3J81Z

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81Z00
1FWZA 2FBIA 2WV0A 2STWA 4BQAA 5IT3A 3NRVA 3ZMDA 2PG4A 1U5TC 3BDDA 4IPAA 3KP4A 4PZJA 1IW7F 1USTA 1B59A 4WK8F 1GXQA 2EA4A 2V79A 2P7VB 3DXJF 3M7GA 4HW0A 4HYEA 1Z91A 4RB1A 3DPTA 4D0PA 1IN7A 1C0WA 1S7AA 4DNCA 1RUNA 3SZPA 3KLNA 3E5UA 2L01A 2GAUA 1Z6RA 3K1MA 3TQNA 2V1UA 4EJVA 4EVIA 3LAPA 4KA4A 2H6BA 2UXNA 2HEOA 2P7CB 2DI3A 4YG2F 2MD5A 4IVNA 3CO7C 1Z6TA 4UUVA 4P96A 2FRHA 3ZP5A 3R0JA 1IRGA 2NNNA 3WTYC 4KMFA 3I64A 4WXHA 3ELKA 2MLGA 5HDGA 2HTSA 3ABUA 1WSUA 1Q1HA 1FZPB 2VOOA 4QLCU 1WRJA 3KP3A 1ZRCA 4ASNA 3RYRA 2OZ6A 3SHFA 5LHGA 4UV8A 2AXLA 3FXRA 2VONA 4GCVA 2OZUA 2KKOA 3V7CA 3V8LA 1W5TA 1RZ4A 3OV8A 2XASA 1D8KA 5EEGA 5FB2A 5FD6A 4KIBA 3CO6C 2K4BA 2YPRA 2XKOA 3N4MA 3O3KA 1WI9A 4M6XA 1F5TA 2FA5A 4EJWA 2A68F 2CFXA 3FX3A 1FPQA 2ZNYA 1I1SA 1XD7A 4MHGA 1ZG3A 1YQAA 4XLNF 1XGNA 3CDHA 3QPTA 1FBQA 4CDGA 2WWYA 4FX0A 3DQVC 3GUDA 2VC0A 4P55A 5ILVA 5L3FA 2FXAA 4G8XA 2RNJA 2G7HA 3R6SA 2FSWA 3CUQC 2NS0A 1EH8A 3FMQA 3JW4A 1Z7UA 1XMAA 1ZARA 2H09A 1IRFA 1W7PD 2L02A 3RIRA 2A5YB 2ACJA 1FSEA 5D4RA 1YIOA 3J80K 1CGPA 1SD5A 5IT9K 3MZHA 1XGSA 1F1ZA 5ERIA 1LJ9A 3TDUC 4UHTA 1J59A 2KJCA 2JPBA 2M30A 2O03A 3T5XA 3HOTA 4YFNF 5KK1A 3KE2A 3J81K 1HBXG 1S6LA 3PQJA 1J7KA 1YFHA 2BEOA 5FFXA 1ONVA 2JRTA 4OIRF 1G6NA 3KCCA 5LHHA 1MD0A 2DK5A 3HRTA 1ZLJA 3T1BA 3GFLA 1TW3A 3RI4A 4ETSA 4A5MA 3LA7A 5ICFA 1F4KA 2IPQX 1UB9A 2QYOA 4IXAA 1BOAA 3V7SA 1FNNA 3COAC 4UVBA 2A07F 3K0LA 2LF7A 2ISYA 2K02A 2QQ9A 3J80Z 2L3DA 3IWZA 1EV7A 5IT9Z 2JT1A 2EWNA 4ENJA 4FHTA 1MGTA 1P4WA 4G9YA 5E18F 3MCZA 4B09A 3IL2A 2P4WA 1OYYA 2QVOA 3VEPA 2FNAA 5CVVA 1BI3A 4I02A 2J5OA 3F8MA 2DT5A 3FXUA 1W7PB 3CTAA 3REOA 4HQMA 4M6YA 2R7DA 4KIFA 3P7NA 1BM9A 4LB5A 4BAYA 1OYIA 1YW9A 4AIHA 3QU3A 1LB2A 1YO5C 1I5ZA 5BMZA 4A6DA 5CJ9A 2IA2A 3E6DA 2QLZA 1BN5A 2F5EA 1FYKA 1NHAA 3TOBA 3E97A 4KIGA 4ENMA 5LGTA 2MA3A 5EEHA 1J75A 1XCBA 1YW8A 4RB3C 4Q5SF 3GYHX 1U3EM 4I0BA 3P9CA 4HZFA 3HSEA 1B6AA 2Y75A 3KP5A 6PAXA 2HYGD 4PDKA 2HYFA 2CWEA 1R5HA 1QO0D 3OOPA 4ZH4F 2QM3A 2O0YA 3QU6A 4EM0B 1KU3A 1YS6A 2OQRA 4FT8A 3IHUA 2RDPA 1F9NA 2HTJA 2IT0A 3F72A 3I59B 1FC3A 1HW1A 3NEUA 4B8XA 1T0FA 4NHJA 4HDUA 3ZPLA 1FP2A 3JTHA 4CICA 2XGXA 5K5RA 1ZGJA 4OMZA 3B73A 5JFRA 4LK1F 3VODA 1TW2A 5FD5A 4LLNA 3QP5A 4PCQA 5HVQC 3ECHA 1BIBA 4I2OA 5BPDA 4S05A 1BI2A 1LNWA 3ABTA 2P6TA 3GZ5A 1YTYA 5H20A 3I58A 1CF7B 1KU9A 3MFKA 1UFMA 1WWXA 3HUGA 2NRAC 3HTUA 2RGVA 3SXYA 4A5NA 3GFMA 4ZYGA 1R23A 4EM2A 2Z33A 1R1UA 1MJAA 3HYIA 2NYXA 1YLFA 3LA3A 2EFOA 2F2EA 4KN4X 1R7JA 3FF5A 3MWMA 4AWXB 4ZYHA 4NQWA 5D8LB 4M71A 4LMYA 2Q2EA 4OOIA 4RGXA 1DPRA 3O6BB 3GVAA 3QPHA 3KETA 3ZN0A 2X4HA 4L9JA 4ZYDA 4JQFA 1W5SA 1J5YA 2XAGA 1ZRDA 5F64A 1LEAA 4G94A 4M74A 1KQ0A 3R60A 5HLGA 2COMA 1BC7C 4QWQA 1UHWA 4RGUA 3BY6A 2HS5A 2V9VA 3E6MA 2M1BA 2XIGA 4G6QA 1GVJA 1E2XA 1LVAA 3Q5FA 1TNSA 2TDXA 5DV5A 3EYYA 5BQTA 3KP7A 5DCMA 1T39A 2BBYA 2FNPA 2G9WA 2PFBA 2IP2A 3GZ6A 1PDNC 2XAJA 1H0MA 2HDCA 3BPXA 2DPDA 3BJ6A 1GXPA 4EGYA 4UVCA 3K1NA 4PGHA 2NNYA 1MZBA 1XSXA 3RDIA 3SFZA 4HF0A 1DDNA 4WXDA 5CYVA 2QBYA 1RNLA 5D5VB 2VOPA 3V4GA 2KIUA 5LRRA 2VN2A 2WC2A 1MKMA 4HDVA 3I59A 3BZ6A 1GHCA 2ESNA 4O6JA 1KU2A 1KA8A 1JE8A 2ZBKA 4MGRA 2MC3A 4MQ9F 1B1BA 2GA1A 2E7WA 1G3WA 5DUIA 2EFPA 2C6YA 1S7OA 3KEQA 2DO7A 4OU0A 2BYVE 5D5WB 4P9UA 3GWZA 1SMTA 2STTA 4LLGF 2QWWA 1SFEA 2P5LC 2EJRA 4EM1A 3IWFA 3ZQ7A 3TDZC 1HKSA 3KFWX 3KLOA 2D2WA 1KYWA 1UHMA 2PMHA 3KP6A 1CF7A 1P6RA 2VXZA 3C1DA 4KFCA 3TKYA 4RAZA 2A61A 2XAHA 3U2RA 5DYMA 1JHFA 1K78A 2M87A 5D5UB 3BWGA 3ZMSA 5H6RA 1IF1A 2EFWA 4M9ZA 1WQ2A 4UNOA 2H6CA 1J0RA 1ZREA 1YS7A 2O61A 2YSRA 3M8EA 5LEKA 1QPMA 5J8FA 1FBUA 1ZLKA 4Z2YA 2FOKA 2LKPA 1HSJA 2XVCA 2VC1A 2VE9A 3C7JA 1S29A 3RKYA 4EMSA 4RB0A 5AIPA 2PJPA 2X0LA 4BYYA 3GW2A 4ENNA 4KUMA 1SD7A 2H27A 1DPUA 1RUOA 1KYZA 3DP7A 1FBSA 2OD5A 1JXSA 5J6XA 1P4XA 3QAHA 4HF1A 2BGCA 1OYWA 5JR3A 4CXFA 2HKOA 4M9XA 2XV4S 1O3TA 3WTSC 3IC7A 4G7HF 1QZZA 1B9MA 1LDJA 2W57A 3U1DA 1Z1DA 5E1WA 3P9IA 4UV9A 4RGRA 4KDPA 1O7FA 2RQPA 1G3TA 2LDUA 4F7ZA 1SD6A 5FO5A 5HLIA 1JGSA 2W24A 3HSRA 4OIQF 1ZH5A 1S3JA 4O3MA 2XROA 5K1YA 2A6HF 4LG0A 4HLYA 3W6JB 2MLKA 3R61A 2EV6A 5AONA 4IRIA 2XAFA 2P6SA 1L3LA 1XGMA 4HV6A 2DAOA 4ZYEA 4LD5A 1R22A 2RVCA 5JVTA 4RS8A 4M73A 5D6FA 3ML6A 2EV5A 3QP6A 1X3UA 3FMSA 1BJAA 3G73A 4P5OA 2M45A 2MBFA 2UZKA 4DQ2A 4WCGA 5E17F 3E5QA 3O2PE 1XDSA 3EDPA 1BIAA 3HHGA 3MQ0A 4IHSA 5E20A 2L4AA 3HHHA 1HQCA 2IA0A 3JTGA 2YR2A 4M9SA 3EUHA 2FMLA 5LEJA 3V8JA 1AWCA 2UWMA 3E6CC 3I4PA 5JHUA 3Q9SA 2XAQA 4OIOF 3H3ZA 4GGGA 4M72A 5DDGA 1ZG1A 2M5WA 4WF2A 2FMYA 4MEYF 3P9KA 3TOAA 4HX4A 3F6VA 3GX4X 5H6QA 5LHIA 1V3FA 4WWCA 5BOXA 4CZZA 4ZZDA 3I0TA 3LSTA 4P9FA 4I01A 1TQPA 2HWVA 4HQEA 2RV8A 1I1GA 2HZTA 3F6OA 2GWRA 1ON1A 3E3VA 3RJPA 1O3QA 2HFHA 3FWEA 1PP7U 2F5CA 3WU0A 2VBXA 2VT3A 2RN7A 5DCMB 5ILUA 2F5FA 3HTSB 2BV6A 1U78A 3D0SA 3R4KA 1ZYRF 1OMIA 1U8RA 2D1HA 1YG2A 4Y15A 2DTRA 3RPUA 4U0WA 4I7HA 4A12A 2D45A 2QBYB 4K2EA 4KN7X 4MTDA 1YW7A 1OR7A 2IJLA 1BC8C 1QZYA 2GXBA 3MEXA 2IA1A 4WX9A 4IHTA 2JPCA 3CUQB 4N9IA 1IN6A 2PEXA 1J9IA 2ZXJA 4KICA 2ZCWA 1SAXA 2CSOA 4U7BA 2UXXA 2ADUA 2EK5A 5CVUA 3WE2A 4YIFA 3I5UA 3DFGA 5JI6A 2L4MA 4CO8A 4BH9A 1G3YA 4UVAA 4XSZF 3RKXA 2CG4A 2JZYA 3J7AO 4LB6B 2FQ3A 3LA2A 1P4AA 3F8NA 1K7AA 1S8NA 4JK1X 1U5TA 2FE3A 1XSVA 3I53A 1IAWA 1J2XA 1ODDA 1LEBA 5L3CA 4L18B 3M8FA 4N9HA 3R0AA 1XGOA 4GO1A 3F22A 2PN6A 4L0ZB 1K78B 4AD9A 3QOPA 3SZTA 2ZKZA 3EETA 1B9NA 4BHBA 4XSXF 5CVRA 1O57A 2HQRA 1H9GA 5HS7A 4GXOA 1JHHA 4I09A 2DW4A 2Y0MA 3FHZA 2DK8A 1UCRA 2IW5A 2OQGA 3C3WA 3NQOA 2JTVA 1QQIA 1T2KA 3IRQA 3WTVC 3E6BA 3M1EA 2KJBA 4HX8A 5HS9A 2A69F 1A04A 5E1XA 2FF4A 1T98A 3WGHA 3ZN1A 1HW2A 4KNYA 1D3YA 3K9TA 3GLXA 4HA8A 1PP8F 5D6EA 1TNTA 2YX7A 3E5XA 4ON0A 2GQQA 3K69A 5ICGA 3T8TA 1IXSB 1FX7A 3JSPA 4GYIA 4Q48A 3HOSA 5A2QZ 2O3FA 4TV7A 2P5VA 2W85A 1O3RA 3WE3A 1ON2A 2NAZA 5HOOA 4IRHA 3F3XA 2PI0A 2Z99A 1HW5A 1TBXA 4UXNA 4AIJA 1YYVA 4FX4A 2DQLA 1IN4A 3LWFA 3KZYA 4CYDA 1P92A 4YFKF 3WG9A 2K27A 2XRNA 3W6KB 2VT2A 1E17A 5LRSA 1W4MA 2KIFA 3HRUA 3KEOA 2GXGA 2KIMA 1DP7P 4LG0B 1LDDA 4IRGA 4R8HA 1BBYA 4MQVA 2HKXA 2W84A 2FBHA 3CUQA 1R00A 4HV5A 3MAJA 1I6XA 2ZMEB 4EJTA 1RIOH 1R36A 5CLSA 5TRDA 4AIKA 3IKVA 2AS5F 2D1VA 4HBLA 3F23A 4ENKA 3AAFA 3WTUC 1FP1D 3JAMZ 4HF2A 5E1ZB 4MTEA 2ZO4A 2FU4A 5ILSA 5ICEA 3WODF 4LK0F 4L5JA 2GZWA 3RTRA 1FT9A 3L9FA 1AOYA 4KT5C 2W25A 4S04A 2PQ8A 4U0VA 4AVPA 1XDUA 3WU1B 1G4DA 2P5KA 3FM3A 2R3SA 2K86A 3T8RA 3ULQB 3L2CA 2ETHA 4IF4A 4XLPF 3WTTC 5BPIA 1I27A 5TJJA 4ESFA 4G7ZF 2E7XA 4HLXA 4ESJA 2VBYA 2OAZA 5BS6A 1BI1A 1T38A 2HOEA 2E1CA 1FOKA 5HDKA 2QENA 3ZMUA 2EV0A 1TTYA 4EV0A 2B0LA 1EH6A 3DF8A 3WGGA 2EFQA 3ISPA 3DKWA 4IJAA 3BOQA 4L5IA 3GXOA 4G7OF 4Y13A 4ZZLA 2ELHA 2KRFA 3EQLF 1ZRFA 1XMKA 1RI7A 3C18A 2VE8A 3M9AA 1IUYA 4BXUA 2PMUA 2XHKA 2CO5A 5E8IA 1SFUA 2DLLA 2J5PA 1KQ8A 2OBPA 3V8KA 1OPCA 4EGZA 4R79A 2PLYA 1STZA 3F8FA 1U2WA 2G7UA 2YX4A 4Y17A 2A3SA 1LQ1A 2HQNA 2ISZA 4BHPA 4L9VA 2L54A 4R1HA 2VBZA 2A6EF 5DUKA 3D5LA 5F6FA 2ZJ2A 2DQRA 2GA2A 3RKWA 2K4JA 2IVMA 2ZNZA 2H94A 4Q4ZF 1HXDA 3GFJA 3KP2A 3F8CA 4U7DA 2QUFA 3MZYA 5F1RA 3T0YA 5LGUA 1LDKB 1FSHA 3U9GA 1L0OC 1ZAOA 3PQKA 1IN5A 2F5DA 3KZZA 3F8BA 2CGPA 1ZN2A 1ZHFA 2HR3A 3ECOA 4KYWA 2QQAA 2RKHA 1QGPA 3WTXC 2ZMEA 3DV8A 2JSCA 2R7FA 3DPLC 3V7RA 4HOBA 3JSOA 4N0BA 4I0AA 3HIFA 3VB2A 3LQRA 3F21A 3GFIA 5J8CA 1BI0A 1KGSA 1K6OA 4XRFA 2DBBA 5ICCA 3CJNA 1QBJA 5HS8A 1R1TA 1U5TB 5HDNA 1FYMA 4A0ZA 3EYIA 1O3SA 4Q47A 4YIIA 1ULYA 3GF2A 3H92A 2P8TA 1IXCA 1V4RA 5ED4A 2QZ8A 3L7WA 5E8GA 5DD4A 3I54A 1TQIA 3RPQA 2MH9A 3DEUA 1R5GA 3J81Z 3SQNA 1HSTA 2K7LA 3FMRA 4L0YB 2CQKA 1U6GA 3TO6A 4I98B 1PUEE 4A0YA 1IN8A 2DPUA 3GEZA 3WTZA 5D4SA 3N97A 2MH2A 3HRMA 1Z05A 1D5VA 2Z5UA 2VODA 3TGNA 1MDMB 2YU3A 3RYPA 1REPC 2LSOA 2XKPA 3BJAA 3ZMTA 3FZVA 3BPVA 3G3ZA 1XB4A 4MEXF 1SFXA 2E1NA 2O6GE 3CUOA 3B02A 2LNBA 2ZFWA 3K1PA 2CW0F 3BJOA 5LGNA 1ZG5A 4GYGA 1TLHB 1VTNC 4CHUA 1SD4A 1G3SA 2Y48A 3K2ZA 4G6DA 3L09A 4JBAA 4YFXF 2Q8KA 5LLQA 4U0YA 3TO9A 1KU7A 4XBFA 1SMYF 4L9NA 2QQBA 3VFZA 5LBQA 3ZMZA 4H0EA 1D8JA 4MNUA 3QRFF 1HKQA 4OINF 2LF8A 1T6SA 2VBWA 4NB5A 1MJ9A 4BHCA 4ESBA 2IRFG 4LGWA 2CYYA 5FFZA 5DCFA 5D5XB 2EB7A 4OIPF 4A0XA 2DFIA 3BROA 1XN7A 3FM5A 2V1XA 3GO5A 2Z9OA 5KVRA 2RC4A 2FEZA 1IXRC 4BNCA 1DUXC 1XCVA 3PFIA 2EFNA 4E70A 3BP8A 5L3DA 2Z3YA 4EQQA 3IKTA 4HX7A 1R58A 1EH7A 3VOEA 5FLXK 5A2QK 3HRSA 2FBKA 3TO7A 4LLLA 4KMUX 4OMYA 2V1DA 2M8EA 1MJBA 4LJZF 2GIVA 5DD8A 1R1VA 2ESHA 3CLOA 1Z9CA 1XSDA 2BE5F 2HGCA 1FY7A 2XUBA 4WXCA 4LFUA 4O5VA 1FLIA 2V6CA 5DEQA 3L00A 1P2FA 3FXQA 3IRRA 4U88A 1B4AA 3LQQA 4L9TA 1FYLA 1TQMA 2PBIA 3Q9VA 4EJUA 3ZMVA 1W7PA 5L3EA 1HKTA 5L3BA 3H3UA 5HLHA 2DU9A 3ERED 4RB2C 4A2UA 1OKRA 5AIQA 3ROUA 1K79A 1MDMA 4RGSA 3S2WA 3I71A 4EJOA 4RAYA 5K5OA 5L3GA 4CGZA 2EA2A 3LFKA 3JAMK 2Q0OA 3HSFA 3WGIA 1ZGAA 3LAJA 4PGGA 2OU2A 5CVJA 1KQ9A 1USSA 5CVIA 3WTWC 5FLXZ 1WKMA 4A6EA 2O8XA 5K5QA 1Y0UA 5FGMA 1O7LA 5D8KB 1IZ1A 4HAMA 2OA4A 1QNTA 1H9TA 2WTEA
chains in the Genus database with same CATH superfamily
2BW3B 1FWZA 2LOOA 2FBIA 1QHGA 3CJTB 3CZ6A 2WV0A 2O8KA 2STWA 3ABMH 4BQAA 3CCYA 5IT3A 2AHQA 2VKVA 2V9PA 1AA7A 3NRVA 3JREA 3ZMDA 1ZR2A 3K4NA 3BZKA 2WY7Q 2PG4A 3OIQA 1U5TC 3BC8A 3H5RA 1TWGJ 2M9HA 3BDDA 2IGKA 4IPAA 3WG7H 3KP4A 2PX9A 3DBRB 3ZQGA 3RKQA 4PZJA 1IW7F 3BR1A 3BT9A 3EPZA 4V19K 1USTA 4Y7NJ 4GDFA 1B59A 3DBLB 3W2VA 4WK8F 1RKTA 4BACA 1GXQA 2BHZA 3HZJA 1YIJI 1P7JA 1PUFA 2XGEA 1NTCA 4AYBA 3L2UA 2EA4A 2V79A 2P7VB 3DXJF 3M7GA 4M3BA 3VYTB 4XRSG 4HW0A 1OISA 4HYEA 1UJ8A 2DA3A 2DTZA 1Z91A 3EUKL 2EZKA 3ZOBA 4RB1A 2V9KA 3DPTA 4D0PA 1IN7A 1C0WA 1S7AA 4DNCA 3G4SI 1RUNA 3SZPA 3KLNA 2E1MC 3E5UA 2OF7A 2L01A 5E79C 2GAUA 1Z6RA 3K1MA 3TQNA 4B43A 4M3DA 4BGDA 2V1UA 4EJVA 3AG1H 3S3NA 2XGCA 4EVIA 3LAPA 4XLAA 4KA4A 4FISA 2H6BA 2M4GA 2UXNA 4UUSA 2HEOA 2P7CB 2DI3A 4YG2F 5JLXA 4YELA 4AU7A 3FHNA 3HOWJ 2MD5A 3OIOA 4IVNA 3CO7C 1NK3P 1Z6TA 3CF2A 4UUVA 4P96A 2FRHA 3ZP5A 3R0JA 1IRGA 2DMTA 2NNNA 2Y0SN 3WTYC 4KMFA 3I64A 4WXHA 4L5EA 5M5XJ 3ELKA 3BR2A 2MLGA 5HDGA 2HTSA 3ABUA 1RRJA 1WSUA 1Q1HA 1AKHA 3J7ZI 1FZPB 2R5YB 3OYGA 2VOOA 4QLCU 3S1MJ 1WRJA 3KP3A 1ZRCA 4ASNA 2H1KA 1R6RA 3RYRA 4BXXJ 1VQLI 4D9JA 2OZ6A 3SHFA 4XORA 5LHGA 1ZTRA 2JVHA 1ZQ3P 1EF4A 1N75A 1OCOH 1T33A 4UV8A 4CZCA 2VUMJ 2AXLA 3FXRA 1LFPA 2VONA 2ZJPF 4GCVA 2OZUA 2KKOA 3HKZA 4B4CA 3V7CA 3OYLA 4DIQA 3V8LA 1W5TA 1LUJB 5J40A 1RZ4A 3OV8A 2XASA 1D8KA 3AG2H 1B8IB 3ASNH 5FLMJ 2QKMB 5EEGA 1V5FA 5FB2A 2XF6A 5FD6A 4KIBA 2L5QA 4DYQA 2CV2A 3CO6C 2K4BA 2YPRA 2XKOA 2LBFB 3N4MA 3O3KA 1WI9A 4M6XA 1F5TA 4F91B 1IDZA 2FA5A 4EJWA 2BY0A 2A68F 2CFXA 4D1QA 3FX3A 2R5ZB 1WJFA 1FPQA 2ZNYA 3H0GJ 3P5JA 2UUZA 1I1SA 1XD7A 4MHGA 2DMUA 2F4MB 4HNUA 1ZG3A 1D0YA 3S8PA 1YQAA 4XLNF 1XGNA 3CDHA 3QPTA 4ZDPA 1FBQA 1Z3XA 4CDGA 1DP3A 2WWYA 4GRIA 4FX0A 3DQVC 2E5ZA 5EEAA 2XPWA 4PUSA 3GUDA 2VC0A 3TEDA 4P55A 5ILVA 2FUG2 2DFHA 5L3FA 2AO9A 2L7FP 2FXAA 4G8XA 2VLAA 2H8WA 2JJ7A 2RNJA 2G7HA 3R6SA 3ASOH 1H89C 2FJ1A 2FSWA 2BZTA 3CUQC 4RM2A 2NS0A 1EH8A 5B5EC 3FMQA 3JW4A 1Z7UA 2ZC2A 1XMAA 3DU5A 1ZARA 3TBIA 2KLOA 4BDZA 2H09A 1IRFA 4ANJA 3IUOA 1W7PD 3H35A 2L02A 1U0JA 1KZHA 4AVZA 2KDOA 2A5YB 3RIRA 1VFCA 1BJZA 2VIXA 2W4SA 2JK3A 2ACJA 3W6VA 5EG0B 4N4OB 1FSEA 3TW7A 5D4RA 1MMDA 1YIOA 3A0BC 1H88C 3HGGA 4DYCA 3J80K 1CGPA 1SD5A 5IT9K 3MZHA 1XGSA 2BVMA 1F1ZA 2YU9J 1TWAJ 5ERIA 5FRMA 3E1SA 1LJ9A 3TDUC 4UHTA 1J59A 2M3AA 2KJCA 2JPBA 2M30A 2O03A 2X48A 1UMQA 2Y31A 3T5XA 1Z77A 3CF5F 3HOTA 5C3EJ 4YFNF 5KK1A 3KE2A 3J81K 2DJIA 2JA6J 2E2HJ 1HBXG 1S6LA 3PQJA 1J7KA 1GVDA 4AYBN 5IOZA 2BEOA 1YFHA 1B72B 3JRBA 5FFXA 1ONVA 2JRTA 2LG4A 4BUPA 3ERMA 2FQ4A 2KPMA 3ONQA 4XK4A 1WH5A 1G6NA 4OIRF 1SAUA 1GT0C 3HOYJ 1BR1A 3MKYB 1GUUA 2DODA 4B1RA 3KCCA 5LHHA 1ETQA 1MD0A 1GDTA 2N8GA 2DK5A 3L2VA 3HRTA 1ZLJA 2LTPA 2LR8A 2WBMA 2X6YA 4XN0A 1WCMJ 3T1BA 2Z1DA 3GFLA 1W5CC 1QU3A 3JRGA 5TGTA 1TW3A 1ZK8A 4IKFA 2KRCA 3RI4A 4ETSA 1I3QJ 2ZSIB 4A5MA 3LA7A 5ICFA 1F4KA 4E6KG 2IPQX 2WAQA 4J01A 1UB9A 1A6IA 2K9NA 2QYOA 4IXAA 3VSKA 1BOAA 4IL6C 1FNNA 3V7SA 3COAC 4UVBA 2A07F 4FTHA 3G1MA 3F0CA 3K0LA 4M3EA 1FOYA 2LF7A 3PO2J 2ISYA 2K02A 2LC2A 4IHXA 3CCEI 2KRHA 1PJRA 1X2NA 2QQ9A 2I8DA 2IGMA 2R93J 3J80Z 2L3DA 3IWZA 5E3LA 1EV7A 5IT9Z 2BY1A 2JT1A 5GAGJ 2LRDA 2R4GA 3FDYA 2VL8A 4HG2A 4IQJA 2EWNA 4XMYA 4CCNA 5GPAA 3S2DJ 3HKZN 4ENJA 2QA4I 4FHTA 4IEJA 1UELB 3K4JA 1MGTA 1TC3C 1P4WA 4G9YA 4IOAF 3Q3SA 2IGOA 3OS1A 5E18F 3MCZA 4B09A 5BNGA 2P4WA 1OYYA 1RETA 2QVOA 3VEPA 3IL2A 2FNAA 1AHDP 2GLOA 3ZRGA 1SVMA 5CVVA 1BI3A 4I02A 2J5OA 3F8MA 4FCYA 4A3KJ 5KHDA 2DT5A 3FXUA 1W7PB 4NQWB 3CTAA 3REOA 4HQMA 2M7AA 3AG4H 1HLVA 3CC2I 1FIPA 2LBFA 1FIAA 4M6YA 1VQ6I 4NNJA 2R7DA 3PJRA 4KIFA 3P7NA 1BM9A 3O8GA 4LB5A 4HPQA 4BAYA 1NG7A 1OYIA 1YW9A 4AIHA 1TT0A 1MIJA 3S32A 1BR2A 3QU3A 1LB2A 4IQ4A 2MGQA 1D5YA 1XX5A 5C4XJ 2IBDA 1YO5C 5GAHJ 3DKXA 1X19A 5GADJ 1I5ZA 5KAIC 3BLYA 4RM3A 5BMZA 1QZEA 4A6DA 1W0UA 5J1YA 3CJRB 5CJ9A 2IA2A 3E6DA 2DXIA 1ACIA 3S14J 2R7XA 3J7AY 2QLZA 1BN5A 1JT6A 2F5EA 1FYKA 1NHAA 3TOBA 3E97A 1RR7A 4JP0A 2VPRA 4KIGA 3MN2A 4ENMA 5LGTA 1N77A 2ID3A 2MG4A 2JA8J 2ZSHB 2ZMEC 2MA3A 5EEHA 3DPUA 3OMYA 1J75A 1XCBA 1YW8A 3HOVJ 1D0ZA 3HJEA 1BA5A 2DCEA 4RB3C 2DMQA 1W0TA 4Q5SF 4A3MJ 2ZFUA 3GYHX 4A93J 1U3EM 2Y9ZA 4I0BA 2H8RA 1YJWI 1T8IA 3P9CA 4HZFA 2ZXIA 3HSEA 2NVTJ 2ELJA 1A6QA 1B6AA 4BEHB 2Y75A 3KP5A 2MFZA 6PAXA 4HSRA 2XRLA 1YX3A 2HYGD 4PDKA 2HYFA 1A36A 2CWEA 1R5HA 3J7YJ 1QO0D 3OOPA 3CC4I 2WB1A 4ZH4F 2VJIA 1JJ8C 2QM3A 3SEZA 3FXJA 2Q1ZB 1Y0NA 1W36C 1B72A 2I10A 2O0YA 4M3GA 3LSMA 3BG5A 2BXYA 2KIQA 3QU6A 4B47A 4CSWA 1KU3A 1YS6A 2OQRA 4EM0B 4FT8A 3IHUA 1OCCH 4D7MA 1VQMI 1Y8QB 2RDPA 4A3DJ 1F9NA 3BTCA 2HTJA 2IT0A 2CQXA 1J09A 3F72A 5CPRB 2X1CA 2DA5A 4AC0A 3RZDJ 3I59B 3OYIA 1FC3A 1HW1A 1MBKA 4CCKA 1QVUA 3NEUA 3GTGJ 4B8XA 1T0FA 4HNTA 4NHJA 4HDUA 2EZHA 1X1PA 3HBLA 3ZPLA 5KAFC 1FP2A 4BY1J 3JTHA 4CICA 2XGXA 2GIZA 2XF5A 5K5RA 1A35A 1ZGJA 2WAQN 4A3EJ 2KL4A 4OMZA 4FASD 3B73A 5JFRA 1LFBA 3TW6A 3K6GA 5FLVA 4LK1F 1Z3YA 4ITVA 3FISA 3VODA 3OS2A 1TW2A 5FD5A 5IP7J 4LLNA 3QP5A 4PCQA 5HVQC 3OIPA 1DU0A 3ECHA 1BIBA 4I2OA 5BPDA 4S05A 2OTJI 4BL0B 1BI2A 1LNWA 3OYHA 3ABTA 2XB0X 3FXMA 4B44A 2P6TA 4RAFA 1Y39A 3GZ5A 3B6AA 1LPQA 1NK2P 4XM3A 2TRTA 1YTYA 1Y8RB 2B63J 5H20A 1XPXA 3S93A 2HPMA 3I58A 1CF7B 1KU9A 5M5YJ 1SVLA 3MFKA 1JKRC 1UFMA 1WWXA 2EILH 3HUGA 2NRAC 1D1AA 3OL3A 3HTUA 2MD0A 2RGVA 3SXYA 5IOYA 1IV6A 4A5NA 3BQZA 2HPIA 3GFMA 4ZYGA 1R23A 4EM2A 2XPVA 3GTPJ 2Z33A 1R1UA 1MJAA 4BBSJ 3HYIA 4NC8A 2NYXA 1YLFA 1HCRA 1F43A 3LA3A 2EFOA 2F2EA 3JRAA 2WY8Q 4KN4X 3SEQA 4MLOA 1R7JA 3FF5A 1MBEA 3MWMA 4AWXB 4EEFG 4DGWB 1TT5B 4ZYHA 4NQWA 2F4IA 1G59A 3AFHA 2LKSA 4J00A 2LP0A 5D8LB 4BJ6C 1BL0A 3K4BA 4M71A 4LMYA 2Q2EA 4Z6YA 4OOIA 4RGXA 2V26A 1DPRA 4A3LJ 5TISC 3O6BB 2W7NA 3GVAA 3QPHA 3KETA 1W36D 2HNHA 3ZN0A 4XL9A 4KT6A 1GV5A 2X4HA 4L9JA 4ZYDA 4JQFA 1W5SA 2QF7A 2DFEA 1J5YA 2XAGA 2LY1A 1ZRDA 3H36A 5F64A 1LEAA 2LY2A 4JOMA 4RLFA 4G94A 3C2BA 4CH7A 2VQCA 4M74A 1KQ0A 3R60A 5EZHA 5HLGA 4QTRA 4E7IA 2COMA 1P9QC 1BC7C 4QWQA 2EIJH 1UHWA 2OJED 4RGUA 3BY6A 2HS5A 2V9VA 3SZGA 3BZCA 3E6MA 4LOCA 2M1BA 1MMGA 2XIGA 4G6QA 3IH2A 1GVJA 2DOAA 3O8HA 3WU2C 1E2XA 1LVAA 4D7NA 3Q5FA 1TNSA 2TDXA 2VJ4A 3CJQB 5DV5A 5C44J 3AL0B 1DQUA 2GOXB 3EYYA 3I9V2 5BQTA 3LSKA 2DOFA 3KP7A 5DCMA 2R7WA 2BBYA 3QODA 3L1PA 2FNPA 1T39A 2JRMA 2G9WA 2PFBA 2WB1N 4BEHA 2IP2A 5FKLA 1X58A 3GZ6A 1PDNC 2XAJA 2DYSH 4FETA 2L9VA 3I55I 2B9SA 3BPXA 1H0MA 2DPDA 2HDCA 3S3OA 3DBHB 3DTIA 2DOEA 3BJ6A 1OFCX 2V6EA 1GXPA 1X3ZB 4UVCA 3K1NA 4PGHA 4EGYA 2NNYA 1HDPA 2JUGA 1JUMA 1MZBA 1XSXA 4C2UA 2DA4A 1VQ5I 3RDIA 1OCTC 4CYCB 1ETVA 3W2AA 2CQQA 4HF0A 3SFZA 4WXDA 5CYVA 3LNQA 2ZJQF 1DDNA 2QBYA 1RNLA 5D5VB 2VOPA 3VYSB 3V4GA 3GLLA 2KIUA 1IDYA 3QPSA 5LRRA 2LMDA 2VN2A 1TWFJ 4BKXA 2QQ8A 1CQTA 2WC2A 3CCRI 1MKMA 3A4CA 4HDVA 3I59A 1X1DA 2R7RA 3QYEA 3NARA 3BZ6A 3LL7A 4ZTFA 1GHCA 3G1LA 3MD2A 2EZLA 1X4PA 2F4OB 5B1BH 2ESNA 4O6JA 4IHVA 1KU2A 1KA8A 2VKEA 1JE8A 2CW7A 2K5CA 3H0DA 2ZBKA 4MGRA 4QIWN 2MC3A 3OWTA 4Y4RA 1S7EA 4MQ9F 1B1BA 1XC5A 2GA1A 2E7WA 3HPGA 3ZGKA 5EGOB 1G3WA 3X2QH 5DUIA 1WJAA 1MSEC 2JN6A 1R71A 2EFPA 1IG7A 2C6YA 1S7OA 4E7KA 3BG7A 2OPTA 3KEQA 4E7LA 2DO7A 2B7EA 2L0KA 3FKJA 1MBFA 4OU0A 4KJZA 2BYVE 4NDLA 4A69C 5D5WB 4P9UA 3GWZA 1SMTA 2STTA 4LLGF 2QWWA 1SFEA 3OYDA 2P5LC 3E7LA 3MZ8A 2EJRA 4EM1A 5FRNA 2VJJA 3IWFA 3ZQ7A 3TDZC 4QSHA 2HQ5A 1HKSA 1IO2A 2EPFA 3KFWX 3KLOA 4IZZA 2P0WA 2D2WA 1KYWA 4DOZA 1UHMA 2PMHA 3KP6A 3BR0A 1CF7A 1P6RA 2VXZA 3V42A 3OYNA 3C1DA 4KFCA 3TKYA 3BR6A 4B48A 1H8AC 2LREA 4RAZA 2TCTA 3SDGA 2A61A 2AQEA 3FIWA 3K4MA 2XAHA 5K7ZA 3U2RA 4P1WA 4DZPA 5DYMA 1R49A 1JHFA 2F5VA 2KZGA 1K78A 5GP9A 2M87A 2BOLA 4CCMA 5D5UB 3BWGA 2E2IJ 3ZMSA 3M3YJ 5H6RA 1IF1A 3M4OJ 2VQHA 2K3FA 5FROA 2EFWA 2W82A 4M9ZA 1WQ2A 4UNOA 3RSNA 2H6CA 1J0RA 4YRVA 3KPHA 4XKVA 1YS7A 1WI3A 2DYRH 2YSRA 3M8EA 2KMUA 1ZREA 2CQ7A 1RC9A 3PO3J 2O61A 4MIMA 4PJNA 4CCLA 5LEKA 3F9KA 3UKGA 5F08A 1QPMA 5J8FA 1FBUA 1ZLKA 4Z2YA 2E2JJ 2FOKA 2LKPA 3G2BA 3PUBA 3H9JA 3I4NJ 1HSJA 2XVCA 3DEWA 3ZXSA 2VC1A 2M34A 2VE9A 3C7JA 2EQRA 1S29A 1POGA 3RKYA 4EMSA 1ENHA 1VNDA 4RB0A 5C4JJ 3U1KA 5AIPA 1XTAA 2X6OA 4YEJA 4GFBA 2PJPA 2X0LA 4NBQA 4BYYA 3LSJA 2A6TA 5EYRA 3GW2A 4ENNA 4KUMA 1SD7A 2H27A 5F0FA 1DPUA 4I6ZA 3BCAA 1RUOA 2YS9A 1KYZA 3DP7A 2EZIA 4A3CJ 1FBSA 3JRIA 1IJWC 3K70D 2OD5A 4D5FA 4KITB 1JXSA 5J6XA 1P4XA 2DFFA 1WH7A 3QAHA 4HF1A 2DJNA 2BGCA 1FTZA 2CUZA 1OYWA 1E3HA 5JR3A 2LFBA 4CXFA 2V4JC 2HKOA 4PJ0C 3OYEA 4M9XA 4HRIA 2XV4S 1PVEA 4XOTA 1O3TA 1T95A 1Z7LA 2IEKA 3N05A 1WJBA 3WTSC 3IC7A 4XKCA 3QOEA 2X85A 5HNHA 4G7HF 3A2KA 4PFOA 3ZQFA 3FXKA 3CDIA 4U87A 1UZCA 1QZZA 1XMXA 1B9MA 4I76A 3PSIA 1LDJA 2W57A 1Z1DA 5E1WA 3U1DA 3P9IA 2E5NA 3CP2A 3K4CA 4BE1A 4ZJZA 4UV9A 1JTXA 3KYCB 4RGRA 2CUFA 4DBQA 4KDPA 3CMAI 1O7FA 2RQPA 1ERDA 1E3OC 3CD6I 1G3TA 3Q0WA 2LDUA 3WHBA 1X3WB 1APLC 4F7ZA 3CCSI 1SD6A 4LIVA 5FO5A 5IP9J 5HLIA 1JGSA 2W24A 3HSRA 4CYCA 4OIQF 1ZH5A 1ITYA 3CLQA 1S3JA 2ZXHA 3OR2C 4O3MA 2XROA 1OCPA 3D1NI 1EJ9A 5K1YA 1FOXA 2A6HF 2BVLA 1X4OA 2MLKA 3R61A 4LG0A 3W6JB 5B3SH 4HLYA 2EV6A 1OJLA 5AONA 4IRIA 2XAFA 2P6SA 1L3LA 1GV2A 1XGMA 3PL8A 4HV6A 2DAOA 2V7FA 4ZYEA 4LD5A 4ZC3A 1X1AA 5J4VA 1R22A 2RVCA 5JVTA 4RS8A 3IAS2 4M73A 5D6FA 3ML6A 2NOGA 2EV5A 2IS1A 3C2GA 2X6WA 4JX5A 3LMMA 3QP6A 3S2HJ 1X3UA 5EGOA 3TP3A 1WJCA 3CP8A 1BJAA 3FMSA 3G73A 5HODA 1U9OA 3JRCA 4P5OA 2M45A 2MBFA 2UZKA 4DQ2A 4WCGA 4M6VA 4RDUA 5E17F 3E5QA 2LH9A 3O2PE 5DM7F 1XDSA 3EDPA 1BIAA 1Z21A 1K6YA 3HHGA 3MQ0A 2AQFA 2OC6A 4IHSA 4N4NB 2K3PA 2O5RA 5E20A 2NVXJ 1EA3A 2L4AA 4PSXA 3HOZJ 3HUGB 3HHHA 1SANA 1HQCA 2IA0A 3S15J 3JTGA 2NVQJ 1HDDC 1PYVA 1K4TA 2YR2A 2L9RA 1MH3A 4XLHA 2K9LA 1WFXA 2E60A 4M9SA 2CU7A 3EUHA 4LITA 1U8BA 2FOWA 3OR1C 2FMLA 1IGNA 5LEJA 2EIKH 2X6XA 3FK6A 3V8JA 1AWCA 2UWMA 2E34A 3I4PA 5JHUA 3E6CC 1YI2I 3PFYA 3Q9SA 1MBJA 1ETWA 5LD2C 2DT7B 3HOXJ 1OCRH 4XONA 1T56A 2XAQA 3DLAA 2L7MP 3H3ZA 4OIOF 2NVUB 4GGGA 4M72A 5DDGA 1ZG1A 2KP6A 2M5WA 2Q2EB 4WF2A 2FMYA 1HF0A 4MEYF 3P9KA 3CCUI 4CA0A 3TOAA 3GTOJ 3ZCOA 4HX4A 3K4LA 1QA6A 1YJ9I 4X6AJ 4FQGA 1Y1WJ 3F6VA 3GX4X 1R9TJ 2ZJRF 5H6QA 5LHIA 2HVRA 1V3FA 4WWCA 4UB8C 5BOXA 4BE2A 2NVYJ 4CZZA 4ZZDA 3I0TA 3OY9A 2VB6A 3LSTA 4P9FA 1IC8A 4I01A 4LIUA 1TQPA 2HWVA 2OUMA 4HQEA 2RV8A 3A0HC 1I1GA 3CESA 2HZTA 3LSRA 3F6OA 5E3NA 2R7SA 2W48A 1RESA 3BCBA 2OCCH 3JRFA 2GWRA 4KISA 1ON1A 3E3VA 3RJPA 1ETKA 1O3QA 2F6CA 1SFOJ 2HFHA 5EF6A 3FWEA 1PP7U 1D1BA 4X1EA 2F5CA 3WU0A 3QQAA 2M4KA 3PNVA 5IYCJ 1SVOA 3SDBA 2VQLA 2VBXA 2VT3A 2RN7A 5DCMB 2RAEA 1NG6A 5ILUA 2HOAA 4XOPA 2F5FA 3FK7A 3HTSB 2BV6A 3CCMI 1U78A 3D0SA 1A31A 2DA7A 2NXNB 3R4KA 1ZYRF 1OMIA 4XR6A 1U8RA 1YOVB 2D1HA 1YG2A 4Y15A 5B1AH 2DTRA 4RA2A 3RPUA 1X2MA 4C9YA 3JR9A 3HL2A 3A01A 4U0WA 4I7HA 4A12A 1FOWA 1ETYA 2D45A 2QBYB 4K2EA 4XQFA 2D5VA 1Y1VJ 3IP4B 2YUSA 3EUAA 3S1NJ 4KN7X 2HDWA 1VZ0A 3M1CA 4MTDA 1YW7A 1OR7A 2ZB9A 3HEFA 2MW8A 2IJLA 1BC8C 3DU6A 4UB6C 1QZYA 2GXBA 2O9LA 2UV1A 2LD5A 3OSGA 3MEXA 2RNGA 2IA1A 4WX9A 4IHTA 3DCFA 2JPCA 3BQYA 3CUQB 2IGNA 4N9IA 1IN6A 2PEXA 5F1JA 2MYSA 4HNVA 1J9IA 3OYFA 1M1EB 3CMEI 2ZXJA 4KICA 2ZCWA 4PJJA 1WZ2A 1SAXA 2CSOA 2VXDA 4U7BA 2UXXA 4BE0A 2XPUA 2ADUA 2EK5A 2CUJA 5CVUA 3WE2A 3OYMA 4YIFA 3PM1A 3I5UA 3DFGA 4ZDOA 5JI6A 2L4MA 2K9MA 4CO8A 2QCOA 5J47A 4BH9A 1G3YA 1LFUP 3HDDA 4UVAA 3OYJA 4XSZF 5J1UA 3RKXA 3GTMJ 2CG4A 2JZYA 2WV1A 2OV7A 5B66C 4YIRX 1ZGWA 3J7AO 1DGRM 4LB6B 2FQ3A 4BQOA 4MFDA 1R5ID 3D5SC 3LA2A 4BJTA 1P4AA 3F8NA 3QPLA 2PMZA 2R7OA 1K7AA 2L9SA 1S8NA 4HEA2 4JK1X 1U5TA 2FE3A 2VQGA 3B6CA 1XSVA 1JGGA 3I53A 1IAWA 1J2XA 1ODDA 1LEBA 5L3CA 1JT0A 2HZDA 1V5GA 2QEXI 4L18B 3M8FA 2QSHX 4N9HA 3R0AA 1XGOA 4GO1A 3F22A 2PN6A 4L0ZB 4IHYA 1K78B 2IS6A 1MW7A 2HXIA 2M0MA 4AD9A 3IAM2 1TZLA 3QOPA 2ZKZA 1WPKA 5FKKA 3SZTA 3EETA 3A1YA 4F55A 1B9NA 4PJMA 1SC7A 5H2FC 3S1QJ 4BHBA 1S9HA 2WADA 4XSXF 5CVRA 1O57A 2G0EA 2BXZA 2HQRA 2K85A 3JRDA 1H9GA 5HS7A 5LFAA 4GXOA 1JHHA 4I09A 4PSWA 2DW4A 2Y0MA 3FHZA 2DN0A 2DK8A 1UCRA 2EINH 1P7IA 3DWLE 2IW5A 2OQGA 3C3WA 3NQOA 2JTVA 4NUBA 1QQIA 1T2KA 2DMPA 2AXTC 3BG6A 3M8JA 3WTVC 3IRQA 1QHHD 3E6BA 2KJBA 2XGDA 3M1EA 4HX8A 5HS9A 1IV8A 2A69F 1A04A 5E1XA 3UNGC 2FF4A 2KFDA 5CKTA 4C3HJ 1T08B 4XKBA 3HPHA 3DLLF 1BOBA 1T98A 3WGHA 5M3FJ 3ZN1A 1HW2A 4KNYA 2O7OA 1D3YA 3GBGA 3K9TA 3GLXA 2CJJA 2CMPA 4HA8A 1PP8F 5D6EA 1TNTA 2YX7A 4IX7A 3E5XA 4ON0A 1VI0A 1T0FC 2GQQA 3PSFA 3K69A 5ICGA 3FBNB 2NOJB 3OYKA 3T8TA 2ME0A 1IXSB 1FX7A 5EZGA 3MKWB 2ECCA 4V2FA 3JSPA 4GYIA 4Y3OA 4C3IJ 2X51A 4Q48A 1JUPA 3HOSA 1OQYA 2GBYA 5A2QZ 2O3FA 4TV7A 2P5VA 2OCEA 4DYRA 2MC4A 2W85A 1O3RA 3WE3A 1ON2A 2NAZA 5HOOA 2CUEA 4IRHA 2X1EA 5F0HA 2H1LA 1I39A 3F3XA 2PI0A 2XC7A 1GLNA 2Z99A 2I5UA 2E1OA 3FKIJ 3KIOA 1YJNI 3KEYA 2COBA 2IXSA 1HW5A 1TBXA 4UXNA 4AIJA 1YYVA 4FX4A 2DQLA 4QPOA 2ZXWH 3L2QA 1IN4A 1FMWA 3LWFA 3QYBA 5DM6F 3KZYA 4CYDA 2R7VA 5J3LA 5JVGF 2IS4A 4G6TB 1P92A 2BY3A 4YFKF 4F92B 3WG9A 2XB5A 2K27A 2XRNA 2LVSA 3NAUA 3KYDB 3W6KB 2VT2A 4A3JJ 2ME6A 1E17A 5LRSA 3FBIB 5DTDA 1D0XA 1W4MA 2KIFA 3HRUA 3KEOA 2GXGA 3QYFA 2LKXA 3TMOA 3IV5A 2KZVA 4FE4A 2KIMA 3CCLI 1DP7P 2GXAA 2M2EA 3WHCA 4LG0B 1LDDA 4IRGA 1X1BA 1BBYA 4R8HA 1UAAA 4MQVA 2BY2A 2HKXA 4EATA 4OAYA 5KCMA 1WGXA 2W84A 2FBHA 3W2WA 4II3A 4XICA 3FXLA 3CUQA 3K70C 4F3QA 1R00A 3OYBA 4HV5A 4DBRA 3MAJA 5FKNA 1I6XA 2ZMEB 4EJTA 1RIOH 1TL8A 1R36A 5CLSA 3RPUD 5TRDA 4FE7A 4AIKA 3IKVA 1DU6A 2AS5F 2D1VA 2NS7A 4HBLA 3F23A 4ENKA 3AAFA 1VQ7I 1BW5A 3WTUC 4XNFA 5HNFA 1FP1D 3JAMZ 2XSJC 4HF2A 3RZOJ 5E1ZB 2M7BA 4MTEA 1XG1A 2ZO4A 1TWCJ 2RQQA 3MKLA 2FU4A 5ILSA 2X9DA 2JUCA 5ICEA 3WODF 1Q1VA 4UY8I 2DT6A 4LK0F 2PMZN 1AU7A 4L5JA 2R7UA 2GZWA 3RTRA 1FT9A 3SJMA 3L9FA 1AOYA 4KT5C 4C3JJ 2W25A 4ZTJA 4S04A 4ZDLA 2PQ8A 4U0VA 4AVPA 2M8GX 1XDUA 4E7HA 3WU1B 1ETXA 2IAIA 2MSYA 2P5KA 3FM3A 1G4DA 2R3SA 2K86A 3T8RA 3ULQB 1OLTA 3L2CA 4BBRJ 2ETHA 1JI8A 4IF4A 3OL4A 2OTLI 1QVTA 4XLPF 1YRNB 2E36A 3WTTC 5BPIA 2LLKA 2K9SA 1ETOA 1ZKGA 4W1UA 5IY5H 4CUGA 1MNEA 1LE8A 1I27A 5TJJA 3S1RJ 4ESFA 3HXLA 3LSHA 4I99C 4G7ZF 2CRGA 2V1NA 1I50J 1MMAA 3ABLH 3HM5A 2Y69H 2LY9A 2E7XA 4HLXA 5DS9A 5KNLA 1VQ9I 4A3IJ 4ESJA 2DA6A 4II2A 3PNTA 2VBYA 2OAZA 5BS6A 1BI1A 1DGWY 1T38A 2L9NA 2HOEA 4CCOA 1FOKA 2E1CA 2HXOA 5HDKA 2QENA 4MO7A 3ZMUA 2R92J 2CV1A 3SFIA 2EV0A 4XKWA 4E7JA 1TTYA 5J1RA 2HVSA 4EV0A 1SFKA 5M5WJ 2B0LA 1EH6A 4XLFA 1HOMA 3DF8A 3WGGA 2EFQA 4BXFA 2VJ5A 3DTKA 3ISPA 3DKWA 4IJAA 4JX6A 3FXOA 3UR3C 3BOQA 4L5IA 1D1CA 3GXOA 4IO9F 4G7OF 3ZR8X 4Y13A 4ZZLA 1K83J 5FJ8J 1IRXA 2ELHA 4BY7J 1ZR4A 1MMSA 2KRFA 3A02A 3EQLF 2R7QA 1ZRFA 3VSLA 1XMKA 1RI7A 3C18A 3H5AA 2VE8A 3M9AA 5CQEA 1IUYA 3ZQHA 2E35A 4BXUA 2IS2A 1YE9A 2PMUA 2XHKA 2CO5A 5E8IA 3C2HA 1SFUA 2DLLA 2J5PA 3ZQIA 1E0EA 1KQ8A 4B3XA 3MKZA 4XRSA 2OBPA 3V8KA 3GTJJ 3M07A 4HSTA 1OPCA 2HQAA 2EIMH 3DEEA 4R79A 4EGZA 1STZA 2PLYA 4D5CA 3F8FA 2KHMA 2ELKA 4BU2A 1U2WA 5F27A 2G7UA 2YX4A 2CQNA 4Y17A 2F48A 2K40A 2A3SA 1LQ1A 2HQNA 2ISZA 4BHPA 3PIOF 2R0QC 4L9VA 3GCMA 2L54A 3LFUA 4R1HA 5IYDJ 1LVKA 4RBOA 2VBZA 3NWSA 2M0CA 2A6EF 3W3CA 5DUKA 2XAUA 3D5LA 2KISA 5F6FA 2ZJ2A 4JYKA 3A01B 2DQRA 2JA5J 2GA2A 2DA1A 4A3FJ 3RKWA 2BW3A 2K4JA 2HOTA 2IVMA 2ZNZA 2Y30A 3QWLA 2H94A 4Q4ZF 1HXDA 3GFJA 3KP2A 2P81A 5CQGA 5JHFA 3BTIA 3K10A 3SYTA 1IRZA 1O4XA 1WJ5A 1WHUA 4UUTA 1XS9A 3F8CA 4BDYA 4OAZA 4U7DA 2QUFA 1E3PA 3MZYA 5F1RA 3T0YA 4XRMA 5LGUA 1LDKB 3PNYA 1FSHA 3U9GA 4LG3A 4AIDA 3H3VK 1JTYA 3GTKJ 1HA8A 1L0OC 3K4KA 1ZAOA 3PQKA 2R7ZJ 1IN5A 2ICWG 2F5DA 2R7TA 5GTIC 2FX0A 3KZZA 2E19A 2QGUA 3KX2A 3F8BA 2CGPA 1ZN2A 1ZHFA 3ABKH 3GMEA 2HR3A 1FJLA 2LK2A 3ECOA 4BQQA 3G6EI 5E3OA 4KYWA 2QQAA 1NH3A 2RKHA 2A05A 1QGPA 1VQNI 3I56I 3WTXC 2ZMEA 2L2OA 3DV8A 2JSCA 4IOCF 2R7FA 3DPLC 3V7RA 4HOBA 3JSOA 1I6HJ 4N0BA 1Y6IA 4I0AA 4XN3A 3HIFA 5JLWA 3VB2A 3LQRA 2JVGA 3G71I 3F21A 3H9GA 3GFIA 4Y52J 5J8CA 1BI0A 2EH3A 2L7ZA 1KGSA 3Q0UA 1K6OA 4XRFA 4V2GA 2EBIA 2DBBA 2CS3A 5ICCA 1HC8A 3NWTA 3CJNA 1QBJA 5HS8A 2WA0A 3VDXA 2VKHA 1KONA 1R1TA 3OYAA 1U5TB 5HDNA 3OSFA 1FYMA 4A0ZA 2CW8A 1R4NB 2DDAA 3EYIA 1V54H 2K9QA 5E3MA 3ZQQA 1O3SA 4Q47A 2DA2A 4YIIA 2QKLB 1ULYA 3GF2A 2A5WA 2E71A 4B3AA 4NC7A 3H92A 2CV0A 2P8TA 1IXCA 3VYUB 2BHYA 3H1CA 1V4RA 1VF9A 1YRNA 3LSPA 5ED4A 1MMNA 2QZ8A 2R5YA 3L7WA 5E8GA 4BJ5C 3DTEA 3GTLJ 5F04A 4ABZA 5DD4A 1U9NA 3I54A 5HLTA 1TQIA 1WJEA 3RPQA 2MH9A 3BG3A 3DEUA 1V55H 1R5GA 1RKWA 3AL0C 3J81Z 2JSPA 1HSTA 2K7LA 3SQNA 3FMRA 3OYCA 2E1MB 1IUFA 4L0YB 2CQKA 3BG9A 1U6GA 3TO6A 4I98B 1PUEE 2JWTA 4A0YA 1IN8A 2DPUA 3GEZA 3WTZA 5K7HA 1B8IA 1VQOI 5D4SA 3N97A 4G12A 4CCJA 2MH2A 3HRMA 2PJRB 1Z05A 1N25A 1MBHA 2Z5UA 1D5VA 2NS8A 2VODA 3S17J 5M3MJ 2R5ZA 3TGNA 1MDMB 1UG2A 1RPWA 2HYJA 3CMMA 2KDZA 2GM4A 3HOUJ 2YU3A 3RYPA 4DW6A 1REPC 3S3MA 2LSOA 2XKPA 2LYCA 3BJAA 3ZMTA 1A5JA 3TL4X 3FZVA 3BPVA 3G3ZA 1XB4A 4MEXF 5EDNA 1SFXA 3ZQCA 2E1NA 3U21A 1V5EA 4OWRB 2O6GE 3CUOA 1X1CA 3B02A 3CDLA 2LNBA 2ZFWA 3K1PA 1ORKA 4RLQA 1VQPI 5K7FA 1YITI 2CW0F 3BJOA 5LGNA 2Y2ZA 5GAEJ 4XIDA 1ZG5A 4GYGA 1TLHB 1VTNC 4CHUA 4F52A 2VASA 5J4YA 1SD4A 1G3SA 2Y48A 3BTJA 2MABA 3CCQI 3K2ZA 2WAEA 4G6DA 3L09A 3CQZJ 3RQIA 4JBAA 4H4KC 3E0JB 3OOUA 4YFXF 3IH3A 1JUSA 2Q8KA 5LLQA 3BR3A 3TO9A 4U0YA 2Z16A 4BS9A 4XBFA 1SMYF 1KU7A 1YHQI 4L9NA 1Z0XA 1JJ6C 2QQBA 3I4MJ 3VFZA 2GOMA 5LBQA 3ZMZA 4JX4A 4H0EA 1D8JA 2QSGX 2ECBA 5EG0A 5FKMA 4MNUA 3JCUC 5IP6A 3QRFF 1HKQA 4OINF 3LSGA 4QPQA 2LF8A 3PUFA 3OS0A 2W1OA 1T6SA 2VBWA 4NB5A 4X0GA 1VQ4I 1MJ9A 4BHCA 1FEXA 4E7ZA 1MBGA 4ESBA 4LGWA 2IRFG 2CYYA 3MMYB 4PK4A 3VWBA 5FFZA 5DCFA 5D5XB 2EB7A 4OIPF 4A0XA 3EUHC 3HB9A 2DFIA 3GTQJ 3BROA 1PUFB 3HG9A 4XLEA 1G8XA 1XN7A 3FM5A 4MFEA 2JA2A 2V1XA 3GO5A 3AG3H 3AKZA 4PJLA 3VYRB 3ZQLA 1S72I 2Z9OA 4PFPA 1QPIA 3KZIC 3LSIA 5KVRA 4ZYAA 2RC4A 2HOSA 1K4SA 1Z67A 2FEZA 2VPLA 1VQ8I 1IXRC 1LKXA 4C2MJ 3VPRA 1RR8C 3L2WA 1DUXC 4BNCA 4IHWA 1I3AA 4BQNA 1XCVA 3PFIA 5IPAA 2HI3A 2EFNA 1R4MB 3PIPF 1JKQC 4E70A 3BP8A 2KT0A 5L3DA 2VI6A 2Y9YA 2Z3YA 4EQQA 4UUSB 3K2AA 3IKTA 5GPCA 4C30A 1MNDA 4HX7A 2L7KA 4W97A 4AM3A 1R58A 1EH7A 3VOEA 5FLXK 5GTHC 5A2QK 3CCJI 3HRSA 2FBKA 3CMYA 3TO7A 4E7SA 4NC6A 4LLLA 1MH4A 4KMUX 4E4HA 1BR4A 1MNMC 4AUXA 1W1WE 4OMYA 2ID6A 2V1DA 3TP0A 2XF7A 2M8EA 1JKOC 1FTTA 1MJBA 1AKHB 2DDBA 2QSFX 2Y0SA 4LJZF 1LE8B 1EKEA 2GIVA 4RAGA 5DD8A 5FKOA 3D5RC 1R1VA 2ESHA 3CLOA 2JA7J 2XSDC 1Z9CA 2HU9A 4F93B 1XSDA 2BE5F 2HGCA 1FY7A 2XUBA 4WXCA 4LFUA 4O5VA 4DJAA 1FLIA 4S0HB 2V6CA 1N78A 5DEQA 2KQRA 3L00A 3I3LA 2XDVA 2VKDA 1P2FA 3FXQA 3Q0VA 3IRRA 1OCZH 3LOCA 3CCVI 4U88A 4C2TA 1B4AA 3LQQA 3G1OA 4L9TA 1BW6A 1S5LC 1FYLA 2RREA 1TQMA 2PBIA 1WVRA 3Q9VA 1VQKI 2HDDA 4EJUA 3ZMVA 4DZJA 4A3BJ 1W7PA 5L3EA 2WAFA 1MSFC 3RCOA 1HKTA 5L3BA 3H9QA 3H3UA 3GZNB 5HLHA 2DU9A 3RQ4A 3ERED 2PJRA 2CH0A 4RB2C 1UG0A 4A2UA 3KYLA 1UHSA 1QRYA 1OKRA 1F36A 2JMWA 4A3GJ 5AIQA 1ZELA 3BR5A 3ROUA 1K79A 1MDMA 1OR7C 5EJCA 5F0CA 3A03A 4RGSA 3S2WA 3I71A 2FD5A 3H5NA 4EJOA 1TP4A 3MVPA 4RAYA 3JRHA 1JKPC 3L2RA 3ESWB 5K5OA 5L3GA 4CGZA 2EA2A 2HVQA 3LFKA 3JAMK 2Q0OA 4Y33A 3HSFA 1Y56A 3WGIA 1ZGAA 3LAJA 4PGGA 2OU2A 2CFOA 1YX5A 5CVJA 1KQ9A 3HGYA 1USSA 3K7AJ 3S16J 5CVIA 2Z2SB 3WTWC 5FLXZ 1WKMA 1K61A 1SEUA 1G2HA 4XLCA 4A6EA 2O8XA 2DMNA 5K5QA 1Y0UA 5IYBJ 5FGMA 3CC7I 1O7LA 5D8KB 3DKYA 1IZ1A 1WJDA 4M3FA 2X1DA 4RMNA 4HAMA 9ANTA 3IH4A 4J19A 2OA4A 1FMVA 1QNTA 1TWHJ 1H9TA 2JQ7A 2W00A 2WTEA 3BTLA 3HC7A
chains in the Genus database with same CATH topology
1FWZA 2FBIA 2WV0A 2STWA 4BQAA 5IT3A 3NRVA 3ZMDA 2PG4A 1U5TC 3BDDA 4IPAA 3KP4A 4PZJA 1IW7F 1USTA 1B59A 4WK8F 1GXQA 2EA4A 2V79A 2P7VB 3DXJF 3M7GA 4HW0A 4HYEA 1Z91A 4RB1A 3DPTA 4D0PA 1IN7A 1C0WA 1S7AA 4DNCA 1RUNA 3SZPA 3KLNA 3E5UA 2L01A 2GAUA 1Z6RA 3K1MA 3TQNA 2V1UA 4EJVA 4EVIA 3LAPA 4KA4A 2H6BA 2UXNA 2HEOA 2P7CB 2DI3A 4YG2F 2MD5A 4IVNA 3CO7C 1Z6TA 4UUVA 4P96A 2FRHA 3ZP5A 3R0JA 1IRGA 2NNNA 3WTYC 4KMFA 3I64A 4WXHA 3ELKA 2MLGA 5HDGA 2HTSA 3ABUA 1WSUA 1Q1HA 1FZPB 2VOOA 4QLCU 1WRJA 3KP3A 1ZRCA 4ASNA 3RYRA 2OZ6A 3SHFA 5LHGA 4UV8A 2AXLA 3FXRA 2VONA 4GCVA 2OZUA 2KKOA 3V7CA 3V8LA 1W5TA 1RZ4A 3OV8A 2XASA 1D8KA 5EEGA 5FB2A 5FD6A 4KIBA 3CO6C 2K4BA 2YPRA 2XKOA 3N4MA 3O3KA 1WI9A 4M6XA 1F5TA 2FA5A 4EJWA 2A68F 2CFXA 3FX3A 1FPQA 2ZNYA 1I1SA 1XD7A 4MHGA 1ZG3A 1YQAA 4XLNF 1XGNA 3CDHA 3QPTA 1FBQA 4CDGA 2WWYA 4FX0A 3DQVC 3GUDA 2VC0A 4P55A 5ILVA 5L3FA 2FXAA 4G8XA 2RNJA 2G7HA 3R6SA 2FSWA 3CUQC 2NS0A 1EH8A 3FMQA 3JW4A 1Z7UA 1XMAA 1ZARA 2H09A 1IRFA 1W7PD 2L02A 3RIRA 2A5YB 2ACJA 1FSEA 5D4RA 1YIOA 3J80K 1CGPA 1SD5A 5IT9K 3MZHA 1XGSA 1F1ZA 5ERIA 1LJ9A 3TDUC 4UHTA 1J59A 2KJCA 2JPBA 2M30A 2O03A 3T5XA 3HOTA 4YFNF 5KK1A 3KE2A 3J81K 1HBXG 1S6LA 3PQJA 1J7KA 1YFHA 2BEOA 5FFXA 1ONVA 2JRTA 4OIRF 1G6NA 3KCCA 5LHHA 1MD0A 2DK5A 3HRTA 1ZLJA 3T1BA 3GFLA 1TW3A 3RI4A 4ETSA 4A5MA 3LA7A 5ICFA 1F4KA 2IPQX 1UB9A 2QYOA 4IXAA 1BOAA 3V7SA 1FNNA 3COAC 4UVBA 2A07F 3K0LA 2LF7A 2ISYA 2K02A 2QQ9A 3J80Z 2L3DA 3IWZA 1EV7A 5IT9Z 2JT1A 2EWNA 4ENJA 4FHTA 1MGTA 1P4WA 4G9YA 5E18F 3MCZA 4B09A 3IL2A 2P4WA 1OYYA 2QVOA 3VEPA 2FNAA 5CVVA 1BI3A 4I02A 2J5OA 3F8MA 2DT5A 3FXUA 1W7PB 3CTAA 3REOA 4HQMA 4M6YA 2R7DA 4KIFA 3P7NA 1BM9A 4LB5A 4BAYA 1OYIA 1YW9A 4AIHA 3QU3A 1LB2A 1YO5C 1I5ZA 5BMZA 4A6DA 5CJ9A 2IA2A 3E6DA 2QLZA 1BN5A 2F5EA 1FYKA 1NHAA 3TOBA 3E97A 4KIGA 4ENMA 5LGTA 2MA3A 5EEHA 1J75A 1XCBA 1YW8A 4RB3C 4Q5SF 3GYHX 1U3EM 4I0BA 3P9CA 4HZFA 3HSEA 1B6AA 2Y75A 3KP5A 6PAXA 2HYGD 4PDKA 2HYFA 2CWEA 1R5HA 1QO0D 3OOPA 4ZH4F 2QM3A 2O0YA 3QU6A 4EM0B 1KU3A 1YS6A 2OQRA 4FT8A 3IHUA 2RDPA 1F9NA 2HTJA 2IT0A 3F72A 3I59B 1FC3A 1HW1A 3NEUA 4B8XA 1T0FA 4NHJA 4HDUA 3ZPLA 1FP2A 3JTHA 4CICA 2XGXA 5K5RA 1ZGJA 4OMZA 3B73A 5JFRA 4LK1F 3VODA 1TW2A 5FD5A 4LLNA 3QP5A 4PCQA 5HVQC 3ECHA 1BIBA 4I2OA 5BPDA 4S05A 1BI2A 1LNWA 3ABTA 2P6TA 3GZ5A 1YTYA 5H20A 3I58A 1CF7B 1KU9A 3MFKA 1UFMA 1WWXA 3HUGA 2NRAC 3HTUA 2RGVA 3SXYA 4A5NA 3GFMA 4ZYGA 1R23A 4EM2A 2Z33A 1R1UA 1MJAA 3HYIA 2NYXA 1YLFA 3LA3A 2EFOA 2F2EA 4KN4X 1R7JA 3FF5A 3MWMA 4AWXB 4ZYHA 4NQWA 5D8LB 4M71A 4LMYA 2Q2EA 4OOIA 4RGXA 1DPRA 3O6BB 3GVAA 3QPHA 3KETA 3ZN0A 2X4HA 4L9JA 4ZYDA 4JQFA 1W5SA 1J5YA 2XAGA 1ZRDA 5F64A 1LEAA 4G94A 4M74A 1KQ0A 3R60A 5HLGA 2COMA 1BC7C 4QWQA 1UHWA 4RGUA 3BY6A 2HS5A 2V9VA 3E6MA 2M1BA 2XIGA 4G6QA 1GVJA 1E2XA 1LVAA 3Q5FA 1TNSA 2TDXA 5DV5A 3EYYA 5BQTA 3KP7A 5DCMA 1T39A 2BBYA 2FNPA 2G9WA 2PFBA 2IP2A 3GZ6A 1PDNC 2XAJA 1H0MA 2HDCA 3BPXA 2DPDA 3BJ6A 1GXPA 4EGYA 4UVCA 3K1NA 4PGHA 2NNYA 1MZBA 1XSXA 3RDIA 3SFZA 4HF0A 1DDNA 4WXDA 5CYVA 2QBYA 1RNLA 5D5VB 2VOPA 3V4GA 2KIUA 5LRRA 2VN2A 2WC2A 1MKMA 4HDVA 3I59A 3BZ6A 1GHCA 2ESNA 4O6JA 1KU2A 1KA8A 1JE8A 2ZBKA 4MGRA 2MC3A 4MQ9F 1B1BA 2GA1A 2E7WA 1G3WA 5DUIA 2EFPA 2C6YA 1S7OA 3KEQA 2DO7A 4OU0A 2BYVE 5D5WB 4P9UA 3GWZA 1SMTA 2STTA 4LLGF 2QWWA 1SFEA 2P5LC 2EJRA 4EM1A 3IWFA 3ZQ7A 3TDZC 1HKSA 3KFWX 3KLOA 2D2WA 1KYWA 1UHMA 2PMHA 3KP6A 1CF7A 1P6RA 2VXZA 3C1DA 4KFCA 3TKYA 4RAZA 2A61A 2XAHA 3U2RA 5DYMA 1JHFA 1K78A 2M87A 5D5UB 3BWGA 3ZMSA 5H6RA 1IF1A 2EFWA 4M9ZA 1WQ2A 4UNOA 2H6CA 1J0RA 1ZREA 1YS7A 2O61A 2YSRA 3M8EA 5LEKA 1QPMA 5J8FA 1FBUA 1ZLKA 4Z2YA 2FOKA 2LKPA 1HSJA 2XVCA 2VC1A 2VE9A 3C7JA 1S29A 3RKYA 4EMSA 4RB0A 5AIPA 2PJPA 2X0LA 4BYYA 3GW2A 4ENNA 4KUMA 1SD7A 2H27A 1DPUA 1RUOA 1KYZA 3DP7A 1FBSA 2OD5A 1JXSA 5J6XA 1P4XA 3QAHA 4HF1A 2BGCA 1OYWA 5JR3A 4CXFA 2HKOA 4M9XA 2XV4S 1O3TA 3WTSC 3IC7A 4G7HF 1QZZA 1B9MA 1LDJA 2W57A 3U1DA 1Z1DA 5E1WA 3P9IA 4UV9A 4RGRA 4KDPA 1O7FA 2RQPA 1G3TA 2LDUA 4F7ZA 1SD6A 5FO5A 5HLIA 1JGSA 2W24A 3HSRA 4OIQF 1ZH5A 1S3JA 4O3MA 2XROA 5K1YA 2A6HF 4LG0A 4HLYA 3W6JB 2MLKA 3R61A 2EV6A 5AONA 4IRIA 2XAFA 2P6SA 1L3LA 1XGMA 4HV6A 2DAOA 4ZYEA 4LD5A 1R22A 2RVCA 5JVTA 4RS8A 4M73A 5D6FA 3ML6A 2EV5A 3QP6A 1X3UA 3FMSA 1BJAA 3G73A 4P5OA 2M45A 2MBFA 2UZKA 4DQ2A 4WCGA 5E17F 3E5QA 3O2PE 1XDSA 3EDPA 1BIAA 3HHGA 3MQ0A 4IHSA 5E20A 2L4AA 3HHHA 1HQCA 2IA0A 3JTGA 2YR2A 4M9SA 3EUHA 2FMLA 5LEJA 3V8JA 1AWCA 2UWMA 3E6CC 3I4PA 5JHUA 3Q9SA 2XAQA 4OIOF 3H3ZA 4GGGA 4M72A 5DDGA 1ZG1A 2M5WA 4WF2A 2FMYA 4MEYF 3P9KA 3TOAA 4HX4A 3F6VA 3GX4X 5H6QA 5LHIA 1V3FA 4WWCA 5BOXA 4CZZA 4ZZDA 3I0TA 3LSTA 4P9FA 4I01A 1TQPA 2HWVA 4HQEA 2RV8A 1I1GA 2HZTA 3F6OA 2GWRA 1ON1A 3E3VA 3RJPA 1O3QA 2HFHA 3FWEA 1PP7U 2F5CA 3WU0A 2VBXA 2VT3A 2RN7A 5DCMB 5ILUA 2F5FA 3HTSB 2BV6A 1U78A 3D0SA 3R4KA 1ZYRF 1OMIA 1U8RA 2D1HA 1YG2A 4Y15A 2DTRA 3RPUA 4U0WA 4I7HA 4A12A 2D45A 2QBYB 4K2EA 4KN7X 4MTDA 1YW7A 1OR7A 2IJLA 1BC8C 1QZYA 2GXBA 3MEXA 2IA1A 4WX9A 4IHTA 2JPCA 3CUQB 4N9IA 1IN6A 2PEXA 1J9IA 2ZXJA 4KICA 2ZCWA 1SAXA 2CSOA 4U7BA 2UXXA 2ADUA 2EK5A 5CVUA 3WE2A 4YIFA 3I5UA 3DFGA 5JI6A 2L4MA 4CO8A 4BH9A 1G3YA 4UVAA 4XSZF 3RKXA 2CG4A 2JZYA 3J7AO 4LB6B 2FQ3A 3LA2A 1P4AA 3F8NA 1K7AA 1S8NA 4JK1X 1U5TA 2FE3A 1XSVA 3I53A 1IAWA 1J2XA 1ODDA 1LEBA 5L3CA 4L18B 3M8FA 4N9HA 3R0AA 1XGOA 4GO1A 3F22A 2PN6A 4L0ZB 1K78B 4AD9A 3QOPA 3SZTA 2ZKZA 3EETA 1B9NA 4BHBA 4XSXF 5CVRA 1O57A 2HQRA 1H9GA 5HS7A 4GXOA 1JHHA 4I09A 2DW4A 2Y0MA 3FHZA 2DK8A 1UCRA 2IW5A 2OQGA 3C3WA 3NQOA 2JTVA 1QQIA 1T2KA 3IRQA 3WTVC 3E6BA 3M1EA 2KJBA 4HX8A 5HS9A 2A69F 1A04A 5E1XA 2FF4A 1T98A 3WGHA 3ZN1A 1HW2A 4KNYA 1D3YA 3K9TA 3GLXA 4HA8A 1PP8F 5D6EA 1TNTA 2YX7A 3E5XA 4ON0A 2GQQA 3K69A 5ICGA 3T8TA 1IXSB 1FX7A 3JSPA 4GYIA 4Q48A 3HOSA 5A2QZ 2O3FA 4TV7A 2P5VA 2W85A 1O3RA 3WE3A 1ON2A 2NAZA 5HOOA 4IRHA 3F3XA 2PI0A 2Z99A 1HW5A 1TBXA 4UXNA 4AIJA 1YYVA 4FX4A 2DQLA 1IN4A 3LWFA 3KZYA 4CYDA 1P92A 4YFKF 3WG9A 2K27A 2XRNA 3W6KB 2VT2A 1E17A 5LRSA 1W4MA 2KIFA 3HRUA 3KEOA 2GXGA 2KIMA 1DP7P 4LG0B 1LDDA 4IRGA 4R8HA 1BBYA 4MQVA 2HKXA 2W84A 2FBHA 3CUQA 1R00A 4HV5A 3MAJA 1I6XA 2ZMEB 4EJTA 1RIOH 1R36A 5CLSA 5TRDA 4AIKA 3IKVA 2AS5F 2D1VA 4HBLA 3F23A 4ENKA 3AAFA 3WTUC 1FP1D 3JAMZ 4HF2A 5E1ZB 4MTEA 2ZO4A 2FU4A 5ILSA 5ICEA 3WODF 4LK0F 4L5JA 2GZWA 3RTRA 1FT9A 3L9FA 1AOYA 4KT5C 2W25A 4S04A 2PQ8A 4U0VA 4AVPA 1XDUA 3WU1B 1G4DA 2P5KA 3FM3A 2R3SA 2K86A 3T8RA 3ULQB 3L2CA 2ETHA 4IF4A 4XLPF 3WTTC 5BPIA 1I27A 5TJJA 4ESFA 4G7ZF 2E7XA 4HLXA 4ESJA 2VBYA 2OAZA 5BS6A 1BI1A 1T38A 2HOEA 2E1CA 1FOKA 5HDKA 2QENA 3ZMUA 2EV0A 1TTYA 4EV0A 2B0LA 1EH6A 3DF8A 3WGGA 2EFQA 3ISPA 3DKWA 4IJAA 3BOQA 4L5IA 3GXOA 4G7OF 4Y13A 4ZZLA 2ELHA 2KRFA 3EQLF 1ZRFA 1XMKA 1RI7A 3C18A 2VE8A 3M9AA 1IUYA 4BXUA 2PMUA 2XHKA 2CO5A 5E8IA 1SFUA 2DLLA 2J5PA 1KQ8A 2OBPA 3V8KA 1OPCA 4EGZA 4R79A 2PLYA 1STZA 3F8FA 1U2WA 2G7UA 2YX4A 4Y17A 2A3SA 1LQ1A 2HQNA 2ISZA 4BHPA 4L9VA 2L54A 4R1HA 2VBZA 2A6EF 5DUKA 3D5LA 5F6FA 2ZJ2A 2DQRA 2GA2A 3RKWA 2K4JA 2IVMA 2ZNZA 2H94A 4Q4ZF 1HXDA 3GFJA 3KP2A 3F8CA 4U7DA 2QUFA 3MZYA 5F1RA 3T0YA 5LGUA 1LDKB 1FSHA 3U9GA 1L0OC 1ZAOA 3PQKA 1IN5A 2F5DA 3KZZA 3F8BA 2CGPA 1ZN2A 1ZHFA 2HR3A 3ECOA 4KYWA 2QQAA 2RKHA 1QGPA 3WTXC 2ZMEA 3DV8A 2JSCA 2R7FA 3DPLC 3V7RA 4HOBA 3JSOA 4N0BA 4I0AA 3HIFA 3VB2A 3LQRA 3F21A 3GFIA 5J8CA 1BI0A 1KGSA 1K6OA 4XRFA 2DBBA 5ICCA 3CJNA 1QBJA 5HS8A 1R1TA 1U5TB 5HDNA 1FYMA 4A0ZA 3EYIA 1O3SA 4Q47A 4YIIA 1ULYA 3GF2A 3H92A 2P8TA 1IXCA 1V4RA 5ED4A 2QZ8A 3L7WA 5E8GA 5DD4A 3I54A 1TQIA 3RPQA 2MH9A 3DEUA 1R5GA 3J81Z 3SQNA 1HSTA 2K7LA 3FMRA 4L0YB 2CQKA 1U6GA 3TO6A 4I98B 1PUEE 4A0YA 1IN8A 2DPUA 3GEZA 3WTZA 5D4SA 3N97A 2MH2A 3HRMA 1Z05A 1D5VA 2Z5UA 2VODA 3TGNA 1MDMB 2YU3A 3RYPA 1REPC 2LSOA 2XKPA 3BJAA 3ZMTA 3FZVA 3BPVA 3G3ZA 1XB4A 4MEXF 1SFXA 2E1NA 2O6GE 3CUOA 3B02A 2LNBA 2ZFWA 3K1PA 2CW0F 3BJOA 5LGNA 1ZG5A 4GYGA 1TLHB 1VTNC 4CHUA 1SD4A 1G3SA 2Y48A 3K2ZA 4G6DA 3L09A 4JBAA 4YFXF 2Q8KA 5LLQA 4U0YA 3TO9A 1KU7A 4XBFA 1SMYF 4L9NA 2QQBA 3VFZA 5LBQA 3ZMZA 4H0EA 1D8JA 4MNUA 3QRFF 1HKQA 4OINF 2LF8A 1T6SA 2VBWA 4NB5A 1MJ9A 4BHCA 4ESBA 2IRFG 4LGWA 2CYYA 5FFZA 5DCFA 5D5XB 2EB7A 4OIPF 4A0XA 2DFIA 3BROA 1XN7A 3FM5A 2V1XA 3GO5A 2Z9OA 5KVRA 2RC4A 2FEZA 1IXRC 4BNCA 1DUXC 1XCVA 3PFIA 2EFNA 4E70A 3BP8A 5L3DA 2Z3YA 4EQQA 3IKTA 4HX7A 1R58A 1EH7A 3VOEA 5FLXK 5A2QK 3HRSA 2FBKA 3TO7A 4LLLA 4KMUX 4OMYA 2V1DA 2M8EA 1MJBA 4LJZF 2GIVA 5DD8A 1R1VA 2ESHA 3CLOA 1Z9CA 1XSDA 2BE5F 2HGCA 1FY7A 2XUBA 4WXCA 4LFUA 4O5VA 1FLIA 2V6CA 5DEQA 3L00A 1P2FA 3FXQA 3IRRA 4U88A 1B4AA 3LQQA 4L9TA 1FYLA 1TQMA 2PBIA 3Q9VA 4EJUA 3ZMVA 1W7PA 5L3EA 1HKTA 5L3BA 3H3UA 5HLHA 2DU9A 3ERED 4RB2C 4A2UA 1OKRA 5AIQA 3ROUA 1K79A 1MDMA 4RGSA 3S2WA 3I71A 4EJOA 4RAYA 5K5OA 5L3GA 4CGZA 2EA2A 3LFKA 3JAMK 2Q0OA 3HSFA 3WGIA 1ZGAA 3LAJA 4PGGA 2OU2A 5CVJA 1KQ9A 1USSA 5CVIA 3WTWC 5FLXZ 1WKMA 4A6EA 2O8XA 5K5QA 1Y0UA 5FGMA 1O7LA 5D8KB 1IZ1A 4HAMA 2OA4A 1QNTA 1H9TA 2WTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWZ A;  2FBI A;  2WV0 A;  2STW A;  4BQA A;  5IT3 A;  3NRV A;  3ZMD A;  2PG4 A;  1U5T C;  3BDD A;  4IPA A;  3KP4 A;  4PZJ A;  1IW7 F;  1UST A;  1B59 A;  4WK8 F;  1GXQ A;  2EA4 A;  2V79 A;  2P7V B;  3DXJ F;  3M7G A;  4HW0 A;  4HYE A;  1Z91 A;  4RB1 A;  3DPT A;  4D0P A;  1IN7 A;  1C0W A;  1S7A A;  4DNC A;  1RUN A;  3SZP A;  3KLN A;  3E5U A;  2L01 A;  2GAU A;  1Z6R A;  3K1M A;  3TQN A;  2V1U A;  4EJV A;  4EVI A;  3LAP A;  4KA4 A;  2H6B A;  2UXN A;  2HEO A;  2P7C B;  2DI3 A;  4YG2 F;  2MD5 A;  4IVN A;  3CO7 C;  1Z6T A;  4UUV A;  4P96 A;  2FRH A;  3ZP5 A;  3R0J A;  1IRG A;  2NNN A;  3WTY C;  4KMF A;  3I64 A;  4WXH A;  3ELK A;  2MLG A;  5HDG A;  2HTS A;  3ABU A;  1WSU A;  1Q1H A;  1FZP B;  2VOO A;  4QLC U;  1WRJ A;  3KP3 A;  1ZRC A;  4ASN A;  3RYR A;  2OZ6 A;  3SHF A;  5LHG A;  4UV8 A;  2AXL A;  3FXR A;  2VON A;  4GCV A;  2OZU A;  2KKO A;  3V7C A;  3V8L A;  1W5T A;  1RZ4 A;  3OV8 A;  2XAS A;  1D8K A;  5EEG A;  5FB2 A;  5FD6 A;  4KIB A;  3CO6 C;  2K4B A;  2YPR A;  2XKO A;  3N4M A;  3O3K A;  1WI9 A;  4M6X A;  1F5T A;  2FA5 A;  4EJW A;  2A68 F;  2CFX A;  3FX3 A;  1FPQ A;  2ZNY A;  1I1S A;  1XD7 A;  4MHG A;  1ZG3 A;  1YQA A;  4XLN F;  1XGN A;  3CDH A;  3QPT A;  1FBQ A;  4CDG A;  2WWY A;  4FX0 A;  3DQV C;  3GUD A;  2VC0 A;  4P55 A;  5ILV A;  5L3F A;  2FXA A;  4G8X A;  2RNJ A;  2G7H A;  3R6S A;  2FSW A;  3CUQ C;  2NS0 A;  1EH8 A;  3FMQ A;  3JW4 A;  1Z7U A;  1XMA A;  1ZAR A;  2H09 A;  1IRF A;  1W7P D;  2L02 A;  3RIR A;  2A5Y B;  2ACJ A;  1FSE A;  5D4R A;  1YIO A;  3J80 K;  1CGP A;  1SD5 A;  5IT9 K;  3MZH A;  1XGS A;  1F1Z A;  5ERI A;  1LJ9 A;  3TDU C;  4UHT A;  1J59 A;  2KJC A;  2JPB A;  2M30 A;  2O03 A;  3T5X A;  3HOT A;  4YFN F;  5KK1 A;  3KE2 A;  3J81 K;  1HBX G;  1S6L A;  3PQJ A;  1J7K A;  1YFH A;  2BEO A;  5FFX A;  1ONV A;  2JRT A;  4OIR F;  1G6N A;  3KCC A;  5LHH A;  1MD0 A;  2DK5 A;  3HRT A;  1ZLJ A;  3T1B A;  3GFL A;  1TW3 A;  3RI4 A;  4ETS A;  4A5M A;  3LA7 A;  5ICF A;  1F4K A;  2IPQ X;  1UB9 A;  2QYO A;  4IXA A;  1BOA A;  3V7S A;  1FNN A;  3COA C;  4UVB A;  2A07 F;  3K0L A;  2LF7 A;  2ISY A;  2K02 A;  2QQ9 A;  3J80 Z;  2L3D A;  3IWZ A;  1EV7 A;  5IT9 Z;  2JT1 A;  2EWN A;  4ENJ A;  4FHT A;  1MGT A;  1P4W A;  4G9Y A;  5E18 F;  3MCZ A;  4B09 A;  3IL2 A;  2P4W A;  1OYY A;  2QVO A;  3VEP A;  2FNA A;  5CVV A;  1BI3 A;  4I02 A;  2J5O A;  3F8M A;  2DT5 A;  3FXU A;  1W7P B;  3CTA A;  3REO A;  4HQM A;  4M6Y A;  2R7D A;  4KIF A;  3P7N A;  1BM9 A;  4LB5 A;  4BAY A;  1OYI A;  1YW9 A;  4AIH A;  3QU3 A;  1LB2 A;  1YO5 C;  1I5Z A;  5BMZ A;  4A6D A;  5CJ9 A;  2IA2 A;  3E6D A;  2QLZ A;  1BN5 A;  2F5E A;  1FYK A;  1NHA A;  3TOB A;  3E97 A;  4KIG A;  4ENM A;  5LGT A;  2MA3 A;  5EEH A;  1J75 A;  1XCB A;  1YW8 A;  4RB3 C;  4Q5S F;  3GYH X;  1U3E M;  4I0B A;  3P9C A;  4HZF A;  3HSE A;  1B6A A;  2Y75 A;  3KP5 A;  6PAX A;  2HYG D;  4PDK A;  2HYF A;  2CWE A;  1R5H A;  1QO0 D;  3OOP A;  4ZH4 F;  2QM3 A;  2O0Y A;  3QU6 A;  4EM0 B;  1KU3 A;  1YS6 A;  2OQR A;  4FT8 A;  3IHU A;  2RDP A;  1F9N A;  2HTJ A;  2IT0 A;  3F72 A;  3I59 B;  1FC3 A;  1HW1 A;  3NEU A;  4B8X A;  1T0F A;  4NHJ A;  4HDU A;  3ZPL A;  1FP2 A;  3JTH A;  4CIC A;  2XGX A;  5K5R A;  1ZGJ A;  4OMZ A;  3B73 A;  5JFR A;  4LK1 F;  3VOD A;  1TW2 A;  5FD5 A;  4LLN A;  3QP5 A;  4PCQ A;  5HVQ C;  3ECH A;  1BIB A;  4I2O A;  5BPD A;  4S05 A;  1BI2 A;  1LNW A;  3ABT A;  2P6T A;  3GZ5 A;  1YTY A;  5H20 A;  3I58 A;  1CF7 B;  1KU9 A;  3MFK A;  1UFM A;  1WWX A;  3HUG A;  2NRA C;  3HTU A;  2RGV A;  3SXY A;  4A5N A;  3GFM A;  4ZYG A;  1R23 A;  4EM2 A;  2Z33 A;  1R1U A;  1MJA A;  3HYI A;  2NYX A;  1YLF A;  3LA3 A;  2EFO A;  2F2E A;  4KN4 X;  1R7J A;  3FF5 A;  3MWM A;  4AWX B;  4ZYH A;  4NQW A;  5D8L B;  4M71 A;  4LMY A;  2Q2E A;  4OOI A;  4RGX A;  1DPR A;  3O6B B;  3GVA A;  3QPH A;  3KET A;  3ZN0 A;  2X4H A;  4L9J A;  4ZYD A;  4JQF A;  1W5S A;  1J5Y A;  2XAG A;  1ZRD A;  5F64 A;  1LEA A;  4G94 A;  4M74 A;  1KQ0 A;  3R60 A;  5HLG A;  2COM A;  1BC7 C;  4QWQ A;  1UHW A;  4RGU A;  3BY6 A;  2HS5 A;  2V9V A;  3E6M A;  2M1B A;  2XIG A;  4G6Q A;  1GVJ A;  1E2X A;  1LVA A;  3Q5F A;  1TNS A;  2TDX A;  5DV5 A;  3EYY A;  5BQT A;  3KP7 A;  5DCM A;  1T39 A;  2BBY A;  2FNP A;  2G9W A;  2PFB A;  2IP2 A;  3GZ6 A;  1PDN C;  2XAJ A;  1H0M A;  2HDC A;  3BPX A;  2DPD A;  3BJ6 A;  1GXP A;  4EGY A;  4UVC A;  3K1N A;  4PGH A;  2NNY A;  1MZB A;  1XSX A;  3RDI A;  3SFZ A;  4HF0 A;  1DDN A;  4WXD A;  5CYV A;  2QBY A;  1RNL A;  5D5V B;  2VOP A;  3V4G A;  2KIU A;  5LRR A;  2VN2 A;  2WC2 A;  1MKM A;  4HDV A;  3I59 A;  3BZ6 A;  1GHC A;  2ESN A;  4O6J A;  1KU2 A;  1KA8 A;  1JE8 A;  2ZBK A;  4MGR A;  2MC3 A;  4MQ9 F;  1B1B A;  2GA1 A;  2E7W A;  1G3W A;  5DUI A;  2EFP A;  2C6Y A;  1S7O A;  3KEQ A;  2DO7 A;  4OU0 A;  2BYV E;  5D5W B;  4P9U A;  3GWZ A;  1SMT A;  2STT A;  4LLG F;  2QWW A;  1SFE A;  2P5L C;  2EJR A;  4EM1 A;  3IWF A;  3ZQ7 A;  3TDZ C;  1HKS A;  3KFW X;  3KLO A;  2D2W A;  1KYW A;  1UHM A;  2PMH A;  3KP6 A;  1CF7 A;  1P6R A;  2VXZ A;  3C1D A;  4KFC A;  3TKY A;  4RAZ A;  2A61 A;  2XAH A;  3U2R A;  5DYM A;  1JHF A;  1K78 A;  2M87 A;  5D5U B;  3BWG A;  3ZMS A;  5H6R A;  1IF1 A;  2EFW A;  4M9Z A;  1WQ2 A;  4UNO A;  2H6C A;  1J0R A;  1ZRE A;  1YS7 A;  2O61 A;  2YSR A;  3M8E A;  5LEK A;  1QPM A;  5J8F A;  1FBU A;  1ZLK A;  4Z2Y A;  2FOK A;  2LKP A;  1HSJ A;  2XVC A;  2VC1 A;  2VE9 A;  3C7J A;  1S29 A;  3RKY A;  4EMS A;  4RB0 A;  5AIP A;  2PJP A;  2X0L A;  4BYY A;  3GW2 A;  4ENN A;  4KUM A;  1SD7 A;  2H27 A;  1DPU A;  1RUO A;  1KYZ A;  3DP7 A;  1FBS A;  2OD5 A;  1JXS A;  5J6X A;  1P4X A;  3QAH A;  4HF1 A;  2BGC A;  1OYW A;  5JR3 A;  4CXF A;  2HKO A;  4M9X A;  2XV4 S;  1O3T A;  3WTS C;  3IC7 A;  4G7H F;  1QZZ A;  1B9M A;  1LDJ A;  2W57 A;  3U1D A;  1Z1D A;  5E1W A;  3P9I A;  4UV9 A;  4RGR A;  4KDP A;  1O7F A;  2RQP A;  1G3T A;  2LDU A;  4F7Z A;  1SD6 A;  5FO5 A;  5HLI A;  1JGS A;  2W24 A;  3HSR A;  4OIQ F;  1ZH5 A;  1S3J A;  4O3M A;  2XRO A;  5K1Y A;  2A6H F;  4LG0 A;  4HLY A;  3W6J B;  2MLK A;  3R61 A;  2EV6 A;  5AON A;  4IRI A;  2XAF A;  2P6S A;  1L3L A;  1XGM A;  4HV6 A;  2DAO A;  4ZYE A;  4LD5 A;  1R22 A;  2RVC A;  5JVT A;  4RS8 A;  4M73 A;  5D6F A;  3ML6 A;  2EV5 A;  3QP6 A;  1X3U A;  3FMS A;  1BJA A;  3G73 A;  4P5O A;  2M45 A;  2MBF A;  2UZK A;  4DQ2 A;  4WCG A;  5E17 F;  3E5Q A;  3O2P E;  1XDS A;  3EDP A;  1BIA A;  3HHG A;  3MQ0 A;  4IHS A;  5E20 A;  2L4A A;  3HHH A;  1HQC A;  2IA0 A;  3JTG A;  2YR2 A;  4M9S A;  3EUH A;  2FML A;  5LEJ A;  3V8J A;  1AWC A;  2UWM A;  3E6C C;  3I4P A;  5JHU A;  3Q9S A;  2XAQ A;  4OIO F;  3H3Z A;  4GGG A;  4M72 A;  5DDG A;  1ZG1 A;  2M5W A;  4WF2 A;  2FMY A;  4MEY F;  3P9K A;  3TOA A;  4HX4 A;  3F6V A;  3GX4 X;  5H6Q A;  5LHI A;  1V3F A;  4WWC A;  5BOX A;  4CZZ A;  4ZZD A;  3I0T A;  3LST A;  4P9F A;  4I01 A;  1TQP A;  2HWV A;  4HQE A;  2RV8 A;  1I1G A;  2HZT A;  3F6O A;  2GWR A;  1ON1 A;  3E3V A;  3RJP A;  1O3Q A;  2HFH A;  3FWE A;  1PP7 U;  2F5C A;  3WU0 A;  2VBX A;  2VT3 A;  2RN7 A;  5DCM B;  5ILU A;  2F5F A;  3HTS B;  2BV6 A;  1U78 A;  3D0S A;  3R4K A;  1ZYR F;  1OMI A;  1U8R A;  2D1H A;  1YG2 A;  4Y15 A;  2DTR A;  3RPU A;  4U0W A;  4I7H A;  4A12 A;  2D45 A;  2QBY B;  4K2E A;  4KN7 X;  4MTD A;  1YW7 A;  1OR7 A;  2IJL A;  1BC8 C;  1QZY A;  2GXB A;  3MEX A;  2IA1 A;  4WX9 A;  4IHT A;  2JPC A;  3CUQ B;  4N9I A;  1IN6 A;  2PEX A;  1J9I A;  2ZXJ A;  4KIC A;  2ZCW A;  1SAX A;  2CSO A;  4U7B A;  2UXX A;  2ADU A;  2EK5 A;  5CVU A;  3WE2 A;  4YIF A;  3I5U A;  3DFG A;  5JI6 A;  2L4M A;  4CO8 A;  4BH9 A;  1G3Y A;  4UVA A;  4XSZ F;  3RKX A;  2CG4 A;  2JZY A;  3J7A O;  4LB6 B;  2FQ3 A;  3LA2 A;  1P4A A;  3F8N A;  1K7A A;  1S8N A;  4JK1 X;  1U5T A;  2FE3 A;  1XSV A;  3I53 A;  1IAW A;  1J2X A;  1ODD A;  1LEB A;  5L3C A;  4L18 B;  3M8F A;  4N9H A;  3R0A A;  1XGO A;  4GO1 A;  3F22 A;  2PN6 A;  4L0Z B;  1K78 B;  4AD9 A;  3QOP A;  3SZT A;  2ZKZ A;  3EET A;  1B9N A;  4BHB A;  4XSX F;  5CVR A;  1O57 A;  2HQR A;  1H9G A;  5HS7 A;  4GXO A;  1JHH A;  4I09 A;  2DW4 A;  2Y0M A;  3FHZ A;  2DK8 A;  1UCR A;  2IW5 A;  2OQG A;  3C3W A;  3NQO A;  2JTV A;  1QQI A;  1T2K A;  3IRQ A;  3WTV C;  3E6B A;  3M1E A;  2KJB A;  4HX8 A;  5HS9 A;  2A69 F;  1A04 A;  5E1X A;  2FF4 A;  1T98 A;  3WGH A;  3ZN1 A;  1HW2 A;  4KNY A;  1D3Y A;  3K9T A;  3GLX A;  4HA8 A;  1PP8 F;  5D6E A;  1TNT A;  2YX7 A;  3E5X A;  4ON0 A;  2GQQ A;  3K69 A;  5ICG A;  3T8T A;  1IXS B;  1FX7 A;  3JSP A;  4GYI A;  4Q48 A;  3HOS A;  5A2Q Z;  2O3F A;  4TV7 A;  2P5V A;  2W85 A;  1O3R A;  3WE3 A;  1ON2 A;  2NAZ A;  5HOO A;  4IRH A;  3F3X A;  2PI0 A;  2Z99 A;  1HW5 A;  1TBX A;  4UXN A;  4AIJ A;  1YYV A;  4FX4 A;  2DQL A;  1IN4 A;  3LWF A;  3KZY A;  4CYD A;  1P92 A;  4YFK F;  3WG9 A;  2K27 A;  2XRN A;  3W6K B;  2VT2 A;  1E17 A;  5LRS A;  1W4M A;  2KIF A;  3HRU A;  3KEO A;  2GXG A;  2KIM A;  1DP7 P;  4LG0 B;  1LDD A;  4IRG A;  4R8H A;  1BBY A;  4MQV A;  2HKX A;  2W84 A;  2FBH A;  3CUQ A;  1R00 A;  4HV5 A;  3MAJ A;  1I6X A;  2ZME B;  4EJT A;  1RIO H;  1R36 A;  5CLS A;  5TRD A;  4AIK A;  3IKV A;  2AS5 F;  2D1V A;  4HBL A;  3F23 A;  4ENK A;  3AAF A;  3WTU C;  1FP1 D;  3JAM Z;  4HF2 A;  5E1Z B;  4MTE A;  2ZO4 A;  2FU4 A;  5ILS A;  5ICE A;  3WOD F;  4LK0 F;  4L5J A;  2GZW A;  3RTR A;  1FT9 A;  3L9F A;  1AOY A;  4KT5 C;  2W25 A;  4S04 A;  2PQ8 A;  4U0V A;  4AVP A;  1XDU A;  3WU1 B;  1G4D A;  2P5K A;  3FM3 A;  2R3S A;  2K86 A;  3T8R A;  3ULQ B;  3L2C A;  2ETH A;  4IF4 A;  4XLP F;  3WTT C;  5BPI A;  1I27 A;  5TJJ A;  4ESF A;  4G7Z F;  2E7X A;  4HLX A;  4ESJ A;  2VBY A;  2OAZ A;  5BS6 A;  1BI1 A;  1T38 A;  2HOE A;  2E1C A;  1FOK A;  5HDK A;  2QEN A;  3ZMU A;  2EV0 A;  1TTY A;  4EV0 A;  2B0L A;  1EH6 A;  3DF8 A;  3WGG A;  2EFQ A;  3ISP A;  3DKW A;  4IJA A;  3BOQ A;  4L5I A;  3GXO A;  4G7O F;  4Y13 A;  4ZZL A;  2ELH A;  2KRF A;  3EQL F;  1ZRF A;  1XMK A;  1RI7 A;  3C18 A;  2VE8 A;  3M9A A;  1IUY A;  4BXU A;  2PMU A;  2XHK A;  2CO5 A;  5E8I A;  1SFU A;  2DLL A;  2J5P A;  1KQ8 A;  2OBP A;  3V8K A;  1OPC A;  4EGZ A;  4R79 A;  2PLY A;  1STZ A;  3F8F A;  1U2W A;  2G7U A;  2YX4 A;  4Y17 A;  2A3S A;  1LQ1 A;  2HQN A;  2ISZ A;  4BHP A;  4L9V A;  2L54 A;  4R1H A;  2VBZ A;  2A6E F;  5DUK A;  3D5L A;  5F6F A;  2ZJ2 A;  2DQR A;  2GA2 A;  3RKW A;  2K4J A;  2IVM A;  2ZNZ A;  2H94 A;  4Q4Z F;  1HXD A;  3GFJ A;  3KP2 A;  3F8C A;  4U7D A;  2QUF A;  3MZY A;  5F1R A;  3T0Y A;  5LGU A;  1LDK B;  1FSH A;  3U9G A;  1L0O C;  1ZAO A;  3PQK A;  1IN5 A;  2F5D A;  3KZZ A;  3F8B A;  2CGP A;  1ZN2 A;  1ZHF A;  2HR3 A;  3ECO A;  4KYW A;  2QQA A;  2RKH A;  1QGP A;  3WTX C;  2ZME A;  3DV8 A;  2JSC A;  2R7F A;  3DPL C;  3V7R A;  4HOB A;  3JSO A;  4N0B A;  4I0A A;  3HIF A;  3VB2 A;  3LQR A;  3F21 A;  3GFI A;  5J8C A;  1BI0 A;  1KGS A;  1K6O A;  4XRF A;  2DBB A;  5ICC A;  3CJN A;  1QBJ A;  5HS8 A;  1R1T A;  1U5T B;  5HDN A;  1FYM A;  4A0Z A;  3EYI A;  1O3S A;  4Q47 A;  4YII A;  1ULY A;  3GF2 A;  3H92 A;  2P8T A;  1IXC A;  1V4R A;  5ED4 A;  2QZ8 A;  3L7W A;  5E8G A;  5DD4 A;  3I54 A;  1TQI A;  3RPQ A;  2MH9 A;  3DEU A;  1R5G A;  3J81 Z;  3SQN A;  1HST A;  2K7L A;  3FMR A;  4L0Y B;  2CQK A;  1U6G A;  3TO6 A;  4I98 B;  1PUE E;  4A0Y A;  1IN8 A;  2DPU A;  3GEZ A;  3WTZ A;  5D4S A;  3N97 A;  2MH2 A;  3HRM A;  1Z05 A;  1D5V A;  2Z5U A;  2VOD A;  3TGN A;  1MDM B;  2YU3 A;  3RYP A;  1REP C;  2LSO A;  2XKP A;  3BJA A;  3ZMT A;  3FZV A;  3BPV A;  3G3Z A;  1XB4 A;  4MEX F;  1SFX A;  2E1N A;  2O6G E;  3CUO A;  3B02 A;  2LNB A;  2ZFW A;  3K1P A;  2CW0 F;  3BJO A;  5LGN A;  1ZG5 A;  4GYG A;  1TLH B;  1VTN C;  4CHU A;  1SD4 A;  1G3S A;  2Y48 A;  3K2Z A;  4G6D A;  3L09 A;  4JBA A;  4YFX F;  2Q8K A;  5LLQ A;  4U0Y A;  3TO9 A;  1KU7 A;  4XBF A;  1SMY F;  4L9N A;  2QQB A;  3VFZ A;  5LBQ A;  3ZMZ A;  4H0E A;  1D8J A;  4MNU A;  3QRF F;  1HKQ A;  4OIN F;  2LF8 A;  1T6S A;  2VBW A;  4NB5 A;  1MJ9 A;  4BHC A;  4ESB A;  2IRF G;  4LGW A;  2CYY A;  5FFZ A;  5DCF A;  5D5X B;  2EB7 A;  4OIP F;  4A0X A;  2DFI A;  3BRO A;  1XN7 A;  3FM5 A;  2V1X A;  3GO5 A;  2Z9O A;  5KVR A;  2RC4 A;  2FEZ A;  1IXR C;  4BNC A;  1DUX C;  1XCV A;  3PFI A;  2EFN A;  4E70 A;  3BP8 A;  5L3D A;  2Z3Y A;  4EQQ A;  3IKT A;  4HX7 A;  1R58 A;  1EH7 A;  3VOE A;  5FLX K;  5A2Q K;  3HRS A;  2FBK A;  3TO7 A;  4LLL A;  4KMU X;  4OMY A;  2V1D A;  2M8E A;  1MJB A;  4LJZ F;  2GIV A;  5DD8 A;  1R1V A;  2ESH A;  3CLO A;  1Z9C A;  1XSD A;  2BE5 F;  2HGC A;  1FY7 A;  2XUB A;  4WXC A;  4LFU A;  4O5V A;  1FLI A;  2V6C A;  5DEQ A;  3L00 A;  1P2F A;  3FXQ A;  3IRR A;  4U88 A;  1B4A A;  3LQQ A;  4L9T A;  1FYL A;  1TQM A;  2PBI A;  3Q9V A;  4EJU A;  3ZMV A;  1W7P A;  5L3E A;  1HKT A;  5L3B A;  3H3U A;  5HLH A;  2DU9 A;  3ERE D;  4RB2 C;  4A2U A;  1OKR A;  5AIQ A;  3ROU A;  1K79 A;  1MDM A;  4RGS A;  3S2W A;  3I71 A;  4EJO A;  4RAY A;  5K5O A;  5L3G A;  4CGZ A;  2EA2 A;  3LFK A;  3JAM K;  2Q0O A;  3HSF A;  3WGI A;  1ZGA A;  3LAJ A;  4PGG A;  2OU2 A;  5CVJ A;  1KQ9 A;  1USS A;  5CVI A;  3WTW C;  5FLX Z;  1WKM A;  4A6E A;  2O8X A;  5K5Q A;  1Y0U A;  5FGM A;  1O7L A;  5D8K B;  1IZ1 A;  4HAM A;  2OA4 A;  1QNT A;  1H9T A;  2WTE A; 
#chains in the Genus database with same CATH topology
 2BW3 B;  1FWZ A;  2LOO A;  2FBI A;  1QHG A;  3CJT B;  3CZ6 A;  2WV0 A;  2O8K A;  2STW A;  3ABM H;  4BQA A;  3CCY A;  5IT3 A;  2AHQ A;  2VKV A;  2V9P A;  1AA7 A;  3NRV A;  3JRE A;  3ZMD A;  1ZR2 A;  3K4N A;  3BZK A;  2WY7 Q;  2PG4 A;  3OIQ A;  1U5T C;  3BC8 A;  3H5R A;  1TWG J;  2M9H A;  3BDD A;  2IGK A;  4IPA A;  3WG7 H;  3KP4 A;  2PX9 A;  3DBR B;  3ZQG A;  3RKQ A;  4PZJ A;  1IW7 F;  3BR1 A;  3BT9 A;  3EPZ A;  4V19 K;  1UST A;  4Y7N J;  4GDF A;  1B59 A;  3DBL B;  3W2V A;  4WK8 F;  1RKT A;  4BAC A;  1GXQ A;  2BHZ A;  3HZJ A;  1YIJ I;  1P7J A;  1PUF A;  2XGE A;  1NTC A;  4AYB A;  3L2U A;  2EA4 A;  2V79 A;  2P7V B;  3DXJ F;  3M7G A;  4M3B A;  3VYT B;  4XRS G;  4HW0 A;  1OIS A;  4HYE A;  1UJ8 A;  2DA3 A;  2DTZ A;  1Z91 A;  3EUK L;  2EZK A;  3ZOB A;  4RB1 A;  2V9K A;  3DPT A;  4D0P A;  1IN7 A;  1C0W A;  1S7A A;  4DNC A;  3G4S I;  1RUN A;  3SZP A;  3KLN A;  2E1M C;  3E5U A;  2OF7 A;  2L01 A;  5E79 C;  2GAU A;  1Z6R A;  3K1M A;  3TQN A;  4B43 A;  4M3D A;  4BGD A;  2V1U A;  4EJV A;  3AG1 H;  3S3N A;  2XGC A;  4EVI A;  3LAP A;  4XLA A;  4KA4 A;  4FIS A;  2H6B A;  2M4G A;  2UXN A;  4UUS A;  2HEO A;  2P7C B;  2DI3 A;  4YG2 F;  5JLX A;  4YEL A;  4AU7 A;  3FHN A;  3HOW J;  2MD5 A;  3OIO A;  4IVN A;  3CO7 C;  1NK3 P;  1Z6T A;  3CF2 A;  4UUV A;  4P96 A;  2FRH A;  3ZP5 A;  3R0J A;  1IRG A;  2DMT A;  2NNN A;  2Y0S N;  3WTY C;  4KMF A;  3I64 A;  4WXH A;  4L5E A;  5M5X J;  3ELK A;  3BR2 A;  2MLG A;  5HDG A;  2HTS A;  3ABU A;  1RRJ A;  1WSU A;  1Q1H A;  1AKH A;  3J7Z I;  1FZP B;  2R5Y B;  3OYG A;  2VOO A;  4QLC U;  3S1M J;  1WRJ A;  3KP3 A;  1ZRC A;  4ASN A;  2H1K A;  1R6R A;  3RYR A;  4BXX J;  1VQL I;  4D9J A;  2OZ6 A;  3SHF A;  4XOR A;  5LHG A;  1ZTR A;  2JVH A;  1ZQ3 P;  1EF4 A;  1N75 A;  1OCO H;  1T33 A;  4UV8 A;  4CZC A;  2VUM J;  2AXL A;  3FXR A;  1LFP A;  2VON A;  2ZJP F;  4GCV A;  2OZU A;  2KKO A;  3HKZ A;  4B4C A;  3V7C A;  3OYL A;  4DIQ A;  3V8L A;  1W5T A;  1LUJ B;  5J40 A;  1RZ4 A;  3OV8 A;  2XAS A;  1D8K A;  3AG2 H;  1B8I B;  3ASN H;  5FLM J;  2QKM B;  5EEG A;  1V5F A;  5FB2 A;  2XF6 A;  5FD6 A;  4KIB A;  2L5Q A;  4DYQ A;  2CV2 A;  3CO6 C;  2K4B A;  2YPR A;  2XKO A;  2LBF B;  3N4M A;  3O3K A;  1WI9 A;  4M6X A;  1F5T A;  4F91 B;  1IDZ A;  2FA5 A;  4EJW A;  2BY0 A;  2A68 F;  2CFX A;  4D1Q A;  3FX3 A;  2R5Z B;  1WJF A;  1FPQ A;  2ZNY A;  3H0G J;  3P5J A;  2UUZ A;  1I1S A;  1XD7 A;  4MHG A;  2DMU A;  2F4M B;  4HNU A;  1ZG3 A;  1D0Y A;  3S8P A;  1YQA A;  4XLN F;  1XGN A;  3CDH A;  3QPT A;  4ZDP A;  1FBQ A;  1Z3X A;  4CDG A;  1DP3 A;  2WWY A;  4GRI A;  4FX0 A;  3DQV C;  2E5Z A;  5EEA A;  2XPW A;  4PUS A;  3GUD A;  2VC0 A;  3TED A;  4P55 A;  5ILV A;  2FUG 2;  2DFH A;  5L3F A;  2AO9 A;  2L7F P;  2FXA A;  4G8X A;  2VLA A;  2H8W A;  2JJ7 A;  2RNJ A;  2G7H A;  3R6S A;  3ASO H;  1H89 C;  2FJ1 A;  2FSW A;  2BZT A;  3CUQ C;  4RM2 A;  2NS0 A;  1EH8 A;  5B5E C;  3FMQ A;  3JW4 A;  1Z7U A;  2ZC2 A;  1XMA A;  3DU5 A;  1ZAR A;  3TBI A;  2KLO A;  4BDZ A;  2H09 A;  1IRF A;  4ANJ A;  3IUO A;  1W7P D;  3H35 A;  2L02 A;  1U0J A;  1KZH A;  4AVZ A;  2KDO A;  2A5Y B;  3RIR A;  1VFC A;  1BJZ A;  2VIX A;  2W4S A;  2JK3 A;  2ACJ A;  3W6V A;  5EG0 B;  4N4O B;  1FSE A;  3TW7 A;  5D4R A;  1MMD A;  1YIO A;  3A0B C;  1H88 C;  3HGG A;  4DYC A;  3J80 K;  1CGP A;  1SD5 A;  5IT9 K;  3MZH A;  1XGS A;  2BVM A;  1F1Z A;  2YU9 J;  1TWA J;  5ERI A;  5FRM A;  3E1S A;  1LJ9 A;  3TDU C;  4UHT A;  1J59 A;  2M3A A;  2KJC A;  2JPB A;  2M30 A;  2O03 A;  2X48 A;  1UMQ A;  2Y31 A;  3T5X A;  1Z77 A;  3CF5 F;  3HOT A;  5C3E J;  4YFN F;  5KK1 A;  3KE2 A;  3J81 K;  2DJI A;  2JA6 J;  2E2H J;  1HBX G;  1S6L A;  3PQJ A;  1J7K A;  1GVD A;  4AYB N;  5IOZ A;  2BEO A;  1YFH A;  1B72 B;  3JRB A;  5FFX A;  1ONV A;  2JRT A;  2LG4 A;  4BUP A;  3ERM A;  2FQ4 A;  2KPM A;  3ONQ A;  4XK4 A;  1WH5 A;  1G6N A;  4OIR F;  1SAU A;  1GT0 C;  3HOY J;  1BR1 A;  3MKY B;  1GUU A;  2DOD A;  4B1R A;  3KCC A;  5LHH A;  1ETQ A;  1MD0 A;  1GDT A;  2N8G A;  2DK5 A;  3L2V A;  3HRT A;  1ZLJ A;  2LTP A;  2LR8 A;  2WBM A;  2X6Y A;  4XN0 A;  1WCM J;  3T1B A;  2Z1D A;  3GFL A;  1W5C C;  1QU3 A;  3JRG A;  5TGT A;  1TW3 A;  1ZK8 A;  4IKF A;  2KRC A;  3RI4 A;  4ETS A;  1I3Q J;  2ZSI B;  4A5M A;  3LA7 A;  5ICF A;  1F4K A;  4E6K G;  2IPQ X;  2WAQ A;  4J01 A;  1UB9 A;  1A6I A;  2K9N A;  2QYO A;  4IXA A;  3VSK A;  1BOA A;  4IL6 C;  1FNN A;  3V7S A;  3COA C;  4UVB A;  2A07 F;  4FTH A;  3G1M A;  3F0C A;  3K0L A;  4M3E A;  1FOY A;  2LF7 A;  3PO2 J;  2ISY A;  2K02 A;  2LC2 A;  4IHX A;  3CCE I;  2KRH A;  1PJR A;  1X2N A;  2QQ9 A;  2I8D A;  2IGM A;  2R93 J;  3J80 Z;  2L3D A;  3IWZ A;  5E3L A;  1EV7 A;  5IT9 Z;  2BY1 A;  2JT1 A;  5GAG J;  2LRD A;  2R4G A;  3FDY A;  2VL8 A;  4HG2 A;  4IQJ A;  2EWN A;  4XMY A;  4CCN A;  5GPA A;  3S2D J;  3HKZ N;  4ENJ A;  2QA4 I;  4FHT A;  4IEJ A;  1UEL B;  3K4J A;  1MGT A;  1TC3 C;  1P4W A;  4G9Y A;  4IOA F;  3Q3S A;  2IGO A;  3OS1 A;  5E18 F;  3MCZ A;  4B09 A;  5BNG A;  2P4W A;  1OYY A;  1RET A;  2QVO A;  3VEP A;  3IL2 A;  2FNA A;  1AHD P;  2GLO A;  3ZRG A;  1SVM A;  5CVV A;  1BI3 A;  4I02 A;  2J5O A;  3F8M A;  4FCY A;  4A3K J;  5KHD A;  2DT5 A;  3FXU A;  1W7P B;  4NQW B;  3CTA A;  3REO A;  4HQM A;  2M7A A;  3AG4 H;  1HLV A;  3CC2 I;  1FIP A;  2LBF A;  1FIA A;  4M6Y A;  1VQ6 I;  4NNJ A;  2R7D A;  3PJR A;  4KIF A;  3P7N A;  1BM9 A;  3O8G A;  4LB5 A;  4HPQ A;  4BAY A;  1NG7 A;  1OYI A;  1YW9 A;  4AIH A;  1TT0 A;  1MIJ A;  3S32 A;  1BR2 A;  3QU3 A;  1LB2 A;  4IQ4 A;  2MGQ A;  1D5Y A;  1XX5 A;  5C4X J;  2IBD A;  1YO5 C;  5GAH J;  3DKX A;  1X19 A;  5GAD J;  1I5Z A;  5KAI C;  3BLY A;  4RM3 A;  5BMZ A;  1QZE A;  4A6D A;  1W0U A;  5J1Y A;  3CJR B;  5CJ9 A;  2IA2 A;  3E6D A;  2DXI A;  1ACI A;  3S14 J;  2R7X A;  3J7A Y;  2QLZ A;  1BN5 A;  1JT6 A;  2F5E A;  1FYK A;  1NHA A;  3TOB A;  3E97 A;  1RR7 A;  4JP0 A;  2VPR A;  4KIG A;  3MN2 A;  4ENM A;  5LGT A;  1N77 A;  2ID3 A;  2MG4 A;  2JA8 J;  2ZSH B;  2ZME C;  2MA3 A;  5EEH A;  3DPU A;  3OMY A;  1J75 A;  1XCB A;  1YW8 A;  3HOV J;  1D0Z A;  3HJE A;  1BA5 A;  2DCE A;  4RB3 C;  2DMQ A;  1W0T A;  4Q5S F;  4A3M J;  2ZFU A;  3GYH X;  4A93 J;  1U3E M;  2Y9Z A;  4I0B A;  2H8R A;  1YJW I;  1T8I A;  3P9C A;  4HZF A;  2ZXI A;  3HSE A;  2NVT J;  2ELJ A;  1A6Q A;  1B6A A;  4BEH B;  2Y75 A;  3KP5 A;  2MFZ A;  6PAX A;  4HSR A;  2XRL A;  1YX3 A;  2HYG D;  4PDK A;  2HYF A;  1A36 A;  2CWE A;  1R5H A;  3J7Y J;  1QO0 D;  3OOP A;  3CC4 I;  2WB1 A;  4ZH4 F;  2VJI A;  1JJ8 C;  2QM3 A;  3SEZ A;  3FXJ A;  2Q1Z B;  1Y0N A;  1W36 C;  1B72 A;  2I10 A;  2O0Y A;  4M3G A;  3LSM A;  3BG5 A;  2BXY A;  2KIQ A;  3QU6 A;  4B47 A;  4CSW A;  1KU3 A;  1YS6 A;  2OQR A;  4EM0 B;  4FT8 A;  3IHU A;  1OCC H;  4D7M A;  1VQM I;  1Y8Q B;  2RDP A;  4A3D J;  1F9N A;  3BTC A;  2HTJ A;  2IT0 A;  2CQX A;  1J09 A;  3F72 A;  5CPR B;  2X1C A;  2DA5 A;  4AC0 A;  3RZD J;  3I59 B;  3OYI A;  1FC3 A;  1HW1 A;  1MBK A;  4CCK A;  1QVU A;  3NEU A;  3GTG J;  4B8X A;  1T0F A;  4HNT A;  4NHJ A;  4HDU A;  2EZH A;  1X1P A;  3HBL A;  3ZPL A;  5KAF C;  1FP2 A;  4BY1 J;  3JTH A;  4CIC A;  2XGX A;  2GIZ A;  2XF5 A;  5K5R A;  1A35 A;  1ZGJ A;  2WAQ N;  4A3E J;  2KL4 A;  4OMZ A;  4FAS D;  3B73 A;  5JFR A;  1LFB A;  3TW6 A;  3K6G A;  5FLV A;  4LK1 F;  1Z3Y A;  4ITV A;  3FIS A;  3VOD A;  3OS2 A;  1TW2 A;  5FD5 A;  5IP7 J;  4LLN A;  3QP5 A;  4PCQ A;  5HVQ C;  3OIP A;  1DU0 A;  3ECH A;  1BIB A;  4I2O A;  5BPD A;  4S05 A;  2OTJ I;  4BL0 B;  1BI2 A;  1LNW A;  3OYH A;  3ABT A;  2XB0 X;  3FXM A;  4B44 A;  2P6T A;  4RAF A;  1Y39 A;  3GZ5 A;  3B6A A;  1LPQ A;  1NK2 P;  4XM3 A;  2TRT A;  1YTY A;  1Y8R B;  2B63 J;  5H20 A;  1XPX A;  3S93 A;  2HPM A;  3I58 A;  1CF7 B;  1KU9 A;  5M5Y J;  1SVL A;  3MFK A;  1JKR C;  1UFM A;  1WWX A;  2EIL H;  3HUG A;  2NRA C;  1D1A A;  3OL3 A;  3HTU A;  2MD0 A;  2RGV A;  3SXY A;  5IOY A;  1IV6 A;  4A5N A;  3BQZ A;  2HPI A;  3GFM A;  4ZYG A;  1R23 A;  4EM2 A;  2XPV A;  3GTP J;  2Z33 A;  1R1U A;  1MJA A;  4BBS J;  3HYI A;  4NC8 A;  2NYX A;  1YLF A;  1HCR A;  1F43 A;  3LA3 A;  2EFO A;  2F2E A;  3JRA A;  2WY8 Q;  4KN4 X;  3SEQ A;  4MLO A;  1R7J A;  3FF5 A;  1MBE A;  3MWM A;  4AWX B;  4EEF G;  4DGW B;  1TT5 B;  4ZYH A;  4NQW A;  2F4I A;  1G59 A;  3AFH A;  2LKS A;  4J00 A;  2LP0 A;  5D8L B;  4BJ6 C;  1BL0 A;  3K4B A;  4M71 A;  4LMY A;  2Q2E A;  4Z6Y A;  4OOI A;  4RGX A;  2V26 A;  1DPR A;  4A3L J;  5TIS C;  3O6B B;  2W7N A;  3GVA A;  3QPH A;  3KET A;  1W36 D;  2HNH A;  3ZN0 A;  4XL9 A;  4KT6 A;  1GV5 A;  2X4H A;  4L9J A;  4ZYD A;  4JQF A;  1W5S A;  2QF7 A;  2DFE A;  1J5Y A;  2XAG A;  2LY1 A;  1ZRD A;  3H36 A;  5F64 A;  1LEA A;  2LY2 A;  4JOM A;  4RLF A;  4G94 A;  3C2B A;  4CH7 A;  2VQC A;  4M74 A;  1KQ0 A;  3R60 A;  5EZH A;  5HLG A;  4QTR A;  4E7I A;  2COM A;  1P9Q C;  1BC7 C;  4QWQ A;  2EIJ H;  1UHW A;  2OJE D;  4RGU A;  3BY6 A;  2HS5 A;  2V9V A;  3SZG A;  3BZC A;  3E6M A;  4LOC A;  2M1B A;  1MMG A;  2XIG A;  4G6Q A;  3IH2 A;  1GVJ A;  2DOA A;  3O8H A;  3WU2 C;  1E2X A;  1LVA A;  4D7N A;  3Q5F A;  1TNS A;  2TDX A;  2VJ4 A;  3CJQ B;  5DV5 A;  5C44 J;  3AL0 B;  1DQU A;  2GOX B;  3EYY A;  3I9V 2;  5BQT A;  3LSK A;  2DOF A;  3KP7 A;  5DCM A;  2R7W A;  2BBY A;  3QOD A;  3L1P A;  2FNP A;  1T39 A;  2JRM A;  2G9W A;  2PFB A;  2WB1 N;  4BEH A;  2IP2 A;  5FKL A;  1X58 A;  3GZ6 A;  1PDN C;  2XAJ A;  2DYS H;  4FET A;  2L9V A;  3I55 I;  2B9S A;  3BPX A;  1H0M A;  2DPD A;  2HDC A;  3S3O A;  3DBH B;  3DTI A;  2DOE A;  3BJ6 A;  1OFC X;  2V6E A;  1GXP A;  1X3Z B;  4UVC A;  3K1N A;  4PGH A;  4EGY A;  2NNY A;  1HDP A;  2JUG A;  1JUM A;  1MZB A;  1XSX A;  4C2U A;  2DA4 A;  1VQ5 I;  3RDI A;  1OCT C;  4CYC B;  1ETV A;  3W2A A;  2CQQ A;  4HF0 A;  3SFZ A;  4WXD A;  5CYV A;  3LNQ A;  2ZJQ F;  1DDN A;  2QBY A;  1RNL A;  5D5V B;  2VOP A;  3VYS B;  3V4G A;  3GLL A;  2KIU A;  1IDY A;  3QPS A;  5LRR A;  2LMD A;  2VN2 A;  1TWF J;  4BKX A;  2QQ8 A;  1CQT A;  2WC2 A;  3CCR I;  1MKM A;  3A4C A;  4HDV A;  3I59 A;  1X1D A;  2R7R A;  3QYE A;  3NAR A;  3BZ6 A;  3LL7 A;  4ZTF A;  1GHC A;  3G1L A;  3MD2 A;  2EZL A;  1X4P A;  2F4O B;  5B1B H;  2ESN A;  4O6J A;  4IHV A;  1KU2 A;  1KA8 A;  2VKE A;  1JE8 A;  2CW7 A;  2K5C A;  3H0D A;  2ZBK A;  4MGR A;  4QIW N;  2MC3 A;  3OWT A;  4Y4R A;  1S7E A;  4MQ9 F;  1B1B A;  1XC5 A;  2GA1 A;  2E7W A;  3HPG A;  3ZGK A;  5EGO B;  1G3W A;  3X2Q H;  5DUI A;  1WJA A;  1MSE C;  2JN6 A;  1R71 A;  2EFP A;  1IG7 A;  2C6Y A;  1S7O A;  4E7K A;  3BG7 A;  2OPT A;  3KEQ A;  4E7L A;  2DO7 A;  2B7E A;  2L0K A;  3FKJ A;  1MBF A;  4OU0 A;  4KJZ A;  2BYV E;  4NDL A;  4A69 C;  5D5W B;  4P9U A;  3GWZ A;  1SMT A;  2STT A;  4LLG F;  2QWW A;  1SFE A;  3OYD A;  2P5L C;  3E7L A;  3MZ8 A;  2EJR A;  4EM1 A;  5FRN A;  2VJJ A;  3IWF A;  3ZQ7 A;  3TDZ C;  4QSH A;  2HQ5 A;  1HKS A;  1IO2 A;  2EPF A;  3KFW X;  3KLO A;  4IZZ A;  2P0W A;  2D2W A;  1KYW A;  4DOZ A;  1UHM A;  2PMH A;  3KP6 A;  3BR0 A;  1CF7 A;  1P6R A;  2VXZ A;  3V42 A;  3OYN A;  3C1D A;  4KFC A;  3TKY A;  3BR6 A;  4B48 A;  1H8A C;  2LRE A;  4RAZ A;  2TCT A;  3SDG A;  2A61 A;  2AQE A;  3FIW A;  3K4M A;  2XAH A;  5K7Z A;  3U2R A;  4P1W A;  4DZP A;  5DYM A;  1R49 A;  1JHF A;  2F5V A;  2KZG A;  1K78 A;  5GP9 A;  2M87 A;  2BOL A;  4CCM A;  5D5U B;  3BWG A;  2E2I J;  3ZMS A;  3M3Y J;  5H6R A;  1IF1 A;  3M4O J;  2VQH A;  2K3F A;  5FRO A;  2EFW A;  2W82 A;  4M9Z A;  1WQ2 A;  4UNO A;  3RSN A;  2H6C A;  1J0R A;  4YRV A;  3KPH A;  4XKV A;  1YS7 A;  1WI3 A;  2DYR H;  2YSR A;  3M8E A;  2KMU A;  1ZRE A;  2CQ7 A;  1RC9 A;  3PO3 J;  2O61 A;  4MIM A;  4PJN A;  4CCL A;  5LEK A;  3F9K A;  3UKG A;  5F08 A;  1QPM A;  5J8F A;  1FBU A;  1ZLK A;  4Z2Y A;  2E2J J;  2FOK A;  2LKP A;  3G2B A;  3PUB A;  3H9J A;  3I4N J;  1HSJ A;  2XVC A;  3DEW A;  3ZXS A;  2VC1 A;  2M34 A;  2VE9 A;  3C7J A;  2EQR A;  1S29 A;  1POG A;  3RKY A;  4EMS A;  1ENH A;  1VND A;  4RB0 A;  5C4J J;  3U1K A;  5AIP A;  1XTA A;  2X6O A;  4YEJ A;  4GFB A;  2PJP A;  2X0L A;  4NBQ A;  4BYY A;  3LSJ A;  2A6T A;  5EYR A;  3GW2 A;  4ENN A;  4KUM A;  1SD7 A;  2H27 A;  5F0F A;  1DPU A;  4I6Z A;  3BCA A;  1RUO A;  2YS9 A;  1KYZ A;  3DP7 A;  2EZI A;  4A3C J;  1FBS A;  3JRI A;  1IJW C;  3K70 D;  2OD5 A;  4D5F A;  4KIT B;  1JXS A;  5J6X A;  1P4X A;  2DFF A;  1WH7 A;  3QAH A;  4HF1 A;  2DJN A;  2BGC A;  1FTZ A;  2CUZ A;  1OYW A;  1E3H A;  5JR3 A;  2LFB A;  4CXF A;  2V4J C;  2HKO A;  4PJ0 C;  3OYE A;  4M9X A;  4HRI A;  2XV4 S;  1PVE A;  4XOT A;  1O3T A;  1T95 A;  1Z7L A;  2IEK A;  3N05 A;  1WJB A;  3WTS C;  3IC7 A;  4XKC A;  3QOE A;  2X85 A;  5HNH A;  4G7H F;  3A2K A;  4PFO A;  3ZQF A;  3FXK A;  3CDI A;  4U87 A;  1UZC A;  1QZZ A;  1XMX A;  1B9M A;  4I76 A;  3PSI A;  1LDJ A;  2W57 A;  1Z1D A;  5E1W A;  3U1D A;  3P9I A;  2E5N A;  3CP2 A;  3K4C A;  4BE1 A;  4ZJZ A;  4UV9 A;  1JTX A;  3KYC B;  4RGR A;  2CUF A;  4DBQ A;  4KDP A;  3CMA I;  1O7F A;  2RQP A;  1ERD A;  1E3O C;  3CD6 I;  1G3T A;  3Q0W A;  2LDU A;  3WHB A;  1X3W B;  1APL C;  4F7Z A;  3CCS I;  1SD6 A;  4LIV A;  5FO5 A;  5IP9 J;  5HLI A;  1JGS A;  2W24 A;  3HSR A;  4CYC A;  4OIQ F;  1ZH5 A;  1ITY A;  3CLQ A;  1S3J A;  2ZXH A;  3OR2 C;  4O3M A;  2XRO A;  1OCP A;  3D1N I;  1EJ9 A;  5K1Y A;  1FOX A;  2A6H F;  2BVL A;  1X4O A;  2MLK A;  3R61 A;  4LG0 A;  3W6J B;  5B3S H;  4HLY A;  2EV6 A;  1OJL A;  5AON A;  4IRI A;  2XAF A;  2P6S A;  1L3L A;  1GV2 A;  1XGM A;  3PL8 A;  4HV6 A;  2DAO A;  2V7F A;  4ZYE A;  4LD5 A;  4ZC3 A;  1X1A A;  5J4V A;  1R22 A;  2RVC A;  5JVT A;  4RS8 A;  3IAS 2;  4M73 A;  5D6F A;  3ML6 A;  2NOG A;  2EV5 A;  2IS1 A;  3C2G A;  2X6W A;  4JX5 A;  3LMM A;  3QP6 A;  3S2H J;  1X3U A;  5EGO A;  3TP3 A;  1WJC A;  3CP8 A;  1BJA A;  3FMS A;  3G73 A;  5HOD A;  1U9O A;  3JRC A;  4P5O A;  2M45 A;  2MBF A;  2UZK A;  4DQ2 A;  4WCG A;  4M6V A;  4RDU A;  5E17 F;  3E5Q A;  2LH9 A;  3O2P E;  5DM7 F;  1XDS A;  3EDP A;  1BIA A;  1Z21 A;  1K6Y A;  3HHG A;  3MQ0 A;  2AQF A;  2OC6 A;  4IHS A;  4N4N B;  2K3P A;  2O5R A;  5E20 A;  2NVX J;  1EA3 A;  2L4A A;  4PSX A;  3HOZ J;  3HUG B;  3HHH A;  1SAN A;  1HQC A;  2IA0 A;  3S15 J;  3JTG A;  2NVQ J;  1HDD C;  1PYV A;  1K4T A;  2YR2 A;  2L9R A;  1MH3 A;  4XLH A;  2K9L A;  1WFX A;  2E60 A;  4M9S A;  2CU7 A;  3EUH A;  4LIT A;  1U8B A;  2FOW A;  3OR1 C;  2FML A;  1IGN A;  5LEJ A;  2EIK H;  2X6X A;  3FK6 A;  3V8J A;  1AWC A;  2UWM A;  2E34 A;  3I4P A;  5JHU A;  3E6C C;  1YI2 I;  3PFY A;  3Q9S A;  1MBJ A;  1ETW A;  5LD2 C;  2DT7 B;  3HOX J;  1OCR H;  4XON A;  1T56 A;  2XAQ A;  3DLA A;  2L7M P;  3H3Z A;  4OIO F;  2NVU B;  4GGG A;  4M72 A;  5DDG A;  1ZG1 A;  2KP6 A;  2M5W A;  2Q2E B;  4WF2 A;  2FMY A;  1HF0 A;  4MEY F;  3P9K A;  3CCU I;  4CA0 A;  3TOA A;  3GTO J;  3ZCO A;  4HX4 A;  3K4L A;  1QA6 A;  1YJ9 I;  4X6A J;  4FQG A;  1Y1W J;  3F6V A;  3GX4 X;  1R9T J;  2ZJR F;  5H6Q A;  5LHI A;  2HVR A;  1V3F A;  4WWC A;  4UB8 C;  5BOX A;  4BE2 A;  2NVY J;  4CZZ A;  4ZZD A;  3I0T A;  3OY9 A;  2VB6 A;  3LST A;  4P9F A;  1IC8 A;  4I01 A;  4LIU A;  1TQP A;  2HWV A;  2OUM A;  4HQE A;  2RV8 A;  3A0H C;  1I1G A;  3CES A;  2HZT A;  3LSR A;  3F6O A;  5E3N A;  2R7S A;  2W48 A;  1RES A;  3BCB A;  2OCC H;  3JRF A;  2GWR A;  4KIS A;  1ON1 A;  3E3V A;  3RJP A;  1ETK A;  1O3Q A;  2F6C A;  1SFO J;  2HFH A;  5EF6 A;  3FWE A;  1PP7 U;  1D1B A;  4X1E A;  2F5C A;  3WU0 A;  3QQA A;  2M4K A;  3PNV A;  5IYC J;  1SVO A;  3SDB A;  2VQL A;  2VBX A;  2VT3 A;  2RN7 A;  5DCM B;  2RAE A;  1NG6 A;  5ILU A;  2HOA A;  4XOP A;  2F5F A;  3FK7 A;  3HTS B;  2BV6 A;  3CCM I;  1U78 A;  3D0S A;  1A31 A;  2DA7 A;  2NXN B;  3R4K A;  1ZYR F;  1OMI A;  4XR6 A;  1U8R A;  1YOV B;  2D1H A;  1YG2 A;  4Y15 A;  5B1A H;  2DTR A;  4RA2 A;  3RPU A;  1X2M A;  4C9Y A;  3JR9 A;  3HL2 A;  3A01 A;  4U0W A;  4I7H A;  4A12 A;  1FOW A;  1ETY A;  2D45 A;  2QBY B;  4K2E A;  4XQF A;  2D5V A;  1Y1V J;  3IP4 B;  2YUS A;  3EUA A;  3S1N J;  4KN7 X;  2HDW A;  1VZ0 A;  3M1C A;  4MTD A;  1YW7 A;  1OR7 A;  2ZB9 A;  3HEF A;  2MW8 A;  2IJL A;  1BC8 C;  3DU6 A;  4UB6 C;  1QZY A;  2GXB A;  2O9L A;  2UV1 A;  2LD5 A;  3OSG A;  3MEX A;  2RNG A;  2IA1 A;  4WX9 A;  4IHT A;  3DCF A;  2JPC A;  3BQY A;  3CUQ B;  2IGN A;  4N9I A;  1IN6 A;  2PEX A;  5F1J A;  2MYS A;  4HNV A;  1J9I A;  3OYF A;  1M1E B;  3CME I;  2ZXJ A;  4KIC A;  2ZCW A;  4PJJ A;  1WZ2 A;  1SAX A;  2CSO A;  2VXD A;  4U7B A;  2UXX A;  4BE0 A;  2XPU A;  2ADU A;  2EK5 A;  2CUJ A;  5CVU A;  3WE2 A;  3OYM A;  4YIF A;  3PM1 A;  3I5U A;  3DFG A;  4ZDO A;  5JI6 A;  2L4M A;  2K9M A;  4CO8 A;  2QCO A;  5J47 A;  4BH9 A;  1G3Y A;  1LFU P;  3HDD A;  4UVA A;  3OYJ A;  4XSZ F;  5J1U A;  3RKX A;  3GTM J;  2CG4 A;  2JZY A;  2WV1 A;  2OV7 A;  5B66 C;  4YIR X;  1ZGW A;  3J7A O;  1DGR M;  4LB6 B;  2FQ3 A;  4BQO A;  4MFD A;  1R5I D;  3D5S C;  3LA2 A;  4BJT A;  1P4A A;  3F8N A;  3QPL A;  2PMZ A;  2R7O A;  1K7A A;  2L9S A;  1S8N A;  4HEA 2;  4JK1 X;  1U5T A;  2FE3 A;  2VQG A;  3B6C A;  1XSV A;  1JGG A;  3I53 A;  1IAW A;  1J2X A;  1ODD A;  1LEB A;  5L3C A;  1JT0 A;  2HZD A;  1V5G A;  2QEX I;  4L18 B;  3M8F A;  2QSH X;  4N9H A;  3R0A A;  1XGO A;  4GO1 A;  3F22 A;  2PN6 A;  4L0Z B;  4IHY A;  1K78 B;  2IS6 A;  1MW7 A;  2HXI A;  2M0M A;  4AD9 A;  3IAM 2;  1TZL A;  3QOP A;  2ZKZ A;  1WPK A;  5FKK A;  3SZT A;  3EET A;  3A1Y A;  4F55 A;  1B9N A;  4PJM A;  1SC7 A;  5H2F C;  3S1Q J;  4BHB A;  1S9H A;  2WAD A;  4XSX F;  5CVR A;  1O57 A;  2G0E A;  2BXZ A;  2HQR A;  2K85 A;  3JRD A;  1H9G A;  5HS7 A;  5LFA A;  4GXO A;  1JHH A;  4I09 A;  4PSW A;  2DW4 A;  2Y0M A;  3FHZ A;  2DN0 A;  2DK8 A;  1UCR A;  2EIN H;  1P7I A;  3DWL E;  2IW5 A;  2OQG A;  3C3W A;  3NQO A;  2JTV A;  4NUB A;  1QQI A;  1T2K A;  2DMP A;  2AXT C;  3BG6 A;  3M8J A;  3WTV C;  3IRQ A;  1QHH D;  3E6B A;  2KJB A;  2XGD A;  3M1E A;  4HX8 A;  5HS9 A;  1IV8 A;  2A69 F;  1A04 A;  5E1X A;  3UNG C;  2FF4 A;  2KFD A;  5CKT A;  4C3H J;  1T08 B;  4XKB A;  3HPH A;  3DLL F;  1BOB A;  1T98 A;  3WGH A;  5M3F J;  3ZN1 A;  1HW2 A;  4KNY A;  2O7O A;  1D3Y A;  3GBG A;  3K9T A;  3GLX A;  2CJJ A;  2CMP A;  4HA8 A;  1PP8 F;  5D6E A;  1TNT A;  2YX7 A;  4IX7 A;  3E5X A;  4ON0 A;  1VI0 A;  1T0F C;  2GQQ A;  3PSF A;  3K69 A;  5ICG A;  3FBN B;  2NOJ B;  3OYK A;  3T8T A;  2ME0 A;  1IXS B;  1FX7 A;  5EZG A;  3MKW B;  2ECC A;  4V2F A;  3JSP A;  4GYI A;  4Y3O A;  4C3I J;  2X51 A;  4Q48 A;  1JUP A;  3HOS A;  1OQY A;  2GBY A;  5A2Q Z;  2O3F A;  4TV7 A;  2P5V A;  2OCE A;  4DYR A;  2MC4 A;  2W85 A;  1O3R A;  3WE3 A;  1ON2 A;  2NAZ A;  5HOO A;  2CUE A;  4IRH A;  2X1E A;  5F0H A;  2H1L A;  1I39 A;  3F3X A;  2PI0 A;  2XC7 A;  1GLN A;  2Z99 A;  2I5U A;  2E1O A;  3FKI J;  3KIO A;  1YJN I;  3KEY A;  2COB A;  2IXS A;  1HW5 A;  1TBX A;  4UXN A;  4AIJ A;  1YYV A;  4FX4 A;  2DQL A;  4QPO A;  2ZXW H;  3L2Q A;  1IN4 A;  1FMW A;  3LWF A;  3QYB A;  5DM6 F;  3KZY A;  4CYD A;  2R7V A;  5J3L A;  5JVG F;  2IS4 A;  4G6T B;  1P92 A;  2BY3 A;  4YFK F;  4F92 B;  3WG9 A;  2XB5 A;  2K27 A;  2XRN A;  2LVS A;  3NAU A;  3KYD B;  3W6K B;  2VT2 A;  4A3J J;  2ME6 A;  1E17 A;  5LRS A;  3FBI B;  5DTD A;  1D0X A;  1W4M A;  2KIF A;  3HRU A;  3KEO A;  2GXG A;  3QYF A;  2LKX A;  3TMO A;  3IV5 A;  2KZV A;  4FE4 A;  2KIM A;  3CCL I;  1DP7 P;  2GXA A;  2M2E A;  3WHC A;  4LG0 B;  1LDD A;  4IRG A;  1X1B A;  1BBY A;  4R8H A;  1UAA A;  4MQV A;  2BY2 A;  2HKX A;  4EAT A;  4OAY A;  5KCM A;  1WGX A;  2W84 A;  2FBH A;  3W2W A;  4II3 A;  4XIC A;  3FXL A;  3CUQ A;  3K70 C;  4F3Q A;  1R00 A;  3OYB A;  4HV5 A;  4DBR A;  3MAJ A;  5FKN A;  1I6X A;  2ZME B;  4EJT A;  1RIO H;  1TL8 A;  1R36 A;  5CLS A;  3RPU D;  5TRD A;  4FE7 A;  4AIK A;  3IKV A;  1DU6 A;  2AS5 F;  2D1V A;  2NS7 A;  4HBL A;  3F23 A;  4ENK A;  3AAF A;  1VQ7 I;  1BW5 A;  3WTU C;  4XNF A;  5HNF A;  1FP1 D;  3JAM Z;  2XSJ C;  4HF2 A;  3RZO J;  5E1Z B;  2M7B A;  4MTE A;  1XG1 A;  2ZO4 A;  1TWC J;  2RQQ A;  3MKL A;  2FU4 A;  5ILS A;  2X9D A;  2JUC A;  5ICE A;  3WOD F;  1Q1V A;  4UY8 I;  2DT6 A;  4LK0 F;  2PMZ N;  1AU7 A;  4L5J A;  2R7U A;  2GZW A;  3RTR A;  1FT9 A;  3SJM A;  3L9F A;  1AOY A;  4KT5 C;  4C3J J;  2W25 A;  4ZTJ A;  4S04 A;  4ZDL A;  2PQ8 A;  4U0V A;  4AVP A;  2M8G X;  1XDU A;  4E7H A;  3WU1 B;  1ETX A;  2IAI A;  2MSY A;  2P5K A;  3FM3 A;  1G4D A;  2R3S A;  2K86 A;  3T8R A;  3ULQ B;  1OLT A;  3L2C A;  4BBR J;  2ETH A;  1JI8 A;  4IF4 A;  3OL4 A;  2OTL I;  1QVT A;  4XLP F;  1YRN B;  2E36 A;  3WTT C;  5BPI A;  2LLK A;  2K9S A;  1ETO A;  1ZKG A;  4W1U A;  5IY5 H;  4CUG A;  1MNE A;  1LE8 A;  1I27 A;  5TJJ A;  3S1R J;  4ESF A;  3HXL A;  3LSH A;  4I99 C;  4G7Z F;  2CRG A;  2V1N A;  1I50 J;  1MMA A;  3ABL H;  3HM5 A;  2Y69 H;  2LY9 A;  2E7X A;  4HLX A;  5DS9 A;  5KNL A;  1VQ9 I;  4A3I J;  4ESJ A;  2DA6 A;  4II2 A;  3PNT A;  2VBY A;  2OAZ A;  5BS6 A;  1BI1 A;  1DGW Y;  1T38 A;  2L9N A;  2HOE A;  4CCO A;  1FOK A;  2E1C A;  2HXO A;  5HDK A;  2QEN A;  4MO7 A;  3ZMU A;  2R92 J;  2CV1 A;  3SFI A;  2EV0 A;  4XKW A;  4E7J A;  1TTY A;  5J1R A;  2HVS A;  4EV0 A;  1SFK A;  5M5W J;  2B0L A;  1EH6 A;  4XLF A;  1HOM A;  3DF8 A;  3WGG A;  2EFQ A;  4BXF A;  2VJ5 A;  3DTK A;  3ISP A;  3DKW A;  4IJA A;  4JX6 A;  3FXO A;  3UR3 C;  3BOQ A;  4L5I A;  1D1C A;  3GXO A;  4IO9 F;  4G7O F;  3ZR8 X;  4Y13 A;  4ZZL A;  1K83 J;  5FJ8 J;  1IRX A;  2ELH A;  4BY7 J;  1ZR4 A;  1MMS A;  2KRF A;  3A02 A;  3EQL F;  2R7Q A;  1ZRF A;  3VSL A;  1XMK A;  1RI7 A;  3C18 A;  3H5A A;  2VE8 A;  3M9A A;  5CQE A;  1IUY A;  3ZQH A;  2E35 A;  4BXU A;  2IS2 A;  1YE9 A;  2PMU A;  2XHK A;  2CO5 A;  5E8I A;  3C2H A;  1SFU A;  2DLL A;  2J5P A;  3ZQI A;  1E0E A;  1KQ8 A;  4B3X A;  3MKZ A;  4XRS A;  2OBP A;  3V8K A;  3GTJ J;  3M07 A;  4HST A;  1OPC A;  2HQA A;  2EIM H;  3DEE A;  4R79 A;  4EGZ A;  1STZ A;  2PLY A;  4D5C A;  3F8F A;  2KHM A;  2ELK A;  4BU2 A;  1U2W A;  5F27 A;  2G7U A;  2YX4 A;  2CQN A;  4Y17 A;  2F48 A;  2K40 A;  2A3S A;  1LQ1 A;  2HQN A;  2ISZ A;  4BHP A;  3PIO F;  2R0Q C;  4L9V A;  3GCM A;  2L54 A;  3LFU A;  4R1H A;  5IYD J;  1LVK A;  4RBO A;  2VBZ A;  3NWS A;  2M0C A;  2A6E F;  3W3C A;  5DUK A;  2XAU A;  3D5L A;  2KIS A;  5F6F A;  2ZJ2 A;  4JYK A;  3A01 B;  2DQR A;  2JA5 J;  2GA2 A;  2DA1 A;  4A3F J;  3RKW A;  2BW3 A;  2K4J A;  2HOT A;  2IVM A;  2ZNZ A;  2Y30 A;  3QWL A;  2H94 A;  4Q4Z F;  1HXD A;  3GFJ A;  3KP2 A;  2P81 A;  5CQG A;  5JHF A;  3BTI A;  3K10 A;  3SYT A;  1IRZ A;  1O4X A;  1WJ5 A;  1WHU A;  4UUT A;  1XS9 A;  3F8C A;  4BDY A;  4OAZ A;  4U7D A;  2QUF A;  1E3P A;  3MZY A;  5F1R A;  3T0Y A;  4XRM A;  5LGU A;  1LDK B;  3PNY A;  1FSH A;  3U9G A;  4LG3 A;  4AID A;  3H3V K;  1JTY A;  3GTK J;  1HA8 A;  1L0O C;  3K4K A;  1ZAO A;  3PQK A;  2R7Z J;  1IN5 A;  2ICW G;  2F5D A;  2R7T A;  5GTI C;  2FX0 A;  3KZZ A;  2E19 A;  2QGU A;  3KX2 A;  3F8B A;  2CGP A;  1ZN2 A;  1ZHF A;  3ABK H;  3GME A;  2HR3 A;  1FJL A;  2LK2 A;  3ECO A;  4BQQ A;  3G6E I;  5E3O A;  4KYW A;  2QQA A;  1NH3 A;  2RKH A;  2A05 A;  1QGP A;  1VQN I;  3I56 I;  3WTX C;  2ZME A;  2L2O A;  3DV8 A;  2JSC A;  4IOC F;  2R7F A;  3DPL C;  3V7R A;  4HOB A;  3JSO A;  1I6H J;  4N0B A;  1Y6I A;  4I0A A;  4XN3 A;  3HIF A;  5JLW A;  3VB2 A;  3LQR A;  2JVG A;  3G71 I;  3F21 A;  3H9G A;  3GFI A;  4Y52 J;  5J8C A;  1BI0 A;  2EH3 A;  2L7Z A;  1KGS A;  3Q0U A;  1K6O A;  4XRF A;  4V2G A;  2EBI A;  2DBB A;  2CS3 A;  5ICC A;  1HC8 A;  3NWT A;  3CJN A;  1QBJ A;  5HS8 A;  2WA0 A;  3VDX A;  2VKH A;  1KON A;  1R1T A;  3OYA A;  1U5T B;  5HDN A;  3OSF A;  1FYM A;  4A0Z A;  2CW8 A;  1R4N B;  2DDA A;  3EYI A;  1V54 H;  2K9Q A;  5E3M A;  3ZQQ A;  1O3S A;  4Q47 A;  2DA2 A;  4YII A;  2QKL B;  1ULY A;  3GF2 A;  2A5W A;  2E71 A;  4B3A A;  4NC7 A;  3H92 A;  2CV0 A;  2P8T A;  1IXC A;  3VYU B;  2BHY A;  3H1C A;  1V4R A;  1VF9 A;  1YRN A;  3LSP A;  5ED4 A;  1MMN A;  2QZ8 A;  2R5Y A;  3L7W A;  5E8G A;  4BJ5 C;  3DTE A;  3GTL J;  5F04 A;  4ABZ A;  5DD4 A;  1U9N A;  3I54 A;  5HLT A;  1TQI A;  1WJE A;  3RPQ A;  2MH9 A;  3BG3 A;  3DEU A;  1V55 H;  1R5G A;  1RKW A;  3AL0 C;  3J81 Z;  2JSP A;  1HST A;  2K7L A;  3SQN A;  3FMR A;  3OYC A;  2E1M B;  1IUF A;  4L0Y B;  2CQK A;  3BG9 A;  1U6G A;  3TO6 A;  4I98 B;  1PUE E;  2JWT A;  4A0Y A;  1IN8 A;  2DPU A;  3GEZ A;  3WTZ A;  5K7H A;  1B8I A;  1VQO I;  5D4S A;  3N97 A;  4G12 A;  4CCJ A;  2MH2 A;  3HRM A;  2PJR B;  1Z05 A;  1N25 A;  1MBH A;  2Z5U A;  1D5V A;  2NS8 A;  2VOD A;  3S17 J;  5M3M J;  2R5Z A;  3TGN A;  1MDM B;  1UG2 A;  1RPW A;  2HYJ A;  3CMM A;  2KDZ A;  2GM4 A;  3HOU J;  2YU3 A;  3RYP A;  4DW6 A;  1REP C;  3S3M A;  2LSO A;  2XKP A;  2LYC A;  3BJA A;  3ZMT A;  1A5J A;  3TL4 X;  3FZV A;  3BPV A;  3G3Z A;  1XB4 A;  4MEX F;  5EDN A;  1SFX A;  3ZQC A;  2E1N A;  3U21 A;  1V5E A;  4OWR B;  2O6G E;  3CUO A;  1X1C A;  3B02 A;  3CDL A;  2LNB A;  2ZFW A;  3K1P A;  1ORK A;  4RLQ A;  1VQP I;  5K7F A;  1YIT I;  2CW0 F;  3BJO A;  5LGN A;  2Y2Z A;  5GAE J;  4XID A;  1ZG5 A;  4GYG A;  1TLH B;  1VTN C;  4CHU A;  4F52 A;  2VAS A;  5J4Y A;  1SD4 A;  1G3S A;  2Y48 A;  3BTJ A;  2MAB A;  3CCQ I;  3K2Z A;  2WAE A;  4G6D A;  3L09 A;  3CQZ J;  3RQI A;  4JBA A;  4H4K C;  3E0J B;  3OOU A;  4YFX F;  3IH3 A;  1JUS A;  2Q8K A;  5LLQ A;  3BR3 A;  3TO9 A;  4U0Y A;  2Z16 A;  4BS9 A;  4XBF A;  1SMY F;  1KU7 A;  1YHQ I;  4L9N A;  1Z0X A;  1JJ6 C;  2QQB A;  3I4M J;  3VFZ A;  2GOM A;  5LBQ A;  3ZMZ A;  4JX4 A;  4H0E A;  1D8J A;  2QSG X;  2ECB A;  5EG0 A;  5FKM A;  4MNU A;  3JCU C;  5IP6 A;  3QRF F;  1HKQ A;  4OIN F;  3LSG A;  4QPQ A;  2LF8 A;  3PUF A;  3OS0 A;  2W1O A;  1T6S A;  2VBW A;  4NB5 A;  4X0G A;  1VQ4 I;  1MJ9 A;  4BHC A;  1FEX A;  4E7Z A;  1MBG A;  4ESB A;  4LGW A;  2IRF G;  2CYY A;  3MMY B;  4PK4 A;  3VWB A;  5FFZ A;  5DCF A;  5D5X B;  2EB7 A;  4OIP F;  4A0X A;  3EUH C;  3HB9 A;  2DFI A;  3GTQ J;  3BRO A;  1PUF B;  3HG9 A;  4XLE A;  1G8X A;  1XN7 A;  3FM5 A;  4MFE A;  2JA2 A;  2V1X A;  3GO5 A;  3AG3 H;  3AKZ A;  4PJL A;  3VYR B;  3ZQL A;  1S72 I;  2Z9O A;  4PFP A;  1QPI A;  3KZI C;  3LSI A;  5KVR A;  4ZYA A;  2RC4 A;  2HOS A;  1K4S A;  1Z67 A;  2FEZ A;  2VPL A;  1VQ8 I;  1IXR C;  1LKX A;  4C2M J;  3VPR A;  1RR8 C;  3L2W A;  1DUX C;  4BNC A;  4IHW A;  1I3A A;  4BQN A;  1XCV A;  3PFI A;  5IPA A;  2HI3 A;  2EFN A;  1R4M B;  3PIP F;  1JKQ C;  4E70 A;  3BP8 A;  2KT0 A;  5L3D A;  2VI6 A;  2Y9Y A;  2Z3Y A;  4EQQ A;  4UUS B;  3K2A A;  3IKT A;  5GPC A;  4C30 A;  1MND A;  4HX7 A;  2L7K A;  4W97 A;  4AM3 A;  1R58 A;  1EH7 A;  3VOE A;  5FLX K;  5GTH C;  5A2Q K;  3CCJ I;  3HRS A;  2FBK A;  3CMY A;  3TO7 A;  4E7S A;  4NC6 A;  4LLL A;  1MH4 A;  4KMU X;  4E4H A;  1BR4 A;  1MNM C;  4AUX A;  1W1W E;  4OMY A;  2ID6 A;  2V1D A;  3TP0 A;  2XF7 A;  2M8E A;  1JKO C;  1FTT A;  1MJB A;  1AKH B;  2DDB A;  2QSF X;  2Y0S A;  4LJZ F;  1LE8 B;  1EKE A;  2GIV A;  4RAG A;  5DD8 A;  5FKO A;  3D5R C;  1R1V A;  2ESH A;  3CLO A;  2JA7 J;  2XSD C;  1Z9C A;  2HU9 A;  4F93 B;  1XSD A;  2BE5 F;  2HGC A;  1FY7 A;  2XUB A;  4WXC A;  4LFU A;  4O5V A;  4DJA A;  1FLI A;  4S0H B;  2V6C A;  1N78 A;  5DEQ A;  2KQR A;  3L00 A;  3I3L A;  2XDV A;  2VKD A;  1P2F A;  3FXQ A;  3Q0V A;  3IRR A;  1OCZ H;  3LOC A;  3CCV I;  4U88 A;  4C2T A;  1B4A A;  3LQQ A;  3G1O A;  4L9T A;  1BW6 A;  1S5L C;  1FYL A;  2RRE A;  1TQM A;  2PBI A;  1WVR A;  3Q9V A;  1VQK I;  2HDD A;  4EJU A;  3ZMV A;  4DZJ A;  4A3B J;  1W7P A;  5L3E A;  2WAF A;  1MSF C;  3RCO A;  1HKT A;  5L3B A;  3H9Q A;  3H3U A;  3GZN B;  5HLH A;  2DU9 A;  3RQ4 A;  3ERE D;  2PJR A;  2CH0 A;  4RB2 C;  1UG0 A;  4A2U A;  3KYL A;  1UHS A;  1QRY A;  1OKR A;  1F36 A;  2JMW A;  4A3G J;  5AIQ A;  1ZEL A;  3BR5 A;  3ROU A;  1K79 A;  1MDM A;  1OR7 C;  5EJC A;  5F0C A;  3A03 A;  4RGS A;  3S2W A;  3I71 A;  2FD5 A;  3H5N A;  4EJO A;  1TP4 A;  3MVP A;  4RAY A;  3JRH A;  1JKP C;  3L2R A;  3ESW B;  5K5O A;  5L3G A;  4CGZ A;  2EA2 A;  2HVQ A;  3LFK A;  3JAM K;  2Q0O A;  4Y33 A;  3HSF A;  1Y56 A;  3WGI A;  1ZGA A;  3LAJ A;  4PGG A;  2OU2 A;  2CFO A;  1YX5 A;  5CVJ A;  1KQ9 A;  3HGY A;  1USS A;  3K7A J;  3S16 J;  5CVI A;  2Z2S B;  3WTW C;  5FLX Z;  1WKM A;  1K61 A;  1SEU A;  1G2H A;  4XLC A;  4A6E A;  2O8X A;  2DMN A;  5K5Q A;  1Y0U A;  5IYB J;  5FGM A;  3CC7 I;  1O7L A;  5D8K B;  3DKY A;  1IZ1 A;  1WJD A;  4M3F A;  2X1D A;  4RMN A;  4HAM A;  9ANT A;  3IH4 A;  4J19 A;  2OA4 A;  1FMV A;  1QNT A;  1TWH J;  1H9T A;  2JQ7 A;  2W00 A;  2WTE A;  3BTL A;  3HC7 A; 
#chains in the Genus database with same CATH homology
 1FWZ A;  2FBI A;  2WV0 A;  2STW A;  4BQA A;  5IT3 A;  3NRV A;  3ZMD A;  2PG4 A;  1U5T C;  3BDD A;  4IPA A;  3KP4 A;  4PZJ A;  1IW7 F;  1UST A;  1B59 A;  4WK8 F;  1GXQ A;  2EA4 A;  2V79 A;  2P7V B;  3DXJ F;  3M7G A;  4HW0 A;  4HYE A;  1Z91 A;  4RB1 A;  3DPT A;  4D0P A;  1IN7 A;  1C0W A;  1S7A A;  4DNC A;  1RUN A;  3SZP A;  3KLN A;  3E5U A;  2L01 A;  2GAU A;  1Z6R A;  3K1M A;  3TQN A;  2V1U A;  4EJV A;  4EVI A;  3LAP A;  4KA4 A;  2H6B A;  2UXN A;  2HEO A;  2P7C B;  2DI3 A;  4YG2 F;  2MD5 A;  4IVN A;  3CO7 C;  1Z6T A;  4UUV A;  4P96 A;  2FRH A;  3ZP5 A;  3R0J A;  1IRG A;  2NNN A;  3WTY C;  4KMF A;  3I64 A;  4WXH A;  3ELK A;  2MLG A;  5HDG A;  2HTS A;  3ABU A;  1WSU A;  1Q1H A;  1FZP B;  2VOO A;  4QLC U;  1WRJ A;  3KP3 A;  1ZRC A;  4ASN A;  3RYR A;  2OZ6 A;  3SHF A;  5LHG A;  4UV8 A;  2AXL A;  3FXR A;  2VON A;  4GCV A;  2OZU A;  2KKO A;  3V7C A;  3V8L A;  1W5T A;  1RZ4 A;  3OV8 A;  2XAS A;  1D8K A;  5EEG A;  5FB2 A;  5FD6 A;  4KIB A;  3CO6 C;  2K4B A;  2YPR A;  2XKO A;  3N4M A;  3O3K A;  1WI9 A;  4M6X A;  1F5T A;  2FA5 A;  4EJW A;  2A68 F;  2CFX A;  3FX3 A;  1FPQ A;  2ZNY A;  1I1S A;  1XD7 A;  4MHG A;  1ZG3 A;  1YQA A;  4XLN F;  1XGN A;  3CDH A;  3QPT A;  1FBQ A;  4CDG A;  2WWY A;  4FX0 A;  3DQV C;  3GUD A;  2VC0 A;  4P55 A;  5ILV A;  5L3F A;  2FXA A;  4G8X A;  2RNJ A;  2G7H A;  3R6S A;  2FSW A;  3CUQ C;  2NS0 A;  1EH8 A;  3FMQ A;  3JW4 A;  1Z7U A;  1XMA A;  1ZAR A;  2H09 A;  1IRF A;  1W7P D;  2L02 A;  3RIR A;  2A5Y B;  2ACJ A;  1FSE A;  5D4R A;  1YIO A;  3J80 K;  1CGP A;  1SD5 A;  5IT9 K;  3MZH A;  1XGS A;  1F1Z A;  5ERI A;  1LJ9 A;  3TDU C;  4UHT A;  1J59 A;  2KJC A;  2JPB A;  2M30 A;  2O03 A;  3T5X A;  3HOT A;  4YFN F;  5KK1 A;  3KE2 A;  3J81 K;  1HBX G;  1S6L A;  3PQJ A;  1J7K A;  1YFH A;  2BEO A;  5FFX A;  1ONV A;  2JRT A;  4OIR F;  1G6N A;  3KCC A;  5LHH A;  1MD0 A;  2DK5 A;  3HRT A;  1ZLJ A;  3T1B A;  3GFL A;  1TW3 A;  3RI4 A;  4ETS A;  4A5M A;  3LA7 A;  5ICF A;  1F4K A;  2IPQ X;  1UB9 A;  2QYO A;  4IXA A;  1BOA A;  3V7S A;  1FNN A;  3COA C;  4UVB A;  2A07 F;  3K0L A;  2LF7 A;  2ISY A;  2K02 A;  2QQ9 A;  3J80 Z;  2L3D A;  3IWZ A;  1EV7 A;  5IT9 Z;  2JT1 A;  2EWN A;  4ENJ A;  4FHT A;  1MGT A;  1P4W A;  4G9Y A;  5E18 F;  3MCZ A;  4B09 A;  3IL2 A;  2P4W A;  1OYY A;  2QVO A;  3VEP A;  2FNA A;  5CVV A;  1BI3 A;  4I02 A;  2J5O A;  3F8M A;  2DT5 A;  3FXU A;  1W7P B;  3CTA A;  3REO A;  4HQM A;  4M6Y A;  2R7D A;  4KIF A;  3P7N A;  1BM9 A;  4LB5 A;  4BAY A;  1OYI A;  1YW9 A;  4AIH A;  3QU3 A;  1LB2 A;  1YO5 C;  1I5Z A;  5BMZ A;  4A6D A;  5CJ9 A;  2IA2 A;  3E6D A;  2QLZ A;  1BN5 A;  2F5E A;  1FYK A;  1NHA A;  3TOB A;  3E97 A;  4KIG A;  4ENM A;  5LGT A;  2MA3 A;  5EEH A;  1J75 A;  1XCB A;  1YW8 A;  4RB3 C;  4Q5S F;  3GYH X;  1U3E M;  4I0B A;  3P9C A;  4HZF A;  3HSE A;  1B6A A;  2Y75 A;  3KP5 A;  6PAX A;  2HYG D;  4PDK A;  2HYF A;  2CWE A;  1R5H A;  1QO0 D;  3OOP A;  4ZH4 F;  2QM3 A;  2O0Y A;  3QU6 A;  4EM0 B;  1KU3 A;  1YS6 A;  2OQR A;  4FT8 A;  3IHU A;  2RDP A;  1F9N A;  2HTJ A;  2IT0 A;  3F72 A;  3I59 B;  1FC3 A;  1HW1 A;  3NEU A;  4B8X A;  1T0F A;  4NHJ A;  4HDU A;  3ZPL A;  1FP2 A;  3JTH A;  4CIC A;  2XGX A;  5K5R A;  1ZGJ A;  4OMZ A;  3B73 A;  5JFR A;  4LK1 F;  3VOD A;  1TW2 A;  5FD5 A;  4LLN A;  3QP5 A;  4PCQ A;  5HVQ C;  3ECH A;  1BIB A;  4I2O A;  5BPD A;  4S05 A;  1BI2 A;  1LNW A;  3ABT A;  2P6T A;  3GZ5 A;  1YTY A;  5H20 A;  3I58 A;  1CF7 B;  1KU9 A;  3MFK A;  1UFM A;  1WWX A;  3HUG A;  2NRA C;  3HTU A;  2RGV A;  3SXY A;  4A5N A;  3GFM A;  4ZYG A;  1R23 A;  4EM2 A;  2Z33 A;  1R1U A;  1MJA A;  3HYI A;  2NYX A;  1YLF A;  3LA3 A;  2EFO A;  2F2E A;  4KN4 X;  1R7J A;  3FF5 A;  3MWM A;  4AWX B;  4ZYH A;  4NQW A;  5D8L B;  4M71 A;  4LMY A;  2Q2E A;  4OOI A;  4RGX A;  1DPR A;  3O6B B;  3GVA A;  3QPH A;  3KET A;  3ZN0 A;  2X4H A;  4L9J A;  4ZYD A;  4JQF A;  1W5S A;  1J5Y A;  2XAG A;  1ZRD A;  5F64 A;  1LEA A;  4G94 A;  4M74 A;  1KQ0 A;  3R60 A;  5HLG A;  2COM A;  1BC7 C;  4QWQ A;  1UHW A;  4RGU A;  3BY6 A;  2HS5 A;  2V9V A;  3E6M A;  2M1B A;  2XIG A;  4G6Q A;  1GVJ A;  1E2X A;  1LVA A;  3Q5F A;  1TNS A;  2TDX A;  5DV5 A;  3EYY A;  5BQT A;  3KP7 A;  5DCM A;  1T39 A;  2BBY A;  2FNP A;  2G9W A;  2PFB A;  2IP2 A;  3GZ6 A;  1PDN C;  2XAJ A;  1H0M A;  2HDC A;  3BPX A;  2DPD A;  3BJ6 A;  1GXP A;  4EGY A;  4UVC A;  3K1N A;  4PGH A;  2NNY A;  1MZB A;  1XSX A;  3RDI A;  3SFZ A;  4HF0 A;  1DDN A;  4WXD A;  5CYV A;  2QBY A;  1RNL A;  5D5V B;  2VOP A;  3V4G A;  2KIU A;  5LRR A;  2VN2 A;  2WC2 A;  1MKM A;  4HDV A;  3I59 A;  3BZ6 A;  1GHC A;  2ESN A;  4O6J A;  1KU2 A;  1KA8 A;  1JE8 A;  2ZBK A;  4MGR A;  2MC3 A;  4MQ9 F;  1B1B A;  2GA1 A;  2E7W A;  1G3W A;  5DUI A;  2EFP A;  2C6Y A;  1S7O A;  3KEQ A;  2DO7 A;  4OU0 A;  2BYV E;  5D5W B;  4P9U A;  3GWZ A;  1SMT A;  2STT A;  4LLG F;  2QWW A;  1SFE A;  2P5L C;  2EJR A;  4EM1 A;  3IWF A;  3ZQ7 A;  3TDZ C;  1HKS A;  3KFW X;  3KLO A;  2D2W A;  1KYW A;  1UHM A;  2PMH A;  3KP6 A;  1CF7 A;  1P6R A;  2VXZ A;  3C1D A;  4KFC A;  3TKY A;  4RAZ A;  2A61 A;  2XAH A;  3U2R A;  5DYM A;  1JHF A;  1K78 A;  2M87 A;  5D5U B;  3BWG A;  3ZMS A;  5H6R A;  1IF1 A;  2EFW A;  4M9Z A;  1WQ2 A;  4UNO A;  2H6C A;  1J0R A;  1ZRE A;  1YS7 A;  2O61 A;  2YSR A;  3M8E A;  5LEK A;  1QPM A;  5J8F A;  1FBU A;  1ZLK A;  4Z2Y A;  2FOK A;  2LKP A;  1HSJ A;  2XVC A;  2VC1 A;  2VE9 A;  3C7J A;  1S29 A;  3RKY A;  4EMS A;  4RB0 A;  5AIP A;  2PJP A;  2X0L A;  4BYY A;  3GW2 A;  4ENN A;  4KUM A;  1SD7 A;  2H27 A;  1DPU A;  1RUO A;  1KYZ A;  3DP7 A;  1FBS A;  2OD5 A;  1JXS A;  5J6X A;  1P4X A;  3QAH A;  4HF1 A;  2BGC A;  1OYW A;  5JR3 A;  4CXF A;  2HKO A;  4M9X A;  2XV4 S;  1O3T A;  3WTS C;  3IC7 A;  4G7H F;  1QZZ A;  1B9M A;  1LDJ A;  2W57 A;  3U1D A;  1Z1D A;  5E1W A;  3P9I A;  4UV9 A;  4RGR A;  4KDP A;  1O7F A;  2RQP A;  1G3T A;  2LDU A;  4F7Z A;  1SD6 A;  5FO5 A;  5HLI A;  1JGS A;  2W24 A;  3HSR A;  4OIQ F;  1ZH5 A;  1S3J A;  4O3M A;  2XRO A;  5K1Y A;  2A6H F;  4LG0 A;  4HLY A;  3W6J B;  2MLK A;  3R61 A;  2EV6 A;  5AON A;  4IRI A;  2XAF A;  2P6S A;  1L3L A;  1XGM A;  4HV6 A;  2DAO A;  4ZYE A;  4LD5 A;  1R22 A;  2RVC A;  5JVT A;  4RS8 A;  4M73 A;  5D6F A;  3ML6 A;  2EV5 A;  3QP6 A;  1X3U A;  3FMS A;  1BJA A;  3G73 A;  4P5O A;  2M45 A;  2MBF A;  2UZK A;  4DQ2 A;  4WCG A;  5E17 F;  3E5Q A;  3O2P E;  1XDS A;  3EDP A;  1BIA A;  3HHG A;  3MQ0 A;  4IHS A;  5E20 A;  2L4A A;  3HHH A;  1HQC A;  2IA0 A;  3JTG A;  2YR2 A;  4M9S A;  3EUH A;  2FML A;  5LEJ A;  3V8J A;  1AWC A;  2UWM A;  3E6C C;  3I4P A;  5JHU A;  3Q9S A;  2XAQ A;  4OIO F;  3H3Z A;  4GGG A;  4M72 A;  5DDG A;  1ZG1 A;  2M5W A;  4WF2 A;  2FMY A;  4MEY F;  3P9K A;  3TOA A;  4HX4 A;  3F6V A;  3GX4 X;  5H6Q A;  5LHI A;  1V3F A;  4WWC A;  5BOX A;  4CZZ A;  4ZZD A;  3I0T A;  3LST A;  4P9F A;  4I01 A;  1TQP A;  2HWV A;  4HQE A;  2RV8 A;  1I1G A;  2HZT A;  3F6O A;  2GWR A;  1ON1 A;  3E3V A;  3RJP A;  1O3Q A;  2HFH A;  3FWE A;  1PP7 U;  2F5C A;  3WU0 A;  2VBX A;  2VT3 A;  2RN7 A;  5DCM B;  5ILU A;  2F5F A;  3HTS B;  2BV6 A;  1U78 A;  3D0S A;  3R4K A;  1ZYR F;  1OMI A;  1U8R A;  2D1H A;  1YG2 A;  4Y15 A;  2DTR A;  3RPU A;  4U0W A;  4I7H A;  4A12 A;  2D45 A;  2QBY B;  4K2E A;  4KN7 X;  4MTD A;  1YW7 A;  1OR7 A;  2IJL A;  1BC8 C;  1QZY A;  2GXB A;  3MEX A;  2IA1 A;  4WX9 A;  4IHT A;  2JPC A;  3CUQ B;  4N9I A;  1IN6 A;  2PEX A;  1J9I A;  2ZXJ A;  4KIC A;  2ZCW A;  1SAX A;  2CSO A;  4U7B A;  2UXX A;  2ADU A;  2EK5 A;  5CVU A;  3WE2 A;  4YIF A;  3I5U A;  3DFG A;  5JI6 A;  2L4M A;  4CO8 A;  4BH9 A;  1G3Y A;  4UVA A;  4XSZ F;  3RKX A;  2CG4 A;  2JZY A;  3J7A O;  4LB6 B;  2FQ3 A;  3LA2 A;  1P4A A;  3F8N A;  1K7A A;  1S8N A;  4JK1 X;  1U5T A;  2FE3 A;  1XSV A;  3I53 A;  1IAW A;  1J2X A;  1ODD A;  1LEB A;  5L3C A;  4L18 B;  3M8F A;  4N9H A;  3R0A A;  1XGO A;  4GO1 A;  3F22 A;  2PN6 A;  4L0Z B;  1K78 B;  4AD9 A;  3QOP A;  3SZT A;  2ZKZ A;  3EET A;  1B9N A;  4BHB A;  4XSX F;  5CVR A;  1O57 A;  2HQR A;  1H9G A;  5HS7 A;  4GXO A;  1JHH A;  4I09 A;  2DW4 A;  2Y0M A;  3FHZ A;  2DK8 A;  1UCR A;  2IW5 A;  2OQG A;  3C3W A;  3NQO A;  2JTV A;  1QQI A;  1T2K A;  3IRQ A;  3WTV C;  3E6B A;  3M1E A;  2KJB A;  4HX8 A;  5HS9 A;  2A69 F;  1A04 A;  5E1X A;  2FF4 A;  1T98 A;  3WGH A;  3ZN1 A;  1HW2 A;  4KNY A;  1D3Y A;  3K9T A;  3GLX A;  4HA8 A;  1PP8 F;  5D6E A;  1TNT A;  2YX7 A;  3E5X A;  4ON0 A;  2GQQ A;  3K69 A;  5ICG A;  3T8T A;  1IXS B;  1FX7 A;  3JSP A;  4GYI A;  4Q48 A;  3HOS A;  5A2Q Z;  2O3F A;  4TV7 A;  2P5V A;  2W85 A;  1O3R A;  3WE3 A;  1ON2 A;  2NAZ A;  5HOO A;  4IRH A;  3F3X A;  2PI0 A;  2Z99 A;  1HW5 A;  1TBX A;  4UXN A;  4AIJ A;  1YYV A;  4FX4 A;  2DQL A;  1IN4 A;  3LWF A;  3KZY A;  4CYD A;  1P92 A;  4YFK F;  3WG9 A;  2K27 A;  2XRN A;  3W6K B;  2VT2 A;  1E17 A;  5LRS A;  1W4M A;  2KIF A;  3HRU A;  3KEO A;  2GXG A;  2KIM A;  1DP7 P;  4LG0 B;  1LDD A;  4IRG A;  4R8H A;  1BBY A;  4MQV A;  2HKX A;  2W84 A;  2FBH A;  3CUQ A;  1R00 A;  4HV5 A;  3MAJ A;  1I6X A;  2ZME B;  4EJT A;  1RIO H;  1R36 A;  5CLS A;  5TRD A;  4AIK A;  3IKV A;  2AS5 F;  2D1V A;  4HBL A;  3F23 A;  4ENK A;  3AAF A;  3WTU C;  1FP1 D;  3JAM Z;  4HF2 A;  5E1Z B;  4MTE A;  2ZO4 A;  2FU4 A;  5ILS A;  5ICE A;  3WOD F;  4LK0 F;  4L5J A;  2GZW A;  3RTR A;  1FT9 A;  3L9F A;  1AOY A;  4KT5 C;  2W25 A;  4S04 A;  2PQ8 A;  4U0V A;  4AVP A;  1XDU A;  3WU1 B;  1G4D A;  2P5K A;  3FM3 A;  2R3S A;  2K86 A;  3T8R A;  3ULQ B;  3L2C A;  2ETH A;  4IF4 A;  4XLP F;  3WTT C;  5BPI A;  1I27 A;  5TJJ A;  4ESF A;  4G7Z F;  2E7X A;  4HLX A;  4ESJ A;  2VBY A;  2OAZ A;  5BS6 A;  1BI1 A;  1T38 A;  2HOE A;  2E1C A;  1FOK A;  5HDK A;  2QEN A;  3ZMU A;  2EV0 A;  1TTY A;  4EV0 A;  2B0L A;  1EH6 A;  3DF8 A;  3WGG A;  2EFQ A;  3ISP A;  3DKW A;  4IJA A;  3BOQ A;  4L5I A;  3GXO A;  4G7O F;  4Y13 A;  4ZZL A;  2ELH A;  2KRF A;  3EQL F;  1ZRF A;  1XMK A;  1RI7 A;  3C18 A;  2VE8 A;  3M9A A;  1IUY A;  4BXU A;  2PMU A;  2XHK A;  2CO5 A;  5E8I A;  1SFU A;  2DLL A;  2J5P A;  1KQ8 A;  2OBP A;  3V8K A;  1OPC A;  4EGZ A;  4R79 A;  2PLY A;  1STZ A;  3F8F A;  1U2W A;  2G7U A;  2YX4 A;  4Y17 A;  2A3S A;  1LQ1 A;  2HQN A;  2ISZ A;  4BHP A;  4L9V A;  2L54 A;  4R1H A;  2VBZ A;  2A6E F;  5DUK A;  3D5L A;  5F6F A;  2ZJ2 A;  2DQR A;  2GA2 A;  3RKW A;  2K4J A;  2IVM A;  2ZNZ A;  2H94 A;  4Q4Z F;  1HXD A;  3GFJ A;  3KP2 A;  3F8C A;  4U7D A;  2QUF A;  3MZY A;  5F1R A;  3T0Y A;  5LGU A;  1LDK B;  1FSH A;  3U9G A;  1L0O C;  1ZAO A;  3PQK A;  1IN5 A;  2F5D A;  3KZZ A;  3F8B A;  2CGP A;  1ZN2 A;  1ZHF A;  2HR3 A;  3ECO A;  4KYW A;  2QQA A;  2RKH A;  1QGP A;  3WTX C;  2ZME A;  3DV8 A;  2JSC A;  2R7F A;  3DPL C;  3V7R A;  4HOB A;  3JSO A;  4N0B A;  4I0A A;  3HIF A;  3VB2 A;  3LQR A;  3F21 A;  3GFI A;  5J8C A;  1BI0 A;  1KGS A;  1K6O A;  4XRF A;  2DBB A;  5ICC A;  3CJN A;  1QBJ A;  5HS8 A;  1R1T A;  1U5T B;  5HDN A;  1FYM A;  4A0Z A;  3EYI A;  1O3S A;  4Q47 A;  4YII A;  1ULY A;  3GF2 A;  3H92 A;  2P8T A;  1IXC A;  1V4R A;  5ED4 A;  2QZ8 A;  3L7W A;  5E8G A;  5DD4 A;  3I54 A;  1TQI A;  3RPQ A;  2MH9 A;  3DEU A;  1R5G A;  3J81 Z;  3SQN A;  1HST A;  2K7L A;  3FMR A;  4L0Y B;  2CQK A;  1U6G A;  3TO6 A;  4I98 B;  1PUE E;  4A0Y A;  1IN8 A;  2DPU A;  3GEZ A;  3WTZ A;  5D4S A;  3N97 A;  2MH2 A;  3HRM A;  1Z05 A;  1D5V A;  2Z5U A;  2VOD A;  3TGN A;  1MDM B;  2YU3 A;  3RYP A;  1REP C;  2LSO A;  2XKP A;  3BJA A;  3ZMT A;  3FZV A;  3BPV A;  3G3Z A;  1XB4 A;  4MEX F;  1SFX A;  2E1N A;  2O6G E;  3CUO A;  3B02 A;  2LNB A;  2ZFW A;  3K1P A;  2CW0 F;  3BJO A;  5LGN A;  1ZG5 A;  4GYG A;  1TLH B;  1VTN C;  4CHU A;  1SD4 A;  1G3S A;  2Y48 A;  3K2Z A;  4G6D A;  3L09 A;  4JBA A;  4YFX F;  2Q8K A;  5LLQ A;  4U0Y A;  3TO9 A;  1KU7 A;  4XBF A;  1SMY F;  4L9N A;  2QQB A;  3VFZ A;  5LBQ A;  3ZMZ A;  4H0E A;  1D8J A;  4MNU A;  3QRF F;  1HKQ A;  4OIN F;  2LF8 A;  1T6S A;  2VBW A;  4NB5 A;  1MJ9 A;  4BHC A;  4ESB A;  2IRF G;  4LGW A;  2CYY A;  5FFZ A;  5DCF A;  5D5X B;  2EB7 A;  4OIP F;  4A0X A;  2DFI A;  3BRO A;  1XN7 A;  3FM5 A;  2V1X A;  3GO5 A;  2Z9O A;  5KVR A;  2RC4 A;  2FEZ A;  1IXR C;  4BNC A;  1DUX C;  1XCV A;  3PFI A;  2EFN A;  4E70 A;  3BP8 A;  5L3D A;  2Z3Y A;  4EQQ A;  3IKT A;  4HX7 A;  1R58 A;  1EH7 A;  3VOE A;  5FLX K;  5A2Q K;  3HRS A;  2FBK A;  3TO7 A;  4LLL A;  4KMU X;  4OMY A;  2V1D A;  2M8E A;  1MJB A;  4LJZ F;  2GIV A;  5DD8 A;  1R1V A;  2ESH A;  3CLO A;  1Z9C A;  1XSD A;  2BE5 F;  2HGC A;  1FY7 A;  2XUB A;  4WXC A;  4LFU A;  4O5V A;  1FLI A;  2V6C A;  5DEQ A;  3L00 A;  1P2F A;  3FXQ A;  3IRR A;  4U88 A;  1B4A A;  3LQQ A;  4L9T A;  1FYL A;  1TQM A;  2PBI A;  3Q9V A;  4EJU A;  3ZMV A;  1W7P A;  5L3E A;  1HKT A;  5L3B A;  3H3U A;  5HLH A;  2DU9 A;  3ERE D;  4RB2 C;  4A2U A;  1OKR A;  5AIQ A;  3ROU A;  1K79 A;  1MDM A;  4RGS A;  3S2W A;  3I71 A;  4EJO A;  4RAY A;  5K5O A;  5L3G A;  4CGZ A;  2EA2 A;  3LFK A;  3JAM K;  2Q0O A;  3HSF A;  3WGI A;  1ZGA A;  3LAJ A;  4PGG A;  2OU2 A;  5CVJ A;  1KQ9 A;  1USS A;  5CVI A;  3WTW C;  5FLX Z;  1WKM A;  4A6E A;  2O8X A;  5K5Q A;  1Y0U A;  5FGM A;  1O7L A;  5D8K B;  1IZ1 A;  4HAM A;  2OA4 A;  1QNT A;  1H9T A;  2WTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...