1WJDA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, 38 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 16
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjdA00
1MW7A 1E0EA 1LFPA 1WJEA 3F9KA 3HPGA 4F3QA 1K6YA 3HPHA 1KONA 1WJDA 1WJFA 1WJCA 1WJBA 1WJAA
chains in the Genus database with same CATH superfamily
1LKXA 2MGQA 2Y9ZA 2KL4A 4EJOA 3B02A 1GXPA 4PJLA 5ICGA 1A6IA 4IPAA 1EH8A 1V5EA 5H6QA 5D5WB 3IRQA 1JHFA 2NRAC 2FOWA 2EIKH 1XTAA 1J09A 1OYYA 2Y0MA 3S2DJ 1TW3A 2HDWA 3VYTB 2OBPA 1FTTA 3S3OA 4RS8A 1ZRFA 2DT5A 2GOXB 3P9KA 4MNUA 2ZBKA 1T8IA 4L18B 1R4NB 3Q5FA 1XGNA 2M8EA 1E3OC 3MZ8A 4L9VA 5LEKA 5DV5A 5LEJA 2DA5A 2EZIA 2R7RA 4CGZA 2D1VA 2LOOA 4BL0B 4ZYDA 1X4PA 1V5FA 3PSIA 2N8GA 2ZXHA 3CCQI 2KHMA 1YJ9I 4AC0A 3EQLF 2EFWA 1IV8A 3FIWA 2I5UA 2WAFA 3I58A 1F9NA 2MG4A 1JHHA 3SHFA 3DXJF 3JSOA 3RYPA 2OF7A 3ONQA 3J80Z 1DPRA 2JA2A 3TOAA 3CCJI 3BTJA 4N4NB 3ASNH 2PEXA 1HC8A 2OCEA 4E70A 2FOKA 4DYQA 2R3SA 4BEHA 3CCEI 2FQ3A 1XGMA 2HOAA 1MBEA 5IPAA 2ELHA 1ONVA 2BW3B 2L9NA 3BR6A 4CO8A 1Z67A 2LKSA 4WXCA 3BDDA 5HLHA 2DOAA 2WC2A 3CZ6A 2NAZA 4O6JA 5D4SA 1LEBA 2EA2A 2VE9A 2GA1A 2L7ZA 1FYKA 3KIOA 4RAZA 2EFOA 3K2AA 2F4IA 1ZRDA 4RAGA 4E4HA 3A01A 1W5CC 3K1MA 1FJLA 1VQNI 4B44A 1XGSA 2BXYA 2F4OB 2GIVA 2MH9A 4AWXB 2VPRA 2Y69H 4V2GA 4RB2C 1GHCA 2WY8Q 3CTAA 1HXDA 3A02A 1Y39A 3DCFA 2P7CB 2F5VA 2ACJA 4MEXF 2HYFA 1I1SA 4UUSA 5TRDA 4OAYA 4RM3A 5FRNA 5HS9A 3V4GA 3WGGA 5M3FJ 1QHHD 3BG6A 1WJ5A 1VQ7I 1UHSA 3BPXA 1T08B 2VKHA 3D0SA 4U87A 4Y13A 2XKOA 3DLLF 4X1EA 3GTLJ 3FHZA 1RKWA 3I53A 1RI7A 5LRRA 3OYFA 1GVDA 1FOKA 2R7OA 3ZGKA 4QTRA 2QQ8A 1QZEA 5DUKA 2P81A 2K4BA 4G6TB 1VQ6I 4M3FA 5IT9K 2IXSA 3RZDJ 2GZWA 1IRZA 3FZVA 2LBFB 1JT6A 5L3DA 4BU2A 1ETXA 2PN6A 2W48A 1X1AA 5HODA 3A2KA 2A6EF 1TT5B 2CU7A 1A31A 2DDAA 2C6YA 5HDNA 3O8HA 3TW6A 3F8NA 3JAMK 4ZTJA 2D2WA 3MCZA 1U5TA 1MMNA 3K70C 2XUBA 2ZSIB 4BAYA 1WI9A 4XRSG 3SEZA 5KAIC 2F5DA 3HTUA 4U0WA 2WBMA 3K0LA 3J80K 1ZTRA 3JRAA 1EA3A 1R5ID 3HIFA 1X19A 4HRIA 2W85A 2FE3A 4OWRB 1H9GA 2RQQA 4M3EA 4UVCA 3MKYB 3GEZA 3L2UA 4M6XA 1KU7A 3BC8A 1WHUA 4LIVA 2VKDA 2AS5F 1AKHA 4HAMA 4S0HB 4DJAA 3KETA 5ILVA 4X0GA 2M4KA 2NVXJ 2VT3A 2VUMJ 2FBIA 4IX7A 2QKLB 2DFHA 4UV9A 1BBYA 2DPUA 2KKOA 3F8CA 4EM0B 2XPVA 1P4XA 4BQOA 1ON1A 4HLYA 3WE3A 3DBHB 3M9AA 5EGOA 3IH3A 2B63J 1Z7LA 3DTEA 2JRMA 1FY7A 3V8KA 1ORKA 3ABTA 3J81Z 3G2BA 1V55H 2BYVE 2HKXA 1MNDA 1F4KA 2EFPA 5FFXA 3W6VA 1MSEC 2HWVA 3O2PE 2QCOA 5IY5H 1LPQA 2QBYA 1TQMA 4JBAA 1VQ4I 1I1GA 4IZZA 2LH9A 3WHBA 3V7CA 2FJ1A 2DA4A 3W6KB 2GOMA 4JP0A 2R5ZA 2DMNA 1R5GA 4NNJA 1HA8A 1G2HA 2ME0A 4LLGF 1U5TC 2JA6J 1S7AA 1BM9A 3L00A 2XGEA 2CV1A 3DKWA 4R8HA 3GTGJ 1E2XA 4WF2A 5M5YJ 1ZG5A 2F5CA 4I01A 2L9RA 2Z3YA 1IDZA 4Y33A 2Z9OA 1EH6A 1ZK8A 1BI2A 3U2RA 3ASOH 2LP0A 2QVOA 1FZPB 3CUQA 4Z2YA 4NQWB 1ZH5A 4IVNA 1D1BA 2XPWA 1NHAA 3G1LA 2PJRB 4HNUA 1YRNB 3L9FA 3RTRA 3LSPA 1LVKA 5M5WJ 3SDBA 3OR1C 1K78A 1QPMA 1D3YA 5D5VB 3J7AY 1DU6A 3RIRA 3WE2A 1LDDA 3RDIA 4IO9F 2AO9A 3AG2H 1U78A 4XMYA 1AOYA 3C7JA 3K1NA 3DKXA 1BIAA 3QYEA 3MVPA 3ZCOA 1O3TA 2O5RA 3H5AA 1BI3A 3ROUA 2CS3A 5HDKA 4HDVA 2DXIA 1FMVA 4G12A 2HNHA 3AG1H 5EG0B 3HG9A 2DFIA 5LFAA 4G7OF 1YS7A 3MWMA 2IW5A 4EM1A 5FKOA 3VEPA 3O3KA 2Y0SN 1G4DA 5HLIA 1S5LC 4F3QA 4E7ZA 5B5EC 3EYIA 3WU2C 4WCGA 5FGMA 3CQZJ 4PJ0C 4I76A 4GCVA 2LNBA 2HVRA 3E7LA 2L9VA 1TQIA 2V26A 1QPIA 4XKVA 4QPQA 2IP2A 2PMUA 4RGUA 4P55A 2CW7A 2KDZA 2KIMA 4F92B 3J81K 1FIPA 3DP7A 2R93J 1LDKB 3K4KA 3Q3SA 4A3CJ 2L54A 1M1EB 3CUQC 3E6MA 4LG3A 5ILUA 1ZLKA 4EJTA 5D6EA 2TCTA 4ZTFA 3ZN0A 1BW6A 2LY9A 1OCPA 2PI0A 1NH3A 2CYYA 1O57A 1WCMJ 3DQVC 3GTPJ 3QP6A 2Q8KA 4ESFA 4OIRF 4LB5A 3BR1A 3MKLA 2H94A 2Z99A 3K4LA 1VI0A 3NEUA 3FXMA 5JFRA 1B6AA 2K9SA 3J7AO 1N25A 2L0KA 4OIPF 2UXNA 2AHQA 4IHVA 1MKMA 1B9MA 4AYBN 2V1UA 3FXKA 2PJPA 1WKMA 2EFNA 3CMMA 3OOPA 4HW0A 5M5XJ 4HOBA 2MLGA 4IQ4A 2K9MA 5BPIA 4KMFA 4GDFA 4WX9A 4CHUA 4ZJZA 5L3BA 2IS6A 4EATA 2ADUA 2QSGX 3GLXA 4ENJA 1IZ1A 1TWGJ 2K3PA 4B43A 4HA8A 1VQMI 1MJ9A 2L2OA 1SMTA 3IC7A 4PGGA 1IRXA 3KX2A 3I64A 3C3WA 2Z33A 4PZJA 2R0QC 4XN3A 2IS2A 3H1CA 1RC9A 3PQKA 2V9PA 2HYJA 5KVRA 3GFJA 4XRMA 4E6KG 2PG4A 1H89C 3MZYA 3OIPA 1RZ4A 2DA7A 2ZMEB 1W7PA 4KFCA 4CCMA 3IAM2 3SZPA 5FROA 4JK1X 3BZCA 1FOXA 3TOBA 2FNAA 3IAS2 1USTA 2NNNA 3HOXJ 2E7XA 1B8IB 4UUVA 1HKSA 4CICA 1Z21A 2GAUA 2FRHA 1KQ8A 2EINH 2LYCA 1I3AA 2EZLA 4I2OA 3J7ZI 3W2VA 2CUEA 4EEFG 1V4RA 3PNVA 3KP4A 3CCRI 3N4MA 2L01A 2VQLA 2F5EA 1PYVA 1S3JA 5JVTA 2VKEA 3D5LA 1ZR4A 4OMYA 1VTNC 1S72I 1O4XA 4KN7X 3JRBA 5C4XJ 1IG7A 2VC1A 1TWCJ 1B72B 3TP0A 1R58A 2CH0A 3FXOA 3K69A 4BGDA 1REPC 2M4GA 1ZG3A 3H35A 3BLYA 3EUKL 1P2FA 4A3KJ 4XOTA 3MAJA 1KGSA 2ZFUA 1ZGAA 1TNTA 2QEXI 3VYSB 2ZJQF 2E34A 2ZJ2A 4II2A 1FBQA 3KLNA 3DTIA 3JW4A 1WRJA 4L5JA 2DT7B 2D45A 2FF4A 1D5YA 1BN5A 3RPUA 1KYZA 3S3NA 3HOWJ 4M71A 1O7LA 1OFCX 1LJ9A 3KZIC 1BC8C 3BQYA 3H9JA 3R61A 1MMDA 1TP4A 4ESBA 1MBJA 1XMXA 1A36A 1FPQA 2P5VA 1G3YA 4NBQA 5E17F 1PUFA 4CZCA 5K7ZA 5K5RA 2QENA 2CV0A 1IW7F 2RDPA 4ENMA 3F0CA 4OAZA 5F0CA 3ZQ7A 4BS9A 2HQ5A 4QIWN 2CV2A 3OYJA 1E3PA 2OPTA 4RGSA 4P9UA 5LRSA 2V7FA 1XS9A 1G3SA 3IKVA 4HLXA 3T5XA 3E97A 4XLCA 3G1MA 5ILSA 5DD4A 3HRMA 2BY2A 1S8NA 2KRFA 5AIPA 5KCMA 3PO3J 3FF5A 4CUGA 4S04A 3LNQA 4A3FJ 4IRIA 3S1RJ 2JT1A 5ICCA 2DU9A 3S2WA 4RAFA 2I8DA 4XK4A 3OR2C 3ZQQA 1FIAA 3KZZA 3GMEA 4YFKF 3ABMH 1YFHA 3W2AA 2K4JA 1ETYA 3PL8A 4C3JJ 3HPGA 3BTCA 3M8FA 1YW9A 2M7AA 1S7OA 2HQNA 2DK8A 2OCCH 2M7BA 3LA3A 2JRTA 5CQEA 2HTSA 3OIOA 4LB6B 4BKXA 2ELKA 1Z05A 2PFBA 1JE8A 4KIGA 2V4JC 2ID3A 3C18A 4C30A 3IH4A 3KE2A 3SEQA 1AHDP 4MO7A 1CF7A 3E5QA 3FBIB 4G94A 4B8XA 1PDNC 2ZO4A 2MBFA 4A0YA 2D5VA 1P6RA 4BE2A 1U6GA 4FX0A 3Q0UA 2DTRA 4RB3C 3DPLC 3CDLA 4IOAF 4XM3A 3UR3C 2FMYA 4Y7NJ 2FEZA 5B66C 1N77A 3L2VA 5JLWA 5LHGA 1F43A 1F1ZA 4ZDOA 5H20A 1TWHJ 3H0DA 1JKRC 2EH3A 4LG0A 4E7SA 3ECHA 4LLLA 1QZZA 5L3CA 2LK2A 3F21A 1DPUA 1UHMA 5GPCA 3OYGA 2DA6A 2IA2A 2IT0A 3QAHA 2RKHA 3GTJJ 1UELB 2PMHA 3BPVA 3H92A 2EBIA 3M1EA 2DMTA 5IYDJ 3LSKA 4PJMA 4UXNA 3AKZA 3FKIJ 5DCMB 2W25A 2VJIA 3I3LA 2CQQA 2RREA 4M72A 1X4OA 3MEXA 4A2UA 2M3AA 3HHGA 5AIQA 3ZOBA 5CYVA 4GXOA 4KIFA 4GGGA 4FQGA 1ZARA 2Y2ZA 4L5IA 3V8LA 2VLAA 4FTHA 2M5WA 2H8RA 3LA7A 4BACA 2LKPA 1LE8A 4A93J 3ERMA 5K7FA 3LMMA 1ZN2A 2YX4A 3DBRB 2GLOA 3K4NA 2MYSA 1U2WA 3JRIA 3C1DA 3KLOA 1WJDA 3GFLA 5EG0A 5C3EJ 4H0EA 2ESNA 2R4GA 4PDKA 3K4BA 1KU3A 5DYMA 1FTZA 1KU9A 2QA4I 2DFFA 3ZMUA 2K9QA 1OPCA 2KPMA 1DP7P 3WTVC 1QGPA 2OA4A 4KMUX 4CXFA 2HQRA 1I6HJ 3TDUC 2M1BA 2OTJI 4E7KA 1FYLA 1Z3XA 3GFMA 3OL3A 1E0EA 5H2FC 5ED4A 1G6NA 1NG7A 3GW2A 3OMYA 3TO6A 3HGGA 1MDMA 1U0JA 3DWLE 2P5LC 2Y31A 1OR7A 3G73A 1D0XA 1R71A 1A5JA 3HEFA 3X2QH 1WGXA 5GP9A 4AIDA 2E5NA 3G1OA 3ZR8X 1SMYF 2BHZA 3PIPF 4BYYA 4EGZA 1IXRC 4JX6A 5DD8A 2P6SA 3D5SC 2I10A 3IV5A 4UB6C 1JI8A 2A69F 1XCBA 1YW7A 2DAOA 1R49A 1XX5A 2NS8A 3GUDA 4D7NA 2R5YA 4GYIA 4ESJA 1OMIA 5E3NA 4AD9A 1J5YA 1HKTA 2HZTA 3S15J 2M30A 3HB9A 1RPWA 4A5NA 4HZFA 1D8JA 2E19A 4ON0A 2KT0A 3M07A 5F27A 3OYDA 4C2UA 4C2TA 2ICWG 3QYBA 3KP7A 3WTXC 1AU7A 3HL2A 2LLKA 2XAHA 2EQRA 4D7MA 2X1DA 3HGYA 4EVIA 3MD2A 4CZZA 1MW7A 2P7VB 4PSWA 3ZMVA 2KRHA 1SD7A 4KYWA 2VQCA 5IT9Z 2AQEA 3VODA 3K10A 1T0FC 4QPOA 3BR0A 3FWEA 2MW8A 3OYKA 1O3QA 1PP8F 1J7KA 2BBYA 5LBQA 3F22A 2Z2SB 4IRHA 5L3EA 1Z9CA 1B59A 4YIFA 2YR2A 3BJ6A 3VDXA 3JAMZ 4B3XA 3CP2A 4BH9A 5IYCJ 5L3GA 1WJFA 1OR7C 1K7AA 2QQAA 2DYSH 2IGMA 3EUAA 2LTPA 3IP4B 3OYEA 2FXAA 5EDNA 3H3UA 1IF1A 2QQ9A 1TWFJ 5FB2A 4YELA 5FLMJ 2EILH 4XL9A 2JQ7A 2GA2A 2LR8A 3PNTA 2BOLA 3BY6A 3KYDB 1YX5A 3D1NI 1FSHA 1OCRH 1T2KA 1XB4A 4LITA 2XAJA 4QSHA 2NYXA 2OC6A 3CP8A 1H9TA 3QPSA 5IOYA 2W1OA 4Y17A 4E7JA 4CYCA 1TL8A 1QZYA 2ZXJA 3CUOA 4FE4A 4A12A 5HVQC 3COAC 5EYRA 1YITI 4ZC3A 3S8PA 3AL0B 1XMKA 3L09A 4XR6A 3A03A 2K9LA 5K5OA 3FXRA 4LJZF 3OS1A 3S17J 4F52A 3ABKH 2R7XA 3K9TA 2O7OA 3J7YJ 1AWCA 3GLLA 2STTA 2DI3A 2A6HF 2PQ8A 2MFZA 3HSFA 2DMUA 3H36A 4JX5A 5F04A 3JSPA 4UUTA 2EA4A 2M0MA 4YEJA 2L02A 2XGCA 3VFZA 3FM5A 2A05A 4IRGA 2R7TA 3WG9A 4IF4A 4M3DA 3MMYB 5L3FA 4RGXA 3QYFA 5FKKA 3ZXSA 2Y0SA 4EJWA 2EZHA 1MNEA 3FX3A 3HUGB 4MGRA 3I56I 3BR3A 1E3HA 1G3WA 4BE0A 1HKQA 3HZJA 2V1XA 1FOYA 4AIKA 1MBKA 2IVMA 2RNGA 3A1YA 4NC7A 5DCFA 1SFOJ 1RETA 2QM3A 3KZYA 4A3BJ 4B4CA 1GV5A 2H8WA 1XSVA 2K7LA 5CJ9A 2HTJA 4EJVA 2X6WA 2KJBA 3SJMA 2R7FA 4A3LJ 2K5CA 2KMUA 1K6OA 1QQIA 1O3SA 4LK0F 5IP6A 3H9QA 1V5GA 1TLHB 4IHTA 2VIXA 2FBKA 1WPKA 1DGWY 2MLKA 1TWAJ 2XVCA 3G3ZA 1P7JA 2V6CA 2O3FA 2EJRA 1C0WA 2HEOA 4F55A 4YFXF 1KQ9A 4A3MJ 2DYRH 3M8JA 3LAJA 3H0GJ 1FP1D 3P7NA 3VYUB 4I0AA 4AYBA 5BPDA 1JUPA 4XKBA 2P4WA 4IHXA 4GYGA 2O9LA 1RR8C 1ENHA 1Y8RB 5E3OA 3GTOJ 1BJZA 2DODA 1W5SA 2JUGA 3S16J 2BZTA 2XSDC 4RAYA 4XNFA 1VQPI 2CUZA 2JWTA 2MD5A 5GTIC 3BROA 5LGNA 2YPRA 1MD0A 3GF2A 3JRGA 2ELJA 2L9SA 2VODA 2IS4A 4PCQA 2H27A 1NK3P 3I59B 3DBLB 4YFNF 3QU3A 5F0HA 2OJED 4XKWA 5F64A 2LRDA 3LQQA 3HRSA 3HKZA 4Q47A 1RESA 2M34A 3GBGA 4KUMA 4M3BA 1YHQI 2CRGA 4IHYA 2K40A 3A4CA 1WJEA 2RN7A 4L0YB 2E71A 2O6GE 2B7EA 1GDTA 4LMYA 3HM5A 2R7QA 2DA2A 1WH7A 1WH5A 4LOCA 5E8GA 3OS2A 1ODDA 2H6CA 1Q1VA 5GADJ 2RC4A 1W0TA 5BQTA 2DK5A 2VC0A 3CCYA 3GX4X 2H1KA 3M1CA 2V79A 5FLXK 1IRGA 3OS0A 1YX3A 4RLFA 4BQNA 4IHWA 4HG2A 1FNNA 3CCUI 3IKTA 1Z6RA 2VOPA 3DV8A 4CCKA 2QZ8A 2Z5UA 2LFBA 2CFOA 1G8XA 2FX0A 3KFWX 2DMQA 5AONA 1YS6A 4XQFA 1FT9A 3LA2A 1KA8A 2E1MC 1U8RA 1D1AA 3BZ6A 2HXOA 5JHUA 4I98B 1HSJA 4PFOA 2OTLI 4BNCA 1FSEA 2E2JJ 2E1OA 4NDLA 3O6BB 1E17A 1EH7A 2ME6A 4HQEA 1IDYA 1XN7A 2JSCA 5J1UA 3BOQA 1Q1HA 3T8TA 1SVOA 1J9IA 4Z6YA 3SQNA 1VFCA 4F93B 5F1JA 1LFPA 5HNHA 2H6BA 3ZQCA 1DDNA 4W1UA 4I09A 1JJ6C 2CO5A 4ETSA 1TW2A 1SD6A 3AAFA 4PUSA 5IYBJ 1SVMA 5BMZA 2E2IJ 2V1NA 4C3HJ 4L0ZB 1H8AC 2VJ5A 4DNCA 4XLPF 3NAUA 4GFBA 3B6AA 2RNJA 3TBIA 1J2XA 4G7ZF 2QSFX 5E79C 1IN7A 2WV0A 2BY0A 5J3LA 1XGOA 2RVCA 1TBXA 4G9YA 4U88A 3GCMA 4B48A 4BJ6C 4HNVA 3LFUA 5FJ8J 2PX9A 3JRCA 1SAXA 3PO2J 2XRLA 3PIOF 2MSYA 3LSTA 2W4SA 1W5TA 2GQQA 2XB5A 4I6ZA 3HTSB 2Q2EB 3NRVA 4HYEA 1XDSA 2HYGD 1UFMA 1KONA 1YW8A 3ESWB 1MMGA 2IA0A 3TEDA 1J0RA 1VQ8I 4HBLA 4CSWA 5FD6A 2KIQA 1MNMC 4BJTA 4IQJA 2FUG2 3ZP5A 5FO5A 3HOVJ 3DEUA 1X2MA 5FKNA 3JTGA 3S93A 1S7EA 1GXQA 4G6DA 2VPLA 3OYMA 1EJ9A 1JGGA 3ZQFA 1F36A 2JA8J 3CD6I 5DM6F 4AU7A 4XLAA 3ZMSA 2K02A 2QF7A 3HSRA 1HDPA 4IL6C 3FMQA 1BOBA 4FISA 3P5JA 4B3AA 2XAFA 2QLZA 5JI6A 2GIZA 4D5FA 2M87A 2A68F 1X1PA 3F6OA 2CWEA 5FRMA 3FKJA 1R00A 1YG2A 1HW1A 2RAEA 2L3DA 3BWGA 2KIFA 3ZQHA 1MMSA 1B4AA 1LDJA 5KAFC 2A61A 2JVHA 3GO5A 3AFHA 1WQ2A 4P9FA 4XBFA 1MBGA 5K7HA 5LHHA 2E35A 4A5MA 4BY7J 4F91B 1HLVA 1WWXA 5EEGA 3FHNA 4WXDA 1XSXA 2NOJB 1TNSA 1FOWA 1PJRA 3HKZN 2DCEA 4B47A 1YJWI 4OINF 3PFYA 3LOCA 3AG4H 2Q1ZB 1G3TA 5F6FA 2XAQA 3QRFF 1X1BA 2UV1A 4A6DA 1FBSA 2H09A 4XKCA 4JYKA 1HOMA 3QU6A 3ZQLA 1ZRCA 4HF2A 2BW3A 1BC7C 1SC7A 3S3MA 1R6RA 3WTZA 2CUJA 3K4CA 4W97A 3GZNB 5K5QA 2LY2A 3I71A 1IO2A 3V42A 3TMOA 4RGRA 1H0MA 3C2HA 4I7HA 1PP7U 3LSJA 2DMPA 3E6BA 3FDYA 3RKYA 2Y48A 4XSXF 3VWBA 3OV8A 4C9YA 3M4OJ 1XSDA 3WTTC 4IOCF 3DTKA 1HQCA 4MFDA 2UZKA 2Z16A 2DJNA 2OUMA 3DF8A 4BHPA 1HCRA 2E5ZA 3F23A 4A6EA 4ASNA 4BXFA 2P6TA 2HDCA 2LMDA 3TKYA 4OIOF 3KP2A 1FX7A 2ZNYA 3RCOA 3FXUA 3DEWA 4BEHB 3ZMZA 3G71I 1RR7A 5GTHC 3CC2I 2XPUA 2QKMB 1ZGJA 1D8KA 1U8BA 5E1XA 4ABZA 1WFXA 2PMZN 3SFZA 1FEXA 4BXUA 2K86A 1DGRM 3T0YA 2XGDA 1Z91A 3OY9A 4MTEA 2ZKZA 3S1MJ 4UNOA 1JJ8C 3HYIA 2AXLA 1YQAA 4OMZA 2R7UA 5GPAA 2M8GX 4L5EA 1ERDA 2R92J 2R7WA 3IHUA 4I99C 2LBFA 1GV2A 4I0BA 5FKMA 1I3QJ 3A01B 1I50J 4ENNA 2OZ6A 4D1QA 3BCAA 4EM2A 1DUXC 1WJAA 2XDVA 1I39A 2VQHA 1QRYA 1OCZH 2R7DA 2XB0X 1SEUA 2YUSA 2HS5A 3S1QJ 3KYLA 1JUSA 3RQ4A 2BE5F 5EJCA 3BJOA 4UUSB 4Q5SF 2RV8A 4HF1A 1KZHA 3I54A 3A0HC 3CLOA 4FT8A 4II3A 2GXBA 3M3YJ 3ERED 3CC7I 3RI4A 1J75A 3WGIA 1VQ9I 2MC3A 1W0UA 1R36A 1SVLA 4RB0A 3U9GA 4YIRX 3IRRA 3LSHA 4G7HF 4ZYHA 2R7VA 1ZHFA 3BG5A 4CCJA 4D5CA 2ZNZA 5D5UB 1YTYA 2CQNA 4A3IJ 2NVTJ 4ZDLA 5JLXA 2VT2A 4BE1A 1W36C 2NVUB 1APLC 2FSWA 2ZC2A 3GTMJ 3FMRA 1R23A 3ZN1A 2O8XA 2BXZA 3E3VA 2LKXA 2CW0F 4HNTA 3HOUJ 3KEOA 3M8EA 3FMSA 2LF7A 5J8FA 3WTYC 4KN4X 2FA5A 3F8FA 3FXJA 3E5XA 4IEJA 2X6YA 3LFKA 3I0TA 1X58A 2CQKA 1OQYA 1U5TB 4MQVA 3LAPA 2X1CA 3K70D 4J01A 1F5TA 2X51A 2BHYA 3KP5A 1IUFA 3TO7A 2JA5J 3JRDA 2E2HJ 1T39A 1CQTA 1JGSA 4O5VA 4PJNA 2NOGA 1HF0A 3VPRA 3W2WA 3LSMA 2TRTA 3NARA 3PUBA 3SYTA 1MSFC 3DPUA 2MABA 3DPTA 2KP6A 1RIOH 3CF5F 1PVEA 1R1TA 2NXNB 2IGNA 4EQQA 1XPXA 5HLTA 2G0EA 2HFHA 3CCMI 5A2QK 2W82A 1AKHB 3VYRB 4UVBA 2V6EA 1UAAA 2F4MB 2X1EA 1P92A 3KEYA 2XASA 4HQMA 5HLGA 2O61A 1O7FA 1QA6A 1MZBA 1UJ8A 2L7KA 2CW8A 2HU9A 2O0YA 2IGKA 3BP8A 3E6DA 2OAZA 4EJUA 4RA2A 4F7ZA 1XCVA 1BL0A 2NVYJ 3OSGA 2HR3A 5KHDA 2WA0A 1TQPA 3CMEI 4CA0A 4NQWA 1AA7A 2STWA 5EGOB 3OYNA 1K6YA 2KIUA 1Z7UA 3RQIA 4IHSA 4M3GA 2VOOA 2PJRA 1YRNA 2EPFA 4XRFA 2QBYB 3ABUA 2DQRA 4XONA 5EZHA 3PM1A 3Q0WA 2R5ZB 1WVRA 4A0XA 1H88C 1A35A 1JTYA 2E60A 2DOFA 1YI2I 4ZYGA 3E0JB 2Y30A 4M6VA 4CCLA 3BQZA 3JREA 1UCRA 4XN0A 1QNTA 2X48A 1Z77A 2VL8A 4B1RA 4A3JJ 1X1DA 2EV5A 2IGOA 3MN2A 1ZYRF 4L9TA 1VZ0A 4FE7A 3ZQGA 3W6JB 2CFXA 2NNYA 5HS7A 2HGCA 3CUQB 4JOMA 3ZPLA 1NK2P 5EEAA 4NUBA 1P4AA 3WODF 1UZCA 4GO1A 3I55I 1R1VA 4M6YA 1MJBA 1SFXA 3HXLA 3U1DA 3CMAI 2ISYA 1W1WE 3TDZC 1STZA 3MKZA 3T8RA 3FXLA 2GWRA 2EFQA 2ZCWA 1YIOA 1T38A 1K78B 5JVGF 2QWWA 1LQ1A 2HOTA 3FBNB 1VQKI 2XAUA 2W24A 1L3LA 5TJJA 3ZMTA 4E7HA 3T1BA 1V54H 2OU2A 2HOEA 1Z0XA 2FD5A 3WTSC 4WK8F 4BJ5C 1WJBA 3CESA 1MBFA 1Y56A 4DQ2A 5J1RA 3HOZJ 1QVUA 2M0CA 2M2EA 5ERIA 1IXCA 4DBQA 3TO9A 5B3SH 4HPQA 1MIJA 5CQGA 1R9TJ 4WXHA 1RRJA 2OD5A 2L7MP 3C2GA 3ECOA 1U3EM 1TC3C 1Y8QB 1MH3A 2AQFA 3BR5A 3TGNA 4CH7A 2E1NA 4ZZDA 1ITYA 2LF8A 4A69C 1OJLA 3Q0VA 5IP9J 2H1LA 3P9IA 4ZZLA 1A6QA 1T95A 3S2HJ 1LFBA 3JR9A 3EETA 4IKFA 2GXAA 1W4MA 5CVIA 2R7SA 4NHJA 4BDZA 2LSOA 1OYWA 3CCSI 2ZFWA 4PGHA 1X3ZB 3K7AJ 3UKGA 3CLQA 1GVJA 1BR2A 2M45A 2D1HA 1GUUA 4JQFA 2E36A 3H3ZA 2JPBA 2WV1A 4B09A 1YOVB 2BEOA 2IS1A 3PFIA 2IEKA 4P1WA 1N75A 1PUEE 2YS9A 2VONA 3H9GA 2RQPA 2ZMEA 1HDDC 2R7ZJ 4UB8C 4HV5A 2QQBA 4FCYA 1SFEA 2RGVA 2ZXIA 2G7HA 2A07F 3A0BC 1IAWA 5LGTA 4BBRJ 5LD2C 1ZGWA 5TISC 1TT0A 3QPTA 1K4SA 3EUHA 1XMAA 2BY3A 2CQ7A 2MC4A 4KICA 4UVAA 1UG2A 3RKQA 1B8IA 4UV8A 1T33A 2P8TA 1VQLI 1DQUA 4HX8A 3S32A 5EEHA 4M9ZA 4V2FA 3SZGA 1OCCH 5BOXA 4V19K 3HSEA 1EF4A 5E8IA 1JUMA 3SXYA 4XLEA 3OYCA 3FISA 5FKLA 4DYCA 5FD5A 5D8KB 2Y75A 2KLOA 3ELKA 2UUZA 3BCBA 3LSRA 1B72A 2DN0A 4A0ZA 4EV0A 1R7JA 4G8XA 2XV4S 1ON2A 1X1CA 3JCUC 4QWQA 4RLQA 1Z3YA 2HKOA 2ECCA 1W7PB 3FK7A 5E3MA 1SD4A 4PFPA 2J5OA 2V9VA 3HHHA 1K61A 4LD5A 4R1HA 2YU3A 3E5UA 2DT6A 1RNLA 2GBYA 3QOPA 1Y0UA 5DEQA 4RDUA 3CCLI 3HC7A 2FQ4A 4RMNA 3MZHA 3S14J 3RKWA 2VASA 5GAEJ 3JTHA 2WTEA 3KPHA 1OCOH 4DBRA 1Y6IA 3R60A 3U1KA 1O3RA 2F48A 3NQOA 3GTKJ 2ZMEC 2W00A 2NVQJ 2DA3A 2XSJC 5FLXZ 1SFKA 3K4JA 2MD0A 3SZTA 5J47A 1P9QC 4BHCA 3L2QA 3CO7C 4EGYA 4C2MJ 3DFGA 5HDGA 4L9NA 5D8LB 1I6XA 1S29A 3REOA 3EUHC 2DPDA 5FLVA 3F9KA 5LHIA 1HBXG 3ABLH 4RB1A 4ZYAA 2MH2A 2CGPA 3P9CA 3ULQB 2HPIA 3KP6A 1KYWA 3G6EI 3WU0A 1XDUA 1EV7A 1HW2A 2HZDA 4HSRA 3HOYJ 3LSGA 3V7RA 1JKQC 3R0AA 3H3VK 4LIUA 3HOTA 4MLOA 2EV6A 3VOEA 2VN2A 3WU1B 2OV7A 1ETWA 3R6SA 2JMWA 1W7PD 3MFKA 4PSXA 5CLSA 2ZJPF 1K79A 2JTVA 3RPQA 1QO0D 4Q48A 1S9HA 2K9NA 2XIGA 4HSTA 3R4KA 1PUFB 2EZKA 1KU2A 4XORA 2HVSA 5F0FA 2LDUA 5B1BH 2LG4A 5E18F 1SAUA 3PNYA 4DIQA 1FLIA 3CJQB 4AVZA 3IH2A 4A3GJ 3TQNA 2CSOA 1Z6TA 4CCOA 1EKEA 5GAHJ 3ZMDA 3C2BA 1K4TA 6PAXA 2HPMA 3MKWB 5TGTA 4YG2F 1IGNA 5CVVA 3LL7A 4JX4A 3CDHA 4MHGA 2QGUA 3DLAA 1R22A 3RSNA 3LSIA 3KP3A 3RYRA 3L7WA 2EIJH 2Z1DA 2L5QA 1W36D 4XLNF 2WAEA 2L4AA 3EPZA 4DZPA 2JK3A 5JHFA 3WTWC 3VSKA 2E1CA 5CVJA 1FMWA 4UY8I 4R79A 2YSRA 4U7DA 2ECBA 4RM2A 3QP5A 2BV6A 5KNLA 4FX4A 4ZYEA 3K6GA 3JRHA 2LC2A 3BTIA 3OYAA 1JKPC 1XC5A 2L7FP 2LD5A 3RPUD 3N97A 4EMSA 2FU4A 2OQRA 1IRFA 1VNDA 3HRTA 3RZOJ 2VQGA 4A3DJ 4BXXJ 1CF7B 3E1SA 2VBWA 2XF5A 5DCMA 1D0YA 2ZB9A 3GZ6A 1OISA 1UMQA 4G6QA 5C4JJ 3ZQIA 2LREA 5D5XB 2KQRA 4NB5A 1HSTA 2PLYA 3TW7A 1FYMA 2KISA 3GZ5A 3ISPA 3QWLA 1RUNA 1S6LA 4QLCU 2GM4A 3LWFA 4MEYF 3RJPA 2FMLA 3OIQA 1U9NA 2E7WA 2IRFG 1DP3A 2VE8A 3CJNA 4D0PA 3IWFA 1LFUP 4LG0B 3GTQJ 2EK5A 5CVUA 3S1NJ 2FBHA 1IN6A 2KZVA 4J19A 1IJWC 1ZLJA 3AG3H 1I27A 4RBOA 1YE9A 3CCVI 2X6OA 4AUXA 2PMZA 2XROA 3OYBA 3HOSA 3I9V2 4AIHA 3ML6A 5IT3A 3B6CA 2L4MA 2WB1A 3H5NA 4LK1F 3JRFA 2W57A 3I4MJ 2WAQA 4M74A 1D5VA 2Y9YA 1I5ZA 2X4HA 3I4PA 2GXGA 2WY7Q 4ZH4F 2DLLA 4N0BA 5BNGA 4O3MA 4IXAA 3BT9A 2KRCA 2YU9J 2JPCA 3DU6A 3BG3A 2BY1A 4BQAA 1LE8B 4HF0A 4CYDA 3SDGA 3WGHA 4KITB 3I4NJ 4ANJA 2IAIA 2MA3A 2XF7A 5F08A 2Q0OA 1IN4A 1ZQ3P 2VJJA 5CVRA 4GRIA 2A5YB 1Y1WJ 2X9DA 2W7NA 3WHCA 4DZJA 3U21A 1Y1VJ 2G7UA 2J5PA 2LVSA 3CJRB 1BR4A 1ULYA 2DOEA 5LGUA 3OOUA 1OLTA 3QPLA 4DYRA 1X3UA 2NS0A 3CC4I 3BZKA 3BG9A 4PJJA 5J40A 1BA5A 1MBHA 3IWZA 4LLNA 2DTZA 4N9IA 4U7BA 4Q4ZF 4E7IA 1JXSA 1MDMB 1QBJA 4Y15A 3L1PA 1ETOA 4OIQF 5E3LA 5C44J 3G4SI 4E7LA 4KDPA 3HBLA 3IL2A 4HX7A 2WWYA 5J1YA 5F1RA 2KFDA 1P4WA 3QOEA 4HV6A 4PK4A 2V1DA 3BR2A 4M9XA 4KT5C 2LY1A 4NC8A 3NWSA 2R5YB 3O8GA 1OKRA 1LEAA 1IXSB 1FP2A 1B1BA 1JTXA 2NS7A 3B73A 2KZGA 3K1PA 5ICEA 2ESHA 5B1AH 5J6XA 3GFIA 5HNFA 1HW5A 1NG6A 3L2WA 1IV6A 3OSFA 1UG0A 3DKYA 1ZELA 2CG4A 4BHBA 2JN6A 1SANA 4KA4A 1IN8A 2CQXA 3UNGC 2KDOA 2G9WA 3N05A 3KEQA 1UB9A 4J00A 1RKTA 2BGCA 2IPQX 4AIJA 1VQOI 3OL4A 4I02A 1U9OA 4XLFA 1JT0A 2CMPA 1L0OC 3GVAA 1G59A 4OOIA 4WWCA 1OCTC 3HDDA 2AXTC 5BS6A 2XF6A 3W3CA 2HXIA 2QSHX 2COBA 5D4RA 1ZAOA 1LVAA 5CKTA 4AVPA 2BVMA 1FC3A 3VB2A 2UXXA 2VBYA 4Y3OA 4KIBA 3VSLA 2EWNA 4H4KC 4C3IJ 2X6XA 1BI1A 1YO5C 5A2QZ 3I5UA 3KCCA 1MMAA 1SD5A 3Q9SA 2A5WA 2TDXA 3PQJA 1WZ2A 2ZSHB 3MQ0A 3HUGA 2EB7A 2WB1N 3QPHA 5HS8A 2DO7A 1J59A 4CYCB 2WAQN 3DEEA 3KYCB 1WJCA 4U0VA 1T6SA 2DW4A 4N4OB 2EV0A 2EIMH 9ANTA 5E20A 2F6CA 3FM3A 4S05A 5J8CA 5IP7J 3WG7H 3CJTB 4MTDA 4M73A 3K2ZA 2VXZA 4IJAA 2JJ7A 2COMA 1TZLA 4YRVA 1MGTA 4KJZA 2HDDA 3F8BA 3FXQA 3F8MA 3TP3A 1ACIA 4Y4RA 2VBZA 4FETA 1BR1A 4DGWB 2JA7J 2VB6A 1ETKA 1IC8A 3RKXA 3V8JA 1ZG1A 3AL0C 2WADA 3QODA 1BI0A 5CPRB 1CGPA 4D9JA 4M9SA 4XICA 3BTLA 5M3MJ 1LNWA 2JUCA 4MIMA 2HOSA 1BW5A 1ZKGA 4XSZF 2VI6A 3TL4X 3OYIA 2M9HA 1FWZA 1R1UA 1DU0A 4UHTA 1IN5A 2XRNA 4MQ9F 4HDUA 4HX4A 1VF9A 2DDBA 4DW6A 2UWMA 1XD7A 2B9SA 2QYOA 1MJAA 2XKPA 4Y52J 5IOZA 1QVTA 2OQGA 3F3XA 4LFUA 2DFEA 3BJAA 2KJCA 1B9NA 3I59A 1K83J 3BG7A 2IJLA 2F5FA 3HJEA 1P7IA 1T56A 3GWZA 4MFEA 3Q9VA 3GYHX 2ETHA 3HPHA 2HI3A 3K4MA 2JVGA 2E1MB 3F72A 1A04A 3CO6C 2X85A 1WI3A 2K85A 5GAGJ 1POGA 5HOOA 3ZRGA 5D6FA 2DA1A 1YIJI 1VQ5I 2VKVA 1QHGA 2VBXA 3V7SA 2DJIA 3L2CA 3OYHA 5H6RA 2XGXA 3L2RA 4FASD 4BY1J 4NC6A 3R0JA 3PJRA 4OU0A 1ZR2A 1LB2A 5J4VA 4XLHA 5ICFA 2ZJRF 4U0YA 2X0LA 1Z1DA 2B0LA 1D0ZA 2ID6A 3CDIA 1FBUA 3IUOA 1R4MB 4AM3A 2JZYA 3DU5A 2XAGA 4HEA2 4N9HA 1BOAA 1X2NA 1LUJB 3M7GA 1R5HA 3OYLA 2VXDA 1T98A 4XIDA 4ITVA 3CF2A 5DUIA 5JR3A 4KISA 2OZUA 1YJNI 2ISZA 4BDYA 2ZXWH 1Y0NA 4ZDPA 3FK6A 2VJ4A 4TV7A 1XG1A 1YLFA 4FHTA 3QQAA 2CJJA 3PSFA 1GT0C 2XC7A 4XOPA 3HRUA 2O03A 4CCNA 2JSPA 4KT6A 1USSA 2W84A 2YX7A 3GXOA 3SFIA 5E1ZB 3OWTA 4K2EA 1ZREA 1BIBA 3EDPA 1JKOC 1X3WB 2CUFA 2A6TA 3D5RC 2A3SA 2DBBA 4XRSA 4P5OA 3E6CC 2HQAA 2PBIA 2Q2EA 4DOZA 3F6VA 5EZGA 2HVQA 1V3FA 4L9JA 4ENKA 4BQQA 2IBDA 2QUFA 1N78A 4A3EJ 5EF6A 2K3FA 2IA1A 5DTDA 1T0FA 5LLQA 4LGWA 1NTCA 3PUFA 1MH4A 3EYYA 5E1WA 1WSUA 3LQRA 3H5RA 5KK1A 2XHKA 1D1CA 4KNYA 1QU3A 1SFUA 2P5KA 2K27A 4YIIA 1ETQA 2P0WA 1UHWA 5DM7F 5K1YA 1RUOA 4CDGA 1OYIA 5DS9A 1TTYA 1KQ0A 1ETVA 1IUYA 5DDGA 4X6AJ 2O8KA 2V9KA 5J4YA 3CMYA 1GLNA 2F2EA 2DQLA 1BJAA 4BBSJ 1YYVA 3WTUC 4BUPA 2BVLA 2FNPA 4P96A 3NWTA 5FFZA
chains in the Genus database with same CATH topology
1LKXA 2KL4A 3CJQB 1BOBA 4AVZA 4PJLA 2I8DA 1V5EA 3OR2C 4CCOA 3ZQQA 1J09A 2HPMA 3W2AA 3MKWB 3FKJA 5TGTA 5FRMA 2HDWA 3LL7A 3VYTB 3PL8A 3DLAA 3HPGA 3RSNA 3S3OA 3LSIA 2JVHA 2M7AA 3AFHA 2GOXB 2M7BA 5CQEA 2Z1DA 1W36D 2L5QA 2WAEA 3EPZA 4F91B 2V4JC 5JHFA 3FHNA 3VSKA 4C30A 2NOJB 1FMWA 4B47A 1PJRA 4R79A 2DCEA 3SEQA 3FBIB 3PFYA 4RM2A 2Q1ZB 5KNLA 4BE2A 2R7RA 1X1BA 2UV1A 2LOOA 3K6GA 4BL0B 2LC2A 1X4PA 1V5FA 3PSIA 2ZXHA 3OYAA 2KHMA 4XKCA 3DPLC 3RPUD 4XM3A 3UR3C 2WAFA 1N77A 2BW3A 3L2VA 3S3MA 1R6RA 2CUJA 3K4CA 4ZDOA 2VQGA 2LY2A 3V42A 3ONQA 3H0DA 3TMOA 2JA2A 3E1SA 2XF5A 4E7SA 1D0YA 4N4NB 3C2HA 2LREA 2KQRA 3FDYA 3VWBA 3OYGA 4BEHA 4C9YA 3DTKA 1UELB 2Z16A 3OIQA 2BW3B 3LSKA 2OUMA 2L9NA 4PJMA 1DP3A 2E5ZA 3AKZA 2VJIA 3I3LA 2RREA 4BXFA 1X4OA 2KZVA 2M3AA 2DOAA 3CZ6A 3RCOA 1YE9A 4BEHB 2VLAA 2PMZA 3OYBA 3HOSA 4BACA 2F4IA 3I9V2 4E4HA 2QKMB 3LMMA 4B44A 2WB1A 3H5NA 1WFXA 2WY8Q 2MYSA 2WAQA 3K4NA 1DGRM 3PNYA 2WY7Q 1WJDA 3OY9A 2R4GA 3K4BA 2F5VA 2R7UA 2KRCA 2KPMA 5FRNA 4OAYA 4RM3A 3DU6A 1ERDA 1QHHD 3BG6A 2R7WA 2LBFA 1WJ5A 2VKHA 4U87A 4KITB 4ANJA 4E7KA 4D1QA 3BCAA 1WJAA 1Z3XA 2XDVA 2VQHA 2XF7A 3OL3A 1E0EA 1NG7A 2VJJA 3OYFA 3OMYA 2R7OA 4GRIA 3ZGKA 3KYLA 1U0JA 3DWLE 2W7NA 3RQ4A 3U21A 1D0XA 4G6TB 2E5NA 3ZR8X 2IXSA 4II3A 3CJRB 1BR4A 2LBFB 4BU2A 3OOUA 1OLTA 1X1AA 3A2KA 3D5SC 4PJJA 3LSHA 1JI8A 4U7BA 4ZTJA 2R7VA 4E7IA 4CCJA 1MMNA 3K70C 2ZSIB 4ZDLA 4BE1A 1W36C 3SEZA 4E7LA 2WBMA 1EA3A 1X19A 4HRIA 4HNTA 4OWRB 4C2TA 3OYDA 2RQQA 3QOEA 4C2UA 4PK4A 3MKYB 3QYBA 3L2UA 3HL2A 2X6YA 2X1DA 2LY1A 3MD2A 3BC8A 4LIVA 2VKDA 2X1CA 1MW7A 3NWSA 4NC8A 3K70D 4J01A 4PSWA 2X51A 4DJAA 4X0GA 2KRHA 2M4KA 2VQCA 4IX7A 2QKLB 2AQEA 4PJNA 3K10A 3W2WA 1T0FC 3LSMA 4QPOA 3PUBA 3OYKA 3SYTA 4BQOA 5HNFA 3DPUA 2MABA 3DPTA 1NG6A 2KP6A 2Z2SB 3L2WA 2IGNA 5HLTA 1UG0A 3DKYA 3VDXA 1ZELA 2W82A 4B3XA 3CP2A 1Z7LA 3DTEA 3VYRB 2V6EA 3UNGC 1UAAA 1WJFA 1OR7C 2X1EA 3KEYA 3G2BA 2KDOA 3N05A 1MNDA 2IGMA 3EUAA 4J00A 3IP4B 2L7KA 2CW8A 2HU9A 3OYEA 2IGKA 4IZZA 2LH9A 4YELA 4XL9A 2GOMA 4NNJA 3OL4A 5KHDA 1HA8A 2WA0A 3PNTA 2BOLA 4CA0A 1AA7A 3OYNA 4XLFA 2CMPA 1K6YA 1YX5A 2CV1A 1G59A 2PJRA 2XF6A 4LITA 3W3CA 2OC6A 3CP8A 4XONA 5CKTA 2W1OA 4Y33A 4E7JA 2BVMA 4Y3OA 4NQWB 5HVQC 2E60A 3VSLA 4H4KC 1D1BA 2X6XA 3E0JB 4ZC3A 3S8PA 4CCLA 3AL0B 4XR6A 2K9LA 4XN0A 1MMAA 3OS1A 2VL8A 4F52A 4HNUA 2PJRB 2R7XA 3RTRA 1X1DA 1LVKA 2A5WA 3SDBA 3OR1C 2IGOA 2ZSHB 3J7AY 1VZ0A 2MFZA 3DEEA 1WJCA 4JOMA 4XMYA 4N4OB 3DKXA 3QYEA 4NUBA 2M0MA 4YEJA 3ZCOA 2F6CA 2O5RA 3H5AA 3HXLA 2R7TA 2CS3A 3MMYB 3MKZA 2DXIA 1FMVA 2VXZA 2HNHA 4YRVA 3QYFA 1TZLA 3ZXSA 2Y0SA 4KJZA 1MNEA 3HG9A 3HUGB 5LFAA 3FBNB 4BE0A 2XAUA 4Y4RA 4FETA 2RNGA 3A1YA 1BR1A 4E7HA 4NC7A 4DGWB 2VB6A 4F3QA 4BJ5C 4E7ZA 1WJBA 3CESA 2WADA 3QODA 3AL0C 5CPRB 1Y56A 4D9JA 2X6WA 2HVRA 2K5CA 2KMUA 2V26A 4DBQA 4XKVA 4QPQA 4HPQA 3TL4X 5CQGA 3OYIA 2CW7A 3H9QA 4F92B 1V5GA 3C2GA 1LDKB 3K4KA 2VIXA 1DGWY 2AQFA 4LG3A 4CH7A 4F55A 4ZTFA 2UWMA 1T95A 3M8JA 3DQVC 4AYBA 3BG7A 3K4LA 3VYUB 4IKFA 4XKBA 2R7SA 4BDZA 2JUGA 3HPHA 1BR2A 3CMMA 4XNFA 3K4MA 2CUZA 4JQFA 2JVGA 2ELJA 2L9SA 4IQ4A 2K9MA 2E1MB 2IS4A 2IS1A 4P1WA 2X85A 1N75A 3H9GA 4ZJZA 4XKWA 2IS6A 4EATA 5HOOA 2LRDA 3ZRGA 2K3PA 4B43A 3HKZA 2ZXIA 1QHGA 3GBGA 2DJIA 2L2OA 3OYHA 3L2RA 4FASD 5LD2C 1TT0A 1IRXA 3PJRA 3A4CA 1WJEA 3KX2A 2MC4A 4XN3A 4XLHA 2IS2A 2R7QA 1DQUA 3OS2A 1D0ZA 3S32A 4E6KG 3IUOA 3SZGA 3OIPA 3DU5A 3M1CA 4HEA2 4XLEA 3IAM2 4CCMA 5FROA 1YX3A 4RLFA 4BQNA 3OS0A 3OYCA 4HG2A 2KLOA 2VXDA 3IAS2 3OYLA 4CCKA 4ITVA 3CF2A 2UUZA 3BCBA 2CFOA 4KISA 1G8XA 1Z21A 4XQFA 1X1CA 2E1MC 2LYCA 1D1AA 4BDYA 4RLQA 1Z3YA 4ZDPA 2VJ4A 3W2VA 4PFOA 3PNVA 4PFPA 2VQLA 1PYVA 3D5LA 3PSFA 2DT6A 2XC7A 4XOPA 4CCNA 2JSPA 4KT6A 2CH0A 4BGDA 2M4GA 3H35A 3BLYA 3HC7A 3EUKL 4RMNA 3OWTA 4F93B 1LFPA 5HNHA 2VASA 4XOTA 4DBRA 1Y6IA 2A6TA 3D5RC 2ZFUA 2W00A 3VYSB 4PUSA 2XSJC 4P5OA 1SFKA 3K4JA 2MD0A 2HQAA 4II2A 1P9QC 2V1NA 3L2QA 4DOZA 3DTIA 2VJ5A 2HVQA 2DT7B 3TBIA 3S3NA 3EUHC 4BQQA 3F9KA 1N78A 4BJ6C 4B48A 3LFUA 4ZYAA 3H9JA 2HPIA 4AU7A 1MMDA 2W4SA 3H5RA 2HZDA 4HSRA 2Q2EB 4CZCA 1D1CA 1QU3A 2CV0A 3LSGA 1KONA 1MMGA 4OAZA 2P0WA 4LIUA 4BS9A 4CSWA 4DIQA 2CV2A 3HOTA 3OYJA 4MLOA 4BJTA 4IQJA 2FUG2 2OV7A 2V7FA 4PSXA 4XLCA 2V9KA 1S9HA 4HSTA 1GLNA 4XORA 5KCMA 3S93A 2HVSA 3OYMA 2VPLA 4BUPA 2LG4A 4CUGA 2BVLA 1SAUA 4XLAA 3NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MW7 A;  1E0E A;  1LFP A;  1WJE A;  3F9K A;  3HPG A;  4F3Q A;  1K6Y A;  3HPH A;  1KON A;  1WJD A;  1WJF A;  1WJC A;  1WJB A;  1WJA A; 
#chains in the Genus database with same CATH topology
 1LKX A;  2MGQ A;  2Y9Z A;  2KL4 A;  4EJO A;  3B02 A;  1GXP A;  4PJL A;  5ICG A;  1A6I A;  4IPA A;  1EH8 A;  1V5E A;  5H6Q A;  5D5W B;  3IRQ A;  1JHF A;  2NRA C;  2FOW A;  2EIK H;  1XTA A;  1J09 A;  1OYY A;  2Y0M A;  3S2D J;  1TW3 A;  2HDW A;  3VYT B;  2OBP A;  1FTT A;  3S3O A;  4RS8 A;  1ZRF A;  2DT5 A;  2GOX B;  3P9K A;  4MNU A;  2ZBK A;  1T8I A;  4L18 B;  1R4N B;  3Q5F A;  1XGN A;  2M8E A;  1E3O C;  3MZ8 A;  4L9V A;  5LEK A;  5DV5 A;  5LEJ A;  2DA5 A;  2EZI A;  2R7R A;  4CGZ A;  2D1V A;  2LOO A;  4BL0 B;  4ZYD A;  1X4P A;  1V5F A;  3PSI A;  2N8G A;  2ZXH A;  3CCQ I;  2KHM A;  1YJ9 I;  4AC0 A;  3EQL F;  2EFW A;  1IV8 A;  3FIW A;  2I5U A;  2WAF A;  3I58 A;  1F9N A;  2MG4 A;  1JHH A;  3SHF A;  3DXJ F;  3JSO A;  3RYP A;  2OF7 A;  3ONQ A;  3J80 Z;  1DPR A;  2JA2 A;  3TOA A;  3CCJ I;  3BTJ A;  4N4N B;  3ASN H;  2PEX A;  1HC8 A;  2OCE A;  4E70 A;  2FOK A;  4DYQ A;  2R3S A;  4BEH A;  3CCE I;  2FQ3 A;  1XGM A;  2HOA A;  1MBE A;  5IPA A;  2ELH A;  1ONV A;  2BW3 B;  2L9N A;  3BR6 A;  4CO8 A;  1Z67 A;  2LKS A;  4WXC A;  3BDD A;  5HLH A;  2DOA A;  2WC2 A;  3CZ6 A;  2NAZ A;  4O6J A;  5D4S A;  1LEB A;  2EA2 A;  2VE9 A;  2GA1 A;  2L7Z A;  1FYK A;  3KIO A;  4RAZ A;  2EFO A;  3K2A A;  2F4I A;  1ZRD A;  4RAG A;  4E4H A;  3A01 A;  1W5C C;  3K1M A;  1FJL A;  1VQN I;  4B44 A;  1XGS A;  2BXY A;  2F4O B;  2GIV A;  2MH9 A;  4AWX B;  2VPR A;  2Y69 H;  4V2G A;  4RB2 C;  1GHC A;  2WY8 Q;  3CTA A;  1HXD A;  3A02 A;  1Y39 A;  3DCF A;  2P7C B;  2F5V A;  2ACJ A;  4MEX F;  2HYF A;  1I1S A;  4UUS A;  5TRD A;  4OAY A;  4RM3 A;  5FRN A;  5HS9 A;  3V4G A;  3WGG A;  5M3F J;  1QHH D;  3BG6 A;  1WJ5 A;  1VQ7 I;  1UHS A;  3BPX A;  1T08 B;  2VKH A;  3D0S A;  4U87 A;  4Y13 A;  2XKO A;  3DLL F;  4X1E A;  3GTL J;  3FHZ A;  1RKW A;  3I53 A;  1RI7 A;  5LRR A;  3OYF A;  1GVD A;  1FOK A;  2R7O A;  3ZGK A;  4QTR A;  2QQ8 A;  1QZE A;  5DUK A;  2P81 A;  2K4B A;  4G6T B;  1VQ6 I;  4M3F A;  5IT9 K;  2IXS A;  3RZD J;  2GZW A;  1IRZ A;  3FZV A;  2LBF B;  1JT6 A;  5L3D A;  4BU2 A;  1ETX A;  2PN6 A;  2W48 A;  1X1A A;  5HOD A;  3A2K A;  2A6E F;  1TT5 B;  2CU7 A;  1A31 A;  2DDA A;  2C6Y A;  5HDN A;  3O8H A;  3TW6 A;  3F8N A;  3JAM K;  4ZTJ A;  2D2W A;  3MCZ A;  1U5T A;  1MMN A;  3K70 C;  2XUB A;  2ZSI B;  4BAY A;  1WI9 A;  4XRS G;  3SEZ A;  5KAI C;  2F5D A;  3HTU A;  4U0W A;  2WBM A;  3K0L A;  3J80 K;  1ZTR A;  3JRA A;  1EA3 A;  1R5I D;  3HIF A;  1X19 A;  4HRI A;  2W85 A;  2FE3 A;  4OWR B;  1H9G A;  2RQQ A;  4M3E A;  4UVC A;  3MKY B;  3GEZ A;  3L2U A;  4M6X A;  1KU7 A;  3BC8 A;  1WHU A;  4LIV A;  2VKD A;  2AS5 F;  1AKH A;  4HAM A;  4S0H B;  4DJA A;  3KET A;  5ILV A;  4X0G A;  2M4K A;  2NVX J;  2VT3 A;  2VUM J;  2FBI A;  4IX7 A;  2QKL B;  2DFH A;  4UV9 A;  1BBY A;  2DPU A;  2KKO A;  3F8C A;  4EM0 B;  2XPV A;  1P4X A;  4BQO A;  1ON1 A;  4HLY A;  3WE3 A;  3DBH B;  3M9A A;  5EGO A;  3IH3 A;  2B63 J;  1Z7L A;  3DTE A;  2JRM A;  1FY7 A;  3V8K A;  1ORK A;  3ABT A;  3J81 Z;  3G2B A;  1V55 H;  2BYV E;  2HKX A;  1MND A;  1F4K A;  2EFP A;  5FFX A;  3W6V A;  1MSE C;  2HWV A;  3O2P E;  2QCO A;  5IY5 H;  1LPQ A;  2QBY A;  1TQM A;  4JBA A;  1VQ4 I;  1I1G A;  4IZZ A;  2LH9 A;  3WHB A;  3V7C A;  2FJ1 A;  2DA4 A;  3W6K B;  2GOM A;  4JP0 A;  2R5Z A;  2DMN A;  1R5G A;  4NNJ A;  1HA8 A;  1G2H A;  2ME0 A;  4LLG F;  1U5T C;  2JA6 J;  1S7A A;  1BM9 A;  3L00 A;  2XGE A;  2CV1 A;  3DKW A;  4R8H A;  3GTG J;  1E2X A;  4WF2 A;  5M5Y J;  1ZG5 A;  2F5C A;  4I01 A;  2L9R A;  2Z3Y A;  1IDZ A;  4Y33 A;  2Z9O A;  1EH6 A;  1ZK8 A;  1BI2 A;  3U2R A;  3ASO H;  2LP0 A;  2QVO A;  1FZP B;  3CUQ A;  4Z2Y A;  4NQW B;  1ZH5 A;  4IVN A;  1D1B A;  2XPW A;  1NHA A;  3G1L A;  2PJR B;  4HNU A;  1YRN B;  3L9F A;  3RTR A;  3LSP A;  1LVK A;  5M5W J;  3SDB A;  3OR1 C;  1K78 A;  1QPM A;  1D3Y A;  5D5V B;  3J7A Y;  1DU6 A;  3RIR A;  3WE2 A;  1LDD A;  3RDI A;  4IO9 F;  2AO9 A;  3AG2 H;  1U78 A;  4XMY A;  1AOY A;  3C7J A;  3K1N A;  3DKX A;  1BIA A;  3QYE A;  3MVP A;  3ZCO A;  1O3T A;  2O5R A;  3H5A A;  1BI3 A;  3ROU A;  2CS3 A;  5HDK A;  4HDV A;  2DXI A;  1FMV A;  4G12 A;  2HNH A;  3AG1 H;  5EG0 B;  3HG9 A;  2DFI A;  5LFA A;  4G7O F;  1YS7 A;  3MWM A;  2IW5 A;  4EM1 A;  5FKO A;  3VEP A;  3O3K A;  2Y0S N;  1G4D A;  5HLI A;  1S5L C;  4F3Q A;  4E7Z A;  5B5E C;  3EYI A;  3WU2 C;  4WCG A;  5FGM A;  3CQZ J;  4PJ0 C;  4I76 A;  4GCV A;  2LNB A;  2HVR A;  3E7L A;  2L9V A;  1TQI A;  2V26 A;  1QPI A;  4XKV A;  4QPQ A;  2IP2 A;  2PMU A;  4RGU A;  4P55 A;  2CW7 A;  2KDZ A;  2KIM A;  4F92 B;  3J81 K;  1FIP A;  3DP7 A;  2R93 J;  1LDK B;  3K4K A;  3Q3S A;  4A3C J;  2L54 A;  1M1E B;  3CUQ C;  3E6M A;  4LG3 A;  5ILU A;  1ZLK A;  4EJT A;  5D6E A;  2TCT A;  4ZTF A;  3ZN0 A;  1BW6 A;  2LY9 A;  1OCP A;  2PI0 A;  1NH3 A;  2CYY A;  1O57 A;  1WCM J;  3DQV C;  3GTP J;  3QP6 A;  2Q8K A;  4ESF A;  4OIR F;  4LB5 A;  3BR1 A;  3MKL A;  2H94 A;  2Z99 A;  3K4L A;  1VI0 A;  3NEU A;  3FXM A;  5JFR A;  1B6A A;  2K9S A;  3J7A O;  1N25 A;  2L0K A;  4OIP F;  2UXN A;  2AHQ A;  4IHV A;  1MKM A;  1B9M A;  4AYB N;  2V1U A;  3FXK A;  2PJP A;  1WKM A;  2EFN A;  3CMM A;  3OOP A;  4HW0 A;  5M5X J;  4HOB A;  2MLG A;  4IQ4 A;  2K9M A;  5BPI A;  4KMF A;  4GDF A;  4WX9 A;  4CHU A;  4ZJZ A;  5L3B A;  2IS6 A;  4EAT A;  2ADU A;  2QSG X;  3GLX A;  4ENJ A;  1IZ1 A;  1TWG J;  2K3P A;  4B43 A;  4HA8 A;  1VQM I;  1MJ9 A;  2L2O A;  1SMT A;  3IC7 A;  4PGG A;  1IRX A;  3KX2 A;  3I64 A;  3C3W A;  2Z33 A;  4PZJ A;  2R0Q C;  4XN3 A;  2IS2 A;  3H1C A;  1RC9 A;  3PQK A;  2V9P A;  2HYJ A;  5KVR A;  3GFJ A;  4XRM A;  4E6K G;  2PG4 A;  1H89 C;  3MZY A;  3OIP A;  1RZ4 A;  2DA7 A;  2ZME B;  1W7P A;  4KFC A;  4CCM A;  3IAM 2;  3SZP A;  5FRO A;  4JK1 X;  3BZC A;  1FOX A;  3TOB A;  2FNA A;  3IAS 2;  1UST A;  2NNN A;  3HOX J;  2E7X A;  1B8I B;  4UUV A;  1HKS A;  4CIC A;  1Z21 A;  2GAU A;  2FRH A;  1KQ8 A;  2EIN H;  2LYC A;  1I3A A;  2EZL A;  4I2O A;  3J7Z I;  3W2V A;  2CUE A;  4EEF G;  1V4R A;  3PNV A;  3KP4 A;  3CCR I;  3N4M A;  2L01 A;  2VQL A;  2F5E A;  1PYV A;  1S3J A;  5JVT A;  2VKE A;  3D5L A;  1ZR4 A;  4OMY A;  1VTN C;  1S72 I;  1O4X A;  4KN7 X;  3JRB A;  5C4X J;  1IG7 A;  2VC1 A;  1TWC J;  1B72 B;  3TP0 A;  1R58 A;  2CH0 A;  3FXO A;  3K69 A;  4BGD A;  1REP C;  2M4G A;  1ZG3 A;  3H35 A;  3BLY A;  3EUK L;  1P2F A;  4A3K J;  4XOT A;  3MAJ A;  1KGS A;  2ZFU A;  1ZGA A;  1TNT A;  2QEX I;  3VYS B;  2ZJQ F;  2E34 A;  2ZJ2 A;  4II2 A;  1FBQ A;  3KLN A;  3DTI A;  3JW4 A;  1WRJ A;  4L5J A;  2DT7 B;  2D45 A;  2FF4 A;  1D5Y A;  1BN5 A;  3RPU A;  1KYZ A;  3S3N A;  3HOW J;  4M71 A;  1O7L A;  1OFC X;  1LJ9 A;  3KZI C;  1BC8 C;  3BQY A;  3H9J A;  3R61 A;  1MMD A;  1TP4 A;  4ESB A;  1MBJ A;  1XMX A;  1A36 A;  1FPQ A;  2P5V A;  1G3Y A;  4NBQ A;  5E17 F;  1PUF A;  4CZC A;  5K7Z A;  5K5R A;  2QEN A;  2CV0 A;  1IW7 F;  2RDP A;  4ENM A;  3F0C A;  4OAZ A;  5F0C A;  3ZQ7 A;  4BS9 A;  2HQ5 A;  4QIW N;  2CV2 A;  3OYJ A;  1E3P A;  2OPT A;  4RGS A;  4P9U A;  5LRS A;  2V7F A;  1XS9 A;  1G3S A;  3IKV A;  4HLX A;  3T5X A;  3E97 A;  4XLC A;  3G1M A;  5ILS A;  5DD4 A;  3HRM A;  2BY2 A;  1S8N A;  2KRF A;  5AIP A;  5KCM A;  3PO3 J;  3FF5 A;  4CUG A;  4S04 A;  3LNQ A;  4A3F J;  4IRI A;  3S1R J;  2JT1 A;  5ICC A;  2DU9 A;  3S2W A;  4RAF A;  2I8D A;  4XK4 A;  3OR2 C;  3ZQQ A;  1FIA A;  3KZZ A;  3GME A;  4YFK F;  3ABM H;  1YFH A;  3W2A A;  2K4J A;  1ETY A;  3PL8 A;  4C3J J;  3HPG A;  3BTC A;  3M8F A;  1YW9 A;  2M7A A;  1S7O A;  2HQN A;  2DK8 A;  2OCC H;  2M7B A;  3LA3 A;  2JRT A;  5CQE A;  2HTS A;  3OIO A;  4LB6 B;  4BKX A;  2ELK A;  1Z05 A;  2PFB A;  1JE8 A;  4KIG A;  2V4J C;  2ID3 A;  3C18 A;  4C30 A;  3IH4 A;  3KE2 A;  3SEQ A;  1AHD P;  4MO7 A;  1CF7 A;  3E5Q A;  3FBI B;  4G94 A;  4B8X A;  1PDN C;  2ZO4 A;  2MBF A;  4A0Y A;  2D5V A;  1P6R A;  4BE2 A;  1U6G A;  4FX0 A;  3Q0U A;  2DTR A;  4RB3 C;  3DPL C;  3CDL A;  4IOA F;  4XM3 A;  3UR3 C;  2FMY A;  4Y7N J;  2FEZ A;  5B66 C;  1N77 A;  3L2V A;  5JLW A;  5LHG A;  1F43 A;  1F1Z A;  4ZDO A;  5H20 A;  1TWH J;  3H0D A;  1JKR C;  2EH3 A;  4LG0 A;  4E7S A;  3ECH A;  4LLL A;  1QZZ A;  5L3C A;  2LK2 A;  3F21 A;  1DPU A;  1UHM A;  5GPC A;  3OYG A;  2DA6 A;  2IA2 A;  2IT0 A;  3QAH A;  2RKH A;  3GTJ J;  1UEL B;  2PMH A;  3BPV A;  3H92 A;  2EBI A;  3M1E A;  2DMT A;  5IYD J;  3LSK A;  4PJM A;  4UXN A;  3AKZ A;  3FKI J;  5DCM B;  2W25 A;  2VJI A;  3I3L A;  2CQQ A;  2RRE A;  4M72 A;  1X4O A;  3MEX A;  4A2U A;  2M3A A;  3HHG A;  5AIQ A;  3ZOB A;  5CYV A;  4GXO A;  4KIF A;  4GGG A;  4FQG A;  1ZAR A;  2Y2Z A;  4L5I A;  3V8L A;  2VLA A;  4FTH A;  2M5W A;  2H8R A;  3LA7 A;  4BAC A;  2LKP A;  1LE8 A;  4A93 J;  3ERM A;  5K7F A;  3LMM A;  1ZN2 A;  2YX4 A;  3DBR B;  2GLO A;  3K4N A;  2MYS A;  1U2W A;  3JRI A;  3C1D A;  3KLO A;  1WJD A;  3GFL A;  5EG0 A;  5C3E J;  4H0E A;  2ESN A;  2R4G A;  4PDK A;  3K4B A;  1KU3 A;  5DYM A;  1FTZ A;  1KU9 A;  2QA4 I;  2DFF A;  3ZMU A;  2K9Q A;  1OPC A;  2KPM A;  1DP7 P;  3WTV C;  1QGP A;  2OA4 A;  4KMU X;  4CXF A;  2HQR A;  1I6H J;  3TDU C;  2M1B A;  2OTJ I;  4E7K A;  1FYL A;  1Z3X A;  3GFM A;  3OL3 A;  1E0E A;  5H2F C;  5ED4 A;  1G6N A;  1NG7 A;  3GW2 A;  3OMY A;  3TO6 A;  3HGG A;  1MDM A;  1U0J A;  3DWL E;  2P5L C;  2Y31 A;  1OR7 A;  3G73 A;  1D0X A;  1R71 A;  1A5J A;  3HEF A;  3X2Q H;  1WGX A;  5GP9 A;  4AID A;  2E5N A;  3G1O A;  3ZR8 X;  1SMY F;  2BHZ A;  3PIP F;  4BYY A;  4EGZ A;  1IXR C;  4JX6 A;  5DD8 A;  2P6S A;  3D5S C;  2I10 A;  3IV5 A;  4UB6 C;  1JI8 A;  2A69 F;  1XCB A;  1YW7 A;  2DAO A;  1R49 A;  1XX5 A;  2NS8 A;  3GUD A;  4D7N A;  2R5Y A;  4GYI A;  4ESJ A;  1OMI A;  5E3N A;  4AD9 A;  1J5Y A;  1HKT A;  2HZT A;  3S15 J;  2M30 A;  3HB9 A;  1RPW A;  4A5N A;  4HZF A;  1D8J A;  2E19 A;  4ON0 A;  2KT0 A;  3M07 A;  5F27 A;  3OYD A;  4C2U A;  4C2T A;  2ICW G;  3QYB A;  3KP7 A;  3WTX C;  1AU7 A;  3HL2 A;  2LLK A;  2XAH A;  2EQR A;  4D7M A;  2X1D A;  3HGY A;  4EVI A;  3MD2 A;  4CZZ A;  1MW7 A;  2P7V B;  4PSW A;  3ZMV A;  2KRH A;  1SD7 A;  4KYW A;  2VQC A;  5IT9 Z;  2AQE A;  3VOD A;  3K10 A;  1T0F C;  4QPO A;  3BR0 A;  3FWE A;  2MW8 A;  3OYK A;  1O3Q A;  1PP8 F;  1J7K A;  2BBY A;  5LBQ A;  3F22 A;  2Z2S B;  4IRH A;  5L3E A;  1Z9C A;  1B59 A;  4YIF A;  2YR2 A;  3BJ6 A;  3VDX A;  3JAM Z;  4B3X A;  3CP2 A;  4BH9 A;  5IYC J;  5L3G A;  1WJF A;  1OR7 C;  1K7A A;  2QQA A;  2DYS H;  2IGM A;  3EUA A;  2LTP A;  3IP4 B;  3OYE A;  2FXA A;  5EDN A;  3H3U A;  1IF1 A;  2QQ9 A;  1TWF J;  5FB2 A;  4YEL A;  5FLM J;  2EIL H;  4XL9 A;  2JQ7 A;  2GA2 A;  2LR8 A;  3PNT A;  2BOL A;  3BY6 A;  3KYD B;  1YX5 A;  3D1N I;  1FSH A;  1OCR H;  1T2K A;  1XB4 A;  4LIT A;  2XAJ A;  4QSH A;  2NYX A;  2OC6 A;  3CP8 A;  1H9T A;  3QPS A;  5IOY A;  2W1O A;  4Y17 A;  4E7J A;  4CYC A;  1TL8 A;  1QZY A;  2ZXJ A;  3CUO A;  4FE4 A;  4A12 A;  5HVQ C;  3COA C;  5EYR A;  1YIT I;  4ZC3 A;  3S8P A;  3AL0 B;  1XMK A;  3L09 A;  4XR6 A;  3A03 A;  2K9L A;  5K5O A;  3FXR A;  4LJZ F;  3OS1 A;  3S17 J;  4F52 A;  3ABK H;  2R7X A;  3K9T A;  2O7O A;  3J7Y J;  1AWC A;  3GLL A;  2STT A;  2DI3 A;  2A6H F;  2PQ8 A;  2MFZ A;  3HSF A;  2DMU A;  3H36 A;  4JX5 A;  5F04 A;  3JSP A;  4UUT A;  2EA4 A;  2M0M A;  4YEJ A;  2L02 A;  2XGC A;  3VFZ A;  3FM5 A;  2A05 A;  4IRG A;  2R7T A;  3WG9 A;  4IF4 A;  4M3D A;  3MMY B;  5L3F A;  4RGX A;  3QYF A;  5FKK A;  3ZXS A;  2Y0S A;  4EJW A;  2EZH A;  1MNE A;  3FX3 A;  3HUG B;  4MGR A;  3I56 I;  3BR3 A;  1E3H A;  1G3W A;  4BE0 A;  1HKQ A;  3HZJ A;  2V1X A;  1FOY A;  4AIK A;  1MBK A;  2IVM A;  2RNG A;  3A1Y A;  4NC7 A;  5DCF A;  1SFO J;  1RET A;  2QM3 A;  3KZY A;  4A3B J;  4B4C A;  1GV5 A;  2H8W A;  1XSV A;  2K7L A;  5CJ9 A;  2HTJ A;  4EJV A;  2X6W A;  2KJB A;  3SJM A;  2R7F A;  4A3L J;  2K5C A;  2KMU A;  1K6O A;  1QQI A;  1O3S A;  4LK0 F;  5IP6 A;  3H9Q A;  1V5G A;  1TLH B;  4IHT A;  2VIX A;  2FBK A;  1WPK A;  1DGW Y;  2MLK A;  1TWA J;  2XVC A;  3G3Z A;  1P7J A;  2V6C A;  2O3F A;  2EJR A;  1C0W A;  2HEO A;  4F55 A;  4YFX F;  1KQ9 A;  4A3M J;  2DYR H;  3M8J A;  3LAJ A;  3H0G J;  1FP1 D;  3P7N A;  3VYU B;  4I0A A;  4AYB A;  5BPD A;  1JUP A;  4XKB A;  2P4W A;  4IHX A;  4GYG A;  2O9L A;  1RR8 C;  1ENH A;  1Y8R B;  5E3O A;  3GTO J;  1BJZ A;  2DOD A;  1W5S A;  2JUG A;  3S16 J;  2BZT A;  2XSD C;  4RAY A;  4XNF A;  1VQP I;  2CUZ A;  2JWT A;  2MD5 A;  5GTI C;  3BRO A;  5LGN A;  2YPR A;  1MD0 A;  3GF2 A;  3JRG A;  2ELJ A;  2L9S A;  2VOD A;  2IS4 A;  4PCQ A;  2H27 A;  1NK3 P;  3I59 B;  3DBL B;  4YFN F;  3QU3 A;  5F0H A;  2OJE D;  4XKW A;  5F64 A;  2LRD A;  3LQQ A;  3HRS A;  3HKZ A;  4Q47 A;  1RES A;  2M34 A;  3GBG A;  4KUM A;  4M3B A;  1YHQ I;  2CRG A;  4IHY A;  2K40 A;  3A4C A;  1WJE A;  2RN7 A;  4L0Y B;  2E71 A;  2O6G E;  2B7E A;  1GDT A;  4LMY A;  3HM5 A;  2R7Q A;  2DA2 A;  1WH7 A;  1WH5 A;  4LOC A;  5E8G A;  3OS2 A;  1ODD A;  2H6C A;  1Q1V A;  5GAD J;  2RC4 A;  1W0T A;  5BQT A;  2DK5 A;  2VC0 A;  3CCY A;  3GX4 X;  2H1K A;  3M1C A;  2V79 A;  5FLX K;  1IRG A;  3OS0 A;  1YX3 A;  4RLF A;  4BQN A;  4IHW A;  4HG2 A;  1FNN A;  3CCU I;  3IKT A;  1Z6R A;  2VOP A;  3DV8 A;  4CCK A;  2QZ8 A;  2Z5U A;  2LFB A;  2CFO A;  1G8X A;  2FX0 A;  3KFW X;  2DMQ A;  5AON A;  1YS6 A;  4XQF A;  1FT9 A;  3LA2 A;  1KA8 A;  2E1M C;  1U8R A;  1D1A A;  3BZ6 A;  2HXO A;  5JHU A;  4I98 B;  1HSJ A;  4PFO A;  2OTL I;  4BNC A;  1FSE A;  2E2J J;  2E1O A;  4NDL A;  3O6B B;  1E17 A;  1EH7 A;  2ME6 A;  4HQE A;  1IDY A;  1XN7 A;  2JSC A;  5J1U A;  3BOQ A;  1Q1H A;  3T8T A;  1SVO A;  1J9I A;  4Z6Y A;  3SQN A;  1VFC A;  4F93 B;  5F1J A;  1LFP A;  5HNH A;  2H6B A;  3ZQC A;  1DDN A;  4W1U A;  4I09 A;  1JJ6 C;  2CO5 A;  4ETS A;  1TW2 A;  1SD6 A;  3AAF A;  4PUS A;  5IYB J;  1SVM A;  5BMZ A;  2E2I J;  2V1N A;  4C3H J;  4L0Z B;  1H8A C;  2VJ5 A;  4DNC A;  4XLP F;  3NAU A;  4GFB A;  3B6A A;  2RNJ A;  3TBI A;  1J2X A;  4G7Z F;  2QSF X;  5E79 C;  1IN7 A;  2WV0 A;  2BY0 A;  5J3L A;  1XGO A;  2RVC A;  1TBX A;  4G9Y A;  4U88 A;  3GCM A;  4B48 A;  4BJ6 C;  4HNV A;  3LFU A;  5FJ8 J;  2PX9 A;  3JRC A;  1SAX A;  3PO2 J;  2XRL A;  3PIO F;  2MSY A;  3LST A;  2W4S A;  1W5T A;  2GQQ A;  2XB5 A;  4I6Z A;  3HTS B;  2Q2E B;  3NRV A;  4HYE A;  1XDS A;  2HYG D;  1UFM A;  1KON A;  1YW8 A;  3ESW B;  1MMG A;  2IA0 A;  3TED A;  1J0R A;  1VQ8 I;  4HBL A;  4CSW A;  5FD6 A;  2KIQ A;  1MNM C;  4BJT A;  4IQJ A;  2FUG 2;  3ZP5 A;  5FO5 A;  3HOV J;  3DEU A;  1X2M A;  5FKN A;  3JTG A;  3S93 A;  1S7E A;  1GXQ A;  4G6D A;  2VPL A;  3OYM A;  1EJ9 A;  1JGG A;  3ZQF A;  1F36 A;  2JA8 J;  3CD6 I;  5DM6 F;  4AU7 A;  4XLA A;  3ZMS A;  2K02 A;  2QF7 A;  3HSR A;  1HDP A;  4IL6 C;  3FMQ A;  1BOB A;  4FIS A;  3P5J A;  4B3A A;  2XAF A;  2QLZ A;  5JI6 A;  2GIZ A;  4D5F A;  2M87 A;  2A68 F;  1X1P A;  3F6O A;  2CWE A;  5FRM A;  3FKJ A;  1R00 A;  1YG2 A;  1HW1 A;  2RAE A;  2L3D A;  3BWG A;  2KIF A;  3ZQH A;  1MMS A;  1B4A A;  1LDJ A;  5KAF C;  2A61 A;  2JVH A;  3GO5 A;  3AFH A;  1WQ2 A;  4P9F A;  4XBF A;  1MBG A;  5K7H A;  5LHH A;  2E35 A;  4A5M A;  4BY7 J;  4F91 B;  1HLV A;  1WWX A;  5EEG A;  3FHN A;  4WXD A;  1XSX A;  2NOJ B;  1TNS A;  1FOW A;  1PJR A;  3HKZ N;  2DCE A;  4B47 A;  1YJW I;  4OIN F;  3PFY A;  3LOC A;  3AG4 H;  2Q1Z B;  1G3T A;  5F6F A;  2XAQ A;  3QRF F;  1X1B A;  2UV1 A;  4A6D A;  1FBS A;  2H09 A;  4XKC A;  4JYK A;  1HOM A;  3QU6 A;  3ZQL A;  1ZRC A;  4HF2 A;  2BW3 A;  1BC7 C;  1SC7 A;  3S3M A;  1R6R A;  3WTZ A;  2CUJ A;  3K4C A;  4W97 A;  3GZN B;  5K5Q A;  2LY2 A;  3I71 A;  1IO2 A;  3V42 A;  3TMO A;  4RGR A;  1H0M A;  3C2H A;  4I7H A;  1PP7 U;  3LSJ A;  2DMP A;  3E6B A;  3FDY A;  3RKY A;  2Y48 A;  4XSX F;  3VWB A;  3OV8 A;  4C9Y A;  3M4O J;  1XSD A;  3WTT C;  4IOC F;  3DTK A;  1HQC A;  4MFD A;  2UZK A;  2Z16 A;  2DJN A;  2OUM A;  3DF8 A;  4BHP A;  1HCR A;  2E5Z A;  3F23 A;  4A6E A;  4ASN A;  4BXF A;  2P6T A;  2HDC A;  2LMD A;  3TKY A;  4OIO F;  3KP2 A;  1FX7 A;  2ZNY A;  3RCO A;  3FXU A;  3DEW A;  4BEH B;  3ZMZ A;  3G71 I;  1RR7 A;  5GTH C;  3CC2 I;  2XPU A;  2QKM B;  1ZGJ A;  1D8K A;  1U8B A;  5E1X A;  4ABZ A;  1WFX A;  2PMZ N;  3SFZ A;  1FEX A;  4BXU A;  2K86 A;  1DGR M;  3T0Y A;  2XGD A;  1Z91 A;  3OY9 A;  4MTE A;  2ZKZ A;  3S1M J;  4UNO A;  1JJ8 C;  3HYI A;  2AXL A;  1YQA A;  4OMZ A;  2R7U A;  5GPA A;  2M8G X;  4L5E A;  1ERD A;  2R92 J;  2R7W A;  3IHU A;  4I99 C;  2LBF A;  1GV2 A;  4I0B A;  5FKM A;  1I3Q J;  3A01 B;  1I50 J;  4ENN A;  2OZ6 A;  4D1Q A;  3BCA A;  4EM2 A;  1DUX C;  1WJA A;  2XDV A;  1I39 A;  2VQH A;  1QRY A;  1OCZ H;  2R7D A;  2XB0 X;  1SEU A;  2YUS A;  2HS5 A;  3S1Q J;  3KYL A;  1JUS A;  3RQ4 A;  2BE5 F;  5EJC A;  3BJO A;  4UUS B;  4Q5S F;  2RV8 A;  4HF1 A;  1KZH A;  3I54 A;  3A0H C;  3CLO A;  4FT8 A;  4II3 A;  2GXB A;  3M3Y J;  3ERE D;  3CC7 I;  3RI4 A;  1J75 A;  3WGI A;  1VQ9 I;  2MC3 A;  1W0U A;  1R36 A;  1SVL A;  4RB0 A;  3U9G A;  4YIR X;  3IRR A;  3LSH A;  4G7H F;  4ZYH A;  2R7V A;  1ZHF A;  3BG5 A;  4CCJ A;  4D5C A;  2ZNZ A;  5D5U B;  1YTY A;  2CQN A;  4A3I J;  2NVT J;  4ZDL A;  5JLX A;  2VT2 A;  4BE1 A;  1W36 C;  2NVU B;  1APL C;  2FSW A;  2ZC2 A;  3GTM J;  3FMR A;  1R23 A;  3ZN1 A;  2O8X A;  2BXZ A;  3E3V A;  2LKX A;  2CW0 F;  4HNT A;  3HOU J;  3KEO A;  3M8E A;  3FMS A;  2LF7 A;  5J8F A;  3WTY C;  4KN4 X;  2FA5 A;  3F8F A;  3FXJ A;  3E5X A;  4IEJ A;  2X6Y A;  3LFK A;  3I0T A;  1X58 A;  2CQK A;  1OQY A;  1U5T B;  4MQV A;  3LAP A;  2X1C A;  3K70 D;  4J01 A;  1F5T A;  2X51 A;  2BHY A;  3KP5 A;  1IUF A;  3TO7 A;  2JA5 J;  3JRD A;  2E2H J;  1T39 A;  1CQT A;  1JGS A;  4O5V A;  4PJN A;  2NOG A;  1HF0 A;  3VPR A;  3W2W A;  3LSM A;  2TRT A;  3NAR A;  3PUB A;  3SYT A;  1MSF C;  3DPU A;  2MAB A;  3DPT A;  2KP6 A;  1RIO H;  3CF5 F;  1PVE A;  1R1T A;  2NXN B;  2IGN A;  4EQQ A;  1XPX A;  5HLT A;  2G0E A;  2HFH A;  3CCM I;  5A2Q K;  2W82 A;  1AKH B;  3VYR B;  4UVB A;  2V6E A;  1UAA A;  2F4M B;  2X1E A;  1P92 A;  3KEY A;  2XAS A;  4HQM A;  5HLG A;  2O61 A;  1O7F A;  1QA6 A;  1MZB A;  1UJ8 A;  2L7K A;  2CW8 A;  2HU9 A;  2O0Y A;  2IGK A;  3BP8 A;  3E6D A;  2OAZ A;  4EJU A;  4RA2 A;  4F7Z A;  1XCV A;  1BL0 A;  2NVY J;  3OSG A;  2HR3 A;  5KHD A;  2WA0 A;  1TQP A;  3CME I;  4CA0 A;  4NQW A;  1AA7 A;  2STW A;  5EGO B;  3OYN A;  1K6Y A;  2KIU A;  1Z7U A;  3RQI A;  4IHS A;  4M3G A;  2VOO A;  2PJR A;  1YRN A;  2EPF A;  4XRF A;  2QBY B;  3ABU A;  2DQR A;  4XON A;  5EZH A;  3PM1 A;  3Q0W A;  2R5Z B;  1WVR A;  4A0X A;  1H88 C;  1A35 A;  1JTY A;  2E60 A;  2DOF A;  1YI2 I;  4ZYG A;  3E0J B;  2Y30 A;  4M6V A;  4CCL A;  3BQZ A;  3JRE A;  1UCR A;  4XN0 A;  1QNT A;  2X48 A;  1Z77 A;  2VL8 A;  4B1R A;  4A3J J;  1X1D A;  2EV5 A;  2IGO A;  3MN2 A;  1ZYR F;  4L9T A;  1VZ0 A;  4FE7 A;  3ZQG A;  3W6J B;  2CFX A;  2NNY A;  5HS7 A;  2HGC A;  3CUQ B;  4JOM A;  3ZPL A;  1NK2 P;  5EEA A;  4NUB A;  1P4A A;  3WOD F;  1UZC A;  4GO1 A;  3I55 I;  1R1V A;  4M6Y A;  1MJB A;  1SFX A;  3HXL A;  3U1D A;  3CMA I;  2ISY A;  1W1W E;  3TDZ C;  1STZ A;  3MKZ A;  3T8R A;  3FXL A;  2GWR A;  2EFQ A;  2ZCW A;  1YIO A;  1T38 A;  1K78 B;  5JVG F;  2QWW A;  1LQ1 A;  2HOT A;  3FBN B;  1VQK I;  2XAU A;  2W24 A;  1L3L A;  5TJJ A;  3ZMT A;  4E7H A;  3T1B A;  1V54 H;  2OU2 A;  2HOE A;  1Z0X A;  2FD5 A;  3WTS C;  4WK8 F;  4BJ5 C;  1WJB A;  3CES A;  1MBF A;  1Y56 A;  4DQ2 A;  5J1R A;  3HOZ J;  1QVU A;  2M0C A;  2M2E A;  5ERI A;  1IXC A;  4DBQ A;  3TO9 A;  5B3S H;  4HPQ A;  1MIJ A;  5CQG A;  1R9T J;  4WXH A;  1RRJ A;  2OD5 A;  2L7M P;  3C2G A;  3ECO A;  1U3E M;  1TC3 C;  1Y8Q B;  1MH3 A;  2AQF A;  3BR5 A;  3TGN A;  4CH7 A;  2E1N A;  4ZZD A;  1ITY A;  2LF8 A;  4A69 C;  1OJL A;  3Q0V A;  5IP9 J;  2H1L A;  3P9I A;  4ZZL A;  1A6Q A;  1T95 A;  3S2H J;  1LFB A;  3JR9 A;  3EET A;  4IKF A;  2GXA A;  1W4M A;  5CVI A;  2R7S A;  4NHJ A;  4BDZ A;  2LSO A;  1OYW A;  3CCS I;  2ZFW A;  4PGH A;  1X3Z B;  3K7A J;  3UKG A;  3CLQ A;  1GVJ A;  1BR2 A;  2M45 A;  2D1H A;  1GUU A;  4JQF A;  2E36 A;  3H3Z A;  2JPB A;  2WV1 A;  4B09 A;  1YOV B;  2BEO A;  2IS1 A;  3PFI A;  2IEK A;  4P1W A;  1N75 A;  1PUE E;  2YS9 A;  2VON A;  3H9G A;  2RQP A;  2ZME A;  1HDD C;  2R7Z J;  4UB8 C;  4HV5 A;  2QQB A;  4FCY A;  1SFE A;  2RGV A;  2ZXI A;  2G7H A;  2A07 F;  3A0B C;  1IAW A;  5LGT A;  4BBR J;  5LD2 C;  1ZGW A;  5TIS C;  1TT0 A;  3QPT A;  1K4S A;  3EUH A;  1XMA A;  2BY3 A;  2CQ7 A;  2MC4 A;  4KIC A;  4UVA A;  1UG2 A;  3RKQ A;  1B8I A;  4UV8 A;  1T33 A;  2P8T A;  1VQL I;  1DQU A;  4HX8 A;  3S32 A;  5EEH A;  4M9Z A;  4V2F A;  3SZG A;  1OCC H;  5BOX A;  4V19 K;  3HSE A;  1EF4 A;  5E8I A;  1JUM A;  3SXY A;  4XLE A;  3OYC A;  3FIS A;  5FKL A;  4DYC A;  5FD5 A;  5D8K B;  2Y75 A;  2KLO A;  3ELK A;  2UUZ A;  3BCB A;  3LSR A;  1B72 A;  2DN0 A;  4A0Z A;  4EV0 A;  1R7J A;  4G8X A;  2XV4 S;  1ON2 A;  1X1C A;  3JCU C;  4QWQ A;  4RLQ A;  1Z3Y A;  2HKO A;  2ECC A;  1W7P B;  3FK7 A;  5E3M A;  1SD4 A;  4PFP A;  2J5O A;  2V9V A;  3HHH A;  1K61 A;  4LD5 A;  4R1H A;  2YU3 A;  3E5U A;  2DT6 A;  1RNL A;  2GBY A;  3QOP A;  1Y0U A;  5DEQ A;  4RDU A;  3CCL I;  3HC7 A;  2FQ4 A;  4RMN A;  3MZH A;  3S14 J;  3RKW A;  2VAS A;  5GAE J;  3JTH A;  2WTE A;  3KPH A;  1OCO H;  4DBR A;  1Y6I A;  3R60 A;  3U1K A;  1O3R A;  2F48 A;  3NQO A;  3GTK J;  2ZME C;  2W00 A;  2NVQ J;  2DA3 A;  2XSJ C;  5FLX Z;  1SFK A;  3K4J A;  2MD0 A;  3SZT A;  5J47 A;  1P9Q C;  4BHC A;  3L2Q A;  3CO7 C;  4EGY A;  4C2M J;  3DFG A;  5HDG A;  4L9N A;  5D8L B;  1I6X A;  1S29 A;  3REO A;  3EUH C;  2DPD A;  5FLV A;  3F9K A;  5LHI A;  1HBX G;  3ABL H;  4RB1 A;  4ZYA A;  2MH2 A;  2CGP A;  3P9C A;  3ULQ B;  2HPI A;  3KP6 A;  1KYW A;  3G6E I;  3WU0 A;  1XDU A;  1EV7 A;  1HW2 A;  2HZD A;  4HSR A;  3HOY J;  3LSG A;  3V7R A;  1JKQ C;  3R0A A;  3H3V K;  4LIU A;  3HOT A;  4MLO A;  2EV6 A;  3VOE A;  2VN2 A;  3WU1 B;  2OV7 A;  1ETW A;  3R6S A;  2JMW A;  1W7P D;  3MFK A;  4PSX A;  5CLS A;  2ZJP F;  1K79 A;  2JTV A;  3RPQ A;  1QO0 D;  4Q48 A;  1S9H A;  2K9N A;  2XIG A;  4HST A;  3R4K A;  1PUF B;  2EZK A;  1KU2 A;  4XOR A;  2HVS A;  5F0F A;  2LDU A;  5B1B H;  2LG4 A;  5E18 F;  1SAU A;  3PNY A;  4DIQ A;  1FLI A;  3CJQ B;  4AVZ A;  3IH2 A;  4A3G J;  3TQN A;  2CSO A;  1Z6T A;  4CCO A;  1EKE A;  5GAH J;  3ZMD A;  3C2B A;  1K4T A;  6PAX A;  2HPM A;  3MKW B;  5TGT A;  4YG2 F;  1IGN A;  5CVV A;  3LL7 A;  4JX4 A;  3CDH A;  4MHG A;  2QGU A;  3DLA A;  1R22 A;  3RSN A;  3LSI A;  3KP3 A;  3RYR A;  3L7W A;  2EIJ H;  2Z1D A;  2L5Q A;  1W36 D;  4XLN F;  2WAE A;  2L4A A;  3EPZ A;  4DZP A;  2JK3 A;  5JHF A;  3WTW C;  3VSK A;  2E1C A;  5CVJ A;  1FMW A;  4UY8 I;  4R79 A;  2YSR A;  4U7D A;  2ECB A;  4RM2 A;  3QP5 A;  2BV6 A;  5KNL A;  4FX4 A;  4ZYE A;  3K6G A;  3JRH A;  2LC2 A;  3BTI A;  3OYA A;  1JKP C;  1XC5 A;  2L7F P;  2LD5 A;  3RPU D;  3N97 A;  4EMS A;  2FU4 A;  2OQR A;  1IRF A;  1VND A;  3HRT A;  3RZO J;  2VQG A;  4A3D J;  4BXX J;  1CF7 B;  3E1S A;  2VBW A;  2XF5 A;  5DCM A;  1D0Y A;  2ZB9 A;  3GZ6 A;  1OIS A;  1UMQ A;  4G6Q A;  5C4J J;  3ZQI A;  2LRE A;  5D5X B;  2KQR A;  4NB5 A;  1HST A;  2PLY A;  3TW7 A;  1FYM A;  2KIS A;  3GZ5 A;  3ISP A;  3QWL A;  1RUN A;  1S6L A;  4QLC U;  2GM4 A;  3LWF A;  4MEY F;  3RJP A;  2FML A;  3OIQ A;  1U9N A;  2E7W A;  2IRF G;  1DP3 A;  2VE8 A;  3CJN A;  4D0P A;  3IWF A;  1LFU P;  4LG0 B;  3GTQ J;  2EK5 A;  5CVU A;  3S1N J;  2FBH A;  1IN6 A;  2KZV A;  4J19 A;  1IJW C;  1ZLJ A;  3AG3 H;  1I27 A;  4RBO A;  1YE9 A;  3CCV I;  2X6O A;  4AUX A;  2PMZ A;  2XRO A;  3OYB A;  3HOS A;  3I9V 2;  4AIH A;  3ML6 A;  5IT3 A;  3B6C A;  2L4M A;  2WB1 A;  3H5N A;  4LK1 F;  3JRF A;  2W57 A;  3I4M J;  2WAQ A;  4M74 A;  1D5V A;  2Y9Y A;  1I5Z A;  2X4H A;  3I4P A;  2GXG A;  2WY7 Q;  4ZH4 F;  2DLL A;  4N0B A;  5BNG A;  4O3M A;  4IXA A;  3BT9 A;  2KRC A;  2YU9 J;  2JPC A;  3DU6 A;  3BG3 A;  2BY1 A;  4BQA A;  1LE8 B;  4HF0 A;  4CYD A;  3SDG A;  3WGH A;  4KIT B;  3I4N J;  4ANJ A;  2IAI A;  2MA3 A;  2XF7 A;  5F08 A;  2Q0O A;  1IN4 A;  1ZQ3 P;  2VJJ A;  5CVR A;  4GRI A;  2A5Y B;  1Y1W J;  2X9D A;  2W7N A;  3WHC A;  4DZJ A;  3U21 A;  1Y1V J;  2G7U A;  2J5P A;  2LVS A;  3CJR B;  1BR4 A;  1ULY A;  2DOE A;  5LGU A;  3OOU A;  1OLT A;  3QPL A;  4DYR A;  1X3U A;  2NS0 A;  3CC4 I;  3BZK A;  3BG9 A;  4PJJ A;  5J40 A;  1BA5 A;  1MBH A;  3IWZ A;  4LLN A;  2DTZ A;  4N9I A;  4U7B A;  4Q4Z F;  4E7I A;  1JXS A;  1MDM B;  1QBJ A;  4Y15 A;  3L1P A;  1ETO A;  4OIQ F;  5E3L A;  5C44 J;  3G4S I;  4E7L A;  4KDP A;  3HBL A;  3IL2 A;  4HX7 A;  2WWY A;  5J1Y A;  5F1R A;  2KFD A;  1P4W A;  3QOE A;  4HV6 A;  4PK4 A;  2V1D A;  3BR2 A;  4M9X A;  4KT5 C;  2LY1 A;  4NC8 A;  3NWS A;  2R5Y B;  3O8G A;  1OKR A;  1LEA A;  1IXS B;  1FP2 A;  1B1B A;  1JTX A;  2NS7 A;  3B73 A;  2KZG A;  3K1P A;  5ICE A;  2ESH A;  5B1A H;  5J6X A;  3GFI A;  5HNF A;  1HW5 A;  1NG6 A;  3L2W A;  1IV6 A;  3OSF A;  1UG0 A;  3DKY A;  1ZEL A;  2CG4 A;  4BHB A;  2JN6 A;  1SAN A;  4KA4 A;  1IN8 A;  2CQX A;  3UNG C;  2KDO A;  2G9W A;  3N05 A;  3KEQ A;  1UB9 A;  4J00 A;  1RKT A;  2BGC A;  2IPQ X;  4AIJ A;  1VQO I;  3OL4 A;  4I02 A;  1U9O A;  4XLF A;  1JT0 A;  2CMP A;  1L0O C;  3GVA A;  1G59 A;  4OOI A;  4WWC A;  1OCT C;  3HDD A;  2AXT C;  5BS6 A;  2XF6 A;  3W3C A;  2HXI A;  2QSH X;  2COB A;  5D4R A;  1ZAO A;  1LVA A;  5CKT A;  4AVP A;  2BVM A;  1FC3 A;  3VB2 A;  2UXX A;  2VBY A;  4Y3O A;  4KIB A;  3VSL A;  2EWN A;  4H4K C;  4C3I J;  2X6X A;  1BI1 A;  1YO5 C;  5A2Q Z;  3I5U A;  3KCC A;  1MMA A;  1SD5 A;  3Q9S A;  2A5W A;  2TDX A;  3PQJ A;  1WZ2 A;  2ZSH B;  3MQ0 A;  3HUG A;  2EB7 A;  2WB1 N;  3QPH A;  5HS8 A;  2DO7 A;  1J59 A;  4CYC B;  2WAQ N;  3DEE A;  3KYC B;  1WJC A;  4U0V A;  1T6S A;  2DW4 A;  4N4O B;  2EV0 A;  2EIM H;  9ANT A;  5E20 A;  2F6C A;  3FM3 A;  4S05 A;  5J8C A;  5IP7 J;  3WG7 H;  3CJT B;  4MTD A;  4M73 A;  3K2Z A;  2VXZ A;  4IJA A;  2JJ7 A;  2COM A;  1TZL A;  4YRV A;  1MGT A;  4KJZ A;  2HDD A;  3F8B A;  3FXQ A;  3F8M A;  3TP3 A;  1ACI A;  4Y4R A;  2VBZ A;  4FET A;  1BR1 A;  4DGW B;  2JA7 J;  2VB6 A;  1ETK A;  1IC8 A;  3RKX A;  3V8J A;  1ZG1 A;  3AL0 C;  2WAD A;  3QOD A;  1BI0 A;  5CPR B;  1CGP A;  4D9J A;  4M9S A;  4XIC A;  3BTL A;  5M3M J;  1LNW A;  2JUC A;  4MIM A;  2HOS A;  1BW5 A;  1ZKG A;  4XSZ F;  2VI6 A;  3TL4 X;  3OYI A;  2M9H A;  1FWZ A;  1R1U A;  1DU0 A;  4UHT A;  1IN5 A;  2XRN A;  4MQ9 F;  4HDU A;  4HX4 A;  1VF9 A;  2DDB A;  4DW6 A;  2UWM A;  1XD7 A;  2B9S A;  2QYO A;  1MJA A;  2XKP A;  4Y52 J;  5IOZ A;  1QVT A;  2OQG A;  3F3X A;  4LFU A;  2DFE A;  3BJA A;  2KJC A;  1B9N A;  3I59 A;  1K83 J;  3BG7 A;  2IJL A;  2F5F A;  3HJE A;  1P7I A;  1T56 A;  3GWZ A;  4MFE A;  3Q9V A;  3GYH X;  2ETH A;  3HPH A;  2HI3 A;  3K4M A;  2JVG A;  2E1M B;  3F72 A;  1A04 A;  3CO6 C;  2X85 A;  1WI3 A;  2K85 A;  5GAG J;  1POG A;  5HOO A;  3ZRG A;  5D6F A;  2DA1 A;  1YIJ I;  1VQ5 I;  2VKV A;  1QHG A;  2VBX A;  3V7S A;  2DJI A;  3L2C A;  3OYH A;  5H6R A;  2XGX A;  3L2R A;  4FAS D;  4BY1 J;  4NC6 A;  3R0J A;  3PJR A;  4OU0 A;  1ZR2 A;  1LB2 A;  5J4V A;  4XLH A;  5ICF A;  2ZJR F;  4U0Y A;  2X0L A;  1Z1D A;  2B0L A;  1D0Z A;  2ID6 A;  3CDI A;  1FBU A;  3IUO A;  1R4M B;  4AM3 A;  2JZY A;  3DU5 A;  2XAG A;  4HEA 2;  4N9H A;  1BOA A;  1X2N A;  1LUJ B;  3M7G A;  1R5H A;  3OYL A;  2VXD A;  1T98 A;  4XID A;  4ITV A;  3CF2 A;  5DUI A;  5JR3 A;  4KIS A;  2OZU A;  1YJN I;  2ISZ A;  4BDY A;  2ZXW H;  1Y0N A;  4ZDP A;  3FK6 A;  2VJ4 A;  4TV7 A;  1XG1 A;  1YLF A;  4FHT A;  3QQA A;  2CJJ A;  3PSF A;  1GT0 C;  2XC7 A;  4XOP A;  3HRU A;  2O03 A;  4CCN A;  2JSP A;  4KT6 A;  1USS A;  2W84 A;  2YX7 A;  3GXO A;  3SFI A;  5E1Z B;  3OWT A;  4K2E A;  1ZRE A;  1BIB A;  3EDP A;  1JKO C;  1X3W B;  2CUF A;  2A6T A;  3D5R C;  2A3S A;  2DBB A;  4XRS A;  4P5O A;  3E6C C;  2HQA A;  2PBI A;  2Q2E A;  4DOZ A;  3F6V A;  5EZG A;  2HVQ A;  1V3F A;  4L9J A;  4ENK A;  4BQQ A;  2IBD A;  2QUF A;  1N78 A;  4A3E J;  5EF6 A;  2K3F A;  2IA1 A;  5DTD A;  1T0F A;  5LLQ A;  4LGW A;  1NTC A;  3PUF A;  1MH4 A;  3EYY A;  5E1W A;  1WSU A;  3LQR A;  3H5R A;  5KK1 A;  2XHK A;  1D1C A;  4KNY A;  1QU3 A;  1SFU A;  2P5K A;  2K27 A;  4YII A;  1ETQ A;  2P0W A;  1UHW A;  5DM7 F;  5K1Y A;  1RUO A;  4CDG A;  1OYI A;  5DS9 A;  1TTY A;  1KQ0 A;  1ETV A;  1IUY A;  5DDG A;  4X6A J;  2O8K A;  2V9K A;  5J4Y A;  3CMY A;  1GLN A;  2F2E A;  2DQL A;  1BJA A;  4BBS J;  1YYV A;  3WTU C;  4BUP A;  2BVL A;  2FNP A;  4P96 A;  3NWT A;  5FFZ A; 
#chains in the Genus database with same CATH homology
 1LKX A;  2KL4 A;  3CJQ B;  1BOB A;  4AVZ A;  4PJL A;  2I8D A;  1V5E A;  3OR2 C;  4CCO A;  3ZQQ A;  1J09 A;  2HPM A;  3W2A A;  3MKW B;  3FKJ A;  5TGT A;  5FRM A;  2HDW A;  3LL7 A;  3VYT B;  3PL8 A;  3DLA A;  3HPG A;  3RSN A;  3S3O A;  3LSI A;  2JVH A;  2M7A A;  3AFH A;  2GOX B;  2M7B A;  5CQE A;  2Z1D A;  1W36 D;  2L5Q A;  2WAE A;  3EPZ A;  4F91 B;  2V4J C;  5JHF A;  3FHN A;  3VSK A;  4C30 A;  2NOJ B;  1FMW A;  4B47 A;  1PJR A;  4R79 A;  2DCE A;  3SEQ A;  3FBI B;  3PFY A;  4RM2 A;  2Q1Z B;  5KNL A;  4BE2 A;  2R7R A;  1X1B A;  2UV1 A;  2LOO A;  3K6G A;  4BL0 B;  2LC2 A;  1X4P A;  1V5F A;  3PSI A;  2ZXH A;  3OYA A;  2KHM A;  4XKC A;  3DPL C;  3RPU D;  4XM3 A;  3UR3 C;  2WAF A;  1N77 A;  2BW3 A;  3L2V A;  3S3M A;  1R6R A;  2CUJ A;  3K4C A;  4ZDO A;  2VQG A;  2LY2 A;  3V42 A;  3ONQ A;  3H0D A;  3TMO A;  2JA2 A;  3E1S A;  2XF5 A;  4E7S A;  1D0Y A;  4N4N B;  3C2H A;  2LRE A;  2KQR A;  3FDY A;  3VWB A;  3OYG A;  4BEH A;  4C9Y A;  3DTK A;  1UEL B;  2Z16 A;  3OIQ A;  2BW3 B;  3LSK A;  2OUM A;  2L9N A;  4PJM A;  1DP3 A;  2E5Z A;  3AKZ A;  2VJI A;  3I3L A;  2RRE A;  4BXF A;  1X4O A;  2KZV A;  2M3A A;  2DOA A;  3CZ6 A;  3RCO A;  1YE9 A;  4BEH B;  2VLA A;  2PMZ A;  3OYB A;  3HOS A;  4BAC A;  2F4I A;  3I9V 2;  4E4H A;  2QKM B;  3LMM A;  4B44 A;  2WB1 A;  3H5N A;  1WFX A;  2WY8 Q;  2MYS A;  2WAQ A;  3K4N A;  1DGR M;  3PNY A;  2WY7 Q;  1WJD A;  3OY9 A;  2R4G A;  3K4B A;  2F5V A;  2R7U A;  2KRC A;  2KPM A;  5FRN A;  4OAY A;  4RM3 A;  3DU6 A;  1ERD A;  1QHH D;  3BG6 A;  2R7W A;  2LBF A;  1WJ5 A;  2VKH A;  4U87 A;  4KIT B;  4ANJ A;  4E7K A;  4D1Q A;  3BCA A;  1WJA A;  1Z3X A;  2XDV A;  2VQH A;  2XF7 A;  3OL3 A;  1E0E A;  1NG7 A;  2VJJ A;  3OYF A;  3OMY A;  2R7O A;  4GRI A;  3ZGK A;  3KYL A;  1U0J A;  3DWL E;  2W7N A;  3RQ4 A;  3U21 A;  1D0X A;  4G6T B;  2E5N A;  3ZR8 X;  2IXS A;  4II3 A;  3CJR B;  1BR4 A;  2LBF B;  4BU2 A;  3OOU A;  1OLT A;  1X1A A;  3A2K A;  3D5S C;  4PJJ A;  3LSH A;  1JI8 A;  4U7B A;  4ZTJ A;  2R7V A;  4E7I A;  4CCJ A;  1MMN A;  3K70 C;  2ZSI B;  4ZDL A;  4BE1 A;  1W36 C;  3SEZ A;  4E7L A;  2WBM A;  1EA3 A;  1X19 A;  4HRI A;  4HNT A;  4OWR B;  4C2T A;  3OYD A;  2RQQ A;  3QOE A;  4C2U A;  4PK4 A;  3MKY B;  3QYB A;  3L2U A;  3HL2 A;  2X6Y A;  2X1D A;  2LY1 A;  3MD2 A;  3BC8 A;  4LIV A;  2VKD A;  2X1C A;  1MW7 A;  3NWS A;  4NC8 A;  3K70 D;  4J01 A;  4PSW A;  2X51 A;  4DJA A;  4X0G A;  2KRH A;  2M4K A;  2VQC A;  4IX7 A;  2QKL B;  2AQE A;  4PJN A;  3K10 A;  3W2W A;  1T0F C;  3LSM A;  4QPO A;  3PUB A;  3OYK A;  3SYT A;  4BQO A;  5HNF A;  3DPU A;  2MAB A;  3DPT A;  1NG6 A;  2KP6 A;  2Z2S B;  3L2W A;  2IGN A;  5HLT A;  1UG0 A;  3DKY A;  3VDX A;  1ZEL A;  2W82 A;  4B3X A;  3CP2 A;  1Z7L A;  3DTE A;  3VYR B;  2V6E A;  3UNG C;  1UAA A;  1WJF A;  1OR7 C;  2X1E A;  3KEY A;  3G2B A;  2KDO A;  3N05 A;  1MND A;  2IGM A;  3EUA A;  4J00 A;  3IP4 B;  2L7K A;  2CW8 A;  2HU9 A;  3OYE A;  2IGK A;  4IZZ A;  2LH9 A;  4YEL A;  4XL9 A;  2GOM A;  4NNJ A;  3OL4 A;  5KHD A;  1HA8 A;  2WA0 A;  3PNT A;  2BOL A;  4CA0 A;  1AA7 A;  3OYN A;  4XLF A;  2CMP A;  1K6Y A;  1YX5 A;  2CV1 A;  1G59 A;  2PJR A;  2XF6 A;  4LIT A;  3W3C A;  2OC6 A;  3CP8 A;  4XON A;  5CKT A;  2W1O A;  4Y33 A;  4E7J A;  2BVM A;  4Y3O A;  4NQW B;  5HVQ C;  2E60 A;  3VSL A;  4H4K C;  1D1B A;  2X6X A;  3E0J B;  4ZC3 A;  3S8P A;  4CCL A;  3AL0 B;  4XR6 A;  2K9L A;  4XN0 A;  1MMA A;  3OS1 A;  2VL8 A;  4F52 A;  4HNU A;  2PJR B;  2R7X A;  3RTR A;  1X1D A;  1LVK A;  2A5W A;  3SDB A;  3OR1 C;  2IGO A;  2ZSH B;  3J7A Y;  1VZ0 A;  2MFZ A;  3DEE A;  1WJC A;  4JOM A;  4XMY A;  4N4O B;  3DKX A;  3QYE A;  4NUB A;  2M0M A;  4YEJ A;  3ZCO A;  2F6C A;  2O5R A;  3H5A A;  3HXL A;  2R7T A;  2CS3 A;  3MMY B;  3MKZ A;  2DXI A;  1FMV A;  2VXZ A;  2HNH A;  4YRV A;  3QYF A;  1TZL A;  3ZXS A;  2Y0S A;  4KJZ A;  1MNE A;  3HG9 A;  3HUG B;  5LFA A;  3FBN B;  4BE0 A;  2XAU A;  4Y4R A;  4FET A;  2RNG A;  3A1Y A;  1BR1 A;  4E7H A;  4NC7 A;  4DGW B;  2VB6 A;  4F3Q A;  4BJ5 C;  4E7Z A;  1WJB A;  3CES A;  2WAD A;  3QOD A;  3AL0 C;  5CPR B;  1Y56 A;  4D9J A;  2X6W A;  2HVR A;  2K5C A;  2KMU A;  2V26 A;  4DBQ A;  4XKV A;  4QPQ A;  4HPQ A;  3TL4 X;  5CQG A;  3OYI A;  2CW7 A;  3H9Q A;  4F92 B;  1V5G A;  3C2G A;  1LDK B;  3K4K A;  2VIX A;  1DGW Y;  2AQF A;  4LG3 A;  4CH7 A;  4F55 A;  4ZTF A;  2UWM A;  1T95 A;  3M8J A;  3DQV C;  4AYB A;  3BG7 A;  3K4L A;  3VYU B;  4IKF A;  4XKB A;  2R7S A;  4BDZ A;  2JUG A;  3HPH A;  1BR2 A;  3CMM A;  4XNF A;  3K4M A;  2CUZ A;  4JQF A;  2JVG A;  2ELJ A;  2L9S A;  4IQ4 A;  2K9M A;  2E1M B;  2IS4 A;  2IS1 A;  4P1W A;  2X85 A;  1N75 A;  3H9G A;  4ZJZ A;  4XKW A;  2IS6 A;  4EAT A;  5HOO A;  2LRD A;  3ZRG A;  2K3P A;  4B43 A;  3HKZ A;  2ZXI A;  1QHG A;  3GBG A;  2DJI A;  2L2O A;  3OYH A;  3L2R A;  4FAS D;  5LD2 C;  1TT0 A;  1IRX A;  3PJR A;  3A4C A;  1WJE A;  3KX2 A;  2MC4 A;  4XN3 A;  4XLH A;  2IS2 A;  2R7Q A;  1DQU A;  3OS2 A;  1D0Z A;  3S32 A;  4E6K G;  3IUO A;  3SZG A;  3OIP A;  3DU5 A;  3M1C A;  4HEA 2;  4XLE A;  3IAM 2;  4CCM A;  5FRO A;  1YX3 A;  4RLF A;  4BQN A;  3OS0 A;  3OYC A;  4HG2 A;  2KLO A;  2VXD A;  3IAS 2;  3OYL A;  4CCK A;  4ITV A;  3CF2 A;  2UUZ A;  3BCB A;  2CFO A;  4KIS A;  1G8X A;  1Z21 A;  4XQF A;  1X1C A;  2E1M C;  2LYC A;  1D1A A;  4BDY A;  4RLQ A;  1Z3Y A;  4ZDP A;  2VJ4 A;  3W2V A;  4PFO A;  3PNV A;  4PFP A;  2VQL A;  1PYV A;  3D5L A;  3PSF A;  2DT6 A;  2XC7 A;  4XOP A;  4CCN A;  2JSP A;  4KT6 A;  2CH0 A;  4BGD A;  2M4G A;  3H35 A;  3BLY A;  3HC7 A;  3EUK L;  4RMN A;  3OWT A;  4F93 B;  1LFP A;  5HNH A;  2VAS A;  4XOT A;  4DBR A;  1Y6I A;  2A6T A;  3D5R C;  2ZFU A;  2W00 A;  3VYS B;  4PUS A;  2XSJ C;  4P5O A;  1SFK A;  3K4J A;  2MD0 A;  2HQA A;  4II2 A;  1P9Q C;  2V1N A;  3L2Q A;  4DOZ A;  3DTI A;  2VJ5 A;  2HVQ A;  2DT7 B;  3TBI A;  3S3N A;  3EUH C;  4BQQ A;  3F9K A;  1N78 A;  4BJ6 C;  4B48 A;  3LFU A;  4ZYA A;  3H9J A;  2HPI A;  4AU7 A;  1MMD A;  2W4S A;  3H5R A;  2HZD A;  4HSR A;  2Q2E B;  4CZC A;  1D1C A;  1QU3 A;  2CV0 A;  3LSG A;  1KON A;  1MMG A;  4OAZ A;  2P0W A;  4LIU A;  4BS9 A;  4CSW A;  4DIQ A;  2CV2 A;  3HOT A;  3OYJ A;  4MLO A;  4BJT A;  4IQJ A;  2FUG 2;  2OV7 A;  2V7F A;  4PSX A;  4XLC A;  2V9K A;  1S9H A;  4HST A;  1GLN A;  4XOR A;  5KCM A;  3S93 A;  2HVS A;  3OYM A;  2VPL A;  4BUP A;  2LG4 A;  4CUG A;  2BVL A;  1SAU A;  4XLA A;  3NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...