1HOMA

Determination of the three-dimensional structure of the antennapedia homeodomain from drosophila in solution by 1h nuclear magnetic resonance spectroscopy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
68
structure length
68
Chain Sequence
MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTENNAPEDIA PROTEIN
publication title Determination of the three-dimensional structure of the Antennapedia homeodomain from Drosophila in solution by 1H nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 21
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1homA00
2L0KA 2MW8A 2CQXA 1JJ8C 1LFBA 2XB0X 5IP7J 3HOZJ 1RKTA 2JJ7A 4A69C 1IRZA 2DTZA 2Y9YA 1H89C 3H3VK 3RZDJ 1WH7A 2JMWA 4M3EA 4MFEA 1MBEA 1MH3A 5J1YA 1R9TJ 3E7LA 4AYBN 3BTIA 1ZQ3P 5FKMA 4C3HJ 4BBRJ 4XRSA 3I4NJ 3FK7A 1EF4A 1PUFB 3JRHA 1QPIA 2VUMJ 3HOUJ 2HQ5A 1QRYA 4BY1J 1JJ6C 4MFDA 5E3OA 2P81A 4XK4A 3HBLA 4W1UA 1JKOC 4BY7J 2VKEA 1AU7A 1AKHB 2DMTA 2O9LA 4D7NA 2XRLA 2CJJA 4FE7A 4A3CJ 2G0EA 1K83J 4Y7NJ 2JA7J 3BR3A 1OCPA 2Y31A 1TWGJ 1S7EA 3SFIA 5IOYA 3GTMJ 2R5ZA 1TWCJ 2Y0SN 3D1NI 2XGEA 3ZQHA 4NDLA 4C3JJ 3BR0A 5F1JA 1ZTRA 2EZHA 3HEFA 5F27A 2HOSA 1T56A 2EQRA 2TRTA 3GTQJ 3CCYA 4A3KJ 4DYCA 4IHYA 2DMQA 1ETOA 2CU7A 1FEXA 2YS9A 1WH5A 1DU0A 1HCRA 1XC5A 2O7OA 2NVQJ 2OPTA 1JKRC 1PUFA 1B8IA 2LLKA 1JT6A 2DMNA 2NS7A 2KT0A 1TWAJ 3ZQFA 3A03A 2WAQN 4UUSB 4D7MA 1GDTA 2DA4A 3G1LA 2NVXJ 1HLVA 1ZR2A 1AKHA 2E2JJ 1ETXA 2NOGA 3K2AA 5FKLA 2E2HJ 1HDDC 1X2NA 3BQZA 1JKQC 4QIWN 4DZJA 5EYRA 1APLC 2AO9A 1ETYA 1RPWA 4IHVA 4CYCA 2DA2A 5DS9A 3GTOJ 5J1RA 1ETQA 2L9RA 4ABZA 2H8RA 2MSYA 3PM1A 4A3JJ 5EGOB 3JRGA 1HDPA 3K7AJ 2DA3A 1OFCX 2QF7A 1BA5A 3I4MJ 4X6AJ 3Q3SA 3BR2A 1ZK8A 5IP6A 3BT9A 1BL0A 3B6AA 4A3BJ 5JLXA 3MKLA 3QPSA 3DEWA 3S1QJ 3FK6A 2X9DA 5EZGA 1ORKA 5GP9A 1A5JA 3JRFA 3UKGA 3CDLA 1YRNB 5F08A 2R5ZB 1GV2A 3LSGA 1K61A 2GLOA 3HOYJ 2XSDC 1FJLA 3JR9A 3S1MJ 1Q1VA 3MN2A 4FISA 4FCYA 3BG3A 1HOMA 3S16J 2D5VA 4IHXA 1JUMA 3HGYA 3RKQA 3GTPJ 4JP0A 3IH3A 2H1KA 1P7JA 4AUXA 1UG2A 3OIOA 1XS9A 2DA1A 4MO7A 1VI0A 2YUSA 5EGOA 1I3QJ 5IYDJ 2Y2ZA 4DZPA 3GTLJ 2XB5A 1MBGA 1B8IB 5M3FJ 4J19A 3TP3A 2IAIA 5IP9J 1X2MA 4A3DJ 3FKIJ 1BW5A 5IPAA 4Y52J 1NK2P 3OOUA 3S15J 3HGGA 2L7FP 3JREA 4L5EA 2X48A 4V2GA 3DCFA 2L7ZA 3BTJA 4W97A 3ZQGA 1A6IA 2NS8A 1F36A 1TC3C 1YRNA 1QVTA 3BR1A 1TWHJ 2ELKA 2ID3A 2EZLA 4V2FA 1GV5A 5C4XJ 5E3NA 1ETKA 2VPRA 2WV1A 3LSJA 4CYCB 5EG0A 4A3EJ 1JUPA 1QVUA 1MBJA 5HODA 4A3FJ 1JUSA 4M3DA 4B3AA 1FTTA 2HDDA 1D5YA 2ZB9A 3HOVJ 1Z0XA 2CUFA 3FIWA 1JKPC 1RKWA 3HOWJ 2NVYJ 1JTYA 2EZKA 4S0HB 1MSEC 1IDZA 3SJMA 1ETWA 4M3FA 2HYJA 2DN0A 3MVPA 4D5CA 1AHDP 3CMYA 4MIMA 4RDUA 2O8KA 3HB9A 3A01B 2IEKA 5IYBJ 3BR6A 5IOZA 5FLMJ 1MSFC 3IH4A 3JRAA 2HI3A 4QSHA 3Q0VA 3CQZJ 1RR7A 2RAEA 3RQIA 1Y1WJ 1ZKGA 5EF6A 4A3MJ 4IEJA 5C4JJ 1IGNA 4UUTA 5K7ZA 1NK3P 4IHWA 3H0GJ 2Y30A 2K9SA 4BKXA 2LY9A 1U9OA 4AC0A 3HOXJ 1LFUP 2DMPA 1MNMC 2XPUA 1BW6A 3SDGA 1U78A 1H88C 4DW6A 2XGDA 5GPAA 3RZOJ 1RETA 3F0CA 2HOTA 2DA7A 2WB1N 5M5XJ 2COBA 3B6CA 4A3IJ 1ZR4A 3JRIA 1FIAA 1B72B 4BXXJ 4GFBA 5JLWA 3GTKJ 1U9NA 5K7FA 3PO2J 4MLOA 2W48A 4XRSG 3QQAA 1VF9A 4FTHA 4LOCA 3HDDA 2JA8J 1DU6A 3FISA 3O8HA 3A01A 4A3LJ 3GTJJ 2VKVA 3S1RJ 3ZQCA 4EEFG 2FD5A 3HKZN 3M3YJ 3LSPA 3S2DJ 2LKXA 2LD5A 1XG1A 1P7IA 3TW6A 1JTXA 5EG0B 3NARA 2JA5J 2FX0A 2NVTJ 4I6ZA 5M3MJ 4XRMA 2FJ1A 2Y9ZA 2DA6A 1W0TA 1WGXA 4M3GA 3A02A 3NAUA 2HXIA 2M2EA 4FE4A 2QCOA 2ECCA 3Q0UA 2LFBA 2PMZN 4JX5A 4XIDA 1VNDA 1UMQA 2E19A 1G2HA 2LP0A 1MBFA 2JA6J 3S2HJ 4C2MJ 1MBHA 1UHSA 4B1RA 4A93J 1B72A 1HF0A 2AHQA 2HOAA 4C3IJ 5IYCJ 4XICA 1U8BA 1I6HJ 1E3OC 4HNVA 2N8GA 5FKKA 2M8GX 3L1PA 4QTRA 2ID6A 3HM5A 1NTCA 3LOCA 3S14J 4D5FA 5K7HA 1OCTC 2R5YA 2LK2A 3IV5A 1OJLA 1T33A 5F0FA 1I50J 2M34A 2K40A 3TP0A 1IC8A 3Q0WA 5F04A 2KDZA 2K9NA 4BBSJ 9ANTA 3PO3J 4M6VA 5GPCA 1WCMJ 2GBYA 2LVSA 2DA5A 2LR8A 2E2IJ 2R92J 2L7MP 3JRCA 1LE8A 3QPLA 2EH3A 2R93J 3BR5A 3OSGA 5E3MA 2K9QA 3LNQA 2FQ4A 4B4CA 1ITYA 5EZHA 5FLVA 2EZIA 2M0CA 3GTGJ 4A3GJ 1RESA 2R0QC 3WHBA 1IG7A 5M5WJ 1F43A 2JWTA 2HXOA 1IDYA 1WPKA 2EBIA 3JRDA 2DMUA 2GM4A 2DJNA 1VFCA 3BG5A 5C3EJ 5C44J 3WHCA 1Y1VJ 3S1NJ 1ZGWA 3TW7A 3ZQIA 3VPRA 5EEAA 2E1OA 1GUUA 2M9HA 2VI6A 3BTCA 1CQTA 5FKOA 3C2BA 4DYRA 5J1UA 1Z77A 2ME0A 2B63J 1FTZA 5DTDA 2IBDA 2OF7A 5FJ8J 5EDNA 5E3LA 3BTLA 3W6VA 1IJWC 2XPVA 3G1MA 1W0UA 4DYQA 1JT0A 2CUEA 5FKNA 1MH4A 2ME6A 2JK3A 2XGCA 1JGGA 1O4XA 3BQYA 5F0CA 5F0HA 4RBOA 4G12A 1ENHA 1GVDA 1TWFJ 2X6OA 5J3LA 3O8GA 2R5YB 4JX4A 2CRGA 3ZOBA 1X58A 4X1EA 3TEDA 3ZQLA 1GT0C 3M4OJ 3IH2A 4JYKA 3BG9A 1WI3A 2YU9J 3G1OA 1SANA 1IUFA 2R7ZJ 2TCTA 1POGA 5M5YJ 3JRBA 3S17J 2XPWA 2LTPA 2MGQA 4UUSA 1ETVA 2I10A 3LSRA 3OSFA 1H8AC 2JN6A 2ECBA 5BNGA 2MG4A 1LE8B 2CQQA 1MBKA 1SFOJ 1BJZA 4M3BA 1IV6A 3GBGA 1FIPA 4I76A 4JX6A
chains in the Genus database with same CATH superfamily
4IXAA 5B3SH 4F52A 4ESFA 2HPIA 1JJ8C 4B48A 3DWLE 3DXJF 1I1SA 1USTA 3KEYA 4A69C 2DTZA 2Y9YA 3DPUA 1B9NA 3R61A 3DTKA 4WF2A 3H5RA 5CVIA 3RZDJ 1QZZA 2JMWA 2W4SA 3A0HC 3VYUB 1MH3A 4WX9A 2QZ8A 4C3HJ 4BBRJ 3QODA 1O7LA 4M9SA 4HNTA 1J9IA 1BIBA 1YIOA 3VOEA 4XRFA 5B66C 3JRHA 2DT7B 2DODA 2DCEA 3CDHA 2HQ5A 3F23A 1FBUA 4GDFA 2X51A 2NRAC 5E3OA 3CJRB 1W36C 4BHBA 1O7FA 5EEHA 4IRIA 2FU4A 1AKHB 2DMTA 2JPCA 1WI9A 2M4KA 2CJJA 5L3FA 2DOEA 1K83J 1E0EA 2Y31A 2V79A 1FT9A 2CV2A 3H5AA 3SFZA 4P9FA 2XGEA 3ZQHA 2IGKA 4C3JJ 1WSUA 1BI0A 3BCBA 3RYPA 3V8KA 2EZHA 4L9NA 1BM9A 4KITB 3L2QA 3FXRA 3MQ0A 1T56A 2EQRA 5GAHJ 2NVUB 3KEOA 2IGNA 3R0AA 4P1WA 5DDGA 4CXFA 4DQ2A 3M8FA 1T8IA 2OU2A 1EKEA 3DBLB 4XKVA 4Y13A 1DU0A 2QBYA 2BHYA 2P6TA 2P6SA 4RB3C 3A0BC 3DF8A 2DYSH 4LFUA 5FLXK 4BS9A 1B8IA 2DMNA 3ABKH 2LY2A 1FSEA 5L3GA 1TWAJ 1RNLA 4NQWB 2M1BA 3J81K 1GDTA 2VXDA 1WVRA 3M9AA 2XUBA 2JVHA 1AKHA 1OR7C 5K5QA 4IQ4A 3ML6A 4BYYA 3LSKA 4MTEA 3K2AA 3WTXC 2XF5A 4H4KC 4P55A 2RNJA 2H94A 3J7AO 3FHZA 1IXRC 1VQMI 1APLC 4KIBA 3MZHA 3PQKA 1OYIA 3BOQA 2DA2A 3KFWX 3W6KB 5J1RA 1UHWA 2H8RA 1L3LA 3PM1A 4A3JJ 3KZZA 2CO5A 5LEJA 3JRGA 1FY7A 5DD8A 4A6EA 2WTEA 3ZMSA 4MQ9F 2X4HA 4I98B 4II2A 4IF4A 4X6AJ 2MFZA 5J8CA 3QYEA 3Q3SA 1CF7B 2QSGX 1BL0A 4E7SA 2R7SA 3OIQA 2Q2EA 3N97A 2F4IA 2FRHA 3QPSA 5E79C 1G3WA 5DEQA 3AL0B 3O2PE 5D8KB 3LAJA 1A5JA 4D9JA 1YRNB 4HAMA 3FMRA 4FX4A 1HSJA 1SFEA 3QYBA 2UXNA 4A5MA 1T08B 4BH9A 3S1MJ 3V8LA 3WU0A 1FZPB 5HLTA 1R23A 2VKDA 3VODA 2D5VA 2VQGA 2HDCA 2TDXA 3HGYA 2RGVA 3GTPJ 4PSWA 2F5CA 2FA5A 4II3A 3VFZA 3WGIA 1VI0A 1WHUA 3SZGA 2CH0A 4FQGA 3OYDA 2Y2ZA 1PJRA 2OUMA 3QAHA 4XLEA 2XGXA 1RZ4A 5AIPA 3PNTA 3GMEA 2R7TA 1UFMA 3HUGA 4Q48A 2AS5F 2LY1A 1HKQA 4GGGA 2X48A 4LD5A 4V2GA 5D5WB 4AIKA 3DKYA 1DGWY 2BZTA 2F6CA 1TNSA 2VN2A 3HRMA 4BJTA 4EATA 4U7DA 1TC3C 1YRNA 1QVTA 4B09A 1K7AA 1TWHJ 2E7XA 3PQJA 2STTA 1MDMB 2ELKA 2ID3A 2JRTA 1JGSA 1LDDA 2VE9A 1HXDA 3WTUC 1O3RA 2CUZA 3NEUA 5HODA 4HBLA 2EINH 2PMUA 4RA2A 3LSIA 5CYVA 3T1BA 5JHFA 1X1PA 4LIVA 2ZB9A 1YYVA 3R4KA 3RQ4A 1D3YA 1MGTA 5JFRA 2EZKA 2X6WA 1IDZA 2DN0A 2XHKA 4HF2A 2MC3A 4HYEA 4MIMA 1S72I 1JHFA 2LMDA 3IP4B 5DUKA 2QYOA 2IEKA 1KONA 2GAUA 3BLYA 3AG3H 2X6YA 5IYBJ 3DTIA 1BI3A 2KRCA 4UV9A 4AWXB 1QGPA 3RQIA 3EUAA 4YFNF 1TTYA 2VQLA 1ZKGA 3F9KA 5EF6A 3F3XA 5C4JJ 3CCMI 1WJAA 4I01A 4YELA 1EH7A 3CCSI 1F4KA 2E5ZA 4DNCA 4E7LA 5B1BH 1U2WA 4Y15A 1MDMA 2LG4A 1YIJI 2B9SA 1WJBA 3CMAI 1S7AA 3B73A 5ERIA 2DMPA 5E1ZB 2P7VB 2K9MA 2BW3A 3IAM2 3OL3A 4M9XA 2V1DA 2HVQA 3TKYA 3ZRGA 3RZOJ 4XLHA 2BY2A 2HS5A 3LQQA 4UXNA 3E97A 3BP8A 3K70C 2DTRA 1IN5A 1LDJA 2COBA 5CQGA 2XDVA 3ESWB 1H0MA 4BXXJ 5F64A 4L9JA 4XRSG 4IHTA 3ZGKA 5FRMA 3L00A 3MEXA 2VBZA 3F8NA 4IRGA 3EPZA 1DU6A 1YS6A 2DPUA 2XC7A 5L3BA 2VKVA 3RPUA 2H27A 2CQNA 3ZQCA 4IOCF 3I0TA 3SZPA 4BQOA 2LD5A 2OA4A 3ABTA 3V42A 3TW6A 3Q9VA 3K9TA 1FNNA 4YRVA 1O3TA 5D4SA 5HDKA 2ADUA 4RMNA 3EUHA 4EGYA 3EUKL 5EG0B 1YTYA 2FX0A 5M3MJ 1FYKA 4MHGA 2QWWA 2HXIA 2UV1A 4FE4A 2XAUA 2QCOA 3WU1B 4GCVA 3LL7A 3KLOA 1KU3A 3GLXA 1Y8QB 3V4GA 3IWFA 3DQVC 5ILVA 2F5EA 3TBIA 5LHHA 1VQ9I 3FWEA 4K2EA 3GLLA 4C3IJ 3N05A 1XD7A 5IYCJ 1I6HJ 1R22A 3RTRA 4BE2A 4CA0A 1D8KA 3JAMZ 2BHZA 1PVEA 4HNVA 3KYDB 1D5VA 5FKKA 1BI1A 1VQKI 2KPMA 4BXUA 4RB2C 3PUFA 3PIPF 2X1CA 2VKHA 1NTCA 2FF4A 1B9MA 4F3QA 4D5FA 2X1DA 2K02A 2W25A 4NC7A 4LLLA 1HA8A 2LK2A 3FXQA 3RYRA 1OJLA 5F0FA 4I99C 3Q0WA 5F04A 2GZWA 2LRDA 3BPXA 2O3FA 1OLTA 1GLNA 4P5OA 4ENMA 1ZG5A 4HX8A 2DDAA 3LWFA 2GBYA 2HKOA 3I59B 5B5EC 3ELKA 4C2UA 1MZBA 4OMZA 3CESA 4X0GA 2L7MP 3JRCA 1CGPA 3QPLA 5J40A 4XBFA 2OJED 1Y39A 2M3AA 4G6QA 1Z7LA 5E3MA 4XLAA 3H3ZA 4HV6A 3N4MA 4CSWA 1IV8A 2KIQA 2VE8A 3TOBA 1ZRCA 5DCMB 2Y48A 1GXPA 2PMHA 4EQQA 1P92A 1IXCA 2AQFA 2FNPA 1PYVA 1QZYA 3I5UA 3GTGJ 3WHBA 3DBRB 5DD4A 3JW4A 1YW8A 4OU0A 3GF2A 3G71I 1IDYA 1WPKA 1DQUA 1BR2A 2EBIA 1MMNA 4OIRF 3U1KA 3L09A 1LVAA 1ZH5A 2DMUA 1K6OA 4CDGA 2ZSHB 5C44J 2VXZA 4S04A 1ZGWA 4E7HA 4G94A 3D5SC 3VPRA 2VLAA 1YQAA 3IKVA 1KZHA 1GUUA 1W7PB 4G6TB 3I59A 3FBIB 2B0LA 3M1CA 2CGPA 1E17A 2F4MB 3DLAA 1T2KA 3RKWA 4RAGA 3GUDA 2IBDA 1U8RA 2OF7A 5FJ8J 1FTZA 1KU9A 3BJOA 2EIKH 1FLIA 2ESHA 2EWNA 4NUBA 2M0MA 2DFEA 1IJWC 1NG7A 1R36A 3L2UA 1W7PD 3GFMA 2R7QA 2JTVA 3CCUI 2R7FA 2E1MB 4I7HA 1RC9A 1Z1DA 4GXOA 4ITVA 3W2WA 5F0CA 1IAWA 1V3FA 2OCEA 4G12A 1TWFJ 2A05A 2A5YB 3O8GA 2CRGA 3ZOBA 3TEDA 4X1EA 5D8LB 1IUYA 1B1BA 3BG9A 1D1BA 2QQ9A 3OYEA 1FMVA 4LLNA 3C3WA 2HDWA 3R6SA 2EIMH 1O57A 2FXAA 1UB9A 2EIJH 4KYWA 2Q1ZB 2XIGA 1BN5A 3OR1C 1IRGA 2HQAA 1PDNC 2JN6A 1YW9A 2L2OA 3DPTA 1FSHA 2MG4A 1LE8B 3CP2A 1B4AA 4M3BA 4CH7A 1FIPA 4I76A 1R6RA 3J80Z 2L0KA 2P5KA 3ZMVA 4RAFA 3H35A 5H2FC 2XB0X 1E3PA 3HJEA 2E71A 2JJ7A 1IRZA 5K5RA 4IPAA 1TW3A 4HZFA 5JVGF 1P4XA 2R7DA 2CS3A 4NC8A 2QA4I 4MFEA 1MBEA 1R9TJ 1KYZA 1TT5B 3IAS2 2R7VA 4OIQF 3MZ8A 5E17F 4XRSA 3I4NJ 2NYXA 3O3KA 3ABMH 4KJZA 2FBIA 3OYNA 4EMSA 3HOUJ 6PAXA 2WAFA 1B59A 1XSVA 4WXDA 4ZDLA 3K4MA 1VZ0A 4DBRA 4BJ6C 4M6XA 1P2FA 3JSPA 1MNDA 4BY7J 4A3CJ 4OAYA 3HPHA 1Q1HA 3OS1A 2IS2A 2L3DA 3BR3A 3BZCA 1TWGJ 1S7EA 3SFIA 5IOYA 2R5ZA 5DCFA 2ZFWA 1KA8A 2M7BA 3PNYA 5F1JA 1W5CC 1X1AA 4L5JA 3J7AY 2P8TA 3LA2A 1SAXA 4XQFA 5F27A 2HOSA 3BZKA 3F8MA 3CC7I 3PJRA 2TRTA 5K1YA 3GTQJ 1K4TA 3BPVA 3E1SA 3CCYA 4IHYA 1BJAA 3KEQA 2HQRA 2RVCA 3WG7H 3A4CA 2DMQA 2UZKA 3HHGA 3OYAA 5KNLA 1ZAOA 1DP3A 1LKXA 3CD6I 2C6YA 4ZC3A 5LEKA 1FYMA 4N4NB 3HG9A 2ZJQF 2JUCA 3KZIC 5H6QA 4HQEA 1JKRC 1TLHB 2LLKA 4E7JA 3E5QA 2NS7A 1T6SA 3KETA 2KT0A 1R1VA 3QU3A 3A03A 2EJRA 3FXLA 1YFHA 4OIOF 2L01A 2WAQN 3OOPA 2DJIA 4KFCA 3G1LA 2NVXJ 4P96A 1HLVA 1ZR2A 5J8FA 2KDOA 1ULYA 1ETXA 3E6MA 3WTZA 4JBAA 4UVBA 4F7ZA 1KYWA 1X2NA 2E7WA 1KQ8A 3V8JA 4NHJA 3LQRA 3P9KA 4DZJA 1W36D 3HOSA 5EYRA 3OY9A 3GFJA 1YG2A 2AO9A 4BEHB 4HX7A 2WC2A 2PBIA 3QPHA 4IHVA 4CYCA 4RB1A 3TDZC 4BHCA 1N78A 1FPQA 2L9RA 2EFQA 1WZ2A 3QWLA 1RIOH 2J5OA 2OTJI 4O6JA 1HDPA 2EV6A 2HGCA 2IT0A 3H1CA 4ZYEA 3CCRI 1J59A 1A36A 1E2XA 4KUMA 1BA5A 1XGMA 1WQ2A 1ON1A 2X85A 2HR3A 2WADA 4HDVA 3BC8A 1T98A 4AVZA 1BIAA 3DEWA 3FK6A 2P4WA 5EZGA 1W1WE 2L54A 4HQMA 4CHUA 1YX3A 2KL4A 2RREA 5GP9A 1WJ5A 3CJQB 3UKGA 5F08A 2PJPA 4XNFA 1FMWA 1GV2A 2BXYA 2LSOA 4ZTJA 2DT6A 2ZSIB 5JHUA 5D5UB 1FJLA 3ZMZA 1Q1VA 4P9UA 1SC7A 2OCCH 1Z9CA 3GWZA 4FCYA 5D6FA 2DK5A 3HRSA 5AONA 4BEHA 4U0YA 3KLNA 4WXHA 4U7BA 3EYIA 2VODA 4JP0A 3IH3A 1Y0UA 2H1KA 3FMSA 1AWCA 2DA1A 3BZ6A 2QBYB 1MMAA 1S29A 2QUFA 5IY5H 1Z91A 1I3QJ 2L7KA 5IYDJ 3KP4A 4U0VA 2XB5A 3GTLJ 1PP7U 3PSIA 4EM2A 1MBGA 1P4AA 3OYKA 1B8IB 2JRMA 1J0RA 3HTUA 2F5DA 2WBMA 5IPAA 5CJ9A 4Y52J 3WTVC 2LF8A 3H92A 3CDIA 4IVNA 3S15J 2VJJA 1EV7A 2L7FP 3HSFA 1ZRFA 2L4MA 2L7ZA 3BTJA 4W97A 4Y3OA 2NS8A 1ON2A 3CLQA 1F36A 1OR7A 1RR8C 1FYLA 5A2QK 3GVAA 1HQCA 3K2ZA 2A07F 2M5WA 4DIQA 4GO1A 2V1NA 5E3NA 4UB8C 1D0YA 1YLFA 2M30A 1QVUA 3GEZA 2E35A 3AAFA 2LOOA 2O8XA 2X1EA 4M3DA 4B3AA 4F93B 5K5OA 1SFUA 1FTTA 2VB6A 4A6DA 1D5YA 3M7GA 3HOVJ 1BC7C 3FIWA 4NB5A 1YI2I 2LDUA 5ED4A 4UVAA 1TBXA 3TO6A 1MSEC 3A1YA 3CTAA 4BNCA 1FWZA 4M3FA 4BL0B 5HLIA 3P9IA 4RAYA 1AHDP 1SEUA 4G8XA 2M7AA 3ZXSA 2Q2EB 4RDUA 2O8KA 4M74A 3RJPA 1F5TA 5E8GA 3BR6A 5EEGA 5E8IA 2W7NA 4XM3A 3JRAA 2Z33A 2HI3A 4QSHA 3CQZJ 1RR7A 4ZZLA 2IP2A 1HKTA 4A3MJ 2K27A 4L9TA 3GZ6A 1IN7A 4HPQA 1IGNA 4UUTA 2KJCA 3G73A 5E1WA 2DFFA 2Y30A 3C1DA 1YJNI 2K9SA 4BKXA 2LY9A 5DV5A 3RPQA 4AC0A 2WV0A 2E34A 3HOXJ 5ICGA 3PIOF 2CWEA 1LFUP 1I5ZA 2RN7A 2Z3YA 1XDSA 1BW6A 2WAQA 2XPUA 3BY6A 1U78A 4DW6A 4MGRA 2VPLA 3JTHA 5GPAA 1VQPI 3X2QH 4WK8F 4EM1A 2DA7A 2H09A 1FOYA 1FX7A 2K85A 1ZR4A 3JRIA 3I55I 4OOIA 3KYCB 4G7OF 1U9NA 4DJAA 3PO2J 2MA3A 4MLOA 2W48A 1LPQA 4GRIA 3HUGB 4FTHA 3ONQA 3HDDA 2JA8J 1J5YA 1T95A 3WE2A 5CVVA 3U2RA 2EK5A 4WCGA 5D4RA 1U6GA 2BEOA 4A3LJ 4XLFA 2XAGA 1ZARA 1AOYA 2PQ8A 3M3YJ 4ENJA 3LSPA 3FF5A 4AD9A 2ACJA 1H9TA 3ZQQA 4UY8I 3GX4X 3FXKA 3MFKA 1P7IA 1LDKB 1JTXA 4RGRA 1G8XA 1IN4A 1UHMA 1W5SA 4HLYA 4XRMA 1W0TA 5B1AH 1WGXA 3SQNA 3S32A 2YPRA 4M3GA 2ZCWA 2DI3A 2ZFUA 3A02A 5AIQA 3AG4H 2OBPA 2Q8KA 5JR3A 3OYLA 1TW2A 3PSFA 5TRDA 3Q0UA 2LFBA 2KMUA 2PMZN 4JX5A 5GADJ 4MQVA 1OCRH 2QSFX 2VQHA 1D0ZA 1UMQA 2E19A 2QENA 3H5NA 2LP0A 1MBFA 5L3DA 4B8XA 5JI6A 1WWXA 3S2HJ 1UHSA 5JVTA 3M07A 1R5GA 1ZLJA 2Y69H 3H36A 2YX7A 5FRNA 1U8BA 2W84A 2CW0F 3GZNB 3K70D 2HZDA 4NBQA 2OQGA 3HSEA 2ZMEC 3FDYA 2K5CA 3WGGA 2M8GX 1XPXA 2HTSA 4QTRA 3K1MA 1Z6RA 1FOKA 2BXZA 2H6BA 2A6TA 3LOCA 4NNJA 5K7HA 3S14J 1OCTC 2H6CA 2EFOA 2V26A 2BVMA 3ABLH 2EFPA 3TO7A 1T33A 3BDDA 3AG2H 3C2GA 1I50J 2BW3B 2Y75A 1SD7A 4XSXF 1WJDA 4CZCA 1IC8A 1WJFA 3WTYC 2H8WA 4YG2F 3KYLA 2M4GA 2CV0A 2KDZA 1KU2A 4BBSJ 2PN6A 3PO3J 1Y6IA 1IXSB 4ENNA 1U5TA 3I71A 4R8HA 1DUXC 2LVSA 2R7RA 3ISPA 2LR8A 1UZCA 1YOVB 3AG1H 2E2IJ 3GXOA 2BV6A 2R92J 1UCRA 4PGGA 3I58A 4IQJA 2JSPA 3DFGA 3F8BA 3T0YA 3RKXA 3OSGA 1R4MB 2CFOA 5IT9K 1SFKA 2K9QA 4XN3A 2HKXA 1YO5C 2QGUA 1ITYA 2BYVE 5FLVA 2M0CA 3HC7A 3MKWB 1RESA 2R0QC 3H0DA 2GOXB 4FX0A 3MWMA 5KHDA 2WY7Q 3PUBA 4HA8A 2WAEA 2WA0A 3RPUD 4BQNA 4PSXA 2DJNA 2GM4A 4RLFA 3BG5A 5C3EJ 2DBBA 2P5LC 5FGMA 3ULQB 1Y1VJ 4PJNA 3ZN0A 1U5TC 2XAHA 1MMGA 1ZYRF 1TQIA 1IW7F 3BTCA 3MCZA 5FKOA 1LQ1A 4DYRA 5J1UA 1XSDA 5LLQA 3K1PA 4KA4A 2EB7A 5BS6A 1PP8F 3MD2A 2LNBA 3KP7A 4OAZA 3BTLA 5LGNA 4YFKF 3L2RA 3LFUA 2HEOA 4KT5C 1JT0A 4ANJA 3H9QA 3WTTC 4CYDA 3LSTA 3WU2C 4EV0A 1O4XA 5BOXA 2K9LA 5DYMA 3CLOA 1GVDA 3C2HA 2X6OA 2HZTA 1DPUA 3Q9SA 2FBHA 5D5VB 1BC8C 2DK8A 1RUOA 1R5ID 1EH6A 4JYKA 4Y33A 2CSOA 1WI3A 1X3ZB 2IW5A 4L9VA 5CPRB 3G1OA 2XKOA 1SANA 2TCTA 1POGA 5ICFA 2FSWA 1F1ZA 5M5YJ 3SEQA 3BROA 3I64A 4PJJA 1V5EA 1TZLA 2MGQA 4UUSA 1G6NA 2I10A 5BPDA 1H8AC 3CMMA 3IC7A 1A31A 3CO7C 5BNGA 2KZVA 4N4OB 3CCJI 1BOBA 2DFHA 3JCUC 4XONA 1DPRA 1BJZA 3T8RA 2HTJA 2EPFA 1IV6A 2MYSA 4A0YA 4HSRA 2D2WA 4B43A 2AQEA 3O6BB 4ZH4F 3L9FA 1Y0NA 5FLXZ 4EJTA 1LFBA 4A0XA 1STZA 5IP7J 3H3UA 3I9V2 2CW8A 4EM0B 4LB6B 3G6EI 1H89C 2ZBKA 3J81Z 1X4OA 3F72A 2PMZA 2VIXA 3WTWC 1WH7A 4AIDA 1V55H 4M3EA 2DLLA 3E7LA 1DGRM 3BTIA 1FP1D 4C30A 4KMUX 5FKMA 5LGUA 1ZQ3P 4KIFA 1EF4A 1PUFB 2L9NA 4XSZF 2IA2A 2VASA 2XKPA 2A5WA 5KAFC 1JJ6C 2P81A 3QYFA 3V7SA 4XK4A 3CCLI 3K69A 4W1UA 4EJUA 3HSRA 2VKEA 5CVUA 1NG6A 2XRLA 4D7NA 3I54A 3MZYA 2G0EA 2HU9A 2XAQA 4Y7NJ 2JA7J 3F21A 5LRSA 1XGOA 3GW2A 3TL4X 3HYIA 4Y4RA 3GTMJ 1SD4A 2Y0SN 4LGWA 3D1NI 2UUZA 3BR0A 2R7XA 1HKSA 1B6AA 2V7FA 3LFKA 2DPDA 4OIPF 3HEFA 1BR1A 1ZG3A 3HZJA 4LG0B 4C9YA 2Z16A 3K1NA 2G9WA 3OWTA 4WXCA 2E60A 3T5XA 2ZNYA 4HV5A 2DXIA 1ETOA 1M1EB 2CU7A 3VB2A 3FHNA 1XMAA 1FBQA 2MH2A 4Q47A 4UV8A 2G7UA 4RGXA 1WJEA 4LITA 3J7ZI 1PUFA 1I1GA 4YFXF 3KP6A 2ZO4A 4XOTA 1G3TA 3S8PA 5FD6A 3E5UA 1HC8A 1JXSA 1XCVA 2YSRA 1MW7A 2JA2A 2QLZA 3DV8A 4BACA 2NOGA 1LFPA 5FKLA 1A04A 1HDDC 3BQZA 3QP5A 4QPQA 1JKQC 3G4SI 4EGZA 3RCOA 3FXMA 2FNAA 4XN0A 1RPWA 2B7EA 3CUQC 2PJRB 2XF7A 5DS9A 3GTOJ 1ETQA 4LG0A 5FD5A 2MSYA 3ZN1A 1VQ6I 4N0BA 3KX2A 4A2UA 3OYFA 4UNOA 3ZMDA 1YE9A 2DDBA 4BQAA 4BAYA 4U87A 4XLCA 2QF7A 4EJVA 3I4MJ 1ZK8A 3BT9A 2R7UA 3CP8A 2P5VA 4A3BJ 4KT6A 3V7RA 1TP4A 5JLXA 3HRTA 4PJLA 3T8TA 2JPBA 4I0BA 2V1XA 3KIOA 5DM6F 1OPCA 3VDXA 3JRFA 3VYSB 3CDLA 3TGNA 2PEXA 4ENKA 1GXQA 2VL8A 3GFIA 3DBHB 1XGSA 2HWVA 2R5ZB 2GLOA 3HOYJ 3TMOA 1ACIA 2FUG2 5GTHC 3JR9A 4ZYAA 1LNWA 1R1TA 4G6DA 3CCEI 3QOEA 3MN2A 4FISA 2HYFA 2BBYA 3VEPA 4E70A 1HOMA 2I8DA 5CQEA 2IJLA 1XMKA 2Z5UA 3GCMA 4IHXA 1JUMA 3A2KA 3RKQA 1X1CA 2PJRA 5E20A 1VQ8I 1P7JA 1OKRA 1YS7A 3ZCOA 4AUXA 3OIOA 1RUNA 1T38A 3RDIA 2XSJC 1XS9A 4MO7A 4OMYA 2YUSA 3J7YJ 4QPOA 3W6JB 3IUOA 4DZPA 4J01A 2LKSA 5FFZA 1QHHD 5LGTA 5J6XA 1D1CA 4OINF 4J19A 3P9CA 3TP3A 3WE3A 2IAIA 1WFXA 5IP9J 4F55A 4A3DJ 3FKIJ 1VQ5I 2DYRH 2QQBA 4R1HA 4L5IA 2I5UA 3OOUA 1D8JA 1K79A 3JREA 3OYHA 3EDPA 4E7IA 2LC2A 3ZQGA 1A6IA 5L3EA 4AU7A 4PDKA 3BG7A 4E7KA 4BJ5C 3FMQA 4J00A 1G3SA 4V2FA 3JSOA 4I02A 5H6RA 1V5GA 1ETKA 2VPRA 2WV1A 3D5LA 3M8EA 4CYCB 3F22A 4DGWB 2FE3A 1YX5A 1J2XA 4PJ0C 3S3MA 3ZP5A 2DO7A 2IS1A 2YX4A 2HDDA 3BJAA 4RGUA 5FO5A 1NHAA 1Z0XA 2CUFA 3C18A 3OYGA 2M45A 3E0JB 1RKWA 1N75A 1QHGA 1SMTA 3HOWJ 3CCVI 1YHQI 1JTYA 2Y0SA 5ILUA 4S0HB 2ESNA 2QEXI 3R0JA 3NWSA 2ELHA 4ZTFA 5D6EA 1Y8RB 4IL6C 3MVPA 3AFHA 3SDBA 1VQ7I 3VYTB 3CO6C 2J5PA 3SYTA 1J7KA 2BY0A 1JHHA 5GAEJ 3OV8A 3FM5A 5TJJA 5IOZA 2O6GE 1BI2A 3ROUA 3WGHA 4BHPA 3IH4A 1MSFC 4KNYA 3FXJA 3Q0VA 2RAEA 1KQ0A 4CCMA 4ZJZA 1TT0A 1Z05A 4ZYDA 4IEJA 2CQKA 3CJTB 1ERDA 4IHWA 1NK3P 1ZRDA 3FZVA 5LHGA 4CCLA 3HXLA 5BMZA 2VJIA 4N9HA 2W1OA 2WWYA 2MD0A 3BG6A 1MNMC 1I27A 1FP2A 1K6YA 2KISA 3SDGA 1H88C 2XGDA 1QNTA 4KICA 4G9YA 1RETA 1IN6A 2VC0A 3M1EA 3F0CA 3PFYA 2VBWA 1O3QA 3KP5A 5L3CA 2HFHA 3OR2C 4KN7X 5KAIC 2WB1N 4BXFA 4MEYF 1QA6A 4AVPA 1XCBA 2LYCA 1FIAA 1B72B 1S5LC 1XMXA 4CUGA 5H20A 4L0YB 4GFBA 3GTKJ 5BPIA 4XR6A 1F9NA 1SD5A 2VT2A 4M73A 2YU3A 4ZDOA 2GQQA 2NOJB 2GIZA 4IJAA 4JK1X 3FISA 2GA1A 3NQOA 3LSHA 4EEFG 2FD5A 3QRFF 2MBFA 4PCQA 4CCJA 2IPQX 1Z6TA 3S2DJ 4RAZA 3DP7A 2P7CB 5CKTA 4XKWA 4ASNA 5FROA 1QO0D 1ZREA 3L7WA 4XKCA 4OWRB 4M72A 4D1QA 2GWRA 1XGNA 5LFAA 2FOWA 2DQRA 1X3UA 3NARA 2JA5J 2NVTJ 1R49A 2Y9ZA 1L0OC 2DA6A 1WKMA 1W5TA 1T39A 1J75A 3HHHA 4XOPA 3NAUA 2FMLA 2ISYA 2M2EA 2OD5A 2V4JC 4YEJA 1MMSA 2ECCA 4HF0A 2BVLA 2MABA 3Q5FA 1A6QA 4XIDA 1VNDA 3B02A 4AIHA 3AKZA 4B1RA 3K4BA 4A93J 3OS0A 1B72A 1HF0A 2AHQA 2HOAA 3I56I 2OTLI 1Z21A 3QOPA 2RKHA 2LREA 3IKTA 2R3SA 4PFPA 1KU7A 2VBYA 2A68F 2KRFA 2F48A 1XX5A 3L1PA 4E4HA 3E6CC 4M71A 4Z6YA 3S93A 3CF2A 1WJCA 2O03A 3QU6A 5CVJA 5DUIA 2R5YA 5E1XA 1OQYA 2DT5A 3OYCA 2XASA 1R5HA 1QPMA 2K40A 1HW5A 4O5VA 3NWTA 9ANTA 1VQ4I 1MKMA 4L0ZB 3CZ6A 4I0AA 1SVMA 5HLGA 2FMYA 3KCCA 1J09A 1IZ1A 2GXBA 2BOLA 2R7OA 4ZYHA 3TOAA 2HOEA 3DEEA 2CUJA 2XVCA 5GTIC 1X19A 2EH3A 2R93J 1YITI 3BR5A 4B44A 3LA7A 3PNVA 2W82A 5HDGA 1IF1A 2ZMEB 2RC4A 2L4AA 1USSA 1SFXA 2JQ7A 2FQ3A 1R1UA 3H9GA 3ERED 4A3GJ 3WG9A 5M5WJ 1F43A 1MD0A 2QSHX 4HOBA 2IRFG 1V5FA 1VTNC 1YJWI 4YIRX 3LAPA 2O5RA 2Z2SB 3C7JA 3JRDA 5J4YA 2VOOA 3U9GA 3JAMK 1VFCA 4F92B 2K3FA 3MMYB 1P6RA 2CQ7A 1Z67A 1R71A 1DP7P 2Z1DA 3ZQIA 3K4JA 5EEAA 2IXSA 2E1OA 1N77A 3RKYA 5HLHA 5HS8A 2ZNZA 2ZJRF 4XLPF 2QQAA 4U88A 1LEBA 5DTDA 4BUPA 1QQIA 5EDNA 2K4BA 3TO9A 5E3LA 5D5XB 1Z3XA 3PFIA 2M87A 2XPVA 3ECOA 3G1MA 1Z7UA 1W0UA 4DYQA 4FHTA 1V54H 2CUEA 4HNUA 2ZMEA 2XGCA 1JGGA 5HDNA 2WB1A 3BQYA 2A3SA 1S8NA 5F0HA 1ENHA 2MD5A 3E3VA 2EFWA 3ZQLA 1X58A 4HEA2 1OISA 4QLCU 3I3LA 3M4OJ 3E6DA 2RDPA 2YU9J 4KIGA 2VONA 1IUFA 2D45A 4ZZDA 2PX9A 4F91B 4HF1A 3S17J 2XPWA 4NQWA 1U5TB 1Z3YA 4CZZA 2LKPA 4E7ZA 3OSFA 2VBXA 2ECBA 4IRHA 2ZC2A 5ILSA 1I3AA 2CQQA 4PFOA 3S3OA 1SFOJ 3GBGA 4ZDPA 3EYYA 4JX6A 2DU9A 3W2VA 2E1NA 1K4SA 4V19K 3VYRB 1GHCA 2KIMA 3DEUA 2MW8A 2CQXA 5HS9A 2PG4A 3HL2A 4KDPA 4FT8A 3HOZJ 1RKTA 3KP3A 4GYIA 1NH3A 1D1AA 4MNUA 3U21A 1ZLKA 3H3VK 1REPC 2IS6A 1OCZH 3K4LA 4BGDA 5J1YA 4AYBN 3COAC 5CVRA 3VSKA 3ZQ7A 4B47A 3K4KA 3FK7A 4H0EA 3IRQA 2XRNA 4CO8A 3OYJA 5ICCA 2H1LA 1CF7A 1QPIA 2VUMJ 1QRYA 2IGOA 4EJWA 4BY1J 4MFDA 3MKZA 4CCKA 3K6GA 3HBLA 2QM3A 4UVCA 1JKOC 2IVMA 1P4WA 3EETA 4HSTA 3MKYB 4UB6C 3RSNA 1AU7A 4IZZA 2O9LA 4FE7A 4CCOA 3HOTA 3IWZA 1OCPA 3L2WA 1LJ9A 4JQFA 1MJBA 1TWCJ 2MLGA 1Y56A 4NDLA 2XV4S 3GFLA 3SZTA 4IKFA 1ZTRA 3MAJA 3HTSB 2KIFA 4PK4A 2LBFB 3FKJA 2ELJA 3H9JA 4A3KJ 2JZYA 3G2BA 4DYCA 4LB5A 3HIFA 4E6KG 2GXAA 1ZGJA 1LUJB 2XAJA 4G7HF 1FEXA 2YS9A 1WH5A 1HCRA 1XC5A 2O7OA 3J80K 4RLQA 2NVQJ 2OPTA 1SVOA 1VQOI 3HRUA 2A6HF 1X1DA 1JT6A 1R58A 3ZMTA 3FM3A 3ZQFA 3ZPLA 2KJBA 1ZG1A 4UUSB 4D7MA 2A6EF 2DA4A 2F2EA 2K86A 1QBJA 3AL0C 3DKXA 1QU3A 3QPTA 2OAZA 2E2JJ 3S3NA 4UHTA 2E2HJ 4BDZA 4AM3A 1TL8A 1OCCH 1UJ8A 4Y17A 4QIWN 2VQCA 2ZXHA 4C2TA 4U0WA 4ESJA 2NS0A 1ETYA 5TGTA 1GVJA 2HVRA 3FXOA 2CMPA 3IL2A 2Y0MA 1ZHFA 2LBFA 4CGZA 4ABZA 3ABUA 5TISC 2HPMA 5EGOB 2D1VA 1LEAA 3K7AJ 4RM2A 5HS7A 2DA3A 1OYYA 1OFCX 2FBKA 5A2QZ 2OQRA 3RIRA 2X6XA 3D5RC 3W3CA 2V9KA 2W24A 3BR2A 1ZGAA 1S6LA 3FBNB 2E36A 5IP6A 2KFDA 2XF6A 3B6AA 2KLOA 1EA3A 2A69F 1XN7A 1X1BA 3P5JA 1HSTA 3MKLA 3TQNA 4IX7A 3S1QJ 2X9DA 1ORKA 4BDYA 1UAAA 1S7OA 2GIVA 2GOMA 2ZXWH 2EV5A 3K10A 3LSGA 2VJ4A 4RM3A 1K61A 2NAZA 2XSDC 1C0WA 3JTGA 3E5XA 3CF5F 2ZJPF 4AIJA 2F4OB 2QKLB 3BG3A 2MC4A 4KMFA 2ZXIA 3W2AA 3P7NA 3S16J 3CUQB 1IRFA 1I39A 2DQLA 4BQQA 1KGSA 1HW1A 2IA0A 2CV1A 2PFBA 3KE2A 3OS2A 1UG2A 1BOAA 4TV7A 3FX3A 1UELB 1D0XA 2BY3A 4DBQA 1P9QC 4XLNF 1BR4A 5EGOA 2BE5F 3VSLA 4CCNA 4B3XA 1R00A 2DFIA 2CFXA 4HX4A 2FEZA 4Z2YA 2MH9A 2FOKA 3DPLC 4XKBA 1K78B 4BE1A 1G59A 5M3FJ 4LK1F 3PL8A 1X2MA 4PZJA 1MJ9A 1BW5A 2ZJ2A 1TQPA 2V9VA 2RNGA 1NK2P 4MTDA 3D0SA 3U1DA 3OYIA 1V4RA 3HGGA 4EJOA 4L5EA 3WTSC 2KKOA 2COMA 3DCFA 1X4PA 4AYBA 2LF7A 5DM7F 4KISA 1ODDA 4ZYGA 1VQLI 3BR1A 2WY8Q 3HPGA 2EZLA 3F8FA 4I2OA 1GV5A 3EUHC 4D0PA 3G3ZA 4ON0A 2IGMA 4Q5SF 5C4XJ 2F5FA 1I6XA 3LSJA 5EG0A 4A3EJ 2HNHA 1JUPA 1MBJA 3CUQA 4A3FJ 1JUSA 2EILH 5KVRA 2KIUA 4PGHA 1RRJA 3IHUA 2PLYA 4LJZF 3VWBA 3OMYA 1S9HA 2Q0OA 3CJNA 3L2VA 2OZUA 1JI8A 1JKPC 2NVYJ 2VT3A 3K4NA 4RB0A 4Q4ZF 3SJMA 1ETWA 2HYJA 2DW4A 2GA2A 4D5CA 2KHMA 3CMYA 2IA1A 4IO9F 1K78A 2EA4A 4IHSA 3HB9A 5LHIA 1TNTA 3A01B 2W85A 4LMYA 2VC1A 2AXTC 2LH9A 5FLMJ 1N25A 1FOWA 5IT3A 2CYYA 1Y1WJ 2R4GA 2EV0A 1OCOH 4S05A 1LVKA 4CICA 5K7ZA 2Z99A 1HW2A 3REOA 1WRJA 3H0GJ 5GAGJ 4DOZA 1U9OA 3LA3A 3I4PA 3M8JA 4HW0A 3DLLF 2ZKZA 1G3YA 3SXYA 3ASOH 3DKWA 3E6BA 3CC2I 3CUOA 2KP6A 4M6YA 2XROA 3BWGA 2HOTA 4XORA 2STWA 5M5XJ 3B6CA 4A3IJ 2K7LA 2VJ5A 2RQPA 1XDUA 5JLWA 2OZ6A 5K7FA 1EH8A 1SMYF 3QQAA 1VF9A 3GO5A 4LOCA 2KQRA 3O8HA 3A01A 1IRXA 3GTJJ 1XB4A 5DCMA 3S1RJ 3RI4A 2GXGA 4ETSA 3HKZN 3DU5A 2LKXA 1XG1A 2JSCA 1XTAA 3FXUA 2MLKA 4I09A 1TQMA 5KK1A 4M9ZA 2QKMB 3EQLF 5HOOA 4WWCA 2L5QA 4PJMA 1T0FA 2EFNA 2ZXJA 4I6ZA 2FJ1A 5IT9Z 5E18F 4KN4X 1W4MA 1A35A 4RS8A 3GYHX 1OMIA 4HLXA 2E1CA 2K3PA 1W7PA 5J47A 2RV8A 1AA7A 3ZMUA 2DOFA 1G2HA 2Z9OA 2JA6J 2YR2A 4C2MJ 1MBHA 3I53A 4A12A 2AXLA 3TDUC 5LRRA 5ICEA 4XICA 1E3OC 4O3MA 3LMMA 2OC6A 1SVLA 3OYBA 2N8GA 3CC4I 2E5NA 3ERMA 2KRHA 2ISZA 5F6FA 3F6VA 4BE0A 3L2CA 3DU6A 4NC6A 2ID6A 1E3HA 3HM5A 4LIUA 3OL4A 4L18B 2M8EA 5LBQA 4HRIA 2QVOA 2O61A 4EVIA 4GYGA 1QZEA 2P0WA 5J4VA 3SEZA 1UG0A 3IV5A 4XL9A 2K4JA 5FB2A 1T0FC 2JT1A 3BCAA 2CG4A 2M34A 3TP0A 4BU2A 1KQ9A 2HVSA 1U3EM 2K9NA 3ASNH 3F8CA 3KPHA 2CW7A 2D1HA 2ICWG 1YW7A 4M6VA 4YIIA 1WCMJ 2L02A 5GPCA 2DA5A 2UXXA 5EJCA 2QQ8A 5FFXA 5HVQC 1LE8A 3ECHA 2X0LA 1PUEE 3KZYA 1JE8A 3QP6A 1ONVA 3IRRA 5HNFA 2RQQA 4RGSA 1ZELA 3LNQA 3UNGC 5F1RA 3ZR8X 1YJ9I 2OV7A 1MJAA 2FQ4A 2L9VA 4B4CA 5EZHA 3WODF 2EZIA 1DDNA 2E1MC 1X3WB 1MIJA 3NRVA 4QWQA 1IG7A 2BY1A 3KP2A 4A0ZA 2ETHA 2JWTA 2HXOA 3LSMA 2V6EA 2V6CA 4MEXF 1FC3A 2HQNA 4LG3A 1EJ9A 1RI7A 3OIPA 3V7CA 4IOAF 1FOXA 3GZ5A 2O0YA 5CLSA 1LB2A 2DOAA 2V9PA 4JOMA 3UR3C 1H9GA 4LK0F 3F6OA 1IN8A 3WHCA 1XSXA 3S1NJ 3TW7A 2L9SA 2DAOA 2R7WA 2IS4A 2M9HA 3K0LA 2VI6A 1ZN2A 3SHFA 5HNHA 1CQTA 2NNYA 3C2BA 2V1UA 2NXNB 1Z77A 2ME0A 2HYGD 1BBYA 2B63J 5KCMA 3OYMA 3W6VA 3DTEA 4A5NA 1G4DA 3BJ6A 2F5VA 4N9IA 5FKNA 1MH4A 1S3JA 2ME6A 2JK3A 5LD2C 1IO2A 2JUGA 2KZGA 4FETA 4RBOA 4XMYA 1HBXG 5J3LA 1R7JA 1R4NB 2R5YB 4JX4A 1GT0C 5BQTA 1SAUA 2W00A 3CCQI 4HDUA 2XAFA 3IH2A 4YIFA 3CMEI 2A61A 4LLGF 2UWMA 1MNEA 2R7ZJ 3R60A 4HG2A 4G7ZF 1O3SA 2NNNA 3JRBA 4FASD 3S2WA 2PI0A 3HKZA 1VQNI 2LTPA 1MMDA 4ESBA 4UUVA 1ETVA 1FBSA 3LSRA 3K4CA 2EA2A 1SD6A 2VOPA 1MBKA 1U0JA 2JVGA 1OYWA 2G7HA 2BGCA 4PUSA 2W57A 4R79A
chains in the Genus database with same CATH topology
2L0KA 2MW8A 2CQXA 1JJ8C 1LFBA 2XB0X 5IP7J 3HOZJ 1RKTA 2JJ7A 4A69C 1IRZA 2DTZA 2Y9YA 1H89C 3H3VK 3RZDJ 1WH7A 2JMWA 4M3EA 4MFEA 1MBEA 1MH3A 5J1YA 1R9TJ 3E7LA 4AYBN 3BTIA 1ZQ3P 5FKMA 4C3HJ 4BBRJ 4XRSA 3I4NJ 3FK7A 1EF4A 1PUFB 3JRHA 1QPIA 2VUMJ 3HOUJ 2HQ5A 1QRYA 4BY1J 1JJ6C 4MFDA 5E3OA 2P81A 4XK4A 3HBLA 4W1UA 1JKOC 4BY7J 2VKEA 1AU7A 1AKHB 2DMTA 2O9LA 4D7NA 2XRLA 2CJJA 4FE7A 4A3CJ 2G0EA 1K83J 4Y7NJ 2JA7J 3BR3A 1OCPA 2Y31A 1TWGJ 1S7EA 3SFIA 5IOYA 3GTMJ 2R5ZA 1TWCJ 2Y0SN 3D1NI 2XGEA 3ZQHA 4NDLA 4C3JJ 3BR0A 5F1JA 1ZTRA 2EZHA 3HEFA 5F27A 2HOSA 1T56A 2EQRA 2TRTA 3GTQJ 3CCYA 4A3KJ 4DYCA 4IHYA 2DMQA 1ETOA 2CU7A 1FEXA 2YS9A 1WH5A 1DU0A 1HCRA 1XC5A 2O7OA 2NVQJ 2OPTA 1JKRC 1PUFA 1B8IA 2LLKA 1JT6A 2DMNA 2NS7A 2KT0A 1TWAJ 3ZQFA 3A03A 2WAQN 4UUSB 4D7MA 1GDTA 2DA4A 3G1LA 2NVXJ 1HLVA 1ZR2A 1AKHA 2E2JJ 1ETXA 2NOGA 3K2AA 5FKLA 2E2HJ 1HDDC 1X2NA 3BQZA 1JKQC 4QIWN 4DZJA 5EYRA 1APLC 2AO9A 1ETYA 1RPWA 4IHVA 4CYCA 2DA2A 5DS9A 3GTOJ 5J1RA 1ETQA 2L9RA 4ABZA 2H8RA 2MSYA 3PM1A 4A3JJ 5EGOB 3JRGA 1HDPA 3K7AJ 2DA3A 1OFCX 2QF7A 1BA5A 3I4MJ 4X6AJ 3Q3SA 3BR2A 1ZK8A 5IP6A 3BT9A 1BL0A 3B6AA 4A3BJ 5JLXA 3MKLA 3QPSA 3DEWA 3S1QJ 3FK6A 2X9DA 5EZGA 1ORKA 5GP9A 1A5JA 3JRFA 3UKGA 3CDLA 1YRNB 5F08A 2R5ZB 1GV2A 3LSGA 1K61A 2GLOA 3HOYJ 2XSDC 1FJLA 3JR9A 3S1MJ 1Q1VA 3MN2A 4FISA 4FCYA 3BG3A 1HOMA 3S16J 2D5VA 4IHXA 1JUMA 3HGYA 3RKQA 3GTPJ 4JP0A 3IH3A 2H1KA 1P7JA 4AUXA 1UG2A 3OIOA 1XS9A 2DA1A 4MO7A 1VI0A 2YUSA 5EGOA 1I3QJ 5IYDJ 2Y2ZA 4DZPA 3GTLJ 2XB5A 1MBGA 1B8IB 5M3FJ 4J19A 3TP3A 2IAIA 5IP9J 1X2MA 4A3DJ 3FKIJ 1BW5A 5IPAA 4Y52J 1NK2P 3OOUA 3S15J 3HGGA 2L7FP 3JREA 4L5EA 2X48A 4V2GA 3DCFA 2L7ZA 3BTJA 4W97A 3ZQGA 1A6IA 2NS8A 1F36A 1TC3C 1YRNA 1QVTA 3BR1A 1TWHJ 2ELKA 2ID3A 2EZLA 4V2FA 1GV5A 5C4XJ 5E3NA 1ETKA 2VPRA 2WV1A 3LSJA 4CYCB 5EG0A 4A3EJ 1JUPA 1QVUA 1MBJA 5HODA 4A3FJ 1JUSA 4M3DA 4B3AA 1FTTA 2HDDA 1D5YA 2ZB9A 3HOVJ 1Z0XA 2CUFA 3FIWA 1JKPC 1RKWA 3HOWJ 2NVYJ 1JTYA 2EZKA 4S0HB 1MSEC 1IDZA 3SJMA 1ETWA 4M3FA 2HYJA 2DN0A 3MVPA 4D5CA 1AHDP 3CMYA 4MIMA 4RDUA 2O8KA 3HB9A 3A01B 2IEKA 5IYBJ 3BR6A 5IOZA 5FLMJ 1MSFC 3IH4A 3JRAA 2HI3A 4QSHA 3Q0VA 3CQZJ 1RR7A 2RAEA 3RQIA 1Y1WJ 1ZKGA 5EF6A 4A3MJ 4IEJA 5C4JJ 1IGNA 4UUTA 5K7ZA 1NK3P 4IHWA 3H0GJ 2Y30A 2K9SA 4BKXA 2LY9A 1U9OA 4AC0A 3HOXJ 1LFUP 2DMPA 1MNMC 2XPUA 1BW6A 3SDGA 1U78A 1H88C 4DW6A 2XGDA 5GPAA 3RZOJ 1RETA 3F0CA 2HOTA 2DA7A 2WB1N 5M5XJ 2COBA 3B6CA 4A3IJ 1ZR4A 3JRIA 1FIAA 1B72B 4BXXJ 4GFBA 5JLWA 3GTKJ 1U9NA 5K7FA 3PO2J 4MLOA 2W48A 4XRSG 3QQAA 1VF9A 4FTHA 4LOCA 3HDDA 2JA8J 1DU6A 3FISA 3O8HA 3A01A 4A3LJ 3GTJJ 2VKVA 3S1RJ 3ZQCA 4EEFG 2FD5A 3HKZN 3M3YJ 3LSPA 3S2DJ 2LKXA 2LD5A 1XG1A 1P7IA 3TW6A 1JTXA 5EG0B 3NARA 2JA5J 2FX0A 2NVTJ 4I6ZA 5M3MJ 4XRMA 2FJ1A 2Y9ZA 2DA6A 1W0TA 1WGXA 4M3GA 3A02A 3NAUA 2HXIA 2M2EA 4FE4A 2QCOA 2ECCA 3Q0UA 2LFBA 2PMZN 4JX5A 4XIDA 1VNDA 1UMQA 2E19A 1G2HA 2LP0A 1MBFA 2JA6J 3S2HJ 4C2MJ 1MBHA 1UHSA 4B1RA 4A93J 1B72A 1HF0A 2AHQA 2HOAA 4C3IJ 5IYCJ 4XICA 1U8BA 1I6HJ 1E3OC 4HNVA 2N8GA 5FKKA 2M8GX 3L1PA 4QTRA 2ID6A 3HM5A 1NTCA 3LOCA 3S14J 4D5FA 5K7HA 1OCTC 2R5YA 2LK2A 3IV5A 1OJLA 1T33A 5F0FA 1I50J 2M34A 2K40A 3TP0A 1IC8A 3Q0WA 5F04A 2KDZA 2K9NA 4BBSJ 9ANTA 3PO3J 4M6VA 5GPCA 1WCMJ 2GBYA 2LVSA 2DA5A 2LR8A 2E2IJ 2R92J 2L7MP 3JRCA 1LE8A 3QPLA 2EH3A 2R93J 3BR5A 3OSGA 5E3MA 2K9QA 3LNQA 2FQ4A 4B4CA 1ITYA 5EZHA 5FLVA 2EZIA 2M0CA 3GTGJ 4A3GJ 1RESA 2R0QC 3WHBA 1IG7A 5M5WJ 1F43A 2JWTA 2HXOA 1IDYA 1WPKA 2EBIA 3JRDA 2DMUA 2GM4A 2DJNA 1VFCA 3BG5A 5C3EJ 5C44J 3WHCA 1Y1VJ 3S1NJ 1ZGWA 3TW7A 3ZQIA 3VPRA 5EEAA 2E1OA 1GUUA 2M9HA 2VI6A 3BTCA 1CQTA 5FKOA 3C2BA 4DYRA 5J1UA 1Z77A 2ME0A 2B63J 1FTZA 5DTDA 2IBDA 2OF7A 5FJ8J 5EDNA 5E3LA 3BTLA 3W6VA 1IJWC 2XPVA 3G1MA 1W0UA 4DYQA 1JT0A 2CUEA 5FKNA 1MH4A 2ME6A 2JK3A 2XGCA 1JGGA 1O4XA 3BQYA 5F0CA 5F0HA 4RBOA 4G12A 1ENHA 1GVDA 1TWFJ 2X6OA 5J3LA 3O8GA 2R5YB 4JX4A 2CRGA 3ZOBA 1X58A 4X1EA 3TEDA 3ZQLA 1GT0C 3M4OJ 3IH2A 4JYKA 3BG9A 1WI3A 2YU9J 3G1OA 1SANA 1IUFA 2R7ZJ 2TCTA 1POGA 5M5YJ 3JRBA 3S17J 2XPWA 2LTPA 2MGQA 4UUSA 1ETVA 2I10A 3LSRA 3OSFA 1H8AC 2JN6A 2ECBA 5BNGA 2MG4A 1LE8B 2CQQA 1MBKA 1SFOJ 1BJZA 4M3BA 1IV6A 3GBGA 1FIPA 4I76A 4JX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0K A;  2MW8 A;  2CQX A;  1JJ8 C;  1LFB A;  2XB0 X;  5IP7 J;  3HOZ J;  1RKT A;  2JJ7 A;  4A69 C;  1IRZ A;  2DTZ A;  2Y9Y A;  1H89 C;  3H3V K;  3RZD J;  1WH7 A;  2JMW A;  4M3E A;  4MFE A;  1MBE A;  1MH3 A;  5J1Y A;  1R9T J;  3E7L A;  4AYB N;  3BTI A;  1ZQ3 P;  5FKM A;  4C3H J;  4BBR J;  4XRS A;  3I4N J;  3FK7 A;  1EF4 A;  1PUF B;  3JRH A;  1QPI A;  2VUM J;  3HOU J;  2HQ5 A;  1QRY A;  4BY1 J;  1JJ6 C;  4MFD A;  5E3O A;  2P81 A;  4XK4 A;  3HBL A;  4W1U A;  1JKO C;  4BY7 J;  2VKE A;  1AU7 A;  1AKH B;  2DMT A;  2O9L A;  4D7N A;  2XRL A;  2CJJ A;  4FE7 A;  4A3C J;  2G0E A;  1K83 J;  4Y7N J;  2JA7 J;  3BR3 A;  1OCP A;  2Y31 A;  1TWG J;  1S7E A;  3SFI A;  5IOY A;  3GTM J;  2R5Z A;  1TWC J;  2Y0S N;  3D1N I;  2XGE A;  3ZQH A;  4NDL A;  4C3J J;  3BR0 A;  5F1J A;  1ZTR A;  2EZH A;  3HEF A;  5F27 A;  2HOS A;  1T56 A;  2EQR A;  2TRT A;  3GTQ J;  3CCY A;  4A3K J;  4DYC A;  4IHY A;  2DMQ A;  1ETO A;  2CU7 A;  1FEX A;  2YS9 A;  1WH5 A;  1DU0 A;  1HCR A;  1XC5 A;  2O7O A;  2NVQ J;  2OPT A;  1JKR C;  1PUF A;  1B8I A;  2LLK A;  1JT6 A;  2DMN A;  2NS7 A;  2KT0 A;  1TWA J;  3ZQF A;  3A03 A;  2WAQ N;  4UUS B;  4D7M A;  1GDT A;  2DA4 A;  3G1L A;  2NVX J;  1HLV A;  1ZR2 A;  1AKH A;  2E2J J;  1ETX A;  2NOG A;  3K2A A;  5FKL A;  2E2H J;  1HDD C;  1X2N A;  3BQZ A;  1JKQ C;  4QIW N;  4DZJ A;  5EYR A;  1APL C;  2AO9 A;  1ETY A;  1RPW A;  4IHV A;  4CYC A;  2DA2 A;  5DS9 A;  3GTO J;  5J1R A;  1ETQ A;  2L9R A;  4ABZ A;  2H8R A;  2MSY A;  3PM1 A;  4A3J J;  5EGO B;  3JRG A;  1HDP A;  3K7A J;  2DA3 A;  1OFC X;  2QF7 A;  1BA5 A;  3I4M J;  4X6A J;  3Q3S A;  3BR2 A;  1ZK8 A;  5IP6 A;  3BT9 A;  1BL0 A;  3B6A A;  4A3B J;  5JLX A;  3MKL A;  3QPS A;  3DEW A;  3S1Q J;  3FK6 A;  2X9D A;  5EZG A;  1ORK A;  5GP9 A;  1A5J A;  3JRF A;  3UKG A;  3CDL A;  1YRN B;  5F08 A;  2R5Z B;  1GV2 A;  3LSG A;  1K61 A;  2GLO A;  3HOY J;  2XSD C;  1FJL A;  3JR9 A;  3S1M J;  1Q1V A;  3MN2 A;  4FIS A;  4FCY A;  3BG3 A;  1HOM A;  3S16 J;  2D5V A;  4IHX A;  1JUM A;  3HGY A;  3RKQ A;  3GTP J;  4JP0 A;  3IH3 A;  2H1K A;  1P7J A;  4AUX A;  1UG2 A;  3OIO A;  1XS9 A;  2DA1 A;  4MO7 A;  1VI0 A;  2YUS A;  5EGO A;  1I3Q J;  5IYD J;  2Y2Z A;  4DZP A;  3GTL J;  2XB5 A;  1MBG A;  1B8I B;  5M3F J;  4J19 A;  3TP3 A;  2IAI A;  5IP9 J;  1X2M A;  4A3D J;  3FKI J;  1BW5 A;  5IPA A;  4Y52 J;  1NK2 P;  3OOU A;  3S15 J;  3HGG A;  2L7F P;  3JRE A;  4L5E A;  2X48 A;  4V2G A;  3DCF A;  2L7Z A;  3BTJ A;  4W97 A;  3ZQG A;  1A6I A;  2NS8 A;  1F36 A;  1TC3 C;  1YRN A;  1QVT A;  3BR1 A;  1TWH J;  2ELK A;  2ID3 A;  2EZL A;  4V2F A;  1GV5 A;  5C4X J;  5E3N A;  1ETK A;  2VPR A;  2WV1 A;  3LSJ A;  4CYC B;  5EG0 A;  4A3E J;  1JUP A;  1QVU A;  1MBJ A;  5HOD A;  4A3F J;  1JUS A;  4M3D A;  4B3A A;  1FTT A;  2HDD A;  1D5Y A;  2ZB9 A;  3HOV J;  1Z0X A;  2CUF A;  3FIW A;  1JKP C;  1RKW A;  3HOW J;  2NVY J;  1JTY A;  2EZK A;  4S0H B;  1MSE C;  1IDZ A;  3SJM A;  1ETW A;  4M3F A;  2HYJ A;  2DN0 A;  3MVP A;  4D5C A;  1AHD P;  3CMY A;  4MIM A;  4RDU A;  2O8K A;  3HB9 A;  3A01 B;  2IEK A;  5IYB J;  3BR6 A;  5IOZ A;  5FLM J;  1MSF C;  3IH4 A;  3JRA A;  2HI3 A;  4QSH A;  3Q0V A;  3CQZ J;  1RR7 A;  2RAE A;  3RQI A;  1Y1W J;  1ZKG A;  5EF6 A;  4A3M J;  4IEJ A;  5C4J J;  1IGN A;  4UUT A;  5K7Z A;  1NK3 P;  4IHW A;  3H0G J;  2Y30 A;  2K9S A;  4BKX A;  2LY9 A;  1U9O A;  4AC0 A;  3HOX J;  1LFU P;  2DMP A;  1MNM C;  2XPU A;  1BW6 A;  3SDG A;  1U78 A;  1H88 C;  4DW6 A;  2XGD A;  5GPA A;  3RZO J;  1RET A;  3F0C A;  2HOT A;  2DA7 A;  2WB1 N;  5M5X J;  2COB A;  3B6C A;  4A3I J;  1ZR4 A;  3JRI A;  1FIA A;  1B72 B;  4BXX J;  4GFB A;  5JLW A;  3GTK J;  1U9N A;  5K7F A;  3PO2 J;  4MLO A;  2W48 A;  4XRS G;  3QQA A;  1VF9 A;  4FTH A;  4LOC A;  3HDD A;  2JA8 J;  1DU6 A;  3FIS A;  3O8H A;  3A01 A;  4A3L J;  3GTJ J;  2VKV A;  3S1R J;  3ZQC A;  4EEF G;  2FD5 A;  3HKZ N;  3M3Y J;  3LSP A;  3S2D J;  2LKX A;  2LD5 A;  1XG1 A;  1P7I A;  3TW6 A;  1JTX A;  5EG0 B;  3NAR A;  2JA5 J;  2FX0 A;  2NVT J;  4I6Z A;  5M3M J;  4XRM A;  2FJ1 A;  2Y9Z A;  2DA6 A;  1W0T A;  1WGX A;  4M3G A;  3A02 A;  3NAU A;  2HXI A;  2M2E A;  4FE4 A;  2QCO A;  2ECC A;  3Q0U A;  2LFB A;  2PMZ N;  4JX5 A;  4XID A;  1VND A;  1UMQ A;  2E19 A;  1G2H A;  2LP0 A;  1MBF A;  2JA6 J;  3S2H J;  4C2M J;  1MBH A;  1UHS A;  4B1R A;  4A93 J;  1B72 A;  1HF0 A;  2AHQ A;  2HOA A;  4C3I J;  5IYC J;  4XIC A;  1U8B A;  1I6H J;  1E3O C;  4HNV A;  2N8G A;  5FKK A;  2M8G X;  3L1P A;  4QTR A;  2ID6 A;  3HM5 A;  1NTC A;  3LOC A;  3S14 J;  4D5F A;  5K7H A;  1OCT C;  2R5Y A;  2LK2 A;  3IV5 A;  1OJL A;  1T33 A;  5F0F A;  1I50 J;  2M34 A;  2K40 A;  3TP0 A;  1IC8 A;  3Q0W A;  5F04 A;  2KDZ A;  2K9N A;  4BBS J;  9ANT A;  3PO3 J;  4M6V A;  5GPC A;  1WCM J;  2GBY A;  2LVS A;  2DA5 A;  2LR8 A;  2E2I J;  2R92 J;  2L7M P;  3JRC A;  1LE8 A;  3QPL A;  2EH3 A;  2R93 J;  3BR5 A;  3OSG A;  5E3M A;  2K9Q A;  3LNQ A;  2FQ4 A;  4B4C A;  1ITY A;  5EZH A;  5FLV A;  2EZI A;  2M0C A;  3GTG J;  4A3G J;  1RES A;  2R0Q C;  3WHB A;  1IG7 A;  5M5W J;  1F43 A;  2JWT A;  2HXO A;  1IDY A;  1WPK A;  2EBI A;  3JRD A;  2DMU A;  2GM4 A;  2DJN A;  1VFC A;  3BG5 A;  5C3E J;  5C44 J;  3WHC A;  1Y1V J;  3S1N J;  1ZGW A;  3TW7 A;  3ZQI A;  3VPR A;  5EEA A;  2E1O A;  1GUU A;  2M9H A;  2VI6 A;  3BTC A;  1CQT A;  5FKO A;  3C2B A;  4DYR A;  5J1U A;  1Z77 A;  2ME0 A;  2B63 J;  1FTZ A;  5DTD A;  2IBD A;  2OF7 A;  5FJ8 J;  5EDN A;  5E3L A;  3BTL A;  3W6V A;  1IJW C;  2XPV A;  3G1M A;  1W0U A;  4DYQ A;  1JT0 A;  2CUE A;  5FKN A;  1MH4 A;  2ME6 A;  2JK3 A;  2XGC A;  1JGG A;  1O4X A;  3BQY A;  5F0C A;  5F0H A;  4RBO A;  4G12 A;  1ENH A;  1GVD A;  1TWF J;  2X6O A;  5J3L A;  3O8G A;  2R5Y B;  4JX4 A;  2CRG A;  3ZOB A;  1X58 A;  4X1E A;  3TED A;  3ZQL A;  1GT0 C;  3M4O J;  3IH2 A;  4JYK A;  3BG9 A;  1WI3 A;  2YU9 J;  3G1O A;  1SAN A;  1IUF A;  2R7Z J;  2TCT A;  1POG A;  5M5Y J;  3JRB A;  3S17 J;  2XPW A;  2LTP A;  2MGQ A;  4UUS A;  1ETV A;  2I10 A;  3LSR A;  3OSF A;  1H8A C;  2JN6 A;  2ECB A;  5BNG A;  2MG4 A;  1LE8 B;  2CQQ A;  1MBK A;  1SFO J;  1BJZ A;  4M3B A;  1IV6 A;  3GBG A;  1FIP A;  4I76 A;  4JX6 A; 
#chains in the Genus database with same CATH topology
 4IXA A;  5B3S H;  4F52 A;  4ESF A;  2HPI A;  1JJ8 C;  4B48 A;  3DWL E;  3DXJ F;  1I1S A;  1UST A;  3KEY A;  4A69 C;  2DTZ A;  2Y9Y A;  3DPU A;  1B9N A;  3R61 A;  3DTK A;  4WF2 A;  3H5R A;  5CVI A;  3RZD J;  1QZZ A;  2JMW A;  2W4S A;  3A0H C;  3VYU B;  1MH3 A;  4WX9 A;  2QZ8 A;  4C3H J;  4BBR J;  3QOD A;  1O7L A;  4M9S A;  4HNT A;  1J9I A;  1BIB A;  1YIO A;  3VOE A;  4XRF A;  5B66 C;  3JRH A;  2DT7 B;  2DOD A;  2DCE A;  3CDH A;  2HQ5 A;  3F23 A;  1FBU A;  4GDF A;  2X51 A;  2NRA C;  5E3O A;  3CJR B;  1W36 C;  4BHB A;  1O7F A;  5EEH A;  4IRI A;  2FU4 A;  1AKH B;  2DMT A;  2JPC A;  1WI9 A;  2M4K A;  2CJJ A;  5L3F A;  2DOE A;  1K83 J;  1E0E A;  2Y31 A;  2V79 A;  1FT9 A;  2CV2 A;  3H5A A;  3SFZ A;  4P9F A;  2XGE A;  3ZQH A;  2IGK A;  4C3J J;  1WSU A;  1BI0 A;  3BCB A;  3RYP A;  3V8K A;  2EZH A;  4L9N A;  1BM9 A;  4KIT B;  3L2Q A;  3FXR A;  3MQ0 A;  1T56 A;  2EQR A;  5GAH J;  2NVU B;  3KEO A;  2IGN A;  3R0A A;  4P1W A;  5DDG A;  4CXF A;  4DQ2 A;  3M8F A;  1T8I A;  2OU2 A;  1EKE A;  3DBL B;  4XKV A;  4Y13 A;  1DU0 A;  2QBY A;  2BHY A;  2P6T A;  2P6S A;  4RB3 C;  3A0B C;  3DF8 A;  2DYS H;  4LFU A;  5FLX K;  4BS9 A;  1B8I A;  2DMN A;  3ABK H;  2LY2 A;  1FSE A;  5L3G A;  1TWA J;  1RNL A;  4NQW B;  2M1B A;  3J81 K;  1GDT A;  2VXD A;  1WVR A;  3M9A A;  2XUB A;  2JVH A;  1AKH A;  1OR7 C;  5K5Q A;  4IQ4 A;  3ML6 A;  4BYY A;  3LSK A;  4MTE A;  3K2A A;  3WTX C;  2XF5 A;  4H4K C;  4P55 A;  2RNJ A;  2H94 A;  3J7A O;  3FHZ A;  1IXR C;  1VQM I;  1APL C;  4KIB A;  3MZH A;  3PQK A;  1OYI A;  3BOQ A;  2DA2 A;  3KFW X;  3W6K B;  5J1R A;  1UHW A;  2H8R A;  1L3L A;  3PM1 A;  4A3J J;  3KZZ A;  2CO5 A;  5LEJ A;  3JRG A;  1FY7 A;  5DD8 A;  4A6E A;  2WTE A;  3ZMS A;  4MQ9 F;  2X4H A;  4I98 B;  4II2 A;  4IF4 A;  4X6A J;  2MFZ A;  5J8C A;  3QYE A;  3Q3S A;  1CF7 B;  2QSG X;  1BL0 A;  4E7S A;  2R7S A;  3OIQ A;  2Q2E A;  3N97 A;  2F4I A;  2FRH A;  3QPS A;  5E79 C;  1G3W A;  5DEQ A;  3AL0 B;  3O2P E;  5D8K B;  3LAJ A;  1A5J A;  4D9J A;  1YRN B;  4HAM A;  3FMR A;  4FX4 A;  1HSJ A;  1SFE A;  3QYB A;  2UXN A;  4A5M A;  1T08 B;  4BH9 A;  3S1M J;  3V8L A;  3WU0 A;  1FZP B;  5HLT A;  1R23 A;  2VKD A;  3VOD A;  2D5V A;  2VQG A;  2HDC A;  2TDX A;  3HGY A;  2RGV A;  3GTP J;  4PSW A;  2F5C A;  2FA5 A;  4II3 A;  3VFZ A;  3WGI A;  1VI0 A;  1WHU A;  3SZG A;  2CH0 A;  4FQG A;  3OYD A;  2Y2Z A;  1PJR A;  2OUM A;  3QAH A;  4XLE A;  2XGX A;  1RZ4 A;  5AIP A;  3PNT A;  3GME A;  2R7T A;  1UFM A;  3HUG A;  4Q48 A;  2AS5 F;  2LY1 A;  1HKQ A;  4GGG A;  2X48 A;  4LD5 A;  4V2G A;  5D5W B;  4AIK A;  3DKY A;  1DGW Y;  2BZT A;  2F6C A;  1TNS A;  2VN2 A;  3HRM A;  4BJT A;  4EAT A;  4U7D A;  1TC3 C;  1YRN A;  1QVT A;  4B09 A;  1K7A A;  1TWH J;  2E7X A;  3PQJ A;  2STT A;  1MDM B;  2ELK A;  2ID3 A;  2JRT A;  1JGS A;  1LDD A;  2VE9 A;  1HXD A;  3WTU C;  1O3R A;  2CUZ A;  3NEU A;  5HOD A;  4HBL A;  2EIN H;  2PMU A;  4RA2 A;  3LSI A;  5CYV A;  3T1B A;  5JHF A;  1X1P A;  4LIV A;  2ZB9 A;  1YYV A;  3R4K A;  3RQ4 A;  1D3Y A;  1MGT A;  5JFR A;  2EZK A;  2X6W A;  1IDZ A;  2DN0 A;  2XHK A;  4HF2 A;  2MC3 A;  4HYE A;  4MIM A;  1S72 I;  1JHF A;  2LMD A;  3IP4 B;  5DUK A;  2QYO A;  2IEK A;  1KON A;  2GAU A;  3BLY A;  3AG3 H;  2X6Y A;  5IYB J;  3DTI A;  1BI3 A;  2KRC A;  4UV9 A;  4AWX B;  1QGP A;  3RQI A;  3EUA A;  4YFN F;  1TTY A;  2VQL A;  1ZKG A;  3F9K A;  5EF6 A;  3F3X A;  5C4J J;  3CCM I;  1WJA A;  4I01 A;  4YEL A;  1EH7 A;  3CCS I;  1F4K A;  2E5Z A;  4DNC A;  4E7L A;  5B1B H;  1U2W A;  4Y15 A;  1MDM A;  2LG4 A;  1YIJ I;  2B9S A;  1WJB A;  3CMA I;  1S7A A;  3B73 A;  5ERI A;  2DMP A;  5E1Z B;  2P7V B;  2K9M A;  2BW3 A;  3IAM 2;  3OL3 A;  4M9X A;  2V1D A;  2HVQ A;  3TKY A;  3ZRG A;  3RZO J;  4XLH A;  2BY2 A;  2HS5 A;  3LQQ A;  4UXN A;  3E97 A;  3BP8 A;  3K70 C;  2DTR A;  1IN5 A;  1LDJ A;  2COB A;  5CQG A;  2XDV A;  3ESW B;  1H0M A;  4BXX J;  5F64 A;  4L9J A;  4XRS G;  4IHT A;  3ZGK A;  5FRM A;  3L00 A;  3MEX A;  2VBZ A;  3F8N A;  4IRG A;  3EPZ A;  1DU6 A;  1YS6 A;  2DPU A;  2XC7 A;  5L3B A;  2VKV A;  3RPU A;  2H27 A;  2CQN A;  3ZQC A;  4IOC F;  3I0T A;  3SZP A;  4BQO A;  2LD5 A;  2OA4 A;  3ABT A;  3V42 A;  3TW6 A;  3Q9V A;  3K9T A;  1FNN A;  4YRV A;  1O3T A;  5D4S A;  5HDK A;  2ADU A;  4RMN A;  3EUH A;  4EGY A;  3EUK L;  5EG0 B;  1YTY A;  2FX0 A;  5M3M J;  1FYK A;  4MHG A;  2QWW A;  2HXI A;  2UV1 A;  4FE4 A;  2XAU A;  2QCO A;  3WU1 B;  4GCV A;  3LL7 A;  3KLO A;  1KU3 A;  3GLX A;  1Y8Q B;  3V4G A;  3IWF A;  3DQV C;  5ILV A;  2F5E A;  3TBI A;  5LHH A;  1VQ9 I;  3FWE A;  4K2E A;  3GLL A;  4C3I J;  3N05 A;  1XD7 A;  5IYC J;  1I6H J;  1R22 A;  3RTR A;  4BE2 A;  4CA0 A;  1D8K A;  3JAM Z;  2BHZ A;  1PVE A;  4HNV A;  3KYD B;  1D5V A;  5FKK A;  1BI1 A;  1VQK I;  2KPM A;  4BXU A;  4RB2 C;  3PUF A;  3PIP F;  2X1C A;  2VKH A;  1NTC A;  2FF4 A;  1B9M A;  4F3Q A;  4D5F A;  2X1D A;  2K02 A;  2W25 A;  4NC7 A;  4LLL A;  1HA8 A;  2LK2 A;  3FXQ A;  3RYR A;  1OJL A;  5F0F A;  4I99 C;  3Q0W A;  5F04 A;  2GZW A;  2LRD A;  3BPX A;  2O3F A;  1OLT A;  1GLN A;  4P5O A;  4ENM A;  1ZG5 A;  4HX8 A;  2DDA A;  3LWF A;  2GBY A;  2HKO A;  3I59 B;  5B5E C;  3ELK A;  4C2U A;  1MZB A;  4OMZ A;  3CES A;  4X0G A;  2L7M P;  3JRC A;  1CGP A;  3QPL A;  5J40 A;  4XBF A;  2OJE D;  1Y39 A;  2M3A A;  4G6Q A;  1Z7L A;  5E3M A;  4XLA A;  3H3Z A;  4HV6 A;  3N4M A;  4CSW A;  1IV8 A;  2KIQ A;  2VE8 A;  3TOB A;  1ZRC A;  5DCM B;  2Y48 A;  1GXP A;  2PMH A;  4EQQ A;  1P92 A;  1IXC A;  2AQF A;  2FNP A;  1PYV A;  1QZY A;  3I5U A;  3GTG J;  3WHB A;  3DBR B;  5DD4 A;  3JW4 A;  1YW8 A;  4OU0 A;  3GF2 A;  3G71 I;  1IDY A;  1WPK A;  1DQU A;  1BR2 A;  2EBI A;  1MMN A;  4OIR F;  3U1K A;  3L09 A;  1LVA A;  1ZH5 A;  2DMU A;  1K6O A;  4CDG A;  2ZSH B;  5C44 J;  2VXZ A;  4S04 A;  1ZGW A;  4E7H A;  4G94 A;  3D5S C;  3VPR A;  2VLA A;  1YQA A;  3IKV A;  1KZH A;  1GUU A;  1W7P B;  4G6T B;  3I59 A;  3FBI B;  2B0L A;  3M1C A;  2CGP A;  1E17 A;  2F4M B;  3DLA A;  1T2K A;  3RKW A;  4RAG A;  3GUD A;  2IBD A;  1U8R A;  2OF7 A;  5FJ8 J;  1FTZ A;  1KU9 A;  3BJO A;  2EIK H;  1FLI A;  2ESH A;  2EWN A;  4NUB A;  2M0M A;  2DFE A;  1IJW C;  1NG7 A;  1R36 A;  3L2U A;  1W7P D;  3GFM A;  2R7Q A;  2JTV A;  3CCU I;  2R7F A;  2E1M B;  4I7H A;  1RC9 A;  1Z1D A;  4GXO A;  4ITV A;  3W2W A;  5F0C A;  1IAW A;  1V3F A;  2OCE A;  4G12 A;  1TWF J;  2A05 A;  2A5Y B;  3O8G A;  2CRG A;  3ZOB A;  3TED A;  4X1E A;  5D8L B;  1IUY A;  1B1B A;  3BG9 A;  1D1B A;  2QQ9 A;  3OYE A;  1FMV A;  4LLN A;  3C3W A;  2HDW A;  3R6S A;  2EIM H;  1O57 A;  2FXA A;  1UB9 A;  2EIJ H;  4KYW A;  2Q1Z B;  2XIG A;  1BN5 A;  3OR1 C;  1IRG A;  2HQA A;  1PDN C;  2JN6 A;  1YW9 A;  2L2O A;  3DPT A;  1FSH A;  2MG4 A;  1LE8 B;  3CP2 A;  1B4A A;  4M3B A;  4CH7 A;  1FIP A;  4I76 A;  1R6R A;  3J80 Z;  2L0K A;  2P5K A;  3ZMV A;  4RAF A;  3H35 A;  5H2F C;  2XB0 X;  1E3P A;  3HJE A;  2E71 A;  2JJ7 A;  1IRZ A;  5K5R A;  4IPA A;  1TW3 A;  4HZF A;  5JVG F;  1P4X A;  2R7D A;  2CS3 A;  4NC8 A;  2QA4 I;  4MFE A;  1MBE A;  1R9T J;  1KYZ A;  1TT5 B;  3IAS 2;  2R7V A;  4OIQ F;  3MZ8 A;  5E17 F;  4XRS A;  3I4N J;  2NYX A;  3O3K A;  3ABM H;  4KJZ A;  2FBI A;  3OYN A;  4EMS A;  3HOU J;  6PAX A;  2WAF A;  1B59 A;  1XSV A;  4WXD A;  4ZDL A;  3K4M A;  1VZ0 A;  4DBR A;  4BJ6 C;  4M6X A;  1P2F A;  3JSP A;  1MND A;  4BY7 J;  4A3C J;  4OAY A;  3HPH A;  1Q1H A;  3OS1 A;  2IS2 A;  2L3D A;  3BR3 A;  3BZC A;  1TWG J;  1S7E A;  3SFI A;  5IOY A;  2R5Z A;  5DCF A;  2ZFW A;  1KA8 A;  2M7B A;  3PNY A;  5F1J A;  1W5C C;  1X1A A;  4L5J A;  3J7A Y;  2P8T A;  3LA2 A;  1SAX A;  4XQF A;  5F27 A;  2HOS A;  3BZK A;  3F8M A;  3CC7 I;  3PJR A;  2TRT A;  5K1Y A;  3GTQ J;  1K4T A;  3BPV A;  3E1S A;  3CCY A;  4IHY A;  1BJA A;  3KEQ A;  2HQR A;  2RVC A;  3WG7 H;  3A4C A;  2DMQ A;  2UZK A;  3HHG A;  3OYA A;  5KNL A;  1ZAO A;  1DP3 A;  1LKX A;  3CD6 I;  2C6Y A;  4ZC3 A;  5LEK A;  1FYM A;  4N4N B;  3HG9 A;  2ZJQ F;  2JUC A;  3KZI C;  5H6Q A;  4HQE A;  1JKR C;  1TLH B;  2LLK A;  4E7J A;  3E5Q A;  2NS7 A;  1T6S A;  3KET A;  2KT0 A;  1R1V A;  3QU3 A;  3A03 A;  2EJR A;  3FXL A;  1YFH A;  4OIO F;  2L01 A;  2WAQ N;  3OOP A;  2DJI A;  4KFC A;  3G1L A;  2NVX J;  4P96 A;  1HLV A;  1ZR2 A;  5J8F A;  2KDO A;  1ULY A;  1ETX A;  3E6M A;  3WTZ A;  4JBA A;  4UVB A;  4F7Z A;  1KYW A;  1X2N A;  2E7W A;  1KQ8 A;  3V8J A;  4NHJ A;  3LQR A;  3P9K A;  4DZJ A;  1W36 D;  3HOS A;  5EYR A;  3OY9 A;  3GFJ A;  1YG2 A;  2AO9 A;  4BEH B;  4HX7 A;  2WC2 A;  2PBI A;  3QPH A;  4IHV A;  4CYC A;  4RB1 A;  3TDZ C;  4BHC A;  1N78 A;  1FPQ A;  2L9R A;  2EFQ A;  1WZ2 A;  3QWL A;  1RIO H;  2J5O A;  2OTJ I;  4O6J A;  1HDP A;  2EV6 A;  2HGC A;  2IT0 A;  3H1C A;  4ZYE A;  3CCR I;  1J59 A;  1A36 A;  1E2X A;  4KUM A;  1BA5 A;  1XGM A;  1WQ2 A;  1ON1 A;  2X85 A;  2HR3 A;  2WAD A;  4HDV A;  3BC8 A;  1T98 A;  4AVZ A;  1BIA A;  3DEW A;  3FK6 A;  2P4W A;  5EZG A;  1W1W E;  2L54 A;  4HQM A;  4CHU A;  1YX3 A;  2KL4 A;  2RRE A;  5GP9 A;  1WJ5 A;  3CJQ B;  3UKG A;  5F08 A;  2PJP A;  4XNF A;  1FMW A;  1GV2 A;  2BXY A;  2LSO A;  4ZTJ A;  2DT6 A;  2ZSI B;  5JHU A;  5D5U B;  1FJL A;  3ZMZ A;  1Q1V A;  4P9U A;  1SC7 A;  2OCC H;  1Z9C A;  3GWZ A;  4FCY A;  5D6F A;  2DK5 A;  3HRS A;  5AON A;  4BEH A;  4U0Y A;  3KLN A;  4WXH A;  4U7B A;  3EYI A;  2VOD A;  4JP0 A;  3IH3 A;  1Y0U A;  2H1K A;  3FMS A;  1AWC A;  2DA1 A;  3BZ6 A;  2QBY B;  1MMA A;  1S29 A;  2QUF A;  5IY5 H;  1Z91 A;  1I3Q J;  2L7K A;  5IYD J;  3KP4 A;  4U0V A;  2XB5 A;  3GTL J;  1PP7 U;  3PSI A;  4EM2 A;  1MBG A;  1P4A A;  3OYK A;  1B8I B;  2JRM A;  1J0R A;  3HTU A;  2F5D A;  2WBM A;  5IPA A;  5CJ9 A;  4Y52 J;  3WTV C;  2LF8 A;  3H92 A;  3CDI A;  4IVN A;  3S15 J;  2VJJ A;  1EV7 A;  2L7F P;  3HSF A;  1ZRF A;  2L4M A;  2L7Z A;  3BTJ A;  4W97 A;  4Y3O A;  2NS8 A;  1ON2 A;  3CLQ A;  1F36 A;  1OR7 A;  1RR8 C;  1FYL A;  5A2Q K;  3GVA A;  1HQC A;  3K2Z A;  2A07 F;  2M5W A;  4DIQ A;  4GO1 A;  2V1N A;  5E3N A;  4UB8 C;  1D0Y A;  1YLF A;  2M30 A;  1QVU A;  3GEZ A;  2E35 A;  3AAF A;  2LOO A;  2O8X A;  2X1E A;  4M3D A;  4B3A A;  4F93 B;  5K5O A;  1SFU A;  1FTT A;  2VB6 A;  4A6D A;  1D5Y A;  3M7G A;  3HOV J;  1BC7 C;  3FIW A;  4NB5 A;  1YI2 I;  2LDU A;  5ED4 A;  4UVA A;  1TBX A;  3TO6 A;  1MSE C;  3A1Y A;  3CTA A;  4BNC A;  1FWZ A;  4M3F A;  4BL0 B;  5HLI A;  3P9I A;  4RAY A;  1AHD P;  1SEU A;  4G8X A;  2M7A A;  3ZXS A;  2Q2E B;  4RDU A;  2O8K A;  4M74 A;  3RJP A;  1F5T A;  5E8G A;  3BR6 A;  5EEG A;  5E8I A;  2W7N A;  4XM3 A;  3JRA A;  2Z33 A;  2HI3 A;  4QSH A;  3CQZ J;  1RR7 A;  4ZZL A;  2IP2 A;  1HKT A;  4A3M J;  2K27 A;  4L9T A;  3GZ6 A;  1IN7 A;  4HPQ A;  1IGN A;  4UUT A;  2KJC A;  3G73 A;  5E1W A;  2DFF A;  2Y30 A;  3C1D A;  1YJN I;  2K9S A;  4BKX A;  2LY9 A;  5DV5 A;  3RPQ A;  4AC0 A;  2WV0 A;  2E34 A;  3HOX J;  5ICG A;  3PIO F;  2CWE A;  1LFU P;  1I5Z A;  2RN7 A;  2Z3Y A;  1XDS A;  1BW6 A;  2WAQ A;  2XPU A;  3BY6 A;  1U78 A;  4DW6 A;  4MGR A;  2VPL A;  3JTH A;  5GPA A;  1VQP I;  3X2Q H;  4WK8 F;  4EM1 A;  2DA7 A;  2H09 A;  1FOY A;  1FX7 A;  2K85 A;  1ZR4 A;  3JRI A;  3I55 I;  4OOI A;  3KYC B;  4G7O F;  1U9N A;  4DJA A;  3PO2 J;  2MA3 A;  4MLO A;  2W48 A;  1LPQ A;  4GRI A;  3HUG B;  4FTH A;  3ONQ A;  3HDD A;  2JA8 J;  1J5Y A;  1T95 A;  3WE2 A;  5CVV A;  3U2R A;  2EK5 A;  4WCG A;  5D4R A;  1U6G A;  2BEO A;  4A3L J;  4XLF A;  2XAG A;  1ZAR A;  1AOY A;  2PQ8 A;  3M3Y J;  4ENJ A;  3LSP A;  3FF5 A;  4AD9 A;  2ACJ A;  1H9T A;  3ZQQ A;  4UY8 I;  3GX4 X;  3FXK A;  3MFK A;  1P7I A;  1LDK B;  1JTX A;  4RGR A;  1G8X A;  1IN4 A;  1UHM A;  1W5S A;  4HLY A;  4XRM A;  1W0T A;  5B1A H;  1WGX A;  3SQN A;  3S32 A;  2YPR A;  4M3G A;  2ZCW A;  2DI3 A;  2ZFU A;  3A02 A;  5AIQ A;  3AG4 H;  2OBP A;  2Q8K A;  5JR3 A;  3OYL A;  1TW2 A;  3PSF A;  5TRD A;  3Q0U A;  2LFB A;  2KMU A;  2PMZ N;  4JX5 A;  5GAD J;  4MQV A;  1OCR H;  2QSF X;  2VQH A;  1D0Z A;  1UMQ A;  2E19 A;  2QEN A;  3H5N A;  2LP0 A;  1MBF A;  5L3D A;  4B8X A;  5JI6 A;  1WWX A;  3S2H J;  1UHS A;  5JVT A;  3M07 A;  1R5G A;  1ZLJ A;  2Y69 H;  3H36 A;  2YX7 A;  5FRN A;  1U8B A;  2W84 A;  2CW0 F;  3GZN B;  3K70 D;  2HZD A;  4NBQ A;  2OQG A;  3HSE A;  2ZME C;  3FDY A;  2K5C A;  3WGG A;  2M8G X;  1XPX A;  2HTS A;  4QTR A;  3K1M A;  1Z6R A;  1FOK A;  2BXZ A;  2H6B A;  2A6T A;  3LOC A;  4NNJ A;  5K7H A;  3S14 J;  1OCT C;  2H6C A;  2EFO A;  2V26 A;  2BVM A;  3ABL H;  2EFP A;  3TO7 A;  1T33 A;  3BDD A;  3AG2 H;  3C2G A;  1I50 J;  2BW3 B;  2Y75 A;  1SD7 A;  4XSX F;  1WJD A;  4CZC A;  1IC8 A;  1WJF A;  3WTY C;  2H8W A;  4YG2 F;  3KYL A;  2M4G A;  2CV0 A;  2KDZ A;  1KU2 A;  4BBS J;  2PN6 A;  3PO3 J;  1Y6I A;  1IXS B;  4ENN A;  1U5T A;  3I71 A;  4R8H A;  1DUX C;  2LVS A;  2R7R A;  3ISP A;  2LR8 A;  1UZC A;  1YOV B;  3AG1 H;  2E2I J;  3GXO A;  2BV6 A;  2R92 J;  1UCR A;  4PGG A;  3I58 A;  4IQJ A;  2JSP A;  3DFG A;  3F8B A;  3T0Y A;  3RKX A;  3OSG A;  1R4M B;  2CFO A;  5IT9 K;  1SFK A;  2K9Q A;  4XN3 A;  2HKX A;  1YO5 C;  2QGU A;  1ITY A;  2BYV E;  5FLV A;  2M0C A;  3HC7 A;  3MKW B;  1RES A;  2R0Q C;  3H0D A;  2GOX B;  4FX0 A;  3MWM A;  5KHD A;  2WY7 Q;  3PUB A;  4HA8 A;  2WAE A;  2WA0 A;  3RPU D;  4BQN A;  4PSX A;  2DJN A;  2GM4 A;  4RLF A;  3BG5 A;  5C3E J;  2DBB A;  2P5L C;  5FGM A;  3ULQ B;  1Y1V J;  4PJN A;  3ZN0 A;  1U5T C;  2XAH A;  1MMG A;  1ZYR F;  1TQI A;  1IW7 F;  3BTC A;  3MCZ A;  5FKO A;  1LQ1 A;  4DYR A;  5J1U A;  1XSD A;  5LLQ A;  3K1P A;  4KA4 A;  2EB7 A;  5BS6 A;  1PP8 F;  3MD2 A;  2LNB A;  3KP7 A;  4OAZ A;  3BTL A;  5LGN A;  4YFK F;  3L2R A;  3LFU A;  2HEO A;  4KT5 C;  1JT0 A;  4ANJ A;  3H9Q A;  3WTT C;  4CYD A;  3LST A;  3WU2 C;  4EV0 A;  1O4X A;  5BOX A;  2K9L A;  5DYM A;  3CLO A;  1GVD A;  3C2H A;  2X6O A;  2HZT A;  1DPU A;  3Q9S A;  2FBH A;  5D5V B;  1BC8 C;  2DK8 A;  1RUO A;  1R5I D;  1EH6 A;  4JYK A;  4Y33 A;  2CSO A;  1WI3 A;  1X3Z B;  2IW5 A;  4L9V A;  5CPR B;  3G1O A;  2XKO A;  1SAN A;  2TCT A;  1POG A;  5ICF A;  2FSW A;  1F1Z A;  5M5Y J;  3SEQ A;  3BRO A;  3I64 A;  4PJJ A;  1V5E A;  1TZL A;  2MGQ A;  4UUS A;  1G6N A;  2I10 A;  5BPD A;  1H8A C;  3CMM A;  3IC7 A;  1A31 A;  3CO7 C;  5BNG A;  2KZV A;  4N4O B;  3CCJ I;  1BOB A;  2DFH A;  3JCU C;  4XON A;  1DPR A;  1BJZ A;  3T8R A;  2HTJ A;  2EPF A;  1IV6 A;  2MYS A;  4A0Y A;  4HSR A;  2D2W A;  4B43 A;  2AQE A;  3O6B B;  4ZH4 F;  3L9F A;  1Y0N A;  5FLX Z;  4EJT A;  1LFB A;  4A0X A;  1STZ A;  5IP7 J;  3H3U A;  3I9V 2;  2CW8 A;  4EM0 B;  4LB6 B;  3G6E I;  1H89 C;  2ZBK A;  3J81 Z;  1X4O A;  3F72 A;  2PMZ A;  2VIX A;  3WTW C;  1WH7 A;  4AID A;  1V55 H;  4M3E A;  2DLL A;  3E7L A;  1DGR M;  3BTI A;  1FP1 D;  4C30 A;  4KMU X;  5FKM A;  5LGU A;  1ZQ3 P;  4KIF A;  1EF4 A;  1PUF B;  2L9N A;  4XSZ F;  2IA2 A;  2VAS A;  2XKP A;  2A5W A;  5KAF C;  1JJ6 C;  2P81 A;  3QYF A;  3V7S A;  4XK4 A;  3CCL I;  3K69 A;  4W1U A;  4EJU A;  3HSR A;  2VKE A;  5CVU A;  1NG6 A;  2XRL A;  4D7N A;  3I54 A;  3MZY A;  2G0E A;  2HU9 A;  2XAQ A;  4Y7N J;  2JA7 J;  3F21 A;  5LRS A;  1XGO A;  3GW2 A;  3TL4 X;  3HYI A;  4Y4R A;  3GTM J;  1SD4 A;  2Y0S N;  4LGW A;  3D1N I;  2UUZ A;  3BR0 A;  2R7X A;  1HKS A;  1B6A A;  2V7F A;  3LFK A;  2DPD A;  4OIP F;  3HEF A;  1BR1 A;  1ZG3 A;  3HZJ A;  4LG0 B;  4C9Y A;  2Z16 A;  3K1N A;  2G9W A;  3OWT A;  4WXC A;  2E60 A;  3T5X A;  2ZNY A;  4HV5 A;  2DXI A;  1ETO A;  1M1E B;  2CU7 A;  3VB2 A;  3FHN A;  1XMA A;  1FBQ A;  2MH2 A;  4Q47 A;  4UV8 A;  2G7U A;  4RGX A;  1WJE A;  4LIT A;  3J7Z I;  1PUF A;  1I1G A;  4YFX F;  3KP6 A;  2ZO4 A;  4XOT A;  1G3T A;  3S8P A;  5FD6 A;  3E5U A;  1HC8 A;  1JXS A;  1XCV A;  2YSR A;  1MW7 A;  2JA2 A;  2QLZ A;  3DV8 A;  4BAC A;  2NOG A;  1LFP A;  5FKL A;  1A04 A;  1HDD C;  3BQZ A;  3QP5 A;  4QPQ A;  1JKQ C;  3G4S I;  4EGZ A;  3RCO A;  3FXM A;  2FNA A;  4XN0 A;  1RPW A;  2B7E A;  3CUQ C;  2PJR B;  2XF7 A;  5DS9 A;  3GTO J;  1ETQ A;  4LG0 A;  5FD5 A;  2MSY A;  3ZN1 A;  1VQ6 I;  4N0B A;  3KX2 A;  4A2U A;  3OYF A;  4UNO A;  3ZMD A;  1YE9 A;  2DDB A;  4BQA A;  4BAY A;  4U87 A;  4XLC A;  2QF7 A;  4EJV A;  3I4M J;  1ZK8 A;  3BT9 A;  2R7U A;  3CP8 A;  2P5V A;  4A3B J;  4KT6 A;  3V7R A;  1TP4 A;  5JLX A;  3HRT A;  4PJL A;  3T8T A;  2JPB A;  4I0B A;  2V1X A;  3KIO A;  5DM6 F;  1OPC A;  3VDX A;  3JRF A;  3VYS B;  3CDL A;  3TGN A;  2PEX A;  4ENK A;  1GXQ A;  2VL8 A;  3GFI A;  3DBH B;  1XGS A;  2HWV A;  2R5Z B;  2GLO A;  3HOY J;  3TMO A;  1ACI A;  2FUG 2;  5GTH C;  3JR9 A;  4ZYA A;  1LNW A;  1R1T A;  4G6D A;  3CCE I;  3QOE A;  3MN2 A;  4FIS A;  2HYF A;  2BBY A;  3VEP A;  4E70 A;  1HOM A;  2I8D A;  5CQE A;  2IJL A;  1XMK A;  2Z5U A;  3GCM A;  4IHX A;  1JUM A;  3A2K A;  3RKQ A;  1X1C A;  2PJR A;  5E20 A;  1VQ8 I;  1P7J A;  1OKR A;  1YS7 A;  3ZCO A;  4AUX A;  3OIO A;  1RUN A;  1T38 A;  3RDI A;  2XSJ C;  1XS9 A;  4MO7 A;  4OMY A;  2YUS A;  3J7Y J;  4QPO A;  3W6J B;  3IUO A;  4DZP A;  4J01 A;  2LKS A;  5FFZ A;  1QHH D;  5LGT A;  5J6X A;  1D1C A;  4OIN F;  4J19 A;  3P9C A;  3TP3 A;  3WE3 A;  2IAI A;  1WFX A;  5IP9 J;  4F55 A;  4A3D J;  3FKI J;  1VQ5 I;  2DYR H;  2QQB A;  4R1H A;  4L5I A;  2I5U A;  3OOU A;  1D8J A;  1K79 A;  3JRE A;  3OYH A;  3EDP A;  4E7I A;  2LC2 A;  3ZQG A;  1A6I A;  5L3E A;  4AU7 A;  4PDK A;  3BG7 A;  4E7K A;  4BJ5 C;  3FMQ A;  4J00 A;  1G3S A;  4V2F A;  3JSO A;  4I02 A;  5H6R A;  1V5G A;  1ETK A;  2VPR A;  2WV1 A;  3D5L A;  3M8E A;  4CYC B;  3F22 A;  4DGW B;  2FE3 A;  1YX5 A;  1J2X A;  4PJ0 C;  3S3M A;  3ZP5 A;  2DO7 A;  2IS1 A;  2YX4 A;  2HDD A;  3BJA A;  4RGU A;  5FO5 A;  1NHA A;  1Z0X A;  2CUF A;  3C18 A;  3OYG A;  2M45 A;  3E0J B;  1RKW A;  1N75 A;  1QHG A;  1SMT A;  3HOW J;  3CCV I;  1YHQ I;  1JTY A;  2Y0S A;  5ILU A;  4S0H B;  2ESN A;  2QEX I;  3R0J A;  3NWS A;  2ELH A;  4ZTF A;  5D6E A;  1Y8R B;  4IL6 C;  3MVP A;  3AFH A;  3SDB A;  1VQ7 I;  3VYT B;  3CO6 C;  2J5P A;  3SYT A;  1J7K A;  2BY0 A;  1JHH A;  5GAE J;  3OV8 A;  3FM5 A;  5TJJ A;  5IOZ A;  2O6G E;  1BI2 A;  3ROU A;  3WGH A;  4BHP A;  3IH4 A;  1MSF C;  4KNY A;  3FXJ A;  3Q0V A;  2RAE A;  1KQ0 A;  4CCM A;  4ZJZ A;  1TT0 A;  1Z05 A;  4ZYD A;  4IEJ A;  2CQK A;  3CJT B;  1ERD A;  4IHW A;  1NK3 P;  1ZRD A;  3FZV A;  5LHG A;  4CCL A;  3HXL A;  5BMZ A;  2VJI A;  4N9H A;  2W1O A;  2WWY A;  2MD0 A;  3BG6 A;  1MNM C;  1I27 A;  1FP2 A;  1K6Y A;  2KIS A;  3SDG A;  1H88 C;  2XGD A;  1QNT A;  4KIC A;  4G9Y A;  1RET A;  1IN6 A;  2VC0 A;  3M1E A;  3F0C A;  3PFY A;  2VBW A;  1O3Q A;  3KP5 A;  5L3C A;  2HFH A;  3OR2 C;  4KN7 X;  5KAI C;  2WB1 N;  4BXF A;  4MEY F;  1QA6 A;  4AVP A;  1XCB A;  2LYC A;  1FIA A;  1B72 B;  1S5L C;  1XMX A;  4CUG A;  5H20 A;  4L0Y B;  4GFB A;  3GTK J;  5BPI A;  4XR6 A;  1F9N A;  1SD5 A;  2VT2 A;  4M73 A;  2YU3 A;  4ZDO A;  2GQQ A;  2NOJ B;  2GIZ A;  4IJA A;  4JK1 X;  3FIS A;  2GA1 A;  3NQO A;  3LSH A;  4EEF G;  2FD5 A;  3QRF F;  2MBF A;  4PCQ A;  4CCJ A;  2IPQ X;  1Z6T A;  3S2D J;  4RAZ A;  3DP7 A;  2P7C B;  5CKT A;  4XKW A;  4ASN A;  5FRO A;  1QO0 D;  1ZRE A;  3L7W A;  4XKC A;  4OWR B;  4M72 A;  4D1Q A;  2GWR A;  1XGN A;  5LFA A;  2FOW A;  2DQR A;  1X3U A;  3NAR A;  2JA5 J;  2NVT J;  1R49 A;  2Y9Z A;  1L0O C;  2DA6 A;  1WKM A;  1W5T A;  1T39 A;  1J75 A;  3HHH A;  4XOP A;  3NAU A;  2FML A;  2ISY A;  2M2E A;  2OD5 A;  2V4J C;  4YEJ A;  1MMS A;  2ECC A;  4HF0 A;  2BVL A;  2MAB A;  3Q5F A;  1A6Q A;  4XID A;  1VND A;  3B02 A;  4AIH A;  3AKZ A;  4B1R A;  3K4B A;  4A93 J;  3OS0 A;  1B72 A;  1HF0 A;  2AHQ A;  2HOA A;  3I56 I;  2OTL I;  1Z21 A;  3QOP A;  2RKH A;  2LRE A;  3IKT A;  2R3S A;  4PFP A;  1KU7 A;  2VBY A;  2A68 F;  2KRF A;  2F48 A;  1XX5 A;  3L1P A;  4E4H A;  3E6C C;  4M71 A;  4Z6Y A;  3S93 A;  3CF2 A;  1WJC A;  2O03 A;  3QU6 A;  5CVJ A;  5DUI A;  2R5Y A;  5E1X A;  1OQY A;  2DT5 A;  3OYC A;  2XAS A;  1R5H A;  1QPM A;  2K40 A;  1HW5 A;  4O5V A;  3NWT A;  9ANT A;  1VQ4 I;  1MKM A;  4L0Z B;  3CZ6 A;  4I0A A;  1SVM A;  5HLG A;  2FMY A;  3KCC A;  1J09 A;  1IZ1 A;  2GXB A;  2BOL A;  2R7O A;  4ZYH A;  3TOA A;  2HOE A;  3DEE A;  2CUJ A;  2XVC A;  5GTI C;  1X19 A;  2EH3 A;  2R93 J;  1YIT I;  3BR5 A;  4B44 A;  3LA7 A;  3PNV A;  2W82 A;  5HDG A;  1IF1 A;  2ZME B;  2RC4 A;  2L4A A;  1USS A;  1SFX A;  2JQ7 A;  2FQ3 A;  1R1U A;  3H9G A;  3ERE D;  4A3G J;  3WG9 A;  5M5W J;  1F43 A;  1MD0 A;  2QSH X;  4HOB A;  2IRF G;  1V5F A;  1VTN C;  1YJW I;  4YIR X;  3LAP A;  2O5R A;  2Z2S B;  3C7J A;  3JRD A;  5J4Y A;  2VOO A;  3U9G A;  3JAM K;  1VFC A;  4F92 B;  2K3F A;  3MMY B;  1P6R A;  2CQ7 A;  1Z67 A;  1R71 A;  1DP7 P;  2Z1D A;  3ZQI A;  3K4J A;  5EEA A;  2IXS A;  2E1O A;  1N77 A;  3RKY A;  5HLH A;  5HS8 A;  2ZNZ A;  2ZJR F;  4XLP F;  2QQA A;  4U88 A;  1LEB A;  5DTD A;  4BUP A;  1QQI A;  5EDN A;  2K4B A;  3TO9 A;  5E3L A;  5D5X B;  1Z3X A;  3PFI A;  2M87 A;  2XPV A;  3ECO A;  3G1M A;  1Z7U A;  1W0U A;  4DYQ A;  4FHT A;  1V54 H;  2CUE A;  4HNU A;  2ZME A;  2XGC A;  1JGG A;  5HDN A;  2WB1 A;  3BQY A;  2A3S A;  1S8N A;  5F0H A;  1ENH A;  2MD5 A;  3E3V A;  2EFW A;  3ZQL A;  1X58 A;  4HEA 2;  1OIS A;  4QLC U;  3I3L A;  3M4O J;  3E6D A;  2RDP A;  2YU9 J;  4KIG A;  2VON A;  1IUF A;  2D45 A;  4ZZD A;  2PX9 A;  4F91 B;  4HF1 A;  3S17 J;  2XPW A;  4NQW A;  1U5T B;  1Z3Y A;  4CZZ A;  2LKP A;  4E7Z A;  3OSF A;  2VBX A;  2ECB A;  4IRH A;  2ZC2 A;  5ILS A;  1I3A A;  2CQQ A;  4PFO A;  3S3O A;  1SFO J;  3GBG A;  4ZDP A;  3EYY A;  4JX6 A;  2DU9 A;  3W2V A;  2E1N A;  1K4S A;  4V19 K;  3VYR B;  1GHC A;  2KIM A;  3DEU A;  2MW8 A;  2CQX A;  5HS9 A;  2PG4 A;  3HL2 A;  4KDP A;  4FT8 A;  3HOZ J;  1RKT A;  3KP3 A;  4GYI A;  1NH3 A;  1D1A A;  4MNU A;  3U21 A;  1ZLK A;  3H3V K;  1REP C;  2IS6 A;  1OCZ H;  3K4L A;  4BGD A;  5J1Y A;  4AYB N;  3COA C;  5CVR A;  3VSK A;  3ZQ7 A;  4B47 A;  3K4K A;  3FK7 A;  4H0E A;  3IRQ A;  2XRN A;  4CO8 A;  3OYJ A;  5ICC A;  2H1L A;  1CF7 A;  1QPI A;  2VUM J;  1QRY A;  2IGO A;  4EJW A;  4BY1 J;  4MFD A;  3MKZ A;  4CCK A;  3K6G A;  3HBL A;  2QM3 A;  4UVC A;  1JKO C;  2IVM A;  1P4W A;  3EET A;  4HST A;  3MKY B;  4UB6 C;  3RSN A;  1AU7 A;  4IZZ A;  2O9L A;  4FE7 A;  4CCO A;  3HOT A;  3IWZ A;  1OCP A;  3L2W A;  1LJ9 A;  4JQF A;  1MJB A;  1TWC J;  2MLG A;  1Y56 A;  4NDL A;  2XV4 S;  3GFL A;  3SZT A;  4IKF A;  1ZTR A;  3MAJ A;  3HTS B;  2KIF A;  4PK4 A;  2LBF B;  3FKJ A;  2ELJ A;  3H9J A;  4A3K J;  2JZY A;  3G2B A;  4DYC A;  4LB5 A;  3HIF A;  4E6K G;  2GXA A;  1ZGJ A;  1LUJ B;  2XAJ A;  4G7H F;  1FEX A;  2YS9 A;  1WH5 A;  1HCR A;  1XC5 A;  2O7O A;  3J80 K;  4RLQ A;  2NVQ J;  2OPT A;  1SVO A;  1VQO I;  3HRU A;  2A6H F;  1X1D A;  1JT6 A;  1R58 A;  3ZMT A;  3FM3 A;  3ZQF A;  3ZPL A;  2KJB A;  1ZG1 A;  4UUS B;  4D7M A;  2A6E F;  2DA4 A;  2F2E A;  2K86 A;  1QBJ A;  3AL0 C;  3DKX A;  1QU3 A;  3QPT A;  2OAZ A;  2E2J J;  3S3N A;  4UHT A;  2E2H J;  4BDZ A;  4AM3 A;  1TL8 A;  1OCC H;  1UJ8 A;  4Y17 A;  4QIW N;  2VQC A;  2ZXH A;  4C2T A;  4U0W A;  4ESJ A;  2NS0 A;  1ETY A;  5TGT A;  1GVJ A;  2HVR A;  3FXO A;  2CMP A;  3IL2 A;  2Y0M A;  1ZHF A;  2LBF A;  4CGZ A;  4ABZ A;  3ABU A;  5TIS C;  2HPM A;  5EGO B;  2D1V A;  1LEA A;  3K7A J;  4RM2 A;  5HS7 A;  2DA3 A;  1OYY A;  1OFC X;  2FBK A;  5A2Q Z;  2OQR A;  3RIR A;  2X6X A;  3D5R C;  3W3C A;  2V9K A;  2W24 A;  3BR2 A;  1ZGA A;  1S6L A;  3FBN B;  2E36 A;  5IP6 A;  2KFD A;  2XF6 A;  3B6A A;  2KLO A;  1EA3 A;  2A69 F;  1XN7 A;  1X1B A;  3P5J A;  1HST A;  3MKL A;  3TQN A;  4IX7 A;  3S1Q J;  2X9D A;  1ORK A;  4BDY A;  1UAA A;  1S7O A;  2GIV A;  2GOM A;  2ZXW H;  2EV5 A;  3K10 A;  3LSG A;  2VJ4 A;  4RM3 A;  1K61 A;  2NAZ A;  2XSD C;  1C0W A;  3JTG A;  3E5X A;  3CF5 F;  2ZJP F;  4AIJ A;  2F4O B;  2QKL B;  3BG3 A;  2MC4 A;  4KMF A;  2ZXI A;  3W2A A;  3P7N A;  3S16 J;  3CUQ B;  1IRF A;  1I39 A;  2DQL A;  4BQQ A;  1KGS A;  1HW1 A;  2IA0 A;  2CV1 A;  2PFB A;  3KE2 A;  3OS2 A;  1UG2 A;  1BOA A;  4TV7 A;  3FX3 A;  1UEL B;  1D0X A;  2BY3 A;  4DBQ A;  1P9Q C;  4XLN F;  1BR4 A;  5EGO A;  2BE5 F;  3VSL A;  4CCN A;  4B3X A;  1R00 A;  2DFI A;  2CFX A;  4HX4 A;  2FEZ A;  4Z2Y A;  2MH9 A;  2FOK A;  3DPL C;  4XKB A;  1K78 B;  4BE1 A;  1G59 A;  5M3F J;  4LK1 F;  3PL8 A;  1X2M A;  4PZJ A;  1MJ9 A;  1BW5 A;  2ZJ2 A;  1TQP A;  2V9V A;  2RNG A;  1NK2 P;  4MTD A;  3D0S A;  3U1D A;  3OYI A;  1V4R A;  3HGG A;  4EJO A;  4L5E A;  3WTS C;  2KKO A;  2COM A;  3DCF A;  1X4P A;  4AYB A;  2LF7 A;  5DM7 F;  4KIS A;  1ODD A;  4ZYG A;  1VQL I;  3BR1 A;  2WY8 Q;  3HPG A;  2EZL A;  3F8F A;  4I2O A;  1GV5 A;  3EUH C;  4D0P A;  3G3Z A;  4ON0 A;  2IGM A;  4Q5S F;  5C4X J;  2F5F A;  1I6X A;  3LSJ A;  5EG0 A;  4A3E J;  2HNH A;  1JUP A;  1MBJ A;  3CUQ A;  4A3F J;  1JUS A;  2EIL H;  5KVR A;  2KIU A;  4PGH A;  1RRJ A;  3IHU A;  2PLY A;  4LJZ F;  3VWB A;  3OMY A;  1S9H A;  2Q0O A;  3CJN A;  3L2V A;  2OZU A;  1JI8 A;  1JKP C;  2NVY J;  2VT3 A;  3K4N A;  4RB0 A;  4Q4Z F;  3SJM A;  1ETW A;  2HYJ A;  2DW4 A;  2GA2 A;  4D5C A;  2KHM A;  3CMY A;  2IA1 A;  4IO9 F;  1K78 A;  2EA4 A;  4IHS A;  3HB9 A;  5LHI A;  1TNT A;  3A01 B;  2W85 A;  4LMY A;  2VC1 A;  2AXT C;  2LH9 A;  5FLM J;  1N25 A;  1FOW A;  5IT3 A;  2CYY A;  1Y1W J;  2R4G A;  2EV0 A;  1OCO H;  4S05 A;  1LVK A;  4CIC A;  5K7Z A;  2Z99 A;  1HW2 A;  3REO A;  1WRJ A;  3H0G J;  5GAG J;  4DOZ A;  1U9O A;  3LA3 A;  3I4P A;  3M8J A;  4HW0 A;  3DLL F;  2ZKZ A;  1G3Y A;  3SXY A;  3ASO H;  3DKW A;  3E6B A;  3CC2 I;  3CUO A;  2KP6 A;  4M6Y A;  2XRO A;  3BWG A;  2HOT A;  4XOR A;  2STW A;  5M5X J;  3B6C A;  4A3I J;  2K7L A;  2VJ5 A;  2RQP A;  1XDU A;  5JLW A;  2OZ6 A;  5K7F A;  1EH8 A;  1SMY F;  3QQA A;  1VF9 A;  3GO5 A;  4LOC A;  2KQR A;  3O8H A;  3A01 A;  1IRX A;  3GTJ J;  1XB4 A;  5DCM A;  3S1R J;  3RI4 A;  2GXG A;  4ETS A;  3HKZ N;  3DU5 A;  2LKX A;  1XG1 A;  2JSC A;  1XTA A;  3FXU A;  2MLK A;  4I09 A;  1TQM A;  5KK1 A;  4M9Z A;  2QKM B;  3EQL F;  5HOO A;  4WWC A;  2L5Q A;  4PJM A;  1T0F A;  2EFN A;  2ZXJ A;  4I6Z A;  2FJ1 A;  5IT9 Z;  5E18 F;  4KN4 X;  1W4M A;  1A35 A;  4RS8 A;  3GYH X;  1OMI A;  4HLX A;  2E1C A;  2K3P A;  1W7P A;  5J47 A;  2RV8 A;  1AA7 A;  3ZMU A;  2DOF A;  1G2H A;  2Z9O A;  2JA6 J;  2YR2 A;  4C2M J;  1MBH A;  3I53 A;  4A12 A;  2AXL A;  3TDU C;  5LRR A;  5ICE A;  4XIC A;  1E3O C;  4O3M A;  3LMM A;  2OC6 A;  1SVL A;  3OYB A;  2N8G A;  3CC4 I;  2E5N A;  3ERM A;  2KRH A;  2ISZ A;  5F6F A;  3F6V A;  4BE0 A;  3L2C A;  3DU6 A;  4NC6 A;  2ID6 A;  1E3H A;  3HM5 A;  4LIU A;  3OL4 A;  4L18 B;  2M8E A;  5LBQ A;  4HRI A;  2QVO A;  2O61 A;  4EVI A;  4GYG A;  1QZE A;  2P0W A;  5J4V A;  3SEZ A;  1UG0 A;  3IV5 A;  4XL9 A;  2K4J A;  5FB2 A;  1T0F C;  2JT1 A;  3BCA A;  2CG4 A;  2M34 A;  3TP0 A;  4BU2 A;  1KQ9 A;  2HVS A;  1U3E M;  2K9N A;  3ASN H;  3F8C A;  3KPH A;  2CW7 A;  2D1H A;  2ICW G;  1YW7 A;  4M6V A;  4YII A;  1WCM J;  2L02 A;  5GPC A;  2DA5 A;  2UXX A;  5EJC A;  2QQ8 A;  5FFX A;  5HVQ C;  1LE8 A;  3ECH A;  2X0L A;  1PUE E;  3KZY A;  1JE8 A;  3QP6 A;  1ONV A;  3IRR A;  5HNF A;  2RQQ A;  4RGS A;  1ZEL A;  3LNQ A;  3UNG C;  5F1R A;  3ZR8 X;  1YJ9 I;  2OV7 A;  1MJA A;  2FQ4 A;  2L9V A;  4B4C A;  5EZH A;  3WOD F;  2EZI A;  1DDN A;  2E1M C;  1X3W B;  1MIJ A;  3NRV A;  4QWQ A;  1IG7 A;  2BY1 A;  3KP2 A;  4A0Z A;  2ETH A;  2JWT A;  2HXO A;  3LSM A;  2V6E A;  2V6C A;  4MEX F;  1FC3 A;  2HQN A;  4LG3 A;  1EJ9 A;  1RI7 A;  3OIP A;  3V7C A;  4IOA F;  1FOX A;  3GZ5 A;  2O0Y A;  5CLS A;  1LB2 A;  2DOA A;  2V9P A;  4JOM A;  3UR3 C;  1H9G A;  4LK0 F;  3F6O A;  1IN8 A;  3WHC A;  1XSX A;  3S1N J;  3TW7 A;  2L9S A;  2DAO A;  2R7W A;  2IS4 A;  2M9H A;  3K0L A;  2VI6 A;  1ZN2 A;  3SHF A;  5HNH A;  1CQT A;  2NNY A;  3C2B A;  2V1U A;  2NXN B;  1Z77 A;  2ME0 A;  2HYG D;  1BBY A;  2B63 J;  5KCM A;  3OYM A;  3W6V A;  3DTE A;  4A5N A;  1G4D A;  3BJ6 A;  2F5V A;  4N9I A;  5FKN A;  1MH4 A;  1S3J A;  2ME6 A;  2JK3 A;  5LD2 C;  1IO2 A;  2JUG A;  2KZG A;  4FET A;  4RBO A;  4XMY A;  1HBX G;  5J3L A;  1R7J A;  1R4N B;  2R5Y B;  4JX4 A;  1GT0 C;  5BQT A;  1SAU A;  2W00 A;  3CCQ I;  4HDU A;  2XAF A;  3IH2 A;  4YIF A;  3CME I;  2A61 A;  4LLG F;  2UWM A;  1MNE A;  2R7Z J;  3R60 A;  4HG2 A;  4G7Z F;  1O3S A;  2NNN A;  3JRB A;  4FAS D;  3S2W A;  2PI0 A;  3HKZ A;  1VQN I;  2LTP A;  1MMD A;  4ESB A;  4UUV A;  1ETV A;  1FBS A;  3LSR A;  3K4C A;  2EA2 A;  1SD6 A;  2VOP A;  1MBK A;  1U0J A;  2JVG A;  1OYW A;  2G7H A;  2BGC A;  4PUS A;  2W57 A;  4R79 A; 
#chains in the Genus database with same CATH homology
 2L0K A;  2MW8 A;  2CQX A;  1JJ8 C;  1LFB A;  2XB0 X;  5IP7 J;  3HOZ J;  1RKT A;  2JJ7 A;  4A69 C;  1IRZ A;  2DTZ A;  2Y9Y A;  1H89 C;  3H3V K;  3RZD J;  1WH7 A;  2JMW A;  4M3E A;  4MFE A;  1MBE A;  1MH3 A;  5J1Y A;  1R9T J;  3E7L A;  4AYB N;  3BTI A;  1ZQ3 P;  5FKM A;  4C3H J;  4BBR J;  4XRS A;  3I4N J;  3FK7 A;  1EF4 A;  1PUF B;  3JRH A;  1QPI A;  2VUM J;  3HOU J;  2HQ5 A;  1QRY A;  4BY1 J;  1JJ6 C;  4MFD A;  5E3O A;  2P81 A;  4XK4 A;  3HBL A;  4W1U A;  1JKO C;  4BY7 J;  2VKE A;  1AU7 A;  1AKH B;  2DMT A;  2O9L A;  4D7N A;  2XRL A;  2CJJ A;  4FE7 A;  4A3C J;  2G0E A;  1K83 J;  4Y7N J;  2JA7 J;  3BR3 A;  1OCP A;  2Y31 A;  1TWG J;  1S7E A;  3SFI A;  5IOY A;  3GTM J;  2R5Z A;  1TWC J;  2Y0S N;  3D1N I;  2XGE A;  3ZQH A;  4NDL A;  4C3J J;  3BR0 A;  5F1J A;  1ZTR A;  2EZH A;  3HEF A;  5F27 A;  2HOS A;  1T56 A;  2EQR A;  2TRT A;  3GTQ J;  3CCY A;  4A3K J;  4DYC A;  4IHY A;  2DMQ A;  1ETO A;  2CU7 A;  1FEX A;  2YS9 A;  1WH5 A;  1DU0 A;  1HCR A;  1XC5 A;  2O7O A;  2NVQ J;  2OPT A;  1JKR C;  1PUF A;  1B8I A;  2LLK A;  1JT6 A;  2DMN A;  2NS7 A;  2KT0 A;  1TWA J;  3ZQF A;  3A03 A;  2WAQ N;  4UUS B;  4D7M A;  1GDT A;  2DA4 A;  3G1L A;  2NVX J;  1HLV A;  1ZR2 A;  1AKH A;  2E2J J;  1ETX A;  2NOG A;  3K2A A;  5FKL A;  2E2H J;  1HDD C;  1X2N A;  3BQZ A;  1JKQ C;  4QIW N;  4DZJ A;  5EYR A;  1APL C;  2AO9 A;  1ETY A;  1RPW A;  4IHV A;  4CYC A;  2DA2 A;  5DS9 A;  3GTO J;  5J1R A;  1ETQ A;  2L9R A;  4ABZ A;  2H8R A;  2MSY A;  3PM1 A;  4A3J J;  5EGO B;  3JRG A;  1HDP A;  3K7A J;  2DA3 A;  1OFC X;  2QF7 A;  1BA5 A;  3I4M J;  4X6A J;  3Q3S A;  3BR2 A;  1ZK8 A;  5IP6 A;  3BT9 A;  1BL0 A;  3B6A A;  4A3B J;  5JLX A;  3MKL A;  3QPS A;  3DEW A;  3S1Q J;  3FK6 A;  2X9D A;  5EZG A;  1ORK A;  5GP9 A;  1A5J A;  3JRF A;  3UKG A;  3CDL A;  1YRN B;  5F08 A;  2R5Z B;  1GV2 A;  3LSG A;  1K61 A;  2GLO A;  3HOY J;  2XSD C;  1FJL A;  3JR9 A;  3S1M J;  1Q1V A;  3MN2 A;  4FIS A;  4FCY A;  3BG3 A;  1HOM A;  3S16 J;  2D5V A;  4IHX A;  1JUM A;  3HGY A;  3RKQ A;  3GTP J;  4JP0 A;  3IH3 A;  2H1K A;  1P7J A;  4AUX A;  1UG2 A;  3OIO A;  1XS9 A;  2DA1 A;  4MO7 A;  1VI0 A;  2YUS A;  5EGO A;  1I3Q J;  5IYD J;  2Y2Z A;  4DZP A;  3GTL J;  2XB5 A;  1MBG A;  1B8I B;  5M3F J;  4J19 A;  3TP3 A;  2IAI A;  5IP9 J;  1X2M A;  4A3D J;  3FKI J;  1BW5 A;  5IPA A;  4Y52 J;  1NK2 P;  3OOU A;  3S15 J;  3HGG A;  2L7F P;  3JRE A;  4L5E A;  2X48 A;  4V2G A;  3DCF A;  2L7Z A;  3BTJ A;  4W97 A;  3ZQG A;  1A6I A;  2NS8 A;  1F36 A;  1TC3 C;  1YRN A;  1QVT A;  3BR1 A;  1TWH J;  2ELK A;  2ID3 A;  2EZL A;  4V2F A;  1GV5 A;  5C4X J;  5E3N A;  1ETK A;  2VPR A;  2WV1 A;  3LSJ A;  4CYC B;  5EG0 A;  4A3E J;  1JUP A;  1QVU A;  1MBJ A;  5HOD A;  4A3F J;  1JUS A;  4M3D A;  4B3A A;  1FTT A;  2HDD A;  1D5Y A;  2ZB9 A;  3HOV J;  1Z0X A;  2CUF A;  3FIW A;  1JKP C;  1RKW A;  3HOW J;  2NVY J;  1JTY A;  2EZK A;  4S0H B;  1MSE C;  1IDZ A;  3SJM A;  1ETW A;  4M3F A;  2HYJ A;  2DN0 A;  3MVP A;  4D5C A;  1AHD P;  3CMY A;  4MIM A;  4RDU A;  2O8K A;  3HB9 A;  3A01 B;  2IEK A;  5IYB J;  3BR6 A;  5IOZ A;  5FLM J;  1MSF C;  3IH4 A;  3JRA A;  2HI3 A;  4QSH A;  3Q0V A;  3CQZ J;  1RR7 A;  2RAE A;  3RQI A;  1Y1W J;  1ZKG A;  5EF6 A;  4A3M J;  4IEJ A;  5C4J J;  1IGN A;  4UUT A;  5K7Z A;  1NK3 P;  4IHW A;  3H0G J;  2Y30 A;  2K9S A;  4BKX A;  2LY9 A;  1U9O A;  4AC0 A;  3HOX J;  1LFU P;  2DMP A;  1MNM C;  2XPU A;  1BW6 A;  3SDG A;  1U78 A;  1H88 C;  4DW6 A;  2XGD A;  5GPA A;  3RZO J;  1RET A;  3F0C A;  2HOT A;  2DA7 A;  2WB1 N;  5M5X J;  2COB A;  3B6C A;  4A3I J;  1ZR4 A;  3JRI A;  1FIA A;  1B72 B;  4BXX J;  4GFB A;  5JLW A;  3GTK J;  1U9N A;  5K7F A;  3PO2 J;  4MLO A;  2W48 A;  4XRS G;  3QQA A;  1VF9 A;  4FTH A;  4LOC A;  3HDD A;  2JA8 J;  1DU6 A;  3FIS A;  3O8H A;  3A01 A;  4A3L J;  3GTJ J;  2VKV A;  3S1R J;  3ZQC A;  4EEF G;  2FD5 A;  3HKZ N;  3M3Y J;  3LSP A;  3S2D J;  2LKX A;  2LD5 A;  1XG1 A;  1P7I A;  3TW6 A;  1JTX A;  5EG0 B;  3NAR A;  2JA5 J;  2FX0 A;  2NVT J;  4I6Z A;  5M3M J;  4XRM A;  2FJ1 A;  2Y9Z A;  2DA6 A;  1W0T A;  1WGX A;  4M3G A;  3A02 A;  3NAU A;  2HXI A;  2M2E A;  4FE4 A;  2QCO A;  2ECC A;  3Q0U A;  2LFB A;  2PMZ N;  4JX5 A;  4XID A;  1VND A;  1UMQ A;  2E19 A;  1G2H A;  2LP0 A;  1MBF A;  2JA6 J;  3S2H J;  4C2M J;  1MBH A;  1UHS A;  4B1R A;  4A93 J;  1B72 A;  1HF0 A;  2AHQ A;  2HOA A;  4C3I J;  5IYC J;  4XIC A;  1U8B A;  1I6H J;  1E3O C;  4HNV A;  2N8G A;  5FKK A;  2M8G X;  3L1P A;  4QTR A;  2ID6 A;  3HM5 A;  1NTC A;  3LOC A;  3S14 J;  4D5F A;  5K7H A;  1OCT C;  2R5Y A;  2LK2 A;  3IV5 A;  1OJL A;  1T33 A;  5F0F A;  1I50 J;  2M34 A;  2K40 A;  3TP0 A;  1IC8 A;  3Q0W A;  5F04 A;  2KDZ A;  2K9N A;  4BBS J;  9ANT A;  3PO3 J;  4M6V A;  5GPC A;  1WCM J;  2GBY A;  2LVS A;  2DA5 A;  2LR8 A;  2E2I J;  2R92 J;  2L7M P;  3JRC A;  1LE8 A;  3QPL A;  2EH3 A;  2R93 J;  3BR5 A;  3OSG A;  5E3M A;  2K9Q A;  3LNQ A;  2FQ4 A;  4B4C A;  1ITY A;  5EZH A;  5FLV A;  2EZI A;  2M0C A;  3GTG J;  4A3G J;  1RES A;  2R0Q C;  3WHB A;  1IG7 A;  5M5W J;  1F43 A;  2JWT A;  2HXO A;  1IDY A;  1WPK A;  2EBI A;  3JRD A;  2DMU A;  2GM4 A;  2DJN A;  1VFC A;  3BG5 A;  5C3E J;  5C44 J;  3WHC A;  1Y1V J;  3S1N J;  1ZGW A;  3TW7 A;  3ZQI A;  3VPR A;  5EEA A;  2E1O A;  1GUU A;  2M9H A;  2VI6 A;  3BTC A;  1CQT A;  5FKO A;  3C2B A;  4DYR A;  5J1U A;  1Z77 A;  2ME0 A;  2B63 J;  1FTZ A;  5DTD A;  2IBD A;  2OF7 A;  5FJ8 J;  5EDN A;  5E3L A;  3BTL A;  3W6V A;  1IJW C;  2XPV A;  3G1M A;  1W0U A;  4DYQ A;  1JT0 A;  2CUE A;  5FKN A;  1MH4 A;  2ME6 A;  2JK3 A;  2XGC A;  1JGG A;  1O4X A;  3BQY A;  5F0C A;  5F0H A;  4RBO A;  4G12 A;  1ENH A;  1GVD A;  1TWF J;  2X6O A;  5J3L A;  3O8G A;  2R5Y B;  4JX4 A;  2CRG A;  3ZOB A;  1X58 A;  4X1E A;  3TED A;  3ZQL A;  1GT0 C;  3M4O J;  3IH2 A;  4JYK A;  3BG9 A;  1WI3 A;  2YU9 J;  3G1O A;  1SAN A;  1IUF A;  2R7Z J;  2TCT A;  1POG A;  5M5Y J;  3JRB A;  3S17 J;  2XPW A;  2LTP A;  2MGQ A;  4UUS A;  1ETV A;  2I10 A;  3LSR A;  3OSF A;  1H8A C;  2JN6 A;  2ECB A;  5BNG A;  2MG4 A;  1LE8 B;  2CQQ A;  1MBK A;  1SFO J;  1BJZ A;  4M3B A;  1IV6 A;  3GBG A;  1FIP A;  4I76 A;  4JX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...