1HOMA

Determination of the three-dimensional structure of the antennapedia homeodomain from drosophila in solution by 1h nuclear magnetic resonance spectroscopy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
68
structure length
68
Chain Sequence
MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ANTENNAPEDIA PROTEIN
publication title Determination of the three-dimensional structure of the Antennapedia homeodomain from Drosophila in solution by 1H nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 21
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1homA00
1HOMA 4A69C 3S2HJ 4G12A 3HOYJ 1WCMJ 2GLOA 2WAQN 1P7IA 2H1KA 5IOZA 4FTHA 1GVDA 5F0HA 3JRBA 1F36A 5EGOB 3S1NJ 3RKQA 2HOTA 1MBJA 1OFCX 1FTTA 2GM4A 2DMUA 1X2MA 5C44J 1I6HJ 3LOCA 3GTQJ 1LE8A 3TW6A 2N8GA 1AHDP 1ZGWA 2DTZA 1ZTRA 1WH5A 5M3MJ 3SJMA 5K7ZA 1MBGA 1U9NA 5F0FA 1BW6A 3BQZA 3BR5A 3FIWA 2K9QA 1T33A 2PMZN 1XS9A 3GTKJ 4FCYA 5FJ8J 3HEFA 1TWAJ 1JUMA 1YRNB 4XIDA 2P81A 3HBLA 1H8AC 3M3YJ 3FK7A 3Q3SA 4BXXJ 4DYQA 1IGNA 1PUFA 1GUUA 3BR0A 1VFCA 4MO7A 4W97A 1JGGA 2HI3A 4MIMA 1Q1VA 2ME6A 3JRHA 1A5JA 1WPKA 4BBSJ 2DA6A 1ENHA 3NAUA 1B8IA 3O8GA 3SFIA 1QRYA 1QVUA 5GPCA 3QPLA 2XB0X 4M3GA 1WH7A 1JUSA 1LFUP 3QQAA 2Y2ZA 5EG0A 2RAEA 5FKNA 3JRFA 1MBEA 2ME0A 4S0HB 2JJ7A 1I3QJ 3BTJA 4DZJA 2MSYA 4QIWN 1S7EA 2DMTA 5IP6A 2NVQJ 1RKWA 5GP9A 2L7MP 3VPRA 5J3LA 3S1QJ 3MN2A 3ZQIA 2OPTA 1X58A 2JA5J 5EZHA 5J1RA 5EF6A 1ETWA 2EQRA 1VF9A 2YU9J 2CUFA 3JRAA 1JKQC 4BY7J 1MSEC 2R5YA 2ELKA 2DA2A 2IBDA 4A3GJ 4A3LJ 5IP9J 2IAIA 4M3EA 2JWTA 4CYCA 2E1OA 2Y9YA 4M3FA 4IHVA 5FKOA 3IH4A 4AUXA 1IG7A 4UUSA 1K83J 3LSJA 1UHSA 1JKOC 2Y30A 1EF4A 3MKLA 3TP0A 3OSGA 4BBRJ 4X1EA 2K40A 4A3EJ 5F1JA 4DYRA 1NK3P 1ETYA 4A3IJ 3C2BA 4M3DA 1RETA 3S14J 3W6VA 1OCTC 3OIOA 2DA4A 4QSHA 1T56A 5EYRA 3TEDA 2TCTA 3GBGA 3K2AA 4D7NA 3JRIA 1MNMC 4JX4A 2CUEA 2CRGA 1RESA 3JRGA 2EZLA 4Y7NJ 5E3LA 1JTXA 1R9TJ 5EGOA 3S2DJ 2XRLA 5F08A 3HOXJ 2LKXA 3JRCA 1FIPA 2DJNA 2K9NA 1VNDA 4JP0A 3BG5A 4NDLA 1MBHA 1XG1A 1JJ6C 1U78A 1QPIA 2JMWA 4JX5A 1NK2P 4A3CJ 3JRDA 2LY9A 1IV6A 2FD5A 2LP0A 3OOUA 3DCFA 4L5EA 1TWHJ 4D7MA 2X9DA 3BTCA 1TWGJ 1H88C 2LFBA 2HQ5A 4V2GA 5EZGA 1YRNA 2LLKA 2VUMJ 2VKEA 3I4NJ 2XPWA 1ZKGA 2L0KA 2DN0A 2YUSA 4B1RA 2Y9ZA 3BG3A 3JREA 2EBIA 1HF0A 3GTLJ 4A3JJ 1ETXA 4GFBA 3S1MJ 4C3JJ 4RDUA 1UG2A 3GTMJ 3PO3J 2NVTJ 4A3FJ 2KT0A 1HCRA 5E3OA 2I10A 2O8KA 4X6AJ 1F43A 5EEAA 3HDDA 3Q0WA 3BR1A 3HGYA 4MLOA 1Z0XA 2HXIA 2VKVA 3A01B 3JR9A 1X2NA 1Y1WJ 4IHWA 3MVPA 2ECBA 3IH2A 2LTPA 3CCYA 3S1RJ 1W0UA 1K61A 1HDDC 1DU0A 2CQQA 2R5ZB 3GTGJ 1ITYA 3BT9A 3NARA 2CQXA 4M3BA 5BNGA 1ZQ3P 2M0CA 1ETKA 4DW6A 5FKLA 2NS7A 2WV1A 2CU7A 3FKIJ 2E2HJ 1A6IA 5IP7J 2NOGA 3CQZJ 2O7OA 4JYKA 3I4MJ 1IDZA 4XICA 1FIAA 5FKMA 3E7LA 3ZQCA 5IYCJ 2MW8A 3OSFA 3BTIA 5DS9A 1CQTA 2MGQA 1U9OA 4XRMA 3LSPA 3RZOJ 2LK2A 3Q0VA 3HOVJ 3BR3A 3ZQGA 2NVYJ 3TP3A 1AU7A 3HOWJ 1MH3A 5C3EJ 2Y0SN 1SFOJ 3S16J 4W1UA 4XK4A 1RKTA 3IH3A 1ORKA 3UKGA 2K9SA 2R7ZJ 1NTCA 3IV5A 2O9LA 3G1MA 1OCPA 3DEWA 5E3MA 4ABZA 4C2MJ 2JA8J 2QCOA 2XB5A 3WHBA 3BTLA 4Y52J 4LOCA 4IHYA 5C4XJ 1P7JA 1I50J 4XRSA 2JN6A 4FE4A 1SANA 3HB9A 2VI6A 2M34A 2MG4A 2E2JJ 1IUFA 5M3FJ 2DMPA 2EZIA 3RQIA 1IC8A 4J19A 1APLC 2XGCA 2DA5A 2LVSA 3F0CA 4MFDA 5IOYA 2FQ4A 2R92J 2COBA 1MBFA 2W48A 2ID3A 4FE7A 1GDTA 3BR6A 2WB1N 5JLWA 3A02A 1GT0C 2GBYA 4XRSG 2DMQA 3ZOBA 3GTOJ 1Y1VJ 5IPAA 2JK3A 2AHQA 3BG9A 3QPSA 5EDNA 2DMNA 3TW7A 1TWCJ 4B4CA 4BKXA 5M5WJ 5JLXA 2L7ZA 4M6VA 2L7FP 2FJ1A 2EH3A 1MBKA 4JX6A 1JTYA 4A3BJ 3PO2J 3HM5A 1TWFJ 2DA3A 1ZK8A 2XGDA 1Z77A 4RBOA 3ZQHA 2JA7J 3S17J 1U8BA 1FJLA 5DTDA 2L9RA 3B6AA 1JKRC 1BJZA 4I76A 1AKHA 3G1LA 4UUTA 2LD5A 5C4JJ 1QVTA 3FK6A 4MFEA 1ETVA 1GV2A 1IRZA 2DA1A 2HXOA 3A01A 1FTZA 5E3NA 3FISA 4FISA 2EZHA 5M5YJ 1WGXA 5K7HA 1H89C 5FLMJ 2X48A 1AKHB 3ZQLA 3BR2A 1POGA 2M9HA 4V2FA 5GPAA 2R0QC 1HLVA 4A3KJ 1LE8B 2R5ZA 3K7AJ 2CJJA 5J1YA 1JT0A 3SDGA 2Y31A 4A93J 1WI3A 3GTPJ 3HOZJ 1VI0A 2VPRA 4A3DJ 1BL0A 5HODA 2OF7A 1ETQA 1HDPA 2LR8A 2KDZA 3PM1A 1JKPC 2HYJA 1IDYA 2XGEA 2QF7A 2TRTA 2XPUA 1G2HA 3G1OA 4IHXA 4I6ZA 2B63J 5IYBJ 4DYCA 4AC0A 1FEXA 5J1UA 3CDLA 4IEJA 1LFBA 5F0CA 2M8GX 1PUFB 1ZR4A 1E3OC 3CMYA 1TC3C 3HOUJ 3O8HA 2ZB9A 3B6CA 9ANTA 2R93J 5IYDJ 1IJWC 2D5VA 1B8IB 1B72A 3LNQA 2M2EA 3HKZN 4B3AA 3D1NI 4D5CA 2HDDA 2IEKA 1BW5A 5M5XJ 4EEFG 1O4XA 2XPVA 3H0GJ 3LSGA 2JA6J 1B72B 1RPWA 1XC5A 4C3HJ 1DU6A 2X6OA 5EG0B 2YS9A 2NS8A 2EZKA 3Q0UA 1RR7A 1OJLA 3L1PA 3ZQFA 2XSDC 3A03A 3BQYA 1ZR2A 3H3VK 4QTRA 1JJ8C 1MSFC 1JT6A 2NVXJ 1GV5A 2FX0A 5F04A 1BA5A 2ID6A 5K7FA 5FLVA 4D5FA 2HOSA 4AYBN 4A3MJ 3LSRA 2R5YB 3GTJJ 5FKKA 1D5YA 4CYCB 4BY1J 2E19A 3RZDJ 2AO9A 4UUSB 1MH4A 2G0EA 2DA7A 1W0TA 3S15J 2ECCA 1ETOA 2HOAA 3WHCA 1UMQA 4C3IJ 4DZPA 3M4OJ 3HGGA 5F27A 2E2IJ 4HNVA 1JUPA 2H8RA
chains in the Genus database with same CATH superfamily
4A69C 5KNLA 1DPRA 3P5JA 2CQNA 5JHFA 3HOYJ 4ANJA 2VJJA 2HVQA 4R1HA 1P4XA 3ZQQA 2H6CA 3M7GA 2GWRA 2WAQN 2JVHA 2Y48A 2H1KA 1HW5A 1O57A 1ZGAA 4LK1F 5IOZA 5EGOB 3K4MA 3BROA 3CP8A 1IN6A 3RKQA 2HOTA 2VASA 3V7CA 1HKQA 4IQJA 3A0HC 3TBIA 3Q9VA 2DMUA 2IVMA 4EQQA 1R22A 2BY0A 1I6HJ 3KP6A 1FY7A 2KPMA 2UUZA 1OPCA 4GO1A 3TW6A 3QPHA 4C30A 5E20A 2E5NA 3GZ6A 1ZGWA 2GA1A 4MEXF 1WH5A 2UXXA 3CTAA 1MBGA 1KU2A 1ONVA 1KYWA 1FYKA 5J8FA 1BW6A 1WJEA 3BQZA 3QPTA 2STWA 1T33A 2PMZN 1PDNC 3GTKJ 2FBKA 1MNEA 2DBBA 2DYRH 2HU9A 3HEFA 5FJ8J 2G7UA 4XLFA 2XAUA 1YRNB 3FXQA 4CCJA 4EV0A 4XIDA 4G7OF 5AONA 2P81A 1H8AC 2KRFA 3ZMTA 3HZJA 4BXXJ 1IGNA 4EVIA 2P6SA 3RPUA 2OCCH 4BXFA 4CXFA 4OIQF 2B7EA 3E6DA 3BR0A 1VFCA 2KJBA 3DP7A 4W97A 4A0XA 1JGGA 4M6XA 1WPKA 2XVCA 5J8CA 4P9UA 3JSPA 2O61A 1QRYA 3CP2A 4BHPA 3D0SA 4L9NA 2J5OA 2Q2EA 5E8GA 1T39A 1WH7A 1S7OA 1JUSA 4KITB 4PJJA 3ECOA 2DQLA 1JGSA 1S3JA 3LSKA 1FLIA 2RAEA 2IA1A 5FKNA 4PGHA 2B9SA 5BPIA 1R58A 3KX2A 1IF1A 4QIWN 2DMTA 3WTXC 3VPRA 2OC6A 2YPRA 1UAAA 3S1QJ 2IS4A 5JFRA 3QYFA 3BG7A 3Q5FA 3L9FA 2KLOA 1K6OA 2EQRA 3K4KA 4DBQA 3KIOA 2MC3A 3KP4A 5L3CA 2LKSA 1JKQC 3PNTA 1IO2A 1MSEC 3VYRB 4A3GJ 2IAIA 4U0YA 2W82A 2CS3A 1UHMA 2Y9YA 3G3ZA 4KMUX 4IHVA 3IH4A 4DQ2A 4E70A 1UHSA 1D0XA 1AA7A 4KYWA 1R71A 1RRJA 2HKXA 4Y17A 2FUG2 5IY5H 2MLGA 3RQ4A 1IV8A 1NK3P 1ETYA 3QU3A 3C2BA 3S14J 1OCTC 3OIOA 1U2WA 2DA4A 1ZG5A 1NHAA 2DOAA 3I55I 3GBGA 3K2AA 3H36A 3ZMZA 2BEOA 4JX4A 2CUEA 2CRGA 1WHUA 2BOLA 2HR3A 1BM9A 2EZLA 2CO5A 3F22A 4Y7NJ 1FZPB 1V5EA 1R9TJ 4DGWB 3R61A 3DXJF 1Y0NA 2E1CA 2XRLA 4LIVA 3C7JA 5F08A 1TT0A 2J5PA 5H20A 2CGPA 1FX7A 3QP5A 1MMGA 2QENA 1YHQI 2DJNA 4ZYDA 4E6KG 1TT5B 4PUSA 1Z3YA 4ENNA 1P6RA 1WI9A 1E17A 2L3DA 5HDNA 2GIVA 1IRGA 3T1BA 3BG5A 1MBHA 4KN7X 4BNCA 3RI4A 2WA0A 1QPIA 4A5MA 3I9V2 4IF4A 1PYVA 4XN3A 2LY9A 5B3SH 2DTRA 3OOUA 3NEUA 4CCOA 1KQ0A 2DFIA 5KHDA 4XKVA 1ACIA 2OU2A 1R1UA 2WB1A 3SXYA 2LFBA 3RIRA 3ZMVA 2VUMJ 2VKEA 2EB7A 3CUQC 2XPWA 4BE0A 4BXUA 4WK8F 3DEEA 3WODF 3BG3A 1HF0A 1IN4A 5CVVA 4EM0B 3GTLJ 5CVJA 4U0VA 3CC4I 4C9YA 4XNFA 1X1BA 4AIKA 2F5VA 3PO3J 4AIDA 4P9FA 4RGSA 2R3SA 4B43A 5EEAA 2XC7A 3HDDA 2ZJQF 4MNUA 4E7ZA 3KYCB 3JR9A 3C2GA 2M45A 3M8JA 1E2XA 3W2WA 1VQ6I 1MIJA 2PBIA 4WWCA 3HUGB 2DK8A 1S6LA 2HZDA 2Q0OA 4CO8A 2ECBA 3I71A 2LTPA 2STTA 4AIJA 4B09A 1HDDC 1K61A 2FXAA 2CQQA 1ITYA 4O3MA 3BT9A 1FC3A 3IL2A 2CQXA 1ZQ3P 4M6YA 2M0CA 1WJ5A 1ETKA 4HSTA 4I02A 4M72A 2NS7A 1A36A 3U1KA 1HW2A 2CU7A 3FKIJ 2E2HJ 1DP3A 4Q5SF 1A6IA 5IP7J 1E3PA 4BQAA 3CD6I 1YIJI 4IHTA 1YW9A 4ESBA 4XICA 5FKMA 3OYEA 2D2WA 2IW5A 4BEHB 3VFZA 4L9VA 2IXSA 4HYEA 1VQPI 4PJ0C 5B1AH 5DS9A 2PJPA 2MBFA 1U9OA 4PFOA 3OR1C 3LSPA 5JR3A 3E3VA 2LK2A 3LA7A 3ABTA 2VQHA 4RA2A 3HOVJ 3VYSB 3ZQGA 1QU3A 2ZXJA 3K6GA 5TGTA 2L9NA 3E1SA 3H5RA 4K2EA 2IGMA 3I0TA 4KIGA 2Y0SN 3ROUA 4UUVA 3FXOA 4GRIA 3H9GA 3GLLA 1VQNI 4XMYA 1Z21A 2LG4A 4TV7A 5E8IA 4NQWA 1FNNA 1NTCA 3CMEI 1X1CA 1D8KA 2HTSA 1UFMA 1XMAA 4C2MJ 4Y52J 4M73A 1X4OA 3MWMA 1I50J 1WRJA 3CJNA 1BBYA 3VB2A 3CC2I 1N75A 1BC7C 1SANA 2K5CA 1B59A 4U7DA 2VI6A 4CDGA 3DFGA 1Z05A 2RGVA 5GADJ 2EZIA 2KMUA 5HLIA 2VKHA 1APLC 5BS6A 1SVLA 2GZWA 1Y56A 3AG2H 2DA5A 3PIOF 2YX7A 4RAGA 2UV1A 2VT3A 2R92J 2COBA 3G6EI 2H1LA 2JUCA 4YIRX 2EFWA 3ML6A 5TRDA 4UB6C 2JSCA 3DBRB 2GBYA 3H35A 2L5QA 2HQRA 4WXCA 1FOYA 3RKYA 1P9QC 2P7VB 3CZ6A 4BKXA 5M5WJ 1KU3A 2A07F 2EH3A 5HLTA 3TGNA 3PO2J 1OKRA 3V4GA 1Z77A 1W7PD 2W7NA 2JA7J 4B8XA 2JSPA 3S17J 1FJLA 5DTDA 1PJRA 4RM2A 3QOPA 4YFNF 1JKRC 1BJZA 2HWVA 2CFOA 2KP6A 2HEOA 3FK6A 3ULQB 1ETVA 3DF8A 2P5LC 2F5DA 3IUOA 3FISA 2EZHA 1HC8A 2PQ8A 3J7YJ 2WAQA 5FLMJ 2FU4A 2VIXA 4M9ZA 1YX5A 4A6DA 5A2QK 2KRCA 3BR2A 1FPQA 5GPAA 1SAXA 3H5AA 4V2FA 4A3KJ 4HX7A 1YO5C 1LE8B 3K7AJ 1ERDA 3EUAA 3RPQA 1Z7UA 5K1YA 3ZPLA 2M0MA 5AIQA 5FD6A 3OYHA 3BZ6A 3HPHA 2PG4A 3RSNA 3GEZA 3OYCA 1J5YA 3U2RA 4NC7A 5FO5A 4N0BA 2DFFA 4YIFA 3PM1A 2XGEA 1IDYA 2GIZA 4M74A 1KYZA 2QF7A 2TRTA 2EFPA 5FGMA 2MD0A 2JT1A 2PMZA 5D5UB 3G1OA 5JVGF 3T5XA 4I6ZA 1D5VA 3ZR8X 4DYCA 2CW8A 2F4IA 1K78A 4IEJA 4L9TA 3S93A 2VN2A 3WGGA 2XDVA 1YFHA 1TC3C 2KKOA 2X6XA 1B4AA 3HOUJ 1Z6TA 4JBAA 5ILSA 2R93J 5IYDJ 2NS0A 4CA0A 3HIFA 5LHIA 1P92A 2KIQA 3GO5A 2XAJA 3QP6A 1YITI 2ELJA 1Q1HA 1YS7A 4D5CA 4Q48A 2HDDA 2IEKA 2ZMEA 1L3LA 4RB3C 1BW5A 5M5XJ 2VOPA 4HQEA 1IZ1A 3H0GJ 2JA6J 1EKEA 2OCEA 2MD5A 4C3HJ 2X6OA 5EG0B 3QRFF 2YS9A 3OWTA 5LBQA 4ENJA 2FNAA 4B44A 2ZMEB 2Q1ZB 1VTNC 2ZSHB 1KQ8A 1RR7A 4N9IA 5DD4A 2OAZA 3A03A 1X3ZB 2E60A 2ZXHA 3H3VK 4QTRA 3I59A 4Z2YA 1RI7A 2NVXJ 3OYAA 1V55H 4YFKF 1Z6RA 3GUDA 2FX0A 3BZCA 3TO7A 3KP5A 2H8WA 1BA5A 1IN8A 5FLVA 5CJ9A 2XKOA 2F4MB 1NG6A 4I98B 3ELKA 4Y4RA 1ZH5A 4I7HA 5DM7F 3WTWC 1D5YA 1LEAA 2HS5A 2WTEA 2DU9A 2E1NA 3RZDJ 2ZC2A 4XKCA 3GF2A 2G0EA 5E1ZB 1W0TA 3KP2A 2Z1DA 1PUEE 1XGSA 3HOSA 3T8RA 4ZYAA 1BI1A 1XX5A 3B73A 4ASNA 4E4HA 3MKZA 1TQIA 5FB2A 4FX4A 4NUBA 1GXQA 5CVRA 4LLGF 4XQFA 2RNGA 2KFDA 2K9MA 3IP4B 3N05A 4L5JA 1SEUA 3K10A 3F8CA 2QUFA 4RGUA 1QNTA 3S2HJ 3HRMA 3E5QA 1FOKA 4BJ6C 1WCMJ 4LD5A 2HTJA 2VKDA 4JOMA 3CCJI 1AWCA 3M8FA 1W7PB 4XRFA 4HW0A 1F4KA 1F36A 1USSA 3DPTA 2IP2A 3ABUA 1MMSA 3P9CA 1F5TA 1OFCX 2KHMA 1DGWY 2HPMA 2CG4A 1FTTA 2GM4A 2Z2SB 2I8DA 3L2RA 1MJ9A 5HLHA 1IXSB 3VSKA 2JUGA 1HBXG 3LOCA 2BVMA 4MHGA 4ESJA 2ZJ2A 4BACA 3HSFA 2VBYA 1UHWA 2DTZA 3FM5A 4RB1A 3SJMA 3DKYA 3CCEI 5K7ZA 3DTEA 3K70D 4RLQA 3WU0A 4FHTA 3DTIA 2BXYA 2LNBA 2DI3A 2M87A 3GYHX 3HPGA 2JTVA 1R6RA 4YRVA 1WJFA 2CV0A 3JSOA 2M7AA 3FZVA 3OS0A 2L9SA 2MA3A 3F72A 3K4BA 3LA3A 3LQQA 3BZKA 3CCVI 1GVJA 1PUFA 1G3TA 1GUUA 3HOTA 5ICFA 5LRSA 1MJAA 1XB4A 2K3PA 3HSEA 2ME6A 1LVKA 3JRHA 3NAUA 4G6DA 3FF5A 3SFIA 2GXBA 3GFMA 1QVUA 5HVQC 5GPCA 2XUBA 1S29A 1J59A 3QPLA 4M3GA 3PUBA 1QO0D 1OCRH 3S32A 3OIPA 2XF6A 4G6QA 1B6AA 3QAHA 4XKBA 3CLQA 2V7FA 2MYSA 2RV8A 1IAWA 1I1SA 2H6BA 4IOCF 3SHFA 3KEQA 1FBQA 1HKSA 4BE1A 2NAZA 1RKWA 1STZA 1WVRA 5LGNA 5J3LA 4QPOA 2R7QA 3MD2A 1A31A 4OIRF 3RPUD 5E1XA 1X58A 1SVMA 2JA5J 2CH0A 3NWSA 4BH9A 2JPCA 3RJPA 5KK1A 4RMNA 3SFZA 1D0YA 5DV5A 2IS2A 2P7CB 2ELKA 2DA2A 3IHUA 2IBDA 4F93B 2LBFA 4A5NA 2M8EA 1R5HA 2CMPA 4M3EA 3E6CC 4RAYA 4EM2A 4QWQA 2YX4A 4UUSA 2Y30A 4ZTJA 3MKLA 4BL0B 4S05A 3DU5A 3P9KA 4BBRJ 3P9IA 4X1EA 5HNFA 5DCMA 2K40A 5HS8A 4A3IJ 1RETA 2Y0SA 4IQ4A 1R36A 2VC1A 3H0DA 5EYRA 3TEDA 3R4KA 3FKJA 3E97A 1MDMA 3TOBA 1FT9A 2L9VA 3DEUA 2KRHA 3RYRA 4BYYA 4OAYA 1IW7F 2H94A 3HRSA 4LK0F 1JTXA 4FETA 4XOTA 5ILUA 3C2HA 4YEJA 5EGOA 5LD2C 1LJ9A 1MDMB 2DPDA 1TBXA 2QYOA 3BJOA 3GFIA 2RN7A 2LKXA 2X0LA 2V6EA 1RC9A 3KYLA 1FIPA 3TL4X 1JXSA 5ICEA 5FLXZ 3RCOA 3PSIA 3EDPA 3FMQA 1XG1A 4RS8A 2CQ7A 2ACJA 4C2UA 2AQFA 4A2UA 3FXKA 4CCKA 4JX5A 5HDGA 3FDYA 3D5LA 1H9TA 1NK2P 4A3CJ 1T6SA 1B9NA 2OBPA 3JRDA 3A2KA 1BR1A 1Z1DA 2JA2A 2EA2A 2EILH 3ESWB 1WJAA 3L2UA 1KGSA 1MZBA 1J9IA 2X9DA 1XSDA 1TWGJ 1W5SA 4IXAA 2HQ5A 1YRNA 2F4OB 3I4NJ 5ICGA 1W4MA 3WU1B 1U0JA 2VBWA 1K6YA 2YUSA 2Y9ZA 2EBIA 1OCZH 1BN5A 1R49A 1ETXA 1O3QA 2DJIA 2OUMA 4A3FJ 4Z6YA 3J7ZI 1FYLA 1FSHA 3KZYA 5F6FA 1K7AA 4X6AJ 4KNYA 1OYWA 4GXOA 3BR1A 3HGYA 2HGCA 1G6NA 3BCAA 1R23A 3KZZA 4ZYHA 1Y1WJ 2XKPA 1MJBA 3MVPA 5TJJA 4G7HF 2XROA 3CJRB 2E1MB 4DBRA 4BDYA 3S1RJ 2ZJRF 1YG2A 1XCBA 3DBLB 4DW6A 2QSFX 1REPC 2Y75A 3BWGA 2F48A 4E7KA 3WU2C 4HPQA 3I4MJ 5K5OA 3CCLI 1IDZA 2CV2A 5IYCJ 1IN5A 4IRHA 3OSFA 3BTIA 5J4VA 1G3WA 4CZCA 2DW4A 2DK5A 5LLQA 2VBXA 4BJTA 2HOEA 3Q0VA 3J80K 2NVYJ 5H6RA 3HOWJ 1BOAA 3ERMA 3K4LA 5BPDA 4Y15A 4W1UA 3ZN0A 2D45A 3H1CA 4HX8A 3ASNH 3OOPA 1OCPA 3L2QA 1FSEA 3S8PA 2BBYA 4ZJZA 3HJEA 3K69A 3K1MA 1YJWI 1LUJB 2F5CA 3CCQI 4ETSA 2FE3A 4IHYA 1XMXA 2A61A 3ZMDA 3H3ZA 4AD9A 2V9PA 1DUXC 3F3XA 2MG4A 5CVIA 2E2JJ 3RQIA 1X4PA 2LRDA 4E7HA 2HYFA 4ZDOA 3RYPA 1SD6A 2LVSA 4MFDA 1RUOA 2MH2A 4F3QA 1MBFA 4ZYGA 3DTKA 4LMYA 3TDUC 1FWZA 1OMIA 3FMSA 2EK5A 4FE7A 3OYDA 3BR6A 1W36C 4EGZA 2O5RA 5FLXK 3A02A 1G4DA 1N78A 2DMQA 3ZOBA 1EJ9A 5IPAA 2JK3A 4S04A 2Z16A 2M7BA 3QPSA 4F91B 1SFKA 2DYSH 2DMNA 2KDOA 3FBIB 3TW7A 1ZREA 3BC8A 4M6VA 2R4GA 2L7FP 1XN7A 4R79A 2DODA 1MBKA 1JTYA 1JHHA 3E6BA 2IGOA 3KPHA 1VZ0A 1YOVB 1WJDA 4II3A 3SEQA 2DA3A 1ZK8A 2XGDA 3ZQHA 3LA2A 2JQ7A 2L01A 1RUNA 4I76A 4EJVA 1AKHA 3MKYB 2WY7Q 2JVGA 4UUTA 3R6SA 5C4JJ 2K7LA 4HLXA 2PEXA 5EEGA 5KVRA 2DA1A 2HXOA 3G4SI 3GZNB 5A2QZ 4MTDA 1OISA 3I64A 2VQCA 5M5YJ 1WGXA 1AKHB 2YU3A 4PSXA 2R7UA 3HUGA 4Y13A 2ZFUA 3ZQLA 3KZIC 4MQVA 2M9HA 4LG0B 2R0QC 1LEBA 4AVZA 3M1CA 3N4MA 4AVPA 4KT6A 3VSLA 4OMYA 3ZP5A 5J1YA 1JT0A 3SDGA 3S3NA 5EJCA 3K4NA 3GVAA 2JZYA 2PN6A 4BGDA 1VI0A 1XSVA 3M9AA 2O3FA 3LSIA 1ZELA 4XLHA 1A35A 1G59A 2VE9A 4KIBA 2CYYA 3HTUA 1X3WB 2KDZA 2HYJA 3VODA 4BEHA 2IGNA 1SC7A 3BY6A 1OR7C 3ZRGA 4IHXA 5EEHA 3WTZA 5IYBJ 1VQ4I 5FFXA 2B63J 2R7FA 1YYVA 2ZCWA 3CDLA 1LQ1A 1SD4A 4HV6A 2XF7A 2M8GX 2XIGA 1R1TA 4WX9A 4CICA 1ZR4A 1E3OC 3O8HA 4UVBA 2VB6A 1IJWC 4OIPF 4EJWA 3L2VA 1B8IB 1B72A 5LHGA 2X1CA 1S5LC 2XAHA 3D1NI 2QM3A 3O6BB 3LFUA 3LSMA 2VJ5A 3D5SC 4PJLA 3PUFA 2W4SA 4RB2C 1P2FA 5IT9K 1J2XA 2P5VA 2VBZA 3ISPA 4PK4A 4EMSA 1O4XA 1B72B 2RDPA 5B1BH 1XC5A 4XLNF 4L0YB 2EV5A 3FXUA 4BS9A 2EZKA 3Q0UA 3L1PA 2FMYA 2XSDC 2W1OA 1U5TB 4UB8C 3SDBA 1JT6A 1KQ9A 4LIUA 4XOPA 1VQLI 3HG9A 3EUHC 1JI8A 1QZEA 2BW3B 2HDWA 1WJBA 5F04A 1V5FA 4UV8A 4LGWA 3F21A 2VODA 3F8FA 4HA8A 2RQPA 1IUYA 1OR7A 2R5YB 2OTLI 3LL7A 5FKKA 2L4MA 3IWZA 3J81K 3JCUC 4AU7A 4HSRA 4CYCB 2QWWA 1LB2A 4AWXB 1XSXA 3EPZA 2AO9A 2QQAA 2DDBA 1MH4A 4DIQA 1TQMA 1BR4A 3S15J 1EH8A 2ECCA 5ED4A 1MMNA 2HOAA 5JI6A 1UZCA 4DZPA 2R7SA 4HDUA 3T8TA 3WGHA 4YG2F 3MKWB 4J01A 3RKWA 1I5ZA 1JUPA 4UV9A 1Z91A 1I3AA 5CYVA 2H8RA 2WADA 3IKVA 1HOMA 3NRVA 2AXLA 1PP7U 1TLHB 3CJQB 2YR2A 1D3YA 4FTHA 1BR2A 1GVDA 3L7WA 1ZARA 3S1NJ 1WJCA 1MBJA 3FXRA 3EUHA 2VE8A 5BOXA 3EQLF 2QA4I 1X2MA 4XONA 5C44J 2V26A 3GTQJ 3MZ8A 2EIJH 1LE8A 2ZMEC 3W2AA 4C2TA 1TW2A 4IRIA 2N8GA 1QGPA 2EA4A 3CCUI 1A6QA 4X0GA 4HF2A 4L9JA 5M3MJ 5BMZA 2VXDA 4M71A 4ZDLA 2JRTA 4WCGA 1BI3A 3FIWA 2RC4A 1XS9A 2X1EA 2FNPA 5KCMA 4UHTA 4XL9A 2CW7A 3VWBA 4KISA 2LMDA 4WXHA 1JUMA 1SVOA 3IWFA 4E7IA 5GTHC 3M3YJ 2NXNB 1VQMI 2QLZA 2VQLA 3U21A 4DYQA 5D6EA 5DYMA 3G73A 3PJRA 2V1NA 4MO7A 2HI3A 3GX4X 2CQKA 3EUKL 2DA6A 1ENHA 4IRGA 4ZZDA 4LLNA 3F9KA 3O8GA 3M1EA 5HS7A 3ECHA 1QBJA 4IZZA 4XBFA 4BQNA 1C0WA 4BHBA 2QBYB 2MFZA 2XF5A 5EG0A 1FOXA 3BPXA 2EV0A 3JRFA 1MBEA 4GDFA 1O3SA 2JJ7A 2LH9A 3BTJA 3V8LA 1D1BA 4DZJA 3H92A 1O7FA 4XKWA 1O3TA 4RGRA 2AS5F 1Y8RB 1BI2A 1S7EA 3KP7A 5IP6A 1V54H 4HOBA 2A6TA 2L7MP 3ASOH 3D5RC 4I01A 2KIMA 3KEOA 5GP9A 3V8KA 3FXMA 3SEZA 3JTHA 2HFHA 3VDXA 4CCNA 1TTYA 3TOAA 1RIOH 2H27A 2ISZA 1W5CC 2V4JC 5CPRB 2HYGD 2RREA 3DWLE 3EYIA 1LDJA 1VF9A 2YU9J 2L4AA 3JRAA 2WC2A 4BY7J 1XGOA 5J6XA 3MZHA 4IX7A 1XGNA 1DQUA 5IP9J 2JWTA 2ZFWA 2E36A 4ZYEA 5CVUA 4M3FA 1Z3XA 2R7WA 2A5WA 2DT6A 3OYLA 4OWRB 4LJZF 4AUXA 1K83J 3LSJA 1WQ2A 2PX9A 3HYIA 3KE2A 5K5RA 1H0MA 1JKOC 1EF4A 1LDKB 1R5ID 1SFXA 2VOOA 3TP0A 1I27A 1X19A 2FQ3A 4H0EA 1S9HA 4A3EJ 5F1JA 2OQRA 2E34A 4DYRA 4HDVA 1XCVA 1I39A 1BOBA 1O3RA 2G9WA 3LFKA 2K4JA 1T56A 2P8TA 3R0AA 1ON1A 4XORA 4D7NA 4ZZLA 1I1GA 3JRIA 2XRNA 1GXPA 3HL2A 1V3FA 1W7PA 4MEYF 3CCMI 2KIFA 3S2DJ 2PMHA 5CQEA 4ENKA 2ZXIA 3PNYA 3JRCA 1R1VA 2F5FA 2VL8A 1QQIA 1VNDA 2A6EF 4JP0A 3X2QH 4CHUA 2OA4A 5J4YA 4NB5A 4BHCA 1U78A 2LC2A 3JTGA 1TQPA 1IRXA 2W84A 1CGPA 1IV6A 2LDUA 2FD5A 2UXNA 2LP0A 2Y69H 3GXOA 3WG9A 1AOYA 1ULYA 2K9LA 2LY1A 4P96A 4IL6C 3CDIA 3PL8A 4G6TB 1D0ZA 4BE2A 3W2VA 1H88C 2NYXA 4FQGA 1ZGJA 4XLAA 4V2GA 5EZGA 2M30A 2R7RA 2IS6A 1B9MA 3CF2A 1EV7A 1FP2A 1YW8A 1ZKGA 2V1XA 2L0KA 4XLCA 3LAJA 2DN0A 3B02A 3CCRI 1T08B 3JREA 3CO7C 3F8NA 3TQNA 5KAIC 1PVEA 4C3JJ 2IGKA 5AIPA 1UB9A 2NVTJ 2ZNZA 3TDZC 2FSWA 5L3DA 2KT0A 1U8RA 4KUMA 5E3OA 1HCRA 2O8KA 1F43A 3F23A 1UELB 3GFJA 3ERED 1J0RA 3K0LA 3Q0WA 3MCZA 3F8MA 3GLXA 3C3WA 4MLOA 1EH6A 1Z0XA 2HXIA 3A01B 1X2NA 3NWTA 4I99C 2W24A 2IJLA 2Z3YA 2PJRB 2GXAA 2Z5UA 2K02A 3IH2A 5CQGA 1WKMA 3CCYA 1W0UA 3OR2C 4N4NB 1DU0A 3OYIA 2R5ZB 3GTGJ 3CLOA 5BNGA 3AL0B 3UNGC 2CFXA 1ZAOA 4HEA2 1BC8C 2DPUA 4QLCU 4ZH4F 1K79A 1HKTA 2NOGA 4B3XA 2O7OA 4JYKA 3WTUC 2LREA 4KFCA 3O2PE 5L3BA 1FIAA 4XN0A 5ICCA 1S7AA 4CYDA 3E7LA 1NH3A 3ZQCA 2NNYA 2V79A 1T2KA 2DT5A 5BQTA 2MW8A 5FROA 4P55A 4BDZA 2EV6A 3HRUA 2XHKA 2OZ6A 2EPFA 3QU6A 2ZSIB 2BY2A 3AG1H 3N97A 3J80Z 3RZOJ 2VJ4A 2BV6A 3BR3A 1MMAA 4PJMA 4CGZA 1HSTA 2BY1A 3KETA 2ESNA 1BJAA 3TP3A 5ILVA 4ITVA 4CCMA 5FRNA 4IKFA 2AXTC 2DO7A 2F6CA 4XLEA 3RDIA 3QYBA 3S16J 1IN7A 4R8HA 3L2WA 1RKTA 3CESA 2QSGX 1LFPA 1ORKA 3OIQA 3UKGA 1N77A 4MGRA 1LVAA 2VC0A 3G1MA 3CJTB 3DEWA 3V7SA 4A0YA 4KN4X 5E3MA 2UZKA 4ABZA 2QCOA 2XB5A 3WHBA 3CMMA 2QSHX 2X51A 3L09A 4XRSA 3BLYA 3FX3A 1FOWA 1VQ7I 2VT2A 3S3MA 2NOJB 3PFIA 2P6TA 5D8LB 3AG4H 3DPLC 3HB9A 1QA6A 2M34A 2HDCA 5DD8A 2OTJI 5IT3A 1IUFA 5M3FJ 1T95A 1S72I 3BG6A 1D1CA 2B0LA 2MLKA 2V9KA 4RLFA 1IC8A 4J19A 2XGCA 1ZHFA 2E1MC 3F0CA 5IOYA 2D1HA 2FQ4A 3ABKH 4EJOA 3C1DA 4O5VA 2W48A 4HLYA 2IRFG 4PFPA 4V19K 1QHHD 1SD5A 4GYIA 4XRSG 3GTOJ 1Y1VJ 2ZKZA 3O3KA 2AHQA 1JHFA 5D5XB 1U6GA 4PJNA 3H3UA 5JLXA 2L7ZA 2A5YB 4EJUA 3GFLA 4A12A 1W5TA 2FJ1A 2PLYA 4JX6A 1HSJA 4RB0A 4G8XA 3RTRA 2WV0A 1TWFJ 2QKLB 3PNVA 2X6WA 4HG2A 1YIOA 4DOZA 2YSRA 5HDKA 2X1DA 5GAGJ 5E1WA 3HC7A 3B6AA 4BQOA 4OMZA 1IXCA 2RVCA 2W00A 3G1LA 3MZYA 4B48A 5DM6F 1YS6A 1OQYA 3BDDA 1GV2A 2HPIA 3AAFA 1MW7A 4M9SA 1RZ4A 4F7ZA 2E35A 5E3NA 1ZRFA 2G7HA 2WAEA 4G7ZF 1H89C 2X48A 1DDNA 4AM3A 3KEYA 3M07A 3OMYA 3C18A 3OYKA 4KIFA 4LFUA 2CJJA 3COAC 2Y31A 2V1UA 4A93J 2GQQA 2EFOA 1X1PA 1TNTA 5FFZA 3GTPJ 3HOZJ 4HRIA 1T0FC 1HA8A 5HODA 2M1BA 1X1DA 2H09A 2LR8A 2EFQA 3SZTA 2FRHA 1KU9A 1JKPC 2DFEA 4IVNA 2IPQX 1T8IA 4F92B 3ZN1A 3I58A 5HS9A 4HNTA 1D8JA 4XM3A 3RKXA 1KA8A 5J1UA 2OZUA 1QZZA 5F0CA 1O7LA 2VQGA 3U1DA 2V1DA 1R5GA 9ANTA 3OYMA 5DCFA 1ZLJA 2LF7A 4L5IA 3BOQA 3T0YA 3HHHA 4I09A 5TISC 3HKZN 2DDAA 3IAS2 5DUKA 4HNUA 2DCEA 1W36D 5IT9Z 2Q2EB 1PP8F 3SZPA 2Q8KA 1FMVA 5HOOA 3LSGA 4NBQA 1DU6A 1DGRM 2LSOA 5GAEJ 4BAYA 3V42A 3MQ0A 1E0EA 4ZC3A 1OJLA 2E7XA 3ZQFA 2QZ8A 2R7XA 2IA2A 4PGGA 2D1VA 3SYTA 4OAZA 1ZR2A 3KFWX 1GLNA 1T0FA 1JJ8C 1SAUA 1MSFC 5L3GA 3DLLF 3WE2A 3OYNA 1GV5A 2L2OA 2A05A 4JQFA 3K4JA 1H9GA 5F64A 3AFHA 2FMLA 2DT7B 5K7FA 1LDDA 4D5FA 2HOSA 4HF0A 4AYBN 3J81Z 2OJED 3LSRA 2XV4S 2DAOA 3LSHA 3PQKA 4EM1A 2BGCA 4A6EA 3AG3H 3KYDB 2F5EA 1J09A 1VQKI 3OL4A 4BY1J 2CW0F 4EJTA 4PDKA 3OS2A 1OCOH 5H6QA 5CKTA 3WE3A 2XSJC 3OYBA 4YFXF 3VEPA 2KQRA 4Y33A 1G8XA 3CCSI 3BJAA 2K86A 4XSXF 1FBUA 4FT8A 2VLAA 3TO9A 1ZG1A 3CO6C 4C3IJ 2PFBA 3BJ6A 1XGMA 2HQNA 2CV1A 2BZTA 4IJAA 2KL4A 3HGGA 3MMYB 1R4MB 1K4SA 5F27A 2E2IJ 4KT5C 4B47A 5LGUA 4G12A 2ZO4A 2L02A 2XGXA 2GLOA 2BE5F 1P7IA 4OIOF 1SD7A 5F0HA 3JRBA 2ZXWH 4WF2A 1KU7A 3CMAI 3ZQ7A 4Q47A 2VJIA 4NNJA 2K3FA 5B66C 4N9HA 2XAQA 3A0BC 1M1EB 4LG0A 4HQMA 5DUIA 2CSOA 2FBIA 1HW1A 1AHDP 1YJNI 5E18F 1ZTRA 3FXJA 3G2BA 1U5TC 1U9NA 1YE9A 1Z67A 5F0FA 5D5VB 4DJAA 1W1WE 2WAFA 3BR5A 1X1AA 3GMEA 1OYIA 2K9QA 3KP3A 3H9JA 1RR8C 4FCYA 5DEQA 1TWAJ 4AIHA 1MNDA 3E5XA 3VOEA 3GW2A 3S3OA 4CH7A 3HBLA 4E7JA 3PSFA 3VYUB 2XAFA 3TKYA 3I3LA 3FK7A 1QHGA 3Q3SA 3L2CA 5H2FC 2Z33A 4CUGA 2KISA 3VYTB 3QOEA 4MIMA 1Q1VA 1L0OC 3W6KB 1A5JA 1CF7A 4BBSJ 4O6JA 1B8IA 2M4GA 5CLSA 1V5GA 4XSZF 5F1RA 1I6XA 3UR3C 2OV7A 4BUPA 2XB0X 2E7WA 1UCRA 2O03A 1CF7B 1LFUP 3QQAA 2GA2A 2V6CA 2Y2ZA 1XD7A 3DLAA 3IAM2 2KIUA 2NVUB 2ME0A 4S0HB 2ZBKA 1MD0A 1I3QJ 3ZGKA 2MSYA 3V7RA 1OCCH 2NVQJ 3I54A 2VONA 1U5TA 3L00A 3MN2A 3WTVC 1EH7A 3QWLA 3ZQIA 2OPTA 4PCQA 3CUQA 2JRMA 5K5QA 5EZHA 1J7KA 2BW3A 5J1RA 2W25A 5EF6A 3IRRA 3HXLA 1ETWA 2V9VA 1HXDA 2E5ZA 3H5NA 1TP4A 3DPUA 1XTAA 2CUFA 1GHCA 3CUQB 2Z99A 4YELA 2R5YA 1OLTA 2DXIA 2OQGA 4A3LJ 3OY9A 2HKOA 4CYCA 1OYYA 2E1OA 3I53A 5E79C 5LFAA 2RKHA 2FA5A 5FKOA 1IG7A 2A68F 3WG7H 4ESFA 3OSGA 5ERIA 1FYMA 3P7NA 5FRMA 4NQWB 4GCVA 4M3DA 2R7VA 5HLGA 2F2EA 2FEZA 3GZ5A 2Z9OA 3W6VA 4E7LA 1QPMA 4QSHA 4HV5A 3LAPA 3F6OA 2TCTA 1R4NB 3W3CA 1MNMC 3DKXA 1YI2I 1MGTA 1SMYF 2GOXB 3F8BA 2XASA 1RESA 3JRGA 2DLLA 3LWFA 2IS1A 3R0JA 5E3LA 3IC7A 4WXDA 3ABMH 2DOFA 4OU0A 4HAMA 1YJ9I 4UXNA 3BCBA 5GTIC 3HOXJ 3CUOA 2WBMA 4YIIA 4IO9F 2ZJPF 5GAHJ 1VQOI 1Y8QB 2X85A 2CWEA 2K9NA 1G3SA 4NDLA 1JJ6C 1ZYRF 4LLLA 2KZVA 1XDUA 5FD5A 3DU6A 3TO6A 5LEJA 4EATA 1V4RA 2JMWA 1ZN2A 4MQ9F 3WTYC 4Q4ZF 1TL8A 3DCFA 2EIKH 3FM3A 4L5EA 1TWHJ 1BI0A 4D7MA 1XDSA 1WFXA 4ON0A 2BHZA 3BTCA 2RQQA 3H9QA 1T38A 1Z7LA 2LOOA 2LLKA 4DNCA 1Y0UA 1ZRCA 2O0YA 5LHHA 4B1RA 1KZHA 1LPQA 2RNJA 2VXZA 4A3JJ 4GFBA 3S1MJ 4Y3OA 3ZCOA 2ZNYA 1UG2A 2A3SA 4RDUA 3GTMJ 3WTSC 1USTA 2GXGA 1ON2A 2I10A 1XMKA 3V8JA 5B5EC 3I56I 3OYFA 4FASD 3E5UA 2VKVA 3DKWA 3OYJA 4OOIA 2MH9A 4N4OB 1SMTA 4IHWA 3IRQA 3BPVA 3PQJA 2QBYA 4I0AA 2EIMH 3J7AY 1N25A 1FBSA 3LMMA 3OV8A 4D1QA 3FMRA 4OINF 2W57A 3NARA 4G94A 4M3BA 5L3EA 2ETHA 4KICA 3WGIA 5FKLA 2NRAC 1S8NA 2DQRA 4HX4A 4NHJA 2WV1A 3JAMZ 3DV8A 3DQVC 2M5WA 4I0BA 3U9GA 3CQZJ 1QZYA 2GAUA 4BJ5C 1K4TA 4RGXA 1FMWA 1KONA 1IRFA 1E3HA 1TZLA 3KCCA 4H4KC 2I5UA 2PI0A 4M9XA 3HHGA 2P0WA 2AQEA 4FX0A 3PIPF 1A04A 2LKPA 3QYEA 4ZTFA 1YQAA 4KMFA 1HQCA 1CQTA 2MGQA 1SFEA 4CSWA 1MMDA 2EINH 4XRMA 2O6GE 1K78B 2ISYA 2IT0A 3FWEA 4NC8A 5DDGA 2OD5A 1LKXA 2LF8A 5D4SA 1AU7A 2E71A 1MH3A 5C3EJ 2HVSA 2BHYA 2IA0A 4RM3A 1SFOJ 3MEXA 1DPUA 4IOAF 3LQRA 5HNHA 5E17F 4UVAA 4XK4A 3IH3A 3R60A 2K9SA 2R7ZJ 3IV5A 2O9LA 1NG7A 1YX3A 1Y39A 1UJ8A 2Y0MA 1ZRDA 1T98A 3HKZA 2JA8J 3PFYA 3BTLA 2WY8Q 2EWNA 4LOCA 1RNLA 5C4XJ 1P7JA 1X3UA 2HQAA 4GGGA 4LB5A 1B1BA 4HZFA 3K1PA 4UNOA 2JN6A 4FE4A 2A69F 2VPLA 3I59B 2R7DA 1J75A 2JPBA 2K85A 2DMPA 3FHNA 2KZGA 3ZXSA 3FBNB 3AKZA 5L3FA 3OYGA 5D5WB 1P4WA 4U88A 5JVTA 4PSWA 3K9TA 1F1ZA 1ZG3A 1YW7A 2HZTA 2ADUA 2FF4A 4LB6B 3AL0C 1VQ8I 2ID3A 3CDHA 3G71I 1GDTA 6PAXA 2BY3A 1R00A 2DFHA 2FBHA 2WB1N 5JLWA 4AYBA 1GT0C 4I2OA 4XLPF 2LY2A 2WWYA 2HNHA 2X6YA 1YTYA 1Z9CA 4J00A 1VQ5I 2W85A 3BG9A 5EDNA 4LITA 3IKTA 1TWCJ 4B4CA 4XR6A 2L7KA 3EETA 1BIAA 2EFNA 4L18B 3FXLA 4A3BJ 2A6HF 2K27A 1UG0A 3ONQA 3OL3A 3HM5A 3TMOA 1WZ2A 4U7BA 3EYYA 2ESHA 2XAGA 2MABA 4RBOA 2PMUA 4U0WA 1IXRC 3FHZA 4A0ZA 2P5KA 2ELHA 1U8BA 2L9RA 2BYVE 4PZJA 3F6VA 2HVRA 2LD5A 1VQ9I 2FOKA 1QVTA 1Y6IA 4CCLA 4MFEA 1ODDA 3JW4A 3E6MA 1IRZA 3KLOA 3A01A 3CC7I 3NQOA 3K2ZA 1FTZA 4FISA 4UVCA 5K7HA 3BP8A 3MAJA 3HRTA 3A1YA 2PJRA 1POGA 4BQQA 1G3YA 3ABLH 1HLVA 3ZMUA 3E0JB 2R5ZA 1DP7P 1TW3A 3LSTA 2BXZA 4G9YA 4II2A 4KA4A 1ZLKA 3HTSB 1WI3A 2EJRA 2GOMA 2VPRA 1D1AA 1BIBA 4A3DJ 1BL0A 2OF7A 2NNNA 3I5UA 1ETQA 1HDPA 3GCMA 2M3AA 3CF5F 2UWMA 2O8XA 2P4WA 5LRRA 1P4AA 3I4PA 3DBHB 2XPUA 2QGUA 4RAFA 3JAMK 1G2HA 5JHUA 2ICWG 3S2WA 2QKMB 4F52A 4EGYA 1U3EM 1FP1D 4AC0A 1FEXA 1LFBA 3MFKA 4RAZA 1PUFB 3GWZA 2CUJA 3K1NA 4BU2A 4P5OA 1MKMA 2QQ8A 3CMYA 3ZMSA 3SQNA 2ZB9A 3B6CA 2QQBA 4P1WA 1SFUA 2D5VA 2TDXA 3LNQA 2M2EA 2R7TA 1WWXA 4B3AA 1YLFA 2COMA 2X4HA 5D6FA 4D0PA 4QPQA 2L54A 4JK1X 3QODA 3K4CA 4EEFG 2XPVA 3SZGA 1RPWA 3K70C 2MC4A 1LNWA 2NS8A 4D9JA 3BQYA 1XPXA 4UY8I 4ENMA 2K4BA 2QQ9A 3OS1A 2QEXI 5J40A 1TNSA 2FOWA 1F9NA 5J47A 4HF1A 5KAFC 3M8EA 2BVLA 3A4CA 3KLNA 3WTTC 4GYGA 4U87A 2ID6A 3J7AO 1EA3A 3REOA 4A3MJ 4ZDPA 3GTJJ 4IHSA 4KJZA 1R7JA 2LBFB 4HBLA 2E19A 2M4KA 4NC6A 1WSUA 4CZZA 3W6JB 4UUSB 5LGTA 2KJCA 2DA7A 1ETOA 3WHCA 1JE8A 1UMQA 2LYCA 5DCMB 4KDPA 2CUZA 2C6YA 4MTEA 2QVOA 2DOEA 4IPAA 2R7OA 4F55A 3M4OJ 4L0ZB 4HNVA 3HSRA 4LG3A 4E7SA 5D8KB 5D4RA 3Q9SA 5LEKA
chains in the Genus database with same CATH topology
1HOMA 4A69C 3S2HJ 4G12A 3HOYJ 1WCMJ 2GLOA 2WAQN 1P7IA 2H1KA 5IOZA 4FTHA 1GVDA 5F0HA 3JRBA 1F36A 5EGOB 3S1NJ 3RKQA 2HOTA 1MBJA 1OFCX 1FTTA 2GM4A 2DMUA 1X2MA 5C44J 1I6HJ 3LOCA 3GTQJ 1LE8A 3TW6A 2N8GA 1AHDP 1ZGWA 2DTZA 1ZTRA 1WH5A 5M3MJ 3SJMA 5K7ZA 1MBGA 1U9NA 5F0FA 1BW6A 3BQZA 3BR5A 3FIWA 2K9QA 1T33A 2PMZN 1XS9A 3GTKJ 4FCYA 5FJ8J 3HEFA 1TWAJ 1JUMA 1YRNB 4XIDA 2P81A 3HBLA 1H8AC 3M3YJ 3FK7A 3Q3SA 4BXXJ 4DYQA 1IGNA 1PUFA 1GUUA 3BR0A 1VFCA 4MO7A 4W97A 1JGGA 2HI3A 4MIMA 1Q1VA 2ME6A 3JRHA 1A5JA 1WPKA 4BBSJ 2DA6A 1ENHA 3NAUA 1B8IA 3O8GA 3SFIA 1QRYA 1QVUA 5GPCA 3QPLA 2XB0X 4M3GA 1WH7A 1JUSA 1LFUP 3QQAA 2Y2ZA 5EG0A 2RAEA 5FKNA 3JRFA 1MBEA 2ME0A 4S0HB 2JJ7A 1I3QJ 3BTJA 4DZJA 2MSYA 4QIWN 1S7EA 2DMTA 5IP6A 2NVQJ 1RKWA 5GP9A 2L7MP 3VPRA 5J3LA 3S1QJ 3MN2A 3ZQIA 2OPTA 1X58A 2JA5J 5EZHA 5J1RA 5EF6A 1ETWA 2EQRA 1VF9A 2YU9J 2CUFA 3JRAA 1JKQC 4BY7J 1MSEC 2R5YA 2ELKA 2DA2A 2IBDA 4A3GJ 4A3LJ 5IP9J 2IAIA 4M3EA 2JWTA 4CYCA 2E1OA 2Y9YA 4M3FA 4IHVA 5FKOA 3IH4A 4AUXA 1IG7A 4UUSA 1K83J 3LSJA 1UHSA 1JKOC 2Y30A 1EF4A 3MKLA 3TP0A 3OSGA 4BBRJ 4X1EA 2K40A 4A3EJ 5F1JA 4DYRA 1NK3P 1ETYA 4A3IJ 3C2BA 4M3DA 1RETA 3S14J 3W6VA 1OCTC 3OIOA 2DA4A 4QSHA 1T56A 5EYRA 3TEDA 2TCTA 3GBGA 3K2AA 4D7NA 3JRIA 1MNMC 4JX4A 2CUEA 2CRGA 1RESA 3JRGA 2EZLA 4Y7NJ 5E3LA 1JTXA 1R9TJ 5EGOA 3S2DJ 2XRLA 5F08A 3HOXJ 2LKXA 3JRCA 1FIPA 2DJNA 2K9NA 1VNDA 4JP0A 3BG5A 4NDLA 1MBHA 1XG1A 1JJ6C 1U78A 1QPIA 2JMWA 4JX5A 1NK2P 4A3CJ 3JRDA 2LY9A 1IV6A 2FD5A 2LP0A 3OOUA 3DCFA 4L5EA 1TWHJ 4D7MA 2X9DA 3BTCA 1TWGJ 1H88C 2LFBA 2HQ5A 4V2GA 5EZGA 1YRNA 2LLKA 2VUMJ 2VKEA 3I4NJ 2XPWA 1ZKGA 2L0KA 2DN0A 2YUSA 4B1RA 2Y9ZA 3BG3A 3JREA 2EBIA 1HF0A 3GTLJ 4A3JJ 1ETXA 4GFBA 3S1MJ 4C3JJ 4RDUA 1UG2A 3GTMJ 3PO3J 2NVTJ 4A3FJ 2KT0A 1HCRA 5E3OA 2I10A 2O8KA 4X6AJ 1F43A 5EEAA 3HDDA 3Q0WA 3BR1A 3HGYA 4MLOA 1Z0XA 2HXIA 2VKVA 3A01B 3JR9A 1X2NA 1Y1WJ 4IHWA 3MVPA 2ECBA 3IH2A 2LTPA 3CCYA 3S1RJ 1W0UA 1K61A 1HDDC 1DU0A 2CQQA 2R5ZB 3GTGJ 1ITYA 3BT9A 3NARA 2CQXA 4M3BA 5BNGA 1ZQ3P 2M0CA 1ETKA 4DW6A 5FKLA 2NS7A 2WV1A 2CU7A 3FKIJ 2E2HJ 1A6IA 5IP7J 2NOGA 3CQZJ 2O7OA 4JYKA 3I4MJ 1IDZA 4XICA 1FIAA 5FKMA 3E7LA 3ZQCA 5IYCJ 2MW8A 3OSFA 3BTIA 5DS9A 1CQTA 2MGQA 1U9OA 4XRMA 3LSPA 3RZOJ 2LK2A 3Q0VA 3HOVJ 3BR3A 3ZQGA 2NVYJ 3TP3A 1AU7A 3HOWJ 1MH3A 5C3EJ 2Y0SN 1SFOJ 3S16J 4W1UA 4XK4A 1RKTA 3IH3A 1ORKA 3UKGA 2K9SA 2R7ZJ 1NTCA 3IV5A 2O9LA 3G1MA 1OCPA 3DEWA 5E3MA 4ABZA 4C2MJ 2JA8J 2QCOA 2XB5A 3WHBA 3BTLA 4Y52J 4LOCA 4IHYA 5C4XJ 1P7JA 1I50J 4XRSA 2JN6A 4FE4A 1SANA 3HB9A 2VI6A 2M34A 2MG4A 2E2JJ 1IUFA 5M3FJ 2DMPA 2EZIA 3RQIA 1IC8A 4J19A 1APLC 2XGCA 2DA5A 2LVSA 3F0CA 4MFDA 5IOYA 2FQ4A 2R92J 2COBA 1MBFA 2W48A 2ID3A 4FE7A 1GDTA 3BR6A 2WB1N 5JLWA 3A02A 1GT0C 2GBYA 4XRSG 2DMQA 3ZOBA 3GTOJ 1Y1VJ 5IPAA 2JK3A 2AHQA 3BG9A 3QPSA 5EDNA 2DMNA 3TW7A 1TWCJ 4B4CA 4BKXA 5M5WJ 5JLXA 2L7ZA 4M6VA 2L7FP 2FJ1A 2EH3A 1MBKA 4JX6A 1JTYA 4A3BJ 3PO2J 3HM5A 1TWFJ 2DA3A 1ZK8A 2XGDA 1Z77A 4RBOA 3ZQHA 2JA7J 3S17J 1U8BA 1FJLA 5DTDA 2L9RA 3B6AA 1JKRC 1BJZA 4I76A 1AKHA 3G1LA 4UUTA 2LD5A 5C4JJ 1QVTA 3FK6A 4MFEA 1ETVA 1GV2A 1IRZA 2DA1A 2HXOA 3A01A 1FTZA 5E3NA 3FISA 4FISA 2EZHA 5M5YJ 1WGXA 5K7HA 1H89C 5FLMJ 2X48A 1AKHB 3ZQLA 3BR2A 1POGA 2M9HA 4V2FA 5GPAA 2R0QC 1HLVA 4A3KJ 1LE8B 2R5ZA 3K7AJ 2CJJA 5J1YA 1JT0A 3SDGA 2Y31A 4A93J 1WI3A 3GTPJ 3HOZJ 1VI0A 2VPRA 4A3DJ 1BL0A 5HODA 2OF7A 1ETQA 1HDPA 2LR8A 2KDZA 3PM1A 1JKPC 2HYJA 1IDYA 2XGEA 2QF7A 2TRTA 2XPUA 1G2HA 3G1OA 4IHXA 4I6ZA 2B63J 5IYBJ 4DYCA 4AC0A 1FEXA 5J1UA 3CDLA 4IEJA 1LFBA 5F0CA 2M8GX 1PUFB 1ZR4A 1E3OC 3CMYA 1TC3C 3HOUJ 3O8HA 2ZB9A 3B6CA 9ANTA 2R93J 5IYDJ 1IJWC 2D5VA 1B8IB 1B72A 3LNQA 2M2EA 3HKZN 4B3AA 3D1NI 4D5CA 2HDDA 2IEKA 1BW5A 5M5XJ 4EEFG 1O4XA 2XPVA 3H0GJ 3LSGA 2JA6J 1B72B 1RPWA 1XC5A 4C3HJ 1DU6A 2X6OA 5EG0B 2YS9A 2NS8A 2EZKA 3Q0UA 1RR7A 1OJLA 3L1PA 3ZQFA 2XSDC 3A03A 3BQYA 1ZR2A 3H3VK 4QTRA 1JJ8C 1MSFC 1JT6A 2NVXJ 1GV5A 2FX0A 5F04A 1BA5A 2ID6A 5K7FA 5FLVA 4D5FA 2HOSA 4AYBN 4A3MJ 3LSRA 2R5YB 3GTJJ 5FKKA 1D5YA 4CYCB 4BY1J 2E19A 3RZDJ 2AO9A 4UUSB 1MH4A 2G0EA 2DA7A 1W0TA 3S15J 2ECCA 1ETOA 2HOAA 3WHCA 1UMQA 4C3IJ 4DZPA 3M4OJ 3HGGA 5F27A 2E2IJ 4HNVA 1JUPA 2H8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HOM A;  4A69 C;  3S2H J;  4G12 A;  3HOY J;  1WCM J;  2GLO A;  2WAQ N;  1P7I A;  2H1K A;  5IOZ A;  4FTH A;  1GVD A;  5F0H A;  3JRB A;  1F36 A;  5EGO B;  3S1N J;  3RKQ A;  2HOT A;  1MBJ A;  1OFC X;  1FTT A;  2GM4 A;  2DMU A;  1X2M A;  5C44 J;  1I6H J;  3LOC A;  3GTQ J;  1LE8 A;  3TW6 A;  2N8G A;  1AHD P;  1ZGW A;  2DTZ A;  1ZTR A;  1WH5 A;  5M3M J;  3SJM A;  5K7Z A;  1MBG A;  1U9N A;  5F0F A;  1BW6 A;  3BQZ A;  3BR5 A;  3FIW A;  2K9Q A;  1T33 A;  2PMZ N;  1XS9 A;  3GTK J;  4FCY A;  5FJ8 J;  3HEF A;  1TWA J;  1JUM A;  1YRN B;  4XID A;  2P81 A;  3HBL A;  1H8A C;  3M3Y J;  3FK7 A;  3Q3S A;  4BXX J;  4DYQ A;  1IGN A;  1PUF A;  1GUU A;  3BR0 A;  1VFC A;  4MO7 A;  4W97 A;  1JGG A;  2HI3 A;  4MIM A;  1Q1V A;  2ME6 A;  3JRH A;  1A5J A;  1WPK A;  4BBS J;  2DA6 A;  1ENH A;  3NAU A;  1B8I A;  3O8G A;  3SFI A;  1QRY A;  1QVU A;  5GPC A;  3QPL A;  2XB0 X;  4M3G A;  1WH7 A;  1JUS A;  1LFU P;  3QQA A;  2Y2Z A;  5EG0 A;  2RAE A;  5FKN A;  3JRF A;  1MBE A;  2ME0 A;  4S0H B;  2JJ7 A;  1I3Q J;  3BTJ A;  4DZJ A;  2MSY A;  4QIW N;  1S7E A;  2DMT A;  5IP6 A;  2NVQ J;  1RKW A;  5GP9 A;  2L7M P;  3VPR A;  5J3L A;  3S1Q J;  3MN2 A;  3ZQI A;  2OPT A;  1X58 A;  2JA5 J;  5EZH A;  5J1R A;  5EF6 A;  1ETW A;  2EQR A;  1VF9 A;  2YU9 J;  2CUF A;  3JRA A;  1JKQ C;  4BY7 J;  1MSE C;  2R5Y A;  2ELK A;  2DA2 A;  2IBD A;  4A3G J;  4A3L J;  5IP9 J;  2IAI A;  4M3E A;  2JWT A;  4CYC A;  2E1O A;  2Y9Y A;  4M3F A;  4IHV A;  5FKO A;  3IH4 A;  4AUX A;  1IG7 A;  4UUS A;  1K83 J;  3LSJ A;  1UHS A;  1JKO C;  2Y30 A;  1EF4 A;  3MKL A;  3TP0 A;  3OSG A;  4BBR J;  4X1E A;  2K40 A;  4A3E J;  5F1J A;  4DYR A;  1NK3 P;  1ETY A;  4A3I J;  3C2B A;  4M3D A;  1RET A;  3S14 J;  3W6V A;  1OCT C;  3OIO A;  2DA4 A;  4QSH A;  1T56 A;  5EYR A;  3TED A;  2TCT A;  3GBG A;  3K2A A;  4D7N A;  3JRI A;  1MNM C;  4JX4 A;  2CUE A;  2CRG A;  1RES A;  3JRG A;  2EZL A;  4Y7N J;  5E3L A;  1JTX A;  1R9T J;  5EGO A;  3S2D J;  2XRL A;  5F08 A;  3HOX J;  2LKX A;  3JRC A;  1FIP A;  2DJN A;  2K9N A;  1VND A;  4JP0 A;  3BG5 A;  4NDL A;  1MBH A;  1XG1 A;  1JJ6 C;  1U78 A;  1QPI A;  2JMW A;  4JX5 A;  1NK2 P;  4A3C J;  3JRD A;  2LY9 A;  1IV6 A;  2FD5 A;  2LP0 A;  3OOU A;  3DCF A;  4L5E A;  1TWH J;  4D7M A;  2X9D A;  3BTC A;  1TWG J;  1H88 C;  2LFB A;  2HQ5 A;  4V2G A;  5EZG A;  1YRN A;  2LLK A;  2VUM J;  2VKE A;  3I4N J;  2XPW A;  1ZKG A;  2L0K A;  2DN0 A;  2YUS A;  4B1R A;  2Y9Z A;  3BG3 A;  3JRE A;  2EBI A;  1HF0 A;  3GTL J;  4A3J J;  1ETX A;  4GFB A;  3S1M J;  4C3J J;  4RDU A;  1UG2 A;  3GTM J;  3PO3 J;  2NVT J;  4A3F J;  2KT0 A;  1HCR A;  5E3O A;  2I10 A;  2O8K A;  4X6A J;  1F43 A;  5EEA A;  3HDD A;  3Q0W A;  3BR1 A;  3HGY A;  4MLO A;  1Z0X A;  2HXI A;  2VKV A;  3A01 B;  3JR9 A;  1X2N A;  1Y1W J;  4IHW A;  3MVP A;  2ECB A;  3IH2 A;  2LTP A;  3CCY A;  3S1R J;  1W0U A;  1K61 A;  1HDD C;  1DU0 A;  2CQQ A;  2R5Z B;  3GTG J;  1ITY A;  3BT9 A;  3NAR A;  2CQX A;  4M3B A;  5BNG A;  1ZQ3 P;  2M0C A;  1ETK A;  4DW6 A;  5FKL A;  2NS7 A;  2WV1 A;  2CU7 A;  3FKI J;  2E2H J;  1A6I A;  5IP7 J;  2NOG A;  3CQZ J;  2O7O A;  4JYK A;  3I4M J;  1IDZ A;  4XIC A;  1FIA A;  5FKM A;  3E7L A;  3ZQC A;  5IYC J;  2MW8 A;  3OSF A;  3BTI A;  5DS9 A;  1CQT A;  2MGQ A;  1U9O A;  4XRM A;  3LSP A;  3RZO J;  2LK2 A;  3Q0V A;  3HOV J;  3BR3 A;  3ZQG A;  2NVY J;  3TP3 A;  1AU7 A;  3HOW J;  1MH3 A;  5C3E J;  2Y0S N;  1SFO J;  3S16 J;  4W1U A;  4XK4 A;  1RKT A;  3IH3 A;  1ORK A;  3UKG A;  2K9S A;  2R7Z J;  1NTC A;  3IV5 A;  2O9L A;  3G1M A;  1OCP A;  3DEW A;  5E3M A;  4ABZ A;  4C2M J;  2JA8 J;  2QCO A;  2XB5 A;  3WHB A;  3BTL A;  4Y52 J;  4LOC A;  4IHY A;  5C4X J;  1P7J A;  1I50 J;  4XRS A;  2JN6 A;  4FE4 A;  1SAN A;  3HB9 A;  2VI6 A;  2M34 A;  2MG4 A;  2E2J J;  1IUF A;  5M3F J;  2DMP A;  2EZI A;  3RQI A;  1IC8 A;  4J19 A;  1APL C;  2XGC A;  2DA5 A;  2LVS A;  3F0C A;  4MFD A;  5IOY A;  2FQ4 A;  2R92 J;  2COB A;  1MBF A;  2W48 A;  2ID3 A;  4FE7 A;  1GDT A;  3BR6 A;  2WB1 N;  5JLW A;  3A02 A;  1GT0 C;  2GBY A;  4XRS G;  2DMQ A;  3ZOB A;  3GTO J;  1Y1V J;  5IPA A;  2JK3 A;  2AHQ A;  3BG9 A;  3QPS A;  5EDN A;  2DMN A;  3TW7 A;  1TWC J;  4B4C A;  4BKX A;  5M5W J;  5JLX A;  2L7Z A;  4M6V A;  2L7F P;  2FJ1 A;  2EH3 A;  1MBK A;  4JX6 A;  1JTY A;  4A3B J;  3PO2 J;  3HM5 A;  1TWF J;  2DA3 A;  1ZK8 A;  2XGD A;  1Z77 A;  4RBO A;  3ZQH A;  2JA7 J;  3S17 J;  1U8B A;  1FJL A;  5DTD A;  2L9R A;  3B6A A;  1JKR C;  1BJZ A;  4I76 A;  1AKH A;  3G1L A;  4UUT A;  2LD5 A;  5C4J J;  1QVT A;  3FK6 A;  4MFE A;  1ETV A;  1GV2 A;  1IRZ A;  2DA1 A;  2HXO A;  3A01 A;  1FTZ A;  5E3N A;  3FIS A;  4FIS A;  2EZH A;  5M5Y J;  1WGX A;  5K7H A;  1H89 C;  5FLM J;  2X48 A;  1AKH B;  3ZQL A;  3BR2 A;  1POG A;  2M9H A;  4V2F A;  5GPA A;  2R0Q C;  1HLV A;  4A3K J;  1LE8 B;  2R5Z A;  3K7A J;  2CJJ A;  5J1Y A;  1JT0 A;  3SDG A;  2Y31 A;  4A93 J;  1WI3 A;  3GTP J;  3HOZ J;  1VI0 A;  2VPR A;  4A3D J;  1BL0 A;  5HOD A;  2OF7 A;  1ETQ A;  1HDP A;  2LR8 A;  2KDZ A;  3PM1 A;  1JKP C;  2HYJ A;  1IDY A;  2XGE A;  2QF7 A;  2TRT A;  2XPU A;  1G2H A;  3G1O A;  4IHX A;  4I6Z A;  2B63 J;  5IYB J;  4DYC A;  4AC0 A;  1FEX A;  5J1U A;  3CDL A;  4IEJ A;  1LFB A;  5F0C A;  2M8G X;  1PUF B;  1ZR4 A;  1E3O C;  3CMY A;  1TC3 C;  3HOU J;  3O8H A;  2ZB9 A;  3B6C A;  9ANT A;  2R93 J;  5IYD J;  1IJW C;  2D5V A;  1B8I B;  1B72 A;  3LNQ A;  2M2E A;  3HKZ N;  4B3A A;  3D1N I;  4D5C A;  2HDD A;  2IEK A;  1BW5 A;  5M5X J;  4EEF G;  1O4X A;  2XPV A;  3H0G J;  3LSG A;  2JA6 J;  1B72 B;  1RPW A;  1XC5 A;  4C3H J;  1DU6 A;  2X6O A;  5EG0 B;  2YS9 A;  2NS8 A;  2EZK A;  3Q0U A;  1RR7 A;  1OJL A;  3L1P A;  3ZQF A;  2XSD C;  3A03 A;  3BQY A;  1ZR2 A;  3H3V K;  4QTR A;  1JJ8 C;  1MSF C;  1JT6 A;  2NVX J;  1GV5 A;  2FX0 A;  5F04 A;  1BA5 A;  2ID6 A;  5K7F A;  5FLV A;  4D5F A;  2HOS A;  4AYB N;  4A3M J;  3LSR A;  2R5Y B;  3GTJ J;  5FKK A;  1D5Y A;  4CYC B;  4BY1 J;  2E19 A;  3RZD J;  2AO9 A;  4UUS B;  1MH4 A;  2G0E A;  2DA7 A;  1W0T A;  3S15 J;  2ECC A;  1ETO A;  2HOA A;  3WHC A;  1UMQ A;  4C3I J;  4DZP A;  3M4O J;  3HGG A;  5F27 A;  2E2I J;  4HNV A;  1JUP A;  2H8R A; 
#chains in the Genus database with same CATH topology
 4A69 C;  5KNL A;  1DPR A;  3P5J A;  2CQN A;  5JHF A;  3HOY J;  4ANJ A;  2VJJ A;  2HVQ A;  4R1H A;  1P4X A;  3ZQQ A;  2H6C A;  3M7G A;  2GWR A;  2WAQ N;  2JVH A;  2Y48 A;  2H1K A;  1HW5 A;  1O57 A;  1ZGA A;  4LK1 F;  5IOZ A;  5EGO B;  3K4M A;  3BRO A;  3CP8 A;  1IN6 A;  3RKQ A;  2HOT A;  2VAS A;  3V7C A;  1HKQ A;  4IQJ A;  3A0H C;  3TBI A;  3Q9V A;  2DMU A;  2IVM A;  4EQQ A;  1R22 A;  2BY0 A;  1I6H J;  3KP6 A;  1FY7 A;  2KPM A;  2UUZ A;  1OPC A;  4GO1 A;  3TW6 A;  3QPH A;  4C30 A;  5E20 A;  2E5N A;  3GZ6 A;  1ZGW A;  2GA1 A;  4MEX F;  1WH5 A;  2UXX A;  3CTA A;  1MBG A;  1KU2 A;  1ONV A;  1KYW A;  1FYK A;  5J8F A;  1BW6 A;  1WJE A;  3BQZ A;  3QPT A;  2STW A;  1T33 A;  2PMZ N;  1PDN C;  3GTK J;  2FBK A;  1MNE A;  2DBB A;  2DYR H;  2HU9 A;  3HEF A;  5FJ8 J;  2G7U A;  4XLF A;  2XAU A;  1YRN B;  3FXQ A;  4CCJ A;  4EV0 A;  4XID A;  4G7O F;  5AON A;  2P81 A;  1H8A C;  2KRF A;  3ZMT A;  3HZJ A;  4BXX J;  1IGN A;  4EVI A;  2P6S A;  3RPU A;  2OCC H;  4BXF A;  4CXF A;  4OIQ F;  2B7E A;  3E6D A;  3BR0 A;  1VFC A;  2KJB A;  3DP7 A;  4W97 A;  4A0X A;  1JGG A;  4M6X A;  1WPK A;  2XVC A;  5J8C A;  4P9U A;  3JSP A;  2O61 A;  1QRY A;  3CP2 A;  4BHP A;  3D0S A;  4L9N A;  2J5O A;  2Q2E A;  5E8G A;  1T39 A;  1WH7 A;  1S7O A;  1JUS A;  4KIT B;  4PJJ A;  3ECO A;  2DQL A;  1JGS A;  1S3J A;  3LSK A;  1FLI A;  2RAE A;  2IA1 A;  5FKN A;  4PGH A;  2B9S A;  5BPI A;  1R58 A;  3KX2 A;  1IF1 A;  4QIW N;  2DMT A;  3WTX C;  3VPR A;  2OC6 A;  2YPR A;  1UAA A;  3S1Q J;  2IS4 A;  5JFR A;  3QYF A;  3BG7 A;  3Q5F A;  3L9F A;  2KLO A;  1K6O A;  2EQR A;  3K4K A;  4DBQ A;  3KIO A;  2MC3 A;  3KP4 A;  5L3C A;  2LKS A;  1JKQ C;  3PNT A;  1IO2 A;  1MSE C;  3VYR B;  4A3G J;  2IAI A;  4U0Y A;  2W82 A;  2CS3 A;  1UHM A;  2Y9Y A;  3G3Z A;  4KMU X;  4IHV A;  3IH4 A;  4DQ2 A;  4E70 A;  1UHS A;  1D0X A;  1AA7 A;  4KYW A;  1R71 A;  1RRJ A;  2HKX A;  4Y17 A;  2FUG 2;  5IY5 H;  2MLG A;  3RQ4 A;  1IV8 A;  1NK3 P;  1ETY A;  3QU3 A;  3C2B A;  3S14 J;  1OCT C;  3OIO A;  1U2W A;  2DA4 A;  1ZG5 A;  1NHA A;  2DOA A;  3I55 I;  3GBG A;  3K2A A;  3H36 A;  3ZMZ A;  2BEO A;  4JX4 A;  2CUE A;  2CRG A;  1WHU A;  2BOL A;  2HR3 A;  1BM9 A;  2EZL A;  2CO5 A;  3F22 A;  4Y7N J;  1FZP B;  1V5E A;  1R9T J;  4DGW B;  3R61 A;  3DXJ F;  1Y0N A;  2E1C A;  2XRL A;  4LIV A;  3C7J A;  5F08 A;  1TT0 A;  2J5P A;  5H20 A;  2CGP A;  1FX7 A;  3QP5 A;  1MMG A;  2QEN A;  1YHQ I;  2DJN A;  4ZYD A;  4E6K G;  1TT5 B;  4PUS A;  1Z3Y A;  4ENN A;  1P6R A;  1WI9 A;  1E17 A;  2L3D A;  5HDN A;  2GIV A;  1IRG A;  3T1B A;  3BG5 A;  1MBH A;  4KN7 X;  4BNC A;  3RI4 A;  2WA0 A;  1QPI A;  4A5M A;  3I9V 2;  4IF4 A;  1PYV A;  4XN3 A;  2LY9 A;  5B3S H;  2DTR A;  3OOU A;  3NEU A;  4CCO A;  1KQ0 A;  2DFI A;  5KHD A;  4XKV A;  1ACI A;  2OU2 A;  1R1U A;  2WB1 A;  3SXY A;  2LFB A;  3RIR A;  3ZMV A;  2VUM J;  2VKE A;  2EB7 A;  3CUQ C;  2XPW A;  4BE0 A;  4BXU A;  4WK8 F;  3DEE A;  3WOD F;  3BG3 A;  1HF0 A;  1IN4 A;  5CVV A;  4EM0 B;  3GTL J;  5CVJ A;  4U0V A;  3CC4 I;  4C9Y A;  4XNF A;  1X1B A;  4AIK A;  2F5V A;  3PO3 J;  4AID A;  4P9F A;  4RGS A;  2R3S A;  4B43 A;  5EEA A;  2XC7 A;  3HDD A;  2ZJQ F;  4MNU A;  4E7Z A;  3KYC B;  3JR9 A;  3C2G A;  2M45 A;  3M8J A;  1E2X A;  3W2W A;  1VQ6 I;  1MIJ A;  2PBI A;  4WWC A;  3HUG B;  2DK8 A;  1S6L A;  2HZD A;  2Q0O A;  4CO8 A;  2ECB A;  3I71 A;  2LTP A;  2STT A;  4AIJ A;  4B09 A;  1HDD C;  1K61 A;  2FXA A;  2CQQ A;  1ITY A;  4O3M A;  3BT9 A;  1FC3 A;  3IL2 A;  2CQX A;  1ZQ3 P;  4M6Y A;  2M0C A;  1WJ5 A;  1ETK A;  4HST A;  4I02 A;  4M72 A;  2NS7 A;  1A36 A;  3U1K A;  1HW2 A;  2CU7 A;  3FKI J;  2E2H J;  1DP3 A;  4Q5S F;  1A6I A;  5IP7 J;  1E3P A;  4BQA A;  3CD6 I;  1YIJ I;  4IHT A;  1YW9 A;  4ESB A;  4XIC A;  5FKM A;  3OYE A;  2D2W A;  2IW5 A;  4BEH B;  3VFZ A;  4L9V A;  2IXS A;  4HYE A;  1VQP I;  4PJ0 C;  5B1A H;  5DS9 A;  2PJP A;  2MBF A;  1U9O A;  4PFO A;  3OR1 C;  3LSP A;  5JR3 A;  3E3V A;  2LK2 A;  3LA7 A;  3ABT A;  2VQH A;  4RA2 A;  3HOV J;  3VYS B;  3ZQG A;  1QU3 A;  2ZXJ A;  3K6G A;  5TGT A;  2L9N A;  3E1S A;  3H5R A;  4K2E A;  2IGM A;  3I0T A;  4KIG A;  2Y0S N;  3ROU A;  4UUV A;  3FXO A;  4GRI A;  3H9G A;  3GLL A;  1VQN I;  4XMY A;  1Z21 A;  2LG4 A;  4TV7 A;  5E8I A;  4NQW A;  1FNN A;  1NTC A;  3CME I;  1X1C A;  1D8K A;  2HTS A;  1UFM A;  1XMA A;  4C2M J;  4Y52 J;  4M73 A;  1X4O A;  3MWM A;  1I50 J;  1WRJ A;  3CJN A;  1BBY A;  3VB2 A;  3CC2 I;  1N75 A;  1BC7 C;  1SAN A;  2K5C A;  1B59 A;  4U7D A;  2VI6 A;  4CDG A;  3DFG A;  1Z05 A;  2RGV A;  5GAD J;  2EZI A;  2KMU A;  5HLI A;  2VKH A;  1APL C;  5BS6 A;  1SVL A;  2GZW A;  1Y56 A;  3AG2 H;  2DA5 A;  3PIO F;  2YX7 A;  4RAG A;  2UV1 A;  2VT3 A;  2R92 J;  2COB A;  3G6E I;  2H1L A;  2JUC A;  4YIR X;  2EFW A;  3ML6 A;  5TRD A;  4UB6 C;  2JSC A;  3DBR B;  2GBY A;  3H35 A;  2L5Q A;  2HQR A;  4WXC A;  1FOY A;  3RKY A;  1P9Q C;  2P7V B;  3CZ6 A;  4BKX A;  5M5W J;  1KU3 A;  2A07 F;  2EH3 A;  5HLT A;  3TGN A;  3PO2 J;  1OKR A;  3V4G A;  1Z77 A;  1W7P D;  2W7N A;  2JA7 J;  4B8X A;  2JSP A;  3S17 J;  1FJL A;  5DTD A;  1PJR A;  4RM2 A;  3QOP A;  4YFN F;  1JKR C;  1BJZ A;  2HWV A;  2CFO A;  2KP6 A;  2HEO A;  3FK6 A;  3ULQ B;  1ETV A;  3DF8 A;  2P5L C;  2F5D A;  3IUO A;  3FIS A;  2EZH A;  1HC8 A;  2PQ8 A;  3J7Y J;  2WAQ A;  5FLM J;  2FU4 A;  2VIX A;  4M9Z A;  1YX5 A;  4A6D A;  5A2Q K;  2KRC A;  3BR2 A;  1FPQ A;  5GPA A;  1SAX A;  3H5A A;  4V2F A;  4A3K J;  4HX7 A;  1YO5 C;  1LE8 B;  3K7A J;  1ERD A;  3EUA A;  3RPQ A;  1Z7U A;  5K1Y A;  3ZPL A;  2M0M A;  5AIQ A;  5FD6 A;  3OYH A;  3BZ6 A;  3HPH A;  2PG4 A;  3RSN A;  3GEZ A;  3OYC A;  1J5Y A;  3U2R A;  4NC7 A;  5FO5 A;  4N0B A;  2DFF A;  4YIF A;  3PM1 A;  2XGE A;  1IDY A;  2GIZ A;  4M74 A;  1KYZ A;  2QF7 A;  2TRT A;  2EFP A;  5FGM A;  2MD0 A;  2JT1 A;  2PMZ A;  5D5U B;  3G1O A;  5JVG F;  3T5X A;  4I6Z A;  1D5V A;  3ZR8 X;  4DYC A;  2CW8 A;  2F4I A;  1K78 A;  4IEJ A;  4L9T A;  3S93 A;  2VN2 A;  3WGG A;  2XDV A;  1YFH A;  1TC3 C;  2KKO A;  2X6X A;  1B4A A;  3HOU J;  1Z6T A;  4JBA A;  5ILS A;  2R93 J;  5IYD J;  2NS0 A;  4CA0 A;  3HIF A;  5LHI A;  1P92 A;  2KIQ A;  3GO5 A;  2XAJ A;  3QP6 A;  1YIT I;  2ELJ A;  1Q1H A;  1YS7 A;  4D5C A;  4Q48 A;  2HDD A;  2IEK A;  2ZME A;  1L3L A;  4RB3 C;  1BW5 A;  5M5X J;  2VOP A;  4HQE A;  1IZ1 A;  3H0G J;  2JA6 J;  1EKE A;  2OCE A;  2MD5 A;  4C3H J;  2X6O A;  5EG0 B;  3QRF F;  2YS9 A;  3OWT A;  5LBQ A;  4ENJ A;  2FNA A;  4B44 A;  2ZME B;  2Q1Z B;  1VTN C;  2ZSH B;  1KQ8 A;  1RR7 A;  4N9I A;  5DD4 A;  2OAZ A;  3A03 A;  1X3Z B;  2E60 A;  2ZXH A;  3H3V K;  4QTR A;  3I59 A;  4Z2Y A;  1RI7 A;  2NVX J;  3OYA A;  1V55 H;  4YFK F;  1Z6R A;  3GUD A;  2FX0 A;  3BZC A;  3TO7 A;  3KP5 A;  2H8W A;  1BA5 A;  1IN8 A;  5FLV A;  5CJ9 A;  2XKO A;  2F4M B;  1NG6 A;  4I98 B;  3ELK A;  4Y4R A;  1ZH5 A;  4I7H A;  5DM7 F;  3WTW C;  1D5Y A;  1LEA A;  2HS5 A;  2WTE A;  2DU9 A;  2E1N A;  3RZD J;  2ZC2 A;  4XKC A;  3GF2 A;  2G0E A;  5E1Z B;  1W0T A;  3KP2 A;  2Z1D A;  1PUE E;  1XGS A;  3HOS A;  3T8R A;  4ZYA A;  1BI1 A;  1XX5 A;  3B73 A;  4ASN A;  4E4H A;  3MKZ A;  1TQI A;  5FB2 A;  4FX4 A;  4NUB A;  1GXQ A;  5CVR A;  4LLG F;  4XQF A;  2RNG A;  2KFD A;  2K9M A;  3IP4 B;  3N05 A;  4L5J A;  1SEU A;  3K10 A;  3F8C A;  2QUF A;  4RGU A;  1QNT A;  3S2H J;  3HRM A;  3E5Q A;  1FOK A;  4BJ6 C;  1WCM J;  4LD5 A;  2HTJ A;  2VKD A;  4JOM A;  3CCJ I;  1AWC A;  3M8F A;  1W7P B;  4XRF A;  4HW0 A;  1F4K A;  1F36 A;  1USS A;  3DPT A;  2IP2 A;  3ABU A;  1MMS A;  3P9C A;  1F5T A;  1OFC X;  2KHM A;  1DGW Y;  2HPM A;  2CG4 A;  1FTT A;  2GM4 A;  2Z2S B;  2I8D A;  3L2R A;  1MJ9 A;  5HLH A;  1IXS B;  3VSK A;  2JUG A;  1HBX G;  3LOC A;  2BVM A;  4MHG A;  4ESJ A;  2ZJ2 A;  4BAC A;  3HSF A;  2VBY A;  1UHW A;  2DTZ A;  3FM5 A;  4RB1 A;  3SJM A;  3DKY A;  3CCE I;  5K7Z A;  3DTE A;  3K70 D;  4RLQ A;  3WU0 A;  4FHT A;  3DTI A;  2BXY A;  2LNB A;  2DI3 A;  2M87 A;  3GYH X;  3HPG A;  2JTV A;  1R6R A;  4YRV A;  1WJF A;  2CV0 A;  3JSO A;  2M7A A;  3FZV A;  3OS0 A;  2L9S A;  2MA3 A;  3F72 A;  3K4B A;  3LA3 A;  3LQQ A;  3BZK A;  3CCV I;  1GVJ A;  1PUF A;  1G3T A;  1GUU A;  3HOT A;  5ICF A;  5LRS A;  1MJA A;  1XB4 A;  2K3P A;  3HSE A;  2ME6 A;  1LVK A;  3JRH A;  3NAU A;  4G6D A;  3FF5 A;  3SFI A;  2GXB A;  3GFM A;  1QVU A;  5HVQ C;  5GPC A;  2XUB A;  1S29 A;  1J59 A;  3QPL A;  4M3G A;  3PUB A;  1QO0 D;  1OCR H;  3S32 A;  3OIP A;  2XF6 A;  4G6Q A;  1B6A A;  3QAH A;  4XKB A;  3CLQ A;  2V7F A;  2MYS A;  2RV8 A;  1IAW A;  1I1S A;  2H6B A;  4IOC F;  3SHF A;  3KEQ A;  1FBQ A;  1HKS A;  4BE1 A;  2NAZ A;  1RKW A;  1STZ A;  1WVR A;  5LGN A;  5J3L A;  4QPO A;  2R7Q A;  3MD2 A;  1A31 A;  4OIR F;  3RPU D;  5E1X A;  1X58 A;  1SVM A;  2JA5 J;  2CH0 A;  3NWS A;  4BH9 A;  2JPC A;  3RJP A;  5KK1 A;  4RMN A;  3SFZ A;  1D0Y A;  5DV5 A;  2IS2 A;  2P7C B;  2ELK A;  2DA2 A;  3IHU A;  2IBD A;  4F93 B;  2LBF A;  4A5N A;  2M8E A;  1R5H A;  2CMP A;  4M3E A;  3E6C C;  4RAY A;  4EM2 A;  4QWQ A;  2YX4 A;  4UUS A;  2Y30 A;  4ZTJ A;  3MKL A;  4BL0 B;  4S05 A;  3DU5 A;  3P9K A;  4BBR J;  3P9I A;  4X1E A;  5HNF A;  5DCM A;  2K40 A;  5HS8 A;  4A3I J;  1RET A;  2Y0S A;  4IQ4 A;  1R36 A;  2VC1 A;  3H0D A;  5EYR A;  3TED A;  3R4K A;  3FKJ A;  3E97 A;  1MDM A;  3TOB A;  1FT9 A;  2L9V A;  3DEU A;  2KRH A;  3RYR A;  4BYY A;  4OAY A;  1IW7 F;  2H94 A;  3HRS A;  4LK0 F;  1JTX A;  4FET A;  4XOT A;  5ILU A;  3C2H A;  4YEJ A;  5EGO A;  5LD2 C;  1LJ9 A;  1MDM B;  2DPD A;  1TBX A;  2QYO A;  3BJO A;  3GFI A;  2RN7 A;  2LKX A;  2X0L A;  2V6E A;  1RC9 A;  3KYL A;  1FIP A;  3TL4 X;  1JXS A;  5ICE A;  5FLX Z;  3RCO A;  3PSI A;  3EDP A;  3FMQ A;  1XG1 A;  4RS8 A;  2CQ7 A;  2ACJ A;  4C2U A;  2AQF A;  4A2U A;  3FXK A;  4CCK A;  4JX5 A;  5HDG A;  3FDY A;  3D5L A;  1H9T A;  1NK2 P;  4A3C J;  1T6S A;  1B9N A;  2OBP A;  3JRD A;  3A2K A;  1BR1 A;  1Z1D A;  2JA2 A;  2EA2 A;  2EIL H;  3ESW B;  1WJA A;  3L2U A;  1KGS A;  1MZB A;  1J9I A;  2X9D A;  1XSD A;  1TWG J;  1W5S A;  4IXA A;  2HQ5 A;  1YRN A;  2F4O B;  3I4N J;  5ICG A;  1W4M A;  3WU1 B;  1U0J A;  2VBW A;  1K6Y A;  2YUS A;  2Y9Z A;  2EBI A;  1OCZ H;  1BN5 A;  1R49 A;  1ETX A;  1O3Q A;  2DJI A;  2OUM A;  4A3F J;  4Z6Y A;  3J7Z I;  1FYL A;  1FSH A;  3KZY A;  5F6F A;  1K7A A;  4X6A J;  4KNY A;  1OYW A;  4GXO A;  3BR1 A;  3HGY A;  2HGC A;  1G6N A;  3BCA A;  1R23 A;  3KZZ A;  4ZYH A;  1Y1W J;  2XKP A;  1MJB A;  3MVP A;  5TJJ A;  4G7H F;  2XRO A;  3CJR B;  2E1M B;  4DBR A;  4BDY A;  3S1R J;  2ZJR F;  1YG2 A;  1XCB A;  3DBL B;  4DW6 A;  2QSF X;  1REP C;  2Y75 A;  3BWG A;  2F48 A;  4E7K A;  3WU2 C;  4HPQ A;  3I4M J;  5K5O A;  3CCL I;  1IDZ A;  2CV2 A;  5IYC J;  1IN5 A;  4IRH A;  3OSF A;  3BTI A;  5J4V A;  1G3W A;  4CZC A;  2DW4 A;  2DK5 A;  5LLQ A;  2VBX A;  4BJT A;  2HOE A;  3Q0V A;  3J80 K;  2NVY J;  5H6R A;  3HOW J;  1BOA A;  3ERM A;  3K4L A;  5BPD A;  4Y15 A;  4W1U A;  3ZN0 A;  2D45 A;  3H1C A;  4HX8 A;  3ASN H;  3OOP A;  1OCP A;  3L2Q A;  1FSE A;  3S8P A;  2BBY A;  4ZJZ A;  3HJE A;  3K69 A;  3K1M A;  1YJW I;  1LUJ B;  2F5C A;  3CCQ I;  4ETS A;  2FE3 A;  4IHY A;  1XMX A;  2A61 A;  3ZMD A;  3H3Z A;  4AD9 A;  2V9P A;  1DUX C;  3F3X A;  2MG4 A;  5CVI A;  2E2J J;  3RQI A;  1X4P A;  2LRD A;  4E7H A;  2HYF A;  4ZDO A;  3RYP A;  1SD6 A;  2LVS A;  4MFD A;  1RUO A;  2MH2 A;  4F3Q A;  1MBF A;  4ZYG A;  3DTK A;  4LMY A;  3TDU C;  1FWZ A;  1OMI A;  3FMS A;  2EK5 A;  4FE7 A;  3OYD A;  3BR6 A;  1W36 C;  4EGZ A;  2O5R A;  5FLX K;  3A02 A;  1G4D A;  1N78 A;  2DMQ A;  3ZOB A;  1EJ9 A;  5IPA A;  2JK3 A;  4S04 A;  2Z16 A;  2M7B A;  3QPS A;  4F91 B;  1SFK A;  2DYS H;  2DMN A;  2KDO A;  3FBI B;  3TW7 A;  1ZRE A;  3BC8 A;  4M6V A;  2R4G A;  2L7F P;  1XN7 A;  4R79 A;  2DOD A;  1MBK A;  1JTY A;  1JHH A;  3E6B A;  2IGO A;  3KPH A;  1VZ0 A;  1YOV B;  1WJD A;  4II3 A;  3SEQ A;  2DA3 A;  1ZK8 A;  2XGD A;  3ZQH A;  3LA2 A;  2JQ7 A;  2L01 A;  1RUN A;  4I76 A;  4EJV A;  1AKH A;  3MKY B;  2WY7 Q;  2JVG A;  4UUT A;  3R6S A;  5C4J J;  2K7L A;  4HLX A;  2PEX A;  5EEG A;  5KVR A;  2DA1 A;  2HXO A;  3G4S I;  3GZN B;  5A2Q Z;  4MTD A;  1OIS A;  3I64 A;  2VQC A;  5M5Y J;  1WGX A;  1AKH B;  2YU3 A;  4PSX A;  2R7U A;  3HUG A;  4Y13 A;  2ZFU A;  3ZQL A;  3KZI C;  4MQV A;  2M9H A;  4LG0 B;  2R0Q C;  1LEB A;  4AVZ A;  3M1C A;  3N4M A;  4AVP A;  4KT6 A;  3VSL A;  4OMY A;  3ZP5 A;  5J1Y A;  1JT0 A;  3SDG A;  3S3N A;  5EJC A;  3K4N A;  3GVA A;  2JZY A;  2PN6 A;  4BGD A;  1VI0 A;  1XSV A;  3M9A A;  2O3F A;  3LSI A;  1ZEL A;  4XLH A;  1A35 A;  1G59 A;  2VE9 A;  4KIB A;  2CYY A;  3HTU A;  1X3W B;  2KDZ A;  2HYJ A;  3VOD A;  4BEH A;  2IGN A;  1SC7 A;  3BY6 A;  1OR7 C;  3ZRG A;  4IHX A;  5EEH A;  3WTZ A;  5IYB J;  1VQ4 I;  5FFX A;  2B63 J;  2R7F A;  1YYV A;  2ZCW A;  3CDL A;  1LQ1 A;  1SD4 A;  4HV6 A;  2XF7 A;  2M8G X;  2XIG A;  1R1T A;  4WX9 A;  4CIC A;  1ZR4 A;  1E3O C;  3O8H A;  4UVB A;  2VB6 A;  1IJW C;  4OIP F;  4EJW A;  3L2V A;  1B8I B;  1B72 A;  5LHG A;  2X1C A;  1S5L C;  2XAH A;  3D1N I;  2QM3 A;  3O6B B;  3LFU A;  3LSM A;  2VJ5 A;  3D5S C;  4PJL A;  3PUF A;  2W4S A;  4RB2 C;  1P2F A;  5IT9 K;  1J2X A;  2P5V A;  2VBZ A;  3ISP A;  4PK4 A;  4EMS A;  1O4X A;  1B72 B;  2RDP A;  5B1B H;  1XC5 A;  4XLN F;  4L0Y B;  2EV5 A;  3FXU A;  4BS9 A;  2EZK A;  3Q0U A;  3L1P A;  2FMY A;  2XSD C;  2W1O A;  1U5T B;  4UB8 C;  3SDB A;  1JT6 A;  1KQ9 A;  4LIU A;  4XOP A;  1VQL I;  3HG9 A;  3EUH C;  1JI8 A;  1QZE A;  2BW3 B;  2HDW A;  1WJB A;  5F04 A;  1V5F A;  4UV8 A;  4LGW A;  3F21 A;  2VOD A;  3F8F A;  4HA8 A;  2RQP A;  1IUY A;  1OR7 A;  2R5Y B;  2OTL I;  3LL7 A;  5FKK A;  2L4M A;  3IWZ A;  3J81 K;  3JCU C;  4AU7 A;  4HSR A;  4CYC B;  2QWW A;  1LB2 A;  4AWX B;  1XSX A;  3EPZ A;  2AO9 A;  2QQA A;  2DDB A;  1MH4 A;  4DIQ A;  1TQM A;  1BR4 A;  3S15 J;  1EH8 A;  2ECC A;  5ED4 A;  1MMN A;  2HOA A;  5JI6 A;  1UZC A;  4DZP A;  2R7S A;  4HDU A;  3T8T A;  3WGH A;  4YG2 F;  3MKW B;  4J01 A;  3RKW A;  1I5Z A;  1JUP A;  4UV9 A;  1Z91 A;  1I3A A;  5CYV A;  2H8R A;  2WAD A;  3IKV A;  1HOM A;  3NRV A;  2AXL A;  1PP7 U;  1TLH B;  3CJQ B;  2YR2 A;  1D3Y A;  4FTH A;  1BR2 A;  1GVD A;  3L7W A;  1ZAR A;  3S1N J;  1WJC A;  1MBJ A;  3FXR A;  3EUH A;  2VE8 A;  5BOX A;  3EQL F;  2QA4 I;  1X2M A;  4XON A;  5C44 J;  2V26 A;  3GTQ J;  3MZ8 A;  2EIJ H;  1LE8 A;  2ZME C;  3W2A A;  4C2T A;  1TW2 A;  4IRI A;  2N8G A;  1QGP A;  2EA4 A;  3CCU I;  1A6Q A;  4X0G A;  4HF2 A;  4L9J A;  5M3M J;  5BMZ A;  2VXD A;  4M71 A;  4ZDL A;  2JRT A;  4WCG A;  1BI3 A;  3FIW A;  2RC4 A;  1XS9 A;  2X1E A;  2FNP A;  5KCM A;  4UHT A;  4XL9 A;  2CW7 A;  3VWB A;  4KIS A;  2LMD A;  4WXH A;  1JUM A;  1SVO A;  3IWF A;  4E7I A;  5GTH C;  3M3Y J;  2NXN B;  1VQM I;  2QLZ A;  2VQL A;  3U21 A;  4DYQ A;  5D6E A;  5DYM A;  3G73 A;  3PJR A;  2V1N A;  4MO7 A;  2HI3 A;  3GX4 X;  2CQK A;  3EUK L;  2DA6 A;  1ENH A;  4IRG A;  4ZZD A;  4LLN A;  3F9K A;  3O8G A;  3M1E A;  5HS7 A;  3ECH A;  1QBJ A;  4IZZ A;  4XBF A;  4BQN A;  1C0W A;  4BHB A;  2QBY B;  2MFZ A;  2XF5 A;  5EG0 A;  1FOX A;  3BPX A;  2EV0 A;  3JRF A;  1MBE A;  4GDF A;  1O3S A;  2JJ7 A;  2LH9 A;  3BTJ A;  3V8L A;  1D1B A;  4DZJ A;  3H92 A;  1O7F A;  4XKW A;  1O3T A;  4RGR A;  2AS5 F;  1Y8R B;  1BI2 A;  1S7E A;  3KP7 A;  5IP6 A;  1V54 H;  4HOB A;  2A6T A;  2L7M P;  3ASO H;  3D5R C;  4I01 A;  2KIM A;  3KEO A;  5GP9 A;  3V8K A;  3FXM A;  3SEZ A;  3JTH A;  2HFH A;  3VDX A;  4CCN A;  1TTY A;  3TOA A;  1RIO H;  2H27 A;  2ISZ A;  1W5C C;  2V4J C;  5CPR B;  2HYG D;  2RRE A;  3DWL E;  3EYI A;  1LDJ A;  1VF9 A;  2YU9 J;  2L4A A;  3JRA A;  2WC2 A;  4BY7 J;  1XGO A;  5J6X A;  3MZH A;  4IX7 A;  1XGN A;  1DQU A;  5IP9 J;  2JWT A;  2ZFW A;  2E36 A;  4ZYE A;  5CVU A;  4M3F A;  1Z3X A;  2R7W A;  2A5W A;  2DT6 A;  3OYL A;  4OWR B;  4LJZ F;  4AUX A;  1K83 J;  3LSJ A;  1WQ2 A;  2PX9 A;  3HYI A;  3KE2 A;  5K5R A;  1H0M A;  1JKO C;  1EF4 A;  1LDK B;  1R5I D;  1SFX A;  2VOO A;  3TP0 A;  1I27 A;  1X19 A;  2FQ3 A;  4H0E A;  1S9H A;  4A3E J;  5F1J A;  2OQR A;  2E34 A;  4DYR A;  4HDV A;  1XCV A;  1I39 A;  1BOB A;  1O3R A;  2G9W A;  3LFK A;  2K4J A;  1T56 A;  2P8T A;  3R0A A;  1ON1 A;  4XOR A;  4D7N A;  4ZZL A;  1I1G A;  3JRI A;  2XRN A;  1GXP A;  3HL2 A;  1V3F A;  1W7P A;  4MEY F;  3CCM I;  2KIF A;  3S2D J;  2PMH A;  5CQE A;  4ENK A;  2ZXI A;  3PNY A;  3JRC A;  1R1V A;  2F5F A;  2VL8 A;  1QQI A;  1VND A;  2A6E F;  4JP0 A;  3X2Q H;  4CHU A;  2OA4 A;  5J4Y A;  4NB5 A;  4BHC A;  1U78 A;  2LC2 A;  3JTG A;  1TQP A;  1IRX A;  2W84 A;  1CGP A;  1IV6 A;  2LDU A;  2FD5 A;  2UXN A;  2LP0 A;  2Y69 H;  3GXO A;  3WG9 A;  1AOY A;  1ULY A;  2K9L A;  2LY1 A;  4P96 A;  4IL6 C;  3CDI A;  3PL8 A;  4G6T B;  1D0Z A;  4BE2 A;  3W2V A;  1H88 C;  2NYX A;  4FQG A;  1ZGJ A;  4XLA A;  4V2G A;  5EZG A;  2M30 A;  2R7R A;  2IS6 A;  1B9M A;  3CF2 A;  1EV7 A;  1FP2 A;  1YW8 A;  1ZKG A;  2V1X A;  2L0K A;  4XLC A;  3LAJ A;  2DN0 A;  3B02 A;  3CCR I;  1T08 B;  3JRE A;  3CO7 C;  3F8N A;  3TQN A;  5KAI C;  1PVE A;  4C3J J;  2IGK A;  5AIP A;  1UB9 A;  2NVT J;  2ZNZ A;  3TDZ C;  2FSW A;  5L3D A;  2KT0 A;  1U8R A;  4KUM A;  5E3O A;  1HCR A;  2O8K A;  1F43 A;  3F23 A;  1UEL B;  3GFJ A;  3ERE D;  1J0R A;  3K0L A;  3Q0W A;  3MCZ A;  3F8M A;  3GLX A;  3C3W A;  4MLO A;  1EH6 A;  1Z0X A;  2HXI A;  3A01 B;  1X2N A;  3NWT A;  4I99 C;  2W24 A;  2IJL A;  2Z3Y A;  2PJR B;  2GXA A;  2Z5U A;  2K02 A;  3IH2 A;  5CQG A;  1WKM A;  3CCY A;  1W0U A;  3OR2 C;  4N4N B;  1DU0 A;  3OYI A;  2R5Z B;  3GTG J;  3CLO A;  5BNG A;  3AL0 B;  3UNG C;  2CFX A;  1ZAO A;  4HEA 2;  1BC8 C;  2DPU A;  4QLC U;  4ZH4 F;  1K79 A;  1HKT A;  2NOG A;  4B3X A;  2O7O A;  4JYK A;  3WTU C;  2LRE A;  4KFC A;  3O2P E;  5L3B A;  1FIA A;  4XN0 A;  5ICC A;  1S7A A;  4CYD A;  3E7L A;  1NH3 A;  3ZQC A;  2NNY A;  2V79 A;  1T2K A;  2DT5 A;  5BQT A;  2MW8 A;  5FRO A;  4P55 A;  4BDZ A;  2EV6 A;  3HRU A;  2XHK A;  2OZ6 A;  2EPF A;  3QU6 A;  2ZSI B;  2BY2 A;  3AG1 H;  3N97 A;  3J80 Z;  3RZO J;  2VJ4 A;  2BV6 A;  3BR3 A;  1MMA A;  4PJM A;  4CGZ A;  1HST A;  2BY1 A;  3KET A;  2ESN A;  1BJA A;  3TP3 A;  5ILV A;  4ITV A;  4CCM A;  5FRN A;  4IKF A;  2AXT C;  2DO7 A;  2F6C A;  4XLE A;  3RDI A;  3QYB A;  3S16 J;  1IN7 A;  4R8H A;  3L2W A;  1RKT A;  3CES A;  2QSG X;  1LFP A;  1ORK A;  3OIQ A;  3UKG A;  1N77 A;  4MGR A;  1LVA A;  2VC0 A;  3G1M A;  3CJT B;  3DEW A;  3V7S A;  4A0Y A;  4KN4 X;  5E3M A;  2UZK A;  4ABZ A;  2QCO A;  2XB5 A;  3WHB A;  3CMM A;  2QSH X;  2X51 A;  3L09 A;  4XRS A;  3BLY A;  3FX3 A;  1FOW A;  1VQ7 I;  2VT2 A;  3S3M A;  2NOJ B;  3PFI A;  2P6T A;  5D8L B;  3AG4 H;  3DPL C;  3HB9 A;  1QA6 A;  2M34 A;  2HDC A;  5DD8 A;  2OTJ I;  5IT3 A;  1IUF A;  5M3F J;  1T95 A;  1S72 I;  3BG6 A;  1D1C A;  2B0L A;  2MLK A;  2V9K A;  4RLF A;  1IC8 A;  4J19 A;  2XGC A;  1ZHF A;  2E1M C;  3F0C A;  5IOY A;  2D1H A;  2FQ4 A;  3ABK H;  4EJO A;  3C1D A;  4O5V A;  2W48 A;  4HLY A;  2IRF G;  4PFP A;  4V19 K;  1QHH D;  1SD5 A;  4GYI A;  4XRS G;  3GTO J;  1Y1V J;  2ZKZ A;  3O3K A;  2AHQ A;  1JHF A;  5D5X B;  1U6G A;  4PJN A;  3H3U A;  5JLX A;  2L7Z A;  2A5Y B;  4EJU A;  3GFL A;  4A12 A;  1W5T A;  2FJ1 A;  2PLY A;  4JX6 A;  1HSJ A;  4RB0 A;  4G8X A;  3RTR A;  2WV0 A;  1TWF J;  2QKL B;  3PNV A;  2X6W A;  4HG2 A;  1YIO A;  4DOZ A;  2YSR A;  5HDK A;  2X1D A;  5GAG J;  5E1W A;  3HC7 A;  3B6A A;  4BQO A;  4OMZ A;  1IXC A;  2RVC A;  2W00 A;  3G1L A;  3MZY A;  4B48 A;  5DM6 F;  1YS6 A;  1OQY A;  3BDD A;  1GV2 A;  2HPI A;  3AAF A;  1MW7 A;  4M9S A;  1RZ4 A;  4F7Z A;  2E35 A;  5E3N A;  1ZRF A;  2G7H A;  2WAE A;  4G7Z F;  1H89 C;  2X48 A;  1DDN A;  4AM3 A;  3KEY A;  3M07 A;  3OMY A;  3C18 A;  3OYK A;  4KIF A;  4LFU A;  2CJJ A;  3COA C;  2Y31 A;  2V1U A;  4A93 J;  2GQQ A;  2EFO A;  1X1P A;  1TNT A;  5FFZ A;  3GTP J;  3HOZ J;  4HRI A;  1T0F C;  1HA8 A;  5HOD A;  2M1B A;  1X1D A;  2H09 A;  2LR8 A;  2EFQ A;  3SZT A;  2FRH A;  1KU9 A;  1JKP C;  2DFE A;  4IVN A;  2IPQ X;  1T8I A;  4F92 B;  3ZN1 A;  3I58 A;  5HS9 A;  4HNT A;  1D8J A;  4XM3 A;  3RKX A;  1KA8 A;  5J1U A;  2OZU A;  1QZZ A;  5F0C A;  1O7L A;  2VQG A;  3U1D A;  2V1D A;  1R5G A;  9ANT A;  3OYM A;  5DCF A;  1ZLJ A;  2LF7 A;  4L5I A;  3BOQ A;  3T0Y A;  3HHH A;  4I09 A;  5TIS C;  3HKZ N;  2DDA A;  3IAS 2;  5DUK A;  4HNU A;  2DCE A;  1W36 D;  5IT9 Z;  2Q2E B;  1PP8 F;  3SZP A;  2Q8K A;  1FMV A;  5HOO A;  3LSG A;  4NBQ A;  1DU6 A;  1DGR M;  2LSO A;  5GAE J;  4BAY A;  3V42 A;  3MQ0 A;  1E0E A;  4ZC3 A;  1OJL A;  2E7X A;  3ZQF A;  2QZ8 A;  2R7X A;  2IA2 A;  4PGG A;  2D1V A;  3SYT A;  4OAZ A;  1ZR2 A;  3KFW X;  1GLN A;  1T0F A;  1JJ8 C;  1SAU A;  1MSF C;  5L3G A;  3DLL F;  3WE2 A;  3OYN A;  1GV5 A;  2L2O A;  2A05 A;  4JQF A;  3K4J A;  1H9G A;  5F64 A;  3AFH A;  2FML A;  2DT7 B;  5K7F A;  1LDD A;  4D5F A;  2HOS A;  4HF0 A;  4AYB N;  3J81 Z;  2OJE D;  3LSR A;  2XV4 S;  2DAO A;  3LSH A;  3PQK A;  4EM1 A;  2BGC A;  4A6E A;  3AG3 H;  3KYD B;  2F5E A;  1J09 A;  1VQK I;  3OL4 A;  4BY1 J;  2CW0 F;  4EJT A;  4PDK A;  3OS2 A;  1OCO H;  5H6Q A;  5CKT A;  3WE3 A;  2XSJ C;  3OYB A;  4YFX F;  3VEP A;  2KQR A;  4Y33 A;  1G8X A;  3CCS I;  3BJA A;  2K86 A;  4XSX F;  1FBU A;  4FT8 A;  2VLA A;  3TO9 A;  1ZG1 A;  3CO6 C;  4C3I J;  2PFB A;  3BJ6 A;  1XGM A;  2HQN A;  2CV1 A;  2BZT A;  4IJA A;  2KL4 A;  3HGG A;  3MMY B;  1R4M B;  1K4S A;  5F27 A;  2E2I J;  4KT5 C;  4B47 A;  5LGU A;  4G12 A;  2ZO4 A;  2L02 A;  2XGX A;  2GLO A;  2BE5 F;  1P7I A;  4OIO F;  1SD7 A;  5F0H A;  3JRB A;  2ZXW H;  4WF2 A;  1KU7 A;  3CMA I;  3ZQ7 A;  4Q47 A;  2VJI A;  4NNJ A;  2K3F A;  5B66 C;  4N9H A;  2XAQ A;  3A0B C;  1M1E B;  4LG0 A;  4HQM A;  5DUI A;  2CSO A;  2FBI A;  1HW1 A;  1AHD P;  1YJN I;  5E18 F;  1ZTR A;  3FXJ A;  3G2B A;  1U5T C;  1U9N A;  1YE9 A;  1Z67 A;  5F0F A;  5D5V B;  4DJA A;  1W1W E;  2WAF A;  3BR5 A;  1X1A A;  3GME A;  1OYI A;  2K9Q A;  3KP3 A;  3H9J A;  1RR8 C;  4FCY A;  5DEQ A;  1TWA J;  4AIH A;  1MND A;  3E5X A;  3VOE A;  3GW2 A;  3S3O A;  4CH7 A;  3HBL A;  4E7J A;  3PSF A;  3VYU B;  2XAF A;  3TKY A;  3I3L A;  3FK7 A;  1QHG A;  3Q3S A;  3L2C A;  5H2F C;  2Z33 A;  4CUG A;  2KIS A;  3VYT B;  3QOE A;  4MIM A;  1Q1V A;  1L0O C;  3W6K B;  1A5J A;  1CF7 A;  4BBS J;  4O6J A;  1B8I A;  2M4G A;  5CLS A;  1V5G A;  4XSZ F;  5F1R A;  1I6X A;  3UR3 C;  2OV7 A;  4BUP A;  2XB0 X;  2E7W A;  1UCR A;  2O03 A;  1CF7 B;  1LFU P;  3QQA A;  2GA2 A;  2V6C A;  2Y2Z A;  1XD7 A;  3DLA A;  3IAM 2;  2KIU A;  2NVU B;  2ME0 A;  4S0H B;  2ZBK A;  1MD0 A;  1I3Q J;  3ZGK A;  2MSY A;  3V7R A;  1OCC H;  2NVQ J;  3I54 A;  2VON A;  1U5T A;  3L00 A;  3MN2 A;  3WTV C;  1EH7 A;  3QWL A;  3ZQI A;  2OPT A;  4PCQ A;  3CUQ A;  2JRM A;  5K5Q A;  5EZH A;  1J7K A;  2BW3 A;  5J1R A;  2W25 A;  5EF6 A;  3IRR A;  3HXL A;  1ETW A;  2V9V A;  1HXD A;  2E5Z A;  3H5N A;  1TP4 A;  3DPU A;  1XTA A;  2CUF A;  1GHC A;  3CUQ B;  2Z99 A;  4YEL A;  2R5Y A;  1OLT A;  2DXI A;  2OQG A;  4A3L J;  3OY9 A;  2HKO A;  4CYC A;  1OYY A;  2E1O A;  3I53 A;  5E79 C;  5LFA A;  2RKH A;  2FA5 A;  5FKO A;  1IG7 A;  2A68 F;  3WG7 H;  4ESF A;  3OSG A;  5ERI A;  1FYM A;  3P7N A;  5FRM A;  4NQW B;  4GCV A;  4M3D A;  2R7V A;  5HLG A;  2F2E A;  2FEZ A;  3GZ5 A;  2Z9O A;  3W6V A;  4E7L A;  1QPM A;  4QSH A;  4HV5 A;  3LAP A;  3F6O A;  2TCT A;  1R4N B;  3W3C A;  1MNM C;  3DKX A;  1YI2 I;  1MGT A;  1SMY F;  2GOX B;  3F8B A;  2XAS A;  1RES A;  3JRG A;  2DLL A;  3LWF A;  2IS1 A;  3R0J A;  5E3L A;  3IC7 A;  4WXD A;  3ABM H;  2DOF A;  4OU0 A;  4HAM A;  1YJ9 I;  4UXN A;  3BCB A;  5GTI C;  3HOX J;  3CUO A;  2WBM A;  4YII A;  4IO9 F;  2ZJP F;  5GAH J;  1VQO I;  1Y8Q B;  2X85 A;  2CWE A;  2K9N A;  1G3S A;  4NDL A;  1JJ6 C;  1ZYR F;  4LLL A;  2KZV A;  1XDU A;  5FD5 A;  3DU6 A;  3TO6 A;  5LEJ A;  4EAT A;  1V4R A;  2JMW A;  1ZN2 A;  4MQ9 F;  3WTY C;  4Q4Z F;  1TL8 A;  3DCF A;  2EIK H;  3FM3 A;  4L5E A;  1TWH J;  1BI0 A;  4D7M A;  1XDS A;  1WFX A;  4ON0 A;  2BHZ A;  3BTC A;  2RQQ A;  3H9Q A;  1T38 A;  1Z7L A;  2LOO A;  2LLK A;  4DNC A;  1Y0U A;  1ZRC A;  2O0Y A;  5LHH A;  4B1R A;  1KZH A;  1LPQ A;  2RNJ A;  2VXZ A;  4A3J J;  4GFB A;  3S1M J;  4Y3O A;  3ZCO A;  2ZNY A;  1UG2 A;  2A3S A;  4RDU A;  3GTM J;  3WTS C;  1UST A;  2GXG A;  1ON2 A;  2I10 A;  1XMK A;  3V8J A;  5B5E C;  3I56 I;  3OYF A;  4FAS D;  3E5U A;  2VKV A;  3DKW A;  3OYJ A;  4OOI A;  2MH9 A;  4N4O B;  1SMT A;  4IHW A;  3IRQ A;  3BPV A;  3PQJ A;  2QBY A;  4I0A A;  2EIM H;  3J7A Y;  1N25 A;  1FBS A;  3LMM A;  3OV8 A;  4D1Q A;  3FMR A;  4OIN F;  2W57 A;  3NAR A;  4G94 A;  4M3B A;  5L3E A;  2ETH A;  4KIC A;  3WGI A;  5FKL A;  2NRA C;  1S8N A;  2DQR A;  4HX4 A;  4NHJ A;  2WV1 A;  3JAM Z;  3DV8 A;  3DQV C;  2M5W A;  4I0B A;  3U9G A;  3CQZ J;  1QZY A;  2GAU A;  4BJ5 C;  1K4T A;  4RGX A;  1FMW A;  1KON A;  1IRF A;  1E3H A;  1TZL A;  3KCC A;  4H4K C;  2I5U A;  2PI0 A;  4M9X A;  3HHG A;  2P0W A;  2AQE A;  4FX0 A;  3PIP F;  1A04 A;  2LKP A;  3QYE A;  4ZTF A;  1YQA A;  4KMF A;  1HQC A;  1CQT A;  2MGQ A;  1SFE A;  4CSW A;  1MMD A;  2EIN H;  4XRM A;  2O6G E;  1K78 B;  2ISY A;  2IT0 A;  3FWE A;  4NC8 A;  5DDG A;  2OD5 A;  1LKX A;  2LF8 A;  5D4S A;  1AU7 A;  2E71 A;  1MH3 A;  5C3E J;  2HVS A;  2BHY A;  2IA0 A;  4RM3 A;  1SFO J;  3MEX A;  1DPU A;  4IOA F;  3LQR A;  5HNH A;  5E17 F;  4UVA A;  4XK4 A;  3IH3 A;  3R60 A;  2K9S A;  2R7Z J;  3IV5 A;  2O9L A;  1NG7 A;  1YX3 A;  1Y39 A;  1UJ8 A;  2Y0M A;  1ZRD A;  1T98 A;  3HKZ A;  2JA8 J;  3PFY A;  3BTL A;  2WY8 Q;  2EWN A;  4LOC A;  1RNL A;  5C4X J;  1P7J A;  1X3U A;  2HQA A;  4GGG A;  4LB5 A;  1B1B A;  4HZF A;  3K1P A;  4UNO A;  2JN6 A;  4FE4 A;  2A69 F;  2VPL A;  3I59 B;  2R7D A;  1J75 A;  2JPB A;  2K85 A;  2DMP A;  3FHN A;  2KZG A;  3ZXS A;  3FBN B;  3AKZ A;  5L3F A;  3OYG A;  5D5W B;  1P4W A;  4U88 A;  5JVT A;  4PSW A;  3K9T A;  1F1Z A;  1ZG3 A;  1YW7 A;  2HZT A;  2ADU A;  2FF4 A;  4LB6 B;  3AL0 C;  1VQ8 I;  2ID3 A;  3CDH A;  3G71 I;  1GDT A;  6PAX A;  2BY3 A;  1R00 A;  2DFH A;  2FBH A;  2WB1 N;  5JLW A;  4AYB A;  1GT0 C;  4I2O A;  4XLP F;  2LY2 A;  2WWY A;  2HNH A;  2X6Y A;  1YTY A;  1Z9C A;  4J00 A;  1VQ5 I;  2W85 A;  3BG9 A;  5EDN A;  4LIT A;  3IKT A;  1TWC J;  4B4C A;  4XR6 A;  2L7K A;  3EET A;  1BIA A;  2EFN A;  4L18 B;  3FXL A;  4A3B J;  2A6H F;  2K27 A;  1UG0 A;  3ONQ A;  3OL3 A;  3HM5 A;  3TMO A;  1WZ2 A;  4U7B A;  3EYY A;  2ESH A;  2XAG A;  2MAB A;  4RBO A;  2PMU A;  4U0W A;  1IXR C;  3FHZ A;  4A0Z A;  2P5K A;  2ELH A;  1U8B A;  2L9R A;  2BYV E;  4PZJ A;  3F6V A;  2HVR A;  2LD5 A;  1VQ9 I;  2FOK A;  1QVT A;  1Y6I A;  4CCL A;  4MFE A;  1ODD A;  3JW4 A;  3E6M A;  1IRZ A;  3KLO A;  3A01 A;  3CC7 I;  3NQO A;  3K2Z A;  1FTZ A;  4FIS A;  4UVC A;  5K7H A;  3BP8 A;  3MAJ A;  3HRT A;  3A1Y A;  2PJR A;  1POG A;  4BQQ A;  1G3Y A;  3ABL H;  1HLV A;  3ZMU A;  3E0J B;  2R5Z A;  1DP7 P;  1TW3 A;  3LST A;  2BXZ A;  4G9Y A;  4II2 A;  4KA4 A;  1ZLK A;  3HTS B;  1WI3 A;  2EJR A;  2GOM A;  2VPR A;  1D1A A;  1BIB A;  4A3D J;  1BL0 A;  2OF7 A;  2NNN A;  3I5U A;  1ETQ A;  1HDP A;  3GCM A;  2M3A A;  3CF5 F;  2UWM A;  2O8X A;  2P4W A;  5LRR A;  1P4A A;  3I4P A;  3DBH B;  2XPU A;  2QGU A;  4RAF A;  3JAM K;  1G2H A;  5JHU A;  2ICW G;  3S2W A;  2QKM B;  4F52 A;  4EGY A;  1U3E M;  1FP1 D;  4AC0 A;  1FEX A;  1LFB A;  3MFK A;  4RAZ A;  1PUF B;  3GWZ A;  2CUJ A;  3K1N A;  4BU2 A;  4P5O A;  1MKM A;  2QQ8 A;  3CMY A;  3ZMS A;  3SQN A;  2ZB9 A;  3B6C A;  2QQB A;  4P1W A;  1SFU A;  2D5V A;  2TDX A;  3LNQ A;  2M2E A;  2R7T A;  1WWX A;  4B3A A;  1YLF A;  2COM A;  2X4H A;  5D6F A;  4D0P A;  4QPQ A;  2L54 A;  4JK1 X;  3QOD A;  3K4C A;  4EEF G;  2XPV A;  3SZG A;  1RPW A;  3K70 C;  2MC4 A;  1LNW A;  2NS8 A;  4D9J A;  3BQY A;  1XPX A;  4UY8 I;  4ENM A;  2K4B A;  2QQ9 A;  3OS1 A;  2QEX I;  5J40 A;  1TNS A;  2FOW A;  1F9N A;  5J47 A;  4HF1 A;  5KAF C;  3M8E A;  2BVL A;  3A4C A;  3KLN A;  3WTT C;  4GYG A;  4U87 A;  2ID6 A;  3J7A O;  1EA3 A;  3REO A;  4A3M J;  4ZDP A;  3GTJ J;  4IHS A;  4KJZ A;  1R7J A;  2LBF B;  4HBL A;  2E19 A;  2M4K A;  4NC6 A;  1WSU A;  4CZZ A;  3W6J B;  4UUS B;  5LGT A;  2KJC A;  2DA7 A;  1ETO A;  3WHC A;  1JE8 A;  1UMQ A;  2LYC A;  5DCM B;  4KDP A;  2CUZ A;  2C6Y A;  4MTE A;  2QVO A;  2DOE A;  4IPA A;  2R7O A;  4F55 A;  3M4O J;  4L0Z B;  4HNV A;  3HSR A;  4LG3 A;  4E7S A;  5D8K B;  5D4R A;  3Q9S A;  5LEK A; 
#chains in the Genus database with same CATH homology
 1HOM A;  4A69 C;  3S2H J;  4G12 A;  3HOY J;  1WCM J;  2GLO A;  2WAQ N;  1P7I A;  2H1K A;  5IOZ A;  4FTH A;  1GVD A;  5F0H A;  3JRB A;  1F36 A;  5EGO B;  3S1N J;  3RKQ A;  2HOT A;  1MBJ A;  1OFC X;  1FTT A;  2GM4 A;  2DMU A;  1X2M A;  5C44 J;  1I6H J;  3LOC A;  3GTQ J;  1LE8 A;  3TW6 A;  2N8G A;  1AHD P;  1ZGW A;  2DTZ A;  1ZTR A;  1WH5 A;  5M3M J;  3SJM A;  5K7Z A;  1MBG A;  1U9N A;  5F0F A;  1BW6 A;  3BQZ A;  3BR5 A;  3FIW A;  2K9Q A;  1T33 A;  2PMZ N;  1XS9 A;  3GTK J;  4FCY A;  5FJ8 J;  3HEF A;  1TWA J;  1JUM A;  1YRN B;  4XID A;  2P81 A;  3HBL A;  1H8A C;  3M3Y J;  3FK7 A;  3Q3S A;  4BXX J;  4DYQ A;  1IGN A;  1PUF A;  1GUU A;  3BR0 A;  1VFC A;  4MO7 A;  4W97 A;  1JGG A;  2HI3 A;  4MIM A;  1Q1V A;  2ME6 A;  3JRH A;  1A5J A;  1WPK A;  4BBS J;  2DA6 A;  1ENH A;  3NAU A;  1B8I A;  3O8G A;  3SFI A;  1QRY A;  1QVU A;  5GPC A;  3QPL A;  2XB0 X;  4M3G A;  1WH7 A;  1JUS A;  1LFU P;  3QQA A;  2Y2Z A;  5EG0 A;  2RAE A;  5FKN A;  3JRF A;  1MBE A;  2ME0 A;  4S0H B;  2JJ7 A;  1I3Q J;  3BTJ A;  4DZJ A;  2MSY A;  4QIW N;  1S7E A;  2DMT A;  5IP6 A;  2NVQ J;  1RKW A;  5GP9 A;  2L7M P;  3VPR A;  5J3L A;  3S1Q J;  3MN2 A;  3ZQI A;  2OPT A;  1X58 A;  2JA5 J;  5EZH A;  5J1R A;  5EF6 A;  1ETW A;  2EQR A;  1VF9 A;  2YU9 J;  2CUF A;  3JRA A;  1JKQ C;  4BY7 J;  1MSE C;  2R5Y A;  2ELK A;  2DA2 A;  2IBD A;  4A3G J;  4A3L J;  5IP9 J;  2IAI A;  4M3E A;  2JWT A;  4CYC A;  2E1O A;  2Y9Y A;  4M3F A;  4IHV A;  5FKO A;  3IH4 A;  4AUX A;  1IG7 A;  4UUS A;  1K83 J;  3LSJ A;  1UHS A;  1JKO C;  2Y30 A;  1EF4 A;  3MKL A;  3TP0 A;  3OSG A;  4BBR J;  4X1E A;  2K40 A;  4A3E J;  5F1J A;  4DYR A;  1NK3 P;  1ETY A;  4A3I J;  3C2B A;  4M3D A;  1RET A;  3S14 J;  3W6V A;  1OCT C;  3OIO A;  2DA4 A;  4QSH A;  1T56 A;  5EYR A;  3TED A;  2TCT A;  3GBG A;  3K2A A;  4D7N A;  3JRI A;  1MNM C;  4JX4 A;  2CUE A;  2CRG A;  1RES A;  3JRG A;  2EZL A;  4Y7N J;  5E3L A;  1JTX A;  1R9T J;  5EGO A;  3S2D J;  2XRL A;  5F08 A;  3HOX J;  2LKX A;  3JRC A;  1FIP A;  2DJN A;  2K9N A;  1VND A;  4JP0 A;  3BG5 A;  4NDL A;  1MBH A;  1XG1 A;  1JJ6 C;  1U78 A;  1QPI A;  2JMW A;  4JX5 A;  1NK2 P;  4A3C J;  3JRD A;  2LY9 A;  1IV6 A;  2FD5 A;  2LP0 A;  3OOU A;  3DCF A;  4L5E A;  1TWH J;  4D7M A;  2X9D A;  3BTC A;  1TWG J;  1H88 C;  2LFB A;  2HQ5 A;  4V2G A;  5EZG A;  1YRN A;  2LLK A;  2VUM J;  2VKE A;  3I4N J;  2XPW A;  1ZKG A;  2L0K A;  2DN0 A;  2YUS A;  4B1R A;  2Y9Z A;  3BG3 A;  3JRE A;  2EBI A;  1HF0 A;  3GTL J;  4A3J J;  1ETX A;  4GFB A;  3S1M J;  4C3J J;  4RDU A;  1UG2 A;  3GTM J;  3PO3 J;  2NVT J;  4A3F J;  2KT0 A;  1HCR A;  5E3O A;  2I10 A;  2O8K A;  4X6A J;  1F43 A;  5EEA A;  3HDD A;  3Q0W A;  3BR1 A;  3HGY A;  4MLO A;  1Z0X A;  2HXI A;  2VKV A;  3A01 B;  3JR9 A;  1X2N A;  1Y1W J;  4IHW A;  3MVP A;  2ECB A;  3IH2 A;  2LTP A;  3CCY A;  3S1R J;  1W0U A;  1K61 A;  1HDD C;  1DU0 A;  2CQQ A;  2R5Z B;  3GTG J;  1ITY A;  3BT9 A;  3NAR A;  2CQX A;  4M3B A;  5BNG A;  1ZQ3 P;  2M0C A;  1ETK A;  4DW6 A;  5FKL A;  2NS7 A;  2WV1 A;  2CU7 A;  3FKI J;  2E2H J;  1A6I A;  5IP7 J;  2NOG A;  3CQZ J;  2O7O A;  4JYK A;  3I4M J;  1IDZ A;  4XIC A;  1FIA A;  5FKM A;  3E7L A;  3ZQC A;  5IYC J;  2MW8 A;  3OSF A;  3BTI A;  5DS9 A;  1CQT A;  2MGQ A;  1U9O A;  4XRM A;  3LSP A;  3RZO J;  2LK2 A;  3Q0V A;  3HOV J;  3BR3 A;  3ZQG A;  2NVY J;  3TP3 A;  1AU7 A;  3HOW J;  1MH3 A;  5C3E J;  2Y0S N;  1SFO J;  3S16 J;  4W1U A;  4XK4 A;  1RKT A;  3IH3 A;  1ORK A;  3UKG A;  2K9S A;  2R7Z J;  1NTC A;  3IV5 A;  2O9L A;  3G1M A;  1OCP A;  3DEW A;  5E3M A;  4ABZ A;  4C2M J;  2JA8 J;  2QCO A;  2XB5 A;  3WHB A;  3BTL A;  4Y52 J;  4LOC A;  4IHY A;  5C4X J;  1P7J A;  1I50 J;  4XRS A;  2JN6 A;  4FE4 A;  1SAN A;  3HB9 A;  2VI6 A;  2M34 A;  2MG4 A;  2E2J J;  1IUF A;  5M3F J;  2DMP A;  2EZI A;  3RQI A;  1IC8 A;  4J19 A;  1APL C;  2XGC A;  2DA5 A;  2LVS A;  3F0C A;  4MFD A;  5IOY A;  2FQ4 A;  2R92 J;  2COB A;  1MBF A;  2W48 A;  2ID3 A;  4FE7 A;  1GDT A;  3BR6 A;  2WB1 N;  5JLW A;  3A02 A;  1GT0 C;  2GBY A;  4XRS G;  2DMQ A;  3ZOB A;  3GTO J;  1Y1V J;  5IPA A;  2JK3 A;  2AHQ A;  3BG9 A;  3QPS A;  5EDN A;  2DMN A;  3TW7 A;  1TWC J;  4B4C A;  4BKX A;  5M5W J;  5JLX A;  2L7Z A;  4M6V A;  2L7F P;  2FJ1 A;  2EH3 A;  1MBK A;  4JX6 A;  1JTY A;  4A3B J;  3PO2 J;  3HM5 A;  1TWF J;  2DA3 A;  1ZK8 A;  2XGD A;  1Z77 A;  4RBO A;  3ZQH A;  2JA7 J;  3S17 J;  1U8B A;  1FJL A;  5DTD A;  2L9R A;  3B6A A;  1JKR C;  1BJZ A;  4I76 A;  1AKH A;  3G1L A;  4UUT A;  2LD5 A;  5C4J J;  1QVT A;  3FK6 A;  4MFE A;  1ETV A;  1GV2 A;  1IRZ A;  2DA1 A;  2HXO A;  3A01 A;  1FTZ A;  5E3N A;  3FIS A;  4FIS A;  2EZH A;  5M5Y J;  1WGX A;  5K7H A;  1H89 C;  5FLM J;  2X48 A;  1AKH B;  3ZQL A;  3BR2 A;  1POG A;  2M9H A;  4V2F A;  5GPA A;  2R0Q C;  1HLV A;  4A3K J;  1LE8 B;  2R5Z A;  3K7A J;  2CJJ A;  5J1Y A;  1JT0 A;  3SDG A;  2Y31 A;  4A93 J;  1WI3 A;  3GTP J;  3HOZ J;  1VI0 A;  2VPR A;  4A3D J;  1BL0 A;  5HOD A;  2OF7 A;  1ETQ A;  1HDP A;  2LR8 A;  2KDZ A;  3PM1 A;  1JKP C;  2HYJ A;  1IDY A;  2XGE A;  2QF7 A;  2TRT A;  2XPU A;  1G2H A;  3G1O A;  4IHX A;  4I6Z A;  2B63 J;  5IYB J;  4DYC A;  4AC0 A;  1FEX A;  5J1U A;  3CDL A;  4IEJ A;  1LFB A;  5F0C A;  2M8G X;  1PUF B;  1ZR4 A;  1E3O C;  3CMY A;  1TC3 C;  3HOU J;  3O8H A;  2ZB9 A;  3B6C A;  9ANT A;  2R93 J;  5IYD J;  1IJW C;  2D5V A;  1B8I B;  1B72 A;  3LNQ A;  2M2E A;  3HKZ N;  4B3A A;  3D1N I;  4D5C A;  2HDD A;  2IEK A;  1BW5 A;  5M5X J;  4EEF G;  1O4X A;  2XPV A;  3H0G J;  3LSG A;  2JA6 J;  1B72 B;  1RPW A;  1XC5 A;  4C3H J;  1DU6 A;  2X6O A;  5EG0 B;  2YS9 A;  2NS8 A;  2EZK A;  3Q0U A;  1RR7 A;  1OJL A;  3L1P A;  3ZQF A;  2XSD C;  3A03 A;  3BQY A;  1ZR2 A;  3H3V K;  4QTR A;  1JJ8 C;  1MSF C;  1JT6 A;  2NVX J;  1GV5 A;  2FX0 A;  5F04 A;  1BA5 A;  2ID6 A;  5K7F A;  5FLV A;  4D5F A;  2HOS A;  4AYB N;  4A3M J;  3LSR A;  2R5Y B;  3GTJ J;  5FKK A;  1D5Y A;  4CYC B;  4BY1 J;  2E19 A;  3RZD J;  2AO9 A;  4UUS B;  1MH4 A;  2G0E A;  2DA7 A;  1W0T A;  3S15 J;  2ECC A;  1ETO A;  2HOA A;  3WHC A;  1UMQ A;  4C3I J;  4DZP A;  3M4O J;  3HGG A;  5F27 A;  2E2I J;  4HNV A;  1JUP A;  2H8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...