4UHTA

Crystal structure of the dna binding domain of cpxr from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
102
structure length
102
Chain Sequence
SPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDHAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN CPXR
publication title Conformational plasticity of the response regulator CpxR, a key player in Gammaproteobacteria virulence and drug-resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 28
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4uhtA00
1B4AA 2GAUA 1S3JA 3JAMZ 3FWEA 5EEHA 2B0LA 2BGCA 3W6JB 2ZFWA 5DUIA 2EFPA 3TO9A 3IKTA 2QUFA 4M72A 4K2EA 4IHTA 4OMYA 2W84A 4DQ2A 3ZMZA 1XB4A 5D5WB 4UUVA 2D1HA 5TRDA 5KK1A 1BI0A 4HX8A 4TV7A 4MEYF 2ACJA 1LEAA 2IP2A 5ILVA 1ZG5A 3IRRA 4Z2YA 4IRGA 4ENNA 5FLXZ 1J2XA 2TDXA 4KMUX 2PMHA 1ZHFA 3KZYA 3CO6C 2GQQA 1ZN2A 1YS6A 5LHIA 3C7JA 4ZH4F 1LNWA 2STTA 4BHCA 4CDGA 2MD5A 1QPMA 5E8IA 5L3BA 3WODF 3V4GA 3I0TA 1S6LA 4L9NA 4ESFA 2R7DA 3KEQA 1EH6A 3RKWA 3E6MA 1BC7C 1IRGA 1F5TA 1L0OC 2FMYA 3IL2A 1R00A 1P92A 5CVUA 1Q1HA 3RIRA 3ZP5A 2DPUA 1ZLKA 3LAPA 2HEOA 1S7AA 4G7ZF 3BPXA 3E5QA 1S29A 1F9NA 2YR2A 1IF1A 1TW3A 1BI1A 3DPLC 3GFIA 3QAHA 2EFNA 4BXUA 2UZKA 3I64A 2GWRA 1O7LA 2CW0F 1UHWA 2VC1A 3KZZA 2J5PA 4UHTA 1TTYA 2KKOA 2F2EA 3WTYC 4YFXF 1I5ZA 4IHSA 3ABTA 3ABUA 4KYWA 4ZYGA 4XSXF 3KLOA 1SFUA 1G3YA 1IN7A 1Z91A 1IUYA 1DUXC 3I5UA 5LBQA 4IPAA 5IT9Z 5CLSA 4GYIA 1R58A 3KP5A 2WV0A 1SMYF 3GWZA 1I1GA 3FX3A 2X4HA 4EJUA 1ZRCA 1E2XA 1HW5A 2ETHA 3TO7A 2HS5A 2VBWA 1TNSA 3QP6A 3PFIA 3VODA 4I01A 4WCGA 3HOSA 2DAOA 1MJBA 3ZMDA 2MLKA 2VODA 2RV8A 4GYGA 3QOPA 2K86A 5FO5A 2D1VA 1EH7A 2HYFA 2A69F 4WX9A 2MA3A 3IHUA 2QQAA 1JGSA 4R8HA 4LK1F 2Z9OA 2W57A 4G6DA 3SHFA 4RB3C 1BOAA 1RI7A 3IWFA 2JTVA 4A6DA 5HLHA 1WI9A 1U5TA 3Q9SA 2ZKZA 2ZO4A 3MZHA 4KICA 3I59A 3BROA 1KU3A 1UB9A 2W25A 1ON2A 1UHMA 2WTEA 4WK8F 4PGGA 4UXNA 3F3XA 4G6QA 3T0YA 2JPCA 3GW2A 3K9TA 4MGRA 1DPUA 5HOOA 2M87A 3NQOA 5ICFA 4PZJA 1FP1D 1XMKA 1YS7A 1J59A 2VN2A 2V1UA 3WG9A 4GO1A 2FEZA 3J81Z 3Q5FA 1QNTA 4P9UA 5ICEA 1LJ9A 3JAMK 2RDPA 3WGIA 2A07F 3PQKA 4HX7A 5D6EA 3ERED 1DPRA 4F7ZA 3DFGA 4LGWA 5J8FA 3K0LA 5HLIA 5HS8A 3LFKA 4YIIA 2A6EF 2OZ6A 4I7HA 3DPTA 2BV6A 3QP5A 2QBYA 4I0BA 1I27A 2O8XA 2M1BA 3T5XA 1RUNA 3GYHX 1KQ8A 1TNTA 1KU7A 3D5LA 5BPIA 1HW1A 1UFMA 3VFZA 4S04A 2OD5A 1SFEA 1JXSA 1HXDA 5D8KB 1TQMA 4HDVA 1X3UA 2ESHA 3FXRA 2LNBA 3VOEA 1FSEA 4M6YA 1J9IA 4RAZA 2DBBA 1D5VA 3GX4X 1CF7A 4KDPA 3GF2A 4B8XA 4AD9A 2CSOA 4O5VA 2ZNYA 1MDMA 2GXGA 2OQRA 1ZRDA 1Z6RA 1U5TB 4XRFA 1FOKA 5E1WA 1W7PD 4L5IA 5DYMA 1I1SA 3I59B 3R61A 2O0YA 3RKXA 3CUQA 3B02A 4G7HF 3ECHA 1R5HA 4Q48A 3VEPA 4HF1A 4P5OA 5BPDA 1B9NA 5F6FA 1IXCA 2Y75A 3VB2A 3QU6A 1IN8A 4HX4A 4I02A 1WKMA 3F8CA 1ZLJA 4IF4A 4JK1X 4ZYHA 4L5JA 3DEUA 2H6BA 3DXJF 4EGYA 3BZ6A 3FXUA 3ZN0A 3U1DA 2WWYA 3R60A 3J80K 2FSWA 2HZTA 2QBYB 5DUKA 4L18B 3V8JA 5HS9A 4EVIA 2DTRA 2HR3A 2A6HF 1OKRA 4IVNA 5HDNA 2G7UA 2HDCA 1F4KA 2XAGA 3HUGA 1J7KA 3RJPA 3ML6A 2PLYA 2PEXA 3HYIA 1BM9A 1GHCA 4PCQA 2IT0A 5IT9K 2E1CA 4O3MA 1W7PA 4GCVA 3L2CA 1CF7B 1B6AA 3MWMA 3P9CA 1R22A 3EDPA 1MDMB 1FX7A 1TLHB 3FMQA 5ERIA 3WGHA 2V1DA 1KQ0A 2IVMA 4LLNA 5CVVA 4LMYA 3CUQB 4OINF 1V3FA 2CGPA 3TO6A 1MZBA 2RKHA 3HHGA 5E1ZB 1PP8F 3BWGA 4KNYA 1ONVA 4FT8A 1O3RA 1J75A 4GXOA 4MHGA 4EM1A 1O57A 4RB1A 2OAZA 3BJOA 2LSOA 2EFQA 3ZMVA 1IXSB 3V7CA 2LKPA 1IN4A 1BC8C 5DEQA 3KLNA 4CXFA 2M30A 2RQPA 5FD6A 3K2ZA 2QYOA 1JHHA 2CG4A 1ZGAA 4GGGA 1UCRA 5H20A 2DLLA 4HOBA 4CICA 2ZMEA 1SFXA 4HZFA 2L01A 2D2WA 5IT3A 4M71A 5D5VB 4L9VA 4HV5A 1GXQA 1ZH5A 3GFJA 4R79A 1W7PB 1G6NA 4UVCA 4U0WA 1XSXA 3H3ZA 3R6SA 1P2FA 1KU9A 1OR7A 4A5NA 1CGPA 1I6XA 1U5TC 2RGVA 2PBIA 5J6XA 1JHFA 3WTSC 2OA4A 2NRAC 2PMUA 3F6VA 1XDSA 2XAJA 3F22A 2ESNA 2F5EA 3F72A 1STZA 3TQNA 5D4SA 4CGZA 1FYKA 2NNNA 3RYPA 4HF2A 1IZ1A 1XGNA 4KIFA 1BIBA 2FBKA 5H6RA 3EYIA 4AIHA 1IAWA 2RC4A 2EV0A 1T0FA 3MFKA 3CLOA 2CO5A 4HYEA 2EB7A 5E8GA 3TDZC 4PDKA 3K1MA 3LQRA 3RTRA 3DV8A 1HKSA 2ZMEB 4MNUA 2L02A 1OYWA 3EETA 1LVAA 2Q0OA 4Q4ZF 3SZTA 2O6GE 1R1TA 2XUBA 2YPRA 5JHUA 5A2QZ 4BH9A 2FQ3A 2AXLA 4M9SA 2G7HA 1K79A 4U0VA 2BBYA 3J7AO 4I2OA 2Q2EA 1P4WA 4HBLA 4XSZF 3TKYA 1P6RA 3F23A 1XGOA 1TBXA 4D0PA 4G9YA 1XCBA 2FBHA 2FXAA 2R7FA 3SZPA 1F1ZA 1FBSA 3RPUA 4IRIA 1MKMA 1SAXA 3ROUA 1ZRFA 1QO0D 1XGSA 5F1RA 3BJAA 3R4KA 2KIUA 1BIAA 4G8XA 1Z1DA 4G94A 1ZG3A 2XVCA 2Z5UA 1QGPA 1K7AA 2IPQX 2DQRA 1BBYA 1QBJA 4OIPF 2P6TA 3K1NA 4L0ZB 1ZG1A 2BYVE 2XKPA 2PN6A 2W85A 2HTJA 1B9MA 4P96A 4LD5A 1MD0A 2V1XA 3BDDA 4OIQF 2OBPA 2XKOA 5D8LB 2H94A 5BOXA 4A5MA 1J0RA 2F5CA 1WQ2A 1REPC 1O3QA 3KP2A 4CZZA 2P8TA 2IJLA 1T98A 1XGMA 1FPQA 1SD5A 4KUMA 1G3TA 4EM0B 2FU4A 4UV9A 2GZWA 3WE2A 3TOBA 2PI0A 1ZARA 4E70A 2QWWA 3M7GA 1YYVA 2EFOA 3BPVA 3HRTA 2HYGD 4U7BA 1D3YA 3WU0A 3EQLF 3M9AA 4HAMA 1J5YA 4L0YB 2Z99A 5K5QA 4WWCA 5JI6A 3NRVA 3K69A 2EV6A 5JVTA 2MLGA 3MAJA 2M5WA 1FSHA 5L3FA 1SD6A 2YU3A 4FX0A 3TDUC 4EQQA 1XSVA 1USTA 1USSA 5J8CA 4U88A 3WTZA 5AIQA 1FNNA 3G73A 1H0MA 1K78A 2O03A 5LRSA 1R1UA 2QM3A 3R0JA 3B73A 1FZPB 1XN7A 3FHZA 4IRHA 1MGTA 1R36A 3LSTA 5HVQC 3JTHA 4EJVA 4U7DA 2XRNA 3RDIA 1T38A 1S7OA 2EWNA 5FLXK 3WTUC 2KRFA 5HLGA 4EJOA 2CWEA 5K1YA 2H09A 2QQ9A 5LGUA 1HKTA 3HTUA 1RZ4A 5D6FA 4S05A 2YX4A 3T8TA 4YG2F 3WE3A 1YW8A 3GUDA 1G3SA 4ENKA 3GEZA 1P4XA 1U8RA 4P55A 4EMSA 4MTEA 1FP2A 2L4MA 3D0SA 4AIJA 2A3SA 1XSDA 3FMRA 2LF8A 1HW2A 2RN7A 2IRFG 3SQNA 4HF0A 4XLPF 1YW7A 3V7SA 2JZYA 4ASNA 3F6OA 4IJAA 1H9GA 3EUHA 5E1XA 3O2PE 2FF4A 2OU2A 3F21A 1R23A 3HRUA 4ZZLA 1ODDA 2QQBA 4UVAA 3FM3A 1K78B 1FYMA 4MTDA 4HLYA 5F64A 3MEXA 4R1HA 3CTAA 4KN7X 2VBXA 1LQ1A 3KCCA 4N0BA 3KE2A 4M74A 4BYYA 4CYDA 3LWFA 2CFXA 2HWVA 4BNCA 3CO7C 2A5YB 1KA8A 1YW9A 1OYYA 3GZ5A 4UNOA 1K6OA 4BQAA 2MBFA 3O6BB 5LRRA 3G3ZA 5FFZA 4AVPA 3HHHA 2P7CB 4KIGA 3P7NA 3LA3A 4ZYEA 5LGNA 5DCMA 1FBUA 2EFWA 3ISPA 1T39A 5D5UB 5ICGA 1PP7U 3WTWC 2ELHA 3OV8A 4BAYA 3E97A 1PDNC 3FXQA 5DCFA 4L9TA 5DD4A 4N9IA 1R1VA 2QENA 1ZAOA 3FMSA 3QRFF 4EV0A 5AIPA 1D8KA 4A0ZA 5CYVA 2PQ8A 2A68F 3ELKA 4HQEA 4FHTA 3DP7A 2VXZA 4LJZF 2IA1A 4M73A 3GFMA 5FGMA 1KQ9A 2HTSA 3COAC 2F5DA 4LFUA 5E18F 4ESBA 3GFLA 3ZN1A 2M8EA 5CJ9A 5D4RA 1TQPA 3SFZA 2UXXA 3HRMA 2ZJ2A 6PAXA 2KJBA 5FB2A 5E17F 4KT5C 4NHJA 3K1PA 2VE8A 1ULYA 4WXCA 5ILUA 2FBIA 1Z7UA 1V4RA 3J81K 3KP6A 5LHHA 2YX7A 4Q5SF 1P4AA 2W24A 4YFKF 3QPTA 2V6CA 4QWQA 5K5RA 3LAJA 1YO5C 2DW4A 2DPDA 4HA8A 3IWZA 4LB5A 3T8RA 3F8NA 1O7FA 5DCMB 2FMLA 4I0AA 4ENJA 4OU0A 3L7WA 2O61A 4A12A 3L09A 5D5XB 2AS5F 1LB2A 2HKOA 3ULQB 2NNYA 3TGNA 3QPHA 4QLCU 2ZNZA 5HS7A 1FT9A 2KIMA 1BN5A 2GIVA 1OMIA 1QQIA 3ZMTA 4EJTA 1IRFA 2EA4A 2VBYA 3S2WA 2ISZA 2IW5A 1BI3A 3HSFA 3E6CC 3KP7A 3P9IA 2P4WA 1ZREA 3U9GA 2NYXA 4Q47A 4UV8A 1SD4A 2XROA 3FF5A 4ZYDA 2XAHA 1QZYA 4WXHA 4NB5A 3HTSB 1KYWA 4OIOF 2IA0A 3NEUA 5DDGA 1QZZA 1XCVA 1WRJA 3V8LA 1VTNC 2MC3A 3GO5A 1LDJA 4A0YA 1Z9CA 3H3UA 4RGRA 2H27A 3DKWA 2DFIA 3JW4A 1D8JA 3KP4A 4KFCA 3MQ0A 3AAFA 4FX4A 2HKXA 3I4PA 4EM2A 5JFRA 3T1BA 1IXRC 4HV6A 3KFWX 2BE5F 2HGCA 2Z3YA 2FRHA 5K5OA 1YQAA 4BHPA 1MJAA 2XGXA 2E1NA 2QZ8A 2A61A 4M9XA 5HDGA 4HQMA 1PUEE 1LDKB 1RUOA 4DNCA 1SMTA 4N9HA 4KIBA 1G3WA 1ZYRF 4MQ9F 3CUQC 3LQQA 2KIFA 4O6JA 1U2WA 1RNLA 2HOEA 2D45A 2LF7A 3I71A 2QLZA 4RB0A 2DO7A 3J80Z 1A04A 3ZQ7A 2P5KA 4M6XA 1T6SA 3HIFA 4G7OF 5HDKA 4LG0A 4WF2A 1Z6TA 2XIGA 2VC0A 2XHKA 2VOOA 3WU1B 2K7LA 5CVJA 2ZXJA 3C1DA 1GXPA 3IKVA 5FD5A 4LLLA 3RPQA 3TOAA 3EYYA 3V8KA 3QU3A 4ZZDA 2FE3A 2Y48A 2GXBA 2BEOA 2ADUA 3M1EA 4IXAA 2WC2A 5LLQA 4U0YA 1U3EM 4MQVA 2XAFA 2UXNA 3U2RA 3M8EA 2FNAA 5E20A 3LA7A 1HSTA 3RI4A 5DD8A 5LHGA 2COMA 4HDUA 1FYLA 4AIKA 1FWZA 2P7VB 1XD7A 3F8MA 1O3SA 3HSRA 2STWA 1KU2A 2QVOA 4KMFA 2H6CA 2FA5A 4LLGF 3H92A 5KVRA 4B09A 4XLNF 1BJAA 2EA2A 3Q9VA 1T2KA 3JTGA 4Y15A 4CO8A 3KP3A 5L3CA 3ZMUA 4P9FA 3CJNA 4LB6B 1IN6A 2FOKA 2J5OA 1EV7A 3GVAA 1FBQA 1R5GA 1KGSA 4A2UA 3ZMSA 1IW7F 1YIOA 2VBZA 3RYRA 2RVCA 4MEXF 2VOPA 2DU9A 4ENMA 1Z05A 3F8FA 5EEGA 4LG0B 2E7XA 2VT2A 1B1BA 4RS8A 1ZGJA 3WGGA 2CYYA 4I98B 5L3DA 4A0XA 3R0AA 3L00A 3ZPLA 2HQRA 2P5VA 2DI3A 2JSCA 1LDDA 2KJCA 1WWXA 4EJWA 3WTXC 1GVJA 5TJJA 2JPBA 2PG4A 3F8BA 5LEKA 4RGXA 1JE8A 2Q8KA 2FNPA 4A6EA 2P5LC 5ICCA 1HSJA 3JSOA 2ZBKA 1NHAA 2L4AA 5L3EA 2L3DA 2JRTA 3CUOA 4RB2C 4RGSA 1FC3A 2VONA 2X0LA 2XAQA 5LEJA 3DQVC 1H9TA 2EV5A 4PGHA 3L9FA 3PQJA 1FY7A 4YIFA 3O3KA 1S8NA 2VE9A 2MH2A 1RIOH 4Y13A 3FZVA 3ECOA 1AOYA 4ON0A 1HBXG 4KA4A 1Y0UA 2HFHA 2JT1A 1TQIA 4JBAA 3IC7A 2K02A 4AWXB 1DDNA 4HLXA 4WXDA 4L9JA 1YG2A 4EGZA 5DV5A 5A2QK 1U6GA 1OPCA 1LEBA 4BHBA 5BMZA 2E7WA 2R3SA 2V9VA 3MCZA 2PFBA 2O3FA 5H6QA 4OMZA 1IN5A 3KEOA 2YSRA 1EH8A 3V7RA 1YTYA 3FM5A 1DP7P 3JSPA 2DQLA 2CQKA 4RAYA 1W5SA 3HSEA 4CHUA 1B59A 5AONA 4NQWA 3CDHA 4M9ZA 2DT5A 1G4DA 1YFHA 3WTTC 2P6SA 2C6YA 3W6KB 1TW2A 3E3VA 3GLXA 1O3TA 2K4JA 4XBFA 3E6BA 3I54A 1W5TA 3MZYA 2GA2A 3BJ6A 3GXOA 4UVBA 3C18A 2NAZA 1C0WA 3HRSA 3KETA 3WTVC 1KYZA 1AWCA 2F5FA 3OOPA 5BS6A 4KN4X 3P9KA 1OYIA 2NS0A 5CVRA 3LA2A 2EK5A 4LK0F 2VT3A 2OQGA 1MJ9A 3E5UA 1FLIA 3BOQA 2LDUA 2K27A 5CVIA 2ISYA 3N97A 3N4MA 2RNJA 4H0EA 5FFXA 2PJPA 2IA2A 1HKQA 5JR3A 2V79A 2G9WA 3REOA 3GZ6A 2HQNA 4HW0A 2XV4S 5ED4A 4YFNF 2DK8A 1L3LA 2MH9A 1R7JA 4OOIA 1XDUA 2M45A 2K4BA 2L54A 5L3GA 3I58A 4ESJA 1U78A 4Y17A 1ON1A 1W4MA 3E5XA 4RGUA 2ZCWA 1SD7A 3IRQA 2UWMA 1E17A 1WSUA 5BQTA 3SXYA 1HQCA 2GA1A 3BP8A 3DF8A 2OZUA 4OIRF 4JQFA 3C3WA 3M8FA 5ILSA 2Y0MA 3RKYA 1XMAA 3I53A 2EJRA 3E6DA 4I09A 2XASA 3HOTA 2DK5A 1BI2A 2Z33A 5LGTA 3BY6A 4ETSA 1YLFA
chains in the Genus database with same CATH superfamily
2XPUA 1B4AA 2GAUA 1S3JA 3JAMZ 3FWEA 5EEHA 2B0LA 1OLTA 2BGCA 3W6JB 4A3IJ 2ZFWA 5DUIA 2EFPA 3BR5A 2VQGA 3TO9A 3C2HA 3IKTA 3ESWB 1EJ9A 2QUFA 4M72A 4K2EA 5B1AH 3AG3H 4IHTA 1OCPA 4OMYA 2A5WA 2W84A 4DQ2A 3ZMZA 3AL0B 1XB4A 1WJBA 5D5WB 1FOWA 2D1HA 4UUVA 5TRDA 5KK1A 1BI0A 4HX8A 1TT5B 4AVZA 4TV7A 4MEYF 3OIPA 2BY3A 1LVKA 2AO9A 2L9SA 3ZCOA 2ACJA 1V55H 1LEAA 2IP2A 5K7FA 5ILVA 3KYLA 1ZG5A 3NAUA 3IRRA 1GV5A 1AHDP 1MSFC 4Z2YA 4UB8C 4IRGA 4ENNA 5FLXZ 1J2XA 3LOCA 2R7SA 3HC7A 2TDXA 4KMUX 2PMHA 1ZHFA 3KZYA 3CO6C 5M3FJ 2GQQA 1ZN2A 1YS6A 2E60A 5LHIA 5E3LA 3OYKA 3C7JA 1IUFA 3A4CA 4XLAA 3SEZA 4DZJA 4ZH4F 3CJTB 1N25A 1LNWA 4D7MA 2DDBA 2STTA 1R4NB 4BHCA 4CDGA 2MD5A 4BEHA 1Y6IA 1QPMA 1V5FA 4CCJA 5E8IA 1N78A 3FKJA 5L3BA 3WODF 4Z6YA 3V4GA 3I0TA 4A3LJ 1S6LA 4PJJA 2ME0A 1EA3A 1R49A 1I50J 4L9NA 4ESFA 2KMUA 2R7DA 1F36A 2NVYJ 2HI3A 2X1CA 2IGNA 4I76A 4A69C 3KEQA 3HEFA 1ZR4A 1EH6A 2R93J 2X1EA 4XL9A 2M0CA 3Q0VA 3RKWA 3E6MA 1BC7C 1IRGA 1F5TA 3CLQA 1L0OC 2FMYA 1X4OA 3IL2A 1YJ9I 3KEYA 1R00A 4PK4A 1P92A 3D5RC 1UZCA 5CVUA 1TWFJ 1UG2A 4A3JJ 1Q1HA 4G12A 3RIRA 3ZP5A 5K7ZA 2DPUA 2R0QC 1ZLKA 4DYRA 3LAPA 4HNVA 3H9GA 1Y8QB 2HEOA 1S7AA 2QGUA 3PFYA 4G7ZF 3BPXA 3E5QA 1S29A 1F9NA 2YR2A 1IF1A 1EF4A 2O9LA 4B3XA 2VQHA 1TW3A 1BI1A 5EZHA 3DPLC 3O8HA 5FKLA 3GFIA 3QAHA 3KYCB 4S0HB 4B43A 2EFNA 4BXUA 2JQ7A 2UZKA 3I64A 2GWRA 2XB0X 3HPGA 1O7LA 3G1OA 2CW0F 1UHWA 2VC1A 2ZJQF 3KZZA 1PYVA 2J5PA 4UHTA 3CMAI 1D0YA 4BBSJ 4Y3OA 5FKOA 3IH4A 1TTYA 3AKZA 4UB6C 1VQPI 2KKOA 2F2EA 3WTYC 5HODA 4YFXF 1E0EA 1I5ZA 3FBNB 4IHSA 3ABTA 3PIPF 3LFUA 2DODA 3ABUA 2CV1A 4RM3A 4YELA 3EUHC 4KYWA 2NOJB 4ZYGA 3LSKA 4XSXF 4XICA 4JYKA 3KLOA 1GV2A 1SFUA 1ZTRA 1G3YA 3Q0WA 1IN7A 1Z91A 1SFKA 1IUYA 1DUXC 3HDDA 3I5UA 2KRHA 2B63J 1ETXA 5LBQA 4IPAA 2DYRH 2OUMA 5CLSA 5IT9Z 4GYIA 4BY7J 2WB1A 5E3OA 5C44J 1R58A 2JA8J 1J09A 3KP5A 2WV0A 4BEHB 1D0XA 1SMYF 3J7AY 2E34A 3GWZA 1I1GA 3OS1A 3FX3A 2X4HA 4EJUA 1ZRCA 1E2XA 1HW5A 1ENHA 2ETHA 5JLXA 5J1UA 3TO7A 2HS5A 2VBWA 3DTKA 4PFPA 1TNSA 3QP6A 3PFIA 3VODA 3FISA 4I01A 2O8KA 4WCGA 3HOSA 2DAOA 3ZQLA 1MJBA 3ZMDA 2MLKA 1I3AA 2W7NA 2X51A 5EGOB 4HG2A 1IV6A 3OYDA 2VODA 2RV8A 1DGWY 1OJLA 5GTHC 1AU7A 4KISA 1Z7LA 4GYGA 3H5NA 3QOPA 3JREA 2Y2ZA 1VI0A 2K86A 5FO5A 2D1VA 1EH7A 2HYFA 2A69F 4BS9A 4WX9A 2MA3A 3IHUA 1TT0A 4PJLA 1MH3A 2DDAA 4XLFA 2XSDC 4HRIA 2JK3A 1O4XA 1TWHJ 1V5GA 2QQAA 3WHCA 1JGSA 4R8HA 3OYEA 2NOGA 4LK1F 2Z9OA 2W57A 1RC9A 1GLNA 4GDFA 4G6DA 2AQFA 3SHFA 4RB3C 1BOAA 4BJ5C 4A93J 1U9OA 1RI7A 3IWFA 3VYRB 2E1MC 2JTVA 3DBLB 3UKGA 4A6DA 5HLHA 2NS7A 3W2WA 1WI9A 1U5TA 2R7XA 3Q9SA 2ZKZA 1ORKA 3DEEA 2ZO4A 2M3AA 1KONA 4OWRB 5IP9J 3MZHA 4KICA 3I59A 3BROA 4D5FA 1KU3A 2H8WA 1UB9A 2W25A 4FETA 3OYGA 1ON2A 1UHMA 2WTEA 2XGDA 1JUPA 4WK8F 4PGGA 4UXNA 3F3XA 3I55I 4G6QA 3T0YA 2JPCA 3JRCA 2V9KA 3GW2A 3AL0C 3K9TA 1YHQI 4MGRA 2W00A 3S1MJ 1DPUA 5HOOA 1UAAA 2OCCH 2M87A 3NQOA 3CC4I 5ICFA 1HF0A 4PZJA 1FP1D 1XMKA 3H9JA 1BL0A 4A3BJ 1YS7A 3K2AA 1J59A 2VN2A 1OCRH 4G6TB 4W1UA 2V1UA 2DT6A 3WG9A 1OCOH 4GO1A 3RQIA 3I4NJ 5LFAA 2FEZA 3J81Z 4P1WA 3Q5FA 1QNTA 3LSJA 4P9UA 5ICEA 1LJ9A 4IEJA 1RESA 3BTJA 3JAMK 2RDPA 3WGIA 2A07F 3ZQHA 3PQKA 2OJED 4XN3A 2BZTA 4HX7A 2ID3A 4QPOA 5D6EA 4NBQA 3ERED 1DPRA 4F7ZA 4LG3A 2JUCA 2B7EA 3DFGA 4LGWA 4FISA 2MC4A 2L7FP 1Y1WJ 5J8FA 2JUGA 3UNGC 2ICWG 1K6YA 3K0LA 5HLIA 5HS8A 3LFKA 4YIIA 5F27A 2A6EF 2OZ6A 4I7HA 1E3PA 2BV6A 3DPTA 3QP5A 2TRTA 5EG0A 3CC7I 2QBYA 4I0BA 3L2QA 2BXYA 1I27A 1U9NA 2O8XA 5M5WJ 2M1BA 2CMPA 3T5XA 1HOMA 1RUNA 1DU0A 3GYHX 4KITB 1VQOI 1KQ8A 1TNTA 2XF7A 1KU7A 3D5LA 5BPIA 1HW1A 1S5LC 1UFMA 3VFZA 4S04A 2OD5A 2DCEA 2XGCA 1SFEA 3F9KA 1JXSA 1HXDA 4BJ6C 1D1BA 5D8KB 5FJ8J 1TQMA 2HXOA 4HDVA 1DGRM 4E7ZA 4NUBA 1X3UA 2ESHA 2FUG2 3FXRA 2VPRA 3LSRA 2DMNA 5IYBJ 2LNBA 3VOEA 4I6ZA 1FSEA 4M6YA 3ZOBA 1J9IA 2HOSA 1TZLA 4RAZA 2DBBA 4FTHA 4A3FJ 1D5VA 4B44A 3GX4X 2LP0A 1CF7A 3GF2A 3VPRA 4B8XA 4KDPA 4AD9A 4XORA 2CSOA 4O5VA 2ZNYA 1MDMA 4E7SA 5F0HA 1NK2P 2HPIA 2GXGA 5CQEA 2OQRA 1ZRDA 1Z6RA 1U5TB 3MKLA 4XRFA 4C2TA 2LR8A 2MABA 1FOKA 5E1WA 1W7PD 1IG7A 4L5IA 3BQZA 3CMMA 5DYMA 2QSGX 1I1SA 3I59B 4XOTA 5M5XJ 3R61A 2O0YA 3RKXA 3CUQA 2K9SA 3B02A 3S8PA 4G7HF 3ECHA 4GFBA 1R5HA 3I9V2 4XR6A 4Q48A 3VEPA 1N75A 4HF1A 3KZIC 4P5OA 5BPDA 4XRMA 1B9NA 1P7JA 5F6FA 2X6YA 3RQ4A 1IXCA 3G6EI 4DOZA 2QEXI 2XC7A 5EDNA 3UR3C 3OY9A 2Y75A 2KZVA 3VB2A 4C2MJ 3QU6A 1IN8A 4HX4A 1SEUA 4I02A 1IJWC 3HKZA 1WKMA 5E79C 3F8CA 1ZLJA 2LY9A 4IF4A 2F48A 2HPMA 2DA7A 3DBRB 4JK1X 5B1BH 5GADJ 4L5JA 4ZYHA 3X2QH 5GAEJ 2QA4I 1KZHA 3DEUA 2H6BA 2L9VA 3DXJF 3LL7A 4EGYA 1JI8A 5TISC 1DP3A 2LOOA 2XGEA 3OYMA 2CH0A 3BCBA 3MMYB 3BZ6A 4J00A 2CQNA 3FXUA 3ZN0A 2R7TA 4V2GA 3U1DA 2WWYA 3R60A 1VZ0A 1V5EA 3K4BA 3J80K 5EG0B 2FSWA 2HZTA 5K7HA 2QBYB 4RM2A 5DUKA 4L18B 3V8JA 5HS9A 4EVIA 3OYIA 3OMYA 2DTRA 2HR3A 2A6HF 3BR2A 3V42A 1OKRA 4IVNA 3QPSA 2A6TA 2F4IA 5HDNA 2OC6A 2G7UA 4FASD 2HDCA 3S93A 1F4KA 3BC8A 4IHWA 2XAGA 3HUGA 2EPFA 4M3DA 2JA5J 1J7KA 2M2EA 3BR6A 2MFZA 3ML6A 3RJPA 4BE0A 2PLYA 2PEXA 3K4CA 4L5EA 3HYIA 1BM9A 3E1SA 1GHCA 4PCQA 3N05A 2M7BA 2IT0A 2E19A 5IT9K 2E1CA 4O3MA 1W7PA 3E0JB 4GCVA 2GOXB 1BR4A 1Y1VJ 3L2CA 1CF7B 1MMGA 1B6AA 3MWMA 2XAUA 3P9CA 1R22A 2EIJH 3MVPA 3CJQB 3EDPA 1MDMB 1FX7A 2YU9J 1TLHB 2WB1N 2FD5A 3FMQA 2GOMA 3MD2A 1D5YA 5ERIA 3WGHA 2QKLB 2V1DA 1KQ0A 2DJNA 2IVMA 3TP0A 1QHHD 5HNFA 4LLNA 4XLCA 2VQCA 5CVVA 3HGGA 3HL2A 4E7IA 4LMYA 3CUQB 1POGA 4OINF 1V3FA 2CGPA 3TO6A 1MZBA 2ELKA 1X1BA 2RKHA 3HHGA 5E1ZB 1ETQA 1WPKA 1PP8F 4CYCA 4IHXA 3BWGA 3H36A 4KNYA 2LY2A 1ONVA 4FT8A 1O3RA 3CCEI 1J75A 1GDTA 5EJCA 4GXOA 4MHGA 3HM5A 1U0JA 4AYBA 4EM1A 2VL8A 1O57A 4RB1A 2OAZA 1OISA 1K61A 3BJOA 1VQNI 4RBOA 1DQUA 1H88C 2LSOA 1R6RA 5JHFA 4M3EA 3DLLF 3LSGA 1M1EB 2CUEA 2EFQA 2CV2A 1GUUA 3ZMVA 3L2RA 1IXSB 3V7CA 1W36C 3OYCA 4M3GA 3HBLA 2BVLA 3FXJA 1MW7A 3DKXA 4XRSA 1I6HJ 2LKPA 3GTJJ 2KRCA 1XS9A 1HDPA 1IN4A 1BC8C 5DEQA 3KLNA 1T08B 4CXFA 1TWGJ 2HVQA 2M30A 1MH4A 2RQPA 5FD6A 4UUSB 4JX6A 2AQEA 3K2ZA 2QYOA 3S17J 1JHHA 4E4HA 2CG4A 1ZGAA 1A31A 4GGGA 2X1DA 1UCRA 5H20A 2DLLA 4HOBA 1VQ8I 3BG9A 4D7NA 3BT9A 3PUFA 4CICA 4JP0A 1XTAA 2ZMEA 1SFXA 5KAIC 4HZFA 1YRNA 1YX3A 2L01A 2QF7A 2D2WA 1SVOA 3DBHB 3OL4A 2DMTA 3QYBA 4OAYA 4DGWB 5IT3A 4M71A 1WJ5A 3HUGB 1ZGWA 5D5VB 3BTIA 4L9VA 5J40A 2VKEA 3RCOA 2IS2A 4HV5A 1GXQA 1NH3A 2Y69H 3K4KA 1ZH5A 3GFJA 4R79A 1QZEA 1W7PB 5IP6A 1G6NA 4UVCA 4U0WA 2R92J 1XSXA 3H3ZA 3R6SA 2P81A 4UY8I 2HNHA 2I10A 1P2FA 1XX5A 1MNMC 4BQQA 3ERMA 2M4KA 3PJRA 1KU9A 1OR7A 1SANA 4A5NA 2ZSIB 1CGPA 1P7IA 3DKYA 2EILH 1I6XA 1U5TC 2RGVA 4XLHA 2PBIA 5J6XA 1JHFA 2IXSA 5J1RA 3WTSC 3OIQA 4IX7A 2Y31A 2OA4A 2NRAC 1QPIA 5JLWA 2PMUA 1X3ZB 2R7WA 2VJ5A 3F6VA 1YJWI 1XDSA 2XAJA 3F22A 4CYCB 1FJLA 4A3MJ 3S2HJ 1UMQA 2ESNA 2F5EA 2HQ5A 2BXZA 1VQLI 2IS1A 4HEA2 4D1QA 1BR1A 2IAIA 1W5CC 3CCMI 4BDZA 2LRDA 3H0GJ 3F72A 4AU7A 1STZA 3TQNA 4LIUA 3GTLJ 3W3CA 4IHVA 5D4SA 3S16J 3CMYA 4CGZA 2E1OA 2L2OA 1FYKA 2NNNA 3RYPA 2QKMB 5FRMA 4HF2A 3RPUD 3FKIJ 1IZ1A 1XGNA 3PIOF 1FIAA 4KIFA 1BIBA 3S3MA 1AKHA 2FBKA 4A3EJ 5H6RA 4CZCA 3EYIA 2ME6A 5BNGA 2KHMA 4AIHA 1IAWA 2RC4A 3JRHA 2X48A 2EV0A 4RDUA 4CCMA 5B66C 1T0FA 3MFKA 3CLOA 5EGOA 4NC8A 2CO5A 4HYEA 4ABZA 4ZDPA 2VPLA 2EB7A 2X6WA 5E8GA 2KT0A 3TDZC 4PDKA 3OSGA 3K1MA 1IC8A 3LQRA 1HCRA 3RTRA 2WAFA 3DV8A 3CCVI 3B6AA 4M3FA 4IZZA 1HKSA 2ID6A 2ZMEB 4BKXA 1T8IA 1YRNB 4MNUA 1MBHA 3A03A 5LD2C 1BW6A 4PJNA 3S32A 2L02A 1OYWA 1JTXA 3EETA 1LVAA 2RQQA 2Q0OA 2LKXA 3RKQA 4Q4ZF 3SZTA 4E7HA 1Z3XA 5HLTA 2O6GE 4XRSG 1GT0C 1R1TA 2XUBA 2M0MA 2YPRA 2G0EA 1WHUA 4ZC3A 4Y33A 3VYUB 5JHUA 4M6VA 2DMPA 3HKZN 5A2QZ 5CQGA 4BH9A 2EZLA 4X0GA 1U8BA 2FQ3A 2AXLA 2E36A 3WG7H 4M9SA 2G7HA 2DA4A 4B3AA 1K79A 2Z16A 4U0VA 1VFCA 2WAQN 2BBYA 1R71A 3J7AO 4I2OA 2X85A 2ELJA 2DFEA 2Q2EA 3OYLA 3GTPJ 4BL0B 1P4WA 2DXIA 2F6CA 4HBLA 4XSZF 5GPAA 3FXLA 3TKYA 5IYCJ 2CFOA 1JTYA 3OYNA 1P6RA 2PMZA 4NNJA 2GIZA 5KCMA 2I5UA 3F23A 4KT6A 4RAFA 1CQTA 1XGOA 1TBXA 4D0PA 1VNDA 4JX4A 5J47A 1Z3YA 4G9YA 1XCBA 3HB9A 2FBHA 2FXAA 2R7FA 1BR2A 3FBIB 3SZPA 1F1ZA 1FBSA 3QWLA 3RPUA 3BZKA 3K4MA 3JRFA 1WFXA 4IRIA 1MKMA 3IAS2 1SAXA 3ROUA 2KDZA 1B72A 1QO0D 1ZRFA 1XGSA 5F1RA 3BJAA 1JKQC 1WI3A 3VYTB 3R4KA 5FKKA 3MKZA 4A3CJ 3BG7A 2KIUA 3BQYA 1BIAA 3CC2I 1ETKA 2RAEA 1ZQ3P 4XONA 4G8XA 1Z1DA 1JT0A 1APLC 4G94A 1ZG3A 2XVCA 2Z5UA 4HSRA 4E7KA 1JKRC 1QGPA 2A05A 1K7AA 1AKHB 2IPQX 1BBYA 2DQRA 1T95A 4X1EA 2Y9YA 2YUSA 1QBJA 1QU3A 4OIPF 2P6TA 3CMEI 4RAGA 3K1NA 3GTMJ 4LITA 4L0ZB 1X3WB 1ZG1A 2VB6A 2BYVE 4DBQA 2XKPA 2WY7Q 2PN6A 2W85A 4BXXJ 2HTJA 1B9MA 2EZKA 4P96A 1MBKA 2Y30A 4A3KJ 4LD5A 1MD0A 2V1XA 3BDDA 4OIQF 4XN0A 3HJEA 2OBPA 3P5JA 2XKOA 3EUAA 2OTJI 3B6CA 5D8LB 1UHSA 2H94A 5BOXA 2KFDA 3LMMA 3FXMA 4A5MA 4H4KC 1J0RA 2F5CA 4AYBN 1WQ2A 1REPC 1VQ6I 1O3QA 3KP2A 4CZZA 2NS8A 3DLAA 2P8TA 4C2UA 2IJLA 3FIWA 1T98A 4E7JA 1D1AA 2VI6A 4ZDOA 1XGMA 1FPQA 1SD5A 4KUMA 5KHDA 1G3TA 2E71A 2FU4A 4EM0B 5J4YA 4UV9A 2HVSA 2GZWA 2I8DA 1WJFA 3WE2A 4D9JA 3TOBA 2HOTA 2PI0A 1ZARA 4E70A 4U87A 2QWWA 2AHQA 3M7GA 4B4CA 2Q2EB 2X6OA 3HOUJ 1YYVA 2EFOA 3BPVA 3HGYA 1OCZH 3HRTA 2HYGD 5C3EJ 3L2WA 4U7BA 1D3YA 3WU0A 1MBJA 3EQLF 3M9AA 4HAMA 1J5YA 4NC7A 4L0YB 4AC0A 1A5JA 2Z99A 3A0BC 5K5QA 3JR9A 4WWCA 2QQ8A 3HZJA 5JI6A 3M4OJ 3NRVA 3K69A 2EV6A 2WBMA 2K9MA 5F1JA 2JRMA 4CCOA 5JVTA 2MLGA 3MAJA 1MMSA 2M5WA 4IOAF 1FSHA 1WJDA 5L3FA 1SD6A 2YU3A 1B72B 4FX0A 4AIDA 3TDUC 4HPQA 3KIOA 1WZ2A 3FDYA 3CP8A 2H8RA 1V54H 4EQQA 1IDZA 1RR7A 1XSVA 1USTA 1USSA 1ACIA 2BOLA 5J8CA 4U88A 5GAHJ 3WTZA 3DEWA 2HXIA 5AIQA 1FNNA 3G73A 1H0MA 2HZDA 1K78A 2O03A 5LRSA 1R1UA 2QM3A 3LSIA 3R0JA 2KISA 3B73A 2LFBA 4C30A 1LFUP 1FZPB 1XN7A 2IGOA 3FHZA 1Y39A 4IRHA 1MGTA 1R36A 3LSTA 2LY1A 3S14J 5HVQC 3SZGA 5M3MJ 2L0KA 4E6KG 3JTHA 4EJVA 4RA2A 4U7DA 2XRNA 3RDIA 1T38A 1AA7A 3GMEA 1S7OA 2EWNA 3AFHA 5FLXK 3CD6I 3WTUC 4YIRX 2KRFA 5FRNA 1IRXA 1K4SA 3QYFA 5HLGA 5GP9A 2CW8A 3JRBA 4EJOA 2CWEA 5K1YA 2H09A 2QQ9A 2IGKA 5LGUA 1JT6A 2E35A 1HKTA 3PM1A 2XF6A 3HTUA 1RZ4A 5D6FA 2JMWA 2DYSH 4S05A 1R4MB 2YX4A 3OR1C 1TP4A 3T8TA 4YG2F 1XPXA 4EATA 5DM7F 3WE3A 1YW8A 3GUDA 1G3SA 5J4VA 2O7OA 3OYHA 3BTCA 4ENKA 3GEZA 1P4XA 2Q1ZB 3OS2A 3ONQA 1PUFA 4ZTFA 1U8RA 2CW7A 3GBGA 4P55A 1G59A 1ETOA 4EMSA 4MTEA 1FP2A 2L4MA 1JKPC 3D0SA 2QSHX 4AIJA 3RSNA 1YITI 2A3SA 1SVLA 1HLVA 1XSDA 3FMRA 2LF8A 1WJAA 1HW2A 4BDYA 2RN7A 2BY2A 4XMYA 3A01A 2IRFG 3SQNA 2GM4A 3E7LA 4HF0A 3LSPA 4W97A 4XLPF 1YW7A 3C2BA 2L7ZA 3V7SA 1OCCH 3W6VA 1S7EA 2DTZA 2JZYA 4ASNA 4E7LA 3F6OA 2IS6A 3QYEA 4IJAA 3ABLH 3LSHA 2VKVA 1FMVA 1H9GA 3EUHA 2B9SA 5E1XA 2DA2A 3O2PE 2P0WA 2FF4A 1TWCJ 2OU2A 2H1LA 3F21A 1LE8A 1R23A 3RZOJ 2ZB9A 2EBIA 3BZCA 3HRUA 4D5CA 1RKWA 2WAQA 4ZZLA 1ODDA 2QQBA 4UVAA 4J19A 2XDVA 3FM3A 1JUSA 3DWLE 1K78B 1FYMA 4UUSA 4MTDA 4HLYA 5F64A 2LTPA 3MEXA 4R1HA 2F5VA 2W82A 1MBFA 3ZGKA 3CTAA 4KN7X 1S9HA 3J7YJ 4CA0A 1ZKGA 2O5RA 2VBXA 1RR8C 1LQ1A 3KCCA 4N0BA 1WH7A 3KE2A 5IPAA 2FQ4A 3PO2J 2PX9A 4BGDA 4M74A 2WADA 4BYYA 4CYDA 3LWFA 2CFXA 1Z67A 2PMZN 5GAGJ 2HWVA 4PFOA 3CCQI 4BNCA 3CO7C 3K70D 2A5YB 2DA3A 1KA8A 5IP7J 1YW9A 4DBRA 3ASOH 1OYYA 3GZ5A 4UNOA 1K6OA 3GTKJ 4BQAA 2MBFA 3HOWJ 4ANJA 3O6BB 2K40A 2V1NA 5LRRA 3G3ZA 5FFZA 4AVPA 1MNEA 4PSXA 2R7VA 3BR1A 3HHHA 2P7CB 2WA0A 4BBRJ 4DW6A 4KIGA 2EZIA 3P7NA 3LA3A 4LIVA 4ZYEA 5LGNA 5DCMA 1Y56A 3OOUA 1FBUA 2VLAA 2EFWA 2FJ1A 3ISPA 1T39A 4IHYA 3QPLA 5KAFC 5FKMA 5DTDA 5D5UB 5ICGA 5E3MA 1PP7U 3WTWC 2ELHA 2M7AA 3OV8A 1PUFB 4BAYA 2V6EA 3E97A 3CF2A 5EF6A 2RREA 3QOEA 1PDNC 3FXQA 1Z77A 4RLFA 5DCFA 1A35A 3K4NA 4XQFA 4L9TA 5DD4A 4N9IA 1R1VA 1SC7A 2QENA 1ZAOA 2NVQJ 1OQYA 3FMSA 2XPVA 3QQAA 3QRFF 1VQ9I 3A01B 5H2FC 2OPTA 3CCSI 4EV0A 2HDWA 5AIPA 1D8KA 4A0ZA 5CYVA 1X1DA 2LLKA 2PQ8A 2A68F 3ELKA 3VWBA 3SYTA 4HQEA 3O8GA 4FHTA 1WVRA 4MO7A 3DU5A 4F91B 1E3OC 3DP7A 3Q0UA 2VXZA 2LYCA 4LJZF 2IA1A 4M73A 1LE8B 1X58A 3GFMA 5FGMA 1FMWA 1KQ9A 2HTSA 1E3HA 4ZTJA 3COAC 2F5DA 4I99C 4LFUA 5E18F 4ESBA 3GFLA 5HNHA 3ZN1A 2E5ZA 2M8EA 4OAZA 5CJ9A 2KIQA 2K85A 1TQPA 5D4RA 5EYRA 4ZJZA 1YIJI 4DIQA 3L2VA 3SFZA 2UXXA 1ZELA 3HRMA 4B1RA 2ZJ2A 6PAXA 2KJBA 5FB2A 3TL4X 5E17F 2WAEA 2OV7A 4KT5C 3NWTA 4NHJA 5EZGA 4C3HJ 3K1PA 2VE8A 1JKOC 3S3NA 1QHGA 1ULYA 4WXCA 1DU6A 5ILUA 2FBIA 3G2BA 5GTIC 1Z7UA 1JUMA 3CZ6A 3BCAA 1V4RA 1I39A 1XC5A 2LK2A 3K4JA 3J81K 2CUFA 3KP6A 2CQXA 5LHHA 5F08A 2XPWA 2YX7A 4F92B 3U21A 1LFPA 3TEDA 4Q5SF 1P4AA 2W24A 2M9HA 4DYQA 4YFKF 3QPTA 2V6CA 1A6IA 4QWQA 2BVMA 3CF5F 2FOWA 2LC2A 2E2IJ 5FKNA 1W0UA 5C4JJ 5K5RA 3LAJA 2DT7B 3HG9A 2LREA 1YO5C 2DW4A 4BUPA 2DPDA 4HA8A 3IWZA 4F55A 3JRDA 3PSIA 4LB5A 4PJMA 3T8RA 3F8NA 1O7FA 5DCMB 2FMLA 1W0TA 1BOBA 2E1MB 4I0AA 4ENJA 2LG4A 4OU0A 3PNVA 4YEJA 3TMOA 3K6GA 5FROA 3L7WA 2O61A 2BW3B 4A12A 3L09A 4NC6A 4FE7A 4KJZA 2OTLI 2DMQA 5D5XB 2AS5F 1LB2A 2HKOA 3ULQB 4MIMA 4FE4A 2NNYA 4XKCA 3TGNA 2JA6J 4QTRA 3QPHA 3DTIA 4QLCU 2ZNZA 5HS7A 4F52A 1OCTC 1HC8A 5F0FA 2EQRA 1FT9A 2KIMA 2IS4A 1BN5A 2GIVA 1OMIA 2LBFA 1QQIA 1D0ZA 3ZMTA 1GVDA 2HDDA 3GZNB 3BG3A 4QPQA 4EJTA 2X6XA 3M8JA 1IRFA 1T56A 2EA4A 1LKXA 3JRAA 2VBYA 4BXFA 2W4SA 3S2WA 1WJEA 2ISZA 2IW5A 4XKWA 3G1LA 1BI3A 3HSFA 3E6CC 3KP7A 3OR2C 5FLMJ 3P9IA 2P4WA 3EUKL 1ZREA 1WJCA 2NYXA 4M3BA 3U9GA 3OIOA 4Q47A 4UV8A 2VXDA 3G4SI 1SD4A 3FF5A 4ZYDA 2XROA 5GPCA 2XAHA 3WHBA 1QZYA 4WXHA 4NB5A 3HTSB 1KYWA 2EIKH 1H8AC 1X1AA 4OIOF 2IA0A 3IH2A 2ZC2A 3NEUA 5DDGA 1QZZA 1XCVA 1WRJA 3V8LA 2IBDA 1VTNC 1YX5A 4MLOA 2MC3A 3GO5A 1X19A 1LDJA 2R4GA 3MZ8A 1BJZA 5CKTA 4A0YA 1Z9CA 2W1OA 3H3UA 4RGRA 1W36D 2H27A 2TCTA 3C2GA 2NVXJ 3DKWA 2HVRA 2F4OB 5J3LA 2DFIA 1MBGA 1ZK8A 3JW4A 1D8JA 3KP4A 3JRIA 4BJTA 4KFCA 2JSPA 1JJ6C 2V9PA 4PSWA 3MQ0A 4DJAA 3AAFA 2R5YA 1K4TA 1VQ4I 4FX4A 2HKXA 3I4PA 3VSLA 1VQ5I 4EM2A 4XKBA 3WU2C 2VKDA 2ZXHA 4II3A 5JFRA 3T1BA 4RLQA 2K9LA 1NG7A 1IXRC 4HV6A 1A36A 3KFWX 3L1PA 2BE5F 4BQNA 3CQZJ 1FIPA 4BACA 4X6AJ 2HGCA 1BA5A 2Z3YA 2FRHA 5K5OA 1YQAA 2OF7A 4BHPA 1MJAA 2XGXA 1B8IA 1LFBA 3DCFA 4RMNA 2E1NA 2JA2A 2XF5A 3K7AJ 2QZ8A 2A61A 4M9XA 5HDGA 3HOXJ 3D5SC 4HQMA 3BG5A 1PUEE 1LDKB 4HNUA 2NVTJ 1RUOA 4DNCA 1XMXA 1SMTA 4HSTA 4N9HA 4KIBA 1G3WA 2CU7A 1FOYA 3MKYB 3OYAA 1ZYRF 2JWTA 4MQ9F 3CUQC 3LQQA 2KIFA 2XSJC 4O6JA 1U2WA 1RNLA 2HOEA 3IP4B 2D45A 3ZR8X 3G71I 2LF7A 3FHNA 3I71A 3S15J 3HOZJ 2CJJA 2VKHA 2QLZA 1ETWA 3PL8A 2LBFB 2HYJA 4RB0A 2DO7A 2ZXWH 3J80Z 1A04A 3H35A 3ZQ7A 2P5KA 4M6XA 1T6SA 3HIFA 4G7OF 5HDKA 3A2KA 1IO2A 4LG0A 4WF2A 1Z6TA 5B3SH 3OSFA 3JCUC 2M8GX 4HNTA 2E2HJ 1X2NA 1P9QC 2XIGA 2BY1A 3CCRI 3DTEA 2VC0A 5M5YJ 2FX0A 3F0CA 3AG4H 4A3GJ 2XHKA 3S2DJ 3JRGA 3ZRGA 2VOOA 3WU1B 3ZQIA 2K7LA 5CVJA 2ZXJA 4ITVA 1Y8RB 3M3YJ 4C9YA 1Z0XA 3C1DA 1GXPA 3IKVA 5FD5A 4LLLA 3ZQCA 3RPQA 4Y7NJ 3TOAA 3EYYA 4FCYA 2Y0SA 2NXNB 4AUXA 3TW7A 3V8KA 3QU3A 3H9QA 4C3IJ 4ZZDA 2FE3A 5IYDJ 2K3FA 2LKSA 3KYDB 2Y48A 1FEXA 2E2JJ 1T33A 2BEOA 2V4JC 2GXBA 2ADUA 2VIXA 1ZR2A 3M1EA 4IXAA 1TC3C 2WC2A 4CCKA 2KDOA 3CCUI 5LLQA 4UUTA 4U0YA 1JJ8C 3BLYA 2CUJA 1U3EM 4MQVA 2XAFA 2UXNA 2XRLA 4IQJA 3U2RA 3M8EA 2R5YB 2FNAA 2CQ7A 5E20A 3LA7A 2VJIA 3IH3A 1HSTA 3RI4A 5DD8A 1W1WE 2DOEA 5LHGA 2HOAA 2COMA 4HDUA 2VUMJ 2ECCA 2DA1A 3BG6A 3QODA 4JOMA 4II2A 1FYLA 1R5ID 4AIKA 1FWZA 3GLLA 3MN2A 2P7VB 1UJ8A 1XD7A 3I3LA 3TP3A 3F8MA 1O3SA 3HSRA 5F0CA 2STWA 1KU2A 4IQ4A 2IGMA 2QVOA 4KMFA 3HOYJ 2H6CA 3IV5A 2FA5A 4LLGF 3H92A 2E5NA 3KPHA 3H0DA 4V19K 2EZHA 1IDYA 5KVRA 4B09A 4XM3A 1B8IB 4XLNF 2MG4A 4J01A 1BJAA 2W48A 3HPHA 2EA2A 3Q9VA 2DOAA 1T2KA 3JTGA 4Y15A 4CO8A 3KP3A 1ETYA 1Q1VA 2EIMH 2JN6A 5L3CA 4NDLA 3ZMUA 3EPZA 4P9FA 5J1YA 3I4MJ 4BQOA 3CJNA 2LVSA 2L7KA 1IN6A 4LB6B 1S72I 2FOKA 2J5OA 4V2FA 1EV7A 1SAUA 3GVAA 3NWSA 3M07A 1FBQA 1R5GA 1KGSA 1VQ7I 2L5QA 3DPUA 3PO3J 4A2UA 3ZMSA 1IW7F 2JVGA 3VDXA 4EEFG 2R5ZA 2DA5A 3CCLI 1YIOA 5CPRB 2VBZA 3RYRA 2RVCA 4Y52J 3FK7A 2AXTC 1G2HA 2EH3A 2Z1DA 2ZSHB 4MEXF 2GXAA 2VOPA 3NARA 1PJRA 2RNGA 3AG2H 2DU9A 4ENMA 3BR0A 1VQKI 4XNFA 1Z05A 2MSYA 3F8FA 3PUBA 5EEGA 4LG0B 2E7XA 4XOPA 2VT2A 1B1BA 4RS8A 1ZGJA 2KPMA 3WGGA 2CYYA 1WCMJ 4I98B 5L3DA 3A02A 4A0XA 3R0AA 3L00A 4CUGA 3ZPLA 3G1MA 2HQRA 2P5VA 1Z21A 2R7RA 2DI3A 2JSCA 2Z2SB 1LDDA 1SFOJ 2KJCA 1WWXA 4EJWA 3WTXC 1GVJA 3L2UA 1MMAA 2CRGA 5TJJA 4CH7A 3H5AA 2JPBA 2PG4A 3F8BA 4IOCF 5LEKA 3HOVJ 2R7QA 3ABKH 2R7ZJ 4RGXA 1QVTA 1RPWA 3OS0A 1JE8A 2Q8KA 2MW8A 3S1QJ 2FNPA 3K70C 4A6EA 2BHZA 2P5LC 5ICCA 2MGQA 3J7ZI 1HSJA 2K3PA 2ZMEC 3JSOA 2ZBKA 1NHAA 2L4AA 5L3EA 2L3DA 2JRTA 4GRIA 5C4XJ 3CUOA 2GLOA 4RB2C 2VQLA 4RGSA 1FC3A 2DN0A 2VONA 2X0LA 2ZFUA 2ZJRF 2XAQA 5LEJA 3FXKA 3DQVC 1K83J 1H9TA 2EV5A 1X2MA 1X4PA 2V7FA 1YOVB 2K9QA 4PGHA 3L9FA 3SFIA 4F3QA 4XIDA 3PQJA 2COBA 2L9NA 2QSFX 1FY7A 4YIFA 4A3DJ 3O3KA 1FOXA 4CSWA 1S8NA 1G8XA 4IKFA 2CQQA 3ZQGA 2H1KA 2VE9A 2MH2A 2YS9A 4QSHA 1RIOH 1MIJA 3ZQQA 2DMUA 1OR7C 4Y13A 5DM6F 3FZVA 3ECOA 1AOYA 4ON0A 5B5EC 1WH5A 1HBXG 2KZGA 3W2AA 4KA4A 1Y0UA 1WGXA 2DOFA 2ECBA 2HFHA 2CV0A 2JT1A 3ABMH 1TQIA 4JBAA 3Q3SA 3IC7A 2K02A 2VASA 4AM3A 3S3OA 3OYFA 4AWXB 4QIWN 2PJRA 3M1CA 2R5ZB 1DDNA 2K5CA 3H3VK 4HLXA 1VQMI 4WXDA 3PNYA 1MBEA 4L9JA 4YRVA 1YG2A 4MFEA 4EGZA 2JA7J 1JGGA 4IO9F 2R7OA 5DV5A 5A2QK 1ETVA 3DU6A 1U6GA 1OPCA 4PUSA 1LEBA 2IEKA 4BU2A 4BHBA 5BMZA 1BW5A 2E7WA 2R3SA 2V9VA 3MCZA 3H1CA 2PFBA 5DS9A 2O3FA 3BR3A 1X1PA 2UUZA 5H6QA 4B48A 4OMZA 1IN5A 2D5VA 3KEOA 2YSRA 2DFHA 3GCMA 3IAM2 1EH8A 3V7RA 1YTYA 1XG1A 4CCLA 2KLOA 3FM5A 1DP7P 2QCOA 4ZYAA 5E3NA 2DFFA 2DQLA 2UV1A 3JSPA 3CJRB 2CQKA 3LNQA 3CESA 1EKEA 3SEQA 1NG6A 1T0FC 4RAYA 2DA6A 1W5SA 3HSEA 4CHUA 3GTQJ 1B59A 5AONA 3ZXSA 3OYJA 4NQWA 4MFDA 3CDHA 4DZPA 1LUJB 4M9ZA 2DT5A 1UELB 2L9RA 4ZDLA 1H89C 3TBIA 4B47A 1G4DA 1YFHA 3WTTC 2P6SA 3FK6A 1FTZA 3U1KA 2C6YA 2MYSA 3W6KB 1TW2A 1D1CA 2M34A 2WV1A 1MNDA 3CP2A 3CDLA 3E3VA 3HXLA 3KX2A 3GLXA 1OFCX 1O3TA 3FXOA 2DJIA 2K4JA 4XBFA 3E6BA 3I54A 3RZDJ 1MMDA 1RRJA 2JVHA 1I3QJ 1W5TA 3MZYA 2GA2A 3BJ6A 3GXOA 4UVBA 1VF9A 3C18A 1RKTA 1HA8A 2NAZA 2BW3A 4Y4RA 1C0WA 2ZXIA 3HRSA 4XK4A 3KETA 3PSFA 1IV8A 3WTVC 1KYZA 3W2VA 2CUZA 1AWCA 2F5FA 2JJ7A 3K4LA 3OOPA 2NVUB 5BS6A 4FQGA 4KN4X 3P9KA 1YI2I 1OYIA 2NS0A 5CVRA 4N4NB 1LPQA 3LA2A 5F04A 1F43A 4DYCA 3S1RJ 3ZQFA 2EK5A 4LK0F 2LMDA 2Y0SN 2VT3A 4JX5A 3TW6A 2OQGA 1TL8A 1MJ9A 3BTLA 5KNLA 5IY5H 3E5UA 3OYBA 1FLIA 2GBYA 3BOQA 4F93B 2HQAA 1RETA 2LDUA 3OL3A 2K27A 1X1CA 5CVIA 3I56I 2PJRB 2ISYA 2BHYA 4CCNA 3N97A 3N4MA 2RNJA 1IGNA 2VJJA 4H0EA 1NK3P 1UG0A 5FFXA 3PNTA 2PJPA 4XKVA 2BY0A 3H5RA 1QA6A 4IL6C 3MKWB 1QVUA 1TWAJ 2IA2A 2L7MP 1Y0NA 4BE1A 1NTCA 3D1NI 4BE2A 1HKQA 5IOZA 2OCEA 5JR3A 2R7UA 3ASNH 3OWTA 3SDGA 2V79A 2G9WA 5IOYA 3REOA 5EEAA 1FTTA 3GZ6A 5TGTA 1ITYA 5FLVA 2HQNA 2V26A 4HW0A 2XV4S 1ERDA 5ED4A 2XB5A 4YFNF 2DK8A 2Y9ZA 1L3LA 1YE9A 2MH9A 2N8GA 4C3JJ 1R7JA 1HDDC 2MD0A 4OOIA 1XDUA 2M45A 2X9DA 3AG1H 2K4BA 4PJ0C 3GTOJ 2HU9A 3IUOA 2EINH 2KL4A 2L54A 3GTGJ 5L3GA 3S1NJ 3I58A 4ESJA 1U78A 4Y17A 1ON1A 1W4MA 4BY1J 1A6QA 3E5XA 4RGUA 4LOCA 4NQWB 2ZCWA 1SD7A 3VYSB 3IRQA 2UWMA 1IRZA 2M4GA 1MMNA 1SVMA 1E17A 1WSUA 3VSKA 3SXYA 1HQCA 2GA1A 5BQTA 3BP8A 3DF8A 2LD5A 2K9NA 2OZUA 1R9TJ 4OIRF 4JQFA 3C3WA 2LH9A 3A0HC 3M8FA 2VJ4A 5ILSA 2Y0MA 3A1YA 1QRYA 3RKYA 2ZJPF 1MSEC 1XMAA 3CCJI 1PVEA 1N77A 3I53A 2KQRA 4XLEA 2F4MB 2WY8Q 4N4OB 9ANTA 2EJRA 3K10A 3SDBA 3E6DA 4I09A 2XASA 3HOTA 3LSMA 2DK5A 1BI2A 2CS3A 1YJNI 2Z33A 5LGTA 3SJMA 3CCYA 3BY6A 2KP6A 4ETSA 1YLFA 3CDIA 5JVGF
chains in the Genus database with same CATH topology
1B4AA 2GAUA 1S3JA 3JAMZ 3FWEA 5EEHA 2B0LA 2BGCA 3W6JB 2ZFWA 5DUIA 2EFPA 3TO9A 3IKTA 2QUFA 4M72A 4K2EA 4IHTA 4OMYA 2W84A 4DQ2A 3ZMZA 1XB4A 5D5WB 4UUVA 2D1HA 5TRDA 5KK1A 1BI0A 4HX8A 4TV7A 4MEYF 2ACJA 1LEAA 2IP2A 5ILVA 1ZG5A 3IRRA 4Z2YA 4IRGA 4ENNA 5FLXZ 1J2XA 2TDXA 4KMUX 2PMHA 1ZHFA 3KZYA 3CO6C 2GQQA 1ZN2A 1YS6A 5LHIA 3C7JA 4ZH4F 1LNWA 2STTA 4BHCA 4CDGA 2MD5A 1QPMA 5E8IA 5L3BA 3WODF 3V4GA 3I0TA 1S6LA 4L9NA 4ESFA 2R7DA 3KEQA 1EH6A 3RKWA 3E6MA 1BC7C 1IRGA 1F5TA 1L0OC 2FMYA 3IL2A 1R00A 1P92A 5CVUA 1Q1HA 3RIRA 3ZP5A 2DPUA 1ZLKA 3LAPA 2HEOA 1S7AA 4G7ZF 3BPXA 3E5QA 1S29A 1F9NA 2YR2A 1IF1A 1TW3A 1BI1A 3DPLC 3GFIA 3QAHA 2EFNA 4BXUA 2UZKA 3I64A 2GWRA 1O7LA 2CW0F 1UHWA 2VC1A 3KZZA 2J5PA 4UHTA 1TTYA 2KKOA 2F2EA 3WTYC 4YFXF 1I5ZA 4IHSA 3ABTA 3ABUA 4KYWA 4ZYGA 4XSXF 3KLOA 1SFUA 1G3YA 1IN7A 1Z91A 1IUYA 1DUXC 3I5UA 5LBQA 4IPAA 5IT9Z 5CLSA 4GYIA 1R58A 3KP5A 2WV0A 1SMYF 3GWZA 1I1GA 3FX3A 2X4HA 4EJUA 1ZRCA 1E2XA 1HW5A 2ETHA 3TO7A 2HS5A 2VBWA 1TNSA 3QP6A 3PFIA 3VODA 4I01A 4WCGA 3HOSA 2DAOA 1MJBA 3ZMDA 2MLKA 2VODA 2RV8A 4GYGA 3QOPA 2K86A 5FO5A 2D1VA 1EH7A 2HYFA 2A69F 4WX9A 2MA3A 3IHUA 2QQAA 1JGSA 4R8HA 4LK1F 2Z9OA 2W57A 4G6DA 3SHFA 4RB3C 1BOAA 1RI7A 3IWFA 2JTVA 4A6DA 5HLHA 1WI9A 1U5TA 3Q9SA 2ZKZA 2ZO4A 3MZHA 4KICA 3I59A 3BROA 1KU3A 1UB9A 2W25A 1ON2A 1UHMA 2WTEA 4WK8F 4PGGA 4UXNA 3F3XA 4G6QA 3T0YA 2JPCA 3GW2A 3K9TA 4MGRA 1DPUA 5HOOA 2M87A 3NQOA 5ICFA 4PZJA 1FP1D 1XMKA 1YS7A 1J59A 2VN2A 2V1UA 3WG9A 4GO1A 2FEZA 3J81Z 3Q5FA 1QNTA 4P9UA 5ICEA 1LJ9A 3JAMK 2RDPA 3WGIA 2A07F 3PQKA 4HX7A 5D6EA 3ERED 1DPRA 4F7ZA 3DFGA 4LGWA 5J8FA 3K0LA 5HLIA 5HS8A 3LFKA 4YIIA 2A6EF 2OZ6A 4I7HA 3DPTA 2BV6A 3QP5A 2QBYA 4I0BA 1I27A 2O8XA 2M1BA 3T5XA 1RUNA 3GYHX 1KQ8A 1TNTA 1KU7A 3D5LA 5BPIA 1HW1A 1UFMA 3VFZA 4S04A 2OD5A 1SFEA 1JXSA 1HXDA 5D8KB 1TQMA 4HDVA 1X3UA 2ESHA 3FXRA 2LNBA 3VOEA 1FSEA 4M6YA 1J9IA 4RAZA 2DBBA 1D5VA 3GX4X 1CF7A 4KDPA 3GF2A 4B8XA 4AD9A 2CSOA 4O5VA 2ZNYA 1MDMA 2GXGA 2OQRA 1ZRDA 1Z6RA 1U5TB 4XRFA 1FOKA 5E1WA 1W7PD 4L5IA 5DYMA 1I1SA 3I59B 3R61A 2O0YA 3RKXA 3CUQA 3B02A 4G7HF 3ECHA 1R5HA 4Q48A 3VEPA 4HF1A 4P5OA 5BPDA 1B9NA 5F6FA 1IXCA 2Y75A 3VB2A 3QU6A 1IN8A 4HX4A 4I02A 1WKMA 3F8CA 1ZLJA 4IF4A 4JK1X 4ZYHA 4L5JA 3DEUA 2H6BA 3DXJF 4EGYA 3BZ6A 3FXUA 3ZN0A 3U1DA 2WWYA 3R60A 3J80K 2FSWA 2HZTA 2QBYB 5DUKA 4L18B 3V8JA 5HS9A 4EVIA 2DTRA 2HR3A 2A6HF 1OKRA 4IVNA 5HDNA 2G7UA 2HDCA 1F4KA 2XAGA 3HUGA 1J7KA 3RJPA 3ML6A 2PLYA 2PEXA 3HYIA 1BM9A 1GHCA 4PCQA 2IT0A 5IT9K 2E1CA 4O3MA 1W7PA 4GCVA 3L2CA 1CF7B 1B6AA 3MWMA 3P9CA 1R22A 3EDPA 1MDMB 1FX7A 1TLHB 3FMQA 5ERIA 3WGHA 2V1DA 1KQ0A 2IVMA 4LLNA 5CVVA 4LMYA 3CUQB 4OINF 1V3FA 2CGPA 3TO6A 1MZBA 2RKHA 3HHGA 5E1ZB 1PP8F 3BWGA 4KNYA 1ONVA 4FT8A 1O3RA 1J75A 4GXOA 4MHGA 4EM1A 1O57A 4RB1A 2OAZA 3BJOA 2LSOA 2EFQA 3ZMVA 1IXSB 3V7CA 2LKPA 1IN4A 1BC8C 5DEQA 3KLNA 4CXFA 2M30A 2RQPA 5FD6A 3K2ZA 2QYOA 1JHHA 2CG4A 1ZGAA 4GGGA 1UCRA 5H20A 2DLLA 4HOBA 4CICA 2ZMEA 1SFXA 4HZFA 2L01A 2D2WA 5IT3A 4M71A 5D5VB 4L9VA 4HV5A 1GXQA 1ZH5A 3GFJA 4R79A 1W7PB 1G6NA 4UVCA 4U0WA 1XSXA 3H3ZA 3R6SA 1P2FA 1KU9A 1OR7A 4A5NA 1CGPA 1I6XA 1U5TC 2RGVA 2PBIA 5J6XA 1JHFA 3WTSC 2OA4A 2NRAC 2PMUA 3F6VA 1XDSA 2XAJA 3F22A 2ESNA 2F5EA 3F72A 1STZA 3TQNA 5D4SA 4CGZA 1FYKA 2NNNA 3RYPA 4HF2A 1IZ1A 1XGNA 4KIFA 1BIBA 2FBKA 5H6RA 3EYIA 4AIHA 1IAWA 2RC4A 2EV0A 1T0FA 3MFKA 3CLOA 2CO5A 4HYEA 2EB7A 5E8GA 3TDZC 4PDKA 3K1MA 3LQRA 3RTRA 3DV8A 1HKSA 2ZMEB 4MNUA 2L02A 1OYWA 3EETA 1LVAA 2Q0OA 4Q4ZF 3SZTA 2O6GE 1R1TA 2XUBA 2YPRA 5JHUA 5A2QZ 4BH9A 2FQ3A 2AXLA 4M9SA 2G7HA 1K79A 4U0VA 2BBYA 3J7AO 4I2OA 2Q2EA 1P4WA 4HBLA 4XSZF 3TKYA 1P6RA 3F23A 1XGOA 1TBXA 4D0PA 4G9YA 1XCBA 2FBHA 2FXAA 2R7FA 3SZPA 1F1ZA 1FBSA 3RPUA 4IRIA 1MKMA 1SAXA 3ROUA 1ZRFA 1QO0D 1XGSA 5F1RA 3BJAA 3R4KA 2KIUA 1BIAA 4G8XA 1Z1DA 4G94A 1ZG3A 2XVCA 2Z5UA 1QGPA 1K7AA 2IPQX 2DQRA 1BBYA 1QBJA 4OIPF 2P6TA 3K1NA 4L0ZB 1ZG1A 2BYVE 2XKPA 2PN6A 2W85A 2HTJA 1B9MA 4P96A 4LD5A 1MD0A 2V1XA 3BDDA 4OIQF 2OBPA 2XKOA 5D8LB 2H94A 5BOXA 4A5MA 1J0RA 2F5CA 1WQ2A 1REPC 1O3QA 3KP2A 4CZZA 2P8TA 2IJLA 1T98A 1XGMA 1FPQA 1SD5A 4KUMA 1G3TA 4EM0B 2FU4A 4UV9A 2GZWA 3WE2A 3TOBA 2PI0A 1ZARA 4E70A 2QWWA 3M7GA 1YYVA 2EFOA 3BPVA 3HRTA 2HYGD 4U7BA 1D3YA 3WU0A 3EQLF 3M9AA 4HAMA 1J5YA 4L0YB 2Z99A 5K5QA 4WWCA 5JI6A 3NRVA 3K69A 2EV6A 5JVTA 2MLGA 3MAJA 2M5WA 1FSHA 5L3FA 1SD6A 2YU3A 4FX0A 3TDUC 4EQQA 1XSVA 1USTA 1USSA 5J8CA 4U88A 3WTZA 5AIQA 1FNNA 3G73A 1H0MA 1K78A 2O03A 5LRSA 1R1UA 2QM3A 3R0JA 3B73A 1FZPB 1XN7A 3FHZA 4IRHA 1MGTA 1R36A 3LSTA 5HVQC 3JTHA 4EJVA 4U7DA 2XRNA 3RDIA 1T38A 1S7OA 2EWNA 5FLXK 3WTUC 2KRFA 5HLGA 4EJOA 2CWEA 5K1YA 2H09A 2QQ9A 5LGUA 1HKTA 3HTUA 1RZ4A 5D6FA 4S05A 2YX4A 3T8TA 4YG2F 3WE3A 1YW8A 3GUDA 1G3SA 4ENKA 3GEZA 1P4XA 1U8RA 4P55A 4EMSA 4MTEA 1FP2A 2L4MA 3D0SA 4AIJA 2A3SA 1XSDA 3FMRA 2LF8A 1HW2A 2RN7A 2IRFG 3SQNA 4HF0A 4XLPF 1YW7A 3V7SA 2JZYA 4ASNA 3F6OA 4IJAA 1H9GA 3EUHA 5E1XA 3O2PE 2FF4A 2OU2A 3F21A 1R23A 3HRUA 4ZZLA 1ODDA 2QQBA 4UVAA 3FM3A 1K78B 1FYMA 4MTDA 4HLYA 5F64A 3MEXA 4R1HA 3CTAA 4KN7X 2VBXA 1LQ1A 3KCCA 4N0BA 3KE2A 4M74A 4BYYA 4CYDA 3LWFA 2CFXA 2HWVA 4BNCA 3CO7C 2A5YB 1KA8A 1YW9A 1OYYA 3GZ5A 4UNOA 1K6OA 4BQAA 2MBFA 3O6BB 5LRRA 3G3ZA 5FFZA 4AVPA 3HHHA 2P7CB 4KIGA 3P7NA 3LA3A 4ZYEA 5LGNA 5DCMA 1FBUA 2EFWA 3ISPA 1T39A 5D5UB 5ICGA 1PP7U 3WTWC 2ELHA 3OV8A 4BAYA 3E97A 1PDNC 3FXQA 5DCFA 4L9TA 5DD4A 4N9IA 1R1VA 2QENA 1ZAOA 3FMSA 3QRFF 4EV0A 5AIPA 1D8KA 4A0ZA 5CYVA 2PQ8A 2A68F 3ELKA 4HQEA 4FHTA 3DP7A 2VXZA 4LJZF 2IA1A 4M73A 3GFMA 5FGMA 1KQ9A 2HTSA 3COAC 2F5DA 4LFUA 5E18F 4ESBA 3GFLA 3ZN1A 2M8EA 5CJ9A 5D4RA 1TQPA 3SFZA 2UXXA 3HRMA 2ZJ2A 6PAXA 2KJBA 5FB2A 5E17F 4KT5C 4NHJA 3K1PA 2VE8A 1ULYA 4WXCA 5ILUA 2FBIA 1Z7UA 1V4RA 3J81K 3KP6A 5LHHA 2YX7A 4Q5SF 1P4AA 2W24A 4YFKF 3QPTA 2V6CA 4QWQA 5K5RA 3LAJA 1YO5C 2DW4A 2DPDA 4HA8A 3IWZA 4LB5A 3T8RA 3F8NA 1O7FA 5DCMB 2FMLA 4I0AA 4ENJA 4OU0A 3L7WA 2O61A 4A12A 3L09A 5D5XB 2AS5F 1LB2A 2HKOA 3ULQB 2NNYA 3TGNA 3QPHA 4QLCU 2ZNZA 5HS7A 1FT9A 2KIMA 1BN5A 2GIVA 1OMIA 1QQIA 3ZMTA 4EJTA 1IRFA 2EA4A 2VBYA 3S2WA 2ISZA 2IW5A 1BI3A 3HSFA 3E6CC 3KP7A 3P9IA 2P4WA 1ZREA 3U9GA 2NYXA 4Q47A 4UV8A 1SD4A 2XROA 3FF5A 4ZYDA 2XAHA 1QZYA 4WXHA 4NB5A 3HTSB 1KYWA 4OIOF 2IA0A 3NEUA 5DDGA 1QZZA 1XCVA 1WRJA 3V8LA 1VTNC 2MC3A 3GO5A 1LDJA 4A0YA 1Z9CA 3H3UA 4RGRA 2H27A 3DKWA 2DFIA 3JW4A 1D8JA 3KP4A 4KFCA 3MQ0A 3AAFA 4FX4A 2HKXA 3I4PA 4EM2A 5JFRA 3T1BA 1IXRC 4HV6A 3KFWX 2BE5F 2HGCA 2Z3YA 2FRHA 5K5OA 1YQAA 4BHPA 1MJAA 2XGXA 2E1NA 2QZ8A 2A61A 4M9XA 5HDGA 4HQMA 1PUEE 1LDKB 1RUOA 4DNCA 1SMTA 4N9HA 4KIBA 1G3WA 1ZYRF 4MQ9F 3CUQC 3LQQA 2KIFA 4O6JA 1U2WA 1RNLA 2HOEA 2D45A 2LF7A 3I71A 2QLZA 4RB0A 2DO7A 3J80Z 1A04A 3ZQ7A 2P5KA 4M6XA 1T6SA 3HIFA 4G7OF 5HDKA 4LG0A 4WF2A 1Z6TA 2XIGA 2VC0A 2XHKA 2VOOA 3WU1B 2K7LA 5CVJA 2ZXJA 3C1DA 1GXPA 3IKVA 5FD5A 4LLLA 3RPQA 3TOAA 3EYYA 3V8KA 3QU3A 4ZZDA 2FE3A 2Y48A 2GXBA 2BEOA 2ADUA 3M1EA 4IXAA 2WC2A 5LLQA 4U0YA 1U3EM 4MQVA 2XAFA 2UXNA 3U2RA 3M8EA 2FNAA 5E20A 3LA7A 1HSTA 3RI4A 5DD8A 5LHGA 2COMA 4HDUA 1FYLA 4AIKA 1FWZA 2P7VB 1XD7A 3F8MA 1O3SA 3HSRA 2STWA 1KU2A 2QVOA 4KMFA 2H6CA 2FA5A 4LLGF 3H92A 5KVRA 4B09A 4XLNF 1BJAA 2EA2A 3Q9VA 1T2KA 3JTGA 4Y15A 4CO8A 3KP3A 5L3CA 3ZMUA 4P9FA 3CJNA 4LB6B 1IN6A 2FOKA 2J5OA 1EV7A 3GVAA 1FBQA 1R5GA 1KGSA 4A2UA 3ZMSA 1IW7F 1YIOA 2VBZA 3RYRA 2RVCA 4MEXF 2VOPA 2DU9A 4ENMA 1Z05A 3F8FA 5EEGA 4LG0B 2E7XA 2VT2A 1B1BA 4RS8A 1ZGJA 3WGGA 2CYYA 4I98B 5L3DA 4A0XA 3R0AA 3L00A 3ZPLA 2HQRA 2P5VA 2DI3A 2JSCA 1LDDA 2KJCA 1WWXA 4EJWA 3WTXC 1GVJA 5TJJA 2JPBA 2PG4A 3F8BA 5LEKA 4RGXA 1JE8A 2Q8KA 2FNPA 4A6EA 2P5LC 5ICCA 1HSJA 3JSOA 2ZBKA 1NHAA 2L4AA 5L3EA 2L3DA 2JRTA 3CUOA 4RB2C 4RGSA 1FC3A 2VONA 2X0LA 2XAQA 5LEJA 3DQVC 1H9TA 2EV5A 4PGHA 3L9FA 3PQJA 1FY7A 4YIFA 3O3KA 1S8NA 2VE9A 2MH2A 1RIOH 4Y13A 3FZVA 3ECOA 1AOYA 4ON0A 1HBXG 4KA4A 1Y0UA 2HFHA 2JT1A 1TQIA 4JBAA 3IC7A 2K02A 4AWXB 1DDNA 4HLXA 4WXDA 4L9JA 1YG2A 4EGZA 5DV5A 5A2QK 1U6GA 1OPCA 1LEBA 4BHBA 5BMZA 2E7WA 2R3SA 2V9VA 3MCZA 2PFBA 2O3FA 5H6QA 4OMZA 1IN5A 3KEOA 2YSRA 1EH8A 3V7RA 1YTYA 3FM5A 1DP7P 3JSPA 2DQLA 2CQKA 4RAYA 1W5SA 3HSEA 4CHUA 1B59A 5AONA 4NQWA 3CDHA 4M9ZA 2DT5A 1G4DA 1YFHA 3WTTC 2P6SA 2C6YA 3W6KB 1TW2A 3E3VA 3GLXA 1O3TA 2K4JA 4XBFA 3E6BA 3I54A 1W5TA 3MZYA 2GA2A 3BJ6A 3GXOA 4UVBA 3C18A 2NAZA 1C0WA 3HRSA 3KETA 3WTVC 1KYZA 1AWCA 2F5FA 3OOPA 5BS6A 4KN4X 3P9KA 1OYIA 2NS0A 5CVRA 3LA2A 2EK5A 4LK0F 2VT3A 2OQGA 1MJ9A 3E5UA 1FLIA 3BOQA 2LDUA 2K27A 5CVIA 2ISYA 3N97A 3N4MA 2RNJA 4H0EA 5FFXA 2PJPA 2IA2A 1HKQA 5JR3A 2V79A 2G9WA 3REOA 3GZ6A 2HQNA 4HW0A 2XV4S 5ED4A 4YFNF 2DK8A 1L3LA 2MH9A 1R7JA 4OOIA 1XDUA 2M45A 2K4BA 2L54A 5L3GA 3I58A 4ESJA 1U78A 4Y17A 1ON1A 1W4MA 3E5XA 4RGUA 2ZCWA 1SD7A 3IRQA 2UWMA 1E17A 1WSUA 5BQTA 3SXYA 1HQCA 2GA1A 3BP8A 3DF8A 2OZUA 4OIRF 4JQFA 3C3WA 3M8FA 5ILSA 2Y0MA 3RKYA 1XMAA 3I53A 2EJRA 3E6DA 4I09A 2XASA 3HOTA 2DK5A 1BI2A 2Z33A 5LGTA 3BY6A 4ETSA 1YLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4A A;  2GAU A;  1S3J A;  3JAM Z;  3FWE A;  5EEH A;  2B0L A;  2BGC A;  3W6J B;  2ZFW A;  5DUI A;  2EFP A;  3TO9 A;  3IKT A;  2QUF A;  4M72 A;  4K2E A;  4IHT A;  4OMY A;  2W84 A;  4DQ2 A;  3ZMZ A;  1XB4 A;  5D5W B;  4UUV A;  2D1H A;  5TRD A;  5KK1 A;  1BI0 A;  4HX8 A;  4TV7 A;  4MEY F;  2ACJ A;  1LEA A;  2IP2 A;  5ILV A;  1ZG5 A;  3IRR A;  4Z2Y A;  4IRG A;  4ENN A;  5FLX Z;  1J2X A;  2TDX A;  4KMU X;  2PMH A;  1ZHF A;  3KZY A;  3CO6 C;  2GQQ A;  1ZN2 A;  1YS6 A;  5LHI A;  3C7J A;  4ZH4 F;  1LNW A;  2STT A;  4BHC A;  4CDG A;  2MD5 A;  1QPM A;  5E8I A;  5L3B A;  3WOD F;  3V4G A;  3I0T A;  1S6L A;  4L9N A;  4ESF A;  2R7D A;  3KEQ A;  1EH6 A;  3RKW A;  3E6M A;  1BC7 C;  1IRG A;  1F5T A;  1L0O C;  2FMY A;  3IL2 A;  1R00 A;  1P92 A;  5CVU A;  1Q1H A;  3RIR A;  3ZP5 A;  2DPU A;  1ZLK A;  3LAP A;  2HEO A;  1S7A A;  4G7Z F;  3BPX A;  3E5Q A;  1S29 A;  1F9N A;  2YR2 A;  1IF1 A;  1TW3 A;  1BI1 A;  3DPL C;  3GFI A;  3QAH A;  2EFN A;  4BXU A;  2UZK A;  3I64 A;  2GWR A;  1O7L A;  2CW0 F;  1UHW A;  2VC1 A;  3KZZ A;  2J5P A;  4UHT A;  1TTY A;  2KKO A;  2F2E A;  3WTY C;  4YFX F;  1I5Z A;  4IHS A;  3ABT A;  3ABU A;  4KYW A;  4ZYG A;  4XSX F;  3KLO A;  1SFU A;  1G3Y A;  1IN7 A;  1Z91 A;  1IUY A;  1DUX C;  3I5U A;  5LBQ A;  4IPA A;  5IT9 Z;  5CLS A;  4GYI A;  1R58 A;  3KP5 A;  2WV0 A;  1SMY F;  3GWZ A;  1I1G A;  3FX3 A;  2X4H A;  4EJU A;  1ZRC A;  1E2X A;  1HW5 A;  2ETH A;  3TO7 A;  2HS5 A;  2VBW A;  1TNS A;  3QP6 A;  3PFI A;  3VOD A;  4I01 A;  4WCG A;  3HOS A;  2DAO A;  1MJB A;  3ZMD A;  2MLK A;  2VOD A;  2RV8 A;  4GYG A;  3QOP A;  2K86 A;  5FO5 A;  2D1V A;  1EH7 A;  2HYF A;  2A69 F;  4WX9 A;  2MA3 A;  3IHU A;  2QQA A;  1JGS A;  4R8H A;  4LK1 F;  2Z9O A;  2W57 A;  4G6D A;  3SHF A;  4RB3 C;  1BOA A;  1RI7 A;  3IWF A;  2JTV A;  4A6D A;  5HLH A;  1WI9 A;  1U5T A;  3Q9S A;  2ZKZ A;  2ZO4 A;  3MZH A;  4KIC A;  3I59 A;  3BRO A;  1KU3 A;  1UB9 A;  2W25 A;  1ON2 A;  1UHM A;  2WTE A;  4WK8 F;  4PGG A;  4UXN A;  3F3X A;  4G6Q A;  3T0Y A;  2JPC A;  3GW2 A;  3K9T A;  4MGR A;  1DPU A;  5HOO A;  2M87 A;  3NQO A;  5ICF A;  4PZJ A;  1FP1 D;  1XMK A;  1YS7 A;  1J59 A;  2VN2 A;  2V1U A;  3WG9 A;  4GO1 A;  2FEZ A;  3J81 Z;  3Q5F A;  1QNT A;  4P9U A;  5ICE A;  1LJ9 A;  3JAM K;  2RDP A;  3WGI A;  2A07 F;  3PQK A;  4HX7 A;  5D6E A;  3ERE D;  1DPR A;  4F7Z A;  3DFG A;  4LGW A;  5J8F A;  3K0L A;  5HLI A;  5HS8 A;  3LFK A;  4YII A;  2A6E F;  2OZ6 A;  4I7H A;  3DPT A;  2BV6 A;  3QP5 A;  2QBY A;  4I0B A;  1I27 A;  2O8X A;  2M1B A;  3T5X A;  1RUN A;  3GYH X;  1KQ8 A;  1TNT A;  1KU7 A;  3D5L A;  5BPI A;  1HW1 A;  1UFM A;  3VFZ A;  4S04 A;  2OD5 A;  1SFE A;  1JXS A;  1HXD A;  5D8K B;  1TQM A;  4HDV A;  1X3U A;  2ESH A;  3FXR A;  2LNB A;  3VOE A;  1FSE A;  4M6Y A;  1J9I A;  4RAZ A;  2DBB A;  1D5V A;  3GX4 X;  1CF7 A;  4KDP A;  3GF2 A;  4B8X A;  4AD9 A;  2CSO A;  4O5V A;  2ZNY A;  1MDM A;  2GXG A;  2OQR A;  1ZRD A;  1Z6R A;  1U5T B;  4XRF A;  1FOK A;  5E1W A;  1W7P D;  4L5I A;  5DYM A;  1I1S A;  3I59 B;  3R61 A;  2O0Y A;  3RKX A;  3CUQ A;  3B02 A;  4G7H F;  3ECH A;  1R5H A;  4Q48 A;  3VEP A;  4HF1 A;  4P5O A;  5BPD A;  1B9N A;  5F6F A;  1IXC A;  2Y75 A;  3VB2 A;  3QU6 A;  1IN8 A;  4HX4 A;  4I02 A;  1WKM A;  3F8C A;  1ZLJ A;  4IF4 A;  4JK1 X;  4ZYH A;  4L5J A;  3DEU A;  2H6B A;  3DXJ F;  4EGY A;  3BZ6 A;  3FXU A;  3ZN0 A;  3U1D A;  2WWY A;  3R60 A;  3J80 K;  2FSW A;  2HZT A;  2QBY B;  5DUK A;  4L18 B;  3V8J A;  5HS9 A;  4EVI A;  2DTR A;  2HR3 A;  2A6H F;  1OKR A;  4IVN A;  5HDN A;  2G7U A;  2HDC A;  1F4K A;  2XAG A;  3HUG A;  1J7K A;  3RJP A;  3ML6 A;  2PLY A;  2PEX A;  3HYI A;  1BM9 A;  1GHC A;  4PCQ A;  2IT0 A;  5IT9 K;  2E1C A;  4O3M A;  1W7P A;  4GCV A;  3L2C A;  1CF7 B;  1B6A A;  3MWM A;  3P9C A;  1R22 A;  3EDP A;  1MDM B;  1FX7 A;  1TLH B;  3FMQ A;  5ERI A;  3WGH A;  2V1D A;  1KQ0 A;  2IVM A;  4LLN A;  5CVV A;  4LMY A;  3CUQ B;  4OIN F;  1V3F A;  2CGP A;  3TO6 A;  1MZB A;  2RKH A;  3HHG A;  5E1Z B;  1PP8 F;  3BWG A;  4KNY A;  1ONV A;  4FT8 A;  1O3R A;  1J75 A;  4GXO A;  4MHG A;  4EM1 A;  1O57 A;  4RB1 A;  2OAZ A;  3BJO A;  2LSO A;  2EFQ A;  3ZMV A;  1IXS B;  3V7C A;  2LKP A;  1IN4 A;  1BC8 C;  5DEQ A;  3KLN A;  4CXF A;  2M30 A;  2RQP A;  5FD6 A;  3K2Z A;  2QYO A;  1JHH A;  2CG4 A;  1ZGA A;  4GGG A;  1UCR A;  5H20 A;  2DLL A;  4HOB A;  4CIC A;  2ZME A;  1SFX A;  4HZF A;  2L01 A;  2D2W A;  5IT3 A;  4M71 A;  5D5V B;  4L9V A;  4HV5 A;  1GXQ A;  1ZH5 A;  3GFJ A;  4R79 A;  1W7P B;  1G6N A;  4UVC A;  4U0W A;  1XSX A;  3H3Z A;  3R6S A;  1P2F A;  1KU9 A;  1OR7 A;  4A5N A;  1CGP A;  1I6X A;  1U5T C;  2RGV A;  2PBI A;  5J6X A;  1JHF A;  3WTS C;  2OA4 A;  2NRA C;  2PMU A;  3F6V A;  1XDS A;  2XAJ A;  3F22 A;  2ESN A;  2F5E A;  3F72 A;  1STZ A;  3TQN A;  5D4S A;  4CGZ A;  1FYK A;  2NNN A;  3RYP A;  4HF2 A;  1IZ1 A;  1XGN A;  4KIF A;  1BIB A;  2FBK A;  5H6R A;  3EYI A;  4AIH A;  1IAW A;  2RC4 A;  2EV0 A;  1T0F A;  3MFK A;  3CLO A;  2CO5 A;  4HYE A;  2EB7 A;  5E8G A;  3TDZ C;  4PDK A;  3K1M A;  3LQR A;  3RTR A;  3DV8 A;  1HKS A;  2ZME B;  4MNU A;  2L02 A;  1OYW A;  3EET A;  1LVA A;  2Q0O A;  4Q4Z F;  3SZT A;  2O6G E;  1R1T A;  2XUB A;  2YPR A;  5JHU A;  5A2Q Z;  4BH9 A;  2FQ3 A;  2AXL A;  4M9S A;  2G7H A;  1K79 A;  4U0V A;  2BBY A;  3J7A O;  4I2O A;  2Q2E A;  1P4W A;  4HBL A;  4XSZ F;  3TKY A;  1P6R A;  3F23 A;  1XGO A;  1TBX A;  4D0P A;  4G9Y A;  1XCB A;  2FBH A;  2FXA A;  2R7F A;  3SZP A;  1F1Z A;  1FBS A;  3RPU A;  4IRI A;  1MKM A;  1SAX A;  3ROU A;  1ZRF A;  1QO0 D;  1XGS A;  5F1R A;  3BJA A;  3R4K A;  2KIU A;  1BIA A;  4G8X A;  1Z1D A;  4G94 A;  1ZG3 A;  2XVC A;  2Z5U A;  1QGP A;  1K7A A;  2IPQ X;  2DQR A;  1BBY A;  1QBJ A;  4OIP F;  2P6T A;  3K1N A;  4L0Z B;  1ZG1 A;  2BYV E;  2XKP A;  2PN6 A;  2W85 A;  2HTJ A;  1B9M A;  4P96 A;  4LD5 A;  1MD0 A;  2V1X A;  3BDD A;  4OIQ F;  2OBP A;  2XKO A;  5D8L B;  2H94 A;  5BOX A;  4A5M A;  1J0R A;  2F5C A;  1WQ2 A;  1REP C;  1O3Q A;  3KP2 A;  4CZZ A;  2P8T A;  2IJL A;  1T98 A;  1XGM A;  1FPQ A;  1SD5 A;  4KUM A;  1G3T A;  4EM0 B;  2FU4 A;  4UV9 A;  2GZW A;  3WE2 A;  3TOB A;  2PI0 A;  1ZAR A;  4E70 A;  2QWW A;  3M7G A;  1YYV A;  2EFO A;  3BPV A;  3HRT A;  2HYG D;  4U7B A;  1D3Y A;  3WU0 A;  3EQL F;  3M9A A;  4HAM A;  1J5Y A;  4L0Y B;  2Z99 A;  5K5Q A;  4WWC A;  5JI6 A;  3NRV A;  3K69 A;  2EV6 A;  5JVT A;  2MLG A;  3MAJ A;  2M5W A;  1FSH A;  5L3F A;  1SD6 A;  2YU3 A;  4FX0 A;  3TDU C;  4EQQ A;  1XSV A;  1UST A;  1USS A;  5J8C A;  4U88 A;  3WTZ A;  5AIQ A;  1FNN A;  3G73 A;  1H0M A;  1K78 A;  2O03 A;  5LRS A;  1R1U A;  2QM3 A;  3R0J A;  3B73 A;  1FZP B;  1XN7 A;  3FHZ A;  4IRH A;  1MGT A;  1R36 A;  3LST A;  5HVQ C;  3JTH A;  4EJV A;  4U7D A;  2XRN A;  3RDI A;  1T38 A;  1S7O A;  2EWN A;  5FLX K;  3WTU C;  2KRF A;  5HLG A;  4EJO A;  2CWE A;  5K1Y A;  2H09 A;  2QQ9 A;  5LGU A;  1HKT A;  3HTU A;  1RZ4 A;  5D6F A;  4S05 A;  2YX4 A;  3T8T A;  4YG2 F;  3WE3 A;  1YW8 A;  3GUD A;  1G3S A;  4ENK A;  3GEZ A;  1P4X A;  1U8R A;  4P55 A;  4EMS A;  4MTE A;  1FP2 A;  2L4M A;  3D0S A;  4AIJ A;  2A3S A;  1XSD A;  3FMR A;  2LF8 A;  1HW2 A;  2RN7 A;  2IRF G;  3SQN A;  4HF0 A;  4XLP F;  1YW7 A;  3V7S A;  2JZY A;  4ASN A;  3F6O A;  4IJA A;  1H9G A;  3EUH A;  5E1X A;  3O2P E;  2FF4 A;  2OU2 A;  3F21 A;  1R23 A;  3HRU A;  4ZZL A;  1ODD A;  2QQB A;  4UVA A;  3FM3 A;  1K78 B;  1FYM A;  4MTD A;  4HLY A;  5F64 A;  3MEX A;  4R1H A;  3CTA A;  4KN7 X;  2VBX A;  1LQ1 A;  3KCC A;  4N0B A;  3KE2 A;  4M74 A;  4BYY A;  4CYD A;  3LWF A;  2CFX A;  2HWV A;  4BNC A;  3CO7 C;  2A5Y B;  1KA8 A;  1YW9 A;  1OYY A;  3GZ5 A;  4UNO A;  1K6O A;  4BQA A;  2MBF A;  3O6B B;  5LRR A;  3G3Z A;  5FFZ A;  4AVP A;  3HHH A;  2P7C B;  4KIG A;  3P7N A;  3LA3 A;  4ZYE A;  5LGN A;  5DCM A;  1FBU A;  2EFW A;  3ISP A;  1T39 A;  5D5U B;  5ICG A;  1PP7 U;  3WTW C;  2ELH A;  3OV8 A;  4BAY A;  3E97 A;  1PDN C;  3FXQ A;  5DCF A;  4L9T A;  5DD4 A;  4N9I A;  1R1V A;  2QEN A;  1ZAO A;  3FMS A;  3QRF F;  4EV0 A;  5AIP A;  1D8K A;  4A0Z A;  5CYV A;  2PQ8 A;  2A68 F;  3ELK A;  4HQE A;  4FHT A;  3DP7 A;  2VXZ A;  4LJZ F;  2IA1 A;  4M73 A;  3GFM A;  5FGM A;  1KQ9 A;  2HTS A;  3COA C;  2F5D A;  4LFU A;  5E18 F;  4ESB A;  3GFL A;  3ZN1 A;  2M8E A;  5CJ9 A;  5D4R A;  1TQP A;  3SFZ A;  2UXX A;  3HRM A;  2ZJ2 A;  6PAX A;  2KJB A;  5FB2 A;  5E17 F;  4KT5 C;  4NHJ A;  3K1P A;  2VE8 A;  1ULY A;  4WXC A;  5ILU A;  2FBI A;  1Z7U A;  1V4R A;  3J81 K;  3KP6 A;  5LHH A;  2YX7 A;  4Q5S F;  1P4A A;  2W24 A;  4YFK F;  3QPT A;  2V6C A;  4QWQ A;  5K5R A;  3LAJ A;  1YO5 C;  2DW4 A;  2DPD A;  4HA8 A;  3IWZ A;  4LB5 A;  3T8R A;  3F8N A;  1O7F A;  5DCM B;  2FML A;  4I0A A;  4ENJ A;  4OU0 A;  3L7W A;  2O61 A;  4A12 A;  3L09 A;  5D5X B;  2AS5 F;  1LB2 A;  2HKO A;  3ULQ B;  2NNY A;  3TGN A;  3QPH A;  4QLC U;  2ZNZ A;  5HS7 A;  1FT9 A;  2KIM A;  1BN5 A;  2GIV A;  1OMI A;  1QQI A;  3ZMT A;  4EJT A;  1IRF A;  2EA4 A;  2VBY A;  3S2W A;  2ISZ A;  2IW5 A;  1BI3 A;  3HSF A;  3E6C C;  3KP7 A;  3P9I A;  2P4W A;  1ZRE A;  3U9G A;  2NYX A;  4Q47 A;  4UV8 A;  1SD4 A;  2XRO A;  3FF5 A;  4ZYD A;  2XAH A;  1QZY A;  4WXH A;  4NB5 A;  3HTS B;  1KYW A;  4OIO F;  2IA0 A;  3NEU A;  5DDG A;  1QZZ A;  1XCV A;  1WRJ A;  3V8L A;  1VTN C;  2MC3 A;  3GO5 A;  1LDJ A;  4A0Y A;  1Z9C A;  3H3U A;  4RGR A;  2H27 A;  3DKW A;  2DFI A;  3JW4 A;  1D8J A;  3KP4 A;  4KFC A;  3MQ0 A;  3AAF A;  4FX4 A;  2HKX A;  3I4P A;  4EM2 A;  5JFR A;  3T1B A;  1IXR C;  4HV6 A;  3KFW X;  2BE5 F;  2HGC A;  2Z3Y A;  2FRH A;  5K5O A;  1YQA A;  4BHP A;  1MJA A;  2XGX A;  2E1N A;  2QZ8 A;  2A61 A;  4M9X A;  5HDG A;  4HQM A;  1PUE E;  1LDK B;  1RUO A;  4DNC A;  1SMT A;  4N9H A;  4KIB A;  1G3W A;  1ZYR F;  4MQ9 F;  3CUQ C;  3LQQ A;  2KIF A;  4O6J A;  1U2W A;  1RNL A;  2HOE A;  2D45 A;  2LF7 A;  3I71 A;  2QLZ A;  4RB0 A;  2DO7 A;  3J80 Z;  1A04 A;  3ZQ7 A;  2P5K A;  4M6X A;  1T6S A;  3HIF A;  4G7O F;  5HDK A;  4LG0 A;  4WF2 A;  1Z6T A;  2XIG A;  2VC0 A;  2XHK A;  2VOO A;  3WU1 B;  2K7L A;  5CVJ A;  2ZXJ A;  3C1D A;  1GXP A;  3IKV A;  5FD5 A;  4LLL A;  3RPQ A;  3TOA A;  3EYY A;  3V8K A;  3QU3 A;  4ZZD A;  2FE3 A;  2Y48 A;  2GXB A;  2BEO A;  2ADU A;  3M1E A;  4IXA A;  2WC2 A;  5LLQ A;  4U0Y A;  1U3E M;  4MQV A;  2XAF A;  2UXN A;  3U2R A;  3M8E A;  2FNA A;  5E20 A;  3LA7 A;  1HST A;  3RI4 A;  5DD8 A;  5LHG A;  2COM A;  4HDU A;  1FYL A;  4AIK A;  1FWZ A;  2P7V B;  1XD7 A;  3F8M A;  1O3S A;  3HSR A;  2STW A;  1KU2 A;  2QVO A;  4KMF A;  2H6C A;  2FA5 A;  4LLG F;  3H92 A;  5KVR A;  4B09 A;  4XLN F;  1BJA A;  2EA2 A;  3Q9V A;  1T2K A;  3JTG A;  4Y15 A;  4CO8 A;  3KP3 A;  5L3C A;  3ZMU A;  4P9F A;  3CJN A;  4LB6 B;  1IN6 A;  2FOK A;  2J5O A;  1EV7 A;  3GVA A;  1FBQ A;  1R5G A;  1KGS A;  4A2U A;  3ZMS A;  1IW7 F;  1YIO A;  2VBZ A;  3RYR A;  2RVC A;  4MEX F;  2VOP A;  2DU9 A;  4ENM A;  1Z05 A;  3F8F A;  5EEG A;  4LG0 B;  2E7X A;  2VT2 A;  1B1B A;  4RS8 A;  1ZGJ A;  3WGG A;  2CYY A;  4I98 B;  5L3D A;  4A0X A;  3R0A A;  3L00 A;  3ZPL A;  2HQR A;  2P5V A;  2DI3 A;  2JSC A;  1LDD A;  2KJC A;  1WWX A;  4EJW A;  3WTX C;  1GVJ A;  5TJJ A;  2JPB A;  2PG4 A;  3F8B A;  5LEK A;  4RGX A;  1JE8 A;  2Q8K A;  2FNP A;  4A6E A;  2P5L C;  5ICC A;  1HSJ A;  3JSO A;  2ZBK A;  1NHA A;  2L4A A;  5L3E A;  2L3D A;  2JRT A;  3CUO A;  4RB2 C;  4RGS A;  1FC3 A;  2VON A;  2X0L A;  2XAQ A;  5LEJ A;  3DQV C;  1H9T A;  2EV5 A;  4PGH A;  3L9F A;  3PQJ A;  1FY7 A;  4YIF A;  3O3K A;  1S8N A;  2VE9 A;  2MH2 A;  1RIO H;  4Y13 A;  3FZV A;  3ECO A;  1AOY A;  4ON0 A;  1HBX G;  4KA4 A;  1Y0U A;  2HFH A;  2JT1 A;  1TQI A;  4JBA A;  3IC7 A;  2K02 A;  4AWX B;  1DDN A;  4HLX A;  4WXD A;  4L9J A;  1YG2 A;  4EGZ A;  5DV5 A;  5A2Q K;  1U6G A;  1OPC A;  1LEB A;  4BHB A;  5BMZ A;  2E7W A;  2R3S A;  2V9V A;  3MCZ A;  2PFB A;  2O3F A;  5H6Q A;  4OMZ A;  1IN5 A;  3KEO A;  2YSR A;  1EH8 A;  3V7R A;  1YTY A;  3FM5 A;  1DP7 P;  3JSP A;  2DQL A;  2CQK A;  4RAY A;  1W5S A;  3HSE A;  4CHU A;  1B59 A;  5AON A;  4NQW A;  3CDH A;  4M9Z A;  2DT5 A;  1G4D A;  1YFH A;  3WTT C;  2P6S A;  2C6Y A;  3W6K B;  1TW2 A;  3E3V A;  3GLX A;  1O3T A;  2K4J A;  4XBF A;  3E6B A;  3I54 A;  1W5T A;  3MZY A;  2GA2 A;  3BJ6 A;  3GXO A;  4UVB A;  3C18 A;  2NAZ A;  1C0W A;  3HRS A;  3KET A;  3WTV C;  1KYZ A;  1AWC A;  2F5F A;  3OOP A;  5BS6 A;  4KN4 X;  3P9K A;  1OYI A;  2NS0 A;  5CVR A;  3LA2 A;  2EK5 A;  4LK0 F;  2VT3 A;  2OQG A;  1MJ9 A;  3E5U A;  1FLI A;  3BOQ A;  2LDU A;  2K27 A;  5CVI A;  2ISY A;  3N97 A;  3N4M A;  2RNJ A;  4H0E A;  5FFX A;  2PJP A;  2IA2 A;  1HKQ A;  5JR3 A;  2V79 A;  2G9W A;  3REO A;  3GZ6 A;  2HQN A;  4HW0 A;  2XV4 S;  5ED4 A;  4YFN F;  2DK8 A;  1L3L A;  2MH9 A;  1R7J A;  4OOI A;  1XDU A;  2M45 A;  2K4B A;  2L54 A;  5L3G A;  3I58 A;  4ESJ A;  1U78 A;  4Y17 A;  1ON1 A;  1W4M A;  3E5X A;  4RGU A;  2ZCW A;  1SD7 A;  3IRQ A;  2UWM A;  1E17 A;  1WSU A;  5BQT A;  3SXY A;  1HQC A;  2GA1 A;  3BP8 A;  3DF8 A;  2OZU A;  4OIR F;  4JQF A;  3C3W A;  3M8F A;  5ILS A;  2Y0M A;  3RKY A;  1XMA A;  3I53 A;  2EJR A;  3E6D A;  4I09 A;  2XAS A;  3HOT A;  2DK5 A;  1BI2 A;  2Z33 A;  5LGT A;  3BY6 A;  4ETS A;  1YLF A; 
#chains in the Genus database with same CATH topology
 2XPU A;  1B4A A;  2GAU A;  1S3J A;  3JAM Z;  3FWE A;  5EEH A;  2B0L A;  1OLT A;  2BGC A;  3W6J B;  4A3I J;  2ZFW A;  5DUI A;  2EFP A;  3BR5 A;  2VQG A;  3TO9 A;  3C2H A;  3IKT A;  3ESW B;  1EJ9 A;  2QUF A;  4M72 A;  4K2E A;  5B1A H;  3AG3 H;  4IHT A;  1OCP A;  4OMY A;  2A5W A;  2W84 A;  4DQ2 A;  3ZMZ A;  3AL0 B;  1XB4 A;  1WJB A;  5D5W B;  1FOW A;  2D1H A;  4UUV A;  5TRD A;  5KK1 A;  1BI0 A;  4HX8 A;  1TT5 B;  4AVZ A;  4TV7 A;  4MEY F;  3OIP A;  2BY3 A;  1LVK A;  2AO9 A;  2L9S A;  3ZCO A;  2ACJ A;  1V55 H;  1LEA A;  2IP2 A;  5K7F A;  5ILV A;  3KYL A;  1ZG5 A;  3NAU A;  3IRR A;  1GV5 A;  1AHD P;  1MSF C;  4Z2Y A;  4UB8 C;  4IRG A;  4ENN A;  5FLX Z;  1J2X A;  3LOC A;  2R7S A;  3HC7 A;  2TDX A;  4KMU X;  2PMH A;  1ZHF A;  3KZY A;  3CO6 C;  5M3F J;  2GQQ A;  1ZN2 A;  1YS6 A;  2E60 A;  5LHI A;  5E3L A;  3OYK A;  3C7J A;  1IUF A;  3A4C A;  4XLA A;  3SEZ A;  4DZJ A;  4ZH4 F;  3CJT B;  1N25 A;  1LNW A;  4D7M A;  2DDB A;  2STT A;  1R4N B;  4BHC A;  4CDG A;  2MD5 A;  4BEH A;  1Y6I A;  1QPM A;  1V5F A;  4CCJ A;  5E8I A;  1N78 A;  3FKJ A;  5L3B A;  3WOD F;  4Z6Y A;  3V4G A;  3I0T A;  4A3L J;  1S6L A;  4PJJ A;  2ME0 A;  1EA3 A;  1R49 A;  1I50 J;  4L9N A;  4ESF A;  2KMU A;  2R7D A;  1F36 A;  2NVY J;  2HI3 A;  2X1C A;  2IGN A;  4I76 A;  4A69 C;  3KEQ A;  3HEF A;  1ZR4 A;  1EH6 A;  2R93 J;  2X1E A;  4XL9 A;  2M0C A;  3Q0V A;  3RKW A;  3E6M A;  1BC7 C;  1IRG A;  1F5T A;  3CLQ A;  1L0O C;  2FMY A;  1X4O A;  3IL2 A;  1YJ9 I;  3KEY A;  1R00 A;  4PK4 A;  1P92 A;  3D5R C;  1UZC A;  5CVU A;  1TWF J;  1UG2 A;  4A3J J;  1Q1H A;  4G12 A;  3RIR A;  3ZP5 A;  5K7Z A;  2DPU A;  2R0Q C;  1ZLK A;  4DYR A;  3LAP A;  4HNV A;  3H9G A;  1Y8Q B;  2HEO A;  1S7A A;  2QGU A;  3PFY A;  4G7Z F;  3BPX A;  3E5Q A;  1S29 A;  1F9N A;  2YR2 A;  1IF1 A;  1EF4 A;  2O9L A;  4B3X A;  2VQH A;  1TW3 A;  1BI1 A;  5EZH A;  3DPL C;  3O8H A;  5FKL A;  3GFI A;  3QAH A;  3KYC B;  4S0H B;  4B43 A;  2EFN A;  4BXU A;  2JQ7 A;  2UZK A;  3I64 A;  2GWR A;  2XB0 X;  3HPG A;  1O7L A;  3G1O A;  2CW0 F;  1UHW A;  2VC1 A;  2ZJQ F;  3KZZ A;  1PYV A;  2J5P A;  4UHT A;  3CMA I;  1D0Y A;  4BBS J;  4Y3O A;  5FKO A;  3IH4 A;  1TTY A;  3AKZ A;  4UB6 C;  1VQP I;  2KKO A;  2F2E A;  3WTY C;  5HOD A;  4YFX F;  1E0E A;  1I5Z A;  3FBN B;  4IHS A;  3ABT A;  3PIP F;  3LFU A;  2DOD A;  3ABU A;  2CV1 A;  4RM3 A;  4YEL A;  3EUH C;  4KYW A;  2NOJ B;  4ZYG A;  3LSK A;  4XSX F;  4XIC A;  4JYK A;  3KLO A;  1GV2 A;  1SFU A;  1ZTR A;  1G3Y A;  3Q0W A;  1IN7 A;  1Z91 A;  1SFK A;  1IUY A;  1DUX C;  3HDD A;  3I5U A;  2KRH A;  2B63 J;  1ETX A;  5LBQ A;  4IPA A;  2DYR H;  2OUM A;  5CLS A;  5IT9 Z;  4GYI A;  4BY7 J;  2WB1 A;  5E3O A;  5C44 J;  1R58 A;  2JA8 J;  1J09 A;  3KP5 A;  2WV0 A;  4BEH B;  1D0X A;  1SMY F;  3J7A Y;  2E34 A;  3GWZ A;  1I1G A;  3OS1 A;  3FX3 A;  2X4H A;  4EJU A;  1ZRC A;  1E2X A;  1HW5 A;  1ENH A;  2ETH A;  5JLX A;  5J1U A;  3TO7 A;  2HS5 A;  2VBW A;  3DTK A;  4PFP A;  1TNS A;  3QP6 A;  3PFI A;  3VOD A;  3FIS A;  4I01 A;  2O8K A;  4WCG A;  3HOS A;  2DAO A;  3ZQL A;  1MJB A;  3ZMD A;  2MLK A;  1I3A A;  2W7N A;  2X51 A;  5EGO B;  4HG2 A;  1IV6 A;  3OYD A;  2VOD A;  2RV8 A;  1DGW Y;  1OJL A;  5GTH C;  1AU7 A;  4KIS A;  1Z7L A;  4GYG A;  3H5N A;  3QOP A;  3JRE A;  2Y2Z A;  1VI0 A;  2K86 A;  5FO5 A;  2D1V A;  1EH7 A;  2HYF A;  2A69 F;  4BS9 A;  4WX9 A;  2MA3 A;  3IHU A;  1TT0 A;  4PJL A;  1MH3 A;  2DDA A;  4XLF A;  2XSD C;  4HRI A;  2JK3 A;  1O4X A;  1TWH J;  1V5G A;  2QQA A;  3WHC A;  1JGS A;  4R8H A;  3OYE A;  2NOG A;  4LK1 F;  2Z9O A;  2W57 A;  1RC9 A;  1GLN A;  4GDF A;  4G6D A;  2AQF A;  3SHF A;  4RB3 C;  1BOA A;  4BJ5 C;  4A93 J;  1U9O A;  1RI7 A;  3IWF A;  3VYR B;  2E1M C;  2JTV A;  3DBL B;  3UKG A;  4A6D A;  5HLH A;  2NS7 A;  3W2W A;  1WI9 A;  1U5T A;  2R7X A;  3Q9S A;  2ZKZ A;  1ORK A;  3DEE A;  2ZO4 A;  2M3A A;  1KON A;  4OWR B;  5IP9 J;  3MZH A;  4KIC A;  3I59 A;  3BRO A;  4D5F A;  1KU3 A;  2H8W A;  1UB9 A;  2W25 A;  4FET A;  3OYG A;  1ON2 A;  1UHM A;  2WTE A;  2XGD A;  1JUP A;  4WK8 F;  4PGG A;  4UXN A;  3F3X A;  3I55 I;  4G6Q A;  3T0Y A;  2JPC A;  3JRC A;  2V9K A;  3GW2 A;  3AL0 C;  3K9T A;  1YHQ I;  4MGR A;  2W00 A;  3S1M J;  1DPU A;  5HOO A;  1UAA A;  2OCC H;  2M87 A;  3NQO A;  3CC4 I;  5ICF A;  1HF0 A;  4PZJ A;  1FP1 D;  1XMK A;  3H9J A;  1BL0 A;  4A3B J;  1YS7 A;  3K2A A;  1J59 A;  2VN2 A;  1OCR H;  4G6T B;  4W1U A;  2V1U A;  2DT6 A;  3WG9 A;  1OCO H;  4GO1 A;  3RQI A;  3I4N J;  5LFA A;  2FEZ A;  3J81 Z;  4P1W A;  3Q5F A;  1QNT A;  3LSJ A;  4P9U A;  5ICE A;  1LJ9 A;  4IEJ A;  1RES A;  3BTJ A;  3JAM K;  2RDP A;  3WGI A;  2A07 F;  3ZQH A;  3PQK A;  2OJE D;  4XN3 A;  2BZT A;  4HX7 A;  2ID3 A;  4QPO A;  5D6E A;  4NBQ A;  3ERE D;  1DPR A;  4F7Z A;  4LG3 A;  2JUC A;  2B7E A;  3DFG A;  4LGW A;  4FIS A;  2MC4 A;  2L7F P;  1Y1W J;  5J8F A;  2JUG A;  3UNG C;  2ICW G;  1K6Y A;  3K0L A;  5HLI A;  5HS8 A;  3LFK A;  4YII A;  5F27 A;  2A6E F;  2OZ6 A;  4I7H A;  1E3P A;  2BV6 A;  3DPT A;  3QP5 A;  2TRT A;  5EG0 A;  3CC7 I;  2QBY A;  4I0B A;  3L2Q A;  2BXY A;  1I27 A;  1U9N A;  2O8X A;  5M5W J;  2M1B A;  2CMP A;  3T5X A;  1HOM A;  1RUN A;  1DU0 A;  3GYH X;  4KIT B;  1VQO I;  1KQ8 A;  1TNT A;  2XF7 A;  1KU7 A;  3D5L A;  5BPI A;  1HW1 A;  1S5L C;  1UFM A;  3VFZ A;  4S04 A;  2OD5 A;  2DCE A;  2XGC A;  1SFE A;  3F9K A;  1JXS A;  1HXD A;  4BJ6 C;  1D1B A;  5D8K B;  5FJ8 J;  1TQM A;  2HXO A;  4HDV A;  1DGR M;  4E7Z A;  4NUB A;  1X3U A;  2ESH A;  2FUG 2;  3FXR A;  2VPR A;  3LSR A;  2DMN A;  5IYB J;  2LNB A;  3VOE A;  4I6Z A;  1FSE A;  4M6Y A;  3ZOB A;  1J9I A;  2HOS A;  1TZL A;  4RAZ A;  2DBB A;  4FTH A;  4A3F J;  1D5V A;  4B44 A;  3GX4 X;  2LP0 A;  1CF7 A;  3GF2 A;  3VPR A;  4B8X A;  4KDP A;  4AD9 A;  4XOR A;  2CSO A;  4O5V A;  2ZNY A;  1MDM A;  4E7S A;  5F0H A;  1NK2 P;  2HPI A;  2GXG A;  5CQE A;  2OQR A;  1ZRD A;  1Z6R A;  1U5T B;  3MKL A;  4XRF A;  4C2T A;  2LR8 A;  2MAB A;  1FOK A;  5E1W A;  1W7P D;  1IG7 A;  4L5I A;  3BQZ A;  3CMM A;  5DYM A;  2QSG X;  1I1S A;  3I59 B;  4XOT A;  5M5X J;  3R61 A;  2O0Y A;  3RKX A;  3CUQ A;  2K9S A;  3B02 A;  3S8P A;  4G7H F;  3ECH A;  4GFB A;  1R5H A;  3I9V 2;  4XR6 A;  4Q48 A;  3VEP A;  1N75 A;  4HF1 A;  3KZI C;  4P5O A;  5BPD A;  4XRM A;  1B9N A;  1P7J A;  5F6F A;  2X6Y A;  3RQ4 A;  1IXC A;  3G6E I;  4DOZ A;  2QEX I;  2XC7 A;  5EDN A;  3UR3 C;  3OY9 A;  2Y75 A;  2KZV A;  3VB2 A;  4C2M J;  3QU6 A;  1IN8 A;  4HX4 A;  1SEU A;  4I02 A;  1IJW C;  3HKZ A;  1WKM A;  5E79 C;  3F8C A;  1ZLJ A;  2LY9 A;  4IF4 A;  2F48 A;  2HPM A;  2DA7 A;  3DBR B;  4JK1 X;  5B1B H;  5GAD J;  4L5J A;  4ZYH A;  3X2Q H;  5GAE J;  2QA4 I;  1KZH A;  3DEU A;  2H6B A;  2L9V A;  3DXJ F;  3LL7 A;  4EGY A;  1JI8 A;  5TIS C;  1DP3 A;  2LOO A;  2XGE A;  3OYM A;  2CH0 A;  3BCB A;  3MMY B;  3BZ6 A;  4J00 A;  2CQN A;  3FXU A;  3ZN0 A;  2R7T A;  4V2G A;  3U1D A;  2WWY A;  3R60 A;  1VZ0 A;  1V5E A;  3K4B A;  3J80 K;  5EG0 B;  2FSW A;  2HZT A;  5K7H A;  2QBY B;  4RM2 A;  5DUK A;  4L18 B;  3V8J A;  5HS9 A;  4EVI A;  3OYI A;  3OMY A;  2DTR A;  2HR3 A;  2A6H F;  3BR2 A;  3V42 A;  1OKR A;  4IVN A;  3QPS A;  2A6T A;  2F4I A;  5HDN A;  2OC6 A;  2G7U A;  4FAS D;  2HDC A;  3S93 A;  1F4K A;  3BC8 A;  4IHW A;  2XAG A;  3HUG A;  2EPF A;  4M3D A;  2JA5 J;  1J7K A;  2M2E A;  3BR6 A;  2MFZ A;  3ML6 A;  3RJP A;  4BE0 A;  2PLY A;  2PEX A;  3K4C A;  4L5E A;  3HYI A;  1BM9 A;  3E1S A;  1GHC A;  4PCQ A;  3N05 A;  2M7B A;  2IT0 A;  2E19 A;  5IT9 K;  2E1C A;  4O3M A;  1W7P A;  3E0J B;  4GCV A;  2GOX B;  1BR4 A;  1Y1V J;  3L2C A;  1CF7 B;  1MMG A;  1B6A A;  3MWM A;  2XAU A;  3P9C A;  1R22 A;  2EIJ H;  3MVP A;  3CJQ B;  3EDP A;  1MDM B;  1FX7 A;  2YU9 J;  1TLH B;  2WB1 N;  2FD5 A;  3FMQ A;  2GOM A;  3MD2 A;  1D5Y A;  5ERI A;  3WGH A;  2QKL B;  2V1D A;  1KQ0 A;  2DJN A;  2IVM A;  3TP0 A;  1QHH D;  5HNF A;  4LLN A;  4XLC A;  2VQC A;  5CVV A;  3HGG A;  3HL2 A;  4E7I A;  4LMY A;  3CUQ B;  1POG A;  4OIN F;  1V3F A;  2CGP A;  3TO6 A;  1MZB A;  2ELK A;  1X1B A;  2RKH A;  3HHG A;  5E1Z B;  1ETQ A;  1WPK A;  1PP8 F;  4CYC A;  4IHX A;  3BWG A;  3H36 A;  4KNY A;  2LY2 A;  1ONV A;  4FT8 A;  1O3R A;  3CCE I;  1J75 A;  1GDT A;  5EJC A;  4GXO A;  4MHG A;  3HM5 A;  1U0J A;  4AYB A;  4EM1 A;  2VL8 A;  1O57 A;  4RB1 A;  2OAZ A;  1OIS A;  1K61 A;  3BJO A;  1VQN I;  4RBO A;  1DQU A;  1H88 C;  2LSO A;  1R6R A;  5JHF A;  4M3E A;  3DLL F;  3LSG A;  1M1E B;  2CUE A;  2EFQ A;  2CV2 A;  1GUU A;  3ZMV A;  3L2R A;  1IXS B;  3V7C A;  1W36 C;  3OYC A;  4M3G A;  3HBL A;  2BVL A;  3FXJ A;  1MW7 A;  3DKX A;  4XRS A;  1I6H J;  2LKP A;  3GTJ J;  2KRC A;  1XS9 A;  1HDP A;  1IN4 A;  1BC8 C;  5DEQ A;  3KLN A;  1T08 B;  4CXF A;  1TWG J;  2HVQ A;  2M30 A;  1MH4 A;  2RQP A;  5FD6 A;  4UUS B;  4JX6 A;  2AQE A;  3K2Z A;  2QYO A;  3S17 J;  1JHH A;  4E4H A;  2CG4 A;  1ZGA A;  1A31 A;  4GGG A;  2X1D A;  1UCR A;  5H20 A;  2DLL A;  4HOB A;  1VQ8 I;  3BG9 A;  4D7N A;  3BT9 A;  3PUF A;  4CIC A;  4JP0 A;  1XTA A;  2ZME A;  1SFX A;  5KAI C;  4HZF A;  1YRN A;  1YX3 A;  2L01 A;  2QF7 A;  2D2W A;  1SVO A;  3DBH B;  3OL4 A;  2DMT A;  3QYB A;  4OAY A;  4DGW B;  5IT3 A;  4M71 A;  1WJ5 A;  3HUG B;  1ZGW A;  5D5V B;  3BTI A;  4L9V A;  5J40 A;  2VKE A;  3RCO A;  2IS2 A;  4HV5 A;  1GXQ A;  1NH3 A;  2Y69 H;  3K4K A;  1ZH5 A;  3GFJ A;  4R79 A;  1QZE A;  1W7P B;  5IP6 A;  1G6N A;  4UVC A;  4U0W A;  2R92 J;  1XSX A;  3H3Z A;  3R6S A;  2P81 A;  4UY8 I;  2HNH A;  2I10 A;  1P2F A;  1XX5 A;  1MNM C;  4BQQ A;  3ERM A;  2M4K A;  3PJR A;  1KU9 A;  1OR7 A;  1SAN A;  4A5N A;  2ZSI B;  1CGP A;  1P7I A;  3DKY A;  2EIL H;  1I6X A;  1U5T C;  2RGV A;  4XLH A;  2PBI A;  5J6X A;  1JHF A;  2IXS A;  5J1R A;  3WTS C;  3OIQ A;  4IX7 A;  2Y31 A;  2OA4 A;  2NRA C;  1QPI A;  5JLW A;  2PMU A;  1X3Z B;  2R7W A;  2VJ5 A;  3F6V A;  1YJW I;  1XDS A;  2XAJ A;  3F22 A;  4CYC B;  1FJL A;  4A3M J;  3S2H J;  1UMQ A;  2ESN A;  2F5E A;  2HQ5 A;  2BXZ A;  1VQL I;  2IS1 A;  4HEA 2;  4D1Q A;  1BR1 A;  2IAI A;  1W5C C;  3CCM I;  4BDZ A;  2LRD A;  3H0G J;  3F72 A;  4AU7 A;  1STZ A;  3TQN A;  4LIU A;  3GTL J;  3W3C A;  4IHV A;  5D4S A;  3S16 J;  3CMY A;  4CGZ A;  2E1O A;  2L2O A;  1FYK A;  2NNN A;  3RYP A;  2QKM B;  5FRM A;  4HF2 A;  3RPU D;  3FKI J;  1IZ1 A;  1XGN A;  3PIO F;  1FIA A;  4KIF A;  1BIB A;  3S3M A;  1AKH A;  2FBK A;  4A3E J;  5H6R A;  4CZC A;  3EYI A;  2ME6 A;  5BNG A;  2KHM A;  4AIH A;  1IAW A;  2RC4 A;  3JRH A;  2X48 A;  2EV0 A;  4RDU A;  4CCM A;  5B66 C;  1T0F A;  3MFK A;  3CLO A;  5EGO A;  4NC8 A;  2CO5 A;  4HYE A;  4ABZ A;  4ZDP A;  2VPL A;  2EB7 A;  2X6W A;  5E8G A;  2KT0 A;  3TDZ C;  4PDK A;  3OSG A;  3K1M A;  1IC8 A;  3LQR A;  1HCR A;  3RTR A;  2WAF A;  3DV8 A;  3CCV I;  3B6A A;  4M3F A;  4IZZ A;  1HKS A;  2ID6 A;  2ZME B;  4BKX A;  1T8I A;  1YRN B;  4MNU A;  1MBH A;  3A03 A;  5LD2 C;  1BW6 A;  4PJN A;  3S32 A;  2L02 A;  1OYW A;  1JTX A;  3EET A;  1LVA A;  2RQQ A;  2Q0O A;  2LKX A;  3RKQ A;  4Q4Z F;  3SZT A;  4E7H A;  1Z3X A;  5HLT A;  2O6G E;  4XRS G;  1GT0 C;  1R1T A;  2XUB A;  2M0M A;  2YPR A;  2G0E A;  1WHU A;  4ZC3 A;  4Y33 A;  3VYU B;  5JHU A;  4M6V A;  2DMP A;  3HKZ N;  5A2Q Z;  5CQG A;  4BH9 A;  2EZL A;  4X0G A;  1U8B A;  2FQ3 A;  2AXL A;  2E36 A;  3WG7 H;  4M9S A;  2G7H A;  2DA4 A;  4B3A A;  1K79 A;  2Z16 A;  4U0V A;  1VFC A;  2WAQ N;  2BBY A;  1R71 A;  3J7A O;  4I2O A;  2X85 A;  2ELJ A;  2DFE A;  2Q2E A;  3OYL A;  3GTP J;  4BL0 B;  1P4W A;  2DXI A;  2F6C A;  4HBL A;  4XSZ F;  5GPA A;  3FXL A;  3TKY A;  5IYC J;  2CFO A;  1JTY A;  3OYN A;  1P6R A;  2PMZ A;  4NNJ A;  2GIZ A;  5KCM A;  2I5U A;  3F23 A;  4KT6 A;  4RAF A;  1CQT A;  1XGO A;  1TBX A;  4D0P A;  1VND A;  4JX4 A;  5J47 A;  1Z3Y A;  4G9Y A;  1XCB A;  3HB9 A;  2FBH A;  2FXA A;  2R7F A;  1BR2 A;  3FBI B;  3SZP A;  1F1Z A;  1FBS A;  3QWL A;  3RPU A;  3BZK A;  3K4M A;  3JRF A;  1WFX A;  4IRI A;  1MKM A;  3IAS 2;  1SAX A;  3ROU A;  2KDZ A;  1B72 A;  1QO0 D;  1ZRF A;  1XGS A;  5F1R A;  3BJA A;  1JKQ C;  1WI3 A;  3VYT B;  3R4K A;  5FKK A;  3MKZ A;  4A3C J;  3BG7 A;  2KIU A;  3BQY A;  1BIA A;  3CC2 I;  1ETK A;  2RAE A;  1ZQ3 P;  4XON A;  4G8X A;  1Z1D A;  1JT0 A;  1APL C;  4G94 A;  1ZG3 A;  2XVC A;  2Z5U A;  4HSR A;  4E7K A;  1JKR C;  1QGP A;  2A05 A;  1K7A A;  1AKH B;  2IPQ X;  1BBY A;  2DQR A;  1T95 A;  4X1E A;  2Y9Y A;  2YUS A;  1QBJ A;  1QU3 A;  4OIP F;  2P6T A;  3CME I;  4RAG A;  3K1N A;  3GTM J;  4LIT A;  4L0Z B;  1X3W B;  1ZG1 A;  2VB6 A;  2BYV E;  4DBQ A;  2XKP A;  2WY7 Q;  2PN6 A;  2W85 A;  4BXX J;  2HTJ A;  1B9M A;  2EZK A;  4P96 A;  1MBK A;  2Y30 A;  4A3K J;  4LD5 A;  1MD0 A;  2V1X A;  3BDD A;  4OIQ F;  4XN0 A;  3HJE A;  2OBP A;  3P5J A;  2XKO A;  3EUA A;  2OTJ I;  3B6C A;  5D8L B;  1UHS A;  2H94 A;  5BOX A;  2KFD A;  3LMM A;  3FXM A;  4A5M A;  4H4K C;  1J0R A;  2F5C A;  4AYB N;  1WQ2 A;  1REP C;  1VQ6 I;  1O3Q A;  3KP2 A;  4CZZ A;  2NS8 A;  3DLA A;  2P8T A;  4C2U A;  2IJL A;  3FIW A;  1T98 A;  4E7J A;  1D1A A;  2VI6 A;  4ZDO A;  1XGM A;  1FPQ A;  1SD5 A;  4KUM A;  5KHD A;  1G3T A;  2E71 A;  2FU4 A;  4EM0 B;  5J4Y A;  4UV9 A;  2HVS A;  2GZW A;  2I8D A;  1WJF A;  3WE2 A;  4D9J A;  3TOB A;  2HOT A;  2PI0 A;  1ZAR A;  4E70 A;  4U87 A;  2QWW A;  2AHQ A;  3M7G A;  4B4C A;  2Q2E B;  2X6O A;  3HOU J;  1YYV A;  2EFO A;  3BPV A;  3HGY A;  1OCZ H;  3HRT A;  2HYG D;  5C3E J;  3L2W A;  4U7B A;  1D3Y A;  3WU0 A;  1MBJ A;  3EQL F;  3M9A A;  4HAM A;  1J5Y A;  4NC7 A;  4L0Y B;  4AC0 A;  1A5J A;  2Z99 A;  3A0B C;  5K5Q A;  3JR9 A;  4WWC A;  2QQ8 A;  3HZJ A;  5JI6 A;  3M4O J;  3NRV A;  3K69 A;  2EV6 A;  2WBM A;  2K9M A;  5F1J A;  2JRM A;  4CCO A;  5JVT A;  2MLG A;  3MAJ A;  1MMS A;  2M5W A;  4IOA F;  1FSH A;  1WJD A;  5L3F A;  1SD6 A;  2YU3 A;  1B72 B;  4FX0 A;  4AID A;  3TDU C;  4HPQ A;  3KIO A;  1WZ2 A;  3FDY A;  3CP8 A;  2H8R A;  1V54 H;  4EQQ A;  1IDZ A;  1RR7 A;  1XSV A;  1UST A;  1USS A;  1ACI A;  2BOL A;  5J8C A;  4U88 A;  5GAH J;  3WTZ A;  3DEW A;  2HXI A;  5AIQ A;  1FNN A;  3G73 A;  1H0M A;  2HZD A;  1K78 A;  2O03 A;  5LRS A;  1R1U A;  2QM3 A;  3LSI A;  3R0J A;  2KIS A;  3B73 A;  2LFB A;  4C30 A;  1LFU P;  1FZP B;  1XN7 A;  2IGO A;  3FHZ A;  1Y39 A;  4IRH A;  1MGT A;  1R36 A;  3LST A;  2LY1 A;  3S14 J;  5HVQ C;  3SZG A;  5M3M J;  2L0K A;  4E6K G;  3JTH A;  4EJV A;  4RA2 A;  4U7D A;  2XRN A;  3RDI A;  1T38 A;  1AA7 A;  3GME A;  1S7O A;  2EWN A;  3AFH A;  5FLX K;  3CD6 I;  3WTU C;  4YIR X;  2KRF A;  5FRN A;  1IRX A;  1K4S A;  3QYF A;  5HLG A;  5GP9 A;  2CW8 A;  3JRB A;  4EJO A;  2CWE A;  5K1Y A;  2H09 A;  2QQ9 A;  2IGK A;  5LGU A;  1JT6 A;  2E35 A;  1HKT A;  3PM1 A;  2XF6 A;  3HTU A;  1RZ4 A;  5D6F A;  2JMW A;  2DYS H;  4S05 A;  1R4M B;  2YX4 A;  3OR1 C;  1TP4 A;  3T8T A;  4YG2 F;  1XPX A;  4EAT A;  5DM7 F;  3WE3 A;  1YW8 A;  3GUD A;  1G3S A;  5J4V A;  2O7O A;  3OYH A;  3BTC A;  4ENK A;  3GEZ A;  1P4X A;  2Q1Z B;  3OS2 A;  3ONQ A;  1PUF A;  4ZTF A;  1U8R A;  2CW7 A;  3GBG A;  4P55 A;  1G59 A;  1ETO A;  4EMS A;  4MTE A;  1FP2 A;  2L4M A;  1JKP C;  3D0S A;  2QSH X;  4AIJ A;  3RSN A;  1YIT I;  2A3S A;  1SVL A;  1HLV A;  1XSD A;  3FMR A;  2LF8 A;  1WJA A;  1HW2 A;  4BDY A;  2RN7 A;  2BY2 A;  4XMY A;  3A01 A;  2IRF G;  3SQN A;  2GM4 A;  3E7L A;  4HF0 A;  3LSP A;  4W97 A;  4XLP F;  1YW7 A;  3C2B A;  2L7Z A;  3V7S A;  1OCC H;  3W6V A;  1S7E A;  2DTZ A;  2JZY A;  4ASN A;  4E7L A;  3F6O A;  2IS6 A;  3QYE A;  4IJA A;  3ABL H;  3LSH A;  2VKV A;  1FMV A;  1H9G A;  3EUH A;  2B9S A;  5E1X A;  2DA2 A;  3O2P E;  2P0W A;  2FF4 A;  1TWC J;  2OU2 A;  2H1L A;  3F21 A;  1LE8 A;  1R23 A;  3RZO J;  2ZB9 A;  2EBI A;  3BZC A;  3HRU A;  4D5C A;  1RKW A;  2WAQ A;  4ZZL A;  1ODD A;  2QQB A;  4UVA A;  4J19 A;  2XDV A;  3FM3 A;  1JUS A;  3DWL E;  1K78 B;  1FYM A;  4UUS A;  4MTD A;  4HLY A;  5F64 A;  2LTP A;  3MEX A;  4R1H A;  2F5V A;  2W82 A;  1MBF A;  3ZGK A;  3CTA A;  4KN7 X;  1S9H A;  3J7Y J;  4CA0 A;  1ZKG A;  2O5R A;  2VBX A;  1RR8 C;  1LQ1 A;  3KCC A;  4N0B A;  1WH7 A;  3KE2 A;  5IPA A;  2FQ4 A;  3PO2 J;  2PX9 A;  4BGD A;  4M74 A;  2WAD A;  4BYY A;  4CYD A;  3LWF A;  2CFX A;  1Z67 A;  2PMZ N;  5GAG J;  2HWV A;  4PFO A;  3CCQ I;  4BNC A;  3CO7 C;  3K70 D;  2A5Y B;  2DA3 A;  1KA8 A;  5IP7 J;  1YW9 A;  4DBR A;  3ASO H;  1OYY A;  3GZ5 A;  4UNO A;  1K6O A;  3GTK J;  4BQA A;  2MBF A;  3HOW J;  4ANJ A;  3O6B B;  2K40 A;  2V1N A;  5LRR A;  3G3Z A;  5FFZ A;  4AVP A;  1MNE A;  4PSX A;  2R7V A;  3BR1 A;  3HHH A;  2P7C B;  2WA0 A;  4BBR J;  4DW6 A;  4KIG A;  2EZI A;  3P7N A;  3LA3 A;  4LIV A;  4ZYE A;  5LGN A;  5DCM A;  1Y56 A;  3OOU A;  1FBU A;  2VLA A;  2EFW A;  2FJ1 A;  3ISP A;  1T39 A;  4IHY A;  3QPL A;  5KAF C;  5FKM A;  5DTD A;  5D5U B;  5ICG A;  5E3M A;  1PP7 U;  3WTW C;  2ELH A;  2M7A A;  3OV8 A;  1PUF B;  4BAY A;  2V6E A;  3E97 A;  3CF2 A;  5EF6 A;  2RRE A;  3QOE A;  1PDN C;  3FXQ A;  1Z77 A;  4RLF A;  5DCF A;  1A35 A;  3K4N A;  4XQF A;  4L9T A;  5DD4 A;  4N9I A;  1R1V A;  1SC7 A;  2QEN A;  1ZAO A;  2NVQ J;  1OQY A;  3FMS A;  2XPV A;  3QQA A;  3QRF F;  1VQ9 I;  3A01 B;  5H2F C;  2OPT A;  3CCS I;  4EV0 A;  2HDW A;  5AIP A;  1D8K A;  4A0Z A;  5CYV A;  1X1D A;  2LLK A;  2PQ8 A;  2A68 F;  3ELK A;  3VWB A;  3SYT A;  4HQE A;  3O8G A;  4FHT A;  1WVR A;  4MO7 A;  3DU5 A;  4F91 B;  1E3O C;  3DP7 A;  3Q0U A;  2VXZ A;  2LYC A;  4LJZ F;  2IA1 A;  4M73 A;  1LE8 B;  1X58 A;  3GFM A;  5FGM A;  1FMW A;  1KQ9 A;  2HTS A;  1E3H A;  4ZTJ A;  3COA C;  2F5D A;  4I99 C;  4LFU A;  5E18 F;  4ESB A;  3GFL A;  5HNH A;  3ZN1 A;  2E5Z A;  2M8E A;  4OAZ A;  5CJ9 A;  2KIQ A;  2K85 A;  1TQP A;  5D4R A;  5EYR A;  4ZJZ A;  1YIJ I;  4DIQ A;  3L2V A;  3SFZ A;  2UXX A;  1ZEL A;  3HRM A;  4B1R A;  2ZJ2 A;  6PAX A;  2KJB A;  5FB2 A;  3TL4 X;  5E17 F;  2WAE A;  2OV7 A;  4KT5 C;  3NWT A;  4NHJ A;  5EZG A;  4C3H J;  3K1P A;  2VE8 A;  1JKO C;  3S3N A;  1QHG A;  1ULY A;  4WXC A;  1DU6 A;  5ILU A;  2FBI A;  3G2B A;  5GTI C;  1Z7U A;  1JUM A;  3CZ6 A;  3BCA A;  1V4R A;  1I39 A;  1XC5 A;  2LK2 A;  3K4J A;  3J81 K;  2CUF A;  3KP6 A;  2CQX A;  5LHH A;  5F08 A;  2XPW A;  2YX7 A;  4F92 B;  3U21 A;  1LFP A;  3TED A;  4Q5S F;  1P4A A;  2W24 A;  2M9H A;  4DYQ A;  4YFK F;  3QPT A;  2V6C A;  1A6I A;  4QWQ A;  2BVM A;  3CF5 F;  2FOW A;  2LC2 A;  2E2I J;  5FKN A;  1W0U A;  5C4J J;  5K5R A;  3LAJ A;  2DT7 B;  3HG9 A;  2LRE A;  1YO5 C;  2DW4 A;  4BUP A;  2DPD A;  4HA8 A;  3IWZ A;  4F55 A;  3JRD A;  3PSI A;  4LB5 A;  4PJM A;  3T8R A;  3F8N A;  1O7F A;  5DCM B;  2FML A;  1W0T A;  1BOB A;  2E1M B;  4I0A A;  4ENJ A;  2LG4 A;  4OU0 A;  3PNV A;  4YEJ A;  3TMO A;  3K6G A;  5FRO A;  3L7W A;  2O61 A;  2BW3 B;  4A12 A;  3L09 A;  4NC6 A;  4FE7 A;  4KJZ A;  2OTL I;  2DMQ A;  5D5X B;  2AS5 F;  1LB2 A;  2HKO A;  3ULQ B;  4MIM A;  4FE4 A;  2NNY A;  4XKC A;  3TGN A;  2JA6 J;  4QTR A;  3QPH A;  3DTI A;  4QLC U;  2ZNZ A;  5HS7 A;  4F52 A;  1OCT C;  1HC8 A;  5F0F A;  2EQR A;  1FT9 A;  2KIM A;  2IS4 A;  1BN5 A;  2GIV A;  1OMI A;  2LBF A;  1QQI A;  1D0Z A;  3ZMT A;  1GVD A;  2HDD A;  3GZN B;  3BG3 A;  4QPQ A;  4EJT A;  2X6X A;  3M8J A;  1IRF A;  1T56 A;  2EA4 A;  1LKX A;  3JRA A;  2VBY A;  4BXF A;  2W4S A;  3S2W A;  1WJE A;  2ISZ A;  2IW5 A;  4XKW A;  3G1L A;  1BI3 A;  3HSF A;  3E6C C;  3KP7 A;  3OR2 C;  5FLM J;  3P9I A;  2P4W A;  3EUK L;  1ZRE A;  1WJC A;  2NYX A;  4M3B A;  3U9G A;  3OIO A;  4Q47 A;  4UV8 A;  2VXD A;  3G4S I;  1SD4 A;  3FF5 A;  4ZYD A;  2XRO A;  5GPC A;  2XAH A;  3WHB A;  1QZY A;  4WXH A;  4NB5 A;  3HTS B;  1KYW A;  2EIK H;  1H8A C;  1X1A A;  4OIO F;  2IA0 A;  3IH2 A;  2ZC2 A;  3NEU A;  5DDG A;  1QZZ A;  1XCV A;  1WRJ A;  3V8L A;  2IBD A;  1VTN C;  1YX5 A;  4MLO A;  2MC3 A;  3GO5 A;  1X19 A;  1LDJ A;  2R4G A;  3MZ8 A;  1BJZ A;  5CKT A;  4A0Y A;  1Z9C A;  2W1O A;  3H3U A;  4RGR A;  1W36 D;  2H27 A;  2TCT A;  3C2G A;  2NVX J;  3DKW A;  2HVR A;  2F4O B;  5J3L A;  2DFI A;  1MBG A;  1ZK8 A;  3JW4 A;  1D8J A;  3KP4 A;  3JRI A;  4BJT A;  4KFC A;  2JSP A;  1JJ6 C;  2V9P A;  4PSW A;  3MQ0 A;  4DJA A;  3AAF A;  2R5Y A;  1K4T A;  1VQ4 I;  4FX4 A;  2HKX A;  3I4P A;  3VSL A;  1VQ5 I;  4EM2 A;  4XKB A;  3WU2 C;  2VKD A;  2ZXH A;  4II3 A;  5JFR A;  3T1B A;  4RLQ A;  2K9L A;  1NG7 A;  1IXR C;  4HV6 A;  1A36 A;  3KFW X;  3L1P A;  2BE5 F;  4BQN A;  3CQZ J;  1FIP A;  4BAC A;  4X6A J;  2HGC A;  1BA5 A;  2Z3Y A;  2FRH A;  5K5O A;  1YQA A;  2OF7 A;  4BHP A;  1MJA A;  2XGX A;  1B8I A;  1LFB A;  3DCF A;  4RMN A;  2E1N A;  2JA2 A;  2XF5 A;  3K7A J;  2QZ8 A;  2A61 A;  4M9X A;  5HDG A;  3HOX J;  3D5S C;  4HQM A;  3BG5 A;  1PUE E;  1LDK B;  4HNU A;  2NVT J;  1RUO A;  4DNC A;  1XMX A;  1SMT A;  4HST A;  4N9H A;  4KIB A;  1G3W A;  2CU7 A;  1FOY A;  3MKY B;  3OYA A;  1ZYR F;  2JWT A;  4MQ9 F;  3CUQ C;  3LQQ A;  2KIF A;  2XSJ C;  4O6J A;  1U2W A;  1RNL A;  2HOE A;  3IP4 B;  2D45 A;  3ZR8 X;  3G71 I;  2LF7 A;  3FHN A;  3I71 A;  3S15 J;  3HOZ J;  2CJJ A;  2VKH A;  2QLZ A;  1ETW A;  3PL8 A;  2LBF B;  2HYJ A;  4RB0 A;  2DO7 A;  2ZXW H;  3J80 Z;  1A04 A;  3H35 A;  3ZQ7 A;  2P5K A;  4M6X A;  1T6S A;  3HIF A;  4G7O F;  5HDK A;  3A2K A;  1IO2 A;  4LG0 A;  4WF2 A;  1Z6T A;  5B3S H;  3OSF A;  3JCU C;  2M8G X;  4HNT A;  2E2H J;  1X2N A;  1P9Q C;  2XIG A;  2BY1 A;  3CCR I;  3DTE A;  2VC0 A;  5M5Y J;  2FX0 A;  3F0C A;  3AG4 H;  4A3G J;  2XHK A;  3S2D J;  3JRG A;  3ZRG A;  2VOO A;  3WU1 B;  3ZQI A;  2K7L A;  5CVJ A;  2ZXJ A;  4ITV A;  1Y8R B;  3M3Y J;  4C9Y A;  1Z0X A;  3C1D A;  1GXP A;  3IKV A;  5FD5 A;  4LLL A;  3ZQC A;  3RPQ A;  4Y7N J;  3TOA A;  3EYY A;  4FCY A;  2Y0S A;  2NXN B;  4AUX A;  3TW7 A;  3V8K A;  3QU3 A;  3H9Q A;  4C3I J;  4ZZD A;  2FE3 A;  5IYD J;  2K3F A;  2LKS A;  3KYD B;  2Y48 A;  1FEX A;  2E2J J;  1T33 A;  2BEO A;  2V4J C;  2GXB A;  2ADU A;  2VIX A;  1ZR2 A;  3M1E A;  4IXA A;  1TC3 C;  2WC2 A;  4CCK A;  2KDO A;  3CCU I;  5LLQ A;  4UUT A;  4U0Y A;  1JJ8 C;  3BLY A;  2CUJ A;  1U3E M;  4MQV A;  2XAF A;  2UXN A;  2XRL A;  4IQJ A;  3U2R A;  3M8E A;  2R5Y B;  2FNA A;  2CQ7 A;  5E20 A;  3LA7 A;  2VJI A;  3IH3 A;  1HST A;  3RI4 A;  5DD8 A;  1W1W E;  2DOE A;  5LHG A;  2HOA A;  2COM A;  4HDU A;  2VUM J;  2ECC A;  2DA1 A;  3BG6 A;  3QOD A;  4JOM A;  4II2 A;  1FYL A;  1R5I D;  4AIK A;  1FWZ A;  3GLL A;  3MN2 A;  2P7V B;  1UJ8 A;  1XD7 A;  3I3L A;  3TP3 A;  3F8M A;  1O3S A;  3HSR A;  5F0C A;  2STW A;  1KU2 A;  4IQ4 A;  2IGM A;  2QVO A;  4KMF A;  3HOY J;  2H6C A;  3IV5 A;  2FA5 A;  4LLG F;  3H92 A;  2E5N A;  3KPH A;  3H0D A;  4V19 K;  2EZH A;  1IDY A;  5KVR A;  4B09 A;  4XM3 A;  1B8I B;  4XLN F;  2MG4 A;  4J01 A;  1BJA A;  2W48 A;  3HPH A;  2EA2 A;  3Q9V A;  2DOA A;  1T2K A;  3JTG A;  4Y15 A;  4CO8 A;  3KP3 A;  1ETY A;  1Q1V A;  2EIM H;  2JN6 A;  5L3C A;  4NDL A;  3ZMU A;  3EPZ A;  4P9F A;  5J1Y A;  3I4M J;  4BQO A;  3CJN A;  2LVS A;  2L7K A;  1IN6 A;  4LB6 B;  1S72 I;  2FOK A;  2J5O A;  4V2F A;  1EV7 A;  1SAU A;  3GVA A;  3NWS A;  3M07 A;  1FBQ A;  1R5G A;  1KGS A;  1VQ7 I;  2L5Q A;  3DPU A;  3PO3 J;  4A2U A;  3ZMS A;  1IW7 F;  2JVG A;  3VDX A;  4EEF G;  2R5Z A;  2DA5 A;  3CCL I;  1YIO A;  5CPR B;  2VBZ A;  3RYR A;  2RVC A;  4Y52 J;  3FK7 A;  2AXT C;  1G2H A;  2EH3 A;  2Z1D A;  2ZSH B;  4MEX F;  2GXA A;  2VOP A;  3NAR A;  1PJR A;  2RNG A;  3AG2 H;  2DU9 A;  4ENM A;  3BR0 A;  1VQK I;  4XNF A;  1Z05 A;  2MSY A;  3F8F A;  3PUB A;  5EEG A;  4LG0 B;  2E7X A;  4XOP A;  2VT2 A;  1B1B A;  4RS8 A;  1ZGJ A;  2KPM A;  3WGG A;  2CYY A;  1WCM J;  4I98 B;  5L3D A;  3A02 A;  4A0X A;  3R0A A;  3L00 A;  4CUG A;  3ZPL A;  3G1M A;  2HQR A;  2P5V A;  1Z21 A;  2R7R A;  2DI3 A;  2JSC A;  2Z2S B;  1LDD A;  1SFO J;  2KJC A;  1WWX A;  4EJW A;  3WTX C;  1GVJ A;  3L2U A;  1MMA A;  2CRG A;  5TJJ A;  4CH7 A;  3H5A A;  2JPB A;  2PG4 A;  3F8B A;  4IOC F;  5LEK A;  3HOV J;  2R7Q A;  3ABK H;  2R7Z J;  4RGX A;  1QVT A;  1RPW A;  3OS0 A;  1JE8 A;  2Q8K A;  2MW8 A;  3S1Q J;  2FNP A;  3K70 C;  4A6E A;  2BHZ A;  2P5L C;  5ICC A;  2MGQ A;  3J7Z I;  1HSJ A;  2K3P A;  2ZME C;  3JSO A;  2ZBK A;  1NHA A;  2L4A A;  5L3E A;  2L3D A;  2JRT A;  4GRI A;  5C4X J;  3CUO A;  2GLO A;  4RB2 C;  2VQL A;  4RGS A;  1FC3 A;  2DN0 A;  2VON A;  2X0L A;  2ZFU A;  2ZJR F;  2XAQ A;  5LEJ A;  3FXK A;  3DQV C;  1K83 J;  1H9T A;  2EV5 A;  1X2M A;  1X4P A;  2V7F A;  1YOV B;  2K9Q A;  4PGH A;  3L9F A;  3SFI A;  4F3Q A;  4XID A;  3PQJ A;  2COB A;  2L9N A;  2QSF X;  1FY7 A;  4YIF A;  4A3D J;  3O3K A;  1FOX A;  4CSW A;  1S8N A;  1G8X A;  4IKF A;  2CQQ A;  3ZQG A;  2H1K A;  2VE9 A;  2MH2 A;  2YS9 A;  4QSH A;  1RIO H;  1MIJ A;  3ZQQ A;  2DMU A;  1OR7 C;  4Y13 A;  5DM6 F;  3FZV A;  3ECO A;  1AOY A;  4ON0 A;  5B5E C;  1WH5 A;  1HBX G;  2KZG A;  3W2A A;  4KA4 A;  1Y0U A;  1WGX A;  2DOF A;  2ECB A;  2HFH A;  2CV0 A;  2JT1 A;  3ABM H;  1TQI A;  4JBA A;  3Q3S A;  3IC7 A;  2K02 A;  2VAS A;  4AM3 A;  3S3O A;  3OYF A;  4AWX B;  4QIW N;  2PJR A;  3M1C A;  2R5Z B;  1DDN A;  2K5C A;  3H3V K;  4HLX A;  1VQM I;  4WXD A;  3PNY A;  1MBE A;  4L9J A;  4YRV A;  1YG2 A;  4MFE A;  4EGZ A;  2JA7 J;  1JGG A;  4IO9 F;  2R7O A;  5DV5 A;  5A2Q K;  1ETV A;  3DU6 A;  1U6G A;  1OPC A;  4PUS A;  1LEB A;  2IEK A;  4BU2 A;  4BHB A;  5BMZ A;  1BW5 A;  2E7W A;  2R3S A;  2V9V A;  3MCZ A;  3H1C A;  2PFB A;  5DS9 A;  2O3F A;  3BR3 A;  1X1P A;  2UUZ A;  5H6Q A;  4B48 A;  4OMZ A;  1IN5 A;  2D5V A;  3KEO A;  2YSR A;  2DFH A;  3GCM A;  3IAM 2;  1EH8 A;  3V7R A;  1YTY A;  1XG1 A;  4CCL A;  2KLO A;  3FM5 A;  1DP7 P;  2QCO A;  4ZYA A;  5E3N A;  2DFF A;  2DQL A;  2UV1 A;  3JSP A;  3CJR B;  2CQK A;  3LNQ A;  3CES A;  1EKE A;  3SEQ A;  1NG6 A;  1T0F C;  4RAY A;  2DA6 A;  1W5S A;  3HSE A;  4CHU A;  3GTQ J;  1B59 A;  5AON A;  3ZXS A;  3OYJ A;  4NQW A;  4MFD A;  3CDH A;  4DZP A;  1LUJ B;  4M9Z A;  2DT5 A;  1UEL B;  2L9R A;  4ZDL A;  1H89 C;  3TBI A;  4B47 A;  1G4D A;  1YFH A;  3WTT C;  2P6S A;  3FK6 A;  1FTZ A;  3U1K A;  2C6Y A;  2MYS A;  3W6K B;  1TW2 A;  1D1C A;  2M34 A;  2WV1 A;  1MND A;  3CP2 A;  3CDL A;  3E3V A;  3HXL A;  3KX2 A;  3GLX A;  1OFC X;  1O3T A;  3FXO A;  2DJI A;  2K4J A;  4XBF A;  3E6B A;  3I54 A;  3RZD J;  1MMD A;  1RRJ A;  2JVH A;  1I3Q J;  1W5T A;  3MZY A;  2GA2 A;  3BJ6 A;  3GXO A;  4UVB A;  1VF9 A;  3C18 A;  1RKT A;  1HA8 A;  2NAZ A;  2BW3 A;  4Y4R A;  1C0W A;  2ZXI A;  3HRS A;  4XK4 A;  3KET A;  3PSF A;  1IV8 A;  3WTV C;  1KYZ A;  3W2V A;  2CUZ A;  1AWC A;  2F5F A;  2JJ7 A;  3K4L A;  3OOP A;  2NVU B;  5BS6 A;  4FQG A;  4KN4 X;  3P9K A;  1YI2 I;  1OYI A;  2NS0 A;  5CVR A;  4N4N B;  1LPQ A;  3LA2 A;  5F04 A;  1F43 A;  4DYC A;  3S1R J;  3ZQF A;  2EK5 A;  4LK0 F;  2LMD A;  2Y0S N;  2VT3 A;  4JX5 A;  3TW6 A;  2OQG A;  1TL8 A;  1MJ9 A;  3BTL A;  5KNL A;  5IY5 H;  3E5U A;  3OYB A;  1FLI A;  2GBY A;  3BOQ A;  4F93 B;  2HQA A;  1RET A;  2LDU A;  3OL3 A;  2K27 A;  1X1C A;  5CVI A;  3I56 I;  2PJR B;  2ISY A;  2BHY A;  4CCN A;  3N97 A;  3N4M A;  2RNJ A;  1IGN A;  2VJJ A;  4H0E A;  1NK3 P;  1UG0 A;  5FFX A;  3PNT A;  2PJP A;  4XKV A;  2BY0 A;  3H5R A;  1QA6 A;  4IL6 C;  3MKW B;  1QVU A;  1TWA J;  2IA2 A;  2L7M P;  1Y0N A;  4BE1 A;  1NTC A;  3D1N I;  4BE2 A;  1HKQ A;  5IOZ A;  2OCE A;  5JR3 A;  2R7U A;  3ASN H;  3OWT A;  3SDG A;  2V79 A;  2G9W A;  5IOY A;  3REO A;  5EEA A;  1FTT A;  3GZ6 A;  5TGT A;  1ITY A;  5FLV A;  2HQN A;  2V26 A;  4HW0 A;  2XV4 S;  1ERD A;  5ED4 A;  2XB5 A;  4YFN F;  2DK8 A;  2Y9Z A;  1L3L A;  1YE9 A;  2MH9 A;  2N8G A;  4C3J J;  1R7J A;  1HDD C;  2MD0 A;  4OOI A;  1XDU A;  2M45 A;  2X9D A;  3AG1 H;  2K4B A;  4PJ0 C;  3GTO J;  2HU9 A;  3IUO A;  2EIN H;  2KL4 A;  2L54 A;  3GTG J;  5L3G A;  3S1N J;  3I58 A;  4ESJ A;  1U78 A;  4Y17 A;  1ON1 A;  1W4M A;  4BY1 J;  1A6Q A;  3E5X A;  4RGU A;  4LOC A;  4NQW B;  2ZCW A;  1SD7 A;  3VYS B;  3IRQ A;  2UWM A;  1IRZ A;  2M4G A;  1MMN A;  1SVM A;  1E17 A;  1WSU A;  3VSK A;  3SXY A;  1HQC A;  2GA1 A;  5BQT A;  3BP8 A;  3DF8 A;  2LD5 A;  2K9N A;  2OZU A;  1R9T J;  4OIR F;  4JQF A;  3C3W A;  2LH9 A;  3A0H C;  3M8F A;  2VJ4 A;  5ILS A;  2Y0M A;  3A1Y A;  1QRY A;  3RKY A;  2ZJP F;  1MSE C;  1XMA A;  3CCJ I;  1PVE A;  1N77 A;  3I53 A;  2KQR A;  4XLE A;  2F4M B;  2WY8 Q;  4N4O B;  9ANT A;  2EJR A;  3K10 A;  3SDB A;  3E6D A;  4I09 A;  2XAS A;  3HOT A;  3LSM A;  2DK5 A;  1BI2 A;  2CS3 A;  1YJN I;  2Z33 A;  5LGT A;  3SJM A;  3CCY A;  3BY6 A;  2KP6 A;  4ETS A;  1YLF A;  3CDI A;  5JVG F; 
#chains in the Genus database with same CATH homology
 1B4A A;  2GAU A;  1S3J A;  3JAM Z;  3FWE A;  5EEH A;  2B0L A;  2BGC A;  3W6J B;  2ZFW A;  5DUI A;  2EFP A;  3TO9 A;  3IKT A;  2QUF A;  4M72 A;  4K2E A;  4IHT A;  4OMY A;  2W84 A;  4DQ2 A;  3ZMZ A;  1XB4 A;  5D5W B;  4UUV A;  2D1H A;  5TRD A;  5KK1 A;  1BI0 A;  4HX8 A;  4TV7 A;  4MEY F;  2ACJ A;  1LEA A;  2IP2 A;  5ILV A;  1ZG5 A;  3IRR A;  4Z2Y A;  4IRG A;  4ENN A;  5FLX Z;  1J2X A;  2TDX A;  4KMU X;  2PMH A;  1ZHF A;  3KZY A;  3CO6 C;  2GQQ A;  1ZN2 A;  1YS6 A;  5LHI A;  3C7J A;  4ZH4 F;  1LNW A;  2STT A;  4BHC A;  4CDG A;  2MD5 A;  1QPM A;  5E8I A;  5L3B A;  3WOD F;  3V4G A;  3I0T A;  1S6L A;  4L9N A;  4ESF A;  2R7D A;  3KEQ A;  1EH6 A;  3RKW A;  3E6M A;  1BC7 C;  1IRG A;  1F5T A;  1L0O C;  2FMY A;  3IL2 A;  1R00 A;  1P92 A;  5CVU A;  1Q1H A;  3RIR A;  3ZP5 A;  2DPU A;  1ZLK A;  3LAP A;  2HEO A;  1S7A A;  4G7Z F;  3BPX A;  3E5Q A;  1S29 A;  1F9N A;  2YR2 A;  1IF1 A;  1TW3 A;  1BI1 A;  3DPL C;  3GFI A;  3QAH A;  2EFN A;  4BXU A;  2UZK A;  3I64 A;  2GWR A;  1O7L A;  2CW0 F;  1UHW A;  2VC1 A;  3KZZ A;  2J5P A;  4UHT A;  1TTY A;  2KKO A;  2F2E A;  3WTY C;  4YFX F;  1I5Z A;  4IHS A;  3ABT A;  3ABU A;  4KYW A;  4ZYG A;  4XSX F;  3KLO A;  1SFU A;  1G3Y A;  1IN7 A;  1Z91 A;  1IUY A;  1DUX C;  3I5U A;  5LBQ A;  4IPA A;  5IT9 Z;  5CLS A;  4GYI A;  1R58 A;  3KP5 A;  2WV0 A;  1SMY F;  3GWZ A;  1I1G A;  3FX3 A;  2X4H A;  4EJU A;  1ZRC A;  1E2X A;  1HW5 A;  2ETH A;  3TO7 A;  2HS5 A;  2VBW A;  1TNS A;  3QP6 A;  3PFI A;  3VOD A;  4I01 A;  4WCG A;  3HOS A;  2DAO A;  1MJB A;  3ZMD A;  2MLK A;  2VOD A;  2RV8 A;  4GYG A;  3QOP A;  2K86 A;  5FO5 A;  2D1V A;  1EH7 A;  2HYF A;  2A69 F;  4WX9 A;  2MA3 A;  3IHU A;  2QQA A;  1JGS A;  4R8H A;  4LK1 F;  2Z9O A;  2W57 A;  4G6D A;  3SHF A;  4RB3 C;  1BOA A;  1RI7 A;  3IWF A;  2JTV A;  4A6D A;  5HLH A;  1WI9 A;  1U5T A;  3Q9S A;  2ZKZ A;  2ZO4 A;  3MZH A;  4KIC A;  3I59 A;  3BRO A;  1KU3 A;  1UB9 A;  2W25 A;  1ON2 A;  1UHM A;  2WTE A;  4WK8 F;  4PGG A;  4UXN A;  3F3X A;  4G6Q A;  3T0Y A;  2JPC A;  3GW2 A;  3K9T A;  4MGR A;  1DPU A;  5HOO A;  2M87 A;  3NQO A;  5ICF A;  4PZJ A;  1FP1 D;  1XMK A;  1YS7 A;  1J59 A;  2VN2 A;  2V1U A;  3WG9 A;  4GO1 A;  2FEZ A;  3J81 Z;  3Q5F A;  1QNT A;  4P9U A;  5ICE A;  1LJ9 A;  3JAM K;  2RDP A;  3WGI A;  2A07 F;  3PQK A;  4HX7 A;  5D6E A;  3ERE D;  1DPR A;  4F7Z A;  3DFG A;  4LGW A;  5J8F A;  3K0L A;  5HLI A;  5HS8 A;  3LFK A;  4YII A;  2A6E F;  2OZ6 A;  4I7H A;  3DPT A;  2BV6 A;  3QP5 A;  2QBY A;  4I0B A;  1I27 A;  2O8X A;  2M1B A;  3T5X A;  1RUN A;  3GYH X;  1KQ8 A;  1TNT A;  1KU7 A;  3D5L A;  5BPI A;  1HW1 A;  1UFM A;  3VFZ A;  4S04 A;  2OD5 A;  1SFE A;  1JXS A;  1HXD A;  5D8K B;  1TQM A;  4HDV A;  1X3U A;  2ESH A;  3FXR A;  2LNB A;  3VOE A;  1FSE A;  4M6Y A;  1J9I A;  4RAZ A;  2DBB A;  1D5V A;  3GX4 X;  1CF7 A;  4KDP A;  3GF2 A;  4B8X A;  4AD9 A;  2CSO A;  4O5V A;  2ZNY A;  1MDM A;  2GXG A;  2OQR A;  1ZRD A;  1Z6R A;  1U5T B;  4XRF A;  1FOK A;  5E1W A;  1W7P D;  4L5I A;  5DYM A;  1I1S A;  3I59 B;  3R61 A;  2O0Y A;  3RKX A;  3CUQ A;  3B02 A;  4G7H F;  3ECH A;  1R5H A;  4Q48 A;  3VEP A;  4HF1 A;  4P5O A;  5BPD A;  1B9N A;  5F6F A;  1IXC A;  2Y75 A;  3VB2 A;  3QU6 A;  1IN8 A;  4HX4 A;  4I02 A;  1WKM A;  3F8C A;  1ZLJ A;  4IF4 A;  4JK1 X;  4ZYH A;  4L5J A;  3DEU A;  2H6B A;  3DXJ F;  4EGY A;  3BZ6 A;  3FXU A;  3ZN0 A;  3U1D A;  2WWY A;  3R60 A;  3J80 K;  2FSW A;  2HZT A;  2QBY B;  5DUK A;  4L18 B;  3V8J A;  5HS9 A;  4EVI A;  2DTR A;  2HR3 A;  2A6H F;  1OKR A;  4IVN A;  5HDN A;  2G7U A;  2HDC A;  1F4K A;  2XAG A;  3HUG A;  1J7K A;  3RJP A;  3ML6 A;  2PLY A;  2PEX A;  3HYI A;  1BM9 A;  1GHC A;  4PCQ A;  2IT0 A;  5IT9 K;  2E1C A;  4O3M A;  1W7P A;  4GCV A;  3L2C A;  1CF7 B;  1B6A A;  3MWM A;  3P9C A;  1R22 A;  3EDP A;  1MDM B;  1FX7 A;  1TLH B;  3FMQ A;  5ERI A;  3WGH A;  2V1D A;  1KQ0 A;  2IVM A;  4LLN A;  5CVV A;  4LMY A;  3CUQ B;  4OIN F;  1V3F A;  2CGP A;  3TO6 A;  1MZB A;  2RKH A;  3HHG A;  5E1Z B;  1PP8 F;  3BWG A;  4KNY A;  1ONV A;  4FT8 A;  1O3R A;  1J75 A;  4GXO A;  4MHG A;  4EM1 A;  1O57 A;  4RB1 A;  2OAZ A;  3BJO A;  2LSO A;  2EFQ A;  3ZMV A;  1IXS B;  3V7C A;  2LKP A;  1IN4 A;  1BC8 C;  5DEQ A;  3KLN A;  4CXF A;  2M30 A;  2RQP A;  5FD6 A;  3K2Z A;  2QYO A;  1JHH A;  2CG4 A;  1ZGA A;  4GGG A;  1UCR A;  5H20 A;  2DLL A;  4HOB A;  4CIC A;  2ZME A;  1SFX A;  4HZF A;  2L01 A;  2D2W A;  5IT3 A;  4M71 A;  5D5V B;  4L9V A;  4HV5 A;  1GXQ A;  1ZH5 A;  3GFJ A;  4R79 A;  1W7P B;  1G6N A;  4UVC A;  4U0W A;  1XSX A;  3H3Z A;  3R6S A;  1P2F A;  1KU9 A;  1OR7 A;  4A5N A;  1CGP A;  1I6X A;  1U5T C;  2RGV A;  2PBI A;  5J6X A;  1JHF A;  3WTS C;  2OA4 A;  2NRA C;  2PMU A;  3F6V A;  1XDS A;  2XAJ A;  3F22 A;  2ESN A;  2F5E A;  3F72 A;  1STZ A;  3TQN A;  5D4S A;  4CGZ A;  1FYK A;  2NNN A;  3RYP A;  4HF2 A;  1IZ1 A;  1XGN A;  4KIF A;  1BIB A;  2FBK A;  5H6R A;  3EYI A;  4AIH A;  1IAW A;  2RC4 A;  2EV0 A;  1T0F A;  3MFK A;  3CLO A;  2CO5 A;  4HYE A;  2EB7 A;  5E8G A;  3TDZ C;  4PDK A;  3K1M A;  3LQR A;  3RTR A;  3DV8 A;  1HKS A;  2ZME B;  4MNU A;  2L02 A;  1OYW A;  3EET A;  1LVA A;  2Q0O A;  4Q4Z F;  3SZT A;  2O6G E;  1R1T A;  2XUB A;  2YPR A;  5JHU A;  5A2Q Z;  4BH9 A;  2FQ3 A;  2AXL A;  4M9S A;  2G7H A;  1K79 A;  4U0V A;  2BBY A;  3J7A O;  4I2O A;  2Q2E A;  1P4W A;  4HBL A;  4XSZ F;  3TKY A;  1P6R A;  3F23 A;  1XGO A;  1TBX A;  4D0P A;  4G9Y A;  1XCB A;  2FBH A;  2FXA A;  2R7F A;  3SZP A;  1F1Z A;  1FBS A;  3RPU A;  4IRI A;  1MKM A;  1SAX A;  3ROU A;  1ZRF A;  1QO0 D;  1XGS A;  5F1R A;  3BJA A;  3R4K A;  2KIU A;  1BIA A;  4G8X A;  1Z1D A;  4G94 A;  1ZG3 A;  2XVC A;  2Z5U A;  1QGP A;  1K7A A;  2IPQ X;  2DQR A;  1BBY A;  1QBJ A;  4OIP F;  2P6T A;  3K1N A;  4L0Z B;  1ZG1 A;  2BYV E;  2XKP A;  2PN6 A;  2W85 A;  2HTJ A;  1B9M A;  4P96 A;  4LD5 A;  1MD0 A;  2V1X A;  3BDD A;  4OIQ F;  2OBP A;  2XKO A;  5D8L B;  2H94 A;  5BOX A;  4A5M A;  1J0R A;  2F5C A;  1WQ2 A;  1REP C;  1O3Q A;  3KP2 A;  4CZZ A;  2P8T A;  2IJL A;  1T98 A;  1XGM A;  1FPQ A;  1SD5 A;  4KUM A;  1G3T A;  4EM0 B;  2FU4 A;  4UV9 A;  2GZW A;  3WE2 A;  3TOB A;  2PI0 A;  1ZAR A;  4E70 A;  2QWW A;  3M7G A;  1YYV A;  2EFO A;  3BPV A;  3HRT A;  2HYG D;  4U7B A;  1D3Y A;  3WU0 A;  3EQL F;  3M9A A;  4HAM A;  1J5Y A;  4L0Y B;  2Z99 A;  5K5Q A;  4WWC A;  5JI6 A;  3NRV A;  3K69 A;  2EV6 A;  5JVT A;  2MLG A;  3MAJ A;  2M5W A;  1FSH A;  5L3F A;  1SD6 A;  2YU3 A;  4FX0 A;  3TDU C;  4EQQ A;  1XSV A;  1UST A;  1USS A;  5J8C A;  4U88 A;  3WTZ A;  5AIQ A;  1FNN A;  3G73 A;  1H0M A;  1K78 A;  2O03 A;  5LRS A;  1R1U A;  2QM3 A;  3R0J A;  3B73 A;  1FZP B;  1XN7 A;  3FHZ A;  4IRH A;  1MGT A;  1R36 A;  3LST A;  5HVQ C;  3JTH A;  4EJV A;  4U7D A;  2XRN A;  3RDI A;  1T38 A;  1S7O A;  2EWN A;  5FLX K;  3WTU C;  2KRF A;  5HLG A;  4EJO A;  2CWE A;  5K1Y A;  2H09 A;  2QQ9 A;  5LGU A;  1HKT A;  3HTU A;  1RZ4 A;  5D6F A;  4S05 A;  2YX4 A;  3T8T A;  4YG2 F;  3WE3 A;  1YW8 A;  3GUD A;  1G3S A;  4ENK A;  3GEZ A;  1P4X A;  1U8R A;  4P55 A;  4EMS A;  4MTE A;  1FP2 A;  2L4M A;  3D0S A;  4AIJ A;  2A3S A;  1XSD A;  3FMR A;  2LF8 A;  1HW2 A;  2RN7 A;  2IRF G;  3SQN A;  4HF0 A;  4XLP F;  1YW7 A;  3V7S A;  2JZY A;  4ASN A;  3F6O A;  4IJA A;  1H9G A;  3EUH A;  5E1X A;  3O2P E;  2FF4 A;  2OU2 A;  3F21 A;  1R23 A;  3HRU A;  4ZZL A;  1ODD A;  2QQB A;  4UVA A;  3FM3 A;  1K78 B;  1FYM A;  4MTD A;  4HLY A;  5F64 A;  3MEX A;  4R1H A;  3CTA A;  4KN7 X;  2VBX A;  1LQ1 A;  3KCC A;  4N0B A;  3KE2 A;  4M74 A;  4BYY A;  4CYD A;  3LWF A;  2CFX A;  2HWV A;  4BNC A;  3CO7 C;  2A5Y B;  1KA8 A;  1YW9 A;  1OYY A;  3GZ5 A;  4UNO A;  1K6O A;  4BQA A;  2MBF A;  3O6B B;  5LRR A;  3G3Z A;  5FFZ A;  4AVP A;  3HHH A;  2P7C B;  4KIG A;  3P7N A;  3LA3 A;  4ZYE A;  5LGN A;  5DCM A;  1FBU A;  2EFW A;  3ISP A;  1T39 A;  5D5U B;  5ICG A;  1PP7 U;  3WTW C;  2ELH A;  3OV8 A;  4BAY A;  3E97 A;  1PDN C;  3FXQ A;  5DCF A;  4L9T A;  5DD4 A;  4N9I A;  1R1V A;  2QEN A;  1ZAO A;  3FMS A;  3QRF F;  4EV0 A;  5AIP A;  1D8K A;  4A0Z A;  5CYV A;  2PQ8 A;  2A68 F;  3ELK A;  4HQE A;  4FHT A;  3DP7 A;  2VXZ A;  4LJZ F;  2IA1 A;  4M73 A;  3GFM A;  5FGM A;  1KQ9 A;  2HTS A;  3COA C;  2F5D A;  4LFU A;  5E18 F;  4ESB A;  3GFL A;  3ZN1 A;  2M8E A;  5CJ9 A;  5D4R A;  1TQP A;  3SFZ A;  2UXX A;  3HRM A;  2ZJ2 A;  6PAX A;  2KJB A;  5FB2 A;  5E17 F;  4KT5 C;  4NHJ A;  3K1P A;  2VE8 A;  1ULY A;  4WXC A;  5ILU A;  2FBI A;  1Z7U A;  1V4R A;  3J81 K;  3KP6 A;  5LHH A;  2YX7 A;  4Q5S F;  1P4A A;  2W24 A;  4YFK F;  3QPT A;  2V6C A;  4QWQ A;  5K5R A;  3LAJ A;  1YO5 C;  2DW4 A;  2DPD A;  4HA8 A;  3IWZ A;  4LB5 A;  3T8R A;  3F8N A;  1O7F A;  5DCM B;  2FML A;  4I0A A;  4ENJ A;  4OU0 A;  3L7W A;  2O61 A;  4A12 A;  3L09 A;  5D5X B;  2AS5 F;  1LB2 A;  2HKO A;  3ULQ B;  2NNY A;  3TGN A;  3QPH A;  4QLC U;  2ZNZ A;  5HS7 A;  1FT9 A;  2KIM A;  1BN5 A;  2GIV A;  1OMI A;  1QQI A;  3ZMT A;  4EJT A;  1IRF A;  2EA4 A;  2VBY A;  3S2W A;  2ISZ A;  2IW5 A;  1BI3 A;  3HSF A;  3E6C C;  3KP7 A;  3P9I A;  2P4W A;  1ZRE A;  3U9G A;  2NYX A;  4Q47 A;  4UV8 A;  1SD4 A;  2XRO A;  3FF5 A;  4ZYD A;  2XAH A;  1QZY A;  4WXH A;  4NB5 A;  3HTS B;  1KYW A;  4OIO F;  2IA0 A;  3NEU A;  5DDG A;  1QZZ A;  1XCV A;  1WRJ A;  3V8L A;  1VTN C;  2MC3 A;  3GO5 A;  1LDJ A;  4A0Y A;  1Z9C A;  3H3U A;  4RGR A;  2H27 A;  3DKW A;  2DFI A;  3JW4 A;  1D8J A;  3KP4 A;  4KFC A;  3MQ0 A;  3AAF A;  4FX4 A;  2HKX A;  3I4P A;  4EM2 A;  5JFR A;  3T1B A;  1IXR C;  4HV6 A;  3KFW X;  2BE5 F;  2HGC A;  2Z3Y A;  2FRH A;  5K5O A;  1YQA A;  4BHP A;  1MJA A;  2XGX A;  2E1N A;  2QZ8 A;  2A61 A;  4M9X A;  5HDG A;  4HQM A;  1PUE E;  1LDK B;  1RUO A;  4DNC A;  1SMT A;  4N9H A;  4KIB A;  1G3W A;  1ZYR F;  4MQ9 F;  3CUQ C;  3LQQ A;  2KIF A;  4O6J A;  1U2W A;  1RNL A;  2HOE A;  2D45 A;  2LF7 A;  3I71 A;  2QLZ A;  4RB0 A;  2DO7 A;  3J80 Z;  1A04 A;  3ZQ7 A;  2P5K A;  4M6X A;  1T6S A;  3HIF A;  4G7O F;  5HDK A;  4LG0 A;  4WF2 A;  1Z6T A;  2XIG A;  2VC0 A;  2XHK A;  2VOO A;  3WU1 B;  2K7L A;  5CVJ A;  2ZXJ A;  3C1D A;  1GXP A;  3IKV A;  5FD5 A;  4LLL A;  3RPQ A;  3TOA A;  3EYY A;  3V8K A;  3QU3 A;  4ZZD A;  2FE3 A;  2Y48 A;  2GXB A;  2BEO A;  2ADU A;  3M1E A;  4IXA A;  2WC2 A;  5LLQ A;  4U0Y A;  1U3E M;  4MQV A;  2XAF A;  2UXN A;  3U2R A;  3M8E A;  2FNA A;  5E20 A;  3LA7 A;  1HST A;  3RI4 A;  5DD8 A;  5LHG A;  2COM A;  4HDU A;  1FYL A;  4AIK A;  1FWZ A;  2P7V B;  1XD7 A;  3F8M A;  1O3S A;  3HSR A;  2STW A;  1KU2 A;  2QVO A;  4KMF A;  2H6C A;  2FA5 A;  4LLG F;  3H92 A;  5KVR A;  4B09 A;  4XLN F;  1BJA A;  2EA2 A;  3Q9V A;  1T2K A;  3JTG A;  4Y15 A;  4CO8 A;  3KP3 A;  5L3C A;  3ZMU A;  4P9F A;  3CJN A;  4LB6 B;  1IN6 A;  2FOK A;  2J5O A;  1EV7 A;  3GVA A;  1FBQ A;  1R5G A;  1KGS A;  4A2U A;  3ZMS A;  1IW7 F;  1YIO A;  2VBZ A;  3RYR A;  2RVC A;  4MEX F;  2VOP A;  2DU9 A;  4ENM A;  1Z05 A;  3F8F A;  5EEG A;  4LG0 B;  2E7X A;  2VT2 A;  1B1B A;  4RS8 A;  1ZGJ A;  3WGG A;  2CYY A;  4I98 B;  5L3D A;  4A0X A;  3R0A A;  3L00 A;  3ZPL A;  2HQR A;  2P5V A;  2DI3 A;  2JSC A;  1LDD A;  2KJC A;  1WWX A;  4EJW A;  3WTX C;  1GVJ A;  5TJJ A;  2JPB A;  2PG4 A;  3F8B A;  5LEK A;  4RGX A;  1JE8 A;  2Q8K A;  2FNP A;  4A6E A;  2P5L C;  5ICC A;  1HSJ A;  3JSO A;  2ZBK A;  1NHA A;  2L4A A;  5L3E A;  2L3D A;  2JRT A;  3CUO A;  4RB2 C;  4RGS A;  1FC3 A;  2VON A;  2X0L A;  2XAQ A;  5LEJ A;  3DQV C;  1H9T A;  2EV5 A;  4PGH A;  3L9F A;  3PQJ A;  1FY7 A;  4YIF A;  3O3K A;  1S8N A;  2VE9 A;  2MH2 A;  1RIO H;  4Y13 A;  3FZV A;  3ECO A;  1AOY A;  4ON0 A;  1HBX G;  4KA4 A;  1Y0U A;  2HFH A;  2JT1 A;  1TQI A;  4JBA A;  3IC7 A;  2K02 A;  4AWX B;  1DDN A;  4HLX A;  4WXD A;  4L9J A;  1YG2 A;  4EGZ A;  5DV5 A;  5A2Q K;  1U6G A;  1OPC A;  1LEB A;  4BHB A;  5BMZ A;  2E7W A;  2R3S A;  2V9V A;  3MCZ A;  2PFB A;  2O3F A;  5H6Q A;  4OMZ A;  1IN5 A;  3KEO A;  2YSR A;  1EH8 A;  3V7R A;  1YTY A;  3FM5 A;  1DP7 P;  3JSP A;  2DQL A;  2CQK A;  4RAY A;  1W5S A;  3HSE A;  4CHU A;  1B59 A;  5AON A;  4NQW A;  3CDH A;  4M9Z A;  2DT5 A;  1G4D A;  1YFH A;  3WTT C;  2P6S A;  2C6Y A;  3W6K B;  1TW2 A;  3E3V A;  3GLX A;  1O3T A;  2K4J A;  4XBF A;  3E6B A;  3I54 A;  1W5T A;  3MZY A;  2GA2 A;  3BJ6 A;  3GXO A;  4UVB A;  3C18 A;  2NAZ A;  1C0W A;  3HRS A;  3KET A;  3WTV C;  1KYZ A;  1AWC A;  2F5F A;  3OOP A;  5BS6 A;  4KN4 X;  3P9K A;  1OYI A;  2NS0 A;  5CVR A;  3LA2 A;  2EK5 A;  4LK0 F;  2VT3 A;  2OQG A;  1MJ9 A;  3E5U A;  1FLI A;  3BOQ A;  2LDU A;  2K27 A;  5CVI A;  2ISY A;  3N97 A;  3N4M A;  2RNJ A;  4H0E A;  5FFX A;  2PJP A;  2IA2 A;  1HKQ A;  5JR3 A;  2V79 A;  2G9W A;  3REO A;  3GZ6 A;  2HQN A;  4HW0 A;  2XV4 S;  5ED4 A;  4YFN F;  2DK8 A;  1L3L A;  2MH9 A;  1R7J A;  4OOI A;  1XDU A;  2M45 A;  2K4B A;  2L54 A;  5L3G A;  3I58 A;  4ESJ A;  1U78 A;  4Y17 A;  1ON1 A;  1W4M A;  3E5X A;  4RGU A;  2ZCW A;  1SD7 A;  3IRQ A;  2UWM A;  1E17 A;  1WSU A;  5BQT A;  3SXY A;  1HQC A;  2GA1 A;  3BP8 A;  3DF8 A;  2OZU A;  4OIR F;  4JQF A;  3C3W A;  3M8F A;  5ILS A;  2Y0M A;  3RKY A;  1XMA A;  3I53 A;  2EJR A;  3E6D A;  4I09 A;  2XAS A;  3HOT A;  2DK5 A;  1BI2 A;  2Z33 A;  5LGT A;  3BY6 A;  4ETS A;  1YLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...