2L9RA

Solution nmr structure of homeobox domain of homeobox protein nkx-3.1 from homo sapiens, northeast structural genomics consortium target hr6470a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
MGHHHHHHSHMSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeobox protein Nkx-3.1
publication title Solution NMR Structure of Homeobox domain of Homeobox protein Nkx-3.1 from homo sapiens, Northeast Structural Genomics Consortium Target HR6470A
rcsb
source organism Homo sapiens
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2011-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l9rA00
2M9HA 2B63J 5F27A 3SJMA 1I3QJ 1UG2A 2GM4A 4A69C 2NS8A 2FQ4A 4MIMA 3VPRA 3BR0A 2MG4A 3ZQHA 1G2HA 4A93J 1IGNA 2DA3A 4UUSA 2DMPA 2JA6J 5FLVA 3MN2A 2ID3A 3JRBA 2XSDC 2N8GA 1MBHA 1JKOC 2XRLA 2EH3A 3JR9A 4JX4A 2DA6A 3FIWA 3ZQLA 2XGEA 2Y0SN 1MBJA 1BJZA 1F36A 1F43A 2R7ZJ 2O8KA 2K9QA 2YUSA 2M34A 4A3DJ 3DCFA 4DZPA 1BA5A 1VF9A 1MH3A 5IP6A 2XPVA 3GTKJ 2CU7A 1JUPA 3TP0A 3BG3A 2D5VA 2DMNA 1DU0A 3OSGA 5EGOB 2E19A 2Y9ZA 1ZTRA 1UHSA 1ZR2A 3Q0VA 2L7ZA 4G12A 1ZGWA 2FX0A 1SANA 2I10A 3D1NI 1O4XA 1X2MA 3PM1A 4C3JJ 2EZKA 2XGCA 4NDLA 1P7JA 2MGQA 1ZQ3P 4DW6A 4IEJA 5IPAA 2L9RA 3HOXJ 2LVSA 2R92J 2LTPA 2NS7A 2HOAA 4IHXA 1JTXA 3JRAA 2YS9A 5F1JA 5EG0B 5IP9J 1QVUA 5EDNA 2LKXA 3FKIJ 1MH4A 1T56A 2K40A 1Y1WJ 3IH2A 1HDPA 4C3IJ 4D5FA 2HOSA 4L5EA 4MLOA 4RDUA 4FISA 5FKLA 2X9DA 1D5YA 2NVYJ 1SFOJ 3S17J 4AYBN 2Y2ZA 5EF6A 1I6HJ 4V2GA 4CYCA 1H88C 1B8IA 1IG7A 3TW6A 1HDDC 3S2DJ 4MFEA 4CYCB 2M8GX 1Q1VA 2KT0A 1GUUA 3MVPA 5EZHA 1FTTA 3HOVJ 1HLVA 2FJ1A 3Q0UA 4C2MJ 2TCTA 2NVXJ 1ENHA 1JTYA 3HKZN 3ZQFA 4HNVA 1PUFA 1POGA 2LK2A 3JREA 2QF7A 5FKMA 5EZGA 5IYBJ 3S1MJ 2DA5A 3BR1A 5F08A 3GTLJ 3BTLA 2HDDA 3HDDA 1ETOA 2Y9YA 2XPWA 3IV5A 2WAQN 2X48A 2ME0A 2MW8A 3TW7A 2X6OA 1K83J 1QVTA 3A01B 2K9NA 3RZOJ 3RQIA 2GBYA 4Y7NJ 1RPWA 4W97A 1A6IA 4DZJA 4JYKA 2EZHA 1B72A 4QIWN 1MNMC 3BQZA 3ZQGA 5E3NA 1ITYA 4AC0A 3CMYA 3BG5A 1RETA 1JUMA 3RZDJ 2DN0A 2JMWA 4I76A 5FJ8J 4MFDA 1IV6A 4FCYA 3GTGJ 3CQZJ 1ETXA 4FE7A 3QPLA 3LNQA 2E1OA 4M3GA 3WHCA 1UMQA 4UUSB 1TWCJ 4C3HJ 5GPCA 1LE8A 4A3CJ 4IHVA 1BL0A 5M5YJ 1IDZA 2EZLA 3GTJJ 2HI3A 2AHQA 3FISA 3Q3SA 1GVDA 3TEDA 3S1QJ 5IOYA 1VI0A 2ELKA 1CQTA 2TRTA 1GDTA 3GTPJ 2Y31A 1YRNA 2WV1A 4DYRA 5HODA 1MBFA 5GPAA 5F0CA 1T33A 5FKKA 2H8RA 3G1LA 1ZR4A 3ZOBA 1MSFC 2LP0A 2JWTA 4XRSG 1HOMA 3HOWJ 4A3GJ 3G1MA 2Y30A 2CUFA 2NVTJ 3M3YJ 2G0EA 1W0UA 5FLMJ 5IOZA 4I6ZA 3K2AA 3HBLA 3PO3J 4A3FJ 2R5YA 1ZKGA 1ETWA 1WCMJ 3OSFA 1GV5A 5EEAA 2R5YB 2JN6A 1OJLA 1IUFA 1W0TA 3K7AJ 1FIAA 4W1UA 3A02A 3GBGA 2E2IJ 2O9LA 3F0CA 4A3EJ 3HB9A 4B3AA 4D7NA 3UKGA 1RESA 4RBOA 2JA5J 3W6VA 3M4OJ 1NTCA 2ID6A 1ZK8A 2EBIA 5EYRA 2LY9A 2XGDA 3JRIA 2LLKA 3S15J 1TWHJ 5JLXA 1AKHA 1JKRC 3BQYA 2DTZA 5IYDJ 1FTZA 3JRFA 1WI3A 5DTDA 3GTQJ 2H1KA 1AU7A 3O8HA 1U9OA 4XK4A 3HGYA 2XB0X 3LOCA 1RKTA 1B8IB 2HOTA 4ABZA 3OIOA 3LSPA 2JA7J 2ECCA 2L7MP 1WPKA 3QPSA 4JX6A 3Q0WA 3FK6A 2L7FP 1U8BA 2NVQJ 2EZIA 4D5CA 4BBSJ 2R93J 3BTIA 3CCYA 5C4XJ 5C3EJ 2OPTA 5FKNA 1JJ6C 1FIPA 3HM5A 1MBEA 2DMUA 2R5ZA 3S2HJ 1X58A 2YU9J 1PUFB 1MBKA 1IJWC 2IEKA 2EQRA 2QCOA 3S1NJ 1H8AC 1XC5A 2HQ5A 3TP3A 4A3KJ 1U78A 2OF7A 4BY1J 3JRHA 3GTMJ 1Y1VJ 1K61A 4FE4A 1JUSA 5FKOA 5F0FA 1HF0A 1DU6A 4JX5A 1JKPC 2DA1A 1NK3P 1A5JA 3BT9A 2L0KA 3JRDA 4XICA 3OOUA 5IP7J 1U9NA 1VNDA 3A03A 5C44J 4M3DA 3H0GJ 1B72B 2JA8J 5JLWA 1QPIA 1IRZA 1VFCA 1MSEC 2DA7A 4A3BJ 3BTCA 4D7MA 5GP9A 1WH7A 2LFBA 4XRMA 4A3JJ 3JRGA 4A3IJ 2HYJA 4QSHA 5F04A 3BR6A 1H89C 4AUXA 2P81A 2PMZN 4M6VA 2K9SA 2AO9A 4BKXA 2M2EA 2W48A 3C2BA 1LE8B 1S7EA 3ZQIA 5J1RA 2XB5A 1BW6A 1ETYA 2VPRA 1OFCX 5IYCJ 4UUTA 1ETKA 1YRNB 2JK3A 4IHYA 1I50J 3DEWA 1XG1A 2FD5A 3HOUJ 4B4CA 1QRYA 1TWGJ 3E7LA 1JKQC 2HXOA 2VKEA 1ETQA 1RR7A 1X2NA 2DMQA 1RKWA 4B1RA 2RAEA 3IH4A 5M5WJ 3S14J 3L1PA 5C4JJ 2ECBA 1E3OC 1AHDP 2E2JJ 5J1UA 3JRCA 2DA2A 1P7IA 1XS9A 5M3FJ 1OCPA 1LFBA 3CDLA 4DYCA 1FJLA 4BBRJ 5E3LA 5EGOA 4XIDA 2CJJA 2CQQA 1JGGA 3H3VK 3NARA 2DJNA 5J3LA 2M0CA 2GLOA 1HCRA 3IH3A 2ME6A 1MBGA 2LR8A 1WGXA 4MO7A 3QQAA 3HGGA 1AKHB 4XRSA 2R0QC 1OCTC 4S0HB 2CQXA 3GTOJ 2IAIA 2WB1N 4JP0A 2HXIA 5EG0A 3S1RJ 4X6AJ 5K7HA 3SFIA 3PO2J 1TWFJ 2JJ7A 3LSRA 3ZQCA 1TC3C 3I4NJ 2IBDA 3B6CA 3HEFA 4EEFG 2LD5A 1IC8A 1EF4A 4BY7J 1JT6A 2VI6A 4FTHA 1GV2A 3FK7A 2VKVA 3G1OA 3HOZJ 1Z77A 5E3OA 3MKLA 5M3MJ 2R5ZB 3LSGA 4A3LJ 4M3EA 2NOGA 3LSJA 2MSYA 2CRGA 1IDYA 3NAUA 4LOCA 3BR5A 3WHBA 5J1YA 4J19A 1TWAJ 2COBA 5E3MA 1NK2P 3BG9A 4V2FA 2DMTA 2XPUA 2O7OA 5BNGA 4DYQA 3BR2A 1ORKA 1WH5A 1JT0A 5K7ZA 4X1EA 3O8GA 5DS9A 2KDZA 1JJ8C 4QTRA 4A3MJ 4GFBA 5K7FA 4BXXJ 3BTJA 1FEXA 1APLC 3I4MJ 3A01A 1GT0C 9ANTA 1R9TJ 2ZB9A 4IHWA 4M3BA 2VUMJ 4Y52J 1Z0XA 2E2HJ 3RKQA 4M3FA 1LFUP 3B6AA 5M5XJ 2CUEA 2DA4A 5F0HA 3SDGA 3HOYJ 3BR3A 3S16J 1BW5A 1ETVA
chains in the Genus database with same CATH superfamily
5EEGA 2M9HA 4EJVA 1IF1A 2HWVA 4A69C 2OZ6A 4HLXA 3VPRA 1FOWA 4K2EA 3ZQHA 3D0SA 4MEYF 2JA6J 4BEHB 2ID3A 4GGGA 2IVMA 2YU3A 2QUFA 4HW0A 2XSDC 2N8GA 3HRTA 5FRNA 1VQ8I 3NEUA 2XRLA 2EH3A 1HKSA 4ASNA 3ZQLA 3VSKA 4XSZF 5FFZA 4RAZA 1F43A 1ZRDA 4A0ZA 3QRFF 4Q48A 2K9QA 5FD5A 1S8NA 1XGNA 1SFKA 1WJBA 4MQVA 4EJWA 5ED4A 2XPVA 3GTKJ 2CU7A 1W7PB 1JUPA 2KIQA 2R7FA 3CMEI 1AWCA 2G9WA 3V7RA 1DU0A 2E19A 4RAGA 2Y9ZA 3Q0VA 2L7ZA 2CYYA 1ZARA 2LKSA 2LREA 3CUQB 3CUOA 3ZMTA 1X2MA 4A6EA 4XLAA 4C3JJ 5CVVA 3IL2A 2CGPA 2DOAA 2MGQA 1ZLKA 1OYWA 5L3DA 4NC8A 4KICA 5ILSA 4WX9A 1HKQA 1ODDA 4IQJA 4I7HA 4XMYA 1DPUA 4PJNA 1O57A 4NHJA 5IP9J 3ABKH 3Q9SA 1PUEE 3LAPA 2DK8A 3BCAA 2R7TA 2VBZA 2VQHA 3IH2A 1HDPA 1SAXA 2HOSA 2LYCA 3CP2A 5IT9Z 2P5LC 3R0AA 4WK8F 4Y15A 2JRTA 3B73A 2Y2ZA 1ZGJA 3QOPA 3W6KB 4CYCA 1H88C 4C30A 2PBIA 3TW6A 3S2DJ 3A4CA 4CYCB 2KT0A 1I6XA 3K10A 4FETA 3DBRB 4C2TA 3MVPA 2H09A 3ELKA 4LIVA 1WVRA 1X1AA 2KP6A 3Q0UA 1V5FA 1WFXA 1JTYA 3HKZN 4UV9A 1PUFA 2COMA 2VL8A 3TOAA 1KU2A 4M72A 3S1MJ 2A6TA 2Y75A 5F08A 3GTLJ 4ENNA 2CSOA 1ETOA 4EM2A 3L2WA 2OZUA 5B5EC 2FQ3A 2LSOA 5HNFA 4KT5C 2R7SA 3RZOJ 4ZTJA 3G71I 2K9MA 4P55A 2GBYA 2ISZA 5KAIC 1TTYA 4ESBA 4Y7NJ 4HX8A 3I0TA 3WTVC 1A6IA 4MEXF 4JYKA 4M73A 3K69A 4CCNA 2IP2A 1B72A 1XMXA 3ZQGA 2EPFA 3BCBA 5E3NA 2LY2A 5H6RA 3KLNA 4AC0A 2HNHA 1JGSA 1JUMA 3H35A 1D8KA 2BV6A 1XCVA 2JMWA 4I76A 5ICGA 5J47A 5H20A 4E4HA 1VQKI 3K4KA 4MFDA 2QSFX 3LSIA 4LLGF 1V55H 3GTGJ 2DT7B 3CQZJ 1ETXA 3DTEA 2LD5A 3DU6A 2PI0A 5LGUA 4XQFA 1DGWY 3CTAA 1PVEA 1LE8A 3PJRA 3OS1A 2HKOA 4EJUA 3HL2A 4O3MA 1O3SA 2AHQA 1GVDA 1XMKA 4LD5A 3S1QJ 5IOYA 1VI0A 3TKYA 4BGDA 1CQTA 3F23A 1YRNA 2ZFWA 1QPMA 5DD8A 5HODA 3ERED 2HDCA 5GPAA 4J01A 3SQNA 2P0WA 4OAZA 3CMMA 4CYDA 4YEJA 2DO7A 1MSFC 2K4BA 2OTLI 1BOAA 3UR3C 3HOWJ 3N4MA 4XN3A 4PGGA 3CP8A 2CUFA 2NVTJ 2BGCA 1Q1HA 1E0EA 2JSCA 4XORA 1R5HA 1G6NA 1XSXA 3I59B 4NUBA 5HNHA 1ACIA 4EQQA 3OR1C 3HBLA 3ECHA 1ETWA 1WCMJ 1MZBA 3P9CA 5EEAA 4MGRA 2EIJH 1R71A 2JQ7A 1LEBA 3K7AJ 3WTXC 4Q4ZF 2QZ8A 2BE5F 3FXMA 3ZGKA 1TW2A 1XB4A 4E7KA 3FXUA 5KK1A 2GZWA 2LRDA 3SZTA 4EGYA 1FLIA 1X1BA 2EBIA 1R1TA 2XGDA 1YOVB 4UUVA 2F4IA 2DT5A 3HRUA 1SC7A 1RC9A 2CQNA 5FO5A 3BQYA 2HPMA 2VIXA 3HUGA 3H0DA 4AIHA 2ELJA 4D0PA 3GTQJ 3HUGB 4BE0A 1AU7A 2KPMA 1YLFA 2JUGA 3PFYA 1U9OA 3WTUC 1ZREA 2CW0F 3PSIA 1H9TA 1PJRA 2STWA 3OIOA 4U7DA 2L7MP 3HSFA 1WPKA 4ON0A 3T5XA 1J2XA 2EK5A 3FK6A 3EDPA 5CJ9A 3PUFA 5LEJA 2BYVE 1KONA 4XLEA 3M1CA 1BR2A 4O6JA 1YX5A 2VC1A 3EETA 3QPHA 4RLFA 4LMYA 5FKNA 3CCJI 1MBEA 5KAFC 4NNJA 2F5DA 1X58A 1J5YA 2M8EA 2VE8A 3ZCOA 2Z5UA 1YIOA 3S93A 3CCVI 4ENKA 1FP1D 3SXYA 3K2ZA 1XC5A 2HQ5A 2W85A 3GFMA 3PNYA 2P6SA 3DPUA 3GTMJ 2V1XA 3OR2C 2XKPA 2ZSIB 2FE3A 1FMVA 5FFXA 1DU6A 3JTHA 1S9HA 2VJ4A 3ZMUA 4U0YA 3BT9A 4CSWA 2X1EA 3JRDA 2RQPA 3JCUC 3KX2A 2R7UA 2TDXA 1MMAA 2RGVA 1U9NA 3WTSC 1WQ2A 2E5ZA 2NOJB 5JI6A 1S29A 2PX9A 4XKWA 5JLWA 3RCOA 1ZN2A 1MSEC 2DA7A 5FRMA 1VQNI 4R8HA 1MGTA 4RB0A 4II2A 5GP9A 1WH7A 2Z33A 2VPLA 2VQCA 4L9TA 3H3ZA 3M8EA 3HOSA 2M45A 4ITVA 4QSHA 3GZNB 1RIOH 2ZXHA 3KP2A 2KFDA 3K1PA 4M6VA 3GLLA 4BKXA 2NNNA 2W48A 3KP4A 4HOBA 2D45A 1B59A 3LL7A 5J1RA 2MBFA 2K85A 4X0GA 5TRDA 1E17A 2DT6A 3U2RA 3LA3A 1H9GA 2BY0A 1BW6A 1T95A 2VPRA 3E3VA 1YE9A 2MH2A 4UUTA 3V4GA 2JK3A 1I50J 3DEWA 4A2UA 5TGTA 1X1PA 2X51A 4MTDA 4B4CA 4DGWB 1TWGJ 1WJDA 4ESFA 2Y0SA 2DFEA 2PFBA 2DMQA 1RKWA 2O03A 1IXSB 2WAEA 4XONA 2BHZA 2JPBA 2W82A 1E3PA 3IH4A 4RGUA 3FWEA 4XBFA 5C4JJ 2XRNA 2L3DA 1Y0UA 4HYEA 4RM3A 4Y13A 1QHHD 1FYLA 1P7IA 4ZYAA 1T0FA 3M8JA 4ZZDA 3BJAA 3KP7A 5M3FJ 1OCPA 3RKYA 2VXDA 4L9NA 4BQOA 4BBRJ 3W6JB 1YJNI 4HDVA 1LUJB 1BM9A 1JE8A 4E7LA 2F5EA 2KJCA 2WA0A 2GLOA 2F2EA 4G8XA 3IH3A 3SHFA 1YS7A 3PQJA 4P1WA 3TO7A 4MO7A 2WB1A 4JOMA 4EJTA 4OIOF 1LVAA 2ZNZA 3CESA 2Y69H 1WHUA 2IXSA 4M74A 3GFJA 4JP0A 1ZRCA 4CCOA 2P5VA 3F9KA 1R1UA 2OC6A 1BI2A 3CUQC 3SDBA 5K7HA 3SFIA 5LHHA 5GTIC 5JHFA 2BY2A 1VQLI 3FHZA 4AYBA 2VASA 1XTAA 4KA4A 1LEAA 3QP6A 4UVCA 1LFPA 3NWSA 1XD7A 4FTHA 3FK7A 3HPHA 3G1OA 1O7LA 3HHHA 3HOZJ 1Z77A 1RR8C 2VT3A 3GLXA 3S3OA 2DDBA 2R5ZB 3LSGA 3S8PA 3LSTA 3G2BA 3LSJA 2FA5A 4PJMA 3SEZA 2VOOA 2MSYA 4NC7A 5E20A 5ICCA 5E1ZB 5J1YA 4YFNF 2COBA 2G7UA 1NK2P 2QWWA 4BL0B 2ZBKA 2DMTA 4MNUA 5LD2C 1OPCA 1ORKA 1R5ID 2R3SA 5K7ZA 3VDXA 5HDKA 2BW3A 3KZZA 2P7CB 5CQGA 1B9MA 1QNTA 1VQMI 3MKYB 2KDZA 3IUOA 5E8GA 3PIOF 4QTRA 4A3MJ 2O8XA 4BXXJ 3BTJA 2XIGA 1LPQA 4BHCA 2W25A 3GYHX 3BY6A 3L7WA 3I55I 2ZB9A 3KEYA 4KMFA 2Z1DA 1YYVA 3CDHA 2STTA 2L4MA 2WV0A 3EUHC 3LWFA 5B1AH 1I1SA 1IN8A 1LFUP 1DPRA 3LSKA 4BDZA 3VYTB 4ZDPA 3SDGA 3S16J 2FU4A 4JBAA 2L9NA 4RM2A 5F27A 2B63J 1UG2A 4S05A 2DK5A 3CZ6A 2ZJPF 2GM4A 4AM3A 2NS8A 3R6SA 2R7QA 2AQEA 3K70C 5TISC 3HSRA 2GAUA 3TOBA 2RC4A 2P5KA 1IGNA 3DKWA 5DUIA 2DMPA 2BVLA 1OYIA 5FLVA 3MN2A 3JRBA 3RPUD 3S3MA 3K9TA 1JKOC 2AQFA 5BPDA 1R1VA 1OISA 1TLHB 2F6CA 4BXFA 2IS4A 2HVQA 3RYPA 4KIFA 5LRSA 3L9FA 4MTEA 4CZZA 2Y0SN 4BU2A 3E6DA 2JT1A 4GRIA 5BPIA 1F36A 1KU7A 5DM7F 4ZDOA 1D5VA 2RREA 1JHFA 3M9AA 3KP3A 3G73A 4XL9A 1QZYA 5LEKA 5IP6A 1HXDA 3QYBA 3CO6C 4HBLA 3AKZA 3IC7A 3P5JA 3BG3A 2E34A 3RYRA 4WCGA 1ZR2A 4HZFA 2EV6A 3A0BC 2QQAA 3OYJA 1F1ZA 1SANA 1O4XA 3D1NI 3IP4B 4N0BA 2JVHA 1O3QA 1Z3XA 3K4LA 5F6FA 3PIPF 3GX4X 5BMZA 4RS8A 2X1DA 4DW6A 3JSPA 5IPAA 3FBNB 3HOXJ 1R49A 2O5RA 1EH8A 4D1QA 4HNTA 3T0YA 4R1HA 1PP8F 2JVGA 4GYIA 4IHXA 3JRAA 3I3LA 1XSVA 4B44A 1KYZA 4WF2A 1QVUA 4LG0B 2PLYA 2IA0A 2BOLA 2OA4A 2LBFB 3S2WA 4D5FA 4IHTA 2ESNA 1V4RA 3CF5F 2VB6A 2OQGA 5FKLA 2NVYJ 4NC6A 4AYBN 2AXTC 2HZTA 2OAZA 1P4XA 2M0MA 3KYCB 1I6HJ 4V2GA 4IF4A 4MFEA 3C2GA 1Q1VA 2YR2A 3D5LA 1GUUA 4F55A 4JK1X 4OWRB 3T1BA 3WGGA 4HF2A 1P4AA 1IN6A 2A5WA 3HKZA 1Z67A 3G6EI 1QHGA 3RDIA 1KU9A 4BACA 3WG7H 1CF7A 4C2MJ 4HV5A 2EFOA 1YQAA 3L2RA 1SMYF 4XRFA 2XGXA 1ENHA 4FX0A 4L9JA 3SYTA 4ZC3A 4BNCA 2B7EA 2X6XA 4PSXA 3ZQFA 4HNVA 2LK2A 3JREA 3FXLA 3HSEA 4I0BA 2E7XA 2QF7A 4P9FA 2V26A 4B8XA 2VC0A 4BHPA 4KISA 2HDDA 3HDDA 2XAJA 2MW8A 3TW7A 1QVTA 3A01B 3ECOA 2K9NA 4OIRF 3RQIA 2VJIA 5K1YA 3IKVA 3MWMA 4U88A 2L4AA 5AIQA 2VKHA 1IRGA 3GFLA 4DZJA 2CG4A 3M7GA 1WKMA 4B47A 1Z3YA 4M6YA 1HA8A 1R23A 2L7KA 1ITYA 2O3FA 1BJAA 3RZDJ 2DN0A 4GO1A 2VXZA 2LNBA 4OIQF 3GUDA 2MA3A 4BUPA 2HTSA 1H0MA 3ASOH 3V42A 1YG2A 3N97A 3ABUA 3R0JA 1CGPA 4M3GA 5BS6A 1FOYA 1G3YA 4XR6A 5DCMA 4C3HJ 1MIJA 3HTSB 1IN4A 4PJLA 4IHVA 2FNPA 4A3CJ 1OYYA 3AG3H 2EZLA 2W7NA 3FF5A 1R22A 2Q2EA 3U9GA 3GZ6A 3FISA 1S72I 5AIPA 4NQWA 3KE2A 1GDTA 4NQWB 3GTPJ 3CD6I 4UXNA 4DYRA 3ZN1A 1LVKA 2PJRA 3H3UA 3ZOBA 2DJIA 5FROA 1K78A 4J00A 1KYWA 1WWXA 1K78B 4A3GJ 3L2UA 2IGOA 2X6YA 3M3YJ 1WJAA 2KKOA 3TMOA 2HU9A 4LJZF 1VTNC 3U21A 2JA2A 4U0VA 1GVJA 4EV0A 1YITI 2JSPA 1P4WA 2PEXA 5ERIA 2R5YA 1D0YA 1RUOA 2DODA 2R5YB 2JN6A 1OJLA 1W0TA 2HKXA 2Z2SB 3GBGA 2E2IJ 2IT0A 3F6VA 4KJZA 2M4GA 2BEOA 1C0WA 4RBOA 2JA5J 1Z7UA 3REOA 2QBYA 1UELB 3FDYA 3MEXA 5EYRA 2LY9A 2A68F 3GZ5A 3JRIA 2M7AA 4N9HA 1AKHA 3LFKA 1L0OC 2DTZA 5IYDJ 3DLLF 1WI3A 1IRFA 2A6HF 4KN7X 3A1YA 1MKMA 3BG6A 1KQ9A 5DTDA 4AIJA 3MFKA 4XK4A 3ZN0A 1R5GA 3LOCA 3GW2A 4ABZA 1M1EB 2ECCA 4JX6A 3QPSA 1P6RA 3E5QA 5CLSA 2X0LA 2ZMEA 3DWLE 3BPXA 3OS0A 2NVQJ 4MQ9F 1KZHA 4II3A 1BC8C 3B02A 2R93J 2LH9A 1LQ1A 2L2OA 2WADA 5C3EJ 3ZQQA 1FIPA 2DMUA 3S2HJ 3RTRA 3T8RA 5DCFA 1PUFB 1MBKA 1IJWC 1T6SA 2EQRA 2K86A 2GXBA 5LHIA 2F5VA 3V8LA 4A3KJ 1OLTA 2FOKA 4FX4A 1S7AA 1OR7A 5EJCA 1Y1VJ 3LQRA 4DOZA 2P7VB 2DW4A 1JUSA 1HW1A 2M30A 3KP6A 4JX5A 3OYFA 2DA1A 1Y0NA 1A5JA 2DU9A 4RAYA 4IX7A 3J7AO 3OIPA 3W2VA 3OYNA 1MMDA 1XSDA 1DDNA 4G7ZF 2E1NA 2LMDA 5C44J 1B72B 1J7KA 3FM3A 1R4NB 5D6EA 4FHTA 1FYMA 1J0RA 2VQGA 2JA8J 1MDMA 1IUYA 1QPIA 1VFCA 4A3BJ 3P9KA 2QA4I 4U87A 3VYSB 3PFIA 1FNNA 3JRGA 2HR3A 3J7AY 1UJ8A 2XF6A 1YW9A 3DKYA 4UVAA 1T08B 5F04A 1YTYA 1L3LA 2QSGX 2AXLA 1H89C 1SEUA 3E6MA 5H6QA 2P81A 3CO7C 4Z2YA 1MJBA 2K9SA 2AO9A 2RDPA 1G59A 1EV7A 1D1BA 3F72A 1LE8B 3OYAA 1E2XA 1UB9A 2RVCA 5DV5A 3L2VA 1X1DA 4Q5SF 2XB5A 2HQRA 3TBIA 4AIDA 3HOTA 2VLAA 1FZPB 1EJ9A 3H9QA 1OFCX 5IYCJ 2V1UA 1YRNB 2DAOA 2CMPA 3A2KA 5JFRA 3VEPA 5HOOA 2OJED 5FD6A 1TBXA 3E7LA 2HXOA 1O3TA 3PQKA 1X19A 3DV8A 1FWZA 3E1SA 2IPQX 4S04A 2RAEA 1U5TA 5KNLA 5M5WJ 1E3OC 1U5TB 5A2QK 3I54A 1AHDP 2PJPA 3EUAA 5J1UA 5B66C 1IN7A 2V1DA 1GXQA 1UAAA 4L0ZB 4YELA 2D1HA 4EGZA 2NYXA 2H94A 1XS9A 4E6KG 5L3FA 2DOEA 2OU2A 4KNYA 3V8KA 2MFZA 1W5TA 5EGOA 2EWNA 1YIJI 4G6QA 3LMMA 1W36C 2CJJA 1BIAA 2CQQA 3HHGA 5BQTA 3NARA 3WU2C 2M0CA 3VOEA 2F4MB 5LBQA 2KL4A 2LR8A 1F9NA 1WGXA 4YG2F 3PNTA 2CFXA 2H1LA 3O2PE 3ZMSA 4U7BA 4KFCA 1U8RA 4ZH4F 2R0QC 2K27A 1R6RA 2QYOA 4S0HB 1MMGA 4OOIA 1TQMA 2Z9OA 2LKPA 2QQ9A 2WTEA 4QPOA 5EG0A 2BBYA 1MJAA 3TO6A 5K5OA 3ABLH 1SFUA 4CH7A 3PO2J 2JJ7A 3ZQCA 1S6LA 3CC4I 1FX7A 1EA3A 1JXSA 4Z6YA 1FBSA 4KMUX 1UCRA 2OCEA 3HEFA 3FMSA 3TGNA 1J09A 1P2FA 2VI6A 2CFOA 3PNVA 2VKVA 4HG2A 5K5QA 4IPAA 2VT2A 1J59A 2FBHA 1B9NA 3BJ6A 2L54A 4PSWA 5E3OA 1YI2I 4OMYA 2FEZA 3VODA 3HG9A 1U2WA 3I53A 3K6GA 1Y6IA 4RGSA 4KDPA 2HVSA 1BN5A 1IDYA 4RMNA 2A61A 3OYGA 3NAUA 4XM3A 3BR5A 4J19A 3BG9A 4V2FA 4G7OF 2EINH 2NAZA 3BR2A 2MC4A 1V5EA 4X1EA 3AL0C 4PDKA 4F91B 2D2WA 2BY3A 2EA4A 5KCMA 2WAQA 1TP4A 3O8GA 1DP3A 3IAM2 4LFUA 3OYKA 4GFBA 1FOXA 5JHUA 4DJAA 1APLC 2LDUA 4N4NB 2DOFA 4XLCA 4AWXB 3CJRB 1FY7A 1LDKB 4LG3A 1R9TJ 5HLHA 3GFIA 2V9KA 4IHWA 3F8CA 1NG7A 1IW7F 2K4JA 1RUNA 3K4JA 1Z0XA 3QU6A 1XGSA 3FMRA 2CUEA 2DA4A 3EPZA 4YFXF 3HOYJ 1IXRC 2DTRA 2EIMH 2EJRA 2XSJC 1Z7LA 5D5VB 4Y33A 1ONVA 1W5SA 2CO5A 2FRHA 1LJ9A 3FM5A 4MIMA 3BR0A 4E7IA 2MG4A 2LG4A 3AG4H 3NRVA 3CCLI 4AIKA 4A93J 5D4RA 2QM3A 3OYDA 4UUSA 4YIRX 2QKLB 2KMUA 1UFMA 4BE2A 3EUKL 3GWZA 4R79A 2X6WA 2QQ8A 2OCCH 3LA2A 2KJBA 2IA1A 2MLKA 4IQ4A 4A0XA 2CH0A 2ZJQF 1LB2A 2RNGA 5CPRB 4F3QA 4JX4A 2L01A 2DA6A 3FIWA 4IZZA 4IRGA 4I01A 1EH6A 2XGEA 4I0AA 1MBJA 2K3PA 2MABA 4XLFA 5DM6F 2QEXI 1MMNA 3CDIA 1YHQI 2R7ZJ 3BROA 4DIQA 2YUSA 2M34A 3WE2A 5IY5H 4XNFA 4DZPA 1Y39A 1U3EM 4GDFA 3Q9VA 5E8IA 1VF9A 3QYEA 3K0LA 2L5QA 3TP0A 3OYMA 4M71A 1SD6A 2Z99A 3OSGA 2UV1A 4BQAA 3DBLB 2GQQA 1F4KA 1S7OA 1ZTRA 2KRFA 2M1BA 4G12A 4L18B 2FX0A 2R7WA 3VYRB 3RJPA 4PFPA 2Q8KA 3HTUA 4NDLA 1TZLA 2F4OB 4HNUA 2XKOA 2HOEA 4P5OA 1G3SA 2XROA 2LVSA 2R92J 2LTPA 2NS7A 2CV2A 3L2QA 1TNTA 2HOAA 4CCJA 1D3YA 1Y56A 2YS9A 3C2HA 3MCZA 1YJ9I 1MMSA 2W84A 2V79A 3WTWC 1N78A 2IW5A 5J4VA 3FKIJ 2UZKA 3RPQA 1BOBA 3FKJA 4C3IJ 1J75A 1R00A 4PK4A 5DYMA 4MLOA 1FMWA 4FISA 4RDUA 2B9SA 1OCZH 3WE3A 1SFOJ 1G8XA 1ZHFA 5EF6A 2IA2A 1B8IA 2B0LA 3MKZA 1IG7A 2QGUA 1HDDC 3EQLF 2UWMA 2M8GX 4DNCA 1R7JA 4CO8A 4YRVA 4ETSA 3CLOA 5A2QZ 4E7HA 3E0JB 5EZHA 4I98B 3E6CC 3O3KA 2MH9A 4WWCA 1FTTA 3HOVJ 2F48A 1HLVA 2FJ1A 1ON1A 1ON2A 1NH3A 4G6TB 1LNWA 1O3RA 2Y48A 4LLNA 2DDAA 3IRQA 1POGA 2WWYA 2BW3B 3K4BA 4ZYHA 4ZYDA 4OINF 1WSUA 2ETHA 2CV1A 2DA5A 3BR1A 2P8TA 3RKWA 2A6EF 2XASA 3MD2A 2Y9YA 2CS3A 3IV5A 1SVLA 2WAQN 2ME0A 3G4SI 1D1CA 1K83J 4Y17A 3EYIA 1V3FA 2HYGD 1MD0A 1K6YA 2W57A 5LRRA 3FMQA 2R7OA 4W97A 3U1DA 3VB2A 1IXCA 4CDGA 4ZJZA 2E35A 2EZHA 4QIWN 5HS7A 3BQZA 1MNMC 4YIIA 2H6CA 3BG5A 1WJ5A 4HF1A 5JVGF 2GIVA 5FJ8J 4MHGA 4FCYA 3C1DA 3QPLA 3LNQA 1D0XA 2E1OA 2F5FA 1I1GA 2CW8A 1UMQA 1VQ5I 1SFXA 3SZPA 1TWCJ 1EF4A 5GPCA 4EATA 1SFEA 3LA7A 2VJJA 3I58A 1YS6A 2P4WA 1MNEA 1Z1DA 2FMYA 1OMIA 5JR3A 5M5YJ 2LOOA 3KEQA 1IZ1A 2HI3A 1J9IA 1QGPA 4B48A 3Q3SA 1N25A 1XN7A 1D1AA 2W00A 1UHWA 3F21A 1P9QC 1SVMA 1MBFA 4DBQA 2WAFA 5F0CA 1T33A 3BLYA 1HSTA 2H8RA 1OQYA 3KYLA 4LLLA 1WRJA 2HFHA 2LP0A 1DP7P 3U1KA 4RB3C 2HEOA 2ZJRF 5E17F 3CCUI 4CXFA 3ABMH 4GXOA 1PDNC 5GAHJ 3G1MA 2D1VA 1D8JA 2L02A 3R4KA 3HRSA 4HA8A 4CZCA 5IOZA 5F64A 4ENJA 3FX3A 1G4DA 4G7HF 4A3FJ 1ZKGA 3OSFA 1WJEA 1GV5A 1IUFA 1X1CA 1OCOH 1Z6TA 1FIAA 3S32A 3A02A 3H92A 3IWFA 3DPTA 4A3EJ 4D7NA 2VONA 4LK1F 1SD5A 3M4OJ 3H1CA 1X3UA 4B3XA 2ID6A 3BC8A 4BYYA 1K79A 2DPUA 2NVUB 2OV7A 3GXOA 2V6CA 2BVMA 2LLKA 3S15J 1BR1A 3OYIA 1TWHJ 5JLXA 3IHUA 3WGIA 3CC7I 4Y4RA 1ZRFA 1JKRC 3TL4X 3T8TA 3JRFA 2NRAC 2H1KA 2QQBA 3O8HA 2R7RA 5J6XA 2X1CA 3HGYA 4LIUA 4WXHA 1P92A 3OWTA 5AONA 2XB0X 1Y8QB 3KPHA 1F5TA 3CCRI 2JA7J 4UV8A 2VN2A 3CCSI 4QPQA 5HS9A 2UXNA 3ML6A 3Q0WA 1K4SA 2IJLA 3L09A 2EZIA 3ZQ7A 2P6TA 3FXQA 3O6BB 1W4MA 1NG6A 1USTA 1CF7B 3VWBA 2AS5F 2OPTA 3QWLA 3F8MA 3MKWB 2Z3YA 5DD4A 3HM5A 2YU9J 2YPRA 4RB1A 5BOXA 3J81Z 1U78A 5CVJA 3K4MA 3DLAA 5J4YA 4PCQA 1B6AA 4BAYA 4BY1J 3NQOA 4IHSA 1XDSA 2V6EA 3H36A 3OMYA 2BY1A 1G3TA 3HRMA 5FKOA 1HBXG 5E18F 1FT9A 1JHHA 2DLLA 2V7FA 2XDVA 4HQMA 4IOAF 3GMEA 3OOUA 2C6YA 1QO0D 2A3SA 1FSEA 3RIRA 3E97A 3ULQB 5F1RA 2YX4A 1OCRH 4M3DA 3H0GJ 4LK0F 1N75A 2ZCWA 3DBHB 4BXUA 2IGMA 1FBUA 1WI9A 2GIZA 3BTCA 4D7MA 2Q1ZB 5L3EA 2MD5A 1SMTA 3V7SA 5HDNA 1BC7C 4A3JJ 4A3IJ 2KIMA 4OU0A 2ADUA 5B1BH 2OD5A 1B1BA 1T2KA 2EV5A 3BR6A 4PGHA 5LGTA 4AUXA 5DCMB 2ICWG 3BDDA 4CICA 2M2EA 3C2BA 5ILUA 1S7EA 4F92B 4HX4A 2Q2EB 3WTZA 1FYKA 2XF5A 2RN7A 1FBQA 5FB2A 1ETYA 2UUZA 3AG1H 4YFKF 2KZGA 1W7PD 4XLPF 1ETKA 1Z21A 3VSLA 4IHYA 1ZAOA 4UVBA 4BEHA 2FD5A 2VE9A 3HOUJ 2PJRB 1QRYA 1W1WE 4KUMA 1DGRM 1JKQC 1HW5A 2VKEA 2GXGA 1E3HA 4AU7A 4BHBA 1X2NA 4ZZLA 4B1RA 3F22A 3TDZC 3L1PA 2L9VA 1KU3A 2QSHX 2LY1A 2E2JJ 3WODF 1FSHA 1A6QA 2EV0A 1T98A 1HSJA 2V9VA 3D5SC 3CDLA 3TQNA 1FJLA 1W7PA 2VQLA 5E3LA 3DPLC 2DPDA 3GVAA 2OQRA 3M07A 5GAEJ 4XKBA 4XIDA 3ZPLA 1JGGA 1Z6RA 2LF7A 3H3VK 1GLNA 2NS0A 1AA7A 3CUQA 1ERDA 2DFHA 1UG0A 1MBGA 1T0FC 2QBYB 3I5UA 1A04A 4GCVA 3QQAA 3ROUA 4EM1A 1BI0A 1KGSA 1XX5A 2K5CA 3HGGA 1AKHB 3QOEA 3BZKA 4XRSA 1OCTC 5CVRA 5LFAA 4HEA2 2CQXA 2IAIA 3WTTC 1T38A 5CQEA 3OYEA 2HXIA 3E5UA 4KT6A 3S1RJ 2FBKA 2OBPA 1QA6A 3BZ6A 2DFIA 4CCLA 3ZMVA 1KQ0A 1Z05A 2BXYA 2M5WA 2R7VA 4C2UA 1TC3C 4IO9F 1WZ2A 5GTHC 3C7JA 1BBYA 3GF2A 5L3CA 3TDUC 1Z91A 2ZMEB 4BY7J 1JT6A 2ELHA 2QKMB 5D6FA 1GV2A 2PMUA 4A6DA 2E1MB 1SD4A 4AVPA 2ZC2A 4XKVA 2HTJA 2VOPA 4PFOA 1FPQA 3WG9A 4I02A 5HDGA 5M3MJ 3ERMA 1R36A 4A3LJ 4LB6B 2E71A 2V1NA 2NOGA 4HV6A 1YJWI 1UHMA 5DEQA 2PG4A 2CRGA 4YIFA 3COAC 1ZG5A 3JSOA 3K70D 4LOCA 3RSNA 3WHBA 2DQLA 1TWAJ 5E3MA 3KP5A 5LGNA 4IOCF 2KRHA 2XPUA 2O7OA 5BNGA 4DYQA 2GOMA 1ZG3A 1WH5A 1KA8A 1N77A 1JT0A 4BE1A 2OUMA 3EUHA 3LSHA 1XPXA 2QLZA 4RGRA 4TV7A 4M9ZA 5LLQA 2KRCA 1MJ9A 1G3WA 3OIQA 3FXOA 2JZYA 3OS2A 5L3GA 5K7FA 3FHNA 1FEXA 2O61A 2EFPA 1I27A 3F6OA 1GT0C 1MDMB 9ANTA 2K9LA 4M3BA 5D5WB 3WU1B 2VUMJ 2E36A 2DI3A 1NHAA 3P7NA 2MYSA 1FP2A 5D4SA 2J5PA 2M3AA 3M1EA 4M3FA 2A5YB 3B6AA 1RRJA 1IO2A 5F0HA 1S3JA 1XMAA 4EM0B 2XV4S 4XOTA 2E60A 5D5UB 3BR3A 3QP5A 1T39A 1X4OA 1ETVA 4F93B 4LGWA 2A69F 3H5RA 3SJMA 1I3QJ 2CWEA 1X4PA 1REPC 2FQ4A 2KIUA 3DU5A 4HRIA 3HZJA 5KVRA 4DBRA 3PUBA 1ZG1A 4HX7A 1G2HA 1W5CC 3BWGA 5FGMA 4E7SA 3JAMZ 2X4HA 1QZZA 2DA3A 3MAJA 4FT8A 2IRFG 3WU0A 1XDUA 3FZVA 5CVUA 1ZYRF 3OL4A 3K1MA 3J80Z 5L3BA 4H0EA 1GXPA 1MBHA 2CQ7A 4IRHA 3JR9A 2KLOA 2QVOA 4HQEA 4BH9A 4L9VA 4N4OB 1BJZA 1R4MB 2WY7Q 4IXAA 3L2CA 2O8KA 4A3DJ 3DCFA 2FNAA 2VBYA 2A07F 1HC8A 1BA5A 1MH3A 4KITB 3AFHA 3ONQA 2BHYA 5J8CA 2D5VA 1TT0A 2DMNA 5EGOB 2ZO4A 3I59A 1UHSA 3KETA 1ZGWA 3PL8A 1VQ6I 2I10A 4GYGA 3PM1A 4H4KC 2EZKA 2DYRH 2XGCA 3W2WA 2IS6A 3F3XA 1P7JA 5D8LB 4LB5A 3MZ8A 2ZXJA 1YO5C 2PMHA 1ZQ3P 4IEJA 2L9RA 2W1OA 1ZGAA 2CV0A 1JTXA 4HF0A 2CUZA 3E5XA 5F1JA 5EG0B 1B4AA 5CKTA 4ZTFA 2WC2A 5EDNA 2LKXA 1MH4A 1S5LC 1T56A 2K40A 1QQIA 4A5MA 2IS2A 1Y1WJ 1BR4A 1I39A 4BJTA 4RB2C 4L5EA 2HGCA 2ZSHB 4AVZA 3X2QH 1PYVA 4IVNA 1X3ZB 1R58A 4F7ZA 2X9DA 4P9UA 5CYVA 1D5YA 2ESHA 3S17J 3RQ4A 2NNYA 2EA2A 4IJAA 1TNSA 2I8DA 4U0WA 1MW7A 3SEQA 2ZXWH 4UHTA 4Q47A 4B09A 4A0YA 4BDYA 2A05A 4HAMA 4HPQA 2MD0A 4M9XA 5HS8A 1QU3A 1LDJA 4RLQA 1KQ8A 1EKEA 2FF4A 2IGKA 2TCTA 3CJNA 2NVXJ 1VQPI 4G9YA 4BJ6C 5FKMA 1A36A 5EZGA 5IYBJ 2VJ5A 2XUBA 3BTLA 2XPWA 4UB8C 2EFWA 2X48A 1RZ4A 2KQRA 3RI4A 4RA2A 3CMAI 3F8FA 2X6OA 5K5RA 2IGNA 3HXLA 3BOQA 3KLOA 1RI7A 1RPWA 1ZELA 2CW7A 1SD7A 3BP8A 3QYFA 4L5JA 4UY8I 4HDUA 4PJJA 1I5ZA 1X3WB 4ZDLA 3JW4A 1K7AA 1QBJA 1VQ7I 2ISYA 1IV8A 3ASNH 3DF8A 3CMYA 3OOPA 1T8IA 1RETA 5ILVA 2EILH 2HPIA 3I64A 3FXKA 4M6XA 2M87A 1BI1A 3K1NA 1IV6A 2PMZA 3LFUA 2XVCA 2MLGA 4FE7A 1ULYA 4ZYGA 5DUKA 1HQCA 3WHCA 5HLGA 4O5VA 2KZVA 1SVOA 3QU3A 4UUSB 3V7CA 2KISA 2GXAA 1BL0A 1IDZA 1PP7U 3GTJJ 3P9IA 2FUG2 3TEDA 2LF8A 5DDGA 2JUCA 2ELKA 1LDDA 2YSRA 2TRTA 2Y31A 3DEEA 4I09A 5KHDA 2WV1A 3K4NA 1RNLA 4G94A 2HQNA 5FKKA 1V5GA 4OMZA 1DQUA 2EFQA 4IRIA 2EIKH 3G1LA 4XSXF 4EVIA 1ZR4A 4M9SA 2DYSH 4Y3OA 2JWTA 3HIFA 3PSFA 3W3CA 3DKXA 3K4CA 4BJ5C 2KIFA 4XRSG 1HOMA 3DEUA 1TT5B 2W4SA 2Y30A 3MQ0A 3LQQA 2G0EA 1W0UA 2HYFA 1STZA 5HVQC 2CUJA 2R7XA 2H8WA 3J81K 2Y0MA 5FLMJ 2PN6A 4I6ZA 3K2AA 4LITA 3ZRGA 4OIPF 3PO3J 3KIOA 2VODA 3R61A 3SFZA 4C9YA 3GCMA 3LAJA 2ZXIA 5E1XA 3S3NA 3HJEA 3BG7A 4PZJA 4W1UA 2O9LA 3F0CA 2ZJ2A 4FQGA 4D9JA 2RNJA 3HB9A 2GOXB 4ANJA 5FLXK 4B3AA 5J40A 3VYUB 3UKGA 3DFGA 1RESA 3CCQI 2LC2A 3W6VA 2YX7A 4CA0A 1NTCA 2GA2A 1ZK8A 3H5AA 3SZGA 2K7LA 3FXJA 2O0YA 1VQ4I 1ZH5A 1FTZA 1BI3A 3FBIB 1O7FA 1IAWA 4B43A 2FXAA 4NBQA 1A35A 3H9JA 4BQQA 1V54H 3HPGA 5GADJ 3F8NA 1B8IB 1RKTA 2HOTA 3ABTA 2IS1A 3LSPA 2XAUA 3OYHA 2RV8A 2L7FP 2M7BA 1VQOI 1U8BA 1K4TA 3D5RC 5HLIA 3KCCA 4D5CA 4UB6C 4BBSJ 3DTIA 3OY9A 3BTIA 1OKRA 3CCYA 5C4XJ 3VFZA 1YFHA 1JJ6C 3KZYA 2R5ZA 3LSMA 5ICEA 3JTGA 2IEKA 4WXDA 2QCOA 2FSWA 3S1NJ 2R4GA 1H8AC 4XKCA 3TP3A 3I56I 3OV8A 4E7ZA 2OF7A 3OL3A 1I3AA 3JRHA 2ZMEC 3MZYA 2UXXA 3J7YJ 2FOWA 1K61A 4FE4A 2E1MC 3IKTA 2RQQA 2FBIA 2G7HA 5F0FA 4ZYEA 1HF0A 4N9IA 1JKPC 1NK3P 5CVIA 1K6OA 2KDOA 2L0KA 2HDWA 4HSTA 1IN5A 6PAXA 3W2AA 4XICA 3KFWX 3M8FA 2GWRA 4RGXA 5IP7J 3MZHA 1VNDA 3EYYA 2XAQA 3A03A 3DXJF 5TJJA 4KIBA 4WXCA 1OR7C 2I5UA 4L5IA 3QAHA 3A0HC 2ZFUA 1IRZA 1XGOA 1TL8A 2DXIA 5J8FA 1YW8A 2LFBA 3ZP5A 3BZCA 4XRMA 2J5OA 3HC7A 3QPTA 4RAFA 4IKFA 2CQKA 4EJOA 2HYJA 3DQVC 4BQNA 1Z9CA 4F52A 4PUSA 1YW7A 2K02A 2PMZN 2V9PA 3ZR8X 1W36D 1FOKA 3ZQIA 4XOPA 3I71A 2XF7A 3ISPA 3G3ZA 1EH7A 1ZLJA 5D5XB 3J7ZI 3E6BA 1VQ9I 4HLYA 2NXNB 4CCMA 1HW2A 2X85A 1USSA 4XN0A 3ZMZA 3HYIA 4G6DA 2DFFA 3KZIC 3RKXA 1XG1A 3CC2I 5IT9K 3I9V2 3UNGC 2Z16A 2E1CA 2DCEA 2ZNYA 3MMYB 2VKDA 2DQRA 1SAUA 4CGZA 2GA1A 3AG2H 1ETQA 3DP7A 2M4KA 1RR7A 5E1WA 3N05A 4UNOA 2HZDA 3IWZA 5LHGA 3S14J 2ECBA 2RKHA 3JRCA 2DA2A 2WBMA 1XCBA 2XAGA 1YX3A 4EMSA 1GHCA 3L00A 4A12A 1TW3A 5EEHA 4E70A 1LFBA 2JPCA 4DYCA 4DQ2A 5H2FC 1A31A 4KYWA 1U5TC 2F5CA 2JRMA 2HS5A 4QWQA 1U6GA 2DJNA 5J3LA 3RPUA 3OYLA 2WY8Q 1HCRA 2ME6A 4FASD 2PQ8A 3GO5A 1Y8RB 2MC3A 1WJCA 4A5NA 1BIBA 2W24A 4ESJA 1LKXA 2H6BA 3ZXSA 5IT3A 2ZKZA 3NWTA 3GTOJ 2WB1N 4CHUA 4I2OA 2E5NA 3CF2A 2EB7A 4AD9A 4E7JA 1HKTA 2R7DA 4X6AJ 1JI8A 2QENA 2BZTA 2ACJA 4LG0A 3AAFA 1TWFJ 2HQAA 4XLHA 1TQIA 1VZ0A 3LSRA 2LBFA 3BJOA 3ESWB 4KN4X 4OAYA 3I4NJ 2IBDA 3B6CA 3H5NA 3ZMDA 2XAHA 3C18A 2KHMA 3DTKA 4CCKA 4EEFG 5D8KB 5HLTA 2V4JC 3GEZA 3CCMI 1IC8A 1WJFA 1AOYA 3C3WA 1TQPA 2BXZA 2VBXA 2K3FA 3JAMK 2EFNA 1XGMA 3MKLA 2FMLA 4JQFA 1D0ZA 3J80K 4M3EA 3AL0B 3CJTB 2DBBA 4L0YB 1OCCH 3IRRA 1FC3A 1U0JA 3QODA 1IRXA 2L9SA 3KYDB 3V8JA 3F8BA 3IAS2 4V19K 2HVRA 5JVTA 4BS9A 2XHKA 4P96A 4HSRA 2O6GE 2E7WA 5FLXZ 3TO9A 5DS9A 3KEOA 3WTYC 1JJ8C 1UZCA 3CJQB 5E79C 4PJ0C 4NB5A 2VBWA 4KIGA 3CCEI 2H27A 3R60A 3I4MJ 3OYBA 3A01A 4IL6C 3H9GA 4I99C 2OTJI 2JTVA 4Y52J 5ICFA 4QLCU 1QZEA 3I4PA 3BPVA 3Q5FA 2XAFA 5B3SH 2E2HJ 3RKQA 5GAGJ 2XC7A 4XLNF 5M5XJ 2Q0OA 3CLQA 4ENMA 1MNDA 1DUXC 3FXRA 4CUGA 3WGHA 1BW5A 3OYCA
chains in the Genus database with same CATH topology
2M9HA 2B63J 5F27A 3SJMA 1I3QJ 1UG2A 2GM4A 4A69C 2NS8A 2FQ4A 4MIMA 3VPRA 3BR0A 2MG4A 3ZQHA 1G2HA 4A93J 1IGNA 2DA3A 4UUSA 2DMPA 2JA6J 5FLVA 3MN2A 2ID3A 3JRBA 2XSDC 2N8GA 1MBHA 1JKOC 2XRLA 2EH3A 3JR9A 4JX4A 2DA6A 3FIWA 3ZQLA 2XGEA 2Y0SN 1MBJA 1BJZA 1F36A 1F43A 2R7ZJ 2O8KA 2K9QA 2YUSA 2M34A 4A3DJ 3DCFA 4DZPA 1BA5A 1VF9A 1MH3A 5IP6A 2XPVA 3GTKJ 2CU7A 1JUPA 3TP0A 3BG3A 2D5VA 2DMNA 1DU0A 3OSGA 5EGOB 2E19A 2Y9ZA 1ZTRA 1UHSA 1ZR2A 3Q0VA 2L7ZA 4G12A 1ZGWA 2FX0A 1SANA 2I10A 3D1NI 1O4XA 1X2MA 3PM1A 4C3JJ 2EZKA 2XGCA 4NDLA 1P7JA 2MGQA 1ZQ3P 4DW6A 4IEJA 5IPAA 2L9RA 3HOXJ 2LVSA 2R92J 2LTPA 2NS7A 2HOAA 4IHXA 1JTXA 3JRAA 2YS9A 5F1JA 5EG0B 5IP9J 1QVUA 5EDNA 2LKXA 3FKIJ 1MH4A 1T56A 2K40A 1Y1WJ 3IH2A 1HDPA 4C3IJ 4D5FA 2HOSA 4L5EA 4MLOA 4RDUA 4FISA 5FKLA 2X9DA 1D5YA 2NVYJ 1SFOJ 3S17J 4AYBN 2Y2ZA 5EF6A 1I6HJ 4V2GA 4CYCA 1H88C 1B8IA 1IG7A 3TW6A 1HDDC 3S2DJ 4MFEA 4CYCB 2M8GX 1Q1VA 2KT0A 1GUUA 3MVPA 5EZHA 1FTTA 3HOVJ 1HLVA 2FJ1A 3Q0UA 4C2MJ 2TCTA 2NVXJ 1ENHA 1JTYA 3HKZN 3ZQFA 4HNVA 1PUFA 1POGA 2LK2A 3JREA 2QF7A 5FKMA 5EZGA 5IYBJ 3S1MJ 2DA5A 3BR1A 5F08A 3GTLJ 3BTLA 2HDDA 3HDDA 1ETOA 2Y9YA 2XPWA 3IV5A 2WAQN 2X48A 2ME0A 2MW8A 3TW7A 2X6OA 1K83J 1QVTA 3A01B 2K9NA 3RZOJ 3RQIA 2GBYA 4Y7NJ 1RPWA 4W97A 1A6IA 4DZJA 4JYKA 2EZHA 1B72A 4QIWN 1MNMC 3BQZA 3ZQGA 5E3NA 1ITYA 4AC0A 3CMYA 3BG5A 1RETA 1JUMA 3RZDJ 2DN0A 2JMWA 4I76A 5FJ8J 4MFDA 1IV6A 4FCYA 3GTGJ 3CQZJ 1ETXA 4FE7A 3QPLA 3LNQA 2E1OA 4M3GA 3WHCA 1UMQA 4UUSB 1TWCJ 4C3HJ 5GPCA 1LE8A 4A3CJ 4IHVA 1BL0A 5M5YJ 1IDZA 2EZLA 3GTJJ 2HI3A 2AHQA 3FISA 3Q3SA 1GVDA 3TEDA 3S1QJ 5IOYA 1VI0A 2ELKA 1CQTA 2TRTA 1GDTA 3GTPJ 2Y31A 1YRNA 2WV1A 4DYRA 5HODA 1MBFA 5GPAA 5F0CA 1T33A 5FKKA 2H8RA 3G1LA 1ZR4A 3ZOBA 1MSFC 2LP0A 2JWTA 4XRSG 1HOMA 3HOWJ 4A3GJ 3G1MA 2Y30A 2CUFA 2NVTJ 3M3YJ 2G0EA 1W0UA 5FLMJ 5IOZA 4I6ZA 3K2AA 3HBLA 3PO3J 4A3FJ 2R5YA 1ZKGA 1ETWA 1WCMJ 3OSFA 1GV5A 5EEAA 2R5YB 2JN6A 1OJLA 1IUFA 1W0TA 3K7AJ 1FIAA 4W1UA 3A02A 3GBGA 2E2IJ 2O9LA 3F0CA 4A3EJ 3HB9A 4B3AA 4D7NA 3UKGA 1RESA 4RBOA 2JA5J 3W6VA 3M4OJ 1NTCA 2ID6A 1ZK8A 2EBIA 5EYRA 2LY9A 2XGDA 3JRIA 2LLKA 3S15J 1TWHJ 5JLXA 1AKHA 1JKRC 3BQYA 2DTZA 5IYDJ 1FTZA 3JRFA 1WI3A 5DTDA 3GTQJ 2H1KA 1AU7A 3O8HA 1U9OA 4XK4A 3HGYA 2XB0X 3LOCA 1RKTA 1B8IB 2HOTA 4ABZA 3OIOA 3LSPA 2JA7J 2ECCA 2L7MP 1WPKA 3QPSA 4JX6A 3Q0WA 3FK6A 2L7FP 1U8BA 2NVQJ 2EZIA 4D5CA 4BBSJ 2R93J 3BTIA 3CCYA 5C4XJ 5C3EJ 2OPTA 5FKNA 1JJ6C 1FIPA 3HM5A 1MBEA 2DMUA 2R5ZA 3S2HJ 1X58A 2YU9J 1PUFB 1MBKA 1IJWC 2IEKA 2EQRA 2QCOA 3S1NJ 1H8AC 1XC5A 2HQ5A 3TP3A 4A3KJ 1U78A 2OF7A 4BY1J 3JRHA 3GTMJ 1Y1VJ 1K61A 4FE4A 1JUSA 5FKOA 5F0FA 1HF0A 1DU6A 4JX5A 1JKPC 2DA1A 1NK3P 1A5JA 3BT9A 2L0KA 3JRDA 4XICA 3OOUA 5IP7J 1U9NA 1VNDA 3A03A 5C44J 4M3DA 3H0GJ 1B72B 2JA8J 5JLWA 1QPIA 1IRZA 1VFCA 1MSEC 2DA7A 4A3BJ 3BTCA 4D7MA 5GP9A 1WH7A 2LFBA 4XRMA 4A3JJ 3JRGA 4A3IJ 2HYJA 4QSHA 5F04A 3BR6A 1H89C 4AUXA 2P81A 2PMZN 4M6VA 2K9SA 2AO9A 4BKXA 2M2EA 2W48A 3C2BA 1LE8B 1S7EA 3ZQIA 5J1RA 2XB5A 1BW6A 1ETYA 2VPRA 1OFCX 5IYCJ 4UUTA 1ETKA 1YRNB 2JK3A 4IHYA 1I50J 3DEWA 1XG1A 2FD5A 3HOUJ 4B4CA 1QRYA 1TWGJ 3E7LA 1JKQC 2HXOA 2VKEA 1ETQA 1RR7A 1X2NA 2DMQA 1RKWA 4B1RA 2RAEA 3IH4A 5M5WJ 3S14J 3L1PA 5C4JJ 2ECBA 1E3OC 1AHDP 2E2JJ 5J1UA 3JRCA 2DA2A 1P7IA 1XS9A 5M3FJ 1OCPA 1LFBA 3CDLA 4DYCA 1FJLA 4BBRJ 5E3LA 5EGOA 4XIDA 2CJJA 2CQQA 1JGGA 3H3VK 3NARA 2DJNA 5J3LA 2M0CA 2GLOA 1HCRA 3IH3A 2ME6A 1MBGA 2LR8A 1WGXA 4MO7A 3QQAA 3HGGA 1AKHB 4XRSA 2R0QC 1OCTC 4S0HB 2CQXA 3GTOJ 2IAIA 2WB1N 4JP0A 2HXIA 5EG0A 3S1RJ 4X6AJ 5K7HA 3SFIA 3PO2J 1TWFJ 2JJ7A 3LSRA 3ZQCA 1TC3C 3I4NJ 2IBDA 3B6CA 3HEFA 4EEFG 2LD5A 1IC8A 1EF4A 4BY7J 1JT6A 2VI6A 4FTHA 1GV2A 3FK7A 2VKVA 3G1OA 3HOZJ 1Z77A 5E3OA 3MKLA 5M3MJ 2R5ZB 3LSGA 4A3LJ 4M3EA 2NOGA 3LSJA 2MSYA 2CRGA 1IDYA 3NAUA 4LOCA 3BR5A 3WHBA 5J1YA 4J19A 1TWAJ 2COBA 5E3MA 1NK2P 3BG9A 4V2FA 2DMTA 2XPUA 2O7OA 5BNGA 4DYQA 3BR2A 1ORKA 1WH5A 1JT0A 5K7ZA 4X1EA 3O8GA 5DS9A 2KDZA 1JJ8C 4QTRA 4A3MJ 4GFBA 5K7FA 4BXXJ 3BTJA 1FEXA 1APLC 3I4MJ 3A01A 1GT0C 9ANTA 1R9TJ 2ZB9A 4IHWA 4M3BA 2VUMJ 4Y52J 1Z0XA 2E2HJ 3RKQA 4M3FA 1LFUP 3B6AA 5M5XJ 2CUEA 2DA4A 5F0HA 3SDGA 3HOYJ 3BR3A 3S16J 1BW5A 1ETVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9H A;  2B63 J;  5F27 A;  3SJM A;  1I3Q J;  1UG2 A;  2GM4 A;  4A69 C;  2NS8 A;  2FQ4 A;  4MIM A;  3VPR A;  3BR0 A;  2MG4 A;  3ZQH A;  1G2H A;  4A93 J;  1IGN A;  2DA3 A;  4UUS A;  2DMP A;  2JA6 J;  5FLV A;  3MN2 A;  2ID3 A;  3JRB A;  2XSD C;  2N8G A;  1MBH A;  1JKO C;  2XRL A;  2EH3 A;  3JR9 A;  4JX4 A;  2DA6 A;  3FIW A;  3ZQL A;  2XGE A;  2Y0S N;  1MBJ A;  1BJZ A;  1F36 A;  1F43 A;  2R7Z J;  2O8K A;  2K9Q A;  2YUS A;  2M34 A;  4A3D J;  3DCF A;  4DZP A;  1BA5 A;  1VF9 A;  1MH3 A;  5IP6 A;  2XPV A;  3GTK J;  2CU7 A;  1JUP A;  3TP0 A;  3BG3 A;  2D5V A;  2DMN A;  1DU0 A;  3OSG A;  5EGO B;  2E19 A;  2Y9Z A;  1ZTR A;  1UHS A;  1ZR2 A;  3Q0V A;  2L7Z A;  4G12 A;  1ZGW A;  2FX0 A;  1SAN A;  2I10 A;  3D1N I;  1O4X A;  1X2M A;  3PM1 A;  4C3J J;  2EZK A;  2XGC A;  4NDL A;  1P7J A;  2MGQ A;  1ZQ3 P;  4DW6 A;  4IEJ A;  5IPA A;  2L9R A;  3HOX J;  2LVS A;  2R92 J;  2LTP A;  2NS7 A;  2HOA A;  4IHX A;  1JTX A;  3JRA A;  2YS9 A;  5F1J A;  5EG0 B;  5IP9 J;  1QVU A;  5EDN A;  2LKX A;  3FKI J;  1MH4 A;  1T56 A;  2K40 A;  1Y1W J;  3IH2 A;  1HDP A;  4C3I J;  4D5F A;  2HOS A;  4L5E A;  4MLO A;  4RDU A;  4FIS A;  5FKL A;  2X9D A;  1D5Y A;  2NVY J;  1SFO J;  3S17 J;  4AYB N;  2Y2Z A;  5EF6 A;  1I6H J;  4V2G A;  4CYC A;  1H88 C;  1B8I A;  1IG7 A;  3TW6 A;  1HDD C;  3S2D J;  4MFE A;  4CYC B;  2M8G X;  1Q1V A;  2KT0 A;  1GUU A;  3MVP A;  5EZH A;  1FTT A;  3HOV J;  1HLV A;  2FJ1 A;  3Q0U A;  4C2M J;  2TCT A;  2NVX J;  1ENH A;  1JTY A;  3HKZ N;  3ZQF A;  4HNV A;  1PUF A;  1POG A;  2LK2 A;  3JRE A;  2QF7 A;  5FKM A;  5EZG A;  5IYB J;  3S1M J;  2DA5 A;  3BR1 A;  5F08 A;  3GTL J;  3BTL A;  2HDD A;  3HDD A;  1ETO A;  2Y9Y A;  2XPW A;  3IV5 A;  2WAQ N;  2X48 A;  2ME0 A;  2MW8 A;  3TW7 A;  2X6O A;  1K83 J;  1QVT A;  3A01 B;  2K9N A;  3RZO J;  3RQI A;  2GBY A;  4Y7N J;  1RPW A;  4W97 A;  1A6I A;  4DZJ A;  4JYK A;  2EZH A;  1B72 A;  4QIW N;  1MNM C;  3BQZ A;  3ZQG A;  5E3N A;  1ITY A;  4AC0 A;  3CMY A;  3BG5 A;  1RET A;  1JUM A;  3RZD J;  2DN0 A;  2JMW A;  4I76 A;  5FJ8 J;  4MFD A;  1IV6 A;  4FCY A;  3GTG J;  3CQZ J;  1ETX A;  4FE7 A;  3QPL A;  3LNQ A;  2E1O A;  4M3G A;  3WHC A;  1UMQ A;  4UUS B;  1TWC J;  4C3H J;  5GPC A;  1LE8 A;  4A3C J;  4IHV A;  1BL0 A;  5M5Y J;  1IDZ A;  2EZL A;  3GTJ J;  2HI3 A;  2AHQ A;  3FIS A;  3Q3S A;  1GVD A;  3TED A;  3S1Q J;  5IOY A;  1VI0 A;  2ELK A;  1CQT A;  2TRT A;  1GDT A;  3GTP J;  2Y31 A;  1YRN A;  2WV1 A;  4DYR A;  5HOD A;  1MBF A;  5GPA A;  5F0C A;  1T33 A;  5FKK A;  2H8R A;  3G1L A;  1ZR4 A;  3ZOB A;  1MSF C;  2LP0 A;  2JWT A;  4XRS G;  1HOM A;  3HOW J;  4A3G J;  3G1M A;  2Y30 A;  2CUF A;  2NVT J;  3M3Y J;  2G0E A;  1W0U A;  5FLM J;  5IOZ A;  4I6Z A;  3K2A A;  3HBL A;  3PO3 J;  4A3F J;  2R5Y A;  1ZKG A;  1ETW A;  1WCM J;  3OSF A;  1GV5 A;  5EEA A;  2R5Y B;  2JN6 A;  1OJL A;  1IUF A;  1W0T A;  3K7A J;  1FIA A;  4W1U A;  3A02 A;  3GBG A;  2E2I J;  2O9L A;  3F0C A;  4A3E J;  3HB9 A;  4B3A A;  4D7N A;  3UKG A;  1RES A;  4RBO A;  2JA5 J;  3W6V A;  3M4O J;  1NTC A;  2ID6 A;  1ZK8 A;  2EBI A;  5EYR A;  2LY9 A;  2XGD A;  3JRI A;  2LLK A;  3S15 J;  1TWH J;  5JLX A;  1AKH A;  1JKR C;  3BQY A;  2DTZ A;  5IYD J;  1FTZ A;  3JRF A;  1WI3 A;  5DTD A;  3GTQ J;  2H1K A;  1AU7 A;  3O8H A;  1U9O A;  4XK4 A;  3HGY A;  2XB0 X;  3LOC A;  1RKT A;  1B8I B;  2HOT A;  4ABZ A;  3OIO A;  3LSP A;  2JA7 J;  2ECC A;  2L7M P;  1WPK A;  3QPS A;  4JX6 A;  3Q0W A;  3FK6 A;  2L7F P;  1U8B A;  2NVQ J;  2EZI A;  4D5C A;  4BBS J;  2R93 J;  3BTI A;  3CCY A;  5C4X J;  5C3E J;  2OPT A;  5FKN A;  1JJ6 C;  1FIP A;  3HM5 A;  1MBE A;  2DMU A;  2R5Z A;  3S2H J;  1X58 A;  2YU9 J;  1PUF B;  1MBK A;  1IJW C;  2IEK A;  2EQR A;  2QCO A;  3S1N J;  1H8A C;  1XC5 A;  2HQ5 A;  3TP3 A;  4A3K J;  1U78 A;  2OF7 A;  4BY1 J;  3JRH A;  3GTM J;  1Y1V J;  1K61 A;  4FE4 A;  1JUS A;  5FKO A;  5F0F A;  1HF0 A;  1DU6 A;  4JX5 A;  1JKP C;  2DA1 A;  1NK3 P;  1A5J A;  3BT9 A;  2L0K A;  3JRD A;  4XIC A;  3OOU A;  5IP7 J;  1U9N A;  1VND A;  3A03 A;  5C44 J;  4M3D A;  3H0G J;  1B72 B;  2JA8 J;  5JLW A;  1QPI A;  1IRZ A;  1VFC A;  1MSE C;  2DA7 A;  4A3B J;  3BTC A;  4D7M A;  5GP9 A;  1WH7 A;  2LFB A;  4XRM A;  4A3J J;  3JRG A;  4A3I J;  2HYJ A;  4QSH A;  5F04 A;  3BR6 A;  1H89 C;  4AUX A;  2P81 A;  2PMZ N;  4M6V A;  2K9S A;  2AO9 A;  4BKX A;  2M2E A;  2W48 A;  3C2B A;  1LE8 B;  1S7E A;  3ZQI A;  5J1R A;  2XB5 A;  1BW6 A;  1ETY A;  2VPR A;  1OFC X;  5IYC J;  4UUT A;  1ETK A;  1YRN B;  2JK3 A;  4IHY A;  1I50 J;  3DEW A;  1XG1 A;  2FD5 A;  3HOU J;  4B4C A;  1QRY A;  1TWG J;  3E7L A;  1JKQ C;  2HXO A;  2VKE A;  1ETQ A;  1RR7 A;  1X2N A;  2DMQ A;  1RKW A;  4B1R A;  2RAE A;  3IH4 A;  5M5W J;  3S14 J;  3L1P A;  5C4J J;  2ECB A;  1E3O C;  1AHD P;  2E2J J;  5J1U A;  3JRC A;  2DA2 A;  1P7I A;  1XS9 A;  5M3F J;  1OCP A;  1LFB A;  3CDL A;  4DYC A;  1FJL A;  4BBR J;  5E3L A;  5EGO A;  4XID A;  2CJJ A;  2CQQ A;  1JGG A;  3H3V K;  3NAR A;  2DJN A;  5J3L A;  2M0C A;  2GLO A;  1HCR A;  3IH3 A;  2ME6 A;  1MBG A;  2LR8 A;  1WGX A;  4MO7 A;  3QQA A;  3HGG A;  1AKH B;  4XRS A;  2R0Q C;  1OCT C;  4S0H B;  2CQX A;  3GTO J;  2IAI A;  2WB1 N;  4JP0 A;  2HXI A;  5EG0 A;  3S1R J;  4X6A J;  5K7H A;  3SFI A;  3PO2 J;  1TWF J;  2JJ7 A;  3LSR A;  3ZQC A;  1TC3 C;  3I4N J;  2IBD A;  3B6C A;  3HEF A;  4EEF G;  2LD5 A;  1IC8 A;  1EF4 A;  4BY7 J;  1JT6 A;  2VI6 A;  4FTH A;  1GV2 A;  3FK7 A;  2VKV A;  3G1O A;  3HOZ J;  1Z77 A;  5E3O A;  3MKL A;  5M3M J;  2R5Z B;  3LSG A;  4A3L J;  4M3E A;  2NOG A;  3LSJ A;  2MSY A;  2CRG A;  1IDY A;  3NAU A;  4LOC A;  3BR5 A;  3WHB A;  5J1Y A;  4J19 A;  1TWA J;  2COB A;  5E3M A;  1NK2 P;  3BG9 A;  4V2F A;  2DMT A;  2XPU A;  2O7O A;  5BNG A;  4DYQ A;  3BR2 A;  1ORK A;  1WH5 A;  1JT0 A;  5K7Z A;  4X1E A;  3O8G A;  5DS9 A;  2KDZ A;  1JJ8 C;  4QTR A;  4A3M J;  4GFB A;  5K7F A;  4BXX J;  3BTJ A;  1FEX A;  1APL C;  3I4M J;  3A01 A;  1GT0 C;  9ANT A;  1R9T J;  2ZB9 A;  4IHW A;  4M3B A;  2VUM J;  4Y52 J;  1Z0X A;  2E2H J;  3RKQ A;  4M3F A;  1LFU P;  3B6A A;  5M5X J;  2CUE A;  2DA4 A;  5F0H A;  3SDG A;  3HOY J;  3BR3 A;  3S16 J;  1BW5 A;  1ETV A; 
#chains in the Genus database with same CATH topology
 5EEG A;  2M9H A;  4EJV A;  1IF1 A;  2HWV A;  4A69 C;  2OZ6 A;  4HLX A;  3VPR A;  1FOW A;  4K2E A;  3ZQH A;  3D0S A;  4MEY F;  2JA6 J;  4BEH B;  2ID3 A;  4GGG A;  2IVM A;  2YU3 A;  2QUF A;  4HW0 A;  2XSD C;  2N8G A;  3HRT A;  5FRN A;  1VQ8 I;  3NEU A;  2XRL A;  2EH3 A;  1HKS A;  4ASN A;  3ZQL A;  3VSK A;  4XSZ F;  5FFZ A;  4RAZ A;  1F43 A;  1ZRD A;  4A0Z A;  3QRF F;  4Q48 A;  2K9Q A;  5FD5 A;  1S8N A;  1XGN A;  1SFK A;  1WJB A;  4MQV A;  4EJW A;  5ED4 A;  2XPV A;  3GTK J;  2CU7 A;  1W7P B;  1JUP A;  2KIQ A;  2R7F A;  3CME I;  1AWC A;  2G9W A;  3V7R A;  1DU0 A;  2E19 A;  4RAG A;  2Y9Z A;  3Q0V A;  2L7Z A;  2CYY A;  1ZAR A;  2LKS A;  2LRE A;  3CUQ B;  3CUO A;  3ZMT A;  1X2M A;  4A6E A;  4XLA A;  4C3J J;  5CVV A;  3IL2 A;  2CGP A;  2DOA A;  2MGQ A;  1ZLK A;  1OYW A;  5L3D A;  4NC8 A;  4KIC A;  5ILS A;  4WX9 A;  1HKQ A;  1ODD A;  4IQJ A;  4I7H A;  4XMY A;  1DPU A;  4PJN A;  1O57 A;  4NHJ A;  5IP9 J;  3ABK H;  3Q9S A;  1PUE E;  3LAP A;  2DK8 A;  3BCA A;  2R7T A;  2VBZ A;  2VQH A;  3IH2 A;  1HDP A;  1SAX A;  2HOS A;  2LYC A;  3CP2 A;  5IT9 Z;  2P5L C;  3R0A A;  4WK8 F;  4Y15 A;  2JRT A;  3B73 A;  2Y2Z A;  1ZGJ A;  3QOP A;  3W6K B;  4CYC A;  1H88 C;  4C30 A;  2PBI A;  3TW6 A;  3S2D J;  3A4C A;  4CYC B;  2KT0 A;  1I6X A;  3K10 A;  4FET A;  3DBR B;  4C2T A;  3MVP A;  2H09 A;  3ELK A;  4LIV A;  1WVR A;  1X1A A;  2KP6 A;  3Q0U A;  1V5F A;  1WFX A;  1JTY A;  3HKZ N;  4UV9 A;  1PUF A;  2COM A;  2VL8 A;  3TOA A;  1KU2 A;  4M72 A;  3S1M J;  2A6T A;  2Y75 A;  5F08 A;  3GTL J;  4ENN A;  2CSO A;  1ETO A;  4EM2 A;  3L2W A;  2OZU A;  5B5E C;  2FQ3 A;  2LSO A;  5HNF A;  4KT5 C;  2R7S A;  3RZO J;  4ZTJ A;  3G71 I;  2K9M A;  4P55 A;  2GBY A;  2ISZ A;  5KAI C;  1TTY A;  4ESB A;  4Y7N J;  4HX8 A;  3I0T A;  3WTV C;  1A6I A;  4MEX F;  4JYK A;  4M73 A;  3K69 A;  4CCN A;  2IP2 A;  1B72 A;  1XMX A;  3ZQG A;  2EPF A;  3BCB A;  5E3N A;  2LY2 A;  5H6R A;  3KLN A;  4AC0 A;  2HNH A;  1JGS A;  1JUM A;  3H35 A;  1D8K A;  2BV6 A;  1XCV A;  2JMW A;  4I76 A;  5ICG A;  5J47 A;  5H20 A;  4E4H A;  1VQK I;  3K4K A;  4MFD A;  2QSF X;  3LSI A;  4LLG F;  1V55 H;  3GTG J;  2DT7 B;  3CQZ J;  1ETX A;  3DTE A;  2LD5 A;  3DU6 A;  2PI0 A;  5LGU A;  4XQF A;  1DGW Y;  3CTA A;  1PVE A;  1LE8 A;  3PJR A;  3OS1 A;  2HKO A;  4EJU A;  3HL2 A;  4O3M A;  1O3S A;  2AHQ A;  1GVD A;  1XMK A;  4LD5 A;  3S1Q J;  5IOY A;  1VI0 A;  3TKY A;  4BGD A;  1CQT A;  3F23 A;  1YRN A;  2ZFW A;  1QPM A;  5DD8 A;  5HOD A;  3ERE D;  2HDC A;  5GPA A;  4J01 A;  3SQN A;  2P0W A;  4OAZ A;  3CMM A;  4CYD A;  4YEJ A;  2DO7 A;  1MSF C;  2K4B A;  2OTL I;  1BOA A;  3UR3 C;  3HOW J;  3N4M A;  4XN3 A;  4PGG A;  3CP8 A;  2CUF A;  2NVT J;  2BGC A;  1Q1H A;  1E0E A;  2JSC A;  4XOR A;  1R5H A;  1G6N A;  1XSX A;  3I59 B;  4NUB A;  5HNH A;  1ACI A;  4EQQ A;  3OR1 C;  3HBL A;  3ECH A;  1ETW A;  1WCM J;  1MZB A;  3P9C A;  5EEA A;  4MGR A;  2EIJ H;  1R71 A;  2JQ7 A;  1LEB A;  3K7A J;  3WTX C;  4Q4Z F;  2QZ8 A;  2BE5 F;  3FXM A;  3ZGK A;  1TW2 A;  1XB4 A;  4E7K A;  3FXU A;  5KK1 A;  2GZW A;  2LRD A;  3SZT A;  4EGY A;  1FLI A;  1X1B A;  2EBI A;  1R1T A;  2XGD A;  1YOV B;  4UUV A;  2F4I A;  2DT5 A;  3HRU A;  1SC7 A;  1RC9 A;  2CQN A;  5FO5 A;  3BQY A;  2HPM A;  2VIX A;  3HUG A;  3H0D A;  4AIH A;  2ELJ A;  4D0P A;  3GTQ J;  3HUG B;  4BE0 A;  1AU7 A;  2KPM A;  1YLF A;  2JUG A;  3PFY A;  1U9O A;  3WTU C;  1ZRE A;  2CW0 F;  3PSI A;  1H9T A;  1PJR A;  2STW A;  3OIO A;  4U7D A;  2L7M P;  3HSF A;  1WPK A;  4ON0 A;  3T5X A;  1J2X A;  2EK5 A;  3FK6 A;  3EDP A;  5CJ9 A;  3PUF A;  5LEJ A;  2BYV E;  1KON A;  4XLE A;  3M1C A;  1BR2 A;  4O6J A;  1YX5 A;  2VC1 A;  3EET A;  3QPH A;  4RLF A;  4LMY A;  5FKN A;  3CCJ I;  1MBE A;  5KAF C;  4NNJ A;  2F5D A;  1X58 A;  1J5Y A;  2M8E A;  2VE8 A;  3ZCO A;  2Z5U A;  1YIO A;  3S93 A;  3CCV I;  4ENK A;  1FP1 D;  3SXY A;  3K2Z A;  1XC5 A;  2HQ5 A;  2W85 A;  3GFM A;  3PNY A;  2P6S A;  3DPU A;  3GTM J;  2V1X A;  3OR2 C;  2XKP A;  2ZSI B;  2FE3 A;  1FMV A;  5FFX A;  1DU6 A;  3JTH A;  1S9H A;  2VJ4 A;  3ZMU A;  4U0Y A;  3BT9 A;  4CSW A;  2X1E A;  3JRD A;  2RQP A;  3JCU C;  3KX2 A;  2R7U A;  2TDX A;  1MMA A;  2RGV A;  1U9N A;  3WTS C;  1WQ2 A;  2E5Z A;  2NOJ B;  5JI6 A;  1S29 A;  2PX9 A;  4XKW A;  5JLW A;  3RCO A;  1ZN2 A;  1MSE C;  2DA7 A;  5FRM A;  1VQN I;  4R8H A;  1MGT A;  4RB0 A;  4II2 A;  5GP9 A;  1WH7 A;  2Z33 A;  2VPL A;  2VQC A;  4L9T A;  3H3Z A;  3M8E A;  3HOS A;  2M45 A;  4ITV A;  4QSH A;  3GZN B;  1RIO H;  2ZXH A;  3KP2 A;  2KFD A;  3K1P A;  4M6V A;  3GLL A;  4BKX A;  2NNN A;  2W48 A;  3KP4 A;  4HOB A;  2D45 A;  1B59 A;  3LL7 A;  5J1R A;  2MBF A;  2K85 A;  4X0G A;  5TRD A;  1E17 A;  2DT6 A;  3U2R A;  3LA3 A;  1H9G A;  2BY0 A;  1BW6 A;  1T95 A;  2VPR A;  3E3V A;  1YE9 A;  2MH2 A;  4UUT A;  3V4G A;  2JK3 A;  1I50 J;  3DEW A;  4A2U A;  5TGT A;  1X1P A;  2X51 A;  4MTD A;  4B4C A;  4DGW B;  1TWG J;  1WJD A;  4ESF A;  2Y0S A;  2DFE A;  2PFB A;  2DMQ A;  1RKW A;  2O03 A;  1IXS B;  2WAE A;  4XON A;  2BHZ A;  2JPB A;  2W82 A;  1E3P A;  3IH4 A;  4RGU A;  3FWE A;  4XBF A;  5C4J J;  2XRN A;  2L3D A;  1Y0U A;  4HYE A;  4RM3 A;  4Y13 A;  1QHH D;  1FYL A;  1P7I A;  4ZYA A;  1T0F A;  3M8J A;  4ZZD A;  3BJA A;  3KP7 A;  5M3F J;  1OCP A;  3RKY A;  2VXD A;  4L9N A;  4BQO A;  4BBR J;  3W6J B;  1YJN I;  4HDV A;  1LUJ B;  1BM9 A;  1JE8 A;  4E7L A;  2F5E A;  2KJC A;  2WA0 A;  2GLO A;  2F2E A;  4G8X A;  3IH3 A;  3SHF A;  1YS7 A;  3PQJ A;  4P1W A;  3TO7 A;  4MO7 A;  2WB1 A;  4JOM A;  4EJT A;  4OIO F;  1LVA A;  2ZNZ A;  3CES A;  2Y69 H;  1WHU A;  2IXS A;  4M74 A;  3GFJ A;  4JP0 A;  1ZRC A;  4CCO A;  2P5V A;  3F9K A;  1R1U A;  2OC6 A;  1BI2 A;  3CUQ C;  3SDB A;  5K7H A;  3SFI A;  5LHH A;  5GTI C;  5JHF A;  2BY2 A;  1VQL I;  3FHZ A;  4AYB A;  2VAS A;  1XTA A;  4KA4 A;  1LEA A;  3QP6 A;  4UVC A;  1LFP A;  3NWS A;  1XD7 A;  4FTH A;  3FK7 A;  3HPH A;  3G1O A;  1O7L A;  3HHH A;  3HOZ J;  1Z77 A;  1RR8 C;  2VT3 A;  3GLX A;  3S3O A;  2DDB A;  2R5Z B;  3LSG A;  3S8P A;  3LST A;  3G2B A;  3LSJ A;  2FA5 A;  4PJM A;  3SEZ A;  2VOO A;  2MSY A;  4NC7 A;  5E20 A;  5ICC A;  5E1Z B;  5J1Y A;  4YFN F;  2COB A;  2G7U A;  1NK2 P;  2QWW A;  4BL0 B;  2ZBK A;  2DMT A;  4MNU A;  5LD2 C;  1OPC A;  1ORK A;  1R5I D;  2R3S A;  5K7Z A;  3VDX A;  5HDK A;  2BW3 A;  3KZZ A;  2P7C B;  5CQG A;  1B9M A;  1QNT A;  1VQM I;  3MKY B;  2KDZ A;  3IUO A;  5E8G A;  3PIO F;  4QTR A;  4A3M J;  2O8X A;  4BXX J;  3BTJ A;  2XIG A;  1LPQ A;  4BHC A;  2W25 A;  3GYH X;  3BY6 A;  3L7W A;  3I55 I;  2ZB9 A;  3KEY A;  4KMF A;  2Z1D A;  1YYV A;  3CDH A;  2STT A;  2L4M A;  2WV0 A;  3EUH C;  3LWF A;  5B1A H;  1I1S A;  1IN8 A;  1LFU P;  1DPR A;  3LSK A;  4BDZ A;  3VYT B;  4ZDP A;  3SDG A;  3S16 J;  2FU4 A;  4JBA A;  2L9N A;  4RM2 A;  5F27 A;  2B63 J;  1UG2 A;  4S05 A;  2DK5 A;  3CZ6 A;  2ZJP F;  2GM4 A;  4AM3 A;  2NS8 A;  3R6S A;  2R7Q A;  2AQE A;  3K70 C;  5TIS C;  3HSR A;  2GAU A;  3TOB A;  2RC4 A;  2P5K A;  1IGN A;  3DKW A;  5DUI A;  2DMP A;  2BVL A;  1OYI A;  5FLV A;  3MN2 A;  3JRB A;  3RPU D;  3S3M A;  3K9T A;  1JKO C;  2AQF A;  5BPD A;  1R1V A;  1OIS A;  1TLH B;  2F6C A;  4BXF A;  2IS4 A;  2HVQ A;  3RYP A;  4KIF A;  5LRS A;  3L9F A;  4MTE A;  4CZZ A;  2Y0S N;  4BU2 A;  3E6D A;  2JT1 A;  4GRI A;  5BPI A;  1F36 A;  1KU7 A;  5DM7 F;  4ZDO A;  1D5V A;  2RRE A;  1JHF A;  3M9A A;  3KP3 A;  3G73 A;  4XL9 A;  1QZY A;  5LEK A;  5IP6 A;  1HXD A;  3QYB A;  3CO6 C;  4HBL A;  3AKZ A;  3IC7 A;  3P5J A;  3BG3 A;  2E34 A;  3RYR A;  4WCG A;  1ZR2 A;  4HZF A;  2EV6 A;  3A0B C;  2QQA A;  3OYJ A;  1F1Z A;  1SAN A;  1O4X A;  3D1N I;  3IP4 B;  4N0B A;  2JVH A;  1O3Q A;  1Z3X A;  3K4L A;  5F6F A;  3PIP F;  3GX4 X;  5BMZ A;  4RS8 A;  2X1D A;  4DW6 A;  3JSP A;  5IPA A;  3FBN B;  3HOX J;  1R49 A;  2O5R A;  1EH8 A;  4D1Q A;  4HNT A;  3T0Y A;  4R1H A;  1PP8 F;  2JVG A;  4GYI A;  4IHX A;  3JRA A;  3I3L A;  1XSV A;  4B44 A;  1KYZ A;  4WF2 A;  1QVU A;  4LG0 B;  2PLY A;  2IA0 A;  2BOL A;  2OA4 A;  2LBF B;  3S2W A;  4D5F A;  4IHT A;  2ESN A;  1V4R A;  3CF5 F;  2VB6 A;  2OQG A;  5FKL A;  2NVY J;  4NC6 A;  4AYB N;  2AXT C;  2HZT A;  2OAZ A;  1P4X A;  2M0M A;  3KYC B;  1I6H J;  4V2G A;  4IF4 A;  4MFE A;  3C2G A;  1Q1V A;  2YR2 A;  3D5L A;  1GUU A;  4F55 A;  4JK1 X;  4OWR B;  3T1B A;  3WGG A;  4HF2 A;  1P4A A;  1IN6 A;  2A5W A;  3HKZ A;  1Z67 A;  3G6E I;  1QHG A;  3RDI A;  1KU9 A;  4BAC A;  3WG7 H;  1CF7 A;  4C2M J;  4HV5 A;  2EFO A;  1YQA A;  3L2R A;  1SMY F;  4XRF A;  2XGX A;  1ENH A;  4FX0 A;  4L9J A;  3SYT A;  4ZC3 A;  4BNC A;  2B7E A;  2X6X A;  4PSX A;  3ZQF A;  4HNV A;  2LK2 A;  3JRE A;  3FXL A;  3HSE A;  4I0B A;  2E7X A;  2QF7 A;  4P9F A;  2V26 A;  4B8X A;  2VC0 A;  4BHP A;  4KIS A;  2HDD A;  3HDD A;  2XAJ A;  2MW8 A;  3TW7 A;  1QVT A;  3A01 B;  3ECO A;  2K9N A;  4OIR F;  3RQI A;  2VJI A;  5K1Y A;  3IKV A;  3MWM A;  4U88 A;  2L4A A;  5AIQ A;  2VKH A;  1IRG A;  3GFL A;  4DZJ A;  2CG4 A;  3M7G A;  1WKM A;  4B47 A;  1Z3Y A;  4M6Y A;  1HA8 A;  1R23 A;  2L7K A;  1ITY A;  2O3F A;  1BJA A;  3RZD J;  2DN0 A;  4GO1 A;  2VXZ A;  2LNB A;  4OIQ F;  3GUD A;  2MA3 A;  4BUP A;  2HTS A;  1H0M A;  3ASO H;  3V42 A;  1YG2 A;  3N97 A;  3ABU A;  3R0J A;  1CGP A;  4M3G A;  5BS6 A;  1FOY A;  1G3Y A;  4XR6 A;  5DCM A;  4C3H J;  1MIJ A;  3HTS B;  1IN4 A;  4PJL A;  4IHV A;  2FNP A;  4A3C J;  1OYY A;  3AG3 H;  2EZL A;  2W7N A;  3FF5 A;  1R22 A;  2Q2E A;  3U9G A;  3GZ6 A;  3FIS A;  1S72 I;  5AIP A;  4NQW A;  3KE2 A;  1GDT A;  4NQW B;  3GTP J;  3CD6 I;  4UXN A;  4DYR A;  3ZN1 A;  1LVK A;  2PJR A;  3H3U A;  3ZOB A;  2DJI A;  5FRO A;  1K78 A;  4J00 A;  1KYW A;  1WWX A;  1K78 B;  4A3G J;  3L2U A;  2IGO A;  2X6Y A;  3M3Y J;  1WJA A;  2KKO A;  3TMO A;  2HU9 A;  4LJZ F;  1VTN C;  3U21 A;  2JA2 A;  4U0V A;  1GVJ A;  4EV0 A;  1YIT I;  2JSP A;  1P4W A;  2PEX A;  5ERI A;  2R5Y A;  1D0Y A;  1RUO A;  2DOD A;  2R5Y B;  2JN6 A;  1OJL A;  1W0T A;  2HKX A;  2Z2S B;  3GBG A;  2E2I J;  2IT0 A;  3F6V A;  4KJZ A;  2M4G A;  2BEO A;  1C0W A;  4RBO A;  2JA5 J;  1Z7U A;  3REO A;  2QBY A;  1UEL B;  3FDY A;  3MEX A;  5EYR A;  2LY9 A;  2A68 F;  3GZ5 A;  3JRI A;  2M7A A;  4N9H A;  1AKH A;  3LFK A;  1L0O C;  2DTZ A;  5IYD J;  3DLL F;  1WI3 A;  1IRF A;  2A6H F;  4KN7 X;  3A1Y A;  1MKM A;  3BG6 A;  1KQ9 A;  5DTD A;  4AIJ A;  3MFK A;  4XK4 A;  3ZN0 A;  1R5G A;  3LOC A;  3GW2 A;  4ABZ A;  1M1E B;  2ECC A;  4JX6 A;  3QPS A;  1P6R A;  3E5Q A;  5CLS A;  2X0L A;  2ZME A;  3DWL E;  3BPX A;  3OS0 A;  2NVQ J;  4MQ9 F;  1KZH A;  4II3 A;  1BC8 C;  3B02 A;  2R93 J;  2LH9 A;  1LQ1 A;  2L2O A;  2WAD A;  5C3E J;  3ZQQ A;  1FIP A;  2DMU A;  3S2H J;  3RTR A;  3T8R A;  5DCF A;  1PUF B;  1MBK A;  1IJW C;  1T6S A;  2EQR A;  2K86 A;  2GXB A;  5LHI A;  2F5V A;  3V8L A;  4A3K J;  1OLT A;  2FOK A;  4FX4 A;  1S7A A;  1OR7 A;  5EJC A;  1Y1V J;  3LQR A;  4DOZ A;  2P7V B;  2DW4 A;  1JUS A;  1HW1 A;  2M30 A;  3KP6 A;  4JX5 A;  3OYF A;  2DA1 A;  1Y0N A;  1A5J A;  2DU9 A;  4RAY A;  4IX7 A;  3J7A O;  3OIP A;  3W2V A;  3OYN A;  1MMD A;  1XSD A;  1DDN A;  4G7Z F;  2E1N A;  2LMD A;  5C44 J;  1B72 B;  1J7K A;  3FM3 A;  1R4N B;  5D6E A;  4FHT A;  1FYM A;  1J0R A;  2VQG A;  2JA8 J;  1MDM A;  1IUY A;  1QPI A;  1VFC A;  4A3B J;  3P9K A;  2QA4 I;  4U87 A;  3VYS B;  3PFI A;  1FNN A;  3JRG A;  2HR3 A;  3J7A Y;  1UJ8 A;  2XF6 A;  1YW9 A;  3DKY A;  4UVA A;  1T08 B;  5F04 A;  1YTY A;  1L3L A;  2QSG X;  2AXL A;  1H89 C;  1SEU A;  3E6M A;  5H6Q A;  2P81 A;  3CO7 C;  4Z2Y A;  1MJB A;  2K9S A;  2AO9 A;  2RDP A;  1G59 A;  1EV7 A;  1D1B A;  3F72 A;  1LE8 B;  3OYA A;  1E2X A;  1UB9 A;  2RVC A;  5DV5 A;  3L2V A;  1X1D A;  4Q5S F;  2XB5 A;  2HQR A;  3TBI A;  4AID A;  3HOT A;  2VLA A;  1FZP B;  1EJ9 A;  3H9Q A;  1OFC X;  5IYC J;  2V1U A;  1YRN B;  2DAO A;  2CMP A;  3A2K A;  5JFR A;  3VEP A;  5HOO A;  2OJE D;  5FD6 A;  1TBX A;  3E7L A;  2HXO A;  1O3T A;  3PQK A;  1X19 A;  3DV8 A;  1FWZ A;  3E1S A;  2IPQ X;  4S04 A;  2RAE A;  1U5T A;  5KNL A;  5M5W J;  1E3O C;  1U5T B;  5A2Q K;  3I54 A;  1AHD P;  2PJP A;  3EUA A;  5J1U A;  5B66 C;  1IN7 A;  2V1D A;  1GXQ A;  1UAA A;  4L0Z B;  4YEL A;  2D1H A;  4EGZ A;  2NYX A;  2H94 A;  1XS9 A;  4E6K G;  5L3F A;  2DOE A;  2OU2 A;  4KNY A;  3V8K A;  2MFZ A;  1W5T A;  5EGO A;  2EWN A;  1YIJ I;  4G6Q A;  3LMM A;  1W36 C;  2CJJ A;  1BIA A;  2CQQ A;  3HHG A;  5BQT A;  3NAR A;  3WU2 C;  2M0C A;  3VOE A;  2F4M B;  5LBQ A;  2KL4 A;  2LR8 A;  1F9N A;  1WGX A;  4YG2 F;  3PNT A;  2CFX A;  2H1L A;  3O2P E;  3ZMS A;  4U7B A;  4KFC A;  1U8R A;  4ZH4 F;  2R0Q C;  2K27 A;  1R6R A;  2QYO A;  4S0H B;  1MMG A;  4OOI A;  1TQM A;  2Z9O A;  2LKP A;  2QQ9 A;  2WTE A;  4QPO A;  5EG0 A;  2BBY A;  1MJA A;  3TO6 A;  5K5O A;  3ABL H;  1SFU A;  4CH7 A;  3PO2 J;  2JJ7 A;  3ZQC A;  1S6L A;  3CC4 I;  1FX7 A;  1EA3 A;  1JXS A;  4Z6Y A;  1FBS A;  4KMU X;  1UCR A;  2OCE A;  3HEF A;  3FMS A;  3TGN A;  1J09 A;  1P2F A;  2VI6 A;  2CFO A;  3PNV A;  2VKV A;  4HG2 A;  5K5Q A;  4IPA A;  2VT2 A;  1J59 A;  2FBH A;  1B9N A;  3BJ6 A;  2L54 A;  4PSW A;  5E3O A;  1YI2 I;  4OMY A;  2FEZ A;  3VOD A;  3HG9 A;  1U2W A;  3I53 A;  3K6G A;  1Y6I A;  4RGS A;  4KDP A;  2HVS A;  1BN5 A;  1IDY A;  4RMN A;  2A61 A;  3OYG A;  3NAU A;  4XM3 A;  3BR5 A;  4J19 A;  3BG9 A;  4V2F A;  4G7O F;  2EIN H;  2NAZ A;  3BR2 A;  2MC4 A;  1V5E A;  4X1E A;  3AL0 C;  4PDK A;  4F91 B;  2D2W A;  2BY3 A;  2EA4 A;  5KCM A;  2WAQ A;  1TP4 A;  3O8G A;  1DP3 A;  3IAM 2;  4LFU A;  3OYK A;  4GFB A;  1FOX A;  5JHU A;  4DJA A;  1APL C;  2LDU A;  4N4N B;  2DOF A;  4XLC A;  4AWX B;  3CJR B;  1FY7 A;  1LDK B;  4LG3 A;  1R9T J;  5HLH A;  3GFI A;  2V9K A;  4IHW A;  3F8C A;  1NG7 A;  1IW7 F;  2K4J A;  1RUN A;  3K4J A;  1Z0X A;  3QU6 A;  1XGS A;  3FMR A;  2CUE A;  2DA4 A;  3EPZ A;  4YFX F;  3HOY J;  1IXR C;  2DTR A;  2EIM H;  2EJR A;  2XSJ C;  1Z7L A;  5D5V B;  4Y33 A;  1ONV A;  1W5S A;  2CO5 A;  2FRH A;  1LJ9 A;  3FM5 A;  4MIM A;  3BR0 A;  4E7I A;  2MG4 A;  2LG4 A;  3AG4 H;  3NRV A;  3CCL I;  4AIK A;  4A93 J;  5D4R A;  2QM3 A;  3OYD A;  4UUS A;  4YIR X;  2QKL B;  2KMU A;  1UFM A;  4BE2 A;  3EUK L;  3GWZ A;  4R79 A;  2X6W A;  2QQ8 A;  2OCC H;  3LA2 A;  2KJB A;  2IA1 A;  2MLK A;  4IQ4 A;  4A0X A;  2CH0 A;  2ZJQ F;  1LB2 A;  2RNG A;  5CPR B;  4F3Q A;  4JX4 A;  2L01 A;  2DA6 A;  3FIW A;  4IZZ A;  4IRG A;  4I01 A;  1EH6 A;  2XGE A;  4I0A A;  1MBJ A;  2K3P A;  2MAB A;  4XLF A;  5DM6 F;  2QEX I;  1MMN A;  3CDI A;  1YHQ I;  2R7Z J;  3BRO A;  4DIQ A;  2YUS A;  2M34 A;  3WE2 A;  5IY5 H;  4XNF A;  4DZP A;  1Y39 A;  1U3E M;  4GDF A;  3Q9V A;  5E8I A;  1VF9 A;  3QYE A;  3K0L A;  2L5Q A;  3TP0 A;  3OYM A;  4M71 A;  1SD6 A;  2Z99 A;  3OSG A;  2UV1 A;  4BQA A;  3DBL B;  2GQQ A;  1F4K A;  1S7O A;  1ZTR A;  2KRF A;  2M1B A;  4G12 A;  4L18 B;  2FX0 A;  2R7W A;  3VYR B;  3RJP A;  4PFP A;  2Q8K A;  3HTU A;  4NDL A;  1TZL A;  2F4O B;  4HNU A;  2XKO A;  2HOE A;  4P5O A;  1G3S A;  2XRO A;  2LVS A;  2R92 J;  2LTP A;  2NS7 A;  2CV2 A;  3L2Q A;  1TNT A;  2HOA A;  4CCJ A;  1D3Y A;  1Y56 A;  2YS9 A;  3C2H A;  3MCZ A;  1YJ9 I;  1MMS A;  2W84 A;  2V79 A;  3WTW C;  1N78 A;  2IW5 A;  5J4V A;  3FKI J;  2UZK A;  3RPQ A;  1BOB A;  3FKJ A;  4C3I J;  1J75 A;  1R00 A;  4PK4 A;  5DYM A;  4MLO A;  1FMW A;  4FIS A;  4RDU A;  2B9S A;  1OCZ H;  3WE3 A;  1SFO J;  1G8X A;  1ZHF A;  5EF6 A;  2IA2 A;  1B8I A;  2B0L A;  3MKZ A;  1IG7 A;  2QGU A;  1HDD C;  3EQL F;  2UWM A;  2M8G X;  4DNC A;  1R7J A;  4CO8 A;  4YRV A;  4ETS A;  3CLO A;  5A2Q Z;  4E7H A;  3E0J B;  5EZH A;  4I98 B;  3E6C C;  3O3K A;  2MH9 A;  4WWC A;  1FTT A;  3HOV J;  2F48 A;  1HLV A;  2FJ1 A;  1ON1 A;  1ON2 A;  1NH3 A;  4G6T B;  1LNW A;  1O3R A;  2Y48 A;  4LLN A;  2DDA A;  3IRQ A;  1POG A;  2WWY A;  2BW3 B;  3K4B A;  4ZYH A;  4ZYD A;  4OIN F;  1WSU A;  2ETH A;  2CV1 A;  2DA5 A;  3BR1 A;  2P8T A;  3RKW A;  2A6E F;  2XAS A;  3MD2 A;  2Y9Y A;  2CS3 A;  3IV5 A;  1SVL A;  2WAQ N;  2ME0 A;  3G4S I;  1D1C A;  1K83 J;  4Y17 A;  3EYI A;  1V3F A;  2HYG D;  1MD0 A;  1K6Y A;  2W57 A;  5LRR A;  3FMQ A;  2R7O A;  4W97 A;  3U1D A;  3VB2 A;  1IXC A;  4CDG A;  4ZJZ A;  2E35 A;  2EZH A;  4QIW N;  5HS7 A;  3BQZ A;  1MNM C;  4YII A;  2H6C A;  3BG5 A;  1WJ5 A;  4HF1 A;  5JVG F;  2GIV A;  5FJ8 J;  4MHG A;  4FCY A;  3C1D A;  3QPL A;  3LNQ A;  1D0X A;  2E1O A;  2F5F A;  1I1G A;  2CW8 A;  1UMQ A;  1VQ5 I;  1SFX A;  3SZP A;  1TWC J;  1EF4 A;  5GPC A;  4EAT A;  1SFE A;  3LA7 A;  2VJJ A;  3I58 A;  1YS6 A;  2P4W A;  1MNE A;  1Z1D A;  2FMY A;  1OMI A;  5JR3 A;  5M5Y J;  2LOO A;  3KEQ A;  1IZ1 A;  2HI3 A;  1J9I A;  1QGP A;  4B48 A;  3Q3S A;  1N25 A;  1XN7 A;  1D1A A;  2W00 A;  1UHW A;  3F21 A;  1P9Q C;  1SVM A;  1MBF A;  4DBQ A;  2WAF A;  5F0C A;  1T33 A;  3BLY A;  1HST A;  2H8R A;  1OQY A;  3KYL A;  4LLL A;  1WRJ A;  2HFH A;  2LP0 A;  1DP7 P;  3U1K A;  4RB3 C;  2HEO A;  2ZJR F;  5E17 F;  3CCU I;  4CXF A;  3ABM H;  4GXO A;  1PDN C;  5GAH J;  3G1M A;  2D1V A;  1D8J A;  2L02 A;  3R4K A;  3HRS A;  4HA8 A;  4CZC A;  5IOZ A;  5F64 A;  4ENJ A;  3FX3 A;  1G4D A;  4G7H F;  4A3F J;  1ZKG A;  3OSF A;  1WJE A;  1GV5 A;  1IUF A;  1X1C A;  1OCO H;  1Z6T A;  1FIA A;  3S32 A;  3A02 A;  3H92 A;  3IWF A;  3DPT A;  4A3E J;  4D7N A;  2VON A;  4LK1 F;  1SD5 A;  3M4O J;  3H1C A;  1X3U A;  4B3X A;  2ID6 A;  3BC8 A;  4BYY A;  1K79 A;  2DPU A;  2NVU B;  2OV7 A;  3GXO A;  2V6C A;  2BVM A;  2LLK A;  3S15 J;  1BR1 A;  3OYI A;  1TWH J;  5JLX A;  3IHU A;  3WGI A;  3CC7 I;  4Y4R A;  1ZRF A;  1JKR C;  3TL4 X;  3T8T A;  3JRF A;  2NRA C;  2H1K A;  2QQB A;  3O8H A;  2R7R A;  5J6X A;  2X1C A;  3HGY A;  4LIU A;  4WXH A;  1P92 A;  3OWT A;  5AON A;  2XB0 X;  1Y8Q B;  3KPH A;  1F5T A;  3CCR I;  2JA7 J;  4UV8 A;  2VN2 A;  3CCS I;  4QPQ A;  5HS9 A;  2UXN A;  3ML6 A;  3Q0W A;  1K4S A;  2IJL A;  3L09 A;  2EZI A;  3ZQ7 A;  2P6T A;  3FXQ A;  3O6B B;  1W4M A;  1NG6 A;  1UST A;  1CF7 B;  3VWB A;  2AS5 F;  2OPT A;  3QWL A;  3F8M A;  3MKW B;  2Z3Y A;  5DD4 A;  3HM5 A;  2YU9 J;  2YPR A;  4RB1 A;  5BOX A;  3J81 Z;  1U78 A;  5CVJ A;  3K4M A;  3DLA A;  5J4Y A;  4PCQ A;  1B6A A;  4BAY A;  4BY1 J;  3NQO A;  4IHS A;  1XDS A;  2V6E A;  3H36 A;  3OMY A;  2BY1 A;  1G3T A;  3HRM A;  5FKO A;  1HBX G;  5E18 F;  1FT9 A;  1JHH A;  2DLL A;  2V7F A;  2XDV A;  4HQM A;  4IOA F;  3GME A;  3OOU A;  2C6Y A;  1QO0 D;  2A3S A;  1FSE A;  3RIR A;  3E97 A;  3ULQ B;  5F1R A;  2YX4 A;  1OCR H;  4M3D A;  3H0G J;  4LK0 F;  1N75 A;  2ZCW A;  3DBH B;  4BXU A;  2IGM A;  1FBU A;  1WI9 A;  2GIZ A;  3BTC A;  4D7M A;  2Q1Z B;  5L3E A;  2MD5 A;  1SMT A;  3V7S A;  5HDN A;  1BC7 C;  4A3J J;  4A3I J;  2KIM A;  4OU0 A;  2ADU A;  5B1B H;  2OD5 A;  1B1B A;  1T2K A;  2EV5 A;  3BR6 A;  4PGH A;  5LGT A;  4AUX A;  5DCM B;  2ICW G;  3BDD A;  4CIC A;  2M2E A;  3C2B A;  5ILU A;  1S7E A;  4F92 B;  4HX4 A;  2Q2E B;  3WTZ A;  1FYK A;  2XF5 A;  2RN7 A;  1FBQ A;  5FB2 A;  1ETY A;  2UUZ A;  3AG1 H;  4YFK F;  2KZG A;  1W7P D;  4XLP F;  1ETK A;  1Z21 A;  3VSL A;  4IHY A;  1ZAO A;  4UVB A;  4BEH A;  2FD5 A;  2VE9 A;  3HOU J;  2PJR B;  1QRY A;  1W1W E;  4KUM A;  1DGR M;  1JKQ C;  1HW5 A;  2VKE A;  2GXG A;  1E3H A;  4AU7 A;  4BHB A;  1X2N A;  4ZZL A;  4B1R A;  3F22 A;  3TDZ C;  3L1P A;  2L9V A;  1KU3 A;  2QSH X;  2LY1 A;  2E2J J;  3WOD F;  1FSH A;  1A6Q A;  2EV0 A;  1T98 A;  1HSJ A;  2V9V A;  3D5S C;  3CDL A;  3TQN A;  1FJL A;  1W7P A;  2VQL A;  5E3L A;  3DPL C;  2DPD A;  3GVA A;  2OQR A;  3M07 A;  5GAE J;  4XKB A;  4XID A;  3ZPL A;  1JGG A;  1Z6R A;  2LF7 A;  3H3V K;  1GLN A;  2NS0 A;  1AA7 A;  3CUQ A;  1ERD A;  2DFH A;  1UG0 A;  1MBG A;  1T0F C;  2QBY B;  3I5U A;  1A04 A;  4GCV A;  3QQA A;  3ROU A;  4EM1 A;  1BI0 A;  1KGS A;  1XX5 A;  2K5C A;  3HGG A;  1AKH B;  3QOE A;  3BZK A;  4XRS A;  1OCT C;  5CVR A;  5LFA A;  4HEA 2;  2CQX A;  2IAI A;  3WTT C;  1T38 A;  5CQE A;  3OYE A;  2HXI A;  3E5U A;  4KT6 A;  3S1R J;  2FBK A;  2OBP A;  1QA6 A;  3BZ6 A;  2DFI A;  4CCL A;  3ZMV A;  1KQ0 A;  1Z05 A;  2BXY A;  2M5W A;  2R7V A;  4C2U A;  1TC3 C;  4IO9 F;  1WZ2 A;  5GTH C;  3C7J A;  1BBY A;  3GF2 A;  5L3C A;  3TDU C;  1Z91 A;  2ZME B;  4BY7 J;  1JT6 A;  2ELH A;  2QKM B;  5D6F A;  1GV2 A;  2PMU A;  4A6D A;  2E1M B;  1SD4 A;  4AVP A;  2ZC2 A;  4XKV A;  2HTJ A;  2VOP A;  4PFO A;  1FPQ A;  3WG9 A;  4I02 A;  5HDG A;  5M3M J;  3ERM A;  1R36 A;  4A3L J;  4LB6 B;  2E71 A;  2V1N A;  2NOG A;  4HV6 A;  1YJW I;  1UHM A;  5DEQ A;  2PG4 A;  2CRG A;  4YIF A;  3COA C;  1ZG5 A;  3JSO A;  3K70 D;  4LOC A;  3RSN A;  3WHB A;  2DQL A;  1TWA J;  5E3M A;  3KP5 A;  5LGN A;  4IOC F;  2KRH A;  2XPU A;  2O7O A;  5BNG A;  4DYQ A;  2GOM A;  1ZG3 A;  1WH5 A;  1KA8 A;  1N77 A;  1JT0 A;  4BE1 A;  2OUM A;  3EUH A;  3LSH A;  1XPX A;  2QLZ A;  4RGR A;  4TV7 A;  4M9Z A;  5LLQ A;  2KRC A;  1MJ9 A;  1G3W A;  3OIQ A;  3FXO A;  2JZY A;  3OS2 A;  5L3G A;  5K7F A;  3FHN A;  1FEX A;  2O61 A;  2EFP A;  1I27 A;  3F6O A;  1GT0 C;  1MDM B;  9ANT A;  2K9L A;  4M3B A;  5D5W B;  3WU1 B;  2VUM J;  2E36 A;  2DI3 A;  1NHA A;  3P7N A;  2MYS A;  1FP2 A;  5D4S A;  2J5P A;  2M3A A;  3M1E A;  4M3F A;  2A5Y B;  3B6A A;  1RRJ A;  1IO2 A;  5F0H A;  1S3J A;  1XMA A;  4EM0 B;  2XV4 S;  4XOT A;  2E60 A;  5D5U B;  3BR3 A;  3QP5 A;  1T39 A;  1X4O A;  1ETV A;  4F93 B;  4LGW A;  2A69 F;  3H5R A;  3SJM A;  1I3Q J;  2CWE A;  1X4P A;  1REP C;  2FQ4 A;  2KIU A;  3DU5 A;  4HRI A;  3HZJ A;  5KVR A;  4DBR A;  3PUB A;  1ZG1 A;  4HX7 A;  1G2H A;  1W5C C;  3BWG A;  5FGM A;  4E7S A;  3JAM Z;  2X4H A;  1QZZ A;  2DA3 A;  3MAJ A;  4FT8 A;  2IRF G;  3WU0 A;  1XDU A;  3FZV A;  5CVU A;  1ZYR F;  3OL4 A;  3K1M A;  3J80 Z;  5L3B A;  4H0E A;  1GXP A;  1MBH A;  2CQ7 A;  4IRH A;  3JR9 A;  2KLO A;  2QVO A;  4HQE A;  4BH9 A;  4L9V A;  4N4O B;  1BJZ A;  1R4M B;  2WY7 Q;  4IXA A;  3L2C A;  2O8K A;  4A3D J;  3DCF A;  2FNA A;  2VBY A;  2A07 F;  1HC8 A;  1BA5 A;  1MH3 A;  4KIT B;  3AFH A;  3ONQ A;  2BHY A;  5J8C A;  2D5V A;  1TT0 A;  2DMN A;  5EGO B;  2ZO4 A;  3I59 A;  1UHS A;  3KET A;  1ZGW A;  3PL8 A;  1VQ6 I;  2I10 A;  4GYG A;  3PM1 A;  4H4K C;  2EZK A;  2DYR H;  2XGC A;  3W2W A;  2IS6 A;  3F3X A;  1P7J A;  5D8L B;  4LB5 A;  3MZ8 A;  2ZXJ A;  1YO5 C;  2PMH A;  1ZQ3 P;  4IEJ A;  2L9R A;  2W1O A;  1ZGA A;  2CV0 A;  1JTX A;  4HF0 A;  2CUZ A;  3E5X A;  5F1J A;  5EG0 B;  1B4A A;  5CKT A;  4ZTF A;  2WC2 A;  5EDN A;  2LKX A;  1MH4 A;  1S5L C;  1T56 A;  2K40 A;  1QQI A;  4A5M A;  2IS2 A;  1Y1W J;  1BR4 A;  1I39 A;  4BJT A;  4RB2 C;  4L5E A;  2HGC A;  2ZSH B;  4AVZ A;  3X2Q H;  1PYV A;  4IVN A;  1X3Z B;  1R58 A;  4F7Z A;  2X9D A;  4P9U A;  5CYV A;  1D5Y A;  2ESH A;  3S17 J;  3RQ4 A;  2NNY A;  2EA2 A;  4IJA A;  1TNS A;  2I8D A;  4U0W A;  1MW7 A;  3SEQ A;  2ZXW H;  4UHT A;  4Q47 A;  4B09 A;  4A0Y A;  4BDY A;  2A05 A;  4HAM A;  4HPQ A;  2MD0 A;  4M9X A;  5HS8 A;  1QU3 A;  1LDJ A;  4RLQ A;  1KQ8 A;  1EKE A;  2FF4 A;  2IGK A;  2TCT A;  3CJN A;  2NVX J;  1VQP I;  4G9Y A;  4BJ6 C;  5FKM A;  1A36 A;  5EZG A;  5IYB J;  2VJ5 A;  2XUB A;  3BTL A;  2XPW A;  4UB8 C;  2EFW A;  2X48 A;  1RZ4 A;  2KQR A;  3RI4 A;  4RA2 A;  3CMA I;  3F8F A;  2X6O A;  5K5R A;  2IGN A;  3HXL A;  3BOQ A;  3KLO A;  1RI7 A;  1RPW A;  1ZEL A;  2CW7 A;  1SD7 A;  3BP8 A;  3QYF A;  4L5J A;  4UY8 I;  4HDU A;  4PJJ A;  1I5Z A;  1X3W B;  4ZDL A;  3JW4 A;  1K7A A;  1QBJ A;  1VQ7 I;  2ISY A;  1IV8 A;  3ASN H;  3DF8 A;  3CMY A;  3OOP A;  1T8I A;  1RET A;  5ILV A;  2EIL H;  2HPI A;  3I64 A;  3FXK A;  4M6X A;  2M87 A;  1BI1 A;  3K1N A;  1IV6 A;  2PMZ A;  3LFU A;  2XVC A;  2MLG A;  4FE7 A;  1ULY A;  4ZYG A;  5DUK A;  1HQC A;  3WHC A;  5HLG A;  4O5V A;  2KZV A;  1SVO A;  3QU3 A;  4UUS B;  3V7C A;  2KIS A;  2GXA A;  1BL0 A;  1IDZ A;  1PP7 U;  3GTJ J;  3P9I A;  2FUG 2;  3TED A;  2LF8 A;  5DDG A;  2JUC A;  2ELK A;  1LDD A;  2YSR A;  2TRT A;  2Y31 A;  3DEE A;  4I09 A;  5KHD A;  2WV1 A;  3K4N A;  1RNL A;  4G94 A;  2HQN A;  5FKK A;  1V5G A;  4OMZ A;  1DQU A;  2EFQ A;  4IRI A;  2EIK H;  3G1L A;  4XSX F;  4EVI A;  1ZR4 A;  4M9S A;  2DYS H;  4Y3O A;  2JWT A;  3HIF A;  3PSF A;  3W3C A;  3DKX A;  3K4C A;  4BJ5 C;  2KIF A;  4XRS G;  1HOM A;  3DEU A;  1TT5 B;  2W4S A;  2Y30 A;  3MQ0 A;  3LQQ A;  2G0E A;  1W0U A;  2HYF A;  1STZ A;  5HVQ C;  2CUJ A;  2R7X A;  2H8W A;  3J81 K;  2Y0M A;  5FLM J;  2PN6 A;  4I6Z A;  3K2A A;  4LIT A;  3ZRG A;  4OIP F;  3PO3 J;  3KIO A;  2VOD A;  3R61 A;  3SFZ A;  4C9Y A;  3GCM A;  3LAJ A;  2ZXI A;  5E1X A;  3S3N A;  3HJE A;  3BG7 A;  4PZJ A;  4W1U A;  2O9L A;  3F0C A;  2ZJ2 A;  4FQG A;  4D9J A;  2RNJ A;  3HB9 A;  2GOX B;  4ANJ A;  5FLX K;  4B3A A;  5J40 A;  3VYU B;  3UKG A;  3DFG A;  1RES A;  3CCQ I;  2LC2 A;  3W6V A;  2YX7 A;  4CA0 A;  1NTC A;  2GA2 A;  1ZK8 A;  3H5A A;  3SZG A;  2K7L A;  3FXJ A;  2O0Y A;  1VQ4 I;  1ZH5 A;  1FTZ A;  1BI3 A;  3FBI B;  1O7F A;  1IAW A;  4B43 A;  2FXA A;  4NBQ A;  1A35 A;  3H9J A;  4BQQ A;  1V54 H;  3HPG A;  5GAD J;  3F8N A;  1B8I B;  1RKT A;  2HOT A;  3ABT A;  2IS1 A;  3LSP A;  2XAU A;  3OYH A;  2RV8 A;  2L7F P;  2M7B A;  1VQO I;  1U8B A;  1K4T A;  3D5R C;  5HLI A;  3KCC A;  4D5C A;  4UB6 C;  4BBS J;  3DTI A;  3OY9 A;  3BTI A;  1OKR A;  3CCY A;  5C4X J;  3VFZ A;  1YFH A;  1JJ6 C;  3KZY A;  2R5Z A;  3LSM A;  5ICE A;  3JTG A;  2IEK A;  4WXD A;  2QCO A;  2FSW A;  3S1N J;  2R4G A;  1H8A C;  4XKC A;  3TP3 A;  3I56 I;  3OV8 A;  4E7Z A;  2OF7 A;  3OL3 A;  1I3A A;  3JRH A;  2ZME C;  3MZY A;  2UXX A;  3J7Y J;  2FOW A;  1K61 A;  4FE4 A;  2E1M C;  3IKT A;  2RQQ A;  2FBI A;  2G7H A;  5F0F A;  4ZYE A;  1HF0 A;  4N9I A;  1JKP C;  1NK3 P;  5CVI A;  1K6O A;  2KDO A;  2L0K A;  2HDW A;  4HST A;  1IN5 A;  6PAX A;  3W2A A;  4XIC A;  3KFW X;  3M8F A;  2GWR A;  4RGX A;  5IP7 J;  3MZH A;  1VND A;  3EYY A;  2XAQ A;  3A03 A;  3DXJ F;  5TJJ A;  4KIB A;  4WXC A;  1OR7 C;  2I5U A;  4L5I A;  3QAH A;  3A0H C;  2ZFU A;  1IRZ A;  1XGO A;  1TL8 A;  2DXI A;  5J8F A;  1YW8 A;  2LFB A;  3ZP5 A;  3BZC A;  4XRM A;  2J5O A;  3HC7 A;  3QPT A;  4RAF A;  4IKF A;  2CQK A;  4EJO A;  2HYJ A;  3DQV C;  4BQN A;  1Z9C A;  4F52 A;  4PUS A;  1YW7 A;  2K02 A;  2PMZ N;  2V9P A;  3ZR8 X;  1W36 D;  1FOK A;  3ZQI A;  4XOP A;  3I71 A;  2XF7 A;  3ISP A;  3G3Z A;  1EH7 A;  1ZLJ A;  5D5X B;  3J7Z I;  3E6B A;  1VQ9 I;  4HLY A;  2NXN B;  4CCM A;  1HW2 A;  2X85 A;  1USS A;  4XN0 A;  3ZMZ A;  3HYI A;  4G6D A;  2DFF A;  3KZI C;  3RKX A;  1XG1 A;  3CC2 I;  5IT9 K;  3I9V 2;  3UNG C;  2Z16 A;  2E1C A;  2DCE A;  2ZNY A;  3MMY B;  2VKD A;  2DQR A;  1SAU A;  4CGZ A;  2GA1 A;  3AG2 H;  1ETQ A;  3DP7 A;  2M4K A;  1RR7 A;  5E1W A;  3N05 A;  4UNO A;  2HZD A;  3IWZ A;  5LHG A;  3S14 J;  2ECB A;  2RKH A;  3JRC A;  2DA2 A;  2WBM A;  1XCB A;  2XAG A;  1YX3 A;  4EMS A;  1GHC A;  3L00 A;  4A12 A;  1TW3 A;  5EEH A;  4E70 A;  1LFB A;  2JPC A;  4DYC A;  4DQ2 A;  5H2F C;  1A31 A;  4KYW A;  1U5T C;  2F5C A;  2JRM A;  2HS5 A;  4QWQ A;  1U6G A;  2DJN A;  5J3L A;  3RPU A;  3OYL A;  2WY8 Q;  1HCR A;  2ME6 A;  4FAS D;  2PQ8 A;  3GO5 A;  1Y8R B;  2MC3 A;  1WJC A;  4A5N A;  1BIB A;  2W24 A;  4ESJ A;  1LKX A;  2H6B A;  3ZXS A;  5IT3 A;  2ZKZ A;  3NWT A;  3GTO J;  2WB1 N;  4CHU A;  4I2O A;  2E5N A;  3CF2 A;  2EB7 A;  4AD9 A;  4E7J A;  1HKT A;  2R7D A;  4X6A J;  1JI8 A;  2QEN A;  2BZT A;  2ACJ A;  4LG0 A;  3AAF A;  1TWF J;  2HQA A;  4XLH A;  1TQI A;  1VZ0 A;  3LSR A;  2LBF A;  3BJO A;  3ESW B;  4KN4 X;  4OAY A;  3I4N J;  2IBD A;  3B6C A;  3H5N A;  3ZMD A;  2XAH A;  3C18 A;  2KHM A;  3DTK A;  4CCK A;  4EEF G;  5D8K B;  5HLT A;  2V4J C;  3GEZ A;  3CCM I;  1IC8 A;  1WJF A;  1AOY A;  3C3W A;  1TQP A;  2BXZ A;  2VBX A;  2K3F A;  3JAM K;  2EFN A;  1XGM A;  3MKL A;  2FML A;  4JQF A;  1D0Z A;  3J80 K;  4M3E A;  3AL0 B;  3CJT B;  2DBB A;  4L0Y B;  1OCC H;  3IRR A;  1FC3 A;  1U0J A;  3QOD A;  1IRX A;  2L9S A;  3KYD B;  3V8J A;  3F8B A;  3IAS 2;  4V19 K;  2HVR A;  5JVT A;  4BS9 A;  2XHK A;  4P96 A;  4HSR A;  2O6G E;  2E7W A;  5FLX Z;  3TO9 A;  5DS9 A;  3KEO A;  3WTY C;  1JJ8 C;  1UZC A;  3CJQ B;  5E79 C;  4PJ0 C;  4NB5 A;  2VBW A;  4KIG A;  3CCE I;  2H27 A;  3R60 A;  3I4M J;  3OYB A;  3A01 A;  4IL6 C;  3H9G A;  4I99 C;  2OTJ I;  2JTV A;  4Y52 J;  5ICF A;  4QLC U;  1QZE A;  3I4P A;  3BPV A;  3Q5F A;  2XAF A;  5B3S H;  2E2H J;  3RKQ A;  5GAG J;  2XC7 A;  4XLN F;  5M5X J;  2Q0O A;  3CLQ A;  4ENM A;  1MND A;  1DUX C;  3FXR A;  4CUG A;  3WGH A;  1BW5 A;  3OYC A; 
#chains in the Genus database with same CATH homology
 2M9H A;  2B63 J;  5F27 A;  3SJM A;  1I3Q J;  1UG2 A;  2GM4 A;  4A69 C;  2NS8 A;  2FQ4 A;  4MIM A;  3VPR A;  3BR0 A;  2MG4 A;  3ZQH A;  1G2H A;  4A93 J;  1IGN A;  2DA3 A;  4UUS A;  2DMP A;  2JA6 J;  5FLV A;  3MN2 A;  2ID3 A;  3JRB A;  2XSD C;  2N8G A;  1MBH A;  1JKO C;  2XRL A;  2EH3 A;  3JR9 A;  4JX4 A;  2DA6 A;  3FIW A;  3ZQL A;  2XGE A;  2Y0S N;  1MBJ A;  1BJZ A;  1F36 A;  1F43 A;  2R7Z J;  2O8K A;  2K9Q A;  2YUS A;  2M34 A;  4A3D J;  3DCF A;  4DZP A;  1BA5 A;  1VF9 A;  1MH3 A;  5IP6 A;  2XPV A;  3GTK J;  2CU7 A;  1JUP A;  3TP0 A;  3BG3 A;  2D5V A;  2DMN A;  1DU0 A;  3OSG A;  5EGO B;  2E19 A;  2Y9Z A;  1ZTR A;  1UHS A;  1ZR2 A;  3Q0V A;  2L7Z A;  4G12 A;  1ZGW A;  2FX0 A;  1SAN A;  2I10 A;  3D1N I;  1O4X A;  1X2M A;  3PM1 A;  4C3J J;  2EZK A;  2XGC A;  4NDL A;  1P7J A;  2MGQ A;  1ZQ3 P;  4DW6 A;  4IEJ A;  5IPA A;  2L9R A;  3HOX J;  2LVS A;  2R92 J;  2LTP A;  2NS7 A;  2HOA A;  4IHX A;  1JTX A;  3JRA A;  2YS9 A;  5F1J A;  5EG0 B;  5IP9 J;  1QVU A;  5EDN A;  2LKX A;  3FKI J;  1MH4 A;  1T56 A;  2K40 A;  1Y1W J;  3IH2 A;  1HDP A;  4C3I J;  4D5F A;  2HOS A;  4L5E A;  4MLO A;  4RDU A;  4FIS A;  5FKL A;  2X9D A;  1D5Y A;  2NVY J;  1SFO J;  3S17 J;  4AYB N;  2Y2Z A;  5EF6 A;  1I6H J;  4V2G A;  4CYC A;  1H88 C;  1B8I A;  1IG7 A;  3TW6 A;  1HDD C;  3S2D J;  4MFE A;  4CYC B;  2M8G X;  1Q1V A;  2KT0 A;  1GUU A;  3MVP A;  5EZH A;  1FTT A;  3HOV J;  1HLV A;  2FJ1 A;  3Q0U A;  4C2M J;  2TCT A;  2NVX J;  1ENH A;  1JTY A;  3HKZ N;  3ZQF A;  4HNV A;  1PUF A;  1POG A;  2LK2 A;  3JRE A;  2QF7 A;  5FKM A;  5EZG A;  5IYB J;  3S1M J;  2DA5 A;  3BR1 A;  5F08 A;  3GTL J;  3BTL A;  2HDD A;  3HDD A;  1ETO A;  2Y9Y A;  2XPW A;  3IV5 A;  2WAQ N;  2X48 A;  2ME0 A;  2MW8 A;  3TW7 A;  2X6O A;  1K83 J;  1QVT A;  3A01 B;  2K9N A;  3RZO J;  3RQI A;  2GBY A;  4Y7N J;  1RPW A;  4W97 A;  1A6I A;  4DZJ A;  4JYK A;  2EZH A;  1B72 A;  4QIW N;  1MNM C;  3BQZ A;  3ZQG A;  5E3N A;  1ITY A;  4AC0 A;  3CMY A;  3BG5 A;  1RET A;  1JUM A;  3RZD J;  2DN0 A;  2JMW A;  4I76 A;  5FJ8 J;  4MFD A;  1IV6 A;  4FCY A;  3GTG J;  3CQZ J;  1ETX A;  4FE7 A;  3QPL A;  3LNQ A;  2E1O A;  4M3G A;  3WHC A;  1UMQ A;  4UUS B;  1TWC J;  4C3H J;  5GPC A;  1LE8 A;  4A3C J;  4IHV A;  1BL0 A;  5M5Y J;  1IDZ A;  2EZL A;  3GTJ J;  2HI3 A;  2AHQ A;  3FIS A;  3Q3S A;  1GVD A;  3TED A;  3S1Q J;  5IOY A;  1VI0 A;  2ELK A;  1CQT A;  2TRT A;  1GDT A;  3GTP J;  2Y31 A;  1YRN A;  2WV1 A;  4DYR A;  5HOD A;  1MBF A;  5GPA A;  5F0C A;  1T33 A;  5FKK A;  2H8R A;  3G1L A;  1ZR4 A;  3ZOB A;  1MSF C;  2LP0 A;  2JWT A;  4XRS G;  1HOM A;  3HOW J;  4A3G J;  3G1M A;  2Y30 A;  2CUF A;  2NVT J;  3M3Y J;  2G0E A;  1W0U A;  5FLM J;  5IOZ A;  4I6Z A;  3K2A A;  3HBL A;  3PO3 J;  4A3F J;  2R5Y A;  1ZKG A;  1ETW A;  1WCM J;  3OSF A;  1GV5 A;  5EEA A;  2R5Y B;  2JN6 A;  1OJL A;  1IUF A;  1W0T A;  3K7A J;  1FIA A;  4W1U A;  3A02 A;  3GBG A;  2E2I J;  2O9L A;  3F0C A;  4A3E J;  3HB9 A;  4B3A A;  4D7N A;  3UKG A;  1RES A;  4RBO A;  2JA5 J;  3W6V A;  3M4O J;  1NTC A;  2ID6 A;  1ZK8 A;  2EBI A;  5EYR A;  2LY9 A;  2XGD A;  3JRI A;  2LLK A;  3S15 J;  1TWH J;  5JLX A;  1AKH A;  1JKR C;  3BQY A;  2DTZ A;  5IYD J;  1FTZ A;  3JRF A;  1WI3 A;  5DTD A;  3GTQ J;  2H1K A;  1AU7 A;  3O8H A;  1U9O A;  4XK4 A;  3HGY A;  2XB0 X;  3LOC A;  1RKT A;  1B8I B;  2HOT A;  4ABZ A;  3OIO A;  3LSP A;  2JA7 J;  2ECC A;  2L7M P;  1WPK A;  3QPS A;  4JX6 A;  3Q0W A;  3FK6 A;  2L7F P;  1U8B A;  2NVQ J;  2EZI A;  4D5C A;  4BBS J;  2R93 J;  3BTI A;  3CCY A;  5C4X J;  5C3E J;  2OPT A;  5FKN A;  1JJ6 C;  1FIP A;  3HM5 A;  1MBE A;  2DMU A;  2R5Z A;  3S2H J;  1X58 A;  2YU9 J;  1PUF B;  1MBK A;  1IJW C;  2IEK A;  2EQR A;  2QCO A;  3S1N J;  1H8A C;  1XC5 A;  2HQ5 A;  3TP3 A;  4A3K J;  1U78 A;  2OF7 A;  4BY1 J;  3JRH A;  3GTM J;  1Y1V J;  1K61 A;  4FE4 A;  1JUS A;  5FKO A;  5F0F A;  1HF0 A;  1DU6 A;  4JX5 A;  1JKP C;  2DA1 A;  1NK3 P;  1A5J A;  3BT9 A;  2L0K A;  3JRD A;  4XIC A;  3OOU A;  5IP7 J;  1U9N A;  1VND A;  3A03 A;  5C44 J;  4M3D A;  3H0G J;  1B72 B;  2JA8 J;  5JLW A;  1QPI A;  1IRZ A;  1VFC A;  1MSE C;  2DA7 A;  4A3B J;  3BTC A;  4D7M A;  5GP9 A;  1WH7 A;  2LFB A;  4XRM A;  4A3J J;  3JRG A;  4A3I J;  2HYJ A;  4QSH A;  5F04 A;  3BR6 A;  1H89 C;  4AUX A;  2P81 A;  2PMZ N;  4M6V A;  2K9S A;  2AO9 A;  4BKX A;  2M2E A;  2W48 A;  3C2B A;  1LE8 B;  1S7E A;  3ZQI A;  5J1R A;  2XB5 A;  1BW6 A;  1ETY A;  2VPR A;  1OFC X;  5IYC J;  4UUT A;  1ETK A;  1YRN B;  2JK3 A;  4IHY A;  1I50 J;  3DEW A;  1XG1 A;  2FD5 A;  3HOU J;  4B4C A;  1QRY A;  1TWG J;  3E7L A;  1JKQ C;  2HXO A;  2VKE A;  1ETQ A;  1RR7 A;  1X2N A;  2DMQ A;  1RKW A;  4B1R A;  2RAE A;  3IH4 A;  5M5W J;  3S14 J;  3L1P A;  5C4J J;  2ECB A;  1E3O C;  1AHD P;  2E2J J;  5J1U A;  3JRC A;  2DA2 A;  1P7I A;  1XS9 A;  5M3F J;  1OCP A;  1LFB A;  3CDL A;  4DYC A;  1FJL A;  4BBR J;  5E3L A;  5EGO A;  4XID A;  2CJJ A;  2CQQ A;  1JGG A;  3H3V K;  3NAR A;  2DJN A;  5J3L A;  2M0C A;  2GLO A;  1HCR A;  3IH3 A;  2ME6 A;  1MBG A;  2LR8 A;  1WGX A;  4MO7 A;  3QQA A;  3HGG A;  1AKH B;  4XRS A;  2R0Q C;  1OCT C;  4S0H B;  2CQX A;  3GTO J;  2IAI A;  2WB1 N;  4JP0 A;  2HXI A;  5EG0 A;  3S1R J;  4X6A J;  5K7H A;  3SFI A;  3PO2 J;  1TWF J;  2JJ7 A;  3LSR A;  3ZQC A;  1TC3 C;  3I4N J;  2IBD A;  3B6C A;  3HEF A;  4EEF G;  2LD5 A;  1IC8 A;  1EF4 A;  4BY7 J;  1JT6 A;  2VI6 A;  4FTH A;  1GV2 A;  3FK7 A;  2VKV A;  3G1O A;  3HOZ J;  1Z77 A;  5E3O A;  3MKL A;  5M3M J;  2R5Z B;  3LSG A;  4A3L J;  4M3E A;  2NOG A;  3LSJ A;  2MSY A;  2CRG A;  1IDY A;  3NAU A;  4LOC A;  3BR5 A;  3WHB A;  5J1Y A;  4J19 A;  1TWA J;  2COB A;  5E3M A;  1NK2 P;  3BG9 A;  4V2F A;  2DMT A;  2XPU A;  2O7O A;  5BNG A;  4DYQ A;  3BR2 A;  1ORK A;  1WH5 A;  1JT0 A;  5K7Z A;  4X1E A;  3O8G A;  5DS9 A;  2KDZ A;  1JJ8 C;  4QTR A;  4A3M J;  4GFB A;  5K7F A;  4BXX J;  3BTJ A;  1FEX A;  1APL C;  3I4M J;  3A01 A;  1GT0 C;  9ANT A;  1R9T J;  2ZB9 A;  4IHW A;  4M3B A;  2VUM J;  4Y52 J;  1Z0X A;  2E2H J;  3RKQ A;  4M3F A;  1LFU P;  3B6A A;  5M5X J;  2CUE A;  2DA4 A;  5F0H A;  3SDG A;  3HOY J;  3BR3 A;  3S16 J;  1BW5 A;  1ETV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...