1WJDA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, 38 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 16
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjdA00
1WJCA 1WJAA 3HPGA 1KONA 1WJDA 3HPHA 1E0EA 4F3QA 1WJFA 1WJBA 1LFPA 1K6YA 1WJEA 1MW7A 3F9KA
chains in the Genus database with same CATH superfamily
1NHAA 4OIQF 1GV5A 1X4PA 4PJ0C 2RDPA 1ZGWA 4C2TA 4OIOF 5GPAA 2ME0A 4LLLA 4BQQA 1S72I 2DTRA 1JGGA 1YIOA 1HDPA 4ZYHA 2QZ8A 1Q1VA 4RGUA 3HZJA 2BW3B 1W5CC 3S8PA 2IS4A 1ULYA 1YW7A 4OAZA 3DCFA 1SFOJ 1HW5A 2EV5A 2OV7A 3EYYA 3MZ8A 1MIJA 1WGXA 4CYCB 2P5VA 2PX9A 2QQ9A 1OCTC 4MTDA 4D5FA 4RB3C 2X6WA 1XG1A 3R60A 2BY3A 1C0WA 2EA4A 1W5TA 3DQVC 3GEZA 4M9XA 2JQ7A 2VJJA 1H9GA 3CD6I 1IXSB 2DA7A 3Q9SA 1XX5A 4HV6A 2AS5F 1P92A 3EUAA 1B59A 2Y75A 4M73A 4TV7A 2BW3A 1X1PA 5B1BH 3ZQIA 2NVUB 2ZJRF 1MBHA 1FZPB 4MGRA 1E3HA 1XMAA 2XB5A 3OSGA 3E1SA 1A04A 2QUFA 4KA4A 1D0XA 3MEXA 5ERIA 4AD9A 4CYCA 2GXGA 4OMYA 4UHTA 3ERED 1GV2A 3LOCA 3LSPA 2VJ5A 1RR7A 4W1UA 3RZOJ 1FSEA 5ICEA 3FK7A 5D5UB 4M3GA 4HQMA 2O7OA 2DLLA 5JFRA 1HA8A 1N25A 2VC1A 4FQGA 2YU3A 2M0CA 2WWYA 3DLLF 2A6HF 3TL4X 2KRCA 1W36D 1W4MA 4XRFA 4ON0A 3FXKA 3QU3A 4EQQA 4P55A 2RN7A 5HDGA 4U7BA 1T33A 2BGCA 2XF6A 2Y2ZA 1VQ7I 1HKQA 3TW7A 1FIAA 5HNHA 1J5YA 2V6EA 2JT1A 5CVIA 4DYRA 4NB5A 3HOUJ 2XAGA 2EFWA 1U2WA 2KISA 3CCEI 4NC6A 2R7ZJ 2V26A 1VF9A 1J2XA 2JA5J 2DA4A 5CYVA 3L1PA 4B43A 3FM3A 4BJTA 3TO9A 3RQIA 1IW7F 4IHTA 1MMDA 2Y9ZA 1FY7A 5FRMA 3H3ZA 3SYTA 1U78A 3CCQI 3JRHA 1TWAJ 2CSOA 4IQ4A 2M2EA 4WX9A 2KKOA 3E6DA 1PP7U 2R0QC 1MDMB 3BCBA 2I5UA 3P7NA 2P7CB 3E7LA 5EG0B 2CQ7A 3GF2A 4QPQA 3K0LA 1JHFA 3DBHB 4H0EA 2MLKA 3LA7A 1HW2A 1YJ9I 1X1CA 2VI6A 2Y0MA 4N9HA 3WTVC 3M4OJ 2E35A 3BQZA 1HOMA 4I0BA 2HOSA 4U7DA 4C2UA 3CMAI 2E71A 2F5CA 3H5NA 3RSNA 4Y7NJ 2CV2A 3G73A 4JBAA 4HV5A 1FX7A 2QSGX 3FISA 1REPC 2OAZA 3EUHA 1MDMA 3LWFA 4K2EA 5EG0A 1IXRC 1DU6A 1KONA 3DKYA 4OIPF 3BQYA 1HDDC 3DFGA 1D0ZA 4IOCF 4WWCA 4P1WA 1TWGJ 3M07A 3IP4B 3JW4A 2H1KA 1MZBA 2HYJA 2HQRA 2VIXA 1J9IA 4ZYEA 2XHKA 2CFXA 3MKYB 4I7HA 2GOMA 1P7IA 3QP5A 5HLTA 4Z6YA 1W1WE 3TDUC 1UHWA 1Z7LA 2KDZA 3HSFA 3OYMA 3PL8A 1HXDA 3WGGA 2MC3A 4AIJA 2WY8Q 4MIMA 2W84A 3KZYA 4C3IJ 4RM2A 1WJDA 2LYCA 1MNDA 4BHBA 2L2OA 3GTLJ 3S14J 3FXRA 5FD6A 2EPFA 1UJ8A 1IN5A 5E3OA 2P6TA 3G71I 1SD4A 3DWLE 4HG2A 4HNVA 3A0BC 4ZYAA 2VT2A 4A69C 2ZXWH 3O6BB 4WXHA 2HZDA 2ESNA 2COMA 3KP4A 5D6EA 3BJOA 2LNBA 2LF7A 4I98B 1VQ6I 4XRMA 3R4KA 1LQ1A 3T5XA 2P4WA 1YO5C 2NVXJ 2E7XA 4O6JA 2Z33A 1Z9CA 2VQLA 3CCRI 5M5YJ 3COAC 1ZGAA 1ZYRF 4LMYA 4IVNA 2VBWA 5FGMA 5H6QA 2LP0A 3SZTA 3DTEA 1BJZA 4X0GA 1SD6A 1OMIA 1MNMC 3EETA 4GFBA 2XASA 2CQQA 3K4BA 2HXIA 4A6DA 5M3MJ 2K4JA 1SANA 2O8KA 4XMYA 3L9FA 2QQBA 3OYNA 5B66C 1VQ9I 4CYDA 2CW7A 3OYBA 2DU9A 1IN7A 2VBZA 1L0OC 5E1XA 5F0CA 2XAUA 5HDNA 1FBUA 3FZVA 1FNNA 2ZJQF 1KU9A 2XAJA 2FU4A 3MVPA 1TNSA 1WHUA 3BP8A 2ISYA 3CLQA 3FF5A 3K7AJ 4ZYDA 2FF4A 2CWEA 3ZMVA 1VQOI 3BC8A 2E5ZA 1JKRC 3C2BA 4AYBA 4XKCA 1NG6A 3BZCA 3K9TA 1FJLA 1IRZA 3NARA 4E7LA 2F48A 2H27A 4BU2A 2ID3A 2LMDA 3TP0A 1LVKA 2DAOA 1YS7A 5DM6F 5LFAA 1T39A 4M3FA 3HJEA 3S16J 3BR1A 1DGWY 2R7QA 3KCCA 3J7AY 2RQPA 4XOTA 1MGTA 1GUUA 4RS8A 2O0YA 3CJNA 3HIFA 5FB2A 5DD4A 4PJNA 3F8FA 1FYMA 1A6QA 4EV0A 4CCOA 2EA2A 1UG0A 2OBPA 3HC7A 3FM5A 4XKBA 1ETQA 1Z6TA 3ML6A 3CUQC 1ZELA 2GA1A 5L3CA 1TWHJ 1D8KA 5HS9A 1F43A 1DP3A 2CG4A 3RJPA 3PUFA 3SEZA 5D6FA 3JRGA 5E1ZB 5JLWA 3ZR8X 5F0FA 1ZK8A 3IUOA 2Z99A 2JVHA 3TOBA 3UNGC 1KU2A 1Y0UA 2CQXA 5DV5A 5FRNA 1DU0A 1BA5A 3ZQ7A 1Y8RB 2E2HJ 1KYWA 4B44A 3VYTB 5IP6A 1LNWA 1GXPA 2VOOA 2XRNA 4YFNF 4M9SA 3NAUA 3FXLA 4UUVA 1X3ZB 4W97A 2LTPA 1YJNI 1EJ9A 3JTHA 2R7RA 1UMQA 2V1XA 2DT6A 5FLXZ 3I58A 2KL4A 3WE3A 2BXYA 2R3SA 1P7JA 1RZ4A 5FO5A 1QPMA 2K86A 3UKGA 4XLFA 3VYRB 1QGPA 1D5YA 3OOUA 4JYKA 3T8TA 2BZTA 5LGTA 3M3YJ 5E17F 4V2FA 5C3EJ 1CQTA 1YX5A 4XKWA 1O7LA 5CKTA 2VUMJ 4MQ9F 1S7OA 2LKXA 4GYGA 3KEQA 5AONA 2HDDA 3RKYA 1ERDA 1O3TA 2HR3A 2BYVE 2M9HA 2LR8A 5E20A 3V7CA 1XDUA 4RLFA 2GM4A 3GTMJ 3A02A 2EB7A 1OCPA 2LKSA 4ZDPA 2LK2A 2ZNZA 5DS9A 3J7AO 3QRFF 2K5CA 2EFPA 4XM3A 3EPZA 3AG3H 1TNTA 4A3LJ 3L2VA 4BL0B 3FBNB 1MBKA 2K3FA 5C4JJ 2UV1A 3X2QH 1CGPA 2ELHA 3K4NA 3IL2A 1T56A 2KRFA 3TP3A 3GTJJ 1ZN2A 1XTAA 3WU0A 2W7NA 4XONA 3H35A 5L3FA 5EJCA 4CA0A 2HFHA 4FETA 3ABLH 2V9VA 1UB9A 2O6GE 2DW4A 2Y31A 1JGSA 2ZMEB 3LFKA 1IRGA 2X85A 5FKOA 4M3EA 3ZQHA 3OYCA 4I01A 3SJMA 2R92J 2FOKA 1KQ9A 4WK8F 3SDGA 2RC4A 1IXCA 1ZTRA 5GAGJ 2PMZA 3WG7H 1T08B 4A3JJ 1MH4A 4EATA 2DXIA 1ZG3A 5CLSA 1LEBA 3DPLC 3DLAA 5GAHJ 3AKZA 1GVDA 1TQIA 3NWTA 3KYCB 1T95A 4PJMA 2JRMA 2IGKA 2LY2A 4FE7A 2FE3A 4A0XA 1J59A 1MMSA 4BHCA 2VASA 2GQQA 1DPUA 3VWBA 3K1MA 4II3A 4B8XA 4ASNA 3VYSB 2ZMEA 1G4DA 2ID6A 5A2QZ 5IOYA 1XCVA 2NNNA 5J40A 3CF2A 3HTSB 3C2GA 4RAYA 3RKWA 1BW6A 1EA3A 4I02A 4FTHA 5LEKA 2KLOA 4EEFG 4BXFA 2FNPA 2YS9A 2MFZA 3B6CA 2DYRH 2EZIA 2E5NA 2HDWA 1Z3XA 4GCVA 2EILH 2L7ZA 4L9NA 5TRDA 4RB0A 3PNVA 2W4SA 3NWSA 3VFZA 3WTUC 2OQRA 1X4OA 2CQKA 3J80Z 2XC7A 1Z1DA 3HTUA 1O3RA 1OYIA 4IRHA 2DI3A 3E5XA 4CCMA 3HOTA 3FXOA 2NOGA 2UXXA 4GYIA 4EMSA 2H6CA 4ABZA 2DMQA 4Y33A 3K4JA 4XK4A 2HYFA 2F4OB 1XGSA 3HHHA 1A6IA 4EGYA 1ZG5A 2IP2A 2KIUA 5FROA 1JKQC 3DPUA 2XIGA 3ZMSA 5CVUA 5BNGA 2XSJC 3F23A 4AWXB 3ASOH 2HI3A 2ZMEC 3D5LA 4FX0A 1FOXA 3OYGA 1WVRA 2DYSH 3HXLA 2CGPA 5JI6A 4A3FJ 3FIWA 5KHDA 1OCCH 3WTSC 3FXJA 1X3WB 1MBFA 2ETHA 2QKLB 3AG1H 3OYLA 1WZ2A 4XRSG 2XGDA 4E7JA 2VN2A 3L00A 2RGVA 3RQ4A 2MGQA 2XUBA 4GXOA 4PGHA 2HKXA 1T0FA 3MWMA 2FQ4A 2MD0A 3C18A 4A5NA 3OYIA 3ZQQA 1Z21A 1B6AA 2FOWA 2KZGA 2DO7A 2FSWA 3G1MA 3QWLA 3M7GA 2VONA 2AHQA 4CCKA 3AAFA 4BACA 3KP6A 4V2GA 2V1DA 2A07F 4KN4X 4HF2A 3H1CA 1V54H 1VZ0A 2WC2A 5CVVA 4XLHA 4Q4ZF 1O3QA 4UVCA 3A0HC 4RDUA 4P9FA 1S7AA 2DFEA 4XSZF 3PIOF 3H9JA 2FD5A 1H8AC 2NRAC 3CO7C 3FHNA 4GO1A 1G59A 3DBRB 2M34A 5L3DA 1AOYA 2IPQX 2Y0SN 4L5IA 1L3LA 1K78B 3LA2A 4F55A 1AHDP 4CHUA 1ZH5A 1G2HA 3RIRA 5LRRA 5L3GA 1JJ6C 1UZCA 3Q3SA 3SXYA 3BG7A 2ECBA 1LFPA 2F5DA 2RREA 2CYYA 3BTJA 4XBFA 3I0TA 3ZQFA 1ZRFA 1T0FC 1LDKB 4KT6A 5B1AH 1BM9A 5HLGA 2L4MA 2K3PA 3PQKA 3JAMK 2R7SA 1I6HJ 4RM3A 2R5ZB 2JA8J 2BY1A 5DEQA 2FA5A 3L2UA 1K79A 4AIKA 3M1EA 3F21A 2ADUA 4BKXA 2EV0A 1FYLA 4HZFA 3HOSA 2K4BA 5IT9K 4MTEA 1K78A 2N8GA 3U1KA 3K4CA 4V19K 3QQAA 3U2RA 2KIFA 2ZSIB 1PJRA 2HPIA 5LBQA 3C2HA 1FBQA 4LD5A 5K5RA 4E7HA 1NG7A 2E2JJ 5EEHA 4ZZLA 3PJRA 3DKXA 4MNUA 3DBLB 3S32A 4XLPF 2R5ZA 2X1CA 4A3CJ 2QF7A 2FXAA 4F7ZA 4XIDA 2MH2A 1STZA 2Y9YA 3VPRA 4AVZA 1IF1A 4Q47A 5GAEJ 5LGUA 5GPCA 2BVLA 3K70D 1IN4A 2YX7A 3QP6A 3CDIA 5IT3A 3A01B 4KICA 3CMEI 4M74A 1W7PD 1YYVA 1Z05A 4JQFA 1RKWA 2VE9A 5LGNA 3V8JA 1ZR4A 4BY1J 2X4HA 3ABTA 5K5OA 3TDZC 2EIMH 2I10A 2DT5A 2JTVA 3UR3C 4E7IA 3MCZA 2HYGD 1U8BA 1OYYA 2LVSA 1WFXA 3V8KA 2E34A 3L2CA 1ETOA 1FEXA 4YEJA 1ETKA 2EIKH 2RQQA 2W25A 3BR3A 3GTGJ 1I5ZA 3CC4I 1JTYA 2H8WA 2H94A 2ME6A 3DTKA 1FIPA 3BCAA 1V5FA 2A6EF 2DJIA 2BHZA 3HSEA 4HNTA 1G3SA 3HOWJ 1XGNA 2WB1N 3TMOA 3E3VA 2DFHA 4OOIA 4L0YB 3A01A 1MJAA 4ZZDA 4BH9A 1MMNA 1UHMA 4ITVA 1E2XA 2V79A 4P96A 2OPTA 3ROUA 5DCFA 4AIDA 2HVRA 3CESA 3JSPA 5LD2C 3S1RJ 2EFOA 1I1SA 1G8XA 3HOXJ 2OUMA 2ZJPF 3CDHA 1LE8B 2DK5A 3KIOA 3G1LA 2M7BA 4D7NA 3MMYB 4CSWA 2HQAA 2OTLI 3KZIC 2ZC2A 1DUXC 3CMMA 2BVMA 2WADA 3EDPA 3HYIA 3TO6A 4E6KG 4Q48A 1GT0C 2FBKA 1R4NB 3WE2A 4YFXF 2R7OA 2E36A 1X1DA 2Y30A 2DFIA 2DN0A 2L3DA 1G3YA 3I3LA 3V42A 2Y69H 2YX4A 1H9TA 2JVGA 5AIQA 1S7EA 1TTYA 1U8RA 5KAFC 3CUOA 4HAMA 4OWRB 4DIQA 1RESA 1PUFB 1K4SA 1LE8A 2R7VA 1RR8C 2LSOA 4CO8A 2CW0F 4XRSA 1R1TA 3OV8A 2G7HA 4IOAF 4ENMA 2LF8A 5GP9A 3VODA 4DGWB 2KT0A 1EKEA 2EINH 1WJ5A 1ZG1A 4XQFA 4XICA 4A3EJ 3BTCA 2XPUA 4IHVA 1JJ8C 4B47A 3DP7A 1MD0A 1DGRM 2MC4A 3BPXA 4L9TA 2X6OA 3HPHA 4JX5A 3ELKA 1H89C 1RKTA 1PUFA 1XMKA 5J1YA 5FKMA 3IV5A 1USTA 2F6CA 2Q1ZB 1KGSA 4C30A 5LEJA 3H9GA 2KJBA 5IYCJ 2XGEA 4E4HA 5F6FA 2L7FP 2KDOA 3JREA 1EH7A 5F1JA 1GDTA 2VQGA 4D9JA 2XAQA 2JUGA 2NVTJ 2EK5A 1V3FA 4ANJA 1MMGA 2FQ3A 3WGIA 2M0MA 3M9AA 3A03A 5ED4A 2K9QA 1BI3A 2CUEA 3PNYA 1OKRA 3OS2A 1W7PB 1SVOA 3HKZN 3FKIJ 3ZN0A 3W2WA 2LD5A 2M87A 3LSIA 4CH7A 3TGNA 4B48A 4Y3OA 1VQKI 3S1MJ 3CC7I 2O03A 2MBFA 5DTDA 2MSYA 1WH7A 2QCOA 3G2BA 3BTIA 1IAWA 3JSOA 2IRFG 4L9VA 3LSGA 4IJAA 1Y0NA 5F08A 3K2AA 2IW5A 4U88A 1U9NA 1WPKA 2DT7B 2DA3A 3MKLA 3ULQB 4E7SA 2KHMA 3MKWB 3WGHA 1W7PA 2CMPA 4Z2YA 3IWZA 4OAYA 3D1NI 4CDGA 2FBHA 4KIGA 1HSJA 3MKZA 4YIIA 3WTYC 1LFBA 2VC0A 2IA2A 1VQMI 3LSRA 3ESWB 3J81Z 1IUFA 2CUJA 2FBIA 2QLZA 3GLXA 4CXFA 3OIQA 2X6XA 1TQPA 4BQOA 2JSCA 4DQ2A 4UVBA 1BR2A 4UVAA 3QU6A 1LFUP 4XLEA 4UNOA 5D8LB 2A3SA 2X1EA 3VYUB 2XAHA 4OINF 1YRNB 3LFUA 1IV8A 1B4AA 1SD7A 2HTSA 3EUHC 3U21A 1XSDA 3J7YJ 3CJRB 5ILSA 3HOVJ 3F0CA 4B1RA 3DEUA 3JRDA 2W1OA 2M4KA 4HPQA 4A3KJ 3PQJA 4WXDA 5D5XB 2RVCA 1U5TB 3F22A 2DMPA 1MBGA 1OISA 1I39A 2HVQA 4ZC3A 3REOA 5F27A 3K70C 2YPRA 2EZHA 2PFBA 1GXQA 4IX7A 3PSFA 3HRMA 4A3IJ 2R7WA 1R1VA 1YRNA 4BHPA 3K69A 1N77A 3HRUA 4AVPA 3LNQA 4F91B 2CO5A 3S17J 2IEKA 5L3BA 2HNHA 2LC2A 1HCRA 3CP2A 1E17A 3CCSI 1TQMA 3W6JB 3S2DJ 1W5SA 2EFQA 1OJLA 3GFMA 2HOTA 1U5TA 2H09A 1ZGJA 3F6OA 1R7JA 3BR6A 2HOEA 2A5YB 4HF0A 1SVLA 3OYKA 4PJJA 5J8FA 3OR2C 2CRGA 3IH2A 2DOFA 3I55I 4UV8A 2CFOA 1YE9A 3K4KA 1QHGA 4DOZA 1BC7C 1Y39A 3PO3J 3K6GA 4KISA 1B9MA 3BR2A 2OC6A 2L01A 4I2OA 2XB0X 2X51A 1UAAA 5JLXA 3E6MA 2BY0A 4BS9A 1YFHA 2YU9J 5TGTA 1DPRA 3HHGA 2D1VA 1T6SA 5E79C 3N05A 4ESFA 2AXLA 3TEDA 4GRIA 1VQ4I 4KNYA 4NC8A 3H36A 3DKWA 3HBLA 3TO7A 1P4XA 5D4SA 5EF6A 5K7HA 5FKNA 2X48A 4L18B 4FISA 5C44J 4LG0B 1XMXA 3SFIA 4KN7X 2LOOA 3S1NJ 1QNTA 1BOBA 2QYOA 4JOMA 1TWCJ 3I4NJ 3BT9A 1LPQA 1U5TC 2F4IA 3W2VA 3BY6A 1IV6A 2HWVA 2JZYA 1YTYA 5ILUA 1OFCX 4RLQA 3AFHA 1XC5A 3A1YA 4LOCA 1IDYA 1U6GA 2J5PA 3I56I 3EUKL 3QODA 5HDKA 2IA0A 1QPIA 5LRSA 1HBXG 1ZREA 4LG0A 2VT3A 1WJFA 1FOKA 2K85A 3BZ6A 2DODA 3PNTA 1AU7A 1KQ0A 3M1CA 5F04A 4BY7J 3KP7A 1FT9A 1UCRA 3FXQA 5BS6A 4G12A 3SEQA 2DOEA 2WAQN 2E1MB 4R8HA 4I76A 2B63J 3FX3A 3E0JB 4M9ZA 4AC0A 4E7KA 2W00A 5JHFA 3OIOA 1BIAA 5K1YA 1B8IB 1ITYA 1FMWA 1QZZA 4XL9A 4RBOA 3GTQJ 2DA1A 3Q0VA 1R4MB 2Y48A 4OIRF 3S2HJ 3GTPJ 4HNUA 1RC9A 1Z91A 1K7AA 1LB2A 3KP5A 3QPHA 2CQNA 1LVAA 1D1AA 1BI1A 2NXNB 1QVUA 3I53A 2A5WA 2X9DA 3KLNA 2O61A 1OQYA 5E8GA 5BMZA 1ENHA 1TWFJ 1WJCA 1D1BA 1A31A 1LDJA 3JR9A 1IN8A 3H3VK 4UB6C 3C3WA 1E3OC 2ESHA 5DDGA 4ZTFA 1W0TA 2M7AA 1FP2A 1V5EA 3RZDJ 1USSA 4PK4A 1B8IA 4D0PA 2FX0A 3F8CA 3E6BA 3I9V2 3TOAA 2L0KA 2JMWA 1R1UA 5HLIA 1TZLA 2OQGA 3OYJA 2NAZA 3OR1C 4A12A 4BQAA 2XAFA 1UELB 1S8NA 3P9CA 6PAXA 5DM7F 3P9IA 5KNLA 4EVIA 1Y8QB 2WAFA 3QOPA 2ELJA 3QPTA 3FWEA 4HX7A 1YI2I 1XD7A 2GXAA 4DZPA 4M3BA 3JRBA 2LFBA 2L5QA 1FC3A 3JCUC 4MFEA 4S04A 1JXSA 2H1LA 2ICWG 1ZR2A 3G3ZA 3ISPA 1AWCA 3T8RA 3ZXSA 4J00A 5E8IA 2Q8KA 1X3UA 3VOEA 2JJ7A 1DDNA 2FUG2 3QAHA 3OMYA 3MAJA 3F9KA 4P9UA 2QA4I 1ONVA 1Z7UA 1JKPC 4M3DA 5FD5A 3Q0UA 1QZEA 3LSHA 3MQ0A 4UUTA 4BDYA 4N4OB 4X1EA 3QPLA 2D45A 1ORKA 2F2EA 2E1MC 1TC3C 4UY8I 2B7EA 4YRVA 2D5VA 2QEXI 2W57A 1A35A 4AU7A 2R4GA 1JUMA 2HTJA 4L5JA 3L2QA 3HDDA 5D5WB 1FSHA 5GTIC 4E7ZA 4YG2F 2GIZA 4B4CA 4FASD 5CVRA 1YLFA 4NBQA 2X1DA 2X6YA 3HGGA 5BQTA 4MHGA 3GTOJ 3I4MJ 3S1QJ 1QBJA 1X1AA 2FEZA 1BR1A 2PMUA 4G94A 3KPHA 2Z16A 1VQPI 1NK3P 4IRIA 2ECCA 4LK1F 5GTHC 2JUCA 1B72B 2CU7A 3NEUA 2VQCA 2BV6A 1XSVA 3I64A 3S93A 3IKTA 3ZPLA 2COBA 3ABKH 1QQIA 2GWRA 5BOXA 5CVJA 3JRIA 1MMAA 3O3KA 2VXDA 1BW5A 3F3XA 3IWFA 4ENNA 1R58A 2L4AA 4LB6B 1TP4A 4DBQA 3BG6A 3GFLA 1SMYF 3DU5A 1JI8A 3OWTA 4RGRA 4QSHA 5KK1A 4J19A 2PN6A 2EH3A 4FT8A 3CMYA 3W6KB 4PFOA 2IS2A 3KYLA 2R7DA 2GZWA 2XPWA 3ZOBA 1TL8A 1BIBA 1OLTA 4KYWA 3I71A 1HQCA 2M45A 4QLCU 1B72A 4IQJA 2DFFA 2STWA 2HZTA 3WODF 2LREA 3JAMZ 2R7FA 1YW8A 5J4VA 3G6EI 5HS7A 1KU7A 5TISC 2MG4A 4BE1A 3BWGA 5IP7J 5IYDJ 1TW3A 4F3QA 2KRHA 5E18F 5ICCA 4KJZA 3ZCOA 2D1HA 3P9KA 2BE5F 1JUSA 5KVRA 1ZHFA 4A0YA 2HOAA 3WTXC 3KE2A 5FKLA 2NVYJ 2V6CA 1S6LA 3ASNH 3V7RA 1G3TA 1JT6A 5HS8A 1I6XA 3BG9A 2UXNA 4DBRA 2P5LC 1MSFC 2M30A 4LK0F 2DDAA 2DTZA 3VDXA 1F1ZA 3OS1A 2L7KA 3H0GJ 3QPSA 4BGDA 1XDSA 4L9JA 4C2MJ 1RPWA 4M6YA 2IJLA 2ZXIA 2GBYA 2K40A 2O9LA 2K02A 2QKMB 4BBRJ 4XOPA 4BXXJ 4A6EA 2JA2A 4XN3A 1MSEC 2FNAA 4XKVA 3M8FA 4QPOA 1XGMA 2L9NA 2V4JC 2IBDA 4J01A 3CJQB 1Z77A 4M71A 3LMMA 5EGOB 4HDUA 4KDPA 1R23A 4CZZA 4IHYA 3GMEA 4RMNA 1P9QC 3LAJA 2A05A 1U0JA 2E1OA 2STTA 3BZKA 3E5UA 4IKFA 2IS6A 1Y6IA 4RGSA 1VQ5I 3IKVA 5HOOA 4R79A 2LY9A 3GFJA 3IH3A 2ZO4A 3F8NA 2GXBA 4HX4A 1WSUA 4LIVA 3CZ6A 3RKXA 5IYBJ 2O5RA 2DA2A 4U0VA 3RCOA 2M8GX 1RNLA 1SAUA 1WCMJ 1P4AA 2ZXHA 2LG4A 3KYDB 4LJZF 4LIUA 4F52A 3K1NA 1XS9A 2P6SA 3W6VA 1QRYA 2XKOA 2Y0SA 3JRCA 3TW6A 3R6SA 3IRRA 3LAPA 1FP1D 1QZYA 4ESJA 3RKQA 3M8EA 4MO7A 1IUYA 2E1NA 4F92B 4KMUX 2DBBA 2DPDA 3DPTA 5E3MA 2CV1A 3CP8A 3G4SI 5JHUA 2E60A 1MH3A 2PG4A 1JHHA 1G3WA 2JK3A 2DJNA 4RAGA 3AG4H 2V9KA 3DEWA 3ZGKA 1I3QJ 3IHUA 2LY1A 3DEEA 1TLHB 2NOJB 3GUDA 4XSXF 1YHQI 2EZKA 1XGOA 4IZZA 4C3JJ 1Z6RA 4I6ZA 5J1RA 4QIWN 4IL6C 2OF7A 1I3AA 4I09A 3HG9A 3F6VA 1T2KA 3GBGA 5DUKA 1WQ2A 2HGCA 1WJAA 1FOWA 3BJ6A 3J80K 3ZMUA 3OYEA 2GLOA 4KIBA 2ZSHB 4XLCA 5FJ8J 3DTIA 2R7UA 1Y1VJ 2VJ4A 3CTAA 4IF4A 3CF5F 3WU2C 2F5VA 4ZDLA 1J75A 1YG2A 2BEOA 2LLKA 3KETA 4XR6A 2PEXA 3GW2A 3H92A 1XN7A 4M6VA 2B9SA 1JTXA 3A2KA 5E1WA 2VQHA 1IG7A 1X58A 2NS8A 3O8GA 1X1BA 2P81A 2ZFUA 5M3FJ 2RKHA 3OYFA 4HX8A 3IAM2 3TBIA 1X19A 2ZXJA 2P7VB 2MLGA 3GO5A 1OYWA 2Z1DA 5DUIA 2IVMA 3TKYA 2V1UA 3ABUA 5CPRB 4CZCA 2QVOA 3S3OA 1K83J 1FMVA 2K9LA 4BE0A 2AO9A 4HA8A 1MJBA 2IAIA 3T1BA 3FXMA 4DW6A 2WB1A 2EQRA 3IAS2 3ZN1A 3H0DA 1KYZA 2D2WA 3FBIB 3K2ZA 2L54A 3OYHA 4JK1X 2PMHA 2MYSA 1D1CA 2X0LA 3KFWX 1I1GA 3SQNA 3PFIA 3DF8A 2CV0A 2QWWA 4U87A 3ZRGA 3CCJI 2BHYA 1CF7B 4KMFA 4A3BJ 5J8CA 1B1BA 2EWNA 2B0LA 1ETVA 2TRTA 4HEA2 4LB5A 3I54A 1I50J 2OCCH 1F5TA 3GYHX 4IHSA 5FKKA 3SZGA 5EZGA 5D4RA 5JVTA 1F9NA 1OCOH 3C1DA 2FRHA 3KP3A 3A4CA 5D8KB 4AM3A 3KZZA 1D8JA 3ZQGA 3HOZJ 1NH3A 4C3HJ 4YIRX 5GADJ 4HLXA 2YUSA 2CS3A 1P6RA 3GWZA 2TDXA 2E1CA 3ZMTA 2A68F 1CF7A 1VQLI 2RNJA 4N0BA 1S3JA 3IC7A 4FE4A 4IO9F 3BLYA 5HVQC 1KU3A 1IJWC 2MD5A 2Z9OA 1ACIA 4I0AA 1V55H 1XB4A 1XCBA 2YR2A 3LL7A 4BUPA 1R9TJ 4CUGA 2G7UA 2JN6A 2KIMA 2HEOA 2PQ8A 2RAEA 3T0YA 2VXZA 3P5JA 3CQZJ 1RRJA 1O7FA 4DYQA 1VQ8I 3WG9A 2L9VA 3FMSA 1VFCA 4HRIA 1X2MA 4HF1A 2W85A 4FX4A 4A3GJ 4O5VA 2XGXA 3CO6C 4PSWA 2P5KA 2NNYA 3OL3A 3CCVI 3ERMA 1F36A 5CQEA 3WTTC 3HPGA 1UG2A 4CCJA 3LSTA 2IXSA 3FKJA 3LSJA 2CW8A 2M5WA 2XPVA 2KZVA 4G6DA 3MZYA 4R1HA 4S05A 3GVAA 1IRFA 3HKZA 4LITA 3C7JA 3BTLA 4PZJA 2A61A 3SHFA 2DK8A 4MEXF 2XGCA 4LG3A 4NHJA 1ZLJA 3ABMH 1SVMA 1YJWI 1B9NA 4KFCA 4M6XA 4NDLA 2PI0A 2HQNA 4D1QA 1OCRH 1R71A 2H8RA 4Y52J 3SZPA 2BBYA 4ENKA 4JX4A 2F4MB 3FK6A 2VKEA 1RIOH 3ECOA 4CCNA 4WXCA 4YFKF 5IY5H 4PUSA 4PSXA 2G9WA 3DXJF 1FOYA 5D5VB 1EF4A 3N4MA 2DQRA 3K4MA 5M5WJ 2BY2A 4EJWA 1VI0A 2XF5A 3D5SC 2L9SA 3BROA 4ZYGA 1U9OA 5JR3A 1S5LC 1T98A 1W0UA 4MQVA 1Y56A 3D5RC 4WF2A 3KLOA 4BDZA 3L2RA 3H5AA 3LSKA 4GDFA 1D3YA 5J6XA 1YOVB 2EZLA 2Q0OA 1ETXA 2DMNA 4A0ZA 2VBXA 3OSFA 2ZFWA 3Q9VA 2IGNA 3LA3A 2K9MA 3F8MA 4HW0A 2JWTA 3BR5A 3MN2A 3H9QA 1Z67A 1X2NA 1YQAA 4DJAA 2KJCA 4G8XA 1SFKA 4XORA 3OOPA 4BAYA 3MFKA 4G7ZF 1XPXA 5E3NA 1EH6A 3OYAA 2KIQA 4DYCA 1YW9A 4FCYA 3S2WA 1ZAOA 3FMRA 4UUSB 2JPCA 2XKPA 1FTZA 4N4NB 2PJRB 1BBYA 4PCQA 5DCMB 2VKHA 3S15J 1XSXA 3QYBA 4RAZA 2L02A 1P4WA 2AXTC 5J4YA 1SD5A 2KP6A 4QTRA 3JTGA 2P8TA 3WHBA 1BJAA 3Q0WA 4A3DJ 3V4GA 3BG5A 2VJIA 3WHCA 4EM2A 2Z2SB 2VOPA 3HGYA 4NNJA 2JA6J 1R6RA 1GLNA 3MZHA 4A2UA 2ZB9A 4RAFA 3CUQB 3SFZA 2W48A 5FLMJ 4B3AA 9ANTA 2OD5A 2QM3A 1BI0A 5EZHA 4LGWA 3VSKA 4ESBA 4UUSA 3ZQLA 2PJRA 5DCMA 2K9SA 3GCMA 2JA7J 3ZMDA 1VTNC 3CC2I 2CJJA 2F5FA 1BN5A 1ON1A 3RDIA 3HRTA 4Y17A 3PUBA 1A36A 2FJ1A 3HL2A 1AKHB 3GLLA 2W24A 1K61A 1SFEA 1HC8A 2O8XA 3S3MA 1JT0A 3H3UA 4UB8C 4ZJZA 2Z3YA 2OU2A 5CJ9A 3ZMZA 1FLIA 5FLVA 3CUQA 2M8EA 2ZNYA 3QYFA 4HSRA 2LBFB 1D0YA 1K6OA 4I99C 4AYBN 3O2PE 3LSMA 2QQAA 1HF0A 2QENA 4BE2A 4G7OF 5F64A 3J81K 1NK2P 1O57A 2ELKA 3B02A 4RA2A 1JE8A 4EM1A 3CDLA 1HLVA 3B73A 2VPRA 3RYRA 1W36C 3ECHA 4B3XA 1K6YA 2HS5A 4ZH4F 1AKHA 4NC7A 3G1OA 3GZNB 4UXNA 3ZP5A 3R0AA 2DMUA 1GHCA 2VLAA 3HB9A 3F8BA 3TQNA 4MLOA 2VB6A 3AL0B 3QOEA 3LQRA 4BNCA 2IGOA 3ONQA 4KIFA 4B09A 3I59B 2HKOA 1SMTA 1RETA 1ODDA 2LBFA 4LLNA 1TW2A 2DOAA 1MNEA 4DZJA 3NRVA 5EEAA 3CLOA 4HYEA 1E3PA 5E3LA 3FDYA 5J3LA 4G9YA 2BOLA 1SEUA 4A3MJ 4P5OA 2WAQA 3RPQA 4HOBA 2IT0A 5TJJA 5IP9J 5J47A 2JPBA 3VEPA 4OMZA 2OJED 3CCMI 5K7ZA 2PLYA 3GZ6A 2E2IJ 4PFPA 4Y15A 4AIHA 4Y13A 3O8HA 4M72A 1DQUA 1R00A 5B3SH 1JKOC 4S0HB 5F1RA 1APLC 3I59A 2K9NA 3E6CC 4BJ5C 3GX4X 1TT0A 4CICA 1PVEA 3OL4A 2OCEA 1SC7A 3GZ5A 2EFNA 1RUOA 2MW8A 2EBIA 4U0WA 1EH8A 2DA6A 2OZ6A 4G7HF 1ZQ3P 1VQNI 2LKPA 4MFDA 4HQEA 3PO2J 2C6YA 2DCEA 1O3SA 4G6QA 4KUMA 3PIPF 5HODA 2XF7A 1PUEE 4D5CA 4O3MA 3WU1B 1KA8A 1R22A 1M1EB 4HBLA 2V9PA 1OR7A 2NYXA 4NQWB 4EGZA 1IO2A 1IN6A 5J1UA 5EEGA 4NUBA 3WTWC 5LLQA 4A5MA 2HVSA 1FYKA 2IGMA 1MJ9A 2OTJI 5EDNA 2RV8A 4IPAA 4C9YA 3EYIA 2XROA 4EJUA 1WI9A 1SFXA 4HLYA 2PJPA 1WRJA 1YX3A 3VSLA 3FHZA 3AL0C 3AG2H 2R7TA 1PP8F 2PBIA 5KCMA 1Z0XA 5IPAA 3KEYA 4PDKA 2E19A 4RB2C 4II2A 1BOAA 4IXAA 2XRLA 1JUPA 1D5VA 2GAUA 3RTRA 4E70A 4NQWA 3KX2A 1S29A 4EJVA 3GTKJ 1R49A 2BXZA 1KZHA 2DA5A 3Q5FA 4PJLA 3IH4A 2NS7A 3KEOA 1WH5A 1IZ1A 2JRTA 2UUZA 1QVTA 3PFYA 3R0JA 4UV9A 1MBJA 3NQOA 1QHHD 3RPUD 3BPVA 2HXOA 1OR7C 4HSTA 3BDDA 1F4KA 3W3CA 1IDZA 1TT5B 2QSHX 3EQLF 1V5GA 3PM1A 2KMUA 4YIFA 1LUJB 1H88C 4RGXA 1AA7A 2DPUA 3V8LA 2DMTA 4L5EA 1R36A 2K27A 4XN0A 2LRDA 5ILVA 2QQ8A 1R5ID 2PMZN 2VKDA 2V7FA 4DNCA 3CJTB 1ON2A 4ZTJA 4YELA 3I4PA 4IHWA 1OPCA 3CCYA 1DP7P 4GGGA 2KQRA 2WTEA 3S3NA 3LQQA 3OY9A 1Q1HA 2J5OA 2UWMA 3GFIA 3V7SA 1OCZH 4Y4RA 1ZRDA 1Z3YA 2VKVA 2R93J 2WBMA 4IHXA 3FMQA 1K4TA 1NTCA 1FWZA 2H6BA 2MABA 2QSFX 5ICGA 5HNFA 5DYMA 5FLXK 3L2WA 2ACJA 5F0HA 1RI7A 1S9HA 3OYDA 3H5RA 4KT5C 4EJOA 3HOYJ 1HSTA 2GOXB 5IT9Z 5FFXA 2FMYA 2MH9A 3W2AA 3E5QA 3QYEA 5B5EC 2YSRA 2K7LA 2M1BA 1KQ8A 1YS6A 2M4GA 4H4KC 3HM5A 4MEYF 4RB1A 1IRXA 3BG3A 4BEHB 5H2FC 4ZDOA 2HU9A 4ENJA 2HDCA 1BL0A 5KAIC 4JP0A 1Y1WJ 3DV8A 4BQNA 3JRFA 4CCLA 2A6TA 2VL8A 2IA1A 2GA2A 1UFMA 2EV6A 5BPDA 4QWQA 2WY7Q 2OA4A 3SDBA 3RI4A 1TBXA 1SFUA 1U3EM 3U9GA 1FTTA 3VB2A 2ZCWA 2I8DA 2NS0A 1WJBA 4ETSA 1SAXA 4PGGA 2R5YB 2KFDA 2WAEA 2V1NA 5DD8A 1ZLKA 1YITI 2XV4S 3BR0A 3J7ZI 4BEHA 2QGUA 2M3AA 3K1PA 1H0MA 2FMLA 5IOZA 2E7WA 2WV0A 5LHIA 1WI3A 2LDUA 3HSRA 3HRSA 2CH0A 3E97A 4G6TB 1PYVA 2F5EA 1FPQA 1WWXA 5C4XJ 2Q2EB 1A5JA 2UZKA 1RUNA 3HUGB 5JVGF 4U0YA 4IEJA 3IRQA 3OIPA 2XDVA 5H6RA 1MBEA 4FHTA 4CGZA 1MW7A 5L3EA 2R5YA 4IRGA 4JX6A 4KITB 3CCLI 4F93B 1LEAA 1BC8C 2G0EA 1J7KA 3BOQA 4XLNF 3L09A 1N78A 2Z5UA 2W82A 3F72A 1FBSA 1J0RA 2VBYA 3B6AA 1ETWA 4N9IA 4BJ6C 1WKMA 1QO0D 1G6NA 3WTZA 4X6AJ 2HQ5A 2XSDC 5HLHA 5FFZA 5EGOA 1GVJA 5K5QA 3CCUI 2Q2EA 5H20A 2VODA 2CUFA 3HUGA 4BBSJ 1E0EA 3U1DA 3R61A 3I5UA 1J09A 2P0WA 4EM0B 4HDVA 1HW1A 1ZRCA 5M5XJ 5A2QK 4LFUA 5EYRA 1UHSA 2L7MP 2WV1A 1HKTA 1LJ9A 2DDBA 1BR4A 5BPIA 3N97A 2ZJ2A 2TCTA 3RYPA 4A93J 4WCGA 1R5HA 5LHGA 1O4XA 1POGA 2GIVA 1R5GA 1VNDA 3K4LA 3PSIA 4LLGF 3RPUA 5LHHA 3L7WA 2ISZA 3M8JA 1EV7A 3MD2A 2HPMA 1V4RA 1YIJI 1QU3A 3JRAA 1ZARA 2DQLA 2OZUA 2VPLA 1WJEA 2EJRA 2QBYB 1I27A 1IGNA 2LH9A 2MA3A 5K7FA 2O3FA 4BXUA 1MKMA 4XNFA 2CUZA 3DU6A 5ICFA 1P2FA 1T38A 2IS1A 1LDDA 5AIPA 5CQGA 2R7XA 2JSPA 3K10A 4Q5SF 3GXOA 3KP2A 2KPMA 1T8IA 2NVQJ 2VE8A 4EJTA 1N75A 1PDNC 4XLAA 2EIJH 3BJAA 4BYYA 3ZQCA 4D7MA 4OU0A 1BI2A 4L0ZB 1HKSA 4AUXA 2A69F 2L9RA 2XVCA 2AQFA 2AQEA 3D0SA 1ZKGA 2ZBKA 3FXUA 2QBYA 3HEFA 1LKXA 2ZKZA 3OS0A 1ETYA 1QA6A 1IC8A 2RNGA 2WA0A
chains in the Genus database with same CATH topology
1Z3XA 3M1CA 3PNVA 1X4PA 2W4SA 4C2TA 3NWSA 3SEQA 4BQQA 1X4OA 4CCNA 2E1MB 2XC7A 3E0JB 4E7KA 2BW3B 2W00A 4PUSA 3S8PA 4PSXA 5JHFA 2IS4A 4OAZA 1FMWA 4CCMA 3HOTA 3K4MA 4XL9A 2OV7A 2XF5A 3D5SC 2L9SA 4Y33A 3K4JA 4HNUA 2X6WA 5FROA 3DPUA 1D1AA 2A5WA 2XSJC 1Y56A 3D5RC 3DQVC 4BDZA 3D5LA 3L2RA 3H5AA 3LSKA 2VJJA 1WJCA 3OYGA 1D1BA 3HXLA 3EUAA 2IGNA 5KHDA 2K9MA 4ZTFA 2BW3A 2M7AA 1V5EA 2QKLB 3OYLA 4PK4A 4E7JA 3E1SA 3RQ4A 3I9V2 3H9QA 1D0XA 4DJAA 3OYJA 1TZLA 2MD0A 3OR1C 1SFKA 4XORA 1UELB 3OYIA 3ZQQA 1Z21A 5KNLA 2VJ5A 3OYAA 2WAFA 2ELJA 4N4NB 4CCKA 2PJRB 1HA8A 4BACA 2L5QA 2VKHA 3QYBA 3TL4X 2KRCA 1W36D 1VZ0A 2KP6A 4XLHA 3ZXSA 4J00A 2VJIA 2FUG2 4U7BA 3OMYA 3F9KA 2Z2SB 2XF6A 4NNJA 3H9JA 3LSHA 4BDYA 1R6RA 4N4OB 1GLNA 5HNHA 3FHNA 1G59A 2V6EA 2E1MC 4F55A 4YRVA 3VSKA 2V26A 4AU7A 2PJRA 2R4GA 4B43A 3L2QA 4BJTA 3BG7A 2RREA 1LFPA 4E7ZA 4FASD 1MMDA 1T0FC 2X1DA 1LDKB 2X6YA 4KT6A 5FRMA 3SYTA 2K3PA 3PUBA 1X1AA 4IQ4A 2R7SA 3HL2A 4RM3A 3L2UA 1BR1A 3S3MA 2Z16A 3BCBA 4ZJZA 3HOSA 2VQCA 4QPQA 3S93A 3K4CA 3QYFA 4HSRA 2LBFB 1D0YA 2ZSIB 1PJRA 1X1CA 2HPIA 3C2HA 3LSMA 4BE2A 4E7HA 1NG7A 1MMAA 2VXDA 3PJRA 3DKXA 4DBQA 1JI8A 3BG6A 1W36C 3DU5A 4B3XA 3OWTA 1K6YA 4C2UA 3S32A 4NC7A 2X1CA 4PFOA 3H5NA 3RSNA 2IS2A 2CV2A 3KYLA 1OLTA 2VLAA 4AVZA 4MLOA 2VB6A 3AL0B 3QOEA 2IGOA 3ONQA 4IQJA 2BVLA 3K70D 2LBFA 1KONA 2LREA 3DKYA 2DOAA 1MNEA 1D0ZA 4JQFA 4P1WA 3IP4B 4BE1A 3FDYA 2BOLA 2VIXA 4F3QA 2KRHA 4E7IA 3UR3C 4P5OA 4KJZA 2WAQA 3ZCOA 1WFXA 4YEJA 3MKYB 2GOMA 2RQQA 5HLTA 1Z7LA 4PFPA 3OYMA 3PL8A 3DTKA 1DQUA 3BCAA 1V5FA 2DJIA 4HNTA 4DBRA 3TMOA 4BJ5C 1TT0A 2WY8Q 3OL4A 1MMNA 4ITVA 3VDXA 3OS1A 2L7KA 4RM2A 4BGDA 1WJDA 2LYCA 1MNDA 2HVRA 3CESA 2L2OA 5LD2C 2ZXIA 1G8XA 2OUMA 2QKMB 4XOPA 2DCEA 2M7BA 3MMYB 4CSWA 2HQAA 2JA2A 4XN3A 2XF7A 3DWLE 3CMMA 2BVMA 4HG2A 2WADA 4XKVA 4QPOA 2L9NA 2V4JC 4E6KG 4J01A 4ZYAA 3CJQB 4NQWB 3LMMA 4NUBA 2R7OA 1X1DA 2HZDA 1P9QC 4RMNA 3V42A 2HVSA 3I3LA 1U0JA 2IGMA 2JVGA 4C9YA 4IKFA 2IS6A 1Y6IA 4OWRB 5HOOA 4DIQA 4R79A 3VSLA 1YX3A 2R7VA 3AL0C 2R7TA 2VQLA 4LIVA 5KCMA 3CZ6A 2O5RA 3KEYA 3RCOA 4II2A 1SAUA 4DGWB 3DTEA 3RTRA 4X0GA 1WJ5A 2ZXHA 2LG4A 3KX2A 4LIUA 4F52A 4XQFA 2Y0SA 3K4BA 4B47A 4PJLA 1DGRM 4XMYA 2MC4A 3OYNA 4F92B 2UUZA 3PFYA 2CW7A 3HPHA 3DPTA 2CV1A 3OYBA 1QHHD 3CP8A 3RPUD 1OR7C 2E60A 2F6CA 4HSTA 2Q1ZB 3W3CA 2XAUA 4C30A 1V5GA 3H9GA 2KMUA 2V9KA 3ZGKA 1AA7A 4E4HA 2KDOA 2LY1A 3DEEA 2NOJB 4XN0A 2LRDA 2VQGA 4D9JA 4IZZA 2VKDA 2JUGA 2V7FA 3BC8A 3HG9A 4ANJA 1MMGA 2E5ZA 4YELA 2M0MA 4ZTJA 4AYBA 3GBGA 4XKCA 1NG6A 3OYEA 1WJAA 3PNYA 2KQRA 4E7LA 3S3NA 3OS2A 4BU2A 2ZSHB 4XLCA 3OY9A 1LVKA 3DTIA 2R7UA 5LFAA 3W2WA 2UWMA 2VJ4A 3LSIA 4Y4RA 1Z3YA 4CH7A 4B48A 2WBMA 4Y3OA 2F5VA 4ZDLA 1DGWY 2MABA 2R7QA 3J7AY 5HNFA 4XOTA 4XR6A 3G2BA 3L2WA 3LSGA 3A2KA 2VQHA 1S9HA 4PJNA 3H5RA 3OYDA 4CCOA 2GOXB 1X1BA 2ZFUA 2DT7B 3W2AA 1UG0A 4E7SA 3QYEA 2KHMA 3OYFA 3HC7A 3IAM2 3MKWB 3TBIA 1X19A 4XKBA 2CMPA 2M4GA 4H4KC 1ZELA 4ZDOA 4OAYA 1IRXA 4BEHB 2HU9A 3MKZA 1DP3A 2Z1DA 3SEZA 5CPRB 4BQNA 4CZCA 3ZR8X 4CCLA 2A6TA 2CUJA 2VL8A 3S3OA 3IUOA 3OIQA 2JVHA 2X6XA 3UNGC 2WY7Q 5FRNA 3SDBA 4BQOA 1FMVA 1BR2A 2K9LA 4BE0A 4XLEA 4B44A 3VYTB 2X1EA 3VYUB 2WB1A 3LFUA 2I8DA 1WJBA 3IAS2 3H0DA 2WAEA 2V1NA 3EUHC 3U21A 2R7RA 3FBIB 3CJRB 3OYHA 2DT6A 4BEHA 2KL4A 2M3AA 2M4KA 2W1OA 2MYSA 4HPQA 1D1CA 2CH0A 4XLFA 4G6TB 3VYRB 1PYVA 3ZRGA 4U87A 2CV0A 3OOUA 2HVQA 4ZC3A 2Q2EB 3K70C 4IX7A 3HUGB 3PSFA 1YX5A 4XKWA 4HEA2 3OIPA 5CKTA 2R7WA 2XDVA 1MW7A 1N77A 4KITB 3SZGA 4F93B 4F91B 1ERDA 2HNHA 2LC2A 3CP2A 1N78A 3A4CA 2W82A 4RLFA 4ZDPA 4BJ6C 2CS3A 2K5CA 4XM3A 3EPZA 3OYKA 4PJJA 3L2VA 4BL0B 3OR2C 1E0EA 2CFOA 3FBNB 1YE9A 1J09A 2P0WA 3BLYA 5HVQC 2UV1A 3K4KA 1QHGA 4DOZA 3K4NA 3K6GA 4KISA 2OC6A 3LL7A 4BUPA 2X51A 2W7NA 4CUGA 1UAAA 4XONA 3H35A 4BS9A 1BR4A 4CA0A 5TGTA 4FETA 3N05A 2VXZA 2E5NA 3K4LA 3PSIA 4GRIA 4NC8A 2X85A 3M8JA 3MD2A 2HPMA 1QU3A 4HRIA 3OYCA 2VPLA 1WJEA 2LH9A 4PSWA 2PMZA 2LOOA 1BOBA 3OL3A 4JOMA 4XNFA 4EATA 2DXIA 2CUZA 3DU6A 5CQEA 3DPLC 3HPGA 3DLAA 4CCJA 3AKZA 2F4IA 2IS1A 3NWTA 2IXSA 5CQGA 1T95A 3FKJA 4PJMA 3W2VA 2JSPA 2R7XA 2IGKA 3K10A 2LY2A 2CW8A 2KZVA 2KPMA 2VASA 3HKZA 1N75A 4LITA 4XLAA 3VWBA 4RLQA 4II3A 3AFHA 3A1YA 3VYSB 4LG3A 3EUKL 3QODA 3CF2A 3C2GA 1EA3A 2AQFA 2AQEA 2KLOA 4BXFA 1LKXA 1WJFA 2MFZA 3OS0A 4D1QA 2RNGA 2HDWA 2WA0A 3PNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJC A;  1WJA A;  3HPG A;  1KON A;  1WJD A;  3HPH A;  1E0E A;  4F3Q A;  1WJF A;  1WJB A;  1LFP A;  1K6Y A;  1WJE A;  1MW7 A;  3F9K A; 
#chains in the Genus database with same CATH topology
 1NHA A;  4OIQ F;  1GV5 A;  1X4P A;  4PJ0 C;  2RDP A;  1ZGW A;  4C2T A;  4OIO F;  5GPA A;  2ME0 A;  4LLL A;  4BQQ A;  1S72 I;  2DTR A;  1JGG A;  1YIO A;  1HDP A;  4ZYH A;  2QZ8 A;  1Q1V A;  4RGU A;  3HZJ A;  2BW3 B;  1W5C C;  3S8P A;  2IS4 A;  1ULY A;  1YW7 A;  4OAZ A;  3DCF A;  1SFO J;  1HW5 A;  2EV5 A;  2OV7 A;  3EYY A;  3MZ8 A;  1MIJ A;  1WGX A;  4CYC B;  2P5V A;  2PX9 A;  2QQ9 A;  1OCT C;  4MTD A;  4D5F A;  4RB3 C;  2X6W A;  1XG1 A;  3R60 A;  2BY3 A;  1C0W A;  2EA4 A;  1W5T A;  3DQV C;  3GEZ A;  4M9X A;  2JQ7 A;  2VJJ A;  1H9G A;  3CD6 I;  1IXS B;  2DA7 A;  3Q9S A;  1XX5 A;  4HV6 A;  2AS5 F;  1P92 A;  3EUA A;  1B59 A;  2Y75 A;  4M73 A;  4TV7 A;  2BW3 A;  1X1P A;  5B1B H;  3ZQI A;  2NVU B;  2ZJR F;  1MBH A;  1FZP B;  4MGR A;  1E3H A;  1XMA A;  2XB5 A;  3OSG A;  3E1S A;  1A04 A;  2QUF A;  4KA4 A;  1D0X A;  3MEX A;  5ERI A;  4AD9 A;  4CYC A;  2GXG A;  4OMY A;  4UHT A;  3ERE D;  1GV2 A;  3LOC A;  3LSP A;  2VJ5 A;  1RR7 A;  4W1U A;  3RZO J;  1FSE A;  5ICE A;  3FK7 A;  5D5U B;  4M3G A;  4HQM A;  2O7O A;  2DLL A;  5JFR A;  1HA8 A;  1N25 A;  2VC1 A;  4FQG A;  2YU3 A;  2M0C A;  2WWY A;  3DLL F;  2A6H F;  3TL4 X;  2KRC A;  1W36 D;  1W4M A;  4XRF A;  4ON0 A;  3FXK A;  3QU3 A;  4EQQ A;  4P55 A;  2RN7 A;  5HDG A;  4U7B A;  1T33 A;  2BGC A;  2XF6 A;  2Y2Z A;  1VQ7 I;  1HKQ A;  3TW7 A;  1FIA A;  5HNH A;  1J5Y A;  2V6E A;  2JT1 A;  5CVI A;  4DYR A;  4NB5 A;  3HOU J;  2XAG A;  2EFW A;  1U2W A;  2KIS A;  3CCE I;  4NC6 A;  2R7Z J;  2V26 A;  1VF9 A;  1J2X A;  2JA5 J;  2DA4 A;  5CYV A;  3L1P A;  4B43 A;  3FM3 A;  4BJT A;  3TO9 A;  3RQI A;  1IW7 F;  4IHT A;  1MMD A;  2Y9Z A;  1FY7 A;  5FRM A;  3H3Z A;  3SYT A;  1U78 A;  3CCQ I;  3JRH A;  1TWA J;  2CSO A;  4IQ4 A;  2M2E A;  4WX9 A;  2KKO A;  3E6D A;  1PP7 U;  2R0Q C;  1MDM B;  3BCB A;  2I5U A;  3P7N A;  2P7C B;  3E7L A;  5EG0 B;  2CQ7 A;  3GF2 A;  4QPQ A;  3K0L A;  1JHF A;  3DBH B;  4H0E A;  2MLK A;  3LA7 A;  1HW2 A;  1YJ9 I;  1X1C A;  2VI6 A;  2Y0M A;  4N9H A;  3WTV C;  3M4O J;  2E35 A;  3BQZ A;  1HOM A;  4I0B A;  2HOS A;  4U7D A;  4C2U A;  3CMA I;  2E71 A;  2F5C A;  3H5N A;  3RSN A;  4Y7N J;  2CV2 A;  3G73 A;  4JBA A;  4HV5 A;  1FX7 A;  2QSG X;  3FIS A;  1REP C;  2OAZ A;  3EUH A;  1MDM A;  3LWF A;  4K2E A;  5EG0 A;  1IXR C;  1DU6 A;  1KON A;  3DKY A;  4OIP F;  3BQY A;  1HDD C;  3DFG A;  1D0Z A;  4IOC F;  4WWC A;  4P1W A;  1TWG J;  3M07 A;  3IP4 B;  3JW4 A;  2H1K A;  1MZB A;  2HYJ A;  2HQR A;  2VIX A;  1J9I A;  4ZYE A;  2XHK A;  2CFX A;  3MKY B;  4I7H A;  2GOM A;  1P7I A;  3QP5 A;  5HLT A;  4Z6Y A;  1W1W E;  3TDU C;  1UHW A;  1Z7L A;  2KDZ A;  3HSF A;  3OYM A;  3PL8 A;  1HXD A;  3WGG A;  2MC3 A;  4AIJ A;  2WY8 Q;  4MIM A;  2W84 A;  3KZY A;  4C3I J;  4RM2 A;  1WJD A;  2LYC A;  1MND A;  4BHB A;  2L2O A;  3GTL J;  3S14 J;  3FXR A;  5FD6 A;  2EPF A;  1UJ8 A;  1IN5 A;  5E3O A;  2P6T A;  3G71 I;  1SD4 A;  3DWL E;  4HG2 A;  4HNV A;  3A0B C;  4ZYA A;  2VT2 A;  4A69 C;  2ZXW H;  3O6B B;  4WXH A;  2HZD A;  2ESN A;  2COM A;  3KP4 A;  5D6E A;  3BJO A;  2LNB A;  2LF7 A;  4I98 B;  1VQ6 I;  4XRM A;  3R4K A;  1LQ1 A;  3T5X A;  2P4W A;  1YO5 C;  2NVX J;  2E7X A;  4O6J A;  2Z33 A;  1Z9C A;  2VQL A;  3CCR I;  5M5Y J;  3COA C;  1ZGA A;  1ZYR F;  4LMY A;  4IVN A;  2VBW A;  5FGM A;  5H6Q A;  2LP0 A;  3SZT A;  3DTE A;  1BJZ A;  4X0G A;  1SD6 A;  1OMI A;  1MNM C;  3EET A;  4GFB A;  2XAS A;  2CQQ A;  3K4B A;  2HXI A;  4A6D A;  5M3M J;  2K4J A;  1SAN A;  2O8K A;  4XMY A;  3L9F A;  2QQB A;  3OYN A;  5B66 C;  1VQ9 I;  4CYD A;  2CW7 A;  3OYB A;  2DU9 A;  1IN7 A;  2VBZ A;  1L0O C;  5E1X A;  5F0C A;  2XAU A;  5HDN A;  1FBU A;  3FZV A;  1FNN A;  2ZJQ F;  1KU9 A;  2XAJ A;  2FU4 A;  3MVP A;  1TNS A;  1WHU A;  3BP8 A;  2ISY A;  3CLQ A;  3FF5 A;  3K7A J;  4ZYD A;  2FF4 A;  2CWE A;  3ZMV A;  1VQO I;  3BC8 A;  2E5Z A;  1JKR C;  3C2B A;  4AYB A;  4XKC A;  1NG6 A;  3BZC A;  3K9T A;  1FJL A;  1IRZ A;  3NAR A;  4E7L A;  2F48 A;  2H27 A;  4BU2 A;  2ID3 A;  2LMD A;  3TP0 A;  1LVK A;  2DAO A;  1YS7 A;  5DM6 F;  5LFA A;  1T39 A;  4M3F A;  3HJE A;  3S16 J;  3BR1 A;  1DGW Y;  2R7Q A;  3KCC A;  3J7A Y;  2RQP A;  4XOT A;  1MGT A;  1GUU A;  4RS8 A;  2O0Y A;  3CJN A;  3HIF A;  5FB2 A;  5DD4 A;  4PJN A;  3F8F A;  1FYM A;  1A6Q A;  4EV0 A;  4CCO A;  2EA2 A;  1UG0 A;  2OBP A;  3HC7 A;  3FM5 A;  4XKB A;  1ETQ A;  1Z6T A;  3ML6 A;  3CUQ C;  1ZEL A;  2GA1 A;  5L3C A;  1TWH J;  1D8K A;  5HS9 A;  1F43 A;  1DP3 A;  2CG4 A;  3RJP A;  3PUF A;  3SEZ A;  5D6F A;  3JRG A;  5E1Z B;  5JLW A;  3ZR8 X;  5F0F A;  1ZK8 A;  3IUO A;  2Z99 A;  2JVH A;  3TOB A;  3UNG C;  1KU2 A;  1Y0U A;  2CQX A;  5DV5 A;  5FRN A;  1DU0 A;  1BA5 A;  3ZQ7 A;  1Y8R B;  2E2H J;  1KYW A;  4B44 A;  3VYT B;  5IP6 A;  1LNW A;  1GXP A;  2VOO A;  2XRN A;  4YFN F;  4M9S A;  3NAU A;  3FXL A;  4UUV A;  1X3Z B;  4W97 A;  2LTP A;  1YJN I;  1EJ9 A;  3JTH A;  2R7R A;  1UMQ A;  2V1X A;  2DT6 A;  5FLX Z;  3I58 A;  2KL4 A;  3WE3 A;  2BXY A;  2R3S A;  1P7J A;  1RZ4 A;  5FO5 A;  1QPM A;  2K86 A;  3UKG A;  4XLF A;  3VYR B;  1QGP A;  1D5Y A;  3OOU A;  4JYK A;  3T8T A;  2BZT A;  5LGT A;  3M3Y J;  5E17 F;  4V2F A;  5C3E J;  1CQT A;  1YX5 A;  4XKW A;  1O7L A;  5CKT A;  2VUM J;  4MQ9 F;  1S7O A;  2LKX A;  4GYG A;  3KEQ A;  5AON A;  2HDD A;  3RKY A;  1ERD A;  1O3T A;  2HR3 A;  2BYV E;  2M9H A;  2LR8 A;  5E20 A;  3V7C A;  1XDU A;  4RLF A;  2GM4 A;  3GTM J;  3A02 A;  2EB7 A;  1OCP A;  2LKS A;  4ZDP A;  2LK2 A;  2ZNZ A;  5DS9 A;  3J7A O;  3QRF F;  2K5C A;  2EFP A;  4XM3 A;  3EPZ A;  3AG3 H;  1TNT A;  4A3L J;  3L2V A;  4BL0 B;  3FBN B;  1MBK A;  2K3F A;  5C4J J;  2UV1 A;  3X2Q H;  1CGP A;  2ELH A;  3K4N A;  3IL2 A;  1T56 A;  2KRF A;  3TP3 A;  3GTJ J;  1ZN2 A;  1XTA A;  3WU0 A;  2W7N A;  4XON A;  3H35 A;  5L3F A;  5EJC A;  4CA0 A;  2HFH A;  4FET A;  3ABL H;  2V9V A;  1UB9 A;  2O6G E;  2DW4 A;  2Y31 A;  1JGS A;  2ZME B;  3LFK A;  1IRG A;  2X85 A;  5FKO A;  4M3E A;  3ZQH A;  3OYC A;  4I01 A;  3SJM A;  2R92 J;  2FOK A;  1KQ9 A;  4WK8 F;  3SDG A;  2RC4 A;  1IXC A;  1ZTR A;  5GAG J;  2PMZ A;  3WG7 H;  1T08 B;  4A3J J;  1MH4 A;  4EAT A;  2DXI A;  1ZG3 A;  5CLS A;  1LEB A;  3DPL C;  3DLA A;  5GAH J;  3AKZ A;  1GVD A;  1TQI A;  3NWT A;  3KYC B;  1T95 A;  4PJM A;  2JRM A;  2IGK A;  2LY2 A;  4FE7 A;  2FE3 A;  4A0X A;  1J59 A;  1MMS A;  4BHC A;  2VAS A;  2GQQ A;  1DPU A;  3VWB A;  3K1M A;  4II3 A;  4B8X A;  4ASN A;  3VYS B;  2ZME A;  1G4D A;  2ID6 A;  5A2Q Z;  5IOY A;  1XCV A;  2NNN A;  5J40 A;  3CF2 A;  3HTS B;  3C2G A;  4RAY A;  3RKW A;  1BW6 A;  1EA3 A;  4I02 A;  4FTH A;  5LEK A;  2KLO A;  4EEF G;  4BXF A;  2FNP A;  2YS9 A;  2MFZ A;  3B6C A;  2DYR H;  2EZI A;  2E5N A;  2HDW A;  1Z3X A;  4GCV A;  2EIL H;  2L7Z A;  4L9N A;  5TRD A;  4RB0 A;  3PNV A;  2W4S A;  3NWS A;  3VFZ A;  3WTU C;  2OQR A;  1X4O A;  2CQK A;  3J80 Z;  2XC7 A;  1Z1D A;  3HTU A;  1O3R A;  1OYI A;  4IRH A;  2DI3 A;  3E5X A;  4CCM A;  3HOT A;  3FXO A;  2NOG A;  2UXX A;  4GYI A;  4EMS A;  2H6C A;  4ABZ A;  2DMQ A;  4Y33 A;  3K4J A;  4XK4 A;  2HYF A;  2F4O B;  1XGS A;  3HHH A;  1A6I A;  4EGY A;  1ZG5 A;  2IP2 A;  2KIU A;  5FRO A;  1JKQ C;  3DPU A;  2XIG A;  3ZMS A;  5CVU A;  5BNG A;  2XSJ C;  3F23 A;  4AWX B;  3ASO H;  2HI3 A;  2ZME C;  3D5L A;  4FX0 A;  1FOX A;  3OYG A;  1WVR A;  2DYS H;  3HXL A;  2CGP A;  5JI6 A;  4A3F J;  3FIW A;  5KHD A;  1OCC H;  3WTS C;  3FXJ A;  1X3W B;  1MBF A;  2ETH A;  2QKL B;  3AG1 H;  3OYL A;  1WZ2 A;  4XRS G;  2XGD A;  4E7J A;  2VN2 A;  3L00 A;  2RGV A;  3RQ4 A;  2MGQ A;  2XUB A;  4GXO A;  4PGH A;  2HKX A;  1T0F A;  3MWM A;  2FQ4 A;  2MD0 A;  3C18 A;  4A5N A;  3OYI A;  3ZQQ A;  1Z21 A;  1B6A A;  2FOW A;  2KZG A;  2DO7 A;  2FSW A;  3G1M A;  3QWL A;  3M7G A;  2VON A;  2AHQ A;  4CCK A;  3AAF A;  4BAC A;  3KP6 A;  4V2G A;  2V1D A;  2A07 F;  4KN4 X;  4HF2 A;  3H1C A;  1V54 H;  1VZ0 A;  2WC2 A;  5CVV A;  4XLH A;  4Q4Z F;  1O3Q A;  4UVC A;  3A0H C;  4RDU A;  4P9F A;  1S7A A;  2DFE A;  4XSZ F;  3PIO F;  3H9J A;  2FD5 A;  1H8A C;  2NRA C;  3CO7 C;  3FHN A;  4GO1 A;  1G59 A;  3DBR B;  2M34 A;  5L3D A;  1AOY A;  2IPQ X;  2Y0S N;  4L5I A;  1L3L A;  1K78 B;  3LA2 A;  4F55 A;  1AHD P;  4CHU A;  1ZH5 A;  1G2H A;  3RIR A;  5LRR A;  5L3G A;  1JJ6 C;  1UZC A;  3Q3S A;  3SXY A;  3BG7 A;  2ECB A;  1LFP A;  2F5D A;  2RRE A;  2CYY A;  3BTJ A;  4XBF A;  3I0T A;  3ZQF A;  1ZRF A;  1T0F C;  1LDK B;  4KT6 A;  5B1A H;  1BM9 A;  5HLG A;  2L4M A;  2K3P A;  3PQK A;  3JAM K;  2R7S A;  1I6H J;  4RM3 A;  2R5Z B;  2JA8 J;  2BY1 A;  5DEQ A;  2FA5 A;  3L2U A;  1K79 A;  4AIK A;  3M1E A;  3F21 A;  2ADU A;  4BKX A;  2EV0 A;  1FYL A;  4HZF A;  3HOS A;  2K4B A;  5IT9 K;  4MTE A;  1K78 A;  2N8G A;  3U1K A;  3K4C A;  4V19 K;  3QQA A;  3U2R A;  2KIF A;  2ZSI B;  1PJR A;  2HPI A;  5LBQ A;  3C2H A;  1FBQ A;  4LD5 A;  5K5R A;  4E7H A;  1NG7 A;  2E2J J;  5EEH A;  4ZZL A;  3PJR A;  3DKX A;  4MNU A;  3DBL B;  3S32 A;  4XLP F;  2R5Z A;  2X1C A;  4A3C J;  2QF7 A;  2FXA A;  4F7Z A;  4XID A;  2MH2 A;  1STZ A;  2Y9Y A;  3VPR A;  4AVZ A;  1IF1 A;  4Q47 A;  5GAE J;  5LGU A;  5GPC A;  2BVL A;  3K70 D;  1IN4 A;  2YX7 A;  3QP6 A;  3CDI A;  5IT3 A;  3A01 B;  4KIC A;  3CME I;  4M74 A;  1W7P D;  1YYV A;  1Z05 A;  4JQF A;  1RKW A;  2VE9 A;  5LGN A;  3V8J A;  1ZR4 A;  4BY1 J;  2X4H A;  3ABT A;  5K5O A;  3TDZ C;  2EIM H;  2I10 A;  2DT5 A;  2JTV A;  3UR3 C;  4E7I A;  3MCZ A;  2HYG D;  1U8B A;  1OYY A;  2LVS A;  1WFX A;  3V8K A;  2E34 A;  3L2C A;  1ETO A;  1FEX A;  4YEJ A;  1ETK A;  2EIK H;  2RQQ A;  2W25 A;  3BR3 A;  3GTG J;  1I5Z A;  3CC4 I;  1JTY A;  2H8W A;  2H94 A;  2ME6 A;  3DTK A;  1FIP A;  3BCA A;  1V5F A;  2A6E F;  2DJI A;  2BHZ A;  3HSE A;  4HNT A;  1G3S A;  3HOW J;  1XGN A;  2WB1 N;  3TMO A;  3E3V A;  2DFH A;  4OOI A;  4L0Y B;  3A01 A;  1MJA A;  4ZZD A;  4BH9 A;  1MMN A;  1UHM A;  4ITV A;  1E2X A;  2V79 A;  4P96 A;  2OPT A;  3ROU A;  5DCF A;  4AID A;  2HVR A;  3CES A;  3JSP A;  5LD2 C;  3S1R J;  2EFO A;  1I1S A;  1G8X A;  3HOX J;  2OUM A;  2ZJP F;  3CDH A;  1LE8 B;  2DK5 A;  3KIO A;  3G1L A;  2M7B A;  4D7N A;  3MMY B;  4CSW A;  2HQA A;  2OTL I;  3KZI C;  2ZC2 A;  1DUX C;  3CMM A;  2BVM A;  2WAD A;  3EDP A;  3HYI A;  3TO6 A;  4E6K G;  4Q48 A;  1GT0 C;  2FBK A;  1R4N B;  3WE2 A;  4YFX F;  2R7O A;  2E36 A;  1X1D A;  2Y30 A;  2DFI A;  2DN0 A;  2L3D A;  1G3Y A;  3I3L A;  3V42 A;  2Y69 H;  2YX4 A;  1H9T A;  2JVG A;  5AIQ A;  1S7E A;  1TTY A;  1U8R A;  5KAF C;  3CUO A;  4HAM A;  4OWR B;  4DIQ A;  1RES A;  1PUF B;  1K4S A;  1LE8 A;  2R7V A;  1RR8 C;  2LSO A;  4CO8 A;  2CW0 F;  4XRS A;  1R1T A;  3OV8 A;  2G7H A;  4IOA F;  4ENM A;  2LF8 A;  5GP9 A;  3VOD A;  4DGW B;  2KT0 A;  1EKE A;  2EIN H;  1WJ5 A;  1ZG1 A;  4XQF A;  4XIC A;  4A3E J;  3BTC A;  2XPU A;  4IHV A;  1JJ8 C;  4B47 A;  3DP7 A;  1MD0 A;  1DGR M;  2MC4 A;  3BPX A;  4L9T A;  2X6O A;  3HPH A;  4JX5 A;  3ELK A;  1H89 C;  1RKT A;  1PUF A;  1XMK A;  5J1Y A;  5FKM A;  3IV5 A;  1UST A;  2F6C A;  2Q1Z B;  1KGS A;  4C30 A;  5LEJ A;  3H9G A;  2KJB A;  5IYC J;  2XGE A;  4E4H A;  5F6F A;  2L7F P;  2KDO A;  3JRE A;  1EH7 A;  5F1J A;  1GDT A;  2VQG A;  4D9J A;  2XAQ A;  2JUG A;  2NVT J;  2EK5 A;  1V3F A;  4ANJ A;  1MMG A;  2FQ3 A;  3WGI A;  2M0M A;  3M9A A;  3A03 A;  5ED4 A;  2K9Q A;  1BI3 A;  2CUE A;  3PNY A;  1OKR A;  3OS2 A;  1W7P B;  1SVO A;  3HKZ N;  3FKI J;  3ZN0 A;  3W2W A;  2LD5 A;  2M87 A;  3LSI A;  4CH7 A;  3TGN A;  4B48 A;  4Y3O A;  1VQK I;  3S1M J;  3CC7 I;  2O03 A;  2MBF A;  5DTD A;  2MSY A;  1WH7 A;  2QCO A;  3G2B A;  3BTI A;  1IAW A;  3JSO A;  2IRF G;  4L9V A;  3LSG A;  4IJA A;  1Y0N A;  5F08 A;  3K2A A;  2IW5 A;  4U88 A;  1U9N A;  1WPK A;  2DT7 B;  2DA3 A;  3MKL A;  3ULQ B;  4E7S A;  2KHM A;  3MKW B;  3WGH A;  1W7P A;  2CMP A;  4Z2Y A;  3IWZ A;  4OAY A;  3D1N I;  4CDG A;  2FBH A;  4KIG A;  1HSJ A;  3MKZ A;  4YII A;  3WTY C;  1LFB A;  2VC0 A;  2IA2 A;  1VQM I;  3LSR A;  3ESW B;  3J81 Z;  1IUF A;  2CUJ A;  2FBI A;  2QLZ A;  3GLX A;  4CXF A;  3OIQ A;  2X6X A;  1TQP A;  4BQO A;  2JSC A;  4DQ2 A;  4UVB A;  1BR2 A;  4UVA A;  3QU6 A;  1LFU P;  4XLE A;  4UNO A;  5D8L B;  2A3S A;  2X1E A;  3VYU B;  2XAH A;  4OIN F;  1YRN B;  3LFU A;  1IV8 A;  1B4A A;  1SD7 A;  2HTS A;  3EUH C;  3U21 A;  1XSD A;  3J7Y J;  3CJR B;  5ILS A;  3HOV J;  3F0C A;  4B1R A;  3DEU A;  3JRD A;  2W1O A;  2M4K A;  4HPQ A;  4A3K J;  3PQJ A;  4WXD A;  5D5X B;  2RVC A;  1U5T B;  3F22 A;  2DMP A;  1MBG A;  1OIS A;  1I39 A;  2HVQ A;  4ZC3 A;  3REO A;  5F27 A;  3K70 C;  2YPR A;  2EZH A;  2PFB A;  1GXQ A;  4IX7 A;  3PSF A;  3HRM A;  4A3I J;  2R7W A;  1R1V A;  1YRN A;  4BHP A;  3K69 A;  1N77 A;  3HRU A;  4AVP A;  3LNQ A;  4F91 B;  2CO5 A;  3S17 J;  2IEK A;  5L3B A;  2HNH A;  2LC2 A;  1HCR A;  3CP2 A;  1E17 A;  3CCS I;  1TQM A;  3W6J B;  3S2D J;  1W5S A;  2EFQ A;  1OJL A;  3GFM A;  2HOT A;  1U5T A;  2H09 A;  1ZGJ A;  3F6O A;  1R7J A;  3BR6 A;  2HOE A;  2A5Y B;  4HF0 A;  1SVL A;  3OYK A;  4PJJ A;  5J8F A;  3OR2 C;  2CRG A;  3IH2 A;  2DOF A;  3I55 I;  4UV8 A;  2CFO A;  1YE9 A;  3K4K A;  1QHG A;  4DOZ A;  1BC7 C;  1Y39 A;  3PO3 J;  3K6G A;  4KIS A;  1B9M A;  3BR2 A;  2OC6 A;  2L01 A;  4I2O A;  2XB0 X;  2X51 A;  1UAA A;  5JLX A;  3E6M A;  2BY0 A;  4BS9 A;  1YFH A;  2YU9 J;  5TGT A;  1DPR A;  3HHG A;  2D1V A;  1T6S A;  5E79 C;  3N05 A;  4ESF A;  2AXL A;  3TED A;  4GRI A;  1VQ4 I;  4KNY A;  4NC8 A;  3H36 A;  3DKW A;  3HBL A;  3TO7 A;  1P4X A;  5D4S A;  5EF6 A;  5K7H A;  5FKN A;  2X48 A;  4L18 B;  4FIS A;  5C44 J;  4LG0 B;  1XMX A;  3SFI A;  4KN7 X;  2LOO A;  3S1N J;  1QNT A;  1BOB A;  2QYO A;  4JOM A;  1TWC J;  3I4N J;  3BT9 A;  1LPQ A;  1U5T C;  2F4I A;  3W2V A;  3BY6 A;  1IV6 A;  2HWV A;  2JZY A;  1YTY A;  5ILU A;  1OFC X;  4RLQ A;  3AFH A;  1XC5 A;  3A1Y A;  4LOC A;  1IDY A;  1U6G A;  2J5P A;  3I56 I;  3EUK L;  3QOD A;  5HDK A;  2IA0 A;  1QPI A;  5LRS A;  1HBX G;  1ZRE A;  4LG0 A;  2VT3 A;  1WJF A;  1FOK A;  2K85 A;  3BZ6 A;  2DOD A;  3PNT A;  1AU7 A;  1KQ0 A;  3M1C A;  5F04 A;  4BY7 J;  3KP7 A;  1FT9 A;  1UCR A;  3FXQ A;  5BS6 A;  4G12 A;  3SEQ A;  2DOE A;  2WAQ N;  2E1M B;  4R8H A;  4I76 A;  2B63 J;  3FX3 A;  3E0J B;  4M9Z A;  4AC0 A;  4E7K A;  2W00 A;  5JHF A;  3OIO A;  1BIA A;  5K1Y A;  1B8I B;  1ITY A;  1FMW A;  1QZZ A;  4XL9 A;  4RBO A;  3GTQ J;  2DA1 A;  3Q0V A;  1R4M B;  2Y48 A;  4OIR F;  3S2H J;  3GTP J;  4HNU A;  1RC9 A;  1Z91 A;  1K7A A;  1LB2 A;  3KP5 A;  3QPH A;  2CQN A;  1LVA A;  1D1A A;  1BI1 A;  2NXN B;  1QVU A;  3I53 A;  2A5W A;  2X9D A;  3KLN A;  2O61 A;  1OQY A;  5E8G A;  5BMZ A;  1ENH A;  1TWF J;  1WJC A;  1D1B A;  1A31 A;  1LDJ A;  3JR9 A;  1IN8 A;  3H3V K;  4UB6 C;  3C3W A;  1E3O C;  2ESH A;  5DDG A;  4ZTF A;  1W0T A;  2M7A A;  1FP2 A;  1V5E A;  3RZD J;  1USS A;  4PK4 A;  1B8I A;  4D0P A;  2FX0 A;  3F8C A;  3E6B A;  3I9V 2;  3TOA A;  2L0K A;  2JMW A;  1R1U A;  5HLI A;  1TZL A;  2OQG A;  3OYJ A;  2NAZ A;  3OR1 C;  4A12 A;  4BQA A;  2XAF A;  1UEL B;  1S8N A;  3P9C A;  6PAX A;  5DM7 F;  3P9I A;  5KNL A;  4EVI A;  1Y8Q B;  2WAF A;  3QOP A;  2ELJ A;  3QPT A;  3FWE A;  4HX7 A;  1YI2 I;  1XD7 A;  2GXA A;  4DZP A;  4M3B A;  3JRB A;  2LFB A;  2L5Q A;  1FC3 A;  3JCU C;  4MFE A;  4S04 A;  1JXS A;  2H1L A;  2ICW G;  1ZR2 A;  3G3Z A;  3ISP A;  1AWC A;  3T8R A;  3ZXS A;  4J00 A;  5E8I A;  2Q8K A;  1X3U A;  3VOE A;  2JJ7 A;  1DDN A;  2FUG 2;  3QAH A;  3OMY A;  3MAJ A;  3F9K A;  4P9U A;  2QA4 I;  1ONV A;  1Z7U A;  1JKP C;  4M3D A;  5FD5 A;  3Q0U A;  1QZE A;  3LSH A;  3MQ0 A;  4UUT A;  4BDY A;  4N4O B;  4X1E A;  3QPL A;  2D45 A;  1ORK A;  2F2E A;  2E1M C;  1TC3 C;  4UY8 I;  2B7E A;  4YRV A;  2D5V A;  2QEX I;  2W57 A;  1A35 A;  4AU7 A;  2R4G A;  1JUM A;  2HTJ A;  4L5J A;  3L2Q A;  3HDD A;  5D5W B;  1FSH A;  5GTI C;  4E7Z A;  4YG2 F;  2GIZ A;  4B4C A;  4FAS D;  5CVR A;  1YLF A;  4NBQ A;  2X1D A;  2X6Y A;  3HGG A;  5BQT A;  4MHG A;  3GTO J;  3I4M J;  3S1Q J;  1QBJ A;  1X1A A;  2FEZ A;  1BR1 A;  2PMU A;  4G94 A;  3KPH A;  2Z16 A;  1VQP I;  1NK3 P;  4IRI A;  2ECC A;  4LK1 F;  5GTH C;  2JUC A;  1B72 B;  2CU7 A;  3NEU A;  2VQC A;  2BV6 A;  1XSV A;  3I64 A;  3S93 A;  3IKT A;  3ZPL A;  2COB A;  3ABK H;  1QQI A;  2GWR A;  5BOX A;  5CVJ A;  3JRI A;  1MMA A;  3O3K A;  2VXD A;  1BW5 A;  3F3X A;  3IWF A;  4ENN A;  1R58 A;  2L4A A;  4LB6 B;  1TP4 A;  4DBQ A;  3BG6 A;  3GFL A;  1SMY F;  3DU5 A;  1JI8 A;  3OWT A;  4RGR A;  4QSH A;  5KK1 A;  4J19 A;  2PN6 A;  2EH3 A;  4FT8 A;  3CMY A;  3W6K B;  4PFO A;  2IS2 A;  3KYL A;  2R7D A;  2GZW A;  2XPW A;  3ZOB A;  1TL8 A;  1BIB A;  1OLT A;  4KYW A;  3I71 A;  1HQC A;  2M45 A;  4QLC U;  1B72 A;  4IQJ A;  2DFF A;  2STW A;  2HZT A;  3WOD F;  2LRE A;  3JAM Z;  2R7F A;  1YW8 A;  5J4V A;  3G6E I;  5HS7 A;  1KU7 A;  5TIS C;  2MG4 A;  4BE1 A;  3BWG A;  5IP7 J;  5IYD J;  1TW3 A;  4F3Q A;  2KRH A;  5E18 F;  5ICC A;  4KJZ A;  3ZCO A;  2D1H A;  3P9K A;  2BE5 F;  1JUS A;  5KVR A;  1ZHF A;  4A0Y A;  2HOA A;  3WTX C;  3KE2 A;  5FKL A;  2NVY J;  2V6C A;  1S6L A;  3ASN H;  3V7R A;  1G3T A;  1JT6 A;  5HS8 A;  1I6X A;  3BG9 A;  2UXN A;  4DBR A;  2P5L C;  1MSF C;  2M30 A;  4LK0 F;  2DDA A;  2DTZ A;  3VDX A;  1F1Z A;  3OS1 A;  2L7K A;  3H0G J;  3QPS A;  4BGD A;  1XDS A;  4L9J A;  4C2M J;  1RPW A;  4M6Y A;  2IJL A;  2ZXI A;  2GBY A;  2K40 A;  2O9L A;  2K02 A;  2QKM B;  4BBR J;  4XOP A;  4BXX J;  4A6E A;  2JA2 A;  4XN3 A;  1MSE C;  2FNA A;  4XKV A;  3M8F A;  4QPO A;  1XGM A;  2L9N A;  2V4J C;  2IBD A;  4J01 A;  3CJQ B;  1Z77 A;  4M71 A;  3LMM A;  5EGO B;  4HDU A;  4KDP A;  1R23 A;  4CZZ A;  4IHY A;  3GME A;  4RMN A;  1P9Q C;  3LAJ A;  2A05 A;  1U0J A;  2E1O A;  2STT A;  3BZK A;  3E5U A;  4IKF A;  2IS6 A;  1Y6I A;  4RGS A;  1VQ5 I;  3IKV A;  5HOO A;  4R79 A;  2LY9 A;  3GFJ A;  3IH3 A;  2ZO4 A;  3F8N A;  2GXB A;  4HX4 A;  1WSU A;  4LIV A;  3CZ6 A;  3RKX A;  5IYB J;  2O5R A;  2DA2 A;  4U0V A;  3RCO A;  2M8G X;  1RNL A;  1SAU A;  1WCM J;  1P4A A;  2ZXH A;  2LG4 A;  3KYD B;  4LJZ F;  4LIU A;  4F52 A;  3K1N A;  1XS9 A;  2P6S A;  3W6V A;  1QRY A;  2XKO A;  2Y0S A;  3JRC A;  3TW6 A;  3R6S A;  3IRR A;  3LAP A;  1FP1 D;  1QZY A;  4ESJ A;  3RKQ A;  3M8E A;  4MO7 A;  1IUY A;  2E1N A;  4F92 B;  4KMU X;  2DBB A;  2DPD A;  3DPT A;  5E3M A;  2CV1 A;  3CP8 A;  3G4S I;  5JHU A;  2E60 A;  1MH3 A;  2PG4 A;  1JHH A;  1G3W A;  2JK3 A;  2DJN A;  4RAG A;  3AG4 H;  2V9K A;  3DEW A;  3ZGK A;  1I3Q J;  3IHU A;  2LY1 A;  3DEE A;  1TLH B;  2NOJ B;  3GUD A;  4XSX F;  1YHQ I;  2EZK A;  1XGO A;  4IZZ A;  4C3J J;  1Z6R A;  4I6Z A;  5J1R A;  4QIW N;  4IL6 C;  2OF7 A;  1I3A A;  4I09 A;  3HG9 A;  3F6V A;  1T2K A;  3GBG A;  5DUK A;  1WQ2 A;  2HGC A;  1WJA A;  1FOW A;  3BJ6 A;  3J80 K;  3ZMU A;  3OYE A;  2GLO A;  4KIB A;  2ZSH B;  4XLC A;  5FJ8 J;  3DTI A;  2R7U A;  1Y1V J;  2VJ4 A;  3CTA A;  4IF4 A;  3CF5 F;  3WU2 C;  2F5V A;  4ZDL A;  1J75 A;  1YG2 A;  2BEO A;  2LLK A;  3KET A;  4XR6 A;  2PEX A;  3GW2 A;  3H92 A;  1XN7 A;  4M6V A;  2B9S A;  1JTX A;  3A2K A;  5E1W A;  2VQH A;  1IG7 A;  1X58 A;  2NS8 A;  3O8G A;  1X1B A;  2P81 A;  2ZFU A;  5M3F J;  2RKH A;  3OYF A;  4HX8 A;  3IAM 2;  3TBI A;  1X19 A;  2ZXJ A;  2P7V B;  2MLG A;  3GO5 A;  1OYW A;  2Z1D A;  5DUI A;  2IVM A;  3TKY A;  2V1U A;  3ABU A;  5CPR B;  4CZC A;  2QVO A;  3S3O A;  1K83 J;  1FMV A;  2K9L A;  4BE0 A;  2AO9 A;  4HA8 A;  1MJB A;  2IAI A;  3T1B A;  3FXM A;  4DW6 A;  2WB1 A;  2EQR A;  3IAS 2;  3ZN1 A;  3H0D A;  1KYZ A;  2D2W A;  3FBI B;  3K2Z A;  2L54 A;  3OYH A;  4JK1 X;  2PMH A;  2MYS A;  1D1C A;  2X0L A;  3KFW X;  1I1G A;  3SQN A;  3PFI A;  3DF8 A;  2CV0 A;  2QWW A;  4U87 A;  3ZRG A;  3CCJ I;  2BHY A;  1CF7 B;  4KMF A;  4A3B J;  5J8C A;  1B1B A;  2EWN A;  2B0L A;  1ETV A;  2TRT A;  4HEA 2;  4LB5 A;  3I54 A;  1I50 J;  2OCC H;  1F5T A;  3GYH X;  4IHS A;  5FKK A;  3SZG A;  5EZG A;  5D4R A;  5JVT A;  1F9N A;  1OCO H;  3C1D A;  2FRH A;  3KP3 A;  3A4C A;  5D8K B;  4AM3 A;  3KZZ A;  1D8J A;  3ZQG A;  3HOZ J;  1NH3 A;  4C3H J;  4YIR X;  5GAD J;  4HLX A;  2YUS A;  2CS3 A;  1P6R A;  3GWZ A;  2TDX A;  2E1C A;  3ZMT A;  2A68 F;  1CF7 A;  1VQL I;  2RNJ A;  4N0B A;  1S3J A;  3IC7 A;  4FE4 A;  4IO9 F;  3BLY A;  5HVQ C;  1KU3 A;  1IJW C;  2MD5 A;  2Z9O A;  1ACI A;  4I0A A;  1V55 H;  1XB4 A;  1XCB A;  2YR2 A;  3LL7 A;  4BUP A;  1R9T J;  4CUG A;  2G7U A;  2JN6 A;  2KIM A;  2HEO A;  2PQ8 A;  2RAE A;  3T0Y A;  2VXZ A;  3P5J A;  3CQZ J;  1RRJ A;  1O7F A;  4DYQ A;  1VQ8 I;  3WG9 A;  2L9V A;  3FMS A;  1VFC A;  4HRI A;  1X2M A;  4HF1 A;  2W85 A;  4FX4 A;  4A3G J;  4O5V A;  2XGX A;  3CO6 C;  4PSW A;  2P5K A;  2NNY A;  3OL3 A;  3CCV I;  3ERM A;  1F36 A;  5CQE A;  3WTT C;  3HPG A;  1UG2 A;  4CCJ A;  3LST A;  2IXS A;  3FKJ A;  3LSJ A;  2CW8 A;  2M5W A;  2XPV A;  2KZV A;  4G6D A;  3MZY A;  4R1H A;  4S05 A;  3GVA A;  1IRF A;  3HKZ A;  4LIT A;  3C7J A;  3BTL A;  4PZJ A;  2A61 A;  3SHF A;  2DK8 A;  4MEX F;  2XGC A;  4LG3 A;  4NHJ A;  1ZLJ A;  3ABM H;  1SVM A;  1YJW I;  1B9N A;  4KFC A;  4M6X A;  4NDL A;  2PI0 A;  2HQN A;  4D1Q A;  1OCR H;  1R71 A;  2H8R A;  4Y52 J;  3SZP A;  2BBY A;  4ENK A;  4JX4 A;  2F4M B;  3FK6 A;  2VKE A;  1RIO H;  3ECO A;  4CCN A;  4WXC A;  4YFK F;  5IY5 H;  4PUS A;  4PSX A;  2G9W A;  3DXJ F;  1FOY A;  5D5V B;  1EF4 A;  3N4M A;  2DQR A;  3K4M A;  5M5W J;  2BY2 A;  4EJW A;  1VI0 A;  2XF5 A;  3D5S C;  2L9S A;  3BRO A;  4ZYG A;  1U9O A;  5JR3 A;  1S5L C;  1T98 A;  1W0U A;  4MQV A;  1Y56 A;  3D5R C;  4WF2 A;  3KLO A;  4BDZ A;  3L2R A;  3H5A A;  3LSK A;  4GDF A;  1D3Y A;  5J6X A;  1YOV B;  2EZL A;  2Q0O A;  1ETX A;  2DMN A;  4A0Z A;  2VBX A;  3OSF A;  2ZFW A;  3Q9V A;  2IGN A;  3LA3 A;  2K9M A;  3F8M A;  4HW0 A;  2JWT A;  3BR5 A;  3MN2 A;  3H9Q A;  1Z67 A;  1X2N A;  1YQA A;  4DJA A;  2KJC A;  4G8X A;  1SFK A;  4XOR A;  3OOP A;  4BAY A;  3MFK A;  4G7Z F;  1XPX A;  5E3N A;  1EH6 A;  3OYA A;  2KIQ A;  4DYC A;  1YW9 A;  4FCY A;  3S2W A;  1ZAO A;  3FMR A;  4UUS B;  2JPC A;  2XKP A;  1FTZ A;  4N4N B;  2PJR B;  1BBY A;  4PCQ A;  5DCM B;  2VKH A;  3S15 J;  1XSX A;  3QYB A;  4RAZ A;  2L02 A;  1P4W A;  2AXT C;  5J4Y A;  1SD5 A;  2KP6 A;  4QTR A;  3JTG A;  2P8T A;  3WHB A;  1BJA A;  3Q0W A;  4A3D J;  3V4G A;  3BG5 A;  2VJI A;  3WHC A;  4EM2 A;  2Z2S B;  2VOP A;  3HGY A;  4NNJ A;  2JA6 J;  1R6R A;  1GLN A;  3MZH A;  4A2U A;  2ZB9 A;  4RAF A;  3CUQ B;  3SFZ A;  2W48 A;  5FLM J;  4B3A A;  9ANT A;  2OD5 A;  2QM3 A;  1BI0 A;  5EZH A;  4LGW A;  3VSK A;  4ESB A;  4UUS A;  3ZQL A;  2PJR A;  5DCM A;  2K9S A;  3GCM A;  2JA7 J;  3ZMD A;  1VTN C;  3CC2 I;  2CJJ A;  2F5F A;  1BN5 A;  1ON1 A;  3RDI A;  3HRT A;  4Y17 A;  3PUB A;  1A36 A;  2FJ1 A;  3HL2 A;  1AKH B;  3GLL A;  2W24 A;  1K61 A;  1SFE A;  1HC8 A;  2O8X A;  3S3M A;  1JT0 A;  3H3U A;  4UB8 C;  4ZJZ A;  2Z3Y A;  2OU2 A;  5CJ9 A;  3ZMZ A;  1FLI A;  5FLV A;  3CUQ A;  2M8E A;  2ZNY A;  3QYF A;  4HSR A;  2LBF B;  1D0Y A;  1K6O A;  4I99 C;  4AYB N;  3O2P E;  3LSM A;  2QQA A;  1HF0 A;  2QEN A;  4BE2 A;  4G7O F;  5F64 A;  3J81 K;  1NK2 P;  1O57 A;  2ELK A;  3B02 A;  4RA2 A;  1JE8 A;  4EM1 A;  3CDL A;  1HLV A;  3B73 A;  2VPR A;  3RYR A;  1W36 C;  3ECH A;  4B3X A;  1K6Y A;  2HS5 A;  4ZH4 F;  1AKH A;  4NC7 A;  3G1O A;  3GZN B;  4UXN A;  3ZP5 A;  3R0A A;  2DMU A;  1GHC A;  2VLA A;  3HB9 A;  3F8B A;  3TQN A;  4MLO A;  2VB6 A;  3AL0 B;  3QOE A;  3LQR A;  4BNC A;  2IGO A;  3ONQ A;  4KIF A;  4B09 A;  3I59 B;  2HKO A;  1SMT A;  1RET A;  1ODD A;  2LBF A;  4LLN A;  1TW2 A;  2DOA A;  1MNE A;  4DZJ A;  3NRV A;  5EEA A;  3CLO A;  4HYE A;  1E3P A;  5E3L A;  3FDY A;  5J3L A;  4G9Y A;  2BOL A;  1SEU A;  4A3M J;  4P5O A;  2WAQ A;  3RPQ A;  4HOB A;  2IT0 A;  5TJJ A;  5IP9 J;  5J47 A;  2JPB A;  3VEP A;  4OMZ A;  2OJE D;  3CCM I;  5K7Z A;  2PLY A;  3GZ6 A;  2E2I J;  4PFP A;  4Y15 A;  4AIH A;  4Y13 A;  3O8H A;  4M72 A;  1DQU A;  1R00 A;  5B3S H;  1JKO C;  4S0H B;  5F1R A;  1APL C;  3I59 A;  2K9N A;  3E6C C;  4BJ5 C;  3GX4 X;  1TT0 A;  4CIC A;  1PVE A;  3OL4 A;  2OCE A;  1SC7 A;  3GZ5 A;  2EFN A;  1RUO A;  2MW8 A;  2EBI A;  4U0W A;  1EH8 A;  2DA6 A;  2OZ6 A;  4G7H F;  1ZQ3 P;  1VQN I;  2LKP A;  4MFD A;  4HQE A;  3PO2 J;  2C6Y A;  2DCE A;  1O3S A;  4G6Q A;  4KUM A;  3PIP F;  5HOD A;  2XF7 A;  1PUE E;  4D5C A;  4O3M A;  3WU1 B;  1KA8 A;  1R22 A;  1M1E B;  4HBL A;  2V9P A;  1OR7 A;  2NYX A;  4NQW B;  4EGZ A;  1IO2 A;  1IN6 A;  5J1U A;  5EEG A;  4NUB A;  3WTW C;  5LLQ A;  4A5M A;  2HVS A;  1FYK A;  2IGM A;  1MJ9 A;  2OTJ I;  5EDN A;  2RV8 A;  4IPA A;  4C9Y A;  3EYI A;  2XRO A;  4EJU A;  1WI9 A;  1SFX A;  4HLY A;  2PJP A;  1WRJ A;  1YX3 A;  3VSL A;  3FHZ A;  3AL0 C;  3AG2 H;  2R7T A;  1PP8 F;  2PBI A;  5KCM A;  1Z0X A;  5IPA A;  3KEY A;  4PDK A;  2E19 A;  4RB2 C;  4II2 A;  1BOA A;  4IXA A;  2XRL A;  1JUP A;  1D5V A;  2GAU A;  3RTR A;  4E70 A;  4NQW A;  3KX2 A;  1S29 A;  4EJV A;  3GTK J;  1R49 A;  2BXZ A;  1KZH A;  2DA5 A;  3Q5F A;  4PJL A;  3IH4 A;  2NS7 A;  3KEO A;  1WH5 A;  1IZ1 A;  2JRT A;  2UUZ A;  1QVT A;  3PFY A;  3R0J A;  4UV9 A;  1MBJ A;  3NQO A;  1QHH D;  3RPU D;  3BPV A;  2HXO A;  1OR7 C;  4HST A;  3BDD A;  1F4K A;  3W3C A;  1IDZ A;  1TT5 B;  2QSH X;  3EQL F;  1V5G A;  3PM1 A;  2KMU A;  4YIF A;  1LUJ B;  1H88 C;  4RGX A;  1AA7 A;  2DPU A;  3V8L A;  2DMT A;  4L5E A;  1R36 A;  2K27 A;  4XN0 A;  2LRD A;  5ILV A;  2QQ8 A;  1R5I D;  2PMZ N;  2VKD A;  2V7F A;  4DNC A;  3CJT B;  1ON2 A;  4ZTJ A;  4YEL A;  3I4P A;  4IHW A;  1OPC A;  3CCY A;  1DP7 P;  4GGG A;  2KQR A;  2WTE A;  3S3N A;  3LQQ A;  3OY9 A;  1Q1H A;  2J5O A;  2UWM A;  3GFI A;  3V7S A;  1OCZ H;  4Y4R A;  1ZRD A;  1Z3Y A;  2VKV A;  2R93 J;  2WBM A;  4IHX A;  3FMQ A;  1K4T A;  1NTC A;  1FWZ A;  2H6B A;  2MAB A;  2QSF X;  5ICG A;  5HNF A;  5DYM A;  5FLX K;  3L2W A;  2ACJ A;  5F0H A;  1RI7 A;  1S9H A;  3OYD A;  3H5R A;  4KT5 C;  4EJO A;  3HOY J;  1HST A;  2GOX B;  5IT9 Z;  5FFX A;  2FMY A;  2MH9 A;  3W2A A;  3E5Q A;  3QYE A;  5B5E C;  2YSR A;  2K7L A;  2M1B A;  1KQ8 A;  1YS6 A;  2M4G A;  4H4K C;  3HM5 A;  4MEY F;  4RB1 A;  1IRX A;  3BG3 A;  4BEH B;  5H2F C;  4ZDO A;  2HU9 A;  4ENJ A;  2HDC A;  1BL0 A;  5KAI C;  4JP0 A;  1Y1W J;  3DV8 A;  4BQN A;  3JRF A;  4CCL A;  2A6T A;  2VL8 A;  2IA1 A;  2GA2 A;  1UFM A;  2EV6 A;  5BPD A;  4QWQ A;  2WY7 Q;  2OA4 A;  3SDB A;  3RI4 A;  1TBX A;  1SFU A;  1U3E M;  3U9G A;  1FTT A;  3VB2 A;  2ZCW A;  2I8D A;  2NS0 A;  1WJB A;  4ETS A;  1SAX A;  4PGG A;  2R5Y B;  2KFD A;  2WAE A;  2V1N A;  5DD8 A;  1ZLK A;  1YIT I;  2XV4 S;  3BR0 A;  3J7Z I;  4BEH A;  2QGU A;  2M3A A;  3K1P A;  1H0M A;  2FML A;  5IOZ A;  2E7W A;  2WV0 A;  5LHI A;  1WI3 A;  2LDU A;  3HSR A;  3HRS A;  2CH0 A;  3E97 A;  4G6T B;  1PYV A;  2F5E A;  1FPQ A;  1WWX A;  5C4X J;  2Q2E B;  1A5J A;  2UZK A;  1RUN A;  3HUG B;  5JVG F;  4U0Y A;  4IEJ A;  3IRQ A;  3OIP A;  2XDV A;  5H6R A;  1MBE A;  4FHT A;  4CGZ A;  1MW7 A;  5L3E A;  2R5Y A;  4IRG A;  4JX6 A;  4KIT B;  3CCL I;  4F93 B;  1LEA A;  1BC8 C;  2G0E A;  1J7K A;  3BOQ A;  4XLN F;  3L09 A;  1N78 A;  2Z5U A;  2W82 A;  3F72 A;  1FBS A;  1J0R A;  2VBY A;  3B6A A;  1ETW A;  4N9I A;  4BJ6 C;  1WKM A;  1QO0 D;  1G6N A;  3WTZ A;  4X6A J;  2HQ5 A;  2XSD C;  5HLH A;  5FFZ A;  5EGO A;  1GVJ A;  5K5Q A;  3CCU I;  2Q2E A;  5H20 A;  2VOD A;  2CUF A;  3HUG A;  4BBS J;  1E0E A;  3U1D A;  3R61 A;  3I5U A;  1J09 A;  2P0W A;  4EM0 B;  4HDV A;  1HW1 A;  1ZRC A;  5M5X J;  5A2Q K;  4LFU A;  5EYR A;  1UHS A;  2L7M P;  2WV1 A;  1HKT A;  1LJ9 A;  2DDB A;  1BR4 A;  5BPI A;  3N97 A;  2ZJ2 A;  2TCT A;  3RYP A;  4A93 J;  4WCG A;  1R5H A;  5LHG A;  1O4X A;  1POG A;  2GIV A;  1R5G A;  1VND A;  3K4L A;  3PSI A;  4LLG F;  3RPU A;  5LHH A;  3L7W A;  2ISZ A;  3M8J A;  1EV7 A;  3MD2 A;  2HPM A;  1V4R A;  1YIJ I;  1QU3 A;  3JRA A;  1ZAR A;  2DQL A;  2OZU A;  2VPL A;  1WJE A;  2EJR A;  2QBY B;  1I27 A;  1IGN A;  2LH9 A;  2MA3 A;  5K7F A;  2O3F A;  4BXU A;  1MKM A;  4XNF A;  2CUZ A;  3DU6 A;  5ICF A;  1P2F A;  1T38 A;  2IS1 A;  1LDD A;  5AIP A;  5CQG A;  2R7X A;  2JSP A;  3K10 A;  4Q5S F;  3GXO A;  3KP2 A;  2KPM A;  1T8I A;  2NVQ J;  2VE8 A;  4EJT A;  1N75 A;  1PDN C;  4XLA A;  2EIJ H;  3BJA A;  4BYY A;  3ZQC A;  4D7M A;  4OU0 A;  1BI2 A;  4L0Z B;  1HKS A;  4AUX A;  2A69 F;  2L9R A;  2XVC A;  2AQF A;  2AQE A;  3D0S A;  1ZKG A;  2ZBK A;  3FXU A;  2QBY A;  3HEF A;  1LKX A;  2ZKZ A;  3OS0 A;  1ETY A;  1QA6 A;  1IC8 A;  2RNG A;  2WA0 A; 
#chains in the Genus database with same CATH homology
 1Z3X A;  3M1C A;  3PNV A;  1X4P A;  2W4S A;  4C2T A;  3NWS A;  3SEQ A;  4BQQ A;  1X4O A;  4CCN A;  2E1M B;  2XC7 A;  3E0J B;  4E7K A;  2BW3 B;  2W00 A;  4PUS A;  3S8P A;  4PSX A;  5JHF A;  2IS4 A;  4OAZ A;  1FMW A;  4CCM A;  3HOT A;  3K4M A;  4XL9 A;  2OV7 A;  2XF5 A;  3D5S C;  2L9S A;  4Y33 A;  3K4J A;  4HNU A;  2X6W A;  5FRO A;  3DPU A;  1D1A A;  2A5W A;  2XSJ C;  1Y56 A;  3D5R C;  3DQV C;  4BDZ A;  3D5L A;  3L2R A;  3H5A A;  3LSK A;  2VJJ A;  1WJC A;  3OYG A;  1D1B A;  3HXL A;  3EUA A;  2IGN A;  5KHD A;  2K9M A;  4ZTF A;  2BW3 A;  2M7A A;  1V5E A;  2QKL B;  3OYL A;  4PK4 A;  4E7J A;  3E1S A;  3RQ4 A;  3I9V 2;  3H9Q A;  1D0X A;  4DJA A;  3OYJ A;  1TZL A;  2MD0 A;  3OR1 C;  1SFK A;  4XOR A;  1UEL B;  3OYI A;  3ZQQ A;  1Z21 A;  5KNL A;  2VJ5 A;  3OYA A;  2WAF A;  2ELJ A;  4N4N B;  4CCK A;  2PJR B;  1HA8 A;  4BAC A;  2L5Q A;  2VKH A;  3QYB A;  3TL4 X;  2KRC A;  1W36 D;  1VZ0 A;  2KP6 A;  4XLH A;  3ZXS A;  4J00 A;  2VJI A;  2FUG 2;  4U7B A;  3OMY A;  3F9K A;  2Z2S B;  2XF6 A;  4NNJ A;  3H9J A;  3LSH A;  4BDY A;  1R6R A;  4N4O B;  1GLN A;  5HNH A;  3FHN A;  1G59 A;  2V6E A;  2E1M C;  4F55 A;  4YRV A;  3VSK A;  2V26 A;  4AU7 A;  2PJR A;  2R4G A;  4B43 A;  3L2Q A;  4BJT A;  3BG7 A;  2RRE A;  1LFP A;  4E7Z A;  4FAS D;  1MMD A;  1T0F C;  2X1D A;  1LDK B;  2X6Y A;  4KT6 A;  5FRM A;  3SYT A;  2K3P A;  3PUB A;  1X1A A;  4IQ4 A;  2R7S A;  3HL2 A;  4RM3 A;  3L2U A;  1BR1 A;  3S3M A;  2Z16 A;  3BCB A;  4ZJZ A;  3HOS A;  2VQC A;  4QPQ A;  3S93 A;  3K4C A;  3QYF A;  4HSR A;  2LBF B;  1D0Y A;  2ZSI B;  1PJR A;  1X1C A;  2HPI A;  3C2H A;  3LSM A;  4BE2 A;  4E7H A;  1NG7 A;  1MMA A;  2VXD A;  3PJR A;  3DKX A;  4DBQ A;  1JI8 A;  3BG6 A;  1W36 C;  3DU5 A;  4B3X A;  3OWT A;  1K6Y A;  4C2U A;  3S32 A;  4NC7 A;  2X1C A;  4PFO A;  3H5N A;  3RSN A;  2IS2 A;  2CV2 A;  3KYL A;  1OLT A;  2VLA A;  4AVZ A;  4MLO A;  2VB6 A;  3AL0 B;  3QOE A;  2IGO A;  3ONQ A;  4IQJ A;  2BVL A;  3K70 D;  2LBF A;  1KON A;  2LRE A;  3DKY A;  2DOA A;  1MNE A;  1D0Z A;  4JQF A;  4P1W A;  3IP4 B;  4BE1 A;  3FDY A;  2BOL A;  2VIX A;  4F3Q A;  2KRH A;  4E7I A;  3UR3 C;  4P5O A;  4KJZ A;  2WAQ A;  3ZCO A;  1WFX A;  4YEJ A;  3MKY B;  2GOM A;  2RQQ A;  5HLT A;  1Z7L A;  4PFP A;  3OYM A;  3PL8 A;  3DTK A;  1DQU A;  3BCA A;  1V5F A;  2DJI A;  4HNT A;  4DBR A;  3TMO A;  4BJ5 C;  1TT0 A;  2WY8 Q;  3OL4 A;  1MMN A;  4ITV A;  3VDX A;  3OS1 A;  2L7K A;  4RM2 A;  4BGD A;  1WJD A;  2LYC A;  1MND A;  2HVR A;  3CES A;  2L2O A;  5LD2 C;  2ZXI A;  1G8X A;  2OUM A;  2QKM B;  4XOP A;  2DCE A;  2M7B A;  3MMY B;  4CSW A;  2HQA A;  2JA2 A;  4XN3 A;  2XF7 A;  3DWL E;  3CMM A;  2BVM A;  4HG2 A;  2WAD A;  4XKV A;  4QPO A;  2L9N A;  2V4J C;  4E6K G;  4J01 A;  4ZYA A;  3CJQ B;  4NQW B;  3LMM A;  4NUB A;  2R7O A;  1X1D A;  2HZD A;  1P9Q C;  4RMN A;  3V42 A;  2HVS A;  3I3L A;  1U0J A;  2IGM A;  2JVG A;  4C9Y A;  4IKF A;  2IS6 A;  1Y6I A;  4OWR B;  5HOO A;  4DIQ A;  4R79 A;  3VSL A;  1YX3 A;  2R7V A;  3AL0 C;  2R7T A;  2VQL A;  4LIV A;  5KCM A;  3CZ6 A;  2O5R A;  3KEY A;  3RCO A;  4II2 A;  1SAU A;  4DGW B;  3DTE A;  3RTR A;  4X0G A;  1WJ5 A;  2ZXH A;  2LG4 A;  3KX2 A;  4LIU A;  4F52 A;  4XQF A;  2Y0S A;  3K4B A;  4B47 A;  4PJL A;  1DGR M;  4XMY A;  2MC4 A;  3OYN A;  4F92 B;  2UUZ A;  3PFY A;  2CW7 A;  3HPH A;  3DPT A;  2CV1 A;  3OYB A;  1QHH D;  3CP8 A;  3RPU D;  1OR7 C;  2E60 A;  2F6C A;  4HST A;  2Q1Z B;  3W3C A;  2XAU A;  4C30 A;  1V5G A;  3H9G A;  2KMU A;  2V9K A;  3ZGK A;  1AA7 A;  4E4H A;  2KDO A;  2LY1 A;  3DEE A;  2NOJ B;  4XN0 A;  2LRD A;  2VQG A;  4D9J A;  4IZZ A;  2VKD A;  2JUG A;  2V7F A;  3BC8 A;  3HG9 A;  4ANJ A;  1MMG A;  2E5Z A;  4YEL A;  2M0M A;  4ZTJ A;  4AYB A;  3GBG A;  4XKC A;  1NG6 A;  3OYE A;  1WJA A;  3PNY A;  2KQR A;  4E7L A;  3S3N A;  3OS2 A;  4BU2 A;  2ZSH B;  4XLC A;  3OY9 A;  1LVK A;  3DTI A;  2R7U A;  5LFA A;  3W2W A;  2UWM A;  2VJ4 A;  3LSI A;  4Y4R A;  1Z3Y A;  4CH7 A;  4B48 A;  2WBM A;  4Y3O A;  2F5V A;  4ZDL A;  1DGW Y;  2MAB A;  2R7Q A;  3J7A Y;  5HNF A;  4XOT A;  4XR6 A;  3G2B A;  3L2W A;  3LSG A;  3A2K A;  2VQH A;  1S9H A;  4PJN A;  3H5R A;  3OYD A;  4CCO A;  2GOX B;  1X1B A;  2ZFU A;  2DT7 B;  3W2A A;  1UG0 A;  4E7S A;  3QYE A;  2KHM A;  3OYF A;  3HC7 A;  3IAM 2;  3MKW B;  3TBI A;  1X19 A;  4XKB A;  2CMP A;  2M4G A;  4H4K C;  1ZEL A;  4ZDO A;  4OAY A;  1IRX A;  4BEH B;  2HU9 A;  3MKZ A;  1DP3 A;  2Z1D A;  3SEZ A;  5CPR B;  4BQN A;  4CZC A;  3ZR8 X;  4CCL A;  2A6T A;  2CUJ A;  2VL8 A;  3S3O A;  3IUO A;  3OIQ A;  2JVH A;  2X6X A;  3UNG C;  2WY7 Q;  5FRN A;  3SDB A;  4BQO A;  1FMV A;  1BR2 A;  2K9L A;  4BE0 A;  4XLE A;  4B44 A;  3VYT B;  2X1E A;  3VYU B;  2WB1 A;  3LFU A;  2I8D A;  1WJB A;  3IAS 2;  3H0D A;  2WAE A;  2V1N A;  3EUH C;  3U21 A;  2R7R A;  3FBI B;  3CJR B;  3OYH A;  2DT6 A;  4BEH A;  2KL4 A;  2M3A A;  2M4K A;  2W1O A;  2MYS A;  4HPQ A;  1D1C A;  2CH0 A;  4XLF A;  4G6T B;  3VYR B;  1PYV A;  3ZRG A;  4U87 A;  2CV0 A;  3OOU A;  2HVQ A;  4ZC3 A;  2Q2E B;  3K70 C;  4IX7 A;  3HUG B;  3PSF A;  1YX5 A;  4XKW A;  4HEA 2;  3OIP A;  5CKT A;  2R7W A;  2XDV A;  1MW7 A;  1N77 A;  4KIT B;  3SZG A;  4F93 B;  4F91 B;  1ERD A;  2HNH A;  2LC2 A;  3CP2 A;  1N78 A;  3A4C A;  2W82 A;  4RLF A;  4ZDP A;  4BJ6 C;  2CS3 A;  2K5C A;  4XM3 A;  3EPZ A;  3OYK A;  4PJJ A;  3L2V A;  4BL0 B;  3OR2 C;  1E0E A;  2CFO A;  3FBN B;  1YE9 A;  1J09 A;  2P0W A;  3BLY A;  5HVQ C;  2UV1 A;  3K4K A;  1QHG A;  4DOZ A;  3K4N A;  3K6G A;  4KIS A;  2OC6 A;  3LL7 A;  4BUP A;  2X51 A;  2W7N A;  4CUG A;  1UAA A;  4XON A;  3H35 A;  4BS9 A;  1BR4 A;  4CA0 A;  5TGT A;  4FET A;  3N05 A;  2VXZ A;  2E5N A;  3K4L A;  3PSI A;  4GRI A;  4NC8 A;  2X85 A;  3M8J A;  3MD2 A;  2HPM A;  1QU3 A;  4HRI A;  3OYC A;  2VPL A;  1WJE A;  2LH9 A;  4PSW A;  2PMZ A;  2LOO A;  1BOB A;  3OL3 A;  4JOM A;  4XNF A;  4EAT A;  2DXI A;  2CUZ A;  3DU6 A;  5CQE A;  3DPL C;  3HPG A;  3DLA A;  4CCJ A;  3AKZ A;  2F4I A;  2IS1 A;  3NWT A;  2IXS A;  5CQG A;  1T95 A;  3FKJ A;  4PJM A;  3W2V A;  2JSP A;  2R7X A;  2IGK A;  3K10 A;  2LY2 A;  2CW8 A;  2KZV A;  2KPM A;  2VAS A;  3HKZ A;  1N75 A;  4LIT A;  4XLA A;  3VWB A;  4RLQ A;  4II3 A;  3AFH A;  3A1Y A;  3VYS B;  4LG3 A;  3EUK L;  3QOD A;  3CF2 A;  3C2G A;  1EA3 A;  2AQF A;  2AQE A;  2KLO A;  4BXF A;  1LKX A;  1WJF A;  2MFZ A;  3OS0 A;  4D1Q A;  2RNG A;  2HDW A;  2WA0 A;  3PNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...