2L9RA

Solution nmr structure of homeobox domain of homeobox protein nkx-3.1 from homo sapiens, northeast structural genomics consortium target hr6470a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'MGHHHHHHSHMSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein Nkx-3.1
publication title Solution NMR Structure of Homeobox domain of Homeobox protein Nkx-3.1 from homo sapiens, Northeast Structural Genomics Consortium Target HR6470A
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l9rA00
3BR6A 2CUEA 3BQYA 1R9TJ 1O4XA 1RR7A 3FKIJ 2AO9A 3S2HJ 2M8GX 2I10A 4I6ZA 1IJWC 1NTCA 1I3QJ 2DTZA 1U9OA 3SJMA 3IH4A 1JTYA 2ZB9A 2NVXJ 1JGGA 1Y1WJ 1ETXA 2CU7A 3TP0A 1P7IA 2HYJA 1ETYA 5FKLA 5F1JA 5C4JJ 5GPAA 2K40A 2LVSA 1JUSA 3W6VA 1MBGA 2PMZN 1WH5A 2P81A 2QCOA 2VKEA 5GPCA 1DU0A 1I50J 4XICA 2M34A 1GUUA 1MNMC 2MW8A 1LE8A 5E3NA 4B1RA 4A3CJ 5M3MJ 4BKXA 1HDPA 2JA6J 2RAEA 5EEAA 5FLVA 2R5YB 1VF9A 5EZHA 2R7ZJ 2CQQA 2Y30A 1OFCX 1U9NA 5EG0A 5FKKA 1FJLA 2LK2A 2NVYJ 3BTIA 4MFEA 5J3LA 3BQZA 3S1NJ 4XK4A 2IAIA 2MGQA 2N8GA 3DEWA 3A03A 1BA5A 3RKQA 3PO2J 3ZQFA 1OCTC 5EYRA 2E1OA 5BNGA 3RQIA 4DZPA 3JREA 3HEFA 4A93J 3JRIA 2D5VA 1WCMJ 1PUFB 5GP9A 2DA4A 3GTPJ 2XB5A 1MH3A 5EGOB 1NK3P 1JTXA 2JA5J 2HI3A 4AC0A 2WV1A 5IP6A 3O8HA 4IEJA 1ZR2A 3HOZJ 1HDDC 4DYQA 1AHDP 2E2IJ 3GTMJ 1S7EA 2GBYA 1MBKA 5J1UA 3S1MJ 2JA7J 3O8GA 5J1RA 5F27A 2DMQA 1BW5A 4UUSA 2O8KA 2H8RA 5K7ZA 1T33A 4M3FA 1HLVA 2NS7A 1TWCJ 2R92J 3BG5A 3S14J 2K9NA 2DA7A 3LNQA 2WB1N 1TC3C 1IC8A 1OCPA 3I4MJ 3S1QJ 3HOVJ 5IOYA 4M3GA 3D1NI 3E7LA 3RZDJ 4IHVA 4B3AA 4V2GA 2DMPA 2COBA 1ETVA 1JKPC 3JRHA 3MKLA 3FK7A 4D7NA 5C3EJ 4C2MJ 2JJ7A 2M9HA 3TEDA 3FK6A 2B63J 1W0TA 3BG3A 1U78A 2DMNA 2ID6A 2YU9J 2DA1A 2KT0A 2IEKA 4C3JJ 5M5WJ 3GTLJ 1NK2P 3GTOJ 3BTLA 5FKOA 2CQXA 3WHBA 1G2HA 1H88C 1WI3A 1SANA 4JX6A 5E3LA 2DN0A 3OIOA 1FIPA 4Y7NJ 3DCFA 1BL0A 1GV5A 2LFBA 2XSDC 2ME0A 3JRAA 3H3VK 4BXXJ 2HDDA 2HXIA 2H1KA 5E3MA 5J1YA 1Y1VJ 3CDLA 4V2FA 4NDLA 4BBSJ 1X2MA 4A3BJ 2LKXA 1WH7A 2R0QC 3JRBA 3IH2A 4A3EJ 1IGNA 3BR1A 2AHQA 4BBRJ 3ZQGA 3K7AJ 3S16J 4FE4A 5JLXA 3ZQLA 1APLC 1VI0A 2NS8A 4GFBA 3F0CA 3PO3J 1B72B 1ZQ3P 2XRLA 1TWGJ 2MSYA 3IH3A 5FLMJ 1HOMA 1FEXA 1RKWA 4IHXA 1HCRA 5IYBJ 4MFDA 2ID3A 4UUTA 2LP0A 1TWAJ 2E19A 3BR5A 3OSFA 1MH4A 2Y9ZA 5IP9J 2K9QA 1F36A 4DYRA 1GT0C 3BG9A 2CJJA 1P7JA 2ECCA 1JKQC 1D5YA 1K83J 2X6OA 5EF6A 3OSGA 5FKMA 3OOUA 3CQZJ 2MG4A 2X48A 2ECBA 5JLWA 4A3KJ 3BT9A 1B8IA 4MLOA 3A01A 3HKZN 4X1EA 5F0CA 3G1LA 2DA6A 2DA5A 4JP0A 4BY1J 2JA8J 1RETA 4JX5A 4A3GJ 4CYCB 5DS9A 1ZR4A 4DW6A 4AYBN 2L7MP 5FJ8J 3TP3A 3TW6A 2CRGA 3NARA 4QTRA 3HBLA 2M0CA 2Y0SN 3S1RJ 1A5JA 3BR2A 4MO7A 5EDNA 2JN6A 2E2JJ 3MVPA 1QVTA 4D5FA 1AKHA 3LSJA 5FKNA 4ABZA 2HOSA 3ZQCA 4FISA 1EF4A 1YRNA 1ETQA 4BY7J 3JRCA 4B4CA 1RKTA 3VPRA 4XRSG 2E2HJ 3HGGA 2HOTA 3BTCA 3SFIA 1LE8B 3A02A 3Q0UA 4D5CA 1RPWA 5F0HA 1MBHA 2DMUA 4JX4A 4I76A 2LLKA 1W0UA 3B6CA 1JJ8C 1X58A 2JMWA 3HM5A 3HGYA 3HOXJ 2KDZA 2VKVA 2FJ1A 2W48A 3Q3SA 1TWHJ 2HQ5A 1FIAA 4W1UA 1GVDA 5EG0B 3I4NJ 1E3OC 2LR8A 2TRTA 4G12A 1K61A 3RZOJ 3WHCA 4Y52J 2DMTA 2VPRA 1UG2A 1JJ6C 2K9SA 4QSHA 4FCYA 4XRSA 1UMQA 1MBJA 2NOGA 4M6VA 3GTJJ 1JT0A 1TWFJ 4D7MA 4FTHA 3HB9A 3GTGJ 4M3EA 1XG1A 4LOCA 4IHYA 1JKRC 4S0HB 1Z77A 1CQTA 2Y31A 3Q0WA 4A3JJ 4DYCA 2R5YA 3QPLA 1A6IA 2HXOA 2JK3A 5IOZA 5C4XJ 2XPWA 3C2BA 3S17J 2WAQN 4QIWN 3PM1A 4UUSB 2EQRA 1MSEC 1I6HJ 2JWTA 1LFUP 3BTJA 2VUMJ 1T56A 1ENHA 1H89C 1MSFC 1DU6A 1MBFA 1HF0A 3Q0VA 4A3DJ 2FQ4A 4CYCA 3TW7A 1PUFA 1IDZA 5DTDA 3CMYA 3K2AA 2EZKA 2L9RA 4W97A 1JT6A 1ETKA 5IPAA 5EGOA 2O9LA 3JRFA 2GLOA 5F0FA 2EZIA 5M3FJ 1XS9A 4A3MJ 1IUFA 1AU7A 2XGDA 4C3HJ 2R93J 1IDYA 4A3IJ 1IV6A 1IRZA 4M3DA 3SDGA 2OPTA 1VFCA 2HOAA 5C44J 3H0GJ 1X2NA 2L7FP 3CCYA 1JKOC 4A3LJ 3M4OJ 1QRYA 2X9DA 1QPIA 4AUXA 3ZQIA 2XPUA 3BR0A 4A69C 3LOCA 2Y9YA 2R5ZB 2DA3A 4EEFG 1ZTRA 4JYKA 3HOYJ 1BW6A 2YS9A 2FX0A 3G1MA 3GBGA 2Y2ZA 5E3OA 1VNDA 2CUFA 1JUPA 4L5EA 1ETWA 3JRGA 2G0EA 3ZQHA 5K7HA 3FIWA 1POGA 3FISA 2NVQJ 2M2EA 4J19A 1JUMA 4M3BA 5M5XJ 1SFOJ 1GV2A 2XGEA 3L1PA 4FE7A 5F04A 2YUSA 1LFBA 3GTKJ 2EZHA 2QF7A 1IG7A 4MIMA 4XRMA 4HNVA 4RBOA 1GDTA 1ORKA 2LY9A 3HOUJ 3M3YJ 3JRDA 4DZJA 3JR9A 3BR3A 3G1OA 4C3IJ 3IV5A 3LSRA 1ZGWA 2LD5A 1ZKGA 4XIDA 3LSGA 5IYCJ 2L0KA 2L7ZA 4IHWA 2IBDA 4A3FJ 3B6AA 2ELKA 2O7OA 2XB0X 2XPVA 5IYDJ 5F08A 1XC5A 1B8IB 5HODA 2ME6A 3A01B 1MBEA 2EH3A 3S2DJ 3LSPA 2VI6A 1ZK8A 3UKGA 2DA2A 5EZGA 1B72A 2GM4A 3MN2A 2EBIA 1UHSA 3HOWJ 2LTPA 1RESA 2TCTA 1ETOA 2FD5A 1OJLA 3ZOBA 3S15J 1WPKA 1FTTA 2EZLA 2OF7A 3QPSA 1H8AC 1BJZA 5M5YJ 9ANTA 4X6AJ 1QVUA 4RDUA 2NVTJ 1AKHB 1WGXA 1Z0XA 1YRNB 3GTQJ 2XGCA 1FTZA 2DJNA 1ITYA 1Q1VA 3QQAA 5IP7J 3HDDA 1F43A 5K7FA 1U8BA 3NAUA 2R5ZA
chains in the Genus database with same CATH superfamily
1IRXA 1W36C 3HXLA 1RR7A 3KZZA 4RGRA 4WX9A 2I10A 3OYCA 4I6ZA 5BMZA 2HDCA 2CFOA 2IGMA 3IH4A 2ZB9A 2MLGA 3FBIB 1ETXA 3BJAA 3L9FA 4PSXA 4RGXA 2DBBA 4M72A 1X3UA 4Y13A 5IT9K 3IWZA 4E7JA 5FKLA 2IPQX 1LJ9A 5F1JA 5C4JJ 4S05A 2K40A 1UJ8A 2LVSA 1Z9CA 3HPHA 2RDPA 1YW9A 2K4JA 4LG3A 2ICWG 2DU9A 5CJ9A 2M34A 5J6XA 1EH6A 2KJBA 5E3NA 3K9TA 1WJBA 1A6QA 4HX4A 2ZJRF 2P0WA 4BKXA 5FRNA 1ZGJA 4CDGA 2OZUA 2ZSHB 5EEAA 3RSNA 2W85A 1V55H 5EZHA 2Y30A 2QEXI 1FOWA 1FJLA 2LK2A 3K69A 5D6EA 1B9NA 2Z9OA 1UELB 3W6KB 2HDWA 4ENNA 3C18A 3V7SA 4WK8F 1FT9A 2DXIA 3WU2C 3W2VA 5LGNA 3CCRI 1OCTC 1R23A 2ELJA 4YFNF 3MZ8A 5CVIA 4DZPA 3E6DA 4XNFA 3AAFA 4A93J 2FSWA 1X1AA 4BE2A 2D5VA 1IF1A 5GP9A 2DA4A 5DUKA 3GTPJ 1OYIA 3OS0A 3QYEA 1JTXA 1NK3P 1NHAA 2QZ8A 2LSOA 3CF2A 4BE1A 3FDYA 4OIPF 1ZR2A 1ZELA 3X2QH 4B3XA 3B02A 2MC3A 2XV4S 1HDDC 3HUGB 1AHDP 4UUVA 4WXHA 4X0GA 2HS5A 1A36A 2Q0OA 3GTMJ 4MTEA 2GBYA 1MBKA 2NXNB 4XBFA 5FRMA 4GYIA 2MC4A 4FX4A 2H8RA 3ECHA 2P7CB 1LDJA 1B9MA 4M3FA 2NS7A 2R92J 3BG5A 3S3MA 4AWXB 3LNQA 2VC1A 1FPQA 3GX4X 1IC8A 2KRHA 2KIFA 1IAWA 1V54H 2BHZA 4M3GA 1U8RA 4UV8A 3D1NI 1KONA 2YSRA 3WE2A 3F6OA 1ZLKA 1XD7A 2J5PA 5LBQA 2RQPA 2V1NA 4C2MJ 5DCMA 3B73A 2JJ7A 5D6FA 3CP8A 1EJ9A 2M9HA 4L9TA 1K79A 1MKMA 2FQ3A 4E7KA 1W0TA 2YR2A 1SD4A 5CVUA 2XDVA 2K4BA 5FLXK 2KT0A 1SFUA 3OV8A 2DYSH 4C3JJ 3LAPA 3GTLJ 2RN7A 3KLOA 3FBNB 2DDAA 5FKOA 4OWRB 4L9JA 2PN6A 4FT8A 4JX6A 1WRJA 2BVLA 3OIOA 4M9ZA 4Y7NJ 1MIJA 3WTTC 2ZSIB 3OL4A 2A68F 2YX7A 1GV5A 3JRAA 4BXXJ 3IKVA 5D5VB 1BIAA 3MCZA 4LK0F 2RV8A 4MHGA 4XLNF 3WG9A 3J80Z 1PUEE 3P9KA 4GDFA 1QNTA 3K4CA 2Z1DA 1J7KA 3DEUA 3KFWX 4GYGA 4NC6A 4BBRJ 2M0MA 4EM2A 4EV0A 3K7AJ 2KHMA 3FF5A 1G59A 4FE4A 3LL7A 5JLXA 1FC3A 2HEOA 3K4KA 1S3JA 1B59A 3RI4A 4D0PA 1AWCA 4F92B 3PO3J 3T8RA 5BPIA 1ZQ3P 2XRLA 3DKYA 4EATA 2AQEA 3OIQA 1QQIA 4RAYA 2JSCA 2DFFA 1SFXA 1K78A 4F3QA 3K2ZA 1HCRA 5IYBJ 3BP8A 3GF2A 3T0YA 2DI3A 2ZJ2A 2HKOA 5A2QZ 1HQCA 3BR5A 2DQRA 2E19A 4G6QA 1TNSA 2Y9ZA 4ZTFA 3GYHX 1KA8A 2LBFA 2W57A 1GT0C 1IN6A 3HRMA 4PJLA 3KP6A 1JKQC 1K83J 2R7DA 2X6OA 4L0YB 2Z3YA 1OMIA 3OOUA 5E17F 2VJJA 5JLWA 4CO8A 3L2CA 2F4IA 5LD2C 2HNHA 4Q4ZF 5F0CA 1WJCA 2NS0A 3IAS2 4XORA 2HYGD 4RAGA 5ICFA 4JX5A 4A3GJ 4CYCB 1TQPA 1UG0A 4AYBN 2H8WA 4DW6A 2Z33A 2L7MP 1W7PB 3TW6A 4QTRA 4L18B 3QAHA 4XONA 2VQGA 3S1RJ 2XIGA 3ZRGA 3CESA 1ZREA 2R7VA 4ZTJA 2HKXA 3M07A 4ABZA 2CMPA 1ZH5A 2O3FA 2DAOA 2UXXA 3SEQA 1LB2A 1X1CA 3EUAA 3ZR8X 3VPRA 2H09A 4XRSG 2LC2A 4I01A 2PI0A 3P5JA 2HOTA 1LE8B 3Q0UA 3DP7A 4D5CA 4HA8A 3GCMA 4IZZA 4I0AA 2P7VB 3G2BA 3QWLA 4XR6A 5DEQA 2KMUA 2VKVA 1BI0A 2H27A 2E5NA 3BDDA 2JSPA 1ZG5A 4YIIA 5EG0B 1WZ2A 2MFZA 4PFOA 1DUXC 4Y52J 1IN7A 2FOWA 3WHCA 5HS8A 1R49A 1JJ6C 3K4BA 4I99C 3LSTA 3WGHA 4Y4RA 1ERDA 4ZDOA 2I5UA 4XRSA 2ISZA 4AYBA 4M6VA 4ZDPA 1DPUA 4D7MA 1YI2I 2COMA 3RKWA 2CV1A 4I02A 2QYOA 5GAGJ 3ZCOA 1XG1A 2JVHA 2W82A 1W4MA 3BCAA 3EYYA 3QP5A 3HRUA 5HOOA 4ZYGA 2VBXA 4UV9A 2XF5A 1VQ8I 3QPLA 1ONVA 3LMMA 4U88A 2HXOA 2JK3A 4O6JA 3T1BA 5C4XJ 4Q5SF 3IC7A 1R5ID 2DDBA 3H9GA 1A04A 1ZLJA 2ADUA 2WAQN 4QIWN 1MNEA 3ERMA 3EUHA 2EV5A 2V7FA 4G8XA 3ZMZA 5HDNA 1LFUP 1TTYA 1YIJI 1H89C 1ENHA 1MSFC 4A3DJ 2FE3A 1ZG1A 2W00A 1OCOH 4XLEA 1JGSA 3TW7A 3OS2A 1TZLA 2L4MA 1D0YA 3S2WA 1YHQI 4G9YA 2DPDA 1KU7A 1JT6A 2XF6A 1P2FA 3RPUD 4HF1A 1QZEA 4HLXA 4C2UA 2EZIA 2IA2A 5H2FC 2MA3A 4OIRF 2VQCA 2DOEA 2XGDA 3HUGA 4C9YA 1JHHA 3DTEA 3HTUA 4M3DA 1AA7A 4C30A 2L9VA 3CMEI 1P6RA 1MMDA 2OPTA 1VFCA 3M8FA 2OQGA 1X2NA 5JI6A 4P9UA 1EH7A 3J80K 2DT5A 3ZQIA 3E5XA 4HDVA 4ZC3A 1A35A 5ILVA 1ULYA 2OA4A 2Y9YA 3FXLA 2DA3A 1EV7A 4RM3A 3G1MA 4BGDA 2X85A 2K27A 1VQ9I 4BH9A 5J8FA 3S3NA 3K4NA 4ZJZA 1W5CC 2ELHA 1VQ4I 1BOAA 3ZQHA 1QGPA 3PFYA 1EA3A 3BWGA 1POGA 2KPMA 1RC9A 3FIWA 5HVQC 2DYRH 4B09A 2V9PA 1N25A 2LH9A 4M9SA 2M2EA 3DPTA 4LB6B 2BVMA 1JUMA 4J19A 2IS2A 3CCUI 3RPUA 3WTYC 4NQWB 5FROA 2XGEA 5JR3A 2PEXA 2XC7A 5JVTA 3F3XA 2RC4A 4ZYDA 3EUHC 1IG7A 4RLFA 3RDIA 1XPXA 3E3VA 1HBXG 4N4OB 4IQ4A 3L00A 4XRMA 3CLQA 3P9IA 5E8GA 3WTWC 3HOUJ 2LY9A 3GZ6A 2R7OA 2JZYA 2Z2SB 1J5YA 2EFOA 1D1BA 2R7FA 2M5WA 2VBWA 2AQFA 2K85A 2LY2A 3LSRA 1B6AA 5EEGA 1ZGWA 4XIDA 2XGXA 2STTA 2Z99A 2IBDA 3B6AA 3I9V2 2ELKA 2BY2A 3PJRA 2XB0X 4IKFA 4CUGA 5IYDJ 1W7PD 2MABA 4ZZDA 1TL8A 2ME6A 4LFUA 4BXUA 2EA2A 1MBEA 4IO9F 2HVQA 1PJRA 3UR3C 2VI6A 4BACA 2LREA 2PMUA 4P5OA 4BHBA 1BN5A 2ZCWA 4UVBA 3A2KA 1KYWA 1RRJA 4RM2A 1UHSA 3HOWJ 4L9VA 2DJIA 3NRVA 2LTPA 2OAZA 2WY8Q 5IT9Z 5KVRA 4PGGA 1ETOA 2Y0SA 5EEHA 4A0YA 1VTNC 3MMYB 5LEKA 5LGTA 3J7ZI 2XAFA 2DOFA 4YIRX 1G8XA 5ICCA 3GZ5A 4FETA 5M5YJ 9ANTA 3IKTA 1S6LA 1QVUA 1R5GA 5BQTA 1UFMA 3E1SA 4RDUA 2NVTJ 4BNCA 3VOEA 3VODA 1R58A 1UHMA 3Q9VA 1OYYA 1Z0XA 4KN4X 4RB1A 1KYZA 1YRNB 2CG4A 2XGCA 2R7SA 1FTZA 4CSWA 4CCJA 2KFDA 1T39A 1KZHA 3CUQC 2ZBKA 2RKHA 3HDDA 3ZP5A 5HLTA 1X3ZB 4ENKA 3F8NA 3NAUA 1LUJB 3BR6A 3QODA 3BQYA 1R9TJ 2UXNA 2MD0A 4M73A 1O4XA 1MJBA 4EQQA 3CJRB 4PJJA 1E2XA 1W7PA 3H5AA 2A6HF 4ON0A 3L2WA 5DD8A 1TP4A 1IJWC 1I3QJ 3RIRA 5KK1A 5EJCA 1LEAA 3OYBA 3FX3A 3VWBA 2MBFA 4GO1A 1P7IA 2HVRA 1GXPA 1ETYA 3OYAA 2ZXJA 2R7UA 3QRFF 3BG6A 4P1WA 2HZTA 2IRFG 5D5UB 2YX4A 1BC8C 3W6VA 4HPQA 2PMZN 3FXMA 3KP3A 2O61A 1WH5A 2BYVE 2HWVA 2P81A 2QCOA 3R6SA 3MKWB 2D2WA 2Q1ZB 3L2RA 2QENA 2VKEA 4HV6A 3AL0C 1I27A 1YLFA 4XICA 3HTSB 2IXSA 5ILSA 2M87A 1LE8A 4BAYA 3U1DA 2XAHA 5FFZA 1IXCA 3KP2A 3ZGKA 2PMHA 3J7AO 3E6BA 1IW7F 4HG2A 2VJ4A 3WODF 5M3MJ 2VOPA 1R7JA 3ZMVA 3OYIA 4LIVA 3C2HA 2IW5A 4LIUA 4CZZA 1R00A 2R7ZJ 2CQQA 1U9NA 2A61A 3VYSB 3WG7H 3ELKA 5FKKA 5LHHA 4EVIA 5EG0A 2RREA 5TISC 1RR8C 2NVYJ 1MJAA 4MFEA 3V7CA 5DM6F 2PG4A 4K2EA 5K5RA 2W4SA 3OYJA 4TV7A 2IAIA 2N8GA 3MQ0A 3RKQA 3ZQFA 4AVPA 2FNPA 3TDZC 4XLPF 4RMNA 2E1OA 2JPCA 3DWLE 3DU6A 1R4NB 1XGMA 3VYRB 3JRIA 1VQLI 4HOBA 2DTRA 1KU3A 1WCMJ 4RGSA 2RGVA 4QWQA 2HU9A 4KYWA 2XB5A 1MH3A 1X19A 3CUOA 3JSPA 3TO7A 3HSRA 4IRHA 4OU0A 5EGOB 1P9QC 2JA5J 2HI3A 4AC0A 3L09A 3C2GA 5IP6A 2WWYA 2IP2A 1R1VA 2OJED 2EPFA 2PMZA 4KNYA 4OMYA 2F2EA 4LD5A 2V1XA 5FLXZ 1TQIA 4N9IA 4UVAA 1FOXA 1XX5A 2OZ6A 2HGCA 3O8GA 3KLNA 4XLAA 2VKHA 2W24A 5K7ZA 1DGWY 1SMYF 1T33A 2QSGX 1TWCJ 3ASOH 3MEXA 3S14J 5DV5A 1ON2A 5CKTA 3F9KA 1TC3C 3DQVC 5BPDA 3S1QJ 4B43A 1BBYA 5H20A 5H6RA 5IOYA 2KQRA 1BI2A 4ENMA 3RZDJ 4B3AA 5E79C 2OBPA 4CZCA 1SD6A 5BOXA 1ETVA 3DXJF 1JKPC 3QPHA 3FK7A 4HX8A 2CV0A 2BE5F 2QKMB 1H9GA 4DBRA 2IA1A 4XKVA 5GAEJ 2M7AA 3DBLB 3BG3A 3F22A 1KU2A 2FMYA 2QUFA 3MKYB 1FYMA 4IL6C 2LRDA 2QWWA 1G3TA 3C3WA 3ERED 2OV7A 3LFUA 2A5WA 5ILUA 2OQRA 3QYFA 2CQXA 2C6YA 3T8TA 1WJAA 5TJJA 4E7IA 1V4RA 4PJNA 3COAC 1RUOA 4IHSA 2CWEA 2ME0A 3WGGA 2XUBA 2HXIA 2EFNA 4MQ9F 1M1EB 1J9IA 3WTXC 5LGUA 1Z1DA 4V2FA 4BBSJ 4A6DA 2WC2A 1EH8A 2XVCA 1WH7A 2R0QC 4U7DA 3IH2A 4RS8A 3KEOA 1T8IA 5LHGA 4CGZA 2AHQA 3CDIA 3GFJA 3ZQGA 4HRIA 4DNCA 4NBQA 2R7XA 2EK5A 4O3MA 1RZ4A 4E4HA 4NQWA 3GW2A 1JXSA 1YG2A 4N0BA 5BS6A 2PLYA 2K7LA 1APLC 4CCNA 3HRSA 3F0CA 1RIOH 2KIQA 3TKYA 1WQ2A 3F23A 2HR3A 1O3QA 4IRIA 2MSYA 3IH3A 5FLMJ 2LOOA 2P6SA 3F8CA 2EFPA 4E70A 4JBAA 4DQ2A 1FEXA 2W84A 3OYHA 1QHGA 3S8PA 2ZC2A 3HC7A 4KT5C 5AIPA 2CQKA 2K5CA 2LP0A 1TWAJ 1UB9A 2IS6A 5DCFA 1QZYA 1MH4A 3U21A 5IP9J 2BZTA 1F36A 2K9QA 4Z6YA 4DYRA 3SFZA 5EF6A 3EUKL 3MWMA 5FKMA 5H6QA 3CQZJ 3H92A 1YE9A 1P4XA 2BBYA 4X1EA 1N78A 4M74A 2FBHA 2OTJI 3G1LA 3V7RA 1FLIA 3LWFA 2DCEA 2GA1A 2GA2A 1RETA 2CO5A 1XMKA 1ZN2A 2XASA 2DLLA 5JHUA 2F5FA 5DDGA 4BQAA 3AG3H 3TP3A 4CYDA 2CRGA 1AOYA 3IWFA 2HFHA 3HBLA 1K7AA 2M0CA 3MZYA 3TBIA 3HOTA 4M9XA 3AG1H 4MO7A 5LFAA 2FXAA 1QVTA 5HS7A 5JHFA 3CCQI 4J01A 2HOSA 2LYCA 1EF4A 3BC8A 1LVAA 1XSXA 1YRNA 1Z7LA 1ETQA 3JRCA 3F6VA 4B4CA 3MKZA 3RPQA 3CCVI 3OMYA 1BR1A 4IOAF 2WADA 3N05A 3BTCA 1D8JA 2G7HA 2RNGA 2EINH 1FZPB 1D3YA 2DMUA 3BY6A 4I76A 3B6CA 1JJ8C 1R36A 4HYEA 2KDZA 3WGIA 1TWHJ 2IGNA 1YTYA 1BC7C 2EIJH 4GXOA 2XROA 2E1MB 2AS5F 3CC2I 1Y0NA 1IRFA 2LR8A 2TRTA 1HSJA 1C0WA 3BJ6A 1QO0D 4EGYA 3CUQB 4QSHA 2DT7B 4FCYA 3BROA 3GLLA 2NOGA 2EILH 1FBUA 1ODDA 1ON1A 3RKYA 4AIDA 2FOKA 3GTJJ 1JT0A 2X6WA 4LG0B 2E34A 4YG2F 1U0JA 1SC7A 1FBQA 1TW2A 1IXSB 4M3EA 3WTZA 3VDXA 3JAMK 1ZARA 4CCOA 4LOCA 3TQNA 5JFRA 5B1AH 1JKRC 4NUBA 2Y31A 2QQBA 1V3FA 1F9NA 2R7TA 1S9HA 2IS4A 2XAJA 1A6IA 4M6YA 5JVGF 4EGZA 3RTRA 4E7LA 2XPWA 2RQQA 5IT3A 3BCBA 3AL0B 1OCZH 3FM5A 3OYDA 2KLOA 4UUSB 1MSEC 2E60A 2JWTA 1I6HJ 2XAGA 3BTJA 2QA4I 1OCCH 3DFGA 4U7BA 3CMAI 2VUMJ 4AIHA 1HF0A 3R4KA 1P4WA 3E6MA 3DKXA 2FQ4A 1O57A 2PQ8A 3ABUA 1IDZA 3K2AA 5ICEA 2EZKA 5EGOA 3R61A 4MGRA 3CCJI 1E0EA 1S5LC 5F0FA 3KCCA 3M9AA 1LFPA 2LNBA 1YW7A 1TLHB 1IUFA 2VQLA 1AU7A 4PDKA 2VJ5A 1IDYA 1XGNA 2QQ9A 5CVJA 1A31A 2DPUA 4IX7A 5AONA 1HXDA 4BUPA 1MNDA 2P5LC 3I53A 1JKOC 1FSEA 2HZDA 1QRYA 1EKEA 3A1YA 1TW3A 2IGOA 1F5TA 4FX0A 1IZ1A 1Y56A 3LOCA 1J59A 3CC4I 4XQFA 2GOMA 1QBJA 1HW5A 4JYKA 1VQPI 1BW6A 2YS9A 3CP2A 3KYCB 3CCMI 2L9NA 1HKTA 1VNDA 2GXBA 2CUFA 3MZHA 2R7QA 4L5EA 2CW8A 2NNYA 4Z2YA 3CDHA 1ETWA 3JRGA 2G0EA 1V5FA 2VT3A 1J09A 5FFXA 3GFIA 5K7HA 3A4CA 1K4TA 3AKZA 1MD0A 1WVRA 2A05A 3PFIA 4HQMA 1D0XA 5F1RA 2NRAC 3HL2A 5F04A 1LFBA 1X1DA 5GAHJ 2EZHA 5J40A 1Y8RB 3DTIA 3KYDB 5F6FA 4F55A 1QA6A 5HDGA 3CCSI 4KIGA 2NVUB 4HSTA 4RBOA 3E0JB 1ORKA 4IOCF 1ACIA 3JR9A 2B7EA 3GXOA 2DK5A 4RAFA 2P5KA 3L2QA 4PUSA 2LD5A 1R1UA 4PFPA 5HLHA 2FA5A 3LSKA 3LSGA 5HNFA 2L7ZA 4IHWA 2MLKA 4EMSA 1ZYRF 4UXNA 1XC5A 2V9VA 3HSEA 5HODA 2YU3A 4JQFA 2O0YA 3LSPA 4QPOA 2TDXA 3ZMDA 1ZK8A 3UKGA 3KEQA 5EZGA 3V8JA 2GM4A 4Q48A 1U6GA 2DT6A 2M8EA 4FQGA 4CICA 3I4PA 3V4GA 2FD5A 1OJLA 3ZOBA 3ML6A 3J81K 1FTTA 1FWZA 2OF7A 3LSIA 1XDUA 2VN2A 1TNTA 5HDKA 1BJZA 4BQNA 2DOAA 3IRRA 2EV6A 1AKHB 1WGXA 5L3EA 5FO5A 2JQ7A 3JTGA 3H9QA 2AXTC 4B44A 4E7HA 2DJNA 4BYYA 3CTAA 1Q1VA 2OUMA 1TQMA 2ESNA 1W5SA 5DM7F 1F43A 1D8KA 1FY7A 3CJTB 2CUEA 4F7ZA 4ASNA 5L3CA 1DQUA 3PNTA 2OCEA 3IAM2 3ULQB 4L0ZB 2AO9A 3S2HJ 3I71A 1NTCA 1N77A 1U9OA 4XN0A 1JTYA 4CXFA 1OPCA 3KP7A 1JGGA 1HW2A 4IQJA 5FD5A 5DYMA 3J7AY 2FMLA 3PL8A 3TP0A 3I58A 2KIMA 2D45A 1VZ0A 1T2KA 2BGCA 1MMGA 2KRCA 2V1DA 5GPAA 1HKSA 2BV6A 4L9NA 2M1BA 3I54A 2IVMA 4ESFA 4ESBA 3EQLF 2CQNA 2F5EA 1ZAOA 3GLXA 2EJRA 4B48A 3G73A 1XB4A 1I50J 2DO7A 2ZNZA 3K4MA 1GUUA 2HOEA 2CSOA 2LG4A 4YFXF 3CO7C 1MNMC 3S3OA 2E35A 2IS1A 4A12A 3EYIA 2VOOA 1XN7A 2KRFA 1DDNA 4L5JA 4G7ZF 1HDPA 2JA6J 2RAEA 5KAIC 1GLNA 5FLVA 3GEZA 4IXAA 1S7OA 4LLGF 2WAQA 3NEUA 4RGUA 2VONA 3KP5A 5GTHC 4XLCA 2Y48A 2E7XA 1T38A 3BQZA 3G71I 4AIKA 3S1NJ 1YITI 1OR7A 2XF7A 2XKPA 4XK4A 6PAXA 3CUQA 2MGQA 5FD6A 3DEWA 2ZJQF 1BA5A 3PIPF 4LK1F 2PJRB 2DFIA 5EYRA 5FB2A 2V26A 5BNGA 4IHTA 2J5OA 4U87A 2ZFWA 4ZH4F 3CZ6A 4LG0A 3FXQA 3M8EA 1SFKA 1T08B 1Z3XA 5CQEA 4BEHB 3FXRA 4NC7A 3CJQB 3O6BB 5CVRA 1RUNA 1X1PA 2VE8A 4UVCA 2WV1A 2A07F 2UUZA 2H1LA 5IY5H 2QLZA 4DYQA 1SD7A 3G4SI 4HAMA 3L7WA 3LSHA 2E2IJ 1S7EA 2BEOA 4I7HA 3S1MJ 1SVLA 3E97A 2JA7J 5J1RA 4PK4A 5F27A 1BW5A 4UUSA 1MMNA 3FM3A 4RA2A 1HLVA 4EM1A 2M30A 3N4MA 2WB1N 3NQOA 2VB6A 5B5EC 3M7GA 1J2XA 4PSWA 3AG2H 3F21A 5GADJ 3HOVJ 2L02A 5B1BH 1XCVA 4BDYA 1BI1A 3E7LA 4YRVA 4IHVA 4BE0A 2MH9A 1I1GA 2COBA 5L3GA 1FYLA 2A3SA 4D7NA 5C3EJ 1MMSA 1N75A 3HG9A 3I59B 1T0FA 3DPUA 3TEDA 1I1SA 1T98A 2R4GA 2NOJB 3SZGA 1U78A 4YFKF 2E1MC 4U0VA 2DA1A 4PCQA 2IEKA 4JOMA 2DFEA 3U1KA 1NK2P 5L3BA 2L7KA 2WV0A 3BTLA 3ZMSA 2NAZA 3WHBA 1G2HA 1FP2A 1OR7C 2M3AA 2V6EA 1MW7A 1SANA 3CJNA 3OYGA 4CCLA 2BY3A 5E3LA 4MEYF 1PDNC 4AU7A 3BZKA 3RYPA 2HPMA 3K1PA 1FIPA 4KA4A 1IXRC 1JHFA 1KQ0A 1BL0A 1WKMA 2LFBA 2K9MA 3KIOA 5CVVA 2H1KA 1KU9A 2ESHA 5E3MA 1IN4A 2CW7A 1XCBA 2JPBA 2KISA 1G3YA 3OYEA 3F8FA 2EFQA 1Y1VJ 4UB6C 1UCRA 4NDLA 4A3BJ 3OIPA 2LKXA 1G6NA 3GZNB 3JRBA 1SEUA 4G94A 2LKSA 1IGNA 3T5XA 3BR1A 4CCMA 4AVZA 3FHZA 4MEXF 2LDUA 1RNLA 1IO2A 2F4OB 2G7UA 3S16J 4YELA 4XLFA 5FGMA 3ZQLA 3DU5A 4A0XA 1VI0A 2NS8A 4GFBA 1B72B 4XM3A 1Z91A 2PJPA 1HOMA 1BI3A 5E20A 2KIUA 2WAEA 3HHGA 4R8HA 4XKCA 1SAXA 2VL8A 4FHTA 1RKWA 2L3DA 3SHFA 2STWA 1W1WE 3LA7A 4UUTA 4KJZA 4U0WA 5AIQA 1USTA 2E7WA 1D5YA 4RB0A 1T0FC 3OL3A 1J75A 2ECBA 5J4VA 4OOIA 2Z5UA 3BT9A 3P9CA 4A3KJ 2OTLI 2DQLA 3HKZN 1IN5A 3H35A 2EFWA 2WY7Q 3LQQA 3PQKA 2DA5A 2K86A 3VSKA 1XMAA 4XOTA 5CLSA 4KMFA 3WTSC 2CS3A 3QOPA 3W6JB 3REOA 5CQGA 3SYTA 3W2WA 1Z67A 3RCOA 2QSHX 3NARA 5D4RA 2K3PA 1A5JA 3BR2A 3PNVA 5EDNA 1HA8A 3K6GA 1Y39A 3DF8A 1OYWA 2CGPA 1Y0UA 1AKHA 5FKNA 4FISA 3SZTA 2L9SA 3MD2A 2K3FA 1BM9A 4NB5A 2X1CA 3JAMZ 4E6KG 3K1NA 2P5VA 1TT5B 3KP4A 4UY8I 1T6SA 5F0HA 1RPWA 3KEYA 1MBHA 2NNNA 2P6TA 1BOBA 1T95A 4A0ZA 2LLKA 4AIJA 4BDZA 1W0UA 1O3TA 4LB5A 4EM0B 2HTSA 4D1QA 1X58A 5D5WB 3BG7A 2CW0F 2JMWA 3BJOA 3HGYA 3HM5A 1CF7B 3ROUA 3I3LA 2FJ1A 1R22A 3C1DA 2D1HA 1FIAA 2JUGA 1GVDA 2E1CA 3I4NJ 1X4OA 1SAUA 5L3DA 4G12A 1D1CA 3RZOJ 2O03A 3HKZA 1UG2A 3ABMH 5LEJA 4LMYA 3HJEA 4XRFA 1ZRDA 2XHKA 3NWTA 3ASNH 3WTVC 3OYNA 3ZN0A 5DD4A 5D5XB 5J4YA 3WE3A 1TWFJ 4FTHA 4KITB 1LDDA 3N97A 5E8IA 1MGTA 3GTGJ 3LSMA 1G3WA 3DBRB 4HLYA 4IHYA 4KIFA 2A69F 1VQNI 1JI8A 3OWTA 3SEZA 3Q0WA 4A3JJ 2VKDA 1Z05A 3CCLI 1SVMA 1UZCA 3RQ4A 5E1WA 1Y8QB 3S17J 2KP6A 2BW3B 4EJTA 1TT0A 3Q5FA 4KISA 2HVSA 4A5MA 1NG6A 1K4SA 2F6CA 3BZCA 2F5CA 1DU6A 2PJRA 1MBFA 3RJPA 2R7WA 4F52A 3CO6C 3F72A 2VBYA 3D0SA 2JRMA 3FXOA 3PSIA 3G3ZA 1P4AA 1LNWA 3CMYA 5E1ZB 3IUOA 2CFXA 2H6CA 2L54A 1B1BA 2L9RA 4O5VA 5ED4A 3GFMA 1ETKA 4BEHA 3FMSA 2BXYA 4Y3OA 2EA4A 3GUDA 3W3CA 5CPRB 4C3HJ 3BPVA 2GIVA 1LDKB 1S29A 3M8JA 2R93J 1ZHFA 4A3IJ 3H3UA 3HPGA 1IV6A 3S32A 1IRZA 3SDGA 3J7YJ 3EETA 3KZIC 2MH2A 2HPIA 2RNJA 2ZXIA 3A0BC 3H0GJ 4UNOA 1FSHA 4P9FA 1FYKA 3M4OJ 1QPIA 1BR2A 1KQ9A 3VSLA 4AUXA 3JCUC 1BR4A 2R3SA 1L3LA 4U0YA 3QU3A 1DP3A 3O3KA 4A69C 3D5SC 3FWEA 3I5UA 3K10A 3PUFA 3KPHA 5HNHA 2FBKA 3DPLC 4EEFG 4G7OF 2ZO4A 1YQAA 1ZTRA 2FX0A 1REPC 3GBGA 3ZMTA 3O2PE 1OQYA 4NNJA 2M45A 3GWZA 3I59A 3EPZA 2NVQJ 3HYIA 1SFEA 2X0LA 4M3BA 4YEJA 5M5XJ 1GV2A 2Y75A 3HZJA 4PZJA 4ZYAA 4AD9A 2Q2EB 1HC8A 2K9LA 3SQNA 1MMAA 2YUSA 2H6BA 4GCVA 4JK1X 2LF7A 1V5EA 3J81Z 1OKRA 1WJ5A 1CGPA 1WHUA 2IJLA 4MIMA 4RB3C 2DW4A 2LMDA 3IL2A 1S72I 1GDTA 3JRDA 3RKXA 5DUIA 4KDPA 4C2TA 1R4MB 4WF2A 4XSXF 1ZKGA 5IYCJ 2L0KA 2A6EF 3BOQA 4WCGA 1YJWI 3CF5F 2ZNYA 2XPVA 2GZWA 5F08A 1B8IB 4P55A 1YOVB 4YIFA 3A01B 4OIOF 3S2DJ 5B66C 2ZMEB 2E36A 1VQOI 2DA2A 4M6XA 4HQEA 1B72A 2XAQA 3KE2A 4N4NB 4E7SA 3UNGC 5KNLA 3JSOA 2EBIA 5J47A 4BJ5C 2ZJPF 1XDSA 5K5QA 4XL9A 2KZVA 2HQNA 2WTEA 4WXCA 3JW4A 4BHCA 3KYLA 1WPKA 1F4KA 3S15J 1WJEA 2CUZA 2JA2A 4IPAA 5HLIA 5D4SA 2EZLA 1LPQA 2GXAA 3QPSA 1H8AC 1LVKA 3K0LA 4OAYA 4WWCA 4LJZF 3L2UA 4ZYHA 1XGSA 1O3SA 4ITVA 1FMWA 1S7AA 3PIOF 4HSRA 1R71A 3H9JA 1DP7P 1QU3A 1QHHD 4HEA2 4QLCU 1W5TA 2GWRA 2ZXWH 2VIXA 4BL0B 3QQAA 1QPMA 5B3SH 3S93A 5K7FA 1YS7A 2HQRA 1PYVA 1MDMB 1VQ6I 2R5ZA 1FNNA 3E6CC 2GIZA 2Z16A 3TOAA 4KIBA 2IGKA 1OISA 3ABTA 3FHNA 4UHTA 3FKIJ 2VXZA 3SZPA 2M8GX 1U3EM 3CD6I 2DTZA 3SJMA 2YPRA 2NVXJ 3HHHA 3TMOA 1Y1WJ 2CU7A 3E5QA 3H1CA 2HYJA 1DPRA 4NC8A 1JUSA 2L5QA 1MBGA 4MTDA 4P96A 5GPCA 5HS9A 1DU0A 5K1YA 2QBYB 5D8LB 4HF0A 4G6TB 4XOPA 2MW8A 5TRDA 1O7LA 3U9GA 3ZMUA 4B1RA 4A3CJ 1B4AA 2DFHA 2VT2A 2KL4A 5HLGA 1CF7A 3A0HC 2F4MB 2O8XA 4EJUA 2PFBA 1OLTA 5TGTA 2R5YB 1VF9A 2VASA 1OFCX 4CCKA 3HIFA 3IHUA 3BTIA 1ZRCA 5J3LA 4IF4A 4XN3A 4CH7A 4HV5A 4S04A 1WSUA 2Y0MA 3QP6A 4HF2A 4Q47A 3A03A 3H0DA 3PO2J 1QZZA 4R79A 1LQ1A 4BU2A 4ETSA 4Y33A 4CA0A 2M7BA 2PX9A 3RQIA 5L3FA 1G4DA 3JREA 3HEFA 4KMUX 2JT1A 2KKOA 3V8KA 3OYFA 2KDOA 3DTKA 2ACJA 1PUFB 3AG4H 2CV2A 3QOEA 4PJ0C 3K1MA 1I39A 3G6EI 2IT0A 1F1ZA 2FUG2 1VQMI 3O8HA 3DEEA 4IEJA 3HOZJ 1HKQA 2LKPA 4I0BA 2XSJC 5CYVA 1RI7A 1YYVA 5J1UA 3F8MA 2ZFUA 2BW3A 4XSZF 2W25A 2DMQA 2O8KA 2LF8A 2Y69H 2UZKA 2VLAA 2K9NA 2DA7A 4PJMA 1OCPA 3I4MJ 2X51A 3PQJA 3QPTA 2FRHA 1IV8A 3GFLA 2E5ZA 4BQQA 2QKLB 3LA3A 3OR1C 4V2GA 2VE9A 3ZXSA 2DMPA 1O3RA 3FMRA 3JRHA 3MKLA 1U5TB 3ECOA 3FK6A 4HX7A 2B63J 2HTJA 4KT6A 1FX7A 1FOKA 1USSA 2K02A 1V5GA 1GXQA 3KZYA 5E18F 2DMNA 2ID6A 2V4JC 4M71A 2YU9J 1GVJA 4CHUA 1U2WA 3CC7I 5M5WJ 1IUYA 1UHWA 4IVNA 3GTOJ 2EWNA 1H88C 1WI3A 2EV0A 2ZKZA 4GGGA 4H0EA 3V42A 4EJVA 2DN0A 3PNYA 4A2UA 2A6TA 3DCFA 2M4KA 2XSDC 3H3VK 3L2VA 2HDDA 4XMYA 4KN7X 4WXDA 2JUCA 3ISPA 4MQVA 1SD5A 2R7RA 5J1YA 3CDLA 2JVGA 3EDPA 4J00A 1X2MA 1JE8A 3H5NA 3FXUA 3KETA 4A3EJ 4OAZA 3MAJA 1K6YA 1Z7UA 3TDUC 1YFHA 1XSVA 1Z6RA 4E7ZA 4Y15A 2F5DA 4ZZLA 2Q2EA 3FMQA 2BOLA 3LFKA 3VFZA 3K70D 4A5NA 1J0RA 3SXYA 2BHYA 3BZ6A 1TBXA 1TWGJ 1BIBA 2XAUA 3OR2C 1H0MA 1I5ZA 3VYUB 1HSTA 1L0OC 2L4AA 4KFCA 1P92A 4IHXA 3V8LA 1WI9A 2I8DA 4MFDA 2Q8KA 1E3HA 2ID3A 4GRIA 2EIMH 3OSFA 1Z6TA 2WBMA 3BG9A 1IN8A 2CJJA 1P7JA 2V79A 2ECCA 3DLAA 1Y6IA 3OSGA 3OYKA 2IA0A 1B8IA 2MG4A 2X48A 4BQOA 4MLOA 3BLYA 3A01A 4N9HA 5K5OA 2VQHA 3E5UA 2DA6A 2ZMEA 1YX3A 4JP0A 4BY1J 3OY9A 3GO5A 2JA8J 2OCCH 4FASD 2HYFA 2HQAA 3Q9SA 5DS9A 5ICGA 2RVCA 4KUMA 1ZR4A 3H5RA 2MD5A 2DK8A 2GOXB 5FJ8J 2JTVA 3ZQ7A 4HW0A 3CCEI 1X3WB 4AM3A 3DV8A 2Y0SN 2WA0A 3RYRA 2OD5A 2JN6A 2E2JJ 1XMXA 3MVPA 3QYBA 4DOZA 4B8XA 4D5FA 3WTUC 4HNUA 3LSJA 3ZQCA 4BS9A 3C7JA 4I98B 2VBZA 4BY7J 5A2QK 1RKTA 5ERIA 1VQ5I 4LITA 2MYSA 2OC6A 2E2HJ 1GHCA 2W7NA 3HGGA 4B47A 4DBQA 3SFIA 4HBLA 3A02A 4BHPA 4ZYEA 1MDMA 4JX4A 1R1TA 1FP1D 1PP8F 4BJTA 2DODA 2OU2A 1YJ9I 1D5VA 4II2A 1K6OA 4I09A 4DJAA 3HOXJ 3Q3SA 2W48A 1YW8A 3TO6A 2F48A 3D5LA 2HQ5A 3ONQA 4W1UA 1ZRFA 1E3OC 2UWMA 2QSFX 1K61A 2FEZA 4V19K 2DMTA 2VPRA 2XKOA 2XRNA 4ZDLA 1YO5C 1NH3A 3ZPLA 2K9SA 5LRSA 3R0JA 2GXGA 1UMQA 1MBJA 1YX5A 3ABKH 3TO9A 2AXLA 5J8CA 2QBYA 3VB2A 3OYMA 1PP7U 1KGSA 3HB9A 4XLHA 1WJDA 3R60A 1YIOA 2X1DA 3LA2A 1STZA 4F91B 1O7FA 2KZGA 5LLQA 4S0HB 1Z77A 4H4KC 4LLLA 1CQTA 2ZMEC 1G3SA 3FZVA 3LQRA 4DYCA 2R5YA 1VQ7I 5IOZA 4XKBA 4QPQA 3OYLA 3C2BA 1S8NA 1WJFA 1MJ9A 3PM1A 2EQRA 1NG7A 3M1CA 2WB1A 3K70C 1ZGAA 4IJAA 2FU4A 1UAAA 2QVOA 1T56A 2V1UA 1Q1HA 3Q0VA 2BY1A 5KCMA 1ZG3A 3QU6A 2LY1A 4CYCA 5LRRA 1FOYA 1PUFA 4ESJA 5DTDA 3CMMA 2FBIA 3TL4X 3W2AA 2H94A 4W97A 2GAUA 3TGNA 2CQ7A 2P8TA 2UV1A 4ANJA 5GTIC 5IPAA 4BXFA 2O9LA 3JTHA 4LGWA 3JRFA 1XSDA 2G9WA 3I56I 1W36D 2PBIA 4DIQA 2GLOA 5KHDA 3DBHB 5M3FJ 1XS9A 4RAZA 3IRQA 5DCMB 4D9JA 4A3MJ 1VQKI 2CYYA 1WFXA 2GQQA 1Z21A 2D1VA 3H36A 3HSFA 1BJAA 2M4GA 2A5YB 3CLOA 3FXJA 3ZN1A 1H9TA 2NYXA 2KJCA 4NHJA 2HOAA 4EJOA 5C44J 3K4JA 2L7FP 2QQAA 1WWXA 3CCYA 4A3LJ 2X9DA 2E1NA 3NWSA 1XTAA 4ENJA 1FMVA 3BPXA 2ISYA 2XPUA 2X4HA 1R5HA 3BR0A 4G6DA 3OOPA 2L01A 3DKWA 1FBSA 1MZBA 4OMZA 3PUBA 2R5ZB 3HOYJ 2F5VA 4MNUA 2V6CA 3SDBA 2Y2ZA 5E3OA 3M1EA 1JUPA 1LEBA 2ETHA 1I3AA 2CH0A 1SVOA 1YS6A 3LAJA 1U5TA 1E3PA 2V9KA 1D0ZA 3HOSA 2O5RA 4L5IA 2QGUA 3FISA 2WAFA 3U2RA 3OS1A 3GVAA 4RLQA 3PSFA 4OINF 4II3A 4UB8C 1SFOJ 3AFHA 1YJNI 3L1PA 2JRTA 1DGRM 4FE7A 2X6XA 3K4LA 3GTKJ 3R0AA 2CUJA 5F64A 2QF7A 3I55I 4LLNA 2VC0A 4EJWA 4KICA 4HNVA 3F8BA 1XGOA 1D1AA 4XKWA 1K78B 3ABLH 3M3YJ 3ZQQA 4DZJA 3KX2A 3BR3A 3G1OA 4C3IJ 3IV5A 4HDUA 4HNTA 2L2OA 4Y17A 3WU0A 4IRGA 1X1BA 4OIQF 2P4WA 2ZXHA 3MFKA 2LBFB 3GMEA 4A3FJ 1I6XA 3DLLF 2VJIA 2O7OA 3IP4B 3VEPA 2VPLA 2X6YA 4A6EA 2E71A 2B9SA 1PVEA 2EB7A 2EH3A 4HZFA 3HRTA 3WU1B 4F93B 4DGWB 4BJ6C 2O6GE 3MN2A 3ESWB 5E1XA 5D8KB 2VODA 2QQ8A 1HW1A 1Z3YA 1IRGA 1OCRH 1RESA 2TCTA 2X1EA 1R6RA 3D5RC 3FXKA 4R1HA 2BY0A 1E17A 1X4PA 2VXDA 5KAFC 2W1OA 4X6AJ 1SMTA 3I0TA 2FF4A 4RB2C 3H3ZA 3GTQJ 4PGHA 5LHIA 1U5TC 4I2OA 1ITYA 2FNAA 3I64A 2B0LA 2EIKH 3P7NA 3TOBA 3FKJA 1LKXA 2QM3A 5IP7J 3VYTB 4G7HF 1U8BA 1KQ8A 2BXZA
chains in the Genus database with same CATH topology
3BR6A 2CUEA 3BQYA 1R9TJ 1O4XA 1RR7A 3FKIJ 2AO9A 3S2HJ 2M8GX 2I10A 4I6ZA 1IJWC 1NTCA 1I3QJ 2DTZA 1U9OA 3SJMA 3IH4A 1JTYA 2ZB9A 2NVXJ 1JGGA 1Y1WJ 1ETXA 2CU7A 3TP0A 1P7IA 2HYJA 1ETYA 5FKLA 5F1JA 5C4JJ 5GPAA 2K40A 2LVSA 1JUSA 3W6VA 1MBGA 2PMZN 1WH5A 2P81A 2QCOA 2VKEA 5GPCA 1DU0A 1I50J 4XICA 2M34A 1GUUA 1MNMC 2MW8A 1LE8A 5E3NA 4B1RA 4A3CJ 5M3MJ 4BKXA 1HDPA 2JA6J 2RAEA 5EEAA 5FLVA 2R5YB 1VF9A 5EZHA 2R7ZJ 2CQQA 2Y30A 1OFCX 1U9NA 5EG0A 5FKKA 1FJLA 2LK2A 2NVYJ 3BTIA 4MFEA 5J3LA 3BQZA 3S1NJ 4XK4A 2IAIA 2MGQA 2N8GA 3DEWA 3A03A 1BA5A 3RKQA 3PO2J 3ZQFA 1OCTC 5EYRA 2E1OA 5BNGA 3RQIA 4DZPA 3JREA 3HEFA 4A93J 3JRIA 2D5VA 1WCMJ 1PUFB 5GP9A 2DA4A 3GTPJ 2XB5A 1MH3A 5EGOB 1NK3P 1JTXA 2JA5J 2HI3A 4AC0A 2WV1A 5IP6A 3O8HA 4IEJA 1ZR2A 3HOZJ 1HDDC 4DYQA 1AHDP 2E2IJ 3GTMJ 1S7EA 2GBYA 1MBKA 5J1UA 3S1MJ 2JA7J 3O8GA 5J1RA 5F27A 2DMQA 1BW5A 4UUSA 2O8KA 2H8RA 5K7ZA 1T33A 4M3FA 1HLVA 2NS7A 1TWCJ 2R92J 3BG5A 3S14J 2K9NA 2DA7A 3LNQA 2WB1N 1TC3C 1IC8A 1OCPA 3I4MJ 3S1QJ 3HOVJ 5IOYA 4M3GA 3D1NI 3E7LA 3RZDJ 4IHVA 4B3AA 4V2GA 2DMPA 2COBA 1ETVA 1JKPC 3JRHA 3MKLA 3FK7A 4D7NA 5C3EJ 4C2MJ 2JJ7A 2M9HA 3TEDA 3FK6A 2B63J 1W0TA 3BG3A 1U78A 2DMNA 2ID6A 2YU9J 2DA1A 2KT0A 2IEKA 4C3JJ 5M5WJ 3GTLJ 1NK2P 3GTOJ 3BTLA 5FKOA 2CQXA 3WHBA 1G2HA 1H88C 1WI3A 1SANA 4JX6A 5E3LA 2DN0A 3OIOA 1FIPA 4Y7NJ 3DCFA 1BL0A 1GV5A 2LFBA 2XSDC 2ME0A 3JRAA 3H3VK 4BXXJ 2HDDA 2HXIA 2H1KA 5E3MA 5J1YA 1Y1VJ 3CDLA 4V2FA 4NDLA 4BBSJ 1X2MA 4A3BJ 2LKXA 1WH7A 2R0QC 3JRBA 3IH2A 4A3EJ 1IGNA 3BR1A 2AHQA 4BBRJ 3ZQGA 3K7AJ 3S16J 4FE4A 5JLXA 3ZQLA 1APLC 1VI0A 2NS8A 4GFBA 3F0CA 3PO3J 1B72B 1ZQ3P 2XRLA 1TWGJ 2MSYA 3IH3A 5FLMJ 1HOMA 1FEXA 1RKWA 4IHXA 1HCRA 5IYBJ 4MFDA 2ID3A 4UUTA 2LP0A 1TWAJ 2E19A 3BR5A 3OSFA 1MH4A 2Y9ZA 5IP9J 2K9QA 1F36A 4DYRA 1GT0C 3BG9A 2CJJA 1P7JA 2ECCA 1JKQC 1D5YA 1K83J 2X6OA 5EF6A 3OSGA 5FKMA 3OOUA 3CQZJ 2MG4A 2X48A 2ECBA 5JLWA 4A3KJ 3BT9A 1B8IA 4MLOA 3A01A 3HKZN 4X1EA 5F0CA 3G1LA 2DA6A 2DA5A 4JP0A 4BY1J 2JA8J 1RETA 4JX5A 4A3GJ 4CYCB 5DS9A 1ZR4A 4DW6A 4AYBN 2L7MP 5FJ8J 3TP3A 3TW6A 2CRGA 3NARA 4QTRA 3HBLA 2M0CA 2Y0SN 3S1RJ 1A5JA 3BR2A 4MO7A 5EDNA 2JN6A 2E2JJ 3MVPA 1QVTA 4D5FA 1AKHA 3LSJA 5FKNA 4ABZA 2HOSA 3ZQCA 4FISA 1EF4A 1YRNA 1ETQA 4BY7J 3JRCA 4B4CA 1RKTA 3VPRA 4XRSG 2E2HJ 3HGGA 2HOTA 3BTCA 3SFIA 1LE8B 3A02A 3Q0UA 4D5CA 1RPWA 5F0HA 1MBHA 2DMUA 4JX4A 4I76A 2LLKA 1W0UA 3B6CA 1JJ8C 1X58A 2JMWA 3HM5A 3HGYA 3HOXJ 2KDZA 2VKVA 2FJ1A 2W48A 3Q3SA 1TWHJ 2HQ5A 1FIAA 4W1UA 1GVDA 5EG0B 3I4NJ 1E3OC 2LR8A 2TRTA 4G12A 1K61A 3RZOJ 3WHCA 4Y52J 2DMTA 2VPRA 1UG2A 1JJ6C 2K9SA 4QSHA 4FCYA 4XRSA 1UMQA 1MBJA 2NOGA 4M6VA 3GTJJ 1JT0A 1TWFJ 4D7MA 4FTHA 3HB9A 3GTGJ 4M3EA 1XG1A 4LOCA 4IHYA 1JKRC 4S0HB 1Z77A 1CQTA 2Y31A 3Q0WA 4A3JJ 4DYCA 2R5YA 3QPLA 1A6IA 2HXOA 2JK3A 5IOZA 5C4XJ 2XPWA 3C2BA 3S17J 2WAQN 4QIWN 3PM1A 4UUSB 2EQRA 1MSEC 1I6HJ 2JWTA 1LFUP 3BTJA 2VUMJ 1T56A 1ENHA 1H89C 1MSFC 1DU6A 1MBFA 1HF0A 3Q0VA 4A3DJ 2FQ4A 4CYCA 3TW7A 1PUFA 1IDZA 5DTDA 3CMYA 3K2AA 2EZKA 2L9RA 4W97A 1JT6A 1ETKA 5IPAA 5EGOA 2O9LA 3JRFA 2GLOA 5F0FA 2EZIA 5M3FJ 1XS9A 4A3MJ 1IUFA 1AU7A 2XGDA 4C3HJ 2R93J 1IDYA 4A3IJ 1IV6A 1IRZA 4M3DA 3SDGA 2OPTA 1VFCA 2HOAA 5C44J 3H0GJ 1X2NA 2L7FP 3CCYA 1JKOC 4A3LJ 3M4OJ 1QRYA 2X9DA 1QPIA 4AUXA 3ZQIA 2XPUA 3BR0A 4A69C 3LOCA 2Y9YA 2R5ZB 2DA3A 4EEFG 1ZTRA 4JYKA 3HOYJ 1BW6A 2YS9A 2FX0A 3G1MA 3GBGA 2Y2ZA 5E3OA 1VNDA 2CUFA 1JUPA 4L5EA 1ETWA 3JRGA 2G0EA 3ZQHA 5K7HA 3FIWA 1POGA 3FISA 2NVQJ 2M2EA 4J19A 1JUMA 4M3BA 5M5XJ 1SFOJ 1GV2A 2XGEA 3L1PA 4FE7A 5F04A 2YUSA 1LFBA 3GTKJ 2EZHA 2QF7A 1IG7A 4MIMA 4XRMA 4HNVA 4RBOA 1GDTA 1ORKA 2LY9A 3HOUJ 3M3YJ 3JRDA 4DZJA 3JR9A 3BR3A 3G1OA 4C3IJ 3IV5A 3LSRA 1ZGWA 2LD5A 1ZKGA 4XIDA 3LSGA 5IYCJ 2L0KA 2L7ZA 4IHWA 2IBDA 4A3FJ 3B6AA 2ELKA 2O7OA 2XB0X 2XPVA 5IYDJ 5F08A 1XC5A 1B8IB 5HODA 2ME6A 3A01B 1MBEA 2EH3A 3S2DJ 3LSPA 2VI6A 1ZK8A 3UKGA 2DA2A 5EZGA 1B72A 2GM4A 3MN2A 2EBIA 1UHSA 3HOWJ 2LTPA 1RESA 2TCTA 1ETOA 2FD5A 1OJLA 3ZOBA 3S15J 1WPKA 1FTTA 2EZLA 2OF7A 3QPSA 1H8AC 1BJZA 5M5YJ 9ANTA 4X6AJ 1QVUA 4RDUA 2NVTJ 1AKHB 1WGXA 1Z0XA 1YRNB 3GTQJ 2XGCA 1FTZA 2DJNA 1ITYA 1Q1VA 3QQAA 5IP7J 3HDDA 1F43A 5K7FA 1U8BA 3NAUA 2R5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR6 A;  2CUE A;  3BQY A;  1R9T J;  1O4X A;  1RR7 A;  3FKI J;  2AO9 A;  3S2H J;  2M8G X;  2I10 A;  4I6Z A;  1IJW C;  1NTC A;  1I3Q J;  2DTZ A;  1U9O A;  3SJM A;  3IH4 A;  1JTY A;  2ZB9 A;  2NVX J;  1JGG A;  1Y1W J;  1ETX A;  2CU7 A;  3TP0 A;  1P7I A;  2HYJ A;  1ETY A;  5FKL A;  5F1J A;  5C4J J;  5GPA A;  2K40 A;  2LVS A;  1JUS A;  3W6V A;  1MBG A;  2PMZ N;  1WH5 A;  2P81 A;  2QCO A;  2VKE A;  5GPC A;  1DU0 A;  1I50 J;  4XIC A;  2M34 A;  1GUU A;  1MNM C;  2MW8 A;  1LE8 A;  5E3N A;  4B1R A;  4A3C J;  5M3M J;  4BKX A;  1HDP A;  2JA6 J;  2RAE A;  5EEA A;  5FLV A;  2R5Y B;  1VF9 A;  5EZH A;  2R7Z J;  2CQQ A;  2Y30 A;  1OFC X;  1U9N A;  5EG0 A;  5FKK A;  1FJL A;  2LK2 A;  2NVY J;  3BTI A;  4MFE A;  5J3L A;  3BQZ A;  3S1N J;  4XK4 A;  2IAI A;  2MGQ A;  2N8G A;  3DEW A;  3A03 A;  1BA5 A;  3RKQ A;  3PO2 J;  3ZQF A;  1OCT C;  5EYR A;  2E1O A;  5BNG A;  3RQI A;  4DZP A;  3JRE A;  3HEF A;  4A93 J;  3JRI A;  2D5V A;  1WCM J;  1PUF B;  5GP9 A;  2DA4 A;  3GTP J;  2XB5 A;  1MH3 A;  5EGO B;  1NK3 P;  1JTX A;  2JA5 J;  2HI3 A;  4AC0 A;  2WV1 A;  5IP6 A;  3O8H A;  4IEJ A;  1ZR2 A;  3HOZ J;  1HDD C;  4DYQ A;  1AHD P;  2E2I J;  3GTM J;  1S7E A;  2GBY A;  1MBK A;  5J1U A;  3S1M J;  2JA7 J;  3O8G A;  5J1R A;  5F27 A;  2DMQ A;  1BW5 A;  4UUS A;  2O8K A;  2H8R A;  5K7Z A;  1T33 A;  4M3F A;  1HLV A;  2NS7 A;  1TWC J;  2R92 J;  3BG5 A;  3S14 J;  2K9N A;  2DA7 A;  3LNQ A;  2WB1 N;  1TC3 C;  1IC8 A;  1OCP A;  3I4M J;  3S1Q J;  3HOV J;  5IOY A;  4M3G A;  3D1N I;  3E7L A;  3RZD J;  4IHV A;  4B3A A;  4V2G A;  2DMP A;  2COB A;  1ETV A;  1JKP C;  3JRH A;  3MKL A;  3FK7 A;  4D7N A;  5C3E J;  4C2M J;  2JJ7 A;  2M9H A;  3TED A;  3FK6 A;  2B63 J;  1W0T A;  3BG3 A;  1U78 A;  2DMN A;  2ID6 A;  2YU9 J;  2DA1 A;  2KT0 A;  2IEK A;  4C3J J;  5M5W J;  3GTL J;  1NK2 P;  3GTO J;  3BTL A;  5FKO A;  2CQX A;  3WHB A;  1G2H A;  1H88 C;  1WI3 A;  1SAN A;  4JX6 A;  5E3L A;  2DN0 A;  3OIO A;  1FIP A;  4Y7N J;  3DCF A;  1BL0 A;  1GV5 A;  2LFB A;  2XSD C;  2ME0 A;  3JRA A;  3H3V K;  4BXX J;  2HDD A;  2HXI A;  2H1K A;  5E3M A;  5J1Y A;  1Y1V J;  3CDL A;  4V2F A;  4NDL A;  4BBS J;  1X2M A;  4A3B J;  2LKX A;  1WH7 A;  2R0Q C;  3JRB A;  3IH2 A;  4A3E J;  1IGN A;  3BR1 A;  2AHQ A;  4BBR J;  3ZQG A;  3K7A J;  3S16 J;  4FE4 A;  5JLX A;  3ZQL A;  1APL C;  1VI0 A;  2NS8 A;  4GFB A;  3F0C A;  3PO3 J;  1B72 B;  1ZQ3 P;  2XRL A;  1TWG J;  2MSY A;  3IH3 A;  5FLM J;  1HOM A;  1FEX A;  1RKW A;  4IHX A;  1HCR A;  5IYB J;  4MFD A;  2ID3 A;  4UUT A;  2LP0 A;  1TWA J;  2E19 A;  3BR5 A;  3OSF A;  1MH4 A;  2Y9Z A;  5IP9 J;  2K9Q A;  1F36 A;  4DYR A;  1GT0 C;  3BG9 A;  2CJJ A;  1P7J A;  2ECC A;  1JKQ C;  1D5Y A;  1K83 J;  2X6O A;  5EF6 A;  3OSG A;  5FKM A;  3OOU A;  3CQZ J;  2MG4 A;  2X48 A;  2ECB A;  5JLW A;  4A3K J;  3BT9 A;  1B8I A;  4MLO A;  3A01 A;  3HKZ N;  4X1E A;  5F0C A;  3G1L A;  2DA6 A;  2DA5 A;  4JP0 A;  4BY1 J;  2JA8 J;  1RET A;  4JX5 A;  4A3G J;  4CYC B;  5DS9 A;  1ZR4 A;  4DW6 A;  4AYB N;  2L7M P;  5FJ8 J;  3TP3 A;  3TW6 A;  2CRG A;  3NAR A;  4QTR A;  3HBL A;  2M0C A;  2Y0S N;  3S1R J;  1A5J A;  3BR2 A;  4MO7 A;  5EDN A;  2JN6 A;  2E2J J;  3MVP A;  1QVT A;  4D5F A;  1AKH A;  3LSJ A;  5FKN A;  4ABZ A;  2HOS A;  3ZQC A;  4FIS A;  1EF4 A;  1YRN A;  1ETQ A;  4BY7 J;  3JRC A;  4B4C A;  1RKT A;  3VPR A;  4XRS G;  2E2H J;  3HGG A;  2HOT A;  3BTC A;  3SFI A;  1LE8 B;  3A02 A;  3Q0U A;  4D5C A;  1RPW A;  5F0H A;  1MBH A;  2DMU A;  4JX4 A;  4I76 A;  2LLK A;  1W0U A;  3B6C A;  1JJ8 C;  1X58 A;  2JMW A;  3HM5 A;  3HGY A;  3HOX J;  2KDZ A;  2VKV A;  2FJ1 A;  2W48 A;  3Q3S A;  1TWH J;  2HQ5 A;  1FIA A;  4W1U A;  1GVD A;  5EG0 B;  3I4N J;  1E3O C;  2LR8 A;  2TRT A;  4G12 A;  1K61 A;  3RZO J;  3WHC A;  4Y52 J;  2DMT A;  2VPR A;  1UG2 A;  1JJ6 C;  2K9S A;  4QSH A;  4FCY A;  4XRS A;  1UMQ A;  1MBJ A;  2NOG A;  4M6V A;  3GTJ J;  1JT0 A;  1TWF J;  4D7M A;  4FTH A;  3HB9 A;  3GTG J;  4M3E A;  1XG1 A;  4LOC A;  4IHY A;  1JKR C;  4S0H B;  1Z77 A;  1CQT A;  2Y31 A;  3Q0W A;  4A3J J;  4DYC A;  2R5Y A;  3QPL A;  1A6I A;  2HXO A;  2JK3 A;  5IOZ A;  5C4X J;  2XPW A;  3C2B A;  3S17 J;  2WAQ N;  4QIW N;  3PM1 A;  4UUS B;  2EQR A;  1MSE C;  1I6H J;  2JWT A;  1LFU P;  3BTJ A;  2VUM J;  1T56 A;  1ENH A;  1H89 C;  1MSF C;  1DU6 A;  1MBF A;  1HF0 A;  3Q0V A;  4A3D J;  2FQ4 A;  4CYC A;  3TW7 A;  1PUF A;  1IDZ A;  5DTD A;  3CMY A;  3K2A A;  2EZK A;  2L9R A;  4W97 A;  1JT6 A;  1ETK A;  5IPA A;  5EGO A;  2O9L A;  3JRF A;  2GLO A;  5F0F A;  2EZI A;  5M3F J;  1XS9 A;  4A3M J;  1IUF A;  1AU7 A;  2XGD A;  4C3H J;  2R93 J;  1IDY A;  4A3I J;  1IV6 A;  1IRZ A;  4M3D A;  3SDG A;  2OPT A;  1VFC A;  2HOA A;  5C44 J;  3H0G J;  1X2N A;  2L7F P;  3CCY A;  1JKO C;  4A3L J;  3M4O J;  1QRY A;  2X9D A;  1QPI A;  4AUX A;  3ZQI A;  2XPU A;  3BR0 A;  4A69 C;  3LOC A;  2Y9Y A;  2R5Z B;  2DA3 A;  4EEF G;  1ZTR A;  4JYK A;  3HOY J;  1BW6 A;  2YS9 A;  2FX0 A;  3G1M A;  3GBG A;  2Y2Z A;  5E3O A;  1VND A;  2CUF A;  1JUP A;  4L5E A;  1ETW A;  3JRG A;  2G0E A;  3ZQH A;  5K7H A;  3FIW A;  1POG A;  3FIS A;  2NVQ J;  2M2E A;  4J19 A;  1JUM A;  4M3B A;  5M5X J;  1SFO J;  1GV2 A;  2XGE A;  3L1P A;  4FE7 A;  5F04 A;  2YUS A;  1LFB A;  3GTK J;  2EZH A;  2QF7 A;  1IG7 A;  4MIM A;  4XRM A;  4HNV A;  4RBO A;  1GDT A;  1ORK A;  2LY9 A;  3HOU J;  3M3Y J;  3JRD A;  4DZJ A;  3JR9 A;  3BR3 A;  3G1O A;  4C3I J;  3IV5 A;  3LSR A;  1ZGW A;  2LD5 A;  1ZKG A;  4XID A;  3LSG A;  5IYC J;  2L0K A;  2L7Z A;  4IHW A;  2IBD A;  4A3F J;  3B6A A;  2ELK A;  2O7O A;  2XB0 X;  2XPV A;  5IYD J;  5F08 A;  1XC5 A;  1B8I B;  5HOD A;  2ME6 A;  3A01 B;  1MBE A;  2EH3 A;  3S2D J;  3LSP A;  2VI6 A;  1ZK8 A;  3UKG A;  2DA2 A;  5EZG A;  1B72 A;  2GM4 A;  3MN2 A;  2EBI A;  1UHS A;  3HOW J;  2LTP A;  1RES A;  2TCT A;  1ETO A;  2FD5 A;  1OJL A;  3ZOB A;  3S15 J;  1WPK A;  1FTT A;  2EZL A;  2OF7 A;  3QPS A;  1H8A C;  1BJZ A;  5M5Y J;  9ANT A;  4X6A J;  1QVU A;  4RDU A;  2NVT J;  1AKH B;  1WGX A;  1Z0X A;  1YRN B;  3GTQ J;  2XGC A;  1FTZ A;  2DJN A;  1ITY A;  1Q1V A;  3QQA A;  5IP7 J;  3HDD A;  1F43 A;  5K7F A;  1U8B A;  3NAU A;  2R5Z A; 
#chains in the Genus database with same CATH topology
 1IRX A;  1W36 C;  3HXL A;  1RR7 A;  3KZZ A;  4RGR A;  4WX9 A;  2I10 A;  3OYC A;  4I6Z A;  5BMZ A;  2HDC A;  2CFO A;  2IGM A;  3IH4 A;  2ZB9 A;  2MLG A;  3FBI B;  1ETX A;  3BJA A;  3L9F A;  4PSX A;  4RGX A;  2DBB A;  4M72 A;  1X3U A;  4Y13 A;  5IT9 K;  3IWZ A;  4E7J A;  5FKL A;  2IPQ X;  1LJ9 A;  5F1J A;  5C4J J;  4S05 A;  2K40 A;  1UJ8 A;  2LVS A;  1Z9C A;  3HPH A;  2RDP A;  1YW9 A;  2K4J A;  4LG3 A;  2ICW G;  2DU9 A;  5CJ9 A;  2M34 A;  5J6X A;  1EH6 A;  2KJB A;  5E3N A;  3K9T A;  1WJB A;  1A6Q A;  4HX4 A;  2ZJR F;  2P0W A;  4BKX A;  5FRN A;  1ZGJ A;  4CDG A;  2OZU A;  2ZSH B;  5EEA A;  3RSN A;  2W85 A;  1V55 H;  5EZH A;  2Y30 A;  2QEX I;  1FOW A;  1FJL A;  2LK2 A;  3K69 A;  5D6E A;  1B9N A;  2Z9O A;  1UEL B;  3W6K B;  2HDW A;  4ENN A;  3C18 A;  3V7S A;  4WK8 F;  1FT9 A;  2DXI A;  3WU2 C;  3W2V A;  5LGN A;  3CCR I;  1OCT C;  1R23 A;  2ELJ A;  4YFN F;  3MZ8 A;  5CVI A;  4DZP A;  3E6D A;  4XNF A;  3AAF A;  4A93 J;  2FSW A;  1X1A A;  4BE2 A;  2D5V A;  1IF1 A;  5GP9 A;  2DA4 A;  5DUK A;  3GTP J;  1OYI A;  3OS0 A;  3QYE A;  1JTX A;  1NK3 P;  1NHA A;  2QZ8 A;  2LSO A;  3CF2 A;  4BE1 A;  3FDY A;  4OIP F;  1ZR2 A;  1ZEL A;  3X2Q H;  4B3X A;  3B02 A;  2MC3 A;  2XV4 S;  1HDD C;  3HUG B;  1AHD P;  4UUV A;  4WXH A;  4X0G A;  2HS5 A;  1A36 A;  2Q0O A;  3GTM J;  4MTE A;  2GBY A;  1MBK A;  2NXN B;  4XBF A;  5FRM A;  4GYI A;  2MC4 A;  4FX4 A;  2H8R A;  3ECH A;  2P7C B;  1LDJ A;  1B9M A;  4M3F A;  2NS7 A;  2R92 J;  3BG5 A;  3S3M A;  4AWX B;  3LNQ A;  2VC1 A;  1FPQ A;  3GX4 X;  1IC8 A;  2KRH A;  2KIF A;  1IAW A;  1V54 H;  2BHZ A;  4M3G A;  1U8R A;  4UV8 A;  3D1N I;  1KON A;  2YSR A;  3WE2 A;  3F6O A;  1ZLK A;  1XD7 A;  2J5P A;  5LBQ A;  2RQP A;  2V1N A;  4C2M J;  5DCM A;  3B73 A;  2JJ7 A;  5D6F A;  3CP8 A;  1EJ9 A;  2M9H A;  4L9T A;  1K79 A;  1MKM A;  2FQ3 A;  4E7K A;  1W0T A;  2YR2 A;  1SD4 A;  5CVU A;  2XDV A;  2K4B A;  5FLX K;  2KT0 A;  1SFU A;  3OV8 A;  2DYS H;  4C3J J;  3LAP A;  3GTL J;  2RN7 A;  3KLO A;  3FBN B;  2DDA A;  5FKO A;  4OWR B;  4L9J A;  2PN6 A;  4FT8 A;  4JX6 A;  1WRJ A;  2BVL A;  3OIO A;  4M9Z A;  4Y7N J;  1MIJ A;  3WTT C;  2ZSI B;  3OL4 A;  2A68 F;  2YX7 A;  1GV5 A;  3JRA A;  4BXX J;  3IKV A;  5D5V B;  1BIA A;  3MCZ A;  4LK0 F;  2RV8 A;  4MHG A;  4XLN F;  3WG9 A;  3J80 Z;  1PUE E;  3P9K A;  4GDF A;  1QNT A;  3K4C A;  2Z1D A;  1J7K A;  3DEU A;  3KFW X;  4GYG A;  4NC6 A;  4BBR J;  2M0M A;  4EM2 A;  4EV0 A;  3K7A J;  2KHM A;  3FF5 A;  1G59 A;  4FE4 A;  3LL7 A;  5JLX A;  1FC3 A;  2HEO A;  3K4K A;  1S3J A;  1B59 A;  3RI4 A;  4D0P A;  1AWC A;  4F92 B;  3PO3 J;  3T8R A;  5BPI A;  1ZQ3 P;  2XRL A;  3DKY A;  4EAT A;  2AQE A;  3OIQ A;  1QQI A;  4RAY A;  2JSC A;  2DFF A;  1SFX A;  1K78 A;  4F3Q A;  3K2Z A;  1HCR A;  5IYB J;  3BP8 A;  3GF2 A;  3T0Y A;  2DI3 A;  2ZJ2 A;  2HKO A;  5A2Q Z;  1HQC A;  3BR5 A;  2DQR A;  2E19 A;  4G6Q A;  1TNS A;  2Y9Z A;  4ZTF A;  3GYH X;  1KA8 A;  2LBF A;  2W57 A;  1GT0 C;  1IN6 A;  3HRM A;  4PJL A;  3KP6 A;  1JKQ C;  1K83 J;  2R7D A;  2X6O A;  4L0Y B;  2Z3Y A;  1OMI A;  3OOU A;  5E17 F;  2VJJ A;  5JLW A;  4CO8 A;  3L2C A;  2F4I A;  5LD2 C;  2HNH A;  4Q4Z F;  5F0C A;  1WJC A;  2NS0 A;  3IAS 2;  4XOR A;  2HYG D;  4RAG A;  5ICF A;  4JX5 A;  4A3G J;  4CYC B;  1TQP A;  1UG0 A;  4AYB N;  2H8W A;  4DW6 A;  2Z33 A;  2L7M P;  1W7P B;  3TW6 A;  4QTR A;  4L18 B;  3QAH A;  4XON A;  2VQG A;  3S1R J;  2XIG A;  3ZRG A;  3CES A;  1ZRE A;  2R7V A;  4ZTJ A;  2HKX A;  3M07 A;  4ABZ A;  2CMP A;  1ZH5 A;  2O3F A;  2DAO A;  2UXX A;  3SEQ A;  1LB2 A;  1X1C A;  3EUA A;  3ZR8 X;  3VPR A;  2H09 A;  4XRS G;  2LC2 A;  4I01 A;  2PI0 A;  3P5J A;  2HOT A;  1LE8 B;  3Q0U A;  3DP7 A;  4D5C A;  4HA8 A;  3GCM A;  4IZZ A;  4I0A A;  2P7V B;  3G2B A;  3QWL A;  4XR6 A;  5DEQ A;  2KMU A;  2VKV A;  1BI0 A;  2H27 A;  2E5N A;  3BDD A;  2JSP A;  1ZG5 A;  4YII A;  5EG0 B;  1WZ2 A;  2MFZ A;  4PFO A;  1DUX C;  4Y52 J;  1IN7 A;  2FOW A;  3WHC A;  5HS8 A;  1R49 A;  1JJ6 C;  3K4B A;  4I99 C;  3LST A;  3WGH A;  4Y4R A;  1ERD A;  4ZDO A;  2I5U A;  4XRS A;  2ISZ A;  4AYB A;  4M6V A;  4ZDP A;  1DPU A;  4D7M A;  1YI2 I;  2COM A;  3RKW A;  2CV1 A;  4I02 A;  2QYO A;  5GAG J;  3ZCO A;  1XG1 A;  2JVH A;  2W82 A;  1W4M A;  3BCA A;  3EYY A;  3QP5 A;  3HRU A;  5HOO A;  4ZYG A;  2VBX A;  4UV9 A;  2XF5 A;  1VQ8 I;  3QPL A;  1ONV A;  3LMM A;  4U88 A;  2HXO A;  2JK3 A;  4O6J A;  3T1B A;  5C4X J;  4Q5S F;  3IC7 A;  1R5I D;  2DDB A;  3H9G A;  1A04 A;  1ZLJ A;  2ADU A;  2WAQ N;  4QIW N;  1MNE A;  3ERM A;  3EUH A;  2EV5 A;  2V7F A;  4G8X A;  3ZMZ A;  5HDN A;  1LFU P;  1TTY A;  1YIJ I;  1H89 C;  1ENH A;  1MSF C;  4A3D J;  2FE3 A;  1ZG1 A;  2W00 A;  1OCO H;  4XLE A;  1JGS A;  3TW7 A;  3OS2 A;  1TZL A;  2L4M A;  1D0Y A;  3S2W A;  1YHQ I;  4G9Y A;  2DPD A;  1KU7 A;  1JT6 A;  2XF6 A;  1P2F A;  3RPU D;  4HF1 A;  1QZE A;  4HLX A;  4C2U A;  2EZI A;  2IA2 A;  5H2F C;  2MA3 A;  4OIR F;  2VQC A;  2DOE A;  2XGD A;  3HUG A;  4C9Y A;  1JHH A;  3DTE A;  3HTU A;  4M3D A;  1AA7 A;  4C30 A;  2L9V A;  3CME I;  1P6R A;  1MMD A;  2OPT A;  1VFC A;  3M8F A;  2OQG A;  1X2N A;  5JI6 A;  4P9U A;  1EH7 A;  3J80 K;  2DT5 A;  3ZQI A;  3E5X A;  4HDV A;  4ZC3 A;  1A35 A;  5ILV A;  1ULY A;  2OA4 A;  2Y9Y A;  3FXL A;  2DA3 A;  1EV7 A;  4RM3 A;  3G1M A;  4BGD A;  2X85 A;  2K27 A;  1VQ9 I;  4BH9 A;  5J8F A;  3S3N A;  3K4N A;  4ZJZ A;  1W5C C;  2ELH A;  1VQ4 I;  1BOA A;  3ZQH A;  1QGP A;  3PFY A;  1EA3 A;  3BWG A;  1POG A;  2KPM A;  1RC9 A;  3FIW A;  5HVQ C;  2DYR H;  4B09 A;  2V9P A;  1N25 A;  2LH9 A;  4M9S A;  2M2E A;  3DPT A;  4LB6 B;  2BVM A;  1JUM A;  4J19 A;  2IS2 A;  3CCU I;  3RPU A;  3WTY C;  4NQW B;  5FRO A;  2XGE A;  5JR3 A;  2PEX A;  2XC7 A;  5JVT A;  3F3X A;  2RC4 A;  4ZYD A;  3EUH C;  1IG7 A;  4RLF A;  3RDI A;  1XPX A;  3E3V A;  1HBX G;  4N4O B;  4IQ4 A;  3L00 A;  4XRM A;  3CLQ A;  3P9I A;  5E8G A;  3WTW C;  3HOU J;  2LY9 A;  3GZ6 A;  2R7O A;  2JZY A;  2Z2S B;  1J5Y A;  2EFO A;  1D1B A;  2R7F A;  2M5W A;  2VBW A;  2AQF A;  2K85 A;  2LY2 A;  3LSR A;  1B6A A;  5EEG A;  1ZGW A;  4XID A;  2XGX A;  2STT A;  2Z99 A;  2IBD A;  3B6A A;  3I9V 2;  2ELK A;  2BY2 A;  3PJR A;  2XB0 X;  4IKF A;  4CUG A;  5IYD J;  1W7P D;  2MAB A;  4ZZD A;  1TL8 A;  2ME6 A;  4LFU A;  4BXU A;  2EA2 A;  1MBE A;  4IO9 F;  2HVQ A;  1PJR A;  3UR3 C;  2VI6 A;  4BAC A;  2LRE A;  2PMU A;  4P5O A;  4BHB A;  1BN5 A;  2ZCW A;  4UVB A;  3A2K A;  1KYW A;  1RRJ A;  4RM2 A;  1UHS A;  3HOW J;  4L9V A;  2DJI A;  3NRV A;  2LTP A;  2OAZ A;  2WY8 Q;  5IT9 Z;  5KVR A;  4PGG A;  1ETO A;  2Y0S A;  5EEH A;  4A0Y A;  1VTN C;  3MMY B;  5LEK A;  5LGT A;  3J7Z I;  2XAF A;  2DOF A;  4YIR X;  1G8X A;  5ICC A;  3GZ5 A;  4FET A;  5M5Y J;  9ANT A;  3IKT A;  1S6L A;  1QVU A;  1R5G A;  5BQT A;  1UFM A;  3E1S A;  4RDU A;  2NVT J;  4BNC A;  3VOE A;  3VOD A;  1R58 A;  1UHM A;  3Q9V A;  1OYY A;  1Z0X A;  4KN4 X;  4RB1 A;  1KYZ A;  1YRN B;  2CG4 A;  2XGC A;  2R7S A;  1FTZ A;  4CSW A;  4CCJ A;  2KFD A;  1T39 A;  1KZH A;  3CUQ C;  2ZBK A;  2RKH A;  3HDD A;  3ZP5 A;  5HLT A;  1X3Z B;  4ENK A;  3F8N A;  3NAU A;  1LUJ B;  3BR6 A;  3QOD A;  3BQY A;  1R9T J;  2UXN A;  2MD0 A;  4M73 A;  1O4X A;  1MJB A;  4EQQ A;  3CJR B;  4PJJ A;  1E2X A;  1W7P A;  3H5A A;  2A6H F;  4ON0 A;  3L2W A;  5DD8 A;  1TP4 A;  1IJW C;  1I3Q J;  3RIR A;  5KK1 A;  5EJC A;  1LEA A;  3OYB A;  3FX3 A;  3VWB A;  2MBF A;  4GO1 A;  1P7I A;  2HVR A;  1GXP A;  1ETY A;  3OYA A;  2ZXJ A;  2R7U A;  3QRF F;  3BG6 A;  4P1W A;  2HZT A;  2IRF G;  5D5U B;  2YX4 A;  1BC8 C;  3W6V A;  4HPQ A;  2PMZ N;  3FXM A;  3KP3 A;  2O61 A;  1WH5 A;  2BYV E;  2HWV A;  2P81 A;  2QCO A;  3R6S A;  3MKW B;  2D2W A;  2Q1Z B;  3L2R A;  2QEN A;  2VKE A;  4HV6 A;  3AL0 C;  1I27 A;  1YLF A;  4XIC A;  3HTS B;  2IXS A;  5ILS A;  2M87 A;  1LE8 A;  4BAY A;  3U1D A;  2XAH A;  5FFZ A;  1IXC A;  3KP2 A;  3ZGK A;  2PMH A;  3J7A O;  3E6B A;  1IW7 F;  4HG2 A;  2VJ4 A;  3WOD F;  5M3M J;  2VOP A;  1R7J A;  3ZMV A;  3OYI A;  4LIV A;  3C2H A;  2IW5 A;  4LIU A;  4CZZ A;  1R00 A;  2R7Z J;  2CQQ A;  1U9N A;  2A61 A;  3VYS B;  3WG7 H;  3ELK A;  5FKK A;  5LHH A;  4EVI A;  5EG0 A;  2RRE A;  5TIS C;  1RR8 C;  2NVY J;  1MJA A;  4MFE A;  3V7C A;  5DM6 F;  2PG4 A;  4K2E A;  5K5R A;  2W4S A;  3OYJ A;  4TV7 A;  2IAI A;  2N8G A;  3MQ0 A;  3RKQ A;  3ZQF A;  4AVP A;  2FNP A;  3TDZ C;  4XLP F;  4RMN A;  2E1O A;  2JPC A;  3DWL E;  3DU6 A;  1R4N B;  1XGM A;  3VYR B;  3JRI A;  1VQL I;  4HOB A;  2DTR A;  1KU3 A;  1WCM J;  4RGS A;  2RGV A;  4QWQ A;  2HU9 A;  4KYW A;  2XB5 A;  1MH3 A;  1X19 A;  3CUO A;  3JSP A;  3TO7 A;  3HSR A;  4IRH A;  4OU0 A;  5EGO B;  1P9Q C;  2JA5 J;  2HI3 A;  4AC0 A;  3L09 A;  3C2G A;  5IP6 A;  2WWY A;  2IP2 A;  1R1V A;  2OJE D;  2EPF A;  2PMZ A;  4KNY A;  4OMY A;  2F2E A;  4LD5 A;  2V1X A;  5FLX Z;  1TQI A;  4N9I A;  4UVA A;  1FOX A;  1XX5 A;  2OZ6 A;  2HGC A;  3O8G A;  3KLN A;  4XLA A;  2VKH A;  2W24 A;  5K7Z A;  1DGW Y;  1SMY F;  1T33 A;  2QSG X;  1TWC J;  3ASO H;  3MEX A;  3S14 J;  5DV5 A;  1ON2 A;  5CKT A;  3F9K A;  1TC3 C;  3DQV C;  5BPD A;  3S1Q J;  4B43 A;  1BBY A;  5H20 A;  5H6R A;  5IOY A;  2KQR A;  1BI2 A;  4ENM A;  3RZD J;  4B3A A;  5E79 C;  2OBP A;  4CZC A;  1SD6 A;  5BOX A;  1ETV A;  3DXJ F;  1JKP C;  3QPH A;  3FK7 A;  4HX8 A;  2CV0 A;  2BE5 F;  2QKM B;  1H9G A;  4DBR A;  2IA1 A;  4XKV A;  5GAE J;  2M7A A;  3DBL B;  3BG3 A;  3F22 A;  1KU2 A;  2FMY A;  2QUF A;  3MKY B;  1FYM A;  4IL6 C;  2LRD A;  2QWW A;  1G3T A;  3C3W A;  3ERE D;  2OV7 A;  3LFU A;  2A5W A;  5ILU A;  2OQR A;  3QYF A;  2CQX A;  2C6Y A;  3T8T A;  1WJA A;  5TJJ A;  4E7I A;  1V4R A;  4PJN A;  3COA C;  1RUO A;  4IHS A;  2CWE A;  2ME0 A;  3WGG A;  2XUB A;  2HXI A;  2EFN A;  4MQ9 F;  1M1E B;  1J9I A;  3WTX C;  5LGU A;  1Z1D A;  4V2F A;  4BBS J;  4A6D A;  2WC2 A;  1EH8 A;  2XVC A;  1WH7 A;  2R0Q C;  4U7D A;  3IH2 A;  4RS8 A;  3KEO A;  1T8I A;  5LHG A;  4CGZ A;  2AHQ A;  3CDI A;  3GFJ A;  3ZQG A;  4HRI A;  4DNC A;  4NBQ A;  2R7X A;  2EK5 A;  4O3M A;  1RZ4 A;  4E4H A;  4NQW A;  3GW2 A;  1JXS A;  1YG2 A;  4N0B A;  5BS6 A;  2PLY A;  2K7L A;  1APL C;  4CCN A;  3HRS A;  3F0C A;  1RIO H;  2KIQ A;  3TKY A;  1WQ2 A;  3F23 A;  2HR3 A;  1O3Q A;  4IRI A;  2MSY A;  3IH3 A;  5FLM J;  2LOO A;  2P6S A;  3F8C A;  2EFP A;  4E70 A;  4JBA A;  4DQ2 A;  1FEX A;  2W84 A;  3OYH A;  1QHG A;  3S8P A;  2ZC2 A;  3HC7 A;  4KT5 C;  5AIP A;  2CQK A;  2K5C A;  2LP0 A;  1TWA J;  1UB9 A;  2IS6 A;  5DCF A;  1QZY A;  1MH4 A;  3U21 A;  5IP9 J;  2BZT A;  1F36 A;  2K9Q A;  4Z6Y A;  4DYR A;  3SFZ A;  5EF6 A;  3EUK L;  3MWM A;  5FKM A;  5H6Q A;  3CQZ J;  3H92 A;  1YE9 A;  1P4X A;  2BBY A;  4X1E A;  1N78 A;  4M74 A;  2FBH A;  2OTJ I;  3G1L A;  3V7R A;  1FLI A;  3LWF A;  2DCE A;  2GA1 A;  2GA2 A;  1RET A;  2CO5 A;  1XMK A;  1ZN2 A;  2XAS A;  2DLL A;  5JHU A;  2F5F A;  5DDG A;  4BQA A;  3AG3 H;  3TP3 A;  4CYD A;  2CRG A;  1AOY A;  3IWF A;  2HFH A;  3HBL A;  1K7A A;  2M0C A;  3MZY A;  3TBI A;  3HOT A;  4M9X A;  3AG1 H;  4MO7 A;  5LFA A;  2FXA A;  1QVT A;  5HS7 A;  5JHF A;  3CCQ I;  4J01 A;  2HOS A;  2LYC A;  1EF4 A;  3BC8 A;  1LVA A;  1XSX A;  1YRN A;  1Z7L A;  1ETQ A;  3JRC A;  3F6V A;  4B4C A;  3MKZ A;  3RPQ A;  3CCV I;  3OMY A;  1BR1 A;  4IOA F;  2WAD A;  3N05 A;  3BTC A;  1D8J A;  2G7H A;  2RNG A;  2EIN H;  1FZP B;  1D3Y A;  2DMU A;  3BY6 A;  4I76 A;  3B6C A;  1JJ8 C;  1R36 A;  4HYE A;  2KDZ A;  3WGI A;  1TWH J;  2IGN A;  1YTY A;  1BC7 C;  2EIJ H;  4GXO A;  2XRO A;  2E1M B;  2AS5 F;  3CC2 I;  1Y0N A;  1IRF A;  2LR8 A;  2TRT A;  1HSJ A;  1C0W A;  3BJ6 A;  1QO0 D;  4EGY A;  3CUQ B;  4QSH A;  2DT7 B;  4FCY A;  3BRO A;  3GLL A;  2NOG A;  2EIL H;  1FBU A;  1ODD A;  1ON1 A;  3RKY A;  4AID A;  2FOK A;  3GTJ J;  1JT0 A;  2X6W A;  4LG0 B;  2E34 A;  4YG2 F;  1U0J A;  1SC7 A;  1FBQ A;  1TW2 A;  1IXS B;  4M3E A;  3WTZ A;  3VDX A;  3JAM K;  1ZAR A;  4CCO A;  4LOC A;  3TQN A;  5JFR A;  5B1A H;  1JKR C;  4NUB A;  2Y31 A;  2QQB A;  1V3F A;  1F9N A;  2R7T A;  1S9H A;  2IS4 A;  2XAJ A;  1A6I A;  4M6Y A;  5JVG F;  4EGZ A;  3RTR A;  4E7L A;  2XPW A;  2RQQ A;  5IT3 A;  3BCB A;  3AL0 B;  1OCZ H;  3FM5 A;  3OYD A;  2KLO A;  4UUS B;  1MSE C;  2E60 A;  2JWT A;  1I6H J;  2XAG A;  3BTJ A;  2QA4 I;  1OCC H;  3DFG A;  4U7B A;  3CMA I;  2VUM J;  4AIH A;  1HF0 A;  3R4K A;  1P4W A;  3E6M A;  3DKX A;  2FQ4 A;  1O57 A;  2PQ8 A;  3ABU A;  1IDZ A;  3K2A A;  5ICE A;  2EZK A;  5EGO A;  3R61 A;  4MGR A;  3CCJ I;  1E0E A;  1S5L C;  5F0F A;  3KCC A;  3M9A A;  1LFP A;  2LNB A;  1YW7 A;  1TLH B;  1IUF A;  2VQL A;  1AU7 A;  4PDK A;  2VJ5 A;  1IDY A;  1XGN A;  2QQ9 A;  5CVJ A;  1A31 A;  2DPU A;  4IX7 A;  5AON A;  1HXD A;  4BUP A;  1MND A;  2P5L C;  3I53 A;  1JKO C;  1FSE A;  2HZD A;  1QRY A;  1EKE A;  3A1Y A;  1TW3 A;  2IGO A;  1F5T A;  4FX0 A;  1IZ1 A;  1Y56 A;  3LOC A;  1J59 A;  3CC4 I;  4XQF A;  2GOM A;  1QBJ A;  1HW5 A;  4JYK A;  1VQP I;  1BW6 A;  2YS9 A;  3CP2 A;  3KYC B;  3CCM I;  2L9N A;  1HKT A;  1VND A;  2GXB A;  2CUF A;  3MZH A;  2R7Q A;  4L5E A;  2CW8 A;  2NNY A;  4Z2Y A;  3CDH A;  1ETW A;  3JRG A;  2G0E A;  1V5F A;  2VT3 A;  1J09 A;  5FFX A;  3GFI A;  5K7H A;  3A4C A;  1K4T A;  3AKZ A;  1MD0 A;  1WVR A;  2A05 A;  3PFI A;  4HQM A;  1D0X A;  5F1R A;  2NRA C;  3HL2 A;  5F04 A;  1LFB A;  1X1D A;  5GAH J;  2EZH A;  5J40 A;  1Y8R B;  3DTI A;  3KYD B;  5F6F A;  4F55 A;  1QA6 A;  5HDG A;  3CCS I;  4KIG A;  2NVU B;  4HST A;  4RBO A;  3E0J B;  1ORK A;  4IOC F;  1ACI A;  3JR9 A;  2B7E A;  3GXO A;  2DK5 A;  4RAF A;  2P5K A;  3L2Q A;  4PUS A;  2LD5 A;  1R1U A;  4PFP A;  5HLH A;  2FA5 A;  3LSK A;  3LSG A;  5HNF A;  2L7Z A;  4IHW A;  2MLK A;  4EMS A;  1ZYR F;  4UXN A;  1XC5 A;  2V9V A;  3HSE A;  5HOD A;  2YU3 A;  4JQF A;  2O0Y A;  3LSP A;  4QPO A;  2TDX A;  3ZMD A;  1ZK8 A;  3UKG A;  3KEQ A;  5EZG A;  3V8J A;  2GM4 A;  4Q48 A;  1U6G A;  2DT6 A;  2M8E A;  4FQG A;  4CIC A;  3I4P A;  3V4G A;  2FD5 A;  1OJL A;  3ZOB A;  3ML6 A;  3J81 K;  1FTT A;  1FWZ A;  2OF7 A;  3LSI A;  1XDU A;  2VN2 A;  1TNT A;  5HDK A;  1BJZ A;  4BQN A;  2DOA A;  3IRR A;  2EV6 A;  1AKH B;  1WGX A;  5L3E A;  5FO5 A;  2JQ7 A;  3JTG A;  3H9Q A;  2AXT C;  4B44 A;  4E7H A;  2DJN A;  4BYY A;  3CTA A;  1Q1V A;  2OUM A;  1TQM A;  2ESN A;  1W5S A;  5DM7 F;  1F43 A;  1D8K A;  1FY7 A;  3CJT B;  2CUE A;  4F7Z A;  4ASN A;  5L3C A;  1DQU A;  3PNT A;  2OCE A;  3IAM 2;  3ULQ B;  4L0Z B;  2AO9 A;  3S2H J;  3I71 A;  1NTC A;  1N77 A;  1U9O A;  4XN0 A;  1JTY A;  4CXF A;  1OPC A;  3KP7 A;  1JGG A;  1HW2 A;  4IQJ A;  5FD5 A;  5DYM A;  3J7A Y;  2FML A;  3PL8 A;  3TP0 A;  3I58 A;  2KIM A;  2D45 A;  1VZ0 A;  1T2K A;  2BGC A;  1MMG A;  2KRC A;  2V1D A;  5GPA A;  1HKS A;  2BV6 A;  4L9N A;  2M1B A;  3I54 A;  2IVM A;  4ESF A;  4ESB A;  3EQL F;  2CQN A;  2F5E A;  1ZAO A;  3GLX A;  2EJR A;  4B48 A;  3G73 A;  1XB4 A;  1I50 J;  2DO7 A;  2ZNZ A;  3K4M A;  1GUU A;  2HOE A;  2CSO A;  2LG4 A;  4YFX F;  3CO7 C;  1MNM C;  3S3O A;  2E35 A;  2IS1 A;  4A12 A;  3EYI A;  2VOO A;  1XN7 A;  2KRF A;  1DDN A;  4L5J A;  4G7Z F;  1HDP A;  2JA6 J;  2RAE A;  5KAI C;  1GLN A;  5FLV A;  3GEZ A;  4IXA A;  1S7O A;  4LLG F;  2WAQ A;  3NEU A;  4RGU A;  2VON A;  3KP5 A;  5GTH C;  4XLC A;  2Y48 A;  2E7X A;  1T38 A;  3BQZ A;  3G71 I;  4AIK A;  3S1N J;  1YIT I;  1OR7 A;  2XF7 A;  2XKP A;  4XK4 A;  6PAX A;  3CUQ A;  2MGQ A;  5FD6 A;  3DEW A;  2ZJQ F;  1BA5 A;  3PIP F;  4LK1 F;  2PJR B;  2DFI A;  5EYR A;  5FB2 A;  2V26 A;  5BNG A;  4IHT A;  2J5O A;  4U87 A;  2ZFW A;  4ZH4 F;  3CZ6 A;  4LG0 A;  3FXQ A;  3M8E A;  1SFK A;  1T08 B;  1Z3X A;  5CQE A;  4BEH B;  3FXR A;  4NC7 A;  3CJQ B;  3O6B B;  5CVR A;  1RUN A;  1X1P A;  2VE8 A;  4UVC A;  2WV1 A;  2A07 F;  2UUZ A;  2H1L A;  5IY5 H;  2QLZ A;  4DYQ A;  1SD7 A;  3G4S I;  4HAM A;  3L7W A;  3LSH A;  2E2I J;  1S7E A;  2BEO A;  4I7H A;  3S1M J;  1SVL A;  3E97 A;  2JA7 J;  5J1R A;  4PK4 A;  5F27 A;  1BW5 A;  4UUS A;  1MMN A;  3FM3 A;  4RA2 A;  1HLV A;  4EM1 A;  2M30 A;  3N4M A;  2WB1 N;  3NQO A;  2VB6 A;  5B5E C;  3M7G A;  1J2X A;  4PSW A;  3AG2 H;  3F21 A;  5GAD J;  3HOV J;  2L02 A;  5B1B H;  1XCV A;  4BDY A;  1BI1 A;  3E7L A;  4YRV A;  4IHV A;  4BE0 A;  2MH9 A;  1I1G A;  2COB A;  5L3G A;  1FYL A;  2A3S A;  4D7N A;  5C3E J;  1MMS A;  1N75 A;  3HG9 A;  3I59 B;  1T0F A;  3DPU A;  3TED A;  1I1S A;  1T98 A;  2R4G A;  2NOJ B;  3SZG A;  1U78 A;  4YFK F;  2E1M C;  4U0V A;  2DA1 A;  4PCQ A;  2IEK A;  4JOM A;  2DFE A;  3U1K A;  1NK2 P;  5L3B A;  2L7K A;  2WV0 A;  3BTL A;  3ZMS A;  2NAZ A;  3WHB A;  1G2H A;  1FP2 A;  1OR7 C;  2M3A A;  2V6E A;  1MW7 A;  1SAN A;  3CJN A;  3OYG A;  4CCL A;  2BY3 A;  5E3L A;  4MEY F;  1PDN C;  4AU7 A;  3BZK A;  3RYP A;  2HPM A;  3K1P A;  1FIP A;  4KA4 A;  1IXR C;  1JHF A;  1KQ0 A;  1BL0 A;  1WKM A;  2LFB A;  2K9M A;  3KIO A;  5CVV A;  2H1K A;  1KU9 A;  2ESH A;  5E3M A;  1IN4 A;  2CW7 A;  1XCB A;  2JPB A;  2KIS A;  1G3Y A;  3OYE A;  3F8F A;  2EFQ A;  1Y1V J;  4UB6 C;  1UCR A;  4NDL A;  4A3B J;  3OIP A;  2LKX A;  1G6N A;  3GZN B;  3JRB A;  1SEU A;  4G94 A;  2LKS A;  1IGN A;  3T5X A;  3BR1 A;  4CCM A;  4AVZ A;  3FHZ A;  4MEX F;  2LDU A;  1RNL A;  1IO2 A;  2F4O B;  2G7U A;  3S16 J;  4YEL A;  4XLF A;  5FGM A;  3ZQL A;  3DU5 A;  4A0X A;  1VI0 A;  2NS8 A;  4GFB A;  1B72 B;  4XM3 A;  1Z91 A;  2PJP A;  1HOM A;  1BI3 A;  5E20 A;  2KIU A;  2WAE A;  3HHG A;  4R8H A;  4XKC A;  1SAX A;  2VL8 A;  4FHT A;  1RKW A;  2L3D A;  3SHF A;  2STW A;  1W1W E;  3LA7 A;  4UUT A;  4KJZ A;  4U0W A;  5AIQ A;  1UST A;  2E7W A;  1D5Y A;  4RB0 A;  1T0F C;  3OL3 A;  1J75 A;  2ECB A;  5J4V A;  4OOI A;  2Z5U A;  3BT9 A;  3P9C A;  4A3K J;  2OTL I;  2DQL A;  3HKZ N;  1IN5 A;  3H35 A;  2EFW A;  2WY7 Q;  3LQQ A;  3PQK A;  2DA5 A;  2K86 A;  3VSK A;  1XMA A;  4XOT A;  5CLS A;  4KMF A;  3WTS C;  2CS3 A;  3QOP A;  3W6J B;  3REO A;  5CQG A;  3SYT A;  3W2W A;  1Z67 A;  3RCO A;  2QSH X;  3NAR A;  5D4R A;  2K3P A;  1A5J A;  3BR2 A;  3PNV A;  5EDN A;  1HA8 A;  3K6G A;  1Y39 A;  3DF8 A;  1OYW A;  2CGP A;  1Y0U A;  1AKH A;  5FKN A;  4FIS A;  3SZT A;  2L9S A;  3MD2 A;  2K3F A;  1BM9 A;  4NB5 A;  2X1C A;  3JAM Z;  4E6K G;  3K1N A;  2P5V A;  1TT5 B;  3KP4 A;  4UY8 I;  1T6S A;  5F0H A;  1RPW A;  3KEY A;  1MBH A;  2NNN A;  2P6T A;  1BOB A;  1T95 A;  4A0Z A;  2LLK A;  4AIJ A;  4BDZ A;  1W0U A;  1O3T A;  4LB5 A;  4EM0 B;  2HTS A;  4D1Q A;  1X58 A;  5D5W B;  3BG7 A;  2CW0 F;  2JMW A;  3BJO A;  3HGY A;  3HM5 A;  1CF7 B;  3ROU A;  3I3L A;  2FJ1 A;  1R22 A;  3C1D A;  2D1H A;  1FIA A;  2JUG A;  1GVD A;  2E1C A;  3I4N J;  1X4O A;  1SAU A;  5L3D A;  4G12 A;  1D1C A;  3RZO J;  2O03 A;  3HKZ A;  1UG2 A;  3ABM H;  5LEJ A;  4LMY A;  3HJE A;  4XRF A;  1ZRD A;  2XHK A;  3NWT A;  3ASN H;  3WTV C;  3OYN A;  3ZN0 A;  5DD4 A;  5D5X B;  5J4Y A;  3WE3 A;  1TWF J;  4FTH A;  4KIT B;  1LDD A;  3N97 A;  5E8I A;  1MGT A;  3GTG J;  3LSM A;  1G3W A;  3DBR B;  4HLY A;  4IHY A;  4KIF A;  2A69 F;  1VQN I;  1JI8 A;  3OWT A;  3SEZ A;  3Q0W A;  4A3J J;  2VKD A;  1Z05 A;  3CCL I;  1SVM A;  1UZC A;  3RQ4 A;  5E1W A;  1Y8Q B;  3S17 J;  2KP6 A;  2BW3 B;  4EJT A;  1TT0 A;  3Q5F A;  4KIS A;  2HVS A;  4A5M A;  1NG6 A;  1K4S A;  2F6C A;  3BZC A;  2F5C A;  1DU6 A;  2PJR A;  1MBF A;  3RJP A;  2R7W A;  4F52 A;  3CO6 C;  3F72 A;  2VBY A;  3D0S A;  2JRM A;  3FXO A;  3PSI A;  3G3Z A;  1P4A A;  1LNW A;  3CMY A;  5E1Z B;  3IUO A;  2CFX A;  2H6C A;  2L54 A;  1B1B A;  2L9R A;  4O5V A;  5ED4 A;  3GFM A;  1ETK A;  4BEH A;  3FMS A;  2BXY A;  4Y3O A;  2EA4 A;  3GUD A;  3W3C A;  5CPR B;  4C3H J;  3BPV A;  2GIV A;  1LDK B;  1S29 A;  3M8J A;  2R93 J;  1ZHF A;  4A3I J;  3H3U A;  3HPG A;  1IV6 A;  3S32 A;  1IRZ A;  3SDG A;  3J7Y J;  3EET A;  3KZI C;  2MH2 A;  2HPI A;  2RNJ A;  2ZXI A;  3A0B C;  3H0G J;  4UNO A;  1FSH A;  4P9F A;  1FYK A;  3M4O J;  1QPI A;  1BR2 A;  1KQ9 A;  3VSL A;  4AUX A;  3JCU C;  1BR4 A;  2R3S A;  1L3L A;  4U0Y A;  3QU3 A;  1DP3 A;  3O3K A;  4A69 C;  3D5S C;  3FWE A;  3I5U A;  3K10 A;  3PUF A;  3KPH A;  5HNH A;  2FBK A;  3DPL C;  4EEF G;  4G7O F;  2ZO4 A;  1YQA A;  1ZTR A;  2FX0 A;  1REP C;  3GBG A;  3ZMT A;  3O2P E;  1OQY A;  4NNJ A;  2M45 A;  3GWZ A;  3I59 A;  3EPZ A;  2NVQ J;  3HYI A;  1SFE A;  2X0L A;  4M3B A;  4YEJ A;  5M5X J;  1GV2 A;  2Y75 A;  3HZJ A;  4PZJ A;  4ZYA A;  4AD9 A;  2Q2E B;  1HC8 A;  2K9L A;  3SQN A;  1MMA A;  2YUS A;  2H6B A;  4GCV A;  4JK1 X;  2LF7 A;  1V5E A;  3J81 Z;  1OKR A;  1WJ5 A;  1CGP A;  1WHU A;  2IJL A;  4MIM A;  4RB3 C;  2DW4 A;  2LMD A;  3IL2 A;  1S72 I;  1GDT A;  3JRD A;  3RKX A;  5DUI A;  4KDP A;  4C2T A;  1R4M B;  4WF2 A;  4XSX F;  1ZKG A;  5IYC J;  2L0K A;  2A6E F;  3BOQ A;  4WCG A;  1YJW I;  3CF5 F;  2ZNY A;  2XPV A;  2GZW A;  5F08 A;  1B8I B;  4P55 A;  1YOV B;  4YIF A;  3A01 B;  4OIO F;  3S2D J;  5B66 C;  2ZME B;  2E36 A;  1VQO I;  2DA2 A;  4M6X A;  4HQE A;  1B72 A;  2XAQ A;  3KE2 A;  4N4N B;  4E7S A;  3UNG C;  5KNL A;  3JSO A;  2EBI A;  5J47 A;  4BJ5 C;  2ZJP F;  1XDS A;  5K5Q A;  4XL9 A;  2KZV A;  2HQN A;  2WTE A;  4WXC A;  3JW4 A;  4BHC A;  3KYL A;  1WPK A;  1F4K A;  3S15 J;  1WJE A;  2CUZ A;  2JA2 A;  4IPA A;  5HLI A;  5D4S A;  2EZL A;  1LPQ A;  2GXA A;  3QPS A;  1H8A C;  1LVK A;  3K0L A;  4OAY A;  4WWC A;  4LJZ F;  3L2U A;  4ZYH A;  1XGS A;  1O3S A;  4ITV A;  1FMW A;  1S7A A;  3PIO F;  4HSR A;  1R71 A;  3H9J A;  1DP7 P;  1QU3 A;  1QHH D;  4HEA 2;  4QLC U;  1W5T A;  2GWR A;  2ZXW H;  2VIX A;  4BL0 B;  3QQA A;  1QPM A;  5B3S H;  3S93 A;  5K7F A;  1YS7 A;  2HQR A;  1PYV A;  1MDM B;  1VQ6 I;  2R5Z A;  1FNN A;  3E6C C;  2GIZ A;  2Z16 A;  3TOA A;  4KIB A;  2IGK A;  1OIS A;  3ABT A;  3FHN A;  4UHT A;  3FKI J;  2VXZ A;  3SZP A;  2M8G X;  1U3E M;  3CD6 I;  2DTZ A;  3SJM A;  2YPR A;  2NVX J;  3HHH A;  3TMO A;  1Y1W J;  2CU7 A;  3E5Q A;  3H1C A;  2HYJ A;  1DPR A;  4NC8 A;  1JUS A;  2L5Q A;  1MBG A;  4MTD A;  4P96 A;  5GPC A;  5HS9 A;  1DU0 A;  5K1Y A;  2QBY B;  5D8L B;  4HF0 A;  4G6T B;  4XOP A;  2MW8 A;  5TRD A;  1O7L A;  3U9G A;  3ZMU A;  4B1R A;  4A3C J;  1B4A A;  2DFH A;  2VT2 A;  2KL4 A;  5HLG A;  1CF7 A;  3A0H C;  2F4M B;  2O8X A;  4EJU A;  2PFB A;  1OLT A;  5TGT A;  2R5Y B;  1VF9 A;  2VAS A;  1OFC X;  4CCK A;  3HIF A;  3IHU A;  3BTI A;  1ZRC A;  5J3L A;  4IF4 A;  4XN3 A;  4CH7 A;  4HV5 A;  4S04 A;  1WSU A;  2Y0M A;  3QP6 A;  4HF2 A;  4Q47 A;  3A03 A;  3H0D A;  3PO2 J;  1QZZ A;  4R79 A;  1LQ1 A;  4BU2 A;  4ETS A;  4Y33 A;  4CA0 A;  2M7B A;  2PX9 A;  3RQI A;  5L3F A;  1G4D A;  3JRE A;  3HEF A;  4KMU X;  2JT1 A;  2KKO A;  3V8K A;  3OYF A;  2KDO A;  3DTK A;  2ACJ A;  1PUF B;  3AG4 H;  2CV2 A;  3QOE A;  4PJ0 C;  3K1M A;  1I39 A;  3G6E I;  2IT0 A;  1F1Z A;  2FUG 2;  1VQM I;  3O8H A;  3DEE A;  4IEJ A;  3HOZ J;  1HKQ A;  2LKP A;  4I0B A;  2XSJ C;  5CYV A;  1RI7 A;  1YYV A;  5J1U A;  3F8M A;  2ZFU A;  2BW3 A;  4XSZ F;  2W25 A;  2DMQ A;  2O8K A;  2LF8 A;  2Y69 H;  2UZK A;  2VLA A;  2K9N A;  2DA7 A;  4PJM A;  1OCP A;  3I4M J;  2X51 A;  3PQJ A;  3QPT A;  2FRH A;  1IV8 A;  3GFL A;  2E5Z A;  4BQQ A;  2QKL B;  3LA3 A;  3OR1 C;  4V2G A;  2VE9 A;  3ZXS A;  2DMP A;  1O3R A;  3FMR A;  3JRH A;  3MKL A;  1U5T B;  3ECO A;  3FK6 A;  4HX7 A;  2B63 J;  2HTJ A;  4KT6 A;  1FX7 A;  1FOK A;  1USS A;  2K02 A;  1V5G A;  1GXQ A;  3KZY A;  5E18 F;  2DMN A;  2ID6 A;  2V4J C;  4M71 A;  2YU9 J;  1GVJ A;  4CHU A;  1U2W A;  3CC7 I;  5M5W J;  1IUY A;  1UHW A;  4IVN A;  3GTO J;  2EWN A;  1H88 C;  1WI3 A;  2EV0 A;  2ZKZ A;  4GGG A;  4H0E A;  3V42 A;  4EJV A;  2DN0 A;  3PNY A;  4A2U A;  2A6T A;  3DCF A;  2M4K A;  2XSD C;  3H3V K;  3L2V A;  2HDD A;  4XMY A;  4KN7 X;  4WXD A;  2JUC A;  3ISP A;  4MQV A;  1SD5 A;  2R7R A;  5J1Y A;  3CDL A;  2JVG A;  3EDP A;  4J00 A;  1X2M A;  1JE8 A;  3H5N A;  3FXU A;  3KET A;  4A3E J;  4OAZ A;  3MAJ A;  1K6Y A;  1Z7U A;  3TDU C;  1YFH A;  1XSV A;  1Z6R A;  4E7Z A;  4Y15 A;  2F5D A;  4ZZL A;  2Q2E A;  3FMQ A;  2BOL A;  3LFK A;  3VFZ A;  3K70 D;  4A5N A;  1J0R A;  3SXY A;  2BHY A;  3BZ6 A;  1TBX A;  1TWG J;  1BIB A;  2XAU A;  3OR2 C;  1H0M A;  1I5Z A;  3VYU B;  1HST A;  1L0O C;  2L4A A;  4KFC A;  1P92 A;  4IHX A;  3V8L A;  1WI9 A;  2I8D A;  4MFD A;  2Q8K A;  1E3H A;  2ID3 A;  4GRI A;  2EIM H;  3OSF A;  1Z6T A;  2WBM A;  3BG9 A;  1IN8 A;  2CJJ A;  1P7J A;  2V79 A;  2ECC A;  3DLA A;  1Y6I A;  3OSG A;  3OYK A;  2IA0 A;  1B8I A;  2MG4 A;  2X48 A;  4BQO A;  4MLO A;  3BLY A;  3A01 A;  4N9H A;  5K5O A;  2VQH A;  3E5U A;  2DA6 A;  2ZME A;  1YX3 A;  4JP0 A;  4BY1 J;  3OY9 A;  3GO5 A;  2JA8 J;  2OCC H;  4FAS D;  2HYF A;  2HQA A;  3Q9S A;  5DS9 A;  5ICG A;  2RVC A;  4KUM A;  1ZR4 A;  3H5R A;  2MD5 A;  2DK8 A;  2GOX B;  5FJ8 J;  2JTV A;  3ZQ7 A;  4HW0 A;  3CCE I;  1X3W B;  4AM3 A;  3DV8 A;  2Y0S N;  2WA0 A;  3RYR A;  2OD5 A;  2JN6 A;  2E2J J;  1XMX A;  3MVP A;  3QYB A;  4DOZ A;  4B8X A;  4D5F A;  3WTU C;  4HNU A;  3LSJ A;  3ZQC A;  4BS9 A;  3C7J A;  4I98 B;  2VBZ A;  4BY7 J;  5A2Q K;  1RKT A;  5ERI A;  1VQ5 I;  4LIT A;  2MYS A;  2OC6 A;  2E2H J;  1GHC A;  2W7N A;  3HGG A;  4B47 A;  4DBQ A;  3SFI A;  4HBL A;  3A02 A;  4BHP A;  4ZYE A;  1MDM A;  4JX4 A;  1R1T A;  1FP1 D;  1PP8 F;  4BJT A;  2DOD A;  2OU2 A;  1YJ9 I;  1D5V A;  4II2 A;  1K6O A;  4I09 A;  4DJA A;  3HOX J;  3Q3S A;  2W48 A;  1YW8 A;  3TO6 A;  2F48 A;  3D5L A;  2HQ5 A;  3ONQ A;  4W1U A;  1ZRF A;  1E3O C;  2UWM A;  2QSF X;  1K61 A;  2FEZ A;  4V19 K;  2DMT A;  2VPR A;  2XKO A;  2XRN A;  4ZDL A;  1YO5 C;  1NH3 A;  3ZPL A;  2K9S A;  5LRS A;  3R0J A;  2GXG A;  1UMQ A;  1MBJ A;  1YX5 A;  3ABK H;  3TO9 A;  2AXL A;  5J8C A;  2QBY A;  3VB2 A;  3OYM A;  1PP7 U;  1KGS A;  3HB9 A;  4XLH A;  1WJD A;  3R60 A;  1YIO A;  2X1D A;  3LA2 A;  1STZ A;  4F91 B;  1O7F A;  2KZG A;  5LLQ A;  4S0H B;  1Z77 A;  4H4K C;  4LLL A;  1CQT A;  2ZME C;  1G3S A;  3FZV A;  3LQR A;  4DYC A;  2R5Y A;  1VQ7 I;  5IOZ A;  4XKB A;  4QPQ A;  3OYL A;  3C2B A;  1S8N A;  1WJF A;  1MJ9 A;  3PM1 A;  2EQR A;  1NG7 A;  3M1C A;  2WB1 A;  3K70 C;  1ZGA A;  4IJA A;  2FU4 A;  1UAA A;  2QVO A;  1T56 A;  2V1U A;  1Q1H A;  3Q0V A;  2BY1 A;  5KCM A;  1ZG3 A;  3QU6 A;  2LY1 A;  4CYC A;  5LRR A;  1FOY A;  1PUF A;  4ESJ A;  5DTD A;  3CMM A;  2FBI A;  3TL4 X;  3W2A A;  2H94 A;  4W97 A;  2GAU A;  3TGN A;  2CQ7 A;  2P8T A;  2UV1 A;  4ANJ A;  5GTI C;  5IPA A;  4BXF A;  2O9L A;  3JTH A;  4LGW A;  3JRF A;  1XSD A;  2G9W A;  3I56 I;  1W36 D;  2PBI A;  4DIQ A;  2GLO A;  5KHD A;  3DBH B;  5M3F J;  1XS9 A;  4RAZ A;  3IRQ A;  5DCM B;  4D9J A;  4A3M J;  1VQK I;  2CYY A;  1WFX A;  2GQQ A;  1Z21 A;  2D1V A;  3H36 A;  3HSF A;  1BJA A;  2M4G A;  2A5Y B;  3CLO A;  3FXJ A;  3ZN1 A;  1H9T A;  2NYX A;  2KJC A;  4NHJ A;  2HOA A;  4EJO A;  5C44 J;  3K4J A;  2L7F P;  2QQA A;  1WWX A;  3CCY A;  4A3L J;  2X9D A;  2E1N A;  3NWS A;  1XTA A;  4ENJ A;  1FMV A;  3BPX A;  2ISY A;  2XPU A;  2X4H A;  1R5H A;  3BR0 A;  4G6D A;  3OOP A;  2L01 A;  3DKW A;  1FBS A;  1MZB A;  4OMZ A;  3PUB A;  2R5Z B;  3HOY J;  2F5V A;  4MNU A;  2V6C A;  3SDB A;  2Y2Z A;  5E3O A;  3M1E A;  1JUP A;  1LEB A;  2ETH A;  1I3A A;  2CH0 A;  1SVO A;  1YS6 A;  3LAJ A;  1U5T A;  1E3P A;  2V9K A;  1D0Z A;  3HOS A;  2O5R A;  4L5I A;  2QGU A;  3FIS A;  2WAF A;  3U2R A;  3OS1 A;  3GVA A;  4RLQ A;  3PSF A;  4OIN F;  4II3 A;  4UB8 C;  1SFO J;  3AFH A;  1YJN I;  3L1P A;  2JRT A;  1DGR M;  4FE7 A;  2X6X A;  3K4L A;  3GTK J;  3R0A A;  2CUJ A;  5F64 A;  2QF7 A;  3I55 I;  4LLN A;  2VC0 A;  4EJW A;  4KIC A;  4HNV A;  3F8B A;  1XGO A;  1D1A A;  4XKW A;  1K78 B;  3ABL H;  3M3Y J;  3ZQQ A;  4DZJ A;  3KX2 A;  3BR3 A;  3G1O A;  4C3I J;  3IV5 A;  4HDU A;  4HNT A;  2L2O A;  4Y17 A;  3WU0 A;  4IRG A;  1X1B A;  4OIQ F;  2P4W A;  2ZXH A;  3MFK A;  2LBF B;  3GME A;  4A3F J;  1I6X A;  3DLL F;  2VJI A;  2O7O A;  3IP4 B;  3VEP A;  2VPL A;  2X6Y A;  4A6E A;  2E71 A;  2B9S A;  1PVE A;  2EB7 A;  2EH3 A;  4HZF A;  3HRT A;  3WU1 B;  4F93 B;  4DGW B;  4BJ6 C;  2O6G E;  3MN2 A;  3ESW B;  5E1X A;  5D8K B;  2VOD A;  2QQ8 A;  1HW1 A;  1Z3Y A;  1IRG A;  1OCR H;  1RES A;  2TCT A;  2X1E A;  1R6R A;  3D5R C;  3FXK A;  4R1H A;  2BY0 A;  1E17 A;  1X4P A;  2VXD A;  5KAF C;  2W1O A;  4X6A J;  1SMT A;  3I0T A;  2FF4 A;  4RB2 C;  3H3Z A;  3GTQ J;  4PGH A;  5LHI A;  1U5T C;  4I2O A;  1ITY A;  2FNA A;  3I64 A;  2B0L A;  2EIK H;  3P7N A;  3TOB A;  3FKJ A;  1LKX A;  2QM3 A;  5IP7 J;  3VYT B;  4G7H F;  1U8B A;  1KQ8 A;  2BXZ A; 
#chains in the Genus database with same CATH homology
 3BR6 A;  2CUE A;  3BQY A;  1R9T J;  1O4X A;  1RR7 A;  3FKI J;  2AO9 A;  3S2H J;  2M8G X;  2I10 A;  4I6Z A;  1IJW C;  1NTC A;  1I3Q J;  2DTZ A;  1U9O A;  3SJM A;  3IH4 A;  1JTY A;  2ZB9 A;  2NVX J;  1JGG A;  1Y1W J;  1ETX A;  2CU7 A;  3TP0 A;  1P7I A;  2HYJ A;  1ETY A;  5FKL A;  5F1J A;  5C4J J;  5GPA A;  2K40 A;  2LVS A;  1JUS A;  3W6V A;  1MBG A;  2PMZ N;  1WH5 A;  2P81 A;  2QCO A;  2VKE A;  5GPC A;  1DU0 A;  1I50 J;  4XIC A;  2M34 A;  1GUU A;  1MNM C;  2MW8 A;  1LE8 A;  5E3N A;  4B1R A;  4A3C J;  5M3M J;  4BKX A;  1HDP A;  2JA6 J;  2RAE A;  5EEA A;  5FLV A;  2R5Y B;  1VF9 A;  5EZH A;  2R7Z J;  2CQQ A;  2Y30 A;  1OFC X;  1U9N A;  5EG0 A;  5FKK A;  1FJL A;  2LK2 A;  2NVY J;  3BTI A;  4MFE A;  5J3L A;  3BQZ A;  3S1N J;  4XK4 A;  2IAI A;  2MGQ A;  2N8G A;  3DEW A;  3A03 A;  1BA5 A;  3RKQ A;  3PO2 J;  3ZQF A;  1OCT C;  5EYR A;  2E1O A;  5BNG A;  3RQI A;  4DZP A;  3JRE A;  3HEF A;  4A93 J;  3JRI A;  2D5V A;  1WCM J;  1PUF B;  5GP9 A;  2DA4 A;  3GTP J;  2XB5 A;  1MH3 A;  5EGO B;  1NK3 P;  1JTX A;  2JA5 J;  2HI3 A;  4AC0 A;  2WV1 A;  5IP6 A;  3O8H A;  4IEJ A;  1ZR2 A;  3HOZ J;  1HDD C;  4DYQ A;  1AHD P;  2E2I J;  3GTM J;  1S7E A;  2GBY A;  1MBK A;  5J1U A;  3S1M J;  2JA7 J;  3O8G A;  5J1R A;  5F27 A;  2DMQ A;  1BW5 A;  4UUS A;  2O8K A;  2H8R A;  5K7Z A;  1T33 A;  4M3F A;  1HLV A;  2NS7 A;  1TWC J;  2R92 J;  3BG5 A;  3S14 J;  2K9N A;  2DA7 A;  3LNQ A;  2WB1 N;  1TC3 C;  1IC8 A;  1OCP A;  3I4M J;  3S1Q J;  3HOV J;  5IOY A;  4M3G A;  3D1N I;  3E7L A;  3RZD J;  4IHV A;  4B3A A;  4V2G A;  2DMP A;  2COB A;  1ETV A;  1JKP C;  3JRH A;  3MKL A;  3FK7 A;  4D7N A;  5C3E J;  4C2M J;  2JJ7 A;  2M9H A;  3TED A;  3FK6 A;  2B63 J;  1W0T A;  3BG3 A;  1U78 A;  2DMN A;  2ID6 A;  2YU9 J;  2DA1 A;  2KT0 A;  2IEK A;  4C3J J;  5M5W J;  3GTL J;  1NK2 P;  3GTO J;  3BTL A;  5FKO A;  2CQX A;  3WHB A;  1G2H A;  1H88 C;  1WI3 A;  1SAN A;  4JX6 A;  5E3L A;  2DN0 A;  3OIO A;  1FIP A;  4Y7N J;  3DCF A;  1BL0 A;  1GV5 A;  2LFB A;  2XSD C;  2ME0 A;  3JRA A;  3H3V K;  4BXX J;  2HDD A;  2HXI A;  2H1K A;  5E3M A;  5J1Y A;  1Y1V J;  3CDL A;  4V2F A;  4NDL A;  4BBS J;  1X2M A;  4A3B J;  2LKX A;  1WH7 A;  2R0Q C;  3JRB A;  3IH2 A;  4A3E J;  1IGN A;  3BR1 A;  2AHQ A;  4BBR J;  3ZQG A;  3K7A J;  3S16 J;  4FE4 A;  5JLX A;  3ZQL A;  1APL C;  1VI0 A;  2NS8 A;  4GFB A;  3F0C A;  3PO3 J;  1B72 B;  1ZQ3 P;  2XRL A;  1TWG J;  2MSY A;  3IH3 A;  5FLM J;  1HOM A;  1FEX A;  1RKW A;  4IHX A;  1HCR A;  5IYB J;  4MFD A;  2ID3 A;  4UUT A;  2LP0 A;  1TWA J;  2E19 A;  3BR5 A;  3OSF A;  1MH4 A;  2Y9Z A;  5IP9 J;  2K9Q A;  1F36 A;  4DYR A;  1GT0 C;  3BG9 A;  2CJJ A;  1P7J A;  2ECC A;  1JKQ C;  1D5Y A;  1K83 J;  2X6O A;  5EF6 A;  3OSG A;  5FKM A;  3OOU A;  3CQZ J;  2MG4 A;  2X48 A;  2ECB A;  5JLW A;  4A3K J;  3BT9 A;  1B8I A;  4MLO A;  3A01 A;  3HKZ N;  4X1E A;  5F0C A;  3G1L A;  2DA6 A;  2DA5 A;  4JP0 A;  4BY1 J;  2JA8 J;  1RET A;  4JX5 A;  4A3G J;  4CYC B;  5DS9 A;  1ZR4 A;  4DW6 A;  4AYB N;  2L7M P;  5FJ8 J;  3TP3 A;  3TW6 A;  2CRG A;  3NAR A;  4QTR A;  3HBL A;  2M0C A;  2Y0S N;  3S1R J;  1A5J A;  3BR2 A;  4MO7 A;  5EDN A;  2JN6 A;  2E2J J;  3MVP A;  1QVT A;  4D5F A;  1AKH A;  3LSJ A;  5FKN A;  4ABZ A;  2HOS A;  3ZQC A;  4FIS A;  1EF4 A;  1YRN A;  1ETQ A;  4BY7 J;  3JRC A;  4B4C A;  1RKT A;  3VPR A;  4XRS G;  2E2H J;  3HGG A;  2HOT A;  3BTC A;  3SFI A;  1LE8 B;  3A02 A;  3Q0U A;  4D5C A;  1RPW A;  5F0H A;  1MBH A;  2DMU A;  4JX4 A;  4I76 A;  2LLK A;  1W0U A;  3B6C A;  1JJ8 C;  1X58 A;  2JMW A;  3HM5 A;  3HGY A;  3HOX J;  2KDZ A;  2VKV A;  2FJ1 A;  2W48 A;  3Q3S A;  1TWH J;  2HQ5 A;  1FIA A;  4W1U A;  1GVD A;  5EG0 B;  3I4N J;  1E3O C;  2LR8 A;  2TRT A;  4G12 A;  1K61 A;  3RZO J;  3WHC A;  4Y52 J;  2DMT A;  2VPR A;  1UG2 A;  1JJ6 C;  2K9S A;  4QSH A;  4FCY A;  4XRS A;  1UMQ A;  1MBJ A;  2NOG A;  4M6V A;  3GTJ J;  1JT0 A;  1TWF J;  4D7M A;  4FTH A;  3HB9 A;  3GTG J;  4M3E A;  1XG1 A;  4LOC A;  4IHY A;  1JKR C;  4S0H B;  1Z77 A;  1CQT A;  2Y31 A;  3Q0W A;  4A3J J;  4DYC A;  2R5Y A;  3QPL A;  1A6I A;  2HXO A;  2JK3 A;  5IOZ A;  5C4X J;  2XPW A;  3C2B A;  3S17 J;  2WAQ N;  4QIW N;  3PM1 A;  4UUS B;  2EQR A;  1MSE C;  1I6H J;  2JWT A;  1LFU P;  3BTJ A;  2VUM J;  1T56 A;  1ENH A;  1H89 C;  1MSF C;  1DU6 A;  1MBF A;  1HF0 A;  3Q0V A;  4A3D J;  2FQ4 A;  4CYC A;  3TW7 A;  1PUF A;  1IDZ A;  5DTD A;  3CMY A;  3K2A A;  2EZK A;  2L9R A;  4W97 A;  1JT6 A;  1ETK A;  5IPA A;  5EGO A;  2O9L A;  3JRF A;  2GLO A;  5F0F A;  2EZI A;  5M3F J;  1XS9 A;  4A3M J;  1IUF A;  1AU7 A;  2XGD A;  4C3H J;  2R93 J;  1IDY A;  4A3I J;  1IV6 A;  1IRZ A;  4M3D A;  3SDG A;  2OPT A;  1VFC A;  2HOA A;  5C44 J;  3H0G J;  1X2N A;  2L7F P;  3CCY A;  1JKO C;  4A3L J;  3M4O J;  1QRY A;  2X9D A;  1QPI A;  4AUX A;  3ZQI A;  2XPU A;  3BR0 A;  4A69 C;  3LOC A;  2Y9Y A;  2R5Z B;  2DA3 A;  4EEF G;  1ZTR A;  4JYK A;  3HOY J;  1BW6 A;  2YS9 A;  2FX0 A;  3G1M A;  3GBG A;  2Y2Z A;  5E3O A;  1VND A;  2CUF A;  1JUP A;  4L5E A;  1ETW A;  3JRG A;  2G0E A;  3ZQH A;  5K7H A;  3FIW A;  1POG A;  3FIS A;  2NVQ J;  2M2E A;  4J19 A;  1JUM A;  4M3B A;  5M5X J;  1SFO J;  1GV2 A;  2XGE A;  3L1P A;  4FE7 A;  5F04 A;  2YUS A;  1LFB A;  3GTK J;  2EZH A;  2QF7 A;  1IG7 A;  4MIM A;  4XRM A;  4HNV A;  4RBO A;  1GDT A;  1ORK A;  2LY9 A;  3HOU J;  3M3Y J;  3JRD A;  4DZJ A;  3JR9 A;  3BR3 A;  3G1O A;  4C3I J;  3IV5 A;  3LSR A;  1ZGW A;  2LD5 A;  1ZKG A;  4XID A;  3LSG A;  5IYC J;  2L0K A;  2L7Z A;  4IHW A;  2IBD A;  4A3F J;  3B6A A;  2ELK A;  2O7O A;  2XB0 X;  2XPV A;  5IYD J;  5F08 A;  1XC5 A;  1B8I B;  5HOD A;  2ME6 A;  3A01 B;  1MBE A;  2EH3 A;  3S2D J;  3LSP A;  2VI6 A;  1ZK8 A;  3UKG A;  2DA2 A;  5EZG A;  1B72 A;  2GM4 A;  3MN2 A;  2EBI A;  1UHS A;  3HOW J;  2LTP A;  1RES A;  2TCT A;  1ETO A;  2FD5 A;  1OJL A;  3ZOB A;  3S15 J;  1WPK A;  1FTT A;  2EZL A;  2OF7 A;  3QPS A;  1H8A C;  1BJZ A;  5M5Y J;  9ANT A;  4X6A J;  1QVU A;  4RDU A;  2NVT J;  1AKH B;  1WGX A;  1Z0X A;  1YRN B;  3GTQ J;  2XGC A;  1FTZ A;  2DJN A;  1ITY A;  1Q1V A;  3QQA A;  5IP7 J;  3HDD A;  1F43 A;  5K7F A;  1U8B A;  3NAU A;  2R5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...