1R1UA

Crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
b'NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords repressor protein
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
total genus 32
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1uA00
2O61A 4RGRA 3IKTA 3R0JA 1KGSA 1MKMA 2ZFWA 1T2KA 5BMZA 3I58A 3WGGA 4DNCA 2V9VA 1ZGAA 3KP4A 2UWMA 3CJNA 1LVAA 4UVAA 4WX9A 2IT0A 1B59A 3IC7A 4LLGF 4A0XA 2CO5A 4CO8A 4LK1F 5LGNA 3F3XA 1MJAA 1IXRC 2CG4A 1IW7F 1S7OA 3ZMSA 2V6CA 2KIMA 1HQCA 2LKPA 2HOEA 5F6FA 2M8EA 5LGTA 1CF7B 3OV8A 4AWXB 1K6OA 1XMKA 2QBYA 3ZP5A 3T5XA 2ESHA 5K5QA 2DW4A 5BPDA 4JBAA 2JSCA 2Y48A 3O2PE 3M8EA 3RYPA 4G94A 3IKVA 2DU9A 2VC0A 2X4HA 1BI0A 3V7CA 1W7PB 1I1SA 4O3MA 1IRGA 4U0YA 2YX7A 5F1RA 3COAC 1BIBA 5J8FA 4N9HA 1QPMA 4UXNA 2R7FA 2DPDA 3ISPA 4D0PA 1FYKA 1DDNA 2MA3A 1I27A 3GXOA 5FGMA 1UB9A 3K0LA 2F5FA 3F8MA 1TW3A 1Z05A 1BOAA 4F7ZA 1IXCA 3BY6A 1G3TA 2HQNA 5ICFA 2XAGA 2VBWA 3RDIA 1ZHFA 4M73A 2RKHA 3WE3A 1FYLA 4H0EA 4LLNA 4IRHA 4HDUA 1ZAOA 4MEYF 4EJTA 3CUQA 5DUIA 4OIOF 2PFBA 2MD5A 2ZNZA 1FX7A 3LAPA 5A2QK 2OZUA 2RVCA 2W84A 2H94A 3LAJA 1FC3A 3MFKA 5TRDA 5JR3A 3WTTC 5DYMA 3WG9A 2VN2A 4P96A 3SZTA 4CZZA 2WV0A 4LJZF 1TQIA 1E2XA 3KLOA 1U8RA 3ZMVA 1BI2A 3TDUC 1DP7P 4NB5A 3WTYC 1U2WA 1H9TA 1YW9A 1XGMA 3RYRA 1J7KA 2VE9A 3GLXA 5L3BA 4RGUA 1IAWA 1H0MA 4MEXF 5CYVA 2FSWA 5AIQA 3GFIA 2EFPA 4CHUA 4EM0B 1SD5A 3TDZC 1ZG1A 1ZRFA 1HSJA 4WWCA 1T0FA 3QP5A 4LMYA 4HV6A 4HX8A 5CVUA 2ZJ2A 3VEPA 4YIIA 1DUXC 3DPLC 5CLSA 4BQAA 1P4AA 2RC4A 1K7AA 3C7JA 3LSTA 1K78A 4FX4A 4UVBA 4KNYA 4UNOA 1P6RA 1R5HA 3VB2A 3HOSA 2XKOA 3N4MA 1R7JA 3ZMUA 3DQVC 4EJWA 1HKSA 1R5GA 5K1YA 1JGSA 4ZZDA 3GO5A 2PQ8A 1HKTA 4KIGA 4XBFA 5CVIA 2ELHA 1GVJA 4AVPA 3IWZA 5FD5A 1FSEA 3FXQA 5E1ZB 5AONA 3DPTA 3LQQA 3GYHX 2OA4A 4U7BA 4P55A 1W4MA 5J6XA 4WCGA 3E6DA 4I02A 5CVRA 4LD5A 3WODF 1SD6A 4P9FA 2VOPA 3T8RA 4EM1A 3MZYA 1MJ9A 3J80K 4P5OA 2P7VB 3F8NA 4KYWA 2CYYA 5L3DA 2MLGA 4XSZF 3L9FA 1B9NA 2STWA 2FE3A 2VT2A 1TW2A 5D6FA 4ASNA 1QGPA 2EV0A 3LA2A 5A2QZ 2P6SA 4UV8A 1KU9A 2JT1A 1RUOA 2F5DA 4MHGA 3WTXC 2UZKA 1IF1A 2TDXA 5LBQA 3P9CA 2KKOA 3DEUA 4IHSA 2O6GE 5AIPA 3ZPLA 1EH7A 2QQ9A 3R0AA 4HF0A 3IRQA 4I01A 2OZ6A 2YPRA 4ZYEA 4U0WA 2HEOA 4HF1A 2XAHA 4NHJA 5CVJA 3U1DA 3SZPA 5D6EA 2DBBA 2RNJA 4M6XA 2X0LA 1Z91A 4KFCA 2QVOA 1FSHA 1O3QA 2KIUA 2E7WA 2E1CA 1P2FA 5BS6A 2EFWA 1GXQA 4YFXF 5E17F 5HS9A 1Z7UA 2Q2EA 3D5LA 3ZMZA 3QP6A 2RQPA 1OYIA 4M9ZA 3SXYA 4XSXF 3GW2A 4G7OF 3ECOA 3D0SA 3QAHA 1ON1A 4HLYA 1Q1HA 3ZN1A 2EB7A 4L0ZB 4K2EA 2MC3A 5ERIA 3O3KA 3WGHA 2DLLA 1YFHA 4A12A 1TLHB 3JSPA 1U3EM 1J2XA 3FMSA 4U0VA 3EYIA 3V8KA 5CVVA 2IA1A 3M9AA 3PFIA 5D4SA 1QO0D 1U78A 3G73A 4CYDA 2CSOA 3WE2A 5JI6A 4U7DA 5K5RA 1ZGJA 2FRHA 4MTEA 3E6BA 2A07F 3J80Z 1R36A 2M87A 5BPIA 1MDMA 3WU1B 6PAXA 4MGRA 4JQFA 4GGGA 1I6XA 5E1XA 3GEZA 4EGZA 1IN6A 1YYVA 1WI9A 4A6DA 3GVAA 2EFNA 2IA2A 1XGSA 3E5UA 5E1WA 4MTDA 4IF4A 3FXUA 3L09A 2MLKA 3IRRA 3HHGA 1FOKA 3BPXA 1Z6RA 3C3WA 1U5TA 4CDGA 2AXLA 5HS7A 4FHTA 1G4DA 1V3FA 1D5VA 2GA1A 1OPCA 4AIHA 4CGZA 3GF2A 1W7PD 1XD7A 1PP7U 2GXBA 3JTGA 4RS8A 2GXGA 1LEAA 2XKPA 3FX3A 3P7NA 4PZJA 2QENA 3I4PA 5CJ9A 1EH8A 2EFQA 3E3VA 1IRFA 3WU0A 3LA7A 1LDKB 1YLFA 5LEKA 2A68F 2FA5A 3MQ0A 3CO7C 3LA3A 2D1HA 4ZYGA 1DPUA 1TNSA 4ESFA 2ZCWA 2O0YA 2XHKA 2L3DA 2VT3A 2HFHA 2XROA 1T39A 5JVTA 1BC7C 1I1GA 1O3RA 5HVQC 5IT9K 1ZH5A 4RB2C 3HHHA 4ZYDA 3HSEA 4U88A 1Z1DA 2ZMEB 3GWZA 4GXOA 1RZ4A 2Y75A 4EVIA 4WF2A 4KMFA 1KU2A 3KP2A 4JK1X 3LWFA 1XN7A 1HSTA 1FP2A 1P92A 1L0OC 2C6YA 2D45A 2E1NA 3F8FA 2WWYA 3KP7A 3ELKA 3IHUA 1ZN2A 4BHBA 1FBSA 2PJPA 4LG0A 1KU3A 4R1HA 2EWNA 3I64A 4B09A 1QBJA 4ESBA 2IW5A 2YR2A 3M1EA 4EGYA 3KE2A 1XCVA 5HLHA 3R61A 2YU3A 1Z6TA 1E17A 2UXNA 3I59A 3L00A 1R58A 3K1NA 2WTEA 1R22A 1KQ8A 1S8NA 1DPRA 1U6GA 2L01A 5KK1A 2HZTA 4PGGA 1YQAA 1B9MA 2RDPA 1XSVA 1BIAA 3RKYA 2PN6A 3Q5FA 3KCCA 2DK5A 3NQOA 5DCFA 2NAZA 3J81K 3IWFA 2VE8A 3L2CA 4BAYA 1ZG5A 3QPHA 1KQ9A 3VFZA 4AIJA 1UHWA 1XMAA 1HW1A 4I0AA 2NNNA 3SQNA 2KJBA 2QLZA 3FMRA 2F5CA 2L4MA 2LNBA 1F1ZA 2Z99A 1YG2A 5BOXA 1BBYA 4HAMA 2L02A 3KP6A 2VONA 1J5YA 3V7RA 3WTSC 2GWRA 3EETA 1REPC 5H20A 5ED4A 1SMTA 5EEHA 1AWCA 4ESJA 4M9SA 1PP8F 1P4WA 4EJOA 2HTSA 5LHIA 1USTA 4ZH4F 1B1BA 1CF7A 2QYOA 1J0RA 2COMA 3KEOA 3FF5A 1IN8A 2GAUA 4FX0A 3G3ZA 1T98A 2OAZA 5IT9Z 5L3CA 1LQ1A 2FBHA 4WK8F 1FBUA 3BWGA 3CUQC 1OKRA 2DAOA 1ON2A 3AAFA 2XASA 4RAZA 1G3SA 1T6SA 3GZ6A 1IUYA 1JXSA 1J9IA 1SFXA 3JAMK 1W7PA 3WTVC 1BM9A 1I5ZA 2BBYA 3I54A 2XVCA 2EV5A 1LDJA 2K86A 4PDKA 2EV6A 5LHHA 2NYXA 2MBFA 5TJJA 2PI0A 3RIRA 2PMUA 2WC2A 2HTJA 4KICA 3RJPA 2W25A 2FNAA 3F6OA 1SMYF 2P7CB 4EJUA 2BYVE 2HGCA 2G7UA 4KIBA 5L3EA 4PGHA 2VC1A 3V7SA 2J5PA 2R7DA 2FMLA 3MEXA 2QUFA 4EJVA 1JHHA 1XDUA 2O8XA 2RGVA 5FD6A 2NS0A 2FBIA 3BROA 1C0WA 3TOBA 3ZMDA 5DCMB 3I5UA 1MGTA 3HSRA 3K2ZA 5HDNA 4YIFA 3EUHA 2PG4A 5ILVA 4S05A 1S7AA 4ENNA 2FU4A 3J81Z 1D8JA 4XRFA 4M6YA 3TO9A 4Y13A 4ZYHA 2XV4S 2O03A 1ZRCA 3H92A 4OMZA 4HF2A 5HDGA 3BJ6A 2P5LC 2KRFA 5JFRA 3QU3A 4G6DA 2EA4A 1UCRA 4OIQF 1OMIA 4HQEA 2FQ3A 2PLYA 2YX4A 3HOTA 4HDVA 1YW8A 2ISYA 4Y17A 3BPVA 3GUDA 3W6JB 4L9JA 2YSRA 4ENMA 3B02A 3FM5A 3F8BA 3QRFF 3ECHA 4GYIA 2O3FA 2K7LA 4WXHA 1ZYRF 3HRTA 4I7HA 2V79A 2EK5A 3I53A 2ETHA 1J59A 1R1VA 4M9XA 4HW0A 5E20A 5ILSA 3RI4A 1FZPB 3TQNA 5DDGA 1GXPA 2EJRA 1IN4A 2IRFG 2F2EA 3T8TA 4G8XA 4QLCU 4OMYA 3JAMZ 1BN5A 3DV8A 1S3JA 1LNWA 3F23A 2ZNYA 1KA8A 4A2UA 1MD0A 4P9UA 5EEGA 2ZXJA 5DEQA 1BC8C 4Z2YA 4YG2F 5HLIA 2FF4A 3KZYA 5D5WB 5LGUA 1ZARA 2XAFA 1B4AA 3JW4A 1ODDA 2H6BA 3GFLA 4YFNF 4KMUX 1T38A 1UHMA 4Q4ZF 3REOA 4BHPA 4EV0A 1FWZA 5ILUA 2FNPA 2FOKA 5H6RA 1QQIA 4L5JA 3HUGA 4Q48A 5KVRA 1SD7A 5E8GA 4HBLA 4HZFA 2XUBA 3R60A 5LLQA 2A5YB 5J8CA 1UFMA 2D2WA 1FP1D 2VXZA 4I2OA 5JHUA 1FT9A 2XAQA 3CTAA 3KEQA 4Y15A 4G7HF 2M45A 4UUVA 3BZ6A 4IJAA 3M7GA 2FBKA 1ZREA 4LFUA 2QBYB 3V8JA 4OINF 2FXAA 3RKWA 2AS5F 2EA2A 5LHGA 2W85A 3PQJA 3E97A 3CUOA 4M72A 2R3SA 4QWQA 4AIKA 4A5NA 4BH9A 2XRNA 1ONVA 5ICCA 4Q47A 2FMYA 2XAJA 4G7ZF 2KJCA 1IN7A 2DO7A 2CW0F 4HX4A 4BYYA 3S2WA 4UHTA 2GQQA 3WTZA 5D5UB 5D5XB 3K9TA 4RGSA 1TTYA 3WGIA 1YIOA 2LSOA 1KYZA 4IXAA 2A3SA 2V1DA 3CLOA 2LF8A 4LGWA 1O3SA 3FMQA 4XLPF 2IVMA 2M1BA 2OBPA 5HS8A 3ZQ7A 1IN5A 4HQMA 1WQ2A 4RB3C 4S04A 4G6QA 3N97A 1SAXA 1HKQA 2G7HA 4WXDA 3V4GA 2NRAC 4MNUA 3HTUA 3Q9SA 5L3FA 4L5IA 4KA4A 1ULYA 4L9TA 1RIOH 3HSFA 1HW5A 4LLLA 3LFKA 1YS7A 1ZLKA 2RN7A 1U5TC 1G3YA 3RTRA 3H3UA 5HOOA 4OOIA 3CUQB 1XGOA 2XIGA 1FBQA 4M74A 3KETA 2K4BA 1IXSB 4ENJA 2A6EF 1EV7A 4M71A 1MZBA 5FFZA 3P9IA 3FWEA 2Z3YA 2IPQX 1HW2A 3VODA 2W57A 1F5TA 3WTUC 2ESNA 1R00A 4GYGA 1AOYA 3HYIA 1R1TA 1FYMA 3NEUA 1WSUA 2KIFA 4DQ2A 1X3UA 4KT5C 1H9GA 3T1BA 3PQKA 3JSOA 3DF8A 3H3ZA 5LEJA 2HWVA 2K02A 3E5QA 3GZ5A 1LDDA 1STZA 2H27A 3ROUA 2GA2A 3CO6C 2CQKA 1TQMA 2VBYA 3KFWX 4HYEA 3I71A 2LDUA 4O6JA 1OYWA 4CICA 5IT3A 1L3LA 1SFEA 5ICGA 2BE5F 1MJBA 1O7LA 1W5TA 3IL2A 2DTRA 2CGPA 2EFOA 2DI3A 4UV9A 2H6CA 2OQGA 3EDPA 1K78B 3EQLF 4LB6B 4OIPF 4KN4X 4A0ZA 3E5XA 3RKXA 3V8LA 4BHCA 3KP3A 4AD9A 2A61A 3SFZA 5H6QA 2BEOA 1Z9CA 3C18A 3ERED 3E6CC 2QM3A 4HV5A 1FNNA 2ZKZA 2JPCA 4I0BA 1USSA 3HRUA 4OU0A 3P9KA 1KU7A 4IRGA 1ZRDA 3R4KA 1BI3A 1D8KA 1O57A 2J5OA 4HA8A 5DD8A 1A04A 5LRSA 1SFUA 2DFIA 2ZMEA 3FXRA 3F21A 3KZZA 3TKYA 5HLGA 3KP5A 2HDCA 2K4JA 3SHFA 2Q8KA 2GIVA 1GHCA 2CWEA 2M5WA 3LQRA 2Z9OA 4IHTA 1RUNA 3GFMA 2BGCA 4ZZLA 1BI1A 1SD4A 1XSXA 3NRVA 3U9GA 2CFXA 1B6AA 2K27A 1XB4A 2STTA 2HYFA 3MCZA 5D4RA 5E8IA 3QOPA 3K1MA 5ICEA 3WTWC 4GCVA 1QZYA 3E6MA 3FM3A 3KLNA 4LB5A 3HRSA 5F64A 1LJ9A 1IZ1A 3DKWA 2MH2A 3HIFA 1J75A 4HX7A 4BXUA 5BQTA 3K1PA 4KIFA 3RPQA 3F6VA 2IJLA 4L9NA 1OYYA 1S6LA 3R6SA 1ZLJA 3BDDA 3O6BB 2PEXA 1K79A 3ZN0A 2NNYA 5D8LB 5FLXK 2G9WA 1TQPA 3RPUA 1QNTA 4HOBA 4IRIA 2OD5A 3ABTA 1ZG3A 2L4AA 4RAYA 1JE8A 2Y0MA 4RGXA 4CXFA 3TGNA 2RV8A 2HQRA 1R23A 4EM2A 2QZ8A 2PMHA 3MZHA 1G3WA 5D8KB 3W6KB 1O3TA 2XGXA 4N9IA 1OR7A 3DP7A 4UVCA 2P4WA 2HR3A 3BP8A 4RB0A 3ABUA 4MQ9F 1Y0UA 3HRMA 3BJAA 3J7AO 4LK0F 4TV7A 3U2RA 4EMSA 4FT8A 3C1DA 5FB2A 4HLXA 3GFJA 2ACJA 3TO6A 3K69A 1CGPA 4KUMA 2JTVA 2Z5UA 1G6NA 4G9YA 4WXCA 2OQRA 3EYYA 2UXXA 3MAJA 4R79A 4KDPA 3ML6A 2DPUA 1FLIA 4ON0A 5LRRA 4L0YB 4KN7X 1MDMB 2VOOA 3TO7A 4XLNF 4OIRF 3F8CA 4E70A 3F22A 2DK8A 2A6HF 4O5VA 2BV6A 2E7XA 1FPQA 4B8XA 3JTHA 3BJOA 3BOQA 1RNLA 1KYWA 4GO1A 3CDHA 4ETSA 1PUEE 3B73A 1F4KA 3DXJF 1U5TB 2QWWA 2JZYA 2OU2A 1XCBA 4BNCA 2L54A 2HKOA 3GX4X 2GZWA 2ZBKA 4PCQA 4A0YA 3QU6A 3MWMA 2IP2A 5D5VB 2ISZA 5FFXA 3T0YA 2QQAA 5DCMA 2P5VA 2Q0OA 1F9NA 3HTSB 2VBXA 5FLXZ 2D1VA 1HBXG 4RB1A 1V4RA 2MH9A 4I09A 3ULQB 2JRTA 1O7FA 2H09A 1S29A 3M8FA 2DT5A 3DFGA 5DV5A 4YFKF 5L3GA 3F72A 3QPTA 1PDNC 1R1UA 1TBXA 3ZMTA 1FY7A 1TNTA 2B0LA 2JPBA 2VBZA 1LB2A 2P6TA 2IA0A 4IVNA 2PBIA 1WWXA 1YW7A 2LF7A 1D3YA 5DUKA 2P5KA 1WRJA 4MQVA 2M30A 2VODA 3I0TA 2HS5A 3VOEA 3OOPA 4N0BA 5K5OA 1QZZA 3Q9VA 4IPAA 2Z33A 2ZO4A 1YS6A 4I98B 1EH6A 2P8TA 4LG0B 1YTYA 1KQ0A 1XDSA 1XGNA 1VTNC 2HYGD 4R8HA 3TOAA 1BJAA 2ADUA 1XSDA 4NQWA 4Q5SF 1LEBA 1W5SA 2HKXA 2V1XA 4A6EA 2DQRA 4L18B 3I59B 1HXDA 1RI7A 2DQLA 2V1UA 1P4XA 2W24A 1YO5C 4EQQA 1WKMA 2QQBA 1JHFA 5DD4A 5E18F 3FHZA 5HDKA 2F5EA 2FEZA 4ENKA 4A5MA 1NHAA 2A69F 5FO5A 4L9VA 3FZVA 3L7WA
chains in the Genus database with same CATH superfamily
4DBQA 3A4CA 2O61A 4RGRA 1VQOI 4BJ6C 2W4SA 3IKTA 3R0JA 1KGSA 1MKMA 2VIXA 2ZFWA 4QPOA 1T2KA 5BMZA 1ETKA 2HVRA 3SZGA 1QU3A 1Z3YA 4BQQA 3OSFA 3I58A 3WGGA 4DNCA 2V9VA 1PYVA 1ZGAA 3KP4A 3FXKA 3JRIA 2UWMA 3CJNA 3HB9A 1LPQA 1LVAA 4AU7A 3QQAA 4J01A 3EPZA 4UVAA 3GZNB 2CJJA 3HKZA 2L0KA 3OIQA 4WX9A 2IT0A 1B59A 3IC7A 1DGRM 4LLGF 4A0XA 2CO5A 4CO8A 4LK1F 2E5NA 5LGNA 3F3XA 1MJAA 3E7LA 4E7SA 2M0CA 1IXRC 2CG4A 1IW7F 1S7OA 5F1JA 2DYSH 3G6EI 2R7VA 3SEQA 3ZMSA 2V6CA 1V5GA 2KIMA 4BE0A 1HQCA 2E60A 3HKZN 2Y30A 1IC8A 2LKPA 3G2BA 2HOEA 4IKFA 5F6FA 5EZHA 2M8EA 1SVOA 1T33A 5LGTA 1CF7B 1NTCA 1JUMA 3OV8A 4AWXB 1K6OA 1XMKA 3PM1A 2QBYA 2ZSIB 4XLEA 1FEXA 5TISC 4M3BA 3ZP5A 3T5XA 2ESHA 4Y7NJ 5K5QA 3DU6A 2DW4A 2CW7A 2ID3A 5BPDA 4JBAA 2WY8Q 2CV2A 3RCOA 3LSIA 1BA5A 2JSCA 5K7HA 2Y48A 4B47A 1KONA 1UAAA 3O2PE 1ETQA 2EBIA 4CCNA 3M8EA 3V42A 3RYPA 2X51A 3VSLA 4G94A 1SC7A 2ZJQF 3IKVA 2DU9A 2VC0A 2X4HA 1BI0A 3V7CA 4ABZA 4X1EA 1W7PB 2E1MB 3A0HC 4W1UA 1I1SA 3BT9A 4O3MA 1IRGA 5DM7F 4U0YA 2YX7A 5F1RA 3COAC 1BIBA 4BJTA 1HLVA 5J8FA 4N9HA 1QPMA 1E3PA 4V2GA 1ENHA 2KQRA 2E2HJ 4UXNA 2CH0A 2R7FA 2BVMA 2DPDA 1QVTA 3ISPA 3BR1A 4D0PA 5K7FA 4XLCA 2ELKA 3P5JA 1FYKA 3K4JA 1DDNA 2QKMB 2FX0A 5KAFC 2Y0SA 2MA3A 3DEEA 3TMOA 1MH4A 1I27A 3GXOA 5DM6F 2VKEA 5FGMA 3CJQB 1A6IA 1UB9A 1TZLA 3OY9A 3K0LA 3KX2A 1FIAA 2F5FA 3F8MA 1TW3A 1FOYA 1Z05A 4MO7A 1BOAA 3W2WA 4F7ZA 4I99C 1IXCA 3BCBA 3HOXJ 3BY6A 2O5RA 3CMEI 1QVUA 3DLLF 4NC7A 4QSHA 1G3TA 2HQNA 5ICFA 4F91B 2XAGA 2VBWA 3RDIA 4CCJA 1FOWA 1ZHFA 2OCEA 4M73A 1DP3A 2RKHA 3WE3A 3CJRB 2BVLA 2A05A 2LKXA 1FYLA 4BY1J 2IGMA 1O4XA 2W00A 1JT0A 4H0EA 4LLNA 4IRHA 4HDUA 2HZDA 1ZAOA 4MEYF 4EJTA 3CUQA 5DUIA 4OIOF 2PFBA 4XORA 2MD5A 2ZNZA 1W0TA 5EGOA 1XG1A 1FX7A 3LAPA 5A2QK 2E2IJ 2WB1N 2OZUA 2RVCA 2W84A 3ONQA 4M3DA 2R7XA 2H94A 3LAJA 1FC3A 4E7JA 1WJDA 3S3MA 3MFKA 5TRDA 5JR3A 2BOLA 2ZXHA 2E71A 2XC7A 1RKTA 2Y2ZA 3WTTC 5DYMA 3WG9A 3S93A 2EILH 2VN2A 1JJ8C 3B6AA 4P96A 3SZTA 2MG4A 1R9TJ 2X9DA 2WV0A 4CZZA 1MIJA 4XRSA 2OV7A 2CQ7A 4LJZF 1TQIA 3L2WA 3D5RC 1E2XA 5B66C 3KLOA 1U8RA 1WJEA 3ZMVA 4IOCF 2V26A 5FLMJ 1BI2A 1X3WB 2LVSA 2NOJB 3TDUC 3ZR8X 4A3EJ 1DP7P 1P9QC 2LH9A 2ECCA 1PJRA 4NB5A 1S5LC 3WTYC 1U2WA 1H9TA 1U9NA 3BQZA 3BTJA 1YW9A 2JUGA 1XGMA 4YEJA 3RYRA 1J7KA 2VE9A 1S7EA 3GLXA 3SDGA 5L3BA 4FASD 4RGUA 3H0GJ 2K3FA 1H0MA 1IAWA 4F55A 4MEXF 1YJ9I 3I56I 4DZJA 5CYVA 4CCOA 2FSWA 5AIQA 5C44J 1OCOH 2EFPA 3GFIA 3BTIA 4CHUA 1WI3A 3OL4A 4XKVA 4EM0B 2DMNA 1SD5A 3TDZC 3W6VA 1ZG1A 1EJ9A 1ZRFA 5FJ8J 1HSJA 4WWCA 5GP9A 5M5XJ 2BXYA 2ZMEC 3BG6A 2ZC2A 1T0FA 2E36A 2N8GA 9ANTA 3QP5A 1Y0NA 4LMYA 4HV6A 3CMAI 2A6TA 4HX8A 5CVUA 3GLLA 2ZJ2A 2CU7A 2HXIA 2ZXIA 4YIIA 3VEPA 5EF6A 4FCYA 2O8KA 1OLTA 3A1YA 1DUXC 3OYLA 3DPLC 5CLSA 1K4TA 4BQAA 1P4AA 4XIDA 2RC4A 3W3CA 1K7AA 3U1KA 1A6QA 2HU9A 5FKOA 3C7JA 3LSTA 5J1YA 1K78A 1OFCX 5CQEA 4V2FA 4FX4A 3AG1H 4UVBA 4KNYA 4BE1A 3MD2A 4UNOA 1N75A 1P6RA 1R5HA 1SFKA 1RC9A 3VB2A 3HOSA 3H5RA 2XKOA 3N4MA 1MBEA 1R7JA 2B9SA 3OR1C 1B8IA 3ZMUA 3DQVC 1N78A 2M8GX 4EJWA 1HKSA 1NH3A 2LFBA 3JRCA 1R5GA 5K1YA 1JGSA 4ZZDA 3GO5A 2E1MC 2PQ8A 1HKTA 5JVGF 2EPFA 4KIGA 4IQJA 4XBFA 1J09A 5CVIA 2ELHA 3CC2I 4ANJA 1GVJA 3LSRA 4AVPA 3IWZA 5FD5A 1FSEA 3HOVJ 3FXQA 5E1ZB 5AONA 5IP6A 3D1NI 3DPTA 3LQQA 3C2BA 3GYHX 1VFCA 1IDYA 2L9SA 2OA4A 2E35A 4U7BA 4P55A 2DYRH 1W4MA 5J6XA 2DDAA 3PFYA 4WCGA 4IHWA 3E6DA 4I02A 5CVRA 4LD5A 5F0FA 3WODF 1SD6A 4P9FA 2VOPA 1TC3C 3T8RA 3H36A 4EM1A 3MZYA 2H8RA 1RESA 5IP9J 5K7ZA 1XPXA 1G59A 4J19A 1MJ9A 4KITB 2CRGA 3J80K 4P5OA 2P7VB 3S16J 3F8NA 3HUGB 3OSGA 2HPMA 4KYWA 1MMDA 2CYYA 1ETVA 5L3DA 4IZZA 1APLC 2MLGA 4XSZF 3L9FA 1X2NA 2CQXA 1B9NA 3AG3H 1XX5A 2FE3A 2LTPA 2XAUA 4X0GA 2STWA 2A5WA 3O8GA 1GV2A 2VT2A 1TW2A 2ICWG 3GTMJ 3HZJA 5D6FA 3S1MJ 1QGPA 4N4OB 4ASNA 5J47A 2EV0A 3LA2A 4HNVA 5A2QZ 2P6SA 4UV8A 1KU9A 1YRNB 2JT1A 1VF9A 1RUOA 2F5DA 4BU2A 4MHGA 1OR7C 2HVQA 3WTXC 4C3JJ 5E3LA 3ERMA 2UZKA 3A03A 2JWTA 1IF1A 2TDXA 2XF6A 5LBQA 1WJFA 2DMQA 3H5AA 3P9CA 1IG7A 2KKOA 3IUOA 1E0EA 3DEUA 2HDDA 1NK2P 4IHSA 5EG0A 2EINH 3JRFA 2GOMA 5AIPA 2O6GE 1EH7A 3ZPLA 1IUFA 2VXDA 1GDTA 4ZDLA 2QQ9A 3R0AA 5LFAA 2O9LA 5CKTA 4HF0A 3IRQA 1GT0C 1LE8A 2HVSA 4I01A 2OZ6A 2YPRA 1M1EB 4ZYEA 4U0WA 2HEOA 2GOXB 4DZPA 4HF1A 2ZB9A 2XAHA 4NHJA 3LSKA 4HPQA 5CVJA 3U1DA 3SZPA 3F0CA 5CQGA 2HXOA 2K9LA 5D6EA 2DBBA 2RNJA 3CJTB 4M6XA 2X0LA 2L7FP 1Z91A 4KFCA 1Z21A 4BEHA 3DTKA 1DU6A 2QVOA 1FSHA 1O3QA 1WVRA 3BC8A 2KIUA 1WJ5A 3OYEA 2E7WA 3FXJA 3MKZA 2E1CA 4XK4A 3K4BA 3LNQA 1P2FA 3JREA 3MKLA 5BS6A 3BLYA 2EFWA 2R5YA 2M34A 1WCMJ 1GXQA 5F08A 3TBIA 2MW8A 2R7RA 4YFXF 5E17F 5HS9A 1Z7UA 4S0HB 4U87A 2Q2EA 2R7ZJ 4KJZA 3D5LA 3B6CA 3ZMZA 1LKXA 4F52A 3ZRGA 3OL3A 5FROA 3QP6A 2RQPA 1GUUA 1TT5B 1ITYA 1OYIA 1WJCA 3BR3A 1UJ8A 4M9ZA 3SXYA 4XSXF 3GW2A 3ZQCA 4G7OF 4A3BJ 3ECOA 3D0SA 3QAHA 1ON1A 4HLYA 2BY0A 1Q1HA 1R49A 3ZN1A 2EB7A 4PSXA 4K2EA 4L0ZB 4D5CA 2MC3A 5ERIA 3O3KA 3WGHA 2XF7A 2B7EA 4DW6A 1K83J 2DLLA 3OS1A 1YFHA 3K4NA 4A12A 4A3LJ 3FXOA 1XTAA 1TLHB 3H35A 3WHBA 3JSPA 1U3EM 2LBFA 1J2XA 3FMSA 3M4OJ 4U0VA 3EYIA 3V8KA 2QEXI 5CVVA 2QGUA 2IA1A 3M9AA 3PFIA 5D4SA 1QO0D 4XOPA 1U78A 2K9MA 3G73A 2DT7B 4CYDA 2CSOA 3FZVA 4XRMA 5GTHC 1VQ9I 3WE2A 3OYBA 5JI6A 3OYCA 4U7DA 2L7MP 3CLQA 1YE9A 5K5RA 3QODA 5IYDJ 5IP7J 3GMEA 1ETXA 1MBKA 3FXMA 1ZGJA 2FRHA 1X1BA 4MTEA 3HM5A 3E6BA 2A07F 2HQ5A 3J80Z 1JUPA 1MNMC 1R36A 1IJWC 2M87A 5BNGA 1Q1VA 5BPIA 2R7TA 1MDMA 3WU1B 2R7OA 3ZQQA 4FE4A 6PAXA 4MGRA 4JQFA 4GGGA 1I6XA 5E1XA 3BR0A 1AKHB 3GEZA 4EGZA 1IN6A 1YYVA 1WI9A 4XKBA 1N77A 1POGA 4UB8C 4XLAA 3GTPJ 4A6DA 3KYCB 2H1KA 4XL9A 4D5FA 3GVAA 2EFNA 3K4KA 2CFOA 2IA2A 1XGSA 3E5UA 1TP4A 2LK2A 5E1WA 2KFDA 4A3FJ 3DEWA 3IAM2 2VL8A 2LG4A 4MTDA 2EQRA 2L9RA 2Z1DA 2E1OA 2M4GA 4IF4A 1WH7A 3FXUA 3L09A 5EZGA 1X1PA 3H3VK 4FTHA 1JKOC 4BBRJ 2MLKA 3IRRA 3HPHA 4ZC3A 2XRLA 3HHGA 1T95A 3BPXA 1FOKA 3GTKJ 1Z6RA 3C3WA 1U5TA 4CDGA 2AXLA 3CZ6A 5HS7A 2MABA 2CUZA 4FHTA 1G4DA 2R93J 4M3GA 1FIPA 1V3FA 1D5VA 2GA1A 1OPCA 2CS3A 3FBNB 2FD5A 4AIHA 4CGZA 1VNDA 3FBIB 3GF2A 3QWLA 4JOMA 2M7BA 1W7PD 4B1RA 2JQ7A 1XD7A 3HGYA 1PP7U 3L2UA 2GXBA 3JTGA 4RS8A 2GXGA 1LEAA 2KZGA 3BZKA 3IH2A 3PNTA 2XKPA 3FX3A 3P7NA 4PZJA 2QENA 1FJLA 3I4PA 2I5UA 5CJ9A 1EH8A 2EFQA 3MMYB 3E3VA 2IBDA 1IRFA 2F6CA 3WU0A 3DPUA 3LA7A 1LDKB 3H9QA 1YLFA 2DA6A 5LEKA 1EKEA 1K61A 5M3MJ 3KEYA 1VQNI 2JJ7A 3JR9A 2A68F 4Y4RA 3IH3A 2VPRA 2BHZA 2FA5A 4J00A 3MQ0A 3CO7C 2ZFUA 3LA3A 4XKWA 2LLKA 2D1HA 4ZYGA 1ORKA 1TNSA 4KT6A 4XRSG 4ESFA 1DPUA 2EZHA 2ZCWA 4D1QA 2O0YA 3GTGJ 2XHKA 5B1AH 1ERDA 1ZR2A 2L3DA 2VT3A 1ZQ3P 2NVQJ 2LY1A 2HFHA 2Z16A 2XROA 1T39A 4HRIA 4PSWA 3VPRA 5JVTA 1BC7C 1I1GA 1O3RA 5HVQC 3QYFA 2D5VA 1ZH5A 4RB2C 3HHHA 5IT9K 4ZYDA 2IS1A 3S17J 4ZDOA 3HSEA 4Z6YA 4U88A 3I4NJ 1Z1DA 2ZMEB 3GWZA 4CYCA 4GXOA 3L2VA 2BW3B 1RZ4A 2Y75A 1UG2A 1MSFC 4EVIA 4WF2A 2VQLA 1WFXA 4KMFA 1KU2A 3KP2A 1Y8RB 4JK1X 3LWFA 4HSTA 1XN7A 1HSTA 1FP2A 1P92A 1L0OC 3AL0C 4E7KA 2C6YA 2NXNB 3M8JA 1P7JA 2D45A 2UV1A 2E1NA 3F8FA 2WWYA 4DOZA 3KP7A 3ELKA 3IHUA 1SFOJ 3LSHA 1ZN2A 1TT0A 3L2QA 1Y8QB 3SJMA 4BHBA 3HOZJ 1UG0A 1FBSA 5C4XJ 4JX6A 1BR4A 1EF4A 2PJPA 4PFOA 4LG0A 1KU3A 4R1HA 5M3FJ 2DJNA 2EWNA 3I64A 4B09A 1QBJA 4ESBA 3DLAA 4Y52J 2DT6A 2IW5A 2YR2A 3M1EA 4EGYA 3KE2A 1XCVA 2AXTC 5HLHA 3R61A 2F5VA 1UZCA 2TRTA 2W82A 2YU3A 1Z6TA 1AA7A 3PO3J 1E17A 2UXNA 2RREA 3I59A 4BS9A 2IGOA 4C2UA 3L00A 3RSNA 1R58A 3K1NA 4HEA2 2WTEA 5KHDA 5C3EJ 1R22A 1KQ8A 4RLQA 1H89C 1S8NA 1DPRA 5IOYA 1U6GA 4I6ZA 2OF7A 2L01A 5KK1A 2HOSA 2HZTA 4PGGA 1YQAA 1B9MA 2RDPA 4BQNA 2X6WA 3X2QH 1LVKA 2V9KA 4B48A 1XSVA 3LFUA 4BDYA 1BIAA 2XSDC 3CCJI 3RKYA 2HOAA 3E0JB 2PN6A 2IS2A 3Q5FA 3VSKA 4UY8I 3KCCA 3GTLJ 1JKPC 2WB1A 2DK5A 3NQOA 5DCFA 2NAZA 3J81K 3IWFA 2VE8A 3L2CA 4BAYA 1ZG5A 3CDLA 2I8DA 1KQ9A 3QPHA 3ASNH 3VFZA 4AIJA 1LFPA 1UHWA 1XMAA 1HW1A 3I3LA 2LOOA 4I0AA 2NNNA 3KZIC 4LG3A 3SQNA 1W36D 2KJBA 1BOBA 2QLZA 3FMRA 3BR6A 2F5CA 4MFEA 2L4MA 4XLHA 3PIPF 2LNBA 2Z99A 1F1ZA 1YG2A 5BOXA 1BBYA 2JA7J 2P81A 2XGCA 4HAMA 2L02A 4BBSJ 3KP6A 2VONA 1J5YA 3H9GA 3GTQJ 3V7RA 3QOEA 3WTSC 2GWRA 3EETA 2JSPA 1REPC 3S3OA 5H20A 2V7FA 2AHQA 5ED4A 5E3NA 1JTXA 1SMTA 3K2AA 5EEHA 2L9NA 4KISA 3HL2A 5KCMA 2LMDA 2MGQA 1AWCA 5FKLA 4ESJA 3OYIA 4M9SA 1SAUA 3J7ZI 1PP8F 1HC8A 1P4WA 1G2HA 1KZHA 2HI3A 4PJ0C 4XONA 3DWLE 3NAUA 3K4MA 3ZQIA 4EJOA 3QYEA 3OIOA 3S14J 4AM3A 3H9JA 2HTSA 1MMGA 3QYBA 1DQUA 3S8PA 3OYNA 4D7MA 1QRYA 5LHIA 5IYBJ 1USTA 4ZH4F 1B1BA 1CF7A 4DYCA 2QYOA 4LITA 1J0RA 2COMA 3GBGA 2OC6A 3KEOA 3FF5A 4IQ4A 3CCLI 1IN8A 2GAUA 4FX0A 1MMSA 4NC6A 3BZCA 3ZQHA 3G3ZA 4E7ZA 2R0QC 4BKXA 1T98A 2OAZA 3CCQI 2EZKA 5L3CA 5IT9Z 1SEUA 2EIMH 1LQ1A 2FBHA 4AIDA 4WK8F 1Y39A 1FBUA 3BWGA 3CUQC 1OKRA 2DAOA 3VYTB 1ON2A 1A5JA 3AAFA 2VUMJ 4ZDPA 4PJNA 2XASA 2R7SA 2DA4A 4G6TB 4RAZA 1G3SA 1T6SA 3A01B 5E3MA 3GZ6A 2XB0X 1IUYA 1JXSA 4P1WA 1J9IA 1SFXA 2R7WA 3JAMK 1W7PA 5KAIC 3WTVC 4E6KG 1BM9A 3CCVI 3EUKL 1A31A 1I5ZA 3C2HA 1S72I 1IO2A 2BBYA 3I54A 2XVCA 2EV5A 1LDJA 2K86A 2KDZA 4H4KC 5KNLA 1UMQA 4PDKA 4DYQA 3K70C 2EV6A 5LHHA 2NYXA 2MBFA 4M6VA 5TJJA 1H88C 2PI0A 3RIRA 2V6EA 2PMUA 1D1CA 2JK3A 4YRVA 1WJBA 2WC2A 3UKGA 2HTJA 4KICA 1SVMA 3RJPA 2W25A 2FNAA 5IYCJ 3F6OA 1SMYF 2P7CB 4EJUA 2BYVE 3OS2A 2KRCA 2HGCA 1PUFB 1H8AC 3SEZA 2G7UA 4D9JA 2K9NA 2BY2A 4KIBA 4A93J 5L3EA 2COBA 3Q0VA 4HSRA 3K4LA 4PGHA 3CCMI 2VC1A 3V7SA 2E19A 1Z67A 3G71I 3DTEA 3WG7H 2E5ZA 4A3IJ 2J5PA 2R7DA 2FMLA 3MEXA 2QUFA 1E3HA 1S9HA 4EJVA 1V5FA 3UR3C 4F92B 2JN6A 3CCUI 5CPRB 1OCZH 1VQMI 1JHHA 1XDUA 2O8XA 2RGVA 5FD6A 4XR6A 1V5EA 2NS0A 2FBIA 3BROA 1C0WA 3TOBA 1T0FC 3ZMDA 5DCMB 4PJJA 1T8IA 3I5UA 4OWRB 1MGTA 1Z77A 3FXLA 3HSRA 3K2ZA 1MH3A 5HDNA 2TCTA 4YIFA 3DBRB 4FQGA 2X6YA 3EUHA 4BACA 1Y1VJ 2PG4A 2M0MA 4AYBN 3JRBA 2IGNA 5J4YA 4BUPA 4A3GJ 5ILVA 2X1EA 4S05A 2HDWA 1S7AA 4ENNA 2ELJA 2FU4A 2X1DA 3U21A 3J81Z 1D8JA 2LYCA 4M6YA 4XRFA 2IXSA 3TO9A 4Y13A 2HOTA 4XN0A 1WGXA 3MKYB 2K85A 4ZYHA 3PUFA 3NWTA 2XV4S 4UUTA 4XNFA 3TP0A 2FUG2 2O03A 2BZTA 3M3YJ 1V54H 1ZRCA 1R6RA 4C3IJ 4CUGA 5FKNA 1G8XA 3H92A 4OMZA 4HF2A 5HDGA 1B72B 3FK6A 2LY2A 2PMZN 4RM2A 1IV6A 3BJ6A 1GVDA 4XICA 1XC5A 2DMTA 5F0CA 2P5LC 2KRFA 5JFRA 3QU3A 4G6DA 2EA4A 1UCRA 1OJLA 4JX4A 4IL6C 2L9VA 2JVGA 2X6OA 2Y69H 4OIQF 1OMIA 4HQEA 3HOYJ 4E7IA 2FQ3A 2KLOA 2PLYA 4XMYA 2YX4A 3HOTA 4HDVA 1YW8A 2KIQA 2ISYA 3FIWA 3G1LA 4UUSB 1BJZA 4E7HA 4Y17A 2PJRB 2E34A 3ZCOA 3BPVA 3GUDA 2EH3A 4L9JA 2JVHA 3W6JB 2YSRA 4E4HA 4ENMA 2IS4A 3B02A 2I10A 4OAZA 3TL4X 3FM5A 3F8BA 3QRFF 1NG7A 3ECHA 4RAFA 3DBLB 3CMYA 2OPTA 3SYTA 5HODA 3JRHA 4DBRA 4GYIA 2O3FA 2VJ5A 2K7LA 5JLXA 2HYJA 4WXHA 1JUSA 1ZYRF 4IX7A 3HRTA 4I7HA 2M3AA 2L7ZA 5GPCA 1U8BA 2V79A 3ABLH 3DTIA 2EK5A 2VLAA 2KT0A 4JYKA 1YIJI 3HC7A 5LD2C 3I53A 2ETHA 1J59A 3KPHA 1YITI 1R1VA 4M9XA 2DA3A 1BW6A 4HW0A 5E20A 5ILSA 3VWBA 4BXXJ 2JRMA 3RI4A 1FZPB 3TQNA 5DDGA 1RETA 1GXPA 1UHSA 1TWCJ 2EJRA 4BY7J 2ID6A 1IN4A 1UELB 2IRFG 3BR5A 2F2EA 4NQWB 3ESWB 3T8TA 3OS0A 4G8XA 4QLCU 3LMMA 4OMYA 3JAMZ 1BN5A 3DV8A 2JA8J 1S3JA 1LNWA 3MN2A 3F23A 2ZNYA 3S1QJ 1KA8A 3A2KA 1FTTA 2LP0A 5GPAA 2DJIA 1BW5A 4A2UA 1MD0A 1MMNA 2GBYA 4P9UA 4FISA 5EEGA 2ZXJA 1MW7A 5DEQA 1BC8C 4Z2YA 4YG2F 1W1WE 2M2EA 2R5ZB 5HLIA 2FF4A 3KZYA 5D5WB 5LGUA 1ZARA 2XAFA 1B4AA 1X3ZB 4NC8A 3JW4A 3AKZA 1ODDA 1EA3A 2H6BA 1TWGJ 3LSPA 3BQYA 3GFLA 4YFNF 4KMUX 1T38A 2CQQA 1UHMA 4Q4ZF 2OTJI 3REOA 4BHPA 4EV0A 1FWZA 1Z7LA 3AL0B 5ILUA 2X48A 1BR1A 2FNPA 1OQYA 2FOKA 2MFZA 2BXZA 5H6RA 2QSHX 1QQIA 4L5JA 5EDNA 3HUGA 1TWFJ 1VI0A 4Q48A 5KVRA 1SD7A 3L1PA 2M4KA 1VQ8I 2LKSA 5E8GA 4HBLA 4HZFA 3OYDA 2XUBA 3R60A 3AG2H 5LLQA 2A5YB 5J8CA 1UFMA 1W0UA 3ZOBA 2XPWA 3G1MA 2D2WA 1RR8C 1ZK8A 1IV8A 1FP1D 2VXZA 4F93B 4Y3OA 4I2OA 3EUAA 4BL0B 5JHUA 1FT9A 2XAQA 3CTAA 2NVYJ 3KEQA 3BTCA 4Y15A 4G7HF 1YRNA 2DTZA 2M45A 4UUVA 3BZ6A 4OAYA 2Z2SB 3BG3A 4HNTA 1Y1WJ 4IJAA 3M7GA 2EZIA 1VQLI 1V55H 2FBKA 5FKKA 2Y9ZA 1ZREA 4IHVA 4LFUA 3PSIA 3M07A 4RA2A 1D5YA 2DOAA 5IY5H 4B4CA 1U0JA 2WADA 2LY9A 2QBYB 1A35A 2IGKA 3V8JA 4OINF 2FXAA 3RKWA 1YI2I 1IRXA 2AS5F 2EA2A 5LHGA 3F9KA 2W85A 3PQJA 2RQQA 1ZKGA 5M5YJ 3E97A 3CF2A 3CUOA 4M72A 2R3SA 1JT6A 4NDLA 3PO2J 4QWQA 4AIKA 4A5NA 4BH9A 2XRNA 1ONVA 2Y9YA 5ICCA 4B3AA 4ITVA 3NWSA 4A3JJ 4Q47A 1A36A 4GFBA 2EIKH 3OYKA 2FMYA 2XAJA 4G7ZF 3ASOH 2KJCA 1IN7A 4AC0A 4RBOA 1VQPI 2DO7A 3VDXA 2CW0F 2JMWA 3MZ8A 4HX4A 3ZQGA 2L5QA 4BYYA 3HPGA 3S2WA 2KRHA 4UHTA 2GQQA 3WTZA 2VPLA 5D5UB 3JRDA 5D5XB 2ZJRF 2XPUA 3K9TA 2XGDA 5C4JJ 5F0HA 4RGSA 1TTYA 3RQ4A 2QKLB 4F3QA 4LIUA 1ZR4A 3WGIA 2NVXJ 1YIOA 2LSOA 4BXFA 1KYZA 2CUJA 3BG9A 3OOUA 3CF5F 1R5ID 4IXAA 2A3SA 4RAGA 2V1DA 3CLOA 1K4SA 3WU2C 2LF8A 2WA0A 4LGWA 1O3SA 5JHFA 3FMQA 4XLPF 2IVMA 1VQ6I 2M1BA 4C2MJ 2OBPA 5HS8A 5FRNA 3ZQ7A 1OCCH 5EEAA 4IO9F 1IN5A 4HQMA 1WQ2A 3J7YJ 1JTYA 4NUBA 4RB3C 2F48A 4S04A 4G6QA 3OYAA 3RZOJ 3N97A 2BY1A 4XN3A 1SAXA 1HKQA 2G7HA 4WXDA 3V4GA 3AG4H 3DU5A 5B1BH 1VZ0A 3HG9A 5J40A 2NRAC 4MNUA 3IAS2 2CUFA 3HTUA 3Q9SA 5L3FA 2GM4A 2IS6A 4L5IA 1ULYA 4L9TA 4KA4A 2M9HA 2DDBA 1RIOH 5TGTA 1NK3P 4C9YA 3HSFA 1HW5A 2KMUA 3HJEA 4RLFA 2L2OA 2ME6A 2OTLI 4LLLA 3LFKA 1YS7A 1BL0A 1ZLKA 2RN7A 4L5EA 1U5TC 3RPUD 1G3YA 2DFEA 3RTRA 3I9V2 3H3UA 1GV5A 5HOOA 4OOIA 3KYLA 1X2MA 3ABKH 3CUQB 4DGWB 1XGOA 2AO9A 4YELA 4JP0A 4D7NA 3OYHA 2XIGA 2DA1A 2WBMA 1FBQA 4M74A 5EGOB 3KETA 1XMXA 2VKDA 2K4BA 4Y33A 1IXSB 2EZLA 4ENJA 5DS9A 4A3KJ 2A6EF 1EV7A 4M71A 1MZBA 5FFZA 3CDIA 3P9IA 1AHDP 3FWEA 2Z3YA 2IPQX 1HW2A 1LFUP 2NVTJ 3VODA 3PIOF 2W57A 3N05A 2DMPA 1F5TA 3WTUC 3UNGC 2ESNA 1R00A 4GYGA 1AOYA 3HYIA 1R1TA 3M1CA 1FYMA 3NEUA 1WSUA 2G0EA 4CCMA 2KIFA 1X1AA 2NS8A 4BDZA 4DQ2A 1F36A 1X3UA 4BJ5C 4KT5C 1HOMA 3S1RJ 1H9GA 1I6HJ 3T1BA 1AKHA 2DMUA 3PQKA 3JSOA 4FE7A 3DF8A 3H3ZA 5LEJA 2HWVA 2K02A 2Q1ZB 2VQGA 2X1CA 1HDPA 1VQ5I 3DBHB 3E5QA 2ZXWH 4DIQA 1OCTC 1DGWY 1JI8A 2P0WA 1VQ7I 1D1AA 3GZ5A 2MSYA 1LFBA 1LDDA 1I3QJ 4CCKA 1STZA 3OMYA 2H27A 1N25A 1T56A 4M3FA 1HDDC 4V19K 5J1UA 4DYRA 3ROUA 2GA2A 2JA2A 4CSWA 3CO6C 1JKRC 2CQKA 3LL7A 1TQMA 4PJLA 1CQTA 2VBYA 2FJ1A 2R4GA 2XPVA 3KFWX 1QA6A 4HYEA 3I71A 2LDUA 1I3AA 3L2RA 4O6JA 1X58A 2YS9A 2H8WA 1OYWA 4CICA 5IT3A 1L3LA 1SFEA 5ICGA 3CCRI 2PX9A 2BE5F 2QCOA 1MJBA 1O7LA 1W5TA 3G4SI 3IL2A 1HF0A 4ZTFA 2DTRA 5B5EC 2CGPA 2EFOA 2DI3A 4UV9A 2DN0A 4AVZA 2H6CA 5GADJ 4CZCA 3S15J 1F43A 3S2DJ 2OQGA 3EDPA 1K78B 2AQFA 5GTIC 3EQLF 4LB6B 4OIPF 4KN4X 3TW6A 3O8HA 1YJNI 2DODA 4II3A 2K3PA 3BTLA 1IRZA 2VQCA 4A0ZA 2QSFX 5HNHA 1SANA 3E5XA 5H2FC 4IEJA 3RKXA 3CC7I 2ZSHB 3FHNA 1QHGA 1B8IB 3V8LA 4BHCA 1YJWI 3KP3A 1MBFA 2GXAA 5E3OA 4AD9A 2A61A 3FISA 3SFZA 5H6QA 2BEOA 1Z9CA 2YUSA 3C18A 3ERED 3E6CC 2XB5A 3K7AJ 2QM3A 4HV5A 1FNNA 2Y0SN 2ZKZA 2JPCA 4I0BA 1USSA 1TWAJ 1Z3XA 2IAIA 3HRUA 1IDZA 4OU0A 3P9KA 1RRJA 1KU7A 1YHQI 1W5CC 4IRGA 4CCLA 1ZRDA 5FLVA 2FOWA 3R4KA 3VYSB 1BI3A 1D8KA 4XOTA 2BHYA 2XGEA 1O57A 1WJAA 2J5OA 4HA8A 5DD8A 1A04A 5LRSA 1I39A 1SFUA 2WAEA 2DFIA 4BE2A 2ZMEA 4PFPA 1WZ2A 3HOWJ 4PK4A 3FXRA 3F21A 3K6GA 2BW3A 3KZZA 3NARA 1FOXA 3TKYA 5HLGA 3KP5A 2HDCA 2K4JA 3KYDB 3SHFA 2DA7A 2GIZA 2VJ4A 3W2AA 2JUCA 2Q8KA 3TP3A 2GIVA 1GHCA 2CWEA 2OCCH 2M5WA 3Q0WA 3LQRA 2AQEA 2H1LA 2Z9OA 1X4PA 2LRDA 4IHTA 1RUNA 3GFMA 5HNFA 4EATA 2BGCA 4ZZLA 1BI1A 1SD4A 1MBJA 1XSXA 3NRVA 3U9GA 2CFXA 3HDDA 4RM3A 1B6AA 2K27A 3BR2A 1WH5A 5DTDA 1QPIA 4II2A 4XQFA 1XB4A 2STTA 1MNEA 3S1NJ 2HYFA 3MCZA 1OISA 3ABMH 3CESA 4CH7A 3BG5A 3FKJA 2QA4I 2KP6A 4MIMA 5D4RA 1MBHA 2DOEA 1NG6A 1T08B 5E8IA 3H0DA 3QOPA 2QQ8A 4IOAF 1DU0A 5EG0B 3K1MA 5ICEA 3WTWC 4GCVA 5J4VA 1QZYA 4PJMA 1FTZA 3CP8A 2VI6A 3E6MA 3FM3A 3KLNA 4LB5A 3HRSA 5F64A 4C2TA 1LJ9A 2X6XA 3IH4A 2K9SA 3DKXA 1OCRH 1IZ1A 3PUBA 1LE8B 3DKWA 2MH2A 3HIFA 4JX5A 4QPQA 1J75A 4HX7A 4BXUA 2WV1A 4A3MJ 5BQTA 3QPSA 4XLFA 4C3HJ 2MD0A 3K1PA 4KIFA 3RPQA 3F6VA 4B44A 1TL8A 4W97A 2CMPA 2IJLA 1QHHD 4L9NA 3I55I 1OYYA 1S6LA 2RNGA 2LREA 1BR2A 4BGDA 3R6SA 1FMWA 1LUJB 1ZLJA 3BDDA 3O6BB 2W7NA 5J3LA 3DCFA 2K5CA 2PEXA 2LD5A 1WHUA 2Y31A 2OJED 4BEHB 1K79A 3ZN0A 2IEKA 4AYBA 2NNYA 1I50J 5D8LB 5FLXK 1R4MB 2G9WA 1TQPA 3RPUA 2RAEA 1QNTA 4HOBA 4IRIA 2OD5A 3ABTA 1ZG3A 3BG7A 2L4AA 5B3SH 2V4JC 4RAYA 1JE8A 1YX5A 2Y0MA 3OIPA 4RGXA 3SFIA 4XM3A 4CXFA 3PNVA 2R5YB 3OYGA 3TGNA 2RV8A 4RMNA 3CD6I 2HQRA 3I4MJ 2KISA 1R23A 2F4IA 4EM2A 2QZ8A 2Q2EB 2PMHA 4NBQA 2W1OA 3MZHA 1G3WA 2EIJH 5D8KB 1JJ6C 1IGNA 3W6KB 1O3TA 2XGXA 2FQ4A 3IP4B 4N9IA 1OR7A 3DP7A 4UVCA 1X19A 2VJJA 2PMZA 2P4WA 4UB6C 2HR3A 4QIWN 3BP8A 1JKQC 4RB0A 3ABUA 4C30A 2HNHA 3A0BC 4MQ9F 2CV0A 1Y0UA 2ME0A 3K10A 3C2GA 3HRMA 1ZELA 3PNYA 3BJAA 3J7AO 2KL4A 4LK0F 4TV7A 5E79C 3U2RA 3IV5A 3LSJA 4NNJA 4EMSA 4FT8A 1D0YA 1ETOA 1X1CA 3C1DA 1D0XA 1PVEA 2NVUB 5FB2A 4HLXA 3GFJA 3H5NA 2QSGX 3GTJJ 2W48A 2WAQA 4XKCA 2ACJA 2R92J 3CCEI 3TO6A 3TEDA 3K69A 2LBFB 1CGPA 4KUMA 3RKQA 2JTVA 2Z5UA 1G6NA 2F4OB 4GRIA 2WAFA 4G9YA 4WXCA 3S2HJ 1RKWA 3CC4I 3CQZJ 2OQRA 4DJAA 5EJCA 4ZJZA 3EYYA 1HA8A 1Y6IA 1JGGA 2UXXA 2F4MB 3MAJA 4PUSA 4R79A 1QZEA 1XS9A 2VB6A 2WAQN 4A3CJ 3OYFA 4G12A 2DFFA 4KDPA 2ZJPF 4QTRA 1VQKI 3ML6A 2JA6J 2NS7A 2DPUA 1FLIA 3EUHC 4ON0A 5LRRA 2WY7Q 4L0YB 4KN7X 3DKYA 1MDMB 2VOOA 3A01A 2MC4A 3TO7A 2DA5A 3W2VA 2LC2A 4GDFA 1D1BA 2DCEA 4OIRF 4XLNF 2L7KA 3F8CA 3QPLA 4E70A 3F22A 2DK8A 2A6HF 2M7AA 5HLTA 5GAEJ 4B3XA 4O5VA 1Z0XA 2ECBA 1ETYA 2BV6A 1E3OC 2E7XA 1FPQA 3HGGA 5J1RA 1GLNA 3JCUC 2KZVA 3JTHA 4B8XA 1Y56A 3BJOA 3BOQA 3CCYA 4B43A 1RNLA 1KYWA 4GO1A 3CDHA 4BQOA 2VASA 5FKMA 4ETSA 1PUEE 1TWHJ 3B73A 3SDBA 2QF7A 1F4KA 3OWTA 3DXJF 1U5TB 5GAHJ 1PUFA 1YX3A 2QWWA 2B63J 2JZYA 2OU2A 1MSEC 1XCBA 1ACIA 3JRGA 1MBGA 4BNCA 3S3NA 1RPWA 2L54A 2HKOA 3CCSI 3GX4X 2GZWA 2DFHA 2CUEA 2DOFA 2XDVA 2KDOA 2ZBKA 4ZYAA 4PCQA 4A0YA 2CW8A 2K40A 3TW7A 3QU6A 2VKHA 3MWMA 2IP2A 3MVPA 5IPAA 2LR8A 1K6YA 5D5VB 1MNDA 4A69C 3LSGA 4LIVA 4A3DJ 2ISZA 5FFXA 3T0YA 2QQAA 3HXLA 5DCMA 2P5VA 2BY3A 2Q0OA 1F9NA 1X4OA 3A02A 3JRAA 4EEFG 2UUZA 3ZXSA 3HTSB 3H1CA 2VBXA 3LOCA 4IHYA 2DA2A 3FK7A 4HG2A 1HCRA 5FLXZ 1ETWA 3E1SA 5FRMA 2D1VA 2VQHA 5F04A 3GTOJ 1ZTRA 3ZQLA 3D5SC 1HBXG 1R71A 2HPIA 4RB1A 1V4RA 3OYMA 2V1NA 2MH9A 3HBLA 4I09A 3ULQB 2JRTA 3K4CA 1W36C 3KIOA 1FMVA 2H09A 1S29A 3GCMA 3M8FA 2E2JJ 1B72A 4E7LA 1X1DA 4IHXA 2DT5A 3RQIA 3DFGA 2GLOA 5DV5A 4YFKF 5L3GA 1RR7A 2DXIA 3F72A 3HOUJ 3QPTA 5JLWA 1PDNC 2R7QA 3CP2A 1R1UA 1TBXA 3VYRB 3VYUB 3ZMTA 3S32A 1FY7A 1TNTA 2PJRA 2B0LA 4UUSA 2JPBA 3WHCA 3ZQFA 2VBZA 1R4NB 4FETA 4CYCB 1U9OA 1LB2A 2P6TA 5IOZA 2IA0A 4YIRX 4AUXA 2CQNA 4IVNA 3ZGKA 4ZTJA 4MLOA 3PSFA 2K9QA 2PBIA 5F27A 1WWXA 1YW7A 2LF7A 1AU7A 3HEFA 1D3YA 5DUKA 2YU9J 4M3EA 2O7OA 2P5KA 1WRJA 4MQVA 2M30A 2VODA 3FKIJ 3I0TA 3K70D 1WPKA 2XSJC 2HS5A 3MKWB 2KPMA 3VOEA 1D0ZA 2OUMA 2VJIA 3OOPA 4CA0A 4N0BA 5K5OA 1ZGWA 1QZZA 2VKVA 2XF5A 3Q9VA 3OR2C 2HQAA 4I76A 4IPAA 2X85A 2Z33A 1YOVB 2ZO4A 1YS6A 2NOGA 3CMMA 4I98B 4MFDA 1EH6A 2P8TA 3FDYA 2MYSA 3L7WA 4LG0B 1YTYA 1KQ0A 1XDSA 3PJRA 4LOCA 3RZDJ 1XGNA 1VTNC 2HYGD 4R8HA 3TOAA 3Q0UA 4X6AJ 1BJAA 2ADUA 1XSDA 4NQWA 1VQ4I 4Q5SF 3AFHA 3Q3SA 1LEBA 1W5SA 2HKXA 2R7UA 2V1XA 1P7IA 3LSMA 4A6EA 2DQRA 2V9PA 4L18B 3I59B 1HXDA 1RI7A 1SVLA 2DQLA 2CV1A 2V1UA 1P4XA 2W24A 5EYRA 1YO5C 4EQQA 1WKMA 5GAGJ 2QQBA 2JA5J 4HNUA 1JHFA 5M5WJ 5DD4A 5E18F 1OCPA 4RDUA 3FHZA 5HDKA 2F5EA 2R5ZA 2FEZA 1MMAA 4ENKA 3BCAA 4A5MA 3J7AY 3PL8A 4N4NB 3OYJA 1NHAA 2A69F 5FO5A 2KHMA 4L9VA 1O7FA 3G1OA
chains in the Genus database with same CATH topology
2O61A 4RGRA 3IKTA 3R0JA 1KGSA 1MKMA 2ZFWA 1T2KA 5BMZA 3I58A 3WGGA 4DNCA 2V9VA 1ZGAA 3KP4A 2UWMA 3CJNA 1LVAA 4UVAA 4WX9A 2IT0A 1B59A 3IC7A 4LLGF 4A0XA 2CO5A 4CO8A 4LK1F 5LGNA 3F3XA 1MJAA 1IXRC 2CG4A 1IW7F 1S7OA 3ZMSA 2V6CA 2KIMA 1HQCA 2LKPA 2HOEA 5F6FA 2M8EA 5LGTA 1CF7B 3OV8A 4AWXB 1K6OA 1XMKA 2QBYA 3ZP5A 3T5XA 2ESHA 5K5QA 2DW4A 5BPDA 4JBAA 2JSCA 2Y48A 3O2PE 3M8EA 3RYPA 4G94A 3IKVA 2DU9A 2VC0A 2X4HA 1BI0A 3V7CA 1W7PB 1I1SA 4O3MA 1IRGA 4U0YA 2YX7A 5F1RA 3COAC 1BIBA 5J8FA 4N9HA 1QPMA 4UXNA 2R7FA 2DPDA 3ISPA 4D0PA 1FYKA 1DDNA 2MA3A 1I27A 3GXOA 5FGMA 1UB9A 3K0LA 2F5FA 3F8MA 1TW3A 1Z05A 1BOAA 4F7ZA 1IXCA 3BY6A 1G3TA 2HQNA 5ICFA 2XAGA 2VBWA 3RDIA 1ZHFA 4M73A 2RKHA 3WE3A 1FYLA 4H0EA 4LLNA 4IRHA 4HDUA 1ZAOA 4MEYF 4EJTA 3CUQA 5DUIA 4OIOF 2PFBA 2MD5A 2ZNZA 1FX7A 3LAPA 5A2QK 2OZUA 2RVCA 2W84A 2H94A 3LAJA 1FC3A 3MFKA 5TRDA 5JR3A 3WTTC 5DYMA 3WG9A 2VN2A 4P96A 3SZTA 4CZZA 2WV0A 4LJZF 1TQIA 1E2XA 3KLOA 1U8RA 3ZMVA 1BI2A 3TDUC 1DP7P 4NB5A 3WTYC 1U2WA 1H9TA 1YW9A 1XGMA 3RYRA 1J7KA 2VE9A 3GLXA 5L3BA 4RGUA 1IAWA 1H0MA 4MEXF 5CYVA 2FSWA 5AIQA 3GFIA 2EFPA 4CHUA 4EM0B 1SD5A 3TDZC 1ZG1A 1ZRFA 1HSJA 4WWCA 1T0FA 3QP5A 4LMYA 4HV6A 4HX8A 5CVUA 2ZJ2A 3VEPA 4YIIA 1DUXC 3DPLC 5CLSA 4BQAA 1P4AA 2RC4A 1K7AA 3C7JA 3LSTA 1K78A 4FX4A 4UVBA 4KNYA 4UNOA 1P6RA 1R5HA 3VB2A 3HOSA 2XKOA 3N4MA 1R7JA 3ZMUA 3DQVC 4EJWA 1HKSA 1R5GA 5K1YA 1JGSA 4ZZDA 3GO5A 2PQ8A 1HKTA 4KIGA 4XBFA 5CVIA 2ELHA 1GVJA 4AVPA 3IWZA 5FD5A 1FSEA 3FXQA 5E1ZB 5AONA 3DPTA 3LQQA 3GYHX 2OA4A 4U7BA 4P55A 1W4MA 5J6XA 4WCGA 3E6DA 4I02A 5CVRA 4LD5A 3WODF 1SD6A 4P9FA 2VOPA 3T8RA 4EM1A 3MZYA 1MJ9A 3J80K 4P5OA 2P7VB 3F8NA 4KYWA 2CYYA 5L3DA 2MLGA 4XSZF 3L9FA 1B9NA 2STWA 2FE3A 2VT2A 1TW2A 5D6FA 4ASNA 1QGPA 2EV0A 3LA2A 5A2QZ 2P6SA 4UV8A 1KU9A 2JT1A 1RUOA 2F5DA 4MHGA 3WTXC 2UZKA 1IF1A 2TDXA 5LBQA 3P9CA 2KKOA 3DEUA 4IHSA 2O6GE 5AIPA 3ZPLA 1EH7A 2QQ9A 3R0AA 4HF0A 3IRQA 4I01A 2OZ6A 2YPRA 4ZYEA 4U0WA 2HEOA 4HF1A 2XAHA 4NHJA 5CVJA 3U1DA 3SZPA 5D6EA 2DBBA 2RNJA 4M6XA 2X0LA 1Z91A 4KFCA 2QVOA 1FSHA 1O3QA 2KIUA 2E7WA 2E1CA 1P2FA 5BS6A 2EFWA 1GXQA 4YFXF 5E17F 5HS9A 1Z7UA 2Q2EA 3D5LA 3ZMZA 3QP6A 2RQPA 1OYIA 4M9ZA 3SXYA 4XSXF 3GW2A 4G7OF 3ECOA 3D0SA 3QAHA 1ON1A 4HLYA 1Q1HA 3ZN1A 2EB7A 4L0ZB 4K2EA 2MC3A 5ERIA 3O3KA 3WGHA 2DLLA 1YFHA 4A12A 1TLHB 3JSPA 1U3EM 1J2XA 3FMSA 4U0VA 3EYIA 3V8KA 5CVVA 2IA1A 3M9AA 3PFIA 5D4SA 1QO0D 1U78A 3G73A 4CYDA 2CSOA 3WE2A 5JI6A 4U7DA 5K5RA 1ZGJA 2FRHA 4MTEA 3E6BA 2A07F 3J80Z 1R36A 2M87A 5BPIA 1MDMA 3WU1B 6PAXA 4MGRA 4JQFA 4GGGA 1I6XA 5E1XA 3GEZA 4EGZA 1IN6A 1YYVA 1WI9A 4A6DA 3GVAA 2EFNA 2IA2A 1XGSA 3E5UA 5E1WA 4MTDA 4IF4A 3FXUA 3L09A 2MLKA 3IRRA 3HHGA 1FOKA 3BPXA 1Z6RA 3C3WA 1U5TA 4CDGA 2AXLA 5HS7A 4FHTA 1G4DA 1V3FA 1D5VA 2GA1A 1OPCA 4AIHA 4CGZA 3GF2A 1W7PD 1XD7A 1PP7U 2GXBA 3JTGA 4RS8A 2GXGA 1LEAA 2XKPA 3FX3A 3P7NA 4PZJA 2QENA 3I4PA 5CJ9A 1EH8A 2EFQA 3E3VA 1IRFA 3WU0A 3LA7A 1LDKB 1YLFA 5LEKA 2A68F 2FA5A 3MQ0A 3CO7C 3LA3A 2D1HA 4ZYGA 1DPUA 1TNSA 4ESFA 2ZCWA 2O0YA 2XHKA 2L3DA 2VT3A 2HFHA 2XROA 1T39A 5JVTA 1BC7C 1I1GA 1O3RA 5HVQC 5IT9K 1ZH5A 4RB2C 3HHHA 4ZYDA 3HSEA 4U88A 1Z1DA 2ZMEB 3GWZA 4GXOA 1RZ4A 2Y75A 4EVIA 4WF2A 4KMFA 1KU2A 3KP2A 4JK1X 3LWFA 1XN7A 1HSTA 1FP2A 1P92A 1L0OC 2C6YA 2D45A 2E1NA 3F8FA 2WWYA 3KP7A 3ELKA 3IHUA 1ZN2A 4BHBA 1FBSA 2PJPA 4LG0A 1KU3A 4R1HA 2EWNA 3I64A 4B09A 1QBJA 4ESBA 2IW5A 2YR2A 3M1EA 4EGYA 3KE2A 1XCVA 5HLHA 3R61A 2YU3A 1Z6TA 1E17A 2UXNA 3I59A 3L00A 1R58A 3K1NA 2WTEA 1R22A 1KQ8A 1S8NA 1DPRA 1U6GA 2L01A 5KK1A 2HZTA 4PGGA 1YQAA 1B9MA 2RDPA 1XSVA 1BIAA 3RKYA 2PN6A 3Q5FA 3KCCA 2DK5A 3NQOA 5DCFA 2NAZA 3J81K 3IWFA 2VE8A 3L2CA 4BAYA 1ZG5A 3QPHA 1KQ9A 3VFZA 4AIJA 1UHWA 1XMAA 1HW1A 4I0AA 2NNNA 3SQNA 2KJBA 2QLZA 3FMRA 2F5CA 2L4MA 2LNBA 1F1ZA 2Z99A 1YG2A 5BOXA 1BBYA 4HAMA 2L02A 3KP6A 2VONA 1J5YA 3V7RA 3WTSC 2GWRA 3EETA 1REPC 5H20A 5ED4A 1SMTA 5EEHA 1AWCA 4ESJA 4M9SA 1PP8F 1P4WA 4EJOA 2HTSA 5LHIA 1USTA 4ZH4F 1B1BA 1CF7A 2QYOA 1J0RA 2COMA 3KEOA 3FF5A 1IN8A 2GAUA 4FX0A 3G3ZA 1T98A 2OAZA 5IT9Z 5L3CA 1LQ1A 2FBHA 4WK8F 1FBUA 3BWGA 3CUQC 1OKRA 2DAOA 1ON2A 3AAFA 2XASA 4RAZA 1G3SA 1T6SA 3GZ6A 1IUYA 1JXSA 1J9IA 1SFXA 3JAMK 1W7PA 3WTVC 1BM9A 1I5ZA 2BBYA 3I54A 2XVCA 2EV5A 1LDJA 2K86A 4PDKA 2EV6A 5LHHA 2NYXA 2MBFA 5TJJA 2PI0A 3RIRA 2PMUA 2WC2A 2HTJA 4KICA 3RJPA 2W25A 2FNAA 3F6OA 1SMYF 2P7CB 4EJUA 2BYVE 2HGCA 2G7UA 4KIBA 5L3EA 4PGHA 2VC1A 3V7SA 2J5PA 2R7DA 2FMLA 3MEXA 2QUFA 4EJVA 1JHHA 1XDUA 2O8XA 2RGVA 5FD6A 2NS0A 2FBIA 3BROA 1C0WA 3TOBA 3ZMDA 5DCMB 3I5UA 1MGTA 3HSRA 3K2ZA 5HDNA 4YIFA 3EUHA 2PG4A 5ILVA 4S05A 1S7AA 4ENNA 2FU4A 3J81Z 1D8JA 4XRFA 4M6YA 3TO9A 4Y13A 4ZYHA 2XV4S 2O03A 1ZRCA 3H92A 4OMZA 4HF2A 5HDGA 3BJ6A 2P5LC 2KRFA 5JFRA 3QU3A 4G6DA 2EA4A 1UCRA 4OIQF 1OMIA 4HQEA 2FQ3A 2PLYA 2YX4A 3HOTA 4HDVA 1YW8A 2ISYA 4Y17A 3BPVA 3GUDA 3W6JB 4L9JA 2YSRA 4ENMA 3B02A 3FM5A 3F8BA 3QRFF 3ECHA 4GYIA 2O3FA 2K7LA 4WXHA 1ZYRF 3HRTA 4I7HA 2V79A 2EK5A 3I53A 2ETHA 1J59A 1R1VA 4M9XA 4HW0A 5E20A 5ILSA 3RI4A 1FZPB 3TQNA 5DDGA 1GXPA 2EJRA 1IN4A 2IRFG 2F2EA 3T8TA 4G8XA 4QLCU 4OMYA 3JAMZ 1BN5A 3DV8A 1S3JA 1LNWA 3F23A 2ZNYA 1KA8A 4A2UA 1MD0A 4P9UA 5EEGA 2ZXJA 5DEQA 1BC8C 4Z2YA 4YG2F 5HLIA 2FF4A 3KZYA 5D5WB 5LGUA 1ZARA 2XAFA 1B4AA 3JW4A 1ODDA 2H6BA 3GFLA 4YFNF 4KMUX 1T38A 1UHMA 4Q4ZF 3REOA 4BHPA 4EV0A 1FWZA 5ILUA 2FNPA 2FOKA 5H6RA 1QQIA 4L5JA 3HUGA 4Q48A 5KVRA 1SD7A 5E8GA 4HBLA 4HZFA 2XUBA 3R60A 5LLQA 2A5YB 5J8CA 1UFMA 2D2WA 1FP1D 2VXZA 4I2OA 5JHUA 1FT9A 2XAQA 3CTAA 3KEQA 4Y15A 4G7HF 2M45A 4UUVA 3BZ6A 4IJAA 3M7GA 2FBKA 1ZREA 4LFUA 2QBYB 3V8JA 4OINF 2FXAA 3RKWA 2AS5F 2EA2A 5LHGA 2W85A 3PQJA 3E97A 3CUOA 4M72A 2R3SA 4QWQA 4AIKA 4A5NA 4BH9A 2XRNA 1ONVA 5ICCA 4Q47A 2FMYA 2XAJA 4G7ZF 2KJCA 1IN7A 2DO7A 2CW0F 4HX4A 4BYYA 3S2WA 4UHTA 2GQQA 3WTZA 5D5UB 5D5XB 3K9TA 4RGSA 1TTYA 3WGIA 1YIOA 2LSOA 1KYZA 4IXAA 2A3SA 2V1DA 3CLOA 2LF8A 4LGWA 1O3SA 3FMQA 4XLPF 2IVMA 2M1BA 2OBPA 5HS8A 3ZQ7A 1IN5A 4HQMA 1WQ2A 4RB3C 4S04A 4G6QA 3N97A 1SAXA 1HKQA 2G7HA 4WXDA 3V4GA 2NRAC 4MNUA 3HTUA 3Q9SA 5L3FA 4L5IA 4KA4A 1ULYA 4L9TA 1RIOH 3HSFA 1HW5A 4LLLA 3LFKA 1YS7A 1ZLKA 2RN7A 1U5TC 1G3YA 3RTRA 3H3UA 5HOOA 4OOIA 3CUQB 1XGOA 2XIGA 1FBQA 4M74A 3KETA 2K4BA 1IXSB 4ENJA 2A6EF 1EV7A 4M71A 1MZBA 5FFZA 3P9IA 3FWEA 2Z3YA 2IPQX 1HW2A 3VODA 2W57A 1F5TA 3WTUC 2ESNA 1R00A 4GYGA 1AOYA 3HYIA 1R1TA 1FYMA 3NEUA 1WSUA 2KIFA 4DQ2A 1X3UA 4KT5C 1H9GA 3T1BA 3PQKA 3JSOA 3DF8A 3H3ZA 5LEJA 2HWVA 2K02A 3E5QA 3GZ5A 1LDDA 1STZA 2H27A 3ROUA 2GA2A 3CO6C 2CQKA 1TQMA 2VBYA 3KFWX 4HYEA 3I71A 2LDUA 4O6JA 1OYWA 4CICA 5IT3A 1L3LA 1SFEA 5ICGA 2BE5F 1MJBA 1O7LA 1W5TA 3IL2A 2DTRA 2CGPA 2EFOA 2DI3A 4UV9A 2H6CA 2OQGA 3EDPA 1K78B 3EQLF 4LB6B 4OIPF 4KN4X 4A0ZA 3E5XA 3RKXA 3V8LA 4BHCA 3KP3A 4AD9A 2A61A 3SFZA 5H6QA 2BEOA 1Z9CA 3C18A 3ERED 3E6CC 2QM3A 4HV5A 1FNNA 2ZKZA 2JPCA 4I0BA 1USSA 3HRUA 4OU0A 3P9KA 1KU7A 4IRGA 1ZRDA 3R4KA 1BI3A 1D8KA 1O57A 2J5OA 4HA8A 5DD8A 1A04A 5LRSA 1SFUA 2DFIA 2ZMEA 3FXRA 3F21A 3KZZA 3TKYA 5HLGA 3KP5A 2HDCA 2K4JA 3SHFA 2Q8KA 2GIVA 1GHCA 2CWEA 2M5WA 3LQRA 2Z9OA 4IHTA 1RUNA 3GFMA 2BGCA 4ZZLA 1BI1A 1SD4A 1XSXA 3NRVA 3U9GA 2CFXA 1B6AA 2K27A 1XB4A 2STTA 2HYFA 3MCZA 5D4RA 5E8IA 3QOPA 3K1MA 5ICEA 3WTWC 4GCVA 1QZYA 3E6MA 3FM3A 3KLNA 4LB5A 3HRSA 5F64A 1LJ9A 1IZ1A 3DKWA 2MH2A 3HIFA 1J75A 4HX7A 4BXUA 5BQTA 3K1PA 4KIFA 3RPQA 3F6VA 2IJLA 4L9NA 1OYYA 1S6LA 3R6SA 1ZLJA 3BDDA 3O6BB 2PEXA 1K79A 3ZN0A 2NNYA 5D8LB 5FLXK 2G9WA 1TQPA 3RPUA 1QNTA 4HOBA 4IRIA 2OD5A 3ABTA 1ZG3A 2L4AA 4RAYA 1JE8A 2Y0MA 4RGXA 4CXFA 3TGNA 2RV8A 2HQRA 1R23A 4EM2A 2QZ8A 2PMHA 3MZHA 1G3WA 5D8KB 3W6KB 1O3TA 2XGXA 4N9IA 1OR7A 3DP7A 4UVCA 2P4WA 2HR3A 3BP8A 4RB0A 3ABUA 4MQ9F 1Y0UA 3HRMA 3BJAA 3J7AO 4LK0F 4TV7A 3U2RA 4EMSA 4FT8A 3C1DA 5FB2A 4HLXA 3GFJA 2ACJA 3TO6A 3K69A 1CGPA 4KUMA 2JTVA 2Z5UA 1G6NA 4G9YA 4WXCA 2OQRA 3EYYA 2UXXA 3MAJA 4R79A 4KDPA 3ML6A 2DPUA 1FLIA 4ON0A 5LRRA 4L0YB 4KN7X 1MDMB 2VOOA 3TO7A 4XLNF 4OIRF 3F8CA 4E70A 3F22A 2DK8A 2A6HF 4O5VA 2BV6A 2E7XA 1FPQA 4B8XA 3JTHA 3BJOA 3BOQA 1RNLA 1KYWA 4GO1A 3CDHA 4ETSA 1PUEE 3B73A 1F4KA 3DXJF 1U5TB 2QWWA 2JZYA 2OU2A 1XCBA 4BNCA 2L54A 2HKOA 3GX4X 2GZWA 2ZBKA 4PCQA 4A0YA 3QU6A 3MWMA 2IP2A 5D5VB 2ISZA 5FFXA 3T0YA 2QQAA 5DCMA 2P5VA 2Q0OA 1F9NA 3HTSB 2VBXA 5FLXZ 2D1VA 1HBXG 4RB1A 1V4RA 2MH9A 4I09A 3ULQB 2JRTA 1O7FA 2H09A 1S29A 3M8FA 2DT5A 3DFGA 5DV5A 4YFKF 5L3GA 3F72A 3QPTA 1PDNC 1R1UA 1TBXA 3ZMTA 1FY7A 1TNTA 2B0LA 2JPBA 2VBZA 1LB2A 2P6TA 2IA0A 4IVNA 2PBIA 1WWXA 1YW7A 2LF7A 1D3YA 5DUKA 2P5KA 1WRJA 4MQVA 2M30A 2VODA 3I0TA 2HS5A 3VOEA 3OOPA 4N0BA 5K5OA 1QZZA 3Q9VA 4IPAA 2Z33A 2ZO4A 1YS6A 4I98B 1EH6A 2P8TA 4LG0B 1YTYA 1KQ0A 1XDSA 1XGNA 1VTNC 2HYGD 4R8HA 3TOAA 1BJAA 2ADUA 1XSDA 4NQWA 4Q5SF 1LEBA 1W5SA 2HKXA 2V1XA 4A6EA 2DQRA 4L18B 3I59B 1HXDA 1RI7A 2DQLA 2V1UA 1P4XA 2W24A 1YO5C 4EQQA 1WKMA 2QQBA 1JHFA 5DD4A 5E18F 3FHZA 5HDKA 2F5EA 2FEZA 4ENKA 4A5MA 1NHAA 2A69F 5FO5A 4L9VA 3FZVA 3L7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O61 A;  4RGR A;  3IKT A;  3R0J A;  1KGS A;  1MKM A;  2ZFW A;  1T2K A;  5BMZ A;  3I58 A;  3WGG A;  4DNC A;  2V9V A;  1ZGA A;  3KP4 A;  2UWM A;  3CJN A;  1LVA A;  4UVA A;  4WX9 A;  2IT0 A;  1B59 A;  3IC7 A;  4LLG F;  4A0X A;  2CO5 A;  4CO8 A;  4LK1 F;  5LGN A;  3F3X A;  1MJA A;  1IXR C;  2CG4 A;  1IW7 F;  1S7O A;  3ZMS A;  2V6C A;  2KIM A;  1HQC A;  2LKP A;  2HOE A;  5F6F A;  2M8E A;  5LGT A;  1CF7 B;  3OV8 A;  4AWX B;  1K6O A;  1XMK A;  2QBY A;  3ZP5 A;  3T5X A;  2ESH A;  5K5Q A;  2DW4 A;  5BPD A;  4JBA A;  2JSC A;  2Y48 A;  3O2P E;  3M8E A;  3RYP A;  4G94 A;  3IKV A;  2DU9 A;  2VC0 A;  2X4H A;  1BI0 A;  3V7C A;  1W7P B;  1I1S A;  4O3M A;  1IRG A;  4U0Y A;  2YX7 A;  5F1R A;  3COA C;  1BIB A;  5J8F A;  4N9H A;  1QPM A;  4UXN A;  2R7F A;  2DPD A;  3ISP A;  4D0P A;  1FYK A;  1DDN A;  2MA3 A;  1I27 A;  3GXO A;  5FGM A;  1UB9 A;  3K0L A;  2F5F A;  3F8M A;  1TW3 A;  1Z05 A;  1BOA A;  4F7Z A;  1IXC A;  3BY6 A;  1G3T A;  2HQN A;  5ICF A;  2XAG A;  2VBW A;  3RDI A;  1ZHF A;  4M73 A;  2RKH A;  3WE3 A;  1FYL A;  4H0E A;  4LLN A;  4IRH A;  4HDU A;  1ZAO A;  4MEY F;  4EJT A;  3CUQ A;  5DUI A;  4OIO F;  2PFB A;  2MD5 A;  2ZNZ A;  1FX7 A;  3LAP A;  5A2Q K;  2OZU A;  2RVC A;  2W84 A;  2H94 A;  3LAJ A;  1FC3 A;  3MFK A;  5TRD A;  5JR3 A;  3WTT C;  5DYM A;  3WG9 A;  2VN2 A;  4P96 A;  3SZT A;  4CZZ A;  2WV0 A;  4LJZ F;  1TQI A;  1E2X A;  3KLO A;  1U8R A;  3ZMV A;  1BI2 A;  3TDU C;  1DP7 P;  4NB5 A;  3WTY C;  1U2W A;  1H9T A;  1YW9 A;  1XGM A;  3RYR A;  1J7K A;  2VE9 A;  3GLX A;  5L3B A;  4RGU A;  1IAW A;  1H0M A;  4MEX F;  5CYV A;  2FSW A;  5AIQ A;  3GFI A;  2EFP A;  4CHU A;  4EM0 B;  1SD5 A;  3TDZ C;  1ZG1 A;  1ZRF A;  1HSJ A;  4WWC A;  1T0F A;  3QP5 A;  4LMY A;  4HV6 A;  4HX8 A;  5CVU A;  2ZJ2 A;  3VEP A;  4YII A;  1DUX C;  3DPL C;  5CLS A;  4BQA A;  1P4A A;  2RC4 A;  1K7A A;  3C7J A;  3LST A;  1K78 A;  4FX4 A;  4UVB A;  4KNY A;  4UNO A;  1P6R A;  1R5H A;  3VB2 A;  3HOS A;  2XKO A;  3N4M A;  1R7J A;  3ZMU A;  3DQV C;  4EJW A;  1HKS A;  1R5G A;  5K1Y A;  1JGS A;  4ZZD A;  3GO5 A;  2PQ8 A;  1HKT A;  4KIG A;  4XBF A;  5CVI A;  2ELH A;  1GVJ A;  4AVP A;  3IWZ A;  5FD5 A;  1FSE A;  3FXQ A;  5E1Z B;  5AON A;  3DPT A;  3LQQ A;  3GYH X;  2OA4 A;  4U7B A;  4P55 A;  1W4M A;  5J6X A;  4WCG A;  3E6D A;  4I02 A;  5CVR A;  4LD5 A;  3WOD F;  1SD6 A;  4P9F A;  2VOP A;  3T8R A;  4EM1 A;  3MZY A;  1MJ9 A;  3J80 K;  4P5O A;  2P7V B;  3F8N A;  4KYW A;  2CYY A;  5L3D A;  2MLG A;  4XSZ F;  3L9F A;  1B9N A;  2STW A;  2FE3 A;  2VT2 A;  1TW2 A;  5D6F A;  4ASN A;  1QGP A;  2EV0 A;  3LA2 A;  5A2Q Z;  2P6S A;  4UV8 A;  1KU9 A;  2JT1 A;  1RUO A;  2F5D A;  4MHG A;  3WTX C;  2UZK A;  1IF1 A;  2TDX A;  5LBQ A;  3P9C A;  2KKO A;  3DEU A;  4IHS A;  2O6G E;  5AIP A;  3ZPL A;  1EH7 A;  2QQ9 A;  3R0A A;  4HF0 A;  3IRQ A;  4I01 A;  2OZ6 A;  2YPR A;  4ZYE A;  4U0W A;  2HEO A;  4HF1 A;  2XAH A;  4NHJ A;  5CVJ A;  3U1D A;  3SZP A;  5D6E A;  2DBB A;  2RNJ A;  4M6X A;  2X0L A;  1Z91 A;  4KFC A;  2QVO A;  1FSH A;  1O3Q A;  2KIU A;  2E7W A;  2E1C A;  1P2F A;  5BS6 A;  2EFW A;  1GXQ A;  4YFX F;  5E17 F;  5HS9 A;  1Z7U A;  2Q2E A;  3D5L A;  3ZMZ A;  3QP6 A;  2RQP A;  1OYI A;  4M9Z A;  3SXY A;  4XSX F;  3GW2 A;  4G7O F;  3ECO A;  3D0S A;  3QAH A;  1ON1 A;  4HLY A;  1Q1H A;  3ZN1 A;  2EB7 A;  4L0Z B;  4K2E A;  2MC3 A;  5ERI A;  3O3K A;  3WGH A;  2DLL A;  1YFH A;  4A12 A;  1TLH B;  3JSP A;  1U3E M;  1J2X A;  3FMS A;  4U0V A;  3EYI A;  3V8K A;  5CVV A;  2IA1 A;  3M9A A;  3PFI A;  5D4S A;  1QO0 D;  1U78 A;  3G73 A;  4CYD A;  2CSO A;  3WE2 A;  5JI6 A;  4U7D A;  5K5R A;  1ZGJ A;  2FRH A;  4MTE A;  3E6B A;  2A07 F;  3J80 Z;  1R36 A;  2M87 A;  5BPI A;  1MDM A;  3WU1 B;  6PAX A;  4MGR A;  4JQF A;  4GGG A;  1I6X A;  5E1X A;  3GEZ A;  4EGZ A;  1IN6 A;  1YYV A;  1WI9 A;  4A6D A;  3GVA A;  2EFN A;  2IA2 A;  1XGS A;  3E5U A;  5E1W A;  4MTD A;  4IF4 A;  3FXU A;  3L09 A;  2MLK A;  3IRR A;  3HHG A;  1FOK A;  3BPX A;  1Z6R A;  3C3W A;  1U5T A;  4CDG A;  2AXL A;  5HS7 A;  4FHT A;  1G4D A;  1V3F A;  1D5V A;  2GA1 A;  1OPC A;  4AIH A;  4CGZ A;  3GF2 A;  1W7P D;  1XD7 A;  1PP7 U;  2GXB A;  3JTG A;  4RS8 A;  2GXG A;  1LEA A;  2XKP A;  3FX3 A;  3P7N A;  4PZJ A;  2QEN A;  3I4P A;  5CJ9 A;  1EH8 A;  2EFQ A;  3E3V A;  1IRF A;  3WU0 A;  3LA7 A;  1LDK B;  1YLF A;  5LEK A;  2A68 F;  2FA5 A;  3MQ0 A;  3CO7 C;  3LA3 A;  2D1H A;  4ZYG A;  1DPU A;  1TNS A;  4ESF A;  2ZCW A;  2O0Y A;  2XHK A;  2L3D A;  2VT3 A;  2HFH A;  2XRO A;  1T39 A;  5JVT A;  1BC7 C;  1I1G A;  1O3R A;  5HVQ C;  5IT9 K;  1ZH5 A;  4RB2 C;  3HHH A;  4ZYD A;  3HSE A;  4U88 A;  1Z1D A;  2ZME B;  3GWZ A;  4GXO A;  1RZ4 A;  2Y75 A;  4EVI A;  4WF2 A;  4KMF A;  1KU2 A;  3KP2 A;  4JK1 X;  3LWF A;  1XN7 A;  1HST A;  1FP2 A;  1P92 A;  1L0O C;  2C6Y A;  2D45 A;  2E1N A;  3F8F A;  2WWY A;  3KP7 A;  3ELK A;  3IHU A;  1ZN2 A;  4BHB A;  1FBS A;  2PJP A;  4LG0 A;  1KU3 A;  4R1H A;  2EWN A;  3I64 A;  4B09 A;  1QBJ A;  4ESB A;  2IW5 A;  2YR2 A;  3M1E A;  4EGY A;  3KE2 A;  1XCV A;  5HLH A;  3R61 A;  2YU3 A;  1Z6T A;  1E17 A;  2UXN A;  3I59 A;  3L00 A;  1R58 A;  3K1N A;  2WTE A;  1R22 A;  1KQ8 A;  1S8N A;  1DPR A;  1U6G A;  2L01 A;  5KK1 A;  2HZT A;  4PGG A;  1YQA A;  1B9M A;  2RDP A;  1XSV A;  1BIA A;  3RKY A;  2PN6 A;  3Q5F A;  3KCC A;  2DK5 A;  3NQO A;  5DCF A;  2NAZ A;  3J81 K;  3IWF A;  2VE8 A;  3L2C A;  4BAY A;  1ZG5 A;  3QPH A;  1KQ9 A;  3VFZ A;  4AIJ A;  1UHW A;  1XMA A;  1HW1 A;  4I0A A;  2NNN A;  3SQN A;  2KJB A;  2QLZ A;  3FMR A;  2F5C A;  2L4M A;  2LNB A;  1F1Z A;  2Z99 A;  1YG2 A;  5BOX A;  1BBY A;  4HAM A;  2L02 A;  3KP6 A;  2VON A;  1J5Y A;  3V7R A;  3WTS C;  2GWR A;  3EET A;  1REP C;  5H20 A;  5ED4 A;  1SMT A;  5EEH A;  1AWC A;  4ESJ A;  4M9S A;  1PP8 F;  1P4W A;  4EJO A;  2HTS A;  5LHI A;  1UST A;  4ZH4 F;  1B1B A;  1CF7 A;  2QYO A;  1J0R A;  2COM A;  3KEO A;  3FF5 A;  1IN8 A;  2GAU A;  4FX0 A;  3G3Z A;  1T98 A;  2OAZ A;  5IT9 Z;  5L3C A;  1LQ1 A;  2FBH A;  4WK8 F;  1FBU A;  3BWG A;  3CUQ C;  1OKR A;  2DAO A;  1ON2 A;  3AAF A;  2XAS A;  4RAZ A;  1G3S A;  1T6S A;  3GZ6 A;  1IUY A;  1JXS A;  1J9I A;  1SFX A;  3JAM K;  1W7P A;  3WTV C;  1BM9 A;  1I5Z A;  2BBY A;  3I54 A;  2XVC A;  2EV5 A;  1LDJ A;  2K86 A;  4PDK A;  2EV6 A;  5LHH A;  2NYX A;  2MBF A;  5TJJ A;  2PI0 A;  3RIR A;  2PMU A;  2WC2 A;  2HTJ A;  4KIC A;  3RJP A;  2W25 A;  2FNA A;  3F6O A;  1SMY F;  2P7C B;  4EJU A;  2BYV E;  2HGC A;  2G7U A;  4KIB A;  5L3E A;  4PGH A;  2VC1 A;  3V7S A;  2J5P A;  2R7D A;  2FML A;  3MEX A;  2QUF A;  4EJV A;  1JHH A;  1XDU A;  2O8X A;  2RGV A;  5FD6 A;  2NS0 A;  2FBI A;  3BRO A;  1C0W A;  3TOB A;  3ZMD A;  5DCM B;  3I5U A;  1MGT A;  3HSR A;  3K2Z A;  5HDN A;  4YIF A;  3EUH A;  2PG4 A;  5ILV A;  4S05 A;  1S7A A;  4ENN A;  2FU4 A;  3J81 Z;  1D8J A;  4XRF A;  4M6Y A;  3TO9 A;  4Y13 A;  4ZYH A;  2XV4 S;  2O03 A;  1ZRC A;  3H92 A;  4OMZ A;  4HF2 A;  5HDG A;  3BJ6 A;  2P5L C;  2KRF A;  5JFR A;  3QU3 A;  4G6D A;  2EA4 A;  1UCR A;  4OIQ F;  1OMI A;  4HQE A;  2FQ3 A;  2PLY A;  2YX4 A;  3HOT A;  4HDV A;  1YW8 A;  2ISY A;  4Y17 A;  3BPV A;  3GUD A;  3W6J B;  4L9J A;  2YSR A;  4ENM A;  3B02 A;  3FM5 A;  3F8B A;  3QRF F;  3ECH A;  4GYI A;  2O3F A;  2K7L A;  4WXH A;  1ZYR F;  3HRT A;  4I7H A;  2V79 A;  2EK5 A;  3I53 A;  2ETH A;  1J59 A;  1R1V A;  4M9X A;  4HW0 A;  5E20 A;  5ILS A;  3RI4 A;  1FZP B;  3TQN A;  5DDG A;  1GXP A;  2EJR A;  1IN4 A;  2IRF G;  2F2E A;  3T8T A;  4G8X A;  4QLC U;  4OMY A;  3JAM Z;  1BN5 A;  3DV8 A;  1S3J A;  1LNW A;  3F23 A;  2ZNY A;  1KA8 A;  4A2U A;  1MD0 A;  4P9U A;  5EEG A;  2ZXJ A;  5DEQ A;  1BC8 C;  4Z2Y A;  4YG2 F;  5HLI A;  2FF4 A;  3KZY A;  5D5W B;  5LGU A;  1ZAR A;  2XAF A;  1B4A A;  3JW4 A;  1ODD A;  2H6B A;  3GFL A;  4YFN F;  4KMU X;  1T38 A;  1UHM A;  4Q4Z F;  3REO A;  4BHP A;  4EV0 A;  1FWZ A;  5ILU A;  2FNP A;  2FOK A;  5H6R A;  1QQI A;  4L5J A;  3HUG A;  4Q48 A;  5KVR A;  1SD7 A;  5E8G A;  4HBL A;  4HZF A;  2XUB A;  3R60 A;  5LLQ A;  2A5Y B;  5J8C A;  1UFM A;  2D2W A;  1FP1 D;  2VXZ A;  4I2O A;  5JHU A;  1FT9 A;  2XAQ A;  3CTA A;  3KEQ A;  4Y15 A;  4G7H F;  2M45 A;  4UUV A;  3BZ6 A;  4IJA A;  3M7G A;  2FBK A;  1ZRE A;  4LFU A;  2QBY B;  3V8J A;  4OIN F;  2FXA A;  3RKW A;  2AS5 F;  2EA2 A;  5LHG A;  2W85 A;  3PQJ A;  3E97 A;  3CUO A;  4M72 A;  2R3S A;  4QWQ A;  4AIK A;  4A5N A;  4BH9 A;  2XRN A;  1ONV A;  5ICC A;  4Q47 A;  2FMY A;  2XAJ A;  4G7Z F;  2KJC A;  1IN7 A;  2DO7 A;  2CW0 F;  4HX4 A;  4BYY A;  3S2W A;  4UHT A;  2GQQ A;  3WTZ A;  5D5U B;  5D5X B;  3K9T A;  4RGS A;  1TTY A;  3WGI A;  1YIO A;  2LSO A;  1KYZ A;  4IXA A;  2A3S A;  2V1D A;  3CLO A;  2LF8 A;  4LGW A;  1O3S A;  3FMQ A;  4XLP F;  2IVM A;  2M1B A;  2OBP A;  5HS8 A;  3ZQ7 A;  1IN5 A;  4HQM A;  1WQ2 A;  4RB3 C;  4S04 A;  4G6Q A;  3N97 A;  1SAX A;  1HKQ A;  2G7H A;  4WXD A;  3V4G A;  2NRA C;  4MNU A;  3HTU A;  3Q9S A;  5L3F A;  4L5I A;  4KA4 A;  1ULY A;  4L9T A;  1RIO H;  3HSF A;  1HW5 A;  4LLL A;  3LFK A;  1YS7 A;  1ZLK A;  2RN7 A;  1U5T C;  1G3Y A;  3RTR A;  3H3U A;  5HOO A;  4OOI A;  3CUQ B;  1XGO A;  2XIG A;  1FBQ A;  4M74 A;  3KET A;  2K4B A;  1IXS B;  4ENJ A;  2A6E F;  1EV7 A;  4M71 A;  1MZB A;  5FFZ A;  3P9I A;  3FWE A;  2Z3Y A;  2IPQ X;  1HW2 A;  3VOD A;  2W57 A;  1F5T A;  3WTU C;  2ESN A;  1R00 A;  4GYG A;  1AOY A;  3HYI A;  1R1T A;  1FYM A;  3NEU A;  1WSU A;  2KIF A;  4DQ2 A;  1X3U A;  4KT5 C;  1H9G A;  3T1B A;  3PQK A;  3JSO A;  3DF8 A;  3H3Z A;  5LEJ A;  2HWV A;  2K02 A;  3E5Q A;  3GZ5 A;  1LDD A;  1STZ A;  2H27 A;  3ROU A;  2GA2 A;  3CO6 C;  2CQK A;  1TQM A;  2VBY A;  3KFW X;  4HYE A;  3I71 A;  2LDU A;  4O6J A;  1OYW A;  4CIC A;  5IT3 A;  1L3L A;  1SFE A;  5ICG A;  2BE5 F;  1MJB A;  1O7L A;  1W5T A;  3IL2 A;  2DTR A;  2CGP A;  2EFO A;  2DI3 A;  4UV9 A;  2H6C A;  2OQG A;  3EDP A;  1K78 B;  3EQL F;  4LB6 B;  4OIP F;  4KN4 X;  4A0Z A;  3E5X A;  3RKX A;  3V8L A;  4BHC A;  3KP3 A;  4AD9 A;  2A61 A;  3SFZ A;  5H6Q A;  2BEO A;  1Z9C A;  3C18 A;  3ERE D;  3E6C C;  2QM3 A;  4HV5 A;  1FNN A;  2ZKZ A;  2JPC A;  4I0B A;  1USS A;  3HRU A;  4OU0 A;  3P9K A;  1KU7 A;  4IRG A;  1ZRD A;  3R4K A;  1BI3 A;  1D8K A;  1O57 A;  2J5O A;  4HA8 A;  5DD8 A;  1A04 A;  5LRS A;  1SFU A;  2DFI A;  2ZME A;  3FXR A;  3F21 A;  3KZZ A;  3TKY A;  5HLG A;  3KP5 A;  2HDC A;  2K4J A;  3SHF A;  2Q8K A;  2GIV A;  1GHC A;  2CWE A;  2M5W A;  3LQR A;  2Z9O A;  4IHT A;  1RUN A;  3GFM A;  2BGC A;  4ZZL A;  1BI1 A;  1SD4 A;  1XSX A;  3NRV A;  3U9G A;  2CFX A;  1B6A A;  2K27 A;  1XB4 A;  2STT A;  2HYF A;  3MCZ A;  5D4R A;  5E8I A;  3QOP A;  3K1M A;  5ICE A;  3WTW C;  4GCV A;  1QZY A;  3E6M A;  3FM3 A;  3KLN A;  4LB5 A;  3HRS A;  5F64 A;  1LJ9 A;  1IZ1 A;  3DKW A;  2MH2 A;  3HIF A;  1J75 A;  4HX7 A;  4BXU A;  5BQT A;  3K1P A;  4KIF A;  3RPQ A;  3F6V A;  2IJL A;  4L9N A;  1OYY A;  1S6L A;  3R6S A;  1ZLJ A;  3BDD A;  3O6B B;  2PEX A;  1K79 A;  3ZN0 A;  2NNY A;  5D8L B;  5FLX K;  2G9W A;  1TQP A;  3RPU A;  1QNT A;  4HOB A;  4IRI A;  2OD5 A;  3ABT A;  1ZG3 A;  2L4A A;  4RAY A;  1JE8 A;  2Y0M A;  4RGX A;  4CXF A;  3TGN A;  2RV8 A;  2HQR A;  1R23 A;  4EM2 A;  2QZ8 A;  2PMH A;  3MZH A;  1G3W A;  5D8K B;  3W6K B;  1O3T A;  2XGX A;  4N9I A;  1OR7 A;  3DP7 A;  4UVC A;  2P4W A;  2HR3 A;  3BP8 A;  4RB0 A;  3ABU A;  4MQ9 F;  1Y0U A;  3HRM A;  3BJA A;  3J7A O;  4LK0 F;  4TV7 A;  3U2R A;  4EMS A;  4FT8 A;  3C1D A;  5FB2 A;  4HLX A;  3GFJ A;  2ACJ A;  3TO6 A;  3K69 A;  1CGP A;  4KUM A;  2JTV A;  2Z5U A;  1G6N A;  4G9Y A;  4WXC A;  2OQR A;  3EYY A;  2UXX A;  3MAJ A;  4R79 A;  4KDP A;  3ML6 A;  2DPU A;  1FLI A;  4ON0 A;  5LRR A;  4L0Y B;  4KN7 X;  1MDM B;  2VOO A;  3TO7 A;  4XLN F;  4OIR F;  3F8C A;  4E70 A;  3F22 A;  2DK8 A;  2A6H F;  4O5V A;  2BV6 A;  2E7X A;  1FPQ A;  4B8X A;  3JTH A;  3BJO A;  3BOQ A;  1RNL A;  1KYW A;  4GO1 A;  3CDH A;  4ETS A;  1PUE E;  3B73 A;  1F4K A;  3DXJ F;  1U5T B;  2QWW A;  2JZY A;  2OU2 A;  1XCB A;  4BNC A;  2L54 A;  2HKO A;  3GX4 X;  2GZW A;  2ZBK A;  4PCQ A;  4A0Y A;  3QU6 A;  3MWM A;  2IP2 A;  5D5V B;  2ISZ A;  5FFX A;  3T0Y A;  2QQA A;  5DCM A;  2P5V A;  2Q0O A;  1F9N A;  3HTS B;  2VBX A;  5FLX Z;  2D1V A;  1HBX G;  4RB1 A;  1V4R A;  2MH9 A;  4I09 A;  3ULQ B;  2JRT A;  1O7F A;  2H09 A;  1S29 A;  3M8F A;  2DT5 A;  3DFG A;  5DV5 A;  4YFK F;  5L3G A;  3F72 A;  3QPT A;  1PDN C;  1R1U A;  1TBX A;  3ZMT A;  1FY7 A;  1TNT A;  2B0L A;  2JPB A;  2VBZ A;  1LB2 A;  2P6T A;  2IA0 A;  4IVN A;  2PBI A;  1WWX A;  1YW7 A;  2LF7 A;  1D3Y A;  5DUK A;  2P5K A;  1WRJ A;  4MQV A;  2M30 A;  2VOD A;  3I0T A;  2HS5 A;  3VOE A;  3OOP A;  4N0B A;  5K5O A;  1QZZ A;  3Q9V A;  4IPA A;  2Z33 A;  2ZO4 A;  1YS6 A;  4I98 B;  1EH6 A;  2P8T A;  4LG0 B;  1YTY A;  1KQ0 A;  1XDS A;  1XGN A;  1VTN C;  2HYG D;  4R8H A;  3TOA A;  1BJA A;  2ADU A;  1XSD A;  4NQW A;  4Q5S F;  1LEB A;  1W5S A;  2HKX A;  2V1X A;  4A6E A;  2DQR A;  4L18 B;  3I59 B;  1HXD A;  1RI7 A;  2DQL A;  2V1U A;  1P4X A;  2W24 A;  1YO5 C;  4EQQ A;  1WKM A;  2QQB A;  1JHF A;  5DD4 A;  5E18 F;  3FHZ A;  5HDK A;  2F5E A;  2FEZ A;  4ENK A;  4A5M A;  1NHA A;  2A69 F;  5FO5 A;  4L9V A;  3FZV A;  3L7W A; 
#chains in the Genus database with same CATH topology
 4DBQ A;  3A4C A;  2O61 A;  4RGR A;  1VQO I;  4BJ6 C;  2W4S A;  3IKT A;  3R0J A;  1KGS A;  1MKM A;  2VIX A;  2ZFW A;  4QPO A;  1T2K A;  5BMZ A;  1ETK A;  2HVR A;  3SZG A;  1QU3 A;  1Z3Y A;  4BQQ A;  3OSF A;  3I58 A;  3WGG A;  4DNC A;  2V9V A;  1PYV A;  1ZGA A;  3KP4 A;  3FXK A;  3JRI A;  2UWM A;  3CJN A;  3HB9 A;  1LPQ A;  1LVA A;  4AU7 A;  3QQA A;  4J01 A;  3EPZ A;  4UVA A;  3GZN B;  2CJJ A;  3HKZ A;  2L0K A;  3OIQ A;  4WX9 A;  2IT0 A;  1B59 A;  3IC7 A;  1DGR M;  4LLG F;  4A0X A;  2CO5 A;  4CO8 A;  4LK1 F;  2E5N A;  5LGN A;  3F3X A;  1MJA A;  3E7L A;  4E7S A;  2M0C A;  1IXR C;  2CG4 A;  1IW7 F;  1S7O A;  5F1J A;  2DYS H;  3G6E I;  2R7V A;  3SEQ A;  3ZMS A;  2V6C A;  1V5G A;  2KIM A;  4BE0 A;  1HQC A;  2E60 A;  3HKZ N;  2Y30 A;  1IC8 A;  2LKP A;  3G2B A;  2HOE A;  4IKF A;  5F6F A;  5EZH A;  2M8E A;  1SVO A;  1T33 A;  5LGT A;  1CF7 B;  1NTC A;  1JUM A;  3OV8 A;  4AWX B;  1K6O A;  1XMK A;  3PM1 A;  2QBY A;  2ZSI B;  4XLE A;  1FEX A;  5TIS C;  4M3B A;  3ZP5 A;  3T5X A;  2ESH A;  4Y7N J;  5K5Q A;  3DU6 A;  2DW4 A;  2CW7 A;  2ID3 A;  5BPD A;  4JBA A;  2WY8 Q;  2CV2 A;  3RCO A;  3LSI A;  1BA5 A;  2JSC A;  5K7H A;  2Y48 A;  4B47 A;  1KON A;  1UAA A;  3O2P E;  1ETQ A;  2EBI A;  4CCN A;  3M8E A;  3V42 A;  3RYP A;  2X51 A;  3VSL A;  4G94 A;  1SC7 A;  2ZJQ F;  3IKV A;  2DU9 A;  2VC0 A;  2X4H A;  1BI0 A;  3V7C A;  4ABZ A;  4X1E A;  1W7P B;  2E1M B;  3A0H C;  4W1U A;  1I1S A;  3BT9 A;  4O3M A;  1IRG A;  5DM7 F;  4U0Y A;  2YX7 A;  5F1R A;  3COA C;  1BIB A;  4BJT A;  1HLV A;  5J8F A;  4N9H A;  1QPM A;  1E3P A;  4V2G A;  1ENH A;  2KQR A;  2E2H J;  4UXN A;  2CH0 A;  2R7F A;  2BVM A;  2DPD A;  1QVT A;  3ISP A;  3BR1 A;  4D0P A;  5K7F A;  4XLC A;  2ELK A;  3P5J A;  1FYK A;  3K4J A;  1DDN A;  2QKM B;  2FX0 A;  5KAF C;  2Y0S A;  2MA3 A;  3DEE A;  3TMO A;  1MH4 A;  1I27 A;  3GXO A;  5DM6 F;  2VKE A;  5FGM A;  3CJQ B;  1A6I A;  1UB9 A;  1TZL A;  3OY9 A;  3K0L A;  3KX2 A;  1FIA A;  2F5F A;  3F8M A;  1TW3 A;  1FOY A;  1Z05 A;  4MO7 A;  1BOA A;  3W2W A;  4F7Z A;  4I99 C;  1IXC A;  3BCB A;  3HOX J;  3BY6 A;  2O5R A;  3CME I;  1QVU A;  3DLL F;  4NC7 A;  4QSH A;  1G3T A;  2HQN A;  5ICF A;  4F91 B;  2XAG A;  2VBW A;  3RDI A;  4CCJ A;  1FOW A;  1ZHF A;  2OCE A;  4M73 A;  1DP3 A;  2RKH A;  3WE3 A;  3CJR B;  2BVL A;  2A05 A;  2LKX A;  1FYL A;  4BY1 J;  2IGM A;  1O4X A;  2W00 A;  1JT0 A;  4H0E A;  4LLN A;  4IRH A;  4HDU A;  2HZD A;  1ZAO A;  4MEY F;  4EJT A;  3CUQ A;  5DUI A;  4OIO F;  2PFB A;  4XOR A;  2MD5 A;  2ZNZ A;  1W0T A;  5EGO A;  1XG1 A;  1FX7 A;  3LAP A;  5A2Q K;  2E2I J;  2WB1 N;  2OZU A;  2RVC A;  2W84 A;  3ONQ A;  4M3D A;  2R7X A;  2H94 A;  3LAJ A;  1FC3 A;  4E7J A;  1WJD A;  3S3M A;  3MFK A;  5TRD A;  5JR3 A;  2BOL A;  2ZXH A;  2E71 A;  2XC7 A;  1RKT A;  2Y2Z A;  3WTT C;  5DYM A;  3WG9 A;  3S93 A;  2EIL H;  2VN2 A;  1JJ8 C;  3B6A A;  4P96 A;  3SZT A;  2MG4 A;  1R9T J;  2X9D A;  2WV0 A;  4CZZ A;  1MIJ A;  4XRS A;  2OV7 A;  2CQ7 A;  4LJZ F;  1TQI A;  3L2W A;  3D5R C;  1E2X A;  5B66 C;  3KLO A;  1U8R A;  1WJE A;  3ZMV A;  4IOC F;  2V26 A;  5FLM J;  1BI2 A;  1X3W B;  2LVS A;  2NOJ B;  3TDU C;  3ZR8 X;  4A3E J;  1DP7 P;  1P9Q C;  2LH9 A;  2ECC A;  1PJR A;  4NB5 A;  1S5L C;  3WTY C;  1U2W A;  1H9T A;  1U9N A;  3BQZ A;  3BTJ A;  1YW9 A;  2JUG A;  1XGM A;  4YEJ A;  3RYR A;  1J7K A;  2VE9 A;  1S7E A;  3GLX A;  3SDG A;  5L3B A;  4FAS D;  4RGU A;  3H0G J;  2K3F A;  1H0M A;  1IAW A;  4F55 A;  4MEX F;  1YJ9 I;  3I56 I;  4DZJ A;  5CYV A;  4CCO A;  2FSW A;  5AIQ A;  5C44 J;  1OCO H;  2EFP A;  3GFI A;  3BTI A;  4CHU A;  1WI3 A;  3OL4 A;  4XKV A;  4EM0 B;  2DMN A;  1SD5 A;  3TDZ C;  3W6V A;  1ZG1 A;  1EJ9 A;  1ZRF A;  5FJ8 J;  1HSJ A;  4WWC A;  5GP9 A;  5M5X J;  2BXY A;  2ZME C;  3BG6 A;  2ZC2 A;  1T0F A;  2E36 A;  2N8G A;  9ANT A;  3QP5 A;  1Y0N A;  4LMY A;  4HV6 A;  3CMA I;  2A6T A;  4HX8 A;  5CVU A;  3GLL A;  2ZJ2 A;  2CU7 A;  2HXI A;  2ZXI A;  4YII A;  3VEP A;  5EF6 A;  4FCY A;  2O8K A;  1OLT A;  3A1Y A;  1DUX C;  3OYL A;  3DPL C;  5CLS A;  1K4T A;  4BQA A;  1P4A A;  4XID A;  2RC4 A;  3W3C A;  1K7A A;  3U1K A;  1A6Q A;  2HU9 A;  5FKO A;  3C7J A;  3LST A;  5J1Y A;  1K78 A;  1OFC X;  5CQE A;  4V2F A;  4FX4 A;  3AG1 H;  4UVB A;  4KNY A;  4BE1 A;  3MD2 A;  4UNO A;  1N75 A;  1P6R A;  1R5H A;  1SFK A;  1RC9 A;  3VB2 A;  3HOS A;  3H5R A;  2XKO A;  3N4M A;  1MBE A;  1R7J A;  2B9S A;  3OR1 C;  1B8I A;  3ZMU A;  3DQV C;  1N78 A;  2M8G X;  4EJW A;  1HKS A;  1NH3 A;  2LFB A;  3JRC A;  1R5G A;  5K1Y A;  1JGS A;  4ZZD A;  3GO5 A;  2E1M C;  2PQ8 A;  1HKT A;  5JVG F;  2EPF A;  4KIG A;  4IQJ A;  4XBF A;  1J09 A;  5CVI A;  2ELH A;  3CC2 I;  4ANJ A;  1GVJ A;  3LSR A;  4AVP A;  3IWZ A;  5FD5 A;  1FSE A;  3HOV J;  3FXQ A;  5E1Z B;  5AON A;  5IP6 A;  3D1N I;  3DPT A;  3LQQ A;  3C2B A;  3GYH X;  1VFC A;  1IDY A;  2L9S A;  2OA4 A;  2E35 A;  4U7B A;  4P55 A;  2DYR H;  1W4M A;  5J6X A;  2DDA A;  3PFY A;  4WCG A;  4IHW A;  3E6D A;  4I02 A;  5CVR A;  4LD5 A;  5F0F A;  3WOD F;  1SD6 A;  4P9F A;  2VOP A;  1TC3 C;  3T8R A;  3H36 A;  4EM1 A;  3MZY A;  2H8R A;  1RES A;  5IP9 J;  5K7Z A;  1XPX A;  1G59 A;  4J19 A;  1MJ9 A;  4KIT B;  2CRG A;  3J80 K;  4P5O A;  2P7V B;  3S16 J;  3F8N A;  3HUG B;  3OSG A;  2HPM A;  4KYW A;  1MMD A;  2CYY A;  1ETV A;  5L3D A;  4IZZ A;  1APL C;  2MLG A;  4XSZ F;  3L9F A;  1X2N A;  2CQX A;  1B9N A;  3AG3 H;  1XX5 A;  2FE3 A;  2LTP A;  2XAU A;  4X0G A;  2STW A;  2A5W A;  3O8G A;  1GV2 A;  2VT2 A;  1TW2 A;  2ICW G;  3GTM J;  3HZJ A;  5D6F A;  3S1M J;  1QGP A;  4N4O B;  4ASN A;  5J47 A;  2EV0 A;  3LA2 A;  4HNV A;  5A2Q Z;  2P6S A;  4UV8 A;  1KU9 A;  1YRN B;  2JT1 A;  1VF9 A;  1RUO A;  2F5D A;  4BU2 A;  4MHG A;  1OR7 C;  2HVQ A;  3WTX C;  4C3J J;  5E3L A;  3ERM A;  2UZK A;  3A03 A;  2JWT A;  1IF1 A;  2TDX A;  2XF6 A;  5LBQ A;  1WJF A;  2DMQ A;  3H5A A;  3P9C A;  1IG7 A;  2KKO A;  3IUO A;  1E0E A;  3DEU A;  2HDD A;  1NK2 P;  4IHS A;  5EG0 A;  2EIN H;  3JRF A;  2GOM A;  5AIP A;  2O6G E;  1EH7 A;  3ZPL A;  1IUF A;  2VXD A;  1GDT A;  4ZDL A;  2QQ9 A;  3R0A A;  5LFA A;  2O9L A;  5CKT A;  4HF0 A;  3IRQ A;  1GT0 C;  1LE8 A;  2HVS A;  4I01 A;  2OZ6 A;  2YPR A;  1M1E B;  4ZYE A;  4U0W A;  2HEO A;  2GOX B;  4DZP A;  4HF1 A;  2ZB9 A;  2XAH A;  4NHJ A;  3LSK A;  4HPQ A;  5CVJ A;  3U1D A;  3SZP A;  3F0C A;  5CQG A;  2HXO A;  2K9L A;  5D6E A;  2DBB A;  2RNJ A;  3CJT B;  4M6X A;  2X0L A;  2L7F P;  1Z91 A;  4KFC A;  1Z21 A;  4BEH A;  3DTK A;  1DU6 A;  2QVO A;  1FSH A;  1O3Q A;  1WVR A;  3BC8 A;  2KIU A;  1WJ5 A;  3OYE A;  2E7W A;  3FXJ A;  3MKZ A;  2E1C A;  4XK4 A;  3K4B A;  3LNQ A;  1P2F A;  3JRE A;  3MKL A;  5BS6 A;  3BLY A;  2EFW A;  2R5Y A;  2M34 A;  1WCM J;  1GXQ A;  5F08 A;  3TBI A;  2MW8 A;  2R7R A;  4YFX F;  5E17 F;  5HS9 A;  1Z7U A;  4S0H B;  4U87 A;  2Q2E A;  2R7Z J;  4KJZ A;  3D5L A;  3B6C A;  3ZMZ A;  1LKX A;  4F52 A;  3ZRG A;  3OL3 A;  5FRO A;  3QP6 A;  2RQP A;  1GUU A;  1TT5 B;  1ITY A;  1OYI A;  1WJC A;  3BR3 A;  1UJ8 A;  4M9Z A;  3SXY A;  4XSX F;  3GW2 A;  3ZQC A;  4G7O F;  4A3B J;  3ECO A;  3D0S A;  3QAH A;  1ON1 A;  4HLY A;  2BY0 A;  1Q1H A;  1R49 A;  3ZN1 A;  2EB7 A;  4PSX A;  4K2E A;  4L0Z B;  4D5C A;  2MC3 A;  5ERI A;  3O3K A;  3WGH A;  2XF7 A;  2B7E A;  4DW6 A;  1K83 J;  2DLL A;  3OS1 A;  1YFH A;  3K4N A;  4A12 A;  4A3L J;  3FXO A;  1XTA A;  1TLH B;  3H35 A;  3WHB A;  3JSP A;  1U3E M;  2LBF A;  1J2X A;  3FMS A;  3M4O J;  4U0V A;  3EYI A;  3V8K A;  2QEX I;  5CVV A;  2QGU A;  2IA1 A;  3M9A A;  3PFI A;  5D4S A;  1QO0 D;  4XOP A;  1U78 A;  2K9M A;  3G73 A;  2DT7 B;  4CYD A;  2CSO A;  3FZV A;  4XRM A;  5GTH C;  1VQ9 I;  3WE2 A;  3OYB A;  5JI6 A;  3OYC A;  4U7D A;  2L7M P;  3CLQ A;  1YE9 A;  5K5R A;  3QOD A;  5IYD J;  5IP7 J;  3GME A;  1ETX A;  1MBK A;  3FXM A;  1ZGJ A;  2FRH A;  1X1B A;  4MTE A;  3HM5 A;  3E6B A;  2A07 F;  2HQ5 A;  3J80 Z;  1JUP A;  1MNM C;  1R36 A;  1IJW C;  2M87 A;  5BNG A;  1Q1V A;  5BPI A;  2R7T A;  1MDM A;  3WU1 B;  2R7O A;  3ZQQ A;  4FE4 A;  6PAX A;  4MGR A;  4JQF A;  4GGG A;  1I6X A;  5E1X A;  3BR0 A;  1AKH B;  3GEZ A;  4EGZ A;  1IN6 A;  1YYV A;  1WI9 A;  4XKB A;  1N77 A;  1POG A;  4UB8 C;  4XLA A;  3GTP J;  4A6D A;  3KYC B;  2H1K A;  4XL9 A;  4D5F A;  3GVA A;  2EFN A;  3K4K A;  2CFO A;  2IA2 A;  1XGS A;  3E5U A;  1TP4 A;  2LK2 A;  5E1W A;  2KFD A;  4A3F J;  3DEW A;  3IAM 2;  2VL8 A;  2LG4 A;  4MTD A;  2EQR A;  2L9R A;  2Z1D A;  2E1O A;  2M4G A;  4IF4 A;  1WH7 A;  3FXU A;  3L09 A;  5EZG A;  1X1P A;  3H3V K;  4FTH A;  1JKO C;  4BBR J;  2MLK A;  3IRR A;  3HPH A;  4ZC3 A;  2XRL A;  3HHG A;  1T95 A;  3BPX A;  1FOK A;  3GTK J;  1Z6R A;  3C3W A;  1U5T A;  4CDG A;  2AXL A;  3CZ6 A;  5HS7 A;  2MAB A;  2CUZ A;  4FHT A;  1G4D A;  2R93 J;  4M3G A;  1FIP A;  1V3F A;  1D5V A;  2GA1 A;  1OPC A;  2CS3 A;  3FBN B;  2FD5 A;  4AIH A;  4CGZ A;  1VND A;  3FBI B;  3GF2 A;  3QWL A;  4JOM A;  2M7B A;  1W7P D;  4B1R A;  2JQ7 A;  1XD7 A;  3HGY A;  1PP7 U;  3L2U A;  2GXB A;  3JTG A;  4RS8 A;  2GXG A;  1LEA A;  2KZG A;  3BZK A;  3IH2 A;  3PNT A;  2XKP A;  3FX3 A;  3P7N A;  4PZJ A;  2QEN A;  1FJL A;  3I4P A;  2I5U A;  5CJ9 A;  1EH8 A;  2EFQ A;  3MMY B;  3E3V A;  2IBD A;  1IRF A;  2F6C A;  3WU0 A;  3DPU A;  3LA7 A;  1LDK B;  3H9Q A;  1YLF A;  2DA6 A;  5LEK A;  1EKE A;  1K61 A;  5M3M J;  3KEY A;  1VQN I;  2JJ7 A;  3JR9 A;  2A68 F;  4Y4R A;  3IH3 A;  2VPR A;  2BHZ A;  2FA5 A;  4J00 A;  3MQ0 A;  3CO7 C;  2ZFU A;  3LA3 A;  4XKW A;  2LLK A;  2D1H A;  4ZYG A;  1ORK A;  1TNS A;  4KT6 A;  4XRS G;  4ESF A;  1DPU A;  2EZH A;  2ZCW A;  4D1Q A;  2O0Y A;  3GTG J;  2XHK A;  5B1A H;  1ERD A;  1ZR2 A;  2L3D A;  2VT3 A;  1ZQ3 P;  2NVQ J;  2LY1 A;  2HFH A;  2Z16 A;  2XRO A;  1T39 A;  4HRI A;  4PSW A;  3VPR A;  5JVT A;  1BC7 C;  1I1G A;  1O3R A;  5HVQ C;  3QYF A;  2D5V A;  1ZH5 A;  4RB2 C;  3HHH A;  5IT9 K;  4ZYD A;  2IS1 A;  3S17 J;  4ZDO A;  3HSE A;  4Z6Y A;  4U88 A;  3I4N J;  1Z1D A;  2ZME B;  3GWZ A;  4CYC A;  4GXO A;  3L2V A;  2BW3 B;  1RZ4 A;  2Y75 A;  1UG2 A;  1MSF C;  4EVI A;  4WF2 A;  2VQL A;  1WFX A;  4KMF A;  1KU2 A;  3KP2 A;  1Y8R B;  4JK1 X;  3LWF A;  4HST A;  1XN7 A;  1HST A;  1FP2 A;  1P92 A;  1L0O C;  3AL0 C;  4E7K A;  2C6Y A;  2NXN B;  3M8J A;  1P7J A;  2D45 A;  2UV1 A;  2E1N A;  3F8F A;  2WWY A;  4DOZ A;  3KP7 A;  3ELK A;  3IHU A;  1SFO J;  3LSH A;  1ZN2 A;  1TT0 A;  3L2Q A;  1Y8Q B;  3SJM A;  4BHB A;  3HOZ J;  1UG0 A;  1FBS A;  5C4X J;  4JX6 A;  1BR4 A;  1EF4 A;  2PJP A;  4PFO A;  4LG0 A;  1KU3 A;  4R1H A;  5M3F J;  2DJN A;  2EWN A;  3I64 A;  4B09 A;  1QBJ A;  4ESB A;  3DLA A;  4Y52 J;  2DT6 A;  2IW5 A;  2YR2 A;  3M1E A;  4EGY A;  3KE2 A;  1XCV A;  2AXT C;  5HLH A;  3R61 A;  2F5V A;  1UZC A;  2TRT A;  2W82 A;  2YU3 A;  1Z6T A;  1AA7 A;  3PO3 J;  1E17 A;  2UXN A;  2RRE A;  3I59 A;  4BS9 A;  2IGO A;  4C2U A;  3L00 A;  3RSN A;  1R58 A;  3K1N A;  4HEA 2;  2WTE A;  5KHD A;  5C3E J;  1R22 A;  1KQ8 A;  4RLQ A;  1H89 C;  1S8N A;  1DPR A;  5IOY A;  1U6G A;  4I6Z A;  2OF7 A;  2L01 A;  5KK1 A;  2HOS A;  2HZT A;  4PGG A;  1YQA A;  1B9M A;  2RDP A;  4BQN A;  2X6W A;  3X2Q H;  1LVK A;  2V9K A;  4B48 A;  1XSV A;  3LFU A;  4BDY A;  1BIA A;  2XSD C;  3CCJ I;  3RKY A;  2HOA A;  3E0J B;  2PN6 A;  2IS2 A;  3Q5F A;  3VSK A;  4UY8 I;  3KCC A;  3GTL J;  1JKP C;  2WB1 A;  2DK5 A;  3NQO A;  5DCF A;  2NAZ A;  3J81 K;  3IWF A;  2VE8 A;  3L2C A;  4BAY A;  1ZG5 A;  3CDL A;  2I8D A;  1KQ9 A;  3QPH A;  3ASN H;  3VFZ A;  4AIJ A;  1LFP A;  1UHW A;  1XMA A;  1HW1 A;  3I3L A;  2LOO A;  4I0A A;  2NNN A;  3KZI C;  4LG3 A;  3SQN A;  1W36 D;  2KJB A;  1BOB A;  2QLZ A;  3FMR A;  3BR6 A;  2F5C A;  4MFE A;  2L4M A;  4XLH A;  3PIP F;  2LNB A;  2Z99 A;  1F1Z A;  1YG2 A;  5BOX A;  1BBY A;  2JA7 J;  2P81 A;  2XGC A;  4HAM A;  2L02 A;  4BBS J;  3KP6 A;  2VON A;  1J5Y A;  3H9G A;  3GTQ J;  3V7R A;  3QOE A;  3WTS C;  2GWR A;  3EET A;  2JSP A;  1REP C;  3S3O A;  5H20 A;  2V7F A;  2AHQ A;  5ED4 A;  5E3N A;  1JTX A;  1SMT A;  3K2A A;  5EEH A;  2L9N A;  4KIS A;  3HL2 A;  5KCM A;  2LMD A;  2MGQ A;  1AWC A;  5FKL A;  4ESJ A;  3OYI A;  4M9S A;  1SAU A;  3J7Z I;  1PP8 F;  1HC8 A;  1P4W A;  1G2H A;  1KZH A;  2HI3 A;  4PJ0 C;  4XON A;  3DWL E;  3NAU A;  3K4M A;  3ZQI A;  4EJO A;  3QYE A;  3OIO A;  3S14 J;  4AM3 A;  3H9J A;  2HTS A;  1MMG A;  3QYB A;  1DQU A;  3S8P A;  3OYN A;  4D7M A;  1QRY A;  5LHI A;  5IYB J;  1UST A;  4ZH4 F;  1B1B A;  1CF7 A;  4DYC A;  2QYO A;  4LIT A;  1J0R A;  2COM A;  3GBG A;  2OC6 A;  3KEO A;  3FF5 A;  4IQ4 A;  3CCL I;  1IN8 A;  2GAU A;  4FX0 A;  1MMS A;  4NC6 A;  3BZC A;  3ZQH A;  3G3Z A;  4E7Z A;  2R0Q C;  4BKX A;  1T98 A;  2OAZ A;  3CCQ I;  2EZK A;  5L3C A;  5IT9 Z;  1SEU A;  2EIM H;  1LQ1 A;  2FBH A;  4AID A;  4WK8 F;  1Y39 A;  1FBU A;  3BWG A;  3CUQ C;  1OKR A;  2DAO A;  3VYT B;  1ON2 A;  1A5J A;  3AAF A;  2VUM J;  4ZDP A;  4PJN A;  2XAS A;  2R7S A;  2DA4 A;  4G6T B;  4RAZ A;  1G3S A;  1T6S A;  3A01 B;  5E3M A;  3GZ6 A;  2XB0 X;  1IUY A;  1JXS A;  4P1W A;  1J9I A;  1SFX A;  2R7W A;  3JAM K;  1W7P A;  5KAI C;  3WTV C;  4E6K G;  1BM9 A;  3CCV I;  3EUK L;  1A31 A;  1I5Z A;  3C2H A;  1S72 I;  1IO2 A;  2BBY A;  3I54 A;  2XVC A;  2EV5 A;  1LDJ A;  2K86 A;  2KDZ A;  4H4K C;  5KNL A;  1UMQ A;  4PDK A;  4DYQ A;  3K70 C;  2EV6 A;  5LHH A;  2NYX A;  2MBF A;  4M6V A;  5TJJ A;  1H88 C;  2PI0 A;  3RIR A;  2V6E A;  2PMU A;  1D1C A;  2JK3 A;  4YRV A;  1WJB A;  2WC2 A;  3UKG A;  2HTJ A;  4KIC A;  1SVM A;  3RJP A;  2W25 A;  2FNA A;  5IYC J;  3F6O A;  1SMY F;  2P7C B;  4EJU A;  2BYV E;  3OS2 A;  2KRC A;  2HGC A;  1PUF B;  1H8A C;  3SEZ A;  2G7U A;  4D9J A;  2K9N A;  2BY2 A;  4KIB A;  4A93 J;  5L3E A;  2COB A;  3Q0V A;  4HSR A;  3K4L A;  4PGH A;  3CCM I;  2VC1 A;  3V7S A;  2E19 A;  1Z67 A;  3G71 I;  3DTE A;  3WG7 H;  2E5Z A;  4A3I J;  2J5P A;  2R7D A;  2FML A;  3MEX A;  2QUF A;  1E3H A;  1S9H A;  4EJV A;  1V5F A;  3UR3 C;  4F92 B;  2JN6 A;  3CCU I;  5CPR B;  1OCZ H;  1VQM I;  1JHH A;  1XDU A;  2O8X A;  2RGV A;  5FD6 A;  4XR6 A;  1V5E A;  2NS0 A;  2FBI A;  3BRO A;  1C0W A;  3TOB A;  1T0F C;  3ZMD A;  5DCM B;  4PJJ A;  1T8I A;  3I5U A;  4OWR B;  1MGT A;  1Z77 A;  3FXL A;  3HSR A;  3K2Z A;  1MH3 A;  5HDN A;  2TCT A;  4YIF A;  3DBR B;  4FQG A;  2X6Y A;  3EUH A;  4BAC A;  1Y1V J;  2PG4 A;  2M0M A;  4AYB N;  3JRB A;  2IGN A;  5J4Y A;  4BUP A;  4A3G J;  5ILV A;  2X1E A;  4S05 A;  2HDW A;  1S7A A;  4ENN A;  2ELJ A;  2FU4 A;  2X1D A;  3U21 A;  3J81 Z;  1D8J A;  2LYC A;  4M6Y A;  4XRF A;  2IXS A;  3TO9 A;  4Y13 A;  2HOT A;  4XN0 A;  1WGX A;  3MKY B;  2K85 A;  4ZYH A;  3PUF A;  3NWT A;  2XV4 S;  4UUT A;  4XNF A;  3TP0 A;  2FUG 2;  2O03 A;  2BZT A;  3M3Y J;  1V54 H;  1ZRC A;  1R6R A;  4C3I J;  4CUG A;  5FKN A;  1G8X A;  3H92 A;  4OMZ A;  4HF2 A;  5HDG A;  1B72 B;  3FK6 A;  2LY2 A;  2PMZ N;  4RM2 A;  1IV6 A;  3BJ6 A;  1GVD A;  4XIC A;  1XC5 A;  2DMT A;  5F0C A;  2P5L C;  2KRF A;  5JFR A;  3QU3 A;  4G6D A;  2EA4 A;  1UCR A;  1OJL A;  4JX4 A;  4IL6 C;  2L9V A;  2JVG A;  2X6O A;  2Y69 H;  4OIQ F;  1OMI A;  4HQE A;  3HOY J;  4E7I A;  2FQ3 A;  2KLO A;  2PLY A;  4XMY A;  2YX4 A;  3HOT A;  4HDV A;  1YW8 A;  2KIQ A;  2ISY A;  3FIW A;  3G1L A;  4UUS B;  1BJZ A;  4E7H A;  4Y17 A;  2PJR B;  2E34 A;  3ZCO A;  3BPV A;  3GUD A;  2EH3 A;  4L9J A;  2JVH A;  3W6J B;  2YSR A;  4E4H A;  4ENM A;  2IS4 A;  3B02 A;  2I10 A;  4OAZ A;  3TL4 X;  3FM5 A;  3F8B A;  3QRF F;  1NG7 A;  3ECH A;  4RAF A;  3DBL B;  3CMY A;  2OPT A;  3SYT A;  5HOD A;  3JRH A;  4DBR A;  4GYI A;  2O3F A;  2VJ5 A;  2K7L A;  5JLX A;  2HYJ A;  4WXH A;  1JUS A;  1ZYR F;  4IX7 A;  3HRT A;  4I7H A;  2M3A A;  2L7Z A;  5GPC A;  1U8B A;  2V79 A;  3ABL H;  3DTI A;  2EK5 A;  2VLA A;  2KT0 A;  4JYK A;  1YIJ I;  3HC7 A;  5LD2 C;  3I53 A;  2ETH A;  1J59 A;  3KPH A;  1YIT I;  1R1V A;  4M9X A;  2DA3 A;  1BW6 A;  4HW0 A;  5E20 A;  5ILS A;  3VWB A;  4BXX J;  2JRM A;  3RI4 A;  1FZP B;  3TQN A;  5DDG A;  1RET A;  1GXP A;  1UHS A;  1TWC J;  2EJR A;  4BY7 J;  2ID6 A;  1IN4 A;  1UEL B;  2IRF G;  3BR5 A;  2F2E A;  4NQW B;  3ESW B;  3T8T A;  3OS0 A;  4G8X A;  4QLC U;  3LMM A;  4OMY A;  3JAM Z;  1BN5 A;  3DV8 A;  2JA8 J;  1S3J A;  1LNW A;  3MN2 A;  3F23 A;  2ZNY A;  3S1Q J;  1KA8 A;  3A2K A;  1FTT A;  2LP0 A;  5GPA A;  2DJI A;  1BW5 A;  4A2U A;  1MD0 A;  1MMN A;  2GBY A;  4P9U A;  4FIS A;  5EEG A;  2ZXJ A;  1MW7 A;  5DEQ A;  1BC8 C;  4Z2Y A;  4YG2 F;  1W1W E;  2M2E A;  2R5Z B;  5HLI A;  2FF4 A;  3KZY A;  5D5W B;  5LGU A;  1ZAR A;  2XAF A;  1B4A A;  1X3Z B;  4NC8 A;  3JW4 A;  3AKZ A;  1ODD A;  1EA3 A;  2H6B A;  1TWG J;  3LSP A;  3BQY A;  3GFL A;  4YFN F;  4KMU X;  1T38 A;  2CQQ A;  1UHM A;  4Q4Z F;  2OTJ I;  3REO A;  4BHP A;  4EV0 A;  1FWZ A;  1Z7L A;  3AL0 B;  5ILU A;  2X48 A;  1BR1 A;  2FNP A;  1OQY A;  2FOK A;  2MFZ A;  2BXZ A;  5H6R A;  2QSH X;  1QQI A;  4L5J A;  5EDN A;  3HUG A;  1TWF J;  1VI0 A;  4Q48 A;  5KVR A;  1SD7 A;  3L1P A;  2M4K A;  1VQ8 I;  2LKS A;  5E8G A;  4HBL A;  4HZF A;  3OYD A;  2XUB A;  3R60 A;  3AG2 H;  5LLQ A;  2A5Y B;  5J8C A;  1UFM A;  1W0U A;  3ZOB A;  2XPW A;  3G1M A;  2D2W A;  1RR8 C;  1ZK8 A;  1IV8 A;  1FP1 D;  2VXZ A;  4F93 B;  4Y3O A;  4I2O A;  3EUA A;  4BL0 B;  5JHU A;  1FT9 A;  2XAQ A;  3CTA A;  2NVY J;  3KEQ A;  3BTC A;  4Y15 A;  4G7H F;  1YRN A;  2DTZ A;  2M45 A;  4UUV A;  3BZ6 A;  4OAY A;  2Z2S B;  3BG3 A;  4HNT A;  1Y1W J;  4IJA A;  3M7G A;  2EZI A;  1VQL I;  1V55 H;  2FBK A;  5FKK A;  2Y9Z A;  1ZRE A;  4IHV A;  4LFU A;  3PSI A;  3M07 A;  4RA2 A;  1D5Y A;  2DOA A;  5IY5 H;  4B4C A;  1U0J A;  2WAD A;  2LY9 A;  2QBY B;  1A35 A;  2IGK A;  3V8J A;  4OIN F;  2FXA A;  3RKW A;  1YI2 I;  1IRX A;  2AS5 F;  2EA2 A;  5LHG A;  3F9K A;  2W85 A;  3PQJ A;  2RQQ A;  1ZKG A;  5M5Y J;  3E97 A;  3CF2 A;  3CUO A;  4M72 A;  2R3S A;  1JT6 A;  4NDL A;  3PO2 J;  4QWQ A;  4AIK A;  4A5N A;  4BH9 A;  2XRN A;  1ONV A;  2Y9Y A;  5ICC A;  4B3A A;  4ITV A;  3NWS A;  4A3J J;  4Q47 A;  1A36 A;  4GFB A;  2EIK H;  3OYK A;  2FMY A;  2XAJ A;  4G7Z F;  3ASO H;  2KJC A;  1IN7 A;  4AC0 A;  4RBO A;  1VQP I;  2DO7 A;  3VDX A;  2CW0 F;  2JMW A;  3MZ8 A;  4HX4 A;  3ZQG A;  2L5Q A;  4BYY A;  3HPG A;  3S2W A;  2KRH A;  4UHT A;  2GQQ A;  3WTZ A;  2VPL A;  5D5U B;  3JRD A;  5D5X B;  2ZJR F;  2XPU A;  3K9T A;  2XGD A;  5C4J J;  5F0H A;  4RGS A;  1TTY A;  3RQ4 A;  2QKL B;  4F3Q A;  4LIU A;  1ZR4 A;  3WGI A;  2NVX J;  1YIO A;  2LSO A;  4BXF A;  1KYZ A;  2CUJ A;  3BG9 A;  3OOU A;  3CF5 F;  1R5I D;  4IXA A;  2A3S A;  4RAG A;  2V1D A;  3CLO A;  1K4S A;  3WU2 C;  2LF8 A;  2WA0 A;  4LGW A;  1O3S A;  5JHF A;  3FMQ A;  4XLP F;  2IVM A;  1VQ6 I;  2M1B A;  4C2M J;  2OBP A;  5HS8 A;  5FRN A;  3ZQ7 A;  1OCC H;  5EEA A;  4IO9 F;  1IN5 A;  4HQM A;  1WQ2 A;  3J7Y J;  1JTY A;  4NUB A;  4RB3 C;  2F48 A;  4S04 A;  4G6Q A;  3OYA A;  3RZO J;  3N97 A;  2BY1 A;  4XN3 A;  1SAX A;  1HKQ A;  2G7H A;  4WXD A;  3V4G A;  3AG4 H;  3DU5 A;  5B1B H;  1VZ0 A;  3HG9 A;  5J40 A;  2NRA C;  4MNU A;  3IAS 2;  2CUF A;  3HTU A;  3Q9S A;  5L3F A;  2GM4 A;  2IS6 A;  4L5I A;  1ULY A;  4L9T A;  4KA4 A;  2M9H A;  2DDB A;  1RIO H;  5TGT A;  1NK3 P;  4C9Y A;  3HSF A;  1HW5 A;  2KMU A;  3HJE A;  4RLF A;  2L2O A;  2ME6 A;  2OTL I;  4LLL A;  3LFK A;  1YS7 A;  1BL0 A;  1ZLK A;  2RN7 A;  4L5E A;  1U5T C;  3RPU D;  1G3Y A;  2DFE A;  3RTR A;  3I9V 2;  3H3U A;  1GV5 A;  5HOO A;  4OOI A;  3KYL A;  1X2M A;  3ABK H;  3CUQ B;  4DGW B;  1XGO A;  2AO9 A;  4YEL A;  4JP0 A;  4D7N A;  3OYH A;  2XIG A;  2DA1 A;  2WBM A;  1FBQ A;  4M74 A;  5EGO B;  3KET A;  1XMX A;  2VKD A;  2K4B A;  4Y33 A;  1IXS B;  2EZL A;  4ENJ A;  5DS9 A;  4A3K J;  2A6E F;  1EV7 A;  4M71 A;  1MZB A;  5FFZ A;  3CDI A;  3P9I A;  1AHD P;  3FWE A;  2Z3Y A;  2IPQ X;  1HW2 A;  1LFU P;  2NVT J;  3VOD A;  3PIO F;  2W57 A;  3N05 A;  2DMP A;  1F5T A;  3WTU C;  3UNG C;  2ESN A;  1R00 A;  4GYG A;  1AOY A;  3HYI A;  1R1T A;  3M1C A;  1FYM A;  3NEU A;  1WSU A;  2G0E A;  4CCM A;  2KIF A;  1X1A A;  2NS8 A;  4BDZ A;  4DQ2 A;  1F36 A;  1X3U A;  4BJ5 C;  4KT5 C;  1HOM A;  3S1R J;  1H9G A;  1I6H J;  3T1B A;  1AKH A;  2DMU A;  3PQK A;  3JSO A;  4FE7 A;  3DF8 A;  3H3Z A;  5LEJ A;  2HWV A;  2K02 A;  2Q1Z B;  2VQG A;  2X1C A;  1HDP A;  1VQ5 I;  3DBH B;  3E5Q A;  2ZXW H;  4DIQ A;  1OCT C;  1DGW Y;  1JI8 A;  2P0W A;  1VQ7 I;  1D1A A;  3GZ5 A;  2MSY A;  1LFB A;  1LDD A;  1I3Q J;  4CCK A;  1STZ A;  3OMY A;  2H27 A;  1N25 A;  1T56 A;  4M3F A;  1HDD C;  4V19 K;  5J1U A;  4DYR A;  3ROU A;  2GA2 A;  2JA2 A;  4CSW A;  3CO6 C;  1JKR C;  2CQK A;  3LL7 A;  1TQM A;  4PJL A;  1CQT A;  2VBY A;  2FJ1 A;  2R4G A;  2XPV A;  3KFW X;  1QA6 A;  4HYE A;  3I71 A;  2LDU A;  1I3A A;  3L2R A;  4O6J A;  1X58 A;  2YS9 A;  2H8W A;  1OYW A;  4CIC A;  5IT3 A;  1L3L A;  1SFE A;  5ICG A;  3CCR I;  2PX9 A;  2BE5 F;  2QCO A;  1MJB A;  1O7L A;  1W5T A;  3G4S I;  3IL2 A;  1HF0 A;  4ZTF A;  2DTR A;  5B5E C;  2CGP A;  2EFO A;  2DI3 A;  4UV9 A;  2DN0 A;  4AVZ A;  2H6C A;  5GAD J;  4CZC A;  3S15 J;  1F43 A;  3S2D J;  2OQG A;  3EDP A;  1K78 B;  2AQF A;  5GTI C;  3EQL F;  4LB6 B;  4OIP F;  4KN4 X;  3TW6 A;  3O8H A;  1YJN I;  2DOD A;  4II3 A;  2K3P A;  3BTL A;  1IRZ A;  2VQC A;  4A0Z A;  2QSF X;  5HNH A;  1SAN A;  3E5X A;  5H2F C;  4IEJ A;  3RKX A;  3CC7 I;  2ZSH B;  3FHN A;  1QHG A;  1B8I B;  3V8L A;  4BHC A;  1YJW I;  3KP3 A;  1MBF A;  2GXA A;  5E3O A;  4AD9 A;  2A61 A;  3FIS A;  3SFZ A;  5H6Q A;  2BEO A;  1Z9C A;  2YUS A;  3C18 A;  3ERE D;  3E6C C;  2XB5 A;  3K7A J;  2QM3 A;  4HV5 A;  1FNN A;  2Y0S N;  2ZKZ A;  2JPC A;  4I0B A;  1USS A;  1TWA J;  1Z3X A;  2IAI A;  3HRU A;  1IDZ A;  4OU0 A;  3P9K A;  1RRJ A;  1KU7 A;  1YHQ I;  1W5C C;  4IRG A;  4CCL A;  1ZRD A;  5FLV A;  2FOW A;  3R4K A;  3VYS B;  1BI3 A;  1D8K A;  4XOT A;  2BHY A;  2XGE A;  1O57 A;  1WJA A;  2J5O A;  4HA8 A;  5DD8 A;  1A04 A;  5LRS A;  1I39 A;  1SFU A;  2WAE A;  2DFI A;  4BE2 A;  2ZME A;  4PFP A;  1WZ2 A;  3HOW J;  4PK4 A;  3FXR A;  3F21 A;  3K6G A;  2BW3 A;  3KZZ A;  3NAR A;  1FOX A;  3TKY A;  5HLG A;  3KP5 A;  2HDC A;  2K4J A;  3KYD B;  3SHF A;  2DA7 A;  2GIZ A;  2VJ4 A;  3W2A A;  2JUC A;  2Q8K A;  3TP3 A;  2GIV A;  1GHC A;  2CWE A;  2OCC H;  2M5W A;  3Q0W A;  3LQR A;  2AQE A;  2H1L A;  2Z9O A;  1X4P A;  2LRD A;  4IHT A;  1RUN A;  3GFM A;  5HNF A;  4EAT A;  2BGC A;  4ZZL A;  1BI1 A;  1SD4 A;  1MBJ A;  1XSX A;  3NRV A;  3U9G A;  2CFX A;  3HDD A;  4RM3 A;  1B6A A;  2K27 A;  3BR2 A;  1WH5 A;  5DTD A;  1QPI A;  4II2 A;  4XQF A;  1XB4 A;  2STT A;  1MNE A;  3S1N J;  2HYF A;  3MCZ A;  1OIS A;  3ABM H;  3CES A;  4CH7 A;  3BG5 A;  3FKJ A;  2QA4 I;  2KP6 A;  4MIM A;  5D4R A;  1MBH A;  2DOE A;  1NG6 A;  1T08 B;  5E8I A;  3H0D A;  3QOP A;  2QQ8 A;  4IOA F;  1DU0 A;  5EG0 B;  3K1M A;  5ICE A;  3WTW C;  4GCV A;  5J4V A;  1QZY A;  4PJM A;  1FTZ A;  3CP8 A;  2VI6 A;  3E6M A;  3FM3 A;  3KLN A;  4LB5 A;  3HRS A;  5F64 A;  4C2T A;  1LJ9 A;  2X6X A;  3IH4 A;  2K9S A;  3DKX A;  1OCR H;  1IZ1 A;  3PUB A;  1LE8 B;  3DKW A;  2MH2 A;  3HIF A;  4JX5 A;  4QPQ A;  1J75 A;  4HX7 A;  4BXU A;  2WV1 A;  4A3M J;  5BQT A;  3QPS A;  4XLF A;  4C3H J;  2MD0 A;  3K1P A;  4KIF A;  3RPQ A;  3F6V A;  4B44 A;  1TL8 A;  4W97 A;  2CMP A;  2IJL A;  1QHH D;  4L9N A;  3I55 I;  1OYY A;  1S6L A;  2RNG A;  2LRE A;  1BR2 A;  4BGD A;  3R6S A;  1FMW A;  1LUJ B;  1ZLJ A;  3BDD A;  3O6B B;  2W7N A;  5J3L A;  3DCF A;  2K5C A;  2PEX A;  2LD5 A;  1WHU A;  2Y31 A;  2OJE D;  4BEH B;  1K79 A;  3ZN0 A;  2IEK A;  4AYB A;  2NNY A;  1I50 J;  5D8L B;  5FLX K;  1R4M B;  2G9W A;  1TQP A;  3RPU A;  2RAE A;  1QNT A;  4HOB A;  4IRI A;  2OD5 A;  3ABT A;  1ZG3 A;  3BG7 A;  2L4A A;  5B3S H;  2V4J C;  4RAY A;  1JE8 A;  1YX5 A;  2Y0M A;  3OIP A;  4RGX A;  3SFI A;  4XM3 A;  4CXF A;  3PNV A;  2R5Y B;  3OYG A;  3TGN A;  2RV8 A;  4RMN A;  3CD6 I;  2HQR A;  3I4M J;  2KIS A;  1R23 A;  2F4I A;  4EM2 A;  2QZ8 A;  2Q2E B;  2PMH A;  4NBQ A;  2W1O A;  3MZH A;  1G3W A;  2EIJ H;  5D8K B;  1JJ6 C;  1IGN A;  3W6K B;  1O3T A;  2XGX A;  2FQ4 A;  3IP4 B;  4N9I A;  1OR7 A;  3DP7 A;  4UVC A;  1X19 A;  2VJJ A;  2PMZ A;  2P4W A;  4UB6 C;  2HR3 A;  4QIW N;  3BP8 A;  1JKQ C;  4RB0 A;  3ABU A;  4C30 A;  2HNH A;  3A0B C;  4MQ9 F;  2CV0 A;  1Y0U A;  2ME0 A;  3K10 A;  3C2G A;  3HRM A;  1ZEL A;  3PNY A;  3BJA A;  3J7A O;  2KL4 A;  4LK0 F;  4TV7 A;  5E79 C;  3U2R A;  3IV5 A;  3LSJ A;  4NNJ A;  4EMS A;  4FT8 A;  1D0Y A;  1ETO A;  1X1C A;  3C1D A;  1D0X A;  1PVE A;  2NVU B;  5FB2 A;  4HLX A;  3GFJ A;  3H5N A;  2QSG X;  3GTJ J;  2W48 A;  2WAQ A;  4XKC A;  2ACJ A;  2R92 J;  3CCE I;  3TO6 A;  3TED A;  3K69 A;  2LBF B;  1CGP A;  4KUM A;  3RKQ A;  2JTV A;  2Z5U A;  1G6N A;  2F4O B;  4GRI A;  2WAF A;  4G9Y A;  4WXC A;  3S2H J;  1RKW A;  3CC4 I;  3CQZ J;  2OQR A;  4DJA A;  5EJC A;  4ZJZ A;  3EYY A;  1HA8 A;  1Y6I A;  1JGG A;  2UXX A;  2F4M B;  3MAJ A;  4PUS A;  4R79 A;  1QZE A;  1XS9 A;  2VB6 A;  2WAQ N;  4A3C J;  3OYF A;  4G12 A;  2DFF A;  4KDP A;  2ZJP F;  4QTR A;  1VQK I;  3ML6 A;  2JA6 J;  2NS7 A;  2DPU A;  1FLI A;  3EUH C;  4ON0 A;  5LRR A;  2WY7 Q;  4L0Y B;  4KN7 X;  3DKY A;  1MDM B;  2VOO A;  3A01 A;  2MC4 A;  3TO7 A;  2DA5 A;  3W2V A;  2LC2 A;  4GDF A;  1D1B A;  2DCE A;  4OIR F;  4XLN F;  2L7K A;  3F8C A;  3QPL A;  4E70 A;  3F22 A;  2DK8 A;  2A6H F;  2M7A A;  5HLT A;  5GAE J;  4B3X A;  4O5V A;  1Z0X A;  2ECB A;  1ETY A;  2BV6 A;  1E3O C;  2E7X A;  1FPQ A;  3HGG A;  5J1R A;  1GLN A;  3JCU C;  2KZV A;  3JTH A;  4B8X A;  1Y56 A;  3BJO A;  3BOQ A;  3CCY A;  4B43 A;  1RNL A;  1KYW A;  4GO1 A;  3CDH A;  4BQO A;  2VAS A;  5FKM A;  4ETS A;  1PUE E;  1TWH J;  3B73 A;  3SDB A;  2QF7 A;  1F4K A;  3OWT A;  3DXJ F;  1U5T B;  5GAH J;  1PUF A;  1YX3 A;  2QWW A;  2B63 J;  2JZY A;  2OU2 A;  1MSE C;  1XCB A;  1ACI A;  3JRG A;  1MBG A;  4BNC A;  3S3N A;  1RPW A;  2L54 A;  2HKO A;  3CCS I;  3GX4 X;  2GZW A;  2DFH A;  2CUE A;  2DOF A;  2XDV A;  2KDO A;  2ZBK A;  4ZYA A;  4PCQ A;  4A0Y A;  2CW8 A;  2K40 A;  3TW7 A;  3QU6 A;  2VKH A;  3MWM A;  2IP2 A;  3MVP A;  5IPA A;  2LR8 A;  1K6Y A;  5D5V B;  1MND A;  4A69 C;  3LSG A;  4LIV A;  4A3D J;  2ISZ A;  5FFX A;  3T0Y A;  2QQA A;  3HXL A;  5DCM A;  2P5V A;  2BY3 A;  2Q0O A;  1F9N A;  1X4O A;  3A02 A;  3JRA A;  4EEF G;  2UUZ A;  3ZXS A;  3HTS B;  3H1C A;  2VBX A;  3LOC A;  4IHY A;  2DA2 A;  3FK7 A;  4HG2 A;  1HCR A;  5FLX Z;  1ETW A;  3E1S A;  5FRM A;  2D1V A;  2VQH A;  5F04 A;  3GTO J;  1ZTR A;  3ZQL A;  3D5S C;  1HBX G;  1R71 A;  2HPI A;  4RB1 A;  1V4R A;  3OYM A;  2V1N A;  2MH9 A;  3HBL A;  4I09 A;  3ULQ B;  2JRT A;  3K4C A;  1W36 C;  3KIO A;  1FMV A;  2H09 A;  1S29 A;  3GCM A;  3M8F A;  2E2J J;  1B72 A;  4E7L A;  1X1D A;  4IHX A;  2DT5 A;  3RQI A;  3DFG A;  2GLO A;  5DV5 A;  4YFK F;  5L3G A;  1RR7 A;  2DXI A;  3F72 A;  3HOU J;  3QPT A;  5JLW A;  1PDN C;  2R7Q A;  3CP2 A;  1R1U A;  1TBX A;  3VYR B;  3VYU B;  3ZMT A;  3S32 A;  1FY7 A;  1TNT A;  2PJR A;  2B0L A;  4UUS A;  2JPB A;  3WHC A;  3ZQF A;  2VBZ A;  1R4N B;  4FET A;  4CYC B;  1U9O A;  1LB2 A;  2P6T A;  5IOZ A;  2IA0 A;  4YIR X;  4AUX A;  2CQN A;  4IVN A;  3ZGK A;  4ZTJ A;  4MLO A;  3PSF A;  2K9Q A;  2PBI A;  5F27 A;  1WWX A;  1YW7 A;  2LF7 A;  1AU7 A;  3HEF A;  1D3Y A;  5DUK A;  2YU9 J;  4M3E A;  2O7O A;  2P5K A;  1WRJ A;  4MQV A;  2M30 A;  2VOD A;  3FKI J;  3I0T A;  3K70 D;  1WPK A;  2XSJ C;  2HS5 A;  3MKW B;  2KPM A;  3VOE A;  1D0Z A;  2OUM A;  2VJI A;  3OOP A;  4CA0 A;  4N0B A;  5K5O A;  1ZGW A;  1QZZ A;  2VKV A;  2XF5 A;  3Q9V A;  3OR2 C;  2HQA A;  4I76 A;  4IPA A;  2X85 A;  2Z33 A;  1YOV B;  2ZO4 A;  1YS6 A;  2NOG A;  3CMM A;  4I98 B;  4MFD A;  1EH6 A;  2P8T A;  3FDY A;  2MYS A;  3L7W A;  4LG0 B;  1YTY A;  1KQ0 A;  1XDS A;  3PJR A;  4LOC A;  3RZD J;  1XGN A;  1VTN C;  2HYG D;  4R8H A;  3TOA A;  3Q0U A;  4X6A J;  1BJA A;  2ADU A;  1XSD A;  4NQW A;  1VQ4 I;  4Q5S F;  3AFH A;  3Q3S A;  1LEB A;  1W5S A;  2HKX A;  2R7U A;  2V1X A;  1P7I A;  3LSM A;  4A6E A;  2DQR A;  2V9P A;  4L18 B;  3I59 B;  1HXD A;  1RI7 A;  1SVL A;  2DQL A;  2CV1 A;  2V1U A;  1P4X A;  2W24 A;  5EYR A;  1YO5 C;  4EQQ A;  1WKM A;  5GAG J;  2QQB A;  2JA5 J;  4HNU A;  1JHF A;  5M5W J;  5DD4 A;  5E18 F;  1OCP A;  4RDU A;  3FHZ A;  5HDK A;  2F5E A;  2R5Z A;  2FEZ A;  1MMA A;  4ENK A;  3BCA A;  4A5M A;  3J7A Y;  3PL8 A;  4N4N B;  3OYJ A;  1NHA A;  2A69 F;  5FO5 A;  2KHM A;  4L9V A;  1O7F A;  3G1O A; 
#chains in the Genus database with same CATH homology
 2O61 A;  4RGR A;  3IKT A;  3R0J A;  1KGS A;  1MKM A;  2ZFW A;  1T2K A;  5BMZ A;  3I58 A;  3WGG A;  4DNC A;  2V9V A;  1ZGA A;  3KP4 A;  2UWM A;  3CJN A;  1LVA A;  4UVA A;  4WX9 A;  2IT0 A;  1B59 A;  3IC7 A;  4LLG F;  4A0X A;  2CO5 A;  4CO8 A;  4LK1 F;  5LGN A;  3F3X A;  1MJA A;  1IXR C;  2CG4 A;  1IW7 F;  1S7O A;  3ZMS A;  2V6C A;  2KIM A;  1HQC A;  2LKP A;  2HOE A;  5F6F A;  2M8E A;  5LGT A;  1CF7 B;  3OV8 A;  4AWX B;  1K6O A;  1XMK A;  2QBY A;  3ZP5 A;  3T5X A;  2ESH A;  5K5Q A;  2DW4 A;  5BPD A;  4JBA A;  2JSC A;  2Y48 A;  3O2P E;  3M8E A;  3RYP A;  4G94 A;  3IKV A;  2DU9 A;  2VC0 A;  2X4H A;  1BI0 A;  3V7C A;  1W7P B;  1I1S A;  4O3M A;  1IRG A;  4U0Y A;  2YX7 A;  5F1R A;  3COA C;  1BIB A;  5J8F A;  4N9H A;  1QPM A;  4UXN A;  2R7F A;  2DPD A;  3ISP A;  4D0P A;  1FYK A;  1DDN A;  2MA3 A;  1I27 A;  3GXO A;  5FGM A;  1UB9 A;  3K0L A;  2F5F A;  3F8M A;  1TW3 A;  1Z05 A;  1BOA A;  4F7Z A;  1IXC A;  3BY6 A;  1G3T A;  2HQN A;  5ICF A;  2XAG A;  2VBW A;  3RDI A;  1ZHF A;  4M73 A;  2RKH A;  3WE3 A;  1FYL A;  4H0E A;  4LLN A;  4IRH A;  4HDU A;  1ZAO A;  4MEY F;  4EJT A;  3CUQ A;  5DUI A;  4OIO F;  2PFB A;  2MD5 A;  2ZNZ A;  1FX7 A;  3LAP A;  5A2Q K;  2OZU A;  2RVC A;  2W84 A;  2H94 A;  3LAJ A;  1FC3 A;  3MFK A;  5TRD A;  5JR3 A;  3WTT C;  5DYM A;  3WG9 A;  2VN2 A;  4P96 A;  3SZT A;  4CZZ A;  2WV0 A;  4LJZ F;  1TQI A;  1E2X A;  3KLO A;  1U8R A;  3ZMV A;  1BI2 A;  3TDU C;  1DP7 P;  4NB5 A;  3WTY C;  1U2W A;  1H9T A;  1YW9 A;  1XGM A;  3RYR A;  1J7K A;  2VE9 A;  3GLX A;  5L3B A;  4RGU A;  1IAW A;  1H0M A;  4MEX F;  5CYV A;  2FSW A;  5AIQ A;  3GFI A;  2EFP A;  4CHU A;  4EM0 B;  1SD5 A;  3TDZ C;  1ZG1 A;  1ZRF A;  1HSJ A;  4WWC A;  1T0F A;  3QP5 A;  4LMY A;  4HV6 A;  4HX8 A;  5CVU A;  2ZJ2 A;  3VEP A;  4YII A;  1DUX C;  3DPL C;  5CLS A;  4BQA A;  1P4A A;  2RC4 A;  1K7A A;  3C7J A;  3LST A;  1K78 A;  4FX4 A;  4UVB A;  4KNY A;  4UNO A;  1P6R A;  1R5H A;  3VB2 A;  3HOS A;  2XKO A;  3N4M A;  1R7J A;  3ZMU A;  3DQV C;  4EJW A;  1HKS A;  1R5G A;  5K1Y A;  1JGS A;  4ZZD A;  3GO5 A;  2PQ8 A;  1HKT A;  4KIG A;  4XBF A;  5CVI A;  2ELH A;  1GVJ A;  4AVP A;  3IWZ A;  5FD5 A;  1FSE A;  3FXQ A;  5E1Z B;  5AON A;  3DPT A;  3LQQ A;  3GYH X;  2OA4 A;  4U7B A;  4P55 A;  1W4M A;  5J6X A;  4WCG A;  3E6D A;  4I02 A;  5CVR A;  4LD5 A;  3WOD F;  1SD6 A;  4P9F A;  2VOP A;  3T8R A;  4EM1 A;  3MZY A;  1MJ9 A;  3J80 K;  4P5O A;  2P7V B;  3F8N A;  4KYW A;  2CYY A;  5L3D A;  2MLG A;  4XSZ F;  3L9F A;  1B9N A;  2STW A;  2FE3 A;  2VT2 A;  1TW2 A;  5D6F A;  4ASN A;  1QGP A;  2EV0 A;  3LA2 A;  5A2Q Z;  2P6S A;  4UV8 A;  1KU9 A;  2JT1 A;  1RUO A;  2F5D A;  4MHG A;  3WTX C;  2UZK A;  1IF1 A;  2TDX A;  5LBQ A;  3P9C A;  2KKO A;  3DEU A;  4IHS A;  2O6G E;  5AIP A;  3ZPL A;  1EH7 A;  2QQ9 A;  3R0A A;  4HF0 A;  3IRQ A;  4I01 A;  2OZ6 A;  2YPR A;  4ZYE A;  4U0W A;  2HEO A;  4HF1 A;  2XAH A;  4NHJ A;  5CVJ A;  3U1D A;  3SZP A;  5D6E A;  2DBB A;  2RNJ A;  4M6X A;  2X0L A;  1Z91 A;  4KFC A;  2QVO A;  1FSH A;  1O3Q A;  2KIU A;  2E7W A;  2E1C A;  1P2F A;  5BS6 A;  2EFW A;  1GXQ A;  4YFX F;  5E17 F;  5HS9 A;  1Z7U A;  2Q2E A;  3D5L A;  3ZMZ A;  3QP6 A;  2RQP A;  1OYI A;  4M9Z A;  3SXY A;  4XSX F;  3GW2 A;  4G7O F;  3ECO A;  3D0S A;  3QAH A;  1ON1 A;  4HLY A;  1Q1H A;  3ZN1 A;  2EB7 A;  4L0Z B;  4K2E A;  2MC3 A;  5ERI A;  3O3K A;  3WGH A;  2DLL A;  1YFH A;  4A12 A;  1TLH B;  3JSP A;  1U3E M;  1J2X A;  3FMS A;  4U0V A;  3EYI A;  3V8K A;  5CVV A;  2IA1 A;  3M9A A;  3PFI A;  5D4S A;  1QO0 D;  1U78 A;  3G73 A;  4CYD A;  2CSO A;  3WE2 A;  5JI6 A;  4U7D A;  5K5R A;  1ZGJ A;  2FRH A;  4MTE A;  3E6B A;  2A07 F;  3J80 Z;  1R36 A;  2M87 A;  5BPI A;  1MDM A;  3WU1 B;  6PAX A;  4MGR A;  4JQF A;  4GGG A;  1I6X A;  5E1X A;  3GEZ A;  4EGZ A;  1IN6 A;  1YYV A;  1WI9 A;  4A6D A;  3GVA A;  2EFN A;  2IA2 A;  1XGS A;  3E5U A;  5E1W A;  4MTD A;  4IF4 A;  3FXU A;  3L09 A;  2MLK A;  3IRR A;  3HHG A;  1FOK A;  3BPX A;  1Z6R A;  3C3W A;  1U5T A;  4CDG A;  2AXL A;  5HS7 A;  4FHT A;  1G4D A;  1V3F A;  1D5V A;  2GA1 A;  1OPC A;  4AIH A;  4CGZ A;  3GF2 A;  1W7P D;  1XD7 A;  1PP7 U;  2GXB A;  3JTG A;  4RS8 A;  2GXG A;  1LEA A;  2XKP A;  3FX3 A;  3P7N A;  4PZJ A;  2QEN A;  3I4P A;  5CJ9 A;  1EH8 A;  2EFQ A;  3E3V A;  1IRF A;  3WU0 A;  3LA7 A;  1LDK B;  1YLF A;  5LEK A;  2A68 F;  2FA5 A;  3MQ0 A;  3CO7 C;  3LA3 A;  2D1H A;  4ZYG A;  1DPU A;  1TNS A;  4ESF A;  2ZCW A;  2O0Y A;  2XHK A;  2L3D A;  2VT3 A;  2HFH A;  2XRO A;  1T39 A;  5JVT A;  1BC7 C;  1I1G A;  1O3R A;  5HVQ C;  5IT9 K;  1ZH5 A;  4RB2 C;  3HHH A;  4ZYD A;  3HSE A;  4U88 A;  1Z1D A;  2ZME B;  3GWZ A;  4GXO A;  1RZ4 A;  2Y75 A;  4EVI A;  4WF2 A;  4KMF A;  1KU2 A;  3KP2 A;  4JK1 X;  3LWF A;  1XN7 A;  1HST A;  1FP2 A;  1P92 A;  1L0O C;  2C6Y A;  2D45 A;  2E1N A;  3F8F A;  2WWY A;  3KP7 A;  3ELK A;  3IHU A;  1ZN2 A;  4BHB A;  1FBS A;  2PJP A;  4LG0 A;  1KU3 A;  4R1H A;  2EWN A;  3I64 A;  4B09 A;  1QBJ A;  4ESB A;  2IW5 A;  2YR2 A;  3M1E A;  4EGY A;  3KE2 A;  1XCV A;  5HLH A;  3R61 A;  2YU3 A;  1Z6T A;  1E17 A;  2UXN A;  3I59 A;  3L00 A;  1R58 A;  3K1N A;  2WTE A;  1R22 A;  1KQ8 A;  1S8N A;  1DPR A;  1U6G A;  2L01 A;  5KK1 A;  2HZT A;  4PGG A;  1YQA A;  1B9M A;  2RDP A;  1XSV A;  1BIA A;  3RKY A;  2PN6 A;  3Q5F A;  3KCC A;  2DK5 A;  3NQO A;  5DCF A;  2NAZ A;  3J81 K;  3IWF A;  2VE8 A;  3L2C A;  4BAY A;  1ZG5 A;  3QPH A;  1KQ9 A;  3VFZ A;  4AIJ A;  1UHW A;  1XMA A;  1HW1 A;  4I0A A;  2NNN A;  3SQN A;  2KJB A;  2QLZ A;  3FMR A;  2F5C A;  2L4M A;  2LNB A;  1F1Z A;  2Z99 A;  1YG2 A;  5BOX A;  1BBY A;  4HAM A;  2L02 A;  3KP6 A;  2VON A;  1J5Y A;  3V7R A;  3WTS C;  2GWR A;  3EET A;  1REP C;  5H20 A;  5ED4 A;  1SMT A;  5EEH A;  1AWC A;  4ESJ A;  4M9S A;  1PP8 F;  1P4W A;  4EJO A;  2HTS A;  5LHI A;  1UST A;  4ZH4 F;  1B1B A;  1CF7 A;  2QYO A;  1J0R A;  2COM A;  3KEO A;  3FF5 A;  1IN8 A;  2GAU A;  4FX0 A;  3G3Z A;  1T98 A;  2OAZ A;  5IT9 Z;  5L3C A;  1LQ1 A;  2FBH A;  4WK8 F;  1FBU A;  3BWG A;  3CUQ C;  1OKR A;  2DAO A;  1ON2 A;  3AAF A;  2XAS A;  4RAZ A;  1G3S A;  1T6S A;  3GZ6 A;  1IUY A;  1JXS A;  1J9I A;  1SFX A;  3JAM K;  1W7P A;  3WTV C;  1BM9 A;  1I5Z A;  2BBY A;  3I54 A;  2XVC A;  2EV5 A;  1LDJ A;  2K86 A;  4PDK A;  2EV6 A;  5LHH A;  2NYX A;  2MBF A;  5TJJ A;  2PI0 A;  3RIR A;  2PMU A;  2WC2 A;  2HTJ A;  4KIC A;  3RJP A;  2W25 A;  2FNA A;  3F6O A;  1SMY F;  2P7C B;  4EJU A;  2BYV E;  2HGC A;  2G7U A;  4KIB A;  5L3E A;  4PGH A;  2VC1 A;  3V7S A;  2J5P A;  2R7D A;  2FML A;  3MEX A;  2QUF A;  4EJV A;  1JHH A;  1XDU A;  2O8X A;  2RGV A;  5FD6 A;  2NS0 A;  2FBI A;  3BRO A;  1C0W A;  3TOB A;  3ZMD A;  5DCM B;  3I5U A;  1MGT A;  3HSR A;  3K2Z A;  5HDN A;  4YIF A;  3EUH A;  2PG4 A;  5ILV A;  4S05 A;  1S7A A;  4ENN A;  2FU4 A;  3J81 Z;  1D8J A;  4XRF A;  4M6Y A;  3TO9 A;  4Y13 A;  4ZYH A;  2XV4 S;  2O03 A;  1ZRC A;  3H92 A;  4OMZ A;  4HF2 A;  5HDG A;  3BJ6 A;  2P5L C;  2KRF A;  5JFR A;  3QU3 A;  4G6D A;  2EA4 A;  1UCR A;  4OIQ F;  1OMI A;  4HQE A;  2FQ3 A;  2PLY A;  2YX4 A;  3HOT A;  4HDV A;  1YW8 A;  2ISY A;  4Y17 A;  3BPV A;  3GUD A;  3W6J B;  4L9J A;  2YSR A;  4ENM A;  3B02 A;  3FM5 A;  3F8B A;  3QRF F;  3ECH A;  4GYI A;  2O3F A;  2K7L A;  4WXH A;  1ZYR F;  3HRT A;  4I7H A;  2V79 A;  2EK5 A;  3I53 A;  2ETH A;  1J59 A;  1R1V A;  4M9X A;  4HW0 A;  5E20 A;  5ILS A;  3RI4 A;  1FZP B;  3TQN A;  5DDG A;  1GXP A;  2EJR A;  1IN4 A;  2IRF G;  2F2E A;  3T8T A;  4G8X A;  4QLC U;  4OMY A;  3JAM Z;  1BN5 A;  3DV8 A;  1S3J A;  1LNW A;  3F23 A;  2ZNY A;  1KA8 A;  4A2U A;  1MD0 A;  4P9U A;  5EEG A;  2ZXJ A;  5DEQ A;  1BC8 C;  4Z2Y A;  4YG2 F;  5HLI A;  2FF4 A;  3KZY A;  5D5W B;  5LGU A;  1ZAR A;  2XAF A;  1B4A A;  3JW4 A;  1ODD A;  2H6B A;  3GFL A;  4YFN F;  4KMU X;  1T38 A;  1UHM A;  4Q4Z F;  3REO A;  4BHP A;  4EV0 A;  1FWZ A;  5ILU A;  2FNP A;  2FOK A;  5H6R A;  1QQI A;  4L5J A;  3HUG A;  4Q48 A;  5KVR A;  1SD7 A;  5E8G A;  4HBL A;  4HZF A;  2XUB A;  3R60 A;  5LLQ A;  2A5Y B;  5J8C A;  1UFM A;  2D2W A;  1FP1 D;  2VXZ A;  4I2O A;  5JHU A;  1FT9 A;  2XAQ A;  3CTA A;  3KEQ A;  4Y15 A;  4G7H F;  2M45 A;  4UUV A;  3BZ6 A;  4IJA A;  3M7G A;  2FBK A;  1ZRE A;  4LFU A;  2QBY B;  3V8J A;  4OIN F;  2FXA A;  3RKW A;  2AS5 F;  2EA2 A;  5LHG A;  2W85 A;  3PQJ A;  3E97 A;  3CUO A;  4M72 A;  2R3S A;  4QWQ A;  4AIK A;  4A5N A;  4BH9 A;  2XRN A;  1ONV A;  5ICC A;  4Q47 A;  2FMY A;  2XAJ A;  4G7Z F;  2KJC A;  1IN7 A;  2DO7 A;  2CW0 F;  4HX4 A;  4BYY A;  3S2W A;  4UHT A;  2GQQ A;  3WTZ A;  5D5U B;  5D5X B;  3K9T A;  4RGS A;  1TTY A;  3WGI A;  1YIO A;  2LSO A;  1KYZ A;  4IXA A;  2A3S A;  2V1D A;  3CLO A;  2LF8 A;  4LGW A;  1O3S A;  3FMQ A;  4XLP F;  2IVM A;  2M1B A;  2OBP A;  5HS8 A;  3ZQ7 A;  1IN5 A;  4HQM A;  1WQ2 A;  4RB3 C;  4S04 A;  4G6Q A;  3N97 A;  1SAX A;  1HKQ A;  2G7H A;  4WXD A;  3V4G A;  2NRA C;  4MNU A;  3HTU A;  3Q9S A;  5L3F A;  4L5I A;  4KA4 A;  1ULY A;  4L9T A;  1RIO H;  3HSF A;  1HW5 A;  4LLL A;  3LFK A;  1YS7 A;  1ZLK A;  2RN7 A;  1U5T C;  1G3Y A;  3RTR A;  3H3U A;  5HOO A;  4OOI A;  3CUQ B;  1XGO A;  2XIG A;  1FBQ A;  4M74 A;  3KET A;  2K4B A;  1IXS B;  4ENJ A;  2A6E F;  1EV7 A;  4M71 A;  1MZB A;  5FFZ A;  3P9I A;  3FWE A;  2Z3Y A;  2IPQ X;  1HW2 A;  3VOD A;  2W57 A;  1F5T A;  3WTU C;  2ESN A;  1R00 A;  4GYG A;  1AOY A;  3HYI A;  1R1T A;  1FYM A;  3NEU A;  1WSU A;  2KIF A;  4DQ2 A;  1X3U A;  4KT5 C;  1H9G A;  3T1B A;  3PQK A;  3JSO A;  3DF8 A;  3H3Z A;  5LEJ A;  2HWV A;  2K02 A;  3E5Q A;  3GZ5 A;  1LDD A;  1STZ A;  2H27 A;  3ROU A;  2GA2 A;  3CO6 C;  2CQK A;  1TQM A;  2VBY A;  3KFW X;  4HYE A;  3I71 A;  2LDU A;  4O6J A;  1OYW A;  4CIC A;  5IT3 A;  1L3L A;  1SFE A;  5ICG A;  2BE5 F;  1MJB A;  1O7L A;  1W5T A;  3IL2 A;  2DTR A;  2CGP A;  2EFO A;  2DI3 A;  4UV9 A;  2H6C A;  2OQG A;  3EDP A;  1K78 B;  3EQL F;  4LB6 B;  4OIP F;  4KN4 X;  4A0Z A;  3E5X A;  3RKX A;  3V8L A;  4BHC A;  3KP3 A;  4AD9 A;  2A61 A;  3SFZ A;  5H6Q A;  2BEO A;  1Z9C A;  3C18 A;  3ERE D;  3E6C C;  2QM3 A;  4HV5 A;  1FNN A;  2ZKZ A;  2JPC A;  4I0B A;  1USS A;  3HRU A;  4OU0 A;  3P9K A;  1KU7 A;  4IRG A;  1ZRD A;  3R4K A;  1BI3 A;  1D8K A;  1O57 A;  2J5O A;  4HA8 A;  5DD8 A;  1A04 A;  5LRS A;  1SFU A;  2DFI A;  2ZME A;  3FXR A;  3F21 A;  3KZZ A;  3TKY A;  5HLG A;  3KP5 A;  2HDC A;  2K4J A;  3SHF A;  2Q8K A;  2GIV A;  1GHC A;  2CWE A;  2M5W A;  3LQR A;  2Z9O A;  4IHT A;  1RUN A;  3GFM A;  2BGC A;  4ZZL A;  1BI1 A;  1SD4 A;  1XSX A;  3NRV A;  3U9G A;  2CFX A;  1B6A A;  2K27 A;  1XB4 A;  2STT A;  2HYF A;  3MCZ A;  5D4R A;  5E8I A;  3QOP A;  3K1M A;  5ICE A;  3WTW C;  4GCV A;  1QZY A;  3E6M A;  3FM3 A;  3KLN A;  4LB5 A;  3HRS A;  5F64 A;  1LJ9 A;  1IZ1 A;  3DKW A;  2MH2 A;  3HIF A;  1J75 A;  4HX7 A;  4BXU A;  5BQT A;  3K1P A;  4KIF A;  3RPQ A;  3F6V A;  2IJL A;  4L9N A;  1OYY A;  1S6L A;  3R6S A;  1ZLJ A;  3BDD A;  3O6B B;  2PEX A;  1K79 A;  3ZN0 A;  2NNY A;  5D8L B;  5FLX K;  2G9W A;  1TQP A;  3RPU A;  1QNT A;  4HOB A;  4IRI A;  2OD5 A;  3ABT A;  1ZG3 A;  2L4A A;  4RAY A;  1JE8 A;  2Y0M A;  4RGX A;  4CXF A;  3TGN A;  2RV8 A;  2HQR A;  1R23 A;  4EM2 A;  2QZ8 A;  2PMH A;  3MZH A;  1G3W A;  5D8K B;  3W6K B;  1O3T A;  2XGX A;  4N9I A;  1OR7 A;  3DP7 A;  4UVC A;  2P4W A;  2HR3 A;  3BP8 A;  4RB0 A;  3ABU A;  4MQ9 F;  1Y0U A;  3HRM A;  3BJA A;  3J7A O;  4LK0 F;  4TV7 A;  3U2R A;  4EMS A;  4FT8 A;  3C1D A;  5FB2 A;  4HLX A;  3GFJ A;  2ACJ A;  3TO6 A;  3K69 A;  1CGP A;  4KUM A;  2JTV A;  2Z5U A;  1G6N A;  4G9Y A;  4WXC A;  2OQR A;  3EYY A;  2UXX A;  3MAJ A;  4R79 A;  4KDP A;  3ML6 A;  2DPU A;  1FLI A;  4ON0 A;  5LRR A;  4L0Y B;  4KN7 X;  1MDM B;  2VOO A;  3TO7 A;  4XLN F;  4OIR F;  3F8C A;  4E70 A;  3F22 A;  2DK8 A;  2A6H F;  4O5V A;  2BV6 A;  2E7X A;  1FPQ A;  4B8X A;  3JTH A;  3BJO A;  3BOQ A;  1RNL A;  1KYW A;  4GO1 A;  3CDH A;  4ETS A;  1PUE E;  3B73 A;  1F4K A;  3DXJ F;  1U5T B;  2QWW A;  2JZY A;  2OU2 A;  1XCB A;  4BNC A;  2L54 A;  2HKO A;  3GX4 X;  2GZW A;  2ZBK A;  4PCQ A;  4A0Y A;  3QU6 A;  3MWM A;  2IP2 A;  5D5V B;  2ISZ A;  5FFX A;  3T0Y A;  2QQA A;  5DCM A;  2P5V A;  2Q0O A;  1F9N A;  3HTS B;  2VBX A;  5FLX Z;  2D1V A;  1HBX G;  4RB1 A;  1V4R A;  2MH9 A;  4I09 A;  3ULQ B;  2JRT A;  1O7F A;  2H09 A;  1S29 A;  3M8F A;  2DT5 A;  3DFG A;  5DV5 A;  4YFK F;  5L3G A;  3F72 A;  3QPT A;  1PDN C;  1R1U A;  1TBX A;  3ZMT A;  1FY7 A;  1TNT A;  2B0L A;  2JPB A;  2VBZ A;  1LB2 A;  2P6T A;  2IA0 A;  4IVN A;  2PBI A;  1WWX A;  1YW7 A;  2LF7 A;  1D3Y A;  5DUK A;  2P5K A;  1WRJ A;  4MQV A;  2M30 A;  2VOD A;  3I0T A;  2HS5 A;  3VOE A;  3OOP A;  4N0B A;  5K5O A;  1QZZ A;  3Q9V A;  4IPA A;  2Z33 A;  2ZO4 A;  1YS6 A;  4I98 B;  1EH6 A;  2P8T A;  4LG0 B;  1YTY A;  1KQ0 A;  1XDS A;  1XGN A;  1VTN C;  2HYG D;  4R8H A;  3TOA A;  1BJA A;  2ADU A;  1XSD A;  4NQW A;  4Q5S F;  1LEB A;  1W5S A;  2HKX A;  2V1X A;  4A6E A;  2DQR A;  4L18 B;  3I59 B;  1HXD A;  1RI7 A;  2DQL A;  2V1U A;  1P4X A;  2W24 A;  1YO5 C;  4EQQ A;  1WKM A;  2QQB A;  1JHF A;  5DD4 A;  5E18 F;  3FHZ A;  5HDK A;  2F5E A;  2FEZ A;  4ENK A;  4A5M A;  1NHA A;  2A69 F;  5FO5 A;  4L9V A;  3FZV A;  3L7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...