1R1UA

Crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor
molecule keywords repressor protein
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 32
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1uA00
3KP3A 4ZH4F 1S8NA 4E70A 4KICA 3ZMVA 1R23A 3J80Z 4S04A 2ZO4A 1FYKA 3L7WA 1ZAOA 4LK0F 4HW0A 3WTWC 4JK1X 2IT0A 1XDUA 1U6GA 2LF8A 3GEZA 5DV5A 3O2PE 2YR2A 5L3DA 2G7HA 4GXOA 3K1PA 3MFKA 5HLGA 1YW9A 1IN8A 2FSWA 2DO7A 4BAYA 5J8FA 3P9KA 1SMYF 3J7AO 2STWA 1HW2A 1XDSA 3GFLA 3T8RA 2DK5A 3KEOA 4KN4X 4KA4A 3FZVA 5LGTA 3MWMA 5E20A 1HQCA 4LG0B 2VODA 2STTA 1UB9A 1LQ1A 3H92A 2K27A 3TOAA 2FBIA 2F5EA 2DQLA 1LEBA 2BYVE 1WI9A 4KT5C 4D0PA 1ZYRF 2DPUA 2DBBA 2XUBA 2VE9A 2DAOA 2E7XA 4KYWA 3JAMK 1MDMA 1XN7A 2E7WA 3ERED 1UHWA 1T98A 1JHFA 4U0WA 2D45A 2Q8KA 2JTVA 3CLOA 3HOSA 3CO6C 2A6HF 5K5OA 4A12A 2K02A 3H3ZA 4B8XA 3KP5A 4RS8A 2HFHA 2DLLA 1YG2A 3HRSA 2QBYB 2MC3A 5CVJA 5KK1A 1REPC 2QZ8A 4Q4ZF 2JPBA 3R60A 4BHPA 2P6SA 5H6QA 3BDDA 2A61A 3KP6A 4YG2F 4M71A 2H27A 3ZP5A 1ZRFA 2VONA 5LHHA 2PMHA 3HSRA 2IA1A 4M6XA 1ZRDA 1A04A 4WWCA 1BBYA 4OIPF 5TJJA 4XLPF 2VT2A 3D5LA 1YO5C 1R1VA 3WTSC 2XAGA 2R3SA 3TDZC 2EFQA 4EMSA 2HKOA 2XKOA 1F9NA 5FB2A 1J75A 1HXDA 1MJAA 1GXPA 4KNYA 4KMUX 4OU0A 2EJRA 1BN5A 1W5TA 1I27A 3BP8A 4HA8A 1GHCA 5JR3A 3KP4A 3T8TA 1QGPA 2UZKA 1FLIA 2HYFA 3EDPA 3ZMSA 2CWEA 3F22A 2WC2A 2Q2EA 3JSOA 3E5XA 3W6JB 3ABTA 1BM9A 1R58A 3MEXA 3E5QA 3IKVA 2V9VA 4ETSA 1SD4A 2XAQA 1BI1A 1TNTA 4LGWA 1ON2A 1XGMA 1P4AA 2ZKZA 2XKPA 1FX7A 1Z7UA 1XSXA 2Z33A 2BEOA 2O3FA 1H9TA 1JXSA 4ENMA 4G6DA 1IN5A 2LF7A 2FBKA 3DQVC 2LDUA 3E6BA 5DD8A 3DKWA 4O5VA 3OV8A 5CJ9A 2EA2A 3F6OA 4HLYA 2EV0A 5FFZA 1P6RA 3R0AA 4BHCA 2NNNA 4KDPA 5FLXK 3KE2A 1D3YA 3M9AA 3FWEA 3KZZA 3LA7A 3SHFA 3ULQB 1ONVA 1FPQA 4BH9A 4R79A 2QYOA 4IRIA 2EB7A 4RB3C 4KIGA 3OOPA 3E97A 1T38A 2M45A 1IZ1A 1DPRA 4F7ZA 4ZYGA 4I09A 2DT5A 4WCGA 1OPCA 1QQIA 4L9VA 2PLYA 2DFIA 4M6YA 3ISPA 3GF2A 3DFGA 1SD7A 2HQNA 4RAZA 5LGUA 1T6SA 3GLXA 3TDUC 2DQRA 2L02A 3C3WA 1IW7F 3V7SA 3DF8A 1ZG5A 2A69F 3DV8A 3WTZA 2KRFA 3I58A 1IUYA 5D5XB 3GW2A 5ICEA 1D8KA 3I59B 4B09A 3F8MA 4LFUA 1T2KA 2ZBKA 3REOA 2L54A 3WG9A 2FRHA 4L0YB 3L09A 3BWGA 3QPHA 1E17A 4AIKA 5HS7A 2EFOA 2D1VA 4A5NA 2XAFA 2ADUA 3B73A 2H94A 3CTAA 1FSHA 1IF1A 4IHTA 3T0YA 3FMRA 2XASA 1KYWA 2R7DA 4BYYA 4O6JA 5EEGA 1YQAA 1XMAA 3PQKA 3QRFF 3KEQA 5ILSA 3L9FA 5FFXA 4G8XA 2XGXA 2COMA 2GIVA 4U7BA 5CVUA 5HOOA 3GYHX 2HTSA 3FMSA 5FLXZ 1RZ4A 3FHZA 1R5GA 4GYIA 3I54A 3BZ6A 4HLXA 2FE3A 1I5ZA 2BBYA 5D4SA 2H6BA 3KLOA 5L3EA 5L3BA 5E1WA 2IVMA 5IT9Z 1R5HA 2KJBA 5ILUA 1EH6A 3LSTA 3BROA 4MTEA 3KP7A 4HQEA 4ZYEA 4XLNF 1D5VA 2GA1A 5H20A 5ICGA 3M7GA 1HBXG 1FC3A 4ENKA 2MLKA 1ZHFA 3HHHA 2A3SA 4EGYA 1S6LA 5HDKA 4PGHA 3V4GA 1OYYA 2NS0A 4G9YA 1FP1D 1TTYA 3HRMA 1Q1HA 5J6XA 1WRJA 3GZ5A 3LQQA 3IWZA 2YPRA 2FNPA 3F23A 4KIFA 2P4WA 2IW5A 2EK5A 1IN4A 4ASNA 4EVIA 3EUHA 1HKTA 3DPTA 2RNJA 1GVJA 1R7JA 4IPAA 3I71A 4AIHA 2IPQX 2MH9A 2OD5A 4LK1F 4I0AA 2NNYA 4IHSA 2ZCWA 4AWXB 4OIOF 3FM3A 4RB1A 3I5UA 4L5JA 4EM2A 1BIAA 3SQNA 3FXQA 3WTXC 2WTEA 2PI0A 6PAXA 4KN7X 1FYMA 1DPUA 1ZGJA 2HKXA 4HZFA 2O03A 3FM5A 4IJAA 3U2RA 3VEPA 3E6MA 5DUKA 4XSXF 2XRNA 4KUMA 1Y0UA 2MLGA 2YU3A 4Z2YA 1LDDA 1OMIA 4YFNF 5BPDA 2KKOA 4ZYHA 2OZUA 1YYVA 3RJPA 4M9SA 1FBUA 2W57A 2VC1A 2IA2A 4P55A 3DPLC 3ZMTA 4IRHA 4HX8A 4HX7A 4XRFA 4L5IA 4A2UA 1FZPB 1W7PD 2QWWA 3HHGA 2NAZA 5FD5A 3I64A 1HSTA 3HTUA 3V7RA 3GZ6A 1NHAA 2P5VA 4M72A 3B02A 5F1RA 3MZHA 3EYIA 2VBYA 3N97A 2ACJA 4UVAA 1TQIA 4EQQA 2XAHA 3MCZA 3COAC 4GGGA 2UWMA 1DUXC 3VFZA 3NQOA 3EQLF 3ZMZA 2HR3A 2CO5A 4P9FA 3J81Z 4PDKA 5E8IA 1I1GA 4OMZA 5D6FA 4WX9A 2P6TA 4WXCA 1LEAA 1AOYA 2FMLA 2O0YA 4LLGF 1Z6TA 4RGSA 4LJZF 3KZYA 4I2OA 4MTDA 4CGZA 4N9IA 1RI7A 4U88A 2M30A 5BPIA 1LB2A 4P9UA 3M1EA 1SFEA 1W7PA 1IRFA 1G3WA 4JBAA 2Z99A 3WTYC 3ROUA 3RTRA 2OBPA 2PFBA 3NRVA 3CUQB 2PQ8A 2QLZA 2JZYA 3KCCA 3CUOA 2QVOA 2W24A 5L3GA 4CZZA 2KIMA 1K6OA 2VBZA 1O3SA 4R1HA 4L9JA 4XSZF 4HYEA 3QAHA 4OIRF 1Z9CA 5F6FA 5DD4A 2VXZA 1FOKA 1WWXA 4EJUA 1G6NA 1TNSA 4AIJA 1LJ9A 1LVAA 4LLNA 2ZNYA 1U8RA 2PJPA 1USSA 5D5WB 5E17F 5JI6A 2FOKA 5J8CA 1ZG1A 1ZH5A 5K5RA 2P5KA 2ZNZA 1Z1DA 2Z9OA 3GVAA 1TQMA 1WSUA 5E1XA 4A6EA 1IXCA 2W85A 5FO5A 4N9HA 5DCFA 3K2ZA 3R6SA 2EV6A 1IXSB 4MNUA 2ETHA 2XHKA 1SD5A 5HS9A 1KU2A 1YIOA 3GX4X 2PG4A 2CG4A 2Z3YA 1XGSA 5CYVA 1K78B 3ML6A 4HV5A 1IAWA 1KA8A 1FP2A 4MEYF 1P92A 2BGCA 2VBWA 4R8HA 3JAMZ 3IL2A 3K69A 1L3LA 3WODF 1TW3A 3TOBA 4I98B 3U9GA 1QBJA 1LDJA 1EH8A 2O6GE 1BI0A 5D4RA 1B4AA 1HSJA 3RKXA 3KP2A 2Q0OA 2RGVA 3IWFA 3QP5A 1Z05A 3Q5FA 4H0EA 4MEXF 4A0YA 1BI3A 5HLHA 2K7LA 4Y15A 1I1SA 2K86A 3KFWX 2LNBA 3EETA 1KU7A 4Q48A 2Y48A 2IA0A 2FMYA 1T0FA 2HS5A 1KGSA 2HOEA 1SFXA 1L0OC 2FNAA 3K0LA 3LA3A 2XV4S 1S3JA 2HGCA 1MZBA 1QPMA 2AS5F 1P4WA 2AXLA 4CXFA 2CYYA 3TO9A 4L18B 1S7OA 1QZYA 2IP2A 4UNOA 3F6VA 2KIUA 1F1ZA 3IRQA 3C7JA 4BQAA 3P9IA 1ZGAA 1T39A 5EEHA 4LG0A 2YSRA 3LFKA 4G94A 1BI2A 3LA2A 3QPTA 1DDNA 3RIRA 2D1HA 2CFXA 2D2WA 1B9MA 2QM3A 4LD5A 5D8KB 2OAZA 4UHTA 2XIGA 5CVVA 2Y75A 2EFPA 5HVQC 2M87A 1CGPA 4DQ2A 4HDUA 5L3CA 1SD6A 1FSEA 1WQ2A 3C1DA 2RN7A 3CDHA 2GXBA 1IRGA 2O61A 2HZTA 3WGGA 3V8JA 3ELKA 3TQNA 1B6AA 5H6RA 2DU9A 1JGSA 4YIIA 1MJBA 5ED4A 3BJAA 2HEOA 1MDMB 3E5UA 5E18F 3GXOA 4GO1A 5LEJA 5K1YA 2FEZA 1TBXA 2QBYA 3ECOA 3CUQA 3IHUA 1PDNC 3QU3A 1UFMA 1P4XA 3LAPA 5DEQA 4MQVA 5DUIA 2CQKA 5L3FA 4MHGA 3IKTA 3RYPA 3SZTA 2FU4A 2HYGD 3LQRA 1YS7A 2K4JA 4GYGA 3WTUC 2QQAA 3C18A 2WWYA 1RUNA 1XGNA 4NHJA 1O57A 1G3YA 3SXYA 4ENNA 5CVIA 1YLFA 2DK8A 5E8GA 1Z6RA 3F8FA 4BNCA 2XROA 1XCBA 4YIFA 2M5WA 1KU9A 5JHUA 2L01A 1TQPA 3JW4A 3EYYA 4G7OF 2F2EA 1R36A 1XMKA 4I0BA 3LWFA 5DYMA 3O3KA 4Q47A 2BE5F 4HV6A 1J7KA 3WGIA 4RGUA 1RNLA 2W84A 3PQJA 3W6KB 1YS6A 3IRRA 1LNWA 1FNNA 4AVPA 1PUEE 1MJ9A 5D8LB 3GO5A 3HRUA 3BJOA 1UHMA 5ICCA 3HTSB 1E2XA 2HTJA 3CUQC 1Z91A 4WXHA 4L9NA 4FX0A 3I0TA 4HF1A 4M73A 1HW1A 2HWVA 4A0XA 4MGRA 3F8CA 2OQGA 3FXRA 3RPQA 2EV5A 2JRTA 5DDGA 2L3DA 1U5TB 4UVCA 1R00A 4IXAA 2F5DA 2H09A 4N0BA 2V6CA 4ESJA 1BIBA 4HF2A 3HUGA 2A5YB 3ZN0A 2XAJA 1G3TA 3PFIA 1ZREA 1F4KA 2L4AA 3JTHA 2DW4A 3IC7A 2MBFA 2RVCA 1SAXA 3GUDA 5BS6A 1CF7B 3DXJF 3ZN1A 3GFJA 1H0MA 4ESFA 4YFKF 3Q9SA 4RAYA 2FQ3A 1KQ8A 2RC4A 1QO0D 4Q5SF 4QWQA 3AAFA 3RKWA 3DEUA 2A6EF 5ERIA 5BQTA 2L4MA 4ZZDA 1ZLKA 2K4BA 2FXAA 2WV0A 2LKPA 5FD6A 4P5OA 2QENA 1KQ9A 4EJVA 2RDPA 2HQRA 3WU1B 1USTA 3BPVA 4UXNA 2MA3A 4FHTA 1QZZA 4GCVA 1YW8A 4KFCA 4OOIA 3BJ6A 3GFIA 1U2WA 2W25A 1FYLA 1BOAA 4EM0B 3V7CA 4M74A 3HIFA 4A6DA 2ESNA 3H3UA 3MAJA 5LHGA 2VBXA 3S2WA 1RUOA 4KIBA 5LLQA 3I59A 2KJCA 3L00A 2V1DA 3K9TA 4CYDA 3TKYA 1BC7C 2JPCA 3WTTC 1J0RA 4IVNA 3SFZA 5JVTA 2M1BA 2F5CA 5CVRA 1U78A 5HDNA 1MD0A 5DCMB 5AIPA 2RKHA 3K1MA 2EFNA 1R1TA 3HYIA 2UXXA 4O3MA 4YFXF 4DNCA 2P7CB 3F8NA 4S05A 5LBQA 1B1BA 1ON1A 1EH7A 3RI4A 2C6YA 2X0LA 4U7DA 1ULYA 2E1NA 3RYRA 3RKYA 2MH2A 3WTVC 1S7AA 2NYXA 2EA4A 3F72A 4A5MA 4OMYA 1O3RA 2ZMEB 5LHIA 4EJOA 1YTYA 3FMQA 1H9GA 1O7FA 4UV9A 4Y13A 4BXUA 2J5PA 1ZARA 4UUVA 4FX4A 3E3VA 2IRFG 1B9NA 2Z5UA 2ISYA 1C0WA 3R0JA 4JQFA 5LGNA 3FX3A 4K2EA 3MQ0A 2G7UA 5LRRA 2ISZA 3QP6A 3VB2A 3TO7A 5D5UB 2P8TA 3L2CA 2ESHA 2OZ6A 5K5QA 4G7HF 1F5TA 2PMUA 5E1ZB 2EFWA 4CHUA 2H6CA 4FT8A 4AD9A 1G4DA 5AIQA 2VN2A 2OQRA 4OINF 3KLNA 4EM1A 1DP7P 1U3EM 4PZJA 3G3ZA 4EJWA 3KETA 5ILVA 1U5TA 4EJTA 1ZLJA 2V1XA 2DTRA 2YX7A 3R4KA 4G7ZF 1FT9A 1FBSA 3HSEA 3P7NA 1BC8C 3VODA 1KQ0A 4HAMA 2MD5A 4CDGA 1S29A 2XVCA 4OIQF 1K79A 4TV7A 4KMFA 1CF7A 3HOTA 2PBIA 3D0SA 1D8JA 2RV8A 1ODDA 1V4RA 4MQ9F 3TO6A 3WGHA 1HKSA 4P96A 2IJLA 2VC0A 3HSFA 3RPUA 2ELHA 1R1UA 2UXNA 3BPXA 1QNTA 3BY6A 1JHHA 3F8BA 5JFRA 2FBHA 2KIFA 5LEKA 2Y0MA 2QQBA 3QU6A 1J2XA 2GAUA 2GZWA 5BMZA 3Q9VA 1LDKB 3ECHA 4I02A 2DI3A 4XBFA 3GWZA 2GWRA 1TW2A 4UV8A 5IT9K 4ENJA 2ZXJA 1U5TC 1XSDA 2EWNA 3P9CA 1O7LA 1RIOH 2GA2A 4HQMA 4LB6B 3HRTA 1EV7A 3F21A 1V3FA 5A2QK 3ZPLA 1J59A 5HS8A 1FBQA 2PN6A 1HKQA 4U0VA 3U1DA 4LB5A 1R22A 1OKRA 2VOPA 2QUFA 4HF0A 3WE2A 5IT3A 3FF5A 1MGTA 1OYIA 3JSPA 3K1NA 1PP8F 5DCMA 5KVRA 3LAJA 5D6EA 4WXDA 1XCVA 2GQQA 2FF4A 5CLSA 4QLCU 4IF4A 2P7VB 4HBLA 3FXUA 2B0LA 4BHBA 1BJAA 4U0YA 2JSCA 3E6DA 2PEXA 1MKMA 1J5YA 4CO8A 1ZG3A 1STZA 2NRAC 3ZQ7A 4CICA 5HLIA 1GXQA 1ZN2A 1TLHB 4LLLA 2M8EA 4HDVA 4ON0A 1PP7U 5TRDA 4LMYA 3DP7A 4NB5A 1W7PB 4EV0A 3T1BA 2BV6A 2P5LC 1W4MA 2JT1A 2X4HA 2CSOA 2QQ9A 2LSOA 3CO7C 1XGOA 3V8KA 5D5VB 5HDGA 2VT3A 1I6XA 2A68F 1IN7A 1WKMA 3J80K 4L9TA 2HDCA 4A0ZA 5ICFA 1G3SA 1XSVA 1O3QA 2E1CA 2ZMEA 2V79A 3RDIA 2GXGA 1X3UA 4I01A 3CJNA 4ZZLA 4UVBA 3VOEA 3JTGA 1OYWA 1YW7A 3E6CC 2R7FA 2F5FA 2CW0F 4G6QA 2YX4A 4IRGA 1O3TA 1J9IA 1P2FA 3MZYA 3N4MA 4L0ZB 1OR7A 2ZJ2A 1SMTA 1KYZA 4M9XA 2J5OA 4ESBA 2VOOA 1HW5A 1XD7A 4ZYDA 1K78A 5BOXA 1JE8A 3M8EA 3I53A 3TGNA 5A2QZ 1K7AA 4RGRA 3O6BB 4HOBA 4RB0A 1FY7A 5AONA 3BOQA 4I7HA 3ZMUA 3J81K 3ZMDA 3WU0A 1IN6A 2VE8A 3I4PA 2CGPA 3SZPA 4WK8F 1FWZA 3F3XA 4RB2C 4PCQA 2OA4A 1ZRCA 3NEUA 1YFHA 3R61A 4RGXA 2A07F 2DPDA 5LRSA 2V1UA 3V8LA 1UCRA 4Y17A 1B59A 3WE3A 1KU3A 2ZFWA 4EGZA 3GFMA 1XB4A 3T5XA 3QOPA 2OU2A 2O8XA 1IXRC 2G9WA 2FA5A 3G73A 3M8FA 4PGGA 4NQWA 1W5SA 1VTNC 1SFUA 5FGMA 2RQPA 3ABUA 5F64A 1AWCA 4M9ZA 4WF2A 4HX4A 2TDXA
chains in the Genus database with same CATH superfamily
4ZJZA 3KP3A 3L2WA 2LC2A 4ZH4F 1S8NA 4E70A 4IHXA 3H0GJ 4KICA 4QIWN 3VDXA 1OR7C 3GCMA 2OCCH 3S3NA 2QCOA 3ZMVA 1R23A 1VQ8I 4DYCA 3J80Z 2LY1A 4S04A 2ZO4A 1FYKA 3L7WA 1ZAOA 4LK0F 4HW0A 3K4BA 1RC9A 3WTWC 4JK1X 2IT0A 1QHGA 1YOVB 3K4NA 1XDUA 4BUPA 1U6GA 2LF8A 3GEZA 5DV5A 3QOEA 3O2PE 2YR2A 3OIQA 5L3DA 2DMPA 2ME0A 2CS3A 2G7HA 4KT6A 2M4KA 2HDWA 4GXOA 4QTRA 3K1PA 3MFKA 5HLGA 2ELKA 1YW9A 4NC7A 1IDZA 1IN8A 2QF7A 2FSWA 2DO7A 4BAYA 2E5NA 5J8FA 2M34A 2YUSA 2JRMA 3P9KA 1SMYF 3OYJA 1U9OA 2LH9A 5KHDA 3J7AO 2STWA 1HW2A 1XDSA 3GFLA 4FE7A 3T8RA 2DK5A 1LUJB 2VJJA 3MKZA 2L9VA 3KEOA 4KN4X 4KA4A 2FD5A 2AHQA 3FZVA 5LGTA 3CMMA 3MWMA 5E20A 1HQCA 4LG0B 2VODA 2F5VA 2E1OA 2E34A 3GTKJ 1VQ7I 5FKOA 4CH7A 1UB9A 4XR6A 2STTA 1WJAA 1LQ1A 3H92A 3B6CA 1P9QC 2L0KA 2VL8A 2K27A 2XF6A 1JKOC 3PJRA 3TOAA 1IV6A 2V6EA 1NK3P 2FBIA 2F5EA 3U1KA 2DQLA 4D1QA 3JRBA 1LEBA 2BYVE 1WI9A 4KT5C 4M3DA 4D0PA 2ZJPF 1ETVA 1ZYRF 2P0WA 1TT0A 2VPRA 2DPUA 5K7FA 5CQEA 3OYCA 3AL0B 4YELA 2DBBA 3CJTB 1VQNI 4E7HA 2V26A 2XUBA 2H8RA 2VE9A 2DAOA 3GTJJ 1F36A 2E7XA 1H89C 4KYWA 3JAMK 2VJIA 4D7MA 4LIUA 1MDMA 2VKEA 4C3JJ 2F4MB 1XN7A 2E7WA 4NNJA 3ERED 2Q1ZB 1UHWA 4YRVA 4CSWA 1T98A 4BEHB 1JHFA 4U0WA 5J4YA 1MBGA 5GP9A 1W36C 3DLAA 3H9GA 2B9SA 1VI0A 2CV1A 2D45A 2Q8KA 2JTVA 1WGXA 1NG7A 3CLOA 3HOSA 4RDUA 3CO6C 4B3XA 2A6HF 1Y39A 2R7TA 2GIZA 4S0HB 3ZOBA 1A5JA 2GOXB 2LMDA 5IOZA 4XLAA 5F0CA 5K5OA 1D1BA 3L2RA 4A12A 2OPTA 2K02A 1OJLA 3FISA 3H3ZA 4B8XA 1TC3C 3KP5A 4RS8A 2HFHA 2M9HA 2EQRA 2DLLA 1YG2A 3HRSA 2QBYB 2MC3A 3HG9A 2W00A 5CVJA 5KK1A 1REPC 3GTOJ 2QZ8A 1MH3A 1D5YA 4Q4ZF 2JPBA 5FJ8J 3R60A 4BHPA 2P6SA 5H6QA 3BDDA 2A61A 3KP6A 4XQFA 4YG2F 4M71A 2H27A 3LOCA 3ZP5A 3GBGA 5DM6F 4C2MJ 4Y4RA 3JREA 1ZRFA 1RRJA 2VONA 5CPRB 5LHHA 2PMHA 3HSRA 2IA1A 4ZDPA 3CCYA 4M6XA 3JCUC 1ZRDA 2WY7Q 2K40A 1A04A 4WWCA 4JOMA 1BBYA 2M0MA 4OIPF 1N78A 5TJJA 4XLPF 2VT2A 3D5LA 1X3ZB 5LD2C 1YO5C 1R1VA 3WTSC 1OFCX 2H1KA 1WI3A 2XAGA 2MG4A 2R3SA 3TDZC 2HOTA 5GPAA 2EFQA 4C3HJ 4EMSA 2HKOA 2XKOA 1F9NA 5FB2A 3CCVI 1J75A 1HXDA 1MJAA 2MC4A 2LBFA 1ZGWA 1GXPA 1IRZA 2QEXI 4KNYA 2CUJA 2DJIA 4KMUX 5TGTA 4F91B 2V7FA 1UG2A 4OU0A 2EJRA 1BN5A 1W5TA 3RPUD 2LYCA 3WHBA 3OR1C 1I27A 2CUEA 3BP8A 1YIJI 4HA8A 1GHCA 5JR3A 2EZHA 4BY7J 1Z67A 3KP4A 3RZDJ 5FKKA 2I8DA 3T8TA 1QGPA 3SEZA 3VYSB 2UZKA 1FTZA 1X4OA 1FLIA 2HYFA 3EDPA 4BE2A 3ZMSA 4F93B 4LIVA 2CWEA 5F0FA 3F22A 2WC2A 2IAIA 4IOAF 4UY8I 2Q2EA 3JSOA 3AFHA 3E5XA 2X6OA 3W6JB 5EDNA 1YRNA 3S1MJ 3ABTA 3VSLA 4FCYA 2F4OB 3FK6A 1BM9A 1R58A 3MEXA 3E5QA 1K4TA 1A31A 3I4MJ 3IKVA 1ETXA 2R5ZA 2V9VA 4ETSA 1V55H 1SD4A 5E79C 1BW5A 4BDZA 2XAQA 2BY3A 1BI1A 2VUMJ 2X48A 1TNTA 4LGWA 1ON2A 1XGMA 1P4AA 4AU7A 2ZKZA 2XKPA 1FX7A 2ECBA 5J1YA 1Z7UA 5K7HA 1XSXA 2XPUA 2Z33A 2BEOA 2O3FA 1H9TA 5EGOB 1JXSA 2DMNA 5E3NA 4ENMA 4G6DA 4DYQA 1IN5A 2LF7A 1PUFB 3HUGB 3SYTA 3OYEA 3OR2C 2PX9A 1MNDA 2FBKA 2VQCA 2K3FA 2LDUA 3DQVC 3E6BA 3MD2A 5DD8A 1IJWC 3DKWA 4O5VA 3CCEI 3OV8A 5CJ9A 3JRHA 2EA2A 1MBHA 2E1MC 2E36A 1QU3A 3F6OA 1RESA 4HSTA 3CC4I 4HLYA 1T95A 2DFEA 3OYDA 3FXMA 2EV0A 2JA8J 2R7ZJ 5FFZA 2CJJA 1P6RA 1ERDA 1SC7A 2L7ZA 3CQZJ 2LOOA 2ZSIB 1SAUA 3W2WA 3R0AA 5KAFC 3LFUA 4BHCA 4JX5A 4IZZA 4BXXJ 2NNNA 2LLKA 5IYCJ 4KDPA 5FLXK 3KE2A 5JVGF 1D3YA 1UG0A 1Y6IA 3M9AA 5B66C 1ZELA 4ABZA 1HDPA 2HXOA 3FWEA 4AVZA 1X2NA 3KZZA 5JHFA 2XGDA 3CCJI 1I6HJ 4LITA 4LG3A 3LA7A 4PJ0C 5M5WJ 3SHFA 1JT6A 2OTJI 3DTKA 4M3GA 1ONVA 3ULQB 1FPQA 4BH9A 2VKVA 4R79A 2R7SA 2QYOA 4JYKA 1TWHJ 3O8GA 4IRIA 2EZKA 2KFDA 2K5CA 1YX5A 2EB7A 4RB3C 4KIGA 3OOPA 3E97A 1T38A 2M45A 2IGMA 1N25A 1IZ1A 2GM4A 2YS9A 1DPRA 4RAFA 4F7ZA 4ZYGA 4I09A 2DT5A 2LD5A 3AG2H 5JLXA 4WCGA 3G71I 1OPCA 1R6RA 2AXTC 1QQIA 4L9VA 1VQLI 1GV5A 2R93J 1T8IA 2KMUA 2G0EA 3HL2A 2K85A 5KCMA 2PLYA 2DFIA 4M6YA 4CZCA 3ISPA 3K7AJ 3GF2A 3DFGA 1SD7A 3MMYB 2HQNA 4RAZA 5LGUA 1T6SA 3GLXA 4F92B 3PSIA 3TDUC 2DQRA 3IV5A 1ZQ3P 2L02A 3C3WA 3P5JA 1IW7F 5J47A 2NOGA 3V7SA 2CFOA 3DF8A 1LVKA 1ZG5A 2A69F 3GTMJ 2AO9A 4IEJA 3DV8A 3HJEA 4BJTA 2X1EA 4PUSA 3WTZA 1E0EA 3OSFA 2KRFA 3CMYA 3A0HC 3I58A 1B8IB 2JA6J 1P7JA 1IUYA 5D5XB 4UUSB 3HXLA 3GW2A 5ICEA 1D8KA 3G6EI 3I59B 4B09A 3F8MA 4LFUA 3LL7A 1ETQA 4XMYA 1T2KA 3S2HJ 4ZDOA 2ZBKA 2ZJQF 3REOA 2VJ5A 2L54A 2QSGX 2M2EA 3WG9A 2FRHA 1EA3A 1BR1A 5GAEJ 4L0YB 4ITVA 3L09A 3BWGA 3QPHA 1E17A 1ZK8A 4AIKA 5HS7A 2EFOA 2YU9J 5J1UA 2D1VA 4A5NA 2XAFA 3GLLA 2ADUA 3B73A 2H94A 3CTAA 2DYRH 3DTEA 3KIOA 2OTLI 1FSHA 1IF1A 2Z2SB 3LSJA 2LY2A 2W82A 3BG9A 1SEUA 3T0YA 3FMRA 2XASA 4IHTA 3ZGKA 2H8WA 1KYWA 2R7DA 3GMEA 4BYYA 5EG0B 4O6JA 4G12A 2DA7A 4F55A 1IV8A 5EEGA 2R7XA 1YITI 4ZC3A 1YQAA 3N05A 1XMAA 3PQKA 3QRFF 3KEQA 3GTLJ 3KEYA 3L9FA 4XLCA 5ILSA 2X1DA 4G8XA 5FFXA 5FROA 3LNQA 2XGXA 2COMA 2GIVA 1BR4A 4U7BA 4F52A 3G1LA 2BXZA 5CVUA 4XONA 1S7EA 1JJ8C 5HOOA 4RLFA 4YIRX 3GYHX 5FLVA 2HTSA 3FMSA 4BXFA 2L9NA 5FLXZ 2LK2A 1RZ4A 2CQXA 2MYSA 2E19A 2MSYA 1R5GA 3FHZA 4GYIA 3I54A 3EPZA 3CP8A 3BZ6A 4HLXA 3ABMH 3G2BA 3BTLA 1JTXA 2DOEA 2FE3A 1I5ZA 1JUMA 2BBYA 2O8KA 5D4SA 1Z77A 2H6BA 3KLOA 3K4MA 1ZTRA 3H3VK 5L3EA 3QYEA 1E3PA 5L3BA 5E1WA 2IVMA 2F48A 5IT9Z 1R5HA 2KJBA 3E7LA 1EH6A 3LSTA 4DZJA 5ILUA 3BROA 4MTEA 2HYJA 1X1CA 4MFEA 3IUOA 1JKPC 3KYCB 3Q0WA 2KDOA 3KP7A 3JR9A 4HQEA 5J4VA 2R4GA 2KIQA 4ZYEA 4XLNF 2XAUA 3A01A 1D5VA 3Q0VA 2GA1A 5H20A 4KISA 2M3AA 5ICGA 3M7GA 3CMEI 1VQPI 1HBXG 1FC3A 4QSHA 5B1BH 4X0GA 3OL4A 2X1CA 4ENKA 4E7IA 3RZOJ 1MBJA 5K7ZA 1W36D 2MLKA 1ZHFA 3HHHA 1D0ZA 2IXSA 5J1RA 1G8XA 2A3SA 2IEKA 4EGYA 3ONQA 3GTGJ 1S6LA 3AG1H 5HDKA 4PGHA 3V4GA 1OYYA 1U0JA 4XLEA 1N75A 2NS0A 4IX7A 2D5VA 4DIQA 4G9YA 2Z16A 1FP1D 1TTYA 3HRMA 5DTDA 1Q1HA 1W0UA 2WB1A 5J6XA 5FKNA 1WRJA 3GZ5A 4CA0A 1WJBA 5HNFA 4BE0A 3LQQA 3IWZA 4JP0A 2YPRA 2FNPA 3F23A 4KIFA 2P4WA 2F4IA 1DP3A 3FIWA 2IW5A 2EK5A 5JLWA 1IN4A 4ASNA 2N8GA 4V2GA 4Z6YA 4KITB 3TEDA 4EVIA 1IRXA 2ECCA 2V4JC 3EUHA 1HKTA 2BVMA 3DPTA 5J3LA 3M1CA 2PJRA 2HOSA 2RNJA 2NOJB 2EZLA 1GVJA 2TCTA 2CUFA 1R7JA 4IPAA 3I71A 4AIHA 2IPQX 2MH9A 2OD5A 4LK1F 4I0AA 2NNYA 5EGOA 4IHSA 4XKBA 2WY8Q 2ZCWA 3A1YA 4AWXB 1PYVA 1PUFA 4OIOF 3FM3A 4RB1A 3I5UA 4L5JA 4EM2A 1BIAA 3SQNA 1SVMA 4A3IJ 3FXQA 2XDVA 3WTXC 2WTEA 3JRFA 2PI0A 6PAXA 4KN7X 2ZSHB 1FYMA 1DPUA 1ZGJA 2HKXA 4HZFA 2O03A 1UZCA 1RR7A 3FM5A 1SFOJ 4IJAA 1LFBA 1I50J 4OAZA 1XPXA 3U2RA 4ANJA 4OAYA 2HU9A 3VEPA 4MIMA 4L5EA 3E6MA 5DUKA 4XSXF 2XRNA 4G6TB 4KUMA 1Y0UA 2MLGA 4HNVA 2YU3A 2MW8A 4Z2YA 1LDDA 1OMIA 2BY2A 2GOMA 4YFNF 5BPDA 3JRDA 2KKOA 4ZYHA 2OZUA 2OF7A 1YYVA 4XRMA 3S93A 3RJPA 4M9SA 1SFKA 1FBUA 1D0YA 2W57A 2VC1A 3Q0UA 2IA2A 4P55A 3OYIA 3DPLC 3LSHA 3CCLI 3ZMTA 4IRHA 5HNHA 4HX8A 4HX7A 3TL4X 3AG3H 4XRFA 4L5IA 5KAIC 4A2UA 1FZPB 1W7PD 2QWWA 2A6TA 5F0HA 1IDYA 2LP0A 3HHGA 3A0BC 1NTCA 2KLOA 3VWBA 2NAZA 5FD5A 3I64A 1HSTA 1V5EA 2HOAA 3HTUA 1MMSA 3V7RA 3GZ6A 1NHAA 2P5VA 4M72A 3H35A 4W97A 3B02A 2OCEA 3DWLE 1AA7A 2JK3A 5F1RA 3MZHA 1KONA 2DFFA 3EYIA 2VBYA 5E3LA 3PM1A 3N97A 3EUHC 4GRIA 4B48A 2ACJA 3S1NJ 3ZQQA 4UVAA 1TQIA 3BQYA 4HRIA 1HA8A 4XOPA 4EQQA 4HG2A 2KPMA 2XAHA 3MCZA 3COAC 4GGGA 5C44J 1JJ6C 2UWMA 1DUXC 3VFZA 4IQ4A 2EBIA 5F04A 3NQOA 1FIAA 3EQLF 3ZMZA 3BZCA 5EZGA 2QKLB 2HR3A 2CO5A 4P9FA 1XC5A 4JX6A 3J81Z 4PDKA 5E8IA 4JX4A 2FOWA 1I1GA 1Z0XA 4MFDA 4FISA 4OMZA 5D6FA 4WX9A 2Z1DA 2P6TA 4WXCA 2EIJH 4UUSA 4RMNA 1VQ4I 2B7EA 3Q3SA 1K4SA 1LEAA 2ZC2A 5TISC 3H9JA 4C30A 4FASD 1AOYA 2FMLA 2O0YA 4LLGF 1Z6TA 4RGSA 4XN3A 1GLNA 4LJZF 3KZYA 3HC7A 3M3YJ 4I2OA 4MTDA 4CGZA 4N9IA 1BA5A 4XRSA 2JA7J 4CCJA 5M5XJ 1RI7A 4U88A 3CF5F 3A2KA 2DMQA 3KYLA 3QYFA 2M30A 9ANTA 2JUGA 3SZGA 3J7ZI 2PMZA 2DODA 4E4HA 5BPIA 2F6CA 4AC0A 1LB2A 1X1DA 2LREA 3C2HA 3GTPJ 4P9UA 1Y8RB 3M1EA 2XGCA 2M7BA 1SFEA 1W7PA 3OYBA 1IRFA 1G3WA 2HNHA 4M3FA 4A3CJ 4JBAA 4XM3A 2MABA 2XSDC 1WFXA 2X6XA 3I4NJ 2MD0A 2Z99A 3WTYC 3OYAA 3ROUA 3AG4H 3RTRA 2OBPA 2PFBA 4RLQA 3NRVA 2WV1A 3CUQB 2PQ8A 2QLZA 4RA2A 4RM2A 3S3OA 2NVQJ 1G2HA 2ZXHA 2JZYA 3KCCA 2XB5A 3CUOA 2QVOA 3FXLA 2W24A 3J7YJ 5L3GA 4XL9A 4CZZA 3KX2A 2KIMA 2XPVA 4AM3A 1K6OA 2VBZA 2EPFA 1O3SA 4R1HA 3S1RJ 4L9JA 4XSZF 4HYEA 2ICWG 3QAHA 4OIRF 1ETKA 1R49A 4M3BA 5F6FA 1Z9CA 3ZQFA 5DD4A 2DOAA 4X6AJ 3RKQA 2VXZA 2DDBA 1YX3A 1FOKA 1WWXA 4EJUA 4IQJA 4NUBA 4DGWB 1G6NA 2GXAA 1TNSA 2CH0A 4AIJA 1LJ9A 1LVAA 3PUBA 4LLNA 3S8PA 3OY9A 4XK4A 3HPHA 2ZNYA 1ZKGA 5EYRA 1USSA 5D5WB 1U8RA 2PJPA 5E17F 5JI6A 2FOKA 5J8CA 1ZG1A 1ZH5A 4CCOA 3BQZA 5K5RA 2P5KA 3IH2A 1MMNA 2ZNZA 4E7JA 1Z1DA 2Z9OA 1UJ8A 2DA1A 1SANA 3GVAA 1TQMA 3HGYA 2AQEA 4HNTA 2CQNA 4FTHA 4A93J 1WSUA 5E1XA 2CW8A 2HDDA 2O7OA 2QQ8A 4A6EA 4AYBA 1GUUA 1IXCA 2W85A 5FO5A 1PVEA 4N9HA 3CMAI 5DCFA 3ZQCA 3HKZA 2GLOA 2BW3B 2BVLA 3K2ZA 3BG7A 1KZHA 2LKSA 3R6SA 2EV6A 1IXSB 1X4PA 1I3QJ 4MNUA 2ETHA 3E1SA 2VKDA 2I10A 3J7AY 5F1JA 4XIDA 5EZHA 2XHKA 2L2OA 1SD5A 5HS9A 1KU2A 2JA2A 2CRGA 2W1OA 5B1AH 1YIOA 4E7SA 3GX4X 2PG4A 2CG4A 3BC8A 1QVTA 4XNFA 2Z3YA 1XGSA 5CYVA 1K78B 3ML6A 1T08B 4HV5A 1IAWA 1KA8A 1OCCH 1XS9A 2NVTJ 4OWRB 1FP2A 4MEYF 1P92A 2BGCA 2CV0A 3OOUA 2VBWA 3VYRB 3ESWB 4R8HA 3F0CA 3JAMZ 3IL2A 3HOXJ 1JT0A 2H1LA 3K69A 1L3LA 3WODF 1TW3A 3TOBA 4XLHA 4I98B 3U9GA 4IO9F 5IY5H 2HPMA 1QBJA 5FRMA 2LKXA 4Y3OA 1LDJA 3W2VA 2VQLA 1EH8A 4IHVA 3X2QH 2O6GE 2FQ4A 4DZPA 4CCLA 1BI0A 4CYCB 5D4RA 4IKFA 2NVUB 4P1WA 4BJ6C 1B4AA 1HSJA 1AHDP 1MSFC 2EH3A 3NWTA 3RKXA 3JRAA 3KP2A 1AKHB 4BY1J 2Q0OA 4NDLA 1K83J 2RGVA 3IWFA 3QP5A 1BR2A 3M8JA 2DMUA 1Z05A 3I3LA 1ENHA 2IS2A 3Q5FA 4H0EA 1W1WE 4MEXF 4A0YA 1BI3A 5HLHA 2K7LA 4Y15A 1I1SA 1WJEA 2K86A 3LSGA 3KFWX 2XB0X 2LNBA 3EETA 4A3EJ 3BTJA 2QSFX 1KU7A 2JVHA 4Q48A 2Y48A 3FK7A 4DBQA 1O4XA 2IA0A 2FMYA 4V19K 1T0FA 2HS5A 2L7MP 1KGSA 2HOEA 1SFXA 1L0OC 3OYLA 2FNAA 1Y1WJ 3K0LA 3LA3A 2XV4S 1S3JA 2HGCA 1WJFA 1MZBA 1QPMA 1VQOI 2WAEA 5EF6A 2AS5F 2VB6A 2BHYA 3TP3A 1P4WA 3DPUA 2AXLA 4CXFA 3HOWJ 2CYYA 3TO9A 5BNGA 4L18B 1H8AC 1S7OA 3QODA 4GFBA 1QZYA 2IP2A 4UNOA 3OS2A 3F6VA 3I9V2 1GV2A 2KIUA 3JRCA 2DDAA 1WHUA 2HVSA 4BGDA 1NK2P 1F1ZA 1NH3A 3IRQA 3C7JA 4QPOA 4BQAA 2MGQA 1TT5B 2WAQA 3P9IA 4E6KG 1ZGAA 1T39A 2W7NA 2JUCA 5HODA 2BXYA 5EEHA 4LG0A 2YSRA 3DBLB 4DW6A 1VQ6I 1JKQC 3CCMI 3LFKA 4G94A 1BI2A 3LA2A 3CCSI 3QPTA 1A6IA 1DDNA 3RIRA 1D0XA 1EF4A 2D1HA 1YI2I 1MMDA 2JMWA 3BG6A 2CFXA 4II2A 2D2WA 4D9JA 1B9MA 2QM3A 3OMYA 4LD5A 5D8KB 2OAZA 4UHTA 1WPKA 2XIGA 3BR5A 3K4LA 5CVVA 3PNTA 5IP7J 5FKLA 2Y75A 2O5RA 2EFPA 2V9KA 5HVQC 2M87A 1CGPA 4DQ2A 2CQ7A 5M3FJ 4HDUA 5L3CA 1SD6A 1FSEA 4UUTA 3KPHA 4BACA 1WQ2A 3C1DA 2RN7A 3S17J 4EATA 3CDHA 2GXBA 1IRGA 2O61A 2HZTA 2JN6A 2Y31A 4XKVA 3WGGA 4BEHA 4X1EA 1MNMC 3V8JA 4MO7A 2IGNA 3ELKA 2E2JJ 1WZ2A 3TQNA 1B6AA 1T0FC 2B63J 2EINH 2XPWA 2DU9A 1JGSA 4YIIA 1MJBA 3K4JA 5H6RA 3VSKA 5ED4A 1QA6A 3BJAA 2HEOA 3HDDA 4A3JJ 1MDMB 1DQUA 3E5UA 1SVOA 3BG5A 3NAUA 1Z3YA 2R7OA 2QSHX 1BOBA 5E18F 4PFOA 3GXOA 4GO1A 5LEJA 5K1YA 2HXIA 3DU5A 2CQQA 3M4OJ 2FEZA 1TBXA 2QBYA 3ECOA 2V1NA 3CUQA 3IHUA 2HVQA 3BR2A 1PDNC 3QU3A 4ZYAA 1UFMA 2VKHA 1P4XA 3LAPA 2HZDA 5DEQA 4MQVA 3HEFA 5DUIA 2CQKA 5L3FA 2XGEA 2RREA 4MHGA 3IKTA 2E2IJ 3RYPA 2E2HJ 3SZTA 2FU4A 3FBNB 3LSMA 3D1NI 2DA5A 3K10A 2HYGD 1TWFJ 3DU6A 3LQRA 3A4CA 1YS7A 2K4JA 4GYGA 1YJ9I 1IG7A 2K3PA 3WTUC 2QQAA 2UV1A 4CCNA 1G59A 3C18A 1UMQA 1HDDC 2WWYA 1RUNA 1I3AA 1XGNA 4NHJA 3MKYB 2DTZA 1O57A 4PJNA 2R7VA 1G3YA 3SXYA 4ENNA 3IH3A 2WAFA 5CVIA 1YLFA 3TBIA 5IYBJ 4GDFA 1RPWA 2DK8A 3RSNA 3DKXA 3HBLA 5E8GA 3AL0C 1Z6RA 3OS0A 4HNUA 1OQYA 3F8FA 4BNCA 2XROA 2DA6A 1XCBA 2TRTA 4YIFA 3S16J 1I39A 2M5WA 1KU9A 5JHUA 2HQ5A 2L01A 1TQPA 3IAM2 3CF2A 3JW4A 4HSRA 3EYYA 2R0QC 5IOYA 3A02A 4G7OF 1OCZH 2X85A 2F2EA 1RKWA 2BW3A 1QVUA 1R36A 1XMKA 4I0BA 2LBFB 1FMVA 3LWFA 5DYMA 3O3KA 4Q47A 2BE5F 4HV6A 5M3MJ 1J7KA 3WGIA 3DEEA 4RGUA 1RNLA 2W4SA 2W84A 2KDZA 1YJNI 3PQJA 3ABKH 1WJDA 3W6KB 3CCQI 3K70C 1YS6A 3IRRA 1LNWA 1FNNA 4HEA2 4AVPA 3H5RA 3BLYA 4HPQA 1MMAA 1PUEE 4H4KC 1MJ9A 5D8LB 3GO5A 2VQGA 3BJOA 1UHMA 3HRUA 2DFHA 5ICCA 4PJLA 3HTSB 4CUGA 1E2XA 3HOYJ 2HTJA 4LOCA 3CUQC 3FDYA 5HLTA 1Z91A 4WXHA 4UB6C 3TMOA 4XORA 4L9NA 2Q2EB 4FX0A 1J09A 3I0TA 4B4CA 4HF1A 4M73A 3HB9A 1HW1A 2HWVA 4A0XA 4MGRA 3F8CA 2OQGA 3FXRA 2X6WA 3BT9A 2EV5A 3RPQA 5FLMJ 2JRTA 5DDGA 3B6AA 2L3DA 2HI3A 1MNEA 1U5TB 3DKYA 2R5ZB 1R9TJ 4UVCA 1R00A 4IXAA 2F5DA 2DA2A 2H09A 4N0BA 2V6CA 4BL0B 3ZRGA 2DJNA 2JWTA 3PO3J 3HOUJ 4ESJA 3OYHA 4BBRJ 1ITYA 1HC8A 1RKTA 1BIBA 1M1EB 3HUGA 4HF2A 2A5YB 3ZN0A 2XAJA 1G3TA 3BCAA 4B44A 1GDTA 2JA5J 4J01A 2DT6A 3PFIA 2LG4A 1ZREA 1F4KA 1QPIA 2L4AA 3JTHA 2DW4A 2KRHA 3IC7A 2CU7A 2MBFA 2RVCA 1SAXA 4IL6C 4BS9A 3GUDA 2ZB9A 3TW7A 5BS6A 1CF7B 2M4GA 3DXJF 3OYFA 3ZN1A 3GFJA 1H0MA 3S32A 3OYNA 1F43A 3WG7H 4ESFA 3DBRB 4AIDA 4YFKF 5H2FC 4XRSG 3Q9SA 4RAYA 2FQ3A 2VLAA 1KQ8A 4DYRA 2E60A 1QO0D 2RC4A 4RBOA 3A03A 3S15J 3MKLA 1DGRM 2NS7A 3LSIA 3QWLA 4Q5SF 1FIPA 2ZXWH 4QWQA 3TP0A 3AAFA 1VQ9I 4DOZA 3RKWA 1UAAA 3DEUA 4D5FA 2A6EF 5ERIA 4Y7NJ 5BQTA 5C4XJ 1HCRA 3JRGA 2L4MA 1IO2A 4ZZDA 1ZLKA 3K2AA 2K4BA 3CJQB 2FXAA 2WV0A 5IP9J 4M3EA 2LKPA 1U8BA 1WJCA 5FD6A 1XX5A 2EILH 4P5OA 2QENA 1KQ9A 1X2MA 4EJVA 2RDPA 2HQRA 3WU1B 1Q1VA 1HLVA 4D7NA 1USTA 3BPVA 4UXNA 4A3KJ 2MA3A 2L7FP 4NC6A 1Z7LA 4FHTA 1OCRH 3I55I 1QZZA 3HOZJ 4GCVA 1Y0NA 1YW8A 4KFCA 2OV7A 3K4KA 4FQGA 4OOIA 3BJ6A 3GFIA 1U2WA 2NS8A 2W25A 1FYLA 1BOAA 4EM0B 4J19A 3V7CA 1V54H 3ASNH 4M74A 2E5ZA 3HIFA 4A6DA 2ESNA 3H3UA 3MAJA 5F27A 4V2FA 4E7LA 2LVSA 5GAGJ 2VBXA 3S2WA 4FETA 5LHGA 3VYUB 3OWTA 2VQHA 1RUOA 4KIBA 5DS9A 3SEQA 1B8IA 3DCFA 1PJRA 1X1PA 1W0TA 2IS4A 3C2GA 3BCBA 1N77A 5LLQA 1Z21A 3I59A 2KJCA 4QPQA 1TWGJ 2R92J 2R5YB 3L00A 1X19A 5IP6A 1QRYA 2V1DA 4E7KA 3K9TA 4CYDA 3TKYA 1BC7C 2JPCA 2BZTA 3WTTC 1J0RA 4IVNA 2XF7A 3SFZA 5FRNA 2A05A 5JVTA 2L9RA 4PJMA 3PL8A 2M1BA 2F5CA 4A3BJ 5CVRA 4XLFA 4II3A 2KRCA 1U78A 1R5ID 2DA4A 5HDNA 1MD0A 5DCMB 2V9PA 5AIPA 2RKHA 5GAHJ 3TW6A 3EUKL 1WCMJ 3K1MA 1FTTA 3G1OA 2EFNA 3IH4A 1UELB 3LSKA 1EKEA 3CZ6A 1R1TA 3HYIA 2UXXA 4O3MA 4YFXF 3K4CA 4N4NB 4DNCA 1WJ5A 1XTAA 3BR3A 5EEAA 2CMPA 5E3OA 2WB1N 1XMXA 1K6YA 4PFPA 2P7CB 3HOVJ 3F8NA 3H9QA 4S05A 2P81A 5LBQA 5EG0A 3SFIA 1B1BA 1ON1A 1EH7A 2ZFUA 3RI4A 3OSGA 5M5YJ 1BL0A 2FX0A 2C6YA 3CD6I 2X0LA 4U7DA 1POGA 2X9DA 1ULYA 3ZQLA 2E1NA 2NXNB 2Y2ZA 3RYRA 3RKYA 2MH2A 5B5EC 2R7WA 1JUPA 3V42A 1S5LC 3W6VA 3PO2J 2FJ1A 3HPGA 4BQOA 3WTVC 3DTIA 2Y69H 1FJLA 1S7AA 4BU2A 3S14J 2DN0A 2NYXA 3BTCA 2EA4A 3FBIB 5EJCA 1MSEC 3HZJA 3H1CA 4B3AA 2BY0A 5CQGA 3IP4B 1LFPA 2BHZA 4BE1A 3F72A 1D1AA 4A5MA 2L7KA 2OUMA 4OMYA 1O3RA 3CC2I 2ZMEB 3NARA 5LHIA 4EJOA 1YTYA 3FMQA 4NBQA 1H9GA 1O7FA 4UV9A 4DJAA 4XN0A 4Y13A 3QQAA 2NVXJ 2E35A 4Y33A 4BXUA 2J5PA 3BZKA 1Y1VJ 1R71A 1ZARA 4UUVA 4FX4A 3E3VA 1VF9A 2IRFG 3MVPA 1B9NA 2Z5UA 3LSPA 3SDGA 2ISYA 1C0WA 3R0JA 3FKJA 1E3OC 1B72B 4JQFA 4XKCA 1UHSA 3FX3A 3VYTB 4B1RA 5LGNA 1LKXA 4K2EA 1DU0A 4C2TA 4A3DJ 2X51A 2O9LA 2VJ4A 3MQ0A 2Y0SA 2G7UA 5LRRA 3LMMA 5LFAA 2ISZA 3QP6A 3VB2A 3TO7A 3K6GA 5D5UB 2P8TA 3A01B 1K61A 3L2CA 2ESHA 5GADJ 2DYSH 3OYMA 4J00A 2I5UA 3LSRA 1TL8A 2JSPA 4BDYA 2CW7A 1P7IA 1OCPA 2OZ6A 5K5QA 4PSXA 1JKRC 4C9YA 3RCOA 3G4SI 2Y9YA 2ELJA 1DGWY 4G7HF 1F5TA 3CESA 2PMUA 3BR6A 3H5NA 5E1ZB 3PNYA 3S2DJ 1S9HA 2EFWA 4CHUA 2H6CA 2K9LA 4FT8A 4AD9A 2LTPA 1G4DA 4MLOA 5AIQA 1HF0A 2VN2A 2DT7B 2OQRA 4OINF 3KLNA 2WADA 3SDBA 4EM1A 1DP7P 1BJZA 1U3EM 4PZJA 3G3ZA 4EJWA 3KETA 5ILVA 3DEWA 1U5TA 2CUZA 2K9SA 2KQRA 4EJTA 1ZLJA 2DMTA 3MN2A 3DLLF 2V1XA 2DTRA 4M6VA 2YX7A 3R4KA 3VPRA 3ZQGA 4G7ZF 1A6QA 1E3HA 1QZEA 2LY9A 1YHQI 1FT9A 1TWAJ 1FBSA 3HSEA 3S3MA 2K9MA 2GBYA 1ZR2A 1S72I 3P7NA 1BC8C 4FE4A 1T56A 3VODA 1KQ0A 2M7AA 4I6ZA 1OCTC 4HAMA 2VXDA 3UR3C 4D5CA 2PJRB 2R7QA 2MD5A 4CDGA 3ZR8X 2KHMA 1MMGA 1S29A 4BJ5C 2XVCA 1FOYA 2OC6A 3BTIA 2L9SA 3QYBA 4OIQF 1K79A 2XF5A 1FMWA 4TV7A 1LE8B 2L5QA 3IAS2 4KMFA 1CF7A 3H0DA 2PMZN 4NQWB 3HOTA 2PBIA 3D0SA 2EZIA 1A36A 1D8JA 2RV8A 1ODDA 1V4RA 4MQ9F 3TO6A 3WGHA 1HKSA 2M0CA 4P96A 3CP2A 2IBDA 2JJ7A 2IJLA 2VC0A 1YJWI 2KL4A 3ASOH 3HSFA 1GVDA 1IUFA 3RPUA 2ELHA 4IHYA 1R1UA 3BPXA 2NVYJ 2UXNA 1YE9A 1QNTA 3BY6A 3ZXSA 4XICA 1JHHA 3F8BA 4EEFG 5JFRA 3GTQJ 2FBHA 2KIFA 3PFYA 1FEXA 3UNGC 5LEKA 1DU6A 2Y0MA 3K70D 3HGGA 2XSJC 1RETA 2QQBA 3QU6A 1J2XA 2GAUA 3OS1A 2GZWA 4ZTFA 3D5SC 1GT0C 3L2VA 5BMZA 1AU7A 1MBFA 3Q9VA 1LDKB 3FXJA 4YEJA 3W3CA 3KZIC 2QA4I 1WH7A 3ECHA 4I02A 2DI3A 2OJED 4XBFA 3OIPA 3GWZA 3W2AA 2GWRA 2IGOA 5B3SH 1TW2A 4A3LJ 5KNLA 4C2UA 4UV8A 1TP4A 4XOTA 5IT9K 3PNVA 4UB8C 4PSWA 4ENJA 2ZXJA 1U5TC 1XSDA 2A5WA 5E3MA 1BW6A 2EWNA 1EJ9A 3P9CA 1O7LA 1RIOH 2GA2A 4HQMA 3I56I 4LB6B 5FKMA 2ZXIA 1ETOA 3HRTA 1EV7A 3BR1A 4CCKA 3F21A 3UKGA 4CCMA 2AQFA 1V3FA 4Y52J 5A2QK 1OLTA 3FXOA 3ZPLA 3JRIA 1J59A 1MH4A 3ERMA 2RAEA 5HS8A 1OISA 2K9NA 1ORKA 1FBQA 2PN6A 4AYBN 1HKQA 4BBSJ 4U0VA 3U1DA 4LB5A 2KZGA 2R5YA 1R22A 1OKRA 2VOPA 4BQNA 1QHHD 2WA0A 3HKZN 3PUFA 1R4MB 2QUFA 3AKZA 4HF0A 3F9KA 3L2UA 2DCEA 3WE2A 3FF5A 1MGTA 5IT3A 1OYIA 1WH5A 3JSPA 3PIOF 3K1NA 1X1BA 1PP8F 5DCMA 2Y0SN 2IGKA 2Y9ZA 5KVRA 3D5RC 4I99C 5CKTA 3LAJA 5D6EA 4WXDA 1XCVA 4ZTJA 2GQQA 2FF4A 2WBMA 2LR8A 1X3WB 5CLSA 4QLCU 3M07A 3CJRB 2P7VB 4HBLA 3FXUA 1MBKA 2QKMB 4IF4A 1VQ5I 5IYDJ 4ZDLA 1XG1A 4BKXA 2VI6A 3NWSA 1FOXA 2B0LA 4BHBA 2R7UA 1BJAA 3FXKA 4U0YA 2JSCA 2Y30A 3E6DA 1CQTA 1A35A 2PEXA 1MKMA 1J5YA 4RM3A 1ZG3A 4CO8A 5C3EJ 2XC7A 4E7ZA 1STZA 2NRAC 3ZQ7A 4CICA 5HLIA 3H5AA 1GXQA 1ZN2A 1TLHB 2FUG2 4LLLA 2M8EA 4HDVA 4ON0A 1PP7U 4IOCF 2VIXA 5TRDA 4LMYA 3DP7A 3OYKA 4NB5A 1W7PB 4EV0A 1H88C 3T1BA 1JTYA 2BV6A 3ZQHA 3PSFA 2P5LC 1W4MA 2JT1A 3U21A 1LPQA 2X4HA 2CSOA 1FOWA 3ABLH 3BR0A 1OCOH 1VNDA 2JVGA 2QQ9A 4B47A 4A3GJ 2LSOA 3EUAA 5C4JJ 3CO7C 1XGOA 3V8KA 5D5VB 5HDGA 3FHNA 1TWCJ 3CC7I 3FKIJ 2VT3A 4U87A 1I6XA 2A68F 1Z3XA 1IN7A 1WKMA 3J80K 4L9TA 1U9NA 1JI8A 5GTHC 2HDCA 1RR8C 4F3QA 2JQ7A 4A0ZA 5ICFA 1G3SA 1XSVA 4BQQA 2ZJRF 1O3QA 2E1CA 2K9QA 4A69C 3OL3A 1Y8QB 4IHWA 2ZMEA 2V79A 3RDIA 2W48A 3RQIA 3BG3A 2BY1A 2GXGA 1X3UA 2HQAA 4I01A 3CJNA 1V5FA 4ZZLA 4UVBA 3VOEA 1MIJA 2IS6A 3JTGA 1ETYA 1OYWA 2DXIA 2XRLA 2VASA 1YW7A 3E6CC 2IS1A 2R7FA 2F5FA 2CW0F 3CLQA 2HPIA 4G6QA 3CCUI 2E1MB 3QPLA 1B72A 3L1PA 2YX4A 4IRGA 2RQQA 3QPSA 4C3IJ 3SJMA 1Y56A 1O3TA 1J9IA 1P2FA 3E0JB 3MZYA 3N4MA 4DBRA 4L0ZB 1VZ0A 2EIKH 1VQMI 1OR7A 4NC8A 3WU2C 2ZJ2A 1SMTA 2VPLA 4KJZA 1KYZA 3ZQIA 1ZR4A 3OIOA 4M9XA 1ACIA 2LRDA 1VFCA 2J5OA 3WHCA 2M8GX 4A3MJ 3O8HA 4ESBA 2VOOA 1HW5A 1XD7A 3OYGA 4ZYDA 1K78A 2KZVA 5BOXA 1JE8A 1X1AA 3M8EA 5F08A 3I53A 3CDIA 2CV2A 4I76A 3TGNA 5A2QZ 1K7AA 4RGRA 2DOFA 2WAQN 3O6BB 2KISA 4HOBA 4RB0A 1V5GA 3DBHB 1FY7A 2E71A 5AONA 3BOQA 3C2BA 4I7HA 3ZMUA 1YRNB 1VQKI 1SVLA 3J81K 3S1QJ 3ZMDA 1APLC 2QGUA 2KP6A 3CCRI 1MBEA 1TZLA 1IN6A 3WU0A 2VE8A 3I4PA 3PIPF 3MZ8A 3MKWB 2CGPA 3SZPA 3ZCOA 5J40A 4W1UA 5GTIC 4WK8F 4N4OB 1FWZA 3F3XA 3G1MA 4RB2C 2MFZA 4PCQA 2OA4A 3RQ4A 4PK4A 1ZRCA 3NEUA 2BOLA 4RAGA 1LFUP 4XKWA 1YFHA 4B43A 3R61A 4CYCA 3GZNB 4RGXA 1X58A 2X6YA 2A07F 1IC8A 1R4NB 2DPDA 4AUXA 2COBA 2UUZA 1MW7A 1AKHA 1W5CC 2EIMH 5LRSA 3HM5A 2ME6A 1NG6A 3L2QA 2V1UA 3V8LA 1UCRA 4Y17A 1B59A 2ID3A 4PJJA 2DA3A 3WE3A 2KT0A 2ZMEC 1KU3A 1JUSA 2ZFWA 1D1CA 3CDLA 3KYDB 5IPAA 4EGZA 3GFMA 1XB4A 3T5XA 1WVRA 3QOPA 2RNGA 2LFBA 2OU2A 2O8XA 2HVRA 5DM7F 1IXRC 2ID6A 2G9WA 1ETWA 2FA5A 1JGGA 1LE8A 3G73A 3M8FA 4PGGA 2R7RA 1IGNA 4NQWA 1W5SA 1VTNC 1SFUA 5FGMA 5GPCA 2RQPA 3ABUA 5F64A 1AWCA 1HOMA 1T33A 4M9ZA 4WF2A 4A3FJ 3H36A 4HX4A 2TDXA
chains in the Genus database with same CATH topology
3KP3A 4ZH4F 1S8NA 4E70A 4KICA 3ZMVA 1R23A 3J80Z 4S04A 2ZO4A 1FYKA 3L7WA 1ZAOA 4LK0F 4HW0A 3WTWC 4JK1X 2IT0A 1XDUA 1U6GA 2LF8A 3GEZA 5DV5A 3O2PE 2YR2A 5L3DA 2G7HA 4GXOA 3K1PA 3MFKA 5HLGA 1YW9A 1IN8A 2FSWA 2DO7A 4BAYA 5J8FA 3P9KA 1SMYF 3J7AO 2STWA 1HW2A 1XDSA 3GFLA 3T8RA 2DK5A 3KEOA 4KN4X 4KA4A 3FZVA 5LGTA 3MWMA 5E20A 1HQCA 4LG0B 2VODA 2STTA 1UB9A 1LQ1A 3H92A 2K27A 3TOAA 2FBIA 2F5EA 2DQLA 1LEBA 2BYVE 1WI9A 4KT5C 4D0PA 1ZYRF 2DPUA 2DBBA 2XUBA 2VE9A 2DAOA 2E7XA 4KYWA 3JAMK 1MDMA 1XN7A 2E7WA 3ERED 1UHWA 1T98A 1JHFA 4U0WA 2D45A 2Q8KA 2JTVA 3CLOA 3HOSA 3CO6C 2A6HF 5K5OA 4A12A 2K02A 3H3ZA 4B8XA 3KP5A 4RS8A 2HFHA 2DLLA 1YG2A 3HRSA 2QBYB 2MC3A 5CVJA 5KK1A 1REPC 2QZ8A 4Q4ZF 2JPBA 3R60A 4BHPA 2P6SA 5H6QA 3BDDA 2A61A 3KP6A 4YG2F 4M71A 2H27A 3ZP5A 1ZRFA 2VONA 5LHHA 2PMHA 3HSRA 2IA1A 4M6XA 1ZRDA 1A04A 4WWCA 1BBYA 4OIPF 5TJJA 4XLPF 2VT2A 3D5LA 1YO5C 1R1VA 3WTSC 2XAGA 2R3SA 3TDZC 2EFQA 4EMSA 2HKOA 2XKOA 1F9NA 5FB2A 1J75A 1HXDA 1MJAA 1GXPA 4KNYA 4KMUX 4OU0A 2EJRA 1BN5A 1W5TA 1I27A 3BP8A 4HA8A 1GHCA 5JR3A 3KP4A 3T8TA 1QGPA 2UZKA 1FLIA 2HYFA 3EDPA 3ZMSA 2CWEA 3F22A 2WC2A 2Q2EA 3JSOA 3E5XA 3W6JB 3ABTA 1BM9A 1R58A 3MEXA 3E5QA 3IKVA 2V9VA 4ETSA 1SD4A 2XAQA 1BI1A 1TNTA 4LGWA 1ON2A 1XGMA 1P4AA 2ZKZA 2XKPA 1FX7A 1Z7UA 1XSXA 2Z33A 2BEOA 2O3FA 1H9TA 1JXSA 4ENMA 4G6DA 1IN5A 2LF7A 2FBKA 3DQVC 2LDUA 3E6BA 5DD8A 3DKWA 4O5VA 3OV8A 5CJ9A 2EA2A 3F6OA 4HLYA 2EV0A 5FFZA 1P6RA 3R0AA 4BHCA 2NNNA 4KDPA 5FLXK 3KE2A 1D3YA 3M9AA 3FWEA 3KZZA 3LA7A 3SHFA 3ULQB 1ONVA 1FPQA 4BH9A 4R79A 2QYOA 4IRIA 2EB7A 4RB3C 4KIGA 3OOPA 3E97A 1T38A 2M45A 1IZ1A 1DPRA 4F7ZA 4ZYGA 4I09A 2DT5A 4WCGA 1OPCA 1QQIA 4L9VA 2PLYA 2DFIA 4M6YA 3ISPA 3GF2A 3DFGA 1SD7A 2HQNA 4RAZA 5LGUA 1T6SA 3GLXA 3TDUC 2DQRA 2L02A 3C3WA 1IW7F 3V7SA 3DF8A 1ZG5A 2A69F 3DV8A 3WTZA 2KRFA 3I58A 1IUYA 5D5XB 3GW2A 5ICEA 1D8KA 3I59B 4B09A 3F8MA 4LFUA 1T2KA 2ZBKA 3REOA 2L54A 3WG9A 2FRHA 4L0YB 3L09A 3BWGA 3QPHA 1E17A 4AIKA 5HS7A 2EFOA 2D1VA 4A5NA 2XAFA 2ADUA 3B73A 2H94A 3CTAA 1FSHA 1IF1A 4IHTA 3T0YA 3FMRA 2XASA 1KYWA 2R7DA 4BYYA 4O6JA 5EEGA 1YQAA 1XMAA 3PQKA 3QRFF 3KEQA 5ILSA 3L9FA 5FFXA 4G8XA 2XGXA 2COMA 2GIVA 4U7BA 5CVUA 5HOOA 3GYHX 2HTSA 3FMSA 5FLXZ 1RZ4A 3FHZA 1R5GA 4GYIA 3I54A 3BZ6A 4HLXA 2FE3A 1I5ZA 2BBYA 5D4SA 2H6BA 3KLOA 5L3EA 5L3BA 5E1WA 2IVMA 5IT9Z 1R5HA 2KJBA 5ILUA 1EH6A 3LSTA 3BROA 4MTEA 3KP7A 4HQEA 4ZYEA 4XLNF 1D5VA 2GA1A 5H20A 5ICGA 3M7GA 1HBXG 1FC3A 4ENKA 2MLKA 1ZHFA 3HHHA 2A3SA 4EGYA 1S6LA 5HDKA 4PGHA 3V4GA 1OYYA 2NS0A 4G9YA 1FP1D 1TTYA 3HRMA 1Q1HA 5J6XA 1WRJA 3GZ5A 3LQQA 3IWZA 2YPRA 2FNPA 3F23A 4KIFA 2P4WA 2IW5A 2EK5A 1IN4A 4ASNA 4EVIA 3EUHA 1HKTA 3DPTA 2RNJA 1GVJA 1R7JA 4IPAA 3I71A 4AIHA 2IPQX 2MH9A 2OD5A 4LK1F 4I0AA 2NNYA 4IHSA 2ZCWA 4AWXB 4OIOF 3FM3A 4RB1A 3I5UA 4L5JA 4EM2A 1BIAA 3SQNA 3FXQA 3WTXC 2WTEA 2PI0A 6PAXA 4KN7X 1FYMA 1DPUA 1ZGJA 2HKXA 4HZFA 2O03A 3FM5A 4IJAA 3U2RA 3VEPA 3E6MA 5DUKA 4XSXF 2XRNA 4KUMA 1Y0UA 2MLGA 2YU3A 4Z2YA 1LDDA 1OMIA 4YFNF 5BPDA 2KKOA 4ZYHA 2OZUA 1YYVA 3RJPA 4M9SA 1FBUA 2W57A 2VC1A 2IA2A 4P55A 3DPLC 3ZMTA 4IRHA 4HX8A 4HX7A 4XRFA 4L5IA 4A2UA 1FZPB 1W7PD 2QWWA 3HHGA 2NAZA 5FD5A 3I64A 1HSTA 3HTUA 3V7RA 3GZ6A 1NHAA 2P5VA 4M72A 3B02A 5F1RA 3MZHA 3EYIA 2VBYA 3N97A 2ACJA 4UVAA 1TQIA 4EQQA 2XAHA 3MCZA 3COAC 4GGGA 2UWMA 1DUXC 3VFZA 3NQOA 3EQLF 3ZMZA 2HR3A 2CO5A 4P9FA 3J81Z 4PDKA 5E8IA 1I1GA 4OMZA 5D6FA 4WX9A 2P6TA 4WXCA 1LEAA 1AOYA 2FMLA 2O0YA 4LLGF 1Z6TA 4RGSA 4LJZF 3KZYA 4I2OA 4MTDA 4CGZA 4N9IA 1RI7A 4U88A 2M30A 5BPIA 1LB2A 4P9UA 3M1EA 1SFEA 1W7PA 1IRFA 1G3WA 4JBAA 2Z99A 3WTYC 3ROUA 3RTRA 2OBPA 2PFBA 3NRVA 3CUQB 2PQ8A 2QLZA 2JZYA 3KCCA 3CUOA 2QVOA 2W24A 5L3GA 4CZZA 2KIMA 1K6OA 2VBZA 1O3SA 4R1HA 4L9JA 4XSZF 4HYEA 3QAHA 4OIRF 1Z9CA 5F6FA 5DD4A 2VXZA 1FOKA 1WWXA 4EJUA 1G6NA 1TNSA 4AIJA 1LJ9A 1LVAA 4LLNA 2ZNYA 1U8RA 2PJPA 1USSA 5D5WB 5E17F 5JI6A 2FOKA 5J8CA 1ZG1A 1ZH5A 5K5RA 2P5KA 2ZNZA 1Z1DA 2Z9OA 3GVAA 1TQMA 1WSUA 5E1XA 4A6EA 1IXCA 2W85A 5FO5A 4N9HA 5DCFA 3K2ZA 3R6SA 2EV6A 1IXSB 4MNUA 2ETHA 2XHKA 1SD5A 5HS9A 1KU2A 1YIOA 3GX4X 2PG4A 2CG4A 2Z3YA 1XGSA 5CYVA 1K78B 3ML6A 4HV5A 1IAWA 1KA8A 1FP2A 4MEYF 1P92A 2BGCA 2VBWA 4R8HA 3JAMZ 3IL2A 3K69A 1L3LA 3WODF 1TW3A 3TOBA 4I98B 3U9GA 1QBJA 1LDJA 1EH8A 2O6GE 1BI0A 5D4RA 1B4AA 1HSJA 3RKXA 3KP2A 2Q0OA 2RGVA 3IWFA 3QP5A 1Z05A 3Q5FA 4H0EA 4MEXF 4A0YA 1BI3A 5HLHA 2K7LA 4Y15A 1I1SA 2K86A 3KFWX 2LNBA 3EETA 1KU7A 4Q48A 2Y48A 2IA0A 2FMYA 1T0FA 2HS5A 1KGSA 2HOEA 1SFXA 1L0OC 2FNAA 3K0LA 3LA3A 2XV4S 1S3JA 2HGCA 1MZBA 1QPMA 2AS5F 1P4WA 2AXLA 4CXFA 2CYYA 3TO9A 4L18B 1S7OA 1QZYA 2IP2A 4UNOA 3F6VA 2KIUA 1F1ZA 3IRQA 3C7JA 4BQAA 3P9IA 1ZGAA 1T39A 5EEHA 4LG0A 2YSRA 3LFKA 4G94A 1BI2A 3LA2A 3QPTA 1DDNA 3RIRA 2D1HA 2CFXA 2D2WA 1B9MA 2QM3A 4LD5A 5D8KB 2OAZA 4UHTA 2XIGA 5CVVA 2Y75A 2EFPA 5HVQC 2M87A 1CGPA 4DQ2A 4HDUA 5L3CA 1SD6A 1FSEA 1WQ2A 3C1DA 2RN7A 3CDHA 2GXBA 1IRGA 2O61A 2HZTA 3WGGA 3V8JA 3ELKA 3TQNA 1B6AA 5H6RA 2DU9A 1JGSA 4YIIA 1MJBA 5ED4A 3BJAA 2HEOA 1MDMB 3E5UA 5E18F 3GXOA 4GO1A 5LEJA 5K1YA 2FEZA 1TBXA 2QBYA 3ECOA 3CUQA 3IHUA 1PDNC 3QU3A 1UFMA 1P4XA 3LAPA 5DEQA 4MQVA 5DUIA 2CQKA 5L3FA 4MHGA 3IKTA 3RYPA 3SZTA 2FU4A 2HYGD 3LQRA 1YS7A 2K4JA 4GYGA 3WTUC 2QQAA 3C18A 2WWYA 1RUNA 1XGNA 4NHJA 1O57A 1G3YA 3SXYA 4ENNA 5CVIA 1YLFA 2DK8A 5E8GA 1Z6RA 3F8FA 4BNCA 2XROA 1XCBA 4YIFA 2M5WA 1KU9A 5JHUA 2L01A 1TQPA 3JW4A 3EYYA 4G7OF 2F2EA 1R36A 1XMKA 4I0BA 3LWFA 5DYMA 3O3KA 4Q47A 2BE5F 4HV6A 1J7KA 3WGIA 4RGUA 1RNLA 2W84A 3PQJA 3W6KB 1YS6A 3IRRA 1LNWA 1FNNA 4AVPA 1PUEE 1MJ9A 5D8LB 3GO5A 3HRUA 3BJOA 1UHMA 5ICCA 3HTSB 1E2XA 2HTJA 3CUQC 1Z91A 4WXHA 4L9NA 4FX0A 3I0TA 4HF1A 4M73A 1HW1A 2HWVA 4A0XA 4MGRA 3F8CA 2OQGA 3FXRA 3RPQA 2EV5A 2JRTA 5DDGA 2L3DA 1U5TB 4UVCA 1R00A 4IXAA 2F5DA 2H09A 4N0BA 2V6CA 4ESJA 1BIBA 4HF2A 3HUGA 2A5YB 3ZN0A 2XAJA 1G3TA 3PFIA 1ZREA 1F4KA 2L4AA 3JTHA 2DW4A 3IC7A 2MBFA 2RVCA 1SAXA 3GUDA 5BS6A 1CF7B 3DXJF 3ZN1A 3GFJA 1H0MA 4ESFA 4YFKF 3Q9SA 4RAYA 2FQ3A 1KQ8A 2RC4A 1QO0D 4Q5SF 4QWQA 3AAFA 3RKWA 3DEUA 2A6EF 5ERIA 5BQTA 2L4MA 4ZZDA 1ZLKA 2K4BA 2FXAA 2WV0A 2LKPA 5FD6A 4P5OA 2QENA 1KQ9A 4EJVA 2RDPA 2HQRA 3WU1B 1USTA 3BPVA 4UXNA 2MA3A 4FHTA 1QZZA 4GCVA 1YW8A 4KFCA 4OOIA 3BJ6A 3GFIA 1U2WA 2W25A 1FYLA 1BOAA 4EM0B 3V7CA 4M74A 3HIFA 4A6DA 2ESNA 3H3UA 3MAJA 5LHGA 2VBXA 3S2WA 1RUOA 4KIBA 5LLQA 3I59A 2KJCA 3L00A 2V1DA 3K9TA 4CYDA 3TKYA 1BC7C 2JPCA 3WTTC 1J0RA 4IVNA 3SFZA 5JVTA 2M1BA 2F5CA 5CVRA 1U78A 5HDNA 1MD0A 5DCMB 5AIPA 2RKHA 3K1MA 2EFNA 1R1TA 3HYIA 2UXXA 4O3MA 4YFXF 4DNCA 2P7CB 3F8NA 4S05A 5LBQA 1B1BA 1ON1A 1EH7A 3RI4A 2C6YA 2X0LA 4U7DA 1ULYA 2E1NA 3RYRA 3RKYA 2MH2A 3WTVC 1S7AA 2NYXA 2EA4A 3F72A 4A5MA 4OMYA 1O3RA 2ZMEB 5LHIA 4EJOA 1YTYA 3FMQA 1H9GA 1O7FA 4UV9A 4Y13A 4BXUA 2J5PA 1ZARA 4UUVA 4FX4A 3E3VA 2IRFG 1B9NA 2Z5UA 2ISYA 1C0WA 3R0JA 4JQFA 5LGNA 3FX3A 4K2EA 3MQ0A 2G7UA 5LRRA 2ISZA 3QP6A 3VB2A 3TO7A 5D5UB 2P8TA 3L2CA 2ESHA 2OZ6A 5K5QA 4G7HF 1F5TA 2PMUA 5E1ZB 2EFWA 4CHUA 2H6CA 4FT8A 4AD9A 1G4DA 5AIQA 2VN2A 2OQRA 4OINF 3KLNA 4EM1A 1DP7P 1U3EM 4PZJA 3G3ZA 4EJWA 3KETA 5ILVA 1U5TA 4EJTA 1ZLJA 2V1XA 2DTRA 2YX7A 3R4KA 4G7ZF 1FT9A 1FBSA 3HSEA 3P7NA 1BC8C 3VODA 1KQ0A 4HAMA 2MD5A 4CDGA 1S29A 2XVCA 4OIQF 1K79A 4TV7A 4KMFA 1CF7A 3HOTA 2PBIA 3D0SA 1D8JA 2RV8A 1ODDA 1V4RA 4MQ9F 3TO6A 3WGHA 1HKSA 4P96A 2IJLA 2VC0A 3HSFA 3RPUA 2ELHA 1R1UA 2UXNA 3BPXA 1QNTA 3BY6A 1JHHA 3F8BA 5JFRA 2FBHA 2KIFA 5LEKA 2Y0MA 2QQBA 3QU6A 1J2XA 2GAUA 2GZWA 5BMZA 3Q9VA 1LDKB 3ECHA 4I02A 2DI3A 4XBFA 3GWZA 2GWRA 1TW2A 4UV8A 5IT9K 4ENJA 2ZXJA 1U5TC 1XSDA 2EWNA 3P9CA 1O7LA 1RIOH 2GA2A 4HQMA 4LB6B 3HRTA 1EV7A 3F21A 1V3FA 5A2QK 3ZPLA 1J59A 5HS8A 1FBQA 2PN6A 1HKQA 4U0VA 3U1DA 4LB5A 1R22A 1OKRA 2VOPA 2QUFA 4HF0A 3WE2A 5IT3A 3FF5A 1MGTA 1OYIA 3JSPA 3K1NA 1PP8F 5DCMA 5KVRA 3LAJA 5D6EA 4WXDA 1XCVA 2GQQA 2FF4A 5CLSA 4QLCU 4IF4A 2P7VB 4HBLA 3FXUA 2B0LA 4BHBA 1BJAA 4U0YA 2JSCA 3E6DA 2PEXA 1MKMA 1J5YA 4CO8A 1ZG3A 1STZA 2NRAC 3ZQ7A 4CICA 5HLIA 1GXQA 1ZN2A 1TLHB 4LLLA 2M8EA 4HDVA 4ON0A 1PP7U 5TRDA 4LMYA 3DP7A 4NB5A 1W7PB 4EV0A 3T1BA 2BV6A 2P5LC 1W4MA 2JT1A 2X4HA 2CSOA 2QQ9A 2LSOA 3CO7C 1XGOA 3V8KA 5D5VB 5HDGA 2VT3A 1I6XA 2A68F 1IN7A 1WKMA 3J80K 4L9TA 2HDCA 4A0ZA 5ICFA 1G3SA 1XSVA 1O3QA 2E1CA 2ZMEA 2V79A 3RDIA 2GXGA 1X3UA 4I01A 3CJNA 4ZZLA 4UVBA 3VOEA 3JTGA 1OYWA 1YW7A 3E6CC 2R7FA 2F5FA 2CW0F 4G6QA 2YX4A 4IRGA 1O3TA 1J9IA 1P2FA 3MZYA 3N4MA 4L0ZB 1OR7A 2ZJ2A 1SMTA 1KYZA 4M9XA 2J5OA 4ESBA 2VOOA 1HW5A 1XD7A 4ZYDA 1K78A 5BOXA 1JE8A 3M8EA 3I53A 3TGNA 5A2QZ 1K7AA 4RGRA 3O6BB 4HOBA 4RB0A 1FY7A 5AONA 3BOQA 4I7HA 3ZMUA 3J81K 3ZMDA 3WU0A 1IN6A 2VE8A 3I4PA 2CGPA 3SZPA 4WK8F 1FWZA 3F3XA 4RB2C 4PCQA 2OA4A 1ZRCA 3NEUA 1YFHA 3R61A 4RGXA 2A07F 2DPDA 5LRSA 2V1UA 3V8LA 1UCRA 4Y17A 1B59A 3WE3A 1KU3A 2ZFWA 4EGZA 3GFMA 1XB4A 3T5XA 3QOPA 2OU2A 2O8XA 1IXRC 2G9WA 2FA5A 3G73A 3M8FA 4PGGA 4NQWA 1W5SA 1VTNC 1SFUA 5FGMA 2RQPA 3ABUA 5F64A 1AWCA 4M9ZA 4WF2A 4HX4A 2TDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP3 A;  4ZH4 F;  1S8N A;  4E70 A;  4KIC A;  3ZMV A;  1R23 A;  3J80 Z;  4S04 A;  2ZO4 A;  1FYK A;  3L7W A;  1ZAO A;  4LK0 F;  4HW0 A;  3WTW C;  4JK1 X;  2IT0 A;  1XDU A;  1U6G A;  2LF8 A;  3GEZ A;  5DV5 A;  3O2P E;  2YR2 A;  5L3D A;  2G7H A;  4GXO A;  3K1P A;  3MFK A;  5HLG A;  1YW9 A;  1IN8 A;  2FSW A;  2DO7 A;  4BAY A;  5J8F A;  3P9K A;  1SMY F;  3J7A O;  2STW A;  1HW2 A;  1XDS A;  3GFL A;  3T8R A;  2DK5 A;  3KEO A;  4KN4 X;  4KA4 A;  3FZV A;  5LGT A;  3MWM A;  5E20 A;  1HQC A;  4LG0 B;  2VOD A;  2STT A;  1UB9 A;  1LQ1 A;  3H92 A;  2K27 A;  3TOA A;  2FBI A;  2F5E A;  2DQL A;  1LEB A;  2BYV E;  1WI9 A;  4KT5 C;  4D0P A;  1ZYR F;  2DPU A;  2DBB A;  2XUB A;  2VE9 A;  2DAO A;  2E7X A;  4KYW A;  3JAM K;  1MDM A;  1XN7 A;  2E7W A;  3ERE D;  1UHW A;  1T98 A;  1JHF A;  4U0W A;  2D45 A;  2Q8K A;  2JTV A;  3CLO A;  3HOS A;  3CO6 C;  2A6H F;  5K5O A;  4A12 A;  2K02 A;  3H3Z A;  4B8X A;  3KP5 A;  4RS8 A;  2HFH A;  2DLL A;  1YG2 A;  3HRS A;  2QBY B;  2MC3 A;  5CVJ A;  5KK1 A;  1REP C;  2QZ8 A;  4Q4Z F;  2JPB A;  3R60 A;  4BHP A;  2P6S A;  5H6Q A;  3BDD A;  2A61 A;  3KP6 A;  4YG2 F;  4M71 A;  2H27 A;  3ZP5 A;  1ZRF A;  2VON A;  5LHH A;  2PMH A;  3HSR A;  2IA1 A;  4M6X A;  1ZRD A;  1A04 A;  4WWC A;  1BBY A;  4OIP F;  5TJJ A;  4XLP F;  2VT2 A;  3D5L A;  1YO5 C;  1R1V A;  3WTS C;  2XAG A;  2R3S A;  3TDZ C;  2EFQ A;  4EMS A;  2HKO A;  2XKO A;  1F9N A;  5FB2 A;  1J75 A;  1HXD A;  1MJA A;  1GXP A;  4KNY A;  4KMU X;  4OU0 A;  2EJR A;  1BN5 A;  1W5T A;  1I27 A;  3BP8 A;  4HA8 A;  1GHC A;  5JR3 A;  3KP4 A;  3T8T A;  1QGP A;  2UZK A;  1FLI A;  2HYF A;  3EDP A;  3ZMS A;  2CWE A;  3F22 A;  2WC2 A;  2Q2E A;  3JSO A;  3E5X A;  3W6J B;  3ABT A;  1BM9 A;  1R58 A;  3MEX A;  3E5Q A;  3IKV A;  2V9V A;  4ETS A;  1SD4 A;  2XAQ A;  1BI1 A;  1TNT A;  4LGW A;  1ON2 A;  1XGM A;  1P4A A;  2ZKZ A;  2XKP A;  1FX7 A;  1Z7U A;  1XSX A;  2Z33 A;  2BEO A;  2O3F A;  1H9T A;  1JXS A;  4ENM A;  4G6D A;  1IN5 A;  2LF7 A;  2FBK A;  3DQV C;  2LDU A;  3E6B A;  5DD8 A;  3DKW A;  4O5V A;  3OV8 A;  5CJ9 A;  2EA2 A;  3F6O A;  4HLY A;  2EV0 A;  5FFZ A;  1P6R A;  3R0A A;  4BHC A;  2NNN A;  4KDP A;  5FLX K;  3KE2 A;  1D3Y A;  3M9A A;  3FWE A;  3KZZ A;  3LA7 A;  3SHF A;  3ULQ B;  1ONV A;  1FPQ A;  4BH9 A;  4R79 A;  2QYO A;  4IRI A;  2EB7 A;  4RB3 C;  4KIG A;  3OOP A;  3E97 A;  1T38 A;  2M45 A;  1IZ1 A;  1DPR A;  4F7Z A;  4ZYG A;  4I09 A;  2DT5 A;  4WCG A;  1OPC A;  1QQI A;  4L9V A;  2PLY A;  2DFI A;  4M6Y A;  3ISP A;  3GF2 A;  3DFG A;  1SD7 A;  2HQN A;  4RAZ A;  5LGU A;  1T6S A;  3GLX A;  3TDU C;  2DQR A;  2L02 A;  3C3W A;  1IW7 F;  3V7S A;  3DF8 A;  1ZG5 A;  2A69 F;  3DV8 A;  3WTZ A;  2KRF A;  3I58 A;  1IUY A;  5D5X B;  3GW2 A;  5ICE A;  1D8K A;  3I59 B;  4B09 A;  3F8M A;  4LFU A;  1T2K A;  2ZBK A;  3REO A;  2L54 A;  3WG9 A;  2FRH A;  4L0Y B;  3L09 A;  3BWG A;  3QPH A;  1E17 A;  4AIK A;  5HS7 A;  2EFO A;  2D1V A;  4A5N A;  2XAF A;  2ADU A;  3B73 A;  2H94 A;  3CTA A;  1FSH A;  1IF1 A;  4IHT A;  3T0Y A;  3FMR A;  2XAS A;  1KYW A;  2R7D A;  4BYY A;  4O6J A;  5EEG A;  1YQA A;  1XMA A;  3PQK A;  3QRF F;  3KEQ A;  5ILS A;  3L9F A;  5FFX A;  4G8X A;  2XGX A;  2COM A;  2GIV A;  4U7B A;  5CVU A;  5HOO A;  3GYH X;  2HTS A;  3FMS A;  5FLX Z;  1RZ4 A;  3FHZ A;  1R5G A;  4GYI A;  3I54 A;  3BZ6 A;  4HLX A;  2FE3 A;  1I5Z A;  2BBY A;  5D4S A;  2H6B A;  3KLO A;  5L3E A;  5L3B A;  5E1W A;  2IVM A;  5IT9 Z;  1R5H A;  2KJB A;  5ILU A;  1EH6 A;  3LST A;  3BRO A;  4MTE A;  3KP7 A;  4HQE A;  4ZYE A;  4XLN F;  1D5V A;  2GA1 A;  5H20 A;  5ICG A;  3M7G A;  1HBX G;  1FC3 A;  4ENK A;  2MLK A;  1ZHF A;  3HHH A;  2A3S A;  4EGY A;  1S6L A;  5HDK A;  4PGH A;  3V4G A;  1OYY A;  2NS0 A;  4G9Y A;  1FP1 D;  1TTY A;  3HRM A;  1Q1H A;  5J6X A;  1WRJ A;  3GZ5 A;  3LQQ A;  3IWZ A;  2YPR A;  2FNP A;  3F23 A;  4KIF A;  2P4W A;  2IW5 A;  2EK5 A;  1IN4 A;  4ASN A;  4EVI A;  3EUH A;  1HKT A;  3DPT A;  2RNJ A;  1GVJ A;  1R7J A;  4IPA A;  3I71 A;  4AIH A;  2IPQ X;  2MH9 A;  2OD5 A;  4LK1 F;  4I0A A;  2NNY A;  4IHS A;  2ZCW A;  4AWX B;  4OIO F;  3FM3 A;  4RB1 A;  3I5U A;  4L5J A;  4EM2 A;  1BIA A;  3SQN A;  3FXQ A;  3WTX C;  2WTE A;  2PI0 A;  6PAX A;  4KN7 X;  1FYM A;  1DPU A;  1ZGJ A;  2HKX A;  4HZF A;  2O03 A;  3FM5 A;  4IJA A;  3U2R A;  3VEP A;  3E6M A;  5DUK A;  4XSX F;  2XRN A;  4KUM A;  1Y0U A;  2MLG A;  2YU3 A;  4Z2Y A;  1LDD A;  1OMI A;  4YFN F;  5BPD A;  2KKO A;  4ZYH A;  2OZU A;  1YYV A;  3RJP A;  4M9S A;  1FBU A;  2W57 A;  2VC1 A;  2IA2 A;  4P55 A;  3DPL C;  3ZMT A;  4IRH A;  4HX8 A;  4HX7 A;  4XRF A;  4L5I A;  4A2U A;  1FZP B;  1W7P D;  2QWW A;  3HHG A;  2NAZ A;  5FD5 A;  3I64 A;  1HST A;  3HTU A;  3V7R A;  3GZ6 A;  1NHA A;  2P5V A;  4M72 A;  3B02 A;  5F1R A;  3MZH A;  3EYI A;  2VBY A;  3N97 A;  2ACJ A;  4UVA A;  1TQI A;  4EQQ A;  2XAH A;  3MCZ A;  3COA C;  4GGG A;  2UWM A;  1DUX C;  3VFZ A;  3NQO A;  3EQL F;  3ZMZ A;  2HR3 A;  2CO5 A;  4P9F A;  3J81 Z;  4PDK A;  5E8I A;  1I1G A;  4OMZ A;  5D6F A;  4WX9 A;  2P6T A;  4WXC A;  1LEA A;  1AOY A;  2FML A;  2O0Y A;  4LLG F;  1Z6T A;  4RGS A;  4LJZ F;  3KZY A;  4I2O A;  4MTD A;  4CGZ A;  4N9I A;  1RI7 A;  4U88 A;  2M30 A;  5BPI A;  1LB2 A;  4P9U A;  3M1E A;  1SFE A;  1W7P A;  1IRF A;  1G3W A;  4JBA A;  2Z99 A;  3WTY C;  3ROU A;  3RTR A;  2OBP A;  2PFB A;  3NRV A;  3CUQ B;  2PQ8 A;  2QLZ A;  2JZY A;  3KCC A;  3CUO A;  2QVO A;  2W24 A;  5L3G A;  4CZZ A;  2KIM A;  1K6O A;  2VBZ A;  1O3S A;  4R1H A;  4L9J A;  4XSZ F;  4HYE A;  3QAH A;  4OIR F;  1Z9C A;  5F6F A;  5DD4 A;  2VXZ A;  1FOK A;  1WWX A;  4EJU A;  1G6N A;  1TNS A;  4AIJ A;  1LJ9 A;  1LVA A;  4LLN A;  2ZNY A;  1U8R A;  2PJP A;  1USS A;  5D5W B;  5E17 F;  5JI6 A;  2FOK A;  5J8C A;  1ZG1 A;  1ZH5 A;  5K5R A;  2P5K A;  2ZNZ A;  1Z1D A;  2Z9O A;  3GVA A;  1TQM A;  1WSU A;  5E1X A;  4A6E A;  1IXC A;  2W85 A;  5FO5 A;  4N9H A;  5DCF A;  3K2Z A;  3R6S A;  2EV6 A;  1IXS B;  4MNU A;  2ETH A;  2XHK A;  1SD5 A;  5HS9 A;  1KU2 A;  1YIO A;  3GX4 X;  2PG4 A;  2CG4 A;  2Z3Y A;  1XGS A;  5CYV A;  1K78 B;  3ML6 A;  4HV5 A;  1IAW A;  1KA8 A;  1FP2 A;  4MEY F;  1P92 A;  2BGC A;  2VBW A;  4R8H A;  3JAM Z;  3IL2 A;  3K69 A;  1L3L A;  3WOD F;  1TW3 A;  3TOB A;  4I98 B;  3U9G A;  1QBJ A;  1LDJ A;  1EH8 A;  2O6G E;  1BI0 A;  5D4R A;  1B4A A;  1HSJ A;  3RKX A;  3KP2 A;  2Q0O A;  2RGV A;  3IWF A;  3QP5 A;  1Z05 A;  3Q5F A;  4H0E A;  4MEX F;  4A0Y A;  1BI3 A;  5HLH A;  2K7L A;  4Y15 A;  1I1S A;  2K86 A;  3KFW X;  2LNB A;  3EET A;  1KU7 A;  4Q48 A;  2Y48 A;  2IA0 A;  2FMY A;  1T0F A;  2HS5 A;  1KGS A;  2HOE A;  1SFX A;  1L0O C;  2FNA A;  3K0L A;  3LA3 A;  2XV4 S;  1S3J A;  2HGC A;  1MZB A;  1QPM A;  2AS5 F;  1P4W A;  2AXL A;  4CXF A;  2CYY A;  3TO9 A;  4L18 B;  1S7O A;  1QZY A;  2IP2 A;  4UNO A;  3F6V A;  2KIU A;  1F1Z A;  3IRQ A;  3C7J A;  4BQA A;  3P9I A;  1ZGA A;  1T39 A;  5EEH A;  4LG0 A;  2YSR A;  3LFK A;  4G94 A;  1BI2 A;  3LA2 A;  3QPT A;  1DDN A;  3RIR A;  2D1H A;  2CFX A;  2D2W A;  1B9M A;  2QM3 A;  4LD5 A;  5D8K B;  2OAZ A;  4UHT A;  2XIG A;  5CVV A;  2Y75 A;  2EFP A;  5HVQ C;  2M87 A;  1CGP A;  4DQ2 A;  4HDU A;  5L3C A;  1SD6 A;  1FSE A;  1WQ2 A;  3C1D A;  2RN7 A;  3CDH A;  2GXB A;  1IRG A;  2O61 A;  2HZT A;  3WGG A;  3V8J A;  3ELK A;  3TQN A;  1B6A A;  5H6R A;  2DU9 A;  1JGS A;  4YII A;  1MJB A;  5ED4 A;  3BJA A;  2HEO A;  1MDM B;  3E5U A;  5E18 F;  3GXO A;  4GO1 A;  5LEJ A;  5K1Y A;  2FEZ A;  1TBX A;  2QBY A;  3ECO A;  3CUQ A;  3IHU A;  1PDN C;  3QU3 A;  1UFM A;  1P4X A;  3LAP A;  5DEQ A;  4MQV A;  5DUI A;  2CQK A;  5L3F A;  4MHG A;  3IKT A;  3RYP A;  3SZT A;  2FU4 A;  2HYG D;  3LQR A;  1YS7 A;  2K4J A;  4GYG A;  3WTU C;  2QQA A;  3C18 A;  2WWY A;  1RUN A;  1XGN A;  4NHJ A;  1O57 A;  1G3Y A;  3SXY A;  4ENN A;  5CVI A;  1YLF A;  2DK8 A;  5E8G A;  1Z6R A;  3F8F A;  4BNC A;  2XRO A;  1XCB A;  4YIF A;  2M5W A;  1KU9 A;  5JHU A;  2L01 A;  1TQP A;  3JW4 A;  3EYY A;  4G7O F;  2F2E A;  1R36 A;  1XMK A;  4I0B A;  3LWF A;  5DYM A;  3O3K A;  4Q47 A;  2BE5 F;  4HV6 A;  1J7K A;  3WGI A;  4RGU A;  1RNL A;  2W84 A;  3PQJ A;  3W6K B;  1YS6 A;  3IRR A;  1LNW A;  1FNN A;  4AVP A;  1PUE E;  1MJ9 A;  5D8L B;  3GO5 A;  3HRU A;  3BJO A;  1UHM A;  5ICC A;  3HTS B;  1E2X A;  2HTJ A;  3CUQ C;  1Z91 A;  4WXH A;  4L9N A;  4FX0 A;  3I0T A;  4HF1 A;  4M73 A;  1HW1 A;  2HWV A;  4A0X A;  4MGR A;  3F8C A;  2OQG A;  3FXR A;  3RPQ A;  2EV5 A;  2JRT A;  5DDG A;  2L3D A;  1U5T B;  4UVC A;  1R00 A;  4IXA A;  2F5D A;  2H09 A;  4N0B A;  2V6C A;  4ESJ A;  1BIB A;  4HF2 A;  3HUG A;  2A5Y B;  3ZN0 A;  2XAJ A;  1G3T A;  3PFI A;  1ZRE A;  1F4K A;  2L4A A;  3JTH A;  2DW4 A;  3IC7 A;  2MBF A;  2RVC A;  1SAX A;  3GUD A;  5BS6 A;  1CF7 B;  3DXJ F;  3ZN1 A;  3GFJ A;  1H0M A;  4ESF A;  4YFK F;  3Q9S A;  4RAY A;  2FQ3 A;  1KQ8 A;  2RC4 A;  1QO0 D;  4Q5S F;  4QWQ A;  3AAF A;  3RKW A;  3DEU A;  2A6E F;  5ERI A;  5BQT A;  2L4M A;  4ZZD A;  1ZLK A;  2K4B A;  2FXA A;  2WV0 A;  2LKP A;  5FD6 A;  4P5O A;  2QEN A;  1KQ9 A;  4EJV A;  2RDP A;  2HQR A;  3WU1 B;  1UST A;  3BPV A;  4UXN A;  2MA3 A;  4FHT A;  1QZZ A;  4GCV A;  1YW8 A;  4KFC A;  4OOI A;  3BJ6 A;  3GFI A;  1U2W A;  2W25 A;  1FYL A;  1BOA A;  4EM0 B;  3V7C A;  4M74 A;  3HIF A;  4A6D A;  2ESN A;  3H3U A;  3MAJ A;  5LHG A;  2VBX A;  3S2W A;  1RUO A;  4KIB A;  5LLQ A;  3I59 A;  2KJC A;  3L00 A;  2V1D A;  3K9T A;  4CYD A;  3TKY A;  1BC7 C;  2JPC A;  3WTT C;  1J0R A;  4IVN A;  3SFZ A;  5JVT A;  2M1B A;  2F5C A;  5CVR A;  1U78 A;  5HDN A;  1MD0 A;  5DCM B;  5AIP A;  2RKH A;  3K1M A;  2EFN A;  1R1T A;  3HYI A;  2UXX A;  4O3M A;  4YFX F;  4DNC A;  2P7C B;  3F8N A;  4S05 A;  5LBQ A;  1B1B A;  1ON1 A;  1EH7 A;  3RI4 A;  2C6Y A;  2X0L A;  4U7D A;  1ULY A;  2E1N A;  3RYR A;  3RKY A;  2MH2 A;  3WTV C;  1S7A A;  2NYX A;  2EA4 A;  3F72 A;  4A5M A;  4OMY A;  1O3R A;  2ZME B;  5LHI A;  4EJO A;  1YTY A;  3FMQ A;  1H9G A;  1O7F A;  4UV9 A;  4Y13 A;  4BXU A;  2J5P A;  1ZAR A;  4UUV A;  4FX4 A;  3E3V A;  2IRF G;  1B9N A;  2Z5U A;  2ISY A;  1C0W A;  3R0J A;  4JQF A;  5LGN A;  3FX3 A;  4K2E A;  3MQ0 A;  2G7U A;  5LRR A;  2ISZ A;  3QP6 A;  3VB2 A;  3TO7 A;  5D5U B;  2P8T A;  3L2C A;  2ESH A;  2OZ6 A;  5K5Q A;  4G7H F;  1F5T A;  2PMU A;  5E1Z B;  2EFW A;  4CHU A;  2H6C A;  4FT8 A;  4AD9 A;  1G4D A;  5AIQ A;  2VN2 A;  2OQR A;  4OIN F;  3KLN A;  4EM1 A;  1DP7 P;  1U3E M;  4PZJ A;  3G3Z A;  4EJW A;  3KET A;  5ILV A;  1U5T A;  4EJT A;  1ZLJ A;  2V1X A;  2DTR A;  2YX7 A;  3R4K A;  4G7Z F;  1FT9 A;  1FBS A;  3HSE A;  3P7N A;  1BC8 C;  3VOD A;  1KQ0 A;  4HAM A;  2MD5 A;  4CDG A;  1S29 A;  2XVC A;  4OIQ F;  1K79 A;  4TV7 A;  4KMF A;  1CF7 A;  3HOT A;  2PBI A;  3D0S A;  1D8J A;  2RV8 A;  1ODD A;  1V4R A;  4MQ9 F;  3TO6 A;  3WGH A;  1HKS A;  4P96 A;  2IJL A;  2VC0 A;  3HSF A;  3RPU A;  2ELH A;  1R1U A;  2UXN A;  3BPX A;  1QNT A;  3BY6 A;  1JHH A;  3F8B A;  5JFR A;  2FBH A;  2KIF A;  5LEK A;  2Y0M A;  2QQB A;  3QU6 A;  1J2X A;  2GAU A;  2GZW A;  5BMZ A;  3Q9V A;  1LDK B;  3ECH A;  4I02 A;  2DI3 A;  4XBF A;  3GWZ A;  2GWR A;  1TW2 A;  4UV8 A;  5IT9 K;  4ENJ A;  2ZXJ A;  1U5T C;  1XSD A;  2EWN A;  3P9C A;  1O7L A;  1RIO H;  2GA2 A;  4HQM A;  4LB6 B;  3HRT A;  1EV7 A;  3F21 A;  1V3F A;  5A2Q K;  3ZPL A;  1J59 A;  5HS8 A;  1FBQ A;  2PN6 A;  1HKQ A;  4U0V A;  3U1D A;  4LB5 A;  1R22 A;  1OKR A;  2VOP A;  2QUF A;  4HF0 A;  3WE2 A;  5IT3 A;  3FF5 A;  1MGT A;  1OYI A;  3JSP A;  3K1N A;  1PP8 F;  5DCM A;  5KVR A;  3LAJ A;  5D6E A;  4WXD A;  1XCV A;  2GQQ A;  2FF4 A;  5CLS A;  4QLC U;  4IF4 A;  2P7V B;  4HBL A;  3FXU A;  2B0L A;  4BHB A;  1BJA A;  4U0Y A;  2JSC A;  3E6D A;  2PEX A;  1MKM A;  1J5Y A;  4CO8 A;  1ZG3 A;  1STZ A;  2NRA C;  3ZQ7 A;  4CIC A;  5HLI A;  1GXQ A;  1ZN2 A;  1TLH B;  4LLL A;  2M8E A;  4HDV A;  4ON0 A;  1PP7 U;  5TRD A;  4LMY A;  3DP7 A;  4NB5 A;  1W7P B;  4EV0 A;  3T1B A;  2BV6 A;  2P5L C;  1W4M A;  2JT1 A;  2X4H A;  2CSO A;  2QQ9 A;  2LSO A;  3CO7 C;  1XGO A;  3V8K A;  5D5V B;  5HDG A;  2VT3 A;  1I6X A;  2A68 F;  1IN7 A;  1WKM A;  3J80 K;  4L9T A;  2HDC A;  4A0Z A;  5ICF A;  1G3S A;  1XSV A;  1O3Q A;  2E1C A;  2ZME A;  2V79 A;  3RDI A;  2GXG A;  1X3U A;  4I01 A;  3CJN A;  4ZZL A;  4UVB A;  3VOE A;  3JTG A;  1OYW A;  1YW7 A;  3E6C C;  2R7F A;  2F5F A;  2CW0 F;  4G6Q A;  2YX4 A;  4IRG A;  1O3T A;  1J9I A;  1P2F A;  3MZY A;  3N4M A;  4L0Z B;  1OR7 A;  2ZJ2 A;  1SMT A;  1KYZ A;  4M9X A;  2J5O A;  4ESB A;  2VOO A;  1HW5 A;  1XD7 A;  4ZYD A;  1K78 A;  5BOX A;  1JE8 A;  3M8E A;  3I53 A;  3TGN A;  5A2Q Z;  1K7A A;  4RGR A;  3O6B B;  4HOB A;  4RB0 A;  1FY7 A;  5AON A;  3BOQ A;  4I7H A;  3ZMU A;  3J81 K;  3ZMD A;  3WU0 A;  1IN6 A;  2VE8 A;  3I4P A;  2CGP A;  3SZP A;  4WK8 F;  1FWZ A;  3F3X A;  4RB2 C;  4PCQ A;  2OA4 A;  1ZRC A;  3NEU A;  1YFH A;  3R61 A;  4RGX A;  2A07 F;  2DPD A;  5LRS A;  2V1U A;  3V8L A;  1UCR A;  4Y17 A;  1B59 A;  3WE3 A;  1KU3 A;  2ZFW A;  4EGZ A;  3GFM A;  1XB4 A;  3T5X A;  3QOP A;  2OU2 A;  2O8X A;  1IXR C;  2G9W A;  2FA5 A;  3G73 A;  3M8F A;  4PGG A;  4NQW A;  1W5S A;  1VTN C;  1SFU A;  5FGM A;  2RQP A;  3ABU A;  5F64 A;  1AWC A;  4M9Z A;  4WF2 A;  4HX4 A;  2TDX A; 
#chains in the Genus database with same CATH topology
 4ZJZ A;  3KP3 A;  3L2W A;  2LC2 A;  4ZH4 F;  1S8N A;  4E70 A;  4IHX A;  3H0G J;  4KIC A;  4QIW N;  3VDX A;  1OR7 C;  3GCM A;  2OCC H;  3S3N A;  2QCO A;  3ZMV A;  1R23 A;  1VQ8 I;  4DYC A;  3J80 Z;  2LY1 A;  4S04 A;  2ZO4 A;  1FYK A;  3L7W A;  1ZAO A;  4LK0 F;  4HW0 A;  3K4B A;  1RC9 A;  3WTW C;  4JK1 X;  2IT0 A;  1QHG A;  1YOV B;  3K4N A;  1XDU A;  4BUP A;  1U6G A;  2LF8 A;  3GEZ A;  5DV5 A;  3QOE A;  3O2P E;  2YR2 A;  3OIQ A;  5L3D A;  2DMP A;  2ME0 A;  2CS3 A;  2G7H A;  4KT6 A;  2M4K A;  2HDW A;  4GXO A;  4QTR A;  3K1P A;  3MFK A;  5HLG A;  2ELK A;  1YW9 A;  4NC7 A;  1IDZ A;  1IN8 A;  2QF7 A;  2FSW A;  2DO7 A;  4BAY A;  2E5N A;  5J8F A;  2M34 A;  2YUS A;  2JRM A;  3P9K A;  1SMY F;  3OYJ A;  1U9O A;  2LH9 A;  5KHD A;  3J7A O;  2STW A;  1HW2 A;  1XDS A;  3GFL A;  4FE7 A;  3T8R A;  2DK5 A;  1LUJ B;  2VJJ A;  3MKZ A;  2L9V A;  3KEO A;  4KN4 X;  4KA4 A;  2FD5 A;  2AHQ A;  3FZV A;  5LGT A;  3CMM A;  3MWM A;  5E20 A;  1HQC A;  4LG0 B;  2VOD A;  2F5V A;  2E1O A;  2E34 A;  3GTK J;  1VQ7 I;  5FKO A;  4CH7 A;  1UB9 A;  4XR6 A;  2STT A;  1WJA A;  1LQ1 A;  3H92 A;  3B6C A;  1P9Q C;  2L0K A;  2VL8 A;  2K27 A;  2XF6 A;  1JKO C;  3PJR A;  3TOA A;  1IV6 A;  2V6E A;  1NK3 P;  2FBI A;  2F5E A;  3U1K A;  2DQL A;  4D1Q A;  3JRB A;  1LEB A;  2BYV E;  1WI9 A;  4KT5 C;  4M3D A;  4D0P A;  2ZJP F;  1ETV A;  1ZYR F;  2P0W A;  1TT0 A;  2VPR A;  2DPU A;  5K7F A;  5CQE A;  3OYC A;  3AL0 B;  4YEL A;  2DBB A;  3CJT B;  1VQN I;  4E7H A;  2V26 A;  2XUB A;  2H8R A;  2VE9 A;  2DAO A;  3GTJ J;  1F36 A;  2E7X A;  1H89 C;  4KYW A;  3JAM K;  2VJI A;  4D7M A;  4LIU A;  1MDM A;  2VKE A;  4C3J J;  2F4M B;  1XN7 A;  2E7W A;  4NNJ A;  3ERE D;  2Q1Z B;  1UHW A;  4YRV A;  4CSW A;  1T98 A;  4BEH B;  1JHF A;  4U0W A;  5J4Y A;  1MBG A;  5GP9 A;  1W36 C;  3DLA A;  3H9G A;  2B9S A;  1VI0 A;  2CV1 A;  2D45 A;  2Q8K A;  2JTV A;  1WGX A;  1NG7 A;  3CLO A;  3HOS A;  4RDU A;  3CO6 C;  4B3X A;  2A6H F;  1Y39 A;  2R7T A;  2GIZ A;  4S0H B;  3ZOB A;  1A5J A;  2GOX B;  2LMD A;  5IOZ A;  4XLA A;  5F0C A;  5K5O A;  1D1B A;  3L2R A;  4A12 A;  2OPT A;  2K02 A;  1OJL A;  3FIS A;  3H3Z A;  4B8X A;  1TC3 C;  3KP5 A;  4RS8 A;  2HFH A;  2M9H A;  2EQR A;  2DLL A;  1YG2 A;  3HRS A;  2QBY B;  2MC3 A;  3HG9 A;  2W00 A;  5CVJ A;  5KK1 A;  1REP C;  3GTO J;  2QZ8 A;  1MH3 A;  1D5Y A;  4Q4Z F;  2JPB A;  5FJ8 J;  3R60 A;  4BHP A;  2P6S A;  5H6Q A;  3BDD A;  2A61 A;  3KP6 A;  4XQF A;  4YG2 F;  4M71 A;  2H27 A;  3LOC A;  3ZP5 A;  3GBG A;  5DM6 F;  4C2M J;  4Y4R A;  3JRE A;  1ZRF A;  1RRJ A;  2VON A;  5CPR B;  5LHH A;  2PMH A;  3HSR A;  2IA1 A;  4ZDP A;  3CCY A;  4M6X A;  3JCU C;  1ZRD A;  2WY7 Q;  2K40 A;  1A04 A;  4WWC A;  4JOM A;  1BBY A;  2M0M A;  4OIP F;  1N78 A;  5TJJ A;  4XLP F;  2VT2 A;  3D5L A;  1X3Z B;  5LD2 C;  1YO5 C;  1R1V A;  3WTS C;  1OFC X;  2H1K A;  1WI3 A;  2XAG A;  2MG4 A;  2R3S A;  3TDZ C;  2HOT A;  5GPA A;  2EFQ A;  4C3H J;  4EMS A;  2HKO A;  2XKO A;  1F9N A;  5FB2 A;  3CCV I;  1J75 A;  1HXD A;  1MJA A;  2MC4 A;  2LBF A;  1ZGW A;  1GXP A;  1IRZ A;  2QEX I;  4KNY A;  2CUJ A;  2DJI A;  4KMU X;  5TGT A;  4F91 B;  2V7F A;  1UG2 A;  4OU0 A;  2EJR A;  1BN5 A;  1W5T A;  3RPU D;  2LYC A;  3WHB A;  3OR1 C;  1I27 A;  2CUE A;  3BP8 A;  1YIJ I;  4HA8 A;  1GHC A;  5JR3 A;  2EZH A;  4BY7 J;  1Z67 A;  3KP4 A;  3RZD J;  5FKK A;  2I8D A;  3T8T A;  1QGP A;  3SEZ A;  3VYS B;  2UZK A;  1FTZ A;  1X4O A;  1FLI A;  2HYF A;  3EDP A;  4BE2 A;  3ZMS A;  4F93 B;  4LIV A;  2CWE A;  5F0F A;  3F22 A;  2WC2 A;  2IAI A;  4IOA F;  4UY8 I;  2Q2E A;  3JSO A;  3AFH A;  3E5X A;  2X6O A;  3W6J B;  5EDN A;  1YRN A;  3S1M J;  3ABT A;  3VSL A;  4FCY A;  2F4O B;  3FK6 A;  1BM9 A;  1R58 A;  3MEX A;  3E5Q A;  1K4T A;  1A31 A;  3I4M J;  3IKV A;  1ETX A;  2R5Z A;  2V9V A;  4ETS A;  1V55 H;  1SD4 A;  5E79 C;  1BW5 A;  4BDZ A;  2XAQ A;  2BY3 A;  1BI1 A;  2VUM J;  2X48 A;  1TNT A;  4LGW A;  1ON2 A;  1XGM A;  1P4A A;  4AU7 A;  2ZKZ A;  2XKP A;  1FX7 A;  2ECB A;  5J1Y A;  1Z7U A;  5K7H A;  1XSX A;  2XPU A;  2Z33 A;  2BEO A;  2O3F A;  1H9T A;  5EGO B;  1JXS A;  2DMN A;  5E3N A;  4ENM A;  4G6D A;  4DYQ A;  1IN5 A;  2LF7 A;  1PUF B;  3HUG B;  3SYT A;  3OYE A;  3OR2 C;  2PX9 A;  1MND A;  2FBK A;  2VQC A;  2K3F A;  2LDU A;  3DQV C;  3E6B A;  3MD2 A;  5DD8 A;  1IJW C;  3DKW A;  4O5V A;  3CCE I;  3OV8 A;  5CJ9 A;  3JRH A;  2EA2 A;  1MBH A;  2E1M C;  2E36 A;  1QU3 A;  3F6O A;  1RES A;  4HST A;  3CC4 I;  4HLY A;  1T95 A;  2DFE A;  3OYD A;  3FXM A;  2EV0 A;  2JA8 J;  2R7Z J;  5FFZ A;  2CJJ A;  1P6R A;  1ERD A;  1SC7 A;  2L7Z A;  3CQZ J;  2LOO A;  2ZSI B;  1SAU A;  3W2W A;  3R0A A;  5KAF C;  3LFU A;  4BHC A;  4JX5 A;  4IZZ A;  4BXX J;  2NNN A;  2LLK A;  5IYC J;  4KDP A;  5FLX K;  3KE2 A;  5JVG F;  1D3Y A;  1UG0 A;  1Y6I A;  3M9A A;  5B66 C;  1ZEL A;  4ABZ A;  1HDP A;  2HXO A;  3FWE A;  4AVZ A;  1X2N A;  3KZZ A;  5JHF A;  2XGD A;  3CCJ I;  1I6H J;  4LIT A;  4LG3 A;  3LA7 A;  4PJ0 C;  5M5W J;  3SHF A;  1JT6 A;  2OTJ I;  3DTK A;  4M3G A;  1ONV A;  3ULQ B;  1FPQ A;  4BH9 A;  2VKV A;  4R79 A;  2R7S A;  2QYO A;  4JYK A;  1TWH J;  3O8G A;  4IRI A;  2EZK A;  2KFD A;  2K5C A;  1YX5 A;  2EB7 A;  4RB3 C;  4KIG A;  3OOP A;  3E97 A;  1T38 A;  2M45 A;  2IGM A;  1N25 A;  1IZ1 A;  2GM4 A;  2YS9 A;  1DPR A;  4RAF A;  4F7Z A;  4ZYG A;  4I09 A;  2DT5 A;  2LD5 A;  3AG2 H;  5JLX A;  4WCG A;  3G71 I;  1OPC A;  1R6R A;  2AXT C;  1QQI A;  4L9V A;  1VQL I;  1GV5 A;  2R93 J;  1T8I A;  2KMU A;  2G0E A;  3HL2 A;  2K85 A;  5KCM A;  2PLY A;  2DFI A;  4M6Y A;  4CZC A;  3ISP A;  3K7A J;  3GF2 A;  3DFG A;  1SD7 A;  3MMY B;  2HQN A;  4RAZ A;  5LGU A;  1T6S A;  3GLX A;  4F92 B;  3PSI A;  3TDU C;  2DQR A;  3IV5 A;  1ZQ3 P;  2L02 A;  3C3W A;  3P5J A;  1IW7 F;  5J47 A;  2NOG A;  3V7S A;  2CFO A;  3DF8 A;  1LVK A;  1ZG5 A;  2A69 F;  3GTM J;  2AO9 A;  4IEJ A;  3DV8 A;  3HJE A;  4BJT A;  2X1E A;  4PUS A;  3WTZ A;  1E0E A;  3OSF A;  2KRF A;  3CMY A;  3A0H C;  3I58 A;  1B8I B;  2JA6 J;  1P7J A;  1IUY A;  5D5X B;  4UUS B;  3HXL A;  3GW2 A;  5ICE A;  1D8K A;  3G6E I;  3I59 B;  4B09 A;  3F8M A;  4LFU A;  3LL7 A;  1ETQ A;  4XMY A;  1T2K A;  3S2H J;  4ZDO A;  2ZBK A;  2ZJQ F;  3REO A;  2VJ5 A;  2L54 A;  2QSG X;  2M2E A;  3WG9 A;  2FRH A;  1EA3 A;  1BR1 A;  5GAE J;  4L0Y B;  4ITV A;  3L09 A;  3BWG A;  3QPH A;  1E17 A;  1ZK8 A;  4AIK A;  5HS7 A;  2EFO A;  2YU9 J;  5J1U A;  2D1V A;  4A5N A;  2XAF A;  3GLL A;  2ADU A;  3B73 A;  2H94 A;  3CTA A;  2DYR H;  3DTE A;  3KIO A;  2OTL I;  1FSH A;  1IF1 A;  2Z2S B;  3LSJ A;  2LY2 A;  2W82 A;  3BG9 A;  1SEU A;  3T0Y A;  3FMR A;  2XAS A;  4IHT A;  3ZGK A;  2H8W A;  1KYW A;  2R7D A;  3GME A;  4BYY A;  5EG0 B;  4O6J A;  4G12 A;  2DA7 A;  4F55 A;  1IV8 A;  5EEG A;  2R7X A;  1YIT I;  4ZC3 A;  1YQA A;  3N05 A;  1XMA A;  3PQK A;  3QRF F;  3KEQ A;  3GTL J;  3KEY A;  3L9F A;  4XLC A;  5ILS A;  2X1D A;  4G8X A;  5FFX A;  5FRO A;  3LNQ A;  2XGX A;  2COM A;  2GIV A;  1BR4 A;  4U7B A;  4F52 A;  3G1L A;  2BXZ A;  5CVU A;  4XON A;  1S7E A;  1JJ8 C;  5HOO A;  4RLF A;  4YIR X;  3GYH X;  5FLV A;  2HTS A;  3FMS A;  4BXF A;  2L9N A;  5FLX Z;  2LK2 A;  1RZ4 A;  2CQX A;  2MYS A;  2E19 A;  2MSY A;  1R5G A;  3FHZ A;  4GYI A;  3I54 A;  3EPZ A;  3CP8 A;  3BZ6 A;  4HLX A;  3ABM H;  3G2B A;  3BTL A;  1JTX A;  2DOE A;  2FE3 A;  1I5Z A;  1JUM A;  2BBY A;  2O8K A;  5D4S A;  1Z77 A;  2H6B A;  3KLO A;  3K4M A;  1ZTR A;  3H3V K;  5L3E A;  3QYE A;  1E3P A;  5L3B A;  5E1W A;  2IVM A;  2F48 A;  5IT9 Z;  1R5H A;  2KJB A;  3E7L A;  1EH6 A;  3LST A;  4DZJ A;  5ILU A;  3BRO A;  4MTE A;  2HYJ A;  1X1C A;  4MFE A;  3IUO A;  1JKP C;  3KYC B;  3Q0W A;  2KDO A;  3KP7 A;  3JR9 A;  4HQE A;  5J4V A;  2R4G A;  2KIQ A;  4ZYE A;  4XLN F;  2XAU A;  3A01 A;  1D5V A;  3Q0V A;  2GA1 A;  5H20 A;  4KIS A;  2M3A A;  5ICG A;  3M7G A;  3CME I;  1VQP I;  1HBX G;  1FC3 A;  4QSH A;  5B1B H;  4X0G A;  3OL4 A;  2X1C A;  4ENK A;  4E7I A;  3RZO J;  1MBJ A;  5K7Z A;  1W36 D;  2MLK A;  1ZHF A;  3HHH A;  1D0Z A;  2IXS A;  5J1R A;  1G8X A;  2A3S A;  2IEK A;  4EGY A;  3ONQ A;  3GTG J;  1S6L A;  3AG1 H;  5HDK A;  4PGH A;  3V4G A;  1OYY A;  1U0J A;  4XLE A;  1N75 A;  2NS0 A;  4IX7 A;  2D5V A;  4DIQ A;  4G9Y A;  2Z16 A;  1FP1 D;  1TTY A;  3HRM A;  5DTD A;  1Q1H A;  1W0U A;  2WB1 A;  5J6X A;  5FKN A;  1WRJ A;  3GZ5 A;  4CA0 A;  1WJB A;  5HNF A;  4BE0 A;  3LQQ A;  3IWZ A;  4JP0 A;  2YPR A;  2FNP A;  3F23 A;  4KIF A;  2P4W A;  2F4I A;  1DP3 A;  3FIW A;  2IW5 A;  2EK5 A;  5JLW A;  1IN4 A;  4ASN A;  2N8G A;  4V2G A;  4Z6Y A;  4KIT B;  3TED A;  4EVI A;  1IRX A;  2ECC A;  2V4J C;  3EUH A;  1HKT A;  2BVM A;  3DPT A;  5J3L A;  3M1C A;  2PJR A;  2HOS A;  2RNJ A;  2NOJ B;  2EZL A;  1GVJ A;  2TCT A;  2CUF A;  1R7J A;  4IPA A;  3I71 A;  4AIH A;  2IPQ X;  2MH9 A;  2OD5 A;  4LK1 F;  4I0A A;  2NNY A;  5EGO A;  4IHS A;  4XKB A;  2WY8 Q;  2ZCW A;  3A1Y A;  4AWX B;  1PYV A;  1PUF A;  4OIO F;  3FM3 A;  4RB1 A;  3I5U A;  4L5J A;  4EM2 A;  1BIA A;  3SQN A;  1SVM A;  4A3I J;  3FXQ A;  2XDV A;  3WTX C;  2WTE A;  3JRF A;  2PI0 A;  6PAX A;  4KN7 X;  2ZSH B;  1FYM A;  1DPU A;  1ZGJ A;  2HKX A;  4HZF A;  2O03 A;  1UZC A;  1RR7 A;  3FM5 A;  1SFO J;  4IJA A;  1LFB A;  1I50 J;  4OAZ A;  1XPX A;  3U2R A;  4ANJ A;  4OAY A;  2HU9 A;  3VEP A;  4MIM A;  4L5E A;  3E6M A;  5DUK A;  4XSX F;  2XRN A;  4G6T B;  4KUM A;  1Y0U A;  2MLG A;  4HNV A;  2YU3 A;  2MW8 A;  4Z2Y A;  1LDD A;  1OMI A;  2BY2 A;  2GOM A;  4YFN F;  5BPD A;  3JRD A;  2KKO A;  4ZYH A;  2OZU A;  2OF7 A;  1YYV A;  4XRM A;  3S93 A;  3RJP A;  4M9S A;  1SFK A;  1FBU A;  1D0Y A;  2W57 A;  2VC1 A;  3Q0U A;  2IA2 A;  4P55 A;  3OYI A;  3DPL C;  3LSH A;  3CCL I;  3ZMT A;  4IRH A;  5HNH A;  4HX8 A;  4HX7 A;  3TL4 X;  3AG3 H;  4XRF A;  4L5I A;  5KAI C;  4A2U A;  1FZP B;  1W7P D;  2QWW A;  2A6T A;  5F0H A;  1IDY A;  2LP0 A;  3HHG A;  3A0B C;  1NTC A;  2KLO A;  3VWB A;  2NAZ A;  5FD5 A;  3I64 A;  1HST A;  1V5E A;  2HOA A;  3HTU A;  1MMS A;  3V7R A;  3GZ6 A;  1NHA A;  2P5V A;  4M72 A;  3H35 A;  4W97 A;  3B02 A;  2OCE A;  3DWL E;  1AA7 A;  2JK3 A;  5F1R A;  3MZH A;  1KON A;  2DFF A;  3EYI A;  2VBY A;  5E3L A;  3PM1 A;  3N97 A;  3EUH C;  4GRI A;  4B48 A;  2ACJ A;  3S1N J;  3ZQQ A;  4UVA A;  1TQI A;  3BQY A;  4HRI A;  1HA8 A;  4XOP A;  4EQQ A;  4HG2 A;  2KPM A;  2XAH A;  3MCZ A;  3COA C;  4GGG A;  5C44 J;  1JJ6 C;  2UWM A;  1DUX C;  3VFZ A;  4IQ4 A;  2EBI A;  5F04 A;  3NQO A;  1FIA A;  3EQL F;  3ZMZ A;  3BZC A;  5EZG A;  2QKL B;  2HR3 A;  2CO5 A;  4P9F A;  1XC5 A;  4JX6 A;  3J81 Z;  4PDK A;  5E8I A;  4JX4 A;  2FOW A;  1I1G A;  1Z0X A;  4MFD A;  4FIS A;  4OMZ A;  5D6F A;  4WX9 A;  2Z1D A;  2P6T A;  4WXC A;  2EIJ H;  4UUS A;  4RMN A;  1VQ4 I;  2B7E A;  3Q3S A;  1K4S A;  1LEA A;  2ZC2 A;  5TIS C;  3H9J A;  4C30 A;  4FAS D;  1AOY A;  2FML A;  2O0Y A;  4LLG F;  1Z6T A;  4RGS A;  4XN3 A;  1GLN A;  4LJZ F;  3KZY A;  3HC7 A;  3M3Y J;  4I2O A;  4MTD A;  4CGZ A;  4N9I A;  1BA5 A;  4XRS A;  2JA7 J;  4CCJ A;  5M5X J;  1RI7 A;  4U88 A;  3CF5 F;  3A2K A;  2DMQ A;  3KYL A;  3QYF A;  2M30 A;  9ANT A;  2JUG A;  3SZG A;  3J7Z I;  2PMZ A;  2DOD A;  4E4H A;  5BPI A;  2F6C A;  4AC0 A;  1LB2 A;  1X1D A;  2LRE A;  3C2H A;  3GTP J;  4P9U A;  1Y8R B;  3M1E A;  2XGC A;  2M7B A;  1SFE A;  1W7P A;  3OYB A;  1IRF A;  1G3W A;  2HNH A;  4M3F A;  4A3C J;  4JBA A;  4XM3 A;  2MAB A;  2XSD C;  1WFX A;  2X6X A;  3I4N J;  2MD0 A;  2Z99 A;  3WTY C;  3OYA A;  3ROU A;  3AG4 H;  3RTR A;  2OBP A;  2PFB A;  4RLQ A;  3NRV A;  2WV1 A;  3CUQ B;  2PQ8 A;  2QLZ A;  4RA2 A;  4RM2 A;  3S3O A;  2NVQ J;  1G2H A;  2ZXH A;  2JZY A;  3KCC A;  2XB5 A;  3CUO A;  2QVO A;  3FXL A;  2W24 A;  3J7Y J;  5L3G A;  4XL9 A;  4CZZ A;  3KX2 A;  2KIM A;  2XPV A;  4AM3 A;  1K6O A;  2VBZ A;  2EPF A;  1O3S A;  4R1H A;  3S1R J;  4L9J A;  4XSZ F;  4HYE A;  2ICW G;  3QAH A;  4OIR F;  1ETK A;  1R49 A;  4M3B A;  5F6F A;  1Z9C A;  3ZQF A;  5DD4 A;  2DOA A;  4X6A J;  3RKQ A;  2VXZ A;  2DDB A;  1YX3 A;  1FOK A;  1WWX A;  4EJU A;  4IQJ A;  4NUB A;  4DGW B;  1G6N A;  2GXA A;  1TNS A;  2CH0 A;  4AIJ A;  1LJ9 A;  1LVA A;  3PUB A;  4LLN A;  3S8P A;  3OY9 A;  4XK4 A;  3HPH A;  2ZNY A;  1ZKG A;  5EYR A;  1USS A;  5D5W B;  1U8R A;  2PJP A;  5E17 F;  5JI6 A;  2FOK A;  5J8C A;  1ZG1 A;  1ZH5 A;  4CCO A;  3BQZ A;  5K5R A;  2P5K A;  3IH2 A;  1MMN A;  2ZNZ A;  4E7J A;  1Z1D A;  2Z9O A;  1UJ8 A;  2DA1 A;  1SAN A;  3GVA A;  1TQM A;  3HGY A;  2AQE A;  4HNT A;  2CQN A;  4FTH A;  4A93 J;  1WSU A;  5E1X A;  2CW8 A;  2HDD A;  2O7O A;  2QQ8 A;  4A6E A;  4AYB A;  1GUU A;  1IXC A;  2W85 A;  5FO5 A;  1PVE A;  4N9H A;  3CMA I;  5DCF A;  3ZQC A;  3HKZ A;  2GLO A;  2BW3 B;  2BVL A;  3K2Z A;  3BG7 A;  1KZH A;  2LKS A;  3R6S A;  2EV6 A;  1IXS B;  1X4P A;  1I3Q J;  4MNU A;  2ETH A;  3E1S A;  2VKD A;  2I10 A;  3J7A Y;  5F1J A;  4XID A;  5EZH A;  2XHK A;  2L2O A;  1SD5 A;  5HS9 A;  1KU2 A;  2JA2 A;  2CRG A;  2W1O A;  5B1A H;  1YIO A;  4E7S A;  3GX4 X;  2PG4 A;  2CG4 A;  3BC8 A;  1QVT A;  4XNF A;  2Z3Y A;  1XGS A;  5CYV A;  1K78 B;  3ML6 A;  1T08 B;  4HV5 A;  1IAW A;  1KA8 A;  1OCC H;  1XS9 A;  2NVT J;  4OWR B;  1FP2 A;  4MEY F;  1P92 A;  2BGC A;  2CV0 A;  3OOU A;  2VBW A;  3VYR B;  3ESW B;  4R8H A;  3F0C A;  3JAM Z;  3IL2 A;  3HOX J;  1JT0 A;  2H1L A;  3K69 A;  1L3L A;  3WOD F;  1TW3 A;  3TOB A;  4XLH A;  4I98 B;  3U9G A;  4IO9 F;  5IY5 H;  2HPM A;  1QBJ A;  5FRM A;  2LKX A;  4Y3O A;  1LDJ A;  3W2V A;  2VQL A;  1EH8 A;  4IHV A;  3X2Q H;  2O6G E;  2FQ4 A;  4DZP A;  4CCL A;  1BI0 A;  4CYC B;  5D4R A;  4IKF A;  2NVU B;  4P1W A;  4BJ6 C;  1B4A A;  1HSJ A;  1AHD P;  1MSF C;  2EH3 A;  3NWT A;  3RKX A;  3JRA A;  3KP2 A;  1AKH B;  4BY1 J;  2Q0O A;  4NDL A;  1K83 J;  2RGV A;  3IWF A;  3QP5 A;  1BR2 A;  3M8J A;  2DMU A;  1Z05 A;  3I3L A;  1ENH A;  2IS2 A;  3Q5F A;  4H0E A;  1W1W E;  4MEX F;  4A0Y A;  1BI3 A;  5HLH A;  2K7L A;  4Y15 A;  1I1S A;  1WJE A;  2K86 A;  3LSG A;  3KFW X;  2XB0 X;  2LNB A;  3EET A;  4A3E J;  3BTJ A;  2QSF X;  1KU7 A;  2JVH A;  4Q48 A;  2Y48 A;  3FK7 A;  4DBQ A;  1O4X A;  2IA0 A;  2FMY A;  4V19 K;  1T0F A;  2HS5 A;  2L7M P;  1KGS A;  2HOE A;  1SFX A;  1L0O C;  3OYL A;  2FNA A;  1Y1W J;  3K0L A;  3LA3 A;  2XV4 S;  1S3J A;  2HGC A;  1WJF A;  1MZB A;  1QPM A;  1VQO I;  2WAE A;  5EF6 A;  2AS5 F;  2VB6 A;  2BHY A;  3TP3 A;  1P4W A;  3DPU A;  2AXL A;  4CXF A;  3HOW J;  2CYY A;  3TO9 A;  5BNG A;  4L18 B;  1H8A C;  1S7O A;  3QOD A;  4GFB A;  1QZY A;  2IP2 A;  4UNO A;  3OS2 A;  3F6V A;  3I9V 2;  1GV2 A;  2KIU A;  3JRC A;  2DDA A;  1WHU A;  2HVS A;  4BGD A;  1NK2 P;  1F1Z A;  1NH3 A;  3IRQ A;  3C7J A;  4QPO A;  4BQA A;  2MGQ A;  1TT5 B;  2WAQ A;  3P9I A;  4E6K G;  1ZGA A;  1T39 A;  2W7N A;  2JUC A;  5HOD A;  2BXY A;  5EEH A;  4LG0 A;  2YSR A;  3DBL B;  4DW6 A;  1VQ6 I;  1JKQ C;  3CCM I;  3LFK A;  4G94 A;  1BI2 A;  3LA2 A;  3CCS I;  3QPT A;  1A6I A;  1DDN A;  3RIR A;  1D0X A;  1EF4 A;  2D1H A;  1YI2 I;  1MMD A;  2JMW A;  3BG6 A;  2CFX A;  4II2 A;  2D2W A;  4D9J A;  1B9M A;  2QM3 A;  3OMY A;  4LD5 A;  5D8K B;  2OAZ A;  4UHT A;  1WPK A;  2XIG A;  3BR5 A;  3K4L A;  5CVV A;  3PNT A;  5IP7 J;  5FKL A;  2Y75 A;  2O5R A;  2EFP A;  2V9K A;  5HVQ C;  2M87 A;  1CGP A;  4DQ2 A;  2CQ7 A;  5M3F J;  4HDU A;  5L3C A;  1SD6 A;  1FSE A;  4UUT A;  3KPH A;  4BAC A;  1WQ2 A;  3C1D A;  2RN7 A;  3S17 J;  4EAT A;  3CDH A;  2GXB A;  1IRG A;  2O61 A;  2HZT A;  2JN6 A;  2Y31 A;  4XKV A;  3WGG A;  4BEH A;  4X1E A;  1MNM C;  3V8J A;  4MO7 A;  2IGN A;  3ELK A;  2E2J J;  1WZ2 A;  3TQN A;  1B6A A;  1T0F C;  2B63 J;  2EIN H;  2XPW A;  2DU9 A;  1JGS A;  4YII A;  1MJB A;  3K4J A;  5H6R A;  3VSK A;  5ED4 A;  1QA6 A;  3BJA A;  2HEO A;  3HDD A;  4A3J J;  1MDM B;  1DQU A;  3E5U A;  1SVO A;  3BG5 A;  3NAU A;  1Z3Y A;  2R7O A;  2QSH X;  1BOB A;  5E18 F;  4PFO A;  3GXO A;  4GO1 A;  5LEJ A;  5K1Y A;  2HXI A;  3DU5 A;  2CQQ A;  3M4O J;  2FEZ A;  1TBX A;  2QBY A;  3ECO A;  2V1N A;  3CUQ A;  3IHU A;  2HVQ A;  3BR2 A;  1PDN C;  3QU3 A;  4ZYA A;  1UFM A;  2VKH A;  1P4X A;  3LAP A;  2HZD A;  5DEQ A;  4MQV A;  3HEF A;  5DUI A;  2CQK A;  5L3F A;  2XGE A;  2RRE A;  4MHG A;  3IKT A;  2E2I J;  3RYP A;  2E2H J;  3SZT A;  2FU4 A;  3FBN B;  3LSM A;  3D1N I;  2DA5 A;  3K10 A;  2HYG D;  1TWF J;  3DU6 A;  3LQR A;  3A4C A;  1YS7 A;  2K4J A;  4GYG A;  1YJ9 I;  1IG7 A;  2K3P A;  3WTU C;  2QQA A;  2UV1 A;  4CCN A;  1G59 A;  3C18 A;  1UMQ A;  1HDD C;  2WWY A;  1RUN A;  1I3A A;  1XGN A;  4NHJ A;  3MKY B;  2DTZ A;  1O57 A;  4PJN A;  2R7V A;  1G3Y A;  3SXY A;  4ENN A;  3IH3 A;  2WAF A;  5CVI A;  1YLF A;  3TBI A;  5IYB J;  4GDF A;  1RPW A;  2DK8 A;  3RSN A;  3DKX A;  3HBL A;  5E8G A;  3AL0 C;  1Z6R A;  3OS0 A;  4HNU A;  1OQY A;  3F8F A;  4BNC A;  2XRO A;  2DA6 A;  1XCB A;  2TRT A;  4YIF A;  3S16 J;  1I39 A;  2M5W A;  1KU9 A;  5JHU A;  2HQ5 A;  2L01 A;  1TQP A;  3IAM 2;  3CF2 A;  3JW4 A;  4HSR A;  3EYY A;  2R0Q C;  5IOY A;  3A02 A;  4G7O F;  1OCZ H;  2X85 A;  2F2E A;  1RKW A;  2BW3 A;  1QVU A;  1R36 A;  1XMK A;  4I0B A;  2LBF B;  1FMV A;  3LWF A;  5DYM A;  3O3K A;  4Q47 A;  2BE5 F;  4HV6 A;  5M3M J;  1J7K A;  3WGI A;  3DEE A;  4RGU A;  1RNL A;  2W4S A;  2W84 A;  2KDZ A;  1YJN I;  3PQJ A;  3ABK H;  1WJD A;  3W6K B;  3CCQ I;  3K70 C;  1YS6 A;  3IRR A;  1LNW A;  1FNN A;  4HEA 2;  4AVP A;  3H5R A;  3BLY A;  4HPQ A;  1MMA A;  1PUE E;  4H4K C;  1MJ9 A;  5D8L B;  3GO5 A;  2VQG A;  3BJO A;  1UHM A;  3HRU A;  2DFH A;  5ICC A;  4PJL A;  3HTS B;  4CUG A;  1E2X A;  3HOY J;  2HTJ A;  4LOC A;  3CUQ C;  3FDY A;  5HLT A;  1Z91 A;  4WXH A;  4UB6 C;  3TMO A;  4XOR A;  4L9N A;  2Q2E B;  4FX0 A;  1J09 A;  3I0T A;  4B4C A;  4HF1 A;  4M73 A;  3HB9 A;  1HW1 A;  2HWV A;  4A0X A;  4MGR A;  3F8C A;  2OQG A;  3FXR A;  2X6W A;  3BT9 A;  2EV5 A;  3RPQ A;  5FLM J;  2JRT A;  5DDG A;  3B6A A;  2L3D A;  2HI3 A;  1MNE A;  1U5T B;  3DKY A;  2R5Z B;  1R9T J;  4UVC A;  1R00 A;  4IXA A;  2F5D A;  2DA2 A;  2H09 A;  4N0B A;  2V6C A;  4BL0 B;  3ZRG A;  2DJN A;  2JWT A;  3PO3 J;  3HOU J;  4ESJ A;  3OYH A;  4BBR J;  1ITY A;  1HC8 A;  1RKT A;  1BIB A;  1M1E B;  3HUG A;  4HF2 A;  2A5Y B;  3ZN0 A;  2XAJ A;  1G3T A;  3BCA A;  4B44 A;  1GDT A;  2JA5 J;  4J01 A;  2DT6 A;  3PFI A;  2LG4 A;  1ZRE A;  1F4K A;  1QPI A;  2L4A A;  3JTH A;  2DW4 A;  2KRH A;  3IC7 A;  2CU7 A;  2MBF A;  2RVC A;  1SAX A;  4IL6 C;  4BS9 A;  3GUD A;  2ZB9 A;  3TW7 A;  5BS6 A;  1CF7 B;  2M4G A;  3DXJ F;  3OYF A;  3ZN1 A;  3GFJ A;  1H0M A;  3S32 A;  3OYN A;  1F43 A;  3WG7 H;  4ESF A;  3DBR B;  4AID A;  4YFK F;  5H2F C;  4XRS G;  3Q9S A;  4RAY A;  2FQ3 A;  2VLA A;  1KQ8 A;  4DYR A;  2E60 A;  1QO0 D;  2RC4 A;  4RBO A;  3A03 A;  3S15 J;  3MKL A;  1DGR M;  2NS7 A;  3LSI A;  3QWL A;  4Q5S F;  1FIP A;  2ZXW H;  4QWQ A;  3TP0 A;  3AAF A;  1VQ9 I;  4DOZ A;  3RKW A;  1UAA A;  3DEU A;  4D5F A;  2A6E F;  5ERI A;  4Y7N J;  5BQT A;  5C4X J;  1HCR A;  3JRG A;  2L4M A;  1IO2 A;  4ZZD A;  1ZLK A;  3K2A A;  2K4B A;  3CJQ B;  2FXA A;  2WV0 A;  5IP9 J;  4M3E A;  2LKP A;  1U8B A;  1WJC A;  5FD6 A;  1XX5 A;  2EIL H;  4P5O A;  2QEN A;  1KQ9 A;  1X2M A;  4EJV A;  2RDP A;  2HQR A;  3WU1 B;  1Q1V A;  1HLV A;  4D7N A;  1UST A;  3BPV A;  4UXN A;  4A3K J;  2MA3 A;  2L7F P;  4NC6 A;  1Z7L A;  4FHT A;  1OCR H;  3I55 I;  1QZZ A;  3HOZ J;  4GCV A;  1Y0N A;  1YW8 A;  4KFC A;  2OV7 A;  3K4K A;  4FQG A;  4OOI A;  3BJ6 A;  3GFI A;  1U2W A;  2NS8 A;  2W25 A;  1FYL A;  1BOA A;  4EM0 B;  4J19 A;  3V7C A;  1V54 H;  3ASN H;  4M74 A;  2E5Z A;  3HIF A;  4A6D A;  2ESN A;  3H3U A;  3MAJ A;  5F27 A;  4V2F A;  4E7L A;  2LVS A;  5GAG J;  2VBX A;  3S2W A;  4FET A;  5LHG A;  3VYU B;  3OWT A;  2VQH A;  1RUO A;  4KIB A;  5DS9 A;  3SEQ A;  1B8I A;  3DCF A;  1PJR A;  1X1P A;  1W0T A;  2IS4 A;  3C2G A;  3BCB A;  1N77 A;  5LLQ A;  1Z21 A;  3I59 A;  2KJC A;  4QPQ A;  1TWG J;  2R92 J;  2R5Y B;  3L00 A;  1X19 A;  5IP6 A;  1QRY A;  2V1D A;  4E7K A;  3K9T A;  4CYD A;  3TKY A;  1BC7 C;  2JPC A;  2BZT A;  3WTT C;  1J0R A;  4IVN A;  2XF7 A;  3SFZ A;  5FRN A;  2A05 A;  5JVT A;  2L9R A;  4PJM A;  3PL8 A;  2M1B A;  2F5C A;  4A3B J;  5CVR A;  4XLF A;  4II3 A;  2KRC A;  1U78 A;  1R5I D;  2DA4 A;  5HDN A;  1MD0 A;  5DCM B;  2V9P A;  5AIP A;  2RKH A;  5GAH J;  3TW6 A;  3EUK L;  1WCM J;  3K1M A;  1FTT A;  3G1O A;  2EFN A;  3IH4 A;  1UEL B;  3LSK A;  1EKE A;  3CZ6 A;  1R1T A;  3HYI A;  2UXX A;  4O3M A;  4YFX F;  3K4C A;  4N4N B;  4DNC A;  1WJ5 A;  1XTA A;  3BR3 A;  5EEA A;  2CMP A;  5E3O A;  2WB1 N;  1XMX A;  1K6Y A;  4PFP A;  2P7C B;  3HOV J;  3F8N A;  3H9Q A;  4S05 A;  2P81 A;  5LBQ A;  5EG0 A;  3SFI A;  1B1B A;  1ON1 A;  1EH7 A;  2ZFU A;  3RI4 A;  3OSG A;  5M5Y J;  1BL0 A;  2FX0 A;  2C6Y A;  3CD6 I;  2X0L A;  4U7D A;  1POG A;  2X9D A;  1ULY A;  3ZQL A;  2E1N A;  2NXN B;  2Y2Z A;  3RYR A;  3RKY A;  2MH2 A;  5B5E C;  2R7W A;  1JUP A;  3V42 A;  1S5L C;  3W6V A;  3PO2 J;  2FJ1 A;  3HPG A;  4BQO A;  3WTV C;  3DTI A;  2Y69 H;  1FJL A;  1S7A A;  4BU2 A;  3S14 J;  2DN0 A;  2NYX A;  3BTC A;  2EA4 A;  3FBI B;  5EJC A;  1MSE C;  3HZJ A;  3H1C A;  4B3A A;  2BY0 A;  5CQG A;  3IP4 B;  1LFP A;  2BHZ A;  4BE1 A;  3F72 A;  1D1A A;  4A5M A;  2L7K A;  2OUM A;  4OMY A;  1O3R A;  3CC2 I;  2ZME B;  3NAR A;  5LHI A;  4EJO A;  1YTY A;  3FMQ A;  4NBQ A;  1H9G A;  1O7F A;  4UV9 A;  4DJA A;  4XN0 A;  4Y13 A;  3QQA A;  2NVX J;  2E35 A;  4Y33 A;  4BXU A;  2J5P A;  3BZK A;  1Y1V J;  1R71 A;  1ZAR A;  4UUV A;  4FX4 A;  3E3V A;  1VF9 A;  2IRF G;  3MVP A;  1B9N A;  2Z5U A;  3LSP A;  3SDG A;  2ISY A;  1C0W A;  3R0J A;  3FKJ A;  1E3O C;  1B72 B;  4JQF A;  4XKC A;  1UHS A;  3FX3 A;  3VYT B;  4B1R A;  5LGN A;  1LKX A;  4K2E A;  1DU0 A;  4C2T A;  4A3D J;  2X51 A;  2O9L A;  2VJ4 A;  3MQ0 A;  2Y0S A;  2G7U A;  5LRR A;  3LMM A;  5LFA A;  2ISZ A;  3QP6 A;  3VB2 A;  3TO7 A;  3K6G A;  5D5U B;  2P8T A;  3A01 B;  1K61 A;  3L2C A;  2ESH A;  5GAD J;  2DYS H;  3OYM A;  4J00 A;  2I5U A;  3LSR A;  1TL8 A;  2JSP A;  4BDY A;  2CW7 A;  1P7I A;  1OCP A;  2OZ6 A;  5K5Q A;  4PSX A;  1JKR C;  4C9Y A;  3RCO A;  3G4S I;  2Y9Y A;  2ELJ A;  1DGW Y;  4G7H F;  1F5T A;  3CES A;  2PMU A;  3BR6 A;  3H5N A;  5E1Z B;  3PNY A;  3S2D J;  1S9H A;  2EFW A;  4CHU A;  2H6C A;  2K9L A;  4FT8 A;  4AD9 A;  2LTP A;  1G4D A;  4MLO A;  5AIQ A;  1HF0 A;  2VN2 A;  2DT7 B;  2OQR A;  4OIN F;  3KLN A;  2WAD A;  3SDB A;  4EM1 A;  1DP7 P;  1BJZ A;  1U3E M;  4PZJ A;  3G3Z A;  4EJW A;  3KET A;  5ILV A;  3DEW A;  1U5T A;  2CUZ A;  2K9S A;  2KQR A;  4EJT A;  1ZLJ A;  2DMT A;  3MN2 A;  3DLL F;  2V1X A;  2DTR A;  4M6V A;  2YX7 A;  3R4K A;  3VPR A;  3ZQG A;  4G7Z F;  1A6Q A;  1E3H A;  1QZE A;  2LY9 A;  1YHQ I;  1FT9 A;  1TWA J;  1FBS A;  3HSE A;  3S3M A;  2K9M A;  2GBY A;  1ZR2 A;  1S72 I;  3P7N A;  1BC8 C;  4FE4 A;  1T56 A;  3VOD A;  1KQ0 A;  2M7A A;  4I6Z A;  1OCT C;  4HAM A;  2VXD A;  3UR3 C;  4D5C A;  2PJR B;  2R7Q A;  2MD5 A;  4CDG A;  3ZR8 X;  2KHM A;  1MMG A;  1S29 A;  4BJ5 C;  2XVC A;  1FOY A;  2OC6 A;  3BTI A;  2L9S A;  3QYB A;  4OIQ F;  1K79 A;  2XF5 A;  1FMW A;  4TV7 A;  1LE8 B;  2L5Q A;  3IAS 2;  4KMF A;  1CF7 A;  3H0D A;  2PMZ N;  4NQW B;  3HOT A;  2PBI A;  3D0S A;  2EZI A;  1A36 A;  1D8J A;  2RV8 A;  1ODD A;  1V4R A;  4MQ9 F;  3TO6 A;  3WGH A;  1HKS A;  2M0C A;  4P96 A;  3CP2 A;  2IBD A;  2JJ7 A;  2IJL A;  2VC0 A;  1YJW I;  2KL4 A;  3ASO H;  3HSF A;  1GVD A;  1IUF A;  3RPU A;  2ELH A;  4IHY A;  1R1U A;  3BPX A;  2NVY J;  2UXN A;  1YE9 A;  1QNT A;  3BY6 A;  3ZXS A;  4XIC A;  1JHH A;  3F8B A;  4EEF G;  5JFR A;  3GTQ J;  2FBH A;  2KIF A;  3PFY A;  1FEX A;  3UNG C;  5LEK A;  1DU6 A;  2Y0M A;  3K70 D;  3HGG A;  2XSJ C;  1RET A;  2QQB A;  3QU6 A;  1J2X A;  2GAU A;  3OS1 A;  2GZW A;  4ZTF A;  3D5S C;  1GT0 C;  3L2V A;  5BMZ A;  1AU7 A;  1MBF A;  3Q9V A;  1LDK B;  3FXJ A;  4YEJ A;  3W3C A;  3KZI C;  2QA4 I;  1WH7 A;  3ECH A;  4I02 A;  2DI3 A;  2OJE D;  4XBF A;  3OIP A;  3GWZ A;  3W2A A;  2GWR A;  2IGO A;  5B3S H;  1TW2 A;  4A3L J;  5KNL A;  4C2U A;  4UV8 A;  1TP4 A;  4XOT A;  5IT9 K;  3PNV A;  4UB8 C;  4PSW A;  4ENJ A;  2ZXJ A;  1U5T C;  1XSD A;  2A5W A;  5E3M A;  1BW6 A;  2EWN A;  1EJ9 A;  3P9C A;  1O7L A;  1RIO H;  2GA2 A;  4HQM A;  3I56 I;  4LB6 B;  5FKM A;  2ZXI A;  1ETO A;  3HRT A;  1EV7 A;  3BR1 A;  4CCK A;  3F21 A;  3UKG A;  4CCM A;  2AQF A;  1V3F A;  4Y52 J;  5A2Q K;  1OLT A;  3FXO A;  3ZPL A;  3JRI A;  1J59 A;  1MH4 A;  3ERM A;  2RAE A;  5HS8 A;  1OIS A;  2K9N A;  1ORK A;  1FBQ A;  2PN6 A;  4AYB N;  1HKQ A;  4BBS J;  4U0V A;  3U1D A;  4LB5 A;  2KZG A;  2R5Y A;  1R22 A;  1OKR A;  2VOP A;  4BQN A;  1QHH D;  2WA0 A;  3HKZ N;  3PUF A;  1R4M B;  2QUF A;  3AKZ A;  4HF0 A;  3F9K A;  3L2U A;  2DCE A;  3WE2 A;  3FF5 A;  1MGT A;  5IT3 A;  1OYI A;  1WH5 A;  3JSP A;  3PIO F;  3K1N A;  1X1B A;  1PP8 F;  5DCM A;  2Y0S N;  2IGK A;  2Y9Z A;  5KVR A;  3D5R C;  4I99 C;  5CKT A;  3LAJ A;  5D6E A;  4WXD A;  1XCV A;  4ZTJ A;  2GQQ A;  2FF4 A;  2WBM A;  2LR8 A;  1X3W B;  5CLS A;  4QLC U;  3M07 A;  3CJR B;  2P7V B;  4HBL A;  3FXU A;  1MBK A;  2QKM B;  4IF4 A;  1VQ5 I;  5IYD J;  4ZDL A;  1XG1 A;  4BKX A;  2VI6 A;  3NWS A;  1FOX A;  2B0L A;  4BHB A;  2R7U A;  1BJA A;  3FXK A;  4U0Y A;  2JSC A;  2Y30 A;  3E6D A;  1CQT A;  1A35 A;  2PEX A;  1MKM A;  1J5Y A;  4RM3 A;  1ZG3 A;  4CO8 A;  5C3E J;  2XC7 A;  4E7Z A;  1STZ A;  2NRA C;  3ZQ7 A;  4CIC A;  5HLI A;  3H5A A;  1GXQ A;  1ZN2 A;  1TLH B;  2FUG 2;  4LLL A;  2M8E A;  4HDV A;  4ON0 A;  1PP7 U;  4IOC F;  2VIX A;  5TRD A;  4LMY A;  3DP7 A;  3OYK A;  4NB5 A;  1W7P B;  4EV0 A;  1H88 C;  3T1B A;  1JTY A;  2BV6 A;  3ZQH A;  3PSF A;  2P5L C;  1W4M A;  2JT1 A;  3U21 A;  1LPQ A;  2X4H A;  2CSO A;  1FOW A;  3ABL H;  3BR0 A;  1OCO H;  1VND A;  2JVG A;  2QQ9 A;  4B47 A;  4A3G J;  2LSO A;  3EUA A;  5C4J J;  3CO7 C;  1XGO A;  3V8K A;  5D5V B;  5HDG A;  3FHN A;  1TWC J;  3CC7 I;  3FKI J;  2VT3 A;  4U87 A;  1I6X A;  2A68 F;  1Z3X A;  1IN7 A;  1WKM A;  3J80 K;  4L9T A;  1U9N A;  1JI8 A;  5GTH C;  2HDC A;  1RR8 C;  4F3Q A;  2JQ7 A;  4A0Z A;  5ICF A;  1G3S A;  1XSV A;  4BQQ A;  2ZJR F;  1O3Q A;  2E1C A;  2K9Q A;  4A69 C;  3OL3 A;  1Y8Q B;  4IHW A;  2ZME A;  2V79 A;  3RDI A;  2W48 A;  3RQI A;  3BG3 A;  2BY1 A;  2GXG A;  1X3U A;  2HQA A;  4I01 A;  3CJN A;  1V5F A;  4ZZL A;  4UVB A;  3VOE A;  1MIJ A;  2IS6 A;  3JTG A;  1ETY A;  1OYW A;  2DXI A;  2XRL A;  2VAS A;  1YW7 A;  3E6C C;  2IS1 A;  2R7F A;  2F5F A;  2CW0 F;  3CLQ A;  2HPI A;  4G6Q A;  3CCU I;  2E1M B;  3QPL A;  1B72 A;  3L1P A;  2YX4 A;  4IRG A;  2RQQ A;  3QPS A;  4C3I J;  3SJM A;  1Y56 A;  1O3T A;  1J9I A;  1P2F A;  3E0J B;  3MZY A;  3N4M A;  4DBR A;  4L0Z B;  1VZ0 A;  2EIK H;  1VQM I;  1OR7 A;  4NC8 A;  3WU2 C;  2ZJ2 A;  1SMT A;  2VPL A;  4KJZ A;  1KYZ A;  3ZQI A;  1ZR4 A;  3OIO A;  4M9X A;  1ACI A;  2LRD A;  1VFC A;  2J5O A;  3WHC A;  2M8G X;  4A3M J;  3O8H A;  4ESB A;  2VOO A;  1HW5 A;  1XD7 A;  3OYG A;  4ZYD A;  1K78 A;  2KZV A;  5BOX A;  1JE8 A;  1X1A A;  3M8E A;  5F08 A;  3I53 A;  3CDI A;  2CV2 A;  4I76 A;  3TGN A;  5A2Q Z;  1K7A A;  4RGR A;  2DOF A;  2WAQ N;  3O6B B;  2KIS A;  4HOB A;  4RB0 A;  1V5G A;  3DBH B;  1FY7 A;  2E71 A;  5AON A;  3BOQ A;  3C2B A;  4I7H A;  3ZMU A;  1YRN B;  1VQK I;  1SVL A;  3J81 K;  3S1Q J;  3ZMD A;  1APL C;  2QGU A;  2KP6 A;  3CCR I;  1MBE A;  1TZL A;  1IN6 A;  3WU0 A;  2VE8 A;  3I4P A;  3PIP F;  3MZ8 A;  3MKW B;  2CGP A;  3SZP A;  3ZCO A;  5J40 A;  4W1U A;  5GTI C;  4WK8 F;  4N4O B;  1FWZ A;  3F3X A;  3G1M A;  4RB2 C;  2MFZ A;  4PCQ A;  2OA4 A;  3RQ4 A;  4PK4 A;  1ZRC A;  3NEU A;  2BOL A;  4RAG A;  1LFU P;  4XKW A;  1YFH A;  4B43 A;  3R61 A;  4CYC A;  3GZN B;  4RGX A;  1X58 A;  2X6Y A;  2A07 F;  1IC8 A;  1R4N B;  2DPD A;  4AUX A;  2COB A;  2UUZ A;  1MW7 A;  1AKH A;  1W5C C;  2EIM H;  5LRS A;  3HM5 A;  2ME6 A;  1NG6 A;  3L2Q A;  2V1U A;  3V8L A;  1UCR A;  4Y17 A;  1B59 A;  2ID3 A;  4PJJ A;  2DA3 A;  3WE3 A;  2KT0 A;  2ZME C;  1KU3 A;  1JUS A;  2ZFW A;  1D1C A;  3CDL A;  3KYD B;  5IPA A;  4EGZ A;  3GFM A;  1XB4 A;  3T5X A;  1WVR A;  3QOP A;  2RNG A;  2LFB A;  2OU2 A;  2O8X A;  2HVR A;  5DM7 F;  1IXR C;  2ID6 A;  2G9W A;  1ETW A;  2FA5 A;  1JGG A;  1LE8 A;  3G73 A;  3M8F A;  4PGG A;  2R7R A;  1IGN A;  4NQW A;  1W5S A;  1VTN C;  1SFU A;  5FGM A;  5GPC A;  2RQP A;  3ABU A;  5F64 A;  1AWC A;  1HOM A;  1T33 A;  4M9Z A;  4WF2 A;  4A3F J;  3H36 A;  4HX4 A;  2TDX A; 
#chains in the Genus database with same CATH homology
 3KP3 A;  4ZH4 F;  1S8N A;  4E70 A;  4KIC A;  3ZMV A;  1R23 A;  3J80 Z;  4S04 A;  2ZO4 A;  1FYK A;  3L7W A;  1ZAO A;  4LK0 F;  4HW0 A;  3WTW C;  4JK1 X;  2IT0 A;  1XDU A;  1U6G A;  2LF8 A;  3GEZ A;  5DV5 A;  3O2P E;  2YR2 A;  5L3D A;  2G7H A;  4GXO A;  3K1P A;  3MFK A;  5HLG A;  1YW9 A;  1IN8 A;  2FSW A;  2DO7 A;  4BAY A;  5J8F A;  3P9K A;  1SMY F;  3J7A O;  2STW A;  1HW2 A;  1XDS A;  3GFL A;  3T8R A;  2DK5 A;  3KEO A;  4KN4 X;  4KA4 A;  3FZV A;  5LGT A;  3MWM A;  5E20 A;  1HQC A;  4LG0 B;  2VOD A;  2STT A;  1UB9 A;  1LQ1 A;  3H92 A;  2K27 A;  3TOA A;  2FBI A;  2F5E A;  2DQL A;  1LEB A;  2BYV E;  1WI9 A;  4KT5 C;  4D0P A;  1ZYR F;  2DPU A;  2DBB A;  2XUB A;  2VE9 A;  2DAO A;  2E7X A;  4KYW A;  3JAM K;  1MDM A;  1XN7 A;  2E7W A;  3ERE D;  1UHW A;  1T98 A;  1JHF A;  4U0W A;  2D45 A;  2Q8K A;  2JTV A;  3CLO A;  3HOS A;  3CO6 C;  2A6H F;  5K5O A;  4A12 A;  2K02 A;  3H3Z A;  4B8X A;  3KP5 A;  4RS8 A;  2HFH A;  2DLL A;  1YG2 A;  3HRS A;  2QBY B;  2MC3 A;  5CVJ A;  5KK1 A;  1REP C;  2QZ8 A;  4Q4Z F;  2JPB A;  3R60 A;  4BHP A;  2P6S A;  5H6Q A;  3BDD A;  2A61 A;  3KP6 A;  4YG2 F;  4M71 A;  2H27 A;  3ZP5 A;  1ZRF A;  2VON A;  5LHH A;  2PMH A;  3HSR A;  2IA1 A;  4M6X A;  1ZRD A;  1A04 A;  4WWC A;  1BBY A;  4OIP F;  5TJJ A;  4XLP F;  2VT2 A;  3D5L A;  1YO5 C;  1R1V A;  3WTS C;  2XAG A;  2R3S A;  3TDZ C;  2EFQ A;  4EMS A;  2HKO A;  2XKO A;  1F9N A;  5FB2 A;  1J75 A;  1HXD A;  1MJA A;  1GXP A;  4KNY A;  4KMU X;  4OU0 A;  2EJR A;  1BN5 A;  1W5T A;  1I27 A;  3BP8 A;  4HA8 A;  1GHC A;  5JR3 A;  3KP4 A;  3T8T A;  1QGP A;  2UZK A;  1FLI A;  2HYF A;  3EDP A;  3ZMS A;  2CWE A;  3F22 A;  2WC2 A;  2Q2E A;  3JSO A;  3E5X A;  3W6J B;  3ABT A;  1BM9 A;  1R58 A;  3MEX A;  3E5Q A;  3IKV A;  2V9V A;  4ETS A;  1SD4 A;  2XAQ A;  1BI1 A;  1TNT A;  4LGW A;  1ON2 A;  1XGM A;  1P4A A;  2ZKZ A;  2XKP A;  1FX7 A;  1Z7U A;  1XSX A;  2Z33 A;  2BEO A;  2O3F A;  1H9T A;  1JXS A;  4ENM A;  4G6D A;  1IN5 A;  2LF7 A;  2FBK A;  3DQV C;  2LDU A;  3E6B A;  5DD8 A;  3DKW A;  4O5V A;  3OV8 A;  5CJ9 A;  2EA2 A;  3F6O A;  4HLY A;  2EV0 A;  5FFZ A;  1P6R A;  3R0A A;  4BHC A;  2NNN A;  4KDP A;  5FLX K;  3KE2 A;  1D3Y A;  3M9A A;  3FWE A;  3KZZ A;  3LA7 A;  3SHF A;  3ULQ B;  1ONV A;  1FPQ A;  4BH9 A;  4R79 A;  2QYO A;  4IRI A;  2EB7 A;  4RB3 C;  4KIG A;  3OOP A;  3E97 A;  1T38 A;  2M45 A;  1IZ1 A;  1DPR A;  4F7Z A;  4ZYG A;  4I09 A;  2DT5 A;  4WCG A;  1OPC A;  1QQI A;  4L9V A;  2PLY A;  2DFI A;  4M6Y A;  3ISP A;  3GF2 A;  3DFG A;  1SD7 A;  2HQN A;  4RAZ A;  5LGU A;  1T6S A;  3GLX A;  3TDU C;  2DQR A;  2L02 A;  3C3W A;  1IW7 F;  3V7S A;  3DF8 A;  1ZG5 A;  2A69 F;  3DV8 A;  3WTZ A;  2KRF A;  3I58 A;  1IUY A;  5D5X B;  3GW2 A;  5ICE A;  1D8K A;  3I59 B;  4B09 A;  3F8M A;  4LFU A;  1T2K A;  2ZBK A;  3REO A;  2L54 A;  3WG9 A;  2FRH A;  4L0Y B;  3L09 A;  3BWG A;  3QPH A;  1E17 A;  4AIK A;  5HS7 A;  2EFO A;  2D1V A;  4A5N A;  2XAF A;  2ADU A;  3B73 A;  2H94 A;  3CTA A;  1FSH A;  1IF1 A;  4IHT A;  3T0Y A;  3FMR A;  2XAS A;  1KYW A;  2R7D A;  4BYY A;  4O6J A;  5EEG A;  1YQA A;  1XMA A;  3PQK A;  3QRF F;  3KEQ A;  5ILS A;  3L9F A;  5FFX A;  4G8X A;  2XGX A;  2COM A;  2GIV A;  4U7B A;  5CVU A;  5HOO A;  3GYH X;  2HTS A;  3FMS A;  5FLX Z;  1RZ4 A;  3FHZ A;  1R5G A;  4GYI A;  3I54 A;  3BZ6 A;  4HLX A;  2FE3 A;  1I5Z A;  2BBY A;  5D4S A;  2H6B A;  3KLO A;  5L3E A;  5L3B A;  5E1W A;  2IVM A;  5IT9 Z;  1R5H A;  2KJB A;  5ILU A;  1EH6 A;  3LST A;  3BRO A;  4MTE A;  3KP7 A;  4HQE A;  4ZYE A;  4XLN F;  1D5V A;  2GA1 A;  5H20 A;  5ICG A;  3M7G A;  1HBX G;  1FC3 A;  4ENK A;  2MLK A;  1ZHF A;  3HHH A;  2A3S A;  4EGY A;  1S6L A;  5HDK A;  4PGH A;  3V4G A;  1OYY A;  2NS0 A;  4G9Y A;  1FP1 D;  1TTY A;  3HRM A;  1Q1H A;  5J6X A;  1WRJ A;  3GZ5 A;  3LQQ A;  3IWZ A;  2YPR A;  2FNP A;  3F23 A;  4KIF A;  2P4W A;  2IW5 A;  2EK5 A;  1IN4 A;  4ASN A;  4EVI A;  3EUH A;  1HKT A;  3DPT A;  2RNJ A;  1GVJ A;  1R7J A;  4IPA A;  3I71 A;  4AIH A;  2IPQ X;  2MH9 A;  2OD5 A;  4LK1 F;  4I0A A;  2NNY A;  4IHS A;  2ZCW A;  4AWX B;  4OIO F;  3FM3 A;  4RB1 A;  3I5U A;  4L5J A;  4EM2 A;  1BIA A;  3SQN A;  3FXQ A;  3WTX C;  2WTE A;  2PI0 A;  6PAX A;  4KN7 X;  1FYM A;  1DPU A;  1ZGJ A;  2HKX A;  4HZF A;  2O03 A;  3FM5 A;  4IJA A;  3U2R A;  3VEP A;  3E6M A;  5DUK A;  4XSX F;  2XRN A;  4KUM A;  1Y0U A;  2MLG A;  2YU3 A;  4Z2Y A;  1LDD A;  1OMI A;  4YFN F;  5BPD A;  2KKO A;  4ZYH A;  2OZU A;  1YYV A;  3RJP A;  4M9S A;  1FBU A;  2W57 A;  2VC1 A;  2IA2 A;  4P55 A;  3DPL C;  3ZMT A;  4IRH A;  4HX8 A;  4HX7 A;  4XRF A;  4L5I A;  4A2U A;  1FZP B;  1W7P D;  2QWW A;  3HHG A;  2NAZ A;  5FD5 A;  3I64 A;  1HST A;  3HTU A;  3V7R A;  3GZ6 A;  1NHA A;  2P5V A;  4M72 A;  3B02 A;  5F1R A;  3MZH A;  3EYI A;  2VBY A;  3N97 A;  2ACJ A;  4UVA A;  1TQI A;  4EQQ A;  2XAH A;  3MCZ A;  3COA C;  4GGG A;  2UWM A;  1DUX C;  3VFZ A;  3NQO A;  3EQL F;  3ZMZ A;  2HR3 A;  2CO5 A;  4P9F A;  3J81 Z;  4PDK A;  5E8I A;  1I1G A;  4OMZ A;  5D6F A;  4WX9 A;  2P6T A;  4WXC A;  1LEA A;  1AOY A;  2FML A;  2O0Y A;  4LLG F;  1Z6T A;  4RGS A;  4LJZ F;  3KZY A;  4I2O A;  4MTD A;  4CGZ A;  4N9I A;  1RI7 A;  4U88 A;  2M30 A;  5BPI A;  1LB2 A;  4P9U A;  3M1E A;  1SFE A;  1W7P A;  1IRF A;  1G3W A;  4JBA A;  2Z99 A;  3WTY C;  3ROU A;  3RTR A;  2OBP A;  2PFB A;  3NRV A;  3CUQ B;  2PQ8 A;  2QLZ A;  2JZY A;  3KCC A;  3CUO A;  2QVO A;  2W24 A;  5L3G A;  4CZZ A;  2KIM A;  1K6O A;  2VBZ A;  1O3S A;  4R1H A;  4L9J A;  4XSZ F;  4HYE A;  3QAH A;  4OIR F;  1Z9C A;  5F6F A;  5DD4 A;  2VXZ A;  1FOK A;  1WWX A;  4EJU A;  1G6N A;  1TNS A;  4AIJ A;  1LJ9 A;  1LVA A;  4LLN A;  2ZNY A;  1U8R A;  2PJP A;  1USS A;  5D5W B;  5E17 F;  5JI6 A;  2FOK A;  5J8C A;  1ZG1 A;  1ZH5 A;  5K5R A;  2P5K A;  2ZNZ A;  1Z1D A;  2Z9O A;  3GVA A;  1TQM A;  1WSU A;  5E1X A;  4A6E A;  1IXC A;  2W85 A;  5FO5 A;  4N9H A;  5DCF A;  3K2Z A;  3R6S A;  2EV6 A;  1IXS B;  4MNU A;  2ETH A;  2XHK A;  1SD5 A;  5HS9 A;  1KU2 A;  1YIO A;  3GX4 X;  2PG4 A;  2CG4 A;  2Z3Y A;  1XGS A;  5CYV A;  1K78 B;  3ML6 A;  4HV5 A;  1IAW A;  1KA8 A;  1FP2 A;  4MEY F;  1P92 A;  2BGC A;  2VBW A;  4R8H A;  3JAM Z;  3IL2 A;  3K69 A;  1L3L A;  3WOD F;  1TW3 A;  3TOB A;  4I98 B;  3U9G A;  1QBJ A;  1LDJ A;  1EH8 A;  2O6G E;  1BI0 A;  5D4R A;  1B4A A;  1HSJ A;  3RKX A;  3KP2 A;  2Q0O A;  2RGV A;  3IWF A;  3QP5 A;  1Z05 A;  3Q5F A;  4H0E A;  4MEX F;  4A0Y A;  1BI3 A;  5HLH A;  2K7L A;  4Y15 A;  1I1S A;  2K86 A;  3KFW X;  2LNB A;  3EET A;  1KU7 A;  4Q48 A;  2Y48 A;  2IA0 A;  2FMY A;  1T0F A;  2HS5 A;  1KGS A;  2HOE A;  1SFX A;  1L0O C;  2FNA A;  3K0L A;  3LA3 A;  2XV4 S;  1S3J A;  2HGC A;  1MZB A;  1QPM A;  2AS5 F;  1P4W A;  2AXL A;  4CXF A;  2CYY A;  3TO9 A;  4L18 B;  1S7O A;  1QZY A;  2IP2 A;  4UNO A;  3F6V A;  2KIU A;  1F1Z A;  3IRQ A;  3C7J A;  4BQA A;  3P9I A;  1ZGA A;  1T39 A;  5EEH A;  4LG0 A;  2YSR A;  3LFK A;  4G94 A;  1BI2 A;  3LA2 A;  3QPT A;  1DDN A;  3RIR A;  2D1H A;  2CFX A;  2D2W A;  1B9M A;  2QM3 A;  4LD5 A;  5D8K B;  2OAZ A;  4UHT A;  2XIG A;  5CVV A;  2Y75 A;  2EFP A;  5HVQ C;  2M87 A;  1CGP A;  4DQ2 A;  4HDU A;  5L3C A;  1SD6 A;  1FSE A;  1WQ2 A;  3C1D A;  2RN7 A;  3CDH A;  2GXB A;  1IRG A;  2O61 A;  2HZT A;  3WGG A;  3V8J A;  3ELK A;  3TQN A;  1B6A A;  5H6R A;  2DU9 A;  1JGS A;  4YII A;  1MJB A;  5ED4 A;  3BJA A;  2HEO A;  1MDM B;  3E5U A;  5E18 F;  3GXO A;  4GO1 A;  5LEJ A;  5K1Y A;  2FEZ A;  1TBX A;  2QBY A;  3ECO A;  3CUQ A;  3IHU A;  1PDN C;  3QU3 A;  1UFM A;  1P4X A;  3LAP A;  5DEQ A;  4MQV A;  5DUI A;  2CQK A;  5L3F A;  4MHG A;  3IKT A;  3RYP A;  3SZT A;  2FU4 A;  2HYG D;  3LQR A;  1YS7 A;  2K4J A;  4GYG A;  3WTU C;  2QQA A;  3C18 A;  2WWY A;  1RUN A;  1XGN A;  4NHJ A;  1O57 A;  1G3Y A;  3SXY A;  4ENN A;  5CVI A;  1YLF A;  2DK8 A;  5E8G A;  1Z6R A;  3F8F A;  4BNC A;  2XRO A;  1XCB A;  4YIF A;  2M5W A;  1KU9 A;  5JHU A;  2L01 A;  1TQP A;  3JW4 A;  3EYY A;  4G7O F;  2F2E A;  1R36 A;  1XMK A;  4I0B A;  3LWF A;  5DYM A;  3O3K A;  4Q47 A;  2BE5 F;  4HV6 A;  1J7K A;  3WGI A;  4RGU A;  1RNL A;  2W84 A;  3PQJ A;  3W6K B;  1YS6 A;  3IRR A;  1LNW A;  1FNN A;  4AVP A;  1PUE E;  1MJ9 A;  5D8L B;  3GO5 A;  3HRU A;  3BJO A;  1UHM A;  5ICC A;  3HTS B;  1E2X A;  2HTJ A;  3CUQ C;  1Z91 A;  4WXH A;  4L9N A;  4FX0 A;  3I0T A;  4HF1 A;  4M73 A;  1HW1 A;  2HWV A;  4A0X A;  4MGR A;  3F8C A;  2OQG A;  3FXR A;  3RPQ A;  2EV5 A;  2JRT A;  5DDG A;  2L3D A;  1U5T B;  4UVC A;  1R00 A;  4IXA A;  2F5D A;  2H09 A;  4N0B A;  2V6C A;  4ESJ A;  1BIB A;  4HF2 A;  3HUG A;  2A5Y B;  3ZN0 A;  2XAJ A;  1G3T A;  3PFI A;  1ZRE A;  1F4K A;  2L4A A;  3JTH A;  2DW4 A;  3IC7 A;  2MBF A;  2RVC A;  1SAX A;  3GUD A;  5BS6 A;  1CF7 B;  3DXJ F;  3ZN1 A;  3GFJ A;  1H0M A;  4ESF A;  4YFK F;  3Q9S A;  4RAY A;  2FQ3 A;  1KQ8 A;  2RC4 A;  1QO0 D;  4Q5S F;  4QWQ A;  3AAF A;  3RKW A;  3DEU A;  2A6E F;  5ERI A;  5BQT A;  2L4M A;  4ZZD A;  1ZLK A;  2K4B A;  2FXA A;  2WV0 A;  2LKP A;  5FD6 A;  4P5O A;  2QEN A;  1KQ9 A;  4EJV A;  2RDP A;  2HQR A;  3WU1 B;  1UST A;  3BPV A;  4UXN A;  2MA3 A;  4FHT A;  1QZZ A;  4GCV A;  1YW8 A;  4KFC A;  4OOI A;  3BJ6 A;  3GFI A;  1U2W A;  2W25 A;  1FYL A;  1BOA A;  4EM0 B;  3V7C A;  4M74 A;  3HIF A;  4A6D A;  2ESN A;  3H3U A;  3MAJ A;  5LHG A;  2VBX A;  3S2W A;  1RUO A;  4KIB A;  5LLQ A;  3I59 A;  2KJC A;  3L00 A;  2V1D A;  3K9T A;  4CYD A;  3TKY A;  1BC7 C;  2JPC A;  3WTT C;  1J0R A;  4IVN A;  3SFZ A;  5JVT A;  2M1B A;  2F5C A;  5CVR A;  1U78 A;  5HDN A;  1MD0 A;  5DCM B;  5AIP A;  2RKH A;  3K1M A;  2EFN A;  1R1T A;  3HYI A;  2UXX A;  4O3M A;  4YFX F;  4DNC A;  2P7C B;  3F8N A;  4S05 A;  5LBQ A;  1B1B A;  1ON1 A;  1EH7 A;  3RI4 A;  2C6Y A;  2X0L A;  4U7D A;  1ULY A;  2E1N A;  3RYR A;  3RKY A;  2MH2 A;  3WTV C;  1S7A A;  2NYX A;  2EA4 A;  3F72 A;  4A5M A;  4OMY A;  1O3R A;  2ZME B;  5LHI A;  4EJO A;  1YTY A;  3FMQ A;  1H9G A;  1O7F A;  4UV9 A;  4Y13 A;  4BXU A;  2J5P A;  1ZAR A;  4UUV A;  4FX4 A;  3E3V A;  2IRF G;  1B9N A;  2Z5U A;  2ISY A;  1C0W A;  3R0J A;  4JQF A;  5LGN A;  3FX3 A;  4K2E A;  3MQ0 A;  2G7U A;  5LRR A;  2ISZ A;  3QP6 A;  3VB2 A;  3TO7 A;  5D5U B;  2P8T A;  3L2C A;  2ESH A;  2OZ6 A;  5K5Q A;  4G7H F;  1F5T A;  2PMU A;  5E1Z B;  2EFW A;  4CHU A;  2H6C A;  4FT8 A;  4AD9 A;  1G4D A;  5AIQ A;  2VN2 A;  2OQR A;  4OIN F;  3KLN A;  4EM1 A;  1DP7 P;  1U3E M;  4PZJ A;  3G3Z A;  4EJW A;  3KET A;  5ILV A;  1U5T A;  4EJT A;  1ZLJ A;  2V1X A;  2DTR A;  2YX7 A;  3R4K A;  4G7Z F;  1FT9 A;  1FBS A;  3HSE A;  3P7N A;  1BC8 C;  3VOD A;  1KQ0 A;  4HAM A;  2MD5 A;  4CDG A;  1S29 A;  2XVC A;  4OIQ F;  1K79 A;  4TV7 A;  4KMF A;  1CF7 A;  3HOT A;  2PBI A;  3D0S A;  1D8J A;  2RV8 A;  1ODD A;  1V4R A;  4MQ9 F;  3TO6 A;  3WGH A;  1HKS A;  4P96 A;  2IJL A;  2VC0 A;  3HSF A;  3RPU A;  2ELH A;  1R1U A;  2UXN A;  3BPX A;  1QNT A;  3BY6 A;  1JHH A;  3F8B A;  5JFR A;  2FBH A;  2KIF A;  5LEK A;  2Y0M A;  2QQB A;  3QU6 A;  1J2X A;  2GAU A;  2GZW A;  5BMZ A;  3Q9V A;  1LDK B;  3ECH A;  4I02 A;  2DI3 A;  4XBF A;  3GWZ A;  2GWR A;  1TW2 A;  4UV8 A;  5IT9 K;  4ENJ A;  2ZXJ A;  1U5T C;  1XSD A;  2EWN A;  3P9C A;  1O7L A;  1RIO H;  2GA2 A;  4HQM A;  4LB6 B;  3HRT A;  1EV7 A;  3F21 A;  1V3F A;  5A2Q K;  3ZPL A;  1J59 A;  5HS8 A;  1FBQ A;  2PN6 A;  1HKQ A;  4U0V A;  3U1D A;  4LB5 A;  1R22 A;  1OKR A;  2VOP A;  2QUF A;  4HF0 A;  3WE2 A;  5IT3 A;  3FF5 A;  1MGT A;  1OYI A;  3JSP A;  3K1N A;  1PP8 F;  5DCM A;  5KVR A;  3LAJ A;  5D6E A;  4WXD A;  1XCV A;  2GQQ A;  2FF4 A;  5CLS A;  4QLC U;  4IF4 A;  2P7V B;  4HBL A;  3FXU A;  2B0L A;  4BHB A;  1BJA A;  4U0Y A;  2JSC A;  3E6D A;  2PEX A;  1MKM A;  1J5Y A;  4CO8 A;  1ZG3 A;  1STZ A;  2NRA C;  3ZQ7 A;  4CIC A;  5HLI A;  1GXQ A;  1ZN2 A;  1TLH B;  4LLL A;  2M8E A;  4HDV A;  4ON0 A;  1PP7 U;  5TRD A;  4LMY A;  3DP7 A;  4NB5 A;  1W7P B;  4EV0 A;  3T1B A;  2BV6 A;  2P5L C;  1W4M A;  2JT1 A;  2X4H A;  2CSO A;  2QQ9 A;  2LSO A;  3CO7 C;  1XGO A;  3V8K A;  5D5V B;  5HDG A;  2VT3 A;  1I6X A;  2A68 F;  1IN7 A;  1WKM A;  3J80 K;  4L9T A;  2HDC A;  4A0Z A;  5ICF A;  1G3S A;  1XSV A;  1O3Q A;  2E1C A;  2ZME A;  2V79 A;  3RDI A;  2GXG A;  1X3U A;  4I01 A;  3CJN A;  4ZZL A;  4UVB A;  3VOE A;  3JTG A;  1OYW A;  1YW7 A;  3E6C C;  2R7F A;  2F5F A;  2CW0 F;  4G6Q A;  2YX4 A;  4IRG A;  1O3T A;  1J9I A;  1P2F A;  3MZY A;  3N4M A;  4L0Z B;  1OR7 A;  2ZJ2 A;  1SMT A;  1KYZ A;  4M9X A;  2J5O A;  4ESB A;  2VOO A;  1HW5 A;  1XD7 A;  4ZYD A;  1K78 A;  5BOX A;  1JE8 A;  3M8E A;  3I53 A;  3TGN A;  5A2Q Z;  1K7A A;  4RGR A;  3O6B B;  4HOB A;  4RB0 A;  1FY7 A;  5AON A;  3BOQ A;  4I7H A;  3ZMU A;  3J81 K;  3ZMD A;  3WU0 A;  1IN6 A;  2VE8 A;  3I4P A;  2CGP A;  3SZP A;  4WK8 F;  1FWZ A;  3F3X A;  4RB2 C;  4PCQ A;  2OA4 A;  1ZRC A;  3NEU A;  1YFH A;  3R61 A;  4RGX A;  2A07 F;  2DPD A;  5LRS A;  2V1U A;  3V8L A;  1UCR A;  4Y17 A;  1B59 A;  3WE3 A;  1KU3 A;  2ZFW A;  4EGZ A;  3GFM A;  1XB4 A;  3T5X A;  3QOP A;  2OU2 A;  2O8X A;  1IXR C;  2G9W A;  2FA5 A;  3G73 A;  3M8F A;  4PGG A;  4NQW A;  1W5S A;  1VTN C;  1SFU A;  5FGM A;  2RQP A;  3ABU A;  5F64 A;  1AWC A;  4M9Z A;  4WF2 A;  4HX4 A;  2TDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...