2UV1A

Hexagonal crystal form of gams from bacteriophage lambda.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
78
structure length
78
Chain Sequence
QQLAREEKEAELADDMEKGIPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords HOST-NUCLEASE INHIBITOR PROTEIN GAM
publication title The Crystal Structure of Lambda-Gam Protein Suggests a Model for Recbcd Inhibition.
pubmed doi rcsb
source organism Bacteriophage lambda
total genus 31
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06064 Gam Host-nuclease inhibitor protein Gam
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2020 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2uv1A00
2UUZA 2UV1A
chains in the Genus database with same CATH superfamily
5FRNA 3O3KA 4E7ZA 1MH4A 3FWEA 5K5RA 4XLEA 4OAYA 2Y0MA 4PZJA 2IPQX 3BY6A 2KQRA 5IP7J 5IY5H 4A3MJ 4LB5A 1TP4A 1V5FA 4QIWN 3HGYA 2IXSA 2CWEA 4DJAA 1F4KA 2VBYA 2KJCA 1YW9A 2H94A 1XC5A 3KP5A 5BOXA 1H0MA 5A2QK 2R7SA 2DFEA 4NC6A 4MFEA 3JCUC 1C0WA 1X1PA 1PP7U 1IN5A 3FMSA 1FP1D 2BY2A 3VYRB 1HW5A 3DU6A 3VFZA 1UMQA 1DQUA 3H3VK 1SAXA 4NDLA 1VQ7I 2LTPA 4XORA 2OAZA 2Q0OA 1YJWI 4M6VA 5FKLA 1J75A 2ESHA 2Z3YA 5EEAA 3AG1H 4IHXA 2L2OA 2Y0SN 3DLAA 2HVSA 1B9NA 4BS9A 5FD5A 3NEUA 5F0HA 4I6ZA 1EJ9A 4A93J 2DK5A 1WJBA 2VT3A 1ON1A 3Q9VA 4HDVA 1KU9A 9ANTA 3F6OA 1VQ9I 2PMZN 3PFIA 3K1NA 2N8GA 3D5SC 3WG9A 1A04A 2VQCA 5E8IA 5JI6A 1MNMC 2JQ7A 2WADA 4M72A 3OYIA 1OISA 1UG2A 2IVMA 1SVMA 1TNSA 2MH2A 3FMQA 2DOEA 3KX2A 3PNYA 3S2HJ 5B3SH 1RIOH 3U9GA 2XHKA 2HVQA 2XGDA 3Q0UA 4KDPA 2CQXA 5J3LA 4GGGA 2OZ6A 2M9HA 2NNYA 3O8GA 3PM1A 1WJAA 3HUGA 2IW5A 2JA5J 5ICEA 4NQWA 2F5FA 2XPWA 4HV6A 1BA5A 2MC3A 2RC4A 2JUCA 1MGTA 3JAMK 1V54H 1MSFC 2RV8A 3PSIA 2WAQA 4XOPA 3HOUJ 5F08A 1IXRC 3LFUA 2NVUB 1IRFA 2HYFA 4ZTJA 3H1CA 1LDJA 2ETHA 2IS4A 4E6KG 4KICA 4YIRX 4G12A 1P2FA 1T8IA 1BW6A 2A5YB 1OPCA 2RAEA 3BZKA 5M3FJ 2L5QA 4P9UA 5D6FA 5DTDA 2XF5A 3AG4H 4GDFA 3V7RA 4KIGA 1JTXA 1Z7UA 3CDIA 2FE3A 2ZSIB 3KIOA 2EFPA 3WTSC 3ISPA 1T0FA 3WODF 4QTRA 3W2WA 2K4BA 3CCEI 3HM5A 3IV5A 3GF2A 5GADJ 5FKMA 1MBJA 5DDGA 4E7LA 3OS2A 3MZHA 3KYLA 2YS9A 1TZLA 3TEDA 1ULYA 2HOTA 3CJQB 3GTKJ 1G4DA 5TJJA 3LA2A 3SFIA 3EETA 4OOIA 1MNDA 1MBHA 2ZSHB 2STWA 4EJVA 3F0CA 2A6TA 3OYNA 4A3LJ 3DU5A 2WV1A 1JUPA 3KYCB 3GVAA 2M30A 1V4RA 4TV7A 2D2WA 2MC4A 3OL4A 5FD6A 4BGDA 1MDMB 3E6CC 4B48A 4KFCA 2CV1A 4FX4A 1BIAA 3SDGA 1WH5A 1SVOA 3I53A 2R3SA 4B3AA 4EV0A 3CCRI 2P5LC 2DA5A 2HPIA 3JAMZ 3KLOA 5L3FA 4AYBN 1X19A 4DIQA 4DW6A 1P7JA 4XLFA 4ZYEA 1JHFA 2Y2ZA 2VBXA 2F4OB 2W1OA 2W4SA 2F4MB 2PMZA 3HOSA 1TBXA 1LB2A 1MBFA 1XMAA 1HSTA 2M7BA 2LY9A 2BZTA 1YS7A 4S04A 3CZ6A 1NK2P 2LLKA 1DU6A 1ZHFA 4O5VA 4FHTA 2DT6A 1U2WA 1USSA 3MD2A 4Y52J 1LJ9A 3LQQA 3GEZA 2Z16A 2JPBA 1AA7A 3K1PA 4D5CA 4ABZA 2DODA 3PUBA 1CF7A 2DOAA 3PNVA 1ZREA 5M5YJ 2GXBA 3VEPA 1FY7A 1MW7A 4QLCU 1G3WA 4WXCA 3TL4X 3IUOA 3MVPA 4QSHA 2EIJH 3DQVC 5ICFA 3CMEI 1IRXA 1QBJA 2Z5UA 3IWFA 4L9VA 2DLLA 1GT0C 2HDCA 4P1WA 2IP2A 4EJUA 4HBLA 1LFBA 2F5EA 3FZVA 3GFJA 3PL8A 4CZZA 1XSXA 3CO7C 3NARA 4E7SA 2VT2A 3U21A 3F21A 3LSIA 2M4KA 2MFZA 4EJWA 4CGZA 2HFHA 2DYSH 2A07F 2BY0A 3E7LA 5JVGF 1ZGAA 5HS8A 5LRSA 1FIAA 2BEOA 1HDPA 2MH9A 3GFLA 2GIVA 1B8IA 3MZ8A 3CO6C 1VQ4I 1R1VA 3ZXSA 4UVAA 3VSKA 3X2QH 1BJAA 4GCVA 1S9HA 2ZMEA 3AAFA 1JXSA 3EUHA 1VQMI 1W5CC 2OUMA 3LQRA 1QHHD 3ZQGA 4XQFA 1NK3P 4LMYA 2M4GA 4CYCA 2HYGD 1KA8A 3I56I 5KHDA 1QVUA 3DTKA 1ZLKA 1R00A 3MMYB 5D8LB 3IC7A 3IAM2 3CESA 1I1GA 4I09A 5EEGA 4WF2A 3RCOA 2DXIA 5CVVA 3IAS2 1BI3A 1JGGA 2IA1A 2LVSA 2M8EA 5J1UA 3WGIA 1ZRCA 2X1EA 4B09A 2R4GA 3K7AJ 3G1LA 3ZCOA 4RGRA 2ZXHA 3JREA 2OU2A 1J59A 1HW1A 1NG6A 2EV6A 1H88C 1Q1HA 1GXPA 2IGKA 4XBFA 4UUSA 3HZJA 2QSGX 3SZTA 4UY8I 2K7LA 1FP2A 2ZXWH 3F9KA 1OCCH 2LY2A 4AYBA 1ZR4A 1TWGJ 4AD9A 4HRIA 4WXHA 3UKGA 5DYMA 2X1CA 4BYYA 1WPKA 1Z1DA 2XAUA 2NS7A 3L00A 1XGOA 4Y7NJ 1EF4A 1FOWA 2VC1A 4LK0F 4HNUA 2QLZA 1K6OA 2NVXJ 1HA8A 4F92B 4MNUA 2ACJA 1D0ZA 4BQAA 3B73A 4A3EJ 4MEYF 2OTLI 1SD7A 3ZMZA 1JJ6C 4AIDA 4NQWB 5BNGA 1R9TJ 2KRFA 1I3AA 3KFWX 4N4OB 3KEQA 3BG7A 3R4KA 4LK1F 1TWAJ 5HS7A 3BTCA 1KQ8A 2DJNA 2DYRH 5FROA 1VQ8I 2QQ8A 3I4NJ 2LBFB 1TTYA 4L18B 5HVQC 1XCVA 1BM9A 4HOBA 2P7VB 1HW2A 2ZCWA 5ICCA 3OYMA 2DA1A 2BV6A 2L02A 2CV2A 3A0HC 4RGUA 3J7AY 3R0JA 5LEKA 5F6FA 5EJCA 5KCMA 3WTYC 3RPUD 1XMXA 3WE3A 2EZIA 2KP6A 3TMOA 1STZA 3ZR8X 1SEUA 2KRCA 2D45A 2IA2A 5GAHJ 4HQEA 1G3SA 2LSOA 3S3MA 4CCJA 2CQ7A 4XSXF 3REOA 4B1RA 4L9NA 2HZDA 3D5LA 4PFPA 1HXDA 3U2RA 4BE1A 4BQOA 3P9CA 2RGVA 2XUBA 4G8XA 3LNQA 1FLIA 4OIOF 5IYDJ 4DGWB 3OR1C 1IG7A 2V9VA 1LE8B 3K4CA 3FKJA 3L09A 4KIFA 3BCAA 3SEQA 2EV0A 5D8KB 5GTIC 4G7ZF 2D1VA 1E0EA 2ICWG 2JJ7A 2Q1ZB 2M34A 2IS6A 3N97A 2RNGA 1E3PA 4U87A 4ZYAA 2ECCA 3IHUA 4EQQA 1BI0A 4WCGA 3LFKA 4XK4A 1XB4A 4ZYDA 1HQCA 3TP0A 3ZN0A 4BEHB 1DUXC 1T6SA 1M1EB 4C2MJ 1T0FC 4EVIA 3LSHA 1RUOA 4ESJA 4U7BA 1FEXA 2HXIA 2L7FP 1XPXA 3CTAA 2QQAA 2QVOA 1D0YA 2F5CA 4A5NA 1HOMA 4BXFA 2DPDA 2A6HF 5LBQA 2EZLA 5DUIA 5FLXK 5D5WB 3IRRA 1Z91A 3S93A 1G6NA 2PLYA 3E6BA 1PVEA 4L9TA 1D5VA 1P6RA 5L3DA 5HLHA 1F9NA 2V79A 1J0RA 4Y15A 4FETA 3H0DA 3W2VA 1YLFA 4BHCA 5DS9A 3J81K 1FBSA 3R61A 3I55I 5JHFA 2F2EA 2DQRA 2G9WA 3H5RA 2D1HA 2QBYA 5D4SA 2MLKA 1YOVB 4ESBA 2L54A 1X1BA 1QQIA 3F23A 2PJRB 3WGHA 3TW7A 1U5TA 1SAUA 2VBWA 3I4MJ 3BWGA 2LRDA 1BBYA 4JK1X 4WX9A 3E6DA 2QQBA 1B59A 3CDLA 1RKTA 1OCOH 1PYVA 1IXSB 1YHQI 2XAJA 3WTUC 3K0LA 3LWFA 5LHIA 2DPUA 1YJ9I 4B43A 4F3QA 5D5VB 4U0VA 3MZYA 4LIVA 3TQNA 3TW6A 5JR3A 3H5AA 1BOAA 2F5VA 1GV5A 1IAWA 2O0YA 3WTWC 1POGA 3CCSI 4O3MA 1WFXA 1P9QC 4NBQA 1F36A 4XN0A 4GO1A 3CCQI 3ZPLA 5DCMA 1FTTA 2WBMA 3CD6I 2O5RA 1VQKI 3N05A 1SD4A 5H6QA 1OYIA 1T08B 5JLXA 5HLTA 3GBGA 1D5YA 3WTVC 3JSPA 1Y8QB 2BW3A 1UFMA 2BYVE 2H8WA 3E6MA 5FLXZ 1UB9A 2ZMEB 3T5XA 4FX0A 1LFPA 4GYIA 1WH7A 3SYTA 2FNAA 3F8BA 4BNCA 3CCLI 1Z77A 4R8HA 1KGSA 2NAZA 4OWRB 1IN7A 5B1AH 3DTEA 5K7HA 3PJRA 1HKSA 4XOTA 3J81Z 5JHUA 2VJIA 4I0AA 4H0EA 2WB1N 4YG2F 4M3GA 4NUBA 4PSWA 4XRFA 2TRTA 2ZJQF 4IHSA 3F8MA 3ZMUA 3WTTC 3COAC 3FMRA 1BN5A 4FISA 4CCOA 4W1UA 3W6KB 1P4XA 5B1BH 1D1BA 1UHMA 3OWTA 2IGOA 2Q8KA 1KU3A 1AWCA 3WU2C 4W97A 3GW2A 3CF5F 1TC3C 4CCMA 3A1YA 4KA4A 2V4JC 2CQNA 4MTEA 2LF7A 2XVCA 4F52A 3CCUI 2X85A 4M3DA 3HHGA 5K5QA 4LD5A 1XCBA 1ETKA 1WJ5A 2VB6A 3EUHC 3SZPA 1W7PB 2W48A 2QZ8A 4BY7J 4B47A 4YEJA 4ON0A 2Z9OA 1TW2A 4HAMA 5FKOA 2LH9A 2GA2A 1Z9CA 4ESFA 2FSWA 3FM3A 2R5YA 1QVTA 2KIMA 3GXOA 3I4PA 2ZXJA 1O3QA 3I5UA 3S8PA 2GOXB 2QKLB 4LOCA 4CDGA 1R36A 1H8AC 4RB1A 3V7CA 2PJPA 2E7XA 2ZXIA 2Q2EB 1I6XA 2DFFA 4EJTA 3BTJA 3GZNB 2XSDC 3DKWA 2A5WA 1U9NA 2Y69H 4BJTA 5BPIA 2VKEA 2JRMA 3F6VA 1H9TA 1APLC 3MEXA 2H1LA 2AO9A 1YIOA 3HRSA 5EYRA 2WTEA 4CCNA 2K9QA 4I98B 4Z6YA 4N4NB 1O3RA 2GQQA 5IOYA 1O57A 1B6AA 4HSTA 3HOTA 4BE0A 1PP8F 3R6SA 4ZZDA 4PCQA 4BDZA 2NVYJ 4HV5A 4MO7A 2DA6A 4RAYA 3J7YJ 2E1NA 2LNBA 4AIHA 2MG4A 2F48A 4M71A 2JK3A 2MW8A 2HR3A 1O4XA 2CQKA 2FMYA 1RR7A 4U0WA 2K3FA 2E36A 4DQ2A 2R7VA 2FXAA 3WGGA 3JRIA 3DBHB 3KPHA 1YTYA 4ITVA 3OSGA 4ENMA 1RRJA 1QU3A 3C18A 2KIQA 3DKYA 3OSFA 2ISYA 2DJIA 4GXOA 4F7ZA 2PQ8A 3B02A 3OYLA 3Q9SA 2HOEA 5CVIA 3OYAA 4IOCF 3K69A 2YX7A 1XD7A 1A6QA 4NC7A 5HOOA 3BDDA 5EDNA 2K02A 4PGGA 5L3EA 1OFCX 4AIJA 1WJEA 3BG9A 1MSEC 5DUKA 2DMQA 3L2WA 3CUQC 3JRDA 4A6EA 4EM1A 5DCFA 2NOGA 4BU2A 3F8CA 4MHGA 3MAJA 4XLHA 5E3NA 1PUEE 1ZK8A 2MD0A 3L2UA 3KLNA 2EINH 1RI7A 3SQNA 1Z7LA 1XDSA 4MGRA 5ILSA 2OJED 3G2BA 1KU7A 1N78A 4D1QA 3FXKA 4RMNA 2WA0A 1I3QJ 5HS9A 4HX4A 3M1EA 3WTZA 2HTJA 1BJZA 4RB0A 3ERMA 2JT1A 2E60A 2KDOA 1WSUA 5EZGA 3PUFA 2XRLA 2DK8A 2LOOA 4JX6A 5K5OA 1HCRA 2V1NA 3KP7A 2W84A 4V2GA 3AL0B 3HGGA 2UV1A 5F0CA 5ERIA 4BDYA 2PEXA 2K9SA 5LFAA 2H6CA 2H1KA 2XKOA 3LA7A 2FU4A 3MKLA 3VB2A 4OIPF 3ABUA 1YW8A 1J2XA 2NS8A 1K78B 3ZRGA 2OF7A 4MFDA 1IRZA 1ZRDA 3GTQJ 2WAFA 4DYRA 1S7OA 1BL0A 1UZCA 2CW0F 3PQJA 2I10A 1QZZA 4DNCA 1A31A 4LGWA 3L2QA 3I58A 1KU2A 2XGEA 2ZO4A 4H4KC 3SZGA 3RPUA 2TDXA 1IZ1A 1VQ6I 2E1CA 5DM6F 4XLAA 1B1BA 4AVPA 2DMPA 1NG7A 4IRGA 5DCMB 3OMYA 5J8FA 4CHUA 3I64A 4BL0B 1FBUA 3I59A 3OYDA 4LIUA 3B6CA 2DFHA 1TQIA 4A3DJ 4BE2A 2RQPA 3TGNA 2M8GX 1U5TC 2X9DA 5J40A 3C2GA 5A2QZ 3JRCA 3CP2A 3ULQB 4IJAA 3HRTA 4KUMA 4J01A 4MEXF 1MD0A 1A6IA 1GDTA 2KISA 5K7FA 2FBHA 4XONA 3VDXA 4ANJA 1ZG1A 1S72I 2EH3A 2NYXA 2MA3A 3D1NI 2B9SA 3ERED 3W3CA 2ELHA 4IX7A 3ECOA 2X6XA 2FRHA 1R5ID 4PGHA 4HF0A 1D1CA 2VKHA 4NHJA 3A01A 2DMNA 1NTCA 1N25A 3GYHX 4K2EA 5B5EC 4ENKA 1LUJB 4Q47A 1LPQA 1X3UA 3V8KA 1B72A 4DYQA 3RYPA 5FLMJ 2DTZA 2IEKA 3W2AA 1PDNC 1JI8A 5CQEA 3QPLA 4UV9A 2KIUA 1AKHA 4XR6A 1YX5A 4MQ9F 2G7HA 2DA7A 3MKWB 2Z99A 2P6TA 5F0FA 4BUPA 2KRHA 3BG3A 2R5YB 2EFNA 4U7DA 1JKQC 5E79C 3Q5FA 3V8LA 4BBRJ 4EATA 2BOLA 4HNVA 4AU7A 2K5CA 5ILUA 3ZQ7A 1MBGA 3HSFA 4KMUX 3CJRB 2XAHA 2R7XA 1FYKA 4CCLA 4EM2A 2XB0X 1MJ9A 3S32A 2ADUA 5FRMA 3TO9A 2NXNB 2Y0SA 2W85A 2R0QC 2IA0A 1LEAA 2NVQJ 2CO5A 4CXFA 2QSHX 2OBPA 2ESNA 3G4SI 5F27A 1R49A 4C3JJ 4AIKA 1ZTRA 1FPQA 4OU0A 1RC9A 1V55H 3M1CA 3DF8A 5ILVA 1RUNA 4O6JA 1HC8A 5EZHA 2O7OA 2JN6A 2HXOA 2GM4A 4XIDA 3L1PA 2WY7Q 3J7ZI 1SFXA 3JRGA 2KHMA 3N4MA 5E17F 2DU9A 3HEFA 5CVRA 3MQ0A 1VI0A 2VIXA 2WC2A 2VONA 3DBRB 2CG4A 4B44A 3CF2A 1JUMA 1AU7A 3CLQA 3IL2A 1J9IA 1W5TA 3ONQA 5ED4A 3E1SA 1GV2A 1QPIA 3ABLH 4S0HB 2YU3A 3G73A 4JOMA 3J7AO 1K6YA 2CSOA 4ZDOA 3G3ZA 3K2AA 4WK8F 3DPLC 3K1MA 2XF7A 3E3VA 1ETOA 4UV8A 4ZZLA 5M3MJ 1X1DA 1FMVA 1P7IA 1FSHA 2XRNA 2CV0A 4IHYA 2IBDA 3K4JA 1J09A 2HKXA 3BR2A 2IGNA 3H0GJ 4LLLA 1LDDA 1UELB 3ABTA 1X2MA 3E0JB 4CYDA 1KZHA 3QODA 4A69C 1AHDP 1RESA 3BTLA 2OPTA 3TO7A 2EB7A 2BXZA 5F04A 1YYVA 4RAFA 3CCVI 3G6EI 1BOBA 4HZFA 1FYMA 1IUFA 3TDUC 5CVJA 3PQKA 1R5GA 3BZCA 3VYSB 3S1NJ 1EV7A 2J5OA 5CVUA 2XGXA 3ECHA 3H35A 5AONA 4U0YA 3DV8A 2RKHA 5GPCA 5FLVA 3S16J 5D5UB 2R7FA 4HPQA 4HYEA 5HDGA 2HNHA 3HJEA 1XMKA 1BR4A 4CICA 1I50J 2CQQA 3K4NA 3WG7H 4Q4ZF 2D5VA 2XGCA 5EG0A 3OR2C 2LFBA 1MBKA 1FNNA 1VQNI 3S17J 3FKIJ 2KPMA 1D8KA 1HKQA 5AIQA 1IRGA 2F4IA 3M07A 2PG4A 2O3FA 4XN3A 3TP3A 2R5ZA 1MNEA 1ZG5A 2HPMA 4BHBA 5FB2A 1VQOI 2LF8A 4CO8A 1W4MA 1RNLA 3CMYA 1OMIA 2EFQA 2W24A 1WJDA 2V9KA 1SFOJ 3FK7A 4AM3A 3NQOA 4ZDLA 2EFWA 1PUFA 2E34A 1X1CA 3DTIA 1I5ZA 2XSJC 4G94A 4Q5SF 5FO5A 3HUGB 5HNFA 2VQLA 4Y17A 4IOAF 2BY1A 1W36D 1UJ8A 3SEZA 5K7ZA 1IO2A 3O6BB 5J6XA 2K9LA 3UR3C 2L7ZA 2V7FA 1QA6A 1ZGJA 1YRNA 3F8NA 2PX9A 4LLNA 2XC7A 1WQ2A 1SMYF 2L4MA 5EEHA 3GTLJ 5JFRA 2EPFA 4C2TA 5J1YA 2DQLA 2KDZA 3FXOA 5F64A 2IS1A 4YFNF 3OYJA 3GCMA 3LSMA 2E2HJ 5F1JA 3GTGJ 4IO9F 3CUQA 1IV6A 2V6CA 2L0KA 4HX7A 4UXNA 1NHAA 3VWBA 4UNOA 1YG2A 4C30A 3BR3A 1XGMA 2DDAA 3TOBA 1I1SA 3IH3A 4JX4A 4DZPA 2OV7A 2DA3A 3KZZA 1WCMJ 4L5JA 3ZOBA 2A6EF 1UHWA 2WY8Q 3BG5A 2O9LA 3WE2A 3VYUB 5E1XA 2VQGA 2XV4S 4D7NA 1ON2A 2P81A 1B9MA 1FOKA 2VJ5A 3GZ6A 3OY9A 3DPUA 5GAGJ 1DP3A 1OYWA 5L3CA 2HGCA 5E3LA 3W6JB 5JVTA 5H2FC 1JGSA 4M3BA 1JE8A 4DBRA 1I39A 2W82A 3GZ5A 3EPZA 3L7WA 2K3PA 5FJ8J 1P4AA 1TWCJ 1QZEA 2XPVA 2DCEA 3ABKH 1WKMA 1XSVA 1EA3A 3ZQCA 5FGMA 1WI3A 3KP6A 3GX4X 2VODA 2JZYA 1UHSA 1TL8A 3HOZJ 3ZMTA 4L0ZB 3M8FA 3BOQA 3C1DA 2YUSA 2OTJI 3LSJA 3CC2I 6PAXA 3OYBA 1MIJA 2CS3A 4RB3C 4AWXB 1O3TA 2XAQA 5J4VA 1RETA 2EQRA 4RGSA 4Y13A 4F93B 3OIPA 2XAFA 4OINF 3S3NA 2GBYA 5LGTA 4KN7X 2DAOA 2K4JA 2VXDA 2LD5A 4UVCA 5EGOA 3VYTB 2E2IJ 2FOWA 3RSNA 5IT9K 1FOYA 3W6VA 1WVRA 3QPTA 3Q0VA 4D5FA 1EH7A 2VL8A 2ZKZA 1OCZH 3G71I 1MZBA 1U78A 4FE4A 4M3FA 3BTIA 4G7HF 4YFXF 2DA4A 5IP9J 4XICA 3M8JA 3FX3A 3HL2A 3A4CA 4NC8A 3QYEA 4LG3A 4A0XA 3H36A 3DEWA 5HDKA 3VSLA 3KYDB 2DDBA 1BC8C 2BXYA 2CGPA 3S14J 1CF7B 3KP3A 4DZJA 4U88A 5HLIA 2QKMB 3IKVA 2E1MB 2R7TA 3FBNB 4AUXA 1X3ZB 2CUFA 3EUAA 3S3OA 1Z6TA 4E7HA 4A3CJ 3M8EA 1IV8A 5HDNA 1K79A 1VQLI 4N9HA 2WV0A 2R7RA 3D5RC 4ZYHA 2CYYA 1FZPB 2JA8J 3H5NA 3NRVA 2H8RA 1U6GA 5C3EJ 2VI6A 4IQJA 2CJJA 4P9FA 3ELKA 2O61A 1H9GA 4BAYA 3GTJJ 4ETSA 1WJFA 1T98A 3LMMA 4L9JA 1F1ZA 3ZMSA 1B8IB 2L9RA 1R6RA 2RREA 5KAIC 2IJLA 2VUMJ 2EJRA 4BJ6C 2DA2A 2JA7J 4RAGA 2JWTA 2UXNA 5IT9Z 1S6LA 1U0JA 3RZDJ 5J8CA 1YJNI 3OV8A 1ONVA 4BH9A 5IOZA 3CJTB 4CYCB 1TNTA 4UB8C 2HQ5A 1JT0A 3QYFA 5IPAA 4E7JA 4JX5A 4HLYA 1Y39A 2Y48A 1K83J 2HDDA 2K86A 2AHQA 4HEA2 3PIOF 2E1OA 1SANA 3P5JA 2EA4A 4XKBA 2MD5A 2ELKA 2C6YA 4DOZA 2LREA 1ERDA 2A61A 2COBA 4V19K 4HQMA 2FBIA 1OLTA 4PSXA 5DM7F 2QSFX 3SXYA 2XB5A 2WWYA 1QZYA 1RPWA 3KZIC 4UUSB 2OCCH 3EUKL 1O7LA 4OIRF 1YW7A 1A36A 2QEXI 1D0XA 1DGWY 4IVNA 2OQGA 3NWSA 3SHFA 4M9SA 2PFBA 5L3BA 2QQ9A 1IN6A 2LK2A 3ZQQA 4NNJA 3ZQLA 3HKZN 2GIZA 3BR6A 1L0OC 3RJPA 3RKYA 4R1HA 2M87A 4UVBA 3FISA 3I3LA 4XM3A 1LDKB 2GXGA 1S3JA 3BC8A 3CUOA 3D0SA 1LNWA 3H9QA 4C3HJ 2COMA 3A02A 2L9SA 2BGCA 5AIPA 3M4OJ 1G8XA 2LY1A 3BPVA 3DLLF 1K4SA 1S7EA 3DWLE 3BLYA 1TQMA 3VOEA 2V1UA 3AFHA 5K1YA 4KMFA 3BPXA 1BI1A 1Q1VA 1D8JA 2HTSA 2V9PA 3LL7A 3EQLF 3MWMA 2O8XA 5CQGA 3HYIA 3BCBA 3QAHA 4MIMA 5TGTA 1MMDA 4EGZA 4A3GJ 1R4NB 2LDUA 5LD2C 2HWVA 2ID3A 1MDMA 4ZJZA 2VJ4A 1Z21A 3J80K 4P96A 1K61A 2V6EA 4ENNA 3ZMVA 2L7KA 2DT7B 1SVLA 3OS0A 1T56A 3CUQB 1JKRC 3K6GA 2M3AA 3GO5A 4ZH4F 3CDHA 2JA6J 3LSPA 5DEQA 1GLNA 1ZLJA 3H9JA 3A03A 1IW7F 2LKSA 4QPQA 4BQQA 2HEOA 1JTYA 3VODA 2QCOA 1MMSA 3WU1B 2RN7A 1PJRA 2EILH 5HODA 1E3HA 5C44J 4FE7A 3FK6A 4J00A 2UWMA 3JRAA 2OCEA 1ZKGA 2HDWA 4PJLA 2BHYA 1H89C 2R7UA 2HOAA 3HPGA 5F1RA 4PJMA 4M74A 3KP4A 1W7PD 2BHZA 2G0EA 4A0ZA 3QYBA 2WB1A 4DYCA 2CMPA 2E2JJ 4XRSA 2OQRA 3VPRA 4RB2C 3HOWJ 4M6YA 1R58A 3JTGA 2CUJA 1DPUA 2LP0A 2A3SA 1ZYRF 3GUDA 4N9IA 2E5ZA 2H09A 3FHZA 2FA5A 1ENHA 3R60A 3HBLA 1YI2I 1CGPA 3HTUA 4M9XA 4XLCA 3FXMA 3O2PE 3LA3A 2X51A 1I6HJ 4P55A 4JYKA 3HOYJ 2VKDA 2PI0A 5GP9A 1O7FA 1FTZA 4RGXA 2ECBA 2Z1DA 3HKZA 3C2HA 2EFOA 3UNGC 5KVRA 2M0MA 3DKXA 2ZFUA 2K40A 4IXAA 3ZN1A 3LSRA 4FTHA 2QBYB 3H3UA 3FDYA 2KZGA 1XGNA 4D0PA 4MQVA 4CZCA 4E7KA 2VBZA 3ROUA 1XSDA 1YS6A 1GVDA 3H9GA 3BT9A 5E18F 4ZYGA 1U5TB 5LHHA 1FX7A 2VOPA 3ASNH 2IGMA 4WWCA 2OA4A 3BG6A 2M1BA 4JQFA 2BVLA 4M3EA 2JVGA 2NOJB 2OD5A 1QNTA 1R1UA 3E5XA 4II3A 1T2KA 3A2KA 3FXRA 1L3LA 3S1MJ 1G3TA 2NS0A 1VFCA 2FEZA 2CFOA 2JPCA 2H27A 5L3GA 1QO0D 2V26A 2ME0A 5HLGA 2EIMH 2L9NA 1UG0A 4M73A 1YIJI 3V8JA 1MJAA 2DI3A 3P9IA 1OCRH 1A35A 2NVTJ 3TKYA 3RI4A 2ZJ2A 5E3MA 2LKXA 2R7QA 2VOOA 2GXAA 2M5WA 1ORKA 4HLXA 2E5NA 5DD8A 2BW3B 1BW5A 2IAIA 3FF5A 3RZOJ 3OS1A 1SMTA 2K9NA 3GLXA 2FBKA 3HSEA 2KKOA 3HG9A 1GVJA 5M5WJ 3LAPA 4BQNA 1P92A 1IC8A 1N75A 3AG3H 2XIGA 2FOKA 4MLOA 3QPHA 1WHUA 4M6XA 3AL0C 2KMUA 3IH4A 3RPQA 5LLQA 1G59A 3RTRA 3GLLA 1DGRM 3E97A 1F43A 2LYCA 2FD5A 1T39A 1ITYA 3SJMA 3HIFA 4L5EA 3CMAI 1XGSA 2EV5A 4FQGA 2Y31A 2IRFG 2A05A 2Y9YA 3K2ZA 3OYGA 1ZG3A 3C3WA 4HW0A 1K7AA 2P7CB 1LEBA 3HB9A 3LSGA 3BROA 1KYZA 3HHHA 4RAZA 2JTVA 3JSOA 2EA2A 1FWZA 2OZUA 5KNLA 3JRHA 4OIQF 2YX4A 5J1RA 5C4JJ 2KLOA 1WI9A 3O8HA 5KK1A 4ASNA 1IDYA 1JKPC 1BR1A 1RZ4A 1W1WE 1Z0XA 2EIKH 3QU6A 2AQEA 3H92A 1U3EM 2LBFA 1I27A 1JKOC 4UUTA 1BC7C 3GTMJ 1HDDC 2L7MP 2LR8A 2XASA 3HRMA 3CCMI 1O3SA 3HOXJ 4GRIA 1UAAA 1X2NA 2EWNA 4YRVA 3ASOH 1YE9A 3KP2A 3R0AA 4RLQA 1GUUA 1XG1A 3I54A 3LAJA 3QPSA 4I76A 4IRHA 3HPHA 1SFKA 5BMZA 2EBIA 2O8KA 2X6YA 1MBEA 2HU9A 3RDIA 3V7SA 3TBIA 1W5SA 3Q0WA 3F22A 1OR7C 1XTAA 2Y9ZA 1YO5C 1TT0A 3QRFF 3NAUA 3KZYA 2JVHA 4A12A 5C4XJ 3JRBA 2YPRA 2VC0A 1DPRA 1LE8A 4RS8A 3BZ6A 3WTXC 2B63J 1IN8A 2Z2SB 3I9V2 3GFIA 4I99C 1ZQ3P 2BY3A 4AVZA 1ZELA 2FUG2 2GAUA 3LOCA 4BJ5C 3CC4I 2P5KA 2AQFA 4B3XA 4CCKA 2EZKA 2L01A 2JA2A 1F5TA 1X4PA 4BEHA 3RKQA 1FMWA 4A3IJ 1NH3A 4KJZA 4CA0A 1ZAOA 1QRYA 1RKWA 1R1TA 1S7AA 2QM3A 4KT5C 1IN4A 2R7WA 2HOSA 4XLNF 4EGYA 4Y4RA 2KZVA 4EM0B 1R22A 1FSEA 4JBAA 1HLVA 1X1AA 1KYWA 3SFZA 4C3IJ 3IP4B 4LJZF 1Y0NA 4IL6C 1Y1VJ 1E17A 5EF6A 3ZGKA 1T38A 2JRTA 5LRRA 1ZARA 4I0BA 2E35A 1IDZA 3FM5A 2G7UA 4IHTA 4FCYA 1T95A 2DW4A 2P5VA 4A3KJ 4JP0A 3C7JA 2A68F 2PJRA 4EJOA 3MCZA 2MABA 4LLGF 4OMZA 5HNHA 1ACIA 4P5OA 4L5IA 3OYKA 2OC6A 5GAEJ 4E4HA 1QHGA 2PN6A 2KJBA 2K27A 4XSZF 4XNFA 3GTPJ 3L2VA 4UB6C 1CQTA 4XMYA 1TQPA 2W7NA 4X1EA 2LKPA 5DV5A 3IWZA 2ZC2A 3DP7A 5M5XJ 3EYYA 3KETA 1V3FA 1MMNA 1OKRA 3KE2A 3HOVJ 3AKZA 3RKWA 3ABMH 5D5XB 4KITB 3M3YJ 3K4LA 1X4OA 1MKMA 5E3OA 2DFIA 2EZHA 2NRAC 2FQ3A 3OIQA 3ZQHA 1TWHJ 4HDUA 1LVAA 1W0TA 3U1DA 2X1DA 1ETYA 2LG4A 2X4HA 1E3OC 2FQ4A 4ZDPA 4KYWA 4J19A 1OQYA 1EH8A 1MMAA 1QPMA 1S5LC 3DBLB 3FXQA 3DPTA 2QENA 3B6AA 2P6SA 4QPOA 4HG2A 4XKWA 3IRQA 2HQRA 3ZP5A 5BQTA 4F91B 4UHTA 4A3JJ 2HKOA 2R7OA 4I2OA 4I7HA 3GWZA 1BIBA 3TOAA 2ID6A 4E70A 1VQ5I 4UUVA 2KL4A 1X3WB 3BJ6A 2EK5A 1W36C 1EKEA 2GZWA 4RBOA 2VQHA 5FKNA 1Z3YA 3G1OA 4GFBA 2DMTA 2AXLA 4PJ0C 4YELA 3T8RA 2XPUA 3ZQFA 3I59B 5J4YA 1ZH5A 2W57A 1JHHA 2DBBA 1FT9A 1WRJA 1IXCA 1W7PA 3BR5A 2HI3A 2CW7A 4KT6A 1VQPI 1Z67A 1WZ2A 2CRGA 3CP8A 2PBIA 4G9YA 3EYIA 3PO3J 4HA8A 1LVKA 3GFMA 4WXDA 4NB5A 4N0BA 2HVRA 1FC3A 1Z05A 1VF9A 3K4BA 3LSTA 5CLSA 1Z6RA 4IQ4A 4S05A 1ZGWA 1U8RA 4PJNA 1IUYA 5TISC 2Q2EA 1WJCA 2HQAA 2VE9A 2CFXA 1JJ8C 3WU0A 4D7MA 2DT5A 2K85A 2ME6A 3A01B 3BQZA 3T8TA 2ZJPF 4YIIA 4FT8A 3M7GA 3OYFA 4A0YA 3BR1A 2JUGA 2DTRA 3DEEA 2VE8A 1B72B 4G6TB 2R92J 3RKXA 4FASD 2AXTC 1S8NA 2XKPA 3QOEA 1R4MB 1P4WA 3PNTA 2BBYA 1T33A 5D4RA 1AKHB 1HBXG 3MKYB 1VZ0A 2Z33A 2XROA 4RM2A 2MSYA 4HSRA 4IF4A 2E7WA 1FOXA 4BY1J 4CSWA 3QWLA 1YFHA 3OYHA 2DMUA 3BP8A 4LFUA 3GTOJ 3S2DJ 4Z2YA 4YFKF 1XX5A 2WAEA 2ISZA 3HRUA 4LG0A 3FXUA 2J5PA 1R5HA 3FIWA 4XL9A 1BR2A 1ODDA 2F6CA 1A5JA 3DFGA 3L2CA 4G7OF 2M45A 4C2UA 2UXXA 4RM3A 1MJBA 3RYRA 3HTSB 2VLAA 1SFEA 2W25A 1V5GA 1Z3XA 3LSKA 2KIFA 1USTA 5E1WA 5IYCJ 2ELJA 3P7NA 2O6GE 4DBQA 2TCTA 1R7JA 2I5UA 1LFUP 3JTHA 1WGXA 1OCPA 2FF4A 3PIPF 2H6BA 5GPAA 4MTDA 3I71A 1IJWC 3KEOA 2UZKA 2FX0A 4KNYA 1Y8RB 3K9TA 2MYSA 2E71A 3M9AA 3HC7A 4IPAA 5IYBJ 4ZC3A 3C2BA 3ESWB 5H20A 4RDUA 2M2EA 4AC0A 1JUSA 3S15J 4HNTA 1X58A 1TWFJ 3TO6A 5IT3A 1S29A 4KIBA 2STTA 2RVCA 2P8TA 3CMMA 1YITI 3MFKA 1DDNA 1WWXA 4YIFA 4B4CA 4D9JA 2M0CA 4BHPA 3OOPA 1J5YA 2ZB9A 2QGUA 3RIRA 1QGPA 4XLPF 2BE5F 2O03A 4GYGA 4Y33A 1U8BA 2QF7A 2W00A 2PMUA 4XKCA 2ZFWA 3ML6A 4A6DA 2DN0A 4Y3OA 4HF2A 4A3FJ 4I01A 1FYLA 1Y1WJ 2GA1A 5KAFC 5LHGA 4BXXJ 4IKFA 4XRSG 1K78A 3JR9A 3S1QJ 3HXLA 1FJLA 1E2XA 2GOMA 2GWRA 3PSFA 1OYYA 4A2UA 5FFXA 3JRFA 5IP6A 2JSCA 2UUZA 3F72A 4II2A 5H6RA 1SD6A 2IS2A 4X6AJ 1FIPA 1IGNA 4BBSJ 2YR2A 2R7ZJ 3BQYA 3S1RJ 2L4AA 3QU3A 3HSRA 2ZBKA 2AS5F 4KISA 4QWQA 2VN2A 2R7DA 2A69F 3IH2A 2IT0A 4BXUA 3FXLA 2CH0A 2XAGA 5BS6A 4PFOA 3QP5A 2HYJA 1VNDA 1YQAA 2MBFA 1VTNC 2B0LA 2FJ1A 4X0GA 2RNJA 3FHNA 2QUFA 3CLOA 4V2FA 4IHVA 1R23A 5CJ9A 4HX8A 5LGNA 1UCRA 2E19A 4A3BJ 4OMYA 3A0BC 1FBQA 3WHBA 4OAZA 3PO2J 4ENJA 5FKKA 4PJJA 5E1ZB 3K10A 4R79A 5JLWA 1AOYA 3K4MA 1GHCA 3DEUA 1XS9A 2RQQA 1DU0A 1BI2A 1Y6IA 1V5EA 3V4GA 4L0YB 2DO7A 5BPDA 1OR7A 3OL3A 2RDPA 1D3YA 2XDVA 1RR8C 2YSRA 2FNPA 2E1MC 3K70C 1W0UA 3CCJI 2QYOA 2ZJRF 1J7KA 1R71A 2V1XA 2XF6A 4XRMA 3DXJF 3CJNA 5TRDA 1YX3A 5EG0B 1ETXA 1IF1A 3E5UA 2QWWA 3Q3SA 2QA4I 5LEJA 2BVMA 5E8GA 4CUGA 3T0YA 3IKTA 2R93J 4RLFA 1SC7A 1HF0A 2VXZA 1DP7P 1LQ1A 1HSJA 2HQNA 2R5ZB 1KQ9A 1TW3A 3QOPA 3HDDA 1XN7A 3EDPA 2K9MA 4BACA 3K70D 4RA2A 2F5DA 1Y0UA 1TLHB 3L2RA 4IHWA 5FFZA 2CUZA 2KFDA 2ZNZA 4I02A 4KN4X 3NWTA 2NNNA 2CU7A 5ICGA 3V42A 1ETVA 2ZMEC 1PUFB 5LGUA 1U9OA 2VPLA 4B8XA 3BR0A 3TDZC 5CYVA 1SFUA 2L9VA 4IEJA 2HZTA 3FXJA 3MN2A 1LKXA 4PUSA 3RQ4A 4G6DA 1YRNB 4LB6B 1ZR2A 4C9YA 5J47A 3E5QA 1JT6A 3QQAA 2VKVA 2X0LA 1ZN2A 1B4AA 2ZNYA 2P4WA 1Y56A 1ETWA 3QP6A 1K4TA 5CPRB 2Y75A 4A5MA 2YU9J 5B66C 4EMSA 1OJLA 5DD4A 3G1MA 1G3YA 3PFYA 3S2WA 2GLOA 1KONA 2I8DA 2VPRA 2VASA 3H3ZA 4EEFG 2LMDA 2MGQA 2X6WA 3K4KA 3CQZJ 3KEYA 3ZMDA 3U1KA 4G6QA 4LITA 2PMHA 1REPC 1HKTA 3DCFA 1SD5A 2LC2A 3AG2H 4PK4A 2CW8A 3T1BA 2DOFA 1EH6A 5D6EA 2CUEA 3OOUA 4IRIA 4M9ZA 3KCCA 3GMEA 1G2HA 4CH7A 3BJAA 2X6OA 4XKVA 2FMLA 3CC7I 1MH3A 3MKZA 2B7EA 3BJOA 2MLGA 4IZZA 1N77A 1ZRFA 1D1AA 1KQ0A 2Y30A 4Q48A 4F55A 1OCTC 3FBIB 4E7IA 4PDKA 3CCYA 2JMWA 4LG0B 1MMGA 2VJJA 3I0TA 3F8FA 2HS5A 5E20A 2WAQN 3F3XA 3ZQIA 3L9FA 3OIOA 1GXQA 4HF1A 2X48A 2P0WA 2L3DA 4BKXA 2JSPA 1TT5B 4ZTFA 2V1DA 3JW4A 1XDUA 5EGOB 3OYEA 3P9KA 3SDBA 2KT0A 5CKTA 3RQIA 5GTHC 2M7AA 3J80Z 1ETQA 3WHCA 3OYCA
chains in the Genus database with same CATH topology
1W36D 3SEZA 5FRNA 4E7ZA 2K9LA 2Z2SB 3I9V2 2BW3A 4OAYA 4XLEA 3UR3C 2V7FA 4AVZA 1ZELA 2FUG2 2KQRA 4BJ5C 1V5FA 2AQFA 4B3XA 2XC7A 2IXSA 4CCKA 1LFPA 4DJAA 3SYTA 4C2TA 2JA2A 1X4PA 4BEHA 1FMWA 4OWRB 2R7SA 4KJZA 3DTEA 3PJRA 4CA0A 4XOTA 2IS1A 3OYJA 3LSMA 2VJIA 2R7WA 4Y4RA 2KZVA 4NUBA 4PSWA 1X1AA 3IP4B 3VWBA 4C30A 3VYRB 3ZGKA 4CCOA 2OV7A 3DU6A 1D1BA 1DQUA 3OWTA 2IGOA 2WY8Q 3VYUB 4XORA 4CCMA 2VQGA 3A1YA 2V4JC 1T95A 2VJ5A 4F52A 2L2OA 3OY9A 3DPUA 1DP3A 3DLAA 2X85A 2HVSA 4BS9A 2PJRA 2VB6A 1WJ5A 3EUHC 4DBRA 2W82A 4B47A 1WJBA 2MABA 3EPZA 4YEJA 5HNHA 2K3PA 4P5OA 2LH9A 2DCEA 3OYKA 2OC6A 1EA3A 4E4HA 1QHGA 3D5SC 2VQCA 2WADA 3OYIA 4XNFA 3L2VA 3S8PA 2GOXB 2QKLB 4XMYA 3OYBA 2W7NA 2CS3A 3KX2A 3PNYA 2ZXIA 2HVQA 2Q2EB 4F93B 3OIPA 3S3NA 1MMNA 2A5WA 4BJTA 2VXDA 3VYTB 3AKZA 3RSNA 4KITB 3K4LA 1WJAA 1X4OA 4CCNA 4N4NB 2VL8A 3OIQA 4HSTA 3HOTA 4BE0A 4BDZA 3PSIA 2WAQA 2X1DA 4XOPA 2LG4A 3LFUA 3M8JA 4ZDPA 4ZTJA 3HL2A 2IS4A 3A4CA 1MMAA 4NC8A 4E6KG 3QYEA 4LG3A 3DPTA 2L5QA 4QPOA 3VSLA 2R7VA 4HG2A 4XKWA 2XF5A 4F91B 4ITVA 2R7OA 1QU3A 2ZSIB 3DKYA 2KL4A 2DJIA 2QKMB 2E1MB 2R7TA 3FBNB 1W36C 3W2WA 3EUAA 2VQHA 3S3OA 4E7HA 3OYLA 1Z3YA 3OYAA 4E7LA 3OS2A 3KYLA 4NC7A 4YELA 1TZLA 5HOOA 3CJQB 2R7RA 3D5RC 3H5NA 1MNDA 4IQJA 2ZSHB 1WJEA 2CW7A 4KT6A 3L2WA 2A6TA 3OYNA 3CP8A 4BU2A 1WJFA 3DU5A 3LMMA 4XLHA 4BGDA 2MC4A 1R6RA 3OL4A 2RREA 1LVKA 4BJ6C 4B48A 2MD0A 3L2UA 2CV1A 2HVRA 1U0JA 3K4BA 1Z7LA 4IQ4A 3G2BA 4PJNA 1N78A 2HPIA 4D1QA 4RMNA 3QYFA 2WA0A 4E7JA 1WJCA 1X19A 2HQAA 4DIQA 4XLFA 4HEA2 2E60A 2KDOA 4XKBA 3OYFA 4DOZA 2W1OA 2LREA 2W4SA 1ERDA 2JUGA 2PMZA 2LOOA 3DEEA 3HOSA 2V1NA 4G6TB 1OLTA 3AL0B 4PSXA 4FASD 2UV1A 2M7BA 3QOEA 4BDYA 3PNTA 5LFAA 3EUKL 3MKYB 1VZ0A 3CZ6A 4RM2A 1D0XA 1DGWY 4HSRA 3NWSA 3ZRGA 4CSWA 2DT6A 2WAFA 3MD2A 3OYHA 3ZQQA 2Z16A 4NNJA 1AA7A 3L2QA 3PUBA 2DOAA 2WAEA 3SZGA 3PNVA 4H4KC 3I3LA 4XM3A 1LDKB 1MW7A 3TL4X 3BC8A 3IUOA 4XL9A 3DQVC 1BR2A 3H9QA 4XLAA 2F6CA 2L9SA 1IRXA 1NG7A 1G8XA 3OMYA 4C2UA 2LY1A 4RM3A 4P1WA 2VLAA 3DWLE 1V5GA 1Z3XA 3BLYA 3LSKA 4BL0B 3OYDA 4LIUA 3AFHA 3PL8A 2ELJA 4BE2A 4DBQA 4E7SA 3U21A 3LSIA 2MFZA 2M4KA 3LL7A 3C2GA 5CQGA 5TGTA 3BCBA 3CP2A 1MMDA 4J01A 5LD2C 2MYSA 4XONA 4ZJZA 3VDXA 4ANJA 2VJ4A 3HC7A 1Z21A 3VSKA 3ZXSA 2V6EA 1S9HA 4ZC3A 2L7KA 4HNTA 2DT7B 3OS0A 2OUMA 1QHHD 3W3CA 4XQFA 4IX7A 3CMMA 2X6XA 3K6GA 2M4GA 2M3AA 5KHDA 3DTKA 3MMYB 3IAM2 4D9JA 3CESA 1D1CA 2VKHA 3RCOA 2DXIA 1GLNA 3IAS2 3H9JA 4QPQA 4BQQA 4Y33A 2X1EA 2W00A 1PJRA 2R4GA 4XKCA 3ZCOA 2ZXHA 4Y3OA 4J00A 2UWMA 1NG6A 3W2AA 1JI8A 5CQEA 2HDWA 4PJLA 2R7UA 2IGKA 3HPGA 4XR6A 1YX5A 4IKFA 4PJMA 3MKWB 3F9KA 3HXLA 4BUPA 3QYBA 2LY2A 4AYBA 2KRHA 4HRIA 2WB1A 2CMPA 2GOMA 3PSFA 4EATA 2BOLA 2X1CA 2UUZA 4II2A 4AU7A 2CUJA 2XAUA 2IS2A 2K5CA 2E5ZA 3CJRB 4KISA 2R7XA 4HNUA 4CCLA 2CH0A 4PFOA 1HA8A 4F92B 3S32A 5FRMA 1D0ZA 4X0GA 2Y0SA 4XLCA 3FHNA 2X51A 4NQWB 2VKDA 4N4OB 4OAZA 2Z1DA 3HKZA 3C2HA 4PJJA 3K10A 4R79A 3UNGC 3M1CA 3K4MA 2M0MA 3BG7A 3DKXA 2RQQA 2ZFUA 1Y6IA 1V5EA 3FDYA 3OL3A 2XDVA 5FROA 4CZCA 4E7KA 2E1MC 3K70C 2LBFB 2XF6A 3H9GA 2WY7Q 5HVQC 1YX3A 2KHMA 2IGMA 3OYMA 2BVMA 3BG6A 4JQFA 2BVLA 2JVGA 2NOJB 4CUGA 2CV2A 4II3A 2VIXA 4RLFA 3J7AY 3A2KA 2VXZA 5KCMA 4B44A 3CF2A 3RPUD 2CFOA 2KP6A 3TMOA 2K9MA 2V26A 3ZR8X 4BACA 3ONQA 3K70D 2KRCA 3E1SA 3S3MA 3L2RA 2L9NA 2CUZA 4CCJA 3NWTA 1UG0A 2HZDA 3D5LA 4PFPA 3V42A 4BE1A 4BQOA 4JOMA 2VPLA 1K6YA 4ZDOA 2R7QA 3OR1C 4DGWB 3DPLC 3K4CA 3FKJA 2XF7A 3BCAA 3SEQA 2E5NA 2BW3B 1E0EA 1X1DA 1FMVA 1LKXA 2Q1ZB 4PUSA 3RQ4A 2CV0A 3OS1A 2RNGA 3K4JA 4C9YA 1J09A 2IS6A 4U87A 4ZYAA 2IGNA 3HG9A 1UELB 4BQNA 3E0JB 4BEHB 1N75A 1Y56A 3QODA 1T0FC 3LSHA 4MLOA 5CPRB 4U7BA 3AL0C 2KMUA 1G59A 1D0YA 3PFYA 3RTRA 1KONA 1DGRM 2I8DA 2VASA 4BXFA 2LYCA 2X6WA 3K4KA 1BOBA 3KEYA 3S93A 4LITA 2LC2A 4FETA 3VYSB 3OYGA 3W2VA 3H0DA 4PK4A 2CW8A 3H35A 5JHFA 3LSGA 5HLTA 3H5RA 3OOUA 5KNLA 4HPQA 2HNHA 2KLOA 4CH7A 4XKVA 1X1BA 1BR1A 1BR4A 2PJRB 2AQEA 2LBFA 3K4NA 3MKZA 4IZZA 1SAUA 3OR2C 1D1AA 1N77A 2LRDA 4F55A 2KPMA 3FBIB 4GRIA 4E7IA 1UAAA 4YRVA 1YE9A 1MMGA 1PYVA 2F4IA 2VJJA 4RLQA 4XN3A 3HPHA 2HPMA 1MNEA 4B43A 4F3QA 1SFKA 4LIVA 2X6YA 3H5AA 2HU9A 1WJDA 2F5VA 3TBIA 2P0WA 1OR7C 2V9KA 2JSPA 1TT0A 1WFXA 1P9QC 4ZTFA 4XN0A 2JVHA 4ZDLA 3OYEA 2WBMA 3SDBA 2O5RA 5CKTA 1X1CA 3DTIA 2XSJC 3N05A 3HUGB 2M7AA 5HNFA 3OYCA 2VQLA 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUZ A;  2UV1 A; 
#chains in the Genus database with same CATH topology
 5FRN A;  3O3K A;  4E7Z A;  1MH4 A;  3FWE A;  5K5R A;  4XLE A;  4OAY A;  2Y0M A;  4PZJ A;  2IPQ X;  3BY6 A;  2KQR A;  5IP7 J;  5IY5 H;  4A3M J;  4LB5 A;  1TP4 A;  1V5F A;  4QIW N;  3HGY A;  2IXS A;  2CWE A;  4DJA A;  1F4K A;  2VBY A;  2KJC A;  1YW9 A;  2H94 A;  1XC5 A;  3KP5 A;  5BOX A;  1H0M A;  5A2Q K;  2R7S A;  2DFE A;  4NC6 A;  4MFE A;  3JCU C;  1C0W A;  1X1P A;  1PP7 U;  1IN5 A;  3FMS A;  1FP1 D;  2BY2 A;  3VYR B;  1HW5 A;  3DU6 A;  3VFZ A;  1UMQ A;  1DQU A;  3H3V K;  1SAX A;  4NDL A;  1VQ7 I;  2LTP A;  4XOR A;  2OAZ A;  2Q0O A;  1YJW I;  4M6V A;  5FKL A;  1J75 A;  2ESH A;  2Z3Y A;  5EEA A;  3AG1 H;  4IHX A;  2L2O A;  2Y0S N;  3DLA A;  2HVS A;  1B9N A;  4BS9 A;  5FD5 A;  3NEU A;  5F0H A;  4I6Z A;  1EJ9 A;  4A93 J;  2DK5 A;  1WJB A;  2VT3 A;  1ON1 A;  3Q9V A;  4HDV A;  1KU9 A;  9ANT A;  3F6O A;  1VQ9 I;  2PMZ N;  3PFI A;  3K1N A;  2N8G A;  3D5S C;  3WG9 A;  1A04 A;  2VQC A;  5E8I A;  5JI6 A;  1MNM C;  2JQ7 A;  2WAD A;  4M72 A;  3OYI A;  1OIS A;  1UG2 A;  2IVM A;  1SVM A;  1TNS A;  2MH2 A;  3FMQ A;  2DOE A;  3KX2 A;  3PNY A;  3S2H J;  5B3S H;  1RIO H;  3U9G A;  2XHK A;  2HVQ A;  2XGD A;  3Q0U A;  4KDP A;  2CQX A;  5J3L A;  4GGG A;  2OZ6 A;  2M9H A;  2NNY A;  3O8G A;  3PM1 A;  1WJA A;  3HUG A;  2IW5 A;  2JA5 J;  5ICE A;  4NQW A;  2F5F A;  2XPW A;  4HV6 A;  1BA5 A;  2MC3 A;  2RC4 A;  2JUC A;  1MGT A;  3JAM K;  1V54 H;  1MSF C;  2RV8 A;  3PSI A;  2WAQ A;  4XOP A;  3HOU J;  5F08 A;  1IXR C;  3LFU A;  2NVU B;  1IRF A;  2HYF A;  4ZTJ A;  3H1C A;  1LDJ A;  2ETH A;  2IS4 A;  4E6K G;  4KIC A;  4YIR X;  4G12 A;  1P2F A;  1T8I A;  1BW6 A;  2A5Y B;  1OPC A;  2RAE A;  3BZK A;  5M3F J;  2L5Q A;  4P9U A;  5D6F A;  5DTD A;  2XF5 A;  3AG4 H;  4GDF A;  3V7R A;  4KIG A;  1JTX A;  1Z7U A;  3CDI A;  2FE3 A;  2ZSI B;  3KIO A;  2EFP A;  3WTS C;  3ISP A;  1T0F A;  3WOD F;  4QTR A;  3W2W A;  2K4B A;  3CCE I;  3HM5 A;  3IV5 A;  3GF2 A;  5GAD J;  5FKM A;  1MBJ A;  5DDG A;  4E7L A;  3OS2 A;  3MZH A;  3KYL A;  2YS9 A;  1TZL A;  3TED A;  1ULY A;  2HOT A;  3CJQ B;  3GTK J;  1G4D A;  5TJJ A;  3LA2 A;  3SFI A;  3EET A;  4OOI A;  1MND A;  1MBH A;  2ZSH B;  2STW A;  4EJV A;  3F0C A;  2A6T A;  3OYN A;  4A3L J;  3DU5 A;  2WV1 A;  1JUP A;  3KYC B;  3GVA A;  2M30 A;  1V4R A;  4TV7 A;  2D2W A;  2MC4 A;  3OL4 A;  5FD6 A;  4BGD A;  1MDM B;  3E6C C;  4B48 A;  4KFC A;  2CV1 A;  4FX4 A;  1BIA A;  3SDG A;  1WH5 A;  1SVO A;  3I53 A;  2R3S A;  4B3A A;  4EV0 A;  3CCR I;  2P5L C;  2DA5 A;  2HPI A;  3JAM Z;  3KLO A;  5L3F A;  4AYB N;  1X19 A;  4DIQ A;  4DW6 A;  1P7J A;  4XLF A;  4ZYE A;  1JHF A;  2Y2Z A;  2VBX A;  2F4O B;  2W1O A;  2W4S A;  2F4M B;  2PMZ A;  3HOS A;  1TBX A;  1LB2 A;  1MBF A;  1XMA A;  1HST A;  2M7B A;  2LY9 A;  2BZT A;  1YS7 A;  4S04 A;  3CZ6 A;  1NK2 P;  2LLK A;  1DU6 A;  1ZHF A;  4O5V A;  4FHT A;  2DT6 A;  1U2W A;  1USS A;  3MD2 A;  4Y52 J;  1LJ9 A;  3LQQ A;  3GEZ A;  2Z16 A;  2JPB A;  1AA7 A;  3K1P A;  4D5C A;  4ABZ A;  2DOD A;  3PUB A;  1CF7 A;  2DOA A;  3PNV A;  1ZRE A;  5M5Y J;  2GXB A;  3VEP A;  1FY7 A;  1MW7 A;  4QLC U;  1G3W A;  4WXC A;  3TL4 X;  3IUO A;  3MVP A;  4QSH A;  2EIJ H;  3DQV C;  5ICF A;  3CME I;  1IRX A;  1QBJ A;  2Z5U A;  3IWF A;  4L9V A;  2DLL A;  1GT0 C;  2HDC A;  4P1W A;  2IP2 A;  4EJU A;  4HBL A;  1LFB A;  2F5E A;  3FZV A;  3GFJ A;  3PL8 A;  4CZZ A;  1XSX A;  3CO7 C;  3NAR A;  4E7S A;  2VT2 A;  3U21 A;  3F21 A;  3LSI A;  2M4K A;  2MFZ A;  4EJW A;  4CGZ A;  2HFH A;  2DYS H;  2A07 F;  2BY0 A;  3E7L A;  5JVG F;  1ZGA A;  5HS8 A;  5LRS A;  1FIA A;  2BEO A;  1HDP A;  2MH9 A;  3GFL A;  2GIV A;  1B8I A;  3MZ8 A;  3CO6 C;  1VQ4 I;  1R1V A;  3ZXS A;  4UVA A;  3VSK A;  3X2Q H;  1BJA A;  4GCV A;  1S9H A;  2ZME A;  3AAF A;  1JXS A;  3EUH A;  1VQM I;  1W5C C;  2OUM A;  3LQR A;  1QHH D;  3ZQG A;  4XQF A;  1NK3 P;  4LMY A;  2M4G A;  4CYC A;  2HYG D;  1KA8 A;  3I56 I;  5KHD A;  1QVU A;  3DTK A;  1ZLK A;  1R00 A;  3MMY B;  5D8L B;  3IC7 A;  3IAM 2;  3CES A;  1I1G A;  4I09 A;  5EEG A;  4WF2 A;  3RCO A;  2DXI A;  5CVV A;  3IAS 2;  1BI3 A;  1JGG A;  2IA1 A;  2LVS A;  2M8E A;  5J1U A;  3WGI A;  1ZRC A;  2X1E A;  4B09 A;  2R4G A;  3K7A J;  3G1L A;  3ZCO A;  4RGR A;  2ZXH A;  3JRE A;  2OU2 A;  1J59 A;  1HW1 A;  1NG6 A;  2EV6 A;  1H88 C;  1Q1H A;  1GXP A;  2IGK A;  4XBF A;  4UUS A;  3HZJ A;  2QSG X;  3SZT A;  4UY8 I;  2K7L A;  1FP2 A;  2ZXW H;  3F9K A;  1OCC H;  2LY2 A;  4AYB A;  1ZR4 A;  1TWG J;  4AD9 A;  4HRI A;  4WXH A;  3UKG A;  5DYM A;  2X1C A;  4BYY A;  1WPK A;  1Z1D A;  2XAU A;  2NS7 A;  3L00 A;  1XGO A;  4Y7N J;  1EF4 A;  1FOW A;  2VC1 A;  4LK0 F;  4HNU A;  2QLZ A;  1K6O A;  2NVX J;  1HA8 A;  4F92 B;  4MNU A;  2ACJ A;  1D0Z A;  4BQA A;  3B73 A;  4A3E J;  4MEY F;  2OTL I;  1SD7 A;  3ZMZ A;  1JJ6 C;  4AID A;  4NQW B;  5BNG A;  1R9T J;  2KRF A;  1I3A A;  3KFW X;  4N4O B;  3KEQ A;  3BG7 A;  3R4K A;  4LK1 F;  1TWA J;  5HS7 A;  3BTC A;  1KQ8 A;  2DJN A;  2DYR H;  5FRO A;  1VQ8 I;  2QQ8 A;  3I4N J;  2LBF B;  1TTY A;  4L18 B;  5HVQ C;  1XCV A;  1BM9 A;  4HOB A;  2P7V B;  1HW2 A;  2ZCW A;  5ICC A;  3OYM A;  2DA1 A;  2BV6 A;  2L02 A;  2CV2 A;  3A0H C;  4RGU A;  3J7A Y;  3R0J A;  5LEK A;  5F6F A;  5EJC A;  5KCM A;  3WTY C;  3RPU D;  1XMX A;  3WE3 A;  2EZI A;  2KP6 A;  3TMO A;  1STZ A;  3ZR8 X;  1SEU A;  2KRC A;  2D45 A;  2IA2 A;  5GAH J;  4HQE A;  1G3S A;  2LSO A;  3S3M A;  4CCJ A;  2CQ7 A;  4XSX F;  3REO A;  4B1R A;  4L9N A;  2HZD A;  3D5L A;  4PFP A;  1HXD A;  3U2R A;  4BE1 A;  4BQO A;  3P9C A;  2RGV A;  2XUB A;  4G8X A;  3LNQ A;  1FLI A;  4OIO F;  5IYD J;  4DGW B;  3OR1 C;  1IG7 A;  2V9V A;  1LE8 B;  3K4C A;  3FKJ A;  3L09 A;  4KIF A;  3BCA A;  3SEQ A;  2EV0 A;  5D8K B;  5GTI C;  4G7Z F;  2D1V A;  1E0E A;  2ICW G;  2JJ7 A;  2Q1Z B;  2M34 A;  2IS6 A;  3N97 A;  2RNG A;  1E3P A;  4U87 A;  4ZYA A;  2ECC A;  3IHU A;  4EQQ A;  1BI0 A;  4WCG A;  3LFK A;  4XK4 A;  1XB4 A;  4ZYD A;  1HQC A;  3TP0 A;  3ZN0 A;  4BEH B;  1DUX C;  1T6S A;  1M1E B;  4C2M J;  1T0F C;  4EVI A;  3LSH A;  1RUO A;  4ESJ A;  4U7B A;  1FEX A;  2HXI A;  2L7F P;  1XPX A;  3CTA A;  2QQA A;  2QVO A;  1D0Y A;  2F5C A;  4A5N A;  1HOM A;  4BXF A;  2DPD A;  2A6H F;  5LBQ A;  2EZL A;  5DUI A;  5FLX K;  5D5W B;  3IRR A;  1Z91 A;  3S93 A;  1G6N A;  2PLY A;  3E6B A;  1PVE A;  4L9T A;  1D5V A;  1P6R A;  5L3D A;  5HLH A;  1F9N A;  2V79 A;  1J0R A;  4Y15 A;  4FET A;  3H0D A;  3W2V A;  1YLF A;  4BHC A;  5DS9 A;  3J81 K;  1FBS A;  3R61 A;  3I55 I;  5JHF A;  2F2E A;  2DQR A;  2G9W A;  3H5R A;  2D1H A;  2QBY A;  5D4S A;  2MLK A;  1YOV B;  4ESB A;  2L54 A;  1X1B A;  1QQI A;  3F23 A;  2PJR B;  3WGH A;  3TW7 A;  1U5T A;  1SAU A;  2VBW A;  3I4M J;  3BWG A;  2LRD A;  1BBY A;  4JK1 X;  4WX9 A;  3E6D A;  2QQB A;  1B59 A;  3CDL A;  1RKT A;  1OCO H;  1PYV A;  1IXS B;  1YHQ I;  2XAJ A;  3WTU C;  3K0L A;  3LWF A;  5LHI A;  2DPU A;  1YJ9 I;  4B43 A;  4F3Q A;  5D5V B;  4U0V A;  3MZY A;  4LIV A;  3TQN A;  3TW6 A;  5JR3 A;  3H5A A;  1BOA A;  2F5V A;  1GV5 A;  1IAW A;  2O0Y A;  3WTW C;  1POG A;  3CCS I;  4O3M A;  1WFX A;  1P9Q C;  4NBQ A;  1F36 A;  4XN0 A;  4GO1 A;  3CCQ I;  3ZPL A;  5DCM A;  1FTT A;  2WBM A;  3CD6 I;  2O5R A;  1VQK I;  3N05 A;  1SD4 A;  5H6Q A;  1OYI A;  1T08 B;  5JLX A;  5HLT A;  3GBG A;  1D5Y A;  3WTV C;  3JSP A;  1Y8Q B;  2BW3 A;  1UFM A;  2BYV E;  2H8W A;  3E6M A;  5FLX Z;  1UB9 A;  2ZME B;  3T5X A;  4FX0 A;  1LFP A;  4GYI A;  1WH7 A;  3SYT A;  2FNA A;  3F8B A;  4BNC A;  3CCL I;  1Z77 A;  4R8H A;  1KGS A;  2NAZ A;  4OWR B;  1IN7 A;  5B1A H;  3DTE A;  5K7H A;  3PJR A;  1HKS A;  4XOT A;  3J81 Z;  5JHU A;  2VJI A;  4I0A A;  4H0E A;  2WB1 N;  4YG2 F;  4M3G A;  4NUB A;  4PSW A;  4XRF A;  2TRT A;  2ZJQ F;  4IHS A;  3F8M A;  3ZMU A;  3WTT C;  3COA C;  3FMR A;  1BN5 A;  4FIS A;  4CCO A;  4W1U A;  3W6K B;  1P4X A;  5B1B H;  1D1B A;  1UHM A;  3OWT A;  2IGO A;  2Q8K A;  1KU3 A;  1AWC A;  3WU2 C;  4W97 A;  3GW2 A;  3CF5 F;  1TC3 C;  4CCM A;  3A1Y A;  4KA4 A;  2V4J C;  2CQN A;  4MTE A;  2LF7 A;  2XVC A;  4F52 A;  3CCU I;  2X85 A;  4M3D A;  3HHG A;  5K5Q A;  4LD5 A;  1XCB A;  1ETK A;  1WJ5 A;  2VB6 A;  3EUH C;  3SZP A;  1W7P B;  2W48 A;  2QZ8 A;  4BY7 J;  4B47 A;  4YEJ A;  4ON0 A;  2Z9O A;  1TW2 A;  4HAM A;  5FKO A;  2LH9 A;  2GA2 A;  1Z9C A;  4ESF A;  2FSW A;  3FM3 A;  2R5Y A;  1QVT A;  2KIM A;  3GXO A;  3I4P A;  2ZXJ A;  1O3Q A;  3I5U A;  3S8P A;  2GOX B;  2QKL B;  4LOC A;  4CDG A;  1R36 A;  1H8A C;  4RB1 A;  3V7C A;  2PJP A;  2E7X A;  2ZXI A;  2Q2E B;  1I6X A;  2DFF A;  4EJT A;  3BTJ A;  3GZN B;  2XSD C;  3DKW A;  2A5W A;  1U9N A;  2Y69 H;  4BJT A;  5BPI A;  2VKE A;  2JRM A;  3F6V A;  1H9T A;  1APL C;  3MEX A;  2H1L A;  2AO9 A;  1YIO A;  3HRS A;  5EYR A;  2WTE A;  4CCN A;  2K9Q A;  4I98 B;  4Z6Y A;  4N4N B;  1O3R A;  2GQQ A;  5IOY A;  1O57 A;  1B6A A;  4HST A;  3HOT A;  4BE0 A;  1PP8 F;  3R6S A;  4ZZD A;  4PCQ A;  4BDZ A;  2NVY J;  4HV5 A;  4MO7 A;  2DA6 A;  4RAY A;  3J7Y J;  2E1N A;  2LNB A;  4AIH A;  2MG4 A;  2F48 A;  4M71 A;  2JK3 A;  2MW8 A;  2HR3 A;  1O4X A;  2CQK A;  2FMY A;  1RR7 A;  4U0W A;  2K3F A;  2E36 A;  4DQ2 A;  2R7V A;  2FXA A;  3WGG A;  3JRI A;  3DBH B;  3KPH A;  1YTY A;  4ITV A;  3OSG A;  4ENM A;  1RRJ A;  1QU3 A;  3C18 A;  2KIQ A;  3DKY A;  3OSF A;  2ISY A;  2DJI A;  4GXO A;  4F7Z A;  2PQ8 A;  3B02 A;  3OYL A;  3Q9S A;  2HOE A;  5CVI A;  3OYA A;  4IOC F;  3K69 A;  2YX7 A;  1XD7 A;  1A6Q A;  4NC7 A;  5HOO A;  3BDD A;  5EDN A;  2K02 A;  4PGG A;  5L3E A;  1OFC X;  4AIJ A;  1WJE A;  3BG9 A;  1MSE C;  5DUK A;  2DMQ A;  3L2W A;  3CUQ C;  3JRD A;  4A6E A;  4EM1 A;  5DCF A;  2NOG A;  4BU2 A;  3F8C A;  4MHG A;  3MAJ A;  4XLH A;  5E3N A;  1PUE E;  1ZK8 A;  2MD0 A;  3L2U A;  3KLN A;  2EIN H;  1RI7 A;  3SQN A;  1Z7L A;  1XDS A;  4MGR A;  5ILS A;  2OJE D;  3G2B A;  1KU7 A;  1N78 A;  4D1Q A;  3FXK A;  4RMN A;  2WA0 A;  1I3Q J;  5HS9 A;  4HX4 A;  3M1E A;  3WTZ A;  2HTJ A;  1BJZ A;  4RB0 A;  3ERM A;  2JT1 A;  2E60 A;  2KDO A;  1WSU A;  5EZG A;  3PUF A;  2XRL A;  2DK8 A;  2LOO A;  4JX6 A;  5K5O A;  1HCR A;  2V1N A;  3KP7 A;  2W84 A;  4V2G A;  3AL0 B;  3HGG A;  2UV1 A;  5F0C A;  5ERI A;  4BDY A;  2PEX A;  2K9S A;  5LFA A;  2H6C A;  2H1K A;  2XKO A;  3LA7 A;  2FU4 A;  3MKL A;  3VB2 A;  4OIP F;  3ABU A;  1YW8 A;  1J2X A;  2NS8 A;  1K78 B;  3ZRG A;  2OF7 A;  4MFD A;  1IRZ A;  1ZRD A;  3GTQ J;  2WAF A;  4DYR A;  1S7O A;  1BL0 A;  1UZC A;  2CW0 F;  3PQJ A;  2I10 A;  1QZZ A;  4DNC A;  1A31 A;  4LGW A;  3L2Q A;  3I58 A;  1KU2 A;  2XGE A;  2ZO4 A;  4H4K C;  3SZG A;  3RPU A;  2TDX A;  1IZ1 A;  1VQ6 I;  2E1C A;  5DM6 F;  4XLA A;  1B1B A;  4AVP A;  2DMP A;  1NG7 A;  4IRG A;  5DCM B;  3OMY A;  5J8F A;  4CHU A;  3I64 A;  4BL0 B;  1FBU A;  3I59 A;  3OYD A;  4LIU A;  3B6C A;  2DFH A;  1TQI A;  4A3D J;  4BE2 A;  2RQP A;  3TGN A;  2M8G X;  1U5T C;  2X9D A;  5J40 A;  3C2G A;  5A2Q Z;  3JRC A;  3CP2 A;  3ULQ B;  4IJA A;  3HRT A;  4KUM A;  4J01 A;  4MEX F;  1MD0 A;  1A6I A;  1GDT A;  2KIS A;  5K7F A;  2FBH A;  4XON A;  3VDX A;  4ANJ A;  1ZG1 A;  1S72 I;  2EH3 A;  2NYX A;  2MA3 A;  3D1N I;  2B9S A;  3ERE D;  3W3C A;  2ELH A;  4IX7 A;  3ECO A;  2X6X A;  2FRH A;  1R5I D;  4PGH A;  4HF0 A;  1D1C A;  2VKH A;  4NHJ A;  3A01 A;  2DMN A;  1NTC A;  1N25 A;  3GYH X;  4K2E A;  5B5E C;  4ENK A;  1LUJ B;  4Q47 A;  1LPQ A;  1X3U A;  3V8K A;  1B72 A;  4DYQ A;  3RYP A;  5FLM J;  2DTZ A;  2IEK A;  3W2A A;  1PDN C;  1JI8 A;  5CQE A;  3QPL A;  4UV9 A;  2KIU A;  1AKH A;  4XR6 A;  1YX5 A;  4MQ9 F;  2G7H A;  2DA7 A;  3MKW B;  2Z99 A;  2P6T A;  5F0F A;  4BUP A;  2KRH A;  3BG3 A;  2R5Y B;  2EFN A;  4U7D A;  1JKQ C;  5E79 C;  3Q5F A;  3V8L A;  4BBR J;  4EAT A;  2BOL A;  4HNV A;  4AU7 A;  2K5C A;  5ILU A;  3ZQ7 A;  1MBG A;  3HSF A;  4KMU X;  3CJR B;  2XAH A;  2R7X A;  1FYK A;  4CCL A;  4EM2 A;  2XB0 X;  1MJ9 A;  3S32 A;  2ADU A;  5FRM A;  3TO9 A;  2NXN B;  2Y0S A;  2W85 A;  2R0Q C;  2IA0 A;  1LEA A;  2NVQ J;  2CO5 A;  4CXF A;  2QSH X;  2OBP A;  2ESN A;  3G4S I;  5F27 A;  1R49 A;  4C3J J;  4AIK A;  1ZTR A;  1FPQ A;  4OU0 A;  1RC9 A;  1V55 H;  3M1C A;  3DF8 A;  5ILV A;  1RUN A;  4O6J A;  1HC8 A;  5EZH A;  2O7O A;  2JN6 A;  2HXO A;  2GM4 A;  4XID A;  3L1P A;  2WY7 Q;  3J7Z I;  1SFX A;  3JRG A;  2KHM A;  3N4M A;  5E17 F;  2DU9 A;  3HEF A;  5CVR A;  3MQ0 A;  1VI0 A;  2VIX A;  2WC2 A;  2VON A;  3DBR B;  2CG4 A;  4B44 A;  3CF2 A;  1JUM A;  1AU7 A;  3CLQ A;  3IL2 A;  1J9I A;  1W5T A;  3ONQ A;  5ED4 A;  3E1S A;  1GV2 A;  1QPI A;  3ABL H;  4S0H B;  2YU3 A;  3G73 A;  4JOM A;  3J7A O;  1K6Y A;  2CSO A;  4ZDO A;  3G3Z A;  3K2A A;  4WK8 F;  3DPL C;  3K1M A;  2XF7 A;  3E3V A;  1ETO A;  4UV8 A;  4ZZL A;  5M3M J;  1X1D A;  1FMV A;  1P7I A;  1FSH A;  2XRN A;  2CV0 A;  4IHY A;  2IBD A;  3K4J A;  1J09 A;  2HKX A;  3BR2 A;  2IGN A;  3H0G J;  4LLL A;  1LDD A;  1UEL B;  3ABT A;  1X2M A;  3E0J B;  4CYD A;  1KZH A;  3QOD A;  4A69 C;  1AHD P;  1RES A;  3BTL A;  2OPT A;  3TO7 A;  2EB7 A;  2BXZ A;  5F04 A;  1YYV A;  4RAF A;  3CCV I;  3G6E I;  1BOB A;  4HZF A;  1FYM A;  1IUF A;  3TDU C;  5CVJ A;  3PQK A;  1R5G A;  3BZC A;  3VYS B;  3S1N J;  1EV7 A;  2J5O A;  5CVU A;  2XGX A;  3ECH A;  3H35 A;  5AON A;  4U0Y A;  3DV8 A;  2RKH A;  5GPC A;  5FLV A;  3S16 J;  5D5U B;  2R7F A;  4HPQ A;  4HYE A;  5HDG A;  2HNH A;  3HJE A;  1XMK A;  1BR4 A;  4CIC A;  1I50 J;  2CQQ A;  3K4N A;  3WG7 H;  4Q4Z F;  2D5V A;  2XGC A;  5EG0 A;  3OR2 C;  2LFB A;  1MBK A;  1FNN A;  1VQN I;  3S17 J;  3FKI J;  2KPM A;  1D8K A;  1HKQ A;  5AIQ A;  1IRG A;  2F4I A;  3M07 A;  2PG4 A;  2O3F A;  4XN3 A;  3TP3 A;  2R5Z A;  1MNE A;  1ZG5 A;  2HPM A;  4BHB A;  5FB2 A;  1VQO I;  2LF8 A;  4CO8 A;  1W4M A;  1RNL A;  3CMY A;  1OMI A;  2EFQ A;  2W24 A;  1WJD A;  2V9K A;  1SFO J;  3FK7 A;  4AM3 A;  3NQO A;  4ZDL A;  2EFW A;  1PUF A;  2E34 A;  1X1C A;  3DTI A;  1I5Z A;  2XSJ C;  4G94 A;  4Q5S F;  5FO5 A;  3HUG B;  5HNF A;  2VQL A;  4Y17 A;  4IOA F;  2BY1 A;  1W36 D;  1UJ8 A;  3SEZ A;  5K7Z A;  1IO2 A;  3O6B B;  5J6X A;  2K9L A;  3UR3 C;  2L7Z A;  2V7F A;  1QA6 A;  1ZGJ A;  1YRN A;  3F8N A;  2PX9 A;  4LLN A;  2XC7 A;  1WQ2 A;  1SMY F;  2L4M A;  5EEH A;  3GTL J;  5JFR A;  2EPF A;  4C2T A;  5J1Y A;  2DQL A;  2KDZ A;  3FXO A;  5F64 A;  2IS1 A;  4YFN F;  3OYJ A;  3GCM A;  3LSM A;  2E2H J;  5F1J A;  3GTG J;  4IO9 F;  3CUQ A;  1IV6 A;  2V6C A;  2L0K A;  4HX7 A;  4UXN A;  1NHA A;  3VWB A;  4UNO A;  1YG2 A;  4C30 A;  3BR3 A;  1XGM A;  2DDA A;  3TOB A;  1I1S A;  3IH3 A;  4JX4 A;  4DZP A;  2OV7 A;  2DA3 A;  3KZZ A;  1WCM J;  4L5J A;  3ZOB A;  2A6E F;  1UHW A;  2WY8 Q;  3BG5 A;  2O9L A;  3WE2 A;  3VYU B;  5E1X A;  2VQG A;  2XV4 S;  4D7N A;  1ON2 A;  2P81 A;  1B9M A;  1FOK A;  2VJ5 A;  3GZ6 A;  3OY9 A;  3DPU A;  5GAG J;  1DP3 A;  1OYW A;  5L3C A;  2HGC A;  5E3L A;  3W6J B;  5JVT A;  5H2F C;  1JGS A;  4M3B A;  1JE8 A;  4DBR A;  1I39 A;  2W82 A;  3GZ5 A;  3EPZ A;  3L7W A;  2K3P A;  5FJ8 J;  1P4A A;  1TWC J;  1QZE A;  2XPV A;  2DCE A;  3ABK H;  1WKM A;  1XSV A;  1EA3 A;  3ZQC A;  5FGM A;  1WI3 A;  3KP6 A;  3GX4 X;  2VOD A;  2JZY A;  1UHS A;  1TL8 A;  3HOZ J;  3ZMT A;  4L0Z B;  3M8F A;  3BOQ A;  3C1D A;  2YUS A;  2OTJ I;  3LSJ A;  3CC2 I;  6PAX A;  3OYB A;  1MIJ A;  2CS3 A;  4RB3 C;  4AWX B;  1O3T A;  2XAQ A;  5J4V A;  1RET A;  2EQR A;  4RGS A;  4Y13 A;  4F93 B;  3OIP A;  2XAF A;  4OIN F;  3S3N A;  2GBY A;  5LGT A;  4KN7 X;  2DAO A;  2K4J A;  2VXD A;  2LD5 A;  4UVC A;  5EGO A;  3VYT B;  2E2I J;  2FOW A;  3RSN A;  5IT9 K;  1FOY A;  3W6V A;  1WVR A;  3QPT A;  3Q0V A;  4D5F A;  1EH7 A;  2VL8 A;  2ZKZ A;  1OCZ H;  3G71 I;  1MZB A;  1U78 A;  4FE4 A;  4M3F A;  3BTI A;  4G7H F;  4YFX F;  2DA4 A;  5IP9 J;  4XIC A;  3M8J A;  3FX3 A;  3HL2 A;  3A4C A;  4NC8 A;  3QYE A;  4LG3 A;  4A0X A;  3H36 A;  3DEW A;  5HDK A;  3VSL A;  3KYD B;  2DDB A;  1BC8 C;  2BXY A;  2CGP A;  3S14 J;  1CF7 B;  3KP3 A;  4DZJ A;  4U88 A;  5HLI A;  2QKM B;  3IKV A;  2E1M B;  2R7T A;  3FBN B;  4AUX A;  1X3Z B;  2CUF A;  3EUA A;  3S3O A;  1Z6T A;  4E7H A;  4A3C J;  3M8E A;  1IV8 A;  5HDN A;  1K79 A;  1VQL I;  4N9H A;  2WV0 A;  2R7R A;  3D5R C;  4ZYH A;  2CYY A;  1FZP B;  2JA8 J;  3H5N A;  3NRV A;  2H8R A;  1U6G A;  5C3E J;  2VI6 A;  4IQJ A;  2CJJ A;  4P9F A;  3ELK A;  2O61 A;  1H9G A;  4BAY A;  3GTJ J;  4ETS A;  1WJF A;  1T98 A;  3LMM A;  4L9J A;  1F1Z A;  3ZMS A;  1B8I B;  2L9R A;  1R6R A;  2RRE A;  5KAI C;  2IJL A;  2VUM J;  2EJR A;  4BJ6 C;  2DA2 A;  2JA7 J;  4RAG A;  2JWT A;  2UXN A;  5IT9 Z;  1S6L A;  1U0J A;  3RZD J;  5J8C A;  1YJN I;  3OV8 A;  1ONV A;  4BH9 A;  5IOZ A;  3CJT B;  4CYC B;  1TNT A;  4UB8 C;  2HQ5 A;  1JT0 A;  3QYF A;  5IPA A;  4E7J A;  4JX5 A;  4HLY A;  1Y39 A;  2Y48 A;  1K83 J;  2HDD A;  2K86 A;  2AHQ A;  4HEA 2;  3PIO F;  2E1O A;  1SAN A;  3P5J A;  2EA4 A;  4XKB A;  2MD5 A;  2ELK A;  2C6Y A;  4DOZ A;  2LRE A;  1ERD A;  2A61 A;  2COB A;  4V19 K;  4HQM A;  2FBI A;  1OLT A;  4PSX A;  5DM7 F;  2QSF X;  3SXY A;  2XB5 A;  2WWY A;  1QZY A;  1RPW A;  3KZI C;  4UUS B;  2OCC H;  3EUK L;  1O7L A;  4OIR F;  1YW7 A;  1A36 A;  2QEX I;  1D0X A;  1DGW Y;  4IVN A;  2OQG A;  3NWS A;  3SHF A;  4M9S A;  2PFB A;  5L3B A;  2QQ9 A;  1IN6 A;  2LK2 A;  3ZQQ A;  4NNJ A;  3ZQL A;  3HKZ N;  2GIZ A;  3BR6 A;  1L0O C;  3RJP A;  3RKY A;  4R1H A;  2M87 A;  4UVB A;  3FIS A;  3I3L A;  4XM3 A;  1LDK B;  2GXG A;  1S3J A;  3BC8 A;  3CUO A;  3D0S A;  1LNW A;  3H9Q A;  4C3H J;  2COM A;  3A02 A;  2L9S A;  2BGC A;  5AIP A;  3M4O J;  1G8X A;  2LY1 A;  3BPV A;  3DLL F;  1K4S A;  1S7E A;  3DWL E;  3BLY A;  1TQM A;  3VOE A;  2V1U A;  3AFH A;  5K1Y A;  4KMF A;  3BPX A;  1BI1 A;  1Q1V A;  1D8J A;  2HTS A;  2V9P A;  3LL7 A;  3EQL F;  3MWM A;  2O8X A;  5CQG A;  3HYI A;  3BCB A;  3QAH A;  4MIM A;  5TGT A;  1MMD A;  4EGZ A;  4A3G J;  1R4N B;  2LDU A;  5LD2 C;  2HWV A;  2ID3 A;  1MDM A;  4ZJZ A;  2VJ4 A;  1Z21 A;  3J80 K;  4P96 A;  1K61 A;  2V6E A;  4ENN A;  3ZMV A;  2L7K A;  2DT7 B;  1SVL A;  3OS0 A;  1T56 A;  3CUQ B;  1JKR C;  3K6G A;  2M3A A;  3GO5 A;  4ZH4 F;  3CDH A;  2JA6 J;  3LSP A;  5DEQ A;  1GLN A;  1ZLJ A;  3H9J A;  3A03 A;  1IW7 F;  2LKS A;  4QPQ A;  4BQQ A;  2HEO A;  1JTY A;  3VOD A;  2QCO A;  1MMS A;  3WU1 B;  2RN7 A;  1PJR A;  2EIL H;  5HOD A;  1E3H A;  5C44 J;  4FE7 A;  3FK6 A;  4J00 A;  2UWM A;  3JRA A;  2OCE A;  1ZKG A;  2HDW A;  4PJL A;  2BHY A;  1H89 C;  2R7U A;  2HOA A;  3HPG A;  5F1R A;  4PJM A;  4M74 A;  3KP4 A;  1W7P D;  2BHZ A;  2G0E A;  4A0Z A;  3QYB A;  2WB1 A;  4DYC A;  2CMP A;  2E2J J;  4XRS A;  2OQR A;  3VPR A;  4RB2 C;  3HOW J;  4M6Y A;  1R58 A;  3JTG A;  2CUJ A;  1DPU A;  2LP0 A;  2A3S A;  1ZYR F;  3GUD A;  4N9I A;  2E5Z A;  2H09 A;  3FHZ A;  2FA5 A;  1ENH A;  3R60 A;  3HBL A;  1YI2 I;  1CGP A;  3HTU A;  4M9X A;  4XLC A;  3FXM A;  3O2P E;  3LA3 A;  2X51 A;  1I6H J;  4P55 A;  4JYK A;  3HOY J;  2VKD A;  2PI0 A;  5GP9 A;  1O7F A;  1FTZ A;  4RGX A;  2ECB A;  2Z1D A;  3HKZ A;  3C2H A;  2EFO A;  3UNG C;  5KVR A;  2M0M A;  3DKX A;  2ZFU A;  2K40 A;  4IXA A;  3ZN1 A;  3LSR A;  4FTH A;  2QBY B;  3H3U A;  3FDY A;  2KZG A;  1XGN A;  4D0P A;  4MQV A;  4CZC A;  4E7K A;  2VBZ A;  3ROU A;  1XSD A;  1YS6 A;  1GVD A;  3H9G A;  3BT9 A;  5E18 F;  4ZYG A;  1U5T B;  5LHH A;  1FX7 A;  2VOP A;  3ASN H;  2IGM A;  4WWC A;  2OA4 A;  3BG6 A;  2M1B A;  4JQF A;  2BVL A;  4M3E A;  2JVG A;  2NOJ B;  2OD5 A;  1QNT A;  1R1U A;  3E5X A;  4II3 A;  1T2K A;  3A2K A;  3FXR A;  1L3L A;  3S1M J;  1G3T A;  2NS0 A;  1VFC A;  2FEZ A;  2CFO A;  2JPC A;  2H27 A;  5L3G A;  1QO0 D;  2V26 A;  2ME0 A;  5HLG A;  2EIM H;  2L9N A;  1UG0 A;  4M73 A;  1YIJ I;  3V8J A;  1MJA A;  2DI3 A;  3P9I A;  1OCR H;  1A35 A;  2NVT J;  3TKY A;  3RI4 A;  2ZJ2 A;  5E3M A;  2LKX A;  2R7Q A;  2VOO A;  2GXA A;  2M5W A;  1ORK A;  4HLX A;  2E5N A;  5DD8 A;  2BW3 B;  1BW5 A;  2IAI A;  3FF5 A;  3RZO J;  3OS1 A;  1SMT A;  2K9N A;  3GLX A;  2FBK A;  3HSE A;  2KKO A;  3HG9 A;  1GVJ A;  5M5W J;  3LAP A;  4BQN A;  1P92 A;  1IC8 A;  1N75 A;  3AG3 H;  2XIG A;  2FOK A;  4MLO A;  3QPH A;  1WHU A;  4M6X A;  3AL0 C;  2KMU A;  3IH4 A;  3RPQ A;  5LLQ A;  1G59 A;  3RTR A;  3GLL A;  1DGR M;  3E97 A;  1F43 A;  2LYC A;  2FD5 A;  1T39 A;  1ITY A;  3SJM A;  3HIF A;  4L5E A;  3CMA I;  1XGS A;  2EV5 A;  4FQG A;  2Y31 A;  2IRF G;  2A05 A;  2Y9Y A;  3K2Z A;  3OYG A;  1ZG3 A;  3C3W A;  4HW0 A;  1K7A A;  2P7C B;  1LEB A;  3HB9 A;  3LSG A;  3BRO A;  1KYZ A;  3HHH A;  4RAZ A;  2JTV A;  3JSO A;  2EA2 A;  1FWZ A;  2OZU A;  5KNL A;  3JRH A;  4OIQ F;  2YX4 A;  5J1R A;  5C4J J;  2KLO A;  1WI9 A;  3O8H A;  5KK1 A;  4ASN A;  1IDY A;  1JKP C;  1BR1 A;  1RZ4 A;  1W1W E;  1Z0X A;  2EIK H;  3QU6 A;  2AQE A;  3H92 A;  1U3E M;  2LBF A;  1I27 A;  1JKO C;  4UUT A;  1BC7 C;  3GTM J;  1HDD C;  2L7M P;  2LR8 A;  2XAS A;  3HRM A;  3CCM I;  1O3S A;  3HOX J;  4GRI A;  1UAA A;  1X2N A;  2EWN A;  4YRV A;  3ASO H;  1YE9 A;  3KP2 A;  3R0A A;  4RLQ A;  1GUU A;  1XG1 A;  3I54 A;  3LAJ A;  3QPS A;  4I76 A;  4IRH A;  3HPH A;  1SFK A;  5BMZ A;  2EBI A;  2O8K A;  2X6Y A;  1MBE A;  2HU9 A;  3RDI A;  3V7S A;  3TBI A;  1W5S A;  3Q0W A;  3F22 A;  1OR7 C;  1XTA A;  2Y9Z A;  1YO5 C;  1TT0 A;  3QRF F;  3NAU A;  3KZY A;  2JVH A;  4A12 A;  5C4X J;  3JRB A;  2YPR A;  2VC0 A;  1DPR A;  1LE8 A;  4RS8 A;  3BZ6 A;  3WTX C;  2B63 J;  1IN8 A;  2Z2S B;  3I9V 2;  3GFI A;  4I99 C;  1ZQ3 P;  2BY3 A;  4AVZ A;  1ZEL A;  2FUG 2;  2GAU A;  3LOC A;  4BJ5 C;  3CC4 I;  2P5K A;  2AQF A;  4B3X A;  4CCK A;  2EZK A;  2L01 A;  2JA2 A;  1F5T A;  1X4P A;  4BEH A;  3RKQ A;  1FMW A;  4A3I J;  1NH3 A;  4KJZ A;  4CA0 A;  1ZAO A;  1QRY A;  1RKW A;  1R1T A;  1S7A A;  2QM3 A;  4KT5 C;  1IN4 A;  2R7W A;  2HOS A;  4XLN F;  4EGY A;  4Y4R A;  2KZV A;  4EM0 B;  1R22 A;  1FSE A;  4JBA A;  1HLV A;  1X1A A;  1KYW A;  3SFZ A;  4C3I J;  3IP4 B;  4LJZ F;  1Y0N A;  4IL6 C;  1Y1V J;  1E17 A;  5EF6 A;  3ZGK A;  1T38 A;  2JRT A;  5LRR A;  1ZAR A;  4I0B A;  2E35 A;  1IDZ A;  3FM5 A;  2G7U A;  4IHT A;  4FCY A;  1T95 A;  2DW4 A;  2P5V A;  4A3K J;  4JP0 A;  3C7J A;  2A68 F;  2PJR A;  4EJO A;  3MCZ A;  2MAB A;  4LLG F;  4OMZ A;  5HNH A;  1ACI A;  4P5O A;  4L5I A;  3OYK A;  2OC6 A;  5GAE J;  4E4H A;  1QHG A;  2PN6 A;  2KJB A;  2K27 A;  4XSZ F;  4XNF A;  3GTP J;  3L2V A;  4UB6 C;  1CQT A;  4XMY A;  1TQP A;  2W7N A;  4X1E A;  2LKP A;  5DV5 A;  3IWZ A;  2ZC2 A;  3DP7 A;  5M5X J;  3EYY A;  3KET A;  1V3F A;  1MMN A;  1OKR A;  3KE2 A;  3HOV J;  3AKZ A;  3RKW A;  3ABM H;  5D5X B;  4KIT B;  3M3Y J;  3K4L A;  1X4O A;  1MKM A;  5E3O A;  2DFI A;  2EZH A;  2NRA C;  2FQ3 A;  3OIQ A;  3ZQH A;  1TWH J;  4HDU A;  1LVA A;  1W0T A;  3U1D A;  2X1D A;  1ETY A;  2LG4 A;  2X4H A;  1E3O C;  2FQ4 A;  4ZDP A;  4KYW A;  4J19 A;  1OQY A;  1EH8 A;  1MMA A;  1QPM A;  1S5L C;  3DBL B;  3FXQ A;  3DPT A;  2QEN A;  3B6A A;  2P6S A;  4QPO A;  4HG2 A;  4XKW A;  3IRQ A;  2HQR A;  3ZP5 A;  5BQT A;  4F91 B;  4UHT A;  4A3J J;  2HKO A;  2R7O A;  4I2O A;  4I7H A;  3GWZ A;  1BIB A;  3TOA A;  2ID6 A;  4E70 A;  1VQ5 I;  4UUV A;  2KL4 A;  1X3W B;  3BJ6 A;  2EK5 A;  1W36 C;  1EKE A;  2GZW A;  4RBO A;  2VQH A;  5FKN A;  1Z3Y A;  3G1O A;  4GFB A;  2DMT A;  2AXL A;  4PJ0 C;  4YEL A;  3T8R A;  2XPU A;  3ZQF A;  3I59 B;  5J4Y A;  1ZH5 A;  2W57 A;  1JHH A;  2DBB A;  1FT9 A;  1WRJ A;  1IXC A;  1W7P A;  3BR5 A;  2HI3 A;  2CW7 A;  4KT6 A;  1VQP I;  1Z67 A;  1WZ2 A;  2CRG A;  3CP8 A;  2PBI A;  4G9Y A;  3EYI A;  3PO3 J;  4HA8 A;  1LVK A;  3GFM A;  4WXD A;  4NB5 A;  4N0B A;  2HVR A;  1FC3 A;  1Z05 A;  1VF9 A;  3K4B A;  3LST A;  5CLS A;  1Z6R A;  4IQ4 A;  4S05 A;  1ZGW A;  1U8R A;  4PJN A;  1IUY A;  5TIS C;  2Q2E A;  1WJC A;  2HQA A;  2VE9 A;  2CFX A;  1JJ8 C;  3WU0 A;  4D7M A;  2DT5 A;  2K85 A;  2ME6 A;  3A01 B;  3BQZ A;  3T8T A;  2ZJP F;  4YII A;  4FT8 A;  3M7G A;  3OYF A;  4A0Y A;  3BR1 A;  2JUG A;  2DTR A;  3DEE A;  2VE8 A;  1B72 B;  4G6T B;  2R92 J;  3RKX A;  4FAS D;  2AXT C;  1S8N A;  2XKP A;  3QOE A;  1R4M B;  1P4W A;  3PNT A;  2BBY A;  1T33 A;  5D4R A;  1AKH B;  1HBX G;  3MKY B;  1VZ0 A;  2Z33 A;  2XRO A;  4RM2 A;  2MSY A;  4HSR A;  4IF4 A;  2E7W A;  1FOX A;  4BY1 J;  4CSW A;  3QWL A;  1YFH A;  3OYH A;  2DMU A;  3BP8 A;  4LFU A;  3GTO J;  3S2D J;  4Z2Y A;  4YFK F;  1XX5 A;  2WAE A;  2ISZ A;  3HRU A;  4LG0 A;  3FXU A;  2J5P A;  1R5H A;  3FIW A;  4XL9 A;  1BR2 A;  1ODD A;  2F6C A;  1A5J A;  3DFG A;  3L2C A;  4G7O F;  2M45 A;  4C2U A;  2UXX A;  4RM3 A;  1MJB A;  3RYR A;  3HTS B;  2VLA A;  1SFE A;  2W25 A;  1V5G A;  1Z3X A;  3LSK A;  2KIF A;  1UST A;  5E1W A;  5IYC J;  2ELJ A;  3P7N A;  2O6G E;  4DBQ A;  2TCT A;  1R7J A;  2I5U A;  1LFU P;  3JTH A;  1WGX A;  1OCP A;  2FF4 A;  3PIP F;  2H6B A;  5GPA A;  4MTD A;  3I71 A;  1IJW C;  3KEO A;  2UZK A;  2FX0 A;  4KNY A;  1Y8R B;  3K9T A;  2MYS A;  2E71 A;  3M9A A;  3HC7 A;  4IPA A;  5IYB J;  4ZC3 A;  3C2B A;  3ESW B;  5H20 A;  4RDU A;  2M2E A;  4AC0 A;  1JUS A;  3S15 J;  4HNT A;  1X58 A;  1TWF J;  3TO6 A;  5IT3 A;  1S29 A;  4KIB A;  2STT A;  2RVC A;  2P8T A;  3CMM A;  1YIT I;  3MFK A;  1DDN A;  1WWX A;  4YIF A;  4B4C A;  4D9J A;  2M0C A;  4BHP A;  3OOP A;  1J5Y A;  2ZB9 A;  2QGU A;  3RIR A;  1QGP A;  4XLP F;  2BE5 F;  2O03 A;  4GYG A;  4Y33 A;  1U8B A;  2QF7 A;  2W00 A;  2PMU A;  4XKC A;  2ZFW A;  3ML6 A;  4A6D A;  2DN0 A;  4Y3O A;  4HF2 A;  4A3F J;  4I01 A;  1FYL A;  1Y1W J;  2GA1 A;  5KAF C;  5LHG A;  4BXX J;  4IKF A;  4XRS G;  1K78 A;  3JR9 A;  3S1Q J;  3HXL A;  1FJL A;  1E2X A;  2GOM A;  2GWR A;  3PSF A;  1OYY A;  4A2U A;  5FFX A;  3JRF A;  5IP6 A;  2JSC A;  2UUZ A;  3F72 A;  4II2 A;  5H6R A;  1SD6 A;  2IS2 A;  4X6A J;  1FIP A;  1IGN A;  4BBS J;  2YR2 A;  2R7Z J;  3BQY A;  3S1R J;  2L4A A;  3QU3 A;  3HSR A;  2ZBK A;  2AS5 F;  4KIS A;  4QWQ A;  2VN2 A;  2R7D A;  2A69 F;  3IH2 A;  2IT0 A;  4BXU A;  3FXL A;  2CH0 A;  2XAG A;  5BS6 A;  4PFO A;  3QP5 A;  2HYJ A;  1VND A;  1YQA A;  2MBF A;  1VTN C;  2B0L A;  2FJ1 A;  4X0G A;  2RNJ A;  3FHN A;  2QUF A;  3CLO A;  4V2F A;  4IHV A;  1R23 A;  5CJ9 A;  4HX8 A;  5LGN A;  1UCR A;  2E19 A;  4A3B J;  4OMY A;  3A0B C;  1FBQ A;  3WHB A;  4OAZ A;  3PO2 J;  4ENJ A;  5FKK A;  4PJJ A;  5E1Z B;  3K10 A;  4R79 A;  5JLW A;  1AOY A;  3K4M A;  1GHC A;  3DEU A;  1XS9 A;  2RQQ A;  1DU0 A;  1BI2 A;  1Y6I A;  1V5E A;  3V4G A;  4L0Y B;  2DO7 A;  5BPD A;  1OR7 A;  3OL3 A;  2RDP A;  1D3Y A;  2XDV A;  1RR8 C;  2YSR A;  2FNP A;  2E1M C;  3K70 C;  1W0U A;  3CCJ I;  2QYO A;  2ZJR F;  1J7K A;  1R71 A;  2V1X A;  2XF6 A;  4XRM A;  3DXJ F;  3CJN A;  5TRD A;  1YX3 A;  5EG0 B;  1ETX A;  1IF1 A;  3E5U A;  2QWW A;  3Q3S A;  2QA4 I;  5LEJ A;  2BVM A;  5E8G A;  4CUG A;  3T0Y A;  3IKT A;  2R93 J;  4RLF A;  1SC7 A;  1HF0 A;  2VXZ A;  1DP7 P;  1LQ1 A;  1HSJ A;  2HQN A;  2R5Z B;  1KQ9 A;  1TW3 A;  3QOP A;  3HDD A;  1XN7 A;  3EDP A;  2K9M A;  4BAC A;  3K70 D;  4RA2 A;  2F5D A;  1Y0U A;  1TLH B;  3L2R A;  4IHW A;  5FFZ A;  2CUZ A;  2KFD A;  2ZNZ A;  4I02 A;  4KN4 X;  3NWT A;  2NNN A;  2CU7 A;  5ICG A;  3V42 A;  1ETV A;  2ZME C;  1PUF B;  5LGU A;  1U9O A;  2VPL A;  4B8X A;  3BR0 A;  3TDZ C;  5CYV A;  1SFU A;  2L9V A;  4IEJ A;  2HZT A;  3FXJ A;  3MN2 A;  1LKX A;  4PUS A;  3RQ4 A;  4G6D A;  1YRN B;  4LB6 B;  1ZR2 A;  4C9Y A;  5J47 A;  3E5Q A;  1JT6 A;  3QQA A;  2VKV A;  2X0L A;  1ZN2 A;  1B4A A;  2ZNY A;  2P4W A;  1Y56 A;  1ETW A;  3QP6 A;  1K4T A;  5CPR B;  2Y75 A;  4A5M A;  2YU9 J;  5B66 C;  4EMS A;  1OJL A;  5DD4 A;  3G1M A;  1G3Y A;  3PFY A;  3S2W A;  2GLO A;  1KON A;  2I8D A;  2VPR A;  2VAS A;  3H3Z A;  4EEF G;  2LMD A;  2MGQ A;  2X6W A;  3K4K A;  3CQZ J;  3KEY A;  3ZMD A;  3U1K A;  4G6Q A;  4LIT A;  2PMH A;  1REP C;  1HKT A;  3DCF A;  1SD5 A;  2LC2 A;  3AG2 H;  4PK4 A;  2CW8 A;  3T1B A;  2DOF A;  1EH6 A;  5D6E A;  2CUE A;  3OOU A;  4IRI A;  4M9Z A;  3KCC A;  3GME A;  1G2H A;  4CH7 A;  3BJA A;  2X6O A;  4XKV A;  2FML A;  3CC7 I;  1MH3 A;  3MKZ A;  2B7E A;  3BJO A;  2MLG A;  4IZZ A;  1N77 A;  1ZRF A;  1D1A A;  1KQ0 A;  2Y30 A;  4Q48 A;  4F55 A;  1OCT C;  3FBI B;  4E7I A;  4PDK A;  3CCY A;  2JMW A;  4LG0 B;  1MMG A;  2VJJ A;  3I0T A;  3F8F A;  2HS5 A;  5E20 A;  2WAQ N;  3F3X A;  3ZQI A;  3L9F A;  3OIO A;  1GXQ A;  4HF1 A;  2X48 A;  2P0W A;  2L3D A;  4BKX A;  2JSP A;  1TT5 B;  4ZTF A;  2V1D A;  3JW4 A;  1XDU A;  5EGO B;  3OYE A;  3P9K A;  3SDB A;  2KT0 A;  5CKT A;  3RQI A;  5GTH C;  2M7A A;  3J80 Z;  1ETQ A;  3WHC A;  3OYC A; 
#chains in the Genus database with same CATH homology
 1W36 D;  3SEZ A;  5FRN A;  4E7Z A;  2K9L A;  2Z2S B;  3I9V 2;  2BW3 A;  4OAY A;  4XLE A;  3UR3 C;  2V7F A;  4AVZ A;  1ZEL A;  2FUG 2;  2KQR A;  4BJ5 C;  1V5F A;  2AQF A;  4B3X A;  2XC7 A;  2IXS A;  4CCK A;  1LFP A;  4DJA A;  3SYT A;  4C2T A;  2JA2 A;  1X4P A;  4BEH A;  1FMW A;  4OWR B;  2R7S A;  4KJZ A;  3DTE A;  3PJR A;  4CA0 A;  4XOT A;  2IS1 A;  3OYJ A;  3LSM A;  2VJI A;  2R7W A;  4Y4R A;  2KZV A;  4NUB A;  4PSW A;  1X1A A;  3IP4 B;  3VWB A;  4C30 A;  3VYR B;  3ZGK A;  4CCO A;  2OV7 A;  3DU6 A;  1D1B A;  1DQU A;  3OWT A;  2IGO A;  2WY8 Q;  3VYU B;  4XOR A;  4CCM A;  2VQG A;  3A1Y A;  2V4J C;  1T95 A;  2VJ5 A;  4F52 A;  2L2O A;  3OY9 A;  3DPU A;  1DP3 A;  3DLA A;  2X85 A;  2HVS A;  4BS9 A;  2PJR A;  2VB6 A;  1WJ5 A;  3EUH C;  4DBR A;  2W82 A;  4B47 A;  1WJB A;  2MAB A;  3EPZ A;  4YEJ A;  5HNH A;  2K3P A;  4P5O A;  2LH9 A;  2DCE A;  3OYK A;  2OC6 A;  1EA3 A;  4E4H A;  1QHG A;  3D5S C;  2VQC A;  2WAD A;  3OYI A;  4XNF A;  3L2V A;  3S8P A;  2GOX B;  2QKL B;  4XMY A;  3OYB A;  2W7N A;  2CS3 A;  3KX2 A;  3PNY A;  2ZXI A;  2HVQ A;  2Q2E B;  4F93 B;  3OIP A;  3S3N A;  1MMN A;  2A5W A;  4BJT A;  2VXD A;  3VYT B;  3AKZ A;  3RSN A;  4KIT B;  3K4L A;  1WJA A;  1X4O A;  4CCN A;  4N4N B;  2VL8 A;  3OIQ A;  4HST A;  3HOT A;  4BE0 A;  4BDZ A;  3PSI A;  2WAQ A;  2X1D A;  4XOP A;  2LG4 A;  3LFU A;  3M8J A;  4ZDP A;  4ZTJ A;  3HL2 A;  2IS4 A;  3A4C A;  1MMA A;  4NC8 A;  4E6K G;  3QYE A;  4LG3 A;  3DPT A;  2L5Q A;  4QPO A;  3VSL A;  2R7V A;  4HG2 A;  4XKW A;  2XF5 A;  4F91 B;  4ITV A;  2R7O A;  1QU3 A;  2ZSI B;  3DKY A;  2KL4 A;  2DJI A;  2QKM B;  2E1M B;  2R7T A;  3FBN B;  1W36 C;  3W2W A;  3EUA A;  2VQH A;  3S3O A;  4E7H A;  3OYL A;  1Z3Y A;  3OYA A;  4E7L A;  3OS2 A;  3KYL A;  4NC7 A;  4YEL A;  1TZL A;  5HOO A;  3CJQ B;  2R7R A;  3D5R C;  3H5N A;  1MND A;  4IQJ A;  2ZSH B;  1WJE A;  2CW7 A;  4KT6 A;  3L2W A;  2A6T A;  3OYN A;  3CP8 A;  4BU2 A;  1WJF A;  3DU5 A;  3LMM A;  4XLH A;  4BGD A;  2MC4 A;  1R6R A;  3OL4 A;  2RRE A;  1LVK A;  4BJ6 C;  4B48 A;  2MD0 A;  3L2U A;  2CV1 A;  2HVR A;  1U0J A;  3K4B A;  1Z7L A;  4IQ4 A;  3G2B A;  4PJN A;  1N78 A;  2HPI A;  4D1Q A;  4RMN A;  3QYF A;  2WA0 A;  4E7J A;  1WJC A;  1X19 A;  2HQA A;  4DIQ A;  4XLF A;  4HEA 2;  2E60 A;  2KDO A;  4XKB A;  3OYF A;  4DOZ A;  2W1O A;  2LRE A;  2W4S A;  1ERD A;  2JUG A;  2PMZ A;  2LOO A;  3DEE A;  3HOS A;  2V1N A;  4G6T B;  1OLT A;  3AL0 B;  4PSX A;  4FAS D;  2UV1 A;  2M7B A;  3QOE A;  4BDY A;  3PNT A;  5LFA A;  3EUK L;  3MKY B;  1VZ0 A;  3CZ6 A;  4RM2 A;  1D0X A;  1DGW Y;  4HSR A;  3NWS A;  3ZRG A;  4CSW A;  2DT6 A;  2WAF A;  3MD2 A;  3OYH A;  3ZQQ A;  2Z16 A;  4NNJ A;  1AA7 A;  3L2Q A;  3PUB A;  2DOA A;  2WAE A;  3SZG A;  3PNV A;  4H4K C;  3I3L A;  4XM3 A;  1LDK B;  1MW7 A;  3TL4 X;  3BC8 A;  3IUO A;  4XL9 A;  3DQV C;  1BR2 A;  3H9Q A;  4XLA A;  2F6C A;  2L9S A;  1IRX A;  1NG7 A;  1G8X A;  3OMY A;  4C2U A;  2LY1 A;  4RM3 A;  4P1W A;  2VLA A;  3DWL E;  1V5G A;  1Z3X A;  3BLY A;  3LSK A;  4BL0 B;  3OYD A;  4LIU A;  3AFH A;  3PL8 A;  2ELJ A;  4BE2 A;  4DBQ A;  4E7S A;  3U21 A;  3LSI A;  2MFZ A;  2M4K A;  3LL7 A;  3C2G A;  5CQG A;  5TGT A;  3BCB A;  3CP2 A;  1MMD A;  4J01 A;  5LD2 C;  2MYS A;  4XON A;  4ZJZ A;  3VDX A;  4ANJ A;  2VJ4 A;  3HC7 A;  1Z21 A;  3VSK A;  3ZXS A;  2V6E A;  1S9H A;  4ZC3 A;  2L7K A;  4HNT A;  2DT7 B;  3OS0 A;  2OUM A;  1QHH D;  3W3C A;  4XQF A;  4IX7 A;  3CMM A;  2X6X A;  3K6G A;  2M4G A;  2M3A A;  5KHD A;  3DTK A;  3MMY B;  3IAM 2;  4D9J A;  3CES A;  1D1C A;  2VKH A;  3RCO A;  2DXI A;  1GLN A;  3IAS 2;  3H9J A;  4QPQ A;  4BQQ A;  4Y33 A;  2X1E A;  2W00 A;  1PJR A;  2R4G A;  4XKC A;  3ZCO A;  2ZXH A;  4Y3O A;  4J00 A;  2UWM A;  1NG6 A;  3W2A A;  1JI8 A;  5CQE A;  2HDW A;  4PJL A;  2R7U A;  2IGK A;  3HPG A;  4XR6 A;  1YX5 A;  4IKF A;  4PJM A;  3MKW B;  3F9K A;  3HXL A;  4BUP A;  3QYB A;  2LY2 A;  4AYB A;  2KRH A;  4HRI A;  2WB1 A;  2CMP A;  2GOM A;  3PSF A;  4EAT A;  2BOL A;  2X1C A;  2UUZ A;  4II2 A;  4AU7 A;  2CUJ A;  2XAU A;  2IS2 A;  2K5C A;  2E5Z A;  3CJR B;  4KIS A;  2R7X A;  4HNU A;  4CCL A;  2CH0 A;  4PFO A;  1HA8 A;  4F92 B;  3S32 A;  5FRM A;  1D0Z A;  4X0G A;  2Y0S A;  4XLC A;  3FHN A;  2X51 A;  4NQW B;  2VKD A;  4N4O B;  4OAZ A;  2Z1D A;  3HKZ A;  3C2H A;  4PJJ A;  3K10 A;  4R79 A;  3UNG C;  3M1C A;  3K4M A;  2M0M A;  3BG7 A;  3DKX A;  2RQQ A;  2ZFU A;  1Y6I A;  1V5E A;  3FDY A;  3OL3 A;  2XDV A;  5FRO A;  4CZC A;  4E7K A;  2E1M C;  3K70 C;  2LBF B;  2XF6 A;  3H9G A;  2WY7 Q;  5HVQ C;  1YX3 A;  2KHM A;  2IGM A;  3OYM A;  2BVM A;  3BG6 A;  4JQF A;  2BVL A;  2JVG A;  2NOJ B;  4CUG A;  2CV2 A;  4II3 A;  2VIX A;  4RLF A;  3J7A Y;  3A2K A;  2VXZ A;  5KCM A;  4B44 A;  3CF2 A;  3RPU D;  2CFO A;  2KP6 A;  3TMO A;  2K9M A;  2V26 A;  3ZR8 X;  4BAC A;  3ONQ A;  3K70 D;  2KRC A;  3E1S A;  3S3M A;  3L2R A;  2L9N A;  2CUZ A;  4CCJ A;  3NWT A;  1UG0 A;  2HZD A;  3D5L A;  4PFP A;  3V42 A;  4BE1 A;  4BQO A;  4JOM A;  2VPL A;  1K6Y A;  4ZDO A;  2R7Q A;  3OR1 C;  4DGW B;  3DPL C;  3K4C A;  3FKJ A;  2XF7 A;  3BCA A;  3SEQ A;  2E5N A;  2BW3 B;  1E0E A;  1X1D A;  1FMV A;  1LKX A;  2Q1Z B;  4PUS A;  3RQ4 A;  2CV0 A;  3OS1 A;  2RNG A;  3K4J A;  4C9Y A;  1J09 A;  2IS6 A;  4U87 A;  4ZYA A;  2IGN A;  3HG9 A;  1UEL B;  4BQN A;  3E0J B;  4BEH B;  1N75 A;  1Y56 A;  3QOD A;  1T0F C;  3LSH A;  4MLO A;  5CPR B;  4U7B A;  3AL0 C;  2KMU A;  1G59 A;  1D0Y A;  3PFY A;  3RTR A;  1KON A;  1DGR M;  2I8D A;  2VAS A;  4BXF A;  2LYC A;  2X6W A;  3K4K A;  1BOB A;  3KEY A;  3S93 A;  4LIT A;  2LC2 A;  4FET A;  3VYS B;  3OYG A;  3W2V A;  3H0D A;  4PK4 A;  2CW8 A;  3H35 A;  5JHF A;  3LSG A;  5HLT A;  3H5R A;  3OOU A;  5KNL A;  4HPQ A;  2HNH A;  2KLO A;  4CH7 A;  4XKV A;  1X1B A;  1BR1 A;  1BR4 A;  2PJR B;  2AQE A;  2LBF A;  3K4N A;  3MKZ A;  4IZZ A;  1SAU A;  3OR2 C;  1D1A A;  1N77 A;  2LRD A;  4F55 A;  2KPM A;  3FBI B;  4GRI A;  4E7I A;  1UAA A;  4YRV A;  1YE9 A;  1MMG A;  1PYV A;  2F4I A;  2VJJ A;  4RLQ A;  4XN3 A;  3HPH A;  2HPM A;  1MNE A;  4B43 A;  4F3Q A;  1SFK A;  4LIV A;  2X6Y A;  3H5A A;  2HU9 A;  1WJD A;  2F5V A;  3TBI A;  2P0W A;  1OR7 C;  2V9K A;  2JSP A;  1TT0 A;  1WFX A;  1P9Q C;  4ZTF A;  4XN0 A;  2JVH A;  4ZDL A;  3OYE A;  2WBM A;  3SDB A;  2O5R A;  5CKT A;  1X1C A;  3DTI A;  2XSJ C;  3N05 A;  3HUG B;  2M7A A;  5HNF A;  3OYC A;  2VQL A;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...