1R1UA

Crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords repressor protein
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription repressor
total genus 32
structure length 94
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1uA00
3DPTA 2MLKA 4KN4X 3E97A 4HQEA 3U9GA 2HZTA 2MA3A 2JTVA 2KIUA 3QU6A 2V9VA 1R23A 4O3MA 3JW4A 2CWEA 1LEBA 4P55A 1LEAA 5E17F 1ZRFA 5FFZA 1J2XA 5LGUA 4UVBA 2HR3A 5IT9K 3KLOA 4Z2YA 3BY6A 1S8NA 4LG0B 1FP1D 1QGPA 3I59A 3IC7A 1ZREA 3KFWX 3TDUC 3K1NA 1XGSA 4YIIA 4EMSA 4OMZA 4EJVA 5CVUA 3WTTC 4JBAA 4G6DA 1ZAOA 1J59A 2UXXA 4WCGA 3R0AA 1PDNC 3K69A 5ILVA 4GXOA 3GFMA 3ERED 3H92A 3GZ6A 4M74A 4I02A 3PQJA 3T8TA 4U7BA 1LDJA 4MEXF 2VC0A 2FQ3A 2NYXA 5E20A 1JHFA 4OIQF 1T2KA 3LSTA 4HF0A 3W6KB 3FF5A 1IF1A 3WU1B 1TQPA 5F1RA 4ASNA 4G6QA 5CVIA 3GVAA 1G6NA 3GFJA 4M72A 2LKPA 1F9NA 2HQRA 2OZ6A 1R22A 2P6TA 5J8CA 5KVRA 2STWA 4A0ZA 2VN2A 4BXUA 2K4JA 1O3RA 4Q4ZF 2W25A 4N0BA 3SZTA 2A69F 4CYDA 2PMHA 1IZ1A 5LRSA 4IRHA 3GFIA 3HHHA 3P9IA 5LEKA 3CLOA 5H6QA 3JTGA 3CUQA 2FSWA 3E6BA 2EA2A 2W84A 2XRNA 5E18F 1Z1DA 1VTNC 1B1BA 4ZH4F 3GEZA 1SD4A 5A2QZ 3FMQA 2DO7A 2M1BA 2EJRA 1XN7A 3EUHA 1YW8A 4HOBA 2XGXA 1ZLJA 2BBYA 4IHSA 4OU0A 3P9CA 2QBYA 1KU3A 3C7JA 1ULYA 2EFQA 3KCCA 4I09A 2AXLA 1IRGA 4AIJA 2DU9A 2PN6A 1IN6A 1XB4A 2HQNA 1SFUA 4AD9A 4L9TA 3I5UA 5BS6A 3C18A 4FHTA 1BI0A 4WXDA 5D5VB 2PBIA 1F5TA 4B09A 4FX0A 1RUNA 1OR7A 2H6CA 2QYOA 2H09A 3V8KA 4Y15A 1SD7A 5L3DA 2VBYA 5LHIA 1JE8A 4BNCA 1TQIA 3L7WA 3KP2A 1S7OA 1P4XA 1XGOA 2PEXA 3L9FA 2YX4A 3HSEA 4ZYDA 4BQAA 4ESFA 2XAQA 1PUEE 4FT8A 2MH9A 1T38A 3TKYA 2HWVA 2EV5A 1O3QA 4A6EA 3DFGA 2BYVE 3LFKA 2A68F 1TW3A 3J80Z 5E1ZB 2XAJA 5LLQA 3AAFA 2E7WA 4LB6B 1FY7A 5DEQA 1IN5A 2XKOA 3IKVA 2EA4A 1K79A 2UWMA 3U2RA 1SFEA 3CTAA 1KYWA 2NNYA 2EWNA 3C3WA 1R1VA 2FBIA 1W7PD 1SD5A 2D1VA 1U5TB 1FBUA 5E8IA 4OIRF 1WRJA 1IRFA 5H20A 2P5LC 3RI4A 2VODA 4BHBA 5FB2A 1PP8F 3W6JB 3E5QA 3ZN1A 1KU2A 2GAUA 4M71A 2XAGA 3IWZA 2Y75A 5JFRA 3OOPA 2CW0F 1OYWA 3HIFA 1QZYA 2R7FA 3H3UA 3IRRA 4IRIA 4U0YA 4YG2F 3I4PA 3MWMA 2QQAA 3WTXC 2E7XA 1EH6A 2FXAA 4IRGA 3BJAA 2P5KA 1KQ9A 5HOOA 1HKQA 1I5ZA 5TJJA 5HDKA 2HTJA 5L3CA 1U3EM 1LVAA 4A6DA 1J75A 3KP3A 4OINF 5CLSA 4BYYA 4KNYA 1XD7A 4HA8A 1NHAA 1LB2A 3FZVA 2A5YB 3I59B 5D8KB 1ZRDA 2Z5UA 4LJZF 3LAJA 1STZA 3E5XA 4A12A 3K9TA 5FD6A 2UZKA 1U2WA 4P9FA 3REOA 1OYYA 2XHKA 3DPLC 3DF8A 4M9XA 2PMUA 4NB5A 2D1HA 1FYKA 2OZUA 4HLYA 2UXNA 3I58A 3TO9A 3LAPA 4JK1X 3KZZA 3ZMZA 1CF7B 5D5XB 2CQKA 2W24A 4ZYEA 1IXSB 2FNPA 3WTWC 1YIOA 2QVOA 4EJWA 2HYFA 3IWFA 1AWCA 4S05A 2QLZA 3PFIA 3FXQA 4A2UA 1IUYA 4EGZA 2CO5A 3RIRA 2DQRA 2DPDA 5HDGA 2FE3A 5LEJA 4ON0A 5HVQC 2JT1A 1O7FA 3M8FA 4HLXA 3RKWA 5ILSA 3SQNA 1ZLKA 1LJ9A 1U5TC 1U78A 4RAZA 1BI1A 3LQQA 1MJ9A 4M6XA 5DD4A 2R3SA 4CZZA 3GUDA 2QENA 1XGNA 3N97A 1T6SA 2KJCA 4M9ZA 2ZMEA 5JHUA 4H0EA 3CUQB 5HS8A 4UHTA 3SXYA 4OIPF 1KYZA 1HKTA 3F6VA 4B8XA 1QPMA 2XASA 2MBFA 3GF2A 3RPUA 2JPCA 1Z9CA 5AIPA 3ULQB 3PQKA 1YW7A 1Z7UA 4L9JA 2W57A 1HQCA 1O7LA 2QUFA 3ML6A 1SMYF 1YYVA 2QBYB 4XSXF 2PFBA 1L0OC 2GWRA 1S3JA 1LDDA 2Z3YA 2MC3A 3LWFA 3WE2A 5LRRA 4EJTA 3I0TA 3V7SA 2EFOA 3VODA 1GVJA 2RKHA 1W5SA 3QP6A 1LDKB 1QZZA 2XUBA 3P9KA 2PQ8A 3KEOA 1XMKA 2IJLA 3KP4A 1B4AA 3G3ZA 3BWGA 1J0RA 2IVMA 1X3UA 5HS7A 3RYPA 4CHUA 1TBXA 5D6FA 3LA7A 3TO6A 5HLHA 4MTDA 2IRFG 4A0YA 4O6JA 2JPBA 2XV4S 3HTSB 4UV8A 5KK1A 4NHJA 5AIQA 2FMYA 4KMFA 3CJNA 4G7OF 2FF4A 1J5YA 2GA1A 3C1DA 3KZYA 1BIBA 1F4KA 4E70A 3VB2A 4EM2A 4KDPA 1ODDA 2VONA 1ZARA 3L00A 1FNNA 1K6OA 3R6SA 2IA1A 4LK1F 2BV6A 1ZG5A 5HDNA 4Q47A 1QO0D 2OA4A 1WWXA 4WXCA 3QPHA 1JGSA 5AONA 4WWCA 5E1WA 3HHGA 5LBQA 2CGPA 3V7CA 3ZMSA 5JI6A 5DCMA 4I0AA 1EH7A 2NNNA 3N4MA 2HTSA 2OQRA 3FM3A 4MGRA 5EEHA 1CGPA 2H27A 2P5VA 2GZWA 3DP7A 4RS8A 2IW5A 3B02A 4HF1A 1Z6TA 5CVRA 3ECOA 4UVCA 2O3FA 5D5WB 3GZ5A 1UCRA 3QAHA 1FYLA 3ZN0A 3MFKA 2QQBA 4GYIA 5CYVA 1A04A 3ZQ7A 1YFHA 2E1NA 1HSJA 1KGSA 4BAYA 2NS0A 3GFLA 2EFWA 3J81K 2EV6A 1J7KA 3CO6C 4IXAA 4UVAA 2K27A 5CVVA 4WK8F 1OMIA 1Y0UA 1H0MA 3R4KA 3KP7A 1H9GA 3EYIA 2PJPA 2ZJ2A 5ICGA 1TTYA 4I2OA 1IN4A 5BOXA 4BHPA 1IXCA 4AVPA 3QRFF 4UXNA 2O61A 4EJOA 1DPUA 5HLIA 1S6LA 2X0LA 3WGIA 5H6RA 1MDMA 4ENNA 3JAMZ 4U88A 3BOQA 2V6CA 4MEYF 2D2WA 4OMYA 1FX7A 3FWEA 3TOBA 1GXPA 1YO5C 1DDNA 2PG4A 1FBQA 3T1BA 4ZYHA 4L9VA 5FLXK 3NEUA 5D8LB 3GX4X 2V1XA 2Z9OA 3MZHA 1FP2A 5ICFA 2Q2EA 4KYWA 4WF2A 3FHZA 2ZO4A 3RDIA 3F8BA 2CG4A 4JQFA 3TOAA 2IT0A 4I7HA 4Y17A 3O2PE 3D0SA 1FSHA 2G7HA 1R1UA 2VT3A 2LNBA 1SAXA 3RYRA 4EQQA 3GYHX 2ZMEB 1SMTA 1BBYA 1P4AA 2L54A 2MLGA 2QM3A 3VEPA 1TW2A 3HRUA 4MTEA 5DCFA 4PZJA 4N9HA 2MD5A 3BZ6A 3O3KA 1BC8C 3K1MA 4L5JA 4KIGA 5J8FA 1I1SA 3HRTA 4GO1A 2ZCWA 2BGCA 3F3XA 2KJBA 1IN7A 3WTSC 3WG9A 1YLFA 2Q0OA 3SZPA 1HSTA 3BP8A 3RJPA 3E6CC 3V7RA 4QLCU 4KICA 3COAC 1YS7A 2GA2A 4IF4A 3U1DA 4AWXB 5L3FA 2DK5A 2EB7A 4RB0A 2DLLA 3V8LA 1OYIA 5ICCA 1MKMA 1OPCA 1D5VA 3FMSA 3WGHA 1MGTA 3R0JA 2PLYA 3DXJF 4G7HF 2HFHA 5D4SA 2F5FA 4ZYGA 2L3DA 3RPQA 5D6EA 1PP7U 1Z05A 1IXRC 5K5RA 4I01A 2O03A 2DW4A 3FMRA 4RB2C 2Q8KA 3EYYA 4Q5SF 3T0YA 3BROA 4HZFA 2VBXA 2VE9A 3WU0A 3ZMUA 4L0ZB 4XSZF 3QP5A 3EQLF 5F6FA 1FC3A 1QNTA 5A2QK 1YS6A 5IT9Z 1Q1HA 1R1TA 3E6MA 3WTVC 4P96A 3GWZA 2OU2A 3TDZC 3GXOA 3ZP5A 2RC4A 3MAJA 4DQ2A 5DCMB 2FNAA 1QBJA 4GYGA 1FSEA 1FZPB 2HYGD 3NQOA 3FM5A 2XVCA 3F8CA 3MEXA 1G3TA 3I64A 1S29A 3ECHA 2GIVA 2HKOA 1BM9A 2H6BA 1XMAA 2CFXA 3M1EA 1I27A 5DD8A 4HV5A 4R1HA 3RKXA 3F6OA 2LSOA 3IL2A 3BPXA 4QWQA 3VFZA 3G73A 3HOTA 2ZNZA 1XCBA 4UUVA 1BOAA 4I0BA 4R79A 2V79A 4IVNA 1W5TA 4PGGA 2YPRA 4IJAA 4ENMA 2CSOA 5K5OA 5FD5A 4RGXA 4OIOF 2L02A 2ISZA 4ZZLA 4LLLA 5J6XA 2XROA 4XRFA 4D0PA 2YU3A 2DQLA 1J9IA 1ON2A 4LK0F 2DAOA 1BJAA 4HV6A 3QU3A 3J80K 2BEOA 4M9SA 3NRVA 2HGCA 1G3YA 4L5IA 4UNOA 4HW0A 4LLGF 1MDMB 4UV9A 2ISYA 4U0VA 4A5MA 1UHMA 3HRMA 2P4WA 2X4HA 1E2XA 2A07F 1I6XA 4L9NA 2VBWA 2HKXA 2ZXJA 2KIFA 3Q5FA 1R5GA 5DDGA 4EJUA 4AIKA 1HKSA 4PCQA 5FO5A 4EGYA 1GXQA 1EV7A 4PDKA 4KT5C 1V4RA 1T0FA 2DTRA 2J5OA 4G9YA 2FOKA 1TQMA 4G94A 3HTUA 1HW2A 2HS5A 4ENKA 2A61A 2VC1A 2ADUA 1U5TA 1YW9A 1ZHFA 2RNJA 4LD5A 1WKMA 1S7AA 2WC2A 4MQ9F 4HDUA 2KKOA 3MCZA 3WODF 1REPC 3O6BB 2P7VB 1FT9A 3EDPA 3M9AA 4NQWA 5IT3A 4MNUA 4R8HA 2TDXA 3V8JA 2VBZA 5L3GA 1UFMA 1FPQA 1ZN2A 3KLNA 2Y0MA 4XLPF 1JXSA 2QWWA 1T39A 1K78A 3ZMTA 2FBHA 4LMYA 1RUOA 3KETA 4F7ZA 2LDUA 2EK5A 3E6DA 5BMZA 2FBKA 3FXRA 3JTHA 3TQNA 1K7AA 3KE2A 1W7PA 2RQPA 1HW5A 4M73A 5D4RA 2XIGA 2WWYA 4KIFA 3M7GA 4YIFA 3HOSA 3CUQC 4OOIA 2COMA 4EM0B 1RNLA 2ZBKA 4IPAA 4M6YA 1XSDA 2V1UA 1R7JA 3F22A 5E1XA 1FLIA 1ZGAA 4KN7X 3CO7C 2F5EA 1RIOH 4RAYA 1KQ0A 5K1YA 1KU9A 3QOPA 3ABTA 3F23A 4PGHA 3QPTA 2Z33A 2WTEA 4DNCA 2M8EA 1CF7A 2RGVA 4U7DA 3ZPLA 2M87A 1XGMA 4FX4A 2A6HF 4Q48A 3ISPA 1U8RA 2G9WA 4GGGA 2PI0A 1D8KA 4RGRA 1D8JA 1MZBA 1O57A 3BJ6A 2FRHA 3MZYA 2RDPA 5LGTA 1YQAA 1FBSA 4HBLA 1OKRA 2H94A 4LFUA 2R7DA 1WQ2A 1LNWA 3IRQA 2FMLA 1P6RA 4EV0A 4HF2A 5BPDA 3HSFA 2Y48A 4P5OA 2KRFA 1ZGJA 2VXZA 1ONVA 4LGWA 3DEUA 1XSXA 1GHCA 4L0YB 1H9TA 5EEGA 3D5LA 5FFXA 5ILUA 1BI3A 2DT5A 1G4DA 4XBFA 3K0LA 4KA4A 1DPRA 1SD6A 3E5UA 3JSPA 3L2CA 4O5VA 5BQTA 3IKTA 2HOEA 3HYIA 1MJAA 5HS9A 3S2WA 2RVCA 2ZKZA 4KUMA 2FA5A 1HXDA 2QQ9A 3M8EA 3KP6A 3F8MA 2P8TA 3BDDA 1BC7C 1XSVA 3F8NA 2NAZA 2MH2A 2M5WA 5ERIA 3K1PA 4CO8A 1W4MA 4LB5A 2V1DA 3LQRA 3CUOA 3J7AO 4HAMA 3R60A 4S04A 2C6YA 1R36A 3KP5A 4RGSA 1ZRCA 2G7UA 3K2ZA 3F21A 1I1GA 4Y13A 5BPIA 3EETA 1WI9A 3P7NA 4WXHA 2OAZA 1YG2A 4CXFA 5JR3A 3FX3A 2A6EF 3VOEA 2LF8A 4CICA 3LA2A 4HYEA 4ETSA 2FEZA 4KFCA 4ESBA 4XLNF 1IW7F 5ED4A 1BN5A 2P7CB 4CDGA 1R5HA 2VE8A 1ZYRF 3JSOA 3MQ0A 4L18B 4LG0A 5E8GA 2VOPA 3I54A 3HSRA 1ZH5A 2ZNYA 2OD5A 4A5NA 4AIHA 5FGMA 2GXBA 3E3VA 3B73A 1Z6RA 1KA8A 4GCVA 1KQ8A 1RI7A 2DBBA 3ELKA 3LA3A 1FOKA 5CVJA 4YFKF 1BIAA 2A3SA 4ESJA 3BPVA 1JHHA 2O0YA 2M30A 1AOYA 1WSUA 1USSA 2CYYA 2LF7A 2ESNA 1G3SA 4I98B 1KU7A 1D3YA 4YFXF 4YFNF 2VT2A 2DPUA 5JVTA 1MJBA 3ZMVA 1BI2A 2IP2A 2EV0A 5D5UB 2ACJA 2AS5F 2GXGA 2O8XA 4U0WA 3I53A 5DYMA 2RN7A 3TGNA 3TO7A 3DV8A 2B0LA 2XAHA 1K78B 1XDUA 3FXUA 1HW1A 2VOOA 3RKYA 2QZ8A 3ROUA 2XKPA 4G8XA 4A0XA 3GO5A 1DP7P 4BH9A 4RGUA 1W7PB 3BJOA 5ICEA 5DUKA 1B59A 1YTYA 2YR2A 3IHUA 4CGZA 3JAMK 4ZZDA 4G7ZF 1P2FA 2W85A 1E17A 1XDSA 1IN8A 2D45A 4TV7A 1Z91A 5F64A 1G3WA 1XCVA 1TNSA 1ZG3A 1ZG1A 3SFZA 3F8FA 1P92A 3WE3A 2IA0A 2F5CA 4HX8A 3HRSA 5TRDA 2HEOA 4HX4A 2ESHA 2P6SA 5DUIA 3H3ZA 1B9NA 2IPQX 3WTZA 1EH8A 1O3TA 5LHGA 4BHCA 2JSCA 1FYMA 1B6AA 4HDVA 2STTA 3GLXA 1O3SA 1LQ1A 4LLNA 2L4MA 2YSRA 5CJ9A 3V4GA 2K86A 1P4WA 2IA2A 2WV0A 2RV8A 3WTUC 4MQVA 3F72A 3Q9VA 2BE5F 2J5PA 3WGGA 1DUXC 3ABUA 3J81Z 3GW2A 2FU4A 4EM1A 4P9UA 5LGNA 3Q9SA 1T98A 2OQGA 1L3LA 5K5QA 2DK8A 2KIMA 1R00A 1HBXG 2NRAC 3I71A 4ENJA 2L01A 3WTYC 4N9IA 1TLHB 3ZMDA 1F1ZA 1U6GA 3RTRA 1QQIA 1TNTA 4EVIA 4KIBA 2DFIA 1B9MA 2DI3A 4HX7A 6PAXA 3T5XA 2ZFWA 4MHGA 2M45A 5LHHA 3L09A 2OBPA 2HDCA 2K02A 2ETHA 4K2EA 1SFXA 2L4AA 2O6GE 5L3BA 1IAWA 2E1CA 4RB1A 2K7LA 2JRTA 2EFPA 2Z99A 4WX9A 1R58A 5DV5A 2K4BA 2EFNA 3DKWA 3OV8A 1USTA 1UHWA 3KEQA 1RZ4A 2ELHA 1V3FA 2JZYA 5FLXZ 4IHTA 4HQMA 3SHFA 1C0WA 3CDHA 4KMUX 5HLGA 2F2EA 1ON1A 1MD0A 4RB3C 3HUGA 2XAFA 3R61A 1FWZA 1UB9A 5L3EA 2YX7A 2F5DA 3T8RA 2GQQA 3DQVC
chains in the Genus database with same CATH superfamily
3DPTA 4QPQA 2QKMB 2MLKA 5EEAA 4LIUA 4KN4X 3E97A 2MSYA 4HQEA 5EDNA 2IS2A 2MW8A 3U9GA 2HZTA 2MA3A 3PL8A 3K4LA 4PJ0C 5E3MA 2JTVA 2KIUA 2OPTA 2V9VA 3QU6A 1R23A 4O3MA 3JW4A 2CWEA 3BLYA 1LEBA 4P55A 1LEAA 5E17F 3G1LA 3OL4A 4CCLA 3CESA 3K4BA 4E7KA 1ZRFA 5FFZA 4RA2A 1J2XA 2KPMA 5LGUA 2HI3A 4UVBA 2HR3A 1ETYA 2H1LA 5IT9K 3KLOA 4Z2YA 3BY6A 1S8NA 2NVQJ 2Y0SA 3LNQA 4LG0B 1FP1D 1QGPA 3FBNB 3I59A 3HGGA 2DA2A 3QPLA 4S0HB 3IC7A 5DM6F 3DBLB 1ZREA 3KFWX 3TDUC 1E3HA 3K1NA 1XGSA 3BCAA 4YIIA 4EMSA 3A01B 4OMZA 4EJVA 5CVUA 3BCBA 4IHWA 3C2GA 3DLAA 3WTTC 1MBHA 4JBAA 3JRBA 3S15J 4G6DA 4B1RA 1FMWA 4GFBA 3WU2C 1ZAOA 3A4CA 1J59A 4HSRA 2UXXA 4WCGA 3R0AA 2H8WA 1PDNC 1I6HJ 3K69A 5ILVA 4GXOA 3S16J 4G12A 3GFMA 3ERED 5LD2C 1G2HA 4NUBA 1Q1VA 2EPFA 3H92A 3Q0WA 3GZ6A 4M74A 4I02A 3PQJA 3T8TA 4U7BA 1LDJA 4XR6A 4MEXF 3Q3SA 3SZGA 2E36A 2VC0A 2FQ3A 2LBFA 2RQQA 2NYXA 4BXXJ 5E20A 3CJQB 1JHFA 3CC7I 2HZDA 4OIQF 1T2KA 2CV0A 3LSTA 2FOWA 2IAIA 3CCSI 2PMZA 3PSFA 4MFDA 4MFEA 4HF0A 3W6KB 3FF5A 4HG2A 1IF1A 3WU1B 1TQPA 2CQXA 5F1RA 4ASNA 4G6QA 5CVIA 3GVAA 2LG4A 4JYKA 5IYCJ 1G6NA 2ZSIB 3GFJA 4M72A 1F43A 4IHXA 2LKPA 4YELA 1F9NA 2HQRA 2OZ6A 1R22A 4QIWN 2P6TA 1Z7LA 2X1DA 3BG3A 1BOBA 1BW6A 5J8CA 1LFBA 5KVRA 1PUFA 2STWA 1VQNI 1JKPC 4A0ZA 2VN2A 3BC8A 4BXUA 2JA5J 1VQ6I 3LSGA 2K4JA 3FXOA 2MC4A 1WH7A 1JUSA 1E3OC 3B6CA 1O3RA 3ZQGA 4Q4ZF 2W25A 4N0BA 3BT9A 3SZTA 3ZQIA 1LFPA 3BTCA 1M1EB 2BY3A 2A69F 4AC0A 4CYCB 4CYDA 2PMHA 1NG7A 3RQ4A 4AYBA 1IZ1A 3HDDA 5EF6A 3IAS2 4IRHA 3ZXSA 5LRSA 1WZ2A 4PJMA 3S1MJ 3GFIA 5KAFC 1TT5B 3HHHA 3P9IA 5LEKA 3CLOA 5H6QA 3JTGA 3CUQA 2M8GX 2W48A 2FSWA 3E6BA 5DM7F 2EA2A 4BE2A 2DMTA 2W84A 2XRNA 3H0GJ 3PFYA 5E18F 1Z1DA 1VTNC 1B1BA 1KONA 3W2WA 4ZH4F 3GEZA 1SD4A 3PIPF 5A2QZ 3JRDA 2EIJH 1QU3A 3FMQA 2DO7A 2M1BA 2EJRA 1XN7A 3RPUD 3EUHA 1YW8A 3BG5A 2QKLB 4HOBA 1LVKA 4BACA 2XGXA 4ZYAA 1ZLJA 2BBYA 1R4MB 4BXFA 4IHSA 1ETKA 4OU0A 3P9CA 3TMOA 2QBYA 3ERMA 1KU3A 3C7JA 3HOYJ 1ULYA 2EFQA 3KCCA 2GIZA 5GAGJ 4I09A 2AXLA 1IRGA 5CQEA 1TZLA 4XN0A 3DTIA 4AIJA 1MH3A 2DU9A 4XQFA 3PNYA 2CFOA 2JA8J 2PX9A 3G6EI 2PN6A 1IN6A 1XB4A 1K6YA 2HQNA 1SFUA 1OQYA 4XRSA 4AD9A 4XK4A 4L9TA 3I5UA 4A3DJ 1XG1A 5BS6A 3C18A 4FHTA 1BI0A 4WXDA 4A3FJ 1OCOH 1AA7A 5D5VB 3LSIA 3L2UA 2PBIA 1F5TA 4B09A 4FX0A 1RUNA 1MMGA 1OR7A 5EJCA 2H6CA 2QYOA 2LKSA 2RREA 1Z67A 1NH3A 2H09A 3V8KA 4Y15A 1NK3P 1SD7A 5L3DA 1ZTRA 1ZR2A 1B72B 2VBYA 2VQGA 5LHIA 1JE8A 4HEA2 4BNCA 2CW8A 2WB1A 3NARA 4DYCA 1LUJB 1TQIA 3L7WA 3VSKA 2I8DA 3KP2A 2DCEA 5IYDJ 1S7OA 1P4XA 3LSRA 3A0HC 1XGOA 2PEXA 3L9FA 1Z77A 1WJEA 2E34A 4IOCF 2CW7A 2YX4A 4XOTA 3HSEA 4ZYDA 3PIOF 4BQAA 4ESFA 2XAQA 1PUEE 3HJEA 4UUTA 4FT8A 3OYLA 2MH9A 1EJ9A 3ONQA 1HF0A 4X0GA 4A3MJ 2R5YB 1T38A 2Y69H 2EH3A 2HWVA 3TKYA 2EV5A 2P81A 1RKWA 3BTLA 5F0FA 1O3QA 2XSJC 1V5GA 3NWTA 4A6EA 4IEJA 3DFGA 2BYVE 2R7RA 3LFKA 4DYRA 2A68F 2E2JJ 3CC4I 3ABKH 1B8IB 2X6XA 1YITI 1IO2A 1TW3A 4PJLA 2L9NA 5E1ZB 3J80Z 3VWBA 1D1AA 2XAJA 5LLQA 3AAFA 2VLAA 3LL7A 2E7WA 4LB6B 1FY7A 5DEQA 4A3LJ 1IN5A 2B63J 4D5CA 2ZXWH 3K4NA 4XOPA 2XKOA 3IKVA 2EA4A 1K79A 2UWMA 3G1OA 3U2RA 1SFEA 2M34A 3CTAA 1KYWA 2NNYA 2VIXA 2HXIA 2DT7B 2EWNA 2ZJPF 3C3WA 1R1VA 2DN0A 2CUZA 2FBIA 1W7PD 4FETA 3H35A 5GTHC 1WI3A 2K3FA 1SD5A 2D1VA 4N4OB 2JN6A 2KLOA 3OYKA 2WBMA 3W2AA 1U5TB 3JREA 4A3EJ 1FBUA 5E8IA 4OIRF 1WRJA 4AVZA 1IRFA 5H20A 2P5LC 2EZHA 1IGNA 3RI4A 2M7AA 3DEWA 4BHBA 2VODA 5FB2A 2JVGA 1PP8F 3W6JB 3E5QA 3ZN1A 2KDOA 2JK3A 1KU2A 2GAUA 4M71A 2XAGA 4RM2A 5E79C 3K2AA 3IWZA 2Y75A 5JFRA 3OOPA 2CW0F 3ABLH 2EBIA 3S3NA 1OYWA 3HIFA 1QZYA 4CCNA 2BHYA 2R7FA 3E0JB 3SEQA 3S17J 4YRVA 3H3UA 4A3BJ 3LSHA 3FXMA 3IRRA 4D5FA 3AG1H 2I10A 4IRIA 4E7SA 1WJ5A 1HDPA 1VQOI 3EUKL 1IUFA 4U0YA 4YG2F 2KRHA 4XLCA 5GPCA 3I4PA 3MWMA 2QQAA 4BQOA 3WTXC 3BR0A 2E7XA 1EH6A 2FXAA 5GAHJ 3DTEA 3BJAA 4IRGA 2P5KA 4ZTJA 1TC3C 1KQ9A 5B1BH 4DZPA 1VQ4I 3HOVJ 4PJJA 5HOOA 1HKQA 1I5ZA 5TJJA 4U87A 5HDKA 2HTJA 5L3CA 1IC8A 1U3EM 3HEFA 1LVAA 4A6DA 1J75A 4ZDOA 3KP3A 4OINF 5CLSA 2KHMA 2X85A 4BYYA 1VQ7I 4KNYA 1XD7A 2ZB9A 2ID3A 2CV2A 1I39A 2AXTC 1NTCA 4BU2A 3OYBA 5FKKA 4HA8A 1NHAA 1LB2A 4QPOA 1VQLI 3FZVA 1MSFC 2A5YB 3I59B 4BKXA 1TWGJ 2DMNA 5D8KB 2M4KA 1ZRDA 1NK2P 2ZFUA 1Y0NA 2Z5UA 5KHDA 2DYRH 4LJZF 3LAJA 1STZA 2VPLA 3VPRA 2CRGA 3E5XA 4A12A 3GMEA 1R5ID 3K9TA 5FD6A 3NAUA 3MD2A 4I76A 1U0JA 2UZKA 1U2WA 3ASNH 3S32A 1YJ9I 2QCOA 3KIOA 3CCLI 4P9FA 2LLKA 3REOA 3MMYB 2H8RA 2DJNA 1OYYA 3HKZN 4XKCA 3HM5A 4MIMA 2XHKA 3H36A 3DPLC 2XPVA 3DF8A 4BGDA 4M9XA 2PMUA 4NB5A 1JKOC 2D1HA 4DZJA 1FYKA 4JX4A 1FTTA 1XX5A 1BL0A 2LMDA 2OZUA 3ZQQA 4HLYA 1Z3YA 1OCTC 2IGOA 2UXNA 5B5EC 3I58A 5TGTA 4ABZA 3TO9A 3TL4X 1HA8A 4BL0B 3IAM2 3OYAA 3LAPA 3H9GA 4JK1X 4MO7A 3KZZA 3RSNA 3ZMZA 1CF7B 5D5XB 2CQKA 2W24A 4ZYEA 4XICA 1IXSB 2FNPA 3WTWC 1YIOA 2QVOA 4EJWA 4F91B 2DXIA 1O4XA 2IS1A 2X6OA 4XIDA 2HYFA 2OTJI 3IWFA 1AWCA 2VKVA 4S05A 2JVHA 2QLZA 3PFIA 3FXQA 5FKMA 4A2UA 2ICWG 3CP8A 2Y9YA 4XMYA 1IUYA 4EGZA 4FISA 2CO5A 2HOAA 3RIRA 1X1AA 2A6TA 2DQRA 5CPRB 1MBKA 2DPDA 5EZGA 5HDGA 2FE3A 5LEJA 2L7FP 4ON0A 1K4TA 3MKLA 1X3ZB 5HVQC 2JT1A 1O7FA 3M8FA 1ZR4A 2XF7A 4HLXA 1X1CA 3RKWA 1GDTA 5ILSA 3SQNA 3ZOBA 2KL4A 1ZLKA 3RCOA 1P9QC 1LJ9A 1U5TC 3FXKA 1VFCA 1U78A 4MLOA 3FHNA 4DBQA 4RAZA 1MMDA 1BI1A 3LQQA 1MJ9A 4M6XA 2WY8Q 4JX5A 5DD4A 2R3SA 4CZZA 3GUDA 2QENA 1XGNA 3N97A 1T6SA 2KJCA 3P5JA 2VKDA 3LFUA 4M9ZA 2ZMEA 1T95A 4ZDLA 3CD6I 2HPIA 1I3AA 2ZSHB 2TCTA 5JHUA 4H0EA 3CUQB 5FLVA 3HG9A 4AU7A 5HS8A 5C3EJ 4UHTA 3SXYA 3JR9A 4OIPF 3G2BA 1KYZA 4M3BA 3SDBA 5J4YA 1HKTA 3F6VA 4B8XA 4RDUA 4BBSJ 1QPMA 2XASA 5GAEJ 2MBFA 3GF2A 2P0WA 2DDBA 3RPUA 2JPCA 1Z9CA 5AIPA 3ULQB 3PQKA 4NC6A 1YW7A 1Z7UA 2WV1A 2JRMA 2I5UA 1X3WB 3OYFA 4L9JA 4EEFG 2W57A 1HQCA 1N78A 1DGRM 1X1DA 3KZIC 3FDYA 1O7LA 2QUFA 4DW6A 3ML6A 2K9SA 1SMYF 1YYVA 2QBYB 4XSXF 2DODA 4C3IJ 2PFBA 1L0OC 2GWRA 5GTIC 1ITYA 2M9HA 2MD0A 4QTRA 3OYGA 1S3JA 1LDDA 4A93J 2Z3YA 2MC3A 2R5ZA 3LWFA 3WE2A 4UY8I 5C44J 3Q0VA 5LRRA 1Z21A 3AL0C 1PJRA 1EF4A 4EJTA 3DTKA 3I0TA 3V7SA 2EFOA 3VODA 2CS3A 2XF5A 1GVJA 2NVXJ 1SANA 2RKHA 1W5SA 3QP6A 1LDKB 1QZZA 3K7AJ 2XUBA 3P9KA 2PQ8A 3KEOA 2QGUA 2K9LA 1XMKA 2IJLA 3KP4A 1B4AA 4RLFA 1GV2A 3G3ZA 3BWGA 1J0RA 2IVMA 2E1MB 1X3UA 4II3A 2WAQA 5HS7A 3RYPA 1SEUA 4CHUA 1TBXA 2X9DA 2HQAA 3LA7A 5D6FA 3SFIA 3TO6A 5HLHA 2NS8A 4MTDA 2IRFG 3A1YA 2M0MA 4A0YA 3CJRB 4BS9A 4O6JA 3L2VA 2JPBA 5CKTA 4E7JA 3ASOH 2XPUA 2XV4S 3HOUJ 3HTSB 4UV8A 3QOEA 1T56A 4OAYA 5KK1A 4CA0A 1WPKA 1MW7A 4NHJA 4XLAA 2M3AA 4IL6C 5AIQA 3DWLE 2FMYA 1OJLA 4KMFA 3OWTA 2W82A 3TP0A 2IEKA 1U9OA 1YHQI 2V26A 3CJNA 4G7OF 3I9V2 5KCMA 1Y6IA 2FF4A 5M3MJ 1QHGA 1J5YA 3NWSA 2GA1A 1Y8RB 3C1DA 3KZYA 1BIBA 2IS4A 1F4KA 4IZZA 4E70A 3VB2A 2EIMH 1XS9A 4EM2A 2VQLA 4BEHB 1WJBA 3FIWA 2WAFA 4KDPA 1R9TJ 1ODDA 2VONA 1ZARA 3L00A 2ECBA 4XL9A 2MFZA 3D5SC 4LITA 2EILH 1FNNA 4A3JJ 3LSJA 2M4GA 1K6OA 3R6SA 1IDZA 5IP7J 2R92J 2IA1A 4KT6A 4LK1F 2BV6A 3X2QH 3BR2A 1AU7A 1ZG5A 5HDNA 4Q47A 1QO0D 3EUAA 2E1OA 1RC9A 2OA4A 1BW5A 1WWXA 3OIPA 4WXCA 3IUOA 3HB9A 1JGSA 3QPHA 5AONA 3IH3A 4WWCA 3I56I 2CH0A 1GV5A 5BNGA 5E1WA 3BR5A 4BUPA 3HHGA 5LBQA 2CGPA 3V7CA 3ZMSA 1X58A 5JI6A 4CUGA 5DCMA 4I0AA 4XLFA 3BZCA 2JMWA 1EH7A 2NNNA 3N4MA 1Y39A 2HTSA 2OQRA 3FM3A 4NC7A 3K4KA 5F04A 4MGRA 4B4CA 5EEHA 1CGPA 2H27A 1WCMJ 2P5VA 1UMQA 2GZWA 4E7HA 3DP7A 2OC6A 4RS8A 1ERDA 2IW5A 3SDGA 1FOWA 3B02A 4HF1A 1Z6TA 5E3OA 5CVRA 4I6ZA 3ECOA 4UVCA 2O3FA 2VB6A 5IOYA 5K7HA 5D5WB 3GZ5A 5C4JJ 1W36C 4DBRA 1UCRA 3OYMA 3QAHA 3CMYA 1FYLA 3ZN0A 4PSXA 2JUGA 3MFKA 3PJRA 2L7ZA 2QQBA 4GYIA 5CYVA 1A04A 1MMAA 3ZQ7A 1YFHA 1RETA 2E1NA 1HSJA 4F55A 1KGSA 5EZHA 1R71A 1YX5A 2WAEA 2IXSA 4BAYA 2NS0A 3GFLA 2EFWA 3UR3C 2GOMA 3PO2J 3J81K 1A6IA 1UELB 1J7KA 2EV6A 2IGNA 3V42A 1QRYA 2ZJQF 1HOMA 3CO6C 1SVOA 2NVYJ 2VPRA 4IXAA 5DS9A 4UVAA 2K27A 5CVVA 5EGOA 5IYBJ 4WK8F 3ZRGA 1OMIA 2M7BA 2XGEA 1FOXA 1Y0UA 5GP9A 1H0MA 3R4KA 3KP7A 1H9GA 3H0DA 3EYIA 3M3YJ 3RKQA 1ZELA 4HSTA 4IKFA 3GCMA 5JLWA 1Y1VJ 3LOCA 2PJPA 1VI0A 2ZJ2A 5ICGA 2KT0A 3G1MA 1UG0A 1IV8A 3A02A 1TTYA 1G8XA 4I2OA 4PSWA 1OCZH 1IN4A 5BOXA 1MBGA 4BHPA 3W3CA 1IXCA 4AVPA 5CQGA 1MBEA 3QRFF 4UXNA 2O61A 4EJOA 1W5CC 2NOGA 3CF2A 2O5RA 1DPUA 2DOAA 1HDDC 5HLIA 4D7MA 1S6LA 2R7XA 4E4HA 2X0LA 2DMQA 3SYTA 3WGIA 1SFOJ 2F4OB 2XRLA 3AG4H 1VQMI 5H6RA 2ZXIA 1SFKA 1MDMA 4ENNA 2R7QA 4KITB 4FASD 4M3DA 5HNHA 3JAMZ 2L7MP 1S7EA 4U88A 3DPUA 3BOQA 3GBGA 2V6CA 4MEYF 2YUSA 2D2WA 1SC7A 2WB1N 4OMYA 5FROA 1FX7A 2HVSA 4DIQA 3H9JA 3JRFA 1ZKGA 3FWEA 3OMYA 1V5EA 3TOBA 2R4GA 2R7OA 4XM3A 1GXPA 2F6CA 1YO5C 1DDNA 2PG4A 4D1QA 2RAEA 1RR8C 1FBQA 4XN3A 3T1BA 4ZYHA 3L1PA 3FKIJ 4L9VA 1N25A 5FLXK 3L2RA 3NEUA 4B44A 3OYHA 3TEDA 1E3PA 1SVLA 5B1AH 5D8LB 3GX4X 2V1XA 2Z9OA 2LH9A 1DQUA 3HXLA 3MZHA 1N75A 5LFAA 3W6VA 1FP2A 5ICFA 4LOCA 2Q2EA 2DA5A 2BY2A 3WHBA 2R7WA 4KYWA 2DA4A 4WF2A 3FHZA 2ZO4A 3RDIA 4E7LA 3F8BA 2CG4A 2CMPA 3JRIA 4F3QA 3H9QA 2FQ4A 4JQFA 3CMAI 3TOAA 2IT0A 4I7HA 4Y17A 3J7ZI 1ETVA 3O2PE 3D0SA 1FSHA 1WVRA 3HBLA 1YJNI 2G7HA 1R1UA 2VT3A 2O8KA 1AKHA 3M07A 1GT0C 2DOEA 2A05A 3CCRI 5F27A 2LC2A 2LNBA 2KP6A 2LYCA 1SAXA 4NDLA 3RYRA 4RBOA 2BY0A 1JUPA 4EQQA 3GYHX 2ZMEB 3PM1A 4EATA 3O8GA 2YS9A 2OCEA 1A5JA 1SMTA 2BHZA 1BBYA 1P4AA 2L54A 2MLGA 3AG2H 2V9KA 4A3GJ 2QM3A 5B3SH 3H1CA 3VEPA 1TW2A 3AKZA 2DFFA 1IRXA 3HRUA 4MTEA 4RLQA 5DCFA 4NBQA 4Y3OA 5KAIC 2E2IJ 1X4PA 1YOVB 5KNLA 4PZJA 4M3EA 2IGMA 1AHDP 4N9HA 1I3QJ 1UZCA 3IH4A 1MBJA 2MD5A 3BZ6A 3O3KA 1N77A 2E19A 1BC8C 3K1MA 2D5VA 2F4MB 2ME6A 2ME0A 4L5JA 4KIGA 5J8FA 1I1SA 1MNEA 3S3OA 3H5NA 2HOTA 3S1RJ 3BQYA 2W7NA 3CCEI 3HRTA 1X2MA 3CDLA 3ESWB 2R7SA 4GO1A 2ZCWA 2ZC2A 2R5ZB 1RPWA 3HPHA 2BGCA 2DDAA 3F3XA 2KJBA 1IN7A 3WTSC 2LP0A 1YLFA 2TRTA 3WG9A 4XONA 3RZOJ 2Q0OA 3PUFA 3BG7A 2QSGX 3SZPA 3TP3A 4H4KC 1HSTA 3BP8A 3RJPA 3ABMH 1Y1WJ 3E6CC 3VSLA 3V7RA 3FK7A 4QLCU 4KICA 3TW7A 3COAC 2XAUA 2HOSA 3BQZA 1YS7A 1DU0A 2GA2A 1F36A 1IG7A 1ZQ3P 1MNMC 2FD5A 4IF4A 3U1DA 1YX3A 4AWXB 5L3FA 3OS2A 2DK5A 2EB7A 3HUGB 4RB0A 5F0HA 4V2GA 2DLLA 3SEZA 3V8LA 3DBRB 1OYIA 5ICCA 1MKMA 1OPCA 3TW6A 3FMSA 1D5VA 1XMXA 3WGHA 3ZQCA 1BR2A 1MGTA 3R0JA 1NG6A 2PLYA 3DXJF 4G7HF 2HFHA 3D5RC 5D4SA 2BOLA 3S2HJ 2F5FA 4ZYGA 1BJZA 2L3DA 3RPQA 2K85A 5D6EA 1Z0XA 1S5LC 1PP7U 2R93J 1Z05A 1W1WE 2VXDA 1P7IA 1X4OA 1IV6A 1IXRC 5K5RA 5HODA 2CUFA 4I01A 2O03A 2Z1DA 2XDVA 1JTXA 3OSGA 1X1PA 1WFXA 4XRSG 2YU9J 2DW4A 3VYSB 2CV1A 2L9RA 3FMRA 4RB2C 1FIPA 2X48A 1VQ5I 2Q8KA 1EKEA 3EYYA 2Y9ZA 3T0YA 4Q5SF 2GLOA 3CCYA 3BROA 1DGWY 3M1CA 2HVRA 1WGXA 4HZFA 3QYEA 2VBXA 2VE9A 3WU0A 3ZMUA 2DFEA 3E7LA 4L0ZB 4XSZF 2BZTA 3QP5A 2EZLA 3EQLF 3QYFA 5F6FA 5M5XJ 1FC3A 3GTQJ 1QNTA 1I50J 2K9NA 3J7YJ 5FKNA 5A2QK 1YS6A 5IT9Z 2M0CA 1Q1HA 1R1TA 2IBDA 2E5NA 2VJ5A 4DYQA 3E6MA 3WTVC 2BW3A 4P96A 3GWZA 4PFPA 3K70C 2ZMEC 2OU2A 3TDZC 4A69C 3GXOA 3ZP5A 2RC4A 4E7IA 4J00A 3MAJA 1S72I 3HL2A 4DQ2A 5DCMB 3G4SI 1HLVA 2FNAA 3E1SA 2X1EA 2HPMA 1QBJA 1HCRA 4GYGA 2LBFB 3C2BA 4GRIA 1FSEA 1FZPB 4AUXA 3CMEI 1UHSA 2HYGD 3CQZJ 3NQOA 1TP4A 3FM5A 4BY1J 1TWFJ 2XVCA 2XGCA 3F8CA 2JUCA 3MEXA 1G3TA 3ZQFA 3I64A 3KPHA 1S29A 3ECHA 2W00A 2GIVA 2HKOA 1BM9A 2H6BA 1XMAA 2CFXA 4ZTFA 4XLHA 3M1EA 4JOMA 2F5VA 3OS1A 4UUSA 1I27A 5DD8A 1YE9A 3JCUC 5TISC 4HV5A 4E6KG 4C2UA 1X1BA 4R1HA 1W36D 1BR1A 1GLNA 2Y31A 2LREA 4PFOA 1D5YA 2LFBA 3DLLF 3GTGJ 3RKXA 2DMUA 3F6OA 2LR8A 3PSIA 2LSOA 4C3HJ 4W1UA 3IL2A 3BPXA 4QWQA 3VFZA 3G73A 1PUFB 3HOTA 2X6YA 3HKZA 2ZNZA 1XCBA 2V6EA 2E60A 2KZVA 5EGOB 4XLEA 4UUVA 3BTJA 1BOAA 1MMNA 1MSEC 4PJNA 4I0BA 4R79A 2V79A 1WH5A 4HNVA 4IVNA 1W5TA 4PGGA 2YPRA 4IJAA 4ENMA 2CSOA 2GM4A 2XSDC 5K5OA 4B47A 5FD5A 4RGXA 4OIOF 4RAFA 2L02A 2ISZA 4ZZLA 3CDIA 4LLLA 2MGQA 5J6XA 3DKXA 2EIKH 3WG7H 4XRFA 4D0PA 2XROA 2YU3A 1FEXA 3GTMJ 2DQLA 3QYBA 1LKXA 3QQAA 4N4NB 4PK4A 1LFUP 1J9IA 4A3KJ 3MN2A 1ON2A 4LK0F 2DAOA 2OUMA 1BJAA 4HV6A 4CH7A 3QU3A 5EG0A 3GZNB 3J80K 2BEOA 4M9SA 2IGKA 3NRVA 2HGCA 1G3YA 5J4VA 3HC7A 4L5IA 4XRMA 1LE8A 4UNOA 2N8GA 4HW0A 4LLGF 3VYUB 3GTKJ 2DA3A 2L9VA 1JKRC 4BQQA 1MDMB 4UV9A 3FK6A 2ISYA 2R5YA 4U0VA 4BJ5C 4A5MA 1UHMA 3BTIA 5IOZA 3HRMA 2P4WA 2V1NA 2X4HA 2F48A 1E2XA 5FJ8J 4ZDPA 2L2OA 2A07F 4C9YA 1I6XA 2BXZA 3QWLA 2VBWA 2EZKA 4L9NA 2HKXA 2UUZA 2ZXJA 1Y8QB 1CQTA 4IX7A 2KIFA 3Q5FA 1R5GA 5DDGA 2OV7A 3RZDJ 3O8HA 4EJUA 5JHFA 2A5WA 4IQ4A 4AIKA 1HKSA 2HDWA 4PCQA 1MBFA 5FO5A 4EGYA 3OL3A 1XTAA 1WJCA 1GXQA 3OOUA 1APLC 1EV7A 1KZHA 3U21A 1SVMA 2K5CA 1VQ9I 2OJED 4PDKA 1DU6A 2WADA 4KT5C 2Q2EB 1V4RA 2B9SA 1T0FA 2DTRA 2J5OA 4G9YA 2FOKA 3PNVA 1TQMA 4G94A 3HTUA 1HW2A 3S93A 2L9SA 2HS5A 4ENKA 2VKEA 2A61A 2VC1A 4BQNA 4IOAF 1TWHJ 3S2DJ 2ADUA 1U5TA 2Y0SN 1YW9A 5JVGF 4HRIA 1ZHFA 5JLXA 4G6TB 3OYIA 5H2FC 2RNJA 2CJJA 2FJ1A 3CP2A 1OCRH 3AFHA 4LD5A 5HNFA 1PVEA 1WKMA 2XPWA 1WHUA 1S7AA 3BG9A 3M8JA 1IRZA 2WC2A 4MQ9F 4HDUA 2KKOA 3MCZA 4F92B 1XPXA 3WODF 1REPC 3O6BB 2P7VB 2F4IA 1K83J 1FT9A 3EDPA 3M9AA 4NQWA 3KYLA 1ETQA 2GBYA 4B48A 3CCUI 3S8PA 5IT3A 3IV5A 4MNUA 4R8HA 2TDXA 3V8JA 4GDFA 1ZGWA 2VBZA 2KISA 3GTLJ 5L3GA 1UFMA 3K4MA 1FPQA 1ZN2A 3KLNA 2Y0MA 4DGWB 4UB8C 4XLPF 1TT0A 1JXSA 4BE1A 3K4CA 2QWWA 1T39A 1BR4A 4LG3A 1K78A 3ZMTA 3OR2C 4CSWA 2FBHA 4LMYA 3OS0A 1RUOA 3KETA 2R0QC 3IH2A 4F7ZA 4JP0A 4RM3A 2LDUA 2VJ4A 1W0UA 2EK5A 4HPQA 1ETWA 3E6DA 3JRHA 2PMZN 5BMZA 2FBKA 2EZIA 3FXRA 3JTHA 2WY7Q 2LVSA 3TQNA 5IPAA 3H5RA 1K7AA 3HOWJ 2CU7A 3KE2A 1W7PA 2RQPA 1HW5A 4Y52J 4M73A 5D4RA 2XIGA 2PJRA 4BBRJ 2WWYA 2DMPA 4KIFA 4M3FA 3M7GA 4YIFA 2XB0X 3HOSA 3CUQC 4OOIA 2MYSA 2COMA 2DOFA 4EM0B 1RNLA 2ZBKA 4IPAA 4M6YA 1XSDA 2Z16A 2Z2SB 1H89C 4RMNA 2HDDA 2V1UA 1R7JA 1SAUA 2DA6A 3F22A 5B66C 4IQJA 1JT0A 5E1XA 4XKBA 1FLIA 3FXJA 3OR1C 1ZGAA 2K9MA 2CUJA 3EUHC 3GTJJ 3CF5F 2LKXA 1YJWI 4KN7X 2JA2A 3CO7C 2F5EA 1RIOH 2CQQA 1KQ0A 2V4JC 4RAYA 5K1YA 1KU9A 3QOPA 2AO9A 3ABTA 3BG6A 4QSHA 3F23A 1RRJA 4PGHA 3QPTA 1D0YA 4AYBN 1JT6A 4ANJA 1TWCJ 2Z33A 2WTEA 2VI6A 4CCMA 3CCQI 4DNCA 2M8EA 1CF7A 4V2FA 2XC7A 5FRNA 4KJZA 2RGVA 1D1BA 4U7DA 3ZPLA 2R7VA 2M87A 1XGMA 4ZJZA 4FX4A 3ZQHA 1T8IA 1UAAA 3ZR8X 2A6HF 2DA1A 2JA7J 1XC5A 1Z3XA 3GLLA 2VJIA 4YIRX 4Q48A 2VKHA 3ISPA 1U8RA 2G9WA 1V55H 4GGGA 2VL8A 2PI0A 2K3PA 1X2NA 1U8BA 1OR7C 4UB6C 1MMSA 1D8KA 2L5QA 4RGRA 1QA6A 2CQ7A 1D8JA 1MZBA 4J19A 1O57A 3BJ6A 2FRHA 3MZYA 2RDPA 3LSKA 2V9PA 2E1MC 5F08A 1QVUA 2DYSH 5LGTA 1H88C 1YQAA 1FBSA 2MABA 4HBLA 2QA4I 1OKRA 2H94A 4LFUA 2R7DA 1WQ2A 1LNWA 3IRQA 5C4XJ 2FMLA 1P6RA 2JWTA 4EV0A 2JQ7A 4HF2A 3WHCA 5BPDA 1K61A 2QEXI 3HSFA 2Y48A 4P5OA 2KRFA 1ZGJA 1YRNA 3TBIA 2VXZA 5J47A 1ONVA 2BW3B 4LGWA 3U1KA 5J1UA 2X6WA 3DEUA 5E3LA 1XSXA 1GHCA 2VJJA 3FISA 4DOZA 4L0YB 1H9TA 5EEGA 1VQ8I 3D5LA 5FFXA 3CJTB 5ILUA 3L2QA 1BI3A 3CLQA 2DT5A 3OYCA 3K70D 2VQHA 3ZQLA 4XBFA 3OIOA 1G4DA 3K0LA 4KA4A 1DPRA 1SD6A 1V5FA 3E5UA 3JSPA 3L2CA 4FTHA 1ORKA 1WJAA 4O5VA 1VF9A 2DT6A 3HPGA 4BY7J 4X1EA 5BQTA 3IKTA 2HOEA 3HYIA 5J3LA 4FQGA 1IJWC 3HOZJ 4Y4RA 1MJAA 2K40A 5HS9A 3S2WA 2RVCA 2ZKZA 4KUMA 5FRMA 2QF7A 3G71I 2FA5A 1HXDA 2QQ9A 3M8EA 2E5ZA 4UUSB 2Q1ZB 3M4OJ 2EQRA 3A2KA 2OTLI 3KP6A 4XKVA 4KISA 1OFCX 4F52A 3F8MA 2P8TA 3BDDA 1JJ6C 1BC7C 2GOXB 4BE0A 3DBHB 3DEEA 3DU6A 1QZEA 2HQ5A 4C2MJ 1XSVA 4A3IJ 2XGDA 4P1WA 3F8NA 2NAZA 2MH2A 2R7TA 3C2HA 2M5WA 1OCCH 1JI8A 5ERIA 3K1PA 4RAGA 4CO8A 3D1NI 2KIQA 1E0EA 1W4MA 4LB5A 4B3AA 2V1DA 1D0XA 2RNGA 3LQRA 3CUOA 3K6GA 2H1KA 3J7AO 2NOJB 3BZKA 2R7UA 4CZCA 5EYRA 4HAMA 3R60A 4S04A 3K10A 2E2HJ 2C6YA 1R36A 4AM3A 3KP5A 3OYEA 2KDZA 4RGSA 1ZRCA 2ID6A 2G7UA 3K2ZA 4C2TA 2NVTJ 3OY9A 3F21A 2KFDA 3I4NJ 1I1GA 4Y13A 2G0EA 5BPIA 3EETA 3OSFA 1WI9A 3P7NA 1QPIA 2NS7A 3H5AA 4WXHA 4J01A 5EG0B 2OAZA 1ZK8A 1YG2A 4CXFA 1RR7A 1ACIA 4ZC3A 5F1JA 5JR3A 1LE8B 3FX3A 2A6EF 2HU9A 3VOEA 1BA5A 2ZJRF 2LF8A 4A3CJ 2X51A 2XB5A 2LY1A 2LD5A 2FUG2 4CICA 3LA2A 1UJ8A 4F93B 3VDXA 4HYEA 5M3FJ 2HNHA 3ZCOA 4ETSA 3OYNA 3QPSA 2FEZA 4KFCA 3UNGC 4ESBA 3B6AA 4XLNF 2KMUA 1IW7F 3F9KA 5ED4A 1BN5A 4BEHA 1YIJI 4CDGA 2P7CB 4BJ6C 1R5HA 2VE8A 1OLTA 1ZYRF 3JSOA 3MQ0A 4L18B 4LG0A 5E8GA 3MZ8A 2VOPA 1A6QA 3HSRA 3I54A 1ZH5A 2ZNYA 2OD5A 4A5NA 4AIHA 5FGMA 2GXBA 3E3VA 2AQFA 3B73A 3HZJA 3A01A 1Z6RA 1KA8A 4GCVA 3I55I 3FXLA 1KQ8A 1RI7A 1FIAA 2DBBA 3ELKA 3MKZA 3LA3A 1RKTA 2E71A 1FOKA 1Y56A 5CVJA 3AG3H 4YFKF 3N05A 1OISA 1A36A 4Y33A 1BIAA 3DCFA 3KX2A 4IO9F 2A3SA 5K7FA 4ESJA 3BPVA 3HOXJ 1JHHA 2O0YA 1JTYA 2M30A 1AOYA 1WSUA 3A03A 5K7ZA 1USSA 1W0TA 2DTZA 3DU5A 3S1QJ 2CYYA 2LF7A 4E7ZA 4HNUA 2ESNA 1G3SA 4I98B 1KU7A 1D3YA 4YFXF 1TWAJ 4FCYA 2HXOA 4JX6A 4YFNF 3KEYA 4OWRB 2VT2A 2DPUA 2L7KA 3DKYA 5JVTA 3OYJA 3OYDA 1MJBA 3ZMVA 4CCJA 5M5YJ 3LSPA 5F0CA 3BR6A 3FKJA 2OCCH 2O7OA 5GPAA 1BI2A 2XF6A 1VNDA 2LTPA 2IP2A 5E3NA 2QSHX 2BY1A 2EV0A 5D5UB 1EA3A 3LMMA 4AIDA 5GADJ 2VQCA 3IP4B 4NQWB 2ACJA 2AS5F 3K4JA 2GXGA 1U9NA 2O8XA 4U0WA 3I53A 5DYMA 2RN7A 5IY5H 3LSMA 2NVUB 2DA7A 2LY9A 3TGNA 3TO7A 2BVLA 3JRGA 3S3MA 3I4MJ 3DV8A 4FE7A 2CUEA 4NC8A 1MNDA 2B0LA 1D1CA 2JJ7A 2XAHA 1GUUA 3W2VA 1K78B 1XDUA 3FXUA 1H8AC 1HW1A 5FLMJ 2VOOA 2JSPA 5J1RA 2UV1A 3RKYA 3SJMA 2QZ8A 3ROUA 2XKPA 4G8XA 4A0XA 4I99C 3GO5A 1DP7P 1QVTA 2R7ZJ 3CCJI 4BH9A 4Y7NJ 3JRAA 4RGUA 3S14J 2AHQA 3MKWB 2W1OA 4NNJA 1W7PB 3BJOA 3PNTA 5ICEA 2COBA 1ETXA 1JGGA 2LRDA 2DJIA 5DUKA 3MVPA 1B59A 1YTYA 2HYJA 3PUBA 5J1YA 4ITVA 2O9LA 3CMMA 2YR2A 4CYCA 3L2WA 2PJRB 3IHUA 4CGZA 2KZGA 2AQEA 3JAMK 3AL0B 1VQPI 4ZZDA 4L5EA 1QHHD 2ELKA 2ECCA 2X1CA 4BDZA 1YI2I 1HC8A 2EINH 4G7ZF 1P2FA 2W85A 9ANTA 1E17A 1XDSA 1IN8A 2D45A 4TV7A 1Z91A 1DP3A 4PUSA 2Y2ZA 2FX0A 1T33A 4BJTA 2HVQA 3CCMI 5F64A 1G3WA 1XCVA 3H3VK 1WJDA 1TNSA 1ZG3A 3MKYB 1ZG1A 3SFZA 4CCOA 1FMVA 3F8FA 1P92A 3WE3A 1MIJA 2OF7A 2IA0A 2F5CA 2QSFX 3UKGA 4HX8A 1J09A 2WA0A 3HRSA 5TRDA 2HEOA 2KQRA 4HX4A 2ZXHA 4M6VA 1OCPA 1K4SA 2ESHA 3CZ6A 2P6SA 5IP6A 1ENHA 5DUIA 5HLTA 3H3ZA 2BXYA 1B9NA 2IPQX 3WTZA 4OAZA 1EH8A 1O3TA 5LHGA 5M5WJ 4BHCA 2JSCA 1FYMA 1B6AA 1WJFA 4HDVA 4B3XA 2STTA 3GLXA 1O3SA 1LQ1A 4LLNA 3GTPJ 2L4MA 1R4NB 2YSRA 5CJ9A 3V4GA 1X19A 2K86A 1FTZA 1P4WA 4II2A 4B43A 1ETOA 2IA2A 2WV0A 3I3LA 3KYDB 3EPZA 1T0FC 2RV8A 3WTUC 4MQVA 3F72A 3Q9VA 3CCVI 1A35A 1GVDA 2BE5F 2DFHA 2J5PA 1UG2A 1VZ0A 3VYTB 1B72A 1G59A 3WGGA 4D7NA 1D0ZA 1DUXC 1JJ8C 2W4SA 3ABUA 1JUMA 4W97A 3J81Z 2LK2A 3GW2A 2FU4A 4EM1A 3BR3A 3FBIB 4P9UA 5LGNA 4XKWA 3Q9SA 3QODA 2GXAA 3Q0UA 1T98A 4Z6YA 4C3JJ 1YRNB 2OQGA 3S1NJ 4DJAA 1L3LA 5K5QA 2DK8A 2KIMA 4M3GA 5IP9J 3JRCA 1R00A 4D9JA 2KRCA 1HBXG 4V19K 2NRAC 2MG4A 3I71A 2BVMA 2L0KA 1P7JA 2L01A 4BDYA 4ENJA 3WTYC 4N9IA 1RESA 5FKLA 1PYVA 1TLHB 3ZMDA 1F1ZA 1U6GA 3RTRA 1QQIA 1TNTA 4IHVA 3J7AY 4EVIA 4HNTA 4KIBA 2DFIA 1B9MA 2DI3A 2WAQN 4YEJA 4HX7A 1B8IA 6PAXA 1TL8A 3OIQA 2ZFWA 4MHGA 3T5XA 1R6RA 2M45A 2QQ8A 1VQKI 5LHHA 3L09A 2OBPA 1JKQC 2HDCA 1FOYA 2K02A 3GTOJ 2IS6A 1V54H 2ETHA 4K2EA 1SFXA 2L4AA 3A0BC 2O6GE 5L3BA 1IAWA 2E35A 1S9HA 4FE4A 2LY2A 4X6AJ 2E1CA 4RB1A 2K7LA 4IHYA 2JRTA 2M2EA 2EFPA 2Z99A 4WX9A 1R58A 5DV5A 1T08B 2NXNB 2JA6J 2K4BA 3VYRB 2B7EA 1FJLA 2EFNA 3DKWA 3OV8A 1USTA 1UHWA 5DTDA 3HGYA 3KEQA 4LIVA 1RZ4A 3KYCB 3BR1A 1POGA 2ELHA 4XORA 3F0CA 2ELJA 1IDYA 2V7FA 2VUMJ 4C30A 2CQNA 1AKHB 1V3FA 2JZYA 5FLXZ 2Y30A 5FKOA 4IHTA 3PO3J 3CC2I 4HQMA 3SHFA 1C0WA 5J40A 3CDHA 1A31A 2VASA 4KMUX 5HLGA 2F2EA 1ON1A 3RQIA 1MD0A 4RB3C 3HUGA 2LOOA 4CCKA 2XAFA 2K9QA 3R61A 1FWZA 1UB9A 1MH4A 1R49A 1LPQA 5L3EA 2YX7A 4XNFA 2F5DA 3ZGKA 3T8RA 2GQQA 3DQVC
chains in the Genus database with same CATH topology
3DPTA 2MLKA 4KN4X 3E97A 4HQEA 3U9GA 2HZTA 2MA3A 2JTVA 2KIUA 3QU6A 2V9VA 1R23A 4O3MA 3JW4A 2CWEA 1LEBA 4P55A 1LEAA 5E17F 1ZRFA 5FFZA 1J2XA 5LGUA 4UVBA 2HR3A 5IT9K 3KLOA 4Z2YA 3BY6A 1S8NA 4LG0B 1FP1D 1QGPA 3I59A 3IC7A 1ZREA 3KFWX 3TDUC 3K1NA 1XGSA 4YIIA 4EMSA 4OMZA 4EJVA 5CVUA 3WTTC 4JBAA 4G6DA 1ZAOA 1J59A 2UXXA 4WCGA 3R0AA 1PDNC 3K69A 5ILVA 4GXOA 3GFMA 3ERED 3H92A 3GZ6A 4M74A 4I02A 3PQJA 3T8TA 4U7BA 1LDJA 4MEXF 2VC0A 2FQ3A 2NYXA 5E20A 1JHFA 4OIQF 1T2KA 3LSTA 4HF0A 3W6KB 3FF5A 1IF1A 3WU1B 1TQPA 5F1RA 4ASNA 4G6QA 5CVIA 3GVAA 1G6NA 3GFJA 4M72A 2LKPA 1F9NA 2HQRA 2OZ6A 1R22A 2P6TA 5J8CA 5KVRA 2STWA 4A0ZA 2VN2A 4BXUA 2K4JA 1O3RA 4Q4ZF 2W25A 4N0BA 3SZTA 2A69F 4CYDA 2PMHA 1IZ1A 5LRSA 4IRHA 3GFIA 3HHHA 3P9IA 5LEKA 3CLOA 5H6QA 3JTGA 3CUQA 2FSWA 3E6BA 2EA2A 2W84A 2XRNA 5E18F 1Z1DA 1VTNC 1B1BA 4ZH4F 3GEZA 1SD4A 5A2QZ 3FMQA 2DO7A 2M1BA 2EJRA 1XN7A 3EUHA 1YW8A 4HOBA 2XGXA 1ZLJA 2BBYA 4IHSA 4OU0A 3P9CA 2QBYA 1KU3A 3C7JA 1ULYA 2EFQA 3KCCA 4I09A 2AXLA 1IRGA 4AIJA 2DU9A 2PN6A 1IN6A 1XB4A 2HQNA 1SFUA 4AD9A 4L9TA 3I5UA 5BS6A 3C18A 4FHTA 1BI0A 4WXDA 5D5VB 2PBIA 1F5TA 4B09A 4FX0A 1RUNA 1OR7A 2H6CA 2QYOA 2H09A 3V8KA 4Y15A 1SD7A 5L3DA 2VBYA 5LHIA 1JE8A 4BNCA 1TQIA 3L7WA 3KP2A 1S7OA 1P4XA 1XGOA 2PEXA 3L9FA 2YX4A 3HSEA 4ZYDA 4BQAA 4ESFA 2XAQA 1PUEE 4FT8A 2MH9A 1T38A 3TKYA 2HWVA 2EV5A 1O3QA 4A6EA 3DFGA 2BYVE 3LFKA 2A68F 1TW3A 3J80Z 5E1ZB 2XAJA 5LLQA 3AAFA 2E7WA 4LB6B 1FY7A 5DEQA 1IN5A 2XKOA 3IKVA 2EA4A 1K79A 2UWMA 3U2RA 1SFEA 3CTAA 1KYWA 2NNYA 2EWNA 3C3WA 1R1VA 2FBIA 1W7PD 1SD5A 2D1VA 1U5TB 1FBUA 5E8IA 4OIRF 1WRJA 1IRFA 5H20A 2P5LC 3RI4A 2VODA 4BHBA 5FB2A 1PP8F 3W6JB 3E5QA 3ZN1A 1KU2A 2GAUA 4M71A 2XAGA 3IWZA 2Y75A 5JFRA 3OOPA 2CW0F 1OYWA 3HIFA 1QZYA 2R7FA 3H3UA 3IRRA 4IRIA 4U0YA 4YG2F 3I4PA 3MWMA 2QQAA 3WTXC 2E7XA 1EH6A 2FXAA 4IRGA 3BJAA 2P5KA 1KQ9A 5HOOA 1HKQA 1I5ZA 5TJJA 5HDKA 2HTJA 5L3CA 1U3EM 1LVAA 4A6DA 1J75A 3KP3A 4OINF 5CLSA 4BYYA 4KNYA 1XD7A 4HA8A 1NHAA 1LB2A 3FZVA 2A5YB 3I59B 5D8KB 1ZRDA 2Z5UA 4LJZF 3LAJA 1STZA 3E5XA 4A12A 3K9TA 5FD6A 2UZKA 1U2WA 4P9FA 3REOA 1OYYA 2XHKA 3DPLC 3DF8A 4M9XA 2PMUA 4NB5A 2D1HA 1FYKA 2OZUA 4HLYA 2UXNA 3I58A 3TO9A 3LAPA 4JK1X 3KZZA 3ZMZA 1CF7B 5D5XB 2CQKA 2W24A 4ZYEA 1IXSB 2FNPA 3WTWC 1YIOA 2QVOA 4EJWA 2HYFA 3IWFA 1AWCA 4S05A 2QLZA 3PFIA 3FXQA 4A2UA 1IUYA 4EGZA 2CO5A 3RIRA 2DQRA 2DPDA 5HDGA 2FE3A 5LEJA 4ON0A 5HVQC 2JT1A 1O7FA 3M8FA 4HLXA 3RKWA 5ILSA 3SQNA 1ZLKA 1LJ9A 1U5TC 1U78A 4RAZA 1BI1A 3LQQA 1MJ9A 4M6XA 5DD4A 2R3SA 4CZZA 3GUDA 2QENA 1XGNA 3N97A 1T6SA 2KJCA 4M9ZA 2ZMEA 5JHUA 4H0EA 3CUQB 5HS8A 4UHTA 3SXYA 4OIPF 1KYZA 1HKTA 3F6VA 4B8XA 1QPMA 2XASA 2MBFA 3GF2A 3RPUA 2JPCA 1Z9CA 5AIPA 3ULQB 3PQKA 1YW7A 1Z7UA 4L9JA 2W57A 1HQCA 1O7LA 2QUFA 3ML6A 1SMYF 1YYVA 2QBYB 4XSXF 2PFBA 1L0OC 2GWRA 1S3JA 1LDDA 2Z3YA 2MC3A 3LWFA 3WE2A 5LRRA 4EJTA 3I0TA 3V7SA 2EFOA 3VODA 1GVJA 2RKHA 1W5SA 3QP6A 1LDKB 1QZZA 2XUBA 3P9KA 2PQ8A 3KEOA 1XMKA 2IJLA 3KP4A 1B4AA 3G3ZA 3BWGA 1J0RA 2IVMA 1X3UA 5HS7A 3RYPA 4CHUA 1TBXA 5D6FA 3LA7A 3TO6A 5HLHA 4MTDA 2IRFG 4A0YA 4O6JA 2JPBA 2XV4S 3HTSB 4UV8A 5KK1A 4NHJA 5AIQA 2FMYA 4KMFA 3CJNA 4G7OF 2FF4A 1J5YA 2GA1A 3C1DA 3KZYA 1BIBA 1F4KA 4E70A 3VB2A 4EM2A 4KDPA 1ODDA 2VONA 1ZARA 3L00A 1FNNA 1K6OA 3R6SA 2IA1A 4LK1F 2BV6A 1ZG5A 5HDNA 4Q47A 1QO0D 2OA4A 1WWXA 4WXCA 3QPHA 1JGSA 5AONA 4WWCA 5E1WA 3HHGA 5LBQA 2CGPA 3V7CA 3ZMSA 5JI6A 5DCMA 4I0AA 1EH7A 2NNNA 3N4MA 2HTSA 2OQRA 3FM3A 4MGRA 5EEHA 1CGPA 2H27A 2P5VA 2GZWA 3DP7A 4RS8A 2IW5A 3B02A 4HF1A 1Z6TA 5CVRA 3ECOA 4UVCA 2O3FA 5D5WB 3GZ5A 1UCRA 3QAHA 1FYLA 3ZN0A 3MFKA 2QQBA 4GYIA 5CYVA 1A04A 3ZQ7A 1YFHA 2E1NA 1HSJA 1KGSA 4BAYA 2NS0A 3GFLA 2EFWA 3J81K 2EV6A 1J7KA 3CO6C 4IXAA 4UVAA 2K27A 5CVVA 4WK8F 1OMIA 1Y0UA 1H0MA 3R4KA 3KP7A 1H9GA 3EYIA 2PJPA 2ZJ2A 5ICGA 1TTYA 4I2OA 1IN4A 5BOXA 4BHPA 1IXCA 4AVPA 3QRFF 4UXNA 2O61A 4EJOA 1DPUA 5HLIA 1S6LA 2X0LA 3WGIA 5H6RA 1MDMA 4ENNA 3JAMZ 4U88A 3BOQA 2V6CA 4MEYF 2D2WA 4OMYA 1FX7A 3FWEA 3TOBA 1GXPA 1YO5C 1DDNA 2PG4A 1FBQA 3T1BA 4ZYHA 4L9VA 5FLXK 3NEUA 5D8LB 3GX4X 2V1XA 2Z9OA 3MZHA 1FP2A 5ICFA 2Q2EA 4KYWA 4WF2A 3FHZA 2ZO4A 3RDIA 3F8BA 2CG4A 4JQFA 3TOAA 2IT0A 4I7HA 4Y17A 3O2PE 3D0SA 1FSHA 2G7HA 1R1UA 2VT3A 2LNBA 1SAXA 3RYRA 4EQQA 3GYHX 2ZMEB 1SMTA 1BBYA 1P4AA 2L54A 2MLGA 2QM3A 3VEPA 1TW2A 3HRUA 4MTEA 5DCFA 4PZJA 4N9HA 2MD5A 3BZ6A 3O3KA 1BC8C 3K1MA 4L5JA 4KIGA 5J8FA 1I1SA 3HRTA 4GO1A 2ZCWA 2BGCA 3F3XA 2KJBA 1IN7A 3WTSC 3WG9A 1YLFA 2Q0OA 3SZPA 1HSTA 3BP8A 3RJPA 3E6CC 3V7RA 4QLCU 4KICA 3COAC 1YS7A 2GA2A 4IF4A 3U1DA 4AWXB 5L3FA 2DK5A 2EB7A 4RB0A 2DLLA 3V8LA 1OYIA 5ICCA 1MKMA 1OPCA 1D5VA 3FMSA 3WGHA 1MGTA 3R0JA 2PLYA 3DXJF 4G7HF 2HFHA 5D4SA 2F5FA 4ZYGA 2L3DA 3RPQA 5D6EA 1PP7U 1Z05A 1IXRC 5K5RA 4I01A 2O03A 2DW4A 3FMRA 4RB2C 2Q8KA 3EYYA 4Q5SF 3T0YA 3BROA 4HZFA 2VBXA 2VE9A 3WU0A 3ZMUA 4L0ZB 4XSZF 3QP5A 3EQLF 5F6FA 1FC3A 1QNTA 5A2QK 1YS6A 5IT9Z 1Q1HA 1R1TA 3E6MA 3WTVC 4P96A 3GWZA 2OU2A 3TDZC 3GXOA 3ZP5A 2RC4A 3MAJA 4DQ2A 5DCMB 2FNAA 1QBJA 4GYGA 1FSEA 1FZPB 2HYGD 3NQOA 3FM5A 2XVCA 3F8CA 3MEXA 1G3TA 3I64A 1S29A 3ECHA 2GIVA 2HKOA 1BM9A 2H6BA 1XMAA 2CFXA 3M1EA 1I27A 5DD8A 4HV5A 4R1HA 3RKXA 3F6OA 2LSOA 3IL2A 3BPXA 4QWQA 3VFZA 3G73A 3HOTA 2ZNZA 1XCBA 4UUVA 1BOAA 4I0BA 4R79A 2V79A 4IVNA 1W5TA 4PGGA 2YPRA 4IJAA 4ENMA 2CSOA 5K5OA 5FD5A 4RGXA 4OIOF 2L02A 2ISZA 4ZZLA 4LLLA 5J6XA 2XROA 4XRFA 4D0PA 2YU3A 2DQLA 1J9IA 1ON2A 4LK0F 2DAOA 1BJAA 4HV6A 3QU3A 3J80K 2BEOA 4M9SA 3NRVA 2HGCA 1G3YA 4L5IA 4UNOA 4HW0A 4LLGF 1MDMB 4UV9A 2ISYA 4U0VA 4A5MA 1UHMA 3HRMA 2P4WA 2X4HA 1E2XA 2A07F 1I6XA 4L9NA 2VBWA 2HKXA 2ZXJA 2KIFA 3Q5FA 1R5GA 5DDGA 4EJUA 4AIKA 1HKSA 4PCQA 5FO5A 4EGYA 1GXQA 1EV7A 4PDKA 4KT5C 1V4RA 1T0FA 2DTRA 2J5OA 4G9YA 2FOKA 1TQMA 4G94A 3HTUA 1HW2A 2HS5A 4ENKA 2A61A 2VC1A 2ADUA 1U5TA 1YW9A 1ZHFA 2RNJA 4LD5A 1WKMA 1S7AA 2WC2A 4MQ9F 4HDUA 2KKOA 3MCZA 3WODF 1REPC 3O6BB 2P7VB 1FT9A 3EDPA 3M9AA 4NQWA 5IT3A 4MNUA 4R8HA 2TDXA 3V8JA 2VBZA 5L3GA 1UFMA 1FPQA 1ZN2A 3KLNA 2Y0MA 4XLPF 1JXSA 2QWWA 1T39A 1K78A 3ZMTA 2FBHA 4LMYA 1RUOA 3KETA 4F7ZA 2LDUA 2EK5A 3E6DA 5BMZA 2FBKA 3FXRA 3JTHA 3TQNA 1K7AA 3KE2A 1W7PA 2RQPA 1HW5A 4M73A 5D4RA 2XIGA 2WWYA 4KIFA 3M7GA 4YIFA 3HOSA 3CUQC 4OOIA 2COMA 4EM0B 1RNLA 2ZBKA 4IPAA 4M6YA 1XSDA 2V1UA 1R7JA 3F22A 5E1XA 1FLIA 1ZGAA 4KN7X 3CO7C 2F5EA 1RIOH 4RAYA 1KQ0A 5K1YA 1KU9A 3QOPA 3ABTA 3F23A 4PGHA 3QPTA 2Z33A 2WTEA 4DNCA 2M8EA 1CF7A 2RGVA 4U7DA 3ZPLA 2M87A 1XGMA 4FX4A 2A6HF 4Q48A 3ISPA 1U8RA 2G9WA 4GGGA 2PI0A 1D8KA 4RGRA 1D8JA 1MZBA 1O57A 3BJ6A 2FRHA 3MZYA 2RDPA 5LGTA 1YQAA 1FBSA 4HBLA 1OKRA 2H94A 4LFUA 2R7DA 1WQ2A 1LNWA 3IRQA 2FMLA 1P6RA 4EV0A 4HF2A 5BPDA 3HSFA 2Y48A 4P5OA 2KRFA 1ZGJA 2VXZA 1ONVA 4LGWA 3DEUA 1XSXA 1GHCA 4L0YB 1H9TA 5EEGA 3D5LA 5FFXA 5ILUA 1BI3A 2DT5A 1G4DA 4XBFA 3K0LA 4KA4A 1DPRA 1SD6A 3E5UA 3JSPA 3L2CA 4O5VA 5BQTA 3IKTA 2HOEA 3HYIA 1MJAA 5HS9A 3S2WA 2RVCA 2ZKZA 4KUMA 2FA5A 1HXDA 2QQ9A 3M8EA 3KP6A 3F8MA 2P8TA 3BDDA 1BC7C 1XSVA 3F8NA 2NAZA 2MH2A 2M5WA 5ERIA 3K1PA 4CO8A 1W4MA 4LB5A 2V1DA 3LQRA 3CUOA 3J7AO 4HAMA 3R60A 4S04A 2C6YA 1R36A 3KP5A 4RGSA 1ZRCA 2G7UA 3K2ZA 3F21A 1I1GA 4Y13A 5BPIA 3EETA 1WI9A 3P7NA 4WXHA 2OAZA 1YG2A 4CXFA 5JR3A 3FX3A 2A6EF 3VOEA 2LF8A 4CICA 3LA2A 4HYEA 4ETSA 2FEZA 4KFCA 4ESBA 4XLNF 1IW7F 5ED4A 1BN5A 2P7CB 4CDGA 1R5HA 2VE8A 1ZYRF 3JSOA 3MQ0A 4L18B 4LG0A 5E8GA 2VOPA 3I54A 3HSRA 1ZH5A 2ZNYA 2OD5A 4A5NA 4AIHA 5FGMA 2GXBA 3E3VA 3B73A 1Z6RA 1KA8A 4GCVA 1KQ8A 1RI7A 2DBBA 3ELKA 3LA3A 1FOKA 5CVJA 4YFKF 1BIAA 2A3SA 4ESJA 3BPVA 1JHHA 2O0YA 2M30A 1AOYA 1WSUA 1USSA 2CYYA 2LF7A 2ESNA 1G3SA 4I98B 1KU7A 1D3YA 4YFXF 4YFNF 2VT2A 2DPUA 5JVTA 1MJBA 3ZMVA 1BI2A 2IP2A 2EV0A 5D5UB 2ACJA 2AS5F 2GXGA 2O8XA 4U0WA 3I53A 5DYMA 2RN7A 3TGNA 3TO7A 3DV8A 2B0LA 2XAHA 1K78B 1XDUA 3FXUA 1HW1A 2VOOA 3RKYA 2QZ8A 3ROUA 2XKPA 4G8XA 4A0XA 3GO5A 1DP7P 4BH9A 4RGUA 1W7PB 3BJOA 5ICEA 5DUKA 1B59A 1YTYA 2YR2A 3IHUA 4CGZA 3JAMK 4ZZDA 4G7ZF 1P2FA 2W85A 1E17A 1XDSA 1IN8A 2D45A 4TV7A 1Z91A 5F64A 1G3WA 1XCVA 1TNSA 1ZG3A 1ZG1A 3SFZA 3F8FA 1P92A 3WE3A 2IA0A 2F5CA 4HX8A 3HRSA 5TRDA 2HEOA 4HX4A 2ESHA 2P6SA 5DUIA 3H3ZA 1B9NA 2IPQX 3WTZA 1EH8A 1O3TA 5LHGA 4BHCA 2JSCA 1FYMA 1B6AA 4HDVA 2STTA 3GLXA 1O3SA 1LQ1A 4LLNA 2L4MA 2YSRA 5CJ9A 3V4GA 2K86A 1P4WA 2IA2A 2WV0A 2RV8A 3WTUC 4MQVA 3F72A 3Q9VA 2BE5F 2J5PA 3WGGA 1DUXC 3ABUA 3J81Z 3GW2A 2FU4A 4EM1A 4P9UA 5LGNA 3Q9SA 1T98A 2OQGA 1L3LA 5K5QA 2DK8A 2KIMA 1R00A 1HBXG 2NRAC 3I71A 4ENJA 2L01A 3WTYC 4N9IA 1TLHB 3ZMDA 1F1ZA 1U6GA 3RTRA 1QQIA 1TNTA 4EVIA 4KIBA 2DFIA 1B9MA 2DI3A 4HX7A 6PAXA 3T5XA 2ZFWA 4MHGA 2M45A 5LHHA 3L09A 2OBPA 2HDCA 2K02A 2ETHA 4K2EA 1SFXA 2L4AA 2O6GE 5L3BA 1IAWA 2E1CA 4RB1A 2K7LA 2JRTA 2EFPA 2Z99A 4WX9A 1R58A 5DV5A 2K4BA 2EFNA 3DKWA 3OV8A 1USTA 1UHWA 3KEQA 1RZ4A 2ELHA 1V3FA 2JZYA 5FLXZ 4IHTA 4HQMA 3SHFA 1C0WA 3CDHA 4KMUX 5HLGA 2F2EA 1ON1A 1MD0A 4RB3C 3HUGA 2XAFA 3R61A 1FWZA 1UB9A 5L3EA 2YX7A 2F5DA 3T8RA 2GQQA 3DQVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPT A;  2MLK A;  4KN4 X;  3E97 A;  4HQE A;  3U9G A;  2HZT A;  2MA3 A;  2JTV A;  2KIU A;  3QU6 A;  2V9V A;  1R23 A;  4O3M A;  3JW4 A;  2CWE A;  1LEB A;  4P55 A;  1LEA A;  5E17 F;  1ZRF A;  5FFZ A;  1J2X A;  5LGU A;  4UVB A;  2HR3 A;  5IT9 K;  3KLO A;  4Z2Y A;  3BY6 A;  1S8N A;  4LG0 B;  1FP1 D;  1QGP A;  3I59 A;  3IC7 A;  1ZRE A;  3KFW X;  3TDU C;  3K1N A;  1XGS A;  4YII A;  4EMS A;  4OMZ A;  4EJV A;  5CVU A;  3WTT C;  4JBA A;  4G6D A;  1ZAO A;  1J59 A;  2UXX A;  4WCG A;  3R0A A;  1PDN C;  3K69 A;  5ILV A;  4GXO A;  3GFM A;  3ERE D;  3H92 A;  3GZ6 A;  4M74 A;  4I02 A;  3PQJ A;  3T8T A;  4U7B A;  1LDJ A;  4MEX F;  2VC0 A;  2FQ3 A;  2NYX A;  5E20 A;  1JHF A;  4OIQ F;  1T2K A;  3LST A;  4HF0 A;  3W6K B;  3FF5 A;  1IF1 A;  3WU1 B;  1TQP A;  5F1R A;  4ASN A;  4G6Q A;  5CVI A;  3GVA A;  1G6N A;  3GFJ A;  4M72 A;  2LKP A;  1F9N A;  2HQR A;  2OZ6 A;  1R22 A;  2P6T A;  5J8C A;  5KVR A;  2STW A;  4A0Z A;  2VN2 A;  4BXU A;  2K4J A;  1O3R A;  4Q4Z F;  2W25 A;  4N0B A;  3SZT A;  2A69 F;  4CYD A;  2PMH A;  1IZ1 A;  5LRS A;  4IRH A;  3GFI A;  3HHH A;  3P9I A;  5LEK A;  3CLO A;  5H6Q A;  3JTG A;  3CUQ A;  2FSW A;  3E6B A;  2EA2 A;  2W84 A;  2XRN A;  5E18 F;  1Z1D A;  1VTN C;  1B1B A;  4ZH4 F;  3GEZ A;  1SD4 A;  5A2Q Z;  3FMQ A;  2DO7 A;  2M1B A;  2EJR A;  1XN7 A;  3EUH A;  1YW8 A;  4HOB A;  2XGX A;  1ZLJ A;  2BBY A;  4IHS A;  4OU0 A;  3P9C A;  2QBY A;  1KU3 A;  3C7J A;  1ULY A;  2EFQ A;  3KCC A;  4I09 A;  2AXL A;  1IRG A;  4AIJ A;  2DU9 A;  2PN6 A;  1IN6 A;  1XB4 A;  2HQN A;  1SFU A;  4AD9 A;  4L9T A;  3I5U A;  5BS6 A;  3C18 A;  4FHT A;  1BI0 A;  4WXD A;  5D5V B;  2PBI A;  1F5T A;  4B09 A;  4FX0 A;  1RUN A;  1OR7 A;  2H6C A;  2QYO A;  2H09 A;  3V8K A;  4Y15 A;  1SD7 A;  5L3D A;  2VBY A;  5LHI A;  1JE8 A;  4BNC A;  1TQI A;  3L7W A;  3KP2 A;  1S7O A;  1P4X A;  1XGO A;  2PEX A;  3L9F A;  2YX4 A;  3HSE A;  4ZYD A;  4BQA A;  4ESF A;  2XAQ A;  1PUE E;  4FT8 A;  2MH9 A;  1T38 A;  3TKY A;  2HWV A;  2EV5 A;  1O3Q A;  4A6E A;  3DFG A;  2BYV E;  3LFK A;  2A68 F;  1TW3 A;  3J80 Z;  5E1Z B;  2XAJ A;  5LLQ A;  3AAF A;  2E7W A;  4LB6 B;  1FY7 A;  5DEQ A;  1IN5 A;  2XKO A;  3IKV A;  2EA4 A;  1K79 A;  2UWM A;  3U2R A;  1SFE A;  3CTA A;  1KYW A;  2NNY A;  2EWN A;  3C3W A;  1R1V A;  2FBI A;  1W7P D;  1SD5 A;  2D1V A;  1U5T B;  1FBU A;  5E8I A;  4OIR F;  1WRJ A;  1IRF A;  5H20 A;  2P5L C;  3RI4 A;  2VOD A;  4BHB A;  5FB2 A;  1PP8 F;  3W6J B;  3E5Q A;  3ZN1 A;  1KU2 A;  2GAU A;  4M71 A;  2XAG A;  3IWZ A;  2Y75 A;  5JFR A;  3OOP A;  2CW0 F;  1OYW A;  3HIF A;  1QZY A;  2R7F A;  3H3U A;  3IRR A;  4IRI A;  4U0Y A;  4YG2 F;  3I4P A;  3MWM A;  2QQA A;  3WTX C;  2E7X A;  1EH6 A;  2FXA A;  4IRG A;  3BJA A;  2P5K A;  1KQ9 A;  5HOO A;  1HKQ A;  1I5Z A;  5TJJ A;  5HDK A;  2HTJ A;  5L3C A;  1U3E M;  1LVA A;  4A6D A;  1J75 A;  3KP3 A;  4OIN F;  5CLS A;  4BYY A;  4KNY A;  1XD7 A;  4HA8 A;  1NHA A;  1LB2 A;  3FZV A;  2A5Y B;  3I59 B;  5D8K B;  1ZRD A;  2Z5U A;  4LJZ F;  3LAJ A;  1STZ A;  3E5X A;  4A12 A;  3K9T A;  5FD6 A;  2UZK A;  1U2W A;  4P9F A;  3REO A;  1OYY A;  2XHK A;  3DPL C;  3DF8 A;  4M9X A;  2PMU A;  4NB5 A;  2D1H A;  1FYK A;  2OZU A;  4HLY A;  2UXN A;  3I58 A;  3TO9 A;  3LAP A;  4JK1 X;  3KZZ A;  3ZMZ A;  1CF7 B;  5D5X B;  2CQK A;  2W24 A;  4ZYE A;  1IXS B;  2FNP A;  3WTW C;  1YIO A;  2QVO A;  4EJW A;  2HYF A;  3IWF A;  1AWC A;  4S05 A;  2QLZ A;  3PFI A;  3FXQ A;  4A2U A;  1IUY A;  4EGZ A;  2CO5 A;  3RIR A;  2DQR A;  2DPD A;  5HDG A;  2FE3 A;  5LEJ A;  4ON0 A;  5HVQ C;  2JT1 A;  1O7F A;  3M8F A;  4HLX A;  3RKW A;  5ILS A;  3SQN A;  1ZLK A;  1LJ9 A;  1U5T C;  1U78 A;  4RAZ A;  1BI1 A;  3LQQ A;  1MJ9 A;  4M6X A;  5DD4 A;  2R3S A;  4CZZ A;  3GUD A;  2QEN A;  1XGN A;  3N97 A;  1T6S A;  2KJC A;  4M9Z A;  2ZME A;  5JHU A;  4H0E A;  3CUQ B;  5HS8 A;  4UHT A;  3SXY A;  4OIP F;  1KYZ A;  1HKT A;  3F6V A;  4B8X A;  1QPM A;  2XAS A;  2MBF A;  3GF2 A;  3RPU A;  2JPC A;  1Z9C A;  5AIP A;  3ULQ B;  3PQK A;  1YW7 A;  1Z7U A;  4L9J A;  2W57 A;  1HQC A;  1O7L A;  2QUF A;  3ML6 A;  1SMY F;  1YYV A;  2QBY B;  4XSX F;  2PFB A;  1L0O C;  2GWR A;  1S3J A;  1LDD A;  2Z3Y A;  2MC3 A;  3LWF A;  3WE2 A;  5LRR A;  4EJT A;  3I0T A;  3V7S A;  2EFO A;  3VOD A;  1GVJ A;  2RKH A;  1W5S A;  3QP6 A;  1LDK B;  1QZZ A;  2XUB A;  3P9K A;  2PQ8 A;  3KEO A;  1XMK A;  2IJL A;  3KP4 A;  1B4A A;  3G3Z A;  3BWG A;  1J0R A;  2IVM A;  1X3U A;  5HS7 A;  3RYP A;  4CHU A;  1TBX A;  5D6F A;  3LA7 A;  3TO6 A;  5HLH A;  4MTD A;  2IRF G;  4A0Y A;  4O6J A;  2JPB A;  2XV4 S;  3HTS B;  4UV8 A;  5KK1 A;  4NHJ A;  5AIQ A;  2FMY A;  4KMF A;  3CJN A;  4G7O F;  2FF4 A;  1J5Y A;  2GA1 A;  3C1D A;  3KZY A;  1BIB A;  1F4K A;  4E70 A;  3VB2 A;  4EM2 A;  4KDP A;  1ODD A;  2VON A;  1ZAR A;  3L00 A;  1FNN A;  1K6O A;  3R6S A;  2IA1 A;  4LK1 F;  2BV6 A;  1ZG5 A;  5HDN A;  4Q47 A;  1QO0 D;  2OA4 A;  1WWX A;  4WXC A;  3QPH A;  1JGS A;  5AON A;  4WWC A;  5E1W A;  3HHG A;  5LBQ A;  2CGP A;  3V7C A;  3ZMS A;  5JI6 A;  5DCM A;  4I0A A;  1EH7 A;  2NNN A;  3N4M A;  2HTS A;  2OQR A;  3FM3 A;  4MGR A;  5EEH A;  1CGP A;  2H27 A;  2P5V A;  2GZW A;  3DP7 A;  4RS8 A;  2IW5 A;  3B02 A;  4HF1 A;  1Z6T A;  5CVR A;  3ECO A;  4UVC A;  2O3F A;  5D5W B;  3GZ5 A;  1UCR A;  3QAH A;  1FYL A;  3ZN0 A;  3MFK A;  2QQB A;  4GYI A;  5CYV A;  1A04 A;  3ZQ7 A;  1YFH A;  2E1N A;  1HSJ A;  1KGS A;  4BAY A;  2NS0 A;  3GFL A;  2EFW A;  3J81 K;  2EV6 A;  1J7K A;  3CO6 C;  4IXA A;  4UVA A;  2K27 A;  5CVV A;  4WK8 F;  1OMI A;  1Y0U A;  1H0M A;  3R4K A;  3KP7 A;  1H9G A;  3EYI A;  2PJP A;  2ZJ2 A;  5ICG A;  1TTY A;  4I2O A;  1IN4 A;  5BOX A;  4BHP A;  1IXC A;  4AVP A;  3QRF F;  4UXN A;  2O61 A;  4EJO A;  1DPU A;  5HLI A;  1S6L A;  2X0L A;  3WGI A;  5H6R A;  1MDM A;  4ENN A;  3JAM Z;  4U88 A;  3BOQ A;  2V6C A;  4MEY F;  2D2W A;  4OMY A;  1FX7 A;  3FWE A;  3TOB A;  1GXP A;  1YO5 C;  1DDN A;  2PG4 A;  1FBQ A;  3T1B A;  4ZYH A;  4L9V A;  5FLX K;  3NEU A;  5D8L B;  3GX4 X;  2V1X A;  2Z9O A;  3MZH A;  1FP2 A;  5ICF A;  2Q2E A;  4KYW A;  4WF2 A;  3FHZ A;  2ZO4 A;  3RDI A;  3F8B A;  2CG4 A;  4JQF A;  3TOA A;  2IT0 A;  4I7H A;  4Y17 A;  3O2P E;  3D0S A;  1FSH A;  2G7H A;  1R1U A;  2VT3 A;  2LNB A;  1SAX A;  3RYR A;  4EQQ A;  3GYH X;  2ZME B;  1SMT A;  1BBY A;  1P4A A;  2L54 A;  2MLG A;  2QM3 A;  3VEP A;  1TW2 A;  3HRU A;  4MTE A;  5DCF A;  4PZJ A;  4N9H A;  2MD5 A;  3BZ6 A;  3O3K A;  1BC8 C;  3K1M A;  4L5J A;  4KIG A;  5J8F A;  1I1S A;  3HRT A;  4GO1 A;  2ZCW A;  2BGC A;  3F3X A;  2KJB A;  1IN7 A;  3WTS C;  3WG9 A;  1YLF A;  2Q0O A;  3SZP A;  1HST A;  3BP8 A;  3RJP A;  3E6C C;  3V7R A;  4QLC U;  4KIC A;  3COA C;  1YS7 A;  2GA2 A;  4IF4 A;  3U1D A;  4AWX B;  5L3F A;  2DK5 A;  2EB7 A;  4RB0 A;  2DLL A;  3V8L A;  1OYI A;  5ICC A;  1MKM A;  1OPC A;  1D5V A;  3FMS A;  3WGH A;  1MGT A;  3R0J A;  2PLY A;  3DXJ F;  4G7H F;  2HFH A;  5D4S A;  2F5F A;  4ZYG A;  2L3D A;  3RPQ A;  5D6E A;  1PP7 U;  1Z05 A;  1IXR C;  5K5R A;  4I01 A;  2O03 A;  2DW4 A;  3FMR A;  4RB2 C;  2Q8K A;  3EYY A;  4Q5S F;  3T0Y A;  3BRO A;  4HZF A;  2VBX A;  2VE9 A;  3WU0 A;  3ZMU A;  4L0Z B;  4XSZ F;  3QP5 A;  3EQL F;  5F6F A;  1FC3 A;  1QNT A;  5A2Q K;  1YS6 A;  5IT9 Z;  1Q1H A;  1R1T A;  3E6M A;  3WTV C;  4P96 A;  3GWZ A;  2OU2 A;  3TDZ C;  3GXO A;  3ZP5 A;  2RC4 A;  3MAJ A;  4DQ2 A;  5DCM B;  2FNA A;  1QBJ A;  4GYG A;  1FSE A;  1FZP B;  2HYG D;  3NQO A;  3FM5 A;  2XVC A;  3F8C A;  3MEX A;  1G3T A;  3I64 A;  1S29 A;  3ECH A;  2GIV A;  2HKO A;  1BM9 A;  2H6B A;  1XMA A;  2CFX A;  3M1E A;  1I27 A;  5DD8 A;  4HV5 A;  4R1H A;  3RKX A;  3F6O A;  2LSO A;  3IL2 A;  3BPX A;  4QWQ A;  3VFZ A;  3G73 A;  3HOT A;  2ZNZ A;  1XCB A;  4UUV A;  1BOA A;  4I0B A;  4R79 A;  2V79 A;  4IVN A;  1W5T A;  4PGG A;  2YPR A;  4IJA A;  4ENM A;  2CSO A;  5K5O A;  5FD5 A;  4RGX A;  4OIO F;  2L02 A;  2ISZ A;  4ZZL A;  4LLL A;  5J6X A;  2XRO A;  4XRF A;  4D0P A;  2YU3 A;  2DQL A;  1J9I A;  1ON2 A;  4LK0 F;  2DAO A;  1BJA A;  4HV6 A;  3QU3 A;  3J80 K;  2BEO A;  4M9S A;  3NRV A;  2HGC A;  1G3Y A;  4L5I A;  4UNO A;  4HW0 A;  4LLG F;  1MDM B;  4UV9 A;  2ISY A;  4U0V A;  4A5M A;  1UHM A;  3HRM A;  2P4W A;  2X4H A;  1E2X A;  2A07 F;  1I6X A;  4L9N A;  2VBW A;  2HKX A;  2ZXJ A;  2KIF A;  3Q5F A;  1R5G A;  5DDG A;  4EJU A;  4AIK A;  1HKS A;  4PCQ A;  5FO5 A;  4EGY A;  1GXQ A;  1EV7 A;  4PDK A;  4KT5 C;  1V4R A;  1T0F A;  2DTR A;  2J5O A;  4G9Y A;  2FOK A;  1TQM A;  4G94 A;  3HTU A;  1HW2 A;  2HS5 A;  4ENK A;  2A61 A;  2VC1 A;  2ADU A;  1U5T A;  1YW9 A;  1ZHF A;  2RNJ A;  4LD5 A;  1WKM A;  1S7A A;  2WC2 A;  4MQ9 F;  4HDU A;  2KKO A;  3MCZ A;  3WOD F;  1REP C;  3O6B B;  2P7V B;  1FT9 A;  3EDP A;  3M9A A;  4NQW A;  5IT3 A;  4MNU A;  4R8H A;  2TDX A;  3V8J A;  2VBZ A;  5L3G A;  1UFM A;  1FPQ A;  1ZN2 A;  3KLN A;  2Y0M A;  4XLP F;  1JXS A;  2QWW A;  1T39 A;  1K78 A;  3ZMT A;  2FBH A;  4LMY A;  1RUO A;  3KET A;  4F7Z A;  2LDU A;  2EK5 A;  3E6D A;  5BMZ A;  2FBK A;  3FXR A;  3JTH A;  3TQN A;  1K7A A;  3KE2 A;  1W7P A;  2RQP A;  1HW5 A;  4M73 A;  5D4R A;  2XIG A;  2WWY A;  4KIF A;  3M7G A;  4YIF A;  3HOS A;  3CUQ C;  4OOI A;  2COM A;  4EM0 B;  1RNL A;  2ZBK A;  4IPA A;  4M6Y A;  1XSD A;  2V1U A;  1R7J A;  3F22 A;  5E1X A;  1FLI A;  1ZGA A;  4KN7 X;  3CO7 C;  2F5E A;  1RIO H;  4RAY A;  1KQ0 A;  5K1Y A;  1KU9 A;  3QOP A;  3ABT A;  3F23 A;  4PGH A;  3QPT A;  2Z33 A;  2WTE A;  4DNC A;  2M8E A;  1CF7 A;  2RGV A;  4U7D A;  3ZPL A;  2M87 A;  1XGM A;  4FX4 A;  2A6H F;  4Q48 A;  3ISP A;  1U8R A;  2G9W A;  4GGG A;  2PI0 A;  1D8K A;  4RGR A;  1D8J A;  1MZB A;  1O57 A;  3BJ6 A;  2FRH A;  3MZY A;  2RDP A;  5LGT A;  1YQA A;  1FBS A;  4HBL A;  1OKR A;  2H94 A;  4LFU A;  2R7D A;  1WQ2 A;  1LNW A;  3IRQ A;  2FML A;  1P6R A;  4EV0 A;  4HF2 A;  5BPD A;  3HSF A;  2Y48 A;  4P5O A;  2KRF A;  1ZGJ A;  2VXZ A;  1ONV A;  4LGW A;  3DEU A;  1XSX A;  1GHC A;  4L0Y B;  1H9T A;  5EEG A;  3D5L A;  5FFX A;  5ILU A;  1BI3 A;  2DT5 A;  1G4D A;  4XBF A;  3K0L A;  4KA4 A;  1DPR A;  1SD6 A;  3E5U A;  3JSP A;  3L2C A;  4O5V A;  5BQT A;  3IKT A;  2HOE A;  3HYI A;  1MJA A;  5HS9 A;  3S2W A;  2RVC A;  2ZKZ A;  4KUM A;  2FA5 A;  1HXD A;  2QQ9 A;  3M8E A;  3KP6 A;  3F8M A;  2P8T A;  3BDD A;  1BC7 C;  1XSV A;  3F8N A;  2NAZ A;  2MH2 A;  2M5W A;  5ERI A;  3K1P A;  4CO8 A;  1W4M A;  4LB5 A;  2V1D A;  3LQR A;  3CUO A;  3J7A O;  4HAM A;  3R60 A;  4S04 A;  2C6Y A;  1R36 A;  3KP5 A;  4RGS A;  1ZRC A;  2G7U A;  3K2Z A;  3F21 A;  1I1G A;  4Y13 A;  5BPI A;  3EET A;  1WI9 A;  3P7N A;  4WXH A;  2OAZ A;  1YG2 A;  4CXF A;  5JR3 A;  3FX3 A;  2A6E F;  3VOE A;  2LF8 A;  4CIC A;  3LA2 A;  4HYE A;  4ETS A;  2FEZ A;  4KFC A;  4ESB A;  4XLN F;  1IW7 F;  5ED4 A;  1BN5 A;  2P7C B;  4CDG A;  1R5H A;  2VE8 A;  1ZYR F;  3JSO A;  3MQ0 A;  4L18 B;  4LG0 A;  5E8G A;  2VOP A;  3I54 A;  3HSR A;  1ZH5 A;  2ZNY A;  2OD5 A;  4A5N A;  4AIH A;  5FGM A;  2GXB A;  3E3V A;  3B73 A;  1Z6R A;  1KA8 A;  4GCV A;  1KQ8 A;  1RI7 A;  2DBB A;  3ELK A;  3LA3 A;  1FOK A;  5CVJ A;  4YFK F;  1BIA A;  2A3S A;  4ESJ A;  3BPV A;  1JHH A;  2O0Y A;  2M30 A;  1AOY A;  1WSU A;  1USS A;  2CYY A;  2LF7 A;  2ESN A;  1G3S A;  4I98 B;  1KU7 A;  1D3Y A;  4YFX F;  4YFN F;  2VT2 A;  2DPU A;  5JVT A;  1MJB A;  3ZMV A;  1BI2 A;  2IP2 A;  2EV0 A;  5D5U B;  2ACJ A;  2AS5 F;  2GXG A;  2O8X A;  4U0W A;  3I53 A;  5DYM A;  2RN7 A;  3TGN A;  3TO7 A;  3DV8 A;  2B0L A;  2XAH A;  1K78 B;  1XDU A;  3FXU A;  1HW1 A;  2VOO A;  3RKY A;  2QZ8 A;  3ROU A;  2XKP A;  4G8X A;  4A0X A;  3GO5 A;  1DP7 P;  4BH9 A;  4RGU A;  1W7P B;  3BJO A;  5ICE A;  5DUK A;  1B59 A;  1YTY A;  2YR2 A;  3IHU A;  4CGZ A;  3JAM K;  4ZZD A;  4G7Z F;  1P2F A;  2W85 A;  1E17 A;  1XDS A;  1IN8 A;  2D45 A;  4TV7 A;  1Z91 A;  5F64 A;  1G3W A;  1XCV A;  1TNS A;  1ZG3 A;  1ZG1 A;  3SFZ A;  3F8F A;  1P92 A;  3WE3 A;  2IA0 A;  2F5C A;  4HX8 A;  3HRS A;  5TRD A;  2HEO A;  4HX4 A;  2ESH A;  2P6S A;  5DUI A;  3H3Z A;  1B9N A;  2IPQ X;  3WTZ A;  1EH8 A;  1O3T A;  5LHG A;  4BHC A;  2JSC A;  1FYM A;  1B6A A;  4HDV A;  2STT A;  3GLX A;  1O3S A;  1LQ1 A;  4LLN A;  2L4M A;  2YSR A;  5CJ9 A;  3V4G A;  2K86 A;  1P4W A;  2IA2 A;  2WV0 A;  2RV8 A;  3WTU C;  4MQV A;  3F72 A;  3Q9V A;  2BE5 F;  2J5P A;  3WGG A;  1DUX C;  3ABU A;  3J81 Z;  3GW2 A;  2FU4 A;  4EM1 A;  4P9U A;  5LGN A;  3Q9S A;  1T98 A;  2OQG A;  1L3L A;  5K5Q A;  2DK8 A;  2KIM A;  1R00 A;  1HBX G;  2NRA C;  3I71 A;  4ENJ A;  2L01 A;  3WTY C;  4N9I A;  1TLH B;  3ZMD A;  1F1Z A;  1U6G A;  3RTR A;  1QQI A;  1TNT A;  4EVI A;  4KIB A;  2DFI A;  1B9M A;  2DI3 A;  4HX7 A;  6PAX A;  3T5X A;  2ZFW A;  4MHG A;  2M45 A;  5LHH A;  3L09 A;  2OBP A;  2HDC A;  2K02 A;  2ETH A;  4K2E A;  1SFX A;  2L4A A;  2O6G E;  5L3B A;  1IAW A;  2E1C A;  4RB1 A;  2K7L A;  2JRT A;  2EFP A;  2Z99 A;  4WX9 A;  1R58 A;  5DV5 A;  2K4B A;  2EFN A;  3DKW A;  3OV8 A;  1UST A;  1UHW A;  3KEQ A;  1RZ4 A;  2ELH A;  1V3F A;  2JZY A;  5FLX Z;  4IHT A;  4HQM A;  3SHF A;  1C0W A;  3CDH A;  4KMU X;  5HLG A;  2F2E A;  1ON1 A;  1MD0 A;  4RB3 C;  3HUG A;  2XAF A;  3R61 A;  1FWZ A;  1UB9 A;  5L3E A;  2YX7 A;  2F5D A;  3T8R A;  2GQQ A;  3DQV C; 
#chains in the Genus database with same CATH topology
 3DPT A;  4QPQ A;  2QKM B;  2MLK A;  5EEA A;  4LIU A;  4KN4 X;  3E97 A;  2MSY A;  4HQE A;  5EDN A;  2IS2 A;  2MW8 A;  3U9G A;  2HZT A;  2MA3 A;  3PL8 A;  3K4L A;  4PJ0 C;  5E3M A;  2JTV A;  2KIU A;  2OPT A;  2V9V A;  3QU6 A;  1R23 A;  4O3M A;  3JW4 A;  2CWE A;  3BLY A;  1LEB A;  4P55 A;  1LEA A;  5E17 F;  3G1L A;  3OL4 A;  4CCL A;  3CES A;  3K4B A;  4E7K A;  1ZRF A;  5FFZ A;  4RA2 A;  1J2X A;  2KPM A;  5LGU A;  2HI3 A;  4UVB A;  2HR3 A;  1ETY A;  2H1L A;  5IT9 K;  3KLO A;  4Z2Y A;  3BY6 A;  1S8N A;  2NVQ J;  2Y0S A;  3LNQ A;  4LG0 B;  1FP1 D;  1QGP A;  3FBN B;  3I59 A;  3HGG A;  2DA2 A;  3QPL A;  4S0H B;  3IC7 A;  5DM6 F;  3DBL B;  1ZRE A;  3KFW X;  3TDU C;  1E3H A;  3K1N A;  1XGS A;  3BCA A;  4YII A;  4EMS A;  3A01 B;  4OMZ A;  4EJV A;  5CVU A;  3BCB A;  4IHW A;  3C2G A;  3DLA A;  3WTT C;  1MBH A;  4JBA A;  3JRB A;  3S15 J;  4G6D A;  4B1R A;  1FMW A;  4GFB A;  3WU2 C;  1ZAO A;  3A4C A;  1J59 A;  4HSR A;  2UXX A;  4WCG A;  3R0A A;  2H8W A;  1PDN C;  1I6H J;  3K69 A;  5ILV A;  4GXO A;  3S16 J;  4G12 A;  3GFM A;  3ERE D;  5LD2 C;  1G2H A;  4NUB A;  1Q1V A;  2EPF A;  3H92 A;  3Q0W A;  3GZ6 A;  4M74 A;  4I02 A;  3PQJ A;  3T8T A;  4U7B A;  1LDJ A;  4XR6 A;  4MEX F;  3Q3S A;  3SZG A;  2E36 A;  2VC0 A;  2FQ3 A;  2LBF A;  2RQQ A;  2NYX A;  4BXX J;  5E20 A;  3CJQ B;  1JHF A;  3CC7 I;  2HZD A;  4OIQ F;  1T2K A;  2CV0 A;  3LST A;  2FOW A;  2IAI A;  3CCS I;  2PMZ A;  3PSF A;  4MFD A;  4MFE A;  4HF0 A;  3W6K B;  3FF5 A;  4HG2 A;  1IF1 A;  3WU1 B;  1TQP A;  2CQX A;  5F1R A;  4ASN A;  4G6Q A;  5CVI A;  3GVA A;  2LG4 A;  4JYK A;  5IYC J;  1G6N A;  2ZSI B;  3GFJ A;  4M72 A;  1F43 A;  4IHX A;  2LKP A;  4YEL A;  1F9N A;  2HQR A;  2OZ6 A;  1R22 A;  4QIW N;  2P6T A;  1Z7L A;  2X1D A;  3BG3 A;  1BOB A;  1BW6 A;  5J8C A;  1LFB A;  5KVR A;  1PUF A;  2STW A;  1VQN I;  1JKP C;  4A0Z A;  2VN2 A;  3BC8 A;  4BXU A;  2JA5 J;  1VQ6 I;  3LSG A;  2K4J A;  3FXO A;  2MC4 A;  1WH7 A;  1JUS A;  1E3O C;  3B6C A;  1O3R A;  3ZQG A;  4Q4Z F;  2W25 A;  4N0B A;  3BT9 A;  3SZT A;  3ZQI A;  1LFP A;  3BTC A;  1M1E B;  2BY3 A;  2A69 F;  4AC0 A;  4CYC B;  4CYD A;  2PMH A;  1NG7 A;  3RQ4 A;  4AYB A;  1IZ1 A;  3HDD A;  5EF6 A;  3IAS 2;  4IRH A;  3ZXS A;  5LRS A;  1WZ2 A;  4PJM A;  3S1M J;  3GFI A;  5KAF C;  1TT5 B;  3HHH A;  3P9I A;  5LEK A;  3CLO A;  5H6Q A;  3JTG A;  3CUQ A;  2M8G X;  2W48 A;  2FSW A;  3E6B A;  5DM7 F;  2EA2 A;  4BE2 A;  2DMT A;  2W84 A;  2XRN A;  3H0G J;  3PFY A;  5E18 F;  1Z1D A;  1VTN C;  1B1B A;  1KON A;  3W2W A;  4ZH4 F;  3GEZ A;  1SD4 A;  3PIP F;  5A2Q Z;  3JRD A;  2EIJ H;  1QU3 A;  3FMQ A;  2DO7 A;  2M1B A;  2EJR A;  1XN7 A;  3RPU D;  3EUH A;  1YW8 A;  3BG5 A;  2QKL B;  4HOB A;  1LVK A;  4BAC A;  2XGX A;  4ZYA A;  1ZLJ A;  2BBY A;  1R4M B;  4BXF A;  4IHS A;  1ETK A;  4OU0 A;  3P9C A;  3TMO A;  2QBY A;  3ERM A;  1KU3 A;  3C7J A;  3HOY J;  1ULY A;  2EFQ A;  3KCC A;  2GIZ A;  5GAG J;  4I09 A;  2AXL A;  1IRG A;  5CQE A;  1TZL A;  4XN0 A;  3DTI A;  4AIJ A;  1MH3 A;  2DU9 A;  4XQF A;  3PNY A;  2CFO A;  2JA8 J;  2PX9 A;  3G6E I;  2PN6 A;  1IN6 A;  1XB4 A;  1K6Y A;  2HQN A;  1SFU A;  1OQY A;  4XRS A;  4AD9 A;  4XK4 A;  4L9T A;  3I5U A;  4A3D J;  1XG1 A;  5BS6 A;  3C18 A;  4FHT A;  1BI0 A;  4WXD A;  4A3F J;  1OCO H;  1AA7 A;  5D5V B;  3LSI A;  3L2U A;  2PBI A;  1F5T A;  4B09 A;  4FX0 A;  1RUN A;  1MMG A;  1OR7 A;  5EJC A;  2H6C A;  2QYO A;  2LKS A;  2RRE A;  1Z67 A;  1NH3 A;  2H09 A;  3V8K A;  4Y15 A;  1NK3 P;  1SD7 A;  5L3D A;  1ZTR A;  1ZR2 A;  1B72 B;  2VBY A;  2VQG A;  5LHI A;  1JE8 A;  4HEA 2;  4BNC A;  2CW8 A;  2WB1 A;  3NAR A;  4DYC A;  1LUJ B;  1TQI A;  3L7W A;  3VSK A;  2I8D A;  3KP2 A;  2DCE A;  5IYD J;  1S7O A;  1P4X A;  3LSR A;  3A0H C;  1XGO A;  2PEX A;  3L9F A;  1Z77 A;  1WJE A;  2E34 A;  4IOC F;  2CW7 A;  2YX4 A;  4XOT A;  3HSE A;  4ZYD A;  3PIO F;  4BQA A;  4ESF A;  2XAQ A;  1PUE E;  3HJE A;  4UUT A;  4FT8 A;  3OYL A;  2MH9 A;  1EJ9 A;  3ONQ A;  1HF0 A;  4X0G A;  4A3M J;  2R5Y B;  1T38 A;  2Y69 H;  2EH3 A;  2HWV A;  3TKY A;  2EV5 A;  2P81 A;  1RKW A;  3BTL A;  5F0F A;  1O3Q A;  2XSJ C;  1V5G A;  3NWT A;  4A6E A;  4IEJ A;  3DFG A;  2BYV E;  2R7R A;  3LFK A;  4DYR A;  2A68 F;  2E2J J;  3CC4 I;  3ABK H;  1B8I B;  2X6X A;  1YIT I;  1IO2 A;  1TW3 A;  4PJL A;  2L9N A;  5E1Z B;  3J80 Z;  3VWB A;  1D1A A;  2XAJ A;  5LLQ A;  3AAF A;  2VLA A;  3LL7 A;  2E7W A;  4LB6 B;  1FY7 A;  5DEQ A;  4A3L J;  1IN5 A;  2B63 J;  4D5C A;  2ZXW H;  3K4N A;  4XOP A;  2XKO A;  3IKV A;  2EA4 A;  1K79 A;  2UWM A;  3G1O A;  3U2R A;  1SFE A;  2M34 A;  3CTA A;  1KYW A;  2NNY A;  2VIX A;  2HXI A;  2DT7 B;  2EWN A;  2ZJP F;  3C3W A;  1R1V A;  2DN0 A;  2CUZ A;  2FBI A;  1W7P D;  4FET A;  3H35 A;  5GTH C;  1WI3 A;  2K3F A;  1SD5 A;  2D1V A;  4N4O B;  2JN6 A;  2KLO A;  3OYK A;  2WBM A;  3W2A A;  1U5T B;  3JRE A;  4A3E J;  1FBU A;  5E8I A;  4OIR F;  1WRJ A;  4AVZ A;  1IRF A;  5H20 A;  2P5L C;  2EZH A;  1IGN A;  3RI4 A;  2M7A A;  3DEW A;  4BHB A;  2VOD A;  5FB2 A;  2JVG A;  1PP8 F;  3W6J B;  3E5Q A;  3ZN1 A;  2KDO A;  2JK3 A;  1KU2 A;  2GAU A;  4M71 A;  2XAG A;  4RM2 A;  5E79 C;  3K2A A;  3IWZ A;  2Y75 A;  5JFR A;  3OOP A;  2CW0 F;  3ABL H;  2EBI A;  3S3N A;  1OYW A;  3HIF A;  1QZY A;  4CCN A;  2BHY A;  2R7F A;  3E0J B;  3SEQ A;  3S17 J;  4YRV A;  3H3U A;  4A3B J;  3LSH A;  3FXM A;  3IRR A;  4D5F A;  3AG1 H;  2I10 A;  4IRI A;  4E7S A;  1WJ5 A;  1HDP A;  1VQO I;  3EUK L;  1IUF A;  4U0Y A;  4YG2 F;  2KRH A;  4XLC A;  5GPC A;  3I4P A;  3MWM A;  2QQA A;  4BQO A;  3WTX C;  3BR0 A;  2E7X A;  1EH6 A;  2FXA A;  5GAH J;  3DTE A;  3BJA A;  4IRG A;  2P5K A;  4ZTJ A;  1TC3 C;  1KQ9 A;  5B1B H;  4DZP A;  1VQ4 I;  3HOV J;  4PJJ A;  5HOO A;  1HKQ A;  1I5Z A;  5TJJ A;  4U87 A;  5HDK A;  2HTJ A;  5L3C A;  1IC8 A;  1U3E M;  3HEF A;  1LVA A;  4A6D A;  1J75 A;  4ZDO A;  3KP3 A;  4OIN F;  5CLS A;  2KHM A;  2X85 A;  4BYY A;  1VQ7 I;  4KNY A;  1XD7 A;  2ZB9 A;  2ID3 A;  2CV2 A;  1I39 A;  2AXT C;  1NTC A;  4BU2 A;  3OYB A;  5FKK A;  4HA8 A;  1NHA A;  1LB2 A;  4QPO A;  1VQL I;  3FZV A;  1MSF C;  2A5Y B;  3I59 B;  4BKX A;  1TWG J;  2DMN A;  5D8K B;  2M4K A;  1ZRD A;  1NK2 P;  2ZFU A;  1Y0N A;  2Z5U A;  5KHD A;  2DYR H;  4LJZ F;  3LAJ A;  1STZ A;  2VPL A;  3VPR A;  2CRG A;  3E5X A;  4A12 A;  3GME A;  1R5I D;  3K9T A;  5FD6 A;  3NAU A;  3MD2 A;  4I76 A;  1U0J A;  2UZK A;  1U2W A;  3ASN H;  3S32 A;  1YJ9 I;  2QCO A;  3KIO A;  3CCL I;  4P9F A;  2LLK A;  3REO A;  3MMY B;  2H8R A;  2DJN A;  1OYY A;  3HKZ N;  4XKC A;  3HM5 A;  4MIM A;  2XHK A;  3H36 A;  3DPL C;  2XPV A;  3DF8 A;  4BGD A;  4M9X A;  2PMU A;  4NB5 A;  1JKO C;  2D1H A;  4DZJ A;  1FYK A;  4JX4 A;  1FTT A;  1XX5 A;  1BL0 A;  2LMD A;  2OZU A;  3ZQQ A;  4HLY A;  1Z3Y A;  1OCT C;  2IGO A;  2UXN A;  5B5E C;  3I58 A;  5TGT A;  4ABZ A;  3TO9 A;  3TL4 X;  1HA8 A;  4BL0 B;  3IAM 2;  3OYA A;  3LAP A;  3H9G A;  4JK1 X;  4MO7 A;  3KZZ A;  3RSN A;  3ZMZ A;  1CF7 B;  5D5X B;  2CQK A;  2W24 A;  4ZYE A;  4XIC A;  1IXS B;  2FNP A;  3WTW C;  1YIO A;  2QVO A;  4EJW A;  4F91 B;  2DXI A;  1O4X A;  2IS1 A;  2X6O A;  4XID A;  2HYF A;  2OTJ I;  3IWF A;  1AWC A;  2VKV A;  4S05 A;  2JVH A;  2QLZ A;  3PFI A;  3FXQ A;  5FKM A;  4A2U A;  2ICW G;  3CP8 A;  2Y9Y A;  4XMY A;  1IUY A;  4EGZ A;  4FIS A;  2CO5 A;  2HOA A;  3RIR A;  1X1A A;  2A6T A;  2DQR A;  5CPR B;  1MBK A;  2DPD A;  5EZG A;  5HDG A;  2FE3 A;  5LEJ A;  2L7F P;  4ON0 A;  1K4T A;  3MKL A;  1X3Z B;  5HVQ C;  2JT1 A;  1O7F A;  3M8F A;  1ZR4 A;  2XF7 A;  4HLX A;  1X1C A;  3RKW A;  1GDT A;  5ILS A;  3SQN A;  3ZOB A;  2KL4 A;  1ZLK A;  3RCO A;  1P9Q C;  1LJ9 A;  1U5T C;  3FXK A;  1VFC A;  1U78 A;  4MLO A;  3FHN A;  4DBQ A;  4RAZ A;  1MMD A;  1BI1 A;  3LQQ A;  1MJ9 A;  4M6X A;  2WY8 Q;  4JX5 A;  5DD4 A;  2R3S A;  4CZZ A;  3GUD A;  2QEN A;  1XGN A;  3N97 A;  1T6S A;  2KJC A;  3P5J A;  2VKD A;  3LFU A;  4M9Z A;  2ZME A;  1T95 A;  4ZDL A;  3CD6 I;  2HPI A;  1I3A A;  2ZSH B;  2TCT A;  5JHU A;  4H0E A;  3CUQ B;  5FLV A;  3HG9 A;  4AU7 A;  5HS8 A;  5C3E J;  4UHT A;  3SXY A;  3JR9 A;  4OIP F;  3G2B A;  1KYZ A;  4M3B A;  3SDB A;  5J4Y A;  1HKT A;  3F6V A;  4B8X A;  4RDU A;  4BBS J;  1QPM A;  2XAS A;  5GAE J;  2MBF A;  3GF2 A;  2P0W A;  2DDB A;  3RPU A;  2JPC A;  1Z9C A;  5AIP A;  3ULQ B;  3PQK A;  4NC6 A;  1YW7 A;  1Z7U A;  2WV1 A;  2JRM A;  2I5U A;  1X3W B;  3OYF A;  4L9J A;  4EEF G;  2W57 A;  1HQC A;  1N78 A;  1DGR M;  1X1D A;  3KZI C;  3FDY A;  1O7L A;  2QUF A;  4DW6 A;  3ML6 A;  2K9S A;  1SMY F;  1YYV A;  2QBY B;  4XSX F;  2DOD A;  4C3I J;  2PFB A;  1L0O C;  2GWR A;  5GTI C;  1ITY A;  2M9H A;  2MD0 A;  4QTR A;  3OYG A;  1S3J A;  1LDD A;  4A93 J;  2Z3Y A;  2MC3 A;  2R5Z A;  3LWF A;  3WE2 A;  4UY8 I;  5C44 J;  3Q0V A;  5LRR A;  1Z21 A;  3AL0 C;  1PJR A;  1EF4 A;  4EJT A;  3DTK A;  3I0T A;  3V7S A;  2EFO A;  3VOD A;  2CS3 A;  2XF5 A;  1GVJ A;  2NVX J;  1SAN A;  2RKH A;  1W5S A;  3QP6 A;  1LDK B;  1QZZ A;  3K7A J;  2XUB A;  3P9K A;  2PQ8 A;  3KEO A;  2QGU A;  2K9L A;  1XMK A;  2IJL A;  3KP4 A;  1B4A A;  4RLF A;  1GV2 A;  3G3Z A;  3BWG A;  1J0R A;  2IVM A;  2E1M B;  1X3U A;  4II3 A;  2WAQ A;  5HS7 A;  3RYP A;  1SEU A;  4CHU A;  1TBX A;  2X9D A;  2HQA A;  3LA7 A;  5D6F A;  3SFI A;  3TO6 A;  5HLH A;  2NS8 A;  4MTD A;  2IRF G;  3A1Y A;  2M0M A;  4A0Y A;  3CJR B;  4BS9 A;  4O6J A;  3L2V A;  2JPB A;  5CKT A;  4E7J A;  3ASO H;  2XPU A;  2XV4 S;  3HOU J;  3HTS B;  4UV8 A;  3QOE A;  1T56 A;  4OAY A;  5KK1 A;  4CA0 A;  1WPK A;  1MW7 A;  4NHJ A;  4XLA A;  2M3A A;  4IL6 C;  5AIQ A;  3DWL E;  2FMY A;  1OJL A;  4KMF A;  3OWT A;  2W82 A;  3TP0 A;  2IEK A;  1U9O A;  1YHQ I;  2V26 A;  3CJN A;  4G7O F;  3I9V 2;  5KCM A;  1Y6I A;  2FF4 A;  5M3M J;  1QHG A;  1J5Y A;  3NWS A;  2GA1 A;  1Y8R B;  3C1D A;  3KZY A;  1BIB A;  2IS4 A;  1F4K A;  4IZZ A;  4E70 A;  3VB2 A;  2EIM H;  1XS9 A;  4EM2 A;  2VQL A;  4BEH B;  1WJB A;  3FIW A;  2WAF A;  4KDP A;  1R9T J;  1ODD A;  2VON A;  1ZAR A;  3L00 A;  2ECB A;  4XL9 A;  2MFZ A;  3D5S C;  4LIT A;  2EIL H;  1FNN A;  4A3J J;  3LSJ A;  2M4G A;  1K6O A;  3R6S A;  1IDZ A;  5IP7 J;  2R92 J;  2IA1 A;  4KT6 A;  4LK1 F;  2BV6 A;  3X2Q H;  3BR2 A;  1AU7 A;  1ZG5 A;  5HDN A;  4Q47 A;  1QO0 D;  3EUA A;  2E1O A;  1RC9 A;  2OA4 A;  1BW5 A;  1WWX A;  3OIP A;  4WXC A;  3IUO A;  3HB9 A;  1JGS A;  3QPH A;  5AON A;  3IH3 A;  4WWC A;  3I56 I;  2CH0 A;  1GV5 A;  5BNG A;  5E1W A;  3BR5 A;  4BUP A;  3HHG A;  5LBQ A;  2CGP A;  3V7C A;  3ZMS A;  1X58 A;  5JI6 A;  4CUG A;  5DCM A;  4I0A A;  4XLF A;  3BZC A;  2JMW A;  1EH7 A;  2NNN A;  3N4M A;  1Y39 A;  2HTS A;  2OQR A;  3FM3 A;  4NC7 A;  3K4K A;  5F04 A;  4MGR A;  4B4C A;  5EEH A;  1CGP A;  2H27 A;  1WCM J;  2P5V A;  1UMQ A;  2GZW A;  4E7H A;  3DP7 A;  2OC6 A;  4RS8 A;  1ERD A;  2IW5 A;  3SDG A;  1FOW A;  3B02 A;  4HF1 A;  1Z6T A;  5E3O A;  5CVR A;  4I6Z A;  3ECO A;  4UVC A;  2O3F A;  2VB6 A;  5IOY A;  5K7H A;  5D5W B;  3GZ5 A;  5C4J J;  1W36 C;  4DBR A;  1UCR A;  3OYM A;  3QAH A;  3CMY A;  1FYL A;  3ZN0 A;  4PSX A;  2JUG A;  3MFK A;  3PJR A;  2L7Z A;  2QQB A;  4GYI A;  5CYV A;  1A04 A;  1MMA A;  3ZQ7 A;  1YFH A;  1RET A;  2E1N A;  1HSJ A;  4F55 A;  1KGS A;  5EZH A;  1R71 A;  1YX5 A;  2WAE A;  2IXS A;  4BAY A;  2NS0 A;  3GFL A;  2EFW A;  3UR3 C;  2GOM A;  3PO2 J;  3J81 K;  1A6I A;  1UEL B;  1J7K A;  2EV6 A;  2IGN A;  3V42 A;  1QRY A;  2ZJQ F;  1HOM A;  3CO6 C;  1SVO A;  2NVY J;  2VPR A;  4IXA A;  5DS9 A;  4UVA A;  2K27 A;  5CVV A;  5EGO A;  5IYB J;  4WK8 F;  3ZRG A;  1OMI A;  2M7B A;  2XGE A;  1FOX A;  1Y0U A;  5GP9 A;  1H0M A;  3R4K A;  3KP7 A;  1H9G A;  3H0D A;  3EYI A;  3M3Y J;  3RKQ A;  1ZEL A;  4HST A;  4IKF A;  3GCM A;  5JLW A;  1Y1V J;  3LOC A;  2PJP A;  1VI0 A;  2ZJ2 A;  5ICG A;  2KT0 A;  3G1M A;  1UG0 A;  1IV8 A;  3A02 A;  1TTY A;  1G8X A;  4I2O A;  4PSW A;  1OCZ H;  1IN4 A;  5BOX A;  1MBG A;  4BHP A;  3W3C A;  1IXC A;  4AVP A;  5CQG A;  1MBE A;  3QRF F;  4UXN A;  2O61 A;  4EJO A;  1W5C C;  2NOG A;  3CF2 A;  2O5R A;  1DPU A;  2DOA A;  1HDD C;  5HLI A;  4D7M A;  1S6L A;  2R7X A;  4E4H A;  2X0L A;  2DMQ A;  3SYT A;  3WGI A;  1SFO J;  2F4O B;  2XRL A;  3AG4 H;  1VQM I;  5H6R A;  2ZXI A;  1SFK A;  1MDM A;  4ENN A;  2R7Q A;  4KIT B;  4FAS D;  4M3D A;  5HNH A;  3JAM Z;  2L7M P;  1S7E A;  4U88 A;  3DPU A;  3BOQ A;  3GBG A;  2V6C A;  4MEY F;  2YUS A;  2D2W A;  1SC7 A;  2WB1 N;  4OMY A;  5FRO A;  1FX7 A;  2HVS A;  4DIQ A;  3H9J A;  3JRF A;  1ZKG A;  3FWE A;  3OMY A;  1V5E A;  3TOB A;  2R4G A;  2R7O A;  4XM3 A;  1GXP A;  2F6C A;  1YO5 C;  1DDN A;  2PG4 A;  4D1Q A;  2RAE A;  1RR8 C;  1FBQ A;  4XN3 A;  3T1B A;  4ZYH A;  3L1P A;  3FKI J;  4L9V A;  1N25 A;  5FLX K;  3L2R A;  3NEU A;  4B44 A;  3OYH A;  3TED A;  1E3P A;  1SVL A;  5B1A H;  5D8L B;  3GX4 X;  2V1X A;  2Z9O A;  2LH9 A;  1DQU A;  3HXL A;  3MZH A;  1N75 A;  5LFA A;  3W6V A;  1FP2 A;  5ICF A;  4LOC A;  2Q2E A;  2DA5 A;  2BY2 A;  3WHB A;  2R7W A;  4KYW A;  2DA4 A;  4WF2 A;  3FHZ A;  2ZO4 A;  3RDI A;  4E7L A;  3F8B A;  2CG4 A;  2CMP A;  3JRI A;  4F3Q A;  3H9Q A;  2FQ4 A;  4JQF A;  3CMA I;  3TOA A;  2IT0 A;  4I7H A;  4Y17 A;  3J7Z I;  1ETV A;  3O2P E;  3D0S A;  1FSH A;  1WVR A;  3HBL A;  1YJN I;  2G7H A;  1R1U A;  2VT3 A;  2O8K A;  1AKH A;  3M07 A;  1GT0 C;  2DOE A;  2A05 A;  3CCR I;  5F27 A;  2LC2 A;  2LNB A;  2KP6 A;  2LYC A;  1SAX A;  4NDL A;  3RYR A;  4RBO A;  2BY0 A;  1JUP A;  4EQQ A;  3GYH X;  2ZME B;  3PM1 A;  4EAT A;  3O8G A;  2YS9 A;  2OCE A;  1A5J A;  1SMT A;  2BHZ A;  1BBY A;  1P4A A;  2L54 A;  2MLG A;  3AG2 H;  2V9K A;  4A3G J;  2QM3 A;  5B3S H;  3H1C A;  3VEP A;  1TW2 A;  3AKZ A;  2DFF A;  1IRX A;  3HRU A;  4MTE A;  4RLQ A;  5DCF A;  4NBQ A;  4Y3O A;  5KAI C;  2E2I J;  1X4P A;  1YOV B;  5KNL A;  4PZJ A;  4M3E A;  2IGM A;  1AHD P;  4N9H A;  1I3Q J;  1UZC A;  3IH4 A;  1MBJ A;  2MD5 A;  3BZ6 A;  3O3K A;  1N77 A;  2E19 A;  1BC8 C;  3K1M A;  2D5V A;  2F4M B;  2ME6 A;  2ME0 A;  4L5J A;  4KIG A;  5J8F A;  1I1S A;  1MNE A;  3S3O A;  3H5N A;  2HOT A;  3S1R J;  3BQY A;  2W7N A;  3CCE I;  3HRT A;  1X2M A;  3CDL A;  3ESW B;  2R7S A;  4GO1 A;  2ZCW A;  2ZC2 A;  2R5Z B;  1RPW A;  3HPH A;  2BGC A;  2DDA A;  3F3X A;  2KJB A;  1IN7 A;  3WTS C;  2LP0 A;  1YLF A;  2TRT A;  3WG9 A;  4XON A;  3RZO J;  2Q0O A;  3PUF A;  3BG7 A;  2QSG X;  3SZP A;  3TP3 A;  4H4K C;  1HST A;  3BP8 A;  3RJP A;  3ABM H;  1Y1W J;  3E6C C;  3VSL A;  3V7R A;  3FK7 A;  4QLC U;  4KIC A;  3TW7 A;  3COA C;  2XAU A;  2HOS A;  3BQZ A;  1YS7 A;  1DU0 A;  2GA2 A;  1F36 A;  1IG7 A;  1ZQ3 P;  1MNM C;  2FD5 A;  4IF4 A;  3U1D A;  1YX3 A;  4AWX B;  5L3F A;  3OS2 A;  2DK5 A;  2EB7 A;  3HUG B;  4RB0 A;  5F0H A;  4V2G A;  2DLL A;  3SEZ A;  3V8L A;  3DBR B;  1OYI A;  5ICC A;  1MKM A;  1OPC A;  3TW6 A;  3FMS A;  1D5V A;  1XMX A;  3WGH A;  3ZQC A;  1BR2 A;  1MGT A;  3R0J A;  1NG6 A;  2PLY A;  3DXJ F;  4G7H F;  2HFH A;  3D5R C;  5D4S A;  2BOL A;  3S2H J;  2F5F A;  4ZYG A;  1BJZ A;  2L3D A;  3RPQ A;  2K85 A;  5D6E A;  1Z0X A;  1S5L C;  1PP7 U;  2R93 J;  1Z05 A;  1W1W E;  2VXD A;  1P7I A;  1X4O A;  1IV6 A;  1IXR C;  5K5R A;  5HOD A;  2CUF A;  4I01 A;  2O03 A;  2Z1D A;  2XDV A;  1JTX A;  3OSG A;  1X1P A;  1WFX A;  4XRS G;  2YU9 J;  2DW4 A;  3VYS B;  2CV1 A;  2L9R A;  3FMR A;  4RB2 C;  1FIP A;  2X48 A;  1VQ5 I;  2Q8K A;  1EKE A;  3EYY A;  2Y9Z A;  3T0Y A;  4Q5S F;  2GLO A;  3CCY A;  3BRO A;  1DGW Y;  3M1C A;  2HVR A;  1WGX A;  4HZF A;  3QYE A;  2VBX A;  2VE9 A;  3WU0 A;  3ZMU A;  2DFE A;  3E7L A;  4L0Z B;  4XSZ F;  2BZT A;  3QP5 A;  2EZL A;  3EQL F;  3QYF A;  5F6F A;  5M5X J;  1FC3 A;  3GTQ J;  1QNT A;  1I50 J;  2K9N A;  3J7Y J;  5FKN A;  5A2Q K;  1YS6 A;  5IT9 Z;  2M0C A;  1Q1H A;  1R1T A;  2IBD A;  2E5N A;  2VJ5 A;  4DYQ A;  3E6M A;  3WTV C;  2BW3 A;  4P96 A;  3GWZ A;  4PFP A;  3K70 C;  2ZME C;  2OU2 A;  3TDZ C;  4A69 C;  3GXO A;  3ZP5 A;  2RC4 A;  4E7I A;  4J00 A;  3MAJ A;  1S72 I;  3HL2 A;  4DQ2 A;  5DCM B;  3G4S I;  1HLV A;  2FNA A;  3E1S A;  2X1E A;  2HPM A;  1QBJ A;  1HCR A;  4GYG A;  2LBF B;  3C2B A;  4GRI A;  1FSE A;  1FZP B;  4AUX A;  3CME I;  1UHS A;  2HYG D;  3CQZ J;  3NQO A;  1TP4 A;  3FM5 A;  4BY1 J;  1TWF J;  2XVC A;  2XGC A;  3F8C A;  2JUC A;  3MEX A;  1G3T A;  3ZQF A;  3I64 A;  3KPH A;  1S29 A;  3ECH A;  2W00 A;  2GIV A;  2HKO A;  1BM9 A;  2H6B A;  1XMA A;  2CFX A;  4ZTF A;  4XLH A;  3M1E A;  4JOM A;  2F5V A;  3OS1 A;  4UUS A;  1I27 A;  5DD8 A;  1YE9 A;  3JCU C;  5TIS C;  4HV5 A;  4E6K G;  4C2U A;  1X1B A;  4R1H A;  1W36 D;  1BR1 A;  1GLN A;  2Y31 A;  2LRE A;  4PFO A;  1D5Y A;  2LFB A;  3DLL F;  3GTG J;  3RKX A;  2DMU A;  3F6O A;  2LR8 A;  3PSI A;  2LSO A;  4C3H J;  4W1U A;  3IL2 A;  3BPX A;  4QWQ A;  3VFZ A;  3G73 A;  1PUF B;  3HOT A;  2X6Y A;  3HKZ A;  2ZNZ A;  1XCB A;  2V6E A;  2E60 A;  2KZV A;  5EGO B;  4XLE A;  4UUV A;  3BTJ A;  1BOA A;  1MMN A;  1MSE C;  4PJN A;  4I0B A;  4R79 A;  2V79 A;  1WH5 A;  4HNV A;  4IVN A;  1W5T A;  4PGG A;  2YPR A;  4IJA A;  4ENM A;  2CSO A;  2GM4 A;  2XSD C;  5K5O A;  4B47 A;  5FD5 A;  4RGX A;  4OIO F;  4RAF A;  2L02 A;  2ISZ A;  4ZZL A;  3CDI A;  4LLL A;  2MGQ A;  5J6X A;  3DKX A;  2EIK H;  3WG7 H;  4XRF A;  4D0P A;  2XRO A;  2YU3 A;  1FEX A;  3GTM J;  2DQL A;  3QYB A;  1LKX A;  3QQA A;  4N4N B;  4PK4 A;  1LFU P;  1J9I A;  4A3K J;  3MN2 A;  1ON2 A;  4LK0 F;  2DAO A;  2OUM A;  1BJA A;  4HV6 A;  4CH7 A;  3QU3 A;  5EG0 A;  3GZN B;  3J80 K;  2BEO A;  4M9S A;  2IGK A;  3NRV A;  2HGC A;  1G3Y A;  5J4V A;  3HC7 A;  4L5I A;  4XRM A;  1LE8 A;  4UNO A;  2N8G A;  4HW0 A;  4LLG F;  3VYU B;  3GTK J;  2DA3 A;  2L9V A;  1JKR C;  4BQQ A;  1MDM B;  4UV9 A;  3FK6 A;  2ISY A;  2R5Y A;  4U0V A;  4BJ5 C;  4A5M A;  1UHM A;  3BTI A;  5IOZ A;  3HRM A;  2P4W A;  2V1N A;  2X4H A;  2F48 A;  1E2X A;  5FJ8 J;  4ZDP A;  2L2O A;  2A07 F;  4C9Y A;  1I6X A;  2BXZ A;  3QWL A;  2VBW A;  2EZK A;  4L9N A;  2HKX A;  2UUZ A;  2ZXJ A;  1Y8Q B;  1CQT A;  4IX7 A;  2KIF A;  3Q5F A;  1R5G A;  5DDG A;  2OV7 A;  3RZD J;  3O8H A;  4EJU A;  5JHF A;  2A5W A;  4IQ4 A;  4AIK A;  1HKS A;  2HDW A;  4PCQ A;  1MBF A;  5FO5 A;  4EGY A;  3OL3 A;  1XTA A;  1WJC A;  1GXQ A;  3OOU A;  1APL C;  1EV7 A;  1KZH A;  3U21 A;  1SVM A;  2K5C A;  1VQ9 I;  2OJE D;  4PDK A;  1DU6 A;  2WAD A;  4KT5 C;  2Q2E B;  1V4R A;  2B9S A;  1T0F A;  2DTR A;  2J5O A;  4G9Y A;  2FOK A;  3PNV A;  1TQM A;  4G94 A;  3HTU A;  1HW2 A;  3S93 A;  2L9S A;  2HS5 A;  4ENK A;  2VKE A;  2A61 A;  2VC1 A;  4BQN A;  4IOA F;  1TWH J;  3S2D J;  2ADU A;  1U5T A;  2Y0S N;  1YW9 A;  5JVG F;  4HRI A;  1ZHF A;  5JLX A;  4G6T B;  3OYI A;  5H2F C;  2RNJ A;  2CJJ A;  2FJ1 A;  3CP2 A;  1OCR H;  3AFH A;  4LD5 A;  5HNF A;  1PVE A;  1WKM A;  2XPW A;  1WHU A;  1S7A A;  3BG9 A;  3M8J A;  1IRZ A;  2WC2 A;  4MQ9 F;  4HDU A;  2KKO A;  3MCZ A;  4F92 B;  1XPX A;  3WOD F;  1REP C;  3O6B B;  2P7V B;  2F4I A;  1K83 J;  1FT9 A;  3EDP A;  3M9A A;  4NQW A;  3KYL A;  1ETQ A;  2GBY A;  4B48 A;  3CCU I;  3S8P A;  5IT3 A;  3IV5 A;  4MNU A;  4R8H A;  2TDX A;  3V8J A;  4GDF A;  1ZGW A;  2VBZ A;  2KIS A;  3GTL J;  5L3G A;  1UFM A;  3K4M A;  1FPQ A;  1ZN2 A;  3KLN A;  2Y0M A;  4DGW B;  4UB8 C;  4XLP F;  1TT0 A;  1JXS A;  4BE1 A;  3K4C A;  2QWW A;  1T39 A;  1BR4 A;  4LG3 A;  1K78 A;  3ZMT A;  3OR2 C;  4CSW A;  2FBH A;  4LMY A;  3OS0 A;  1RUO A;  3KET A;  2R0Q C;  3IH2 A;  4F7Z A;  4JP0 A;  4RM3 A;  2LDU A;  2VJ4 A;  1W0U A;  2EK5 A;  4HPQ A;  1ETW A;  3E6D A;  3JRH A;  2PMZ N;  5BMZ A;  2FBK A;  2EZI A;  3FXR A;  3JTH A;  2WY7 Q;  2LVS A;  3TQN A;  5IPA A;  3H5R A;  1K7A A;  3HOW J;  2CU7 A;  3KE2 A;  1W7P A;  2RQP A;  1HW5 A;  4Y52 J;  4M73 A;  5D4R A;  2XIG A;  2PJR A;  4BBR J;  2WWY A;  2DMP A;  4KIF A;  4M3F A;  3M7G A;  4YIF A;  2XB0 X;  3HOS A;  3CUQ C;  4OOI A;  2MYS A;  2COM A;  2DOF A;  4EM0 B;  1RNL A;  2ZBK A;  4IPA A;  4M6Y A;  1XSD A;  2Z16 A;  2Z2S B;  1H89 C;  4RMN A;  2HDD A;  2V1U A;  1R7J A;  1SAU A;  2DA6 A;  3F22 A;  5B66 C;  4IQJ A;  1JT0 A;  5E1X A;  4XKB A;  1FLI A;  3FXJ A;  3OR1 C;  1ZGA A;  2K9M A;  2CUJ A;  3EUH C;  3GTJ J;  3CF5 F;  2LKX A;  1YJW I;  4KN7 X;  2JA2 A;  3CO7 C;  2F5E A;  1RIO H;  2CQQ A;  1KQ0 A;  2V4J C;  4RAY A;  5K1Y A;  1KU9 A;  3QOP A;  2AO9 A;  3ABT A;  3BG6 A;  4QSH A;  3F23 A;  1RRJ A;  4PGH A;  3QPT A;  1D0Y A;  4AYB N;  1JT6 A;  4ANJ A;  1TWC J;  2Z33 A;  2WTE A;  2VI6 A;  4CCM A;  3CCQ I;  4DNC A;  2M8E A;  1CF7 A;  4V2F A;  2XC7 A;  5FRN A;  4KJZ A;  2RGV A;  1D1B A;  4U7D A;  3ZPL A;  2R7V A;  2M87 A;  1XGM A;  4ZJZ A;  4FX4 A;  3ZQH A;  1T8I A;  1UAA A;  3ZR8 X;  2A6H F;  2DA1 A;  2JA7 J;  1XC5 A;  1Z3X A;  3GLL A;  2VJI A;  4YIR X;  4Q48 A;  2VKH A;  3ISP A;  1U8R A;  2G9W A;  1V55 H;  4GGG A;  2VL8 A;  2PI0 A;  2K3P A;  1X2N A;  1U8B A;  1OR7 C;  4UB6 C;  1MMS A;  1D8K A;  2L5Q A;  4RGR A;  1QA6 A;  2CQ7 A;  1D8J A;  1MZB A;  4J19 A;  1O57 A;  3BJ6 A;  2FRH A;  3MZY A;  2RDP A;  3LSK A;  2V9P A;  2E1M C;  5F08 A;  1QVU A;  2DYS H;  5LGT A;  1H88 C;  1YQA A;  1FBS A;  2MAB A;  4HBL A;  2QA4 I;  1OKR A;  2H94 A;  4LFU A;  2R7D A;  1WQ2 A;  1LNW A;  3IRQ A;  5C4X J;  2FML A;  1P6R A;  2JWT A;  4EV0 A;  2JQ7 A;  4HF2 A;  3WHC A;  5BPD A;  1K61 A;  2QEX I;  3HSF A;  2Y48 A;  4P5O A;  2KRF A;  1ZGJ A;  1YRN A;  3TBI A;  2VXZ A;  5J47 A;  1ONV A;  2BW3 B;  4LGW A;  3U1K A;  5J1U A;  2X6W A;  3DEU A;  5E3L A;  1XSX A;  1GHC A;  2VJJ A;  3FIS A;  4DOZ A;  4L0Y B;  1H9T A;  5EEG A;  1VQ8 I;  3D5L A;  5FFX A;  3CJT B;  5ILU A;  3L2Q A;  1BI3 A;  3CLQ A;  2DT5 A;  3OYC A;  3K70 D;  2VQH A;  3ZQL A;  4XBF A;  3OIO A;  1G4D A;  3K0L A;  4KA4 A;  1DPR A;  1SD6 A;  1V5F A;  3E5U A;  3JSP A;  3L2C A;  4FTH A;  1ORK A;  1WJA A;  4O5V A;  1VF9 A;  2DT6 A;  3HPG A;  4BY7 J;  4X1E A;  5BQT A;  3IKT A;  2HOE A;  3HYI A;  5J3L A;  4FQG A;  1IJW C;  3HOZ J;  4Y4R A;  1MJA A;  2K40 A;  5HS9 A;  3S2W A;  2RVC A;  2ZKZ A;  4KUM A;  5FRM A;  2QF7 A;  3G71 I;  2FA5 A;  1HXD A;  2QQ9 A;  3M8E A;  2E5Z A;  4UUS B;  2Q1Z B;  3M4O J;  2EQR A;  3A2K A;  2OTL I;  3KP6 A;  4XKV A;  4KIS A;  1OFC X;  4F52 A;  3F8M A;  2P8T A;  3BDD A;  1JJ6 C;  1BC7 C;  2GOX B;  4BE0 A;  3DBH B;  3DEE A;  3DU6 A;  1QZE A;  2HQ5 A;  4C2M J;  1XSV A;  4A3I J;  2XGD A;  4P1W A;  3F8N A;  2NAZ A;  2MH2 A;  2R7T A;  3C2H A;  2M5W A;  1OCC H;  1JI8 A;  5ERI A;  3K1P A;  4RAG A;  4CO8 A;  3D1N I;  2KIQ A;  1E0E A;  1W4M A;  4LB5 A;  4B3A A;  2V1D A;  1D0X A;  2RNG A;  3LQR A;  3CUO A;  3K6G A;  2H1K A;  3J7A O;  2NOJ B;  3BZK A;  2R7U A;  4CZC A;  5EYR A;  4HAM A;  3R60 A;  4S04 A;  3K10 A;  2E2H J;  2C6Y A;  1R36 A;  4AM3 A;  3KP5 A;  3OYE A;  2KDZ A;  4RGS A;  1ZRC A;  2ID6 A;  2G7U A;  3K2Z A;  4C2T A;  2NVT J;  3OY9 A;  3F21 A;  2KFD A;  3I4N J;  1I1G A;  4Y13 A;  2G0E A;  5BPI A;  3EET A;  3OSF A;  1WI9 A;  3P7N A;  1QPI A;  2NS7 A;  3H5A A;  4WXH A;  4J01 A;  5EG0 B;  2OAZ A;  1ZK8 A;  1YG2 A;  4CXF A;  1RR7 A;  1ACI A;  4ZC3 A;  5F1J A;  5JR3 A;  1LE8 B;  3FX3 A;  2A6E F;  2HU9 A;  3VOE A;  1BA5 A;  2ZJR F;  2LF8 A;  4A3C J;  2X51 A;  2XB5 A;  2LY1 A;  2LD5 A;  2FUG 2;  4CIC A;  3LA2 A;  1UJ8 A;  4F93 B;  3VDX A;  4HYE A;  5M3F J;  2HNH A;  3ZCO A;  4ETS A;  3OYN A;  3QPS A;  2FEZ A;  4KFC A;  3UNG C;  4ESB A;  3B6A A;  4XLN F;  2KMU A;  1IW7 F;  3F9K A;  5ED4 A;  1BN5 A;  4BEH A;  1YIJ I;  4CDG A;  2P7C B;  4BJ6 C;  1R5H A;  2VE8 A;  1OLT A;  1ZYR F;  3JSO A;  3MQ0 A;  4L18 B;  4LG0 A;  5E8G A;  3MZ8 A;  2VOP A;  1A6Q A;  3HSR A;  3I54 A;  1ZH5 A;  2ZNY A;  2OD5 A;  4A5N A;  4AIH A;  5FGM A;  2GXB A;  3E3V A;  2AQF A;  3B73 A;  3HZJ A;  3A01 A;  1Z6R A;  1KA8 A;  4GCV A;  3I55 I;  3FXL A;  1KQ8 A;  1RI7 A;  1FIA A;  2DBB A;  3ELK A;  3MKZ A;  3LA3 A;  1RKT A;  2E71 A;  1FOK A;  1Y56 A;  5CVJ A;  3AG3 H;  4YFK F;  3N05 A;  1OIS A;  1A36 A;  4Y33 A;  1BIA A;  3DCF A;  3KX2 A;  4IO9 F;  2A3S A;  5K7F A;  4ESJ A;  3BPV A;  3HOX J;  1JHH A;  2O0Y A;  1JTY A;  2M30 A;  1AOY A;  1WSU A;  3A03 A;  5K7Z A;  1USS A;  1W0T A;  2DTZ A;  3DU5 A;  3S1Q J;  2CYY A;  2LF7 A;  4E7Z A;  4HNU A;  2ESN A;  1G3S A;  4I98 B;  1KU7 A;  1D3Y A;  4YFX F;  1TWA J;  4FCY A;  2HXO A;  4JX6 A;  4YFN F;  3KEY A;  4OWR B;  2VT2 A;  2DPU A;  2L7K A;  3DKY A;  5JVT A;  3OYJ A;  3OYD A;  1MJB A;  3ZMV A;  4CCJ A;  5M5Y J;  3LSP A;  5F0C A;  3BR6 A;  3FKJ A;  2OCC H;  2O7O A;  5GPA A;  1BI2 A;  2XF6 A;  1VND A;  2LTP A;  2IP2 A;  5E3N A;  2QSH X;  2BY1 A;  2EV0 A;  5D5U B;  1EA3 A;  3LMM A;  4AID A;  5GAD J;  2VQC A;  3IP4 B;  4NQW B;  2ACJ A;  2AS5 F;  3K4J A;  2GXG A;  1U9N A;  2O8X A;  4U0W A;  3I53 A;  5DYM A;  2RN7 A;  5IY5 H;  3LSM A;  2NVU B;  2DA7 A;  2LY9 A;  3TGN A;  3TO7 A;  2BVL A;  3JRG A;  3S3M A;  3I4M J;  3DV8 A;  4FE7 A;  2CUE A;  4NC8 A;  1MND A;  2B0L A;  1D1C A;  2JJ7 A;  2XAH A;  1GUU A;  3W2V A;  1K78 B;  1XDU A;  3FXU A;  1H8A C;  1HW1 A;  5FLM J;  2VOO A;  2JSP A;  5J1R A;  2UV1 A;  3RKY A;  3SJM A;  2QZ8 A;  3ROU A;  2XKP A;  4G8X A;  4A0X A;  4I99 C;  3GO5 A;  1DP7 P;  1QVT A;  2R7Z J;  3CCJ I;  4BH9 A;  4Y7N J;  3JRA A;  4RGU A;  3S14 J;  2AHQ A;  3MKW B;  2W1O A;  4NNJ A;  1W7P B;  3BJO A;  3PNT A;  5ICE A;  2COB A;  1ETX A;  1JGG A;  2LRD A;  2DJI A;  5DUK A;  3MVP A;  1B59 A;  1YTY A;  2HYJ A;  3PUB A;  5J1Y A;  4ITV A;  2O9L A;  3CMM A;  2YR2 A;  4CYC A;  3L2W A;  2PJR B;  3IHU A;  4CGZ A;  2KZG A;  2AQE A;  3JAM K;  3AL0 B;  1VQP I;  4ZZD A;  4L5E A;  1QHH D;  2ELK A;  2ECC A;  2X1C A;  4BDZ A;  1YI2 I;  1HC8 A;  2EIN H;  4G7Z F;  1P2F A;  2W85 A;  9ANT A;  1E17 A;  1XDS A;  1IN8 A;  2D45 A;  4TV7 A;  1Z91 A;  1DP3 A;  4PUS A;  2Y2Z A;  2FX0 A;  1T33 A;  4BJT A;  2HVQ A;  3CCM I;  5F64 A;  1G3W A;  1XCV A;  3H3V K;  1WJD A;  1TNS A;  1ZG3 A;  3MKY B;  1ZG1 A;  3SFZ A;  4CCO A;  1FMV A;  3F8F A;  1P92 A;  3WE3 A;  1MIJ A;  2OF7 A;  2IA0 A;  2F5C A;  2QSF X;  3UKG A;  4HX8 A;  1J09 A;  2WA0 A;  3HRS A;  5TRD A;  2HEO A;  2KQR A;  4HX4 A;  2ZXH A;  4M6V A;  1OCP A;  1K4S A;  2ESH A;  3CZ6 A;  2P6S A;  5IP6 A;  1ENH A;  5DUI A;  5HLT A;  3H3Z A;  2BXY A;  1B9N A;  2IPQ X;  3WTZ A;  4OAZ A;  1EH8 A;  1O3T A;  5LHG A;  5M5W J;  4BHC A;  2JSC A;  1FYM A;  1B6A A;  1WJF A;  4HDV A;  4B3X A;  2STT A;  3GLX A;  1O3S A;  1LQ1 A;  4LLN A;  3GTP J;  2L4M A;  1R4N B;  2YSR A;  5CJ9 A;  3V4G A;  1X19 A;  2K86 A;  1FTZ A;  1P4W A;  4II2 A;  4B43 A;  1ETO A;  2IA2 A;  2WV0 A;  3I3L A;  3KYD B;  3EPZ A;  1T0F C;  2RV8 A;  3WTU C;  4MQV A;  3F72 A;  3Q9V A;  3CCV I;  1A35 A;  1GVD A;  2BE5 F;  2DFH A;  2J5P A;  1UG2 A;  1VZ0 A;  3VYT B;  1B72 A;  1G59 A;  3WGG A;  4D7N A;  1D0Z A;  1DUX C;  1JJ8 C;  2W4S A;  3ABU A;  1JUM A;  4W97 A;  3J81 Z;  2LK2 A;  3GW2 A;  2FU4 A;  4EM1 A;  3BR3 A;  3FBI B;  4P9U A;  5LGN A;  4XKW A;  3Q9S A;  3QOD A;  2GXA A;  3Q0U A;  1T98 A;  4Z6Y A;  4C3J J;  1YRN B;  2OQG A;  3S1N J;  4DJA A;  1L3L A;  5K5Q A;  2DK8 A;  2KIM A;  4M3G A;  5IP9 J;  3JRC A;  1R00 A;  4D9J A;  2KRC A;  1HBX G;  4V19 K;  2NRA C;  2MG4 A;  3I71 A;  2BVM A;  2L0K A;  1P7J A;  2L01 A;  4BDY A;  4ENJ A;  3WTY C;  4N9I A;  1RES A;  5FKL A;  1PYV A;  1TLH B;  3ZMD A;  1F1Z A;  1U6G A;  3RTR A;  1QQI A;  1TNT A;  4IHV A;  3J7A Y;  4EVI A;  4HNT A;  4KIB A;  2DFI A;  1B9M A;  2DI3 A;  2WAQ N;  4YEJ A;  4HX7 A;  1B8I A;  6PAX A;  1TL8 A;  3OIQ A;  2ZFW A;  4MHG A;  3T5X A;  1R6R A;  2M45 A;  2QQ8 A;  1VQK I;  5LHH A;  3L09 A;  2OBP A;  1JKQ C;  2HDC A;  1FOY A;  2K02 A;  3GTO J;  2IS6 A;  1V54 H;  2ETH A;  4K2E A;  1SFX A;  2L4A A;  3A0B C;  2O6G E;  5L3B A;  1IAW A;  2E35 A;  1S9H A;  4FE4 A;  2LY2 A;  4X6A J;  2E1C A;  4RB1 A;  2K7L A;  4IHY A;  2JRT A;  2M2E A;  2EFP A;  2Z99 A;  4WX9 A;  1R58 A;  5DV5 A;  1T08 B;  2NXN B;  2JA6 J;  2K4B A;  3VYR B;  2B7E A;  1FJL A;  2EFN A;  3DKW A;  3OV8 A;  1UST A;  1UHW A;  5DTD A;  3HGY A;  3KEQ A;  4LIV A;  1RZ4 A;  3KYC B;  3BR1 A;  1POG A;  2ELH A;  4XOR A;  3F0C A;  2ELJ A;  1IDY A;  2V7F A;  2VUM J;  4C30 A;  2CQN A;  1AKH B;  1V3F A;  2JZY A;  5FLX Z;  2Y30 A;  5FKO A;  4IHT A;  3PO3 J;  3CC2 I;  4HQM A;  3SHF A;  1C0W A;  5J40 A;  3CDH A;  1A31 A;  2VAS A;  4KMU X;  5HLG A;  2F2E A;  1ON1 A;  3RQI A;  1MD0 A;  4RB3 C;  3HUG A;  2LOO A;  4CCK A;  2XAF A;  2K9Q A;  3R61 A;  1FWZ A;  1UB9 A;  1MH4 A;  1R49 A;  1LPQ A;  5L3E A;  2YX7 A;  4XNF A;  2F5D A;  3ZGK A;  3T8R A;  2GQQ A;  3DQV C; 
#chains in the Genus database with same CATH homology
 3DPT A;  2MLK A;  4KN4 X;  3E97 A;  4HQE A;  3U9G A;  2HZT A;  2MA3 A;  2JTV A;  2KIU A;  3QU6 A;  2V9V A;  1R23 A;  4O3M A;  3JW4 A;  2CWE A;  1LEB A;  4P55 A;  1LEA A;  5E17 F;  1ZRF A;  5FFZ A;  1J2X A;  5LGU A;  4UVB A;  2HR3 A;  5IT9 K;  3KLO A;  4Z2Y A;  3BY6 A;  1S8N A;  4LG0 B;  1FP1 D;  1QGP A;  3I59 A;  3IC7 A;  1ZRE A;  3KFW X;  3TDU C;  3K1N A;  1XGS A;  4YII A;  4EMS A;  4OMZ A;  4EJV A;  5CVU A;  3WTT C;  4JBA A;  4G6D A;  1ZAO A;  1J59 A;  2UXX A;  4WCG A;  3R0A A;  1PDN C;  3K69 A;  5ILV A;  4GXO A;  3GFM A;  3ERE D;  3H92 A;  3GZ6 A;  4M74 A;  4I02 A;  3PQJ A;  3T8T A;  4U7B A;  1LDJ A;  4MEX F;  2VC0 A;  2FQ3 A;  2NYX A;  5E20 A;  1JHF A;  4OIQ F;  1T2K A;  3LST A;  4HF0 A;  3W6K B;  3FF5 A;  1IF1 A;  3WU1 B;  1TQP A;  5F1R A;  4ASN A;  4G6Q A;  5CVI A;  3GVA A;  1G6N A;  3GFJ A;  4M72 A;  2LKP A;  1F9N A;  2HQR A;  2OZ6 A;  1R22 A;  2P6T A;  5J8C A;  5KVR A;  2STW A;  4A0Z A;  2VN2 A;  4BXU A;  2K4J A;  1O3R A;  4Q4Z F;  2W25 A;  4N0B A;  3SZT A;  2A69 F;  4CYD A;  2PMH A;  1IZ1 A;  5LRS A;  4IRH A;  3GFI A;  3HHH A;  3P9I A;  5LEK A;  3CLO A;  5H6Q A;  3JTG A;  3CUQ A;  2FSW A;  3E6B A;  2EA2 A;  2W84 A;  2XRN A;  5E18 F;  1Z1D A;  1VTN C;  1B1B A;  4ZH4 F;  3GEZ A;  1SD4 A;  5A2Q Z;  3FMQ A;  2DO7 A;  2M1B A;  2EJR A;  1XN7 A;  3EUH A;  1YW8 A;  4HOB A;  2XGX A;  1ZLJ A;  2BBY A;  4IHS A;  4OU0 A;  3P9C A;  2QBY A;  1KU3 A;  3C7J A;  1ULY A;  2EFQ A;  3KCC A;  4I09 A;  2AXL A;  1IRG A;  4AIJ A;  2DU9 A;  2PN6 A;  1IN6 A;  1XB4 A;  2HQN A;  1SFU A;  4AD9 A;  4L9T A;  3I5U A;  5BS6 A;  3C18 A;  4FHT A;  1BI0 A;  4WXD A;  5D5V B;  2PBI A;  1F5T A;  4B09 A;  4FX0 A;  1RUN A;  1OR7 A;  2H6C A;  2QYO A;  2H09 A;  3V8K A;  4Y15 A;  1SD7 A;  5L3D A;  2VBY A;  5LHI A;  1JE8 A;  4BNC A;  1TQI A;  3L7W A;  3KP2 A;  1S7O A;  1P4X A;  1XGO A;  2PEX A;  3L9F A;  2YX4 A;  3HSE A;  4ZYD A;  4BQA A;  4ESF A;  2XAQ A;  1PUE E;  4FT8 A;  2MH9 A;  1T38 A;  3TKY A;  2HWV A;  2EV5 A;  1O3Q A;  4A6E A;  3DFG A;  2BYV E;  3LFK A;  2A68 F;  1TW3 A;  3J80 Z;  5E1Z B;  2XAJ A;  5LLQ A;  3AAF A;  2E7W A;  4LB6 B;  1FY7 A;  5DEQ A;  1IN5 A;  2XKO A;  3IKV A;  2EA4 A;  1K79 A;  2UWM A;  3U2R A;  1SFE A;  3CTA A;  1KYW A;  2NNY A;  2EWN A;  3C3W A;  1R1V A;  2FBI A;  1W7P D;  1SD5 A;  2D1V A;  1U5T B;  1FBU A;  5E8I A;  4OIR F;  1WRJ A;  1IRF A;  5H20 A;  2P5L C;  3RI4 A;  2VOD A;  4BHB A;  5FB2 A;  1PP8 F;  3W6J B;  3E5Q A;  3ZN1 A;  1KU2 A;  2GAU A;  4M71 A;  2XAG A;  3IWZ A;  2Y75 A;  5JFR A;  3OOP A;  2CW0 F;  1OYW A;  3HIF A;  1QZY A;  2R7F A;  3H3U A;  3IRR A;  4IRI A;  4U0Y A;  4YG2 F;  3I4P A;  3MWM A;  2QQA A;  3WTX C;  2E7X A;  1EH6 A;  2FXA A;  4IRG A;  3BJA A;  2P5K A;  1KQ9 A;  5HOO A;  1HKQ A;  1I5Z A;  5TJJ A;  5HDK A;  2HTJ A;  5L3C A;  1U3E M;  1LVA A;  4A6D A;  1J75 A;  3KP3 A;  4OIN F;  5CLS A;  4BYY A;  4KNY A;  1XD7 A;  4HA8 A;  1NHA A;  1LB2 A;  3FZV A;  2A5Y B;  3I59 B;  5D8K B;  1ZRD A;  2Z5U A;  4LJZ F;  3LAJ A;  1STZ A;  3E5X A;  4A12 A;  3K9T A;  5FD6 A;  2UZK A;  1U2W A;  4P9F A;  3REO A;  1OYY A;  2XHK A;  3DPL C;  3DF8 A;  4M9X A;  2PMU A;  4NB5 A;  2D1H A;  1FYK A;  2OZU A;  4HLY A;  2UXN A;  3I58 A;  3TO9 A;  3LAP A;  4JK1 X;  3KZZ A;  3ZMZ A;  1CF7 B;  5D5X B;  2CQK A;  2W24 A;  4ZYE A;  1IXS B;  2FNP A;  3WTW C;  1YIO A;  2QVO A;  4EJW A;  2HYF A;  3IWF A;  1AWC A;  4S05 A;  2QLZ A;  3PFI A;  3FXQ A;  4A2U A;  1IUY A;  4EGZ A;  2CO5 A;  3RIR A;  2DQR A;  2DPD A;  5HDG A;  2FE3 A;  5LEJ A;  4ON0 A;  5HVQ C;  2JT1 A;  1O7F A;  3M8F A;  4HLX A;  3RKW A;  5ILS A;  3SQN A;  1ZLK A;  1LJ9 A;  1U5T C;  1U78 A;  4RAZ A;  1BI1 A;  3LQQ A;  1MJ9 A;  4M6X A;  5DD4 A;  2R3S A;  4CZZ A;  3GUD A;  2QEN A;  1XGN A;  3N97 A;  1T6S A;  2KJC A;  4M9Z A;  2ZME A;  5JHU A;  4H0E A;  3CUQ B;  5HS8 A;  4UHT A;  3SXY A;  4OIP F;  1KYZ A;  1HKT A;  3F6V A;  4B8X A;  1QPM A;  2XAS A;  2MBF A;  3GF2 A;  3RPU A;  2JPC A;  1Z9C A;  5AIP A;  3ULQ B;  3PQK A;  1YW7 A;  1Z7U A;  4L9J A;  2W57 A;  1HQC A;  1O7L A;  2QUF A;  3ML6 A;  1SMY F;  1YYV A;  2QBY B;  4XSX F;  2PFB A;  1L0O C;  2GWR A;  1S3J A;  1LDD A;  2Z3Y A;  2MC3 A;  3LWF A;  3WE2 A;  5LRR A;  4EJT A;  3I0T A;  3V7S A;  2EFO A;  3VOD A;  1GVJ A;  2RKH A;  1W5S A;  3QP6 A;  1LDK B;  1QZZ A;  2XUB A;  3P9K A;  2PQ8 A;  3KEO A;  1XMK A;  2IJL A;  3KP4 A;  1B4A A;  3G3Z A;  3BWG A;  1J0R A;  2IVM A;  1X3U A;  5HS7 A;  3RYP A;  4CHU A;  1TBX A;  5D6F A;  3LA7 A;  3TO6 A;  5HLH A;  4MTD A;  2IRF G;  4A0Y A;  4O6J A;  2JPB A;  2XV4 S;  3HTS B;  4UV8 A;  5KK1 A;  4NHJ A;  5AIQ A;  2FMY A;  4KMF A;  3CJN A;  4G7O F;  2FF4 A;  1J5Y A;  2GA1 A;  3C1D A;  3KZY A;  1BIB A;  1F4K A;  4E70 A;  3VB2 A;  4EM2 A;  4KDP A;  1ODD A;  2VON A;  1ZAR A;  3L00 A;  1FNN A;  1K6O A;  3R6S A;  2IA1 A;  4LK1 F;  2BV6 A;  1ZG5 A;  5HDN A;  4Q47 A;  1QO0 D;  2OA4 A;  1WWX A;  4WXC A;  3QPH A;  1JGS A;  5AON A;  4WWC A;  5E1W A;  3HHG A;  5LBQ A;  2CGP A;  3V7C A;  3ZMS A;  5JI6 A;  5DCM A;  4I0A A;  1EH7 A;  2NNN A;  3N4M A;  2HTS A;  2OQR A;  3FM3 A;  4MGR A;  5EEH A;  1CGP A;  2H27 A;  2P5V A;  2GZW A;  3DP7 A;  4RS8 A;  2IW5 A;  3B02 A;  4HF1 A;  1Z6T A;  5CVR A;  3ECO A;  4UVC A;  2O3F A;  5D5W B;  3GZ5 A;  1UCR A;  3QAH A;  1FYL A;  3ZN0 A;  3MFK A;  2QQB A;  4GYI A;  5CYV A;  1A04 A;  3ZQ7 A;  1YFH A;  2E1N A;  1HSJ A;  1KGS A;  4BAY A;  2NS0 A;  3GFL A;  2EFW A;  3J81 K;  2EV6 A;  1J7K A;  3CO6 C;  4IXA A;  4UVA A;  2K27 A;  5CVV A;  4WK8 F;  1OMI A;  1Y0U A;  1H0M A;  3R4K A;  3KP7 A;  1H9G A;  3EYI A;  2PJP A;  2ZJ2 A;  5ICG A;  1TTY A;  4I2O A;  1IN4 A;  5BOX A;  4BHP A;  1IXC A;  4AVP A;  3QRF F;  4UXN A;  2O61 A;  4EJO A;  1DPU A;  5HLI A;  1S6L A;  2X0L A;  3WGI A;  5H6R A;  1MDM A;  4ENN A;  3JAM Z;  4U88 A;  3BOQ A;  2V6C A;  4MEY F;  2D2W A;  4OMY A;  1FX7 A;  3FWE A;  3TOB A;  1GXP A;  1YO5 C;  1DDN A;  2PG4 A;  1FBQ A;  3T1B A;  4ZYH A;  4L9V A;  5FLX K;  3NEU A;  5D8L B;  3GX4 X;  2V1X A;  2Z9O A;  3MZH A;  1FP2 A;  5ICF A;  2Q2E A;  4KYW A;  4WF2 A;  3FHZ A;  2ZO4 A;  3RDI A;  3F8B A;  2CG4 A;  4JQF A;  3TOA A;  2IT0 A;  4I7H A;  4Y17 A;  3O2P E;  3D0S A;  1FSH A;  2G7H A;  1R1U A;  2VT3 A;  2LNB A;  1SAX A;  3RYR A;  4EQQ A;  3GYH X;  2ZME B;  1SMT A;  1BBY A;  1P4A A;  2L54 A;  2MLG A;  2QM3 A;  3VEP A;  1TW2 A;  3HRU A;  4MTE A;  5DCF A;  4PZJ A;  4N9H A;  2MD5 A;  3BZ6 A;  3O3K A;  1BC8 C;  3K1M A;  4L5J A;  4KIG A;  5J8F A;  1I1S A;  3HRT A;  4GO1 A;  2ZCW A;  2BGC A;  3F3X A;  2KJB A;  1IN7 A;  3WTS C;  3WG9 A;  1YLF A;  2Q0O A;  3SZP A;  1HST A;  3BP8 A;  3RJP A;  3E6C C;  3V7R A;  4QLC U;  4KIC A;  3COA C;  1YS7 A;  2GA2 A;  4IF4 A;  3U1D A;  4AWX B;  5L3F A;  2DK5 A;  2EB7 A;  4RB0 A;  2DLL A;  3V8L A;  1OYI A;  5ICC A;  1MKM A;  1OPC A;  1D5V A;  3FMS A;  3WGH A;  1MGT A;  3R0J A;  2PLY A;  3DXJ F;  4G7H F;  2HFH A;  5D4S A;  2F5F A;  4ZYG A;  2L3D A;  3RPQ A;  5D6E A;  1PP7 U;  1Z05 A;  1IXR C;  5K5R A;  4I01 A;  2O03 A;  2DW4 A;  3FMR A;  4RB2 C;  2Q8K A;  3EYY A;  4Q5S F;  3T0Y A;  3BRO A;  4HZF A;  2VBX A;  2VE9 A;  3WU0 A;  3ZMU A;  4L0Z B;  4XSZ F;  3QP5 A;  3EQL F;  5F6F A;  1FC3 A;  1QNT A;  5A2Q K;  1YS6 A;  5IT9 Z;  1Q1H A;  1R1T A;  3E6M A;  3WTV C;  4P96 A;  3GWZ A;  2OU2 A;  3TDZ C;  3GXO A;  3ZP5 A;  2RC4 A;  3MAJ A;  4DQ2 A;  5DCM B;  2FNA A;  1QBJ A;  4GYG A;  1FSE A;  1FZP B;  2HYG D;  3NQO A;  3FM5 A;  2XVC A;  3F8C A;  3MEX A;  1G3T A;  3I64 A;  1S29 A;  3ECH A;  2GIV A;  2HKO A;  1BM9 A;  2H6B A;  1XMA A;  2CFX A;  3M1E A;  1I27 A;  5DD8 A;  4HV5 A;  4R1H A;  3RKX A;  3F6O A;  2LSO A;  3IL2 A;  3BPX A;  4QWQ A;  3VFZ A;  3G73 A;  3HOT A;  2ZNZ A;  1XCB A;  4UUV A;  1BOA A;  4I0B A;  4R79 A;  2V79 A;  4IVN A;  1W5T A;  4PGG A;  2YPR A;  4IJA A;  4ENM A;  2CSO A;  5K5O A;  5FD5 A;  4RGX A;  4OIO F;  2L02 A;  2ISZ A;  4ZZL A;  4LLL A;  5J6X A;  2XRO A;  4XRF A;  4D0P A;  2YU3 A;  2DQL A;  1J9I A;  1ON2 A;  4LK0 F;  2DAO A;  1BJA A;  4HV6 A;  3QU3 A;  3J80 K;  2BEO A;  4M9S A;  3NRV A;  2HGC A;  1G3Y A;  4L5I A;  4UNO A;  4HW0 A;  4LLG F;  1MDM B;  4UV9 A;  2ISY A;  4U0V A;  4A5M A;  1UHM A;  3HRM A;  2P4W A;  2X4H A;  1E2X A;  2A07 F;  1I6X A;  4L9N A;  2VBW A;  2HKX A;  2ZXJ A;  2KIF A;  3Q5F A;  1R5G A;  5DDG A;  4EJU A;  4AIK A;  1HKS A;  4PCQ A;  5FO5 A;  4EGY A;  1GXQ A;  1EV7 A;  4PDK A;  4KT5 C;  1V4R A;  1T0F A;  2DTR A;  2J5O A;  4G9Y A;  2FOK A;  1TQM A;  4G94 A;  3HTU A;  1HW2 A;  2HS5 A;  4ENK A;  2A61 A;  2VC1 A;  2ADU A;  1U5T A;  1YW9 A;  1ZHF A;  2RNJ A;  4LD5 A;  1WKM A;  1S7A A;  2WC2 A;  4MQ9 F;  4HDU A;  2KKO A;  3MCZ A;  3WOD F;  1REP C;  3O6B B;  2P7V B;  1FT9 A;  3EDP A;  3M9A A;  4NQW A;  5IT3 A;  4MNU A;  4R8H A;  2TDX A;  3V8J A;  2VBZ A;  5L3G A;  1UFM A;  1FPQ A;  1ZN2 A;  3KLN A;  2Y0M A;  4XLP F;  1JXS A;  2QWW A;  1T39 A;  1K78 A;  3ZMT A;  2FBH A;  4LMY A;  1RUO A;  3KET A;  4F7Z A;  2LDU A;  2EK5 A;  3E6D A;  5BMZ A;  2FBK A;  3FXR A;  3JTH A;  3TQN A;  1K7A A;  3KE2 A;  1W7P A;  2RQP A;  1HW5 A;  4M73 A;  5D4R A;  2XIG A;  2WWY A;  4KIF A;  3M7G A;  4YIF A;  3HOS A;  3CUQ C;  4OOI A;  2COM A;  4EM0 B;  1RNL A;  2ZBK A;  4IPA A;  4M6Y A;  1XSD A;  2V1U A;  1R7J A;  3F22 A;  5E1X A;  1FLI A;  1ZGA A;  4KN7 X;  3CO7 C;  2F5E A;  1RIO H;  4RAY A;  1KQ0 A;  5K1Y A;  1KU9 A;  3QOP A;  3ABT A;  3F23 A;  4PGH A;  3QPT A;  2Z33 A;  2WTE A;  4DNC A;  2M8E A;  1CF7 A;  2RGV A;  4U7D A;  3ZPL A;  2M87 A;  1XGM A;  4FX4 A;  2A6H F;  4Q48 A;  3ISP A;  1U8R A;  2G9W A;  4GGG A;  2PI0 A;  1D8K A;  4RGR A;  1D8J A;  1MZB A;  1O57 A;  3BJ6 A;  2FRH A;  3MZY A;  2RDP A;  5LGT A;  1YQA A;  1FBS A;  4HBL A;  1OKR A;  2H94 A;  4LFU A;  2R7D A;  1WQ2 A;  1LNW A;  3IRQ A;  2FML A;  1P6R A;  4EV0 A;  4HF2 A;  5BPD A;  3HSF A;  2Y48 A;  4P5O A;  2KRF A;  1ZGJ A;  2VXZ A;  1ONV A;  4LGW A;  3DEU A;  1XSX A;  1GHC A;  4L0Y B;  1H9T A;  5EEG A;  3D5L A;  5FFX A;  5ILU A;  1BI3 A;  2DT5 A;  1G4D A;  4XBF A;  3K0L A;  4KA4 A;  1DPR A;  1SD6 A;  3E5U A;  3JSP A;  3L2C A;  4O5V A;  5BQT A;  3IKT A;  2HOE A;  3HYI A;  1MJA A;  5HS9 A;  3S2W A;  2RVC A;  2ZKZ A;  4KUM A;  2FA5 A;  1HXD A;  2QQ9 A;  3M8E A;  3KP6 A;  3F8M A;  2P8T A;  3BDD A;  1BC7 C;  1XSV A;  3F8N A;  2NAZ A;  2MH2 A;  2M5W A;  5ERI A;  3K1P A;  4CO8 A;  1W4M A;  4LB5 A;  2V1D A;  3LQR A;  3CUO A;  3J7A O;  4HAM A;  3R60 A;  4S04 A;  2C6Y A;  1R36 A;  3KP5 A;  4RGS A;  1ZRC A;  2G7U A;  3K2Z A;  3F21 A;  1I1G A;  4Y13 A;  5BPI A;  3EET A;  1WI9 A;  3P7N A;  4WXH A;  2OAZ A;  1YG2 A;  4CXF A;  5JR3 A;  3FX3 A;  2A6E F;  3VOE A;  2LF8 A;  4CIC A;  3LA2 A;  4HYE A;  4ETS A;  2FEZ A;  4KFC A;  4ESB A;  4XLN F;  1IW7 F;  5ED4 A;  1BN5 A;  2P7C B;  4CDG A;  1R5H A;  2VE8 A;  1ZYR F;  3JSO A;  3MQ0 A;  4L18 B;  4LG0 A;  5E8G A;  2VOP A;  3I54 A;  3HSR A;  1ZH5 A;  2ZNY A;  2OD5 A;  4A5N A;  4AIH A;  5FGM A;  2GXB A;  3E3V A;  3B73 A;  1Z6R A;  1KA8 A;  4GCV A;  1KQ8 A;  1RI7 A;  2DBB A;  3ELK A;  3LA3 A;  1FOK A;  5CVJ A;  4YFK F;  1BIA A;  2A3S A;  4ESJ A;  3BPV A;  1JHH A;  2O0Y A;  2M30 A;  1AOY A;  1WSU A;  1USS A;  2CYY A;  2LF7 A;  2ESN A;  1G3S A;  4I98 B;  1KU7 A;  1D3Y A;  4YFX F;  4YFN F;  2VT2 A;  2DPU A;  5JVT A;  1MJB A;  3ZMV A;  1BI2 A;  2IP2 A;  2EV0 A;  5D5U B;  2ACJ A;  2AS5 F;  2GXG A;  2O8X A;  4U0W A;  3I53 A;  5DYM A;  2RN7 A;  3TGN A;  3TO7 A;  3DV8 A;  2B0L A;  2XAH A;  1K78 B;  1XDU A;  3FXU A;  1HW1 A;  2VOO A;  3RKY A;  2QZ8 A;  3ROU A;  2XKP A;  4G8X A;  4A0X A;  3GO5 A;  1DP7 P;  4BH9 A;  4RGU A;  1W7P B;  3BJO A;  5ICE A;  5DUK A;  1B59 A;  1YTY A;  2YR2 A;  3IHU A;  4CGZ A;  3JAM K;  4ZZD A;  4G7Z F;  1P2F A;  2W85 A;  1E17 A;  1XDS A;  1IN8 A;  2D45 A;  4TV7 A;  1Z91 A;  5F64 A;  1G3W A;  1XCV A;  1TNS A;  1ZG3 A;  1ZG1 A;  3SFZ A;  3F8F A;  1P92 A;  3WE3 A;  2IA0 A;  2F5C A;  4HX8 A;  3HRS A;  5TRD A;  2HEO A;  4HX4 A;  2ESH A;  2P6S A;  5DUI A;  3H3Z A;  1B9N A;  2IPQ X;  3WTZ A;  1EH8 A;  1O3T A;  5LHG A;  4BHC A;  2JSC A;  1FYM A;  1B6A A;  4HDV A;  2STT A;  3GLX A;  1O3S A;  1LQ1 A;  4LLN A;  2L4M A;  2YSR A;  5CJ9 A;  3V4G A;  2K86 A;  1P4W A;  2IA2 A;  2WV0 A;  2RV8 A;  3WTU C;  4MQV A;  3F72 A;  3Q9V A;  2BE5 F;  2J5P A;  3WGG A;  1DUX C;  3ABU A;  3J81 Z;  3GW2 A;  2FU4 A;  4EM1 A;  4P9U A;  5LGN A;  3Q9S A;  1T98 A;  2OQG A;  1L3L A;  5K5Q A;  2DK8 A;  2KIM A;  1R00 A;  1HBX G;  2NRA C;  3I71 A;  4ENJ A;  2L01 A;  3WTY C;  4N9I A;  1TLH B;  3ZMD A;  1F1Z A;  1U6G A;  3RTR A;  1QQI A;  1TNT A;  4EVI A;  4KIB A;  2DFI A;  1B9M A;  2DI3 A;  4HX7 A;  6PAX A;  3T5X A;  2ZFW A;  4MHG A;  2M45 A;  5LHH A;  3L09 A;  2OBP A;  2HDC A;  2K02 A;  2ETH A;  4K2E A;  1SFX A;  2L4A A;  2O6G E;  5L3B A;  1IAW A;  2E1C A;  4RB1 A;  2K7L A;  2JRT A;  2EFP A;  2Z99 A;  4WX9 A;  1R58 A;  5DV5 A;  2K4B A;  2EFN A;  3DKW A;  3OV8 A;  1UST A;  1UHW A;  3KEQ A;  1RZ4 A;  2ELH A;  1V3F A;  2JZY A;  5FLX Z;  4IHT A;  4HQM A;  3SHF A;  1C0W A;  3CDH A;  4KMU X;  5HLG A;  2F2E A;  1ON1 A;  1MD0 A;  4RB3 C;  3HUG A;  2XAF A;  3R61 A;  1FWZ A;  1UB9 A;  5L3E A;  2YX7 A;  2F5D A;  3T8R A;  2GQQ A;  3DQV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...