5IP9J

Structure of rna polymerase ii-tfiif complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ip9J00
1POGA 5IYDJ 1P7IA 5GP9A 4A3EJ 2HQ5A 1HF0A 1K61A 2DTZA 3LSRA 2GBYA 4W97A 5F08A 2DA1A 1F36A 3S14J 1QRYA 1RPWA 1Y1VJ 4BY1J 4AYBN 3JRGA 2GM4A 1QVUA 1G2HA 2X6OA 3GTQJ 1AKHB 1WPKA 3JRFA 3BQYA 3L1PA 1IG7A 3S2HJ 1D5YA 3IH4A 3HM5A 3ZQHA 2HDDA 1WH7A 2Y31A 3DCFA 3H0GJ 4ABZA 4M3EA 2XGDA 2AO9A 1X58A 2HYJA 4A3FJ 1ORKA 2R92J 2KDZA 1JTYA 1ETQA 2DA3A 3JRDA 2Y2ZA 1H88C 1JTXA 1BW6A 4A3IJ 2LVSA 3NAUA 1U9NA 3O8GA 4UUTA 2JWTA 2ID6A 3BR5A 4DZPA 1BJZA 3JRIA 5K7ZA 3RKQA 4IHVA 2I10A 1GV5A 2XRLA 1TWFJ 4X1EA 3ZQCA 4MO7A 2KT0A 1K83J 3A01A 3BG5A 5M5WJ 3WHCA 3JR9A 2DN0A 3F0CA 4DW6A 4I6ZA 3TP3A 2VKEA 1LFUP 2LY9A 1ITYA 5F1JA 2K40A 4MFEA 1AHDP 2ELKA 2Y9YA 2TRTA 1OCTC 1NK2P 1HCRA 1WI3A 1TWHJ 1CQTA 4FCYA 1B8IB 2NVTJ 2YU9J 3HOVJ 1QPIA 2MSYA 1Y1WJ 1MSEC 3TP0A 1ETKA 4JX5A 2DA4A 3B6CA 1JJ8C 2MW8A 5EZGA 4FTHA 3FK7A 2R0QC 2CJJA 1IDZA 4D7MA 4AC0A 5F0FA 2G0EA 3HOYJ 1AKHA 4BKXA 4EEFG 2VUMJ 2Y0SN 1HDPA 3GTJJ 1E3OC 1WH5A 4LOCA 3S1RJ 1ZR2A 1RETA 1WGXA 4XRSA 3HB9A 2ECCA 2VI6A 2MGQA 3TW6A 2L7ZA 4HNVA 2JA5J 1GUUA 2Y9ZA 3GTOJ 4XICA 2O8KA 1TWCJ 1IV6A 1IJWC 5JLWA 3HOXJ 1DU0A 2M34A 4DYQA 5C44J 3M3YJ 4M3FA 1NK3P 3ZQIA 4BXXJ 4IEJA 1SANA 2EBIA 4UUSB 2AHQA 2HXOA 3BG9A 1GDTA 3LNQA 5C4XJ 3S2DJ 2N8GA 4JYKA 5FLVA 4A93J 5M5XJ 1JGGA 1FTTA 1YRNB 1BW5A 4QSHA 3S17J 3G1LA 4G12A 3HOUJ 2ME0A 1T33A 2JN6A 5FKMA 5K7HA 1IRZA 2M8GX 2ECBA 5BNGA 3SJMA 1FTZA 1DU6A 5M3FJ 2X9DA 3HGYA 2K9NA 1Z0XA 2NOGA 2EZHA 4A3JJ 1Q1VA 3BR6A 4M3DA 4QTRA 5F27A 3BTJA 5EF6A 4XRSG 1B8IA 2NVXJ 1IGNA 3OSFA 5FKKA 2JK3A 2DMNA 5F0CA 2R5YB 3JRHA 2CUFA 4J19A 3TEDA 3ZOBA 4XIDA 2XB5A 3BG3A 4C3HJ 3GTMJ 1FJLA 2EZLA 1X2MA 4GFBA 1TWGJ 2D5VA 4A3KJ 5IP9J 1U8BA 4A69C 5EYRA 1ZTRA 1OCPA 1MBEA 5M5YJ 3H3VK 3S1MJ 2NVQJ 3HOZJ 5IYCJ 1ZR4A 1PUFB 3IV5A 5E3OA 3CCYA 2FQ4A 3UKGA 3ZQFA 4BBSJ 3W6VA 2FJ1A 1MBJA 3GTPJ 3QPSA 3OSGA 3BTCA 1HLVA 1RESA 4C3JJ 3FK6A 1VNDA 3IH2A 1JKOC 2XGEA 4A3MJ 2VPRA 3BTLA 5F0HA 4D5CA 1ZKGA 1RR7A 2RAEA 1S7EA 3GTKJ 4I76A 3RZDJ 4DYCA 2MG4A 4W1UA 4UUSA 3I4NJ 5J1RA 5IOZA 2E2HJ 3GTLJ 1BA5A 1UHSA 2WB1N 5GPCA 1MH4A 2CQXA 5FJ8J 2ID3A 2YS9A 5E3MA 2JA6J 3BR2A 4M3BA 2P81A 5E3NA 4FISA 3RZOJ 2VKVA 2R93J 1YRNA 2JA7J 3A03A 3Q0VA 2XGCA 1TWAJ 1WCMJ 4V2GA 1W0TA 4B4CA 2M0CA 1I6HJ 5FKOA 3FKIJ 1U78A 3CQZJ 1IC8A 2DA2A 3S15J 5DTDA 1GVDA 1XC5A 4RBOA 3I4MJ 2L9RA 5F04A 5J3LA 3BR0A 2EZIA 5M3MJ 2XSDC 3NARA 2LD5A 3C2BA 2FD5A 4C2MJ 2OPTA 3S1QJ 1JUPA 3VPRA 4Y7NJ 4FE4A 2K9SA 3B6AA 2ZB9A 4IHXA 3OIOA 2JJ7A 1MBKA 2E2IJ 4B3AA 2OF7A 2PMZN 5IP6A 2DA6A 2B63J 1RKTA 5EG0B 1H8AC 1A5JA 1A6IA 4MIMA 3S16J 2YUSA 3K2AA 2IAIA 5E3LA 2DMTA 1RKWA 1VI0A 1APLC 1F43A 4XRMA 2HOSA 4V2FA 1FIPA 3JRCA 3HEFA 1PUFA 3FISA 1O4XA 5J1UA 3A01B 4A3GJ 4C3IJ 4BBRJ 2X48A 1H89C 2L7MP 1R9TJ 2IEKA 1SFOJ 2DMQA 4A3LJ 2DMUA 2NS7A 4JP0A 4MFDA 1MSFC 2IBDA 2XB0X 4IHYA 1GV2A 5C3EJ 2QCOA 3LOCA 1JKPC 2FX0A 3CDLA 3BTIA 2WV1A 1QVTA 1U9OA 1B72B 5FKLA 3RQIA 2E2JJ 4B1RA 1XG1A 1Z77A 1ETXA 1JUMA 2GLOA 5EEAA 2M2EA 2CUEA 3MN2A 4BY7J 1GT0C 2R7ZJ 1MBGA 3HOWJ 2DA7A 1W0UA 1LE8B 4S0HB 2R5ZB 2JMWA 4JX4A 3WHBA 5C4JJ 1IUFA 3G1MA 4CYCB 4X6AJ 1JJ6C 2LP0A 4D7NA 3QQAA 1NTCA 2HOAA 4DYRA 2LR8A 1AU7A 2O7OA 2NS8A 1BL0A 3TW7A 3D1NI 1HOMA 2W48A 2L0KA 2CQQA 3CMYA 3MKLA 1JT6A 1JUSA 5EGOB 3HGGA 5EG0A 1JKQC 2HOTA 1OFCX 3GBGA 3OOUA 2K9QA 2ME6A 4QIWN 5FKNA 2WAQN 2LFBA 4IHWA 5GPAA 2EH3A 1P7JA 1T56A 3JRAA 2H1KA 3FIWA 3PM1A 1MBHA 2E19A 1ETOA 3IH3A 3Q0UA 4RDUA 3LSPA 1I50J 4MLOA 1JT0A 3Q3SA 2O9LA 5FLMJ 1VFCA 5JLXA 1ZQ3P 5IOYA 2LLKA 3QPLA 5EZHA 2COBA 3JREA 3HDDA 4D5FA 2LTPA 2NVYJ 2XPUA 3BT9A 1ETYA 3HKZN 2L7FP 1MBFA 1B72A 2XPWA 1OJLA 3G1OA 4Y52J 3A02A 2CU7A 1ETWA 2Y30A 4DZJA 4M3GA 3ZQLA 4L5EA 2R5YA 4M6VA 1ENHA 3LSGA 2HI3A 4JX6A 1HDDC 3E7LA 3ZQGA 2E1OA 3Q0WA 4A3DJ 3O8HA 4FE7A 1LE8A 2DMPA 3PO2J 2R5ZA 2JA8J 5DS9A 3BR3A 2DA5A 3M4OJ 1FEXA 2M9HA 2TCTA 5EDNA 3BR1A 1ZGWA 4CYCA 5HODA 1ZK8A 1JKRC 3HBLA 3GTGJ 5K7FA 2XPVA 5J1YA 2LK2A 5IYBJ 4AUXA 1MH3A 1UG2A 1I3QJ 2H8RA 1VF9A 1X2NA 5IPAA 3S1NJ 3DEWA 3SFIA 1UMQA 3PO3J 2CRGA 5EGOA 1MNMC 1IDYA 4A3CJ 1XS9A 2DJNA 1LFBA 2EZKA 4NDLA 3MVPA 1FIAA 3K7AJ 2QF7A 3BQZA 1ETVA 3LSJA 4A3BJ 9ANTA 2HXIA 1EF4A 2EQRA 5IP7J 1TC3C 3SDGA 2LKXA 4XK4A 3JRBA
chains in the Genus database with same CATH superfamily
1POGA 4BGDA 1P7IA 2KZGA 3IP4B 2HQ5A 2E36A 1XDSA 4QLCU 1K61A 1TW2A 2DTZA 1P9QC 4KMUX 4N4OB 4CA0A 3S3NA 1M1EB 1WJDA 4KJZA 4P9UA 2WAQA 5B1AH 2ZSIB 1IRXA 2RGVA 2HTSA 2D1VA 5EEHA 1BI2A 1QRYA 4OINF 3ZMDA 3H5NA 4AYBN 1IN6A 2NS0A 2X6OA 1KQ8A 4HV5A 2V1UA 1EJ9A 1D5YA 2DLLA 3HM5A 2JT1A 2HDDA 3DCFA 3I71A 4U7DA 1E2XA 4P5OA 5H6RA 3ROUA 5HNHA 2IS6A 4ABZA 2XGDA 4IXAA 2HYJA 2IA1A 4DIQA 4A3FJ 2KRFA 3JRDA 4BAYA 3LA3A 3C2GA 4KA4A 3AG4H 4XBFA 3KYLA 4LGWA 4RAFA 3ZN1A 4A3IJ 4UNOA 1U9NA 3M1CA 4V19K 3J7AY 2E71A 3CCUI 4UVCA 4OWRB 3VB2A 3H36A 5B3SH 2STWA 2PG4A 3BR5A 1SMTA 2R4GA 1BJZA 3JRIA 1YJWI 2RNJA 3FF5A 1ZREA 1G3TA 3V42A 3RKQA 1R4NB 4BE2A 5D6EA 1YS7A 2JVGA 1W5TA 2OU2A 5BOXA 2KHMA 2BVMA 3OIPA 1K83J 3M9AA 3MMYB 4M73A 4F93B 4LIVA 3K1NA 1B9NA 3F8FA 1T6SA 2WWYA 4DW6A 4I6ZA 2XF5A 3EUKL 1NG7A 1ITYA 3O3KA 3T8TA 2IT0A 3IWZA 2F4IA 4MFEA 1AHDP 4ANJA 4ZYEA 3JAMZ 2VKDA 2QVOA 4E7SA 3A0BC 1NK2P 1XMXA 2Q0OA 2L9NA 1WHUA 1VQ9I 1YTYA 1YYVA 4BQNA 2HDWA 4FCYA 4L9TA 1BIBA 2OAZA 4BHCA 5FFXA 5GTHC 4RMNA 4G7HF 4U87A 1ETKA 3W6KB 3E97A 2QBYB 2QGUA 2W1OA 5EZGA 4OIPF 3FXKA 2Y75A 3IKVA 4AC0A 1MZBA 2DFIA 2VC1A 2FQ3A 3RIRA 4CCKA 3VSLA 4ETSA 2QSFX 3DFGA 3HOYJ 3VODA 2XF6A 4WCGA 4EEFG 2ZJQF 3QYEA 5FGMA 3OYJA 3OS1A 4KIFA 1WH5A 2JRTA 1RETA 1GXPA 1DPUA 2GWRA 2HQRA 2OZUA 3H3UA 2OTJI 3OYBA 2KIFA 2Y9ZA 1SD4A 4AYBA 4CCLA 2O8KA 5L3FA 4XSZF 1ZGJA 2X1CA 2P5LC 1IV6A 1MJAA 1OR7C 3H9QA 1R1VA 3DU5A 1DU0A 2P6TA 2M34A 5C44J 1TNSA 1TLHB 2EBIA 4UUSB 1J5YA 3BG9A 1BIAA 2QSGX 2ZO4A 1U5TC 2D45A 2QUFA 4KDPA 5C4XJ 1YIJI 1V55H 1G4DA 2A6HF 2VLAA 3T1BA 3JCUC 4XLHA 4A93J 2W82A 3GW2A 2O61A 1FTTA 1Z7LA 1BW5A 1B4AA 1MDMA 4IRHA 3WG9A 5D8LB 2K85A 3GF2A 3DBLB 3PNTA 1IRZA 3KEYA 5BNGA 4D9JA 3SJMA 3BDDA 1DU6A 3OYEA 1EKEA 3LSHA 3J81K 2HR3A 5DYMA 2EZHA 1Q1VA 3GX4X 3BTJA 4HX8A 2DK8A 4XRSG 4ZYDA 4U0YA 5DM7F 2A61A 4LG0B 1F9NA 1XDUA 4XOPA 5CJ9A 3OSFA 1ZELA 1BI0A 4AVZA 4ESJA 1XMKA 2CUFA 2M45A 3PQKA 4MEYF 3GCMA 3JRHA 3TEDA 3HSFA 2IRFG 3OYFA 3EYIA 1K6YA 3DPLC 1VQPI 2KQRA 2YR2A 3K4MA 1IZ1A 3M7GA 3AG2H 4GFBA 1WFXA 3JTHA 3LMMA 1R4MB 2HDCA 2DAOA 3W2AA 2K7LA 2LG4A 2ZXHA 4BACA 1MIJA 1OCPA 1SFEA 2WY7Q 2MLKA 4NC6A 4PDKA 2KL4A 4R1HA 1LB2A 1QBJA 2DFHA 2CV2A 2NVQJ 4YFNF 4X0GA 5DD8A 3D5LA 4C30A 4OIRF 2QM3A 3WU1B 1X1PA 2FQ4A 2CQKA 3CCYA 4XLFA 2FMLA 4XRFA 2FJ1A 3ZGKA 3W6VA 4BBSJ 1MBJA 3K69A 4A2UA 1V4RA 2ZC2A 3CESA 2PN6A 2LKPA 4LLLA 1RESA 5LHIA 1VQ5I 5FD6A 4KMFA 3G71I 1SMYF 3TO7A 1FBSA 4BJ6C 4HF0A 3FHZA 3KEQA 1RR7A 3GTKJ 5JI6A 3GYHX 5GAGJ 2MLGA 4HA8A 3K0LA 4I98B 2E2HJ 2ZJ2A 5GPCA 2L5QA 2CQXA 3AL0B 2ID3A 3DKXA 2YS9A 2VQLA 3LA2A 3BR2A 1DGRM 2CSOA 1WKMA 4NC7A 1R00A 3MWMA 1T2KA 1SAXA 3RZOJ 2R93J 3T5XA 1YRNA 3H9JA 3DKWA 1L0OC 3DQVC 5KAFC 2VJ5A 1FBUA 1W0TA 1Q1HA 3W6JB 4ZJZA 4LB5A 3FBNB 1P6RA 2M0CA 4II3A 1BR4A 3CQZJ 1KYWA 3H3ZA 4IL6C 2OA4A 4E7ZA 4IQ4A 2DT6A 2EFQA 2EZIA 1XCBA 5DUKA 4C2MJ 2OPTA 1DP3A 1JUPA 2X85A 4Y7NJ 2VBWA 4BQQA 2K27A 4MTDA 1UJ8A 2O03A 5K5RA 2ZB9A 3OIOA 2JJ7A 3TDUC 1GXQA 5J8CA 3KFWX 3SZGA 2H1LA 2XSJC 4B3AA 5IP6A 2B63J 4XNFA 1H8AC 3L09A 5DM6F 5KNLA 4XLPF 2G9WA 4NBQA 4OMYA 5KHDA 1RIOH 2LY2A 1REPC 1APLC 3BJAA 4B43A 1FIPA 3JRCA 3HEFA 3FISA 1O4XA 1BOAA 5J1UA 1O7LA 1TZLA 2GIZA 1K7AA 1H89C 1W36D 2IEKA 1SFOJ 2DMQA 4HLYA 2Z1DA 1PUEE 2NS7A 3K70D 5EEGA 2A6TA 1GV2A 1Z3YA 5C3EJ 3CDLA 3BTIA 3WU2C 3RTRA 1W7PA 1XN7A 3IL2A 1RR8C 2VN2A 5FKLA 4JOMA 2IGKA 3KCCA 3HG9A 2GLOA 3HYIA 3OYDA 1BC7C 2M2EA 4NNJA 4ZH4F 2NRAC 4XLAA 2QQBA 1X1CA 2DA7A 1KQ0A 4XORA 2Q8KA 1HW1A 1W0UA 2Y0MA 1S5LC 2KP6A 3FMSA 1MW7A 1LE8B 2BY1A 5L3CA 1O57A 4JX4A 5C4JJ 4EMSA 2GOXB 4BXUA 4CYCB 2M3AA 1N77A 2WA0A 4HQMA 1TL8A 2LR8A 4BEHB 2FBKA 1OLTA 1YHQI 1X1BA 1U3EM 1LKXA 4FT8A 1UG0A 1PP8F 5K5OA 3PUFA 2CQQA 3KE2A 2VPLA 3ERMA 1Y8RB 2DOEA 3MKLA 3I64A 2YPRA 1X3ZB 3UR3C 2V26A 3BOQA 1V54H 2ZXIA 2W00A 3VEPA 1HQCA 2HOTA 4MGRA 2FUG2 3RKYA 3ABMH 3WTVC 3CLOA 1FNNA 3BROA 1WSUA 1V3FA 3I53A 2CV0A 2LFBA 4HSTA 3P7NA 2EH3A 4YFXF 2H6CA 2H1KA 1MBHA 2XAQA 3SQNA 1W7PD 4Q48A 2MFZA 3LSPA 1I50J 2E60A 1U2WA 4UV8A 4E7IA 2KRHA 3PL8A 1IRGA 1NG6A 2QEXI 2XV4S 4B3XA 5IY5H 3OYLA 2EILH 5LD2C 2LTPA 1MNDA 2V1NA 4G94A 2BE5F 3IC7A 1MBFA 3F22A 2OBPA 2K5CA 1B1BA 2BXZA 2V6EA 4ZYHA 3F8NA 1FLIA 2D1HA 4KNYA 4NC8A 2ISYA 2R5YA 4M6VA 1P2FA 5L3DA 1FSEA 2HI3A 4JX6A 1UZCA 3EUHC 2E1OA 1O3SA 2PEXA 3Q0WA 2R7WA 1W1WE 1WJEA 4BHBA 2JA2A 3F6OA 3I58A 3SDBA 3BR3A 3U21A 3C3WA 4B09A 4BU2A 1WZ2A 3QP6A 3AG1H 1ZGWA 1YJNI 2EJRA 5HODA 3CCRI 3TMOA 1ZH5A 5E17F 3HXLA 2ZBKA 4F91B 5LGTA 1ZLKA 2GZWA 5IYBJ 3H0DA 1RC9A 2QQ9A 4AUXA 1YX5A 1MH3A 5DCFA 1I3QJ 4M6XA 1ZRDA 2KKOA 3R6SA 1WJCA 5IT3A 4MQ9F 5LLQA 3HL2A 3H9GA 2CRGA 5EGOA 2G7UA 2JVHA 2M4KA 2DODA 3OL3A 1TT5B 1CF7A 3EYYA 1MNMC 1HC8A 3EETA 5D8KB 4A3CJ 3P9CA 3CMMA 1LFBA 1HKSA 3FXQA 2MD5A 5TISC 1BI3A 2HKOA 2K4JA 2QF7A 4Y3OA 1EF4A 1EV7A 4XK4A 2ZNYA 4Y4RA 4PJLA 2MYSA 5IYDJ 5GP9A 1H9GA 1HF0A 5LRRA 1VQNI 3SEZA 2JPBA 2RQQA 4W97A 2OJED 2Q2EB 3ASNH 4FHTA 1SVMA 4CYDA 1SAUA 1Y1VJ 1IW7F 1UFMA 2FNAA 3RYRA 1AKHB 3QOPA 2VOPA 3BQYA 2CQNA 1TW3A 2BYVE 4ZYAA 1W5CC 3OV8A 3GFJA 2HFHA 2FOWA 5HLHA 4ENNA 1VQMI 3FXMA 4ON0A 1R23A 3M07A 2EIKH 4AIHA 1FOYA 2DBBA 4G6QA 5CQEA 1D0XA 2ZMEA 1JTXA 2WTEA 1RNLA 2QWWA 1BW6A 2XC7A 2LVSA 4HNTA 2Z5UA 5GTIC 2XROA 2DOFA 2M7BA 3DEEA 2LBFB 3CC7I 3CCJI 2DT7B 2BY0A 3K1MA 1R49A 1K4SA 2R7DA 2GIVA 3KZIC 4IHVA 2AQEA 1GV5A 4ZZLA 1OCCH 1TWFJ 1XGOA 1YJ9I 4X1EA 3ZQCA 2M8EA 5LBQA 4MO7A 2KT0A 5E1XA 1W5SA 2KPMA 3BG5A 3A01A 3WHCA 3WGHA 2Z9OA 3DLAA 5ICEA 3JR9A 1KU2A 1Z6TA 2DN0A 3M8JA 1A6QA 5LGNA 3RPUD 2KLOA 2MC3A 2L01A 2K40A 4AU7A 3L7WA 2EFWA 5DDGA 3I59A 1IF1A 2Y9YA 1TTYA 5H20A 4ZTFA 2LDUA 4BS9A 1OCTC 3K10A 2AXLA 3CCVI 3R61A 3BC8A 1Z1DA 1J9IA 2RQPA 1TWHJ 1FPQA 1FMWA 4WF2A 1CQTA 3LFUA 1B8IB 3HRSA 2YU9J 3OYAA 3J80Z 4E7HA 3DBHB 1Y1WJ 2R7XA 4UXNA 4BHPA 1MSEC 2VQHA 4JX5A 3OS0A 1O7FA 2AS5F 4D7MA 4LMYA 4BJTA 2MH9A 3CC2I 5GAHJ 2E35A 5HOOA 3G6EI 4A5MA 1G3SA 2EFPA 3C1DA 3I56I 4RGSA 1IUYA 1G3WA 2VUMJ 2Y0SN 1HDPA 3IRRA 1WJAA 4L9VA 2GXAA 2RREA 3GTJJ 2ZCWA 4A0YA 3PQJA 3SYTA 4LD5A 3SZTA 1ZR2A 2E5ZA 5D4SA 4M9XA 2V9VA 1T8IA 2ECCA 3R60A 3KP5A 2L7ZA 4HNVA 4MHGA 3CO7C 5DCMB 2VJ4A 3L9FA 3P9KA 2EIMH 2G7HA 3C7JA 1TWCJ 2R3SA 2XGXA 1ZG5A 5DD4A 1J75A 1LDJA 2PMHA 2FEZA 2M30A 2DTRA 1NK3P 2JSPA 4L18B 1SANA 3QYBA 2HXOA 4I99C 1GDTA 3DLLF 2KJBA 1AA7A 1HSTA 1D1AA 3BPXA 2V1XA 3BPVA 4JYKA 3PFIA 1U5TB 2UXNA 3H92A 2CWEA 1FOWA 2CO5A 2Q1ZB 3F72A 3QOEA 2UV1A 4PGGA 1FYKA 1YO5C 1R5GA 2KIUA 4G12A 1FYMA 3NRVA 3HOUJ 2FA5A 3HRTA 3PSIA 1ZRCA 3KP6A 2M8GX 2ECBA 3CCLI 4BH9A 2CUJA 3U1DA 1VQ6I 2FSWA 2X9DA 4AIJA 5LGUA 2IS1A 4Y13A 5BPDA 2NVXJ 3PSFA 1IGNA 1XTAA 2HS5A 4WXDA 2DMNA 5F0CA 2BEOA 3REOA 1RUOA 3ZOBA 2VL8A 2KZVA 5E8IA 4XIDA 2QBYA 1BI1A 2HGCA 1BC8C 4BDYA 3BG3A 1YW8A 4C3HJ 3GTMJ 3E5UA 4KN4X 3RYPA 2L4AA 2EZLA 4EJTA 3HKZA 5F64A 5IP9J 2UZKA 1SFXA 3ZMZA 1H9TA 3ZN0A 4KUMA 3G3ZA 5M5YJ 2IGMA 4XMYA 3U2RA 4BE1A 2DI3A 3HOZJ 2EIJH 1PUFB 3IV5A 2XKOA 3K4BA 1ZG3A 4ZDPA 5E3OA 3VYRB 3UKGA 3CC4I 5CKTA 4BUPA 3GTPJ 1WI9A 3LQRA 1FX7A 1HBXG 4C3JJ 2QA4I 4A3MJ 5D6FA 5BS6A 5F0HA 1X3WB 2F48A 3FWEA 2Y0SA 3AG3H 3O2PE 3RZDJ 1K4TA 1USSA 3V8JA 3CUQC 4UUSA 3I4NJ 4U0VA 5ILUA 5IOZA 2DU9A 4F3QA 1UHSA 4I01A 2WB1N 1Y39A 5HVQC 1G6NA 1MH4A 1JGSA 5F1RA 4M3BA 2P81A 4E70A 1FSHA 2V9PA 3OL4A 1PVEA 3TBIA 1QO0D 4LJZF 1QA6A 3Q0VA 3HC7A 5L3GA 2COMA 2R7SA 1WCMJ 3DWLE 2GQQA 3LSTA 3R4KA 2DJIA 4B4CA 4NB5A 3IHUA 1T39A 3I9V2 5FKOA 4RLQA 2V7FA 4YG2F 1U78A 1IC8A 3ML6A 3ONQA 1GVDA 4I7HA 4RBOA 2L9RA 5F04A 3T8RA 4HRIA 2KJCA 3BR0A 3DKYA 2QENA 2LD5A 3C2BA 2FD5A 3WE3A 4LG0A 2ESNA 5J8FA 1ZYRF 3F9KA 4UUVA 2Y69H 2E5NA 2LY1A 3LFKA 3CF5F 1K6OA 2XAFA 1J59A 3ABLH 2L4MA 2ICWG 3VFZA 4PFPA 2ZFUA 3OYIA 2CUZA 3X2QH 3ZPLA 4IRGA 1OYWA 2PMZN 1A5JA 3RDIA 1RKTA 2GXBA 1KU9A 1T95A 2YUSA 3K4NA 5JR3A 3R0AA 4RB3C 1Z67A 3K2AA 4LLNA 2ELHA 5FROA 4XQFA 5E3LA 1RKWA 1XPXA 4M9SA 1F43A 2VBZA 1DDNA 4KFCA 4LFUA 3NWSA 4PCQA 5DUIA 4QPQA 4CDGA 3MCZA 1WRJA 2PX9A 3BZCA 4U7BA 1TQIA 3L2RA 1TQPA 4NUBA 3FBIB 2P6SA 2VT2A 3GEZA 1J2XA 4TV7A 4A3LJ 4MFDA 3COAC 2QZ8A 1ON2A 2BZTA 4II2A 1UCRA 2QCOA 2X6XA 4E7LA 2FX0A 5CVVA 2XHKA 3HTUA 1UHWA 4DBQA 1SD5A 3RSNA 1U9OA 1JHHA 1B72B 3S32A 2EFNA 4RB2C 1KONA 2KISA 1FMVA 2L2OA 1XG1A 4I2OA 3I54A 3KZYA 1ETXA 3EUAA 5CVUA 4ENKA 1R71A 2CUEA 4BY7J 3JTGA 1GT0C 2R7ZJ 2OQRA 3HOWJ 5AIQA 4RAYA 1LVKA 1XGMA 1LQ1A 4IKFA 3RKWA 2R5ZB 1S8NA 1OYYA 1WJBA 3L2UA 5HLIA 3ECHA 3FKJA 1JJ6C 4XL9A 4D7NA 3OR1C 5F6FA 1NTCA 5H6QA 3TL4X 4LB6B 5FD5A 4UHTA 1LUJB 4GDFA 1B6AA 2DFEA 2I5UA 1BL0A 4H0EA 3V7CA 2O6GE 1YOVB 1HOMA 3ERED 2W4SA 1TBXA 3CMYA 1PYVA 3ABTA 4PJJA 1F5TA 1JUSA 2JSCA 3H5RA 2JUGA 3K1PA 1VQKI 1QU3A 3HGGA 1JKQC 3V8LA 2K9QA 1Z6RA 2ME6A 1QQIA 2HQAA 5FKNA 2W24A 3HOSA 5GPAA 3FXRA 4MNUA 3TO6A 1MGTA 3LL7A 4U88A 2NYXA 2UUZA 4DOZA 2CFOA 2MH2A 3Q0UA 4G6DA 4RDUA 4HNUA 2PMZA 1ONVA 1XSXA 3HPHA 1MDMB 1ON1A 4XN3A 2MC4A 4BDZA 1LPQA 2LYCA 2R7QA 1VFCA 1ZQ3P 2QKMB 2VXDA 1T98A 1LFPA 4U0WA 4HQEA 4IRIA 3BY6A 2HKXA 3IWFA 3JREA 1JHFA 3WTWC 2XPUA 3F3XA 2LMDA 4IOCF 2FXAA 2GAUA 1D0YA 1D1CA 3F21A 2CU7A 3TDZC 5LFAA 3CZ6A 2E7XA 2B0LA 5HDGA 3CCMI 1C0WA 2EFOA 1R58A 2IA2A 2TDXA 4GYIA 2EA2A 3O8HA 1Z9CA 3K4LA 4FE7A 3GFLA 2YX4A 5BPIA 2B9SA 1LE8A 1BOBA 1ZLJA 1U8RA 2JA8J 1S9HA 2DA5A 3M4OJ 2K86A 5AIPA 2FBIA 2K9LA 1P92A 3IUOA 4CYCA 4JQFA 4UVAA 1JKRC 2Z99A 1RUNA 1S3JA 4BEHA 2J5PA 4RS8A 3ZMSA 1X19A 5JFRA 2DYSH 1Z05A 1UG2A 5ERIA 2M5WA 2H8RA 4C9YA 5BQTA 4XKCA 3U9GA 3S1NJ 2KDOA 3DEWA 3SFIA 4IHTA 2EV6A 5HLGA 1T08B 4LLGF 2VQGA 3CCEI 1IDYA 2YSRA 3MKZA 5HS8A 2A5YB 2EZKA 4NDLA 2OCCH 1E17A 5KCMA 1FIAA 1TQMA 1T38A 2KFDA 1FWZA 2DPUA 2ZJRF 2X0LA 4XSXF 4P9FA 3LSJA 2WC2A 4C2UA 2EQRA 3L00A 4XLEA 1YW7A 3SDGA 4BQOA 1ZN2A 3OYCA 1BM9A 4XN0A 3BWGA 4A3EJ 4PK4A 3KLOA 2IS4A 1SVLA 1RZ4A 2F4MB 2PMUA 2VQCA 3KLNA 4CO8A 5FB2A 2DA1A 3KIOA 2IA0A 1A36A 3PIOF 3S14J 2BY3A 2DFFA 3D0SA 1RPWA 3R0JA 4HG2A 1WQ2A 3QRFF 4BY1J 2QLZA 3OYNA 4RB1A 2XAUA 2F5FA 3OYGA 3GTQJ 4KIGA 1WPKA 1L3LA 3FDYA 3V4GA 1S7AA 2BHYA 3KP7A 3V8KA 3S2HJ 3A4CA 5HDKA 4YFKF 3IH4A 4A12A 3HPGA 2E34A 2IJLA 2Y31A 3W3CA 4L9NA 3FXOA 5DV5A 3H0GJ 3OYKA 3LAJA 2AO9A 1X58A 2BW3B 3PNVA 4IVNA 3E5XA 1ORKA 2IXSA 4KIBA 1JTYA 4IQJA 2Y2ZA 5TRDA 3HSRA 3NAUA 3F6VA 2DW4A 3WODF 2LF8A 3O8GA 2ID6A 3E6DA 4DZPA 2HOEA 3WTYC 1Z7UA 4UB8C 3BLYA 1FP2A 2X4HA 5B66C 3OYHA 2XRLA 3J7ZI 5CLSA 2DK5A 4LG3A 4PSXA 4XLCA 3EPZA 4L5JA 2XIGA 2ZSHB 1VQOI 2JZYA 2J5OA 3TGNA 3CDIA 1E3PA 3F0CA 3EDPA 2VKEA 3F23A 5F1JA 1D8KA 1YW9A 4UB6C 3L2QA 3J81Z 2ELKA 1K78B 4CHUA 3ISPA 2TRTA 4Q47A 4B48A 3GUDA 4YRVA 4IHSA 3K4CA 1HCRA 4L0ZB 2FE3A 1D8JA 2XAHA 1T0FA 5CVIA 1QZEA 2CH0A 1ODDA 2NVTJ 4CH7A 3HOVJ 4M71A 2DO7A 4ZTJA 5LRSA 1AWCA 4RM3A 2R7VA 2DCEA 5CVRA 2R0QC 2CJJA 1IDZA 5D5WB 3ELKA 4ZDLA 3CLQA 5F0FA 1FBQA 3WE2A 1SFUA 1MJ9A 3N05A 2G0EA 3VYUB 5HNFA 3L2VA 3GXOA 1AKHA 4BKXA 2V1DA 2VASA 4YELA 4PSWA 1E3OC 4BYYA 1SVOA 3HJEA 5JHUA 2DXIA 4XRSA 1WGXA 1IXRC 3WGGA 3A2KA 3HB9A 5D5UB 1R5HA 2MGQA 3HSEA 2PQ8A 1GUUA 2L02A 5D5XB 4ENJA 4FETA 3GTOJ 1N75A 5H2FC 4WXCA 5JLWA 1KZHA 1IN8A 3ESWB 4KT6A 4M3FA 4YIFA 2ACJA 2LBFA 3ZQIA 1XMAA 4F55A 4BXXJ 4IEJA 1W36C 5E1WA 2I8DA 2L54A 4GRIA 2CV1A 2M1BA 3OR2C 4HW0A 2L9SA 3FMRA 3K70C 3LNQA 2LF7A 1R5ID 1H0MA 5GAEJ 4O5VA 1IXCA 4CXFA 3RPUA 2N8GA 2FOKA 3KZZA 1ZARA 2ETHA 3E3VA 1JGGA 3ZP5A 2A68F 4QSHA 4IPAA 2DPDA 3DP7A 3HUGB 4CCJA 2W57A 2DOAA 1T33A 2F4OB 2JN6A 2W85A 1S29A 1YIOA 3CTAA 3VDXA 1FTZA 1FOKA 3SHFA 3VYSB 3JAMK 1HKTA 4EVIA 2NOGA 2L3DA 2E1NA 3BR6A 4XR6A 2FF4A 4M3DA 5EF6A 3GLXA 1B8IA 1A31A 1MMNA 4P96A 5FKKA 2R5YB 1S6LA 5KK1A 3IAM2 2E1MC 2IPQX 4HX4A 4DNCA 2A07F 1X2MA 1KA8A 1EH7A 2KRCA 4JBAA 2D5VA 2VKHA 3CJQB 5EYRA 1ZTRA 2JQ7A 2P7VB 1VZ0A 1MBEA 3N4MA 2HVSA 4NQWB 3FZVA 2XRNA 2YX7A 5IYCJ 1MJBA 1ZR4A 1IO2A 3HIFA 1BR1A 3CP8A 1P4AA 5J6XA 3CCQI 4ENMA 3ZQFA 1NH3A 1EA3A 2MABA 1HXDA 2OZ6A 2R7OA 3BTCA 2O0YA 5DCMA 3W2VA 3LQQA 1F4KA 1VNDA 4FASD 1JKOC 2XGEA 3TKYA 3DBRB 2VPRA 2A69F 3BCBA 4D5CA 2DQLA 3VWBA 1P4XA 4KN7X 3FXLA 1XGSA 2O8XA 2HQNA 3LWFA 4I76A 4AM3A 1OR7A 4DYCA 2D2WA 2MG4A 5J1RA 2XUBA 1DP7P 2ELJA 3KX2A 3GTLJ 1B59A 5FJ8J 1XSDA 3CUQB 3H1CA 2DDBA 3ECOA 5E3MA 2PJPA 2JA6J 4L9JA 1U5TA 4FISA 5E3NA 1RI7A 2VKVA 4P55A 2VODA 4Y15A 2H09A 2JA7J 4DQ2A 1VQ7I 2XGCA 3ZR8X 4ZZDA 2P5KA 4B47A 1KYZA 2Z16A 4AD9A 4C2TA 3BZ6A 1I6HJ 3QU3A 4QWQA 3FKIJ 2DA2A 1YITI 1IN4A 3CO6C 5J3LA 2JRMA 3F8CA 3Q9SA 2ZFWA 3FXUA 3SEQA 2XSDC 3NARA 3S1QJ 3BP8A 2BHZA 2DQRA 3VPRA 2FNPA 4XONA 3DU6A 4FE4A 1G3YA 4D0PA 3E0JB 3IRQA 1HKQA 2M4GA 2O3FA 3B6AA 2VXZA 3C2HA 3S93A 1MBKA 5FLXK 3BG6A 3QP5A 2ZKZA 2OF7A 4G8XA 1GVJA 5EG0B 1A6IA 3NWTA 3EQLF 1R6RA 1Y8QB 1R1TA 2DMTA 4G6TB 1YX3A 4XRMA 4V2FA 3L2CA 3I55I 3W2WA 4CCMA 4I0AA 4PGHA 1PUFA 5E20A 2OTLI 3A01B 3CUOA 3FX3A 3F8BA 4BBRJ 2X48A 4YEJA 4C3IJ 2DDAA 2L7MP 4N4NB 1SC7A 1R9TJ 4BNCA 4H4KC 2ESHA 2DMUA 2IP2A 1MSFC 1W4MA 4BJ5C 2OV7A 3TO9A 3ULQB 2NVUB 3GMEA 2FRHA 2BY2A 2WADA 1JKPC 5CYVA 2WV1A 2NXNB 1FZPB 4HAMA 3LSIA 4GGGA 4I02A 2NNNA 2XAJA 3RQIA 4ASNA 1YI2I 2E2JJ 2RNGA 4B1RA 2V9KA 2F5CA 2H8WA 5FFZA 4AIDA 3WTTC 5EEAA 2NAZA 3MN2A 4E4HA 2AQFA 1ZG1A 1MBGA 4WWCA 3FM3A 3FXJA 4HF2A 2M7AA 3P5JA 2BGCA 3OWTA 4PUSA 5ILSA 3V7RA 4S0HB 4EATA 3WHBA 4RGXA 3C18A 1IUFA 1MMSA 2P0WA 3FMQA 2LP0A 4M72A 2EV5A 3QQAA 4F7ZA 2HOAA 4RAZA 5B1BH 3ZMUA 1AU7A 5AONA 2ZXWH 4L5IA 4UV9A 4MQVA 2EPFA 1J09A 4LK0F 4GCVA 3DF8A 4IZZA 1TNTA 1HW5A 1X1AA 3MKWB 3K9TA 3SXYA 5B5EC 3MZYA 1IN5A 1OFCX 3GBGA 2PJRB 1J0RA 1XSVA 4Z6YA 5FRNA 3KP4A 4IHWA 2OCEA 4E7JA 4EJUA 2CQ7A 1T56A 3JRAA 3PM1A 3HOTA 1XB4A 1ETOA 1B9MA 5CPRB 2VE8A 5ICCA 1TT0A 4HF1A 2HTJA 1VTNC 2CFXA 1JT0A 3RQ4A 3Q3SA 1O3TA 2O9LA 3QAHA 2B7EA 2WV0A 2LLKA 3DPTA 4J00A 1Z3XA 3ZRGA 1FT9A 1YQAA 3QPLA 5EZHA 3HDDA 4D5FA 1LJ9A 1QNTA 2NVYJ 3BT9A 3GO5A 2L7FP 1I5ZA 1B72A 2VBXA 2VJJA 3KP3A 4N0BA 3TOBA 3WTXC 3A02A 2CYYA 1U6GA 2M0MA 3CMEI 3GLLA 1ETWA 5E79C 2HPIA 4DZJA 1I3AA 2IVMA 4L5EA 4LK1F 1WJFA 3ABUA 2CGPA 1ENHA 2ZMEC 1ERDA 1V5EA 3LSGA 3VOEA 1HDDC 5BMZA 1ZHFA 3ZQGA 2K9MA 1Y56A 2CS3A 1EH6A 4AWXB 4S05A 1X3UA 2DMPA 3PO2J 2R5ZA 4B8XA 3QPHA 5DS9A 2QYOA 4RAGA 5KVRA 1QZYA 2M9HA 1FEXA 4PZJA 5EDNA 1FC3A 2BOLA 3BR1A 1LEBA 2EK5A 1ZK8A 3GWZA 3QU6A 3WU0A 3ZMVA 3MEXA 1CGPA 5J1YA 4Q4ZF 3I4PA 4JK1X 4M74A 5CQGA 2VONA 1IRFA 2GXGA 2L7KA 2RKHA 1X2NA 5IPAA 2CG4A 4I09A 2STTA 1XD7A 4GO1A 1MD0A 5E18F 2NOJB 3GVAA 3GZNB 2LREA 4RA2A 1VQ8I 4AIKA 1Z21A 5J4VA 5TJJA 1XCVA 2IGNA 2V4JC 3K7AJ 5ICGA 3BQZA 4A3BJ 9ANTA 2OD5A 2PBIA 1TC3C 3G73A 2VB6A 3DTIA 3J7YJ 3JRBA 1ZGAA 1I39A 5TGTA 1N25A 1FY7A 5JHFA 2GBYA 2Y48A 3HHGA 3K2ZA 4PJMA 3LSRA 2NNYA 2P8TA 3OMYA 3IAS2 2RN7A 3L2WA 2K3FA 1G59A 3GFMA 4M9ZA 5F08A 1F36A 2CW0F 2Z3YA 1OCOH 2KIMA 1RRJA 1OMIA 3ZCOA 3JRGA 2GM4A 2ISZA 1QVUA 2WB1A 1G2HA 1JE8A 3DTEA 3JRFA 2PFBA 3L1PA 3ZQQA 1YE9A 3I5UA 1IG7A 4KITB 5HLTA 1LEAA 1X4PA 3ZQHA 2PI0A 1WH7A 2HYFA 5FO5A 2VE9A 2R7FA 2LC2A 4M3EA 4YIIA 5L3EA 1BJAA 5FLXZ 3WGIA 3OYMA 3QPTA 2R92J 2KDZA 2DA3A 1ETQA 5A2QK 1Z91A 1O3QA 1V5GA 1H88C 2XF7A 3K6GA 3EUHA 5LHHA 1YFHA 4HX7A 4UUTA 2XAGA 2JWTA 3QYFA 1BBYA 1ZAOA 5K7ZA 4OIOF 2I10A 2F5DA 3O6BB 1VQ4I 4XKWA 1I6XA 1WWXA 4CICA 2UXXA 5M5WJ 2C6YA 1LNWA 3SZPA 3E6BA 3TP3A 2EA4A 1MNEA 1LFUP 2LY9A 4LITA 4UVBA 1D1BA 5LEJA 2A5WA 2KIQA 3WTSC 5JVGF 4WXHA 1QPMA 4RGUA 5J47A 2HEOA 1NHAA 3OS2A 2R7RA 1WI3A 4F92B 1JXSA 4WX9A 5K5QA 4S04A 4UY8I 1QPIA 2OC6A 2MSYA 3NEUA 4GYGA 3TP0A 3V7SA 2EV0A 2DA4A 2V6CA 2K4BA 2MW8A 3B6CA 1JJ8C 2VBYA 3MZ8A 4EM1A 4FTHA 3FK7A 1PP7U 2IS2A 1UAAA 1UELB 2ZNZA 2OQGA 3CJRB 1IV8A 3B73A 1KU3A 2QQAA 2X51A 1S7OA 1D0ZA 2XASA 2ADUA 3E1SA 3LA7A 4G9YA 1GLNA 2HWVA 4OIQF 3B02A 4LOCA 3S1RJ 2W7NA 4I0BA 2VIXA 3KYCB 2VI6A 3BCAA 4FQGA 2WY8Q 1WVRA 3TW6A 2BW3A 3M8FA 4RB0A 2JA5J 2ZJPF 1XGNA 4XICA 3H35A 1IJWC 2RC4A 1USTA 3HOXJ 3HRMA 2A3SA 4DYQA 3M3YJ 3G2BA 5GADJ 2IW5A 3MZHA 4B44A 2AHQA 4BE0A 2X6WA 3KEOA 1JI8A 4F52A 1V5FA 3VYTB 4Q5SF 1X4OA 2AXTC 4MTEA 3QWLA 3S2DJ 1OCRH 5FLVA 3CP2A 2BXYA 2H6BA 5M5XJ 4HBLA 2GA2A 3CCSI 1YRNB 2R7TA 4CSWA 3S17J 4HYEA 1MMDA 2DYRH 2E1CA 3G1LA 3T0YA 2ME0A 1IXSB 2W84A 3DTKA 5FKMA 5K7HA 2H27A 2EB7A 2P5VA 4HOBA 3AFHA 1K78A 1WJ5A 4A5NA 4EJVA 4OAZA 5M3FJ 3HGYA 5CVJA 3GFIA 4PJ0C 2K02A 5K1YA 4IOAF 2K9NA 1Z0XA 3CDHA 2DT5A 3WTZA 4A3JJ 3K4KA 4HPQA 4EJWA 4QTRA 5F27A 5LEKA 2A05A 4NHJA 4HEA2 2JK3A 4J19A 3J80K 2JUCA 5ED4A 2XB5A 4DBRA 1FJLA 3SFZA 2UWMA 3A0HC 2E1MB 3CMAI 1TWGJ 4A3KJ 1U8BA 4A69C 1OKRA 3MKYB 2HYGD 2LKSA 2HPMA 2X1DA 3H3VK 3S1MJ 1LDKB 1YLFA 4IF4A 1OCZH 4E7KA 4O3MA 3GZ6A 2KMUA 2IGOA 2FU4A 5D4RA 1Y0UA 5J4YA 5KAIC 1IN7A 3JSPA 1DUXC 1R1UA 4KISA 3QPSA 3OSGA 4MEXF 3K4JA 1HLVA 1DPRA 2L9VA 3FK6A 3IH2A 3MD2A 3BTLA 3VSKA 3RCOA 1ZKGA 3M8EA 3HHHA 2F5VA 3DEUA 2RAEA 1S7EA 2EINH 2A6EF 3AL0C 4CZZA 1W7PB 3NQOA 4W1UA 1BA5A 3BJOA 3DV8A 2CW7A 2LRDA 1P4WA 5IT9K 2F6CA 3I3LA 2R7UA 1FYLA 2M87A 3A03A 3HUGA 4R79A 4FX4A 2HVRA 1TWAJ 4CGZA 2LSOA 4V2GA 3U1KA 1MKMA 2Q2EA 1Y0NA 3KETA 3KPHA 4FX0A 1U0JA 5D5VB 4PJNA 3S15J 5DTDA 1XC5A 3QODA 4N9HA 1ZRFA 5EJCA 3I4MJ 4AVPA 4R8HA 6PAXA 5M3MJ 4CCOA 4YIRX 3HRUA 4CZCA 2JPCA 4HSRA 3LAPA 5J40A 1BN5A 4XKBA 5LHGA 4D1QA 2JTVA 5A2QZ 4HDVA 2K9SA 1X1DA 3RKXA 1A04A 2GA1A 1O3RA 3HTSB 4IHXA 4A6DA 1DQUA 1QHGA 5FRMA 2E2IJ 3OIQA 2DA6A 3D5SC 1UB9A 4MIMA 3S16J 4HLXA 4ESBA 4ITVA 1ACIA 2ZXJA 3M1EA 3PFYA 2IAIA 1VI0A 4NQWA 3N97A 3LSMA 2X6YA 4RGRA 3ABKH 2HOSA 1QGPA 2X1EA 4WK8F 4KICA 3AKZA 3S3OA 4EQQA 5HDNA 2CW8A 3S2WA 3DXJF 3TQNA 4A3GJ 2GOMA 4XLNF 2MBFA 2Z2SB 4CUGA 3CJNA 3D5RC 3E6CC 1R36A 4QPOA 4JP0A 4IHYA 2IBDA 2XB0X 2XVCA 2K3PA 3LOCA 4KT5C 4HV6A 2QSHX 1ULYA 1EH8A 1DGWY 1QVTA 4DJAA 4L0YB 5HS9A 1TP4A 3CF2A 3CUQA 1Z77A 4BQAA 1JUMA 4EJOA 1PDNC 1AOYA 4N9IA 4HZFA 1SD7A 5DEQA 2O5RA 3CD6I 2E7WA 4M6YA 3Q9VA 1MMAA 5L3BA 2YU3A 3JW4A 1YS6A 4A0XA 2MD0A 2JMWA 1KU7A 3G1MA 3JSOA 3DPUA 1OPCA 4IX7A 4ZDOA 4XM3A 4X6AJ 4OU0A 2WAFA 4DYRA 2HVQA 3BG7A 2O7OA 4OMZA 2NS8A 2VT3A 2HZTA 3TW7A 4EM2A 4Z2YA 3J7AO 3D1NI 2VC0A 2W48A 2XKPA 3F8MA 4OAYA 5E8GA 2RDPA 3GZ5A 1BR2A 2L0KA 3ZQ7A 3KP2A 2Z33A 1JT6A 4DGWB 1FP1D 1STZA 4EV0A 5EGOB 1N78A 4RLFA 5EG0A 4Y17A 3E6MA 3PIPF 1CF7B 4ZC3A 1F1ZA 3OOUA 4QIWN 2HZDA 3ASOH 1MMGA 3UNGC 2WAQN 4BXFA 3MAJA 3I0TA 1QHHD 1R7JA 2LNBA 1VQLI 1P7JA 3FIWA 1Y6IA 3ZMTA 2E19A 2QQ8A 1OQYA 2WAEA 4P1WA 2V79A 3IH3A 4BL0B 4MLOA 4XOTA 4K2EA 3OY9A 3P9IA 1HA8A 4GXOA 3CJTB 3MQ0A 1R22A 4G7ZF 5FLMJ 2LOOA 2PLYA 2BBYA 5JLXA 1I1SA 1I1GA 5IOYA 2FMYA 4KYWA 3S8PA 4RM2A 2BVLA 4EM0B 1IAWA 2COBA 3WG7H 3H5AA 4J01A 1ETYA 3HKZN 2OUMA 3OOPA 1I27A 4LIUA 2RV8A 2XPWA 1OJLA 3G1OA 4Y52J 3Q5FA 4A6EA 5JVTA 1FOXA 2MA3A 1UHMA 2BV6A 4IO9F 1OYIA 4OOIA 2Y30A 3BJ6A 3ZQLA 1J7KA 4IJAA 4M3GA 3RI4A 3S3MA 4A0ZA 3AAFA 3BZKA 1A35A 1KQ9A 1XX5A 2QKLB 3HZJA 3MFKA 2WBMA 3E7LA 1SD6A 2CMPA 2ZMEB 4A3DJ 2LH9A 5ILVA 1S72I 3LSKA 4EGZA 1SEUA 1HW2A 1GHCA 3ZXSA 3KYDB 4G7OF 2TCTA 1LDDA 2RVCA 1E0EA 2W25A 1PJRA 3RJPA 3HBLA 3GTGJ 3A1YA 2XPVA 5K7FA 4HDUA 2LK2A 4O6JA 3FHNA 4CCNA 4EGYA 1HSJA 2HNHA 2P4WA 3FM5A 3IKTA 4XKVA 3PNYA 5HS7A 1LVAA 1VF9A 2VOOA 5ICFA 2H94A 2F5EA 2XDVA 2F2EA 1YG2A 4ESFA 1UMQA 4ZYGA 3PO3J 3TOAA 3E5QA 3WTUC 1QZZA 2FBHA 1K79A 1D3YA 1SFKA 3PJRA 3RPQA 1OISA 3I59B 2PJRA 1T0FC 1XS9A 2DJNA 5E1ZB 3MVPA 2HU9A 2EWNA 3PUBA 3G4SI 4Y33A 1ETVA 1G8XA 1E3HA 4E6KG 2HXIA 2VJIA 5IT9Z 5IP7J 4PFOA 2LKXA 2P7CB 1D5VA 1KGSA
chains in the Genus database with same CATH topology
1POGA 5IYDJ 1P7IA 5GP9A 4A3EJ 2HQ5A 1HF0A 1K61A 2DTZA 3LSRA 2GBYA 4W97A 5F08A 2DA1A 1F36A 3S14J 1QRYA 1RPWA 1Y1VJ 4BY1J 4AYBN 3JRGA 2GM4A 1QVUA 1G2HA 2X6OA 3GTQJ 1AKHB 1WPKA 3JRFA 3BQYA 3L1PA 1IG7A 3S2HJ 1D5YA 3IH4A 3HM5A 3ZQHA 2HDDA 1WH7A 2Y31A 3DCFA 3H0GJ 4ABZA 4M3EA 2XGDA 2AO9A 1X58A 2HYJA 4A3FJ 1ORKA 2R92J 2KDZA 1JTYA 1ETQA 2DA3A 3JRDA 2Y2ZA 1H88C 1JTXA 1BW6A 4A3IJ 2LVSA 3NAUA 1U9NA 3O8GA 4UUTA 2JWTA 2ID6A 3BR5A 4DZPA 1BJZA 3JRIA 5K7ZA 3RKQA 4IHVA 2I10A 1GV5A 2XRLA 1TWFJ 4X1EA 3ZQCA 4MO7A 2KT0A 1K83J 3A01A 3BG5A 5M5WJ 3WHCA 3JR9A 2DN0A 3F0CA 4DW6A 4I6ZA 3TP3A 2VKEA 1LFUP 2LY9A 1ITYA 5F1JA 2K40A 4MFEA 1AHDP 2ELKA 2Y9YA 2TRTA 1OCTC 1NK2P 1HCRA 1WI3A 1TWHJ 1CQTA 4FCYA 1B8IB 2NVTJ 2YU9J 3HOVJ 1QPIA 2MSYA 1Y1WJ 1MSEC 3TP0A 1ETKA 4JX5A 2DA4A 3B6CA 1JJ8C 2MW8A 5EZGA 4FTHA 3FK7A 2R0QC 2CJJA 1IDZA 4D7MA 4AC0A 5F0FA 2G0EA 3HOYJ 1AKHA 4BKXA 4EEFG 2VUMJ 2Y0SN 1HDPA 3GTJJ 1E3OC 1WH5A 4LOCA 3S1RJ 1ZR2A 1RETA 1WGXA 4XRSA 3HB9A 2ECCA 2VI6A 2MGQA 3TW6A 2L7ZA 4HNVA 2JA5J 1GUUA 2Y9ZA 3GTOJ 4XICA 2O8KA 1TWCJ 1IV6A 1IJWC 5JLWA 3HOXJ 1DU0A 2M34A 4DYQA 5C44J 3M3YJ 4M3FA 1NK3P 3ZQIA 4BXXJ 4IEJA 1SANA 2EBIA 4UUSB 2AHQA 2HXOA 3BG9A 1GDTA 3LNQA 5C4XJ 3S2DJ 2N8GA 4JYKA 5FLVA 4A93J 5M5XJ 1JGGA 1FTTA 1YRNB 1BW5A 4QSHA 3S17J 3G1LA 4G12A 3HOUJ 2ME0A 1T33A 2JN6A 5FKMA 5K7HA 1IRZA 2M8GX 2ECBA 5BNGA 3SJMA 1FTZA 1DU6A 5M3FJ 2X9DA 3HGYA 2K9NA 1Z0XA 2NOGA 2EZHA 4A3JJ 1Q1VA 3BR6A 4M3DA 4QTRA 5F27A 3BTJA 5EF6A 4XRSG 1B8IA 2NVXJ 1IGNA 3OSFA 5FKKA 2JK3A 2DMNA 5F0CA 2R5YB 3JRHA 2CUFA 4J19A 3TEDA 3ZOBA 4XIDA 2XB5A 3BG3A 4C3HJ 3GTMJ 1FJLA 2EZLA 1X2MA 4GFBA 1TWGJ 2D5VA 4A3KJ 5IP9J 1U8BA 4A69C 5EYRA 1ZTRA 1OCPA 1MBEA 5M5YJ 3H3VK 3S1MJ 2NVQJ 3HOZJ 5IYCJ 1ZR4A 1PUFB 3IV5A 5E3OA 3CCYA 2FQ4A 3UKGA 3ZQFA 4BBSJ 3W6VA 2FJ1A 1MBJA 3GTPJ 3QPSA 3OSGA 3BTCA 1HLVA 1RESA 4C3JJ 3FK6A 1VNDA 3IH2A 1JKOC 2XGEA 4A3MJ 2VPRA 3BTLA 5F0HA 4D5CA 1ZKGA 1RR7A 2RAEA 1S7EA 3GTKJ 4I76A 3RZDJ 4DYCA 2MG4A 4W1UA 4UUSA 3I4NJ 5J1RA 5IOZA 2E2HJ 3GTLJ 1BA5A 1UHSA 2WB1N 5GPCA 1MH4A 2CQXA 5FJ8J 2ID3A 2YS9A 5E3MA 2JA6J 3BR2A 4M3BA 2P81A 5E3NA 4FISA 3RZOJ 2VKVA 2R93J 1YRNA 2JA7J 3A03A 3Q0VA 2XGCA 1TWAJ 1WCMJ 4V2GA 1W0TA 4B4CA 2M0CA 1I6HJ 5FKOA 3FKIJ 1U78A 3CQZJ 1IC8A 2DA2A 3S15J 5DTDA 1GVDA 1XC5A 4RBOA 3I4MJ 2L9RA 5F04A 5J3LA 3BR0A 2EZIA 5M3MJ 2XSDC 3NARA 2LD5A 3C2BA 2FD5A 4C2MJ 2OPTA 3S1QJ 1JUPA 3VPRA 4Y7NJ 4FE4A 2K9SA 3B6AA 2ZB9A 4IHXA 3OIOA 2JJ7A 1MBKA 2E2IJ 4B3AA 2OF7A 2PMZN 5IP6A 2DA6A 2B63J 1RKTA 5EG0B 1H8AC 1A5JA 1A6IA 4MIMA 3S16J 2YUSA 3K2AA 2IAIA 5E3LA 2DMTA 1RKWA 1VI0A 1APLC 1F43A 4XRMA 2HOSA 4V2FA 1FIPA 3JRCA 3HEFA 1PUFA 3FISA 1O4XA 5J1UA 3A01B 4A3GJ 4C3IJ 4BBRJ 2X48A 1H89C 2L7MP 1R9TJ 2IEKA 1SFOJ 2DMQA 4A3LJ 2DMUA 2NS7A 4JP0A 4MFDA 1MSFC 2IBDA 2XB0X 4IHYA 1GV2A 5C3EJ 2QCOA 3LOCA 1JKPC 2FX0A 3CDLA 3BTIA 2WV1A 1QVTA 1U9OA 1B72B 5FKLA 3RQIA 2E2JJ 4B1RA 1XG1A 1Z77A 1ETXA 1JUMA 2GLOA 5EEAA 2M2EA 2CUEA 3MN2A 4BY7J 1GT0C 2R7ZJ 1MBGA 3HOWJ 2DA7A 1W0UA 1LE8B 4S0HB 2R5ZB 2JMWA 4JX4A 3WHBA 5C4JJ 1IUFA 3G1MA 4CYCB 4X6AJ 1JJ6C 2LP0A 4D7NA 3QQAA 1NTCA 2HOAA 4DYRA 2LR8A 1AU7A 2O7OA 2NS8A 1BL0A 3TW7A 3D1NI 1HOMA 2W48A 2L0KA 2CQQA 3CMYA 3MKLA 1JT6A 1JUSA 5EGOB 3HGGA 5EG0A 1JKQC 2HOTA 1OFCX 3GBGA 3OOUA 2K9QA 2ME6A 4QIWN 5FKNA 2WAQN 2LFBA 4IHWA 5GPAA 2EH3A 1P7JA 1T56A 3JRAA 2H1KA 3FIWA 3PM1A 1MBHA 2E19A 1ETOA 3IH3A 3Q0UA 4RDUA 3LSPA 1I50J 4MLOA 1JT0A 3Q3SA 2O9LA 5FLMJ 1VFCA 5JLXA 1ZQ3P 5IOYA 2LLKA 3QPLA 5EZHA 2COBA 3JREA 3HDDA 4D5FA 2LTPA 2NVYJ 2XPUA 3BT9A 1ETYA 3HKZN 2L7FP 1MBFA 1B72A 2XPWA 1OJLA 3G1OA 4Y52J 3A02A 2CU7A 1ETWA 2Y30A 4DZJA 4M3GA 3ZQLA 4L5EA 2R5YA 4M6VA 1ENHA 3LSGA 2HI3A 4JX6A 1HDDC 3E7LA 3ZQGA 2E1OA 3Q0WA 4A3DJ 3O8HA 4FE7A 1LE8A 2DMPA 3PO2J 2R5ZA 2JA8J 5DS9A 3BR3A 2DA5A 3M4OJ 1FEXA 2M9HA 2TCTA 5EDNA 3BR1A 1ZGWA 4CYCA 5HODA 1ZK8A 1JKRC 3HBLA 3GTGJ 5K7FA 2XPVA 5J1YA 2LK2A 5IYBJ 4AUXA 1MH3A 1UG2A 1I3QJ 2H8RA 1VF9A 1X2NA 5IPAA 3S1NJ 3DEWA 3SFIA 1UMQA 3PO3J 2CRGA 5EGOA 1MNMC 1IDYA 4A3CJ 1XS9A 2DJNA 1LFBA 2EZKA 4NDLA 3MVPA 1FIAA 3K7AJ 2QF7A 3BQZA 1ETVA 3LSJA 4A3BJ 9ANTA 2HXIA 1EF4A 2EQRA 5IP7J 1TC3C 3SDGA 2LKXA 4XK4A 3JRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POG A;  5IYD J;  1P7I A;  5GP9 A;  4A3E J;  2HQ5 A;  1HF0 A;  1K61 A;  2DTZ A;  3LSR A;  2GBY A;  4W97 A;  5F08 A;  2DA1 A;  1F36 A;  3S14 J;  1QRY A;  1RPW A;  1Y1V J;  4BY1 J;  4AYB N;  3JRG A;  2GM4 A;  1QVU A;  1G2H A;  2X6O A;  3GTQ J;  1AKH B;  1WPK A;  3JRF A;  3BQY A;  3L1P A;  1IG7 A;  3S2H J;  1D5Y A;  3IH4 A;  3HM5 A;  3ZQH A;  2HDD A;  1WH7 A;  2Y31 A;  3DCF A;  3H0G J;  4ABZ A;  4M3E A;  2XGD A;  2AO9 A;  1X58 A;  2HYJ A;  4A3F J;  1ORK A;  2R92 J;  2KDZ A;  1JTY A;  1ETQ A;  2DA3 A;  3JRD A;  2Y2Z A;  1H88 C;  1JTX A;  1BW6 A;  4A3I J;  2LVS A;  3NAU A;  1U9N A;  3O8G A;  4UUT A;  2JWT A;  2ID6 A;  3BR5 A;  4DZP A;  1BJZ A;  3JRI A;  5K7Z A;  3RKQ A;  4IHV A;  2I10 A;  1GV5 A;  2XRL A;  1TWF J;  4X1E A;  3ZQC A;  4MO7 A;  2KT0 A;  1K83 J;  3A01 A;  3BG5 A;  5M5W J;  3WHC A;  3JR9 A;  2DN0 A;  3F0C A;  4DW6 A;  4I6Z A;  3TP3 A;  2VKE A;  1LFU P;  2LY9 A;  1ITY A;  5F1J A;  2K40 A;  4MFE A;  1AHD P;  2ELK A;  2Y9Y A;  2TRT A;  1OCT C;  1NK2 P;  1HCR A;  1WI3 A;  1TWH J;  1CQT A;  4FCY A;  1B8I B;  2NVT J;  2YU9 J;  3HOV J;  1QPI A;  2MSY A;  1Y1W J;  1MSE C;  3TP0 A;  1ETK A;  4JX5 A;  2DA4 A;  3B6C A;  1JJ8 C;  2MW8 A;  5EZG A;  4FTH A;  3FK7 A;  2R0Q C;  2CJJ A;  1IDZ A;  4D7M A;  4AC0 A;  5F0F A;  2G0E A;  3HOY J;  1AKH A;  4BKX A;  4EEF G;  2VUM J;  2Y0S N;  1HDP A;  3GTJ J;  1E3O C;  1WH5 A;  4LOC A;  3S1R J;  1ZR2 A;  1RET A;  1WGX A;  4XRS A;  3HB9 A;  2ECC A;  2VI6 A;  2MGQ A;  3TW6 A;  2L7Z A;  4HNV A;  2JA5 J;  1GUU A;  2Y9Z A;  3GTO J;  4XIC A;  2O8K A;  1TWC J;  1IV6 A;  1IJW C;  5JLW A;  3HOX J;  1DU0 A;  2M34 A;  4DYQ A;  5C44 J;  3M3Y J;  4M3F A;  1NK3 P;  3ZQI A;  4BXX J;  4IEJ A;  1SAN A;  2EBI A;  4UUS B;  2AHQ A;  2HXO A;  3BG9 A;  1GDT A;  3LNQ A;  5C4X J;  3S2D J;  2N8G A;  4JYK A;  5FLV A;  4A93 J;  5M5X J;  1JGG A;  1FTT A;  1YRN B;  1BW5 A;  4QSH A;  3S17 J;  3G1L A;  4G12 A;  3HOU J;  2ME0 A;  1T33 A;  2JN6 A;  5FKM A;  5K7H A;  1IRZ A;  2M8G X;  2ECB A;  5BNG A;  3SJM A;  1FTZ A;  1DU6 A;  5M3F J;  2X9D A;  3HGY A;  2K9N A;  1Z0X A;  2NOG A;  2EZH A;  4A3J J;  1Q1V A;  3BR6 A;  4M3D A;  4QTR A;  5F27 A;  3BTJ A;  5EF6 A;  4XRS G;  1B8I A;  2NVX J;  1IGN A;  3OSF A;  5FKK A;  2JK3 A;  2DMN A;  5F0C A;  2R5Y B;  3JRH A;  2CUF A;  4J19 A;  3TED A;  3ZOB A;  4XID A;  2XB5 A;  3BG3 A;  4C3H J;  3GTM J;  1FJL A;  2EZL A;  1X2M A;  4GFB A;  1TWG J;  2D5V A;  4A3K J;  5IP9 J;  1U8B A;  4A69 C;  5EYR A;  1ZTR A;  1OCP A;  1MBE A;  5M5Y J;  3H3V K;  3S1M J;  2NVQ J;  3HOZ J;  5IYC J;  1ZR4 A;  1PUF B;  3IV5 A;  5E3O A;  3CCY A;  2FQ4 A;  3UKG A;  3ZQF A;  4BBS J;  3W6V A;  2FJ1 A;  1MBJ A;  3GTP J;  3QPS A;  3OSG A;  3BTC A;  1HLV A;  1RES A;  4C3J J;  3FK6 A;  1VND A;  3IH2 A;  1JKO C;  2XGE A;  4A3M J;  2VPR A;  3BTL A;  5F0H A;  4D5C A;  1ZKG A;  1RR7 A;  2RAE A;  1S7E A;  3GTK J;  4I76 A;  3RZD J;  4DYC A;  2MG4 A;  4W1U A;  4UUS A;  3I4N J;  5J1R A;  5IOZ A;  2E2H J;  3GTL J;  1BA5 A;  1UHS A;  2WB1 N;  5GPC A;  1MH4 A;  2CQX A;  5FJ8 J;  2ID3 A;  2YS9 A;  5E3M A;  2JA6 J;  3BR2 A;  4M3B A;  2P81 A;  5E3N A;  4FIS A;  3RZO J;  2VKV A;  2R93 J;  1YRN A;  2JA7 J;  3A03 A;  3Q0V A;  2XGC A;  1TWA J;  1WCM J;  4V2G A;  1W0T A;  4B4C A;  2M0C A;  1I6H J;  5FKO A;  3FKI J;  1U78 A;  3CQZ J;  1IC8 A;  2DA2 A;  3S15 J;  5DTD A;  1GVD A;  1XC5 A;  4RBO A;  3I4M J;  2L9R A;  5F04 A;  5J3L A;  3BR0 A;  2EZI A;  5M3M J;  2XSD C;  3NAR A;  2LD5 A;  3C2B A;  2FD5 A;  4C2M J;  2OPT A;  3S1Q J;  1JUP A;  3VPR A;  4Y7N J;  4FE4 A;  2K9S A;  3B6A A;  2ZB9 A;  4IHX A;  3OIO A;  2JJ7 A;  1MBK A;  2E2I J;  4B3A A;  2OF7 A;  2PMZ N;  5IP6 A;  2DA6 A;  2B63 J;  1RKT A;  5EG0 B;  1H8A C;  1A5J A;  1A6I A;  4MIM A;  3S16 J;  2YUS A;  3K2A A;  2IAI A;  5E3L A;  2DMT A;  1RKW A;  1VI0 A;  1APL C;  1F43 A;  4XRM A;  2HOS A;  4V2F A;  1FIP A;  3JRC A;  3HEF A;  1PUF A;  3FIS A;  1O4X A;  5J1U A;  3A01 B;  4A3G J;  4C3I J;  4BBR J;  2X48 A;  1H89 C;  2L7M P;  1R9T J;  2IEK A;  1SFO J;  2DMQ A;  4A3L J;  2DMU A;  2NS7 A;  4JP0 A;  4MFD A;  1MSF C;  2IBD A;  2XB0 X;  4IHY A;  1GV2 A;  5C3E J;  2QCO A;  3LOC A;  1JKP C;  2FX0 A;  3CDL A;  3BTI A;  2WV1 A;  1QVT A;  1U9O A;  1B72 B;  5FKL A;  3RQI A;  2E2J J;  4B1R A;  1XG1 A;  1Z77 A;  1ETX A;  1JUM A;  2GLO A;  5EEA A;  2M2E A;  2CUE A;  3MN2 A;  4BY7 J;  1GT0 C;  2R7Z J;  1MBG A;  3HOW J;  2DA7 A;  1W0U A;  1LE8 B;  4S0H B;  2R5Z B;  2JMW A;  4JX4 A;  3WHB A;  5C4J J;  1IUF A;  3G1M A;  4CYC B;  4X6A J;  1JJ6 C;  2LP0 A;  4D7N A;  3QQA A;  1NTC A;  2HOA A;  4DYR A;  2LR8 A;  1AU7 A;  2O7O A;  2NS8 A;  1BL0 A;  3TW7 A;  3D1N I;  1HOM A;  2W48 A;  2L0K A;  2CQQ A;  3CMY A;  3MKL A;  1JT6 A;  1JUS A;  5EGO B;  3HGG A;  5EG0 A;  1JKQ C;  2HOT A;  1OFC X;  3GBG A;  3OOU A;  2K9Q A;  2ME6 A;  4QIW N;  5FKN A;  2WAQ N;  2LFB A;  4IHW A;  5GPA A;  2EH3 A;  1P7J A;  1T56 A;  3JRA A;  2H1K A;  3FIW A;  3PM1 A;  1MBH A;  2E19 A;  1ETO A;  3IH3 A;  3Q0U A;  4RDU A;  3LSP A;  1I50 J;  4MLO A;  1JT0 A;  3Q3S A;  2O9L A;  5FLM J;  1VFC A;  5JLX A;  1ZQ3 P;  5IOY A;  2LLK A;  3QPL A;  5EZH A;  2COB A;  3JRE A;  3HDD A;  4D5F A;  2LTP A;  2NVY J;  2XPU A;  3BT9 A;  1ETY A;  3HKZ N;  2L7F P;  1MBF A;  1B72 A;  2XPW A;  1OJL A;  3G1O A;  4Y52 J;  3A02 A;  2CU7 A;  1ETW A;  2Y30 A;  4DZJ A;  4M3G A;  3ZQL A;  4L5E A;  2R5Y A;  4M6V A;  1ENH A;  3LSG A;  2HI3 A;  4JX6 A;  1HDD C;  3E7L A;  3ZQG A;  2E1O A;  3Q0W A;  4A3D J;  3O8H A;  4FE7 A;  1LE8 A;  2DMP A;  3PO2 J;  2R5Z A;  2JA8 J;  5DS9 A;  3BR3 A;  2DA5 A;  3M4O J;  1FEX A;  2M9H A;  2TCT A;  5EDN A;  3BR1 A;  1ZGW A;  4CYC A;  5HOD A;  1ZK8 A;  1JKR C;  3HBL A;  3GTG J;  5K7F A;  2XPV A;  5J1Y A;  2LK2 A;  5IYB J;  4AUX A;  1MH3 A;  1UG2 A;  1I3Q J;  2H8R A;  1VF9 A;  1X2N A;  5IPA A;  3S1N J;  3DEW A;  3SFI A;  1UMQ A;  3PO3 J;  2CRG A;  5EGO A;  1MNM C;  1IDY A;  4A3C J;  1XS9 A;  2DJN A;  1LFB A;  2EZK A;  4NDL A;  3MVP A;  1FIA A;  3K7A J;  2QF7 A;  3BQZ A;  1ETV A;  3LSJ A;  4A3B J;  9ANT A;  2HXI A;  1EF4 A;  2EQR A;  5IP7 J;  1TC3 C;  3SDG A;  2LKX A;  4XK4 A;  3JRB A; 
#chains in the Genus database with same CATH topology
 1POG A;  4BGD A;  1P7I A;  2KZG A;  3IP4 B;  2HQ5 A;  2E36 A;  1XDS A;  4QLC U;  1K61 A;  1TW2 A;  2DTZ A;  1P9Q C;  4KMU X;  4N4O B;  4CA0 A;  3S3N A;  1M1E B;  1WJD A;  4KJZ A;  4P9U A;  2WAQ A;  5B1A H;  2ZSI B;  1IRX A;  2RGV A;  2HTS A;  2D1V A;  5EEH A;  1BI2 A;  1QRY A;  4OIN F;  3ZMD A;  3H5N A;  4AYB N;  1IN6 A;  2NS0 A;  2X6O A;  1KQ8 A;  4HV5 A;  2V1U A;  1EJ9 A;  1D5Y A;  2DLL A;  3HM5 A;  2JT1 A;  2HDD A;  3DCF A;  3I71 A;  4U7D A;  1E2X A;  4P5O A;  5H6R A;  3ROU A;  5HNH A;  2IS6 A;  4ABZ A;  2XGD A;  4IXA A;  2HYJ A;  2IA1 A;  4DIQ A;  4A3F J;  2KRF A;  3JRD A;  4BAY A;  3LA3 A;  3C2G A;  4KA4 A;  3AG4 H;  4XBF A;  3KYL A;  4LGW A;  4RAF A;  3ZN1 A;  4A3I J;  4UNO A;  1U9N A;  3M1C A;  4V19 K;  3J7A Y;  2E71 A;  3CCU I;  4UVC A;  4OWR B;  3VB2 A;  3H36 A;  5B3S H;  2STW A;  2PG4 A;  3BR5 A;  1SMT A;  2R4G A;  1BJZ A;  3JRI A;  1YJW I;  2RNJ A;  3FF5 A;  1ZRE A;  1G3T A;  3V42 A;  3RKQ A;  1R4N B;  4BE2 A;  5D6E A;  1YS7 A;  2JVG A;  1W5T A;  2OU2 A;  5BOX A;  2KHM A;  2BVM A;  3OIP A;  1K83 J;  3M9A A;  3MMY B;  4M73 A;  4F93 B;  4LIV A;  3K1N A;  1B9N A;  3F8F A;  1T6S A;  2WWY A;  4DW6 A;  4I6Z A;  2XF5 A;  3EUK L;  1NG7 A;  1ITY A;  3O3K A;  3T8T A;  2IT0 A;  3IWZ A;  2F4I A;  4MFE A;  1AHD P;  4ANJ A;  4ZYE A;  3JAM Z;  2VKD A;  2QVO A;  4E7S A;  3A0B C;  1NK2 P;  1XMX A;  2Q0O A;  2L9N A;  1WHU A;  1VQ9 I;  1YTY A;  1YYV A;  4BQN A;  2HDW A;  4FCY A;  4L9T A;  1BIB A;  2OAZ A;  4BHC A;  5FFX A;  5GTH C;  4RMN A;  4G7H F;  4U87 A;  1ETK A;  3W6K B;  3E97 A;  2QBY B;  2QGU A;  2W1O A;  5EZG A;  4OIP F;  3FXK A;  2Y75 A;  3IKV A;  4AC0 A;  1MZB A;  2DFI A;  2VC1 A;  2FQ3 A;  3RIR A;  4CCK A;  3VSL A;  4ETS A;  2QSF X;  3DFG A;  3HOY J;  3VOD A;  2XF6 A;  4WCG A;  4EEF G;  2ZJQ F;  3QYE A;  5FGM A;  3OYJ A;  3OS1 A;  4KIF A;  1WH5 A;  2JRT A;  1RET A;  1GXP A;  1DPU A;  2GWR A;  2HQR A;  2OZU A;  3H3U A;  2OTJ I;  3OYB A;  2KIF A;  2Y9Z A;  1SD4 A;  4AYB A;  4CCL A;  2O8K A;  5L3F A;  4XSZ F;  1ZGJ A;  2X1C A;  2P5L C;  1IV6 A;  1MJA A;  1OR7 C;  3H9Q A;  1R1V A;  3DU5 A;  1DU0 A;  2P6T A;  2M34 A;  5C44 J;  1TNS A;  1TLH B;  2EBI A;  4UUS B;  1J5Y A;  3BG9 A;  1BIA A;  2QSG X;  2ZO4 A;  1U5T C;  2D45 A;  2QUF A;  4KDP A;  5C4X J;  1YIJ I;  1V55 H;  1G4D A;  2A6H F;  2VLA A;  3T1B A;  3JCU C;  4XLH A;  4A93 J;  2W82 A;  3GW2 A;  2O61 A;  1FTT A;  1Z7L A;  1BW5 A;  1B4A A;  1MDM A;  4IRH A;  3WG9 A;  5D8L B;  2K85 A;  3GF2 A;  3DBL B;  3PNT A;  1IRZ A;  3KEY A;  5BNG A;  4D9J A;  3SJM A;  3BDD A;  1DU6 A;  3OYE A;  1EKE A;  3LSH A;  3J81 K;  2HR3 A;  5DYM A;  2EZH A;  1Q1V A;  3GX4 X;  3BTJ A;  4HX8 A;  2DK8 A;  4XRS G;  4ZYD A;  4U0Y A;  5DM7 F;  2A61 A;  4LG0 B;  1F9N A;  1XDU A;  4XOP A;  5CJ9 A;  3OSF A;  1ZEL A;  1BI0 A;  4AVZ A;  4ESJ A;  1XMK A;  2CUF A;  2M45 A;  3PQK A;  4MEY F;  3GCM A;  3JRH A;  3TED A;  3HSF A;  2IRF G;  3OYF A;  3EYI A;  1K6Y A;  3DPL C;  1VQP I;  2KQR A;  2YR2 A;  3K4M A;  1IZ1 A;  3M7G A;  3AG2 H;  4GFB A;  1WFX A;  3JTH A;  3LMM A;  1R4M B;  2HDC A;  2DAO A;  3W2A A;  2K7L A;  2LG4 A;  2ZXH A;  4BAC A;  1MIJ A;  1OCP A;  1SFE A;  2WY7 Q;  2MLK A;  4NC6 A;  4PDK A;  2KL4 A;  4R1H A;  1LB2 A;  1QBJ A;  2DFH A;  2CV2 A;  2NVQ J;  4YFN F;  4X0G A;  5DD8 A;  3D5L A;  4C30 A;  4OIR F;  2QM3 A;  3WU1 B;  1X1P A;  2FQ4 A;  2CQK A;  3CCY A;  4XLF A;  2FML A;  4XRF A;  2FJ1 A;  3ZGK A;  3W6V A;  4BBS J;  1MBJ A;  3K69 A;  4A2U A;  1V4R A;  2ZC2 A;  3CES A;  2PN6 A;  2LKP A;  4LLL A;  1RES A;  5LHI A;  1VQ5 I;  5FD6 A;  4KMF A;  3G71 I;  1SMY F;  3TO7 A;  1FBS A;  4BJ6 C;  4HF0 A;  3FHZ A;  3KEQ A;  1RR7 A;  3GTK J;  5JI6 A;  3GYH X;  5GAG J;  2MLG A;  4HA8 A;  3K0L A;  4I98 B;  2E2H J;  2ZJ2 A;  5GPC A;  2L5Q A;  2CQX A;  3AL0 B;  2ID3 A;  3DKX A;  2YS9 A;  2VQL A;  3LA2 A;  3BR2 A;  1DGR M;  2CSO A;  1WKM A;  4NC7 A;  1R00 A;  3MWM A;  1T2K A;  1SAX A;  3RZO J;  2R93 J;  3T5X A;  1YRN A;  3H9J A;  3DKW A;  1L0O C;  3DQV C;  5KAF C;  2VJ5 A;  1FBU A;  1W0T A;  1Q1H A;  3W6J B;  4ZJZ A;  4LB5 A;  3FBN B;  1P6R A;  2M0C A;  4II3 A;  1BR4 A;  3CQZ J;  1KYW A;  3H3Z A;  4IL6 C;  2OA4 A;  4E7Z A;  4IQ4 A;  2DT6 A;  2EFQ A;  2EZI A;  1XCB A;  5DUK A;  4C2M J;  2OPT A;  1DP3 A;  1JUP A;  2X85 A;  4Y7N J;  2VBW A;  4BQQ A;  2K27 A;  4MTD A;  1UJ8 A;  2O03 A;  5K5R A;  2ZB9 A;  3OIO A;  2JJ7 A;  3TDU C;  1GXQ A;  5J8C A;  3KFW X;  3SZG A;  2H1L A;  2XSJ C;  4B3A A;  5IP6 A;  2B63 J;  4XNF A;  1H8A C;  3L09 A;  5DM6 F;  5KNL A;  4XLP F;  2G9W A;  4NBQ A;  4OMY A;  5KHD A;  1RIO H;  2LY2 A;  1REP C;  1APL C;  3BJA A;  4B43 A;  1FIP A;  3JRC A;  3HEF A;  3FIS A;  1O4X A;  1BOA A;  5J1U A;  1O7L A;  1TZL A;  2GIZ A;  1K7A A;  1H89 C;  1W36 D;  2IEK A;  1SFO J;  2DMQ A;  4HLY A;  2Z1D A;  1PUE E;  2NS7 A;  3K70 D;  5EEG A;  2A6T A;  1GV2 A;  1Z3Y A;  5C3E J;  3CDL A;  3BTI A;  3WU2 C;  3RTR A;  1W7P A;  1XN7 A;  3IL2 A;  1RR8 C;  2VN2 A;  5FKL A;  4JOM A;  2IGK A;  3KCC A;  3HG9 A;  2GLO A;  3HYI A;  3OYD A;  1BC7 C;  2M2E A;  4NNJ A;  4ZH4 F;  2NRA C;  4XLA A;  2QQB A;  1X1C A;  2DA7 A;  1KQ0 A;  4XOR A;  2Q8K A;  1HW1 A;  1W0U A;  2Y0M A;  1S5L C;  2KP6 A;  3FMS A;  1MW7 A;  1LE8 B;  2BY1 A;  5L3C A;  1O57 A;  4JX4 A;  5C4J J;  4EMS A;  2GOX B;  4BXU A;  4CYC B;  2M3A A;  1N77 A;  2WA0 A;  4HQM A;  1TL8 A;  2LR8 A;  4BEH B;  2FBK A;  1OLT A;  1YHQ I;  1X1B A;  1U3E M;  1LKX A;  4FT8 A;  1UG0 A;  1PP8 F;  5K5O A;  3PUF A;  2CQQ A;  3KE2 A;  2VPL A;  3ERM A;  1Y8R B;  2DOE A;  3MKL A;  3I64 A;  2YPR A;  1X3Z B;  3UR3 C;  2V26 A;  3BOQ A;  1V54 H;  2ZXI A;  2W00 A;  3VEP A;  1HQC A;  2HOT A;  4MGR A;  2FUG 2;  3RKY A;  3ABM H;  3WTV C;  3CLO A;  1FNN A;  3BRO A;  1WSU A;  1V3F A;  3I53 A;  2CV0 A;  2LFB A;  4HST A;  3P7N A;  2EH3 A;  4YFX F;  2H6C A;  2H1K A;  1MBH A;  2XAQ A;  3SQN A;  1W7P D;  4Q48 A;  2MFZ A;  3LSP A;  1I50 J;  2E60 A;  1U2W A;  4UV8 A;  4E7I A;  2KRH A;  3PL8 A;  1IRG A;  1NG6 A;  2QEX I;  2XV4 S;  4B3X A;  5IY5 H;  3OYL A;  2EIL H;  5LD2 C;  2LTP A;  1MND A;  2V1N A;  4G94 A;  2BE5 F;  3IC7 A;  1MBF A;  3F22 A;  2OBP A;  2K5C A;  1B1B A;  2BXZ A;  2V6E A;  4ZYH A;  3F8N A;  1FLI A;  2D1H A;  4KNY A;  4NC8 A;  2ISY A;  2R5Y A;  4M6V A;  1P2F A;  5L3D A;  1FSE A;  2HI3 A;  4JX6 A;  1UZC A;  3EUH C;  2E1O A;  1O3S A;  2PEX A;  3Q0W A;  2R7W A;  1W1W E;  1WJE A;  4BHB A;  2JA2 A;  3F6O A;  3I58 A;  3SDB A;  3BR3 A;  3U21 A;  3C3W A;  4B09 A;  4BU2 A;  1WZ2 A;  3QP6 A;  3AG1 H;  1ZGW A;  1YJN I;  2EJR A;  5HOD A;  3CCR I;  3TMO A;  1ZH5 A;  5E17 F;  3HXL A;  2ZBK A;  4F91 B;  5LGT A;  1ZLK A;  2GZW A;  5IYB J;  3H0D A;  1RC9 A;  2QQ9 A;  4AUX A;  1YX5 A;  1MH3 A;  5DCF A;  1I3Q J;  4M6X A;  1ZRD A;  2KKO A;  3R6S A;  1WJC A;  5IT3 A;  4MQ9 F;  5LLQ A;  3HL2 A;  3H9G A;  2CRG A;  5EGO A;  2G7U A;  2JVH A;  2M4K A;  2DOD A;  3OL3 A;  1TT5 B;  1CF7 A;  3EYY A;  1MNM C;  1HC8 A;  3EET A;  5D8K B;  4A3C J;  3P9C A;  3CMM A;  1LFB A;  1HKS A;  3FXQ A;  2MD5 A;  5TIS C;  1BI3 A;  2HKO A;  2K4J A;  2QF7 A;  4Y3O A;  1EF4 A;  1EV7 A;  4XK4 A;  2ZNY A;  4Y4R A;  4PJL A;  2MYS A;  5IYD J;  5GP9 A;  1H9G A;  1HF0 A;  5LRR A;  1VQN I;  3SEZ A;  2JPB A;  2RQQ A;  4W97 A;  2OJE D;  2Q2E B;  3ASN H;  4FHT A;  1SVM A;  4CYD A;  1SAU A;  1Y1V J;  1IW7 F;  1UFM A;  2FNA A;  3RYR A;  1AKH B;  3QOP A;  2VOP A;  3BQY A;  2CQN A;  1TW3 A;  2BYV E;  4ZYA A;  1W5C C;  3OV8 A;  3GFJ A;  2HFH A;  2FOW A;  5HLH A;  4ENN A;  1VQM I;  3FXM A;  4ON0 A;  1R23 A;  3M07 A;  2EIK H;  4AIH A;  1FOY A;  2DBB A;  4G6Q A;  5CQE A;  1D0X A;  2ZME A;  1JTX A;  2WTE A;  1RNL A;  2QWW A;  1BW6 A;  2XC7 A;  2LVS A;  4HNT A;  2Z5U A;  5GTI C;  2XRO A;  2DOF A;  2M7B A;  3DEE A;  2LBF B;  3CC7 I;  3CCJ I;  2DT7 B;  2BY0 A;  3K1M A;  1R49 A;  1K4S A;  2R7D A;  2GIV A;  3KZI C;  4IHV A;  2AQE A;  1GV5 A;  4ZZL A;  1OCC H;  1TWF J;  1XGO A;  1YJ9 I;  4X1E A;  3ZQC A;  2M8E A;  5LBQ A;  4MO7 A;  2KT0 A;  5E1X A;  1W5S A;  2KPM A;  3BG5 A;  3A01 A;  3WHC A;  3WGH A;  2Z9O A;  3DLA A;  5ICE A;  3JR9 A;  1KU2 A;  1Z6T A;  2DN0 A;  3M8J A;  1A6Q A;  5LGN A;  3RPU D;  2KLO A;  2MC3 A;  2L01 A;  2K40 A;  4AU7 A;  3L7W A;  2EFW A;  5DDG A;  3I59 A;  1IF1 A;  2Y9Y A;  1TTY A;  5H20 A;  4ZTF A;  2LDU A;  4BS9 A;  1OCT C;  3K10 A;  2AXL A;  3CCV I;  3R61 A;  3BC8 A;  1Z1D A;  1J9I A;  2RQP A;  1TWH J;  1FPQ A;  1FMW A;  4WF2 A;  1CQT A;  3LFU A;  1B8I B;  3HRS A;  2YU9 J;  3OYA A;  3J80 Z;  4E7H A;  3DBH B;  1Y1W J;  2R7X A;  4UXN A;  4BHP A;  1MSE C;  2VQH A;  4JX5 A;  3OS0 A;  1O7F A;  2AS5 F;  4D7M A;  4LMY A;  4BJT A;  2MH9 A;  3CC2 I;  5GAH J;  2E35 A;  5HOO A;  3G6E I;  4A5M A;  1G3S A;  2EFP A;  3C1D A;  3I56 I;  4RGS A;  1IUY A;  1G3W A;  2VUM J;  2Y0S N;  1HDP A;  3IRR A;  1WJA A;  4L9V A;  2GXA A;  2RRE A;  3GTJ J;  2ZCW A;  4A0Y A;  3PQJ A;  3SYT A;  4LD5 A;  3SZT A;  1ZR2 A;  2E5Z A;  5D4S A;  4M9X A;  2V9V A;  1T8I A;  2ECC A;  3R60 A;  3KP5 A;  2L7Z A;  4HNV A;  4MHG A;  3CO7 C;  5DCM B;  2VJ4 A;  3L9F A;  3P9K A;  2EIM H;  2G7H A;  3C7J A;  1TWC J;  2R3S A;  2XGX A;  1ZG5 A;  5DD4 A;  1J75 A;  1LDJ A;  2PMH A;  2FEZ A;  2M30 A;  2DTR A;  1NK3 P;  2JSP A;  4L18 B;  1SAN A;  3QYB A;  2HXO A;  4I99 C;  1GDT A;  3DLL F;  2KJB A;  1AA7 A;  1HST A;  1D1A A;  3BPX A;  2V1X A;  3BPV A;  4JYK A;  3PFI A;  1U5T B;  2UXN A;  3H92 A;  2CWE A;  1FOW A;  2CO5 A;  2Q1Z B;  3F72 A;  3QOE A;  2UV1 A;  4PGG A;  1FYK A;  1YO5 C;  1R5G A;  2KIU A;  4G12 A;  1FYM A;  3NRV A;  3HOU J;  2FA5 A;  3HRT A;  3PSI A;  1ZRC A;  3KP6 A;  2M8G X;  2ECB A;  3CCL I;  4BH9 A;  2CUJ A;  3U1D A;  1VQ6 I;  2FSW A;  2X9D A;  4AIJ A;  5LGU A;  2IS1 A;  4Y13 A;  5BPD A;  2NVX J;  3PSF A;  1IGN A;  1XTA A;  2HS5 A;  4WXD A;  2DMN A;  5F0C A;  2BEO A;  3REO A;  1RUO A;  3ZOB A;  2VL8 A;  2KZV A;  5E8I A;  4XID A;  2QBY A;  1BI1 A;  2HGC A;  1BC8 C;  4BDY A;  3BG3 A;  1YW8 A;  4C3H J;  3GTM J;  3E5U A;  4KN4 X;  3RYP A;  2L4A A;  2EZL A;  4EJT A;  3HKZ A;  5F64 A;  5IP9 J;  2UZK A;  1SFX A;  3ZMZ A;  1H9T A;  3ZN0 A;  4KUM A;  3G3Z A;  5M5Y J;  2IGM A;  4XMY A;  3U2R A;  4BE1 A;  2DI3 A;  3HOZ J;  2EIJ H;  1PUF B;  3IV5 A;  2XKO A;  3K4B A;  1ZG3 A;  4ZDP A;  5E3O A;  3VYR B;  3UKG A;  3CC4 I;  5CKT A;  4BUP A;  3GTP J;  1WI9 A;  3LQR A;  1FX7 A;  1HBX G;  4C3J J;  2QA4 I;  4A3M J;  5D6F A;  5BS6 A;  5F0H A;  1X3W B;  2F48 A;  3FWE A;  2Y0S A;  3AG3 H;  3O2P E;  3RZD J;  1K4T A;  1USS A;  3V8J A;  3CUQ C;  4UUS A;  3I4N J;  4U0V A;  5ILU A;  5IOZ A;  2DU9 A;  4F3Q A;  1UHS A;  4I01 A;  2WB1 N;  1Y39 A;  5HVQ C;  1G6N A;  1MH4 A;  1JGS A;  5F1R A;  4M3B A;  2P81 A;  4E70 A;  1FSH A;  2V9P A;  3OL4 A;  1PVE A;  3TBI A;  1QO0 D;  4LJZ F;  1QA6 A;  3Q0V A;  3HC7 A;  5L3G A;  2COM A;  2R7S A;  1WCM J;  3DWL E;  2GQQ A;  3LST A;  3R4K A;  2DJI A;  4B4C A;  4NB5 A;  3IHU A;  1T39 A;  3I9V 2;  5FKO A;  4RLQ A;  2V7F A;  4YG2 F;  1U78 A;  1IC8 A;  3ML6 A;  3ONQ A;  1GVD A;  4I7H A;  4RBO A;  2L9R A;  5F04 A;  3T8R A;  4HRI A;  2KJC A;  3BR0 A;  3DKY A;  2QEN A;  2LD5 A;  3C2B A;  2FD5 A;  3WE3 A;  4LG0 A;  2ESN A;  5J8F A;  1ZYR F;  3F9K A;  4UUV A;  2Y69 H;  2E5N A;  2LY1 A;  3LFK A;  3CF5 F;  1K6O A;  2XAF A;  1J59 A;  3ABL H;  2L4M A;  2ICW G;  3VFZ A;  4PFP A;  2ZFU A;  3OYI A;  2CUZ A;  3X2Q H;  3ZPL A;  4IRG A;  1OYW A;  2PMZ N;  1A5J A;  3RDI A;  1RKT A;  2GXB A;  1KU9 A;  1T95 A;  2YUS A;  3K4N A;  5JR3 A;  3R0A A;  4RB3 C;  1Z67 A;  3K2A A;  4LLN A;  2ELH A;  5FRO A;  4XQF A;  5E3L A;  1RKW A;  1XPX A;  4M9S A;  1F43 A;  2VBZ A;  1DDN A;  4KFC A;  4LFU A;  3NWS A;  4PCQ A;  5DUI A;  4QPQ A;  4CDG A;  3MCZ A;  1WRJ A;  2PX9 A;  3BZC A;  4U7B A;  1TQI A;  3L2R A;  1TQP A;  4NUB A;  3FBI B;  2P6S A;  2VT2 A;  3GEZ A;  1J2X A;  4TV7 A;  4A3L J;  4MFD A;  3COA C;  2QZ8 A;  1ON2 A;  2BZT A;  4II2 A;  1UCR A;  2QCO A;  2X6X A;  4E7L A;  2FX0 A;  5CVV A;  2XHK A;  3HTU A;  1UHW A;  4DBQ A;  1SD5 A;  3RSN A;  1U9O A;  1JHH A;  1B72 B;  3S32 A;  2EFN A;  4RB2 C;  1KON A;  2KIS A;  1FMV A;  2L2O A;  1XG1 A;  4I2O A;  3I54 A;  3KZY A;  1ETX A;  3EUA A;  5CVU A;  4ENK A;  1R71 A;  2CUE A;  4BY7 J;  3JTG A;  1GT0 C;  2R7Z J;  2OQR A;  3HOW J;  5AIQ A;  4RAY A;  1LVK A;  1XGM A;  1LQ1 A;  4IKF A;  3RKW A;  2R5Z B;  1S8N A;  1OYY A;  1WJB A;  3L2U A;  5HLI A;  3ECH A;  3FKJ A;  1JJ6 C;  4XL9 A;  4D7N A;  3OR1 C;  5F6F A;  1NTC A;  5H6Q A;  3TL4 X;  4LB6 B;  5FD5 A;  4UHT A;  1LUJ B;  4GDF A;  1B6A A;  2DFE A;  2I5U A;  1BL0 A;  4H0E A;  3V7C A;  2O6G E;  1YOV B;  1HOM A;  3ERE D;  2W4S A;  1TBX A;  3CMY A;  1PYV A;  3ABT A;  4PJJ A;  1F5T A;  1JUS A;  2JSC A;  3H5R A;  2JUG A;  3K1P A;  1VQK I;  1QU3 A;  3HGG A;  1JKQ C;  3V8L A;  2K9Q A;  1Z6R A;  2ME6 A;  1QQI A;  2HQA A;  5FKN A;  2W24 A;  3HOS A;  5GPA A;  3FXR A;  4MNU A;  3TO6 A;  1MGT A;  3LL7 A;  4U88 A;  2NYX A;  2UUZ A;  4DOZ A;  2CFO A;  2MH2 A;  3Q0U A;  4G6D A;  4RDU A;  4HNU A;  2PMZ A;  1ONV A;  1XSX A;  3HPH A;  1MDM B;  1ON1 A;  4XN3 A;  2MC4 A;  4BDZ A;  1LPQ A;  2LYC A;  2R7Q A;  1VFC A;  1ZQ3 P;  2QKM B;  2VXD A;  1T98 A;  1LFP A;  4U0W A;  4HQE A;  4IRI A;  3BY6 A;  2HKX A;  3IWF A;  3JRE A;  1JHF A;  3WTW C;  2XPU A;  3F3X A;  2LMD A;  4IOC F;  2FXA A;  2GAU A;  1D0Y A;  1D1C A;  3F21 A;  2CU7 A;  3TDZ C;  5LFA A;  3CZ6 A;  2E7X A;  2B0L A;  5HDG A;  3CCM I;  1C0W A;  2EFO A;  1R58 A;  2IA2 A;  2TDX A;  4GYI A;  2EA2 A;  3O8H A;  1Z9C A;  3K4L A;  4FE7 A;  3GFL A;  2YX4 A;  5BPI A;  2B9S A;  1LE8 A;  1BOB A;  1ZLJ A;  1U8R A;  2JA8 J;  1S9H A;  2DA5 A;  3M4O J;  2K86 A;  5AIP A;  2FBI A;  2K9L A;  1P92 A;  3IUO A;  4CYC A;  4JQF A;  4UVA A;  1JKR C;  2Z99 A;  1RUN A;  1S3J A;  4BEH A;  2J5P A;  4RS8 A;  3ZMS A;  1X19 A;  5JFR A;  2DYS H;  1Z05 A;  1UG2 A;  5ERI A;  2M5W A;  2H8R A;  4C9Y A;  5BQT A;  4XKC A;  3U9G A;  3S1N J;  2KDO A;  3DEW A;  3SFI A;  4IHT A;  2EV6 A;  5HLG A;  1T08 B;  4LLG F;  2VQG A;  3CCE I;  1IDY A;  2YSR A;  3MKZ A;  5HS8 A;  2A5Y B;  2EZK A;  4NDL A;  2OCC H;  1E17 A;  5KCM A;  1FIA A;  1TQM A;  1T38 A;  2KFD A;  1FWZ A;  2DPU A;  2ZJR F;  2X0L A;  4XSX F;  4P9F A;  3LSJ A;  2WC2 A;  4C2U A;  2EQR A;  3L00 A;  4XLE A;  1YW7 A;  3SDG A;  4BQO A;  1ZN2 A;  3OYC A;  1BM9 A;  4XN0 A;  3BWG A;  4A3E J;  4PK4 A;  3KLO A;  2IS4 A;  1SVL A;  1RZ4 A;  2F4M B;  2PMU A;  2VQC A;  3KLN A;  4CO8 A;  5FB2 A;  2DA1 A;  3KIO A;  2IA0 A;  1A36 A;  3PIO F;  3S14 J;  2BY3 A;  2DFF A;  3D0S A;  1RPW A;  3R0J A;  4HG2 A;  1WQ2 A;  3QRF F;  4BY1 J;  2QLZ A;  3OYN A;  4RB1 A;  2XAU A;  2F5F A;  3OYG A;  3GTQ J;  4KIG A;  1WPK A;  1L3L A;  3FDY A;  3V4G A;  1S7A A;  2BHY A;  3KP7 A;  3V8K A;  3S2H J;  3A4C A;  5HDK A;  4YFK F;  3IH4 A;  4A12 A;  3HPG A;  2E34 A;  2IJL A;  2Y31 A;  3W3C A;  4L9N A;  3FXO A;  5DV5 A;  3H0G J;  3OYK A;  3LAJ A;  2AO9 A;  1X58 A;  2BW3 B;  3PNV A;  4IVN A;  3E5X A;  1ORK A;  2IXS A;  4KIB A;  1JTY A;  4IQJ A;  2Y2Z A;  5TRD A;  3HSR A;  3NAU A;  3F6V A;  2DW4 A;  3WOD F;  2LF8 A;  3O8G A;  2ID6 A;  3E6D A;  4DZP A;  2HOE A;  3WTY C;  1Z7U A;  4UB8 C;  3BLY A;  1FP2 A;  2X4H A;  5B66 C;  3OYH A;  2XRL A;  3J7Z I;  5CLS A;  2DK5 A;  4LG3 A;  4PSX A;  4XLC A;  3EPZ A;  4L5J A;  2XIG A;  2ZSH B;  1VQO I;  2JZY A;  2J5O A;  3TGN A;  3CDI A;  1E3P A;  3F0C A;  3EDP A;  2VKE A;  3F23 A;  5F1J A;  1D8K A;  1YW9 A;  4UB6 C;  3L2Q A;  3J81 Z;  2ELK A;  1K78 B;  4CHU A;  3ISP A;  2TRT A;  4Q47 A;  4B48 A;  3GUD A;  4YRV A;  4IHS A;  3K4C A;  1HCR A;  4L0Z B;  2FE3 A;  1D8J A;  2XAH A;  1T0F A;  5CVI A;  1QZE A;  2CH0 A;  1ODD A;  2NVT J;  4CH7 A;  3HOV J;  4M71 A;  2DO7 A;  4ZTJ A;  5LRS A;  1AWC A;  4RM3 A;  2R7V A;  2DCE A;  5CVR A;  2R0Q C;  2CJJ A;  1IDZ A;  5D5W B;  3ELK A;  4ZDL A;  3CLQ A;  5F0F A;  1FBQ A;  3WE2 A;  1SFU A;  1MJ9 A;  3N05 A;  2G0E A;  3VYU B;  5HNF A;  3L2V A;  3GXO A;  1AKH A;  4BKX A;  2V1D A;  2VAS A;  4YEL A;  4PSW A;  1E3O C;  4BYY A;  1SVO A;  3HJE A;  5JHU A;  2DXI A;  4XRS A;  1WGX A;  1IXR C;  3WGG A;  3A2K A;  3HB9 A;  5D5U B;  1R5H A;  2MGQ A;  3HSE A;  2PQ8 A;  1GUU A;  2L02 A;  5D5X B;  4ENJ A;  4FET A;  3GTO J;  1N75 A;  5H2F C;  4WXC A;  5JLW A;  1KZH A;  1IN8 A;  3ESW B;  4KT6 A;  4M3F A;  4YIF A;  2ACJ A;  2LBF A;  3ZQI A;  1XMA A;  4F55 A;  4BXX J;  4IEJ A;  1W36 C;  5E1W A;  2I8D A;  2L54 A;  4GRI A;  2CV1 A;  2M1B A;  3OR2 C;  4HW0 A;  2L9S A;  3FMR A;  3K70 C;  3LNQ A;  2LF7 A;  1R5I D;  1H0M A;  5GAE J;  4O5V A;  1IXC A;  4CXF A;  3RPU A;  2N8G A;  2FOK A;  3KZZ A;  1ZAR A;  2ETH A;  3E3V A;  1JGG A;  3ZP5 A;  2A68 F;  4QSH A;  4IPA A;  2DPD A;  3DP7 A;  3HUG B;  4CCJ A;  2W57 A;  2DOA A;  1T33 A;  2F4O B;  2JN6 A;  2W85 A;  1S29 A;  1YIO A;  3CTA A;  3VDX A;  1FTZ A;  1FOK A;  3SHF A;  3VYS B;  3JAM K;  1HKT A;  4EVI A;  2NOG A;  2L3D A;  2E1N A;  3BR6 A;  4XR6 A;  2FF4 A;  4M3D A;  5EF6 A;  3GLX A;  1B8I A;  1A31 A;  1MMN A;  4P96 A;  5FKK A;  2R5Y B;  1S6L A;  5KK1 A;  3IAM 2;  2E1M C;  2IPQ X;  4HX4 A;  4DNC A;  2A07 F;  1X2M A;  1KA8 A;  1EH7 A;  2KRC A;  4JBA A;  2D5V A;  2VKH A;  3CJQ B;  5EYR A;  1ZTR A;  2JQ7 A;  2P7V B;  1VZ0 A;  1MBE A;  3N4M A;  2HVS A;  4NQW B;  3FZV A;  2XRN A;  2YX7 A;  5IYC J;  1MJB A;  1ZR4 A;  1IO2 A;  3HIF A;  1BR1 A;  3CP8 A;  1P4A A;  5J6X A;  3CCQ I;  4ENM A;  3ZQF A;  1NH3 A;  1EA3 A;  2MAB A;  1HXD A;  2OZ6 A;  2R7O A;  3BTC A;  2O0Y A;  5DCM A;  3W2V A;  3LQQ A;  1F4K A;  1VND A;  4FAS D;  1JKO C;  2XGE A;  3TKY A;  3DBR B;  2VPR A;  2A69 F;  3BCB A;  4D5C A;  2DQL A;  3VWB A;  1P4X A;  4KN7 X;  3FXL A;  1XGS A;  2O8X A;  2HQN A;  3LWF A;  4I76 A;  4AM3 A;  1OR7 A;  4DYC A;  2D2W A;  2MG4 A;  5J1R A;  2XUB A;  1DP7 P;  2ELJ A;  3KX2 A;  3GTL J;  1B59 A;  5FJ8 J;  1XSD A;  3CUQ B;  3H1C A;  2DDB A;  3ECO A;  5E3M A;  2PJP A;  2JA6 J;  4L9J A;  1U5T A;  4FIS A;  5E3N A;  1RI7 A;  2VKV A;  4P55 A;  2VOD A;  4Y15 A;  2H09 A;  2JA7 J;  4DQ2 A;  1VQ7 I;  2XGC A;  3ZR8 X;  4ZZD A;  2P5K A;  4B47 A;  1KYZ A;  2Z16 A;  4AD9 A;  4C2T A;  3BZ6 A;  1I6H J;  3QU3 A;  4QWQ A;  3FKI J;  2DA2 A;  1YIT I;  1IN4 A;  3CO6 C;  5J3L A;  2JRM A;  3F8C A;  3Q9S A;  2ZFW A;  3FXU A;  3SEQ A;  2XSD C;  3NAR A;  3S1Q J;  3BP8 A;  2BHZ A;  2DQR A;  3VPR A;  2FNP A;  4XON A;  3DU6 A;  4FE4 A;  1G3Y A;  4D0P A;  3E0J B;  3IRQ A;  1HKQ A;  2M4G A;  2O3F A;  3B6A A;  2VXZ A;  3C2H A;  3S93 A;  1MBK A;  5FLX K;  3BG6 A;  3QP5 A;  2ZKZ A;  2OF7 A;  4G8X A;  1GVJ A;  5EG0 B;  1A6I A;  3NWT A;  3EQL F;  1R6R A;  1Y8Q B;  1R1T A;  2DMT A;  4G6T B;  1YX3 A;  4XRM A;  4V2F A;  3L2C A;  3I55 I;  3W2W A;  4CCM A;  4I0A A;  4PGH A;  1PUF A;  5E20 A;  2OTL I;  3A01 B;  3CUO A;  3FX3 A;  3F8B A;  4BBR J;  2X48 A;  4YEJ A;  4C3I J;  2DDA A;  2L7M P;  4N4N B;  1SC7 A;  1R9T J;  4BNC A;  4H4K C;  2ESH A;  2DMU A;  2IP2 A;  1MSF C;  1W4M A;  4BJ5 C;  2OV7 A;  3TO9 A;  3ULQ B;  2NVU B;  3GME A;  2FRH A;  2BY2 A;  2WAD A;  1JKP C;  5CYV A;  2WV1 A;  2NXN B;  1FZP B;  4HAM A;  3LSI A;  4GGG A;  4I02 A;  2NNN A;  2XAJ A;  3RQI A;  4ASN A;  1YI2 I;  2E2J J;  2RNG A;  4B1R A;  2V9K A;  2F5C A;  2H8W A;  5FFZ A;  4AID A;  3WTT C;  5EEA A;  2NAZ A;  3MN2 A;  4E4H A;  2AQF A;  1ZG1 A;  1MBG A;  4WWC A;  3FM3 A;  3FXJ A;  4HF2 A;  2M7A A;  3P5J A;  2BGC A;  3OWT A;  4PUS A;  5ILS A;  3V7R A;  4S0H B;  4EAT A;  3WHB A;  4RGX A;  3C18 A;  1IUF A;  1MMS A;  2P0W A;  3FMQ A;  2LP0 A;  4M72 A;  2EV5 A;  3QQA A;  4F7Z A;  2HOA A;  4RAZ A;  5B1B H;  3ZMU A;  1AU7 A;  5AON A;  2ZXW H;  4L5I A;  4UV9 A;  4MQV A;  2EPF A;  1J09 A;  4LK0 F;  4GCV A;  3DF8 A;  4IZZ A;  1TNT A;  1HW5 A;  1X1A A;  3MKW B;  3K9T A;  3SXY A;  5B5E C;  3MZY A;  1IN5 A;  1OFC X;  3GBG A;  2PJR B;  1J0R A;  1XSV A;  4Z6Y A;  5FRN A;  3KP4 A;  4IHW A;  2OCE A;  4E7J A;  4EJU A;  2CQ7 A;  1T56 A;  3JRA A;  3PM1 A;  3HOT A;  1XB4 A;  1ETO A;  1B9M A;  5CPR B;  2VE8 A;  5ICC A;  1TT0 A;  4HF1 A;  2HTJ A;  1VTN C;  2CFX A;  1JT0 A;  3RQ4 A;  3Q3S A;  1O3T A;  2O9L A;  3QAH A;  2B7E A;  2WV0 A;  2LLK A;  3DPT A;  4J00 A;  1Z3X A;  3ZRG A;  1FT9 A;  1YQA A;  3QPL A;  5EZH A;  3HDD A;  4D5F A;  1LJ9 A;  1QNT A;  2NVY J;  3BT9 A;  3GO5 A;  2L7F P;  1I5Z A;  1B72 A;  2VBX A;  2VJJ A;  3KP3 A;  4N0B A;  3TOB A;  3WTX C;  3A02 A;  2CYY A;  1U6G A;  2M0M A;  3CME I;  3GLL A;  1ETW A;  5E79 C;  2HPI A;  4DZJ A;  1I3A A;  2IVM A;  4L5E A;  4LK1 F;  1WJF A;  3ABU A;  2CGP A;  1ENH A;  2ZME C;  1ERD A;  1V5E A;  3LSG A;  3VOE A;  1HDD C;  5BMZ A;  1ZHF A;  3ZQG A;  2K9M A;  1Y56 A;  2CS3 A;  1EH6 A;  4AWX B;  4S05 A;  1X3U A;  2DMP A;  3PO2 J;  2R5Z A;  4B8X A;  3QPH A;  5DS9 A;  2QYO A;  4RAG A;  5KVR A;  1QZY A;  2M9H A;  1FEX A;  4PZJ A;  5EDN A;  1FC3 A;  2BOL A;  3BR1 A;  1LEB A;  2EK5 A;  1ZK8 A;  3GWZ A;  3QU6 A;  3WU0 A;  3ZMV A;  3MEX A;  1CGP A;  5J1Y A;  4Q4Z F;  3I4P A;  4JK1 X;  4M74 A;  5CQG A;  2VON A;  1IRF A;  2GXG A;  2L7K A;  2RKH A;  1X2N A;  5IPA A;  2CG4 A;  4I09 A;  2STT A;  1XD7 A;  4GO1 A;  1MD0 A;  5E18 F;  2NOJ B;  3GVA A;  3GZN B;  2LRE A;  4RA2 A;  1VQ8 I;  4AIK A;  1Z21 A;  5J4V A;  5TJJ A;  1XCV A;  2IGN A;  2V4J C;  3K7A J;  5ICG A;  3BQZ A;  4A3B J;  9ANT A;  2OD5 A;  2PBI A;  1TC3 C;  3G73 A;  2VB6 A;  3DTI A;  3J7Y J;  3JRB A;  1ZGA A;  1I39 A;  5TGT A;  1N25 A;  1FY7 A;  5JHF A;  2GBY A;  2Y48 A;  3HHG A;  3K2Z A;  4PJM A;  3LSR A;  2NNY A;  2P8T A;  3OMY A;  3IAS 2;  2RN7 A;  3L2W A;  2K3F A;  1G59 A;  3GFM A;  4M9Z A;  5F08 A;  1F36 A;  2CW0 F;  2Z3Y A;  1OCO H;  2KIM A;  1RRJ A;  1OMI A;  3ZCO A;  3JRG A;  2GM4 A;  2ISZ A;  1QVU A;  2WB1 A;  1G2H A;  1JE8 A;  3DTE A;  3JRF A;  2PFB A;  3L1P A;  3ZQQ A;  1YE9 A;  3I5U A;  1IG7 A;  4KIT B;  5HLT A;  1LEA A;  1X4P A;  3ZQH A;  2PI0 A;  1WH7 A;  2HYF A;  5FO5 A;  2VE9 A;  2R7F A;  2LC2 A;  4M3E A;  4YII A;  5L3E A;  1BJA A;  5FLX Z;  3WGI A;  3OYM A;  3QPT A;  2R92 J;  2KDZ A;  2DA3 A;  1ETQ A;  5A2Q K;  1Z91 A;  1O3Q A;  1V5G A;  1H88 C;  2XF7 A;  3K6G A;  3EUH A;  5LHH A;  1YFH A;  4HX7 A;  4UUT A;  2XAG A;  2JWT A;  3QYF A;  1BBY A;  1ZAO A;  5K7Z A;  4OIO F;  2I10 A;  2F5D A;  3O6B B;  1VQ4 I;  4XKW A;  1I6X A;  1WWX A;  4CIC A;  2UXX A;  5M5W J;  2C6Y A;  1LNW A;  3SZP A;  3E6B A;  3TP3 A;  2EA4 A;  1MNE A;  1LFU P;  2LY9 A;  4LIT A;  4UVB A;  1D1B A;  5LEJ A;  2A5W A;  2KIQ A;  3WTS C;  5JVG F;  4WXH A;  1QPM A;  4RGU A;  5J47 A;  2HEO A;  1NHA A;  3OS2 A;  2R7R A;  1WI3 A;  4F92 B;  1JXS A;  4WX9 A;  5K5Q A;  4S04 A;  4UY8 I;  1QPI A;  2OC6 A;  2MSY A;  3NEU A;  4GYG A;  3TP0 A;  3V7S A;  2EV0 A;  2DA4 A;  2V6C A;  2K4B A;  2MW8 A;  3B6C A;  1JJ8 C;  2VBY A;  3MZ8 A;  4EM1 A;  4FTH A;  3FK7 A;  1PP7 U;  2IS2 A;  1UAA A;  1UEL B;  2ZNZ A;  2OQG A;  3CJR B;  1IV8 A;  3B73 A;  1KU3 A;  2QQA A;  2X51 A;  1S7O A;  1D0Z A;  2XAS A;  2ADU A;  3E1S A;  3LA7 A;  4G9Y A;  1GLN A;  2HWV A;  4OIQ F;  3B02 A;  4LOC A;  3S1R J;  2W7N A;  4I0B A;  2VIX A;  3KYC B;  2VI6 A;  3BCA A;  4FQG A;  2WY8 Q;  1WVR A;  3TW6 A;  2BW3 A;  3M8F A;  4RB0 A;  2JA5 J;  2ZJP F;  1XGN A;  4XIC A;  3H35 A;  1IJW C;  2RC4 A;  1UST A;  3HOX J;  3HRM A;  2A3S A;  4DYQ A;  3M3Y J;  3G2B A;  5GAD J;  2IW5 A;  3MZH A;  4B44 A;  2AHQ A;  4BE0 A;  2X6W A;  3KEO A;  1JI8 A;  4F52 A;  1V5F A;  3VYT B;  4Q5S F;  1X4O A;  2AXT C;  4MTE A;  3QWL A;  3S2D J;  1OCR H;  5FLV A;  3CP2 A;  2BXY A;  2H6B A;  5M5X J;  4HBL A;  2GA2 A;  3CCS I;  1YRN B;  2R7T A;  4CSW A;  3S17 J;  4HYE A;  1MMD A;  2DYR H;  2E1C A;  3G1L A;  3T0Y A;  2ME0 A;  1IXS B;  2W84 A;  3DTK A;  5FKM A;  5K7H A;  2H27 A;  2EB7 A;  2P5V A;  4HOB A;  3AFH A;  1K78 A;  1WJ5 A;  4A5N A;  4EJV A;  4OAZ A;  5M3F J;  3HGY A;  5CVJ A;  3GFI A;  4PJ0 C;  2K02 A;  5K1Y A;  4IOA F;  2K9N A;  1Z0X A;  3CDH A;  2DT5 A;  3WTZ A;  4A3J J;  3K4K A;  4HPQ A;  4EJW A;  4QTR A;  5F27 A;  5LEK A;  2A05 A;  4NHJ A;  4HEA 2;  2JK3 A;  4J19 A;  3J80 K;  2JUC A;  5ED4 A;  2XB5 A;  4DBR A;  1FJL A;  3SFZ A;  2UWM A;  3A0H C;  2E1M B;  3CMA I;  1TWG J;  4A3K J;  1U8B A;  4A69 C;  1OKR A;  3MKY B;  2HYG D;  2LKS A;  2HPM A;  2X1D A;  3H3V K;  3S1M J;  1LDK B;  1YLF A;  4IF4 A;  1OCZ H;  4E7K A;  4O3M A;  3GZ6 A;  2KMU A;  2IGO A;  2FU4 A;  5D4R A;  1Y0U A;  5J4Y A;  5KAI C;  1IN7 A;  3JSP A;  1DUX C;  1R1U A;  4KIS A;  3QPS A;  3OSG A;  4MEX F;  3K4J A;  1HLV A;  1DPR A;  2L9V A;  3FK6 A;  3IH2 A;  3MD2 A;  3BTL A;  3VSK A;  3RCO A;  1ZKG A;  3M8E A;  3HHH A;  2F5V A;  3DEU A;  2RAE A;  1S7E A;  2EIN H;  2A6E F;  3AL0 C;  4CZZ A;  1W7P B;  3NQO A;  4W1U A;  1BA5 A;  3BJO A;  3DV8 A;  2CW7 A;  2LRD A;  1P4W A;  5IT9 K;  2F6C A;  3I3L A;  2R7U A;  1FYL A;  2M87 A;  3A03 A;  3HUG A;  4R79 A;  4FX4 A;  2HVR A;  1TWA J;  4CGZ A;  2LSO A;  4V2G A;  3U1K A;  1MKM A;  2Q2E A;  1Y0N A;  3KET A;  3KPH A;  4FX0 A;  1U0J A;  5D5V B;  4PJN A;  3S15 J;  5DTD A;  1XC5 A;  3QOD A;  4N9H A;  1ZRF A;  5EJC A;  3I4M J;  4AVP A;  4R8H A;  6PAX A;  5M3M J;  4CCO A;  4YIR X;  3HRU A;  4CZC A;  2JPC A;  4HSR A;  3LAP A;  5J40 A;  1BN5 A;  4XKB A;  5LHG A;  4D1Q A;  2JTV A;  5A2Q Z;  4HDV A;  2K9S A;  1X1D A;  3RKX A;  1A04 A;  2GA1 A;  1O3R A;  3HTS B;  4IHX A;  4A6D A;  1DQU A;  1QHG A;  5FRM A;  2E2I J;  3OIQ A;  2DA6 A;  3D5S C;  1UB9 A;  4MIM A;  3S16 J;  4HLX A;  4ESB A;  4ITV A;  1ACI A;  2ZXJ A;  3M1E A;  3PFY A;  2IAI A;  1VI0 A;  4NQW A;  3N97 A;  3LSM A;  2X6Y A;  4RGR A;  3ABK H;  2HOS A;  1QGP A;  2X1E A;  4WK8 F;  4KIC A;  3AKZ A;  3S3O A;  4EQQ A;  5HDN A;  2CW8 A;  3S2W A;  3DXJ F;  3TQN A;  4A3G J;  2GOM A;  4XLN F;  2MBF A;  2Z2S B;  4CUG A;  3CJN A;  3D5R C;  3E6C C;  1R36 A;  4QPO A;  4JP0 A;  4IHY A;  2IBD A;  2XB0 X;  2XVC A;  2K3P A;  3LOC A;  4KT5 C;  4HV6 A;  2QSH X;  1ULY A;  1EH8 A;  1DGW Y;  1QVT A;  4DJA A;  4L0Y B;  5HS9 A;  1TP4 A;  3CF2 A;  3CUQ A;  1Z77 A;  4BQA A;  1JUM A;  4EJO A;  1PDN C;  1AOY A;  4N9I A;  4HZF A;  1SD7 A;  5DEQ A;  2O5R A;  3CD6 I;  2E7W A;  4M6Y A;  3Q9V A;  1MMA A;  5L3B A;  2YU3 A;  3JW4 A;  1YS6 A;  4A0X A;  2MD0 A;  2JMW A;  1KU7 A;  3G1M A;  3JSO A;  3DPU A;  1OPC A;  4IX7 A;  4ZDO A;  4XM3 A;  4X6A J;  4OU0 A;  2WAF A;  4DYR A;  2HVQ A;  3BG7 A;  2O7O A;  4OMZ A;  2NS8 A;  2VT3 A;  2HZT A;  3TW7 A;  4EM2 A;  4Z2Y A;  3J7A O;  3D1N I;  2VC0 A;  2W48 A;  2XKP A;  3F8M A;  4OAY A;  5E8G A;  2RDP A;  3GZ5 A;  1BR2 A;  2L0K A;  3ZQ7 A;  3KP2 A;  2Z33 A;  1JT6 A;  4DGW B;  1FP1 D;  1STZ A;  4EV0 A;  5EGO B;  1N78 A;  4RLF A;  5EG0 A;  4Y17 A;  3E6M A;  3PIP F;  1CF7 B;  4ZC3 A;  1F1Z A;  3OOU A;  4QIW N;  2HZD A;  3ASO H;  1MMG A;  3UNG C;  2WAQ N;  4BXF A;  3MAJ A;  3I0T A;  1QHH D;  1R7J A;  2LNB A;  1VQL I;  1P7J A;  3FIW A;  1Y6I A;  3ZMT A;  2E19 A;  2QQ8 A;  1OQY A;  2WAE A;  4P1W A;  2V79 A;  3IH3 A;  4BL0 B;  4MLO A;  4XOT A;  4K2E A;  3OY9 A;  3P9I A;  1HA8 A;  4GXO A;  3CJT B;  3MQ0 A;  1R22 A;  4G7Z F;  5FLM J;  2LOO A;  2PLY A;  2BBY A;  5JLX A;  1I1S A;  1I1G A;  5IOY A;  2FMY A;  4KYW A;  3S8P A;  4RM2 A;  2BVL A;  4EM0 B;  1IAW A;  2COB A;  3WG7 H;  3H5A A;  4J01 A;  1ETY A;  3HKZ N;  2OUM A;  3OOP A;  1I27 A;  4LIU A;  2RV8 A;  2XPW A;  1OJL A;  3G1O A;  4Y52 J;  3Q5F A;  4A6E A;  5JVT A;  1FOX A;  2MA3 A;  1UHM A;  2BV6 A;  4IO9 F;  1OYI A;  4OOI A;  2Y30 A;  3BJ6 A;  3ZQL A;  1J7K A;  4IJA A;  4M3G A;  3RI4 A;  3S3M A;  4A0Z A;  3AAF A;  3BZK A;  1A35 A;  1KQ9 A;  1XX5 A;  2QKL B;  3HZJ A;  3MFK A;  2WBM A;  3E7L A;  1SD6 A;  2CMP A;  2ZME B;  4A3D J;  2LH9 A;  5ILV A;  1S72 I;  3LSK A;  4EGZ A;  1SEU A;  1HW2 A;  1GHC A;  3ZXS A;  3KYD B;  4G7O F;  2TCT A;  1LDD A;  2RVC A;  1E0E A;  2W25 A;  1PJR A;  3RJP A;  3HBL A;  3GTG J;  3A1Y A;  2XPV A;  5K7F A;  4HDU A;  2LK2 A;  4O6J A;  3FHN A;  4CCN A;  4EGY A;  1HSJ A;  2HNH A;  2P4W A;  3FM5 A;  3IKT A;  4XKV A;  3PNY A;  5HS7 A;  1LVA A;  1VF9 A;  2VOO A;  5ICF A;  2H94 A;  2F5E A;  2XDV A;  2F2E A;  1YG2 A;  4ESF A;  1UMQ A;  4ZYG A;  3PO3 J;  3TOA A;  3E5Q A;  3WTU C;  1QZZ A;  2FBH A;  1K79 A;  1D3Y A;  1SFK A;  3PJR A;  3RPQ A;  1OIS A;  3I59 B;  2PJR A;  1T0F C;  1XS9 A;  2DJN A;  5E1Z B;  3MVP A;  2HU9 A;  2EWN A;  3PUB A;  3G4S I;  4Y33 A;  1ETV A;  1G8X A;  1E3H A;  4E6K G;  2HXI A;  2VJI A;  5IT9 Z;  5IP7 J;  4PFO A;  2LKX A;  2P7C B;  1D5V A;  1KGS A; 
#chains in the Genus database with same CATH homology
 1POG A;  5IYD J;  1P7I A;  5GP9 A;  4A3E J;  2HQ5 A;  1HF0 A;  1K61 A;  2DTZ A;  3LSR A;  2GBY A;  4W97 A;  5F08 A;  2DA1 A;  1F36 A;  3S14 J;  1QRY A;  1RPW A;  1Y1V J;  4BY1 J;  4AYB N;  3JRG A;  2GM4 A;  1QVU A;  1G2H A;  2X6O A;  3GTQ J;  1AKH B;  1WPK A;  3JRF A;  3BQY A;  3L1P A;  1IG7 A;  3S2H J;  1D5Y A;  3IH4 A;  3HM5 A;  3ZQH A;  2HDD A;  1WH7 A;  2Y31 A;  3DCF A;  3H0G J;  4ABZ A;  4M3E A;  2XGD A;  2AO9 A;  1X58 A;  2HYJ A;  4A3F J;  1ORK A;  2R92 J;  2KDZ A;  1JTY A;  1ETQ A;  2DA3 A;  3JRD A;  2Y2Z A;  1H88 C;  1JTX A;  1BW6 A;  4A3I J;  2LVS A;  3NAU A;  1U9N A;  3O8G A;  4UUT A;  2JWT A;  2ID6 A;  3BR5 A;  4DZP A;  1BJZ A;  3JRI A;  5K7Z A;  3RKQ A;  4IHV A;  2I10 A;  1GV5 A;  2XRL A;  1TWF J;  4X1E A;  3ZQC A;  4MO7 A;  2KT0 A;  1K83 J;  3A01 A;  3BG5 A;  5M5W J;  3WHC A;  3JR9 A;  2DN0 A;  3F0C A;  4DW6 A;  4I6Z A;  3TP3 A;  2VKE A;  1LFU P;  2LY9 A;  1ITY A;  5F1J A;  2K40 A;  4MFE A;  1AHD P;  2ELK A;  2Y9Y A;  2TRT A;  1OCT C;  1NK2 P;  1HCR A;  1WI3 A;  1TWH J;  1CQT A;  4FCY A;  1B8I B;  2NVT J;  2YU9 J;  3HOV J;  1QPI A;  2MSY A;  1Y1W J;  1MSE C;  3TP0 A;  1ETK A;  4JX5 A;  2DA4 A;  3B6C A;  1JJ8 C;  2MW8 A;  5EZG A;  4FTH A;  3FK7 A;  2R0Q C;  2CJJ A;  1IDZ A;  4D7M A;  4AC0 A;  5F0F A;  2G0E A;  3HOY J;  1AKH A;  4BKX A;  4EEF G;  2VUM J;  2Y0S N;  1HDP A;  3GTJ J;  1E3O C;  1WH5 A;  4LOC A;  3S1R J;  1ZR2 A;  1RET A;  1WGX A;  4XRS A;  3HB9 A;  2ECC A;  2VI6 A;  2MGQ A;  3TW6 A;  2L7Z A;  4HNV A;  2JA5 J;  1GUU A;  2Y9Z A;  3GTO J;  4XIC A;  2O8K A;  1TWC J;  1IV6 A;  1IJW C;  5JLW A;  3HOX J;  1DU0 A;  2M34 A;  4DYQ A;  5C44 J;  3M3Y J;  4M3F A;  1NK3 P;  3ZQI A;  4BXX J;  4IEJ A;  1SAN A;  2EBI A;  4UUS B;  2AHQ A;  2HXO A;  3BG9 A;  1GDT A;  3LNQ A;  5C4X J;  3S2D J;  2N8G A;  4JYK A;  5FLV A;  4A93 J;  5M5X J;  1JGG A;  1FTT A;  1YRN B;  1BW5 A;  4QSH A;  3S17 J;  3G1L A;  4G12 A;  3HOU J;  2ME0 A;  1T33 A;  2JN6 A;  5FKM A;  5K7H A;  1IRZ A;  2M8G X;  2ECB A;  5BNG A;  3SJM A;  1FTZ A;  1DU6 A;  5M3F J;  2X9D A;  3HGY A;  2K9N A;  1Z0X A;  2NOG A;  2EZH A;  4A3J J;  1Q1V A;  3BR6 A;  4M3D A;  4QTR A;  5F27 A;  3BTJ A;  5EF6 A;  4XRS G;  1B8I A;  2NVX J;  1IGN A;  3OSF A;  5FKK A;  2JK3 A;  2DMN A;  5F0C A;  2R5Y B;  3JRH A;  2CUF A;  4J19 A;  3TED A;  3ZOB A;  4XID A;  2XB5 A;  3BG3 A;  4C3H J;  3GTM J;  1FJL A;  2EZL A;  1X2M A;  4GFB A;  1TWG J;  2D5V A;  4A3K J;  5IP9 J;  1U8B A;  4A69 C;  5EYR A;  1ZTR A;  1OCP A;  1MBE A;  5M5Y J;  3H3V K;  3S1M J;  2NVQ J;  3HOZ J;  5IYC J;  1ZR4 A;  1PUF B;  3IV5 A;  5E3O A;  3CCY A;  2FQ4 A;  3UKG A;  3ZQF A;  4BBS J;  3W6V A;  2FJ1 A;  1MBJ A;  3GTP J;  3QPS A;  3OSG A;  3BTC A;  1HLV A;  1RES A;  4C3J J;  3FK6 A;  1VND A;  3IH2 A;  1JKO C;  2XGE A;  4A3M J;  2VPR A;  3BTL A;  5F0H A;  4D5C A;  1ZKG A;  1RR7 A;  2RAE A;  1S7E A;  3GTK J;  4I76 A;  3RZD J;  4DYC A;  2MG4 A;  4W1U A;  4UUS A;  3I4N J;  5J1R A;  5IOZ A;  2E2H J;  3GTL J;  1BA5 A;  1UHS A;  2WB1 N;  5GPC A;  1MH4 A;  2CQX A;  5FJ8 J;  2ID3 A;  2YS9 A;  5E3M A;  2JA6 J;  3BR2 A;  4M3B A;  2P81 A;  5E3N A;  4FIS A;  3RZO J;  2VKV A;  2R93 J;  1YRN A;  2JA7 J;  3A03 A;  3Q0V A;  2XGC A;  1TWA J;  1WCM J;  4V2G A;  1W0T A;  4B4C A;  2M0C A;  1I6H J;  5FKO A;  3FKI J;  1U78 A;  3CQZ J;  1IC8 A;  2DA2 A;  3S15 J;  5DTD A;  1GVD A;  1XC5 A;  4RBO A;  3I4M J;  2L9R A;  5F04 A;  5J3L A;  3BR0 A;  2EZI A;  5M3M J;  2XSD C;  3NAR A;  2LD5 A;  3C2B A;  2FD5 A;  4C2M J;  2OPT A;  3S1Q J;  1JUP A;  3VPR A;  4Y7N J;  4FE4 A;  2K9S A;  3B6A A;  2ZB9 A;  4IHX A;  3OIO A;  2JJ7 A;  1MBK A;  2E2I J;  4B3A A;  2OF7 A;  2PMZ N;  5IP6 A;  2DA6 A;  2B63 J;  1RKT A;  5EG0 B;  1H8A C;  1A5J A;  1A6I A;  4MIM A;  3S16 J;  2YUS A;  3K2A A;  2IAI A;  5E3L A;  2DMT A;  1RKW A;  1VI0 A;  1APL C;  1F43 A;  4XRM A;  2HOS A;  4V2F A;  1FIP A;  3JRC A;  3HEF A;  1PUF A;  3FIS A;  1O4X A;  5J1U A;  3A01 B;  4A3G J;  4C3I J;  4BBR J;  2X48 A;  1H89 C;  2L7M P;  1R9T J;  2IEK A;  1SFO J;  2DMQ A;  4A3L J;  2DMU A;  2NS7 A;  4JP0 A;  4MFD A;  1MSF C;  2IBD A;  2XB0 X;  4IHY A;  1GV2 A;  5C3E J;  2QCO A;  3LOC A;  1JKP C;  2FX0 A;  3CDL A;  3BTI A;  2WV1 A;  1QVT A;  1U9O A;  1B72 B;  5FKL A;  3RQI A;  2E2J J;  4B1R A;  1XG1 A;  1Z77 A;  1ETX A;  1JUM A;  2GLO A;  5EEA A;  2M2E A;  2CUE A;  3MN2 A;  4BY7 J;  1GT0 C;  2R7Z J;  1MBG A;  3HOW J;  2DA7 A;  1W0U A;  1LE8 B;  4S0H B;  2R5Z B;  2JMW A;  4JX4 A;  3WHB A;  5C4J J;  1IUF A;  3G1M A;  4CYC B;  4X6A J;  1JJ6 C;  2LP0 A;  4D7N A;  3QQA A;  1NTC A;  2HOA A;  4DYR A;  2LR8 A;  1AU7 A;  2O7O A;  2NS8 A;  1BL0 A;  3TW7 A;  3D1N I;  1HOM A;  2W48 A;  2L0K A;  2CQQ A;  3CMY A;  3MKL A;  1JT6 A;  1JUS A;  5EGO B;  3HGG A;  5EG0 A;  1JKQ C;  2HOT A;  1OFC X;  3GBG A;  3OOU A;  2K9Q A;  2ME6 A;  4QIW N;  5FKN A;  2WAQ N;  2LFB A;  4IHW A;  5GPA A;  2EH3 A;  1P7J A;  1T56 A;  3JRA A;  2H1K A;  3FIW A;  3PM1 A;  1MBH A;  2E19 A;  1ETO A;  3IH3 A;  3Q0U A;  4RDU A;  3LSP A;  1I50 J;  4MLO A;  1JT0 A;  3Q3S A;  2O9L A;  5FLM J;  1VFC A;  5JLX A;  1ZQ3 P;  5IOY A;  2LLK A;  3QPL A;  5EZH A;  2COB A;  3JRE A;  3HDD A;  4D5F A;  2LTP A;  2NVY J;  2XPU A;  3BT9 A;  1ETY A;  3HKZ N;  2L7F P;  1MBF A;  1B72 A;  2XPW A;  1OJL A;  3G1O A;  4Y52 J;  3A02 A;  2CU7 A;  1ETW A;  2Y30 A;  4DZJ A;  4M3G A;  3ZQL A;  4L5E A;  2R5Y A;  4M6V A;  1ENH A;  3LSG A;  2HI3 A;  4JX6 A;  1HDD C;  3E7L A;  3ZQG A;  2E1O A;  3Q0W A;  4A3D J;  3O8H A;  4FE7 A;  1LE8 A;  2DMP A;  3PO2 J;  2R5Z A;  2JA8 J;  5DS9 A;  3BR3 A;  2DA5 A;  3M4O J;  1FEX A;  2M9H A;  2TCT A;  5EDN A;  3BR1 A;  1ZGW A;  4CYC A;  5HOD A;  1ZK8 A;  1JKR C;  3HBL A;  3GTG J;  5K7F A;  2XPV A;  5J1Y A;  2LK2 A;  5IYB J;  4AUX A;  1MH3 A;  1UG2 A;  1I3Q J;  2H8R A;  1VF9 A;  1X2N A;  5IPA A;  3S1N J;  3DEW A;  3SFI A;  1UMQ A;  3PO3 J;  2CRG A;  5EGO A;  1MNM C;  1IDY A;  4A3C J;  1XS9 A;  2DJN A;  1LFB A;  2EZK A;  4NDL A;  3MVP A;  1FIA A;  3K7A J;  2QF7 A;  3BQZ A;  1ETV A;  3LSJ A;  4A3B J;  9ANT A;  2HXI A;  1EF4 A;  2EQR A;  5IP7 J;  1TC3 C;  3SDG A;  2LKX A;  4XK4 A;  3JRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...