3J81Z

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81Z00
4EM1A 1YW7A 3HHGA 2RVCA 4MQVA 2VBYA 2H94A 4UVBA 5BPDA 1R1VA 1SMTA 4B8XA 3J80Z 4I09A 4HLXA 1V4RA 2L3DA 4ZYHA 2A6EF 1HKQA 5L3FA 1LJ9A 1KU7A 3HRTA 3GFMA 1L0OC 1XMKA 2HKXA 3I54A 3BJAA 3R61A 2VBZA 2DPUA 5L3EA 2OQGA 5E18F 2FF4A 2KIFA 3IRRA 2JT1A 2UZKA 3WTSC 2R3SA 4ENJA 3R6SA 1O7LA 4L0ZB 4TV7A 4OIRF 3LWFA 3LQRA 4IHSA 4Q47A 2ESNA 3Q9VA 3U2RA 3I4PA 3ML6A 5BQTA 1J2XA 2GIVA 3L09A 4RAYA 1EH7A 1FSEA 3W6KB 5D8LB 3GEZA 4U7BA 1V3FA 3MEXA 1BBYA 3M8FA 2BEOA 3F8BA 2Z99A 5D5WB 3B02A 2Z3YA 1IAWA 5FD5A 3H92A 3ECOA 1LVAA 1O7FA 3QOPA 4HDUA 4KIGA 1XGMA 1P4WA 1TQIA 1G6NA 5LBQA 1Z7UA 3TKYA 1JE8A 4P96A 2M8EA 1K79A 5AONA 4G94A 4M9ZA 3BPXA 5DUKA 1OPCA 3TOAA 3L2CA 1JGSA 5DCMA 3CLOA 2M45A 4RB0A 3D0SA 3WE3A 3HYIA 4EV0A 2AS5F 3L9FA 4I01A 3LAPA 2HZTA 3FMQA 2BBYA 1IRFA 5JVTA 2O03A 2WTEA 2IA1A 3TO7A 3T8RA 4M72A 2DAOA 1ZLJA 1R36A 2YX4A 2VT3A 4G6DA 3GO5A 3RPQA 2A61A 4U0YA 5DYMA 1R7JA 2FBKA 3V7RA 1STZA 3TDUC 5HDNA 1IUYA 2HQNA 2UXNA 3BP8A 2STWA 4ZYEA 4EGZA 4KDPA 3W6JB 4Q4ZF 4I2OA 3FF5A 4M74A 5IT9K 5IT3A 4CICA 4XBFA 1B1BA 4PGGA 1P4XA 1O3QA 4O6JA 2GXGA 4BHPA 3ZMVA 5CVIA 1Z91A 4HQEA 3WTWC 4KUMA 1OYWA 1O3TA 5HDGA 1KQ8A 2QM3A 1TQMA 3GZ5A 4GGGA 1FYKA 4RB3C 4XSZF 2VXZA 4ZH4F 1T0FA 1F1ZA 4RGRA 3IWFA 2QBYB 1B6AA 3GYHX 4MNUA 2Z5UA 4RGUA 3OOPA 2J5OA 5K5RA 4FHTA 2XASA 5CVRA 5ILSA 4EGYA 4FT8A 2BGCA 1HW1A 3KFWX 1IW7F 2DO7A 2Q0OA 5JI6A 1KA8A 3C3WA 3TOBA 2Y75A 1HW2A 2DK5A 4Y17A 4XLPF 1O3RA 4Q48A 1YLFA 3HSEA 4XRFA 5K1YA 4NB5A 1SD5A 2K7LA 1IN4A 3RJPA 1ZH5A 1ZG3A 1S7AA 4HOBA 3HIFA 1XCVA 3ECHA 1BM9A 2CG4A 5BOXA 2EA2A 1QO0D 1D8JA 1R5GA 4BXUA 3CUQB 1FOKA 1SAXA 1MGTA 5EEHA 5HS9A 5D4RA 2ZMEA 1BIAA 5ICCA 3TGNA 5L3DA 2HR3A 3EQLF 5H6QA 4HA8A 2GXBA 1IRGA 4LG0A 1X3UA 2F5FA 2W25A 1S8NA 1JHFA 1XMAA 4CHUA 2D2WA 4LLGF 1W5TA 3SQNA 4CGZA 4N9HA 4L9JA 2K4JA 2ZNYA 5J8CA 4LK0F 4UVAA 5KK1A 4OOIA 4OU0A 1U5TB 4LJZF 2EJRA 2UWMA 1ZGJA 5K5QA 3P7NA 3EUHA 1BI2A 2QZ8A 3E5XA 2XAJA 1OKRA 3WG9A 2RN7A 2KJBA 3EDPA 2QENA 1C0WA 2PI0A 2A5YB 2FU4A 3FZVA 1Z05A 2OZUA 4IPAA 2FXAA 5LLQA 4EVIA 5HOOA 3VB2A 1A04A 5DV5A 2HFHA 3R0AA 4D0PA 3KLOA 3WU0A 5DCFA 5ERIA 2H6CA 2PBIA 1OR7A 2L4AA 2EWNA 1ZRFA 1ZREA 3SXYA 1BI0A 1UHWA 2O3FA 3HOTA 1TNTA 1BC8C 3ZMTA 4GO1A 3F22A 4A2UA 3FXRA 5IT9Z 4UV8A 1CF7A 4ZYGA 2H27A 3REOA 2NS0A 3V8JA 4YIFA 2ZXJA 5E1XA 3KP7A 5HS8A 1ZRDA 4P9UA 2AXLA 1T39A 4PCQA 4R8HA 4A0ZA 3FWEA 3HRUA 2YSRA 2Z9OA 4GYIA 4KMFA 4BAYA 1Z6RA 3E6DA 3K1PA 2P5KA 2XAGA 1TLHB 3T0YA 2HGCA 2XV4S 1BN5A 3LA7A 2PQ8A 5KVRA 2DFIA 5E20A 2PLYA 3M8EA 3ABUA 1T98A 4ASNA 2P7VB 1KYWA 3I0TA 4Z2YA 5D4SA 4HX7A 1W4MA 2V6CA 2EK5A 4MQ9F 3IKVA 3JTGA 2HTSA 4P9FA 1E2XA 3E5UA 1MZBA 2XHKA 5JR3A 1B9NA 1J7KA 4UNOA 5LGUA 2L54A 4UV9A 2MH2A 2ELHA 3I71A 1K6OA 5A2QK 2L01A 4LLLA 3FM5A 2MLGA 2VC0A 1ZARA 5CVVA 4YG2F 5H6RA 4G7HF 3P9CA 1LEAA 1P2FA 5D5VB 4HW0A 4G7ZF 4IHTA 1KQ9A 1I1SA 3O6BB 3E6CC 1I27A 2XRNA 1FC3A 2PEXA 3SZPA 5ICFA 4GYGA 3HHHA 1S3JA 3KEOA 2V79A 2NYXA 3WTYC 1WWXA 3ROUA 3ZMUA 3ZQ7A 1AOYA 1L3LA 1ODDA 1Z1DA 4UXNA 3I5UA 5JFRA 1FBUA 4U88A 3OV8A 3C1DA 1LDKB 3QU3A 1GVJA 2IPQX 1ONVA 4WF2A 5F6FA 5LGTA 4HX8A 2WV0A 1RNLA 4H0EA 2M5WA 2E1CA 1W5SA 4ETSA 5FD6A 3I64A 3V4GA 3FXQA 2VE8A 3FHZA 4BH9A 4KNYA 1CF7B 3E6MA 4XLNF 5CLSA 2MH9A 3KP4A 5LHGA 2RDPA 3HOSA 1G4DA 3DPLC 1J75A 4M9SA 3RI4A 2HTJA 4MEXF 2VOPA 3HSFA 1MDMB 4QWQA 1F4KA 2VT2A 2EFOA 2XAFA 1UHMA 4A12A 2IW5A 2ZFWA 2A07F 2EFNA 1MJAA 2FSWA 2IJLA 2NNYA 4U0WA 1EH8A 2CWEA 4MEYF 4HF2A 2OAZA 4YFNF 1RUNA 1UFMA 4I0AA 4MTDA 4RS8A 2VC1A 2O6GE 1B59A 1ON2A 2CQKA 4G9YA 4KA4A 2RV8A 5LEKA 1CGPA 3QP6A 1TQPA 3E6BA 3DFGA 3JSPA 4WXHA 1FPQA 2FEZA 2M30A 4CYDA 1TNSA 3RYPA 2E7WA 1P92A 4M6YA 5D5XB 1DPUA 1LQ1A 1SMYF 1NHAA 1BI1A 5L3BA 4N9IA 3HUGA 5DUIA 1E17A 1BC7C 2ADUA 2ZO4A 2P8TA 4KIBA 1MJBA 3WTUC 4EJTA 4WCGA 3L00A 1IN6A 3MZHA 1PP8F 4HZFA 5HDKA 3LAJA 2PJPA 4G7OF 1REPC 2ZJ2A 1YYVA 3LQQA 3WGHA 3GW2A 4LMYA 4U0VA 1FBQA 1UCRA 2DLLA 2TDXA 3TO9A 2P5VA 3CO7C 1ZAOA 3I58A 2ZCWA 5A2QZ 1ZLKA 4M6XA 5CJ9A 4PDKA 3WODF 4FX4A 3IHUA 2P5LC 2HDCA 5CYVA 4ZZLA 3TO6A 4AIKA 1WKMA 3M9AA 3SHFA 3KEQA 2CGPA 4MTEA 2HYFA 2OU2A 3K9TA 3GFLA 2E1NA 4EQQA 3BROA 5TJJA 2FNAA 2LNBA 3BJOA 3IKTA 4MHGA 4KT5C 1U78A 1J9IA 1EV7A 2C6YA 2HWVA 2DBBA 2Y48A 2YU3A 4ENNA 2VE9A 3GF2A 1BIBA 2M1BA 1MD0A 4WK8F 5E1WA 5LHIA 1SFXA 1F9NA 4LGWA 1LNWA 4UHTA 2CSOA 1XGOA 3QP5A 3V7CA 4A6DA 4LK1F 3GLXA 3KP6A 3G3ZA 4L5JA 2GA1A 2J5PA 3DV8A 2WWYA 1KU2A 4HF0A 4KN4X 2JPCA 2HEOA 2P6TA 5LEJA 1ZG1A 5BPIA 3R60A 3Q5FA 3FXUA 2B0LA 2V1XA 4G6QA 3RKWA 3CUOA 1W7PA 2LF8A 1G3YA 4L0YB 3DKWA 2FQ3A 2XKPA 3ERED 3I53A 2G9WA 2HS5A 2PMUA 4AIHA 2XVCA 1Y0UA 2K02A 4A5NA 5DCMB 1ZN2A 2F5DA 2GZWA 3HTSB 2ESHA 1JHHA 5HVQC 2VN2A 1I5ZA 3RPUA 3DEUA 3MZYA 2BYVE 2F5CA 1FWZA 2R7FA 4Q5SF 2E7XA 4XSXF 1HSJA 2OD5A 3F6VA 1FT9A 3CDHA 2GAUA 4JBAA 2IA0A 1B4AA 2A69F 1QGPA 1IXCA 3CO6C 4EJUA 3J81K 3P9IA 1RIOH 3F3XA 1T2KA 1YS6A 2ACJA 2ZBKA 2STTA 4WWCA 4KN7X 1GXQA 3K69A 3G73A 3WTXC 4OMYA 3FM3A 5F64A 1LEBA 1J0RA 3TQNA 4CO8A 3COAC 5FGMA 1WSUA 1JXSA 1S7OA 3QU6A 4ESBA 1PP7U 2A68F 5D6FA 2FOKA 4BYYA 1DDNA 1ZGAA 2G7HA 3RDIA 2COMA 3FMSA 3R0JA 1K78A 2KKOA 1TW2A 2XKOA 3LSTA 2ZNZA 1OYYA 3ZP5A 2XAQA 2W57A 3T5XA 1USSA 4HF1A 2OZ6A 2V1UA 4L18B 2YPRA 3LFKA 2YR2A 4Y15A 2EV5A 1FP1D 4O3MA 3F21A 3K0LA 5DEQA 4EJWA 5D8KB 3N4MA 2YX7A 1VTNC 1RUOA 4KYWA 3M1EA 4IJAA 1U6GA 2DPDA 1QBJA 3ELKA 5FO5A 3F8MA 1OYIA 2ZMEB 4BQAA 3IL2A 1AWCA 4M73A 3TDZC 4LG0B 4PGHA 3MAJA 1WI9A 1BI3A 2W24A 3U1DA 2MLKA 3KP2A 3GX4X 3F8CA 2F2EA 2H09A 1G3TA 4FX0A 4A0XA 2GA2A 4AVPA 3PQKA 2JPBA 3H3UA 1R58A 4AD9A 1D8KA 3VOEA 4AWXB 1R5HA 4ON0A 3QPHA 2D1VA 4WX9A 2QWWA 4RGXA 4RB2C 4L5IA 1WQ2A 2A6HF 2BV6A 4Y13A 1IN8A 2EV0A 5FLXK 3GUDA 5HLGA 5F1RA 1FYLA 1FBSA 2LSOA 2DQRA 4AIJA 1FLIA 1S29A 2PN6A 5ILVA 3DQVC 5HLHA 1GHCA 2X4HA 1U2WA 1ULYA 3DXJF 1RZ4A 5ED4A 4OIPF 3FX3A 4KFCA 3WGGA 2RKHA 2PFBA 2ZKZA 4HBLA 5J6XA 3DF8A 4LB5A 1K78B 2KRFA 2QQ9A 1WRJA 1IXSB 1R1TA 1FP2A 2VONA 3QAHA 2EA4A 1TTYA 3GWZA 1EH6A 3J81Z 2JSCA 1YIOA 1O3SA 1MKMA 2P4WA 3LA3A 4OINF 1HKSA 1Q1HA 2P6SA 4IF4A 3IC7A 3H3ZA 3E5QA 1YS7A 3M7GA 1R00A 1W7PD 3RYRA 5BMZA 5DD8A 3PQJA 3IWZA 3PFIA 4U7DA 4KICA 3V7SA 1HBXG 1TW3A 4HDVA 1F5TA 3V8KA 1XN7A 2P7CB 2HQRA 1I1GA 2XUBA 5JHUA 1HQCA 2OBPA 2O8XA 2VBWA 1XSXA 2OA4A 3L7WA 4RAZA 4IRGA 3ZMDA 5CVJA 2GQQA 2CW0F 2QQBA 2O0YA 4N0BA 1PDNC 1PUEE 4L9VA 5HLIA 2IT0A 2MBFA 3U9GA 4CDGA 2VBXA 1P4AA 3DPTA 4HAMA 3VFZA 2QBYA 2KIMA 3ZN1A 2QVOA 5ICGA 4DQ2A 3HRMA 6PAXA 3KP5A 2EB7A 2XAHA 3EYIA 1XB4A 3GZ6A 5E1ZB 1Z6TA 4JQFA 3O3KA 2NRAC 2D1HA 1RI7A 3EETA 5E17F 1USTA 1H9GA 5AIPA 2DT5A 3KLNA 2ISZA 2EV6A 1KYZA 3NEUA 4WXDA 4YFKF 2CO5A 4P5OA 2Y0MA 2K27A 4OMZA 3VODA 4YIIA 3HRSA 1DUXC 1B9MA 4KIFA 4JK1X 1HKTA 3SZTA 2FNPA 3T8TA 1FY7A 2IVMA 4ESJA 2PG4A 2LKPA 4HV5A 3CUQA 3KP3A 3D5LA 1HW5A 2H6BA 2LDUA 3WTVC 1T38A 3F8NA 3RKXA 2QQAA 1IN5A 2DK8A 3NQOA 3T1BA 3BY6A 3VEPA 4ENKA 5ICEA 5D6EA 4I02A 3RIRA 2ETHA 3BOQA 4S04A 5FLXZ 1P6RA 5L3CA 4WXCA 2QYOA 2CYYA 3QPTA 3KETA 4A0YA 1LB2A 3E97A 3HTUA 3LA2A 3RKYA 3S2WA 1T6SA 5D5UB 1QPMA 3JAMK 3WGIA 3ABTA 1U5TA 2XGXA 2XIGA 5FFZA 1KU9A 4R79A 3BDDA 2JRTA 5K5OA 4BNCA 4L9TA 1XGNA 3K1MA 3F72A 3SFZA 3I59A 1IZ1A 5EEGA 5AIQA 4LLNA 1DPRA 3O2PE 1R1UA 5CVUA 2FBHA 1YFHA 3ULQB 2F5EA 2G7UA 4M9XA 5LGNA 3BJ6A 3GFJA 3CJNA 2QLZA 1FNNA 2RQPA 1ZHFA 2KJCA 4IRHA 5LRRA 1XCBA 1KU3A 5FB2A 1SD4A 2M87A 3E3VA 4EM0B 5DDGA 1SD7A 2K4BA 2L4MA 3KZYA 2QUFA 3Q9SA 5ILUA 3MCZA 1SFEA 3HSRA 1XSDA 1R22A 1R23A 2V1DA 2ISYA 2Q2EA 2EFQA 3AAFA 1BJAA 5LHHA 1XSVA 4LFUA 1QNTA 1KGSA 3K1NA 3WU1B 3F6OA 3GVAA 4QLCU 3JTHA 4M71A 2OQRA 2PMHA 2FMYA 3ZN0A 2VODA 1D3YA 2DW4A 1XGSA 1KQ0A 2RC4A 1J59A 3FMRA 4IXAA 2Z33A 3BWGA 4K2EA 4I7HA 1DP7P 3F8FA 4S05A 2FRHA 3KZZA 1Z9CA 4ENMA 4EMSA 3MQ0A 4E70A 4F7ZA 4LB6B 3C18A 1D5VA 1IXRC 2X0LA 4A5MA 2WC2A 2IP2A 2NNNA 4HYEA 2EFWA 4RGSA 1YG2A 3R4KA 3WE2A 1YW9A 3QRFF 4NHJA 4L9NA 2DQLA 3JSOA 4LD5A 5H20A 3IRQA 1FZPB 2MC3A 2W85A 1YO5C 3J80K 3ISPA 2V9VA 3N97A 3ZMZA 3I59B 1GXPA 5TRDA 1QZZA 1QZYA 5DD4A 4DNCA 1XDSA 1SFUA 1H0MA 1TBXA 3GXOA 5J8FA 3ZMSA 2W84A 4CZZA 2JTVA 1FYMA 4PZJA 2EFPA 2RNJA 2GWRA 4R1HA 1K7AA 1YW8A 1H9TA 4EJOA 1G3WA 2A3SA 3JAMZ 3MWMA 1BOAA 2FA5A 1OMIA 3K2ZA 2NAZA 4I98B 5E8GA 1W7PB 2IA2A 4BHBA 2Q8KA 1O57A 1FSHA 4MGRA 3JW4A 2FBIA 1I6XA 2FMLA 2MD5A 5LRSA 5FFXA 1IF1A 2UXXA 2JZYA 1MDMA 1HXDA 4O5VA 4YFXF 3EYYA 3BZ6A 4BHCA 1LDDA 1ON1A 2RGVA 4HX4A 4IVNA 1QQIA 4CXFA 1FX7A 3RTRA 1HSTA 4OIQF 3KCCA 3MFKA 1YQAA 3B73A 2HOEA 3KE2A 4HV6A 3BPVA 1XDUA 4GXOA 2FE3A 2LF7A 3WTZA 5E8IA 2HKOA 4ZYDA 4GCVA 1XD7A 1J5YA 3DP7A 4EJVA 4HLYA 2HYGD 1LDJA 3F23A 2KIUA 3C7JA 4IRIA 1S6LA 4NQWA 4UVCA 4B09A 4OIOF 3CUQC 2DI3A 1U3EM 2O61A 3GFIA 2IRFG 3P9KA 3NRVA 1MJ9A 1U8RA 4KMUX 2DU9A 1YTYA 5BS6A 4P55A 3ZPLA 4G8XA 2L02A 2BE5F 4UUVA 5HS7A 2K86A 2XROA 1G3SA 2D45A 4ESFA 2CFXA 4A6EA 4HQMA 3J7AO 1SD6A 2DTRA 2MA3A 2VOOA 4EM2A 5L3GA 1U5TC 1ZRCA 3V8LA 1ZYRF 1IN7A 3WTTC 1ZG5A 1UB9A 3CTAA 2R7DA 4ZZDA 4RB1A 4I0BA
chains in the Genus database with same CATH superfamily
4EM1A 2R7XA 2JA7J 2BW3B 1YW7A 3HHGA 2RVCA 4MQVA 2LREA 2VBYA 4CSWA 2H94A 4UVBA 4DZPA 1M1EB 1WI3A 1D0YA 5HNHA 5BPDA 1R1VA 1SMTA 2Y69H 1UELB 4B8XA 4RM2A 3J80Z 4E7ZA 4OWRB 4I09A 4NC6A 1PJRA 4HLXA 1V4RA 2WBMA 2L3DA 2VQLA 3H9JA 4ZYHA 2ZJQF 2IS2A 2A6EF 3H9GA 3IV5A 1H88C 1D5YA 1HKQA 5L3FA 3RQ4A 2MFZA 1D1BA 1LJ9A 1KU7A 3HRTA 5H2FC 5C4XJ 3GFMA 1L0OC 5EYRA 1RC9A 1XMKA 4BJ5C 3GTKJ 2HKXA 3I54A 3BJAA 3R61A 2VBZA 2H8RA 2DPUA 2FQ4A 2OC6A 5L3EA 2HQ5A 4QSHA 2RNGA 2M0CA 2OQGA 1WFXA 5E18F 2FF4A 2KIFA 1JUSA 1IV8A 3IRRA 1P7IA 1T56A 2E71A 2JT1A 2UZKA 3WTSC 2R3SA 3D5RC 4ENJA 4PK4A 4YELA 3R6SA 2VXDA 1O7LA 2I5UA 2LP0A 4TV7A 4B3AA 1R4MB 4L0ZB 4OIRF 1MBJA 3LWFA 3LQRA 4IHSA 5M5WJ 4CH7A 4Q47A 3G1LA 5GTIC 3H1CA 1A36A 2ESNA 3Q9VA 3U2RA 3I4PA 4PSWA 4II2A 3ML6A 2JA8J 5BQTA 1J2XA 2GIVA 3CC2I 3L09A 1I39A 4RAYA 1EH7A 1X1BA 3M4OJ 3G6EI 4F52A 2R7TA 1FSEA 3VSKA 4NQWB 4XRSA 3W6KB 5D8LB 4DOZA 4RBOA 2CQQA 2E5NA 3GEZA 1RRJA 2CQXA 3S3MA 2DT6A 4U7BA 2BY3A 1VQPI 1V3FA 1MNDA 4I6ZA 4HNUA 3MEXA 1BBYA 3M8FA 2BEOA 3F8BA 1VQ4I 2Z99A 1FTZA 1ETXA 5D5WB 1MH3A 3B02A 1QPIA 4CZCA 1BL0A 2Z3YA 4EATA 3Q0UA 3CF2A 3ZQLA 1VQ6I 3PM1A 1IAWA 3KIOA 2LG4A 4A3EJ 5FD5A 3H92A 3ECOA 1LVAA 5B66C 1O7FA 2VQCA 3K2AA 5F08A 5IYBJ 2K9NA 3QOPA 4HDUA 2ECCA 2K9SA 4KIGA 1XGMA 1P4WA 2AO9A 2X6YA 1V5EA 2XGEA 2Y0SA 1VQNI 1TQIA 2R93J 3K4MA 1G6NA 3F0CA 5LBQA 1Z7UA 2OCEA 3TKYA 1JE8A 3DTKA 3GBGA 4P96A 5EG0B 2H1KA 2M8EA 4BL0B 2KZVA 1K79A 5EGOA 5AONA 1JI8A 4G94A 2MD0A 3N05A 3ABLH 1FOXA 1WHUA 2DYSH 4M9ZA 3BPXA 5DUKA 1OPCA 3TOAA 5BNGA 3L2CA 1JGSA 5DCMA 3CLOA 2M45A 2XB0X 4RB0A 1YRNB 4BY1J 3D0SA 2PJRB 1AHDP 4IOAF 3WE3A 3HYIA 2CUFA 2HVSA 4EV0A 4XLAA 2AS5F 3L9FA 4I01A 2DOAA 3CMMA 3LAPA 2HZTA 3A4CA 2A05A 3FMQA 5FKKA 2BBYA 1IRFA 5JVTA 2O03A 3G71I 2RREA 2V4JC 2WTEA 3BR6A 5EZHA 2IA1A 3TO7A 3T8RA 2WAFA 4M72A 3IH2A 3CCUI 2DAOA 1ZLJA 1R36A 2YX4A 2OTJI 2VT3A 3P5JA 4XL9A 4G6DA 3GO5A 3RPQA 2A61A 2QKLB 4XQFA 4U0YA 3H9QA 5DYMA 1R7JA 1N25A 2LMDA 2FBKA 3V7RA 1STZA 3TDUC 5HDNA 2ZJPF 1IUYA 2HQNA 2UXNA 3BG6A 4QPQA 3BP8A 2STWA 1Y8RB 2NXNB 4ZYEA 4EGZA 4KDPA 3CD6I 1RETA 3W6JB 4B48A 1OR7C 4Q4ZF 4I2OA 3FF5A 4M74A 5IT9K 4PSXA 4NUBA 4XOTA 5IT3A 3ZR8X 1QZEA 2ZB9A 1XC5A 4CICA 3CCQI 4XBFA 3OWTA 2HPMA 1RR8C 1B1BA 1WJBA 4PGGA 1P4XA 1DU0A 3LSKA 4FETA 1O3QA 1MNEA 2NS7A 4O6JA 2GXGA 4BHPA 3ZMVA 2NVUB 5CVIA 1Z91A 4FTHA 2JA6J 4HQEA 3WTWC 4KUMA 3FXLA 1OYWA 5FJ8J 5HDGA 1VFCA 1O3TA 1KQ8A 3L2VA 2QM3A 1TQMA 3GZ5A 4GGGA 1FYKA 4RB3C 3BR2A 4X0GA 4XSZF 5J47A 3JREA 2KT0A 5FROA 4RA2A 4AYBA 1TZLA 3QYEA 2VXZA 4PJ0C 4ZH4F 1X2MA 1T0FA 1F1ZA 4RGRA 3IWFA 3S3NA 2QBYB 1IRXA 3OOUA 1LVKA 1B6AA 3LSIA 5EZGA 3GYHX 4MNUA 2V7FA 2Z5UA 4RGUA 3OOPA 2J5OA 1NH3A 5K5RA 4FHTA 1R5ID 2XASA 3CC7I 5CVRA 3W6VA 5ILSA 4EGYA 4BJ6C 4FT8A 5J4YA 2BGCA 1CQTA 1HW1A 3A1YA 3KFWX 1OQYA 1IW7F 2DO7A 2Q0OA 5JI6A 3HJEA 4E4HA 1ERDA 1KA8A 3C3WA 2E34A 3TOBA 5FRNA 3MZ8A 1SAUA 2Y75A 2MABA 1HW2A 1ZR2A 2H1LA 4Y33A 1GV2A 2DK5A 4Y17A 1LE8B 1MMDA 4XLPF 1O3RA 4Q48A 1F43A 1YLFA 3HSEA 4XRFA 1LFBA 5K1YA 4NB5A 1SD5A 2R7QA 2DXIA 2K7LA 2K5CA 1IN4A 2GOXB 3RJPA 2PMZN 2JA5J 1ZH5A 2WAQN 3ONQA 2HI3A 4W1UA 1ZG3A 3FXMA 1S7AA 1JKQC 2F4MB 4HOBA 4JX4A 1N78A 3PUBA 3HIFA 1XCVA 5KAIC 3OYCA 3ECHA 1BM9A 4XR6A 1TL8A 1RESA 2CG4A 1FOWA 2UV1A 5BOXA 3OSFA 1B8IA 2EA2A 1QO0D 1D0ZA 1D8JA 1R5GA 2R0QC 2R7RA 4BXUA 4BXXJ 3JRGA 3CUQB 1FOKA 1SAXA 2B7EA 1MGTA 5EEHA 5J4VA 1Z67A 5HS9A 1OLTA 1P9QC 2VKHA 3HPHA 3ZQHA 5D4RA 2ZMEA 1BIAA 1U9NA 5ICCA 3TGNA 3HOUJ 5L3DA 3AG2H 2HR3A 2L9VA 1OISA 3EQLF 4HA8A 5H6QA 4IEJA 2GXBA 2QCOA 3H35A 1IRGA 4AVZA 1XMXA 1X3UA 4X1EA 4LG0A 2F5FA 2W25A 1S8NA 2CUEA 1JHFA 1DGWY 3QOEA 2LLKA 1XMAA 4CHUA 1A35A 5LFAA 3RZOJ 5GPCA 3HL2A 4E7SA 2D2WA 2HU9A 4M6VA 1MIJA 2K9MA 3DTIA 4LLGF 1W5TA 3SQNA 2VL8A 2K3FA 4CGZA 4N9HA 4XLFA 4L9JA 2GXAA 3DBRB 2K4JA 3ZRGA 2ZNYA 5J8CA 4LK0F 4UVAA 5KK1A 4OOIA 4OU0A 1U5TB 2IEKA 4M3DA 4BQOA 4M3EA 3PO3J 4LJZF 2DA1A 2EJRA 4E7KA 4HG2A 2UWMA 1ZGJA 5K5QA 1YOVB 2E19A 1W0UA 5KAFC 3P7NA 3EUHA 3QWLA 3JRCA 1BI2A 2JMWA 1HA8A 2QZ8A 3E5XA 3OYDA 2XAJA 2MG4A 1OKRA 3WG9A 2DODA 2RN7A 2KJBA 3EDPA 3HPGA 5FLMJ 3DLLF 2QENA 3A01B 3WG7H 1C0WA 1FEXA 2CQ7A 4HEA2 3TMOA 1WH7A 2PI0A 2A5YB 2E2JJ 2FU4A 2NVYJ 3FZVA 3MMYB 4BBSJ 2ME6A 2V9KA 1Z05A 1LFUP 1Q1VA 5IP9J 2OZUA 4IPAA 2CW7A 2FXAA 5LLQA 3MKYB 1VQLI 2FUG2 4EVIA 5HOOA 2OTLI 3VB2A 5IY5H 4BQNA 2DMTA 1A04A 5DV5A 2E5ZA 2HFHA 2OJED 3R0AA 4D0PA 3KLOA 3WU0A 5DCFA 5ERIA 2H6CA 2TCTA 2PBIA 2XRLA 4MFDA 1OR7A 2L4AA 2EWNA 4XONA 1ZRFA 1ZREA 3SXYA 1BI0A 1UHWA 2F5VA 3IAM2 1F36A 1I3QJ 4UUSA 2V9PA 2O3FA 2HOTA 1A6QA 4XIDA 3HOTA 1TNTA 2CQNA 1UZCA 3ZMTA 1BC8C 3S2DJ 1SANA 4GO1A 3F22A 1YJ9I 4A2UA 4IX7A 1JKRC 2Q2EB 1YITI 3FXRA 5IT9Z 4UV8A 3E1SA 1CF7A 1HDPA 4ZYGA 3JRBA 1VQ9I 2H27A 3HOZJ 3REOA 2NS0A 2DJIA 2VLAA 3A2KA 1ETQA 4BEHA 1SVMA 3CDLA 3V8JA 4YIFA 2KRCA 2ZXJA 5E1XA 3KP7A 5HS8A 2X6WA 4P9UA 1ZRDA 2TRTA 2R7VA 2AXLA 1Y0NA 4UY8I 3OYLA 1T39A 3GTOJ 4PCQA 4IL6C 4R8HA 3DWLE 4A0ZA 3FWEA 3HRUA 2YSRA 2Z9OA 2DA4A 3CZ6A 4GYIA 4KMFA 4BAYA 1B8IB 3BR5A 1E3PA 1Z6RA 1YX3A 3E6DA 2EIJH 4D7MA 1GUUA 3K1PA 1DQUA 2P5KA 2XAGA 1TLHB 3T0YA 2HGCA 2XB5A 2XV4S 1BN5A 3LA7A 2R5YB 3S3OA 2KIQA 5J40A 2PQ8A 5KVRA 2DFIA 5E20A 2E35A 2M7BA 2PLYA 2P0WA 3M8EA 3MN2A 3ABUA 1T98A 4ASNA 1N77A 4C2MJ 2P7VB 1KYWA 2LH9A 2EH3A 3I0TA 3BQYA 1ETYA 2EZIA 4Z2YA 1AKHA 5D4SA 4UB8C 1WJDA 2QSGX 1ETKA 4HX7A 1W4MA 2V6CA 2EK5A 4MQ9F 4H4KC 2LY9A 2WA0A 1ENHA 3IKVA 3IUOA 3GTQJ 1IDZA 1VQMI 2P81A 4HNTA 3JTGA 5IOZA 2ZC2A 2HTSA 4P9FA 1E2XA 3E5UA 2BXYA 1MZBA 4C3HJ 3E0JB 3HOWJ 2VPLA 2XHKA 4KISA 2VKEA 5JR3A 5CPRB 1B9NA 1J7KA 4YIRX 4A3JJ 2ZXWH 2LBFA 4UNOA 4DYQA 2W7NA 4XMYA 5LGUA 2E1OA 5GAGJ 3ZQQA 2M2EA 2L54A 3JRFA 2DCEA 4XNFA 2JUGA 4UV9A 3HG9A 2MH2A 4V2GA 2ELHA 3I71A 1K6OA 5HLTA 5A2QK 3FISA 4AUXA 3HXLA 2L01A 4LLLA 3FM5A 2MLGA 2I10A 2VC0A 4LG3A 1ZARA 2CUZA 2B63J 5CVVA 3CCEI 4AM3A 4YG2F 4BDZA 5H6RA 4G7HF 3P9CA 1LEAA 5IP6A 1P2FA 3H5AA 3MD2A 5D5VB 4HW0A 4XKWA 2VKDA 3KEYA 4G7ZF 4IHTA 1KQ9A 1I1SA 3O6BB 1Y39A 3E6CC 3JRHA 1I27A 2XRNA 1FC3A 1MMGA 2PEXA 3SZPA 5ICFA 4GYGA 1A5JA 3HHHA 1S3JA 3KEOA 2V79A 2NYXA 3AFHA 3WTYC 2LVSA 1WWXA 2DDAA 1MMNA 2JK3A 2EBIA 3ROUA 3ZMUA 3ZQ7A 1AOYA 5M5YJ 2UUZA 1L3LA 2BVMA 1ODDA 1Z1DA 2WADA 3CCLI 3OYFA 4UXNA 1U8BA 1S72I 4J00A 3I5UA 2KL4A 1FOYA 2MSYA 5JFRA 1FBUA 5TISC 4U88A 3OV8A 3C1DA 1LDKB 3QU3A 1GVJA 1OCPA 2CS3A 2IPQX 4CCJA 2F4IA 4XOPA 5B3SH 2D5VA 1ONVA 4UUSB 4WF2A 5F6FA 5LGTA 2X85A 4HX8A 1TWHJ 5IYDJ 2WV0A 1RNLA 5FKOA 5F1JA 2L9RA 4H0EA 2M5WA 2E1CA 1W5SA 2LY1A 2QQ8A 4ETSA 5FD6A 3JR9A 2W48A 3DCFA 3ABKH 3I64A 3V4GA 3FXQA 2VE8A 3FHZA 4BH9A 4KNYA 3VYSB 1CF7B 1IO2A 3E6MA 4XLNF 5CLSA 4E6KG 2MH9A 3B6CA 3KP4A 1HF0A 5LHGA 2RDPA 3HOSA 1WGXA 3K4JA 4XKVA 4HSTA 1G4DA 3ZGKA 3DPLC 1ZTRA 4M9SA 1J75A 1ETVA 2JUCA 3RI4A 1T0FC 2HTJA 4MEXF 2VOPA 2YUSA 4B1RA 3HSFA 4A3GJ 1MDMB 4QWQA 1F4KA 3S15J 1D1CA 1IC8A 3HBLA 4B4CA 2VT2A 5J1UA 2EFOA 2XAFA 1UHMA 5EJCA 3ZQIA 4A12A 1S9HA 1YIJI 3K7AJ 2IW5A 2ZFWA 4A3KJ 1X58A 1SFOJ 2A07F 1Y1VJ 3H0GJ 3CQZJ 3UKGA 5DS9A 1FMVA 5KNLA 2EFNA 3NWSA 2LYCA 2CJJA 1MJAA 2FSWA 2IJLA 4CCLA 2NNYA 2DMNA 3C2BA 4U0WA 1EH8A 1PUFA 1GT0C 2IGOA 2Y0SN 1VQKI 2CWEA 4MEYF 2PX9A 3IP4B 3LSHA 4HF2A 2OAZA 4YFNF 1W36D 1RUNA 1UFMA 1AKHB 4I0AA 3I3LA 4MTDA 4RS8A 2VC1A 3AG1H 4F55A 2O6GE 1B59A 1ON2A 4OAYA 3OL4A 1NK3P 3TP3A 2CQKA 4CCOA 4G9YA 4KA4A 2RV8A 1POGA 5LEKA 4CCMA 4A93J 1CGPA 3QP6A 3BG9A 1HLVA 5GAEJ 4XLCA 1EA3A 1TQPA 2E36A 3E6BA 3DFGA 2LBFB 3JSPA 4WXHA 1FPQA 1PYVA 3QQAA 2FEZA 4D5FA 2M30A 1JTYA 4CYDA 2E2IJ 1TNSA 3RYPA 2E7WA 3BQZA 2ZMEC 3K4CA 1JJ6C 1V54H 1P92A 4M6YA 5D5XB 3RZDJ 1JTXA 2M34A 3EUKL 2Y9ZA 1DPUA 1LQ1A 1MH4A 1SMYF 1NHAA 1BI1A 5L3BA 2V1NA 4N9IA 3LL7A 2E2HJ 4ABZA 3HUGA 2VPRA 5DUIA 4V2FA 1E17A 3K10A 3LOCA 3RQIA 3HOYJ 1BC7C 2ADUA 1HC8A 2ZO4A 2WAEA 4LITA 2P8TA 4KIBA 4ZTJA 1UHSA 1MJBA 3TL4X 4XLHA 3S2HJ 3WTUC 4EJTA 4WCGA 2EIMH 3L00A 4C30A 3OIPA 5E3OA 1IN6A 4XICA 3MZHA 1V5FA 3HKZA 1PP8F 2NS8A 2R4GA 4GRIA 4BXFA 3CLQA 4HZFA 5HDKA 1GDTA 2L7FP 1QVTA 2JA2A 2OF7A 3LAJA 4HNVA 2PJPA 4G7OF 2CW8A 1DP3A 3FHNA 3BTCA 3EUHC 2ZJ2A 1YJWI 1REPC 4A69C 1YYVA 3LQQA 4C2TA 2ID6A 3WGHA 3GTMJ 2L7KA 3GW2A 4LMYA 2Q1ZB 1FBQA 1ORKA 1UCRA 2DLLA 4U0VA 2TDXA 3TO9A 4M3BA 4AYBN 3I9V2 3A03A 2P5VA 3CO7C 2X9DA 2B9SA 2A5WA 1D1AA 1ZAOA 3I58A 2ZCWA 3Q3SA 3G2BA 4DGWB 5A2QZ 3BCBA 1N75A 4OAZA 4CYCA 1K4TA 4ZDOA 1ZLKA 4M6XA 5CJ9A 4PDKA 3WODF 4YRVA 3IHUA 4FX4A 4B47A 5K7HA 2P5LC 3X2QH 2BHZA 2HDCA 5CYVA 4NBQA 4ZZLA 3TO6A 4AIKA 1WKMA 3M9AA 3SHFA 3VYUB 3GTGJ 3KEQA 5F0HA 1XPXA 1OCCH 3OYEA 1W5CC 3W2VA 2CGPA 2CU7A 4MTEA 2HYFA 4XN3A 2OU2A 2NOGA 3K9TA 1R49A 4BU2A 2HOAA 2K3PA 3GFLA 3U1KA 2VKVA 2NVXJ 2E1NA 3OMYA 1LFPA 4EQQA 3L2WA 3BROA 2JVHA 5TJJA 1H8AC 4Y7NJ 4BQQA 3EPZA 2FNAA 2LNBA 3BJOA 3IKTA 1BW5A 2O7OA 4MHGA 4KT5C 1U78A 5F04A 3GZNB 2CRGA 2Y9YA 3NARA 1J9IA 1EV7A 2C6YA 2HWVA 2DBBA 2L2OA 3PSIA 1X3WB 2Y48A 2X1EA 3DEWA 2JN6A 2YU3A 4ENNA 1PUFB 2VE9A 2CV1A 3GF2A 1BIBA 1WJAA 1JUPA 2M1BA 4PFOA 1MD0A 1Y56A 2IGKA 4WK8F 3IH3A 5E1WA 5LHIA 1SFXA 1F9NA 4LGWA 3JRIA 1LNWA 2N8GA 4AIDA 4UHTA 3OSGA 3OR2C 2CSOA 3K4LA 1XGOA 3ZCOA 3QP5A 4IHYA 3BG5A 3FKJA 2ZXIA 3J7YJ 3Q0WA 4YEJA 3V7CA 4A6DA 4LK1F 2XC7A 1WCMJ 3GLXA 3KP6A 3G3ZA 4L5JA 1WPKA 3S1MJ 2LFBA 3TBIA 2GA1A 2J5PA 3DV8A 4FE7A 5M3MJ 2WWYA 2W4SA 2DA3A 3S1RJ 1KU2A 4HF0A 5KCMA 2ICWG 1HDDC 4KN4X 4NDLA 5E3NA 2JPCA 3BR0A 4EEFG 2HEOA 2P6TA 3BLYA 2VIXA 1EKEA 1WH5A 5LEJA 2HVRA 1ZG1A 5BPIA 3R60A 1ZK8A 3FDYA 1OJLA 3Q5FA 2QSFX 3FXUA 2B0LA 2V1XA 3W3CA 1MBKA 2O9LA 4G6QA 3LSMA 3RKWA 4ZJZA 3CUOA 3BCAA 1K6YA 1W7PA 2VJJA 2HZDA 4LIVA 2E1MC 2X1DA 2LF8A 3S93A 1G3YA 1X19A 4L0YB 3DKWA 2FQ3A 4KT6A 3BTIA 2XKPA 3ERED 3I53A 1YE9A 3H3VK 3AL0C 2L7ZA 2G9WA 5FKNA 1E3HA 2CUJA 5EGOB 3D1NI 2HS5A 2PMUA 4AIHA 1IGNA 2XVCA 3OYGA 1TP4A 2CMPA 3HEFA 3HM5A 4JX6A 4ZYAA 1Y0UA 2K02A 4A5NA 5DCMB 1ZN2A 1BW6A 3SJMA 4A3MJ 1UAAA 1UMQA 3F9KA 3SDBA 3G4SI 2F5DA 3VPRA 2GZWA 4QTRA 3HTSB 2ESHA 1KZHA 1JHHA 5HVQC 3WU2C 1TWAJ 2VN2A 1I5ZA 3RPUA 3DEUA 3MZYA 1ZQ3P 2BYVE 2DA7A 1RKWA 4E7IA 1IRZA 2F5CA 1YI2I 1MSEC 4CYCB 1O4XA 1FWZA 2R7FA 4Q5SF 2E7XA 1LUJB 3ASNH 4XSXF 3HOXJ 1HSJA 1X1DA 4ZC3A 2OD5A 3OYJA 3F6VA 1FT9A 2DOEA 4IZZA 4PFPA 3CDHA 5FRMA 1VQOI 1FIPA 2GAUA 1NG6A 4JBAA 2IA0A 1B4AA 5DM6F 2A69F 3MKWB 3BR1A 1UJ8A 1QGPA 3DBLB 3CCJI 1XTAA 4A3DJ 1X1PA 3A0HC 4N4OB 4IO9F 3ESWB 5JLXA 1IXCA 3CO6C 4EJUA 5GAHJ 3J81K 1Z77A 3P9IA 1RPWA 1RIOH 3BTLA 3SEQA 3F3XA 2Y30A 2O8KA 1T2KA 1YS6A 2ACJA 2ZBKA 1OCZH 2XDVA 4WWCA 3JRAA 2STTA 4E7LA 4KN7X 3V42A 3SYTA 1GXQA 3K69A 2E60A 3G73A 3WTXC 4V19K 4OMYA 2VJIA 3FM3A 5F64A 4UB6C 1LEBA 5B1BH 1J0RA 3KYDB 2HYJA 3TQNA 2L0KA 2W82A 4CO8A 3COAC 5FGMA 2KFDA 3TP0A 1WSUA 2XPWA 1JXSA 4LOCA 1S7OA 3QU6A 4N4NB 4ESBA 1Y1WJ 1PP7U 4RLFA 2A68F 5D6FA 2FOKA 1BOBA 4BYYA 2OPTA 3OY9A 1DDNA 3NAUA 1V5GA 1ZGAA 4A3IJ 4IOCF 2ECBA 5IPAA 2G7HA 2XGCA 2AXTC 5K7FA 3S1NJ 4KJZA 4QPOA 3DU5A 3RDIA 2COMA 1MMAA 3FMSA 3QYFA 3GTPJ 2DN0A 3R0JA 1K78A 4PJMA 2IAIA 2KKOA 4IKFA 5F0FA 1TW2A 4II3A 2L9NA 2XKOA 3LSTA 1JT6A 2ZNZA 3FXJA 1OYYA 3ZP5A 1TWFJ 2DTZA 1YJNI 2XAQA 2W57A 3T5XA 2V6EA 3K70D 1A31A 1USSA 4HF1A 3DKYA 2R7WA 2OZ6A 2GIZA 2V1UA 4W97A 4L18B 2DFHA 2YPRA 3LFKA 2BY1A 3FXOA 2BW3A 2YR2A 3VYRB 4Y15A 2V26A 2EV5A 4S0HB 1FP1D 4O3MA 1Z21A 4JOMA 3F21A 4M3GA 2RQQA 4BS9A 1K61A 3K0LA 4ANJA 2HOSA 3CC4I 3S16J 5DEQA 4EJWA 2IGNA 5D8KB 3N4MA 5C4JJ 2YX7A 1TWGJ 3ZOBA 1VTNC 2BY0A 1RUOA 4KYWA 3M1EA 4IJAA 2Y2ZA 1U6GA 2FOWA 2DPDA 3B6AA 4JYKA 4G12A 2XPVA 1QBJA 3ELKA 5FO5A 3F8MA 4DJAA 1OYIA 2DFEA 1HOMA 3CJQB 1QHGA 3G1MA 2K85A 2ZMEB 2EQRA 4BQAA 2Z2SB 2DA2A 3IL2A 1Z3XA 1AWCA 2GM4A 2CV0A 4M73A 3TDZC 3SZGA 3HOVJ 4LG0B 4JP0A 4PGHA 3MAJA 2QKMB 1WI9A 1BI3A 2W24A 2ZSHB 3ZXSA 2JRMA 5EDNA 3U1DA 2MLKA 4GDFA 2XF6A 3KP2A 1W0TA 2VJ4A 3BG7A 4E7HA 4FISA 3I4MJ 3GX4X 3F8CA 4B3XA 2F2EA 1SVLA 1BR1A 1XX5A 2H09A 1G3TA 1KONA 3BG3A 3BZCA 1XG1A 4FX0A 4A0XA 4BDYA 2GA2A 4AVPA 1OCTC 3PQKA 1I50J 2K9QA 1ETWA 2JPBA 3H3UA 3GCMA 1R58A 4AD9A 1SFKA 4ZDLA 2IS4A 4X6AJ 1D8KA 3LNQA 1APLC 1TC3C 1TWCJ 3VOEA 5DM7F 1X1AA 4AWXB 2AQFA 2DA5A 4I99C 2QA4I 2HDDA 1R5HA 4ON0A 2LY2A 1AA7A 3QPHA 2D1VA 4WX9A 2QWWA 4RGXA 4C3IJ 2M9HA 4RB2C 3AKZA 4L5IA 1WQ2A 5GPAA 2A6HF 2H8WA 1BR2A 2KP6A 1QRYA 2BV6A 4Y13A 1IN8A 2EV0A 5FLXK 3GUDA 5HLGA 2NVQJ 4A3LJ 3FK7A 1T8IA 5F1RA 4DYCA 2F4OB 2KMUA 2O5RA 1FYLA 1FBSA 3UR3C 2LSOA 2X1CA 2DQRA 4AIJA 2ELJA 3HZJA 1FLIA 1S29A 2PN6A 5ILVA 3DQVC 5HLHA 1GHCA 2X4HA 1U2WA 1ULYA 3DXJF 1RZ4A 1S7EA 5E3LA 5ED4A 4OIPF 3FX3A 1E3OC 1W1WE 4KFCA 4J01A 3BT9A 1ITYA 3WGGA 5EG0A 1PVEA 2WB1A 5C3EJ 1AU7A 2RKHA 3PNYA 1IUFA 3DPUA 2PFBA 2ZKZA 4HBLA 5J6XA 5C44J 3DF8A 2QGUA 4LB5A 1K78B 4I76A 2KRFA 3QPSA 5CKTA 2QQ9A 1JUMA 1WRJA 1IXSB 1YRNA 1R1TA 1FP2A 2PJRA 4DZJA 2VONA 3QAHA 2EA4A 1TTYA 3GWZA 3BZKA 4J19A 1EH6A 4IHVA 1FJLA 3J81Z 4C9YA 3VWBA 2JSCA 2R7ZJ 1YIOA 1O3SA 1MKMA 2JSPA 4BEHB 2P4WA 3LA3A 4OINF 1R71A 1HKSA 1ZELA 2M7AA 4AC0A 1Q1HA 2P6SA 3HDDA 3MKLA 4IF4A 1MBFA 5GP9A 4B43A 2HVQA 1Z3YA 1WVRA 3IC7A 2BVLA 3L2RA 3H3ZA 5B5EC 4HRIA 3E5QA 2LRDA 2WV1A 3HGGA 1YS7A 3M7GA 1R00A 3ABMH 1W7PD 2ZXHA 3FBIB 3RYRA 3CCSI 5BMZA 4XM3A 2KHMA 3PQJA 5DD8A 3CCVI 5J1YA 3IWZA 3PFIA 4U7DA 3U21A 4KICA 3V7SA 1HBXG 1TW3A 2IGMA 4ZDPA 4HDVA 1F5TA 3V8KA 4BE2A 1NTCA 1XN7A 4RMNA 2EINH 2P7CB 1K4SA 1X1CA 2HQRA 2KISA 1I1GA 2XUBA 2LC2A 5JHUA 1HQCA 3EUAA 2OBPA 2O8XA 1MNMC 2VBWA 1XSXA 1MBEA 3L2QA 5IOYA 1D0XA 2OA4A 3L7WA 4RAZA 3OS0A 4IRGA 3VYTB 1NG7A 3KX2A 3ZMDA 5CVJA 2LR8A 3HKZN 5IYCJ 4RLQA 2GQQA 4MLOA 2CW0F 3RPUD 2E1MB 2QQBA 2O0YA 4N0BA 1PDNC 3O8GA 1VQ8I 2X6XA 4RAFA 1PUEE 1EJ9A 4L9VA 1UG0A 5HLIA 3AL0B 2IT0A 3SDGA 2MBFA 1JJ8C 1DGRM 2KDOA 2L7MP 3U9GA 3OYKA 4CDGA 2VBXA 1P4AA 1RKTA 3DPTA 4HAMA 3VFZA 2QBYA 2KIMA 1W36C 1ACIA 3H5NA 3ZN1A 1JKPC 2DT7B 2QVOA 5ICGA 4DQ2A 4C2UA 3HRMA 6PAXA 4CA0A 3KP5A 3AG3H 2DA6A 2EB7A 2XAHA 3EYIA 1XB4A 2R7SA 4PJJA 3GZ6A 5E1ZB 1Z6TA 4JQFA 1UG2A 5FKMA 2R5ZA 3OR1C 1H89C 1WJCA 3O3KA 3S8PA 2NRAC 2D1HA 1RI7A 3KYLA 3EETA 5E17F 1USTA 1H9GA 1IV6A 5AIPA 2DT5A 3BTJA 3KLNA 2NOJB 3TW7A 2ISZA 1LE8A 3RKQA 2EV6A 1X4PA 1KYZA 1BA5A 3NEUA 4WXDA 4CCNA 3PIOF 4YFKF 2CO5A 2LTPA 2Z16A 4P5OA 2HXOA 2Y0MA 2K27A 1OCRH 2OCCH 4OMZA 3VODA 3OYBA 4YIIA 3VSLA 2XF7A 3HRSA 2G0EA 2ELKA 1DUXC 1B9MA 4KIFA 4JK1X 1HKTA 1X3ZB 3SZTA 5M3FJ 2IS6A 2FNPA 1ETOA 3T8TA 3CESA 1IJWC 2COBA 3RSNA 1X2NA 1FY7A 2EZKA 3BC8A 4DIQA 2IVMA 4D9JA 4ESJA 1S5LC 1MW7A 3LSGA 2PG4A 4CCKA 2KRHA 4JX5A 2MW8A 2LKPA 3CMAI 5M5XJ 4HV5A 3CUQA 3KP3A 3G1OA 1U9OA 3J7AY 3D5LA 1HW5A 3HC7A 1VQ7I 2H6BA 2LDUA 3WTVC 1T38A 3F8NA 3RKXA 2QQAA 4HPQA 1IN5A 2DK8A 3NQOA 3T1BA 3BY6A 5FLVA 4UUTA 3VEPA 4ENKA 5ICEA 4FQGA 1G8XA 5D6EA 4I02A 4BY7J 2AQEA 2XF5A 3RIRA 2ETHA 3BOQA 3OYMA 3M3YJ 4S04A 5FLXZ 3OIOA 1P6RA 5L3CA 4WXCA 5JVGF 2QYOA 4E7JA 3ZQGA 4ZTFA 2CYYA 3QPTA 2M8GX 3KETA 5TGTA 4A0YA 1FIAA 1K83J 1LB2A 3PFYA 3E97A 3HTUA 3LA2A 3RKYA 2M4KA 2L9SA 4XRMA 2Z1DA 3S2WA 4D7NA 3H5RA 3O8HA 1R4NB 1T6SA 3VDXA 5D5UB 5CQEA 1QPMA 3ZQFA 3JAMK 3GLLA 3PL8A 3DEEA 4PJLA 1I3AA 1J09A 3FKIJ 1BJZA 4QIWN 3WGIA 3ABTA 1U5TA 2XGXA 2XIGA 2KZGA 5FFZA 3HGYA 2OUMA 1KU9A 4BKXA 4R79A 3BDDA 3CMEI 2JRTA 5K5OA 4BNCA 1U0JA 2HXIA 4L9TA 1XGNA 3CCYA 3K1MA 3I56I 1GV5A 2ZFUA 3F72A 4Y52J 3SFZA 2ME0A 3I59A 5GTHC 1IZ1A 5EEGA 5CQGA 5AIQA 4LLNA 1DPRA 1T95A 3A01A 3O2PE 4BJTA 4BE0A 1R1UA 2CH0A 2FD5A 2FBHA 5CVUA 1BR4A 1R6RA 5B1AH 1YFHA 2YS9A 1YHQI 3ULQB 2F6CA 3WHBA 4U87A 2LK2A 5JHFA 2DMUA 2K9LA 2F5EA 2G7UA 4M9XA 5LGNA 5HNFA 2Y31A 3BJ6A 3PUFA 3GFJA 3CJNA 2QLZA 3PNVA 1FNNA 2RQPA 3OL3A 2VQGA 1ZHFA 2KJCA 4IRHA 5LRRA 1XCBA 1KU3A 5FB2A 1SD4A 2M87A 3E3VA 4EM0B 2DYRH 5DDGA 4XRSG 1SD7A 4MFEA 4IQJA 2K4BA 2L4MA 3KZYA 2QUFA 2A6TA 1V55H 3CP8A 4B44A 3HUGB 2R5ZB 3DU6A 3Q9SA 5ILUA 2MGQA 3LMMA 3MCZA 1XS9A 2EZLA 1SFEA 1IDYA 3HSRA 3KPHA 1B72A 2KQRA 2DJNA 3DBHB 1XSDA 1R22A 1R23A 2V1DA 2ISYA 2Q2EA 2EFQA 3OS2A 3AAFA 1BJAA 4FASD 3C2HA 2LOOA 3ZQCA 3AG4H 3OIQA 1SVOA 5LHHA 1XSVA 1VI0A 4A3BJ 3OYIA 1OCOH 4LFUA 1QNTA 1KGSA 3K1NA 3WU1B 3F6OA 3GVAA 3PO2J 4QLCU 3JTHA 4M71A 5GADJ 3IH4A 3LSPA 2OQRA 3CCRI 4F3QA 2PMHA 3KYCB 2FMYA 4RDUA 3CCMI 3ZN0A 2VODA 3TEDA 4GFBA 1D3YA 2DW4A 3M1CA 2VASA 3H0DA 4IQ4A 1XGSA 2X51A 2MYSA 1KQ0A 4C3JJ 2RC4A 1J59A 4D5CA 2IXSA 3M07A 3W2WA 3A02A 2GLOA 4FE4A 3NWTA 2R5YA 3FMRA 1Y6IA 4IXAA 2Z33A 3BWGA 4K2EA 3CP2A 4HSRA 4I7HA 1DP7P 3F8FA 1ZGWA 5J3LA 4S05A 2FRHA 3PNTA 3LFUA 3OS1A 2JVGA 3KZZA 4A3FJ 4P1WA 1Z9CA 4ENMA 2FJ1A 4EMSA 2HDWA 1T08B 3H36A 3MQ0A 5JLWA 4E70A 3QPLA 4F7ZA 3RCOA 5E3MA 4DYRA 3L2UA 4LB6B 3C18A 2XAUA 3UNGC 1D5VA 1HCRA 4RAGA 1IXRC 2X0LA 4A5MA 2WC2A 4Y3OA 2IP2A 4IHXA 5FKLA 1EF4A 2NNNA 4HYEA 2EFWA 3CF5F 1WZ2A 3I55I 3OYHA 4RGSA 1FMWA 4L5EA 1YG2A 2GOMA 4MO7A 3R4KA 2PMZA 1YW9A 3WE2A 2WAQA 5EEAA 3FIWA 1GLNA 2R7OA 3QRFF 4NHJA 3QYBA 4L9NA 3K4NA 1LPQA 2DQLA 3JSOA 4LD5A 2LD5A 5H20A 3IRQA 2XPUA 4M3FA 1FZPB 3CMYA 2MC3A 2W85A 3Q0VA 1YO5C 1ZR4A 2DMQA 3J80K 2X6OA 5J1RA 2VB6A 2R7UA 3LSJA 3ISPA 2V9VA 2EILH 3TW6A 3N97A 3ZMZA 3I59B 3MVPA 4XORA 1QHHD 1GXPA 5TRDA 3CJTB 3C2GA 1QZZA 1TT5B 4F93B 4PUSA 1QZYA 9ANTA 5DD4A 2DMPA 4DNCA 1XDSA 1R9TJ 1SFUA 1H0MA 2EIKH 2ID3A 1TBXA 3GXOA 2EPFA 4AU7A 5J8FA 2W1OA 5HODA 1VNDA 2KDZA 3ZMSA 2W84A 3SFIA 2L5QA 4CZZA 3ASOH 5F0CA 2JTVA 3I4NJ 2ZSIB 2VJ5A 2IS1A 1FYMA 2BY2A 4PZJA 3PIPF 3S17J 2EFPA 2RNJA 4BACA 2GWRA 4R1HA 2XSJC 1K7AA 1E0EA 2MC4A 1YW8A 3DLAA 4PJNA 5EF6A 1H9TA 4EJOA 1G3WA 4Y4RA 2DOFA 3A0BC 2A3SA 3JAMZ 3GMEA 3MWMA 1BOAA 4DW6A 2QEXI 1Z0XA 2CV2A 2HNHA 3KZIC 3E7LA 2M3AA 2FA5A 1OMIA 1A6IA 3MKZA 3K2ZA 2NAZA 4I98B 5E8GA 1GVDA 1W7PB 1B72B 2IA2A 2X48A 2K40A 2BHYA 4BHBA 1P7JA 1VZ0A 4F91B 3J7ZI 2Q8KA 1O57A 1FSHA 2HPIA 3FXKA 4MGRA 4KITB 3WHCA 3JW4A 2FBIA 4LIUA 1I6XA 2FMLA 2CFOA 2MD5A 2LKXA 3DKXA 3K70C 5LRSA 5FFXA 1IF1A 2YU9J 2UXXA 2JZYA 2RAEA 4D1QA 1MDMA 1HXDA 4O5VA 4YFXF 1WJ5A 5K7ZA 3EYYA 3BZ6A 4BHCA 4MIMA 1LDDA 1ON1A 2RGVA 1QVUA 1WJEA 4HX4A 4IVNA 1QQIA 4CXFA 2BZTA 2QF7A 1FX7A 4NNJA 1MBHA 2VI6A 1QU3A 1JKOC 2VQHA 2XGDA 3RTRA 1MSFC 1HSTA 4OIQF 3KCCA 4CUGA 3JRDA 3MFKA 1YQAA 2VUMJ 1FTTA 3FK6A 3B73A 2HOEA 3KE2A 3BR3A 4HV6A 4XKCA 3BPVA 2ZJRF 2WY8Q 2HQAA 3OYAA 1XDUA 2FX0A 2BOLA 2WB1N 4GXOA 2QSHX 2FE3A 2AHQA 1I6HJ 2LF7A 3WTZA 3K4BA 5E8IA 1Y8QB 2HKOA 4ZYDA 2JQ7A 3GTJJ 4GCVA 4IHWA 1LKXA 5DTDA 1XD7A 1J5YA 3DP7A 2LKSA 4EJVA 4HLYA 4XLEA 2EZHA 2HYGD 3HB9A 1LDJA 1WJFA 3QODA 5F27A 2KIUA 3C7JA 4DBQA 3F23A 4IRIA 3S14J 3JCUC 3GTLJ 2DFFA 4NC7A 1S6LA 4FCYA 1ZKGA 2KLOA 2XSDC 3CDIA 2W00A 4NQWA 1SC7A 3S32A 4UVCA 1RR7A 1OFCX 3CJRB 4B09A 4OIOF 4A3CJ 4XN0A 3OYNA 3CUQC 4Z6YA 4BBRJ 2DI3A 4F92B 1U3EM 1G59A 3GFIA 2O61A 3FBNB 1NK2P 3M8JA 2M0MA 2F48A 1JT0A 2IRFG 3P9KA 3W2AA 2BXZA 1YX5A 3NRVA 1MJ9A 4BGDA 1U8RA 3L1PA 2OV7A 1G2HA 4DBRA 2I8DA 5IP7J 4KMUX 1X4OA 2DU9A 4XKBA 4BE1A 1MMSA 1YTYA 5BS6A 4P55A 4XK4A 3ZPLA 4G6TB 4G8XA 3IAS2 2GBYA 2L02A 2BE5F 4UUVA 3PSFA 3SEZA 5HS7A 3D5SC 2K86A 2DDBA 2XROA 2WY7Q 1G3SA 1JGGA 1VF9A 2D45A 4ESFA 1T33A 2CFXA 3PJRA 3S1QJ 3DTEA 4A6EA 5LD2C 4HQMA 4BUPA 3J7AO 1QA6A 1Z7LA 1SD6A 5KHDA 2DTRA 2MA3A 1SEUA 2M4GA 1VQ5I 3LSRA 3K4KA 2VOOA 4EM2A 5L3GA 2KPMA 3ERMA 5E79C 1DU6A 4RM3A 4ITVA 2JWTA 4NC8A 1U5TC 1IG7A 2IBDA 1ZRCA 2JJ7A 3V8LA 1ZYRF 1IN7A 2R92J 2NVTJ 3WTTC 1ZG5A 1TT0A 1UB9A 3K6GA 1MBGA 3CTAA 2R7DA 4ZZDA 4RB1A 4I0BA
chains in the Genus database with same CATH topology
4EM1A 1YW7A 3HHGA 2RVCA 4MQVA 2VBYA 2H94A 4UVBA 5BPDA 1R1VA 1SMTA 4B8XA 3J80Z 4I09A 4HLXA 1V4RA 2L3DA 4ZYHA 2A6EF 1HKQA 5L3FA 1LJ9A 1KU7A 3HRTA 3GFMA 1L0OC 1XMKA 2HKXA 3I54A 3BJAA 3R61A 2VBZA 2DPUA 5L3EA 2OQGA 5E18F 2FF4A 2KIFA 3IRRA 2JT1A 2UZKA 3WTSC 2R3SA 4ENJA 3R6SA 1O7LA 4L0ZB 4TV7A 4OIRF 3LWFA 3LQRA 4IHSA 4Q47A 2ESNA 3Q9VA 3U2RA 3I4PA 3ML6A 5BQTA 1J2XA 2GIVA 3L09A 4RAYA 1EH7A 1FSEA 3W6KB 5D8LB 3GEZA 4U7BA 1V3FA 3MEXA 1BBYA 3M8FA 2BEOA 3F8BA 2Z99A 5D5WB 3B02A 2Z3YA 1IAWA 5FD5A 3H92A 3ECOA 1LVAA 1O7FA 3QOPA 4HDUA 4KIGA 1XGMA 1P4WA 1TQIA 1G6NA 5LBQA 1Z7UA 3TKYA 1JE8A 4P96A 2M8EA 1K79A 5AONA 4G94A 4M9ZA 3BPXA 5DUKA 1OPCA 3TOAA 3L2CA 1JGSA 5DCMA 3CLOA 2M45A 4RB0A 3D0SA 3WE3A 3HYIA 4EV0A 2AS5F 3L9FA 4I01A 3LAPA 2HZTA 3FMQA 2BBYA 1IRFA 5JVTA 2O03A 2WTEA 2IA1A 3TO7A 3T8RA 4M72A 2DAOA 1ZLJA 1R36A 2YX4A 2VT3A 4G6DA 3GO5A 3RPQA 2A61A 4U0YA 5DYMA 1R7JA 2FBKA 3V7RA 1STZA 3TDUC 5HDNA 1IUYA 2HQNA 2UXNA 3BP8A 2STWA 4ZYEA 4EGZA 4KDPA 3W6JB 4Q4ZF 4I2OA 3FF5A 4M74A 5IT9K 5IT3A 4CICA 4XBFA 1B1BA 4PGGA 1P4XA 1O3QA 4O6JA 2GXGA 4BHPA 3ZMVA 5CVIA 1Z91A 4HQEA 3WTWC 4KUMA 1OYWA 1O3TA 5HDGA 1KQ8A 2QM3A 1TQMA 3GZ5A 4GGGA 1FYKA 4RB3C 4XSZF 2VXZA 4ZH4F 1T0FA 1F1ZA 4RGRA 3IWFA 2QBYB 1B6AA 3GYHX 4MNUA 2Z5UA 4RGUA 3OOPA 2J5OA 5K5RA 4FHTA 2XASA 5CVRA 5ILSA 4EGYA 4FT8A 2BGCA 1HW1A 3KFWX 1IW7F 2DO7A 2Q0OA 5JI6A 1KA8A 3C3WA 3TOBA 2Y75A 1HW2A 2DK5A 4Y17A 4XLPF 1O3RA 4Q48A 1YLFA 3HSEA 4XRFA 5K1YA 4NB5A 1SD5A 2K7LA 1IN4A 3RJPA 1ZH5A 1ZG3A 1S7AA 4HOBA 3HIFA 1XCVA 3ECHA 1BM9A 2CG4A 5BOXA 2EA2A 1QO0D 1D8JA 1R5GA 4BXUA 3CUQB 1FOKA 1SAXA 1MGTA 5EEHA 5HS9A 5D4RA 2ZMEA 1BIAA 5ICCA 3TGNA 5L3DA 2HR3A 3EQLF 5H6QA 4HA8A 2GXBA 1IRGA 4LG0A 1X3UA 2F5FA 2W25A 1S8NA 1JHFA 1XMAA 4CHUA 2D2WA 4LLGF 1W5TA 3SQNA 4CGZA 4N9HA 4L9JA 2K4JA 2ZNYA 5J8CA 4LK0F 4UVAA 5KK1A 4OOIA 4OU0A 1U5TB 4LJZF 2EJRA 2UWMA 1ZGJA 5K5QA 3P7NA 3EUHA 1BI2A 2QZ8A 3E5XA 2XAJA 1OKRA 3WG9A 2RN7A 2KJBA 3EDPA 2QENA 1C0WA 2PI0A 2A5YB 2FU4A 3FZVA 1Z05A 2OZUA 4IPAA 2FXAA 5LLQA 4EVIA 5HOOA 3VB2A 1A04A 5DV5A 2HFHA 3R0AA 4D0PA 3KLOA 3WU0A 5DCFA 5ERIA 2H6CA 2PBIA 1OR7A 2L4AA 2EWNA 1ZRFA 1ZREA 3SXYA 1BI0A 1UHWA 2O3FA 3HOTA 1TNTA 1BC8C 3ZMTA 4GO1A 3F22A 4A2UA 3FXRA 5IT9Z 4UV8A 1CF7A 4ZYGA 2H27A 3REOA 2NS0A 3V8JA 4YIFA 2ZXJA 5E1XA 3KP7A 5HS8A 1ZRDA 4P9UA 2AXLA 1T39A 4PCQA 4R8HA 4A0ZA 3FWEA 3HRUA 2YSRA 2Z9OA 4GYIA 4KMFA 4BAYA 1Z6RA 3E6DA 3K1PA 2P5KA 2XAGA 1TLHB 3T0YA 2HGCA 2XV4S 1BN5A 3LA7A 2PQ8A 5KVRA 2DFIA 5E20A 2PLYA 3M8EA 3ABUA 1T98A 4ASNA 2P7VB 1KYWA 3I0TA 4Z2YA 5D4SA 4HX7A 1W4MA 2V6CA 2EK5A 4MQ9F 3IKVA 3JTGA 2HTSA 4P9FA 1E2XA 3E5UA 1MZBA 2XHKA 5JR3A 1B9NA 1J7KA 4UNOA 5LGUA 2L54A 4UV9A 2MH2A 2ELHA 3I71A 1K6OA 5A2QK 2L01A 4LLLA 3FM5A 2MLGA 2VC0A 1ZARA 5CVVA 4YG2F 5H6RA 4G7HF 3P9CA 1LEAA 1P2FA 5D5VB 4HW0A 4G7ZF 4IHTA 1KQ9A 1I1SA 3O6BB 3E6CC 1I27A 2XRNA 1FC3A 2PEXA 3SZPA 5ICFA 4GYGA 3HHHA 1S3JA 3KEOA 2V79A 2NYXA 3WTYC 1WWXA 3ROUA 3ZMUA 3ZQ7A 1AOYA 1L3LA 1ODDA 1Z1DA 4UXNA 3I5UA 5JFRA 1FBUA 4U88A 3OV8A 3C1DA 1LDKB 3QU3A 1GVJA 2IPQX 1ONVA 4WF2A 5F6FA 5LGTA 4HX8A 2WV0A 1RNLA 4H0EA 2M5WA 2E1CA 1W5SA 4ETSA 5FD6A 3I64A 3V4GA 3FXQA 2VE8A 3FHZA 4BH9A 4KNYA 1CF7B 3E6MA 4XLNF 5CLSA 2MH9A 3KP4A 5LHGA 2RDPA 3HOSA 1G4DA 3DPLC 1J75A 4M9SA 3RI4A 2HTJA 4MEXF 2VOPA 3HSFA 1MDMB 4QWQA 1F4KA 2VT2A 2EFOA 2XAFA 1UHMA 4A12A 2IW5A 2ZFWA 2A07F 2EFNA 1MJAA 2FSWA 2IJLA 2NNYA 4U0WA 1EH8A 2CWEA 4MEYF 4HF2A 2OAZA 4YFNF 1RUNA 1UFMA 4I0AA 4MTDA 4RS8A 2VC1A 2O6GE 1B59A 1ON2A 2CQKA 4G9YA 4KA4A 2RV8A 5LEKA 1CGPA 3QP6A 1TQPA 3E6BA 3DFGA 3JSPA 4WXHA 1FPQA 2FEZA 2M30A 4CYDA 1TNSA 3RYPA 2E7WA 1P92A 4M6YA 5D5XB 1DPUA 1LQ1A 1SMYF 1NHAA 1BI1A 5L3BA 4N9IA 3HUGA 5DUIA 1E17A 1BC7C 2ADUA 2ZO4A 2P8TA 4KIBA 1MJBA 3WTUC 4EJTA 4WCGA 3L00A 1IN6A 3MZHA 1PP8F 4HZFA 5HDKA 3LAJA 2PJPA 4G7OF 1REPC 2ZJ2A 1YYVA 3LQQA 3WGHA 3GW2A 4LMYA 4U0VA 1FBQA 1UCRA 2DLLA 2TDXA 3TO9A 2P5VA 3CO7C 1ZAOA 3I58A 2ZCWA 5A2QZ 1ZLKA 4M6XA 5CJ9A 4PDKA 3WODF 4FX4A 3IHUA 2P5LC 2HDCA 5CYVA 4ZZLA 3TO6A 4AIKA 1WKMA 3M9AA 3SHFA 3KEQA 2CGPA 4MTEA 2HYFA 2OU2A 3K9TA 3GFLA 2E1NA 4EQQA 3BROA 5TJJA 2FNAA 2LNBA 3BJOA 3IKTA 4MHGA 4KT5C 1U78A 1J9IA 1EV7A 2C6YA 2HWVA 2DBBA 2Y48A 2YU3A 4ENNA 2VE9A 3GF2A 1BIBA 2M1BA 1MD0A 4WK8F 5E1WA 5LHIA 1SFXA 1F9NA 4LGWA 1LNWA 4UHTA 2CSOA 1XGOA 3QP5A 3V7CA 4A6DA 4LK1F 3GLXA 3KP6A 3G3ZA 4L5JA 2GA1A 2J5PA 3DV8A 2WWYA 1KU2A 4HF0A 4KN4X 2JPCA 2HEOA 2P6TA 5LEJA 1ZG1A 5BPIA 3R60A 3Q5FA 3FXUA 2B0LA 2V1XA 4G6QA 3RKWA 3CUOA 1W7PA 2LF8A 1G3YA 4L0YB 3DKWA 2FQ3A 2XKPA 3ERED 3I53A 2G9WA 2HS5A 2PMUA 4AIHA 2XVCA 1Y0UA 2K02A 4A5NA 5DCMB 1ZN2A 2F5DA 2GZWA 3HTSB 2ESHA 1JHHA 5HVQC 2VN2A 1I5ZA 3RPUA 3DEUA 3MZYA 2BYVE 2F5CA 1FWZA 2R7FA 4Q5SF 2E7XA 4XSXF 1HSJA 2OD5A 3F6VA 1FT9A 3CDHA 2GAUA 4JBAA 2IA0A 1B4AA 2A69F 1QGPA 1IXCA 3CO6C 4EJUA 3J81K 3P9IA 1RIOH 3F3XA 1T2KA 1YS6A 2ACJA 2ZBKA 2STTA 4WWCA 4KN7X 1GXQA 3K69A 3G73A 3WTXC 4OMYA 3FM3A 5F64A 1LEBA 1J0RA 3TQNA 4CO8A 3COAC 5FGMA 1WSUA 1JXSA 1S7OA 3QU6A 4ESBA 1PP7U 2A68F 5D6FA 2FOKA 4BYYA 1DDNA 1ZGAA 2G7HA 3RDIA 2COMA 3FMSA 3R0JA 1K78A 2KKOA 1TW2A 2XKOA 3LSTA 2ZNZA 1OYYA 3ZP5A 2XAQA 2W57A 3T5XA 1USSA 4HF1A 2OZ6A 2V1UA 4L18B 2YPRA 3LFKA 2YR2A 4Y15A 2EV5A 1FP1D 4O3MA 3F21A 3K0LA 5DEQA 4EJWA 5D8KB 3N4MA 2YX7A 1VTNC 1RUOA 4KYWA 3M1EA 4IJAA 1U6GA 2DPDA 1QBJA 3ELKA 5FO5A 3F8MA 1OYIA 2ZMEB 4BQAA 3IL2A 1AWCA 4M73A 3TDZC 4LG0B 4PGHA 3MAJA 1WI9A 1BI3A 2W24A 3U1DA 2MLKA 3KP2A 3GX4X 3F8CA 2F2EA 2H09A 1G3TA 4FX0A 4A0XA 2GA2A 4AVPA 3PQKA 2JPBA 3H3UA 1R58A 4AD9A 1D8KA 3VOEA 4AWXB 1R5HA 4ON0A 3QPHA 2D1VA 4WX9A 2QWWA 4RGXA 4RB2C 4L5IA 1WQ2A 2A6HF 2BV6A 4Y13A 1IN8A 2EV0A 5FLXK 3GUDA 5HLGA 5F1RA 1FYLA 1FBSA 2LSOA 2DQRA 4AIJA 1FLIA 1S29A 2PN6A 5ILVA 3DQVC 5HLHA 1GHCA 2X4HA 1U2WA 1ULYA 3DXJF 1RZ4A 5ED4A 4OIPF 3FX3A 4KFCA 3WGGA 2RKHA 2PFBA 2ZKZA 4HBLA 5J6XA 3DF8A 4LB5A 1K78B 2KRFA 2QQ9A 1WRJA 1IXSB 1R1TA 1FP2A 2VONA 3QAHA 2EA4A 1TTYA 3GWZA 1EH6A 3J81Z 2JSCA 1YIOA 1O3SA 1MKMA 2P4WA 3LA3A 4OINF 1HKSA 1Q1HA 2P6SA 4IF4A 3IC7A 3H3ZA 3E5QA 1YS7A 3M7GA 1R00A 1W7PD 3RYRA 5BMZA 5DD8A 3PQJA 3IWZA 3PFIA 4U7DA 4KICA 3V7SA 1HBXG 1TW3A 4HDVA 1F5TA 3V8KA 1XN7A 2P7CB 2HQRA 1I1GA 2XUBA 5JHUA 1HQCA 2OBPA 2O8XA 2VBWA 1XSXA 2OA4A 3L7WA 4RAZA 4IRGA 3ZMDA 5CVJA 2GQQA 2CW0F 2QQBA 2O0YA 4N0BA 1PDNC 1PUEE 4L9VA 5HLIA 2IT0A 2MBFA 3U9GA 4CDGA 2VBXA 1P4AA 3DPTA 4HAMA 3VFZA 2QBYA 2KIMA 3ZN1A 2QVOA 5ICGA 4DQ2A 3HRMA 6PAXA 3KP5A 2EB7A 2XAHA 3EYIA 1XB4A 3GZ6A 5E1ZB 1Z6TA 4JQFA 3O3KA 2NRAC 2D1HA 1RI7A 3EETA 5E17F 1USTA 1H9GA 5AIPA 2DT5A 3KLNA 2ISZA 2EV6A 1KYZA 3NEUA 4WXDA 4YFKF 2CO5A 4P5OA 2Y0MA 2K27A 4OMZA 3VODA 4YIIA 3HRSA 1DUXC 1B9MA 4KIFA 4JK1X 1HKTA 3SZTA 2FNPA 3T8TA 1FY7A 2IVMA 4ESJA 2PG4A 2LKPA 4HV5A 3CUQA 3KP3A 3D5LA 1HW5A 2H6BA 2LDUA 3WTVC 1T38A 3F8NA 3RKXA 2QQAA 1IN5A 2DK8A 3NQOA 3T1BA 3BY6A 3VEPA 4ENKA 5ICEA 5D6EA 4I02A 3RIRA 2ETHA 3BOQA 4S04A 5FLXZ 1P6RA 5L3CA 4WXCA 2QYOA 2CYYA 3QPTA 3KETA 4A0YA 1LB2A 3E97A 3HTUA 3LA2A 3RKYA 3S2WA 1T6SA 5D5UB 1QPMA 3JAMK 3WGIA 3ABTA 1U5TA 2XGXA 2XIGA 5FFZA 1KU9A 4R79A 3BDDA 2JRTA 5K5OA 4BNCA 4L9TA 1XGNA 3K1MA 3F72A 3SFZA 3I59A 1IZ1A 5EEGA 5AIQA 4LLNA 1DPRA 3O2PE 1R1UA 5CVUA 2FBHA 1YFHA 3ULQB 2F5EA 2G7UA 4M9XA 5LGNA 3BJ6A 3GFJA 3CJNA 2QLZA 1FNNA 2RQPA 1ZHFA 2KJCA 4IRHA 5LRRA 1XCBA 1KU3A 5FB2A 1SD4A 2M87A 3E3VA 4EM0B 5DDGA 1SD7A 2K4BA 2L4MA 3KZYA 2QUFA 3Q9SA 5ILUA 3MCZA 1SFEA 3HSRA 1XSDA 1R22A 1R23A 2V1DA 2ISYA 2Q2EA 2EFQA 3AAFA 1BJAA 5LHHA 1XSVA 4LFUA 1QNTA 1KGSA 3K1NA 3WU1B 3F6OA 3GVAA 4QLCU 3JTHA 4M71A 2OQRA 2PMHA 2FMYA 3ZN0A 2VODA 1D3YA 2DW4A 1XGSA 1KQ0A 2RC4A 1J59A 3FMRA 4IXAA 2Z33A 3BWGA 4K2EA 4I7HA 1DP7P 3F8FA 4S05A 2FRHA 3KZZA 1Z9CA 4ENMA 4EMSA 3MQ0A 4E70A 4F7ZA 4LB6B 3C18A 1D5VA 1IXRC 2X0LA 4A5MA 2WC2A 2IP2A 2NNNA 4HYEA 2EFWA 4RGSA 1YG2A 3R4KA 3WE2A 1YW9A 3QRFF 4NHJA 4L9NA 2DQLA 3JSOA 4LD5A 5H20A 3IRQA 1FZPB 2MC3A 2W85A 1YO5C 3J80K 3ISPA 2V9VA 3N97A 3ZMZA 3I59B 1GXPA 5TRDA 1QZZA 1QZYA 5DD4A 4DNCA 1XDSA 1SFUA 1H0MA 1TBXA 3GXOA 5J8FA 3ZMSA 2W84A 4CZZA 2JTVA 1FYMA 4PZJA 2EFPA 2RNJA 2GWRA 4R1HA 1K7AA 1YW8A 1H9TA 4EJOA 1G3WA 2A3SA 3JAMZ 3MWMA 1BOAA 2FA5A 1OMIA 3K2ZA 2NAZA 4I98B 5E8GA 1W7PB 2IA2A 4BHBA 2Q8KA 1O57A 1FSHA 4MGRA 3JW4A 2FBIA 1I6XA 2FMLA 2MD5A 5LRSA 5FFXA 1IF1A 2UXXA 2JZYA 1MDMA 1HXDA 4O5VA 4YFXF 3EYYA 3BZ6A 4BHCA 1LDDA 1ON1A 2RGVA 4HX4A 4IVNA 1QQIA 4CXFA 1FX7A 3RTRA 1HSTA 4OIQF 3KCCA 3MFKA 1YQAA 3B73A 2HOEA 3KE2A 4HV6A 3BPVA 1XDUA 4GXOA 2FE3A 2LF7A 3WTZA 5E8IA 2HKOA 4ZYDA 4GCVA 1XD7A 1J5YA 3DP7A 4EJVA 4HLYA 2HYGD 1LDJA 3F23A 2KIUA 3C7JA 4IRIA 1S6LA 4NQWA 4UVCA 4B09A 4OIOF 3CUQC 2DI3A 1U3EM 2O61A 3GFIA 2IRFG 3P9KA 3NRVA 1MJ9A 1U8RA 4KMUX 2DU9A 1YTYA 5BS6A 4P55A 3ZPLA 4G8XA 2L02A 2BE5F 4UUVA 5HS7A 2K86A 2XROA 1G3SA 2D45A 4ESFA 2CFXA 4A6EA 4HQMA 3J7AO 1SD6A 2DTRA 2MA3A 2VOOA 4EM2A 5L3GA 1U5TC 1ZRCA 3V8LA 1ZYRF 1IN7A 3WTTC 1ZG5A 1UB9A 3CTAA 2R7DA 4ZZDA 4RB1A 4I0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM1 A;  1YW7 A;  3HHG A;  2RVC A;  4MQV A;  2VBY A;  2H94 A;  4UVB A;  5BPD A;  1R1V A;  1SMT A;  4B8X A;  3J80 Z;  4I09 A;  4HLX A;  1V4R A;  2L3D A;  4ZYH A;  2A6E F;  1HKQ A;  5L3F A;  1LJ9 A;  1KU7 A;  3HRT A;  3GFM A;  1L0O C;  1XMK A;  2HKX A;  3I54 A;  3BJA A;  3R61 A;  2VBZ A;  2DPU A;  5L3E A;  2OQG A;  5E18 F;  2FF4 A;  2KIF A;  3IRR A;  2JT1 A;  2UZK A;  3WTS C;  2R3S A;  4ENJ A;  3R6S A;  1O7L A;  4L0Z B;  4TV7 A;  4OIR F;  3LWF A;  3LQR A;  4IHS A;  4Q47 A;  2ESN A;  3Q9V A;  3U2R A;  3I4P A;  3ML6 A;  5BQT A;  1J2X A;  2GIV A;  3L09 A;  4RAY A;  1EH7 A;  1FSE A;  3W6K B;  5D8L B;  3GEZ A;  4U7B A;  1V3F A;  3MEX A;  1BBY A;  3M8F A;  2BEO A;  3F8B A;  2Z99 A;  5D5W B;  3B02 A;  2Z3Y A;  1IAW A;  5FD5 A;  3H92 A;  3ECO A;  1LVA A;  1O7F A;  3QOP A;  4HDU A;  4KIG A;  1XGM A;  1P4W A;  1TQI A;  1G6N A;  5LBQ A;  1Z7U A;  3TKY A;  1JE8 A;  4P96 A;  2M8E A;  1K79 A;  5AON A;  4G94 A;  4M9Z A;  3BPX A;  5DUK A;  1OPC A;  3TOA A;  3L2C A;  1JGS A;  5DCM A;  3CLO A;  2M45 A;  4RB0 A;  3D0S A;  3WE3 A;  3HYI A;  4EV0 A;  2AS5 F;  3L9F A;  4I01 A;  3LAP A;  2HZT A;  3FMQ A;  2BBY A;  1IRF A;  5JVT A;  2O03 A;  2WTE A;  2IA1 A;  3TO7 A;  3T8R A;  4M72 A;  2DAO A;  1ZLJ A;  1R36 A;  2YX4 A;  2VT3 A;  4G6D A;  3GO5 A;  3RPQ A;  2A61 A;  4U0Y A;  5DYM A;  1R7J A;  2FBK A;  3V7R A;  1STZ A;  3TDU C;  5HDN A;  1IUY A;  2HQN A;  2UXN A;  3BP8 A;  2STW A;  4ZYE A;  4EGZ A;  4KDP A;  3W6J B;  4Q4Z F;  4I2O A;  3FF5 A;  4M74 A;  5IT9 K;  5IT3 A;  4CIC A;  4XBF A;  1B1B A;  4PGG A;  1P4X A;  1O3Q A;  4O6J A;  2GXG A;  4BHP A;  3ZMV A;  5CVI A;  1Z91 A;  4HQE A;  3WTW C;  4KUM A;  1OYW A;  1O3T A;  5HDG A;  1KQ8 A;  2QM3 A;  1TQM A;  3GZ5 A;  4GGG A;  1FYK A;  4RB3 C;  4XSZ F;  2VXZ A;  4ZH4 F;  1T0F A;  1F1Z A;  4RGR A;  3IWF A;  2QBY B;  1B6A A;  3GYH X;  4MNU A;  2Z5U A;  4RGU A;  3OOP A;  2J5O A;  5K5R A;  4FHT A;  2XAS A;  5CVR A;  5ILS A;  4EGY A;  4FT8 A;  2BGC A;  1HW1 A;  3KFW X;  1IW7 F;  2DO7 A;  2Q0O A;  5JI6 A;  1KA8 A;  3C3W A;  3TOB A;  2Y75 A;  1HW2 A;  2DK5 A;  4Y17 A;  4XLP F;  1O3R A;  4Q48 A;  1YLF A;  3HSE A;  4XRF A;  5K1Y A;  4NB5 A;  1SD5 A;  2K7L A;  1IN4 A;  3RJP A;  1ZH5 A;  1ZG3 A;  1S7A A;  4HOB A;  3HIF A;  1XCV A;  3ECH A;  1BM9 A;  2CG4 A;  5BOX A;  2EA2 A;  1QO0 D;  1D8J A;  1R5G A;  4BXU A;  3CUQ B;  1FOK A;  1SAX A;  1MGT A;  5EEH A;  5HS9 A;  5D4R A;  2ZME A;  1BIA A;  5ICC A;  3TGN A;  5L3D A;  2HR3 A;  3EQL F;  5H6Q A;  4HA8 A;  2GXB A;  1IRG A;  4LG0 A;  1X3U A;  2F5F A;  2W25 A;  1S8N A;  1JHF A;  1XMA A;  4CHU A;  2D2W A;  4LLG F;  1W5T A;  3SQN A;  4CGZ A;  4N9H A;  4L9J A;  2K4J A;  2ZNY A;  5J8C A;  4LK0 F;  4UVA A;  5KK1 A;  4OOI A;  4OU0 A;  1U5T B;  4LJZ F;  2EJR A;  2UWM A;  1ZGJ A;  5K5Q A;  3P7N A;  3EUH A;  1BI2 A;  2QZ8 A;  3E5X A;  2XAJ A;  1OKR A;  3WG9 A;  2RN7 A;  2KJB A;  3EDP A;  2QEN A;  1C0W A;  2PI0 A;  2A5Y B;  2FU4 A;  3FZV A;  1Z05 A;  2OZU A;  4IPA A;  2FXA A;  5LLQ A;  4EVI A;  5HOO A;  3VB2 A;  1A04 A;  5DV5 A;  2HFH A;  3R0A A;  4D0P A;  3KLO A;  3WU0 A;  5DCF A;  5ERI A;  2H6C A;  2PBI A;  1OR7 A;  2L4A A;  2EWN A;  1ZRF A;  1ZRE A;  3SXY A;  1BI0 A;  1UHW A;  2O3F A;  3HOT A;  1TNT A;  1BC8 C;  3ZMT A;  4GO1 A;  3F22 A;  4A2U A;  3FXR A;  5IT9 Z;  4UV8 A;  1CF7 A;  4ZYG A;  2H27 A;  3REO A;  2NS0 A;  3V8J A;  4YIF A;  2ZXJ A;  5E1X A;  3KP7 A;  5HS8 A;  1ZRD A;  4P9U A;  2AXL A;  1T39 A;  4PCQ A;  4R8H A;  4A0Z A;  3FWE A;  3HRU A;  2YSR A;  2Z9O A;  4GYI A;  4KMF A;  4BAY A;  1Z6R A;  3E6D A;  3K1P A;  2P5K A;  2XAG A;  1TLH B;  3T0Y A;  2HGC A;  2XV4 S;  1BN5 A;  3LA7 A;  2PQ8 A;  5KVR A;  2DFI A;  5E20 A;  2PLY A;  3M8E A;  3ABU A;  1T98 A;  4ASN A;  2P7V B;  1KYW A;  3I0T A;  4Z2Y A;  5D4S A;  4HX7 A;  1W4M A;  2V6C A;  2EK5 A;  4MQ9 F;  3IKV A;  3JTG A;  2HTS A;  4P9F A;  1E2X A;  3E5U A;  1MZB A;  2XHK A;  5JR3 A;  1B9N A;  1J7K A;  4UNO A;  5LGU A;  2L54 A;  4UV9 A;  2MH2 A;  2ELH A;  3I71 A;  1K6O A;  5A2Q K;  2L01 A;  4LLL A;  3FM5 A;  2MLG A;  2VC0 A;  1ZAR A;  5CVV A;  4YG2 F;  5H6R A;  4G7H F;  3P9C A;  1LEA A;  1P2F A;  5D5V B;  4HW0 A;  4G7Z F;  4IHT A;  1KQ9 A;  1I1S A;  3O6B B;  3E6C C;  1I27 A;  2XRN A;  1FC3 A;  2PEX A;  3SZP A;  5ICF A;  4GYG A;  3HHH A;  1S3J A;  3KEO A;  2V79 A;  2NYX A;  3WTY C;  1WWX A;  3ROU A;  3ZMU A;  3ZQ7 A;  1AOY A;  1L3L A;  1ODD A;  1Z1D A;  4UXN A;  3I5U A;  5JFR A;  1FBU A;  4U88 A;  3OV8 A;  3C1D A;  1LDK B;  3QU3 A;  1GVJ A;  2IPQ X;  1ONV A;  4WF2 A;  5F6F A;  5LGT A;  4HX8 A;  2WV0 A;  1RNL A;  4H0E A;  2M5W A;  2E1C A;  1W5S A;  4ETS A;  5FD6 A;  3I64 A;  3V4G A;  3FXQ A;  2VE8 A;  3FHZ A;  4BH9 A;  4KNY A;  1CF7 B;  3E6M A;  4XLN F;  5CLS A;  2MH9 A;  3KP4 A;  5LHG A;  2RDP A;  3HOS A;  1G4D A;  3DPL C;  1J75 A;  4M9S A;  3RI4 A;  2HTJ A;  4MEX F;  2VOP A;  3HSF A;  1MDM B;  4QWQ A;  1F4K A;  2VT2 A;  2EFO A;  2XAF A;  1UHM A;  4A12 A;  2IW5 A;  2ZFW A;  2A07 F;  2EFN A;  1MJA A;  2FSW A;  2IJL A;  2NNY A;  4U0W A;  1EH8 A;  2CWE A;  4MEY F;  4HF2 A;  2OAZ A;  4YFN F;  1RUN A;  1UFM A;  4I0A A;  4MTD A;  4RS8 A;  2VC1 A;  2O6G E;  1B59 A;  1ON2 A;  2CQK A;  4G9Y A;  4KA4 A;  2RV8 A;  5LEK A;  1CGP A;  3QP6 A;  1TQP A;  3E6B A;  3DFG A;  3JSP A;  4WXH A;  1FPQ A;  2FEZ A;  2M30 A;  4CYD A;  1TNS A;  3RYP A;  2E7W A;  1P92 A;  4M6Y A;  5D5X B;  1DPU A;  1LQ1 A;  1SMY F;  1NHA A;  1BI1 A;  5L3B A;  4N9I A;  3HUG A;  5DUI A;  1E17 A;  1BC7 C;  2ADU A;  2ZO4 A;  2P8T A;  4KIB A;  1MJB A;  3WTU C;  4EJT A;  4WCG A;  3L00 A;  1IN6 A;  3MZH A;  1PP8 F;  4HZF A;  5HDK A;  3LAJ A;  2PJP A;  4G7O F;  1REP C;  2ZJ2 A;  1YYV A;  3LQQ A;  3WGH A;  3GW2 A;  4LMY A;  4U0V A;  1FBQ A;  1UCR A;  2DLL A;  2TDX A;  3TO9 A;  2P5V A;  3CO7 C;  1ZAO A;  3I58 A;  2ZCW A;  5A2Q Z;  1ZLK A;  4M6X A;  5CJ9 A;  4PDK A;  3WOD F;  4FX4 A;  3IHU A;  2P5L C;  2HDC A;  5CYV A;  4ZZL A;  3TO6 A;  4AIK A;  1WKM A;  3M9A A;  3SHF A;  3KEQ A;  2CGP A;  4MTE A;  2HYF A;  2OU2 A;  3K9T A;  3GFL A;  2E1N A;  4EQQ A;  3BRO A;  5TJJ A;  2FNA A;  2LNB A;  3BJO A;  3IKT A;  4MHG A;  4KT5 C;  1U78 A;  1J9I A;  1EV7 A;  2C6Y A;  2HWV A;  2DBB A;  2Y48 A;  2YU3 A;  4ENN A;  2VE9 A;  3GF2 A;  1BIB A;  2M1B A;  1MD0 A;  4WK8 F;  5E1W A;  5LHI A;  1SFX A;  1F9N A;  4LGW A;  1LNW A;  4UHT A;  2CSO A;  1XGO A;  3QP5 A;  3V7C A;  4A6D A;  4LK1 F;  3GLX A;  3KP6 A;  3G3Z A;  4L5J A;  2GA1 A;  2J5P A;  3DV8 A;  2WWY A;  1KU2 A;  4HF0 A;  4KN4 X;  2JPC A;  2HEO A;  2P6T A;  5LEJ A;  1ZG1 A;  5BPI A;  3R60 A;  3Q5F A;  3FXU A;  2B0L A;  2V1X A;  4G6Q A;  3RKW A;  3CUO A;  1W7P A;  2LF8 A;  1G3Y A;  4L0Y B;  3DKW A;  2FQ3 A;  2XKP A;  3ERE D;  3I53 A;  2G9W A;  2HS5 A;  2PMU A;  4AIH A;  2XVC A;  1Y0U A;  2K02 A;  4A5N A;  5DCM B;  1ZN2 A;  2F5D A;  2GZW A;  3HTS B;  2ESH A;  1JHH A;  5HVQ C;  2VN2 A;  1I5Z A;  3RPU A;  3DEU A;  3MZY A;  2BYV E;  2F5C A;  1FWZ A;  2R7F A;  4Q5S F;  2E7X A;  4XSX F;  1HSJ A;  2OD5 A;  3F6V A;  1FT9 A;  3CDH A;  2GAU A;  4JBA A;  2IA0 A;  1B4A A;  2A69 F;  1QGP A;  1IXC A;  3CO6 C;  4EJU A;  3J81 K;  3P9I A;  1RIO H;  3F3X A;  1T2K A;  1YS6 A;  2ACJ A;  2ZBK A;  2STT A;  4WWC A;  4KN7 X;  1GXQ A;  3K69 A;  3G73 A;  3WTX C;  4OMY A;  3FM3 A;  5F64 A;  1LEB A;  1J0R A;  3TQN A;  4CO8 A;  3COA C;  5FGM A;  1WSU A;  1JXS A;  1S7O A;  3QU6 A;  4ESB A;  1PP7 U;  2A68 F;  5D6F A;  2FOK A;  4BYY A;  1DDN A;  1ZGA A;  2G7H A;  3RDI A;  2COM A;  3FMS A;  3R0J A;  1K78 A;  2KKO A;  1TW2 A;  2XKO A;  3LST A;  2ZNZ A;  1OYY A;  3ZP5 A;  2XAQ A;  2W57 A;  3T5X A;  1USS A;  4HF1 A;  2OZ6 A;  2V1U A;  4L18 B;  2YPR A;  3LFK A;  2YR2 A;  4Y15 A;  2EV5 A;  1FP1 D;  4O3M A;  3F21 A;  3K0L A;  5DEQ A;  4EJW A;  5D8K B;  3N4M A;  2YX7 A;  1VTN C;  1RUO A;  4KYW A;  3M1E A;  4IJA A;  1U6G A;  2DPD A;  1QBJ A;  3ELK A;  5FO5 A;  3F8M A;  1OYI A;  2ZME B;  4BQA A;  3IL2 A;  1AWC A;  4M73 A;  3TDZ C;  4LG0 B;  4PGH A;  3MAJ A;  1WI9 A;  1BI3 A;  2W24 A;  3U1D A;  2MLK A;  3KP2 A;  3GX4 X;  3F8C A;  2F2E A;  2H09 A;  1G3T A;  4FX0 A;  4A0X A;  2GA2 A;  4AVP A;  3PQK A;  2JPB A;  3H3U A;  1R58 A;  4AD9 A;  1D8K A;  3VOE A;  4AWX B;  1R5H A;  4ON0 A;  3QPH A;  2D1V A;  4WX9 A;  2QWW A;  4RGX A;  4RB2 C;  4L5I A;  1WQ2 A;  2A6H F;  2BV6 A;  4Y13 A;  1IN8 A;  2EV0 A;  5FLX K;  3GUD A;  5HLG A;  5F1R A;  1FYL A;  1FBS A;  2LSO A;  2DQR A;  4AIJ A;  1FLI A;  1S29 A;  2PN6 A;  5ILV A;  3DQV C;  5HLH A;  1GHC A;  2X4H A;  1U2W A;  1ULY A;  3DXJ F;  1RZ4 A;  5ED4 A;  4OIP F;  3FX3 A;  4KFC A;  3WGG A;  2RKH A;  2PFB A;  2ZKZ A;  4HBL A;  5J6X A;  3DF8 A;  4LB5 A;  1K78 B;  2KRF A;  2QQ9 A;  1WRJ A;  1IXS B;  1R1T A;  1FP2 A;  2VON A;  3QAH A;  2EA4 A;  1TTY A;  3GWZ A;  1EH6 A;  3J81 Z;  2JSC A;  1YIO A;  1O3S A;  1MKM A;  2P4W A;  3LA3 A;  4OIN F;  1HKS A;  1Q1H A;  2P6S A;  4IF4 A;  3IC7 A;  3H3Z A;  3E5Q A;  1YS7 A;  3M7G A;  1R00 A;  1W7P D;  3RYR A;  5BMZ A;  5DD8 A;  3PQJ A;  3IWZ A;  3PFI A;  4U7D A;  4KIC A;  3V7S A;  1HBX G;  1TW3 A;  4HDV A;  1F5T A;  3V8K A;  1XN7 A;  2P7C B;  2HQR A;  1I1G A;  2XUB A;  5JHU A;  1HQC A;  2OBP A;  2O8X A;  2VBW A;  1XSX A;  2OA4 A;  3L7W A;  4RAZ A;  4IRG A;  3ZMD A;  5CVJ A;  2GQQ A;  2CW0 F;  2QQB A;  2O0Y A;  4N0B A;  1PDN C;  1PUE E;  4L9V A;  5HLI A;  2IT0 A;  2MBF A;  3U9G A;  4CDG A;  2VBX A;  1P4A A;  3DPT A;  4HAM A;  3VFZ A;  2QBY A;  2KIM A;  3ZN1 A;  2QVO A;  5ICG A;  4DQ2 A;  3HRM A;  6PAX A;  3KP5 A;  2EB7 A;  2XAH A;  3EYI A;  1XB4 A;  3GZ6 A;  5E1Z B;  1Z6T A;  4JQF A;  3O3K A;  2NRA C;  2D1H A;  1RI7 A;  3EET A;  5E17 F;  1UST A;  1H9G A;  5AIP A;  2DT5 A;  3KLN A;  2ISZ A;  2EV6 A;  1KYZ A;  3NEU A;  4WXD A;  4YFK F;  2CO5 A;  4P5O A;  2Y0M A;  2K27 A;  4OMZ A;  3VOD A;  4YII A;  3HRS A;  1DUX C;  1B9M A;  4KIF A;  4JK1 X;  1HKT A;  3SZT A;  2FNP A;  3T8T A;  1FY7 A;  2IVM A;  4ESJ A;  2PG4 A;  2LKP A;  4HV5 A;  3CUQ A;  3KP3 A;  3D5L A;  1HW5 A;  2H6B A;  2LDU A;  3WTV C;  1T38 A;  3F8N A;  3RKX A;  2QQA A;  1IN5 A;  2DK8 A;  3NQO A;  3T1B A;  3BY6 A;  3VEP A;  4ENK A;  5ICE A;  5D6E A;  4I02 A;  3RIR A;  2ETH A;  3BOQ A;  4S04 A;  5FLX Z;  1P6R A;  5L3C A;  4WXC A;  2QYO A;  2CYY A;  3QPT A;  3KET A;  4A0Y A;  1LB2 A;  3E97 A;  3HTU A;  3LA2 A;  3RKY A;  3S2W A;  1T6S A;  5D5U B;  1QPM A;  3JAM K;  3WGI A;  3ABT A;  1U5T A;  2XGX A;  2XIG A;  5FFZ A;  1KU9 A;  4R79 A;  3BDD A;  2JRT A;  5K5O A;  4BNC A;  4L9T A;  1XGN A;  3K1M A;  3F72 A;  3SFZ A;  3I59 A;  1IZ1 A;  5EEG A;  5AIQ A;  4LLN A;  1DPR A;  3O2P E;  1R1U A;  5CVU A;  2FBH A;  1YFH A;  3ULQ B;  2F5E A;  2G7U A;  4M9X A;  5LGN A;  3BJ6 A;  3GFJ A;  3CJN A;  2QLZ A;  1FNN A;  2RQP A;  1ZHF A;  2KJC A;  4IRH A;  5LRR A;  1XCB A;  1KU3 A;  5FB2 A;  1SD4 A;  2M87 A;  3E3V A;  4EM0 B;  5DDG A;  1SD7 A;  2K4B A;  2L4M A;  3KZY A;  2QUF A;  3Q9S A;  5ILU A;  3MCZ A;  1SFE A;  3HSR A;  1XSD A;  1R22 A;  1R23 A;  2V1D A;  2ISY A;  2Q2E A;  2EFQ A;  3AAF A;  1BJA A;  5LHH A;  1XSV A;  4LFU A;  1QNT A;  1KGS A;  3K1N A;  3WU1 B;  3F6O A;  3GVA A;  4QLC U;  3JTH A;  4M71 A;  2OQR A;  2PMH A;  2FMY A;  3ZN0 A;  2VOD A;  1D3Y A;  2DW4 A;  1XGS A;  1KQ0 A;  2RC4 A;  1J59 A;  3FMR A;  4IXA A;  2Z33 A;  3BWG A;  4K2E A;  4I7H A;  1DP7 P;  3F8F A;  4S05 A;  2FRH A;  3KZZ A;  1Z9C A;  4ENM A;  4EMS A;  3MQ0 A;  4E70 A;  4F7Z A;  4LB6 B;  3C18 A;  1D5V A;  1IXR C;  2X0L A;  4A5M A;  2WC2 A;  2IP2 A;  2NNN A;  4HYE A;  2EFW A;  4RGS A;  1YG2 A;  3R4K A;  3WE2 A;  1YW9 A;  3QRF F;  4NHJ A;  4L9N A;  2DQL A;  3JSO A;  4LD5 A;  5H20 A;  3IRQ A;  1FZP B;  2MC3 A;  2W85 A;  1YO5 C;  3J80 K;  3ISP A;  2V9V A;  3N97 A;  3ZMZ A;  3I59 B;  1GXP A;  5TRD A;  1QZZ A;  1QZY A;  5DD4 A;  4DNC A;  1XDS A;  1SFU A;  1H0M A;  1TBX A;  3GXO A;  5J8F A;  3ZMS A;  2W84 A;  4CZZ A;  2JTV A;  1FYM A;  4PZJ A;  2EFP A;  2RNJ A;  2GWR A;  4R1H A;  1K7A A;  1YW8 A;  1H9T A;  4EJO A;  1G3W A;  2A3S A;  3JAM Z;  3MWM A;  1BOA A;  2FA5 A;  1OMI A;  3K2Z A;  2NAZ A;  4I98 B;  5E8G A;  1W7P B;  2IA2 A;  4BHB A;  2Q8K A;  1O57 A;  1FSH A;  4MGR A;  3JW4 A;  2FBI A;  1I6X A;  2FML A;  2MD5 A;  5LRS A;  5FFX A;  1IF1 A;  2UXX A;  2JZY A;  1MDM A;  1HXD A;  4O5V A;  4YFX F;  3EYY A;  3BZ6 A;  4BHC A;  1LDD A;  1ON1 A;  2RGV A;  4HX4 A;  4IVN A;  1QQI A;  4CXF A;  1FX7 A;  3RTR A;  1HST A;  4OIQ F;  3KCC A;  3MFK A;  1YQA A;  3B73 A;  2HOE A;  3KE2 A;  4HV6 A;  3BPV A;  1XDU A;  4GXO A;  2FE3 A;  2LF7 A;  3WTZ A;  5E8I A;  2HKO A;  4ZYD A;  4GCV A;  1XD7 A;  1J5Y A;  3DP7 A;  4EJV A;  4HLY A;  2HYG D;  1LDJ A;  3F23 A;  2KIU A;  3C7J A;  4IRI A;  1S6L A;  4NQW A;  4UVC A;  4B09 A;  4OIO F;  3CUQ C;  2DI3 A;  1U3E M;  2O61 A;  3GFI A;  2IRF G;  3P9K A;  3NRV A;  1MJ9 A;  1U8R A;  4KMU X;  2DU9 A;  1YTY A;  5BS6 A;  4P55 A;  3ZPL A;  4G8X A;  2L02 A;  2BE5 F;  4UUV A;  5HS7 A;  2K86 A;  2XRO A;  1G3S A;  2D45 A;  4ESF A;  2CFX A;  4A6E A;  4HQM A;  3J7A O;  1SD6 A;  2DTR A;  2MA3 A;  2VOO A;  4EM2 A;  5L3G A;  1U5T C;  1ZRC A;  3V8L A;  1ZYR F;  1IN7 A;  3WTT C;  1ZG5 A;  1UB9 A;  3CTA A;  2R7D A;  4ZZD A;  4RB1 A;  4I0B A; 
#chains in the Genus database with same CATH topology
 4EM1 A;  2R7X A;  2JA7 J;  2BW3 B;  1YW7 A;  3HHG A;  2RVC A;  4MQV A;  2LRE A;  2VBY A;  4CSW A;  2H94 A;  4UVB A;  4DZP A;  1M1E B;  1WI3 A;  1D0Y A;  5HNH A;  5BPD A;  1R1V A;  1SMT A;  2Y69 H;  1UEL B;  4B8X A;  4RM2 A;  3J80 Z;  4E7Z A;  4OWR B;  4I09 A;  4NC6 A;  1PJR A;  4HLX A;  1V4R A;  2WBM A;  2L3D A;  2VQL A;  3H9J A;  4ZYH A;  2ZJQ F;  2IS2 A;  2A6E F;  3H9G A;  3IV5 A;  1H88 C;  1D5Y A;  1HKQ A;  5L3F A;  3RQ4 A;  2MFZ A;  1D1B A;  1LJ9 A;  1KU7 A;  3HRT A;  5H2F C;  5C4X J;  3GFM A;  1L0O C;  5EYR A;  1RC9 A;  1XMK A;  4BJ5 C;  3GTK J;  2HKX A;  3I54 A;  3BJA A;  3R61 A;  2VBZ A;  2H8R A;  2DPU A;  2FQ4 A;  2OC6 A;  5L3E A;  2HQ5 A;  4QSH A;  2RNG A;  2M0C A;  2OQG A;  1WFX A;  5E18 F;  2FF4 A;  2KIF A;  1JUS A;  1IV8 A;  3IRR A;  1P7I A;  1T56 A;  2E71 A;  2JT1 A;  2UZK A;  3WTS C;  2R3S A;  3D5R C;  4ENJ A;  4PK4 A;  4YEL A;  3R6S A;  2VXD A;  1O7L A;  2I5U A;  2LP0 A;  4TV7 A;  4B3A A;  1R4M B;  4L0Z B;  4OIR F;  1MBJ A;  3LWF A;  3LQR A;  4IHS A;  5M5W J;  4CH7 A;  4Q47 A;  3G1L A;  5GTI C;  3H1C A;  1A36 A;  2ESN A;  3Q9V A;  3U2R A;  3I4P A;  4PSW A;  4II2 A;  3ML6 A;  2JA8 J;  5BQT A;  1J2X A;  2GIV A;  3CC2 I;  3L09 A;  1I39 A;  4RAY A;  1EH7 A;  1X1B A;  3M4O J;  3G6E I;  4F52 A;  2R7T A;  1FSE A;  3VSK A;  4NQW B;  4XRS A;  3W6K B;  5D8L B;  4DOZ A;  4RBO A;  2CQQ A;  2E5N A;  3GEZ A;  1RRJ A;  2CQX A;  3S3M A;  2DT6 A;  4U7B A;  2BY3 A;  1VQP I;  1V3F A;  1MND A;  4I6Z A;  4HNU A;  3MEX A;  1BBY A;  3M8F A;  2BEO A;  3F8B A;  1VQ4 I;  2Z99 A;  1FTZ A;  1ETX A;  5D5W B;  1MH3 A;  3B02 A;  1QPI A;  4CZC A;  1BL0 A;  2Z3Y A;  4EAT A;  3Q0U A;  3CF2 A;  3ZQL A;  1VQ6 I;  3PM1 A;  1IAW A;  3KIO A;  2LG4 A;  4A3E J;  5FD5 A;  3H92 A;  3ECO A;  1LVA A;  5B66 C;  1O7F A;  2VQC A;  3K2A A;  5F08 A;  5IYB J;  2K9N A;  3QOP A;  4HDU A;  2ECC A;  2K9S A;  4KIG A;  1XGM A;  1P4W A;  2AO9 A;  2X6Y A;  1V5E A;  2XGE A;  2Y0S A;  1VQN I;  1TQI A;  2R93 J;  3K4M A;  1G6N A;  3F0C A;  5LBQ A;  1Z7U A;  2OCE A;  3TKY A;  1JE8 A;  3DTK A;  3GBG A;  4P96 A;  5EG0 B;  2H1K A;  2M8E A;  4BL0 B;  2KZV A;  1K79 A;  5EGO A;  5AON A;  1JI8 A;  4G94 A;  2MD0 A;  3N05 A;  3ABL H;  1FOX A;  1WHU A;  2DYS H;  4M9Z A;  3BPX A;  5DUK A;  1OPC A;  3TOA A;  5BNG A;  3L2C A;  1JGS A;  5DCM A;  3CLO A;  2M45 A;  2XB0 X;  4RB0 A;  1YRN B;  4BY1 J;  3D0S A;  2PJR B;  1AHD P;  4IOA F;  3WE3 A;  3HYI A;  2CUF A;  2HVS A;  4EV0 A;  4XLA A;  2AS5 F;  3L9F A;  4I01 A;  2DOA A;  3CMM A;  3LAP A;  2HZT A;  3A4C A;  2A05 A;  3FMQ A;  5FKK A;  2BBY A;  1IRF A;  5JVT A;  2O03 A;  3G71 I;  2RRE A;  2V4J C;  2WTE A;  3BR6 A;  5EZH A;  2IA1 A;  3TO7 A;  3T8R A;  2WAF A;  4M72 A;  3IH2 A;  3CCU I;  2DAO A;  1ZLJ A;  1R36 A;  2YX4 A;  2OTJ I;  2VT3 A;  3P5J A;  4XL9 A;  4G6D A;  3GO5 A;  3RPQ A;  2A61 A;  2QKL B;  4XQF A;  4U0Y A;  3H9Q A;  5DYM A;  1R7J A;  1N25 A;  2LMD A;  2FBK A;  3V7R A;  1STZ A;  3TDU C;  5HDN A;  2ZJP F;  1IUY A;  2HQN A;  2UXN A;  3BG6 A;  4QPQ A;  3BP8 A;  2STW A;  1Y8R B;  2NXN B;  4ZYE A;  4EGZ A;  4KDP A;  3CD6 I;  1RET A;  3W6J B;  4B48 A;  1OR7 C;  4Q4Z F;  4I2O A;  3FF5 A;  4M74 A;  5IT9 K;  4PSX A;  4NUB A;  4XOT A;  5IT3 A;  3ZR8 X;  1QZE A;  2ZB9 A;  1XC5 A;  4CIC A;  3CCQ I;  4XBF A;  3OWT A;  2HPM A;  1RR8 C;  1B1B A;  1WJB A;  4PGG A;  1P4X A;  1DU0 A;  3LSK A;  4FET A;  1O3Q A;  1MNE A;  2NS7 A;  4O6J A;  2GXG A;  4BHP A;  3ZMV A;  2NVU B;  5CVI A;  1Z91 A;  4FTH A;  2JA6 J;  4HQE A;  3WTW C;  4KUM A;  3FXL A;  1OYW A;  5FJ8 J;  5HDG A;  1VFC A;  1O3T A;  1KQ8 A;  3L2V A;  2QM3 A;  1TQM A;  3GZ5 A;  4GGG A;  1FYK A;  4RB3 C;  3BR2 A;  4X0G A;  4XSZ F;  5J47 A;  3JRE A;  2KT0 A;  5FRO A;  4RA2 A;  4AYB A;  1TZL A;  3QYE A;  2VXZ A;  4PJ0 C;  4ZH4 F;  1X2M A;  1T0F A;  1F1Z A;  4RGR A;  3IWF A;  3S3N A;  2QBY B;  1IRX A;  3OOU A;  1LVK A;  1B6A A;  3LSI A;  5EZG A;  3GYH X;  4MNU A;  2V7F A;  2Z5U A;  4RGU A;  3OOP A;  2J5O A;  1NH3 A;  5K5R A;  4FHT A;  1R5I D;  2XAS A;  3CC7 I;  5CVR A;  3W6V A;  5ILS A;  4EGY A;  4BJ6 C;  4FT8 A;  5J4Y A;  2BGC A;  1CQT A;  1HW1 A;  3A1Y A;  3KFW X;  1OQY A;  1IW7 F;  2DO7 A;  2Q0O A;  5JI6 A;  3HJE A;  4E4H A;  1ERD A;  1KA8 A;  3C3W A;  2E34 A;  3TOB A;  5FRN A;  3MZ8 A;  1SAU A;  2Y75 A;  2MAB A;  1HW2 A;  1ZR2 A;  2H1L A;  4Y33 A;  1GV2 A;  2DK5 A;  4Y17 A;  1LE8 B;  1MMD A;  4XLP F;  1O3R A;  4Q48 A;  1F43 A;  1YLF A;  3HSE A;  4XRF A;  1LFB A;  5K1Y A;  4NB5 A;  1SD5 A;  2R7Q A;  2DXI A;  2K7L A;  2K5C A;  1IN4 A;  2GOX B;  3RJP A;  2PMZ N;  2JA5 J;  1ZH5 A;  2WAQ N;  3ONQ A;  2HI3 A;  4W1U A;  1ZG3 A;  3FXM A;  1S7A A;  1JKQ C;  2F4M B;  4HOB A;  4JX4 A;  1N78 A;  3PUB A;  3HIF A;  1XCV A;  5KAI C;  3OYC A;  3ECH A;  1BM9 A;  4XR6 A;  1TL8 A;  1RES A;  2CG4 A;  1FOW A;  2UV1 A;  5BOX A;  3OSF A;  1B8I A;  2EA2 A;  1QO0 D;  1D0Z A;  1D8J A;  1R5G A;  2R0Q C;  2R7R A;  4BXU A;  4BXX J;  3JRG A;  3CUQ B;  1FOK A;  1SAX A;  2B7E A;  1MGT A;  5EEH A;  5J4V A;  1Z67 A;  5HS9 A;  1OLT A;  1P9Q C;  2VKH A;  3HPH A;  3ZQH A;  5D4R A;  2ZME A;  1BIA A;  1U9N A;  5ICC A;  3TGN A;  3HOU J;  5L3D A;  3AG2 H;  2HR3 A;  2L9V A;  1OIS A;  3EQL F;  4HA8 A;  5H6Q A;  4IEJ A;  2GXB A;  2QCO A;  3H35 A;  1IRG A;  4AVZ A;  1XMX A;  1X3U A;  4X1E A;  4LG0 A;  2F5F A;  2W25 A;  1S8N A;  2CUE A;  1JHF A;  1DGW Y;  3QOE A;  2LLK A;  1XMA A;  4CHU A;  1A35 A;  5LFA A;  3RZO J;  5GPC A;  3HL2 A;  4E7S A;  2D2W A;  2HU9 A;  4M6V A;  1MIJ A;  2K9M A;  3DTI A;  4LLG F;  1W5T A;  3SQN A;  2VL8 A;  2K3F A;  4CGZ A;  4N9H A;  4XLF A;  4L9J A;  2GXA A;  3DBR B;  2K4J A;  3ZRG A;  2ZNY A;  5J8C A;  4LK0 F;  4UVA A;  5KK1 A;  4OOI A;  4OU0 A;  1U5T B;  2IEK A;  4M3D A;  4BQO A;  4M3E A;  3PO3 J;  4LJZ F;  2DA1 A;  2EJR A;  4E7K A;  4HG2 A;  2UWM A;  1ZGJ A;  5K5Q A;  1YOV B;  2E19 A;  1W0U A;  5KAF C;  3P7N A;  3EUH A;  3QWL A;  3JRC A;  1BI2 A;  2JMW A;  1HA8 A;  2QZ8 A;  3E5X A;  3OYD A;  2XAJ A;  2MG4 A;  1OKR A;  3WG9 A;  2DOD A;  2RN7 A;  2KJB A;  3EDP A;  3HPG A;  5FLM J;  3DLL F;  2QEN A;  3A01 B;  3WG7 H;  1C0W A;  1FEX A;  2CQ7 A;  4HEA 2;  3TMO A;  1WH7 A;  2PI0 A;  2A5Y B;  2E2J J;  2FU4 A;  2NVY J;  3FZV A;  3MMY B;  4BBS J;  2ME6 A;  2V9K A;  1Z05 A;  1LFU P;  1Q1V A;  5IP9 J;  2OZU A;  4IPA A;  2CW7 A;  2FXA A;  5LLQ A;  3MKY B;  1VQL I;  2FUG 2;  4EVI A;  5HOO A;  2OTL I;  3VB2 A;  5IY5 H;  4BQN A;  2DMT A;  1A04 A;  5DV5 A;  2E5Z A;  2HFH A;  2OJE D;  3R0A A;  4D0P A;  3KLO A;  3WU0 A;  5DCF A;  5ERI A;  2H6C A;  2TCT A;  2PBI A;  2XRL A;  4MFD A;  1OR7 A;  2L4A A;  2EWN A;  4XON A;  1ZRF A;  1ZRE A;  3SXY A;  1BI0 A;  1UHW A;  2F5V A;  3IAM 2;  1F36 A;  1I3Q J;  4UUS A;  2V9P A;  2O3F A;  2HOT A;  1A6Q A;  4XID A;  3HOT A;  1TNT A;  2CQN A;  1UZC A;  3ZMT A;  1BC8 C;  3S2D J;  1SAN A;  4GO1 A;  3F22 A;  1YJ9 I;  4A2U A;  4IX7 A;  1JKR C;  2Q2E B;  1YIT I;  3FXR A;  5IT9 Z;  4UV8 A;  3E1S A;  1CF7 A;  1HDP A;  4ZYG A;  3JRB A;  1VQ9 I;  2H27 A;  3HOZ J;  3REO A;  2NS0 A;  2DJI A;  2VLA A;  3A2K A;  1ETQ A;  4BEH A;  1SVM A;  3CDL A;  3V8J A;  4YIF A;  2KRC A;  2ZXJ A;  5E1X A;  3KP7 A;  5HS8 A;  2X6W A;  4P9U A;  1ZRD A;  2TRT A;  2R7V A;  2AXL A;  1Y0N A;  4UY8 I;  3OYL A;  1T39 A;  3GTO J;  4PCQ A;  4IL6 C;  4R8H A;  3DWL E;  4A0Z A;  3FWE A;  3HRU A;  2YSR A;  2Z9O A;  2DA4 A;  3CZ6 A;  4GYI A;  4KMF A;  4BAY A;  1B8I B;  3BR5 A;  1E3P A;  1Z6R A;  1YX3 A;  3E6D A;  2EIJ H;  4D7M A;  1GUU A;  3K1P A;  1DQU A;  2P5K A;  2XAG A;  1TLH B;  3T0Y A;  2HGC A;  2XB5 A;  2XV4 S;  1BN5 A;  3LA7 A;  2R5Y B;  3S3O A;  2KIQ A;  5J40 A;  2PQ8 A;  5KVR A;  2DFI A;  5E20 A;  2E35 A;  2M7B A;  2PLY A;  2P0W A;  3M8E A;  3MN2 A;  3ABU A;  1T98 A;  4ASN A;  1N77 A;  4C2M J;  2P7V B;  1KYW A;  2LH9 A;  2EH3 A;  3I0T A;  3BQY A;  1ETY A;  2EZI A;  4Z2Y A;  1AKH A;  5D4S A;  4UB8 C;  1WJD A;  2QSG X;  1ETK A;  4HX7 A;  1W4M A;  2V6C A;  2EK5 A;  4MQ9 F;  4H4K C;  2LY9 A;  2WA0 A;  1ENH A;  3IKV A;  3IUO A;  3GTQ J;  1IDZ A;  1VQM I;  2P81 A;  4HNT A;  3JTG A;  5IOZ A;  2ZC2 A;  2HTS A;  4P9F A;  1E2X A;  3E5U A;  2BXY A;  1MZB A;  4C3H J;  3E0J B;  3HOW J;  2VPL A;  2XHK A;  4KIS A;  2VKE A;  5JR3 A;  5CPR B;  1B9N A;  1J7K A;  4YIR X;  4A3J J;  2ZXW H;  2LBF A;  4UNO A;  4DYQ A;  2W7N A;  4XMY A;  5LGU A;  2E1O A;  5GAG J;  3ZQQ A;  2M2E A;  2L54 A;  3JRF A;  2DCE A;  4XNF A;  2JUG A;  4UV9 A;  3HG9 A;  2MH2 A;  4V2G A;  2ELH A;  3I71 A;  1K6O A;  5HLT A;  5A2Q K;  3FIS A;  4AUX A;  3HXL A;  2L01 A;  4LLL A;  3FM5 A;  2MLG A;  2I10 A;  2VC0 A;  4LG3 A;  1ZAR A;  2CUZ A;  2B63 J;  5CVV A;  3CCE I;  4AM3 A;  4YG2 F;  4BDZ A;  5H6R A;  4G7H F;  3P9C A;  1LEA A;  5IP6 A;  1P2F A;  3H5A A;  3MD2 A;  5D5V B;  4HW0 A;  4XKW A;  2VKD A;  3KEY A;  4G7Z F;  4IHT A;  1KQ9 A;  1I1S A;  3O6B B;  1Y39 A;  3E6C C;  3JRH A;  1I27 A;  2XRN A;  1FC3 A;  1MMG A;  2PEX A;  3SZP A;  5ICF A;  4GYG A;  1A5J A;  3HHH A;  1S3J A;  3KEO A;  2V79 A;  2NYX A;  3AFH A;  3WTY C;  2LVS A;  1WWX A;  2DDA A;  1MMN A;  2JK3 A;  2EBI A;  3ROU A;  3ZMU A;  3ZQ7 A;  1AOY A;  5M5Y J;  2UUZ A;  1L3L A;  2BVM A;  1ODD A;  1Z1D A;  2WAD A;  3CCL I;  3OYF A;  4UXN A;  1U8B A;  1S72 I;  4J00 A;  3I5U A;  2KL4 A;  1FOY A;  2MSY A;  5JFR A;  1FBU A;  5TIS C;  4U88 A;  3OV8 A;  3C1D A;  1LDK B;  3QU3 A;  1GVJ A;  1OCP A;  2CS3 A;  2IPQ X;  4CCJ A;  2F4I A;  4XOP A;  5B3S H;  2D5V A;  1ONV A;  4UUS B;  4WF2 A;  5F6F A;  5LGT A;  2X85 A;  4HX8 A;  1TWH J;  5IYD J;  2WV0 A;  1RNL A;  5FKO A;  5F1J A;  2L9R A;  4H0E A;  2M5W A;  2E1C A;  1W5S A;  2LY1 A;  2QQ8 A;  4ETS A;  5FD6 A;  3JR9 A;  2W48 A;  3DCF A;  3ABK H;  3I64 A;  3V4G A;  3FXQ A;  2VE8 A;  3FHZ A;  4BH9 A;  4KNY A;  3VYS B;  1CF7 B;  1IO2 A;  3E6M A;  4XLN F;  5CLS A;  4E6K G;  2MH9 A;  3B6C A;  3KP4 A;  1HF0 A;  5LHG A;  2RDP A;  3HOS A;  1WGX A;  3K4J A;  4XKV A;  4HST A;  1G4D A;  3ZGK A;  3DPL C;  1ZTR A;  4M9S A;  1J75 A;  1ETV A;  2JUC A;  3RI4 A;  1T0F C;  2HTJ A;  4MEX F;  2VOP A;  2YUS A;  4B1R A;  3HSF A;  4A3G J;  1MDM B;  4QWQ A;  1F4K A;  3S15 J;  1D1C A;  1IC8 A;  3HBL A;  4B4C A;  2VT2 A;  5J1U A;  2EFO A;  2XAF A;  1UHM A;  5EJC A;  3ZQI A;  4A12 A;  1S9H A;  1YIJ I;  3K7A J;  2IW5 A;  2ZFW A;  4A3K J;  1X58 A;  1SFO J;  2A07 F;  1Y1V J;  3H0G J;  3CQZ J;  3UKG A;  5DS9 A;  1FMV A;  5KNL A;  2EFN A;  3NWS A;  2LYC A;  2CJJ A;  1MJA A;  2FSW A;  2IJL A;  4CCL A;  2NNY A;  2DMN A;  3C2B A;  4U0W A;  1EH8 A;  1PUF A;  1GT0 C;  2IGO A;  2Y0S N;  1VQK I;  2CWE A;  4MEY F;  2PX9 A;  3IP4 B;  3LSH A;  4HF2 A;  2OAZ A;  4YFN F;  1W36 D;  1RUN A;  1UFM A;  1AKH B;  4I0A A;  3I3L A;  4MTD A;  4RS8 A;  2VC1 A;  3AG1 H;  4F55 A;  2O6G E;  1B59 A;  1ON2 A;  4OAY A;  3OL4 A;  1NK3 P;  3TP3 A;  2CQK A;  4CCO A;  4G9Y A;  4KA4 A;  2RV8 A;  1POG A;  5LEK A;  4CCM A;  4A93 J;  1CGP A;  3QP6 A;  3BG9 A;  1HLV A;  5GAE J;  4XLC A;  1EA3 A;  1TQP A;  2E36 A;  3E6B A;  3DFG A;  2LBF B;  3JSP A;  4WXH A;  1FPQ A;  1PYV A;  3QQA A;  2FEZ A;  4D5F A;  2M30 A;  1JTY A;  4CYD A;  2E2I J;  1TNS A;  3RYP A;  2E7W A;  3BQZ A;  2ZME C;  3K4C A;  1JJ6 C;  1V54 H;  1P92 A;  4M6Y A;  5D5X B;  3RZD J;  1JTX A;  2M34 A;  3EUK L;  2Y9Z A;  1DPU A;  1LQ1 A;  1MH4 A;  1SMY F;  1NHA A;  1BI1 A;  5L3B A;  2V1N A;  4N9I A;  3LL7 A;  2E2H J;  4ABZ A;  3HUG A;  2VPR A;  5DUI A;  4V2F A;  1E17 A;  3K10 A;  3LOC A;  3RQI A;  3HOY J;  1BC7 C;  2ADU A;  1HC8 A;  2ZO4 A;  2WAE A;  4LIT A;  2P8T A;  4KIB A;  4ZTJ A;  1UHS A;  1MJB A;  3TL4 X;  4XLH A;  3S2H J;  3WTU C;  4EJT A;  4WCG A;  2EIM H;  3L00 A;  4C30 A;  3OIP A;  5E3O A;  1IN6 A;  4XIC A;  3MZH A;  1V5F A;  3HKZ A;  1PP8 F;  2NS8 A;  2R4G A;  4GRI A;  4BXF A;  3CLQ A;  4HZF A;  5HDK A;  1GDT A;  2L7F P;  1QVT A;  2JA2 A;  2OF7 A;  3LAJ A;  4HNV A;  2PJP A;  4G7O F;  2CW8 A;  1DP3 A;  3FHN A;  3BTC A;  3EUH C;  2ZJ2 A;  1YJW I;  1REP C;  4A69 C;  1YYV A;  3LQQ A;  4C2T A;  2ID6 A;  3WGH A;  3GTM J;  2L7K A;  3GW2 A;  4LMY A;  2Q1Z B;  1FBQ A;  1ORK A;  1UCR A;  2DLL A;  4U0V A;  2TDX A;  3TO9 A;  4M3B A;  4AYB N;  3I9V 2;  3A03 A;  2P5V A;  3CO7 C;  2X9D A;  2B9S A;  2A5W A;  1D1A A;  1ZAO A;  3I58 A;  2ZCW A;  3Q3S A;  3G2B A;  4DGW B;  5A2Q Z;  3BCB A;  1N75 A;  4OAZ A;  4CYC A;  1K4T A;  4ZDO A;  1ZLK A;  4M6X A;  5CJ9 A;  4PDK A;  3WOD F;  4YRV A;  3IHU A;  4FX4 A;  4B47 A;  5K7H A;  2P5L C;  3X2Q H;  2BHZ A;  2HDC A;  5CYV A;  4NBQ A;  4ZZL A;  3TO6 A;  4AIK A;  1WKM A;  3M9A A;  3SHF A;  3VYU B;  3GTG J;  3KEQ A;  5F0H A;  1XPX A;  1OCC H;  3OYE A;  1W5C C;  3W2V A;  2CGP A;  2CU7 A;  4MTE A;  2HYF A;  4XN3 A;  2OU2 A;  2NOG A;  3K9T A;  1R49 A;  4BU2 A;  2HOA A;  2K3P A;  3GFL A;  3U1K A;  2VKV A;  2NVX J;  2E1N A;  3OMY A;  1LFP A;  4EQQ A;  3L2W A;  3BRO A;  2JVH A;  5TJJ A;  1H8A C;  4Y7N J;  4BQQ A;  3EPZ A;  2FNA A;  2LNB A;  3BJO A;  3IKT A;  1BW5 A;  2O7O A;  4MHG A;  4KT5 C;  1U78 A;  5F04 A;  3GZN B;  2CRG A;  2Y9Y A;  3NAR A;  1J9I A;  1EV7 A;  2C6Y A;  2HWV A;  2DBB A;  2L2O A;  3PSI A;  1X3W B;  2Y48 A;  2X1E A;  3DEW A;  2JN6 A;  2YU3 A;  4ENN A;  1PUF B;  2VE9 A;  2CV1 A;  3GF2 A;  1BIB A;  1WJA A;  1JUP A;  2M1B A;  4PFO A;  1MD0 A;  1Y56 A;  2IGK A;  4WK8 F;  3IH3 A;  5E1W A;  5LHI A;  1SFX A;  1F9N A;  4LGW A;  3JRI A;  1LNW A;  2N8G A;  4AID A;  4UHT A;  3OSG A;  3OR2 C;  2CSO A;  3K4L A;  1XGO A;  3ZCO A;  3QP5 A;  4IHY A;  3BG5 A;  3FKJ A;  2ZXI A;  3J7Y J;  3Q0W A;  4YEJ A;  3V7C A;  4A6D A;  4LK1 F;  2XC7 A;  1WCM J;  3GLX A;  3KP6 A;  3G3Z A;  4L5J A;  1WPK A;  3S1M J;  2LFB A;  3TBI A;  2GA1 A;  2J5P A;  3DV8 A;  4FE7 A;  5M3M J;  2WWY A;  2W4S A;  2DA3 A;  3S1R J;  1KU2 A;  4HF0 A;  5KCM A;  2ICW G;  1HDD C;  4KN4 X;  4NDL A;  5E3N A;  2JPC A;  3BR0 A;  4EEF G;  2HEO A;  2P6T A;  3BLY A;  2VIX A;  1EKE A;  1WH5 A;  5LEJ A;  2HVR A;  1ZG1 A;  5BPI A;  3R60 A;  1ZK8 A;  3FDY A;  1OJL A;  3Q5F A;  2QSF X;  3FXU A;  2B0L A;  2V1X A;  3W3C A;  1MBK A;  2O9L A;  4G6Q A;  3LSM A;  3RKW A;  4ZJZ A;  3CUO A;  3BCA A;  1K6Y A;  1W7P A;  2VJJ A;  2HZD A;  4LIV A;  2E1M C;  2X1D A;  2LF8 A;  3S93 A;  1G3Y A;  1X19 A;  4L0Y B;  3DKW A;  2FQ3 A;  4KT6 A;  3BTI A;  2XKP A;  3ERE D;  3I53 A;  1YE9 A;  3H3V K;  3AL0 C;  2L7Z A;  2G9W A;  5FKN A;  1E3H A;  2CUJ A;  5EGO B;  3D1N I;  2HS5 A;  2PMU A;  4AIH A;  1IGN A;  2XVC A;  3OYG A;  1TP4 A;  2CMP A;  3HEF A;  3HM5 A;  4JX6 A;  4ZYA A;  1Y0U A;  2K02 A;  4A5N A;  5DCM B;  1ZN2 A;  1BW6 A;  3SJM A;  4A3M J;  1UAA A;  1UMQ A;  3F9K A;  3SDB A;  3G4S I;  2F5D A;  3VPR A;  2GZW A;  4QTR A;  3HTS B;  2ESH A;  1KZH A;  1JHH A;  5HVQ C;  3WU2 C;  1TWA J;  2VN2 A;  1I5Z A;  3RPU A;  3DEU A;  3MZY A;  1ZQ3 P;  2BYV E;  2DA7 A;  1RKW A;  4E7I A;  1IRZ A;  2F5C A;  1YI2 I;  1MSE C;  4CYC B;  1O4X A;  1FWZ A;  2R7F A;  4Q5S F;  2E7X A;  1LUJ B;  3ASN H;  4XSX F;  3HOX J;  1HSJ A;  1X1D A;  4ZC3 A;  2OD5 A;  3OYJ A;  3F6V A;  1FT9 A;  2DOE A;  4IZZ A;  4PFP A;  3CDH A;  5FRM A;  1VQO I;  1FIP A;  2GAU A;  1NG6 A;  4JBA A;  2IA0 A;  1B4A A;  5DM6 F;  2A69 F;  3MKW B;  3BR1 A;  1UJ8 A;  1QGP A;  3DBL B;  3CCJ I;  1XTA A;  4A3D J;  1X1P A;  3A0H C;  4N4O B;  4IO9 F;  3ESW B;  5JLX A;  1IXC A;  3CO6 C;  4EJU A;  5GAH J;  3J81 K;  1Z77 A;  3P9I A;  1RPW A;  1RIO H;  3BTL A;  3SEQ A;  3F3X A;  2Y30 A;  2O8K A;  1T2K A;  1YS6 A;  2ACJ A;  2ZBK A;  1OCZ H;  2XDV A;  4WWC A;  3JRA A;  2STT A;  4E7L A;  4KN7 X;  3V42 A;  3SYT A;  1GXQ A;  3K69 A;  2E60 A;  3G73 A;  3WTX C;  4V19 K;  4OMY A;  2VJI A;  3FM3 A;  5F64 A;  4UB6 C;  1LEB A;  5B1B H;  1J0R A;  3KYD B;  2HYJ A;  3TQN A;  2L0K A;  2W82 A;  4CO8 A;  3COA C;  5FGM A;  2KFD A;  3TP0 A;  1WSU A;  2XPW A;  1JXS A;  4LOC A;  1S7O A;  3QU6 A;  4N4N B;  4ESB A;  1Y1W J;  1PP7 U;  4RLF A;  2A68 F;  5D6F A;  2FOK A;  1BOB A;  4BYY A;  2OPT A;  3OY9 A;  1DDN A;  3NAU A;  1V5G A;  1ZGA A;  4A3I J;  4IOC F;  2ECB A;  5IPA A;  2G7H A;  2XGC A;  2AXT C;  5K7F A;  3S1N J;  4KJZ A;  4QPO A;  3DU5 A;  3RDI A;  2COM A;  1MMA A;  3FMS A;  3QYF A;  3GTP J;  2DN0 A;  3R0J A;  1K78 A;  4PJM A;  2IAI A;  2KKO A;  4IKF A;  5F0F A;  1TW2 A;  4II3 A;  2L9N A;  2XKO A;  3LST A;  1JT6 A;  2ZNZ A;  3FXJ A;  1OYY A;  3ZP5 A;  1TWF J;  2DTZ A;  1YJN I;  2XAQ A;  2W57 A;  3T5X A;  2V6E A;  3K70 D;  1A31 A;  1USS A;  4HF1 A;  3DKY A;  2R7W A;  2OZ6 A;  2GIZ A;  2V1U A;  4W97 A;  4L18 B;  2DFH A;  2YPR A;  3LFK A;  2BY1 A;  3FXO A;  2BW3 A;  2YR2 A;  3VYR B;  4Y15 A;  2V26 A;  2EV5 A;  4S0H B;  1FP1 D;  4O3M A;  1Z21 A;  4JOM A;  3F21 A;  4M3G A;  2RQQ A;  4BS9 A;  1K61 A;  3K0L A;  4ANJ A;  2HOS A;  3CC4 I;  3S16 J;  5DEQ A;  4EJW A;  2IGN A;  5D8K B;  3N4M A;  5C4J J;  2YX7 A;  1TWG J;  3ZOB A;  1VTN C;  2BY0 A;  1RUO A;  4KYW A;  3M1E A;  4IJA A;  2Y2Z A;  1U6G A;  2FOW A;  2DPD A;  3B6A A;  4JYK A;  4G12 A;  2XPV A;  1QBJ A;  3ELK A;  5FO5 A;  3F8M A;  4DJA A;  1OYI A;  2DFE A;  1HOM A;  3CJQ B;  1QHG A;  3G1M A;  2K85 A;  2ZME B;  2EQR A;  4BQA A;  2Z2S B;  2DA2 A;  3IL2 A;  1Z3X A;  1AWC A;  2GM4 A;  2CV0 A;  4M73 A;  3TDZ C;  3SZG A;  3HOV J;  4LG0 B;  4JP0 A;  4PGH A;  3MAJ A;  2QKM B;  1WI9 A;  1BI3 A;  2W24 A;  2ZSH B;  3ZXS A;  2JRM A;  5EDN A;  3U1D A;  2MLK A;  4GDF A;  2XF6 A;  3KP2 A;  1W0T A;  2VJ4 A;  3BG7 A;  4E7H A;  4FIS A;  3I4M J;  3GX4 X;  3F8C A;  4B3X A;  2F2E A;  1SVL A;  1BR1 A;  1XX5 A;  2H09 A;  1G3T A;  1KON A;  3BG3 A;  3BZC A;  1XG1 A;  4FX0 A;  4A0X A;  4BDY A;  2GA2 A;  4AVP A;  1OCT C;  3PQK A;  1I50 J;  2K9Q A;  1ETW A;  2JPB A;  3H3U A;  3GCM A;  1R58 A;  4AD9 A;  1SFK A;  4ZDL A;  2IS4 A;  4X6A J;  1D8K A;  3LNQ A;  1APL C;  1TC3 C;  1TWC J;  3VOE A;  5DM7 F;  1X1A A;  4AWX B;  2AQF A;  2DA5 A;  4I99 C;  2QA4 I;  2HDD A;  1R5H A;  4ON0 A;  2LY2 A;  1AA7 A;  3QPH A;  2D1V A;  4WX9 A;  2QWW A;  4RGX A;  4C3I J;  2M9H A;  4RB2 C;  3AKZ A;  4L5I A;  1WQ2 A;  5GPA A;  2A6H F;  2H8W A;  1BR2 A;  2KP6 A;  1QRY A;  2BV6 A;  4Y13 A;  1IN8 A;  2EV0 A;  5FLX K;  3GUD A;  5HLG A;  2NVQ J;  4A3L J;  3FK7 A;  1T8I A;  5F1R A;  4DYC A;  2F4O B;  2KMU A;  2O5R A;  1FYL A;  1FBS A;  3UR3 C;  2LSO A;  2X1C A;  2DQR A;  4AIJ A;  2ELJ A;  3HZJ A;  1FLI A;  1S29 A;  2PN6 A;  5ILV A;  3DQV C;  5HLH A;  1GHC A;  2X4H A;  1U2W A;  1ULY A;  3DXJ F;  1RZ4 A;  1S7E A;  5E3L A;  5ED4 A;  4OIP F;  3FX3 A;  1E3O C;  1W1W E;  4KFC A;  4J01 A;  3BT9 A;  1ITY A;  3WGG A;  5EG0 A;  1PVE A;  2WB1 A;  5C3E J;  1AU7 A;  2RKH A;  3PNY A;  1IUF A;  3DPU A;  2PFB A;  2ZKZ A;  4HBL A;  5J6X A;  5C44 J;  3DF8 A;  2QGU A;  4LB5 A;  1K78 B;  4I76 A;  2KRF A;  3QPS A;  5CKT A;  2QQ9 A;  1JUM A;  1WRJ A;  1IXS B;  1YRN A;  1R1T A;  1FP2 A;  2PJR A;  4DZJ A;  2VON A;  3QAH A;  2EA4 A;  1TTY A;  3GWZ A;  3BZK A;  4J19 A;  1EH6 A;  4IHV A;  1FJL A;  3J81 Z;  4C9Y A;  3VWB A;  2JSC A;  2R7Z J;  1YIO A;  1O3S A;  1MKM A;  2JSP A;  4BEH B;  2P4W A;  3LA3 A;  4OIN F;  1R71 A;  1HKS A;  1ZEL A;  2M7A A;  4AC0 A;  1Q1H A;  2P6S A;  3HDD A;  3MKL A;  4IF4 A;  1MBF A;  5GP9 A;  4B43 A;  2HVQ A;  1Z3Y A;  1WVR A;  3IC7 A;  2BVL A;  3L2R A;  3H3Z A;  5B5E C;  4HRI A;  3E5Q A;  2LRD A;  2WV1 A;  3HGG A;  1YS7 A;  3M7G A;  1R00 A;  3ABM H;  1W7P D;  2ZXH A;  3FBI B;  3RYR A;  3CCS I;  5BMZ A;  4XM3 A;  2KHM A;  3PQJ A;  5DD8 A;  3CCV I;  5J1Y A;  3IWZ A;  3PFI A;  4U7D A;  3U21 A;  4KIC A;  3V7S A;  1HBX G;  1TW3 A;  2IGM A;  4ZDP A;  4HDV A;  1F5T A;  3V8K A;  4BE2 A;  1NTC A;  1XN7 A;  4RMN A;  2EIN H;  2P7C B;  1K4S A;  1X1C A;  2HQR A;  2KIS A;  1I1G A;  2XUB A;  2LC2 A;  5JHU A;  1HQC A;  3EUA A;  2OBP A;  2O8X A;  1MNM C;  2VBW A;  1XSX A;  1MBE A;  3L2Q A;  5IOY A;  1D0X A;  2OA4 A;  3L7W A;  4RAZ A;  3OS0 A;  4IRG A;  3VYT B;  1NG7 A;  3KX2 A;  3ZMD A;  5CVJ A;  2LR8 A;  3HKZ N;  5IYC J;  4RLQ A;  2GQQ A;  4MLO A;  2CW0 F;  3RPU D;  2E1M B;  2QQB A;  2O0Y A;  4N0B A;  1PDN C;  3O8G A;  1VQ8 I;  2X6X A;  4RAF A;  1PUE E;  1EJ9 A;  4L9V A;  1UG0 A;  5HLI A;  3AL0 B;  2IT0 A;  3SDG A;  2MBF A;  1JJ8 C;  1DGR M;  2KDO A;  2L7M P;  3U9G A;  3OYK A;  4CDG A;  2VBX A;  1P4A A;  1RKT A;  3DPT A;  4HAM A;  3VFZ A;  2QBY A;  2KIM A;  1W36 C;  1ACI A;  3H5N A;  3ZN1 A;  1JKP C;  2DT7 B;  2QVO A;  5ICG A;  4DQ2 A;  4C2U A;  3HRM A;  6PAX A;  4CA0 A;  3KP5 A;  3AG3 H;  2DA6 A;  2EB7 A;  2XAH A;  3EYI A;  1XB4 A;  2R7S A;  4PJJ A;  3GZ6 A;  5E1Z B;  1Z6T A;  4JQF A;  1UG2 A;  5FKM A;  2R5Z A;  3OR1 C;  1H89 C;  1WJC A;  3O3K A;  3S8P A;  2NRA C;  2D1H A;  1RI7 A;  3KYL A;  3EET A;  5E17 F;  1UST A;  1H9G A;  1IV6 A;  5AIP A;  2DT5 A;  3BTJ A;  3KLN A;  2NOJ B;  3TW7 A;  2ISZ A;  1LE8 A;  3RKQ A;  2EV6 A;  1X4P A;  1KYZ A;  1BA5 A;  3NEU A;  4WXD A;  4CCN A;  3PIO F;  4YFK F;  2CO5 A;  2LTP A;  2Z16 A;  4P5O A;  2HXO A;  2Y0M A;  2K27 A;  1OCR H;  2OCC H;  4OMZ A;  3VOD A;  3OYB A;  4YII A;  3VSL A;  2XF7 A;  3HRS A;  2G0E A;  2ELK A;  1DUX C;  1B9M A;  4KIF A;  4JK1 X;  1HKT A;  1X3Z B;  3SZT A;  5M3F J;  2IS6 A;  2FNP A;  1ETO A;  3T8T A;  3CES A;  1IJW C;  2COB A;  3RSN A;  1X2N A;  1FY7 A;  2EZK A;  3BC8 A;  4DIQ A;  2IVM A;  4D9J A;  4ESJ A;  1S5L C;  1MW7 A;  3LSG A;  2PG4 A;  4CCK A;  2KRH A;  4JX5 A;  2MW8 A;  2LKP A;  3CMA I;  5M5X J;  4HV5 A;  3CUQ A;  3KP3 A;  3G1O A;  1U9O A;  3J7A Y;  3D5L A;  1HW5 A;  3HC7 A;  1VQ7 I;  2H6B A;  2LDU A;  3WTV C;  1T38 A;  3F8N A;  3RKX A;  2QQA A;  4HPQ A;  1IN5 A;  2DK8 A;  3NQO A;  3T1B A;  3BY6 A;  5FLV A;  4UUT A;  3VEP A;  4ENK A;  5ICE A;  4FQG A;  1G8X A;  5D6E A;  4I02 A;  4BY7 J;  2AQE A;  2XF5 A;  3RIR A;  2ETH A;  3BOQ A;  3OYM A;  3M3Y J;  4S04 A;  5FLX Z;  3OIO A;  1P6R A;  5L3C A;  4WXC A;  5JVG F;  2QYO A;  4E7J A;  3ZQG A;  4ZTF A;  2CYY A;  3QPT A;  2M8G X;  3KET A;  5TGT A;  4A0Y A;  1FIA A;  1K83 J;  1LB2 A;  3PFY A;  3E97 A;  3HTU A;  3LA2 A;  3RKY A;  2M4K A;  2L9S A;  4XRM A;  2Z1D A;  3S2W A;  4D7N A;  3H5R A;  3O8H A;  1R4N B;  1T6S A;  3VDX A;  5D5U B;  5CQE A;  1QPM A;  3ZQF A;  3JAM K;  3GLL A;  3PL8 A;  3DEE A;  4PJL A;  1I3A A;  1J09 A;  3FKI J;  1BJZ A;  4QIW N;  3WGI A;  3ABT A;  1U5T A;  2XGX A;  2XIG A;  2KZG A;  5FFZ A;  3HGY A;  2OUM A;  1KU9 A;  4BKX A;  4R79 A;  3BDD A;  3CME I;  2JRT A;  5K5O A;  4BNC A;  1U0J A;  2HXI A;  4L9T A;  1XGN A;  3CCY A;  3K1M A;  3I56 I;  1GV5 A;  2ZFU A;  3F72 A;  4Y52 J;  3SFZ A;  2ME0 A;  3I59 A;  5GTH C;  1IZ1 A;  5EEG A;  5CQG A;  5AIQ A;  4LLN A;  1DPR A;  1T95 A;  3A01 A;  3O2P E;  4BJT A;  4BE0 A;  1R1U A;  2CH0 A;  2FD5 A;  2FBH A;  5CVU A;  1BR4 A;  1R6R A;  5B1A H;  1YFH A;  2YS9 A;  1YHQ I;  3ULQ B;  2F6C A;  3WHB A;  4U87 A;  2LK2 A;  5JHF A;  2DMU A;  2K9L A;  2F5E A;  2G7U A;  4M9X A;  5LGN A;  5HNF A;  2Y31 A;  3BJ6 A;  3PUF A;  3GFJ A;  3CJN A;  2QLZ A;  3PNV A;  1FNN A;  2RQP A;  3OL3 A;  2VQG A;  1ZHF A;  2KJC A;  4IRH A;  5LRR A;  1XCB A;  1KU3 A;  5FB2 A;  1SD4 A;  2M87 A;  3E3V A;  4EM0 B;  2DYR H;  5DDG A;  4XRS G;  1SD7 A;  4MFE A;  4IQJ A;  2K4B A;  2L4M A;  3KZY A;  2QUF A;  2A6T A;  1V55 H;  3CP8 A;  4B44 A;  3HUG B;  2R5Z B;  3DU6 A;  3Q9S A;  5ILU A;  2MGQ A;  3LMM A;  3MCZ A;  1XS9 A;  2EZL A;  1SFE A;  1IDY A;  3HSR A;  3KPH A;  1B72 A;  2KQR A;  2DJN A;  3DBH B;  1XSD A;  1R22 A;  1R23 A;  2V1D A;  2ISY A;  2Q2E A;  2EFQ A;  3OS2 A;  3AAF A;  1BJA A;  4FAS D;  3C2H A;  2LOO A;  3ZQC A;  3AG4 H;  3OIQ A;  1SVO A;  5LHH A;  1XSV A;  1VI0 A;  4A3B J;  3OYI A;  1OCO H;  4LFU A;  1QNT A;  1KGS A;  3K1N A;  3WU1 B;  3F6O A;  3GVA A;  3PO2 J;  4QLC U;  3JTH A;  4M71 A;  5GAD J;  3IH4 A;  3LSP A;  2OQR A;  3CCR I;  4F3Q A;  2PMH A;  3KYC B;  2FMY A;  4RDU A;  3CCM I;  3ZN0 A;  2VOD A;  3TED A;  4GFB A;  1D3Y A;  2DW4 A;  3M1C A;  2VAS A;  3H0D A;  4IQ4 A;  1XGS A;  2X51 A;  2MYS A;  1KQ0 A;  4C3J J;  2RC4 A;  1J59 A;  4D5C A;  2IXS A;  3M07 A;  3W2W A;  3A02 A;  2GLO A;  4FE4 A;  3NWT A;  2R5Y A;  3FMR A;  1Y6I A;  4IXA A;  2Z33 A;  3BWG A;  4K2E A;  3CP2 A;  4HSR A;  4I7H A;  1DP7 P;  3F8F A;  1ZGW A;  5J3L A;  4S05 A;  2FRH A;  3PNT A;  3LFU A;  3OS1 A;  2JVG A;  3KZZ A;  4A3F J;  4P1W A;  1Z9C A;  4ENM A;  2FJ1 A;  4EMS A;  2HDW A;  1T08 B;  3H36 A;  3MQ0 A;  5JLW A;  4E70 A;  3QPL A;  4F7Z A;  3RCO A;  5E3M A;  4DYR A;  3L2U A;  4LB6 B;  3C18 A;  2XAU A;  3UNG C;  1D5V A;  1HCR A;  4RAG A;  1IXR C;  2X0L A;  4A5M A;  2WC2 A;  4Y3O A;  2IP2 A;  4IHX A;  5FKL A;  1EF4 A;  2NNN A;  4HYE A;  2EFW A;  3CF5 F;  1WZ2 A;  3I55 I;  3OYH A;  4RGS A;  1FMW A;  4L5E A;  1YG2 A;  2GOM A;  4MO7 A;  3R4K A;  2PMZ A;  1YW9 A;  3WE2 A;  2WAQ A;  5EEA A;  3FIW A;  1GLN A;  2R7O A;  3QRF F;  4NHJ A;  3QYB A;  4L9N A;  3K4N A;  1LPQ A;  2DQL A;  3JSO A;  4LD5 A;  2LD5 A;  5H20 A;  3IRQ A;  2XPU A;  4M3F A;  1FZP B;  3CMY A;  2MC3 A;  2W85 A;  3Q0V A;  1YO5 C;  1ZR4 A;  2DMQ A;  3J80 K;  2X6O A;  5J1R A;  2VB6 A;  2R7U A;  3LSJ A;  3ISP A;  2V9V A;  2EIL H;  3TW6 A;  3N97 A;  3ZMZ A;  3I59 B;  3MVP A;  4XOR A;  1QHH D;  1GXP A;  5TRD A;  3CJT B;  3C2G A;  1QZZ A;  1TT5 B;  4F93 B;  4PUS A;  1QZY A;  9ANT A;  5DD4 A;  2DMP A;  4DNC A;  1XDS A;  1R9T J;  1SFU A;  1H0M A;  2EIK H;  2ID3 A;  1TBX A;  3GXO A;  2EPF A;  4AU7 A;  5J8F A;  2W1O A;  5HOD A;  1VND A;  2KDZ A;  3ZMS A;  2W84 A;  3SFI A;  2L5Q A;  4CZZ A;  3ASO H;  5F0C A;  2JTV A;  3I4N J;  2ZSI B;  2VJ5 A;  2IS1 A;  1FYM A;  2BY2 A;  4PZJ A;  3PIP F;  3S17 J;  2EFP A;  2RNJ A;  4BAC A;  2GWR A;  4R1H A;  2XSJ C;  1K7A A;  1E0E A;  2MC4 A;  1YW8 A;  3DLA A;  4PJN A;  5EF6 A;  1H9T A;  4EJO A;  1G3W A;  4Y4R A;  2DOF A;  3A0B C;  2A3S A;  3JAM Z;  3GME A;  3MWM A;  1BOA A;  4DW6 A;  2QEX I;  1Z0X A;  2CV2 A;  2HNH A;  3KZI C;  3E7L A;  2M3A A;  2FA5 A;  1OMI A;  1A6I A;  3MKZ A;  3K2Z A;  2NAZ A;  4I98 B;  5E8G A;  1GVD A;  1W7P B;  1B72 B;  2IA2 A;  2X48 A;  2K40 A;  2BHY A;  4BHB A;  1P7J A;  1VZ0 A;  4F91 B;  3J7Z I;  2Q8K A;  1O57 A;  1FSH A;  2HPI A;  3FXK A;  4MGR A;  4KIT B;  3WHC A;  3JW4 A;  2FBI A;  4LIU A;  1I6X A;  2FML A;  2CFO A;  2MD5 A;  2LKX A;  3DKX A;  3K70 C;  5LRS A;  5FFX A;  1IF1 A;  2YU9 J;  2UXX A;  2JZY A;  2RAE A;  4D1Q A;  1MDM A;  1HXD A;  4O5V A;  4YFX F;  1WJ5 A;  5K7Z A;  3EYY A;  3BZ6 A;  4BHC A;  4MIM A;  1LDD A;  1ON1 A;  2RGV A;  1QVU A;  1WJE A;  4HX4 A;  4IVN A;  1QQI A;  4CXF A;  2BZT A;  2QF7 A;  1FX7 A;  4NNJ A;  1MBH A;  2VI6 A;  1QU3 A;  1JKO C;  2VQH A;  2XGD A;  3RTR A;  1MSF C;  1HST A;  4OIQ F;  3KCC A;  4CUG A;  3JRD A;  3MFK A;  1YQA A;  2VUM J;  1FTT A;  3FK6 A;  3B73 A;  2HOE A;  3KE2 A;  3BR3 A;  4HV6 A;  4XKC A;  3BPV A;  2ZJR F;  2WY8 Q;  2HQA A;  3OYA A;  1XDU A;  2FX0 A;  2BOL A;  2WB1 N;  4GXO A;  2QSH X;  2FE3 A;  2AHQ A;  1I6H J;  2LF7 A;  3WTZ A;  3K4B A;  5E8I A;  1Y8Q B;  2HKO A;  4ZYD A;  2JQ7 A;  3GTJ J;  4GCV A;  4IHW A;  1LKX A;  5DTD A;  1XD7 A;  1J5Y A;  3DP7 A;  2LKS A;  4EJV A;  4HLY A;  4XLE A;  2EZH A;  2HYG D;  3HB9 A;  1LDJ A;  1WJF A;  3QOD A;  5F27 A;  2KIU A;  3C7J A;  4DBQ A;  3F23 A;  4IRI A;  3S14 J;  3JCU C;  3GTL J;  2DFF A;  4NC7 A;  1S6L A;  4FCY A;  1ZKG A;  2KLO A;  2XSD C;  3CDI A;  2W00 A;  4NQW A;  1SC7 A;  3S32 A;  4UVC A;  1RR7 A;  1OFC X;  3CJR B;  4B09 A;  4OIO F;  4A3C J;  4XN0 A;  3OYN A;  3CUQ C;  4Z6Y A;  4BBR J;  2DI3 A;  4F92 B;  1U3E M;  1G59 A;  3GFI A;  2O61 A;  3FBN B;  1NK2 P;  3M8J A;  2M0M A;  2F48 A;  1JT0 A;  2IRF G;  3P9K A;  3W2A A;  2BXZ A;  1YX5 A;  3NRV A;  1MJ9 A;  4BGD A;  1U8R A;  3L1P A;  2OV7 A;  1G2H A;  4DBR A;  2I8D A;  5IP7 J;  4KMU X;  1X4O A;  2DU9 A;  4XKB A;  4BE1 A;  1MMS A;  1YTY A;  5BS6 A;  4P55 A;  4XK4 A;  3ZPL A;  4G6T B;  4G8X A;  3IAS 2;  2GBY A;  2L02 A;  2BE5 F;  4UUV A;  3PSF A;  3SEZ A;  5HS7 A;  3D5S C;  2K86 A;  2DDB A;  2XRO A;  2WY7 Q;  1G3S A;  1JGG A;  1VF9 A;  2D45 A;  4ESF A;  1T33 A;  2CFX A;  3PJR A;  3S1Q J;  3DTE A;  4A6E A;  5LD2 C;  4HQM A;  4BUP A;  3J7A O;  1QA6 A;  1Z7L A;  1SD6 A;  5KHD A;  2DTR A;  2MA3 A;  1SEU A;  2M4G A;  1VQ5 I;  3LSR A;  3K4K A;  2VOO A;  4EM2 A;  5L3G A;  2KPM A;  3ERM A;  5E79 C;  1DU6 A;  4RM3 A;  4ITV A;  2JWT A;  4NC8 A;  1U5T C;  1IG7 A;  2IBD A;  1ZRC A;  2JJ7 A;  3V8L A;  1ZYR F;  1IN7 A;  2R92 J;  2NVT J;  3WTT C;  1ZG5 A;  1TT0 A;  1UB9 A;  3K6G A;  1MBG A;  3CTA A;  2R7D A;  4ZZD A;  4RB1 A;  4I0B A; 
#chains in the Genus database with same CATH homology
 4EM1 A;  1YW7 A;  3HHG A;  2RVC A;  4MQV A;  2VBY A;  2H94 A;  4UVB A;  5BPD A;  1R1V A;  1SMT A;  4B8X A;  3J80 Z;  4I09 A;  4HLX A;  1V4R A;  2L3D A;  4ZYH A;  2A6E F;  1HKQ A;  5L3F A;  1LJ9 A;  1KU7 A;  3HRT A;  3GFM A;  1L0O C;  1XMK A;  2HKX A;  3I54 A;  3BJA A;  3R61 A;  2VBZ A;  2DPU A;  5L3E A;  2OQG A;  5E18 F;  2FF4 A;  2KIF A;  3IRR A;  2JT1 A;  2UZK A;  3WTS C;  2R3S A;  4ENJ A;  3R6S A;  1O7L A;  4L0Z B;  4TV7 A;  4OIR F;  3LWF A;  3LQR A;  4IHS A;  4Q47 A;  2ESN A;  3Q9V A;  3U2R A;  3I4P A;  3ML6 A;  5BQT A;  1J2X A;  2GIV A;  3L09 A;  4RAY A;  1EH7 A;  1FSE A;  3W6K B;  5D8L B;  3GEZ A;  4U7B A;  1V3F A;  3MEX A;  1BBY A;  3M8F A;  2BEO A;  3F8B A;  2Z99 A;  5D5W B;  3B02 A;  2Z3Y A;  1IAW A;  5FD5 A;  3H92 A;  3ECO A;  1LVA A;  1O7F A;  3QOP A;  4HDU A;  4KIG A;  1XGM A;  1P4W A;  1TQI A;  1G6N A;  5LBQ A;  1Z7U A;  3TKY A;  1JE8 A;  4P96 A;  2M8E A;  1K79 A;  5AON A;  4G94 A;  4M9Z A;  3BPX A;  5DUK A;  1OPC A;  3TOA A;  3L2C A;  1JGS A;  5DCM A;  3CLO A;  2M45 A;  4RB0 A;  3D0S A;  3WE3 A;  3HYI A;  4EV0 A;  2AS5 F;  3L9F A;  4I01 A;  3LAP A;  2HZT A;  3FMQ A;  2BBY A;  1IRF A;  5JVT A;  2O03 A;  2WTE A;  2IA1 A;  3TO7 A;  3T8R A;  4M72 A;  2DAO A;  1ZLJ A;  1R36 A;  2YX4 A;  2VT3 A;  4G6D A;  3GO5 A;  3RPQ A;  2A61 A;  4U0Y A;  5DYM A;  1R7J A;  2FBK A;  3V7R A;  1STZ A;  3TDU C;  5HDN A;  1IUY A;  2HQN A;  2UXN A;  3BP8 A;  2STW A;  4ZYE A;  4EGZ A;  4KDP A;  3W6J B;  4Q4Z F;  4I2O A;  3FF5 A;  4M74 A;  5IT9 K;  5IT3 A;  4CIC A;  4XBF A;  1B1B A;  4PGG A;  1P4X A;  1O3Q A;  4O6J A;  2GXG A;  4BHP A;  3ZMV A;  5CVI A;  1Z91 A;  4HQE A;  3WTW C;  4KUM A;  1OYW A;  1O3T A;  5HDG A;  1KQ8 A;  2QM3 A;  1TQM A;  3GZ5 A;  4GGG A;  1FYK A;  4RB3 C;  4XSZ F;  2VXZ A;  4ZH4 F;  1T0F A;  1F1Z A;  4RGR A;  3IWF A;  2QBY B;  1B6A A;  3GYH X;  4MNU A;  2Z5U A;  4RGU A;  3OOP A;  2J5O A;  5K5R A;  4FHT A;  2XAS A;  5CVR A;  5ILS A;  4EGY A;  4FT8 A;  2BGC A;  1HW1 A;  3KFW X;  1IW7 F;  2DO7 A;  2Q0O A;  5JI6 A;  1KA8 A;  3C3W A;  3TOB A;  2Y75 A;  1HW2 A;  2DK5 A;  4Y17 A;  4XLP F;  1O3R A;  4Q48 A;  1YLF A;  3HSE A;  4XRF A;  5K1Y A;  4NB5 A;  1SD5 A;  2K7L A;  1IN4 A;  3RJP A;  1ZH5 A;  1ZG3 A;  1S7A A;  4HOB A;  3HIF A;  1XCV A;  3ECH A;  1BM9 A;  2CG4 A;  5BOX A;  2EA2 A;  1QO0 D;  1D8J A;  1R5G A;  4BXU A;  3CUQ B;  1FOK A;  1SAX A;  1MGT A;  5EEH A;  5HS9 A;  5D4R A;  2ZME A;  1BIA A;  5ICC A;  3TGN A;  5L3D A;  2HR3 A;  3EQL F;  5H6Q A;  4HA8 A;  2GXB A;  1IRG A;  4LG0 A;  1X3U A;  2F5F A;  2W25 A;  1S8N A;  1JHF A;  1XMA A;  4CHU A;  2D2W A;  4LLG F;  1W5T A;  3SQN A;  4CGZ A;  4N9H A;  4L9J A;  2K4J A;  2ZNY A;  5J8C A;  4LK0 F;  4UVA A;  5KK1 A;  4OOI A;  4OU0 A;  1U5T B;  4LJZ F;  2EJR A;  2UWM A;  1ZGJ A;  5K5Q A;  3P7N A;  3EUH A;  1BI2 A;  2QZ8 A;  3E5X A;  2XAJ A;  1OKR A;  3WG9 A;  2RN7 A;  2KJB A;  3EDP A;  2QEN A;  1C0W A;  2PI0 A;  2A5Y B;  2FU4 A;  3FZV A;  1Z05 A;  2OZU A;  4IPA A;  2FXA A;  5LLQ A;  4EVI A;  5HOO A;  3VB2 A;  1A04 A;  5DV5 A;  2HFH A;  3R0A A;  4D0P A;  3KLO A;  3WU0 A;  5DCF A;  5ERI A;  2H6C A;  2PBI A;  1OR7 A;  2L4A A;  2EWN A;  1ZRF A;  1ZRE A;  3SXY A;  1BI0 A;  1UHW A;  2O3F A;  3HOT A;  1TNT A;  1BC8 C;  3ZMT A;  4GO1 A;  3F22 A;  4A2U A;  3FXR A;  5IT9 Z;  4UV8 A;  1CF7 A;  4ZYG A;  2H27 A;  3REO A;  2NS0 A;  3V8J A;  4YIF A;  2ZXJ A;  5E1X A;  3KP7 A;  5HS8 A;  1ZRD A;  4P9U A;  2AXL A;  1T39 A;  4PCQ A;  4R8H A;  4A0Z A;  3FWE A;  3HRU A;  2YSR A;  2Z9O A;  4GYI A;  4KMF A;  4BAY A;  1Z6R A;  3E6D A;  3K1P A;  2P5K A;  2XAG A;  1TLH B;  3T0Y A;  2HGC A;  2XV4 S;  1BN5 A;  3LA7 A;  2PQ8 A;  5KVR A;  2DFI A;  5E20 A;  2PLY A;  3M8E A;  3ABU A;  1T98 A;  4ASN A;  2P7V B;  1KYW A;  3I0T A;  4Z2Y A;  5D4S A;  4HX7 A;  1W4M A;  2V6C A;  2EK5 A;  4MQ9 F;  3IKV A;  3JTG A;  2HTS A;  4P9F A;  1E2X A;  3E5U A;  1MZB A;  2XHK A;  5JR3 A;  1B9N A;  1J7K A;  4UNO A;  5LGU A;  2L54 A;  4UV9 A;  2MH2 A;  2ELH A;  3I71 A;  1K6O A;  5A2Q K;  2L01 A;  4LLL A;  3FM5 A;  2MLG A;  2VC0 A;  1ZAR A;  5CVV A;  4YG2 F;  5H6R A;  4G7H F;  3P9C A;  1LEA A;  1P2F A;  5D5V B;  4HW0 A;  4G7Z F;  4IHT A;  1KQ9 A;  1I1S A;  3O6B B;  3E6C C;  1I27 A;  2XRN A;  1FC3 A;  2PEX A;  3SZP A;  5ICF A;  4GYG A;  3HHH A;  1S3J A;  3KEO A;  2V79 A;  2NYX A;  3WTY C;  1WWX A;  3ROU A;  3ZMU A;  3ZQ7 A;  1AOY A;  1L3L A;  1ODD A;  1Z1D A;  4UXN A;  3I5U A;  5JFR A;  1FBU A;  4U88 A;  3OV8 A;  3C1D A;  1LDK B;  3QU3 A;  1GVJ A;  2IPQ X;  1ONV A;  4WF2 A;  5F6F A;  5LGT A;  4HX8 A;  2WV0 A;  1RNL A;  4H0E A;  2M5W A;  2E1C A;  1W5S A;  4ETS A;  5FD6 A;  3I64 A;  3V4G A;  3FXQ A;  2VE8 A;  3FHZ A;  4BH9 A;  4KNY A;  1CF7 B;  3E6M A;  4XLN F;  5CLS A;  2MH9 A;  3KP4 A;  5LHG A;  2RDP A;  3HOS A;  1G4D A;  3DPL C;  1J75 A;  4M9S A;  3RI4 A;  2HTJ A;  4MEX F;  2VOP A;  3HSF A;  1MDM B;  4QWQ A;  1F4K A;  2VT2 A;  2EFO A;  2XAF A;  1UHM A;  4A12 A;  2IW5 A;  2ZFW A;  2A07 F;  2EFN A;  1MJA A;  2FSW A;  2IJL A;  2NNY A;  4U0W A;  1EH8 A;  2CWE A;  4MEY F;  4HF2 A;  2OAZ A;  4YFN F;  1RUN A;  1UFM A;  4I0A A;  4MTD A;  4RS8 A;  2VC1 A;  2O6G E;  1B59 A;  1ON2 A;  2CQK A;  4G9Y A;  4KA4 A;  2RV8 A;  5LEK A;  1CGP A;  3QP6 A;  1TQP A;  3E6B A;  3DFG A;  3JSP A;  4WXH A;  1FPQ A;  2FEZ A;  2M30 A;  4CYD A;  1TNS A;  3RYP A;  2E7W A;  1P92 A;  4M6Y A;  5D5X B;  1DPU A;  1LQ1 A;  1SMY F;  1NHA A;  1BI1 A;  5L3B A;  4N9I A;  3HUG A;  5DUI A;  1E17 A;  1BC7 C;  2ADU A;  2ZO4 A;  2P8T A;  4KIB A;  1MJB A;  3WTU C;  4EJT A;  4WCG A;  3L00 A;  1IN6 A;  3MZH A;  1PP8 F;  4HZF A;  5HDK A;  3LAJ A;  2PJP A;  4G7O F;  1REP C;  2ZJ2 A;  1YYV A;  3LQQ A;  3WGH A;  3GW2 A;  4LMY A;  4U0V A;  1FBQ A;  1UCR A;  2DLL A;  2TDX A;  3TO9 A;  2P5V A;  3CO7 C;  1ZAO A;  3I58 A;  2ZCW A;  5A2Q Z;  1ZLK A;  4M6X A;  5CJ9 A;  4PDK A;  3WOD F;  4FX4 A;  3IHU A;  2P5L C;  2HDC A;  5CYV A;  4ZZL A;  3TO6 A;  4AIK A;  1WKM A;  3M9A A;  3SHF A;  3KEQ A;  2CGP A;  4MTE A;  2HYF A;  2OU2 A;  3K9T A;  3GFL A;  2E1N A;  4EQQ A;  3BRO A;  5TJJ A;  2FNA A;  2LNB A;  3BJO A;  3IKT A;  4MHG A;  4KT5 C;  1U78 A;  1J9I A;  1EV7 A;  2C6Y A;  2HWV A;  2DBB A;  2Y48 A;  2YU3 A;  4ENN A;  2VE9 A;  3GF2 A;  1BIB A;  2M1B A;  1MD0 A;  4WK8 F;  5E1W A;  5LHI A;  1SFX A;  1F9N A;  4LGW A;  1LNW A;  4UHT A;  2CSO A;  1XGO A;  3QP5 A;  3V7C A;  4A6D A;  4LK1 F;  3GLX A;  3KP6 A;  3G3Z A;  4L5J A;  2GA1 A;  2J5P A;  3DV8 A;  2WWY A;  1KU2 A;  4HF0 A;  4KN4 X;  2JPC A;  2HEO A;  2P6T A;  5LEJ A;  1ZG1 A;  5BPI A;  3R60 A;  3Q5F A;  3FXU A;  2B0L A;  2V1X A;  4G6Q A;  3RKW A;  3CUO A;  1W7P A;  2LF8 A;  1G3Y A;  4L0Y B;  3DKW A;  2FQ3 A;  2XKP A;  3ERE D;  3I53 A;  2G9W A;  2HS5 A;  2PMU A;  4AIH A;  2XVC A;  1Y0U A;  2K02 A;  4A5N A;  5DCM B;  1ZN2 A;  2F5D A;  2GZW A;  3HTS B;  2ESH A;  1JHH A;  5HVQ C;  2VN2 A;  1I5Z A;  3RPU A;  3DEU A;  3MZY A;  2BYV E;  2F5C A;  1FWZ A;  2R7F A;  4Q5S F;  2E7X A;  4XSX F;  1HSJ A;  2OD5 A;  3F6V A;  1FT9 A;  3CDH A;  2GAU A;  4JBA A;  2IA0 A;  1B4A A;  2A69 F;  1QGP A;  1IXC A;  3CO6 C;  4EJU A;  3J81 K;  3P9I A;  1RIO H;  3F3X A;  1T2K A;  1YS6 A;  2ACJ A;  2ZBK A;  2STT A;  4WWC A;  4KN7 X;  1GXQ A;  3K69 A;  3G73 A;  3WTX C;  4OMY A;  3FM3 A;  5F64 A;  1LEB A;  1J0R A;  3TQN A;  4CO8 A;  3COA C;  5FGM A;  1WSU A;  1JXS A;  1S7O A;  3QU6 A;  4ESB A;  1PP7 U;  2A68 F;  5D6F A;  2FOK A;  4BYY A;  1DDN A;  1ZGA A;  2G7H A;  3RDI A;  2COM A;  3FMS A;  3R0J A;  1K78 A;  2KKO A;  1TW2 A;  2XKO A;  3LST A;  2ZNZ A;  1OYY A;  3ZP5 A;  2XAQ A;  2W57 A;  3T5X A;  1USS A;  4HF1 A;  2OZ6 A;  2V1U A;  4L18 B;  2YPR A;  3LFK A;  2YR2 A;  4Y15 A;  2EV5 A;  1FP1 D;  4O3M A;  3F21 A;  3K0L A;  5DEQ A;  4EJW A;  5D8K B;  3N4M A;  2YX7 A;  1VTN C;  1RUO A;  4KYW A;  3M1E A;  4IJA A;  1U6G A;  2DPD A;  1QBJ A;  3ELK A;  5FO5 A;  3F8M A;  1OYI A;  2ZME B;  4BQA A;  3IL2 A;  1AWC A;  4M73 A;  3TDZ C;  4LG0 B;  4PGH A;  3MAJ A;  1WI9 A;  1BI3 A;  2W24 A;  3U1D A;  2MLK A;  3KP2 A;  3GX4 X;  3F8C A;  2F2E A;  2H09 A;  1G3T A;  4FX0 A;  4A0X A;  2GA2 A;  4AVP A;  3PQK A;  2JPB A;  3H3U A;  1R58 A;  4AD9 A;  1D8K A;  3VOE A;  4AWX B;  1R5H A;  4ON0 A;  3QPH A;  2D1V A;  4WX9 A;  2QWW A;  4RGX A;  4RB2 C;  4L5I A;  1WQ2 A;  2A6H F;  2BV6 A;  4Y13 A;  1IN8 A;  2EV0 A;  5FLX K;  3GUD A;  5HLG A;  5F1R A;  1FYL A;  1FBS A;  2LSO A;  2DQR A;  4AIJ A;  1FLI A;  1S29 A;  2PN6 A;  5ILV A;  3DQV C;  5HLH A;  1GHC A;  2X4H A;  1U2W A;  1ULY A;  3DXJ F;  1RZ4 A;  5ED4 A;  4OIP F;  3FX3 A;  4KFC A;  3WGG A;  2RKH A;  2PFB A;  2ZKZ A;  4HBL A;  5J6X A;  3DF8 A;  4LB5 A;  1K78 B;  2KRF A;  2QQ9 A;  1WRJ A;  1IXS B;  1R1T A;  1FP2 A;  2VON A;  3QAH A;  2EA4 A;  1TTY A;  3GWZ A;  1EH6 A;  3J81 Z;  2JSC A;  1YIO A;  1O3S A;  1MKM A;  2P4W A;  3LA3 A;  4OIN F;  1HKS A;  1Q1H A;  2P6S A;  4IF4 A;  3IC7 A;  3H3Z A;  3E5Q A;  1YS7 A;  3M7G A;  1R00 A;  1W7P D;  3RYR A;  5BMZ A;  5DD8 A;  3PQJ A;  3IWZ A;  3PFI A;  4U7D A;  4KIC A;  3V7S A;  1HBX G;  1TW3 A;  4HDV A;  1F5T A;  3V8K A;  1XN7 A;  2P7C B;  2HQR A;  1I1G A;  2XUB A;  5JHU A;  1HQC A;  2OBP A;  2O8X A;  2VBW A;  1XSX A;  2OA4 A;  3L7W A;  4RAZ A;  4IRG A;  3ZMD A;  5CVJ A;  2GQQ A;  2CW0 F;  2QQB A;  2O0Y A;  4N0B A;  1PDN C;  1PUE E;  4L9V A;  5HLI A;  2IT0 A;  2MBF A;  3U9G A;  4CDG A;  2VBX A;  1P4A A;  3DPT A;  4HAM A;  3VFZ A;  2QBY A;  2KIM A;  3ZN1 A;  2QVO A;  5ICG A;  4DQ2 A;  3HRM A;  6PAX A;  3KP5 A;  2EB7 A;  2XAH A;  3EYI A;  1XB4 A;  3GZ6 A;  5E1Z B;  1Z6T A;  4JQF A;  3O3K A;  2NRA C;  2D1H A;  1RI7 A;  3EET A;  5E17 F;  1UST A;  1H9G A;  5AIP A;  2DT5 A;  3KLN A;  2ISZ A;  2EV6 A;  1KYZ A;  3NEU A;  4WXD A;  4YFK F;  2CO5 A;  4P5O A;  2Y0M A;  2K27 A;  4OMZ A;  3VOD A;  4YII A;  3HRS A;  1DUX C;  1B9M A;  4KIF A;  4JK1 X;  1HKT A;  3SZT A;  2FNP A;  3T8T A;  1FY7 A;  2IVM A;  4ESJ A;  2PG4 A;  2LKP A;  4HV5 A;  3CUQ A;  3KP3 A;  3D5L A;  1HW5 A;  2H6B A;  2LDU A;  3WTV C;  1T38 A;  3F8N A;  3RKX A;  2QQA A;  1IN5 A;  2DK8 A;  3NQO A;  3T1B A;  3BY6 A;  3VEP A;  4ENK A;  5ICE A;  5D6E A;  4I02 A;  3RIR A;  2ETH A;  3BOQ A;  4S04 A;  5FLX Z;  1P6R A;  5L3C A;  4WXC A;  2QYO A;  2CYY A;  3QPT A;  3KET A;  4A0Y A;  1LB2 A;  3E97 A;  3HTU A;  3LA2 A;  3RKY A;  3S2W A;  1T6S A;  5D5U B;  1QPM A;  3JAM K;  3WGI A;  3ABT A;  1U5T A;  2XGX A;  2XIG A;  5FFZ A;  1KU9 A;  4R79 A;  3BDD A;  2JRT A;  5K5O A;  4BNC A;  4L9T A;  1XGN A;  3K1M A;  3F72 A;  3SFZ A;  3I59 A;  1IZ1 A;  5EEG A;  5AIQ A;  4LLN A;  1DPR A;  3O2P E;  1R1U A;  5CVU A;  2FBH A;  1YFH A;  3ULQ B;  2F5E A;  2G7U A;  4M9X A;  5LGN A;  3BJ6 A;  3GFJ A;  3CJN A;  2QLZ A;  1FNN A;  2RQP A;  1ZHF A;  2KJC A;  4IRH A;  5LRR A;  1XCB A;  1KU3 A;  5FB2 A;  1SD4 A;  2M87 A;  3E3V A;  4EM0 B;  5DDG A;  1SD7 A;  2K4B A;  2L4M A;  3KZY A;  2QUF A;  3Q9S A;  5ILU A;  3MCZ A;  1SFE A;  3HSR A;  1XSD A;  1R22 A;  1R23 A;  2V1D A;  2ISY A;  2Q2E A;  2EFQ A;  3AAF A;  1BJA A;  5LHH A;  1XSV A;  4LFU A;  1QNT A;  1KGS A;  3K1N A;  3WU1 B;  3F6O A;  3GVA A;  4QLC U;  3JTH A;  4M71 A;  2OQR A;  2PMH A;  2FMY A;  3ZN0 A;  2VOD A;  1D3Y A;  2DW4 A;  1XGS A;  1KQ0 A;  2RC4 A;  1J59 A;  3FMR A;  4IXA A;  2Z33 A;  3BWG A;  4K2E A;  4I7H A;  1DP7 P;  3F8F A;  4S05 A;  2FRH A;  3KZZ A;  1Z9C A;  4ENM A;  4EMS A;  3MQ0 A;  4E70 A;  4F7Z A;  4LB6 B;  3C18 A;  1D5V A;  1IXR C;  2X0L A;  4A5M A;  2WC2 A;  2IP2 A;  2NNN A;  4HYE A;  2EFW A;  4RGS A;  1YG2 A;  3R4K A;  3WE2 A;  1YW9 A;  3QRF F;  4NHJ A;  4L9N A;  2DQL A;  3JSO A;  4LD5 A;  5H20 A;  3IRQ A;  1FZP B;  2MC3 A;  2W85 A;  1YO5 C;  3J80 K;  3ISP A;  2V9V A;  3N97 A;  3ZMZ A;  3I59 B;  1GXP A;  5TRD A;  1QZZ A;  1QZY A;  5DD4 A;  4DNC A;  1XDS A;  1SFU A;  1H0M A;  1TBX A;  3GXO A;  5J8F A;  3ZMS A;  2W84 A;  4CZZ A;  2JTV A;  1FYM A;  4PZJ A;  2EFP A;  2RNJ A;  2GWR A;  4R1H A;  1K7A A;  1YW8 A;  1H9T A;  4EJO A;  1G3W A;  2A3S A;  3JAM Z;  3MWM A;  1BOA A;  2FA5 A;  1OMI A;  3K2Z A;  2NAZ A;  4I98 B;  5E8G A;  1W7P B;  2IA2 A;  4BHB A;  2Q8K A;  1O57 A;  1FSH A;  4MGR A;  3JW4 A;  2FBI A;  1I6X A;  2FML A;  2MD5 A;  5LRS A;  5FFX A;  1IF1 A;  2UXX A;  2JZY A;  1MDM A;  1HXD A;  4O5V A;  4YFX F;  3EYY A;  3BZ6 A;  4BHC A;  1LDD A;  1ON1 A;  2RGV A;  4HX4 A;  4IVN A;  1QQI A;  4CXF A;  1FX7 A;  3RTR A;  1HST A;  4OIQ F;  3KCC A;  3MFK A;  1YQA A;  3B73 A;  2HOE A;  3KE2 A;  4HV6 A;  3BPV A;  1XDU A;  4GXO A;  2FE3 A;  2LF7 A;  3WTZ A;  5E8I A;  2HKO A;  4ZYD A;  4GCV A;  1XD7 A;  1J5Y A;  3DP7 A;  4EJV A;  4HLY A;  2HYG D;  1LDJ A;  3F23 A;  2KIU A;  3C7J A;  4IRI A;  1S6L A;  4NQW A;  4UVC A;  4B09 A;  4OIO F;  3CUQ C;  2DI3 A;  1U3E M;  2O61 A;  3GFI A;  2IRF G;  3P9K A;  3NRV A;  1MJ9 A;  1U8R A;  4KMU X;  2DU9 A;  1YTY A;  5BS6 A;  4P55 A;  3ZPL A;  4G8X A;  2L02 A;  2BE5 F;  4UUV A;  5HS7 A;  2K86 A;  2XRO A;  1G3S A;  2D45 A;  4ESF A;  2CFX A;  4A6E A;  4HQM A;  3J7A O;  1SD6 A;  2DTR A;  2MA3 A;  2VOO A;  4EM2 A;  5L3G A;  1U5T C;  1ZRC A;  3V8L A;  1ZYR F;  1IN7 A;  3WTT C;  1ZG5 A;  1UB9 A;  3CTA A;  2R7D A;  4ZZD A;  4RB1 A;  4I0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...