3ABKH

Bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3abkH00
5B1AH 1V55H 2EIKH 2EILH 3X2QH 3AG1H 2OCCH 2ZXWH 3AG3H 3WG7H 1OCRH 3ABMH 3AG4H 3ASNH 1OCZH 2EIMH 1OCCH 2DYSH 3ABLH 5IY5H 2Y69H 1V54H 2DYRH 5B1BH 1OCOH 3ASOH 2EIJH 5B3SH 3ABKH 2EINH 3AG2H
chains in the Genus database with same CATH superfamily
1OLTA 1M1EB 4JX6A 3SZTA 1X1PA 1X4OA 2DA5A 3K4CA 3S1QJ 3S2HJ 1D0XA 3UR3C 3RKQA 3F8FA 4CGZA 2B7EA 2HQAA 2QKLB 3L2QA 3V7CA 3ZQGA 5B66C 5FKLA 1H88C 1JTYA 3JRGA 4IHVA 4YELA 2IGMA 3I0TA 3FZVA 3CJRB 4H4KC 1RESA 1S72I 1OFCX 3K1MA 3VYSB 2VOOA 2NAZA 2RC4A 1W7PB 1X1AA 2QF7A 4KJZA 3G4SI 2FJ1A 4BJ6C 1TWGJ 2R0QC 4BACA 3NEUA 4MFDA 4BU2A 4XLAA 2M7AA 4RBOA 4I0AA 3RYPA 4M6VA 1YLFA 3FMRA 1Y1VJ 2HYGD 2LY9A 3AG2H 3F0CA 3QPHA 4ZTJA 1I39A 2PMZN 4ZYDA 2GXAA 1GXPA 2ZJ2A 2EBIA 4PUSA 4A3BJ 5F27A 1HOMA 3WGHA 2R7FA 4AYBA 2CU7A 3I55I 2E1MB 4RAGA 1J09A 4KIBA 4IQJA 2P4WA 3GF2A 4QWQA 1TC3C 3M07A 3DPTA 5GAEJ 5TRDA 2DYRH 1A6IA 2VLAA 4FHTA 2LYCA 4XSZF 4B4CA 4MIMA 1P9QC 3EYIA 3HRUA 3GX4X 3H5NA 1G4DA 1B6AA 2OF7A 1UB9A 2E5NA 2FX0A 5EEGA 1R7JA 4M3BA 4HQEA 4YRVA 4XLHA 2ME0A 2XPUA 2L4MA 1OPCA 1OJLA 1X2MA 1S7EA 4Y4RA 4CA0A 3K4LA 1B1BA 3BQYA 1YRNA 2LREA 2Y2ZA 3EUHA 2HOEA 2OA4A 1UFMA 2DT6A 1FTZA 2UV1A 4A3KJ 3DTIA 5FKOA 5HDKA 1KQ8A 4IF4A 3BR1A 3F6VA 1P4WA 4JX4A 2AXTC 1UG0A 2ZMEB 1BN5A 4IHTA 5FO5A 2KP6A 1EH7A 3M8FA 2HOTA 1S7OA 1ORKA 5DS9A 1ZREA 2Y9YA 2HWVA 4B3AA 1MMNA 4A3GJ 2XB0X 4RB3C 2VKEA 2PG4A 3QOEA 3HB9A 3A01B 3J7YJ 4UVAA 1RC9A 2OZUA 4GYIA 3OIQA 4ZYAA 3MWMA 2M5WA 1W7PA 3FHZA 2EV0A 2G7HA 1LB2A 5FLXK 3DFGA 2HS5A 5KVRA 3F22A 4C3IJ 4CCLA 2YS9A 1XGNA 3K4NA 3CC4I 1VFCA 3W2VA 3KZZA 3QU6A 5EF6A 2OV7A 4E7IA 2MH9A 2QVOA 3PIOF 3E5UA 2DODA 1T38A 3OS1A 1SFOJ 3HOUJ 4OAZA 5K7FA 3K4MA 3A01A 5A2QK 4IHXA 3OYKA 1WCMJ 2GM4A 2CV1A 4BY7J 4II3A 5M3MJ 1XG1A 1BL0A 3OSGA 4DIQA 3WU2C 3T8RA 2EZKA 4WXDA 4D9JA 3P9KA 5H6QA 1MMSA 1AU7A 1LKXA 3OL4A 4NNJA 3HOWJ 2AS5F 4A5MA 2OUMA 1GXQA 3VB2A 1D8KA 3HOZJ 2HOAA 3BR2A 3CDHA 3CP8A 4XIDA 3LFKA 1RNLA 5LBQA 2R7TA 1VTNC 3B02A 4Q5SF 5K1YA 2OAZA 4M3EA 3DXJF 1ON2A 4FETA 2ZBKA 4A0YA 5IT9K 5L3GA 4IHWA 1MBHA 2EV6A 1IN6A 1X1CA 3E6DA 1SFXA 1ULYA 2HFHA 4G6QA 4L0YB 2LKSA 1WSUA 5DUKA 2R4GA 3CO7C 3JREA 1TLHB 4G94A 4R1HA 3PIPF 2CYYA 3GW2A 2R7XA 4W1UA 2M7BA 1Z91A 3FXMA 3F72A 4FE4A 4U88A 2XGCA 4CUGA 5CVJA 4XL9A 3ZMTA 2F5FA 1FP2A 1ZARA 2UXXA 4OIRF 4Y52J 1VQ4I 3GXOA 1W5TA 3BG9A 5EG0B 3OYFA 2EFPA 4D5FA 3MKLA 4L18B 2IT0A 2ZNZA 2LBFB 3OYJA 2OCEA 3W3CA 3C2GA 1XS9A 3BWGA 1VQ9I 3ABTA 3BG5A 3U9GA 2CSOA 3I56I 1B8IA 2F2EA 3FKIJ 3CF5F 2COMA 5ICGA 3NWSA 4LGWA 1K61A 3SDGA 2PI0A 4JOMA 1FPQA 4M71A 2X0LA 3BDDA 1S8NA 2BZTA 2FSWA 3WHCA 1Q1VA 1ODDA 2DA6A 2P8TA 1YITI 1E17A 2W7NA 1ZQ3P 4EJUA 3M1EA 3CUQA 4RAZA 5EZHA 4BGDA 3CCVI 3NAUA 5B3SH 4HLYA 1CF7A 1OYWA 1FOXA 5DCFA 1I6XA 1BA5A 2GOXB 3TP0A 1T98A 4N4NB 3FM3A 2WA0A 1IN5A 4LLLA 1REPC 1GV2A 3HPGA 5DYMA 4XKCA 3KYLA 3S3OA 2CFXA 2VPRA 3S3MA 3DKXA 1SFKA 1O3SA 2HDWA 4QSHA 3ABUA 3ZCOA 3SFIA 1H9GA 2LOOA 1W1WE 1TTYA 2CV2A 1YX5A 2Q2EA 3G1LA 2LFBA 4XRSG 4MO7A 3K2ZA 1X1BA 3H3ZA 1ZGWA 2L7FP 3LSTA 1E0EA 1B4AA 1OR7C 2V26A 5FKNA 1FOKA 2R7DA 3EPZA 1KYZA 3TGNA 3G71I 2O7OA 3KZIC 4C30A 1TT5B 2BHYA 2ZXIA 1F43A 4E7KA 2HEOA 4FTHA 4GGGA 2F5EA 4OWRB 2WADA 1F9NA 1USSA 4CICA 2F48A 1W36C 2VE9A 2IVMA 2GWRA 2VKHA 2NVXJ 1JKOC 1BR2A 5IOYA 5K5RA 4C2TA 2V4JC 3OWTA 3BP8A 1YIJI 5L3FA 2FOKA 1APLC 3O3KA 2VQGA 2Z5UA 3H5RA 2NRAC 1L0OC 2R5YA 1IAWA 1Y8QB 4II2A 3GVAA 3ZQIA 2Y31A 4A6DA 2D45A 2V1DA 3KPHA 1N25A 3E6MA 4A93J 3HRSA 3BR3A 2CQQA 2L5QA 1XCVA 3DP7A 2AXLA 5AONA 3AAFA 2UWMA 3FXUA 2Z1DA 2EA2A 1JE8A 4A3IJ 2JUCA 1BM9A 3ZRGA 3BJOA 4X1EA 2NNYA 4YIFA 1LEAA 3BG3A 4FCYA 2WB1N 3D5LA 1Q1HA 2NOJB 3CCYA 1MGTA 3OL3A 4LG0A 1RPWA 2JK3A 2I5UA 3LSGA 2VQHA 3PNTA 1YI2I 2BEOA 2HQ5A 1W5CC 4M6YA 2ESNA 3DEEA 4KNYA 3ZOBA 1BR4A 2L3DA 1W4MA 3IC7A 1PJRA 2QSHX 1BI1A 1JHFA 1HW5A 2STTA 4IPAA 1Z0XA 2LY2A 5FLVA 2XDVA 4XLFA 3LWFA 5DTDA 1L3LA 2G9WA 3DKWA 2DA2A 3JRIA 2F5VA 4DBQA 2NS8A 4PJLA 5E1WA 2GAUA 3W6KB 3X2QH 3SQNA 3UKGA 1Y0NA 2GXBA 3Q3SA 2KLOA 2VE8A 3K69A 2XROA 2P7CB 2BV6A 5EZGA 4PJ0C 1MMDA 1FT9A 2E1CA 4U7DA 2ISZA 1R9TJ 1I1GA 1MNEA 3BY6A 4F91B 3GTGJ 1P92A 2JA7J 1W7PD 5K7HA 3JRFA 2A61A 4DYCA 4Q47A 2EA4A 2XF7A 2N8GA 4L0ZB 3E97A 2X85A 5FFXA 2R7ZJ 1R1TA 2Q1ZB 3WTSC 2VKDA 3BZCA 1R49A 1ZN2A 3TO6A 2DA1A 2WAQA 2V1XA 4W97A 2DFFA 4IRHA 1QO0D 2EH3A 3U2RA 2AO9A 2K5CA 2ZFUA 3K1PA 2XF6A 1YW7A 4ZYHA 1BOBA 4RB2C 1OR7A 2R7VA 1ZH5A 3TP3A 2LSOA 3LA2A 2W4SA 1V5EA 3K10A 2HVRA 1WQ2A 1E2XA 4S05A 1XSVA 2VUMJ 4ZZLA 1V54H 3F21A 5CQEA 1G3YA 3WTXC 2PJRA 2FBHA 2F6CA 2W00A 6PAXA 4EGYA 3KYCB 5CPRB 3CMYA 2QLZA 1U5TB 2K85A 2HYJA 4A3DJ 4HX8A 4YIIA 2ZJQF 4FX4A 5DV5A 1DDNA 4HDUA 1B72B 2F4MB 2DK5A 3I64A 1I3QJ 2OQRA 2IAIA 2O0YA 4GYGA 1QQIA 2QENA 2CG4A 4L9NA 5HS9A 2XAUA 3OIOA 3L2CA 4HPQA 1V5GA 3ECOA 5LHGA 3Q0WA 4KYWA 3TDUC 1NHAA 3RPUD 2W24A 3S15J 3LMMA 5J1YA 1GDTA 3CZ6A 1LFBA 2X1DA 4LMYA 2O8KA 1S29A 1W0UA 4RB0A 3HEFA 1X1DA 4ASNA 2KJBA 5EGOA 3HOTA 1E3OC 4IOAF 1U9NA 2Y48A 1S7AA 3JW4A 4I98B 3OYHA 1F5TA 1XMXA 1WHUA 3S14J 3H1CA 2CQXA 2EFQA 2L9VA 4N9HA 4HNUA 1YO5C 2E7XA 5E3OA 1QBJA 2K9NA 1FYKA 3F23A 4RAYA 2K9MA 2QQBA 3VPRA 4N0BA 2VT3A 2OTJI 3GTJJ 4HOBA 1Z9CA 5LEKA 2M2EA 2TRTA 1LEBA 1OQYA 2X9DA 3PO3J 2Y0MA 5E17F 1O7LA 2KDOA 3HYIA 3VWBA 3HL2A 1R4NB 2IRFG 4FASD 4LJZF 4O5VA 2VOPA 4R8HA 5E20A 3Q0VA 4XOTA 2ZJRF 5FKMA 3MAJA 2KPMA 4Y15A 4BBRJ 4I2OA 2E60A 2VBYA 2R92J 1JTXA 2QM3A 1ZLJA 2O9LA 2W57A 4XKWA 2CO5A 1G2HA 3OYBA 1MBKA 4I0BA 3ZGKA 1RR8C 2QZ8A 3K4JA 2K40A 1T0FA 5LRSA 5GAGJ 2ELHA 3LL7A 1ETVA 2OPTA 5TISC 1ITYA 2EQRA 1IV8A 2HOSA 5ICCA 3FXJA 1LDKB 3QYEA 2DA4A 4UHTA 2ADUA 2V7FA 1K78A 4CHUA 2CW7A 2HU9A 2LR8A 2M8EA 3OY9A 1YYVA 5KHDA 3I54A 3OYMA 4BXUA 5IYDJ 1CQTA 2L02A 3TEDA 1N77A 4U0YA 2X6OA 1MBEA 4KN7X 3C2HA 3ERMA 1TW2A 2ZXWH 4AWXB 1ZTRA 2FQ3A 1KU9A 3J7ZI 1Z7UA 3LAPA 3I3LA 4RS8A 3SZGA 1IRZA 2DOAA 3DLAA 3GEZA 1Y0UA 5LHHA 1S3JA 4IRGA 2BW3A 2AHQA 2GIVA 3S17J 3D5RC 3LA3A 1XMAA 1DU6A 1T0FC 4BE1A 2V6CA 2M8GX 2VC1A 4GCVA 1GLNA 5DCMA 5M5WJ 3FK7A 2VPLA 1HKSA 2RDPA 3QWLA 2W84A 4UXNA 1IN8A 2M4GA 5H6RA 1RUNA 1KGSA 1T6SA 2MFZA 5FLXZ 3ZMUA 4P96A 3CUQC 1IZ1A 4EJOA 1B8IB 2WAQN 2Y69H 4XRMA 2PFBA 1PP7U 2RQQA 5HDNA 4ZDLA 2H8WA 5DCMB 5C44J 4EJVA 1IDYA 4C2UA 5IP9J 2KZVA 3F8NA 2JRMA 2WY7Q 2KFDA 3J80K 2OC6A 3ZMDA 4BYYA 3LSMA 3EUHC 3VSKA 1ZG3A 4BDZA 3KP6A 3BPVA 2YSRA 3FMSA 4HV6A 1OCPA 4X6AJ 3PL8A 5KK1A 5BPDA 2LNBA 3GZ6A 1VZ0A 5E8IA 3MZ8A 3DKYA 2MD0A 1F4KA 3BTLA 3KLNA 2JQ7A 2R7SA 5EDNA 3K70C 4A3LJ 2BXYA 4B09A 2XAGA 4IJAA 4MQ9F 1JGGA 3WODF 1UAAA 2ISYA 5CJ9A 4G6DA 2JVHA 5LHIA 4JK1X 2X6YA 2O3FA 3TO7A 5F0HA 1FX7A 1PUEE 2ZXHA 1U9OA 2IA0A 1T56A 3G1MA 5LGNA 2NS7A 2IS2A 3C3WA 2E36A 4CCOA 3CCRI 4YG2F 2J5PA 3ELKA 2NVQJ 2QQ9A 2FBIA 4I7HA 1ZAOA 4E6KG 3WTUC 2R7UA 4EM1A 1J7KA 1ONVA 5K5QA 1S6LA 1FZPB 5D6FA 2FRHA 5GTIC 4E7HA 2DI3A 1JUSA 1FOYA 3IWZA 3KETA 1POGA 2I8DA 3B6AA 4YEJA 4E7ZA 3OYGA 3SEZA 1KU3A 3JCUC 5J1UA 1QHGA 3S32A 2HXIA 2JPCA 1UJ8A 3CMMA 2F4IA 3CDLA 5BNGA 1VQMI 4CCMA 2W48A 1OCOH 4XN0A 1K7AA 4LG3A 2R7RA 4M3FA 1K6YA 5AIQA 1A04A 3CDIA 3QPSA 2LLKA 3VEPA 2O5RA 4LOCA 4ZYGA 4ENJA 2K27A 4ETSA 5C4XJ 4XLEA 1TQMA 4O6JA 1T2KA 2VQLA 5FLMJ 2MSYA 2VXZA 3DU6A 4OMZA 4G7ZF 4HRIA 4DZPA 4Y13A 2V6EA 2NVUB 1HDDC 4E7LA 4OINF 4D5CA 4ANJA 2E1NA 2IBDA 3JAMK 2JT1A 2E1MC 3OS0A 2KDZA 4B47A 4BBSJ 1YQAA 4ZDPA 4H0EA 3W2AA 3IWFA 3TBIA 1MJBA 3J81K 3CQZJ 2IS1A 4KITB 4NHJA 4OIOF 3RQIA 3LFUA 3PSIA 2X51A 2FNPA 1NK3P 4WF2A 1SMTA 4EJWA 4KISA 2FA5A 5JFRA 1ZRDA 2NNNA 2ZJPF 2EV5A 1ON1A 4Z6YA 3H3VK 4FX0A 3OYCA 2KIFA 2JZYA 2K3PA 3LQRA 3JSPA 1OYYA 5GAHJ 3CF2A 2VN2A 3HRMA 4A0ZA 5E1XA 3CJNA 4Y17A 3ROUA 2F5DA 4P5OA 5HNHA 3AKZA 4BHCA 2P5VA 3ECHA 2H27A 1K78B 1F1ZA 1D1CA 1LFUP 2DDBA 3DWLE 1JHHA 1IN7A 2FNAA 2MC4A 3GO5A 3H9JA 4WX9A 1MMGA 4QPQA 1QPMA 4J01A 1PDNC 3COAC 5D4RA 3DF8A 2B0LA 2XSJC 4UUSA 2O8XA 1IRFA 1BIBA 3REOA 2BE5F 2EFWA 1KONA 1Y8RB 1MIJA 1HW2A 2HQNA 3FHNA 3K70D 2ICWG 1IO2A 1ETWA 3T0YA 1H0MA 3LSJA 1R23A 3BLYA 3DPLC 1I5ZA 2FBKA 3W6JB 4ESJA 2HPIA 3Q9SA 5DUIA 3O6BB 1OCTC 2EIKH 4B3XA 1SANA 1DP7P 2IGOA 3NWTA 3CCEI 1FC3A 3LSIA 4UVBA 4XORA 4WWCA 2GQQA 2V9PA 2XB5A 4BEHA 2PEXA 2DFIA 1VNDA 2CUFA 2FD5A 1ZR2A 3GFLA 1K79A 3PQKA 1HF0A 4ON0A 3L2RA 3BTIA 3E6BA 3VOEA 3GLXA 9ANTA 1LPQA 4S04A 3F3XA 3F8BA 4MHGA 1ZKGA 2G7UA 1J9IA 2LTPA 4M9ZA 4DZJA 4HW0A 4CCJA 3DU5A 3AL0C 4BE0A 2M3AA 3E5QA 4F7ZA 3ERED 3V7SA 1SAXA 3GUDA 4WXHA 1ZK8A 2I10A 2JSPA 1U8RA 3LSRA 1KQ0A 3GTOJ 3RZOJ 3K7AJ 1BI3A 5CVVA 2A6HF 1FBUA 4M72A 2DDAA 2DJNA 4OOIA 2Y75A 1MKMA 4XQFA 2OBPA 2NS0A 5M5XJ 3ZQLA 4CSWA 3HOVJ 5ICEA 4HSTA 2BGCA 1Z6RA 4L9JA 3S8PA 4AU7A 2EIJH 3KLOA 3TKYA 2HQRA 1LJ9A 2CUEA 4ABZA 2WY8Q 1U0JA 2BY0A 1D5VA 3V8LA 4MEYF 2LRDA 3I9V2 1BI0A 3JTGA 1YE9A 1SVMA 3R60A 1TWCJ 4CZCA 3ZMZA 5J8CA 3JSOA 4IRIA 2RGVA 1U5TA 2XGXA 4HQMA 2E71A 4Z2YA 2JTVA 2R5YB 4FT8A 1R71A 3CUQB 4Y7NJ 2NVYJ 1I3AA 3VSLA 3RTRA 3MEXA 3N4MA 1LFPA 2L7MP 3C7JA 2A5YB 1QVTA 2QKMB 4PGGA 2A6TA 1MBGA 5GTHC 2EWNA 1ENHA 3RQ4A 1WJDA 1LUJB 4E7JA 1ZR4A 1KU7A 2Z2SB 4JQFA 3OYIA 1KA8A 3ABMH 2L2OA 2ID3A 2AQFA 2W82A 4BL0B 3MKYB 3A1YA 1VQ8I 1HKTA 1EH8A 2JWTA 3E7LA 2KRHA 2LH9A 2HKOA 2MLGA 4XK4A 1JUPA 4J19A 1XN7A 5L3EA 4BXXJ 3G3ZA 2ZB9A 1FMVA 5CVIA 2JN6A 3L7WA 3QOPA 4U0WA 3QP6A 5JLXA 5K5OA 4Q48A 3WTTC 5D5XB 3FM5A 2AQEA 4E70A 2D1HA 3KZYA 1HLVA 3DEUA 4RGSA 4EEFG 3M9AA 4A2UA 4X0GA 5JVTA 1I6HJ 2JMWA 2HPMA 1R36A 4C9YA 5ICFA 2DMPA 2VL8A 5JHUA 3ISPA 3N05A 1QZYA 4M3DA 4BS9A 1K4SA 3M3YJ 2O6GE 3HSFA 2XPWA 4DNCA 3V4GA 3NARA 3RKWA 1ETQA 1YOVB 3FF5A 3BR5A 4K2EA 1LE8A 5D5VB 3BG6A 3QQAA 2NOGA 2E7WA 2D1VA 1QRYA 4JBAA 1OCRH 1ZG1A 2GXGA 5C4JJ 3R61A 3FDYA 3RIRA 2EZLA 5L3DA 2MG4A 2L7ZA 3R6SA 5JVGF 4LFUA 4CCKA 3OYAA 1XTAA 4BDYA 3KEYA 4KFCA 1IUYA 2DW4A 2Q0OA 4GFBA 5ILUA 4ESBA 1MDMA 1WZ2A 4ZDOA 4MGRA 2M4KA 2HKXA 1ZYRF 2L4AA 5KNLA 3E0JB 1B59A 4EQQA 1Z77A 4XN3A 3B6CA 3W2WA 1SFUA 3OYLA 5E8GA 3SZPA 3LSPA 2EPFA 3JAMZ 4IXAA 4ITVA 3HKZA 1A31A 3R0JA 3PSFA 1FIAA 1G8XA 4MTDA 4KICA 2QCOA 2CUJA 2DU9A 2F5CA 2H09A 1WKMA 3H92A 3FX3A 4JP0A 2Z99A 4UB6C 3QP5A 3KP3A 4QTRA 1YHQI 2E2JJ 2A69F 5GADJ 1YS6A 2ETHA 4HNTA 2ECBA 1YIOA 2KIUA 5IT3A 2MC3A 2RN7A 2PMZA 2ELJA 1R58A 4OAYA 4EGZA 3C2BA 2LKXA 1YJNI 3KP4A 4CYCA 4F92B 3VYTB 1IG7A 4IKFA 1RKWA 2JUGA 2YUSA 4A6EA 2XF5A 1N75A 3HJEA 4XRSA 2H8RA 3IH4A 2P5LC 3CCSI 5F6FA 3F8MA 3P5JA 5E3MA 3HKZN 2HNHA 4KIGA 2CS3A 2HVSA 2WV1A 3K0LA 4E7SA 1BJAA 4PJMA 1ACIA 1SD6A 1XC5A 1O3QA 5F08A 1Y56A 2BW3B 2FXAA 3ML6A 1P4XA 4PSXA 3WTZA 1VQ5I 2PMUA 2BHZA 3KCCA 1Z21A 1BR1A 2MBFA 1YW8A 1HW1A 1U5TC 5BOXA 4KDPA 5LFAA 2PN6A 2VONA 1MJAA 5IOZA 1MD0A 1TT0A 5BQTA 1HDPA 2CFOA 5F0CA 4ESFA 3CMAI 4M9SA 3A4CA 5HLIA 2HTSA 4RGUA 2XASA 1GHCA 3M4OJ 3DQVC 1FWZA 2L01A 2ESHA 1IXRC 2JA2A 2XUBA 1WI3A 3HSRA 5EYRA 3OOUA 2JVGA 3RPUA 1JI8A 4EMSA 1OYIA 4IHYA 1JT6A 3GCMA 1LE8B 2XIGA 4BHPA 2ACJA 2K02A 2XSDC 2IJLA 1NG6A 4P55A 1MSFC 3BQZA 1K4TA 1A5JA 3FXLA 3E6CC 2WV0A 4N4OB 2Q8KA 2H6CA 2QUFA 3DBHB 4XMYA 3QPLA 2PBIA 5CLSA 5D6EA 4UY8I 2E19A 5A2QZ 5IY5H 4Q4ZF 3HC7A 2PLYA 2ID6A 2P0WA 1O57A 2ZKZA 3ASOH 4IEJA 4P9FA 2R93J 4IZZA 5LRRA 1Z6TA 5E3NA 3QRFF 4BY1J 2BBYA 2M0CA 2XRNA 4DGWB 4DOZA 4BXFA 4XNFA 1SD4A 2RAEA 3I4MJ 5KCMA 4B43A 3WE3A 2VKVA 1RETA 2DCEA 3AG3H 3BCAA 5TGTA 4FQGA 3O8HA 2C6YA 2HR3A 4O3MA 2FQ4A 5DDGA 1QU3A 4RM3A 5DEQA 1QHHD 2HZTA 1JJ6C 1SAUA 1XX5A 3G6EI 3ABLH 1XSXA 4BE2A 4ENNA 3FXRA 2ME6A 3IL2A 1IN4A 3GBGA 4NB5A 5HLTA 3IKTA 3H35A 3IV5A 4PFOA 2DLLA 3BR6A 4A12A 3EUKL 4HEA2 2KL4A 1LVKA 1AOYA 2IA1A 3IHUA 4HYEA 1SEUA 2H1KA 3A2KA 3GTKJ 3QYFA 1Y6IA 3JRBA 1R5HA 2A07F 4AM3A 5DD4A 4PDKA 2CW0F 3F9KA 2ZC2A 1V3FA 3LOCA 1IUFA 5JHFA 1QPIA 1UCRA 3DTEA 2MABA 1SD5A 1TWHJ 4BQNA 4ZYEA 4AYBN 2L9RA 4CYCB 3GWZA 3MQ0A 3KIOA 5FB2A 1OMIA 3JRHA 1FJLA 3WTYC 4UV8A 1RKTA 3M7GA 4WCGA 3I59B 4C3JJ 1KU2A 1SMYF 3V42A 3DBRB 3HPHA 3FXOA 1N78A 3BJAA 3H3UA 3WG9A 2VB6A 4A5NA 4CYDA 1OCZH 4RGRA 5LD2C 4PJJA 1OCCH 4V2FA 4HNVA 3CESA 2ZXJA 2WAEA 4CXFA 5IP7J 1R00A 2P6TA 5LLQA 2B63J 4XLCA 3BCBA 2A3SA 3LSHA 2ZO4A 3L9FA 3FWEA 5IPAA 3MFKA 1P6RA 3E3VA 1J2XA 4B8XA 3WTWC 3S1MJ 3CLOA 4CZZA 2JA5J 3RKXA 3IAS2 4AC0A 5AIPA 4EJTA 2NYXA 3I59A 4XKBA 4ZJZA 4U0VA 2EJRA 1XMKA 4A3FJ 4A69C 3CMEI 1TP4A 3IAM2 5DM7F 5H20A 2BOLA 4B48A 1T08B 2VT2A 3HHHA 1NK2P 1QZEA 3ZR8X 4OU0A 1P7JA 3ASNH 3I71A 1DUXC 4A3CJ 2H1LA 1G3TA 2GIZA 2OJED 4ZTFA 4HDVA 1DQUA 2FE3A 1WH7A 5EG0A 3BROA 2DA7A 5CVUA 1HKQA 4DBRA 3OYNA 3L1PA 1UHMA 2HZDA 1WH5A 4LD5A 2YU3A 1SD7A 3CJQB 5D8KB 1I1SA 3RKYA 2XC7A 4M74A 4XLPF 2CMPA 1PUFA 1MZBA 4AIJA 3H0DA 5E79C 3KP2A 1BOAA 3F8CA 5FRMA 3KYDB 1IXSB 4I02A 3KX2A 1D8JA 5L3CA 3IP4B 1WJBA 1H8AC 1QA6A 2XAQA 4UNOA 3K1NA 1IRGA 5K7ZA 2OTLI 2O03A 3IRRA 3HGGA 1V55H 1BJZA 4IVNA 2B9SA 2IP2A 1FYMA 2NVTJ 4ZZDA 1GVDA 2OCCH 3HG9A 3DCFA 5ED4A 3NRVA 5F04A 3V8JA 1FBSA 4D7NA 2KKOA 2P81A 1GT0C 3J80Z 4BAYA 2CQNA 5EEAA 1SVOA 1PUFB 3KP7A 4DJAA 1Z1DA 4GRIA 1AHDP 3J7AO 1TL8A 2PX9A 1RI7A 3S2WA 1JUMA 3MMYB 3TO9A 1R5GA 2V9KA 4RA2A 5HOOA 3RYRA 1VQKI 3IRQA 2GZWA 2QSGX 4DW6A 5LGUA 2V1NA 1YG2A 4HX7A 4MFEA 2UUZA 3TW7A 1WJ5A 4G12A 5BPIA 1B9MA 2XVCA 1BI2A 4U87A 3T5XA 1ZGAA 3PNVA 4QPOA 2D2WA 4M6XA 4L5IA 1YJ9I 3R0AA 3CCLI 4AUXA 3FXQA 3L00A 2CWEA 4PCQA 4HG2A 2QBYB 2CQ7A 1MH3A 2K9LA 3TOAA 5ILSA 4L9TA 2WB1A 5B1AH 3I5UA 1WJCA 3MVPA 1DPUA 1XB4A 5FFZA 5FROA 1FIPA 3I4NJ 4RLQA 3WE2A 1F36A 2UXNA 1UZCA 2FUG2 3RJPA 1T95A 2X1CA 4U7BA 3GYHX 2K9SA 2LD5A 2LP0A 2M0MA 1JJ8C 1UHSA 5HS7A 2GA2A 2VODA 5FKKA 3P9CA 2RREA 2RV8A 3K6GA 3PNYA 1Z05A 3TW6A 3CCJI 2L9SA 4IL6C 5CQGA 4QLCU 4PGHA 2Q2EB 3OYEA 1DGRM 2X6WA 3D0SA 3HDDA 4RM2A 2JSCA 4IX7A 1MSEC 3PQJA 3A0HC 1ZLKA 2DQLA 3E1SA 3CC7I 3S93A 3PJRA 1WRJA 5DD8A 3VODA 1KZHA 2DOEA 4C3HJ 1FSHA 2TCTA 1TWFJ 5FRNA 2OD5A 1CF7B 1BW6A 2JPBA 5L3BA 2K4JA 3ZN0A 3BPXA 2R7WA 2COBA 4HLXA 2OU2A 3ZQ7A 5B1BH 4YFKF 3GFJA 4B1RA 2PJRB 3HM5A 3HXLA 2P7VB 1ETYA 3DBLB 1FP1D 2VJIA 2DMNA 3HRTA 3ULQB 4AVPA 1G59A 1WI9A 2XKPA 3CCMI 1A35A 2Y30A 1QZZA 2XRLA 1PVEA 2CV0A 1VQPI 2BY2A 1XPXA 1IC8A 1MDMB 2DAOA 1DU0A 1B9NA 2VBWA 3AG4H 1T39A 1SFEA 2WC2A 1XCBA 5CKTA 3T8TA 3ZP5A 1HC8A 3BT9A 4BJTA 2DXIA 2R5ZA 1MNDA 1O7FA 1Z7LA 2E34A 3I4PA 5J1RA 1GV5A 2LK2A 3MKZA 1ETKA 4BQQA 3JRDA 5ERIA 3RSNA 1LNWA 1TQPA 1XDUA 2IPQX 4NC6A 4BJ5C 1TNTA 3RI4A 5FD6A 5GPCA 1WVRA 4G6TB 3AL0B 2A6EF 2IGNA 5EGOB 3CCQI 3GTMJ 1QGPA 5BS6A 4IHSA 3L2UA 3VYUB 1Z3XA 4F3QA 4PJNA 2IS4A 3BR0A 4EATA 1E3HA 1FTTA 2WAFA 1NTCA 1ERDA 2JA6J 4NC8A 2VIXA 3V7RA 3IH2A 3DEWA 2BYVE 4S0HB 3HTUA 4UUSB 2ECCA 4HA8A 3EYYA 4D1QA 3PFIA 5J4VA 3WGIA 5F64A 4YFXF 1J75A 3SXYA 3HIFA 3WGGA 4AIKA 1XSDA 1IW7F 4ZH4F 3OOPA 1TBXA 2K7LA 2E35A 2DTZA 3R4KA 3PUBA 2BY3A 3MZHA 1E3PA 2VBZA 2QWWA 2DN0A 2YX7A 3DLLF 2DO7A 1TNSA 3HTSB 1BW5A 1ZELA 1FOWA 1R5ID 1G3WA 1V4RA 2X6XA 3BZKA 1EV7A 4MNUA 4XICA 4EV0A 1OKRA 3UNGC 4ENMA 5HNFA 3A03A 4XONA 1MJ9A 3Q0UA 3ZQCA 2MLKA 4RAFA 2HYFA 4BQOA 2M1BA 1H89C 3FBNB 1R22A 2STWA 4E4HA 3BJ6A 5KAIC 4PSWA 2FF4A 5BMZA 4MQVA 1R1UA 4RB1A 2DYSH 2XGEA 3JTHA 3K4BA 2FEZA 4NBQA 1HXDA 4XSXF 5IYBJ 3K2AA 2DFEA 2L9NA 3M8EA 1PYVA 1TWAJ 3IH3A 4LLGF 1X58A 3CLQA 5C3EJ 2KMUA 3S3NA 2H6BA 4V19K 2HVQA 2EZIA 1VI0A 2VJ5A 4RLFA 3ZMSA 2IEKA 2Y0SA 3BTCA 4V2GA 5E18F 2DMTA 4Y3OA 2F4OB 5CVRA 4LIVA 2LF7A 1W0TA 3GFMA 2ZNYA 1G6NA 1TZLA 2EK5A 1KQ9A 2EFNA 5LEJA 2YR2A 3BZ6A 1RZ4A 2K9QA 1MW7A 2EINH 3KEOA 2GBYA 2M30A 3D5SC 4GXOA 3NQOA 4N9IA 2VJJA 1HBXG 1GUUA 1O3RA 3FMQA 1FBQA 2FU4A 1V5FA 1XD7A 1MNMC 2QGUA 3F6OA 2M34A 3DTKA 4LK1F 4UV9A 2CGPA 4FE7A 2PQ8A 1GVJA 3Q5FA 3HZJA 1FY7A 5D5WB 4AIHA 1JKQC 1G3SA 5JI6A 1HSTA 3IKVA 2JJ7A 5CYVA 4KA4A 2XAHA 1AKHA 2MGQA 3CTAA 3J7AY 3PO2J 3OIPA 3CJTB 2QEXI 4CCNA 3ZQFA 2X1EA 2KIQA 1ZRCA 1BC7C 2LC2A 2XPVA 2H94A 2G0EA 5J40A 2PJPA 4D7MA 3H9QA 2HDDA 3BOQA 2VQCA 2Z3YA 1KYWA 3C1DA 3EDPA 5IYCJ 3L09A 1UMQA 4CH7A 1IV6A 1VQNI 2XV4S 5HLHA 3OV8A 3ESWB 4M3GA 1IDZA 3OR1C 3CO6C 3LSKA 3L2WA 3LA7A 4PK4A 3QPTA 1XDSA 1IRXA 4DQ2A 4G7OF 4BEHB 2PMHA 5F1RA 2QA4I 1JKRC 4L5EA 2CH0A 2GOMA 1T33A 4HAMA 2JA8J 4FISA 1U8BA 1VF9A 3LAJA 1FLIA 4IQ4A 4EVIA 2A68F 5M3FJ 2W1OA 2RQPA 4F93B 3FISA 1J0RA 4OIPF 1ZG5A 2ZSIB 3PUFA 2ELKA 3FK6A 3GTLJ 3MD2A 4BKXA 2O61A 4HBLA 1U6GA 1H9TA 4MLOA 1Z3YA 3OSFA 2XHKA 3FKJA 3ABKH 4UUTA 2XAJA 1EH6A 3DPUA 2CW8A 2KRFA 2K86A 4KT5C 2KZGA 1VQ6I 4RMNA 2M45A 4M9XA 1SC7A 1YTYA 4XLNF 1BC8C 1FNNA 5E1ZB 1HQCA 4RGXA 1A6QA 4YIRX 4EM0B 3JR9A 3TQNA 2WTEA 4NQWB 1ZHFA 5GP9A 4HF0A 5EJCA 3EUAA 2Z16A 2L7KA 4ENKA 4G7HF 3LQQA 3HOXJ 3PM1A 2KIMA 2DTRA 3E5XA 5DM6F 3G73A 3L2VA 3GLLA 2DPUA 4KMFA 2DMUA 4NDLA 2RVCA 5H2FC 2QBYA 1MH4A 1TW3A 2J5OA 1D1AA 1P2FA 2VBXA 5FGMA 2HGCA 3S16J 1IXCA 4G8XA 3AFHA 3V8KA 2KHMA 4AVZA 3DV8A 4BQAA 1FEXA 4F55A 5B5EC 1FMWA 4JYKA 2Z33A 1X3WB 2EIMH 3HSEA 2KRCA 3O8GA 4XRFA 4AD9A 2VJ4A 1WJEA 2DA3A 4L5JA 2P6SA 1UHWA 1HCRA 3H9GA 3CD6I 2GA1A 2LMDA 2M9HA 3SHFA 3FBIB 3QU3A 2RKHA 3QYBA 3TOBA 3ZQQA 1MBJA 5HODA 4DYQA 5HVQC 2X48A 1QNTA 4D0PA 3TL4X 4LG0B 1OISA 2DBBA 4I09A 5EEHA 3BG7A 4L9VA 5D8LB 1K6OA 4UB8C 3PFYA 1DPRA 1D0ZA 2ZSHB 1FSEA 4LB5A 4HF1A 2L54A 2R3SA 2DT5A 4OIQF 4XR6A 1ETOA 4GO1A 3SFZA 2IS6A 2DOFA 3CP2A 4A3JJ 2CQKA 1WPKA 2R7OA 1IGNA 1PP8F 1USTA 2RNGA 3ZQHA 3TDZC 3GMEA 3GTPJ 3W6VA 4GDFA 2DJIA 2QQAA 2HDCA 4Y33A 1O4XA 2QYOA 1JGSA 1LDDA 3WU1B 4I6ZA 3KFWX 1EF4A 3P9IA 1D5YA 2K3FA 2TDXA 3FXKA 2FMLA 1W36D 3CC2I 3SEQA 3I53A 5F0FA 3ZMVA 4QIWN 1U3EM 4LK0F 1DP3A 1XGOA 3RDIA 3P7NA 5ILVA 2XGDA 1A36A 4A0XA 1EA3A 3HGYA 2A05A 1D0YA 3IUOA 5JR3A 4BH9A 3O2PE 3MKWB 1X2NA 2CJJA 2XKOA 4HSRA 3GFIA 2DFHA 2YPRA 5JLWA 5D5UB 2LF8A 3MCZA 2BY1A 3K4KA 2EFOA 2IW5A 2ZMEC 3WG7H 4I99C 2M87A 3HUGB 2YX4A 2QQ8A 2BXZA 3KE2A 2KISA 1P4AA 2A5WA 3G2BA 4MEXF 2IA2A 3WHBA 3G1OA 3U1DA 2EZHA 1NG7A 2FOWA 5GPAA 3SYTA 2BVLA 2QSFX 5M5YJ 2YU9J 2KQRA 1HSJA 2RNJA 3EQLF 4NC7A 5F1JA 2MH2A 3H5AA 4P1WA 4YFNF 2WBMA 2EILH 2NXNB 3QODA 4JX5A 1EJ9A 1MMAA 1BBYA 2HXOA 2DMQA 3BC8A 2E2IJ 3RZDJ 3ZPLA 1S9HA 4PZJA 4XM3A 4C2MJ 2DQRA 3JRAA 2CRGA 3ZXSA 1YX3A 2LKPA 3WTVC 4XBFA 5J47A 5J3LA 4LB6B 2E5ZA 3OMYA 4G9YA 3KP5A 3S2DJ 1X3UA 3LNQA 5KAFC 1AA7A 2E1OA 5IP6A 3C18A 4KIFA 4LLNA 1X19A 3AG1H 2ZMEA 1WJAA 2IXSA 1YJWI 4P9UA 2FMYA 4EM2A 1ETXA 4AIDA 3N97A 2OZ6A 3HOYJ 3GZNB 1XGSA 2KJCA 3B73A 3ONQA 4MTEA 1I27A 1S5LC 5HLGA 2W85A 2HI3A 1J59A 2GLOA 2JRTA 4NUBA 3EETA 1P7IA 1LDJA 1RR7A 1ZRFA 4HZFA 1AKHB 1R6RA 3SDBA 1DGWY 1U2WA 3VFZA 2XAFA 1HA8A 3RPQA 3HHGA 2X4HA 3U1KA 1D3YA 1WGXA 3MZYA 1UELB 2ZFWA 2MD5A 4TV7A 1SVLA 1IF1A 3ZN1A 1ZGJA 4PFPA 4XKVA 2L0KA 2VI6A 3FIWA 4BNCA 1C0WA 3VDXA 5TJJA 2LBFA 3H0GJ 5D4SA 3OS2A 3S1RJ 1RIOH 2LY1A 1YS7A 4I76A 4ZC3A 5J4YA 3KEQA 3MN2A 3M1CA 4KT6A 4OMYA 2K4BA 1LQ1A 5FJ8J 2VASA 1VQ7I 2V9VA 1Z67A 2Y0SN 4I01A 4DYRA 2R5ZB 5E3LA 4A3MJ 1JXSA 1JT0A 1W5SA 2CUZA 1CGPA 1UG2A 1FYLA 1RUOA 4BUPA 1BIAA 2OQGA 1VQLI 4XOPA 2LDUA 4KMUX 4J00A 3I58A 1YFHA 5J6XA 2UZKA 1U78A 1IJWC 3OYDA 4BHBA 4WK8F 2MW8A 2W25A 4KN4X 1X3ZB 3OR2C 2VXDA 4A3EJ 4M73A 4KUMA 2R7QA 1T8IA 3Q9VA 4LITA 4CDGA 1O3TA 2MA3A 2VC0A 2V79A 1Y1WJ 3CUOA 1J5YA 1NH3A 3A0BC 3JRCA 1WFXA 3M8JA 4HV5A 4WXCA 1R4MB 4R79A 1QVUA 4B44A 3D1NI 3RCOA 1R1VA 2DK8A 5HS8A 2Z9OA 3HBLA 1WJFA 1D1BA 4IO9F 1RRJA 5IT9Z 2E2HJ 2LG4A 1Y39A 4RDUA 4IOCF 3K9TA 2V1UA 2LVSA 3HOSA 2DPDA 5HDGA 4F52A 3HUGA 1WWXA 1YW9A 1AWCA 4NQWA 1LVAA 2DT7B 4UUVA 3GTQJ 2BVMA 2IGKA 3S1NJ 4LIUA 4HX4A 3U21A 3CCUI 3TMOA 1EKEA 3WU0A 5FD5A 5J8FA 3J81Z 1STZA 2D5VA 1TQIA 1MBFA 1YRNB 1X4PA 4CO8A 2KT0A 2MYSA 2HTJA 1XGMA 2EB7A 1VQOI 5LGTA 3BTJA 3QAHA 4HF2A 3T1BA 1JKPC 4UVCA 2ZCWA 3SJMA 3A02A 2Y9ZA 2P5KA 1B72A 1K83J 3VYRB 3GZ5A 2WWYA 3H36A 1I50J
chains in the Genus database with same CATH topology
5B1AH 1V55H 2EIKH 2EILH 3X2QH 3AG1H 2OCCH 2ZXWH 3AG3H 3WG7H 1OCRH 3ABMH 3AG4H 3ASNH 1OCZH 2EIMH 1OCCH 2DYSH 3ABLH 5IY5H 2Y69H 1V54H 2DYRH 5B1BH 1OCOH 3ASOH 2EIJH 5B3SH 3ABKH 2EINH 3AG2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1A H;  1V55 H;  2EIK H;  2EIL H;  3X2Q H;  3AG1 H;  2OCC H;  2ZXW H;  3AG3 H;  3WG7 H;  1OCR H;  3ABM H;  3AG4 H;  3ASN H;  1OCZ H;  2EIM H;  1OCC H;  2DYS H;  3ABL H;  5IY5 H;  2Y69 H;  1V54 H;  2DYR H;  5B1B H;  1OCO H;  3ASO H;  2EIJ H;  5B3S H;  3ABK H;  2EIN H;  3AG2 H; 
#chains in the Genus database with same CATH topology
 1OLT A;  1M1E B;  4JX6 A;  3SZT A;  1X1P A;  1X4O A;  2DA5 A;  3K4C A;  3S1Q J;  3S2H J;  1D0X A;  3UR3 C;  3RKQ A;  3F8F A;  4CGZ A;  2B7E A;  2HQA A;  2QKL B;  3L2Q A;  3V7C A;  3ZQG A;  5B66 C;  5FKL A;  1H88 C;  1JTY A;  3JRG A;  4IHV A;  4YEL A;  2IGM A;  3I0T A;  3FZV A;  3CJR B;  4H4K C;  1RES A;  1S72 I;  1OFC X;  3K1M A;  3VYS B;  2VOO A;  2NAZ A;  2RC4 A;  1W7P B;  1X1A A;  2QF7 A;  4KJZ A;  3G4S I;  2FJ1 A;  4BJ6 C;  1TWG J;  2R0Q C;  4BAC A;  3NEU A;  4MFD A;  4BU2 A;  4XLA A;  2M7A A;  4RBO A;  4I0A A;  3RYP A;  4M6V A;  1YLF A;  3FMR A;  1Y1V J;  2HYG D;  2LY9 A;  3AG2 H;  3F0C A;  3QPH A;  4ZTJ A;  1I39 A;  2PMZ N;  4ZYD A;  2GXA A;  1GXP A;  2ZJ2 A;  2EBI A;  4PUS A;  4A3B J;  5F27 A;  1HOM A;  3WGH A;  2R7F A;  4AYB A;  2CU7 A;  3I55 I;  2E1M B;  4RAG A;  1J09 A;  4KIB A;  4IQJ A;  2P4W A;  3GF2 A;  4QWQ A;  1TC3 C;  3M07 A;  3DPT A;  5GAE J;  5TRD A;  2DYR H;  1A6I A;  2VLA A;  4FHT A;  2LYC A;  4XSZ F;  4B4C A;  4MIM A;  1P9Q C;  3EYI A;  3HRU A;  3GX4 X;  3H5N A;  1G4D A;  1B6A A;  2OF7 A;  1UB9 A;  2E5N A;  2FX0 A;  5EEG A;  1R7J A;  4M3B A;  4HQE A;  4YRV A;  4XLH A;  2ME0 A;  2XPU A;  2L4M A;  1OPC A;  1OJL A;  1X2M A;  1S7E A;  4Y4R A;  4CA0 A;  3K4L A;  1B1B A;  3BQY A;  1YRN A;  2LRE A;  2Y2Z A;  3EUH A;  2HOE A;  2OA4 A;  1UFM A;  2DT6 A;  1FTZ A;  2UV1 A;  4A3K J;  3DTI A;  5FKO A;  5HDK A;  1KQ8 A;  4IF4 A;  3BR1 A;  3F6V A;  1P4W A;  4JX4 A;  2AXT C;  1UG0 A;  2ZME B;  1BN5 A;  4IHT A;  5FO5 A;  2KP6 A;  1EH7 A;  3M8F A;  2HOT A;  1S7O A;  1ORK A;  5DS9 A;  1ZRE A;  2Y9Y A;  2HWV A;  4B3A A;  1MMN A;  4A3G J;  2XB0 X;  4RB3 C;  2VKE A;  2PG4 A;  3QOE A;  3HB9 A;  3A01 B;  3J7Y J;  4UVA A;  1RC9 A;  2OZU A;  4GYI A;  3OIQ A;  4ZYA A;  3MWM A;  2M5W A;  1W7P A;  3FHZ A;  2EV0 A;  2G7H A;  1LB2 A;  5FLX K;  3DFG A;  2HS5 A;  5KVR A;  3F22 A;  4C3I J;  4CCL A;  2YS9 A;  1XGN A;  3K4N A;  3CC4 I;  1VFC A;  3W2V A;  3KZZ A;  3QU6 A;  5EF6 A;  2OV7 A;  4E7I A;  2MH9 A;  2QVO A;  3PIO F;  3E5U A;  2DOD A;  1T38 A;  3OS1 A;  1SFO J;  3HOU J;  4OAZ A;  5K7F A;  3K4M A;  3A01 A;  5A2Q K;  4IHX A;  3OYK A;  1WCM J;  2GM4 A;  2CV1 A;  4BY7 J;  4II3 A;  5M3M J;  1XG1 A;  1BL0 A;  3OSG A;  4DIQ A;  3WU2 C;  3T8R A;  2EZK A;  4WXD A;  4D9J A;  3P9K A;  5H6Q A;  1MMS A;  1AU7 A;  1LKX A;  3OL4 A;  4NNJ A;  3HOW J;  2AS5 F;  4A5M A;  2OUM A;  1GXQ A;  3VB2 A;  1D8K A;  3HOZ J;  2HOA A;  3BR2 A;  3CDH A;  3CP8 A;  4XID A;  3LFK A;  1RNL A;  5LBQ A;  2R7T A;  1VTN C;  3B02 A;  4Q5S F;  5K1Y A;  2OAZ A;  4M3E A;  3DXJ F;  1ON2 A;  4FET A;  2ZBK A;  4A0Y A;  5IT9 K;  5L3G A;  4IHW A;  1MBH A;  2EV6 A;  1IN6 A;  1X1C A;  3E6D A;  1SFX A;  1ULY A;  2HFH A;  4G6Q A;  4L0Y B;  2LKS A;  1WSU A;  5DUK A;  2R4G A;  3CO7 C;  3JRE A;  1TLH B;  4G94 A;  4R1H A;  3PIP F;  2CYY A;  3GW2 A;  2R7X A;  4W1U A;  2M7B A;  1Z91 A;  3FXM A;  3F72 A;  4FE4 A;  4U88 A;  2XGC A;  4CUG A;  5CVJ A;  4XL9 A;  3ZMT A;  2F5F A;  1FP2 A;  1ZAR A;  2UXX A;  4OIR F;  4Y52 J;  1VQ4 I;  3GXO A;  1W5T A;  3BG9 A;  5EG0 B;  3OYF A;  2EFP A;  4D5F A;  3MKL A;  4L18 B;  2IT0 A;  2ZNZ A;  2LBF B;  3OYJ A;  2OCE A;  3W3C A;  3C2G A;  1XS9 A;  3BWG A;  1VQ9 I;  3ABT A;  3BG5 A;  3U9G A;  2CSO A;  3I56 I;  1B8I A;  2F2E A;  3FKI J;  3CF5 F;  2COM A;  5ICG A;  3NWS A;  4LGW A;  1K61 A;  3SDG A;  2PI0 A;  4JOM A;  1FPQ A;  4M71 A;  2X0L A;  3BDD A;  1S8N A;  2BZT A;  2FSW A;  3WHC A;  1Q1V A;  1ODD A;  2DA6 A;  2P8T A;  1YIT I;  1E17 A;  2W7N A;  1ZQ3 P;  4EJU A;  3M1E A;  3CUQ A;  4RAZ A;  5EZH A;  4BGD A;  3CCV I;  3NAU A;  5B3S H;  4HLY A;  1CF7 A;  1OYW A;  1FOX A;  5DCF A;  1I6X A;  1BA5 A;  2GOX B;  3TP0 A;  1T98 A;  4N4N B;  3FM3 A;  2WA0 A;  1IN5 A;  4LLL A;  1REP C;  1GV2 A;  3HPG A;  5DYM A;  4XKC A;  3KYL A;  3S3O A;  2CFX A;  2VPR A;  3S3M A;  3DKX A;  1SFK A;  1O3S A;  2HDW A;  4QSH A;  3ABU A;  3ZCO A;  3SFI A;  1H9G A;  2LOO A;  1W1W E;  1TTY A;  2CV2 A;  1YX5 A;  2Q2E A;  3G1L A;  2LFB A;  4XRS G;  4MO7 A;  3K2Z A;  1X1B A;  3H3Z A;  1ZGW A;  2L7F P;  3LST A;  1E0E A;  1B4A A;  1OR7 C;  2V26 A;  5FKN A;  1FOK A;  2R7D A;  3EPZ A;  1KYZ A;  3TGN A;  3G71 I;  2O7O A;  3KZI C;  4C30 A;  1TT5 B;  2BHY A;  2ZXI A;  1F43 A;  4E7K A;  2HEO A;  4FTH A;  4GGG A;  2F5E A;  4OWR B;  2WAD A;  1F9N A;  1USS A;  4CIC A;  2F48 A;  1W36 C;  2VE9 A;  2IVM A;  2GWR A;  2VKH A;  2NVX J;  1JKO C;  1BR2 A;  5IOY A;  5K5R A;  4C2T A;  2V4J C;  3OWT A;  3BP8 A;  1YIJ I;  5L3F A;  2FOK A;  1APL C;  3O3K A;  2VQG A;  2Z5U A;  3H5R A;  2NRA C;  1L0O C;  2R5Y A;  1IAW A;  1Y8Q B;  4II2 A;  3GVA A;  3ZQI A;  2Y31 A;  4A6D A;  2D45 A;  2V1D A;  3KPH A;  1N25 A;  3E6M A;  4A93 J;  3HRS A;  3BR3 A;  2CQQ A;  2L5Q A;  1XCV A;  3DP7 A;  2AXL A;  5AON A;  3AAF A;  2UWM A;  3FXU A;  2Z1D A;  2EA2 A;  1JE8 A;  4A3I J;  2JUC A;  1BM9 A;  3ZRG A;  3BJO A;  4X1E A;  2NNY A;  4YIF A;  1LEA A;  3BG3 A;  4FCY A;  2WB1 N;  3D5L A;  1Q1H A;  2NOJ B;  3CCY A;  1MGT A;  3OL3 A;  4LG0 A;  1RPW A;  2JK3 A;  2I5U A;  3LSG A;  2VQH A;  3PNT A;  1YI2 I;  2BEO A;  2HQ5 A;  1W5C C;  4M6Y A;  2ESN A;  3DEE A;  4KNY A;  3ZOB A;  1BR4 A;  2L3D A;  1W4M A;  3IC7 A;  1PJR A;  2QSH X;  1BI1 A;  1JHF A;  1HW5 A;  2STT A;  4IPA A;  1Z0X A;  2LY2 A;  5FLV A;  2XDV A;  4XLF A;  3LWF A;  5DTD A;  1L3L A;  2G9W A;  3DKW A;  2DA2 A;  3JRI A;  2F5V A;  4DBQ A;  2NS8 A;  4PJL A;  5E1W A;  2GAU A;  3W6K B;  3X2Q H;  3SQN A;  3UKG A;  1Y0N A;  2GXB A;  3Q3S A;  2KLO A;  2VE8 A;  3K69 A;  2XRO A;  2P7C B;  2BV6 A;  5EZG A;  4PJ0 C;  1MMD A;  1FT9 A;  2E1C A;  4U7D A;  2ISZ A;  1R9T J;  1I1G A;  1MNE A;  3BY6 A;  4F91 B;  3GTG J;  1P92 A;  2JA7 J;  1W7P D;  5K7H A;  3JRF A;  2A61 A;  4DYC A;  4Q47 A;  2EA4 A;  2XF7 A;  2N8G A;  4L0Z B;  3E97 A;  2X85 A;  5FFX A;  2R7Z J;  1R1T A;  2Q1Z B;  3WTS C;  2VKD A;  3BZC A;  1R49 A;  1ZN2 A;  3TO6 A;  2DA1 A;  2WAQ A;  2V1X A;  4W97 A;  2DFF A;  4IRH A;  1QO0 D;  2EH3 A;  3U2R A;  2AO9 A;  2K5C A;  2ZFU A;  3K1P A;  2XF6 A;  1YW7 A;  4ZYH A;  1BOB A;  4RB2 C;  1OR7 A;  2R7V A;  1ZH5 A;  3TP3 A;  2LSO A;  3LA2 A;  2W4S A;  1V5E A;  3K10 A;  2HVR A;  1WQ2 A;  1E2X A;  4S05 A;  1XSV A;  2VUM J;  4ZZL A;  1V54 H;  3F21 A;  5CQE A;  1G3Y A;  3WTX C;  2PJR A;  2FBH A;  2F6C A;  2W00 A;  6PAX A;  4EGY A;  3KYC B;  5CPR B;  3CMY A;  2QLZ A;  1U5T B;  2K85 A;  2HYJ A;  4A3D J;  4HX8 A;  4YII A;  2ZJQ F;  4FX4 A;  5DV5 A;  1DDN A;  4HDU A;  1B72 B;  2F4M B;  2DK5 A;  3I64 A;  1I3Q J;  2OQR A;  2IAI A;  2O0Y A;  4GYG A;  1QQI A;  2QEN A;  2CG4 A;  4L9N A;  5HS9 A;  2XAU A;  3OIO A;  3L2C A;  4HPQ A;  1V5G A;  3ECO A;  5LHG A;  3Q0W A;  4KYW A;  3TDU C;  1NHA A;  3RPU D;  2W24 A;  3S15 J;  3LMM A;  5J1Y A;  1GDT A;  3CZ6 A;  1LFB A;  2X1D A;  4LMY A;  2O8K A;  1S29 A;  1W0U A;  4RB0 A;  3HEF A;  1X1D A;  4ASN A;  2KJB A;  5EGO A;  3HOT A;  1E3O C;  4IOA F;  1U9N A;  2Y48 A;  1S7A A;  3JW4 A;  4I98 B;  3OYH A;  1F5T A;  1XMX A;  1WHU A;  3S14 J;  3H1C A;  2CQX A;  2EFQ A;  2L9V A;  4N9H A;  4HNU A;  1YO5 C;  2E7X A;  5E3O A;  1QBJ A;  2K9N A;  1FYK A;  3F23 A;  4RAY A;  2K9M A;  2QQB A;  3VPR A;  4N0B A;  2VT3 A;  2OTJ I;  3GTJ J;  4HOB A;  1Z9C A;  5LEK A;  2M2E A;  2TRT A;  1LEB A;  1OQY A;  2X9D A;  3PO3 J;  2Y0M A;  5E17 F;  1O7L A;  2KDO A;  3HYI A;  3VWB A;  3HL2 A;  1R4N B;  2IRF G;  4FAS D;  4LJZ F;  4O5V A;  2VOP A;  4R8H A;  5E20 A;  3Q0V A;  4XOT A;  2ZJR F;  5FKM A;  3MAJ A;  2KPM A;  4Y15 A;  4BBR J;  4I2O A;  2E60 A;  2VBY A;  2R92 J;  1JTX A;  2QM3 A;  1ZLJ A;  2O9L A;  2W57 A;  4XKW A;  2CO5 A;  1G2H A;  3OYB A;  1MBK A;  4I0B A;  3ZGK A;  1RR8 C;  2QZ8 A;  3K4J A;  2K40 A;  1T0F A;  5LRS A;  5GAG J;  2ELH A;  3LL7 A;  1ETV A;  2OPT A;  5TIS C;  1ITY A;  2EQR A;  1IV8 A;  2HOS A;  5ICC A;  3FXJ A;  1LDK B;  3QYE A;  2DA4 A;  4UHT A;  2ADU A;  2V7F A;  1K78 A;  4CHU A;  2CW7 A;  2HU9 A;  2LR8 A;  2M8E A;  3OY9 A;  1YYV A;  5KHD A;  3I54 A;  3OYM A;  4BXU A;  5IYD J;  1CQT A;  2L02 A;  3TED A;  1N77 A;  4U0Y A;  2X6O A;  1MBE A;  4KN7 X;  3C2H A;  3ERM A;  1TW2 A;  2ZXW H;  4AWX B;  1ZTR A;  2FQ3 A;  1KU9 A;  3J7Z I;  1Z7U A;  3LAP A;  3I3L A;  4RS8 A;  3SZG A;  1IRZ A;  2DOA A;  3DLA A;  3GEZ A;  1Y0U A;  5LHH A;  1S3J A;  4IRG A;  2BW3 A;  2AHQ A;  2GIV A;  3S17 J;  3D5R C;  3LA3 A;  1XMA A;  1DU6 A;  1T0F C;  4BE1 A;  2V6C A;  2M8G X;  2VC1 A;  4GCV A;  1GLN A;  5DCM A;  5M5W J;  3FK7 A;  2VPL A;  1HKS A;  2RDP A;  3QWL A;  2W84 A;  4UXN A;  1IN8 A;  2M4G A;  5H6R A;  1RUN A;  1KGS A;  1T6S A;  2MFZ A;  5FLX Z;  3ZMU A;  4P96 A;  3CUQ C;  1IZ1 A;  4EJO A;  1B8I B;  2WAQ N;  2Y69 H;  4XRM A;  2PFB A;  1PP7 U;  2RQQ A;  5HDN A;  4ZDL A;  2H8W A;  5DCM B;  5C44 J;  4EJV A;  1IDY A;  4C2U A;  5IP9 J;  2KZV A;  3F8N A;  2JRM A;  2WY7 Q;  2KFD A;  3J80 K;  2OC6 A;  3ZMD A;  4BYY A;  3LSM A;  3EUH C;  3VSK A;  1ZG3 A;  4BDZ A;  3KP6 A;  3BPV A;  2YSR A;  3FMS A;  4HV6 A;  1OCP A;  4X6A J;  3PL8 A;  5KK1 A;  5BPD A;  2LNB A;  3GZ6 A;  1VZ0 A;  5E8I A;  3MZ8 A;  3DKY A;  2MD0 A;  1F4K A;  3BTL A;  3KLN A;  2JQ7 A;  2R7S A;  5EDN A;  3K70 C;  4A3L J;  2BXY A;  4B09 A;  2XAG A;  4IJA A;  4MQ9 F;  1JGG A;  3WOD F;  1UAA A;  2ISY A;  5CJ9 A;  4G6D A;  2JVH A;  5LHI A;  4JK1 X;  2X6Y A;  2O3F A;  3TO7 A;  5F0H A;  1FX7 A;  1PUE E;  2ZXH A;  1U9O A;  2IA0 A;  1T56 A;  3G1M A;  5LGN A;  2NS7 A;  2IS2 A;  3C3W A;  2E36 A;  4CCO A;  3CCR I;  4YG2 F;  2J5P A;  3ELK A;  2NVQ J;  2QQ9 A;  2FBI A;  4I7H A;  1ZAO A;  4E6K G;  3WTU C;  2R7U A;  4EM1 A;  1J7K A;  1ONV A;  5K5Q A;  1S6L A;  1FZP B;  5D6F A;  2FRH A;  5GTI C;  4E7H A;  2DI3 A;  1JUS A;  1FOY A;  3IWZ A;  3KET A;  1POG A;  2I8D A;  3B6A A;  4YEJ A;  4E7Z A;  3OYG A;  3SEZ A;  1KU3 A;  3JCU C;  5J1U A;  1QHG A;  3S32 A;  2HXI A;  2JPC A;  1UJ8 A;  3CMM A;  2F4I A;  3CDL A;  5BNG A;  1VQM I;  4CCM A;  2W48 A;  1OCO H;  4XN0 A;  1K7A A;  4LG3 A;  2R7R A;  4M3F A;  1K6Y A;  5AIQ A;  1A04 A;  3CDI A;  3QPS A;  2LLK A;  3VEP A;  2O5R A;  4LOC A;  4ZYG A;  4ENJ A;  2K27 A;  4ETS A;  5C4X J;  4XLE A;  1TQM A;  4O6J A;  1T2K A;  2VQL A;  5FLM J;  2MSY A;  2VXZ A;  3DU6 A;  4OMZ A;  4G7Z F;  4HRI A;  4DZP A;  4Y13 A;  2V6E A;  2NVU B;  1HDD C;  4E7L A;  4OIN F;  4D5C A;  4ANJ A;  2E1N A;  2IBD A;  3JAM K;  2JT1 A;  2E1M C;  3OS0 A;  2KDZ A;  4B47 A;  4BBS J;  1YQA A;  4ZDP A;  4H0E A;  3W2A A;  3IWF A;  3TBI A;  1MJB A;  3J81 K;  3CQZ J;  2IS1 A;  4KIT B;  4NHJ A;  4OIO F;  3RQI A;  3LFU A;  3PSI A;  2X51 A;  2FNP A;  1NK3 P;  4WF2 A;  1SMT A;  4EJW A;  4KIS A;  2FA5 A;  5JFR A;  1ZRD A;  2NNN A;  2ZJP F;  2EV5 A;  1ON1 A;  4Z6Y A;  3H3V K;  4FX0 A;  3OYC A;  2KIF A;  2JZY A;  2K3P A;  3LQR A;  3JSP A;  1OYY A;  5GAH J;  3CF2 A;  2VN2 A;  3HRM A;  4A0Z A;  5E1X A;  3CJN A;  4Y17 A;  3ROU A;  2F5D A;  4P5O A;  5HNH A;  3AKZ A;  4BHC A;  2P5V A;  3ECH A;  2H27 A;  1K78 B;  1F1Z A;  1D1C A;  1LFU P;  2DDB A;  3DWL E;  1JHH A;  1IN7 A;  2FNA A;  2MC4 A;  3GO5 A;  3H9J A;  4WX9 A;  1MMG A;  4QPQ A;  1QPM A;  4J01 A;  1PDN C;  3COA C;  5D4R A;  3DF8 A;  2B0L A;  2XSJ C;  4UUS A;  2O8X A;  1IRF A;  1BIB A;  3REO A;  2BE5 F;  2EFW A;  1KON A;  1Y8R B;  1MIJ A;  1HW2 A;  2HQN A;  3FHN A;  3K70 D;  2ICW G;  1IO2 A;  1ETW A;  3T0Y A;  1H0M A;  3LSJ A;  1R23 A;  3BLY A;  3DPL C;  1I5Z A;  2FBK A;  3W6J B;  4ESJ A;  2HPI A;  3Q9S A;  5DUI A;  3O6B B;  1OCT C;  2EIK H;  4B3X A;  1SAN A;  1DP7 P;  2IGO A;  3NWT A;  3CCE I;  1FC3 A;  3LSI A;  4UVB A;  4XOR A;  4WWC A;  2GQQ A;  2V9P A;  2XB5 A;  4BEH A;  2PEX A;  2DFI A;  1VND A;  2CUF A;  2FD5 A;  1ZR2 A;  3GFL A;  1K79 A;  3PQK A;  1HF0 A;  4ON0 A;  3L2R A;  3BTI A;  3E6B A;  3VOE A;  3GLX A;  9ANT A;  1LPQ A;  4S04 A;  3F3X A;  3F8B A;  4MHG A;  1ZKG A;  2G7U A;  1J9I A;  2LTP A;  4M9Z A;  4DZJ A;  4HW0 A;  4CCJ A;  3DU5 A;  3AL0 C;  4BE0 A;  2M3A A;  3E5Q A;  4F7Z A;  3ERE D;  3V7S A;  1SAX A;  3GUD A;  4WXH A;  1ZK8 A;  2I10 A;  2JSP A;  1U8R A;  3LSR A;  1KQ0 A;  3GTO J;  3RZO J;  3K7A J;  1BI3 A;  5CVV A;  2A6H F;  1FBU A;  4M72 A;  2DDA A;  2DJN A;  4OOI A;  2Y75 A;  1MKM A;  4XQF A;  2OBP A;  2NS0 A;  5M5X J;  3ZQL A;  4CSW A;  3HOV J;  5ICE A;  4HST A;  2BGC A;  1Z6R A;  4L9J A;  3S8P A;  4AU7 A;  2EIJ H;  3KLO A;  3TKY A;  2HQR A;  1LJ9 A;  2CUE A;  4ABZ A;  2WY8 Q;  1U0J A;  2BY0 A;  1D5V A;  3V8L A;  4MEY F;  2LRD A;  3I9V 2;  1BI0 A;  3JTG A;  1YE9 A;  1SVM A;  3R60 A;  1TWC J;  4CZC A;  3ZMZ A;  5J8C A;  3JSO A;  4IRI A;  2RGV A;  1U5T A;  2XGX A;  4HQM A;  2E71 A;  4Z2Y A;  2JTV A;  2R5Y B;  4FT8 A;  1R71 A;  3CUQ B;  4Y7N J;  2NVY J;  1I3A A;  3VSL A;  3RTR A;  3MEX A;  3N4M A;  1LFP A;  2L7M P;  3C7J A;  2A5Y B;  1QVT A;  2QKM B;  4PGG A;  2A6T A;  1MBG A;  5GTH C;  2EWN A;  1ENH A;  3RQ4 A;  1WJD A;  1LUJ B;  4E7J A;  1ZR4 A;  1KU7 A;  2Z2S B;  4JQF A;  3OYI A;  1KA8 A;  3ABM H;  2L2O A;  2ID3 A;  2AQF A;  2W82 A;  4BL0 B;  3MKY B;  3A1Y A;  1VQ8 I;  1HKT A;  1EH8 A;  2JWT A;  3E7L A;  2KRH A;  2LH9 A;  2HKO A;  2MLG A;  4XK4 A;  1JUP A;  4J19 A;  1XN7 A;  5L3E A;  4BXX J;  3G3Z A;  2ZB9 A;  1FMV A;  5CVI A;  2JN6 A;  3L7W A;  3QOP A;  4U0W A;  3QP6 A;  5JLX A;  5K5O A;  4Q48 A;  3WTT C;  5D5X B;  3FM5 A;  2AQE A;  4E70 A;  2D1H A;  3KZY A;  1HLV A;  3DEU A;  4RGS A;  4EEF G;  3M9A A;  4A2U A;  4X0G A;  5JVT A;  1I6H J;  2JMW A;  2HPM A;  1R36 A;  4C9Y A;  5ICF A;  2DMP A;  2VL8 A;  5JHU A;  3ISP A;  3N05 A;  1QZY A;  4M3D A;  4BS9 A;  1K4S A;  3M3Y J;  2O6G E;  3HSF A;  2XPW A;  4DNC A;  3V4G A;  3NAR A;  3RKW A;  1ETQ A;  1YOV B;  3FF5 A;  3BR5 A;  4K2E A;  1LE8 A;  5D5V B;  3BG6 A;  3QQA A;  2NOG A;  2E7W A;  2D1V A;  1QRY A;  4JBA A;  1OCR H;  1ZG1 A;  2GXG A;  5C4J J;  3R61 A;  3FDY A;  3RIR A;  2EZL A;  5L3D A;  2MG4 A;  2L7Z A;  3R6S A;  5JVG F;  4LFU A;  4CCK A;  3OYA A;  1XTA A;  4BDY A;  3KEY A;  4KFC A;  1IUY A;  2DW4 A;  2Q0O A;  4GFB A;  5ILU A;  4ESB A;  1MDM A;  1WZ2 A;  4ZDO A;  4MGR A;  2M4K A;  2HKX A;  1ZYR F;  2L4A A;  5KNL A;  3E0J B;  1B59 A;  4EQQ A;  1Z77 A;  4XN3 A;  3B6C A;  3W2W A;  1SFU A;  3OYL A;  5E8G A;  3SZP A;  3LSP A;  2EPF A;  3JAM Z;  4IXA A;  4ITV A;  3HKZ A;  1A31 A;  3R0J A;  3PSF A;  1FIA A;  1G8X A;  4MTD A;  4KIC A;  2QCO A;  2CUJ A;  2DU9 A;  2F5C A;  2H09 A;  1WKM A;  3H92 A;  3FX3 A;  4JP0 A;  2Z99 A;  4UB6 C;  3QP5 A;  3KP3 A;  4QTR A;  1YHQ I;  2E2J J;  2A69 F;  5GAD J;  1YS6 A;  2ETH A;  4HNT A;  2ECB A;  1YIO A;  2KIU A;  5IT3 A;  2MC3 A;  2RN7 A;  2PMZ A;  2ELJ A;  1R58 A;  4OAY A;  4EGZ A;  3C2B A;  2LKX A;  1YJN I;  3KP4 A;  4CYC A;  4F92 B;  3VYT B;  1IG7 A;  4IKF A;  1RKW A;  2JUG A;  2YUS A;  4A6E A;  2XF5 A;  1N75 A;  3HJE A;  4XRS A;  2H8R A;  3IH4 A;  2P5L C;  3CCS I;  5F6F A;  3F8M A;  3P5J A;  5E3M A;  3HKZ N;  2HNH A;  4KIG A;  2CS3 A;  2HVS A;  2WV1 A;  3K0L A;  4E7S A;  1BJA A;  4PJM A;  1ACI A;  1SD6 A;  1XC5 A;  1O3Q A;  5F08 A;  1Y56 A;  2BW3 B;  2FXA A;  3ML6 A;  1P4X A;  4PSX A;  3WTZ A;  1VQ5 I;  2PMU A;  2BHZ A;  3KCC A;  1Z21 A;  1BR1 A;  2MBF A;  1YW8 A;  1HW1 A;  1U5T C;  5BOX A;  4KDP A;  5LFA A;  2PN6 A;  2VON A;  1MJA A;  5IOZ A;  1MD0 A;  1TT0 A;  5BQT A;  1HDP A;  2CFO A;  5F0C A;  4ESF A;  3CMA I;  4M9S A;  3A4C A;  5HLI A;  2HTS A;  4RGU A;  2XAS A;  1GHC A;  3M4O J;  3DQV C;  1FWZ A;  2L01 A;  2ESH A;  1IXR C;  2JA2 A;  2XUB A;  1WI3 A;  3HSR A;  5EYR A;  3OOU A;  2JVG A;  3RPU A;  1JI8 A;  4EMS A;  1OYI A;  4IHY A;  1JT6 A;  3GCM A;  1LE8 B;  2XIG A;  4BHP A;  2ACJ A;  2K02 A;  2XSD C;  2IJL A;  1NG6 A;  4P55 A;  1MSF C;  3BQZ A;  1K4T A;  1A5J A;  3FXL A;  3E6C C;  2WV0 A;  4N4O B;  2Q8K A;  2H6C A;  2QUF A;  3DBH B;  4XMY A;  3QPL A;  2PBI A;  5CLS A;  5D6E A;  4UY8 I;  2E19 A;  5A2Q Z;  5IY5 H;  4Q4Z F;  3HC7 A;  2PLY A;  2ID6 A;  2P0W A;  1O57 A;  2ZKZ A;  3ASO H;  4IEJ A;  4P9F A;  2R93 J;  4IZZ A;  5LRR A;  1Z6T A;  5E3N A;  3QRF F;  4BY1 J;  2BBY A;  2M0C A;  2XRN A;  4DGW B;  4DOZ A;  4BXF A;  4XNF A;  1SD4 A;  2RAE A;  3I4M J;  5KCM A;  4B43 A;  3WE3 A;  2VKV A;  1RET A;  2DCE A;  3AG3 H;  3BCA A;  5TGT A;  4FQG A;  3O8H A;  2C6Y A;  2HR3 A;  4O3M A;  2FQ4 A;  5DDG A;  1QU3 A;  4RM3 A;  5DEQ A;  1QHH D;  2HZT A;  1JJ6 C;  1SAU A;  1XX5 A;  3G6E I;  3ABL H;  1XSX A;  4BE2 A;  4ENN A;  3FXR A;  2ME6 A;  3IL2 A;  1IN4 A;  3GBG A;  4NB5 A;  5HLT A;  3IKT A;  3H35 A;  3IV5 A;  4PFO A;  2DLL A;  3BR6 A;  4A12 A;  3EUK L;  4HEA 2;  2KL4 A;  1LVK A;  1AOY A;  2IA1 A;  3IHU A;  4HYE A;  1SEU A;  2H1K A;  3A2K A;  3GTK J;  3QYF A;  1Y6I A;  3JRB A;  1R5H A;  2A07 F;  4AM3 A;  5DD4 A;  4PDK A;  2CW0 F;  3F9K A;  2ZC2 A;  1V3F A;  3LOC A;  1IUF A;  5JHF A;  1QPI A;  1UCR A;  3DTE A;  2MAB A;  1SD5 A;  1TWH J;  4BQN A;  4ZYE A;  4AYB N;  2L9R A;  4CYC B;  3GWZ A;  3MQ0 A;  3KIO A;  5FB2 A;  1OMI A;  3JRH A;  1FJL A;  3WTY C;  4UV8 A;  1RKT A;  3M7G A;  4WCG A;  3I59 B;  4C3J J;  1KU2 A;  1SMY F;  3V42 A;  3DBR B;  3HPH A;  3FXO A;  1N78 A;  3BJA A;  3H3U A;  3WG9 A;  2VB6 A;  4A5N A;  4CYD A;  1OCZ H;  4RGR A;  5LD2 C;  4PJJ A;  1OCC H;  4V2F A;  4HNV A;  3CES A;  2ZXJ A;  2WAE A;  4CXF A;  5IP7 J;  1R00 A;  2P6T A;  5LLQ A;  2B63 J;  4XLC A;  3BCB A;  2A3S A;  3LSH A;  2ZO4 A;  3L9F A;  3FWE A;  5IPA A;  3MFK A;  1P6R A;  3E3V A;  1J2X A;  4B8X A;  3WTW C;  3S1M J;  3CLO A;  4CZZ A;  2JA5 J;  3RKX A;  3IAS 2;  4AC0 A;  5AIP A;  4EJT A;  2NYX A;  3I59 A;  4XKB A;  4ZJZ A;  4U0V A;  2EJR A;  1XMK A;  4A3F J;  4A69 C;  3CME I;  1TP4 A;  3IAM 2;  5DM7 F;  5H20 A;  2BOL A;  4B48 A;  1T08 B;  2VT2 A;  3HHH A;  1NK2 P;  1QZE A;  3ZR8 X;  4OU0 A;  1P7J A;  3ASN H;  3I71 A;  1DUX C;  4A3C J;  2H1L A;  1G3T A;  2GIZ A;  2OJE D;  4ZTF A;  4HDV A;  1DQU A;  2FE3 A;  1WH7 A;  5EG0 A;  3BRO A;  2DA7 A;  5CVU A;  1HKQ A;  4DBR A;  3OYN A;  3L1P A;  1UHM A;  2HZD A;  1WH5 A;  4LD5 A;  2YU3 A;  1SD7 A;  3CJQ B;  5D8K B;  1I1S A;  3RKY A;  2XC7 A;  4M74 A;  4XLP F;  2CMP A;  1PUF A;  1MZB A;  4AIJ A;  3H0D A;  5E79 C;  3KP2 A;  1BOA A;  3F8C A;  5FRM A;  3KYD B;  1IXS B;  4I02 A;  3KX2 A;  1D8J A;  5L3C A;  3IP4 B;  1WJB A;  1H8A C;  1QA6 A;  2XAQ A;  4UNO A;  3K1N A;  1IRG A;  5K7Z A;  2OTL I;  2O03 A;  3IRR A;  3HGG A;  1V55 H;  1BJZ A;  4IVN A;  2B9S A;  2IP2 A;  1FYM A;  2NVT J;  4ZZD A;  1GVD A;  2OCC H;  3HG9 A;  3DCF A;  5ED4 A;  3NRV A;  5F04 A;  3V8J A;  1FBS A;  4D7N A;  2KKO A;  2P81 A;  1GT0 C;  3J80 Z;  4BAY A;  2CQN A;  5EEA A;  1SVO A;  1PUF B;  3KP7 A;  4DJA A;  1Z1D A;  4GRI A;  1AHD P;  3J7A O;  1TL8 A;  2PX9 A;  1RI7 A;  3S2W A;  1JUM A;  3MMY B;  3TO9 A;  1R5G A;  2V9K A;  4RA2 A;  5HOO A;  3RYR A;  1VQK I;  3IRQ A;  2GZW A;  2QSG X;  4DW6 A;  5LGU A;  2V1N A;  1YG2 A;  4HX7 A;  4MFE A;  2UUZ A;  3TW7 A;  1WJ5 A;  4G12 A;  5BPI A;  1B9M A;  2XVC A;  1BI2 A;  4U87 A;  3T5X A;  1ZGA A;  3PNV A;  4QPO A;  2D2W A;  4M6X A;  4L5I A;  1YJ9 I;  3R0A A;  3CCL I;  4AUX A;  3FXQ A;  3L00 A;  2CWE A;  4PCQ A;  4HG2 A;  2QBY B;  2CQ7 A;  1MH3 A;  2K9L A;  3TOA A;  5ILS A;  4L9T A;  2WB1 A;  5B1A H;  3I5U A;  1WJC A;  3MVP A;  1DPU A;  1XB4 A;  5FFZ A;  5FRO A;  1FIP A;  3I4N J;  4RLQ A;  3WE2 A;  1F36 A;  2UXN A;  1UZC A;  2FUG 2;  3RJP A;  1T95 A;  2X1C A;  4U7B A;  3GYH X;  2K9S A;  2LD5 A;  2LP0 A;  2M0M A;  1JJ8 C;  1UHS A;  5HS7 A;  2GA2 A;  2VOD A;  5FKK A;  3P9C A;  2RRE A;  2RV8 A;  3K6G A;  3PNY A;  1Z05 A;  3TW6 A;  3CCJ I;  2L9S A;  4IL6 C;  5CQG A;  4QLC U;  4PGH A;  2Q2E B;  3OYE A;  1DGR M;  2X6W A;  3D0S A;  3HDD A;  4RM2 A;  2JSC A;  4IX7 A;  1MSE C;  3PQJ A;  3A0H C;  1ZLK A;  2DQL A;  3E1S A;  3CC7 I;  3S93 A;  3PJR A;  1WRJ A;  5DD8 A;  3VOD A;  1KZH A;  2DOE A;  4C3H J;  1FSH A;  2TCT A;  1TWF J;  5FRN A;  2OD5 A;  1CF7 B;  1BW6 A;  2JPB A;  5L3B A;  2K4J A;  3ZN0 A;  3BPX A;  2R7W A;  2COB A;  4HLX A;  2OU2 A;  3ZQ7 A;  5B1B H;  4YFK F;  3GFJ A;  4B1R A;  2PJR B;  3HM5 A;  3HXL A;  2P7V B;  1ETY A;  3DBL B;  1FP1 D;  2VJI A;  2DMN A;  3HRT A;  3ULQ B;  4AVP A;  1G59 A;  1WI9 A;  2XKP A;  3CCM I;  1A35 A;  2Y30 A;  1QZZ A;  2XRL A;  1PVE A;  2CV0 A;  1VQP I;  2BY2 A;  1XPX A;  1IC8 A;  1MDM B;  2DAO A;  1DU0 A;  1B9N A;  2VBW A;  3AG4 H;  1T39 A;  1SFE A;  2WC2 A;  1XCB A;  5CKT A;  3T8T A;  3ZP5 A;  1HC8 A;  3BT9 A;  4BJT A;  2DXI A;  2R5Z A;  1MND A;  1O7F A;  1Z7L A;  2E34 A;  3I4P A;  5J1R A;  1GV5 A;  2LK2 A;  3MKZ A;  1ETK A;  4BQQ A;  3JRD A;  5ERI A;  3RSN A;  1LNW A;  1TQP A;  1XDU A;  2IPQ X;  4NC6 A;  4BJ5 C;  1TNT A;  3RI4 A;  5FD6 A;  5GPC A;  1WVR A;  4G6T B;  3AL0 B;  2A6E F;  2IGN A;  5EGO B;  3CCQ I;  3GTM J;  1QGP A;  5BS6 A;  4IHS A;  3L2U A;  3VYU B;  1Z3X A;  4F3Q A;  4PJN A;  2IS4 A;  3BR0 A;  4EAT A;  1E3H A;  1FTT A;  2WAF A;  1NTC A;  1ERD A;  2JA6 J;  4NC8 A;  2VIX A;  3V7R A;  3IH2 A;  3DEW A;  2BYV E;  4S0H B;  3HTU A;  4UUS B;  2ECC A;  4HA8 A;  3EYY A;  4D1Q A;  3PFI A;  5J4V A;  3WGI A;  5F64 A;  4YFX F;  1J75 A;  3SXY A;  3HIF A;  3WGG A;  4AIK A;  1XSD A;  1IW7 F;  4ZH4 F;  3OOP A;  1TBX A;  2K7L A;  2E35 A;  2DTZ A;  3R4K A;  3PUB A;  2BY3 A;  3MZH A;  1E3P A;  2VBZ A;  2QWW A;  2DN0 A;  2YX7 A;  3DLL F;  2DO7 A;  1TNS A;  3HTS B;  1BW5 A;  1ZEL A;  1FOW A;  1R5I D;  1G3W A;  1V4R A;  2X6X A;  3BZK A;  1EV7 A;  4MNU A;  4XIC A;  4EV0 A;  1OKR A;  3UNG C;  4ENM A;  5HNF A;  3A03 A;  4XON A;  1MJ9 A;  3Q0U A;  3ZQC A;  2MLK A;  4RAF A;  2HYF A;  4BQO A;  2M1B A;  1H89 C;  3FBN B;  1R22 A;  2STW A;  4E4H A;  3BJ6 A;  5KAI C;  4PSW A;  2FF4 A;  5BMZ A;  4MQV A;  1R1U A;  4RB1 A;  2DYS H;  2XGE A;  3JTH A;  3K4B A;  2FEZ A;  4NBQ A;  1HXD A;  4XSX F;  5IYB J;  3K2A A;  2DFE A;  2L9N A;  3M8E A;  1PYV A;  1TWA J;  3IH3 A;  4LLG F;  1X58 A;  3CLQ A;  5C3E J;  2KMU A;  3S3N A;  2H6B A;  4V19 K;  2HVQ A;  2EZI A;  1VI0 A;  2VJ5 A;  4RLF A;  3ZMS A;  2IEK A;  2Y0S A;  3BTC A;  4V2G A;  5E18 F;  2DMT A;  4Y3O A;  2F4O B;  5CVR A;  4LIV A;  2LF7 A;  1W0T A;  3GFM A;  2ZNY A;  1G6N A;  1TZL A;  2EK5 A;  1KQ9 A;  2EFN A;  5LEJ A;  2YR2 A;  3BZ6 A;  1RZ4 A;  2K9Q A;  1MW7 A;  2EIN H;  3KEO A;  2GBY A;  2M30 A;  3D5S C;  4GXO A;  3NQO A;  4N9I A;  2VJJ A;  1HBX G;  1GUU A;  1O3R A;  3FMQ A;  1FBQ A;  2FU4 A;  1V5F A;  1XD7 A;  1MNM C;  2QGU A;  3F6O A;  2M34 A;  3DTK A;  4LK1 F;  4UV9 A;  2CGP A;  4FE7 A;  2PQ8 A;  1GVJ A;  3Q5F A;  3HZJ A;  1FY7 A;  5D5W B;  4AIH A;  1JKQ C;  1G3S A;  5JI6 A;  1HST A;  3IKV A;  2JJ7 A;  5CYV A;  4KA4 A;  2XAH A;  1AKH A;  2MGQ A;  3CTA A;  3J7A Y;  3PO2 J;  3OIP A;  3CJT B;  2QEX I;  4CCN A;  3ZQF A;  2X1E A;  2KIQ A;  1ZRC A;  1BC7 C;  2LC2 A;  2XPV A;  2H94 A;  2G0E A;  5J40 A;  2PJP A;  4D7M A;  3H9Q A;  2HDD A;  3BOQ A;  2VQC A;  2Z3Y A;  1KYW A;  3C1D A;  3EDP A;  5IYC J;  3L09 A;  1UMQ A;  4CH7 A;  1IV6 A;  1VQN I;  2XV4 S;  5HLH A;  3OV8 A;  3ESW B;  4M3G A;  1IDZ A;  3OR1 C;  3CO6 C;  3LSK A;  3L2W A;  3LA7 A;  4PK4 A;  3QPT A;  1XDS A;  1IRX A;  4DQ2 A;  4G7O F;  4BEH B;  2PMH A;  5F1R A;  2QA4 I;  1JKR C;  4L5E A;  2CH0 A;  2GOM A;  1T33 A;  4HAM A;  2JA8 J;  4FIS A;  1U8B A;  1VF9 A;  3LAJ A;  1FLI A;  4IQ4 A;  4EVI A;  2A68 F;  5M3F J;  2W1O A;  2RQP A;  4F93 B;  3FIS A;  1J0R A;  4OIP F;  1ZG5 A;  2ZSI B;  3PUF A;  2ELK A;  3FK6 A;  3GTL J;  3MD2 A;  4BKX A;  2O61 A;  4HBL A;  1U6G A;  1H9T A;  4MLO A;  1Z3Y A;  3OSF A;  2XHK A;  3FKJ A;  3ABK H;  4UUT A;  2XAJ A;  1EH6 A;  3DPU A;  2CW8 A;  2KRF A;  2K86 A;  4KT5 C;  2KZG A;  1VQ6 I;  4RMN A;  2M45 A;  4M9X A;  1SC7 A;  1YTY A;  4XLN F;  1BC8 C;  1FNN A;  5E1Z B;  1HQC A;  4RGX A;  1A6Q A;  4YIR X;  4EM0 B;  3JR9 A;  3TQN A;  2WTE A;  4NQW B;  1ZHF A;  5GP9 A;  4HF0 A;  5EJC A;  3EUA A;  2Z16 A;  2L7K A;  4ENK A;  4G7H F;  3LQQ A;  3HOX J;  3PM1 A;  2KIM A;  2DTR A;  3E5X A;  5DM6 F;  3G73 A;  3L2V A;  3GLL A;  2DPU A;  4KMF A;  2DMU A;  4NDL A;  2RVC A;  5H2F C;  2QBY A;  1MH4 A;  1TW3 A;  2J5O A;  1D1A A;  1P2F A;  2VBX A;  5FGM A;  2HGC A;  3S16 J;  1IXC A;  4G8X A;  3AFH A;  3V8K A;  2KHM A;  4AVZ A;  3DV8 A;  4BQA A;  1FEX A;  4F55 A;  5B5E C;  1FMW A;  4JYK A;  2Z33 A;  1X3W B;  2EIM H;  3HSE A;  2KRC A;  3O8G A;  4XRF A;  4AD9 A;  2VJ4 A;  1WJE A;  2DA3 A;  4L5J A;  2P6S A;  1UHW A;  1HCR A;  3H9G A;  3CD6 I;  2GA1 A;  2LMD A;  2M9H A;  3SHF A;  3FBI B;  3QU3 A;  2RKH A;  3QYB A;  3TOB A;  3ZQQ A;  1MBJ A;  5HOD A;  4DYQ A;  5HVQ C;  2X48 A;  1QNT A;  4D0P A;  3TL4 X;  4LG0 B;  1OIS A;  2DBB A;  4I09 A;  5EEH A;  3BG7 A;  4L9V A;  5D8L B;  1K6O A;  4UB8 C;  3PFY A;  1DPR A;  1D0Z A;  2ZSH B;  1FSE A;  4LB5 A;  4HF1 A;  2L54 A;  2R3S A;  2DT5 A;  4OIQ F;  4XR6 A;  1ETO A;  4GO1 A;  3SFZ A;  2IS6 A;  2DOF A;  3CP2 A;  4A3J J;  2CQK A;  1WPK A;  2R7O A;  1IGN A;  1PP8 F;  1UST A;  2RNG A;  3ZQH A;  3TDZ C;  3GME A;  3GTP J;  3W6V A;  4GDF A;  2DJI A;  2QQA A;  2HDC A;  4Y33 A;  1O4X A;  2QYO A;  1JGS A;  1LDD A;  3WU1 B;  4I6Z A;  3KFW X;  1EF4 A;  3P9I A;  1D5Y A;  2K3F A;  2TDX A;  3FXK A;  2FML A;  1W36 D;  3CC2 I;  3SEQ A;  3I53 A;  5F0F A;  3ZMV A;  4QIW N;  1U3E M;  4LK0 F;  1DP3 A;  1XGO A;  3RDI A;  3P7N A;  5ILV A;  2XGD A;  1A36 A;  4A0X A;  1EA3 A;  3HGY A;  2A05 A;  1D0Y A;  3IUO A;  5JR3 A;  4BH9 A;  3O2P E;  3MKW B;  1X2N A;  2CJJ A;  2XKO A;  4HSR A;  3GFI A;  2DFH A;  2YPR A;  5JLW A;  5D5U B;  2LF8 A;  3MCZ A;  2BY1 A;  3K4K A;  2EFO A;  2IW5 A;  2ZME C;  3WG7 H;  4I99 C;  2M87 A;  3HUG B;  2YX4 A;  2QQ8 A;  2BXZ A;  3KE2 A;  2KIS A;  1P4A A;  2A5W A;  3G2B A;  4MEX F;  2IA2 A;  3WHB A;  3G1O A;  3U1D A;  2EZH A;  1NG7 A;  2FOW A;  5GPA A;  3SYT A;  2BVL A;  2QSF X;  5M5Y J;  2YU9 J;  2KQR A;  1HSJ A;  2RNJ A;  3EQL F;  4NC7 A;  5F1J A;  2MH2 A;  3H5A A;  4P1W A;  4YFN F;  2WBM A;  2EIL H;  2NXN B;  3QOD A;  4JX5 A;  1EJ9 A;  1MMA A;  1BBY A;  2HXO A;  2DMQ A;  3BC8 A;  2E2I J;  3RZD J;  3ZPL A;  1S9H A;  4PZJ A;  4XM3 A;  4C2M J;  2DQR A;  3JRA A;  2CRG A;  3ZXS A;  1YX3 A;  2LKP A;  3WTV C;  4XBF A;  5J47 A;  5J3L A;  4LB6 B;  2E5Z A;  3OMY A;  4G9Y A;  3KP5 A;  3S2D J;  1X3U A;  3LNQ A;  5KAF C;  1AA7 A;  2E1O A;  5IP6 A;  3C18 A;  4KIF A;  4LLN A;  1X19 A;  3AG1 H;  2ZME A;  1WJA A;  2IXS A;  1YJW I;  4P9U A;  2FMY A;  4EM2 A;  1ETX A;  4AID A;  3N97 A;  2OZ6 A;  3HOY J;  3GZN B;  1XGS A;  2KJC A;  3B73 A;  3ONQ A;  4MTE A;  1I27 A;  1S5L C;  5HLG A;  2W85 A;  2HI3 A;  1J59 A;  2GLO A;  2JRT A;  4NUB A;  3EET A;  1P7I A;  1LDJ A;  1RR7 A;  1ZRF A;  4HZF A;  1AKH B;  1R6R A;  3SDB A;  1DGW Y;  1U2W A;  3VFZ A;  2XAF A;  1HA8 A;  3RPQ A;  3HHG A;  2X4H A;  3U1K A;  1D3Y A;  1WGX A;  3MZY A;  1UEL B;  2ZFW A;  2MD5 A;  4TV7 A;  1SVL A;  1IF1 A;  3ZN1 A;  1ZGJ A;  4PFP A;  4XKV A;  2L0K A;  2VI6 A;  3FIW A;  4BNC A;  1C0W A;  3VDX A;  5TJJ A;  2LBF A;  3H0G J;  5D4S A;  3OS2 A;  3S1R J;  1RIO H;  2LY1 A;  1YS7 A;  4I76 A;  4ZC3 A;  5J4Y A;  3KEQ A;  3MN2 A;  3M1C A;  4KT6 A;  4OMY A;  2K4B A;  1LQ1 A;  5FJ8 J;  2VAS A;  1VQ7 I;  2V9V A;  1Z67 A;  2Y0S N;  4I01 A;  4DYR A;  2R5Z B;  5E3L A;  4A3M J;  1JXS A;  1JT0 A;  1W5S A;  2CUZ A;  1CGP A;  1UG2 A;  1FYL A;  1RUO A;  4BUP A;  1BIA A;  2OQG A;  1VQL I;  4XOP A;  2LDU A;  4KMU X;  4J00 A;  3I58 A;  1YFH A;  5J6X A;  2UZK A;  1U78 A;  1IJW C;  3OYD A;  4BHB A;  4WK8 F;  2MW8 A;  2W25 A;  4KN4 X;  1X3Z B;  3OR2 C;  2VXD A;  4A3E J;  4M73 A;  4KUM A;  2R7Q A;  1T8I A;  3Q9V A;  4LIT A;  4CDG A;  1O3T A;  2MA3 A;  2VC0 A;  2V79 A;  1Y1W J;  3CUO A;  1J5Y A;  1NH3 A;  3A0B C;  3JRC A;  1WFX A;  3M8J A;  4HV5 A;  4WXC A;  1R4M B;  4R79 A;  1QVU A;  4B44 A;  3D1N I;  3RCO A;  1R1V A;  2DK8 A;  5HS8 A;  2Z9O A;  3HBL A;  1WJF A;  1D1B A;  4IO9 F;  1RRJ A;  5IT9 Z;  2E2H J;  2LG4 A;  1Y39 A;  4RDU A;  4IOC F;  3K9T A;  2V1U A;  2LVS A;  3HOS A;  2DPD A;  5HDG A;  4F52 A;  3HUG A;  1WWX A;  1YW9 A;  1AWC A;  4NQW A;  1LVA A;  2DT7 B;  4UUV A;  3GTQ J;  2BVM A;  2IGK A;  3S1N J;  4LIU A;  4HX4 A;  3U21 A;  3CCU I;  3TMO A;  1EKE A;  3WU0 A;  5FD5 A;  5J8F A;  3J81 Z;  1STZ A;  2D5V A;  1TQI A;  1MBF A;  1YRN B;  1X4P A;  4CO8 A;  2KT0 A;  2MYS A;  2HTJ A;  1XGM A;  2EB7 A;  1VQO I;  5LGT A;  3BTJ A;  3QAH A;  4HF2 A;  3T1B A;  1JKP C;  4UVC A;  2ZCW A;  3SJM A;  3A02 A;  2Y9Z A;  2P5K A;  1B72 A;  1K83 J;  3VYR B;  3GZ5 A;  2WWY A;  3H36 A;  1I50 J; 
#chains in the Genus database with same CATH homology
 5B1A H;  1V55 H;  2EIK H;  2EIL H;  3X2Q H;  3AG1 H;  2OCC H;  2ZXW H;  3AG3 H;  3WG7 H;  1OCR H;  3ABM H;  3AG4 H;  3ASN H;  1OCZ H;  2EIM H;  1OCC H;  2DYS H;  3ABL H;  5IY5 H;  2Y69 H;  1V54 H;  2DYR H;  5B1B H;  1OCO H;  3ASO H;  2EIJ H;  5B3S H;  3ABK H;  2EIN H;  3AG2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...