1WJDA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, 38 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
b'FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 16
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjdA00
1WJFA 1E0EA 4F3QA 1K6YA 1KONA 1WJAA 1WJEA 3HPGA 1WJCA 3HPHA 1LFPA 3F9KA 1MW7A 1WJBA 1WJDA
chains in the Genus database with same CATH superfamily
1Y56A 4LD5A 1I39A 1J5YA 2PMZN 2XB0X 4JP0A 2CO5A 2RC4A 4KIFA 1SFOJ 2XAQA 2LK2A 4U0YA 4MEXF 1MMDA 3RPQA 2VE8A 2OAZA 3MEXA 3KYDB 5GAEJ 1F5TA 1R4MB 3ABTA 2M1BA 1V5GA 4M3BA 4V2FA 3S16J 4DNCA 1W0TA 1SFEA 3E0JB 1OJLA 3CDHA 1YOVB 3U1KA 5LHHA 3GZNB 2QZ8A 1HKSA 3BJAA 4IF4A 1MMGA 2VQGA 1GVDA 4IHXA 3JRGA 1T33A 1W5SA 4W97A 5LBQA 4GO1A 3PSIA 1ZG5A 3GO5A 2XUBA 1YTYA 1ZRDA 2HDCA 2OD5A 3DU6A 3WU2C 1BI0A 1X3ZB 2KDOA 4ZC3A 1V3FA 1T08B 1U3EM 1BJZA 3K4LA 2DFFA 4XRMA 4BQNA 1HSJA 2FF4A 1R9TJ 2DCEA 2E35A 2DT5A 3D0SA 4ZYDA 1BI3A 4AD9A 3EUKL 3TW6A 3VSLA 4LIVA 2KQRA 2WBMA 3LAPA 4DW6A 4HX8A 3V8LA 4CSWA 2DOFA 2XAUA 2HWVA 3S1RJ 2W48A 5K5OA 3RQ4A 4F52A 1I6HJ 4OOIA 4PZJA 4CYCA 3A01B 5FROA 1P7JA 1LE8A 3FKIJ 3IHUA 3JRCA 4RB2C 1F36A 2B0LA 2OJED 5E8IA 4ZZDA 1RC9A 4XLHA 2D2WA 2E19A 3MFKA 5HLTA 4AIJA 1YJ9I 3IC7A 3HXLA 4KYWA 3S3MA 2V1XA 2M34A 1XMXA 3GF2A 3QPLA 1X1AA 3O8GA 2Z2SB 2JMWA 2JRTA 1MNEA 1UELB 5DM7F 3FISA 5HLHA 4PJLA 3OIOA 2JJ7A 4IRHA 1XGMA 1XPXA 1B8IB 2Y2ZA 2DJIA 4JX5A 4YFXF 4E7JA 1J59A 2J5OA 5H6QA 5KVRA 2J5PA 4GGGA 1ZARA 3R4KA 2A5WA 1PUEE 2IP2A 5BMZA 5F0HA 2Q2EA 3MN2A 1ZR2A 4C3IJ 3V8KA 4BNCA 3MKZA 2FNPA 4Z6YA 3WTTC 1MW7A 2IGMA 3BTLA 1UHSA 4PFOA 3CMMA 2GQQA 2PMUA 5FD6A 3VYSB 2LKXA 3K70C 4I01A 2R3SA 1TWHJ 2CQKA 3JRFA 1KQ8A 5JR3A 5IPAA 2YR2A 3C2GA 2ZNZA 4HW0A 1QO0D 2A6HF 4I7HA 1LEAA 2R92J 4M9XA 1O4XA 3TL4X 4HLXA 3ZQCA 2VPLA 4E7ZA 2ADUA 3OS2A 1VQ5I 1BBYA 3LFUA 2W85A 3DEUA 5L3GA 2M30A 1IAWA 2IGNA 3ASOH 5BQTA 3PJRA 3BTJA 3SFIA 5L3BA 1VQKI 2ZJ2A 3K4NA 4PCQA 3F23A 3IRQA 2R7WA 5GAGJ 1MJBA 3K7AJ 4HPQA 3S3NA 2Z33A 3L1PA 4EGYA 5C4XJ 5CVVA 1XB4A 1ZGJA 1EV7A 1XMAA 5FKLA 3NQOA 4A5MA 1TC3C 1F1ZA 1FLIA 3KE2A 2EPFA 1UHMA 1TNSA 3A01A 2JWTA 4ENKA 3N4MA 1IN5A 4R8HA 5IYCJ 1MH3A 2CGPA 2PMHA 2F5FA 4BAYA 3MZYA 4A69C 3JR9A 2Z3YA 3VSKA 1IV6A 3I58A 2DT6A 3H35A 2LMDA 2ZXIA 2GAUA 3BC8A 3CUQC 1MIJA 4E7HA 2RQPA 2YUSA 2DQLA 2QQBA 3CMYA 4MFEA 3J7AY 2AXLA 4D7NA 5FLVA 5CVRA 4FE4A 4BKXA 1B8IA 3IKTA 2ID6A 2JSCA 4NB5A 1XDSA 3HOVJ 1WZ2A 1JI8A 3K4CA 4FHTA 4XRFA 1YW8A 4IHSA 2WADA 2DA6A 4LJZF 4A3FJ 1Y39A 3W6KB 2DOAA 2LTPA 2OA4A 1H9GA 1X2NA 4XR6A 4M3EA 4AIDA 2FOWA 4EATA 3H3VK 4M73A 4QTRA 2K9MA 2H6CA 2W4SA 1FBQA 1QU3A 1ERDA 4BE2A 3OYAA 3N05A 2KMUA 1RR7A 2YS9A 4Y7NJ 1GT0C 1OYWA 3KZIC 2H27A 1R4NB 3OL3A 1A36A 1XSDA 3BG6A 3RKQA 2X6WA 4D9JA 4C3JJ 3WTXC 3VEPA 4U7DA 1UB9A 2E36A 4KN7X 1O7LA 4OIRF 5CJ9A 1TQPA 3AG4H 2DA4A 2EZIA 4M6XA 1OCCH 5DS9A 2CH0A 2O5RA 3JAMK 2NRAC 3FXRA 1ETOA 1FP2A 4R79A 3ECOA 1AWCA 3VOEA 2FD5A 3F8FA 3OYDA 3OYGA 3F9KA 2VUMJ 1CF7B 2DU9A 4PUSA 4U7BA 2WTEA 3ZMDA 2L7ZA 3MWMA 5D5UB 2FU4A 3Q9SA 3O2PE 3OS0A 3G4SI 1T98A 4AWXB 4N9HA 5L3FA 3ABLH 2IEKA 3ABUA 3JTHA 4A6EA 1NK2P 2R7UA 3QAHA 5EDNA 1IN4A 1ZLJA 1FYKA 3VFZA 3QQAA 4ZYAA 3R0JA 1REPC 3MD2A 4W1UA 5GADJ 4A6DA 4BJTA 3NAUA 4HRIA 2K9QA 3KLOA 3HRTA 2BHYA 2O8XA 2DK5A 3GFLA 4Y17A 4XLCA 1XG1A 1D0YA 2X9DA 4CZZA 2PJPA 4BBRJ 2Z5UA 2DAOA 5ERIA 1JUPA 2OZUA 1V5FA 2UXXA 3K9TA 2XDVA 1FYMA 2D1VA 4BXUA 4XN3A 3FBIB 1XN7A 2E1OA 5L3DA 4XN0A 4QLCU 3GYHX 2LFBA 3FKJA 3K10A 3FXMA 2H1KA 3TKYA 4EGZA 3JRIA 4UVAA 3CCMI 3CCQI 4A3KJ 5H6RA 1BIAA 1LVAA 2CYYA 2QQ8A 3RDIA 4EM0B 3KYLA 2H8WA 1S3JA 2UWMA 5AIPA 3V8JA 5DV5A 1MGTA 3RPUD 2CFXA 3DP7A 3FMSA 2HS5A 3RKXA 4Y13A 4F7ZA 4KDPA 2ZMEA 3C7JA 1ZH5A 4TV7A 4PJJA 4CUGA 1FSHA 1T6SA 4BXFA 2VJJA 1VQ9I 1YI2I 3H9GA 1U2WA 1IDYA 5GTHC 2NYXA 2H6BA 3FMQA 3OYEA 1MBEA 1JHHA 3CD6I 3WGGA 2FOKA 2MC4A 3V7SA 3HPHA 5C4JJ 1VQ8I 1ON1A 2L02A 2CW0F 1BL0A 2EA2A 3ABKH 3OYHA 3GBGA 1SVLA 4U0WA 1OCPA 5EF6A 1Z05A 1BR2A 2HOEA 2HQRA 4OAZA 3G71I 5B66C 2KL4A 4QIWN 3OSFA 2QSFX 2ZFUA 4L9JA 2IS1A 4B3XA 2PBIA 4M72A 3OYKA 3OR2C 3SJMA 2CUEA 3IP4B 2I10A 2X0LA 3M9AA 1YS6A 3E5UA 1ZTRA 1BN5A 1CF7A 3HKZA 3JSOA 3WTVC 4IQ4A 3F6OA 3ASNH 1BR1A 3BWGA 5BNGA 4L5IA 2Y75A 1BC8C 1IN6A 1Z7UA 3S93A 4AUXA 1G3WA 2ZFWA 4XL9A 1FZPB 4LK0F 3GFJA 2W24A 2DFHA 2HKOA 2IRFG 1EKEA 3QPHA 1Z1DA 4P9FA 4KMFA 4NC8A 2YPRA 2JPCA 3HTUA 1BR4A 5JHUA 5JHFA 1DP3A 2E1MB 2A05A 3TOBA 4YIIA 3CUOA 3GW2A 1YITI 3CJTB 3FZVA 2W7NA 1A31A 2V7FA 2ZO4A 3K6GA 3H1CA 1S72I 1GLNA 3Q0UA 4A3CJ 1YE9A 2ZJQF 2MD5A 2GBYA 5DD4A 3FXQA 2IT0A 1TWCJ 2HPMA 4I2OA 3QYBA 4UNOA 3CO6C 4BJ6C 1WJFA 1XTAA 4WXCA 1EJ9A 4HLYA 4G7ZF 4BL0B 1U6GA 3I0TA 3FM5A 5EEHA 3S15J 4EJUA 2LVSA 3Q0WA 3F22A 4P1WA 1JKQC 2G7UA 3LQQA 4DYQA 3BZ6A 1OR7A 3JTGA 3KEYA 5HLIA 5GAHJ 4ANJA 1R23A 4ESJA 1R5GA 3M1CA 3E1SA 2IVMA 1J7KA 1SMTA 4B8XA 3W2WA 5LEKA 1Y8QB 3CF2A 3TO9A 4I0AA 2HI3A 3S32A 2VN2A 3H9QA 3K1PA 1B9NA 1VTNC 2JT1A 4RB1A 2M8GX 1QBJA 5FKKA 1J75A 3GCMA 5ICGA 2CW8A 4J01A 3ZCOA 2LD5A 4E4HA 1DPUA 5EEAA 4LB5A 2LREA 5F64A 4BHCA 2HOTA 1R71A 2YX7A 2LBFB 2NS8A 2L4MA 1D1BA 3E5XA 4Z2YA 1DDNA 3E6DA 4XOPA 5M5XJ 3ZXSA 4IKFA 4BQOA 2P5KA 5D8LB 2QGUA 1SC7A 4Y3OA 3GFMA 1AHDP 2XPWA 3P9CA 2XVCA 4BBSJ 3HOTA 5CKTA 1ZQ3P 5JVTA 1RKWA 2DDBA 5J8CA 1LUJB 3PQKA 4BACA 3HSEA 2V26A 1FYLA 4UUTA 2IGOA 2XAGA 2DW4A 2WC2A 3KEOA 2EFQA 3OYIA 2K27A 3L2CA 3F72A 2CS3A 2K4JA 2VQHA 5ED4A 2LR8A 2ISZA 3BT9A 1Y0UA 4IHVA 2CJJA 5CVIA 1TQIA 5IOZA 3IUOA 4KIBA 2GA1A 2VKDA 5TRDA 2CQNA 3KP6A 2F4MB 4XMYA 2CG4A 1X58A 3CC7I 3BPXA 4DQ2A 3RJPA 2HQ5A 1VQNI 4OIQF 2P6SA 3F8BA 1HKTA 1WI9A 3HTSB 2FBKA 1FTZA 3WTZA 3ZMSA 1FEXA 2EV5A 1IXSB 2CV2A 1KU7A 4G8XA 3CP8A 2UUZA 1BOAA 4M3DA 4I09A 4M9ZA 5J1YA 1AKHA 4N9IA 1B4AA 2TDXA 1SEUA 3J81K 1I6XA 3CC4I 1WCMJ 1O3TA 2BV6A 3NWTA 2ZKZA 2P7CB 1HF0A 1GVJA 1S7EA 2PI0A 3DXJF 5FFXA 2CV1A 1WGXA 1YX3A 2HVRA 2IAIA 2M3AA 2ID3A 2K9NA 5K7FA 2FUG2 1ETXA 1UZCA 3L9FA 2JA8J 3BP8A 1NHAA 4A0XA 1XGOA 4ENMA 4V2GA 2R7RA 4P55A 2OTLI 5E3LA 4BHBA 1I5ZA 1X1PA 4IO9F 1IRZA 1OYIA 3QP5A 4RGRA 3JRDA 4X1EA 3CMEI 1J0RA 4B3AA 4Y52J 5FKNA 2D5VA 9ANTA 5D5VB 1SFUA 2MFZA 4LIUA 3ZR8X 4JBAA 2LBFA 5EJCA 1N75A 2WY7Q 4BE0A 1K4SA 4FT8A 4P9UA 3BZKA 1OCTC 2VJ5A 3CJRB 1S5LC 4BQQA 5IT3A 3PIPF 3DKXA 4CYCB 1T8IA 3I53A 1FBUA 4DJAA 2M0CA 1LE8B 3PNVA 3DKWA 2XASA 1ZREA 3WG7H 4ZYEA 3ONQA 1Q1HA 4L0YB 2ZBKA 1ETQA 2VBZA 4S0HB 3HOUJ 3M07A 1Z7LA 2PFBA 3GTJJ 1FT9A 3QODA 1H88C 2LNBA 2VJIA 4K2EA 1V55H 2YSRA 1CQTA 1I3AA 2K02A 5M5YJ 3V7CA 5LHIA 2E5ZA 3E7LA 4B1RA 1RESA 5DEQA 2BW3B 4LOCA 4DZJA 1FOWA 3MKYB 1U0JA 2LF7A 3EPZA 3TO6A 2Q8KA 3CCLI 2DA5A 1LFBA 3LSRA 2HYGD 3KPHA 1UG2A 1IXRC 2OZ6A 1R1UA 1FWZA 4L9VA 3OSGA 4FTHA 1DGRM 4DZPA 1R5HA 4BYYA 2MH9A 3GVAA 1YJNI 1HKQA 2E60A 1FBSA 3FK6A 2LH9A 2QF7A 2JSPA 1XS9A 1X3WB 2LP0A 2XROA 2O7OA 1RETA 3BDDA 4N4NB 3C2BA 4XLFA 5J47A 3DLLF 4HG2A 2IA2A 4EJOA 4HEA2 3SEQA 5LD2C 4PSWA 4C30A 3CTAA 3ROUA 3KFWX 2IS2A 4YIRX 1U5TB 4DBRA 3NARA 3R60A 4NBQA 3TQNA 1HSTA 3FK7A 4ZTFA 1YIOA 3X2QH 3BG5A 1OYYA 1I1SA 1WJAA 5GPCA 2VL8A 4G6DA 2ELJA 4RGXA 5CQGA 2IXSA 1TW3A 5J4YA 3DCFA 5KHDA 3IH2A 2JZYA 5F27A 3GTGJ 2XGDA 2HXIA 4KIGA 4BDZA 4XSZF 2H1LA 3WTSC 1X4PA 1R1VA 2FNAA 4N4OB 5J3LA 3LSHA 2IS4A 2X4HA 2HOSA 1P4WA 2M9HA 1WH5A 1HQCA 1R5ID 2ZXHA 4NC6A 1KGSA 5KNLA 2P0WA 2E7WA 5LGUA 1T39A 1AOYA 1H0MA 2B9SA 2EFWA 2KIFA 1T0FA 3E6CC 4FCYA 2W1OA 2OC6A 1D8KA 4Q5SF 2MA3A 1SMYF 2KPMA 3M7GA 2EINH 5FLXZ 3M8EA 1E17A 1JGGA 4D5FA 3G1MA 1QZYA 1RUOA 4NUBA 4M6VA 4E7SA 3MCZA 4JYKA 3WE3A 4XIDA 2XGXA 2BW3A 2JTVA 4G9YA 5HDNA 2XSDC 1KZHA 4CHUA 2P7VB 4CZCA 3S1NJ 3QOEA 4HYEA 4S05A 4IQJA 4JQFA 1ORKA 1WWXA 1VQOI 3AKZA 1VI0A 3WU0A 1OISA 2R7TA 3B02A 1LVKA 4B48A 4XRSG 1YO5C 2LRDA 1PYVA 1MMNA 2X1DA 3FXJA 2YU3A 4XRSA 3FBNB 5DCFA 4RLFA 2AHQA 2GWRA 3RTRA 2UXNA 1JHFA 2R7QA 1LDDA 4BU2A 2V4JC 3DFGA 1QPMA 3CCSI 4RA2A 5CLSA 4KA4A 3DBLB 3WTYC 3SQNA 1Z77A 2ME6A 4HF0A 3ZMUA 1G3TA 5IT9Z 1U5TA 3HKZN 4PDKA 3PNYA 3CDLA 1NTCA 2LY9A 3ML6A 2ME0A 1FC3A 3ABMH 3F6VA 3M8FA 4MLOA 1HDDC 2L9NA 1QVTA 1YYVA 3RYRA 3HPGA 1KQ0A 1O3RA 1V5EA 1LFPA 1HC8A 4IJAA 1FOYA 1Y8RB 2IPQX 2K85A 3J7YJ 2EIJH 1MBKA 1K6OA 5F04A 5HNHA 3HHGA 1RUNA 5K7HA 1Z9CA 3HJEA 2R7VA 5D4SA 4DOZA 3PO2J 1XSVA 3R6SA 4LG3A 4V19K 1P6RA 1XSXA 2XAJA 2PJRB 2Y31A 1BJAA 2KZGA 3AFHA 3ZRGA 1WJBA 3I4NJ 5FLMJ 2ZNYA 1FOXA 3I55I 1MBHA 2VC0A 3M8JA 3P5JA 2E34A 3EQLF 4ZYGA 2HOAA 2P4WA 2HNHA 3V7RA 1R22A 3VYUB 1GV2A 1O7FA 4HQEA 1UCRA 2HTJA 2L2OA 4IHWA 2DN0A 1F9NA 4A5NA 4PJNA 5D5XB 3S14J 3FMRA 5FB2A 2IGKA 1MSFC 5C44J 5ICEA 1XCVA 3ESWB 2FX0A 1IXCA 1P4XA 2OUMA 2QUFA 3SDGA 2V79A 5ILVA 2FQ3A 4MQVA 2R7ZJ 3FXUA 1JT6A 1LKXA 3PFYA 4EJTA 1MJAA 3CCEI 3S2DJ 2A68F 2V9PA 3GWZA 2V1UA 1VZ0A 4HDUA 2F5EA 2ZMEB 3W3CA 1G2HA 4AIHA 4FX4A 4F3QA 5E18F 2DT7B 1R00A 3KP7A 2OQGA 4UXNA 5JI6A 1U5TC 4IOAF 1TTYA 5E8GA 1ZAOA 2QVOA 3S2HJ 2FJ1A 1W5CC 5F1JA 1E0EA 1J09A 1ITYA 4E6KG 4M74A 3MAJA 2EILH 3I4PA 3RCOA 1H8AC 5J8FA 5FRNA 1QZZA 2GIVA 2ACJA 1R6RA 3KETA 4NC7A 4B44A 2O6GE 4LLLA 4MIMA 1A6QA 3ISPA 1SD6A 1SVOA 1PP8F 5DD8A 3LSPA 3CMAI 4XLPF 3ZQHA 2DMTA 2ZCWA 2R4GA 4HNVA 3G73A 3K0LA 5A2QZ 1LPQA 4MEYF 1P2FA 3ZN0A 5DM6F 1MMSA 1FP1D 2KFDA 5F0CA 3RIRA 3NRVA 1FTTA 2GXAA 3VB2A 2E5NA 4FX0A 2F5DA 3HOSA 4BHPA 5KCMA 3TDUC 3EYIA 2PJRA 2HYJA 1RZ4A 1WQ2A 3E97A 3L09A 3HRSA 3KP5A 4D1QA 1K78B 2EZHA 1BI2A 1OMIA 3O6BB 3PIOF 3Q3SA 2ZSHB 2DMNA 3OOPA 3ZMTA 4F93B 2CQXA 3ELKA 3BCBA 3HOYJ 3JREA 2B63J 2WAEA 2AO9A 2O9LA 2GXBA 4HSTA 2PLYA 3J80Z 2CFOA 3GZ5A 2WAQA 3KP2A 4ABZA 3OYBA 2VODA 1MD0A 2BEOA 1D3YA 2Y0SN 4HZFA 3PFIA 3TO7A 5D6EA 3OL4A 2RKHA 4KMUX 1FIPA 2W00A 3TDZC 4AC0A 3HGGA 3DTEA 2CQQA 2VBXA 1BI1A 3GTQJ 3L00A 2DPDA 4JX4A 4OMYA 2ETHA 2ZJRF 3G1LA 2QM3A 2KIMA 1BW5A 4MQ9F 1JTYA 3QPTA 4XOTA 4CA0A 3S1MJ 2NOJB 3K4MA 1P9QC 2D1HA 1N77A 1VF9A 3HRUA 3D5SC 4ITVA 2LF8A 2C6YA 1KU3A 2CQ7A 4HQMA 3HB9A 3W2AA 3ZQIA 4UY8I 1Y6IA 5EG0A 4CCLA 4Q48A 5DTDA 1WKMA 2O3FA 4GRIA 2QCOA 1FNNA 1A35A 1IRXA 1FMWA 3ZQGA 4G7OF 4GXOA 1OQYA 1LNWA 3TP0A 2GM4A 2HEOA 1TW2A 3OYFA 1HA8A 3BQYA 4P96A 2F2EA 1RI7A 2LSOA 5LGTA 1TT5B 2KZVA 2EIKH 2BY3A 3PM1A 3SZPA 4OAYA 4XK4A 2HU9A 1ODDA 1W4MA 2XGEA 3JRBA 4H4KC 2IS6A 5FRMA 2KRFA 3BG7A 3LA3A 2M87A 3OR1C 4RM3A 5B3SH 2O61A 3HOXJ 4N0BA 2R5YB 5HLGA 3ULQB 3TGNA 4ETSA 4YEJA 4B09A 4XKVA 4UV9A 1FX7A 1IF1A 4BQAA 4Y33A 3IL2A 1WJEA 3FDYA 5HODA 3QP6A 2CRGA 1SD4A 2QWWA 2A6EF 1ENHA 4CCOA 2VONA 2K3PA 3P7NA 4MFDA 2BY0A 3AG2H 1V54H 1SANA 4D5CA 1LEBA 4OMZA 4FASD 3LNQA 3T8TA 3K1MA 3B6CA 1K78A 3OOUA 1HOMA 2NAZA 3BR1A 2WB1A 2R7XA 2EJRA 5ICFA 3FM3A 1ZGWA 3DU5A 5FFZA 4WCGA 3GTKJ 2R5ZA 3HOWJ 1G3YA 2HQNA 1EA3A 3BTCA 4EQQA 5BPDA 5LHGA 1P92A 4EMSA 2NVUB 2DO7A 2DJNA 4ENJA 2HVQA 3K1NA 4CO8A 5LFAA 2JPBA 2CUJA 2O03A 4FE7A 2OV7A 5M5WJ 3P9IA 1R49A 1O3SA 3QYEA 2MLKA 5K5QA 4ASNA 3WE2A 3SEZA 5JVGF 1TBXA 2A69F 2MGQA 2X6XA 4PGGA 3UKGA 2CV0A 1K83J 2ZMEC 4OU0A 3RKYA 1HW5A 2RN7A 1TL8A 1A5JA 1GV5A 4L5JA 3VDXA 5E1ZB 2Y69H 2I8DA 1AKHB 1MZBA 1KYZA 3LFKA 5E20A 4ENNA 3BLYA 1YX5A 4Y4RA 2L7KA 2IJLA 1IC8A 2X48A 1WJ5A 4BEHB 4CCJA 4MTDA 3D5LA 4G7HF 4AVZA 5GTIC 2K40A 3HEFA 1P7IA 1Z21A 1XC5A 3TBIA 5IT9K 3Q0VA 3I71A 3GTOJ 3CCRI 2VKEA 1APLC 2DMUA 5HS8A 2XF5A 2R7SA 3LSJA 3RSNA 2E2IJ 1VQ7I 5F08A 1NH3A 3DPUA 1L3LA 3E6MA 1F4KA 5E3MA 3KIOA 3TMOA 3DKYA 3LL7A 1H9TA 1UAAA 2NVTJ 4F92B 3AAFA 1NK3P 2VASA 1BOBA 2WY8Q 1FPQA 3OYJA 3COAC 3HUGB 2R5YA 2FBHA 2F5VA 1YHQI 1HW1A 1ULYA 2HXOA 2MBFA 2RREA 3VWBA 3DPTA 4QPQA 4XKBA 2KIUA 2UV1A 5B1AH 4C9YA 4M71A 2Z1DA 3IAM2 4BS9A 4J19A 2L7FP 5D5WB 2FMLA 4G12A 1Y1VJ 2OU2A 4RAFA 5EZHA 2P81A 4LFUA 3VYRB 5LLQA 1D1CA 3M4OJ 2COBA 1STZA 1USTA 2L0KA 1SAXA 3OMYA 5EZGA 2JUCA 3WHBA 4F55A 3BG3A 3CJNA 3IH4A 2LC2A 1ZRCA 3LMMA 4XONA 1LDKB 3I56I 1YIJI 5C3EJ 4XLNF 4WK8F 3HHHA 1TWFJ 2V9VA 3S1QJ 2EH3A 2RQQA 1JUMA 3QWLA 2HVSA 2RNGA 3L2UA 1RRJA 3HOZJ 2EFNA 2HZDA 3S17J 1ONVA 1ZK8A 4A2UA 3IAS2 4YIFA 4WX9A 4IRIA 1BM9A 1WSUA 5H20A 1QNTA 2KISA 1KA8A 3EETA 1XGNA 4YFNF 2LLKA 2ISYA 2LKSA 1OR7C 5JFRA 2Y0SA 3ZQ7A 1HLVA 1N78A 2X51A 3I9V2 4IHYA 2RNJA 5JLWA 1XCBA 1R36A 4LGWA 3A2KA 5CVJA 1JGSA 3CCYA 4IXAA 4BEHA 3L2QA 3LSTA 1TNTA 4G94A 3WU1B 2KJBA 1E3PA 3I59B 3Q9VA 3A02A 2BXZA 2ICWG 1K79A 1ETWA 1RKTA 2BOLA 1GHCA 2NNYA 3NWSA 3WTWC 4CCKA 1SD7A 4Q47A 3I5UA 2XSJC 1TWGJ 3HBLA 2R0QC 1JXSA 1UG0A 3BJ6A 2ZC2A 3IWZA 5HVQC 1P4AA 5F6FA 1X4OA 3GMEA 4WWCA 4II2A 5KAFC 2XPVA 3TEDA 5K5RA 2DXIA 1OLTA 3HUGA 4BY7J 3KCCA 4BH9A 5IY5H 3AG3H 3F0CA 2A6TA 4M6YA 5FJ8J 3HSFA 2BY1A 2X1EA 1QVUA 2VI6A 3BR5A 1KU2A 2YU9J 1IUYA 1Z3YA 2KKOA 4RB0A 1YRNB 3FXLA 3MQ0A 5F0FA 5J1RA 1JJ6C 4A3LJ 3JAMZ 3OWTA 4LK1F 5E1XA 1W7PB 4CICA 2M7AA 2BVMA 4AIKA 1K61A 4ESFA 4BJ5C 1I27A 2GOMA 4XQFA 1HXDA 1ZKGA 3DTKA 1WJCA 3BTIA 1IJWC 4BXXJ 2E1MC 3J80K 4E7IA 2X85A 4HNUA 3TP3A 4HF2A 2XF6A 2E2HJ 3LSMA 3T8RA 1PVEA 5FO5A 4I99C 2EQRA 3MZHA 3RZOJ 5HS7A 1EH8A 2BBYA 2RGVA 5M3MJ 1C0WA 3QU6A 1E3HA 2V1DA 4A0YA 2NOGA 2X1CA 5BS6A 2EB7A 2KHMA 4XORA 2AS5F 1X3UA 2BHZA 2JUGA 3WODF 4AVPA 1BC7C 4O3MA 4CGZA 4EVIA 2DFIA 4MNUA 2PX9A 4L5EA 4Q4ZF 4A0ZA 2FE3A 4PJ0C 2EZLA 3AG1H 1RPWA 5AONA 1X1DA 4QSHA 3A03A 3LSIA 4M3FA 4RAGA 3GLLA 4LLGF 4UUVA 3DBHB 5D8KB 2CW7A 1SAUA 3CUQB 4L9NA 1ZGAA 4HV6A 4UHTA 5D6FA 2OCEA 1R7JA 2QBYB 4EJVA 3BY6A 1K4TA 4EV0A 2H8RA 3I54A 3QOPA 1S7AA 1T95A 2HDWA 2KJCA 4RDUA 5KK1A 3BPVA 3DV8A 4XICA 1G4DA 1U78A 1KYWA 1UJ8A 2LKPA 3REOA 3RZDJ 4ESBA 1ZYRF 4CXFA 2E1NA 2OBPA 2XPUA 2EWNA 3I59A 2GZWA 2FEZA 4XM3A 2JA2A 2TCTA 5K7ZA 5D4RA 2D45A 2QSGX 2V1NA 1GXPA 4R1HA 2HPIA 5CYVA 2XV4S 2ELKA 4YG2F 3GTMJ 1O57A 4ZJZA 3G3ZA 3M1EA 2XKOA 2VXDA 2DQRA 5AIQA 2M2EA 5E79C 2CSOA 4C2UA 2RAEA 2K7LA 1Z6RA 4CDGA 2DA2A 3BR6A 4HNTA 3FHNA 2VB6A 1DPRA 4AM3A 2WAQN 4KJZA 2JK3A 4XLAA 1LJ9A 4XKWA 4GDFA 3SFZA 3VODA 5DYMA 4A3DJ 2OTJI 3S3OA 1EH6A 3H0GJ 3OV8A 3GFIA 1WFXA 3ZPLA 1W5TA 2M4KA 3CJQB 5CQEA 5HNFA 4CH7A 1JJ8C 3BCAA 4KICA 1YRNA 1DQUA 1QGPA 1G59A 3B73A 4ZH4F 4XLEA 4A3BJ 1W7PA 3MVPA 5DCMB 2HTSA 1X2MA 3QU3A 3N97A 2NVQJ 5BOXA 3R61A 1U8BA 2L01A 3EYYA 2F5CA 3IRRA 4BDYA 4X0GA 1QA6A 1SFKA 3ZP5A 3UNGC 2V9KA 2QQ9A 1QHHD 2GIZA 1BW6A 1U9OA 3HG9A 3PQJA 2E2JJ 4YELA 2QYOA 2ZSIB 3A0BC 2CWEA 3UR3C 3E5QA 1DP7P 2Q0OA 4AYBA 2VE9A 1MJ9A 3LA2A 1A6IA 3U9GA 2QKLB 4XKCA 3C18A 2P5VA 2WWYA 2OQRA 2K9SA 1FMVA 2DMQA 5KAIC 4IL6C 1B59A 3KEQA 2XAHA 3CZ6A 4IOCF 1ETYA 3F8NA 3ZQFA 5LEJA 4OIPF 3H36A 2M4GA 2E1CA 3B6AA 1BIBA 3CO7C 2HQAA 2Y48A 2BZTA 3CUQA 4HX4A 4P5OA 4PJMA 4A3MJ 2DK8A 2QBYA 3KZZA 5DUIA 2O8KA 3A4CA 2FMYA 1PP7U 1LQ1A 2QLZA 1DUXC 1ZG3A 3EUHA 1VFCA 1VQ4I 5FGMA 1FY7A 4PSXA 2P6TA 3H92A 3CCVI 4CCNA 2ESHA 4C2MJ 2CUZA 2M5WA 4MGRA 1EH7A 4U88A 3OY9A 2DYSH 3DTIA 3L2RA 3O8HA 4IX7A 3OIPA 2HZTA 3LQRA 4NDLA 1JE8A 4ON0A 2A07F 1XD7A 3ERED 4BE1A 1IV8A 1W36D 1Z3XA 2DYRH 3G2BA 2WB1N 1Z91A 2VKHA 1T56A 3O3KA 2B7EA 2G9WA 1B1BA 3C1DA 1USSA 3KX2A 1D1AA 2XAFA 1LFUP 5L3CA 3IKVA 3KLNA 5E3NA 3LSGA 3S2WA 1U8RA 4UB8C 2W82A 2NVYJ 2VT2A 1R58A 3VPRA 2QSHX 5BPIA 3T1BA 1T0FC 3I4MJ 2HYFA 2NS7A 4PGHA 5EGOB 2HFHA 5J6XA 5M3FJ 2ZB9A 4WF2A 1DU0A 4IHTA 2O0YA 2DI3A 2VOPA 3HIFA 2MG4A 1YJWI 1HW2A 3DLAA 5DCMA 4NHJA 1S9HA 3E6BA 1ZHFA 4C2TA 1SVMA 1IN7A 1D5YA 3VYTB 4B4CA 1TP4A 4KT5C 4RB3C 3JRHA 2R93J 5TJJA 2WV1A 2XKPA 1FJLA 2FBIA 1G3SA 3OYMA 3FIWA 1YFHA 3LA7A 2WAFA 1WRJA 2ELHA 1R1TA 2M7BA 2VBYA 4ZDOA 2MABA 4OWRB 2DODA 4JK1X 4GFBA 1T38A 4RAZA 3SYTA 1W0UA 1NG6A 2BXYA 2KDZA 5HDGA 1IG7A 1BA5A 5EG0B 3CC2I 1D8JA 2L5QA 4BGDA 1UHWA 1VQPI 4WXHA 3EUHC 1JTXA 5FKOA 3U1DA 3T0YA 3BROA 2HR3A 3E3VA 1WVRA 1G8XA 3OYLA 3RI4A 3EUAA 4FETA 3BR3A 2NXNB 3DEWA 4GYGA 1JKRC 2IW5A 3C2HA 3OYCA 3I64A 4XNFA 2JVHA 2STWA 4MTEA 3ZQLA 1YQAA 1MDMB 4D0PA 3HL2A 1X19A 2IBDA 2VC1A 5FD5A 5JLXA 1VQ6I 3PSFA 2Z99A 4A93J 2PG4A 2DBBA 2K86A 4BY1J 2QQAA 1W1WE 3BR2A 3CLQA 3J81Z 1IW7F 2YX4A 2CMPA 2OPTA 5J40A 5IP7J 3P9KA 3AL0B 1TWAJ 2A61A 2KT0A 3G1OA 3JCUC 4JOMA 3CDIA 3OYNA 1Y0NA 2L54A 2COMA 3BOQA 1IGNA 1SFXA 2M45A 4GCVA 1Y1WJ 4LLNA 3ZQQA 4L18B 2DDAA 5H2FC 1D5VA 1V4RA 1KQ9A 3KP4A 1K6YA 2F48A 3H0DA 1L0OC 2PMZA 2K3FA 1ZELA 3GTLJ 5EGOA 1AA7A 4IZZA 3C3WA 5CPRB 4XBFA 2XC7A 5TISC 1RNLA 3W2VA 3A1YA 1FOKA 2X6YA 5J4VA 2XGCA 3M3YJ 3R0AA 4HV5A 2KIQA 2PQ8A 2STTA 4IPAA 2BGCA 4ZZLA 1ACIA 2I5UA 3FX3A 2DA7A 4L9TA 4MO7A 2DMPA 2X6OA 2ZJPF 2R5ZB 1LDJA 1HBXG 3RKWA 4QWQA 4HAMA 3W6VA 5LRSA 5EEGA 2QENA 3WG9A 3BG9A 2UZKA 4RAYA 5HDKA 3CQZJ 1S6LA 3J7AO 1IZ1A 2WV0A 1JKOC 2W57A 4G6QA 4U0VA 4YRVA 4I02A 1S29A 4HDVA 3FWEA 4RBOA 1MNDA 2F4OB 2VT3A 5TGTA 1POGA 2EFPA 1I50J 4ZYHA 4CCMA 3KP3A 4F91B 5L3EA 6PAXA 3GTPJ 5IYBJ 3D5RC 2RV8A 4E7LA 1WHUA 3H5AA 1ETVA 2L9VA 4I6ZA 1H89C 2MH2A 4PK4A 4UUSB 1QPIA 2MW8A 4NNJA 4A3IJ 2EK5A 3L2WA 2KRHA 2L9SA 2VQLA 1PJRA 4KFCA 2DOEA 2ECBA 1WJDA 4EEFG 2R7DA 2K4BA 1S8NA 1IDZA 3T5XA 2MYSA 3F3XA 3IH3A 1FSEA 3V42A 5HOOA 3K69A 2KRCA 3CCUI 1ZR4A 5K1YA 3OS1A 1F43A 1ZN2A 3NEUA 1MDMA 2NNNA 2JRMA 3K2ZA 2JVGA 2VKVA 1B72B 4WXDA 3LOCA 1D0ZA 1N25A 2FRHA 2GXGA 1AU7A 2P5LC 2DTRA 2M8EA 3WHCA 4DIQA 3FXKA 2EFOA 4RGUA 1ZG1A 4DYCA 5ILSA 2LG4A 1MBFA 3J7ZI 2GOXB 4IRGA 4JX6A 4DBQA 5CVUA 3GX4X 3BR0A 4G6TB 3SHFA 4DGWB 5E17F 2PN6A 3KZYA 2QKMB 2EA4A 4KITB 3K70D 4LITA 3Q5FA 2GA2A 4RM2A 2L3DA 3DBRB 3H3UA 3FHZA 2Z9OA 3GUDA 5FLXK 5GPAA 2W25A 3DQVC 1RR8C 1DU6A 3H3ZA 3SZGA 1TLHB 1PUFB 4EJWA 3ZN1A 2G0EA 4LG0B 2M0MA 1YS7A 3K4BA 3ZMVA 2R7OA 1G6NA 5FKMA 4QPOA 5ILUA 4H0EA 3LSKA 3H5RA 1HCRA 1ON2A 1W7PD 1VNDA 4RMNA 2AQEA 3HZJA 1OCRH 2AQFA 3G6EI 3CF5F 2OCCH 1K7AA 2NVXJ 2DLLA 3DF8A 3U21A 1TQMA 2VBWA 3ECHA 2DTZA 3K4KA 2VIXA 4E70A 2JA5J 2V6EA 2A3SA 1U9NA 3S8PA 3CESA 4EM1A 3PUFA 4UUSA 4KISA 4NQWB 2EV0A 3D1NI 1OPCA 4OINF 4UVCA 1UFMA 5GP9A 5HS9A 3QRFF 3CCJI 3SXYA 1JUSA 2RDPA 2L4AA 2Y9YA 1T2KA 2Y30A 5B5EC 3F8CA 2L9RA 1QRYA 2NS0A 1Z6TA 1B6AA 2ZXJA 2JN6A 3WGIA 2HGCA 4S04A 4J00A 4UB6C 3MMYB 2TRTA 3HSRA 1B72A 5DUKA 4PFPA 1XGSA 4O6JA 3AL0C 1XMKA 1OCZH 3HGYA 3SZTA 3FXOA 2EBIA 4HSRA 2V6CA 2XRNA 2E71A 2AXTC 4FQGA 1X1BA 4HA8A 3PUBA 3OIQA 2EV6A 3H9JA 3HRMA 2H09A 2XB5A 1B9MA 1S7OA 4LB6B 4I0BA 3ZMZA 1O3QA 5IP6A 4ZDPA 4AYBN 5IYDJ 3WGHA 3L2VA 3PL8A 1YLFA 3I3LA 1GDTA 5LGNA 2CU7A 2BYVE 2G7HA 3JW4A 4B43A 1OCOH 2F4IA 2BVLA 2KP6A 1IRFA 4A3GJ 2EIMH 3LAJA 1Q1VA 1ZRFA 2VPRA 3H5NA 3K2AA 3U2RA 3HYIA 1MSEC 3GXOA 1ETKA 3L7WA 2DA1A 4XSXF 1M1EB 5IP9J 3QPSA 1PUFA 2DA3A 2ECCA 3GEZA 4LMYA 4LG0A 3MKWB 1RIOH 3LWFA 1QHGA 4X6AJ 4U87A 1Z0XA 5DDGA 4BUPA 2ESNA 3CLOA 1NG7A 2Q1ZB 2JA7J 2VLAA 4I76A 1MNMC 1I3QJ 5F1RA 3W6JB 2HDDA 5IOYA 1IO2A 2N8GA 3A0HC 4M3GA 1SD5A 1Z67A 2LOOA 1W36C 2A5YB 1CGPA 2FSWA 4C3HJ 4OIOF 5ICCA 3KYCB 3JSPA 2IA0A 4EM2A 4E7KA 1MKMA 2VQCA 4NQWA 2Y9ZA 4ZDLA 1A04A 1IUFA 1J9IA 1YW7A 4AU7A 3F21A 3TOAA 1WPKA 1YW9A 1JKPC 3DPLC 2MC3A 4HOBA 3PNTA 2LDUA 2Z16A 1HDPA 1D0XA 2MLGA 4ZTJA 1TZLA 1TT0A 1QZEA 4M9SA 4L0ZB 2CUFA 3CP2A 3HM5A 4HX7A 1XDUA 2Y0MA 2K9LA 1OFCX 2XF7A 3RYPA 2KLOA 1MMAA 1I1GA 3EDPA 1J2XA 3MZ8A 4YFKF 2JQ7A 1KU9A 2FA5A 2FQ4A 2LY1A 3IV5A 1WH7A 4KUMA 4UVBA 4A3EJ 2XIGA 1GXQA 5E1WA 4RS8A 5B1BH 3TW7A 5A2QK 1ZLKA 4HBLA 1PDNC 3BQZA 4IVNA 3SDBA 4O5VA 1FIAA 1LB2A 2XHKA 3HC7A 1XX5A 1X1CA 2DPUA 5E3OA 4UV8A 2ZXWH 3DEEA 5J1UA 2LYCA 2P8TA 1VQLI 1KONA 4Y15A 2W84A 2JA6J 4FISA 4RGSA 3F8MA 2VJ4A 2FXAA 2BY2A 1OKRA 2VXZA 1MBGA 2PEXA 2H94A 4I98B 1QQIA 1VQMI 4KN4X 1GUUA 2OF7A 2R7FA 3GZ6A 1DGWY 3JRAA 1MBJA 2GLOA 2WA0A 2HKXA 1WI3A 1IN8A 3ERMA 3ZOBA 2QA4I 4A12A 2L7MP 5EYRA 5LRRA 2BE5F 1E3OC 4D7MA 2F6CA 1JT0A 2DFEA 1UMQA 2E7XA 3ZGKA 2LY2A 3GLXA 1E2XA 3FF5A 2MSYA 3IWFA 3BJOA 3K4JA 4II3A 4IEJA 3QYFA 3BZCA 3RPUA 2QEXI 4A3JJ 2XRLA 4GYIA 2K5CA 4B47A 3MKLA 4KNYA 3HDDA 2IA1A 1YG2A 4CYDA 3V4GA 1IRGA 1MH4A 4HF1A 3WTUC 4KT6A 2EZKA 3DWLE 2Q2EB 1EF4A 2RVCA 2VOOA 3RQIA 3PO3J 4RLQA 4DYRA 4MHGA 2MD0A
chains in the Genus database with same CATH topology
1Y56A 4Y3OA 4GRIA 1S9HA 3HOTA 1IRXA 1FMWA 5CKTA 4C2TA 1MMDA 3OYFA 3VYTB 1HA8A 4BACA 1V5GA 2KZVA 2V26A 2IGOA 3E0JB 4OAYA 3OYMA 3OYIA 2HU9A 2WAFA 2IS6A 4H4KC 2CS3A 2M7BA 2VQHA 5FRMA 3BG7A 1MMGA 3OR1C 2VQGA 4RM3A 4ZDOA 2MABA 4OWRB 3IUOA 3PSIA 2VKDA 4YEJA 4XKVA 3SYTA 1NG6A 3DU6A 4Y33A 2KDOA 4XMYA 4ZC3A 1WJEA 3FDYA 3K4LA 2L5QA 4BGDA 4CCOA 4BQNA 2K3PA 3EUHC 2DCEA 3EUKL 4FASD 1G8XA 3OYLA 3EUAA 4FETA 4LIVA 2KQRA 3CP8A 2UUZA 2WBMA 3VSLA 2CV2A 4CSWA 3OOUA 3C2HA 3OYCA 2XAUA 4XNFA 2JVHA 2WB1A 2R7XA 3RQ4A 4F52A 3DU5A 3NWTA 5FROA 3HL2A 2CV1A 1X19A 4XLHA 1YX3A 1EA3A 3PSFA 2M3AA 2HVRA 5HLTA 2FUG2 3HXLA 2CMPA 3S3MA 2HVQA 5LFAA 1X1AA 2CUJA 2Z2SB 3AL0B 2OV7A 4JOMA 1MNEA 3OYNA 1UELB 3QYEA 2R7RA 4PJLA 3ZQQA 3SEZA 2X6XA 2DJIA 2CV0A 4E7JA 1K6YA 2MFZA 3H0DA 2PMZA 4LIUA 3ZR8X 2A5WA 1ZELA 2LBFA 1AA7A 4IZZA 1N75A 5CPRB 2WY7Q 3VDXA 2XC7A 4BE0A 3W2VA 3A1YA 2I8DA 3MKZA 2X6YA 2VJ5A 3CJRB 1MW7A 3BLYA 2IGMA 1YX5A 4BQQA 3DKXA 2L7KA 4Y4RA 1WJ5A 4BEHB 4PFOA 4CCJA 3D5LA 4DJAA 3CMMA 4AVZA 3PNVA 3ONQA 3VYSB 1Z21A 3K70C 3TBIA 1Z7LA 3QODA 3C2GA 2XF5A 2VJIA 2R7SA 3RSNA 3DPUA 2E5ZA 3ZXSA 4YRVA 2BW3B 3TMOA 3DKYA 3LL7A 1MNDA 5TGTA 3TL4X 3MKYB 1UAAA 1U0JA 3EPZA 2VPLA 4E7ZA 4F92B 3OS2A 4CCMA 4F91B 3LFUA 2VASA 1BOBA 2WY8Q 3OYJA 3HUGB 3D5RC 2F5VA 4E7LA 2IGNA 3H5AA 3VWBA 2RREA 3PJRA 1DGRM 3DPTA 4QPQA 4XKBA 4PK4A 2UV1A 4NNJA 3L2WA 3K4NA 2KRHA 4C9YA 2L9SA 2Z1DA 3IAM2 4BS9A 2VQLA 1PJRA 2E60A 2R7WA 4HPQA 2LH9A 3S3NA 2JSPA 1WJDA 3VYRB 4N4NB 1D1CA 4XLFA 2MYSA 3OMYA 3V42A 5HOOA 4HG2A 2KRCA 4HEA2 3SEQA 4F55A 3OS1A 2LC2A 5LD2C 4PSWA 4C30A 3LMMA 2JVGA 2IS2A 4XONA 1D0ZA 1LDKB 4DBRA 4ZTFA 2RQQA 2HVSA 2RNGA 1WJAA 3VSKA 3L2UA 4DIQA 2VL8A 2HZDA 2ELJA 2DT6A 3H35A 5CQGA 2ZXIA 3BC8A 3IAS2 2IXSA 4E7HA 2LG4A 5KHDA 2GOXB 3J7AY 4BDZA 1X4PA 4DBQA 4N4OB 4G6TB 1JI8A 3K4CA 3LSHA 4DGWB 1OR7C 2IS4A 2Y0SA 1N78A 2X51A 3I9V2 2QKMB 4KITB 3K70D 2WADA 4LITA 4RM2A 2ZXHA 2DOAA 3A2KA 5KNLA 2P0WA 4XR6A 4BEHA 4EATA 3DQVC 3L2QA 2W1OA 2OC6A 3SZGA 2K9MA 2KPMA 2W4SA 1QU3A 2BOLA 1ERDA 2M0MA 3K4BA 3NWSA 4NUBA 4CCKA 4BE2A 2R7OA 3OYAA 4E7SA 2XSJC 2KMUA 3N05A 4QPOA 2BW3A 3H5RA 3LSKA 1UG0A 3OL3A 5HVQC 4RMNA 4CZCA 1X4OA 3BG6A 2AQEA 3QOEA 4II2A 2X6WA 2AQFA 4D9JA 4IQJA 3U21A 4JQFA 2DXIA 1OLTA 3AKZA 3K4KA 4IKFA 2VIXA 2A6TA 2V6EA 2R7TA 2CH0A 3S8PA 3CESA 1LVKA 2O5RA 4KISA 4B48A 4NQWB 2X1EA 2LRDA 1PYVA 1MMNA 2X1DA 4R79A 3OYDA 3FBNB 3OYGA 3F9KA 4RLFA 3RTRA 1Z3YA 2R7QA 4PUSA 4U7BA 4BU2A 2V4JC 3OWTA 2M7AA 2BVMA 3OS0A 4XQFA 4BJ5C 2GOMA 3DTKA 2R7UA 1WJCA 4J00A 2E1MC 4E7IA 2X85A 4HNUA 3MMYB 2XF6A 3LSMA 3PNYA 4PFPA 4ZYAA 3MD2A 4BJTA 3AL0C 4HRIA 2X1CA 4XLCA 1D0YA 4MLOA 2KHMA 2L9NA 4XORA 4HSRA 2JUGA 1V5FA 3HPGA 1X1BA 1V5EA 1LFPA 2XDVA 3PUBA 3OIQA 3H9JA 3FBIB 1X1DA 4XN3A 4XN0A 3FKJA 3K10A 3LSIA 4ZDPA 5HNHA 3L2VA 3PL8A 2CW7A 1SAUA 3I3LA 3KYLA 2R7VA 2UWMA 4B43A 4DOZA 2F4IA 2BVLA 2KP6A 4LG3A 3RPUD 2PJRB 1T95A 2HDWA 3ZRGA 3AFHA 3H5NA 1WJBA 4PJJA 4CUGA 4BXFA 2VJJA 3M8JA 4XM3A 2JA2A 2V1NA 3H9GA 2HNHA 2HPIA 3VYUB 3MKWB 1QHGA 4U87A 4ZJZA 2L2OA 3OYEA 4BUPA 2VXDA 4PJNA 1NG7A 2Q1ZB 2MC4A 3HPHA 4C2UA 2VLAA 2IGKA 3OYHA 3GBGA 4HNTA 2OUMA 3FHNA 2VB6A 2LOOA 1BR2A 1W36C 4OAZA 2KL4A 4KJZA 4XLAA 4XKWA 2ZFUA 2IS1A 4B3XA 1LKXA 3PFYA 3OYKA 4E7KA 3S3OA 3OR2C 1WFXA 2VQCA 3IP4B 1VZ0A 4ZDLA 2M4KA 3CJQB 3W3CA 4AU7A 5CQEA 5HNFA 3HKZA 4CH7A 4F3QA 3BCAA 2DT7B 4IQ4A 1DQUA 1G59A 1BR1A 3DPLC 4XLEA 3PNTA 2Z16A 1D0XA 3S93A 4ZTJA 1TZLA 1TT0A 3CP2A 4BDYA 4X0GA 1SFKA 2K9LA 1E0EA 3UNGC 2XF7A 1J09A 1QHHD 2V9KA 4XL9A 2KLOA 3HG9A 4E6KG 1MMAA 4YELA 2LY1A 2ZSIB 3RCOA 3UR3C 5FRNA 4NC8A 1R6RA 4AYBA 4NC7A 4B44A 1BR4A 5JHFA 1DP3A 2E1MB 2QKLB 4XKCA 3SDBA 1FMVA 2W7NA 3HC7A 2R4GA 3CZ6A 1X1CA 2V7FA 3K6GA 1GLNA 1YE9A 3DEEA 2LYCA 2M4GA 2HPMA 1KONA 3QYBA 2HQAA 4PJMA 4P5OA 4BJ6C 2E5NA 2VJ4A 1WJFA 2VXZA 3HOSA 3A4CA 5KCMA 4BL0B 2PJRA 4D1QA 4PSXA 4CCNA 2CUZA 4P1WA 1DGWY 2ZSHB 3KEYA 4F93B 3OY9A 3BCBA 2WA0A 3DTIA 4ANJA 3L2RA 4IX7A 2WAEA 3OIPA 4HSTA 3M1CA 3E1SA 2CFOA 2WAQA 3OYBA 2F6CA 3W2WA 4BE1A 1W36D 1Z3XA 3ZGKA 2LY2A 3CF2A 3OL4A 2W00A 3G2BA 3S32A 3DTEA 3H9QA 2VKHA 3K4JA 4II3A 3QYFA 3KX2A 1D1AA 2K5CA 2CW8A 4B47A 3LSGA 4J01A 4XOTA 4CA0A 3ZCOA 2NOJB 3K4MA 4E4HA 2W82A 1P9QC 1N77A 2LREA 1T0FC 3D5SC 4ITVA 2LBFB 4KT6A 3DWLE 2Q2EB 1D1BA 3W2AA 4RLQA 4XOPA 1Y6IA 3DLAA 4CCLA 2MD0A 4BQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJF A;  1E0E A;  4F3Q A;  1K6Y A;  1KON A;  1WJA A;  1WJE A;  3HPG A;  1WJC A;  3HPH A;  1LFP A;  3F9K A;  1MW7 A;  1WJB A;  1WJD A; 
#chains in the Genus database with same CATH topology
 1Y56 A;  4LD5 A;  1I39 A;  1J5Y A;  2PMZ N;  2XB0 X;  4JP0 A;  2CO5 A;  2RC4 A;  4KIF A;  1SFO J;  2XAQ A;  2LK2 A;  4U0Y A;  4MEX F;  1MMD A;  3RPQ A;  2VE8 A;  2OAZ A;  3MEX A;  3KYD B;  5GAE J;  1F5T A;  1R4M B;  3ABT A;  2M1B A;  1V5G A;  4M3B A;  4V2F A;  3S16 J;  4DNC A;  1W0T A;  1SFE A;  3E0J B;  1OJL A;  3CDH A;  1YOV B;  3U1K A;  5LHH A;  3GZN B;  2QZ8 A;  1HKS A;  3BJA A;  4IF4 A;  1MMG A;  2VQG A;  1GVD A;  4IHX A;  3JRG A;  1T33 A;  1W5S A;  4W97 A;  5LBQ A;  4GO1 A;  3PSI A;  1ZG5 A;  3GO5 A;  2XUB A;  1YTY A;  1ZRD A;  2HDC A;  2OD5 A;  3DU6 A;  3WU2 C;  1BI0 A;  1X3Z B;  2KDO A;  4ZC3 A;  1V3F A;  1T08 B;  1U3E M;  1BJZ A;  3K4L A;  2DFF A;  4XRM A;  4BQN A;  1HSJ A;  2FF4 A;  1R9T J;  2DCE A;  2E35 A;  2DT5 A;  3D0S A;  4ZYD A;  1BI3 A;  4AD9 A;  3EUK L;  3TW6 A;  3VSL A;  4LIV A;  2KQR A;  2WBM A;  3LAP A;  4DW6 A;  4HX8 A;  3V8L A;  4CSW A;  2DOF A;  2XAU A;  2HWV A;  3S1R J;  2W48 A;  5K5O A;  3RQ4 A;  4F52 A;  1I6H J;  4OOI A;  4PZJ A;  4CYC A;  3A01 B;  5FRO A;  1P7J A;  1LE8 A;  3FKI J;  3IHU A;  3JRC A;  4RB2 C;  1F36 A;  2B0L A;  2OJE D;  5E8I A;  4ZZD A;  1RC9 A;  4XLH A;  2D2W A;  2E19 A;  3MFK A;  5HLT A;  4AIJ A;  1YJ9 I;  3IC7 A;  3HXL A;  4KYW A;  3S3M A;  2V1X A;  2M34 A;  1XMX A;  3GF2 A;  3QPL A;  1X1A A;  3O8G A;  2Z2S B;  2JMW A;  2JRT A;  1MNE A;  1UEL B;  5DM7 F;  3FIS A;  5HLH A;  4PJL A;  3OIO A;  2JJ7 A;  4IRH A;  1XGM A;  1XPX A;  1B8I B;  2Y2Z A;  2DJI A;  4JX5 A;  4YFX F;  4E7J A;  1J59 A;  2J5O A;  5H6Q A;  5KVR A;  2J5P A;  4GGG A;  1ZAR A;  3R4K A;  2A5W A;  1PUE E;  2IP2 A;  5BMZ A;  5F0H A;  2Q2E A;  3MN2 A;  1ZR2 A;  4C3I J;  3V8K A;  4BNC A;  3MKZ A;  2FNP A;  4Z6Y A;  3WTT C;  1MW7 A;  2IGM A;  3BTL A;  1UHS A;  4PFO A;  3CMM A;  2GQQ A;  2PMU A;  5FD6 A;  3VYS B;  2LKX A;  3K70 C;  4I01 A;  2R3S A;  1TWH J;  2CQK A;  3JRF A;  1KQ8 A;  5JR3 A;  5IPA A;  2YR2 A;  3C2G A;  2ZNZ A;  4HW0 A;  1QO0 D;  2A6H F;  4I7H A;  1LEA A;  2R92 J;  4M9X A;  1O4X A;  3TL4 X;  4HLX A;  3ZQC A;  2VPL A;  4E7Z A;  2ADU A;  3OS2 A;  1VQ5 I;  1BBY A;  3LFU A;  2W85 A;  3DEU A;  5L3G A;  2M30 A;  1IAW A;  2IGN A;  3ASO H;  5BQT A;  3PJR A;  3BTJ A;  3SFI A;  5L3B A;  1VQK I;  2ZJ2 A;  3K4N A;  4PCQ A;  3F23 A;  3IRQ A;  2R7W A;  5GAG J;  1MJB A;  3K7A J;  4HPQ A;  3S3N A;  2Z33 A;  3L1P A;  4EGY A;  5C4X J;  5CVV A;  1XB4 A;  1ZGJ A;  1EV7 A;  1XMA A;  5FKL A;  3NQO A;  4A5M A;  1TC3 C;  1F1Z A;  1FLI A;  3KE2 A;  2EPF A;  1UHM A;  1TNS A;  3A01 A;  2JWT A;  4ENK A;  3N4M A;  1IN5 A;  4R8H A;  5IYC J;  1MH3 A;  2CGP A;  2PMH A;  2F5F A;  4BAY A;  3MZY A;  4A69 C;  3JR9 A;  2Z3Y A;  3VSK A;  1IV6 A;  3I58 A;  2DT6 A;  3H35 A;  2LMD A;  2ZXI A;  2GAU A;  3BC8 A;  3CUQ C;  1MIJ A;  4E7H A;  2RQP A;  2YUS A;  2DQL A;  2QQB A;  3CMY A;  4MFE A;  3J7A Y;  2AXL A;  4D7N A;  5FLV A;  5CVR A;  4FE4 A;  4BKX A;  1B8I A;  3IKT A;  2ID6 A;  2JSC A;  4NB5 A;  1XDS A;  3HOV J;  1WZ2 A;  1JI8 A;  3K4C A;  4FHT A;  4XRF A;  1YW8 A;  4IHS A;  2WAD A;  2DA6 A;  4LJZ F;  4A3F J;  1Y39 A;  3W6K B;  2DOA A;  2LTP A;  2OA4 A;  1H9G A;  1X2N A;  4XR6 A;  4M3E A;  4AID A;  2FOW A;  4EAT A;  3H3V K;  4M73 A;  4QTR A;  2K9M A;  2H6C A;  2W4S A;  1FBQ A;  1QU3 A;  1ERD A;  4BE2 A;  3OYA A;  3N05 A;  2KMU A;  1RR7 A;  2YS9 A;  4Y7N J;  1GT0 C;  1OYW A;  3KZI C;  2H27 A;  1R4N B;  3OL3 A;  1A36 A;  1XSD A;  3BG6 A;  3RKQ A;  2X6W A;  4D9J A;  4C3J J;  3WTX C;  3VEP A;  4U7D A;  1UB9 A;  2E36 A;  4KN7 X;  1O7L A;  4OIR F;  5CJ9 A;  1TQP A;  3AG4 H;  2DA4 A;  2EZI A;  4M6X A;  1OCC H;  5DS9 A;  2CH0 A;  2O5R A;  3JAM K;  2NRA C;  3FXR A;  1ETO A;  1FP2 A;  4R79 A;  3ECO A;  1AWC A;  3VOE A;  2FD5 A;  3F8F A;  3OYD A;  3OYG A;  3F9K A;  2VUM J;  1CF7 B;  2DU9 A;  4PUS A;  4U7B A;  2WTE A;  3ZMD A;  2L7Z A;  3MWM A;  5D5U B;  2FU4 A;  3Q9S A;  3O2P E;  3OS0 A;  3G4S I;  1T98 A;  4AWX B;  4N9H A;  5L3F A;  3ABL H;  2IEK A;  3ABU A;  3JTH A;  4A6E A;  1NK2 P;  2R7U A;  3QAH A;  5EDN A;  1IN4 A;  1ZLJ A;  1FYK A;  3VFZ A;  3QQA A;  4ZYA A;  3R0J A;  1REP C;  3MD2 A;  4W1U A;  5GAD J;  4A6D A;  4BJT A;  3NAU A;  4HRI A;  2K9Q A;  3KLO A;  3HRT A;  2BHY A;  2O8X A;  2DK5 A;  3GFL A;  4Y17 A;  4XLC A;  1XG1 A;  1D0Y A;  2X9D A;  4CZZ A;  2PJP A;  4BBR J;  2Z5U A;  2DAO A;  5ERI A;  1JUP A;  2OZU A;  1V5F A;  2UXX A;  3K9T A;  2XDV A;  1FYM A;  2D1V A;  4BXU A;  4XN3 A;  3FBI B;  1XN7 A;  2E1O A;  5L3D A;  4XN0 A;  4QLC U;  3GYH X;  2LFB A;  3FKJ A;  3K10 A;  3FXM A;  2H1K A;  3TKY A;  4EGZ A;  3JRI A;  4UVA A;  3CCM I;  3CCQ I;  4A3K J;  5H6R A;  1BIA A;  1LVA A;  2CYY A;  2QQ8 A;  3RDI A;  4EM0 B;  3KYL A;  2H8W A;  1S3J A;  2UWM A;  5AIP A;  3V8J A;  5DV5 A;  1MGT A;  3RPU D;  2CFX A;  3DP7 A;  3FMS A;  2HS5 A;  3RKX A;  4Y13 A;  4F7Z A;  4KDP A;  2ZME A;  3C7J A;  1ZH5 A;  4TV7 A;  4PJJ A;  4CUG A;  1FSH A;  1T6S A;  4BXF A;  2VJJ A;  1VQ9 I;  1YI2 I;  3H9G A;  1U2W A;  1IDY A;  5GTH C;  2NYX A;  2H6B A;  3FMQ A;  3OYE A;  1MBE A;  1JHH A;  3CD6 I;  3WGG A;  2FOK A;  2MC4 A;  3V7S A;  3HPH A;  5C4J J;  1VQ8 I;  1ON1 A;  2L02 A;  2CW0 F;  1BL0 A;  2EA2 A;  3ABK H;  3OYH A;  3GBG A;  1SVL A;  4U0W A;  1OCP A;  5EF6 A;  1Z05 A;  1BR2 A;  2HOE A;  2HQR A;  4OAZ A;  3G71 I;  5B66 C;  2KL4 A;  4QIW N;  3OSF A;  2QSF X;  2ZFU A;  4L9J A;  2IS1 A;  4B3X A;  2PBI A;  4M72 A;  3OYK A;  3OR2 C;  3SJM A;  2CUE A;  3IP4 B;  2I10 A;  2X0L A;  3M9A A;  1YS6 A;  3E5U A;  1ZTR A;  1BN5 A;  1CF7 A;  3HKZ A;  3JSO A;  3WTV C;  4IQ4 A;  3F6O A;  3ASN H;  1BR1 A;  3BWG A;  5BNG A;  4L5I A;  2Y75 A;  1BC8 C;  1IN6 A;  1Z7U A;  3S93 A;  4AUX A;  1G3W A;  2ZFW A;  4XL9 A;  1FZP B;  4LK0 F;  3GFJ A;  2W24 A;  2DFH A;  2HKO A;  2IRF G;  1EKE A;  3QPH A;  1Z1D A;  4P9F A;  4KMF A;  4NC8 A;  2YPR A;  2JPC A;  3HTU A;  1BR4 A;  5JHU A;  5JHF A;  1DP3 A;  2E1M B;  2A05 A;  3TOB A;  4YII A;  3CUO A;  3GW2 A;  1YIT I;  3CJT B;  3FZV A;  2W7N A;  1A31 A;  2V7F A;  2ZO4 A;  3K6G A;  3H1C A;  1S72 I;  1GLN A;  3Q0U A;  4A3C J;  1YE9 A;  2ZJQ F;  2MD5 A;  2GBY A;  5DD4 A;  3FXQ A;  2IT0 A;  1TWC J;  2HPM A;  4I2O A;  3QYB A;  4UNO A;  3CO6 C;  4BJ6 C;  1WJF A;  1XTA A;  4WXC A;  1EJ9 A;  4HLY A;  4G7Z F;  4BL0 B;  1U6G A;  3I0T A;  3FM5 A;  5EEH A;  3S15 J;  4EJU A;  2LVS A;  3Q0W A;  3F22 A;  4P1W A;  1JKQ C;  2G7U A;  3LQQ A;  4DYQ A;  3BZ6 A;  1OR7 A;  3JTG A;  3KEY A;  5HLI A;  5GAH J;  4ANJ A;  1R23 A;  4ESJ A;  1R5G A;  3M1C A;  3E1S A;  2IVM A;  1J7K A;  1SMT A;  4B8X A;  3W2W A;  5LEK A;  1Y8Q B;  3CF2 A;  3TO9 A;  4I0A A;  2HI3 A;  3S32 A;  2VN2 A;  3H9Q A;  3K1P A;  1B9N A;  1VTN C;  2JT1 A;  4RB1 A;  2M8G X;  1QBJ A;  5FKK A;  1J75 A;  3GCM A;  5ICG A;  2CW8 A;  4J01 A;  3ZCO A;  2LD5 A;  4E4H A;  1DPU A;  5EEA A;  4LB5 A;  2LRE A;  5F64 A;  4BHC A;  2HOT A;  1R71 A;  2YX7 A;  2LBF B;  2NS8 A;  2L4M A;  1D1B A;  3E5X A;  4Z2Y A;  1DDN A;  3E6D A;  4XOP A;  5M5X J;  3ZXS A;  4IKF A;  4BQO A;  2P5K A;  5D8L B;  2QGU A;  1SC7 A;  4Y3O A;  3GFM A;  1AHD P;  2XPW A;  3P9C A;  2XVC A;  4BBS J;  3HOT A;  5CKT A;  1ZQ3 P;  5JVT A;  1RKW A;  2DDB A;  5J8C A;  1LUJ B;  3PQK A;  4BAC A;  3HSE A;  2V26 A;  1FYL A;  4UUT A;  2IGO A;  2XAG A;  2DW4 A;  2WC2 A;  3KEO A;  2EFQ A;  3OYI A;  2K27 A;  3L2C A;  3F72 A;  2CS3 A;  2K4J A;  2VQH A;  5ED4 A;  2LR8 A;  2ISZ A;  3BT9 A;  1Y0U A;  4IHV A;  2CJJ A;  5CVI A;  1TQI A;  5IOZ A;  3IUO A;  4KIB A;  2GA1 A;  2VKD A;  5TRD A;  2CQN A;  3KP6 A;  2F4M B;  4XMY A;  2CG4 A;  1X58 A;  3CC7 I;  3BPX A;  4DQ2 A;  3RJP A;  2HQ5 A;  1VQN I;  4OIQ F;  2P6S A;  3F8B A;  1HKT A;  1WI9 A;  3HTS B;  2FBK A;  1FTZ A;  3WTZ A;  3ZMS A;  1FEX A;  2EV5 A;  1IXS B;  2CV2 A;  1KU7 A;  4G8X A;  3CP8 A;  2UUZ A;  1BOA A;  4M3D A;  4I09 A;  4M9Z A;  5J1Y A;  1AKH A;  4N9I A;  1B4A A;  2TDX A;  1SEU A;  3J81 K;  1I6X A;  3CC4 I;  1WCM J;  1O3T A;  2BV6 A;  3NWT A;  2ZKZ A;  2P7C B;  1HF0 A;  1GVJ A;  1S7E A;  2PI0 A;  3DXJ F;  5FFX A;  2CV1 A;  1WGX A;  1YX3 A;  2HVR A;  2IAI A;  2M3A A;  2ID3 A;  2K9N A;  5K7F A;  2FUG 2;  1ETX A;  1UZC A;  3L9F A;  2JA8 J;  3BP8 A;  1NHA A;  4A0X A;  1XGO A;  4ENM A;  4V2G A;  2R7R A;  4P55 A;  2OTL I;  5E3L A;  4BHB A;  1I5Z A;  1X1P A;  4IO9 F;  1IRZ A;  1OYI A;  3QP5 A;  4RGR A;  3JRD A;  4X1E A;  3CME I;  1J0R A;  4B3A A;  4Y52 J;  5FKN A;  2D5V A;  9ANT A;  5D5V B;  1SFU A;  2MFZ A;  4LIU A;  3ZR8 X;  4JBA A;  2LBF A;  5EJC A;  1N75 A;  2WY7 Q;  4BE0 A;  1K4S A;  4FT8 A;  4P9U A;  3BZK A;  1OCT C;  2VJ5 A;  3CJR B;  1S5L C;  4BQQ A;  5IT3 A;  3PIP F;  3DKX A;  4CYC B;  1T8I A;  3I53 A;  1FBU A;  4DJA A;  2M0C A;  1LE8 B;  3PNV A;  3DKW A;  2XAS A;  1ZRE A;  3WG7 H;  4ZYE A;  3ONQ A;  1Q1H A;  4L0Y B;  2ZBK A;  1ETQ A;  2VBZ A;  4S0H B;  3HOU J;  3M07 A;  1Z7L A;  2PFB A;  3GTJ J;  1FT9 A;  3QOD A;  1H88 C;  2LNB A;  2VJI A;  4K2E A;  1V55 H;  2YSR A;  1CQT A;  1I3A A;  2K02 A;  5M5Y J;  3V7C A;  5LHI A;  2E5Z A;  3E7L A;  4B1R A;  1RES A;  5DEQ A;  2BW3 B;  4LOC A;  4DZJ A;  1FOW A;  3MKY B;  1U0J A;  2LF7 A;  3EPZ A;  3TO6 A;  2Q8K A;  3CCL I;  2DA5 A;  1LFB A;  3LSR A;  2HYG D;  3KPH A;  1UG2 A;  1IXR C;  2OZ6 A;  1R1U A;  1FWZ A;  4L9V A;  3OSG A;  4FTH A;  1DGR M;  4DZP A;  1R5H A;  4BYY A;  2MH9 A;  3GVA A;  1YJN I;  1HKQ A;  2E60 A;  1FBS A;  3FK6 A;  2LH9 A;  2QF7 A;  2JSP A;  1XS9 A;  1X3W B;  2LP0 A;  2XRO A;  2O7O A;  1RET A;  3BDD A;  4N4N B;  3C2B A;  4XLF A;  5J47 A;  3DLL F;  4HG2 A;  2IA2 A;  4EJO A;  4HEA 2;  3SEQ A;  5LD2 C;  4PSW A;  4C30 A;  3CTA A;  3ROU A;  3KFW X;  2IS2 A;  4YIR X;  1U5T B;  4DBR A;  3NAR A;  3R60 A;  4NBQ A;  3TQN A;  1HST A;  3FK7 A;  4ZTF A;  1YIO A;  3X2Q H;  3BG5 A;  1OYY A;  1I1S A;  1WJA A;  5GPC A;  2VL8 A;  4G6D A;  2ELJ A;  4RGX A;  5CQG A;  2IXS A;  1TW3 A;  5J4Y A;  3DCF A;  5KHD A;  3IH2 A;  2JZY A;  5F27 A;  3GTG J;  2XGD A;  2HXI A;  4KIG A;  4BDZ A;  4XSZ F;  2H1L A;  3WTS C;  1X4P A;  1R1V A;  2FNA A;  4N4O B;  5J3L A;  3LSH A;  2IS4 A;  2X4H A;  2HOS A;  1P4W A;  2M9H A;  1WH5 A;  1HQC A;  1R5I D;  2ZXH A;  4NC6 A;  1KGS A;  5KNL A;  2P0W A;  2E7W A;  5LGU A;  1T39 A;  1AOY A;  1H0M A;  2B9S A;  2EFW A;  2KIF A;  1T0F A;  3E6C C;  4FCY A;  2W1O A;  2OC6 A;  1D8K A;  4Q5S F;  2MA3 A;  1SMY F;  2KPM A;  3M7G A;  2EIN H;  5FLX Z;  3M8E A;  1E17 A;  1JGG A;  4D5F A;  3G1M A;  1QZY A;  1RUO A;  4NUB A;  4M6V A;  4E7S A;  3MCZ A;  4JYK A;  3WE3 A;  4XID A;  2XGX A;  2BW3 A;  2JTV A;  4G9Y A;  5HDN A;  2XSD C;  1KZH A;  4CHU A;  2P7V B;  4CZC A;  3S1N J;  3QOE A;  4HYE A;  4S05 A;  4IQJ A;  4JQF A;  1ORK A;  1WWX A;  1VQO I;  3AKZ A;  1VI0 A;  3WU0 A;  1OIS A;  2R7T A;  3B02 A;  1LVK A;  4B48 A;  4XRS G;  1YO5 C;  2LRD A;  1PYV A;  1MMN A;  2X1D A;  3FXJ A;  2YU3 A;  4XRS A;  3FBN B;  5DCF A;  4RLF A;  2AHQ A;  2GWR A;  3RTR A;  2UXN A;  1JHF A;  2R7Q A;  1LDD A;  4BU2 A;  2V4J C;  3DFG A;  1QPM A;  3CCS I;  4RA2 A;  5CLS A;  4KA4 A;  3DBL B;  3WTY C;  3SQN A;  1Z77 A;  2ME6 A;  4HF0 A;  3ZMU A;  1G3T A;  5IT9 Z;  1U5T A;  3HKZ N;  4PDK A;  3PNY A;  3CDL A;  1NTC A;  2LY9 A;  3ML6 A;  2ME0 A;  1FC3 A;  3ABM H;  3F6V A;  3M8F A;  4MLO A;  1HDD C;  2L9N A;  1QVT A;  1YYV A;  3RYR A;  3HPG A;  1KQ0 A;  1O3R A;  1V5E A;  1LFP A;  1HC8 A;  4IJA A;  1FOY A;  1Y8R B;  2IPQ X;  2K85 A;  3J7Y J;  2EIJ H;  1MBK A;  1K6O A;  5F04 A;  5HNH A;  3HHG A;  1RUN A;  5K7H A;  1Z9C A;  3HJE A;  2R7V A;  5D4S A;  4DOZ A;  3PO2 J;  1XSV A;  3R6S A;  4LG3 A;  4V19 K;  1P6R A;  1XSX A;  2XAJ A;  2PJR B;  2Y31 A;  1BJA A;  2KZG A;  3AFH A;  3ZRG A;  1WJB A;  3I4N J;  5FLM J;  2ZNY A;  1FOX A;  3I55 I;  1MBH A;  2VC0 A;  3M8J A;  3P5J A;  2E34 A;  3EQL F;  4ZYG A;  2HOA A;  2P4W A;  2HNH A;  3V7R A;  1R22 A;  3VYU B;  1GV2 A;  1O7F A;  4HQE A;  1UCR A;  2HTJ A;  2L2O A;  4IHW A;  2DN0 A;  1F9N A;  4A5N A;  4PJN A;  5D5X B;  3S14 J;  3FMR A;  5FB2 A;  2IGK A;  1MSF C;  5C44 J;  5ICE A;  1XCV A;  3ESW B;  2FX0 A;  1IXC A;  1P4X A;  2OUM A;  2QUF A;  3SDG A;  2V79 A;  5ILV A;  2FQ3 A;  4MQV A;  2R7Z J;  3FXU A;  1JT6 A;  1LKX A;  3PFY A;  4EJT A;  1MJA A;  3CCE I;  3S2D J;  2A68 F;  2V9P A;  3GWZ A;  2V1U A;  1VZ0 A;  4HDU A;  2F5E A;  2ZME B;  3W3C A;  1G2H A;  4AIH A;  4FX4 A;  4F3Q A;  5E18 F;  2DT7 B;  1R00 A;  3KP7 A;  2OQG A;  4UXN A;  5JI6 A;  1U5T C;  4IOA F;  1TTY A;  5E8G A;  1ZAO A;  2QVO A;  3S2H J;  2FJ1 A;  1W5C C;  5F1J A;  1E0E A;  1J09 A;  1ITY A;  4E6K G;  4M74 A;  3MAJ A;  2EIL H;  3I4P A;  3RCO A;  1H8A C;  5J8F A;  5FRN A;  1QZZ A;  2GIV A;  2ACJ A;  1R6R A;  3KET A;  4NC7 A;  4B44 A;  2O6G E;  4LLL A;  4MIM A;  1A6Q A;  3ISP A;  1SD6 A;  1SVO A;  1PP8 F;  5DD8 A;  3LSP A;  3CMA I;  4XLP F;  3ZQH A;  2DMT A;  2ZCW A;  2R4G A;  4HNV A;  3G73 A;  3K0L A;  5A2Q Z;  1LPQ A;  4MEY F;  1P2F A;  3ZN0 A;  5DM6 F;  1MMS A;  1FP1 D;  2KFD A;  5F0C A;  3RIR A;  3NRV A;  1FTT A;  2GXA A;  3VB2 A;  2E5N A;  4FX0 A;  2F5D A;  3HOS A;  4BHP A;  5KCM A;  3TDU C;  3EYI A;  2PJR A;  2HYJ A;  1RZ4 A;  1WQ2 A;  3E97 A;  3L09 A;  3HRS A;  3KP5 A;  4D1Q A;  1K78 B;  2EZH A;  1BI2 A;  1OMI A;  3O6B B;  3PIO F;  3Q3S A;  2ZSH B;  2DMN A;  3OOP A;  3ZMT A;  4F93 B;  2CQX A;  3ELK A;  3BCB A;  3HOY J;  3JRE A;  2B63 J;  2WAE A;  2AO9 A;  2O9L A;  2GXB A;  4HST A;  2PLY A;  3J80 Z;  2CFO A;  3GZ5 A;  2WAQ A;  3KP2 A;  4ABZ A;  3OYB A;  2VOD A;  1MD0 A;  2BEO A;  1D3Y A;  2Y0S N;  4HZF A;  3PFI A;  3TO7 A;  5D6E A;  3OL4 A;  2RKH A;  4KMU X;  1FIP A;  2W00 A;  3TDZ C;  4AC0 A;  3HGG A;  3DTE A;  2CQQ A;  2VBX A;  1BI1 A;  3GTQ J;  3L00 A;  2DPD A;  4JX4 A;  4OMY A;  2ETH A;  2ZJR F;  3G1L A;  2QM3 A;  2KIM A;  1BW5 A;  4MQ9 F;  1JTY A;  3QPT A;  4XOT A;  4CA0 A;  3S1M J;  2NOJ B;  3K4M A;  1P9Q C;  2D1H A;  1N77 A;  1VF9 A;  3HRU A;  3D5S C;  4ITV A;  2LF8 A;  2C6Y A;  1KU3 A;  2CQ7 A;  4HQM A;  3HB9 A;  3W2A A;  3ZQI A;  4UY8 I;  1Y6I A;  5EG0 A;  4CCL A;  4Q48 A;  5DTD A;  1WKM A;  2O3F A;  4GRI A;  2QCO A;  1FNN A;  1A35 A;  1IRX A;  1FMW A;  3ZQG A;  4G7O F;  4GXO A;  1OQY A;  1LNW A;  3TP0 A;  2GM4 A;  2HEO A;  1TW2 A;  3OYF A;  1HA8 A;  3BQY A;  4P96 A;  2F2E A;  1RI7 A;  2LSO A;  5LGT A;  1TT5 B;  2KZV A;  2EIK H;  2BY3 A;  3PM1 A;  3SZP A;  4OAY A;  4XK4 A;  2HU9 A;  1ODD A;  1W4M A;  2XGE A;  3JRB A;  4H4K C;  2IS6 A;  5FRM A;  2KRF A;  3BG7 A;  3LA3 A;  2M87 A;  3OR1 C;  4RM3 A;  5B3S H;  2O61 A;  3HOX J;  4N0B A;  2R5Y B;  5HLG A;  3ULQ B;  3TGN A;  4ETS A;  4YEJ A;  4B09 A;  4XKV A;  4UV9 A;  1FX7 A;  1IF1 A;  4BQA A;  4Y33 A;  3IL2 A;  1WJE A;  3FDY A;  5HOD A;  3QP6 A;  2CRG A;  1SD4 A;  2QWW A;  2A6E F;  1ENH A;  4CCO A;  2VON A;  2K3P A;  3P7N A;  4MFD A;  2BY0 A;  3AG2 H;  1V54 H;  1SAN A;  4D5C A;  1LEB A;  4OMZ A;  4FAS D;  3LNQ A;  3T8T A;  3K1M A;  3B6C A;  1K78 A;  3OOU A;  1HOM A;  2NAZ A;  3BR1 A;  2WB1 A;  2R7X A;  2EJR A;  5ICF A;  3FM3 A;  1ZGW A;  3DU5 A;  5FFZ A;  4WCG A;  3GTK J;  2R5Z A;  3HOW J;  1G3Y A;  2HQN A;  1EA3 A;  3BTC A;  4EQQ A;  5BPD A;  5LHG A;  1P92 A;  4EMS A;  2NVU B;  2DO7 A;  2DJN A;  4ENJ A;  2HVQ A;  3K1N A;  4CO8 A;  5LFA A;  2JPB A;  2CUJ A;  2O03 A;  4FE7 A;  2OV7 A;  5M5W J;  3P9I A;  1R49 A;  1O3S A;  3QYE A;  2MLK A;  5K5Q A;  4ASN A;  3WE2 A;  3SEZ A;  5JVG F;  1TBX A;  2A69 F;  2MGQ A;  2X6X A;  4PGG A;  3UKG A;  2CV0 A;  1K83 J;  2ZME C;  4OU0 A;  3RKY A;  1HW5 A;  2RN7 A;  1TL8 A;  1A5J A;  1GV5 A;  4L5J A;  3VDX A;  5E1Z B;  2Y69 H;  2I8D A;  1AKH B;  1MZB A;  1KYZ A;  3LFK A;  5E20 A;  4ENN A;  3BLY A;  1YX5 A;  4Y4R A;  2L7K A;  2IJL A;  1IC8 A;  2X48 A;  1WJ5 A;  4BEH B;  4CCJ A;  4MTD A;  3D5L A;  4G7H F;  4AVZ A;  5GTI C;  2K40 A;  3HEF A;  1P7I A;  1Z21 A;  1XC5 A;  3TBI A;  5IT9 K;  3Q0V A;  3I71 A;  3GTO J;  3CCR I;  2VKE A;  1APL C;  2DMU A;  5HS8 A;  2XF5 A;  2R7S A;  3LSJ A;  3RSN A;  2E2I J;  1VQ7 I;  5F08 A;  1NH3 A;  3DPU A;  1L3L A;  3E6M A;  1F4K A;  5E3M A;  3KIO A;  3TMO A;  3DKY A;  3LL7 A;  1H9T A;  1UAA A;  2NVT J;  4F92 B;  3AAF A;  1NK3 P;  2VAS A;  1BOB A;  2WY8 Q;  1FPQ A;  3OYJ A;  3COA C;  3HUG B;  2R5Y A;  2FBH A;  2F5V A;  1YHQ I;  1HW1 A;  1ULY A;  2HXO A;  2MBF A;  2RRE A;  3VWB A;  3DPT A;  4QPQ A;  4XKB A;  2KIU A;  2UV1 A;  5B1A H;  4C9Y A;  4M71 A;  2Z1D A;  3IAM 2;  4BS9 A;  4J19 A;  2L7F P;  5D5W B;  2FML A;  4G12 A;  1Y1V J;  2OU2 A;  4RAF A;  5EZH A;  2P81 A;  4LFU A;  3VYR B;  5LLQ A;  1D1C A;  3M4O J;  2COB A;  1STZ A;  1UST A;  2L0K A;  1SAX A;  3OMY A;  5EZG A;  2JUC A;  3WHB A;  4F55 A;  3BG3 A;  3CJN A;  3IH4 A;  2LC2 A;  1ZRC A;  3LMM A;  4XON A;  1LDK B;  3I56 I;  1YIJ I;  5C3E J;  4XLN F;  4WK8 F;  3HHH A;  1TWF J;  2V9V A;  3S1Q J;  2EH3 A;  2RQQ A;  1JUM A;  3QWL A;  2HVS A;  2RNG A;  3L2U A;  1RRJ A;  3HOZ J;  2EFN A;  2HZD A;  3S17 J;  1ONV A;  1ZK8 A;  4A2U A;  3IAS 2;  4YIF A;  4WX9 A;  4IRI A;  1BM9 A;  1WSU A;  5H20 A;  1QNT A;  2KIS A;  1KA8 A;  3EET A;  1XGN A;  4YFN F;  2LLK A;  2ISY A;  2LKS A;  1OR7 C;  5JFR A;  2Y0S A;  3ZQ7 A;  1HLV A;  1N78 A;  2X51 A;  3I9V 2;  4IHY A;  2RNJ A;  5JLW A;  1XCB A;  1R36 A;  4LGW A;  3A2K A;  5CVJ A;  1JGS A;  3CCY A;  4IXA A;  4BEH A;  3L2Q A;  3LST A;  1TNT A;  4G94 A;  3WU1 B;  2KJB A;  1E3P A;  3I59 B;  3Q9V A;  3A02 A;  2BXZ A;  2ICW G;  1K79 A;  1ETW A;  1RKT A;  2BOL A;  1GHC A;  2NNY A;  3NWS A;  3WTW C;  4CCK A;  1SD7 A;  4Q47 A;  3I5U A;  2XSJ C;  1TWG J;  3HBL A;  2R0Q C;  1JXS A;  1UG0 A;  3BJ6 A;  2ZC2 A;  3IWZ A;  5HVQ C;  1P4A A;  5F6F A;  1X4O A;  3GME A;  4WWC A;  4II2 A;  5KAF C;  2XPV A;  3TED A;  5K5R A;  2DXI A;  1OLT A;  3HUG A;  4BY7 J;  3KCC A;  4BH9 A;  5IY5 H;  3AG3 H;  3F0C A;  2A6T A;  4M6Y A;  5FJ8 J;  3HSF A;  2BY1 A;  2X1E A;  1QVU A;  2VI6 A;  3BR5 A;  1KU2 A;  2YU9 J;  1IUY A;  1Z3Y A;  2KKO A;  4RB0 A;  1YRN B;  3FXL A;  3MQ0 A;  5F0F A;  5J1R A;  1JJ6 C;  4A3L J;  3JAM Z;  3OWT A;  4LK1 F;  5E1X A;  1W7P B;  4CIC A;  2M7A A;  2BVM A;  4AIK A;  1K61 A;  4ESF A;  4BJ5 C;  1I27 A;  2GOM A;  4XQF A;  1HXD A;  1ZKG A;  3DTK A;  1WJC A;  3BTI A;  1IJW C;  4BXX J;  2E1M C;  3J80 K;  4E7I A;  2X85 A;  4HNU A;  3TP3 A;  4HF2 A;  2XF6 A;  2E2H J;  3LSM A;  3T8R A;  1PVE A;  5FO5 A;  4I99 C;  2EQR A;  3MZH A;  3RZO J;  5HS7 A;  1EH8 A;  2BBY A;  2RGV A;  5M3M J;  1C0W A;  3QU6 A;  1E3H A;  2V1D A;  4A0Y A;  2NOG A;  2X1C A;  5BS6 A;  2EB7 A;  2KHM A;  4XOR A;  2AS5 F;  1X3U A;  2BHZ A;  2JUG A;  3WOD F;  4AVP A;  1BC7 C;  4O3M A;  4CGZ A;  4EVI A;  2DFI A;  4MNU A;  2PX9 A;  4L5E A;  4Q4Z F;  4A0Z A;  2FE3 A;  4PJ0 C;  2EZL A;  3AG1 H;  1RPW A;  5AON A;  1X1D A;  4QSH A;  3A03 A;  3LSI A;  4M3F A;  4RAG A;  3GLL A;  4LLG F;  4UUV A;  3DBH B;  5D8K B;  2CW7 A;  1SAU A;  3CUQ B;  4L9N A;  1ZGA A;  4HV6 A;  4UHT A;  5D6F A;  2OCE A;  1R7J A;  2QBY B;  4EJV A;  3BY6 A;  1K4T A;  4EV0 A;  2H8R A;  3I54 A;  3QOP A;  1S7A A;  1T95 A;  2HDW A;  2KJC A;  4RDU A;  5KK1 A;  3BPV A;  3DV8 A;  4XIC A;  1G4D A;  1U78 A;  1KYW A;  1UJ8 A;  2LKP A;  3REO A;  3RZD J;  4ESB A;  1ZYR F;  4CXF A;  2E1N A;  2OBP A;  2XPU A;  2EWN A;  3I59 A;  2GZW A;  2FEZ A;  4XM3 A;  2JA2 A;  2TCT A;  5K7Z A;  5D4R A;  2D45 A;  2QSG X;  2V1N A;  1GXP A;  4R1H A;  2HPI A;  5CYV A;  2XV4 S;  2ELK A;  4YG2 F;  3GTM J;  1O57 A;  4ZJZ A;  3G3Z A;  3M1E A;  2XKO A;  2VXD A;  2DQR A;  5AIQ A;  2M2E A;  5E79 C;  2CSO A;  4C2U A;  2RAE A;  2K7L A;  1Z6R A;  4CDG A;  2DA2 A;  3BR6 A;  4HNT A;  3FHN A;  2VB6 A;  1DPR A;  4AM3 A;  2WAQ N;  4KJZ A;  2JK3 A;  4XLA A;  1LJ9 A;  4XKW A;  4GDF A;  3SFZ A;  3VOD A;  5DYM A;  4A3D J;  2OTJ I;  3S3O A;  1EH6 A;  3H0G J;  3OV8 A;  3GFI A;  1WFX A;  3ZPL A;  1W5T A;  2M4K A;  3CJQ B;  5CQE A;  5HNF A;  4CH7 A;  1JJ8 C;  3BCA A;  4KIC A;  1YRN A;  1DQU A;  1QGP A;  1G59 A;  3B73 A;  4ZH4 F;  4XLE A;  4A3B J;  1W7P A;  3MVP A;  5DCM B;  2HTS A;  1X2M A;  3QU3 A;  3N97 A;  2NVQ J;  5BOX A;  3R61 A;  1U8B A;  2L01 A;  3EYY A;  2F5C A;  3IRR A;  4BDY A;  4X0G A;  1QA6 A;  1SFK A;  3ZP5 A;  3UNG C;  2V9K A;  2QQ9 A;  1QHH D;  2GIZ A;  1BW6 A;  1U9O A;  3HG9 A;  3PQJ A;  2E2J J;  4YEL A;  2QYO A;  2ZSI B;  3A0B C;  2CWE A;  3UR3 C;  3E5Q A;  1DP7 P;  2Q0O A;  4AYB A;  2VE9 A;  1MJ9 A;  3LA2 A;  1A6I A;  3U9G A;  2QKL B;  4XKC A;  3C18 A;  2P5V A;  2WWY A;  2OQR A;  2K9S A;  1FMV A;  2DMQ A;  5KAI C;  4IL6 C;  1B59 A;  3KEQ A;  2XAH A;  3CZ6 A;  4IOC F;  1ETY A;  3F8N A;  3ZQF A;  5LEJ A;  4OIP F;  3H36 A;  2M4G A;  2E1C A;  3B6A A;  1BIB A;  3CO7 C;  2HQA A;  2Y48 A;  2BZT A;  3CUQ A;  4HX4 A;  4P5O A;  4PJM A;  4A3M J;  2DK8 A;  2QBY A;  3KZZ A;  5DUI A;  2O8K A;  3A4C A;  2FMY A;  1PP7 U;  1LQ1 A;  2QLZ A;  1DUX C;  1ZG3 A;  3EUH A;  1VFC A;  1VQ4 I;  5FGM A;  1FY7 A;  4PSX A;  2P6T A;  3H92 A;  3CCV I;  4CCN A;  2ESH A;  4C2M J;  2CUZ A;  2M5W A;  4MGR A;  1EH7 A;  4U88 A;  3OY9 A;  2DYS H;  3DTI A;  3L2R A;  3O8H A;  4IX7 A;  3OIP A;  2HZT A;  3LQR A;  4NDL A;  1JE8 A;  4ON0 A;  2A07 F;  1XD7 A;  3ERE D;  4BE1 A;  1IV8 A;  1W36 D;  1Z3X A;  2DYR H;  3G2B A;  2WB1 N;  1Z91 A;  2VKH A;  1T56 A;  3O3K A;  2B7E A;  2G9W A;  1B1B A;  3C1D A;  1USS A;  3KX2 A;  1D1A A;  2XAF A;  1LFU P;  5L3C A;  3IKV A;  3KLN A;  5E3N A;  3LSG A;  3S2W A;  1U8R A;  4UB8 C;  2W82 A;  2NVY J;  2VT2 A;  1R58 A;  3VPR A;  2QSH X;  5BPI A;  3T1B A;  1T0F C;  3I4M J;  2HYF A;  2NS7 A;  4PGH A;  5EGO B;  2HFH A;  5J6X A;  5M3F J;  2ZB9 A;  4WF2 A;  1DU0 A;  4IHT A;  2O0Y A;  2DI3 A;  2VOP A;  3HIF A;  2MG4 A;  1YJW I;  1HW2 A;  3DLA A;  5DCM A;  4NHJ A;  1S9H A;  3E6B A;  1ZHF A;  4C2T A;  1SVM A;  1IN7 A;  1D5Y A;  3VYT B;  4B4C A;  1TP4 A;  4KT5 C;  4RB3 C;  3JRH A;  2R93 J;  5TJJ A;  2WV1 A;  2XKP A;  1FJL A;  2FBI A;  1G3S A;  3OYM A;  3FIW A;  1YFH A;  3LA7 A;  2WAF A;  1WRJ A;  2ELH A;  1R1T A;  2M7B A;  2VBY A;  4ZDO A;  2MAB A;  4OWR B;  2DOD A;  4JK1 X;  4GFB A;  1T38 A;  4RAZ A;  3SYT A;  1W0U A;  1NG6 A;  2BXY A;  2KDZ A;  5HDG A;  1IG7 A;  1BA5 A;  5EG0 B;  3CC2 I;  1D8J A;  2L5Q A;  4BGD A;  1UHW A;  1VQP I;  4WXH A;  3EUH C;  1JTX A;  5FKO A;  3U1D A;  3T0Y A;  3BRO A;  2HR3 A;  3E3V A;  1WVR A;  1G8X A;  3OYL A;  3RI4 A;  3EUA A;  4FET A;  3BR3 A;  2NXN B;  3DEW A;  4GYG A;  1JKR C;  2IW5 A;  3C2H A;  3OYC A;  3I64 A;  4XNF A;  2JVH A;  2STW A;  4MTE A;  3ZQL A;  1YQA A;  1MDM B;  4D0P A;  3HL2 A;  1X19 A;  2IBD A;  2VC1 A;  5FD5 A;  5JLX A;  1VQ6 I;  3PSF A;  2Z99 A;  4A93 J;  2PG4 A;  2DBB A;  2K86 A;  4BY1 J;  2QQA A;  1W1W E;  3BR2 A;  3CLQ A;  3J81 Z;  1IW7 F;  2YX4 A;  2CMP A;  2OPT A;  5J40 A;  5IP7 J;  3P9K A;  3AL0 B;  1TWA J;  2A61 A;  2KT0 A;  3G1O A;  3JCU C;  4JOM A;  3CDI A;  3OYN A;  1Y0N A;  2L54 A;  2COM A;  3BOQ A;  1IGN A;  1SFX A;  2M45 A;  4GCV A;  1Y1W J;  4LLN A;  3ZQQ A;  4L18 B;  2DDA A;  5H2F C;  1D5V A;  1V4R A;  1KQ9 A;  3KP4 A;  1K6Y A;  2F48 A;  3H0D A;  1L0O C;  2PMZ A;  2K3F A;  1ZEL A;  3GTL J;  5EGO A;  1AA7 A;  4IZZ A;  3C3W A;  5CPR B;  4XBF A;  2XC7 A;  5TIS C;  1RNL A;  3W2V A;  3A1Y A;  1FOK A;  2X6Y A;  5J4V A;  2XGC A;  3M3Y J;  3R0A A;  4HV5 A;  2KIQ A;  2PQ8 A;  2STT A;  4IPA A;  2BGC A;  4ZZL A;  1ACI A;  2I5U A;  3FX3 A;  2DA7 A;  4L9T A;  4MO7 A;  2DMP A;  2X6O A;  2ZJP F;  2R5Z B;  1LDJ A;  1HBX G;  3RKW A;  4QWQ A;  4HAM A;  3W6V A;  5LRS A;  5EEG A;  2QEN A;  3WG9 A;  3BG9 A;  2UZK A;  4RAY A;  5HDK A;  3CQZ J;  1S6L A;  3J7A O;  1IZ1 A;  2WV0 A;  1JKO C;  2W57 A;  4G6Q A;  4U0V A;  4YRV A;  4I02 A;  1S29 A;  4HDV A;  3FWE A;  4RBO A;  1MND A;  2F4O B;  2VT3 A;  5TGT A;  1POG A;  2EFP A;  1I50 J;  4ZYH A;  4CCM A;  3KP3 A;  4F91 B;  5L3E A;  6PAX A;  3GTP J;  5IYB J;  3D5R C;  2RV8 A;  4E7L A;  1WHU A;  3H5A A;  1ETV A;  2L9V A;  4I6Z A;  1H89 C;  2MH2 A;  4PK4 A;  4UUS B;  1QPI A;  2MW8 A;  4NNJ A;  4A3I J;  2EK5 A;  3L2W A;  2KRH A;  2L9S A;  2VQL A;  1PJR A;  4KFC A;  2DOE A;  2ECB A;  1WJD A;  4EEF G;  2R7D A;  2K4B A;  1S8N A;  1IDZ A;  3T5X A;  2MYS A;  3F3X A;  3IH3 A;  1FSE A;  3V42 A;  5HOO A;  3K69 A;  2KRC A;  3CCU I;  1ZR4 A;  5K1Y A;  3OS1 A;  1F43 A;  1ZN2 A;  3NEU A;  1MDM A;  2NNN A;  2JRM A;  3K2Z A;  2JVG A;  2VKV A;  1B72 B;  4WXD A;  3LOC A;  1D0Z A;  1N25 A;  2FRH A;  2GXG A;  1AU7 A;  2P5L C;  2DTR A;  2M8E A;  3WHC A;  4DIQ A;  3FXK A;  2EFO A;  4RGU A;  1ZG1 A;  4DYC A;  5ILS A;  2LG4 A;  1MBF A;  3J7Z I;  2GOX B;  4IRG A;  4JX6 A;  4DBQ A;  5CVU A;  3GX4 X;  3BR0 A;  4G6T B;  3SHF A;  4DGW B;  5E17 F;  2PN6 A;  3KZY A;  2QKM B;  2EA4 A;  4KIT B;  3K70 D;  4LIT A;  3Q5F A;  2GA2 A;  4RM2 A;  2L3D A;  3DBR B;  3H3U A;  3FHZ A;  2Z9O A;  3GUD A;  5FLX K;  5GPA A;  2W25 A;  3DQV C;  1RR8 C;  1DU6 A;  3H3Z A;  3SZG A;  1TLH B;  1PUF B;  4EJW A;  3ZN1 A;  2G0E A;  4LG0 B;  2M0M A;  1YS7 A;  3K4B A;  3ZMV A;  2R7O A;  1G6N A;  5FKM A;  4QPO A;  5ILU A;  4H0E A;  3LSK A;  3H5R A;  1HCR A;  1ON2 A;  1W7P D;  1VND A;  4RMN A;  2AQE A;  3HZJ A;  1OCR H;  2AQF A;  3G6E I;  3CF5 F;  2OCC H;  1K7A A;  2NVX J;  2DLL A;  3DF8 A;  3U21 A;  1TQM A;  2VBW A;  3ECH A;  2DTZ A;  3K4K A;  2VIX A;  4E70 A;  2JA5 J;  2V6E A;  2A3S A;  1U9N A;  3S8P A;  3CES A;  4EM1 A;  3PUF A;  4UUS A;  4KIS A;  4NQW B;  2EV0 A;  3D1N I;  1OPC A;  4OIN F;  4UVC A;  1UFM A;  5GP9 A;  5HS9 A;  3QRF F;  3CCJ I;  3SXY A;  1JUS A;  2RDP A;  2L4A A;  2Y9Y A;  1T2K A;  2Y30 A;  5B5E C;  3F8C A;  2L9R A;  1QRY A;  2NS0 A;  1Z6T A;  1B6A A;  2ZXJ A;  2JN6 A;  3WGI A;  2HGC A;  4S04 A;  4J00 A;  4UB6 C;  3MMY B;  2TRT A;  3HSR A;  1B72 A;  5DUK A;  4PFP A;  1XGS A;  4O6J A;  3AL0 C;  1XMK A;  1OCZ H;  3HGY A;  3SZT A;  3FXO A;  2EBI A;  4HSR A;  2V6C A;  2XRN A;  2E71 A;  2AXT C;  4FQG A;  1X1B A;  4HA8 A;  3PUB A;  3OIQ A;  2EV6 A;  3H9J A;  3HRM A;  2H09 A;  2XB5 A;  1B9M A;  1S7O A;  4LB6 B;  4I0B A;  3ZMZ A;  1O3Q A;  5IP6 A;  4ZDP A;  4AYB N;  5IYD J;  3WGH A;  3L2V A;  3PL8 A;  1YLF A;  3I3L A;  1GDT A;  5LGN A;  2CU7 A;  2BYV E;  2G7H A;  3JW4 A;  4B43 A;  1OCO H;  2F4I A;  2BVL A;  2KP6 A;  1IRF A;  4A3G J;  2EIM H;  3LAJ A;  1Q1V A;  1ZRF A;  2VPR A;  3H5N A;  3K2A A;  3U2R A;  3HYI A;  1MSE C;  3GXO A;  1ETK A;  3L7W A;  2DA1 A;  4XSX F;  1M1E B;  5IP9 J;  3QPS A;  1PUF A;  2DA3 A;  2ECC A;  3GEZ A;  4LMY A;  4LG0 A;  3MKW B;  1RIO H;  3LWF A;  1QHG A;  4X6A J;  4U87 A;  1Z0X A;  5DDG A;  4BUP A;  2ESN A;  3CLO A;  1NG7 A;  2Q1Z B;  2JA7 J;  2VLA A;  4I76 A;  1MNM C;  1I3Q J;  5F1R A;  3W6J B;  2HDD A;  5IOY A;  1IO2 A;  2N8G A;  3A0H C;  4M3G A;  1SD5 A;  1Z67 A;  2LOO A;  1W36 C;  2A5Y B;  1CGP A;  2FSW A;  4C3H J;  4OIO F;  5ICC A;  3KYC B;  3JSP A;  2IA0 A;  4EM2 A;  4E7K A;  1MKM A;  2VQC A;  4NQW A;  2Y9Z A;  4ZDL A;  1A04 A;  1IUF A;  1J9I A;  1YW7 A;  4AU7 A;  3F21 A;  3TOA A;  1WPK A;  1YW9 A;  1JKP C;  3DPL C;  2MC3 A;  4HOB A;  3PNT A;  2LDU A;  2Z16 A;  1HDP A;  1D0X A;  2MLG A;  4ZTJ A;  1TZL A;  1TT0 A;  1QZE A;  4M9S A;  4L0Z B;  2CUF A;  3CP2 A;  3HM5 A;  4HX7 A;  1XDU A;  2Y0M A;  2K9L A;  1OFC X;  2XF7 A;  3RYP A;  2KLO A;  1MMA A;  1I1G A;  3EDP A;  1J2X A;  3MZ8 A;  4YFK F;  2JQ7 A;  1KU9 A;  2FA5 A;  2FQ4 A;  2LY1 A;  3IV5 A;  1WH7 A;  4KUM A;  4UVB A;  4A3E J;  2XIG A;  1GXQ A;  5E1W A;  4RS8 A;  5B1B H;  3TW7 A;  5A2Q K;  1ZLK A;  4HBL A;  1PDN C;  3BQZ A;  4IVN A;  3SDB A;  4O5V A;  1FIA A;  1LB2 A;  2XHK A;  3HC7 A;  1XX5 A;  1X1C A;  2DPU A;  5E3O A;  4UV8 A;  2ZXW H;  3DEE A;  5J1U A;  2LYC A;  2P8T A;  1VQL I;  1KON A;  4Y15 A;  2W84 A;  2JA6 J;  4FIS A;  4RGS A;  3F8M A;  2VJ4 A;  2FXA A;  2BY2 A;  1OKR A;  2VXZ A;  1MBG A;  2PEX A;  2H94 A;  4I98 B;  1QQI A;  1VQM I;  4KN4 X;  1GUU A;  2OF7 A;  2R7F A;  3GZ6 A;  1DGW Y;  3JRA A;  1MBJ A;  2GLO A;  2WA0 A;  2HKX A;  1WI3 A;  1IN8 A;  3ERM A;  3ZOB A;  2QA4 I;  4A12 A;  2L7M P;  5EYR A;  5LRR A;  2BE5 F;  1E3O C;  4D7M A;  2F6C A;  1JT0 A;  2DFE A;  1UMQ A;  2E7X A;  3ZGK A;  2LY2 A;  3GLX A;  1E2X A;  3FF5 A;  2MSY A;  3IWF A;  3BJO A;  3K4J A;  4II3 A;  4IEJ A;  3QYF A;  3BZC A;  3RPU A;  2QEX I;  4A3J J;  2XRL A;  4GYI A;  2K5C A;  4B47 A;  3MKL A;  4KNY A;  3HDD A;  2IA1 A;  1YG2 A;  4CYD A;  3V4G A;  1IRG A;  1MH4 A;  4HF1 A;  3WTU C;  4KT6 A;  2EZK A;  3DWL E;  2Q2E B;  1EF4 A;  2RVC A;  2VOO A;  3RQI A;  3PO3 J;  4RLQ A;  4DYR A;  4MHG A;  2MD0 A; 
#chains in the Genus database with same CATH homology
 1Y56 A;  4Y3O A;  4GRI A;  1S9H A;  3HOT A;  1IRX A;  1FMW A;  5CKT A;  4C2T A;  1MMD A;  3OYF A;  3VYT B;  1HA8 A;  4BAC A;  1V5G A;  2KZV A;  2V26 A;  2IGO A;  3E0J B;  4OAY A;  3OYM A;  3OYI A;  2HU9 A;  2WAF A;  2IS6 A;  4H4K C;  2CS3 A;  2M7B A;  2VQH A;  5FRM A;  3BG7 A;  1MMG A;  3OR1 C;  2VQG A;  4RM3 A;  4ZDO A;  2MAB A;  4OWR B;  3IUO A;  3PSI A;  2VKD A;  4YEJ A;  4XKV A;  3SYT A;  1NG6 A;  3DU6 A;  4Y33 A;  2KDO A;  4XMY A;  4ZC3 A;  1WJE A;  3FDY A;  3K4L A;  2L5Q A;  4BGD A;  4CCO A;  4BQN A;  2K3P A;  3EUH C;  2DCE A;  3EUK L;  4FAS D;  1G8X A;  3OYL A;  3EUA A;  4FET A;  4LIV A;  2KQR A;  3CP8 A;  2UUZ A;  2WBM A;  3VSL A;  2CV2 A;  4CSW A;  3OOU A;  3C2H A;  3OYC A;  2XAU A;  4XNF A;  2JVH A;  2WB1 A;  2R7X A;  3RQ4 A;  4F52 A;  3DU5 A;  3NWT A;  5FRO A;  3HL2 A;  2CV1 A;  1X19 A;  4XLH A;  1YX3 A;  1EA3 A;  3PSF A;  2M3A A;  2HVR A;  5HLT A;  2FUG 2;  3HXL A;  2CMP A;  3S3M A;  2HVQ A;  5LFA A;  1X1A A;  2CUJ A;  2Z2S B;  3AL0 B;  2OV7 A;  4JOM A;  1MNE A;  3OYN A;  1UEL B;  3QYE A;  2R7R A;  4PJL A;  3ZQQ A;  3SEZ A;  2X6X A;  2DJI A;  2CV0 A;  4E7J A;  1K6Y A;  2MFZ A;  3H0D A;  2PMZ A;  4LIU A;  3ZR8 X;  2A5W A;  1ZEL A;  2LBF A;  1AA7 A;  4IZZ A;  1N75 A;  5CPR B;  2WY7 Q;  3VDX A;  2XC7 A;  4BE0 A;  3W2V A;  3A1Y A;  2I8D A;  3MKZ A;  2X6Y A;  2VJ5 A;  3CJR B;  1MW7 A;  3BLY A;  2IGM A;  1YX5 A;  4BQQ A;  3DKX A;  2L7K A;  4Y4R A;  1WJ5 A;  4BEH B;  4PFO A;  4CCJ A;  3D5L A;  4DJA A;  3CMM A;  4AVZ A;  3PNV A;  3ONQ A;  3VYS B;  1Z21 A;  3K70 C;  3TBI A;  1Z7L A;  3QOD A;  3C2G A;  2XF5 A;  2VJI A;  2R7S A;  3RSN A;  3DPU A;  2E5Z A;  3ZXS A;  4YRV A;  2BW3 B;  3TMO A;  3DKY A;  3LL7 A;  1MND A;  5TGT A;  3TL4 X;  3MKY B;  1UAA A;  1U0J A;  3EPZ A;  2VPL A;  4E7Z A;  4F92 B;  3OS2 A;  4CCM A;  4F91 B;  3LFU A;  2VAS A;  1BOB A;  2WY8 Q;  3OYJ A;  3HUG B;  3D5R C;  2F5V A;  4E7L A;  2IGN A;  3H5A A;  3VWB A;  2RRE A;  3PJR A;  1DGR M;  3DPT A;  4QPQ A;  4XKB A;  4PK4 A;  2UV1 A;  4NNJ A;  3L2W A;  3K4N A;  2KRH A;  4C9Y A;  2L9S A;  2Z1D A;  3IAM 2;  4BS9 A;  2VQL A;  1PJR A;  2E60 A;  2R7W A;  4HPQ A;  2LH9 A;  3S3N A;  2JSP A;  1WJD A;  3VYR B;  4N4N B;  1D1C A;  4XLF A;  2MYS A;  3OMY A;  3V42 A;  5HOO A;  4HG2 A;  2KRC A;  4HEA 2;  3SEQ A;  4F55 A;  3OS1 A;  2LC2 A;  5LD2 C;  4PSW A;  4C30 A;  3LMM A;  2JVG A;  2IS2 A;  4XON A;  1D0Z A;  1LDK B;  4DBR A;  4ZTF A;  2RQQ A;  2HVS A;  2RNG A;  1WJA A;  3VSK A;  3L2U A;  4DIQ A;  2VL8 A;  2HZD A;  2ELJ A;  2DT6 A;  3H35 A;  5CQG A;  2ZXI A;  3BC8 A;  3IAS 2;  2IXS A;  4E7H A;  2LG4 A;  5KHD A;  2GOX B;  3J7A Y;  4BDZ A;  1X4P A;  4DBQ A;  4N4O B;  4G6T B;  1JI8 A;  3K4C A;  3LSH A;  4DGW B;  1OR7 C;  2IS4 A;  2Y0S A;  1N78 A;  2X51 A;  3I9V 2;  2QKM B;  4KIT B;  3K70 D;  2WAD A;  4LIT A;  4RM2 A;  2ZXH A;  2DOA A;  3A2K A;  5KNL A;  2P0W A;  4XR6 A;  4BEH A;  4EAT A;  3DQV C;  3L2Q A;  2W1O A;  2OC6 A;  3SZG A;  2K9M A;  2KPM A;  2W4S A;  1QU3 A;  2BOL A;  1ERD A;  2M0M A;  3K4B A;  3NWS A;  4NUB A;  4CCK A;  4BE2 A;  2R7O A;  3OYA A;  4E7S A;  2XSJ C;  2KMU A;  3N05 A;  4QPO A;  2BW3 A;  3H5R A;  3LSK A;  1UG0 A;  3OL3 A;  5HVQ C;  4RMN A;  4CZC A;  1X4O A;  3BG6 A;  2AQE A;  3QOE A;  4II2 A;  2X6W A;  2AQF A;  4D9J A;  4IQJ A;  3U21 A;  4JQF A;  2DXI A;  1OLT A;  3AKZ A;  3K4K A;  4IKF A;  2VIX A;  2A6T A;  2V6E A;  2R7T A;  2CH0 A;  3S8P A;  3CES A;  1LVK A;  2O5R A;  4KIS A;  4B48 A;  4NQW B;  2X1E A;  2LRD A;  1PYV A;  1MMN A;  2X1D A;  4R79 A;  3OYD A;  3FBN B;  3OYG A;  3F9K A;  4RLF A;  3RTR A;  1Z3Y A;  2R7Q A;  4PUS A;  4U7B A;  4BU2 A;  2V4J C;  3OWT A;  2M7A A;  2BVM A;  3OS0 A;  4XQF A;  4BJ5 C;  2GOM A;  3DTK A;  2R7U A;  1WJC A;  4J00 A;  2E1M C;  4E7I A;  2X85 A;  4HNU A;  3MMY B;  2XF6 A;  3LSM A;  3PNY A;  4PFP A;  4ZYA A;  3MD2 A;  4BJT A;  3AL0 C;  4HRI A;  2X1C A;  4XLC A;  1D0Y A;  4MLO A;  2KHM A;  2L9N A;  4XOR A;  4HSR A;  2JUG A;  1V5F A;  3HPG A;  1X1B A;  1V5E A;  1LFP A;  2XDV A;  3PUB A;  3OIQ A;  3H9J A;  3FBI B;  1X1D A;  4XN3 A;  4XN0 A;  3FKJ A;  3K10 A;  3LSI A;  4ZDP A;  5HNH A;  3L2V A;  3PL8 A;  2CW7 A;  1SAU A;  3I3L A;  3KYL A;  2R7V A;  2UWM A;  4B43 A;  4DOZ A;  2F4I A;  2BVL A;  2KP6 A;  4LG3 A;  3RPU D;  2PJR B;  1T95 A;  2HDW A;  3ZRG A;  3AFH A;  3H5N A;  1WJB A;  4PJJ A;  4CUG A;  4BXF A;  2VJJ A;  3M8J A;  4XM3 A;  2JA2 A;  2V1N A;  3H9G A;  2HNH A;  2HPI A;  3VYU B;  3MKW B;  1QHG A;  4U87 A;  4ZJZ A;  2L2O A;  3OYE A;  4BUP A;  2VXD A;  4PJN A;  1NG7 A;  2Q1Z B;  2MC4 A;  3HPH A;  4C2U A;  2VLA A;  2IGK A;  3OYH A;  3GBG A;  4HNT A;  2OUM A;  3FHN A;  2VB6 A;  2LOO A;  1BR2 A;  1W36 C;  4OAZ A;  2KL4 A;  4KJZ A;  4XLA A;  4XKW A;  2ZFU A;  2IS1 A;  4B3X A;  1LKX A;  3PFY A;  3OYK A;  4E7K A;  3S3O A;  3OR2 C;  1WFX A;  2VQC A;  3IP4 B;  1VZ0 A;  4ZDL A;  2M4K A;  3CJQ B;  3W3C A;  4AU7 A;  5CQE A;  5HNF A;  3HKZ A;  4CH7 A;  4F3Q A;  3BCA A;  2DT7 B;  4IQ4 A;  1DQU A;  1G59 A;  1BR1 A;  3DPL C;  4XLE A;  3PNT A;  2Z16 A;  1D0X A;  3S93 A;  4ZTJ A;  1TZL A;  1TT0 A;  3CP2 A;  4BDY A;  4X0G A;  1SFK A;  2K9L A;  1E0E A;  3UNG C;  2XF7 A;  1J09 A;  1QHH D;  2V9K A;  4XL9 A;  2KLO A;  3HG9 A;  4E6K G;  1MMA A;  4YEL A;  2LY1 A;  2ZSI B;  3RCO A;  3UR3 C;  5FRN A;  4NC8 A;  1R6R A;  4AYB A;  4NC7 A;  4B44 A;  1BR4 A;  5JHF A;  1DP3 A;  2E1M B;  2QKL B;  4XKC A;  3SDB A;  1FMV A;  2W7N A;  3HC7 A;  2R4G A;  3CZ6 A;  1X1C A;  2V7F A;  3K6G A;  1GLN A;  1YE9 A;  3DEE A;  2LYC A;  2M4G A;  2HPM A;  1KON A;  3QYB A;  2HQA A;  4PJM A;  4P5O A;  4BJ6 C;  2E5N A;  2VJ4 A;  1WJF A;  2VXZ A;  3HOS A;  3A4C A;  5KCM A;  4BL0 B;  2PJR A;  4D1Q A;  4PSX A;  4CCN A;  2CUZ A;  4P1W A;  1DGW Y;  2ZSH B;  3KEY A;  4F93 B;  3OY9 A;  3BCB A;  2WA0 A;  3DTI A;  4ANJ A;  3L2R A;  4IX7 A;  2WAE A;  3OIP A;  4HST A;  3M1C A;  3E1S A;  2CFO A;  2WAQ A;  3OYB A;  2F6C A;  3W2W A;  4BE1 A;  1W36 D;  1Z3X A;  3ZGK A;  2LY2 A;  3CF2 A;  3OL4 A;  2W00 A;  3G2B A;  3S32 A;  3DTE A;  3H9Q A;  2VKH A;  3K4J A;  4II3 A;  3QYF A;  3KX2 A;  1D1A A;  2K5C A;  2CW8 A;  4B47 A;  3LSG A;  4J01 A;  4XOT A;  4CA0 A;  3ZCO A;  2NOJ B;  3K4M A;  4E4H A;  2W82 A;  1P9Q C;  1N77 A;  2LRE A;  1T0F C;  3D5S C;  4ITV A;  2LBF B;  4KT6 A;  3DWL E;  2Q2E B;  1D1B A;  3W2A A;  4RLQ A;  4XOP A;  1Y6I A;  3DLA A;  4CCL A;  2MD0 A;  4BQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...