1R1UA

Crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
molecule keywords repressor protein
total genus 32
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1uA00
3CTAA 2GZWA 3R61A 1U5TB 3VEPA 2QQBA 3WTXC 1ON1A 1ZGJA 2C6YA 4RAZA 4LB5A 3PQKA 2A69F 3GVAA 2M30A 4B09A 2H94A 4KDPA 2W24A 2QQ9A 1Z1DA 2VC1A 4HBLA 3SHFA 1GVJA 1Q1HA 1BBYA 5ICGA 3J81K 5KK1A 1YYVA 2Q8KA 4ZZLA 5LBQA 3F8NA 1SMTA 3P9IA 4GYIA 1JHFA 1Z05A 3MWMA 1J7KA 3LWFA 1R1VA 1J0RA 3SZTA 2RDPA 1XCVA 1FP2A 3FMSA 4M71A 2L02A 5D6EA 2MD5A 1IN4A 4WXCA 4EJUA 2RV8A 1WRJA 5L3DA 4Y15A 4CGZA 1YW9A 2XGXA 2P7CB 3C1DA 1QNTA 3KZZA 3F22A 3FHZA 5DUKA 4ZH4F 2CYYA 1P4AA 1S3JA 5D4SA 3M8EA 1RNLA 5CYVA 5E17F 1SFUA 4LFUA 3GW2A 3QU6A 1I27A 1WKMA 1FLIA 1KYZA 1TNSA 2JZYA 5DYMA 3RJPA 5LGNA 3RPQA 4I98B 3MZYA 3D0SA 4LD5A 3W6JB 3KLNA 1EV7A 1TW2A 1X3UA 2VBXA 1IN8A 2OZ6A 3BP8A 3E6DA 3BJAA 2O6GE 1V3FA 1R1UA 2VBWA 3K1NA 4AIKA 3FMRA 2HDCA 3KP3A 4S05A 1DPRA 1ODDA 4XLNF 2EFNA 3V7RA 1IRGA 4N9HA 4U88A 1PDNC 1IN6A 1STZA 3C3WA 4RGXA 4A6EA 1E2XA 3WTYC 5DD8A 1ZAOA 1BI3A 5AIPA 5FLXK 1WI9A 4FT8A 4PGHA 5FD5A 2HYGD 1D8JA 5HDKA 2W25A 4EM1A 2IJLA 3PQJA 5LHGA 3GFJA 4XBFA 2L01A 1I6XA 3KEQA 5DEQA 2XKPA 5DV5A 3ABTA 3F8MA 4M74A 4EMSA 1GXQA 5DCMB 4RB2C 1D5VA 3E5QA 3SFZA 2G9WA 3GWZA 2HQRA 4JK1X 1P4WA 1MJBA 1G6NA 2HOEA 4A5NA 3BOQA 3RDIA 2GA1A 4CYDA 4UVBA 2FBHA 4ENMA 1G4DA 1EH6A 1LDDA 4HX4A 4HQEA 3I54A 1U5TC 3LQQA 5HS9A 3HOSA 1UHWA 3SZPA 5BPDA 2QYOA 4HOBA 1FX7A 3V8LA 5H20A 2HFHA 3CO6C 1BC8C 2HTJA 3E6MA 4XSZF 2ADUA 4PZJA 1JE8A 4G6QA 4NQWA 5F6FA 4KIBA 3HRSA 4CICA 2KKOA 1FWZA 3BPVA 1AWCA 4UHTA 3C18A 1FZPB 5TJJA 4M72A 2CSOA 4IF4A 2ZMEA 2JPCA 2X4HA 2ZJ2A 3QAHA 4ENNA 1RUOA 2LSOA 2H6CA 4U0WA 1DP7P 1SD7A 3K1MA 2EFOA 4R8HA 2GIVA 2BV6A 1KQ0A 2KJBA 3EQLF 3CUQC 2VBYA 4ZYHA 2VT2A 2IT0A 1ZGAA 5FFZA 4WCGA 4L0ZB 3BPXA 2Y0MA 1SD6A 3V7SA 2ACJA 1J5YA 3ECHA 5L3GA 4KMFA 3SXYA 3I64A 2HTSA 4FX4A 1DPUA 4A0XA 2V6CA 4IXAA 5HLIA 1O7LA 1ZN2A 2FRHA 3ZP5A 4Z2YA 3U1DA 3EYIA 4EJVA 1IN5A 5L3BA 1ONVA 3LAPA 1G3YA 1OPCA 2QBYA 3F8CA 1B9NA 3I53A 1YW8A 1MKMA 3TDUC 1I1GA 5F64A 3HRTA 3J80K 2STWA 3VB2A 3N4MA 1BI2A 4L9JA 4L5IA 1ZLJA 3N97A 3HUGA 1ZLKA 1W7PB 2F5DA 4H0EA 3T5XA 2ZMEB 4HDUA 4P96A 4DNCA 3E6CC 3HTSB 2FSWA 3F3XA 2F5EA 4U0VA 2FNAA 4I01A 2E7XA 2O0YA 2RVCA 1UCRA 2FBIA 2H27A 3HSRA 4LK1F 3T0YA 4KYWA 1YS6A 2DQRA 1Z91A 3ZMSA 4UVCA 4CXFA 1XMAA 3LA2A 3DPTA 1ZG5A 2VOOA 1XGSA 2V1XA 2K4BA 2EFQA 4O6JA 1R23A 2PJPA 4LJZF 2E1CA 2XRNA 3TQNA 5D6FA 1B6AA 2VC0A 2DLLA 3OV8A 5DCMA 2A5YB 3MEXA 1MDMB 3KZYA 3JSOA 4FX0A 2GWRA 4YFXF 5LHIA 5A2QK 5L3EA 1CGPA 4HQMA 3CUOA 1EH8A 3HTUA 3G3ZA 1LNWA 1MZBA 2OQRA 3ML6A 2QVOA 3ZMUA 2V1UA 2PBIA 4WF2A 5J6XA 1O57A 2H09A 1S7OA 3K9TA 4L9TA 3M7GA 1TTYA 3GLXA 4TV7A 1BIAA 2WWYA 3BROA 4HX8A 4A5MA 2JSCA 5CVRA 2ZXJA 1JHHA 3CUQB 1IRFA 2P5KA 1HSTA 2D1HA 3GZ5A 2K27A 2BGCA 3IKVA 2JPBA 2XVCA 5L3CA 3EUHA 3M9AA 2EFPA 3IWZA 4MGRA 1Z7UA 2KIMA 1RIOH 1HKSA 2MLKA 3F72A 1W5TA 5H6QA 1RUNA 4AWXB 4XLPF 2XAQA 1YS7A 1ZRFA 4BAYA 2D1VA 1G3TA 5FGMA 1ZH5A 2XUBA 2HR3A 1BIBA 1K78A 4RB3C 2RNJA 1P92A 2P7VB 1ZREA 1S6LA 1XDUA 2QWWA 1J75A 2VONA 1B9MA 3R60A 2DO7A 4YIIA 2MA3A 4WX9A 1KQ9A 1FBSA 1U8RA 2DTRA 1KYWA 1S29A 2P4WA 1K7AA 3J81Z 4CHUA 3JAMK 4O3MA 3F23A 4M9SA 4NHJA 1GXPA 1ZG1A 5HDGA 5BOXA 4LMYA 2ETHA 1XDSA 4LG0A 1CF7B 4GGGA 3JAMZ 3FF5A 3V8KA 4KN4X 3RKWA 2P6TA 5D5XB 2EA2A 2XAHA 4EJOA 4E70A 4BNCA 5ILUA 4XRFA 4KICA 2LKPA 2PI0A 3V8JA 2FMLA 2GA2A 4MEXF 3L09A 2NS0A 5FB2A 3RPUA 2Q2EA 1SMYF 1LVAA 4YIFA 3ZN1A 4P55A 1O3SA 3F6OA 2HYFA 5ICCA 1SAXA 3GF2A 2G7HA 2D45A 1LDJA 2HKXA 1R00A 2FEZA 2HWVA 3HRUA 4HYEA 4R1HA 5LRRA 5JR3A 1RI7A 3AAFA 2EWNA 2RKHA 4EGYA 1YFHA 2VN2A 3R4KA 3P9KA 3DFGA 1OYYA 3O6BB 2OQGA 4LK0F 4CZZA 2M5WA 5HS7A 3L00A 4KUMA 2BE5F 2IP2A 3TOAA 1J2XA 3IRRA 2JRTA 3B02A 5L3FA 1IW7F 2YR2A 1BM9A 5EEGA 3ZPLA 1U2WA 3MAJA 2E1NA 3JTGA 1D8KA 4IJAA 4G7HF 3ZQ7A 1R7JA 4MEYF 4OU0A 3ECOA 3CLOA 5CVIA 4A0ZA 4A0YA 3LA7A 3FXUA 4OIQF 5E1XA 5E18F 3EETA 3WE2A 4IRIA 5ILSA 1MGTA 2EB7A 4I2OA 3IL2A 1B4AA 3TGNA 3JW4A 1P6RA 5ED4A 2Z99A 3I5UA 1FYMA 2O61A 2LDUA 2ZNYA 1U78A 2QENA 3GFIA 2Y75A 2QM3A 2RC4A 1F4KA 4MQVA 2KIUA 1F1ZA 3G73A 2A07F 1LDKB 2G7UA 4EGZA 2M45A 1W7PA 1G3SA 1H0MA 3FZVA 1T98A 3O2PE 2FBKA 1YTYA 5ICFA 4LGWA 1KGSA 1BI0A 4UUVA 5HVQC 4HLYA 2NNNA 5CVUA 2OA4A 2DPDA 3IRQA 2YSRA 3HYIA 3FXRA 5LEJA 4IRHA 3KFWX 2IW5A 4AD9A 4CO8A 4G94A 4Y17A 4BH9A 4AIHA 4L9VA 4EQQA 1ZARA 1HW1A 3BY6A 2GQQA 1RZ4A 5LGUA 3ABUA 6PAXA 2FF4A 3SQNA 3WTWC 2DK5A 2OAZA 1KQ8A 4OIPF 3KP6A 2LF7A 1T2KA 5AIQA 1BJAA 3K2ZA 2NYXA 1O7FA 2FNPA 3WE3A 4IHTA 1HKTA 2WTEA 4KNYA 4ENJA 4RB0A 3HIFA 2YX7A 1HW5A 4RAYA 4ON0A 2AXLA 3IHUA 4M73A 5J8CA 3VOEA 3QP6A 2EV6A 5CVJA 1FC3A 1I5ZA 3FX3A 3F8FA 4RGUA 1USTA 1IAWA 2Z5UA 4B8XA 4OIRF 3WU0A 5BS6A 2DI3A 4G7OF 4HF0A 3NQOA 3OOPA 3J7AO 5F1RA 2DW4A 2XROA 4QLCU 4EM2A 1LEAA 3TO7A 3HRMA 4Q47A 4UNOA 2CQKA 2K86A 2ZBKA 5HLGA 1XB4A 3RYPA 5D5WB 2OD5A 3FM3A 5J8FA 4Q48A 1L3LA 4G9YA 2PG4A 4EV0A 1FSHA 4U7DA 4IPAA 5EEHA 1WQ2A 3KP5A 3R0AA 2OBPA 4AIJA 2ISZA 1HQCA 4LB6B 3R6SA 3JSPA 4L18B 4KIFA 2A3SA 2M8EA 4A6DA 3QOPA 5CJ9A 3GO5A 3WG9A 2ISYA 4HF1A 4S04A 3R0JA 4ETSA 4UV8A 2M87A 4A12A 1LQ1A 5JFRA 3BJOA 3VFZA 2PEXA 4FHTA 2FU4A 3WU1B 5AONA 2P8TA 1SFXA 2H6BA 3KETA 2XHKA 3M1EA 3ZMZA 3FWEA 4G6DA 2XASA 4OMYA 4GXOA 1QO0D 5BMZA 3IWFA 2K02A 4LG0B 1HKQA 2KIFA 4ZYEA 3M8FA 2QLZA 4WXHA 1FP1D 1YW7A 3JTHA 4M9ZA 2XIGA 3I58A 4MHGA 2LF8A 5CLSA 4LLNA 1F5TA 3HSEA 1K78B 4CDGA 5LRSA 5BPIA 3DV8A 2MBFA 4IVNA 3W6KB 2MH2A 2NRAC 2BYVE 1S7AA 1YIOA 2JTVA 2QZ8A 3L9FA 2CG4A 5BQTA 1HSJA 1B1BA 3H3UA 2QUFA 4M6YA 2STTA 1AOYA 1Z9CA 1SD5A 1R58A 2DFIA 5KVRA 4BYYA 4I02A 4ESFA 2KRFA 1IF1A 1YQAA 3O3KA 4I7HA 2J5PA 1Z6TA 2PFBA 3FXQA 4PGGA 4ENKA 2ZFWA 3WGHA 3HOTA 1FPQA 3GZ6A 1R5GA 1IXCA 2OZUA 2E7WA 1U6GA 1MDMA 2AS5F 5HDNA 4GO1A 2GAUA 5ERIA 4KA4A 2B0LA 1JXSA 3KP7A 5K5OA 2NNYA 2ZNZA 3E6BA 1O3RA 2P5VA 2GXGA 1FYKA 1LJ9A 4HF2A 2HS5A 2HGCA 2RGVA 3K1PA 1R1TA 4N9IA 3RKYA 2MH9A 5FD6A 1OMIA 5FO5A 2R7FA 2K4JA 1H9TA 1TW3A 1DDNA 3REOA 3L7WA 2FE3A 2FMYA 2XAFA 3GFLA 1OKRA 3CUQA 3S2WA 1I1SA 4HZFA 1TNTA 3U9GA 1ZRDA 3TO9A 4GCVA 2COMA 1PUEE 2Z33A 2ZO4A 1EH7A 1Y0UA 1FSEA 2FXAA 5HOOA 3P7NA 3TDZC 1NHAA 4WWCA 1HBXG 1FYLA 4QWQA 4A2UA 1XCBA 3HSFA 1YO5C 1WWXA 4HX7A 4U7BA 1KU9A 2VXZA 2ESHA 3T1BA 4OIOF 2HQNA 2IPQX 4KMUX 4ESBA 2DBBA 5E8IA 3I71A 1YG2A 2XV4S 3D5LA 4HA8A 3WODF 2HEOA 2IA0A 2PQ8A 1TQMA 1IZ1A 5IT3A 3KLOA 2Z9OA 4RS8A 1V4RA 1XSVA 2DAOA 2YX4A 4L5JA 4NB5A 5HS8A 3MZHA 1TBXA 3F8BA 1JGSA 3LAJA 2Q0OA 1OR7A 4P9FA 1TQIA 5ILVA 5E1WA 3RI4A 3P9CA 2OU2A 1MJ9A 3ERED 4Q4ZF 2DPUA 1UB9A 1FBQA 2PN6A 4PDKA 5JI6A 2YU3A 4LLLA 5DUIA 4LLGF 4HW0A 1KU7A 2EA4A 2L4AA 2ELHA 2FQ3A 2VODA 1Z6RA 3WTSC 1B59A 1U3EM 4OOIA 3GUDA 4HV6A 3KEOA 2V9VA 2EV5A 5TRDA 1KU3A 4RB1A 1KU2A 4OINF 1ZG3A 1GHCA 4WK8F 3K0LA 4G8XA 4O5VA 1G3WA 3NRVA 3Q9VA 2O8XA 1ZYRF 1J9IA 2LNBA 4KN7X 1UHMA 1HW2A 1D3YA 1XGOA 4UVAA 1FY7A 5IT9Z 1T6SA 4AVPA 4PCQA 1OYIA 1P4XA 4BHCA 3L2CA 1R36A 3U2RA 1T39A 4YG2F 3RTRA 1IXSB 3DF8A 4Y13A 2CGPA 5IT9K 4JQFA 4EVIA 2FOKA 3CDHA 3E5UA 2ZKZA 3E3VA 2MLGA 1XGNA 3B73A 3TKYA 3E97A 2XAJA 2XKOA 4KIGA 5E20A 4L0YB 1QPMA 4RGRA 2V79A 2F5CA 1P2FA 1E17A 2P5LC 5FLXZ 4YFNF 3FMQA 5ICEA 2L4MA 5E8GA 3DXJF 1KA8A 3BWGA 3CO7C 3ELKA 2IA1A 3IC7A 1MJAA 3Q9SA 1WSUA 4BHPA 3ZMDA 1T0FA 2VE9A 2Y48A 1XN7A 4BQAA 3TOBA 3ULQB 3HHHA 4I09A 3ZMTA 3ROUA 4WXDA 1C0WA 2HZTA 1LEBA 1W5SA 1QQIA 2XAGA 2RN7A 2IRFG 3C7JA 2QQAA 1QBJA 3ZMVA 2MC3A 3GEZA 3J80Z 1OYWA 4KT5C 3K69A 1W7PD 3QRFF 2ESNA 2KJCA 3ZN0A 3LQRA 1J59A 2TDXA 1XSDA 4R79A 5D5VB 3I59B 4IRGA 3KCCA 1L0OC 2QBYB 3QU3A 1T38A 1F9NA 1XD7A 3F6VA 2VE8A 5LGTA 1QZYA 1LB2A 3RKXA 3I0TA 3WTTC 5K5QA 2X0LA 4U0YA 3WGGA 4ESJA 2W57A 5HLHA 4K2EA 5FFXA 2D2WA 4HDVA 2A6EF 4XSXF 3VODA 5H6RA 1W4MA 3QPHA 1R22A 1UFMA 2A61A 3NEUA 5A2QZ 4M9XA 3BZ6A 3COAC 1XGMA 1ZRCA 2F5FA 3Q5FA 2BEOA 2RQPA 1S8NA 1K79A 2O03A 3QP5A 5DDGA 4OMZA 4YFKF 3T8RA 3WTUC 1XSXA 2R7DA 1A04A 3GFMA 3LSTA 3CJNA 5D8KB 2UWMA 3BJ6A 2M1BA 5LEKA 2DQLA 4KFCA 1H9GA 3TO6A 1PP8F 1BI1A 4M6XA 1K6OA 3WGIA 1ULYA 2ZCWA 3H92A 3I4PA 2IVMA 5LHHA 4BHBA 2WC2A 2DU9A 3EYYA 1XMKA 2FA5A 2O3FA 3GX4X 4HV5A 1MD0A 2VBZA 1CF7A 1IUYA 3LA3A 2R3SA 4RGSA 2L3DA 4P5OA 2Z3YA 3DP7A 4Q5SF 1FOKA 4MTDA 3DPLC 4EJTA 2A6HF 3KP2A 5JVTA 2F2EA 4D0PA 2EV0A 4HAMA 4G7ZF 2W85A 5K1YA 3E5XA 2P6SA 4N0BA 1BC7C 4I0AA 4EJWA 3IKTA 4EM0B 1FNNA 2EK5A 2PMHA 4I0BA 1QGPA 2CWEA 4UV9A 2PLYA 5D4RA 1HXDA 2DT5A 1ZHFA 1R5HA 3FM5A 1TQPA 3EDPA 2EFWA 1PP7U 5CVVA 4IHSA 1VTNC 4F7ZA 1U5TA 2BBYA 3GXOA 4JBAA 1TLHB 3H3ZA 2UZKA 4MTEA 5JHUA 2WV0A 2HKOA 2K7LA 3DEUA 2PMUA 1O3QA 1YLFA 3MFKA 2CW0F 1IN7A 1BN5A 5D8LB 5E1ZB 2CFXA 2EJRA 4GYGA 3GYHX 4L9NA 2IA2A 5LLQA 2W84A 4MNUA 3WTZA 2CO5A 5DD4A 4ZZDA 2L54A 3RIRA 4ASNA 2YPRA 4MQ9F 3PFIA 5D5UB 1IXRC 3V7CA 3QPTA 2DK8A 2VOPA 1QZZA 2V1DA 4BXUA 3BDDA 2VT3A 4ZYGA 3T8TA 1REPC 3MQ0A 5K5RA 2JT1A 3WTVC 1DUXC 3HHGA 3RYRA 2NAZA 3F21A 2UXNA 4HLXA 4DQ2A 3V4GA 1ON2A 2A68F 4P9UA 3KE2A 1SFEA 1BOAA 3I59A 1USSA 4UXNA 3ISPA 2UXXA 1FBUA 3MCZA 5DCFA 3LFKA 1SD4A 3DQVC 3KP4A 2J5OA 2GXBA 3DKWA 1FT9A 4ZYDA 1O3TA
chains in the Genus database with same CATH superfamily
3CTAA 4CA0A 2GZWA 3R61A 3K6GA 2BVLA 5E3MA 2KIQA 4V19K 1U5TB 3OR2C 3VEPA 3RZDJ 1OCTC 3ZCOA 3OYNA 2QQBA 3WTXC 1ON1A 1ZGJA 2C6YA 4FISA 2LFBA 4RAZA 4LB5A 3PQKA 2A69F 1F43A 3GVAA 3MMYB 2M30A 2A6TA 4B09A 4ZDOA 2H94A 4KDPA 1W0UA 2L7ZA 2BXZA 2W24A 2QQ9A 1Z1DA 5JLXA 4XKWA 3JRFA 1I6HJ 3KYDB 4BU2A 4CCJA 2R93J 1ENHA 9ANTA 2VC1A 4HBLA 3ZQQA 3SHFA 3H5NA 3QODA 3GLLA 2K3FA 1GVJA 4OAYA 3EUAA 1X1DA 2MW8A 4M3EA 5TGTA 4IOCF 4II3A 3OYHA 4DOZA 1Q1HA 1BBYA 3OYGA 5ICGA 1HC8A 3J81K 5KK1A 1YYVA 3GMEA 2Q8KA 1QRYA 4ZZLA 3F8NA 4QPQA 4EATA 5LBQA 1SMTA 1DU0A 4J00A 1R9TJ 3P9IA 5FRNA 4GYIA 1JHFA 1Z05A 2QQ8A 4ANJA 3RZOJ 3MWMA 1J7KA 3LWFA 1R1VA 5FKNA 2E5ZA 4F92B 2DDAA 4MFEA 1MNEA 1J0RA 3SZTA 2RDPA 1XCVA 1FP2A 2HQAA 3H1CA 3FMSA 4M71A 1RC9A 2L02A 1D1BA 4FQGA 5D6EA 2MD5A 1IN4A 3FIWA 4WXCA 4YELA 4X6AJ 3OYEA 3S93A 4EJUA 2RV8A 1WRJA 3TBIA 5L3DA 1DGRM 2M4KA 4Y15A 4CGZA 1R49A 4ZDLA 1YW9A 2XGXA 2P7CB 1ETVA 3C1DA 1QNTA 3KZZA 4XONA 1I3AA 4LG3A 3F22A 4XL9A 3FHZA 5EZHA 5DUKA 4ZH4F 2IGMA 2CYYA 1S9HA 3BR5A 1P4AA 1S3JA 3A0BC 3BT9A 5D4SA 3M8EA 1OQYA 3CP2A 1RNLA 1PUFA 5IOZA 3I9V2 2E2HJ 4IOAF 3B6CA 3HXLA 5CYVA 3AG4H 1SFUA 5E17F 2E60A 3UKGA 2DMQA 2FOWA 3TL4X 1BW6A 4LFUA 3GW2A 1LFBA 3QU6A 1A36A 1I27A 1Y1VJ 2UV1A 1WKMA 1FLIA 4L5EA 3CF2A 2RNGA 1ZGWA 1KYZA 1TNSA 2JZYA 5DYMA 3RJPA 5LGNA 4XOTA 4I98B 4XNFA 3RPQA 3TP3A 1X1PA 2ZSHB 3IUOA 3MZYA 4E7SA 3D0SA 4LD5A 3W6JB 3KLNA 1EV7A 1TW2A 1X3UA 2VBXA 4AUXA 1IN8A 2OZ6A 3BP8A 3E6DA 3SDBA 2NOGA 1BR2A 4Z6YA 2XSDC 3BJAA 2K85A 2O6GE 3I3LA 1V3FA 1R1UA 2K9NA 2VBWA 3K1NA 4AIKA 4FCYA 3LNQA 3FMRA 2HDCA 2LREA 3KP3A 4XLCA 3BCAA 4S05A 5EGOB 1DPRA 1ODDA 1X58A 2Y9ZA 4XLNF 1F36A 3HZJA 2EFNA 3V7RA 2HVSA 1IRGA 4N9HA 4U88A 1PDNC 1IN6A 1STZA 3C3WA 4RGXA 4A6EA 1E2XA 2X1CA 3WTYC 5DD8A 1A6IA 1ZAOA 3QYEA 4D5FA 1U8BA 1ETWA 4XRSA 2VQCA 1BI3A 4CZCA 2JMWA 3HKZA 5AIPA 3L2UA 5FLXK 1WI9A 4E7HA 4FT8A 4PGHA 5FD5A 2HYGD 2HDDA 1D8JA 3MKLA 2ELJA 5HDKA 2W25A 1TZLA 4EM1A 2IJLA 3PQJA 5LHGA 2LBFB 3GFJA 5FKOA 3K70D 3ZQLA 3CJQB 1UZCA 1BW5A 2DFHA 5CPRB 3S1MJ 1R6RA 2V1NA 4XBFA 2LD5A 2L01A 4BGDA 1I6XA 1JTYA 1SFOJ 3KEQA 4AVZA 5DEQA 2KDZA 1JUSA 2XKPA 1MMNA 5DV5A 3ABTA 2ELKA 3HOVJ 2GOMA 4NC7A 2DYSH 3VPRA 3F8MA 4M74A 4EMSA 1IRZA 5F0CA 1GXQA 5DCMB 4RB2C 3S3NA 5M3MJ 1D5VA 3E5QA 3SFZA 3FXOA 3HC7A 2DOFA 5JHFA 1JT0A 2G9WA 3GWZA 2LY2A 2HQRA 2HOSA 4JK1X 1P4WA 1MJBA 5BNGA 1G6NA 2HOEA 4A5NA 2CV0A 3BOQA 3ZR8X 3RDIA 2GA1A 4CYDA 4UVBA 5CQGA 2FBHA 4QSHA 4ENMA 2IS4A 1G4DA 1Y56A 4IX7A 1EH6A 2R7ZJ 1LDDA 4XLHA 4HX4A 1UMQA 4HQEA 4RMNA 3I54A 2LP0A 1U5TC 3LQQA 2JJ7A 5HS9A 1FTTA 1Z7LA 3I56I 1ZK8A 3HOSA 1UHWA 3SZPA 4XRMA 2DA1A 3JRGA 2PJRA 5BPDA 2QYOA 4HOBA 3CLQA 1X3ZB 1LPQA 2HXIA 2L5QA 3LSPA 1FX7A 2OTJI 5J3LA 3V8LA 5H20A 2PX9A 3JREA 5J47A 3M8JA 2HFHA 3CCLI 2DCEA 3CO6C 1BC8C 2HTJA 1TT5B 2LTPA 3BQZA 3E6MA 4XSZF 1JKPC 2ADUA 4PZJA 1JE8A 4G6QA 4NQWA 2IS2A 4A3IJ 5F6FA 1ETKA 2Y2ZA 4KIBA 2FUG2 4RAGA 3BZKA 2WBMA 3HRSA 1SAUA 4CICA 4A3BJ 3OYIA 1UJ8A 2KKOA 2HVQA 1FWZA 1A6QA 3BPVA 4D1QA 1AWCA 4UHTA 1V5GA 3C18A 2P81A 1QHGA 1FZPB 3J7YJ 5TJJA 1MBEA 1P7IA 1RR8C 4M72A 4UB8C 1MBGA 2CSOA 4IF4A 2ZMEA 3OYCA 2JPCA 2X4HA 2ZJ2A 3QAHA 4ENNA 4HNTA 1RUOA 1MIJA 5M5YJ 4RLQA 2LSOA 2H6CA 4U0WA 4X0GA 1DP7P 3D5SC 1SD7A 3K1MA 2EFOA 1YJ9I 3HM5A 4R8HA 2GIVA 4M3FA 2BV6A 4N4OB 4KITB 1KQ0A 2KJBA 5CKTA 1WJFA 3EQLF 1FIAA 1FMVA 3CUQC 3QYBA 3W2VA 2VBYA 4ZYHA 2VT2A 2IT0A 1ZGAA 2E34A 5FFZA 4WCGA 2DMTA 1TWHJ 4D5CA 4OWRB 4L0ZB 1ZR2A 3BPXA 4ZDPA 2Y0MA 3H5RA 1SD6A 3V7SA 1EJ9A 2ACJA 3HG9A 2VJJA 3FK7A 3DWLE 1J5YA 4PFPA 5KHDA 3ECHA 1N25A 5L3GA 4KMFA 4XICA 3SXYA 1O4XA 2EQRA 3ASNH 3I64A 2DJIA 2HTSA 4FX4A 1DPUA 4NNJA 2M0MA 4ITVA 4A0XA 2V6CA 4IXAA 5HLIA 2L7FP 2PMZN 1O7LA 1ZN2A 2R7RA 1K83J 2FRHA 3CMYA 2KL4A 3S3OA 3ZP5A 4Z2YA 3U1DA 4IHXA 3EYIA 2KLOA 2JQ7A 4EJVA 1IN5A 5L3BA 3W6VA 3DKYA 1ONVA 2XSJC 3LAPA 2Y30A 1G3YA 4ZTJA 4I99C 1OPCA 2QBYA 1FJLA 3A2KA 3F8CA 1B9NA 3I53A 5F0HA 3OSGA 1YW8A 1MKMA 3TDUC 4BEHA 1I1GA 2VJIA 5F64A 3HRTA 3J80K 5B66C 2STWA 3VB2A 5J1YA 3N4MA 2DTZA 2R0QC 4DYRA 1BI2A 4L9JA 4L5IA 2LC2A 2LKSA 3ZQGA 1ZLJA 1JT6A 3N97A 3K70C 1VQ8I 2OTLI 2ID3A 2JA8J 2E71A 4H4KC 2VKDA 3HUGA 1ZLKA 3HGYA 2VLAA 1W7PB 2F5DA 4YIRX 4H0EA 3OIPA 3T5XA 4E7IA 5IYDJ 2ZMEB 2NVQJ 4MIMA 2QCOA 3DBLB 3BG3A 1BR4A 4HDUA 1TL8A 4P96A 1X1AA 3AFHA 5J4VA 2HU9A 3KPHA 4DNCA 1NTCA 4A3CJ 2JUCA 3E6CC 3DTKA 4AM3A 1ETOA 4DGWB 2G0EA 3HTSB 1Z67A 2FSWA 3F3XA 2F5EA 4RA2A 2VL8A 4U0VA 2HYJA 3DEEA 5F08A 2FNAA 4XLFA 4HG2A 1D5YA 3SEQA 3NAUA 4NBQA 4I01A 1GLNA 2E7XA 4RM2A 3PIPF 3L2QA 4B43A 2O0YA 2RVCA 3GBGA 3WU2C 1UCRA 1OCRH 2FBIA 3GTPJ 1J09A 3H3VK 2H27A 1PJRA 2MYSA 3HSRA 3PO2J 4LK1F 3T0YA 2EPFA 3LFUA 4FE4A 1AU7A 2DDBA 2PMZA 3DCFA 4FASD 4CCKA 2LRDA 2VIXA 4KYWA 1YS6A 2DQRA 1Z91A 3RQIA 3ZMSA 4CH7A 4UVCA 1X4OA 4S0HB 4CXFA 4E4HA 1X1BA 1XMAA 3LA2A 4IZZA 1OR7C 2O7OA 1VQ4I 2X1EA 2Z16A 1WJBA 2R7UA 2TCTA 1XPXA 1HLVA 3DPTA 1ZG5A 2IGKA 1XGSA 2V1XA 3OYBA 2VOOA 2OV7A 2LBFA 3LSMA 2WAFA 2K4BA 2EFQA 4O6JA 1R23A 1V5EA 1G8XA 4LJZF 2PJPA 5JVGF 3RKQA 2E1CA 2XRNA 3TQNA 4XN0A 5D6FA 3K10A 2O8KA 3IAS2 1B6AA 2WY8Q 3W2AA 3H36A 2YUSA 4QPOA 1JUPA 2VC0A 1K61A 1X3WB 1AA7A 3CESA 2DLLA 3K4BA 4JOMA 3OV8A 3FISA 4BDYA 5DCMA 2A5YB 3MEXA 2NVUB 3KZYA 3JSOA 1MDMB 4FX0A 2GWRA 2XPVA 4YFXF 3L2VA 5LHIA 5A2QK 1T56A 5L3EA 1CGPA 4HRIA 3FHNA 2VI6A 4HQMA 1E0EA 3G6EI 3CUOA 1EH8A 2K9SA 3HTUA 5EDNA 3CC4I 3G3ZA 1LNWA 1MZBA 2OQRA 3ML6A 4NC8A 2X6OA 2QVOA 4BQOA 3ZMUA 2QA4I 3KZIC 4RLFA 5M5WJ 4M3BA 4RM3A 4D7NA 2V1UA 2PBIA 4WF2A 2ZJQF 2I8DA 5J6XA 1O57A 2H09A 2OF7A 1S7OA 3DBRB 2EIJH 2OUMA 2QKMB 3K9TA 1RETA 4L9TA 4M6VA 2O5RA 5GP9A 3M7GA 1TTYA 1RESA 3ASOH 2EZLA 2F4OB 3GLXA 2PJRB 4TV7A 1BIAA 2WWYA 3BROA 4HX8A 4A5MA 3HPHA 3ZQFA 2JSCA 1KZHA 5CVRA 3O8HA 2ZXJA 2R7OA 2R7XA 1JHHA 1JJ6C 4D9JA 3CUQB 1IRFA 2P5KA 3E0JB 1HSTA 1IC8A 2D1HA 1VQ6I 1Q1VA 3GZ5A 4UUTA 4AC0A 4CYCB 1OFCX 2K27A 1FIPA 3OYJA 5E3NA 2BGCA 3IKVA 2JPBA 2XVCA 3FXMA 4JX4A 2F6CA 3SYTA 2KMUA 5L3CA 2CS3A 2HNHA 3PFYA 3EUHA 3M9AA 2EFPA 3IWZA 4MGRA 1Z7UA 3BR2A 1WHUA 2KIMA 1RIOH 1HKSA 4LITA 2MLKA 3F72A 3OL4A 3GTGJ 1W5TA 5H6QA 2ZC2A 1RUNA 4AWXB 1JKQC 3G1LA 1NK2P 4XLAA 1ETYA 2XAQA 1YS7A 4XLPF 3VYTB 1ZRFA 4BAYA 3CP8A 1NK3P 2D1VA 1G3TA 5FGMA 1ZH5A 1TP4A 4B44A 2XUBA 2HR3A 1BIBA 4IHYA 3AG2H 2M34A 1K78A 4RB3C 2MSYA 4E7ZA 2RNJA 1P92A 2P7VB 5K7HA 4F52A 2R7VA 3HOWJ 3PIOF 1ZREA 1IUFA 1MMGA 3K7AJ 1S6LA 2R5YA 1XDUA 2QWWA 4B47A 1J75A 2VONA 1B9MA 1QZEA 3R60A 3Q3SA 4XM3A 3CC7I 1MW7A 2IAIA 2DO7A 3BR1A 4YIIA 3VWBA 3CDLA 1YITI 3CMAI 3I4MJ 1YX3A 2M0CA 2MA3A 4WX9A 1KQ9A 1FBSA 1U8RA 4M3DA 4XOPA 2DTRA 1U0JA 1KYWA 4UUSB 3KYLA 1S29A 2P4WA 1K7AA 3HBLA 2JA6J 1Z21A 4BJTA 3J81Z 4CHUA 1XX5A 2QF7A 4IHWA 1WJAA 3JAMK 3FKIJ 4A69C 4BEHB 4O3MA 3EPZA 3F23A 1BJZA 4M9SA 4NHJA 1GXPA 1ZG1A 5HDGA 5BOXA 4LMYA 2VKVA 2ETHA 3DLAA 1XDSA 4LG0A 1CF7B 4GGGA 1BR1A 3JAMZ 3HEFA 3FF5A 3V8KA 3K4LA 2M2EA 4KN4X 3RKWA 2P6TA 1OCZH 3FKJA 5D5XB 3QPLA 4B3XA 2EA2A 4DIQA 2XAHA 4EJOA 4E70A 1FTZA 2XAUA 5C44J 2H8WA 2Z2SB 5ILUA 4BNCA 4XRFA 4KICA 1Y8QB 2LKPA 1YJNI 4C2UA 3A1YA 1B8IB 2PI0A 3V8JA 2FMLA 2GA2A 4MEXF 3L09A 4XKVA 2NS0A 5FB2A 3RPUA 2Q2EA 1AKHA 1SMYF 2BY3A 3CJTB 1LVAA 1T95A 1WJCA 4YIFA 2CQXA 3ZN1A 4P55A 2EBIA 1O3SA 3F6OA 2HYFA 3SDGA 5ICCA 3OIQA 1SAXA 3CCSI 3GF2A 2G7HA 3QWLA 2D45A 1LDJA 1U9NA 2VASA 2HKXA 1R00A 4JYKA 2FEZA 1EA3A 1R4MB 2HWVA 2W1OA 3QPSA 3HRUA 3BG7A 1TWFJ 4HYEA 4XQFA 4R1HA 5LRRA 3A01B 5JR3A 1RI7A 3AAFA 3HB9A 2EWNA 2RKHA 2X1DA 4EGYA 1YFHA 2VN2A 1JKRC 3R4KA 3P9KA 2IXSA 3DFGA 3ZQHA 1BL0A 1OYYA 4DYQA 3O6BB 2R7SA 2HOAA 1JUMA 5E79C 2E36A 4B3AA 2QSGX 5EG0B 4ZTFA 5J40A 5B3SH 3FDYA 2OQGA 2DFEA 4LK0F 4CZZA 2M5WA 1SVMA 5HS7A 1ZKGA 3L00A 1OLTA 4KUMA 2BE5F 1TWCJ 2CJJA 1JI8A 2DA4A 3TW6A 2BXYA 3DU6A 2M8GX 2IP2A 3H5AA 3TOAA 2DA2A 1J2XA 4F55A 3IRRA 3S17J 2JRMA 2JRTA 3B02A 5L3FA 1IW7F 2YR2A 2VKHA 2Z1DA 2LMDA 1PUFB 2FX0A 4B1RA 1BM9A 5EEGA 3ZPLA 1U2WA 2EIMH 4GFBA 3MAJA 2E1NA 2E35A 3JTGA 4D7MA 1D8KA 2UUZA 2M4GA 4HSTA 4IJAA 1NG7A 4RBOA 5FJ8J 1K4SA 4G7HF 1XC5A 2ZFUA 3BQYA 3ZQ7A 4XR6A 1R7JA 4MEYF 4OU0A 1VQPI 3GCMA 3ECOA 1MBJA 3KYCB 2NVTJ 2WB1N 3CLOA 5CVIA 3X2QH 4A0ZA 4A0YA 5KAFC 4E7KA 4IQJA 4GRIA 3LA7A 3FXUA 4I76A 1QVUA 5GPAA 3CDIA 4OIQF 3DTEA 1GUUA 1MNDA 4G6TB 1D0YA 5E1XA 3J7ZI 5E18F 1GV2A 3EETA 1B8IA 3WE2A 1ZELA 5ILSA 4IRIA 1MGTA 3FK6A 2OPTA 1AKHB 1CQTA 1Z3XA 2L7MP 3CZ6A 4OAZA 2EB7A 4I2OA 3CQZJ 2IEKA 4ZYAA 1B4AA 3IL2A 3TGNA 2CV2A 3JW4A 1P6RA 2CFOA 3O8GA 3GTQJ 1ZR4A 5ED4A 3HOXJ 2R7WA 2Z99A 1POGA 1TWAJ 3I5UA 1FYMA 2O61A 2LDUA 2ZNYA 3OIOA 3UR3C 1U78A 2QGUA 2QENA 5GAGJ 3GFIA 2Y75A 2QM3A 4FTHA 2RC4A 3DLLF 4BY1J 2MFZA 1F4KA 2JN6A 4PJ0C 3A01A 4MQVA 2KIUA 2X6WA 1F1ZA 3G73A 3U21A 2B63J 3E1SA 2E5NA 5F1JA 1LDKB 2A07F 3ZQCA 5FLVA 2G7UA 4EGZA 2M45A 1BA5A 1W7PA 1G3SA 2CQQA 1H0MA 4Y52J 3FZVA 4XKBA 3CJRB 3HOYJ 2DN0A 3BTCA 2OJED 5LD2C 1T98A 1ERDA 3O2PE 2WB1A 2FBKA 1YTYA 5ICFA 5FKMA 4LGWA 3PO3J 1KGSA 1BI0A 4UUVA 5HVQC 4HLYA 2NNNA 5CVUA 2OA4A 2DPDA 3IRQA 2YSRA 3HYIA 5EYRA 4KT6A 3FXRA 2NS8A 5LEJA 4IRHA 3KFWX 2IW5A 4AD9A 4CO8A 4PK4A 4G94A 2ZSIB 4Y17A 4BH9A 4AIHA 1MMAA 1VF9A 4L9VA 4EQQA 1ZARA 1X2MA 1R4NB 1HW1A 3ZQIA 2R5ZA 3BY6A 2GQQA 1RZ4A 5LGUA 2EINH 1SVLA 3ABUA 6PAXA 2WAQA 2FF4A 2XPUA 3MKWB 2Q1ZB 3SQNA 3WTWC 2NS7A 3ZRGA 2DA3A 2WY7Q 2YS9A 4BUPA 2DK5A 1S5LC 2OAZA 5M3FJ 1IRXA 1WJEA 1KQ8A 5E3OA 2E1MC 2RAEA 4OIPF 1MH4A 3KP6A 2FJ1A 2LF7A 3TEDA 1T2KA 2V9PA 4HEA2 5AIQA 2YU9J 3HUGB 4BQQA 2IS6A 1BJAA 3K2ZA 2JA2A 1YOVB 2NYXA 1O7FA 2FNPA 1E3OC 5C4XJ 2EILH 2XB0X 1Y1WJ 3WE3A 4IHTA 4NQWB 5DTDA 1HKTA 2WTEA 1TT0A 4KNYA 3BLYA 4ENJA 3J7AY 4BS9A 4RB0A 4BJ6C 2RREA 3HIFA 1QHHD 1WFXA 2YX7A 5GADJ 2VKEA 1HW5A 1W36D 4RAYA 4E7LA 4ON0A 2AXLA 3OYLA 4BJ5C 3ABKH 3JCUC 3IHUA 4M73A 5J8CA 3VOEA 3QP6A 3PSFA 4NUBA 1MBHA 4HSRA 2EV6A 4PJLA 5CVJA 1FC3A 1I5ZA 3JRAA 2A05A 2X9DA 3FX3A 2L9VA 3F8FA 4RGUA 3K4JA 3N05A 1USTA 4Y7NJ 1IAWA 1VQ9I 4U87A 4B4CA 1U9OA 2Z5UA 3A03A 2BHZA 2WAEA 3RSNA 4B8XA 4OIRF 3WU0A 5BS6A 2DI3A 3RQ4A 4C3JJ 4G7OF 1X4PA 2KHMA 4HF0A 3NQOA 3OOPA 1JJ8C 1VFCA 3GZNB 4DZPA 2VQLA 1S72I 3J7AO 4DBQA 3CCJI 5F1RA 2XC7A 3Q0VA 2DW4A 2XROA 4QLCU 1DP3A 4CCOA 4EM2A 3S1RJ 1HDPA 3OYKA 1LEAA 3TO7A 3HRMA 2KISA 4Q47A 2CQKA 4UNOA 2K86A 2ZBKA 4BL0B 1XB4A 2JWTA 3RYPA 5HLGA 4PJJA 5D5WB 2OD5A 3FM3A 5J8FA 4IO9F 3OYFA 5FRMA 3SEZA 4Q48A 2L0KA 3VSLA 5DS9A 1VQOI 1L3LA 3PM1A 2Y0SA 4G9YA 2PG4A 4EV0A 4GDFA 2ME0A 3JRDA 4BXXJ 1MBKA 1FSHA 2EH3A 4U7DA 4IPAA 5EEHA 1MSFC 2HVRA 1WI3A 1ORKA 1WQ2A 2AQFA 2K40A 1V5FA 3KP5A 3R0AA 2OBPA 3FXJA 4AIJA 1A31A 2ISZA 1HQCA 1PVEA 2XRLA 4PJMA 4LB6B 3VYUB 3R6SA 3C2GA 3JSPA 3LOCA 2ZJRF 2CU7A 4L18B 3M4OJ 4KIFA 4YRVA 2A3SA 2M8EA 4BE1A 2LH9A 4A6DA 5FLMJ 3NARA 1IGNA 3NWTA 2DA7A 5TISC 2M3AA 3QOPA 5CJ9A 3GO5A 4HNVA 2R5YB 3WG9A 2ISYA 2W4SA 4HF1A 2W82A 3BTJA 5GAEJ 4S04A 2XGEA 4BACA 3LSHA 2OC6A 3R0JA 3G2BA 4ETSA 4UV8A 1H88C 2M87A 4A12A 1LQ1A 5F0FA 5JFRA 3BJOA 1IV8A 3WHBA 3VFZA 2PEXA 4FHTA 3MKZA 2FU4A 3WU1B 5AONA 2P8TA 1SFXA 2H6BA 2EZKA 2XHKA 3LSIA 5KCMA 3KETA 3M1EA 3ZMZA 1NH3A 1QU3A 3FWEA 5CQEA 4G6DA 4J01A 2XASA 5DM6F 1RKWA 4OMYA 3IP4B 1EF4A 4GXOA 1QO0D 3HJEA 5BMZA 3IWFA 5M5XJ 2K02A 4XLEA 3JRHA 1HKQA 3LSJA 1WCMJ 3JRCA 4LG0B 2KIFA 2K9LA 2E2JJ 2CRGA 2E19A 4ZYEA 3CC2I 1D1AA 3M8FA 2QLZA 3DU5A 3IH2A 3QYFA 4F91B 4KISA 4WXHA 1LE8A 2BHYA 1TC3C 1FP1D 1KONA 2E1MB 1XTAA 5IOYA 1YW7A 3W3CA 1X1CA 2I10A 3JTHA 3PNYA 4M9ZA 1SANA 2XIGA 4A3GJ 5GTHC 2COBA 3I58A 4MHGA 4MLOA 2JK3A 3CCMI 1FOYA 2LF8A 3AL0C 3OYDA 4A3FJ 5CLSA 1UHSA 3H0GJ 4C30A 4LLNA 1F5TA 3HSEA 5LFAA 2Q2EB 1K78B 3U1KA 4CDGA 5KAIC 2M7AA 1N75A 5LRSA 5BPIA 3DV8A 2MBFA 3CCYA 4IVNA 3W6KB 2MH2A 2NRAC 4QTRA 2BYVE 1S7AA 1YIOA 2JTVA 2QZ8A 3FBNB 2CG4A 3L9FA 1HOMA 5BQTA 5JLWA 2MGQA 5IP7J 3S14J 3KIOA 2BZTA 1D0ZA 1B1BA 1HSJA 3Q0UA 3H3UA 4CCLA 2VJ4A 4IKFA 2QUFA 1B72A 4RAFA 4M6YA 2STTA 5GTIC 1AOYA 1K6YA 3BTIA 1Z9CA 3I4NJ 4BXFA 1SD5A 1S7EA 1R58A 2DFIA 5KVRA 2K9MA 4BYYA 4I02A 4ESFA 2KRFA 1IF1A 1YQAA 1OJLA 2DYRH 3O3KA 4I7HA 2J5PA 3G1MA 4XKCA 1Z6TA 2PFBA 1IO2A 1SVOA 3FXQA 4PGGA 4ENKA 1BOBA 2ZFWA 1WJDA 3MD2A 3WGHA 3HOTA 2BOLA 1FPQA 3GZ6A 1R5GA 2HXOA 1IXCA 2OZUA 2E7WA 4J19A 1Z3YA 1U6GA 1MDMA 3H0DA 2LKXA 2MG4A 2AS5F 5HDNA 1MNMC 4JX6A 4BY7J 2D5VA 4GO1A 1ETXA 2GAUA 3A02A 3MN2A 5ERIA 4KA4A 2B0LA 1FOXA 1JXSA 3PNTA 2ECBA 3KP7A 4AYBA 3S2HJ 1LE8B 1LKXA 5IP6A 1Z77A 5K5OA 2NNYA 2ZNZA 3E6BA 2WV1A 4ZC3A 3H35A 3UNGC 4NDLA 1O3RA 3HDDA 2P5VA 4A3JJ 2GXGA 1FYKA 3D5RC 1LJ9A 4CSWA 4HF2A 1I50J 1IDZA 2HS5A 2HGCA 2RGVA 3K1PA 1R1TA 4N9IA 3RKYA 3AL0B 3B6AA 2MH9A 5FD6A 1OMIA 2K5CA 2GOXB 3M07A 5FO5A 3OYAA 1WZ2A 2K3PA 5FKKA 1ACIA 2R7FA 2K4JA 1H9TA 1TW3A 1DDNA 2VJ5A 1V55H 3REOA 3G1OA 3PUFA 1XG1A 3L7WA 2FE3A 2FMYA 2XAFA 1ITYA 4QIWN 3GFLA 2NXNB 2X6YA 5HNHA 5EG0A 1OKRA 2DOAA 4N4NB 3CUQA 4JP0A 3S2WA 2QSFX 1I1SA 1G59A 4HZFA 1TNTA 2LR8A 4C2TA 3U9GA 1W5CC 4CYCA 1ZRDA 3TO9A 4XK4A 2WA0A 1B72B 1MSEC 1P9QC 3FXKA 4PUSA 4GCVA 1E3PA 2IGNA 1YX5A 2COMA 3LL7A 3M1CA 2X51A 2JSPA 4X1EA 2Z33A 2ZO4A 1PUEE 1EH7A 1Y0UA 1FSEA 2FXAA 3HGGA 1DQUA 5HOOA 1JGGA 3P7NA 1GDTA 2L2OA 2CUEA 3TP0A 3TDZC 4E7JA 1NG6A 4IHVA 3S2DJ 1NHAA 4WWCA 4BBSJ 5F27A 2GM4A 1W1WE 2KT0A 2RQQA 1HBXG 1T8IA 1FYLA 2DT7B 3K4CA 4QWQA 4A2UA 1YI2I 3CCVI 1XCBA 3HSFA 3D1NI 1YO5C 2H1KA 3MZ8A 1WWXA 4HX7A 3ZGKA 4DW6A 4U7BA 1AHDP 5C3EJ 1KU9A 1PYVA 2VXZA 2ESHA 1Y6IA 2XF6A 3T1BA 4C9YA 4OIOF 2HQNA 5DM7F 3OSFA 2IPQX 4KMUX 4AYBN 4ESBA 3IH4A 2DBBA 1YRNA 5GPCA 5E8IA 3I71A 1YG2A 1T33A 2XV4S 2CH0A 3D5LA 4HA8A 3WODF 1YE9A 4P1WA 1WGXA 2DJNA 2HEOA 4A3DJ 2IA0A 2PQ8A 3SFIA 3ZOBA 1TQMA 3GTJJ 3K4KA 1IZ1A 2B9SA 2BVMA 5IT3A 5K7FA 3KLOA 2Z9OA 2XF5A 4RS8A 2ICWG 1V4RA 1XSVA 2DAOA 2YX4A 3H9JA 4L5JA 4NB5A 4F3QA 5HS8A 3MZHA 4AU7A 2AXTC 1R71A 1TBXA 3F8BA 1QVTA 1JGSA 1OCPA 3LAJA 2Q0OA 2CQ7A 2HDWA 2DXIA 1UG0A 3A4CA 3WHCA 1OR7A 1RKTA 4P9FA 3GTOJ 1TQIA 2ME6A 5E1WA 5ILVA 3RI4A 1IV6A 2LY1A 1SFKA 1P7JA 3DKXA 3H9GA 2ZB9A 2OU2A 1MJ9A 3P9CA 3CMEI 1WH5A 3ABLH 4AIDA 4Q4ZF 3ERED 2DPUA 1UB9A 1FBQA 1MBFA 2PN6A 4PDKA 4C3HJ 2KFDA 1FMWA 5JI6A 1OCCH 2YU3A 4LLLA 5DUIA 1DU6A 4LLGF 4HW0A 4BQNA 4CUGA 3OS1A 2VQGA 3OS0A 1KU7A 3SJMA 2EA4A 2VXDA 2L4AA 2ELHA 3GTKJ 2FQ3A 3BC8A 3LSGA 2VODA 1Z6RA 3WTSC 3VSKA 1B59A 1U3EM 3K2AA 4PJNA 2CV1A 4OOIA 3GUDA 3OS2A 4HV6A 3KEOA 2ZJPF 1D0XA 2V9VA 3BTLA 2EV5A 5TRDA 1KU3A 3S16J 4RB1A 1KU2A 4OINF 1ZG3A 2O9LA 3S1NJ 1GHCA 4WK8F 3K0LA 4BDZA 4G8XA 4RDUA 4O5VA 2R4GA 1G3WA 3NRVA 3Q9VA 2VB6A 2A5WA 2O8XA 1ZYRF 2DMUA 2F5VA 1J9IA 1R5ID 5B5EC 2LNBA 4I6ZA 4KN7X 3BR0A 3M3YJ 1UHMA 1HW2A 1D3YA 2MC4A 2CUFA 1XGOA 4C2MJ 4UVAA 2N8GA 1FY7A 3G4SI 2HQ5A 1T6SA 4AVPA 4PCQA 5IT9Z 1OYIA 1P4XA 4BHCA 3L2CA 1R36A 3U2RA 4FETA 1T39A 3W2WA 4YG2F 3RTRA 3OOUA 1IXSB 3DF8A 4Y13A 3JRIA 1HDDC 2NVXJ 4LIUA 4JX5A 2CGPA 1XS9A 2KRCA 5IT9K 3BCBA 4JQFA 4EVIA 2FOKA 1RPWA 3CDHA 3E5UA 2WAQN 1DGWY 2ZKZA 2XB5A 3BR6A 3E3VA 2HI3A 4PSXA 1YHQI 2MLGA 1XGNA 3B73A 3TKYA 3E97A 2XAJA 2QEXI 2L9SA 2XKOA 3JR9A 3LSKA 4A3MJ 2QSHX 4KIGA 5E20A 2P0WA 1VQNI 4L0YB 2KRHA 1QPMA 2LG4A 3JRBA 4RGRA 2V79A 2F5CA 1P2FA 1E17A 2P5LC 1WPKA 3AKZA 5FLXZ 4YFNF 2R7TA 4MO7A 3FMQA 1YJWI 5ICEA 2L4MA 5E8GA 2HPIA 1MH3A 3BG9A 3DXJF 1KA8A 2V9KA 3BWGA 1UELB 4CCNA 3CO7C 3ELKA 3MKYB 2IA1A 3IC7A 1MJAA 3Q9SA 1I3QJ 5KNLA 1WSUA 1YIJI 2DMPA 4BHPA 1VQMI 3OWTA 2CUJA 3ZMDA 5F04A 3P5JA 1T0FA 2VE9A 4II2A 3VDXA 2Y48A 4XRSG 4ABZA 1XN7A 5IP9J 2VPRA 3TOBA 4BQAA 2LOOA 3QOEA 2F4MB 2F48A 2L9NA 2CUZA 4XN3A 1K4TA 3TMOA 3PL8A 3FBIB 3MVPA 3ULQB 2HPMA 1W36C 3HHHA 1ZTRA 3CMMA 2KZVA 5EZGA 4I09A 3ZMTA 1T08B 1VNDA 1N77A 3ROUA 1EKEA 1G2HA 3BG6A 4WXDA 1C0WA 4F93B 2HZTA 2FQ4A 1LEBA 1W5SA 2I5UA 1QQIA 5EGOA 2XAGA 2X6XA 2JUGA 2RN7A 4PSWA 3VYSB 1FEXA 2IRFG 2CMPA 1OCOH 3C7JA 2QQAA 1UG2A 1Y8RB 1QBJA 2Y69H 2MC3A 3GEZA 3ABMH 3ZMVA 5K7ZA 3J80Z 3OY9A 1A5JA 3OYMA 2R5ZB 1OYWA 4KT5C 2LLKA 2ZXWH 1N78A 1IG7A 3CCEI 2M9HA 3K69A 1W7PD 3QRFF 2ESNA 3DEWA 2KJCA 2VUMJ 3ZN0A 3LQRA 1HF0A 3HOZJ 2XDVA 2CW7A 2FD5A 2JVHA 2TDXA 1XSDA 1J59A 1YRNB 3L2WA 4R79A 2H8RA 5EEAA 1E3HA 1SC7A 5D5VB 3KX2A 3EUHC 3I59B 1LFPA 4IRGA 3DPUA 1APLC 3KCCA 2Y9YA 2KP6A 1L0OC 2QBYB 3QU3A 3GTMJ 4A93J 2E1OA 1H8AC 1T38A 1RR7A 1F9NA 3HPGA 3BG5A 1XD7A 2WADA 4XORA 2JA7J 2E2IJ 3F6VA 3H9QA 2VE8A 5LGTA 4NC6A 1IJWC 4HPQA 1QZYA 3CCQI 2H1LA 3S1QJ 2B7EA 1LB2A 4Y33A 3Q0WA 5EF6A 3RKXA 3PUBA 3LSRA 5J4YA 3L2RA 4KJZA 3K4NA 3I0TA 2F4IA 3WTTC 2KZGA 5B1BH 4M3GA 5IYBJ 2X0LA 5K5QA 3F9KA 4BKXA 5J1RA 4U0YA 3WGGA 4ESJA 2W57A 5HLHA 3RCOA 3DBHB 4K2EA 5FFXA 4UY8I 4FE7A 1T0FC 2DFFA 4Y4RA 2D2WA 4HDVA 2A6EF 3BZCA 2LY9A 4XMYA 4XSXF 3VODA 2GIZA 5H6RA 4BE2A 1WH7A 1W4MA 3QPHA 4IL6C 2EIKH 1R22A 1UFMA 2A61A 3ERMA 3NEUA 5A2QZ 4M9XA 4V2GA 2R92J 3BZ6A 2AQEA 3COAC 3AG3H 2W00A 4ZJZA 1XGMA 1VQLI 2BY2A 1ZRCA 2F5FA 3Q5FA 1D1CA 2V26A 2BEOA 2RQPA 1S8NA 3EUKL 1K79A 2L9RA 2OCEA 3G71I 2O03A 2QKLB 1GVDA 4A3KJ 2V7FA 3QP5A 1VQKI 5DDGA 2LVSA 2W48A 2X85A 3VYRB 3S8PA 2DOEA 2AHQA 4OMZA 4YFKF 3T8RA 3WTUC 1OISA 2AO9A 1XSXA 2DMNA 3I55I 2R7DA 1ZQ3P 1A04A 3GFMA 3LSTA 1TWGJ 3CJNA 1HCRA 3CCRI 2GLOA 5D8KB 2UWMA 5HODA 3BJ6A 2M1BA 2Y31A 5LEKA 1X19A 2DQLA 4KFCA 2DA5A 1H9GA 3TO6A 5J1UA 1PP8F 4A3LJ 2ZXHA 1BI1A 3IAM2 4M6XA 4BE0A 1K6OA 3WGIA 5FKLA 1ULYA 1Y0NA 2JA5J 2V4JC 4HNUA 3HKZN 2ZCWA 4W1UA 3H92A 1MMDA 3I4PA 1LVKA 2IVMA 4LIVA 1LUJB 2DODA 5LHHA 4A3EJ 4BHBA 2WC2A 2DU9A 1I39A 3OR1C 2VQHA 3EYYA 1XMKA 2FA5A 3OMYA 2O3FA 3GX4X 2NOJB 1VQ5I 4HV5A 2ZXIA 2VBZA 1MD0A 2LK2A 2MD0A 1CF7A 1IUYA 1RRJA 3PSIA 1VQ7I 3LA3A 2R3SA 1JKOC 3CCUI 4RGSA 2L3DA 4P5OA 5EJCA 2Z3YA 2GBYA 3DP7A 4Q5SF 1FOKA 2ZMEC 4MTDA 1WVRA 3DPLC 1UAAA 4EJTA 2A6HF 3KP2A 4YEJA 4DJAA 3PJRA 4CCMA 5JVTA 2F2EA 3F0CA 2EV0A 4HAMA 4D0PA 3L1PA 4G7ZF 2V6EA 5HNFA 4IEJA 1VI0A 2W85A 2BW3B 4UB6C 5K1YA 3E5XA 2P6SA 4N0BA 1BC7C 4I0AA 4EJWA 2ECCA 2KPMA 1WJ5A 3IKTA 1FOWA 1H89C 4EM0B 1FNNA 2EK5A 1GT0C 2PMHA 4I0BA 4XIDA 1LFUP 1QGPA 1ETQA 2XPWA 5IY5H 2CWEA 4UV9A 5B1AH 2R7QA 4IQ4A 2NVYJ 2PLYA 5IPAA 4DYCA 5D4RA 1HXDA 2DT5A 2LYCA 3C2HA 3V42A 1ZHFA 2ID6A 2KDOA 1R5HA 1QA6A 3FM5A 1TQPA 3EDPA 3QQAA 4PFOA 2EFWA 1PP7U 5C4JJ 5CVVA 2Y0SN 1VTNC 4IHSA 3IV5A 4F7ZA 3K4MA 1U5TA 4Y3OA 2BBYA 3GXOA 4JBAA 4B48A 1SEUA 1TLHB 3H3ZA 2IS1A 2XGCA 2UZKA 4G12A 4W97A 4MTEA 5JHUA 2MABA 1GV5A 3S15J 2WV0A 2HKOA 5FROA 4C3IJ 1M1EB 2K7LA 3DEUA 2PMUA 1O3QA 1YLFA 1XMXA 3MFKA 2CW0F 3GTLJ 3BR3A 1IN7A 1BN5A 5D8LB 4V2FA 3FXLA 5E1ZB 2CFXA 2EJRA 3DTIA 4GYGA 3GYHX 2TRTA 2KQRA 4L9NA 4DZJA 2OCCH 2IA2A 3HOUJ 3PNVA 5GAHJ 5LLQA 2W84A 4MNUA 5IYCJ 1A35A 3WTZA 2CO5A 5DD4A 3SZGA 1HA8A 2L7KA 4E6KG 4ZZDA 2HZDA 2L54A 2HOTA 1IDYA 3RIRA 4ASNA 2YPRA 3IH3A 1Z0XA 2XF7A 3PFIA 4MQ9F 3TW7A 1IXRC 3V7CA 5D5UB 2W7NA 3QPTA 4BBRJ 3C2BA 2DK8A 2VOPA 1QZZA 2DT6A 1V54H 3CF5F 2V1DA 3S3MA 4BXUA 1JTXA 3BDDA 2VT3A 4ZYGA 3T8TA 1REPC 5H2FC 3MQ0A 2K9QA 2BY0A 2JT1A 5K5RA 2GXAA 1MMSA 3ZXSA 3CD6I 3NWSA 3ONQA 3WTVC 3HL2A 2BW3A 1VZ0A 1DUXC 3HHGA 3RYRA 2NAZA 3F21A 2UXNA 1X2NA 2BY1A 4HLXA 3S32A 2JVGA 3KEYA 4DQ2A 3E7LA 3V4GA 4MFDA 2EZIA 1ON2A 1Y39A 2A68F 4P9UA 3KE2A 4DBRA 1SFEA 1BOAA 3I59A 1USSA 2IBDA 2XGDA 3RPUD 4UXNA 4UUSA 3ISPA 2EZHA 3A0HC 5E3LA 4LOCA 2UXXA 1FBUA 2IGOA 3MCZA 2VPLA 3WG7H 2DA6A 5HLTA 1QPIA 2CW8A 3AG1H 5DCFA 3LFKA 4EEFG 1SD4A 2M7BA 3DQVC 3ESWB 3KP4A 2J5OA 1W0TA 2CQNA 3DKWA 2GXBA 3LMMA 1FT9A 2X48A 4ZYDA 1O3TA 3OL3A
chains in the Genus database with same CATH topology
3CTAA 2GZWA 3R61A 1U5TB 3VEPA 2QQBA 3WTXC 1ON1A 1ZGJA 2C6YA 4RAZA 4LB5A 3PQKA 2A69F 3GVAA 2M30A 4B09A 2H94A 4KDPA 2W24A 2QQ9A 1Z1DA 2VC1A 4HBLA 3SHFA 1GVJA 1Q1HA 1BBYA 5ICGA 3J81K 5KK1A 1YYVA 2Q8KA 4ZZLA 5LBQA 3F8NA 1SMTA 3P9IA 4GYIA 1JHFA 1Z05A 3MWMA 1J7KA 3LWFA 1R1VA 1J0RA 3SZTA 2RDPA 1XCVA 1FP2A 3FMSA 4M71A 2L02A 5D6EA 2MD5A 1IN4A 4WXCA 4EJUA 2RV8A 1WRJA 5L3DA 4Y15A 4CGZA 1YW9A 2XGXA 2P7CB 3C1DA 1QNTA 3KZZA 3F22A 3FHZA 5DUKA 4ZH4F 2CYYA 1P4AA 1S3JA 5D4SA 3M8EA 1RNLA 5CYVA 5E17F 1SFUA 4LFUA 3GW2A 3QU6A 1I27A 1WKMA 1FLIA 1KYZA 1TNSA 2JZYA 5DYMA 3RJPA 5LGNA 3RPQA 4I98B 3MZYA 3D0SA 4LD5A 3W6JB 3KLNA 1EV7A 1TW2A 1X3UA 2VBXA 1IN8A 2OZ6A 3BP8A 3E6DA 3BJAA 2O6GE 1V3FA 1R1UA 2VBWA 3K1NA 4AIKA 3FMRA 2HDCA 3KP3A 4S05A 1DPRA 1ODDA 4XLNF 2EFNA 3V7RA 1IRGA 4N9HA 4U88A 1PDNC 1IN6A 1STZA 3C3WA 4RGXA 4A6EA 1E2XA 3WTYC 5DD8A 1ZAOA 1BI3A 5AIPA 5FLXK 1WI9A 4FT8A 4PGHA 5FD5A 2HYGD 1D8JA 5HDKA 2W25A 4EM1A 2IJLA 3PQJA 5LHGA 3GFJA 4XBFA 2L01A 1I6XA 3KEQA 5DEQA 2XKPA 5DV5A 3ABTA 3F8MA 4M74A 4EMSA 1GXQA 5DCMB 4RB2C 1D5VA 3E5QA 3SFZA 2G9WA 3GWZA 2HQRA 4JK1X 1P4WA 1MJBA 1G6NA 2HOEA 4A5NA 3BOQA 3RDIA 2GA1A 4CYDA 4UVBA 2FBHA 4ENMA 1G4DA 1EH6A 1LDDA 4HX4A 4HQEA 3I54A 1U5TC 3LQQA 5HS9A 3HOSA 1UHWA 3SZPA 5BPDA 2QYOA 4HOBA 1FX7A 3V8LA 5H20A 2HFHA 3CO6C 1BC8C 2HTJA 3E6MA 4XSZF 2ADUA 4PZJA 1JE8A 4G6QA 4NQWA 5F6FA 4KIBA 3HRSA 4CICA 2KKOA 1FWZA 3BPVA 1AWCA 4UHTA 3C18A 1FZPB 5TJJA 4M72A 2CSOA 4IF4A 2ZMEA 2JPCA 2X4HA 2ZJ2A 3QAHA 4ENNA 1RUOA 2LSOA 2H6CA 4U0WA 1DP7P 1SD7A 3K1MA 2EFOA 4R8HA 2GIVA 2BV6A 1KQ0A 2KJBA 3EQLF 3CUQC 2VBYA 4ZYHA 2VT2A 2IT0A 1ZGAA 5FFZA 4WCGA 4L0ZB 3BPXA 2Y0MA 1SD6A 3V7SA 2ACJA 1J5YA 3ECHA 5L3GA 4KMFA 3SXYA 3I64A 2HTSA 4FX4A 1DPUA 4A0XA 2V6CA 4IXAA 5HLIA 1O7LA 1ZN2A 2FRHA 3ZP5A 4Z2YA 3U1DA 3EYIA 4EJVA 1IN5A 5L3BA 1ONVA 3LAPA 1G3YA 1OPCA 2QBYA 3F8CA 1B9NA 3I53A 1YW8A 1MKMA 3TDUC 1I1GA 5F64A 3HRTA 3J80K 2STWA 3VB2A 3N4MA 1BI2A 4L9JA 4L5IA 1ZLJA 3N97A 3HUGA 1ZLKA 1W7PB 2F5DA 4H0EA 3T5XA 2ZMEB 4HDUA 4P96A 4DNCA 3E6CC 3HTSB 2FSWA 3F3XA 2F5EA 4U0VA 2FNAA 4I01A 2E7XA 2O0YA 2RVCA 1UCRA 2FBIA 2H27A 3HSRA 4LK1F 3T0YA 4KYWA 1YS6A 2DQRA 1Z91A 3ZMSA 4UVCA 4CXFA 1XMAA 3LA2A 3DPTA 1ZG5A 2VOOA 1XGSA 2V1XA 2K4BA 2EFQA 4O6JA 1R23A 2PJPA 4LJZF 2E1CA 2XRNA 3TQNA 5D6FA 1B6AA 2VC0A 2DLLA 3OV8A 5DCMA 2A5YB 3MEXA 1MDMB 3KZYA 3JSOA 4FX0A 2GWRA 4YFXF 5LHIA 5A2QK 5L3EA 1CGPA 4HQMA 3CUOA 1EH8A 3HTUA 3G3ZA 1LNWA 1MZBA 2OQRA 3ML6A 2QVOA 3ZMUA 2V1UA 2PBIA 4WF2A 5J6XA 1O57A 2H09A 1S7OA 3K9TA 4L9TA 3M7GA 1TTYA 3GLXA 4TV7A 1BIAA 2WWYA 3BROA 4HX8A 4A5MA 2JSCA 5CVRA 2ZXJA 1JHHA 3CUQB 1IRFA 2P5KA 1HSTA 2D1HA 3GZ5A 2K27A 2BGCA 3IKVA 2JPBA 2XVCA 5L3CA 3EUHA 3M9AA 2EFPA 3IWZA 4MGRA 1Z7UA 2KIMA 1RIOH 1HKSA 2MLKA 3F72A 1W5TA 5H6QA 1RUNA 4AWXB 4XLPF 2XAQA 1YS7A 1ZRFA 4BAYA 2D1VA 1G3TA 5FGMA 1ZH5A 2XUBA 2HR3A 1BIBA 1K78A 4RB3C 2RNJA 1P92A 2P7VB 1ZREA 1S6LA 1XDUA 2QWWA 1J75A 2VONA 1B9MA 3R60A 2DO7A 4YIIA 2MA3A 4WX9A 1KQ9A 1FBSA 1U8RA 2DTRA 1KYWA 1S29A 2P4WA 1K7AA 3J81Z 4CHUA 3JAMK 4O3MA 3F23A 4M9SA 4NHJA 1GXPA 1ZG1A 5HDGA 5BOXA 4LMYA 2ETHA 1XDSA 4LG0A 1CF7B 4GGGA 3JAMZ 3FF5A 3V8KA 4KN4X 3RKWA 2P6TA 5D5XB 2EA2A 2XAHA 4EJOA 4E70A 4BNCA 5ILUA 4XRFA 4KICA 2LKPA 2PI0A 3V8JA 2FMLA 2GA2A 4MEXF 3L09A 2NS0A 5FB2A 3RPUA 2Q2EA 1SMYF 1LVAA 4YIFA 3ZN1A 4P55A 1O3SA 3F6OA 2HYFA 5ICCA 1SAXA 3GF2A 2G7HA 2D45A 1LDJA 2HKXA 1R00A 2FEZA 2HWVA 3HRUA 4HYEA 4R1HA 5LRRA 5JR3A 1RI7A 3AAFA 2EWNA 2RKHA 4EGYA 1YFHA 2VN2A 3R4KA 3P9KA 3DFGA 1OYYA 3O6BB 2OQGA 4LK0F 4CZZA 2M5WA 5HS7A 3L00A 4KUMA 2BE5F 2IP2A 3TOAA 1J2XA 3IRRA 2JRTA 3B02A 5L3FA 1IW7F 2YR2A 1BM9A 5EEGA 3ZPLA 1U2WA 3MAJA 2E1NA 3JTGA 1D8KA 4IJAA 4G7HF 3ZQ7A 1R7JA 4MEYF 4OU0A 3ECOA 3CLOA 5CVIA 4A0ZA 4A0YA 3LA7A 3FXUA 4OIQF 5E1XA 5E18F 3EETA 3WE2A 4IRIA 5ILSA 1MGTA 2EB7A 4I2OA 3IL2A 1B4AA 3TGNA 3JW4A 1P6RA 5ED4A 2Z99A 3I5UA 1FYMA 2O61A 2LDUA 2ZNYA 1U78A 2QENA 3GFIA 2Y75A 2QM3A 2RC4A 1F4KA 4MQVA 2KIUA 1F1ZA 3G73A 2A07F 1LDKB 2G7UA 4EGZA 2M45A 1W7PA 1G3SA 1H0MA 3FZVA 1T98A 3O2PE 2FBKA 1YTYA 5ICFA 4LGWA 1KGSA 1BI0A 4UUVA 5HVQC 4HLYA 2NNNA 5CVUA 2OA4A 2DPDA 3IRQA 2YSRA 3HYIA 3FXRA 5LEJA 4IRHA 3KFWX 2IW5A 4AD9A 4CO8A 4G94A 4Y17A 4BH9A 4AIHA 4L9VA 4EQQA 1ZARA 1HW1A 3BY6A 2GQQA 1RZ4A 5LGUA 3ABUA 6PAXA 2FF4A 3SQNA 3WTWC 2DK5A 2OAZA 1KQ8A 4OIPF 3KP6A 2LF7A 1T2KA 5AIQA 1BJAA 3K2ZA 2NYXA 1O7FA 2FNPA 3WE3A 4IHTA 1HKTA 2WTEA 4KNYA 4ENJA 4RB0A 3HIFA 2YX7A 1HW5A 4RAYA 4ON0A 2AXLA 3IHUA 4M73A 5J8CA 3VOEA 3QP6A 2EV6A 5CVJA 1FC3A 1I5ZA 3FX3A 3F8FA 4RGUA 1USTA 1IAWA 2Z5UA 4B8XA 4OIRF 3WU0A 5BS6A 2DI3A 4G7OF 4HF0A 3NQOA 3OOPA 3J7AO 5F1RA 2DW4A 2XROA 4QLCU 4EM2A 1LEAA 3TO7A 3HRMA 4Q47A 4UNOA 2CQKA 2K86A 2ZBKA 5HLGA 1XB4A 3RYPA 5D5WB 2OD5A 3FM3A 5J8FA 4Q48A 1L3LA 4G9YA 2PG4A 4EV0A 1FSHA 4U7DA 4IPAA 5EEHA 1WQ2A 3KP5A 3R0AA 2OBPA 4AIJA 2ISZA 1HQCA 4LB6B 3R6SA 3JSPA 4L18B 4KIFA 2A3SA 2M8EA 4A6DA 3QOPA 5CJ9A 3GO5A 3WG9A 2ISYA 4HF1A 4S04A 3R0JA 4ETSA 4UV8A 2M87A 4A12A 1LQ1A 5JFRA 3BJOA 3VFZA 2PEXA 4FHTA 2FU4A 3WU1B 5AONA 2P8TA 1SFXA 2H6BA 3KETA 2XHKA 3M1EA 3ZMZA 3FWEA 4G6DA 2XASA 4OMYA 4GXOA 1QO0D 5BMZA 3IWFA 2K02A 4LG0B 1HKQA 2KIFA 4ZYEA 3M8FA 2QLZA 4WXHA 1FP1D 1YW7A 3JTHA 4M9ZA 2XIGA 3I58A 4MHGA 2LF8A 5CLSA 4LLNA 1F5TA 3HSEA 1K78B 4CDGA 5LRSA 5BPIA 3DV8A 2MBFA 4IVNA 3W6KB 2MH2A 2NRAC 2BYVE 1S7AA 1YIOA 2JTVA 2QZ8A 3L9FA 2CG4A 5BQTA 1HSJA 1B1BA 3H3UA 2QUFA 4M6YA 2STTA 1AOYA 1Z9CA 1SD5A 1R58A 2DFIA 5KVRA 4BYYA 4I02A 4ESFA 2KRFA 1IF1A 1YQAA 3O3KA 4I7HA 2J5PA 1Z6TA 2PFBA 3FXQA 4PGGA 4ENKA 2ZFWA 3WGHA 3HOTA 1FPQA 3GZ6A 1R5GA 1IXCA 2OZUA 2E7WA 1U6GA 1MDMA 2AS5F 5HDNA 4GO1A 2GAUA 5ERIA 4KA4A 2B0LA 1JXSA 3KP7A 5K5OA 2NNYA 2ZNZA 3E6BA 1O3RA 2P5VA 2GXGA 1FYKA 1LJ9A 4HF2A 2HS5A 2HGCA 2RGVA 3K1PA 1R1TA 4N9IA 3RKYA 2MH9A 5FD6A 1OMIA 5FO5A 2R7FA 2K4JA 1H9TA 1TW3A 1DDNA 3REOA 3L7WA 2FE3A 2FMYA 2XAFA 3GFLA 1OKRA 3CUQA 3S2WA 1I1SA 4HZFA 1TNTA 3U9GA 1ZRDA 3TO9A 4GCVA 2COMA 1PUEE 2Z33A 2ZO4A 1EH7A 1Y0UA 1FSEA 2FXAA 5HOOA 3P7NA 3TDZC 1NHAA 4WWCA 1HBXG 1FYLA 4QWQA 4A2UA 1XCBA 3HSFA 1YO5C 1WWXA 4HX7A 4U7BA 1KU9A 2VXZA 2ESHA 3T1BA 4OIOF 2HQNA 2IPQX 4KMUX 4ESBA 2DBBA 5E8IA 3I71A 1YG2A 2XV4S 3D5LA 4HA8A 3WODF 2HEOA 2IA0A 2PQ8A 1TQMA 1IZ1A 5IT3A 3KLOA 2Z9OA 4RS8A 1V4RA 1XSVA 2DAOA 2YX4A 4L5JA 4NB5A 5HS8A 3MZHA 1TBXA 3F8BA 1JGSA 3LAJA 2Q0OA 1OR7A 4P9FA 1TQIA 5ILVA 5E1WA 3RI4A 3P9CA 2OU2A 1MJ9A 3ERED 4Q4ZF 2DPUA 1UB9A 1FBQA 2PN6A 4PDKA 5JI6A 2YU3A 4LLLA 5DUIA 4LLGF 4HW0A 1KU7A 2EA4A 2L4AA 2ELHA 2FQ3A 2VODA 1Z6RA 3WTSC 1B59A 1U3EM 4OOIA 3GUDA 4HV6A 3KEOA 2V9VA 2EV5A 5TRDA 1KU3A 4RB1A 1KU2A 4OINF 1ZG3A 1GHCA 4WK8F 3K0LA 4G8XA 4O5VA 1G3WA 3NRVA 3Q9VA 2O8XA 1ZYRF 1J9IA 2LNBA 4KN7X 1UHMA 1HW2A 1D3YA 1XGOA 4UVAA 1FY7A 5IT9Z 1T6SA 4AVPA 4PCQA 1OYIA 1P4XA 4BHCA 3L2CA 1R36A 3U2RA 1T39A 4YG2F 3RTRA 1IXSB 3DF8A 4Y13A 2CGPA 5IT9K 4JQFA 4EVIA 2FOKA 3CDHA 3E5UA 2ZKZA 3E3VA 2MLGA 1XGNA 3B73A 3TKYA 3E97A 2XAJA 2XKOA 4KIGA 5E20A 4L0YB 1QPMA 4RGRA 2V79A 2F5CA 1P2FA 1E17A 2P5LC 5FLXZ 4YFNF 3FMQA 5ICEA 2L4MA 5E8GA 3DXJF 1KA8A 3BWGA 3CO7C 3ELKA 2IA1A 3IC7A 1MJAA 3Q9SA 1WSUA 4BHPA 3ZMDA 1T0FA 2VE9A 2Y48A 1XN7A 4BQAA 3TOBA 3ULQB 3HHHA 4I09A 3ZMTA 3ROUA 4WXDA 1C0WA 2HZTA 1LEBA 1W5SA 1QQIA 2XAGA 2RN7A 2IRFG 3C7JA 2QQAA 1QBJA 3ZMVA 2MC3A 3GEZA 3J80Z 1OYWA 4KT5C 3K69A 1W7PD 3QRFF 2ESNA 2KJCA 3ZN0A 3LQRA 1J59A 2TDXA 1XSDA 4R79A 5D5VB 3I59B 4IRGA 3KCCA 1L0OC 2QBYB 3QU3A 1T38A 1F9NA 1XD7A 3F6VA 2VE8A 5LGTA 1QZYA 1LB2A 3RKXA 3I0TA 3WTTC 5K5QA 2X0LA 4U0YA 3WGGA 4ESJA 2W57A 5HLHA 4K2EA 5FFXA 2D2WA 4HDVA 2A6EF 4XSXF 3VODA 5H6RA 1W4MA 3QPHA 1R22A 1UFMA 2A61A 3NEUA 5A2QZ 4M9XA 3BZ6A 3COAC 1XGMA 1ZRCA 2F5FA 3Q5FA 2BEOA 2RQPA 1S8NA 1K79A 2O03A 3QP5A 5DDGA 4OMZA 4YFKF 3T8RA 3WTUC 1XSXA 2R7DA 1A04A 3GFMA 3LSTA 3CJNA 5D8KB 2UWMA 3BJ6A 2M1BA 5LEKA 2DQLA 4KFCA 1H9GA 3TO6A 1PP8F 1BI1A 4M6XA 1K6OA 3WGIA 1ULYA 2ZCWA 3H92A 3I4PA 2IVMA 5LHHA 4BHBA 2WC2A 2DU9A 3EYYA 1XMKA 2FA5A 2O3FA 3GX4X 4HV5A 1MD0A 2VBZA 1CF7A 1IUYA 3LA3A 2R3SA 4RGSA 2L3DA 4P5OA 2Z3YA 3DP7A 4Q5SF 1FOKA 4MTDA 3DPLC 4EJTA 2A6HF 3KP2A 5JVTA 2F2EA 4D0PA 2EV0A 4HAMA 4G7ZF 2W85A 5K1YA 3E5XA 2P6SA 4N0BA 1BC7C 4I0AA 4EJWA 3IKTA 4EM0B 1FNNA 2EK5A 2PMHA 4I0BA 1QGPA 2CWEA 4UV9A 2PLYA 5D4RA 1HXDA 2DT5A 1ZHFA 1R5HA 3FM5A 1TQPA 3EDPA 2EFWA 1PP7U 5CVVA 4IHSA 1VTNC 4F7ZA 1U5TA 2BBYA 3GXOA 4JBAA 1TLHB 3H3ZA 2UZKA 4MTEA 5JHUA 2WV0A 2HKOA 2K7LA 3DEUA 2PMUA 1O3QA 1YLFA 3MFKA 2CW0F 1IN7A 1BN5A 5D8LB 5E1ZB 2CFXA 2EJRA 4GYGA 3GYHX 4L9NA 2IA2A 5LLQA 2W84A 4MNUA 3WTZA 2CO5A 5DD4A 4ZZDA 2L54A 3RIRA 4ASNA 2YPRA 4MQ9F 3PFIA 5D5UB 1IXRC 3V7CA 3QPTA 2DK8A 2VOPA 1QZZA 2V1DA 4BXUA 3BDDA 2VT3A 4ZYGA 3T8TA 1REPC 3MQ0A 5K5RA 2JT1A 3WTVC 1DUXC 3HHGA 3RYRA 2NAZA 3F21A 2UXNA 4HLXA 4DQ2A 3V4GA 1ON2A 2A68F 4P9UA 3KE2A 1SFEA 1BOAA 3I59A 1USSA 4UXNA 3ISPA 2UXXA 1FBUA 3MCZA 5DCFA 3LFKA 1SD4A 3DQVC 3KP4A 2J5OA 2GXBA 3DKWA 1FT9A 4ZYDA 1O3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTA A;  2GZW A;  3R61 A;  1U5T B;  3VEP A;  2QQB A;  3WTX C;  1ON1 A;  1ZGJ A;  2C6Y A;  4RAZ A;  4LB5 A;  3PQK A;  2A69 F;  3GVA A;  2M30 A;  4B09 A;  2H94 A;  4KDP A;  2W24 A;  2QQ9 A;  1Z1D A;  2VC1 A;  4HBL A;  3SHF A;  1GVJ A;  1Q1H A;  1BBY A;  5ICG A;  3J81 K;  5KK1 A;  1YYV A;  2Q8K A;  4ZZL A;  5LBQ A;  3F8N A;  1SMT A;  3P9I A;  4GYI A;  1JHF A;  1Z05 A;  3MWM A;  1J7K A;  3LWF A;  1R1V A;  1J0R A;  3SZT A;  2RDP A;  1XCV A;  1FP2 A;  3FMS A;  4M71 A;  2L02 A;  5D6E A;  2MD5 A;  1IN4 A;  4WXC A;  4EJU A;  2RV8 A;  1WRJ A;  5L3D A;  4Y15 A;  4CGZ A;  1YW9 A;  2XGX A;  2P7C B;  3C1D A;  1QNT A;  3KZZ A;  3F22 A;  3FHZ A;  5DUK A;  4ZH4 F;  2CYY A;  1P4A A;  1S3J A;  5D4S A;  3M8E A;  1RNL A;  5CYV A;  5E17 F;  1SFU A;  4LFU A;  3GW2 A;  3QU6 A;  1I27 A;  1WKM A;  1FLI A;  1KYZ A;  1TNS A;  2JZY A;  5DYM A;  3RJP A;  5LGN A;  3RPQ A;  4I98 B;  3MZY A;  3D0S A;  4LD5 A;  3W6J B;  3KLN A;  1EV7 A;  1TW2 A;  1X3U A;  2VBX A;  1IN8 A;  2OZ6 A;  3BP8 A;  3E6D A;  3BJA A;  2O6G E;  1V3F A;  1R1U A;  2VBW A;  3K1N A;  4AIK A;  3FMR A;  2HDC A;  3KP3 A;  4S05 A;  1DPR A;  1ODD A;  4XLN F;  2EFN A;  3V7R A;  1IRG A;  4N9H A;  4U88 A;  1PDN C;  1IN6 A;  1STZ A;  3C3W A;  4RGX A;  4A6E A;  1E2X A;  3WTY C;  5DD8 A;  1ZAO A;  1BI3 A;  5AIP A;  5FLX K;  1WI9 A;  4FT8 A;  4PGH A;  5FD5 A;  2HYG D;  1D8J A;  5HDK A;  2W25 A;  4EM1 A;  2IJL A;  3PQJ A;  5LHG A;  3GFJ A;  4XBF A;  2L01 A;  1I6X A;  3KEQ A;  5DEQ A;  2XKP A;  5DV5 A;  3ABT A;  3F8M A;  4M74 A;  4EMS A;  1GXQ A;  5DCM B;  4RB2 C;  1D5V A;  3E5Q A;  3SFZ A;  2G9W A;  3GWZ A;  2HQR A;  4JK1 X;  1P4W A;  1MJB A;  1G6N A;  2HOE A;  4A5N A;  3BOQ A;  3RDI A;  2GA1 A;  4CYD A;  4UVB A;  2FBH A;  4ENM A;  1G4D A;  1EH6 A;  1LDD A;  4HX4 A;  4HQE A;  3I54 A;  1U5T C;  3LQQ A;  5HS9 A;  3HOS A;  1UHW A;  3SZP A;  5BPD A;  2QYO A;  4HOB A;  1FX7 A;  3V8L A;  5H20 A;  2HFH A;  3CO6 C;  1BC8 C;  2HTJ A;  3E6M A;  4XSZ F;  2ADU A;  4PZJ A;  1JE8 A;  4G6Q A;  4NQW A;  5F6F A;  4KIB A;  3HRS A;  4CIC A;  2KKO A;  1FWZ A;  3BPV A;  1AWC A;  4UHT A;  3C18 A;  1FZP B;  5TJJ A;  4M72 A;  2CSO A;  4IF4 A;  2ZME A;  2JPC A;  2X4H A;  2ZJ2 A;  3QAH A;  4ENN A;  1RUO A;  2LSO A;  2H6C A;  4U0W A;  1DP7 P;  1SD7 A;  3K1M A;  2EFO A;  4R8H A;  2GIV A;  2BV6 A;  1KQ0 A;  2KJB A;  3EQL F;  3CUQ C;  2VBY A;  4ZYH A;  2VT2 A;  2IT0 A;  1ZGA A;  5FFZ A;  4WCG A;  4L0Z B;  3BPX A;  2Y0M A;  1SD6 A;  3V7S A;  2ACJ A;  1J5Y A;  3ECH A;  5L3G A;  4KMF A;  3SXY A;  3I64 A;  2HTS A;  4FX4 A;  1DPU A;  4A0X A;  2V6C A;  4IXA A;  5HLI A;  1O7L A;  1ZN2 A;  2FRH A;  3ZP5 A;  4Z2Y A;  3U1D A;  3EYI A;  4EJV A;  1IN5 A;  5L3B A;  1ONV A;  3LAP A;  1G3Y A;  1OPC A;  2QBY A;  3F8C A;  1B9N A;  3I53 A;  1YW8 A;  1MKM A;  3TDU C;  1I1G A;  5F64 A;  3HRT A;  3J80 K;  2STW A;  3VB2 A;  3N4M A;  1BI2 A;  4L9J A;  4L5I A;  1ZLJ A;  3N97 A;  3HUG A;  1ZLK A;  1W7P B;  2F5D A;  4H0E A;  3T5X A;  2ZME B;  4HDU A;  4P96 A;  4DNC A;  3E6C C;  3HTS B;  2FSW A;  3F3X A;  2F5E A;  4U0V A;  2FNA A;  4I01 A;  2E7X A;  2O0Y A;  2RVC A;  1UCR A;  2FBI A;  2H27 A;  3HSR A;  4LK1 F;  3T0Y A;  4KYW A;  1YS6 A;  2DQR A;  1Z91 A;  3ZMS A;  4UVC A;  4CXF A;  1XMA A;  3LA2 A;  3DPT A;  1ZG5 A;  2VOO A;  1XGS A;  2V1X A;  2K4B A;  2EFQ A;  4O6J A;  1R23 A;  2PJP A;  4LJZ F;  2E1C A;  2XRN A;  3TQN A;  5D6F A;  1B6A A;  2VC0 A;  2DLL A;  3OV8 A;  5DCM A;  2A5Y B;  3MEX A;  1MDM B;  3KZY A;  3JSO A;  4FX0 A;  2GWR A;  4YFX F;  5LHI A;  5A2Q K;  5L3E A;  1CGP A;  4HQM A;  3CUO A;  1EH8 A;  3HTU A;  3G3Z A;  1LNW A;  1MZB A;  2OQR A;  3ML6 A;  2QVO A;  3ZMU A;  2V1U A;  2PBI A;  4WF2 A;  5J6X A;  1O57 A;  2H09 A;  1S7O A;  3K9T A;  4L9T A;  3M7G A;  1TTY A;  3GLX A;  4TV7 A;  1BIA A;  2WWY A;  3BRO A;  4HX8 A;  4A5M A;  2JSC A;  5CVR A;  2ZXJ A;  1JHH A;  3CUQ B;  1IRF A;  2P5K A;  1HST A;  2D1H A;  3GZ5 A;  2K27 A;  2BGC A;  3IKV A;  2JPB A;  2XVC A;  5L3C A;  3EUH A;  3M9A A;  2EFP A;  3IWZ A;  4MGR A;  1Z7U A;  2KIM A;  1RIO H;  1HKS A;  2MLK A;  3F72 A;  1W5T A;  5H6Q A;  1RUN A;  4AWX B;  4XLP F;  2XAQ A;  1YS7 A;  1ZRF A;  4BAY A;  2D1V A;  1G3T A;  5FGM A;  1ZH5 A;  2XUB A;  2HR3 A;  1BIB A;  1K78 A;  4RB3 C;  2RNJ A;  1P92 A;  2P7V B;  1ZRE A;  1S6L A;  1XDU A;  2QWW A;  1J75 A;  2VON A;  1B9M A;  3R60 A;  2DO7 A;  4YII A;  2MA3 A;  4WX9 A;  1KQ9 A;  1FBS A;  1U8R A;  2DTR A;  1KYW A;  1S29 A;  2P4W A;  1K7A A;  3J81 Z;  4CHU A;  3JAM K;  4O3M A;  3F23 A;  4M9S A;  4NHJ A;  1GXP A;  1ZG1 A;  5HDG A;  5BOX A;  4LMY A;  2ETH A;  1XDS A;  4LG0 A;  1CF7 B;  4GGG A;  3JAM Z;  3FF5 A;  3V8K A;  4KN4 X;  3RKW A;  2P6T A;  5D5X B;  2EA2 A;  2XAH A;  4EJO A;  4E70 A;  4BNC A;  5ILU A;  4XRF A;  4KIC A;  2LKP A;  2PI0 A;  3V8J A;  2FML A;  2GA2 A;  4MEX F;  3L09 A;  2NS0 A;  5FB2 A;  3RPU A;  2Q2E A;  1SMY F;  1LVA A;  4YIF A;  3ZN1 A;  4P55 A;  1O3S A;  3F6O A;  2HYF A;  5ICC A;  1SAX A;  3GF2 A;  2G7H A;  2D45 A;  1LDJ A;  2HKX A;  1R00 A;  2FEZ A;  2HWV A;  3HRU A;  4HYE A;  4R1H A;  5LRR A;  5JR3 A;  1RI7 A;  3AAF A;  2EWN A;  2RKH A;  4EGY A;  1YFH A;  2VN2 A;  3R4K A;  3P9K A;  3DFG A;  1OYY A;  3O6B B;  2OQG A;  4LK0 F;  4CZZ A;  2M5W A;  5HS7 A;  3L00 A;  4KUM A;  2BE5 F;  2IP2 A;  3TOA A;  1J2X A;  3IRR A;  2JRT A;  3B02 A;  5L3F A;  1IW7 F;  2YR2 A;  1BM9 A;  5EEG A;  3ZPL A;  1U2W A;  3MAJ A;  2E1N A;  3JTG A;  1D8K A;  4IJA A;  4G7H F;  3ZQ7 A;  1R7J A;  4MEY F;  4OU0 A;  3ECO A;  3CLO A;  5CVI A;  4A0Z A;  4A0Y A;  3LA7 A;  3FXU A;  4OIQ F;  5E1X A;  5E18 F;  3EET A;  3WE2 A;  4IRI A;  5ILS A;  1MGT A;  2EB7 A;  4I2O A;  3IL2 A;  1B4A A;  3TGN A;  3JW4 A;  1P6R A;  5ED4 A;  2Z99 A;  3I5U A;  1FYM A;  2O61 A;  2LDU A;  2ZNY A;  1U78 A;  2QEN A;  3GFI A;  2Y75 A;  2QM3 A;  2RC4 A;  1F4K A;  4MQV A;  2KIU A;  1F1Z A;  3G73 A;  2A07 F;  1LDK B;  2G7U A;  4EGZ A;  2M45 A;  1W7P A;  1G3S A;  1H0M A;  3FZV A;  1T98 A;  3O2P E;  2FBK A;  1YTY A;  5ICF A;  4LGW A;  1KGS A;  1BI0 A;  4UUV A;  5HVQ C;  4HLY A;  2NNN A;  5CVU A;  2OA4 A;  2DPD A;  3IRQ A;  2YSR A;  3HYI A;  3FXR A;  5LEJ A;  4IRH A;  3KFW X;  2IW5 A;  4AD9 A;  4CO8 A;  4G94 A;  4Y17 A;  4BH9 A;  4AIH A;  4L9V A;  4EQQ A;  1ZAR A;  1HW1 A;  3BY6 A;  2GQQ A;  1RZ4 A;  5LGU A;  3ABU A;  6PAX A;  2FF4 A;  3SQN A;  3WTW C;  2DK5 A;  2OAZ A;  1KQ8 A;  4OIP F;  3KP6 A;  2LF7 A;  1T2K A;  5AIQ A;  1BJA A;  3K2Z A;  2NYX A;  1O7F A;  2FNP A;  3WE3 A;  4IHT A;  1HKT A;  2WTE A;  4KNY A;  4ENJ A;  4RB0 A;  3HIF A;  2YX7 A;  1HW5 A;  4RAY A;  4ON0 A;  2AXL A;  3IHU A;  4M73 A;  5J8C A;  3VOE A;  3QP6 A;  2EV6 A;  5CVJ A;  1FC3 A;  1I5Z A;  3FX3 A;  3F8F A;  4RGU A;  1UST A;  1IAW A;  2Z5U A;  4B8X A;  4OIR F;  3WU0 A;  5BS6 A;  2DI3 A;  4G7O F;  4HF0 A;  3NQO A;  3OOP A;  3J7A O;  5F1R A;  2DW4 A;  2XRO A;  4QLC U;  4EM2 A;  1LEA A;  3TO7 A;  3HRM A;  4Q47 A;  4UNO A;  2CQK A;  2K86 A;  2ZBK A;  5HLG A;  1XB4 A;  3RYP A;  5D5W B;  2OD5 A;  3FM3 A;  5J8F A;  4Q48 A;  1L3L A;  4G9Y A;  2PG4 A;  4EV0 A;  1FSH A;  4U7D A;  4IPA A;  5EEH A;  1WQ2 A;  3KP5 A;  3R0A A;  2OBP A;  4AIJ A;  2ISZ A;  1HQC A;  4LB6 B;  3R6S A;  3JSP A;  4L18 B;  4KIF A;  2A3S A;  2M8E A;  4A6D A;  3QOP A;  5CJ9 A;  3GO5 A;  3WG9 A;  2ISY A;  4HF1 A;  4S04 A;  3R0J A;  4ETS A;  4UV8 A;  2M87 A;  4A12 A;  1LQ1 A;  5JFR A;  3BJO A;  3VFZ A;  2PEX A;  4FHT A;  2FU4 A;  3WU1 B;  5AON A;  2P8T A;  1SFX A;  2H6B A;  3KET A;  2XHK A;  3M1E A;  3ZMZ A;  3FWE A;  4G6D A;  2XAS A;  4OMY A;  4GXO A;  1QO0 D;  5BMZ A;  3IWF A;  2K02 A;  4LG0 B;  1HKQ A;  2KIF A;  4ZYE A;  3M8F A;  2QLZ A;  4WXH A;  1FP1 D;  1YW7 A;  3JTH A;  4M9Z A;  2XIG A;  3I58 A;  4MHG A;  2LF8 A;  5CLS A;  4LLN A;  1F5T A;  3HSE A;  1K78 B;  4CDG A;  5LRS A;  5BPI A;  3DV8 A;  2MBF A;  4IVN A;  3W6K B;  2MH2 A;  2NRA C;  2BYV E;  1S7A A;  1YIO A;  2JTV A;  2QZ8 A;  3L9F A;  2CG4 A;  5BQT A;  1HSJ A;  1B1B A;  3H3U A;  2QUF A;  4M6Y A;  2STT A;  1AOY A;  1Z9C A;  1SD5 A;  1R58 A;  2DFI A;  5KVR A;  4BYY A;  4I02 A;  4ESF A;  2KRF A;  1IF1 A;  1YQA A;  3O3K A;  4I7H A;  2J5P A;  1Z6T A;  2PFB A;  3FXQ A;  4PGG A;  4ENK A;  2ZFW A;  3WGH A;  3HOT A;  1FPQ A;  3GZ6 A;  1R5G A;  1IXC A;  2OZU A;  2E7W A;  1U6G A;  1MDM A;  2AS5 F;  5HDN A;  4GO1 A;  2GAU A;  5ERI A;  4KA4 A;  2B0L A;  1JXS A;  3KP7 A;  5K5O A;  2NNY A;  2ZNZ A;  3E6B A;  1O3R A;  2P5V A;  2GXG A;  1FYK A;  1LJ9 A;  4HF2 A;  2HS5 A;  2HGC A;  2RGV A;  3K1P A;  1R1T A;  4N9I A;  3RKY A;  2MH9 A;  5FD6 A;  1OMI A;  5FO5 A;  2R7F A;  2K4J A;  1H9T A;  1TW3 A;  1DDN A;  3REO A;  3L7W A;  2FE3 A;  2FMY A;  2XAF A;  3GFL A;  1OKR A;  3CUQ A;  3S2W A;  1I1S A;  4HZF A;  1TNT A;  3U9G A;  1ZRD A;  3TO9 A;  4GCV A;  2COM A;  1PUE E;  2Z33 A;  2ZO4 A;  1EH7 A;  1Y0U A;  1FSE A;  2FXA A;  5HOO A;  3P7N A;  3TDZ C;  1NHA A;  4WWC A;  1HBX G;  1FYL A;  4QWQ A;  4A2U A;  1XCB A;  3HSF A;  1YO5 C;  1WWX A;  4HX7 A;  4U7B A;  1KU9 A;  2VXZ A;  2ESH A;  3T1B A;  4OIO F;  2HQN A;  2IPQ X;  4KMU X;  4ESB A;  2DBB A;  5E8I A;  3I71 A;  1YG2 A;  2XV4 S;  3D5L A;  4HA8 A;  3WOD F;  2HEO A;  2IA0 A;  2PQ8 A;  1TQM A;  1IZ1 A;  5IT3 A;  3KLO A;  2Z9O A;  4RS8 A;  1V4R A;  1XSV A;  2DAO A;  2YX4 A;  4L5J A;  4NB5 A;  5HS8 A;  3MZH A;  1TBX A;  3F8B A;  1JGS A;  3LAJ A;  2Q0O A;  1OR7 A;  4P9F A;  1TQI A;  5ILV A;  5E1W A;  3RI4 A;  3P9C A;  2OU2 A;  1MJ9 A;  3ERE D;  4Q4Z F;  2DPU A;  1UB9 A;  1FBQ A;  2PN6 A;  4PDK A;  5JI6 A;  2YU3 A;  4LLL A;  5DUI A;  4LLG F;  4HW0 A;  1KU7 A;  2EA4 A;  2L4A A;  2ELH A;  2FQ3 A;  2VOD A;  1Z6R A;  3WTS C;  1B59 A;  1U3E M;  4OOI A;  3GUD A;  4HV6 A;  3KEO A;  2V9V A;  2EV5 A;  5TRD A;  1KU3 A;  4RB1 A;  1KU2 A;  4OIN F;  1ZG3 A;  1GHC A;  4WK8 F;  3K0L A;  4G8X A;  4O5V A;  1G3W A;  3NRV A;  3Q9V A;  2O8X A;  1ZYR F;  1J9I A;  2LNB A;  4KN7 X;  1UHM A;  1HW2 A;  1D3Y A;  1XGO A;  4UVA A;  1FY7 A;  5IT9 Z;  1T6S A;  4AVP A;  4PCQ A;  1OYI A;  1P4X A;  4BHC A;  3L2C A;  1R36 A;  3U2R A;  1T39 A;  4YG2 F;  3RTR A;  1IXS B;  3DF8 A;  4Y13 A;  2CGP A;  5IT9 K;  4JQF A;  4EVI A;  2FOK A;  3CDH A;  3E5U A;  2ZKZ A;  3E3V A;  2MLG A;  1XGN A;  3B73 A;  3TKY A;  3E97 A;  2XAJ A;  2XKO A;  4KIG A;  5E20 A;  4L0Y B;  1QPM A;  4RGR A;  2V79 A;  2F5C A;  1P2F A;  1E17 A;  2P5L C;  5FLX Z;  4YFN F;  3FMQ A;  5ICE A;  2L4M A;  5E8G A;  3DXJ F;  1KA8 A;  3BWG A;  3CO7 C;  3ELK A;  2IA1 A;  3IC7 A;  1MJA A;  3Q9S A;  1WSU A;  4BHP A;  3ZMD A;  1T0F A;  2VE9 A;  2Y48 A;  1XN7 A;  4BQA A;  3TOB A;  3ULQ B;  3HHH A;  4I09 A;  3ZMT A;  3ROU A;  4WXD A;  1C0W A;  2HZT A;  1LEB A;  1W5S A;  1QQI A;  2XAG A;  2RN7 A;  2IRF G;  3C7J A;  2QQA A;  1QBJ A;  3ZMV A;  2MC3 A;  3GEZ A;  3J80 Z;  1OYW A;  4KT5 C;  3K69 A;  1W7P D;  3QRF F;  2ESN A;  2KJC A;  3ZN0 A;  3LQR A;  1J59 A;  2TDX A;  1XSD A;  4R79 A;  5D5V B;  3I59 B;  4IRG A;  3KCC A;  1L0O C;  2QBY B;  3QU3 A;  1T38 A;  1F9N A;  1XD7 A;  3F6V A;  2VE8 A;  5LGT A;  1QZY A;  1LB2 A;  3RKX A;  3I0T A;  3WTT C;  5K5Q A;  2X0L A;  4U0Y A;  3WGG A;  4ESJ A;  2W57 A;  5HLH A;  4K2E A;  5FFX A;  2D2W A;  4HDV A;  2A6E F;  4XSX F;  3VOD A;  5H6R A;  1W4M A;  3QPH A;  1R22 A;  1UFM A;  2A61 A;  3NEU A;  5A2Q Z;  4M9X A;  3BZ6 A;  3COA C;  1XGM A;  1ZRC A;  2F5F A;  3Q5F A;  2BEO A;  2RQP A;  1S8N A;  1K79 A;  2O03 A;  3QP5 A;  5DDG A;  4OMZ A;  4YFK F;  3T8R A;  3WTU C;  1XSX A;  2R7D A;  1A04 A;  3GFM A;  3LST A;  3CJN A;  5D8K B;  2UWM A;  3BJ6 A;  2M1B A;  5LEK A;  2DQL A;  4KFC A;  1H9G A;  3TO6 A;  1PP8 F;  1BI1 A;  4M6X A;  1K6O A;  3WGI A;  1ULY A;  2ZCW A;  3H92 A;  3I4P A;  2IVM A;  5LHH A;  4BHB A;  2WC2 A;  2DU9 A;  3EYY A;  1XMK A;  2FA5 A;  2O3F A;  3GX4 X;  4HV5 A;  1MD0 A;  2VBZ A;  1CF7 A;  1IUY A;  3LA3 A;  2R3S A;  4RGS A;  2L3D A;  4P5O A;  2Z3Y A;  3DP7 A;  4Q5S F;  1FOK A;  4MTD A;  3DPL C;  4EJT A;  2A6H F;  3KP2 A;  5JVT A;  2F2E A;  4D0P A;  2EV0 A;  4HAM A;  4G7Z F;  2W85 A;  5K1Y A;  3E5X A;  2P6S A;  4N0B A;  1BC7 C;  4I0A A;  4EJW A;  3IKT A;  4EM0 B;  1FNN A;  2EK5 A;  2PMH A;  4I0B A;  1QGP A;  2CWE A;  4UV9 A;  2PLY A;  5D4R A;  1HXD A;  2DT5 A;  1ZHF A;  1R5H A;  3FM5 A;  1TQP A;  3EDP A;  2EFW A;  1PP7 U;  5CVV A;  4IHS A;  1VTN C;  4F7Z A;  1U5T A;  2BBY A;  3GXO A;  4JBA A;  1TLH B;  3H3Z A;  2UZK A;  4MTE A;  5JHU A;  2WV0 A;  2HKO A;  2K7L A;  3DEU A;  2PMU A;  1O3Q A;  1YLF A;  3MFK A;  2CW0 F;  1IN7 A;  1BN5 A;  5D8L B;  5E1Z B;  2CFX A;  2EJR A;  4GYG A;  3GYH X;  4L9N A;  2IA2 A;  5LLQ A;  2W84 A;  4MNU A;  3WTZ A;  2CO5 A;  5DD4 A;  4ZZD A;  2L54 A;  3RIR A;  4ASN A;  2YPR A;  4MQ9 F;  3PFI A;  5D5U B;  1IXR C;  3V7C A;  3QPT A;  2DK8 A;  2VOP A;  1QZZ A;  2V1D A;  4BXU A;  3BDD A;  2VT3 A;  4ZYG A;  3T8T A;  1REP C;  3MQ0 A;  5K5R A;  2JT1 A;  3WTV C;  1DUX C;  3HHG A;  3RYR A;  2NAZ A;  3F21 A;  2UXN A;  4HLX A;  4DQ2 A;  3V4G A;  1ON2 A;  2A68 F;  4P9U A;  3KE2 A;  1SFE A;  1BOA A;  3I59 A;  1USS A;  4UXN A;  3ISP A;  2UXX A;  1FBU A;  3MCZ A;  5DCF A;  3LFK A;  1SD4 A;  3DQV C;  3KP4 A;  2J5O A;  2GXB A;  3DKW A;  1FT9 A;  4ZYD A;  1O3T A; 
#chains in the Genus database with same CATH topology
 3CTA A;  4CA0 A;  2GZW A;  3R61 A;  3K6G A;  2BVL A;  5E3M A;  2KIQ A;  4V19 K;  1U5T B;  3OR2 C;  3VEP A;  3RZD J;  1OCT C;  3ZCO A;  3OYN A;  2QQB A;  3WTX C;  1ON1 A;  1ZGJ A;  2C6Y A;  4FIS A;  2LFB A;  4RAZ A;  4LB5 A;  3PQK A;  2A69 F;  1F43 A;  3GVA A;  3MMY B;  2M30 A;  2A6T A;  4B09 A;  4ZDO A;  2H94 A;  4KDP A;  1W0U A;  2L7Z A;  2BXZ A;  2W24 A;  2QQ9 A;  1Z1D A;  5JLX A;  4XKW A;  3JRF A;  1I6H J;  3KYD B;  4BU2 A;  4CCJ A;  2R93 J;  1ENH A;  9ANT A;  2VC1 A;  4HBL A;  3ZQQ A;  3SHF A;  3H5N A;  3QOD A;  3GLL A;  2K3F A;  1GVJ A;  4OAY A;  3EUA A;  1X1D A;  2MW8 A;  4M3E A;  5TGT A;  4IOC F;  4II3 A;  3OYH A;  4DOZ A;  1Q1H A;  1BBY A;  3OYG A;  5ICG A;  1HC8 A;  3J81 K;  5KK1 A;  1YYV A;  3GME A;  2Q8K A;  1QRY A;  4ZZL A;  3F8N A;  4QPQ A;  4EAT A;  5LBQ A;  1SMT A;  1DU0 A;  4J00 A;  1R9T J;  3P9I A;  5FRN A;  4GYI A;  1JHF A;  1Z05 A;  2QQ8 A;  4ANJ A;  3RZO J;  3MWM A;  1J7K A;  3LWF A;  1R1V A;  5FKN A;  2E5Z A;  4F92 B;  2DDA A;  4MFE A;  1MNE A;  1J0R A;  3SZT A;  2RDP A;  1XCV A;  1FP2 A;  2HQA A;  3H1C A;  3FMS A;  4M71 A;  1RC9 A;  2L02 A;  1D1B A;  4FQG A;  5D6E A;  2MD5 A;  1IN4 A;  3FIW A;  4WXC A;  4YEL A;  4X6A J;  3OYE A;  3S93 A;  4EJU A;  2RV8 A;  1WRJ A;  3TBI A;  5L3D A;  1DGR M;  2M4K A;  4Y15 A;  4CGZ A;  1R49 A;  4ZDL A;  1YW9 A;  2XGX A;  2P7C B;  1ETV A;  3C1D A;  1QNT A;  3KZZ A;  4XON A;  1I3A A;  4LG3 A;  3F22 A;  4XL9 A;  3FHZ A;  5EZH A;  5DUK A;  4ZH4 F;  2IGM A;  2CYY A;  1S9H A;  3BR5 A;  1P4A A;  1S3J A;  3A0B C;  3BT9 A;  5D4S A;  3M8E A;  1OQY A;  3CP2 A;  1RNL A;  1PUF A;  5IOZ A;  3I9V 2;  2E2H J;  4IOA F;  3B6C A;  3HXL A;  5CYV A;  3AG4 H;  1SFU A;  5E17 F;  2E60 A;  3UKG A;  2DMQ A;  2FOW A;  3TL4 X;  1BW6 A;  4LFU A;  3GW2 A;  1LFB A;  3QU6 A;  1A36 A;  1I27 A;  1Y1V J;  2UV1 A;  1WKM A;  1FLI A;  4L5E A;  3CF2 A;  2RNG A;  1ZGW A;  1KYZ A;  1TNS A;  2JZY A;  5DYM A;  3RJP A;  5LGN A;  4XOT A;  4I98 B;  4XNF A;  3RPQ A;  3TP3 A;  1X1P A;  2ZSH B;  3IUO A;  3MZY A;  4E7S A;  3D0S A;  4LD5 A;  3W6J B;  3KLN A;  1EV7 A;  1TW2 A;  1X3U A;  2VBX A;  4AUX A;  1IN8 A;  2OZ6 A;  3BP8 A;  3E6D A;  3SDB A;  2NOG A;  1BR2 A;  4Z6Y A;  2XSD C;  3BJA A;  2K85 A;  2O6G E;  3I3L A;  1V3F A;  1R1U A;  2K9N A;  2VBW A;  3K1N A;  4AIK A;  4FCY A;  3LNQ A;  3FMR A;  2HDC A;  2LRE A;  3KP3 A;  4XLC A;  3BCA A;  4S05 A;  5EGO B;  1DPR A;  1ODD A;  1X58 A;  2Y9Z A;  4XLN F;  1F36 A;  3HZJ A;  2EFN A;  3V7R A;  2HVS A;  1IRG A;  4N9H A;  4U88 A;  1PDN C;  1IN6 A;  1STZ A;  3C3W A;  4RGX A;  4A6E A;  1E2X A;  2X1C A;  3WTY C;  5DD8 A;  1A6I A;  1ZAO A;  3QYE A;  4D5F A;  1U8B A;  1ETW A;  4XRS A;  2VQC A;  1BI3 A;  4CZC A;  2JMW A;  3HKZ A;  5AIP A;  3L2U A;  5FLX K;  1WI9 A;  4E7H A;  4FT8 A;  4PGH A;  5FD5 A;  2HYG D;  2HDD A;  1D8J A;  3MKL A;  2ELJ A;  5HDK A;  2W25 A;  1TZL A;  4EM1 A;  2IJL A;  3PQJ A;  5LHG A;  2LBF B;  3GFJ A;  5FKO A;  3K70 D;  3ZQL A;  3CJQ B;  1UZC A;  1BW5 A;  2DFH A;  5CPR B;  3S1M J;  1R6R A;  2V1N A;  4XBF A;  2LD5 A;  2L01 A;  4BGD A;  1I6X A;  1JTY A;  1SFO J;  3KEQ A;  4AVZ A;  5DEQ A;  2KDZ A;  1JUS A;  2XKP A;  1MMN A;  5DV5 A;  3ABT A;  2ELK A;  3HOV J;  2GOM A;  4NC7 A;  2DYS H;  3VPR A;  3F8M A;  4M74 A;  4EMS A;  1IRZ A;  5F0C A;  1GXQ A;  5DCM B;  4RB2 C;  3S3N A;  5M3M J;  1D5V A;  3E5Q A;  3SFZ A;  3FXO A;  3HC7 A;  2DOF A;  5JHF A;  1JT0 A;  2G9W A;  3GWZ A;  2LY2 A;  2HQR A;  2HOS A;  4JK1 X;  1P4W A;  1MJB A;  5BNG A;  1G6N A;  2HOE A;  4A5N A;  2CV0 A;  3BOQ A;  3ZR8 X;  3RDI A;  2GA1 A;  4CYD A;  4UVB A;  5CQG A;  2FBH A;  4QSH A;  4ENM A;  2IS4 A;  1G4D A;  1Y56 A;  4IX7 A;  1EH6 A;  2R7Z J;  1LDD A;  4XLH A;  4HX4 A;  1UMQ A;  4HQE A;  4RMN A;  3I54 A;  2LP0 A;  1U5T C;  3LQQ A;  2JJ7 A;  5HS9 A;  1FTT A;  1Z7L A;  3I56 I;  1ZK8 A;  3HOS A;  1UHW A;  3SZP A;  4XRM A;  2DA1 A;  3JRG A;  2PJR A;  5BPD A;  2QYO A;  4HOB A;  3CLQ A;  1X3Z B;  1LPQ A;  2HXI A;  2L5Q A;  3LSP A;  1FX7 A;  2OTJ I;  5J3L A;  3V8L A;  5H20 A;  2PX9 A;  3JRE A;  5J47 A;  3M8J A;  2HFH A;  3CCL I;  2DCE A;  3CO6 C;  1BC8 C;  2HTJ A;  1TT5 B;  2LTP A;  3BQZ A;  3E6M A;  4XSZ F;  1JKP C;  2ADU A;  4PZJ A;  1JE8 A;  4G6Q A;  4NQW A;  2IS2 A;  4A3I J;  5F6F A;  1ETK A;  2Y2Z A;  4KIB A;  2FUG 2;  4RAG A;  3BZK A;  2WBM A;  3HRS A;  1SAU A;  4CIC A;  4A3B J;  3OYI A;  1UJ8 A;  2KKO A;  2HVQ A;  1FWZ A;  1A6Q A;  3BPV A;  4D1Q A;  1AWC A;  4UHT A;  1V5G A;  3C18 A;  2P81 A;  1QHG A;  1FZP B;  3J7Y J;  5TJJ A;  1MBE A;  1P7I A;  1RR8 C;  4M72 A;  4UB8 C;  1MBG A;  2CSO A;  4IF4 A;  2ZME A;  3OYC A;  2JPC A;  2X4H A;  2ZJ2 A;  3QAH A;  4ENN A;  4HNT A;  1RUO A;  1MIJ A;  5M5Y J;  4RLQ A;  2LSO A;  2H6C A;  4U0W A;  4X0G A;  1DP7 P;  3D5S C;  1SD7 A;  3K1M A;  2EFO A;  1YJ9 I;  3HM5 A;  4R8H A;  2GIV A;  4M3F A;  2BV6 A;  4N4O B;  4KIT B;  1KQ0 A;  2KJB A;  5CKT A;  1WJF A;  3EQL F;  1FIA A;  1FMV A;  3CUQ C;  3QYB A;  3W2V A;  2VBY A;  4ZYH A;  2VT2 A;  2IT0 A;  1ZGA A;  2E34 A;  5FFZ A;  4WCG A;  2DMT A;  1TWH J;  4D5C A;  4OWR B;  4L0Z B;  1ZR2 A;  3BPX A;  4ZDP A;  2Y0M A;  3H5R A;  1SD6 A;  3V7S A;  1EJ9 A;  2ACJ A;  3HG9 A;  2VJJ A;  3FK7 A;  3DWL E;  1J5Y A;  4PFP A;  5KHD A;  3ECH A;  1N25 A;  5L3G A;  4KMF A;  4XIC A;  3SXY A;  1O4X A;  2EQR A;  3ASN H;  3I64 A;  2DJI A;  2HTS A;  4FX4 A;  1DPU A;  4NNJ A;  2M0M A;  4ITV A;  4A0X A;  2V6C A;  4IXA A;  5HLI A;  2L7F P;  2PMZ N;  1O7L A;  1ZN2 A;  2R7R A;  1K83 J;  2FRH A;  3CMY A;  2KL4 A;  3S3O A;  3ZP5 A;  4Z2Y A;  3U1D A;  4IHX A;  3EYI A;  2KLO A;  2JQ7 A;  4EJV A;  1IN5 A;  5L3B A;  3W6V A;  3DKY A;  1ONV A;  2XSJ C;  3LAP A;  2Y30 A;  1G3Y A;  4ZTJ A;  4I99 C;  1OPC A;  2QBY A;  1FJL A;  3A2K A;  3F8C A;  1B9N A;  3I53 A;  5F0H A;  3OSG A;  1YW8 A;  1MKM A;  3TDU C;  4BEH A;  1I1G A;  2VJI A;  5F64 A;  3HRT A;  3J80 K;  5B66 C;  2STW A;  3VB2 A;  5J1Y A;  3N4M A;  2DTZ A;  2R0Q C;  4DYR A;  1BI2 A;  4L9J A;  4L5I A;  2LC2 A;  2LKS A;  3ZQG A;  1ZLJ A;  1JT6 A;  3N97 A;  3K70 C;  1VQ8 I;  2OTL I;  2ID3 A;  2JA8 J;  2E71 A;  4H4K C;  2VKD A;  3HUG A;  1ZLK A;  3HGY A;  2VLA A;  1W7P B;  2F5D A;  4YIR X;  4H0E A;  3OIP A;  3T5X A;  4E7I A;  5IYD J;  2ZME B;  2NVQ J;  4MIM A;  2QCO A;  3DBL B;  3BG3 A;  1BR4 A;  4HDU A;  1TL8 A;  4P96 A;  1X1A A;  3AFH A;  5J4V A;  2HU9 A;  3KPH A;  4DNC A;  1NTC A;  4A3C J;  2JUC A;  3E6C C;  3DTK A;  4AM3 A;  1ETO A;  4DGW B;  2G0E A;  3HTS B;  1Z67 A;  2FSW A;  3F3X A;  2F5E A;  4RA2 A;  2VL8 A;  4U0V A;  2HYJ A;  3DEE A;  5F08 A;  2FNA A;  4XLF A;  4HG2 A;  1D5Y A;  3SEQ A;  3NAU A;  4NBQ A;  4I01 A;  1GLN A;  2E7X A;  4RM2 A;  3PIP F;  3L2Q A;  4B43 A;  2O0Y A;  2RVC A;  3GBG A;  3WU2 C;  1UCR A;  1OCR H;  2FBI A;  3GTP J;  1J09 A;  3H3V K;  2H27 A;  1PJR A;  2MYS A;  3HSR A;  3PO2 J;  4LK1 F;  3T0Y A;  2EPF A;  3LFU A;  4FE4 A;  1AU7 A;  2DDB A;  2PMZ A;  3DCF A;  4FAS D;  4CCK A;  2LRD A;  2VIX A;  4KYW A;  1YS6 A;  2DQR A;  1Z91 A;  3RQI A;  3ZMS A;  4CH7 A;  4UVC A;  1X4O A;  4S0H B;  4CXF A;  4E4H A;  1X1B A;  1XMA A;  3LA2 A;  4IZZ A;  1OR7 C;  2O7O A;  1VQ4 I;  2X1E A;  2Z16 A;  1WJB A;  2R7U A;  2TCT A;  1XPX A;  1HLV A;  3DPT A;  1ZG5 A;  2IGK A;  1XGS A;  2V1X A;  3OYB A;  2VOO A;  2OV7 A;  2LBF A;  3LSM A;  2WAF A;  2K4B A;  2EFQ A;  4O6J A;  1R23 A;  1V5E A;  1G8X A;  4LJZ F;  2PJP A;  5JVG F;  3RKQ A;  2E1C A;  2XRN A;  3TQN A;  4XN0 A;  5D6F A;  3K10 A;  2O8K A;  3IAS 2;  1B6A A;  2WY8 Q;  3W2A A;  3H36 A;  2YUS A;  4QPO A;  1JUP A;  2VC0 A;  1K61 A;  1X3W B;  1AA7 A;  3CES A;  2DLL A;  3K4B A;  4JOM A;  3OV8 A;  3FIS A;  4BDY A;  5DCM A;  2A5Y B;  3MEX A;  2NVU B;  3KZY A;  3JSO A;  1MDM B;  4FX0 A;  2GWR A;  2XPV A;  4YFX F;  3L2V A;  5LHI A;  5A2Q K;  1T56 A;  5L3E A;  1CGP A;  4HRI A;  3FHN A;  2VI6 A;  4HQM A;  1E0E A;  3G6E I;  3CUO A;  1EH8 A;  2K9S A;  3HTU A;  5EDN A;  3CC4 I;  3G3Z A;  1LNW A;  1MZB A;  2OQR A;  3ML6 A;  4NC8 A;  2X6O A;  2QVO A;  4BQO A;  3ZMU A;  2QA4 I;  3KZI C;  4RLF A;  5M5W J;  4M3B A;  4RM3 A;  4D7N A;  2V1U A;  2PBI A;  4WF2 A;  2ZJQ F;  2I8D A;  5J6X A;  1O57 A;  2H09 A;  2OF7 A;  1S7O A;  3DBR B;  2EIJ H;  2OUM A;  2QKM B;  3K9T A;  1RET A;  4L9T A;  4M6V A;  2O5R A;  5GP9 A;  3M7G A;  1TTY A;  1RES A;  3ASO H;  2EZL A;  2F4O B;  3GLX A;  2PJR B;  4TV7 A;  1BIA A;  2WWY A;  3BRO A;  4HX8 A;  4A5M A;  3HPH A;  3ZQF A;  2JSC A;  1KZH A;  5CVR A;  3O8H A;  2ZXJ A;  2R7O A;  2R7X A;  1JHH A;  1JJ6 C;  4D9J A;  3CUQ B;  1IRF A;  2P5K A;  3E0J B;  1HST A;  1IC8 A;  2D1H A;  1VQ6 I;  1Q1V A;  3GZ5 A;  4UUT A;  4AC0 A;  4CYC B;  1OFC X;  2K27 A;  1FIP A;  3OYJ A;  5E3N A;  2BGC A;  3IKV A;  2JPB A;  2XVC A;  3FXM A;  4JX4 A;  2F6C A;  3SYT A;  2KMU A;  5L3C A;  2CS3 A;  2HNH A;  3PFY A;  3EUH A;  3M9A A;  2EFP A;  3IWZ A;  4MGR A;  1Z7U A;  3BR2 A;  1WHU A;  2KIM A;  1RIO H;  1HKS A;  4LIT A;  2MLK A;  3F72 A;  3OL4 A;  3GTG J;  1W5T A;  5H6Q A;  2ZC2 A;  1RUN A;  4AWX B;  1JKQ C;  3G1L A;  1NK2 P;  4XLA A;  1ETY A;  2XAQ A;  1YS7 A;  4XLP F;  3VYT B;  1ZRF A;  4BAY A;  3CP8 A;  1NK3 P;  2D1V A;  1G3T A;  5FGM A;  1ZH5 A;  1TP4 A;  4B44 A;  2XUB A;  2HR3 A;  1BIB A;  4IHY A;  3AG2 H;  2M34 A;  1K78 A;  4RB3 C;  2MSY A;  4E7Z A;  2RNJ A;  1P92 A;  2P7V B;  5K7H A;  4F52 A;  2R7V A;  3HOW J;  3PIO F;  1ZRE A;  1IUF A;  1MMG A;  3K7A J;  1S6L A;  2R5Y A;  1XDU A;  2QWW A;  4B47 A;  1J75 A;  2VON A;  1B9M A;  1QZE A;  3R60 A;  3Q3S A;  4XM3 A;  3CC7 I;  1MW7 A;  2IAI A;  2DO7 A;  3BR1 A;  4YII A;  3VWB A;  3CDL A;  1YIT I;  3CMA I;  3I4M J;  1YX3 A;  2M0C A;  2MA3 A;  4WX9 A;  1KQ9 A;  1FBS A;  1U8R A;  4M3D A;  4XOP A;  2DTR A;  1U0J A;  1KYW A;  4UUS B;  3KYL A;  1S29 A;  2P4W A;  1K7A A;  3HBL A;  2JA6 J;  1Z21 A;  4BJT A;  3J81 Z;  4CHU A;  1XX5 A;  2QF7 A;  4IHW A;  1WJA A;  3JAM K;  3FKI J;  4A69 C;  4BEH B;  4O3M A;  3EPZ A;  3F23 A;  1BJZ A;  4M9S A;  4NHJ A;  1GXP A;  1ZG1 A;  5HDG A;  5BOX A;  4LMY A;  2VKV A;  2ETH A;  3DLA A;  1XDS A;  4LG0 A;  1CF7 B;  4GGG A;  1BR1 A;  3JAM Z;  3HEF A;  3FF5 A;  3V8K A;  3K4L A;  2M2E A;  4KN4 X;  3RKW A;  2P6T A;  1OCZ H;  3FKJ A;  5D5X B;  3QPL A;  4B3X A;  2EA2 A;  4DIQ A;  2XAH A;  4EJO A;  4E70 A;  1FTZ A;  2XAU A;  5C44 J;  2H8W A;  2Z2S B;  5ILU A;  4BNC A;  4XRF A;  4KIC A;  1Y8Q B;  2LKP A;  1YJN I;  4C2U A;  3A1Y A;  1B8I B;  2PI0 A;  3V8J A;  2FML A;  2GA2 A;  4MEX F;  3L09 A;  4XKV A;  2NS0 A;  5FB2 A;  3RPU A;  2Q2E A;  1AKH A;  1SMY F;  2BY3 A;  3CJT B;  1LVA A;  1T95 A;  1WJC A;  4YIF A;  2CQX A;  3ZN1 A;  4P55 A;  2EBI A;  1O3S A;  3F6O A;  2HYF A;  3SDG A;  5ICC A;  3OIQ A;  1SAX A;  3CCS I;  3GF2 A;  2G7H A;  3QWL A;  2D45 A;  1LDJ A;  1U9N A;  2VAS A;  2HKX A;  1R00 A;  4JYK A;  2FEZ A;  1EA3 A;  1R4M B;  2HWV A;  2W1O A;  3QPS A;  3HRU A;  3BG7 A;  1TWF J;  4HYE A;  4XQF A;  4R1H A;  5LRR A;  3A01 B;  5JR3 A;  1RI7 A;  3AAF A;  3HB9 A;  2EWN A;  2RKH A;  2X1D A;  4EGY A;  1YFH A;  2VN2 A;  1JKR C;  3R4K A;  3P9K A;  2IXS A;  3DFG A;  3ZQH A;  1BL0 A;  1OYY A;  4DYQ A;  3O6B B;  2R7S A;  2HOA A;  1JUM A;  5E79 C;  2E36 A;  4B3A A;  2QSG X;  5EG0 B;  4ZTF A;  5J40 A;  5B3S H;  3FDY A;  2OQG A;  2DFE A;  4LK0 F;  4CZZ A;  2M5W A;  1SVM A;  5HS7 A;  1ZKG A;  3L00 A;  1OLT A;  4KUM A;  2BE5 F;  1TWC J;  2CJJ A;  1JI8 A;  2DA4 A;  3TW6 A;  2BXY A;  3DU6 A;  2M8G X;  2IP2 A;  3H5A A;  3TOA A;  2DA2 A;  1J2X A;  4F55 A;  3IRR A;  3S17 J;  2JRM A;  2JRT A;  3B02 A;  5L3F A;  1IW7 F;  2YR2 A;  2VKH A;  2Z1D A;  2LMD A;  1PUF B;  2FX0 A;  4B1R A;  1BM9 A;  5EEG A;  3ZPL A;  1U2W A;  2EIM H;  4GFB A;  3MAJ A;  2E1N A;  2E35 A;  3JTG A;  4D7M A;  1D8K A;  2UUZ A;  2M4G A;  4HST A;  4IJA A;  1NG7 A;  4RBO A;  5FJ8 J;  1K4S A;  4G7H F;  1XC5 A;  2ZFU A;  3BQY A;  3ZQ7 A;  4XR6 A;  1R7J A;  4MEY F;  4OU0 A;  1VQP I;  3GCM A;  3ECO A;  1MBJ A;  3KYC B;  2NVT J;  2WB1 N;  3CLO A;  5CVI A;  3X2Q H;  4A0Z A;  4A0Y A;  5KAF C;  4E7K A;  4IQJ A;  4GRI A;  3LA7 A;  3FXU A;  4I76 A;  1QVU A;  5GPA A;  3CDI A;  4OIQ F;  3DTE A;  1GUU A;  1MND A;  4G6T B;  1D0Y A;  5E1X A;  3J7Z I;  5E18 F;  1GV2 A;  3EET A;  1B8I A;  3WE2 A;  1ZEL A;  5ILS A;  4IRI A;  1MGT A;  3FK6 A;  2OPT A;  1AKH B;  1CQT A;  1Z3X A;  2L7M P;  3CZ6 A;  4OAZ A;  2EB7 A;  4I2O A;  3CQZ J;  2IEK A;  4ZYA A;  1B4A A;  3IL2 A;  3TGN A;  2CV2 A;  3JW4 A;  1P6R A;  2CFO A;  3O8G A;  3GTQ J;  1ZR4 A;  5ED4 A;  3HOX J;  2R7W A;  2Z99 A;  1POG A;  1TWA J;  3I5U A;  1FYM A;  2O61 A;  2LDU A;  2ZNY A;  3OIO A;  3UR3 C;  1U78 A;  2QGU A;  2QEN A;  5GAG J;  3GFI A;  2Y75 A;  2QM3 A;  4FTH A;  2RC4 A;  3DLL F;  4BY1 J;  2MFZ A;  1F4K A;  2JN6 A;  4PJ0 C;  3A01 A;  4MQV A;  2KIU A;  2X6W A;  1F1Z A;  3G73 A;  3U21 A;  2B63 J;  3E1S A;  2E5N A;  5F1J A;  1LDK B;  2A07 F;  3ZQC A;  5FLV A;  2G7U A;  4EGZ A;  2M45 A;  1BA5 A;  1W7P A;  1G3S A;  2CQQ A;  1H0M A;  4Y52 J;  3FZV A;  4XKB A;  3CJR B;  3HOY J;  2DN0 A;  3BTC A;  2OJE D;  5LD2 C;  1T98 A;  1ERD A;  3O2P E;  2WB1 A;  2FBK A;  1YTY A;  5ICF A;  5FKM A;  4LGW A;  3PO3 J;  1KGS A;  1BI0 A;  4UUV A;  5HVQ C;  4HLY A;  2NNN A;  5CVU A;  2OA4 A;  2DPD A;  3IRQ A;  2YSR A;  3HYI A;  5EYR A;  4KT6 A;  3FXR A;  2NS8 A;  5LEJ A;  4IRH A;  3KFW X;  2IW5 A;  4AD9 A;  4CO8 A;  4PK4 A;  4G94 A;  2ZSI B;  4Y17 A;  4BH9 A;  4AIH A;  1MMA A;  1VF9 A;  4L9V A;  4EQQ A;  1ZAR A;  1X2M A;  1R4N B;  1HW1 A;  3ZQI A;  2R5Z A;  3BY6 A;  2GQQ A;  1RZ4 A;  5LGU A;  2EIN H;  1SVL A;  3ABU A;  6PAX A;  2WAQ A;  2FF4 A;  2XPU A;  3MKW B;  2Q1Z B;  3SQN A;  3WTW C;  2NS7 A;  3ZRG A;  2DA3 A;  2WY7 Q;  2YS9 A;  4BUP A;  2DK5 A;  1S5L C;  2OAZ A;  5M3F J;  1IRX A;  1WJE A;  1KQ8 A;  5E3O A;  2E1M C;  2RAE A;  4OIP F;  1MH4 A;  3KP6 A;  2FJ1 A;  2LF7 A;  3TED A;  1T2K A;  2V9P A;  4HEA 2;  5AIQ A;  2YU9 J;  3HUG B;  4BQQ A;  2IS6 A;  1BJA A;  3K2Z A;  2JA2 A;  1YOV B;  2NYX A;  1O7F A;  2FNP A;  1E3O C;  5C4X J;  2EIL H;  2XB0 X;  1Y1W J;  3WE3 A;  4IHT A;  4NQW B;  5DTD A;  1HKT A;  2WTE A;  1TT0 A;  4KNY A;  3BLY A;  4ENJ A;  3J7A Y;  4BS9 A;  4RB0 A;  4BJ6 C;  2RRE A;  3HIF A;  1QHH D;  1WFX A;  2YX7 A;  5GAD J;  2VKE A;  1HW5 A;  1W36 D;  4RAY A;  4E7L A;  4ON0 A;  2AXL A;  3OYL A;  4BJ5 C;  3ABK H;  3JCU C;  3IHU A;  4M73 A;  5J8C A;  3VOE A;  3QP6 A;  3PSF A;  4NUB A;  1MBH A;  4HSR A;  2EV6 A;  4PJL A;  5CVJ A;  1FC3 A;  1I5Z A;  3JRA A;  2A05 A;  2X9D A;  3FX3 A;  2L9V A;  3F8F A;  4RGU A;  3K4J A;  3N05 A;  1UST A;  4Y7N J;  1IAW A;  1VQ9 I;  4U87 A;  4B4C A;  1U9O A;  2Z5U A;  3A03 A;  2BHZ A;  2WAE A;  3RSN A;  4B8X A;  4OIR F;  3WU0 A;  5BS6 A;  2DI3 A;  3RQ4 A;  4C3J J;  4G7O F;  1X4P A;  2KHM A;  4HF0 A;  3NQO A;  3OOP A;  1JJ8 C;  1VFC A;  3GZN B;  4DZP A;  2VQL A;  1S72 I;  3J7A O;  4DBQ A;  3CCJ I;  5F1R A;  2XC7 A;  3Q0V A;  2DW4 A;  2XRO A;  4QLC U;  1DP3 A;  4CCO A;  4EM2 A;  3S1R J;  1HDP A;  3OYK A;  1LEA A;  3TO7 A;  3HRM A;  2KIS A;  4Q47 A;  2CQK A;  4UNO A;  2K86 A;  2ZBK A;  4BL0 B;  1XB4 A;  2JWT A;  3RYP A;  5HLG A;  4PJJ A;  5D5W B;  2OD5 A;  3FM3 A;  5J8F A;  4IO9 F;  3OYF A;  5FRM A;  3SEZ A;  4Q48 A;  2L0K A;  3VSL A;  5DS9 A;  1VQO I;  1L3L A;  3PM1 A;  2Y0S A;  4G9Y A;  2PG4 A;  4EV0 A;  4GDF A;  2ME0 A;  3JRD A;  4BXX J;  1MBK A;  1FSH A;  2EH3 A;  4U7D A;  4IPA A;  5EEH A;  1MSF C;  2HVR A;  1WI3 A;  1ORK A;  1WQ2 A;  2AQF A;  2K40 A;  1V5F A;  3KP5 A;  3R0A A;  2OBP A;  3FXJ A;  4AIJ A;  1A31 A;  2ISZ A;  1HQC A;  1PVE A;  2XRL A;  4PJM A;  4LB6 B;  3VYU B;  3R6S A;  3C2G A;  3JSP A;  3LOC A;  2ZJR F;  2CU7 A;  4L18 B;  3M4O J;  4KIF A;  4YRV A;  2A3S A;  2M8E A;  4BE1 A;  2LH9 A;  4A6D A;  5FLM J;  3NAR A;  1IGN A;  3NWT A;  2DA7 A;  5TIS C;  2M3A A;  3QOP A;  5CJ9 A;  3GO5 A;  4HNV A;  2R5Y B;  3WG9 A;  2ISY A;  2W4S A;  4HF1 A;  2W82 A;  3BTJ A;  5GAE J;  4S04 A;  2XGE A;  4BAC A;  3LSH A;  2OC6 A;  3R0J A;  3G2B A;  4ETS A;  4UV8 A;  1H88 C;  2M87 A;  4A12 A;  1LQ1 A;  5F0F A;  5JFR A;  3BJO A;  1IV8 A;  3WHB A;  3VFZ A;  2PEX A;  4FHT A;  3MKZ A;  2FU4 A;  3WU1 B;  5AON A;  2P8T A;  1SFX A;  2H6B A;  2EZK A;  2XHK A;  3LSI A;  5KCM A;  3KET A;  3M1E A;  3ZMZ A;  1NH3 A;  1QU3 A;  3FWE A;  5CQE A;  4G6D A;  4J01 A;  2XAS A;  5DM6 F;  1RKW A;  4OMY A;  3IP4 B;  1EF4 A;  4GXO A;  1QO0 D;  3HJE A;  5BMZ A;  3IWF A;  5M5X J;  2K02 A;  4XLE A;  3JRH A;  1HKQ A;  3LSJ A;  1WCM J;  3JRC A;  4LG0 B;  2KIF A;  2K9L A;  2E2J J;  2CRG A;  2E19 A;  4ZYE A;  3CC2 I;  1D1A A;  3M8F A;  2QLZ A;  3DU5 A;  3IH2 A;  3QYF A;  4F91 B;  4KIS A;  4WXH A;  1LE8 A;  2BHY A;  1TC3 C;  1FP1 D;  1KON A;  2E1M B;  1XTA A;  5IOY A;  1YW7 A;  3W3C A;  1X1C A;  2I10 A;  3JTH A;  3PNY A;  4M9Z A;  1SAN A;  2XIG A;  4A3G J;  5GTH C;  2COB A;  3I58 A;  4MHG A;  4MLO A;  2JK3 A;  3CCM I;  1FOY A;  2LF8 A;  3AL0 C;  3OYD A;  4A3F J;  5CLS A;  1UHS A;  3H0G J;  4C30 A;  4LLN A;  1F5T A;  3HSE A;  5LFA A;  2Q2E B;  1K78 B;  3U1K A;  4CDG A;  5KAI C;  2M7A A;  1N75 A;  5LRS A;  5BPI A;  3DV8 A;  2MBF A;  3CCY A;  4IVN A;  3W6K B;  2MH2 A;  2NRA C;  4QTR A;  2BYV E;  1S7A A;  1YIO A;  2JTV A;  2QZ8 A;  3FBN B;  2CG4 A;  3L9F A;  1HOM A;  5BQT A;  5JLW A;  2MGQ A;  5IP7 J;  3S14 J;  3KIO A;  2BZT A;  1D0Z A;  1B1B A;  1HSJ A;  3Q0U A;  3H3U A;  4CCL A;  2VJ4 A;  4IKF A;  2QUF A;  1B72 A;  4RAF A;  4M6Y A;  2STT A;  5GTI C;  1AOY A;  1K6Y A;  3BTI A;  1Z9C A;  3I4N J;  4BXF A;  1SD5 A;  1S7E A;  1R58 A;  2DFI A;  5KVR A;  2K9M A;  4BYY A;  4I02 A;  4ESF A;  2KRF A;  1IF1 A;  1YQA A;  1OJL A;  2DYR H;  3O3K A;  4I7H A;  2J5P A;  3G1M A;  4XKC A;  1Z6T A;  2PFB A;  1IO2 A;  1SVO A;  3FXQ A;  4PGG A;  4ENK A;  1BOB A;  2ZFW A;  1WJD A;  3MD2 A;  3WGH A;  3HOT A;  2BOL A;  1FPQ A;  3GZ6 A;  1R5G A;  2HXO A;  1IXC A;  2OZU A;  2E7W A;  4J19 A;  1Z3Y A;  1U6G A;  1MDM A;  3H0D A;  2LKX A;  2MG4 A;  2AS5 F;  5HDN A;  1MNM C;  4JX6 A;  4BY7 J;  2D5V A;  4GO1 A;  1ETX A;  2GAU A;  3A02 A;  3MN2 A;  5ERI A;  4KA4 A;  2B0L A;  1FOX A;  1JXS A;  3PNT A;  2ECB A;  3KP7 A;  4AYB A;  3S2H J;  1LE8 B;  1LKX A;  5IP6 A;  1Z77 A;  5K5O A;  2NNY A;  2ZNZ A;  3E6B A;  2WV1 A;  4ZC3 A;  3H35 A;  3UNG C;  4NDL A;  1O3R A;  3HDD A;  2P5V A;  4A3J J;  2GXG A;  1FYK A;  3D5R C;  1LJ9 A;  4CSW A;  4HF2 A;  1I50 J;  1IDZ A;  2HS5 A;  2HGC A;  2RGV A;  3K1P A;  1R1T A;  4N9I A;  3RKY A;  3AL0 B;  3B6A A;  2MH9 A;  5FD6 A;  1OMI A;  2K5C A;  2GOX B;  3M07 A;  5FO5 A;  3OYA A;  1WZ2 A;  2K3P A;  5FKK A;  1ACI A;  2R7F A;  2K4J A;  1H9T A;  1TW3 A;  1DDN A;  2VJ5 A;  1V55 H;  3REO A;  3G1O A;  3PUF A;  1XG1 A;  3L7W A;  2FE3 A;  2FMY A;  2XAF A;  1ITY A;  4QIW N;  3GFL A;  2NXN B;  2X6Y A;  5HNH A;  5EG0 A;  1OKR A;  2DOA A;  4N4N B;  3CUQ A;  4JP0 A;  3S2W A;  2QSF X;  1I1S A;  1G59 A;  4HZF A;  1TNT A;  2LR8 A;  4C2T A;  3U9G A;  1W5C C;  4CYC A;  1ZRD A;  3TO9 A;  4XK4 A;  2WA0 A;  1B72 B;  1MSE C;  1P9Q C;  3FXK A;  4PUS A;  4GCV A;  1E3P A;  2IGN A;  1YX5 A;  2COM A;  3LL7 A;  3M1C A;  2X51 A;  2JSP A;  4X1E A;  2Z33 A;  2ZO4 A;  1PUE E;  1EH7 A;  1Y0U A;  1FSE A;  2FXA A;  3HGG A;  1DQU A;  5HOO A;  1JGG A;  3P7N A;  1GDT A;  2L2O A;  2CUE A;  3TP0 A;  3TDZ C;  4E7J A;  1NG6 A;  4IHV A;  3S2D J;  1NHA A;  4WWC A;  4BBS J;  5F27 A;  2GM4 A;  1W1W E;  2KT0 A;  2RQQ A;  1HBX G;  1T8I A;  1FYL A;  2DT7 B;  3K4C A;  4QWQ A;  4A2U A;  1YI2 I;  3CCV I;  1XCB A;  3HSF A;  3D1N I;  1YO5 C;  2H1K A;  3MZ8 A;  1WWX A;  4HX7 A;  3ZGK A;  4DW6 A;  4U7B A;  1AHD P;  5C3E J;  1KU9 A;  1PYV A;  2VXZ A;  2ESH A;  1Y6I A;  2XF6 A;  3T1B A;  4C9Y A;  4OIO F;  2HQN A;  5DM7 F;  3OSF A;  2IPQ X;  4KMU X;  4AYB N;  4ESB A;  3IH4 A;  2DBB A;  1YRN A;  5GPC A;  5E8I A;  3I71 A;  1YG2 A;  1T33 A;  2XV4 S;  2CH0 A;  3D5L A;  4HA8 A;  3WOD F;  1YE9 A;  4P1W A;  1WGX A;  2DJN A;  2HEO A;  4A3D J;  2IA0 A;  2PQ8 A;  3SFI A;  3ZOB A;  1TQM A;  3GTJ J;  3K4K A;  1IZ1 A;  2B9S A;  2BVM A;  5IT3 A;  5K7F A;  3KLO A;  2Z9O A;  2XF5 A;  4RS8 A;  2ICW G;  1V4R A;  1XSV A;  2DAO A;  2YX4 A;  3H9J A;  4L5J A;  4NB5 A;  4F3Q A;  5HS8 A;  3MZH A;  4AU7 A;  2AXT C;  1R71 A;  1TBX A;  3F8B A;  1QVT A;  1JGS A;  1OCP A;  3LAJ A;  2Q0O A;  2CQ7 A;  2HDW A;  2DXI A;  1UG0 A;  3A4C A;  3WHC A;  1OR7 A;  1RKT A;  4P9F A;  3GTO J;  1TQI A;  2ME6 A;  5E1W A;  5ILV A;  3RI4 A;  1IV6 A;  2LY1 A;  1SFK A;  1P7J A;  3DKX A;  3H9G A;  2ZB9 A;  2OU2 A;  1MJ9 A;  3P9C A;  3CME I;  1WH5 A;  3ABL H;  4AID A;  4Q4Z F;  3ERE D;  2DPU A;  1UB9 A;  1FBQ A;  1MBF A;  2PN6 A;  4PDK A;  4C3H J;  2KFD A;  1FMW A;  5JI6 A;  1OCC H;  2YU3 A;  4LLL A;  5DUI A;  1DU6 A;  4LLG F;  4HW0 A;  4BQN A;  4CUG A;  3OS1 A;  2VQG A;  3OS0 A;  1KU7 A;  3SJM A;  2EA4 A;  2VXD A;  2L4A A;  2ELH A;  3GTK J;  2FQ3 A;  3BC8 A;  3LSG A;  2VOD A;  1Z6R A;  3WTS C;  3VSK A;  1B59 A;  1U3E M;  3K2A A;  4PJN A;  2CV1 A;  4OOI A;  3GUD A;  3OS2 A;  4HV6 A;  3KEO A;  2ZJP F;  1D0X A;  2V9V A;  3BTL A;  2EV5 A;  5TRD A;  1KU3 A;  3S16 J;  4RB1 A;  1KU2 A;  4OIN F;  1ZG3 A;  2O9L A;  3S1N J;  1GHC A;  4WK8 F;  3K0L A;  4BDZ A;  4G8X A;  4RDU A;  4O5V A;  2R4G A;  1G3W A;  3NRV A;  3Q9V A;  2VB6 A;  2A5W A;  2O8X A;  1ZYR F;  2DMU A;  2F5V A;  1J9I A;  1R5I D;  5B5E C;  2LNB A;  4I6Z A;  4KN7 X;  3BR0 A;  3M3Y J;  1UHM A;  1HW2 A;  1D3Y A;  2MC4 A;  2CUF A;  1XGO A;  4C2M J;  4UVA A;  2N8G A;  1FY7 A;  3G4S I;  2HQ5 A;  1T6S A;  4AVP A;  4PCQ A;  5IT9 Z;  1OYI A;  1P4X A;  4BHC A;  3L2C A;  1R36 A;  3U2R A;  4FET A;  1T39 A;  3W2W A;  4YG2 F;  3RTR A;  3OOU A;  1IXS B;  3DF8 A;  4Y13 A;  3JRI A;  1HDD C;  2NVX J;  4LIU A;  4JX5 A;  2CGP A;  1XS9 A;  2KRC A;  5IT9 K;  3BCB A;  4JQF A;  4EVI A;  2FOK A;  1RPW A;  3CDH A;  3E5U A;  2WAQ N;  1DGW Y;  2ZKZ A;  2XB5 A;  3BR6 A;  3E3V A;  2HI3 A;  4PSX A;  1YHQ I;  2MLG A;  1XGN A;  3B73 A;  3TKY A;  3E97 A;  2XAJ A;  2QEX I;  2L9S A;  2XKO A;  3JR9 A;  3LSK A;  4A3M J;  2QSH X;  4KIG A;  5E20 A;  2P0W A;  1VQN I;  4L0Y B;  2KRH A;  1QPM A;  2LG4 A;  3JRB A;  4RGR A;  2V79 A;  2F5C A;  1P2F A;  1E17 A;  2P5L C;  1WPK A;  3AKZ A;  5FLX Z;  4YFN F;  2R7T A;  4MO7 A;  3FMQ A;  1YJW I;  5ICE A;  2L4M A;  5E8G A;  2HPI A;  1MH3 A;  3BG9 A;  3DXJ F;  1KA8 A;  2V9K A;  3BWG A;  1UEL B;  4CCN A;  3CO7 C;  3ELK A;  3MKY B;  2IA1 A;  3IC7 A;  1MJA A;  3Q9S A;  1I3Q J;  5KNL A;  1WSU A;  1YIJ I;  2DMP A;  4BHP A;  1VQM I;  3OWT A;  2CUJ A;  3ZMD A;  5F04 A;  3P5J A;  1T0F A;  2VE9 A;  4II2 A;  3VDX A;  2Y48 A;  4XRS G;  4ABZ A;  1XN7 A;  5IP9 J;  2VPR A;  3TOB A;  4BQA A;  2LOO A;  3QOE A;  2F4M B;  2F48 A;  2L9N A;  2CUZ A;  4XN3 A;  1K4T A;  3TMO A;  3PL8 A;  3FBI B;  3MVP A;  3ULQ B;  2HPM A;  1W36 C;  3HHH A;  1ZTR A;  3CMM A;  2KZV A;  5EZG A;  4I09 A;  3ZMT A;  1T08 B;  1VND A;  1N77 A;  3ROU A;  1EKE A;  1G2H A;  3BG6 A;  4WXD A;  1C0W A;  4F93 B;  2HZT A;  2FQ4 A;  1LEB A;  1W5S A;  2I5U A;  1QQI A;  5EGO A;  2XAG A;  2X6X A;  2JUG A;  2RN7 A;  4PSW A;  3VYS B;  1FEX A;  2IRF G;  2CMP A;  1OCO H;  3C7J A;  2QQA A;  1UG2 A;  1Y8R B;  1QBJ A;  2Y69 H;  2MC3 A;  3GEZ A;  3ABM H;  3ZMV A;  5K7Z A;  3J80 Z;  3OY9 A;  1A5J A;  3OYM A;  2R5Z B;  1OYW A;  4KT5 C;  2LLK A;  2ZXW H;  1N78 A;  1IG7 A;  3CCE I;  2M9H A;  3K69 A;  1W7P D;  3QRF F;  2ESN A;  3DEW A;  2KJC A;  2VUM J;  3ZN0 A;  3LQR A;  1HF0 A;  3HOZ J;  2XDV A;  2CW7 A;  2FD5 A;  2JVH A;  2TDX A;  1XSD A;  1J59 A;  1YRN B;  3L2W A;  4R79 A;  2H8R A;  5EEA A;  1E3H A;  1SC7 A;  5D5V B;  3KX2 A;  3EUH C;  3I59 B;  1LFP A;  4IRG A;  3DPU A;  1APL C;  3KCC A;  2Y9Y A;  2KP6 A;  1L0O C;  2QBY B;  3QU3 A;  3GTM J;  4A93 J;  2E1O A;  1H8A C;  1T38 A;  1RR7 A;  1F9N A;  3HPG A;  3BG5 A;  1XD7 A;  2WAD A;  4XOR A;  2JA7 J;  2E2I J;  3F6V A;  3H9Q A;  2VE8 A;  5LGT A;  4NC6 A;  1IJW C;  4HPQ A;  1QZY A;  3CCQ I;  2H1L A;  3S1Q J;  2B7E A;  1LB2 A;  4Y33 A;  3Q0W A;  5EF6 A;  3RKX A;  3PUB A;  3LSR A;  5J4Y A;  3L2R A;  4KJZ A;  3K4N A;  3I0T A;  2F4I A;  3WTT C;  2KZG A;  5B1B H;  4M3G A;  5IYB J;  2X0L A;  5K5Q A;  3F9K A;  4BKX A;  5J1R A;  4U0Y A;  3WGG A;  4ESJ A;  2W57 A;  5HLH A;  3RCO A;  3DBH B;  4K2E A;  5FFX A;  4UY8 I;  4FE7 A;  1T0F C;  2DFF A;  4Y4R A;  2D2W A;  4HDV A;  2A6E F;  3BZC A;  2LY9 A;  4XMY A;  4XSX F;  3VOD A;  2GIZ A;  5H6R A;  4BE2 A;  1WH7 A;  1W4M A;  3QPH A;  4IL6 C;  2EIK H;  1R22 A;  1UFM A;  2A61 A;  3ERM A;  3NEU A;  5A2Q Z;  4M9X A;  4V2G A;  2R92 J;  3BZ6 A;  2AQE A;  3COA C;  3AG3 H;  2W00 A;  4ZJZ A;  1XGM A;  1VQL I;  2BY2 A;  1ZRC A;  2F5F A;  3Q5F A;  1D1C A;  2V26 A;  2BEO A;  2RQP A;  1S8N A;  3EUK L;  1K79 A;  2L9R A;  2OCE A;  3G71 I;  2O03 A;  2QKL B;  1GVD A;  4A3K J;  2V7F A;  3QP5 A;  1VQK I;  5DDG A;  2LVS A;  2W48 A;  2X85 A;  3VYR B;  3S8P A;  2DOE A;  2AHQ A;  4OMZ A;  4YFK F;  3T8R A;  3WTU C;  1OIS A;  2AO9 A;  1XSX A;  2DMN A;  3I55 I;  2R7D A;  1ZQ3 P;  1A04 A;  3GFM A;  3LST A;  1TWG J;  3CJN A;  1HCR A;  3CCR I;  2GLO A;  5D8K B;  2UWM A;  5HOD A;  3BJ6 A;  2M1B A;  2Y31 A;  5LEK A;  1X19 A;  2DQL A;  4KFC A;  2DA5 A;  1H9G A;  3TO6 A;  5J1U A;  1PP8 F;  4A3L J;  2ZXH A;  1BI1 A;  3IAM 2;  4M6X A;  4BE0 A;  1K6O A;  3WGI A;  5FKL A;  1ULY A;  1Y0N A;  2JA5 J;  2V4J C;  4HNU A;  3HKZ N;  2ZCW A;  4W1U A;  3H92 A;  1MMD A;  3I4P A;  1LVK A;  2IVM A;  4LIV A;  1LUJ B;  2DOD A;  5LHH A;  4A3E J;  4BHB A;  2WC2 A;  2DU9 A;  1I39 A;  3OR1 C;  2VQH A;  3EYY A;  1XMK A;  2FA5 A;  3OMY A;  2O3F A;  3GX4 X;  2NOJ B;  1VQ5 I;  4HV5 A;  2ZXI A;  2VBZ A;  1MD0 A;  2LK2 A;  2MD0 A;  1CF7 A;  1IUY A;  1RRJ A;  3PSI A;  1VQ7 I;  3LA3 A;  2R3S A;  1JKO C;  3CCU I;  4RGS A;  2L3D A;  4P5O A;  5EJC A;  2Z3Y A;  2GBY A;  3DP7 A;  4Q5S F;  1FOK A;  2ZME C;  4MTD A;  1WVR A;  3DPL C;  1UAA A;  4EJT A;  2A6H F;  3KP2 A;  4YEJ A;  4DJA A;  3PJR A;  4CCM A;  5JVT A;  2F2E A;  3F0C A;  2EV0 A;  4HAM A;  4D0P A;  3L1P A;  4G7Z F;  2V6E A;  5HNF A;  4IEJ A;  1VI0 A;  2W85 A;  2BW3 B;  4UB6 C;  5K1Y A;  3E5X A;  2P6S A;  4N0B A;  1BC7 C;  4I0A A;  4EJW A;  2ECC A;  2KPM A;  1WJ5 A;  3IKT A;  1FOW A;  1H89 C;  4EM0 B;  1FNN A;  2EK5 A;  1GT0 C;  2PMH A;  4I0B A;  4XID A;  1LFU P;  1QGP A;  1ETQ A;  2XPW A;  5IY5 H;  2CWE A;  4UV9 A;  5B1A H;  2R7Q A;  4IQ4 A;  2NVY J;  2PLY A;  5IPA A;  4DYC A;  5D4R A;  1HXD A;  2DT5 A;  2LYC A;  3C2H A;  3V42 A;  1ZHF A;  2ID6 A;  2KDO A;  1R5H A;  1QA6 A;  3FM5 A;  1TQP A;  3EDP A;  3QQA A;  4PFO A;  2EFW A;  1PP7 U;  5C4J J;  5CVV A;  2Y0S N;  1VTN C;  4IHS A;  3IV5 A;  4F7Z A;  3K4M A;  1U5T A;  4Y3O A;  2BBY A;  3GXO A;  4JBA A;  4B48 A;  1SEU A;  1TLH B;  3H3Z A;  2IS1 A;  2XGC A;  2UZK A;  4G12 A;  4W97 A;  4MTE A;  5JHU A;  2MAB A;  1GV5 A;  3S15 J;  2WV0 A;  2HKO A;  5FRO A;  4C3I J;  1M1E B;  2K7L A;  3DEU A;  2PMU A;  1O3Q A;  1YLF A;  1XMX A;  3MFK A;  2CW0 F;  3GTL J;  3BR3 A;  1IN7 A;  1BN5 A;  5D8L B;  4V2F A;  3FXL A;  5E1Z B;  2CFX A;  2EJR A;  3DTI A;  4GYG A;  3GYH X;  2TRT A;  2KQR A;  4L9N A;  4DZJ A;  2OCC H;  2IA2 A;  3HOU J;  3PNV A;  5GAH J;  5LLQ A;  2W84 A;  4MNU A;  5IYC J;  1A35 A;  3WTZ A;  2CO5 A;  5DD4 A;  3SZG A;  1HA8 A;  2L7K A;  4E6K G;  4ZZD A;  2HZD A;  2L54 A;  2HOT A;  1IDY A;  3RIR A;  4ASN A;  2YPR A;  3IH3 A;  1Z0X A;  2XF7 A;  3PFI A;  4MQ9 F;  3TW7 A;  1IXR C;  3V7C A;  5D5U B;  2W7N A;  3QPT A;  4BBR J;  3C2B A;  2DK8 A;  2VOP A;  1QZZ A;  2DT6 A;  1V54 H;  3CF5 F;  2V1D A;  3S3M A;  4BXU A;  1JTX A;  3BDD A;  2VT3 A;  4ZYG A;  3T8T A;  1REP C;  5H2F C;  3MQ0 A;  2K9Q A;  2BY0 A;  2JT1 A;  5K5R A;  2GXA A;  1MMS A;  3ZXS A;  3CD6 I;  3NWS A;  3ONQ A;  3WTV C;  3HL2 A;  2BW3 A;  1VZ0 A;  1DUX C;  3HHG A;  3RYR A;  2NAZ A;  3F21 A;  2UXN A;  1X2N A;  2BY1 A;  4HLX A;  3S32 A;  2JVG A;  3KEY A;  4DQ2 A;  3E7L A;  3V4G A;  4MFD A;  2EZI A;  1ON2 A;  1Y39 A;  2A68 F;  4P9U A;  3KE2 A;  4DBR A;  1SFE A;  1BOA A;  3I59 A;  1USS A;  2IBD A;  2XGD A;  3RPU D;  4UXN A;  4UUS A;  3ISP A;  2EZH A;  3A0H C;  5E3L A;  4LOC A;  2UXX A;  1FBU A;  2IGO A;  3MCZ A;  2VPL A;  3WG7 H;  2DA6 A;  5HLT A;  1QPI A;  2CW8 A;  3AG1 H;  5DCF A;  3LFK A;  4EEF G;  1SD4 A;  2M7B A;  3DQV C;  3ESW B;  3KP4 A;  2J5O A;  1W0T A;  2CQN A;  3DKW A;  2GXB A;  3LMM A;  1FT9 A;  2X48 A;  4ZYD A;  1O3T A;  3OL3 A; 
#chains in the Genus database with same CATH homology
 3CTA A;  2GZW A;  3R61 A;  1U5T B;  3VEP A;  2QQB A;  3WTX C;  1ON1 A;  1ZGJ A;  2C6Y A;  4RAZ A;  4LB5 A;  3PQK A;  2A69 F;  3GVA A;  2M30 A;  4B09 A;  2H94 A;  4KDP A;  2W24 A;  2QQ9 A;  1Z1D A;  2VC1 A;  4HBL A;  3SHF A;  1GVJ A;  1Q1H A;  1BBY A;  5ICG A;  3J81 K;  5KK1 A;  1YYV A;  2Q8K A;  4ZZL A;  5LBQ A;  3F8N A;  1SMT A;  3P9I A;  4GYI A;  1JHF A;  1Z05 A;  3MWM A;  1J7K A;  3LWF A;  1R1V A;  1J0R A;  3SZT A;  2RDP A;  1XCV A;  1FP2 A;  3FMS A;  4M71 A;  2L02 A;  5D6E A;  2MD5 A;  1IN4 A;  4WXC A;  4EJU A;  2RV8 A;  1WRJ A;  5L3D A;  4Y15 A;  4CGZ A;  1YW9 A;  2XGX A;  2P7C B;  3C1D A;  1QNT A;  3KZZ A;  3F22 A;  3FHZ A;  5DUK A;  4ZH4 F;  2CYY A;  1P4A A;  1S3J A;  5D4S A;  3M8E A;  1RNL A;  5CYV A;  5E17 F;  1SFU A;  4LFU A;  3GW2 A;  3QU6 A;  1I27 A;  1WKM A;  1FLI A;  1KYZ A;  1TNS A;  2JZY A;  5DYM A;  3RJP A;  5LGN A;  3RPQ A;  4I98 B;  3MZY A;  3D0S A;  4LD5 A;  3W6J B;  3KLN A;  1EV7 A;  1TW2 A;  1X3U A;  2VBX A;  1IN8 A;  2OZ6 A;  3BP8 A;  3E6D A;  3BJA A;  2O6G E;  1V3F A;  1R1U A;  2VBW A;  3K1N A;  4AIK A;  3FMR A;  2HDC A;  3KP3 A;  4S05 A;  1DPR A;  1ODD A;  4XLN F;  2EFN A;  3V7R A;  1IRG A;  4N9H A;  4U88 A;  1PDN C;  1IN6 A;  1STZ A;  3C3W A;  4RGX A;  4A6E A;  1E2X A;  3WTY C;  5DD8 A;  1ZAO A;  1BI3 A;  5AIP A;  5FLX K;  1WI9 A;  4FT8 A;  4PGH A;  5FD5 A;  2HYG D;  1D8J A;  5HDK A;  2W25 A;  4EM1 A;  2IJL A;  3PQJ A;  5LHG A;  3GFJ A;  4XBF A;  2L01 A;  1I6X A;  3KEQ A;  5DEQ A;  2XKP A;  5DV5 A;  3ABT A;  3F8M A;  4M74 A;  4EMS A;  1GXQ A;  5DCM B;  4RB2 C;  1D5V A;  3E5Q A;  3SFZ A;  2G9W A;  3GWZ A;  2HQR A;  4JK1 X;  1P4W A;  1MJB A;  1G6N A;  2HOE A;  4A5N A;  3BOQ A;  3RDI A;  2GA1 A;  4CYD A;  4UVB A;  2FBH A;  4ENM A;  1G4D A;  1EH6 A;  1LDD A;  4HX4 A;  4HQE A;  3I54 A;  1U5T C;  3LQQ A;  5HS9 A;  3HOS A;  1UHW A;  3SZP A;  5BPD A;  2QYO A;  4HOB A;  1FX7 A;  3V8L A;  5H20 A;  2HFH A;  3CO6 C;  1BC8 C;  2HTJ A;  3E6M A;  4XSZ F;  2ADU A;  4PZJ A;  1JE8 A;  4G6Q A;  4NQW A;  5F6F A;  4KIB A;  3HRS A;  4CIC A;  2KKO A;  1FWZ A;  3BPV A;  1AWC A;  4UHT A;  3C18 A;  1FZP B;  5TJJ A;  4M72 A;  2CSO A;  4IF4 A;  2ZME A;  2JPC A;  2X4H A;  2ZJ2 A;  3QAH A;  4ENN A;  1RUO A;  2LSO A;  2H6C A;  4U0W A;  1DP7 P;  1SD7 A;  3K1M A;  2EFO A;  4R8H A;  2GIV A;  2BV6 A;  1KQ0 A;  2KJB A;  3EQL F;  3CUQ C;  2VBY A;  4ZYH A;  2VT2 A;  2IT0 A;  1ZGA A;  5FFZ A;  4WCG A;  4L0Z B;  3BPX A;  2Y0M A;  1SD6 A;  3V7S A;  2ACJ A;  1J5Y A;  3ECH A;  5L3G A;  4KMF A;  3SXY A;  3I64 A;  2HTS A;  4FX4 A;  1DPU A;  4A0X A;  2V6C A;  4IXA A;  5HLI A;  1O7L A;  1ZN2 A;  2FRH A;  3ZP5 A;  4Z2Y A;  3U1D A;  3EYI A;  4EJV A;  1IN5 A;  5L3B A;  1ONV A;  3LAP A;  1G3Y A;  1OPC A;  2QBY A;  3F8C A;  1B9N A;  3I53 A;  1YW8 A;  1MKM A;  3TDU C;  1I1G A;  5F64 A;  3HRT A;  3J80 K;  2STW A;  3VB2 A;  3N4M A;  1BI2 A;  4L9J A;  4L5I A;  1ZLJ A;  3N97 A;  3HUG A;  1ZLK A;  1W7P B;  2F5D A;  4H0E A;  3T5X A;  2ZME B;  4HDU A;  4P96 A;  4DNC A;  3E6C C;  3HTS B;  2FSW A;  3F3X A;  2F5E A;  4U0V A;  2FNA A;  4I01 A;  2E7X A;  2O0Y A;  2RVC A;  1UCR A;  2FBI A;  2H27 A;  3HSR A;  4LK1 F;  3T0Y A;  4KYW A;  1YS6 A;  2DQR A;  1Z91 A;  3ZMS A;  4UVC A;  4CXF A;  1XMA A;  3LA2 A;  3DPT A;  1ZG5 A;  2VOO A;  1XGS A;  2V1X A;  2K4B A;  2EFQ A;  4O6J A;  1R23 A;  2PJP A;  4LJZ F;  2E1C A;  2XRN A;  3TQN A;  5D6F A;  1B6A A;  2VC0 A;  2DLL A;  3OV8 A;  5DCM A;  2A5Y B;  3MEX A;  1MDM B;  3KZY A;  3JSO A;  4FX0 A;  2GWR A;  4YFX F;  5LHI A;  5A2Q K;  5L3E A;  1CGP A;  4HQM A;  3CUO A;  1EH8 A;  3HTU A;  3G3Z A;  1LNW A;  1MZB A;  2OQR A;  3ML6 A;  2QVO A;  3ZMU A;  2V1U A;  2PBI A;  4WF2 A;  5J6X A;  1O57 A;  2H09 A;  1S7O A;  3K9T A;  4L9T A;  3M7G A;  1TTY A;  3GLX A;  4TV7 A;  1BIA A;  2WWY A;  3BRO A;  4HX8 A;  4A5M A;  2JSC A;  5CVR A;  2ZXJ A;  1JHH A;  3CUQ B;  1IRF A;  2P5K A;  1HST A;  2D1H A;  3GZ5 A;  2K27 A;  2BGC A;  3IKV A;  2JPB A;  2XVC A;  5L3C A;  3EUH A;  3M9A A;  2EFP A;  3IWZ A;  4MGR A;  1Z7U A;  2KIM A;  1RIO H;  1HKS A;  2MLK A;  3F72 A;  1W5T A;  5H6Q A;  1RUN A;  4AWX B;  4XLP F;  2XAQ A;  1YS7 A;  1ZRF A;  4BAY A;  2D1V A;  1G3T A;  5FGM A;  1ZH5 A;  2XUB A;  2HR3 A;  1BIB A;  1K78 A;  4RB3 C;  2RNJ A;  1P92 A;  2P7V B;  1ZRE A;  1S6L A;  1XDU A;  2QWW A;  1J75 A;  2VON A;  1B9M A;  3R60 A;  2DO7 A;  4YII A;  2MA3 A;  4WX9 A;  1KQ9 A;  1FBS A;  1U8R A;  2DTR A;  1KYW A;  1S29 A;  2P4W A;  1K7A A;  3J81 Z;  4CHU A;  3JAM K;  4O3M A;  3F23 A;  4M9S A;  4NHJ A;  1GXP A;  1ZG1 A;  5HDG A;  5BOX A;  4LMY A;  2ETH A;  1XDS A;  4LG0 A;  1CF7 B;  4GGG A;  3JAM Z;  3FF5 A;  3V8K A;  4KN4 X;  3RKW A;  2P6T A;  5D5X B;  2EA2 A;  2XAH A;  4EJO A;  4E70 A;  4BNC A;  5ILU A;  4XRF A;  4KIC A;  2LKP A;  2PI0 A;  3V8J A;  2FML A;  2GA2 A;  4MEX F;  3L09 A;  2NS0 A;  5FB2 A;  3RPU A;  2Q2E A;  1SMY F;  1LVA A;  4YIF A;  3ZN1 A;  4P55 A;  1O3S A;  3F6O A;  2HYF A;  5ICC A;  1SAX A;  3GF2 A;  2G7H A;  2D45 A;  1LDJ A;  2HKX A;  1R00 A;  2FEZ A;  2HWV A;  3HRU A;  4HYE A;  4R1H A;  5LRR A;  5JR3 A;  1RI7 A;  3AAF A;  2EWN A;  2RKH A;  4EGY A;  1YFH A;  2VN2 A;  3R4K A;  3P9K A;  3DFG A;  1OYY A;  3O6B B;  2OQG A;  4LK0 F;  4CZZ A;  2M5W A;  5HS7 A;  3L00 A;  4KUM A;  2BE5 F;  2IP2 A;  3TOA A;  1J2X A;  3IRR A;  2JRT A;  3B02 A;  5L3F A;  1IW7 F;  2YR2 A;  1BM9 A;  5EEG A;  3ZPL A;  1U2W A;  3MAJ A;  2E1N A;  3JTG A;  1D8K A;  4IJA A;  4G7H F;  3ZQ7 A;  1R7J A;  4MEY F;  4OU0 A;  3ECO A;  3CLO A;  5CVI A;  4A0Z A;  4A0Y A;  3LA7 A;  3FXU A;  4OIQ F;  5E1X A;  5E18 F;  3EET A;  3WE2 A;  4IRI A;  5ILS A;  1MGT A;  2EB7 A;  4I2O A;  3IL2 A;  1B4A A;  3TGN A;  3JW4 A;  1P6R A;  5ED4 A;  2Z99 A;  3I5U A;  1FYM A;  2O61 A;  2LDU A;  2ZNY A;  1U78 A;  2QEN A;  3GFI A;  2Y75 A;  2QM3 A;  2RC4 A;  1F4K A;  4MQV A;  2KIU A;  1F1Z A;  3G73 A;  2A07 F;  1LDK B;  2G7U A;  4EGZ A;  2M45 A;  1W7P A;  1G3S A;  1H0M A;  3FZV A;  1T98 A;  3O2P E;  2FBK A;  1YTY A;  5ICF A;  4LGW A;  1KGS A;  1BI0 A;  4UUV A;  5HVQ C;  4HLY A;  2NNN A;  5CVU A;  2OA4 A;  2DPD A;  3IRQ A;  2YSR A;  3HYI A;  3FXR A;  5LEJ A;  4IRH A;  3KFW X;  2IW5 A;  4AD9 A;  4CO8 A;  4G94 A;  4Y17 A;  4BH9 A;  4AIH A;  4L9V A;  4EQQ A;  1ZAR A;  1HW1 A;  3BY6 A;  2GQQ A;  1RZ4 A;  5LGU A;  3ABU A;  6PAX A;  2FF4 A;  3SQN A;  3WTW C;  2DK5 A;  2OAZ A;  1KQ8 A;  4OIP F;  3KP6 A;  2LF7 A;  1T2K A;  5AIQ A;  1BJA A;  3K2Z A;  2NYX A;  1O7F A;  2FNP A;  3WE3 A;  4IHT A;  1HKT A;  2WTE A;  4KNY A;  4ENJ A;  4RB0 A;  3HIF A;  2YX7 A;  1HW5 A;  4RAY A;  4ON0 A;  2AXL A;  3IHU A;  4M73 A;  5J8C A;  3VOE A;  3QP6 A;  2EV6 A;  5CVJ A;  1FC3 A;  1I5Z A;  3FX3 A;  3F8F A;  4RGU A;  1UST A;  1IAW A;  2Z5U A;  4B8X A;  4OIR F;  3WU0 A;  5BS6 A;  2DI3 A;  4G7O F;  4HF0 A;  3NQO A;  3OOP A;  3J7A O;  5F1R A;  2DW4 A;  2XRO A;  4QLC U;  4EM2 A;  1LEA A;  3TO7 A;  3HRM A;  4Q47 A;  4UNO A;  2CQK A;  2K86 A;  2ZBK A;  5HLG A;  1XB4 A;  3RYP A;  5D5W B;  2OD5 A;  3FM3 A;  5J8F A;  4Q48 A;  1L3L A;  4G9Y A;  2PG4 A;  4EV0 A;  1FSH A;  4U7D A;  4IPA A;  5EEH A;  1WQ2 A;  3KP5 A;  3R0A A;  2OBP A;  4AIJ A;  2ISZ A;  1HQC A;  4LB6 B;  3R6S A;  3JSP A;  4L18 B;  4KIF A;  2A3S A;  2M8E A;  4A6D A;  3QOP A;  5CJ9 A;  3GO5 A;  3WG9 A;  2ISY A;  4HF1 A;  4S04 A;  3R0J A;  4ETS A;  4UV8 A;  2M87 A;  4A12 A;  1LQ1 A;  5JFR A;  3BJO A;  3VFZ A;  2PEX A;  4FHT A;  2FU4 A;  3WU1 B;  5AON A;  2P8T A;  1SFX A;  2H6B A;  3KET A;  2XHK A;  3M1E A;  3ZMZ A;  3FWE A;  4G6D A;  2XAS A;  4OMY A;  4GXO A;  1QO0 D;  5BMZ A;  3IWF A;  2K02 A;  4LG0 B;  1HKQ A;  2KIF A;  4ZYE A;  3M8F A;  2QLZ A;  4WXH A;  1FP1 D;  1YW7 A;  3JTH A;  4M9Z A;  2XIG A;  3I58 A;  4MHG A;  2LF8 A;  5CLS A;  4LLN A;  1F5T A;  3HSE A;  1K78 B;  4CDG A;  5LRS A;  5BPI A;  3DV8 A;  2MBF A;  4IVN A;  3W6K B;  2MH2 A;  2NRA C;  2BYV E;  1S7A A;  1YIO A;  2JTV A;  2QZ8 A;  3L9F A;  2CG4 A;  5BQT A;  1HSJ A;  1B1B A;  3H3U A;  2QUF A;  4M6Y A;  2STT A;  1AOY A;  1Z9C A;  1SD5 A;  1R58 A;  2DFI A;  5KVR A;  4BYY A;  4I02 A;  4ESF A;  2KRF A;  1IF1 A;  1YQA A;  3O3K A;  4I7H A;  2J5P A;  1Z6T A;  2PFB A;  3FXQ A;  4PGG A;  4ENK A;  2ZFW A;  3WGH A;  3HOT A;  1FPQ A;  3GZ6 A;  1R5G A;  1IXC A;  2OZU A;  2E7W A;  1U6G A;  1MDM A;  2AS5 F;  5HDN A;  4GO1 A;  2GAU A;  5ERI A;  4KA4 A;  2B0L A;  1JXS A;  3KP7 A;  5K5O A;  2NNY A;  2ZNZ A;  3E6B A;  1O3R A;  2P5V A;  2GXG A;  1FYK A;  1LJ9 A;  4HF2 A;  2HS5 A;  2HGC A;  2RGV A;  3K1P A;  1R1T A;  4N9I A;  3RKY A;  2MH9 A;  5FD6 A;  1OMI A;  5FO5 A;  2R7F A;  2K4J A;  1H9T A;  1TW3 A;  1DDN A;  3REO A;  3L7W A;  2FE3 A;  2FMY A;  2XAF A;  3GFL A;  1OKR A;  3CUQ A;  3S2W A;  1I1S A;  4HZF A;  1TNT A;  3U9G A;  1ZRD A;  3TO9 A;  4GCV A;  2COM A;  1PUE E;  2Z33 A;  2ZO4 A;  1EH7 A;  1Y0U A;  1FSE A;  2FXA A;  5HOO A;  3P7N A;  3TDZ C;  1NHA A;  4WWC A;  1HBX G;  1FYL A;  4QWQ A;  4A2U A;  1XCB A;  3HSF A;  1YO5 C;  1WWX A;  4HX7 A;  4U7B A;  1KU9 A;  2VXZ A;  2ESH A;  3T1B A;  4OIO F;  2HQN A;  2IPQ X;  4KMU X;  4ESB A;  2DBB A;  5E8I A;  3I71 A;  1YG2 A;  2XV4 S;  3D5L A;  4HA8 A;  3WOD F;  2HEO A;  2IA0 A;  2PQ8 A;  1TQM A;  1IZ1 A;  5IT3 A;  3KLO A;  2Z9O A;  4RS8 A;  1V4R A;  1XSV A;  2DAO A;  2YX4 A;  4L5J A;  4NB5 A;  5HS8 A;  3MZH A;  1TBX A;  3F8B A;  1JGS A;  3LAJ A;  2Q0O A;  1OR7 A;  4P9F A;  1TQI A;  5ILV A;  5E1W A;  3RI4 A;  3P9C A;  2OU2 A;  1MJ9 A;  3ERE D;  4Q4Z F;  2DPU A;  1UB9 A;  1FBQ A;  2PN6 A;  4PDK A;  5JI6 A;  2YU3 A;  4LLL A;  5DUI A;  4LLG F;  4HW0 A;  1KU7 A;  2EA4 A;  2L4A A;  2ELH A;  2FQ3 A;  2VOD A;  1Z6R A;  3WTS C;  1B59 A;  1U3E M;  4OOI A;  3GUD A;  4HV6 A;  3KEO A;  2V9V A;  2EV5 A;  5TRD A;  1KU3 A;  4RB1 A;  1KU2 A;  4OIN F;  1ZG3 A;  1GHC A;  4WK8 F;  3K0L A;  4G8X A;  4O5V A;  1G3W A;  3NRV A;  3Q9V A;  2O8X A;  1ZYR F;  1J9I A;  2LNB A;  4KN7 X;  1UHM A;  1HW2 A;  1D3Y A;  1XGO A;  4UVA A;  1FY7 A;  5IT9 Z;  1T6S A;  4AVP A;  4PCQ A;  1OYI A;  1P4X A;  4BHC A;  3L2C A;  1R36 A;  3U2R A;  1T39 A;  4YG2 F;  3RTR A;  1IXS B;  3DF8 A;  4Y13 A;  2CGP A;  5IT9 K;  4JQF A;  4EVI A;  2FOK A;  3CDH A;  3E5U A;  2ZKZ A;  3E3V A;  2MLG A;  1XGN A;  3B73 A;  3TKY A;  3E97 A;  2XAJ A;  2XKO A;  4KIG A;  5E20 A;  4L0Y B;  1QPM A;  4RGR A;  2V79 A;  2F5C A;  1P2F A;  1E17 A;  2P5L C;  5FLX Z;  4YFN F;  3FMQ A;  5ICE A;  2L4M A;  5E8G A;  3DXJ F;  1KA8 A;  3BWG A;  3CO7 C;  3ELK A;  2IA1 A;  3IC7 A;  1MJA A;  3Q9S A;  1WSU A;  4BHP A;  3ZMD A;  1T0F A;  2VE9 A;  2Y48 A;  1XN7 A;  4BQA A;  3TOB A;  3ULQ B;  3HHH A;  4I09 A;  3ZMT A;  3ROU A;  4WXD A;  1C0W A;  2HZT A;  1LEB A;  1W5S A;  1QQI A;  2XAG A;  2RN7 A;  2IRF G;  3C7J A;  2QQA A;  1QBJ A;  3ZMV A;  2MC3 A;  3GEZ A;  3J80 Z;  1OYW A;  4KT5 C;  3K69 A;  1W7P D;  3QRF F;  2ESN A;  2KJC A;  3ZN0 A;  3LQR A;  1J59 A;  2TDX A;  1XSD A;  4R79 A;  5D5V B;  3I59 B;  4IRG A;  3KCC A;  1L0O C;  2QBY B;  3QU3 A;  1T38 A;  1F9N A;  1XD7 A;  3F6V A;  2VE8 A;  5LGT A;  1QZY A;  1LB2 A;  3RKX A;  3I0T A;  3WTT C;  5K5Q A;  2X0L A;  4U0Y A;  3WGG A;  4ESJ A;  2W57 A;  5HLH A;  4K2E A;  5FFX A;  2D2W A;  4HDV A;  2A6E F;  4XSX F;  3VOD A;  5H6R A;  1W4M A;  3QPH A;  1R22 A;  1UFM A;  2A61 A;  3NEU A;  5A2Q Z;  4M9X A;  3BZ6 A;  3COA C;  1XGM A;  1ZRC A;  2F5F A;  3Q5F A;  2BEO A;  2RQP A;  1S8N A;  1K79 A;  2O03 A;  3QP5 A;  5DDG A;  4OMZ A;  4YFK F;  3T8R A;  3WTU C;  1XSX A;  2R7D A;  1A04 A;  3GFM A;  3LST A;  3CJN A;  5D8K B;  2UWM A;  3BJ6 A;  2M1B A;  5LEK A;  2DQL A;  4KFC A;  1H9G A;  3TO6 A;  1PP8 F;  1BI1 A;  4M6X A;  1K6O A;  3WGI A;  1ULY A;  2ZCW A;  3H92 A;  3I4P A;  2IVM A;  5LHH A;  4BHB A;  2WC2 A;  2DU9 A;  3EYY A;  1XMK A;  2FA5 A;  2O3F A;  3GX4 X;  4HV5 A;  1MD0 A;  2VBZ A;  1CF7 A;  1IUY A;  3LA3 A;  2R3S A;  4RGS A;  2L3D A;  4P5O A;  2Z3Y A;  3DP7 A;  4Q5S F;  1FOK A;  4MTD A;  3DPL C;  4EJT A;  2A6H F;  3KP2 A;  5JVT A;  2F2E A;  4D0P A;  2EV0 A;  4HAM A;  4G7Z F;  2W85 A;  5K1Y A;  3E5X A;  2P6S A;  4N0B A;  1BC7 C;  4I0A A;  4EJW A;  3IKT A;  4EM0 B;  1FNN A;  2EK5 A;  2PMH A;  4I0B A;  1QGP A;  2CWE A;  4UV9 A;  2PLY A;  5D4R A;  1HXD A;  2DT5 A;  1ZHF A;  1R5H A;  3FM5 A;  1TQP A;  3EDP A;  2EFW A;  1PP7 U;  5CVV A;  4IHS A;  1VTN C;  4F7Z A;  1U5T A;  2BBY A;  3GXO A;  4JBA A;  1TLH B;  3H3Z A;  2UZK A;  4MTE A;  5JHU A;  2WV0 A;  2HKO A;  2K7L A;  3DEU A;  2PMU A;  1O3Q A;  1YLF A;  3MFK A;  2CW0 F;  1IN7 A;  1BN5 A;  5D8L B;  5E1Z B;  2CFX A;  2EJR A;  4GYG A;  3GYH X;  4L9N A;  2IA2 A;  5LLQ A;  2W84 A;  4MNU A;  3WTZ A;  2CO5 A;  5DD4 A;  4ZZD A;  2L54 A;  3RIR A;  4ASN A;  2YPR A;  4MQ9 F;  3PFI A;  5D5U B;  1IXR C;  3V7C A;  3QPT A;  2DK8 A;  2VOP A;  1QZZ A;  2V1D A;  4BXU A;  3BDD A;  2VT3 A;  4ZYG A;  3T8T A;  1REP C;  3MQ0 A;  5K5R A;  2JT1 A;  3WTV C;  1DUX C;  3HHG A;  3RYR A;  2NAZ A;  3F21 A;  2UXN A;  4HLX A;  4DQ2 A;  3V4G A;  1ON2 A;  2A68 F;  4P9U A;  3KE2 A;  1SFE A;  1BOA A;  3I59 A;  1USS A;  4UXN A;  3ISP A;  2UXX A;  1FBU A;  3MCZ A;  5DCF A;  3LFK A;  1SD4 A;  3DQV C;  3KP4 A;  2J5O A;  2GXB A;  3DKW A;  1FT9 A;  4ZYD A;  1O3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...