3J81Z

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
b'AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81Z00
5DUKA 4B09A 2ZJ2A 4GXOA 5KVRA 2STTA 3I59B 2QBYB 3WE2A 1K78A 1RNLA 3K69A 1H9GA 4MNUA 3GFMA 2LKPA 1HQCA 3Q9SA 2H27A 3ZMSA 3SHFA 1T39A 1P4AA 4I0AA 4ZH4F 3S2WA 2VBYA 3WGIA 4D0PA 3ZN1A 3I54A 4RGSA 3N4MA 1QQIA 3V7CA 1KU7A 3E6MA 1XB4A 4IHSA 1T0FA 2ZMEB 3ZMDA 3IWZA 1Z1DA 1SD4A 3N97A 5IT9K 4QWQA 4A6DA 1EH8A 1ZG3A 2OBPA 4YG2F 1FWZA 1Z91A 2O8XA 1QGPA 3R0JA 3GZ6A 4I01A 3W6JB 2A07F 1YIOA 2JPBA 1DPUA 1LEAA 4RGUA 2L4MA 3FMSA 3GO5A 2HDCA 1Q1HA 1UHMA 3TO7A 1B4AA 4EJOA 4UHTA 2P6SA 4RB0A 4LG0B 4G94A 3F21A 4LD5A 1H0MA 5D8LB 3M8EA 5LGNA 4GO1A 4FT8A 1ZRFA 1OYIA 1OPCA 2K27A 4EQQA 1HW1A 4ZZDA 2O61A 3JW4A 2M30A 4OU0A 4K2EA 3P9CA 2P7VB 1W7PB 4M71A 1R36A 4EV0A 2GAUA 3WG9A 3DPLC 2FMYA 4KT5C 4ENJA 3L09A 3VFZA 4DQ2A 4NHJA 4KYWA 1J59A 2L3DA 4M72A 3K1PA 2KIFA 1REPC 4AVPA 5LHIA 4Q48A 5AIQA 4U88A 1AOYA 3KP2A 2E7WA 4G7ZF 5F64A 2HQNA 1A04A 3CLOA 2FEZA 4CO8A 3GFLA 2Z9OA 1T38A 5J8CA 1ZYRF 2VOOA 5E17F 3RKWA 1B9MA 3REOA 3RIRA 1D5VA 3MZYA 1E2XA 3H3ZA 2K4BA 3KLNA 3LA7A 1XGSA 3JTHA 5E18F 1G3YA 3LAPA 3WE3A 5CVVA 1L3LA 4UV9A 5IT3A 1U3EM 2D1VA 3CO6C 4EJWA 3JSPA 2MLKA 3IL2A 1IXRC 2B0LA 5DDGA 2MA3A 2RC4A 4A0XA 1S6LA 1KYWA 2PFBA 1U8RA 2FNPA 4CXFA 2IA2A 4EJTA 1ZAOA 2FMLA 2XV4S 3FWEA 3WTUC 1HW5A 3PQJA 2L4AA 4PZJA 1F9NA 3K1MA 4L0ZB 3R61A 3QRFF 2YPRA 2MLGA 2Z33A 4HLYA 3NEUA 3M9AA 3IRRA 2RQPA 2IA1A 4HF1A 5ERIA 3M7GA 2DW4A 1BC7C 1TBXA 1FX7A 4O6JA 2ZNZA 2XAQA 3T1BA 4P96A 4AD9A 4UVBA 5F6FA 3EQLF 3U2RA 5LRSA 3HUGA 2M45A 3KP4A 2BEOA 1YYVA 2KJBA 4BHCA 4KN4X 4XBFA 2LNBA 1GVJA 3WODF 3Q5FA 3WTWC 2H6BA 1KQ9A 3BROA 2PI0A 1IN8A 3HRUA 1STZA 1IF1A 2HEOA 1XGMA 1LDKB 3KE2A 1BC8C 2E1CA 3KEQA 2NS0A 3R6SA 3L2CA 1OKRA 2HKXA 2W25A 4ENMA 5D5UB 5JI6A 2EK5A 4LLNA 3ZMUA 1F5TA 1HW2A 2UXNA 1YFHA 4TV7A 3BWGA 3K2ZA 2JSCA 3J81Z 5L3CA 3L7WA 4HBLA 1USSA 3HSFA 3IHUA 3TO9A 1IN4A 4I7HA 2OZUA 1ZRDA 3KP7A 4IF4A 4ON0A 2RDPA 4L9NA 1IN7A 3HOTA 3WGGA 1HKSA 2V9VA 2EFNA 3ZMVA 4XSXF 3FZVA 2UXXA 2HTJA 2OU2A 5DUIA 2AS5F 2QQBA 3KZZA 1ODDA 4GYGA 4PGGA 4XLPF 2P6TA 4KN7X 4I09A 5DCMB 1DPRA 3WTSC 3COAC 4OINF 4LMYA 1UB9A 2ZO4A 1FLIA 2A68F 2V79A 4IRHA 3FXQA 2Y75A 4AIHA 1XGNA 4HF0A 4EMSA 2F5EA 2NAZA 5TRDA 2O0YA 4R79A 3H92A 2XUBA 4OIRF 2G9WA 5K5RA 1S7OA 4KFCA 4PDKA 1LQ1A 5AIPA 2VE8A 4RB2C 1R1UA 2ESHA 2DI3A 2DTRA 1F4KA 2VOPA 3P7NA 4YFXF 1ZLKA 5E8IA 1CF7A 2DU9A 3VODA 1XMAA 5HDNA 1G3TA 5D5VB 2F5FA 4HOBA 3DF8A 4EGYA 3F8MA 3C18A 3O6BB 2ZXJA 1R22A 1B1BA 1Z9CA 4MTEA 3LWFA 2VBWA 2XIGA 3E6DA 4Y15A 1TW2A 3ML6A 3E3VA 2D1HA 3GUDA 3DPTA 5FB2A 1YW7A 4KICA 1MD0A 1F1ZA 2GA2A 3I59A 4IPAA 2Z99A 2QBYA 1FSHA 4IXAA 2STWA 2O3FA 3FMQA 3WTXC 3KETA 1YW8A 4S04A 2G7HA 2GWRA 3WTYC 2QWWA 5E8GA 2EA2A 3L00A 1S29A 3TQNA 3I71A 1MJ9A 3K1NA 1Z05A 1R00A 4O3MA 2R3SA 5HS8A 3BJ6A 5LEJA 2BV6A 2IP2A 3OV8A 4M74A 3DFGA 2QENA 2KRFA 5BS6A 2C6YA 1GHCA 1USTA 2PBIA 3U9GA 1GXQA 4KUMA 4N0BA 3E5QA 2XROA 2YX7A 4U0YA 1CGPA 3GVAA 4OMZA 2RGVA 2VONA 2XASA 1T98A 1ZRCA 1TQMA 2DO7A 2PG4A 2P5LC 1JGSA 2HWVA 2HQRA 6PAXA 5JR3A 3DKWA 1DP7P 3F3XA 3E6BA 1YS7A 1YO5C 2JT1A 3BOQA 1WWXA 1L0OC 3C1DA 4BYYA 3CTAA 1LNWA 1U5TB 3ZQ7A 4KDPA 4L18B 4LG0A 4ZYHA 4A12A 2CW0F 3HRTA 1V3FA 2RN7A 4BH9A 2FQ3A 2XAFA 3JSOA 4LGWA 3FXRA 3ERED 3HTUA 1W7PA 4R8HA 4HYEA 2CGPA 3T0YA 2DBBA 4GCVA 4MEYF 4KIFA 1MZBA 4N9HA 5D8KB 2BYVE 5CLSA 1FY7A 1IZ1A 5CYVA 1P92A 2FOKA 1IN5A 2IA0A 3LSTA 4G9YA 3IKTA 3BZ6A 5HLHA 4HV5A 3GWZA 3MZHA 1BIBA 5H20A 5FGMA 2W57A 1I1SA 3QPTA 1E17A 3V8LA 3I53A 3D5LA 2YR2A 1FPQA 2VC1A 2JTVA 4WK8F 2Z3YA 2WC2A 2M87A 5J6XA 1ON2A 1TLHB 1XMKA 1KQ8A 1XSDA 1B59A 4I02A 4EGZA 4IJAA 4GGGA 1R7JA 1T6SA 3CUOA 1I6XA 4R1HA 2CFXA 4L9VA 5FLXZ 2DK8A 1RUOA 3RPQA 1R1VA 2MC3A 1YW9A 2K4JA 4KIGA 3BPXA 3HRSA 1UFMA 1WI9A 1DUXC 2GIVA 5BPIA 4WCGA 1WRJA 2FSWA 1HKTA 4BAYA 3ROUA 1AWCA 1FP1D 2MH2A 2DLLA 5LBQA 3MEXA 3HTSB 1R58A 1TNTA 1BI2A 1P6RA 1FSEA 4L9JA 3D0SA 5DCFA 1Y0UA 2LSOA 3LAJA 3H3UA 1B9NA 3T8TA 2QQ9A 2CO5A 2JRTA 3GW2A 1RIOH 3CDHA 2FRHA 5HDKA 3DP7A 2QM3A 2IW5A 1U5TC 2FU4A 2W84A 4P9UA 1NHAA 3JAMZ 5FLXK 1FYKA 4UVCA 1U2WA 2O6GE 4P5OA 4EM0B 2BBYA 3GXOA 5KK1A 1D3YA 1G3SA 3I58A 1PP7U 2R7DA 3OOPA 5BOXA 3GLXA 3MQ0A 5H6RA 1WQ2A 1KA8A 2CQKA 4LB6B 4ETSA 2P7CB 4I98B 4HDVA 3VOEA 3QOPA 2DFIA 2CSOA 4U7BA 3EYYA 4LB5A 5J8FA 5ILVA 1YS6A 1YG2A 4MHGA 4WX9A 1QO0D 4LJZF 1LDJA 1TQPA 3C3WA 1XD7A 4Z2YA 1OMIA 3QU3A 1S8NA 4M9SA 4Y17A 4HX8A 1FP2A 4XSZF 3BP8A 4RS8A 1R1TA 1R5HA 4WXHA 4AIKA 1TNSA 2KKOA 4PGHA 1ZGAA 4YIIA 3I4PA 4G6DA 2ESNA 2FXAA 1SFUA 5AONA 1J0RA 2KIUA 2YX4A 3IC7A 1W5TA 5DV5A 2DAOA 3LA2A 2XKPA 3BDDA 3J80Z 2A61A 5CVIA 5K1YA 3E5XA 1XDSA 4L5JA 3DV8A 3MAJA 2OA4A 1IAWA 3HSEA 3NQOA 1IXCA 3F6OA 3G73A 3DQVC 3QP6A 2H09A 3R0AA 1W7PD 3U1DA 3ZPLA 3IRQA 4KNYA 1HSTA 2EA4A 3J7AO 3KLOA 5EEHA 4A5NA 2ISZA 2V1DA 2V1XA 4MQVA 1FBQA 1YLFA 2IPQX 4A0ZA 1KYZA 1ZARA 4CICA 4HQEA 3PFIA 3QPHA 2HOEA 5L3BA 2FF4A 3SXYA 4P9FA 3FX3A 1SMTA 4M6YA 3P9KA 1TTYA 2J5PA 4RAZA 2A3SA 2HZTA 4G6QA 4QLCU 1Z7UA 2L54A 3J80K 1C0WA 2XVCA 2EB7A 4EVIA 3E5UA 3WTZA 3B02A 5BMZA 5L3EA 2G7UA 5ICGA 3T8RA 2P5VA 2F5DA 4EJUA 2ISYA 2GZWA 1TW3A 3G3ZA 4OIOF 3K0LA 1ON1A 4G7OF 3R4KA 2YU3A 5DD8A 3RYRA 1QPMA 4HX4A 4MGRA 3J81K 1LB2A 3BY6A 2EV5A 1BN5A 2R7FA 2EFPA 1G6NA 2X0LA 3LA3A 2NYXA 1MDMA 2QUFA 2DT5A 1SMYF 2BE5F 4XLNF 4AWXB 4ASNA 2FA5A 5D4RA 3KFWX 2EFWA 4FX4A 5F1RA 3M1EA 1S3JA 1O7LA 1U6GA 4LLLA 4UVAA 1S7AA 3WU0A 1FBSA 2EFQA 4RGXA 4F7ZA 3RTRA 3M8FA 2HYFA 4S05A 1GXPA 4BQAA 3BPVA 1J9IA 4OMYA 3KP6A 3ULQB 2DK5A 2W85A 5ICFA 2HKOA 4L5IA 3QU6A 3SQNA 3SFZA 4JK1X 1U5TA 5D6FA 2K02A 3WGHA 1JXSA 3RI4A 4A5MA 4GYIA 2ZFWA 1W4MA 1XN7A 1BIAA 2MD5A 4WF2A 1P4XA 3O3KA 2RVCA 1O3SA 5E1WA 3RYPA 2AXLA 5HS9A 3C7JA 1WSUA 1QBJA 2GXGA 1ONVA 3ABTA 1H9TA 2W24A 5FD6A 3F23A 4CZZA 2M5WA 4YFKF 1O3TA 1P2FA 3P9IA 2RKHA 3O2PE 3FHZA 2FBKA 2OAZA 5CVUA 1K7AA 1SFXA 3EYIA 2ZMEA 1BI1A 2UZKA 5L3DA 1XDUA 2VE9A 4ESJA 1ULYA 1I5ZA 2NNYA 1BI0A 1CF7B 2WWYA 1ZLJA 4PCQA 4DNCA 1KU9A 2XKOA 3ABUA 5L3GA 1VTNC 2ELHA 2PMUA 2QVOA 2RV8A 4CDGA 2VBXA 3TDUC 1XGOA 4YFNF 3SZPA 5IT9Z 1FYMA 2D45A 3V8KA 1B6AA 3HOSA 2GQQA 2DPUA 2XAGA 3FM3A 2PN6A 3EDPA 2XRNA 3MFKA 3MWMA 2RNJA 1RI7A 3CUQB 1PP8F 2DQRA 4ESFA 5LGTA 1FNNA 5E20A 4EM1A 3NRVA 3KZYA 1J5YA 1XSVA 2LDUA 3R60A 1ZREA 3ZN0A 4LK0F 1D8JA 4KMUX 4NB5A 2MH9A 5D4SA 4A6EA 2HR3A 2ZBKA 1J7KA 2VBZA 1XCBA 1SD5A 5BPDA 1R23A 3FMRA 1ZHFA 3KCCA 5FFZA 3KP3A 3LFKA 2PEXA 2Q0OA 3WTTC 2Q8KA 1P4WA 1G4DA 3JTGA 3HHGA 5E1ZB 3T5XA 1KQ0A 1PUEE 3TOAA 1LDDA 3KP5A 3IWFA 1DDNA 3I0TA 3E6CC 1ZG1A 4LLGF 4LK1F 3TGNA 4BHBA 4ENKA 1XSXA 2F5CA 1IUYA 2EJRA 2V1UA 1O3RA 1EH6A 1SD7A 2FBHA 1LJ9A 1TQIA 1BI3A 1O7FA 4I0BA 4O5VA 2ACJA 1FC3A 5DD4A 5LLQA 2VC0A 1RZ4A 3GEZA 4FX0A 1BBYA 1K78B 3FF5A 5HOOA 2GA1A 5LGUA 3QP5A 5A2QZ 3GFJA 3ZMTA 1JHFA 1Z6TA 2KJCA 1HBXG 1J2XA 4M9ZA 4H0EA 3ISPA 4RB1A 2OZ6A 1YTYA 3LQQA 4HF2A 1IN6A 2VODA 3B73A 2KIMA 4Q5SF 5K5QA 2PLYA 2DQLA 2A5YB 1JE8A 1FYLA 4HW0A 2CG4A 3GF2A 4N9IA 3GX4X 3ZMZA 3FM5A 2LF7A 4U0WA 2Q2EA 5K5OA 2HYGD 3E97A 2PQ8A 2F2EA 1SFEA 3TDZC 3I64A 2XGXA 2A69F 3K9TA 4WXDA 5D5WB 4KA4A 3CUQC 4ZYDA 1LEBA 2EV0A 4M6XA 3ELKA 4MTDA 3V8JA 2P4WA 4XRFA 5TJJA 2IT0A 3V4GA 4ZYEA 3HHHA 5D5XB 2OQGA 4ZZLA 4ENNA 2EV6A 2EFOA 1BM9A 5A2QK 4UUVA 4BHPA 2ZCWA 3I5UA 2IRFG 3ECHA 4E70A 2Z5UA 1ZN2A 5JVTA 4BNCA 4JQFA 4HQMA 4HLXA 3RDIA 3RJPA 1G3WA 5LHGA 3GZ5A 4P55A 4RAYA 4HV6A 2XAHA 4UV8A 2M1BA 2FBIA 1IRFA 3F8FA 2NRAC 1IRGA 2V6CA 4BXUA 2A6EF 4YIFA 3MCZA 5HLIA 2D2WA 3F72A 5DCMA 4HZFA 4A0YA 4U0VA 2IVMA 3BJAA 1EH7A 3JAMK 4Q47A 3F8NA 1UCRA 3V7SA 3WTVC 1UHWA 3DXJF 3TOBA 3TO6A 2P5KA 4FHTA 4KIBA 1FBUA 5ILSA 1ZG5A 3V7RA 1RUNA 5ED4A 2Y0MA 2HTSA 2CYYA 4CHUA 4WWCA 1HKQA 1OYWA 4EJVA 2ETHA 4HDUA 2OD5A 5FD5A 4A2UA 3VB2A 5CVJA 4RB3C 3HIFA 5CJ9A 4UNOA 2COMA 5FFXA 3F6VA 2TDXA 3HRMA 2ZNYA 2WTEA 2ADUA 1QZYA 2IJLA 2A6HF 3DEUA 2K86A 3RPUA 1FZPB 2JPCA 1PDNC 3GYHX 2FE3A 1BJAA 2YSRA 2GXBA 4WXCA 5EEGA 2CWEA 1HSJA 3RKYA 4IRIA 1YQAA 1KGSA 2QYOA 4G8XA 1HXDA 3IKVA 2MBFA 4EM2A 2QZ8A 4IRGA 4U7DA 4Q4ZF 2NNNA 1O3QA 1KU2A 1FOKA 1OR7A 3HYIA 2H94A 5L3FA 4RGRA 1XCVA 4NQWA 1K79A 1SAXA 2L01A 2K7LA 2PMHA 4CYDA 4OOIA 5HVQC 2P8TA 3Q9VA 5LHHA 1I1GA 3ECOA 2PJPA 2LF8A 3F8CA 5HS7A 1MGTA 2X4HA 5DEQA 1OYYA 1MJBA 1LVAA 1ZGJA 4KMFA 2VT3A 2QLZA 3F22A 3FXUA 1J75A 4HAMA 1R5GA 3SZTA 1ZH5A 5JHUA 4G7HF 3PQKA 2H6CA 1T2KA 5ICCA 3CO7C 1KU3A 3LQRA 5FO5A 3EETA 3GFIA 3ZP5A 4AIJA 2L02A 5HLGA 2OQRA 3W6KB 4HA8A 2HS5A 2Y48A 3CUQA 4LFUA 3AAFA 2EWNA 1QZZA 3EUHA 5LRRA 3L9FA 5ICEA 4HX7A 1D8KA 1I27A 5JFRA 3TKYA 2M8EA 2E7XA 4MEXF 1IXSB 2FNAA 5BQTA 2DPDA 3VEPA 1WKMA 4UXNA 4CGZA 4IVNA 1BOAA 5DYMA 4M73A 3KEOA 3CJNA 4L9TA 4OIQF 5ILUA 1V4RA 2JZYA 1JHHA 2UWMA 2XAJA 4ESBA 2XHKA 1EV7A 1Z6RA 2QQAA 1FT9A 2WV0A 3HSRA 4JBAA 2ZKZA 4MQ9F 3RKXA 5D6EA 1MDMB 1O57A 5H6QA 5E1XA 4M9XA 5LEKA 2HGCA 3WU1B 5CVRA 1QNTA 4ZYGA 2VN2A 5HDGA 2VXZA 4OIPF 3QAHA 1W5SA 4B8XA 1IW7F 2O03A 1MJAA 4L0YB 2VT2A 3BJOA 4I2OA 1MKMA 1X3UA 2J5OA 2E1NA 2HFHA 4IHTA 4Y13A 1K6OA 3F8BA 2BGCA 1SD6A 1U78A
chains in the Genus database with same CATH superfamily
5DUKA 4B09A 2ZJ2A 2IGNA 4GXOA 2HQAA 5F0FA 2L7ZA 5KVRA 2STTA 3I59B 5M3MJ 3LSRA 1A31A 3NAUA 1MBJA 1LVKA 4BQQA 2AHQA 4CCJA 4M3EA 3A0BC 4XL9A 2QBYB 2KQRA 3WE2A 1MW7A 1ETKA 1K78A 3CF2A 1QVTA 1RNLA 3K69A 2B7EA 1H9GA 4MNUA 3MVPA 2TRTA 2LKPA 1HQCA 3GFMA 3Q9SA 2H27A 3ZMSA 3SHFA 1LFBA 3MN2A 1R5ID 3CESA 1MBGA 1VQNI 3LOCA 1T39A 1P4AA 2VQGA 4I0AA 4ZH4F 2JA6J 3M1CA 3S2WA 1BW5A 2VBYA 4DZPA 2MFZA 3WGIA 4D0PA 2NS8A 3ZN1A 3H0GJ 2ME6A 1ETYA 3I54A 5CPRB 3K10A 4RGSA 3N4MA 1QQIA 2MYSA 2XF5A 2K3FA 3BG5A 3V7CA 2KT0A 1UG0A 1KU7A 4CCMA 4BQOA 3A02A 3E6MA 2ZSHB 2TCTA 1XB4A 3CC2I 1VQ9I 3ASNH 2L5QA 4IHSA 1KONA 1T0FA 2ZMEB 3ZMDA 1UELB 3IWZA 2BXYA 3BTCA 1Z1DA 1SD4A 3N97A 2IS2A 3J7YJ 1HOMA 3G1LA 4BDYA 1VQPI 1APLC 5IT9K 4QWQA 5DS9A 1HA8A 2KDZA 4A6DA 1EH8A 1ZTRA 1ZG3A 2OBPA 4YG2F 4D5CA 1FWZA 1WJAA 3KPHA 2L9NA 3NARA 1Z91A 3TBIA 1IUFA 1Z21A 2O8XA 3BZCA 1H88C 1QGPA 3D5RC 3R0JA 3OL4A 2WAQN 3GZ6A 3QYFA 4I01A 1UJ8A 3W6JB 2A07F 1UAAA 1YIOA 2JPBA 1DPUA 1LEAA 3HKZN 1WVRA 4GRIA 2L4MA 4RGUA 1YJ9I 3FMSA 3GO5A 2HDCA 1Q1HA 1UHMA 3TO7A 1B4AA 2X6OA 4EJOA 4W97A 3TL4X 4UHTA 2P6SA 4RB0A 4LG0B 4YELA 4G94A 3F21A 1DQUA 4B43A 5IYDJ 4LD5A 1H0MA 5D8LB 3M8EA 1FOYA 5LGNA 4GO1A 1MBHA 1RC9A 4FT8A 3KYDB 2E35A 1ZRFA 1OYIA 1OPCA 2K27A 1HF0A 3GTOJ 4CCNA 4EQQA 1HW1A 1WJFA 4ZZDA 3JW4A 2O61A 1I3QJ 4ZDPA 2M30A 4OU0A 3HG9A 1M1EB 4K2EA 3P9CA 2P7VB 1D5YA 1W7PB 4M71A 1R36A 1JJ6C 1X4OA 4EV0A 1MSFC 1X1BA 2GAUA 1Y1VJ 1IV6A 3WG9A 2BY2A 3DPLC 5IOZA 1X3ZB 3A01B 2KRCA 1FEXA 2FMYA 5GAHJ 4KT5C 4XK4A 5EGOB 5E79C 1LE8A 1AHDP 4M6VA 3F9KA 4ENJA 3L09A 3LSHA 3VFZA 4II2A 4DQ2A 4NHJA 4E7KA 1VQMI 4KYWA 1J59A 4XRSG 4A3IJ 2L3DA 4M72A 3K1PA 2KIFA 1REPC 2R7OA 4AVPA 5LHIA 4Q48A 2LY1A 5AIQA 2JA8J 4PJNA 5GP9A 4U88A 4XOTA 3S3OA 1AOYA 2VQHA 1ETOA 2DMPA 2GOMA 3KP2A 2E7WA 4G7ZF 5F64A 2HQNA 3PNVA 1A04A 1AKHB 1YX5A 3CLOA 4XN0A 3ZR8X 1EF4A 3LFUA 2FEZA 4CO8A 2R5YA 3GFLA 2Z9OA 1I39A 5JVGF 2LTPA 4Z6YA 1T38A 1XMXA 1LFUP 3ONQA 5J8CA 1ZYRF 2VOOA 3QPSA 4DW6A 3RKWA 5E17F 1B9MA 2E19A 2ECCA 3REOA 4ZDLA 3RIRA 1D5VA 3MZYA 1E2XA 2KP6A 3H3ZA 1A36A 2K4BA 5IP6A 2LREA 2ZB9A 5CQGA 3KLNA 3LA7A 1XGSA 5FKOA 2F4OB 2NVXJ 2LH9A 2ZSIB 3JTHA 5E18F 1G3YA 3LAPA 2PJRB 3JRDA 1YRNA 2X85A 3WE3A 4PSWA 3CQZJ 5CVVA 1L3LA 4UV9A 5IT3A 1B72A 1U3EM 1VNDA 3ABKH 1KZHA 3JRAA 5C4JJ 2D1VA 2IBDA 4CCLA 4EJWA 3JSPA 3CO6C 3EUAA 2MLKA 3IL2A 1IXRC 2B0LA 1S5LC 5DDGA 4G12A 1LFPA 2MA3A 2RC4A 4A0XA 1HLVA 1S6LA 1KYWA 3K4LA 2PFBA 1U8RA 2FNPA 4CXFA 2ZJQF 2IA2A 5FKMA 4EJTA 5HNHA 1ZAOA 2FMLA 3FBIB 4G6TB 4OAZA 3N05A 2XV4S 4UUSB 3G4SI 3FWEA 4XR6A 5FKKA 2EZHA 4HRIA 3WTUC 3LSGA 1HW5A 5GAEJ 3S3NA 3PQJA 2L4AA 4PZJA 4D1QA 1F9NA 4NC8A 1WCMJ 3K1MA 4L0ZB 2EH3A 3R61A 3QRFF 2YPRA 2MLGA 2Z33A 4HLYA 1YE9A 3NEUA 1FOXA 4CH7A 3M9AA 2XSDC 3IRRA 3FKIJ 2QCOA 2RQPA 4A69C 2IA1A 3K4KA 3S1MJ 2W4SA 2LYCA 3ZGKA 4HF1A 5ERIA 4UY8I 2VUMJ 2E60A 3M7GA 2CUZA 2DW4A 4FISA 3L2VA 3W2WA 1BC7C 1TBXA 2BY0A 3HKZA 1FX7A 4O6JA 2LMDA 2ZNZA 2F4MB 2R93J 2V1NA 2XAQA 2OTJI 1XX5A 4DBRA 1A6IA 3T1BA 4P96A 4AD9A 2AQFA 4E7JA 4UVBA 3HOUJ 5F6FA 3EQLF 4AIDA 3Q0VA 3QOEA 5F0CA 3U2RA 5LRSA 3HUGA 2M45A 3K6GA 1TWCJ 3KP4A 2BEOA 1ETQA 1YYVA 2KJBA 3VYUB 4A3MJ 5J4VA 2LBFB 4BHCA 1Q1VA 5JLXA 4KN4X 2W1OA 2Q1ZB 4XBFA 1RR8C 2LNBA 3LNQA 3KYLA 1GVJA 3WODF 5M5WJ 3Q5FA 3WTWC 2H6BA 1KQ9A 1VQLI 2I8DA 3BROA 1IN8A 2PI0A 1BOBA 3HRUA 2OTLI 4DIQA 1STZA 1IF1A 2HEOA 2B63J 1PJRA 2EZKA 4CSWA 1XGMA 2XB0X 5BNGA 1LDKB 2X51A 3KE2A 2L7FP 1BC8C 2LKSA 1BR4A 2M4GA 3IV5A 1GT0C 2E1CA 3KEQA 5DM6F 1J09A 5FLVA 5JLWA 2DMTA 3H5RA 4OAYA 2Y2ZA 2NS0A 2HVQA 3DWLE 3R6SA 3L2CA 1OKRA 2HKXA 2W25A 4ENMA 5F27A 2D5VA 1G59A 5D5UB 5JI6A 2EK5A 3G1OA 4X1EA 4LLNA 3ZMUA 1F5TA 1HW2A 2UXNA 4XOPA 4XM3A 1YFHA 4TV7A 3BWGA 3K2ZA 1IRZA 3CCYA 1LKXA 2JSCA 3J81Z 2ZJRF 1WI3A 3CZ6A 2VPRA 5L3CA 3L7WA 4HBLA 1USSA 3CP2A 3HSFA 4B3XA 5C44J 1ETVA 3IHUA 4AYBN 2M3AA 2ME0A 3BG9A 1Y56A 3TO9A 2DA6A 1MMAA 1IN4A 3K4BA 3SZGA 4MLOA 4I7HA 2OZUA 1ZRDA 3KP7A 4IF4A 2Y0SA 3OIQA 4ON0A 1D0XA 3AG3H 2RDPA 4L9NA 1IN7A 4XLAA 3HOTA 4A3KJ 3WGGA 2ZXWH 1Y8RB 1MBKA 1HKSA 2V9VA 2EFNA 2DT7B 2VB6A 3ZMVA 4XSXF 3FZVA 3OOUA 2WV1A 4IHYA 2UXXA 3CCSI 4ZJZA 2HTJA 4D7NA 2OU2A 3DTKA 5DUIA 4HEA2 1N77A 3S14J 2AS5F 2QQBA 2VJIA 3KZZA 1ODDA 2HXOA 4GYGA 3BTIA 4PGGA 3GTKJ 4E7HA 4XLPF 2P6TA 1MNEA 4KN7X 3H36A 1V54H 2IEKA 4I09A 5DCMB 1DPRA 3VDXA 3WTSC 3COAC 4OINF 2ZJPF 3W2AA 3LSJA 4LMYA 1UB9A 2ZO4A 3KX2A 3S1RJ 1FLIA 2A68F 2JUGA 2V79A 4IRHA 3FXQA 3CMYA 2Y75A 4AIHA 2OPTA 1XGNA 2HOSA 4CA0A 4HF0A 4EMSA 2F5EA 2NAZA 5TRDA 3RKQA 2O0YA 1RR7A 2LD5A 4R79A 4HNTA 3VYRB 3H92A 1JGGA 3M8JA 2XUBA 4OIRF 3ZQGA 2G9WA 5K5RA 3PL8A 1S7OA 4KFCA 1YOVB 3HGYA 4PDKA 4ZYAA 1U8BA 1LQ1A 1BL0A 4RLQA 4OWRB 5AIPA 3TW6A 1OCPA 3S3MA 2VE8A 3CD6I 4RB2C 1P9QC 1R1UA 1WJCA 1OCOH 2DYSH 2ESHA 3OSFA 2R7ZJ 2DI3A 2CQNA 1SAUA 1LUJB 2DTRA 1F4KA 3IAM2 2VOPA 2NOGA 3P7NA 4YFXF 2JQ7A 1ZLKA 3SYTA 5E8IA 3HOZJ 2DA3A 3L1PA 1TL8A 3BG6A 1CF7A 2DU9A 3VODA 1OISA 3QWLA 3SFIA 4F93B 1XMAA 4KITB 5HDNA 1G3TA 5D5VB 2F5FA 4DBQA 4HOBA 3FK6A 2RNGA 2A6TA 5EJCA 3DF8A 2DJIA 2F5VA 3OIPA 4YRVA 3OYIA 4EGYA 1YI2I 3F8MA 4BEHB 2VJJA 1TC3C 2K9QA 3C18A 2DN0A 3O6BB 3CJTB 2ZXJA 1R22A 1B1BA 5C3EJ 2EQRA 1Z9CA 4MTEA 1FJLA 2W48A 4RMNA 3LWFA 3RSNA 1CQTA 3BTLA 2VBWA 2XIGA 3E6DA 4Y15A 3CCLI 1TW2A 3ABLH 3ML6A 3E3VA 2D1HA 3GUDA 2XPWA 3CCQI 1MSEC 3DPTA 5FB2A 3S15J 2XGEA 1R71A 1YW7A 4KICA 3FISA 1MD0A 4C3JJ 1F1ZA 2GA2A 3I59A 1QU3A 3JREA 4IPAA 2Z99A 2QBYA 4QPQA 5J1UA 1FSHA 4IXAA 2STWA 2O3FA 3VYSB 4U87A 3FMQA 2K40A 5EG0A 3WTXC 3KETA 3SEZA 1ZQ3P 3FXLA 2KISA 1YW8A 2IGMA 4AYBA 4S04A 4FCYA 3L2UA 1FTTA 2G7HA 2IXSA 2GWRA 3WTYC 4NQWB 2QWWA 5E8GA 5J1YA 2EA2A 3AFHA 2Z16A 2JA5J 3FIWA 5CKTA 3L00A 3IH3A 4IHVA 4LIUA 2WA0A 1S29A 2K5CA 3TQNA 4EATA 3I71A 1T08B 1IC8A 2QSGX 4BJTA 1MJ9A 3K1NA 1Z05A 1R00A 2V6EA 2XB5A 2HYJA 2HQ5A 4O3MA 2R3SA 5HS8A 3BJ6A 5LEJA 2BV6A 2IP2A 3OV8A 4M74A 3DFGA 2EPFA 2KRFA 2DA5A 2QENA 1P7IA 5BS6A 2V9KA 4CCOA 3CLQA 2C6YA 1GHCA 1USTA 2PBIA 2QKLB 3U9GA 1GXQA 1QVUA 4KUMA 4N0BA 3E5QA 2DMNA 2XROA 2YX7A 4U0YA 1CGPA 4UUTA 2BW3B 3GVAA 4OMZA 2RGVA 3Q3SA 2VONA 2XASA 3ZRGA 4PFPA 1T98A 1ZRCA 1TQMA 2DO7A 2PG4A 2P5LC 4FE4A 1JGSA 2HWVA 2HQRA 6PAXA 2DDBA 1JT0A 1VQ6I 5JR3A 3HC7A 3RQ4A 1A35A 4AC0A 3DKWA 1DP7P 2M0MA 3F3XA 3E6BA 2R7RA 2VJ4A 1YS7A 3DU6A 4J01A 1YO5C 1X1DA 2JT1A 1YHQI 4B47A 2KDOA 1WWXA 3BOQA 1HCRA 1L0OC 3C1DA 2HXIA 3DBLB 3WG7H 5HLTA 4BYYA 3CTAA 1LNWA 1U5TB 3E0JB 3ZQ7A 4HPQA 2R7QA 4KDPA 4L18B 4LG0A 4ZYHA 4A12A 3BR5A 1WPKA 2CW0F 5EZGA 1MH4A 1JUSA 2BHYA 2VQLA 4JX4A 3HRTA 5EZHA 1V3FA 2RQQA 2LLKA 2RN7A 4BH9A 5KAFC 2FQ3A 5B5EC 1ZR4A 1JUMA 2XAFA 1XTAA 4DJAA 3JSOA 4LGWA 1R49A 3FXRA 3ERED 3HTUA 1W7PA 4C3IJ 4MIMA 4R8HA 4HYEA 5EEAA 2IGKA 1TT0A 3T0YA 4E7IA 2CGPA 4DGWB 2FD5A 3DTIA 1E3PA 3M3YJ 2DBBA 4GCVA 4MEYF 3A01A 4KIFA 3RZDJ 1NH3A 1Z3XA 1MZBA 2WADA 3EUKL 4N9HA 5K7FA 5D8KB 2V7FA 1W5CC 5GTHC 2BYVE 5CLSA 3AKZA 1FY7A 1IZ1A 4HG2A 4MFEA 4XONA 5CYVA 1PVEA 4RA2A 4II3A 1P92A 3WHBA 2FOKA 5M3FJ 2P81A 1IN5A 1V5FA 2IA0A 3J7ZI 3LSTA 4G9YA 3IKTA 3BZ6A 5HLHA 1NK2P 4IHXA 1B8IB 4HV5A 4IOCF 2LOOA 3GWZA 4XLHA 3MZHA 1BIBA 5H20A 5FGMA 3X2QH 2W57A 1IV8A 4PUSA 1I1SA 3QPTA 5KNLA 3WU2C 2KHMA 1E17A 3V8LA 3I53A 3D5LA 2YR2A 4ANJA 1QPIA 1AU7A 1FPQA 3FK7A 1TWHJ 2VC1A 1Y1WJ 2JTVA 3ZQFA 2M7BA 4WK8F 2Z3YA 2E2HJ 2WC2A 3AG1H 2M87A 5J6XA 1VQ7I 1ON2A 1TLHB 2QKMB 1XMKA 3MKLA 1KQ8A 4ZTFA 4BKXA 3HB9A 1VQ4I 4BS9A 2WBMA 3K4JA 2CW7A 3G71I 1XSDA 2PJRA 4ITVA 1B59A 4BE0A 4I02A 2V4JC 4A3LJ 4EGZA 4IJAA 4GGGA 1R7JA 1T6SA 3CUOA 2R7UA 5E3NA 1I6XA 4R1HA 3SDBA 3QODA 2CFXA 4L9VA 1OR7C 5FLXZ 1A6QA 2DK8A 4A3DJ 1RUOA 2LG4A 3RPQA 5FRNA 2KMUA 1R1VA 2WAFA 3HXLA 4B1RA 2MC3A 1YW9A 2K4JA 5EF6A 2DTZA 4KIGA 4UUSA 3BPXA 1FMVA 2CUEA 3HRSA 3OYDA 1UFMA 1WI9A 3UKGA 1DUXC 3DEEA 2DYRH 2GIVA 5BPIA 4WCGA 1WRJA 2FSWA 5FRMA 1HKTA 4BAYA 3KZIC 3ROUA 3OYNA 1AWCA 2QGUA 3OR2C 4UB8C 1FP1D 3O8HA 1Z67A 3HOYJ 2MH2A 2DLLA 2E2JJ 5LBQA 1DU0A 1OCRH 3MEXA 3HTSB 1R58A 1JUPA 1TNTA 1BI2A 1OQYA 1P6RA 1TT5B 2DOEA 2G0EA 2WB1A 4Y52J 1FSEA 2O7OA 2VJ5A 3W3CA 4L9JA 3D0SA 3F0CA 1JJ8C 3JR9A 1D0ZA 3UNGC 5DCFA 2M2EA 3CDLA 1Y0UA 2XDVA 3GLLA 1FOWA 2LSOA 2CMPA 3H3UA 3LAJA 1B9NA 3T8TA 2QQ9A 2BXZA 2NVUB 1JKQC 2CO5A 4ZTJA 3VSKA 2DDAA 2JA2A 2JRTA 3GW2A 2F48A 1VQ5I 1RIOH 3CDHA 2FRHA 1E3HA 2ID3A 5HDKA 2V9PA 3DP7A 1UHSA 5EYRA 1JKPC 3UR3C 2QM3A 3W2VA 2IW5A 4JP0A 1U5TC 2M4KA 2FU4A 2RAEA 2W84A 2LBFA 4P9UA 5IY5H 5GTIC 4F91B 2EBIA 2P0WA 1NHAA 5EDNA 2CV1A 2DA1A 4IQJA 3JAMZ 3FXMA 5FLXK 1FYKA 3DLAA 1VZ0A 4UVCA 4BY7J 1U2WA 2O6GE 4B4CA 4P5OA 4EM0B 2BBYA 5KHDA 3GXOA 5KK1A 1D3YA 1K6YA 1G3SA 2MW8A 3I58A 1ACIA 4BDZA 1PP7U 3U21A 1IO2A 3IUOA 2R7DA 1X2MA 3OOPA 5BOXA 5FKNA 3HOXJ 3GTGJ 3GLXA 4V2GA 2I5UA 4LOCA 2R4GA 2L2OA 3MQ0A 5H6RA 1WQ2A 1EJ9A 1WH5A 4Y4RA 3HGGA 4E7SA 4M3GA 1KA8A 2VKEA 2CQKA 5M5YJ 3ZQCA 1YJNI 2ZMEC 3U1KA 4LB6B 4ETSA 1ENHA 2P7CB 4I98B 1Y6IA 4XORA 3OIOA 4HDVA 3VOEA 3AG4H 3QOPA 2DFIA 3CJQB 2MABA 2CSOA 2JVHA 4U7BA 3EYYA 4LB5A 3BR1A 2CQQA 5J8FA 3FXKA 3JRHA 5ILVA 1YS6A 1YG2A 2LK2A 1TZLA 4MHGA 4WX9A 1LE8B 4P1WA 2WAQA 1QO0D 4LJZF 1LDJA 1TQPA 3C3WA 4C3HJ 2HVRA 1XD7A 2HZDA 4Z2YA 1NTCA 1X1PA 1OMIA 3QU3A 4LIVA 1S8NA 4M9SA 1OJLA 4Y17A 1OLTA 3JCUC 4HX8A 3BT9A 1FP2A 4XSZF 3BP8A 4RS8A 4HNUA 4B48A 1R1TA 1R5HA 4WXHA 2FJ1A 4AIKA 1TNSA 3TMOA 2JRMA 2L9RA 2KKOA 4PGHA 1ZGAA 4A3GJ 5HNFA 2Q2EB 1IDZA 4YIIA 3BCAA 3BTJA 3I4PA 2A5WA 2R5YB 2FOWA 1GV2A 2Y31A 4G6DA 2OCEA 2ESNA 2FXAA 1SFUA 5AONA 1IRXA 2LR8A 1J0RA 2KIUA 2YX4A 3IC7A 1W5TA 1X58A 1N75A 3ABMH 5DV5A 4CYCA 5E3LA 2DAOA 4XKBA 3I3LA 3LA2A 3P5JA 2XKPA 1X1AA 4XRSA 3BDDA 3J80Z 1I6HJ 3CMEI 1X3WB 1PUFA 2R7TA 2B9SA 2MSYA 1EA3A 4IQ4A 2A61A 4BU2A 3PO3J 5CVIA 5K1YA 3E5XA 1XDSA 1I50J 4L5JA 3DV8A 1YRNB 1Z0XA 3I9V2 2Y9ZA 2GXAA 2R92J 3MAJA 1AA7A 2OA4A 3GCMA 1IAWA 2ZXIA 3HSEA 3NQOA 1IXCA 3F6OA 3G73A 2MC4A 3SJMA 1WJBA 3S93A 3DQVC 3QP6A 3DLLF 2H1KA 3CCMI 2I10A 2H09A 4BGDA 2NS7A 1FIPA 3R0AA 1W7PD 3OYBA 1MNDA 1RKWA 4IX7A 3CCEI 3U1DA 4W1UA 3IRQA 3ZPLA 4KNYA 3K2AA 1HSTA 1OCCH 2EA4A 3J7AO 3QYBA 4PJJA 1RETA 1BJZA 4IL6C 3KLOA 5EEHA 3CMMA 3RZOJ 5J4YA 2E5ZA 3MKYB 4A5NA 2ISZA 2V1DA 2V1XA 4MQVA 1FBQA 4YEJA 2PMZN 4PJMA 1YLFA 5B3SH 3DTEA 2IPQX 4BEHA 4A0ZA 2LKXA 1FIAA 1KYZA 1ZARA 4BE2A 4A3FJ 3OYJA 4CICA 3HZJA 1F36A 2EZLA 4FASD 3C2BA 3PFIA 4HQEA 3QPHA 1R9TJ 2HOEA 1EKEA 2L9SA 5L3BA 2O9LA 3K4NA 3CJRB 3M07A 3OYHA 1YX3A 2CS3A 2FF4A 1GUUA 3SXYA 4FETA 5GAGJ 4P9FA 2NOJB 1E0EA 2OF7A 3S16J 4NNJA 2NVTJ 2JWTA 3FX3A 3S32A 1JI8A 2DA2A 4Y33A 1SMTA 4M6YA 2BY1A 3I55I 3P9KA 3I56I 4J19A 3PUBA 1TTYA 2J5PA 4RAZA 3LSKA 2A3SA 2HZTA 2OV7A 1IG7A 3MZ8A 4G6QA 5IPAA 4QLCU 1Z7UA 2L54A 2MGQA 3GMEA 3RCOA 1PYVA 4D7MA 5K7HA 3J80K 1WH7A 2XVCA 3H9QA 1C0WA 2CV2A 2EB7A 4EVIA 3HDDA 2DFEA 3E5UA 1X4PA 1TP4A 1GLNA 3B02A 3WTZA 5BMZA 5L3EA 3ZQQA 2G7UA 3LSIA 4GDFA 5ICGA 3T8RA 2P5VA 4DYQA 2F5DA 2Z1DA 4EJUA 2R5ZB 2ISYA 5J47A 4BBRJ 3CCJI 2GZWA 1TW3A 3G3ZA 4OIOF 3OSGA 3K0LA 3FBNB 1ON1A 4B44A 4G7OF 1QHGA 2DOFA 2BHZA 3R4KA 2YU3A 5DD8A 3RYRA 1K83J 1QPMA 4HX4A 4MGRA 3J81K 1LB2A 3OMYA 4RLFA 3AG2H 3BY6A 2EV5A 3MKWB 1BN5A 2R7FA 4XMYA 2EFPA 2L7MP 1G6NA 1R4NB 2ZC2A 2X0LA 1UG2A 1QRYA 3LA3A 2NYXA 2HPIA 1MDMA 2QUFA 2H8RA 2DT5A 3S2DJ 3H1CA 3CCVI 2DA7A 3H5AA 1SMYF 4M3FA 2JMWA 2BE5F 5KCMA 4XLNF 4AWXB 4KT6A 4ASNA 4BXXJ 1ETXA 2FA5A 4BY1J 5D4RA 2GOXB 2VI6A 2NVYJ 3KFWX 2EFWA 4FX4A 5F1RA 3GTJJ 2MD0A 1OCTC 2V26A 1MMSA 3M1EA 1S3JA 1O7LA 5K7ZA 1U6GA 4LLLA 4UVAA 1S7AA 3HJEA 3WU0A 1W36C 1FBSA 1MBFA 2EFQA 2DMUA 4RGXA 3RTRA 4BQNA 2BY3A 4F7ZA 3H3VK 3M8FA 2HYFA 4KJZA 4S05A 4BJ5C 1GXPA 4BQAA 2RREA 3BPVA 1J9IA 4OMYA 2BW3A 3ZQLA 3KP6A 3CDIA 3TW7A 4UB6C 3ULQB 2DK5A 3L2QA 2R7SA 2W85A 2HNHA 5ICFA 2K9NA 5FJ8J 4XNFA 4PJ0C 3K4CA 2HKOA 4L5IA 3QU6A 1JKOC 3BR3A 3G6EI 4JX6A 2XF6A 3SQNA 1IJWC 3SFZA 4JK1X 1YJWI 1U5TA 5D6FA 2K02A 3WGHA 1JXSA 3E7LA 3RI4A 2KL4A 4A5MA 1YIJI 3PUFA 1ZGWA 2A05A 2DJNA 5IYCJ 2E71A 4GYIA 2E5NA 2ZFWA 1W4MA 1XN7A 4LITA 5F04A 2VKHA 3NWTA 2WY7Q 1BIAA 2ELKA 2MD5A 4IO9F 2OJED 1P4XA 2CQXA 3O3KA 4WF2A 2RVCA 4ZC3A 3BR0A 1O3SA 5E1WA 3RYPA 4I76A 2AXLA 3HOWJ 4FE7A 4NUBA 3PIPF 5HS9A 2VPLA 3K70C 4BBSJ 3C7JA 3FXJA 2BZTA 5J40A 1WSUA 1QBJA 2GXGA 2R0QC 1ONVA 3ABTA 1H9TA 2W24A 5FD6A 3F23A 2QEXI 3S2HJ 1NG7A 4CZZA 2M5WA 4YFKF 1O3TA 4RDUA 1HDPA 1P2FA 3P9IA 1YITI 4J00A 2CJJA 2RKHA 3O2PE 5LD2C 2JN6A 3HEFA 3FHZA 2FBKA 2OAZA 5CVUA 1K7AA 4AVZA 3DBRB 1SFXA 4XLCA 3EYIA 2ZMEA 1BI1A 1B8IA 2UZKA 5L3DA 1XDUA 2VE9A 2X1CA 4ESJA 2L0KA 1X2NA 1ULYA 3G1MA 1I5ZA 2NNYA 1BI0A 4QIWN 2Z2SB 2X6WA 1CF7B 2WWYA 4IHWA 1ZLJA 4PCQA 5JHFA 1VQOI 4DNCA 1KU9A 5LFAA 2XKOA 3ABUA 3OYGA 1V5GA 5L3GA 4LG3A 3ESWB 5J3LA 2ELHA 1VTNC 2PMUA 2QVOA 2M34A 2LFBA 2RV8A 4CDGA 1Y39A 2AO9A 2VBXA 3TDUC 1XGOA 4YFNF 4ZDOA 2EIKH 4N4OB 4KISA 1JTXA 3SZPA 5IT9Z 3HOVJ 1FYMA 4C2UA 5TISC 2D45A 1ERDA 3BC8A 3V8KA 1D1CA 1B6AA 3HOSA 2GQQA 2DPUA 3LSMA 3EPZA 2XAGA 3FM3A 3DKYA 2PN6A 1XC5A 3EDPA 1RKTA 1ZK8A 2XRNA 2CRGA 1Y0NA 3O8GA 3VSLA 1S7EA 3MFKA 3KIOA 3MWMA 4B3AA 4XN3A 2K9MA 5CQEA 3BR6A 2RNJA 1RI7A 3CUQB 1PP8F 2DQRA 4ESFA 5LGTA 1FNNA 4YIRX 4XQFA 5E20A 3GTLJ 5IP9J 1OCZH 4EM1A 4C2MJ 1IDYA 4A3CJ 2KIQA 3NRVA 3KZYA 1J5YA 1XSVA 2DODA 2LDUA 3CC7I 1SEUA 3R60A 2M8GX 1ZREA 1WZ2A 3ZN0A 3OYLA 3WHCA 4LK0F 1N78A 1D8JA 4KMUX 4NB5A 2MH9A 5EGOA 2JK3A 4JYKA 3BR2A 5D4SA 2DFHA 4A6EA 2HR3A 2ZBKA 1F43A 3OS1A 5EG0B 1J7KA 2VBZA 1XCBA 1VI0A 2LP0A 3TEDA 1SD5A 5BPDA 4C2TA 1R23A 1DU6A 3FMRA 3K7AJ 1QA6A 1ZHFA 3KCCA 2K9SA 2E36A 5FLMJ 5FFZA 3CCRI 1GDTA 2X6XA 3J7AY 3KP3A 3LFKA 2PEXA 2Q0OA 2EIJH 2ICWG 1HC8A 3JRIA 3CCUI 3WTTC 2Q8KA 1P4WA 1AKHA 3ZOBA 3A03A 4HSRA 3DBHB 2KZGA 1G4DA 3MKZA 3JTGA 3HHGA 3BCBA 5E1ZB 3T5XA 1KQ0A 1PUEE 3TOAA 1LDDA 3KP5A 3IWFA 1DDNA 1UMQA 2IGOA 3I0TA 3PNTA 2VL8A 1ZR2A 1WJEA 3RPUD 3E6CC 3SDGA 1ZG1A 2COBA 4LLGF 4LK1F 3TGNA 4PSXA 4BHBA 1TWGJ 4BUPA 4ENKA 1XSXA 1MH3A 2F5CA 1MBEA 3PJRA 4QPOA 1NK3P 1IUYA 2EJRA 2QF7A 1JKRC 2F4IA 2V1UA 1MMGA 2Y69H 1O3RA 3K4MA 2IS1A 5DTDA 1EH6A 1U9OA 1SD7A 3IP4B 1IGNA 2FBHA 1LJ9A 5F08A 1ITYA 1TQIA 2LC2A 2UUZA 2X1DA 1BI3A 1O7FA 4I0BA 4O5VA 2ACJA 4D9JA 1FC3A 3S1NJ 1QHHD 4BE1A 5DD4A 1RRJA 2YU9J 5LLQA 3D5SC 1SANA 3PFYA 5IYBJ 2VC0A 1RZ4A 3B6CA 2W00A 2XGDA 3BG7A 4NDLA 2QA4I 3GEZA 4FX0A 3TP3A 1BBYA 1K78B 1ORKA 3I4NJ 3FF5A 5HOOA 2GA1A 5LGUA 1X19A 2KPMA 3QP5A 5A2QZ 2E1OA 2CQ7A 3GFJA 4IEJA 3ZMTA 1JHFA 1Z6TA 2KJCA 5IP7J 2VQCA 3DKXA 4PFOA 1HBXG 3CMAI 2UV1A 5GPAA 1J2XA 4M9ZA 4H0EA 1GV5A 3ISPA 2BVLA 1SVLA 4RB1A 2OZ6A 1YTYA 3LQQA 4HF2A 3OY9A 1IN6A 2VODA 2PX9A 3B73A 2KIMA 2OC6A 3B6AA 3DEWA 5K5QA 4Q5SF 2PLYA 2DQLA 4BL0B 1SFKA 3A2KA 3PO2J 2A5YB 5HODA 1FTZA 3ZQHA 1JE8A 3AL0B 2R7VA 2CFOA 4PK4A 3DCFA 4Y3OA 4RBOA 4HW0A 1FYLA 1H8AC 4A3EJ 2HDDA 1T33A 2CG4A 5IOYA 3IAS2 3GF2A 3Q0UA 4I6ZA 2NXNB 4N9IA 3GX4X 3ZMZA 3NWSA 3FM5A 2LF7A 4U0WA 2Q2EA 5K5OA 4EEFG 1VFCA 2HYGD 3E97A 2PQ8A 2F2EA 1SFEA 1XG1A 2GLOA 3TDZC 2FX0A 2E1MB 3I64A 2XGXA 4F92B 2MG4A 3ASOH 2A69F 2ID6A 3K9TA 4WXDA 1P7JA 5D5WB 4KA4A 2Y0SN 3CUQC 3OYKA 4ZYDA 2QSFX 4XKCA 1LEBA 2W7NA 2EV0A 4M6XA 3ELKA 5H2FC 2KLOA 3EUHC 3H9GA 2FUG2 4MTDA 2ZFUA 4AUXA 1T95A 3S8PA 2P4WA 3V8JA 4XRFA 5TJJA 2IT0A 3V4GA 5B1BH 4ZYEA 5KAIC 3HHHA 2KZVA 1HDDC 2IS6A 5D5XB 1K4SA 2ECBA 3OS2A 2OQGA 4ZZLA 1MNMC 1R6RA 4ENNA 3IH2A 2EV6A 2EFOA 1BM9A 5A2QK 4UUVA 4BHPA 4F3QA 5J1RA 2M7AA 4XKVA 2ZCWA 2EINH 3I5UA 2VKDA 4IKFA 2IRFG 3ECHA 4E70A 1BR2A 5E3MA 3FDYA 2Z5UA 3BQZA 1ZKGA 1ZN2A 5JVTA 3H5NA 2X9DA 2M9HA 2R7XA 4BNCA 4E7ZA 2XGCA 4XIDA 4HSTA 4JQFA 4HQMA 4HLXA 4FTHA 3RDIA 3RJPA 2E2IJ 3MD2A 3OYMA 3ZQIA 1G3WA 5LHGA 3GZ5A 4P55A 1D0YA 4RAYA 1GVDA 2XAHA 4HV6A 4UV8A 3RQIA 3LSPA 4QSHA 4HNVA 1DGWY 4N4NB 4F55A 9ANTA 4V2FA 3IH4A 2M1BA 1ZELA 1VF9A 2FBIA 1IRFA 3F8FA 1W0TA 2NRAC 4NBQA 3QQAA 1OFCX 5FKLA 2DMQA 2OCCH 1IRGA 2V6CA 4BXUA 2A6EF 3E1SA 4YIFA 3MCZA 5HLIA 2D2WA 2AQEA 2O8KA 3F72A 5DCMA 4RM2A 2JSPA 2VIXA 4HZFA 4A0YA 2XF7A 2IS4A 1RESA 3OYEA 4U0VA 2IVMA 2N8GA 4PJLA 3BJAA 1EH7A 2CH0A 3A0HC 2LY9A 3G2BA 3JAMK 1XPXA 4Q47A 4BJ6C 3PM1A 1WFXA 5FROA 3F8NA 1UCRA 3V7SA 3KEYA 3WTVC 1UHWA 3DXJF 3TOBA 4IZZA 3TO6A 2P5KA 4Y7NJ 4FHTA 4KIBA 2VXDA 4NC7A 1FBUA 5ILSA 3JRBA 3GZNB 1ZG5A 2R5ZA 3V7RA 1B72B 1RUNA 1TWAJ 3HL2A 1BR1A 3HPHA 4DOZA 5ED4A 2Y0MA 5GPCA 4E4HA 2HTSA 1I3AA 2CYYA 4CHUA 4WWCA 2CU7A 1V55H 3CC4I 4XKWA 3C2HA 1HKQA 2E34A 1OYWA 2HDWA 4EJVA 3CF5F 1VQKI 4RM3A 2ETHA 2KFDA 4HDUA 2OD5A 5FD5A 1POGA 1Z3YA 4A2UA 3ZCOA 4X6AJ 3VB2A 3OYCA 5GADJ 2YS9A 5CVJA 4RB3C 2CUFA 2LRDA 5E3OA 3QYEA 3HIFA 5CJ9A 3L2WA 1G8XA 2NVQJ 4UNOA 1X1CA 3MMYB 3HM5A 4MFDA 2GM4A 2COMA 2BVMA 2O5RA 5FFXA 3F6VA 1T0FC 1RPWA 2TDXA 1O4XA 3AL0C 3OL3A 4A93J 3HRMA 2ZNYA 2FQ4A 2WTEA 3JRCA 2ADUA 1QZYA 2IJLA 2EIMH 2A6HF 2EILH 3DEUA 2K86A 3RPUA 4D5FA 1FZPB 2GBYA 3LL7A 2QQ8A 2X6YA 2JPCA 1PDNC 3GYHX 2FE3A 1BJAA 2HOTA 2YSRA 2GXBA 3H9JA 3QPLA 2E1MC 4DYCA 4WXCA 3OYFA 5EEGA 1W1WE 2CWEA 1Z77A 1HSJA 3RKYA 1WJ5A 2WY8Q 4IRIA 1YQAA 1KGSA 2F6CA 1QZEA 1K4TA 2QYOA 4G8XA 1HXDA 4A3BJ 2VLAA 3JRGA 3IKVA 3VYTB 1A5JA 1WGXA 2MBFA 4EM2A 2QZ8A 4A3JJ 3HUGB 1WHUA 4IRGA 2LY2A 2KRHA 2H8WA 4U7DA 4Q4ZF 2NNNA 3BG3A 5B66C 4F52A 2DXIA 1O3QA 1S72I 1U0JA 4JX5A 1KU2A 1LPQA 1FOKA 3GTPJ 1OR7A 4CYCB 2OUMA 3S17J 1R4MB 3HYIA 4RAFA 2ZXHA 2HVSA 3Q0WA 5DM7F 2H94A 5L3FA 4RGRA 1XCVA 4BACA 1PUFB 2K85A 3BLYA 2X1EA 4NQWA 3V42A 1K79A 1SAXA 2XSJC 1MMDA 1SVMA 3ZXSA 3GBGA 2L01A 2K7LA 2PMHA 3D1NI 4CYDA 3C2GA 3DPUA 4OOIA 1T56A 2YUSA 5HVQC 2P8TA 3GTQJ 1S9HA 3Q9VA 3BZKA 5LHHA 1I1GA 3ECOA 2CV0A 2PJPA 2JJ7A 2LF8A 3F8CA 3PSIA 4ABZA 5HS7A 1MGTA 2HI3A 2X4HA 5DEQA 1OYYA 2R7WA 2DFFA 3BQYA 1MJBA 1LVAA 1ZGJA 2EZIA 4KMFA 2H1LA 3GTMJ 1V5EA 2HOAA 2VT3A 2K9LA 2XC7A 1FMWA 2QLZA 4DZJA 1SC7A 3PIOF 2QSHX 3JRFA 3F22A 3S1QJ 2VKVA 4AM3A 3FXUA 3KYCB 5B1AH 1J75A 4HAMA 1JTYA 1R5GA 3SZTA 2DT6A 1ZH5A 3SEQA 4XRMA 5JHUA 4XICA 4G7HF 3PQKA 4BXFA 4L5EA 2H6CA 3L2RA 1T2KA 5ICCA 3CO7C 3HPGA 1KU3A 3LQRA 1W36D 4QTRA 1DGRM 1XS9A 5FO5A 1K61A 3EETA 3GFIA 2IAIA 3ZP5A 4AIJA 2L02A 3FXOA 4H4KC 3PNYA 4M3DA 2JUCA 3I4MJ 2HU9A 5HLGA 1WJDA 2OQRA 4HA8A 3W6KB 2HS5A 2Y48A 1D1AA 3DU5A 3W6VA 3CUQA 4NC6A 2BOLA 4LFUA 1G2HA 2L9VA 4AU7A 1JT6A 3AAFA 3HBLA 1W0UA 1D1BA 2EWNA 4X0GA 1QZZA 3EUHA 4IOAF 5LRRA 3L9FA 5ICEA 4HX7A 1D8KA 3ERMA 1I27A 2DA4A 3TKYA 5JFRA 1N25A 2M8EA 5TGTA 1UZCA 5F1JA 4C30A 1DP3A 2E7XA 4MEXF 1SVOA 3OS0A 1IXSB 2XRLA 1MIJA 2FNAA 4S0HB 2PMZA 5BQTA 2DPDA 4E6KG 2VASA 3VEPA 2XPVA 3TP0A 1WKMA 4UXNA 4CGZA 4IVNA 1BOAA 5DYMA 2CW8A 4M73A 4XLEA 3KEOA 3CJNA 4CZCA 4L9TA 4OIQF 5ILUA 3K70D 1V4RA 1Z7LA 1JHHA 2JZYA 2LVSA 2UWMA 3A1YA 3FHNA 2XAJA 4ESBA 4I99C 2WAEA 2XHKA 1EV7A 1Z6RA 2QQAA 1FT9A 2X48A 2K3PA 3FKJA 2WV0A 3HSRA 4JBAA 4JOMA 1BW6A 2ZKZA 2DOAA 4MQ9F 4C9YA 5C4XJ 1TWFJ 1Y8QB 3RKXA 5D6EA 1U9NA 1MDMB 1O57A 5H6QA 5E1XA 3VWBA 2ELJA 2JA7J 4V19K 2GIZA 4M9XA 3VPRA 5F0HA 1VQ8I 3OYAA 1T8IA 5LEKA 3H0DA 2W82A 1H89C 4DYRA 1NG6A 2HGCA 3WU1B 4CCKA 2AXTC 5CVRA 3A4CA 1QNTA 4E7LA 2JVGA 3OWTA 2XPUA 4MO7A 2CUJA 1E3OC 2DCEA 2Y30A 4GFBA 4ZYGA 2HPMA 2VN2A 4XLFA 3CP8A 2L7KA 5HDGA 3OR1C 2VXZA 4OIPF 1MMNA 3QAHA 1W5SA 4B8XA 3H35A 1IW7F 5M5XJ 2O03A 2WB1N 2XAUA 1MJAA 1ETWA 4L0YB 2VT2A 2M0CA 4CUGA 3BJOA 3LMMA 1MKMA 3PSFA 4I2OA 1X3UA 2J5OA 4RAGA 1BA5A 2E1NA 3M4OJ 2Y9YA 2HFHA 4M3BA 1SFOJ 4IHTA 4FQGA 4Y13A 1K6OA 3F8BA 2BGCA 1SD6A 1U78A
chains in the Genus database with same CATH topology
5DUKA 4B09A 2ZJ2A 4GXOA 5KVRA 2STTA 3I59B 2QBYB 3WE2A 1K78A 1RNLA 3K69A 1H9GA 4MNUA 3GFMA 2LKPA 1HQCA 3Q9SA 2H27A 3ZMSA 3SHFA 1T39A 1P4AA 4I0AA 4ZH4F 3S2WA 2VBYA 3WGIA 4D0PA 3ZN1A 3I54A 4RGSA 3N4MA 1QQIA 3V7CA 1KU7A 3E6MA 1XB4A 4IHSA 1T0FA 2ZMEB 3ZMDA 3IWZA 1Z1DA 1SD4A 3N97A 5IT9K 4QWQA 4A6DA 1EH8A 1ZG3A 2OBPA 4YG2F 1FWZA 1Z91A 2O8XA 1QGPA 3R0JA 3GZ6A 4I01A 3W6JB 2A07F 1YIOA 2JPBA 1DPUA 1LEAA 4RGUA 2L4MA 3FMSA 3GO5A 2HDCA 1Q1HA 1UHMA 3TO7A 1B4AA 4EJOA 4UHTA 2P6SA 4RB0A 4LG0B 4G94A 3F21A 4LD5A 1H0MA 5D8LB 3M8EA 5LGNA 4GO1A 4FT8A 1ZRFA 1OYIA 1OPCA 2K27A 4EQQA 1HW1A 4ZZDA 2O61A 3JW4A 2M30A 4OU0A 4K2EA 3P9CA 2P7VB 1W7PB 4M71A 1R36A 4EV0A 2GAUA 3WG9A 3DPLC 2FMYA 4KT5C 4ENJA 3L09A 3VFZA 4DQ2A 4NHJA 4KYWA 1J59A 2L3DA 4M72A 3K1PA 2KIFA 1REPC 4AVPA 5LHIA 4Q48A 5AIQA 4U88A 1AOYA 3KP2A 2E7WA 4G7ZF 5F64A 2HQNA 1A04A 3CLOA 2FEZA 4CO8A 3GFLA 2Z9OA 1T38A 5J8CA 1ZYRF 2VOOA 5E17F 3RKWA 1B9MA 3REOA 3RIRA 1D5VA 3MZYA 1E2XA 3H3ZA 2K4BA 3KLNA 3LA7A 1XGSA 3JTHA 5E18F 1G3YA 3LAPA 3WE3A 5CVVA 1L3LA 4UV9A 5IT3A 1U3EM 2D1VA 3CO6C 4EJWA 3JSPA 2MLKA 3IL2A 1IXRC 2B0LA 5DDGA 2MA3A 2RC4A 4A0XA 1S6LA 1KYWA 2PFBA 1U8RA 2FNPA 4CXFA 2IA2A 4EJTA 1ZAOA 2FMLA 2XV4S 3FWEA 3WTUC 1HW5A 3PQJA 2L4AA 4PZJA 1F9NA 3K1MA 4L0ZB 3R61A 3QRFF 2YPRA 2MLGA 2Z33A 4HLYA 3NEUA 3M9AA 3IRRA 2RQPA 2IA1A 4HF1A 5ERIA 3M7GA 2DW4A 1BC7C 1TBXA 1FX7A 4O6JA 2ZNZA 2XAQA 3T1BA 4P96A 4AD9A 4UVBA 5F6FA 3EQLF 3U2RA 5LRSA 3HUGA 2M45A 3KP4A 2BEOA 1YYVA 2KJBA 4BHCA 4KN4X 4XBFA 2LNBA 1GVJA 3WODF 3Q5FA 3WTWC 2H6BA 1KQ9A 3BROA 2PI0A 1IN8A 3HRUA 1STZA 1IF1A 2HEOA 1XGMA 1LDKB 3KE2A 1BC8C 2E1CA 3KEQA 2NS0A 3R6SA 3L2CA 1OKRA 2HKXA 2W25A 4ENMA 5D5UB 5JI6A 2EK5A 4LLNA 3ZMUA 1F5TA 1HW2A 2UXNA 1YFHA 4TV7A 3BWGA 3K2ZA 2JSCA 3J81Z 5L3CA 3L7WA 4HBLA 1USSA 3HSFA 3IHUA 3TO9A 1IN4A 4I7HA 2OZUA 1ZRDA 3KP7A 4IF4A 4ON0A 2RDPA 4L9NA 1IN7A 3HOTA 3WGGA 1HKSA 2V9VA 2EFNA 3ZMVA 4XSXF 3FZVA 2UXXA 2HTJA 2OU2A 5DUIA 2AS5F 2QQBA 3KZZA 1ODDA 4GYGA 4PGGA 4XLPF 2P6TA 4KN7X 4I09A 5DCMB 1DPRA 3WTSC 3COAC 4OINF 4LMYA 1UB9A 2ZO4A 1FLIA 2A68F 2V79A 4IRHA 3FXQA 2Y75A 4AIHA 1XGNA 4HF0A 4EMSA 2F5EA 2NAZA 5TRDA 2O0YA 4R79A 3H92A 2XUBA 4OIRF 2G9WA 5K5RA 1S7OA 4KFCA 4PDKA 1LQ1A 5AIPA 2VE8A 4RB2C 1R1UA 2ESHA 2DI3A 2DTRA 1F4KA 2VOPA 3P7NA 4YFXF 1ZLKA 5E8IA 1CF7A 2DU9A 3VODA 1XMAA 5HDNA 1G3TA 5D5VB 2F5FA 4HOBA 3DF8A 4EGYA 3F8MA 3C18A 3O6BB 2ZXJA 1R22A 1B1BA 1Z9CA 4MTEA 3LWFA 2VBWA 2XIGA 3E6DA 4Y15A 1TW2A 3ML6A 3E3VA 2D1HA 3GUDA 3DPTA 5FB2A 1YW7A 4KICA 1MD0A 1F1ZA 2GA2A 3I59A 4IPAA 2Z99A 2QBYA 1FSHA 4IXAA 2STWA 2O3FA 3FMQA 3WTXC 3KETA 1YW8A 4S04A 2G7HA 2GWRA 3WTYC 2QWWA 5E8GA 2EA2A 3L00A 1S29A 3TQNA 3I71A 1MJ9A 3K1NA 1Z05A 1R00A 4O3MA 2R3SA 5HS8A 3BJ6A 5LEJA 2BV6A 2IP2A 3OV8A 4M74A 3DFGA 2QENA 2KRFA 5BS6A 2C6YA 1GHCA 1USTA 2PBIA 3U9GA 1GXQA 4KUMA 4N0BA 3E5QA 2XROA 2YX7A 4U0YA 1CGPA 3GVAA 4OMZA 2RGVA 2VONA 2XASA 1T98A 1ZRCA 1TQMA 2DO7A 2PG4A 2P5LC 1JGSA 2HWVA 2HQRA 6PAXA 5JR3A 3DKWA 1DP7P 3F3XA 3E6BA 1YS7A 1YO5C 2JT1A 3BOQA 1WWXA 1L0OC 3C1DA 4BYYA 3CTAA 1LNWA 1U5TB 3ZQ7A 4KDPA 4L18B 4LG0A 4ZYHA 4A12A 2CW0F 3HRTA 1V3FA 2RN7A 4BH9A 2FQ3A 2XAFA 3JSOA 4LGWA 3FXRA 3ERED 3HTUA 1W7PA 4R8HA 4HYEA 2CGPA 3T0YA 2DBBA 4GCVA 4MEYF 4KIFA 1MZBA 4N9HA 5D8KB 2BYVE 5CLSA 1FY7A 1IZ1A 5CYVA 1P92A 2FOKA 1IN5A 2IA0A 3LSTA 4G9YA 3IKTA 3BZ6A 5HLHA 4HV5A 3GWZA 3MZHA 1BIBA 5H20A 5FGMA 2W57A 1I1SA 3QPTA 1E17A 3V8LA 3I53A 3D5LA 2YR2A 1FPQA 2VC1A 2JTVA 4WK8F 2Z3YA 2WC2A 2M87A 5J6XA 1ON2A 1TLHB 1XMKA 1KQ8A 1XSDA 1B59A 4I02A 4EGZA 4IJAA 4GGGA 1R7JA 1T6SA 3CUOA 1I6XA 4R1HA 2CFXA 4L9VA 5FLXZ 2DK8A 1RUOA 3RPQA 1R1VA 2MC3A 1YW9A 2K4JA 4KIGA 3BPXA 3HRSA 1UFMA 1WI9A 1DUXC 2GIVA 5BPIA 4WCGA 1WRJA 2FSWA 1HKTA 4BAYA 3ROUA 1AWCA 1FP1D 2MH2A 2DLLA 5LBQA 3MEXA 3HTSB 1R58A 1TNTA 1BI2A 1P6RA 1FSEA 4L9JA 3D0SA 5DCFA 1Y0UA 2LSOA 3LAJA 3H3UA 1B9NA 3T8TA 2QQ9A 2CO5A 2JRTA 3GW2A 1RIOH 3CDHA 2FRHA 5HDKA 3DP7A 2QM3A 2IW5A 1U5TC 2FU4A 2W84A 4P9UA 1NHAA 3JAMZ 5FLXK 1FYKA 4UVCA 1U2WA 2O6GE 4P5OA 4EM0B 2BBYA 3GXOA 5KK1A 1D3YA 1G3SA 3I58A 1PP7U 2R7DA 3OOPA 5BOXA 3GLXA 3MQ0A 5H6RA 1WQ2A 1KA8A 2CQKA 4LB6B 4ETSA 2P7CB 4I98B 4HDVA 3VOEA 3QOPA 2DFIA 2CSOA 4U7BA 3EYYA 4LB5A 5J8FA 5ILVA 1YS6A 1YG2A 4MHGA 4WX9A 1QO0D 4LJZF 1LDJA 1TQPA 3C3WA 1XD7A 4Z2YA 1OMIA 3QU3A 1S8NA 4M9SA 4Y17A 4HX8A 1FP2A 4XSZF 3BP8A 4RS8A 1R1TA 1R5HA 4WXHA 4AIKA 1TNSA 2KKOA 4PGHA 1ZGAA 4YIIA 3I4PA 4G6DA 2ESNA 2FXAA 1SFUA 5AONA 1J0RA 2KIUA 2YX4A 3IC7A 1W5TA 5DV5A 2DAOA 3LA2A 2XKPA 3BDDA 3J80Z 2A61A 5CVIA 5K1YA 3E5XA 1XDSA 4L5JA 3DV8A 3MAJA 2OA4A 1IAWA 3HSEA 3NQOA 1IXCA 3F6OA 3G73A 3DQVC 3QP6A 2H09A 3R0AA 1W7PD 3U1DA 3ZPLA 3IRQA 4KNYA 1HSTA 2EA4A 3J7AO 3KLOA 5EEHA 4A5NA 2ISZA 2V1DA 2V1XA 4MQVA 1FBQA 1YLFA 2IPQX 4A0ZA 1KYZA 1ZARA 4CICA 4HQEA 3PFIA 3QPHA 2HOEA 5L3BA 2FF4A 3SXYA 4P9FA 3FX3A 1SMTA 4M6YA 3P9KA 1TTYA 2J5PA 4RAZA 2A3SA 2HZTA 4G6QA 4QLCU 1Z7UA 2L54A 3J80K 1C0WA 2XVCA 2EB7A 4EVIA 3E5UA 3WTZA 3B02A 5BMZA 5L3EA 2G7UA 5ICGA 3T8RA 2P5VA 2F5DA 4EJUA 2ISYA 2GZWA 1TW3A 3G3ZA 4OIOF 3K0LA 1ON1A 4G7OF 3R4KA 2YU3A 5DD8A 3RYRA 1QPMA 4HX4A 4MGRA 3J81K 1LB2A 3BY6A 2EV5A 1BN5A 2R7FA 2EFPA 1G6NA 2X0LA 3LA3A 2NYXA 1MDMA 2QUFA 2DT5A 1SMYF 2BE5F 4XLNF 4AWXB 4ASNA 2FA5A 5D4RA 3KFWX 2EFWA 4FX4A 5F1RA 3M1EA 1S3JA 1O7LA 1U6GA 4LLLA 4UVAA 1S7AA 3WU0A 1FBSA 2EFQA 4RGXA 4F7ZA 3RTRA 3M8FA 2HYFA 4S05A 1GXPA 4BQAA 3BPVA 1J9IA 4OMYA 3KP6A 3ULQB 2DK5A 2W85A 5ICFA 2HKOA 4L5IA 3QU6A 3SQNA 3SFZA 4JK1X 1U5TA 5D6FA 2K02A 3WGHA 1JXSA 3RI4A 4A5MA 4GYIA 2ZFWA 1W4MA 1XN7A 1BIAA 2MD5A 4WF2A 1P4XA 3O3KA 2RVCA 1O3SA 5E1WA 3RYPA 2AXLA 5HS9A 3C7JA 1WSUA 1QBJA 2GXGA 1ONVA 3ABTA 1H9TA 2W24A 5FD6A 3F23A 4CZZA 2M5WA 4YFKF 1O3TA 1P2FA 3P9IA 2RKHA 3O2PE 3FHZA 2FBKA 2OAZA 5CVUA 1K7AA 1SFXA 3EYIA 2ZMEA 1BI1A 2UZKA 5L3DA 1XDUA 2VE9A 4ESJA 1ULYA 1I5ZA 2NNYA 1BI0A 1CF7B 2WWYA 1ZLJA 4PCQA 4DNCA 1KU9A 2XKOA 3ABUA 5L3GA 1VTNC 2ELHA 2PMUA 2QVOA 2RV8A 4CDGA 2VBXA 3TDUC 1XGOA 4YFNF 3SZPA 5IT9Z 1FYMA 2D45A 3V8KA 1B6AA 3HOSA 2GQQA 2DPUA 2XAGA 3FM3A 2PN6A 3EDPA 2XRNA 3MFKA 3MWMA 2RNJA 1RI7A 3CUQB 1PP8F 2DQRA 4ESFA 5LGTA 1FNNA 5E20A 4EM1A 3NRVA 3KZYA 1J5YA 1XSVA 2LDUA 3R60A 1ZREA 3ZN0A 4LK0F 1D8JA 4KMUX 4NB5A 2MH9A 5D4SA 4A6EA 2HR3A 2ZBKA 1J7KA 2VBZA 1XCBA 1SD5A 5BPDA 1R23A 3FMRA 1ZHFA 3KCCA 5FFZA 3KP3A 3LFKA 2PEXA 2Q0OA 3WTTC 2Q8KA 1P4WA 1G4DA 3JTGA 3HHGA 5E1ZB 3T5XA 1KQ0A 1PUEE 3TOAA 1LDDA 3KP5A 3IWFA 1DDNA 3I0TA 3E6CC 1ZG1A 4LLGF 4LK1F 3TGNA 4BHBA 4ENKA 1XSXA 2F5CA 1IUYA 2EJRA 2V1UA 1O3RA 1EH6A 1SD7A 2FBHA 1LJ9A 1TQIA 1BI3A 1O7FA 4I0BA 4O5VA 2ACJA 1FC3A 5DD4A 5LLQA 2VC0A 1RZ4A 3GEZA 4FX0A 1BBYA 1K78B 3FF5A 5HOOA 2GA1A 5LGUA 3QP5A 5A2QZ 3GFJA 3ZMTA 1JHFA 1Z6TA 2KJCA 1HBXG 1J2XA 4M9ZA 4H0EA 3ISPA 4RB1A 2OZ6A 1YTYA 3LQQA 4HF2A 1IN6A 2VODA 3B73A 2KIMA 4Q5SF 5K5QA 2PLYA 2DQLA 2A5YB 1JE8A 1FYLA 4HW0A 2CG4A 3GF2A 4N9IA 3GX4X 3ZMZA 3FM5A 2LF7A 4U0WA 2Q2EA 5K5OA 2HYGD 3E97A 2PQ8A 2F2EA 1SFEA 3TDZC 3I64A 2XGXA 2A69F 3K9TA 4WXDA 5D5WB 4KA4A 3CUQC 4ZYDA 1LEBA 2EV0A 4M6XA 3ELKA 4MTDA 3V8JA 2P4WA 4XRFA 5TJJA 2IT0A 3V4GA 4ZYEA 3HHHA 5D5XB 2OQGA 4ZZLA 4ENNA 2EV6A 2EFOA 1BM9A 5A2QK 4UUVA 4BHPA 2ZCWA 3I5UA 2IRFG 3ECHA 4E70A 2Z5UA 1ZN2A 5JVTA 4BNCA 4JQFA 4HQMA 4HLXA 3RDIA 3RJPA 1G3WA 5LHGA 3GZ5A 4P55A 4RAYA 4HV6A 2XAHA 4UV8A 2M1BA 2FBIA 1IRFA 3F8FA 2NRAC 1IRGA 2V6CA 4BXUA 2A6EF 4YIFA 3MCZA 5HLIA 2D2WA 3F72A 5DCMA 4HZFA 4A0YA 4U0VA 2IVMA 3BJAA 1EH7A 3JAMK 4Q47A 3F8NA 1UCRA 3V7SA 3WTVC 1UHWA 3DXJF 3TOBA 3TO6A 2P5KA 4FHTA 4KIBA 1FBUA 5ILSA 1ZG5A 3V7RA 1RUNA 5ED4A 2Y0MA 2HTSA 2CYYA 4CHUA 4WWCA 1HKQA 1OYWA 4EJVA 2ETHA 4HDUA 2OD5A 5FD5A 4A2UA 3VB2A 5CVJA 4RB3C 3HIFA 5CJ9A 4UNOA 2COMA 5FFXA 3F6VA 2TDXA 3HRMA 2ZNYA 2WTEA 2ADUA 1QZYA 2IJLA 2A6HF 3DEUA 2K86A 3RPUA 1FZPB 2JPCA 1PDNC 3GYHX 2FE3A 1BJAA 2YSRA 2GXBA 4WXCA 5EEGA 2CWEA 1HSJA 3RKYA 4IRIA 1YQAA 1KGSA 2QYOA 4G8XA 1HXDA 3IKVA 2MBFA 4EM2A 2QZ8A 4IRGA 4U7DA 4Q4ZF 2NNNA 1O3QA 1KU2A 1FOKA 1OR7A 3HYIA 2H94A 5L3FA 4RGRA 1XCVA 4NQWA 1K79A 1SAXA 2L01A 2K7LA 2PMHA 4CYDA 4OOIA 5HVQC 2P8TA 3Q9VA 5LHHA 1I1GA 3ECOA 2PJPA 2LF8A 3F8CA 5HS7A 1MGTA 2X4HA 5DEQA 1OYYA 1MJBA 1LVAA 1ZGJA 4KMFA 2VT3A 2QLZA 3F22A 3FXUA 1J75A 4HAMA 1R5GA 3SZTA 1ZH5A 5JHUA 4G7HF 3PQKA 2H6CA 1T2KA 5ICCA 3CO7C 1KU3A 3LQRA 5FO5A 3EETA 3GFIA 3ZP5A 4AIJA 2L02A 5HLGA 2OQRA 3W6KB 4HA8A 2HS5A 2Y48A 3CUQA 4LFUA 3AAFA 2EWNA 1QZZA 3EUHA 5LRRA 3L9FA 5ICEA 4HX7A 1D8KA 1I27A 5JFRA 3TKYA 2M8EA 2E7XA 4MEXF 1IXSB 2FNAA 5BQTA 2DPDA 3VEPA 1WKMA 4UXNA 4CGZA 4IVNA 1BOAA 5DYMA 4M73A 3KEOA 3CJNA 4L9TA 4OIQF 5ILUA 1V4RA 2JZYA 1JHHA 2UWMA 2XAJA 4ESBA 2XHKA 1EV7A 1Z6RA 2QQAA 1FT9A 2WV0A 3HSRA 4JBAA 2ZKZA 4MQ9F 3RKXA 5D6EA 1MDMB 1O57A 5H6QA 5E1XA 4M9XA 5LEKA 2HGCA 3WU1B 5CVRA 1QNTA 4ZYGA 2VN2A 5HDGA 2VXZA 4OIPF 3QAHA 1W5SA 4B8XA 1IW7F 2O03A 1MJAA 4L0YB 2VT2A 3BJOA 4I2OA 1MKMA 1X3UA 2J5OA 2E1NA 2HFHA 4IHTA 4Y13A 1K6OA 3F8BA 2BGCA 1SD6A 1U78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUK A;  4B09 A;  2ZJ2 A;  4GXO A;  5KVR A;  2STT A;  3I59 B;  2QBY B;  3WE2 A;  1K78 A;  1RNL A;  3K69 A;  1H9G A;  4MNU A;  3GFM A;  2LKP A;  1HQC A;  3Q9S A;  2H27 A;  3ZMS A;  3SHF A;  1T39 A;  1P4A A;  4I0A A;  4ZH4 F;  3S2W A;  2VBY A;  3WGI A;  4D0P A;  3ZN1 A;  3I54 A;  4RGS A;  3N4M A;  1QQI A;  3V7C A;  1KU7 A;  3E6M A;  1XB4 A;  4IHS A;  1T0F A;  2ZME B;  3ZMD A;  3IWZ A;  1Z1D A;  1SD4 A;  3N97 A;  5IT9 K;  4QWQ A;  4A6D A;  1EH8 A;  1ZG3 A;  2OBP A;  4YG2 F;  1FWZ A;  1Z91 A;  2O8X A;  1QGP A;  3R0J A;  3GZ6 A;  4I01 A;  3W6J B;  2A07 F;  1YIO A;  2JPB A;  1DPU A;  1LEA A;  4RGU A;  2L4M A;  3FMS A;  3GO5 A;  2HDC A;  1Q1H A;  1UHM A;  3TO7 A;  1B4A A;  4EJO A;  4UHT A;  2P6S A;  4RB0 A;  4LG0 B;  4G94 A;  3F21 A;  4LD5 A;  1H0M A;  5D8L B;  3M8E A;  5LGN A;  4GO1 A;  4FT8 A;  1ZRF A;  1OYI A;  1OPC A;  2K27 A;  4EQQ A;  1HW1 A;  4ZZD A;  2O61 A;  3JW4 A;  2M30 A;  4OU0 A;  4K2E A;  3P9C A;  2P7V B;  1W7P B;  4M71 A;  1R36 A;  4EV0 A;  2GAU A;  3WG9 A;  3DPL C;  2FMY A;  4KT5 C;  4ENJ A;  3L09 A;  3VFZ A;  4DQ2 A;  4NHJ A;  4KYW A;  1J59 A;  2L3D A;  4M72 A;  3K1P A;  2KIF A;  1REP C;  4AVP A;  5LHI A;  4Q48 A;  5AIQ A;  4U88 A;  1AOY A;  3KP2 A;  2E7W A;  4G7Z F;  5F64 A;  2HQN A;  1A04 A;  3CLO A;  2FEZ A;  4CO8 A;  3GFL A;  2Z9O A;  1T38 A;  5J8C A;  1ZYR F;  2VOO A;  5E17 F;  3RKW A;  1B9M A;  3REO A;  3RIR A;  1D5V A;  3MZY A;  1E2X A;  3H3Z A;  2K4B A;  3KLN A;  3LA7 A;  1XGS A;  3JTH A;  5E18 F;  1G3Y A;  3LAP A;  3WE3 A;  5CVV A;  1L3L A;  4UV9 A;  5IT3 A;  1U3E M;  2D1V A;  3CO6 C;  4EJW A;  3JSP A;  2MLK A;  3IL2 A;  1IXR C;  2B0L A;  5DDG A;  2MA3 A;  2RC4 A;  4A0X A;  1S6L A;  1KYW A;  2PFB A;  1U8R A;  2FNP A;  4CXF A;  2IA2 A;  4EJT A;  1ZAO A;  2FML A;  2XV4 S;  3FWE A;  3WTU C;  1HW5 A;  3PQJ A;  2L4A A;  4PZJ A;  1F9N A;  3K1M A;  4L0Z B;  3R61 A;  3QRF F;  2YPR A;  2MLG A;  2Z33 A;  4HLY A;  3NEU A;  3M9A A;  3IRR A;  2RQP A;  2IA1 A;  4HF1 A;  5ERI A;  3M7G A;  2DW4 A;  1BC7 C;  1TBX A;  1FX7 A;  4O6J A;  2ZNZ A;  2XAQ A;  3T1B A;  4P96 A;  4AD9 A;  4UVB A;  5F6F A;  3EQL F;  3U2R A;  5LRS A;  3HUG A;  2M45 A;  3KP4 A;  2BEO A;  1YYV A;  2KJB A;  4BHC A;  4KN4 X;  4XBF A;  2LNB A;  1GVJ A;  3WOD F;  3Q5F A;  3WTW C;  2H6B A;  1KQ9 A;  3BRO A;  2PI0 A;  1IN8 A;  3HRU A;  1STZ A;  1IF1 A;  2HEO A;  1XGM A;  1LDK B;  3KE2 A;  1BC8 C;  2E1C A;  3KEQ A;  2NS0 A;  3R6S A;  3L2C A;  1OKR A;  2HKX A;  2W25 A;  4ENM A;  5D5U B;  5JI6 A;  2EK5 A;  4LLN A;  3ZMU A;  1F5T A;  1HW2 A;  2UXN A;  1YFH A;  4TV7 A;  3BWG A;  3K2Z A;  2JSC A;  3J81 Z;  5L3C A;  3L7W A;  4HBL A;  1USS A;  3HSF A;  3IHU A;  3TO9 A;  1IN4 A;  4I7H A;  2OZU A;  1ZRD A;  3KP7 A;  4IF4 A;  4ON0 A;  2RDP A;  4L9N A;  1IN7 A;  3HOT A;  3WGG A;  1HKS A;  2V9V A;  2EFN A;  3ZMV A;  4XSX F;  3FZV A;  2UXX A;  2HTJ A;  2OU2 A;  5DUI A;  2AS5 F;  2QQB A;  3KZZ A;  1ODD A;  4GYG A;  4PGG A;  4XLP F;  2P6T A;  4KN7 X;  4I09 A;  5DCM B;  1DPR A;  3WTS C;  3COA C;  4OIN F;  4LMY A;  1UB9 A;  2ZO4 A;  1FLI A;  2A68 F;  2V79 A;  4IRH A;  3FXQ A;  2Y75 A;  4AIH A;  1XGN A;  4HF0 A;  4EMS A;  2F5E A;  2NAZ A;  5TRD A;  2O0Y A;  4R79 A;  3H92 A;  2XUB A;  4OIR F;  2G9W A;  5K5R A;  1S7O A;  4KFC A;  4PDK A;  1LQ1 A;  5AIP A;  2VE8 A;  4RB2 C;  1R1U A;  2ESH A;  2DI3 A;  2DTR A;  1F4K A;  2VOP A;  3P7N A;  4YFX F;  1ZLK A;  5E8I A;  1CF7 A;  2DU9 A;  3VOD A;  1XMA A;  5HDN A;  1G3T A;  5D5V B;  2F5F A;  4HOB A;  3DF8 A;  4EGY A;  3F8M A;  3C18 A;  3O6B B;  2ZXJ A;  1R22 A;  1B1B A;  1Z9C A;  4MTE A;  3LWF A;  2VBW A;  2XIG A;  3E6D A;  4Y15 A;  1TW2 A;  3ML6 A;  3E3V A;  2D1H A;  3GUD A;  3DPT A;  5FB2 A;  1YW7 A;  4KIC A;  1MD0 A;  1F1Z A;  2GA2 A;  3I59 A;  4IPA A;  2Z99 A;  2QBY A;  1FSH A;  4IXA A;  2STW A;  2O3F A;  3FMQ A;  3WTX C;  3KET A;  1YW8 A;  4S04 A;  2G7H A;  2GWR A;  3WTY C;  2QWW A;  5E8G A;  2EA2 A;  3L00 A;  1S29 A;  3TQN A;  3I71 A;  1MJ9 A;  3K1N A;  1Z05 A;  1R00 A;  4O3M A;  2R3S A;  5HS8 A;  3BJ6 A;  5LEJ A;  2BV6 A;  2IP2 A;  3OV8 A;  4M74 A;  3DFG A;  2QEN A;  2KRF A;  5BS6 A;  2C6Y A;  1GHC A;  1UST A;  2PBI A;  3U9G A;  1GXQ A;  4KUM A;  4N0B A;  3E5Q A;  2XRO A;  2YX7 A;  4U0Y A;  1CGP A;  3GVA A;  4OMZ A;  2RGV A;  2VON A;  2XAS A;  1T98 A;  1ZRC A;  1TQM A;  2DO7 A;  2PG4 A;  2P5L C;  1JGS A;  2HWV A;  2HQR A;  6PAX A;  5JR3 A;  3DKW A;  1DP7 P;  3F3X A;  3E6B A;  1YS7 A;  1YO5 C;  2JT1 A;  3BOQ A;  1WWX A;  1L0O C;  3C1D A;  4BYY A;  3CTA A;  1LNW A;  1U5T B;  3ZQ7 A;  4KDP A;  4L18 B;  4LG0 A;  4ZYH A;  4A12 A;  2CW0 F;  3HRT A;  1V3F A;  2RN7 A;  4BH9 A;  2FQ3 A;  2XAF A;  3JSO A;  4LGW A;  3FXR A;  3ERE D;  3HTU A;  1W7P A;  4R8H A;  4HYE A;  2CGP A;  3T0Y A;  2DBB A;  4GCV A;  4MEY F;  4KIF A;  1MZB A;  4N9H A;  5D8K B;  2BYV E;  5CLS A;  1FY7 A;  1IZ1 A;  5CYV A;  1P92 A;  2FOK A;  1IN5 A;  2IA0 A;  3LST A;  4G9Y A;  3IKT A;  3BZ6 A;  5HLH A;  4HV5 A;  3GWZ A;  3MZH A;  1BIB A;  5H20 A;  5FGM A;  2W57 A;  1I1S A;  3QPT A;  1E17 A;  3V8L A;  3I53 A;  3D5L A;  2YR2 A;  1FPQ A;  2VC1 A;  2JTV A;  4WK8 F;  2Z3Y A;  2WC2 A;  2M87 A;  5J6X A;  1ON2 A;  1TLH B;  1XMK A;  1KQ8 A;  1XSD A;  1B59 A;  4I02 A;  4EGZ A;  4IJA A;  4GGG A;  1R7J A;  1T6S A;  3CUO A;  1I6X A;  4R1H A;  2CFX A;  4L9V A;  5FLX Z;  2DK8 A;  1RUO A;  3RPQ A;  1R1V A;  2MC3 A;  1YW9 A;  2K4J A;  4KIG A;  3BPX A;  3HRS A;  1UFM A;  1WI9 A;  1DUX C;  2GIV A;  5BPI A;  4WCG A;  1WRJ A;  2FSW A;  1HKT A;  4BAY A;  3ROU A;  1AWC A;  1FP1 D;  2MH2 A;  2DLL A;  5LBQ A;  3MEX A;  3HTS B;  1R58 A;  1TNT A;  1BI2 A;  1P6R A;  1FSE A;  4L9J A;  3D0S A;  5DCF A;  1Y0U A;  2LSO A;  3LAJ A;  3H3U A;  1B9N A;  3T8T A;  2QQ9 A;  2CO5 A;  2JRT A;  3GW2 A;  1RIO H;  3CDH A;  2FRH A;  5HDK A;  3DP7 A;  2QM3 A;  2IW5 A;  1U5T C;  2FU4 A;  2W84 A;  4P9U A;  1NHA A;  3JAM Z;  5FLX K;  1FYK A;  4UVC A;  1U2W A;  2O6G E;  4P5O A;  4EM0 B;  2BBY A;  3GXO A;  5KK1 A;  1D3Y A;  1G3S A;  3I58 A;  1PP7 U;  2R7D A;  3OOP A;  5BOX A;  3GLX A;  3MQ0 A;  5H6R A;  1WQ2 A;  1KA8 A;  2CQK A;  4LB6 B;  4ETS A;  2P7C B;  4I98 B;  4HDV A;  3VOE A;  3QOP A;  2DFI A;  2CSO A;  4U7B A;  3EYY A;  4LB5 A;  5J8F A;  5ILV A;  1YS6 A;  1YG2 A;  4MHG A;  4WX9 A;  1QO0 D;  4LJZ F;  1LDJ A;  1TQP A;  3C3W A;  1XD7 A;  4Z2Y A;  1OMI A;  3QU3 A;  1S8N A;  4M9S A;  4Y17 A;  4HX8 A;  1FP2 A;  4XSZ F;  3BP8 A;  4RS8 A;  1R1T A;  1R5H A;  4WXH A;  4AIK A;  1TNS A;  2KKO A;  4PGH A;  1ZGA A;  4YII A;  3I4P A;  4G6D A;  2ESN A;  2FXA A;  1SFU A;  5AON A;  1J0R A;  2KIU A;  2YX4 A;  3IC7 A;  1W5T A;  5DV5 A;  2DAO A;  3LA2 A;  2XKP A;  3BDD A;  3J80 Z;  2A61 A;  5CVI A;  5K1Y A;  3E5X A;  1XDS A;  4L5J A;  3DV8 A;  3MAJ A;  2OA4 A;  1IAW A;  3HSE A;  3NQO A;  1IXC A;  3F6O A;  3G73 A;  3DQV C;  3QP6 A;  2H09 A;  3R0A A;  1W7P D;  3U1D A;  3ZPL A;  3IRQ A;  4KNY A;  1HST A;  2EA4 A;  3J7A O;  3KLO A;  5EEH A;  4A5N A;  2ISZ A;  2V1D A;  2V1X A;  4MQV A;  1FBQ A;  1YLF A;  2IPQ X;  4A0Z A;  1KYZ A;  1ZAR A;  4CIC A;  4HQE A;  3PFI A;  3QPH A;  2HOE A;  5L3B A;  2FF4 A;  3SXY A;  4P9F A;  3FX3 A;  1SMT A;  4M6Y A;  3P9K A;  1TTY A;  2J5P A;  4RAZ A;  2A3S A;  2HZT A;  4G6Q A;  4QLC U;  1Z7U A;  2L54 A;  3J80 K;  1C0W A;  2XVC A;  2EB7 A;  4EVI A;  3E5U A;  3WTZ A;  3B02 A;  5BMZ A;  5L3E A;  2G7U A;  5ICG A;  3T8R A;  2P5V A;  2F5D A;  4EJU A;  2ISY A;  2GZW A;  1TW3 A;  3G3Z A;  4OIO F;  3K0L A;  1ON1 A;  4G7O F;  3R4K A;  2YU3 A;  5DD8 A;  3RYR A;  1QPM A;  4HX4 A;  4MGR A;  3J81 K;  1LB2 A;  3BY6 A;  2EV5 A;  1BN5 A;  2R7F A;  2EFP A;  1G6N A;  2X0L A;  3LA3 A;  2NYX A;  1MDM A;  2QUF A;  2DT5 A;  1SMY F;  2BE5 F;  4XLN F;  4AWX B;  4ASN A;  2FA5 A;  5D4R A;  3KFW X;  2EFW A;  4FX4 A;  5F1R A;  3M1E A;  1S3J A;  1O7L A;  1U6G A;  4LLL A;  4UVA A;  1S7A A;  3WU0 A;  1FBS A;  2EFQ A;  4RGX A;  4F7Z A;  3RTR A;  3M8F A;  2HYF A;  4S05 A;  1GXP A;  4BQA A;  3BPV A;  1J9I A;  4OMY A;  3KP6 A;  3ULQ B;  2DK5 A;  2W85 A;  5ICF A;  2HKO A;  4L5I A;  3QU6 A;  3SQN A;  3SFZ A;  4JK1 X;  1U5T A;  5D6F A;  2K02 A;  3WGH A;  1JXS A;  3RI4 A;  4A5M A;  4GYI A;  2ZFW A;  1W4M A;  1XN7 A;  1BIA A;  2MD5 A;  4WF2 A;  1P4X A;  3O3K A;  2RVC A;  1O3S A;  5E1W A;  3RYP A;  2AXL A;  5HS9 A;  3C7J A;  1WSU A;  1QBJ A;  2GXG A;  1ONV A;  3ABT A;  1H9T A;  2W24 A;  5FD6 A;  3F23 A;  4CZZ A;  2M5W A;  4YFK F;  1O3T A;  1P2F A;  3P9I A;  2RKH A;  3O2P E;  3FHZ A;  2FBK A;  2OAZ A;  5CVU A;  1K7A A;  1SFX A;  3EYI A;  2ZME A;  1BI1 A;  2UZK A;  5L3D A;  1XDU A;  2VE9 A;  4ESJ A;  1ULY A;  1I5Z A;  2NNY A;  1BI0 A;  1CF7 B;  2WWY A;  1ZLJ A;  4PCQ A;  4DNC A;  1KU9 A;  2XKO A;  3ABU A;  5L3G A;  1VTN C;  2ELH A;  2PMU A;  2QVO A;  2RV8 A;  4CDG A;  2VBX A;  3TDU C;  1XGO A;  4YFN F;  3SZP A;  5IT9 Z;  1FYM A;  2D45 A;  3V8K A;  1B6A A;  3HOS A;  2GQQ A;  2DPU A;  2XAG A;  3FM3 A;  2PN6 A;  3EDP A;  2XRN A;  3MFK A;  3MWM A;  2RNJ A;  1RI7 A;  3CUQ B;  1PP8 F;  2DQR A;  4ESF A;  5LGT A;  1FNN A;  5E20 A;  4EM1 A;  3NRV A;  3KZY A;  1J5Y A;  1XSV A;  2LDU A;  3R60 A;  1ZRE A;  3ZN0 A;  4LK0 F;  1D8J A;  4KMU X;  4NB5 A;  2MH9 A;  5D4S A;  4A6E A;  2HR3 A;  2ZBK A;  1J7K A;  2VBZ A;  1XCB A;  1SD5 A;  5BPD A;  1R23 A;  3FMR A;  1ZHF A;  3KCC A;  5FFZ A;  3KP3 A;  3LFK A;  2PEX A;  2Q0O A;  3WTT C;  2Q8K A;  1P4W A;  1G4D A;  3JTG A;  3HHG A;  5E1Z B;  3T5X A;  1KQ0 A;  1PUE E;  3TOA A;  1LDD A;  3KP5 A;  3IWF A;  1DDN A;  3I0T A;  3E6C C;  1ZG1 A;  4LLG F;  4LK1 F;  3TGN A;  4BHB A;  4ENK A;  1XSX A;  2F5C A;  1IUY A;  2EJR A;  2V1U A;  1O3R A;  1EH6 A;  1SD7 A;  2FBH A;  1LJ9 A;  1TQI A;  1BI3 A;  1O7F A;  4I0B A;  4O5V A;  2ACJ A;  1FC3 A;  5DD4 A;  5LLQ A;  2VC0 A;  1RZ4 A;  3GEZ A;  4FX0 A;  1BBY A;  1K78 B;  3FF5 A;  5HOO A;  2GA1 A;  5LGU A;  3QP5 A;  5A2Q Z;  3GFJ A;  3ZMT A;  1JHF A;  1Z6T A;  2KJC A;  1HBX G;  1J2X A;  4M9Z A;  4H0E A;  3ISP A;  4RB1 A;  2OZ6 A;  1YTY A;  3LQQ A;  4HF2 A;  1IN6 A;  2VOD A;  3B73 A;  2KIM A;  4Q5S F;  5K5Q A;  2PLY A;  2DQL A;  2A5Y B;  1JE8 A;  1FYL A;  4HW0 A;  2CG4 A;  3GF2 A;  4N9I A;  3GX4 X;  3ZMZ A;  3FM5 A;  2LF7 A;  4U0W A;  2Q2E A;  5K5O A;  2HYG D;  3E97 A;  2PQ8 A;  2F2E A;  1SFE A;  3TDZ C;  3I64 A;  2XGX A;  2A69 F;  3K9T A;  4WXD A;  5D5W B;  4KA4 A;  3CUQ C;  4ZYD A;  1LEB A;  2EV0 A;  4M6X A;  3ELK A;  4MTD A;  3V8J A;  2P4W A;  4XRF A;  5TJJ A;  2IT0 A;  3V4G A;  4ZYE A;  3HHH A;  5D5X B;  2OQG A;  4ZZL A;  4ENN A;  2EV6 A;  2EFO A;  1BM9 A;  5A2Q K;  4UUV A;  4BHP A;  2ZCW A;  3I5U A;  2IRF G;  3ECH A;  4E70 A;  2Z5U A;  1ZN2 A;  5JVT A;  4BNC A;  4JQF A;  4HQM A;  4HLX A;  3RDI A;  3RJP A;  1G3W A;  5LHG A;  3GZ5 A;  4P55 A;  4RAY A;  4HV6 A;  2XAH A;  4UV8 A;  2M1B A;  2FBI A;  1IRF A;  3F8F A;  2NRA C;  1IRG A;  2V6C A;  4BXU A;  2A6E F;  4YIF A;  3MCZ A;  5HLI A;  2D2W A;  3F72 A;  5DCM A;  4HZF A;  4A0Y A;  4U0V A;  2IVM A;  3BJA A;  1EH7 A;  3JAM K;  4Q47 A;  3F8N A;  1UCR A;  3V7S A;  3WTV C;  1UHW A;  3DXJ F;  3TOB A;  3TO6 A;  2P5K A;  4FHT A;  4KIB A;  1FBU A;  5ILS A;  1ZG5 A;  3V7R A;  1RUN A;  5ED4 A;  2Y0M A;  2HTS A;  2CYY A;  4CHU A;  4WWC A;  1HKQ A;  1OYW A;  4EJV A;  2ETH A;  4HDU A;  2OD5 A;  5FD5 A;  4A2U A;  3VB2 A;  5CVJ A;  4RB3 C;  3HIF A;  5CJ9 A;  4UNO A;  2COM A;  5FFX A;  3F6V A;  2TDX A;  3HRM A;  2ZNY A;  2WTE A;  2ADU A;  1QZY A;  2IJL A;  2A6H F;  3DEU A;  2K86 A;  3RPU A;  1FZP B;  2JPC A;  1PDN C;  3GYH X;  2FE3 A;  1BJA A;  2YSR A;  2GXB A;  4WXC A;  5EEG A;  2CWE A;  1HSJ A;  3RKY A;  4IRI A;  1YQA A;  1KGS A;  2QYO A;  4G8X A;  1HXD A;  3IKV A;  2MBF A;  4EM2 A;  2QZ8 A;  4IRG A;  4U7D A;  4Q4Z F;  2NNN A;  1O3Q A;  1KU2 A;  1FOK A;  1OR7 A;  3HYI A;  2H94 A;  5L3F A;  4RGR A;  1XCV A;  4NQW A;  1K79 A;  1SAX A;  2L01 A;  2K7L A;  2PMH A;  4CYD A;  4OOI A;  5HVQ C;  2P8T A;  3Q9V A;  5LHH A;  1I1G A;  3ECO A;  2PJP A;  2LF8 A;  3F8C A;  5HS7 A;  1MGT A;  2X4H A;  5DEQ A;  1OYY A;  1MJB A;  1LVA A;  1ZGJ A;  4KMF A;  2VT3 A;  2QLZ A;  3F22 A;  3FXU A;  1J75 A;  4HAM A;  1R5G A;  3SZT A;  1ZH5 A;  5JHU A;  4G7H F;  3PQK A;  2H6C A;  1T2K A;  5ICC A;  3CO7 C;  1KU3 A;  3LQR A;  5FO5 A;  3EET A;  3GFI A;  3ZP5 A;  4AIJ A;  2L02 A;  5HLG A;  2OQR A;  3W6K B;  4HA8 A;  2HS5 A;  2Y48 A;  3CUQ A;  4LFU A;  3AAF A;  2EWN A;  1QZZ A;  3EUH A;  5LRR A;  3L9F A;  5ICE A;  4HX7 A;  1D8K A;  1I27 A;  5JFR A;  3TKY A;  2M8E A;  2E7X A;  4MEX F;  1IXS B;  2FNA A;  5BQT A;  2DPD A;  3VEP A;  1WKM A;  4UXN A;  4CGZ A;  4IVN A;  1BOA A;  5DYM A;  4M73 A;  3KEO A;  3CJN A;  4L9T A;  4OIQ F;  5ILU A;  1V4R A;  2JZY A;  1JHH A;  2UWM A;  2XAJ A;  4ESB A;  2XHK A;  1EV7 A;  1Z6R A;  2QQA A;  1FT9 A;  2WV0 A;  3HSR A;  4JBA A;  2ZKZ A;  4MQ9 F;  3RKX A;  5D6E A;  1MDM B;  1O57 A;  5H6Q A;  5E1X A;  4M9X A;  5LEK A;  2HGC A;  3WU1 B;  5CVR A;  1QNT A;  4ZYG A;  2VN2 A;  5HDG A;  2VXZ A;  4OIP F;  3QAH A;  1W5S A;  4B8X A;  1IW7 F;  2O03 A;  1MJA A;  4L0Y B;  2VT2 A;  3BJO A;  4I2O A;  1MKM A;  1X3U A;  2J5O A;  2E1N A;  2HFH A;  4IHT A;  4Y13 A;  1K6O A;  3F8B A;  2BGC A;  1SD6 A;  1U78 A; 
#chains in the Genus database with same CATH topology
 5DUK A;  4B09 A;  2ZJ2 A;  2IGN A;  4GXO A;  2HQA A;  5F0F A;  2L7Z A;  5KVR A;  2STT A;  3I59 B;  5M3M J;  3LSR A;  1A31 A;  3NAU A;  1MBJ A;  1LVK A;  4BQQ A;  2AHQ A;  4CCJ A;  4M3E A;  3A0B C;  4XL9 A;  2QBY B;  2KQR A;  3WE2 A;  1MW7 A;  1ETK A;  1K78 A;  3CF2 A;  1QVT A;  1RNL A;  3K69 A;  2B7E A;  1H9G A;  4MNU A;  3MVP A;  2TRT A;  2LKP A;  1HQC A;  3GFM A;  3Q9S A;  2H27 A;  3ZMS A;  3SHF A;  1LFB A;  3MN2 A;  1R5I D;  3CES A;  1MBG A;  1VQN I;  3LOC A;  1T39 A;  1P4A A;  2VQG A;  4I0A A;  4ZH4 F;  2JA6 J;  3M1C A;  3S2W A;  1BW5 A;  2VBY A;  4DZP A;  2MFZ A;  3WGI A;  4D0P A;  2NS8 A;  3ZN1 A;  3H0G J;  2ME6 A;  1ETY A;  3I54 A;  5CPR B;  3K10 A;  4RGS A;  3N4M A;  1QQI A;  2MYS A;  2XF5 A;  2K3F A;  3BG5 A;  3V7C A;  2KT0 A;  1UG0 A;  1KU7 A;  4CCM A;  4BQO A;  3A02 A;  3E6M A;  2ZSH B;  2TCT A;  1XB4 A;  3CC2 I;  1VQ9 I;  3ASN H;  2L5Q A;  4IHS A;  1KON A;  1T0F A;  2ZME B;  3ZMD A;  1UEL B;  3IWZ A;  2BXY A;  3BTC A;  1Z1D A;  1SD4 A;  3N97 A;  2IS2 A;  3J7Y J;  1HOM A;  3G1L A;  4BDY A;  1VQP I;  1APL C;  5IT9 K;  4QWQ A;  5DS9 A;  1HA8 A;  2KDZ A;  4A6D A;  1EH8 A;  1ZTR A;  1ZG3 A;  2OBP A;  4YG2 F;  4D5C A;  1FWZ A;  1WJA A;  3KPH A;  2L9N A;  3NAR A;  1Z91 A;  3TBI A;  1IUF A;  1Z21 A;  2O8X A;  3BZC A;  1H88 C;  1QGP A;  3D5R C;  3R0J A;  3OL4 A;  2WAQ N;  3GZ6 A;  3QYF A;  4I01 A;  1UJ8 A;  3W6J B;  2A07 F;  1UAA A;  1YIO A;  2JPB A;  1DPU A;  1LEA A;  3HKZ N;  1WVR A;  4GRI A;  2L4M A;  4RGU A;  1YJ9 I;  3FMS A;  3GO5 A;  2HDC A;  1Q1H A;  1UHM A;  3TO7 A;  1B4A A;  2X6O A;  4EJO A;  4W97 A;  3TL4 X;  4UHT A;  2P6S A;  4RB0 A;  4LG0 B;  4YEL A;  4G94 A;  3F21 A;  1DQU A;  4B43 A;  5IYD J;  4LD5 A;  1H0M A;  5D8L B;  3M8E A;  1FOY A;  5LGN A;  4GO1 A;  1MBH A;  1RC9 A;  4FT8 A;  3KYD B;  2E35 A;  1ZRF A;  1OYI A;  1OPC A;  2K27 A;  1HF0 A;  3GTO J;  4CCN A;  4EQQ A;  1HW1 A;  1WJF A;  4ZZD A;  3JW4 A;  2O61 A;  1I3Q J;  4ZDP A;  2M30 A;  4OU0 A;  3HG9 A;  1M1E B;  4K2E A;  3P9C A;  2P7V B;  1D5Y A;  1W7P B;  4M71 A;  1R36 A;  1JJ6 C;  1X4O A;  4EV0 A;  1MSF C;  1X1B A;  2GAU A;  1Y1V J;  1IV6 A;  3WG9 A;  2BY2 A;  3DPL C;  5IOZ A;  1X3Z B;  3A01 B;  2KRC A;  1FEX A;  2FMY A;  5GAH J;  4KT5 C;  4XK4 A;  5EGO B;  5E79 C;  1LE8 A;  1AHD P;  4M6V A;  3F9K A;  4ENJ A;  3L09 A;  3LSH A;  3VFZ A;  4II2 A;  4DQ2 A;  4NHJ A;  4E7K A;  1VQM I;  4KYW A;  1J59 A;  4XRS G;  4A3I J;  2L3D A;  4M72 A;  3K1P A;  2KIF A;  1REP C;  2R7O A;  4AVP A;  5LHI A;  4Q48 A;  2LY1 A;  5AIQ A;  2JA8 J;  4PJN A;  5GP9 A;  4U88 A;  4XOT A;  3S3O A;  1AOY A;  2VQH A;  1ETO A;  2DMP A;  2GOM A;  3KP2 A;  2E7W A;  4G7Z F;  5F64 A;  2HQN A;  3PNV A;  1A04 A;  1AKH B;  1YX5 A;  3CLO A;  4XN0 A;  3ZR8 X;  1EF4 A;  3LFU A;  2FEZ A;  4CO8 A;  2R5Y A;  3GFL A;  2Z9O A;  1I39 A;  5JVG F;  2LTP A;  4Z6Y A;  1T38 A;  1XMX A;  1LFU P;  3ONQ A;  5J8C A;  1ZYR F;  2VOO A;  3QPS A;  4DW6 A;  3RKW A;  5E17 F;  1B9M A;  2E19 A;  2ECC A;  3REO A;  4ZDL A;  3RIR A;  1D5V A;  3MZY A;  1E2X A;  2KP6 A;  3H3Z A;  1A36 A;  2K4B A;  5IP6 A;  2LRE A;  2ZB9 A;  5CQG A;  3KLN A;  3LA7 A;  1XGS A;  5FKO A;  2F4O B;  2NVX J;  2LH9 A;  2ZSI B;  3JTH A;  5E18 F;  1G3Y A;  3LAP A;  2PJR B;  3JRD A;  1YRN A;  2X85 A;  3WE3 A;  4PSW A;  3CQZ J;  5CVV A;  1L3L A;  4UV9 A;  5IT3 A;  1B72 A;  1U3E M;  1VND A;  3ABK H;  1KZH A;  3JRA A;  5C4J J;  2D1V A;  2IBD A;  4CCL A;  4EJW A;  3JSP A;  3CO6 C;  3EUA A;  2MLK A;  3IL2 A;  1IXR C;  2B0L A;  1S5L C;  5DDG A;  4G12 A;  1LFP A;  2MA3 A;  2RC4 A;  4A0X A;  1HLV A;  1S6L A;  1KYW A;  3K4L A;  2PFB A;  1U8R A;  2FNP A;  4CXF A;  2ZJQ F;  2IA2 A;  5FKM A;  4EJT A;  5HNH A;  1ZAO A;  2FML A;  3FBI B;  4G6T B;  4OAZ A;  3N05 A;  2XV4 S;  4UUS B;  3G4S I;  3FWE A;  4XR6 A;  5FKK A;  2EZH A;  4HRI A;  3WTU C;  3LSG A;  1HW5 A;  5GAE J;  3S3N A;  3PQJ A;  2L4A A;  4PZJ A;  4D1Q A;  1F9N A;  4NC8 A;  1WCM J;  3K1M A;  4L0Z B;  2EH3 A;  3R61 A;  3QRF F;  2YPR A;  2MLG A;  2Z33 A;  4HLY A;  1YE9 A;  3NEU A;  1FOX A;  4CH7 A;  3M9A A;  2XSD C;  3IRR A;  3FKI J;  2QCO A;  2RQP A;  4A69 C;  2IA1 A;  3K4K A;  3S1M J;  2W4S A;  2LYC A;  3ZGK A;  4HF1 A;  5ERI A;  4UY8 I;  2VUM J;  2E60 A;  3M7G A;  2CUZ A;  2DW4 A;  4FIS A;  3L2V A;  3W2W A;  1BC7 C;  1TBX A;  2BY0 A;  3HKZ A;  1FX7 A;  4O6J A;  2LMD A;  2ZNZ A;  2F4M B;  2R93 J;  2V1N A;  2XAQ A;  2OTJ I;  1XX5 A;  4DBR A;  1A6I A;  3T1B A;  4P96 A;  4AD9 A;  2AQF A;  4E7J A;  4UVB A;  3HOU J;  5F6F A;  3EQL F;  4AID A;  3Q0V A;  3QOE A;  5F0C A;  3U2R A;  5LRS A;  3HUG A;  2M45 A;  3K6G A;  1TWC J;  3KP4 A;  2BEO A;  1ETQ A;  1YYV A;  2KJB A;  3VYU B;  4A3M J;  5J4V A;  2LBF B;  4BHC A;  1Q1V A;  5JLX A;  4KN4 X;  2W1O A;  2Q1Z B;  4XBF A;  1RR8 C;  2LNB A;  3LNQ A;  3KYL A;  1GVJ A;  3WOD F;  5M5W J;  3Q5F A;  3WTW C;  2H6B A;  1KQ9 A;  1VQL I;  2I8D A;  3BRO A;  1IN8 A;  2PI0 A;  1BOB A;  3HRU A;  2OTL I;  4DIQ A;  1STZ A;  1IF1 A;  2HEO A;  2B63 J;  1PJR A;  2EZK A;  4CSW A;  1XGM A;  2XB0 X;  5BNG A;  1LDK B;  2X51 A;  3KE2 A;  2L7F P;  1BC8 C;  2LKS A;  1BR4 A;  2M4G A;  3IV5 A;  1GT0 C;  2E1C A;  3KEQ A;  5DM6 F;  1J09 A;  5FLV A;  5JLW A;  2DMT A;  3H5R A;  4OAY A;  2Y2Z A;  2NS0 A;  2HVQ A;  3DWL E;  3R6S A;  3L2C A;  1OKR A;  2HKX A;  2W25 A;  4ENM A;  5F27 A;  2D5V A;  1G59 A;  5D5U B;  5JI6 A;  2EK5 A;  3G1O A;  4X1E A;  4LLN A;  3ZMU A;  1F5T A;  1HW2 A;  2UXN A;  4XOP A;  4XM3 A;  1YFH A;  4TV7 A;  3BWG A;  3K2Z A;  1IRZ A;  3CCY A;  1LKX A;  2JSC A;  3J81 Z;  2ZJR F;  1WI3 A;  3CZ6 A;  2VPR A;  5L3C A;  3L7W A;  4HBL A;  1USS A;  3CP2 A;  3HSF A;  4B3X A;  5C44 J;  1ETV A;  3IHU A;  4AYB N;  2M3A A;  2ME0 A;  3BG9 A;  1Y56 A;  3TO9 A;  2DA6 A;  1MMA A;  1IN4 A;  3K4B A;  3SZG A;  4MLO A;  4I7H A;  2OZU A;  1ZRD A;  3KP7 A;  4IF4 A;  2Y0S A;  3OIQ A;  4ON0 A;  1D0X A;  3AG3 H;  2RDP A;  4L9N A;  1IN7 A;  4XLA A;  3HOT A;  4A3K J;  3WGG A;  2ZXW H;  1Y8R B;  1MBK A;  1HKS A;  2V9V A;  2EFN A;  2DT7 B;  2VB6 A;  3ZMV A;  4XSX F;  3FZV A;  3OOU A;  2WV1 A;  4IHY A;  2UXX A;  3CCS I;  4ZJZ A;  2HTJ A;  4D7N A;  2OU2 A;  3DTK A;  5DUI A;  4HEA 2;  1N77 A;  3S14 J;  2AS5 F;  2QQB A;  2VJI A;  3KZZ A;  1ODD A;  2HXO A;  4GYG A;  3BTI A;  4PGG A;  3GTK J;  4E7H A;  4XLP F;  2P6T A;  1MNE A;  4KN7 X;  3H36 A;  1V54 H;  2IEK A;  4I09 A;  5DCM B;  1DPR A;  3VDX A;  3WTS C;  3COA C;  4OIN F;  2ZJP F;  3W2A A;  3LSJ A;  4LMY A;  1UB9 A;  2ZO4 A;  3KX2 A;  3S1R J;  1FLI A;  2A68 F;  2JUG A;  2V79 A;  4IRH A;  3FXQ A;  3CMY A;  2Y75 A;  4AIH A;  2OPT A;  1XGN A;  2HOS A;  4CA0 A;  4HF0 A;  4EMS A;  2F5E A;  2NAZ A;  5TRD A;  3RKQ A;  2O0Y A;  1RR7 A;  2LD5 A;  4R79 A;  4HNT A;  3VYR B;  3H92 A;  1JGG A;  3M8J A;  2XUB A;  4OIR F;  3ZQG A;  2G9W A;  5K5R A;  3PL8 A;  1S7O A;  4KFC A;  1YOV B;  3HGY A;  4PDK A;  4ZYA A;  1U8B A;  1LQ1 A;  1BL0 A;  4RLQ A;  4OWR B;  5AIP A;  3TW6 A;  1OCP A;  3S3M A;  2VE8 A;  3CD6 I;  4RB2 C;  1P9Q C;  1R1U A;  1WJC A;  1OCO H;  2DYS H;  2ESH A;  3OSF A;  2R7Z J;  2DI3 A;  2CQN A;  1SAU A;  1LUJ B;  2DTR A;  1F4K A;  3IAM 2;  2VOP A;  2NOG A;  3P7N A;  4YFX F;  2JQ7 A;  1ZLK A;  3SYT A;  5E8I A;  3HOZ J;  2DA3 A;  3L1P A;  1TL8 A;  3BG6 A;  1CF7 A;  2DU9 A;  3VOD A;  1OIS A;  3QWL A;  3SFI A;  4F93 B;  1XMA A;  4KIT B;  5HDN A;  1G3T A;  5D5V B;  2F5F A;  4DBQ A;  4HOB A;  3FK6 A;  2RNG A;  2A6T A;  5EJC A;  3DF8 A;  2DJI A;  2F5V A;  3OIP A;  4YRV A;  3OYI A;  4EGY A;  1YI2 I;  3F8M A;  4BEH B;  2VJJ A;  1TC3 C;  2K9Q A;  3C18 A;  2DN0 A;  3O6B B;  3CJT B;  2ZXJ A;  1R22 A;  1B1B A;  5C3E J;  2EQR A;  1Z9C A;  4MTE A;  1FJL A;  2W48 A;  4RMN A;  3LWF A;  3RSN A;  1CQT A;  3BTL A;  2VBW A;  2XIG A;  3E6D A;  4Y15 A;  3CCL I;  1TW2 A;  3ABL H;  3ML6 A;  3E3V A;  2D1H A;  3GUD A;  2XPW A;  3CCQ I;  1MSE C;  3DPT A;  5FB2 A;  3S15 J;  2XGE A;  1R71 A;  1YW7 A;  4KIC A;  3FIS A;  1MD0 A;  4C3J J;  1F1Z A;  2GA2 A;  3I59 A;  1QU3 A;  3JRE A;  4IPA A;  2Z99 A;  2QBY A;  4QPQ A;  5J1U A;  1FSH A;  4IXA A;  2STW A;  2O3F A;  3VYS B;  4U87 A;  3FMQ A;  2K40 A;  5EG0 A;  3WTX C;  3KET A;  3SEZ A;  1ZQ3 P;  3FXL A;  2KIS A;  1YW8 A;  2IGM A;  4AYB A;  4S04 A;  4FCY A;  3L2U A;  1FTT A;  2G7H A;  2IXS A;  2GWR A;  3WTY C;  4NQW B;  2QWW A;  5E8G A;  5J1Y A;  2EA2 A;  3AFH A;  2Z16 A;  2JA5 J;  3FIW A;  5CKT A;  3L00 A;  3IH3 A;  4IHV A;  4LIU A;  2WA0 A;  1S29 A;  2K5C A;  3TQN A;  4EAT A;  3I71 A;  1T08 B;  1IC8 A;  2QSG X;  4BJT A;  1MJ9 A;  3K1N A;  1Z05 A;  1R00 A;  2V6E A;  2XB5 A;  2HYJ A;  2HQ5 A;  4O3M A;  2R3S A;  5HS8 A;  3BJ6 A;  5LEJ A;  2BV6 A;  2IP2 A;  3OV8 A;  4M74 A;  3DFG A;  2EPF A;  2KRF A;  2DA5 A;  2QEN A;  1P7I A;  5BS6 A;  2V9K A;  4CCO A;  3CLQ A;  2C6Y A;  1GHC A;  1UST A;  2PBI A;  2QKL B;  3U9G A;  1GXQ A;  1QVU A;  4KUM A;  4N0B A;  3E5Q A;  2DMN A;  2XRO A;  2YX7 A;  4U0Y A;  1CGP A;  4UUT A;  2BW3 B;  3GVA A;  4OMZ A;  2RGV A;  3Q3S A;  2VON A;  2XAS A;  3ZRG A;  4PFP A;  1T98 A;  1ZRC A;  1TQM A;  2DO7 A;  2PG4 A;  2P5L C;  4FE4 A;  1JGS A;  2HWV A;  2HQR A;  6PAX A;  2DDB A;  1JT0 A;  1VQ6 I;  5JR3 A;  3HC7 A;  3RQ4 A;  1A35 A;  4AC0 A;  3DKW A;  1DP7 P;  2M0M A;  3F3X A;  3E6B A;  2R7R A;  2VJ4 A;  1YS7 A;  3DU6 A;  4J01 A;  1YO5 C;  1X1D A;  2JT1 A;  1YHQ I;  4B47 A;  2KDO A;  1WWX A;  3BOQ A;  1HCR A;  1L0O C;  3C1D A;  2HXI A;  3DBL B;  3WG7 H;  5HLT A;  4BYY A;  3CTA A;  1LNW A;  1U5T B;  3E0J B;  3ZQ7 A;  4HPQ A;  2R7Q A;  4KDP A;  4L18 B;  4LG0 A;  4ZYH A;  4A12 A;  3BR5 A;  1WPK A;  2CW0 F;  5EZG A;  1MH4 A;  1JUS A;  2BHY A;  2VQL A;  4JX4 A;  3HRT A;  5EZH A;  1V3F A;  2RQQ A;  2LLK A;  2RN7 A;  4BH9 A;  5KAF C;  2FQ3 A;  5B5E C;  1ZR4 A;  1JUM A;  2XAF A;  1XTA A;  4DJA A;  3JSO A;  4LGW A;  1R49 A;  3FXR A;  3ERE D;  3HTU A;  1W7P A;  4C3I J;  4MIM A;  4R8H A;  4HYE A;  5EEA A;  2IGK A;  1TT0 A;  3T0Y A;  4E7I A;  2CGP A;  4DGW B;  2FD5 A;  3DTI A;  1E3P A;  3M3Y J;  2DBB A;  4GCV A;  4MEY F;  3A01 A;  4KIF A;  3RZD J;  1NH3 A;  1Z3X A;  1MZB A;  2WAD A;  3EUK L;  4N9H A;  5K7F A;  5D8K B;  2V7F A;  1W5C C;  5GTH C;  2BYV E;  5CLS A;  3AKZ A;  1FY7 A;  1IZ1 A;  4HG2 A;  4MFE A;  4XON A;  5CYV A;  1PVE A;  4RA2 A;  4II3 A;  1P92 A;  3WHB A;  2FOK A;  5M3F J;  2P81 A;  1IN5 A;  1V5F A;  2IA0 A;  3J7Z I;  3LST A;  4G9Y A;  3IKT A;  3BZ6 A;  5HLH A;  1NK2 P;  4IHX A;  1B8I B;  4HV5 A;  4IOC F;  2LOO A;  3GWZ A;  4XLH A;  3MZH A;  1BIB A;  5H20 A;  5FGM A;  3X2Q H;  2W57 A;  1IV8 A;  4PUS A;  1I1S A;  3QPT A;  5KNL A;  3WU2 C;  2KHM A;  1E17 A;  3V8L A;  3I53 A;  3D5L A;  2YR2 A;  4ANJ A;  1QPI A;  1AU7 A;  1FPQ A;  3FK7 A;  1TWH J;  2VC1 A;  1Y1W J;  2JTV A;  3ZQF A;  2M7B A;  4WK8 F;  2Z3Y A;  2E2H J;  2WC2 A;  3AG1 H;  2M87 A;  5J6X A;  1VQ7 I;  1ON2 A;  1TLH B;  2QKM B;  1XMK A;  3MKL A;  1KQ8 A;  4ZTF A;  4BKX A;  3HB9 A;  1VQ4 I;  4BS9 A;  2WBM A;  3K4J A;  2CW7 A;  3G71 I;  1XSD A;  2PJR A;  4ITV A;  1B59 A;  4BE0 A;  4I02 A;  2V4J C;  4A3L J;  4EGZ A;  4IJA A;  4GGG A;  1R7J A;  1T6S A;  3CUO A;  2R7U A;  5E3N A;  1I6X A;  4R1H A;  3SDB A;  3QOD A;  2CFX A;  4L9V A;  1OR7 C;  5FLX Z;  1A6Q A;  2DK8 A;  4A3D J;  1RUO A;  2LG4 A;  3RPQ A;  5FRN A;  2KMU A;  1R1V A;  2WAF A;  3HXL A;  4B1R A;  2MC3 A;  1YW9 A;  2K4J A;  5EF6 A;  2DTZ A;  4KIG A;  4UUS A;  3BPX A;  1FMV A;  2CUE A;  3HRS A;  3OYD A;  1UFM A;  1WI9 A;  3UKG A;  1DUX C;  3DEE A;  2DYR H;  2GIV A;  5BPI A;  4WCG A;  1WRJ A;  2FSW A;  5FRM A;  1HKT A;  4BAY A;  3KZI C;  3ROU A;  3OYN A;  1AWC A;  2QGU A;  3OR2 C;  4UB8 C;  1FP1 D;  3O8H A;  1Z67 A;  3HOY J;  2MH2 A;  2DLL A;  2E2J J;  5LBQ A;  1DU0 A;  1OCR H;  3MEX A;  3HTS B;  1R58 A;  1JUP A;  1TNT A;  1BI2 A;  1OQY A;  1P6R A;  1TT5 B;  2DOE A;  2G0E A;  2WB1 A;  4Y52 J;  1FSE A;  2O7O A;  2VJ5 A;  3W3C A;  4L9J A;  3D0S A;  3F0C A;  1JJ8 C;  3JR9 A;  1D0Z A;  3UNG C;  5DCF A;  2M2E A;  3CDL A;  1Y0U A;  2XDV A;  3GLL A;  1FOW A;  2LSO A;  2CMP A;  3H3U A;  3LAJ A;  1B9N A;  3T8T A;  2QQ9 A;  2BXZ A;  2NVU B;  1JKQ C;  2CO5 A;  4ZTJ A;  3VSK A;  2DDA A;  2JA2 A;  2JRT A;  3GW2 A;  2F48 A;  1VQ5 I;  1RIO H;  3CDH A;  2FRH A;  1E3H A;  2ID3 A;  5HDK A;  2V9P A;  3DP7 A;  1UHS A;  5EYR A;  1JKP C;  3UR3 C;  2QM3 A;  3W2V A;  2IW5 A;  4JP0 A;  1U5T C;  2M4K A;  2FU4 A;  2RAE A;  2W84 A;  2LBF A;  4P9U A;  5IY5 H;  5GTI C;  4F91 B;  2EBI A;  2P0W A;  1NHA A;  5EDN A;  2CV1 A;  2DA1 A;  4IQJ A;  3JAM Z;  3FXM A;  5FLX K;  1FYK A;  3DLA A;  1VZ0 A;  4UVC A;  4BY7 J;  1U2W A;  2O6G E;  4B4C A;  4P5O A;  4EM0 B;  2BBY A;  5KHD A;  3GXO A;  5KK1 A;  1D3Y A;  1K6Y A;  1G3S A;  2MW8 A;  3I58 A;  1ACI A;  4BDZ A;  1PP7 U;  3U21 A;  1IO2 A;  3IUO A;  2R7D A;  1X2M A;  3OOP A;  5BOX A;  5FKN A;  3HOX J;  3GTG J;  3GLX A;  4V2G A;  2I5U A;  4LOC A;  2R4G A;  2L2O A;  3MQ0 A;  5H6R A;  1WQ2 A;  1EJ9 A;  1WH5 A;  4Y4R A;  3HGG A;  4E7S A;  4M3G A;  1KA8 A;  2VKE A;  2CQK A;  5M5Y J;  3ZQC A;  1YJN I;  2ZME C;  3U1K A;  4LB6 B;  4ETS A;  1ENH A;  2P7C B;  4I98 B;  1Y6I A;  4XOR A;  3OIO A;  4HDV A;  3VOE A;  3AG4 H;  3QOP A;  2DFI A;  3CJQ B;  2MAB A;  2CSO A;  2JVH A;  4U7B A;  3EYY A;  4LB5 A;  3BR1 A;  2CQQ A;  5J8F A;  3FXK A;  3JRH A;  5ILV A;  1YS6 A;  1YG2 A;  2LK2 A;  1TZL A;  4MHG A;  4WX9 A;  1LE8 B;  4P1W A;  2WAQ A;  1QO0 D;  4LJZ F;  1LDJ A;  1TQP A;  3C3W A;  4C3H J;  2HVR A;  1XD7 A;  2HZD A;  4Z2Y A;  1NTC A;  1X1P A;  1OMI A;  3QU3 A;  4LIV A;  1S8N A;  4M9S A;  1OJL A;  4Y17 A;  1OLT A;  3JCU C;  4HX8 A;  3BT9 A;  1FP2 A;  4XSZ F;  3BP8 A;  4RS8 A;  4HNU A;  4B48 A;  1R1T A;  1R5H A;  4WXH A;  2FJ1 A;  4AIK A;  1TNS A;  3TMO A;  2JRM A;  2L9R A;  2KKO A;  4PGH A;  1ZGA A;  4A3G J;  5HNF A;  2Q2E B;  1IDZ A;  4YII A;  3BCA A;  3BTJ A;  3I4P A;  2A5W A;  2R5Y B;  2FOW A;  1GV2 A;  2Y31 A;  4G6D A;  2OCE A;  2ESN A;  2FXA A;  1SFU A;  5AON A;  1IRX A;  2LR8 A;  1J0R A;  2KIU A;  2YX4 A;  3IC7 A;  1W5T A;  1X58 A;  1N75 A;  3ABM H;  5DV5 A;  4CYC A;  5E3L A;  2DAO A;  4XKB A;  3I3L A;  3LA2 A;  3P5J A;  2XKP A;  1X1A A;  4XRS A;  3BDD A;  3J80 Z;  1I6H J;  3CME I;  1X3W B;  1PUF A;  2R7T A;  2B9S A;  2MSY A;  1EA3 A;  4IQ4 A;  2A61 A;  4BU2 A;  3PO3 J;  5CVI A;  5K1Y A;  3E5X A;  1XDS A;  1I50 J;  4L5J A;  3DV8 A;  1YRN B;  1Z0X A;  3I9V 2;  2Y9Z A;  2GXA A;  2R92 J;  3MAJ A;  1AA7 A;  2OA4 A;  3GCM A;  1IAW A;  2ZXI A;  3HSE A;  3NQO A;  1IXC A;  3F6O A;  3G73 A;  2MC4 A;  3SJM A;  1WJB A;  3S93 A;  3DQV C;  3QP6 A;  3DLL F;  2H1K A;  3CCM I;  2I10 A;  2H09 A;  4BGD A;  2NS7 A;  1FIP A;  3R0A A;  1W7P D;  3OYB A;  1MND A;  1RKW A;  4IX7 A;  3CCE I;  3U1D A;  4W1U A;  3IRQ A;  3ZPL A;  4KNY A;  3K2A A;  1HST A;  1OCC H;  2EA4 A;  3J7A O;  3QYB A;  4PJJ A;  1RET A;  1BJZ A;  4IL6 C;  3KLO A;  5EEH A;  3CMM A;  3RZO J;  5J4Y A;  2E5Z A;  3MKY B;  4A5N A;  2ISZ A;  2V1D A;  2V1X A;  4MQV A;  1FBQ A;  4YEJ A;  2PMZ N;  4PJM A;  1YLF A;  5B3S H;  3DTE A;  2IPQ X;  4BEH A;  4A0Z A;  2LKX A;  1FIA A;  1KYZ A;  1ZAR A;  4BE2 A;  4A3F J;  3OYJ A;  4CIC A;  3HZJ A;  1F36 A;  2EZL A;  4FAS D;  3C2B A;  3PFI A;  4HQE A;  3QPH A;  1R9T J;  2HOE A;  1EKE A;  2L9S A;  5L3B A;  2O9L A;  3K4N A;  3CJR B;  3M07 A;  3OYH A;  1YX3 A;  2CS3 A;  2FF4 A;  1GUU A;  3SXY A;  4FET A;  5GAG J;  4P9F A;  2NOJ B;  1E0E A;  2OF7 A;  3S16 J;  4NNJ A;  2NVT J;  2JWT A;  3FX3 A;  3S32 A;  1JI8 A;  2DA2 A;  4Y33 A;  1SMT A;  4M6Y A;  2BY1 A;  3I55 I;  3P9K A;  3I56 I;  4J19 A;  3PUB A;  1TTY A;  2J5P A;  4RAZ A;  3LSK A;  2A3S A;  2HZT A;  2OV7 A;  1IG7 A;  3MZ8 A;  4G6Q A;  5IPA A;  4QLC U;  1Z7U A;  2L54 A;  2MGQ A;  3GME A;  3RCO A;  1PYV A;  4D7M A;  5K7H A;  3J80 K;  1WH7 A;  2XVC A;  3H9Q A;  1C0W A;  2CV2 A;  2EB7 A;  4EVI A;  3HDD A;  2DFE A;  3E5U A;  1X4P A;  1TP4 A;  1GLN A;  3B02 A;  3WTZ A;  5BMZ A;  5L3E A;  3ZQQ A;  2G7U A;  3LSI A;  4GDF A;  5ICG A;  3T8R A;  2P5V A;  4DYQ A;  2F5D A;  2Z1D A;  4EJU A;  2R5Z B;  2ISY A;  5J47 A;  4BBR J;  3CCJ I;  2GZW A;  1TW3 A;  3G3Z A;  4OIO F;  3OSG A;  3K0L A;  3FBN B;  1ON1 A;  4B44 A;  4G7O F;  1QHG A;  2DOF A;  2BHZ A;  3R4K A;  2YU3 A;  5DD8 A;  3RYR A;  1K83 J;  1QPM A;  4HX4 A;  4MGR A;  3J81 K;  1LB2 A;  3OMY A;  4RLF A;  3AG2 H;  3BY6 A;  2EV5 A;  3MKW B;  1BN5 A;  2R7F A;  4XMY A;  2EFP A;  2L7M P;  1G6N A;  1R4N B;  2ZC2 A;  2X0L A;  1UG2 A;  1QRY A;  3LA3 A;  2NYX A;  2HPI A;  1MDM A;  2QUF A;  2H8R A;  2DT5 A;  3S2D J;  3H1C A;  3CCV I;  2DA7 A;  3H5A A;  1SMY F;  4M3F A;  2JMW A;  2BE5 F;  5KCM A;  4XLN F;  4AWX B;  4KT6 A;  4ASN A;  4BXX J;  1ETX A;  2FA5 A;  4BY1 J;  5D4R A;  2GOX B;  2VI6 A;  2NVY J;  3KFW X;  2EFW A;  4FX4 A;  5F1R A;  3GTJ J;  2MD0 A;  1OCT C;  2V26 A;  1MMS A;  3M1E A;  1S3J A;  1O7L A;  5K7Z A;  1U6G A;  4LLL A;  4UVA A;  1S7A A;  3HJE A;  3WU0 A;  1W36 C;  1FBS A;  1MBF A;  2EFQ A;  2DMU A;  4RGX A;  3RTR A;  4BQN A;  2BY3 A;  4F7Z A;  3H3V K;  3M8F A;  2HYF A;  4KJZ A;  4S05 A;  4BJ5 C;  1GXP A;  4BQA A;  2RRE A;  3BPV A;  1J9I A;  4OMY A;  2BW3 A;  3ZQL A;  3KP6 A;  3CDI A;  3TW7 A;  4UB6 C;  3ULQ B;  2DK5 A;  3L2Q A;  2R7S A;  2W85 A;  2HNH A;  5ICF A;  2K9N A;  5FJ8 J;  4XNF A;  4PJ0 C;  3K4C A;  2HKO A;  4L5I A;  3QU6 A;  1JKO C;  3BR3 A;  3G6E I;  4JX6 A;  2XF6 A;  3SQN A;  1IJW C;  3SFZ A;  4JK1 X;  1YJW I;  1U5T A;  5D6F A;  2K02 A;  3WGH A;  1JXS A;  3E7L A;  3RI4 A;  2KL4 A;  4A5M A;  1YIJ I;  3PUF A;  1ZGW A;  2A05 A;  2DJN A;  5IYC J;  2E71 A;  4GYI A;  2E5N A;  2ZFW A;  1W4M A;  1XN7 A;  4LIT A;  5F04 A;  2VKH A;  3NWT A;  2WY7 Q;  1BIA A;  2ELK A;  2MD5 A;  4IO9 F;  2OJE D;  1P4X A;  2CQX A;  3O3K A;  4WF2 A;  2RVC A;  4ZC3 A;  3BR0 A;  1O3S A;  5E1W A;  3RYP A;  4I76 A;  2AXL A;  3HOW J;  4FE7 A;  4NUB A;  3PIP F;  5HS9 A;  2VPL A;  3K70 C;  4BBS J;  3C7J A;  3FXJ A;  2BZT A;  5J40 A;  1WSU A;  1QBJ A;  2GXG A;  2R0Q C;  1ONV A;  3ABT A;  1H9T A;  2W24 A;  5FD6 A;  3F23 A;  2QEX I;  3S2H J;  1NG7 A;  4CZZ A;  2M5W A;  4YFK F;  1O3T A;  4RDU A;  1HDP A;  1P2F A;  3P9I A;  1YIT I;  4J00 A;  2CJJ A;  2RKH A;  3O2P E;  5LD2 C;  2JN6 A;  3HEF A;  3FHZ A;  2FBK A;  2OAZ A;  5CVU A;  1K7A A;  4AVZ A;  3DBR B;  1SFX A;  4XLC A;  3EYI A;  2ZME A;  1BI1 A;  1B8I A;  2UZK A;  5L3D A;  1XDU A;  2VE9 A;  2X1C A;  4ESJ A;  2L0K A;  1X2N A;  1ULY A;  3G1M A;  1I5Z A;  2NNY A;  1BI0 A;  4QIW N;  2Z2S B;  2X6W A;  1CF7 B;  2WWY A;  4IHW A;  1ZLJ A;  4PCQ A;  5JHF A;  1VQO I;  4DNC A;  1KU9 A;  5LFA A;  2XKO A;  3ABU A;  3OYG A;  1V5G A;  5L3G A;  4LG3 A;  3ESW B;  5J3L A;  2ELH A;  1VTN C;  2PMU A;  2QVO A;  2M34 A;  2LFB A;  2RV8 A;  4CDG A;  1Y39 A;  2AO9 A;  2VBX A;  3TDU C;  1XGO A;  4YFN F;  4ZDO A;  2EIK H;  4N4O B;  4KIS A;  1JTX A;  3SZP A;  5IT9 Z;  3HOV J;  1FYM A;  4C2U A;  5TIS C;  2D45 A;  1ERD A;  3BC8 A;  3V8K A;  1D1C A;  1B6A A;  3HOS A;  2GQQ A;  2DPU A;  3LSM A;  3EPZ A;  2XAG A;  3FM3 A;  3DKY A;  2PN6 A;  1XC5 A;  3EDP A;  1RKT A;  1ZK8 A;  2XRN A;  2CRG A;  1Y0N A;  3O8G A;  3VSL A;  1S7E A;  3MFK A;  3KIO A;  3MWM A;  4B3A A;  4XN3 A;  2K9M A;  5CQE A;  3BR6 A;  2RNJ A;  1RI7 A;  3CUQ B;  1PP8 F;  2DQR A;  4ESF A;  5LGT A;  1FNN A;  4YIR X;  4XQF A;  5E20 A;  3GTL J;  5IP9 J;  1OCZ H;  4EM1 A;  4C2M J;  1IDY A;  4A3C J;  2KIQ A;  3NRV A;  3KZY A;  1J5Y A;  1XSV A;  2DOD A;  2LDU A;  3CC7 I;  1SEU A;  3R60 A;  2M8G X;  1ZRE A;  1WZ2 A;  3ZN0 A;  3OYL A;  3WHC A;  4LK0 F;  1N78 A;  1D8J A;  4KMU X;  4NB5 A;  2MH9 A;  5EGO A;  2JK3 A;  4JYK A;  3BR2 A;  5D4S A;  2DFH A;  4A6E A;  2HR3 A;  2ZBK A;  1F43 A;  3OS1 A;  5EG0 B;  1J7K A;  2VBZ A;  1XCB A;  1VI0 A;  2LP0 A;  3TED A;  1SD5 A;  5BPD A;  4C2T A;  1R23 A;  1DU6 A;  3FMR A;  3K7A J;  1QA6 A;  1ZHF A;  3KCC A;  2K9S A;  2E36 A;  5FLM J;  5FFZ A;  3CCR I;  1GDT A;  2X6X A;  3J7A Y;  3KP3 A;  3LFK A;  2PEX A;  2Q0O A;  2EIJ H;  2ICW G;  1HC8 A;  3JRI A;  3CCU I;  3WTT C;  2Q8K A;  1P4W A;  1AKH A;  3ZOB A;  3A03 A;  4HSR A;  3DBH B;  2KZG A;  1G4D A;  3MKZ A;  3JTG A;  3HHG A;  3BCB A;  5E1Z B;  3T5X A;  1KQ0 A;  1PUE E;  3TOA A;  1LDD A;  3KP5 A;  3IWF A;  1DDN A;  1UMQ A;  2IGO A;  3I0T A;  3PNT A;  2VL8 A;  1ZR2 A;  1WJE A;  3RPU D;  3E6C C;  3SDG A;  1ZG1 A;  2COB A;  4LLG F;  4LK1 F;  3TGN A;  4PSX A;  4BHB A;  1TWG J;  4BUP A;  4ENK A;  1XSX A;  1MH3 A;  2F5C A;  1MBE A;  3PJR A;  4QPO A;  1NK3 P;  1IUY A;  2EJR A;  2QF7 A;  1JKR C;  2F4I A;  2V1U A;  1MMG A;  2Y69 H;  1O3R A;  3K4M A;  2IS1 A;  5DTD A;  1EH6 A;  1U9O A;  1SD7 A;  3IP4 B;  1IGN A;  2FBH A;  1LJ9 A;  5F08 A;  1ITY A;  1TQI A;  2LC2 A;  2UUZ A;  2X1D A;  1BI3 A;  1O7F A;  4I0B A;  4O5V A;  2ACJ A;  4D9J A;  1FC3 A;  3S1N J;  1QHH D;  4BE1 A;  5DD4 A;  1RRJ A;  2YU9 J;  5LLQ A;  3D5S C;  1SAN A;  3PFY A;  5IYB J;  2VC0 A;  1RZ4 A;  3B6C A;  2W00 A;  2XGD A;  3BG7 A;  4NDL A;  2QA4 I;  3GEZ A;  4FX0 A;  3TP3 A;  1BBY A;  1K78 B;  1ORK A;  3I4N J;  3FF5 A;  5HOO A;  2GA1 A;  5LGU A;  1X19 A;  2KPM A;  3QP5 A;  5A2Q Z;  2E1O A;  2CQ7 A;  3GFJ A;  4IEJ A;  3ZMT A;  1JHF A;  1Z6T A;  2KJC A;  5IP7 J;  2VQC A;  3DKX A;  4PFO A;  1HBX G;  3CMA I;  2UV1 A;  5GPA A;  1J2X A;  4M9Z A;  4H0E A;  1GV5 A;  3ISP A;  2BVL A;  1SVL A;  4RB1 A;  2OZ6 A;  1YTY A;  3LQQ A;  4HF2 A;  3OY9 A;  1IN6 A;  2VOD A;  2PX9 A;  3B73 A;  2KIM A;  2OC6 A;  3B6A A;  3DEW A;  5K5Q A;  4Q5S F;  2PLY A;  2DQL A;  4BL0 B;  1SFK A;  3A2K A;  3PO2 J;  2A5Y B;  5HOD A;  1FTZ A;  3ZQH A;  1JE8 A;  3AL0 B;  2R7V A;  2CFO A;  4PK4 A;  3DCF A;  4Y3O A;  4RBO A;  4HW0 A;  1FYL A;  1H8A C;  4A3E J;  2HDD A;  1T33 A;  2CG4 A;  5IOY A;  3IAS 2;  3GF2 A;  3Q0U A;  4I6Z A;  2NXN B;  4N9I A;  3GX4 X;  3ZMZ A;  3NWS A;  3FM5 A;  2LF7 A;  4U0W A;  2Q2E A;  5K5O A;  4EEF G;  1VFC A;  2HYG D;  3E97 A;  2PQ8 A;  2F2E A;  1SFE A;  1XG1 A;  2GLO A;  3TDZ C;  2FX0 A;  2E1M B;  3I64 A;  2XGX A;  4F92 B;  2MG4 A;  3ASO H;  2A69 F;  2ID6 A;  3K9T A;  4WXD A;  1P7J A;  5D5W B;  4KA4 A;  2Y0S N;  3CUQ C;  3OYK A;  4ZYD A;  2QSF X;  4XKC A;  1LEB A;  2W7N A;  2EV0 A;  4M6X A;  3ELK A;  5H2F C;  2KLO A;  3EUH C;  3H9G A;  2FUG 2;  4MTD A;  2ZFU A;  4AUX A;  1T95 A;  3S8P A;  2P4W A;  3V8J A;  4XRF A;  5TJJ A;  2IT0 A;  3V4G A;  5B1B H;  4ZYE A;  5KAI C;  3HHH A;  2KZV A;  1HDD C;  2IS6 A;  5D5X B;  1K4S A;  2ECB A;  3OS2 A;  2OQG A;  4ZZL A;  1MNM C;  1R6R A;  4ENN A;  3IH2 A;  2EV6 A;  2EFO A;  1BM9 A;  5A2Q K;  4UUV A;  4BHP A;  4F3Q A;  5J1R A;  2M7A A;  4XKV A;  2ZCW A;  2EIN H;  3I5U A;  2VKD A;  4IKF A;  2IRF G;  3ECH A;  4E70 A;  1BR2 A;  5E3M A;  3FDY A;  2Z5U A;  3BQZ A;  1ZKG A;  1ZN2 A;  5JVT A;  3H5N A;  2X9D A;  2M9H A;  2R7X A;  4BNC A;  4E7Z A;  2XGC A;  4XID A;  4HST A;  4JQF A;  4HQM A;  4HLX A;  4FTH A;  3RDI A;  3RJP A;  2E2I J;  3MD2 A;  3OYM A;  3ZQI A;  1G3W A;  5LHG A;  3GZ5 A;  4P55 A;  1D0Y A;  4RAY A;  1GVD A;  2XAH A;  4HV6 A;  4UV8 A;  3RQI A;  3LSP A;  4QSH A;  4HNV A;  1DGW Y;  4N4N B;  4F55 A;  9ANT A;  4V2F A;  3IH4 A;  2M1B A;  1ZEL A;  1VF9 A;  2FBI A;  1IRF A;  3F8F A;  1W0T A;  2NRA C;  4NBQ A;  3QQA A;  1OFC X;  5FKL A;  2DMQ A;  2OCC H;  1IRG A;  2V6C A;  4BXU A;  2A6E F;  3E1S A;  4YIF A;  3MCZ A;  5HLI A;  2D2W A;  2AQE A;  2O8K A;  3F72 A;  5DCM A;  4RM2 A;  2JSP A;  2VIX A;  4HZF A;  4A0Y A;  2XF7 A;  2IS4 A;  1RES A;  3OYE A;  4U0V A;  2IVM A;  2N8G A;  4PJL A;  3BJA A;  1EH7 A;  2CH0 A;  3A0H C;  2LY9 A;  3G2B A;  3JAM K;  1XPX A;  4Q47 A;  4BJ6 C;  3PM1 A;  1WFX A;  5FRO A;  3F8N A;  1UCR A;  3V7S A;  3KEY A;  3WTV C;  1UHW A;  3DXJ F;  3TOB A;  4IZZ A;  3TO6 A;  2P5K A;  4Y7N J;  4FHT A;  4KIB A;  2VXD A;  4NC7 A;  1FBU A;  5ILS A;  3JRB A;  3GZN B;  1ZG5 A;  2R5Z A;  3V7R A;  1B72 B;  1RUN A;  1TWA J;  3HL2 A;  1BR1 A;  3HPH A;  4DOZ A;  5ED4 A;  2Y0M A;  5GPC A;  4E4H A;  2HTS A;  1I3A A;  2CYY A;  4CHU A;  4WWC A;  2CU7 A;  1V55 H;  3CC4 I;  4XKW A;  3C2H A;  1HKQ A;  2E34 A;  1OYW A;  2HDW A;  4EJV A;  3CF5 F;  1VQK I;  4RM3 A;  2ETH A;  2KFD A;  4HDU A;  2OD5 A;  5FD5 A;  1POG A;  1Z3Y A;  4A2U A;  3ZCO A;  4X6A J;  3VB2 A;  3OYC A;  5GAD J;  2YS9 A;  5CVJ A;  4RB3 C;  2CUF A;  2LRD A;  5E3O A;  3QYE A;  3HIF A;  5CJ9 A;  3L2W A;  1G8X A;  2NVQ J;  4UNO A;  1X1C A;  3MMY B;  3HM5 A;  4MFD A;  2GM4 A;  2COM A;  2BVM A;  2O5R A;  5FFX A;  3F6V A;  1T0F C;  1RPW A;  2TDX A;  1O4X A;  3AL0 C;  3OL3 A;  4A93 J;  3HRM A;  2ZNY A;  2FQ4 A;  2WTE A;  3JRC A;  2ADU A;  1QZY A;  2IJL A;  2EIM H;  2A6H F;  2EIL H;  3DEU A;  2K86 A;  3RPU A;  4D5F A;  1FZP B;  2GBY A;  3LL7 A;  2QQ8 A;  2X6Y A;  2JPC A;  1PDN C;  3GYH X;  2FE3 A;  1BJA A;  2HOT A;  2YSR A;  2GXB A;  3H9J A;  3QPL A;  2E1M C;  4DYC A;  4WXC A;  3OYF A;  5EEG A;  1W1W E;  2CWE A;  1Z77 A;  1HSJ A;  3RKY A;  1WJ5 A;  2WY8 Q;  4IRI A;  1YQA A;  1KGS A;  2F6C A;  1QZE A;  1K4T A;  2QYO A;  4G8X A;  1HXD A;  4A3B J;  2VLA A;  3JRG A;  3IKV A;  3VYT B;  1A5J A;  1WGX A;  2MBF A;  4EM2 A;  2QZ8 A;  4A3J J;  3HUG B;  1WHU A;  4IRG A;  2LY2 A;  2KRH A;  2H8W A;  4U7D A;  4Q4Z F;  2NNN A;  3BG3 A;  5B66 C;  4F52 A;  2DXI A;  1O3Q A;  1S72 I;  1U0J A;  4JX5 A;  1KU2 A;  1LPQ A;  1FOK A;  3GTP J;  1OR7 A;  4CYC B;  2OUM A;  3S17 J;  1R4M B;  3HYI A;  4RAF A;  2ZXH A;  2HVS A;  3Q0W A;  5DM7 F;  2H94 A;  5L3F A;  4RGR A;  1XCV A;  4BAC A;  1PUF B;  2K85 A;  3BLY A;  2X1E A;  4NQW A;  3V42 A;  1K79 A;  1SAX A;  2XSJ C;  1MMD A;  1SVM A;  3ZXS A;  3GBG A;  2L01 A;  2K7L A;  2PMH A;  3D1N I;  4CYD A;  3C2G A;  3DPU A;  4OOI A;  1T56 A;  2YUS A;  5HVQ C;  2P8T A;  3GTQ J;  1S9H A;  3Q9V A;  3BZK A;  5LHH A;  1I1G A;  3ECO A;  2CV0 A;  2PJP A;  2JJ7 A;  2LF8 A;  3F8C A;  3PSI A;  4ABZ A;  5HS7 A;  1MGT A;  2HI3 A;  2X4H A;  5DEQ A;  1OYY A;  2R7W A;  2DFF A;  3BQY A;  1MJB A;  1LVA A;  1ZGJ A;  2EZI A;  4KMF A;  2H1L A;  3GTM J;  1V5E A;  2HOA A;  2VT3 A;  2K9L A;  2XC7 A;  1FMW A;  2QLZ A;  4DZJ A;  1SC7 A;  3PIO F;  2QSH X;  3JRF A;  3F22 A;  3S1Q J;  2VKV A;  4AM3 A;  3FXU A;  3KYC B;  5B1A H;  1J75 A;  4HAM A;  1JTY A;  1R5G A;  3SZT A;  2DT6 A;  1ZH5 A;  3SEQ A;  4XRM A;  5JHU A;  4XIC A;  4G7H F;  3PQK A;  4BXF A;  4L5E A;  2H6C A;  3L2R A;  1T2K A;  5ICC A;  3CO7 C;  3HPG A;  1KU3 A;  3LQR A;  1W36 D;  4QTR A;  1DGR M;  1XS9 A;  5FO5 A;  1K61 A;  3EET A;  3GFI A;  2IAI A;  3ZP5 A;  4AIJ A;  2L02 A;  3FXO A;  4H4K C;  3PNY A;  4M3D A;  2JUC A;  3I4M J;  2HU9 A;  5HLG A;  1WJD A;  2OQR A;  4HA8 A;  3W6K B;  2HS5 A;  2Y48 A;  1D1A A;  3DU5 A;  3W6V A;  3CUQ A;  4NC6 A;  2BOL A;  4LFU A;  1G2H A;  2L9V A;  4AU7 A;  1JT6 A;  3AAF A;  3HBL A;  1W0U A;  1D1B A;  2EWN A;  4X0G A;  1QZZ A;  3EUH A;  4IOA F;  5LRR A;  3L9F A;  5ICE A;  4HX7 A;  1D8K A;  3ERM A;  1I27 A;  2DA4 A;  3TKY A;  5JFR A;  1N25 A;  2M8E A;  5TGT A;  1UZC A;  5F1J A;  4C30 A;  1DP3 A;  2E7X A;  4MEX F;  1SVO A;  3OS0 A;  1IXS B;  2XRL A;  1MIJ A;  2FNA A;  4S0H B;  2PMZ A;  5BQT A;  2DPD A;  4E6K G;  2VAS A;  3VEP A;  2XPV A;  3TP0 A;  1WKM A;  4UXN A;  4CGZ A;  4IVN A;  1BOA A;  5DYM A;  2CW8 A;  4M73 A;  4XLE A;  3KEO A;  3CJN A;  4CZC A;  4L9T A;  4OIQ F;  5ILU A;  3K70 D;  1V4R A;  1Z7L A;  1JHH A;  2JZY A;  2LVS A;  2UWM A;  3A1Y A;  3FHN A;  2XAJ A;  4ESB A;  4I99 C;  2WAE A;  2XHK A;  1EV7 A;  1Z6R A;  2QQA A;  1FT9 A;  2X48 A;  2K3P A;  3FKJ A;  2WV0 A;  3HSR A;  4JBA A;  4JOM A;  1BW6 A;  2ZKZ A;  2DOA A;  4MQ9 F;  4C9Y A;  5C4X J;  1TWF J;  1Y8Q B;  3RKX A;  5D6E A;  1U9N A;  1MDM B;  1O57 A;  5H6Q A;  5E1X A;  3VWB A;  2ELJ A;  2JA7 J;  4V19 K;  2GIZ A;  4M9X A;  3VPR A;  5F0H A;  1VQ8 I;  3OYA A;  1T8I A;  5LEK A;  3H0D A;  2W82 A;  1H89 C;  4DYR A;  1NG6 A;  2HGC A;  3WU1 B;  4CCK A;  2AXT C;  5CVR A;  3A4C A;  1QNT A;  4E7L A;  2JVG A;  3OWT A;  2XPU A;  4MO7 A;  2CUJ A;  1E3O C;  2DCE A;  2Y30 A;  4GFB A;  4ZYG A;  2HPM A;  2VN2 A;  4XLF A;  3CP8 A;  2L7K A;  5HDG A;  3OR1 C;  2VXZ A;  4OIP F;  1MMN A;  3QAH A;  1W5S A;  4B8X A;  3H35 A;  1IW7 F;  5M5X J;  2O03 A;  2WB1 N;  2XAU A;  1MJA A;  1ETW A;  4L0Y B;  2VT2 A;  2M0C A;  4CUG A;  3BJO A;  3LMM A;  1MKM A;  3PSF A;  4I2O A;  1X3U A;  2J5O A;  4RAG A;  1BA5 A;  2E1N A;  3M4O J;  2Y9Y A;  2HFH A;  4M3B A;  1SFO J;  4IHT A;  4FQG A;  4Y13 A;  1K6O A;  3F8B A;  2BGC A;  1SD6 A;  1U78 A; 
#chains in the Genus database with same CATH homology
 5DUK A;  4B09 A;  2ZJ2 A;  4GXO A;  5KVR A;  2STT A;  3I59 B;  2QBY B;  3WE2 A;  1K78 A;  1RNL A;  3K69 A;  1H9G A;  4MNU A;  3GFM A;  2LKP A;  1HQC A;  3Q9S A;  2H27 A;  3ZMS A;  3SHF A;  1T39 A;  1P4A A;  4I0A A;  4ZH4 F;  3S2W A;  2VBY A;  3WGI A;  4D0P A;  3ZN1 A;  3I54 A;  4RGS A;  3N4M A;  1QQI A;  3V7C A;  1KU7 A;  3E6M A;  1XB4 A;  4IHS A;  1T0F A;  2ZME B;  3ZMD A;  3IWZ A;  1Z1D A;  1SD4 A;  3N97 A;  5IT9 K;  4QWQ A;  4A6D A;  1EH8 A;  1ZG3 A;  2OBP A;  4YG2 F;  1FWZ A;  1Z91 A;  2O8X A;  1QGP A;  3R0J A;  3GZ6 A;  4I01 A;  3W6J B;  2A07 F;  1YIO A;  2JPB A;  1DPU A;  1LEA A;  4RGU A;  2L4M A;  3FMS A;  3GO5 A;  2HDC A;  1Q1H A;  1UHM A;  3TO7 A;  1B4A A;  4EJO A;  4UHT A;  2P6S A;  4RB0 A;  4LG0 B;  4G94 A;  3F21 A;  4LD5 A;  1H0M A;  5D8L B;  3M8E A;  5LGN A;  4GO1 A;  4FT8 A;  1ZRF A;  1OYI A;  1OPC A;  2K27 A;  4EQQ A;  1HW1 A;  4ZZD A;  2O61 A;  3JW4 A;  2M30 A;  4OU0 A;  4K2E A;  3P9C A;  2P7V B;  1W7P B;  4M71 A;  1R36 A;  4EV0 A;  2GAU A;  3WG9 A;  3DPL C;  2FMY A;  4KT5 C;  4ENJ A;  3L09 A;  3VFZ A;  4DQ2 A;  4NHJ A;  4KYW A;  1J59 A;  2L3D A;  4M72 A;  3K1P A;  2KIF A;  1REP C;  4AVP A;  5LHI A;  4Q48 A;  5AIQ A;  4U88 A;  1AOY A;  3KP2 A;  2E7W A;  4G7Z F;  5F64 A;  2HQN A;  1A04 A;  3CLO A;  2FEZ A;  4CO8 A;  3GFL A;  2Z9O A;  1T38 A;  5J8C A;  1ZYR F;  2VOO A;  5E17 F;  3RKW A;  1B9M A;  3REO A;  3RIR A;  1D5V A;  3MZY A;  1E2X A;  3H3Z A;  2K4B A;  3KLN A;  3LA7 A;  1XGS A;  3JTH A;  5E18 F;  1G3Y A;  3LAP A;  3WE3 A;  5CVV A;  1L3L A;  4UV9 A;  5IT3 A;  1U3E M;  2D1V A;  3CO6 C;  4EJW A;  3JSP A;  2MLK A;  3IL2 A;  1IXR C;  2B0L A;  5DDG A;  2MA3 A;  2RC4 A;  4A0X A;  1S6L A;  1KYW A;  2PFB A;  1U8R A;  2FNP A;  4CXF A;  2IA2 A;  4EJT A;  1ZAO A;  2FML A;  2XV4 S;  3FWE A;  3WTU C;  1HW5 A;  3PQJ A;  2L4A A;  4PZJ A;  1F9N A;  3K1M A;  4L0Z B;  3R61 A;  3QRF F;  2YPR A;  2MLG A;  2Z33 A;  4HLY A;  3NEU A;  3M9A A;  3IRR A;  2RQP A;  2IA1 A;  4HF1 A;  5ERI A;  3M7G A;  2DW4 A;  1BC7 C;  1TBX A;  1FX7 A;  4O6J A;  2ZNZ A;  2XAQ A;  3T1B A;  4P96 A;  4AD9 A;  4UVB A;  5F6F A;  3EQL F;  3U2R A;  5LRS A;  3HUG A;  2M45 A;  3KP4 A;  2BEO A;  1YYV A;  2KJB A;  4BHC A;  4KN4 X;  4XBF A;  2LNB A;  1GVJ A;  3WOD F;  3Q5F A;  3WTW C;  2H6B A;  1KQ9 A;  3BRO A;  2PI0 A;  1IN8 A;  3HRU A;  1STZ A;  1IF1 A;  2HEO A;  1XGM A;  1LDK B;  3KE2 A;  1BC8 C;  2E1C A;  3KEQ A;  2NS0 A;  3R6S A;  3L2C A;  1OKR A;  2HKX A;  2W25 A;  4ENM A;  5D5U B;  5JI6 A;  2EK5 A;  4LLN A;  3ZMU A;  1F5T A;  1HW2 A;  2UXN A;  1YFH A;  4TV7 A;  3BWG A;  3K2Z A;  2JSC A;  3J81 Z;  5L3C A;  3L7W A;  4HBL A;  1USS A;  3HSF A;  3IHU A;  3TO9 A;  1IN4 A;  4I7H A;  2OZU A;  1ZRD A;  3KP7 A;  4IF4 A;  4ON0 A;  2RDP A;  4L9N A;  1IN7 A;  3HOT A;  3WGG A;  1HKS A;  2V9V A;  2EFN A;  3ZMV A;  4XSX F;  3FZV A;  2UXX A;  2HTJ A;  2OU2 A;  5DUI A;  2AS5 F;  2QQB A;  3KZZ A;  1ODD A;  4GYG A;  4PGG A;  4XLP F;  2P6T A;  4KN7 X;  4I09 A;  5DCM B;  1DPR A;  3WTS C;  3COA C;  4OIN F;  4LMY A;  1UB9 A;  2ZO4 A;  1FLI A;  2A68 F;  2V79 A;  4IRH A;  3FXQ A;  2Y75 A;  4AIH A;  1XGN A;  4HF0 A;  4EMS A;  2F5E A;  2NAZ A;  5TRD A;  2O0Y A;  4R79 A;  3H92 A;  2XUB A;  4OIR F;  2G9W A;  5K5R A;  1S7O A;  4KFC A;  4PDK A;  1LQ1 A;  5AIP A;  2VE8 A;  4RB2 C;  1R1U A;  2ESH A;  2DI3 A;  2DTR A;  1F4K A;  2VOP A;  3P7N A;  4YFX F;  1ZLK A;  5E8I A;  1CF7 A;  2DU9 A;  3VOD A;  1XMA A;  5HDN A;  1G3T A;  5D5V B;  2F5F A;  4HOB A;  3DF8 A;  4EGY A;  3F8M A;  3C18 A;  3O6B B;  2ZXJ A;  1R22 A;  1B1B A;  1Z9C A;  4MTE A;  3LWF A;  2VBW A;  2XIG A;  3E6D A;  4Y15 A;  1TW2 A;  3ML6 A;  3E3V A;  2D1H A;  3GUD A;  3DPT A;  5FB2 A;  1YW7 A;  4KIC A;  1MD0 A;  1F1Z A;  2GA2 A;  3I59 A;  4IPA A;  2Z99 A;  2QBY A;  1FSH A;  4IXA A;  2STW A;  2O3F A;  3FMQ A;  3WTX C;  3KET A;  1YW8 A;  4S04 A;  2G7H A;  2GWR A;  3WTY C;  2QWW A;  5E8G A;  2EA2 A;  3L00 A;  1S29 A;  3TQN A;  3I71 A;  1MJ9 A;  3K1N A;  1Z05 A;  1R00 A;  4O3M A;  2R3S A;  5HS8 A;  3BJ6 A;  5LEJ A;  2BV6 A;  2IP2 A;  3OV8 A;  4M74 A;  3DFG A;  2QEN A;  2KRF A;  5BS6 A;  2C6Y A;  1GHC A;  1UST A;  2PBI A;  3U9G A;  1GXQ A;  4KUM A;  4N0B A;  3E5Q A;  2XRO A;  2YX7 A;  4U0Y A;  1CGP A;  3GVA A;  4OMZ A;  2RGV A;  2VON A;  2XAS A;  1T98 A;  1ZRC A;  1TQM A;  2DO7 A;  2PG4 A;  2P5L C;  1JGS A;  2HWV A;  2HQR A;  6PAX A;  5JR3 A;  3DKW A;  1DP7 P;  3F3X A;  3E6B A;  1YS7 A;  1YO5 C;  2JT1 A;  3BOQ A;  1WWX A;  1L0O C;  3C1D A;  4BYY A;  3CTA A;  1LNW A;  1U5T B;  3ZQ7 A;  4KDP A;  4L18 B;  4LG0 A;  4ZYH A;  4A12 A;  2CW0 F;  3HRT A;  1V3F A;  2RN7 A;  4BH9 A;  2FQ3 A;  2XAF A;  3JSO A;  4LGW A;  3FXR A;  3ERE D;  3HTU A;  1W7P A;  4R8H A;  4HYE A;  2CGP A;  3T0Y A;  2DBB A;  4GCV A;  4MEY F;  4KIF A;  1MZB A;  4N9H A;  5D8K B;  2BYV E;  5CLS A;  1FY7 A;  1IZ1 A;  5CYV A;  1P92 A;  2FOK A;  1IN5 A;  2IA0 A;  3LST A;  4G9Y A;  3IKT A;  3BZ6 A;  5HLH A;  4HV5 A;  3GWZ A;  3MZH A;  1BIB A;  5H20 A;  5FGM A;  2W57 A;  1I1S A;  3QPT A;  1E17 A;  3V8L A;  3I53 A;  3D5L A;  2YR2 A;  1FPQ A;  2VC1 A;  2JTV A;  4WK8 F;  2Z3Y A;  2WC2 A;  2M87 A;  5J6X A;  1ON2 A;  1TLH B;  1XMK A;  1KQ8 A;  1XSD A;  1B59 A;  4I02 A;  4EGZ A;  4IJA A;  4GGG A;  1R7J A;  1T6S A;  3CUO A;  1I6X A;  4R1H A;  2CFX A;  4L9V A;  5FLX Z;  2DK8 A;  1RUO A;  3RPQ A;  1R1V A;  2MC3 A;  1YW9 A;  2K4J A;  4KIG A;  3BPX A;  3HRS A;  1UFM A;  1WI9 A;  1DUX C;  2GIV A;  5BPI A;  4WCG A;  1WRJ A;  2FSW A;  1HKT A;  4BAY A;  3ROU A;  1AWC A;  1FP1 D;  2MH2 A;  2DLL A;  5LBQ A;  3MEX A;  3HTS B;  1R58 A;  1TNT A;  1BI2 A;  1P6R A;  1FSE A;  4L9J A;  3D0S A;  5DCF A;  1Y0U A;  2LSO A;  3LAJ A;  3H3U A;  1B9N A;  3T8T A;  2QQ9 A;  2CO5 A;  2JRT A;  3GW2 A;  1RIO H;  3CDH A;  2FRH A;  5HDK A;  3DP7 A;  2QM3 A;  2IW5 A;  1U5T C;  2FU4 A;  2W84 A;  4P9U A;  1NHA A;  3JAM Z;  5FLX K;  1FYK A;  4UVC A;  1U2W A;  2O6G E;  4P5O A;  4EM0 B;  2BBY A;  3GXO A;  5KK1 A;  1D3Y A;  1G3S A;  3I58 A;  1PP7 U;  2R7D A;  3OOP A;  5BOX A;  3GLX A;  3MQ0 A;  5H6R A;  1WQ2 A;  1KA8 A;  2CQK A;  4LB6 B;  4ETS A;  2P7C B;  4I98 B;  4HDV A;  3VOE A;  3QOP A;  2DFI A;  2CSO A;  4U7B A;  3EYY A;  4LB5 A;  5J8F A;  5ILV A;  1YS6 A;  1YG2 A;  4MHG A;  4WX9 A;  1QO0 D;  4LJZ F;  1LDJ A;  1TQP A;  3C3W A;  1XD7 A;  4Z2Y A;  1OMI A;  3QU3 A;  1S8N A;  4M9S A;  4Y17 A;  4HX8 A;  1FP2 A;  4XSZ F;  3BP8 A;  4RS8 A;  1R1T A;  1R5H A;  4WXH A;  4AIK A;  1TNS A;  2KKO A;  4PGH A;  1ZGA A;  4YII A;  3I4P A;  4G6D A;  2ESN A;  2FXA A;  1SFU A;  5AON A;  1J0R A;  2KIU A;  2YX4 A;  3IC7 A;  1W5T A;  5DV5 A;  2DAO A;  3LA2 A;  2XKP A;  3BDD A;  3J80 Z;  2A61 A;  5CVI A;  5K1Y A;  3E5X A;  1XDS A;  4L5J A;  3DV8 A;  3MAJ A;  2OA4 A;  1IAW A;  3HSE A;  3NQO A;  1IXC A;  3F6O A;  3G73 A;  3DQV C;  3QP6 A;  2H09 A;  3R0A A;  1W7P D;  3U1D A;  3ZPL A;  3IRQ A;  4KNY A;  1HST A;  2EA4 A;  3J7A O;  3KLO A;  5EEH A;  4A5N A;  2ISZ A;  2V1D A;  2V1X A;  4MQV A;  1FBQ A;  1YLF A;  2IPQ X;  4A0Z A;  1KYZ A;  1ZAR A;  4CIC A;  4HQE A;  3PFI A;  3QPH A;  2HOE A;  5L3B A;  2FF4 A;  3SXY A;  4P9F A;  3FX3 A;  1SMT A;  4M6Y A;  3P9K A;  1TTY A;  2J5P A;  4RAZ A;  2A3S A;  2HZT A;  4G6Q A;  4QLC U;  1Z7U A;  2L54 A;  3J80 K;  1C0W A;  2XVC A;  2EB7 A;  4EVI A;  3E5U A;  3WTZ A;  3B02 A;  5BMZ A;  5L3E A;  2G7U A;  5ICG A;  3T8R A;  2P5V A;  2F5D A;  4EJU A;  2ISY A;  2GZW A;  1TW3 A;  3G3Z A;  4OIO F;  3K0L A;  1ON1 A;  4G7O F;  3R4K A;  2YU3 A;  5DD8 A;  3RYR A;  1QPM A;  4HX4 A;  4MGR A;  3J81 K;  1LB2 A;  3BY6 A;  2EV5 A;  1BN5 A;  2R7F A;  2EFP A;  1G6N A;  2X0L A;  3LA3 A;  2NYX A;  1MDM A;  2QUF A;  2DT5 A;  1SMY F;  2BE5 F;  4XLN F;  4AWX B;  4ASN A;  2FA5 A;  5D4R A;  3KFW X;  2EFW A;  4FX4 A;  5F1R A;  3M1E A;  1S3J A;  1O7L A;  1U6G A;  4LLL A;  4UVA A;  1S7A A;  3WU0 A;  1FBS A;  2EFQ A;  4RGX A;  4F7Z A;  3RTR A;  3M8F A;  2HYF A;  4S05 A;  1GXP A;  4BQA A;  3BPV A;  1J9I A;  4OMY A;  3KP6 A;  3ULQ B;  2DK5 A;  2W85 A;  5ICF A;  2HKO A;  4L5I A;  3QU6 A;  3SQN A;  3SFZ A;  4JK1 X;  1U5T A;  5D6F A;  2K02 A;  3WGH A;  1JXS A;  3RI4 A;  4A5M A;  4GYI A;  2ZFW A;  1W4M A;  1XN7 A;  1BIA A;  2MD5 A;  4WF2 A;  1P4X A;  3O3K A;  2RVC A;  1O3S A;  5E1W A;  3RYP A;  2AXL A;  5HS9 A;  3C7J A;  1WSU A;  1QBJ A;  2GXG A;  1ONV A;  3ABT A;  1H9T A;  2W24 A;  5FD6 A;  3F23 A;  4CZZ A;  2M5W A;  4YFK F;  1O3T A;  1P2F A;  3P9I A;  2RKH A;  3O2P E;  3FHZ A;  2FBK A;  2OAZ A;  5CVU A;  1K7A A;  1SFX A;  3EYI A;  2ZME A;  1BI1 A;  2UZK A;  5L3D A;  1XDU A;  2VE9 A;  4ESJ A;  1ULY A;  1I5Z A;  2NNY A;  1BI0 A;  1CF7 B;  2WWY A;  1ZLJ A;  4PCQ A;  4DNC A;  1KU9 A;  2XKO A;  3ABU A;  5L3G A;  1VTN C;  2ELH A;  2PMU A;  2QVO A;  2RV8 A;  4CDG A;  2VBX A;  3TDU C;  1XGO A;  4YFN F;  3SZP A;  5IT9 Z;  1FYM A;  2D45 A;  3V8K A;  1B6A A;  3HOS A;  2GQQ A;  2DPU A;  2XAG A;  3FM3 A;  2PN6 A;  3EDP A;  2XRN A;  3MFK A;  3MWM A;  2RNJ A;  1RI7 A;  3CUQ B;  1PP8 F;  2DQR A;  4ESF A;  5LGT A;  1FNN A;  5E20 A;  4EM1 A;  3NRV A;  3KZY A;  1J5Y A;  1XSV A;  2LDU A;  3R60 A;  1ZRE A;  3ZN0 A;  4LK0 F;  1D8J A;  4KMU X;  4NB5 A;  2MH9 A;  5D4S A;  4A6E A;  2HR3 A;  2ZBK A;  1J7K A;  2VBZ A;  1XCB A;  1SD5 A;  5BPD A;  1R23 A;  3FMR A;  1ZHF A;  3KCC A;  5FFZ A;  3KP3 A;  3LFK A;  2PEX A;  2Q0O A;  3WTT C;  2Q8K A;  1P4W A;  1G4D A;  3JTG A;  3HHG A;  5E1Z B;  3T5X A;  1KQ0 A;  1PUE E;  3TOA A;  1LDD A;  3KP5 A;  3IWF A;  1DDN A;  3I0T A;  3E6C C;  1ZG1 A;  4LLG F;  4LK1 F;  3TGN A;  4BHB A;  4ENK A;  1XSX A;  2F5C A;  1IUY A;  2EJR A;  2V1U A;  1O3R A;  1EH6 A;  1SD7 A;  2FBH A;  1LJ9 A;  1TQI A;  1BI3 A;  1O7F A;  4I0B A;  4O5V A;  2ACJ A;  1FC3 A;  5DD4 A;  5LLQ A;  2VC0 A;  1RZ4 A;  3GEZ A;  4FX0 A;  1BBY A;  1K78 B;  3FF5 A;  5HOO A;  2GA1 A;  5LGU A;  3QP5 A;  5A2Q Z;  3GFJ A;  3ZMT A;  1JHF A;  1Z6T A;  2KJC A;  1HBX G;  1J2X A;  4M9Z A;  4H0E A;  3ISP A;  4RB1 A;  2OZ6 A;  1YTY A;  3LQQ A;  4HF2 A;  1IN6 A;  2VOD A;  3B73 A;  2KIM A;  4Q5S F;  5K5Q A;  2PLY A;  2DQL A;  2A5Y B;  1JE8 A;  1FYL A;  4HW0 A;  2CG4 A;  3GF2 A;  4N9I A;  3GX4 X;  3ZMZ A;  3FM5 A;  2LF7 A;  4U0W A;  2Q2E A;  5K5O A;  2HYG D;  3E97 A;  2PQ8 A;  2F2E A;  1SFE A;  3TDZ C;  3I64 A;  2XGX A;  2A69 F;  3K9T A;  4WXD A;  5D5W B;  4KA4 A;  3CUQ C;  4ZYD A;  1LEB A;  2EV0 A;  4M6X A;  3ELK A;  4MTD A;  3V8J A;  2P4W A;  4XRF A;  5TJJ A;  2IT0 A;  3V4G A;  4ZYE A;  3HHH A;  5D5X B;  2OQG A;  4ZZL A;  4ENN A;  2EV6 A;  2EFO A;  1BM9 A;  5A2Q K;  4UUV A;  4BHP A;  2ZCW A;  3I5U A;  2IRF G;  3ECH A;  4E70 A;  2Z5U A;  1ZN2 A;  5JVT A;  4BNC A;  4JQF A;  4HQM A;  4HLX A;  3RDI A;  3RJP A;  1G3W A;  5LHG A;  3GZ5 A;  4P55 A;  4RAY A;  4HV6 A;  2XAH A;  4UV8 A;  2M1B A;  2FBI A;  1IRF A;  3F8F A;  2NRA C;  1IRG A;  2V6C A;  4BXU A;  2A6E F;  4YIF A;  3MCZ A;  5HLI A;  2D2W A;  3F72 A;  5DCM A;  4HZF A;  4A0Y A;  4U0V A;  2IVM A;  3BJA A;  1EH7 A;  3JAM K;  4Q47 A;  3F8N A;  1UCR A;  3V7S A;  3WTV C;  1UHW A;  3DXJ F;  3TOB A;  3TO6 A;  2P5K A;  4FHT A;  4KIB A;  1FBU A;  5ILS A;  1ZG5 A;  3V7R A;  1RUN A;  5ED4 A;  2Y0M A;  2HTS A;  2CYY A;  4CHU A;  4WWC A;  1HKQ A;  1OYW A;  4EJV A;  2ETH A;  4HDU A;  2OD5 A;  5FD5 A;  4A2U A;  3VB2 A;  5CVJ A;  4RB3 C;  3HIF A;  5CJ9 A;  4UNO A;  2COM A;  5FFX A;  3F6V A;  2TDX A;  3HRM A;  2ZNY A;  2WTE A;  2ADU A;  1QZY A;  2IJL A;  2A6H F;  3DEU A;  2K86 A;  3RPU A;  1FZP B;  2JPC A;  1PDN C;  3GYH X;  2FE3 A;  1BJA A;  2YSR A;  2GXB A;  4WXC A;  5EEG A;  2CWE A;  1HSJ A;  3RKY A;  4IRI A;  1YQA A;  1KGS A;  2QYO A;  4G8X A;  1HXD A;  3IKV A;  2MBF A;  4EM2 A;  2QZ8 A;  4IRG A;  4U7D A;  4Q4Z F;  2NNN A;  1O3Q A;  1KU2 A;  1FOK A;  1OR7 A;  3HYI A;  2H94 A;  5L3F A;  4RGR A;  1XCV A;  4NQW A;  1K79 A;  1SAX A;  2L01 A;  2K7L A;  2PMH A;  4CYD A;  4OOI A;  5HVQ C;  2P8T A;  3Q9V A;  5LHH A;  1I1G A;  3ECO A;  2PJP A;  2LF8 A;  3F8C A;  5HS7 A;  1MGT A;  2X4H A;  5DEQ A;  1OYY A;  1MJB A;  1LVA A;  1ZGJ A;  4KMF A;  2VT3 A;  2QLZ A;  3F22 A;  3FXU A;  1J75 A;  4HAM A;  1R5G A;  3SZT A;  1ZH5 A;  5JHU A;  4G7H F;  3PQK A;  2H6C A;  1T2K A;  5ICC A;  3CO7 C;  1KU3 A;  3LQR A;  5FO5 A;  3EET A;  3GFI A;  3ZP5 A;  4AIJ A;  2L02 A;  5HLG A;  2OQR A;  3W6K B;  4HA8 A;  2HS5 A;  2Y48 A;  3CUQ A;  4LFU A;  3AAF A;  2EWN A;  1QZZ A;  3EUH A;  5LRR A;  3L9F A;  5ICE A;  4HX7 A;  1D8K A;  1I27 A;  5JFR A;  3TKY A;  2M8E A;  2E7X A;  4MEX F;  1IXS B;  2FNA A;  5BQT A;  2DPD A;  3VEP A;  1WKM A;  4UXN A;  4CGZ A;  4IVN A;  1BOA A;  5DYM A;  4M73 A;  3KEO A;  3CJN A;  4L9T A;  4OIQ F;  5ILU A;  1V4R A;  2JZY A;  1JHH A;  2UWM A;  2XAJ A;  4ESB A;  2XHK A;  1EV7 A;  1Z6R A;  2QQA A;  1FT9 A;  2WV0 A;  3HSR A;  4JBA A;  2ZKZ A;  4MQ9 F;  3RKX A;  5D6E A;  1MDM B;  1O57 A;  5H6Q A;  5E1X A;  4M9X A;  5LEK A;  2HGC A;  3WU1 B;  5CVR A;  1QNT A;  4ZYG A;  2VN2 A;  5HDG A;  2VXZ A;  4OIP F;  3QAH A;  1W5S A;  4B8X A;  1IW7 F;  2O03 A;  1MJA A;  4L0Y B;  2VT2 A;  3BJO A;  4I2O A;  1MKM A;  1X3U A;  2J5O A;  2E1N A;  2HFH A;  4IHT A;  4Y13 A;  1K6O A;  3F8B A;  2BGC A;  1SD6 A;  1U78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...