4UHTA

Crystal structure of the dna binding domain of cpxr from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
b'SPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDHAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Conformational plasticity of the response regulator CpxR, a key player in Gammaproteobacteria virulence and drug-resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 28
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4uhtA00
4LG0A 3BP8A 4ZYGA 1T2KA 3M7GA 2HDCA 5BOXA 4IJAA 2A6HF 3I59B 3TOBA 5CJ9A 3IRQA 3JTGA 3DEUA 1BOAA 2Z9OA 3WTZA 2QQ9A 1E17A 3WE3A 4P9UA 3WTVC 3QRFF 2DTRA 2M30A 5E1XA 4FT8A 2KKOA 2DK5A 1JGSA 1IN4A 1IN5A 4M6YA 4RGRA 3EYIA 4IHSA 3MZYA 1FX7A 3KZYA 3WTXC 1RIOH 1V4RA 2YU3A 1YO5C 1XN7A 3E6CC 1B59A 1C0WA 5D5UB 5KVRA 2NS0A 2NRAC 1Q1HA 1HSJA 3M1EA 4I0AA 1EH7A 3GFLA 4D0PA 3ZMSA 5AIPA 4BH9A 3ZMTA 2YSRA 5K5QA 4UVAA 1S7OA 2QUFA 2VT2A 1MJ9A 2ESNA 5BMZA 3IHUA 1TW2A 1XGMA 4G6QA 2PFBA 3LA2A 3MWMA 4Y15A 1S6LA 3QU6A 5JI6A 4JBAA 2P6TA 3WGGA 2XKOA 5LGTA 4FX0A 2F2EA 1YW9A 2GXGA 5CVUA 1ZARA 2BE5F 2FA5A 1XDUA 1SFXA 2DK8A 4HV5A 1ZYRF 5FLXZ 3HIFA 2P5LC 2FOKA 2H6BA 2V1XA 2RN7A 2EFPA 1I5ZA 4S04A 1RI7A 4HA8A 1GVJA 4KA4A 2PEXA 4UV9A 4L9NA 2O3FA 3KZZA 4LLNA 2RNJA 3HYIA 2FQ3A 5HS9A 2MA3A 1ON1A 2RVCA 2EJRA 4HDUA 2O8XA 2BV6A 3LFKA 1I27A 5FD5A 1B9MA 5LHIA 4L5IA 2PI0A 4IRHA 3P9CA 4CXFA 3E6MA 1SMTA 3I58A 5LEKA 1HW2A 1LDKB 1J7KA 4U0WA 4P96A 2NNYA 4HF0A 4KYWA 1TQMA 2UXNA 3EUHA 4OIQF 4A12A 5D6FA 2IJLA 3HRTA 1DPRA 2W84A 2HEOA 4Y17A 4I02A 1YQAA 2EFQA 4N9IA 3SQNA 1Z91A 4EJWA 1IZ1A 1TNTA 2V79A 3R0JA 1STZA 4ESBA 2EV6A 4RB3C 4GYGA 1B9NA 3K1PA 2P7VB 1KYZA 2BEOA 4NQWA 4EJOA 5KK1A 1BI3A 3LAJA 3EETA 2CSOA 4O3MA 1IAWA 1ZHFA 3SHFA 4HX7A 1H9TA 3QPHA 3ZPLA 4IRIA 1X3UA 1FT9A 3ZN0A 4A5MA 3O6BB 4JK1X 1ON2A 4BHCA 5ILVA 2COMA 5D4SA 4M74A 3U2RA 3RYPA 1XGSA 2Z99A 3C1DA 4UVBA 1K78B 3L9FA 1I1GA 1DUXC 4U7BA 4G7ZF 3FHZA 3WU0A 1HSTA 1MJAA 5HLGA 2PBIA 4BAYA 2GAUA 5HOOA 4HV6A 1USSA 4KIBA 4OMYA 1MDMB 2A5YB 4I01A 4HZFA 1IN7A 4A2UA 2D1VA 4EMSA 1KU7A 1KQ0A 1J59A 4RGUA 3LQRA 2HFHA 1IRFA 2ZMEB 3HUGA 4CZZA 3CUQC 1XMAA 1O3SA 1IXCA 1W5SA 3BY6A 3HHHA 4ON0A 2PJPA 3J81K 2Z5UA 1XSXA 4EM0B 4I2OA 3QAHA 1U78A 1O3RA 3SZTA 3BDDA 2F5DA 2DBBA 3KE2A 2QYOA 5ICFA 1FLIA 3O2PE 1IXSB 2Z3YA 3TKYA 3MFKA 3IWZA 4ENJA 4PGGA 2O0YA 3R4KA 4KMUX 1GHCA 1ZGAA 1WRJA 1XDSA 3F8BA 5D5WB 2MLGA 3GZ5A 1K78A 5J6XA 4MHGA 2CYYA 2QENA 2ISYA 1BM9A 1ZGJA 1TLHB 4OIRF 2PMUA 1ZG3A 1AWCA 3R61A 2MLKA 4EGZA 5AONA 4WCGA 3QP6A 2FBKA 2EFWA 3F6OA 3TDUC 3JAMK 1D3YA 2IA0A 3KP2A 1QNTA 3I4PA 4YFKF 3AAFA 3GFIA 2AS5F 2ZKZA 5ILUA 2CW0F 4P5OA 3COAC 3TO6A 3H92A 1UFMA 2XHKA 1SD6A 3PQJA 4L18B 4HLXA 4PCQA 2JSCA 1XGOA 2A3SA 4IF4A 4CICA 4KMFA 3CO6C 2ZMEA 2M8EA 3MAJA 1FBSA 2HS5A 3IL2A 1SD4A 3T8RA 2K27A 3D0SA 1XCVA 3N4MA 1BI0A 3K0LA 1R1VA 4YFNF 2YX7A 5DCFA 3BROA 2TDXA 3ELKA 5LBQA 4Q5SF 3RJPA 3SXYA 4LLGF 4HQEA 2EWNA 2P8TA 2R7FA 2K4BA 2F5FA 1R58A 3I53A 3LWFA 1E2XA 2EFOA 5L3EA 2WC2A 2VBXA 2KRFA 3GLXA 2UXXA 3FXUA 5E8IA 5CYVA 1QZZA 1O7LA 4E70A 2K86A 2KIFA 3F8CA 1BBYA 2QZ8A 3GFMA 1PDNC 3HRSA 1ODDA 1FBQA 3E5QA 4CYDA 2D2WA 1O3QA 4R79A 3K9TA 3V7CA 3B73A 5BS6A 4L0ZB 4EM1A 4HX8A 3FZVA 5LHGA 2QWWA 5HLIA 1XD7A 1U3EM 1W5TA 4A6EA 1BC8C 3IWFA 3N97A 2DO7A 3BOQA 1TW3A 4LGWA 1ZG5A 1CF7A 3SFZA 1FYKA 4PZJA 1ZLJA 1R36A 3FMSA 3PQKA 5HVQC 2EV0A 1KA8A 2LSOA 3E97A 1UCRA 2XV4S 4M6XA 3DPTA 2CO5A 5LGNA 3DV8A 4ZZLA 3ECOA 2A61A 4H0EA 1G4DA 1B6AA 1FYMA 2IRFG 1R5HA 2RDPA 4HOBA 1PP8F 2ZXJA 2GWRA 2VBWA 4S05A 3C18A 4KN4X 4UXNA 2Q8KA 2VOOA 4GO1A 3FXQA 1USTA 2FMLA 2O61A 1KU9A 4KIFA 1TQIA 2OBPA 4BQAA 4LK1F 1JHFA 2KIUA 4HW0A 3C7JA 1YW8A 4U88A 1YS7A 4LB6B 1KYWA 3BJAA 2F5CA 2XKPA 2IPQX 3S2WA 1QGPA 5H20A 1QQIA 2WV0A 3HTSB 3WODF 2ELHA 5DYMA 2BGCA 4EQQA 5LEJA 4XLNF 3GUDA 2XAHA 3R6SA 1REPC 4RB0A 1SD7A 2W25A 1YG2A 4WWCA 2VE9A 4R1HA 4IXAA 1BI1A 1HQCA 1MZBA 4ENNA 4OMZA 5DDGA 1Y0UA 3VFZA 2KIMA 3GYHX 3I64A 2R7DA 2L02A 4EJUA 3FXRA 5EEGA 4UVCA 2RC4A 3GXOA 4UV8A 2D45A 3Q9SA 4XBFA 3JSOA 3E6DA 1XSVA 4IHTA 4AIKA 4DQ2A 4YIFA 3WE2A 4B8XA 2VBZA 5LRRA 2H6CA 4AVPA 5D8KB 5FGMA 2XUBA 4ENKA 3F21A 2W57A 1SAXA 2FNAA 2QBYA 2HKXA 3REOA 3F8FA 2OD5A 4U7DA 4CDGA 2DT5A 1BJAA 4EJTA 4MTEA 3IKTA 3EYYA 1U5TC 1MD0A 5ICEA 2Q0OA 4UUVA 2XASA 3KFWX 2E1NA 3TDZC 3J81Z 3FM3A 1RNLA 2ZNYA 1P4XA 3EQLF 2ZO4A 2V1UA 2P4WA 1U8RA 1J5YA 3HSRA 1KGSA 2R3SA 3GFJA 4M72A 3NQOA 1FSEA 4LFUA 1LJ9A 3VB2A 2CG4A 1OYYA 5K5RA 2A69F 4OINF 4MTDA 3T1BA 5CLSA 3TOAA 2DAOA 2RGVA 2X4HA 2MD5A 1T38A 2M45A 4M9XA 4RAZA 1ZH5A 3I54A 2VODA 2BBYA 2XVCA 4BHBA 4PGHA 5F64A 3IC7A 2XAGA 2C6YA 4RAYA 1UB9A 5EEHA 3ZP5A 1FOKA 3JAMZ 3WTUC 4YFXF 4RS8A 2YPRA 3WGIA 2DFIA 1XGNA 3GF2A 3HRMA 4AD9A 3RPQA 2K7LA 4KUMA 3WG9A 4G9YA 1ZRCA 3J80K 3F3XA 4ZZDA 2JPBA 1IW7F 1G3YA 4WXHA 3W6KB 4ASNA 2O03A 4MGRA 3ISPA 2UWMA 4A0YA 1WKMA 4EGYA 2M87A 1ZRFA 2AXLA 3MQ0A 1YLFA 2HYFA 2VN2A 2L54A 3ZMUA 2ACJA 1OKRA 3L09A 2FNPA 2FMYA 5IT3A 1R23A 1U5TA 2CQKA 1XMKA 3KLOA 1G3TA 5E1WA 4WXDA 4NB5A 2LKPA 3U9GA 2O6GE 1BIBA 4XSXF 2DPUA 4FX4A 1IN8A 2L01A 5F6FA 3GO5A 3RKYA 1FNNA 4JQFA 5HS8A 1P2FA 2XIGA 1D5VA 3U1DA 1K7AA 1B1BA 1I1SA 1SFUA 1LVAA 2ZJ2A 3Q9VA 1FC3A 2KJCA 1KQ9A 2HR3A 5L3CA 3G73A 2FXAA 1S29A 1KU3A 2VC0A 4F7ZA 4RGSA 3EDPA 5DCMA 3LAPA 4KICA 2OQGA 3KP4A 2HZTA 2UZKA 1MJBA 3M9AA 3RYRA 1R7JA 5K5OA 1HW5A 3DFGA 4GXOA 3F8NA 1J75A 3WTWC 2DQLA 3CUQB 2A6EF 1L3LA 4XRFA 4CHUA 3GX4X 2FU4A 2H27A 1LEAA 4O6JA 3HOTA 1T39A 2ISZA 4NHJA 3ML6A 2OAZA 2V1DA 2VONA 2EB7A 4PDKA 1L0OC 3R0AA 3F23A 1W7PA 2HQNA 5FFZA 2ETHA 2M5WA 3DP7A 5BPIA 5LHHA 5J8FA 4N0BA 4YIIA 3C3WA 1CF7B 4G8XA 5JFRA 3WU1B 1O7FA 4A0ZA 1SMYF 3RTRA 3QP5A 1FP2A 1LDJA 4XSZF 3T5XA 2DW4A 2FBHA 4Q48A 3F72A 4MQ9F 3TGNA 1H0MA 5F1RA 1FWZA 1TNSA 1MGTA 1QBJA 2E7XA 2MBFA 1ONVA 2NAZA 2DI3A 2V6CA 1JE8A 3CJNA 1FYLA 2XGXA 3P9IA 3DXJF 5DUIA 1F4KA 2K02A 1S3JA 1UHMA 4I98B 3IKVA 4OIOF 1G3SA 3KEQA 3CUQA 2PN6A 4LLLA 5HDNA 2XAFA 4M73A 3G3ZA 2MC3A 2J5PA 2IT0A 1YIOA 4AIHA 3NEUA 4I0BA 2G7UA 5JHUA 4WK8F 1D8JA 2VE8A 3GW2A 1TBXA 4L0YB 3VODA 2ZNZA 5A2QK 2FEZA 2KJBA 1R1UA 1LEBA 1YFHA 3KEOA 3V8KA 1FSHA 1SFEA 4QWQA 1WQ2A 5D6EA 3WTYC 4A5NA 3KP7A 2LF8A 5J8CA 4RGXA 2JRTA 2CWEA 2HWVA 3T0YA 1BN5A 4LK0F 1F9NA 4M9ZA 2XAQA 5AIQA 4LMYA 4LJZF 5LGUA 4IPAA 2JPCA 5FO5A 3K1NA 5ILSA 1XSDA 2XAJA 3IRRA 3RI4A 2XRNA 3O3KA 5HDKA 2QBYB 3BPVA 3RDIA 4GYIA 3K2ZA 2HKOA 4YG2F 2F5EA 2Q2EA 3FM5A 3GWZA 1P6RA 3RIRA 3E5UA 5BPDA 4KFCA 2OZ6A 1OYIA 5LRSA 3BPXA 1R22A 4EVIA 4G94A 4MEXF 1RZ4A 2MH9A 1UHWA 3F22A 5HDGA 1Z1DA 4M9SA 4AWXB 1GXQA 3R60A 2HTJA 4K2EA 4TV7A 3KP3A 3J80Z 1GXPA 5IT9K 4MEYF 3PFIA 1XCBA 2ZCWA 2Y0MA 1J2XA 1EH6A 1K79A 2A07F 1HKTA 3TO7A 1F1ZA 4IVNA 1U6GA 4EJVA 1P92A 2L4MA 2VXZA 3GZ6A 3ERED 4B09A 1QZYA 3V7RA 2DLLA 4EV0A 3P7NA 3LA3A 3SZPA 2QLZA 5L3DA 3JSPA 1WSUA 3Q5FA 1DDNA 2NNNA 4UNOA 3LQQA 4N9HA 5H6RA 2EA4A 5ICCA 2B0LA 3QOPA 4HF2A 4L9VA 3W6JB 2V9VA 1DP7P 2JTVA 2OQRA 2HYGD 1NHAA 3CLOA 2BYVE 3KP6A 3T8TA 4LD5A 3JTHA 4O5VA 2L4AA 3VOEA 2OA4A 2JT1A 3RPUA 4ESFA 5HLHA 2YR2A 3E3VA 1QO0D 4ETSA 5L3FA 2EV5A 1KU2A 4ESJA 3NRVA 2HGCA 1FZPB 4WX9A 2IVMA 2P5VA 2FSWA 2Y48A 1MKMA 3I59A 4MNUA 3JW4A 2P5KA 1IF1A 1U5TB 3ECHA 5L3GA 1ZAOA 3ZN1A 4KT5C 2DU9A 2VOPA 4Z2YA 3ZMZA 3V7SA 2J5OA 3KETA 1ZREA 3QU3A 1HKQA 2M1BA 3L00A 1RUNA 3CDHA 2DQRA 3D5LA 4U0YA 4IRGA 4A6DA 3P9KA 4GCVA 5ERIA 1IXRC 5E18F 4WXCA 3H3ZA 1LDDA 2L3DA 1YYVA 1RUOA 2HQRA 1BI2A 4FHTA 2G9WA 3DPLC 3KP5A 3FF5A 5CVJA 2ESHA 4L9TA 4RB1A 2E1CA 1TQPA 4WF2A 2D1HA 4U0VA 1F5TA 3HHGA 2CFXA 1Z7UA 3ABTA 5DCMB 4OU0A 5E17F 2RQPA 3RKWA 4G6DA 2E7WA 2FRHA 2GZWA 3BJOA 4HF1A 2ZBKA 4KDPA 1SD5A 4KIGA 3WTSC 2W24A 2GIVA 3I71A 3KLNA 1ZRDA 2JZYA 4OOIA 4DNCA 4Q47A 4M71A 2QVOA 3E5XA 1AOYA 5DD4A 3ZQ7A 1JHHA 4XLPF 3ZMDA 1OYWA 3HSEA 1O3TA 3V8LA 4LB5A 2GA1A 1W7PB 1G3WA 5ICGA 3DQVC 4HYEA 2PQ8A 2GXBA 5DEQA 5E8GA 4RB2C 1Z05A 2VC1A 3WGHA 5FB2A 3B02A 2LNBA 2P6SA 5JR3A 2QQAA 1EH8A 2HOEA 4HX4A 1Z6RA 1LQ1A 1EV7A 1HKSA 3V8JA 2MH2A 1ZN2A 3FWEA 5A2QZ 5JVTA 4P9FA 1P4WA 1ZG1A 2RV8A 4BHPA 1O57A 1R5GA 5D4RA 2EA2A 1J0RA 3L2CA 4HDVA 2QQBA 1PP7U 5CVVA 1HW1A 5D5VB 3ABUA 5FLXK 2Z33A 4MQVA 5ED4A 4UHTA 1I6XA 2LF7A 1OPCA 4GGGA 4HAMA 3HOSA 2IP2A 3BJ6A 6PAXA 3OV8A 4HQMA 3FMRA 4HLYA 4KN7X 1LNWA 1YTYA 1QPMA 2Y75A 5FD6A 1T0FA 4A0XA 1T6SA 1TTYA 1T98A 2W85A 1U2WA 5CVIA 5K1YA 4BXUA 5DV5A 2PLYA 1HXDA 5L3BA 1JXSA 4CGZA 3CTAA 1FP1D 1VTNC 4I09A 3V4GA 5IT9Z 4ZH4F 3FMQA 1A04A 2G7HA 5FFXA 3LSTA 3F8MA 2OU2A 2IA1A 4I7HA 5TRDA 1Z9CA 2P7CB 1YW7A 3H3UA 2CGPA 1CGPA 5E20A 1J9IA 1LB2A 1ULYA 3FX3A 3I0TA 3RKXA 4BYYA 1MDMA 1WWXA 3MZHA 4G7HF 2EFNA 3CO7C 2IA2A 2IW5A 4Q4ZF 3HSFA 4HBLA 1R1TA 2H09A 5LLQA 3TQNA 3J7AO 2ADUA 3E6BA 2XROA 2VT3A 3OOPA 2A68F 2VBYA 1OMIA 3HTUA 3BZ6A 3DKWA 3TO9A 4G7OF 2PG4A 5D8LB 2EK5A 1IN6A 3ULQB 4QLCU 3M8FA 1OR7A 4LG0B 5H6QA 1WI9A 2WWYA 4BNCA 2FF4A 1ZLKA 2QM3A 2GQQA 1DPUA 2PMHA 1IUYA 4L5JA 1B4AA 5TJJA 4Y13A 4CO8A 1W4MA 2X0LA 4AIJA 1S8NA 2H94A 1D8KA 2FE3A 3K69A 3K1MA 5DD8A 5E1ZB 1BC7C 5BQTA 2K4JA 3QPTA 3MEXA 1V3FA 3CUOA 2DPDA 4KNYA 3GEZA 5D5XB 3M8EA 1S7AA 3F6VA 2HTSA 1P4AA 3GVAA 4ZYHA 1KQ8A 3VEPA 3HRUA 4EM2A 4P55A 3KCCA 2YX4A 2NYXA 1YS6A 1G6NA 3LA7A 2STWA 2GA2A 3MCZA 3WTTC 1HBXG 2LDUA 4OIPF 2RKHA 3ZMVA 1IRGA 4L9JA 2FBIA 5CVRA 1FPQA 1FBUA 3L7WA 2WTEA 1H9GA 2ZFWA 3BWGA 3DF8A 1PUEE 1XB4A 5HS7A 3I5UA 1FY7A 4ENMA 2OZUA 4ZYDA 1BIAA 2STTA 1W7PD 3ROUA 5DUKA 4R8HA 1Z6TA 1K6OA 1R00A 4ZYEA
chains in the Genus database with same CATH superfamily
4LG0A 4XRSG 3BP8A 4ZYGA 4UY8I 1T2KA 4M3DA 3HC7A 4QTRA 2OCCH 3M7GA 1OCCH 1JI8A 2HDCA 3CESA 1A35A 1PJRA 5BOXA 4IJAA 4C2TA 1IUFA 2A6HF 3I59B 3TOBA 5CJ9A 3BCBA 3HXLA 3IRQA 1JTYA 3JTGA 3DEUA 1BOAA 4IHVA 3I4MJ 2Z9OA 3WTZA 5FLVA 2QQ9A 1E17A 3WE3A 4P9UA 4M3BA 3WTVC 3QRFF 3HGYA 3CCJI 2DTRA 2M30A 5E1XA 4FT8A 2QKLB 2KKOA 3IAS2 1OCTC 2DK5A 3AG3H 1VQNI 5CKTA 1JGSA 1LVKA 3PNVA 3ZQFA 1IN4A 4CSWA 1IN5A 4E7SA 4M6YA 2R7RA 4RGRA 4DJAA 3EYIA 1RPWA 3MZYA 1ZGWA 2OUMA 1FX7A 2JK3A 3KZYA 3WTXC 1YRNA 4IHSA 3RKQA 4BUPA 1RIOH 2JQ7A 3EUHC 3ZQQA 1V4RA 3OYBA 2YU3A 4E7IA 3AFHA 1YO5C 1XN7A 4BS9A 3E6CC 1HLVA 3GTKJ 1B59A 4L5EA 1LE8B 2EIKH 1C0WA 3S2HJ 5D5UB 4MLOA 5KVRA 2ZC2A 3MD2A 1S72I 2NS0A 3GZNB 2NRAC 1OCPA 3VPRA 1MBHA 1Q1HA 1JUPA 1U0JA 1Q1VA 2DMTA 2Y9YA 5DM6F 2VJIA 1HSJA 3M1EA 4I0AA 1EH7A 3GFLA 1TT5B 4D0PA 3ZMSA 1G2HA 5AIPA 3JRHA 2JUGA 1JTXA 2BW3A 4RLQA 4BH9A 3ZMTA 2YSRA 3MZ8A 3I55I 1VZ0A 4NUBA 5K5QA 1W36C 4UVAA 2PMZN 1TZLA 1K61A 1S7OA 2QUFA 2VT2A 1A36A 2ME0A 1MJ9A 3QODA 4CYCB 2ESNA 4XKVA 3HDDA 5BMZA 4HEA2 4AYBA 3IHUA 1TW2A 1XGMA 4G6QA 1W0TA 3DLAA 1ETVA 2PFBA 5GTHC 2Q1ZB 3PM1A 3LA2A 2JN6A 3MWMA 2DT6A 4Y15A 3ZQHA 1S6LA 1A31A 1SFKA 3QU6A 2JA5J 2HOAA 2BY2A 5JI6A 1QZEA 4JBAA 4Y7NJ 2P6TA 3WGGA 2XKOA 2W00A 2LYCA 5LGTA 4XM3A 4FX0A 2F2EA 1O4XA 1YW9A 3OYIA 2GXGA 1FOYA 5M5YJ 5CVUA 2OJED 1ZARA 2BE5F 2FA5A 1Z67A 1XDUA 1SFXA 2DK8A 4HV5A 1ZYRF 3H9GA 5FLXZ 3HIFA 2P5LC 1VQKI 1MMGA 2FOKA 2H6BA 4RM3A 3OYAA 2X6WA 3CC4I 1GDTA 2V1XA 3H9QA 2RN7A 2EFPA 1I5ZA 3PUFA 4S04A 1X19A 1RI7A 4HA8A 1GVJA 4KA4A 2LOOA 2PEXA 2ZJPF 4UV9A 4L9NA 2O3FA 3KZZA 4LLNA 2RNJA 2KDOA 2FQ3A 3HYIA 1VQOI 5HS9A 1DU0A 2MA3A 2WADA 1ON1A 2EH3A 1XX5A 2O5RA 3TP3A 2RVCA 2CV0A 2EJRA 3J7ZI 4HDUA 2O8XA 2BV6A 3HB9A 3NWSA 4M3EA 2M0CA 3LFKA 1I27A 1DP3A 5FD5A 4I6ZA 1B9MA 3H0DA 4XKWA 5LHIA 4IZZA 4L5IA 4XOTA 2PI0A 2NOJB 4IRHA 1UG0A 3OY9A 1LE8A 3P9CA 3PSFA 1E3HA 4CXFA 1ZR2A 3E6MA 1SMTA 3I58A 5LEKA 1HW2A 1LDKB 1J7KA 5B5EC 2Y0SA 4U0WA 4P96A 3KEYA 4XK4A 1DGRM 2NNYA 4HF0A 4NC6A 2E1OA 3OS0A 4KYWA 1TQMA 4BQQA 3K4JA 2UXNA 3EUHA 1ENHA 3JRBA 4BXFA 3OS2A 1VQ6I 4OIQF 1LPQA 4A12A 5D6FA 2IJLA 1YJWI 2BXZA 3HRTA 3HGGA 4Z6YA 1UMQA 4B44A 1DPRA 2NVTJ 4CYCA 5C3EJ 2W84A 4BJ6C 1WPKA 2CUFA 4FASD 3CCYA 2HEOA 3HUGB 5EDNA 3DKXA 1QU3A 4Y17A 4I02A 4FE4A 2AXTC 1YQAA 2EFQA 4N9IA 5EZGA 3S3MA 3SQNA 3C2GA 1G59A 1Z91A 4EJWA 1IZ1A 1TNTA 2V79A 3M07A 4FETA 2CU7A 2KHMA 3OYJA 3R0JA 1STZA 3G1LA 2NXNB 2F4MB 4ESBA 2EV6A 4RB3C 4GYGA 2LMDA 1B9NA 3K1PA 3BR1A 3CMYA 2P7VB 1NH3A 1KYZA 2BEOA 4NQWA 4Y3OA 4EJOA 4Y4RA 3W3CA 5KK1A 1BI3A 3LAJA 3EETA 3DU5A 2CSOA 4O3MA 1ETYA 1IAWA 2DA4A 1ZHFA 2L7FP 3SHFA 4HX7A 1H9TA 3QPHA 3ZPLA 4IRIA 1X3UA 1FT9A 2Y9ZA 2HXOA 3ZN0A 2LY9A 4ZDLA 3OYHA 3VDXA 4A5MA 4HG2A 3O6BB 4JK1X 1ON2A 4BHCA 2CS3A 5ILVA 1A5JA 1ETXA 2COMA 5D4SA 3CP2A 1E3OC 4M74A 1SAUA 3U2RA 2JA7J 3RYPA 1XGSA 2Z99A 3C1DA 4UVBA 2DT7B 1K78B 3L9FA 2E35A 4OAZA 3AG1H 1I1GA 1P7JA 5DS9A 5IPAA 1DUXC 4U7BA 3KPHA 4G7ZF 3FHZA 5F08A 3WU0A 4D1QA 3O8GA 3AL0C 3KX2A 5E3LA 1HSTA 1TWHJ 1AHDP 2ZMEC 1BOBA 1MJAA 5HLGA 1S7EA 2PBIA 3HBLA 3Q0VA 4BAYA 2GAUA 5EYRA 3RPUD 5HOOA 2L9SA 1USSA 4HV6A 4KIBA 1K83J 2PJRB 4OMYA 1MDMB 2A5YB 3PSIA 1RKWA 3CC7I 5IY5H 1LKXA 2OTJI 4I01A 3I4NJ 1X58A 4HZFA 5GTIC 1IN7A 4A2UA 1WJDA 3HM5A 2D1VA 4EMSA 1KU7A 1X4PA 1KQ0A 1J59A 2XB0X 2XC7A 2I10A 4AYBN 4RGUA 2NS7A 3LQRA 2JUCA 2RREA 1SC7A 2HFHA 4A69C 1MBJA 1IRFA 2ZMEB 2W7NA 3HUGA 4CZZA 5B1BH 3H9JA 1MMAA 2VL8A 4LITA 4QPQA 3CUQC 1XMAA 1O3SA 2QA4I 1IXCA 1WJFA 2ECCA 2P0WA 1W5SA 3M3YJ 3BY6A 3HHHA 4ON0A 5GAEJ 1MW7A 2PJPA 3J81K 2NVUB 3QPSA 1SVOA 2Z5UA 1XSXA 1D1CA 2H1KA 1PYVA 1FJLA 4EM0B 3H5AA 3OS1A 4I2OA 1A6QA 3QAHA 1U78A 2BHYA 2G0EA 2F5VA 1O3RA 1Y8QB 3SZTA 1VFCA 3BDDA 3VYSB 2F5DA 4PJLA 2DTZA 2DBBA 3KE2A 4F3QA 2QYOA 3K2AA 5ICFA 1FLIA 2R7WA 2R7OA 5J47A 3O2PE 1IXSB 2Z3YA 3HEFA 3TKYA 3MFKA 3GLLA 2QEXI 2M4KA 2DA2A 3IWZA 4ENJA 3GTJJ 3W6VA 2VKEA 4PGGA 1LFBA 1MBFA 5HODA 2O0YA 3R4KA 4KMUX 1GHCA 1ZGAA 3SDGA 1YJNI 1WRJA 1XDSA 2BY0A 2R92J 3F8BA 2BOLA 3H0GJ 1TWAJ 2QSGX 5D5WB 2MLGA 3GZ5A 1K78A 2LR8A 4MHGA 4DYQA 5J6XA 4ZTFA 2CYYA 2QENA 2ISYA 3IH4A 1BM9A 3OMYA 1VQ4I 1ZGJA 4EEFG 2K9MA 4D9JA 1H8AC 1TLHB 1J09A 4OIRF 1EJ9A 1QVTA 3KZIC 3QPLA 4F55A 2PMUA 4KITB 1ZG3A 1GV5A 1V5FA 1AWCA 3R61A 2DA1A 2MLKA 4DIQA 4EGZA 2X51A 3DKYA 1IV8A 5AONA 4WCGA 3QP6A 3W2AA 2FBKA 2CW8A 2EFWA 5C4XJ 3S16J 2BY1A 2QSFX 3F6OA 3TDUC 1YI2I 4XRMA 3OL3A 3DU6A 3JAMK 1D3YA 3CMEI 2IA0A 3KP2A 2DYRH 4FISA 2YS9A 1FTZA 2CQ7A 2AHQA 1QNTA 2CUJA 3I4PA 3FXLA 4YFKF 3AAFA 3GFIA 2AS5F 2ZKZA 2KLOA 5ILUA 2CW0F 4P5OA 3TO6A 3JRAA 3COAC 3H92A 3S17J 1UFMA 2FD5A 2XHKA 4G12A 1SD6A 4B1RA 2EBIA 3PQJA 4L18B 4HLXA 4PCQA 3CJQB 2OCEA 2JSCA 1N25A 1XGOA 2A3SA 4IF4A 4BQOA 4CICA 3S3OA 3FKJA 4KMFA 2ZMEA 3MAJA 2M8EA 3CO6C 1FBSA 4IQJA 2HS5A 3IL2A 4PJNA 1SD4A 3T8RA 1WJCA 2K27A 2GOXB 3D0SA 1XCVA 3N4MA 2LK2A 1BW6A 1BI0A 3K0LA 4X0GA 5FKMA 1R1VA 4G6TB 4YFNF 3QWLA 1TWFJ 2YX7A 3E1SA 5DCFA 4NNJA 3BROA 2TDXA 3ELKA 2VJJA 4PSXA 3JREA 5LBQA 4PJJA 3VSKA 4Q5SF 1FTTA 3ONQA 3RJPA 2IAIA 3SXYA 4LLGF 5F0FA 2O8KA 3FK6A 3X2QH 4E7HA 4HQEA 2MGQA 2EWNA 1KONA 2P8TA 2R7FA 5JVGF 2K4BA 2F5FA 4UUTA 2EINH 1R58A 5LFAA 3I53A 3LWFA 2E2IJ 4XRSA 4PSWA 3DBHB 1E2XA 2HOTA 4ZDPA 1UAAA 3M8JA 2EFOA 1X3WB 2DN0A 5L3EA 2WC2A 3WU2C 2VBXA 2KRFA 3GLXA 5GPCA 4RBOA 2UXXA 3FXUA 4PJ0C 5E8IA 5CYVA 1QZZA 3DTIA 2DOFA 1O7LA 3K4CA 1VQ7I 3GTQJ 3HPHA 4E70A 2K86A 2KIFA 3BG7A 3CF5F 1NK2P 3F8CA 1BBYA 4I76A 2QZ8A 2XSDC 3S1NJ 3GFMA 1PDNC 3HRSA 3OIOA 1ODDA 1UJ8A 1FBQA 3E5QA 4CYDA 2D2WA 1O3QA 4R79A 3K9TA 3V7CA 2R5YA 1POGA 4XORA 3A02A 3B73A 1YRNB 2CH0A 2KRCA 3S8PA 3CP8A 2UUZA 5BS6A 4L0ZB 4EM1A 3NWTA 1BW5A 4HX8A 2R7VA 3FZVA 3LSHA 5LHGA 2DFHA 2ZXWH 2QWWA 5HLIA 5GADJ 1XD7A 2XB5A 3WHBA 1U3EM 1ZKGA 3SZGA 3PIOF 3TW6A 1W5TA 3CQZJ 4BJTA 4XIDA 2MC4A 3G2BA 4A6EA 1BC8C 3IWFA 4H4KC 3N97A 5JHFA 2DO7A 3BOQA 1TW3A 4LGWA 1VQ9I 1ZG5A 1NG6A 1CF7A 1OCOH 3OR2C 1RKTA 3HOVJ 2K5CA 2KMUA 2VQLA 3K4LA 3SFZA 1Y8RB 1FYKA 4PZJA 1Z7LA 1ZLJA 2EIMH 2A6TA 4NBQA 1R36A 3OYGA 3FMSA 3PQKA 2TRTA 5HVQC 3PNTA 2DMNA 2EV0A 1KA8A 2LSOA 3E97A 4PJMA 1IC8A 1UCRA 2XV4S 4M6XA 3DPTA 2CO5A 1W5CC 5LGNA 3DV8A 4JX6A 4ZZLA 1RRJA 2ZXIA 2A61A 2V1NA 3ECOA 4H0EA 2F48A 4F93B 1G4DA 3FBIB 2LTPA 1B6AA 1XMXA 1FYMA 5K7HA 2IRFG 1R5HA 2RDPA 5J40A 1Z21A 4HOBA 1PP8F 4J19A 1HOMA 2ZXJA 2GWRA 2VBWA 4BJ5C 2L9VA 4S05A 3C18A 2B7EA 3F0CA 4KN4X 4UXNA 2Q8KA 2VOOA 4GO1A 2W1OA 2DYSH 4F92B 2E5NA 4DGWB 3FXQA 1QRYA 3C2HA 3WHCA 2X1EA 1USTA 2FMLA 2O61A 1KU9A 1IDYA 4KIFA 1TQIA 2OBPA 4BQAA 4LK1F 1JHFA 4OAYA 2KIUA 4HW0A 4BBSJ 3C7JA 1YW8A 3BZKA 4U88A 1YS7A 1K4SA 4LB6B 1KYWA 3BJAA 2F5CA 2XKPA 2IPQX 3S2WA 2R7XA 3BQZA 2HNHA 2JJ7A 1YX3A 1QGPA 3HOUJ 1TL8A 3S93A 5JLXA 5H2FC 1R9TJ 5H20A 1GT0C 2KISA 2FJ1A 4XLHA 1QQIA 2WV0A 3SEZA 3HTSB 1Z3YA 1MMSA 3WODF 2ELHA 4RMNA 4NDLA 1MSFC 3OWTA 3E0JB 5DYMA 2LLKA 4B3AA 2BGCA 1N75A 3A4CA 3DPUA 1ETQA 4EQQA 5LEJA 4XLNF 4C30A 3GUDA 2XAHA 1AKHB 4CCNA 3R6SA 1REPC 3SJMA 3TEDA 2KIQA 4RB0A 1FEXA 1SD7A 3VYUB 1FMVA 3I56I 2W25A 1YG2A 4WWCA 1JKQC 5IYBJ 2VE9A 2VKHA 3BR3A 4CCOA 4R1HA 3BR5A 4IXAA 1BI1A 1HQCA 2IGKA 1TWCJ 1MZBA 4ENNA 2YU9J 2IGNA 2XF6A 4OMZA 5DDGA 2MABA 2F4OB 2TCTA 1IRXA 1Y0UA 3VFZA 3S14J 2KIMA 1BJZA 3GYHX 4HNVA 3I64A 1I6HJ 2R7DA 2R0QC 2L02A 4EJUA 3FXRA 5EEGA 1WJBA 4UVCA 2RC4A 4IKFA 3GXOA 4UV8A 2D45A 3Q9SA 4XBFA 3JSOA 3E6DA 1XSVA 4IHTA 4AIKA 1TP4A 4M3GA 4DQ2A 4YIFA 3WE2A 4B8XA 1K6YA 1OFCX 3W2VA 4QSHA 1BR2A 2ME6A 5J4YA 2VBZA 2IS6A 5LRRA 3RZOJ 2H6CA 4AVPA 5KAIC 5D8KB 4C3IJ 2HPIA 5FGMA 4E4HA 2WAEA 2XUBA 2KFDA 1D5YA 5TISC 1XPXA 4IOAF 4ENKA 2K3PA 4W1UA 4XLAA 3F21A 2W57A 1SAXA 3FK7A 5GPAA 2FNAA 2QBYA 2HKXA 3REOA 2LBFA 4I99C 3F8FA 5J4VA 5IP7J 2OD5A 2FUG2 4AVZA 2ICWG 4CDGA 4U7DA 2DT5A 5KHDA 1WFXA 1BJAA 2BVLA 3OSFA 4EJTA 2WBMA 4E7JA 3K70D 4MTEA 2B9SA 2JA2A 1TC3C 3IKTA 3K4BA 4V2FA 3EYYA 4NQWB 4YIRX 1U5TC 1E3PA 2DCEA 2DJNA 1MD0A 1BA5A 2VASA 5ICEA 5FRNA 3DEWA 2Q0OA 2I8DA 4UUVA 2XASA 1VQ5I 2XPUA 3CJTB 3KFWX 2E1NA 4IL6C 3TDZC 3J81Z 3FM3A 1WZ2A 2CUEA 1RNLA 1Z3XA 4MIMA 2ZNYA 4V19K 2WY8Q 3CZ6A 1P4XA 3EQLF 1JGGA 2ZO4A 2V1UA 2P4WA 1U8RA 1J5YA 2X85A 3HSRA 2L9NA 1KGSA 5IP6A 3G6EI 3CC2I 2R3SA 1AKHA 3GFJA 2EIJH 4M72A 3NQOA 1FSEA 4LFUA 1LJ9A 3DCFA 3KYCB 5FKOA 3QOEA 3LSIA 3VB2A 2CG4A 1OYYA 4XQFA 5F0HA 2A69F 5K5RA 4IHYA 1X2MA 2KP6A 1YHQI 4OWRB 4OINF 1T56A 4MTDA 1P9QC 1D0ZA 3T1BA 5CLSA 3TOAA 2DAOA 2RGVA 4PK4A 1WJEA 2MD5A 2X4HA 1T38A 3NARA 2XGCA 2M45A 3GTGJ 2K9QA 4M9XA 4RAZA 3OYMA 4IHWA 1ZH5A 1WVRA 4MFEA 3I54A 2M34A 2VODA 2MFZA 2BBYA 2IS4A 4II3A 1MBGA 2XVCA 4BHBA 4PGHA 4J00A 5F64A 2DA6A 3IC7A 3QQAA 2XAGA 2C6YA 1EKEA 4RAYA 1EA3A 1X1DA 1UB9A 3SFIA 3TW7A 4BEHA 4XL9A 2BXYA 1ACIA 5EEHA 3ZP5A 1T8IA 5EGOA 1FOKA 4B3XA 3JAMZ 4DOZA 1YJ9I 3WTUC 2VPLA 2A05A 4YFXF 4RS8A 2YPRA 3WGIA 4ZTJA 2HDDA 4A3MJ 5GAHJ 2DFIA 1JUSA 1XGNA 2V26A 2XDVA 3GF2A 1BR4A 3HRMA 3RPQA 4AD9A 2K7LA 4KUMA 3WG9A 4C2UA 2JVHA 4G9YA 1ZRCA 3J80K 3F3XA 5FJ8J 4JOMA 4CA0A 3D1NI 2K9NA 4ZZDA 2M2EA 2JPBA 4A3GJ 1IW7F 1G3YA 4WXHA 2VIXA 3W6KB 4ASNA 3DBRB 1ETWA 4B47A 3GTMJ 3U1KA 3BCAA 3ZQLA 2O03A 4MGRA 3ISPA 2UWMA 3OSGA 3HPGA 4A0YA 1R49A 3JRCA 2VLAA 2KZGA 1WKMA 2VPRA 4EGYA 1IG7A 3S15J 5DTDA 2M87A 4XONA 1U8BA 1ZRFA 3MKYB 2AXLA 2CUZA 3MQ0A 1YLFA 2HYFA 2JVGA 3Q3SA 4XICA 4XLCA 2ELKA 2L54A 2VN2A 3E7LA 3ZMUA 2F4IA 2ACJA 1OKRA 1OCZH 3L09A 2FNPA 2FMYA 5IT3A 1R23A 2Z16A 3ABLH 2NVYJ 5IP9J 1U5TA 2CQKA 1XMKA 1G8XA 2XPWA 3KLOA 4W97A 1G3TA 5E3NA 2KRHA 3CDIA 5E1WA 4D7NA 4WXDA 3G4SI 3D5SC 4NB5A 2LKPA 3H3VK 3U9GA 2O6GE 1BIBA 4XSXF 3LMMA 1WJ5A 2V9PA 4FX4A 2DPUA 2W4SA 1JKPC 4RLFA 1IN8A 1H89C 2L01A 2OC6A 3CDLA 5C44J 3CCSI 4J01A 5F6FA 3GO5A 1QVUA 2HZDA 2Z1DA 4BBRJ 3RKYA 2V7FA 1FNNA 3CF2A 4JQFA 5HS8A 1P2FA 1VQ8I 3G1OA 2KZVA 3OYCA 2XIGA 1D5VA 2DA5A 3SEQA 3AKZA 1VQLI 3U1DA 1W1WE 3VYRB 2O9LA 1K7AA 1B1BA 3P5JA 1I1SA 3OYDA 1SFUA 1LVAA 4BL0B 2HQ5A 2ZJ2A 4IO9F 3Q9VA 1QA6A 2CQXA 1ETOA 1FC3A 1FIAA 2KJCA 3GCMA 4Y33A 4XMYA 3AL0B 2R5ZA 1KQ9A 3MKLA 1S9HA 2HR3A 3A03A 2OF7A 5L3CA 2MW8A 3G73A 3OR1C 2HU9A 2FXAA 1S29A 1X1PA 1KU3A 2VC0A 5EF6A 4YELA 2V6EA 4F7ZA 1I39A 3V42A 4RGSA 2HYJA 3EDPA 5DCMA 3LAPA 4KICA 2OQGA 3KP4A 4XNFA 5CQEA 4X6AJ 2X48A 1B8IA 2L5QA 2HZTA 2EZHA 3IP4B 1X4OA 1IJWC 1A6IA 4C9YA 2UZKA 2Y2ZA 2ZSHB 2WAFA 3J7YJ 4BQNA 1MJBA 3M9AA 1WJAA 3RYRA 1R7JA 5K5OA 2IS2A 1D1BA 1HW5A 2ECBA 3DFGA 5IYCJ 4GXOA 2LKXA 3F8NA 4ZJZA 5B1AH 1J75A 3WTWC 2WB1A 3QYBA 2DQLA 3CUQB 2A6EF 5M3MJ 4GRIA 1L3LA 2OTLI 1SANA 3K4KA 5GP9A 3DTEA 4XRFA 4A3FJ 4CHUA 3GX4X 2FU4A 2H27A 4UUSA 1LEAA 4O6JA 3HOTA 2LG4A 1GUUA 1HDPA 1T39A 2ISZA 3K70C 4NHJA 3ML6A 2VB6A 2M4GA 2LP0A 5E3MA 2OAZA 2V1DA 3I3LA 2R5YB 2LFBA 4ITVA 4RAFA 2VONA 2EB7A 4PDKA 1L0OC 4IQ4A 3R0AA 1OJLA 3DWLE 4QIWN 3F23A 1W7PA 3CCMI 2GXAA 1I50J 3HG9A 2HQNA 3BR2A 4DBRA 5FFZA 2ETHA 2M5WA 2K9LA 2Y0SN 3DP7A 3LOCA 3HZJA 4ZC3A 5BPIA 5LHHA 1MNDA 5J8FA 2E19A 5FLMJ 3S32A 3RSNA 4N0BA 3FXJA 4YIIA 3C3WA 1MMDA 2K85A 4HPQA 1CF7B 4G8XA 5JFRA 3WU1B 1JKOC 1O7FA 2JRMA 2NVQJ 4A0ZA 4BE1A 1SMYF 4JX4A 3RTRA 2O7OA 3QP5A 1FP2A 1LDJA 4XSZF 5FKNA 3T5XA 2DW4A 2FBHA 4Q48A 5B66C 2X6YA 4C3HJ 3H1CA 3F72A 5F27A 3TP0A 4MQ9F 3TGNA 1H0MA 4A3EJ 5F1RA 1FWZA 1TNSA 3S2DJ 1MGTA 1QBJA 2E7XA 1FIPA 2MBFA 4DBQA 1ONVA 2BY3A 3BG9A 4NC8A 2NAZA 2DI3A 2DOEA 2V6CA 1JE8A 3CJNA 3EUKL 2QQ8A 1FYLA 2XGXA 4B43A 3J7AY 2KDZA 4AM3A 3P9IA 3BG3A 4UB6C 2LY1A 3DXJF 1DGWY 3ZQCA 3KYLA 2VI6A 5DUIA 1F4KA 9ANTA 4D7MA 2K02A 1S3JA 2LRDA 1UHMA 3FXOA 2Z2SB 4I98B 2ZJQF 3IKVA 2L7KA 4OIOF 5KCMA 1G3SA 3KEQA 4U87A 3BR6A 2E5ZA 2L2OA 2MD0A 3CUQA 1MBEA 3CCQI 2PN6A 4D5CA 4LLLA 1MSEC 2EQRA 3O8HA 5M5XJ 2EZKA 2DMPA 5HDNA 2XAFA 2HVSA 4M73A 1AA7A 1Y1VJ 1XC5A 1MNMC 3G3ZA 2MC3A 2J5PA 3WG7H 3C2BA 2ZXHA 3IUOA 3GBGA 4B48A 2IT0A 3S1MJ 1F43A 1YIOA 4AIHA 2K9SA 2LY2A 3NEUA 1QHGA 1V55H 2G7UA 4I0BA 5JHUA 4WK8F 5J3LA 1D8JA 2VE8A 2X9DA 3IH2A 3GW2A 4X1EA 1TBXA 2P81A 3L1PA 4JYKA 2KPMA 4HRIA 1I3AA 2DA3A 2D5VA 1V54H 4L0YB 4LIVA 2ZNZA 3VODA 5A2QK 4BY1J 1HCRA 4IOCF 2FEZA 2XSJC 3MKWB 2KJBA 1R1UA 1LEBA 3TMOA 3CCRI 2E71A 3BC8A 1JJ8C 3ABMH 5KAFC 1YFHA 3KEOA 1WHUA 3BLYA 3V8KA 2HXIA 1SFEA 3FXMA 1WQ2A 4QWQA 5D6EA 1FSHA 4NC7A 3WTYC 4A5NA 2DFFA 2LH9A 1VQMI 1BR1A 3KP7A 2LF8A 1B72A 1GLNA 4RGXA 2JRTA 5J8CA 3HOYJ 2L0KA 4ZYAA 2VQHA 2F6CA 3A01A 2CWEA 2HWVA 3T0YA 1BN5A 4LK0F 1F9NA 3LSKA 4A3KJ 1HF0A 3K4MA 1OLTA 3ZQGA 4M9ZA 3BT9A 2XAQA 3H5NA 1RR8C 5AIQA 3JRDA 2XPVA 3PFYA 3M1CA 4LMYA 4RAGA 2IS1A 4LJZF 5LGUA 1I3QJ 1Z77A 2M0MA 4IHXA 2XAUA 4IPAA 5FROA 2E1MC 1VF9A 2JPCA 3B6AA 5FO5A 4KT6A 3HOXJ 1K4TA 1EF4A 2GOMA 3Q0UA 2ID3A 3K1NA 5ILSA 1XSDA 2XAJA 5J1UA 4CH7A 4BU2A 2JWTA 3IRRA 3RI4A 2XGEA 2XRNA 1WH5A 2WY7Q 3O3KA 5HDKA 2QBYB 3BPVA 3RDIA 2LBFB 4GYIA 4Y52J 3DBLB 3K2ZA 1R4MB 4A93J 2HKOA 4YG2F 2F5EA 2Q2EA 3FM5A 3GWZA 1P6RA 2WB1N 3RIRA 2DMQA 3E5UA 5BPDA 4KFCA 2OZ6A 1OYIA 1R4NB 5LRSA 1MH3A 3BPXA 1R22A 4EVIA 1NK3P 1RC9A 4G94A 5E79C 4MEXF 1RZ4A 2MH9A 1IRZA 4N4NB 1UHWA 4PFPA 3ZGKA 3F22A 1JUMA 5HDGA 1Z1DA 4M9SA 4AWXB 2GM4A 1GXQA 2E60A 3R60A 1GVDA 3ZCOA 2XF7A 2L7MP 4V2GA 1ZQ3P 2HTJA 5HLTA 3OYLA 1QHHD 2DDAA 4K2EA 5K7ZA 4B4CA 3LSPA 4TV7A 1MNEA 4A3JJ 3PO3J 2ZJRF 3KP3A 3J80Z 1T33A 1GXPA 5IT9K 4IEJA 5EZHA 4KJZA 2W82A 4MEYF 3GMEA 3CCVI 3OIQA 3PFIA 5M5WJ 4E7KA 4II2A 1XCBA 2ZCWA 2Y0MA 3CMMA 1ZTRA 1J2XA 3FIWA 3CCEI 1JJ6C 1EH6A 4ABZA 1K79A 3BG5A 3BZCA 3PO2J 2A07F 1HKTA 3TO7A 4KISA 2QKMB 4UB8C 1F1ZA 2CFOA 4IVNA 3ABKH 1SEUA 1U6GA 4EJVA 4A3CJ 1P92A 3CLQA 3JR9A 3GTPJ 2X6OA 2BHZA 3U21A 2L4MA 2VXZA 4C3JJ 4RDUA 3GZ6A 3K10A 4B09A 3ERED 3JRIA 4A3IJ 1QZYA 2CQNA 3ESWB 3V7RA 2DLLA 4EV0A 2R7TA 2AQEA 1HDDC 3P7NA 5IYDJ 1ORKA 3LA3A 3SZPA 2V4JC 2QLZA 3HKZA 3PIPF 5L3DA 3JSPA 3L2UA 1WSUA 1N78A 4E7ZA 5EG0B 3DLLF 3Q5FA 1DDNA 2HPMA 2NNNA 4BXXJ 1WH7A 1R6RA 5DM7F 4UNOA 3LL7A 3LQQA 4N9HA 5H6RA 2EA4A 3G71I 2B0LA 5ICCA 3QOPA 1UHSA 4HF2A 4BEHB 2L7ZA 2ZFUA 4L9VA 3W6JB 5EGOB 1T08B 2V9VA 3CD6I 4AU7A 1DP7P 4HSRA 2JTVA 2OQRA 2HYGD 1NHAA 3CLOA 3PL8A 2BYVE 3KP6A 2E34A 3T8TA 1KZHA 4JX5A 4LD5A 5E3OA 3JTHA 5EJCA 2VJ5A 4O5VA 4YRVA 2L4AA 4HNUA 3UR3C 3VOEA 3N05A 1WGXA 1TWGJ 2ID6A 2OA4A 2JT1A 3RPUA 4ESFA 4YEJA 1FOWA 3OYFA 3JRFA 2E2HJ 2AO9A 1SVMA 5HLHA 4PUSA 2YR2A 3E3VA 1QO0D 2DXIA 4ETSA 5L3FA 2LC2A 1QPIA 4BDYA 2EV5A 1KU2A 4ESJA 3K4NA 4F91B 3NRVA 3OYKA 3UNGC 3TBIA 2HGCA 1FZPB 4WX9A 2IVMA 2P5VA 2GIZA 2FSWA 2Y48A 1MKMA 3I59A 2XGDA 2EILH 2FX0A 4MNUA 3MKZA 4N4OB 3K7AJ 3JW4A 2P5KA 1IF1A 3Q0WA 1U5TB 3ECHA 5L3GA 1ZAOA 3ZN1A 4KT5C 2DU9A 2VOPA 5CPRB 2VXDA 4Z2YA 3ZMZA 4LIUA 3V7SA 1JT6A 2JA8J 2CJJA 2J5OA 4A3BJ 3KETA 2IGOA 1ZREA 3QU3A 4PFOA 1HKQA 2M1BA 3L00A 2WV1A 1RUNA 3CDHA 2DQRA 3D5LA 2EZIA 4U0YA 4IRGA 3HJEA 4D5FA 4A6DA 2DDBA 3P9KA 4GCVA 3SYTA 5ERIA 2K40A 1E0EA 1IXRC 5E18F 4WXCA 3H3ZA 2H8RA 1LDDA 1M1EB 2L3DA 1YYVA 2HVQA 1FOXA 3ZRGA 1RUOA 2HQRA 1BI2A 2R93J 1MIJA 1RR7A 1BL0A 1CQTA 5EG0A 4FHTA 3CMAI 2G9WA 3DPLC 2FQ4A 3CJRB 4S0HB 3KP5A 3FF5A 1RESA 5CVJA 2ESHA 2VJ4A 3JRGA 4L9TA 2R5ZB 4RB1A 2E1CA 1TQPA 4BE2A 2M8GX 4WF2A 2WAQA 3RQIA 1ETKA 2D1HA 4CCKA 4U0VA 3S3NA 1YIJI 2CQQA 3HHGA 3UKGA 2CFXA 1H88C 2DA7A 1F5TA 1YX5A 1Z7UA 5F0CA 2DFEA 3ABTA 3PJRA 5DCMB 3GTLJ 5TGTA 1IGNA 4OU0A 3S1QJ 2AQFA 3OYNA 5E17F 2RQPA 3RKWA 2CMPA 4G6DA 1T0FC 1B8IB 1UZCA 2JMWA 3DEEA 2BZTA 1X2NA 2CRGA 2DJIA 3ERMA 1NTCA 2E7WA 5FKKA 3I9V2 3FHNA 1VI0A 2FRHA 2GZWA 2DODA 3BJOA 4HF1A 2ZBKA 3BTIA 4KDPA 1SD5A 4KIGA 3WTSC 3MVPA 2W24A 2GIVA 2R4GA 3CCLI 2A5WA 4AIDA 3GTOJ 3I71A 3KLNA 3DTKA 1ZRDA 2JZYA 1P7IA 4OOIA 2M3AA 4DNCA 2IGMA 2XF5A 4Q47A 4M71A 5KNLA 3LSGA 2QVOA 2RNGA 3OIPA 1D0YA 5CQGA 3E5XA 4GDFA 1Y6IA 1T95A 3OL4A 5DD4A 1AOYA 3ZQ7A 1JHHA 2BVMA 3FXKA 3LFUA 1XTAA 4UUSB 4XLPF 5HNFA 3ZMDA 2MG4A 1RETA 2QF7A 1OYWA 3FDYA 2WA0A 2KL4A 5JLWA 3IAM2 4XN0A 2YUSA 4XKCA 3HSEA 3JCUC 3CCUI 1O3TA 1UELB 3V8LA 4LB5A 4GFBA 3ZQIA 2GA1A 1MH4A 2V9KA 1SFOJ 3QYEA 1W7PB 3ASNH 3VWBA 1G3WA 2X1CA 3KIOA 5ICGA 2KT0A 5BNGA 3DQVC 4HYEA 2IXSA 2PQ8A 1Y1WJ 2GXBA 4DW6A 1OQYA 2COBA 5DEQA 5E8GA 1IV6A 2HI3A 1LUJB 4RB2C 1Z05A 4E7LA 2M9HA 3D5RC 1PUFB 2IEKA 2VC1A 2DMUA 3HKZN 4LG3A 1JT0A 3FKIJ 2HOSA 1IDZA 3A1YA 3WGHA 5FB2A 3B02A 4FCYA 3FISA 3ZXSA 2LNBA 1MMNA 2P6SA 1OISA 5JR3A 2QQAA 1FMWA 5LD2C 1EH8A 2HOEA 2W48A 3H5RA 4HX4A 4HSTA 1Z6RA 1LQ1A 1EV7A 1HKSA 3V8JA 4BACA 2MH2A 3NAUA 1ZN2A 3FWEA 5A2QZ 2R7QA 5JVTA 1ZELA 4F52A 2OV7A 4P9FA 1D1AA 3IH3A 3BQYA 3A2KA 1U9NA 4ZDOA 1P4WA 1WI3A 1ZG1A 4P1WA 3A0HC 2NOGA 2RV8A 4BHPA 2LREA 1O57A 2H1LA 1R5GA 5D4RA 1OR7C 4XLEA 2MYSA 4CUGA 2EA2A 1J0RA 2LVSA 3L2CA 4HDVA 2QSHX 4XR6A 1YITI 1HA8A 2QQBA 4XLFA 1PP7U 5CVVA 1HW1A 3AG4H 5D5VB 3ABUA 5FLXK 2Z33A 4MQVA 5ED4A 4UHTA 2Y69H 2CV2A 1I6XA 1VQPI 3VSLA 1F36A 3M4OJ 2LF7A 1OPCA 4GGGA 4HAMA 3HOSA 2IP2A 3BJ6A 4CZCA 6PAXA 4M3FA 1X1CA 2UV1A 3OV8A 4HQMA 3A0BC 3FMRA 4HLYA 4KN7X 1LNWA 2H8WA 3QYFA 2PX9A 1YTYA 2VKDA 1QPMA 2Y75A 5FD6A 1Z0XA 1Y56A 1T0FA 1DU6A 4A0XA 3KYDB 1T6SA 3HOZJ 5GAGJ 3BTLA 1TTYA 2N8GA 4E6KG 1T98A 4AC0A 1LFPA 2W85A 1WCMJ 1UG2A 1U2WA 5CVIA 1X1AA 3RCOA 5K1YA 2HDWA 3SDBA 4FE7A 5J1YA 3OYEA 4BXUA 3LSMA 5DV5A 3LSJA 1D0XA 2PLYA 1HXDA 2IBDA 5L3BA 1JXSA 2VQGA 4CGZA 3CTAA 4DZPA 1FP1D 2OPTA 2LKSA 1VTNC 1Y39A 1HC8A 1MBKA 2CW7A 1YOVB 3MN2A 4I09A 2VKVA 3V4GA 1PUFA 5IT9Z 2JA6J 4ZH4F 3FMQA 1A04A 3TL4X 1X1BA 2G7HA 5FFXA 2RAEA 3LSTA 2NS8A 2X6XA 3F8MA 2OU2A 2IA1A 4I7HA 2XRLA 5TRDA 1B72B 4DYCA 1V5EA 1Z9CA 2DOAA 3A01B 2JSPA 5J1RA 1W36D 2P7CB 5FKLA 4BDZA 3K6GA 5F04A 1YW7A 3H3UA 3RQ4A 2K3FA 2CGPA 1CGPA 2WAQN 3W2WA 5E20A 3L2QA 1J9IA 1W0UA 1LB2A 1ULYA 4A3DJ 2PJRA 5M3FJ 3FX3A 3I0TA 4JP0A 3RKXA 4BYYA 1MDMA 3BR0A 3EPZA 2NVXJ 1WWXA 2M7BA 3MZHA 4G7HF 3H35A 4CCMA 3BTCA 3H36A 4EATA 1XS9A 2EFNA 3CO7C 5IOZA 3BG6A 2IA2A 2IW5A 2KQRA 2GLOA 2HVRA 4LOCA 4Q4ZF 3HSFA 4HBLA 1R1TA 2H09A 5LLQA 3TQNA 3J7AO 1AU7A 1ZK8A 1Y0NA 2ADUA 3E6BA 2XROA 1YE9A 2X1DA 4M6VA 2PMZA 4BGDA 2VT3A 3OOPA 5F1JA 2A68F 3FBNB 2Q2EB 2VBYA 1OMIA 1TT0A 4BY7J 3HTUA 3BZ6A 4XN3A 1U9OA 3DKWA 3TO9A 4BKXA 3PUBA 4AUXA 5HNHA 4G7OF 2PG4A 5D8LB 2EK5A 1IN6A 1GV2A 2I5UA 3ULQB 1IO2A 1PVEA 4QLCU 3M8FA 1S5LC 2EZLA 1OR7A 1APLC 5B3SH 4LG0B 5H6QA 1WI9A 2WWYA 4BNCA 2ZB9A 2FF4A 4QPOA 1ZLKA 5FRMA 3MMYB 3G1MA 2QM3A 3OOUA 2E36A 2EPFA 3L2VA 4RA2A 2GQQA 1DPUA 3RZDJ 3ZR8X 1OCRH 2PMHA 5C4JJ 2GBYA 1IUYA 1NG7A 2ZSIB 4L5JA 1R71A 1B4AA 3EUAA 1VNDA 5TJJA 4Y13A 4CO8A 3IV5A 1W4MA 4A3LJ 1SVLA 2X0LA 4AIJA 1S8NA 2H94A 1D8KA 2FE3A 1ERDA 3K69A 2E2JJ 3S1RJ 1XG1A 3K1MA 5DD8A 5E1ZB 1BC7C 5BQTA 3ASOH 2K4JA 3PNYA 3QPTA 3MEXA 1N77A 4DZJA 1V3FA 3CUOA 2DPDA 4KNYA 3GEZA 5D5XB 1DQUA 2B63J 3M8EA 1X3ZB 4C2MJ 5EEAA 2L9RA 1R5ID 1S7AA 3F6VA 2VQCA 3VYTB 2HQAA 4XKBA 2HTSA 1P4AA 2M7AA 3GVAA 2LD5A 4ZYHA 2QCOA 4CCLA 1KQ8A 4ANJA 3LSRA 3VEPA 3HRUA 4EM2A 4P55A 3KCCA 4IX7A 2YX4A 2NYXA 4BE0A 1YS6A 2RQQA 1G6NA 2FOWA 3LA7A 2STWA 2GA2A 2Y30A 3MCZA 3WTTC 1LFUP 1HBXG 3AG2H 2LDUA 4RM2A 4OIPF 2RKHA 3ZMVA 1IRGA 1ITYA 3ZOBA 5K7FA 4L9JA 2FBIA 2VUMJ 5CVRA 1FPQA 1FBUA 3L7WA 3F9KA 4HNTA 2R7UA 2Y31A 2BW3B 2WTEA 1H9GA 2ZFWA 4MO7A 3BWGA 3HL2A 3DF8A 1JKRC 4MFDA 1PUEE 1XB4A 5HS7A 2MSYA 3I5UA 1FY7A 3L2WA 4ENMA 3LNQA 4XOPA 2OZUA 4ZYDA 1BIAA 2ELJA 2STTA 4CCJA 1W7PD 3ROUA 5DUKA 4FQGA 2R7SA 2E1MB 2R7ZJ 4R8HA 5IOYA 1ZR4A 1Z6TA 3B6CA 3L2RA 4FTHA 1V5GA 1R00A 4DYRA 3BTJA 1K6OA 3HOWJ 4ZYEA 2QGUA 2CV1A
chains in the Genus database with same CATH topology
4LG0A 3BP8A 4ZYGA 1T2KA 3M7GA 2HDCA 5BOXA 4IJAA 2A6HF 3I59B 3TOBA 5CJ9A 3IRQA 3JTGA 3DEUA 1BOAA 2Z9OA 3WTZA 2QQ9A 1E17A 3WE3A 4P9UA 3WTVC 3QRFF 2DTRA 2M30A 5E1XA 4FT8A 2KKOA 2DK5A 1JGSA 1IN4A 1IN5A 4M6YA 4RGRA 3EYIA 4IHSA 3MZYA 1FX7A 3KZYA 3WTXC 1RIOH 1V4RA 2YU3A 1YO5C 1XN7A 3E6CC 1B59A 1C0WA 5D5UB 5KVRA 2NS0A 2NRAC 1Q1HA 1HSJA 3M1EA 4I0AA 1EH7A 3GFLA 4D0PA 3ZMSA 5AIPA 4BH9A 3ZMTA 2YSRA 5K5QA 4UVAA 1S7OA 2QUFA 2VT2A 1MJ9A 2ESNA 5BMZA 3IHUA 1TW2A 1XGMA 4G6QA 2PFBA 3LA2A 3MWMA 4Y15A 1S6LA 3QU6A 5JI6A 4JBAA 2P6TA 3WGGA 2XKOA 5LGTA 4FX0A 2F2EA 1YW9A 2GXGA 5CVUA 1ZARA 2BE5F 2FA5A 1XDUA 1SFXA 2DK8A 4HV5A 1ZYRF 5FLXZ 3HIFA 2P5LC 2FOKA 2H6BA 2V1XA 2RN7A 2EFPA 1I5ZA 4S04A 1RI7A 4HA8A 1GVJA 4KA4A 2PEXA 4UV9A 4L9NA 2O3FA 3KZZA 4LLNA 2RNJA 3HYIA 2FQ3A 5HS9A 2MA3A 1ON1A 2RVCA 2EJRA 4HDUA 2O8XA 2BV6A 3LFKA 1I27A 5FD5A 1B9MA 5LHIA 4L5IA 2PI0A 4IRHA 3P9CA 4CXFA 3E6MA 1SMTA 3I58A 5LEKA 1HW2A 1LDKB 1J7KA 4U0WA 4P96A 2NNYA 4HF0A 4KYWA 1TQMA 2UXNA 3EUHA 4OIQF 4A12A 5D6FA 2IJLA 3HRTA 1DPRA 2W84A 2HEOA 4Y17A 4I02A 1YQAA 2EFQA 4N9IA 3SQNA 1Z91A 4EJWA 1IZ1A 1TNTA 2V79A 3R0JA 1STZA 4ESBA 2EV6A 4RB3C 4GYGA 1B9NA 3K1PA 2P7VB 1KYZA 2BEOA 4NQWA 4EJOA 5KK1A 1BI3A 3LAJA 3EETA 2CSOA 4O3MA 1IAWA 1ZHFA 3SHFA 4HX7A 1H9TA 3QPHA 3ZPLA 4IRIA 1X3UA 1FT9A 3ZN0A 4A5MA 3O6BB 4JK1X 1ON2A 4BHCA 5ILVA 2COMA 5D4SA 4M74A 3U2RA 3RYPA 1XGSA 2Z99A 3C1DA 4UVBA 1K78B 3L9FA 1I1GA 1DUXC 4U7BA 4G7ZF 3FHZA 3WU0A 1HSTA 1MJAA 5HLGA 2PBIA 4BAYA 2GAUA 5HOOA 4HV6A 1USSA 4KIBA 4OMYA 1MDMB 2A5YB 4I01A 4HZFA 1IN7A 4A2UA 2D1VA 4EMSA 1KU7A 1KQ0A 1J59A 4RGUA 3LQRA 2HFHA 1IRFA 2ZMEB 3HUGA 4CZZA 3CUQC 1XMAA 1O3SA 1IXCA 1W5SA 3BY6A 3HHHA 4ON0A 2PJPA 3J81K 2Z5UA 1XSXA 4EM0B 4I2OA 3QAHA 1U78A 1O3RA 3SZTA 3BDDA 2F5DA 2DBBA 3KE2A 2QYOA 5ICFA 1FLIA 3O2PE 1IXSB 2Z3YA 3TKYA 3MFKA 3IWZA 4ENJA 4PGGA 2O0YA 3R4KA 4KMUX 1GHCA 1ZGAA 1WRJA 1XDSA 3F8BA 5D5WB 2MLGA 3GZ5A 1K78A 5J6XA 4MHGA 2CYYA 2QENA 2ISYA 1BM9A 1ZGJA 1TLHB 4OIRF 2PMUA 1ZG3A 1AWCA 3R61A 2MLKA 4EGZA 5AONA 4WCGA 3QP6A 2FBKA 2EFWA 3F6OA 3TDUC 3JAMK 1D3YA 2IA0A 3KP2A 1QNTA 3I4PA 4YFKF 3AAFA 3GFIA 2AS5F 2ZKZA 5ILUA 2CW0F 4P5OA 3COAC 3TO6A 3H92A 1UFMA 2XHKA 1SD6A 3PQJA 4L18B 4HLXA 4PCQA 2JSCA 1XGOA 2A3SA 4IF4A 4CICA 4KMFA 3CO6C 2ZMEA 2M8EA 3MAJA 1FBSA 2HS5A 3IL2A 1SD4A 3T8RA 2K27A 3D0SA 1XCVA 3N4MA 1BI0A 3K0LA 1R1VA 4YFNF 2YX7A 5DCFA 3BROA 2TDXA 3ELKA 5LBQA 4Q5SF 3RJPA 3SXYA 4LLGF 4HQEA 2EWNA 2P8TA 2R7FA 2K4BA 2F5FA 1R58A 3I53A 3LWFA 1E2XA 2EFOA 5L3EA 2WC2A 2VBXA 2KRFA 3GLXA 2UXXA 3FXUA 5E8IA 5CYVA 1QZZA 1O7LA 4E70A 2K86A 2KIFA 3F8CA 1BBYA 2QZ8A 3GFMA 1PDNC 3HRSA 1ODDA 1FBQA 3E5QA 4CYDA 2D2WA 1O3QA 4R79A 3K9TA 3V7CA 3B73A 5BS6A 4L0ZB 4EM1A 4HX8A 3FZVA 5LHGA 2QWWA 5HLIA 1XD7A 1U3EM 1W5TA 4A6EA 1BC8C 3IWFA 3N97A 2DO7A 3BOQA 1TW3A 4LGWA 1ZG5A 1CF7A 3SFZA 1FYKA 4PZJA 1ZLJA 1R36A 3FMSA 3PQKA 5HVQC 2EV0A 1KA8A 2LSOA 3E97A 1UCRA 2XV4S 4M6XA 3DPTA 2CO5A 5LGNA 3DV8A 4ZZLA 3ECOA 2A61A 4H0EA 1G4DA 1B6AA 1FYMA 2IRFG 1R5HA 2RDPA 4HOBA 1PP8F 2ZXJA 2GWRA 2VBWA 4S05A 3C18A 4KN4X 4UXNA 2Q8KA 2VOOA 4GO1A 3FXQA 1USTA 2FMLA 2O61A 1KU9A 4KIFA 1TQIA 2OBPA 4BQAA 4LK1F 1JHFA 2KIUA 4HW0A 3C7JA 1YW8A 4U88A 1YS7A 4LB6B 1KYWA 3BJAA 2F5CA 2XKPA 2IPQX 3S2WA 1QGPA 5H20A 1QQIA 2WV0A 3HTSB 3WODF 2ELHA 5DYMA 2BGCA 4EQQA 5LEJA 4XLNF 3GUDA 2XAHA 3R6SA 1REPC 4RB0A 1SD7A 2W25A 1YG2A 4WWCA 2VE9A 4R1HA 4IXAA 1BI1A 1HQCA 1MZBA 4ENNA 4OMZA 5DDGA 1Y0UA 3VFZA 2KIMA 3GYHX 3I64A 2R7DA 2L02A 4EJUA 3FXRA 5EEGA 4UVCA 2RC4A 3GXOA 4UV8A 2D45A 3Q9SA 4XBFA 3JSOA 3E6DA 1XSVA 4IHTA 4AIKA 4DQ2A 4YIFA 3WE2A 4B8XA 2VBZA 5LRRA 2H6CA 4AVPA 5D8KB 5FGMA 2XUBA 4ENKA 3F21A 2W57A 1SAXA 2FNAA 2QBYA 2HKXA 3REOA 3F8FA 2OD5A 4U7DA 4CDGA 2DT5A 1BJAA 4EJTA 4MTEA 3IKTA 3EYYA 1U5TC 1MD0A 5ICEA 2Q0OA 4UUVA 2XASA 3KFWX 2E1NA 3TDZC 3J81Z 3FM3A 1RNLA 2ZNYA 1P4XA 3EQLF 2ZO4A 2V1UA 2P4WA 1U8RA 1J5YA 3HSRA 1KGSA 2R3SA 3GFJA 4M72A 3NQOA 1FSEA 4LFUA 1LJ9A 3VB2A 2CG4A 1OYYA 5K5RA 2A69F 4OINF 4MTDA 3T1BA 5CLSA 3TOAA 2DAOA 2RGVA 2X4HA 2MD5A 1T38A 2M45A 4M9XA 4RAZA 1ZH5A 3I54A 2VODA 2BBYA 2XVCA 4BHBA 4PGHA 5F64A 3IC7A 2XAGA 2C6YA 4RAYA 1UB9A 5EEHA 3ZP5A 1FOKA 3JAMZ 3WTUC 4YFXF 4RS8A 2YPRA 3WGIA 2DFIA 1XGNA 3GF2A 3HRMA 4AD9A 3RPQA 2K7LA 4KUMA 3WG9A 4G9YA 1ZRCA 3J80K 3F3XA 4ZZDA 2JPBA 1IW7F 1G3YA 4WXHA 3W6KB 4ASNA 2O03A 4MGRA 3ISPA 2UWMA 4A0YA 1WKMA 4EGYA 2M87A 1ZRFA 2AXLA 3MQ0A 1YLFA 2HYFA 2VN2A 2L54A 3ZMUA 2ACJA 1OKRA 3L09A 2FNPA 2FMYA 5IT3A 1R23A 1U5TA 2CQKA 1XMKA 3KLOA 1G3TA 5E1WA 4WXDA 4NB5A 2LKPA 3U9GA 2O6GE 1BIBA 4XSXF 2DPUA 4FX4A 1IN8A 2L01A 5F6FA 3GO5A 3RKYA 1FNNA 4JQFA 5HS8A 1P2FA 2XIGA 1D5VA 3U1DA 1K7AA 1B1BA 1I1SA 1SFUA 1LVAA 2ZJ2A 3Q9VA 1FC3A 2KJCA 1KQ9A 2HR3A 5L3CA 3G73A 2FXAA 1S29A 1KU3A 2VC0A 4F7ZA 4RGSA 3EDPA 5DCMA 3LAPA 4KICA 2OQGA 3KP4A 2HZTA 2UZKA 1MJBA 3M9AA 3RYRA 1R7JA 5K5OA 1HW5A 3DFGA 4GXOA 3F8NA 1J75A 3WTWC 2DQLA 3CUQB 2A6EF 1L3LA 4XRFA 4CHUA 3GX4X 2FU4A 2H27A 1LEAA 4O6JA 3HOTA 1T39A 2ISZA 4NHJA 3ML6A 2OAZA 2V1DA 2VONA 2EB7A 4PDKA 1L0OC 3R0AA 3F23A 1W7PA 2HQNA 5FFZA 2ETHA 2M5WA 3DP7A 5BPIA 5LHHA 5J8FA 4N0BA 4YIIA 3C3WA 1CF7B 4G8XA 5JFRA 3WU1B 1O7FA 4A0ZA 1SMYF 3RTRA 3QP5A 1FP2A 1LDJA 4XSZF 3T5XA 2DW4A 2FBHA 4Q48A 3F72A 4MQ9F 3TGNA 1H0MA 5F1RA 1FWZA 1TNSA 1MGTA 1QBJA 2E7XA 2MBFA 1ONVA 2NAZA 2DI3A 2V6CA 1JE8A 3CJNA 1FYLA 2XGXA 3P9IA 3DXJF 5DUIA 1F4KA 2K02A 1S3JA 1UHMA 4I98B 3IKVA 4OIOF 1G3SA 3KEQA 3CUQA 2PN6A 4LLLA 5HDNA 2XAFA 4M73A 3G3ZA 2MC3A 2J5PA 2IT0A 1YIOA 4AIHA 3NEUA 4I0BA 2G7UA 5JHUA 4WK8F 1D8JA 2VE8A 3GW2A 1TBXA 4L0YB 3VODA 2ZNZA 5A2QK 2FEZA 2KJBA 1R1UA 1LEBA 1YFHA 3KEOA 3V8KA 1FSHA 1SFEA 4QWQA 1WQ2A 5D6EA 3WTYC 4A5NA 3KP7A 2LF8A 5J8CA 4RGXA 2JRTA 2CWEA 2HWVA 3T0YA 1BN5A 4LK0F 1F9NA 4M9ZA 2XAQA 5AIQA 4LMYA 4LJZF 5LGUA 4IPAA 2JPCA 5FO5A 3K1NA 5ILSA 1XSDA 2XAJA 3IRRA 3RI4A 2XRNA 3O3KA 5HDKA 2QBYB 3BPVA 3RDIA 4GYIA 3K2ZA 2HKOA 4YG2F 2F5EA 2Q2EA 3FM5A 3GWZA 1P6RA 3RIRA 3E5UA 5BPDA 4KFCA 2OZ6A 1OYIA 5LRSA 3BPXA 1R22A 4EVIA 4G94A 4MEXF 1RZ4A 2MH9A 1UHWA 3F22A 5HDGA 1Z1DA 4M9SA 4AWXB 1GXQA 3R60A 2HTJA 4K2EA 4TV7A 3KP3A 3J80Z 1GXPA 5IT9K 4MEYF 3PFIA 1XCBA 2ZCWA 2Y0MA 1J2XA 1EH6A 1K79A 2A07F 1HKTA 3TO7A 1F1ZA 4IVNA 1U6GA 4EJVA 1P92A 2L4MA 2VXZA 3GZ6A 3ERED 4B09A 1QZYA 3V7RA 2DLLA 4EV0A 3P7NA 3LA3A 3SZPA 2QLZA 5L3DA 3JSPA 1WSUA 3Q5FA 1DDNA 2NNNA 4UNOA 3LQQA 4N9HA 5H6RA 2EA4A 5ICCA 2B0LA 3QOPA 4HF2A 4L9VA 3W6JB 2V9VA 1DP7P 2JTVA 2OQRA 2HYGD 1NHAA 3CLOA 2BYVE 3KP6A 3T8TA 4LD5A 3JTHA 4O5VA 2L4AA 3VOEA 2OA4A 2JT1A 3RPUA 4ESFA 5HLHA 2YR2A 3E3VA 1QO0D 4ETSA 5L3FA 2EV5A 1KU2A 4ESJA 3NRVA 2HGCA 1FZPB 4WX9A 2IVMA 2P5VA 2FSWA 2Y48A 1MKMA 3I59A 4MNUA 3JW4A 2P5KA 1IF1A 1U5TB 3ECHA 5L3GA 1ZAOA 3ZN1A 4KT5C 2DU9A 2VOPA 4Z2YA 3ZMZA 3V7SA 2J5OA 3KETA 1ZREA 3QU3A 1HKQA 2M1BA 3L00A 1RUNA 3CDHA 2DQRA 3D5LA 4U0YA 4IRGA 4A6DA 3P9KA 4GCVA 5ERIA 1IXRC 5E18F 4WXCA 3H3ZA 1LDDA 2L3DA 1YYVA 1RUOA 2HQRA 1BI2A 4FHTA 2G9WA 3DPLC 3KP5A 3FF5A 5CVJA 2ESHA 4L9TA 4RB1A 2E1CA 1TQPA 4WF2A 2D1HA 4U0VA 1F5TA 3HHGA 2CFXA 1Z7UA 3ABTA 5DCMB 4OU0A 5E17F 2RQPA 3RKWA 4G6DA 2E7WA 2FRHA 2GZWA 3BJOA 4HF1A 2ZBKA 4KDPA 1SD5A 4KIGA 3WTSC 2W24A 2GIVA 3I71A 3KLNA 1ZRDA 2JZYA 4OOIA 4DNCA 4Q47A 4M71A 2QVOA 3E5XA 1AOYA 5DD4A 3ZQ7A 1JHHA 4XLPF 3ZMDA 1OYWA 3HSEA 1O3TA 3V8LA 4LB5A 2GA1A 1W7PB 1G3WA 5ICGA 3DQVC 4HYEA 2PQ8A 2GXBA 5DEQA 5E8GA 4RB2C 1Z05A 2VC1A 3WGHA 5FB2A 3B02A 2LNBA 2P6SA 5JR3A 2QQAA 1EH8A 2HOEA 4HX4A 1Z6RA 1LQ1A 1EV7A 1HKSA 3V8JA 2MH2A 1ZN2A 3FWEA 5A2QZ 5JVTA 4P9FA 1P4WA 1ZG1A 2RV8A 4BHPA 1O57A 1R5GA 5D4RA 2EA2A 1J0RA 3L2CA 4HDVA 2QQBA 1PP7U 5CVVA 1HW1A 5D5VB 3ABUA 5FLXK 2Z33A 4MQVA 5ED4A 4UHTA 1I6XA 2LF7A 1OPCA 4GGGA 4HAMA 3HOSA 2IP2A 3BJ6A 6PAXA 3OV8A 4HQMA 3FMRA 4HLYA 4KN7X 1LNWA 1YTYA 1QPMA 2Y75A 5FD6A 1T0FA 4A0XA 1T6SA 1TTYA 1T98A 2W85A 1U2WA 5CVIA 5K1YA 4BXUA 5DV5A 2PLYA 1HXDA 5L3BA 1JXSA 4CGZA 3CTAA 1FP1D 1VTNC 4I09A 3V4GA 5IT9Z 4ZH4F 3FMQA 1A04A 2G7HA 5FFXA 3LSTA 3F8MA 2OU2A 2IA1A 4I7HA 5TRDA 1Z9CA 2P7CB 1YW7A 3H3UA 2CGPA 1CGPA 5E20A 1J9IA 1LB2A 1ULYA 3FX3A 3I0TA 3RKXA 4BYYA 1MDMA 1WWXA 3MZHA 4G7HF 2EFNA 3CO7C 2IA2A 2IW5A 4Q4ZF 3HSFA 4HBLA 1R1TA 2H09A 5LLQA 3TQNA 3J7AO 2ADUA 3E6BA 2XROA 2VT3A 3OOPA 2A68F 2VBYA 1OMIA 3HTUA 3BZ6A 3DKWA 3TO9A 4G7OF 2PG4A 5D8LB 2EK5A 1IN6A 3ULQB 4QLCU 3M8FA 1OR7A 4LG0B 5H6QA 1WI9A 2WWYA 4BNCA 2FF4A 1ZLKA 2QM3A 2GQQA 1DPUA 2PMHA 1IUYA 4L5JA 1B4AA 5TJJA 4Y13A 4CO8A 1W4MA 2X0LA 4AIJA 1S8NA 2H94A 1D8KA 2FE3A 3K69A 3K1MA 5DD8A 5E1ZB 1BC7C 5BQTA 2K4JA 3QPTA 3MEXA 1V3FA 3CUOA 2DPDA 4KNYA 3GEZA 5D5XB 3M8EA 1S7AA 3F6VA 2HTSA 1P4AA 3GVAA 4ZYHA 1KQ8A 3VEPA 3HRUA 4EM2A 4P55A 3KCCA 2YX4A 2NYXA 1YS6A 1G6NA 3LA7A 2STWA 2GA2A 3MCZA 3WTTC 1HBXG 2LDUA 4OIPF 2RKHA 3ZMVA 1IRGA 4L9JA 2FBIA 5CVRA 1FPQA 1FBUA 3L7WA 2WTEA 1H9GA 2ZFWA 3BWGA 3DF8A 1PUEE 1XB4A 5HS7A 3I5UA 1FY7A 4ENMA 2OZUA 4ZYDA 1BIAA 2STTA 1W7PD 3ROUA 5DUKA 4R8HA 1Z6TA 1K6OA 1R00A 4ZYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG0 A;  3BP8 A;  4ZYG A;  1T2K A;  3M7G A;  2HDC A;  5BOX A;  4IJA A;  2A6H F;  3I59 B;  3TOB A;  5CJ9 A;  3IRQ A;  3JTG A;  3DEU A;  1BOA A;  2Z9O A;  3WTZ A;  2QQ9 A;  1E17 A;  3WE3 A;  4P9U A;  3WTV C;  3QRF F;  2DTR A;  2M30 A;  5E1X A;  4FT8 A;  2KKO A;  2DK5 A;  1JGS A;  1IN4 A;  1IN5 A;  4M6Y A;  4RGR A;  3EYI A;  4IHS A;  3MZY A;  1FX7 A;  3KZY A;  3WTX C;  1RIO H;  1V4R A;  2YU3 A;  1YO5 C;  1XN7 A;  3E6C C;  1B59 A;  1C0W A;  5D5U B;  5KVR A;  2NS0 A;  2NRA C;  1Q1H A;  1HSJ A;  3M1E A;  4I0A A;  1EH7 A;  3GFL A;  4D0P A;  3ZMS A;  5AIP A;  4BH9 A;  3ZMT A;  2YSR A;  5K5Q A;  4UVA A;  1S7O A;  2QUF A;  2VT2 A;  1MJ9 A;  2ESN A;  5BMZ A;  3IHU A;  1TW2 A;  1XGM A;  4G6Q A;  2PFB A;  3LA2 A;  3MWM A;  4Y15 A;  1S6L A;  3QU6 A;  5JI6 A;  4JBA A;  2P6T A;  3WGG A;  2XKO A;  5LGT A;  4FX0 A;  2F2E A;  1YW9 A;  2GXG A;  5CVU A;  1ZAR A;  2BE5 F;  2FA5 A;  1XDU A;  1SFX A;  2DK8 A;  4HV5 A;  1ZYR F;  5FLX Z;  3HIF A;  2P5L C;  2FOK A;  2H6B A;  2V1X A;  2RN7 A;  2EFP A;  1I5Z A;  4S04 A;  1RI7 A;  4HA8 A;  1GVJ A;  4KA4 A;  2PEX A;  4UV9 A;  4L9N A;  2O3F A;  3KZZ A;  4LLN A;  2RNJ A;  3HYI A;  2FQ3 A;  5HS9 A;  2MA3 A;  1ON1 A;  2RVC A;  2EJR A;  4HDU A;  2O8X A;  2BV6 A;  3LFK A;  1I27 A;  5FD5 A;  1B9M A;  5LHI A;  4L5I A;  2PI0 A;  4IRH A;  3P9C A;  4CXF A;  3E6M A;  1SMT A;  3I58 A;  5LEK A;  1HW2 A;  1LDK B;  1J7K A;  4U0W A;  4P96 A;  2NNY A;  4HF0 A;  4KYW A;  1TQM A;  2UXN A;  3EUH A;  4OIQ F;  4A12 A;  5D6F A;  2IJL A;  3HRT A;  1DPR A;  2W84 A;  2HEO A;  4Y17 A;  4I02 A;  1YQA A;  2EFQ A;  4N9I A;  3SQN A;  1Z91 A;  4EJW A;  1IZ1 A;  1TNT A;  2V79 A;  3R0J A;  1STZ A;  4ESB A;  2EV6 A;  4RB3 C;  4GYG A;  1B9N A;  3K1P A;  2P7V B;  1KYZ A;  2BEO A;  4NQW A;  4EJO A;  5KK1 A;  1BI3 A;  3LAJ A;  3EET A;  2CSO A;  4O3M A;  1IAW A;  1ZHF A;  3SHF A;  4HX7 A;  1H9T A;  3QPH A;  3ZPL A;  4IRI A;  1X3U A;  1FT9 A;  3ZN0 A;  4A5M A;  3O6B B;  4JK1 X;  1ON2 A;  4BHC A;  5ILV A;  2COM A;  5D4S A;  4M74 A;  3U2R A;  3RYP A;  1XGS A;  2Z99 A;  3C1D A;  4UVB A;  1K78 B;  3L9F A;  1I1G A;  1DUX C;  4U7B A;  4G7Z F;  3FHZ A;  3WU0 A;  1HST A;  1MJA A;  5HLG A;  2PBI A;  4BAY A;  2GAU A;  5HOO A;  4HV6 A;  1USS A;  4KIB A;  4OMY A;  1MDM B;  2A5Y B;  4I01 A;  4HZF A;  1IN7 A;  4A2U A;  2D1V A;  4EMS A;  1KU7 A;  1KQ0 A;  1J59 A;  4RGU A;  3LQR A;  2HFH A;  1IRF A;  2ZME B;  3HUG A;  4CZZ A;  3CUQ C;  1XMA A;  1O3S A;  1IXC A;  1W5S A;  3BY6 A;  3HHH A;  4ON0 A;  2PJP A;  3J81 K;  2Z5U A;  1XSX A;  4EM0 B;  4I2O A;  3QAH A;  1U78 A;  1O3R A;  3SZT A;  3BDD A;  2F5D A;  2DBB A;  3KE2 A;  2QYO A;  5ICF A;  1FLI A;  3O2P E;  1IXS B;  2Z3Y A;  3TKY A;  3MFK A;  3IWZ A;  4ENJ A;  4PGG A;  2O0Y A;  3R4K A;  4KMU X;  1GHC A;  1ZGA A;  1WRJ A;  1XDS A;  3F8B A;  5D5W B;  2MLG A;  3GZ5 A;  1K78 A;  5J6X A;  4MHG A;  2CYY A;  2QEN A;  2ISY A;  1BM9 A;  1ZGJ A;  1TLH B;  4OIR F;  2PMU A;  1ZG3 A;  1AWC A;  3R61 A;  2MLK A;  4EGZ A;  5AON A;  4WCG A;  3QP6 A;  2FBK A;  2EFW A;  3F6O A;  3TDU C;  3JAM K;  1D3Y A;  2IA0 A;  3KP2 A;  1QNT A;  3I4P A;  4YFK F;  3AAF A;  3GFI A;  2AS5 F;  2ZKZ A;  5ILU A;  2CW0 F;  4P5O A;  3COA C;  3TO6 A;  3H92 A;  1UFM A;  2XHK A;  1SD6 A;  3PQJ A;  4L18 B;  4HLX A;  4PCQ A;  2JSC A;  1XGO A;  2A3S A;  4IF4 A;  4CIC A;  4KMF A;  3CO6 C;  2ZME A;  2M8E A;  3MAJ A;  1FBS A;  2HS5 A;  3IL2 A;  1SD4 A;  3T8R A;  2K27 A;  3D0S A;  1XCV A;  3N4M A;  1BI0 A;  3K0L A;  1R1V A;  4YFN F;  2YX7 A;  5DCF A;  3BRO A;  2TDX A;  3ELK A;  5LBQ A;  4Q5S F;  3RJP A;  3SXY A;  4LLG F;  4HQE A;  2EWN A;  2P8T A;  2R7F A;  2K4B A;  2F5F A;  1R58 A;  3I53 A;  3LWF A;  1E2X A;  2EFO A;  5L3E A;  2WC2 A;  2VBX A;  2KRF A;  3GLX A;  2UXX A;  3FXU A;  5E8I A;  5CYV A;  1QZZ A;  1O7L A;  4E70 A;  2K86 A;  2KIF A;  3F8C A;  1BBY A;  2QZ8 A;  3GFM A;  1PDN C;  3HRS A;  1ODD A;  1FBQ A;  3E5Q A;  4CYD A;  2D2W A;  1O3Q A;  4R79 A;  3K9T A;  3V7C A;  3B73 A;  5BS6 A;  4L0Z B;  4EM1 A;  4HX8 A;  3FZV A;  5LHG A;  2QWW A;  5HLI A;  1XD7 A;  1U3E M;  1W5T A;  4A6E A;  1BC8 C;  3IWF A;  3N97 A;  2DO7 A;  3BOQ A;  1TW3 A;  4LGW A;  1ZG5 A;  1CF7 A;  3SFZ A;  1FYK A;  4PZJ A;  1ZLJ A;  1R36 A;  3FMS A;  3PQK A;  5HVQ C;  2EV0 A;  1KA8 A;  2LSO A;  3E97 A;  1UCR A;  2XV4 S;  4M6X A;  3DPT A;  2CO5 A;  5LGN A;  3DV8 A;  4ZZL A;  3ECO A;  2A61 A;  4H0E A;  1G4D A;  1B6A A;  1FYM A;  2IRF G;  1R5H A;  2RDP A;  4HOB A;  1PP8 F;  2ZXJ A;  2GWR A;  2VBW A;  4S05 A;  3C18 A;  4KN4 X;  4UXN A;  2Q8K A;  2VOO A;  4GO1 A;  3FXQ A;  1UST A;  2FML A;  2O61 A;  1KU9 A;  4KIF A;  1TQI A;  2OBP A;  4BQA A;  4LK1 F;  1JHF A;  2KIU A;  4HW0 A;  3C7J A;  1YW8 A;  4U88 A;  1YS7 A;  4LB6 B;  1KYW A;  3BJA A;  2F5C A;  2XKP A;  2IPQ X;  3S2W A;  1QGP A;  5H20 A;  1QQI A;  2WV0 A;  3HTS B;  3WOD F;  2ELH A;  5DYM A;  2BGC A;  4EQQ A;  5LEJ A;  4XLN F;  3GUD A;  2XAH A;  3R6S A;  1REP C;  4RB0 A;  1SD7 A;  2W25 A;  1YG2 A;  4WWC A;  2VE9 A;  4R1H A;  4IXA A;  1BI1 A;  1HQC A;  1MZB A;  4ENN A;  4OMZ A;  5DDG A;  1Y0U A;  3VFZ A;  2KIM A;  3GYH X;  3I64 A;  2R7D A;  2L02 A;  4EJU A;  3FXR A;  5EEG A;  4UVC A;  2RC4 A;  3GXO A;  4UV8 A;  2D45 A;  3Q9S A;  4XBF A;  3JSO A;  3E6D A;  1XSV A;  4IHT A;  4AIK A;  4DQ2 A;  4YIF A;  3WE2 A;  4B8X A;  2VBZ A;  5LRR A;  2H6C A;  4AVP A;  5D8K B;  5FGM A;  2XUB A;  4ENK A;  3F21 A;  2W57 A;  1SAX A;  2FNA A;  2QBY A;  2HKX A;  3REO A;  3F8F A;  2OD5 A;  4U7D A;  4CDG A;  2DT5 A;  1BJA A;  4EJT A;  4MTE A;  3IKT A;  3EYY A;  1U5T C;  1MD0 A;  5ICE A;  2Q0O A;  4UUV A;  2XAS A;  3KFW X;  2E1N A;  3TDZ C;  3J81 Z;  3FM3 A;  1RNL A;  2ZNY A;  1P4X A;  3EQL F;  2ZO4 A;  2V1U A;  2P4W A;  1U8R A;  1J5Y A;  3HSR A;  1KGS A;  2R3S A;  3GFJ A;  4M72 A;  3NQO A;  1FSE A;  4LFU A;  1LJ9 A;  3VB2 A;  2CG4 A;  1OYY A;  5K5R A;  2A69 F;  4OIN F;  4MTD A;  3T1B A;  5CLS A;  3TOA A;  2DAO A;  2RGV A;  2X4H A;  2MD5 A;  1T38 A;  2M45 A;  4M9X A;  4RAZ A;  1ZH5 A;  3I54 A;  2VOD A;  2BBY A;  2XVC A;  4BHB A;  4PGH A;  5F64 A;  3IC7 A;  2XAG A;  2C6Y A;  4RAY A;  1UB9 A;  5EEH A;  3ZP5 A;  1FOK A;  3JAM Z;  3WTU C;  4YFX F;  4RS8 A;  2YPR A;  3WGI A;  2DFI A;  1XGN A;  3GF2 A;  3HRM A;  4AD9 A;  3RPQ A;  2K7L A;  4KUM A;  3WG9 A;  4G9Y A;  1ZRC A;  3J80 K;  3F3X A;  4ZZD A;  2JPB A;  1IW7 F;  1G3Y A;  4WXH A;  3W6K B;  4ASN A;  2O03 A;  4MGR A;  3ISP A;  2UWM A;  4A0Y A;  1WKM A;  4EGY A;  2M87 A;  1ZRF A;  2AXL A;  3MQ0 A;  1YLF A;  2HYF A;  2VN2 A;  2L54 A;  3ZMU A;  2ACJ A;  1OKR A;  3L09 A;  2FNP A;  2FMY A;  5IT3 A;  1R23 A;  1U5T A;  2CQK A;  1XMK A;  3KLO A;  1G3T A;  5E1W A;  4WXD A;  4NB5 A;  2LKP A;  3U9G A;  2O6G E;  1BIB A;  4XSX F;  2DPU A;  4FX4 A;  1IN8 A;  2L01 A;  5F6F A;  3GO5 A;  3RKY A;  1FNN A;  4JQF A;  5HS8 A;  1P2F A;  2XIG A;  1D5V A;  3U1D A;  1K7A A;  1B1B A;  1I1S A;  1SFU A;  1LVA A;  2ZJ2 A;  3Q9V A;  1FC3 A;  2KJC A;  1KQ9 A;  2HR3 A;  5L3C A;  3G73 A;  2FXA A;  1S29 A;  1KU3 A;  2VC0 A;  4F7Z A;  4RGS A;  3EDP A;  5DCM A;  3LAP A;  4KIC A;  2OQG A;  3KP4 A;  2HZT A;  2UZK A;  1MJB A;  3M9A A;  3RYR A;  1R7J A;  5K5O A;  1HW5 A;  3DFG A;  4GXO A;  3F8N A;  1J75 A;  3WTW C;  2DQL A;  3CUQ B;  2A6E F;  1L3L A;  4XRF A;  4CHU A;  3GX4 X;  2FU4 A;  2H27 A;  1LEA A;  4O6J A;  3HOT A;  1T39 A;  2ISZ A;  4NHJ A;  3ML6 A;  2OAZ A;  2V1D A;  2VON A;  2EB7 A;  4PDK A;  1L0O C;  3R0A A;  3F23 A;  1W7P A;  2HQN A;  5FFZ A;  2ETH A;  2M5W A;  3DP7 A;  5BPI A;  5LHH A;  5J8F A;  4N0B A;  4YII A;  3C3W A;  1CF7 B;  4G8X A;  5JFR A;  3WU1 B;  1O7F A;  4A0Z A;  1SMY F;  3RTR A;  3QP5 A;  1FP2 A;  1LDJ A;  4XSZ F;  3T5X A;  2DW4 A;  2FBH A;  4Q48 A;  3F72 A;  4MQ9 F;  3TGN A;  1H0M A;  5F1R A;  1FWZ A;  1TNS A;  1MGT A;  1QBJ A;  2E7X A;  2MBF A;  1ONV A;  2NAZ A;  2DI3 A;  2V6C A;  1JE8 A;  3CJN A;  1FYL A;  2XGX A;  3P9I A;  3DXJ F;  5DUI A;  1F4K A;  2K02 A;  1S3J A;  1UHM A;  4I98 B;  3IKV A;  4OIO F;  1G3S A;  3KEQ A;  3CUQ A;  2PN6 A;  4LLL A;  5HDN A;  2XAF A;  4M73 A;  3G3Z A;  2MC3 A;  2J5P A;  2IT0 A;  1YIO A;  4AIH A;  3NEU A;  4I0B A;  2G7U A;  5JHU A;  4WK8 F;  1D8J A;  2VE8 A;  3GW2 A;  1TBX A;  4L0Y B;  3VOD A;  2ZNZ A;  5A2Q K;  2FEZ A;  2KJB A;  1R1U A;  1LEB A;  1YFH A;  3KEO A;  3V8K A;  1FSH A;  1SFE A;  4QWQ A;  1WQ2 A;  5D6E A;  3WTY C;  4A5N A;  3KP7 A;  2LF8 A;  5J8C A;  4RGX A;  2JRT A;  2CWE A;  2HWV A;  3T0Y A;  1BN5 A;  4LK0 F;  1F9N A;  4M9Z A;  2XAQ A;  5AIQ A;  4LMY A;  4LJZ F;  5LGU A;  4IPA A;  2JPC A;  5FO5 A;  3K1N A;  5ILS A;  1XSD A;  2XAJ A;  3IRR A;  3RI4 A;  2XRN A;  3O3K A;  5HDK A;  2QBY B;  3BPV A;  3RDI A;  4GYI A;  3K2Z A;  2HKO A;  4YG2 F;  2F5E A;  2Q2E A;  3FM5 A;  3GWZ A;  1P6R A;  3RIR A;  3E5U A;  5BPD A;  4KFC A;  2OZ6 A;  1OYI A;  5LRS A;  3BPX A;  1R22 A;  4EVI A;  4G94 A;  4MEX F;  1RZ4 A;  2MH9 A;  1UHW A;  3F22 A;  5HDG A;  1Z1D A;  4M9S A;  4AWX B;  1GXQ A;  3R60 A;  2HTJ A;  4K2E A;  4TV7 A;  3KP3 A;  3J80 Z;  1GXP A;  5IT9 K;  4MEY F;  3PFI A;  1XCB A;  2ZCW A;  2Y0M A;  1J2X A;  1EH6 A;  1K79 A;  2A07 F;  1HKT A;  3TO7 A;  1F1Z A;  4IVN A;  1U6G A;  4EJV A;  1P92 A;  2L4M A;  2VXZ A;  3GZ6 A;  3ERE D;  4B09 A;  1QZY A;  3V7R A;  2DLL A;  4EV0 A;  3P7N A;  3LA3 A;  3SZP A;  2QLZ A;  5L3D A;  3JSP A;  1WSU A;  3Q5F A;  1DDN A;  2NNN A;  4UNO A;  3LQQ A;  4N9H A;  5H6R A;  2EA4 A;  5ICC A;  2B0L A;  3QOP A;  4HF2 A;  4L9V A;  3W6J B;  2V9V A;  1DP7 P;  2JTV A;  2OQR A;  2HYG D;  1NHA A;  3CLO A;  2BYV E;  3KP6 A;  3T8T A;  4LD5 A;  3JTH A;  4O5V A;  2L4A A;  3VOE A;  2OA4 A;  2JT1 A;  3RPU A;  4ESF A;  5HLH A;  2YR2 A;  3E3V A;  1QO0 D;  4ETS A;  5L3F A;  2EV5 A;  1KU2 A;  4ESJ A;  3NRV A;  2HGC A;  1FZP B;  4WX9 A;  2IVM A;  2P5V A;  2FSW A;  2Y48 A;  1MKM A;  3I59 A;  4MNU A;  3JW4 A;  2P5K A;  1IF1 A;  1U5T B;  3ECH A;  5L3G A;  1ZAO A;  3ZN1 A;  4KT5 C;  2DU9 A;  2VOP A;  4Z2Y A;  3ZMZ A;  3V7S A;  2J5O A;  3KET A;  1ZRE A;  3QU3 A;  1HKQ A;  2M1B A;  3L00 A;  1RUN A;  3CDH A;  2DQR A;  3D5L A;  4U0Y A;  4IRG A;  4A6D A;  3P9K A;  4GCV A;  5ERI A;  1IXR C;  5E18 F;  4WXC A;  3H3Z A;  1LDD A;  2L3D A;  1YYV A;  1RUO A;  2HQR A;  1BI2 A;  4FHT A;  2G9W A;  3DPL C;  3KP5 A;  3FF5 A;  5CVJ A;  2ESH A;  4L9T A;  4RB1 A;  2E1C A;  1TQP A;  4WF2 A;  2D1H A;  4U0V A;  1F5T A;  3HHG A;  2CFX A;  1Z7U A;  3ABT A;  5DCM B;  4OU0 A;  5E17 F;  2RQP A;  3RKW A;  4G6D A;  2E7W A;  2FRH A;  2GZW A;  3BJO A;  4HF1 A;  2ZBK A;  4KDP A;  1SD5 A;  4KIG A;  3WTS C;  2W24 A;  2GIV A;  3I71 A;  3KLN A;  1ZRD A;  2JZY A;  4OOI A;  4DNC A;  4Q47 A;  4M71 A;  2QVO A;  3E5X A;  1AOY A;  5DD4 A;  3ZQ7 A;  1JHH A;  4XLP F;  3ZMD A;  1OYW A;  3HSE A;  1O3T A;  3V8L A;  4LB5 A;  2GA1 A;  1W7P B;  1G3W A;  5ICG A;  3DQV C;  4HYE A;  2PQ8 A;  2GXB A;  5DEQ A;  5E8G A;  4RB2 C;  1Z05 A;  2VC1 A;  3WGH A;  5FB2 A;  3B02 A;  2LNB A;  2P6S A;  5JR3 A;  2QQA A;  1EH8 A;  2HOE A;  4HX4 A;  1Z6R A;  1LQ1 A;  1EV7 A;  1HKS A;  3V8J A;  2MH2 A;  1ZN2 A;  3FWE A;  5A2Q Z;  5JVT A;  4P9F A;  1P4W A;  1ZG1 A;  2RV8 A;  4BHP A;  1O57 A;  1R5G A;  5D4R A;  2EA2 A;  1J0R A;  3L2C A;  4HDV A;  2QQB A;  1PP7 U;  5CVV A;  1HW1 A;  5D5V B;  3ABU A;  5FLX K;  2Z33 A;  4MQV A;  5ED4 A;  4UHT A;  1I6X A;  2LF7 A;  1OPC A;  4GGG A;  4HAM A;  3HOS A;  2IP2 A;  3BJ6 A;  6PAX A;  3OV8 A;  4HQM A;  3FMR A;  4HLY A;  4KN7 X;  1LNW A;  1YTY A;  1QPM A;  2Y75 A;  5FD6 A;  1T0F A;  4A0X A;  1T6S A;  1TTY A;  1T98 A;  2W85 A;  1U2W A;  5CVI A;  5K1Y A;  4BXU A;  5DV5 A;  2PLY A;  1HXD A;  5L3B A;  1JXS A;  4CGZ A;  3CTA A;  1FP1 D;  1VTN C;  4I09 A;  3V4G A;  5IT9 Z;  4ZH4 F;  3FMQ A;  1A04 A;  2G7H A;  5FFX A;  3LST A;  3F8M A;  2OU2 A;  2IA1 A;  4I7H A;  5TRD A;  1Z9C A;  2P7C B;  1YW7 A;  3H3U A;  2CGP A;  1CGP A;  5E20 A;  1J9I A;  1LB2 A;  1ULY A;  3FX3 A;  3I0T A;  3RKX A;  4BYY A;  1MDM A;  1WWX A;  3MZH A;  4G7H F;  2EFN A;  3CO7 C;  2IA2 A;  2IW5 A;  4Q4Z F;  3HSF A;  4HBL A;  1R1T A;  2H09 A;  5LLQ A;  3TQN A;  3J7A O;  2ADU A;  3E6B A;  2XRO A;  2VT3 A;  3OOP A;  2A68 F;  2VBY A;  1OMI A;  3HTU A;  3BZ6 A;  3DKW A;  3TO9 A;  4G7O F;  2PG4 A;  5D8L B;  2EK5 A;  1IN6 A;  3ULQ B;  4QLC U;  3M8F A;  1OR7 A;  4LG0 B;  5H6Q A;  1WI9 A;  2WWY A;  4BNC A;  2FF4 A;  1ZLK A;  2QM3 A;  2GQQ A;  1DPU A;  2PMH A;  1IUY A;  4L5J A;  1B4A A;  5TJJ A;  4Y13 A;  4CO8 A;  1W4M A;  2X0L A;  4AIJ A;  1S8N A;  2H94 A;  1D8K A;  2FE3 A;  3K69 A;  3K1M A;  5DD8 A;  5E1Z B;  1BC7 C;  5BQT A;  2K4J A;  3QPT A;  3MEX A;  1V3F A;  3CUO A;  2DPD A;  4KNY A;  3GEZ A;  5D5X B;  3M8E A;  1S7A A;  3F6V A;  2HTS A;  1P4A A;  3GVA A;  4ZYH A;  1KQ8 A;  3VEP A;  3HRU A;  4EM2 A;  4P55 A;  3KCC A;  2YX4 A;  2NYX A;  1YS6 A;  1G6N A;  3LA7 A;  2STW A;  2GA2 A;  3MCZ A;  3WTT C;  1HBX G;  2LDU A;  4OIP F;  2RKH A;  3ZMV A;  1IRG A;  4L9J A;  2FBI A;  5CVR A;  1FPQ A;  1FBU A;  3L7W A;  2WTE A;  1H9G A;  2ZFW A;  3BWG A;  3DF8 A;  1PUE E;  1XB4 A;  5HS7 A;  3I5U A;  1FY7 A;  4ENM A;  2OZU A;  4ZYD A;  1BIA A;  2STT A;  1W7P D;  3ROU A;  5DUK A;  4R8H A;  1Z6T A;  1K6O A;  1R00 A;  4ZYE A; 
#chains in the Genus database with same CATH topology
 4LG0 A;  4XRS G;  3BP8 A;  4ZYG A;  4UY8 I;  1T2K A;  4M3D A;  3HC7 A;  4QTR A;  2OCC H;  3M7G A;  1OCC H;  1JI8 A;  2HDC A;  3CES A;  1A35 A;  1PJR A;  5BOX A;  4IJA A;  4C2T A;  1IUF A;  2A6H F;  3I59 B;  3TOB A;  5CJ9 A;  3BCB A;  3HXL A;  3IRQ A;  1JTY A;  3JTG A;  3DEU A;  1BOA A;  4IHV A;  3I4M J;  2Z9O A;  3WTZ A;  5FLV A;  2QQ9 A;  1E17 A;  3WE3 A;  4P9U A;  4M3B A;  3WTV C;  3QRF F;  3HGY A;  3CCJ I;  2DTR A;  2M30 A;  5E1X A;  4FT8 A;  2QKL B;  2KKO A;  3IAS 2;  1OCT C;  2DK5 A;  3AG3 H;  1VQN I;  5CKT A;  1JGS A;  1LVK A;  3PNV A;  3ZQF A;  1IN4 A;  4CSW A;  1IN5 A;  4E7S A;  4M6Y A;  2R7R A;  4RGR A;  4DJA A;  3EYI A;  1RPW A;  3MZY A;  1ZGW A;  2OUM A;  1FX7 A;  2JK3 A;  3KZY A;  3WTX C;  1YRN A;  4IHS A;  3RKQ A;  4BUP A;  1RIO H;  2JQ7 A;  3EUH C;  3ZQQ A;  1V4R A;  3OYB A;  2YU3 A;  4E7I A;  3AFH A;  1YO5 C;  1XN7 A;  4BS9 A;  3E6C C;  1HLV A;  3GTK J;  1B59 A;  4L5E A;  1LE8 B;  2EIK H;  1C0W A;  3S2H J;  5D5U B;  4MLO A;  5KVR A;  2ZC2 A;  3MD2 A;  1S72 I;  2NS0 A;  3GZN B;  2NRA C;  1OCP A;  3VPR A;  1MBH A;  1Q1H A;  1JUP A;  1U0J A;  1Q1V A;  2DMT A;  2Y9Y A;  5DM6 F;  2VJI A;  1HSJ A;  3M1E A;  4I0A A;  1EH7 A;  3GFL A;  1TT5 B;  4D0P A;  3ZMS A;  1G2H A;  5AIP A;  3JRH A;  2JUG A;  1JTX A;  2BW3 A;  4RLQ A;  4BH9 A;  3ZMT A;  2YSR A;  3MZ8 A;  3I55 I;  1VZ0 A;  4NUB A;  5K5Q A;  1W36 C;  4UVA A;  2PMZ N;  1TZL A;  1K61 A;  1S7O A;  2QUF A;  2VT2 A;  1A36 A;  2ME0 A;  1MJ9 A;  3QOD A;  4CYC B;  2ESN A;  4XKV A;  3HDD A;  5BMZ A;  4HEA 2;  4AYB A;  3IHU A;  1TW2 A;  1XGM A;  4G6Q A;  1W0T A;  3DLA A;  1ETV A;  2PFB A;  5GTH C;  2Q1Z B;  3PM1 A;  3LA2 A;  2JN6 A;  3MWM A;  2DT6 A;  4Y15 A;  3ZQH A;  1S6L A;  1A31 A;  1SFK A;  3QU6 A;  2JA5 J;  2HOA A;  2BY2 A;  5JI6 A;  1QZE A;  4JBA A;  4Y7N J;  2P6T A;  3WGG A;  2XKO A;  2W00 A;  2LYC A;  5LGT A;  4XM3 A;  4FX0 A;  2F2E A;  1O4X A;  1YW9 A;  3OYI A;  2GXG A;  1FOY A;  5M5Y J;  5CVU A;  2OJE D;  1ZAR A;  2BE5 F;  2FA5 A;  1Z67 A;  1XDU A;  1SFX A;  2DK8 A;  4HV5 A;  1ZYR F;  3H9G A;  5FLX Z;  3HIF A;  2P5L C;  1VQK I;  1MMG A;  2FOK A;  2H6B A;  4RM3 A;  3OYA A;  2X6W A;  3CC4 I;  1GDT A;  2V1X A;  3H9Q A;  2RN7 A;  2EFP A;  1I5Z A;  3PUF A;  4S04 A;  1X19 A;  1RI7 A;  4HA8 A;  1GVJ A;  4KA4 A;  2LOO A;  2PEX A;  2ZJP F;  4UV9 A;  4L9N A;  2O3F A;  3KZZ A;  4LLN A;  2RNJ A;  2KDO A;  2FQ3 A;  3HYI A;  1VQO I;  5HS9 A;  1DU0 A;  2MA3 A;  2WAD A;  1ON1 A;  2EH3 A;  1XX5 A;  2O5R A;  3TP3 A;  2RVC A;  2CV0 A;  2EJR A;  3J7Z I;  4HDU A;  2O8X A;  2BV6 A;  3HB9 A;  3NWS A;  4M3E A;  2M0C A;  3LFK A;  1I27 A;  1DP3 A;  5FD5 A;  4I6Z A;  1B9M A;  3H0D A;  4XKW A;  5LHI A;  4IZZ A;  4L5I A;  4XOT A;  2PI0 A;  2NOJ B;  4IRH A;  1UG0 A;  3OY9 A;  1LE8 A;  3P9C A;  3PSF A;  1E3H A;  4CXF A;  1ZR2 A;  3E6M A;  1SMT A;  3I58 A;  5LEK A;  1HW2 A;  1LDK B;  1J7K A;  5B5E C;  2Y0S A;  4U0W A;  4P96 A;  3KEY A;  4XK4 A;  1DGR M;  2NNY A;  4HF0 A;  4NC6 A;  2E1O A;  3OS0 A;  4KYW A;  1TQM A;  4BQQ A;  3K4J A;  2UXN A;  3EUH A;  1ENH A;  3JRB A;  4BXF A;  3OS2 A;  1VQ6 I;  4OIQ F;  1LPQ A;  4A12 A;  5D6F A;  2IJL A;  1YJW I;  2BXZ A;  3HRT A;  3HGG A;  4Z6Y A;  1UMQ A;  4B44 A;  1DPR A;  2NVT J;  4CYC A;  5C3E J;  2W84 A;  4BJ6 C;  1WPK A;  2CUF A;  4FAS D;  3CCY A;  2HEO A;  3HUG B;  5EDN A;  3DKX A;  1QU3 A;  4Y17 A;  4I02 A;  4FE4 A;  2AXT C;  1YQA A;  2EFQ A;  4N9I A;  5EZG A;  3S3M A;  3SQN A;  3C2G A;  1G59 A;  1Z91 A;  4EJW A;  1IZ1 A;  1TNT A;  2V79 A;  3M07 A;  4FET A;  2CU7 A;  2KHM A;  3OYJ A;  3R0J A;  1STZ A;  3G1L A;  2NXN B;  2F4M B;  4ESB A;  2EV6 A;  4RB3 C;  4GYG A;  2LMD A;  1B9N A;  3K1P A;  3BR1 A;  3CMY A;  2P7V B;  1NH3 A;  1KYZ A;  2BEO A;  4NQW A;  4Y3O A;  4EJO A;  4Y4R A;  3W3C A;  5KK1 A;  1BI3 A;  3LAJ A;  3EET A;  3DU5 A;  2CSO A;  4O3M A;  1ETY A;  1IAW A;  2DA4 A;  1ZHF A;  2L7F P;  3SHF A;  4HX7 A;  1H9T A;  3QPH A;  3ZPL A;  4IRI A;  1X3U A;  1FT9 A;  2Y9Z A;  2HXO A;  3ZN0 A;  2LY9 A;  4ZDL A;  3OYH A;  3VDX A;  4A5M A;  4HG2 A;  3O6B B;  4JK1 X;  1ON2 A;  4BHC A;  2CS3 A;  5ILV A;  1A5J A;  1ETX A;  2COM A;  5D4S A;  3CP2 A;  1E3O C;  4M74 A;  1SAU A;  3U2R A;  2JA7 J;  3RYP A;  1XGS A;  2Z99 A;  3C1D A;  4UVB A;  2DT7 B;  1K78 B;  3L9F A;  2E35 A;  4OAZ A;  3AG1 H;  1I1G A;  1P7J A;  5DS9 A;  5IPA A;  1DUX C;  4U7B A;  3KPH A;  4G7Z F;  3FHZ A;  5F08 A;  3WU0 A;  4D1Q A;  3O8G A;  3AL0 C;  3KX2 A;  5E3L A;  1HST A;  1TWH J;  1AHD P;  2ZME C;  1BOB A;  1MJA A;  5HLG A;  1S7E A;  2PBI A;  3HBL A;  3Q0V A;  4BAY A;  2GAU A;  5EYR A;  3RPU D;  5HOO A;  2L9S A;  1USS A;  4HV6 A;  4KIB A;  1K83 J;  2PJR B;  4OMY A;  1MDM B;  2A5Y B;  3PSI A;  1RKW A;  3CC7 I;  5IY5 H;  1LKX A;  2OTJ I;  4I01 A;  3I4N J;  1X58 A;  4HZF A;  5GTI C;  1IN7 A;  4A2U A;  1WJD A;  3HM5 A;  2D1V A;  4EMS A;  1KU7 A;  1X4P A;  1KQ0 A;  1J59 A;  2XB0 X;  2XC7 A;  2I10 A;  4AYB N;  4RGU A;  2NS7 A;  3LQR A;  2JUC A;  2RRE A;  1SC7 A;  2HFH A;  4A69 C;  1MBJ A;  1IRF A;  2ZME B;  2W7N A;  3HUG A;  4CZZ A;  5B1B H;  3H9J A;  1MMA A;  2VL8 A;  4LIT A;  4QPQ A;  3CUQ C;  1XMA A;  1O3S A;  2QA4 I;  1IXC A;  1WJF A;  2ECC A;  2P0W A;  1W5S A;  3M3Y J;  3BY6 A;  3HHH A;  4ON0 A;  5GAE J;  1MW7 A;  2PJP A;  3J81 K;  2NVU B;  3QPS A;  1SVO A;  2Z5U A;  1XSX A;  1D1C A;  2H1K A;  1PYV A;  1FJL A;  4EM0 B;  3H5A A;  3OS1 A;  4I2O A;  1A6Q A;  3QAH A;  1U78 A;  2BHY A;  2G0E A;  2F5V A;  1O3R A;  1Y8Q B;  3SZT A;  1VFC A;  3BDD A;  3VYS B;  2F5D A;  4PJL A;  2DTZ A;  2DBB A;  3KE2 A;  4F3Q A;  2QYO A;  3K2A A;  5ICF A;  1FLI A;  2R7W A;  2R7O A;  5J47 A;  3O2P E;  1IXS B;  2Z3Y A;  3HEF A;  3TKY A;  3MFK A;  3GLL A;  2QEX I;  2M4K A;  2DA2 A;  3IWZ A;  4ENJ A;  3GTJ J;  3W6V A;  2VKE A;  4PGG A;  1LFB A;  1MBF A;  5HOD A;  2O0Y A;  3R4K A;  4KMU X;  1GHC A;  1ZGA A;  3SDG A;  1YJN I;  1WRJ A;  1XDS A;  2BY0 A;  2R92 J;  3F8B A;  2BOL A;  3H0G J;  1TWA J;  2QSG X;  5D5W B;  2MLG A;  3GZ5 A;  1K78 A;  2LR8 A;  4MHG A;  4DYQ A;  5J6X A;  4ZTF A;  2CYY A;  2QEN A;  2ISY A;  3IH4 A;  1BM9 A;  3OMY A;  1VQ4 I;  1ZGJ A;  4EEF G;  2K9M A;  4D9J A;  1H8A C;  1TLH B;  1J09 A;  4OIR F;  1EJ9 A;  1QVT A;  3KZI C;  3QPL A;  4F55 A;  2PMU A;  4KIT B;  1ZG3 A;  1GV5 A;  1V5F A;  1AWC A;  3R61 A;  2DA1 A;  2MLK A;  4DIQ A;  4EGZ A;  2X51 A;  3DKY A;  1IV8 A;  5AON A;  4WCG A;  3QP6 A;  3W2A A;  2FBK A;  2CW8 A;  2EFW A;  5C4X J;  3S16 J;  2BY1 A;  2QSF X;  3F6O A;  3TDU C;  1YI2 I;  4XRM A;  3OL3 A;  3DU6 A;  3JAM K;  1D3Y A;  3CME I;  2IA0 A;  3KP2 A;  2DYR H;  4FIS A;  2YS9 A;  1FTZ A;  2CQ7 A;  2AHQ A;  1QNT A;  2CUJ A;  3I4P A;  3FXL A;  4YFK F;  3AAF A;  3GFI A;  2AS5 F;  2ZKZ A;  2KLO A;  5ILU A;  2CW0 F;  4P5O A;  3TO6 A;  3JRA A;  3COA C;  3H92 A;  3S17 J;  1UFM A;  2FD5 A;  2XHK A;  4G12 A;  1SD6 A;  4B1R A;  2EBI A;  3PQJ A;  4L18 B;  4HLX A;  4PCQ A;  3CJQ B;  2OCE A;  2JSC A;  1N25 A;  1XGO A;  2A3S A;  4IF4 A;  4BQO A;  4CIC A;  3S3O A;  3FKJ A;  4KMF A;  2ZME A;  3MAJ A;  2M8E A;  3CO6 C;  1FBS A;  4IQJ A;  2HS5 A;  3IL2 A;  4PJN A;  1SD4 A;  3T8R A;  1WJC A;  2K27 A;  2GOX B;  3D0S A;  1XCV A;  3N4M A;  2LK2 A;  1BW6 A;  1BI0 A;  3K0L A;  4X0G A;  5FKM A;  1R1V A;  4G6T B;  4YFN F;  3QWL A;  1TWF J;  2YX7 A;  3E1S A;  5DCF A;  4NNJ A;  3BRO A;  2TDX A;  3ELK A;  2VJJ A;  4PSX A;  3JRE A;  5LBQ A;  4PJJ A;  3VSK A;  4Q5S F;  1FTT A;  3ONQ A;  3RJP A;  2IAI A;  3SXY A;  4LLG F;  5F0F A;  2O8K A;  3FK6 A;  3X2Q H;  4E7H A;  4HQE A;  2MGQ A;  2EWN A;  1KON A;  2P8T A;  2R7F A;  5JVG F;  2K4B A;  2F5F A;  4UUT A;  2EIN H;  1R58 A;  5LFA A;  3I53 A;  3LWF A;  2E2I J;  4XRS A;  4PSW A;  3DBH B;  1E2X A;  2HOT A;  4ZDP A;  1UAA A;  3M8J A;  2EFO A;  1X3W B;  2DN0 A;  5L3E A;  2WC2 A;  3WU2 C;  2VBX A;  2KRF A;  3GLX A;  5GPC A;  4RBO A;  2UXX A;  3FXU A;  4PJ0 C;  5E8I A;  5CYV A;  1QZZ A;  3DTI A;  2DOF A;  1O7L A;  3K4C A;  1VQ7 I;  3GTQ J;  3HPH A;  4E70 A;  2K86 A;  2KIF A;  3BG7 A;  3CF5 F;  1NK2 P;  3F8C A;  1BBY A;  4I76 A;  2QZ8 A;  2XSD C;  3S1N J;  3GFM A;  1PDN C;  3HRS A;  3OIO A;  1ODD A;  1UJ8 A;  1FBQ A;  3E5Q A;  4CYD A;  2D2W A;  1O3Q A;  4R79 A;  3K9T A;  3V7C A;  2R5Y A;  1POG A;  4XOR A;  3A02 A;  3B73 A;  1YRN B;  2CH0 A;  2KRC A;  3S8P A;  3CP8 A;  2UUZ A;  5BS6 A;  4L0Z B;  4EM1 A;  3NWT A;  1BW5 A;  4HX8 A;  2R7V A;  3FZV A;  3LSH A;  5LHG A;  2DFH A;  2ZXW H;  2QWW A;  5HLI A;  5GAD J;  1XD7 A;  2XB5 A;  3WHB A;  1U3E M;  1ZKG A;  3SZG A;  3PIO F;  3TW6 A;  1W5T A;  3CQZ J;  4BJT A;  4XID A;  2MC4 A;  3G2B A;  4A6E A;  1BC8 C;  3IWF A;  4H4K C;  3N97 A;  5JHF A;  2DO7 A;  3BOQ A;  1TW3 A;  4LGW A;  1VQ9 I;  1ZG5 A;  1NG6 A;  1CF7 A;  1OCO H;  3OR2 C;  1RKT A;  3HOV J;  2K5C A;  2KMU A;  2VQL A;  3K4L A;  3SFZ A;  1Y8R B;  1FYK A;  4PZJ A;  1Z7L A;  1ZLJ A;  2EIM H;  2A6T A;  4NBQ A;  1R36 A;  3OYG A;  3FMS A;  3PQK A;  2TRT A;  5HVQ C;  3PNT A;  2DMN A;  2EV0 A;  1KA8 A;  2LSO A;  3E97 A;  4PJM A;  1IC8 A;  1UCR A;  2XV4 S;  4M6X A;  3DPT A;  2CO5 A;  1W5C C;  5LGN A;  3DV8 A;  4JX6 A;  4ZZL A;  1RRJ A;  2ZXI A;  2A61 A;  2V1N A;  3ECO A;  4H0E A;  2F48 A;  4F93 B;  1G4D A;  3FBI B;  2LTP A;  1B6A A;  1XMX A;  1FYM A;  5K7H A;  2IRF G;  1R5H A;  2RDP A;  5J40 A;  1Z21 A;  4HOB A;  1PP8 F;  4J19 A;  1HOM A;  2ZXJ A;  2GWR A;  2VBW A;  4BJ5 C;  2L9V A;  4S05 A;  3C18 A;  2B7E A;  3F0C A;  4KN4 X;  4UXN A;  2Q8K A;  2VOO A;  4GO1 A;  2W1O A;  2DYS H;  4F92 B;  2E5N A;  4DGW B;  3FXQ A;  1QRY A;  3C2H A;  3WHC A;  2X1E A;  1UST A;  2FML A;  2O61 A;  1KU9 A;  1IDY A;  4KIF A;  1TQI A;  2OBP A;  4BQA A;  4LK1 F;  1JHF A;  4OAY A;  2KIU A;  4HW0 A;  4BBS J;  3C7J A;  1YW8 A;  3BZK A;  4U88 A;  1YS7 A;  1K4S A;  4LB6 B;  1KYW A;  3BJA A;  2F5C A;  2XKP A;  2IPQ X;  3S2W A;  2R7X A;  3BQZ A;  2HNH A;  2JJ7 A;  1YX3 A;  1QGP A;  3HOU J;  1TL8 A;  3S93 A;  5JLX A;  5H2F C;  1R9T J;  5H20 A;  1GT0 C;  2KIS A;  2FJ1 A;  4XLH A;  1QQI A;  2WV0 A;  3SEZ A;  3HTS B;  1Z3Y A;  1MMS A;  3WOD F;  2ELH A;  4RMN A;  4NDL A;  1MSF C;  3OWT A;  3E0J B;  5DYM A;  2LLK A;  4B3A A;  2BGC A;  1N75 A;  3A4C A;  3DPU A;  1ETQ A;  4EQQ A;  5LEJ A;  4XLN F;  4C30 A;  3GUD A;  2XAH A;  1AKH B;  4CCN A;  3R6S A;  1REP C;  3SJM A;  3TED A;  2KIQ A;  4RB0 A;  1FEX A;  1SD7 A;  3VYU B;  1FMV A;  3I56 I;  2W25 A;  1YG2 A;  4WWC A;  1JKQ C;  5IYB J;  2VE9 A;  2VKH A;  3BR3 A;  4CCO A;  4R1H A;  3BR5 A;  4IXA A;  1BI1 A;  1HQC A;  2IGK A;  1TWC J;  1MZB A;  4ENN A;  2YU9 J;  2IGN A;  2XF6 A;  4OMZ A;  5DDG A;  2MAB A;  2F4O B;  2TCT A;  1IRX A;  1Y0U A;  3VFZ A;  3S14 J;  2KIM A;  1BJZ A;  3GYH X;  4HNV A;  3I64 A;  1I6H J;  2R7D A;  2R0Q C;  2L02 A;  4EJU A;  3FXR A;  5EEG A;  1WJB A;  4UVC A;  2RC4 A;  4IKF A;  3GXO A;  4UV8 A;  2D45 A;  3Q9S A;  4XBF A;  3JSO A;  3E6D A;  1XSV A;  4IHT A;  4AIK A;  1TP4 A;  4M3G A;  4DQ2 A;  4YIF A;  3WE2 A;  4B8X A;  1K6Y A;  1OFC X;  3W2V A;  4QSH A;  1BR2 A;  2ME6 A;  5J4Y A;  2VBZ A;  2IS6 A;  5LRR A;  3RZO J;  2H6C A;  4AVP A;  5KAI C;  5D8K B;  4C3I J;  2HPI A;  5FGM A;  4E4H A;  2WAE A;  2XUB A;  2KFD A;  1D5Y A;  5TIS C;  1XPX A;  4IOA F;  4ENK A;  2K3P A;  4W1U A;  4XLA A;  3F21 A;  2W57 A;  1SAX A;  3FK7 A;  5GPA A;  2FNA A;  2QBY A;  2HKX A;  3REO A;  2LBF A;  4I99 C;  3F8F A;  5J4V A;  5IP7 J;  2OD5 A;  2FUG 2;  4AVZ A;  2ICW G;  4CDG A;  4U7D A;  2DT5 A;  5KHD A;  1WFX A;  1BJA A;  2BVL A;  3OSF A;  4EJT A;  2WBM A;  4E7J A;  3K70 D;  4MTE A;  2B9S A;  2JA2 A;  1TC3 C;  3IKT A;  3K4B A;  4V2F A;  3EYY A;  4NQW B;  4YIR X;  1U5T C;  1E3P A;  2DCE A;  2DJN A;  1MD0 A;  1BA5 A;  2VAS A;  5ICE A;  5FRN A;  3DEW A;  2Q0O A;  2I8D A;  4UUV A;  2XAS A;  1VQ5 I;  2XPU A;  3CJT B;  3KFW X;  2E1N A;  4IL6 C;  3TDZ C;  3J81 Z;  3FM3 A;  1WZ2 A;  2CUE A;  1RNL A;  1Z3X A;  4MIM A;  2ZNY A;  4V19 K;  2WY8 Q;  3CZ6 A;  1P4X A;  3EQL F;  1JGG A;  2ZO4 A;  2V1U A;  2P4W A;  1U8R A;  1J5Y A;  2X85 A;  3HSR A;  2L9N A;  1KGS A;  5IP6 A;  3G6E I;  3CC2 I;  2R3S A;  1AKH A;  3GFJ A;  2EIJ H;  4M72 A;  3NQO A;  1FSE A;  4LFU A;  1LJ9 A;  3DCF A;  3KYC B;  5FKO A;  3QOE A;  3LSI A;  3VB2 A;  2CG4 A;  1OYY A;  4XQF A;  5F0H A;  2A69 F;  5K5R A;  4IHY A;  1X2M A;  2KP6 A;  1YHQ I;  4OWR B;  4OIN F;  1T56 A;  4MTD A;  1P9Q C;  1D0Z A;  3T1B A;  5CLS A;  3TOA A;  2DAO A;  2RGV A;  4PK4 A;  1WJE A;  2MD5 A;  2X4H A;  1T38 A;  3NAR A;  2XGC A;  2M45 A;  3GTG J;  2K9Q A;  4M9X A;  4RAZ A;  3OYM A;  4IHW A;  1ZH5 A;  1WVR A;  4MFE A;  3I54 A;  2M34 A;  2VOD A;  2MFZ A;  2BBY A;  2IS4 A;  4II3 A;  1MBG A;  2XVC A;  4BHB A;  4PGH A;  4J00 A;  5F64 A;  2DA6 A;  3IC7 A;  3QQA A;  2XAG A;  2C6Y A;  1EKE A;  4RAY A;  1EA3 A;  1X1D A;  1UB9 A;  3SFI A;  3TW7 A;  4BEH A;  4XL9 A;  2BXY A;  1ACI A;  5EEH A;  3ZP5 A;  1T8I A;  5EGO A;  1FOK A;  4B3X A;  3JAM Z;  4DOZ A;  1YJ9 I;  3WTU C;  2VPL A;  2A05 A;  4YFX F;  4RS8 A;  2YPR A;  3WGI A;  4ZTJ A;  2HDD A;  4A3M J;  5GAH J;  2DFI A;  1JUS A;  1XGN A;  2V26 A;  2XDV A;  3GF2 A;  1BR4 A;  3HRM A;  3RPQ A;  4AD9 A;  2K7L A;  4KUM A;  3WG9 A;  4C2U A;  2JVH A;  4G9Y A;  1ZRC A;  3J80 K;  3F3X A;  5FJ8 J;  4JOM A;  4CA0 A;  3D1N I;  2K9N A;  4ZZD A;  2M2E A;  2JPB A;  4A3G J;  1IW7 F;  1G3Y A;  4WXH A;  2VIX A;  3W6K B;  4ASN A;  3DBR B;  1ETW A;  4B47 A;  3GTM J;  3U1K A;  3BCA A;  3ZQL A;  2O03 A;  4MGR A;  3ISP A;  2UWM A;  3OSG A;  3HPG A;  4A0Y A;  1R49 A;  3JRC A;  2VLA A;  2KZG A;  1WKM A;  2VPR A;  4EGY A;  1IG7 A;  3S15 J;  5DTD A;  2M87 A;  4XON A;  1U8B A;  1ZRF A;  3MKY B;  2AXL A;  2CUZ A;  3MQ0 A;  1YLF A;  2HYF A;  2JVG A;  3Q3S A;  4XIC A;  4XLC A;  2ELK A;  2L54 A;  2VN2 A;  3E7L A;  3ZMU A;  2F4I A;  2ACJ A;  1OKR A;  1OCZ H;  3L09 A;  2FNP A;  2FMY A;  5IT3 A;  1R23 A;  2Z16 A;  3ABL H;  2NVY J;  5IP9 J;  1U5T A;  2CQK A;  1XMK A;  1G8X A;  2XPW A;  3KLO A;  4W97 A;  1G3T A;  5E3N A;  2KRH A;  3CDI A;  5E1W A;  4D7N A;  4WXD A;  3G4S I;  3D5S C;  4NB5 A;  2LKP A;  3H3V K;  3U9G A;  2O6G E;  1BIB A;  4XSX F;  3LMM A;  1WJ5 A;  2V9P A;  4FX4 A;  2DPU A;  2W4S A;  1JKP C;  4RLF A;  1IN8 A;  1H89 C;  2L01 A;  2OC6 A;  3CDL A;  5C44 J;  3CCS I;  4J01 A;  5F6F A;  3GO5 A;  1QVU A;  2HZD A;  2Z1D A;  4BBR J;  3RKY A;  2V7F A;  1FNN A;  3CF2 A;  4JQF A;  5HS8 A;  1P2F A;  1VQ8 I;  3G1O A;  2KZV A;  3OYC A;  2XIG A;  1D5V A;  2DA5 A;  3SEQ A;  3AKZ A;  1VQL I;  3U1D A;  1W1W E;  3VYR B;  2O9L A;  1K7A A;  1B1B A;  3P5J A;  1I1S A;  3OYD A;  1SFU A;  1LVA A;  4BL0 B;  2HQ5 A;  2ZJ2 A;  4IO9 F;  3Q9V A;  1QA6 A;  2CQX A;  1ETO A;  1FC3 A;  1FIA A;  2KJC A;  3GCM A;  4Y33 A;  4XMY A;  3AL0 B;  2R5Z A;  1KQ9 A;  3MKL A;  1S9H A;  2HR3 A;  3A03 A;  2OF7 A;  5L3C A;  2MW8 A;  3G73 A;  3OR1 C;  2HU9 A;  2FXA A;  1S29 A;  1X1P A;  1KU3 A;  2VC0 A;  5EF6 A;  4YEL A;  2V6E A;  4F7Z A;  1I39 A;  3V42 A;  4RGS A;  2HYJ A;  3EDP A;  5DCM A;  3LAP A;  4KIC A;  2OQG A;  3KP4 A;  4XNF A;  5CQE A;  4X6A J;  2X48 A;  1B8I A;  2L5Q A;  2HZT A;  2EZH A;  3IP4 B;  1X4O A;  1IJW C;  1A6I A;  4C9Y A;  2UZK A;  2Y2Z A;  2ZSH B;  2WAF A;  3J7Y J;  4BQN A;  1MJB A;  3M9A A;  1WJA A;  3RYR A;  1R7J A;  5K5O A;  2IS2 A;  1D1B A;  1HW5 A;  2ECB A;  3DFG A;  5IYC J;  4GXO A;  2LKX A;  3F8N A;  4ZJZ A;  5B1A H;  1J75 A;  3WTW C;  2WB1 A;  3QYB A;  2DQL A;  3CUQ B;  2A6E F;  5M3M J;  4GRI A;  1L3L A;  2OTL I;  1SAN A;  3K4K A;  5GP9 A;  3DTE A;  4XRF A;  4A3F J;  4CHU A;  3GX4 X;  2FU4 A;  2H27 A;  4UUS A;  1LEA A;  4O6J A;  3HOT A;  2LG4 A;  1GUU A;  1HDP A;  1T39 A;  2ISZ A;  3K70 C;  4NHJ A;  3ML6 A;  2VB6 A;  2M4G A;  2LP0 A;  5E3M A;  2OAZ A;  2V1D A;  3I3L A;  2R5Y B;  2LFB A;  4ITV A;  4RAF A;  2VON A;  2EB7 A;  4PDK A;  1L0O C;  4IQ4 A;  3R0A A;  1OJL A;  3DWL E;  4QIW N;  3F23 A;  1W7P A;  3CCM I;  2GXA A;  1I50 J;  3HG9 A;  2HQN A;  3BR2 A;  4DBR A;  5FFZ A;  2ETH A;  2M5W A;  2K9L A;  2Y0S N;  3DP7 A;  3LOC A;  3HZJ A;  4ZC3 A;  5BPI A;  5LHH A;  1MND A;  5J8F A;  2E19 A;  5FLM J;  3S32 A;  3RSN A;  4N0B A;  3FXJ A;  4YII A;  3C3W A;  1MMD A;  2K85 A;  4HPQ A;  1CF7 B;  4G8X A;  5JFR A;  3WU1 B;  1JKO C;  1O7F A;  2JRM A;  2NVQ J;  4A0Z A;  4BE1 A;  1SMY F;  4JX4 A;  3RTR A;  2O7O A;  3QP5 A;  1FP2 A;  1LDJ A;  4XSZ F;  5FKN A;  3T5X A;  2DW4 A;  2FBH A;  4Q48 A;  5B66 C;  2X6Y A;  4C3H J;  3H1C A;  3F72 A;  5F27 A;  3TP0 A;  4MQ9 F;  3TGN A;  1H0M A;  4A3E J;  5F1R A;  1FWZ A;  1TNS A;  3S2D J;  1MGT A;  1QBJ A;  2E7X A;  1FIP A;  2MBF A;  4DBQ A;  1ONV A;  2BY3 A;  3BG9 A;  4NC8 A;  2NAZ A;  2DI3 A;  2DOE A;  2V6C A;  1JE8 A;  3CJN A;  3EUK L;  2QQ8 A;  1FYL A;  2XGX A;  4B43 A;  3J7A Y;  2KDZ A;  4AM3 A;  3P9I A;  3BG3 A;  4UB6 C;  2LY1 A;  3DXJ F;  1DGW Y;  3ZQC A;  3KYL A;  2VI6 A;  5DUI A;  1F4K A;  9ANT A;  4D7M A;  2K02 A;  1S3J A;  2LRD A;  1UHM A;  3FXO A;  2Z2S B;  4I98 B;  2ZJQ F;  3IKV A;  2L7K A;  4OIO F;  5KCM A;  1G3S A;  3KEQ A;  4U87 A;  3BR6 A;  2E5Z A;  2L2O A;  2MD0 A;  3CUQ A;  1MBE A;  3CCQ I;  2PN6 A;  4D5C A;  4LLL A;  1MSE C;  2EQR A;  3O8H A;  5M5X J;  2EZK A;  2DMP A;  5HDN A;  2XAF A;  2HVS A;  4M73 A;  1AA7 A;  1Y1V J;  1XC5 A;  1MNM C;  3G3Z A;  2MC3 A;  2J5P A;  3WG7 H;  3C2B A;  2ZXH A;  3IUO A;  3GBG A;  4B48 A;  2IT0 A;  3S1M J;  1F43 A;  1YIO A;  4AIH A;  2K9S A;  2LY2 A;  3NEU A;  1QHG A;  1V55 H;  2G7U A;  4I0B A;  5JHU A;  4WK8 F;  5J3L A;  1D8J A;  2VE8 A;  2X9D A;  3IH2 A;  3GW2 A;  4X1E A;  1TBX A;  2P81 A;  3L1P A;  4JYK A;  2KPM A;  4HRI A;  1I3A A;  2DA3 A;  2D5V A;  1V54 H;  4L0Y B;  4LIV A;  2ZNZ A;  3VOD A;  5A2Q K;  4BY1 J;  1HCR A;  4IOC F;  2FEZ A;  2XSJ C;  3MKW B;  2KJB A;  1R1U A;  1LEB A;  3TMO A;  3CCR I;  2E71 A;  3BC8 A;  1JJ8 C;  3ABM H;  5KAF C;  1YFH A;  3KEO A;  1WHU A;  3BLY A;  3V8K A;  2HXI A;  1SFE A;  3FXM A;  1WQ2 A;  4QWQ A;  5D6E A;  1FSH A;  4NC7 A;  3WTY C;  4A5N A;  2DFF A;  2LH9 A;  1VQM I;  1BR1 A;  3KP7 A;  2LF8 A;  1B72 A;  1GLN A;  4RGX A;  2JRT A;  5J8C A;  3HOY J;  2L0K A;  4ZYA A;  2VQH A;  2F6C A;  3A01 A;  2CWE A;  2HWV A;  3T0Y A;  1BN5 A;  4LK0 F;  1F9N A;  3LSK A;  4A3K J;  1HF0 A;  3K4M A;  1OLT A;  3ZQG A;  4M9Z A;  3BT9 A;  2XAQ A;  3H5N A;  1RR8 C;  5AIQ A;  3JRD A;  2XPV A;  3PFY A;  3M1C A;  4LMY A;  4RAG A;  2IS1 A;  4LJZ F;  5LGU A;  1I3Q J;  1Z77 A;  2M0M A;  4IHX A;  2XAU A;  4IPA A;  5FRO A;  2E1M C;  1VF9 A;  2JPC A;  3B6A A;  5FO5 A;  4KT6 A;  3HOX J;  1K4T A;  1EF4 A;  2GOM A;  3Q0U A;  2ID3 A;  3K1N A;  5ILS A;  1XSD A;  2XAJ A;  5J1U A;  4CH7 A;  4BU2 A;  2JWT A;  3IRR A;  3RI4 A;  2XGE A;  2XRN A;  1WH5 A;  2WY7 Q;  3O3K A;  5HDK A;  2QBY B;  3BPV A;  3RDI A;  2LBF B;  4GYI A;  4Y52 J;  3DBL B;  3K2Z A;  1R4M B;  4A93 J;  2HKO A;  4YG2 F;  2F5E A;  2Q2E A;  3FM5 A;  3GWZ A;  1P6R A;  2WB1 N;  3RIR A;  2DMQ A;  3E5U A;  5BPD A;  4KFC A;  2OZ6 A;  1OYI A;  1R4N B;  5LRS A;  1MH3 A;  3BPX A;  1R22 A;  4EVI A;  1NK3 P;  1RC9 A;  4G94 A;  5E79 C;  4MEX F;  1RZ4 A;  2MH9 A;  1IRZ A;  4N4N B;  1UHW A;  4PFP A;  3ZGK A;  3F22 A;  1JUM A;  5HDG A;  1Z1D A;  4M9S A;  4AWX B;  2GM4 A;  1GXQ A;  2E60 A;  3R60 A;  1GVD A;  3ZCO A;  2XF7 A;  2L7M P;  4V2G A;  1ZQ3 P;  2HTJ A;  5HLT A;  3OYL A;  1QHH D;  2DDA A;  4K2E A;  5K7Z A;  4B4C A;  3LSP A;  4TV7 A;  1MNE A;  4A3J J;  3PO3 J;  2ZJR F;  3KP3 A;  3J80 Z;  1T33 A;  1GXP A;  5IT9 K;  4IEJ A;  5EZH A;  4KJZ A;  2W82 A;  4MEY F;  3GME A;  3CCV I;  3OIQ A;  3PFI A;  5M5W J;  4E7K A;  4II2 A;  1XCB A;  2ZCW A;  2Y0M A;  3CMM A;  1ZTR A;  1J2X A;  3FIW A;  3CCE I;  1JJ6 C;  1EH6 A;  4ABZ A;  1K79 A;  3BG5 A;  3BZC A;  3PO2 J;  2A07 F;  1HKT A;  3TO7 A;  4KIS A;  2QKM B;  4UB8 C;  1F1Z A;  2CFO A;  4IVN A;  3ABK H;  1SEU A;  1U6G A;  4EJV A;  4A3C J;  1P92 A;  3CLQ A;  3JR9 A;  3GTP J;  2X6O A;  2BHZ A;  3U21 A;  2L4M A;  2VXZ A;  4C3J J;  4RDU A;  3GZ6 A;  3K10 A;  4B09 A;  3ERE D;  3JRI A;  4A3I J;  1QZY A;  2CQN A;  3ESW B;  3V7R A;  2DLL A;  4EV0 A;  2R7T A;  2AQE A;  1HDD C;  3P7N A;  5IYD J;  1ORK A;  3LA3 A;  3SZP A;  2V4J C;  2QLZ A;  3HKZ A;  3PIP F;  5L3D A;  3JSP A;  3L2U A;  1WSU A;  1N78 A;  4E7Z A;  5EG0 B;  3DLL F;  3Q5F A;  1DDN A;  2HPM A;  2NNN A;  4BXX J;  1WH7 A;  1R6R A;  5DM7 F;  4UNO A;  3LL7 A;  3LQQ A;  4N9H A;  5H6R A;  2EA4 A;  3G71 I;  2B0L A;  5ICC A;  3QOP A;  1UHS A;  4HF2 A;  4BEH B;  2L7Z A;  2ZFU A;  4L9V A;  3W6J B;  5EGO B;  1T08 B;  2V9V A;  3CD6 I;  4AU7 A;  1DP7 P;  4HSR A;  2JTV A;  2OQR A;  2HYG D;  1NHA A;  3CLO A;  3PL8 A;  2BYV E;  3KP6 A;  2E34 A;  3T8T A;  1KZH A;  4JX5 A;  4LD5 A;  5E3O A;  3JTH A;  5EJC A;  2VJ5 A;  4O5V A;  4YRV A;  2L4A A;  4HNU A;  3UR3 C;  3VOE A;  3N05 A;  1WGX A;  1TWG J;  2ID6 A;  2OA4 A;  2JT1 A;  3RPU A;  4ESF A;  4YEJ A;  1FOW A;  3OYF A;  3JRF A;  2E2H J;  2AO9 A;  1SVM A;  5HLH A;  4PUS A;  2YR2 A;  3E3V A;  1QO0 D;  2DXI A;  4ETS A;  5L3F A;  2LC2 A;  1QPI A;  4BDY A;  2EV5 A;  1KU2 A;  4ESJ A;  3K4N A;  4F91 B;  3NRV A;  3OYK A;  3UNG C;  3TBI A;  2HGC A;  1FZP B;  4WX9 A;  2IVM A;  2P5V A;  2GIZ A;  2FSW A;  2Y48 A;  1MKM A;  3I59 A;  2XGD A;  2EIL H;  2FX0 A;  4MNU A;  3MKZ A;  4N4O B;  3K7A J;  3JW4 A;  2P5K A;  1IF1 A;  3Q0W A;  1U5T B;  3ECH A;  5L3G A;  1ZAO A;  3ZN1 A;  4KT5 C;  2DU9 A;  2VOP A;  5CPR B;  2VXD A;  4Z2Y A;  3ZMZ A;  4LIU A;  3V7S A;  1JT6 A;  2JA8 J;  2CJJ A;  2J5O A;  4A3B J;  3KET A;  2IGO A;  1ZRE A;  3QU3 A;  4PFO A;  1HKQ A;  2M1B A;  3L00 A;  2WV1 A;  1RUN A;  3CDH A;  2DQR A;  3D5L A;  2EZI A;  4U0Y A;  4IRG A;  3HJE A;  4D5F A;  4A6D A;  2DDB A;  3P9K A;  4GCV A;  3SYT A;  5ERI A;  2K40 A;  1E0E A;  1IXR C;  5E18 F;  4WXC A;  3H3Z A;  2H8R A;  1LDD A;  1M1E B;  2L3D A;  1YYV A;  2HVQ A;  1FOX A;  3ZRG A;  1RUO A;  2HQR A;  1BI2 A;  2R93 J;  1MIJ A;  1RR7 A;  1BL0 A;  1CQT A;  5EG0 A;  4FHT A;  3CMA I;  2G9W A;  3DPL C;  2FQ4 A;  3CJR B;  4S0H B;  3KP5 A;  3FF5 A;  1RES A;  5CVJ A;  2ESH A;  2VJ4 A;  3JRG A;  4L9T A;  2R5Z B;  4RB1 A;  2E1C A;  1TQP A;  4BE2 A;  2M8G X;  4WF2 A;  2WAQ A;  3RQI A;  1ETK A;  2D1H A;  4CCK A;  4U0V A;  3S3N A;  1YIJ I;  2CQQ A;  3HHG A;  3UKG A;  2CFX A;  1H88 C;  2DA7 A;  1F5T A;  1YX5 A;  1Z7U A;  5F0C A;  2DFE A;  3ABT A;  3PJR A;  5DCM B;  3GTL J;  5TGT A;  1IGN A;  4OU0 A;  3S1Q J;  2AQF A;  3OYN A;  5E17 F;  2RQP A;  3RKW A;  2CMP A;  4G6D A;  1T0F C;  1B8I B;  1UZC A;  2JMW A;  3DEE A;  2BZT A;  1X2N A;  2CRG A;  2DJI A;  3ERM A;  1NTC A;  2E7W A;  5FKK A;  3I9V 2;  3FHN A;  1VI0 A;  2FRH A;  2GZW A;  2DOD A;  3BJO A;  4HF1 A;  2ZBK A;  3BTI A;  4KDP A;  1SD5 A;  4KIG A;  3WTS C;  3MVP A;  2W24 A;  2GIV A;  2R4G A;  3CCL I;  2A5W A;  4AID A;  3GTO J;  3I71 A;  3KLN A;  3DTK A;  1ZRD A;  2JZY A;  1P7I A;  4OOI A;  2M3A A;  4DNC A;  2IGM A;  2XF5 A;  4Q47 A;  4M71 A;  5KNL A;  3LSG A;  2QVO A;  2RNG A;  3OIP A;  1D0Y A;  5CQG A;  3E5X A;  4GDF A;  1Y6I A;  1T95 A;  3OL4 A;  5DD4 A;  1AOY A;  3ZQ7 A;  1JHH A;  2BVM A;  3FXK A;  3LFU A;  1XTA A;  4UUS B;  4XLP F;  5HNF A;  3ZMD A;  2MG4 A;  1RET A;  2QF7 A;  1OYW A;  3FDY A;  2WA0 A;  2KL4 A;  5JLW A;  3IAM 2;  4XN0 A;  2YUS A;  4XKC A;  3HSE A;  3JCU C;  3CCU I;  1O3T A;  1UEL B;  3V8L A;  4LB5 A;  4GFB A;  3ZQI A;  2GA1 A;  1MH4 A;  2V9K A;  1SFO J;  3QYE A;  1W7P B;  3ASN H;  3VWB A;  1G3W A;  2X1C A;  3KIO A;  5ICG A;  2KT0 A;  5BNG A;  3DQV C;  4HYE A;  2IXS A;  2PQ8 A;  1Y1W J;  2GXB A;  4DW6 A;  1OQY A;  2COB A;  5DEQ A;  5E8G A;  1IV6 A;  2HI3 A;  1LUJ B;  4RB2 C;  1Z05 A;  4E7L A;  2M9H A;  3D5R C;  1PUF B;  2IEK A;  2VC1 A;  2DMU A;  3HKZ N;  4LG3 A;  1JT0 A;  3FKI J;  2HOS A;  1IDZ A;  3A1Y A;  3WGH A;  5FB2 A;  3B02 A;  4FCY A;  3FIS A;  3ZXS A;  2LNB A;  1MMN A;  2P6S A;  1OIS A;  5JR3 A;  2QQA A;  1FMW A;  5LD2 C;  1EH8 A;  2HOE A;  2W48 A;  3H5R A;  4HX4 A;  4HST A;  1Z6R A;  1LQ1 A;  1EV7 A;  1HKS A;  3V8J A;  4BAC A;  2MH2 A;  3NAU A;  1ZN2 A;  3FWE A;  5A2Q Z;  2R7Q A;  5JVT A;  1ZEL A;  4F52 A;  2OV7 A;  4P9F A;  1D1A A;  3IH3 A;  3BQY A;  3A2K A;  1U9N A;  4ZDO A;  1P4W A;  1WI3 A;  1ZG1 A;  4P1W A;  3A0H C;  2NOG A;  2RV8 A;  4BHP A;  2LRE A;  1O57 A;  2H1L A;  1R5G A;  5D4R A;  1OR7 C;  4XLE A;  2MYS A;  4CUG A;  2EA2 A;  1J0R A;  2LVS A;  3L2C A;  4HDV A;  2QSH X;  4XR6 A;  1YIT I;  1HA8 A;  2QQB A;  4XLF A;  1PP7 U;  5CVV A;  1HW1 A;  3AG4 H;  5D5V B;  3ABU A;  5FLX K;  2Z33 A;  4MQV A;  5ED4 A;  4UHT A;  2Y69 H;  2CV2 A;  1I6X A;  1VQP I;  3VSL A;  1F36 A;  3M4O J;  2LF7 A;  1OPC A;  4GGG A;  4HAM A;  3HOS A;  2IP2 A;  3BJ6 A;  4CZC A;  6PAX A;  4M3F A;  1X1C A;  2UV1 A;  3OV8 A;  4HQM A;  3A0B C;  3FMR A;  4HLY A;  4KN7 X;  1LNW A;  2H8W A;  3QYF A;  2PX9 A;  1YTY A;  2VKD A;  1QPM A;  2Y75 A;  5FD6 A;  1Z0X A;  1Y56 A;  1T0F A;  1DU6 A;  4A0X A;  3KYD B;  1T6S A;  3HOZ J;  5GAG J;  3BTL A;  1TTY A;  2N8G A;  4E6K G;  1T98 A;  4AC0 A;  1LFP A;  2W85 A;  1WCM J;  1UG2 A;  1U2W A;  5CVI A;  1X1A A;  3RCO A;  5K1Y A;  2HDW A;  3SDB A;  4FE7 A;  5J1Y A;  3OYE A;  4BXU A;  3LSM A;  5DV5 A;  3LSJ A;  1D0X A;  2PLY A;  1HXD A;  2IBD A;  5L3B A;  1JXS A;  2VQG A;  4CGZ A;  3CTA A;  4DZP A;  1FP1 D;  2OPT A;  2LKS A;  1VTN C;  1Y39 A;  1HC8 A;  1MBK A;  2CW7 A;  1YOV B;  3MN2 A;  4I09 A;  2VKV A;  3V4G A;  1PUF A;  5IT9 Z;  2JA6 J;  4ZH4 F;  3FMQ A;  1A04 A;  3TL4 X;  1X1B A;  2G7H A;  5FFX A;  2RAE A;  3LST A;  2NS8 A;  2X6X A;  3F8M A;  2OU2 A;  2IA1 A;  4I7H A;  2XRL A;  5TRD A;  1B72 B;  4DYC A;  1V5E A;  1Z9C A;  2DOA A;  3A01 B;  2JSP A;  5J1R A;  1W36 D;  2P7C B;  5FKL A;  4BDZ A;  3K6G A;  5F04 A;  1YW7 A;  3H3U A;  3RQ4 A;  2K3F A;  2CGP A;  1CGP A;  2WAQ N;  3W2W A;  5E20 A;  3L2Q A;  1J9I A;  1W0U A;  1LB2 A;  1ULY A;  4A3D J;  2PJR A;  5M3F J;  3FX3 A;  3I0T A;  4JP0 A;  3RKX A;  4BYY A;  1MDM A;  3BR0 A;  3EPZ A;  2NVX J;  1WWX A;  2M7B A;  3MZH A;  4G7H F;  3H35 A;  4CCM A;  3BTC A;  3H36 A;  4EAT A;  1XS9 A;  2EFN A;  3CO7 C;  5IOZ A;  3BG6 A;  2IA2 A;  2IW5 A;  2KQR A;  2GLO A;  2HVR A;  4LOC A;  4Q4Z F;  3HSF A;  4HBL A;  1R1T A;  2H09 A;  5LLQ A;  3TQN A;  3J7A O;  1AU7 A;  1ZK8 A;  1Y0N A;  2ADU A;  3E6B A;  2XRO A;  1YE9 A;  2X1D A;  4M6V A;  2PMZ A;  4BGD A;  2VT3 A;  3OOP A;  5F1J A;  2A68 F;  3FBN B;  2Q2E B;  2VBY A;  1OMI A;  1TT0 A;  4BY7 J;  3HTU A;  3BZ6 A;  4XN3 A;  1U9O A;  3DKW A;  3TO9 A;  4BKX A;  3PUB A;  4AUX A;  5HNH A;  4G7O F;  2PG4 A;  5D8L B;  2EK5 A;  1IN6 A;  1GV2 A;  2I5U A;  3ULQ B;  1IO2 A;  1PVE A;  4QLC U;  3M8F A;  1S5L C;  2EZL A;  1OR7 A;  1APL C;  5B3S H;  4LG0 B;  5H6Q A;  1WI9 A;  2WWY A;  4BNC A;  2ZB9 A;  2FF4 A;  4QPO A;  1ZLK A;  5FRM A;  3MMY B;  3G1M A;  2QM3 A;  3OOU A;  2E36 A;  2EPF A;  3L2V A;  4RA2 A;  2GQQ A;  1DPU A;  3RZD J;  3ZR8 X;  1OCR H;  2PMH A;  5C4J J;  2GBY A;  1IUY A;  1NG7 A;  2ZSI B;  4L5J A;  1R71 A;  1B4A A;  3EUA A;  1VND A;  5TJJ A;  4Y13 A;  4CO8 A;  3IV5 A;  1W4M A;  4A3L J;  1SVL A;  2X0L A;  4AIJ A;  1S8N A;  2H94 A;  1D8K A;  2FE3 A;  1ERD A;  3K69 A;  2E2J J;  3S1R J;  1XG1 A;  3K1M A;  5DD8 A;  5E1Z B;  1BC7 C;  5BQT A;  3ASO H;  2K4J A;  3PNY A;  3QPT A;  3MEX A;  1N77 A;  4DZJ A;  1V3F A;  3CUO A;  2DPD A;  4KNY A;  3GEZ A;  5D5X B;  1DQU A;  2B63 J;  3M8E A;  1X3Z B;  4C2M J;  5EEA A;  2L9R A;  1R5I D;  1S7A A;  3F6V A;  2VQC A;  3VYT B;  2HQA A;  4XKB A;  2HTS A;  1P4A A;  2M7A A;  3GVA A;  2LD5 A;  4ZYH A;  2QCO A;  4CCL A;  1KQ8 A;  4ANJ A;  3LSR A;  3VEP A;  3HRU A;  4EM2 A;  4P55 A;  3KCC A;  4IX7 A;  2YX4 A;  2NYX A;  4BE0 A;  1YS6 A;  2RQQ A;  1G6N A;  2FOW A;  3LA7 A;  2STW A;  2GA2 A;  2Y30 A;  3MCZ A;  3WTT C;  1LFU P;  1HBX G;  3AG2 H;  2LDU A;  4RM2 A;  4OIP F;  2RKH A;  3ZMV A;  1IRG A;  1ITY A;  3ZOB A;  5K7F A;  4L9J A;  2FBI A;  2VUM J;  5CVR A;  1FPQ A;  1FBU A;  3L7W A;  3F9K A;  4HNT A;  2R7U A;  2Y31 A;  2BW3 B;  2WTE A;  1H9G A;  2ZFW A;  4MO7 A;  3BWG A;  3HL2 A;  3DF8 A;  1JKR C;  4MFD A;  1PUE E;  1XB4 A;  5HS7 A;  2MSY A;  3I5U A;  1FY7 A;  3L2W A;  4ENM A;  3LNQ A;  4XOP A;  2OZU A;  4ZYD A;  1BIA A;  2ELJ A;  2STT A;  4CCJ A;  1W7P D;  3ROU A;  5DUK A;  4FQG A;  2R7S A;  2E1M B;  2R7Z J;  4R8H A;  5IOY A;  1ZR4 A;  1Z6T A;  3B6C A;  3L2R A;  4FTH A;  1V5G A;  1R00 A;  4DYR A;  3BTJ A;  1K6O A;  3HOW J;  4ZYE A;  2QGU A;  2CV1 A; 
#chains in the Genus database with same CATH homology
 4LG0 A;  3BP8 A;  4ZYG A;  1T2K A;  3M7G A;  2HDC A;  5BOX A;  4IJA A;  2A6H F;  3I59 B;  3TOB A;  5CJ9 A;  3IRQ A;  3JTG A;  3DEU A;  1BOA A;  2Z9O A;  3WTZ A;  2QQ9 A;  1E17 A;  3WE3 A;  4P9U A;  3WTV C;  3QRF F;  2DTR A;  2M30 A;  5E1X A;  4FT8 A;  2KKO A;  2DK5 A;  1JGS A;  1IN4 A;  1IN5 A;  4M6Y A;  4RGR A;  3EYI A;  4IHS A;  3MZY A;  1FX7 A;  3KZY A;  3WTX C;  1RIO H;  1V4R A;  2YU3 A;  1YO5 C;  1XN7 A;  3E6C C;  1B59 A;  1C0W A;  5D5U B;  5KVR A;  2NS0 A;  2NRA C;  1Q1H A;  1HSJ A;  3M1E A;  4I0A A;  1EH7 A;  3GFL A;  4D0P A;  3ZMS A;  5AIP A;  4BH9 A;  3ZMT A;  2YSR A;  5K5Q A;  4UVA A;  1S7O A;  2QUF A;  2VT2 A;  1MJ9 A;  2ESN A;  5BMZ A;  3IHU A;  1TW2 A;  1XGM A;  4G6Q A;  2PFB A;  3LA2 A;  3MWM A;  4Y15 A;  1S6L A;  3QU6 A;  5JI6 A;  4JBA A;  2P6T A;  3WGG A;  2XKO A;  5LGT A;  4FX0 A;  2F2E A;  1YW9 A;  2GXG A;  5CVU A;  1ZAR A;  2BE5 F;  2FA5 A;  1XDU A;  1SFX A;  2DK8 A;  4HV5 A;  1ZYR F;  5FLX Z;  3HIF A;  2P5L C;  2FOK A;  2H6B A;  2V1X A;  2RN7 A;  2EFP A;  1I5Z A;  4S04 A;  1RI7 A;  4HA8 A;  1GVJ A;  4KA4 A;  2PEX A;  4UV9 A;  4L9N A;  2O3F A;  3KZZ A;  4LLN A;  2RNJ A;  3HYI A;  2FQ3 A;  5HS9 A;  2MA3 A;  1ON1 A;  2RVC A;  2EJR A;  4HDU A;  2O8X A;  2BV6 A;  3LFK A;  1I27 A;  5FD5 A;  1B9M A;  5LHI A;  4L5I A;  2PI0 A;  4IRH A;  3P9C A;  4CXF A;  3E6M A;  1SMT A;  3I58 A;  5LEK A;  1HW2 A;  1LDK B;  1J7K A;  4U0W A;  4P96 A;  2NNY A;  4HF0 A;  4KYW A;  1TQM A;  2UXN A;  3EUH A;  4OIQ F;  4A12 A;  5D6F A;  2IJL A;  3HRT A;  1DPR A;  2W84 A;  2HEO A;  4Y17 A;  4I02 A;  1YQA A;  2EFQ A;  4N9I A;  3SQN A;  1Z91 A;  4EJW A;  1IZ1 A;  1TNT A;  2V79 A;  3R0J A;  1STZ A;  4ESB A;  2EV6 A;  4RB3 C;  4GYG A;  1B9N A;  3K1P A;  2P7V B;  1KYZ A;  2BEO A;  4NQW A;  4EJO A;  5KK1 A;  1BI3 A;  3LAJ A;  3EET A;  2CSO A;  4O3M A;  1IAW A;  1ZHF A;  3SHF A;  4HX7 A;  1H9T A;  3QPH A;  3ZPL A;  4IRI A;  1X3U A;  1FT9 A;  3ZN0 A;  4A5M A;  3O6B B;  4JK1 X;  1ON2 A;  4BHC A;  5ILV A;  2COM A;  5D4S A;  4M74 A;  3U2R A;  3RYP A;  1XGS A;  2Z99 A;  3C1D A;  4UVB A;  1K78 B;  3L9F A;  1I1G A;  1DUX C;  4U7B A;  4G7Z F;  3FHZ A;  3WU0 A;  1HST A;  1MJA A;  5HLG A;  2PBI A;  4BAY A;  2GAU A;  5HOO A;  4HV6 A;  1USS A;  4KIB A;  4OMY A;  1MDM B;  2A5Y B;  4I01 A;  4HZF A;  1IN7 A;  4A2U A;  2D1V A;  4EMS A;  1KU7 A;  1KQ0 A;  1J59 A;  4RGU A;  3LQR A;  2HFH A;  1IRF A;  2ZME B;  3HUG A;  4CZZ A;  3CUQ C;  1XMA A;  1O3S A;  1IXC A;  1W5S A;  3BY6 A;  3HHH A;  4ON0 A;  2PJP A;  3J81 K;  2Z5U A;  1XSX A;  4EM0 B;  4I2O A;  3QAH A;  1U78 A;  1O3R A;  3SZT A;  3BDD A;  2F5D A;  2DBB A;  3KE2 A;  2QYO A;  5ICF A;  1FLI A;  3O2P E;  1IXS B;  2Z3Y A;  3TKY A;  3MFK A;  3IWZ A;  4ENJ A;  4PGG A;  2O0Y A;  3R4K A;  4KMU X;  1GHC A;  1ZGA A;  1WRJ A;  1XDS A;  3F8B A;  5D5W B;  2MLG A;  3GZ5 A;  1K78 A;  5J6X A;  4MHG A;  2CYY A;  2QEN A;  2ISY A;  1BM9 A;  1ZGJ A;  1TLH B;  4OIR F;  2PMU A;  1ZG3 A;  1AWC A;  3R61 A;  2MLK A;  4EGZ A;  5AON A;  4WCG A;  3QP6 A;  2FBK A;  2EFW A;  3F6O A;  3TDU C;  3JAM K;  1D3Y A;  2IA0 A;  3KP2 A;  1QNT A;  3I4P A;  4YFK F;  3AAF A;  3GFI A;  2AS5 F;  2ZKZ A;  5ILU A;  2CW0 F;  4P5O A;  3COA C;  3TO6 A;  3H92 A;  1UFM A;  2XHK A;  1SD6 A;  3PQJ A;  4L18 B;  4HLX A;  4PCQ A;  2JSC A;  1XGO A;  2A3S A;  4IF4 A;  4CIC A;  4KMF A;  3CO6 C;  2ZME A;  2M8E A;  3MAJ A;  1FBS A;  2HS5 A;  3IL2 A;  1SD4 A;  3T8R A;  2K27 A;  3D0S A;  1XCV A;  3N4M A;  1BI0 A;  3K0L A;  1R1V A;  4YFN F;  2YX7 A;  5DCF A;  3BRO A;  2TDX A;  3ELK A;  5LBQ A;  4Q5S F;  3RJP A;  3SXY A;  4LLG F;  4HQE A;  2EWN A;  2P8T A;  2R7F A;  2K4B A;  2F5F A;  1R58 A;  3I53 A;  3LWF A;  1E2X A;  2EFO A;  5L3E A;  2WC2 A;  2VBX A;  2KRF A;  3GLX A;  2UXX A;  3FXU A;  5E8I A;  5CYV A;  1QZZ A;  1O7L A;  4E70 A;  2K86 A;  2KIF A;  3F8C A;  1BBY A;  2QZ8 A;  3GFM A;  1PDN C;  3HRS A;  1ODD A;  1FBQ A;  3E5Q A;  4CYD A;  2D2W A;  1O3Q A;  4R79 A;  3K9T A;  3V7C A;  3B73 A;  5BS6 A;  4L0Z B;  4EM1 A;  4HX8 A;  3FZV A;  5LHG A;  2QWW A;  5HLI A;  1XD7 A;  1U3E M;  1W5T A;  4A6E A;  1BC8 C;  3IWF A;  3N97 A;  2DO7 A;  3BOQ A;  1TW3 A;  4LGW A;  1ZG5 A;  1CF7 A;  3SFZ A;  1FYK A;  4PZJ A;  1ZLJ A;  1R36 A;  3FMS A;  3PQK A;  5HVQ C;  2EV0 A;  1KA8 A;  2LSO A;  3E97 A;  1UCR A;  2XV4 S;  4M6X A;  3DPT A;  2CO5 A;  5LGN A;  3DV8 A;  4ZZL A;  3ECO A;  2A61 A;  4H0E A;  1G4D A;  1B6A A;  1FYM A;  2IRF G;  1R5H A;  2RDP A;  4HOB A;  1PP8 F;  2ZXJ A;  2GWR A;  2VBW A;  4S05 A;  3C18 A;  4KN4 X;  4UXN A;  2Q8K A;  2VOO A;  4GO1 A;  3FXQ A;  1UST A;  2FML A;  2O61 A;  1KU9 A;  4KIF A;  1TQI A;  2OBP A;  4BQA A;  4LK1 F;  1JHF A;  2KIU A;  4HW0 A;  3C7J A;  1YW8 A;  4U88 A;  1YS7 A;  4LB6 B;  1KYW A;  3BJA A;  2F5C A;  2XKP A;  2IPQ X;  3S2W A;  1QGP A;  5H20 A;  1QQI A;  2WV0 A;  3HTS B;  3WOD F;  2ELH A;  5DYM A;  2BGC A;  4EQQ A;  5LEJ A;  4XLN F;  3GUD A;  2XAH A;  3R6S A;  1REP C;  4RB0 A;  1SD7 A;  2W25 A;  1YG2 A;  4WWC A;  2VE9 A;  4R1H A;  4IXA A;  1BI1 A;  1HQC A;  1MZB A;  4ENN A;  4OMZ A;  5DDG A;  1Y0U A;  3VFZ A;  2KIM A;  3GYH X;  3I64 A;  2R7D A;  2L02 A;  4EJU A;  3FXR A;  5EEG A;  4UVC A;  2RC4 A;  3GXO A;  4UV8 A;  2D45 A;  3Q9S A;  4XBF A;  3JSO A;  3E6D A;  1XSV A;  4IHT A;  4AIK A;  4DQ2 A;  4YIF A;  3WE2 A;  4B8X A;  2VBZ A;  5LRR A;  2H6C A;  4AVP A;  5D8K B;  5FGM A;  2XUB A;  4ENK A;  3F21 A;  2W57 A;  1SAX A;  2FNA A;  2QBY A;  2HKX A;  3REO A;  3F8F A;  2OD5 A;  4U7D A;  4CDG A;  2DT5 A;  1BJA A;  4EJT A;  4MTE A;  3IKT A;  3EYY A;  1U5T C;  1MD0 A;  5ICE A;  2Q0O A;  4UUV A;  2XAS A;  3KFW X;  2E1N A;  3TDZ C;  3J81 Z;  3FM3 A;  1RNL A;  2ZNY A;  1P4X A;  3EQL F;  2ZO4 A;  2V1U A;  2P4W A;  1U8R A;  1J5Y A;  3HSR A;  1KGS A;  2R3S A;  3GFJ A;  4M72 A;  3NQO A;  1FSE A;  4LFU A;  1LJ9 A;  3VB2 A;  2CG4 A;  1OYY A;  5K5R A;  2A69 F;  4OIN F;  4MTD A;  3T1B A;  5CLS A;  3TOA A;  2DAO A;  2RGV A;  2X4H A;  2MD5 A;  1T38 A;  2M45 A;  4M9X A;  4RAZ A;  1ZH5 A;  3I54 A;  2VOD A;  2BBY A;  2XVC A;  4BHB A;  4PGH A;  5F64 A;  3IC7 A;  2XAG A;  2C6Y A;  4RAY A;  1UB9 A;  5EEH A;  3ZP5 A;  1FOK A;  3JAM Z;  3WTU C;  4YFX F;  4RS8 A;  2YPR A;  3WGI A;  2DFI A;  1XGN A;  3GF2 A;  3HRM A;  4AD9 A;  3RPQ A;  2K7L A;  4KUM A;  3WG9 A;  4G9Y A;  1ZRC A;  3J80 K;  3F3X A;  4ZZD A;  2JPB A;  1IW7 F;  1G3Y A;  4WXH A;  3W6K B;  4ASN A;  2O03 A;  4MGR A;  3ISP A;  2UWM A;  4A0Y A;  1WKM A;  4EGY A;  2M87 A;  1ZRF A;  2AXL A;  3MQ0 A;  1YLF A;  2HYF A;  2VN2 A;  2L54 A;  3ZMU A;  2ACJ A;  1OKR A;  3L09 A;  2FNP A;  2FMY A;  5IT3 A;  1R23 A;  1U5T A;  2CQK A;  1XMK A;  3KLO A;  1G3T A;  5E1W A;  4WXD A;  4NB5 A;  2LKP A;  3U9G A;  2O6G E;  1BIB A;  4XSX F;  2DPU A;  4FX4 A;  1IN8 A;  2L01 A;  5F6F A;  3GO5 A;  3RKY A;  1FNN A;  4JQF A;  5HS8 A;  1P2F A;  2XIG A;  1D5V A;  3U1D A;  1K7A A;  1B1B A;  1I1S A;  1SFU A;  1LVA A;  2ZJ2 A;  3Q9V A;  1FC3 A;  2KJC A;  1KQ9 A;  2HR3 A;  5L3C A;  3G73 A;  2FXA A;  1S29 A;  1KU3 A;  2VC0 A;  4F7Z A;  4RGS A;  3EDP A;  5DCM A;  3LAP A;  4KIC A;  2OQG A;  3KP4 A;  2HZT A;  2UZK A;  1MJB A;  3M9A A;  3RYR A;  1R7J A;  5K5O A;  1HW5 A;  3DFG A;  4GXO A;  3F8N A;  1J75 A;  3WTW C;  2DQL A;  3CUQ B;  2A6E F;  1L3L A;  4XRF A;  4CHU A;  3GX4 X;  2FU4 A;  2H27 A;  1LEA A;  4O6J A;  3HOT A;  1T39 A;  2ISZ A;  4NHJ A;  3ML6 A;  2OAZ A;  2V1D A;  2VON A;  2EB7 A;  4PDK A;  1L0O C;  3R0A A;  3F23 A;  1W7P A;  2HQN A;  5FFZ A;  2ETH A;  2M5W A;  3DP7 A;  5BPI A;  5LHH A;  5J8F A;  4N0B A;  4YII A;  3C3W A;  1CF7 B;  4G8X A;  5JFR A;  3WU1 B;  1O7F A;  4A0Z A;  1SMY F;  3RTR A;  3QP5 A;  1FP2 A;  1LDJ A;  4XSZ F;  3T5X A;  2DW4 A;  2FBH A;  4Q48 A;  3F72 A;  4MQ9 F;  3TGN A;  1H0M A;  5F1R A;  1FWZ A;  1TNS A;  1MGT A;  1QBJ A;  2E7X A;  2MBF A;  1ONV A;  2NAZ A;  2DI3 A;  2V6C A;  1JE8 A;  3CJN A;  1FYL A;  2XGX A;  3P9I A;  3DXJ F;  5DUI A;  1F4K A;  2K02 A;  1S3J A;  1UHM A;  4I98 B;  3IKV A;  4OIO F;  1G3S A;  3KEQ A;  3CUQ A;  2PN6 A;  4LLL A;  5HDN A;  2XAF A;  4M73 A;  3G3Z A;  2MC3 A;  2J5P A;  2IT0 A;  1YIO A;  4AIH A;  3NEU A;  4I0B A;  2G7U A;  5JHU A;  4WK8 F;  1D8J A;  2VE8 A;  3GW2 A;  1TBX A;  4L0Y B;  3VOD A;  2ZNZ A;  5A2Q K;  2FEZ A;  2KJB A;  1R1U A;  1LEB A;  1YFH A;  3KEO A;  3V8K A;  1FSH A;  1SFE A;  4QWQ A;  1WQ2 A;  5D6E A;  3WTY C;  4A5N A;  3KP7 A;  2LF8 A;  5J8C A;  4RGX A;  2JRT A;  2CWE A;  2HWV A;  3T0Y A;  1BN5 A;  4LK0 F;  1F9N A;  4M9Z A;  2XAQ A;  5AIQ A;  4LMY A;  4LJZ F;  5LGU A;  4IPA A;  2JPC A;  5FO5 A;  3K1N A;  5ILS A;  1XSD A;  2XAJ A;  3IRR A;  3RI4 A;  2XRN A;  3O3K A;  5HDK A;  2QBY B;  3BPV A;  3RDI A;  4GYI A;  3K2Z A;  2HKO A;  4YG2 F;  2F5E A;  2Q2E A;  3FM5 A;  3GWZ A;  1P6R A;  3RIR A;  3E5U A;  5BPD A;  4KFC A;  2OZ6 A;  1OYI A;  5LRS A;  3BPX A;  1R22 A;  4EVI A;  4G94 A;  4MEX F;  1RZ4 A;  2MH9 A;  1UHW A;  3F22 A;  5HDG A;  1Z1D A;  4M9S A;  4AWX B;  1GXQ A;  3R60 A;  2HTJ A;  4K2E A;  4TV7 A;  3KP3 A;  3J80 Z;  1GXP A;  5IT9 K;  4MEY F;  3PFI A;  1XCB A;  2ZCW A;  2Y0M A;  1J2X A;  1EH6 A;  1K79 A;  2A07 F;  1HKT A;  3TO7 A;  1F1Z A;  4IVN A;  1U6G A;  4EJV A;  1P92 A;  2L4M A;  2VXZ A;  3GZ6 A;  3ERE D;  4B09 A;  1QZY A;  3V7R A;  2DLL A;  4EV0 A;  3P7N A;  3LA3 A;  3SZP A;  2QLZ A;  5L3D A;  3JSP A;  1WSU A;  3Q5F A;  1DDN A;  2NNN A;  4UNO A;  3LQQ A;  4N9H A;  5H6R A;  2EA4 A;  5ICC A;  2B0L A;  3QOP A;  4HF2 A;  4L9V A;  3W6J B;  2V9V A;  1DP7 P;  2JTV A;  2OQR A;  2HYG D;  1NHA A;  3CLO A;  2BYV E;  3KP6 A;  3T8T A;  4LD5 A;  3JTH A;  4O5V A;  2L4A A;  3VOE A;  2OA4 A;  2JT1 A;  3RPU A;  4ESF A;  5HLH A;  2YR2 A;  3E3V A;  1QO0 D;  4ETS A;  5L3F A;  2EV5 A;  1KU2 A;  4ESJ A;  3NRV A;  2HGC A;  1FZP B;  4WX9 A;  2IVM A;  2P5V A;  2FSW A;  2Y48 A;  1MKM A;  3I59 A;  4MNU A;  3JW4 A;  2P5K A;  1IF1 A;  1U5T B;  3ECH A;  5L3G A;  1ZAO A;  3ZN1 A;  4KT5 C;  2DU9 A;  2VOP A;  4Z2Y A;  3ZMZ A;  3V7S A;  2J5O A;  3KET A;  1ZRE A;  3QU3 A;  1HKQ A;  2M1B A;  3L00 A;  1RUN A;  3CDH A;  2DQR A;  3D5L A;  4U0Y A;  4IRG A;  4A6D A;  3P9K A;  4GCV A;  5ERI A;  1IXR C;  5E18 F;  4WXC A;  3H3Z A;  1LDD A;  2L3D A;  1YYV A;  1RUO A;  2HQR A;  1BI2 A;  4FHT A;  2G9W A;  3DPL C;  3KP5 A;  3FF5 A;  5CVJ A;  2ESH A;  4L9T A;  4RB1 A;  2E1C A;  1TQP A;  4WF2 A;  2D1H A;  4U0V A;  1F5T A;  3HHG A;  2CFX A;  1Z7U A;  3ABT A;  5DCM B;  4OU0 A;  5E17 F;  2RQP A;  3RKW A;  4G6D A;  2E7W A;  2FRH A;  2GZW A;  3BJO A;  4HF1 A;  2ZBK A;  4KDP A;  1SD5 A;  4KIG A;  3WTS C;  2W24 A;  2GIV A;  3I71 A;  3KLN A;  1ZRD A;  2JZY A;  4OOI A;  4DNC A;  4Q47 A;  4M71 A;  2QVO A;  3E5X A;  1AOY A;  5DD4 A;  3ZQ7 A;  1JHH A;  4XLP F;  3ZMD A;  1OYW A;  3HSE A;  1O3T A;  3V8L A;  4LB5 A;  2GA1 A;  1W7P B;  1G3W A;  5ICG A;  3DQV C;  4HYE A;  2PQ8 A;  2GXB A;  5DEQ A;  5E8G A;  4RB2 C;  1Z05 A;  2VC1 A;  3WGH A;  5FB2 A;  3B02 A;  2LNB A;  2P6S A;  5JR3 A;  2QQA A;  1EH8 A;  2HOE A;  4HX4 A;  1Z6R A;  1LQ1 A;  1EV7 A;  1HKS A;  3V8J A;  2MH2 A;  1ZN2 A;  3FWE A;  5A2Q Z;  5JVT A;  4P9F A;  1P4W A;  1ZG1 A;  2RV8 A;  4BHP A;  1O57 A;  1R5G A;  5D4R A;  2EA2 A;  1J0R A;  3L2C A;  4HDV A;  2QQB A;  1PP7 U;  5CVV A;  1HW1 A;  5D5V B;  3ABU A;  5FLX K;  2Z33 A;  4MQV A;  5ED4 A;  4UHT A;  1I6X A;  2LF7 A;  1OPC A;  4GGG A;  4HAM A;  3HOS A;  2IP2 A;  3BJ6 A;  6PAX A;  3OV8 A;  4HQM A;  3FMR A;  4HLY A;  4KN7 X;  1LNW A;  1YTY A;  1QPM A;  2Y75 A;  5FD6 A;  1T0F A;  4A0X A;  1T6S A;  1TTY A;  1T98 A;  2W85 A;  1U2W A;  5CVI A;  5K1Y A;  4BXU A;  5DV5 A;  2PLY A;  1HXD A;  5L3B A;  1JXS A;  4CGZ A;  3CTA A;  1FP1 D;  1VTN C;  4I09 A;  3V4G A;  5IT9 Z;  4ZH4 F;  3FMQ A;  1A04 A;  2G7H A;  5FFX A;  3LST A;  3F8M A;  2OU2 A;  2IA1 A;  4I7H A;  5TRD A;  1Z9C A;  2P7C B;  1YW7 A;  3H3U A;  2CGP A;  1CGP A;  5E20 A;  1J9I A;  1LB2 A;  1ULY A;  3FX3 A;  3I0T A;  3RKX A;  4BYY A;  1MDM A;  1WWX A;  3MZH A;  4G7H F;  2EFN A;  3CO7 C;  2IA2 A;  2IW5 A;  4Q4Z F;  3HSF A;  4HBL A;  1R1T A;  2H09 A;  5LLQ A;  3TQN A;  3J7A O;  2ADU A;  3E6B A;  2XRO A;  2VT3 A;  3OOP A;  2A68 F;  2VBY A;  1OMI A;  3HTU A;  3BZ6 A;  3DKW A;  3TO9 A;  4G7O F;  2PG4 A;  5D8L B;  2EK5 A;  1IN6 A;  3ULQ B;  4QLC U;  3M8F A;  1OR7 A;  4LG0 B;  5H6Q A;  1WI9 A;  2WWY A;  4BNC A;  2FF4 A;  1ZLK A;  2QM3 A;  2GQQ A;  1DPU A;  2PMH A;  1IUY A;  4L5J A;  1B4A A;  5TJJ A;  4Y13 A;  4CO8 A;  1W4M A;  2X0L A;  4AIJ A;  1S8N A;  2H94 A;  1D8K A;  2FE3 A;  3K69 A;  3K1M A;  5DD8 A;  5E1Z B;  1BC7 C;  5BQT A;  2K4J A;  3QPT A;  3MEX A;  1V3F A;  3CUO A;  2DPD A;  4KNY A;  3GEZ A;  5D5X B;  3M8E A;  1S7A A;  3F6V A;  2HTS A;  1P4A A;  3GVA A;  4ZYH A;  1KQ8 A;  3VEP A;  3HRU A;  4EM2 A;  4P55 A;  3KCC A;  2YX4 A;  2NYX A;  1YS6 A;  1G6N A;  3LA7 A;  2STW A;  2GA2 A;  3MCZ A;  3WTT C;  1HBX G;  2LDU A;  4OIP F;  2RKH A;  3ZMV A;  1IRG A;  4L9J A;  2FBI A;  5CVR A;  1FPQ A;  1FBU A;  3L7W A;  2WTE A;  1H9G A;  2ZFW A;  3BWG A;  3DF8 A;  1PUE E;  1XB4 A;  5HS7 A;  3I5U A;  1FY7 A;  4ENM A;  2OZU A;  4ZYD A;  1BIA A;  2STT A;  1W7P D;  3ROU A;  5DUK A;  4R8H A;  1Z6T A;  1K6O A;  1R00 A;  4ZYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...