1HOMA

Determination of the three-dimensional structure of the antennapedia homeodomain from drosophila in solution by 1h nuclear magnetic resonance spectroscopy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
68
structure length
68
Chain Sequence
b'MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTENNAPEDIA PROTEIN
publication title Determination of the three-dimensional structure of the Antennapedia homeodomain from Drosophila in solution by 1H nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 21
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1homA00
1X2MA 4LOCA 3JRIA 1TWGJ 1GV5A 2JJ7A 1X2NA 2DA2A 2XPVA 3BG9A 2DTZA 3HM5A 1T56A 2EZLA 2HOAA 4G12A 1O4XA 4L5EA 2IBDA 2QF7A 3ZOBA 4DW6A 1IJWC 2G0EA 3BQYA 2L9RA 2R5ZB 4EEFG 2XPWA 1JT6A 4JP0A 4C3HJ 4UUSA 1JJ8C 4QSHA 2LK2A 1P7JA 1WCMJ 2JK3A 3HOYJ 1JGGA 3TW7A 1IC8A 2K9QA 3S16J 3S2HJ 2I10A 2DA1A 4UUTA 4JX4A 1IUFA 3HBLA 4A3FJ 2M9HA 1SFOJ 3H0GJ 1GT0C 2HXOA 4BY7J 3TEDA 4A3IJ 5EGOA 5F0FA 3WHCA 4MFEA 1ETKA 5M5YJ 3HOXJ 4XICA 3LSJA 1XS9A 1ETOA 4A69C 2XSDC 3HOWJ 2N8GA 2XB0X 4XRSG 1LFBA 2K9SA 4JX6A 4ABZA 5M5XJ 3JRAA 2NS8A 4DYCA 1DU0A 1JUPA 1K83J 2W48A 1Q1VA 5E3OA 3B6CA 5IPAA 3SJMA 2XB5A 4A3GJ 4A3KJ 2YUSA 3K2AA 2AHQA 3HGGA 4M3DA 1MBJA 3O8GA 3QPLA 1SANA 5F1JA 2MW8A 5J1UA 4FTHA 5EYRA 5DTDA 1AU7A 3FISA 2MSYA 1BW5A 2JWTA 5HODA 4CYCB 1W0UA 4D5CA 1QVUA 5M3FJ 2L7ZA 3TP3A 1XC5A 4B4CA 4D7MA 5IOZA 2R5YB 1JKPC 3ZQLA 4BBRJ 1TWCJ 2ZB9A 3BR0A 2E2JJ 2X9DA 1AKHB 1YRNA 5F04A 4BKXA 2DA6A 1Y1VJ 1ZK8A 1W0TA 2L0KA 1B72B 1MBGA 5IYCJ 1BW6A 3B6AA 1EF4A 1BJZA 1JUMA 1PUFA 1FIAA 3M3YJ 3CQZJ 1K61A 4XRSA 3I4MJ 4XRMA 2DN0A 3BR2A 4D7NA 2LY9A 3ZQIA 5FJ8J 1S7EA 1QVTA 4FE7A 2WV1A 3PO2J 2HDDA 1TWFJ 3LNQA 2FQ4A 2MGQA 5DS9A 3JRCA 3K7AJ 3S1QJ 5F0HA 4I76A 3G1OA 4I6ZA 1U9OA 1GVDA 4HNVA 1TC3C 2XRLA 4JX5A 4A93J 2CU7A 1GDTA 3S2DJ 4JYKA 1IDZA 2CUFA 2DMQA 3Q0UA 1Z77A 1P7IA 5E3NA 2NVQJ 1OCTC 2GM4A 2DMPA 5GP9A 4FISA 3JRBA 3PM1A 2Y31A 1DU6A 3BR5A 4C3JJ 2IAIA 4A3MJ 3ZQHA 5F0CA 5GPAA 3GTPJ 2DA7A 2HI3A 2VPRA 2CRGA 1TWHJ 4M3FA 1WH5A 9ANTA 1MSFC 3TP0A 5IP6A 1JTYA 5K7FA 2B63J 2VUMJ 2LP0A 3A01A 3LSPA 4UUSB 2ECCA 3GTMJ 3JRHA 1E3OC 1JKOC 1VFCA 4A3JJ 1ZGWA 3BR3A 2H1KA 1FTTA 4IHYA 2LFBA 1GV2A 1ORKA 5EG0A 4IHXA 3HKZN 1U8BA 1WH7A 4MFDA 5C4XJ 1ZKGA 2DMUA 5IYBJ 4S0HB 5C4JJ 3S1RJ 2R5ZA 1LFUP 2ID6A 3HDDA 5EGOB 5M3MJ 2R7ZJ 4RBOA 2OF7A 3BR6A 2CQXA 3Q0VA 3IH3A 2JA6J 3JREA 2DA5A 2K40A 2Y0SN 4A3BJ 1FIPA 2JMWA 1POGA 3DCFA 3FK7A 3BTIA 4QTRA 1APLC 4DZPA 1MBKA 1HLVA 1RESA 5EZGA 2Y9ZA 1HDPA 2DMNA 2FJ1A 4B1RA 5M5WJ 4W1UA 3H3VK 5J1YA 5FLVA 2Y30A 1ETYA 4A3EJ 4FCYA 2HXIA 5J1RA 1A5JA 2K9NA 1LE8A 1FEXA 1ENHA 3UKGA 3GTKJ 2HQ5A 2NVXJ 4Y7NJ 2LR8A 3OSGA 3MN2A 1T33A 2E19A 1B8IA 3BR1A 1BL0A 2PMZN 3JRFA 5EZHA 3LSGA 1H8AC 2LLKA 3HEFA 1F36A 2R93J 1YRNB 2E1OA 1I50J 2NVYJ 4V2FA 4W97A 3Q0WA 2CJJA 2YS9A 1ITYA 1JTXA 3HOVJ 3GTLJ 3C2BA 1PUFB 3BG5A 3S14J 2R0QC 3M4OJ 3TW6A 1MH4A 1G2HA 4AYBN 1H88C 3S1NJ 4AC0A 3FIWA 3QPSA 4GFBA 2NS7A 1VF9A 2JA8J 3GTOJ 3ZQGA 5JLXA 2EZIA 4A3LJ 2O7OA 1JKRC 1Z0XA 3HB9A 3BG3A 3RZDJ 1FTZA 2X48A 5IP9J 2GBYA 3IH2A 4IHWA 4A3CJ 2R92J 1IGNA 1Y1WJ 3NARA 3NAUA 5EDNA 1ZR2A 4IEJA 3LSRA 1MBFA 4D5FA 3GTGJ 2LKXA 2LD5A 3OIOA 1GUUA 2JN6A 2NVTJ 2MG4A 1IDYA 2O9LA 2EQRA 2KDZA 3BTLA 2XGDA 1RKTA 1JT0A 3RQIA 1ETVA 2DJNA 5K7ZA 3WHBA 1IRZA 3E7LA 4A3DJ 1RKWA 3F0CA 1NK2P 4MO7A 3JR9A 1MH3A 4BBSJ 1HF0A 2QCOA 4DYRA 1AHDP 2ECBA 2ID3A 2O8KA 3RZOJ 4XK4A 3A01B 3OSFA 1U78A 4FE4A 1OJLA 3L1PA 3I4NJ 3GTQJ 2XGEA 2HOSA 2M8GX 3G1LA 1VI0A 2DMTA 2E2HJ 2D5VA 5IYDJ 5K7HA 1MBEA 4X1EA 2EH3A 1UG2A 1A6IA 3BT9A 1XG1A 4M3BA 2EZKA 5EG0B 4BY1J 2HYJA 3PO3J 1JUSA 1OFCX 5EEAA 1ETWA 1ZTRA 4QIWN 1VNDA 3ZQCA 5E3LA 1I3QJ 2DA4A 5FKLA 1H89C 5C3EJ 2ME6A 3S1MJ 2L7MP 1FJLA 5IOYA 3W6VA 2VI6A 3QQAA 5FKMA 1JKQC 1JJ6C 2DA3A 2M2EA 3VPRA 1QPIA 2FD5A 3BQZA 4B3AA 4NDLA 4C3IJ 1IV6A 4BXXJ 2P81A 2M34A 5F08A 3ZQFA 4DYQA 4C2MJ 1RETA 2M0CA 3S17J 2X6OA 3SDGA 5EF6A 3IH4A 1LE8B 1F43A 1X58A 2WAQN 4IHVA 3O8HA 4DZJA 3CMYA 1UMQA 2JA7J 1B8IB 4M3EA 1ZR4A 2CQQA 3BTJA 1BA5A 1HCRA 4XIDA 3IV5A 2FX0A 3MVPA 5GPCA 3JRDA 3LOCA 1I6HJ 1IG7A 1RPWA 1HOMA 1UHSA 3CDLA 1WGXA 2E2IJ 5FKNA 2IEKA 1NK3P 3HOUJ 4CYCA 5E3MA 2EBIA 5FLMJ 2LVSA 3MKLA 3G1MA 1TWAJ 2R5YA 2OPTA 2GLOA 2Y2ZA 2HOTA 3BTCA 3S15J 5IP7J 2VKVA 1NTCA 3HGYA 5FKKA 1R9TJ 3DEWA 4V2GA 1AKHA 3CCYA 2JA5J 1ZQ3P 5BNGA 2RAEA 3D1NI 3OOUA 4X6AJ 1WPKA 1RR7A 1B72A 2VKEA 5JLWA 2CUEA 2NOGA 2KT0A 1WI3A 1MNMC 4J19A 5C44J 3SFIA 1ETXA 2L7FP 4M6VA 2AO9A 2ELKA 1HDDC 3JRGA 4MLOA 3FKIJ 5FKOA 1U9NA 1CQTA 2ME0A 2WB1N 2EZHA 5J3LA 3HOZJ 1OCPA 1MBHA 4AUXA 2TRTA 2XPUA 3A02A 1QRYA 2LTPA 2H8RA 4Y52J 3RKQA 3GTJJ 1D5YA 3FK6A 5F27A 1MSEC 1ETQA 2YU9J 3A03A 3GBGA 2TCTA 4RDUA 4M3GA 2XGCA 2Y9YA 2COBA 3Q3SA 4MIMA
chains in the Genus database with same CATH superfamily
2IPQX 4A0ZA 3FMRA 4LOCA 2G9WA 1BN5A 5DM7F 1R1VA 3KYCB 2DK8A 2HWVA 4EM2A 2D45A 1EH8A 1FLIA 1GXPA 1T95A 2DA2A 2X1DA 3BG9A 3ULQB 1IF1A 2ZBKA 1RUOA 2PG4A 3EUAA 3HM5A 3KLNA 5CVRA 2NS0A 1FOWA 1W5CC 4G12A 2ZCWA 2IBDA 3ZOBA 4I7HA 2M7BA 5LRRA 1IN8A 1V54H 3KEYA 4EEFG 1JT6A 4UUSA 4QSHA 1M1EB 1ZH5A 2E36A 1FZPB 2LK2A 1WJDA 1Z3XA 1WCMJ 1HKTA 4HYEA 4A6DA 1IXRC 2JK3A 4XRFA 4G7HF 2IT0A 3CD6I 3TW7A 4Q48A 1TLHB 4A3FJ 3G4SI 2O8XA 2L2OA 5HDGA 3H0GJ 4XSZF 3F9KA 2B0LA 3BPXA 5KCMA 4EJOA 4A3IJ 1L3LA 3KP6A 3RYPA 4MFEA 1ETKA 3P9CA 1X1DA 3HOTA 4II3A 3HC7A 1O3QA 1ETOA 2XSDC 4L5JA 2N8GA 4XRSG 2K9SA 5M5XJ 3JRAA 2Q1ZB 2DQLA 2NS8A 1JUPA 3H35A 4CSWA 1I5ZA 5FLXZ 1NH3A 3B6CA 2H6BA 3ZPLA 3F22A 4ESJA 1SMTA 2OUMA 2IRFG 1YTYA 4PSWA 4LK0F 5DCMB 2YUSA 3K2AA 5IT3A 2O3FA 4ZDOA 4LLGF 1MBJA 3O8GA 3QPLA 1SANA 3FKJA 2HPMA 3WG9A 1D0ZA 2VE9A 3GMEA 1XGOA 2M3AA 1O7LA 1G3YA 1ZN2A 2QSFX 2WBMA 5L3CA 3ABLH 1Z91A 3FISA 2Z9OA 4CCNA 1HQCA 4IKFA 2CO5A 1JHHA 3BP8A 4E7SA 1XC5A 5IOZA 4P5OA 4KYWA 3AL0C 4BBRJ 2ZMEC 1SD4A 1FYLA 1BI2A 2ZB9A 3BR0A 3KZYA 4OINF 3ZMZA 3OYIA 1YRNA 3TMOA 1V5GA 4UV9A 1K79A 2L0KA 4N9IA 3FXLA 1MBGA 3B6AA 1EF4A 4CZCA 1PUFA 2DOFA 1LNWA 1W7PB 4JK1X 4G94A 3HRMA 2FXAA 4ENMA 2K9LA 2HVQA 2X6XA 3BZCA 2TDXA 2DFEA 2PMUA 1T98A 3L2UA 5D6EA 2LY9A 3ZQIA 1BOAA 3AG3H 4KUMA 5FJ8J 2IA2A 3EYYA 1KQ8A 1W1WE 5D6FA 3MFKA 2WV1A 3DKXA 2HDDA 5GTIC 1AOYA 2FQ4A 2MGQA 2HQNA 5JI6A 3K70D 2Y75A 1YO5C 1T38A 3K4CA 3Q9VA 5D4SA 4F55A 4PGHA 5HS7A 5L3FA 2L5QA 1TC3C 1X3ZB 2KZVA 2V9VA 4RGRA 2CFOA 1P4AA 2PFBA 4JYKA 3M1EA 5J4VA 3S2DJ 2Z16A 2W25A 4KMFA 5E3NA 3BY6A 2DYRH 3CO7C 2GM4A 2DMPA 2I5UA 1ZRCA 5E1WA 1OCRH 3R0AA 1IV8A 1Y0NA 2XAGA 4NBQA 2JPBA 3S2WA 4ESFA 3FF5A 3TO7A 3IAS2 3GTPJ 4PJJA 2F2EA 1TWHJ 3E3VA 4ASNA 4HG2A 4WXCA 4WCGA 1KU7A 1IW7F 5IP6A 1JTYA 5ED4A 4UVBA 4EGZA 2FQ3A 1AA7A 4RGSA 2LP0A 3HSFA 3A01A 4UXNA 2V1XA 1ZELA 4HDVA 2E34A 2QBYB 2BGCA 3DKWA 2ESNA 4ZZLA 1MNEA 2BHZA 3V8KA 1ZG3A 4OOIA 4KIGA 3JRHA 1RR8C 5DDGA 3MAJA 3T1BA 4A3JJ 3KZZA 4HX7A 4IHYA 3OIPA 1IO2A 2MA3A 3I59A 1FNNA 4I02A 3GZ5A 4MEXF 1WH7A 4MFDA 2LC2A 1ZKGA 5IYBJ 3S1RJ 4B3XA 2ID6A 2P5VA 5M3MJ 4AVZA 1I27A 2GXAA 4A5MA 2V6EA 3BR6A 1S9HA 1FBQA 5DD4A 3Q0VA 4RB1A 4BEHA 1Z7UA 5E8GA 3W6KB 3FXMA 2UUZA 3C3WA 2I8DA 2K40A 1FIPA 1WRJA 3KLOA 3BTIA 3HL2A 2IS6A 1IRXA 4XORA 2DT6A 5B5EC 2Y9ZA 1HDPA 1WJAA 4HAMA 4L0YB 5LD2C 4XL9A 3K1MA 5F6FA 1VQKI 2Y30A 4M9XA 4C9YA 4HQEA 4TV7A 3A2KA 1BI3A 3MQ0A 2K27A 2QQAA 4A3EJ 2XASA 4NQWB 4IQ4A 1QBJA 5E18F 2HXIA 5HS9A 2ZXHA 2ISZA 1ENHA 3VYTB 2KMUA 4F3QA 2HDWA 5HLGA 3UKGA 4CCLA 3QYFA 3SEZA 3L00A 1LKXA 3BCAA 4AVPA 2H8WA 4I2OA 2J5OA 3MN2A 3S3MA 2E19A 3FXQA 2QSGX 4MHGA 1BL0A 2E71A 2A69F 2W57A 3HJEA 4MTDA 3JRFA 5EZHA 3LSGA 1K78B 2R93J 4L0ZB 1I50J 1XGNA 4LMYA 4ZH4F 2K9MA 3MZYA 5AONA 2CJJA 3RKWA 3RTRA 3WE3A 3BG5A 3QOEA 1QPMA 3ZMTA 3MWMA 2CW8A 1OYIA 4F7ZA 2QSHX 2CV1A 1H88C 1B9MA 4B09A 4GFBA 5KVRA 4XQFA 1VF9A 3FXKA 4HA8A 2JA8J 3DPUA 4BUPA 2HU9A 3I4PA 2P7VB 1X1CA 2EZIA 3SZTA 4RS8A 2LMDA 2O7OA 2HVSA 4UVCA 1JKRC 1IN6A 2MD5A 1YQAA 1TQPA 2X48A 4O5VA 4PJNA 2A68F 3K1NA 4XSXF 1G6NA 4A3CJ 2X6YA 1R23A 2DOEA 2CQKA 1IGNA 2KRFA 2VN2A 4BE0A 1A35A 3ECHA 1MD0A 2HKOA 1J0RA 4RB3C 1ZR2A 3K4MA 4IEJA 3KYDB 2MBFA 2LD5A 1IN5A 2NVTJ 1B9NA 1IDYA 2O9LA 3I53A 4RAYA 1JT0A 3BTLA 1VQ9I 1RZ4A 3RQIA 1ETVA 2BYVE 3WHBA 4C2TA 3WE2A 2GIZA 1USTA 1VQLI 2OV7A 5IT9K 2W84A 1KA8A 3F0CA 1TQMA 2JPCA 4BDYA 1LQ1A 1MMDA 3ERED 4G6TB 1L0OC 2QCOA 4FQGA 1AHDP 3TO9A 2ECBA 2JQ7A 3N4MA 1BOBA 3BCBA 2HOSA 4PFOA 2M8GX 1BIAA 3G1LA 3HSRA 2EFWA 1VI0A 2DMTA 3ZXSA 5K7HA 2P7CB 3FM3A 4M9SA 2EH3A 1EH6A 1UG2A 3BT9A 2NYXA 5EG0B 2EZKA 1KZHA 1LEBA 1YFHA 3CUQB 2G7HA 2ZNYA 4C30A 1WJ5A 1B59A 5GTHC 3H3UA 4QIWN 4YFNF 3ZQCA 5E3LA 4M74A 4IRHA 1TQIA 2QLZA 3TOAA 4IF4A 4ENNA 2L7MP 3R4KA 1IRGA 1VZ0A 3WTYC 3SZPA 4YRVA 5E79C 4EM1A 1DUXC 2ZFUA 3NRVA 1JKQC 2WA0A 3ELKA 2R7XA 1JJ6C 2DA3A 3I58A 3VPRA 4XM3A 3BQZA 2EFOA 4JQFA 3ROUA 2MH2A 5JVGF 1UB9A 3GCMA 5L3BA 3CCUI 4BXXJ 4JBAA 5F1RA 2M34A 2ZJPF 1WJCA 3ZCOA 1HC8A 3DBRB 1S5LC 4C2MJ 1Z7LA 2X6OA 1LE8B 4O6JA 2R7RA 4EM0B 3O8HA 1UMQA 2HVRA 4H4KC 4KJZA 3GEZA 3KP2A 4WXDA 2BY0A 4R79A 4M3EA 5GAGJ 2V1DA 5GAHJ 2BZTA 5DCMA 2AQFA 4BHPA 3CMMA 3FZVA 4BS9A 4ITVA 2FX0A 3MVPA 5GPCA 3GVAA 2LYCA 3JRDA 3LOCA 3QU6A 5FGMA 1SFUA 3F23A 1YJ9I 1YIJI 1IG7A 1HOMA 2M45A 3FXOA 3WU0A 3GLLA 1WGXA 4BXUA 4EVIA 2E2IJ 5FKNA 2QQBA 3GYHX 3RYRA 5GAEJ 1FOYA 2VJ4A 3RPUA 3HYIA 1I6XA 2OPTA 2HOTA 3BTCA 3OYKA 4EJWA 3EQLF 2ZSHB 2VKVA 5FKKA 3K9TA 1R58A 3DEWA 1R9TJ 4LIVA 2VL8A 2AXTC 3D1NI 4C2UA 2O5RA 1IN7A 2DQRA 2F48A 2YPRA 3VB2A 1U0JA 2LRDA 4MQ9F 3OR2C 3A0HC 4CA0A 1OKRA 2KPMA 4JOMA 2QKMB 1YITI 1W7PA 2V9KA 4F52A 3BJOA 1MNMC 1ZHFA 4KN4X 4J19A 4XKBA 2R7OA 5J6XA 1FX7A 3IKTA 1OLTA 2ZSIB 5H20A 2K3FA 4GGGA 2ELKA 2Q2EB 4S04A 4MLOA 4RM3A 3B02A 2BBYA 3IUOA 1U9NA 1H9GA 3HPHA 1YW7A 4MNUA 1TP4A 1ZLJA 2CMPA 2EZHA 2KIFA 3DTKA 5J3LA 3HOZJ 1OCPA 4AUXA 3AG4H 1BR1A 2QQ8A 1ZYRF 3A02A 2JA2A 2OTJI 2LTPA 4ENJA 4NNJA 3FK6A 3M8FA 4XLCA 1SVMA 1MSEC 1W36D 1ETQA 1QZEA 1TNTA 1WJEA 2F5FA 3TOBA 2R3SA 4Z6YA 4RDUA 1LDJA 4GO1A 2VASA 4NB5A 1W5SA 2UXXA 1YI2I 5KHDA 4XLAA 3OYMA 1LB2A 2P8TA 3RKYA 2OU2A 3EUKL 1TWGJ 4Y13A 1NG7A 2HQAA 1REPC 1GV5A 4F92B 3J81Z 3QWLA 4KIBA 2XPVA 4HEA2 3RSNA 2VC1A 2KRCA 2OC6A 1T56A 1XSVA 2EZLA 3GF2A 4EJVA 2DT7B 3E6MA 2FRHA 4L5EA 2QF7A 3OS2A 2X1EA 4DW6A 1ODDA 5JR3A 2IXSA 3BQYA 3I54A 2UV1A 2QBYA 2HZDA 4JP0A 2BY3A 4C3HJ 1P6RA 4U0WA 1JJ8C 3FWEA 3UNGC 5KK1A 3W2VA 1TTYA 2W1OA 1P7JA 4BEHB 2WV0A 3PNYA 3J7AY 3HOYJ 4KITB 1JGGA 1Z05A 2I10A 2DA1A 3JTHA 4JX4A 1IUFA 3HBLA 1MZBA 3FXRA 4E7JA 2JVGA 1WKMA 2PX9A 2RNJA 3GUDA 2F4MB 4OAYA 1Y39A 3TEDA 5FRNA 3NQOA 3WHCA 3GZ6A 1IXSB 2LF7A 5DUKA 4XONA 2CH0A 4AM3A 1XS9A 3HOWJ 1SVLA 2XB0X 2R7QA 2NNNA 4JX6A 5HLHA 4DYCA 2LDUA 3RDIA 1ZLKA 3VYSB 1R6RA 3PSIA 1TZLA 1JXSA 2ELJA 2E60A 4R1HA 2OCCH 2L9NA 2K86A 2FNPA 2VQGA 2XV4S 2CQNA 3I5UA 2V6CA 3HGGA 3E1SA 4LLLA 1XDSA 1RI7A 2F5EA 2Z33A 3HIFA 3RIRA 5F1JA 1QZZA 3PIOF 1YW9A 2GXGA 3SFZA 2QKLB 4FTHA 2IA0A 5EYRA 5DTDA 3E5XA 3WTSC 1AU7A 1BW5A 2CS3A 2HEOA 4CYCB 2COMA 5CYVA 1QVUA 2L7ZA 1SD5A 2VJJA 4G9YA 4XLNF 4QWQA 2R5YB 2V4JC 2PEXA 1JKPC 1UJ8A 4O3MA 2KQRA 1K78A 1O3RA 5FD5A 5FD6A 1UZCA 2ICWG 2X9DA 4NUBA 4PCQA 2MABA 3U9GA 2E5NA 3K4NA 2HOEA 5DUIA 4Y4RA 2W7NA 1BW6A 3M3YJ 1X3WB 1QU3A 1YYVA 1GXQA 2ZFWA 3CQZJ 5HLTA 4CGZA 2F5CA 4XRMA 3LAJA 2VIXA 1V5EA 3V42A 2BOLA 2HYFA 3EUHA 4BHCA 5FO5A 4HV5A 1S7EA 2H27A 2DYSH 2E35A 3BROA 1ON1A 1JGSA 3D5RC 3GWZA 1Z9CA 2PLYA 1LDKB 4HLXA 5DS9A 3F21A 3I55I 1S72I 3K7AJ 2EV0A 3S1QJ 2A6TA 5F0HA 2UWMA 5CQEA 4QPQA 3VSKA 3T5XA 5HNFA 2NOJB 3G1OA 5LLQA 1U9OA 3CCQI 1U2WA 2A05A 1P92A 2KZGA 4HF0A 5DM6F 2VKDA 4PZJA 4EGYA 2CUFA 1FBUA 2LREA 1Z77A 3ZMVA 2NVQJ 3I0TA 1ZRDA 3JRBA 2EFNA 3PM1A 3QU3A 4P1WA 3LSHA 1TBXA 4IX7A 4C3JJ 6PAXA 4L9VA 2EK5A 3EUHC 4HRIA 4A3MJ 4UVAA 4EV0A 5A2QZ 4P9UA 2M87A 3ZMDA 1U5TB 2DA7A 2HI3A 4OAZA 3V8JA 2VPRA 1JHFA 4RAFA 2FMYA 9ANTA 1IXCA 1FT9A 3LQRA 4RAGA 5J47A 2NNYA 4N0BA 5K7FA 3CLOA 2DODA 1SFKA 2X51A 2RVCA 4KMUX 2YR2A 1DGRM 1MJBA 2W85A 3PFYA 2P6SA 3JCUC 3PL8A 2DTRA 3DBHB 3GTMJ 2E5ZA 5F64A 1JE8A 2E1CA 2HGCA 1JKOC 3O3KA 3BR3A 1ZGWA 2FOWA 3JW4A 2AQEA 3GZNB 1Y56A 3E6BA 4E6KG 3PIPF 3H3ZA 2QVOA 3HHHA 1DGWY 1P9QC 5FFXA 2R7WA 5EG0A 1CF7B 2EFQA 3NWTA 3CUQA 1U8BA 2P4WA 3ZN1A 3DBLB 1VQ7I 1OQYA 4LLNA 5C4XJ 4KT6A 5C4JJ 1UCRA 2GZWA 5EGOB 4NC8A 2ZJ2A 3U1DA 2EIMH 4MEYF 5HNHA 3I71A 3HTSB 3KIOA 4XLFA 4RB0A 4BQAA 2HQRA 2DA5A 2DPUA 2JZYA 3W2WA 2JMWA 1QHHD 4QTRA 3FK7A 1APLC 3K69A 4UB6C 4DZPA 2DFHA 4U7BA 1YW8A 1TW2A 5E1XA 5EZGA 1R5ID 3U1KA 2FJ1A 5M5WJ 4KN7X 5ILSA 4RA2A 2FOKA 1BI1A 1LE8A 1J5YA 1QQIA 3FBNB 2K3PA 3GTKJ 2HQ5A 3CUQC 2NVXJ 2KHMA 4HLYA 3RI4A 4Y7NJ 4FETA 2FBKA 1OISA 4BJTA 3MMYB 3OYNA 3VODA 3WU2C 1H9TA 3BR1A 3DF8A 3V7RA 1ONVA 3VFZA 1FMVA 3LSIA 5LEKA 2H1LA 2NVYJ 4A6EA 2ADUA 2B7EA 3ESWB 4V2FA 3L2WA 2UZKA 4J01A 1J75A 2CQ7A 2LG4A 3ZRGA 3CZ6A 1R00A 2JUCA 2YS9A 5FLXK 2HTJA 1ITYA 1VQ5I 3U21A 1K6OA 3DV8A 2Y0SA 3V8LA 3S14J 3E5QA 3S3NA 1HXDA 3P9IA 1G2HA 2E7XA 2EJRA 3KP4A 4BXFA 1I39A 1OCCH 2RC4A 4CXFA 5L3GA 3GX4X 4H0EA 1K7AA 3ZR8X 2ISYA 4NC7A 3DEEA 4HBLA 2EWNA 1Z0XA 3S3OA 5K1YA 1KU3A 3A1YA 2HKXA 3DTEA 5IP9J 3AAFA 1U8RA 2DDAA 2A5WA 2GBYA 1WSUA 1R1TA 3LA7A 3NARA 2L4AA 4RB2C 4PSXA 3CCSI 2Q2EA 2VPLA 4E7LA 2L54A 2F4OB 3OMYA 3BZKA 2ZC2A 4B44A 1MBFA 2MH9A 4D5FA 1HW2A 3GTGJ 1GUUA 1ZG5A 2MLKA 3IWFA 1W5TA 2KDZA 3VYUB 2VQCA 1TW3A 4GXOA 2EINH 1MMGA 3D0SA 4A0YA 1IRZA 1ZGAA 3OOPA 3ZMSA 2Q0OA 1PP7U 3OYBA 4A3DJ 3L2VA 2IS4A 4BBSJ 1HF0A 1SMYF 1GHCA 1A36A 2Z2SB 4EQQA 3M07A 4XK4A 3OSFA 2VOPA 1F4KA 3FM5A 4FE4A 4B43A 4AIKA 2XF5A 3I4NJ 3GTQJ 2XGEA 1DP3A 3CCRI 3KCCA 2BXYA 4XBFA 4BL0B 4AU7A 2D5VA 2E2HJ 5IYDJ 1X3UA 4X1EA 1A6IA 4KICA 3CCMI 3UR3C 4M3BA 3PO3J 3WTTC 3ISPA 2EPFA 2H6CA 1VNDA 1QA6A 2BVMA 2DA4A 5C3EJ 4A5NA 4QLCU 1FJLA 2MFZA 3H9JA 4AWXB 3FXJA 3SZGA 1PVEA 4ZJZA 3HRSA 3TO6A 4PGGA 2M2EA 4XNFA 4RMNA 1MMAA 2HR3A 4EJTA 4NDLA 2X0LA 1T2KA 3KFWX 2P5LC 1IV6A 2P81A 2VT3A 1B1BA 1XSXA 3NWSA 5F08A 4BAYA 2XAJA 1A04A 5CKTA 1K4TA 4PJLA 3S17J 5EF6A 3PSFA 2D1VA 3BG7A 4Y17A 3SYTA 2GQQA 4YIFA 1J09A 4M72A 1B8IB 1QZYA 2FEZA 2CQQA 3BTJA 1WFXA 1H0MA 1HCRA 3IV5A 1DQUA 2GOMA 5LBQA 1VQ6I 3K4LA 3LFUA 3AG2H 2IEKA 2B9SA 1NK3P 4CYCA 1PP8F 5FLMJ 4HX4A 2KIQA 3G1MA 2CV0A 4K2EA 2R5YA 3S93A 4CO8A 2GLOA 2VBZA 3N05A 3HGYA 2XDVA 1YX5A 3G6EI 3CCYA 3F8BA 5HDKA 2AS5F 5E17F 1ZQ3P 5BNGA 4X6AJ 4HF2A 1WPKA 2A07F 3DFGA 2IP2A 2WWYA 4G7ZF 2WAQA 4AIDA 1BR2A 3OL4A 3TQNA 1LPQA 2K4BA 4F93B 2KT0A 1WI3A 3B73A 4BH9A 2QGUA 1MGTA 3DU6A 1KGSA 2EIKH 3LL7A 3E6CC 1YE9A 1ZG1A 1ETXA 1ZGJA 2L7FP 2XAUA 4ON0A 4BNCA 3LSKA 4M6VA 1KONA 1HDDC 1Z67A 4L18B 2M0MA 4IHSA 4BU2A 4BHBA 4HSRA 5EEGA 3RCOA 1MBHA 2XAHA 1SC7A 2TRTA 2XPUA 1EA3A 4IXAA 5DEQA 2W4SA 3H1CA 2XROA 3RKQA 1D5YA 2H8RA 1N75A 1E2XA 4E4HA 2PBIA 3BZ6A 3KP5A 2TCTA 2V1NA 1FSEA 4M3GA 2Y9YA 2RGVA 2COBA 2JT1A 3TDZC 3V4GA 4N4OB 4NHJA 3Q3SA 3HRUA 2LOOA 2XF7A 2BVLA 3W3CA 4QPOA 3LAPA 2EIJH 4DBQA 4ZTFA 1U5TA 2DTZA 1MDMB 1WVRA 3KX2A 2VOOA 3G2BA 1BJAA 4LGWA 3VDXA 1O4XA 5BMZA 1YJWI 1KYWA 1ON2A 2BW3B 4Q4ZF 3CO6C 1BC7C 1ZREA 2PJRB 4IVNA 3H36A 5LFAA 1LUJB 2L01A 3KEOA 2XAQA 1BI0A 3P5JA 3R0JA 2XGXA 1OYWA 5BS6A 5TRDA 5EEHA 4II2A 1IC8A 1ACIA 3S2HJ 2WTEA 4UUTA 1FP1D 1CF7A 2M9HA 1XDUA 1N77A 3CDIA 2L9SA 1SFOJ 3CDHA 5EJCA 1GT0C 3LQQA 4DIQA 4BY7J 4D1QA 4HX8A 3IP4B 5F0FA 5EGOA 4WWCA 1USSA 4D0PA 2LH9A 1U5TC 3HOXJ 3LSJA 2O6GE 3TKYA 3ABTA 3CCJI 2DCEA 1LFBA 1VQOI 2VQLA 1W7PD 1TT0A 1EKEA 2CW0F 2W48A 1Q1VA 1XSDA 5IPAA 2DXIA 4IL6C 3SJMA 1MJAA 4XMYA 1UHWA 3KETA 2STWA 2XB5A 4A3GJ 3PUFA 3DPLC 4UV8A 2AHQA 1FOKA 4M3DA 1RNLA 2FE3A 2XC7A 4E70A 1D1CA 1TT5B 5H6RA 2MW8A 5J1UA 2GOXB 1OR7A 4HF1A 2P5KA 3HUGB 3IRRA 4GDFA 2XVCA 5DV5A 2PI0A 4D5CA 4XLHA 4D7MA 5LEJA 3QAHA 2CG4A 4I99C 1J9IA 1WHUA 5LGNA 5CLSA 1N25A 1Z6TA 4GCVA 5F04A 2MC4A 3ZP5A 2O03A 2DU9A 1Y1VJ 2JSCA 1ZK8A 3M8EA 1FSHA 3BDDA 4OIOF 1B72B 4Y3OA 4EMSA 1BJZA 3F8CA 4Y33A 3U2RA 4XKWA 3OYFA 4XRSA 2EA4A 1ULYA 4XKVA 3REOA 3LA2A 4D7NA 1LVAA 3I9V2 3OYHA 1P4XA 4KT5C 4G6DA 4RLFA 1QVTA 4FE7A 4Q5SF 2L9VA 2WY7Q 3LNQA 4RGXA 2XKOA 3OYDA 3JRCA 2E7WA 4E7HA 1V5FA 4OIPF 3T8RA 4U88A 2QZ8A 3PUBA 4EATA 2GIVA 3F6VA 5TISC 3COAC 3WTXC 4I6ZA 1G3SA 2CU7A 2A61A 1E3HA 4J00A 3VWBA 1OCTC 1R4NB 4X0GA 1YIOA 5GP9A 3QYBA 4ANJA 2CUZA 4FISA 4U87A 2Y31A 3CC2I 1MMNA 2L3DA 2XKPA 3BR5A 2RN7A 3IHUA 1T0FA 1WJBA 3ZQHA 3F3XA 2OQGA 5F0CA 3O6BB 5GPAA 5BPIA 3Q9SA 2CRGA 4P96A 4M3FA 4ETSA 5LGTA 1MSFC 2CV2A 2PN6A 4XOPA 5CVUA 2XRNA 3GO5A 5DYMA 2F6CA 3K1PA 2Z1DA 1X4PA 1MW7A 3WGGA 3MEXA 5BOXA 3E97A 4PFPA 2VONA 1VFCA 3ML6A 2H1KA 2IS1A 1R49A 4CYDA 4A12A 1YLFA 3CCVI 4IHXA 1G8XA 1X1PA 3BLYA 3KP3A 3J81K 2A6HF 2DMUA 3QP6A 4S0HB 1LFUP 2R5ZA 3F8MA 2F5DA 2R7ZJ 3C18A 4RBOA 5LRSA 1MIJA 2CQXA 3KPHA 3IH3A 3IC7A 3ONQA 1N78A 5L3DA 4KISA 2JVHA 1FWZA 2PQ8A 4BYYA 2Y0SN 3M1CA 2FBIA 1POGA 2E1MB 1MKMA 3QRFF 2K02A 1RESA 3JAMZ 1D5VA 1D1BA 2KIMA 1SFEA 4M73A 5J1YA 4N9HA 4MTEA 2DT5A 3K4BA 1ETYA 4FCYA 1UAAA 1WZ2A 3L2RA 3H5RA 1FBSA 2K9NA 1A5JA 1FEXA 2RV8A 2Y69H 2QWWA 1E3PA 3K4JA 2VBWA 1PJRA 3HKZA 2LR8A 3OSGA 1R1UA 2F4IA 2WAFA 5L3EA 2QYOA 1J59A 1T33A 1FOXA 1V3FA 1B8IA 4UY8I 2ETHA 3A4CA 1H8AC 4N4NB 3HEFA 1F36A 1D1AA 1F1ZA 2HZTA 3Q0WA 1V4RA 2HTSA 3CP2A 1PDNC 4CICA 2GXBA 1JTXA 3PNVA 3GTLJ 4CZZA 3HOVJ 3C2BA 1K6YA 2JRMA 5E8IA 1MH4A 4M6YA 1Z1DA 2RNGA 3F8FA 4CUGA 3J80Z 3F6OA 3FIWA 2NS7A 5K5QA 3MD2A 3GTOJ 3ZQGA 2VLAA 2VC0A 1FYKA 5D8LB 2FA5A 5J4YA 3MZHA 2XAFA 3DLAA 5JLXA 4MGRA 1DPRA 4A3LJ 3CMEI 3HB9A 3P9KA 3RZDJ 2BHYA 3AG1H 4L5IA 1T6SA 4ZTJA 2H09A 2JRTA 2KRHA 5HVQC 3IH2A 2PMZA 2ZXIA 3GLXA 2R92J 1Y1WJ 3HHGA 3QODA 4IJAA 3IL2A 2NAZA 5EDNA 1R22A 2MG4A 1SD6A 2NXNB 2EQRA 3CESA 1RKTA 2DJNA 4AYBA 3E7LA 4HNUA 1RKWA 4I09A 3EETA 4BJ6C 3L2QA 3JR9A 1MH3A 1C0WA 2HFHA 1KQ0A 4HSTA 4B8XA 2VB6A 4DYRA 2DAOA 3EDPA 4M71A 3JSPA 2VBYA 2ID3A 2O8KA 3RZOJ 2W24A 2OA4A 1U78A 3CCEI 1D0XA 2VQHA 3L1PA 1TL8A 2WADA 1O3SA 2XSJC 3A0BC 5FFZA 2NVUB 1XMAA 2ZJQF 5ILVA 1S7OA 1EH7A 3PNTA 4LB6B 2DK5A 2LKSA 4YG2F 4I98B 4YFKF 4ZDPA 1MDMA 4Y15A 3E6DA 1R7JA 2CUJA 5KAFC 2HYJA 2DDBA 1OFCX 3WTUC 4L9TA 2BW3A 2V1UA 4FHTA 2XHKA 3M9AA 4LD5A 2PJRA 1I3QJ 5HLIA 4XOTA 5A2QK 4XN3A 3N97A 1FY7A 5FKLA 2O0YA 3MZ8A 3QYEA 5CVJA 2FBHA 3WGHA 5IOYA 3AFHA 3VEPA 2P6TA 1T08B 2K85A 2ELHA 2KFDA 3QQAA 4ZYGA 2LBFA 2V7FA 2IA1A 4WK8F 3C1DA 4LG0B 1VQMI 1J7KA 5B3SH 5HOOA 3ABUA 3HG9A 3DP7A 3R61A 1U6GA 2Z99A 2FD5A 1QPIA 1K4SA 3RQ4A 5J8FA 5H6QA 3G3ZA 4C3IJ 5K5OA 1OYYA 2QENA 4AIHA 3IWZA 1SAXA 3ZQFA 2ZMEA 1RETA 4L9JA 3DPTA 3SDGA 1VQ8I 3IH4A 4ZZDA 2WAQN 3SDBA 2EILH 1MJ9A 5B66C 1VQPI 4YEJA 3EPZA 2DBBA 2HYGD 4U0YA 2LNBA 3FBIB 2JA7J 1ZR4A 1Y8QB 1KU9A 2PJPA 4HW0A 1SAUA 2XUBA 1XCBA 1BA5A 4PJMA 3LMMA 4DQ2A 3AKZA 4LB5A 3CUOA 4PUSA 2KL4A 2UXNA 2QUFA 2Q8KA 1RPWA 3ABKH 3TGNA 1IZ1A 3VOEA 5LHHA 3ASOH 3WG7H 1HBXG 2NRAC 5ERIA 2OJED 3HUGA 3HOUJ 4BQOA 2EBIA 2D2WA 1R5GA 3JSOA 2LVSA 2KLOA 3MKLA 3JTGA 2KIUA 1TWAJ 3DEUA 2Y2ZA 3S15J 1R4MB 4HPQA 4PK4A 1NTCA 1UG0A 5K5RA 3TBIA 1RRJA 2HDCA 1V55H 4FX4A 1LJ9A 2RAEA 2ZNZA 3BPVA 3KYLA 1Z3YA 3OS1A 2YU3A 1RR7A 2R7UA 1B72A 5DCFA 2CUEA 2XF6A 2L02A 3W6JB 3C2GA 3BJ6A 2FMLA 5CPRB 4LJZF 1FP2A 1PUEE 3V7CA 3W2AA 3BJAA 1YS6A 2W82A 3SFIA 4PDKA 2DLLA 4B48A 1KQ9A 4WF2A 3WU1B 3J7YJ 3JRGA 2VODA 1SFXA 4ZC3A 2OZ6A 3FKIJ 3KP7A 3H5NA 5FKOA 5FRMA 4UHTA 4M6XA 4ZYDA 1FC3A 1D0YA 3G71I 1UELB 1O3TA 3O2PE 3OY9A 2GA2A 3S8PA 2KISA 3WODF 3BOQA 2Y48A 3MKWB 2YU9J 3A03A 4LK1F 2VXDA 4FT8A 3GW2A 3GFMA 2DOAA 4LITA 3OYAA 2A5YB 1A6QA 5IY5H 3ZGKA 2GWRA 2DA6A 2OZUA 1WQ2A 3SHFA 1G3TA 1X2MA 2KJBA 2YX4A 2X6WA 4DNCA 3JRIA 1HA8A 1BBYA 3SEQA 1EV7A 4G6QA 2JJ7A 3G73A 1X2NA 1Q1HA 2ZKZA 5ICEA 1JI8A 3R60A 2P0WA 2HOAA 3ABMH 1Y8RB 2V79A 5FROA 2R7SA 1P2FA 1XX5A 5TJJA 2RQPA 1IJWC 2G0EA 3J7ZI 2WB1A 2MC3A 2L9RA 2R5ZB 2XPWA 3D5SC 4CHUA 1E0EA 3DQVC 5CJ9A 4DBRA 4OIRF 3L9FA 3M8JA 3MKZA 4OMZA 2Y0MA 3LWFA 1D3YA 2K9QA 3S16J 4RM2A 2K7LA 5HS8A 1R71A 4G8XA 1G3WA 2HXOA 1I1GA 3KZIC 2IGNA 1YOVB 3IAM2 2VJIA 3Q5FA 5M5YJ 4MQVA 2KJCA 4XICA 3I64A 2M30A 4A69C 4CH7A 5GADJ 2QQ9A 4GRIA 4ABZA 4BGDA 3GXOA 2MLGA 1DU0A 5ICFA 1K83J 3BG6A 5E3OA 3HRTA 2K4JA 5ILUA 3K70C 2MD0A 3FDYA 4A3KJ 3OL3A 1RC9A 1BR4A 4HZFA 3RKXA 1OMIA 3K10A 2EV6A 2GA1A 3OIQA 3T0YA 2MSYA 1XGMA 2JWTA 3OYEA 5HODA 1W0UA 3LA3A 1CGPA 1QO0D 4UB8C 5M3FJ 3TP3A 1XMXA 4B4CA 3KE2A 3ZQLA 1TWCJ 2CGPA 1ZRFA 2E2JJ 2OTLI 5ICGA 1AKHB 3CTAA 4KFCA 4IHTA 3CLQA 1P4WA 3F8NA 3WGIA 1YG2A 3ASNH 4BKXA 3OS0A 4RLQA 3K0LA 5AIPA 1W0TA 3SXYA 3FHZA 2E1MC 1QGPA 4ZYEA 2BV6A 5IYCJ 1ZAOA 4LFUA 1JUMA 1FIAA 4L9NA 5TGTA 1HKSA 3QP5A 1K61A 1Y0UA 3I4MJ 3BR2A 2DN0A 2LF8A 1VQNI 4HDUA 5DD8A 3DKYA 5BQTA 2WC2A 2VT2A 5IT9Z 3F72A 2CW7A 3C7JA 5LHGA 3PO2J 1TWFJ 2IGMA 3H92A 4YELA 1SD7A 1A31A 3PQJA 2QEXI 3DWLE 3K6GA 2ESHA 2DJIA 1YJNI 4I0BA 4IRIA 3H0DA 3CC4I 2V26A 2X4HA 2E1NA 4I76A 2DFFA 1GVDA 4HNVA 4AIJA 2XRLA 1LEAA 4JX5A 2L7KA 3GFLA 4A93J 1GDTA 3HPGA 4IO9F 3HSEA 1IDZA 4A2UA 2AXLA 2DMQA 3Q0UA 1W4MA 1P7IA 5AIQA 5J8CA 2R7TA 4A0XA 3PJRA 3I3LA 1DU6A 1UFMA 4BDZA 3QOPA 2MYSA 2IAIA 1KU2A 1X19A 3RJPA 1DPUA 4E7ZA 1WH5A 4DGWB 2IS2A 1DDNA 3TP0A 5BPDA 2DO7A 4IPAA 2B63J 2VUMJ 2HS5A 3LSPA 5D4RA 1RUNA 3PFIA 4UUSB 2F5VA 2ECCA 4EJUA 2ZXWH 1E3OC 1BIBA 3K2ZA 3CCLI 1FTTA 1Z21A 2M5WA 3BWGA 2LFBA 2HPIA 1GV2A 2LBFB 1S29A 4HV6A 5LHIA 1HW1A 2OCEA 2M7AA 1HSTA 1ORKA 2OBPA 3RPUD 4ZYHA 3HKZN 2CFXA 3LSMA 1BC8C 2VKHA 2ACJA 3HDDA 1YHQI 3DLLF 3MCZA 3OYGA 2A3SA 2GAUA 4AD9A 2OF7A 3AL0B 2ZMEB 1XN7A 3EYIA 1T8IA 1MNDA 1HW5A 4OIQF 2JA6J 3JREA 4LG0A 3OYLA 1XD7A 3TL4X 3H5AA 2FU4A 2ZJRF 4A3BJ 5CQGA 3DCFA 1AWCA 1I3AA 1DP7P 2O61A 5JHUA 1IUYA 2WAEA 1MBKA 2BE5F 1HLVA 1XGSA 2RREA 2DMNA 4R8HA 4B1RA 4W1UA 3H3VK 4WX9A 1E17A 2DW4A 5FLVA 2VE8A 1XB4A 4KDPA 2OD5A 5D5UB 5J1RA 2DI3A 2HNHA 2H94A 2LKPA 2WY8Q 1WI9A 3X2QH 3K4KA 2KKOA 4XKCA 5CVVA 1J2XA 1RIOH 3HOSA 4I0AA 4V19K 2OAZA 4IRGA 4GYGA 4UUVA 2PMZN 2IGOA 1I1SA 1ZARA 2LLKA 2Z3YA 4BE1A 4FX0A 4GYIA 2C6YA 1YRNB 4CDGA 4KNYA 2E1OA 5D8KB 3SQNA 1LFPA 2BY2A 4W97A 1IN4A 1FPQA 4RAZA 1IRFA 3DTIA 1HSJA 1WJFA 3L2CA 1PUFB 3FXUA 2R0QC 2LSOA 3GFJA 2LY1A 3M4OJ 3TW6A 2ZO4A 5LGUA 4AYBN 2M4GA 2BEOA 3IRQA 1R5HA 3S1NJ 3T8TA 1BM9A 4AC0A 3DXJF 3QPSA 1OCZH 3L09A 3DU5A 2G7UA 3CJNA 3H9QA 1OR7C 3OV8A 4IZZA 2IW5A 5JVTA 2W00A 1Y6IA 3E5UA 4Z2YA 3BG3A 1X1AA 4XLEA 5E1ZB 1T39A 4ZDLA 1FTZA 1STZA 2JTVA 2IVMA 3J7AO 4IHWA 1S8NA 2DFIA 2JSPA 4S05A 2YSRA 4BACA 2CSOA 2FUG2 3NAUA 1G59A 2EB7A 3LFKA 4E7IA 1R36A 2KDOA 3LSRA 2LKXA 2X1CA 3OIOA 5CVIA 4ESBA 3CC7I 2JN6A 1F5TA 3ECOA 2FSWA 2XGDA 3L7WA 1D8KA 3OYCA 3FMQA 4HQMA 5K7ZA 4YIRX 3CMAI 5FB2A 4OWRB 1LVKA 1S7AA 1NK2P 4MO7A 4CCOA 3GFIA 3V7SA 4U7DA 1QHGA 4B47A 1XCVA 5E20A 1HKQA 1YS7A 2YX7A 3HZJA 2CWEA 1FYMA 1YX3A 3WTVC 3A01B 1F9NA 2VBXA 1FMWA 2PMHA 1OJLA 5H2FC 3BC8A 3KEQA 3NEUA 1O57A 4Q47A 4G7OF 3ZN0A 1SVOA 1MBEA 2XIGA 2R7DA 2FNAA 1XG1A 3I59B 4BY1J 2JUGA 1GLNA 2IGKA 1JUSA 4P55A 5EEAA 3CF2A 1ETWA 3CJQB 1ZTRA 2D1HA 1SEUA 1T0FC 4HOBA 1S3JA 4E7KA 1H89C 1XMKA 2ME6A 3S1MJ 4OU0A 3W6VA 2KP6A 1OCOH 3RPQA 4KA4A 3D5LA 2VI6A 3C2HA 2RDPA 3CP8A 5FKMA 4YIIA 5J40A 2DPDA 3QPTA 2M1BA 5D5VB 1VQ4I 3I56I 2BY1A 1OPCA 3OYJA 4B3AA 4U0VA 4BQNA 3S32A 3M7GA 1B4AA 4PJ0C 2EV5A 1NHAA 4DYQA 4HNTA 1NG6A 2OQRA 3H9GA 2R7FA 2M0CA 3HXLA 3FHNA 1F43A 2Z5UA 1X58A 4M9ZA 2V9PA 3FMSA 4BE2A 2J5PA 4IHVA 4DZJA 1MMSA 2ZXJA 4CCKA 3CMYA 4FASD 3PQKA 2QA4I 3CJTB 4BQQA 4NC6A 3HTUA 2RQQA 3VYRB 1X1BA 3CJRB 4XIDA 1Z6RA 1I6HJ 4UNOA 2EA2A 1W36C 4CCMA 3E0JB 4NQWA 3R6SA 1UHSA 4P9FA 2EFPA 1KYZA 3CDLA 3ERMA 3JAMK 1WWXA 3MKYB 2RKHA 5E3MA 4ZYAA 3ZQQA 1XPXA 2QM3A 4CCJA 1X4OA 1O7FA 1IAWA 4OMYA 2VJ5A 1ERDA 3TDUC 5IP7J 2LY2A 3VSLA 5JHFA 2IJLA 4IOAF 2FF4A 2BXZA 3IKVA 4V2GA 1AKHA 2JA5J 1QNTA 1EJ9A 1S6LA 3OOUA 5D5WB 4RGUA 4IOCF 4BJ5C 5D5XB 2VKEA 2VXZA 5JLWA 2R4GA 2M4KA 2CYYA 3WTWC 1VTNC 4WXHA 2NOGA 3OR1C 2R7VA 1B6AA 2K5CA 4XN0A 3LSTA 4DJAA 1XTAA 3FX3A 4KIFA 3P7NA 2L4MA 5C44J 3WTZA 5B1AH 1UHMA 4LG3A 2AO9A 4YFXF 4DOZA 2X85A 1PYVA 2STTA 5JFRA 1U3EM 1CQTA 2ME0A 2WB1N 3ZQ7A 4XLPF 5B1BH 3J80K 4ENKA 5HDNA 1QRYA 4Y52J 3GTJJ 1G4DA 4I01A 1D8JA 3QPHA 4LIUA 5F27A 4XR6A 5KNLA 3GBGA 3ZMUA 4IQJA 2M8EA 2A6EF 3OWTA 5KAIC 1LDDA 4D9JA 2XGCA 5ICCA 1TNSA 4F91B 3CF5F 1GVJA 4MIMA
chains in the Genus database with same CATH topology
1X2MA 4LOCA 3JRIA 1TWGJ 1GV5A 2JJ7A 1X2NA 2DA2A 2XPVA 3BG9A 2DTZA 3HM5A 1T56A 2EZLA 2HOAA 4G12A 1O4XA 4L5EA 2IBDA 2QF7A 3ZOBA 4DW6A 1IJWC 2G0EA 3BQYA 2L9RA 2R5ZB 4EEFG 2XPWA 1JT6A 4JP0A 4C3HJ 4UUSA 1JJ8C 4QSHA 2LK2A 1P7JA 1WCMJ 2JK3A 3HOYJ 1JGGA 3TW7A 1IC8A 2K9QA 3S16J 3S2HJ 2I10A 2DA1A 4UUTA 4JX4A 1IUFA 3HBLA 4A3FJ 2M9HA 1SFOJ 3H0GJ 1GT0C 2HXOA 4BY7J 3TEDA 4A3IJ 5EGOA 5F0FA 3WHCA 4MFEA 1ETKA 5M5YJ 3HOXJ 4XICA 3LSJA 1XS9A 1ETOA 4A69C 2XSDC 3HOWJ 2N8GA 2XB0X 4XRSG 1LFBA 2K9SA 4JX6A 4ABZA 5M5XJ 3JRAA 2NS8A 4DYCA 1DU0A 1JUPA 1K83J 2W48A 1Q1VA 5E3OA 3B6CA 5IPAA 3SJMA 2XB5A 4A3GJ 4A3KJ 2YUSA 3K2AA 2AHQA 3HGGA 4M3DA 1MBJA 3O8GA 3QPLA 1SANA 5F1JA 2MW8A 5J1UA 4FTHA 5EYRA 5DTDA 1AU7A 3FISA 2MSYA 1BW5A 2JWTA 5HODA 4CYCB 1W0UA 4D5CA 1QVUA 5M3FJ 2L7ZA 3TP3A 1XC5A 4B4CA 4D7MA 5IOZA 2R5YB 1JKPC 3ZQLA 4BBRJ 1TWCJ 2ZB9A 3BR0A 2E2JJ 2X9DA 1AKHB 1YRNA 5F04A 4BKXA 2DA6A 1Y1VJ 1ZK8A 1W0TA 2L0KA 1B72B 1MBGA 5IYCJ 1BW6A 3B6AA 1EF4A 1BJZA 1JUMA 1PUFA 1FIAA 3M3YJ 3CQZJ 1K61A 4XRSA 3I4MJ 4XRMA 2DN0A 3BR2A 4D7NA 2LY9A 3ZQIA 5FJ8J 1S7EA 1QVTA 4FE7A 2WV1A 3PO2J 2HDDA 1TWFJ 3LNQA 2FQ4A 2MGQA 5DS9A 3JRCA 3K7AJ 3S1QJ 5F0HA 4I76A 3G1OA 4I6ZA 1U9OA 1GVDA 4HNVA 1TC3C 2XRLA 4JX5A 4A93J 2CU7A 1GDTA 3S2DJ 4JYKA 1IDZA 2CUFA 2DMQA 3Q0UA 1Z77A 1P7IA 5E3NA 2NVQJ 1OCTC 2GM4A 2DMPA 5GP9A 4FISA 3JRBA 3PM1A 2Y31A 1DU6A 3BR5A 4C3JJ 2IAIA 4A3MJ 3ZQHA 5F0CA 5GPAA 3GTPJ 2DA7A 2HI3A 2VPRA 2CRGA 1TWHJ 4M3FA 1WH5A 9ANTA 1MSFC 3TP0A 5IP6A 1JTYA 5K7FA 2B63J 2VUMJ 2LP0A 3A01A 3LSPA 4UUSB 2ECCA 3GTMJ 3JRHA 1E3OC 1JKOC 1VFCA 4A3JJ 1ZGWA 3BR3A 2H1KA 1FTTA 4IHYA 2LFBA 1GV2A 1ORKA 5EG0A 4IHXA 3HKZN 1U8BA 1WH7A 4MFDA 5C4XJ 1ZKGA 2DMUA 5IYBJ 4S0HB 5C4JJ 3S1RJ 2R5ZA 1LFUP 2ID6A 3HDDA 5EGOB 5M3MJ 2R7ZJ 4RBOA 2OF7A 3BR6A 2CQXA 3Q0VA 3IH3A 2JA6J 3JREA 2DA5A 2K40A 2Y0SN 4A3BJ 1FIPA 2JMWA 1POGA 3DCFA 3FK7A 3BTIA 4QTRA 1APLC 4DZPA 1MBKA 1HLVA 1RESA 5EZGA 2Y9ZA 1HDPA 2DMNA 2FJ1A 4B1RA 5M5WJ 4W1UA 3H3VK 5J1YA 5FLVA 2Y30A 1ETYA 4A3EJ 4FCYA 2HXIA 5J1RA 1A5JA 2K9NA 1LE8A 1FEXA 1ENHA 3UKGA 3GTKJ 2HQ5A 2NVXJ 4Y7NJ 2LR8A 3OSGA 3MN2A 1T33A 2E19A 1B8IA 3BR1A 1BL0A 2PMZN 3JRFA 5EZHA 3LSGA 1H8AC 2LLKA 3HEFA 1F36A 2R93J 1YRNB 2E1OA 1I50J 2NVYJ 4V2FA 4W97A 3Q0WA 2CJJA 2YS9A 1ITYA 1JTXA 3HOVJ 3GTLJ 3C2BA 1PUFB 3BG5A 3S14J 2R0QC 3M4OJ 3TW6A 1MH4A 1G2HA 4AYBN 1H88C 3S1NJ 4AC0A 3FIWA 3QPSA 4GFBA 2NS7A 1VF9A 2JA8J 3GTOJ 3ZQGA 5JLXA 2EZIA 4A3LJ 2O7OA 1JKRC 1Z0XA 3HB9A 3BG3A 3RZDJ 1FTZA 2X48A 5IP9J 2GBYA 3IH2A 4IHWA 4A3CJ 2R92J 1IGNA 1Y1WJ 3NARA 3NAUA 5EDNA 1ZR2A 4IEJA 3LSRA 1MBFA 4D5FA 3GTGJ 2LKXA 2LD5A 3OIOA 1GUUA 2JN6A 2NVTJ 2MG4A 1IDYA 2O9LA 2EQRA 2KDZA 3BTLA 2XGDA 1RKTA 1JT0A 3RQIA 1ETVA 2DJNA 5K7ZA 3WHBA 1IRZA 3E7LA 4A3DJ 1RKWA 3F0CA 1NK2P 4MO7A 3JR9A 1MH3A 4BBSJ 1HF0A 2QCOA 4DYRA 1AHDP 2ECBA 2ID3A 2O8KA 3RZOJ 4XK4A 3A01B 3OSFA 1U78A 4FE4A 1OJLA 3L1PA 3I4NJ 3GTQJ 2XGEA 2HOSA 2M8GX 3G1LA 1VI0A 2DMTA 2E2HJ 2D5VA 5IYDJ 5K7HA 1MBEA 4X1EA 2EH3A 1UG2A 1A6IA 3BT9A 1XG1A 4M3BA 2EZKA 5EG0B 4BY1J 2HYJA 3PO3J 1JUSA 1OFCX 5EEAA 1ETWA 1ZTRA 4QIWN 1VNDA 3ZQCA 5E3LA 1I3QJ 2DA4A 5FKLA 1H89C 5C3EJ 2ME6A 3S1MJ 2L7MP 1FJLA 5IOYA 3W6VA 2VI6A 3QQAA 5FKMA 1JKQC 1JJ6C 2DA3A 2M2EA 3VPRA 1QPIA 2FD5A 3BQZA 4B3AA 4NDLA 4C3IJ 1IV6A 4BXXJ 2P81A 2M34A 5F08A 3ZQFA 4DYQA 4C2MJ 1RETA 2M0CA 3S17J 2X6OA 3SDGA 5EF6A 3IH4A 1LE8B 1F43A 1X58A 2WAQN 4IHVA 3O8HA 4DZJA 3CMYA 1UMQA 2JA7J 1B8IB 4M3EA 1ZR4A 2CQQA 3BTJA 1BA5A 1HCRA 4XIDA 3IV5A 2FX0A 3MVPA 5GPCA 3JRDA 3LOCA 1I6HJ 1IG7A 1RPWA 1HOMA 1UHSA 3CDLA 1WGXA 2E2IJ 5FKNA 2IEKA 1NK3P 3HOUJ 4CYCA 5E3MA 2EBIA 5FLMJ 2LVSA 3MKLA 3G1MA 1TWAJ 2R5YA 2OPTA 2GLOA 2Y2ZA 2HOTA 3BTCA 3S15J 5IP7J 2VKVA 1NTCA 3HGYA 5FKKA 1R9TJ 3DEWA 4V2GA 1AKHA 3CCYA 2JA5J 1ZQ3P 5BNGA 2RAEA 3D1NI 3OOUA 4X6AJ 1WPKA 1RR7A 1B72A 2VKEA 5JLWA 2CUEA 2NOGA 2KT0A 1WI3A 1MNMC 4J19A 5C44J 3SFIA 1ETXA 2L7FP 4M6VA 2AO9A 2ELKA 1HDDC 3JRGA 4MLOA 3FKIJ 5FKOA 1U9NA 1CQTA 2ME0A 2WB1N 2EZHA 5J3LA 3HOZJ 1OCPA 1MBHA 4AUXA 2TRTA 2XPUA 3A02A 1QRYA 2LTPA 2H8RA 4Y52J 3RKQA 3GTJJ 1D5YA 3FK6A 5F27A 1MSEC 1ETQA 2YU9J 3A03A 3GBGA 2TCTA 4RDUA 4M3GA 2XGCA 2Y9YA 2COBA 3Q3SA 4MIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2M A;  4LOC A;  3JRI A;  1TWG J;  1GV5 A;  2JJ7 A;  1X2N A;  2DA2 A;  2XPV A;  3BG9 A;  2DTZ A;  3HM5 A;  1T56 A;  2EZL A;  2HOA A;  4G12 A;  1O4X A;  4L5E A;  2IBD A;  2QF7 A;  3ZOB A;  4DW6 A;  1IJW C;  2G0E A;  3BQY A;  2L9R A;  2R5Z B;  4EEF G;  2XPW A;  1JT6 A;  4JP0 A;  4C3H J;  4UUS A;  1JJ8 C;  4QSH A;  2LK2 A;  1P7J A;  1WCM J;  2JK3 A;  3HOY J;  1JGG A;  3TW7 A;  1IC8 A;  2K9Q A;  3S16 J;  3S2H J;  2I10 A;  2DA1 A;  4UUT A;  4JX4 A;  1IUF A;  3HBL A;  4A3F J;  2M9H A;  1SFO J;  3H0G J;  1GT0 C;  2HXO A;  4BY7 J;  3TED A;  4A3I J;  5EGO A;  5F0F A;  3WHC A;  4MFE A;  1ETK A;  5M5Y J;  3HOX J;  4XIC A;  3LSJ A;  1XS9 A;  1ETO A;  4A69 C;  2XSD C;  3HOW J;  2N8G A;  2XB0 X;  4XRS G;  1LFB A;  2K9S A;  4JX6 A;  4ABZ A;  5M5X J;  3JRA A;  2NS8 A;  4DYC A;  1DU0 A;  1JUP A;  1K83 J;  2W48 A;  1Q1V A;  5E3O A;  3B6C A;  5IPA A;  3SJM A;  2XB5 A;  4A3G J;  4A3K J;  2YUS A;  3K2A A;  2AHQ A;  3HGG A;  4M3D A;  1MBJ A;  3O8G A;  3QPL A;  1SAN A;  5F1J A;  2MW8 A;  5J1U A;  4FTH A;  5EYR A;  5DTD A;  1AU7 A;  3FIS A;  2MSY A;  1BW5 A;  2JWT A;  5HOD A;  4CYC B;  1W0U A;  4D5C A;  1QVU A;  5M3F J;  2L7Z A;  3TP3 A;  1XC5 A;  4B4C A;  4D7M A;  5IOZ A;  2R5Y B;  1JKP C;  3ZQL A;  4BBR J;  1TWC J;  2ZB9 A;  3BR0 A;  2E2J J;  2X9D A;  1AKH B;  1YRN A;  5F04 A;  4BKX A;  2DA6 A;  1Y1V J;  1ZK8 A;  1W0T A;  2L0K A;  1B72 B;  1MBG A;  5IYC J;  1BW6 A;  3B6A A;  1EF4 A;  1BJZ A;  1JUM A;  1PUF A;  1FIA A;  3M3Y J;  3CQZ J;  1K61 A;  4XRS A;  3I4M J;  4XRM A;  2DN0 A;  3BR2 A;  4D7N A;  2LY9 A;  3ZQI A;  5FJ8 J;  1S7E A;  1QVT A;  4FE7 A;  2WV1 A;  3PO2 J;  2HDD A;  1TWF J;  3LNQ A;  2FQ4 A;  2MGQ A;  5DS9 A;  3JRC A;  3K7A J;  3S1Q J;  5F0H A;  4I76 A;  3G1O A;  4I6Z A;  1U9O A;  1GVD A;  4HNV A;  1TC3 C;  2XRL A;  4JX5 A;  4A93 J;  2CU7 A;  1GDT A;  3S2D J;  4JYK A;  1IDZ A;  2CUF A;  2DMQ A;  3Q0U A;  1Z77 A;  1P7I A;  5E3N A;  2NVQ J;  1OCT C;  2GM4 A;  2DMP A;  5GP9 A;  4FIS A;  3JRB A;  3PM1 A;  2Y31 A;  1DU6 A;  3BR5 A;  4C3J J;  2IAI A;  4A3M J;  3ZQH A;  5F0C A;  5GPA A;  3GTP J;  2DA7 A;  2HI3 A;  2VPR A;  2CRG A;  1TWH J;  4M3F A;  1WH5 A;  9ANT A;  1MSF C;  3TP0 A;  5IP6 A;  1JTY A;  5K7F A;  2B63 J;  2VUM J;  2LP0 A;  3A01 A;  3LSP A;  4UUS B;  2ECC A;  3GTM J;  3JRH A;  1E3O C;  1JKO C;  1VFC A;  4A3J J;  1ZGW A;  3BR3 A;  2H1K A;  1FTT A;  4IHY A;  2LFB A;  1GV2 A;  1ORK A;  5EG0 A;  4IHX A;  3HKZ N;  1U8B A;  1WH7 A;  4MFD A;  5C4X J;  1ZKG A;  2DMU A;  5IYB J;  4S0H B;  5C4J J;  3S1R J;  2R5Z A;  1LFU P;  2ID6 A;  3HDD A;  5EGO B;  5M3M J;  2R7Z J;  4RBO A;  2OF7 A;  3BR6 A;  2CQX A;  3Q0V A;  3IH3 A;  2JA6 J;  3JRE A;  2DA5 A;  2K40 A;  2Y0S N;  4A3B J;  1FIP A;  2JMW A;  1POG A;  3DCF A;  3FK7 A;  3BTI A;  4QTR A;  1APL C;  4DZP A;  1MBK A;  1HLV A;  1RES A;  5EZG A;  2Y9Z A;  1HDP A;  2DMN A;  2FJ1 A;  4B1R A;  5M5W J;  4W1U A;  3H3V K;  5J1Y A;  5FLV A;  2Y30 A;  1ETY A;  4A3E J;  4FCY A;  2HXI A;  5J1R A;  1A5J A;  2K9N A;  1LE8 A;  1FEX A;  1ENH A;  3UKG A;  3GTK J;  2HQ5 A;  2NVX J;  4Y7N J;  2LR8 A;  3OSG A;  3MN2 A;  1T33 A;  2E19 A;  1B8I A;  3BR1 A;  1BL0 A;  2PMZ N;  3JRF A;  5EZH A;  3LSG A;  1H8A C;  2LLK A;  3HEF A;  1F36 A;  2R93 J;  1YRN B;  2E1O A;  1I50 J;  2NVY J;  4V2F A;  4W97 A;  3Q0W A;  2CJJ A;  2YS9 A;  1ITY A;  1JTX A;  3HOV J;  3GTL J;  3C2B A;  1PUF B;  3BG5 A;  3S14 J;  2R0Q C;  3M4O J;  3TW6 A;  1MH4 A;  1G2H A;  4AYB N;  1H88 C;  3S1N J;  4AC0 A;  3FIW A;  3QPS A;  4GFB A;  2NS7 A;  1VF9 A;  2JA8 J;  3GTO J;  3ZQG A;  5JLX A;  2EZI A;  4A3L J;  2O7O A;  1JKR C;  1Z0X A;  3HB9 A;  3BG3 A;  3RZD J;  1FTZ A;  2X48 A;  5IP9 J;  2GBY A;  3IH2 A;  4IHW A;  4A3C J;  2R92 J;  1IGN A;  1Y1W J;  3NAR A;  3NAU A;  5EDN A;  1ZR2 A;  4IEJ A;  3LSR A;  1MBF A;  4D5F A;  3GTG J;  2LKX A;  2LD5 A;  3OIO A;  1GUU A;  2JN6 A;  2NVT J;  2MG4 A;  1IDY A;  2O9L A;  2EQR A;  2KDZ A;  3BTL A;  2XGD A;  1RKT A;  1JT0 A;  3RQI A;  1ETV A;  2DJN A;  5K7Z A;  3WHB A;  1IRZ A;  3E7L A;  4A3D J;  1RKW A;  3F0C A;  1NK2 P;  4MO7 A;  3JR9 A;  1MH3 A;  4BBS J;  1HF0 A;  2QCO A;  4DYR A;  1AHD P;  2ECB A;  2ID3 A;  2O8K A;  3RZO J;  4XK4 A;  3A01 B;  3OSF A;  1U78 A;  4FE4 A;  1OJL A;  3L1P A;  3I4N J;  3GTQ J;  2XGE A;  2HOS A;  2M8G X;  3G1L A;  1VI0 A;  2DMT A;  2E2H J;  2D5V A;  5IYD J;  5K7H A;  1MBE A;  4X1E A;  2EH3 A;  1UG2 A;  1A6I A;  3BT9 A;  1XG1 A;  4M3B A;  2EZK A;  5EG0 B;  4BY1 J;  2HYJ A;  3PO3 J;  1JUS A;  1OFC X;  5EEA A;  1ETW A;  1ZTR A;  4QIW N;  1VND A;  3ZQC A;  5E3L A;  1I3Q J;  2DA4 A;  5FKL A;  1H89 C;  5C3E J;  2ME6 A;  3S1M J;  2L7M P;  1FJL A;  5IOY A;  3W6V A;  2VI6 A;  3QQA A;  5FKM A;  1JKQ C;  1JJ6 C;  2DA3 A;  2M2E A;  3VPR A;  1QPI A;  2FD5 A;  3BQZ A;  4B3A A;  4NDL A;  4C3I J;  1IV6 A;  4BXX J;  2P81 A;  2M34 A;  5F08 A;  3ZQF A;  4DYQ A;  4C2M J;  1RET A;  2M0C A;  3S17 J;  2X6O A;  3SDG A;  5EF6 A;  3IH4 A;  1LE8 B;  1F43 A;  1X58 A;  2WAQ N;  4IHV A;  3O8H A;  4DZJ A;  3CMY A;  1UMQ A;  2JA7 J;  1B8I B;  4M3E A;  1ZR4 A;  2CQQ A;  3BTJ A;  1BA5 A;  1HCR A;  4XID A;  3IV5 A;  2FX0 A;  3MVP A;  5GPC A;  3JRD A;  3LOC A;  1I6H J;  1IG7 A;  1RPW A;  1HOM A;  1UHS A;  3CDL A;  1WGX A;  2E2I J;  5FKN A;  2IEK A;  1NK3 P;  3HOU J;  4CYC A;  5E3M A;  2EBI A;  5FLM J;  2LVS A;  3MKL A;  3G1M A;  1TWA J;  2R5Y A;  2OPT A;  2GLO A;  2Y2Z A;  2HOT A;  3BTC A;  3S15 J;  5IP7 J;  2VKV A;  1NTC A;  3HGY A;  5FKK A;  1R9T J;  3DEW A;  4V2G A;  1AKH A;  3CCY A;  2JA5 J;  1ZQ3 P;  5BNG A;  2RAE A;  3D1N I;  3OOU A;  4X6A J;  1WPK A;  1RR7 A;  1B72 A;  2VKE A;  5JLW A;  2CUE A;  2NOG A;  2KT0 A;  1WI3 A;  1MNM C;  4J19 A;  5C44 J;  3SFI A;  1ETX A;  2L7F P;  4M6V A;  2AO9 A;  2ELK A;  1HDD C;  3JRG A;  4MLO A;  3FKI J;  5FKO A;  1U9N A;  1CQT A;  2ME0 A;  2WB1 N;  2EZH A;  5J3L A;  3HOZ J;  1OCP A;  1MBH A;  4AUX A;  2TRT A;  2XPU A;  3A02 A;  1QRY A;  2LTP A;  2H8R A;  4Y52 J;  3RKQ A;  3GTJ J;  1D5Y A;  3FK6 A;  5F27 A;  1MSE C;  1ETQ A;  2YU9 J;  3A03 A;  3GBG A;  2TCT A;  4RDU A;  4M3G A;  2XGC A;  2Y9Y A;  2COB A;  3Q3S A;  4MIM A; 
#chains in the Genus database with same CATH topology
 2IPQ X;  4A0Z A;  3FMR A;  4LOC A;  2G9W A;  1BN5 A;  5DM7 F;  1R1V A;  3KYC B;  2DK8 A;  2HWV A;  4EM2 A;  2D45 A;  1EH8 A;  1FLI A;  1GXP A;  1T95 A;  2DA2 A;  2X1D A;  3BG9 A;  3ULQ B;  1IF1 A;  2ZBK A;  1RUO A;  2PG4 A;  3EUA A;  3HM5 A;  3KLN A;  5CVR A;  2NS0 A;  1FOW A;  1W5C C;  4G12 A;  2ZCW A;  2IBD A;  3ZOB A;  4I7H A;  2M7B A;  5LRR A;  1IN8 A;  1V54 H;  3KEY A;  4EEF G;  1JT6 A;  4UUS A;  4QSH A;  1M1E B;  1ZH5 A;  2E36 A;  1FZP B;  2LK2 A;  1WJD A;  1Z3X A;  1WCM J;  1HKT A;  4HYE A;  4A6D A;  1IXR C;  2JK3 A;  4XRF A;  4G7H F;  2IT0 A;  3CD6 I;  3TW7 A;  4Q48 A;  1TLH B;  4A3F J;  3G4S I;  2O8X A;  2L2O A;  5HDG A;  3H0G J;  4XSZ F;  3F9K A;  2B0L A;  3BPX A;  5KCM A;  4EJO A;  4A3I J;  1L3L A;  3KP6 A;  3RYP A;  4MFE A;  1ETK A;  3P9C A;  1X1D A;  3HOT A;  4II3 A;  3HC7 A;  1O3Q A;  1ETO A;  2XSD C;  4L5J A;  2N8G A;  4XRS G;  2K9S A;  5M5X J;  3JRA A;  2Q1Z B;  2DQL A;  2NS8 A;  1JUP A;  3H35 A;  4CSW A;  1I5Z A;  5FLX Z;  1NH3 A;  3B6C A;  2H6B A;  3ZPL A;  3F22 A;  4ESJ A;  1SMT A;  2OUM A;  2IRF G;  1YTY A;  4PSW A;  4LK0 F;  5DCM B;  2YUS A;  3K2A A;  5IT3 A;  2O3F A;  4ZDO A;  4LLG F;  1MBJ A;  3O8G A;  3QPL A;  1SAN A;  3FKJ A;  2HPM A;  3WG9 A;  1D0Z A;  2VE9 A;  3GME A;  1XGO A;  2M3A A;  1O7L A;  1G3Y A;  1ZN2 A;  2QSF X;  2WBM A;  5L3C A;  3ABL H;  1Z91 A;  3FIS A;  2Z9O A;  4CCN A;  1HQC A;  4IKF A;  2CO5 A;  1JHH A;  3BP8 A;  4E7S A;  1XC5 A;  5IOZ A;  4P5O A;  4KYW A;  3AL0 C;  4BBR J;  2ZME C;  1SD4 A;  1FYL A;  1BI2 A;  2ZB9 A;  3BR0 A;  3KZY A;  4OIN F;  3ZMZ A;  3OYI A;  1YRN A;  3TMO A;  1V5G A;  4UV9 A;  1K79 A;  2L0K A;  4N9I A;  3FXL A;  1MBG A;  3B6A A;  1EF4 A;  4CZC A;  1PUF A;  2DOF A;  1LNW A;  1W7P B;  4JK1 X;  4G94 A;  3HRM A;  2FXA A;  4ENM A;  2K9L A;  2HVQ A;  2X6X A;  3BZC A;  2TDX A;  2DFE A;  2PMU A;  1T98 A;  3L2U A;  5D6E A;  2LY9 A;  3ZQI A;  1BOA A;  3AG3 H;  4KUM A;  5FJ8 J;  2IA2 A;  3EYY A;  1KQ8 A;  1W1W E;  5D6F A;  3MFK A;  2WV1 A;  3DKX A;  2HDD A;  5GTI C;  1AOY A;  2FQ4 A;  2MGQ A;  2HQN A;  5JI6 A;  3K70 D;  2Y75 A;  1YO5 C;  1T38 A;  3K4C A;  3Q9V A;  5D4S A;  4F55 A;  4PGH A;  5HS7 A;  5L3F A;  2L5Q A;  1TC3 C;  1X3Z B;  2KZV A;  2V9V A;  4RGR A;  2CFO A;  1P4A A;  2PFB A;  4JYK A;  3M1E A;  5J4V A;  3S2D J;  2Z16 A;  2W25 A;  4KMF A;  5E3N A;  3BY6 A;  2DYR H;  3CO7 C;  2GM4 A;  2DMP A;  2I5U A;  1ZRC A;  5E1W A;  1OCR H;  3R0A A;  1IV8 A;  1Y0N A;  2XAG A;  4NBQ A;  2JPB A;  3S2W A;  4ESF A;  3FF5 A;  3TO7 A;  3IAS 2;  3GTP J;  4PJJ A;  2F2E A;  1TWH J;  3E3V A;  4ASN A;  4HG2 A;  4WXC A;  4WCG A;  1KU7 A;  1IW7 F;  5IP6 A;  1JTY A;  5ED4 A;  4UVB A;  4EGZ A;  2FQ3 A;  1AA7 A;  4RGS A;  2LP0 A;  3HSF A;  3A01 A;  4UXN A;  2V1X A;  1ZEL A;  4HDV A;  2E34 A;  2QBY B;  2BGC A;  3DKW A;  2ESN A;  4ZZL A;  1MNE A;  2BHZ A;  3V8K A;  1ZG3 A;  4OOI A;  4KIG A;  3JRH A;  1RR8 C;  5DDG A;  3MAJ A;  3T1B A;  4A3J J;  3KZZ A;  4HX7 A;  4IHY A;  3OIP A;  1IO2 A;  2MA3 A;  3I59 A;  1FNN A;  4I02 A;  3GZ5 A;  4MEX F;  1WH7 A;  4MFD A;  2LC2 A;  1ZKG A;  5IYB J;  3S1R J;  4B3X A;  2ID6 A;  2P5V A;  5M3M J;  4AVZ A;  1I27 A;  2GXA A;  4A5M A;  2V6E A;  3BR6 A;  1S9H A;  1FBQ A;  5DD4 A;  3Q0V A;  4RB1 A;  4BEH A;  1Z7U A;  5E8G A;  3W6K B;  3FXM A;  2UUZ A;  3C3W A;  2I8D A;  2K40 A;  1FIP A;  1WRJ A;  3KLO A;  3BTI A;  3HL2 A;  2IS6 A;  1IRX A;  4XOR A;  2DT6 A;  5B5E C;  2Y9Z A;  1HDP A;  1WJA A;  4HAM A;  4L0Y B;  5LD2 C;  4XL9 A;  3K1M A;  5F6F A;  1VQK I;  2Y30 A;  4M9X A;  4C9Y A;  4HQE A;  4TV7 A;  3A2K A;  1BI3 A;  3MQ0 A;  2K27 A;  2QQA A;  4A3E J;  2XAS A;  4NQW B;  4IQ4 A;  1QBJ A;  5E18 F;  2HXI A;  5HS9 A;  2ZXH A;  2ISZ A;  1ENH A;  3VYT B;  2KMU A;  4F3Q A;  2HDW A;  5HLG A;  3UKG A;  4CCL A;  3QYF A;  3SEZ A;  3L00 A;  1LKX A;  3BCA A;  4AVP A;  2H8W A;  4I2O A;  2J5O A;  3MN2 A;  3S3M A;  2E19 A;  3FXQ A;  2QSG X;  4MHG A;  1BL0 A;  2E71 A;  2A69 F;  2W57 A;  3HJE A;  4MTD A;  3JRF A;  5EZH A;  3LSG A;  1K78 B;  2R93 J;  4L0Z B;  1I50 J;  1XGN A;  4LMY A;  4ZH4 F;  2K9M A;  3MZY A;  5AON A;  2CJJ A;  3RKW A;  3RTR A;  3WE3 A;  3BG5 A;  3QOE A;  1QPM A;  3ZMT A;  3MWM A;  2CW8 A;  1OYI A;  4F7Z A;  2QSH X;  2CV1 A;  1H88 C;  1B9M A;  4B09 A;  4GFB A;  5KVR A;  4XQF A;  1VF9 A;  3FXK A;  4HA8 A;  2JA8 J;  3DPU A;  4BUP A;  2HU9 A;  3I4P A;  2P7V B;  1X1C A;  2EZI A;  3SZT A;  4RS8 A;  2LMD A;  2O7O A;  2HVS A;  4UVC A;  1JKR C;  1IN6 A;  2MD5 A;  1YQA A;  1TQP A;  2X48 A;  4O5V A;  4PJN A;  2A68 F;  3K1N A;  4XSX F;  1G6N A;  4A3C J;  2X6Y A;  1R23 A;  2DOE A;  2CQK A;  1IGN A;  2KRF A;  2VN2 A;  4BE0 A;  1A35 A;  3ECH A;  1MD0 A;  2HKO A;  1J0R A;  4RB3 C;  1ZR2 A;  3K4M A;  4IEJ A;  3KYD B;  2MBF A;  2LD5 A;  1IN5 A;  2NVT J;  1B9N A;  1IDY A;  2O9L A;  3I53 A;  4RAY A;  1JT0 A;  3BTL A;  1VQ9 I;  1RZ4 A;  3RQI A;  1ETV A;  2BYV E;  3WHB A;  4C2T A;  3WE2 A;  2GIZ A;  1UST A;  1VQL I;  2OV7 A;  5IT9 K;  2W84 A;  1KA8 A;  3F0C A;  1TQM A;  2JPC A;  4BDY A;  1LQ1 A;  1MMD A;  3ERE D;  4G6T B;  1L0O C;  2QCO A;  4FQG A;  1AHD P;  3TO9 A;  2ECB A;  2JQ7 A;  3N4M A;  1BOB A;  3BCB A;  2HOS A;  4PFO A;  2M8G X;  1BIA A;  3G1L A;  3HSR A;  2EFW A;  1VI0 A;  2DMT A;  3ZXS A;  5K7H A;  2P7C B;  3FM3 A;  4M9S A;  2EH3 A;  1EH6 A;  1UG2 A;  3BT9 A;  2NYX A;  5EG0 B;  2EZK A;  1KZH A;  1LEB A;  1YFH A;  3CUQ B;  2G7H A;  2ZNY A;  4C30 A;  1WJ5 A;  1B59 A;  5GTH C;  3H3U A;  4QIW N;  4YFN F;  3ZQC A;  5E3L A;  4M74 A;  4IRH A;  1TQI A;  2QLZ A;  3TOA A;  4IF4 A;  4ENN A;  2L7M P;  3R4K A;  1IRG A;  1VZ0 A;  3WTY C;  3SZP A;  4YRV A;  5E79 C;  4EM1 A;  1DUX C;  2ZFU A;  3NRV A;  1JKQ C;  2WA0 A;  3ELK A;  2R7X A;  1JJ6 C;  2DA3 A;  3I58 A;  3VPR A;  4XM3 A;  3BQZ A;  2EFO A;  4JQF A;  3ROU A;  2MH2 A;  5JVG F;  1UB9 A;  3GCM A;  5L3B A;  3CCU I;  4BXX J;  4JBA A;  5F1R A;  2M34 A;  2ZJP F;  1WJC A;  3ZCO A;  1HC8 A;  3DBR B;  1S5L C;  4C2M J;  1Z7L A;  2X6O A;  1LE8 B;  4O6J A;  2R7R A;  4EM0 B;  3O8H A;  1UMQ A;  2HVR A;  4H4K C;  4KJZ A;  3GEZ A;  3KP2 A;  4WXD A;  2BY0 A;  4R79 A;  4M3E A;  5GAG J;  2V1D A;  5GAH J;  2BZT A;  5DCM A;  2AQF A;  4BHP A;  3CMM A;  3FZV A;  4BS9 A;  4ITV A;  2FX0 A;  3MVP A;  5GPC A;  3GVA A;  2LYC A;  3JRD A;  3LOC A;  3QU6 A;  5FGM A;  1SFU A;  3F23 A;  1YJ9 I;  1YIJ I;  1IG7 A;  1HOM A;  2M45 A;  3FXO A;  3WU0 A;  3GLL A;  1WGX A;  4BXU A;  4EVI A;  2E2I J;  5FKN A;  2QQB A;  3GYH X;  3RYR A;  5GAE J;  1FOY A;  2VJ4 A;  3RPU A;  3HYI A;  1I6X A;  2OPT A;  2HOT A;  3BTC A;  3OYK A;  4EJW A;  3EQL F;  2ZSH B;  2VKV A;  5FKK A;  3K9T A;  1R58 A;  3DEW A;  1R9T J;  4LIV A;  2VL8 A;  2AXT C;  3D1N I;  4C2U A;  2O5R A;  1IN7 A;  2DQR A;  2F48 A;  2YPR A;  3VB2 A;  1U0J A;  2LRD A;  4MQ9 F;  3OR2 C;  3A0H C;  4CA0 A;  1OKR A;  2KPM A;  4JOM A;  2QKM B;  1YIT I;  1W7P A;  2V9K A;  4F52 A;  3BJO A;  1MNM C;  1ZHF A;  4KN4 X;  4J19 A;  4XKB A;  2R7O A;  5J6X A;  1FX7 A;  3IKT A;  1OLT A;  2ZSI B;  5H20 A;  2K3F A;  4GGG A;  2ELK A;  2Q2E B;  4S04 A;  4MLO A;  4RM3 A;  3B02 A;  2BBY A;  3IUO A;  1U9N A;  1H9G A;  3HPH A;  1YW7 A;  4MNU A;  1TP4 A;  1ZLJ A;  2CMP A;  2EZH A;  2KIF A;  3DTK A;  5J3L A;  3HOZ J;  1OCP A;  4AUX A;  3AG4 H;  1BR1 A;  2QQ8 A;  1ZYR F;  3A02 A;  2JA2 A;  2OTJ I;  2LTP A;  4ENJ A;  4NNJ A;  3FK6 A;  3M8F A;  4XLC A;  1SVM A;  1MSE C;  1W36 D;  1ETQ A;  1QZE A;  1TNT A;  1WJE A;  2F5F A;  3TOB A;  2R3S A;  4Z6Y A;  4RDU A;  1LDJ A;  4GO1 A;  2VAS A;  4NB5 A;  1W5S A;  2UXX A;  1YI2 I;  5KHD A;  4XLA A;  3OYM A;  1LB2 A;  2P8T A;  3RKY A;  2OU2 A;  3EUK L;  1TWG J;  4Y13 A;  1NG7 A;  2HQA A;  1REP C;  1GV5 A;  4F92 B;  3J81 Z;  3QWL A;  4KIB A;  2XPV A;  4HEA 2;  3RSN A;  2VC1 A;  2KRC A;  2OC6 A;  1T56 A;  1XSV A;  2EZL A;  3GF2 A;  4EJV A;  2DT7 B;  3E6M A;  2FRH A;  4L5E A;  2QF7 A;  3OS2 A;  2X1E A;  4DW6 A;  1ODD A;  5JR3 A;  2IXS A;  3BQY A;  3I54 A;  2UV1 A;  2QBY A;  2HZD A;  4JP0 A;  2BY3 A;  4C3H J;  1P6R A;  4U0W A;  1JJ8 C;  3FWE A;  3UNG C;  5KK1 A;  3W2V A;  1TTY A;  2W1O A;  1P7J A;  4BEH B;  2WV0 A;  3PNY A;  3J7A Y;  3HOY J;  4KIT B;  1JGG A;  1Z05 A;  2I10 A;  2DA1 A;  3JTH A;  4JX4 A;  1IUF A;  3HBL A;  1MZB A;  3FXR A;  4E7J A;  2JVG A;  1WKM A;  2PX9 A;  2RNJ A;  3GUD A;  2F4M B;  4OAY A;  1Y39 A;  3TED A;  5FRN A;  3NQO A;  3WHC A;  3GZ6 A;  1IXS B;  2LF7 A;  5DUK A;  4XON A;  2CH0 A;  4AM3 A;  1XS9 A;  3HOW J;  1SVL A;  2XB0 X;  2R7Q A;  2NNN A;  4JX6 A;  5HLH A;  4DYC A;  2LDU A;  3RDI A;  1ZLK A;  3VYS B;  1R6R A;  3PSI A;  1TZL A;  1JXS A;  2ELJ A;  2E60 A;  4R1H A;  2OCC H;  2L9N A;  2K86 A;  2FNP A;  2VQG A;  2XV4 S;  2CQN A;  3I5U A;  2V6C A;  3HGG A;  3E1S A;  4LLL A;  1XDS A;  1RI7 A;  2F5E A;  2Z33 A;  3HIF A;  3RIR A;  5F1J A;  1QZZ A;  3PIO F;  1YW9 A;  2GXG A;  3SFZ A;  2QKL B;  4FTH A;  2IA0 A;  5EYR A;  5DTD A;  3E5X A;  3WTS C;  1AU7 A;  1BW5 A;  2CS3 A;  2HEO A;  4CYC B;  2COM A;  5CYV A;  1QVU A;  2L7Z A;  1SD5 A;  2VJJ A;  4G9Y A;  4XLN F;  4QWQ A;  2R5Y B;  2V4J C;  2PEX A;  1JKP C;  1UJ8 A;  4O3M A;  2KQR A;  1K78 A;  1O3R A;  5FD5 A;  5FD6 A;  1UZC A;  2ICW G;  2X9D A;  4NUB A;  4PCQ A;  2MAB A;  3U9G A;  2E5N A;  3K4N A;  2HOE A;  5DUI A;  4Y4R A;  2W7N A;  1BW6 A;  3M3Y J;  1X3W B;  1QU3 A;  1YYV A;  1GXQ A;  2ZFW A;  3CQZ J;  5HLT A;  4CGZ A;  2F5C A;  4XRM A;  3LAJ A;  2VIX A;  1V5E A;  3V42 A;  2BOL A;  2HYF A;  3EUH A;  4BHC A;  5FO5 A;  4HV5 A;  1S7E A;  2H27 A;  2DYS H;  2E35 A;  3BRO A;  1ON1 A;  1JGS A;  3D5R C;  3GWZ A;  1Z9C A;  2PLY A;  1LDK B;  4HLX A;  5DS9 A;  3F21 A;  3I55 I;  1S72 I;  3K7A J;  2EV0 A;  3S1Q J;  2A6T A;  5F0H A;  2UWM A;  5CQE A;  4QPQ A;  3VSK A;  3T5X A;  5HNF A;  2NOJ B;  3G1O A;  5LLQ A;  1U9O A;  3CCQ I;  1U2W A;  2A05 A;  1P92 A;  2KZG A;  4HF0 A;  5DM6 F;  2VKD A;  4PZJ A;  4EGY A;  2CUF A;  1FBU A;  2LRE A;  1Z77 A;  3ZMV A;  2NVQ J;  3I0T A;  1ZRD A;  3JRB A;  2EFN A;  3PM1 A;  3QU3 A;  4P1W A;  3LSH A;  1TBX A;  4IX7 A;  4C3J J;  6PAX A;  4L9V A;  2EK5 A;  3EUH C;  4HRI A;  4A3M J;  4UVA A;  4EV0 A;  5A2Q Z;  4P9U A;  2M87 A;  3ZMD A;  1U5T B;  2DA7 A;  2HI3 A;  4OAZ A;  3V8J A;  2VPR A;  1JHF A;  4RAF A;  2FMY A;  9ANT A;  1IXC A;  1FT9 A;  3LQR A;  4RAG A;  5J47 A;  2NNY A;  4N0B A;  5K7F A;  3CLO A;  2DOD A;  1SFK A;  2X51 A;  2RVC A;  4KMU X;  2YR2 A;  1DGR M;  1MJB A;  2W85 A;  3PFY A;  2P6S A;  3JCU C;  3PL8 A;  2DTR A;  3DBH B;  3GTM J;  2E5Z A;  5F64 A;  1JE8 A;  2E1C A;  2HGC A;  1JKO C;  3O3K A;  3BR3 A;  1ZGW A;  2FOW A;  3JW4 A;  2AQE A;  3GZN B;  1Y56 A;  3E6B A;  4E6K G;  3PIP F;  3H3Z A;  2QVO A;  3HHH A;  1DGW Y;  1P9Q C;  5FFX A;  2R7W A;  5EG0 A;  1CF7 B;  2EFQ A;  3NWT A;  3CUQ A;  1U8B A;  2P4W A;  3ZN1 A;  3DBL B;  1VQ7 I;  1OQY A;  4LLN A;  5C4X J;  4KT6 A;  5C4J J;  1UCR A;  2GZW A;  5EGO B;  4NC8 A;  2ZJ2 A;  3U1D A;  2EIM H;  4MEY F;  5HNH A;  3I71 A;  3HTS B;  3KIO A;  4XLF A;  4RB0 A;  4BQA A;  2HQR A;  2DA5 A;  2DPU A;  2JZY A;  3W2W A;  2JMW A;  1QHH D;  4QTR A;  3FK7 A;  1APL C;  3K69 A;  4UB6 C;  4DZP A;  2DFH A;  4U7B A;  1YW8 A;  1TW2 A;  5E1X A;  5EZG A;  1R5I D;  3U1K A;  2FJ1 A;  5M5W J;  4KN7 X;  5ILS A;  4RA2 A;  2FOK A;  1BI1 A;  1LE8 A;  1J5Y A;  1QQI A;  3FBN B;  2K3P A;  3GTK J;  2HQ5 A;  3CUQ C;  2NVX J;  2KHM A;  4HLY A;  3RI4 A;  4Y7N J;  4FET A;  2FBK A;  1OIS A;  4BJT A;  3MMY B;  3OYN A;  3VOD A;  3WU2 C;  1H9T A;  3BR1 A;  3DF8 A;  3V7R A;  1ONV A;  3VFZ A;  1FMV A;  3LSI A;  5LEK A;  2H1L A;  2NVY J;  4A6E A;  2ADU A;  2B7E A;  3ESW B;  4V2F A;  3L2W A;  2UZK A;  4J01 A;  1J75 A;  2CQ7 A;  2LG4 A;  3ZRG A;  3CZ6 A;  1R00 A;  2JUC A;  2YS9 A;  5FLX K;  2HTJ A;  1ITY A;  1VQ5 I;  3U21 A;  1K6O A;  3DV8 A;  2Y0S A;  3V8L A;  3S14 J;  3E5Q A;  3S3N A;  1HXD A;  3P9I A;  1G2H A;  2E7X A;  2EJR A;  3KP4 A;  4BXF A;  1I39 A;  1OCC H;  2RC4 A;  4CXF A;  5L3G A;  3GX4 X;  4H0E A;  1K7A A;  3ZR8 X;  2ISY A;  4NC7 A;  3DEE A;  4HBL A;  2EWN A;  1Z0X A;  3S3O A;  5K1Y A;  1KU3 A;  3A1Y A;  2HKX A;  3DTE A;  5IP9 J;  3AAF A;  1U8R A;  2DDA A;  2A5W A;  2GBY A;  1WSU A;  1R1T A;  3LA7 A;  3NAR A;  2L4A A;  4RB2 C;  4PSX A;  3CCS I;  2Q2E A;  2VPL A;  4E7L A;  2L54 A;  2F4O B;  3OMY A;  3BZK A;  2ZC2 A;  4B44 A;  1MBF A;  2MH9 A;  4D5F A;  1HW2 A;  3GTG J;  1GUU A;  1ZG5 A;  2MLK A;  3IWF A;  1W5T A;  2KDZ A;  3VYU B;  2VQC A;  1TW3 A;  4GXO A;  2EIN H;  1MMG A;  3D0S A;  4A0Y A;  1IRZ A;  1ZGA A;  3OOP A;  3ZMS A;  2Q0O A;  1PP7 U;  3OYB A;  4A3D J;  3L2V A;  2IS4 A;  4BBS J;  1HF0 A;  1SMY F;  1GHC A;  1A36 A;  2Z2S B;  4EQQ A;  3M07 A;  4XK4 A;  3OSF A;  2VOP A;  1F4K A;  3FM5 A;  4FE4 A;  4B43 A;  4AIK A;  2XF5 A;  3I4N J;  3GTQ J;  2XGE A;  1DP3 A;  3CCR I;  3KCC A;  2BXY A;  4XBF A;  4BL0 B;  4AU7 A;  2D5V A;  2E2H J;  5IYD J;  1X3U A;  4X1E A;  1A6I A;  4KIC A;  3CCM I;  3UR3 C;  4M3B A;  3PO3 J;  3WTT C;  3ISP A;  2EPF A;  2H6C A;  1VND A;  1QA6 A;  2BVM A;  2DA4 A;  5C3E J;  4A5N A;  4QLC U;  1FJL A;  2MFZ A;  3H9J A;  4AWX B;  3FXJ A;  3SZG A;  1PVE A;  4ZJZ A;  3HRS A;  3TO6 A;  4PGG A;  2M2E A;  4XNF A;  4RMN A;  1MMA A;  2HR3 A;  4EJT A;  4NDL A;  2X0L A;  1T2K A;  3KFW X;  2P5L C;  1IV6 A;  2P81 A;  2VT3 A;  1B1B A;  1XSX A;  3NWS A;  5F08 A;  4BAY A;  2XAJ A;  1A04 A;  5CKT A;  1K4T A;  4PJL A;  3S17 J;  5EF6 A;  3PSF A;  2D1V A;  3BG7 A;  4Y17 A;  3SYT A;  2GQQ A;  4YIF A;  1J09 A;  4M72 A;  1B8I B;  1QZY A;  2FEZ A;  2CQQ A;  3BTJ A;  1WFX A;  1H0M A;  1HCR A;  3IV5 A;  1DQU A;  2GOM A;  5LBQ A;  1VQ6 I;  3K4L A;  3LFU A;  3AG2 H;  2IEK A;  2B9S A;  1NK3 P;  4CYC A;  1PP8 F;  5FLM J;  4HX4 A;  2KIQ A;  3G1M A;  2CV0 A;  4K2E A;  2R5Y A;  3S93 A;  4CO8 A;  2GLO A;  2VBZ A;  3N05 A;  3HGY A;  2XDV A;  1YX5 A;  3G6E I;  3CCY A;  3F8B A;  5HDK A;  2AS5 F;  5E17 F;  1ZQ3 P;  5BNG A;  4X6A J;  4HF2 A;  1WPK A;  2A07 F;  3DFG A;  2IP2 A;  2WWY A;  4G7Z F;  2WAQ A;  4AID A;  1BR2 A;  3OL4 A;  3TQN A;  1LPQ A;  2K4B A;  4F93 B;  2KT0 A;  1WI3 A;  3B73 A;  4BH9 A;  2QGU A;  1MGT A;  3DU6 A;  1KGS A;  2EIK H;  3LL7 A;  3E6C C;  1YE9 A;  1ZG1 A;  1ETX A;  1ZGJ A;  2L7F P;  2XAU A;  4ON0 A;  4BNC A;  3LSK A;  4M6V A;  1KON A;  1HDD C;  1Z67 A;  4L18 B;  2M0M A;  4IHS A;  4BU2 A;  4BHB A;  4HSR A;  5EEG A;  3RCO A;  1MBH A;  2XAH A;  1SC7 A;  2TRT A;  2XPU A;  1EA3 A;  4IXA A;  5DEQ A;  2W4S A;  3H1C A;  2XRO A;  3RKQ A;  1D5Y A;  2H8R A;  1N75 A;  1E2X A;  4E4H A;  2PBI A;  3BZ6 A;  3KP5 A;  2TCT A;  2V1N A;  1FSE A;  4M3G A;  2Y9Y A;  2RGV A;  2COB A;  2JT1 A;  3TDZ C;  3V4G A;  4N4O B;  4NHJ A;  3Q3S A;  3HRU A;  2LOO A;  2XF7 A;  2BVL A;  3W3C A;  4QPO A;  3LAP A;  2EIJ H;  4DBQ A;  4ZTF A;  1U5T A;  2DTZ A;  1MDM B;  1WVR A;  3KX2 A;  2VOO A;  3G2B A;  1BJA A;  4LGW A;  3VDX A;  1O4X A;  5BMZ A;  1YJW I;  1KYW A;  1ON2 A;  2BW3 B;  4Q4Z F;  3CO6 C;  1BC7 C;  1ZRE A;  2PJR B;  4IVN A;  3H36 A;  5LFA A;  1LUJ B;  2L01 A;  3KEO A;  2XAQ A;  1BI0 A;  3P5J A;  3R0J A;  2XGX A;  1OYW A;  5BS6 A;  5TRD A;  5EEH A;  4II2 A;  1IC8 A;  1ACI A;  3S2H J;  2WTE A;  4UUT A;  1FP1 D;  1CF7 A;  2M9H A;  1XDU A;  1N77 A;  3CDI A;  2L9S A;  1SFO J;  3CDH A;  5EJC A;  1GT0 C;  3LQQ A;  4DIQ A;  4BY7 J;  4D1Q A;  4HX8 A;  3IP4 B;  5F0F A;  5EGO A;  4WWC A;  1USS A;  4D0P A;  2LH9 A;  1U5T C;  3HOX J;  3LSJ A;  2O6G E;  3TKY A;  3ABT A;  3CCJ I;  2DCE A;  1LFB A;  1VQO I;  2VQL A;  1W7P D;  1TT0 A;  1EKE A;  2CW0 F;  2W48 A;  1Q1V A;  1XSD A;  5IPA A;  2DXI A;  4IL6 C;  3SJM A;  1MJA A;  4XMY A;  1UHW A;  3KET A;  2STW A;  2XB5 A;  4A3G J;  3PUF A;  3DPL C;  4UV8 A;  2AHQ A;  1FOK A;  4M3D A;  1RNL A;  2FE3 A;  2XC7 A;  4E70 A;  1D1C A;  1TT5 B;  5H6R A;  2MW8 A;  5J1U A;  2GOX B;  1OR7 A;  4HF1 A;  2P5K A;  3HUG B;  3IRR A;  4GDF A;  2XVC A;  5DV5 A;  2PI0 A;  4D5C A;  4XLH A;  4D7M A;  5LEJ A;  3QAH A;  2CG4 A;  4I99 C;  1J9I A;  1WHU A;  5LGN A;  5CLS A;  1N25 A;  1Z6T A;  4GCV A;  5F04 A;  2MC4 A;  3ZP5 A;  2O03 A;  2DU9 A;  1Y1V J;  2JSC A;  1ZK8 A;  3M8E A;  1FSH A;  3BDD A;  4OIO F;  1B72 B;  4Y3O A;  4EMS A;  1BJZ A;  3F8C A;  4Y33 A;  3U2R A;  4XKW A;  3OYF A;  4XRS A;  2EA4 A;  1ULY A;  4XKV A;  3REO A;  3LA2 A;  4D7N A;  1LVA A;  3I9V 2;  3OYH A;  1P4X A;  4KT5 C;  4G6D A;  4RLF A;  1QVT A;  4FE7 A;  4Q5S F;  2L9V A;  2WY7 Q;  3LNQ A;  4RGX A;  2XKO A;  3OYD A;  3JRC A;  2E7W A;  4E7H A;  1V5F A;  4OIP F;  3T8R A;  4U88 A;  2QZ8 A;  3PUB A;  4EAT A;  2GIV A;  3F6V A;  5TIS C;  3COA C;  3WTX C;  4I6Z A;  1G3S A;  2CU7 A;  2A61 A;  1E3H A;  4J00 A;  3VWB A;  1OCT C;  1R4N B;  4X0G A;  1YIO A;  5GP9 A;  3QYB A;  4ANJ A;  2CUZ A;  4FIS A;  4U87 A;  2Y31 A;  3CC2 I;  1MMN A;  2L3D A;  2XKP A;  3BR5 A;  2RN7 A;  3IHU A;  1T0F A;  1WJB A;  3ZQH A;  3F3X A;  2OQG A;  5F0C A;  3O6B B;  5GPA A;  5BPI A;  3Q9S A;  2CRG A;  4P96 A;  4M3F A;  4ETS A;  5LGT A;  1MSF C;  2CV2 A;  2PN6 A;  4XOP A;  5CVU A;  2XRN A;  3GO5 A;  5DYM A;  2F6C A;  3K1P A;  2Z1D A;  1X4P A;  1MW7 A;  3WGG A;  3MEX A;  5BOX A;  3E97 A;  4PFP A;  2VON A;  1VFC A;  3ML6 A;  2H1K A;  2IS1 A;  1R49 A;  4CYD A;  4A12 A;  1YLF A;  3CCV I;  4IHX A;  1G8X A;  1X1P A;  3BLY A;  3KP3 A;  3J81 K;  2A6H F;  2DMU A;  3QP6 A;  4S0H B;  1LFU P;  2R5Z A;  3F8M A;  2F5D A;  2R7Z J;  3C18 A;  4RBO A;  5LRS A;  1MIJ A;  2CQX A;  3KPH A;  3IH3 A;  3IC7 A;  3ONQ A;  1N78 A;  5L3D A;  4KIS A;  2JVH A;  1FWZ A;  2PQ8 A;  4BYY A;  2Y0S N;  3M1C A;  2FBI A;  1POG A;  2E1M B;  1MKM A;  3QRF F;  2K02 A;  1RES A;  3JAM Z;  1D5V A;  1D1B A;  2KIM A;  1SFE A;  4M73 A;  5J1Y A;  4N9H A;  4MTE A;  2DT5 A;  3K4B A;  1ETY A;  4FCY A;  1UAA A;  1WZ2 A;  3L2R A;  3H5R A;  1FBS A;  2K9N A;  1A5J A;  1FEX A;  2RV8 A;  2Y69 H;  2QWW A;  1E3P A;  3K4J A;  2VBW A;  1PJR A;  3HKZ A;  2LR8 A;  3OSG A;  1R1U A;  2F4I A;  2WAF A;  5L3E A;  2QYO A;  1J59 A;  1T33 A;  1FOX A;  1V3F A;  1B8I A;  4UY8 I;  2ETH A;  3A4C A;  1H8A C;  4N4N B;  3HEF A;  1F36 A;  1D1A A;  1F1Z A;  2HZT A;  3Q0W A;  1V4R A;  2HTS A;  3CP2 A;  1PDN C;  4CIC A;  2GXB A;  1JTX A;  3PNV A;  3GTL J;  4CZZ A;  3HOV J;  3C2B A;  1K6Y A;  2JRM A;  5E8I A;  1MH4 A;  4M6Y A;  1Z1D A;  2RNG A;  3F8F A;  4CUG A;  3J80 Z;  3F6O A;  3FIW A;  2NS7 A;  5K5Q A;  3MD2 A;  3GTO J;  3ZQG A;  2VLA A;  2VC0 A;  1FYK A;  5D8L B;  2FA5 A;  5J4Y A;  3MZH A;  2XAF A;  3DLA A;  5JLX A;  4MGR A;  1DPR A;  4A3L J;  3CME I;  3HB9 A;  3P9K A;  3RZD J;  2BHY A;  3AG1 H;  4L5I A;  1T6S A;  4ZTJ A;  2H09 A;  2JRT A;  2KRH A;  5HVQ C;  3IH2 A;  2PMZ A;  2ZXI A;  3GLX A;  2R92 J;  1Y1W J;  3HHG A;  3QOD A;  4IJA A;  3IL2 A;  2NAZ A;  5EDN A;  1R22 A;  2MG4 A;  1SD6 A;  2NXN B;  2EQR A;  3CES A;  1RKT A;  2DJN A;  4AYB A;  3E7L A;  4HNU A;  1RKW A;  4I09 A;  3EET A;  4BJ6 C;  3L2Q A;  3JR9 A;  1MH3 A;  1C0W A;  2HFH A;  1KQ0 A;  4HST A;  4B8X A;  2VB6 A;  4DYR A;  2DAO A;  3EDP A;  4M71 A;  3JSP A;  2VBY A;  2ID3 A;  2O8K A;  3RZO J;  2W24 A;  2OA4 A;  1U78 A;  3CCE I;  1D0X A;  2VQH A;  3L1P A;  1TL8 A;  2WAD A;  1O3S A;  2XSJ C;  3A0B C;  5FFZ A;  2NVU B;  1XMA A;  2ZJQ F;  5ILV A;  1S7O A;  1EH7 A;  3PNT A;  4LB6 B;  2DK5 A;  2LKS A;  4YG2 F;  4I98 B;  4YFK F;  4ZDP A;  1MDM A;  4Y15 A;  3E6D A;  1R7J A;  2CUJ A;  5KAF C;  2HYJ A;  2DDB A;  1OFC X;  3WTU C;  4L9T A;  2BW3 A;  2V1U A;  4FHT A;  2XHK A;  3M9A A;  4LD5 A;  2PJR A;  1I3Q J;  5HLI A;  4XOT A;  5A2Q K;  4XN3 A;  3N97 A;  1FY7 A;  5FKL A;  2O0Y A;  3MZ8 A;  3QYE A;  5CVJ A;  2FBH A;  3WGH A;  5IOY A;  3AFH A;  3VEP A;  2P6T A;  1T08 B;  2K85 A;  2ELH A;  2KFD A;  3QQA A;  4ZYG A;  2LBF A;  2V7F A;  2IA1 A;  4WK8 F;  3C1D A;  4LG0 B;  1VQM I;  1J7K A;  5B3S H;  5HOO A;  3ABU A;  3HG9 A;  3DP7 A;  3R61 A;  1U6G A;  2Z99 A;  2FD5 A;  1QPI A;  1K4S A;  3RQ4 A;  5J8F A;  5H6Q A;  3G3Z A;  4C3I J;  5K5O A;  1OYY A;  2QEN A;  4AIH A;  3IWZ A;  1SAX A;  3ZQF A;  2ZME A;  1RET A;  4L9J A;  3DPT A;  3SDG A;  1VQ8 I;  3IH4 A;  4ZZD A;  2WAQ N;  3SDB A;  2EIL H;  1MJ9 A;  5B66 C;  1VQP I;  4YEJ A;  3EPZ A;  2DBB A;  2HYG D;  4U0Y A;  2LNB A;  3FBI B;  2JA7 J;  1ZR4 A;  1Y8Q B;  1KU9 A;  2PJP A;  4HW0 A;  1SAU A;  2XUB A;  1XCB A;  1BA5 A;  4PJM A;  3LMM A;  4DQ2 A;  3AKZ A;  4LB5 A;  3CUO A;  4PUS A;  2KL4 A;  2UXN A;  2QUF A;  2Q8K A;  1RPW A;  3ABK H;  3TGN A;  1IZ1 A;  3VOE A;  5LHH A;  3ASO H;  3WG7 H;  1HBX G;  2NRA C;  5ERI A;  2OJE D;  3HUG A;  3HOU J;  4BQO A;  2EBI A;  2D2W A;  1R5G A;  3JSO A;  2LVS A;  2KLO A;  3MKL A;  3JTG A;  2KIU A;  1TWA J;  3DEU A;  2Y2Z A;  3S15 J;  1R4M B;  4HPQ A;  4PK4 A;  1NTC A;  1UG0 A;  5K5R A;  3TBI A;  1RRJ A;  2HDC A;  1V55 H;  4FX4 A;  1LJ9 A;  2RAE A;  2ZNZ A;  3BPV A;  3KYL A;  1Z3Y A;  3OS1 A;  2YU3 A;  1RR7 A;  2R7U A;  1B72 A;  5DCF A;  2CUE A;  2XF6 A;  2L02 A;  3W6J B;  3C2G A;  3BJ6 A;  2FML A;  5CPR B;  4LJZ F;  1FP2 A;  1PUE E;  3V7C A;  3W2A A;  3BJA A;  1YS6 A;  2W82 A;  3SFI A;  4PDK A;  2DLL A;  4B48 A;  1KQ9 A;  4WF2 A;  3WU1 B;  3J7Y J;  3JRG A;  2VOD A;  1SFX A;  4ZC3 A;  2OZ6 A;  3FKI J;  3KP7 A;  3H5N A;  5FKO A;  5FRM A;  4UHT A;  4M6X A;  4ZYD A;  1FC3 A;  1D0Y A;  3G71 I;  1UEL B;  1O3T A;  3O2P E;  3OY9 A;  2GA2 A;  3S8P A;  2KIS A;  3WOD F;  3BOQ A;  2Y48 A;  3MKW B;  2YU9 J;  3A03 A;  4LK1 F;  2VXD A;  4FT8 A;  3GW2 A;  3GFM A;  2DOA A;  4LIT A;  3OYA A;  2A5Y B;  1A6Q A;  5IY5 H;  3ZGK A;  2GWR A;  2DA6 A;  2OZU A;  1WQ2 A;  3SHF A;  1G3T A;  1X2M A;  2KJB A;  2YX4 A;  2X6W A;  4DNC A;  3JRI A;  1HA8 A;  1BBY A;  3SEQ A;  1EV7 A;  4G6Q A;  2JJ7 A;  3G73 A;  1X2N A;  1Q1H A;  2ZKZ A;  5ICE A;  1JI8 A;  3R60 A;  2P0W A;  2HOA A;  3ABM H;  1Y8R B;  2V79 A;  5FRO A;  2R7S A;  1P2F A;  1XX5 A;  5TJJ A;  2RQP A;  1IJW C;  2G0E A;  3J7Z I;  2WB1 A;  2MC3 A;  2L9R A;  2R5Z B;  2XPW A;  3D5S C;  4CHU A;  1E0E A;  3DQV C;  5CJ9 A;  4DBR A;  4OIR F;  3L9F A;  3M8J A;  3MKZ A;  4OMZ A;  2Y0M A;  3LWF A;  1D3Y A;  2K9Q A;  3S16 J;  4RM2 A;  2K7L A;  5HS8 A;  1R71 A;  4G8X A;  1G3W A;  2HXO A;  1I1G A;  3KZI C;  2IGN A;  1YOV B;  3IAM 2;  2VJI A;  3Q5F A;  5M5Y J;  4MQV A;  2KJC A;  4XIC A;  3I64 A;  2M30 A;  4A69 C;  4CH7 A;  5GAD J;  2QQ9 A;  4GRI A;  4ABZ A;  4BGD A;  3GXO A;  2MLG A;  1DU0 A;  5ICF A;  1K83 J;  3BG6 A;  5E3O A;  3HRT A;  2K4J A;  5ILU A;  3K70 C;  2MD0 A;  3FDY A;  4A3K J;  3OL3 A;  1RC9 A;  1BR4 A;  4HZF A;  3RKX A;  1OMI A;  3K10 A;  2EV6 A;  2GA1 A;  3OIQ A;  3T0Y A;  2MSY A;  1XGM A;  2JWT A;  3OYE A;  5HOD A;  1W0U A;  3LA3 A;  1CGP A;  1QO0 D;  4UB8 C;  5M3F J;  3TP3 A;  1XMX A;  4B4C A;  3KE2 A;  3ZQL A;  1TWC J;  2CGP A;  1ZRF A;  2E2J J;  2OTL I;  5ICG A;  1AKH B;  3CTA A;  4KFC A;  4IHT A;  3CLQ A;  1P4W A;  3F8N A;  3WGI A;  1YG2 A;  3ASN H;  4BKX A;  3OS0 A;  4RLQ A;  3K0L A;  5AIP A;  1W0T A;  3SXY A;  3FHZ A;  2E1M C;  1QGP A;  4ZYE A;  2BV6 A;  5IYC J;  1ZAO A;  4LFU A;  1JUM A;  1FIA A;  4L9N A;  5TGT A;  1HKS A;  3QP5 A;  1K61 A;  1Y0U A;  3I4M J;  3BR2 A;  2DN0 A;  2LF8 A;  1VQN I;  4HDU A;  5DD8 A;  3DKY A;  5BQT A;  2WC2 A;  2VT2 A;  5IT9 Z;  3F72 A;  2CW7 A;  3C7J A;  5LHG A;  3PO2 J;  1TWF J;  2IGM A;  3H92 A;  4YEL A;  1SD7 A;  1A31 A;  3PQJ A;  2QEX I;  3DWL E;  3K6G A;  2ESH A;  2DJI A;  1YJN I;  4I0B A;  4IRI A;  3H0D A;  3CC4 I;  2V26 A;  2X4H A;  2E1N A;  4I76 A;  2DFF A;  1GVD A;  4HNV A;  4AIJ A;  2XRL A;  1LEA A;  4JX5 A;  2L7K A;  3GFL A;  4A93 J;  1GDT A;  3HPG A;  4IO9 F;  3HSE A;  1IDZ A;  4A2U A;  2AXL A;  2DMQ A;  3Q0U A;  1W4M A;  1P7I A;  5AIQ A;  5J8C A;  2R7T A;  4A0X A;  3PJR A;  3I3L A;  1DU6 A;  1UFM A;  4BDZ A;  3QOP A;  2MYS A;  2IAI A;  1KU2 A;  1X19 A;  3RJP A;  1DPU A;  4E7Z A;  1WH5 A;  4DGW B;  2IS2 A;  1DDN A;  3TP0 A;  5BPD A;  2DO7 A;  4IPA A;  2B63 J;  2VUM J;  2HS5 A;  3LSP A;  5D4R A;  1RUN A;  3PFI A;  4UUS B;  2F5V A;  2ECC A;  4EJU A;  2ZXW H;  1E3O C;  1BIB A;  3K2Z A;  3CCL I;  1FTT A;  1Z21 A;  2M5W A;  3BWG A;  2LFB A;  2HPI A;  1GV2 A;  2LBF B;  1S29 A;  4HV6 A;  5LHI A;  1HW1 A;  2OCE A;  2M7A A;  1HST A;  1ORK A;  2OBP A;  3RPU D;  4ZYH A;  3HKZ N;  2CFX A;  3LSM A;  1BC8 C;  2VKH A;  2ACJ A;  3HDD A;  1YHQ I;  3DLL F;  3MCZ A;  3OYG A;  2A3S A;  2GAU A;  4AD9 A;  2OF7 A;  3AL0 B;  2ZME B;  1XN7 A;  3EYI A;  1T8I A;  1MND A;  1HW5 A;  4OIQ F;  2JA6 J;  3JRE A;  4LG0 A;  3OYL A;  1XD7 A;  3TL4 X;  3H5A A;  2FU4 A;  2ZJR F;  4A3B J;  5CQG A;  3DCF A;  1AWC A;  1I3A A;  1DP7 P;  2O61 A;  5JHU A;  1IUY A;  2WAE A;  1MBK A;  2BE5 F;  1HLV A;  1XGS A;  2RRE A;  2DMN A;  4R8H A;  4B1R A;  4W1U A;  3H3V K;  4WX9 A;  1E17 A;  2DW4 A;  5FLV A;  2VE8 A;  1XB4 A;  4KDP A;  2OD5 A;  5D5U B;  5J1R A;  2DI3 A;  2HNH A;  2H94 A;  2LKP A;  2WY8 Q;  1WI9 A;  3X2Q H;  3K4K A;  2KKO A;  4XKC A;  5CVV A;  1J2X A;  1RIO H;  3HOS A;  4I0A A;  4V19 K;  2OAZ A;  4IRG A;  4GYG A;  4UUV A;  2PMZ N;  2IGO A;  1I1S A;  1ZAR A;  2LLK A;  2Z3Y A;  4BE1 A;  4FX0 A;  4GYI A;  2C6Y A;  1YRN B;  4CDG A;  4KNY A;  2E1O A;  5D8K B;  3SQN A;  1LFP A;  2BY2 A;  4W97 A;  1IN4 A;  1FPQ A;  4RAZ A;  1IRF A;  3DTI A;  1HSJ A;  1WJF A;  3L2C A;  1PUF B;  3FXU A;  2R0Q C;  2LSO A;  3GFJ A;  2LY1 A;  3M4O J;  3TW6 A;  2ZO4 A;  5LGU A;  4AYB N;  2M4G A;  2BEO A;  3IRQ A;  1R5H A;  3S1N J;  3T8T A;  1BM9 A;  4AC0 A;  3DXJ F;  3QPS A;  1OCZ H;  3L09 A;  3DU5 A;  2G7U A;  3CJN A;  3H9Q A;  1OR7 C;  3OV8 A;  4IZZ A;  2IW5 A;  5JVT A;  2W00 A;  1Y6I A;  3E5U A;  4Z2Y A;  3BG3 A;  1X1A A;  4XLE A;  5E1Z B;  1T39 A;  4ZDL A;  1FTZ A;  1STZ A;  2JTV A;  2IVM A;  3J7A O;  4IHW A;  1S8N A;  2DFI A;  2JSP A;  4S05 A;  2YSR A;  4BAC A;  2CSO A;  2FUG 2;  3NAU A;  1G59 A;  2EB7 A;  3LFK A;  4E7I A;  1R36 A;  2KDO A;  3LSR A;  2LKX A;  2X1C A;  3OIO A;  5CVI A;  4ESB A;  3CC7 I;  2JN6 A;  1F5T A;  3ECO A;  2FSW A;  2XGD A;  3L7W A;  1D8K A;  3OYC A;  3FMQ A;  4HQM A;  5K7Z A;  4YIR X;  3CMA I;  5FB2 A;  4OWR B;  1LVK A;  1S7A A;  1NK2 P;  4MO7 A;  4CCO A;  3GFI A;  3V7S A;  4U7D A;  1QHG A;  4B47 A;  1XCV A;  5E20 A;  1HKQ A;  1YS7 A;  2YX7 A;  3HZJ A;  2CWE A;  1FYM A;  1YX3 A;  3WTV C;  3A01 B;  1F9N A;  2VBX A;  1FMW A;  2PMH A;  1OJL A;  5H2F C;  3BC8 A;  3KEQ A;  3NEU A;  1O57 A;  4Q47 A;  4G7O F;  3ZN0 A;  1SVO A;  1MBE A;  2XIG A;  2R7D A;  2FNA A;  1XG1 A;  3I59 B;  4BY1 J;  2JUG A;  1GLN A;  2IGK A;  1JUS A;  4P55 A;  5EEA A;  3CF2 A;  1ETW A;  3CJQ B;  1ZTR A;  2D1H A;  1SEU A;  1T0F C;  4HOB A;  1S3J A;  4E7K A;  1H89 C;  1XMK A;  2ME6 A;  3S1M J;  4OU0 A;  3W6V A;  2KP6 A;  1OCO H;  3RPQ A;  4KA4 A;  3D5L A;  2VI6 A;  3C2H A;  2RDP A;  3CP8 A;  5FKM A;  4YII A;  5J40 A;  2DPD A;  3QPT A;  2M1B A;  5D5V B;  1VQ4 I;  3I56 I;  2BY1 A;  1OPC A;  3OYJ A;  4B3A A;  4U0V A;  4BQN A;  3S32 A;  3M7G A;  1B4A A;  4PJ0 C;  2EV5 A;  1NHA A;  4DYQ A;  4HNT A;  1NG6 A;  2OQR A;  3H9G A;  2R7F A;  2M0C A;  3HXL A;  3FHN A;  1F43 A;  2Z5U A;  1X58 A;  4M9Z A;  2V9P A;  3FMS A;  4BE2 A;  2J5P A;  4IHV A;  4DZJ A;  1MMS A;  2ZXJ A;  4CCK A;  3CMY A;  4FAS D;  3PQK A;  2QA4 I;  3CJT B;  4BQQ A;  4NC6 A;  3HTU A;  2RQQ A;  3VYR B;  1X1B A;  3CJR B;  4XID A;  1Z6R A;  1I6H J;  4UNO A;  2EA2 A;  1W36 C;  4CCM A;  3E0J B;  4NQW A;  3R6S A;  1UHS A;  4P9F A;  2EFP A;  1KYZ A;  3CDL A;  3ERM A;  3JAM K;  1WWX A;  3MKY B;  2RKH A;  5E3M A;  4ZYA A;  3ZQQ A;  1XPX A;  2QM3 A;  4CCJ A;  1X4O A;  1O7F A;  1IAW A;  4OMY A;  2VJ5 A;  1ERD A;  3TDU C;  5IP7 J;  2LY2 A;  3VSL A;  5JHF A;  2IJL A;  4IOA F;  2FF4 A;  2BXZ A;  3IKV A;  4V2G A;  1AKH A;  2JA5 J;  1QNT A;  1EJ9 A;  1S6L A;  3OOU A;  5D5W B;  4RGU A;  4IOC F;  4BJ5 C;  5D5X B;  2VKE A;  2VXZ A;  5JLW A;  2R4G A;  2M4K A;  2CYY A;  3WTW C;  1VTN C;  4WXH A;  2NOG A;  3OR1 C;  2R7V A;  1B6A A;  2K5C A;  4XN0 A;  3LST A;  4DJA A;  1XTA A;  3FX3 A;  4KIF A;  3P7N A;  2L4M A;  5C44 J;  3WTZ A;  5B1A H;  1UHM A;  4LG3 A;  2AO9 A;  4YFX F;  4DOZ A;  2X85 A;  1PYV A;  2STT A;  5JFR A;  1U3E M;  1CQT A;  2ME0 A;  2WB1 N;  3ZQ7 A;  4XLP F;  5B1B H;  3J80 K;  4ENK A;  5HDN A;  1QRY A;  4Y52 J;  3GTJ J;  1G4D A;  4I01 A;  1D8J A;  3QPH A;  4LIU A;  5F27 A;  4XR6 A;  5KNL A;  3GBG A;  3ZMU A;  4IQJ A;  2M8E A;  2A6E F;  3OWT A;  5KAI C;  1LDD A;  4D9J A;  2XGC A;  5ICC A;  1TNS A;  4F91 B;  3CF5 F;  1GVJ A;  4MIM A; 
#chains in the Genus database with same CATH homology
 1X2M A;  4LOC A;  3JRI A;  1TWG J;  1GV5 A;  2JJ7 A;  1X2N A;  2DA2 A;  2XPV A;  3BG9 A;  2DTZ A;  3HM5 A;  1T56 A;  2EZL A;  2HOA A;  4G12 A;  1O4X A;  4L5E A;  2IBD A;  2QF7 A;  3ZOB A;  4DW6 A;  1IJW C;  2G0E A;  3BQY A;  2L9R A;  2R5Z B;  4EEF G;  2XPW A;  1JT6 A;  4JP0 A;  4C3H J;  4UUS A;  1JJ8 C;  4QSH A;  2LK2 A;  1P7J A;  1WCM J;  2JK3 A;  3HOY J;  1JGG A;  3TW7 A;  1IC8 A;  2K9Q A;  3S16 J;  3S2H J;  2I10 A;  2DA1 A;  4UUT A;  4JX4 A;  1IUF A;  3HBL A;  4A3F J;  2M9H A;  1SFO J;  3H0G J;  1GT0 C;  2HXO A;  4BY7 J;  3TED A;  4A3I J;  5EGO A;  5F0F A;  3WHC A;  4MFE A;  1ETK A;  5M5Y J;  3HOX J;  4XIC A;  3LSJ A;  1XS9 A;  1ETO A;  4A69 C;  2XSD C;  3HOW J;  2N8G A;  2XB0 X;  4XRS G;  1LFB A;  2K9S A;  4JX6 A;  4ABZ A;  5M5X J;  3JRA A;  2NS8 A;  4DYC A;  1DU0 A;  1JUP A;  1K83 J;  2W48 A;  1Q1V A;  5E3O A;  3B6C A;  5IPA A;  3SJM A;  2XB5 A;  4A3G J;  4A3K J;  2YUS A;  3K2A A;  2AHQ A;  3HGG A;  4M3D A;  1MBJ A;  3O8G A;  3QPL A;  1SAN A;  5F1J A;  2MW8 A;  5J1U A;  4FTH A;  5EYR A;  5DTD A;  1AU7 A;  3FIS A;  2MSY A;  1BW5 A;  2JWT A;  5HOD A;  4CYC B;  1W0U A;  4D5C A;  1QVU A;  5M3F J;  2L7Z A;  3TP3 A;  1XC5 A;  4B4C A;  4D7M A;  5IOZ A;  2R5Y B;  1JKP C;  3ZQL A;  4BBR J;  1TWC J;  2ZB9 A;  3BR0 A;  2E2J J;  2X9D A;  1AKH B;  1YRN A;  5F04 A;  4BKX A;  2DA6 A;  1Y1V J;  1ZK8 A;  1W0T A;  2L0K A;  1B72 B;  1MBG A;  5IYC J;  1BW6 A;  3B6A A;  1EF4 A;  1BJZ A;  1JUM A;  1PUF A;  1FIA A;  3M3Y J;  3CQZ J;  1K61 A;  4XRS A;  3I4M J;  4XRM A;  2DN0 A;  3BR2 A;  4D7N A;  2LY9 A;  3ZQI A;  5FJ8 J;  1S7E A;  1QVT A;  4FE7 A;  2WV1 A;  3PO2 J;  2HDD A;  1TWF J;  3LNQ A;  2FQ4 A;  2MGQ A;  5DS9 A;  3JRC A;  3K7A J;  3S1Q J;  5F0H A;  4I76 A;  3G1O A;  4I6Z A;  1U9O A;  1GVD A;  4HNV A;  1TC3 C;  2XRL A;  4JX5 A;  4A93 J;  2CU7 A;  1GDT A;  3S2D J;  4JYK A;  1IDZ A;  2CUF A;  2DMQ A;  3Q0U A;  1Z77 A;  1P7I A;  5E3N A;  2NVQ J;  1OCT C;  2GM4 A;  2DMP A;  5GP9 A;  4FIS A;  3JRB A;  3PM1 A;  2Y31 A;  1DU6 A;  3BR5 A;  4C3J J;  2IAI A;  4A3M J;  3ZQH A;  5F0C A;  5GPA A;  3GTP J;  2DA7 A;  2HI3 A;  2VPR A;  2CRG A;  1TWH J;  4M3F A;  1WH5 A;  9ANT A;  1MSF C;  3TP0 A;  5IP6 A;  1JTY A;  5K7F A;  2B63 J;  2VUM J;  2LP0 A;  3A01 A;  3LSP A;  4UUS B;  2ECC A;  3GTM J;  3JRH A;  1E3O C;  1JKO C;  1VFC A;  4A3J J;  1ZGW A;  3BR3 A;  2H1K A;  1FTT A;  4IHY A;  2LFB A;  1GV2 A;  1ORK A;  5EG0 A;  4IHX A;  3HKZ N;  1U8B A;  1WH7 A;  4MFD A;  5C4X J;  1ZKG A;  2DMU A;  5IYB J;  4S0H B;  5C4J J;  3S1R J;  2R5Z A;  1LFU P;  2ID6 A;  3HDD A;  5EGO B;  5M3M J;  2R7Z J;  4RBO A;  2OF7 A;  3BR6 A;  2CQX A;  3Q0V A;  3IH3 A;  2JA6 J;  3JRE A;  2DA5 A;  2K40 A;  2Y0S N;  4A3B J;  1FIP A;  2JMW A;  1POG A;  3DCF A;  3FK7 A;  3BTI A;  4QTR A;  1APL C;  4DZP A;  1MBK A;  1HLV A;  1RES A;  5EZG A;  2Y9Z A;  1HDP A;  2DMN A;  2FJ1 A;  4B1R A;  5M5W J;  4W1U A;  3H3V K;  5J1Y A;  5FLV A;  2Y30 A;  1ETY A;  4A3E J;  4FCY A;  2HXI A;  5J1R A;  1A5J A;  2K9N A;  1LE8 A;  1FEX A;  1ENH A;  3UKG A;  3GTK J;  2HQ5 A;  2NVX J;  4Y7N J;  2LR8 A;  3OSG A;  3MN2 A;  1T33 A;  2E19 A;  1B8I A;  3BR1 A;  1BL0 A;  2PMZ N;  3JRF A;  5EZH A;  3LSG A;  1H8A C;  2LLK A;  3HEF A;  1F36 A;  2R93 J;  1YRN B;  2E1O A;  1I50 J;  2NVY J;  4V2F A;  4W97 A;  3Q0W A;  2CJJ A;  2YS9 A;  1ITY A;  1JTX A;  3HOV J;  3GTL J;  3C2B A;  1PUF B;  3BG5 A;  3S14 J;  2R0Q C;  3M4O J;  3TW6 A;  1MH4 A;  1G2H A;  4AYB N;  1H88 C;  3S1N J;  4AC0 A;  3FIW A;  3QPS A;  4GFB A;  2NS7 A;  1VF9 A;  2JA8 J;  3GTO J;  3ZQG A;  5JLX A;  2EZI A;  4A3L J;  2O7O A;  1JKR C;  1Z0X A;  3HB9 A;  3BG3 A;  3RZD J;  1FTZ A;  2X48 A;  5IP9 J;  2GBY A;  3IH2 A;  4IHW A;  4A3C J;  2R92 J;  1IGN A;  1Y1W J;  3NAR A;  3NAU A;  5EDN A;  1ZR2 A;  4IEJ A;  3LSR A;  1MBF A;  4D5F A;  3GTG J;  2LKX A;  2LD5 A;  3OIO A;  1GUU A;  2JN6 A;  2NVT J;  2MG4 A;  1IDY A;  2O9L A;  2EQR A;  2KDZ A;  3BTL A;  2XGD A;  1RKT A;  1JT0 A;  3RQI A;  1ETV A;  2DJN A;  5K7Z A;  3WHB A;  1IRZ A;  3E7L A;  4A3D J;  1RKW A;  3F0C A;  1NK2 P;  4MO7 A;  3JR9 A;  1MH3 A;  4BBS J;  1HF0 A;  2QCO A;  4DYR A;  1AHD P;  2ECB A;  2ID3 A;  2O8K A;  3RZO J;  4XK4 A;  3A01 B;  3OSF A;  1U78 A;  4FE4 A;  1OJL A;  3L1P A;  3I4N J;  3GTQ J;  2XGE A;  2HOS A;  2M8G X;  3G1L A;  1VI0 A;  2DMT A;  2E2H J;  2D5V A;  5IYD J;  5K7H A;  1MBE A;  4X1E A;  2EH3 A;  1UG2 A;  1A6I A;  3BT9 A;  1XG1 A;  4M3B A;  2EZK A;  5EG0 B;  4BY1 J;  2HYJ A;  3PO3 J;  1JUS A;  1OFC X;  5EEA A;  1ETW A;  1ZTR A;  4QIW N;  1VND A;  3ZQC A;  5E3L A;  1I3Q J;  2DA4 A;  5FKL A;  1H89 C;  5C3E J;  2ME6 A;  3S1M J;  2L7M P;  1FJL A;  5IOY A;  3W6V A;  2VI6 A;  3QQA A;  5FKM A;  1JKQ C;  1JJ6 C;  2DA3 A;  2M2E A;  3VPR A;  1QPI A;  2FD5 A;  3BQZ A;  4B3A A;  4NDL A;  4C3I J;  1IV6 A;  4BXX J;  2P81 A;  2M34 A;  5F08 A;  3ZQF A;  4DYQ A;  4C2M J;  1RET A;  2M0C A;  3S17 J;  2X6O A;  3SDG A;  5EF6 A;  3IH4 A;  1LE8 B;  1F43 A;  1X58 A;  2WAQ N;  4IHV A;  3O8H A;  4DZJ A;  3CMY A;  1UMQ A;  2JA7 J;  1B8I B;  4M3E A;  1ZR4 A;  2CQQ A;  3BTJ A;  1BA5 A;  1HCR A;  4XID A;  3IV5 A;  2FX0 A;  3MVP A;  5GPC A;  3JRD A;  3LOC A;  1I6H J;  1IG7 A;  1RPW A;  1HOM A;  1UHS A;  3CDL A;  1WGX A;  2E2I J;  5FKN A;  2IEK A;  1NK3 P;  3HOU J;  4CYC A;  5E3M A;  2EBI A;  5FLM J;  2LVS A;  3MKL A;  3G1M A;  1TWA J;  2R5Y A;  2OPT A;  2GLO A;  2Y2Z A;  2HOT A;  3BTC A;  3S15 J;  5IP7 J;  2VKV A;  1NTC A;  3HGY A;  5FKK A;  1R9T J;  3DEW A;  4V2G A;  1AKH A;  3CCY A;  2JA5 J;  1ZQ3 P;  5BNG A;  2RAE A;  3D1N I;  3OOU A;  4X6A J;  1WPK A;  1RR7 A;  1B72 A;  2VKE A;  5JLW A;  2CUE A;  2NOG A;  2KT0 A;  1WI3 A;  1MNM C;  4J19 A;  5C44 J;  3SFI A;  1ETX A;  2L7F P;  4M6V A;  2AO9 A;  2ELK A;  1HDD C;  3JRG A;  4MLO A;  3FKI J;  5FKO A;  1U9N A;  1CQT A;  2ME0 A;  2WB1 N;  2EZH A;  5J3L A;  3HOZ J;  1OCP A;  1MBH A;  4AUX A;  2TRT A;  2XPU A;  3A02 A;  1QRY A;  2LTP A;  2H8R A;  4Y52 J;  3RKQ A;  3GTJ J;  1D5Y A;  3FK6 A;  5F27 A;  1MSE C;  1ETQ A;  2YU9 J;  3A03 A;  3GBG A;  2TCT A;  4RDU A;  4M3G A;  2XGC A;  2Y9Y A;  2COB A;  3Q3S A;  4MIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...