1WJDA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, 38 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
b'FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 16
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjdA00
1WJFA 3HPHA 3F9KA 1WJBA 1LFPA 1MW7A 1KONA 1WJCA 1WJDA 3HPGA 1K6YA 1E0EA 4F3QA 1WJAA 1WJEA
chains in the Genus database with same CATH superfamily
1YG2A 1A04A 3GW2A 4M6XA 3E3VA 2RNGA 2CU7A 2JZYA 3KP6A 4P96A 1HSJA 4HRIA 3CC2I 4AVPA 2GA1A 3GVAA 1HQCA 1AA7A 3QP6A 2OV7A 1KU2A 2X6OA 5GTIC 4HF2A 3MQ0A 3CLOA 4UUVA 4XKVA 2VJIA 2CUJA 2XASA 2NVQJ 3HGGA 2RAEA 2M34A 1OYWA 3ZCOA 4A5NA 2DCEA 4FE7A 1OR7A 3A01B 2EBIA 2Z3YA 5KCMA 4NB5A 1NTCA 3CDHA 5BPDA 3T0YA 1M1EB 4FCYA 3CLQA 2DFIA 3K1NA 2OD5A 4LIUA 5E3MA 1TT0A 1OMIA 2GA2A 4NC7A 1A6IA 1FBQA 2KJBA 3BR3A 1NK3P 4NC8A 2CH0A 2CW7A 2IS1A 1U5TB 3M3YJ 2DFEA 5D4SA 1VQOI 3HIFA 1JI8A 2XPUA 2IA0A 4BHCA 4BYYA 3WTUC 3SEQA 3NWTA 6PAXA 3K4MA 5IT3A 1JJ6C 4GFBA 2FD5A 5A2QZ 5KNLA 3H9JA 4MFEA 2JQ7A 1P7JA 1R1UA 2FNPA 3OYEA 1BJZA 4W1UA 1Y39A 5F1JA 3HGYA 4YRVA 3GZ6A 2IS4A 3KETA 3OS2A 5E3OA 3PO3J 3G4SI 1V3FA 2K7LA 2NVYJ 2VPRA 4I0BA 4BL0B 5GTHC 4L18B 3FXOA 4BH9A 1YJWI 2JRMA 1ZREA 1J2XA 2Z1DA 3ML6A 4EGYA 2A6TA 5C4JJ 1UAAA 4U0VA 2BZTA 3DF8A 1MMGA 3PO2J 1YRNB 3SEZA 3ZQFA 2XF7A 2XKPA 4MLOA 2DT6A 1IV8A 3RKXA 1E3PA 2OCCH 2FUG2 1FOYA 3I58A 4DOZA 4V2GA 1H88C 1PP8F 4YFXF 2VUMJ 3IRQA 1SEUA 5IYBJ 2H8RA 2ZB9A 2ZXJA 4M9XA 1G3WA 1LE8B 1I3AA 2IRFG 2CV1A 2JUCA 1TQPA 4BS9A 3HUGA 2VXZA 1F1ZA 2HZTA 1SMYF 2CO5A 2K27A 1A5JA 3I3LA 3TMOA 3A0BC 4BNCA 1LEBA 5F27A 1UFMA 3BR2A 2RNJA 3P5JA 3CUOA 3C18A 4FASD 2ZMEA 1PYVA 1QRYA 1B4AA 1KZHA 5GPAA 4HQMA 3VDXA 3JRFA 2TCTA 1P4XA 3GBGA 4G6DA 3K10A 4IHXA 1JE8A 3DFGA 4HEA2 2X6XA 4I98B 3M4OJ 1MBKA 5JLXA 3JAMZ 2I10A 2O03A 3LL7A 4C3JJ 3A0HC 1U5TC 3RYRA 1ZQ3P 3JW4A 1OCZH 2C6YA 1K6OA 2QEXI 1RRJA 1X1AA 4Q4ZF 1Y8QB 1SFOJ 4JX4A 2KRFA 1ITYA 2EILH 1WJFA 3L2UA 2DYSH 4YEJA 5HDNA 1H89C 3GTQJ 3IH2A 5DM7F 2NYXA 4EM1A 2R93J 1FP2A 3GFJA 5F1RA 2Y9ZA 2DK5A 3MCZA 4I0AA 3WTWC 2EIMH 4I02A 2R5YB 2LREA 2STWA 1W7PB 1XC5A 2M30A 3PM1A 5F08A 1VZ0A 5BS6A 1PUEE 3CJNA 2ZJ2A 3RPUD 5JVGF 1TWHJ 4E70A 3HTSB 3PNTA 4NC6A 3MZ8A 5JLWA 4XLPF 1HKQA 2B63J 1T39A 1YX5A 4C9YA 2F4IA 3L1PA 4PFOA 3B02A 3HOVJ 5BQTA 4AU7A 5JI6A 3MZYA 1UHWA 3AKZA 3F0CA 2KIQA 2FQ4A 2VBZA 2WAEA 3IH3A 4FHTA 1MDMA 3KP4A 1O4XA 5B1BH 3JRAA 1T98A 1SVLA 1R36A 1IDYA 1TL8A 3TO6A 2FSWA 4BY7J 2HDCA 3LSPA 5K7ZA 4RB0A 2IAIA 3WHBA 3FIWA 2L9RA 3COAC 3W2WA 2HZDA 2K3FA 3SZTA 2B9SA 3HEFA 1XSVA 3OR1C 1S7OA 4F91B 3BG9A 3RQIA 1ETVA 2OTJI 3OYHA 4IZZA 1SFXA 3CDIA 3BR1A 4XNFA 5K1YA 5EG0B 3J7AY 2YR2A 1KYWA 4LITA 2NOGA 3HOZJ 4EEFG 3BT9A 3HTUA 3GFIA 5JFRA 4J00A 4BXFA 2NNNA 3PIPF 4XOTA 1QHGA 2DMUA 3GTGJ 2XVCA 4N4OB 2ZKZA 1FOWA 4UB6C 3ZMZA 1D1BA 4PK4A 2JA6J 2F5EA 4BJ5C 3KYCB 3I54A 1XDUA 2A69F 2HPMA 2FBKA 4DGWB 5J4YA 2XGDA 1ZG3A 1OCRH 1HCRA 1BI3A 2WC2A 3S14J 3RJPA 3KE2A 5L3BA 1T33A 4KIFA 3VODA 4UHTA 3D0SA 1MMNA 5ILUA 1J75A 1MH3A 2A05A 1REPC 5EYRA 4QPOA 4GXOA 5DEQA 2LOOA 3IAM2 2P5VA 2GM4A 4EJUA 3TOBA 1B9NA 4DNCA 2HTSA 3L2VA 3HOUJ 1W5TA 3BY6A 3H3ZA 3M7GA 3AG1H 4Y4RA 1IV6A 3TW6A 2CQQA 1W36D 2P4WA 2DU9A 4PGHA 4E7LA 2DPUA 5JHFA 2UXNA 3BPVA 4CCNA 2X0LA 2F2EA 4BQNA 4HDVA 4DYQA 2ID3A 3TEDA 2FEZA 2MD0A 4PJNA 1NH3A 1H0MA 1YS7A 4DYCA 1U5TA 4JK1X 2GIVA 2DN0A 2X9DA 1LUJB 3QOEA 2JA2A 4N4NB 3W3CA 2XB0X 3SZGA 4CZCA 2PG4A 3OYFA 3GTJJ 4LK0F 1N77A 1AKHB 4HPQA 3V42A 5K5RA 1JGSA 2V1XA 3S17J 3S8PA 3CCQI 2OQRA 2XGCA 1DGRM 3KIOA 1QZEA 3GYHX 3CC7I 5HDGA 2EH3A 2FMYA 2WV1A 3OR2C 3BJOA 3CMMA 4M9SA 2MC3A 5IP9J 4L5EA 3BLYA 2XGEA 3RZDJ 5ICFA 2HKXA 3WHCA 1GT0C 1BC8C 4QTRA 3C2BA 2M5WA 3W6JB 2XROA 2MLKA 1LFBA 1Z3YA 3F8FA 1MZBA 4KN7X 3T8RA 4IQJA 4X6AJ 2P5LC 3FZVA 4YIIA 4B47A 4XBFA 3FXJA 5TISC 2HGCA 5D5VB 4EGZA 3M1EA 2LMDA 3JRGA 2GXBA 2FNAA 3ZQ7A 2D1VA 2G9WA 2BXZA 2HOSA 3LAPA 1HKSA 2E7XA 4E7SA 4A5MA 1MMSA 3A03A 3KP5A 4A3BJ 3LA3A 5H6QA 1P6RA 1W36C 2CV0A 1XGOA 5J1UA 4FX4A 2GOXB 2F5FA 3P7NA 1E17A 3ONQA 2DOEA 5D6EA 2CUZA 2KP6A 2MLGA 3ZMDA 3CCMI 1HXDA 3I59B 2V4JC 1ZKGA 2CRGA 2LKSA 5HLTA 5TGTA 3GZNB 4XRFA 4A3KJ 2UZKA 2QUFA 5IY5H 2FRHA 3OYIA 2K9SA 4RM3A 5ICEA 2VPLA 4M73A 1S5LC 3DXJF 3MVPA 1VQ6I 4IPAA 2PJRB 4A0YA 2WADA 1TT5B 2M45A 3K70D 2P7CB 1W0UA 3IC7A 2FX0A 2PBIA 1G59A 3FXUA 3GXOA 1ORKA 1SFEA 1HW1A 1MBGA 1D8KA 1ZGJA 3GO5A 4A2UA 1H9GA 4AWXB 2GAUA 3OS1A 3WTYC 2M1BA 1UCRA 4HBLA 4G7HF 3OL3A 1YIJI 1VF9A 4ZYHA 3DEUA 2V9PA 1X4PA 4BHPA 2GLOA 1IJWC 3OYNA 2DAOA 3QRFF 1RR7A 3QQAA 4LB5A 3OYLA 2ZNZA 2A07F 2A5WA 1R58A 2IW5A 2MG4A 3OMYA 4IEJA 1MNMC 1MMAA 4ZZLA 4DW6A 3JRIA 3FISA 3MKYB 1R5ID 2ESHA 4BAYA 4A3CJ 4GO1A 3KFWX 1J7KA 1TWCJ 4ON0A 2WBMA 2CFXA 4FTHA 5E17F 5FFZA 4ZDPA 4XLEA 2E36A 3VSLA 2K4BA 1IO2A 2VBWA 1TNTA 4OIPF 4LGWA 1X2MA 5IOYA 4LJZF 2P0WA 3OIPA 1USSA 1X3UA 1OPCA 4GGGA 4RAGA 1S9HA 2QLZA 3TDZC 1JKOC 2GOMA 1XTAA 3DKWA 3FHZA 3ZN1A 2DDAA 3PJRA 4BEHA 4OWRB 4MHGA 1WSUA 2R7VA 4JX6A 2HYJA 2CQNA 3RZOJ 2XPVA 1ERDA 2YU9J 3H0DA 1G4DA 2R5ZA 1FJLA 4HX4A 3WE3A 1TWAJ 2LVSA 3RTRA 2W82A 2Z16A 3W2AA 1WJDA 2LLKA 4M3FA 4U0WA 5KVRA 3RYPA 5BOXA 1T95A 3IL2A 1JTYA 5FROA 3GCMA 1XMAA 2LYCA 2ICWG 3GFMA 2XUBA 2RGVA 2CWEA 3K70C 2VBYA 3WTZA 3K4BA 4IF4A 4B43A 3DLLF 5EGOB 2IXSA 3FKJA 2WY7Q 4L5IA 2DA6A 2L7ZA 1VFCA 4ZYAA 3NEUA 2LG4A 4RGRA 5EG0A 1IN5A 2RVCA 1JTXA 3U1DA 2GWRA 2HQAA 2W57A 2DA7A 2QF7A 3I71A 2NOJB 2RQPA 4MEYF 3BJAA 2K85A 2L4AA 2LRDA 3B73A 3HPGA 5K7HA 3HG9A 3DKXA 3RIRA 4KICA 1F4KA 3F6VA 1RKTA 1MJAA 1SD5A 2OF7A 5CVUA 4H4KC 5FD5A 3OYAA 2ZFUA 2DDBA 1TP4A 2OUMA 4NQWA 2VJ5A 3SZPA 5HS9A 2AXLA 2HYGD 2WB1A 3BG6A 3CUQC 3G6EI 5J1RA 3RPQA 1CF7B 2CS3A 5B66C 4XIDA 4L0ZB 3S3OA 2W24A 4F93B 2FMLA 1Q1VA 1SMTA 1ZG1A 1YJNI 2KQRA 4CCOA 3JTHA 1HLVA 3A4CA 3DTIA 1IUYA 3ESWB 2HFHA 4IJAA 3WE2A 2LTPA 1UMQA 2RDPA 3HYIA 3U9GA 4I7HA 4JBAA 3UR3C 1K83J 1AOYA 2CUEA 3E5QA 2JA7J 3KPHA 2HDDA 1L0OC 5EF6A 1XCBA 4RS8A 1QVTA 5A2QK 2DYRH 1O3QA 2M7BA 1FT9A 3FWEA 4HAMA 1W5CC 4B3AA 1QZYA 4ZTJA 1O3RA 3SHFA 3G3ZA 3IRRA 2ZBKA 4IX7A 5CVVA 2VC0A 3RKYA 2ZSHB 4GDFA 1LB2A 2L7MP 2P5KA 4U87A 3DBRB 1U8RA 2ETHA 3KLNA 2K40A 3BTJA 3GTKJ 4B09A 5E8IA 3DBLB 2F5VA 2YX7A 5J4VA 2WWYA 1YITI 4XKCA 1IDZA 1X58A 1GXQA 3K1PA 3AL0C 1KA8A 1T6SA 4ZYDA 3I55I 5LGUA 3E6CC 1V5GA 3ZRGA 3RKWA 1XMXA 4A0ZA 4J01A 1WVRA 5GPCA 4HZFA 2QSHX 3QPSA 1JKQC 2E2JJ 2VL8A 4YELA 3LOCA 2DMTA 2HVQA 2R7RA 1MNDA 4WXCA 1VQ9I 1FTTA 1QNTA 2J5PA 2O6GE 2PN6A 2BEOA 2HTJA 1JKRC 2Y69H 3ASNH 2KZGA 1BI1A 4CCMA 2E1CA 3CJTB 4DBRA 2HU9A 4ANJA 3S1RJ 1P4WA 4NHJA 4O6JA 2V9VA 1FC3A 2E1NA 4MGRA 3F8CA 4EJWA 2OA4A 2K5CA 4B8XA 2VQGA 4A93J 1QU3A 3OYBA 1FP1D 5FGMA 4G9YA 3BQZA 1QO0D 2XKOA 1Y1WJ 1K78A 5HODA 2VONA 2EIJH 2VT2A 5ILVA 3IHUA 1IAWA 2EFQA 2W00A 3S1NJ 4YFNF 2DMNA 1P9QC 3J7YJ 1FYMA 1YS6A 3I59A 4QIWN 2DBBA 4GYIA 3CDLA 5L3DA 3BPXA 2B0LA 4P9UA 3BOQA 3F23A 1HF0A 3H0GJ 3HRUA 3LFUA 4F52A 3MMYB 4RGSA 3H1CA 1ZN2A 1ENHA 4HV6A 4ABZA 4B44A 2KLOA 4OIQF 1VNDA 3ASOH 3R0AA 3SYTA 1XSDA 2Z99A 3D5RC 3MFKA 3MKWB 1WWXA 1Z0XA 1FZPB 1WPKA 5DCMA 4BJTA 2EFNA 4FE4A 5LHGA 3CJRB 1A36A 4RAFA 4EM2A 3PSIA 2X6YA 2HQRA 3LSIA 2KFDA 4MQ9F 3ZQIA 4MFDA 3CUQA 2MD5A 2B7EA 5L3GA 3IV5A 1D8JA 5FRNA 3EDPA 3OOPA 3CF2A 1MH4A 1D5VA 2OTLI 1Y8RB 1LVKA 1Q1HA 1ZTRA 5D5WB 2BY0A 1O3TA 3KCCA 4Q47A 4ESBA 1J9IA 1BJAA 3BTLA 3IP4B 4ZC3A 3J81K 1J0RA 3KEOA 4EQQA 3K7AJ 3LSKA 2L3DA 3RKQA 4HNVA 1FLIA 1O57A 3HRSA 3AAFA 1HW5A 1TTYA 1ZLJA 3S93A 2DO7A 3CCLI 2IEKA 3U2RA 1C0WA 2P6SA 2JUGA 3QPHA 3PFYA 4BJ6C 3JCUC 3HPHA 4IRGA 5HLHA 3TOAA 2FU4A 4PJJA 4ZJZA 2L4MA 2XB5A 2F5CA 3BC8A 1V55H 2JK3A 1G6NA 2QCOA 2AQEA 3GZ5A 1NHAA 1OJLA 4BDZA 1ZRDA 2O8KA 1U0JA 5C44J 2BW3A 2M0MA 1K6YA 1U2WA 1QPMA 2O0YA 4F7ZA 2R7FA 2VBXA 2O8XA 5D5UB 2WY8Q 1DGWY 1HKTA 2PLYA 4IHVA 2FOKA 4GRIA 1Y0NA 1T0FC 3HC7A 3K4CA 1I27A 5ICGA 4PCQA 3V4GA 1T08B 2ELJA 2CJJA 3H5RA 4GYGA 4ETSA 1X2NA 3I5UA 3LMMA 5FKNA 2HVRA 2KL4A 1IW7F 4JP0A 1I5ZA 1Z6TA 2X4HA 2ZNYA 3VB2A 4H0EA 4Q5SF 1LJ9A 2WB1N 3HOXJ 2V26A 5DM6F 1MJBA 5C4XJ 1HDPA 1R6RA 3FMSA 3GFLA 1B8IA 1V54H 4D0PA 2BBYA 3Q0VA 4U0YA 2D1HA 4HOBA 1LKXA 2M8GX 3E7LA 4BQOA 4ITVA 4HSTA 1ZLKA 2CV2A 3AG3H 5DV5A 3H3UA 1KU9A 1KQ8A 2LY2A 4G8XA 1W0TA 2DTZA 5FKMA 4DYRA 2X48A 1CF7A 3H9QA 4HYEA 4F55A 1XB4A 2OZ6A 3M8FA 3H92A 4IXAA 4L9NA 1IG7A 2HQ5A 3DLAA 3ZMTA 1G3TA 2XAUA 3QU3A 4AD9A 3TP3A 3QYBA 2K4JA 2VT3A 3FXQA 2BY2A 1PJRA 4QLCU 2QM3A 3ZMUA 1HOMA 4OAYA 4A3FJ 4XSXF 2A68F 3GMEA 4IO9F 4O5VA 3P9CA 4RB2C 3CESA 4BACA 1WZ2A 4CYCA 1NG6A 2OAZA 3M9AA 5FO5A 4Y7NJ 3S2DJ 2H6CA 2OU2A 2NRAC 2KZVA 4P1WA 2VE9A 1DDNA 1BM9A 5FLXZ 4XICA 5IT9Z 2NS8A 1U9OA 2BGCA 4XORA 3FM3A 5IYDJ 1W7PD 1UJ8A 2Q1ZB 1DUXC 5EEHA 1STZA 5L3EA 1EF4A 2LC2A 5H6RA 1O7FA 1V5EA 4RB1A 4XONA 3Q0UA 4KDPA 2EIKH 2O61A 4NNJA 2IJLA 4I01A 3FXLA 1J5YA 1OFCX 3CQZJ 3K4NA 2QBYA 4KYWA 3HSEA 2K9QA 1RIOH 4JQFA 2Y0MA 3ABMH 3VYRB 4D7NA 5M5XJ 2ZJRF 5DUKA 1TW3A 1PUFA 2IS6A 3MKLA 3L2CA 1USTA 2L02A 2DLLA 4XRSG 1FMVA 1ULYA 5J3LA 3N97A 4CSWA 2VKHA 4M3BA 1LVAA 4HW0A 2JMWA 5CPRB 1ZR4A 1IXCA 4CCJA 3I4MJ 2LFBA 4E7IA 3MAJA 2F5DA 2VJJA 1OISA 3RCOA 2F4OB 3JRDA 2DW4A 2CW8A 5F0FA 5FLVA 1XN7A 2VE8A 4L5JA 2FE3A 2JJ7A 1RUNA 1WJAA 2L7KA 1RKWA 3WU1B 2LNBA 1S72I 1JKPC 2K3PA 3FBIB 4LLLA 3Q5FA 4G6TB 5LEKA 2G7UA 3BQYA 3EETA 2NVTJ 3R6SA 2UWMA 3ZP5A 4JYKA 2CFOA 4V2FA 3V7RA 1ON1A 2Z33A 4CHUA 1I1GA 4EMSA 5CKTA 2E1MB 3DTEA 1VQNI 1ETYA 3WTTC 2A5YB 2DQRA 2KIMA 4KITB 3ZOBA 3HSRA 1T0FA 4N0BA 2R92J 2OC6A 2QWWA 1VQPI 4CA0A 2V6CA 1XG1A 5FD6A 4CICA 4HLXA 1D0XA 3WTVC 2OBPA 4L9JA 1BI0A 4DIQA 1T56A 5ILSA 2O3FA 5DD4A 3KZZA 3E5UA 4OU0A 4WWCA 5HVQC 1ETWA 5FB2A 1MGTA 2LR8A 1MD0A 1SAXA 4K2EA 3ABKH 3TGNA 5CJ9A 3A01A 5LGNA 3L2WA 3VFZA 5HS8A 2JVHA 2ISZA 3E6MA 3HBLA 1F5TA 3RDIA 4XMYA 1ZK8A 4NBQA 4U7DA 3P9IA 4FQGA 3P9KA 3BJ6A 2YU3A 1Z1DA 2ZXIA 5DCFA 3GUDA 2R0QC 3REOA 4HLYA 3DCFA 3GX4X 3VOEA 3EYIA 1IN8A 1MW7A 4UXNA 3VYTB 4HNTA 4W97A 1BC7C 2MC4A 1X1CA 2O9LA 2R7DA 2LBFB 3G73A 1I1SA 4E6KG 1TLHB 3E6DA 2STTA 3HOSA 2KJCA 1GUUA 1S29A 1G8XA 5LFAA 1S8NA 3ZQCA 4LG0B 2FOWA 2E71A 4P5OA 3HOYJ 1IRXA 3T5XA 2M3AA 5IP7J 4Y15A 4WXDA 1ODDA 3HZJA 2RN7A 1UG2A 3M07A 1U3EM 2E2HJ 2E35A 1WCMJ 5HNFA 3DTKA 2XHKA 3UNGC 1YRNA 4RA2A 4L9TA 1QVUA 2HOAA 3QYFA 2CQXA 2R7TA 2VQCA 1OCOH 2IS2A 1GDTA 2L54A 5E3NA 2TRTA 2DFFA 2HXOA 3FMRA 2QKLB 1APLC 4A3IJ 3EUAA 2F48A 4OMYA 3E5XA 3ERMA 1LE8A 5HLGA 3J80K 1KU7A 3QU6A 1D1CA 3CTAA 1E3HA 1RPWA 2CG4A 3AG4H 5EDNA 4R8HA 2QYOA 1KU3A 4KFCA 2BV6A 1Y1VJ 2EA4A 3NRVA 1R49A 2ELHA 2Q2EB 2X1CA 3PNYA 4I2OA 4L0YB 3LSGA 2P7VB 3A1YA 1ZH5A 5GAEJ 4B48A 1P4AA 1JHFA 5TJJA 5FJ8J 1FX7A 1OQYA 2VJ4A 3NQOA 1NK2P 2DTRA 1QPIA 1POGA 4KIBA 2XC7A 2RKHA 4M74A 2DA3A 2DA4A 2EV0A 3L00A 3H5NA 5IYCJ 4G94A 3J7ZI 3SXYA 2HWVA 3QODA 3I53A 2R3SA 3Q0WA 3WGHA 1TC3C 5KAIC 2HQNA 3VWBA 3EYYA 1RI7A 4EV0A 1VQLI 4A3DJ 1Z67A 3DU5A 4KIGA 4X0GA 1Z7UA 2DXIA 3WGIA 1YYVA 3PNVA 1VTNC 4CCLA 3R60A 2R7SA 5FFXA 4OAZA 2WA0A 1BIBA 2EK5A 1A31A 4IKFA 1N78A 1HA8A 2H94A 1ZYRF 2KRHA 4M3EA 2XF5A 4Y13A 3RPUA 3OYGA 2PFBA 4ZDOA 4C2MJ 1Z7LA 4BQAA 3H3VK 1Z3XA 3TQNA 5D8LB 1P2FA 2R5YA 2KDOA 1W7PA 3I56I 1WJBA 1YO5C 1X4OA 5E79C 1QZZA 3NAUA 4BE1A 2HVSA 5FKOA 2VASA 1H9TA 2HR3A 1FEXA 1BR1A 1S3JA 1OYIA 2W48A 2LSOA 3QAHA 1A35A 2K9LA 3K1MA 3SQNA 3TO9A 5HOOA 4Y17A 4PSXA 4IHYA 4G12A 3BG3A 3W2VA 5M3FJ 2BHYA 4XM3A 4EJOA 3OYMA 4IOCF 1D5YA 1KYZA 5E3LA 4NUBA 3HJEA 4IRHA 2VOOA 3CMEI 5BNGA 2EA2A 1BIAA 5LD2C 5CYVA 1D1AA 1WJ5A 1X1BA 1JXSA 2M7AA 3DPTA 3V7SA 3OYJA 1SVOA 1D0YA 1TQMA 1X3ZB 1YIOA 3K2AA 3KP3A 4PJMA 4UVAA 5K7FA 1N75A 3HB9A 4II2A 1ONVA 4FETA 1MBEA 1UHMA 4A69C 5LEJA 4BBSJ 2WAFA 2AS5F 4G6QA 2EFPA 3IKVA 5E8GA 2DA1A 2DOFA 3HOWJ 2K86A 1FBUA 5BPIA 2BOLA 3ABLH 2JPCA 2KPMA 2O5RA 4RGXA 3AG2H 2PI0A 1D0ZA 3GEZA 2XV4S 1SD7A 1T2KA 2JPBA 4XLCA 1B72B 1F43A 3S16J 1XMKA 2UV1A 4AIKA 1HW2A 5D4RA 1G3SA 1G2HA 4PUSA 3S15J 2ZCWA 2XAJA 4RBOA 4DZPA 4ZTFA 1WRJA 4OOIA 1YFHA 4LB6B 1RUOA 5J6XA 2IP2A 4XOPA 1MBFA 3TW7A 5CQGA 3HUGB 2VB6A 1TWFJ 4XRSA 2BHZA 2V9KA 1SANA 4BKXA 2QGUA 2YUSA 4AM3A 2LF8A 3FBNB 1BR2A 3LQQA 1FYLA 2HEOA 3RI4A 2ID6A 2MH2A 4IHWA 4QPQA 2ZMEB 2KIUA 3DWLE 3OYKA 1T8IA 4MTEA 1MKMA 1JGGA 4TV7A 4HA8A 5B1AH 3ECOA 1ETXA 4DZJA 2G0EA 1KONA 1XD7A 4EM0B 1N25A 4Y52J 5KHDA 2H1LA 4CUGA 1Z21A 4EATA 1QA6A 2ZJQF 3BR6A 3BG5A 1IF1A 3H9GA 2J5OA 3B6AA 1GLNA 2VC1A 3FMQA 4LD5A 5CLSA 4AYBN 3X2QH 1S7EA 5KK1A 3FHNA 2JTVA 2VKVA 1WJEA 3C2HA 3IAS2 1LNWA 2CMPA 1TBXA 4M72A 2HI3A 4KN4X 4UY8I 4LLNA 2NNYA 3VSKA 1T38A 3MN2A 1LQ1A 3D5SC 3HRTA 5EEAA 1RETA 1BL0A 3ERED 1SD6A 3N4MA 3HOTA 5F64A 4BBRJ 2LBFA 2VIXA 1RNLA 2EINH 2BXYA 4BGDA 5LHHA 1ZRCA 5J1YA 1AKHA 2L9NA 3JTGA 2BE5F 1BN5A 1FWZA 3K69A 3SDBA 4ZYGA 1ZAOA 1ZARA 1LDJA 2M9HA 2EZIA 4S0HB 2MW8A 4JX5A 2LKXA 2VOPA 4GCVA 1WI3A 3ULQB 2V1NA 2HOTA 5EZGA 3OSFA 3L2RA 1OKRA 3ZMVA 1W1WE 1MDMB 2PMUA 2FJ1A 4PGGA 2EZLA 3S32A 1BI2A 4XK4A 1K79A 2XAFA 2MSYA 4MIMA 4AIHA 2Z9OA 2V6EA 2RC4A 4UVBA 2QZ8A 3ZQLA 3EPZA 1JHHA 2ZFWA 3G71I 1R23A 1E3OC 1RZ4A 3PUBA 1JUSA 3QWLA 3OV8A 1WKMA 2IPQX 2IA2A 1FTZA 4OINF 3BZKA 1ZG5A 3H35A 3ISPA 3JAMK 3MZHA 1EH8A 3H36A 1XPXA 1J59A 2AXTC 1BBYA 2Y30A 3CD6I 1LPQA 2V1UA 1V4RA 2EZKA 1GV5A 2HYFA 3I4PA 3GWZA 4A6EA 1B1BA 2DPDA 2R7XA 1R4MB 2COBA 2FBIA 4NDLA 4BUPA 1XDSA 1JT6A 4DJAA 3K9TA 2H1KA 3F22A 3OWTA 2ADUA 3BZCA 4HV5A 4EVIA 3L2QA 1E2XA 1HSTA 1RC9A 2IGNA 2WV0A 4B4CA 2X1EA 2PJRA 1YW7A 4KT6A 2DMPA 3KX2A 4XL9A 4M6VA 4AUXA 3G1MA 4UB8C 5FLXK 2DT5A 3M8EA 1R1VA 1IRZA 1Z77A 2H09A 3CJQB 4F3QA 5IT9K 2BVMA 4CCKA 2V1DA 5IP6A 4KMUX 2A6EF 4HX8A 3J7AO 4XKBA 4OIOF 3I4NJ 3WODF 3FK6A 1W5SA 2CQ7A 3HKZA 1OCPA 3C3WA 4PDKA 2F4MB 2FA5A 3CP2A 3IWFA 2M4GA 1SFUA 3R0JA 4C3HJ 3V8JA 4G7OF 1UB9A 2MABA 3CZ6A 2D45A 1Z6RA 4BU2A 4D7MA 4XN3A 1GXPA 2H6BA 1Y6IA 3JRBA 3EUKL 3FKIJ 3O8GA 5J47A 2KHMA 3PQKA 3OYCA 2Y48A 2QQ9A 1FOKA 5FKKA 5F0HA 5H2FC 3AFHA 3F6OA 3HM5A 3TL4X 3L7WA 5E18F 1DPUA 4XQFA 1OCTC 2XIGA 1SD4A 2RV8A 5AIPA 1K7AA 1BW6A 3HHGA 2Y2ZA 2EFOA 5B5EC 3NARA 2XSDC 3MEXA 2R7OA 4LK1F 4BE0A 2KKOA 1MMDA 4AC0A 2ZXWH 1F36A 3K4LA 4N9IA 2VODA 1DU0A 3O3KA 1BW5A 2P8TA 3LWFA 3WG9A 4MTDA 3OIOA 4CYDA 5EGOA 2HKOA 3SDGA 5GAGJ 3GTLJ 5K5OA 1RR8C 1B72A 4B1RA 3LSHA 1IUFA 3O6BB 4DBQA 3PL8A 1FMWA 2MFZA 1EH6A 1VQMI 3OL4A 4ZZDA 4WCGA 3RQ4A 4PSWA 5LRRA 3CMAI 2JWTA 4HG2A 1HDDC 5GAHJ 2MBFA 3G1OA 5D5XB 5BMZA 3CCVI 3ZQGA 5B3SH 3ZQQA 1EA3A 4QSHA 1WH5A 4EJTA 4O3MA 2W85A 2LY1A 3KP7A 2IGOA 2NAZA 3I0TA 3I9V2 4YIFA 2E60A 1LDKB 3IWZA 4PJ0C 5LGTA 4KJZA 3HSFA 1UZCA 4RLQA 5E1WA 3K4JA 4M9ZA 1R71A 2LKPA 2BYVE 2XPWA 3WTSC 2D2WA 1UELB 4AIJA 1R00A 1I50J 2XDVA 3L09A 3E6BA 2V7FA 3W6VA 4C2UA 1GV2A 4FISA 1U6GA 2VXDA 2WTEA 4XRMA 3KYDB 1U8BA 1TNSA 3E1SA 2W84A 4PFPA 3OY9A 2OPTA 4D9JA 5LRSA 5E1ZB 5EEGA 4L9VA 3WG7H 2R7QA 1X3WB 3MKZA 2E1OA 2CQKA 3BWGA 5JR3A 2WAQA 2EQRA 3LA2A 4XLFA 4BXUA 4CH7A 3CMYA 2ELKA 2X51A 2XAQA 1YTYA 3K6GA 2Y31A 3FDYA 3JRCA 3BTCA 4I6ZA 1QQIA 1ZHFA 2FF4A 2JT1A 2KMUA 2Z5UA 3JRHA 1TWGJ 2VQHA 5JHUA 2IBDA 4KISA 4BQQA 2E34A 2L01A 2ZSIB 2R4GA 4D1QA 1IGNA 3K2ZA 4AVZA 4HSRA 1FYKA 3LNQA 5IPAA 4QWQA 2QVOA 2LK2A 3ABUA 1MIJA 2ME6A 1WGXA 3BCBA 3GTOJ 2NS0A 2YSRA 2M2EA 4UV8A 2HXIA 4JOMA 3HL2A 3CP8A 1TZLA 3PQJA 2CGPA 2LH9A 2P81A 1J09A 3V7CA 1E0EA 3QYEA 2CYYA 4I09A 3BG7A 5AIQA 4BEHB 2UUZA 2EJRA 1EH7A 1VQ4I 4Z6YA 4IHTA 1TW2A 4XLAA 3UKGA 3BDDA 4UVCA 2AHQA 2R7UA 2R5ZB 1VQ8I 3F8BA 2N8GA 2L0KA 3CCEI 2JVGA 1R1TA 2PX9A 4P55A 2PMHA 4YIRX 2JA8J 3RSNA 3J81Z 1QGPA 2ZXHA 3ZR8X 3DPUA 1ETKA 1MSEC 3DU6A 4MQVA 4U88A 1IRFA 3IH4A 4A0XA 4MEXF 1D3YA 3ZXSA 4YG2F 3M1CA 5LLQA 3T8TA 3KP2A 3D1NI 4E7JA 4KNYA 1S6LA 3TO7A 2VN2A 4A3GJ 3VYSB 4ESJA 1X19A 2Q8KA 4WX9A 1XCVA 4UUSB 1V5FA 1LEAA 2OQGA 4E7HA 1YW9A 4ENJA 1XS9A 1U78A 3SFZA 2LD5A 4UUTA 5DYMA 1IC8A 1F9NA 1MBHA 4Q48A 2XGXA 3F8NA 1B59A 1ZGAA 4LG3A 2KRCA 2I8DA 3KZYA 4A3LJ 1IXRC 2NVXJ 5LHIA 4A6DA 2MGQA 1BOAA 1Y56A 1B9MA 1XX5A 2YPRA 3ZMSA 3R4KA 2NXNB 2DFHA 4HX7A 2L7FP 5L3CA 3TKYA 3FXRA 1KQ0A 4CDGA 2BY1A 4KA4A 4NQWB 4A3EJ 3HKZN 3DPLC 3DBHB 3ZN0A 2I5UA 1YLFA 1IN4A 3CCJI 5M3MJ 1Z9CA 1ON2A 2DJIA 2W25A 4ZYEA 2QSFX 2PMZA 1I6XA 4R1HA 1ETQA 1AHDP 2Y0SA 3U21A 3TBIA 4IVNA 2VI6A 3DKYA 4D5FA 1FPQA 2MH9A 1WJCA 1FOXA 4UV9A 2E2IJ 3S1MJ 1ACIA 1I39A 4AYBA 3KEQA 3ABTA 2HOEA 4A12A 3VEPA 2OJED 3A02A 2IVMA 3V8LA 2W4SA 5HNHA 4F92B 2ZC2A 3QPLA 3EQLF 4ZDLA 4B3XA 1IZ1A 2IA1A 2KISA 3Q3SA 2GBYA 3NWSA 4ESFA 2PJPA 1OCCH 1ZR2A 1X1PA 5J40A 5FLMJ 3OS0A 4WXHA 3ZQHA 3K0LA 4FT8A 4ASNA 5E1XA 3CO6C 3E97A 1VQ5I 4D5CA 2CW0F 2L9VA 2Z2SB 2DA2A 2H8WA 2E5NA 2OCEA 3CCUI 3GTPJ 1B6AA 3WU2C 2DI3A 1X1DA 1JT0A 1AWCA 2XRNA 3E0JB 5GP9A 5ED4A 2L2OA 3KZIC 5FRMA 3S2HJ 1FSHA 2YX4A 4BDYA 3LSMA 4E7KA 2ZJPF 2ISYA 4M6YA 2E1MC 4XR6A 3G1LA 1GVDA 2LP0A 1RESA 2VKEA 3DEWA 1IXSB 3N05A 4CO8A 1QHHD 1ZGWA 2QQ8A 3BROA 2X6WA 3MD2A 2EWNA 1YHQI 5CQEA 2ACJA 3DV8A 4M71A 4XN0A 4I99C 3IUOA 1WHUA 1Y0UA 1VQKI 3DQVC 2O7OA 4IQ4A 1ZRFA 1GVJA 1U9NA 3ZGKA 4IL6C 5E20A 3KLOA 1FBSA 1IN7A 3GLXA 4RDUA 1JUMA 4CGZA 1JUPA 1YJ9I 2GZWA 1BA5A 4FX0A 4HF0A 3CC4I 3EUHC 3WTXC 1LFUP 2XSJC 5H20A 2FXAA 4BE2A 1K78B 2GIZA 2DT7B 4DQ2A 4BXXJ 1FNNA 1WH7A 1DP7P 1BR4A 4MO7A 5HDKA 1P92A 2XAHA 3S1QJ 1CQTA 3PUFA 1KQ9A 3KYLA 2JA5J 4IHSA 2JRTA 4PJLA 2ECCA 2EFWA 3OOUA 2GQQA 2WAQN 1YOVB 2M4KA 1YQAA 3U1KA 4LLGF 4XLHA 1EKEA 3BCAA 4MNUA 2BVLA 4IOAF 1MBJA 4RAZA 4X1EA 2RREA 5F0CA 2DQLA 1VQ7I 9ANTA 4ENMA 3BZ6A 1XGMA 3FF5A 4Y33A 1CGPA 3SJMA 3BTIA 1MJ9A 2R7WA 3QPTA 2ME0A 2GXAA 1SC7A 1W4MA 2FQ3A 1IRGA 5AONA 1L3LA 3C2GA 5DCMB 3IKTA 3T1BA 5M5WJ 4KMFA 3S3MA 1NG7A 2TDXA 4CZZA 2NS7A 1YI2I 3D5LA 2IGMA 4HDUA 3CUQB 2DMQA 3TDUC 5D8KB 5DTDA 1GHCA 4LIVA 1WI9A 4UNOA 1UG0A 3JREA 1XGSA 3PIOF 1JJ8C 3JR9A 3W6KB 3GF2A 1VI0A 2XF6A 1R5GA 2DJNA 4XSZF 5DUIA 1R9TJ 1YW8A 3LQRA 4R79A 1LFPA 3CF5F 4RMNA 5D6FA 3M8JA 1ZELA 3ROUA 3QOPA 5FKLA 4HQEA 2HDWA 2AO9A 4I76A 3PFIA 5IOZA 2JSCA 4YFKF 3F9KA 3HHHA 2X85A 3F3XA 4LMYA 2OZUA 3R61A 1UHSA 2COMA 1DU6A 2VKDA 2A3SA 1KGSA 5L3FA 3BP8A 2EZHA 1XSXA 3PSFA 1OLTA 4C30A 2BW3B 3MWMA 1WFXA 3CCYA 4M3DA 2F6CA 2ECBA 1K4TA 2DODA 4C3IJ 1DP3A 2MA3A 3F8MA 1FSEA 3CO7C 3AL0B 2K9MA 3HRMA 5F04A 3F21A 4E4HA 2QQAA 4C2TA 1Z91A 1R5HA 2LY9A 3Q9VA 2D5VA 3DEEA 2RQQA 2YS9A 4UUSA 4S04A 2AQFA 2HNHA 4RGUA 1QBJA 1SFKA 2A61A 2UXXA 2FBHA 3S3NA 2M8EA 4BY1J 1B8IB 4RB3C 2W1OA 1IN6A 4V19K 5F6FA 3WU0A 1DQUA 1XGNA 2E5ZA 2QKMB 4ZH4F 5J8FA 4ENKA 3Q9SA 1OR7C 5K5QA 2P6TA 3ECHA 2Y75A 1SVMA 3VPRA 1PDNC 1G3YA 2PMZN 3VYUB 4LFUA 1P7IA 1OYYA 1PVEA 2Y0SN 1R7JA 1HBXG 1SAUA 3TP0A 3V8KA 2VQLA 1I6HJ 3J80Z 2ESNA 2EB7A 2KDZA 3L9FA 3FXMA 2Y9YA 5C3EJ 1A6QA 5ERIA 4U7BA 2K9NA 5TRDA 4A3JJ 3BR0A 3JSPA 3FM5A 1Z05A 2G7HA 5CVIA 2H27A 1FY7A 1O7LA 5LBQA 1K4SA 4OMZA 1DPRA 2CSOA 3EUHA 2QSGX 5CVJA 1I3QJ 2PQ8A 2ZO4A 5EJCA 3OYDA 2HPIA 3LSJA 2HS5A 4CYCB 2E19A 4A3MJ 3B6CA 2GXGA 4P9FA 4Z2YA 1EJ9A 3CCRI 2DK8A 5JVTA 2LF7A 4AIDA 3LAJA 4WF2A 3BR5A 2IT0A 4OIRF 4IRIA 3G2BA 3O8HA 3OIQA 2L5QA 3KEYA 1WQ2A 5HLIA 4RAYA 5HS7A 5J8CA 4HF1A 3FK7A 3LFKA 1LDDA 2Q0OA 5DDGA 4XLNF 4E7ZA 2PEXA 1K61A 1MSFC 3C1DA 3C7JA 4S05A 1TQIA 2DA5A 4LG0A 2NVUB 2E7WA 3QP5A 2VLAA 2A6HF 3K4KA 3FXKA 2BY3A 3A2KA 3DP7A 3CCSI 2QA4I 4XKWA 4RLFA 4LOCA 2EV6A 1ETOA 2QBYB 2R7ZJ 3F72A 3ZPLA 4II3A 4HNUA 4ENNA 4WK8F 1R4NB 1MNEA 2XAGA 5EZHA 3O2PE 4KUMA 1PUFB 3S2WA 1AU7A 2DOAA 2X1DA 2CUFA 2M0CA 1FIAA 3GTMJ 2LDUA 3OSGA 2XRLA 4CXFA 4N9HA 4PZJA 4J19A 5DD8A 2ZMEC 1PP7U 4M3GA 2KIFA 4RM2A 2EPFA 3LA7A 1BOBA 5M5YJ 2K02A 2QQBA 2Q2EA 5CVRA 5KAFC 3HDDA 2JSPA 1HC8A 4BHBA 1EV7A 3JSOA 2M87A 3ELKA 4KT5C 3LSRA 2JN6A 1O3SA 4EJVA 2L9SA 2V79A 1H8AC 1FIPA 5ICCA 2QENA 5GADJ 3HXLA 2W7NA 2KT0A 2IGKA 3SFIA 2MYSA 3FX3A 3H5AA 1S7AA 3I64A 3LSTA 5DS9A 3WGGA 1YE9A 2EV5A 3GLLA 4G7ZF 1R22A 4Y3OA 1YX3A
chains in the Genus database with same CATH topology
2LG4A 2X51A 2RNGA 3FDYA 3K6GA 5HNFA 3DTKA 2HQAA 3UNGC 4HRIA 2KMUA 2NOJB 2VQHA 1AA7A 3QYFA 2OV7A 2LRDA 3HPGA 2R7TA 4KISA 4BQQA 2VQCA 3HG9A 3DKXA 2IS2A 4XKVA 2VJIA 2R4GA 2ZSIB 4D1QA 2CUJA 2QKLB 4H4KC 4AVZA 4HSRA 3OYAA 2ZFUA 3ZCOA 2OUMA 3EUAA 2DCEA 2VJ5A 2WB1A 3BG6A 3BCBA 1D1CA 5KCMA 2CS3A 4JOMA 3HL2A 3CP8A 1TZLA 2LH9A 3S3OA 1J09A 4F93B 2Q2EB 2X1CA 3QYEA 4LIUA 1E0EA 3BG7A 1TT0A 3PNYA 4NC7A 2KQRA 4BEHB 4CCOA 2UUZA 3A4CA 3A1YA 3DTIA 3LSGA 4NC8A 2CH0A 4B48A 2CW7A 2IS1A 4XLAA 1JI8A 2VJ4A 2R7UA 3UR3C 2JVGA 3SEQA 3NWTA 3RSNA 3K4MA 2XC7A 5KNLA 3H9JA 2ZXHA 3H5NA 3ZR8X 3DPUA 3OYEA 2M7BA 3DU6A 4ZTJA 4YRVA 3QODA 2IS4A 3ZXSA 3OS2A 3VWBA 4IX7A 3M1CA 4BL0B 4E7JA 3DU5A 2ZSHB 3VYSB 4X0GA 1X19A 2DXIA 4E7HA 1V5FA 4U87A 3PNVA 2Z1DA 2A6TA 4CCLA 1UAAA 2R7SA 1MMGA 2WA0A 4LG3A 4OAZA 2F5VA 2KRCA 2I8DA 3SEZA 4IKFA 1N78A 4XKCA 1HA8A 2KRHA 2XF7A 2XF5A 3AL0C 1Y56A 4MLOA 3OYGA 2DT6A 4ZDOA 2FUG2 1Z7LA 4DOZA 1Z3XA 1V5GA 3ZRGA 2KDOA 1WJBA 1X4OA 4J01A 4NQWB 4BE1A 2HVSA 2VASA 1BR1A 2VL8A 4YELA 3DPLC 2HVQA 2CV1A 4BS9A 2R7RA 1MNDA 2VXZA 2K9LA 5HOOA 3I3LA 4PSXA 3TMOA 3W2VA 2DJIA 4XM3A 3OYMA 2PMZA 4NUBA 2Y0SA 4FASD 3U21A 4CCMA 5LD2C 3TBIA 1D1AA 3DKYA 1WJ5A 1PYVA 4DBRA 1X1BA 2HU9A 4ANJA 2M7AA 3DPTA 3VDXA 3OYJA 3GBGA 1WJCA 3K10A 1D0YA 4PJMA 2K5CA 4AYBA 1N75A 4HEA2 2X6XA 2VQGA 4II2A 4FETA 1QU3A 3OYBA 3LL7A 2W4SA 5HNHA 4F92B 2WAFA 4ZDLA 4B3XA 2BOLA 3NWSA 2W00A 1X1AA 2KPMA 2O5RA 1P9QC 3OS0A 1D0ZA 1WJFA 3L2UA 4YEJA 4XLCA 2UV1A 4PUSA 2Z2SB 2E5NA 2LREA 3LFUA 1X1DA 4ZTFA 4F52A 1VZ0A 3E0JB 5FRMA 3MMYB 2L2OA 4BDYA 4XOPA 3LSMA 4B44A 4E7KA 3RPUD 2E1MC 5CQGA 2KLOA 4XR6A 3HUGB 2VB6A 3SYTA 3PNTA 3D5RC 2V9KA 3MKWB 1YX5A 4C9YA 2F4IA 3FBNB 3N05A 1BR2A 4PFOA 4BJTA 3CJRB 1QHHD 4AU7A 3PSIA 2X6WA 3MD2A 3AKZA 2X6YA 3LSIA 4QPQA 5CQEA 4XN0A 3OYKA 3DWLE 3IUOA 2WAEA 3DQVC 4IQ4A 5FRNA 3ZGKA 3CF2A 1KONA 1LVKA 5KHDA 4CUGA 1Z21A 4EATA 3IP4B 4ZC3A 3H9GA 1GLNA 3EUHC 2XSJC 3LSKA 4BE2A 2DT7B 3W2WA 2HZDA 3FHNA 1BR4A 1WJEA 3C2HA 3IAS2 3OR1C 4F91B 2CMPA 3S93A 3OYHA 4IZZA 3KYLA 2JUGA 3PFYA 4BJ6C 4XNFA 3HPHA 4PJLA 3J7AY 3VSKA 4PJJA 4ZJZA 3D5SC 3OOUA 4LITA 3BC8A 3HOTA 2AQEA 2M4KA 4BDZA 4XLHA 4J00A 3BCAA 4BXFA 2BVLA 4XOTA 1QHGA 1U0JA 2LBFA 2BW3A 2M0MA 1K6YA 2RREA 2VIXA 4BGDA 4Y33A 4N4OB 1D1BA 2R7WA 4PK4A 2L9NA 2WY8Q 1DGWY 4BJ5C 3SDBA 4GRIA 1T0FC 3HC7A 3K4CA 2HPMA 3C2GA 4DGWB 2ELJA 3H5RA 3LMMA 3S3MA 2HVRA 1NG7A 2KL4A 2V1NA 3D5LA 2IGMA 2V26A 3L2RA 1R6RA 1MMNA 3S32A 4LIVA 1UG0A 4QPOA 2LOOA 3IAM2 2V6EA 1LKXA 2XF6A 3L2VA 4BQOA 3EPZA 4ITVA 4HSTA 4Y4RA 2CV2A 3PUBA 1LFPA 4R79A 4RMNA 2LY2A 3M8JA 1ZELA 1W36D 3H35A 3H9QA 4F55A 4E7LA 5JHFA 2HDWA 4CCNA 3F9KA 4BQNA 3DLAA 2XAUA 2X85A 2MD0A 4PJNA 3QYBA 1PJRA 2R7XA 2VKDA 4OAYA 3PSFA 1OLTA 3CESA 2BW3B 3QOEA 2JA2A 4C30A 1NG6A 4BUPA 4BACA 4N4NB 3W3CA 3SZGA 4CZCA 4DJAA 1WFXA 3OYFA 1N77A 2F6CA 3OWTA 4HPQA 3V42A 1DP3A 3L2QA 3S8PA 2IGNA 2PJRA 3AL0B 2X1EA 2K9MA 1DGRM 4XL9A 4KT6A 3KX2A 2KZVA 4P1WA 4E4HA 4C2TA 2RQQA 3DEEA 4XORA 3OR2C 3CJQB 2AQFA 2HNHA 3CMMA 2BVMA 4CCKA 4F3QA 2Q1ZB 1SFKA 3BLYA 4XLFA 2LC2A 3S3NA 1V5EA 2W1OA 4XONA 4XKBA 1DQUA 1Z3YA 2E5ZA 2QKMB 4NNJA 1OR7C 4IQJA 3HKZA 3K4NA 4B47A 4JQFA 3CP2A 3VYRB 2M4GA 3VYUB 2IS6A 1SAUA 2MABA 3CZ6A 2VQLA 4BU2A 4XN3A 1Y6IA 1FMVA 4CSWA 3EUKL 2VKHA 4E7SA 2KHMA 4U7BA 3OYCA 5CPRB 1W36C 2CV0A 4CCJA 2GOXB 3AFHA 3ONQA 2CUZA 4E7IA 3TL4X 2KP6A 3RCOA 2VJJA 3OYDA 2V4JC 2HPIA 5HLTA 2CW8A 4XQFA 5TGTA 3OYIA 1WJAA 2L7KA 4RM3A 2K3PA 3FBIB 2VPLA 4G6TB 2R7OA 2PJRB 3G2BA 3OIQA 4BE0A 2UWMA 2L5QA 1MMDA 2WADA 3KEYA 3K70D 3K4LA 4E7ZA 2CFOA 1G59A 3OS1A 3OL3A 2VLAA 3K4KA 5CKTA 1X4PA 3A2KA 2E1MB 3DTEA 3OYNA 4XKWA 3LSHA 4RLFA 4KITB 4DBQA 3PL8A 1FMWA 3OYLA 2MFZA 2A5WA 2OC6A 4II3A 3OL4A 3OMYA 4CA0A 4HNUA 1MNEA 1D0XA 3RQ4A 4PSWA 1MMAA 4HG2A 4DIQA 3MKYB 2DOAA 2X1DA 5HVQC 3ZQQA 1EA3A 2WBMA 2LY1A 4ZDPA 4XLEA 2IGOA 3VSLA 3I9V2 3L2WA 2E60A 1LDKB 2P0WA 3OIPA 2JVHA 4KJZA 4RLQA 1S9HA 4RM2A 3K4JA 4XMYA 2GOMA 1BOBA 1UELB 3PJRA 2ZXIA 4BEHA 4OWRB 2R7VA 2JSPA 2XDVA 1MW7A 3VYTB 4HNTA 1ERDA 3H0DA 2MC4A 2V7FA 4C2UA 1X1CA 2L9SA 2VXDA 3RTRA 2LBFB 2W82A 2Z16A 3W2AA 1WJDA 4E6KG 1T95A 3E1SA 4PFPA 3HOSA 5FROA 2LYCA 3HXLA 3OY9A 2W7NA 1G8XA 4D9JA 5LFAA 2IGKA 3K70C 2MYSA 3K4BA 3H5AA 4B43A 2R7QA 4P5OA 2IXSA 3FKJA 1IRXA 1YE9A 2M3AA 2WY7Q 3MKZA 2WAQA 4CH7A 4Y3OA 1YX3A 4ZYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJF A;  3HPH A;  3F9K A;  1WJB A;  1LFP A;  1MW7 A;  1KON A;  1WJC A;  1WJD A;  3HPG A;  1K6Y A;  1E0E A;  4F3Q A;  1WJA A;  1WJE A; 
#chains in the Genus database with same CATH topology
 1YG2 A;  1A04 A;  3GW2 A;  4M6X A;  3E3V A;  2RNG A;  2CU7 A;  2JZY A;  3KP6 A;  4P96 A;  1HSJ A;  4HRI A;  3CC2 I;  4AVP A;  2GA1 A;  3GVA A;  1HQC A;  1AA7 A;  3QP6 A;  2OV7 A;  1KU2 A;  2X6O A;  5GTI C;  4HF2 A;  3MQ0 A;  3CLO A;  4UUV A;  4XKV A;  2VJI A;  2CUJ A;  2XAS A;  2NVQ J;  3HGG A;  2RAE A;  2M34 A;  1OYW A;  3ZCO A;  4A5N A;  2DCE A;  4FE7 A;  1OR7 A;  3A01 B;  2EBI A;  2Z3Y A;  5KCM A;  4NB5 A;  1NTC A;  3CDH A;  5BPD A;  3T0Y A;  1M1E B;  4FCY A;  3CLQ A;  2DFI A;  3K1N A;  2OD5 A;  4LIU A;  5E3M A;  1TT0 A;  1OMI A;  2GA2 A;  4NC7 A;  1A6I A;  1FBQ A;  2KJB A;  3BR3 A;  1NK3 P;  4NC8 A;  2CH0 A;  2CW7 A;  2IS1 A;  1U5T B;  3M3Y J;  2DFE A;  5D4S A;  1VQO I;  3HIF A;  1JI8 A;  2XPU A;  2IA0 A;  4BHC A;  4BYY A;  3WTU C;  3SEQ A;  3NWT A;  6PAX A;  3K4M A;  5IT3 A;  1JJ6 C;  4GFB A;  2FD5 A;  5A2Q Z;  5KNL A;  3H9J A;  4MFE A;  2JQ7 A;  1P7J A;  1R1U A;  2FNP A;  3OYE A;  1BJZ A;  4W1U A;  1Y39 A;  5F1J A;  3HGY A;  4YRV A;  3GZ6 A;  2IS4 A;  3KET A;  3OS2 A;  5E3O A;  3PO3 J;  3G4S I;  1V3F A;  2K7L A;  2NVY J;  2VPR A;  4I0B A;  4BL0 B;  5GTH C;  4L18 B;  3FXO A;  4BH9 A;  1YJW I;  2JRM A;  1ZRE A;  1J2X A;  2Z1D A;  3ML6 A;  4EGY A;  2A6T A;  5C4J J;  1UAA A;  4U0V A;  2BZT A;  3DF8 A;  1MMG A;  3PO2 J;  1YRN B;  3SEZ A;  3ZQF A;  2XF7 A;  2XKP A;  4MLO A;  2DT6 A;  1IV8 A;  3RKX A;  1E3P A;  2OCC H;  2FUG 2;  1FOY A;  3I58 A;  4DOZ A;  4V2G A;  1H88 C;  1PP8 F;  4YFX F;  2VUM J;  3IRQ A;  1SEU A;  5IYB J;  2H8R A;  2ZB9 A;  2ZXJ A;  4M9X A;  1G3W A;  1LE8 B;  1I3A A;  2IRF G;  2CV1 A;  2JUC A;  1TQP A;  4BS9 A;  3HUG A;  2VXZ A;  1F1Z A;  2HZT A;  1SMY F;  2CO5 A;  2K27 A;  1A5J A;  3I3L A;  3TMO A;  3A0B C;  4BNC A;  1LEB A;  5F27 A;  1UFM A;  3BR2 A;  2RNJ A;  3P5J A;  3CUO A;  3C18 A;  4FAS D;  2ZME A;  1PYV A;  1QRY A;  1B4A A;  1KZH A;  5GPA A;  4HQM A;  3VDX A;  3JRF A;  2TCT A;  1P4X A;  3GBG A;  4G6D A;  3K10 A;  4IHX A;  1JE8 A;  3DFG A;  4HEA 2;  2X6X A;  4I98 B;  3M4O J;  1MBK A;  5JLX A;  3JAM Z;  2I10 A;  2O03 A;  3LL7 A;  4C3J J;  3A0H C;  1U5T C;  3RYR A;  1ZQ3 P;  3JW4 A;  1OCZ H;  2C6Y A;  1K6O A;  2QEX I;  1RRJ A;  1X1A A;  4Q4Z F;  1Y8Q B;  1SFO J;  4JX4 A;  2KRF A;  1ITY A;  2EIL H;  1WJF A;  3L2U A;  2DYS H;  4YEJ A;  5HDN A;  1H89 C;  3GTQ J;  3IH2 A;  5DM7 F;  2NYX A;  4EM1 A;  2R93 J;  1FP2 A;  3GFJ A;  5F1R A;  2Y9Z A;  2DK5 A;  3MCZ A;  4I0A A;  3WTW C;  2EIM H;  4I02 A;  2R5Y B;  2LRE A;  2STW A;  1W7P B;  1XC5 A;  2M30 A;  3PM1 A;  5F08 A;  1VZ0 A;  5BS6 A;  1PUE E;  3CJN A;  2ZJ2 A;  3RPU D;  5JVG F;  1TWH J;  4E70 A;  3HTS B;  3PNT A;  4NC6 A;  3MZ8 A;  5JLW A;  4XLP F;  1HKQ A;  2B63 J;  1T39 A;  1YX5 A;  4C9Y A;  2F4I A;  3L1P A;  4PFO A;  3B02 A;  3HOV J;  5BQT A;  4AU7 A;  5JI6 A;  3MZY A;  1UHW A;  3AKZ A;  3F0C A;  2KIQ A;  2FQ4 A;  2VBZ A;  2WAE A;  3IH3 A;  4FHT A;  1MDM A;  3KP4 A;  1O4X A;  5B1B H;  3JRA A;  1T98 A;  1SVL A;  1R36 A;  1IDY A;  1TL8 A;  3TO6 A;  2FSW A;  4BY7 J;  2HDC A;  3LSP A;  5K7Z A;  4RB0 A;  2IAI A;  3WHB A;  3FIW A;  2L9R A;  3COA C;  3W2W A;  2HZD A;  2K3F A;  3SZT A;  2B9S A;  3HEF A;  1XSV A;  3OR1 C;  1S7O A;  4F91 B;  3BG9 A;  3RQI A;  1ETV A;  2OTJ I;  3OYH A;  4IZZ A;  1SFX A;  3CDI A;  3BR1 A;  4XNF A;  5K1Y A;  5EG0 B;  3J7A Y;  2YR2 A;  1KYW A;  4LIT A;  2NOG A;  3HOZ J;  4EEF G;  3BT9 A;  3HTU A;  3GFI A;  5JFR A;  4J00 A;  4BXF A;  2NNN A;  3PIP F;  4XOT A;  1QHG A;  2DMU A;  3GTG J;  2XVC A;  4N4O B;  2ZKZ A;  1FOW A;  4UB6 C;  3ZMZ A;  1D1B A;  4PK4 A;  2JA6 J;  2F5E A;  4BJ5 C;  3KYC B;  3I54 A;  1XDU A;  2A69 F;  2HPM A;  2FBK A;  4DGW B;  5J4Y A;  2XGD A;  1ZG3 A;  1OCR H;  1HCR A;  1BI3 A;  2WC2 A;  3S14 J;  3RJP A;  3KE2 A;  5L3B A;  1T33 A;  4KIF A;  3VOD A;  4UHT A;  3D0S A;  1MMN A;  5ILU A;  1J75 A;  1MH3 A;  2A05 A;  1REP C;  5EYR A;  4QPO A;  4GXO A;  5DEQ A;  2LOO A;  3IAM 2;  2P5V A;  2GM4 A;  4EJU A;  3TOB A;  1B9N A;  4DNC A;  2HTS A;  3L2V A;  3HOU J;  1W5T A;  3BY6 A;  3H3Z A;  3M7G A;  3AG1 H;  4Y4R A;  1IV6 A;  3TW6 A;  2CQQ A;  1W36 D;  2P4W A;  2DU9 A;  4PGH A;  4E7L A;  2DPU A;  5JHF A;  2UXN A;  3BPV A;  4CCN A;  2X0L A;  2F2E A;  4BQN A;  4HDV A;  4DYQ A;  2ID3 A;  3TED A;  2FEZ A;  2MD0 A;  4PJN A;  1NH3 A;  1H0M A;  1YS7 A;  4DYC A;  1U5T A;  4JK1 X;  2GIV A;  2DN0 A;  2X9D A;  1LUJ B;  3QOE A;  2JA2 A;  4N4N B;  3W3C A;  2XB0 X;  3SZG A;  4CZC A;  2PG4 A;  3OYF A;  3GTJ J;  4LK0 F;  1N77 A;  1AKH B;  4HPQ A;  3V42 A;  5K5R A;  1JGS A;  2V1X A;  3S17 J;  3S8P A;  3CCQ I;  2OQR A;  2XGC A;  1DGR M;  3KIO A;  1QZE A;  3GYH X;  3CC7 I;  5HDG A;  2EH3 A;  2FMY A;  2WV1 A;  3OR2 C;  3BJO A;  3CMM A;  4M9S A;  2MC3 A;  5IP9 J;  4L5E A;  3BLY A;  2XGE A;  3RZD J;  5ICF A;  2HKX A;  3WHC A;  1GT0 C;  1BC8 C;  4QTR A;  3C2B A;  2M5W A;  3W6J B;  2XRO A;  2MLK A;  1LFB A;  1Z3Y A;  3F8F A;  1MZB A;  4KN7 X;  3T8R A;  4IQJ A;  4X6A J;  2P5L C;  3FZV A;  4YII A;  4B47 A;  4XBF A;  3FXJ A;  5TIS C;  2HGC A;  5D5V B;  4EGZ A;  3M1E A;  2LMD A;  3JRG A;  2GXB A;  2FNA A;  3ZQ7 A;  2D1V A;  2G9W A;  2BXZ A;  2HOS A;  3LAP A;  1HKS A;  2E7X A;  4E7S A;  4A5M A;  1MMS A;  3A03 A;  3KP5 A;  4A3B J;  3LA3 A;  5H6Q A;  1P6R A;  1W36 C;  2CV0 A;  1XGO A;  5J1U A;  4FX4 A;  2GOX B;  2F5F A;  3P7N A;  1E17 A;  3ONQ A;  2DOE A;  5D6E A;  2CUZ A;  2KP6 A;  2MLG A;  3ZMD A;  3CCM I;  1HXD A;  3I59 B;  2V4J C;  1ZKG A;  2CRG A;  2LKS A;  5HLT A;  5TGT A;  3GZN B;  4XRF A;  4A3K J;  2UZK A;  2QUF A;  5IY5 H;  2FRH A;  3OYI A;  2K9S A;  4RM3 A;  5ICE A;  2VPL A;  4M73 A;  1S5L C;  3DXJ F;  3MVP A;  1VQ6 I;  4IPA A;  2PJR B;  4A0Y A;  2WAD A;  1TT5 B;  2M45 A;  3K70 D;  2P7C B;  1W0U A;  3IC7 A;  2FX0 A;  2PBI A;  1G59 A;  3FXU A;  3GXO A;  1ORK A;  1SFE A;  1HW1 A;  1MBG A;  1D8K A;  1ZGJ A;  3GO5 A;  4A2U A;  1H9G A;  4AWX B;  2GAU A;  3OS1 A;  3WTY C;  2M1B A;  1UCR A;  4HBL A;  4G7H F;  3OL3 A;  1YIJ I;  1VF9 A;  4ZYH A;  3DEU A;  2V9P A;  1X4P A;  4BHP A;  2GLO A;  1IJW C;  3OYN A;  2DAO A;  3QRF F;  1RR7 A;  3QQA A;  4LB5 A;  3OYL A;  2ZNZ A;  2A07 F;  2A5W A;  1R58 A;  2IW5 A;  2MG4 A;  3OMY A;  4IEJ A;  1MNM C;  1MMA A;  4ZZL A;  4DW6 A;  3JRI A;  3FIS A;  3MKY B;  1R5I D;  2ESH A;  4BAY A;  4A3C J;  4GO1 A;  3KFW X;  1J7K A;  1TWC J;  4ON0 A;  2WBM A;  2CFX A;  4FTH A;  5E17 F;  5FFZ A;  4ZDP A;  4XLE A;  2E36 A;  3VSL A;  2K4B A;  1IO2 A;  2VBW A;  1TNT A;  4OIP F;  4LGW A;  1X2M A;  5IOY A;  4LJZ F;  2P0W A;  3OIP A;  1USS A;  1X3U A;  1OPC A;  4GGG A;  4RAG A;  1S9H A;  2QLZ A;  3TDZ C;  1JKO C;  2GOM A;  1XTA A;  3DKW A;  3FHZ A;  3ZN1 A;  2DDA A;  3PJR A;  4BEH A;  4OWR B;  4MHG A;  1WSU A;  2R7V A;  4JX6 A;  2HYJ A;  2CQN A;  3RZO J;  2XPV A;  1ERD A;  2YU9 J;  3H0D A;  1G4D A;  2R5Z A;  1FJL A;  4HX4 A;  3WE3 A;  1TWA J;  2LVS A;  3RTR A;  2W82 A;  2Z16 A;  3W2A A;  1WJD A;  2LLK A;  4M3F A;  4U0W A;  5KVR A;  3RYP A;  5BOX A;  1T95 A;  3IL2 A;  1JTY A;  5FRO A;  3GCM A;  1XMA A;  2LYC A;  2ICW G;  3GFM A;  2XUB A;  2RGV A;  2CWE A;  3K70 C;  2VBY A;  3WTZ A;  3K4B A;  4IF4 A;  4B43 A;  3DLL F;  5EGO B;  2IXS A;  3FKJ A;  2WY7 Q;  4L5I A;  2DA6 A;  2L7Z A;  1VFC A;  4ZYA A;  3NEU A;  2LG4 A;  4RGR A;  5EG0 A;  1IN5 A;  2RVC A;  1JTX A;  3U1D A;  2GWR A;  2HQA A;  2W57 A;  2DA7 A;  2QF7 A;  3I71 A;  2NOJ B;  2RQP A;  4MEY F;  3BJA A;  2K85 A;  2L4A A;  2LRD A;  3B73 A;  3HPG A;  5K7H A;  3HG9 A;  3DKX A;  3RIR A;  4KIC A;  1F4K A;  3F6V A;  1RKT A;  1MJA A;  1SD5 A;  2OF7 A;  5CVU A;  4H4K C;  5FD5 A;  3OYA A;  2ZFU A;  2DDB A;  1TP4 A;  2OUM A;  4NQW A;  2VJ5 A;  3SZP A;  5HS9 A;  2AXL A;  2HYG D;  2WB1 A;  3BG6 A;  3CUQ C;  3G6E I;  5J1R A;  3RPQ A;  1CF7 B;  2CS3 A;  5B66 C;  4XID A;  4L0Z B;  3S3O A;  2W24 A;  4F93 B;  2FML A;  1Q1V A;  1SMT A;  1ZG1 A;  1YJN I;  2KQR A;  4CCO A;  3JTH A;  1HLV A;  3A4C A;  3DTI A;  1IUY A;  3ESW B;  2HFH A;  4IJA A;  3WE2 A;  2LTP A;  1UMQ A;  2RDP A;  3HYI A;  3U9G A;  4I7H A;  4JBA A;  3UR3 C;  1K83 J;  1AOY A;  2CUE A;  3E5Q A;  2JA7 J;  3KPH A;  2HDD A;  1L0O C;  5EF6 A;  1XCB A;  4RS8 A;  1QVT A;  5A2Q K;  2DYR H;  1O3Q A;  2M7B A;  1FT9 A;  3FWE A;  4HAM A;  1W5C C;  4B3A A;  1QZY A;  4ZTJ A;  1O3R A;  3SHF A;  3G3Z A;  3IRR A;  2ZBK A;  4IX7 A;  5CVV A;  2VC0 A;  3RKY A;  2ZSH B;  4GDF A;  1LB2 A;  2L7M P;  2P5K A;  4U87 A;  3DBR B;  1U8R A;  2ETH A;  3KLN A;  2K40 A;  3BTJ A;  3GTK J;  4B09 A;  5E8I A;  3DBL B;  2F5V A;  2YX7 A;  5J4V A;  2WWY A;  1YIT I;  4XKC A;  1IDZ A;  1X58 A;  1GXQ A;  3K1P A;  3AL0 C;  1KA8 A;  1T6S A;  4ZYD A;  3I55 I;  5LGU A;  3E6C C;  1V5G A;  3ZRG A;  3RKW A;  1XMX A;  4A0Z A;  4J01 A;  1WVR A;  5GPC A;  4HZF A;  2QSH X;  3QPS A;  1JKQ C;  2E2J J;  2VL8 A;  4YEL A;  3LOC A;  2DMT A;  2HVQ A;  2R7R A;  1MND A;  4WXC A;  1VQ9 I;  1FTT A;  1QNT A;  2J5P A;  2O6G E;  2PN6 A;  2BEO A;  2HTJ A;  1JKR C;  2Y69 H;  3ASN H;  2KZG A;  1BI1 A;  4CCM A;  2E1C A;  3CJT B;  4DBR A;  2HU9 A;  4ANJ A;  3S1R J;  1P4W A;  4NHJ A;  4O6J A;  2V9V A;  1FC3 A;  2E1N A;  4MGR A;  3F8C A;  4EJW A;  2OA4 A;  2K5C A;  4B8X A;  2VQG A;  4A93 J;  1QU3 A;  3OYB A;  1FP1 D;  5FGM A;  4G9Y A;  3BQZ A;  1QO0 D;  2XKO A;  1Y1W J;  1K78 A;  5HOD A;  2VON A;  2EIJ H;  2VT2 A;  5ILV A;  3IHU A;  1IAW A;  2EFQ A;  2W00 A;  3S1N J;  4YFN F;  2DMN A;  1P9Q C;  3J7Y J;  1FYM A;  1YS6 A;  3I59 A;  4QIW N;  2DBB A;  4GYI A;  3CDL A;  5L3D A;  3BPX A;  2B0L A;  4P9U A;  3BOQ A;  3F23 A;  1HF0 A;  3H0G J;  3HRU A;  3LFU A;  4F52 A;  3MMY B;  4RGS A;  3H1C A;  1ZN2 A;  1ENH A;  4HV6 A;  4ABZ A;  4B44 A;  2KLO A;  4OIQ F;  1VND A;  3ASO H;  3R0A A;  3SYT A;  1XSD A;  2Z99 A;  3D5R C;  3MFK A;  3MKW B;  1WWX A;  1Z0X A;  1FZP B;  1WPK A;  5DCM A;  4BJT A;  2EFN A;  4FE4 A;  5LHG A;  3CJR B;  1A36 A;  4RAF A;  4EM2 A;  3PSI A;  2X6Y A;  2HQR A;  3LSI A;  2KFD A;  4MQ9 F;  3ZQI A;  4MFD A;  3CUQ A;  2MD5 A;  2B7E A;  5L3G A;  3IV5 A;  1D8J A;  5FRN A;  3EDP A;  3OOP A;  3CF2 A;  1MH4 A;  1D5V A;  2OTL I;  1Y8R B;  1LVK A;  1Q1H A;  1ZTR A;  5D5W B;  2BY0 A;  1O3T A;  3KCC A;  4Q47 A;  4ESB A;  1J9I A;  1BJA A;  3BTL A;  3IP4 B;  4ZC3 A;  3J81 K;  1J0R A;  3KEO A;  4EQQ A;  3K7A J;  3LSK A;  2L3D A;  3RKQ A;  4HNV A;  1FLI A;  1O57 A;  3HRS A;  3AAF A;  1HW5 A;  1TTY A;  1ZLJ A;  3S93 A;  2DO7 A;  3CCL I;  2IEK A;  3U2R A;  1C0W A;  2P6S A;  2JUG A;  3QPH A;  3PFY A;  4BJ6 C;  3JCU C;  3HPH A;  4IRG A;  5HLH A;  3TOA A;  2FU4 A;  4PJJ A;  4ZJZ A;  2L4M A;  2XB5 A;  2F5C A;  3BC8 A;  1V55 H;  2JK3 A;  1G6N A;  2QCO A;  2AQE A;  3GZ5 A;  1NHA A;  1OJL A;  4BDZ A;  1ZRD A;  2O8K A;  1U0J A;  5C44 J;  2BW3 A;  2M0M A;  1K6Y A;  1U2W A;  1QPM A;  2O0Y A;  4F7Z A;  2R7F A;  2VBX A;  2O8X A;  5D5U B;  2WY8 Q;  1DGW Y;  1HKT A;  2PLY A;  4IHV A;  2FOK A;  4GRI A;  1Y0N A;  1T0F C;  3HC7 A;  3K4C A;  1I27 A;  5ICG A;  4PCQ A;  3V4G A;  1T08 B;  2ELJ A;  2CJJ A;  3H5R A;  4GYG A;  4ETS A;  1X2N A;  3I5U A;  3LMM A;  5FKN A;  2HVR A;  2KL4 A;  1IW7 F;  4JP0 A;  1I5Z A;  1Z6T A;  2X4H A;  2ZNY A;  3VB2 A;  4H0E A;  4Q5S F;  1LJ9 A;  2WB1 N;  3HOX J;  2V26 A;  5DM6 F;  1MJB A;  5C4X J;  1HDP A;  1R6R A;  3FMS A;  3GFL A;  1B8I A;  1V54 H;  4D0P A;  2BBY A;  3Q0V A;  4U0Y A;  2D1H A;  4HOB A;  1LKX A;  2M8G X;  3E7L A;  4BQO A;  4ITV A;  4HST A;  1ZLK A;  2CV2 A;  3AG3 H;  5DV5 A;  3H3U A;  1KU9 A;  1KQ8 A;  2LY2 A;  4G8X A;  1W0T A;  2DTZ A;  5FKM A;  4DYR A;  2X48 A;  1CF7 A;  3H9Q A;  4HYE A;  4F55 A;  1XB4 A;  2OZ6 A;  3M8F A;  3H92 A;  4IXA A;  4L9N A;  1IG7 A;  2HQ5 A;  3DLA A;  3ZMT A;  1G3T A;  2XAU A;  3QU3 A;  4AD9 A;  3TP3 A;  3QYB A;  2K4J A;  2VT3 A;  3FXQ A;  2BY2 A;  1PJR A;  4QLC U;  2QM3 A;  3ZMU A;  1HOM A;  4OAY A;  4A3F J;  4XSX F;  2A68 F;  3GME A;  4IO9 F;  4O5V A;  3P9C A;  4RB2 C;  3CES A;  4BAC A;  1WZ2 A;  4CYC A;  1NG6 A;  2OAZ A;  3M9A A;  5FO5 A;  4Y7N J;  3S2D J;  2H6C A;  2OU2 A;  2NRA C;  2KZV A;  4P1W A;  2VE9 A;  1DDN A;  1BM9 A;  5FLX Z;  4XIC A;  5IT9 Z;  2NS8 A;  1U9O A;  2BGC A;  4XOR A;  3FM3 A;  5IYD J;  1W7P D;  1UJ8 A;  2Q1Z B;  1DUX C;  5EEH A;  1STZ A;  5L3E A;  1EF4 A;  2LC2 A;  5H6R A;  1O7F A;  1V5E A;  4RB1 A;  4XON A;  3Q0U A;  4KDP A;  2EIK H;  2O61 A;  4NNJ A;  2IJL A;  4I01 A;  3FXL A;  1J5Y A;  1OFC X;  3CQZ J;  3K4N A;  2QBY A;  4KYW A;  3HSE A;  2K9Q A;  1RIO H;  4JQF A;  2Y0M A;  3ABM H;  3VYR B;  4D7N A;  5M5X J;  2ZJR F;  5DUK A;  1TW3 A;  1PUF A;  2IS6 A;  3MKL A;  3L2C A;  1UST A;  2L02 A;  2DLL A;  4XRS G;  1FMV A;  1ULY A;  5J3L A;  3N97 A;  4CSW A;  2VKH A;  4M3B A;  1LVA A;  4HW0 A;  2JMW A;  5CPR B;  1ZR4 A;  1IXC A;  4CCJ A;  3I4M J;  2LFB A;  4E7I A;  3MAJ A;  2F5D A;  2VJJ A;  1OIS A;  3RCO A;  2F4O B;  3JRD A;  2DW4 A;  2CW8 A;  5F0F A;  5FLV A;  1XN7 A;  2VE8 A;  4L5J A;  2FE3 A;  2JJ7 A;  1RUN A;  1WJA A;  2L7K A;  1RKW A;  3WU1 B;  2LNB A;  1S72 I;  1JKP C;  2K3P A;  3FBI B;  4LLL A;  3Q5F A;  4G6T B;  5LEK A;  2G7U A;  3BQY A;  3EET A;  2NVT J;  3R6S A;  2UWM A;  3ZP5 A;  4JYK A;  2CFO A;  4V2F A;  3V7R A;  1ON1 A;  2Z33 A;  4CHU A;  1I1G A;  4EMS A;  5CKT A;  2E1M B;  3DTE A;  1VQN I;  1ETY A;  3WTT C;  2A5Y B;  2DQR A;  2KIM A;  4KIT B;  3ZOB A;  3HSR A;  1T0F A;  4N0B A;  2R92 J;  2OC6 A;  2QWW A;  1VQP I;  4CA0 A;  2V6C A;  1XG1 A;  5FD6 A;  4CIC A;  4HLX A;  1D0X A;  3WTV C;  2OBP A;  4L9J A;  1BI0 A;  4DIQ A;  1T56 A;  5ILS A;  2O3F A;  5DD4 A;  3KZZ A;  3E5U A;  4OU0 A;  4WWC A;  5HVQ C;  1ETW A;  5FB2 A;  1MGT A;  2LR8 A;  1MD0 A;  1SAX A;  4K2E A;  3ABK H;  3TGN A;  5CJ9 A;  3A01 A;  5LGN A;  3L2W A;  3VFZ A;  5HS8 A;  2JVH A;  2ISZ A;  3E6M A;  3HBL A;  1F5T A;  3RDI A;  4XMY A;  1ZK8 A;  4NBQ A;  4U7D A;  3P9I A;  4FQG A;  3P9K A;  3BJ6 A;  2YU3 A;  1Z1D A;  2ZXI A;  5DCF A;  3GUD A;  2R0Q C;  3REO A;  4HLY A;  3DCF A;  3GX4 X;  3VOE A;  3EYI A;  1IN8 A;  1MW7 A;  4UXN A;  3VYT B;  4HNT A;  4W97 A;  1BC7 C;  2MC4 A;  1X1C A;  2O9L A;  2R7D A;  2LBF B;  3G73 A;  1I1S A;  4E6K G;  1TLH B;  3E6D A;  2STT A;  3HOS A;  2KJC A;  1GUU A;  1S29 A;  1G8X A;  5LFA A;  1S8N A;  3ZQC A;  4LG0 B;  2FOW A;  2E71 A;  4P5O A;  3HOY J;  1IRX A;  3T5X A;  2M3A A;  5IP7 J;  4Y15 A;  4WXD A;  1ODD A;  3HZJ A;  2RN7 A;  1UG2 A;  3M07 A;  1U3E M;  2E2H J;  2E35 A;  1WCM J;  5HNF A;  3DTK A;  2XHK A;  3UNG C;  1YRN A;  4RA2 A;  4L9T A;  1QVU A;  2HOA A;  3QYF A;  2CQX A;  2R7T A;  2VQC A;  1OCO H;  2IS2 A;  1GDT A;  2L54 A;  5E3N A;  2TRT A;  2DFF A;  2HXO A;  3FMR A;  2QKL B;  1APL C;  4A3I J;  3EUA A;  2F48 A;  4OMY A;  3E5X A;  3ERM A;  1LE8 A;  5HLG A;  3J80 K;  1KU7 A;  3QU6 A;  1D1C A;  3CTA A;  1E3H A;  1RPW A;  2CG4 A;  3AG4 H;  5EDN A;  4R8H A;  2QYO A;  1KU3 A;  4KFC A;  2BV6 A;  1Y1V J;  2EA4 A;  3NRV A;  1R49 A;  2ELH A;  2Q2E B;  2X1C A;  3PNY A;  4I2O A;  4L0Y B;  3LSG A;  2P7V B;  3A1Y A;  1ZH5 A;  5GAE J;  4B48 A;  1P4A A;  1JHF A;  5TJJ A;  5FJ8 J;  1FX7 A;  1OQY A;  2VJ4 A;  3NQO A;  1NK2 P;  2DTR A;  1QPI A;  1POG A;  4KIB A;  2XC7 A;  2RKH A;  4M74 A;  2DA3 A;  2DA4 A;  2EV0 A;  3L00 A;  3H5N A;  5IYC J;  4G94 A;  3J7Z I;  3SXY A;  2HWV A;  3QOD A;  3I53 A;  2R3S A;  3Q0W A;  3WGH A;  1TC3 C;  5KAI C;  2HQN A;  3VWB A;  3EYY A;  1RI7 A;  4EV0 A;  1VQL I;  4A3D J;  1Z67 A;  3DU5 A;  4KIG A;  4X0G A;  1Z7U A;  2DXI A;  3WGI A;  1YYV A;  3PNV A;  1VTN C;  4CCL A;  3R60 A;  2R7S A;  5FFX A;  4OAZ A;  2WA0 A;  1BIB A;  2EK5 A;  1A31 A;  4IKF A;  1N78 A;  1HA8 A;  2H94 A;  1ZYR F;  2KRH A;  4M3E A;  2XF5 A;  4Y13 A;  3RPU A;  3OYG A;  2PFB A;  4ZDO A;  4C2M J;  1Z7L A;  4BQA A;  3H3V K;  1Z3X A;  3TQN A;  5D8L B;  1P2F A;  2R5Y A;  2KDO A;  1W7P A;  3I56 I;  1WJB A;  1YO5 C;  1X4O A;  5E79 C;  1QZZ A;  3NAU A;  4BE1 A;  2HVS A;  5FKO A;  2VAS A;  1H9T A;  2HR3 A;  1FEX A;  1BR1 A;  1S3J A;  1OYI A;  2W48 A;  2LSO A;  3QAH A;  1A35 A;  2K9L A;  3K1M A;  3SQN A;  3TO9 A;  5HOO A;  4Y17 A;  4PSX A;  4IHY A;  4G12 A;  3BG3 A;  3W2V A;  5M3F J;  2BHY A;  4XM3 A;  4EJO A;  3OYM A;  4IOC F;  1D5Y A;  1KYZ A;  5E3L A;  4NUB A;  3HJE A;  4IRH A;  2VOO A;  3CME I;  5BNG A;  2EA2 A;  1BIA A;  5LD2 C;  5CYV A;  1D1A A;  1WJ5 A;  1X1B A;  1JXS A;  2M7A A;  3DPT A;  3V7S A;  3OYJ A;  1SVO A;  1D0Y A;  1TQM A;  1X3Z B;  1YIO A;  3K2A A;  3KP3 A;  4PJM A;  4UVA A;  5K7F A;  1N75 A;  3HB9 A;  4II2 A;  1ONV A;  4FET A;  1MBE A;  1UHM A;  4A69 C;  5LEJ A;  4BBS J;  2WAF A;  2AS5 F;  4G6Q A;  2EFP A;  3IKV A;  5E8G A;  2DA1 A;  2DOF A;  3HOW J;  2K86 A;  1FBU A;  5BPI A;  2BOL A;  3ABL H;  2JPC A;  2KPM A;  2O5R A;  4RGX A;  3AG2 H;  2PI0 A;  1D0Z A;  3GEZ A;  2XV4 S;  1SD7 A;  1T2K A;  2JPB A;  4XLC A;  1B72 B;  1F43 A;  3S16 J;  1XMK A;  2UV1 A;  4AIK A;  1HW2 A;  5D4R A;  1G3S A;  1G2H A;  4PUS A;  3S15 J;  2ZCW A;  2XAJ A;  4RBO A;  4DZP A;  4ZTF A;  1WRJ A;  4OOI A;  1YFH A;  4LB6 B;  1RUO A;  5J6X A;  2IP2 A;  4XOP A;  1MBF A;  3TW7 A;  5CQG A;  3HUG B;  2VB6 A;  1TWF J;  4XRS A;  2BHZ A;  2V9K A;  1SAN A;  4BKX A;  2QGU A;  2YUS A;  4AM3 A;  2LF8 A;  3FBN B;  1BR2 A;  3LQQ A;  1FYL A;  2HEO A;  3RI4 A;  2ID6 A;  2MH2 A;  4IHW A;  4QPQ A;  2ZME B;  2KIU A;  3DWL E;  3OYK A;  1T8I A;  4MTE A;  1MKM A;  1JGG A;  4TV7 A;  4HA8 A;  5B1A H;  3ECO A;  1ETX A;  4DZJ A;  2G0E A;  1KON A;  1XD7 A;  4EM0 B;  1N25 A;  4Y52 J;  5KHD A;  2H1L A;  4CUG A;  1Z21 A;  4EAT A;  1QA6 A;  2ZJQ F;  3BR6 A;  3BG5 A;  1IF1 A;  3H9G A;  2J5O A;  3B6A A;  1GLN A;  2VC1 A;  3FMQ A;  4LD5 A;  5CLS A;  4AYB N;  3X2Q H;  1S7E A;  5KK1 A;  3FHN A;  2JTV A;  2VKV A;  1WJE A;  3C2H A;  3IAS 2;  1LNW A;  2CMP A;  1TBX A;  4M72 A;  2HI3 A;  4KN4 X;  4UY8 I;  4LLN A;  2NNY A;  3VSK A;  1T38 A;  3MN2 A;  1LQ1 A;  3D5S C;  3HRT A;  5EEA A;  1RET A;  1BL0 A;  3ERE D;  1SD6 A;  3N4M A;  3HOT A;  5F64 A;  4BBR J;  2LBF A;  2VIX A;  1RNL A;  2EIN H;  2BXY A;  4BGD A;  5LHH A;  1ZRC A;  5J1Y A;  1AKH A;  2L9N A;  3JTG A;  2BE5 F;  1BN5 A;  1FWZ A;  3K69 A;  3SDB A;  4ZYG A;  1ZAO A;  1ZAR A;  1LDJ A;  2M9H A;  2EZI A;  4S0H B;  2MW8 A;  4JX5 A;  2LKX A;  2VOP A;  4GCV A;  1WI3 A;  3ULQ B;  2V1N A;  2HOT A;  5EZG A;  3OSF A;  3L2R A;  1OKR A;  3ZMV A;  1W1W E;  1MDM B;  2PMU A;  2FJ1 A;  4PGG A;  2EZL A;  3S32 A;  1BI2 A;  4XK4 A;  1K79 A;  2XAF A;  2MSY A;  4MIM A;  4AIH A;  2Z9O A;  2V6E A;  2RC4 A;  4UVB A;  2QZ8 A;  3ZQL A;  3EPZ A;  1JHH A;  2ZFW A;  3G71 I;  1R23 A;  1E3O C;  1RZ4 A;  3PUB A;  1JUS A;  3QWL A;  3OV8 A;  1WKM A;  2IPQ X;  2IA2 A;  1FTZ A;  4OIN F;  3BZK A;  1ZG5 A;  3H35 A;  3ISP A;  3JAM K;  3MZH A;  1EH8 A;  3H36 A;  1XPX A;  1J59 A;  2AXT C;  1BBY A;  2Y30 A;  3CD6 I;  1LPQ A;  2V1U A;  1V4R A;  2EZK A;  1GV5 A;  2HYF A;  3I4P A;  3GWZ A;  4A6E A;  1B1B A;  2DPD A;  2R7X A;  1R4M B;  2COB A;  2FBI A;  4NDL A;  4BUP A;  1XDS A;  1JT6 A;  4DJA A;  3K9T A;  2H1K A;  3F22 A;  3OWT A;  2ADU A;  3BZC A;  4HV5 A;  4EVI A;  3L2Q A;  1E2X A;  1HST A;  1RC9 A;  2IGN A;  2WV0 A;  4B4C A;  2X1E A;  2PJR A;  1YW7 A;  4KT6 A;  2DMP A;  3KX2 A;  4XL9 A;  4M6V A;  4AUX A;  3G1M A;  4UB8 C;  5FLX K;  2DT5 A;  3M8E A;  1R1V A;  1IRZ A;  1Z77 A;  2H09 A;  3CJQ B;  4F3Q A;  5IT9 K;  2BVM A;  4CCK A;  2V1D A;  5IP6 A;  4KMU X;  2A6E F;  4HX8 A;  3J7A O;  4XKB A;  4OIO F;  3I4N J;  3WOD F;  3FK6 A;  1W5S A;  2CQ7 A;  3HKZ A;  1OCP A;  3C3W A;  4PDK A;  2F4M B;  2FA5 A;  3CP2 A;  3IWF A;  2M4G A;  1SFU A;  3R0J A;  4C3H J;  3V8J A;  4G7O F;  1UB9 A;  2MAB A;  3CZ6 A;  2D45 A;  1Z6R A;  4BU2 A;  4D7M A;  4XN3 A;  1GXP A;  2H6B A;  1Y6I A;  3JRB A;  3EUK L;  3FKI J;  3O8G A;  5J47 A;  2KHM A;  3PQK A;  3OYC A;  2Y48 A;  2QQ9 A;  1FOK A;  5FKK A;  5F0H A;  5H2F C;  3AFH A;  3F6O A;  3HM5 A;  3TL4 X;  3L7W A;  5E18 F;  1DPU A;  4XQF A;  1OCT C;  2XIG A;  1SD4 A;  2RV8 A;  5AIP A;  1K7A A;  1BW6 A;  3HHG A;  2Y2Z A;  2EFO A;  5B5E C;  3NAR A;  2XSD C;  3MEX A;  2R7O A;  4LK1 F;  4BE0 A;  2KKO A;  1MMD A;  4AC0 A;  2ZXW H;  1F36 A;  3K4L A;  4N9I A;  2VOD A;  1DU0 A;  3O3K A;  1BW5 A;  2P8T A;  3LWF A;  3WG9 A;  4MTD A;  3OIO A;  4CYD A;  5EGO A;  2HKO A;  3SDG A;  5GAG J;  3GTL J;  5K5O A;  1RR8 C;  1B72 A;  4B1R A;  3LSH A;  1IUF A;  3O6B B;  4DBQ A;  3PL8 A;  1FMW A;  2MFZ A;  1EH6 A;  1VQM I;  3OL4 A;  4ZZD A;  4WCG A;  3RQ4 A;  4PSW A;  5LRR A;  3CMA I;  2JWT A;  4HG2 A;  1HDD C;  5GAH J;  2MBF A;  3G1O A;  5D5X B;  5BMZ A;  3CCV I;  3ZQG A;  5B3S H;  3ZQQ A;  1EA3 A;  4QSH A;  1WH5 A;  4EJT A;  4O3M A;  2W85 A;  2LY1 A;  3KP7 A;  2IGO A;  2NAZ A;  3I0T A;  3I9V 2;  4YIF A;  2E60 A;  1LDK B;  3IWZ A;  4PJ0 C;  5LGT A;  4KJZ A;  3HSF A;  1UZC A;  4RLQ A;  5E1W A;  3K4J A;  4M9Z A;  1R71 A;  2LKP A;  2BYV E;  2XPW A;  3WTS C;  2D2W A;  1UEL B;  4AIJ A;  1R00 A;  1I50 J;  2XDV A;  3L09 A;  3E6B A;  2V7F A;  3W6V A;  4C2U A;  1GV2 A;  4FIS A;  1U6G A;  2VXD A;  2WTE A;  4XRM A;  3KYD B;  1U8B A;  1TNS A;  3E1S A;  2W84 A;  4PFP A;  3OY9 A;  2OPT A;  4D9J A;  5LRS A;  5E1Z B;  5EEG A;  4L9V A;  3WG7 H;  2R7Q A;  1X3W B;  3MKZ A;  2E1O A;  2CQK A;  3BWG A;  5JR3 A;  2WAQ A;  2EQR A;  3LA2 A;  4XLF A;  4BXU A;  4CH7 A;  3CMY A;  2ELK A;  2X51 A;  2XAQ A;  1YTY A;  3K6G A;  2Y31 A;  3FDY A;  3JRC A;  3BTC A;  4I6Z A;  1QQI A;  1ZHF A;  2FF4 A;  2JT1 A;  2KMU A;  2Z5U A;  3JRH A;  1TWG J;  2VQH A;  5JHU A;  2IBD A;  4KIS A;  4BQQ A;  2E34 A;  2L01 A;  2ZSI B;  2R4G A;  4D1Q A;  1IGN A;  3K2Z A;  4AVZ A;  4HSR A;  1FYK A;  3LNQ A;  5IPA A;  4QWQ A;  2QVO A;  2LK2 A;  3ABU A;  1MIJ A;  2ME6 A;  1WGX A;  3BCB A;  3GTO J;  2NS0 A;  2YSR A;  2M2E A;  4UV8 A;  2HXI A;  4JOM A;  3HL2 A;  3CP8 A;  1TZL A;  3PQJ A;  2CGP A;  2LH9 A;  2P81 A;  1J09 A;  3V7C A;  1E0E A;  3QYE A;  2CYY A;  4I09 A;  3BG7 A;  5AIQ A;  4BEH B;  2UUZ A;  2EJR A;  1EH7 A;  1VQ4 I;  4Z6Y A;  4IHT A;  1TW2 A;  4XLA A;  3UKG A;  3BDD A;  4UVC A;  2AHQ A;  2R7U A;  2R5Z B;  1VQ8 I;  3F8B A;  2N8G A;  2L0K A;  3CCE I;  2JVG A;  1R1T A;  2PX9 A;  4P55 A;  2PMH A;  4YIR X;  2JA8 J;  3RSN A;  3J81 Z;  1QGP A;  2ZXH A;  3ZR8 X;  3DPU A;  1ETK A;  1MSE C;  3DU6 A;  4MQV A;  4U88 A;  1IRF A;  3IH4 A;  4A0X A;  4MEX F;  1D3Y A;  3ZXS A;  4YG2 F;  3M1C A;  5LLQ A;  3T8T A;  3KP2 A;  3D1N I;  4E7J A;  4KNY A;  1S6L A;  3TO7 A;  2VN2 A;  4A3G J;  3VYS B;  4ESJ A;  1X19 A;  2Q8K A;  4WX9 A;  1XCV A;  4UUS B;  1V5F A;  1LEA A;  2OQG A;  4E7H A;  1YW9 A;  4ENJ A;  1XS9 A;  1U78 A;  3SFZ A;  2LD5 A;  4UUT A;  5DYM A;  1IC8 A;  1F9N A;  1MBH A;  4Q48 A;  2XGX A;  3F8N A;  1B59 A;  1ZGA A;  4LG3 A;  2KRC A;  2I8D A;  3KZY A;  4A3L J;  1IXR C;  2NVX J;  5LHI A;  4A6D A;  2MGQ A;  1BOA A;  1Y56 A;  1B9M A;  1XX5 A;  2YPR A;  3ZMS A;  3R4K A;  2NXN B;  2DFH A;  4HX7 A;  2L7F P;  5L3C A;  3TKY A;  3FXR A;  1KQ0 A;  4CDG A;  2BY1 A;  4KA4 A;  4NQW B;  4A3E J;  3HKZ N;  3DPL C;  3DBH B;  3ZN0 A;  2I5U A;  1YLF A;  1IN4 A;  3CCJ I;  5M3M J;  1Z9C A;  1ON2 A;  2DJI A;  2W25 A;  4ZYE A;  2QSF X;  2PMZ A;  1I6X A;  4R1H A;  1ETQ A;  1AHD P;  2Y0S A;  3U21 A;  3TBI A;  4IVN A;  2VI6 A;  3DKY A;  4D5F A;  1FPQ A;  2MH9 A;  1WJC A;  1FOX A;  4UV9 A;  2E2I J;  3S1M J;  1ACI A;  1I39 A;  4AYB A;  3KEQ A;  3ABT A;  2HOE A;  4A12 A;  3VEP A;  2OJE D;  3A02 A;  2IVM A;  3V8L A;  2W4S A;  5HNH A;  4F92 B;  2ZC2 A;  3QPL A;  3EQL F;  4ZDL A;  4B3X A;  1IZ1 A;  2IA1 A;  2KIS A;  3Q3S A;  2GBY A;  3NWS A;  4ESF A;  2PJP A;  1OCC H;  1ZR2 A;  1X1P A;  5J40 A;  5FLM J;  3OS0 A;  4WXH A;  3ZQH A;  3K0L A;  4FT8 A;  4ASN A;  5E1X A;  3CO6 C;  3E97 A;  1VQ5 I;  4D5C A;  2CW0 F;  2L9V A;  2Z2S B;  2DA2 A;  2H8W A;  2E5N A;  2OCE A;  3CCU I;  3GTP J;  1B6A A;  3WU2 C;  2DI3 A;  1X1D A;  1JT0 A;  1AWC A;  2XRN A;  3E0J B;  5GP9 A;  5ED4 A;  2L2O A;  3KZI C;  5FRM A;  3S2H J;  1FSH A;  2YX4 A;  4BDY A;  3LSM A;  4E7K A;  2ZJP F;  2ISY A;  4M6Y A;  2E1M C;  4XR6 A;  3G1L A;  1GVD A;  2LP0 A;  1RES A;  2VKE A;  3DEW A;  1IXS B;  3N05 A;  4CO8 A;  1QHH D;  1ZGW A;  2QQ8 A;  3BRO A;  2X6W A;  3MD2 A;  2EWN A;  1YHQ I;  5CQE A;  2ACJ A;  3DV8 A;  4M71 A;  4XN0 A;  4I99 C;  3IUO A;  1WHU A;  1Y0U A;  1VQK I;  3DQV C;  2O7O A;  4IQ4 A;  1ZRF A;  1GVJ A;  1U9N A;  3ZGK A;  4IL6 C;  5E20 A;  3KLO A;  1FBS A;  1IN7 A;  3GLX A;  4RDU A;  1JUM A;  4CGZ A;  1JUP A;  1YJ9 I;  2GZW A;  1BA5 A;  4FX0 A;  4HF0 A;  3CC4 I;  3EUH C;  3WTX C;  1LFU P;  2XSJ C;  5H20 A;  2FXA A;  4BE2 A;  1K78 B;  2GIZ A;  2DT7 B;  4DQ2 A;  4BXX J;  1FNN A;  1WH7 A;  1DP7 P;  1BR4 A;  4MO7 A;  5HDK A;  1P92 A;  2XAH A;  3S1Q J;  1CQT A;  3PUF A;  1KQ9 A;  3KYL A;  2JA5 J;  4IHS A;  2JRT A;  4PJL A;  2ECC A;  2EFW A;  3OOU A;  2GQQ A;  2WAQ N;  1YOV B;  2M4K A;  1YQA A;  3U1K A;  4LLG F;  4XLH A;  1EKE A;  3BCA A;  4MNU A;  2BVL A;  4IOA F;  1MBJ A;  4RAZ A;  4X1E A;  2RRE A;  5F0C A;  2DQL A;  1VQ7 I;  9ANT A;  4ENM A;  3BZ6 A;  1XGM A;  3FF5 A;  4Y33 A;  1CGP A;  3SJM A;  3BTI A;  1MJ9 A;  2R7W A;  3QPT A;  2ME0 A;  2GXA A;  1SC7 A;  1W4M A;  2FQ3 A;  1IRG A;  5AON A;  1L3L A;  3C2G A;  5DCM B;  3IKT A;  3T1B A;  5M5W J;  4KMF A;  3S3M A;  1NG7 A;  2TDX A;  4CZZ A;  2NS7 A;  1YI2 I;  3D5L A;  2IGM A;  4HDU A;  3CUQ B;  2DMQ A;  3TDU C;  5D8K B;  5DTD A;  1GHC A;  4LIV A;  1WI9 A;  4UNO A;  1UG0 A;  3JRE A;  1XGS A;  3PIO F;  1JJ8 C;  3JR9 A;  3W6K B;  3GF2 A;  1VI0 A;  2XF6 A;  1R5G A;  2DJN A;  4XSZ F;  5DUI A;  1R9T J;  1YW8 A;  3LQR A;  4R79 A;  1LFP A;  3CF5 F;  4RMN A;  5D6F A;  3M8J A;  1ZEL A;  3ROU A;  3QOP A;  5FKL A;  4HQE A;  2HDW A;  2AO9 A;  4I76 A;  3PFI A;  5IOZ A;  2JSC A;  4YFK F;  3F9K A;  3HHH A;  2X85 A;  3F3X A;  4LMY A;  2OZU A;  3R61 A;  1UHS A;  2COM A;  1DU6 A;  2VKD A;  2A3S A;  1KGS A;  5L3F A;  3BP8 A;  2EZH A;  1XSX A;  3PSF A;  1OLT A;  4C30 A;  2BW3 B;  3MWM A;  1WFX A;  3CCY A;  4M3D A;  2F6C A;  2ECB A;  1K4T A;  2DOD A;  4C3I J;  1DP3 A;  2MA3 A;  3F8M A;  1FSE A;  3CO7 C;  3AL0 B;  2K9M A;  3HRM A;  5F04 A;  3F21 A;  4E4H A;  2QQA A;  4C2T A;  1Z91 A;  1R5H A;  2LY9 A;  3Q9V A;  2D5V A;  3DEE A;  2RQQ A;  2YS9 A;  4UUS A;  4S04 A;  2AQF A;  2HNH A;  4RGU A;  1QBJ A;  1SFK A;  2A61 A;  2UXX A;  2FBH A;  3S3N A;  2M8E A;  4BY1 J;  1B8I B;  4RB3 C;  2W1O A;  1IN6 A;  4V19 K;  5F6F A;  3WU0 A;  1DQU A;  1XGN A;  2E5Z A;  2QKM B;  4ZH4 F;  5J8F A;  4ENK A;  3Q9S A;  1OR7 C;  5K5Q A;  2P6T A;  3ECH A;  2Y75 A;  1SVM A;  3VPR A;  1PDN C;  1G3Y A;  2PMZ N;  3VYU B;  4LFU A;  1P7I A;  1OYY A;  1PVE A;  2Y0S N;  1R7J A;  1HBX G;  1SAU A;  3TP0 A;  3V8K A;  2VQL A;  1I6H J;  3J80 Z;  2ESN A;  2EB7 A;  2KDZ A;  3L9F A;  3FXM A;  2Y9Y A;  5C3E J;  1A6Q A;  5ERI A;  4U7B A;  2K9N A;  5TRD A;  4A3J J;  3BR0 A;  3JSP A;  3FM5 A;  1Z05 A;  2G7H A;  5CVI A;  2H27 A;  1FY7 A;  1O7L A;  5LBQ A;  1K4S A;  4OMZ A;  1DPR A;  2CSO A;  3EUH A;  2QSG X;  5CVJ A;  1I3Q J;  2PQ8 A;  2ZO4 A;  5EJC A;  3OYD A;  2HPI A;  3LSJ A;  2HS5 A;  4CYC B;  2E19 A;  4A3M J;  3B6C A;  2GXG A;  4P9F A;  4Z2Y A;  1EJ9 A;  3CCR I;  2DK8 A;  5JVT A;  2LF7 A;  4AID A;  3LAJ A;  4WF2 A;  3BR5 A;  2IT0 A;  4OIR F;  4IRI A;  3G2B A;  3O8H A;  3OIQ A;  2L5Q A;  3KEY A;  1WQ2 A;  5HLI A;  4RAY A;  5HS7 A;  5J8C A;  4HF1 A;  3FK7 A;  3LFK A;  1LDD A;  2Q0O A;  5DDG A;  4XLN F;  4E7Z A;  2PEX A;  1K61 A;  1MSF C;  3C1D A;  3C7J A;  4S05 A;  1TQI A;  2DA5 A;  4LG0 A;  2NVU B;  2E7W A;  3QP5 A;  2VLA A;  2A6H F;  3K4K A;  3FXK A;  2BY3 A;  3A2K A;  3DP7 A;  3CCS I;  2QA4 I;  4XKW A;  4RLF A;  4LOC A;  2EV6 A;  1ETO A;  2QBY B;  2R7Z J;  3F72 A;  3ZPL A;  4II3 A;  4HNU A;  4ENN A;  4WK8 F;  1R4N B;  1MNE A;  2XAG A;  5EZH A;  3O2P E;  4KUM A;  1PUF B;  3S2W A;  1AU7 A;  2DOA A;  2X1D A;  2CUF A;  2M0C A;  1FIA A;  3GTM J;  2LDU A;  3OSG A;  2XRL A;  4CXF A;  4N9H A;  4PZJ A;  4J19 A;  5DD8 A;  2ZME C;  1PP7 U;  4M3G A;  2KIF A;  4RM2 A;  2EPF A;  3LA7 A;  1BOB A;  5M5Y J;  2K02 A;  2QQB A;  2Q2E A;  5CVR A;  5KAF C;  3HDD A;  2JSP A;  1HC8 A;  4BHB A;  1EV7 A;  3JSO A;  2M87 A;  3ELK A;  4KT5 C;  3LSR A;  2JN6 A;  1O3S A;  4EJV A;  2L9S A;  2V79 A;  1H8A C;  1FIP A;  5ICC A;  2QEN A;  5GAD J;  3HXL A;  2W7N A;  2KT0 A;  2IGK A;  3SFI A;  2MYS A;  3FX3 A;  3H5A A;  1S7A A;  3I64 A;  3LST A;  5DS9 A;  3WGG A;  1YE9 A;  2EV5 A;  3GLL A;  4G7Z F;  1R22 A;  4Y3O A;  1YX3 A; 
#chains in the Genus database with same CATH homology
 2LG4 A;  2X51 A;  2RNG A;  3FDY A;  3K6G A;  5HNF A;  3DTK A;  2HQA A;  3UNG C;  4HRI A;  2KMU A;  2NOJ B;  2VQH A;  1AA7 A;  3QYF A;  2OV7 A;  2LRD A;  3HPG A;  2R7T A;  4KIS A;  4BQQ A;  2VQC A;  3HG9 A;  3DKX A;  2IS2 A;  4XKV A;  2VJI A;  2R4G A;  2ZSI B;  4D1Q A;  2CUJ A;  2QKL B;  4H4K C;  4AVZ A;  4HSR A;  3OYA A;  2ZFU A;  3ZCO A;  2OUM A;  3EUA A;  2DCE A;  2VJ5 A;  2WB1 A;  3BG6 A;  3BCB A;  1D1C A;  5KCM A;  2CS3 A;  4JOM A;  3HL2 A;  3CP8 A;  1TZL A;  2LH9 A;  3S3O A;  1J09 A;  4F93 B;  2Q2E B;  2X1C A;  3QYE A;  4LIU A;  1E0E A;  3BG7 A;  1TT0 A;  3PNY A;  4NC7 A;  2KQR A;  4BEH B;  4CCO A;  2UUZ A;  3A4C A;  3A1Y A;  3DTI A;  3LSG A;  4NC8 A;  2CH0 A;  4B48 A;  2CW7 A;  2IS1 A;  4XLA A;  1JI8 A;  2VJ4 A;  2R7U A;  3UR3 C;  2JVG A;  3SEQ A;  3NWT A;  3RSN A;  3K4M A;  2XC7 A;  5KNL A;  3H9J A;  2ZXH A;  3H5N A;  3ZR8 X;  3DPU A;  3OYE A;  2M7B A;  3DU6 A;  4ZTJ A;  4YRV A;  3QOD A;  2IS4 A;  3ZXS A;  3OS2 A;  3VWB A;  4IX7 A;  3M1C A;  4BL0 B;  4E7J A;  3DU5 A;  2ZSH B;  3VYS B;  4X0G A;  1X19 A;  2DXI A;  4E7H A;  1V5F A;  4U87 A;  3PNV A;  2Z1D A;  2A6T A;  4CCL A;  1UAA A;  2R7S A;  1MMG A;  2WA0 A;  4LG3 A;  4OAZ A;  2F5V A;  2KRC A;  2I8D A;  3SEZ A;  4IKF A;  1N78 A;  4XKC A;  1HA8 A;  2KRH A;  2XF7 A;  2XF5 A;  3AL0 C;  1Y56 A;  4MLO A;  3OYG A;  2DT6 A;  4ZDO A;  2FUG 2;  1Z7L A;  4DOZ A;  1Z3X A;  1V5G A;  3ZRG A;  2KDO A;  1WJB A;  1X4O A;  4J01 A;  4NQW B;  4BE1 A;  2HVS A;  2VAS A;  1BR1 A;  2VL8 A;  4YEL A;  3DPL C;  2HVQ A;  2CV1 A;  4BS9 A;  2R7R A;  1MND A;  2VXZ A;  2K9L A;  5HOO A;  3I3L A;  4PSX A;  3TMO A;  3W2V A;  2DJI A;  4XM3 A;  3OYM A;  2PMZ A;  4NUB A;  2Y0S A;  4FAS D;  3U21 A;  4CCM A;  5LD2 C;  3TBI A;  1D1A A;  3DKY A;  1WJ5 A;  1PYV A;  4DBR A;  1X1B A;  2HU9 A;  4ANJ A;  2M7A A;  3DPT A;  3VDX A;  3OYJ A;  3GBG A;  1WJC A;  3K10 A;  1D0Y A;  4PJM A;  2K5C A;  4AYB A;  1N75 A;  4HEA 2;  2X6X A;  2VQG A;  4II2 A;  4FET A;  1QU3 A;  3OYB A;  3LL7 A;  2W4S A;  5HNH A;  4F92 B;  2WAF A;  4ZDL A;  4B3X A;  2BOL A;  3NWS A;  2W00 A;  1X1A A;  2KPM A;  2O5R A;  1P9Q C;  3OS0 A;  1D0Z A;  1WJF A;  3L2U A;  4YEJ A;  4XLC A;  2UV1 A;  4PUS A;  2Z2S B;  2E5N A;  2LRE A;  3LFU A;  1X1D A;  4ZTF A;  4F52 A;  1VZ0 A;  3E0J B;  5FRM A;  3MMY B;  2L2O A;  4BDY A;  4XOP A;  3LSM A;  4B44 A;  4E7K A;  3RPU D;  2E1M C;  5CQG A;  2KLO A;  4XR6 A;  3HUG B;  2VB6 A;  3SYT A;  3PNT A;  3D5R C;  2V9K A;  3MKW B;  1YX5 A;  4C9Y A;  2F4I A;  3FBN B;  3N05 A;  1BR2 A;  4PFO A;  4BJT A;  3CJR B;  1QHH D;  4AU7 A;  3PSI A;  2X6W A;  3MD2 A;  3AKZ A;  2X6Y A;  3LSI A;  4QPQ A;  5CQE A;  4XN0 A;  3OYK A;  3DWL E;  3IUO A;  2WAE A;  3DQV C;  4IQ4 A;  5FRN A;  3ZGK A;  3CF2 A;  1KON A;  1LVK A;  5KHD A;  4CUG A;  1Z21 A;  4EAT A;  3IP4 B;  4ZC3 A;  3H9G A;  1GLN A;  3EUH C;  2XSJ C;  3LSK A;  4BE2 A;  2DT7 B;  3W2W A;  2HZD A;  3FHN A;  1BR4 A;  1WJE A;  3C2H A;  3IAS 2;  3OR1 C;  4F91 B;  2CMP A;  3S93 A;  3OYH A;  4IZZ A;  3KYL A;  2JUG A;  3PFY A;  4BJ6 C;  4XNF A;  3HPH A;  4PJL A;  3J7A Y;  3VSK A;  4PJJ A;  4ZJZ A;  3D5S C;  3OOU A;  4LIT A;  3BC8 A;  3HOT A;  2AQE A;  2M4K A;  4BDZ A;  4XLH A;  4J00 A;  3BCA A;  4BXF A;  2BVL A;  4XOT A;  1QHG A;  1U0J A;  2LBF A;  2BW3 A;  2M0M A;  1K6Y A;  2RRE A;  2VIX A;  4BGD A;  4Y33 A;  4N4O B;  1D1B A;  2R7W A;  4PK4 A;  2L9N A;  2WY8 Q;  1DGW Y;  4BJ5 C;  3SDB A;  4GRI A;  1T0F C;  3HC7 A;  3K4C A;  2HPM A;  3C2G A;  4DGW B;  2ELJ A;  3H5R A;  3LMM A;  3S3M A;  2HVR A;  1NG7 A;  2KL4 A;  2V1N A;  3D5L A;  2IGM A;  2V26 A;  3L2R A;  1R6R A;  1MMN A;  3S32 A;  4LIV A;  1UG0 A;  4QPO A;  2LOO A;  3IAM 2;  2V6E A;  1LKX A;  2XF6 A;  3L2V A;  4BQO A;  3EPZ A;  4ITV A;  4HST A;  4Y4R A;  2CV2 A;  3PUB A;  1LFP A;  4R79 A;  4RMN A;  2LY2 A;  3M8J A;  1ZEL A;  1W36 D;  3H35 A;  3H9Q A;  4F55 A;  4E7L A;  5JHF A;  2HDW A;  4CCN A;  3F9K A;  4BQN A;  3DLA A;  2XAU A;  2X85 A;  2MD0 A;  4PJN A;  3QYB A;  1PJR A;  2R7X A;  2VKD A;  4OAY A;  3PSF A;  1OLT A;  3CES A;  2BW3 B;  3QOE A;  2JA2 A;  4C30 A;  1NG6 A;  4BUP A;  4BAC A;  4N4N B;  3W3C A;  3SZG A;  4CZC A;  4DJA A;  1WFX A;  3OYF A;  1N77 A;  2F6C A;  3OWT A;  4HPQ A;  3V42 A;  1DP3 A;  3L2Q A;  3S8P A;  2IGN A;  2PJR A;  3AL0 B;  2X1E A;  2K9M A;  1DGR M;  4XL9 A;  4KT6 A;  3KX2 A;  2KZV A;  4P1W A;  4E4H A;  4C2T A;  2RQQ A;  3DEE A;  4XOR A;  3OR2 C;  3CJQ B;  2AQF A;  2HNH A;  3CMM A;  2BVM A;  4CCK A;  4F3Q A;  2Q1Z B;  1SFK A;  3BLY A;  4XLF A;  2LC2 A;  3S3N A;  1V5E A;  2W1O A;  4XON A;  4XKB A;  1DQU A;  1Z3Y A;  2E5Z A;  2QKM B;  4NNJ A;  1OR7 C;  4IQJ A;  3HKZ A;  3K4N A;  4B47 A;  4JQF A;  3CP2 A;  3VYR B;  2M4G A;  3VYU B;  2IS6 A;  1SAU A;  2MAB A;  3CZ6 A;  2VQL A;  4BU2 A;  4XN3 A;  1Y6I A;  1FMV A;  4CSW A;  3EUK L;  2VKH A;  4E7S A;  2KHM A;  4U7B A;  3OYC A;  5CPR B;  1W36 C;  2CV0 A;  4CCJ A;  2GOX B;  3AFH A;  3ONQ A;  2CUZ A;  4E7I A;  3TL4 X;  2KP6 A;  3RCO A;  2VJJ A;  3OYD A;  2V4J C;  2HPI A;  5HLT A;  2CW8 A;  4XQF A;  5TGT A;  3OYI A;  1WJA A;  2L7K A;  4RM3 A;  2K3P A;  3FBI B;  2VPL A;  4G6T B;  2R7O A;  2PJR B;  3G2B A;  3OIQ A;  4BE0 A;  2UWM A;  2L5Q A;  1MMD A;  2WAD A;  3KEY A;  3K70 D;  3K4L A;  4E7Z A;  2CFO A;  1G59 A;  3OS1 A;  3OL3 A;  2VLA A;  3K4K A;  5CKT A;  1X4P A;  3A2K A;  2E1M B;  3DTE A;  3OYN A;  4XKW A;  3LSH A;  4RLF A;  4KIT B;  4DBQ A;  3PL8 A;  1FMW A;  3OYL A;  2MFZ A;  2A5W A;  2OC6 A;  4II3 A;  3OL4 A;  3OMY A;  4CA0 A;  4HNU A;  1MNE A;  1D0X A;  3RQ4 A;  4PSW A;  1MMA A;  4HG2 A;  4DIQ A;  3MKY B;  2DOA A;  2X1D A;  5HVQ C;  3ZQQ A;  1EA3 A;  2WBM A;  2LY1 A;  4ZDP A;  4XLE A;  2IGO A;  3VSL A;  3I9V 2;  3L2W A;  2E60 A;  1LDK B;  2P0W A;  3OIP A;  2JVH A;  4KJZ A;  4RLQ A;  1S9H A;  4RM2 A;  3K4J A;  4XMY A;  2GOM A;  1BOB A;  1UEL B;  3PJR A;  2ZXI A;  4BEH A;  4OWR B;  2R7V A;  2JSP A;  2XDV A;  1MW7 A;  3VYT B;  4HNT A;  1ERD A;  3H0D A;  2MC4 A;  2V7F A;  4C2U A;  1X1C A;  2L9S A;  2VXD A;  3RTR A;  2LBF B;  2W82 A;  2Z16 A;  3W2A A;  1WJD A;  4E6K G;  1T95 A;  3E1S A;  4PFP A;  3HOS A;  5FRO A;  2LYC A;  3HXL A;  3OY9 A;  2W7N A;  1G8X A;  4D9J A;  5LFA A;  2IGK A;  3K70 C;  2MYS A;  3K4B A;  3H5A A;  4B43 A;  2R7Q A;  4P5O A;  2IXS A;  3FKJ A;  1IRX A;  1YE9 A;  2M3A A;  2WY7 Q;  3MKZ A;  2WAQ A;  4CH7 A;  4Y3O A;  1YX3 A;  4ZYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...