5IP9J

Structure of rna polymerase ii-tfiif complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ip9J00
3JRBA 5F0CA 1X58A 3ZOBA 1TWAJ 2DMNA 1T56A 1HLVA 4V2GA 5M5XJ 2H1KA 1K83J 4JYKA 5IOYA 1FJLA 2HOTA 1HCRA 4A3LJ 5M5WJ 4A3EJ 2NVYJ 4JX4A 4G12A 2GM4A 3G1OA 3NARA 5EDNA 3JRGA 2Y9YA 1Y1VJ 1ZKGA 3IH2A 4AC0A 1PUFA 4JP0A 1K61A 1NK2P 2IBDA 1UHSA 4D5FA 1ZQ3P 2L7MP 2E2HJ 2YUSA 1B8IB 5J1YA 2FJ1A 2YU9J 4FISA 4IEJA 3Q0VA 3MN2A 3OIOA 4DYCA 1GV5A 1A6IA 3PM1A 1LFBA 2LLKA 5FKLA 1WH5A 4MIMA 4MO7A 2WAQN 2L0KA 1P7JA 2P81A 2XPUA 1ZK8A 5FKKA 5E3LA 3IH3A 3H3VK 5IYBJ 3FK7A 2O7OA 2QF7A 5FKNA 2TCTA 2K40A 1HDPA 1X2NA 5FKMA 2Y0SN 4RDUA 3BQZA 1XC5A 1AU7A 2VPRA 3RZDJ 2M9HA 1GV2A 2LFBA 3FK6A 2HQ5A 2VI6A 1FTTA 1ETOA 3WHCA 1LE8A 2L7ZA 2JJ7A 3K7AJ 3Q0UA 4UUSB 2MGQA 3S1NJ 4A3BJ 1MBEA 2EH3A 2M8GX 1MBKA 2CJJA 3BQYA 4Y52J 2LY9A 4BY1J 1XS9A 2DMUA 1GUUA 5DS9A 2HDDA 2Y31A 1QVUA 3ZQIA 3TEDA 3S1MJ 2JN6A 3C2BA 4A3FJ 2YS9A 4IHYA 1ETWA 3CDLA 1AKHA 5M3MJ 1ENHA 4A3KJ 2HXIA 2E1OA 5F0HA 2XPVA 1JKPC 1RETA 2R92J 5EG0B 1TWHJ 1H88C 2VKVA 3SDGA 5JLXA 1XG1A 1UG2A 1TWCJ 2DMTA 2VKEA 3S14J 1U8BA 3HOVJ 2CQQA 9ANTA 2R5ZA 2O9LA 3GTJJ 3JRFA 3OOUA 5IYDJ 1TWFJ 3RQIA 2EZKA 1IUFA 1ORKA 2MG4A 4D7MA 3CMYA 2NS7A 2CQXA 2GLOA 2NOGA 2FQ4A 2XB0X 3TW7A 1MSFC 5FJ8J 3JRIA 2L7FP 1CQTA 2KDZA 1Z0XA 4XRSG 3UKGA 1ZR4A 3TW6A 4B3AA 2DA7A 2K9SA 1B72B 2MSYA 1AHDP 3LNQA 4QSHA 2XSDC 3BR1A 4DW6A 2I10A 4A3DJ 2E19A 1JKOC 3WHBA 2XGDA 1JUMA 2OF7A 1JUPA 2MW8A 3G1MA 3HDDA 3FIWA 1E3OC 3A03A 2ID6A 3E7LA 3Q0WA 5BNGA 2DA2A 2R5YA 4MFEA 2ELKA 3LSPA 2ZB9A 4XIDA 3I4MJ 3CCYA 3BTJA 1QRYA 4B4CA 2GBYA 2EQRA 4I76A 1W0UA 2NVQJ 3NAUA 2NS8A 1ETYA 4MLOA 5F04A 4I6ZA 2NVTJ 1OCPA 4D7NA 4A3JJ 1MBHA 2XPWA 1RKTA 3GTQJ 3S1RJ 4AYBN 1ITYA 1YRNB 2LR8A 2JWTA 1GT0C 4DYRA 3OSGA 3GTOJ 3OSFA 5EGOA 1IGNA 5F08A 2XRLA 2KT0A 4V2FA 3RKQA 3HOUJ 4BBRJ 3S2DJ 5IP6A 1U9NA 1IV6A 3A01A 1ETKA 1U9OA 4XRMA 5M3FJ 1WGXA 2DMPA 4X6AJ 5K7FA 1GDTA 3M3YJ 4CYCA 1NTCA 2G0EA 5C3EJ 3A02A 1G2HA 1TWGJ 2ECBA 2LVSA 3DEWA 4S0HB 2HOAA 3JREA 1TC3C 3QQAA 1SFOJ 2E2JJ 3M4OJ 3JRDA 3LSGA 1IRZA 1T33A 1VNDA 3ZQHA 2Y9ZA 4HNVA 2X9DA 3FISA 3BG3A 4XICA 2M2EA 4C3JJ 2LKXA 2EZLA 3SFIA 3TP0A 2R5YB 5GPAA 3B6CA 4GFBA 2JK3A 1HDDC 4UUTA 5EZHA 4RBOA 2R0QC 4JX5A 1DU6A 5GPCA 2EBIA 1PUFB 4A3GJ 2QCOA 1RKWA 3QPSA 1WH7A 3GTGJ 2DN0A 3SJMA 2COBA 4FTHA 2EZIA 1D5YA 3BG9A 1A5JA 3BTIA 4M3DA 1H89C 3HEFA 4FCYA 3GTKJ 2CUFA 2DA4A 3BR5A 1X2MA 4BXXJ 2X6OA 1MNMC 4A69C 3LSRA 3LSJA 1F36A 1IJWC 2CU7A 5F1JA 1QPIA 4M3BA 4M3EA 4M6VA 2R7ZJ 3HGYA 1BW5A 2OPTA 4BY7J 1RPWA 3B6AA 1JJ8C 2IAIA 1MBJA 2WB1N 5IPAA 3ZQLA 1FIPA 1UMQA 1B8IA 5F27A 1LE8B 2ECCA 2PMZN 4NDLA 1SANA 2X48A 3S1QJ 3JRCA 2AHQA 1S7EA 4B1RA 1JT0A 3HB9A 3JRAA 2W48A 4QTRA 5GP9A 2JA5J 2DA1A 1ZTRA 5DTDA 2B63J 1WI3A 2CUEA 2ME0A 5EYRA 4D5CA 1R9TJ 4IHXA 1JTYA 4DYQA 3G1LA 2JA6J 2Y2ZA 4DZPA 3Q3SA 1HOMA 2R93J 1ETXA 1IDZA 5F0FA 3HOZJ 3ZQGA 3BTLA 1VF9A 2M34A 1AKHB 1EF4A 2HOSA 1MBFA 1OFCX 3K2AA 4W97A 1Y1WJ 5EEAA 1RESA 5K7HA 1BA5A 1MSEC 3BT9A 3HKZN 2O8KA 1JT6A 4LOCA 4UUSA 1Z77A 1GVDA 1O4XA 4X1EA 1OJLA 3JRHA 5M5YJ 1JKRC 1OCTC 3JR9A 2VUMJ 2FD5A 4M3FA 4AUXA 2JMWA 4FE7A 4BBSJ 2R5ZB 3S16J 1QVTA 2LP0A 1BJZA 3D1NI 1H8AC 1JJ6C 1WCMJ 1P7IA 2DA3A 1BL0A 1IDYA 2DA6A 1JKQC 2DJNA 3HOWJ 2WV1A 1JTXA 5J1UA 4BKXA 5C4XJ 2RAEA 4IHWA 1ZGWA 5EG0A 5E3MA 5IP7J 3TP3A 2LK2A 5IOZA 1DU0A 1FEXA 5FLMJ 3ZQCA 1I3QJ 2DTZA 3VPRA 2XB5A 2XGEA 4J19A 4XRSA 2TRTA 3IV5A 3S2HJ 4C2MJ 1JUSA 3GTLJ 1JGGA 2E2IJ 1RR7A 2CRGA 3PO3J 1NK3P 3O8HA 3QPLA 2ME6A 1APLC 1ZR2A 2EZHA 3I4NJ 4FE4A 3HM5A 2NVXJ 4A3CJ 2D5VA 1F43A 1B72A 2DA5A 1ETQA 5J1RA 3BR3A 4W1UA 5EF6A 2DMQA 4MFDA 2N8GA 3L1PA 1MBGA 2AO9A 2ID3A 2K9NA 5HODA 2LTPA 5K7ZA 3HOXJ 1U78A 4A93J 1IC8A 3BR6A 2JA8J 3O8GA 1FIAA 2L9RA 5E3NA 4QIWN 3S15J 1IG7A 4EEFG 1W0TA 1I6HJ 3BG5A 3IH4A 3MKLA 1WPKA 4C3IJ 4A3MJ 4A3IJ 1LFUP 1I50J 3HBLA 2FX0A 5EGOB 2M0CA 4JX6A 5E3OA 2XGCA 1VFCA 4L5EA 3GTPJ 5JLWA 3A01B 3BR0A 3RZOJ 3LOCA 3PO2J 3F0CA 4DZJA 5IP9J 5C4JJ 5EZGA 3BR2A 3MVPA 1POGA 3W6VA 3S17J 4CYCB 2HI3A 5J3LA 5C44J 1ETVA 3HGGA 4XK4A 4IHVA 3H0GJ 3ZQFA 4ABZA 2LD5A 1YRNA 1HF0A 5FLVA 3BTCA 4Y7NJ 4M3GA 3GTMJ 3GBGA 1FTZA 2HXOA 1BW6A 1MH3A 2Y30A 2HYJA 5IYCJ 1MH4A 3CQZJ 2JA7J 1Q1VA 4C3HJ 1VI0A 2K9QA 3DCFA 3HOYJ 2IEKA 3FKIJ 2H8RA 5FKOA
chains in the Genus database with same CATH superfamily
3JRBA 2GA2A 1X58A 3ZOBA 2WAEA 1T56A 2H1KA 3O3KA 4N4OB 4MTDA 2X6WA 2LMDA 5IOYA 4CYDA 2R7WA 3WGIA 2HVQA 2BY0A 4HX4A 2DCEA 3DEEA 1R5GA 3A0BC 1VQ8I 4O6JA 1V5FA 3E5UA 2X1EA 4JX4A 3FKJA 3K2ZA 3H36A 3ZN1A 2HTJA 3MD2A 1WFXA 4BE2A 3BJOA 4A0ZA 2P5VA 3JRGA 2HWVA 2A05A 4ZYGA 3ZXSA 3C7JA 1FMVA 4S04A 2EV0A 4F93B 1I1SA 2FOKA 4BQOA 3W6JB 4ANJA 3VFZA 5HS8A 1NK2P 2WY7Q 3D5SC 2VXZA 2DT5A 2YUSA 4ZDOA 5KNLA 1B8IB 2P7VB 4FISA 1T98A 1Y56A 4HG2A 3OIOA 1GV5A 5FKLA 3WTXC 3CUOA 2MC3A 1P7JA 2ELHA 3G2BA 2CV2A 4RLFA 3DFGA 2BY1A 3FK7A 2E5NA 2E1MB 3TGNA 2H6CA 5FKNA 2LKPA 3BCAA 1U8RA 1X2NA 5FKMA 1LPQA 4A6DA 3BQZA 4G9YA 2CWEA 1UHMA 4LG0A 3HIFA 1QA6A 3FK6A 3DLLF 1FTTA 2IPQX 2W57A 4RM2A 3WHCA 2JJ7A 2X1CA 5L3GA 5IT9K 1FLIA 5ERIA 5J4YA 4PK4A 3W6KB 1MBEA 2X0LA 2QQAA 4JBAA 4RAYA 3PJRA 4IKFA 2M8GX 5LBQA 1YI2I 4J00A 2X4HA 3R6SA 1S7AA 2HVRA 2LYCA 3IWFA 2WAQA 3AFHA 4FQGA 1Y39A 4V19K 3SHFA 3S1MJ 2DJIA 3ZQIA 3GXOA 2JN6A 2YS9A 3OMYA 5B66C 4XBFA 4FT8A 5D6FA 2PG4A 3LA3A 2J5OA 1Q1HA 1JHFA 2KLOA 4EQQA 2DYSH 5LEKA 3CC4I 1TWHJ 5HLTA 5KK1A 3WTYC 3DV8A 1H88C 1MDMA 2VKVA 3ZMSA 4Q5SF 1ZG3A 4UVBA 2BVLA 1U8BA 4LIUA 1YFHA 4NQWA 4MQ9F 4ITVA 1V54H 4B3XA 2EB7A 3ZGKA 4D7MA 3CC7I 2UWMA 1W5SA 1YE9A 2GLOA 3F8MA 3TW7A 1MSFC 3RQ4A 2OBPA 3JRIA 5AIQA 4CHUA 1LFPA 2KDZA 1CQTA 4HLYA 3WTTC 4DQ2A 3E6CC 4DJAA 2ESHA 3F8CA 4B3AA 2FOWA 4BEHA 3MZYA 3I5UA 2F48A 3FM5A 3V8KA 4E6KG 1J0RA 2KJCA 3EETA 4AIDA 4F3QA 5KVRA 4PJMA 5H20A 3WHBA 2WBMA 3VYTB 4EM2A 1PJRA 1JUMA 5D5UB 2OF7A 2MW8A 1YQAA 4CCJA 3G1MA 1UZCA 3HDDA 2E1CA 2GOMA 2VPLA 1E3OC 3F23A 2DAOA 3FXQA 5BOXA 2HQNA 3FXKA 1RUOA 2A5WA 4HBLA 1ZG5A 4IZZA 3KZZA 3GMEA 3Q9SA 1I1GA 2ELKA 3LSPA 2QGUA 2WY8Q 1T8IA 2F5FA 3I4MJ 3BTJA 1QRYA 1WJCA 1XB4A 1X3ZB 4KISA 2EQRA 3K9TA 4MHGA 3ISPA 2NVQJ 3VWBA 1ETYA 1OCPA 3OS1A 1RKTA 2HZTA 2LDUA 1MMSA 3S1RJ 4KDPA 1O3QA 4LIVA 4XKWA 4TV7A 2PI0A 4P96A 1ITYA 5LGTA 1YRNB 2ZXWH 1SD4A 1A04A 1BI2A 3SZGA 1A6QA 4CZCA 5EGOA 1IGNA 3CESA 1D0YA 1GXPA 1Y6IA 1B4AA 2EA2A 3S2DJ 4L0YB 3HSFA 3CCRI 4AIHA 2FSWA 2NNNA 2H27A 1NH3A 1U9OA 3KYCB 1QNTA 2MH2A 4WK8F 4U7DA 2PJRA 4CYCA 1FP1D 1DGRM 4ESBA 3J81K 3A02A 4A5NA 3CCEI 1W36D 2K7LA 2ECBA 2HKOA 1WJ5A 2IA0A 1SFKA 3JREA 1W1WE 4KA4A 3HOSA 3QQAA 2OTJI 4P9UA 2E36A 1XGNA 3CJRB 4FASD 1SFOJ 3JRDA 1K6YA 2P4WA 4ZYAA 1IRZA 3HPHA 3FWEA 1T33A 1VNDA 1Y8QB 3ZQHA 1E17A 3GUDA 2M45A 3TO9A 2EFNA 3HHHA 3HRUA 2W84A 2E5ZA 4C3JJ 3BROA 2EZLA 3TP0A 5H6QA 2R5YB 5GPAA 1ZAOA 4GGGA 3PIOF 4HX8A 1VQLI 2XIGA 3HL2A 4GFBA 1YYVA 2JK3A 2LY1A 1LVKA 2IVMA 1KGSA 2H94A 3HJEA 4JX5A 2R0QC 5BPDA 4A0XA 2EBIA 3V7CA 4AWXB 1YO5C 2QCOA 1PUFB 4A3GJ 3K4JA 4HF0A 3CF5F 2DI3A 4UVAA 2Z33A 2FU4A 3ABLH 3LFUA 4AVZA 3OYJA 4NBQA 2UXNA 4G94A 1STZA 4ZTJA 2CUJA 4YRVA 1OYWA 2PN6A 2DA4A 2UUZA 2F5DA 4IRHA 4QWQA 4BXXJ 1PVEA 2DDBA 2K3PA 3BOQA 4UB6C 2ZO4A 5BMZA 3OS2A 1YITI 1FMWA 1SVOA 1XMKA 1K4TA 5DV5A 2ZBKA 1IJWC 4GDFA 1ZRCA 2KQRA 1E0EA 5F1JA 1QPIA 4M3BA 3V7RA 1YJ9I 4YIRX 5HVQC 3GYHX 2R7ZJ 2OPTA 2JUGA 3I55I 4CICA 1G59A 3H3UA 2KFDA 4AIKA 4HOBA 3VOEA 3ZQLA 1B8IA 3SXYA 2F5CA 2XKOA 5IT9Z 2K86A 1G8XA 2PMZN 4NDLA 4OOIA 4NC6A 3TOBA 2CQNA 3JRCA 1S7EA 4B1RA 1X4OA 3HB9A 3JRAA 3OL4A 4QTRA 1JT0A 4A12A 2P7CB 2Z1DA 3AG4H 2FF4A 2TDXA 3CP2A 1X1AA 2BHYA 2HEOA 5EYRA 3TMOA 4WX9A 4IHXA 3BDDA 3I53A 3LSTA 1JTYA 3ABMH 1DPRA 3G1LA 1LJ9A 4DGWB 4NUBA 2W85A 5FFXA 2F5VA 4NC8A 3HOZJ 2L02A 3BLYA 3ZQGA 4L0ZB 2NOJB 1A35A 3DKYA 1DGWY 2O03A 5D5WB 2HVSA 4GXOA 2HQRA 4NC7A 2QSGX 1IRXA 2KISA 2HOSA 1OFCX 4W97A 3CUQC 5TRDA 1BA5A 1RESA 3CP8A 5K7HA 2DTRA 5CQEA 2MLGA 1MSEC 2WWYA 3KE2A 2VIXA 5D8LB 1XCVA 2P8TA 3DTKA 1IN7A 1O4XA 2ACJA 1OJLA 2FQ3A 3JRHA 1OCTC 2FD5A 4IQ4A 4BBSJ 4EM1A 4XORA 3I58A 1W4MA 1QVTA 4CZZA 1H8AC 2WV0A 3OYKA 4L5IA 2DA3A 3OYHA 1V4RA 2MABA 3R0AA 3DXJF 3CO7C 2PQ8A 1FT9A 2CYYA 4EATA 3HOWJ 2F6CA 1B9NA 1I5ZA 2WTEA 1YLFA 5C4XJ 4RAGA 3W2AA 2Z99A 1VQMI 5CVVA 1ZGWA 4YEJA 5E3MA 5FLXK 1UJ8A 1R4NB 4Y17A 1AOYA 3ZN0A 3L2WA 3KZIC 2EFPA 1FYMA 3KP7A 5FLMJ 4WXDA 1I3QJ 2JT1A 3FXRA 4HA8A 3ZMZA 1HBXG 3VPRA 2VBZA 1Z21A 2F4IA 1DPUA 2R7QA 4ZC3A 2XF5A 4LLNA 5CVUA 4KNYA 4IF4A 2E2IJ 2CRGA 1TQIA 4XOTA 4HSTA 4XLFA 2BYVE 3G4SI 1WHUA 3WE2A 5K1YA 3HM5A 5HDGA 2CV1A 2GXAA 3AL0B 1ZGAA 2M30A 1MMGA 1S72I 5HS9A 5J1RA 5TGTA 3CCVI 2VE8A 4KMUX 5HS7A 2VONA 2VT3A 4IVNA 2N8GA 2VOOA 2ID3A 2AO9A 2X6YA 3AG1H 3P9CA 3VYSB 1S5LC 4RB1A 1U78A 2JRMA 1IC8A 1O57A 1OR7C 4CCNA 1K4SA 3I9V2 4N0BA 1FIAA 2V1UA 3KEYA 4QIWN 4EEFG 4A3MJ 4A3IJ 2OV7A 4KYWA 2KRFA 2ZMEB 2M0CA 4XKCA 3CDIA 2P0WA 3COAC 4KIGA 3GTPJ 3I0TA 3K4MA 1SAXA 2NS0A 5LRRA 2L9NA 5C4JJ 2MH9A 5EZGA 3J81Z 3MVPA 1VTNC 2V6EA 3WTWC 2DPDA 1ZREA 1VQ4I 3S17J 4A0YA 2QBYA 1E2XA 1ZHFA 3HGGA 4XK4A 1Z91A 4IHVA 1X1CA 5AIPA 3H0DA 2LD5A 1YRNA 2ELJA 5BPIA 4XOPA 5FLVA 2E1NA 3T1BA 1QZEA 2ESNA 2RVCA 5ILUA 2A69F 2IGMA 4M3GA 1REPC 3LSMA 4DOZA 3GTMJ 1XGMA 4XSZF 5IYCJ 4OINF 2RKHA 3CQZJ 3F72A 1Q1VA 4IJAA 5HDKA 3D5RC 3J7AY 1UFMA 4ENJA 2EV6A 2VC0A 2W25A 2D1HA 5HOOA 1TT5B 2JPCA 3E5XA 1HLVA 5M5XJ 2BXZA 4UVCA 4BDYA 3L9FA 4LGWA 2EPFA 3FM3A 2R4GA 3EUAA 3IKVA 4YIFA 3O6BB 4U0YA 3WTSC 4A3LJ 2OZ6A 2FBHA 2HPIA 2NVYJ 1HKSA 1KYWA 1BN5A 1ZG1A 4ENMA 3S93A 1SFXA 2GWRA 3NARA 3PQJA 2J5PA 2V1DA 4XLEA 2BBYA 4EJUA 1WZ2A 4ZYDA 3CLOA 3ZQQA 2VBXA 2VBYA 4RB3C 4HW0A 4AC0A 2RNGA 1PUFA 2HOEA 2LY2A 5DYMA 3BC8A 5KAFC 4BNCA 2IBDA 1UHSA 4D5FA 3DU6A 2L7MP 3KP5A 2ZJQF 1NG6A 3SZPA 1SFEA 2FJ1A 5J1YA 2XAQA 1U5TC 2NRAC 3MN2A 4HQMA 2PX9A 1MMAA 4WXHA 3PM1A 3T0YA 1YHQI 4UV9A 2QKLB 3RPUA 2MBFA 4RGSA 3GW2A 3MZHA 1ZH5A 2XPUA 1ZK8A 3CCQI 4HF1A 5FKKA 4ZZLA 3NWSA 1RR8C 3ZCOA 3CCSI 1EH8A 1NG7A 2EFOA 2QF7A 1R58A 2MA3A 1T0FA 3EUKL 2Y0SN 2K02A 3GEZA 4MTEA 4RDUA 3L09A 2O5RA 1EV7A 2M9HA 1GV2A 3GZ5A 2LFBA 4Z6YA 4E4HA 1SFUA 4M9SA 3MCZA 1O3RA 4H4KC 3ZMUA 2L01A 2LNBA 3K7AJ 5JVGF 3MKZA 2XC7A 3RDIA 2MGQA 3S1NJ 2K4BA 1TZLA 3OYCA 4FX0A 3A2KA 4YELA 3MZ8A 1HSJA 5LHIA 1T08B 2FEZA 2R7OA 3BQYA 4MGRA 1W7PA 1R71A 3F3XA 1D0XA 1XS9A 1P9QC 3CTAA 4BY1J 1SAUA 3EPZA 3P9KA 2BEOA 2DMUA 2D45A 4I0BA 2Y31A 1QVUA 2M87A 4IOCF 1DDNA 4A3FJ 2MD5A 2ZSHB 4BQQA 4BYYA 3CCJI 1IW7F 1UAAA 1BIBA 5M3MJ 4I02A 5E1XA 4RAFA 5F0HA 3T8TA 5FLXZ 1JKPC 2V6CA 2QQBA 2ZFWA 1IRFA 2Y48A 5EG0B 2QEXI 4O3MA 4XLPF 1D0ZA 2CV0A 1D3YA 2JVGA 5JFRA 2OQRA 1K78A 3S14J 4Q48A 3FF5A 4LD5A 1FX7A 2O9LA 2RDPA 1G3SA 1TWFJ 4R1HA 2LC2A 3REOA 1ORKA 3CMYA 3RIRA 3FXOA 1FC3A 2NOGA 3R60A 2XB0X 4ZDPA 1S9HA 3N97A 1G6NA 1QQIA 2L7FP 4UXNA 2ZCWA 4M71A 4XRFA 1ZR4A 5J8FA 2LBFB 1AHDP 3LNQA 4QSHA 1BR4A 1YW7A 4EJOA 1S6LA 2I10A 1XPXA 3JSPA 3ABTA 5FO5A 2H1LA 3P5JA 5E18F 2LSOA 4IPAA 2E19A 2EILH 1JKOC 3KP4A 2ZXIA 2DPUA 3U9GA 3MQ0A 1FP2A 2GXGA 3V4GA 3AKZA 3WU2C 4KUMA 4LB5A 3E6DA 3UR3C 3A03A 3Q0WA 4CCOA 5J47A 2BXYA 1TW2A 5BNGA 1R7JA 4XLNF 1N78A 2V26A 2JSPA 3KIOA 4Y3OA 4PGHA 4XIDA 1FZPB 4G7HF 2LOOA 1HKQA 4B4CA 4AD9A 2STTA 5CVJA 3K4NA 5JVTA 2DODA 3NEUA 3HRTA 1W0UA 5CKTA 1JI8A 3HG9A 3E6BA 4C2UA 4D7NA 1XCBA 2FNAA 3WODF 2QVOA 3JTGA 1FSEA 4AYBN 1OYYA 1IN6A 2XF6A 2A68F 5E1ZB 3TO6A 3RKXA 2JWTA 3OS0A 1GT0C 3OSFA 2ZMEA 2CFOA 4U0WA 5F08A 2CQKA 1ZYRF 5CVIA 3WTZA 4HNTA 3HOUJ 1FOXA 4C9YA 1IV6A 3DKXA 3FBNB 3IUOA 1BC7C 2VASA 2GZWA 5K7FA 4BJ6C 4L9VA 3M3YJ 3OYLA 2G0EA 1IXRC 1YW9A 2RREA 4KITB 2A5YB 5E8IA 1R36A 3L2CA 4HZFA 4KFCA 2ZXJA 4MEYF 5H6RA 2W7NA 1YS6A 3P9IA 3QPHA 1T95A 4KN7X 2E2JJ 2IRFG 3MEXA 2E60A 2QLZA 3M4OJ 3LSGA 2C6YA 1C0WA 5DM7F 3PNTA 5F1RA 2IS1A 3FISA 1J09A 1MMNA 4HF2A 2R7FA 1MMDA 1S29A 2M2EA 1XGSA 2YX7A 1YTYA 4H0EA 1UB9A 1Z1DA 3SFIA 2LH9A 3S2WA 5LFAA 3B6CA 3ZQ7A 1XTAA 1LDDA 1ZLKA 1Z9CA 4BH9A 1VQOI 4IOAF 4IHSA 5GPCA 2AXLA 2EIKH 4XKVA 3GTGJ 4DNCA 2L2OA 2X1DA 2XVCA 4FTHA 2W82A 1SD7A 5LEJA 4CDGA 3HRSA 2HNHA 3LAPA 1BBYA 5LRSA 3ELKA 3BPVA 3TQNA 1A5JA 3HEFA 2BY2A 2X6OA 2PFBA 2XUBA 2GIZA 4A69C 3HTSB 5DCFA 3C18A 3LSJA 4PDKA 3MKYB 3FMRA 1BI3A 3CUQB 2Q1ZB 2E71A 1L0OC 4ASNA 2DOAA 2VLAA 3H1CA 3OYFA 1S8NA 1RPWA 2H09A 3B6AA 4I01A 5ICCA 1MBJA 5IPAA 2L5QA 1A36A 1FIPA 1UMQA 1KONA 1LE8B 2ECCA 1ON1A 1SC7A 4F52A 1FBUA 4K2EA 4DBQA 1V5EA 3E97A 1KQ0A 2AHQA 3LSHA 2DQRA 5GP9A 5FGMA 2DA1A 3WGHA 2VQLA 2Q2EB 3FXMA 1H9GA 1WWXA 4D5CA 3GWZA 3WU1B 3IL2A 3G71I 2Y2ZA 1T2KA 5CJ9A 1DP3A 5E8GA 2R93J 1R22A 1ETXA 3PNVA 1IDZA 3K0LA 2NAZA 3B02A 2CSOA 1VF9A 4A5MA 2QYOA 5FRMA 1AKHB 4I98B 4QLCU 1EF4A 2LF8A 1MBFA 3K10A 3I71A 1Y1WJ 5EEAA 4X0GA 1XDUA 1JT6A 4LOCA 1R6RA 2QQ9A 2W1OA 2FA5A 2WB1A 2EFQA 5BS6A 4HDUA 5M5YJ 2X85A 2Y0MA 2BHZA 2VUMJ 4AUXA 2R7UA 1BC8C 1R5ID 2R5ZB 1GVJA 4BQAA 2VOPA 3CJTB 1RIOH 2LP0A 3C3WA 4M73A 1WCMJ 1P7IA 2ZJRF 1QHGA 1IDYA 1R1UA 2DFIA 2KDOA 2MFZA 3LA7A 3MMYB 5HLGA 4HEA2 1Z6TA 5J1UA 4BKXA 4D1QA 2KIUA 1TL8A 5EG0A 3GLLA 3FMQA 3PSIA 1ZRFA 1IN8A 3SDBA 2BE5F 1DU0A 2AS5F 4LK0F 4PSXA 2Z3YA 3L7WA 3IHUA 2UZKA 3HKZA 2YR2A 1LKXA 4QPOA 2E34A 1V5GA 1TBXA 2K27A 3O2PE 1R1TA 4EJVA 2XAHA 4E7JA 3OYBA 1LVAA 1JUSA 1S7OA 3GTLJ 2PBIA 2I5UA 4AVPA 2KL4A 1RI7A 2EIJH 1KZHA 5DUIA 1APLC 5FD6A 3QOPA 1ZR2A 1VQ7I 3I4NJ 4LLLA 3OIPA 3FMSA 4PFOA 4A3CJ 2RQQA 2F4OB 2EINH 2LBFA 2A61A 3F22A 2M4GA 1H9TA 3DWLE 4L5JA 3DPUA 4P1WA 5B3SH 4PGGA 4M72A 3K4BA 4P55A 4ENKA 2CS3A 2KZGA 5KCMA 5K7ZA 3PFYA 3OR2C 2VQCA 2V7FA 3O8GA 4RMNA 2L9RA 3TKYA 1E3PA 3X2QH 1I50J 3A1YA 1IO2A 2XHKA 2M5WA 3LMMA 2E35A 1R5HA 1B1BA 2WAFA 4L5EA 2FBKA 1CF7B 3A01B 3BR0A 1MW7A 3RZOJ 1Z7UA 2Y0SA 4WCGA 1E3HA 3F0CA 3CMAI 3BR2A 4G6QA 1FOYA 2LREA 3FX3A 4B43A 3J80K 3W6VA 1ETVA 4L9TA 2Z2SB 3VYRB 2R7SA 1MJBA 3H0GJ 3I54A 1Z3YA 2VQHA 4ABZA 4J01A 4U0VA 3PQKA 2OD5A 3OYMA 2QM3A 2DQLA 3K6GA 1IZ1A 3M8EA 1XGOA 5E17F 2DFFA 1XN7A 2ZSIB 1I39A 4YFXF 5IY5H 3OWTA 2JA7J 2JUCA 3M1EA 1FOWA 2LG4A 1MIJA 3LSIA 4NB5A 4F91B 3FKIJ 4I09A 3LAJA 4C2TA 2K5CA 2H8RA 2A6TA 4E7LA 3RCOA 2CGPA 1TWAJ 1WSUA 4HPQA 3E1SA 1U5TB 1XDSA 1LEBA 1W5TA 1K83J 1FY7A 1HQCA 2PEXA 3V42A 4BE1A 2HDWA 2M8EA 2RC4A 2XRNA 4OMZA 1F1ZA 1FJLA 3V8LA 2HOTA 5M5WJ 3PL8A 2H6BA 4HNUA 3G6EI 3QODA 3QYFA 3ZRGA 3IWZA 1TQPA 2NYXA 5TJJA 1Y8RB 4G12A 2GM4A 3G1OA 3PNYA 1DP7P 1YG2A 2HTSA 3RPQA 5JHFA 2O3FA 2JPBA 1JXSA 1WKMA 2ZNZA 1FWZA 1ZKGA 3EUHA 2K9MA 2M7BA 4XQFA 4LITA 3LWFA 3MAJA 1QHHD 2XF7A 3EYYA 1K61A 3TOAA 4G6TB 1ZQ3P 1CGPA 2Y69H 4ENNA 1EA3A 2FMYA 2ISYA 2IA1A 3DBLB 4KICA 3CMEI 2E2HJ 2IS2A 1G3WA 4XSXF 3DPTA 3HRMA 4IEJA 1QGPA 2XROA 2ETHA 3Q0VA 3QYEA 1J7KA 4DBRA 3L2VA 1IRGA 1BR2A 4DYCA 4C30A 3GF2A 4OIQF 2M7AA 3GCMA 1WH5A 4MIMA 4MO7A 2WAQN 3G3ZA 2L0KA 1USTA 5F6FA 3K4LA 3BZKA 5E3LA 3IH3A 3H3VK 1K6OA 3QAHA 1LDKB 3CUQA 3I64A 1QPMA 3GLXA 4YIIA 1AU7A 3RZDJ 3CCMI 3EDPA 5GADJ 4CUGA 4E7KA 3HUGB 3ULQB 1LE8A 2L7ZA 3FZVA 4YFKF 4M6XA 5FB2A 4BXFA 1P4AA 1YJWI 2DXIA 1FOKA 3EQLF 5L3CA 2EH3A 1BI0A 1MBKA 1K7AA 4MQVA 3CD6I 2Q2EA 4RA2A 1ZELA 4BE0A 1X1BA 3R0JA 3PIPF 1J2XA 2FBIA 1OISA 2L9VA 4ESFA 3U1KA 2PJPA 2OQGA 2K9LA 4G7ZF 2HDDA 3TEDA 3ZMDA 3LFKA 3MKWB 2HZDA 2G7UA 3ZP5A 4IHYA 3CDLA 3ROUA 1VQ5I 1FSHA 1WVRA 1AKHA 3IAM2 3QRFF 1ENHA 4P9FA 2E1OA 1KU2A 3KP2A 2XPVA 5ICFA 1RETA 2R92J 2V79A 3KEOA 4OAYA 4B44A 4OU0A 4PZJA 5JLXA 1UG2A 2DMTA 2VKEA 3HOVJ 2R5ZA 2R7XA 3DBHB 5E1WA 3GTJJ 3JRFA 2RNJA 1F9NA 1MJ9A 3OOUA 2Z9OA 2YPRA 5IYDJ 2IGOA 3GX4X 2EZKA 2DO7A 2MG4A 2HQAA 2MYSA 3VSLA 2NS7A 3SZTA 1D5VA 5A2QK 1I6XA 4II2A 1FYKA 4XRSG 1BJAA 1TLHB 2X51A 3TW6A 1OR7A 1B72B 2MSYA 4N9IA 3BR1A 4RGXA 2ZFUA 3I56I 2IT0A 4CCKA 2NXNB 5K5OA 3L00A 2DOFA 2FXAA 5DUKA 3WU0A 1QZZA 4Y13A 4FX4A 1M1EB 1Z6RA 2XGDA 3K69A 2COMA 3GVAA 3VEPA 2F4MB 3HC7A 4XLHA 3AG3H 4LLGF 2V1NA 4UY8I 4BGDA 2XSJC 2ID6A 3F9KA 3E7LA 5B1AH 3QP5A 4BAYA 2R5YA 3PUFA 4LB6B 1KQ9A 3P7NA 5EJCA 3BJAA 3CCYA 3IP4B 4ESJA 1PUEE 3J80Z 1UCRA 4I76A 4RS8A 1T0FC 2VKDA 2R7DA 5CLSA 3WE3A 4MLOA 2NVTJ 4I6ZA 1ODDA 3LL7A 3F6OA 2QA4I 3GTQJ 4U87A 4FHTA 3BZCA 2A6HF 4PJ0C 2BW3B 4NNJA 3GZ6A 4PUSA 2PMHA 1O3SA 2HYGD 1TNSA 1P2FA 1XX5A 2LR8A 3F8FA 4L9JA 1YIOA 4E7HA 3OSGA 3GTOJ 3QPTA 2ZXHA 2VT2A 4XN3A 1XSVA 2XRLA 2KT0A 4NHJA 4V2FA 4IRIA 1NHAA 4BBRJ 3ZMVA 2B9SA 1U9NA 3OIQA 1CF7A 4CXFA 3A01A 3IRRA 2V9VA 2VBWA 1ETKA 1N77A 4XRMA 4OIPF 1OCOH 1LNWA 4UUVA 3SFZA 4WF2A 1GDTA 4ZZDA 5C3EJ 1KQ8A 3K70C 4HLXA 5DEQA 1TWGJ 2NVUB 2GQQA 3DLAA 1G4DA 4EJTA 1HC8A 2LVSA 3DEWA 1TTYA 2EV5A 2A07F 4YG2F 3H3ZA 4HYEA 2CMPA 1TC3C 3BZ6A 2M1BA 4PSWA 2ZNYA 3OYIA 5DM6F 1R23A 2MD0A 2BV6A 3SEQA 3TDZC 4B48A 3J7ZI 4HNVA 2QENA 2X9DA 3W2WA 3BG3A 2DBBA 2LKXA 5CYVA 5GTIC 2VJIA 3RJPA 4CH7A 1XD7A 1EKEA 1D8JA 3CO6C 1Z7LA 2B7EA 1SD6A 3VB2A 1JGSA 4N4NB 1HKTA 3R61A 3S3MA 2Q0OA 4KT5C 4RBOA 1DU6A 1O7FA 5D5XB 3U1DA 2M0MA 1IUYA 1WH7A 4ZJZA 3BP8A 3QU3A 2DN0A 2P5LC 4BS9A 3SJMA 2COBA 2M4KA 5D4RA 1MD0A 2LRDA 3CLQA 2MLKA 1YS7A 2A6EF 1D5YA 3BG9A 2VE9A 3CF2A 3HXLA 3BTIA 4M3DA 1QU3A 3ZR8X 2CUFA 1USSA 1MNMC 3NRVA 1KU7A 2K3FA 4JOMA 3AAFA 1HXDA 2XAGA 4HX7A 1SMYF 1F36A 5GTHC 1OCRH 1OCZH 2BGCA 2PJRB 4M3EA 2HYFA 2YU3A 3CCLI 3QWLA 1VQ6I 3ECOA 1BW5A 3AL0C 3KX2A 4BY7J 1H0MA 4OAZA 2OAZA 4FETA 2IAIA 2DDAA 1R1VA 3DU5A 3WTUC 2V9PA 3KYLA 2D1VA 2JA5J 5HNHA 1ZTRA 2B63J 1OPCA 1WI3A 2ME0A 4O5VA 1R9TJ 2CFXA 3QP6A 4DYQA 2KIFA 2JA6J 2Z5UA 2QKMB 3OR1C 2GA1A 3OV8A 3Q3SA 3QOEA 4XONA 4Z2YA 1HOMA 1R49A 5F0FA 3S3OA 2OJED 1LUJB 3HZJA 1I3AA 5LD2C 2M34A 3HUGA 3K2AA 4CCLA 2O8KA 3BT9A 4PFPA 4G8XA 1Z77A 4AM3A 4X1EA 3HPGA 2QWWA 2PMZA 1B9MA 5FD5A 5KAIC 3FDYA 3S16J 2PMUA 1BJZA 2KRCA 2MC4A 1SVLA 1O7LA 3L2QA 3H35A 3C2HA 5A2QZ 2EFWA 1PP8F 4Y33A 4QPQA 2Q8KA 4M74A 3QYBA 5EEGA 1XSXA 2ZJ2A 1V55H 3WG9A 3KLNA 2DK8A 2RAEA 1FBSA 5L3BA 5IP7J 3L2UA 1ZRDA 1IN5A 4IL6C 4XNFA 2KJBA 3LQRA 5DD8A 1FEXA 5FRNA 3ZQCA 3ONQA 3I3LA 4ZYHA 2DTZA 1OLTA 5FFZA 3DEUA 2XB5A 3DQVC 2LKSA 3IV5A 2TRTA 3S32A 1X1PA 1JGGA 1RR7A 3PO3J 3A4CA 4KN4X 1NK3P 4E70A 2RN7A 3QPLA 2ME6A 3K4KA 2EZHA 4FE4A 1TT0A 2B0LA 3JTHA 2D5VA 5ED4A 3BCBA 3H9GA 1B72A 1ONVA 2OUMA 3U21A 2DA5A 4GYIA 1ETQA 1D1AA 3CJNA 1JHHA 4XM3A 4MFDA 2WC2A 4L9NA 4IHTA 3RKWA 2LTPA 3HOXJ 4A93J 4BQNA 1FPQA 4PJLA 3I59B 3MWMA 5E3NA 3GO5A 3S15J 1IXCA 1I6HJ 2XAJA 3BG5A 3FXUA 3IH4A 3ASOH 2LF7A 2CH0A 4XKBA 2FX0A 3DTEA 5E3OA 4JX6A 5EEHA 1D8KA 2QUFA 2XGCA 1VFCA 1EH7A 3RSNA 5HLHA 2M3AA 5JLWA 2E7XA 1ULYA 1PDNC 3LOCA 3PO2J 5K5QA 1MNDA 3M9AA 2L7KA 2KP6A 5LGUA 4ZDLA 3I4PA 5C44J 3RYPA 3FHZA 1VQPI 4S05A 3IKTA 4EVIA 2QQ8A 4ON0A 3DBRB 1WJEA 1AWCA 4RGRA 2HR3A 2BW3A 4BU2A 3MFKA 2RGVA 4I99C 1HW2A 4JQFA 3W2VA 4E7IA 3WGGA 4BL0B 5JR3A 1VZ0A 5H2FC 3OYEA 1KU9A 2EIMH 3BWGA 3VODA 3J7YJ 1LQ1A 3V8JA 2JZYA 1UHWA 2L3DA 4BDZA 3GFIA 2HXOA 1BW6A 4IXAA 4GCVA 1MH3A 4XLCA 3JCUC 2K9QA 2DFEA 2IEKA 3AG2H 4LG3A 1R00A 5FKOA 1Y0NA 5F0CA 2CO5A 1T6SA 6PAXA 2DMNA 4BJTA 3RYRA 4V2GA 1PP7U 2CW8A 2F2EA 3H5NA 4JYKA 1RRJA 4UNOA 1YW8A 2HGCA 2IJLA 1OCCH 1HCRA 2I8DA 3GZNB 4A3EJ 3JW4A 2VB6A 3OYAA 3UNGC 1PYVA 3N4MA 4HDVA 2IGKA 4ETSA 2W24A 5BQTA 2UXXA 1ZLJA 1BR1A 1WJDA 2IXSA 2OC6A 3K4CA 5FROA 3ZMTA 5L3DA 5EDNA 1DQUA 2P6TA 3CJQB 3ZPLA 2Y9YA 1Y1VJ 3W3CA 3DF8A 1UG0A 3IH2A 4CSWA 2H8WA 3CZ6A 5B5EC 5D8KB 4JP0A 4IO9F 1HW5A 2QBYB 3RTRA 2RQPA 2GXBA 4PJNA 5L3EA 1LDJA 2YU9J 1TNTA 4HQEA 2W4SA 2WADA 2DT7B 3M7GA 1BI1A 3M07A 4KJZA 4OWRB 5JI6A 2PLYA 4EMSA 1A6IA 1LFBA 2LLKA 3M8JA 5E20A 1G3YA 3H9JA 4B47A 5K5RA 2P81A 2DLLA 1MJAA 2FMLA 4P5OA 2DU9A 3RI4A 2CQ7A 3OOPA 5IYBJ 2O7OA 2TCTA 2K40A 3JAMK 1HDPA 4HRIA 2FNPA 3BG7A 1XC5A 5AONA 2VPRA 4UV8A 3PFIA 5CVRA 1YX5A 2HQ5A 2VI6A 1N75A 2K85A 3BY6A 2JTVA 3C1DA 4BJ5C 4YFNF 1ETOA 2XKPA 4MNUA 1SD5A 3GFLA 3Q0UA 4G6DA 3OYDA 4UUSB 2UV1A 3S8PA 4EJWA 4HV5A 4A3BJ 1IN4A 5ILSA 3BJ6A 1B59A 1FBQA 2CJJA 4Y52J 2LY9A 1MKMA 3WTVC 4GO1A 3GFMA 1MNEA 1GUUA 4WWCA 4BHBA 5DS9A 1AA7A 1OMIA 4OMYA 3C2BA 4MEXF 1ETWA 2GOXB 2OCEA 4GRIA 3VDXA 1V3FA 2YSRA 4A3KJ 2HXIA 2E1MC 1HW1A 5IT3A 3F21A 1OKRA 5ILVA 2O6GE 1U3EM 3IAS2 1KU3A 1QBJA 3TBIA 3ERMA 3SQNA 3M1CA 3SDGA 2AQFA 1XG1A 2IGNA 3K1NA 1TWCJ 3TO7A 1BM9A 4M6YA 2KRHA 2BY3A 2CQQA 3T8RA 9ANTA 2QSFX 2O0YA 1JE8A 2X6XA 1J9IA 3RQIA 1D1CA 2BOLA 3BPXA 3K1MA 1IUFA 1X3UA 4HV6A 1OYIA 1VQNI 2CQXA 2FQ4A 1RC9A 2CW0F 5CQGA 3KCCA 3R4KA 3V7SA 2KKOA 5FJ8J 3J7AO 1Z0XA 3UKGA 2L54A 1YJNI 3RPUD 1ZGJA 3SYTA 3SEZA 2DA7A 2K9SA 2K4JA 4CO8A 1O3TA 2XSDC 4DW6A 3EUHC 2HU9A 2BVMA 4PCQA 4A3DJ 1HA8A 5D4SA 2Y75A 5TISC 2VC1A 2JRTA 4D9JA 5HNFA 1D1BA 3DP7A 4DIQA 1X4PA 3A0HC 4XN0A 1JUPA 4E7ZA 4JK1X 4R8HA 3IC7A 2EJRA 3CC2I 1W7PB 2YX4A 5DD4A 1OQYA 3FIWA 1P92A 2HFHA 5DDGA 3JSOA 1KYZA 1TP4A 2DA2A 3M8FA 3LSKA 4MFEA 2ZB9A 1W7PD 4HSRA 3WG7H 1X19A 3K1PA 2QZ8A 4II3A 2GBYA 2W00A 3RKYA 1WQ2A 2HKXA 2CG4A 3G73A 3TDUC 4XLAA 3NAUA 2NS8A 2P6SA 3KETA 5F04A 4CCMA 3F6VA 1MBHA 2BZTA 2XPWA 4A3JJ 1LB2A 3K70D 1P6RA 2JSCA 5J40A 1MGTA 1WI9A 4UHTA 2E7WA 2WA0A 3I59A 1K78B 2GIVA 5CPRB 3D5LA 1XSDA 2KIQA 4R79A 5DCMB 4XMYA 4XL9A 4DYRA 2L9SA 4I2OA 2R3SA 2ZKZA 1GLNA 1GXQA 1XMAA 2R7VA 3RKQA 3E3VA 3IRQA 5IP6A 1HSTA 2RV8A 5ICGA 3DKWA 2EA4A 5M3FJ 4U88A 1WGXA 2DMPA 4B09A 4X6AJ 1ZN2A 4RLQA 3QU6A 2HS5A 1VQKI 1NTCA 1ACIA 2VN2A 2CW7A 1G2HA 5E79C 3H9QA 1GHCA 4S0HB 3PSFA 1ERDA 2HOAA 1RZ4A 2IP2A 2R7TA 2NNYA 1L3LA 2D2WA 4BHCA 2R7RA 1FNNA 4AYBA 1S3JA 2Y9ZA 3FBIB 4G7OF 3HSRA 3H92A 4RAZA 1EH6A 1QO0D 2VJ5A 3ECHA 4XICA 2V4JC 1I27A 4RB2C 2VODA 1IV8A 1WJFA 2AQEA 1EJ9A 1W36C 2FRHA 3B73A 4CA0A 1HDDC 4UUTA 5EZHA 1Z3XA 5GAGJ 3KZYA 1RKWA 3QPSA 1BIAA 2OA4A 3PUBA 1X3WB 2Z16A 3GFJA 2L4MA 3L2RA 3BG6A 5D6EA 2EZIA 3N05A 1ZARA 2XV4S 4Q47A 4OIRF 2KHMA 1H89C 4FCYA 2A3SA 3GTKJ 3BR5A 1J59A 1X2MA 1SMTA 3E6MA 1IF1A 3ML6A 5ICEA 5F64A 2VJJA 3LSRA 2CU7A 3KFWX 5JHUA 2XGXA 1FYLA 3JAMZ 1K79A 1BOAA 1RNLA 2IA2A 2DOEA 1P4XA 4IQJA 4M6VA 1W5CC 3HGYA 1U6GA 3KEQA 3LA2A 4RM3A 4HAMA 4Y15A 4LG0B 2JQ7A 3E5QA 5L3FA 2QSHX 1Z67A 4BHPA 1JJ8C 2WB1N 1IAWA 1ON2A 4U7BA 3KLOA 2GAUA 4A2UA 5F27A 2VKHA 4ZYEA 2VQGA 4KIFA 1SANA 4A6EA 5LGNA 2X48A 3S1QJ 1YIJI 1WJBA 1U0JA 4M9ZA 2W48A 2G7HA 3ASNH 4LMYA 4RGUA 4F92B 5DTDA 4B8XA 2CUEA 3ESWB 4AIJA 3EYIA 4KT6A 2DYRH 2DW4A 2L4AA 2KPMA 4DZPA 1T39A 4Q4ZF 3HTUA 4UB8C 3FHNA 1Z05A 4BUPA 3VYUB 1XMXA 3BTLA 2OZUA 4PJJA 3U2RA 4CGZA 4I0AA 1J75A 3HKZN 1WRJA 1DUXC 3OL3A 4F55A 4UUSA 4Y4RA 3CCUI 4ZTFA 1GVDA 2G9WA 1MDMB 4LK1F 3DPLC 2XAFA 3F8BA 1JKRC 3JR9A 4KMFA 3KYDB 4M3FA 1R4MB 2EWNA 2JMWA 4FE7A 2OTLI 2ADUA 2ICWG 2FUG2 4LJZF 4NQWB 2XASA 2FE3A 2OCCH 3C2GA 2VXDA 3ABKH 3D1NI 3H5RA 4EV0A 1JJ6C 1BL0A 2DA6A 3E0JB 1JKQC 2VJ4A 2DJNA 3KP6A 2WV1A 5LHHA 3TL4X 1JTXA 2JVHA 4I7HA 4EGYA 4BEHB 4IHWA 1J5YA 4IX7A 3Q5FA 3TP3A 1QZYA 2LK2A 5IOZA 5D5VB 1N25A 3LQQA 2ISZA 5GAHJ 3HSEA 4XR6A 2STWA 2XGEA 3ERED 4J19A 4XRSA 3NWTA 2VL8A 1LEAA 3S2HJ 4C2MJ 5LLQA 4GYGA 3NQOA 1A31A 2XDVA 3O8HA 1IXSB 3Q9VA 1TQMA 1F4KA 1Y0UA 2OU2A 2XAUA 2KZVA 4F7ZA 1YX3A 2NVXJ 2F5EA 4WXCA 2HPMA 1F43A 2ZC2A 1BOBA 4BACA 3BR3A 4W1UA 1X1DA 5EF6A 3HOTA 1TW3A 2DMQA 2KMUA 4M9XA 4AU7A 3L1PA 1MBGA 2K9NA 1U5TA 2DK5A 2KIMA 3T5XA 5HODA 4EM0B 2O8XA 3BR6A 1SVMA 2JA8J 5B1BH 4N9HA 2IW5A 3KPHA 1IG7A 4E7SA 3H5AA 1W0TA 2DFHA 1WJAA 4LFUA 3MKLA 1WPKA 4C3IJ 2O61A 3OYGA 1LFUP 1KA8A 3HBLA 5EGOB 4D0PA 2V9KA 1SEUA 3F8NA 2HDCA 4RB0A 5KHDA 5LHGA 4BXUA 3OY9A 5J6XA 4DZJA 5IP9J 2JA2A 1T38A 1POGA 5J4VA 5GAEJ 4CYCB 3ABUA 4OIOF 2HI3A 5J3LA 3VSKA 4L18B 2ZJPF 2IS6A 1G3TA 3ZQFA 1HF0A 3FXLA 4EGZA 3HHGA 5DCMA 3CMMA 4IRGA 2CUZA 5HDNA 3BTCA 3S3NA 2V1XA 3HYIA 4KIBA 2IS4A 1P4WA 3D0SA 4Y7NJ 2DT6A 5J8CA 3GBGA 4ZH4F 1VQ9I 2P5KA 1FTZA 2AXTC 3OYNA 1UELB 2Y30A 5HLIA 2EK5A 2HYJA 1MH4A 3DTIA 3KP3A 1MZBA 1YOVB 1RUNA 4C3HJ 3DCFA 1VI0A 3HOYJ 1F5TA 3CDHA 2ZMEC 1B6AA 3FXJA 1U2WA
chains in the Genus database with same CATH topology
3JRBA 5F0CA 1X58A 3ZOBA 1TWAJ 2DMNA 1T56A 1HLVA 4V2GA 5M5XJ 2H1KA 1K83J 4JYKA 5IOYA 1FJLA 2HOTA 1HCRA 4A3LJ 5M5WJ 4A3EJ 2NVYJ 4JX4A 4G12A 2GM4A 3G1OA 3NARA 5EDNA 3JRGA 2Y9YA 1Y1VJ 1ZKGA 3IH2A 4AC0A 1PUFA 4JP0A 1K61A 1NK2P 2IBDA 1UHSA 4D5FA 1ZQ3P 2L7MP 2E2HJ 2YUSA 1B8IB 5J1YA 2FJ1A 2YU9J 4FISA 4IEJA 3Q0VA 3MN2A 3OIOA 4DYCA 1GV5A 1A6IA 3PM1A 1LFBA 2LLKA 5FKLA 1WH5A 4MIMA 4MO7A 2WAQN 2L0KA 1P7JA 2P81A 2XPUA 1ZK8A 5FKKA 5E3LA 3IH3A 3H3VK 5IYBJ 3FK7A 2O7OA 2QF7A 5FKNA 2TCTA 2K40A 1HDPA 1X2NA 5FKMA 2Y0SN 4RDUA 3BQZA 1XC5A 1AU7A 2VPRA 3RZDJ 2M9HA 1GV2A 2LFBA 3FK6A 2HQ5A 2VI6A 1FTTA 1ETOA 3WHCA 1LE8A 2L7ZA 2JJ7A 3K7AJ 3Q0UA 4UUSB 2MGQA 3S1NJ 4A3BJ 1MBEA 2EH3A 2M8GX 1MBKA 2CJJA 3BQYA 4Y52J 2LY9A 4BY1J 1XS9A 2DMUA 1GUUA 5DS9A 2HDDA 2Y31A 1QVUA 3ZQIA 3TEDA 3S1MJ 2JN6A 3C2BA 4A3FJ 2YS9A 4IHYA 1ETWA 3CDLA 1AKHA 5M3MJ 1ENHA 4A3KJ 2HXIA 2E1OA 5F0HA 2XPVA 1JKPC 1RETA 2R92J 5EG0B 1TWHJ 1H88C 2VKVA 3SDGA 5JLXA 1XG1A 1UG2A 1TWCJ 2DMTA 2VKEA 3S14J 1U8BA 3HOVJ 2CQQA 9ANTA 2R5ZA 2O9LA 3GTJJ 3JRFA 3OOUA 5IYDJ 1TWFJ 3RQIA 2EZKA 1IUFA 1ORKA 2MG4A 4D7MA 3CMYA 2NS7A 2CQXA 2GLOA 2NOGA 2FQ4A 2XB0X 3TW7A 1MSFC 5FJ8J 3JRIA 2L7FP 1CQTA 2KDZA 1Z0XA 4XRSG 3UKGA 1ZR4A 3TW6A 4B3AA 2DA7A 2K9SA 1B72B 2MSYA 1AHDP 3LNQA 4QSHA 2XSDC 3BR1A 4DW6A 2I10A 4A3DJ 2E19A 1JKOC 3WHBA 2XGDA 1JUMA 2OF7A 1JUPA 2MW8A 3G1MA 3HDDA 3FIWA 1E3OC 3A03A 2ID6A 3E7LA 3Q0WA 5BNGA 2DA2A 2R5YA 4MFEA 2ELKA 3LSPA 2ZB9A 4XIDA 3I4MJ 3CCYA 3BTJA 1QRYA 4B4CA 2GBYA 2EQRA 4I76A 1W0UA 2NVQJ 3NAUA 2NS8A 1ETYA 4MLOA 5F04A 4I6ZA 2NVTJ 1OCPA 4D7NA 4A3JJ 1MBHA 2XPWA 1RKTA 3GTQJ 3S1RJ 4AYBN 1ITYA 1YRNB 2LR8A 2JWTA 1GT0C 4DYRA 3OSGA 3GTOJ 3OSFA 5EGOA 1IGNA 5F08A 2XRLA 2KT0A 4V2FA 3RKQA 3HOUJ 4BBRJ 3S2DJ 5IP6A 1U9NA 1IV6A 3A01A 1ETKA 1U9OA 4XRMA 5M3FJ 1WGXA 2DMPA 4X6AJ 5K7FA 1GDTA 3M3YJ 4CYCA 1NTCA 2G0EA 5C3EJ 3A02A 1G2HA 1TWGJ 2ECBA 2LVSA 3DEWA 4S0HB 2HOAA 3JREA 1TC3C 3QQAA 1SFOJ 2E2JJ 3M4OJ 3JRDA 3LSGA 1IRZA 1T33A 1VNDA 3ZQHA 2Y9ZA 4HNVA 2X9DA 3FISA 3BG3A 4XICA 2M2EA 4C3JJ 2LKXA 2EZLA 3SFIA 3TP0A 2R5YB 5GPAA 3B6CA 4GFBA 2JK3A 1HDDC 4UUTA 5EZHA 4RBOA 2R0QC 4JX5A 1DU6A 5GPCA 2EBIA 1PUFB 4A3GJ 2QCOA 1RKWA 3QPSA 1WH7A 3GTGJ 2DN0A 3SJMA 2COBA 4FTHA 2EZIA 1D5YA 3BG9A 1A5JA 3BTIA 4M3DA 1H89C 3HEFA 4FCYA 3GTKJ 2CUFA 2DA4A 3BR5A 1X2MA 4BXXJ 2X6OA 1MNMC 4A69C 3LSRA 3LSJA 1F36A 1IJWC 2CU7A 5F1JA 1QPIA 4M3BA 4M3EA 4M6VA 2R7ZJ 3HGYA 1BW5A 2OPTA 4BY7J 1RPWA 3B6AA 1JJ8C 2IAIA 1MBJA 2WB1N 5IPAA 3ZQLA 1FIPA 1UMQA 1B8IA 5F27A 1LE8B 2ECCA 2PMZN 4NDLA 1SANA 2X48A 3S1QJ 3JRCA 2AHQA 1S7EA 4B1RA 1JT0A 3HB9A 3JRAA 2W48A 4QTRA 5GP9A 2JA5J 2DA1A 1ZTRA 5DTDA 2B63J 1WI3A 2CUEA 2ME0A 5EYRA 4D5CA 1R9TJ 4IHXA 1JTYA 4DYQA 3G1LA 2JA6J 2Y2ZA 4DZPA 3Q3SA 1HOMA 2R93J 1ETXA 1IDZA 5F0FA 3HOZJ 3ZQGA 3BTLA 1VF9A 2M34A 1AKHB 1EF4A 2HOSA 1MBFA 1OFCX 3K2AA 4W97A 1Y1WJ 5EEAA 1RESA 5K7HA 1BA5A 1MSEC 3BT9A 3HKZN 2O8KA 1JT6A 4LOCA 4UUSA 1Z77A 1GVDA 1O4XA 4X1EA 1OJLA 3JRHA 5M5YJ 1JKRC 1OCTC 3JR9A 2VUMJ 2FD5A 4M3FA 4AUXA 2JMWA 4FE7A 4BBSJ 2R5ZB 3S16J 1QVTA 2LP0A 1BJZA 3D1NI 1H8AC 1JJ6C 1WCMJ 1P7IA 2DA3A 1BL0A 1IDYA 2DA6A 1JKQC 2DJNA 3HOWJ 2WV1A 1JTXA 5J1UA 4BKXA 5C4XJ 2RAEA 4IHWA 1ZGWA 5EG0A 5E3MA 5IP7J 3TP3A 2LK2A 5IOZA 1DU0A 1FEXA 5FLMJ 3ZQCA 1I3QJ 2DTZA 3VPRA 2XB5A 2XGEA 4J19A 4XRSA 2TRTA 3IV5A 3S2HJ 4C2MJ 1JUSA 3GTLJ 1JGGA 2E2IJ 1RR7A 2CRGA 3PO3J 1NK3P 3O8HA 3QPLA 2ME6A 1APLC 1ZR2A 2EZHA 3I4NJ 4FE4A 3HM5A 2NVXJ 4A3CJ 2D5VA 1F43A 1B72A 2DA5A 1ETQA 5J1RA 3BR3A 4W1UA 5EF6A 2DMQA 4MFDA 2N8GA 3L1PA 1MBGA 2AO9A 2ID3A 2K9NA 5HODA 2LTPA 5K7ZA 3HOXJ 1U78A 4A93J 1IC8A 3BR6A 2JA8J 3O8GA 1FIAA 2L9RA 5E3NA 4QIWN 3S15J 1IG7A 4EEFG 1W0TA 1I6HJ 3BG5A 3IH4A 3MKLA 1WPKA 4C3IJ 4A3MJ 4A3IJ 1LFUP 1I50J 3HBLA 2FX0A 5EGOB 2M0CA 4JX6A 5E3OA 2XGCA 1VFCA 4L5EA 3GTPJ 5JLWA 3A01B 3BR0A 3RZOJ 3LOCA 3PO2J 3F0CA 4DZJA 5IP9J 5C4JJ 5EZGA 3BR2A 3MVPA 1POGA 3W6VA 3S17J 4CYCB 2HI3A 5J3LA 5C44J 1ETVA 3HGGA 4XK4A 4IHVA 3H0GJ 3ZQFA 4ABZA 2LD5A 1YRNA 1HF0A 5FLVA 3BTCA 4Y7NJ 4M3GA 3GTMJ 3GBGA 1FTZA 2HXOA 1BW6A 1MH3A 2Y30A 2HYJA 5IYCJ 1MH4A 3CQZJ 2JA7J 1Q1VA 4C3HJ 1VI0A 2K9QA 3DCFA 3HOYJ 2IEKA 3FKIJ 2H8RA 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRB A;  5F0C A;  1X58 A;  3ZOB A;  1TWA J;  2DMN A;  1T56 A;  1HLV A;  4V2G A;  5M5X J;  2H1K A;  1K83 J;  4JYK A;  5IOY A;  1FJL A;  2HOT A;  1HCR A;  4A3L J;  5M5W J;  4A3E J;  2NVY J;  4JX4 A;  4G12 A;  2GM4 A;  3G1O A;  3NAR A;  5EDN A;  3JRG A;  2Y9Y A;  1Y1V J;  1ZKG A;  3IH2 A;  4AC0 A;  1PUF A;  4JP0 A;  1K61 A;  1NK2 P;  2IBD A;  1UHS A;  4D5F A;  1ZQ3 P;  2L7M P;  2E2H J;  2YUS A;  1B8I B;  5J1Y A;  2FJ1 A;  2YU9 J;  4FIS A;  4IEJ A;  3Q0V A;  3MN2 A;  3OIO A;  4DYC A;  1GV5 A;  1A6I A;  3PM1 A;  1LFB A;  2LLK A;  5FKL A;  1WH5 A;  4MIM A;  4MO7 A;  2WAQ N;  2L0K A;  1P7J A;  2P81 A;  2XPU A;  1ZK8 A;  5FKK A;  5E3L A;  3IH3 A;  3H3V K;  5IYB J;  3FK7 A;  2O7O A;  2QF7 A;  5FKN A;  2TCT A;  2K40 A;  1HDP A;  1X2N A;  5FKM A;  2Y0S N;  4RDU A;  3BQZ A;  1XC5 A;  1AU7 A;  2VPR A;  3RZD J;  2M9H A;  1GV2 A;  2LFB A;  3FK6 A;  2HQ5 A;  2VI6 A;  1FTT A;  1ETO A;  3WHC A;  1LE8 A;  2L7Z A;  2JJ7 A;  3K7A J;  3Q0U A;  4UUS B;  2MGQ A;  3S1N J;  4A3B J;  1MBE A;  2EH3 A;  2M8G X;  1MBK A;  2CJJ A;  3BQY A;  4Y52 J;  2LY9 A;  4BY1 J;  1XS9 A;  2DMU A;  1GUU A;  5DS9 A;  2HDD A;  2Y31 A;  1QVU A;  3ZQI A;  3TED A;  3S1M J;  2JN6 A;  3C2B A;  4A3F J;  2YS9 A;  4IHY A;  1ETW A;  3CDL A;  1AKH A;  5M3M J;  1ENH A;  4A3K J;  2HXI A;  2E1O A;  5F0H A;  2XPV A;  1JKP C;  1RET A;  2R92 J;  5EG0 B;  1TWH J;  1H88 C;  2VKV A;  3SDG A;  5JLX A;  1XG1 A;  1UG2 A;  1TWC J;  2DMT A;  2VKE A;  3S14 J;  1U8B A;  3HOV J;  2CQQ A;  9ANT A;  2R5Z A;  2O9L A;  3GTJ J;  3JRF A;  3OOU A;  5IYD J;  1TWF J;  3RQI A;  2EZK A;  1IUF A;  1ORK A;  2MG4 A;  4D7M A;  3CMY A;  2NS7 A;  2CQX A;  2GLO A;  2NOG A;  2FQ4 A;  2XB0 X;  3TW7 A;  1MSF C;  5FJ8 J;  3JRI A;  2L7F P;  1CQT A;  2KDZ A;  1Z0X A;  4XRS G;  3UKG A;  1ZR4 A;  3TW6 A;  4B3A A;  2DA7 A;  2K9S A;  1B72 B;  2MSY A;  1AHD P;  3LNQ A;  4QSH A;  2XSD C;  3BR1 A;  4DW6 A;  2I10 A;  4A3D J;  2E19 A;  1JKO C;  3WHB A;  2XGD A;  1JUM A;  2OF7 A;  1JUP A;  2MW8 A;  3G1M A;  3HDD A;  3FIW A;  1E3O C;  3A03 A;  2ID6 A;  3E7L A;  3Q0W A;  5BNG A;  2DA2 A;  2R5Y A;  4MFE A;  2ELK A;  3LSP A;  2ZB9 A;  4XID A;  3I4M J;  3CCY A;  3BTJ A;  1QRY A;  4B4C A;  2GBY A;  2EQR A;  4I76 A;  1W0U A;  2NVQ J;  3NAU A;  2NS8 A;  1ETY A;  4MLO A;  5F04 A;  4I6Z A;  2NVT J;  1OCP A;  4D7N A;  4A3J J;  1MBH A;  2XPW A;  1RKT A;  3GTQ J;  3S1R J;  4AYB N;  1ITY A;  1YRN B;  2LR8 A;  2JWT A;  1GT0 C;  4DYR A;  3OSG A;  3GTO J;  3OSF A;  5EGO A;  1IGN A;  5F08 A;  2XRL A;  2KT0 A;  4V2F A;  3RKQ A;  3HOU J;  4BBR J;  3S2D J;  5IP6 A;  1U9N A;  1IV6 A;  3A01 A;  1ETK A;  1U9O A;  4XRM A;  5M3F J;  1WGX A;  2DMP A;  4X6A J;  5K7F A;  1GDT A;  3M3Y J;  4CYC A;  1NTC A;  2G0E A;  5C3E J;  3A02 A;  1G2H A;  1TWG J;  2ECB A;  2LVS A;  3DEW A;  4S0H B;  2HOA A;  3JRE A;  1TC3 C;  3QQA A;  1SFO J;  2E2J J;  3M4O J;  3JRD A;  3LSG A;  1IRZ A;  1T33 A;  1VND A;  3ZQH A;  2Y9Z A;  4HNV A;  2X9D A;  3FIS A;  3BG3 A;  4XIC A;  2M2E A;  4C3J J;  2LKX A;  2EZL A;  3SFI A;  3TP0 A;  2R5Y B;  5GPA A;  3B6C A;  4GFB A;  2JK3 A;  1HDD C;  4UUT A;  5EZH A;  4RBO A;  2R0Q C;  4JX5 A;  1DU6 A;  5GPC A;  2EBI A;  1PUF B;  4A3G J;  2QCO A;  1RKW A;  3QPS A;  1WH7 A;  3GTG J;  2DN0 A;  3SJM A;  2COB A;  4FTH A;  2EZI A;  1D5Y A;  3BG9 A;  1A5J A;  3BTI A;  4M3D A;  1H89 C;  3HEF A;  4FCY A;  3GTK J;  2CUF A;  2DA4 A;  3BR5 A;  1X2M A;  4BXX J;  2X6O A;  1MNM C;  4A69 C;  3LSR A;  3LSJ A;  1F36 A;  1IJW C;  2CU7 A;  5F1J A;  1QPI A;  4M3B A;  4M3E A;  4M6V A;  2R7Z J;  3HGY A;  1BW5 A;  2OPT A;  4BY7 J;  1RPW A;  3B6A A;  1JJ8 C;  2IAI A;  1MBJ A;  2WB1 N;  5IPA A;  3ZQL A;  1FIP A;  1UMQ A;  1B8I A;  5F27 A;  1LE8 B;  2ECC A;  2PMZ N;  4NDL A;  1SAN A;  2X48 A;  3S1Q J;  3JRC A;  2AHQ A;  1S7E A;  4B1R A;  1JT0 A;  3HB9 A;  3JRA A;  2W48 A;  4QTR A;  5GP9 A;  2JA5 J;  2DA1 A;  1ZTR A;  5DTD A;  2B63 J;  1WI3 A;  2CUE A;  2ME0 A;  5EYR A;  4D5C A;  1R9T J;  4IHX A;  1JTY A;  4DYQ A;  3G1L A;  2JA6 J;  2Y2Z A;  4DZP A;  3Q3S A;  1HOM A;  2R93 J;  1ETX A;  1IDZ A;  5F0F A;  3HOZ J;  3ZQG A;  3BTL A;  1VF9 A;  2M34 A;  1AKH B;  1EF4 A;  2HOS A;  1MBF A;  1OFC X;  3K2A A;  4W97 A;  1Y1W J;  5EEA A;  1RES A;  5K7H A;  1BA5 A;  1MSE C;  3BT9 A;  3HKZ N;  2O8K A;  1JT6 A;  4LOC A;  4UUS A;  1Z77 A;  1GVD A;  1O4X A;  4X1E A;  1OJL A;  3JRH A;  5M5Y J;  1JKR C;  1OCT C;  3JR9 A;  2VUM J;  2FD5 A;  4M3F A;  4AUX A;  2JMW A;  4FE7 A;  4BBS J;  2R5Z B;  3S16 J;  1QVT A;  2LP0 A;  1BJZ A;  3D1N I;  1H8A C;  1JJ6 C;  1WCM J;  1P7I A;  2DA3 A;  1BL0 A;  1IDY A;  2DA6 A;  1JKQ C;  2DJN A;  3HOW J;  2WV1 A;  1JTX A;  5J1U A;  4BKX A;  5C4X J;  2RAE A;  4IHW A;  1ZGW A;  5EG0 A;  5E3M A;  5IP7 J;  3TP3 A;  2LK2 A;  5IOZ A;  1DU0 A;  1FEX A;  5FLM J;  3ZQC A;  1I3Q J;  2DTZ A;  3VPR A;  2XB5 A;  2XGE A;  4J19 A;  4XRS A;  2TRT A;  3IV5 A;  3S2H J;  4C2M J;  1JUS A;  3GTL J;  1JGG A;  2E2I J;  1RR7 A;  2CRG A;  3PO3 J;  1NK3 P;  3O8H A;  3QPL A;  2ME6 A;  1APL C;  1ZR2 A;  2EZH A;  3I4N J;  4FE4 A;  3HM5 A;  2NVX J;  4A3C J;  2D5V A;  1F43 A;  1B72 A;  2DA5 A;  1ETQ A;  5J1R A;  3BR3 A;  4W1U A;  5EF6 A;  2DMQ A;  4MFD A;  2N8G A;  3L1P A;  1MBG A;  2AO9 A;  2ID3 A;  2K9N A;  5HOD A;  2LTP A;  5K7Z A;  3HOX J;  1U78 A;  4A93 J;  1IC8 A;  3BR6 A;  2JA8 J;  3O8G A;  1FIA A;  2L9R A;  5E3N A;  4QIW N;  3S15 J;  1IG7 A;  4EEF G;  1W0T A;  1I6H J;  3BG5 A;  3IH4 A;  3MKL A;  1WPK A;  4C3I J;  4A3M J;  4A3I J;  1LFU P;  1I50 J;  3HBL A;  2FX0 A;  5EGO B;  2M0C A;  4JX6 A;  5E3O A;  2XGC A;  1VFC A;  4L5E A;  3GTP J;  5JLW A;  3A01 B;  3BR0 A;  3RZO J;  3LOC A;  3PO2 J;  3F0C A;  4DZJ A;  5IP9 J;  5C4J J;  5EZG A;  3BR2 A;  3MVP A;  1POG A;  3W6V A;  3S17 J;  4CYC B;  2HI3 A;  5J3L A;  5C44 J;  1ETV A;  3HGG A;  4XK4 A;  4IHV A;  3H0G J;  3ZQF A;  4ABZ A;  2LD5 A;  1YRN A;  1HF0 A;  5FLV A;  3BTC A;  4Y7N J;  4M3G A;  3GTM J;  3GBG A;  1FTZ A;  2HXO A;  1BW6 A;  1MH3 A;  2Y30 A;  2HYJ A;  5IYC J;  1MH4 A;  3CQZ J;  2JA7 J;  1Q1V A;  4C3H J;  1VI0 A;  2K9Q A;  3DCF A;  3HOY J;  2IEK A;  3FKI J;  2H8R A;  5FKO A; 
#chains in the Genus database with same CATH topology
 3JRB A;  2GA2 A;  1X58 A;  3ZOB A;  2WAE A;  1T56 A;  2H1K A;  3O3K A;  4N4O B;  4MTD A;  2X6W A;  2LMD A;  5IOY A;  4CYD A;  2R7W A;  3WGI A;  2HVQ A;  2BY0 A;  4HX4 A;  2DCE A;  3DEE A;  1R5G A;  3A0B C;  1VQ8 I;  4O6J A;  1V5F A;  3E5U A;  2X1E A;  4JX4 A;  3FKJ A;  3K2Z A;  3H36 A;  3ZN1 A;  2HTJ A;  3MD2 A;  1WFX A;  4BE2 A;  3BJO A;  4A0Z A;  2P5V A;  3JRG A;  2HWV A;  2A05 A;  4ZYG A;  3ZXS A;  3C7J A;  1FMV A;  4S04 A;  2EV0 A;  4F93 B;  1I1S A;  2FOK A;  4BQO A;  3W6J B;  4ANJ A;  3VFZ A;  5HS8 A;  1NK2 P;  2WY7 Q;  3D5S C;  2VXZ A;  2DT5 A;  2YUS A;  4ZDO A;  5KNL A;  1B8I B;  2P7V B;  4FIS A;  1T98 A;  1Y56 A;  4HG2 A;  3OIO A;  1GV5 A;  5FKL A;  3WTX C;  3CUO A;  2MC3 A;  1P7J A;  2ELH A;  3G2B A;  2CV2 A;  4RLF A;  3DFG A;  2BY1 A;  3FK7 A;  2E5N A;  2E1M B;  3TGN A;  2H6C A;  5FKN A;  2LKP A;  3BCA A;  1U8R A;  1X2N A;  5FKM A;  1LPQ A;  4A6D A;  3BQZ A;  4G9Y A;  2CWE A;  1UHM A;  4LG0 A;  3HIF A;  1QA6 A;  3FK6 A;  3DLL F;  1FTT A;  2IPQ X;  2W57 A;  4RM2 A;  3WHC A;  2JJ7 A;  2X1C A;  5L3G A;  5IT9 K;  1FLI A;  5ERI A;  5J4Y A;  4PK4 A;  3W6K B;  1MBE A;  2X0L A;  2QQA A;  4JBA A;  4RAY A;  3PJR A;  4IKF A;  2M8G X;  5LBQ A;  1YI2 I;  4J00 A;  2X4H A;  3R6S A;  1S7A A;  2HVR A;  2LYC A;  3IWF A;  2WAQ A;  3AFH A;  4FQG A;  1Y39 A;  4V19 K;  3SHF A;  3S1M J;  2DJI A;  3ZQI A;  3GXO A;  2JN6 A;  2YS9 A;  3OMY A;  5B66 C;  4XBF A;  4FT8 A;  5D6F A;  2PG4 A;  3LA3 A;  2J5O A;  1Q1H A;  1JHF A;  2KLO A;  4EQQ A;  2DYS H;  5LEK A;  3CC4 I;  1TWH J;  5HLT A;  5KK1 A;  3WTY C;  3DV8 A;  1H88 C;  1MDM A;  2VKV A;  3ZMS A;  4Q5S F;  1ZG3 A;  4UVB A;  2BVL A;  1U8B A;  4LIU A;  1YFH A;  4NQW A;  4MQ9 F;  4ITV A;  1V54 H;  4B3X A;  2EB7 A;  3ZGK A;  4D7M A;  3CC7 I;  2UWM A;  1W5S A;  1YE9 A;  2GLO A;  3F8M A;  3TW7 A;  1MSF C;  3RQ4 A;  2OBP A;  3JRI A;  5AIQ A;  4CHU A;  1LFP A;  2KDZ A;  1CQT A;  4HLY A;  3WTT C;  4DQ2 A;  3E6C C;  4DJA A;  2ESH A;  3F8C A;  4B3A A;  2FOW A;  4BEH A;  3MZY A;  3I5U A;  2F48 A;  3FM5 A;  3V8K A;  4E6K G;  1J0R A;  2KJC A;  3EET A;  4AID A;  4F3Q A;  5KVR A;  4PJM A;  5H20 A;  3WHB A;  2WBM A;  3VYT B;  4EM2 A;  1PJR A;  1JUM A;  5D5U B;  2OF7 A;  2MW8 A;  1YQA A;  4CCJ A;  3G1M A;  1UZC A;  3HDD A;  2E1C A;  2GOM A;  2VPL A;  1E3O C;  3F23 A;  2DAO A;  3FXQ A;  5BOX A;  2HQN A;  3FXK A;  1RUO A;  2A5W A;  4HBL A;  1ZG5 A;  4IZZ A;  3KZZ A;  3GME A;  3Q9S A;  1I1G A;  2ELK A;  3LSP A;  2QGU A;  2WY8 Q;  1T8I A;  2F5F A;  3I4M J;  3BTJ A;  1QRY A;  1WJC A;  1XB4 A;  1X3Z B;  4KIS A;  2EQR A;  3K9T A;  4MHG A;  3ISP A;  2NVQ J;  3VWB A;  1ETY A;  1OCP A;  3OS1 A;  1RKT A;  2HZT A;  2LDU A;  1MMS A;  3S1R J;  4KDP A;  1O3Q A;  4LIV A;  4XKW A;  4TV7 A;  2PI0 A;  4P96 A;  1ITY A;  5LGT A;  1YRN B;  2ZXW H;  1SD4 A;  1A04 A;  1BI2 A;  3SZG A;  1A6Q A;  4CZC A;  5EGO A;  1IGN A;  3CES A;  1D0Y A;  1GXP A;  1Y6I A;  1B4A A;  2EA2 A;  3S2D J;  4L0Y B;  3HSF A;  3CCR I;  4AIH A;  2FSW A;  2NNN A;  2H27 A;  1NH3 A;  1U9O A;  3KYC B;  1QNT A;  2MH2 A;  4WK8 F;  4U7D A;  2PJR A;  4CYC A;  1FP1 D;  1DGR M;  4ESB A;  3J81 K;  3A02 A;  4A5N A;  3CCE I;  1W36 D;  2K7L A;  2ECB A;  2HKO A;  1WJ5 A;  2IA0 A;  1SFK A;  3JRE A;  1W1W E;  4KA4 A;  3HOS A;  3QQA A;  2OTJ I;  4P9U A;  2E36 A;  1XGN A;  3CJR B;  4FAS D;  1SFO J;  3JRD A;  1K6Y A;  2P4W A;  4ZYA A;  1IRZ A;  3HPH A;  3FWE A;  1T33 A;  1VND A;  1Y8Q B;  3ZQH A;  1E17 A;  3GUD A;  2M45 A;  3TO9 A;  2EFN A;  3HHH A;  3HRU A;  2W84 A;  2E5Z A;  4C3J J;  3BRO A;  2EZL A;  3TP0 A;  5H6Q A;  2R5Y B;  5GPA A;  1ZAO A;  4GGG A;  3PIO F;  4HX8 A;  1VQL I;  2XIG A;  3HL2 A;  4GFB A;  1YYV A;  2JK3 A;  2LY1 A;  1LVK A;  2IVM A;  1KGS A;  2H94 A;  3HJE A;  4JX5 A;  2R0Q C;  5BPD A;  4A0X A;  2EBI A;  3V7C A;  4AWX B;  1YO5 C;  2QCO A;  1PUF B;  4A3G J;  3K4J A;  4HF0 A;  3CF5 F;  2DI3 A;  4UVA A;  2Z33 A;  2FU4 A;  3ABL H;  3LFU A;  4AVZ A;  3OYJ A;  4NBQ A;  2UXN A;  4G94 A;  1STZ A;  4ZTJ A;  2CUJ A;  4YRV A;  1OYW A;  2PN6 A;  2DA4 A;  2UUZ A;  2F5D A;  4IRH A;  4QWQ A;  4BXX J;  1PVE A;  2DDB A;  2K3P A;  3BOQ A;  4UB6 C;  2ZO4 A;  5BMZ A;  3OS2 A;  1YIT I;  1FMW A;  1SVO A;  1XMK A;  1K4T A;  5DV5 A;  2ZBK A;  1IJW C;  4GDF A;  1ZRC A;  2KQR A;  1E0E A;  5F1J A;  1QPI A;  4M3B A;  3V7R A;  1YJ9 I;  4YIR X;  5HVQ C;  3GYH X;  2R7Z J;  2OPT A;  2JUG A;  3I55 I;  4CIC A;  1G59 A;  3H3U A;  2KFD A;  4AIK A;  4HOB A;  3VOE A;  3ZQL A;  1B8I A;  3SXY A;  2F5C A;  2XKO A;  5IT9 Z;  2K86 A;  1G8X A;  2PMZ N;  4NDL A;  4OOI A;  4NC6 A;  3TOB A;  2CQN A;  3JRC A;  1S7E A;  4B1R A;  1X4O A;  3HB9 A;  3JRA A;  3OL4 A;  4QTR A;  1JT0 A;  4A12 A;  2P7C B;  2Z1D A;  3AG4 H;  2FF4 A;  2TDX A;  3CP2 A;  1X1A A;  2BHY A;  2HEO A;  5EYR A;  3TMO A;  4WX9 A;  4IHX A;  3BDD A;  3I53 A;  3LST A;  1JTY A;  3ABM H;  1DPR A;  3G1L A;  1LJ9 A;  4DGW B;  4NUB A;  2W85 A;  5FFX A;  2F5V A;  4NC8 A;  3HOZ J;  2L02 A;  3BLY A;  3ZQG A;  4L0Z B;  2NOJ B;  1A35 A;  3DKY A;  1DGW Y;  2O03 A;  5D5W B;  2HVS A;  4GXO A;  2HQR A;  4NC7 A;  2QSG X;  1IRX A;  2KIS A;  2HOS A;  1OFC X;  4W97 A;  3CUQ C;  5TRD A;  1BA5 A;  1RES A;  3CP8 A;  5K7H A;  2DTR A;  5CQE A;  2MLG A;  1MSE C;  2WWY A;  3KE2 A;  2VIX A;  5D8L B;  1XCV A;  2P8T A;  3DTK A;  1IN7 A;  1O4X A;  2ACJ A;  1OJL A;  2FQ3 A;  3JRH A;  1OCT C;  2FD5 A;  4IQ4 A;  4BBS J;  4EM1 A;  4XOR A;  3I58 A;  1W4M A;  1QVT A;  4CZZ A;  1H8A C;  2WV0 A;  3OYK A;  4L5I A;  2DA3 A;  3OYH A;  1V4R A;  2MAB A;  3R0A A;  3DXJ F;  3CO7 C;  2PQ8 A;  1FT9 A;  2CYY A;  4EAT A;  3HOW J;  2F6C A;  1B9N A;  1I5Z A;  2WTE A;  1YLF A;  5C4X J;  4RAG A;  3W2A A;  2Z99 A;  1VQM I;  5CVV A;  1ZGW A;  4YEJ A;  5E3M A;  5FLX K;  1UJ8 A;  1R4N B;  4Y17 A;  1AOY A;  3ZN0 A;  3L2W A;  3KZI C;  2EFP A;  1FYM A;  3KP7 A;  5FLM J;  4WXD A;  1I3Q J;  2JT1 A;  3FXR A;  4HA8 A;  3ZMZ A;  1HBX G;  3VPR A;  2VBZ A;  1Z21 A;  2F4I A;  1DPU A;  2R7Q A;  4ZC3 A;  2XF5 A;  4LLN A;  5CVU A;  4KNY A;  4IF4 A;  2E2I J;  2CRG A;  1TQI A;  4XOT A;  4HST A;  4XLF A;  2BYV E;  3G4S I;  1WHU A;  3WE2 A;  5K1Y A;  3HM5 A;  5HDG A;  2CV1 A;  2GXA A;  3AL0 B;  1ZGA A;  2M30 A;  1MMG A;  1S72 I;  5HS9 A;  5J1R A;  5TGT A;  3CCV I;  2VE8 A;  4KMU X;  5HS7 A;  2VON A;  2VT3 A;  4IVN A;  2N8G A;  2VOO A;  2ID3 A;  2AO9 A;  2X6Y A;  3AG1 H;  3P9C A;  3VYS B;  1S5L C;  4RB1 A;  1U78 A;  2JRM A;  1IC8 A;  1O57 A;  1OR7 C;  4CCN A;  1K4S A;  3I9V 2;  4N0B A;  1FIA A;  2V1U A;  3KEY A;  4QIW N;  4EEF G;  4A3M J;  4A3I J;  2OV7 A;  4KYW A;  2KRF A;  2ZME B;  2M0C A;  4XKC A;  3CDI A;  2P0W A;  3COA C;  4KIG A;  3GTP J;  3I0T A;  3K4M A;  1SAX A;  2NS0 A;  5LRR A;  2L9N A;  5C4J J;  2MH9 A;  5EZG A;  3J81 Z;  3MVP A;  1VTN C;  2V6E A;  3WTW C;  2DPD A;  1ZRE A;  1VQ4 I;  3S17 J;  4A0Y A;  2QBY A;  1E2X A;  1ZHF A;  3HGG A;  4XK4 A;  1Z91 A;  4IHV A;  1X1C A;  5AIP A;  3H0D A;  2LD5 A;  1YRN A;  2ELJ A;  5BPI A;  4XOP A;  5FLV A;  2E1N A;  3T1B A;  1QZE A;  2ESN A;  2RVC A;  5ILU A;  2A69 F;  2IGM A;  4M3G A;  1REP C;  3LSM A;  4DOZ A;  3GTM J;  1XGM A;  4XSZ F;  5IYC J;  4OIN F;  2RKH A;  3CQZ J;  3F72 A;  1Q1V A;  4IJA A;  5HDK A;  3D5R C;  3J7A Y;  1UFM A;  4ENJ A;  2EV6 A;  2VC0 A;  2W25 A;  2D1H A;  5HOO A;  1TT5 B;  2JPC A;  3E5X A;  1HLV A;  5M5X J;  2BXZ A;  4UVC A;  4BDY A;  3L9F A;  4LGW A;  2EPF A;  3FM3 A;  2R4G A;  3EUA A;  3IKV A;  4YIF A;  3O6B B;  4U0Y A;  3WTS C;  4A3L J;  2OZ6 A;  2FBH A;  2HPI A;  2NVY J;  1HKS A;  1KYW A;  1BN5 A;  1ZG1 A;  4ENM A;  3S93 A;  1SFX A;  2GWR A;  3NAR A;  3PQJ A;  2J5P A;  2V1D A;  4XLE A;  2BBY A;  4EJU A;  1WZ2 A;  4ZYD A;  3CLO A;  3ZQQ A;  2VBX A;  2VBY A;  4RB3 C;  4HW0 A;  4AC0 A;  2RNG A;  1PUF A;  2HOE A;  2LY2 A;  5DYM A;  3BC8 A;  5KAF C;  4BNC A;  2IBD A;  1UHS A;  4D5F A;  3DU6 A;  2L7M P;  3KP5 A;  2ZJQ F;  1NG6 A;  3SZP A;  1SFE A;  2FJ1 A;  5J1Y A;  2XAQ A;  1U5T C;  2NRA C;  3MN2 A;  4HQM A;  2PX9 A;  1MMA A;  4WXH A;  3PM1 A;  3T0Y A;  1YHQ I;  4UV9 A;  2QKL B;  3RPU A;  2MBF A;  4RGS A;  3GW2 A;  3MZH A;  1ZH5 A;  2XPU A;  1ZK8 A;  3CCQ I;  4HF1 A;  5FKK A;  4ZZL A;  3NWS A;  1RR8 C;  3ZCO A;  3CCS I;  1EH8 A;  1NG7 A;  2EFO A;  2QF7 A;  1R58 A;  2MA3 A;  1T0F A;  3EUK L;  2Y0S N;  2K02 A;  3GEZ A;  4MTE A;  4RDU A;  3L09 A;  2O5R A;  1EV7 A;  2M9H A;  1GV2 A;  3GZ5 A;  2LFB A;  4Z6Y A;  4E4H A;  1SFU A;  4M9S A;  3MCZ A;  1O3R A;  4H4K C;  3ZMU A;  2L01 A;  2LNB A;  3K7A J;  5JVG F;  3MKZ A;  2XC7 A;  3RDI A;  2MGQ A;  3S1N J;  2K4B A;  1TZL A;  3OYC A;  4FX0 A;  3A2K A;  4YEL A;  3MZ8 A;  1HSJ A;  5LHI A;  1T08 B;  2FEZ A;  2R7O A;  3BQY A;  4MGR A;  1W7P A;  1R71 A;  3F3X A;  1D0X A;  1XS9 A;  1P9Q C;  3CTA A;  4BY1 J;  1SAU A;  3EPZ A;  3P9K A;  2BEO A;  2DMU A;  2D45 A;  4I0B A;  2Y31 A;  1QVU A;  2M87 A;  4IOC F;  1DDN A;  4A3F J;  2MD5 A;  2ZSH B;  4BQQ A;  4BYY A;  3CCJ I;  1IW7 F;  1UAA A;  1BIB A;  5M3M J;  4I02 A;  5E1X A;  4RAF A;  5F0H A;  3T8T A;  5FLX Z;  1JKP C;  2V6C A;  2QQB A;  2ZFW A;  1IRF A;  2Y48 A;  5EG0 B;  2QEX I;  4O3M A;  4XLP F;  1D0Z A;  2CV0 A;  1D3Y A;  2JVG A;  5JFR A;  2OQR A;  1K78 A;  3S14 J;  4Q48 A;  3FF5 A;  4LD5 A;  1FX7 A;  2O9L A;  2RDP A;  1G3S A;  1TWF J;  4R1H A;  2LC2 A;  3REO A;  1ORK A;  3CMY A;  3RIR A;  3FXO A;  1FC3 A;  2NOG A;  3R60 A;  2XB0 X;  4ZDP A;  1S9H A;  3N97 A;  1G6N A;  1QQI A;  2L7F P;  4UXN A;  2ZCW A;  4M71 A;  4XRF A;  1ZR4 A;  5J8F A;  2LBF B;  1AHD P;  3LNQ A;  4QSH A;  1BR4 A;  1YW7 A;  4EJO A;  1S6L A;  2I10 A;  1XPX A;  3JSP A;  3ABT A;  5FO5 A;  2H1L A;  3P5J A;  5E18 F;  2LSO A;  4IPA A;  2E19 A;  2EIL H;  1JKO C;  3KP4 A;  2ZXI A;  2DPU A;  3U9G A;  3MQ0 A;  1FP2 A;  2GXG A;  3V4G A;  3AKZ A;  3WU2 C;  4KUM A;  4LB5 A;  3E6D A;  3UR3 C;  3A03 A;  3Q0W A;  4CCO A;  5J47 A;  2BXY A;  1TW2 A;  5BNG A;  1R7J A;  4XLN F;  1N78 A;  2V26 A;  2JSP A;  3KIO A;  4Y3O A;  4PGH A;  4XID A;  1FZP B;  4G7H F;  2LOO A;  1HKQ A;  4B4C A;  4AD9 A;  2STT A;  5CVJ A;  3K4N A;  5JVT A;  2DOD A;  3NEU A;  3HRT A;  1W0U A;  5CKT A;  1JI8 A;  3HG9 A;  3E6B A;  4C2U A;  4D7N A;  1XCB A;  2FNA A;  3WOD F;  2QVO A;  3JTG A;  1FSE A;  4AYB N;  1OYY A;  1IN6 A;  2XF6 A;  2A68 F;  5E1Z B;  3TO6 A;  3RKX A;  2JWT A;  3OS0 A;  1GT0 C;  3OSF A;  2ZME A;  2CFO A;  4U0W A;  5F08 A;  2CQK A;  1ZYR F;  5CVI A;  3WTZ A;  4HNT A;  3HOU J;  1FOX A;  4C9Y A;  1IV6 A;  3DKX A;  3FBN B;  3IUO A;  1BC7 C;  2VAS A;  2GZW A;  5K7F A;  4BJ6 C;  4L9V A;  3M3Y J;  3OYL A;  2G0E A;  1IXR C;  1YW9 A;  2RRE A;  4KIT B;  2A5Y B;  5E8I A;  1R36 A;  3L2C A;  4HZF A;  4KFC A;  2ZXJ A;  4MEY F;  5H6R A;  2W7N A;  1YS6 A;  3P9I A;  3QPH A;  1T95 A;  4KN7 X;  2E2J J;  2IRF G;  3MEX A;  2E60 A;  2QLZ A;  3M4O J;  3LSG A;  2C6Y A;  1C0W A;  5DM7 F;  3PNT A;  5F1R A;  2IS1 A;  3FIS A;  1J09 A;  1MMN A;  4HF2 A;  2R7F A;  1MMD A;  1S29 A;  2M2E A;  1XGS A;  2YX7 A;  1YTY A;  4H0E A;  1UB9 A;  1Z1D A;  3SFI A;  2LH9 A;  3S2W A;  5LFA A;  3B6C A;  3ZQ7 A;  1XTA A;  1LDD A;  1ZLK A;  1Z9C A;  4BH9 A;  1VQO I;  4IOA F;  4IHS A;  5GPC A;  2AXL A;  2EIK H;  4XKV A;  3GTG J;  4DNC A;  2L2O A;  2X1D A;  2XVC A;  4FTH A;  2W82 A;  1SD7 A;  5LEJ A;  4CDG A;  3HRS A;  2HNH A;  3LAP A;  1BBY A;  5LRS A;  3ELK A;  3BPV A;  3TQN A;  1A5J A;  3HEF A;  2BY2 A;  2X6O A;  2PFB A;  2XUB A;  2GIZ A;  4A69 C;  3HTS B;  5DCF A;  3C18 A;  3LSJ A;  4PDK A;  3MKY B;  3FMR A;  1BI3 A;  3CUQ B;  2Q1Z B;  2E71 A;  1L0O C;  4ASN A;  2DOA A;  2VLA A;  3H1C A;  3OYF A;  1S8N A;  1RPW A;  2H09 A;  3B6A A;  4I01 A;  5ICC A;  1MBJ A;  5IPA A;  2L5Q A;  1A36 A;  1FIP A;  1UMQ A;  1KON A;  1LE8 B;  2ECC A;  1ON1 A;  1SC7 A;  4F52 A;  1FBU A;  4K2E A;  4DBQ A;  1V5E A;  3E97 A;  1KQ0 A;  2AHQ A;  3LSH A;  2DQR A;  5GP9 A;  5FGM A;  2DA1 A;  3WGH A;  2VQL A;  2Q2E B;  3FXM A;  1H9G A;  1WWX A;  4D5C A;  3GWZ A;  3WU1 B;  3IL2 A;  3G71 I;  2Y2Z A;  1T2K A;  5CJ9 A;  1DP3 A;  5E8G A;  2R93 J;  1R22 A;  1ETX A;  3PNV A;  1IDZ A;  3K0L A;  2NAZ A;  3B02 A;  2CSO A;  1VF9 A;  4A5M A;  2QYO A;  5FRM A;  1AKH B;  4I98 B;  4QLC U;  1EF4 A;  2LF8 A;  1MBF A;  3K10 A;  3I71 A;  1Y1W J;  5EEA A;  4X0G A;  1XDU A;  1JT6 A;  4LOC A;  1R6R A;  2QQ9 A;  2W1O A;  2FA5 A;  2WB1 A;  2EFQ A;  5BS6 A;  4HDU A;  5M5Y J;  2X85 A;  2Y0M A;  2BHZ A;  2VUM J;  4AUX A;  2R7U A;  1BC8 C;  1R5I D;  2R5Z B;  1GVJ A;  4BQA A;  2VOP A;  3CJT B;  1RIO H;  2LP0 A;  3C3W A;  4M73 A;  1WCM J;  1P7I A;  2ZJR F;  1QHG A;  1IDY A;  1R1U A;  2DFI A;  2KDO A;  2MFZ A;  3LA7 A;  3MMY B;  5HLG A;  4HEA 2;  1Z6T A;  5J1U A;  4BKX A;  4D1Q A;  2KIU A;  1TL8 A;  5EG0 A;  3GLL A;  3FMQ A;  3PSI A;  1ZRF A;  1IN8 A;  3SDB A;  2BE5 F;  1DU0 A;  2AS5 F;  4LK0 F;  4PSX A;  2Z3Y A;  3L7W A;  3IHU A;  2UZK A;  3HKZ A;  2YR2 A;  1LKX A;  4QPO A;  2E34 A;  1V5G A;  1TBX A;  2K27 A;  3O2P E;  1R1T A;  4EJV A;  2XAH A;  4E7J A;  3OYB A;  1LVA A;  1JUS A;  1S7O A;  3GTL J;  2PBI A;  2I5U A;  4AVP A;  2KL4 A;  1RI7 A;  2EIJ H;  1KZH A;  5DUI A;  1APL C;  5FD6 A;  3QOP A;  1ZR2 A;  1VQ7 I;  3I4N J;  4LLL A;  3OIP A;  3FMS A;  4PFO A;  4A3C J;  2RQQ A;  2F4O B;  2EIN H;  2LBF A;  2A61 A;  3F22 A;  2M4G A;  1H9T A;  3DWL E;  4L5J A;  3DPU A;  4P1W A;  5B3S H;  4PGG A;  4M72 A;  3K4B A;  4P55 A;  4ENK A;  2CS3 A;  2KZG A;  5KCM A;  5K7Z A;  3PFY A;  3OR2 C;  2VQC A;  2V7F A;  3O8G A;  4RMN A;  2L9R A;  3TKY A;  1E3P A;  3X2Q H;  1I50 J;  3A1Y A;  1IO2 A;  2XHK A;  2M5W A;  3LMM A;  2E35 A;  1R5H A;  1B1B A;  2WAF A;  4L5E A;  2FBK A;  1CF7 B;  3A01 B;  3BR0 A;  1MW7 A;  3RZO J;  1Z7U A;  2Y0S A;  4WCG A;  1E3H A;  3F0C A;  3CMA I;  3BR2 A;  4G6Q A;  1FOY A;  2LRE A;  3FX3 A;  4B43 A;  3J80 K;  3W6V A;  1ETV A;  4L9T A;  2Z2S B;  3VYR B;  2R7S A;  1MJB A;  3H0G J;  3I54 A;  1Z3Y A;  2VQH A;  4ABZ A;  4J01 A;  4U0V A;  3PQK A;  2OD5 A;  3OYM A;  2QM3 A;  2DQL A;  3K6G A;  1IZ1 A;  3M8E A;  1XGO A;  5E17 F;  2DFF A;  1XN7 A;  2ZSI B;  1I39 A;  4YFX F;  5IY5 H;  3OWT A;  2JA7 J;  2JUC A;  3M1E A;  1FOW A;  2LG4 A;  1MIJ A;  3LSI A;  4NB5 A;  4F91 B;  3FKI J;  4I09 A;  3LAJ A;  4C2T A;  2K5C A;  2H8R A;  2A6T A;  4E7L A;  3RCO A;  2CGP A;  1TWA J;  1WSU A;  4HPQ A;  3E1S A;  1U5T B;  1XDS A;  1LEB A;  1W5T A;  1K83 J;  1FY7 A;  1HQC A;  2PEX A;  3V42 A;  4BE1 A;  2HDW A;  2M8E A;  2RC4 A;  2XRN A;  4OMZ A;  1F1Z A;  1FJL A;  3V8L A;  2HOT A;  5M5W J;  3PL8 A;  2H6B A;  4HNU A;  3G6E I;  3QOD A;  3QYF A;  3ZRG A;  3IWZ A;  1TQP A;  2NYX A;  5TJJ A;  1Y8R B;  4G12 A;  2GM4 A;  3G1O A;  3PNY A;  1DP7 P;  1YG2 A;  2HTS A;  3RPQ A;  5JHF A;  2O3F A;  2JPB A;  1JXS A;  1WKM A;  2ZNZ A;  1FWZ A;  1ZKG A;  3EUH A;  2K9M A;  2M7B A;  4XQF A;  4LIT A;  3LWF A;  3MAJ A;  1QHH D;  2XF7 A;  3EYY A;  1K61 A;  3TOA A;  4G6T B;  1ZQ3 P;  1CGP A;  2Y69 H;  4ENN A;  1EA3 A;  2FMY A;  2ISY A;  2IA1 A;  3DBL B;  4KIC A;  3CME I;  2E2H J;  2IS2 A;  1G3W A;  4XSX F;  3DPT A;  3HRM A;  4IEJ A;  1QGP A;  2XRO A;  2ETH A;  3Q0V A;  3QYE A;  1J7K A;  4DBR A;  3L2V A;  1IRG A;  1BR2 A;  4DYC A;  4C30 A;  3GF2 A;  4OIQ F;  2M7A A;  3GCM A;  1WH5 A;  4MIM A;  4MO7 A;  2WAQ N;  3G3Z A;  2L0K A;  1UST A;  5F6F A;  3K4L A;  3BZK A;  5E3L A;  3IH3 A;  3H3V K;  1K6O A;  3QAH A;  1LDK B;  3CUQ A;  3I64 A;  1QPM A;  3GLX A;  4YII A;  1AU7 A;  3RZD J;  3CCM I;  3EDP A;  5GAD J;  4CUG A;  4E7K A;  3HUG B;  3ULQ B;  1LE8 A;  2L7Z A;  3FZV A;  4YFK F;  4M6X A;  5FB2 A;  4BXF A;  1P4A A;  1YJW I;  2DXI A;  1FOK A;  3EQL F;  5L3C A;  2EH3 A;  1BI0 A;  1MBK A;  1K7A A;  4MQV A;  3CD6 I;  2Q2E A;  4RA2 A;  1ZEL A;  4BE0 A;  1X1B A;  3R0J A;  3PIP F;  1J2X A;  2FBI A;  1OIS A;  2L9V A;  4ESF A;  3U1K A;  2PJP A;  2OQG A;  2K9L A;  4G7Z F;  2HDD A;  3TED A;  3ZMD A;  3LFK A;  3MKW B;  2HZD A;  2G7U A;  3ZP5 A;  4IHY A;  3CDL A;  3ROU A;  1VQ5 I;  1FSH A;  1WVR A;  1AKH A;  3IAM 2;  3QRF F;  1ENH A;  4P9F A;  2E1O A;  1KU2 A;  3KP2 A;  2XPV A;  5ICF A;  1RET A;  2R92 J;  2V79 A;  3KEO A;  4OAY A;  4B44 A;  4OU0 A;  4PZJ A;  5JLX A;  1UG2 A;  2DMT A;  2VKE A;  3HOV J;  2R5Z A;  2R7X A;  3DBH B;  5E1W A;  3GTJ J;  3JRF A;  2RNJ A;  1F9N A;  1MJ9 A;  3OOU A;  2Z9O A;  2YPR A;  5IYD J;  2IGO A;  3GX4 X;  2EZK A;  2DO7 A;  2MG4 A;  2HQA A;  2MYS A;  3VSL A;  2NS7 A;  3SZT A;  1D5V A;  5A2Q K;  1I6X A;  4II2 A;  1FYK A;  4XRS G;  1BJA A;  1TLH B;  2X51 A;  3TW6 A;  1OR7 A;  1B72 B;  2MSY A;  4N9I A;  3BR1 A;  4RGX A;  2ZFU A;  3I56 I;  2IT0 A;  4CCK A;  2NXN B;  5K5O A;  3L00 A;  2DOF A;  2FXA A;  5DUK A;  3WU0 A;  1QZZ A;  4Y13 A;  4FX4 A;  1M1E B;  1Z6R A;  2XGD A;  3K69 A;  2COM A;  3GVA A;  3VEP A;  2F4M B;  3HC7 A;  4XLH A;  3AG3 H;  4LLG F;  2V1N A;  4UY8 I;  4BGD A;  2XSJ C;  2ID6 A;  3F9K A;  3E7L A;  5B1A H;  3QP5 A;  4BAY A;  2R5Y A;  3PUF A;  4LB6 B;  1KQ9 A;  3P7N A;  5EJC A;  3BJA A;  3CCY A;  3IP4 B;  4ESJ A;  1PUE E;  3J80 Z;  1UCR A;  4I76 A;  4RS8 A;  1T0F C;  2VKD A;  2R7D A;  5CLS A;  3WE3 A;  4MLO A;  2NVT J;  4I6Z A;  1ODD A;  3LL7 A;  3F6O A;  2QA4 I;  3GTQ J;  4U87 A;  4FHT A;  3BZC A;  2A6H F;  4PJ0 C;  2BW3 B;  4NNJ A;  3GZ6 A;  4PUS A;  2PMH A;  1O3S A;  2HYG D;  1TNS A;  1P2F A;  1XX5 A;  2LR8 A;  3F8F A;  4L9J A;  1YIO A;  4E7H A;  3OSG A;  3GTO J;  3QPT A;  2ZXH A;  2VT2 A;  4XN3 A;  1XSV A;  2XRL A;  2KT0 A;  4NHJ A;  4V2F A;  4IRI A;  1NHA A;  4BBR J;  3ZMV A;  2B9S A;  1U9N A;  3OIQ A;  1CF7 A;  4CXF A;  3A01 A;  3IRR A;  2V9V A;  2VBW A;  1ETK A;  1N77 A;  4XRM A;  4OIP F;  1OCO H;  1LNW A;  4UUV A;  3SFZ A;  4WF2 A;  1GDT A;  4ZZD A;  5C3E J;  1KQ8 A;  3K70 C;  4HLX A;  5DEQ A;  1TWG J;  2NVU B;  2GQQ A;  3DLA A;  1G4D A;  4EJT A;  1HC8 A;  2LVS A;  3DEW A;  1TTY A;  2EV5 A;  2A07 F;  4YG2 F;  3H3Z A;  4HYE A;  2CMP A;  1TC3 C;  3BZ6 A;  2M1B A;  4PSW A;  2ZNY A;  3OYI A;  5DM6 F;  1R23 A;  2MD0 A;  2BV6 A;  3SEQ A;  3TDZ C;  4B48 A;  3J7Z I;  4HNV A;  2QEN A;  2X9D A;  3W2W A;  3BG3 A;  2DBB A;  2LKX A;  5CYV A;  5GTI C;  2VJI A;  3RJP A;  4CH7 A;  1XD7 A;  1EKE A;  1D8J A;  3CO6 C;  1Z7L A;  2B7E A;  1SD6 A;  3VB2 A;  1JGS A;  4N4N B;  1HKT A;  3R61 A;  3S3M A;  2Q0O A;  4KT5 C;  4RBO A;  1DU6 A;  1O7F A;  5D5X B;  3U1D A;  2M0M A;  1IUY A;  1WH7 A;  4ZJZ A;  3BP8 A;  3QU3 A;  2DN0 A;  2P5L C;  4BS9 A;  3SJM A;  2COB A;  2M4K A;  5D4R A;  1MD0 A;  2LRD A;  3CLQ A;  2MLK A;  1YS7 A;  2A6E F;  1D5Y A;  3BG9 A;  2VE9 A;  3CF2 A;  3HXL A;  3BTI A;  4M3D A;  1QU3 A;  3ZR8 X;  2CUF A;  1USS A;  1MNM C;  3NRV A;  1KU7 A;  2K3F A;  4JOM A;  3AAF A;  1HXD A;  2XAG A;  4HX7 A;  1SMY F;  1F36 A;  5GTH C;  1OCR H;  1OCZ H;  2BGC A;  2PJR B;  4M3E A;  2HYF A;  2YU3 A;  3CCL I;  3QWL A;  1VQ6 I;  3ECO A;  1BW5 A;  3AL0 C;  3KX2 A;  4BY7 J;  1H0M A;  4OAZ A;  2OAZ A;  4FET A;  2IAI A;  2DDA A;  1R1V A;  3DU5 A;  3WTU C;  2V9P A;  3KYL A;  2D1V A;  2JA5 J;  5HNH A;  1ZTR A;  2B63 J;  1OPC A;  1WI3 A;  2ME0 A;  4O5V A;  1R9T J;  2CFX A;  3QP6 A;  4DYQ A;  2KIF A;  2JA6 J;  2Z5U A;  2QKM B;  3OR1 C;  2GA1 A;  3OV8 A;  3Q3S A;  3QOE A;  4XON A;  4Z2Y A;  1HOM A;  1R49 A;  5F0F A;  3S3O A;  2OJE D;  1LUJ B;  3HZJ A;  1I3A A;  5LD2 C;  2M34 A;  3HUG A;  3K2A A;  4CCL A;  2O8K A;  3BT9 A;  4PFP A;  4G8X A;  1Z77 A;  4AM3 A;  4X1E A;  3HPG A;  2QWW A;  2PMZ A;  1B9M A;  5FD5 A;  5KAI C;  3FDY A;  3S16 J;  2PMU A;  1BJZ A;  2KRC A;  2MC4 A;  1SVL A;  1O7L A;  3L2Q A;  3H35 A;  3C2H A;  5A2Q Z;  2EFW A;  1PP8 F;  4Y33 A;  4QPQ A;  2Q8K A;  4M74 A;  3QYB A;  5EEG A;  1XSX A;  2ZJ2 A;  1V55 H;  3WG9 A;  3KLN A;  2DK8 A;  2RAE A;  1FBS A;  5L3B A;  5IP7 J;  3L2U A;  1ZRD A;  1IN5 A;  4IL6 C;  4XNF A;  2KJB A;  3LQR A;  5DD8 A;  1FEX A;  5FRN A;  3ZQC A;  3ONQ A;  3I3L A;  4ZYH A;  2DTZ A;  1OLT A;  5FFZ A;  3DEU A;  2XB5 A;  3DQV C;  2LKS A;  3IV5 A;  2TRT A;  3S32 A;  1X1P A;  1JGG A;  1RR7 A;  3PO3 J;  3A4C A;  4KN4 X;  1NK3 P;  4E70 A;  2RN7 A;  3QPL A;  2ME6 A;  3K4K A;  2EZH A;  4FE4 A;  1TT0 A;  2B0L A;  3JTH A;  2D5V A;  5ED4 A;  3BCB A;  3H9G A;  1B72 A;  1ONV A;  2OUM A;  3U21 A;  2DA5 A;  4GYI A;  1ETQ A;  1D1A A;  3CJN A;  1JHH A;  4XM3 A;  4MFD A;  2WC2 A;  4L9N A;  4IHT A;  3RKW A;  2LTP A;  3HOX J;  4A93 J;  4BQN A;  1FPQ A;  4PJL A;  3I59 B;  3MWM A;  5E3N A;  3GO5 A;  3S15 J;  1IXC A;  1I6H J;  2XAJ A;  3BG5 A;  3FXU A;  3IH4 A;  3ASO H;  2LF7 A;  2CH0 A;  4XKB A;  2FX0 A;  3DTE A;  5E3O A;  4JX6 A;  5EEH A;  1D8K A;  2QUF A;  2XGC A;  1VFC A;  1EH7 A;  3RSN A;  5HLH A;  2M3A A;  5JLW A;  2E7X A;  1ULY A;  1PDN C;  3LOC A;  3PO2 J;  5K5Q A;  1MND A;  3M9A A;  2L7K A;  2KP6 A;  5LGU A;  4ZDL A;  3I4P A;  5C44 J;  3RYP A;  3FHZ A;  1VQP I;  4S05 A;  3IKT A;  4EVI A;  2QQ8 A;  4ON0 A;  3DBR B;  1WJE A;  1AWC A;  4RGR A;  2HR3 A;  2BW3 A;  4BU2 A;  3MFK A;  2RGV A;  4I99 C;  1HW2 A;  4JQF A;  3W2V A;  4E7I A;  3WGG A;  4BL0 B;  5JR3 A;  1VZ0 A;  5H2F C;  3OYE A;  1KU9 A;  2EIM H;  3BWG A;  3VOD A;  3J7Y J;  1LQ1 A;  3V8J A;  2JZY A;  1UHW A;  2L3D A;  4BDZ A;  3GFI A;  2HXO A;  1BW6 A;  4IXA A;  4GCV A;  1MH3 A;  4XLC A;  3JCU C;  2K9Q A;  2DFE A;  2IEK A;  3AG2 H;  4LG3 A;  1R00 A;  5FKO A;  1Y0N A;  5F0C A;  2CO5 A;  1T6S A;  6PAX A;  2DMN A;  4BJT A;  3RYR A;  4V2G A;  1PP7 U;  2CW8 A;  2F2E A;  3H5N A;  4JYK A;  1RRJ A;  4UNO A;  1YW8 A;  2HGC A;  2IJL A;  1OCC H;  1HCR A;  2I8D A;  3GZN B;  4A3E J;  3JW4 A;  2VB6 A;  3OYA A;  3UNG C;  1PYV A;  3N4M A;  4HDV A;  2IGK A;  4ETS A;  2W24 A;  5BQT A;  2UXX A;  1ZLJ A;  1BR1 A;  1WJD A;  2IXS A;  2OC6 A;  3K4C A;  5FRO A;  3ZMT A;  5L3D A;  5EDN A;  1DQU A;  2P6T A;  3CJQ B;  3ZPL A;  2Y9Y A;  1Y1V J;  3W3C A;  3DF8 A;  1UG0 A;  3IH2 A;  4CSW A;  2H8W A;  3CZ6 A;  5B5E C;  5D8K B;  4JP0 A;  4IO9 F;  1HW5 A;  2QBY B;  3RTR A;  2RQP A;  2GXB A;  4PJN A;  5L3E A;  1LDJ A;  2YU9 J;  1TNT A;  4HQE A;  2W4S A;  2WAD A;  2DT7 B;  3M7G A;  1BI1 A;  3M07 A;  4KJZ A;  4OWR B;  5JI6 A;  2PLY A;  4EMS A;  1A6I A;  1LFB A;  2LLK A;  3M8J A;  5E20 A;  1G3Y A;  3H9J A;  4B47 A;  5K5R A;  2P81 A;  2DLL A;  1MJA A;  2FML A;  4P5O A;  2DU9 A;  3RI4 A;  2CQ7 A;  3OOP A;  5IYB J;  2O7O A;  2TCT A;  2K40 A;  3JAM K;  1HDP A;  4HRI A;  2FNP A;  3BG7 A;  1XC5 A;  5AON A;  2VPR A;  4UV8 A;  3PFI A;  5CVR A;  1YX5 A;  2HQ5 A;  2VI6 A;  1N75 A;  2K85 A;  3BY6 A;  2JTV A;  3C1D A;  4BJ5 C;  4YFN F;  1ETO A;  2XKP A;  4MNU A;  1SD5 A;  3GFL A;  3Q0U A;  4G6D A;  3OYD A;  4UUS B;  2UV1 A;  3S8P A;  4EJW A;  4HV5 A;  4A3B J;  1IN4 A;  5ILS A;  3BJ6 A;  1B59 A;  1FBQ A;  2CJJ A;  4Y52 J;  2LY9 A;  1MKM A;  3WTV C;  4GO1 A;  3GFM A;  1MNE A;  1GUU A;  4WWC A;  4BHB A;  5DS9 A;  1AA7 A;  1OMI A;  4OMY A;  3C2B A;  4MEX F;  1ETW A;  2GOX B;  2OCE A;  4GRI A;  3VDX A;  1V3F A;  2YSR A;  4A3K J;  2HXI A;  2E1M C;  1HW1 A;  5IT3 A;  3F21 A;  1OKR A;  5ILV A;  2O6G E;  1U3E M;  3IAS 2;  1KU3 A;  1QBJ A;  3TBI A;  3ERM A;  3SQN A;  3M1C A;  3SDG A;  2AQF A;  1XG1 A;  2IGN A;  3K1N A;  1TWC J;  3TO7 A;  1BM9 A;  4M6Y A;  2KRH A;  2BY3 A;  2CQQ A;  3T8R A;  9ANT A;  2QSF X;  2O0Y A;  1JE8 A;  2X6X A;  1J9I A;  3RQI A;  1D1C A;  2BOL A;  3BPX A;  3K1M A;  1IUF A;  1X3U A;  4HV6 A;  1OYI A;  1VQN I;  2CQX A;  2FQ4 A;  1RC9 A;  2CW0 F;  5CQG A;  3KCC A;  3R4K A;  3V7S A;  2KKO A;  5FJ8 J;  3J7A O;  1Z0X A;  3UKG A;  2L54 A;  1YJN I;  3RPU D;  1ZGJ A;  3SYT A;  3SEZ A;  2DA7 A;  2K9S A;  2K4J A;  4CO8 A;  1O3T A;  2XSD C;  4DW6 A;  3EUH C;  2HU9 A;  2BVM A;  4PCQ A;  4A3D J;  1HA8 A;  5D4S A;  2Y75 A;  5TIS C;  2VC1 A;  2JRT A;  4D9J A;  5HNF A;  1D1B A;  3DP7 A;  4DIQ A;  1X4P A;  3A0H C;  4XN0 A;  1JUP A;  4E7Z A;  4JK1 X;  4R8H A;  3IC7 A;  2EJR A;  3CC2 I;  1W7P B;  2YX4 A;  5DD4 A;  1OQY A;  3FIW A;  1P92 A;  2HFH A;  5DDG A;  3JSO A;  1KYZ A;  1TP4 A;  2DA2 A;  3M8F A;  3LSK A;  4MFE A;  2ZB9 A;  1W7P D;  4HSR A;  3WG7 H;  1X19 A;  3K1P A;  2QZ8 A;  4II3 A;  2GBY A;  2W00 A;  3RKY A;  1WQ2 A;  2HKX A;  2CG4 A;  3G73 A;  3TDU C;  4XLA A;  3NAU A;  2NS8 A;  2P6S A;  3KET A;  5F04 A;  4CCM A;  3F6V A;  1MBH A;  2BZT A;  2XPW A;  4A3J J;  1LB2 A;  3K70 D;  1P6R A;  2JSC A;  5J40 A;  1MGT A;  1WI9 A;  4UHT A;  2E7W A;  2WA0 A;  3I59 A;  1K78 B;  2GIV A;  5CPR B;  3D5L A;  1XSD A;  2KIQ A;  4R79 A;  5DCM B;  4XMY A;  4XL9 A;  4DYR A;  2L9S A;  4I2O A;  2R3S A;  2ZKZ A;  1GLN A;  1GXQ A;  1XMA A;  2R7V A;  3RKQ A;  3E3V A;  3IRQ A;  5IP6 A;  1HST A;  2RV8 A;  5ICG A;  3DKW A;  2EA4 A;  5M3F J;  4U88 A;  1WGX A;  2DMP A;  4B09 A;  4X6A J;  1ZN2 A;  4RLQ A;  3QU6 A;  2HS5 A;  1VQK I;  1NTC A;  1ACI A;  2VN2 A;  2CW7 A;  1G2H A;  5E79 C;  3H9Q A;  1GHC A;  4S0H B;  3PSF A;  1ERD A;  2HOA A;  1RZ4 A;  2IP2 A;  2R7T A;  2NNY A;  1L3L A;  2D2W A;  4BHC A;  2R7R A;  1FNN A;  4AYB A;  1S3J A;  2Y9Z A;  3FBI B;  4G7O F;  3HSR A;  3H92 A;  4RAZ A;  1EH6 A;  1QO0 D;  2VJ5 A;  3ECH A;  4XIC A;  2V4J C;  1I27 A;  4RB2 C;  2VOD A;  1IV8 A;  1WJF A;  2AQE A;  1EJ9 A;  1W36 C;  2FRH A;  3B73 A;  4CA0 A;  1HDD C;  4UUT A;  5EZH A;  1Z3X A;  5GAG J;  3KZY A;  1RKW A;  3QPS A;  1BIA A;  2OA4 A;  3PUB A;  1X3W B;  2Z16 A;  3GFJ A;  2L4M A;  3L2R A;  3BG6 A;  5D6E A;  2EZI A;  3N05 A;  1ZAR A;  2XV4 S;  4Q47 A;  4OIR F;  2KHM A;  1H89 C;  4FCY A;  2A3S A;  3GTK J;  3BR5 A;  1J59 A;  1X2M A;  1SMT A;  3E6M A;  1IF1 A;  3ML6 A;  5ICE A;  5F64 A;  2VJJ A;  3LSR A;  2CU7 A;  3KFW X;  5JHU A;  2XGX A;  1FYL A;  3JAM Z;  1K79 A;  1BOA A;  1RNL A;  2IA2 A;  2DOE A;  1P4X A;  4IQJ A;  4M6V A;  1W5C C;  3HGY A;  1U6G A;  3KEQ A;  3LA2 A;  4RM3 A;  4HAM A;  4Y15 A;  4LG0 B;  2JQ7 A;  3E5Q A;  5L3F A;  2QSH X;  1Z67 A;  4BHP A;  1JJ8 C;  2WB1 N;  1IAW A;  1ON2 A;  4U7B A;  3KLO A;  2GAU A;  4A2U A;  5F27 A;  2VKH A;  4ZYE A;  2VQG A;  4KIF A;  1SAN A;  4A6E A;  5LGN A;  2X48 A;  3S1Q J;  1YIJ I;  1WJB A;  1U0J A;  4M9Z A;  2W48 A;  2G7H A;  3ASN H;  4LMY A;  4RGU A;  4F92 B;  5DTD A;  4B8X A;  2CUE A;  3ESW B;  4AIJ A;  3EYI A;  4KT6 A;  2DYR H;  2DW4 A;  2L4A A;  2KPM A;  4DZP A;  1T39 A;  4Q4Z F;  3HTU A;  4UB8 C;  3FHN A;  1Z05 A;  4BUP A;  3VYU B;  1XMX A;  3BTL A;  2OZU A;  4PJJ A;  3U2R A;  4CGZ A;  4I0A A;  1J75 A;  3HKZ N;  1WRJ A;  1DUX C;  3OL3 A;  4F55 A;  4UUS A;  4Y4R A;  3CCU I;  4ZTF A;  1GVD A;  2G9W A;  1MDM B;  4LK1 F;  3DPL C;  2XAF A;  3F8B A;  1JKR C;  3JR9 A;  4KMF A;  3KYD B;  4M3F A;  1R4M B;  2EWN A;  2JMW A;  4FE7 A;  2OTL I;  2ADU A;  2ICW G;  2FUG 2;  4LJZ F;  4NQW B;  2XAS A;  2FE3 A;  2OCC H;  3C2G A;  2VXD A;  3ABK H;  3D1N I;  3H5R A;  4EV0 A;  1JJ6 C;  1BL0 A;  2DA6 A;  3E0J B;  1JKQ C;  2VJ4 A;  2DJN A;  3KP6 A;  2WV1 A;  5LHH A;  3TL4 X;  1JTX A;  2JVH A;  4I7H A;  4EGY A;  4BEH B;  4IHW A;  1J5Y A;  4IX7 A;  3Q5F A;  3TP3 A;  1QZY A;  2LK2 A;  5IOZ A;  5D5V B;  1N25 A;  3LQQ A;  2ISZ A;  5GAH J;  3HSE A;  4XR6 A;  2STW A;  2XGE A;  3ERE D;  4J19 A;  4XRS A;  3NWT A;  2VL8 A;  1LEA A;  3S2H J;  4C2M J;  5LLQ A;  4GYG A;  3NQO A;  1A31 A;  2XDV A;  3O8H A;  1IXS B;  3Q9V A;  1TQM A;  1F4K A;  1Y0U A;  2OU2 A;  2XAU A;  2KZV A;  4F7Z A;  1YX3 A;  2NVX J;  2F5E A;  4WXC A;  2HPM A;  1F43 A;  2ZC2 A;  1BOB A;  4BAC A;  3BR3 A;  4W1U A;  1X1D A;  5EF6 A;  3HOT A;  1TW3 A;  2DMQ A;  2KMU A;  4M9X A;  4AU7 A;  3L1P A;  1MBG A;  2K9N A;  1U5T A;  2DK5 A;  2KIM A;  3T5X A;  5HOD A;  4EM0 B;  2O8X A;  3BR6 A;  1SVM A;  2JA8 J;  5B1B H;  4N9H A;  2IW5 A;  3KPH A;  1IG7 A;  4E7S A;  3H5A A;  1W0T A;  2DFH A;  1WJA A;  4LFU A;  3MKL A;  1WPK A;  4C3I J;  2O61 A;  3OYG A;  1LFU P;  1KA8 A;  3HBL A;  5EGO B;  4D0P A;  2V9K A;  1SEU A;  3F8N A;  2HDC A;  4RB0 A;  5KHD A;  5LHG A;  4BXU A;  3OY9 A;  5J6X A;  4DZJ A;  5IP9 J;  2JA2 A;  1T38 A;  1POG A;  5J4V A;  5GAE J;  4CYC B;  3ABU A;  4OIO F;  2HI3 A;  5J3L A;  3VSK A;  4L18 B;  2ZJP F;  2IS6 A;  1G3T A;  3ZQF A;  1HF0 A;  3FXL A;  4EGZ A;  3HHG A;  5DCM A;  3CMM A;  4IRG A;  2CUZ A;  5HDN A;  3BTC A;  3S3N A;  2V1X A;  3HYI A;  4KIB A;  2IS4 A;  1P4W A;  3D0S A;  4Y7N J;  2DT6 A;  5J8C A;  3GBG A;  4ZH4 F;  1VQ9 I;  2P5K A;  1FTZ A;  2AXT C;  3OYN A;  1UEL B;  2Y30 A;  5HLI A;  2EK5 A;  2HYJ A;  1MH4 A;  3DTI A;  3KP3 A;  1MZB A;  1YOV B;  1RUN A;  4C3H J;  3DCF A;  1VI0 A;  3HOY J;  1F5T A;  3CDH A;  2ZME C;  1B6A A;  3FXJ A;  1U2W A; 
#chains in the Genus database with same CATH homology
 3JRB A;  5F0C A;  1X58 A;  3ZOB A;  1TWA J;  2DMN A;  1T56 A;  1HLV A;  4V2G A;  5M5X J;  2H1K A;  1K83 J;  4JYK A;  5IOY A;  1FJL A;  2HOT A;  1HCR A;  4A3L J;  5M5W J;  4A3E J;  2NVY J;  4JX4 A;  4G12 A;  2GM4 A;  3G1O A;  3NAR A;  5EDN A;  3JRG A;  2Y9Y A;  1Y1V J;  1ZKG A;  3IH2 A;  4AC0 A;  1PUF A;  4JP0 A;  1K61 A;  1NK2 P;  2IBD A;  1UHS A;  4D5F A;  1ZQ3 P;  2L7M P;  2E2H J;  2YUS A;  1B8I B;  5J1Y A;  2FJ1 A;  2YU9 J;  4FIS A;  4IEJ A;  3Q0V A;  3MN2 A;  3OIO A;  4DYC A;  1GV5 A;  1A6I A;  3PM1 A;  1LFB A;  2LLK A;  5FKL A;  1WH5 A;  4MIM A;  4MO7 A;  2WAQ N;  2L0K A;  1P7J A;  2P81 A;  2XPU A;  1ZK8 A;  5FKK A;  5E3L A;  3IH3 A;  3H3V K;  5IYB J;  3FK7 A;  2O7O A;  2QF7 A;  5FKN A;  2TCT A;  2K40 A;  1HDP A;  1X2N A;  5FKM A;  2Y0S N;  4RDU A;  3BQZ A;  1XC5 A;  1AU7 A;  2VPR A;  3RZD J;  2M9H A;  1GV2 A;  2LFB A;  3FK6 A;  2HQ5 A;  2VI6 A;  1FTT A;  1ETO A;  3WHC A;  1LE8 A;  2L7Z A;  2JJ7 A;  3K7A J;  3Q0U A;  4UUS B;  2MGQ A;  3S1N J;  4A3B J;  1MBE A;  2EH3 A;  2M8G X;  1MBK A;  2CJJ A;  3BQY A;  4Y52 J;  2LY9 A;  4BY1 J;  1XS9 A;  2DMU A;  1GUU A;  5DS9 A;  2HDD A;  2Y31 A;  1QVU A;  3ZQI A;  3TED A;  3S1M J;  2JN6 A;  3C2B A;  4A3F J;  2YS9 A;  4IHY A;  1ETW A;  3CDL A;  1AKH A;  5M3M J;  1ENH A;  4A3K J;  2HXI A;  2E1O A;  5F0H A;  2XPV A;  1JKP C;  1RET A;  2R92 J;  5EG0 B;  1TWH J;  1H88 C;  2VKV A;  3SDG A;  5JLX A;  1XG1 A;  1UG2 A;  1TWC J;  2DMT A;  2VKE A;  3S14 J;  1U8B A;  3HOV J;  2CQQ A;  9ANT A;  2R5Z A;  2O9L A;  3GTJ J;  3JRF A;  3OOU A;  5IYD J;  1TWF J;  3RQI A;  2EZK A;  1IUF A;  1ORK A;  2MG4 A;  4D7M A;  3CMY A;  2NS7 A;  2CQX A;  2GLO A;  2NOG A;  2FQ4 A;  2XB0 X;  3TW7 A;  1MSF C;  5FJ8 J;  3JRI A;  2L7F P;  1CQT A;  2KDZ A;  1Z0X A;  4XRS G;  3UKG A;  1ZR4 A;  3TW6 A;  4B3A A;  2DA7 A;  2K9S A;  1B72 B;  2MSY A;  1AHD P;  3LNQ A;  4QSH A;  2XSD C;  3BR1 A;  4DW6 A;  2I10 A;  4A3D J;  2E19 A;  1JKO C;  3WHB A;  2XGD A;  1JUM A;  2OF7 A;  1JUP A;  2MW8 A;  3G1M A;  3HDD A;  3FIW A;  1E3O C;  3A03 A;  2ID6 A;  3E7L A;  3Q0W A;  5BNG A;  2DA2 A;  2R5Y A;  4MFE A;  2ELK A;  3LSP A;  2ZB9 A;  4XID A;  3I4M J;  3CCY A;  3BTJ A;  1QRY A;  4B4C A;  2GBY A;  2EQR A;  4I76 A;  1W0U A;  2NVQ J;  3NAU A;  2NS8 A;  1ETY A;  4MLO A;  5F04 A;  4I6Z A;  2NVT J;  1OCP A;  4D7N A;  4A3J J;  1MBH A;  2XPW A;  1RKT A;  3GTQ J;  3S1R J;  4AYB N;  1ITY A;  1YRN B;  2LR8 A;  2JWT A;  1GT0 C;  4DYR A;  3OSG A;  3GTO J;  3OSF A;  5EGO A;  1IGN A;  5F08 A;  2XRL A;  2KT0 A;  4V2F A;  3RKQ A;  3HOU J;  4BBR J;  3S2D J;  5IP6 A;  1U9N A;  1IV6 A;  3A01 A;  1ETK A;  1U9O A;  4XRM A;  5M3F J;  1WGX A;  2DMP A;  4X6A J;  5K7F A;  1GDT A;  3M3Y J;  4CYC A;  1NTC A;  2G0E A;  5C3E J;  3A02 A;  1G2H A;  1TWG J;  2ECB A;  2LVS A;  3DEW A;  4S0H B;  2HOA A;  3JRE A;  1TC3 C;  3QQA A;  1SFO J;  2E2J J;  3M4O J;  3JRD A;  3LSG A;  1IRZ A;  1T33 A;  1VND A;  3ZQH A;  2Y9Z A;  4HNV A;  2X9D A;  3FIS A;  3BG3 A;  4XIC A;  2M2E A;  4C3J J;  2LKX A;  2EZL A;  3SFI A;  3TP0 A;  2R5Y B;  5GPA A;  3B6C A;  4GFB A;  2JK3 A;  1HDD C;  4UUT A;  5EZH A;  4RBO A;  2R0Q C;  4JX5 A;  1DU6 A;  5GPC A;  2EBI A;  1PUF B;  4A3G J;  2QCO A;  1RKW A;  3QPS A;  1WH7 A;  3GTG J;  2DN0 A;  3SJM A;  2COB A;  4FTH A;  2EZI A;  1D5Y A;  3BG9 A;  1A5J A;  3BTI A;  4M3D A;  1H89 C;  3HEF A;  4FCY A;  3GTK J;  2CUF A;  2DA4 A;  3BR5 A;  1X2M A;  4BXX J;  2X6O A;  1MNM C;  4A69 C;  3LSR A;  3LSJ A;  1F36 A;  1IJW C;  2CU7 A;  5F1J A;  1QPI A;  4M3B A;  4M3E A;  4M6V A;  2R7Z J;  3HGY A;  1BW5 A;  2OPT A;  4BY7 J;  1RPW A;  3B6A A;  1JJ8 C;  2IAI A;  1MBJ A;  2WB1 N;  5IPA A;  3ZQL A;  1FIP A;  1UMQ A;  1B8I A;  5F27 A;  1LE8 B;  2ECC A;  2PMZ N;  4NDL A;  1SAN A;  2X48 A;  3S1Q J;  3JRC A;  2AHQ A;  1S7E A;  4B1R A;  1JT0 A;  3HB9 A;  3JRA A;  2W48 A;  4QTR A;  5GP9 A;  2JA5 J;  2DA1 A;  1ZTR A;  5DTD A;  2B63 J;  1WI3 A;  2CUE A;  2ME0 A;  5EYR A;  4D5C A;  1R9T J;  4IHX A;  1JTY A;  4DYQ A;  3G1L A;  2JA6 J;  2Y2Z A;  4DZP A;  3Q3S A;  1HOM A;  2R93 J;  1ETX A;  1IDZ A;  5F0F A;  3HOZ J;  3ZQG A;  3BTL A;  1VF9 A;  2M34 A;  1AKH B;  1EF4 A;  2HOS A;  1MBF A;  1OFC X;  3K2A A;  4W97 A;  1Y1W J;  5EEA A;  1RES A;  5K7H A;  1BA5 A;  1MSE C;  3BT9 A;  3HKZ N;  2O8K A;  1JT6 A;  4LOC A;  4UUS A;  1Z77 A;  1GVD A;  1O4X A;  4X1E A;  1OJL A;  3JRH A;  5M5Y J;  1JKR C;  1OCT C;  3JR9 A;  2VUM J;  2FD5 A;  4M3F A;  4AUX A;  2JMW A;  4FE7 A;  4BBS J;  2R5Z B;  3S16 J;  1QVT A;  2LP0 A;  1BJZ A;  3D1N I;  1H8A C;  1JJ6 C;  1WCM J;  1P7I A;  2DA3 A;  1BL0 A;  1IDY A;  2DA6 A;  1JKQ C;  2DJN A;  3HOW J;  2WV1 A;  1JTX A;  5J1U A;  4BKX A;  5C4X J;  2RAE A;  4IHW A;  1ZGW A;  5EG0 A;  5E3M A;  5IP7 J;  3TP3 A;  2LK2 A;  5IOZ A;  1DU0 A;  1FEX A;  5FLM J;  3ZQC A;  1I3Q J;  2DTZ A;  3VPR A;  2XB5 A;  2XGE A;  4J19 A;  4XRS A;  2TRT A;  3IV5 A;  3S2H J;  4C2M J;  1JUS A;  3GTL J;  1JGG A;  2E2I J;  1RR7 A;  2CRG A;  3PO3 J;  1NK3 P;  3O8H A;  3QPL A;  2ME6 A;  1APL C;  1ZR2 A;  2EZH A;  3I4N J;  4FE4 A;  3HM5 A;  2NVX J;  4A3C J;  2D5V A;  1F43 A;  1B72 A;  2DA5 A;  1ETQ A;  5J1R A;  3BR3 A;  4W1U A;  5EF6 A;  2DMQ A;  4MFD A;  2N8G A;  3L1P A;  1MBG A;  2AO9 A;  2ID3 A;  2K9N A;  5HOD A;  2LTP A;  5K7Z A;  3HOX J;  1U78 A;  4A93 J;  1IC8 A;  3BR6 A;  2JA8 J;  3O8G A;  1FIA A;  2L9R A;  5E3N A;  4QIW N;  3S15 J;  1IG7 A;  4EEF G;  1W0T A;  1I6H J;  3BG5 A;  3IH4 A;  3MKL A;  1WPK A;  4C3I J;  4A3M J;  4A3I J;  1LFU P;  1I50 J;  3HBL A;  2FX0 A;  5EGO B;  2M0C A;  4JX6 A;  5E3O A;  2XGC A;  1VFC A;  4L5E A;  3GTP J;  5JLW A;  3A01 B;  3BR0 A;  3RZO J;  3LOC A;  3PO2 J;  3F0C A;  4DZJ A;  5IP9 J;  5C4J J;  5EZG A;  3BR2 A;  3MVP A;  1POG A;  3W6V A;  3S17 J;  4CYC B;  2HI3 A;  5J3L A;  5C44 J;  1ETV A;  3HGG A;  4XK4 A;  4IHV A;  3H0G J;  3ZQF A;  4ABZ A;  2LD5 A;  1YRN A;  1HF0 A;  5FLV A;  3BTC A;  4Y7N J;  4M3G A;  3GTM J;  3GBG A;  1FTZ A;  2HXO A;  1BW6 A;  1MH3 A;  2Y30 A;  2HYJ A;  5IYC J;  1MH4 A;  3CQZ J;  2JA7 J;  1Q1V A;  4C3H J;  1VI0 A;  2K9Q A;  3DCF A;  3HOY J;  2IEK A;  3FKI J;  2H8R A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...