5IP9J

Structure of rna polymerase ii-tfiif complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5ip9J00
2DN0A 2ELKA 2CUEA 2ID3A 2R5ZB 1Y1WJ 1BW5A 1TWAJ 1HDPA 3BG5A 2OPTA 4NDLA 4AC0A 5M5WJ 3C2BA 1MBJA 2DJNA 2MGQA 5EYRA 3BQYA 4HNVA 3JRIA 3FKIJ 5E3OA 3HOWJ 2KT0A 4C3JJ 1TC3C 2XPVA 3MN2A 1LE8B 4FISA 2FQ4A 2LLKA 4QSHA 5FJ8J 2FX0A 4IHVA 1B8IA 1U9NA 2G0EA 5F27A 2LTPA 1POGA 1DU0A 3IH4A 5M5XJ 4FE4A 3OSFA 2HDDA 1K83J 2Y31A 3WHCA 1VF9A 1UMQA 3F0CA 2L7ZA 5K7ZA 2VPRA 3G1LA 3JRGA 1ZK8A 3S17J 4JX5A 3CQZJ 5IPAA 3GTGJ 1SFOJ 3G1OA 2O8KA 5F0FA 1MBKA 5C4JJ 2TCTA 3FK6A 2EBIA 2LVSA 2Y9YA 1JKRC 3Q0UA 3S16J 1FTZA 4I76A 1RKWA 4A3IJ 2DA5A 5FKLA 1MSFC 3O8GA 5BNGA 1DU6A 1FTTA 3HDDA 5F1JA 3S15J 3BG3A 2KDZA 1LFBA 3M3YJ 2NVQJ 4JX4A 3FISA 1T56A 1B8IB 2VUMJ 2CUFA 3I4MJ 3M4OJ 2DA3A 2WB1N 1W0UA 1NK2P 2R0QC 3CCYA 1FEXA 1FIAA 1JUMA 3S2HJ 5HODA 2Y30A 3BR3A 1ETWA 1O4XA 3B6AA 2YU9J 2R5YA 3S1RJ 1TWCJ 3A03A 1H88C 4M3DA 4UUSA 2H1KA 1BW6A 4M6VA 2D5VA 1JT0A 2W48A 1ZGWA 5C44J 1H8AC 1VNDA 1MNMC 2MW8A 4A3JJ 4A3KJ 5M3MJ 3JRDA 3HOZJ 3TW7A 2CJJA 5FKOA 1QVUA 5IP6A 2TRTA 4M3EA 2O9LA 1ENHA 1Z77A 4XRSG 2DMTA 4FE7A 4A3EJ 1R9TJ 3Q0WA 4D7MA 4DYCA 4D5FA 3GTQJ 4W1UA 5C3EJ 3SFIA 1PUFA 1OCPA 4S0HB 2GLOA 3BTCA 4IHXA 1JUSA 4RBOA 1JTYA 3JRCA 1WGXA 3S14J 2K40A 2LD5A 3E7LA 5EGOA 2EZLA 2NS8A 1RESA 2R5YB 2OF7A 1QVTA 1WPKA 4JYKA 2FD5A 2CU7A 5J1UA 3HKZN 1IRZA 2L0KA 5IYCJ 1WI3A 4DYRA 1U8BA 4A3LJ 3HOYJ 4JP0A 3TP0A 2HYJA 4AUXA 3PO3J 1Q1VA 1APLC 1P7IA 1SANA 2NVYJ 1XG1A 2AO9A 3H3VK 3JREA 1XS9A 5FKMA 3H0GJ 4A3DJ 2MG4A 2ECCA 5IP7J 1S7EA 1PUFB 1GVDA 2HOSA 5FKNA 3HGYA 1IC8A 3FK7A 1B72B 1VI0A 1HF0A 2XB0X 2B63J 5F0CA 4L5EA 2DA7A 5EGOB 1I3QJ 1MBHA 1IUFA 3LNQA 1X2MA 5FLVA 2XPUA 4DYQA 4V2FA 2VKVA 3S1NJ 3HGGA 3S1MJ 4Y7NJ 3G1MA 5F0HA 2K9QA 2LFBA 4IEJA 2L7MP 1WH5A 2IEKA 1MBEA 2ME6A 1OCTC 2X6OA 4A3MJ 1A6IA 1BL0A 2M8GX 4MLOA 5DTDA 2IBDA 1FJLA 4A3GJ 2DA6A 1IJWC 1JKPC 4MFEA 3S2DJ 3WHBA 3RZOJ 1NTCA 4EEFG 4UUTA 5EZHA 2HI3A 1OFCX 4M3FA 3ZQLA 4BXXJ 4XRSA 1F36A 1AKHB 1FIPA 2E2HJ 3ZQFA 2X9DA 4BY1J 4XIDA 1Y1VJ 2GM4A 2VKEA 2JN6A 3GTOJ 2JK3A 3NARA 3L1PA 4W97A 1Z0XA 2CQXA 3TW6A 3OSGA 4C3IJ 4QIWN 4XRMA 5FKKA 4MFDA 4DW6A 1JUPA 5E3NA 1MH3A 1WH7A 2DMQA 3DEWA 4DZJA 1D5YA 1HOMA 4FCYA 5GPCA 2DA1A 1MBGA 1ZKGA 5F04A 2XPWA 4A3FJ 1RPWA 3OOUA 1ETQA 1X2NA 3HOVJ 2NVTJ 2DA4A 3BTLA 2LR8A 3HBLA 2QF7A 3ZQIA 3HB9A 3D1NI 2ME0A 3JRBA 3RZDJ 3MKLA 1ETOA 4BKXA 1XC5A 2EZKA 5J1RA 2M2EA 2M9HA 2NS7A 1RKTA 4BBRJ 3ZQGA 2DA2A 4I6ZA 1A5JA 2CQQA 3Q3SA 4BBSJ 1U9OA 1CQTA 2YS9A 3A01A 1B72A 1IGNA 3ZQHA 5IYDJ 2XGDA 5FLMJ 3GTKJ 1BJZA 3BT9A 3LSRA 2NVXJ 1ETKA 1UHSA 5E3LA 4J19A 3ZQCA 2FJ1A 5K7FA 2P81A 2HOAA 4QTRA 5DS9A 3OIOA 4C2MJ 3UKGA 1P7JA 2XGCA 4DZPA 2Y9ZA 2HQ5A 3A02A 3DCFA 1K61A 4X6AJ 2HXIA 1BA5A 1ETYA 3LOCA 3VPRA 1JKQC 4B4CA 2QCOA 3SJMA 4M3BA 1ORKA 1ZR2A 3RKQA 1U78A 5EDNA 5EG0A 4AYBN 3B6CA 3QPSA 2R93J 4XICA 4Y52J 3K2AA 4B1RA 1AKHA 2AHQA 2R92J 1ZR4A 2N8GA 3QQAA 2K9NA 2XB5A 1VFCA 4CYCA 4X1EA 2JMWA 3A01B 2M34A 2LY9A 4C3HJ 3IV5A 2JWTA 2WV1A 3LSJA 2E2JJ 2RAEA 3GTJJ 3Q0VA 3FIWA 2EH3A 4D7NA 4GFBA 2H8RA 3ZOBA 2R7ZJ 2MSYA 5GP9A 2CRGA 1GT0C 3BR6A 9ANTA 1HCRA 3HOUJ 1WCMJ 5J3LA 3CMYA 3IH3A 1HDDC 2DMNA 5EG0B 3BR1A 1JJ8C 1JJ6C 2YUSA 1JGGA 3JR9A 3BG9A 5JLXA 4A69C 2X48A 4G12A 4V2GA 4A93J 1OJLA 3PM1A 4MO7A 4CYCB 2EZIA 1ETVA 3BR0A 5F08A 1TWHJ 3I4NJ 5EF6A 1MH4A 1E3OC 2IAIA 2PMZN 2ID6A 3NAUA 1G2HA 1YRNA 2EQRA 2L9RA 1ZQ3P 2Y0SN 4B3AA 3GTMJ 3PO2J 2COBA 1NK3P 3RQIA 1ZTRA 3BTJA 3W6VA 4JX6A 4BY7J 1X58A 5K7HA 1IV6A 2Y2ZA 2LK2A 3LSPA 1GUUA 4LOCA 2K9SA 3IH2A 3HM5A 2M0CA 3QPLA 3O8HA 4MIMA 1EF4A 2GBYA 1AU7A 2E1OA 1HLVA 1IDZA 4D5CA 2LKXA 1RETA 4IHYA 2NOGA 1MBFA 1TWFJ 4IHWA 2JA6J 2EZHA 2L7FP 1I6HJ 2E19A 2R5ZA 3SDGA 3TEDA 5IYBJ 1IDYA 1T33A 2DMPA 2JA8J 2XGEA 1W0TA 4ABZA 3BR2A 5E3MA 5IP9J 3JRAA 2ZB9A 3HOXJ 2I10A 1JTXA 2O7OA 3JRFA 5M3FJ 5C4XJ 5IOYA 3BTIA 2JA7J 3BQZA 2JA5J 5JLWA 3TP3A 1GV5A 2XRLA 3GTLJ 4XK4A 1H89C 5IOZA 1LE8A 1QPIA 1YRNB 1ITYA 2E2IJ 1GV2A 2ECBA 1F43A 2LP0A 2HXOA 4A3CJ 1MSEC 4M3GA 3GTPJ 3K7AJ 5M5YJ 1LFUP 2WAQN 4FTHA 2XSDC 1IG7A 1GDTA 2VI6A 1QRYA 2JJ7A 3HEFA 5EEAA 2DMUA 5GPAA 3GBGA 5J1YA 1AHDP 1JT6A 3BR5A 1JKOC 1TWGJ 4RDUA 1ETXA 1RR7A 4A3BJ 3MVPA 5EZGA 1I50J 4UUSB 3JRHA 1UG2A 2DTZA 3S1QJ 3CDLA 3LSGA 2HOTA
chains in the Genus database with same CATH superfamily
2DN0A 2ELKA 4WXHA 4E70A 2R5ZB 1Y1WJ 2HZTA 3BG5A 5M5WJ 4ZDLA 1V3FA 2MGQA 5EYRA 2M30A 1FMVA 4IO9F 1QU3A 3PIPF 5KHDA 4AU7A 3W2WA 2K7LA 3RIRA 4G6QA 4I01A 3JCUC 4A0YA 2PJRB 1VTNC 4MEYF 2W82A 2ZSHB 2QVOA 2A5YB 2FX0A 3PFIA 1HW5A 3CC4I 3K0LA 2DU9A 1IRFA 1VQKI 2G0EA 5F27A 1X4OA 2IA1A 2BV6A 2JZYA 3ZMUA 3BZKA 2OBPA 1HQCA 2ESNA 1D0ZA 3HC7A 2HDDA 5TISC 1X1CA 3G73A 3WHCA 2X1DA 4IRGA 4ZYGA 2CYYA 2QZ8A 5E8IA 2Z2SB 2DAOA 1KA8A 3F0CA 2VC1A 3G1LA 1QPMA 3S17J 1WJAA 5FD6A 4A6EA 2ZJQF 3CCRI 1MJAA 3RSNA 5F0FA 1MBKA 1TNTA 3DLAA 2QLZA 4BGDA 2KRCA 4PJNA 3DTIA 4ANJA 3LMMA 4EV0A 3PIOF 3G2BA 2KZVA 5CVUA 1JI8A 3Q0UA 5B5EC 4I76A 3ASNH 1YW9A 1U5TC 1W36D 4HF2A 5BNGA 4NC6A 4ZDOA 5CVRA 4BHCA 4Y17A 3S15J 3MZYA 3SZTA 2HTJA 1HSTA 4HSTA 3D5LA 1LFBA 2O8XA 1FBUA 1T56A 2CUFA 2DA3A 3HHGA 3HZJA 3BOQA 3F6VA 4LGWA 5CQEA 3CCVI 1HSJA 1YIJI 1LDDA 2Y69H 2FMLA 3GVAA 4IHSA 4KITB 1DQUA 1VQ8I 2CS3A 1ODDA 1H88C 3D5RC 2VODA 1BW6A 4M6VA 2D5VA 2W48A 3CDIA 1FYKA 1R36A 1ZGWA 3IAM2 2X6WA 1G6NA 1H8AC 2CGPA 2B7EA 1MNMC 2KLOA 4C9YA 3H36A 4A3KJ 1YJNI 4NHJA 3K70C 3CUOA 2V26A 2Z99A 2PMZA 2P4WA 2V9VA 4BQOA 2EB7A 3CESA 2O9LA 5DM6F 1WZ2A 2EJRA 2VBZA 4A3EJ 1YS6A 2JUGA 4XBFA 2E1MB 1DGRM 3IAS2 4D5FA 3GTQJ 4ZYEA 4BH9A 2X6XA 1JUSA 2W24A 1JTYA 2P5KA 1WGXA 3K4JA 5B1AH 3WGIA 1QNTA 5GAGJ 1IN5A 3C1DA 5JR3A 5H6QA 4HQMA 3P7NA 2JPCA 1VQNI 2EZLA 1DP3A 2BVMA 4LB6B 1Z7LA 2R5YB 4RB2C 4RAYA 2KHMA 2CQNA 1YW7A 2LDUA 3ABTA 3CZ6A 1XDUA 4DBQA 1KGSA 5KAIC 3ISPA 3BC8A 2FD5A 2K86A 4CHUA 2L0KA 5IYCJ 1I5ZA 3M8FA 2D2WA 4YELA 4A3LJ 1TLHB 3EUHA 1YO5C 2DK8A 3OYGA 1W7PA 3LSTA 1P4AA 1LQ1A 3RCOA 3CJNA 3CJQB 4XORA 4OOIA 2X0LA 3DF8A 3VDXA 3LFKA 4CXFA 2PMHA 1TQMA 1ZLJA 5D8LB 1XS9A 1K78A 3N05A 3PUFA 4N4OB 4IOCF 1SFEA 2FBKA 1R6RA 4BHPA 3W2AA 1WFXA 1XSXA 1QZEA 2IW5A 2K4BA 3HGYA 4HA8A 2K02A 5L3CA 2CV0A 1VI0A 3LSIA 1HF0A 3ERMA 2K3FA 2B63J 4C2TA 3BP8A 4L5EA 1D8KA 1X1DA 2DA7A 5BQTA 3KP5A 5EGOB 1PYVA 1YFHA 1Z3XA 2KFDA 1ZG3A 4BQQA 1HXDA 3J7YJ 3NWSA 3FM3A 4V2FA 3S1NJ 4PSXA 5TJJA 3GZ5A 3QODA 1B1BA 3IKTA 2LFBA 1UELB 4IEJA 3J7ZI 3R61A 2ME6A 3V7RA 5ICFA 4ESJA 1MDMB 1JGSA 2M8GX 2IBDA 2IPQX 3QYFA 5LLQA 1IJWC 3K9TA 4MFEA 5ICCA 5LFAA 1BN5A 1NTCA 3H0DA 1XTAA 4EEFG 4UB6C 1SAUA 1OFCX 3HOSA 1RR8C 4BXXJ 2OZUA 3GZ6A 1H9GA 1FIPA 4OU0A 3I59A 4XIDA 4RAGA 3HTUA 2JN6A 5EEGA 2L01A 1KU3A 3J80Z 4Z6YA 3JW4A 1UG0A 2HDCA 2ZNYA 3COAC 5DUIA 1YW8A 4C2UA 2B0LA 1B59A 3CJTB 4M6XA 2DDAA 3F8MA 4LG0B 2DMQA 2ZCWA 2HR3A 3DEWA 2XUBA 4BU2A 2RREA 3JSOA 4MHGA 3U2RA 2BOLA 1ZKGA 3OOUA 3JAMZ 1REPC 5DCMA 3DQVC 1T0FA 3BTLA 4HG2A 2A07F 4XONA 5J8CA 2ZXWH 3FX3A 2R7DA 3RZDJ 2DPDA 2UWMA 3MKLA 4DIQA 1ETOA 4BKXA 3TGNA 3K1PA 2M2EA 3SQNA 4HW0A 2NNNA 2UV1A 2P8TA 3M7GA 3ZQGA 2P0WA 2EWNA 3OY9A 4BL0B 4HQEA 1TNSA 1U9OA 2YR2A 1CQTA 1QO0D 2LOOA 2XAGA 1YS7A 3GZNB 6PAXA 1R4NB 5D5UB 4YEJA 1BJZA 4G6DA 4LLGF 1P92A 2NVXJ 4D9JA 4IOAF 1ETKA 1UHSA 2JPBA 3I3LA 4YIIA 2FJ1A 5E3LA 2R7SA 2IA0A 2MD0A 4C2MJ 3FMSA 3A02A 3QPHA 3OYDA 2WV0A 1SEUA 4DOZA 4LD5A 3WODF 1K61A 2E35A 3LOCA 2WAEA 2CMPA 3LSHA 3WTXC 4LB5A 3DPTA 5CYVA 4B4CA 2QCOA 3PSFA 3JSPA 4AM3A 4L0YB 3RKQA 3ASOH 5EG0A 2YX7A 1R1TA 2R4GA 3B6CA 2R93J 3K2AA 3VODA 4B1RA 2LC2A 4P9FA 3GX4X 1AKHA 3E1SA 2R92J 1D0YA 1N25A 4I0BA 1RUNA 1LFPA 5LGTA 2ZNZA 3C7JA 2WY8Q 2A61A 1OR7A 1YQAA 2HU9A 4CCJA 4C3HJ 3IV5A 2P5LC 4II2A 1SVOA 1TT5B 4U87A 2RAEA 5HOOA 2J5PA 3TDZC 1BR2A 3RTRA 4O5VA 3E6CC 2DFEA 2BVLA 4D7NA 3F23A 1YJWI 1UZCA 3F8FA 3HKZA 1HKSA 1S8NA 5GP9A 3ZRGA 2MLKA 2K3PA 2XDVA 3BR6A 1WCMJ 2STWA 4GXOA 4ZYHA 1J7KA 2CH0A 2E60A 2QA4I 2YPRA 1HDDC 2BEOA 1EH7A 3FZVA 3U1DA 3KE2A 3J7AO 3REOA 4I7HA 3RPQA 2ZMEA 5GTHC 2HQNA 3JR9A 3HYIA 5JLXA 3KP2A 3T5XA 4A69C 4EM1A 5B3SH 1VQMI 2ZXHA 1SD4A 3RQ4A 4FHTA 2NNYA 4MO7A 5DD8A 4EVIA 4EATA 4N9IA 1E17A 2EZIA 2ACJA 3BJOA 3WGHA 5F08A 3CO7C 3AG4H 4A5NA 4YG2F 3KLNA 3FXOA 2DPUA 3QWLA 2V6EA 1RIOH 5ERIA 5D4SA 2ID6A 2F48A 1IO2A 3KP6A 3PNTA 2M8EA 4XKCA 2M45A 3A0BC 4WXCA 3GFMA 2L9RA 2Y0SN 3GTMJ 4XSXF 2COBA 1NK3P 3RQIA 1H9TA 4EM2A 1GXQA 1FP1D 2E7XA 3Q9SA 4BEHA 3T8RA 1STZA 4CCOA 5CVVA 4LIVA 3MD2A 1IZ1A 4I98B 3KPHA 2ADUA 2ZKZA 4XL9A 4MQ9F 3DU6A 2Y2ZA 2R7RA 1WVRA 3OYFA 5FFXA 3HM5A 4NQWA 2M0CA 3IHUA 4CH7A 4CZZA 3GF2A 4OMYA 3H5AA 1AU7A 1GXPA 2VJJA 1RETA 1WJDA 1MBFA 1U0JA 3ZP5A 2V9KA 1SFUA 2QBYB 4GDFA 1ZYRF 1WJEA 3EDPA 1WKMA 4IHWA 1FNNA 1P4WA 2R5ZA 1OKRA 1MD0A 1Z05A 3P9CA 1OISA 2BXYA 1FOWA 1KZHA 3SEQA 3R0JA 2JA8J 2R7UA 3BR2A 3OOPA 3JRAA 5M3FJ 1JTXA 2H8WA 3J80K 5IOYA 3BTIA 2JA7J 1TQIA 3W6JB 4MGRA 3TP3A 1GV5A 3D5SC 4P55A 3PSIA 2W00A 2IVMA 2PJRA 4HYEA 2CUZA 3FMRA 5ILSA 4U88A 3IP4B 4KDPA 1P2FA 3K7AJ 3GTPJ 3S93A 2VE8A 5DYMA 5LHIA 1LFUP 3H9GA 4L9NA 3S3MA 1PP7U 3CC2I 2XSDC 1BIAA 1IRXA 2VJIA 2A5WA 2VI6A 3GO5A 2M7AA 1QRYA 3JAMK 4LFUA 2DMUA 2UUZA 2XKPA 2GWRA 1AHDP 4BAYA 2MH9A 3L2CA 3ROUA 4LITA 2M0MA 2BY2A 2DOFA 4RDUA 2BE5F 4LK0F 4A3BJ 1XCVA 4I02A 1I3AA 2KIMA 1D0XA 4RAFA 3S1QJ 2R3SA 2ICWG 1I1SA 2DOEA 4ENKA 2ID3A 2XIGA 5ILUA 2V6CA 3H1CA 1TWAJ 3G6EI 4NDLA 2OPTA 4S05A 1P4XA 4HDVA 1IW7F 1HA8A 2FQ3A 2HQRA 4LIUA 2VPLA 3HOWJ 2VE9A 2KT0A 1A31A 1XGOA 2GXBA 1J59A 2L3DA 1TTYA 2LLKA 1R22A 4XLCA 2M87A 3AG1H 4A0XA 4F7ZA 2VN2A 4CCMA 3IH4A 5DD4A 5M5XJ 4FE4A 3M8JA 4BE0A 3CUQB 1XDSA 4ZZDA 2PFBA 3RYPA 2HKOA 1X1PA 3M8EA 2P7VB 2D1VA 3A2KA 5HDNA 3T0YA 4LG3A 4HLXA 2RKHA 5EJCA 4B8XA 5K7ZA 2QYOA 2L02A 3CQZJ 1MW7A 3GTGJ 4QPOA 3FXUA 2XHKA 2KIUA 1BR1A 3F3XA 5JI6A 5C4JJ 4WK8F 5B66C 3FK6A 3KZIC 1MMAA 1GVJA 2VBXA 1YE9A 1JKRC 2OV7A 2DQRA 2PLYA 1Z6RA 2YSRA 4CZCA 3S16J 1RKWA 4A3IJ 2KRFA 4UVBA 5GAHJ 3ML6A 3WU0A 2X51A 2PQ8A 3CO6C 4RS8A 5F1JA 2PX9A 2L7KA 4MTEA 3ELKA 3BG3A 2ZBKA 3GFIA 3H35A 4JX4A 3LA2A 3FISA 1B8IB 2YU3A 2HYGD 3M4OJ 2WB1N 3SXYA 3M9AA 1USTA 1RZ4A 1W0UA 1NK2P 2R0QC 1G3YA 1Y56A 3FXLA 3CUQC 4BXUA 3CCYA 5FO5A 3S2HJ 2VBYA 3ABMH 1Y39A 2Y30A 1YIOA 1ETWA 1XB4A 2EPFA 1TQPA 3BR3A 4FETA 4S04A 5K1YA 2R5YA 3S1RJ 2VXDA 1RNLA 3G71I 3AL0B 4UUSA 2H1KA 4HPQA 4MQVA 4OIQF 3PQKA 1HW2A 2AXLA 5D5WB 3V7CA 5C44J 1YJ9I 2IT0A 1WSUA 2OD5A 4A3JJ 2X6YA 4KN4X 1RI7A 4Q48A 2VOOA 1I27A 3CF5F 2L4AA 2IP2A 2VKDA 3TW7A 2JVHA 2FXAA 2H1LA 2TRTA 1BOAA 3GUDA 4M3EA 1Z77A 5D5XB 1R9TJ 3BZ6A 3CMAI 4DYCA 5C3EJ 3ZPLA 3SFIA 4DBRA 4RBOA 3JRCA 4GRIA 3OYJA 3E7LA 2LF7A 5EGOA 2QUFA 4PJMA 2JA2A 3TQNA 4BQAA 5CVJA 3HRTA 3I53A 1WJFA 1WPKA 4BDZA 3WTSC 1T6SA 2DT7B 2CU7A 4K2EA 5J1UA 2DK5A 1IRZA 5DDGA 1WI3A 3SZPA 4DYRA 4BJTA 2CQKA 4R8HA 2AS5F 3S8PA 5HS9A 3KYCB 1MDMA 3TMOA 4YIRX 5HS8A 2HS5A 1U5TB 2F6CA 2PBIA 3FXRA 1SANA 2O61A 3PQJA 2NS0A 3M07A 1NHAA 2XROA 5FKMA 4HF1A 3DBHB 5H6RA 4ZYDA 1S7EA 2L9NA 1IC8A 4I99C 3U21A 2IGOA 3WGGA 3KLOA 1PDNC 1JHFA 3AG2H 5F0CA 1V5GA 2OTLI 3I64A 2BW3B 2E36A 3O2PE 2FBHA 1IUFA 4LG0A 3CC7I 2BHYA 2Z3YA 3SHFA 1DP7P 4PJ0C 1XMKA 3OR1C 3HGGA 5ICEA 4B43A 2MH2A 3G1MA 2WA0A 3EQLF 2AQEA 1U8RA 2HPMA 1WH5A 5KNLA 2D45A 4M73A 4E7ZA 5FLXZ 3TKYA 4V19K 3V7SA 3TL4X 3K10A 1Y0UA 2DA6A 2KL4A 3PL8A 4PFPA 1JKPC 3BG6A 4XM3A 3GCMA 4XOTA 3LL7A 2V79A 2XGXA 4KUMA 4RGUA 4A5MA 1A04A 4UUTA 2O5RA 3HTSB 1XSDA 4M3FA 4EJTA 2K9LA 2QWWA 1F36A 3OYNA 2E2HJ 3ZQFA 2GXGA 4IX7A 4BY1J 5DUKA 1Y1VJ 2VKEA 3K4BA 3CJRB 4W97A 2FNPA 1Z0XA 5DV5A 4EGYA 1FOKA 4EM0B 3S2WA 3OSGA 3GMEA 3N97A 2TDXA 4XRMA 4MFDA 2RDPA 1WH7A 4XNFA 2FBIA 4NB5A 2EINH 2GXAA 4ZJZA 4EGZA 4DZJA 1BI3A 1OQYA 4O6JA 4RGRA 3OYKA 1YI2I 5F04A 2V1NA 4IVNA 4A3FJ 4IHTA 1ETQA 4RMNA 5D4RA 1FOYA 2LR8A 3QYEA 3ZQIA 3H9JA 4XRFA 4J00A 3V42A 2CWEA 2ME0A 4WWCA 4ZH4F 5J40A 2DLLA 2F4OB 2M9HA 1UJ8A 2VASA 1P6RA 1SMYF 3OYBA 2MFZA 5K5QA 3OS2A 3N4MA 4M72A 2VLAA 1MJ9A 1A5JA 2QEXI 1B6AA 3QOEA 4RGSA 2Q2EB 4HX7A 4WX9A 4EMSA 4BE1A 2A3SA 2DOAA 1IGNA 2AXTC 3ZQHA 1B72A 5IYDJ 3GTKJ 2VXZA 2LY2A 2X4HA 4J01A 1EA3A 4HV5A 3ZQCA 4A2UA 1FT9A 2P81A 3SFZA 5J4VA 4QTRA 1Z6TA 3KP4A 3UKGA 5E1WA 1F9NA 3F21A 2XGCA 4F52A 2F5FA 1B4AA 3X2QH 1Z67A 4FX0A 2HXIA 1ETYA 4HSRA 1XMAA 2A05A 2MYSA 1L3LA 3FDYA 2CG4A 3EYYA 1JKQC 3SJMA 1AOYA 1TZLA 1ORKA 2KRHA 1KU2A 4L9TA 1R71A 3HUGB 4AYBN 4CO8A 3HPHA 4ZTFA 1S7OA 2FE3A 4ESBA 4EQQA 1W1WE 2V1DA 1VZ0A 3HSEA 2LMDA 3TBIA 2HDWA 3GEZA 4CYDA 2AHQA 5L3DA 1ZR4A 2N8GA 5LRSA 2D1HA 1OYIA 2XB5A 3MZHA 1VFCA 1BI2A 4X1EA 4Y13A 4CCNA 3BJ6A 3WU2C 2EFQA 2M34A 1C0WA 2JWTA 2VJ4A 1MIJA 2MABA 3EPZA 2K27A 3Q0VA 3FIWA 3VYUB 1IXSB 1VQPI 2GOXB 4DJAA 2A6EF 4ENNA 2YX4A 3IL2A 2EIJH 2EH3A 3QRFF 4GFBA 4N4NB 1DDNA 2H8RA 4BYYA 3ESWB 3MCZA 1GT0C 1CF7B 1WHUA 1ZAOA 1HKTA 2BHZA 3FWEA 4PCQA 2HVSA 4HX4A 3G4SI 4E6KG 4KA4A 1TL8A 4AIJA 2GA1A 5A2QK 2P6SA 2IJLA 3MEXA 1BR4A 2OAZA 5EEHA 3W2VA 3DFGA 2K4JA 2MBFA 1FBQA 2XAJA 4G12A 2XAFA 3QYBA 4IJAA 3E6BA 5HNFA 3CLOA 3OYEA 1ETVA 1FWZA 1R5HA 4D0PA 1JXSA 4KNYA 3MFKA 4KT6A 1MNEA 2UZKA 2VBWA 1OLTA 3T8TA 1UB9A 3DBLB 3K4KA 5L3GA 1G3TA 4RLFA 2XSJC 1W5TA 1VQ6I 1ZQ3P 3PO2J 2XF5A 2LSOA 1Z1DA 5BPIA 4PUSA 1ZG1A 4F92B 2KDOA 3MMYB 3K4CA 2HVQA 3BTJA 4OIPF 1FY7A 3W6VA 2GZWA 1FC3A 3E6DA 4BY7J 3ZQQA 4E7LA 4HAMA 2DJIA 2MC3A 5K7HA 4HLYA 2LK2A 3V4GA 2CQ7A 5LD2C 5FLXK 1BC8C 3IH2A 4CICA 3WTVC 2EIKH 1F5TA 3QPLA 4G7OF 1XX5A 1HLVA 1IDZA 2LKSA 4RGXA 2ZJPF 1QA6A 4IHYA 4JQFA 4ZTJA 4UUVA 1ZRCA 2EA4A 4NUBA 5D6FA 3AFHA 2QENA 2E1NA 3SDGA 1IXRC 1RUOA 5IYBJ 1T33A 1YG2A 2E5ZA 2XGEA 4ABZA 1IV6A 5E3MA 4ETSA 4RB1A 2O7OA 2ZC2A 1S72I 3BQZA 1ZN2A 1A35A 5JLWA 2O3FA 4G9YA 4PJLA 3BY6A 5KK1A 3MKYB 1WJCA 1YRNB 2E2IJ 3KYLA 1GV2A 2Y75A 4PK4A 4A3CJ 3NWTA 5HLHA 1MSEC 4PZJA 5DEQA 3BWGA 2WAQN 1FSHA 4BE2A 2XAHA 1MNDA 4FTHA 1VQ5I 2VT2A 1GDTA 3MQ0A 3RKYA 1OCZH 4GCVA 4BQNA 3GYHX 3JTGA 2WTEA 3OYMA 1JT6A 1IRGA 3QP5A 1DPUA 1ETXA 3MVPA 5EZGA 2G7UA 3JRHA 3I56I 5LHGA 1K6YA 1J2XA 3LSGA 4AVPA 1V5FA 2CUEA 4UHTA 1BW5A 2STTA 1HDPA 4RM3A 5LRRA 3C2BA 3CCLI 4KIGA 3CP2A 2I8DA 2DJNA 1D1CA 3H9QA 3KEQA 4RB0A 1KYZA 3WTYC 4HNVA 3K2ZA 2DYRH 5LEJA 5E3OA 3LA7A 4KN7X 1LKXA 1W36C 1IAWA 4Q47A 2WBMA 1MMGA 4KIFA 4C3JJ 1TC3C 5KCMA 2XPVA 4FISA 2CV2A 2DFHA 3F9KA 4QSHA 4H4KC 5HLGA 5FJ8J 1E0EA 4IHVA 1G4DA 1ACIA 2WAQA 4HV6A 5DCFA 1ZG5A 1VQLI 1B8IA 2LTPA 2QQ8A 1SD6A 1DU0A 4IQJA 1AA7A 4HDUA 2HZDA 4CA0A 1K83J 2Y31A 2HQAA 2XVCA 3L7WA 1VF9A 1XD7A 2DYSH 3L2UA 1YLFA 2DT5A 3CDHA 2ETHA 4UNOA 1I6XA 3I71A 1EKEA 1ON2A 3VYSB 4YFXF 5DM7F 1R58A 1SFOJ 3E97A 4F3QA 3CCEI 3EUKL 4U7DA 2O8KA 3ZQ7A 2L9VA 3DKWA 3OMYA 3UNGC 2TCTA 4YRVA 1WRJA 4KMFA 2LVSA 3GWZA 3R60A 2VB6A 1W7PB 3DWLE 4RB3C 3OIQA 1FTZA 3E5XA 1HW1A 5FKLA 1MSFC 1V55H 3O8GA 3P5JA 2X1EA 3FBIB 1G59A 3I54A 5LGUA 2R7OA 1K78B 3HDDA 4OAZA 4OAYA 1ZRFA 1SC7A 4QWQA 2KDZA 3ZN1A 3W6KB 2CSOA 3HRUA 5B1BH 2NVQJ 2BBYA 3IKVA 2WC2A 2R7QA 2FF4A 3FBNB 1S29A 1WWXA 3V8JA 2H94A 2L4MA 3RDIA 1R5GA 2ISYA 1FIAA 1JUMA 5HODA 4YIFA 1XPXA 3K69A 2YU9J 4ESFA 3A03A 3RPUA 1SD7A 4M3DA 3RPUD 5L3BA 2DDBA 1FLIA 4CDGA 1MZBA 3OR2C 1J09A 2GQQA 4BUPA 4E4HA 1VNDA 3OS0A 3RKXA 2XKOA 3NRVA 3EUHC 3QP6A 2HPIA 3JRDA 4M9SA 5HVQC 4FASD 3CP8A 2VIXA 3SDBA 3HOZJ 2KJCA 5FKOA 1QVUA 4E7KA 5IP6A 2DT6A 4RA2A 2KPMA 1U5TA 3DEUA 4XRSG 2DMTA 2Y0SA 4FE7A 3WTZA 2WWYA 5HLTA 5HLIA 2C6YA 4CGZA 2Z1DA 1PJRA 1LDJA 3TOBA 2GLOA 3BTCA 3BZCA 4XSZF 3DP7A 2VQHA 2ISZA 3S14J 3B02A 2K40A 2M3AA 2LD5A 2P7CB 2ZJRF 3GFJA 5CJ9A 2BW3A 1O7FA 1RESA 3DKYA 2F5DA 3KYDB 2Q8KA 4NC7A 3OV8A 2HNHA 2DCEA 4MNUA 2QSGX 5HNHA 1TW2A 2LREA 3E0JB 1SVMA 1U8BA 3K70D 2HYJA 4KT5C 3ECHA 4AUXA 2RNGA 4XLPF 3C2GA 3PO3J 1P7IA 2NVYJ 1QHGA 1XG1A 1Y6IA 2EV6A 3QU6A 3A4CA 3V8KA 2CW8A 2QKMB 3H0GJ 4GYIA 4A3DJ 3EUAA 5E1XA 1V54H 3L2WA 5IP7J 2W85A 3GLLA 1O3QA 1PUFB 4B48A 1B9NA 2FSWA 2WY7Q 1L0OC 2R7TA 2XB0X 2W84A 5E1ZB 2IS2A 2LBFB 3O6BB 2B9SA 1NG7A 3T1BA 4CUGA 4M6YA 4GGGA 4A0ZA 4Q4ZF 2V1XA 3LNQA 1X2MA 2MA3A 2JSPA 2VKVA 2RQQA 1D1AA 1OPCA 1N77A 1KYWA 2GIZA 2L5QA 3EETA 3F8NA 5F0HA 3ZCOA 5KVRA 5ILVA 2KMUA 1DGWY 2IEKA 2QQ9A 4KFCA 1T0FC 1S9HA 1LJ9A 1SMTA 2CO5A 4A3MJ 1A6IA 3DPUA 4UV9A 4A3GJ 4E7JA 4Z2YA 1ZREA 2EFOA 3CD6I 1PVEA 1DPRA 3O3KA 3WHBA 3RZOJ 1G3WA 5L3FA 3Q5FA 5EZHA 4PGGA 4XRSA 3J81Z 1AKHB 2OQRA 3ZMZA 2O0YA 5JVTA 5D5VB 2GM4A 3H3ZA 3TDUC 1K6OA 4I2OA 2DODA 3VFZA 2W1OA 4ASNA 1MKMA 4BJ5C 2JK3A 3MKWB 2E7WA 2Q2EA 3GTOJ 3L1PA 1X3UA 3VOEA 1QZYA 4FX4A 3FF5A 2CQXA 3TW6A 3FXJA 2H27A 4C3IJ 1HBXG 2FU4A 2K9MA 2KP6A 5CVIA 4DW6A 4HEA2 5E3NA 5AIQA 1MH3A 2RQPA 3PNYA 1D5YA 1LVKA 2FOWA 5GPCA 3OYCA 2CV1A 2F4IA 1VQOI 3LA3A 1RPWA 3TO7A 2ZFUA 1B9MA 2HKXA 2NVTJ 5TRDA 2DA4A 2VKHA 4XLNF 4AD9A 2QF7A 5K5OA 1H0MA 4KYWA 1KQ8A 2FEZA 3I58A 3HUGA 3JRBA 1EJ9A 2E1CA 5J1RA 1XC5A 4IKFA 2JRTA 3GW2A 1FBSA 3H3UA 4QPQA 4HNUA 1T39A 3IRQA 4CCKA 1BBYA 1EH8A 1D8JA 1S3JA 3F6OA 2PMUA 3C3WA 4UB8C 3DBRB 2FUG2 4BBRJ 2EFPA 4N0BA 4U7BA 2DA2A 5FB2A 4I6ZA 1J75A 3BPVA 4IF4A 4IQ4A 2WB1A 2CQQA 1U6GA 1DUXC 4BBSJ 1ZHFA 2XRNA 4QLCU 3A0HC 1OR7C 2YS9A 4OIRF 2HGCA 2XGDA 2J5OA 4OWRB 1LVAA 3BT9A 3ONQA 1KONA 3LSRA 4KICA 4L9JA 1S7AA 4J19A 2RVCA 5K7FA 3R0AA 4WCGA 2PI0A 3G3ZA 3OIOA 4EJUA 3ABLH 2JQ7A 2KJBA 4Q5SF 2M4KA 4BEHB 4IRHA 2HQ5A 2BY0A 1NG6A 4IPAA 1CF7A 3QOPA 2OCCH 4RAZA 5CPRB 1R49A 1BA5A 3VPRA 5A2QZ 3L09A 3HG9A 4WF2A 1ZR2A 1ON1A 2LG4A 3L00A 1U78A 3VWBA 4I0AA 1IUYA 1J5YA 4IXAA 1Q1HA 2ZMEC 4E7SA 3E6MA 4XICA 3WTTC 1XN7A 1YTYA 1MMDA 1QGPA 4CSWA 3VEPA 2LRDA 3DXJF 3QQAA 3VB2A 1RC9A 2K9NA 1X1BA 3LQQA 1XMXA 3BJAA 2JMWA 3L2QA 4B09A 2VL8A 3A01B 5JVGF 2LY9A 3HPGA 2VJ5A 1X3WB 3AAFA 1FYLA 3B73A 3GTJJ 2E71A 3TOAA 4JBAA 5IT3A 2DW4A 4HRIA 3BCBA 1ZGAA 4PSWA 3CMEI 1O3TA 3BROA 4PFOA 2W4SA 3ZOBA 4XQFA 1T98A 1UAAA 1R4MB 1KU9A 2CRGA 4R79A 2GOMA 1EV7A 4GO1A 2XV4S 4EJVA 1ZRDA 3CMYA 3IH3A 3KP7A 4HBLA 4UXNA 5FD5A 4U0YA 2A69F 2OA4A 5D8KB 3HOTA 2OTJI 4P9UA 3BR1A 3NEUA 1JJ8C 4ON0A 1JJ6C 2LF8A 2YUSA 3BG9A 2OZ6A 5FRMA 2X48A 1XGNA 1N78A 4V2GA 4A93J 5E17F 4ZDPA 4CYCB 1KQ9A 3OYLA 3BR0A 4FQGA 1TWHJ 3I4NJ 5LEKA 1MH4A 4BJ6C 3PUBA 5J8FA 2PMZN 1E3OC 2RNJA 1KQ0A 1VQ7I 4KIBA 3NAUA 4XN0A 4U0WA 2AQFA 4Y4RA 2QQAA 1YRNA 3ERED 3WE3A 3HXLA 4X0GA 4LLNA 1HC8A 1PP8F 1OMIA 4DGWB 1W5CC 4AIKA 2JVGA 3HJEA 5JFRA 2Z16A 1X58A 3HL2A 1YHQI 3DPLC 1W5SA 1BI1A 1R5ID 1WJ5A 2LH9A 4TV7A 3LSPA 3FHZA 3WTUC 1D1BA 1GUUA 2K9SA 3S3NA 1A6QA 4IZZA 3KP3A 5ICGA 3FXKA 1W4MA 2GBYA 1EF4A 2E1OA 2VQGA 3QPTA 2VQLA 4D5CA 2LKXA 2NVUB 1X3ZB 3LQRA 5CQGA 5LBQA 2R7VA 1G3SA 2EZHA 2L7FP 4LJZF 3SEZA 5JHUA 4E7IA 1I6HJ 2E19A 2F2EA 3HSFA 4F91B 3J81K 1MGTA 2VOPA 4YFNF 3L2RA 2X1CA 5BS6A 2VONA 2DMPA 2L9SA 4AVZA 1OYYA 5IP9J 2ZB9A 2I10A 2Y48A 1U3EM 3VSLA 5C4XJ 4NBQA 4L5JA 2JA5J 2DXIA 4A6DA 5GADJ 4XK4A 1H89C 2X85A 4N9HA 1Z21A 2ECBA 1R1UA 2HXOA 3PFYA 3LSKA 3SYTA 3TO6A 4M3GA 1VQ4I 5M5YJ 1ERDA 3H92A 4XMYA 2XF6A 4R1HA 2FRHA 2OJED 5GAEJ 3MAJA 1LUJB 2JJ7A 2LNBA 3HIFA 3HEFA 5EEAA 3GBGA 5J1YA 4MTDA 3K1NA 3BR5A 1JKOC 4Y33A 2BY3A 3F8BA 4UV8A 5F6FA 1RR7A 2IGMA 1I50J 4UUSB 2CUJA 3WU1B 1UG2A 1JHHA 2DTZA 2CFXA 3RKWA 3OYIA 1N75A 2EK5A 1Y8QB 2HOTA 1MJBA 1LB2A 2DFFA 1YOVB 2V1UA 4AC0A 1AWCA 1MBJA 2FMYA 3BQYA 2HTSA 1W7PD 3FKIJ 3JRIA 4AIDA 1FSEA 2KKOA 4HF0A 3MN2A 5FROA 3ZMDA 1LE8B 2IS1A 1V5EA 4B47A 2FQ4A 1RRJA 4BNCA 2BYVE 1D3YA 2E1MC 3JTHA 2V4JC 1OYWA 3F8CA 1U9NA 1POGA 2CW7A 1UHWA 3PNVA 4OMZA 4ZC3A 5CKTA 4EJOA 3KZZA 3CCQI 3OSFA 1SFKA 1K7AA 2A6TA 2ZO4A 5H2FC 1WJBA 1IXCA 4XLHA 4AYBA 1Z3YA 5FGMA 3HRMA 2H09A 1UMQA 3QU3A 4BXFA 2L7ZA 2VPRA 2UXNA 1ZK8A 3JRGA 4JX5A 2EV0A 2ZXIA 5IPAA 1UCRA 2QBYA 3G1OA 2F4MB 3UR3C 5E18F 3EYIA 2EBIA 4L0ZB 2Y9YA 1ZARA 1QHHD 3L9FA 3AKZA 1Z9CA 2P5VA 2UXXA 1FYMA 2M7BA 2DA5A 4RLQA 1R00A 2VC0A 1DU6A 1FTTA 1BJAA 1FX7A 4XLFA 4L5IA 3M3YJ 4U0VA 3R4KA 2VUMJ 3I4MJ 3ZN0A 5BMZA 3KIOA 3MWMA 1YX5A 3FXQA 5H20A 3HSRA 2O03A 3I0TA 5D6EA 4DQ2A 3CTAA 3CLQA 1QZZA 2IS6A 3IRRA 2GA2A 1SAXA 3MKZA 4NNJA 2MD5A 3KEYA 1O4XA 3W3CA 4HX8A 4UY8I 3B6AA 2Z33A 1TWCJ 1T38A 4M9XA 1JT0A 2KIQA 1IV8A 2NYXA 4G6TB 1FOXA 2V7FA 2MW8A 1Y8RB 5KAFC 3WG7H 3ZMSA 5M3MJ 2V9PA 3IWFA 1IF1A 3FM5A 3CCJI 2JSCA 3DV8A 4M74A 2CJJA 3ZMVA 3J7AY 3OYHA 1ENHA 4EJWA 2QSHX 3Q0WA 4D7MA 1XSVA 2F5VA 5L3EA 4W1UA 3OS1A 5E79C 2GAUA 5CLSA 4Y3OA 1PUFA 1OCPA 4S0HB 2XF7A 4IHXA 3OL4A 2P6TA 2OU2A 3BDDA 1R7JA 3CF2A 1J0RA 1F1ZA 3CUQA 2LBFA 2NRAC 3E5UA 2IGNA 3Q9VA 2NS8A 5IT9Z 1M1EB 2OF7A 3KEOA 1QVTA 2O6GE 2VQCA 4JYKA 3HKZN 2LY1A 2IA2A 5F1RA 1IN7A 3I5UA 1P9QC 1LDKB 2Q1ZB 3LAPA 5E20A 4II3A 3V8LA 3HOYJ 4JP0A 3DTEA 1T8IA 1XCBA 3HHHA 3TP0A 2KZGA 2BXZA 2JRMA 2R7XA 2IXSA 1Q1VA 5FRNA 3C18A 1APLC 1O57A 1SD5A 4F55A 2AO9A 5AONA 1FZPB 3H3VK 2IRFG 3JREA 2JT1A 1JE8A 2MG4A 2BY1A 2ECCA 4XOPA 1V4RA 1GVDA 4P5OA 3FXMA 2W7NA 5FKNA 2HOSA 3FK7A 2DFIA 3ABUA 1BI0A 1GLNA 1TW3A 3CCMI 1KU7A 1R23A 1B72B 2MC4A 4ZZLA 4BS9A 1ZGJA 4L18B 1QBJA 4ZYAA 4D1QA 1I3QJ 2PG4A 2IS4A 1MBHA 2EV5A 5FLVA 2XPUA 4DYQA 3PJRA 2EILH 1U2WA 4ENJA 3S1MJ 4Y7NJ 1IN8A 2K9QA 4L9VA 2L7MP 2R7WA 3RI4A 1MBEA 1OCTC 2L54A 2X6OA 4LLLA 4DNCA 3BLYA 1BL0A 2ZJ2A 4MLOA 1LPQA 5DTDA 2EFWA 1FJLA 1E3HA 2DTRA 3DTKA 3S2DJ 2G9WA 2RN7A 4M71A 1K4TA 2Z9OA 2HI3A 4JK1X 1HKQA 3ZQLA 2X9DA 4IL6C 2XAQA 2XC7A 3ZGKA 3FHNA 2HEOA 2QM3A 2FA5A 3NARA 1K4SA 4XKBA 5HDKA 1O3RA 1PUEE 2COMA 2HOEA 3F22A 3CCUI 3KCCA 4QIWN 3U1KA 5JHFA 5FKKA 1T2KA 1YITI 1JUPA 2XAUA 1I39A 1S6LA 1BIBA 5ED4A 1X1AA 1HOMA 2EA2A 4FCYA 2HFHA 2DA1A 1MBGA 3E3VA 1WI9A 4LMYA 2QGUA 2XPWA 3WTWC 3LAJA 1OCCH 5K5RA 1X2NA 3HOVJ 1LNWA 2E5NA 1EH6A 5J6XA 2G7HA 3HBLA 5E8GA 3HB9A 3D1NI 3BG7A 2Z5UA 2CW0F 2EZKA 3I9V2 3E5QA 5BPDA 1FPQA 2HYFA 2NS7A 3WE2A 2KISA 1RKTA 1CGPA 2PEXA 3I59B 2I5UA 4Y15A 2W57A 3D0SA 2M4GA 3Q3SA 1D5VA 2OUMA 3A01A 3LWFA 4G7HF 5FLMJ 2H6BA 3KFWX 4FT8A 2QKLB 2WADA 3F72A 1MMSA 1OCRH 4XLEA 2ZFWA 4OINF 3U9GA 1Z91A 2R7FA 3LFUA 2HOAA 2LKPA 5DS9A 2F5CA 1P7JA 3FMQA 3RJPA 2ZXJA 4DZPA 2Y9ZA 1YX3A 5HS7A 1ZH5A 5TGTA 3DCFA 3FKJA 2NOJB 4X6AJ 1FMWA 5DCMB 4HOBA 4XN3A 5IY5H 1SVLA 2ZSIB 3M1EA 1XGMA 2GIVA 3IC7A 4M3BA 1S5LC 2A6HF 2OC6A 4G8XA 5EDNA 1VQ9I 2OQGA 4YFKF 3K6GA 3QPSA 4GYGA 4NC8A 3TO9A 4Y52J 1G8XA 5J47A 4F93B 1T95A 4CYCA 3NQOA 3QAHA 3S32A 1ULYA 2JTVA 3K4MA 1R1VA 3H5RA 3HRSA 2WV1A 3LSJA 1GHCA 2E2JJ 3GXOA 4G7ZF 1BOBA 4XKVA 2OCEA 1YYVA 1NH3A 2KIFA 4BDYA 4O3MA 2IGKA 5LHHA 1UFMA 4HZFA 5IT9K 2FNAA 2R7ZJ 2MSYA 1Y0NA 4AIHA 1X19A 2HVRA 3ABKH 4KISA 2RGVA 4UVAA 9ANTA 1J9IA 1HCRA 3VSKA 3HOUJ 5J3LA 2RC4A 2LYCA 3DEEA 4MEXF 2K5CA 4A12A 4OIOF 5BOXA 4XR6A 1IN6A 1E2XA 2VT3A 2DMNA 4XLAA 2DQLA 5EG0B 2HWVA 4B3XA 4HNTA 2Y0MA 3OIPA 3P9IA 1JGGA 3OYAA 3S3OA 2WAFA 4IRIA 4RM2A 4H0EA 5GTIC 3DU5A 1OJLA 3PM1A 1E3PA 1IN4A 1OCOH 3OWTA 4JOMA 2QSFX 3ZXSA 2L2OA 4B44A 5EF6A 1BM9A 4CCLA 4KMUX 3RYRA 2IAIA 1QQIA 2ELJA 4LK1F 3MZ8A 1WQ2A 2NXNB 2JUCA 3K4NA 1G2HA 2EQRA 2FOKA 3P9KA 3K1MA 1TBXA 4M9ZA 4B3AA 1TP4A 2EFNA 3R6SA 2W25A 3LSMA 4BACA 4WXDA 4C30A 1ZTRA 3GLXA 3DLLF 4JX6A 5AIPA 4AWXB 3KETA 2DI3A 3IUOA 3ZR8X 1X4PA 3KZYA 4KJZA 5F64A 2ELHA 4XKWA 4LOCA 3C2HA 3IWZA 2ESHA 2ZMEB 4MIMA 3O8HA 2DO7A 3L2VA 3KX2A 1BC7C 2NOGA 5LGNA 1TWFJ 2JA6J 2XASA 1I1GA 3M1CA 2A68F 3DKXA 1A36A 1ONVA 4PGHA 3TEDA 1IDYA 2PJPA 1T08B 3VYRB 1W0TA 3HOXJ 1F4KA 1FEXA 2NAZA 3GFLA 3JRFA 4G94A 3BCAA 2PN6A 2XRLA 3GTLJ 1MMNA 3BPXA 4ITVA 5FFZA 5IOZA 1LE8A 1QPIA 1ITYA 4E7HA 4BHBA 1Z7UA 1O7LA 2BGCA 3K4LA 1XGSA 1F43A 2LP0A 3H5NA 3A1YA 3CMMA 1FP2A 1UHMA 4UVCA 5J4YA 2Q0OA 2MLGA 3I55I 1LEBA 1IG7A 1K79A 1O3SA 3ULQB 3VYTB 4ENMA 2K85A 3I4PA 4P96A 5GPAA 2M5WA 2QQBA 2EIMH 3WG9A 3CCSI 1LEAA 3OL3A 4PDKA 1ZELA 4I09A 4P1WA 1TWGJ 3AG3H 4NQWB 3ZMTA 1SFXA 2M1BA 2KQRA 3AL0C 2F5EA 2RV8A 1ZLKA 2BZTA 2DBBA 1TT0A 3ECOA 1USSA 3CDLA 5HDGA 2E34A 2H6CA 4PJJA 2CFOA 3SZGA
chains in the Genus database with same CATH topology
2DN0A 2ELKA 2CUEA 2ID3A 2R5ZB 1Y1WJ 1BW5A 1TWAJ 1HDPA 3BG5A 2OPTA 4NDLA 4AC0A 5M5WJ 3C2BA 1MBJA 2DJNA 2MGQA 5EYRA 3BQYA 4HNVA 3JRIA 3FKIJ 5E3OA 3HOWJ 2KT0A 4C3JJ 1TC3C 2XPVA 3MN2A 1LE8B 4FISA 2FQ4A 2LLKA 4QSHA 5FJ8J 2FX0A 4IHVA 1B8IA 1U9NA 2G0EA 5F27A 2LTPA 1POGA 1DU0A 3IH4A 5M5XJ 4FE4A 3OSFA 2HDDA 1K83J 2Y31A 3WHCA 1VF9A 1UMQA 3F0CA 2L7ZA 5K7ZA 2VPRA 3G1LA 3JRGA 1ZK8A 3S17J 4JX5A 3CQZJ 5IPAA 3GTGJ 1SFOJ 3G1OA 2O8KA 5F0FA 1MBKA 5C4JJ 2TCTA 3FK6A 2EBIA 2LVSA 2Y9YA 1JKRC 3Q0UA 3S16J 1FTZA 4I76A 1RKWA 4A3IJ 2DA5A 5FKLA 1MSFC 3O8GA 5BNGA 1DU6A 1FTTA 3HDDA 5F1JA 3S15J 3BG3A 2KDZA 1LFBA 3M3YJ 2NVQJ 4JX4A 3FISA 1T56A 1B8IB 2VUMJ 2CUFA 3I4MJ 3M4OJ 2DA3A 2WB1N 1W0UA 1NK2P 2R0QC 3CCYA 1FEXA 1FIAA 1JUMA 3S2HJ 5HODA 2Y30A 3BR3A 1ETWA 1O4XA 3B6AA 2YU9J 2R5YA 3S1RJ 1TWCJ 3A03A 1H88C 4M3DA 4UUSA 2H1KA 1BW6A 4M6VA 2D5VA 1JT0A 2W48A 1ZGWA 5C44J 1H8AC 1VNDA 1MNMC 2MW8A 4A3JJ 4A3KJ 5M3MJ 3JRDA 3HOZJ 3TW7A 2CJJA 5FKOA 1QVUA 5IP6A 2TRTA 4M3EA 2O9LA 1ENHA 1Z77A 4XRSG 2DMTA 4FE7A 4A3EJ 1R9TJ 3Q0WA 4D7MA 4DYCA 4D5FA 3GTQJ 4W1UA 5C3EJ 3SFIA 1PUFA 1OCPA 4S0HB 2GLOA 3BTCA 4IHXA 1JUSA 4RBOA 1JTYA 3JRCA 1WGXA 3S14J 2K40A 2LD5A 3E7LA 5EGOA 2EZLA 2NS8A 1RESA 2R5YB 2OF7A 1QVTA 1WPKA 4JYKA 2FD5A 2CU7A 5J1UA 3HKZN 1IRZA 2L0KA 5IYCJ 1WI3A 4DYRA 1U8BA 4A3LJ 3HOYJ 4JP0A 3TP0A 2HYJA 4AUXA 3PO3J 1Q1VA 1APLC 1P7IA 1SANA 2NVYJ 1XG1A 2AO9A 3H3VK 3JREA 1XS9A 5FKMA 3H0GJ 4A3DJ 2MG4A 2ECCA 5IP7J 1S7EA 1PUFB 1GVDA 2HOSA 5FKNA 3HGYA 1IC8A 3FK7A 1B72B 1VI0A 1HF0A 2XB0X 2B63J 5F0CA 4L5EA 2DA7A 5EGOB 1I3QJ 1MBHA 1IUFA 3LNQA 1X2MA 5FLVA 2XPUA 4DYQA 4V2FA 2VKVA 3S1NJ 3HGGA 3S1MJ 4Y7NJ 3G1MA 5F0HA 2K9QA 2LFBA 4IEJA 2L7MP 1WH5A 2IEKA 1MBEA 2ME6A 1OCTC 2X6OA 4A3MJ 1A6IA 1BL0A 2M8GX 4MLOA 5DTDA 2IBDA 1FJLA 4A3GJ 2DA6A 1IJWC 1JKPC 4MFEA 3S2DJ 3WHBA 3RZOJ 1NTCA 4EEFG 4UUTA 5EZHA 2HI3A 1OFCX 4M3FA 3ZQLA 4BXXJ 4XRSA 1F36A 1AKHB 1FIPA 2E2HJ 3ZQFA 2X9DA 4BY1J 4XIDA 1Y1VJ 2GM4A 2VKEA 2JN6A 3GTOJ 2JK3A 3NARA 3L1PA 4W97A 1Z0XA 2CQXA 3TW6A 3OSGA 4C3IJ 4QIWN 4XRMA 5FKKA 4MFDA 4DW6A 1JUPA 5E3NA 1MH3A 1WH7A 2DMQA 3DEWA 4DZJA 1D5YA 1HOMA 4FCYA 5GPCA 2DA1A 1MBGA 1ZKGA 5F04A 2XPWA 4A3FJ 1RPWA 3OOUA 1ETQA 1X2NA 3HOVJ 2NVTJ 2DA4A 3BTLA 2LR8A 3HBLA 2QF7A 3ZQIA 3HB9A 3D1NI 2ME0A 3JRBA 3RZDJ 3MKLA 1ETOA 4BKXA 1XC5A 2EZKA 5J1RA 2M2EA 2M9HA 2NS7A 1RKTA 4BBRJ 3ZQGA 2DA2A 4I6ZA 1A5JA 2CQQA 3Q3SA 4BBSJ 1U9OA 1CQTA 2YS9A 3A01A 1B72A 1IGNA 3ZQHA 5IYDJ 2XGDA 5FLMJ 3GTKJ 1BJZA 3BT9A 3LSRA 2NVXJ 1ETKA 1UHSA 5E3LA 4J19A 3ZQCA 2FJ1A 5K7FA 2P81A 2HOAA 4QTRA 5DS9A 3OIOA 4C2MJ 3UKGA 1P7JA 2XGCA 4DZPA 2Y9ZA 2HQ5A 3A02A 3DCFA 1K61A 4X6AJ 2HXIA 1BA5A 1ETYA 3LOCA 3VPRA 1JKQC 4B4CA 2QCOA 3SJMA 4M3BA 1ORKA 1ZR2A 3RKQA 1U78A 5EDNA 5EG0A 4AYBN 3B6CA 3QPSA 2R93J 4XICA 4Y52J 3K2AA 4B1RA 1AKHA 2AHQA 2R92J 1ZR4A 2N8GA 3QQAA 2K9NA 2XB5A 1VFCA 4CYCA 4X1EA 2JMWA 3A01B 2M34A 2LY9A 4C3HJ 3IV5A 2JWTA 2WV1A 3LSJA 2E2JJ 2RAEA 3GTJJ 3Q0VA 3FIWA 2EH3A 4D7NA 4GFBA 2H8RA 3ZOBA 2R7ZJ 2MSYA 5GP9A 2CRGA 1GT0C 3BR6A 9ANTA 1HCRA 3HOUJ 1WCMJ 5J3LA 3CMYA 3IH3A 1HDDC 2DMNA 5EG0B 3BR1A 1JJ8C 1JJ6C 2YUSA 1JGGA 3JR9A 3BG9A 5JLXA 4A69C 2X48A 4G12A 4V2GA 4A93J 1OJLA 3PM1A 4MO7A 4CYCB 2EZIA 1ETVA 3BR0A 5F08A 1TWHJ 3I4NJ 5EF6A 1MH4A 1E3OC 2IAIA 2PMZN 2ID6A 3NAUA 1G2HA 1YRNA 2EQRA 2L9RA 1ZQ3P 2Y0SN 4B3AA 3GTMJ 3PO2J 2COBA 1NK3P 3RQIA 1ZTRA 3BTJA 3W6VA 4JX6A 4BY7J 1X58A 5K7HA 1IV6A 2Y2ZA 2LK2A 3LSPA 1GUUA 4LOCA 2K9SA 3IH2A 3HM5A 2M0CA 3QPLA 3O8HA 4MIMA 1EF4A 2GBYA 1AU7A 2E1OA 1HLVA 1IDZA 4D5CA 2LKXA 1RETA 4IHYA 2NOGA 1MBFA 1TWFJ 4IHWA 2JA6J 2EZHA 2L7FP 1I6HJ 2E19A 2R5ZA 3SDGA 3TEDA 5IYBJ 1IDYA 1T33A 2DMPA 2JA8J 2XGEA 1W0TA 4ABZA 3BR2A 5E3MA 5IP9J 3JRAA 2ZB9A 3HOXJ 2I10A 1JTXA 2O7OA 3JRFA 5M3FJ 5C4XJ 5IOYA 3BTIA 2JA7J 3BQZA 2JA5J 5JLWA 3TP3A 1GV5A 2XRLA 3GTLJ 4XK4A 1H89C 5IOZA 1LE8A 1QPIA 1YRNB 1ITYA 2E2IJ 1GV2A 2ECBA 1F43A 2LP0A 2HXOA 4A3CJ 1MSEC 4M3GA 3GTPJ 3K7AJ 5M5YJ 1LFUP 2WAQN 4FTHA 2XSDC 1IG7A 1GDTA 2VI6A 1QRYA 2JJ7A 3HEFA 5EEAA 2DMUA 5GPAA 3GBGA 5J1YA 1AHDP 1JT6A 3BR5A 1JKOC 1TWGJ 4RDUA 1ETXA 1RR7A 4A3BJ 3MVPA 5EZGA 1I50J 4UUSB 3JRHA 1UG2A 2DTZA 3S1QJ 3CDLA 3LSGA 2HOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN0 A;  2ELK A;  2CUE A;  2ID3 A;  2R5Z B;  1Y1W J;  1BW5 A;  1TWA J;  1HDP A;  3BG5 A;  2OPT A;  4NDL A;  4AC0 A;  5M5W J;  3C2B A;  1MBJ A;  2DJN A;  2MGQ A;  5EYR A;  3BQY A;  4HNV A;  3JRI A;  3FKI J;  5E3O A;  3HOW J;  2KT0 A;  4C3J J;  1TC3 C;  2XPV A;  3MN2 A;  1LE8 B;  4FIS A;  2FQ4 A;  2LLK A;  4QSH A;  5FJ8 J;  2FX0 A;  4IHV A;  1B8I A;  1U9N A;  2G0E A;  5F27 A;  2LTP A;  1POG A;  1DU0 A;  3IH4 A;  5M5X J;  4FE4 A;  3OSF A;  2HDD A;  1K83 J;  2Y31 A;  3WHC A;  1VF9 A;  1UMQ A;  3F0C A;  2L7Z A;  5K7Z A;  2VPR A;  3G1L A;  3JRG A;  1ZK8 A;  3S17 J;  4JX5 A;  3CQZ J;  5IPA A;  3GTG J;  1SFO J;  3G1O A;  2O8K A;  5F0F A;  1MBK A;  5C4J J;  2TCT A;  3FK6 A;  2EBI A;  2LVS A;  2Y9Y A;  1JKR C;  3Q0U A;  3S16 J;  1FTZ A;  4I76 A;  1RKW A;  4A3I J;  2DA5 A;  5FKL A;  1MSF C;  3O8G A;  5BNG A;  1DU6 A;  1FTT A;  3HDD A;  5F1J A;  3S15 J;  3BG3 A;  2KDZ A;  1LFB A;  3M3Y J;  2NVQ J;  4JX4 A;  3FIS A;  1T56 A;  1B8I B;  2VUM J;  2CUF A;  3I4M J;  3M4O J;  2DA3 A;  2WB1 N;  1W0U A;  1NK2 P;  2R0Q C;  3CCY A;  1FEX A;  1FIA A;  1JUM A;  3S2H J;  5HOD A;  2Y30 A;  3BR3 A;  1ETW A;  1O4X A;  3B6A A;  2YU9 J;  2R5Y A;  3S1R J;  1TWC J;  3A03 A;  1H88 C;  4M3D A;  4UUS A;  2H1K A;  1BW6 A;  4M6V A;  2D5V A;  1JT0 A;  2W48 A;  1ZGW A;  5C44 J;  1H8A C;  1VND A;  1MNM C;  2MW8 A;  4A3J J;  4A3K J;  5M3M J;  3JRD A;  3HOZ J;  3TW7 A;  2CJJ A;  5FKO A;  1QVU A;  5IP6 A;  2TRT A;  4M3E A;  2O9L A;  1ENH A;  1Z77 A;  4XRS G;  2DMT A;  4FE7 A;  4A3E J;  1R9T J;  3Q0W A;  4D7M A;  4DYC A;  4D5F A;  3GTQ J;  4W1U A;  5C3E J;  3SFI A;  1PUF A;  1OCP A;  4S0H B;  2GLO A;  3BTC A;  4IHX A;  1JUS A;  4RBO A;  1JTY A;  3JRC A;  1WGX A;  3S14 J;  2K40 A;  2LD5 A;  3E7L A;  5EGO A;  2EZL A;  2NS8 A;  1RES A;  2R5Y B;  2OF7 A;  1QVT A;  1WPK A;  4JYK A;  2FD5 A;  2CU7 A;  5J1U A;  3HKZ N;  1IRZ A;  2L0K A;  5IYC J;  1WI3 A;  4DYR A;  1U8B A;  4A3L J;  3HOY J;  4JP0 A;  3TP0 A;  2HYJ A;  4AUX A;  3PO3 J;  1Q1V A;  1APL C;  1P7I A;  1SAN A;  2NVY J;  1XG1 A;  2AO9 A;  3H3V K;  3JRE A;  1XS9 A;  5FKM A;  3H0G J;  4A3D J;  2MG4 A;  2ECC A;  5IP7 J;  1S7E A;  1PUF B;  1GVD A;  2HOS A;  5FKN A;  3HGY A;  1IC8 A;  3FK7 A;  1B72 B;  1VI0 A;  1HF0 A;  2XB0 X;  2B63 J;  5F0C A;  4L5E A;  2DA7 A;  5EGO B;  1I3Q J;  1MBH A;  1IUF A;  3LNQ A;  1X2M A;  5FLV A;  2XPU A;  4DYQ A;  4V2F A;  2VKV A;  3S1N J;  3HGG A;  3S1M J;  4Y7N J;  3G1M A;  5F0H A;  2K9Q A;  2LFB A;  4IEJ A;  2L7M P;  1WH5 A;  2IEK A;  1MBE A;  2ME6 A;  1OCT C;  2X6O A;  4A3M J;  1A6I A;  1BL0 A;  2M8G X;  4MLO A;  5DTD A;  2IBD A;  1FJL A;  4A3G J;  2DA6 A;  1IJW C;  1JKP C;  4MFE A;  3S2D J;  3WHB A;  3RZO J;  1NTC A;  4EEF G;  4UUT A;  5EZH A;  2HI3 A;  1OFC X;  4M3F A;  3ZQL A;  4BXX J;  4XRS A;  1F36 A;  1AKH B;  1FIP A;  2E2H J;  3ZQF A;  2X9D A;  4BY1 J;  4XID A;  1Y1V J;  2GM4 A;  2VKE A;  2JN6 A;  3GTO J;  2JK3 A;  3NAR A;  3L1P A;  4W97 A;  1Z0X A;  2CQX A;  3TW6 A;  3OSG A;  4C3I J;  4QIW N;  4XRM A;  5FKK A;  4MFD A;  4DW6 A;  1JUP A;  5E3N A;  1MH3 A;  1WH7 A;  2DMQ A;  3DEW A;  4DZJ A;  1D5Y A;  1HOM A;  4FCY A;  5GPC A;  2DA1 A;  1MBG A;  1ZKG A;  5F04 A;  2XPW A;  4A3F J;  1RPW A;  3OOU A;  1ETQ A;  1X2N A;  3HOV J;  2NVT J;  2DA4 A;  3BTL A;  2LR8 A;  3HBL A;  2QF7 A;  3ZQI A;  3HB9 A;  3D1N I;  2ME0 A;  3JRB A;  3RZD J;  3MKL A;  1ETO A;  4BKX A;  1XC5 A;  2EZK A;  5J1R A;  2M2E A;  2M9H A;  2NS7 A;  1RKT A;  4BBR J;  3ZQG A;  2DA2 A;  4I6Z A;  1A5J A;  2CQQ A;  3Q3S A;  4BBS J;  1U9O A;  1CQT A;  2YS9 A;  3A01 A;  1B72 A;  1IGN A;  3ZQH A;  5IYD J;  2XGD A;  5FLM J;  3GTK J;  1BJZ A;  3BT9 A;  3LSR A;  2NVX J;  1ETK A;  1UHS A;  5E3L A;  4J19 A;  3ZQC A;  2FJ1 A;  5K7F A;  2P81 A;  2HOA A;  4QTR A;  5DS9 A;  3OIO A;  4C2M J;  3UKG A;  1P7J A;  2XGC A;  4DZP A;  2Y9Z A;  2HQ5 A;  3A02 A;  3DCF A;  1K61 A;  4X6A J;  2HXI A;  1BA5 A;  1ETY A;  3LOC A;  3VPR A;  1JKQ C;  4B4C A;  2QCO A;  3SJM A;  4M3B A;  1ORK A;  1ZR2 A;  3RKQ A;  1U78 A;  5EDN A;  5EG0 A;  4AYB N;  3B6C A;  3QPS A;  2R93 J;  4XIC A;  4Y52 J;  3K2A A;  4B1R A;  1AKH A;  2AHQ A;  2R92 J;  1ZR4 A;  2N8G A;  3QQA A;  2K9N A;  2XB5 A;  1VFC A;  4CYC A;  4X1E A;  2JMW A;  3A01 B;  2M34 A;  2LY9 A;  4C3H J;  3IV5 A;  2JWT A;  2WV1 A;  3LSJ A;  2E2J J;  2RAE A;  3GTJ J;  3Q0V A;  3FIW A;  2EH3 A;  4D7N A;  4GFB A;  2H8R A;  3ZOB A;  2R7Z J;  2MSY A;  5GP9 A;  2CRG A;  1GT0 C;  3BR6 A;  9ANT A;  1HCR A;  3HOU J;  1WCM J;  5J3L A;  3CMY A;  3IH3 A;  1HDD C;  2DMN A;  5EG0 B;  3BR1 A;  1JJ8 C;  1JJ6 C;  2YUS A;  1JGG A;  3JR9 A;  3BG9 A;  5JLX A;  4A69 C;  2X48 A;  4G12 A;  4V2G A;  4A93 J;  1OJL A;  3PM1 A;  4MO7 A;  4CYC B;  2EZI A;  1ETV A;  3BR0 A;  5F08 A;  1TWH J;  3I4N J;  5EF6 A;  1MH4 A;  1E3O C;  2IAI A;  2PMZ N;  2ID6 A;  3NAU A;  1G2H A;  1YRN A;  2EQR A;  2L9R A;  1ZQ3 P;  2Y0S N;  4B3A A;  3GTM J;  3PO2 J;  2COB A;  1NK3 P;  3RQI A;  1ZTR A;  3BTJ A;  3W6V A;  4JX6 A;  4BY7 J;  1X58 A;  5K7H A;  1IV6 A;  2Y2Z A;  2LK2 A;  3LSP A;  1GUU A;  4LOC A;  2K9S A;  3IH2 A;  3HM5 A;  2M0C A;  3QPL A;  3O8H A;  4MIM A;  1EF4 A;  2GBY A;  1AU7 A;  2E1O A;  1HLV A;  1IDZ A;  4D5C A;  2LKX A;  1RET A;  4IHY A;  2NOG A;  1MBF A;  1TWF J;  4IHW A;  2JA6 J;  2EZH A;  2L7F P;  1I6H J;  2E19 A;  2R5Z A;  3SDG A;  3TED A;  5IYB J;  1IDY A;  1T33 A;  2DMP A;  2JA8 J;  2XGE A;  1W0T A;  4ABZ A;  3BR2 A;  5E3M A;  5IP9 J;  3JRA A;  2ZB9 A;  3HOX J;  2I10 A;  1JTX A;  2O7O A;  3JRF A;  5M3F J;  5C4X J;  5IOY A;  3BTI A;  2JA7 J;  3BQZ A;  2JA5 J;  5JLW A;  3TP3 A;  1GV5 A;  2XRL A;  3GTL J;  4XK4 A;  1H89 C;  5IOZ A;  1LE8 A;  1QPI A;  1YRN B;  1ITY A;  2E2I J;  1GV2 A;  2ECB A;  1F43 A;  2LP0 A;  2HXO A;  4A3C J;  1MSE C;  4M3G A;  3GTP J;  3K7A J;  5M5Y J;  1LFU P;  2WAQ N;  4FTH A;  2XSD C;  1IG7 A;  1GDT A;  2VI6 A;  1QRY A;  2JJ7 A;  3HEF A;  5EEA A;  2DMU A;  5GPA A;  3GBG A;  5J1Y A;  1AHD P;  1JT6 A;  3BR5 A;  1JKO C;  1TWG J;  4RDU A;  1ETX A;  1RR7 A;  4A3B J;  3MVP A;  5EZG A;  1I50 J;  4UUS B;  3JRH A;  1UG2 A;  2DTZ A;  3S1Q J;  3CDL A;  3LSG A;  2HOT A; 
#chains in the Genus database with same CATH topology
 2DN0 A;  2ELK A;  4WXH A;  4E70 A;  2R5Z B;  1Y1W J;  2HZT A;  3BG5 A;  5M5W J;  4ZDL A;  1V3F A;  2MGQ A;  5EYR A;  2M30 A;  1FMV A;  4IO9 F;  1QU3 A;  3PIP F;  5KHD A;  4AU7 A;  3W2W A;  2K7L A;  3RIR A;  4G6Q A;  4I01 A;  3JCU C;  4A0Y A;  2PJR B;  1VTN C;  4MEY F;  2W82 A;  2ZSH B;  2QVO A;  2A5Y B;  2FX0 A;  3PFI A;  1HW5 A;  3CC4 I;  3K0L A;  2DU9 A;  1IRF A;  1VQK I;  2G0E A;  5F27 A;  1X4O A;  2IA1 A;  2BV6 A;  2JZY A;  3ZMU A;  3BZK A;  2OBP A;  1HQC A;  2ESN A;  1D0Z A;  3HC7 A;  2HDD A;  5TIS C;  1X1C A;  3G73 A;  3WHC A;  2X1D A;  4IRG A;  4ZYG A;  2CYY A;  2QZ8 A;  5E8I A;  2Z2S B;  2DAO A;  1KA8 A;  3F0C A;  2VC1 A;  3G1L A;  1QPM A;  3S17 J;  1WJA A;  5FD6 A;  4A6E A;  2ZJQ F;  3CCR I;  1MJA A;  3RSN A;  5F0F A;  1MBK A;  1TNT A;  3DLA A;  2QLZ A;  4BGD A;  2KRC A;  4PJN A;  3DTI A;  4ANJ A;  3LMM A;  4EV0 A;  3PIO F;  3G2B A;  2KZV A;  5CVU A;  1JI8 A;  3Q0U A;  5B5E C;  4I76 A;  3ASN H;  1YW9 A;  1U5T C;  1W36 D;  4HF2 A;  5BNG A;  4NC6 A;  4ZDO A;  5CVR A;  4BHC A;  4Y17 A;  3S15 J;  3MZY A;  3SZT A;  2HTJ A;  1HST A;  4HST A;  3D5L A;  1LFB A;  2O8X A;  1FBU A;  1T56 A;  2CUF A;  2DA3 A;  3HHG A;  3HZJ A;  3BOQ A;  3F6V A;  4LGW A;  5CQE A;  3CCV I;  1HSJ A;  1YIJ I;  1LDD A;  2Y69 H;  2FML A;  3GVA A;  4IHS A;  4KIT B;  1DQU A;  1VQ8 I;  2CS3 A;  1ODD A;  1H88 C;  3D5R C;  2VOD A;  1BW6 A;  4M6V A;  2D5V A;  2W48 A;  3CDI A;  1FYK A;  1R36 A;  1ZGW A;  3IAM 2;  2X6W A;  1G6N A;  1H8A C;  2CGP A;  2B7E A;  1MNM C;  2KLO A;  4C9Y A;  3H36 A;  4A3K J;  1YJN I;  4NHJ A;  3K70 C;  3CUO A;  2V26 A;  2Z99 A;  2PMZ A;  2P4W A;  2V9V A;  4BQO A;  2EB7 A;  3CES A;  2O9L A;  5DM6 F;  1WZ2 A;  2EJR A;  2VBZ A;  4A3E J;  1YS6 A;  2JUG A;  4XBF A;  2E1M B;  1DGR M;  3IAS 2;  4D5F A;  3GTQ J;  4ZYE A;  4BH9 A;  2X6X A;  1JUS A;  2W24 A;  1JTY A;  2P5K A;  1WGX A;  3K4J A;  5B1A H;  3WGI A;  1QNT A;  5GAG J;  1IN5 A;  3C1D A;  5JR3 A;  5H6Q A;  4HQM A;  3P7N A;  2JPC A;  1VQN I;  2EZL A;  1DP3 A;  2BVM A;  4LB6 B;  1Z7L A;  2R5Y B;  4RB2 C;  4RAY A;  2KHM A;  2CQN A;  1YW7 A;  2LDU A;  3ABT A;  3CZ6 A;  1XDU A;  4DBQ A;  1KGS A;  5KAI C;  3ISP A;  3BC8 A;  2FD5 A;  2K86 A;  4CHU A;  2L0K A;  5IYC J;  1I5Z A;  3M8F A;  2D2W A;  4YEL A;  4A3L J;  1TLH B;  3EUH A;  1YO5 C;  2DK8 A;  3OYG A;  1W7P A;  3LST A;  1P4A A;  1LQ1 A;  3RCO A;  3CJN A;  3CJQ B;  4XOR A;  4OOI A;  2X0L A;  3DF8 A;  3VDX A;  3LFK A;  4CXF A;  2PMH A;  1TQM A;  1ZLJ A;  5D8L B;  1XS9 A;  1K78 A;  3N05 A;  3PUF A;  4N4O B;  4IOC F;  1SFE A;  2FBK A;  1R6R A;  4BHP A;  3W2A A;  1WFX A;  1XSX A;  1QZE A;  2IW5 A;  2K4B A;  3HGY A;  4HA8 A;  2K02 A;  5L3C A;  2CV0 A;  1VI0 A;  3LSI A;  1HF0 A;  3ERM A;  2K3F A;  2B63 J;  4C2T A;  3BP8 A;  4L5E A;  1D8K A;  1X1D A;  2DA7 A;  5BQT A;  3KP5 A;  5EGO B;  1PYV A;  1YFH A;  1Z3X A;  2KFD A;  1ZG3 A;  4BQQ A;  1HXD A;  3J7Y J;  3NWS A;  3FM3 A;  4V2F A;  3S1N J;  4PSX A;  5TJJ A;  3GZ5 A;  3QOD A;  1B1B A;  3IKT A;  2LFB A;  1UEL B;  4IEJ A;  3J7Z I;  3R61 A;  2ME6 A;  3V7R A;  5ICF A;  4ESJ A;  1MDM B;  1JGS A;  2M8G X;  2IBD A;  2IPQ X;  3QYF A;  5LLQ A;  1IJW C;  3K9T A;  4MFE A;  5ICC A;  5LFA A;  1BN5 A;  1NTC A;  3H0D A;  1XTA A;  4EEF G;  4UB6 C;  1SAU A;  1OFC X;  3HOS A;  1RR8 C;  4BXX J;  2OZU A;  3GZ6 A;  1H9G A;  1FIP A;  4OU0 A;  3I59 A;  4XID A;  4RAG A;  3HTU A;  2JN6 A;  5EEG A;  2L01 A;  1KU3 A;  3J80 Z;  4Z6Y A;  3JW4 A;  1UG0 A;  2HDC A;  2ZNY A;  3COA C;  5DUI A;  1YW8 A;  4C2U A;  2B0L A;  1B59 A;  3CJT B;  4M6X A;  2DDA A;  3F8M A;  4LG0 B;  2DMQ A;  2ZCW A;  2HR3 A;  3DEW A;  2XUB A;  4BU2 A;  2RRE A;  3JSO A;  4MHG A;  3U2R A;  2BOL A;  1ZKG A;  3OOU A;  3JAM Z;  1REP C;  5DCM A;  3DQV C;  1T0F A;  3BTL A;  4HG2 A;  2A07 F;  4XON A;  5J8C A;  2ZXW H;  3FX3 A;  2R7D A;  3RZD J;  2DPD A;  2UWM A;  3MKL A;  4DIQ A;  1ETO A;  4BKX A;  3TGN A;  3K1P A;  2M2E A;  3SQN A;  4HW0 A;  2NNN A;  2UV1 A;  2P8T A;  3M7G A;  3ZQG A;  2P0W A;  2EWN A;  3OY9 A;  4BL0 B;  4HQE A;  1TNS A;  1U9O A;  2YR2 A;  1CQT A;  1QO0 D;  2LOO A;  2XAG A;  1YS7 A;  3GZN B;  6PAX A;  1R4N B;  5D5U B;  4YEJ A;  1BJZ A;  4G6D A;  4LLG F;  1P92 A;  2NVX J;  4D9J A;  4IOA F;  1ETK A;  1UHS A;  2JPB A;  3I3L A;  4YII A;  2FJ1 A;  5E3L A;  2R7S A;  2IA0 A;  2MD0 A;  4C2M J;  3FMS A;  3A02 A;  3QPH A;  3OYD A;  2WV0 A;  1SEU A;  4DOZ A;  4LD5 A;  3WOD F;  1K61 A;  2E35 A;  3LOC A;  2WAE A;  2CMP A;  3LSH A;  3WTX C;  4LB5 A;  3DPT A;  5CYV A;  4B4C A;  2QCO A;  3PSF A;  3JSP A;  4AM3 A;  4L0Y B;  3RKQ A;  3ASO H;  5EG0 A;  2YX7 A;  1R1T A;  2R4G A;  3B6C A;  2R93 J;  3K2A A;  3VOD A;  4B1R A;  2LC2 A;  4P9F A;  3GX4 X;  1AKH A;  3E1S A;  2R92 J;  1D0Y A;  1N25 A;  4I0B A;  1RUN A;  1LFP A;  5LGT A;  2ZNZ A;  3C7J A;  2WY8 Q;  2A61 A;  1OR7 A;  1YQA A;  2HU9 A;  4CCJ A;  4C3H J;  3IV5 A;  2P5L C;  4II2 A;  1SVO A;  1TT5 B;  4U87 A;  2RAE A;  5HOO A;  2J5P A;  3TDZ C;  1BR2 A;  3RTR A;  4O5V A;  3E6C C;  2DFE A;  2BVL A;  4D7N A;  3F23 A;  1YJW I;  1UZC A;  3F8F A;  3HKZ A;  1HKS A;  1S8N A;  5GP9 A;  3ZRG A;  2MLK A;  2K3P A;  2XDV A;  3BR6 A;  1WCM J;  2STW A;  4GXO A;  4ZYH A;  1J7K A;  2CH0 A;  2E60 A;  2QA4 I;  2YPR A;  1HDD C;  2BEO A;  1EH7 A;  3FZV A;  3U1D A;  3KE2 A;  3J7A O;  3REO A;  4I7H A;  3RPQ A;  2ZME A;  5GTH C;  2HQN A;  3JR9 A;  3HYI A;  5JLX A;  3KP2 A;  3T5X A;  4A69 C;  4EM1 A;  5B3S H;  1VQM I;  2ZXH A;  1SD4 A;  3RQ4 A;  4FHT A;  2NNY A;  4MO7 A;  5DD8 A;  4EVI A;  4EAT A;  4N9I A;  1E17 A;  2EZI A;  2ACJ A;  3BJO A;  3WGH A;  5F08 A;  3CO7 C;  3AG4 H;  4A5N A;  4YG2 F;  3KLN A;  3FXO A;  2DPU A;  3QWL A;  2V6E A;  1RIO H;  5ERI A;  5D4S A;  2ID6 A;  2F48 A;  1IO2 A;  3KP6 A;  3PNT A;  2M8E A;  4XKC A;  2M45 A;  3A0B C;  4WXC A;  3GFM A;  2L9R A;  2Y0S N;  3GTM J;  4XSX F;  2COB A;  1NK3 P;  3RQI A;  1H9T A;  4EM2 A;  1GXQ A;  1FP1 D;  2E7X A;  3Q9S A;  4BEH A;  3T8R A;  1STZ A;  4CCO A;  5CVV A;  4LIV A;  3MD2 A;  1IZ1 A;  4I98 B;  3KPH A;  2ADU A;  2ZKZ A;  4XL9 A;  4MQ9 F;  3DU6 A;  2Y2Z A;  2R7R A;  1WVR A;  3OYF A;  5FFX A;  3HM5 A;  4NQW A;  2M0C A;  3IHU A;  4CH7 A;  4CZZ A;  3GF2 A;  4OMY A;  3H5A A;  1AU7 A;  1GXP A;  2VJJ A;  1RET A;  1WJD A;  1MBF A;  1U0J A;  3ZP5 A;  2V9K A;  1SFU A;  2QBY B;  4GDF A;  1ZYR F;  1WJE A;  3EDP A;  1WKM A;  4IHW A;  1FNN A;  1P4W A;  2R5Z A;  1OKR A;  1MD0 A;  1Z05 A;  3P9C A;  1OIS A;  2BXY A;  1FOW A;  1KZH A;  3SEQ A;  3R0J A;  2JA8 J;  2R7U A;  3BR2 A;  3OOP A;  3JRA A;  5M3F J;  1JTX A;  2H8W A;  3J80 K;  5IOY A;  3BTI A;  2JA7 J;  1TQI A;  3W6J B;  4MGR A;  3TP3 A;  1GV5 A;  3D5S C;  4P55 A;  3PSI A;  2W00 A;  2IVM A;  2PJR A;  4HYE A;  2CUZ A;  3FMR A;  5ILS A;  4U88 A;  3IP4 B;  4KDP A;  1P2F A;  3K7A J;  3GTP J;  3S93 A;  2VE8 A;  5DYM A;  5LHI A;  1LFU P;  3H9G A;  4L9N A;  3S3M A;  1PP7 U;  3CC2 I;  2XSD C;  1BIA A;  1IRX A;  2VJI A;  2A5W A;  2VI6 A;  3GO5 A;  2M7A A;  1QRY A;  3JAM K;  4LFU A;  2DMU A;  2UUZ A;  2XKP A;  2GWR A;  1AHD P;  4BAY A;  2MH9 A;  3L2C A;  3ROU A;  4LIT A;  2M0M A;  2BY2 A;  2DOF A;  4RDU A;  2BE5 F;  4LK0 F;  4A3B J;  1XCV A;  4I02 A;  1I3A A;  2KIM A;  1D0X A;  4RAF A;  3S1Q J;  2R3S A;  2ICW G;  1I1S A;  2DOE A;  4ENK A;  2ID3 A;  2XIG A;  5ILU A;  2V6C A;  3H1C A;  1TWA J;  3G6E I;  4NDL A;  2OPT A;  4S05 A;  1P4X A;  4HDV A;  1IW7 F;  1HA8 A;  2FQ3 A;  2HQR A;  4LIU A;  2VPL A;  3HOW J;  2VE9 A;  2KT0 A;  1A31 A;  1XGO A;  2GXB A;  1J59 A;  2L3D A;  1TTY A;  2LLK A;  1R22 A;  4XLC A;  2M87 A;  3AG1 H;  4A0X A;  4F7Z A;  2VN2 A;  4CCM A;  3IH4 A;  5DD4 A;  5M5X J;  4FE4 A;  3M8J A;  4BE0 A;  3CUQ B;  1XDS A;  4ZZD A;  2PFB A;  3RYP A;  2HKO A;  1X1P A;  3M8E A;  2P7V B;  2D1V A;  3A2K A;  5HDN A;  3T0Y A;  4LG3 A;  4HLX A;  2RKH A;  5EJC A;  4B8X A;  5K7Z A;  2QYO A;  2L02 A;  3CQZ J;  1MW7 A;  3GTG J;  4QPO A;  3FXU A;  2XHK A;  2KIU A;  1BR1 A;  3F3X A;  5JI6 A;  5C4J J;  4WK8 F;  5B66 C;  3FK6 A;  3KZI C;  1MMA A;  1GVJ A;  2VBX A;  1YE9 A;  1JKR C;  2OV7 A;  2DQR A;  2PLY A;  1Z6R A;  2YSR A;  4CZC A;  3S16 J;  1RKW A;  4A3I J;  2KRF A;  4UVB A;  5GAH J;  3ML6 A;  3WU0 A;  2X51 A;  2PQ8 A;  3CO6 C;  4RS8 A;  5F1J A;  2PX9 A;  2L7K A;  4MTE A;  3ELK A;  3BG3 A;  2ZBK A;  3GFI A;  3H35 A;  4JX4 A;  3LA2 A;  3FIS A;  1B8I B;  2YU3 A;  2HYG D;  3M4O J;  2WB1 N;  3SXY A;  3M9A A;  1UST A;  1RZ4 A;  1W0U A;  1NK2 P;  2R0Q C;  1G3Y A;  1Y56 A;  3FXL A;  3CUQ C;  4BXU A;  3CCY A;  5FO5 A;  3S2H J;  2VBY A;  3ABM H;  1Y39 A;  2Y30 A;  1YIO A;  1ETW A;  1XB4 A;  2EPF A;  1TQP A;  3BR3 A;  4FET A;  4S04 A;  5K1Y A;  2R5Y A;  3S1R J;  2VXD A;  1RNL A;  3G71 I;  3AL0 B;  4UUS A;  2H1K A;  4HPQ A;  4MQV A;  4OIQ F;  3PQK A;  1HW2 A;  2AXL A;  5D5W B;  3V7C A;  5C44 J;  1YJ9 I;  2IT0 A;  1WSU A;  2OD5 A;  4A3J J;  2X6Y A;  4KN4 X;  1RI7 A;  4Q48 A;  2VOO A;  1I27 A;  3CF5 F;  2L4A A;  2IP2 A;  2VKD A;  3TW7 A;  2JVH A;  2FXA A;  2H1L A;  2TRT A;  1BOA A;  3GUD A;  4M3E A;  1Z77 A;  5D5X B;  1R9T J;  3BZ6 A;  3CMA I;  4DYC A;  5C3E J;  3ZPL A;  3SFI A;  4DBR A;  4RBO A;  3JRC A;  4GRI A;  3OYJ A;  3E7L A;  2LF7 A;  5EGO A;  2QUF A;  4PJM A;  2JA2 A;  3TQN A;  4BQA A;  5CVJ A;  3HRT A;  3I53 A;  1WJF A;  1WPK A;  4BDZ A;  3WTS C;  1T6S A;  2DT7 B;  2CU7 A;  4K2E A;  5J1U A;  2DK5 A;  1IRZ A;  5DDG A;  1WI3 A;  3SZP A;  4DYR A;  4BJT A;  2CQK A;  4R8H A;  2AS5 F;  3S8P A;  5HS9 A;  3KYC B;  1MDM A;  3TMO A;  4YIR X;  5HS8 A;  2HS5 A;  1U5T B;  2F6C A;  2PBI A;  3FXR A;  1SAN A;  2O61 A;  3PQJ A;  2NS0 A;  3M07 A;  1NHA A;  2XRO A;  5FKM A;  4HF1 A;  3DBH B;  5H6R A;  4ZYD A;  1S7E A;  2L9N A;  1IC8 A;  4I99 C;  3U21 A;  2IGO A;  3WGG A;  3KLO A;  1PDN C;  1JHF A;  3AG2 H;  5F0C A;  1V5G A;  2OTL I;  3I64 A;  2BW3 B;  2E36 A;  3O2P E;  2FBH A;  1IUF A;  4LG0 A;  3CC7 I;  2BHY A;  2Z3Y A;  3SHF A;  1DP7 P;  4PJ0 C;  1XMK A;  3OR1 C;  3HGG A;  5ICE A;  4B43 A;  2MH2 A;  3G1M A;  2WA0 A;  3EQL F;  2AQE A;  1U8R A;  2HPM A;  1WH5 A;  5KNL A;  2D45 A;  4M73 A;  4E7Z A;  5FLX Z;  3TKY A;  4V19 K;  3V7S A;  3TL4 X;  3K10 A;  1Y0U A;  2DA6 A;  2KL4 A;  3PL8 A;  4PFP A;  1JKP C;  3BG6 A;  4XM3 A;  3GCM A;  4XOT A;  3LL7 A;  2V79 A;  2XGX A;  4KUM A;  4RGU A;  4A5M A;  1A04 A;  4UUT A;  2O5R A;  3HTS B;  1XSD A;  4M3F A;  4EJT A;  2K9L A;  2QWW A;  1F36 A;  3OYN A;  2E2H J;  3ZQF A;  2GXG A;  4IX7 A;  4BY1 J;  5DUK A;  1Y1V J;  2VKE A;  3K4B A;  3CJR B;  4W97 A;  2FNP A;  1Z0X A;  5DV5 A;  4EGY A;  1FOK A;  4EM0 B;  3S2W A;  3OSG A;  3GME A;  3N97 A;  2TDX A;  4XRM A;  4MFD A;  2RDP A;  1WH7 A;  4XNF A;  2FBI A;  4NB5 A;  2EIN H;  2GXA A;  4ZJZ A;  4EGZ A;  4DZJ A;  1BI3 A;  1OQY A;  4O6J A;  4RGR A;  3OYK A;  1YI2 I;  5F04 A;  2V1N A;  4IVN A;  4A3F J;  4IHT A;  1ETQ A;  4RMN A;  5D4R A;  1FOY A;  2LR8 A;  3QYE A;  3ZQI A;  3H9J A;  4XRF A;  4J00 A;  3V42 A;  2CWE A;  2ME0 A;  4WWC A;  4ZH4 F;  5J40 A;  2DLL A;  2F4O B;  2M9H A;  1UJ8 A;  2VAS A;  1P6R A;  1SMY F;  3OYB A;  2MFZ A;  5K5Q A;  3OS2 A;  3N4M A;  4M72 A;  2VLA A;  1MJ9 A;  1A5J A;  2QEX I;  1B6A A;  3QOE A;  4RGS A;  2Q2E B;  4HX7 A;  4WX9 A;  4EMS A;  4BE1 A;  2A3S A;  2DOA A;  1IGN A;  2AXT C;  3ZQH A;  1B72 A;  5IYD J;  3GTK J;  2VXZ A;  2LY2 A;  2X4H A;  4J01 A;  1EA3 A;  4HV5 A;  3ZQC A;  4A2U A;  1FT9 A;  2P81 A;  3SFZ A;  5J4V A;  4QTR A;  1Z6T A;  3KP4 A;  3UKG A;  5E1W A;  1F9N A;  3F21 A;  2XGC A;  4F52 A;  2F5F A;  1B4A A;  3X2Q H;  1Z67 A;  4FX0 A;  2HXI A;  1ETY A;  4HSR A;  1XMA A;  2A05 A;  2MYS A;  1L3L A;  3FDY A;  2CG4 A;  3EYY A;  1JKQ C;  3SJM A;  1AOY A;  1TZL A;  1ORK A;  2KRH A;  1KU2 A;  4L9T A;  1R71 A;  3HUG B;  4AYB N;  4CO8 A;  3HPH A;  4ZTF A;  1S7O A;  2FE3 A;  4ESB A;  4EQQ A;  1W1W E;  2V1D A;  1VZ0 A;  3HSE A;  2LMD A;  3TBI A;  2HDW A;  3GEZ A;  4CYD A;  2AHQ A;  5L3D A;  1ZR4 A;  2N8G A;  5LRS A;  2D1H A;  1OYI A;  2XB5 A;  3MZH A;  1VFC A;  1BI2 A;  4X1E A;  4Y13 A;  4CCN A;  3BJ6 A;  3WU2 C;  2EFQ A;  2M34 A;  1C0W A;  2JWT A;  2VJ4 A;  1MIJ A;  2MAB A;  3EPZ A;  2K27 A;  3Q0V A;  3FIW A;  3VYU B;  1IXS B;  1VQP I;  2GOX B;  4DJA A;  2A6E F;  4ENN A;  2YX4 A;  3IL2 A;  2EIJ H;  2EH3 A;  3QRF F;  4GFB A;  4N4N B;  1DDN A;  2H8R A;  4BYY A;  3ESW B;  3MCZ A;  1GT0 C;  1CF7 B;  1WHU A;  1ZAO A;  1HKT A;  2BHZ A;  3FWE A;  4PCQ A;  2HVS A;  4HX4 A;  3G4S I;  4E6K G;  4KA4 A;  1TL8 A;  4AIJ A;  2GA1 A;  5A2Q K;  2P6S A;  2IJL A;  3MEX A;  1BR4 A;  2OAZ A;  5EEH A;  3W2V A;  3DFG A;  2K4J A;  2MBF A;  1FBQ A;  2XAJ A;  4G12 A;  2XAF A;  3QYB A;  4IJA A;  3E6B A;  5HNF A;  3CLO A;  3OYE A;  1ETV A;  1FWZ A;  1R5H A;  4D0P A;  1JXS A;  4KNY A;  3MFK A;  4KT6 A;  1MNE A;  2UZK A;  2VBW A;  1OLT A;  3T8T A;  1UB9 A;  3DBL B;  3K4K A;  5L3G A;  1G3T A;  4RLF A;  2XSJ C;  1W5T A;  1VQ6 I;  1ZQ3 P;  3PO2 J;  2XF5 A;  2LSO A;  1Z1D A;  5BPI A;  4PUS A;  1ZG1 A;  4F92 B;  2KDO A;  3MMY B;  3K4C A;  2HVQ A;  3BTJ A;  4OIP F;  1FY7 A;  3W6V A;  2GZW A;  1FC3 A;  3E6D A;  4BY7 J;  3ZQQ A;  4E7L A;  4HAM A;  2DJI A;  2MC3 A;  5K7H A;  4HLY A;  2LK2 A;  3V4G A;  2CQ7 A;  5LD2 C;  5FLX K;  1BC8 C;  3IH2 A;  4CIC A;  3WTV C;  2EIK H;  1F5T A;  3QPL A;  4G7O F;  1XX5 A;  1HLV A;  1IDZ A;  2LKS A;  4RGX A;  2ZJP F;  1QA6 A;  4IHY A;  4JQF A;  4ZTJ A;  4UUV A;  1ZRC A;  2EA4 A;  4NUB A;  5D6F A;  3AFH A;  2QEN A;  2E1N A;  3SDG A;  1IXR C;  1RUO A;  5IYB J;  1T33 A;  1YG2 A;  2E5Z A;  2XGE A;  4ABZ A;  1IV6 A;  5E3M A;  4ETS A;  4RB1 A;  2O7O A;  2ZC2 A;  1S72 I;  3BQZ A;  1ZN2 A;  1A35 A;  5JLW A;  2O3F A;  4G9Y A;  4PJL A;  3BY6 A;  5KK1 A;  3MKY B;  1WJC A;  1YRN B;  2E2I J;  3KYL A;  1GV2 A;  2Y75 A;  4PK4 A;  4A3C J;  3NWT A;  5HLH A;  1MSE C;  4PZJ A;  5DEQ A;  3BWG A;  2WAQ N;  1FSH A;  4BE2 A;  2XAH A;  1MND A;  4FTH A;  1VQ5 I;  2VT2 A;  1GDT A;  3MQ0 A;  3RKY A;  1OCZ H;  4GCV A;  4BQN A;  3GYH X;  3JTG A;  2WTE A;  3OYM A;  1JT6 A;  1IRG A;  3QP5 A;  1DPU A;  1ETX A;  3MVP A;  5EZG A;  2G7U A;  3JRH A;  3I56 I;  5LHG A;  1K6Y A;  1J2X A;  3LSG A;  4AVP A;  1V5F A;  2CUE A;  4UHT A;  1BW5 A;  2STT A;  1HDP A;  4RM3 A;  5LRR A;  3C2B A;  3CCL I;  4KIG A;  3CP2 A;  2I8D A;  2DJN A;  1D1C A;  3H9Q A;  3KEQ A;  4RB0 A;  1KYZ A;  3WTY C;  4HNV A;  3K2Z A;  2DYR H;  5LEJ A;  5E3O A;  3LA7 A;  4KN7 X;  1LKX A;  1W36 C;  1IAW A;  4Q47 A;  2WBM A;  1MMG A;  4KIF A;  4C3J J;  1TC3 C;  5KCM A;  2XPV A;  4FIS A;  2CV2 A;  2DFH A;  3F9K A;  4QSH A;  4H4K C;  5HLG A;  5FJ8 J;  1E0E A;  4IHV A;  1G4D A;  1ACI A;  2WAQ A;  4HV6 A;  5DCF A;  1ZG5 A;  1VQL I;  1B8I A;  2LTP A;  2QQ8 A;  1SD6 A;  1DU0 A;  4IQJ A;  1AA7 A;  4HDU A;  2HZD A;  4CA0 A;  1K83 J;  2Y31 A;  2HQA A;  2XVC A;  3L7W A;  1VF9 A;  1XD7 A;  2DYS H;  3L2U A;  1YLF A;  2DT5 A;  3CDH A;  2ETH A;  4UNO A;  1I6X A;  3I71 A;  1EKE A;  1ON2 A;  3VYS B;  4YFX F;  5DM7 F;  1R58 A;  1SFO J;  3E97 A;  4F3Q A;  3CCE I;  3EUK L;  4U7D A;  2O8K A;  3ZQ7 A;  2L9V A;  3DKW A;  3OMY A;  3UNG C;  2TCT A;  4YRV A;  1WRJ A;  4KMF A;  2LVS A;  3GWZ A;  3R60 A;  2VB6 A;  1W7P B;  3DWL E;  4RB3 C;  3OIQ A;  1FTZ A;  3E5X A;  1HW1 A;  5FKL A;  1MSF C;  1V55 H;  3O8G A;  3P5J A;  2X1E A;  3FBI B;  1G59 A;  3I54 A;  5LGU A;  2R7O A;  1K78 B;  3HDD A;  4OAZ A;  4OAY A;  1ZRF A;  1SC7 A;  4QWQ A;  2KDZ A;  3ZN1 A;  3W6K B;  2CSO A;  3HRU A;  5B1B H;  2NVQ J;  2BBY A;  3IKV A;  2WC2 A;  2R7Q A;  2FF4 A;  3FBN B;  1S29 A;  1WWX A;  3V8J A;  2H94 A;  2L4M A;  3RDI A;  1R5G A;  2ISY A;  1FIA A;  1JUM A;  5HOD A;  4YIF A;  1XPX A;  3K69 A;  2YU9 J;  4ESF A;  3A03 A;  3RPU A;  1SD7 A;  4M3D A;  3RPU D;  5L3B A;  2DDB A;  1FLI A;  4CDG A;  1MZB A;  3OR2 C;  1J09 A;  2GQQ A;  4BUP A;  4E4H A;  1VND A;  3OS0 A;  3RKX A;  2XKO A;  3NRV A;  3EUH C;  3QP6 A;  2HPI A;  3JRD A;  4M9S A;  5HVQ C;  4FAS D;  3CP8 A;  2VIX A;  3SDB A;  3HOZ J;  2KJC A;  5FKO A;  1QVU A;  4E7K A;  5IP6 A;  2DT6 A;  4RA2 A;  2KPM A;  1U5T A;  3DEU A;  4XRS G;  2DMT A;  2Y0S A;  4FE7 A;  3WTZ A;  2WWY A;  5HLT A;  5HLI A;  2C6Y A;  4CGZ A;  2Z1D A;  1PJR A;  1LDJ A;  3TOB A;  2GLO A;  3BTC A;  3BZC A;  4XSZ F;  3DP7 A;  2VQH A;  2ISZ A;  3S14 J;  3B02 A;  2K40 A;  2M3A A;  2LD5 A;  2P7C B;  2ZJR F;  3GFJ A;  5CJ9 A;  2BW3 A;  1O7F A;  1RES A;  3DKY A;  2F5D A;  3KYD B;  2Q8K A;  4NC7 A;  3OV8 A;  2HNH A;  2DCE A;  4MNU A;  2QSG X;  5HNH A;  1TW2 A;  2LRE A;  3E0J B;  1SVM A;  1U8B A;  3K70 D;  2HYJ A;  4KT5 C;  3ECH A;  4AUX A;  2RNG A;  4XLP F;  3C2G A;  3PO3 J;  1P7I A;  2NVY J;  1QHG A;  1XG1 A;  1Y6I A;  2EV6 A;  3QU6 A;  3A4C A;  3V8K A;  2CW8 A;  2QKM B;  3H0G J;  4GYI A;  4A3D J;  3EUA A;  5E1X A;  1V54 H;  3L2W A;  5IP7 J;  2W85 A;  3GLL A;  1O3Q A;  1PUF B;  4B48 A;  1B9N A;  2FSW A;  2WY7 Q;  1L0O C;  2R7T A;  2XB0 X;  2W84 A;  5E1Z B;  2IS2 A;  2LBF B;  3O6B B;  2B9S A;  1NG7 A;  3T1B A;  4CUG A;  4M6Y A;  4GGG A;  4A0Z A;  4Q4Z F;  2V1X A;  3LNQ A;  1X2M A;  2MA3 A;  2JSP A;  2VKV A;  2RQQ A;  1D1A A;  1OPC A;  1N77 A;  1KYW A;  2GIZ A;  2L5Q A;  3EET A;  3F8N A;  5F0H A;  3ZCO A;  5KVR A;  5ILV A;  2KMU A;  1DGW Y;  2IEK A;  2QQ9 A;  4KFC A;  1T0F C;  1S9H A;  1LJ9 A;  1SMT A;  2CO5 A;  4A3M J;  1A6I A;  3DPU A;  4UV9 A;  4A3G J;  4E7J A;  4Z2Y A;  1ZRE A;  2EFO A;  3CD6 I;  1PVE A;  1DPR A;  3O3K A;  3WHB A;  3RZO J;  1G3W A;  5L3F A;  3Q5F A;  5EZH A;  4PGG A;  4XRS A;  3J81 Z;  1AKH B;  2OQR A;  3ZMZ A;  2O0Y A;  5JVT A;  5D5V B;  2GM4 A;  3H3Z A;  3TDU C;  1K6O A;  4I2O A;  2DOD A;  3VFZ A;  2W1O A;  4ASN A;  1MKM A;  4BJ5 C;  2JK3 A;  3MKW B;  2E7W A;  2Q2E A;  3GTO J;  3L1P A;  1X3U A;  3VOE A;  1QZY A;  4FX4 A;  3FF5 A;  2CQX A;  3TW6 A;  3FXJ A;  2H27 A;  4C3I J;  1HBX G;  2FU4 A;  2K9M A;  2KP6 A;  5CVI A;  4DW6 A;  4HEA 2;  5E3N A;  5AIQ A;  1MH3 A;  2RQP A;  3PNY A;  1D5Y A;  1LVK A;  2FOW A;  5GPC A;  3OYC A;  2CV1 A;  2F4I A;  1VQO I;  3LA3 A;  1RPW A;  3TO7 A;  2ZFU A;  1B9M A;  2HKX A;  2NVT J;  5TRD A;  2DA4 A;  2VKH A;  4XLN F;  4AD9 A;  2QF7 A;  5K5O A;  1H0M A;  4KYW A;  1KQ8 A;  2FEZ A;  3I58 A;  3HUG A;  3JRB A;  1EJ9 A;  2E1C A;  5J1R A;  1XC5 A;  4IKF A;  2JRT A;  3GW2 A;  1FBS A;  3H3U A;  4QPQ A;  4HNU A;  1T39 A;  3IRQ A;  4CCK A;  1BBY A;  1EH8 A;  1D8J A;  1S3J A;  3F6O A;  2PMU A;  3C3W A;  4UB8 C;  3DBR B;  2FUG 2;  4BBR J;  2EFP A;  4N0B A;  4U7B A;  2DA2 A;  5FB2 A;  4I6Z A;  1J75 A;  3BPV A;  4IF4 A;  4IQ4 A;  2WB1 A;  2CQQ A;  1U6G A;  1DUX C;  4BBS J;  1ZHF A;  2XRN A;  4QLC U;  3A0H C;  1OR7 C;  2YS9 A;  4OIR F;  2HGC A;  2XGD A;  2J5O A;  4OWR B;  1LVA A;  3BT9 A;  3ONQ A;  1KON A;  3LSR A;  4KIC A;  4L9J A;  1S7A A;  4J19 A;  2RVC A;  5K7F A;  3R0A A;  4WCG A;  2PI0 A;  3G3Z A;  3OIO A;  4EJU A;  3ABL H;  2JQ7 A;  2KJB A;  4Q5S F;  2M4K A;  4BEH B;  4IRH A;  2HQ5 A;  2BY0 A;  1NG6 A;  4IPA A;  1CF7 A;  3QOP A;  2OCC H;  4RAZ A;  5CPR B;  1R49 A;  1BA5 A;  3VPR A;  5A2Q Z;  3L09 A;  3HG9 A;  4WF2 A;  1ZR2 A;  1ON1 A;  2LG4 A;  3L00 A;  1U78 A;  3VWB A;  4I0A A;  1IUY A;  1J5Y A;  4IXA A;  1Q1H A;  2ZME C;  4E7S A;  3E6M A;  4XIC A;  3WTT C;  1XN7 A;  1YTY A;  1MMD A;  1QGP A;  4CSW A;  3VEP A;  2LRD A;  3DXJ F;  3QQA A;  3VB2 A;  1RC9 A;  2K9N A;  1X1B A;  3LQQ A;  1XMX A;  3BJA A;  2JMW A;  3L2Q A;  4B09 A;  2VL8 A;  3A01 B;  5JVG F;  2LY9 A;  3HPG A;  2VJ5 A;  1X3W B;  3AAF A;  1FYL A;  3B73 A;  3GTJ J;  2E71 A;  3TOA A;  4JBA A;  5IT3 A;  2DW4 A;  4HRI A;  3BCB A;  1ZGA A;  4PSW A;  3CME I;  1O3T A;  3BRO A;  4PFO A;  2W4S A;  3ZOB A;  4XQF A;  1T98 A;  1UAA A;  1R4M B;  1KU9 A;  2CRG A;  4R79 A;  2GOM A;  1EV7 A;  4GO1 A;  2XV4 S;  4EJV A;  1ZRD A;  3CMY A;  3IH3 A;  3KP7 A;  4HBL A;  4UXN A;  5FD5 A;  4U0Y A;  2A69 F;  2OA4 A;  5D8K B;  3HOT A;  2OTJ I;  4P9U A;  3BR1 A;  3NEU A;  1JJ8 C;  4ON0 A;  1JJ6 C;  2LF8 A;  2YUS A;  3BG9 A;  2OZ6 A;  5FRM A;  2X48 A;  1XGN A;  1N78 A;  4V2G A;  4A93 J;  5E17 F;  4ZDP A;  4CYC B;  1KQ9 A;  3OYL A;  3BR0 A;  4FQG A;  1TWH J;  3I4N J;  5LEK A;  1MH4 A;  4BJ6 C;  3PUB A;  5J8F A;  2PMZ N;  1E3O C;  2RNJ A;  1KQ0 A;  1VQ7 I;  4KIB A;  3NAU A;  4XN0 A;  4U0W A;  2AQF A;  4Y4R A;  2QQA A;  1YRN A;  3ERE D;  3WE3 A;  3HXL A;  4X0G A;  4LLN A;  1HC8 A;  1PP8 F;  1OMI A;  4DGW B;  1W5C C;  4AIK A;  2JVG A;  3HJE A;  5JFR A;  2Z16 A;  1X58 A;  3HL2 A;  1YHQ I;  3DPL C;  1W5S A;  1BI1 A;  1R5I D;  1WJ5 A;  2LH9 A;  4TV7 A;  3LSP A;  3FHZ A;  3WTU C;  1D1B A;  1GUU A;  2K9S A;  3S3N A;  1A6Q A;  4IZZ A;  3KP3 A;  5ICG A;  3FXK A;  1W4M A;  2GBY A;  1EF4 A;  2E1O A;  2VQG A;  3QPT A;  2VQL A;  4D5C A;  2LKX A;  2NVU B;  1X3Z B;  3LQR A;  5CQG A;  5LBQ A;  2R7V A;  1G3S A;  2EZH A;  2L7F P;  4LJZ F;  3SEZ A;  5JHU A;  4E7I A;  1I6H J;  2E19 A;  2F2E A;  3HSF A;  4F91 B;  3J81 K;  1MGT A;  2VOP A;  4YFN F;  3L2R A;  2X1C A;  5BS6 A;  2VON A;  2DMP A;  2L9S A;  4AVZ A;  1OYY A;  5IP9 J;  2ZB9 A;  2I10 A;  2Y48 A;  1U3E M;  3VSL A;  5C4X J;  4NBQ A;  4L5J A;  2JA5 J;  2DXI A;  4A6D A;  5GAD J;  4XK4 A;  1H89 C;  2X85 A;  4N9H A;  1Z21 A;  2ECB A;  1R1U A;  2HXO A;  3PFY A;  3LSK A;  3SYT A;  3TO6 A;  4M3G A;  1VQ4 I;  5M5Y J;  1ERD A;  3H92 A;  4XMY A;  2XF6 A;  4R1H A;  2FRH A;  2OJE D;  5GAE J;  3MAJ A;  1LUJ B;  2JJ7 A;  2LNB A;  3HIF A;  3HEF A;  5EEA A;  3GBG A;  5J1Y A;  4MTD A;  3K1N A;  3BR5 A;  1JKO C;  4Y33 A;  2BY3 A;  3F8B A;  4UV8 A;  5F6F A;  1RR7 A;  2IGM A;  1I50 J;  4UUS B;  2CUJ A;  3WU1 B;  1UG2 A;  1JHH A;  2DTZ A;  2CFX A;  3RKW A;  3OYI A;  1N75 A;  2EK5 A;  1Y8Q B;  2HOT A;  1MJB A;  1LB2 A;  2DFF A;  1YOV B;  2V1U A;  4AC0 A;  1AWC A;  1MBJ A;  2FMY A;  3BQY A;  2HTS A;  1W7P D;  3FKI J;  3JRI A;  4AID A;  1FSE A;  2KKO A;  4HF0 A;  3MN2 A;  5FRO A;  3ZMD A;  1LE8 B;  2IS1 A;  1V5E A;  4B47 A;  2FQ4 A;  1RRJ A;  4BNC A;  2BYV E;  1D3Y A;  2E1M C;  3JTH A;  2V4J C;  1OYW A;  3F8C A;  1U9N A;  1POG A;  2CW7 A;  1UHW A;  3PNV A;  4OMZ A;  4ZC3 A;  5CKT A;  4EJO A;  3KZZ A;  3CCQ I;  3OSF A;  1SFK A;  1K7A A;  2A6T A;  2ZO4 A;  5H2F C;  1WJB A;  1IXC A;  4XLH A;  4AYB A;  1Z3Y A;  5FGM A;  3HRM A;  2H09 A;  1UMQ A;  3QU3 A;  4BXF A;  2L7Z A;  2VPR A;  2UXN A;  1ZK8 A;  3JRG A;  4JX5 A;  2EV0 A;  2ZXI A;  5IPA A;  1UCR A;  2QBY A;  3G1O A;  2F4M B;  3UR3 C;  5E18 F;  3EYI A;  2EBI A;  4L0Z B;  2Y9Y A;  1ZAR A;  1QHH D;  3L9F A;  3AKZ A;  1Z9C A;  2P5V A;  2UXX A;  1FYM A;  2M7B A;  2DA5 A;  4RLQ A;  1R00 A;  2VC0 A;  1DU6 A;  1FTT A;  1BJA A;  1FX7 A;  4XLF A;  4L5I A;  3M3Y J;  4U0V A;  3R4K A;  2VUM J;  3I4M J;  3ZN0 A;  5BMZ A;  3KIO A;  3MWM A;  1YX5 A;  3FXQ A;  5H20 A;  3HSR A;  2O03 A;  3I0T A;  5D6E A;  4DQ2 A;  3CTA A;  3CLQ A;  1QZZ A;  2IS6 A;  3IRR A;  2GA2 A;  1SAX A;  3MKZ A;  4NNJ A;  2MD5 A;  3KEY A;  1O4X A;  3W3C A;  4HX8 A;  4UY8 I;  3B6A A;  2Z33 A;  1TWC J;  1T38 A;  4M9X A;  1JT0 A;  2KIQ A;  1IV8 A;  2NYX A;  4G6T B;  1FOX A;  2V7F A;  2MW8 A;  1Y8R B;  5KAF C;  3WG7 H;  3ZMS A;  5M3M J;  2V9P A;  3IWF A;  1IF1 A;  3FM5 A;  3CCJ I;  2JSC A;  3DV8 A;  4M74 A;  2CJJ A;  3ZMV A;  3J7A Y;  3OYH A;  1ENH A;  4EJW A;  2QSH X;  3Q0W A;  4D7M A;  1XSV A;  2F5V A;  5L3E A;  4W1U A;  3OS1 A;  5E79 C;  2GAU A;  5CLS A;  4Y3O A;  1PUF A;  1OCP A;  4S0H B;  2XF7 A;  4IHX A;  3OL4 A;  2P6T A;  2OU2 A;  3BDD A;  1R7J A;  3CF2 A;  1J0R A;  1F1Z A;  3CUQ A;  2LBF A;  2NRA C;  3E5U A;  2IGN A;  3Q9V A;  2NS8 A;  5IT9 Z;  1M1E B;  2OF7 A;  3KEO A;  1QVT A;  2O6G E;  2VQC A;  4JYK A;  3HKZ N;  2LY1 A;  2IA2 A;  5F1R A;  1IN7 A;  3I5U A;  1P9Q C;  1LDK B;  2Q1Z B;  3LAP A;  5E20 A;  4II3 A;  3V8L A;  3HOY J;  4JP0 A;  3DTE A;  1T8I A;  1XCB A;  3HHH A;  3TP0 A;  2KZG A;  2BXZ A;  2JRM A;  2R7X A;  2IXS A;  1Q1V A;  5FRN A;  3C18 A;  1APL C;  1O57 A;  1SD5 A;  4F55 A;  2AO9 A;  5AON A;  1FZP B;  3H3V K;  2IRF G;  3JRE A;  2JT1 A;  1JE8 A;  2MG4 A;  2BY1 A;  2ECC A;  4XOP A;  1V4R A;  1GVD A;  4P5O A;  3FXM A;  2W7N A;  5FKN A;  2HOS A;  3FK7 A;  2DFI A;  3ABU A;  1BI0 A;  1GLN A;  1TW3 A;  3CCM I;  1KU7 A;  1R23 A;  1B72 B;  2MC4 A;  4ZZL A;  4BS9 A;  1ZGJ A;  4L18 B;  1QBJ A;  4ZYA A;  4D1Q A;  1I3Q J;  2PG4 A;  2IS4 A;  1MBH A;  2EV5 A;  5FLV A;  2XPU A;  4DYQ A;  3PJR A;  2EIL H;  1U2W A;  4ENJ A;  3S1M J;  4Y7N J;  1IN8 A;  2K9Q A;  4L9V A;  2L7M P;  2R7W A;  3RI4 A;  1MBE A;  1OCT C;  2L54 A;  2X6O A;  4LLL A;  4DNC A;  3BLY A;  1BL0 A;  2ZJ2 A;  4MLO A;  1LPQ A;  5DTD A;  2EFW A;  1FJL A;  1E3H A;  2DTR A;  3DTK A;  3S2D J;  2G9W A;  2RN7 A;  4M71 A;  1K4T A;  2Z9O A;  2HI3 A;  4JK1 X;  1HKQ A;  3ZQL A;  2X9D A;  4IL6 C;  2XAQ A;  2XC7 A;  3ZGK A;  3FHN A;  2HEO A;  2QM3 A;  2FA5 A;  3NAR A;  1K4S A;  4XKB A;  5HDK A;  1O3R A;  1PUE E;  2COM A;  2HOE A;  3F22 A;  3CCU I;  3KCC A;  4QIW N;  3U1K A;  5JHF A;  5FKK A;  1T2K A;  1YIT I;  1JUP A;  2XAU A;  1I39 A;  1S6L A;  1BIB A;  5ED4 A;  1X1A A;  1HOM A;  2EA2 A;  4FCY A;  2HFH A;  2DA1 A;  1MBG A;  3E3V A;  1WI9 A;  4LMY A;  2QGU A;  2XPW A;  3WTW C;  3LAJ A;  1OCC H;  5K5R A;  1X2N A;  3HOV J;  1LNW A;  2E5N A;  1EH6 A;  5J6X A;  2G7H A;  3HBL A;  5E8G A;  3HB9 A;  3D1N I;  3BG7 A;  2Z5U A;  2CW0 F;  2EZK A;  3I9V 2;  3E5Q A;  5BPD A;  1FPQ A;  2HYF A;  2NS7 A;  3WE2 A;  2KIS A;  1RKT A;  1CGP A;  2PEX A;  3I59 B;  2I5U A;  4Y15 A;  2W57 A;  3D0S A;  2M4G A;  3Q3S A;  1D5V A;  2OUM A;  3A01 A;  3LWF A;  4G7H F;  5FLM J;  2H6B A;  3KFW X;  4FT8 A;  2QKL B;  2WAD A;  3F72 A;  1MMS A;  1OCR H;  4XLE A;  2ZFW A;  4OIN F;  3U9G A;  1Z91 A;  2R7F A;  3LFU A;  2HOA A;  2LKP A;  5DS9 A;  2F5C A;  1P7J A;  3FMQ A;  3RJP A;  2ZXJ A;  4DZP A;  2Y9Z A;  1YX3 A;  5HS7 A;  1ZH5 A;  5TGT A;  3DCF A;  3FKJ A;  2NOJ B;  4X6A J;  1FMW A;  5DCM B;  4HOB A;  4XN3 A;  5IY5 H;  1SVL A;  2ZSI B;  3M1E A;  1XGM A;  2GIV A;  3IC7 A;  4M3B A;  1S5L C;  2A6H F;  2OC6 A;  4G8X A;  5EDN A;  1VQ9 I;  2OQG A;  4YFK F;  3K6G A;  3QPS A;  4GYG A;  4NC8 A;  3TO9 A;  4Y52 J;  1G8X A;  5J47 A;  4F93 B;  1T95 A;  4CYC A;  3NQO A;  3QAH A;  3S32 A;  1ULY A;  2JTV A;  3K4M A;  1R1V A;  3H5R A;  3HRS A;  2WV1 A;  3LSJ A;  1GHC A;  2E2J J;  3GXO A;  4G7Z F;  1BOB A;  4XKV A;  2OCE A;  1YYV A;  1NH3 A;  2KIF A;  4BDY A;  4O3M A;  2IGK A;  5LHH A;  1UFM A;  4HZF A;  5IT9 K;  2FNA A;  2R7Z J;  2MSY A;  1Y0N A;  4AIH A;  1X19 A;  2HVR A;  3ABK H;  4KIS A;  2RGV A;  4UVA A;  9ANT A;  1J9I A;  1HCR A;  3VSK A;  3HOU J;  5J3L A;  2RC4 A;  2LYC A;  3DEE A;  4MEX F;  2K5C A;  4A12 A;  4OIO F;  5BOX A;  4XR6 A;  1IN6 A;  1E2X A;  2VT3 A;  2DMN A;  4XLA A;  2DQL A;  5EG0 B;  2HWV A;  4B3X A;  4HNT A;  2Y0M A;  3OIP A;  3P9I A;  1JGG A;  3OYA A;  3S3O A;  2WAF A;  4IRI A;  4RM2 A;  4H0E A;  5GTI C;  3DU5 A;  1OJL A;  3PM1 A;  1E3P A;  1IN4 A;  1OCO H;  3OWT A;  4JOM A;  2QSF X;  3ZXS A;  2L2O A;  4B44 A;  5EF6 A;  1BM9 A;  4CCL A;  4KMU X;  3RYR A;  2IAI A;  1QQI A;  2ELJ A;  4LK1 F;  3MZ8 A;  1WQ2 A;  2NXN B;  2JUC A;  3K4N A;  1G2H A;  2EQR A;  2FOK A;  3P9K A;  3K1M A;  1TBX A;  4M9Z A;  4B3A A;  1TP4 A;  2EFN A;  3R6S A;  2W25 A;  3LSM A;  4BAC A;  4WXD A;  4C30 A;  1ZTR A;  3GLX A;  3DLL F;  4JX6 A;  5AIP A;  4AWX B;  3KET A;  2DI3 A;  3IUO A;  3ZR8 X;  1X4P A;  3KZY A;  4KJZ A;  5F64 A;  2ELH A;  4XKW A;  4LOC A;  3C2H A;  3IWZ A;  2ESH A;  2ZME B;  4MIM A;  3O8H A;  2DO7 A;  3L2V A;  3KX2 A;  1BC7 C;  2NOG A;  5LGN A;  1TWF J;  2JA6 J;  2XAS A;  1I1G A;  3M1C A;  2A68 F;  3DKX A;  1A36 A;  1ONV A;  4PGH A;  3TED A;  1IDY A;  2PJP A;  1T08 B;  3VYR B;  1W0T A;  3HOX J;  1F4K A;  1FEX A;  2NAZ A;  3GFL A;  3JRF A;  4G94 A;  3BCA A;  2PN6 A;  2XRL A;  3GTL J;  1MMN A;  3BPX A;  4ITV A;  5FFZ A;  5IOZ A;  1LE8 A;  1QPI A;  1ITY A;  4E7H A;  4BHB A;  1Z7U A;  1O7L A;  2BGC A;  3K4L A;  1XGS A;  1F43 A;  2LP0 A;  3H5N A;  3A1Y A;  3CMM A;  1FP2 A;  1UHM A;  4UVC A;  5J4Y A;  2Q0O A;  2MLG A;  3I55 I;  1LEB A;  1IG7 A;  1K79 A;  1O3S A;  3ULQ B;  3VYT B;  4ENM A;  2K85 A;  3I4P A;  4P96 A;  5GPA A;  2M5W A;  2QQB A;  2EIM H;  3WG9 A;  3CCS I;  1LEA A;  3OL3 A;  4PDK A;  1ZEL A;  4I09 A;  4P1W A;  1TWG J;  3AG3 H;  4NQW B;  3ZMT A;  1SFX A;  2M1B A;  2KQR A;  3AL0 C;  2F5E A;  2RV8 A;  1ZLK A;  2BZT A;  2DBB A;  1TT0 A;  3ECO A;  1USS A;  3CDL A;  5HDG A;  2E34 A;  2H6C A;  4PJJ A;  2CFO A;  3SZG A; 
#chains in the Genus database with same CATH homology
 2DN0 A;  2ELK A;  2CUE A;  2ID3 A;  2R5Z B;  1Y1W J;  1BW5 A;  1TWA J;  1HDP A;  3BG5 A;  2OPT A;  4NDL A;  4AC0 A;  5M5W J;  3C2B A;  1MBJ A;  2DJN A;  2MGQ A;  5EYR A;  3BQY A;  4HNV A;  3JRI A;  3FKI J;  5E3O A;  3HOW J;  2KT0 A;  4C3J J;  1TC3 C;  2XPV A;  3MN2 A;  1LE8 B;  4FIS A;  2FQ4 A;  2LLK A;  4QSH A;  5FJ8 J;  2FX0 A;  4IHV A;  1B8I A;  1U9N A;  2G0E A;  5F27 A;  2LTP A;  1POG A;  1DU0 A;  3IH4 A;  5M5X J;  4FE4 A;  3OSF A;  2HDD A;  1K83 J;  2Y31 A;  3WHC A;  1VF9 A;  1UMQ A;  3F0C A;  2L7Z A;  5K7Z A;  2VPR A;  3G1L A;  3JRG A;  1ZK8 A;  3S17 J;  4JX5 A;  3CQZ J;  5IPA A;  3GTG J;  1SFO J;  3G1O A;  2O8K A;  5F0F A;  1MBK A;  5C4J J;  2TCT A;  3FK6 A;  2EBI A;  2LVS A;  2Y9Y A;  1JKR C;  3Q0U A;  3S16 J;  1FTZ A;  4I76 A;  1RKW A;  4A3I J;  2DA5 A;  5FKL A;  1MSF C;  3O8G A;  5BNG A;  1DU6 A;  1FTT A;  3HDD A;  5F1J A;  3S15 J;  3BG3 A;  2KDZ A;  1LFB A;  3M3Y J;  2NVQ J;  4JX4 A;  3FIS A;  1T56 A;  1B8I B;  2VUM J;  2CUF A;  3I4M J;  3M4O J;  2DA3 A;  2WB1 N;  1W0U A;  1NK2 P;  2R0Q C;  3CCY A;  1FEX A;  1FIA A;  1JUM A;  3S2H J;  5HOD A;  2Y30 A;  3BR3 A;  1ETW A;  1O4X A;  3B6A A;  2YU9 J;  2R5Y A;  3S1R J;  1TWC J;  3A03 A;  1H88 C;  4M3D A;  4UUS A;  2H1K A;  1BW6 A;  4M6V A;  2D5V A;  1JT0 A;  2W48 A;  1ZGW A;  5C44 J;  1H8A C;  1VND A;  1MNM C;  2MW8 A;  4A3J J;  4A3K J;  5M3M J;  3JRD A;  3HOZ J;  3TW7 A;  2CJJ A;  5FKO A;  1QVU A;  5IP6 A;  2TRT A;  4M3E A;  2O9L A;  1ENH A;  1Z77 A;  4XRS G;  2DMT A;  4FE7 A;  4A3E J;  1R9T J;  3Q0W A;  4D7M A;  4DYC A;  4D5F A;  3GTQ J;  4W1U A;  5C3E J;  3SFI A;  1PUF A;  1OCP A;  4S0H B;  2GLO A;  3BTC A;  4IHX A;  1JUS A;  4RBO A;  1JTY A;  3JRC A;  1WGX A;  3S14 J;  2K40 A;  2LD5 A;  3E7L A;  5EGO A;  2EZL A;  2NS8 A;  1RES A;  2R5Y B;  2OF7 A;  1QVT A;  1WPK A;  4JYK A;  2FD5 A;  2CU7 A;  5J1U A;  3HKZ N;  1IRZ A;  2L0K A;  5IYC J;  1WI3 A;  4DYR A;  1U8B A;  4A3L J;  3HOY J;  4JP0 A;  3TP0 A;  2HYJ A;  4AUX A;  3PO3 J;  1Q1V A;  1APL C;  1P7I A;  1SAN A;  2NVY J;  1XG1 A;  2AO9 A;  3H3V K;  3JRE A;  1XS9 A;  5FKM A;  3H0G J;  4A3D J;  2MG4 A;  2ECC A;  5IP7 J;  1S7E A;  1PUF B;  1GVD A;  2HOS A;  5FKN A;  3HGY A;  1IC8 A;  3FK7 A;  1B72 B;  1VI0 A;  1HF0 A;  2XB0 X;  2B63 J;  5F0C A;  4L5E A;  2DA7 A;  5EGO B;  1I3Q J;  1MBH A;  1IUF A;  3LNQ A;  1X2M A;  5FLV A;  2XPU A;  4DYQ A;  4V2F A;  2VKV A;  3S1N J;  3HGG A;  3S1M J;  4Y7N J;  3G1M A;  5F0H A;  2K9Q A;  2LFB A;  4IEJ A;  2L7M P;  1WH5 A;  2IEK A;  1MBE A;  2ME6 A;  1OCT C;  2X6O A;  4A3M J;  1A6I A;  1BL0 A;  2M8G X;  4MLO A;  5DTD A;  2IBD A;  1FJL A;  4A3G J;  2DA6 A;  1IJW C;  1JKP C;  4MFE A;  3S2D J;  3WHB A;  3RZO J;  1NTC A;  4EEF G;  4UUT A;  5EZH A;  2HI3 A;  1OFC X;  4M3F A;  3ZQL A;  4BXX J;  4XRS A;  1F36 A;  1AKH B;  1FIP A;  2E2H J;  3ZQF A;  2X9D A;  4BY1 J;  4XID A;  1Y1V J;  2GM4 A;  2VKE A;  2JN6 A;  3GTO J;  2JK3 A;  3NAR A;  3L1P A;  4W97 A;  1Z0X A;  2CQX A;  3TW6 A;  3OSG A;  4C3I J;  4QIW N;  4XRM A;  5FKK A;  4MFD A;  4DW6 A;  1JUP A;  5E3N A;  1MH3 A;  1WH7 A;  2DMQ A;  3DEW A;  4DZJ A;  1D5Y A;  1HOM A;  4FCY A;  5GPC A;  2DA1 A;  1MBG A;  1ZKG A;  5F04 A;  2XPW A;  4A3F J;  1RPW A;  3OOU A;  1ETQ A;  1X2N A;  3HOV J;  2NVT J;  2DA4 A;  3BTL A;  2LR8 A;  3HBL A;  2QF7 A;  3ZQI A;  3HB9 A;  3D1N I;  2ME0 A;  3JRB A;  3RZD J;  3MKL A;  1ETO A;  4BKX A;  1XC5 A;  2EZK A;  5J1R A;  2M2E A;  2M9H A;  2NS7 A;  1RKT A;  4BBR J;  3ZQG A;  2DA2 A;  4I6Z A;  1A5J A;  2CQQ A;  3Q3S A;  4BBS J;  1U9O A;  1CQT A;  2YS9 A;  3A01 A;  1B72 A;  1IGN A;  3ZQH A;  5IYD J;  2XGD A;  5FLM J;  3GTK J;  1BJZ A;  3BT9 A;  3LSR A;  2NVX J;  1ETK A;  1UHS A;  5E3L A;  4J19 A;  3ZQC A;  2FJ1 A;  5K7F A;  2P81 A;  2HOA A;  4QTR A;  5DS9 A;  3OIO A;  4C2M J;  3UKG A;  1P7J A;  2XGC A;  4DZP A;  2Y9Z A;  2HQ5 A;  3A02 A;  3DCF A;  1K61 A;  4X6A J;  2HXI A;  1BA5 A;  1ETY A;  3LOC A;  3VPR A;  1JKQ C;  4B4C A;  2QCO A;  3SJM A;  4M3B A;  1ORK A;  1ZR2 A;  3RKQ A;  1U78 A;  5EDN A;  5EG0 A;  4AYB N;  3B6C A;  3QPS A;  2R93 J;  4XIC A;  4Y52 J;  3K2A A;  4B1R A;  1AKH A;  2AHQ A;  2R92 J;  1ZR4 A;  2N8G A;  3QQA A;  2K9N A;  2XB5 A;  1VFC A;  4CYC A;  4X1E A;  2JMW A;  3A01 B;  2M34 A;  2LY9 A;  4C3H J;  3IV5 A;  2JWT A;  2WV1 A;  3LSJ A;  2E2J J;  2RAE A;  3GTJ J;  3Q0V A;  3FIW A;  2EH3 A;  4D7N A;  4GFB A;  2H8R A;  3ZOB A;  2R7Z J;  2MSY A;  5GP9 A;  2CRG A;  1GT0 C;  3BR6 A;  9ANT A;  1HCR A;  3HOU J;  1WCM J;  5J3L A;  3CMY A;  3IH3 A;  1HDD C;  2DMN A;  5EG0 B;  3BR1 A;  1JJ8 C;  1JJ6 C;  2YUS A;  1JGG A;  3JR9 A;  3BG9 A;  5JLX A;  4A69 C;  2X48 A;  4G12 A;  4V2G A;  4A93 J;  1OJL A;  3PM1 A;  4MO7 A;  4CYC B;  2EZI A;  1ETV A;  3BR0 A;  5F08 A;  1TWH J;  3I4N J;  5EF6 A;  1MH4 A;  1E3O C;  2IAI A;  2PMZ N;  2ID6 A;  3NAU A;  1G2H A;  1YRN A;  2EQR A;  2L9R A;  1ZQ3 P;  2Y0S N;  4B3A A;  3GTM J;  3PO2 J;  2COB A;  1NK3 P;  3RQI A;  1ZTR A;  3BTJ A;  3W6V A;  4JX6 A;  4BY7 J;  1X58 A;  5K7H A;  1IV6 A;  2Y2Z A;  2LK2 A;  3LSP A;  1GUU A;  4LOC A;  2K9S A;  3IH2 A;  3HM5 A;  2M0C A;  3QPL A;  3O8H A;  4MIM A;  1EF4 A;  2GBY A;  1AU7 A;  2E1O A;  1HLV A;  1IDZ A;  4D5C A;  2LKX A;  1RET A;  4IHY A;  2NOG A;  1MBF A;  1TWF J;  4IHW A;  2JA6 J;  2EZH A;  2L7F P;  1I6H J;  2E19 A;  2R5Z A;  3SDG A;  3TED A;  5IYB J;  1IDY A;  1T33 A;  2DMP A;  2JA8 J;  2XGE A;  1W0T A;  4ABZ A;  3BR2 A;  5E3M A;  5IP9 J;  3JRA A;  2ZB9 A;  3HOX J;  2I10 A;  1JTX A;  2O7O A;  3JRF A;  5M3F J;  5C4X J;  5IOY A;  3BTI A;  2JA7 J;  3BQZ A;  2JA5 J;  5JLW A;  3TP3 A;  1GV5 A;  2XRL A;  3GTL J;  4XK4 A;  1H89 C;  5IOZ A;  1LE8 A;  1QPI A;  1YRN B;  1ITY A;  2E2I J;  1GV2 A;  2ECB A;  1F43 A;  2LP0 A;  2HXO A;  4A3C J;  1MSE C;  4M3G A;  3GTP J;  3K7A J;  5M5Y J;  1LFU P;  2WAQ N;  4FTH A;  2XSD C;  1IG7 A;  1GDT A;  2VI6 A;  1QRY A;  2JJ7 A;  3HEF A;  5EEA A;  2DMU A;  5GPA A;  3GBG A;  5J1Y A;  1AHD P;  1JT6 A;  3BR5 A;  1JKO C;  1TWG J;  4RDU A;  1ETX A;  1RR7 A;  4A3B J;  3MVP A;  5EZG A;  1I50 J;  4UUS B;  3JRH A;  1UG2 A;  2DTZ A;  3S1Q J;  3CDL A;  3LSG A;  2HOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...