3J81Z

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81Z00
1OKRA 3J80Z 3BROA 1R5GA 2FMYA 2DT5A 1EH8A 2VN2A 2IW5A 3H3UA 2EFWA 3PQKA 1R7JA 3GYHX 2LDUA 3HRSA 1R36A 1IN5A 5DCFA 4KNYA 2KRFA 3RIRA 2VBXA 1REPC 1HKTA 2HOEA 4MEXF 1I1SA 3TQNA 1U2WA 3V7RA 2Z9OA 3NRVA 2L54A 1LEBA 4CXFA 1GVJA 2MD5A 4MQ9F 2XHKA 1I1GA 2O8XA 4N0BA 5FD5A 2ADUA 2VOOA 1SD7A 2FBIA 5HLHA 4WXCA 2DK5A 3F8FA 1E17A 3E6BA 2A61A 1BN5A 4ZH4F 2ZNZA 1I6XA 1JGSA 1I5ZA 4FHTA 1T2KA 3DKWA 2NNNA 1B6AA 1TBXA 2QBYA 3ZQ7A 3P9CA 1BJAA 5D4RA 3F8CA 4BNCA 1J75A 2MLGA 3KETA 2A3SA 4G7HF 1FP1D 5LRSA 5E1WA 1ZRDA 1R22A 4KYWA 5CYVA 3V4GA 5BPDA 2Q0OA 3D0SA 2KIMA 3H3ZA 1XGMA 3SFZA 5FFXA 5FO5A 2VT2A 2W57A 1G3WA 3HRUA 5FB2A 4ENNA 1FSEA 2ZJ2A 3L9FA 1YO5C 2WC2A 1BC8C 1ZLKA 2K7LA 3F23A 4UHTA 2V9VA 4YFNF 3BZ6A 1BI1A 1SFXA 1TQMA 2ZMEA 1USTA 1U5TA 3IKVA 1RUNA 2CG4A 1TQPA 4UNOA 1HKSA 5DV5A 1R58A 1YFHA 4N9HA 1ZGJA 4GO1A 4CO8A 4EJWA 3KLOA 1D3YA 5CVUA 1W7PB 4KN7X 1QGPA 5HDGA 4UVCA 4Z2YA 5BPIA 2LF7A 1XDUA 5D4SA 5E18F 4RS8A 4I98B 2GXGA 2X4HA 3D5LA 1ON1A 1T6SA 1KQ8A 3KP6A 1FYMA 4A0XA 1F5TA 4MEYF 1XCVA 1ODDA 1R1UA 4ENMA 5DEQA 1W5SA 4ZYHA 2P7CB 1G3YA 4HYEA 4M9ZA 5HLGA 3HHGA 4ZYDA 2Y0MA 3QP6A 3MQ0A 5BOXA 5L3DA 5CVIA 3DF8A 3KP5A 1GXQA 5H6RA 4IPAA 2OU2A 3F6VA 2ETHA 1XDSA 1WRJA 5CLSA 2DO7A 2E1NA 3GXOA 3RJPA 4GGGA 5J6XA 3K1NA 2W24A 4GXOA 2P4WA 4EJTA 5CJ9A 3ERED 1ZHFA 1HW5A 2GZWA 4A2UA 4NQWA 4PCQA 3WTZA 1ZG5A 2FEZA 3BP8A 2PG4A 1G3TA 1PP8F 2VC1A 2OD5A 3HSEA 2HS5A 1HW2A 2HGCA 4K2EA 1S3JA 3LQRA 1IN4A 2P5KA 4EM0B 2DPUA 2IP2A 4HBLA 3BJOA 2OZUA 2F5DA 1BIAA 2ZXJA 2RNJA 4IJAA 1KU3A 3T8RA 2K02A 3Q5FA 4M6XA 1SD4A 1KQ0A 4RGXA 1YW8A 1E2XA 1ZN2A 2RVCA 3BJAA 2PFBA 1O7LA 2LNBA 3DP7A 1Z05A 3IWZA 5K5QA 2QVOA 3ISPA 3P9KA 3EUHA 3TDZC 4D0PA 3WE2A 1A04A 4CDGA 3P9IA 5DD8A 2Z99A 3HIFA 3S2WA 5JR3A 1B9MA 2E1CA 4EVIA 2ISYA 2A6HF 3GF2A 1T0FA 2M45A 4DQ2A 4P55A 1GXPA 4N9IA 3LA7A 2RKHA 4FX0A 1GHCA 1BOAA 2V6CA 1H9TA 4DNCA 3KP7A 3DFGA 5D5XB 2J5OA 3SZPA 1RZ4A 4OIRF 3DPTA 3GLXA 3RI4A 4Q4ZF 3ZMZA 4XSZF 2MBFA 4JBAA 2EWNA 2D1HA 3MAJA 4ON0A 3L09A 2DFIA 5D8KB 3WE3A 1B1BA 2IA0A 3J81Z 3IRRA 4AD9A 2K4JA 2KIUA 4XBFA 2QBYB 3WODF 3LA3A 4FT8A 1LVAA 1C0WA 3RKYA 4I01A 2P5LC 3TDUC 2OQGA 3G73A 4G8XA 4I09A 1LEAA 3DXJF 4L0YB 4HF1A 4HX8A 1YIOA 1OMIA 2NRAC 1IRGA 1R00A 2FBHA 4KT5C 4I7HA 3F22A 1FYKA 1BM9A 1WI9A 5JI6A 2EA2A 3H92A 2BE5F 2A5YB 2F5EA 1V3FA 4WCGA 1Q1HA 2R3SA 3IL2A 3ZMDA 3HYIA 4A12A 2CQKA 1RNLA 2WTEA 1ZYRF 1U5TB 3M8FA 1IXRC 4OMZA 4LJZF 4U0WA 3OV8A 3WTVC 5AONA 4R79A 3MCZA 2HKXA 3I71A 1YS6A 3TGNA 1HBXG 2GA2A 2HQRA 1XSVA 4U88A 4LK1F 3F8NA 1YLFA 5FFZA 4KMUX 1O7FA 4HF0A 2NS0A 5LGUA 4BQAA 3SQNA 2UWMA 4LLGF 1FT9A 1SFUA 3W6KB 3BPXA 1NHAA 2H6BA 2XRNA 1X3UA 4A6EA 5J8FA 2ELHA 3CO7C 1FZPB 4LB6B 4KMFA 1MD0A 3LA2A 1XCBA 1KU2A 1IN6A 2LKPA 3FZVA 4KUMA 3ZMTA 2VE9A 3E5XA 1DDNA 2KJBA 3WTTC 5H20A 4MHGA 3C3WA 4WX9A 3ZN0A 1Z6TA 3GX4X 1FY7A 2A07F 5CVRA 4RAZA 1ZARA 1P4AA 5ILUA 3I53A 3O2PE 1QQIA 4HX7A 1U78A 2L02A 4M73A 3SZTA 2H09A 3HOSA 1IN8A 2MC3A 3LAJA 3QPHA 2BYVE 1SMYF 2VBYA 4XRFA 1IXCA 2DBBA 2J5PA 1S7AA 4L18B 2R7DA 1KU9A 4TV7A 4PDKA 2PJPA 3G3ZA 1BI2A 3QAHA 2L4AA 1R23A 3BY6A 3NEUA 4M9SA 1DPRA 4P9UA 3QU3A 3CUOA 2O3FA 4EGZA 1T98A 2HYFA 3KP2A 2QENA 4ESFA 4I0AA 4LB5A 2KKOA 5CVVA 3P7NA 4OOIA 2EB7A 4WXHA 4HAMA 5F6FA 1USSA 2QQ9A 3E6DA 5L3EA 4U0VA 2FMLA 2FU4A 3M7GA 3Q9VA 4CHUA 1ZGAA 1WQ2A 4EJUA 3IWFA 1JHHA 1TNTA 2VBZA 1KU7A 1T39A 2H27A 2EA4A 2ESHA 2DU9A 1L3LA 3E97A 4HW0A 1KYZA 4OU0A 1U5TC 2FOKA 4BHPA 4A6DA 2ESNA 1J2XA 2DK8A 2BBYA 5ED4A 2HR3A 4O3MA 5L3CA 1J0RA 2HFHA 1U8RA 1KYWA 6PAXA 1OYWA 3K9TA 4GYGA 3L2CA 1DUXC 4PGGA 1YTYA 5A2QK 4Y13A 1S29A 1K78A 1Z91A 2F2EA 4YIFA 4L5JA 1LDKB 5HOOA 2FXAA 1F9NA 3KCCA 2M5WA 3OOPA 3L7WA 4R1HA 2MA3A 1DP7P 2AS5F 3KE2A 5E1ZB 3WTUC 1R1TA 2XAHA 2RQPA 2WV0A 2ZO4A 3V8KA 4OINF 1IAWA 2CYYA 1HW1A 3GUDA 2O03A 5K1YA 4WK8F 4JK1X 2XKPA 3I58A 1J5YA 4A5MA 1U6GA 3B02A 1CGPA 1Z7UA 4GYIA 3ELKA 2IPQX 3I5UA 3COAC 3RDIA 5HDKA 3R4KA 4XLNF 2F5FA 2ACJA 1STZA 5E1XA 4ZZLA 1K7AA 2W84A 1OYYA 3V8LA 5HS8A 5K5OA 5E8IA 3PFIA 4Q47A 2UXXA 4I02A 4ENKA 5EEHA 1ZAOA 1O3TA 1MKMA 1SD5A 3QP5A 3MEXA 1TQIA 3JW4A 1FBSA 5L3GA 3FMSA 4IHSA 4ZZDA 4IVNA 1WKMA 5ILVA 2FNPA 1LJ9A 1ZG3A 4KIGA 3HTUA 5HDNA 2YU3A 3K0LA 2ZBKA 5IT3A 3HSRA 4I0BA 2WWYA 4KA4A 4HQEA 3J80K 3V7CA 1XB4A 2FE3A 3K1PA 1QZYA 3ML6A 2V79A 4IRGA 3CUQA 5LGNA 4EM2A 2HYGD 2EJRA 2CSOA 4I2OA 3HUGA 4NB5A 1WSUA 3L00A 2FBKA 2CFXA 1L0OC 4U7DA 4E70A 1XD7A 3RPUA 2FNAA 1SD6A 1Y0UA 3EYYA 2OAZA 1U3EM 2E7XA 4HOBA 1HQCA 3TO6A 2IA1A 3KLNA 2V1XA 3WGIA 5KK1A 2HTSA 4RGRA 4LGWA 1Z6RA 4M6YA 3ZP5A 3QU6A 1IRFA 1TW3A 1AOYA 3B73A 2F5CA 4BHCA 3VB2A 2EFQA 5DD4A 2P8TA 3R0AA 1H0MA 1QPMA 2EFPA 3ECHA 1P4WA 4IF4A 5AIPA 2A6EF 3T0YA 4XLPF 1VTNC 2JRTA 3M8EA 2JPBA 4H0EA 1TNSA 3I64A 3ZPLA 2DAOA 3ABUA 4O6JA 4M72A 3M9AA 4EV0A 3GZ5A 4UV8A 3O3KA 1LDJA 1D5VA 2FRHA 3DV8A 4EM1A 5LEKA 2IJLA 3ZMVA 1YYVA 2XUBA 1O3QA 2M87A 5D5VB 1FP2A 2IRFG 2W25A 2COMA 4YG2F 1V4RA 3R6SA 3ZN1A 3KEOA 3MFKA 1OYIA 1KGSA 3Q9SA 4HQMA 2JTVA 2ZNYA 4CYDA 2A69F 4AVPA 4ENJA 1S6LA 4L9JA 2GAUA 4RGUA 2IVMA 3REOA 3TOAA 3U9GA 4Y15A 4BH9A 4QWQA 2HZTA 4GCVA 4EGYA 3FWEA 5A2QZ 1FNNA 2RGVA 1FWZA 4Q5SF 2G9WA 4LK0F 2MH2A 5BMZA 3JSPA 1F4KA 3ABTA 2UXNA 1MJ9A 4LLLA 1EH6A 4OIQF 5ILSA 4Q48A 2GXBA 3TO9A 2V1UA 2EFNA 3JTHA 3GVAA 2FSWA 2M30A 3KZZA 3JAMK 3F21A 1BC7C 4WXDA 1K79A 3F6OA 1SAXA 5DCMA 1O3RA 3NQOA 1K78B 3KP4A 2NYXA 1D8JA 2BEOA 1RI7A 3E3VA 1KA8A 2G7HA 3CTAA 2RN7A 4JQFA 1BIBA 4A0ZA 1TTYA 2PN6A 5H6QA 4UUVA 5D8LB 3N97A 3E5QA 2O61A 2XROA 2V1DA 4CGZA 2M1BA 2GIVA 5FD6A 4M71A 4QLCU 3JSOA 2XKOA 4XSXF 5TJJA 4A0YA 1DPUA 5JVTA 2P6SA 4OMYA 3FM3A 1XN7A 3GW2A 3QRFF 4HDVA 1B4AA 2L3DA 1FBUA 4WWCA 1YW7A 2STWA 3VODA 4WF2A 3N4MA 1RIOH 1EH7A 1BBYA 3WU0A 1ZRFA 2O6GE 4Y17A 4IRIA 1W4MA 3KFWX 4CICA 3WGGA 3TOBA 5L3FA 2QWWA 3V8JA 3BJ6A 5D5UB 3QOPA 5J8CA 1OPCA 5F1RA 3E6MA 1B59A 2W85A 3V7SA 4B09A 2STTA 2FQ3A 2Y75A 2RV8A 5K5RA 1FX7A 3FXRA 4AWXB 2YR2A 3GEZA 1CF7B 3GWZA 4HA8A 3RKXA 4ETSA 5HLIA 3T8TA 1Z1DA 3CUQB 1PUEE 2HQNA 3SXYA 4G6QA 1XGOA 3DPLC 1HKQA 1WWXA 3FF5A 1S7OA 4B8XA 2VONA 3LAPA 3IHUA 1Z9CA 5ERIA 4M9XA 2XAQA 2C6YA 4KICA 4HV5A 2XIGA 2CWEA 4MTDA 4BHBA 3I59A 2LF8A 3FXUA 1O57A 4LG0A 5JHUA 1IW7F 2IT0A 5ICGA 3EYIA 4FX4A 2O0YA 5LBQA 2EV0A 2Y48A 5TRDA 4AIJA 4ZYEA 4RB2C 2XAJA 2DLLA 4NHJA 2OZ6A 2VOPA 3ECOA 2EV5A 2BGCA 2Q2EA 1IXSB 3I4PA 4LFUA 1W7PD 3F3XA 1P4XA 2YX7A 3J81K 1UB9A 3CDHA 1ONVA 4G94A 2ZKZA 3T1BA 4AIHA 2DQRA 2PBIA 4EMSA 1UFMA 2DI3A 2Z33A 1XGNA 1LDDA 2GA1A 2XVCA 3VEPA 1RUOA 4UV9A 5E20A 5LHGA 1BI3A 5DUKA 1MZBA 4EJOA 1F1ZA 4S04A 1IZ1A 1PDNC 4OIOF 2MLKA 4G7OF 2YSRA 3E5UA 2VE8A 4ESBA 3MWMA 3U1DA 4EQQA 3HOTA 2ZCWA 4KIFA 5FLXK 3BWGA 3LWFA 1SFEA 1FOKA 2PI0A 1QBJA 3F8BA 5IT9K 4L5IA 4RB0A 3EDPA 2OBPA 3RYPA 5LLQA 3WTWC 3CLOA 2PQ8A 5ICEA 2B0LA 1IF1A 3IKTA 1HXDA 1T38A 2HWVA 1UCRA 1ON2A 4HV6A 2QYOA 3FXQA 1D8KA 3DQVC 3JAMZ 2X0LA 3IC7A 5D5WB 3AAFA 4HLYA 3O6BB 5HS9A 2EFOA 3FM5A 1TLHB 3FX3A 2VT3A 1KQ9A 2IA2A 4L9VA 2HDCA 2DQLA 1MDMA 2RC4A 2A68F 4AIKA 1P6RA 2XASA 2H94A 3WU1B 4HLXA 4PGHA 2G7UA 4KFCA 4G9YA 3WTXC 3C1DA 4PZJA 5LGTA 5DCMB 1R5HA 2K4BA 3KZYA 1MJAA 4F7ZA 1UHMA 1K6OA 2GQQA 3GFLA 3RYRA 4MGRA 3BPVA 3RTRA 1AWCA 3F72A 2ZFWA 1ZG1A 1CF7A 3CUQC 1UHWA 2FA5A 3K69A 4HZFA 2BV6A 3U2RA 2EV6A 2PLYA 2DTRA 2OA4A 5ICFA 5L3BA 2K86A 1BI0A 2YX4A 2HTJA 2FF4A 5KVRA 5BQTA 1HSTA 4L9NA 2JPCA 4L9TA 1J7KA 3FHZA 1R1VA 1YG2A 4A5NA 5BS6A 2L01A 4BAYA 1P2FA 4MTEA 2ISZA 4UVBA 1MGTA 5HVQC 3VFZA 2L4MA 2CGPA 3K1MA 3K2ZA 3VOEA 1QNTA 2JSCA 1G6NA 2NNYA 3W6JB 4G7ZF 1O3SA 4IHTA 2D45A 4OIPF 3T5XA 1EV7A 2XV4S 2PMUA 4LLNA 2VC0A 4M74A 3WTYC 3F8MA 4UVAA 3ROUA 3HSFA 1PP7U 3TKYA 3QPTA 3GFMA 2NAZA 4YIIA 2XAGA 1ULYA 4BYYA 1FPQA 3EQLF 2D2WA 2RDPA 4P5OA 2P7VB 1TW2A 5F64A 3GFIA 4RAYA 3ULQB 1QZZA 2CO5A 4ZYGA 2XGXA 3HRMA 4RB3C 1SMTA 3GO5A 2XAFA 4IXAA 4KIBA 4YFKF 3E6CC 1ZH5A 2UZKA 3R61A 4U0YA 2Z5UA 2QQBA 4BXUA 3C7JA 5D6FA 3JTGA 1G4DA 3BOQA 5EEGA 1G3SA 2CW0F 5E17F 2YPRA 5AIQA 1JXSA 1LB2A 3M1EA 3EETA 3FMRA 3KEQA 2HKOA 2PEXA 3R60A 2E7WA 5HS7A 4IRHA 2H6CA 1HSJA 3I54A 4U7BA 5LHHA 4ESJA 1FYLA 2VXZA 1W7PA 3I59B 4LD5A 1JE8A 4YFXF 4LG0B 3FMQA 1FLIA 1S8NA 1JHFA 4HDUA 3BDDA 2Z3YA 3LQQA 3J7AO 2QZ8A 2OQRA 2Q8KA 3WG9A 1FC3A 4EJVA 1ZLJA 2TDXA 5CVJA 2JZYA 4LMYA 1XSXA 3HHHA 4O5VA 2R7FA 4MNUA 2D1VA 5FGMA 5DYMA 5LHIA 2JT1A 1QO0D 3PQJA 2PMHA 1ZREA 1I27A 1W5TA 2AXLA 1XGSA 2GWRA 3CJNA 2K27A 4G6DA 2QUFA 3GZ6A 5ICCA 5FLXZ 1J9IA 3HTSB 1YQAA 3IRQA 2VBWA 3WGHA 5IT9Z 3MZYA 2KIFA 1YS7A 2ZMEB 1ZRCA 2LSOA 4HF2A 2M8EA 4P9FA 1H9GA 1IUYA 1OR7A 2QQAA 1J59A 3MZHA 2MH9A 3CO6C 2QLZA 1YW9A 3RKWA 1FSHA 2P5VA 3DEUA 5DUIA 5DDGA 4ASNA 3GFJA 4KDPA 4HX4A 1XMKA 3HRTA 1XSDA 2DW4A 4P96A 4UXNA 3TO7A 3LSTA 4RGSA 2DPDA 1FBQA 4R8HA 3C18A 3RPQA 5LRRA 1MJBA 5JFRA 4KN4X 4L0ZB 2P6TA 3WTSC 5D6EA 1P92A 5E8GA 1LQ1A 1LNWA 3SHFA 1B9NA 2KJCA 4RB1A 3LFKA 3KP3A 1IN7A 3ZMUA 4CZZA 2QM3A 1XMAA 3I0TA 1MDMB 2HEOA 3R0JA 4MQVA 2EK5A 2VODA 5LEJA 3ZMSA 4S05A
chains in the Genus database with same CATH superfamily
1OKRA 3J80Z 3BROA 3FXOA 1R5GA 2FMYA 5CQGA 2DT5A 1EH8A 3OL4A 3GZNB 2HPIA 1S7EA 2IW5A 2VN2A 3H3UA 3KYCB 2EFWA 3PQKA 1R7JA 2V4JC 5DM6F 4Y7NJ 1X1CA 2ZJRF 3GYHX 5E3LA 2LDUA 3HRSA 3BG3A 3W3CA 4U87A 4XLHA 1IV8A 1R36A 3L1PA 2DA5A 1IN5A 1OQYA 2FX0A 2VUMJ 5DCFA 4XMYA 5FKLA 3H36A 4KNYA 2KRFA 4BS9A 3RIRA 4E7ZA 2WAFA 2VBXA 3H5NA 1REPC 1HKTA 2HOEA 2KRCA 4MEXF 3BG6A 3G1MA 1N75A 1I1SA 3TQNA 4NQWB 1U2WA 2GIZA 2B9SA 1W36C 3V7RA 4CZCA 1X1DA 2Z9OA 2M3AA 3AG2H 4JX4A 3NRVA 2L54A 1LEBA 1IGNA 4RBOA 3CLQA 5J3LA 4LG3A 4CXFA 1B8IB 3J7ZI 1GVJA 2MD5A 4ZDPA 1D5YA 2QSFX 4M3BA 3L2RA 4MQ9F 4AYBA 3BC8A 4PJMA 1APLC 2XHKA 1GUUA 1R9TJ 1I1GA 2O8XA 2WB1N 2L7ZA 3DEEA 1WH5A 4N0BA 1W0TA 5FD5A 2ADUA 2VOOA 2CQQA 2I8DA 2VQHA 1SD7A 2FBIA 2Q1ZB 3CF2A 5HLHA 4WXCA 3GTPJ 3FISA 1DP3A 2DK5A 3F8FA 2EZKA 3S15J 1N25A 2NS7A 2DJNA 5F0CA 1EJ9A 1E17A 5HLTA 2CFOA 3E6BA 2EZLA 2A61A 5E3MA 1BN5A 4DW6A 2D5VA 4XLAA 4ZH4F 1Z21A 3D5RC 2ZNZA 1I6XA 2OCCH 1JGSA 1I5ZA 4FCYA 5FRNA 4FHTA 3H3VK 3AG4H 4ABZA 1T2KA 1JKRC 3DKWA 5GADJ 3K4BA 2H8WA 1B6AA 1TBXA 2NNNA 3ZQ7A 2QBYA 3P9CA 1BJAA 5D4RA 3F8CA 4BQNA 4BNCA 1BL0A 1J75A 3RCOA 3A01A 5F0FA 2MLGA 2V7FA 2A3SA 3KETA 1MW7A 1YOVB 2RREA 4G7HF 1FTTA 1FP1D 3ABKH 5LRSA 5CPRB 3ZRGA 5E1WA 3CF5F 1ZRDA 1R22A 4KYWA 3WHBA 4HSTA 5CYVA 1LE8B 3V4GA 2HZDA 5BPDA 2Q0OA 3QQAA 3D0SA 2KIMA 3H3ZA 1XGMA 2BW3B 3SFZA 4AVZA 5FFXA 5FO5A 2EH3A 3FBNB 2VT2A 3PL8A 2ZXWH 2W57A 1G3WA 3HRUA 5FB2A 1DU0A 1DGRM 4ENNA 4ZC3A 1FSEA 2ZJ2A 3L9FA 4XRMA 4F52A 1YO5C 2KZVA 2WC2A 3EUKL 5EDNA 1VZ0A 1VF9A 2H1LA 4F3QA 1BC8C 2LC2A 1ZLKA 2VB6A 1SVMA 4FQGA 2HYJA 2K7LA 3F23A 4UHTA 2V9VA 4YFNF 3BZ6A 2LD5A 2IXSA 1YJNI 1BI1A 1SFXA 5EG0A 1TQMA 3IAM2 2WY7Q 2ZMEA 2R4GA 1GV5A 1USTA 4XKCA 2L9RA 1AA7A 1U5TA 2L0KA 3IKVA 2CUFA 2L9VA 1RUNA 2BXZA 2CG4A 1TQPA 3MKLA 2IS4A 2K9MA 4BY7J 5IYDJ 4UNOA 1HKSA 2V1NA 5DV5A 1R58A 4CCMA 2E34A 1YFHA 4N9HA 3DPUA 4C30A 4L5EA 3M8JA 1MBEA 1ZGJA 4GO1A 4CO8A 4A3BJ 4EJWA 3KLOA 1D3YA 3OR1C 3DU5A 2L7KA 4X0GA 4IKFA 1JI8A 5CVUA 4PSXA 5KCMA 1W7PB 1SC7A 2LFBA 4E7SA 3QOEA 4KN7X 1QGPA 1TL8A 3NARA 4QPOA 5HDGA 4UVCA 4Z2YA 3VSLA 1I50J 2L5QA 3HL2A 5BPIA 2BY3A 4XOTA 4FETA 1XPXA 2LF7A 1XDUA 2ECBA 3A1YA 3SEQA 5D4SA 4NDLA 4RS8A 5E18F 4I98B 2GXGA 2X4HA 4C2TA 4IOAF 3D5LA 2HPMA 1ON1A 1MBKA 1T6SA 2VKHA 1DQUA 5C44J 1KQ8A 4RAFA 3KP6A 2DXIA 5J4YA 1FYMA 2KT0A 4A0XA 1P7JA 2DMTA 4MEYF 3TP0A 1F5TA 1XCVA 1ODDA 1R1UA 2IBDA 3ZGKA 2IGMA 4ENMA 1ZQ3P 2DFHA 3DWLE 5DEQA 4F93B 5F1JA 1W5SA 4ZTFA 4BBRJ 4PSWA 4ZYHA 2OCEA 2R7OA 3SDGA 3BCAA 2P7CB 1G3YA 4HYEA 4M9ZA 5HLGA 4E7HA 3HHGA 4A3IJ 1JGGA 4ZYDA 2Y0MA 3GTKJ 2R5ZA 3QP6A 3MQ0A 1PVEA 1Y6IA 5BOXA 5L3DA 5CVIA 3DF8A 1E0EA 3KP5A 2E19A 3MKWB 1GXQA 5H6RA 3OYEA 4IPAA 2OU2A 2JK3A 3F6VA 2ETHA 2LYCA 1XDSA 2R0QC 1WRJA 5CLSA 1XX5A 1OCCH 2DO7A 5K7FA 1Y39A 1BR2A 1MMDA 2E1NA 3GXOA 3CJTB 3RJPA 4GGGA 4XN3A 1YRNB 4JP0A 3HGYA 5J6XA 3K1NA 2W24A 5J47A 4GXOA 2P4WA 4EJTA 3HM5A 2CJJA 5CJ9A 2KIQA 3JCUC 5GTIC 3BG7A 3FKIJ 3ERED 1ZHFA 1SFOJ 1HW5A 1R4MB 3S14J 3DKYA 1A31A 4NNJA 4BEHB 2LVSA 2GZWA 2L7FP 4A2UA 4NQWA 4PCQA 3WTZA 1ZG5A 1GDTA 2FEZA 3K4CA 4HPQA 3BP8A 2CUZA 2Z16A 2LR8A 2PG4A 3AKZA 1G3TA 2YU9J 1PP8F 2Z2SB 4IHVA 2VC1A 1A5JA 2OD5A 1RKWA 3HC7A 3IV5A 3HSEA 1RR7A 1TC3C 3JRHA 2HS5A 1VI0A 1Y1VJ 3IP4B 1HW2A 2HGCA 4K2EA 1S3JA 3HXLA 2R7TA 3LQRA 1IN4A 2P5KA 3K2AA 4EM0B 2DPUA 4ZTJA 2IP2A 4HBLA 3BJOA 2OZUA 2F4IA 1Z67A 2F5DA 1ZR4A 3ONQA 4XIDA 5C3EJ 3PNYA 2LK2A 4CCKA 2LMDA 1BIAA 4EEFG 2ZXJA 2RNJA 4IJAA 2HXOA 1KU3A 4D7MA 1X1AA 2VKVA 3FXJA 3T8RA 2K02A 3Q5FA 3GBGA 4M6XA 4B3AA 1ETOA 3FXLA 3OWTA 3DTKA 4V2FA 3QWLA 3D1NI 1SD4A 1KQ0A 3DBLB 4RGXA 3CCEI 3I4MJ 2PMZA 4BU2A 2XF6A 1YW8A 3PUFA 1D1CA 1E2XA 2DA1A 2CUEA 1ZN2A 2RVCA 3BJAA 3KYLA 1QRYA 2PFBA 3BQZA 2KDZA 1O7LA 2LNBA 3DP7A 1IG7A 1Z05A 3IWZA 2HOSA 1Z77A 5K5QA 2QVOA 3ISPA 3P9KA 2VQGA 1K6YA 5EF6A 3EUHA 3IH3A 3TDZC 3S1QJ 4XNFA 4D0PA 3PJRA 1K83J 3WE2A 4Y4RA 2PJRA 1X3ZB 1A04A 2VKEA 3P9IA 5DD8A 4CDGA 2Z99A 3GLLA 3HIFA 1W36D 3S2WA 5JR3A 1B9MA 2F48A 5B66C 2GOXB 3BLYA 5IOYA 3BR2A 2E1CA 1JJ6C 4EVIA 1B72A 2M8GX 5EEAA 2ISYA 2A6HF 3GF2A 1V5FA 2E36A 2KMUA 2VI6A 1T0FA 2M45A 4DQ2A 4P55A 2K40A 1GXPA 2IS2A 4N9IA 1SEUA 3LA7A 2RKHA 2IAIA 3IH2A 1YX5A 4PUSA 4OAYA 4PFOA 2LOOA 3GTLJ 4FX0A 1U8BA 1GHCA 1MMAA 1Y0NA 1XTAA 2AQFA 1BOAA 2JVHA 2V6CA 1WJEA 3JRAA 2K85A 5M5YJ 5EGOA 2A6TA 3BG5A 4IEJA 1H9TA 4DNCA 3KP7A 3DFGA 4RM3A 5D5XB 2J5OA 3SZPA 3LSGA 1FJLA 1RZ4A 4OIRF 5B3SH 4AC0A 3DPTA 3GLXA 3RI4A 4Q4ZF 3ZMZA 4J00A 2JQ7A 1BOBA 4JYKA 4XSZF 2MBFA 2FUG2 4JBAA 2EWNA 1TT5B 2D1HA 1V5GA 3MAJA 4ON0A 3BQYA 3L09A 2DODA 2PMZN 4IO9F 1VFCA 2DFIA 1IV6A 1HDDC 5GPCA 5D8KB 3DLLF 3WE3A 1B1BA 2IA0A 3J81Z 2DT6A 4OWRB 3WHCA 3IRRA 5JLXA 4AD9A 4FE4A 5HNFA 1JTXA 3OYLA 4XRSG 3CCMI 3TW7A 2K4JA 5KNLA 1MSFC 2KIUA 4XBFA 2A5WA 3ZQFA 3CCJI 2QBYB 3WODF 2FQ4A 3LA3A 4FT8A 1LVAA 4N4NB 3A01B 4CUGA 1C0WA 2K3FA 2HDDA 3RKYA 4E7IA 4I01A 2P5LC 3TDUC 2OQGA 2V26A 2XAUA 3G73A 4G8XA 4I09A 1LEAA 3DXJF 1ENHA 4L0YB 2W48A 4HF1A 4HX8A 4B48A 4A69C 4GFBA 2QQ8A 1PJRA 5GPAA 1YIOA 5B1BH 2LKXA 1OMIA 2NRAC 4A3CJ 1IRGA 2B7EA 1R00A 3I55I 4M3EA 3U1KA 2FBHA 4KT5C 4I7HA 3F22A 1FYKA 3C2HA 2R92J 1BM9A 3H5RA 2DOFA 3OYGA 1VQMI 1WI9A 5JI6A 2EA2A 3CMEI 3H92A 2CUJA 2BE5F 3EPZA 2A5YB 2F5EA 1V3FA 4WCGA 1Q1HA 4N4OB 5M5XJ 2KZGA 2EILH 2R3SA 3IL2A 2NVUB 2G0EA 3ZMDA 1NH3A 2L9NA 3HYIA 4A12A 1OR7C 2V9KA 2V9PA 2CQKA 1RNLA 3ZR8X 5KHDA 1VQ7I 2IS1A 3VYRB 2WTEA 3HKZA 1ETQA 1U5TB 1ZYRF 1IXRC 3M8FA 2DA6A 4OMZA 1X2NA 4C3JJ 4LJZF 4U0WA 3OYMA 3OV8A 3MMYB 3WTVC 1I3AA 5AONA 4R79A 2HOTA 2O8KA 3F0CA 3ZQIA 3MCZA 2HKXA 3I71A 1YS6A 1X58A 3TGNA 2NVYJ 4FISA 2XB0X 5BNGA 1HBXG 3LMMA 2VXDA 2ZXIA 2GA2A 1YJ9I 2HQRA 1RRJA 1XSVA 4U88A 1HA8A 4LK1F 3HEFA 4ANJA 4XRSA 3B6CA 3F8NA 1YLFA 5FFZA 2XC7A 1WFXA 4KMUX 1O7FA 4RAGA 3BR3A 3K4KA 4HF0A 4HNVA 4BDZA 1GV2A 2GBYA 4E4HA 2NS0A 5HODA 2E35A 2DN0A 2RQQA 2JA8J 2F6CA 5LGUA 4BQAA 3SQNA 2UWMA 4LLGF 1FT9A 1SFUA 2QKLB 1SANA 3W6KB 1P7IA 3BPXA 1NHAA 2H6BA 1OCZH 2XRNA 1X3UA 1WHUA 4A6EA 5J8FA 2ELHA 1KONA 3PM1A 1OFCX 1N77A 2WB1A 4UUSB 3CO7C 3G1OA 1FZPB 4LB6B 4B47A 5KAIC 4KMFA 1A6QA 1MD0A 1Z7LA 3LA2A 2LH9A 1XCBA 4RDUA 3QYBA 1KU2A 1IN6A 2LKPA 3FZVA 1YJWI 4KUMA 2X1DA 3ZMTA 2VE9A 3E5XA 2R5ZB 4BQOA 1DDNA 3CCUI 3HKZN 2KJBA 2VPRA 4C3HJ 3WTTC 3BG9A 5H20A 4MHGA 5IP6A 3C3WA 2R7ZJ 4WX9A 4BGDA 3ZN0A 1Z6TA 2YUSA 5CKTA 1VQNI 2NXNB 4JX6A 3K70C 1POGA 1PYVA 2DMPA 3GX4X 3HOZJ 1MBHA 1FY7A 2A07F 5CVRA 1A35A 4RAZA 1ZARA 3OMYA 1ETVA 1P4AA 3UKGA 3H0DA 2QF7A 3P5JA 5ILUA 3I53A 3RQ4A 3O2PE 1QQIA 4HX7A 1U78A 3KEYA 4CSWA 2L02A 3PNVA 2DOEA 4M73A 5JVGF 5F08A 3SZTA 2H09A 3RPUD 1VQ5I 3HOSA 2KP6A 1UG2A 4XQFA 1IN8A 2MC3A 3LAJA 4J01A 3ZQLA 3QPHA 2BYVE 1EF4A 1ETKA 1SMYF 1UELB 3TBIA 2VBYA 4XRFA 1ZK8A 2KFDA 4DOZA 1IXCA 2DBBA 3OYAA 3DTEA 1IC8A 2J5PA 3BTCA 1ORKA 1S7AA 3W2WA 4L18B 4IX7A 2R7DA 1KU9A 4TV7A 2X48A 4Y52J 2R93J 3OS0A 2VJ5A 4A3MJ 1JUMA 4FTHA 4PDKA 2PJPA 3G3ZA 1BI2A 3QAHA 2L4AA 1N78A 1R23A 3BY6A 3NEUA 4M9SA 1DPRA 1T08B 4P9UA 3QU3A 2YS9A 3CUOA 3OYHA 3CJRB 2O3FA 2R7RA 3M4OJ 4DYQA 4EGZA 1OJLA 3G2BA 2XGDA 1T98A 1LFPA 2HYFA 3KP2A 1OCRH 2ECCA 1W1WE 2R7WA 1D1BA 2QENA 4ESFA 4I0AA 4LB5A 2KKOA 4I76A 5CVVA 3BTJA 4I99C 3P7NA 4OOIA 2EB7A 2VASA 3FK7A 5KAFC 4WXHA 4HAMA 5F6FA 1USSA 4C9YA 2QQ9A 3E6DA 1MNMC 1WJ5A 5L3EA 4U0VA 4QIWN 2L2OA 1DGWY 2FMLA 2DFFA 4CCJA 1HDPA 2FU4A 3KX2A 2XPWA 3S2DJ 3M7GA 2PJRB 4A3EJ 3Q9VA 1D1AA 3FIWA 4CHUA 2X1CA 3K7AJ 4UY8I 1X1BA 1ZGAA 1WQ2A 1WVRA 1E3PA 1HLVA 1YITI 4EJUA 2CW8A 4M3DA 3IWFA 1JHHA 1TNTA 3TW6A 1QZEA 2VBZA 3Q0WA 2EIKH 1H89C 1KU7A 1B72B 3GTQJ 1T39A 3HOWJ 3I56I 3OOUA 5FKOA 1BW5A 3HJEA 2H27A 3CD6I 3J7YJ 2COBA 2EA4A 4C3IJ 2ESHA 5B5EC 3HPHA 2DU9A 3A03A 5FKMA 2ZMEC 1L3LA 3A02A 3I3LA 3E97A 4HW0A 1KYZA 4OU0A 2B63J 1U5TC 2QKMB 2FOKA 2MGQA 4BHPA 5EGOB 4A6DA 2ESNA 1J2XA 2DK8A 4NC6A 2BBYA 5ED4A 2HR3A 2M7BA 4O3MA 5L3CA 2UUZA 1P9QC 1J0RA 1WPKA 3MN2A 2HFHA 2P81A 1U8RA 4D9JA 2FJ1A 1RPWA 1LFBA 1KYWA 1OYWA 1HF0A 3QPLA 6PAXA 1QHHD 2ME0A 2MFZA 4YELA 5IY5H 3JRCA 5M5WJ 3K9TA 1JUPA 2VQLA 4GYGA 3L2CA 1DUXC 4PGGA 1VQ8I 1YTYA 2CQ7A 3QYFA 5A2QK 3DLAA 4Y13A 1S29A 1K78A 2M7AA 1Z91A 3AL0B 2F2EA 3GTOJ 4YIFA 4L5JA 1LDKB 5HOOA 2JMWA 2X85A 2FXAA 1ZR2A 1F9NA 3KCCA 3CCLI 2M5WA 3FDYA 5LFAA 3OOPA 2HNHA 3L7WA 4R1HA 2MA3A 3EUAA 1YX3A 1DP7P 3K4NA 2AS5F 3KE2A 3CMAI 2LP0A 3ZQQA 5E1ZB 3WTUC 2AXTC 4F92B 1R1TA 3OY9A 1R4NB 2IGNA 1E3HA 2XAHA 2RQPA 4S0HB 4I6ZA 2R7QA 2WV0A 1QHGA 2ZO4A 3V8KA 3G71I 2VLAA 4OINF 2M9HA 1IAWA 5E3NA 3H1CA 4BXFA 5H2FC 4A93J 2CYYA 4ZDOA 2DMQA 1HW1A 1JKOC 3GUDA 5M3MJ 2O03A 5K1YA 4WK8F 3V42A 3C2BA 4AM3A 4UUSA 4JK1X 2RNGA 2XKPA 1TWFJ 4B4CA 1S9HA 3I58A 4W1UA 1X4OA 2R7SA 1J5YA 4A5MA 1U6GA 2LG4A 3B02A 2CMPA 1CGPA 5IP9J 4DGWB 1Z7UA 3OS1A 1QA6A 2O7OA 4GYIA 2XRLA 4F91B 3ELKA 2IPQX 3I5UA 3COAC 3RDIA 1H8AC 3SDBA 4CCNA 1AHDP 5HDKA 1ERDA 4D7NA 2X51A 3R4KA 2E2IJ 4XLNF 1MMSA 2F5FA 4DJAA 3MKYB 1X2MA 5FJ8J 2ACJA 1STZA 4A3LJ 5E1XA 4CYCA 2F4MB 4LOCA 4ZZLA 1K7AA 2HDWA 1VQ4I 2W84A 3H9QA 2ICWG 4QTRA 1NG7A 1WJDA 5DM7F 1OYYA 3V8LA 5HS8A 5K5OA 5E8IA 3F9KA 2DFEA 3PFIA 2KRHA 4Q47A 2UXXA 1Q1VA 4I02A 4ENKA 5EEHA 1ZAOA 4NC8A 2DA2A 1O3TA 1IJWC 1NTCA 3H9JA 1MKMA 1SD5A 3LSMA 3QP5A 2LREA 3MEXA 3M3YJ 1TQIA 3JW4A 2L7MP 2BHZA 1FBSA 4CH7A 5L3GA 4IHYA 3FMSA 4IHSA 4RLQA 4ZZDA 1A6IA 4IVNA 3WU2C 1WKMA 5ILVA 2FNPA 3QPSA 3KIOA 1LJ9A 1ZG3A 5IP7J 4KT6A 4KIGA 3HTUA 5HDNA 3LOCA 1LKXA 2YU3A 2OF7A 3CP8A 3K0LA 2KHMA 3MVPA 2ZBKA 3L2WA 2AHQA 2X6XA 5IT3A 2E71A 2DOAA 3HSRA 4CCLA 3SEZA 4I0BA 4M3GA 2WWYA 4KA4A 4HQEA 3J80K 1SVOA 3V7CA 1CQTA 1Z3YA 3HOXJ 1XB4A 2FE3A 3K1PA 4UB6C 3E1SA 1QZYA 4XOPA 3ML6A 3DEWA 2V79A 4IRGA 3OYFA 3CUQA 5LGNA 3LSJA 4EM2A 1IDZA 2HYGD 2BVMA 1ETYA 2EJRA 2R7XA 2CSOA 2M4GA 3LSHA 2XGCA 3SFIA 4I2OA 2LY9A 1Y56A 1RETA 1I6HJ 5J1UA 4AUXA 3HUGA 4NB5A 3EUHC 2ZXHA 1WSUA 3L00A 1MNDA 1O4XA 2FBKA 3E7LA 2CFXA 5J4VA 3CC7I 1TWGJ 1L0OC 4XM3A 2CW7A 3CCSI 4U7DA 4E70A 1XD7A 2XPUA 2M34A 3RPUA 3HG9A 2FNAA 1SD6A 1Y0UA 2MABA 3EYYA 2OAZA 2K9QA 1OLTA 1U3EM 1OCPA 2E7XA 4HOBA 3ABMH 1U9OA 1HQCA 3PSIA 3TO6A 2Y2ZA 1T0FC 2IA1A 1IO2A 2V6EA 3ZCOA 3KLNA 4DIQA 2V1XA 3WGIA 2JSPA 5KK1A 2XDVA 2HTSA 4RGRA 4LGWA 3C2GA 3TEDA 1D0ZA 4XK4A 1Z6RA 3L2QA 2DA3A 3K10A 4M6YA 3ZP5A 5F04A 1UZCA 1VQOI 3QU6A 1MMNA 1IRFA 1TW3A 1AOYA 2ME6A 3B73A 2F5CA 4RLFA 3M1CA 4BHCA 3KYDB 3VB2A 4XN0A 2EFQA 5DD4A 2P8TA 1FOWA 3R0AA 1H0MA 2CV2A 1QPMA 2QCOA 2EFPA 2JN6A 2F4OB 2ZJPF 2UV1A 2XF5A 1G2HA 3ECHA 1P4WA 4IF4A 5AIPA 2A6EF 3T0YA 4XLPF 1VTNC 2QSHX 1AU7A 4DBQA 2JRTA 2Z1DA 3M8EA 2JPBA 2QA4I 2ID3A 4X1EA 4H0EA 3CCQI 2QSGX 3AL0C 1TNSA 1V5EA 3I64A 2QEXI 4MLOA 4E7LA 2WBMA 3ZPLA 3FKJA 2DAOA 3ABUA 1ZELA 1LPQA 5FROA 4HG2A 4O6JA 4M72A 3M9AA 4EV0A 1LUJB 3GZ5A 4UV8A 3O3KA 1Y8QB 2GLOA 1LDJA 1D5VA 2X6YA 2FRHA 3DV8A 3OYNA 2DA4A 3OYBA 4EM1A 5LEKA 4J19A 1S5LC 2ZSIB 1GVDA 3L2UA 2IJLA 3ZMVA 3QYEA 1ZTRA 1YYVA 1WCMJ 2XUBA 1O3QA 2M87A 5D5VB 1FP2A 5DS9A 4ZJZA 2CRGA 2IRFG 2W25A 2COMA 4YG2F 3BT9A 1V4RA 3R6SA 3ZN1A 3KEOA 3VSKA 3MFKA 2WAEA 1HC8A 2LLKA 1WJCA 1OYIA 3O8HA 1KGSA 3Q9SA 4HQMA 2EIJH 1FEXA 3OSGA 4A3GJ 1GT0C 1K4SA 2JTVA 2ZNYA 4XKBA 1OCOH 4CYDA 2A69F 3NWSA 4AVPA 4ENJA 1S6LA 4L9JA 2ELKA 2WY8Q 1G59A 2GAUA 3KZIC 3LSKA 4RGUA 2IVMA 2IEKA 3REOA 2KDOA 3TOAA 3U9GA 4Y15A 3LSIA 2KPMA 4QWQA 4B44A 4BH9A 2MD0A 2HZTA 2IGOA 3TMOA 1UHSA 4GCVA 3AG3H 4EGYA 3FWEA 1FIAA 5FKKA 5A2QZ 2OTJI 4XLCA 1FNNA 2OTLI 2RGVA 2F5VA 2JJ7A 1FWZA 2X1EA 4Q5SF 3BR0A 3H35A 2G9WA 4LK0F 2MH2A 5BMZA 4PJNA 3S1MJ 3N05A 3JSPA 2L9SA 1F4KA 2BY2A 2VJ4A 4RM2A 3Q0VA 3ABTA 2UXNA 1MJ9A 3HBLA 4LLLA 1EH6A 2AQEA 2XF7A 1MSEC 4OIQF 2K3PA 4E7JA 5ILSA 4Q48A 2GXBA 4BL0B 3TO9A 2V1UA 3BR5A 2EFNA 1XG1A 3JTHA 3GVAA 3HB9A 1XMXA 1U9NA 4ZYAA 2JA5J 2FSWA 2M30A 3KZZA 1X1PA 3DBHB 4B3XA 3JAMK 2OV7A 3F21A 1BC7C 4FASD 5CQEA 4WXDA 1K79A 5IYCJ 3F6OA 3RKQA 1SAXA 4Y3OA 5DCMA 4JOMA 1O3RA 2NVTJ 3FBIB 3ASOH 3NQOA 3OIPA 1K78B 1XC5A 1TWCJ 5FRMA 3KP4A 1R6RA 2NYXA 1D8JA 3JRGA 3CP2A 2CS3A 1FOYA 2BEOA 2W1OA 3ESWB 1RI7A 3E3VA 4XKVA 1KA8A 3HZJA 2G7HA 3S1RJ 1K61A 2OC6A 2IGKA 3H0GJ 3CTAA 2RN7A 2XSDC 2M0MA 4PJ0C 4JQFA 1BIBA 4A0ZA 2I5UA 2WAQN 1W5CC 3S16J 4BE0A 3OYCA 1TTYA 2W00A 2PN6A 1T33A 3A2KA 2GXAA 2EPFA 5H6QA 2NS8A 1IDYA 4UUVA 2LTPA 5D8LB 5B1AH 3N97A 3E5QA 2O61A 2X6WA 2HQ5A 2XROA 3OYIA 2V1DA 1G8XA 4CGZA 2E5ZA 2M1BA 4BE2A 2EBIA 2GIVA 1VNDA 5FD6A 4M71A 4UUTA 2R5YA 1VQKI 2HVRA 4QLCU 3JSOA 2XKOA 4XSXF 5TJJA 4A0YA 4KITB 5IOZA 1DPUA 5JVTA 2LY2A 2P6SA 4OMYA 5EZHA 3FM3A 4BY1J 1QVUA 3MD2A 1XN7A 3CDIA 3G1LA 3GW2A 3QRFF 2NVXJ 4HDVA 3K6GA 2E2HJ 1B4AA 4CYCB 2L3DA 4ITVA 1FBUA 4WWCA 1YW7A 2STWA 3VYUB 3VODA 4BUPA 4BXXJ 4YEJA 4WF2A 3N4MA 1RIOH 4II2A 3VWBA 1I3QJ 5LD2C 1EH7A 2BHYA 1BBYA 3WU0A 2EIMH 1ZRFA 1TP4A 2O6GE 2OUMA 4Y17A 4IRIA 1E3OC 1W4MA 3OYDA 3KFWX 4CICA 3WGGA 3TOBA 1T95A 5L3FA 1Z3XA 2WADA 2QWWA 4OAZA 3V8JA 3LSRA 3BJ6A 5D5UB 4II3A 3QOPA 4NUBA 5J8CA 1OPCA 5F1RA 1MH4A 3E6MA 3CC4I 1B59A 3L2VA 2VQCA 1R49A 2W85A 4PJJA 3V7SA 4B09A 2STTA 3BTLA 2FQ3A 2Y75A 1SFKA 2RV8A 3CESA 3U21A 4W97A 5K5RA 2HXIA 3NWTA 1FX7A 3W6VA 2DYSH 3GTGJ 3M07A 3FXRA 2YR2A 2EINH 4AWXB 3GEZA 5GAEJ 1CF7B 4M6VA 3GWZA 1F36A 2JA6J 4HA8A 3RKXA 4ETSA 4D5CA 4D1QA 2N8GA 4DZPA 5HLIA 3T8TA 1Y8RB 1Z1DA 1V54H 1QVTA 1MBJA 2JUGA 1YE9A 4MO7A 2DT7B 2JUCA 3CUQB 2DA7A 2HQNA 1PUEE 3SXYA 5GTHC 4G6QA 1XGOA 3DPLC 3ZOBA 4XORA 1K4TA 1HKQA 1WWXA 3OSFA 3FF5A 1TZLA 1S7OA 2GM4A 4B8XA 2VONA 3LAPA 3HUGB 2JA7J 2TRTA 3IHUA 1Z9CA 5ERIA 1ZGWA 4M9XA 1LVKA 3A4CA 2ZFUA 2XAQA 3D5SC 2C6YA 4KICA 2KQRA 5JLWA 1BJZA 3FXMA 4HV5A 2XIGA 2CWEA 4BJ6C 4A3JJ 4GRIA 4MTDA 3K4MA 4XKWA 4BHBA 2VJIA 1UJ8A 3I59A 1OCTC 1RESA 2LF8A 3FXUA 1O57A 4LG0A 5JHUA 3UNGC 1IW7F 1WH7A 5J40A 2IT0A 5ICGA 3EYIA 4FX4A 3JRIA 4QPQA 2O0YA 3S93A 2JWTA 3Q0UA 3GMEA 5LBQA 2EV0A 2Y48A 5TRDA 4AIJA 3S1NJ 5J1RA 4ZYEA 4RB2C 2XAJA 3LFUA 4P1WA 4XONA 1WZ2A 2DLLA 4NHJA 4C2MJ 2Y30A 2OZ6A 3AFHA 3BCBA 4DBRA 4UB8C 1JKQC 2VOPA 3ECOA 2M2EA 1FIPA 1TT0A 2EV5A 5GAHJ 2BGCA 3I9V2 1AKHA 2Q2EA 1IXSB 2X9DA 3I4PA 5TISC 4LFUA 1W7PD 3F3XA 3QODA 1P4XA 2XSJC 2BXYA 3NAUA 1NK2P 2YX7A 3J81K 1UB9A 3CDHA 2HI3A 4E7KA 1ONVA 4G94A 1M1EB 3RZOJ 1WJAA 3HPGA 3IH4A 4MFDA 2ZKZA 3T1BA 2CV1A 3VDXA 2DQRA 4AIHA 1VQ9I 2DJIA 4AYBN 3IAS2 3W2AA 2HVQA 2MSYA 3ZQCA 2PBIA 4EMSA 5HNHA 1UFMA 2BVLA 2DI3A 2HU9A 2Z33A 1XGNA 1LDDA 2GA1A 4GDFA 2XVCA 4HRIA 3VEPA 1RUOA 2BY0A 4UV9A 5E20A 3MZ8A 2OJED 5LHGA 4FE7A 3TP3A 1BI3A 2Y0SA 5DUKA 1MZBA 2Y69H 4EJOA 1X3WB 1F1ZA 4S04A 2NOJB 1IZ1A 3DU6A 4A3FJ 2DCEA 1PDNC 2H1KA 3OIQA 1PUFA 4OIOF 2HOAA 5FLMJ 3TL4X 2MLKA 4G7OF 3CC2I 1ACIA 2YSRA 3E5UA 2VIXA 3S32A 2VE8A 4ESBA 1VQ6I 3MWMA 2GOMA 4CA0A 3U1DA 1JT0A 3W2VA 4EQQA 3RSNA 3HOTA 4XLFA 2ZCWA 4KIFA 1BW6A 5FLXK 3BWGA 3PUBA 4IQJA 3LWFA 4YRVA 2K9SA 1SFEA 1FOKA 2PI0A 1QBJA 4PK4A 3F8BA 5IT9K 4DYRA 4Y33A 1TWAJ 2DMUA 4L5IA 4MFEA 4RB0A 2LBFA 3EDPA 3G6EI 1R71A 1FOXA 2OBPA 3OS2A 3RYPA 3CCRI 5IYBJ 1WJFA 4BJTA 5LLQA 2E1OA 3CMMA 4HNTA 3WTWC 3CLOA 2PQ8A 5ICEA 2B0LA 1U0JA 1IF1A 3IKTA 1HXDA 1T38A 2HWVA 1UCRA 2M4KA 3JR9A 1ON2A 3S8PA 4HV6A 2HQAA 2QYOA 2W4SA 3FXQA 1D8KA 3DQVC 3BTIA 3JAMZ 3FXKA 2X0LA 1T56A 3LSPA 2XB5A 2JRMA 1ETXA 1JKPC 3IC7A 5D5WB 3AAFA 4HLYA 2CH0A 3SYTA 3O6BB 5HS9A 2EFOA 1IRZA 3FM5A 1TLHB 3FX3A 2AO9A 1ETWA 2VT3A 1KQ9A 5EYRA 2IA2A 4L9VA 2MYSA 2Y9ZA 2HDCA 2DQLA 2KL4A 4V2GA 1IUFA 2H8RA 1MDMA 1ZKGA 4HNUA 3VYSB 2RC4A 2Y0SN 2A68F 5K7ZA 2W82A 4BACA 4IHWA 2R7VA 4AIKA 1P6RA 3A0HC 5FLVA 2XASA 3ASNH 3CQZJ 2E1MB 3HOUJ 2H94A 3JRDA 2Y31A 1QPIA 2RAEA 3WU1B 4HLXA 4PGHA 2G7UA 4KFCA 4G9YA 2PX9A 4M3FA 3VPRA 3WTXC 3C1DA 4PZJA 5LGTA 5DCMB 1R5HA 5J1YA 4NC7A 2VPLA 3K4JA 2K4BA 2W7NA 5EZGA 3ABLH 3KZYA 1MJAA 2E5NA 2TCTA 3S17J 4F7ZA 1UHMA 1K6OA 2GQQA 3GFLA 4JX5A 4MGRA 3BPVA 3RTRA 3RYRA 4DYCA 1AWCA 3I4NJ 2CQNA 2JA2A 3F72A 2ZFWA 3CMYA 1EKEA 1ZG1A 1CF7A 3CUQC 1MBGA 4CCOA 2XPVA 1UHWA 1MIJA 2FA5A 3K69A 5EJCA 1YHQI 2DDAA 4DZJA 4BE1A 2KISA 3Q3SA 4HZFA 1FMVA 2EQRA 3MKZA 2BV6A 1B8IA 1BA5A 5GAGJ 2EZHA 3U2RA 2EV6A 2PLYA 2DTRA 2OA4A 2VJJA 5ICFA 1VQLI 5L3BA 2DYRH 2K86A 2DDBA 2LRDA 1BI0A 2YX4A 5F27A 2HTJA 2FF4A 2ZB9A 5KVRA 3K70D 5BQTA 5F0HA 1HSTA 4L9NA 3OYKA 2JPCA 4L9TA 2R5YB 1J7KA 2BOLA 3E0JB 3OL3A 3FHZA 4RA2A 4A3KJ 1R1VA 1YG2A 4A5NA 3CCVI 3H9GA 5BS6A 3PSFA 2L01A 4BAYA 1P2FA 3K4LA 4MTEA 2DTZA 2ISZA 4C2UA 4UVBA 4IQ4A 1YI2I 1MGTA 5HVQC 2MC4A 3VFZA 3ZQHA 2L4MA 4G6TB 2CU7A 4PFPA 2CGPA 1MMGA 3PO3J 1H88C 3K1MA 3K2ZA 4LITA 1OISA 3VOEA 1QNTA 2JSCA 3ZQGA 1G6NA 4F55A 2NNYA 3W6JB 4G7ZF 1O3SA 3FHNA 4Z6YA 4IHTA 2D45A 3JRBA 4OIPF 3T5XA 3CDLA 1EV7A 2XV4S 5GP9A 4BDYA 2PMUA 4LLNA 4PJLA 2VC0A 5E79C 4M74A 1HOMA 5C4XJ 2NOGA 2HVSA 4ZDLA 5K7HA 2ELJA 4BBSJ 3WTYC 3F8MA 4UVAA 2P0WA 3ROUA 2X6OA 2DMNA 3HSFA 1PP7U 3TKYA 2K9LA 4BQQA 2O9LA 3RZDJ 3QPTA 1IRXA 2K9NA 3GFMA 2NAZA 4YIIA 1SVLA 2XAGA 4KJZA 1ULYA 1LE8A 3S3NA 4BYYA 1J09A 1FPQA 3LL7A 4RMNA 3WG7H 3CZ6A 3EQLF 2D2WA 2RDPA 4P5OA 9ANTA 2BW3A 2P7VB 1TW2A 5F64A 3GFIA 4RAYA 3ULQB 1QZZA 1JJ8C 2MG4A 1RR8C 1JUSA 2CO5A 2Y9YA 3OYJA 1UG0A 4ZYGA 3PIOF 2XGXA 3HRMA 4RB3C 1SMTA 3GO5A 2XAFA 4G12A 4IXAA 4KIBA 4YFKF 2ZJQF 2O5RA 3E6CC 1ZH5A 2UZKA 3R61A 3S2HJ 4U0YA 2Z5UA 2M0CA 2QQBA 4BXUA 3J7AY 3FK6A 3C7JA 5D6FA 3JTGA 4IZZA 1Z0XA 1G4DA 3BOQA 4LIVA 2CV0A 5EEGA 4HSRA 1G3SA 4AIDA 2CW0F 5E17F 2YPRA 2XGEA 5AIQA 1JXSA 3HDDA 1YIJI 3PIPF 1LB2A 3PFYA 3G4SI 1NG6A 3M1EA 3EETA 4B1RA 3FMRA 3KEQA 4XLEA 2HKOA 2PEXA 3R60A 4KISA 1DU6A 2E7WA 2I10A 5M3FJ 5HS7A 1MNEA 4IRHA 4EATA 2H6CA 1HSJA 3H5AA 3I54A 4IHXA 1V55H 2LY1A 4U7BA 4AU7A 5LHHA 2IS6A 2K5CA 2EZIA 4ESJA 1FYLA 3DBRB 2BY1A 2VXZA 4X6AJ 2VL8A 1W7PA 3I59B 4LD5A 1T8IA 1JE8A 4YFXF 3HGGA 4LG0B 3FMQA 1FLIA 4HEA2 1JTYA 1S8NA 3UR3C 1RC9A 2NVQJ 1JHFA 4HDUA 3BDDA 2Z3YA 3LQQA 4QSHA 4E6KG 1HCRA 2QZ8A 3J7AO 1BR1A 2OQRA 1EA3A 2Q8KA 1UAAA 1R5ID 1D0XA 3WG9A 2WAQA 3PNTA 1FC3A 3VYTB 4EJVA 1MH3A 2FOWA 1ZLJA 3GTJJ 2TDXA 3S3OA 5CVJA 2JZYA 4LMYA 4BKXA 1XSXA 4A3DJ 3HHHA 1X4PA 2A05A 4O5VA 1AKHB 2Q2EB 2R7FA 3CJQB 4MNUA 3DKXA 3IUOA 5C4JJ 3LNQA 5FKNA 4V19K 2D1VA 1A36A 3ZXSA 2E1MC 4YIRX 5FGMA 5JHFA 1RKTA 2LKSA 5DYMA 5LHIA 2JT1A 3RQIA 2OPTA 1QO0D 3PQJA 2PMHA 3X2QH 3A0BC 1ZREA 1MBFA 1I27A 1W5TA 1XGSA 2AXLA 5IPAA 1I39A 2R7UA 3AG1H 2GWRA 3CJNA 2K27A 4G6DA 2QUFA 3GZ6A 5ICCA 5FLXZ 1J9IA 3HTSB 2FD5A 1YQAA 3IRQA 2WA0A 2VBWA 3SZGA 3WGHA 3JRFA 5IT9Z 3MZYA 1S72I 2KLOA 5EG0B 2KIFA 1ITYA 1YS7A 2ZMEB 1ZRCA 2LSOA 2BZTA 2E60A 4HF2A 2M8EA 1PUFB 1YRNA 4P9FA 2WV1A 1GLNA 2ID6A 1Y1WJ 5E3OA 4XL9A 1H9GA 3S3MA 4NBQA 4XICA 1IUYA 4D5FA 1WI3A 1OR7A 2QQAA 1J59A 4BEHA 3MZHA 1NK3P 2MH9A 3CO6C 4LIUA 2QLZA 1LFUP 1YW9A 5DTDA 3BZKA 4XR6A 3RKWA 1QU3A 3GCMA 1FSHA 2P5VA 3DEUA 5DUIA 2E2JJ 1XS9A 5DDGA 5TGTA 4ASNA 1BR4A 3JREA 2CQXA 1KZHA 1TWHJ 3HOVJ 3GFJA 3KPHA 4KDPA 4HX4A 1XMKA 2QGUA 3HRTA 3ERMA 2VKDA 1VQPI 1XSDA 3GTMJ 1W0UA 2DW4A 2LBFB 3CCYA 1WGXA 4P96A 3BZCA 4IL6C 3DCFA 4UXNA 3B6AA 3TO7A 4IOCF 3LSTA 4RGSA 2DPDA 1FBQA 4R8HA 3C18A 3RPQA 3BR6A 3OR2C 3HOYJ 5LRRA 4MIMA 1MJBA 4BJ5C 5JFRA 1D0YA 4KN4X 4L0ZB 1FTZA 2P6TA 3WTSC 5D6EA 3OIOA 1SAUA 3O8GA 1P92A 5E8GA 4H4KC 1LQ1A 1LNWA 3SHFA 1B9NA 1F43A 2KJCA 1FMWA 4RB1A 2JVGA 3LFKA 1X19A 3KP3A 1IN7A 3ZMUA 4CZZA 2QM3A 1XMAA 3I0TA 1JT6A 3PO2J 1MDMB 2HEOA 2ZC2A 3R0JA 2MW8A 3BR1A 4MQVA 2EK5A 2VODA 1WJBA 3DTIA 5LEJA 3ZMSA 4B43A 3SJMA 1UMQA 2ZSHB 4S05A
chains in the Genus database with same CATH topology
1OKRA 3J80Z 3BROA 1R5GA 2FMYA 2DT5A 1EH8A 2VN2A 2IW5A 3H3UA 2EFWA 3PQKA 1R7JA 3GYHX 2LDUA 3HRSA 1R36A 1IN5A 5DCFA 4KNYA 2KRFA 3RIRA 2VBXA 1REPC 1HKTA 2HOEA 4MEXF 1I1SA 3TQNA 1U2WA 3V7RA 2Z9OA 3NRVA 2L54A 1LEBA 4CXFA 1GVJA 2MD5A 4MQ9F 2XHKA 1I1GA 2O8XA 4N0BA 5FD5A 2ADUA 2VOOA 1SD7A 2FBIA 5HLHA 4WXCA 2DK5A 3F8FA 1E17A 3E6BA 2A61A 1BN5A 4ZH4F 2ZNZA 1I6XA 1JGSA 1I5ZA 4FHTA 1T2KA 3DKWA 2NNNA 1B6AA 1TBXA 2QBYA 3ZQ7A 3P9CA 1BJAA 5D4RA 3F8CA 4BNCA 1J75A 2MLGA 3KETA 2A3SA 4G7HF 1FP1D 5LRSA 5E1WA 1ZRDA 1R22A 4KYWA 5CYVA 3V4GA 5BPDA 2Q0OA 3D0SA 2KIMA 3H3ZA 1XGMA 3SFZA 5FFXA 5FO5A 2VT2A 2W57A 1G3WA 3HRUA 5FB2A 4ENNA 1FSEA 2ZJ2A 3L9FA 1YO5C 2WC2A 1BC8C 1ZLKA 2K7LA 3F23A 4UHTA 2V9VA 4YFNF 3BZ6A 1BI1A 1SFXA 1TQMA 2ZMEA 1USTA 1U5TA 3IKVA 1RUNA 2CG4A 1TQPA 4UNOA 1HKSA 5DV5A 1R58A 1YFHA 4N9HA 1ZGJA 4GO1A 4CO8A 4EJWA 3KLOA 1D3YA 5CVUA 1W7PB 4KN7X 1QGPA 5HDGA 4UVCA 4Z2YA 5BPIA 2LF7A 1XDUA 5D4SA 5E18F 4RS8A 4I98B 2GXGA 2X4HA 3D5LA 1ON1A 1T6SA 1KQ8A 3KP6A 1FYMA 4A0XA 1F5TA 4MEYF 1XCVA 1ODDA 1R1UA 4ENMA 5DEQA 1W5SA 4ZYHA 2P7CB 1G3YA 4HYEA 4M9ZA 5HLGA 3HHGA 4ZYDA 2Y0MA 3QP6A 3MQ0A 5BOXA 5L3DA 5CVIA 3DF8A 3KP5A 1GXQA 5H6RA 4IPAA 2OU2A 3F6VA 2ETHA 1XDSA 1WRJA 5CLSA 2DO7A 2E1NA 3GXOA 3RJPA 4GGGA 5J6XA 3K1NA 2W24A 4GXOA 2P4WA 4EJTA 5CJ9A 3ERED 1ZHFA 1HW5A 2GZWA 4A2UA 4NQWA 4PCQA 3WTZA 1ZG5A 2FEZA 3BP8A 2PG4A 1G3TA 1PP8F 2VC1A 2OD5A 3HSEA 2HS5A 1HW2A 2HGCA 4K2EA 1S3JA 3LQRA 1IN4A 2P5KA 4EM0B 2DPUA 2IP2A 4HBLA 3BJOA 2OZUA 2F5DA 1BIAA 2ZXJA 2RNJA 4IJAA 1KU3A 3T8RA 2K02A 3Q5FA 4M6XA 1SD4A 1KQ0A 4RGXA 1YW8A 1E2XA 1ZN2A 2RVCA 3BJAA 2PFBA 1O7LA 2LNBA 3DP7A 1Z05A 3IWZA 5K5QA 2QVOA 3ISPA 3P9KA 3EUHA 3TDZC 4D0PA 3WE2A 1A04A 4CDGA 3P9IA 5DD8A 2Z99A 3HIFA 3S2WA 5JR3A 1B9MA 2E1CA 4EVIA 2ISYA 2A6HF 3GF2A 1T0FA 2M45A 4DQ2A 4P55A 1GXPA 4N9IA 3LA7A 2RKHA 4FX0A 1GHCA 1BOAA 2V6CA 1H9TA 4DNCA 3KP7A 3DFGA 5D5XB 2J5OA 3SZPA 1RZ4A 4OIRF 3DPTA 3GLXA 3RI4A 4Q4ZF 3ZMZA 4XSZF 2MBFA 4JBAA 2EWNA 2D1HA 3MAJA 4ON0A 3L09A 2DFIA 5D8KB 3WE3A 1B1BA 2IA0A 3J81Z 3IRRA 4AD9A 2K4JA 2KIUA 4XBFA 2QBYB 3WODF 3LA3A 4FT8A 1LVAA 1C0WA 3RKYA 4I01A 2P5LC 3TDUC 2OQGA 3G73A 4G8XA 4I09A 1LEAA 3DXJF 4L0YB 4HF1A 4HX8A 1YIOA 1OMIA 2NRAC 1IRGA 1R00A 2FBHA 4KT5C 4I7HA 3F22A 1FYKA 1BM9A 1WI9A 5JI6A 2EA2A 3H92A 2BE5F 2A5YB 2F5EA 1V3FA 4WCGA 1Q1HA 2R3SA 3IL2A 3ZMDA 3HYIA 4A12A 2CQKA 1RNLA 2WTEA 1ZYRF 1U5TB 3M8FA 1IXRC 4OMZA 4LJZF 4U0WA 3OV8A 3WTVC 5AONA 4R79A 3MCZA 2HKXA 3I71A 1YS6A 3TGNA 1HBXG 2GA2A 2HQRA 1XSVA 4U88A 4LK1F 3F8NA 1YLFA 5FFZA 4KMUX 1O7FA 4HF0A 2NS0A 5LGUA 4BQAA 3SQNA 2UWMA 4LLGF 1FT9A 1SFUA 3W6KB 3BPXA 1NHAA 2H6BA 2XRNA 1X3UA 4A6EA 5J8FA 2ELHA 3CO7C 1FZPB 4LB6B 4KMFA 1MD0A 3LA2A 1XCBA 1KU2A 1IN6A 2LKPA 3FZVA 4KUMA 3ZMTA 2VE9A 3E5XA 1DDNA 2KJBA 3WTTC 5H20A 4MHGA 3C3WA 4WX9A 3ZN0A 1Z6TA 3GX4X 1FY7A 2A07F 5CVRA 4RAZA 1ZARA 1P4AA 5ILUA 3I53A 3O2PE 1QQIA 4HX7A 1U78A 2L02A 4M73A 3SZTA 2H09A 3HOSA 1IN8A 2MC3A 3LAJA 3QPHA 2BYVE 1SMYF 2VBYA 4XRFA 1IXCA 2DBBA 2J5PA 1S7AA 4L18B 2R7DA 1KU9A 4TV7A 4PDKA 2PJPA 3G3ZA 1BI2A 3QAHA 2L4AA 1R23A 3BY6A 3NEUA 4M9SA 1DPRA 4P9UA 3QU3A 3CUOA 2O3FA 4EGZA 1T98A 2HYFA 3KP2A 2QENA 4ESFA 4I0AA 4LB5A 2KKOA 5CVVA 3P7NA 4OOIA 2EB7A 4WXHA 4HAMA 5F6FA 1USSA 2QQ9A 3E6DA 5L3EA 4U0VA 2FMLA 2FU4A 3M7GA 3Q9VA 4CHUA 1ZGAA 1WQ2A 4EJUA 3IWFA 1JHHA 1TNTA 2VBZA 1KU7A 1T39A 2H27A 2EA4A 2ESHA 2DU9A 1L3LA 3E97A 4HW0A 1KYZA 4OU0A 1U5TC 2FOKA 4BHPA 4A6DA 2ESNA 1J2XA 2DK8A 2BBYA 5ED4A 2HR3A 4O3MA 5L3CA 1J0RA 2HFHA 1U8RA 1KYWA 6PAXA 1OYWA 3K9TA 4GYGA 3L2CA 1DUXC 4PGGA 1YTYA 5A2QK 4Y13A 1S29A 1K78A 1Z91A 2F2EA 4YIFA 4L5JA 1LDKB 5HOOA 2FXAA 1F9NA 3KCCA 2M5WA 3OOPA 3L7WA 4R1HA 2MA3A 1DP7P 2AS5F 3KE2A 5E1ZB 3WTUC 1R1TA 2XAHA 2RQPA 2WV0A 2ZO4A 3V8KA 4OINF 1IAWA 2CYYA 1HW1A 3GUDA 2O03A 5K1YA 4WK8F 4JK1X 2XKPA 3I58A 1J5YA 4A5MA 1U6GA 3B02A 1CGPA 1Z7UA 4GYIA 3ELKA 2IPQX 3I5UA 3COAC 3RDIA 5HDKA 3R4KA 4XLNF 2F5FA 2ACJA 1STZA 5E1XA 4ZZLA 1K7AA 2W84A 1OYYA 3V8LA 5HS8A 5K5OA 5E8IA 3PFIA 4Q47A 2UXXA 4I02A 4ENKA 5EEHA 1ZAOA 1O3TA 1MKMA 1SD5A 3QP5A 3MEXA 1TQIA 3JW4A 1FBSA 5L3GA 3FMSA 4IHSA 4ZZDA 4IVNA 1WKMA 5ILVA 2FNPA 1LJ9A 1ZG3A 4KIGA 3HTUA 5HDNA 2YU3A 3K0LA 2ZBKA 5IT3A 3HSRA 4I0BA 2WWYA 4KA4A 4HQEA 3J80K 3V7CA 1XB4A 2FE3A 3K1PA 1QZYA 3ML6A 2V79A 4IRGA 3CUQA 5LGNA 4EM2A 2HYGD 2EJRA 2CSOA 4I2OA 3HUGA 4NB5A 1WSUA 3L00A 2FBKA 2CFXA 1L0OC 4U7DA 4E70A 1XD7A 3RPUA 2FNAA 1SD6A 1Y0UA 3EYYA 2OAZA 1U3EM 2E7XA 4HOBA 1HQCA 3TO6A 2IA1A 3KLNA 2V1XA 3WGIA 5KK1A 2HTSA 4RGRA 4LGWA 1Z6RA 4M6YA 3ZP5A 3QU6A 1IRFA 1TW3A 1AOYA 3B73A 2F5CA 4BHCA 3VB2A 2EFQA 5DD4A 2P8TA 3R0AA 1H0MA 1QPMA 2EFPA 3ECHA 1P4WA 4IF4A 5AIPA 2A6EF 3T0YA 4XLPF 1VTNC 2JRTA 3M8EA 2JPBA 4H0EA 1TNSA 3I64A 3ZPLA 2DAOA 3ABUA 4O6JA 4M72A 3M9AA 4EV0A 3GZ5A 4UV8A 3O3KA 1LDJA 1D5VA 2FRHA 3DV8A 4EM1A 5LEKA 2IJLA 3ZMVA 1YYVA 2XUBA 1O3QA 2M87A 5D5VB 1FP2A 2IRFG 2W25A 2COMA 4YG2F 1V4RA 3R6SA 3ZN1A 3KEOA 3MFKA 1OYIA 1KGSA 3Q9SA 4HQMA 2JTVA 2ZNYA 4CYDA 2A69F 4AVPA 4ENJA 1S6LA 4L9JA 2GAUA 4RGUA 2IVMA 3REOA 3TOAA 3U9GA 4Y15A 4BH9A 4QWQA 2HZTA 4GCVA 4EGYA 3FWEA 5A2QZ 1FNNA 2RGVA 1FWZA 4Q5SF 2G9WA 4LK0F 2MH2A 5BMZA 3JSPA 1F4KA 3ABTA 2UXNA 1MJ9A 4LLLA 1EH6A 4OIQF 5ILSA 4Q48A 2GXBA 3TO9A 2V1UA 2EFNA 3JTHA 3GVAA 2FSWA 2M30A 3KZZA 3JAMK 3F21A 1BC7C 4WXDA 1K79A 3F6OA 1SAXA 5DCMA 1O3RA 3NQOA 1K78B 3KP4A 2NYXA 1D8JA 2BEOA 1RI7A 3E3VA 1KA8A 2G7HA 3CTAA 2RN7A 4JQFA 1BIBA 4A0ZA 1TTYA 2PN6A 5H6QA 4UUVA 5D8LB 3N97A 3E5QA 2O61A 2XROA 2V1DA 4CGZA 2M1BA 2GIVA 5FD6A 4M71A 4QLCU 3JSOA 2XKOA 4XSXF 5TJJA 4A0YA 1DPUA 5JVTA 2P6SA 4OMYA 3FM3A 1XN7A 3GW2A 3QRFF 4HDVA 1B4AA 2L3DA 1FBUA 4WWCA 1YW7A 2STWA 3VODA 4WF2A 3N4MA 1RIOH 1EH7A 1BBYA 3WU0A 1ZRFA 2O6GE 4Y17A 4IRIA 1W4MA 3KFWX 4CICA 3WGGA 3TOBA 5L3FA 2QWWA 3V8JA 3BJ6A 5D5UB 3QOPA 5J8CA 1OPCA 5F1RA 3E6MA 1B59A 2W85A 3V7SA 4B09A 2STTA 2FQ3A 2Y75A 2RV8A 5K5RA 1FX7A 3FXRA 4AWXB 2YR2A 3GEZA 1CF7B 3GWZA 4HA8A 3RKXA 4ETSA 5HLIA 3T8TA 1Z1DA 3CUQB 1PUEE 2HQNA 3SXYA 4G6QA 1XGOA 3DPLC 1HKQA 1WWXA 3FF5A 1S7OA 4B8XA 2VONA 3LAPA 3IHUA 1Z9CA 5ERIA 4M9XA 2XAQA 2C6YA 4KICA 4HV5A 2XIGA 2CWEA 4MTDA 4BHBA 3I59A 2LF8A 3FXUA 1O57A 4LG0A 5JHUA 1IW7F 2IT0A 5ICGA 3EYIA 4FX4A 2O0YA 5LBQA 2EV0A 2Y48A 5TRDA 4AIJA 4ZYEA 4RB2C 2XAJA 2DLLA 4NHJA 2OZ6A 2VOPA 3ECOA 2EV5A 2BGCA 2Q2EA 1IXSB 3I4PA 4LFUA 1W7PD 3F3XA 1P4XA 2YX7A 3J81K 1UB9A 3CDHA 1ONVA 4G94A 2ZKZA 3T1BA 4AIHA 2DQRA 2PBIA 4EMSA 1UFMA 2DI3A 2Z33A 1XGNA 1LDDA 2GA1A 2XVCA 3VEPA 1RUOA 4UV9A 5E20A 5LHGA 1BI3A 5DUKA 1MZBA 4EJOA 1F1ZA 4S04A 1IZ1A 1PDNC 4OIOF 2MLKA 4G7OF 2YSRA 3E5UA 2VE8A 4ESBA 3MWMA 3U1DA 4EQQA 3HOTA 2ZCWA 4KIFA 5FLXK 3BWGA 3LWFA 1SFEA 1FOKA 2PI0A 1QBJA 3F8BA 5IT9K 4L5IA 4RB0A 3EDPA 2OBPA 3RYPA 5LLQA 3WTWC 3CLOA 2PQ8A 5ICEA 2B0LA 1IF1A 3IKTA 1HXDA 1T38A 2HWVA 1UCRA 1ON2A 4HV6A 2QYOA 3FXQA 1D8KA 3DQVC 3JAMZ 2X0LA 3IC7A 5D5WB 3AAFA 4HLYA 3O6BB 5HS9A 2EFOA 3FM5A 1TLHB 3FX3A 2VT3A 1KQ9A 2IA2A 4L9VA 2HDCA 2DQLA 1MDMA 2RC4A 2A68F 4AIKA 1P6RA 2XASA 2H94A 3WU1B 4HLXA 4PGHA 2G7UA 4KFCA 4G9YA 3WTXC 3C1DA 4PZJA 5LGTA 5DCMB 1R5HA 2K4BA 3KZYA 1MJAA 4F7ZA 1UHMA 1K6OA 2GQQA 3GFLA 3RYRA 4MGRA 3BPVA 3RTRA 1AWCA 3F72A 2ZFWA 1ZG1A 1CF7A 3CUQC 1UHWA 2FA5A 3K69A 4HZFA 2BV6A 3U2RA 2EV6A 2PLYA 2DTRA 2OA4A 5ICFA 5L3BA 2K86A 1BI0A 2YX4A 2HTJA 2FF4A 5KVRA 5BQTA 1HSTA 4L9NA 2JPCA 4L9TA 1J7KA 3FHZA 1R1VA 1YG2A 4A5NA 5BS6A 2L01A 4BAYA 1P2FA 4MTEA 2ISZA 4UVBA 1MGTA 5HVQC 3VFZA 2L4MA 2CGPA 3K1MA 3K2ZA 3VOEA 1QNTA 2JSCA 1G6NA 2NNYA 3W6JB 4G7ZF 1O3SA 4IHTA 2D45A 4OIPF 3T5XA 1EV7A 2XV4S 2PMUA 4LLNA 2VC0A 4M74A 3WTYC 3F8MA 4UVAA 3ROUA 3HSFA 1PP7U 3TKYA 3QPTA 3GFMA 2NAZA 4YIIA 2XAGA 1ULYA 4BYYA 1FPQA 3EQLF 2D2WA 2RDPA 4P5OA 2P7VB 1TW2A 5F64A 3GFIA 4RAYA 3ULQB 1QZZA 2CO5A 4ZYGA 2XGXA 3HRMA 4RB3C 1SMTA 3GO5A 2XAFA 4IXAA 4KIBA 4YFKF 3E6CC 1ZH5A 2UZKA 3R61A 4U0YA 2Z5UA 2QQBA 4BXUA 3C7JA 5D6FA 3JTGA 1G4DA 3BOQA 5EEGA 1G3SA 2CW0F 5E17F 2YPRA 5AIQA 1JXSA 1LB2A 3M1EA 3EETA 3FMRA 3KEQA 2HKOA 2PEXA 3R60A 2E7WA 5HS7A 4IRHA 2H6CA 1HSJA 3I54A 4U7BA 5LHHA 4ESJA 1FYLA 2VXZA 1W7PA 3I59B 4LD5A 1JE8A 4YFXF 4LG0B 3FMQA 1FLIA 1S8NA 1JHFA 4HDUA 3BDDA 2Z3YA 3LQQA 3J7AO 2QZ8A 2OQRA 2Q8KA 3WG9A 1FC3A 4EJVA 1ZLJA 2TDXA 5CVJA 2JZYA 4LMYA 1XSXA 3HHHA 4O5VA 2R7FA 4MNUA 2D1VA 5FGMA 5DYMA 5LHIA 2JT1A 1QO0D 3PQJA 2PMHA 1ZREA 1I27A 1W5TA 2AXLA 1XGSA 2GWRA 3CJNA 2K27A 4G6DA 2QUFA 3GZ6A 5ICCA 5FLXZ 1J9IA 3HTSB 1YQAA 3IRQA 2VBWA 3WGHA 5IT9Z 3MZYA 2KIFA 1YS7A 2ZMEB 1ZRCA 2LSOA 4HF2A 2M8EA 4P9FA 1H9GA 1IUYA 1OR7A 2QQAA 1J59A 3MZHA 2MH9A 3CO6C 2QLZA 1YW9A 3RKWA 1FSHA 2P5VA 3DEUA 5DUIA 5DDGA 4ASNA 3GFJA 4KDPA 4HX4A 1XMKA 3HRTA 1XSDA 2DW4A 4P96A 4UXNA 3TO7A 3LSTA 4RGSA 2DPDA 1FBQA 4R8HA 3C18A 3RPQA 5LRRA 1MJBA 5JFRA 4KN4X 4L0ZB 2P6TA 3WTSC 5D6EA 1P92A 5E8GA 1LQ1A 1LNWA 3SHFA 1B9NA 2KJCA 4RB1A 3LFKA 3KP3A 1IN7A 3ZMUA 4CZZA 2QM3A 1XMAA 3I0TA 1MDMB 2HEOA 3R0JA 4MQVA 2EK5A 2VODA 5LEJA 3ZMSA 4S05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKR A;  3J80 Z;  3BRO A;  1R5G A;  2FMY A;  2DT5 A;  1EH8 A;  2VN2 A;  2IW5 A;  3H3U A;  2EFW A;  3PQK A;  1R7J A;  3GYH X;  2LDU A;  3HRS A;  1R36 A;  1IN5 A;  5DCF A;  4KNY A;  2KRF A;  3RIR A;  2VBX A;  1REP C;  1HKT A;  2HOE A;  4MEX F;  1I1S A;  3TQN A;  1U2W A;  3V7R A;  2Z9O A;  3NRV A;  2L54 A;  1LEB A;  4CXF A;  1GVJ A;  2MD5 A;  4MQ9 F;  2XHK A;  1I1G A;  2O8X A;  4N0B A;  5FD5 A;  2ADU A;  2VOO A;  1SD7 A;  2FBI A;  5HLH A;  4WXC A;  2DK5 A;  3F8F A;  1E17 A;  3E6B A;  2A61 A;  1BN5 A;  4ZH4 F;  2ZNZ A;  1I6X A;  1JGS A;  1I5Z A;  4FHT A;  1T2K A;  3DKW A;  2NNN A;  1B6A A;  1TBX A;  2QBY A;  3ZQ7 A;  3P9C A;  1BJA A;  5D4R A;  3F8C A;  4BNC A;  1J75 A;  2MLG A;  3KET A;  2A3S A;  4G7H F;  1FP1 D;  5LRS A;  5E1W A;  1ZRD A;  1R22 A;  4KYW A;  5CYV A;  3V4G A;  5BPD A;  2Q0O A;  3D0S A;  2KIM A;  3H3Z A;  1XGM A;  3SFZ A;  5FFX A;  5FO5 A;  2VT2 A;  2W57 A;  1G3W A;  3HRU A;  5FB2 A;  4ENN A;  1FSE A;  2ZJ2 A;  3L9F A;  1YO5 C;  2WC2 A;  1BC8 C;  1ZLK A;  2K7L A;  3F23 A;  4UHT A;  2V9V A;  4YFN F;  3BZ6 A;  1BI1 A;  1SFX A;  1TQM A;  2ZME A;  1UST A;  1U5T A;  3IKV A;  1RUN A;  2CG4 A;  1TQP A;  4UNO A;  1HKS A;  5DV5 A;  1R58 A;  1YFH A;  4N9H A;  1ZGJ A;  4GO1 A;  4CO8 A;  4EJW A;  3KLO A;  1D3Y A;  5CVU A;  1W7P B;  4KN7 X;  1QGP A;  5HDG A;  4UVC A;  4Z2Y A;  5BPI A;  2LF7 A;  1XDU A;  5D4S A;  5E18 F;  4RS8 A;  4I98 B;  2GXG A;  2X4H A;  3D5L A;  1ON1 A;  1T6S A;  1KQ8 A;  3KP6 A;  1FYM A;  4A0X A;  1F5T A;  4MEY F;  1XCV A;  1ODD A;  1R1U A;  4ENM A;  5DEQ A;  1W5S A;  4ZYH A;  2P7C B;  1G3Y A;  4HYE A;  4M9Z A;  5HLG A;  3HHG A;  4ZYD A;  2Y0M A;  3QP6 A;  3MQ0 A;  5BOX A;  5L3D A;  5CVI A;  3DF8 A;  3KP5 A;  1GXQ A;  5H6R A;  4IPA A;  2OU2 A;  3F6V A;  2ETH A;  1XDS A;  1WRJ A;  5CLS A;  2DO7 A;  2E1N A;  3GXO A;  3RJP A;  4GGG A;  5J6X A;  3K1N A;  2W24 A;  4GXO A;  2P4W A;  4EJT A;  5CJ9 A;  3ERE D;  1ZHF A;  1HW5 A;  2GZW A;  4A2U A;  4NQW A;  4PCQ A;  3WTZ A;  1ZG5 A;  2FEZ A;  3BP8 A;  2PG4 A;  1G3T A;  1PP8 F;  2VC1 A;  2OD5 A;  3HSE A;  2HS5 A;  1HW2 A;  2HGC A;  4K2E A;  1S3J A;  3LQR A;  1IN4 A;  2P5K A;  4EM0 B;  2DPU A;  2IP2 A;  4HBL A;  3BJO A;  2OZU A;  2F5D A;  1BIA A;  2ZXJ A;  2RNJ A;  4IJA A;  1KU3 A;  3T8R A;  2K02 A;  3Q5F A;  4M6X A;  1SD4 A;  1KQ0 A;  4RGX A;  1YW8 A;  1E2X A;  1ZN2 A;  2RVC A;  3BJA A;  2PFB A;  1O7L A;  2LNB A;  3DP7 A;  1Z05 A;  3IWZ A;  5K5Q A;  2QVO A;  3ISP A;  3P9K A;  3EUH A;  3TDZ C;  4D0P A;  3WE2 A;  1A04 A;  4CDG A;  3P9I A;  5DD8 A;  2Z99 A;  3HIF A;  3S2W A;  5JR3 A;  1B9M A;  2E1C A;  4EVI A;  2ISY A;  2A6H F;  3GF2 A;  1T0F A;  2M45 A;  4DQ2 A;  4P55 A;  1GXP A;  4N9I A;  3LA7 A;  2RKH A;  4FX0 A;  1GHC A;  1BOA A;  2V6C A;  1H9T A;  4DNC A;  3KP7 A;  3DFG A;  5D5X B;  2J5O A;  3SZP A;  1RZ4 A;  4OIR F;  3DPT A;  3GLX A;  3RI4 A;  4Q4Z F;  3ZMZ A;  4XSZ F;  2MBF A;  4JBA A;  2EWN A;  2D1H A;  3MAJ A;  4ON0 A;  3L09 A;  2DFI A;  5D8K B;  3WE3 A;  1B1B A;  2IA0 A;  3J81 Z;  3IRR A;  4AD9 A;  2K4J A;  2KIU A;  4XBF A;  2QBY B;  3WOD F;  3LA3 A;  4FT8 A;  1LVA A;  1C0W A;  3RKY A;  4I01 A;  2P5L C;  3TDU C;  2OQG A;  3G73 A;  4G8X A;  4I09 A;  1LEA A;  3DXJ F;  4L0Y B;  4HF1 A;  4HX8 A;  1YIO A;  1OMI A;  2NRA C;  1IRG A;  1R00 A;  2FBH A;  4KT5 C;  4I7H A;  3F22 A;  1FYK A;  1BM9 A;  1WI9 A;  5JI6 A;  2EA2 A;  3H92 A;  2BE5 F;  2A5Y B;  2F5E A;  1V3F A;  4WCG A;  1Q1H A;  2R3S A;  3IL2 A;  3ZMD A;  3HYI A;  4A12 A;  2CQK A;  1RNL A;  2WTE A;  1ZYR F;  1U5T B;  3M8F A;  1IXR C;  4OMZ A;  4LJZ F;  4U0W A;  3OV8 A;  3WTV C;  5AON A;  4R79 A;  3MCZ A;  2HKX A;  3I71 A;  1YS6 A;  3TGN A;  1HBX G;  2GA2 A;  2HQR A;  1XSV A;  4U88 A;  4LK1 F;  3F8N A;  1YLF A;  5FFZ A;  4KMU X;  1O7F A;  4HF0 A;  2NS0 A;  5LGU A;  4BQA A;  3SQN A;  2UWM A;  4LLG F;  1FT9 A;  1SFU A;  3W6K B;  3BPX A;  1NHA A;  2H6B A;  2XRN A;  1X3U A;  4A6E A;  5J8F A;  2ELH A;  3CO7 C;  1FZP B;  4LB6 B;  4KMF A;  1MD0 A;  3LA2 A;  1XCB A;  1KU2 A;  1IN6 A;  2LKP A;  3FZV A;  4KUM A;  3ZMT A;  2VE9 A;  3E5X A;  1DDN A;  2KJB A;  3WTT C;  5H20 A;  4MHG A;  3C3W A;  4WX9 A;  3ZN0 A;  1Z6T A;  3GX4 X;  1FY7 A;  2A07 F;  5CVR A;  4RAZ A;  1ZAR A;  1P4A A;  5ILU A;  3I53 A;  3O2P E;  1QQI A;  4HX7 A;  1U78 A;  2L02 A;  4M73 A;  3SZT A;  2H09 A;  3HOS A;  1IN8 A;  2MC3 A;  3LAJ A;  3QPH A;  2BYV E;  1SMY F;  2VBY A;  4XRF A;  1IXC A;  2DBB A;  2J5P A;  1S7A A;  4L18 B;  2R7D A;  1KU9 A;  4TV7 A;  4PDK A;  2PJP A;  3G3Z A;  1BI2 A;  3QAH A;  2L4A A;  1R23 A;  3BY6 A;  3NEU A;  4M9S A;  1DPR A;  4P9U A;  3QU3 A;  3CUO A;  2O3F A;  4EGZ A;  1T98 A;  2HYF A;  3KP2 A;  2QEN A;  4ESF A;  4I0A A;  4LB5 A;  2KKO A;  5CVV A;  3P7N A;  4OOI A;  2EB7 A;  4WXH A;  4HAM A;  5F6F A;  1USS A;  2QQ9 A;  3E6D A;  5L3E A;  4U0V A;  2FML A;  2FU4 A;  3M7G A;  3Q9V A;  4CHU A;  1ZGA A;  1WQ2 A;  4EJU A;  3IWF A;  1JHH A;  1TNT A;  2VBZ A;  1KU7 A;  1T39 A;  2H27 A;  2EA4 A;  2ESH A;  2DU9 A;  1L3L A;  3E97 A;  4HW0 A;  1KYZ A;  4OU0 A;  1U5T C;  2FOK A;  4BHP A;  4A6D A;  2ESN A;  1J2X A;  2DK8 A;  2BBY A;  5ED4 A;  2HR3 A;  4O3M A;  5L3C A;  1J0R A;  2HFH A;  1U8R A;  1KYW A;  6PAX A;  1OYW A;  3K9T A;  4GYG A;  3L2C A;  1DUX C;  4PGG A;  1YTY A;  5A2Q K;  4Y13 A;  1S29 A;  1K78 A;  1Z91 A;  2F2E A;  4YIF A;  4L5J A;  1LDK B;  5HOO A;  2FXA A;  1F9N A;  3KCC A;  2M5W A;  3OOP A;  3L7W A;  4R1H A;  2MA3 A;  1DP7 P;  2AS5 F;  3KE2 A;  5E1Z B;  3WTU C;  1R1T A;  2XAH A;  2RQP A;  2WV0 A;  2ZO4 A;  3V8K A;  4OIN F;  1IAW A;  2CYY A;  1HW1 A;  3GUD A;  2O03 A;  5K1Y A;  4WK8 F;  4JK1 X;  2XKP A;  3I58 A;  1J5Y A;  4A5M A;  1U6G A;  3B02 A;  1CGP A;  1Z7U A;  4GYI A;  3ELK A;  2IPQ X;  3I5U A;  3COA C;  3RDI A;  5HDK A;  3R4K A;  4XLN F;  2F5F A;  2ACJ A;  1STZ A;  5E1X A;  4ZZL A;  1K7A A;  2W84 A;  1OYY A;  3V8L A;  5HS8 A;  5K5O A;  5E8I A;  3PFI A;  4Q47 A;  2UXX A;  4I02 A;  4ENK A;  5EEH A;  1ZAO A;  1O3T A;  1MKM A;  1SD5 A;  3QP5 A;  3MEX A;  1TQI A;  3JW4 A;  1FBS A;  5L3G A;  3FMS A;  4IHS A;  4ZZD A;  4IVN A;  1WKM A;  5ILV A;  2FNP A;  1LJ9 A;  1ZG3 A;  4KIG A;  3HTU A;  5HDN A;  2YU3 A;  3K0L A;  2ZBK A;  5IT3 A;  3HSR A;  4I0B A;  2WWY A;  4KA4 A;  4HQE A;  3J80 K;  3V7C A;  1XB4 A;  2FE3 A;  3K1P A;  1QZY A;  3ML6 A;  2V79 A;  4IRG A;  3CUQ A;  5LGN A;  4EM2 A;  2HYG D;  2EJR A;  2CSO A;  4I2O A;  3HUG A;  4NB5 A;  1WSU A;  3L00 A;  2FBK A;  2CFX A;  1L0O C;  4U7D A;  4E70 A;  1XD7 A;  3RPU A;  2FNA A;  1SD6 A;  1Y0U A;  3EYY A;  2OAZ A;  1U3E M;  2E7X A;  4HOB A;  1HQC A;  3TO6 A;  2IA1 A;  3KLN A;  2V1X A;  3WGI A;  5KK1 A;  2HTS A;  4RGR A;  4LGW A;  1Z6R A;  4M6Y A;  3ZP5 A;  3QU6 A;  1IRF A;  1TW3 A;  1AOY A;  3B73 A;  2F5C A;  4BHC A;  3VB2 A;  2EFQ A;  5DD4 A;  2P8T A;  3R0A A;  1H0M A;  1QPM A;  2EFP A;  3ECH A;  1P4W A;  4IF4 A;  5AIP A;  2A6E F;  3T0Y A;  4XLP F;  1VTN C;  2JRT A;  3M8E A;  2JPB A;  4H0E A;  1TNS A;  3I64 A;  3ZPL A;  2DAO A;  3ABU A;  4O6J A;  4M72 A;  3M9A A;  4EV0 A;  3GZ5 A;  4UV8 A;  3O3K A;  1LDJ A;  1D5V A;  2FRH A;  3DV8 A;  4EM1 A;  5LEK A;  2IJL A;  3ZMV A;  1YYV A;  2XUB A;  1O3Q A;  2M87 A;  5D5V B;  1FP2 A;  2IRF G;  2W25 A;  2COM A;  4YG2 F;  1V4R A;  3R6S A;  3ZN1 A;  3KEO A;  3MFK A;  1OYI A;  1KGS A;  3Q9S A;  4HQM A;  2JTV A;  2ZNY A;  4CYD A;  2A69 F;  4AVP A;  4ENJ A;  1S6L A;  4L9J A;  2GAU A;  4RGU A;  2IVM A;  3REO A;  3TOA A;  3U9G A;  4Y15 A;  4BH9 A;  4QWQ A;  2HZT A;  4GCV A;  4EGY A;  3FWE A;  5A2Q Z;  1FNN A;  2RGV A;  1FWZ A;  4Q5S F;  2G9W A;  4LK0 F;  2MH2 A;  5BMZ A;  3JSP A;  1F4K A;  3ABT A;  2UXN A;  1MJ9 A;  4LLL A;  1EH6 A;  4OIQ F;  5ILS A;  4Q48 A;  2GXB A;  3TO9 A;  2V1U A;  2EFN A;  3JTH A;  3GVA A;  2FSW A;  2M30 A;  3KZZ A;  3JAM K;  3F21 A;  1BC7 C;  4WXD A;  1K79 A;  3F6O A;  1SAX A;  5DCM A;  1O3R A;  3NQO A;  1K78 B;  3KP4 A;  2NYX A;  1D8J A;  2BEO A;  1RI7 A;  3E3V A;  1KA8 A;  2G7H A;  3CTA A;  2RN7 A;  4JQF A;  1BIB A;  4A0Z A;  1TTY A;  2PN6 A;  5H6Q A;  4UUV A;  5D8L B;  3N97 A;  3E5Q A;  2O61 A;  2XRO A;  2V1D A;  4CGZ A;  2M1B A;  2GIV A;  5FD6 A;  4M71 A;  4QLC U;  3JSO A;  2XKO A;  4XSX F;  5TJJ A;  4A0Y A;  1DPU A;  5JVT A;  2P6S A;  4OMY A;  3FM3 A;  1XN7 A;  3GW2 A;  3QRF F;  4HDV A;  1B4A A;  2L3D A;  1FBU A;  4WWC A;  1YW7 A;  2STW A;  3VOD A;  4WF2 A;  3N4M A;  1RIO H;  1EH7 A;  1BBY A;  3WU0 A;  1ZRF A;  2O6G E;  4Y17 A;  4IRI A;  1W4M A;  3KFW X;  4CIC A;  3WGG A;  3TOB A;  5L3F A;  2QWW A;  3V8J A;  3BJ6 A;  5D5U B;  3QOP A;  5J8C A;  1OPC A;  5F1R A;  3E6M A;  1B59 A;  2W85 A;  3V7S A;  4B09 A;  2STT A;  2FQ3 A;  2Y75 A;  2RV8 A;  5K5R A;  1FX7 A;  3FXR A;  4AWX B;  2YR2 A;  3GEZ A;  1CF7 B;  3GWZ A;  4HA8 A;  3RKX A;  4ETS A;  5HLI A;  3T8T A;  1Z1D A;  3CUQ B;  1PUE E;  2HQN A;  3SXY A;  4G6Q A;  1XGO A;  3DPL C;  1HKQ A;  1WWX A;  3FF5 A;  1S7O A;  4B8X A;  2VON A;  3LAP A;  3IHU A;  1Z9C A;  5ERI A;  4M9X A;  2XAQ A;  2C6Y A;  4KIC A;  4HV5 A;  2XIG A;  2CWE A;  4MTD A;  4BHB A;  3I59 A;  2LF8 A;  3FXU A;  1O57 A;  4LG0 A;  5JHU A;  1IW7 F;  2IT0 A;  5ICG A;  3EYI A;  4FX4 A;  2O0Y A;  5LBQ A;  2EV0 A;  2Y48 A;  5TRD A;  4AIJ A;  4ZYE A;  4RB2 C;  2XAJ A;  2DLL A;  4NHJ A;  2OZ6 A;  2VOP A;  3ECO A;  2EV5 A;  2BGC A;  2Q2E A;  1IXS B;  3I4P A;  4LFU A;  1W7P D;  3F3X A;  1P4X A;  2YX7 A;  3J81 K;  1UB9 A;  3CDH A;  1ONV A;  4G94 A;  2ZKZ A;  3T1B A;  4AIH A;  2DQR A;  2PBI A;  4EMS A;  1UFM A;  2DI3 A;  2Z33 A;  1XGN A;  1LDD A;  2GA1 A;  2XVC A;  3VEP A;  1RUO A;  4UV9 A;  5E20 A;  5LHG A;  1BI3 A;  5DUK A;  1MZB A;  4EJO A;  1F1Z A;  4S04 A;  1IZ1 A;  1PDN C;  4OIO F;  2MLK A;  4G7O F;  2YSR A;  3E5U A;  2VE8 A;  4ESB A;  3MWM A;  3U1D A;  4EQQ A;  3HOT A;  2ZCW A;  4KIF A;  5FLX K;  3BWG A;  3LWF A;  1SFE A;  1FOK A;  2PI0 A;  1QBJ A;  3F8B A;  5IT9 K;  4L5I A;  4RB0 A;  3EDP A;  2OBP A;  3RYP A;  5LLQ A;  3WTW C;  3CLO A;  2PQ8 A;  5ICE A;  2B0L A;  1IF1 A;  3IKT A;  1HXD A;  1T38 A;  2HWV A;  1UCR A;  1ON2 A;  4HV6 A;  2QYO A;  3FXQ A;  1D8K A;  3DQV C;  3JAM Z;  2X0L A;  3IC7 A;  5D5W B;  3AAF A;  4HLY A;  3O6B B;  5HS9 A;  2EFO A;  3FM5 A;  1TLH B;  3FX3 A;  2VT3 A;  1KQ9 A;  2IA2 A;  4L9V A;  2HDC A;  2DQL A;  1MDM A;  2RC4 A;  2A68 F;  4AIK A;  1P6R A;  2XAS A;  2H94 A;  3WU1 B;  4HLX A;  4PGH A;  2G7U A;  4KFC A;  4G9Y A;  3WTX C;  3C1D A;  4PZJ A;  5LGT A;  5DCM B;  1R5H A;  2K4B A;  3KZY A;  1MJA A;  4F7Z A;  1UHM A;  1K6O A;  2GQQ A;  3GFL A;  3RYR A;  4MGR A;  3BPV A;  3RTR A;  1AWC A;  3F72 A;  2ZFW A;  1ZG1 A;  1CF7 A;  3CUQ C;  1UHW A;  2FA5 A;  3K69 A;  4HZF A;  2BV6 A;  3U2R A;  2EV6 A;  2PLY A;  2DTR A;  2OA4 A;  5ICF A;  5L3B A;  2K86 A;  1BI0 A;  2YX4 A;  2HTJ A;  2FF4 A;  5KVR A;  5BQT A;  1HST A;  4L9N A;  2JPC A;  4L9T A;  1J7K A;  3FHZ A;  1R1V A;  1YG2 A;  4A5N A;  5BS6 A;  2L01 A;  4BAY A;  1P2F A;  4MTE A;  2ISZ A;  4UVB A;  1MGT A;  5HVQ C;  3VFZ A;  2L4M A;  2CGP A;  3K1M A;  3K2Z A;  3VOE A;  1QNT A;  2JSC A;  1G6N A;  2NNY A;  3W6J B;  4G7Z F;  1O3S A;  4IHT A;  2D45 A;  4OIP F;  3T5X A;  1EV7 A;  2XV4 S;  2PMU A;  4LLN A;  2VC0 A;  4M74 A;  3WTY C;  3F8M A;  4UVA A;  3ROU A;  3HSF A;  1PP7 U;  3TKY A;  3QPT A;  3GFM A;  2NAZ A;  4YII A;  2XAG A;  1ULY A;  4BYY A;  1FPQ A;  3EQL F;  2D2W A;  2RDP A;  4P5O A;  2P7V B;  1TW2 A;  5F64 A;  3GFI A;  4RAY A;  3ULQ B;  1QZZ A;  2CO5 A;  4ZYG A;  2XGX A;  3HRM A;  4RB3 C;  1SMT A;  3GO5 A;  2XAF A;  4IXA A;  4KIB A;  4YFK F;  3E6C C;  1ZH5 A;  2UZK A;  3R61 A;  4U0Y A;  2Z5U A;  2QQB A;  4BXU A;  3C7J A;  5D6F A;  3JTG A;  1G4D A;  3BOQ A;  5EEG A;  1G3S A;  2CW0 F;  5E17 F;  2YPR A;  5AIQ A;  1JXS A;  1LB2 A;  3M1E A;  3EET A;  3FMR A;  3KEQ A;  2HKO A;  2PEX A;  3R60 A;  2E7W A;  5HS7 A;  4IRH A;  2H6C A;  1HSJ A;  3I54 A;  4U7B A;  5LHH A;  4ESJ A;  1FYL A;  2VXZ A;  1W7P A;  3I59 B;  4LD5 A;  1JE8 A;  4YFX F;  4LG0 B;  3FMQ A;  1FLI A;  1S8N A;  1JHF A;  4HDU A;  3BDD A;  2Z3Y A;  3LQQ A;  3J7A O;  2QZ8 A;  2OQR A;  2Q8K A;  3WG9 A;  1FC3 A;  4EJV A;  1ZLJ A;  2TDX A;  5CVJ A;  2JZY A;  4LMY A;  1XSX A;  3HHH A;  4O5V A;  2R7F A;  4MNU A;  2D1V A;  5FGM A;  5DYM A;  5LHI A;  2JT1 A;  1QO0 D;  3PQJ A;  2PMH A;  1ZRE A;  1I27 A;  1W5T A;  2AXL A;  1XGS A;  2GWR A;  3CJN A;  2K27 A;  4G6D A;  2QUF A;  3GZ6 A;  5ICC A;  5FLX Z;  1J9I A;  3HTS B;  1YQA A;  3IRQ A;  2VBW A;  3WGH A;  5IT9 Z;  3MZY A;  2KIF A;  1YS7 A;  2ZME B;  1ZRC A;  2LSO A;  4HF2 A;  2M8E A;  4P9F A;  1H9G A;  1IUY A;  1OR7 A;  2QQA A;  1J59 A;  3MZH A;  2MH9 A;  3CO6 C;  2QLZ A;  1YW9 A;  3RKW A;  1FSH A;  2P5V A;  3DEU A;  5DUI A;  5DDG A;  4ASN A;  3GFJ A;  4KDP A;  4HX4 A;  1XMK A;  3HRT A;  1XSD A;  2DW4 A;  4P96 A;  4UXN A;  3TO7 A;  3LST A;  4RGS A;  2DPD A;  1FBQ A;  4R8H A;  3C18 A;  3RPQ A;  5LRR A;  1MJB A;  5JFR A;  4KN4 X;  4L0Z B;  2P6T A;  3WTS C;  5D6E A;  1P92 A;  5E8G A;  1LQ1 A;  1LNW A;  3SHF A;  1B9N A;  2KJC A;  4RB1 A;  3LFK A;  3KP3 A;  1IN7 A;  3ZMU A;  4CZZ A;  2QM3 A;  1XMA A;  3I0T A;  1MDM B;  2HEO A;  3R0J A;  4MQV A;  2EK5 A;  2VOD A;  5LEJ A;  3ZMS A;  4S05 A; 
#chains in the Genus database with same CATH topology
 1OKR A;  3J80 Z;  3BRO A;  3FXO A;  1R5G A;  2FMY A;  5CQG A;  2DT5 A;  1EH8 A;  3OL4 A;  3GZN B;  2HPI A;  1S7E A;  2IW5 A;  2VN2 A;  3H3U A;  3KYC B;  2EFW A;  3PQK A;  1R7J A;  2V4J C;  5DM6 F;  4Y7N J;  1X1C A;  2ZJR F;  3GYH X;  5E3L A;  2LDU A;  3HRS A;  3BG3 A;  3W3C A;  4U87 A;  4XLH A;  1IV8 A;  1R36 A;  3L1P A;  2DA5 A;  1IN5 A;  1OQY A;  2FX0 A;  2VUM J;  5DCF A;  4XMY A;  5FKL A;  3H36 A;  4KNY A;  2KRF A;  4BS9 A;  3RIR A;  4E7Z A;  2WAF A;  2VBX A;  3H5N A;  1REP C;  1HKT A;  2HOE A;  2KRC A;  4MEX F;  3BG6 A;  3G1M A;  1N75 A;  1I1S A;  3TQN A;  4NQW B;  1U2W A;  2GIZ A;  2B9S A;  1W36 C;  3V7R A;  4CZC A;  1X1D A;  2Z9O A;  2M3A A;  3AG2 H;  4JX4 A;  3NRV A;  2L54 A;  1LEB A;  1IGN A;  4RBO A;  3CLQ A;  5J3L A;  4LG3 A;  4CXF A;  1B8I B;  3J7Z I;  1GVJ A;  2MD5 A;  4ZDP A;  1D5Y A;  2QSF X;  4M3B A;  3L2R A;  4MQ9 F;  4AYB A;  3BC8 A;  4PJM A;  1APL C;  2XHK A;  1GUU A;  1R9T J;  1I1G A;  2O8X A;  2WB1 N;  2L7Z A;  3DEE A;  1WH5 A;  4N0B A;  1W0T A;  5FD5 A;  2ADU A;  2VOO A;  2CQQ A;  2I8D A;  2VQH A;  1SD7 A;  2FBI A;  2Q1Z B;  3CF2 A;  5HLH A;  4WXC A;  3GTP J;  3FIS A;  1DP3 A;  2DK5 A;  3F8F A;  2EZK A;  3S15 J;  1N25 A;  2NS7 A;  2DJN A;  5F0C A;  1EJ9 A;  1E17 A;  5HLT A;  2CFO A;  3E6B A;  2EZL A;  2A61 A;  5E3M A;  1BN5 A;  4DW6 A;  2D5V A;  4XLA A;  4ZH4 F;  1Z21 A;  3D5R C;  2ZNZ A;  1I6X A;  2OCC H;  1JGS A;  1I5Z A;  4FCY A;  5FRN A;  4FHT A;  3H3V K;  3AG4 H;  4ABZ A;  1T2K A;  1JKR C;  3DKW A;  5GAD J;  3K4B A;  2H8W A;  1B6A A;  1TBX A;  2NNN A;  3ZQ7 A;  2QBY A;  3P9C A;  1BJA A;  5D4R A;  3F8C A;  4BQN A;  4BNC A;  1BL0 A;  1J75 A;  3RCO A;  3A01 A;  5F0F A;  2MLG A;  2V7F A;  2A3S A;  3KET A;  1MW7 A;  1YOV B;  2RRE A;  4G7H F;  1FTT A;  1FP1 D;  3ABK H;  5LRS A;  5CPR B;  3ZRG A;  5E1W A;  3CF5 F;  1ZRD A;  1R22 A;  4KYW A;  3WHB A;  4HST A;  5CYV A;  1LE8 B;  3V4G A;  2HZD A;  5BPD A;  2Q0O A;  3QQA A;  3D0S A;  2KIM A;  3H3Z A;  1XGM A;  2BW3 B;  3SFZ A;  4AVZ A;  5FFX A;  5FO5 A;  2EH3 A;  3FBN B;  2VT2 A;  3PL8 A;  2ZXW H;  2W57 A;  1G3W A;  3HRU A;  5FB2 A;  1DU0 A;  1DGR M;  4ENN A;  4ZC3 A;  1FSE A;  2ZJ2 A;  3L9F A;  4XRM A;  4F52 A;  1YO5 C;  2KZV A;  2WC2 A;  3EUK L;  5EDN A;  1VZ0 A;  1VF9 A;  2H1L A;  4F3Q A;  1BC8 C;  2LC2 A;  1ZLK A;  2VB6 A;  1SVM A;  4FQG A;  2HYJ A;  2K7L A;  3F23 A;  4UHT A;  2V9V A;  4YFN F;  3BZ6 A;  2LD5 A;  2IXS A;  1YJN I;  1BI1 A;  1SFX A;  5EG0 A;  1TQM A;  3IAM 2;  2WY7 Q;  2ZME A;  2R4G A;  1GV5 A;  1UST A;  4XKC A;  2L9R A;  1AA7 A;  1U5T A;  2L0K A;  3IKV A;  2CUF A;  2L9V A;  1RUN A;  2BXZ A;  2CG4 A;  1TQP A;  3MKL A;  2IS4 A;  2K9M A;  4BY7 J;  5IYD J;  4UNO A;  1HKS A;  2V1N A;  5DV5 A;  1R58 A;  4CCM A;  2E34 A;  1YFH A;  4N9H A;  3DPU A;  4C30 A;  4L5E A;  3M8J A;  1MBE A;  1ZGJ A;  4GO1 A;  4CO8 A;  4A3B J;  4EJW A;  3KLO A;  1D3Y A;  3OR1 C;  3DU5 A;  2L7K A;  4X0G A;  4IKF A;  1JI8 A;  5CVU A;  4PSX A;  5KCM A;  1W7P B;  1SC7 A;  2LFB A;  4E7S A;  3QOE A;  4KN7 X;  1QGP A;  1TL8 A;  3NAR A;  4QPO A;  5HDG A;  4UVC A;  4Z2Y A;  3VSL A;  1I50 J;  2L5Q A;  3HL2 A;  5BPI A;  2BY3 A;  4XOT A;  4FET A;  1XPX A;  2LF7 A;  1XDU A;  2ECB A;  3A1Y A;  3SEQ A;  5D4S A;  4NDL A;  4RS8 A;  5E18 F;  4I98 B;  2GXG A;  2X4H A;  4C2T A;  4IOA F;  3D5L A;  2HPM A;  1ON1 A;  1MBK A;  1T6S A;  2VKH A;  1DQU A;  5C44 J;  1KQ8 A;  4RAF A;  3KP6 A;  2DXI A;  5J4Y A;  1FYM A;  2KT0 A;  4A0X A;  1P7J A;  2DMT A;  4MEY F;  3TP0 A;  1F5T A;  1XCV A;  1ODD A;  1R1U A;  2IBD A;  3ZGK A;  2IGM A;  4ENM A;  1ZQ3 P;  2DFH A;  3DWL E;  5DEQ A;  4F93 B;  5F1J A;  1W5S A;  4ZTF A;  4BBR J;  4PSW A;  4ZYH A;  2OCE A;  2R7O A;  3SDG A;  3BCA A;  2P7C B;  1G3Y A;  4HYE A;  4M9Z A;  5HLG A;  4E7H A;  3HHG A;  4A3I J;  1JGG A;  4ZYD A;  2Y0M A;  3GTK J;  2R5Z A;  3QP6 A;  3MQ0 A;  1PVE A;  1Y6I A;  5BOX A;  5L3D A;  5CVI A;  3DF8 A;  1E0E A;  3KP5 A;  2E19 A;  3MKW B;  1GXQ A;  5H6R A;  3OYE A;  4IPA A;  2OU2 A;  2JK3 A;  3F6V A;  2ETH A;  2LYC A;  1XDS A;  2R0Q C;  1WRJ A;  5CLS A;  1XX5 A;  1OCC H;  2DO7 A;  5K7F A;  1Y39 A;  1BR2 A;  1MMD A;  2E1N A;  3GXO A;  3CJT B;  3RJP A;  4GGG A;  4XN3 A;  1YRN B;  4JP0 A;  3HGY A;  5J6X A;  3K1N A;  2W24 A;  5J47 A;  4GXO A;  2P4W A;  4EJT A;  3HM5 A;  2CJJ A;  5CJ9 A;  2KIQ A;  3JCU C;  5GTI C;  3BG7 A;  3FKI J;  3ERE D;  1ZHF A;  1SFO J;  1HW5 A;  1R4M B;  3S14 J;  3DKY A;  1A31 A;  4NNJ A;  4BEH B;  2LVS A;  2GZW A;  2L7F P;  4A2U A;  4NQW A;  4PCQ A;  3WTZ A;  1ZG5 A;  1GDT A;  2FEZ A;  3K4C A;  4HPQ A;  3BP8 A;  2CUZ A;  2Z16 A;  2LR8 A;  2PG4 A;  3AKZ A;  1G3T A;  2YU9 J;  1PP8 F;  2Z2S B;  4IHV A;  2VC1 A;  1A5J A;  2OD5 A;  1RKW A;  3HC7 A;  3IV5 A;  3HSE A;  1RR7 A;  1TC3 C;  3JRH A;  2HS5 A;  1VI0 A;  1Y1V J;  3IP4 B;  1HW2 A;  2HGC A;  4K2E A;  1S3J A;  3HXL A;  2R7T A;  3LQR A;  1IN4 A;  2P5K A;  3K2A A;  4EM0 B;  2DPU A;  4ZTJ A;  2IP2 A;  4HBL A;  3BJO A;  2OZU A;  2F4I A;  1Z67 A;  2F5D A;  1ZR4 A;  3ONQ A;  4XID A;  5C3E J;  3PNY A;  2LK2 A;  4CCK A;  2LMD A;  1BIA A;  4EEF G;  2ZXJ A;  2RNJ A;  4IJA A;  2HXO A;  1KU3 A;  4D7M A;  1X1A A;  2VKV A;  3FXJ A;  3T8R A;  2K02 A;  3Q5F A;  3GBG A;  4M6X A;  4B3A A;  1ETO A;  3FXL A;  3OWT A;  3DTK A;  4V2F A;  3QWL A;  3D1N I;  1SD4 A;  1KQ0 A;  3DBL B;  4RGX A;  3CCE I;  3I4M J;  2PMZ A;  4BU2 A;  2XF6 A;  1YW8 A;  3PUF A;  1D1C A;  1E2X A;  2DA1 A;  2CUE A;  1ZN2 A;  2RVC A;  3BJA A;  3KYL A;  1QRY A;  2PFB A;  3BQZ A;  2KDZ A;  1O7L A;  2LNB A;  3DP7 A;  1IG7 A;  1Z05 A;  3IWZ A;  2HOS A;  1Z77 A;  5K5Q A;  2QVO A;  3ISP A;  3P9K A;  2VQG A;  1K6Y A;  5EF6 A;  3EUH A;  3IH3 A;  3TDZ C;  3S1Q J;  4XNF A;  4D0P A;  3PJR A;  1K83 J;  3WE2 A;  4Y4R A;  2PJR A;  1X3Z B;  1A04 A;  2VKE A;  3P9I A;  5DD8 A;  4CDG A;  2Z99 A;  3GLL A;  3HIF A;  1W36 D;  3S2W A;  5JR3 A;  1B9M A;  2F48 A;  5B66 C;  2GOX B;  3BLY A;  5IOY A;  3BR2 A;  2E1C A;  1JJ6 C;  4EVI A;  1B72 A;  2M8G X;  5EEA A;  2ISY A;  2A6H F;  3GF2 A;  1V5F A;  2E36 A;  2KMU A;  2VI6 A;  1T0F A;  2M45 A;  4DQ2 A;  4P55 A;  2K40 A;  1GXP A;  2IS2 A;  4N9I A;  1SEU A;  3LA7 A;  2RKH A;  2IAI A;  3IH2 A;  1YX5 A;  4PUS A;  4OAY A;  4PFO A;  2LOO A;  3GTL J;  4FX0 A;  1U8B A;  1GHC A;  1MMA A;  1Y0N A;  1XTA A;  2AQF A;  1BOA A;  2JVH A;  2V6C A;  1WJE A;  3JRA A;  2K85 A;  5M5Y J;  5EGO A;  2A6T A;  3BG5 A;  4IEJ A;  1H9T A;  4DNC A;  3KP7 A;  3DFG A;  4RM3 A;  5D5X B;  2J5O A;  3SZP A;  3LSG A;  1FJL A;  1RZ4 A;  4OIR F;  5B3S H;  4AC0 A;  3DPT A;  3GLX A;  3RI4 A;  4Q4Z F;  3ZMZ A;  4J00 A;  2JQ7 A;  1BOB A;  4JYK A;  4XSZ F;  2MBF A;  2FUG 2;  4JBA A;  2EWN A;  1TT5 B;  2D1H A;  1V5G A;  3MAJ A;  4ON0 A;  3BQY A;  3L09 A;  2DOD A;  2PMZ N;  4IO9 F;  1VFC A;  2DFI A;  1IV6 A;  1HDD C;  5GPC A;  5D8K B;  3DLL F;  3WE3 A;  1B1B A;  2IA0 A;  3J81 Z;  2DT6 A;  4OWR B;  3WHC A;  3IRR A;  5JLX A;  4AD9 A;  4FE4 A;  5HNF A;  1JTX A;  3OYL A;  4XRS G;  3CCM I;  3TW7 A;  2K4J A;  5KNL A;  1MSF C;  2KIU A;  4XBF A;  2A5W A;  3ZQF A;  3CCJ I;  2QBY B;  3WOD F;  2FQ4 A;  3LA3 A;  4FT8 A;  1LVA A;  4N4N B;  3A01 B;  4CUG A;  1C0W A;  2K3F A;  2HDD A;  3RKY A;  4E7I A;  4I01 A;  2P5L C;  3TDU C;  2OQG A;  2V26 A;  2XAU A;  3G73 A;  4G8X A;  4I09 A;  1LEA A;  3DXJ F;  1ENH A;  4L0Y B;  2W48 A;  4HF1 A;  4HX8 A;  4B48 A;  4A69 C;  4GFB A;  2QQ8 A;  1PJR A;  5GPA A;  1YIO A;  5B1B H;  2LKX A;  1OMI A;  2NRA C;  4A3C J;  1IRG A;  2B7E A;  1R00 A;  3I55 I;  4M3E A;  3U1K A;  2FBH A;  4KT5 C;  4I7H A;  3F22 A;  1FYK A;  3C2H A;  2R92 J;  1BM9 A;  3H5R A;  2DOF A;  3OYG A;  1VQM I;  1WI9 A;  5JI6 A;  2EA2 A;  3CME I;  3H92 A;  2CUJ A;  2BE5 F;  3EPZ A;  2A5Y B;  2F5E A;  1V3F A;  4WCG A;  1Q1H A;  4N4O B;  5M5X J;  2KZG A;  2EIL H;  2R3S A;  3IL2 A;  2NVU B;  2G0E A;  3ZMD A;  1NH3 A;  2L9N A;  3HYI A;  4A12 A;  1OR7 C;  2V9K A;  2V9P A;  2CQK A;  1RNL A;  3ZR8 X;  5KHD A;  1VQ7 I;  2IS1 A;  3VYR B;  2WTE A;  3HKZ A;  1ETQ A;  1U5T B;  1ZYR F;  1IXR C;  3M8F A;  2DA6 A;  4OMZ A;  1X2N A;  4C3J J;  4LJZ F;  4U0W A;  3OYM A;  3OV8 A;  3MMY B;  3WTV C;  1I3A A;  5AON A;  4R79 A;  2HOT A;  2O8K A;  3F0C A;  3ZQI A;  3MCZ A;  2HKX A;  3I71 A;  1YS6 A;  1X58 A;  3TGN A;  2NVY J;  4FIS A;  2XB0 X;  5BNG A;  1HBX G;  3LMM A;  2VXD A;  2ZXI A;  2GA2 A;  1YJ9 I;  2HQR A;  1RRJ A;  1XSV A;  4U88 A;  1HA8 A;  4LK1 F;  3HEF A;  4ANJ A;  4XRS A;  3B6C A;  3F8N A;  1YLF A;  5FFZ A;  2XC7 A;  1WFX A;  4KMU X;  1O7F A;  4RAG A;  3BR3 A;  3K4K A;  4HF0 A;  4HNV A;  4BDZ A;  1GV2 A;  2GBY A;  4E4H A;  2NS0 A;  5HOD A;  2E35 A;  2DN0 A;  2RQQ A;  2JA8 J;  2F6C A;  5LGU A;  4BQA A;  3SQN A;  2UWM A;  4LLG F;  1FT9 A;  1SFU A;  2QKL B;  1SAN A;  3W6K B;  1P7I A;  3BPX A;  1NHA A;  2H6B A;  1OCZ H;  2XRN A;  1X3U A;  1WHU A;  4A6E A;  5J8F A;  2ELH A;  1KON A;  3PM1 A;  1OFC X;  1N77 A;  2WB1 A;  4UUS B;  3CO7 C;  3G1O A;  1FZP B;  4LB6 B;  4B47 A;  5KAI C;  4KMF A;  1A6Q A;  1MD0 A;  1Z7L A;  3LA2 A;  2LH9 A;  1XCB A;  4RDU A;  3QYB A;  1KU2 A;  1IN6 A;  2LKP A;  3FZV A;  1YJW I;  4KUM A;  2X1D A;  3ZMT A;  2VE9 A;  3E5X A;  2R5Z B;  4BQO A;  1DDN A;  3CCU I;  3HKZ N;  2KJB A;  2VPR A;  4C3H J;  3WTT C;  3BG9 A;  5H20 A;  4MHG A;  5IP6 A;  3C3W A;  2R7Z J;  4WX9 A;  4BGD A;  3ZN0 A;  1Z6T A;  2YUS A;  5CKT A;  1VQN I;  2NXN B;  4JX6 A;  3K70 C;  1POG A;  1PYV A;  2DMP A;  3GX4 X;  3HOZ J;  1MBH A;  1FY7 A;  2A07 F;  5CVR A;  1A35 A;  4RAZ A;  1ZAR A;  3OMY A;  1ETV A;  1P4A A;  3UKG A;  3H0D A;  2QF7 A;  3P5J A;  5ILU A;  3I53 A;  3RQ4 A;  3O2P E;  1QQI A;  4HX7 A;  1U78 A;  3KEY A;  4CSW A;  2L02 A;  3PNV A;  2DOE A;  4M73 A;  5JVG F;  5F08 A;  3SZT A;  2H09 A;  3RPU D;  1VQ5 I;  3HOS A;  2KP6 A;  1UG2 A;  4XQF A;  1IN8 A;  2MC3 A;  3LAJ A;  4J01 A;  3ZQL A;  3QPH A;  2BYV E;  1EF4 A;  1ETK A;  1SMY F;  1UEL B;  3TBI A;  2VBY A;  4XRF A;  1ZK8 A;  2KFD A;  4DOZ A;  1IXC A;  2DBB A;  3OYA A;  3DTE A;  1IC8 A;  2J5P A;  3BTC A;  1ORK A;  1S7A A;  3W2W A;  4L18 B;  4IX7 A;  2R7D A;  1KU9 A;  4TV7 A;  2X48 A;  4Y52 J;  2R93 J;  3OS0 A;  2VJ5 A;  4A3M J;  1JUM A;  4FTH A;  4PDK A;  2PJP A;  3G3Z A;  1BI2 A;  3QAH A;  2L4A A;  1N78 A;  1R23 A;  3BY6 A;  3NEU A;  4M9S A;  1DPR A;  1T08 B;  4P9U A;  3QU3 A;  2YS9 A;  3CUO A;  3OYH A;  3CJR B;  2O3F A;  2R7R A;  3M4O J;  4DYQ A;  4EGZ A;  1OJL A;  3G2B A;  2XGD A;  1T98 A;  1LFP A;  2HYF A;  3KP2 A;  1OCR H;  2ECC A;  1W1W E;  2R7W A;  1D1B A;  2QEN A;  4ESF A;  4I0A A;  4LB5 A;  2KKO A;  4I76 A;  5CVV A;  3BTJ A;  4I99 C;  3P7N A;  4OOI A;  2EB7 A;  2VAS A;  3FK7 A;  5KAF C;  4WXH A;  4HAM A;  5F6F A;  1USS A;  4C9Y A;  2QQ9 A;  3E6D A;  1MNM C;  1WJ5 A;  5L3E A;  4U0V A;  4QIW N;  2L2O A;  1DGW Y;  2FML A;  2DFF A;  4CCJ A;  1HDP A;  2FU4 A;  3KX2 A;  2XPW A;  3S2D J;  3M7G A;  2PJR B;  4A3E J;  3Q9V A;  1D1A A;  3FIW A;  4CHU A;  2X1C A;  3K7A J;  4UY8 I;  1X1B A;  1ZGA A;  1WQ2 A;  1WVR A;  1E3P A;  1HLV A;  1YIT I;  4EJU A;  2CW8 A;  4M3D A;  3IWF A;  1JHH A;  1TNT A;  3TW6 A;  1QZE A;  2VBZ A;  3Q0W A;  2EIK H;  1H89 C;  1KU7 A;  1B72 B;  3GTQ J;  1T39 A;  3HOW J;  3I56 I;  3OOU A;  5FKO A;  1BW5 A;  3HJE A;  2H27 A;  3CD6 I;  3J7Y J;  2COB A;  2EA4 A;  4C3I J;  2ESH A;  5B5E C;  3HPH A;  2DU9 A;  3A03 A;  5FKM A;  2ZME C;  1L3L A;  3A02 A;  3I3L A;  3E97 A;  4HW0 A;  1KYZ A;  4OU0 A;  2B63 J;  1U5T C;  2QKM B;  2FOK A;  2MGQ A;  4BHP A;  5EGO B;  4A6D A;  2ESN A;  1J2X A;  2DK8 A;  4NC6 A;  2BBY A;  5ED4 A;  2HR3 A;  2M7B A;  4O3M A;  5L3C A;  2UUZ A;  1P9Q C;  1J0R A;  1WPK A;  3MN2 A;  2HFH A;  2P81 A;  1U8R A;  4D9J A;  2FJ1 A;  1RPW A;  1LFB A;  1KYW A;  1OYW A;  1HF0 A;  3QPL A;  6PAX A;  1QHH D;  2ME0 A;  2MFZ A;  4YEL A;  5IY5 H;  3JRC A;  5M5W J;  3K9T A;  1JUP A;  2VQL A;  4GYG A;  3L2C A;  1DUX C;  4PGG A;  1VQ8 I;  1YTY A;  2CQ7 A;  3QYF A;  5A2Q K;  3DLA A;  4Y13 A;  1S29 A;  1K78 A;  2M7A A;  1Z91 A;  3AL0 B;  2F2E A;  3GTO J;  4YIF A;  4L5J A;  1LDK B;  5HOO A;  2JMW A;  2X85 A;  2FXA A;  1ZR2 A;  1F9N A;  3KCC A;  3CCL I;  2M5W A;  3FDY A;  5LFA A;  3OOP A;  2HNH A;  3L7W A;  4R1H A;  2MA3 A;  3EUA A;  1YX3 A;  1DP7 P;  3K4N A;  2AS5 F;  3KE2 A;  3CMA I;  2LP0 A;  3ZQQ A;  5E1Z B;  3WTU C;  2AXT C;  4F92 B;  1R1T A;  3OY9 A;  1R4N B;  2IGN A;  1E3H A;  2XAH A;  2RQP A;  4S0H B;  4I6Z A;  2R7Q A;  2WV0 A;  1QHG A;  2ZO4 A;  3V8K A;  3G71 I;  2VLA A;  4OIN F;  2M9H A;  1IAW A;  5E3N A;  3H1C A;  4BXF A;  5H2F C;  4A93 J;  2CYY A;  4ZDO A;  2DMQ A;  1HW1 A;  1JKO C;  3GUD A;  5M3M J;  2O03 A;  5K1Y A;  4WK8 F;  3V42 A;  3C2B A;  4AM3 A;  4UUS A;  4JK1 X;  2RNG A;  2XKP A;  1TWF J;  4B4C A;  1S9H A;  3I58 A;  4W1U A;  1X4O A;  2R7S A;  1J5Y A;  4A5M A;  1U6G A;  2LG4 A;  3B02 A;  2CMP A;  1CGP A;  5IP9 J;  4DGW B;  1Z7U A;  3OS1 A;  1QA6 A;  2O7O A;  4GYI A;  2XRL A;  4F91 B;  3ELK A;  2IPQ X;  3I5U A;  3COA C;  3RDI A;  1H8A C;  3SDB A;  4CCN A;  1AHD P;  5HDK A;  1ERD A;  4D7N A;  2X51 A;  3R4K A;  2E2I J;  4XLN F;  1MMS A;  2F5F A;  4DJA A;  3MKY B;  1X2M A;  5FJ8 J;  2ACJ A;  1STZ A;  4A3L J;  5E1X A;  4CYC A;  2F4M B;  4LOC A;  4ZZL A;  1K7A A;  2HDW A;  1VQ4 I;  2W84 A;  3H9Q A;  2ICW G;  4QTR A;  1NG7 A;  1WJD A;  5DM7 F;  1OYY A;  3V8L A;  5HS8 A;  5K5O A;  5E8I A;  3F9K A;  2DFE A;  3PFI A;  2KRH A;  4Q47 A;  2UXX A;  1Q1V A;  4I02 A;  4ENK A;  5EEH A;  1ZAO A;  4NC8 A;  2DA2 A;  1O3T A;  1IJW C;  1NTC A;  3H9J A;  1MKM A;  1SD5 A;  3LSM A;  3QP5 A;  2LRE A;  3MEX A;  3M3Y J;  1TQI A;  3JW4 A;  2L7M P;  2BHZ A;  1FBS A;  4CH7 A;  5L3G A;  4IHY A;  3FMS A;  4IHS A;  4RLQ A;  4ZZD A;  1A6I A;  4IVN A;  3WU2 C;  1WKM A;  5ILV A;  2FNP A;  3QPS A;  3KIO A;  1LJ9 A;  1ZG3 A;  5IP7 J;  4KT6 A;  4KIG A;  3HTU A;  5HDN A;  3LOC A;  1LKX A;  2YU3 A;  2OF7 A;  3CP8 A;  3K0L A;  2KHM A;  3MVP A;  2ZBK A;  3L2W A;  2AHQ A;  2X6X A;  5IT3 A;  2E71 A;  2DOA A;  3HSR A;  4CCL A;  3SEZ A;  4I0B A;  4M3G A;  2WWY A;  4KA4 A;  4HQE A;  3J80 K;  1SVO A;  3V7C A;  1CQT A;  1Z3Y A;  3HOX J;  1XB4 A;  2FE3 A;  3K1P A;  4UB6 C;  3E1S A;  1QZY A;  4XOP A;  3ML6 A;  3DEW A;  2V79 A;  4IRG A;  3OYF A;  3CUQ A;  5LGN A;  3LSJ A;  4EM2 A;  1IDZ A;  2HYG D;  2BVM A;  1ETY A;  2EJR A;  2R7X A;  2CSO A;  2M4G A;  3LSH A;  2XGC A;  3SFI A;  4I2O A;  2LY9 A;  1Y56 A;  1RET A;  1I6H J;  5J1U A;  4AUX A;  3HUG A;  4NB5 A;  3EUH C;  2ZXH A;  1WSU A;  3L00 A;  1MND A;  1O4X A;  2FBK A;  3E7L A;  2CFX A;  5J4V A;  3CC7 I;  1TWG J;  1L0O C;  4XM3 A;  2CW7 A;  3CCS I;  4U7D A;  4E70 A;  1XD7 A;  2XPU A;  2M34 A;  3RPU A;  3HG9 A;  2FNA A;  1SD6 A;  1Y0U A;  2MAB A;  3EYY A;  2OAZ A;  2K9Q A;  1OLT A;  1U3E M;  1OCP A;  2E7X A;  4HOB A;  3ABM H;  1U9O A;  1HQC A;  3PSI A;  3TO6 A;  2Y2Z A;  1T0F C;  2IA1 A;  1IO2 A;  2V6E A;  3ZCO A;  3KLN A;  4DIQ A;  2V1X A;  3WGI A;  2JSP A;  5KK1 A;  2XDV A;  2HTS A;  4RGR A;  4LGW A;  3C2G A;  3TED A;  1D0Z A;  4XK4 A;  1Z6R A;  3L2Q A;  2DA3 A;  3K10 A;  4M6Y A;  3ZP5 A;  5F04 A;  1UZC A;  1VQO I;  3QU6 A;  1MMN A;  1IRF A;  1TW3 A;  1AOY A;  2ME6 A;  3B73 A;  2F5C A;  4RLF A;  3M1C A;  4BHC A;  3KYD B;  3VB2 A;  4XN0 A;  2EFQ A;  5DD4 A;  2P8T A;  1FOW A;  3R0A A;  1H0M A;  2CV2 A;  1QPM A;  2QCO A;  2EFP A;  2JN6 A;  2F4O B;  2ZJP F;  2UV1 A;  2XF5 A;  1G2H A;  3ECH A;  1P4W A;  4IF4 A;  5AIP A;  2A6E F;  3T0Y A;  4XLP F;  1VTN C;  2QSH X;  1AU7 A;  4DBQ A;  2JRT A;  2Z1D A;  3M8E A;  2JPB A;  2QA4 I;  2ID3 A;  4X1E A;  4H0E A;  3CCQ I;  2QSG X;  3AL0 C;  1TNS A;  1V5E A;  3I64 A;  2QEX I;  4MLO A;  4E7L A;  2WBM A;  3ZPL A;  3FKJ A;  2DAO A;  3ABU A;  1ZEL A;  1LPQ A;  5FRO A;  4HG2 A;  4O6J A;  4M72 A;  3M9A A;  4EV0 A;  1LUJ B;  3GZ5 A;  4UV8 A;  3O3K A;  1Y8Q B;  2GLO A;  1LDJ A;  1D5V A;  2X6Y A;  2FRH A;  3DV8 A;  3OYN A;  2DA4 A;  3OYB A;  4EM1 A;  5LEK A;  4J19 A;  1S5L C;  2ZSI B;  1GVD A;  3L2U A;  2IJL A;  3ZMV A;  3QYE A;  1ZTR A;  1YYV A;  1WCM J;  2XUB A;  1O3Q A;  2M87 A;  5D5V B;  1FP2 A;  5DS9 A;  4ZJZ A;  2CRG A;  2IRF G;  2W25 A;  2COM A;  4YG2 F;  3BT9 A;  1V4R A;  3R6S A;  3ZN1 A;  3KEO A;  3VSK A;  3MFK A;  2WAE A;  1HC8 A;  2LLK A;  1WJC A;  1OYI A;  3O8H A;  1KGS A;  3Q9S A;  4HQM A;  2EIJ H;  1FEX A;  3OSG A;  4A3G J;  1GT0 C;  1K4S A;  2JTV A;  2ZNY A;  4XKB A;  1OCO H;  4CYD A;  2A69 F;  3NWS A;  4AVP A;  4ENJ A;  1S6L A;  4L9J A;  2ELK A;  2WY8 Q;  1G59 A;  2GAU A;  3KZI C;  3LSK A;  4RGU A;  2IVM A;  2IEK A;  3REO A;  2KDO A;  3TOA A;  3U9G A;  4Y15 A;  3LSI A;  2KPM A;  4QWQ A;  4B44 A;  4BH9 A;  2MD0 A;  2HZT A;  2IGO A;  3TMO A;  1UHS A;  4GCV A;  3AG3 H;  4EGY A;  3FWE A;  1FIA A;  5FKK A;  5A2Q Z;  2OTJ I;  4XLC A;  1FNN A;  2OTL I;  2RGV A;  2F5V A;  2JJ7 A;  1FWZ A;  2X1E A;  4Q5S F;  3BR0 A;  3H35 A;  2G9W A;  4LK0 F;  2MH2 A;  5BMZ A;  4PJN A;  3S1M J;  3N05 A;  3JSP A;  2L9S A;  1F4K A;  2BY2 A;  2VJ4 A;  4RM2 A;  3Q0V A;  3ABT A;  2UXN A;  1MJ9 A;  3HBL A;  4LLL A;  1EH6 A;  2AQE A;  2XF7 A;  1MSE C;  4OIQ F;  2K3P A;  4E7J A;  5ILS A;  4Q48 A;  2GXB A;  4BL0 B;  3TO9 A;  2V1U A;  3BR5 A;  2EFN A;  1XG1 A;  3JTH A;  3GVA A;  3HB9 A;  1XMX A;  1U9N A;  4ZYA A;  2JA5 J;  2FSW A;  2M30 A;  3KZZ A;  1X1P A;  3DBH B;  4B3X A;  3JAM K;  2OV7 A;  3F21 A;  1BC7 C;  4FAS D;  5CQE A;  4WXD A;  1K79 A;  5IYC J;  3F6O A;  3RKQ A;  1SAX A;  4Y3O A;  5DCM A;  4JOM A;  1O3R A;  2NVT J;  3FBI B;  3ASO H;  3NQO A;  3OIP A;  1K78 B;  1XC5 A;  1TWC J;  5FRM A;  3KP4 A;  1R6R A;  2NYX A;  1D8J A;  3JRG A;  3CP2 A;  2CS3 A;  1FOY A;  2BEO A;  2W1O A;  3ESW B;  1RI7 A;  3E3V A;  4XKV A;  1KA8 A;  3HZJ A;  2G7H A;  3S1R J;  1K61 A;  2OC6 A;  2IGK A;  3H0G J;  3CTA A;  2RN7 A;  2XSD C;  2M0M A;  4PJ0 C;  4JQF A;  1BIB A;  4A0Z A;  2I5U A;  2WAQ N;  1W5C C;  3S16 J;  4BE0 A;  3OYC A;  1TTY A;  2W00 A;  2PN6 A;  1T33 A;  3A2K A;  2GXA A;  2EPF A;  5H6Q A;  2NS8 A;  1IDY A;  4UUV A;  2LTP A;  5D8L B;  5B1A H;  3N97 A;  3E5Q A;  2O61 A;  2X6W A;  2HQ5 A;  2XRO A;  3OYI A;  2V1D A;  1G8X A;  4CGZ A;  2E5Z A;  2M1B A;  4BE2 A;  2EBI A;  2GIV A;  1VND A;  5FD6 A;  4M71 A;  4UUT A;  2R5Y A;  1VQK I;  2HVR A;  4QLC U;  3JSO A;  2XKO A;  4XSX F;  5TJJ A;  4A0Y A;  4KIT B;  5IOZ A;  1DPU A;  5JVT A;  2LY2 A;  2P6S A;  4OMY A;  5EZH A;  3FM3 A;  4BY1 J;  1QVU A;  3MD2 A;  1XN7 A;  3CDI A;  3G1L A;  3GW2 A;  3QRF F;  2NVX J;  4HDV A;  3K6G A;  2E2H J;  1B4A A;  4CYC B;  2L3D A;  4ITV A;  1FBU A;  4WWC A;  1YW7 A;  2STW A;  3VYU B;  3VOD A;  4BUP A;  4BXX J;  4YEJ A;  4WF2 A;  3N4M A;  1RIO H;  4II2 A;  3VWB A;  1I3Q J;  5LD2 C;  1EH7 A;  2BHY A;  1BBY A;  3WU0 A;  2EIM H;  1ZRF A;  1TP4 A;  2O6G E;  2OUM A;  4Y17 A;  4IRI A;  1E3O C;  1W4M A;  3OYD A;  3KFW X;  4CIC A;  3WGG A;  3TOB A;  1T95 A;  5L3F A;  1Z3X A;  2WAD A;  2QWW A;  4OAZ A;  3V8J A;  3LSR A;  3BJ6 A;  5D5U B;  4II3 A;  3QOP A;  4NUB A;  5J8C A;  1OPC A;  5F1R A;  1MH4 A;  3E6M A;  3CC4 I;  1B59 A;  3L2V A;  2VQC A;  1R49 A;  2W85 A;  4PJJ A;  3V7S A;  4B09 A;  2STT A;  3BTL A;  2FQ3 A;  2Y75 A;  1SFK A;  2RV8 A;  3CES A;  3U21 A;  4W97 A;  5K5R A;  2HXI A;  3NWT A;  1FX7 A;  3W6V A;  2DYS H;  3GTG J;  3M07 A;  3FXR A;  2YR2 A;  2EIN H;  4AWX B;  3GEZ A;  5GAE J;  1CF7 B;  4M6V A;  3GWZ A;  1F36 A;  2JA6 J;  4HA8 A;  3RKX A;  4ETS A;  4D5C A;  4D1Q A;  2N8G A;  4DZP A;  5HLI A;  3T8T A;  1Y8R B;  1Z1D A;  1V54 H;  1QVT A;  1MBJ A;  2JUG A;  1YE9 A;  4MO7 A;  2DT7 B;  2JUC A;  3CUQ B;  2DA7 A;  2HQN A;  1PUE E;  3SXY A;  5GTH C;  4G6Q A;  1XGO A;  3DPL C;  3ZOB A;  4XOR A;  1K4T A;  1HKQ A;  1WWX A;  3OSF A;  3FF5 A;  1TZL A;  1S7O A;  2GM4 A;  4B8X A;  2VON A;  3LAP A;  3HUG B;  2JA7 J;  2TRT A;  3IHU A;  1Z9C A;  5ERI A;  1ZGW A;  4M9X A;  1LVK A;  3A4C A;  2ZFU A;  2XAQ A;  3D5S C;  2C6Y A;  4KIC A;  2KQR A;  5JLW A;  1BJZ A;  3FXM A;  4HV5 A;  2XIG A;  2CWE A;  4BJ6 C;  4A3J J;  4GRI A;  4MTD A;  3K4M A;  4XKW A;  4BHB A;  2VJI A;  1UJ8 A;  3I59 A;  1OCT C;  1RES A;  2LF8 A;  3FXU A;  1O57 A;  4LG0 A;  5JHU A;  3UNG C;  1IW7 F;  1WH7 A;  5J40 A;  2IT0 A;  5ICG A;  3EYI A;  4FX4 A;  3JRI A;  4QPQ A;  2O0Y A;  3S93 A;  2JWT A;  3Q0U A;  3GME A;  5LBQ A;  2EV0 A;  2Y48 A;  5TRD A;  4AIJ A;  3S1N J;  5J1R A;  4ZYE A;  4RB2 C;  2XAJ A;  3LFU A;  4P1W A;  4XON A;  1WZ2 A;  2DLL A;  4NHJ A;  4C2M J;  2Y30 A;  2OZ6 A;  3AFH A;  3BCB A;  4DBR A;  4UB8 C;  1JKQ C;  2VOP A;  3ECO A;  2M2E A;  1FIP A;  1TT0 A;  2EV5 A;  5GAH J;  2BGC A;  3I9V 2;  1AKH A;  2Q2E A;  1IXS B;  2X9D A;  3I4P A;  5TIS C;  4LFU A;  1W7P D;  3F3X A;  3QOD A;  1P4X A;  2XSJ C;  2BXY A;  3NAU A;  1NK2 P;  2YX7 A;  3J81 K;  1UB9 A;  3CDH A;  2HI3 A;  4E7K A;  1ONV A;  4G94 A;  1M1E B;  3RZO J;  1WJA A;  3HPG A;  3IH4 A;  4MFD A;  2ZKZ A;  3T1B A;  2CV1 A;  3VDX A;  2DQR A;  4AIH A;  1VQ9 I;  2DJI A;  4AYB N;  3IAS 2;  3W2A A;  2HVQ A;  2MSY A;  3ZQC A;  2PBI A;  4EMS A;  5HNH A;  1UFM A;  2BVL A;  2DI3 A;  2HU9 A;  2Z33 A;  1XGN A;  1LDD A;  2GA1 A;  4GDF A;  2XVC A;  4HRI A;  3VEP A;  1RUO A;  2BY0 A;  4UV9 A;  5E20 A;  3MZ8 A;  2OJE D;  5LHG A;  4FE7 A;  3TP3 A;  1BI3 A;  2Y0S A;  5DUK A;  1MZB A;  2Y69 H;  4EJO A;  1X3W B;  1F1Z A;  4S04 A;  2NOJ B;  1IZ1 A;  3DU6 A;  4A3F J;  2DCE A;  1PDN C;  2H1K A;  3OIQ A;  1PUF A;  4OIO F;  2HOA A;  5FLM J;  3TL4 X;  2MLK A;  4G7O F;  3CC2 I;  1ACI A;  2YSR A;  3E5U A;  2VIX A;  3S32 A;  2VE8 A;  4ESB A;  1VQ6 I;  3MWM A;  2GOM A;  4CA0 A;  3U1D A;  1JT0 A;  3W2V A;  4EQQ A;  3RSN A;  3HOT A;  4XLF A;  2ZCW A;  4KIF A;  1BW6 A;  5FLX K;  3BWG A;  3PUB A;  4IQJ A;  3LWF A;  4YRV A;  2K9S A;  1SFE A;  1FOK A;  2PI0 A;  1QBJ A;  4PK4 A;  3F8B A;  5IT9 K;  4DYR A;  4Y33 A;  1TWA J;  2DMU A;  4L5I A;  4MFE A;  4RB0 A;  2LBF A;  3EDP A;  3G6E I;  1R71 A;  1FOX A;  2OBP A;  3OS2 A;  3RYP A;  3CCR I;  5IYB J;  1WJF A;  4BJT A;  5LLQ A;  2E1O A;  3CMM A;  4HNT A;  3WTW C;  3CLO A;  2PQ8 A;  5ICE A;  2B0L A;  1U0J A;  1IF1 A;  3IKT A;  1HXD A;  1T38 A;  2HWV A;  1UCR A;  2M4K A;  3JR9 A;  1ON2 A;  3S8P A;  4HV6 A;  2HQA A;  2QYO A;  2W4S A;  3FXQ A;  1D8K A;  3DQV C;  3BTI A;  3JAM Z;  3FXK A;  2X0L A;  1T56 A;  3LSP A;  2XB5 A;  2JRM A;  1ETX A;  1JKP C;  3IC7 A;  5D5W B;  3AAF A;  4HLY A;  2CH0 A;  3SYT A;  3O6B B;  5HS9 A;  2EFO A;  1IRZ A;  3FM5 A;  1TLH B;  3FX3 A;  2AO9 A;  1ETW A;  2VT3 A;  1KQ9 A;  5EYR A;  2IA2 A;  4L9V A;  2MYS A;  2Y9Z A;  2HDC A;  2DQL A;  2KL4 A;  4V2G A;  1IUF A;  2H8R A;  1MDM A;  1ZKG A;  4HNU A;  3VYS B;  2RC4 A;  2Y0S N;  2A68 F;  5K7Z A;  2W82 A;  4BAC A;  4IHW A;  2R7V A;  4AIK A;  1P6R A;  3A0H C;  5FLV A;  2XAS A;  3ASN H;  3CQZ J;  2E1M B;  3HOU J;  2H94 A;  3JRD A;  2Y31 A;  1QPI A;  2RAE A;  3WU1 B;  4HLX A;  4PGH A;  2G7U A;  4KFC A;  4G9Y A;  2PX9 A;  4M3F A;  3VPR A;  3WTX C;  3C1D A;  4PZJ A;  5LGT A;  5DCM B;  1R5H A;  5J1Y A;  4NC7 A;  2VPL A;  3K4J A;  2K4B A;  2W7N A;  5EZG A;  3ABL H;  3KZY A;  1MJA A;  2E5N A;  2TCT A;  3S17 J;  4F7Z A;  1UHM A;  1K6O A;  2GQQ A;  3GFL A;  4JX5 A;  4MGR A;  3BPV A;  3RTR A;  3RYR A;  4DYC A;  1AWC A;  3I4N J;  2CQN A;  2JA2 A;  3F72 A;  2ZFW A;  3CMY A;  1EKE A;  1ZG1 A;  1CF7 A;  3CUQ C;  1MBG A;  4CCO A;  2XPV A;  1UHW A;  1MIJ A;  2FA5 A;  3K69 A;  5EJC A;  1YHQ I;  2DDA A;  4DZJ A;  4BE1 A;  2KIS A;  3Q3S A;  4HZF A;  1FMV A;  2EQR A;  3MKZ A;  2BV6 A;  1B8I A;  1BA5 A;  5GAG J;  2EZH A;  3U2R A;  2EV6 A;  2PLY A;  2DTR A;  2OA4 A;  2VJJ A;  5ICF A;  1VQL I;  5L3B A;  2DYR H;  2K86 A;  2DDB A;  2LRD A;  1BI0 A;  2YX4 A;  5F27 A;  2HTJ A;  2FF4 A;  2ZB9 A;  5KVR A;  3K70 D;  5BQT A;  5F0H A;  1HST A;  4L9N A;  3OYK A;  2JPC A;  4L9T A;  2R5Y B;  1J7K A;  2BOL A;  3E0J B;  3OL3 A;  3FHZ A;  4RA2 A;  4A3K J;  1R1V A;  1YG2 A;  4A5N A;  3CCV I;  3H9G A;  5BS6 A;  3PSF A;  2L01 A;  4BAY A;  1P2F A;  3K4L A;  4MTE A;  2DTZ A;  2ISZ A;  4C2U A;  4UVB A;  4IQ4 A;  1YI2 I;  1MGT A;  5HVQ C;  2MC4 A;  3VFZ A;  3ZQH A;  2L4M A;  4G6T B;  2CU7 A;  4PFP A;  2CGP A;  1MMG A;  3PO3 J;  1H88 C;  3K1M A;  3K2Z A;  4LIT A;  1OIS A;  3VOE A;  1QNT A;  2JSC A;  3ZQG A;  1G6N A;  4F55 A;  2NNY A;  3W6J B;  4G7Z F;  1O3S A;  3FHN A;  4Z6Y A;  4IHT A;  2D45 A;  3JRB A;  4OIP F;  3T5X A;  3CDL A;  1EV7 A;  2XV4 S;  5GP9 A;  4BDY A;  2PMU A;  4LLN A;  4PJL A;  2VC0 A;  5E79 C;  4M74 A;  1HOM A;  5C4X J;  2NOG A;  2HVS A;  4ZDL A;  5K7H A;  2ELJ A;  4BBS J;  3WTY C;  3F8M A;  4UVA A;  2P0W A;  3ROU A;  2X6O A;  2DMN A;  3HSF A;  1PP7 U;  3TKY A;  2K9L A;  4BQQ A;  2O9L A;  3RZD J;  3QPT A;  1IRX A;  2K9N A;  3GFM A;  2NAZ A;  4YII A;  1SVL A;  2XAG A;  4KJZ A;  1ULY A;  1LE8 A;  3S3N A;  4BYY A;  1J09 A;  1FPQ A;  3LL7 A;  4RMN A;  3WG7 H;  3CZ6 A;  3EQL F;  2D2W A;  2RDP A;  4P5O A;  9ANT A;  2BW3 A;  2P7V B;  1TW2 A;  5F64 A;  3GFI A;  4RAY A;  3ULQ B;  1QZZ A;  1JJ8 C;  2MG4 A;  1RR8 C;  1JUS A;  2CO5 A;  2Y9Y A;  3OYJ A;  1UG0 A;  4ZYG A;  3PIO F;  2XGX A;  3HRM A;  4RB3 C;  1SMT A;  3GO5 A;  2XAF A;  4G12 A;  4IXA A;  4KIB A;  4YFK F;  2ZJQ F;  2O5R A;  3E6C C;  1ZH5 A;  2UZK A;  3R61 A;  3S2H J;  4U0Y A;  2Z5U A;  2M0C A;  2QQB A;  4BXU A;  3J7A Y;  3FK6 A;  3C7J A;  5D6F A;  3JTG A;  4IZZ A;  1Z0X A;  1G4D A;  3BOQ A;  4LIV A;  2CV0 A;  5EEG A;  4HSR A;  1G3S A;  4AID A;  2CW0 F;  5E17 F;  2YPR A;  2XGE A;  5AIQ A;  1JXS A;  3HDD A;  1YIJ I;  3PIP F;  1LB2 A;  3PFY A;  3G4S I;  1NG6 A;  3M1E A;  3EET A;  4B1R A;  3FMR A;  3KEQ A;  4XLE A;  2HKO A;  2PEX A;  3R60 A;  4KIS A;  1DU6 A;  2E7W A;  2I10 A;  5M3F J;  5HS7 A;  1MNE A;  4IRH A;  4EAT A;  2H6C A;  1HSJ A;  3H5A A;  3I54 A;  4IHX A;  1V55 H;  2LY1 A;  4U7B A;  4AU7 A;  5LHH A;  2IS6 A;  2K5C A;  2EZI A;  4ESJ A;  1FYL A;  3DBR B;  2BY1 A;  2VXZ A;  4X6A J;  2VL8 A;  1W7P A;  3I59 B;  4LD5 A;  1T8I A;  1JE8 A;  4YFX F;  3HGG A;  4LG0 B;  3FMQ A;  1FLI A;  4HEA 2;  1JTY A;  1S8N A;  3UR3 C;  1RC9 A;  2NVQ J;  1JHF A;  4HDU A;  3BDD A;  2Z3Y A;  3LQQ A;  4QSH A;  4E6K G;  1HCR A;  2QZ8 A;  3J7A O;  1BR1 A;  2OQR A;  1EA3 A;  2Q8K A;  1UAA A;  1R5I D;  1D0X A;  3WG9 A;  2WAQ A;  3PNT A;  1FC3 A;  3VYT B;  4EJV A;  1MH3 A;  2FOW A;  1ZLJ A;  3GTJ J;  2TDX A;  3S3O A;  5CVJ A;  2JZY A;  4LMY A;  4BKX A;  1XSX A;  4A3D J;  3HHH A;  1X4P A;  2A05 A;  4O5V A;  1AKH B;  2Q2E B;  2R7F A;  3CJQ B;  4MNU A;  3DKX A;  3IUO A;  5C4J J;  3LNQ A;  5FKN A;  4V19 K;  2D1V A;  1A36 A;  3ZXS A;  2E1M C;  4YIR X;  5FGM A;  5JHF A;  1RKT A;  2LKS A;  5DYM A;  5LHI A;  2JT1 A;  3RQI A;  2OPT A;  1QO0 D;  3PQJ A;  2PMH A;  3X2Q H;  3A0B C;  1ZRE A;  1MBF A;  1I27 A;  1W5T A;  1XGS A;  2AXL A;  5IPA A;  1I39 A;  2R7U A;  3AG1 H;  2GWR A;  3CJN A;  2K27 A;  4G6D A;  2QUF A;  3GZ6 A;  5ICC A;  5FLX Z;  1J9I A;  3HTS B;  2FD5 A;  1YQA A;  3IRQ A;  2WA0 A;  2VBW A;  3SZG A;  3WGH A;  3JRF A;  5IT9 Z;  3MZY A;  1S72 I;  2KLO A;  5EG0 B;  2KIF A;  1ITY A;  1YS7 A;  2ZME B;  1ZRC A;  2LSO A;  2BZT A;  2E60 A;  4HF2 A;  2M8E A;  1PUF B;  1YRN A;  4P9F A;  2WV1 A;  1GLN A;  2ID6 A;  1Y1W J;  5E3O A;  4XL9 A;  1H9G A;  3S3M A;  4NBQ A;  4XIC A;  1IUY A;  4D5F A;  1WI3 A;  1OR7 A;  2QQA A;  1J59 A;  4BEH A;  3MZH A;  1NK3 P;  2MH9 A;  3CO6 C;  4LIU A;  2QLZ A;  1LFU P;  1YW9 A;  5DTD A;  3BZK A;  4XR6 A;  3RKW A;  1QU3 A;  3GCM A;  1FSH A;  2P5V A;  3DEU A;  5DUI A;  2E2J J;  1XS9 A;  5DDG A;  5TGT A;  4ASN A;  1BR4 A;  3JRE A;  2CQX A;  1KZH A;  1TWH J;  3HOV J;  3GFJ A;  3KPH A;  4KDP A;  4HX4 A;  1XMK A;  2QGU A;  3HRT A;  3ERM A;  2VKD A;  1VQP I;  1XSD A;  3GTM J;  1W0U A;  2DW4 A;  2LBF B;  3CCY A;  1WGX A;  4P96 A;  3BZC A;  4IL6 C;  3DCF A;  4UXN A;  3B6A A;  3TO7 A;  4IOC F;  3LST A;  4RGS A;  2DPD A;  1FBQ A;  4R8H A;  3C18 A;  3RPQ A;  3BR6 A;  3OR2 C;  3HOY J;  5LRR A;  4MIM A;  1MJB A;  4BJ5 C;  5JFR A;  1D0Y A;  4KN4 X;  4L0Z B;  1FTZ A;  2P6T A;  3WTS C;  5D6E A;  3OIO A;  1SAU A;  3O8G A;  1P92 A;  5E8G A;  4H4K C;  1LQ1 A;  1LNW A;  3SHF A;  1B9N A;  1F43 A;  2KJC A;  1FMW A;  4RB1 A;  2JVG A;  3LFK A;  1X19 A;  3KP3 A;  1IN7 A;  3ZMU A;  4CZZ A;  2QM3 A;  1XMA A;  3I0T A;  1JT6 A;  3PO2 J;  1MDM B;  2HEO A;  2ZC2 A;  3R0J A;  2MW8 A;  3BR1 A;  4MQV A;  2EK5 A;  2VOD A;  1WJB A;  3DTI A;  5LEJ A;  3ZMS A;  4B43 A;  3SJM A;  1UMQ A;  2ZSH B;  4S05 A; 
#chains in the Genus database with same CATH homology
 1OKR A;  3J80 Z;  3BRO A;  1R5G A;  2FMY A;  2DT5 A;  1EH8 A;  2VN2 A;  2IW5 A;  3H3U A;  2EFW A;  3PQK A;  1R7J A;  3GYH X;  2LDU A;  3HRS A;  1R36 A;  1IN5 A;  5DCF A;  4KNY A;  2KRF A;  3RIR A;  2VBX A;  1REP C;  1HKT A;  2HOE A;  4MEX F;  1I1S A;  3TQN A;  1U2W A;  3V7R A;  2Z9O A;  3NRV A;  2L54 A;  1LEB A;  4CXF A;  1GVJ A;  2MD5 A;  4MQ9 F;  2XHK A;  1I1G A;  2O8X A;  4N0B A;  5FD5 A;  2ADU A;  2VOO A;  1SD7 A;  2FBI A;  5HLH A;  4WXC A;  2DK5 A;  3F8F A;  1E17 A;  3E6B A;  2A61 A;  1BN5 A;  4ZH4 F;  2ZNZ A;  1I6X A;  1JGS A;  1I5Z A;  4FHT A;  1T2K A;  3DKW A;  2NNN A;  1B6A A;  1TBX A;  2QBY A;  3ZQ7 A;  3P9C A;  1BJA A;  5D4R A;  3F8C A;  4BNC A;  1J75 A;  2MLG A;  3KET A;  2A3S A;  4G7H F;  1FP1 D;  5LRS A;  5E1W A;  1ZRD A;  1R22 A;  4KYW A;  5CYV A;  3V4G A;  5BPD A;  2Q0O A;  3D0S A;  2KIM A;  3H3Z A;  1XGM A;  3SFZ A;  5FFX A;  5FO5 A;  2VT2 A;  2W57 A;  1G3W A;  3HRU A;  5FB2 A;  4ENN A;  1FSE A;  2ZJ2 A;  3L9F A;  1YO5 C;  2WC2 A;  1BC8 C;  1ZLK A;  2K7L A;  3F23 A;  4UHT A;  2V9V A;  4YFN F;  3BZ6 A;  1BI1 A;  1SFX A;  1TQM A;  2ZME A;  1UST A;  1U5T A;  3IKV A;  1RUN A;  2CG4 A;  1TQP A;  4UNO A;  1HKS A;  5DV5 A;  1R58 A;  1YFH A;  4N9H A;  1ZGJ A;  4GO1 A;  4CO8 A;  4EJW A;  3KLO A;  1D3Y A;  5CVU A;  1W7P B;  4KN7 X;  1QGP A;  5HDG A;  4UVC A;  4Z2Y A;  5BPI A;  2LF7 A;  1XDU A;  5D4S A;  5E18 F;  4RS8 A;  4I98 B;  2GXG A;  2X4H A;  3D5L A;  1ON1 A;  1T6S A;  1KQ8 A;  3KP6 A;  1FYM A;  4A0X A;  1F5T A;  4MEY F;  1XCV A;  1ODD A;  1R1U A;  4ENM A;  5DEQ A;  1W5S A;  4ZYH A;  2P7C B;  1G3Y A;  4HYE A;  4M9Z A;  5HLG A;  3HHG A;  4ZYD A;  2Y0M A;  3QP6 A;  3MQ0 A;  5BOX A;  5L3D A;  5CVI A;  3DF8 A;  3KP5 A;  1GXQ A;  5H6R A;  4IPA A;  2OU2 A;  3F6V A;  2ETH A;  1XDS A;  1WRJ A;  5CLS A;  2DO7 A;  2E1N A;  3GXO A;  3RJP A;  4GGG A;  5J6X A;  3K1N A;  2W24 A;  4GXO A;  2P4W A;  4EJT A;  5CJ9 A;  3ERE D;  1ZHF A;  1HW5 A;  2GZW A;  4A2U A;  4NQW A;  4PCQ A;  3WTZ A;  1ZG5 A;  2FEZ A;  3BP8 A;  2PG4 A;  1G3T A;  1PP8 F;  2VC1 A;  2OD5 A;  3HSE A;  2HS5 A;  1HW2 A;  2HGC A;  4K2E A;  1S3J A;  3LQR A;  1IN4 A;  2P5K A;  4EM0 B;  2DPU A;  2IP2 A;  4HBL A;  3BJO A;  2OZU A;  2F5D A;  1BIA A;  2ZXJ A;  2RNJ A;  4IJA A;  1KU3 A;  3T8R A;  2K02 A;  3Q5F A;  4M6X A;  1SD4 A;  1KQ0 A;  4RGX A;  1YW8 A;  1E2X A;  1ZN2 A;  2RVC A;  3BJA A;  2PFB A;  1O7L A;  2LNB A;  3DP7 A;  1Z05 A;  3IWZ A;  5K5Q A;  2QVO A;  3ISP A;  3P9K A;  3EUH A;  3TDZ C;  4D0P A;  3WE2 A;  1A04 A;  4CDG A;  3P9I A;  5DD8 A;  2Z99 A;  3HIF A;  3S2W A;  5JR3 A;  1B9M A;  2E1C A;  4EVI A;  2ISY A;  2A6H F;  3GF2 A;  1T0F A;  2M45 A;  4DQ2 A;  4P55 A;  1GXP A;  4N9I A;  3LA7 A;  2RKH A;  4FX0 A;  1GHC A;  1BOA A;  2V6C A;  1H9T A;  4DNC A;  3KP7 A;  3DFG A;  5D5X B;  2J5O A;  3SZP A;  1RZ4 A;  4OIR F;  3DPT A;  3GLX A;  3RI4 A;  4Q4Z F;  3ZMZ A;  4XSZ F;  2MBF A;  4JBA A;  2EWN A;  2D1H A;  3MAJ A;  4ON0 A;  3L09 A;  2DFI A;  5D8K B;  3WE3 A;  1B1B A;  2IA0 A;  3J81 Z;  3IRR A;  4AD9 A;  2K4J A;  2KIU A;  4XBF A;  2QBY B;  3WOD F;  3LA3 A;  4FT8 A;  1LVA A;  1C0W A;  3RKY A;  4I01 A;  2P5L C;  3TDU C;  2OQG A;  3G73 A;  4G8X A;  4I09 A;  1LEA A;  3DXJ F;  4L0Y B;  4HF1 A;  4HX8 A;  1YIO A;  1OMI A;  2NRA C;  1IRG A;  1R00 A;  2FBH A;  4KT5 C;  4I7H A;  3F22 A;  1FYK A;  1BM9 A;  1WI9 A;  5JI6 A;  2EA2 A;  3H92 A;  2BE5 F;  2A5Y B;  2F5E A;  1V3F A;  4WCG A;  1Q1H A;  2R3S A;  3IL2 A;  3ZMD A;  3HYI A;  4A12 A;  2CQK A;  1RNL A;  2WTE A;  1ZYR F;  1U5T B;  3M8F A;  1IXR C;  4OMZ A;  4LJZ F;  4U0W A;  3OV8 A;  3WTV C;  5AON A;  4R79 A;  3MCZ A;  2HKX A;  3I71 A;  1YS6 A;  3TGN A;  1HBX G;  2GA2 A;  2HQR A;  1XSV A;  4U88 A;  4LK1 F;  3F8N A;  1YLF A;  5FFZ A;  4KMU X;  1O7F A;  4HF0 A;  2NS0 A;  5LGU A;  4BQA A;  3SQN A;  2UWM A;  4LLG F;  1FT9 A;  1SFU A;  3W6K B;  3BPX A;  1NHA A;  2H6B A;  2XRN A;  1X3U A;  4A6E A;  5J8F A;  2ELH A;  3CO7 C;  1FZP B;  4LB6 B;  4KMF A;  1MD0 A;  3LA2 A;  1XCB A;  1KU2 A;  1IN6 A;  2LKP A;  3FZV A;  4KUM A;  3ZMT A;  2VE9 A;  3E5X A;  1DDN A;  2KJB A;  3WTT C;  5H20 A;  4MHG A;  3C3W A;  4WX9 A;  3ZN0 A;  1Z6T A;  3GX4 X;  1FY7 A;  2A07 F;  5CVR A;  4RAZ A;  1ZAR A;  1P4A A;  5ILU A;  3I53 A;  3O2P E;  1QQI A;  4HX7 A;  1U78 A;  2L02 A;  4M73 A;  3SZT A;  2H09 A;  3HOS A;  1IN8 A;  2MC3 A;  3LAJ A;  3QPH A;  2BYV E;  1SMY F;  2VBY A;  4XRF A;  1IXC A;  2DBB A;  2J5P A;  1S7A A;  4L18 B;  2R7D A;  1KU9 A;  4TV7 A;  4PDK A;  2PJP A;  3G3Z A;  1BI2 A;  3QAH A;  2L4A A;  1R23 A;  3BY6 A;  3NEU A;  4M9S A;  1DPR A;  4P9U A;  3QU3 A;  3CUO A;  2O3F A;  4EGZ A;  1T98 A;  2HYF A;  3KP2 A;  2QEN A;  4ESF A;  4I0A A;  4LB5 A;  2KKO A;  5CVV A;  3P7N A;  4OOI A;  2EB7 A;  4WXH A;  4HAM A;  5F6F A;  1USS A;  2QQ9 A;  3E6D A;  5L3E A;  4U0V A;  2FML A;  2FU4 A;  3M7G A;  3Q9V A;  4CHU A;  1ZGA A;  1WQ2 A;  4EJU A;  3IWF A;  1JHH A;  1TNT A;  2VBZ A;  1KU7 A;  1T39 A;  2H27 A;  2EA4 A;  2ESH A;  2DU9 A;  1L3L A;  3E97 A;  4HW0 A;  1KYZ A;  4OU0 A;  1U5T C;  2FOK A;  4BHP A;  4A6D A;  2ESN A;  1J2X A;  2DK8 A;  2BBY A;  5ED4 A;  2HR3 A;  4O3M A;  5L3C A;  1J0R A;  2HFH A;  1U8R A;  1KYW A;  6PAX A;  1OYW A;  3K9T A;  4GYG A;  3L2C A;  1DUX C;  4PGG A;  1YTY A;  5A2Q K;  4Y13 A;  1S29 A;  1K78 A;  1Z91 A;  2F2E A;  4YIF A;  4L5J A;  1LDK B;  5HOO A;  2FXA A;  1F9N A;  3KCC A;  2M5W A;  3OOP A;  3L7W A;  4R1H A;  2MA3 A;  1DP7 P;  2AS5 F;  3KE2 A;  5E1Z B;  3WTU C;  1R1T A;  2XAH A;  2RQP A;  2WV0 A;  2ZO4 A;  3V8K A;  4OIN F;  1IAW A;  2CYY A;  1HW1 A;  3GUD A;  2O03 A;  5K1Y A;  4WK8 F;  4JK1 X;  2XKP A;  3I58 A;  1J5Y A;  4A5M A;  1U6G A;  3B02 A;  1CGP A;  1Z7U A;  4GYI A;  3ELK A;  2IPQ X;  3I5U A;  3COA C;  3RDI A;  5HDK A;  3R4K A;  4XLN F;  2F5F A;  2ACJ A;  1STZ A;  5E1X A;  4ZZL A;  1K7A A;  2W84 A;  1OYY A;  3V8L A;  5HS8 A;  5K5O A;  5E8I A;  3PFI A;  4Q47 A;  2UXX A;  4I02 A;  4ENK A;  5EEH A;  1ZAO A;  1O3T A;  1MKM A;  1SD5 A;  3QP5 A;  3MEX A;  1TQI A;  3JW4 A;  1FBS A;  5L3G A;  3FMS A;  4IHS A;  4ZZD A;  4IVN A;  1WKM A;  5ILV A;  2FNP A;  1LJ9 A;  1ZG3 A;  4KIG A;  3HTU A;  5HDN A;  2YU3 A;  3K0L A;  2ZBK A;  5IT3 A;  3HSR A;  4I0B A;  2WWY A;  4KA4 A;  4HQE A;  3J80 K;  3V7C A;  1XB4 A;  2FE3 A;  3K1P A;  1QZY A;  3ML6 A;  2V79 A;  4IRG A;  3CUQ A;  5LGN A;  4EM2 A;  2HYG D;  2EJR A;  2CSO A;  4I2O A;  3HUG A;  4NB5 A;  1WSU A;  3L00 A;  2FBK A;  2CFX A;  1L0O C;  4U7D A;  4E70 A;  1XD7 A;  3RPU A;  2FNA A;  1SD6 A;  1Y0U A;  3EYY A;  2OAZ A;  1U3E M;  2E7X A;  4HOB A;  1HQC A;  3TO6 A;  2IA1 A;  3KLN A;  2V1X A;  3WGI A;  5KK1 A;  2HTS A;  4RGR A;  4LGW A;  1Z6R A;  4M6Y A;  3ZP5 A;  3QU6 A;  1IRF A;  1TW3 A;  1AOY A;  3B73 A;  2F5C A;  4BHC A;  3VB2 A;  2EFQ A;  5DD4 A;  2P8T A;  3R0A A;  1H0M A;  1QPM A;  2EFP A;  3ECH A;  1P4W A;  4IF4 A;  5AIP A;  2A6E F;  3T0Y A;  4XLP F;  1VTN C;  2JRT A;  3M8E A;  2JPB A;  4H0E A;  1TNS A;  3I64 A;  3ZPL A;  2DAO A;  3ABU A;  4O6J A;  4M72 A;  3M9A A;  4EV0 A;  3GZ5 A;  4UV8 A;  3O3K A;  1LDJ A;  1D5V A;  2FRH A;  3DV8 A;  4EM1 A;  5LEK A;  2IJL A;  3ZMV A;  1YYV A;  2XUB A;  1O3Q A;  2M87 A;  5D5V B;  1FP2 A;  2IRF G;  2W25 A;  2COM A;  4YG2 F;  1V4R A;  3R6S A;  3ZN1 A;  3KEO A;  3MFK A;  1OYI A;  1KGS A;  3Q9S A;  4HQM A;  2JTV A;  2ZNY A;  4CYD A;  2A69 F;  4AVP A;  4ENJ A;  1S6L A;  4L9J A;  2GAU A;  4RGU A;  2IVM A;  3REO A;  3TOA A;  3U9G A;  4Y15 A;  4BH9 A;  4QWQ A;  2HZT A;  4GCV A;  4EGY A;  3FWE A;  5A2Q Z;  1FNN A;  2RGV A;  1FWZ A;  4Q5S F;  2G9W A;  4LK0 F;  2MH2 A;  5BMZ A;  3JSP A;  1F4K A;  3ABT A;  2UXN A;  1MJ9 A;  4LLL A;  1EH6 A;  4OIQ F;  5ILS A;  4Q48 A;  2GXB A;  3TO9 A;  2V1U A;  2EFN A;  3JTH A;  3GVA A;  2FSW A;  2M30 A;  3KZZ A;  3JAM K;  3F21 A;  1BC7 C;  4WXD A;  1K79 A;  3F6O A;  1SAX A;  5DCM A;  1O3R A;  3NQO A;  1K78 B;  3KP4 A;  2NYX A;  1D8J A;  2BEO A;  1RI7 A;  3E3V A;  1KA8 A;  2G7H A;  3CTA A;  2RN7 A;  4JQF A;  1BIB A;  4A0Z A;  1TTY A;  2PN6 A;  5H6Q A;  4UUV A;  5D8L B;  3N97 A;  3E5Q A;  2O61 A;  2XRO A;  2V1D A;  4CGZ A;  2M1B A;  2GIV A;  5FD6 A;  4M71 A;  4QLC U;  3JSO A;  2XKO A;  4XSX F;  5TJJ A;  4A0Y A;  1DPU A;  5JVT A;  2P6S A;  4OMY A;  3FM3 A;  1XN7 A;  3GW2 A;  3QRF F;  4HDV A;  1B4A A;  2L3D A;  1FBU A;  4WWC A;  1YW7 A;  2STW A;  3VOD A;  4WF2 A;  3N4M A;  1RIO H;  1EH7 A;  1BBY A;  3WU0 A;  1ZRF A;  2O6G E;  4Y17 A;  4IRI A;  1W4M A;  3KFW X;  4CIC A;  3WGG A;  3TOB A;  5L3F A;  2QWW A;  3V8J A;  3BJ6 A;  5D5U B;  3QOP A;  5J8C A;  1OPC A;  5F1R A;  3E6M A;  1B59 A;  2W85 A;  3V7S A;  4B09 A;  2STT A;  2FQ3 A;  2Y75 A;  2RV8 A;  5K5R A;  1FX7 A;  3FXR A;  4AWX B;  2YR2 A;  3GEZ A;  1CF7 B;  3GWZ A;  4HA8 A;  3RKX A;  4ETS A;  5HLI A;  3T8T A;  1Z1D A;  3CUQ B;  1PUE E;  2HQN A;  3SXY A;  4G6Q A;  1XGO A;  3DPL C;  1HKQ A;  1WWX A;  3FF5 A;  1S7O A;  4B8X A;  2VON A;  3LAP A;  3IHU A;  1Z9C A;  5ERI A;  4M9X A;  2XAQ A;  2C6Y A;  4KIC A;  4HV5 A;  2XIG A;  2CWE A;  4MTD A;  4BHB A;  3I59 A;  2LF8 A;  3FXU A;  1O57 A;  4LG0 A;  5JHU A;  1IW7 F;  2IT0 A;  5ICG A;  3EYI A;  4FX4 A;  2O0Y A;  5LBQ A;  2EV0 A;  2Y48 A;  5TRD A;  4AIJ A;  4ZYE A;  4RB2 C;  2XAJ A;  2DLL A;  4NHJ A;  2OZ6 A;  2VOP A;  3ECO A;  2EV5 A;  2BGC A;  2Q2E A;  1IXS B;  3I4P A;  4LFU A;  1W7P D;  3F3X A;  1P4X A;  2YX7 A;  3J81 K;  1UB9 A;  3CDH A;  1ONV A;  4G94 A;  2ZKZ A;  3T1B A;  4AIH A;  2DQR A;  2PBI A;  4EMS A;  1UFM A;  2DI3 A;  2Z33 A;  1XGN A;  1LDD A;  2GA1 A;  2XVC A;  3VEP A;  1RUO A;  4UV9 A;  5E20 A;  5LHG A;  1BI3 A;  5DUK A;  1MZB A;  4EJO A;  1F1Z A;  4S04 A;  1IZ1 A;  1PDN C;  4OIO F;  2MLK A;  4G7O F;  2YSR A;  3E5U A;  2VE8 A;  4ESB A;  3MWM A;  3U1D A;  4EQQ A;  3HOT A;  2ZCW A;  4KIF A;  5FLX K;  3BWG A;  3LWF A;  1SFE A;  1FOK A;  2PI0 A;  1QBJ A;  3F8B A;  5IT9 K;  4L5I A;  4RB0 A;  3EDP A;  2OBP A;  3RYP A;  5LLQ A;  3WTW C;  3CLO A;  2PQ8 A;  5ICE A;  2B0L A;  1IF1 A;  3IKT A;  1HXD A;  1T38 A;  2HWV A;  1UCR A;  1ON2 A;  4HV6 A;  2QYO A;  3FXQ A;  1D8K A;  3DQV C;  3JAM Z;  2X0L A;  3IC7 A;  5D5W B;  3AAF A;  4HLY A;  3O6B B;  5HS9 A;  2EFO A;  3FM5 A;  1TLH B;  3FX3 A;  2VT3 A;  1KQ9 A;  2IA2 A;  4L9V A;  2HDC A;  2DQL A;  1MDM A;  2RC4 A;  2A68 F;  4AIK A;  1P6R A;  2XAS A;  2H94 A;  3WU1 B;  4HLX A;  4PGH A;  2G7U A;  4KFC A;  4G9Y A;  3WTX C;  3C1D A;  4PZJ A;  5LGT A;  5DCM B;  1R5H A;  2K4B A;  3KZY A;  1MJA A;  4F7Z A;  1UHM A;  1K6O A;  2GQQ A;  3GFL A;  3RYR A;  4MGR A;  3BPV A;  3RTR A;  1AWC A;  3F72 A;  2ZFW A;  1ZG1 A;  1CF7 A;  3CUQ C;  1UHW A;  2FA5 A;  3K69 A;  4HZF A;  2BV6 A;  3U2R A;  2EV6 A;  2PLY A;  2DTR A;  2OA4 A;  5ICF A;  5L3B A;  2K86 A;  1BI0 A;  2YX4 A;  2HTJ A;  2FF4 A;  5KVR A;  5BQT A;  1HST A;  4L9N A;  2JPC A;  4L9T A;  1J7K A;  3FHZ A;  1R1V A;  1YG2 A;  4A5N A;  5BS6 A;  2L01 A;  4BAY A;  1P2F A;  4MTE A;  2ISZ A;  4UVB A;  1MGT A;  5HVQ C;  3VFZ A;  2L4M A;  2CGP A;  3K1M A;  3K2Z A;  3VOE A;  1QNT A;  2JSC A;  1G6N A;  2NNY A;  3W6J B;  4G7Z F;  1O3S A;  4IHT A;  2D45 A;  4OIP F;  3T5X A;  1EV7 A;  2XV4 S;  2PMU A;  4LLN A;  2VC0 A;  4M74 A;  3WTY C;  3F8M A;  4UVA A;  3ROU A;  3HSF A;  1PP7 U;  3TKY A;  3QPT A;  3GFM A;  2NAZ A;  4YII A;  2XAG A;  1ULY A;  4BYY A;  1FPQ A;  3EQL F;  2D2W A;  2RDP A;  4P5O A;  2P7V B;  1TW2 A;  5F64 A;  3GFI A;  4RAY A;  3ULQ B;  1QZZ A;  2CO5 A;  4ZYG A;  2XGX A;  3HRM A;  4RB3 C;  1SMT A;  3GO5 A;  2XAF A;  4IXA A;  4KIB A;  4YFK F;  3E6C C;  1ZH5 A;  2UZK A;  3R61 A;  4U0Y A;  2Z5U A;  2QQB A;  4BXU A;  3C7J A;  5D6F A;  3JTG A;  1G4D A;  3BOQ A;  5EEG A;  1G3S A;  2CW0 F;  5E17 F;  2YPR A;  5AIQ A;  1JXS A;  1LB2 A;  3M1E A;  3EET A;  3FMR A;  3KEQ A;  2HKO A;  2PEX A;  3R60 A;  2E7W A;  5HS7 A;  4IRH A;  2H6C A;  1HSJ A;  3I54 A;  4U7B A;  5LHH A;  4ESJ A;  1FYL A;  2VXZ A;  1W7P A;  3I59 B;  4LD5 A;  1JE8 A;  4YFX F;  4LG0 B;  3FMQ A;  1FLI A;  1S8N A;  1JHF A;  4HDU A;  3BDD A;  2Z3Y A;  3LQQ A;  3J7A O;  2QZ8 A;  2OQR A;  2Q8K A;  3WG9 A;  1FC3 A;  4EJV A;  1ZLJ A;  2TDX A;  5CVJ A;  2JZY A;  4LMY A;  1XSX A;  3HHH A;  4O5V A;  2R7F A;  4MNU A;  2D1V A;  5FGM A;  5DYM A;  5LHI A;  2JT1 A;  1QO0 D;  3PQJ A;  2PMH A;  1ZRE A;  1I27 A;  1W5T A;  2AXL A;  1XGS A;  2GWR A;  3CJN A;  2K27 A;  4G6D A;  2QUF A;  3GZ6 A;  5ICC A;  5FLX Z;  1J9I A;  3HTS B;  1YQA A;  3IRQ A;  2VBW A;  3WGH A;  5IT9 Z;  3MZY A;  2KIF A;  1YS7 A;  2ZME B;  1ZRC A;  2LSO A;  4HF2 A;  2M8E A;  4P9F A;  1H9G A;  1IUY A;  1OR7 A;  2QQA A;  1J59 A;  3MZH A;  2MH9 A;  3CO6 C;  2QLZ A;  1YW9 A;  3RKW A;  1FSH A;  2P5V A;  3DEU A;  5DUI A;  5DDG A;  4ASN A;  3GFJ A;  4KDP A;  4HX4 A;  1XMK A;  3HRT A;  1XSD A;  2DW4 A;  4P96 A;  4UXN A;  3TO7 A;  3LST A;  4RGS A;  2DPD A;  1FBQ A;  4R8H A;  3C18 A;  3RPQ A;  5LRR A;  1MJB A;  5JFR A;  4KN4 X;  4L0Z B;  2P6T A;  3WTS C;  5D6E A;  1P92 A;  5E8G A;  1LQ1 A;  1LNW A;  3SHF A;  1B9N A;  2KJC A;  4RB1 A;  3LFK A;  3KP3 A;  1IN7 A;  3ZMU A;  4CZZ A;  2QM3 A;  1XMA A;  3I0T A;  1MDM B;  2HEO A;  3R0J A;  4MQV A;  2EK5 A;  2VOD A;  5LEJ A;  3ZMS A;  4S05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...