2E5NA

Solution structure of the ell_n2 domain of target of rna polymerase ii elongation factor ell2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
GSSGSSGTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II elongation factor ELL2
publication title Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e5nA00
2E5NA 2DOAA
chains in the Genus database with same CATH superfamily
1E3HA 4FX4A 2O8KA 3DTKA 1MIJA 2MC3A 2Y0SA 3KP6A 2CMPA 1MW7A 2DQRA 5K5OA 2RQQA 1SD7A 1SANA 2H09A 2X1EA 3HSRA 2E1NA 3OIOA 2Z9OA 2EBIA 2XF6A 1UMQA 4XN0A 2IA1A 1TP4A 3MWMA 3VPRA 1O3TA 1EV7A 1UHMA 1YTYA 1OISA 4HNVA 2H1KA 4UXNA 1PJRA 4DJAA 2F5VA 1X1CA 4GFBA 2H8RA 1FMWA 2JWTA 3G2BA 2R0QC 1SMYF 3ZMDA 1SFOJ 3CF5F 2O8XA 3M8JA 3ML6A 5CVJA 4IHYA 3MN2A 1TWGJ 1V5EA 4BXFA 2KZVA 1LPQA 3CCQI 2B9SA 3DBLB 3E6DA 2TDXA 5F04A 1KU2A 1OFCX 1Y0UA 2P4WA 2NVYJ 4K2EA 3FKIJ 4HQMA 1ZRCA 1HSJA 1XX5A 4QLCU 3K4CA 3GWZA 2IS6A 5HLHA 1R9TJ 1BI3A 2JTVA 4UHTA 5J1YA 1TNTA 2LDUA 1J5YA 3CUOA 4AIHA 1W7PB 4IO9F 2XGCA 4HF1A 3E3VA 4RA2A 2E1MB 2FF4A 1RI7A 1EH7A 2PN6A 4E7SA 3QPSA 1CGPA 4DYRA 1DU0A 3RKWA 3OYNA 4IQ4A 5HS7A 3ABMH 3VYUB 4BKXA 5D6EA 2VODA 4CXFA 5TISC 3MD2A 2IGKA 2DO7A 4E7HA 1O7FA 3GXOA 1ZRFA 2R7RA 2CQ7A 4DBRA 2M9HA 2VUMJ 2R7XA 2L5QA 3LSTA 3QAHA 1I1SA 2V1DA 2ISYA 2ELJA 4YG2F 2DQLA 5J3LA 3H3ZA 3D0SA 2VOPA 4BQOA 4MHGA 1YHQI 3DEWA 2FQ3A 1C0WA 3KZYA 1J7KA 1D3YA 2TRTA 1FLIA 3DFGA 1K61A 2ZFUA 2LH9A 2PMZA 4Y4RA 5F6FA 3DU6A 2DA7A 3HPHA 5FGMA 4BBSJ 2VN2A 3P9CA 1JTYA 3GTLJ 3VB2A 4QWQA 3DTEA 5LHGA 3H0DA 3S17J 5D5UB 5J4VA 2H6CA 3S2HJ 3F0CA 1P7IA 4EATA 3WGIA 2X9DA 2PQ8A 2G7HA 3MAJA 1HA8A 2CW7A 1ETYA 3ECHA 2FBHA 5IP9J 3LAJA 5FD5A 2HQRA 1SMTA 3TBIA 1R00A 4BE0A 3M8FA 2BE5F 2EFNA 3MVPA 2ZJ2A 2LKXA 4OAZA 2VBYA 2YX4A 1B72B 3M4OJ 5H2FC 1F1ZA 2E1OA 2P5LC 2NVTJ 3M8EA 2NS0A 3GFIA 5LBQA 3OYLA 1MNMC 4C2MJ 2BY2A 4G7ZF 3QODA 1P92A 1ZK8A 3MKYB 3IRQA 1I1GA 2RNJA 1OKRA 2VBXA 2R3SA 1VI0A 4DGWB 1B8IB 3IWFA 3EQLF 1BBYA 5IT9Z 1OR7C 1YQAA 3ULQB 4XLPF 2WAQA 2YUSA 4KNYA 3OSFA 1MDMA 3AAFA 4OIQF 2Z33A 1ORKA 3VDXA 2PMUA 5DD4A 1LFBA 2DN0A 2ZO4A 5E17F 3GTOJ 4IHSA 2WWYA 2ECBA 2FSWA 4NC6A 3HUGB 5M3MJ 3EDPA 1AU7A 4ZYGA 3FHNA 2VBZA 2IJLA 4JX5A 2BY3A 4EM1A 1DGWY 4A12A 2F6CA 4HV6A 3K70D 3L2WA 2PLYA 3CP8A 4B4CA 1O3RA 3FIWA 3HXLA 1OQYA 4UVAA 3AL0B 3ASOH 1PP7U 4I6ZA 4NQWB 2DDBA 1I6XA 3GX4X 1SD5A 1O3SA 3ABLH 3ZQGA 1FWZA 5E8GA 1ZAOA 4EJVA 1UELB 2ID6A 2DODA 2FNAA 2DAOA 3JTHA 3IH2A 3OYEA 4I99C 2M45A 5E79C 2V79A 1ZR2A 4EJOA 2LP0A 2HKXA 3FK6A 4BHBA 3VFZA 3RJPA 1YW9A 1GHCA 1G8XA 1A6QA 3GUDA 1A6IA 3K9TA 4I01A 3ZMTA 1L0OC 4B09A 1ZELA 2IXSA 4UY8I 4J19A 1G4DA 5JI6A 2G9WA 2XB5A 2STTA 1OYIA 5IY5H 4LLNA 2JPCA 1XN7A 4RM2A 5B66C 1TL8A 1P4WA 2P8TA 3SDBA 1V5GA 4AC0A 2OZUA 1FY7A 4BY7J 4BEHB 3LMMA 2XAJA 2CYYA 3G73A 3R60A 2K9NA 2BY1A 3OYFA 4WK8F 4E7IA 2IBDA 2LBFA 1BI1A 3QOPA 2R7ZJ 3AFHA 2LKSA 3PUBA 1S3JA 3KX2A 3DLAA 3GFLA 2EA4A 2B7EA 1HDPA 1OPCA 3FXMA 1X3WB 2QF7A 5EEGA 4YFXF 5FLXZ 2LSOA 4A0XA 4A3LJ 4FETA 5B1AH 5KHDA 5DEQA 1BN5A 4IF4A 1P7JA 4KA4A 2XPUA 4PFOA 1K4TA 4UB6C 5HNHA 4G8XA 2W00A 3ZMSA 1B59A 1RESA 3LSRA 4IRHA 1RIOH 4CSWA 3Q9VA 2XIGA 4L9JA 2GXAA 2J5PA 3IRRA 4MLOA 4Y17A 1J0RA 2R5YB 3VOEA 4UUVA 2R7DA 3BJ6A 3JRIA 4EGZA 2MD5A 1PUFA 3Q0VA 4BDZA 4CICA 1U2WA 1ZLKA 1I27A 2BVLA 1MGTA 2M7AA 3RYRA 3ZPLA 1W1WE 1NG6A 3CUQB 4PUSA 3TW7A 2GM4A 2LLKA 1ULYA 2LMDA 2Q2EA 3LSJA 1GXQA 1UFMA 2XGDA 1WRJA 4EV0A 1HF0A 4E4HA 3CMEI 4H0EA 4L0ZB 3HSFA 3TL4X 4MFDA 2CV0A 3R6SA 4ENKA 2LY1A 4FISA 3FDYA 5LGUA 3HYIA 2KHMA 2PBIA 4II3A 2F4OB 3ELKA 3X2QH 2HWVA 2H27A 1FOXA 2HXIA 1ZN2A 3F6OA 1XG1A 5CQEA 5KAIC 5LD2C 2VC0A 2L9NA 5D8KB 4B47A 3DKWA 2RAEA 3A2KA 2JUCA 4W97A 3FK7A 1NK3P 2NYXA 2P5KA 3V4GA 2GAUA 5E3NA 4NNJA 3NRVA 1VQ6I 4E70A 4ZJZA 1EKEA 2E1MC 1LDJA 2HOEA 4N0BA 4B43A 4PK4A 4U0WA 2K3FA 2L7FP 5HOOA 3KEOA 1O3QA 3C7JA 4KN4X 4XRSG 1IF1A 2HI3A 4ENNA 1REPC 2X6YA 1OCPA 2HFHA 4RGXA 4MGRA 5HDGA 5LRSA 2A69F 2JZYA 1HKTA 1OCRH 3I53A 5ILSA 5H20A 4XLNF 2WY8Q 3W3CA 4I0BA 4MFEA 4PDKA 1VQ8I 4CCNA 4CYCB 3RPUD 4ZTFA 3HGYA 5CVVA 3JRFA 4HQEA 3K4LA 1RKTA 2NVUB 3DLLF 1ERDA 3HHGA 2KL4A 1APLC 3HZJA 2JUGA 2EFOA 3SDGA 3LA7A 2EV6A 4F52A 1S72I 3JR9A 2QSFX 1FIAA 3HRMA 1UZCA 2MABA 3I0TA 1WFXA 1FIPA 2LG4A 3L1PA 4JYKA 2GZWA 4RAZA 2COBA 3JSPA 2HU9A 3F6VA 3K2AA 3KZZA 2CJJA 1N25A 1K79A 1B6AA 1RR7A 2YX7A 3HRSA 3OMYA 4GXOA 1EF4A 3O3KA 4JP0A 4M9XA 1YJWI 3DPTA 4AD9A 3RQ4A 1F43A 1EH8A 4KDPA 2XHKA 1S9HA 1X4OA 2K5CA 4Q48A 1WHUA 3TQNA 2HYGD 4BJ5C 3BC8A 3OIQA 1DPRA 5LHHA 2JA5J 1UJ8A 1YRNA 1O7LA 2M0MA 1WJBA 4XOTA 2V1UA 4KMUX 4F7ZA 1K78B 1WPKA 1RETA 2DOEA 3ISPA 3MQ0A 5DUIA 1T38A 2BHYA 2IAIA 3K2ZA 2VQGA 5LGNA 3E7LA 2TCTA 2X4HA 4HX8A 2FJ1A 3GO5A 4JBAA 1CF7A 3LSHA 5AONA 3W6KB 2Y75A 1OYWA 1ZARA 1YW8A 5F0FA 5GAEJ 1KYZA 1Z77A 4D0PA 4ENMA 2QM3A 3N97A 1AKHA 5IYCJ 1NHAA 4XKBA 2L9SA 1JGSA 2VT2A 3VYTB 1I50J 1GT0C 1OR7A 2WAEA 4OWRB 4R8HA 5IYDJ 4ZYHA 5LHIA 2MBFA 1TW3A 1VQOI 3L09A 1V54H 3AL0C 3I4MJ 2Z16A 2N8GA 3EYIA 3I64A 5DTDA 1TQPA 2XPWA 4L18B 3K6GA 3O2PE 1FYKA 1LVKA 1Z67A 5GTIC 3HOSA 1ZQ3P 4HX4A 2WBMA 4R1HA 2VJJA 2OU2A 2PEXA 1U78A 2VKEA 2QQ8A 1X1AA 3EPZA 3CCYA 2PI0A 3A01A 1T39A 3RI4A 2VQCA 5EZGA 2I10A 3HPGA 3CDHA 3BDDA 5CYVA 4F93B 5DS9A 3CCUI 1VTNC 4IHXA 2R7SA 5CQGA 1XSVA 1XGNA 3ONQA 4A3KJ 3LQRA 2QQAA 1X58A 2V9KA 3CJQB 2P5VA 4G6DA 5F0HA 1A5JA 5EGOA 4UV9A 5AIQA 1D8KA 1XMAA 5KAFC 1D5VA 3BCAA 1R49A 3BPVA 1M1EB 2DTZA 2JVHA 4NBQA 1MSEC 1KYWA 3GZ6A 4HLXA 1OCTC 2NVXJ 4HA8A 4ETSA 4A3MJ 3MKWB 2KLOA 3FXOA 3M1CA 3BOQA 5BS6A 2K4BA 2DXIA 3PO2J 1F4KA 2MLKA 1QVTA 2DTRA 4U7BA 4I09A 2DA2A 2R5ZA 3BR2A 3C18A 1IRXA 3CTAA 3IV5A 2Y31A 1F5TA 5K7FA 3KCCA 2Y2ZA 2XSJC 1W0UA 1XGSA 2DT7B 3LA3A 1FPQA 1BJAA 2K9SA 4F91B 4DZPA 2LRDA 5DCMB 3WG7H 2ZFWA 4MQVA 3WTXC 3K1NA 3JRCA 2DA5A 1U0JA 2R4GA 3GZ5A 2WAQN 4XLCA 3WTYC 3JCUC 1ON1A 2JJ7A 4HW0A 2CS3A 3S3OA 5ILUA 2MLGA 1WSUA 3K1MA 3ZN1A 2OAZA 3PUFA 3T8TA 4XNFA 1ITYA 3DKYA 3TGNA 1JJ6C 5LGTA 2ZXIA 3V42A 3WTZA 3OS2A 2CUEA 2EA2A 1VFCA 2LFBA 4BQNA 2IW5A 3HUGA 5IPAA 2K02A 2XC7A 2FMLA 4AIJA 2P7VB 5DDGA 4CDGA 1BIBA 4D7NA 4U88A 4M6YA 4QIWN 2QZ8A 5L3CA 3ZOBA 1J59A 2ZMEB 2CGPA 2P6SA 1R58A 2WY7Q 3H92A 5JVGF 2VIXA 3TO6A 5D4RA 3H1CA 3V8JA 1IN6A 2AS5F 2A3SA 3PL8A 1Q1HA 2XKOA 2VASA 2XDVA 2L54A 1ETKA 3FXQA 4UUSB 2KIUA 4XLHA 2A61A 4WF2A 3NAUA 1W5CC 3BZ6A 1QHHD 2W1OA 3R0AA 1YE9A 1U9NA 4YIRX 2XROA 2ZJPF 3OL4A 1K7AA 1SD4A 4AIDA 2LOOA 3GMEA 3V7RA 1AA7A 3D5RC 1FOKA 3JRDA 3ROUA 1XB4A 2EINH 3QYFA 4GRIA 2EB7A 2M4KA 2DDAA 3A0HC 1DGRM 1LE8B 5M3FJ 1MNDA 3RSNA 3PIPF 3ZQFA 4UB8C 3K69A 3FM3A 3CMMA 3D5LA 1E2XA 3OIPA 2BBYA 2JT1A 3LOCA 1H89C 4KT6A 3C1DA 1AHDP 3G1OA 4CCJA 4IHWA 5ICEA 4IVNA 4A5MA 3DKXA 1XDSA 1RZ4A 4MQ9F 1QPMA 3TW6A 4GO1A 4J00A 1V3FA 3VWBA 1R1VA 1R1TA 3MKZA 3OS1A 3D5SC 4A93J 1HKQA 2I8DA 3BR3A 3W2AA 1D8JA 2A05A 1IDYA 1P2FA 5EG0B 3LL7A 3ZRGA 2QEXI 2MGQA 2CUZA 3GF2A 2GXBA 2X0LA 1O57A 2DA6A 3H3VK 3OYBA 4HDUA 4G94A 3I4PA 3T0YA 2DA3A 5ICFA 5HNFA 3PIOF 3IAM2 1DP3A 3WTUC 3FZVA 3G4SI 1U9OA 5JVTA 4KFCA 3NQOA 2CV2A 3V7SA 3E0JB 4ANJA 4FE7A 3QP5A 3Q5FA 3DU5A 5K1YA 2L7MP 1GV2A 5GTHC 4OMYA 1R36A 3KLOA 4OIOF 4ITVA 2OD5A 2KJCA 3OYDA 1WWXA 2O5RA 3CF2A 3KPHA 3U9GA 1ETWA 4AWXB 2XRNA 3BG9A 1SAXA 5J1UA 1A04A 1B72A 1S29A 2HDWA 2FE3A 4IX7A 1LJ9A 1IJWC 4BNCA 4LG3A 2PFBA 4WXCA 3H0GJ 1ZHFA 2E36A 1YS6A 3PQJA 1CQTA 3KE2A 5L3BA 2DFFA 2H6BA 1GXPA 1MJAA 1P4XA 2VXZA 1K6YA 3E5QA 2Y9YA 2RQPA 4N4OB 4X6AJ 5EDNA 3SFIA 2ESNA 1WI9A 4DYCA 4AIKA 3TP3A 4HZFA 2YU9J 1FMVA 2ETHA 3KP3A 1YJ9I 3HL2A 3OOPA 1Z3XA 3BZCA 5FD6A 4XRMA 3QYBA 2PX9A 2R7TA 2DFIA 4LD5A 4CZCA 2EFWA 3R61A 5A2QK 3RZOJ 1QGPA 2PJPA 1JT0A 1Z05A 5FLMJ 3H9QA 2L3DA 1WJDA 4OMZA 4U7DA 2RNGA 2H94A 1SEUA 2MA3A 3M1EA 4U0VA 4O3MA 4ZC3A 1TQIA 5J8FA 3WHCA 5ICCA 3R4KA 5DM6F 3WTSC 2F4MB 4A5NA 3VYSB 1IGNA 4NQWA 3L2RA 3L2VA 2EH3A 1GVJA 3BJAA 5GAHJ 1B4AA 2FUG2 3CMAI 3O8GA 3ABTA 4ESBA 3C2HA 2L2OA 2W25A 4JX6A 4DOZA 1ENHA 1X1BA 3CDIA 1YI2I 4MEYF 5IOYA 3J81K 2NOJB 5HLIA 3REOA 2KDZA 2VE9A 5M5WJ 1S8NA 2Y0MA 1XGOA 4I2OA 2CUFA 1Y1VJ 2X6WA 1X3UA 5HLGA 2KQRA 4Y3OA 3OYKA 2OJED 4OINF 1EJ9A 2OPTA 4S05A 2NVQJ 1LFUP 3LNQA 3DV8A 4BEHA 1FP2A 4A3EJ 5HDKA 5CLSA 1VQ4I 2IS2A 5E3LA 1BA5A 1HSTA 4N9IA 5E3MA 2HGCA 3E5UA 4P9UA 4DNCA 1PUEE 1VQLI 3G3ZA 4CCKA 1OCZH 4Z6YA 3LSKA 2JRMA 2M7BA 4MO7A 2HZTA 3BR5A 2FOKA 1BOAA 3IP4B 2WAFA 4CA0A 3BZKA 4A69C 2XAGA 3GBGA 3LSIA 1FX7A 2LNBA 3J80Z 5ERIA 4RAFA 2HTJA 2KT0A 3VSLA 2ACJA 3H9JA 5CVIA 2CV1A 6PAXA 2AXTC 2BVMA 4P96A 5DCFA 2LD5A 2JA7J 3W2WA 2QENA 4ZYEA 3CJNA 4C2UA 1PYVA 2ZCWA 2BEOA 2EFQA 3FXJA 2AQEA 3KEYA 1YLFA 1P4AA 1RPWA 5L3FA 3DBRB 3QP6A 3JRAA 4PJMA 3S3MA 1SFUA 4LIVA 2PJRB 1BI2A 4QPOA 1ZG5A 2W24A 4KYWA 3CCSI 3K10A 4ZYAA 2WC2A 1ZLJA 2KP6A 3I55I 2V4JC 2PMHA 3S14J 3S1QJ 1Y6IA 2R5YA 2O6GE 4BAYA 2KFDA 2RDPA 3QOEA 3DPUA 3G1LA 2AXLA 2ZMEC 3WODF 1IRFA 1I3AA 3IAS2 2WTEA 2XAHA 4BJTA 4A3IJ 2CH0A 3SZGA 3S93A 4L9NA 1W0TA 2P6TA 3T5XA 3ESWB 3DWLE 5GP9A 3CLOA 1V5FA 2K3PA 2BW3B 1TBXA 3F8CA 5GAGJ 1KQ8A 2HDDA 1MBGA 5E1ZB 3H5AA 4IRIA 1D1BA 4PSXA 3NWSA 3HM5A 1B9MA 1JUPA 4FHTA 5GPCA 2HEOA 1HOMA 1K4SA 4TV7A 4D9JA 4XLAA 1ETXA 3JAMZ 4EM0B 1R5GA 2KIMA 1X19A 1MKMA 2VQHA 4IQJA 5FB2A 1HW1A 3Q0UA 2KJBA 2M1BA 4BQAA 3GCMA 4LK1F 4XOPA 4AVPA 4CO8A 4A3JJ 1WH7A 1FOWA 2A6EF 4A6EA 2OC6A 1HW5A 1V4RA 4BS9A 1RUOA 3ZQLA 3HOZJ 2DT5A 1MDMB 5C4XJ 3CCMI 1R6RA 2P81A 2Q0OA 1TTYA 2A07F 3TDUC 1DDNA 3FF5A 3ZMVA 1W5TA 5F08A 4FTHA 3E6MA 1MMAA 1BR1A 4KIFA 3S1RJ 1HC8A 3A03A 2E2IJ 3SZTA 1Z0XA 3IKTA 3W6VA 3SHFA 4C9YA 5FRMA 3AKZA 5AIPA 2I5UA 4Y7NJ 2L01A 3OR2C 2XF5A 2FBIA 2W85A 4KISA 4DBQA 4IOAF 2YS9A 5JHUA 4CCLA 1P9QC 4CUGA 4BXUA 2XGXA 3DQVC 3L2CA 2X6OA 4NUBA 3A02A 1R4MB 3LFUA 4BJ6C 2M87A 5KNLA 4Y33A 5E8IA 3JW4A 1BC7C 2VC1A 2XAFA 3K4KA 3OOUA 3HC7A 1KA8A 2Z1DA 2STWA 4G6TB 1BW6A 2EFPA 4NDLA 2FD5A 4DIQA 3FMQA 3HOXJ 3CCJI 1HCRA 4M3BA 2EV5A 1UHWA 4G9YA 4O5VA 1IXSB 2IRFG 3HOUJ 3CJTB 3F3XA 4HYEA 3ZQCA 1ETOA 3UR3C 5D5WB 1BJZA 4RGRA 4IXAA 2X1CA 1ZRDA 4M3FA 4XRSA 3ZMUA 2UXNA 1JKQC 5FJ8J 9ANTA 4V19K 2WV1A 2ZJRF 5TRDA 3H5NA 3PSFA 1ON2A 3B6CA 1ZR4A 3O8HA 1OCCH 5J4YA 4ENJA 3WU0A 1I3QJ 3BR6A 3HKZA 4C3JJ 1T33A 2VLAA 1AOYA 2HVSA 1Z21A 3KP5A 3I9V2 3BCBA 5IOZA 1H9TA 2IP2A 3K1PA 2DJIA 2FQ4A 2RGVA 5LRRA 4B44A 3LFKA 1L3LA 1QRYA 3ZQ7A 4HEA2 3ASNH 4D5FA 3WE2A 1USSA 4MNUA 1VQ7I 2GA2A 3DEUA 3EUHC 4Q47A 3HEFA 3BTLA 2K9LA 2IT0A 1QBJA 3IC7A 5C3EJ 3BT9A 1I6HJ 1LVAA 3TDZC 1VQNI 4RGUA 2K27A 1T2KA 3QU6A 4YRVA 2EIKH 4XK4A 5J47A 4A3GJ 2UXXA 4RS8A 2AO9A 4BGDA 1TW2A 4BH9A 4M74A 4AU7A 5EYRA 4C3IJ 3QPLA 1KGSA 3OL3A 1PDNC 1T6SA 2F5EA 3J7YJ 2O61A 1POGA 4RAYA 2AQFA 4HG2A 1UG2A 2FX0A 4OU0A 2VB6A 3LAPA 1YYVA 2JQ7A 2M0CA 3KFWX 2UZKA 1I5ZA 3ZMZA 1YX5A 2NXNB 2V9PA 2J5OA 2YR2A 1KONA 3IKVA 5EZHA 1QPIA 2W4SA 3FMRA 4XRFA 3P5JA 3OR1C 2E7XA 2MYSA 2V1XA 4M6VA 1R22A 4XIDA 3CJRB 1YJNI 3E1SA 4AVZA 1PVEA 2HQ5A 5HVQC 3M7GA 5IP6A 2CU7A 3CCEI 3UKGA 2L0KA 3HG9A 5EEAA 3G1MA 3TP0A 3U1KA 2E35A 1S6LA 5H6RA 1SFEA 1YFHA 5JLWA 4I7HA 1YITI 2FOWA 2O03A 3U21A 1JI8A 5J1RA 1HKSA 2FRHA 4PJLA 3NARA 1ZGAA 1U5TB 5FKOA 1ZG1A 1WH5A 5DM7F 2R7QA 4A3DJ 2EZLA 1VQPI 1JKPC 1LFPA 1MJ9A 5DCMA 1WJAA 4BDYA 3SEQA 2R7WA 1XC5A 4E7KA 3FXLA 1HXDA 4HV5A 1MBEA 1FP1D 1TZLA 2DOAA 4XORA 4A6DA 4IKFA 4A3FJ 3FMSA 2DMUA 4WXHA 1T0FC 2K40A 3O6BB 2FU4A 1ZREA 2JSCA 1A35A 2HS5A 4LLGF 3AG3H 2XKPA 3QRFF 1G6NA 2MC4A 1BIAA 1ETVA 4IRGA 2Y9ZA 2A6HF 2NRAC 2YU3A 1DQUA 1R5ID 3CDLA 2EZHA 4IPAA 1IUYA 4YIIA 1BI0A 4M72A 2VKVA 2NNNA 5DV5A 5FFZA 5K5RA 2EZKA 2GOMA 3GLLA 3RKXA 4D5CA 2ZMEA 4IEJA 3EYYA 2Y48A 3ZQQA 2ZB9A 3J7ZI 2UV1A 4LG0B 2E2HJ 3MZYA 5IYBJ 1MBKA 4UUSA 2QKLB 3V8LA 4EVIA 3JRHA 4F92B 5BPDA 2LF8A 3KLNA 5BMZA 2NAZA 5TJJA 3S8PA 2X51A 2DPUA 1XD7A 2DCEA 2OF7A 3IWZA 3NWTA 1CF7B 3ZQIA 1T95A 3CP2A 3VODA 3F8BA 3I58A 2DMQA 2KKOA 4I76A 2JSPA 2LK2A 4FASD 4S04A 1WZ2A 4GGGA 4C3HJ 2EK5A 5IT9K 2QBYB 1SD6A 3F72A 1FYMA 2VBWA 4XQFA 1TWHJ 5HS9A 2EV0A 4OAYA 2QKMB 3GZNB 1G3TA 2LR8A 3T1BA 4B1RA 1TT5B 4C2TA 1LE8A 2GIZA 5KK1A 2VKDA 3K70C 4QTRA 2HYJA 2IA0A 1G59A 4FX0A 5ILVA 1WQ2A 2DLLA 1G3SA 3DEEA 2HQAA 4CH7A 1QNTA 3BG3A 4YFKF 3JRGA 4F55A 1S5LC 4XONA 5F1RA 2ZSIB 4KIBA 2CQXA 3CUQC 4BBRJ 2COMA 2E34A 2W82A 1Z7LA 1DU6A 1GVDA 4BACA 2XUBA 4Y52J 5H6QA 2LVSA 3UNGC 4LFUA 1ACIA 1IV8A 2QYOA 1XMKA 2DW4A 4KIGA 5EG0A 1AWCA 2OBPA 3PNTA 1J9IA 4RLQA 2QSGX 2Z5UA 2DYSH 2EILH 2OCCH 1FEXA 1J75A 2DMNA 3M07A 3CCLI 1Y56A 5JFRA 4IOCF 1FBSA 3BQZA 1JUSA 4PFPA 3KEQA 4UUTA 2L02A 2A5WA 3TOAA 1D1AA 4ZDLA 2ID3A 3I59B 1SC7A 2VE8A 3HOTA 4XSZF 2ME6A 2JA6J 5B1BH 5LEJA 4NC7A 4BYYA 5M5YJ 1MMNA 2V6CA 1RR8C 4ESFA 4NC8A 1Z6RA 1S7EA 5JHFA 3QQAA 2R7UA 3RKYA 2Z2SB 5HDNA 2CUJA 3WTWC 4Y13A 1N75A 3OYIA 3BWGA 4B3AA 4WX9A 2OUMA 2VOOA 2CW0F 4F3QA 1K6OA 4L9VA 1W7PA 4L5EA 4ZTJA 1G2HA 2WB1A 2DK8A 2Y69H 5D8LB 2FXAA 2K86A 5E18F 1W4MA 5FLXK 1XDUA 3BTCA 4LMYA 3CCRI 2IS4A 3FBNB 4NB5A 1NTCA 2DPDA 4LIUA 2CQKA 3LQQA 3FBIB 2GA1A 4LB5A 1BOBA 5HS8A 2OQGA 4YELA 3BR1A 3AG1H 4EM2A 1VNDA 4U0YA 4UVCA 3FXKA 3WTVC 2V9VA 4ABZA 2VI6A 3IHUA 4OIRF 3JTGA 2RC4A 2A6TA 3KYCB 1OJLA 3U2RA 3C2GA 1RRJA 4Z2YA 4IJAA 1GDTA 2F4IA 3EUHA 1TQMA 2A5YB 3K7AJ 1BR2A 1X2NA 4P9FA 2WA0A 2IGOA 2R7OA 5C44J 1DPUA 2CFOA 2FBKA 3PO3J 3ERED 2VJ4A 1BR4A 1XSDA 3B73A 3IL2A 2LREA 4QPQA 4JK1X 4OOIA 1QZEA 3SQNA 1XSXA 2V26A 3LA2A 2HVRA 1F36A 5BOXA 4WCGA 2HPIA 2ESHA 3M3YJ 1ZTRA 3KYDB 4M3GA 4XKWA 3C2BA 4PGGA 3L9FA 3SEZA 4UVBA 1KQ9A 4XN3A 2M3AA 3W6JB 2ELHA 1UB9A 4EEFG 4I98B 2Y30A 3CLQA 4XR6A 4XL9A 2JPBA 3CD6I 4A2UA 4ZDOA 1A36A 3ERMA 1SVMA 5TGTA 2OA4A 2K4JA 4HOBA 2DK5A 4ZYDA 4PJ0C 2B0LA 5FO5A 2NNYA 3S1MJ 3GTGJ 2ZBKA 1ETQA 3ZQHA 4A0ZA 1N77A 1QA6A 4E7JA 2ZSHB 3K4NA 3ZR8X 2ZJQF 4FQGA 4LGWA 2GLOA 2JA8J 1MJBA 1B8IA 3GW2A 3GVAA 5B5EC 1TWAJ 2CSOA 4P55A 4BE2A 2F48A 1XMXA 3FX3A 2OCEA 1LEAA 3E5XA 2BYVE 3WU2C 1FZPB 1Z9CA 3BG5A 1RC9A 1U5TC 2OZ6A 2JK3A 2QVOA 3S32A 4CZZA 2QWWA 1GV5A 2LC2A 2DU9A 3CQZJ 2KIFA 2E60A 4XKVA 2Q8KA 2CWEA 1Y8RB 2XRLA 2MD0A 2E2JJ 3TOBA 3HHHA 4ZZDA 2MG4A 1BC8C 5B3SH 1D0XA 3OY9A 2FA5A 3OYJA 3HKZN 2IEKA 1T8IA 3EUAA 4BQQA 4DW6A 3H5RA 4BY1J 4ZDPA 2EPFA 4O6JA 1E0EA 5LLQA 2E5ZA 1Z7UA 2P7CB 1SAUA 3LSGA 4BHPA 4M3DA 1FYLA 1WGXA 3S16J 2RVCA 2PJRA 2ZNYA 1MZBA 2E71A 2V6EA 1IZ1A 3LSPA 2X85A 3H9GA 3FM5A 4GCVA 2H1LA 4I0AA 2W84A 1UCRA 3G71I 3F9KA 1WKMA 1T0FA 3BPXA 4PSWA 2IA2A 3B6AA 1B1BA 1KZHA 3KP4A 4RM3A 4C30A 1YIOA 2RREA 4XLFA 3G6EI 3OS0A 3L2QA 2FMYA 1H88C 2BW3A 4PZJA 2DOFA 4JQFA 3PFIA 2R92J 1GUUA 3GLXA 1E3PA 2Q1ZB 3MKLA 3OYAA 3K4MA 2K85A 4GDFA 1SFXA 1Y8QB 4G7HF 3F8FA 1KU7A 2V1NA 2HOTA 4N4NB 1HBXG 1Y0NA 4E7ZA 4L5JA 5DD8A 3HIFA 4YIFA 2P0WA 3TO7A 1EA3A 2OTLI 4EGYA 1LB2A 2IVMA 3RCOA 2NS7A 2RN7A 3K0LA 1TNSA 4LLLA 1R5HA 2ZC2A 5CVRA 1W36D 3S1NJ 4I02A 4KN7X 4B3XA 1B9NA 2HR3A 5K5QA 4KITB 2LF7A 1QO0D 5F1JA 1E3OC 3U1DA 3OYHA 2CG4A 1QU3A 4XLEA 1IDZA 1MSFC 2R93J 3DCFA 3L2UA 1U6GA 5BNGA 3DPLC 1FJLA 4KJZA 2GIVA 3RIRA 4LB6B 4BE1A 1T56A 1ZG3A 4EJUA 3ZGKA 3CC2I 4A3BJ 4HF2A 2HNHA 4EQQA 2HDCA 5KVRA 3OYGA 1HQCA 4FE4A 3SYTA 1HLVA 4KT5C 3TKYA 1QVUA 1R1UA 1ZH5A 4HAMA 5E20A 1G3WA 2VL8A 3DXJF 2MSYA 4EJTA 1D1CA 5GADJ 5CVUA 1IG7A 1NH3A 1SVOA 3CUQA 5D4SA 1FBUA 5DYMA 3L00A 5K7HA 1D0ZA 3CMYA 1Z3YA 2VT3A 3EETA 5CJ9A 2ZXHA 3DF8A 4CHUA 2IGNA 3W2VA 3GTKJ 4XMYA 3A0BC 4X0GA 3QU3A 2QUFA 2DI3A 5CPRB 3ABUA 2BXZA 3MCZA 1T08B 2GOXB 4PJNA 3KETA 1Y39A 3TO9A 3VEPA 4ON0A 2K9QA 2JMWA 2WADA 1IO2A 3FXUA 3I54A 3HBLA 4P1WA 1J09A 4ASNA 1BW5A 5GPAA 2B63J 2X48A 1J2XA 4M71A 4XICA 1Q1VA 2CO5A 3GTMJ 4AUXA 1VZ0A 1IN4A 1OCOH 5L3EA 5ICGA 3FWEA 1HW2A 3OSGA 1IN5A 2W57A 3PJRA 2DA1A 5FKKA 2MW8A 5HLTA 3D1NI 1VQ5I 4RB1A 2M5WA 2ZXJA 3TMOA 3HTUA 4L9TA 2BV6A 1MD0A 1OLTA 3VYRB 2VXDA 3AG4H 1PP8F 3J7AY 3BG7A 1TLHB 2HTSA 4BL0B 2XPVA 4PGHA 5KCMA 2KDOA 3IH4A 1JKRC 2H8WA 4HX7A 2KRCA 3Q9SA 4KMFA 3HOWJ 4II2A 1IN8A 2F5FA 3HB9A 4AYBN 4H4KC 2VKHA 4LK0F 4CYCA 3F23A 3J7AO 4GYGA 1LKXA 2XB0X 4KICA 2M8EA 4HPQA 3QYEA 3H36A 4M6XA 4L0YB 3GFMA 2EJRA 1YIJI 3F21A 1KQ0A 3JREA 2A68F 3AG2H 2LY9A 4CYDA 1ONVA 4AM3A 2LTPA 1MH4A 5F0CA 3TEDA 1FT9A 2BGCA 1JUMA 1IV6A 3ZP5A 3GTPJ 4RB0A 4IHTA 5K7ZA 3GEZA 4J01A 5FFXA 2BOLA 4RBOA 3B02A 2E7WA 2KZGA 2KRHA 4RAGA 1H0MA 2CRGA 1TC3C 1A31A 2G0EA 3RPQA 3OWTA 3HDDA 5D5XB 2X6XA 3E97A 2R7VA 4A0YA 1RKWA 1YOVB 2CW8A 2M4GA 2LBFB 1WJCA 5E1WA 2L4MA 2ZKZA 1K78A 1LUJB 1LEBA 2X1DA 3S15J 3CESA 2QGUA 4LITA 4M9ZA 4ZH4F 2QA4I 3PQKA 3SFZA 4E7LA 1N78A 1R4NB 1MBFA 1UG0A 5J6XA 4PJJA 3BTIA 1X4PA 5LFAA 5FLVA 4WXDA 2HVQA 1BM9A 1LNWA 3HJEA 3FHZA 1XGMA 2DFHA 3DTIA 4B8XA 5D6FA 2VJIA 3KZIC 1MH3A 2BXYA 3F8MA 3BLYA 3HOVJ 1TWFJ 2ZXWH 1X2MA 1S7OA 1QZZA 3A4CA 3HRTA 2JRTA 4IZZA 4OIPF 4GYIA 2VPLA 1MBHA 4R79A 4M3EA 3BY6A 3QPHA 3K4JA 3LSMA 2L9RA 3BG6A 1IAWA 2HQNA 3GTQJ 5J8CA 1JT6A 2WB1N 3PNYA 2EIJH 5J40A 1SFKA 2D45A 5FKMA 4FT8A 1U5TA 1PUFB 4V2FA 4DQ2A 1LDDA 3RPUA 3OYCA 1VQMI 1KU3A 5A2QZ 4UNOA 1ZKGA 2OV7A 3T8RA 5BQTA 3F8NA 3KIOA 3SJMA 2Q2EB 4RMNA 1ZGWA 2DYRH 3V8KA 1E17A 2DFEA 2E5NA 4HNTA 3WHBA 2F5DA 3QWLA 4RGSA 1O4XA 2D1VA 1USTA 1YG2A 1Z91A 3J81Z 2KIQA 3F22A 3KYLA 2GWRA 4Q5SF 2Y0SN 2ELKA 2CQQA 4RB2C 1W5SA 3MEXA 2IGMA 2LKPA 2LYCA 4V2GA 3I4NJ 3P9IA 3BR0A 3HRUA 2DMTA 4LG0A 1FC3A 3N05A 2CQNA 4XBFA 4HBLA 1YS7A 2AHQA 4CGZA 2ADUA 3E6BA 5M5XJ 4WWCA 1P6RA 3S2WA 3P9KA 1ODDA 2ME0A 3IH3A 1FSHA 1SVLA 3IUOA 2DA4A 3MFKA 3WG9A 4HLYA 4HSTA 3I5UA 2KPMA 4IL6C 1WJFA 3JRBA 1D5YA 1R7JA 3A1YA 1JHHA 1UAAA 1X1DA 2XSDC 4BUPA 1JJ8C 1YW7A 3GYHX 4DYQA 2HXOA 1ZGJA 1JGGA 3PM1A 1MBJA 3SXYA 2EIMH 2K9MA 2RKHA 4KUMA 2QBYA 2XAUA 1LQ1A 4P5OA 2QCOA 4CCMA 1I39A 5DUKA 1IRGA 3FXRA 3NEUA 2V7FA 2UUZA 4ESJA 2LY2A 5C4JJ 2Z99A 1XTAA 2IPQX 2WV0A 3WGGA 3ZXSA 3N4MA 3OV8A 2KMUA 1NG7A 3RYPA 4XM3A 2L4AA 1MMGA 4HSRA 3HGGA 3DBHB 2JN6A 4Q4ZF 4HDVA 4NHJA 2DMPA 5L3DA 2M8GX 2BY0A 1QHGA 4MEXF 3ZN0A 2L7KA 2XGEA 5D5VB 4U87A 4RDUA 5IT3A 3JSOA 3ZCOA 3RQIA 1GLNA 4S0HB 1VQ9I 2BHZA 4M73A 1JE8A 2F5CA 2ICWG 3EUKL 3FKJA 5L3GA 4EMSA 5JLXA 4D7MA 2DBBA 4UV8A 3CO7C 1IN7A 3CC4I 2W7NA 1R23A 3V7CA 4QSHA 1YRNB 4G12A 2OTJI 4DZJA 1XCVA 3E6CC 4LJZF 4E6KG 1FSEA 1JKOC 2KISA 2F2EA 1OYYA 2HZDA 1IUFA 1IW7F 2L7ZA 3I59A 4CCOA 2PMZN 1OMIA 2GXGA 4W1UA 2E1CA 4A3CJ 3PFYA 5FKLA 1IXRC 1G3YA 1IXCA 2DJNA 3WU1B 3RZDJ 3LWFA 3S2DJ 3SZPA 2ECCA 5E3OA 3WTTC 2MH2A 4MTDA 4HNUA 4M9SA 5F27A 4RB3C 1V55H 3PSIA 1UHSA 4AYBA 1W36C 5EJCA 1QZYA 3ABKH 1AKHB 3S3NA 1FOYA 1TWCJ 3P7NA 2O9LA 4N9HA 2W48A 3HTSB 4IHVA 3RTRA 3PNVA 5LEKA 2JVGA 1HDDC 3DP7A 2M34A 2D2WA 3J80K 4EJWA 3FISA 1STZA 1JHFA 4XKCA 2QQ9A 3RDIA 5ED4A 5BPIA 3CO6C 2IS1A 1DP7P 5CKTA 1K83J 3WGHA 2O7OA 1U3EM 2XASA 1S7AA 3I71A 4X1EA 3I3LA 2GQQA 2NOGA 2L9VA 2EQRA 3ECOA 1FNNA 3BTJA 2VQLA 3KP7A 2K7LA 3A01B 2ISZA 2XV4S 3MMYB 4MIMA 2D5VA 1QQIA 1TT0A 4LOCA 4RLFA 2CFXA 1DUXC 2VONA 2XF7A 3BQYA 1RNLA 2PG4A 1Z1DA 3CCVI 3RKQA 5HODA 1ZYRF 1IRZA 4YFNF 1T98A 3KP2A 3WE3A 2JA2A 1WCMJ 3VSKA 3QPTA 3GFJA 1MMSA 3L7WA 2QLZA 3HOYJ 2M30A 3H3UA 5EGOB 1JTXA 3HSEA 1FTZA 3BJOA 2VJ5A 2HPMA 2O0YA 1XCBA 1WVRA 2QQBA 2O3FA 2YPRA 5E1XA 2QSHX 2KRFA 1VF9A 3CZ6A 2FEZA 1U8BA 1MNEA 2HKOA 4JOMA 4ZZLA 2EWNA 1H9GA 3GTJJ 1WI3A 4L5IA 4MTEA 1XPXA 1U8RA 1YX3A 3R0JA 2ZNZA 4HF0A 1YO5C 2D1HA 4XSXF 2NS8A 4PCQA 2XAQA 3JAMK 2YSRA 1MMDA 2R7FA 1WJ5A 2HOAA 3C3WA 5FKNA 2R5ZB 2C6YA 1H8AC 2FNPA 1FTTA 3Q0WA 2MFZA 5FROA 2EZIA 1W7PD 5EF6A 4G7OF 4Y15A 1XS9A 1F9NA 4BU2A 2XVCA 1R71A 3H35A 3BP8A 4D1QA 3COAC 5JR3A 1BL0A 1Z6TA 4B48A 1IC8A 1EH6A 3Q3SA 1WJEA 1LDKB 3I56I 1X1PA 1FBQA 4G6QA 5F64A 5IP7J 2VPRA 3BROA 1RUNA 2HOSA 2UWMA 4JX4A 2G7UA 3M9AA 2OQRA 1NK2P 1JXSA 4HRIA 2BZTA 3OYMA 4BXXJ 3CC7I 1D0YA 2E19A 2DT6A 2RV8A 5EEHA 1KU9A 4YEJA 1VQKI 4FCYA 3MZHA 3K4BA 4BHCA 5FRNA 1X3ZB 2M2EA 2HYFA 2GBYA 3MZ8A 1Y1WJ 2MH9A 2Z3YA
chains in the Genus database with same CATH topology
2X1CA 4KITB 3DTKA 2V9KA 2Y0SA 3CJQB 3OYHA 2CMPA 1MW7A 1QU3A 4XLEA 2RQQA 3H5NA 3PSFA 2X1EA 3L2UA 2XF6A 3BCAA 4XN0A 3DPLC 4KJZA 4BE1A 3HKZA 2JVHA 3ZGKA 2VLAA 2HVSA 2HNHA 1Z21A 3I9V2 3BCBA 3OYGA 1PJRA 4DJAA 2F5VA 1X1CA 2DJIA 3SYTA 1FMWA 4B44A 3G2BA 3MKWB 2KLOA 4HEA2 3M1CA 2VL8A 1D1CA 3M8JA 2DXIA 3EUHC 4U7BA 2K9LA 1D0ZA 4BXFA 1V5EA 1Z3YA 2KZVA 1IRXA 2ZXHA 2IGNA 2XSJC 3W2VA 2DT7B 4XMYA 3K4CA 4X0GA 2IS6A 4YRVA 5CPRB 4F91B 2LRDA 2GOXB 4BGDA 4PJNA 1U0JA 2R4GA 4XLCA 4AU7A 3OL3A 2WADA 2CS3A 4P1WA 1J09A 3S3OA 2E1MB 2AQFA 4HG2A 4E7SA 1VZ0A 2VB6A 4XNFA 3DKYA 2ZXIA 3V42A 3OYNA 3OS2A 1YX5A 4IQ4A 3VYUB 3PJRA 4BQNA 1KONA 3MD2A 2XC7A 2IGKA 5HLTA 2W4SA 3TMOA 4E7HA 1OLTA 3OR1C 3VYRB 2MYSA 2VXDA 2R7RA 4DBRA 2R7XA 3CJRB 3J7AY 2L5QA 3BG7A 3E1SA 4AVZA 4BL0B 5HVQC 2WY7Q 5KCMA 2KDOA 2VIXA 2ELJA 3PL8A 4BQOA 3HG9A 2KRCA 2VASA 2XDVA 4XLHA 4II2A 2ZFUA 2LH9A 2PMZA 4Y4RA 3DU6A 3HPHA 4H4KC 2VKHA 1QHHD 2W1OA 1LKXA 1YE9A 3DTEA 4HPQA 3H0DA 3U21A 3OL4A 3QYEA 1JI8A 2LOOA 4PJLA 4EATA 1AA7A 3D5RC 1HA8A 2R7QA 2CW7A 3QYFA 4GRIA 3TBIA 4BE0A 2M4KA 1LFPA 1WJAA 4BDYA 1DGRM 3SEQA 2R7WA 4OAZA 1MNDA 3RSNA 4E7KA 4J01A 2BOLA 1TZLA 2DOAA 4XORA 3CMMA 3D5LA 4IKFA 2KRHA 3OIPA 3OYLA 3QODA 4KT6A 3MKYB 1T0FC 4CCJA 3OWTA 2X6XA 3DKXA 2R7VA 4DGWB 4J00A 2CW8A 2M4GA 2LBFB 1WJCA 3VWBA 2MC4A 1OR7C 3MKZA 3OS1A 3D5SC 2WAQA 2I8DA 1DQUA 3W2AA 2X1DA 3CESA 4LITA 3LL7A 3VDXA 3ZRGA 1N78A 4E7LA 1UG0A 2CUZA 2GOMA 4PJJA 1X4PA 5LFAA 3ZQQA 3OYBA 2HVQA 2UV1A 3DTIA 3FHNA 5HNFA 2VJIA 2QKLB 1DGWY 3BLYA 2F6CA 3IAM2 1DP3A 3K70D 4F92B 3L2WA 3A4CA 4IZZA 3CP8A 2CV2A 2VPLA 3HXLA 3S8PA 3E0JB 4R79A 3AL0B 4ANJA 2X51A 3K4JA 4NQWB 2DCEA 3LSMA 3BG6A 3NWTA 3DU5A 1T95A 3CP2A 3PNYA 1SFKA 1UELB 2JSPA 4FASD 3OYEA 4ITVA 3OYCA 3OYDA 2O5RA 3CF2A 4XQFA 4OAYA 2QKMB 1G8XA 2OV7A 4C2TA 1ZELA 2IXSA 3K70C 2VKDA 1G59A 2HDWA 2Q2EB 4IX7A 3DEEA 2HQAA 4LG3A 4CH7A 4RM2A 4F55A 4RMNA 3SDBA 4XONA 1V5GA 4BEHB 2ZSIB 3LMMA 2E5NA 4HNTA 3OYFA 2VXZA 2W82A 1K6YA 1Z7LA 4E7IA 4N4OB 2LBFA 4BACA 3AFHA 3PUBA 3UNGC 3KX2A 1FMVA 3DLAA 3KYLA 3HL2A 1Z3XA 3PNTA 2IGMA 2LYCA 3QYBA 4RLQA 2R7TA 3N05A 4FETA 4CZCA 5KHDA 1Y56A 4PFPA 3H9QA 2A5WA 1WJDA 1D1AA 4ZDLA 4PFOA 2RNGA 5HNHA 4ZC3A 3IUOA 2W00A 3HOTA 3VYSB 4CSWA 4HSTA 2KPMA 1WJFA 3L2RA 3L2VA 1UAAA 3A1YA 1X1DA 4BUPA 4MLOA 4NC7A 1MMNA 4NC8A 2FUG2 5JHFA 2R7UA 2Z2SB 4BDZA 3C2HA 2CUJA 2K9MA 2BVLA 2L2OA 1N75A 2M7AA 2XAUA 4DOZA 3OYIA 4P5OA 1X1BA 4CCMA 2NOJB 2OUMA 2V7FA 2UUZA 1NG6A 4F3QA 2LY2A 4PUSA 3ZXSA 4ZTJA 2WB1A 2KMUA 1NG7A 2X6WA 4XM3A 4HSRA 1MMGA 2KQRA 4Y3OA 3OYKA 2IS4A 3FBNB 4E4HA 4BEHA 4LIUA 2IS2A 3TL4X 3FBIB 2CV0A 1BOBA 1QHGA 2LY1A 4YELA 2L7KA 4CCKA 4U87A 3LSKA 3FDYA 3ZCOA 2KHMA 1GLNA 2M7BA 4II3A 3EUKL 3FKJA 3IP4B 5CQEA 2WAFA 4CA0A 5LD2C 2A6TA 2L9NA 4B47A 3GBGA 3LSIA 3C2GA 3A2KA 2W7NA 3VSLA 3H9JA 2CV1A 2F4IA 4NNJA 2BVMA 4ZJZA 1BR2A 2E1MC 2WA0A 3W2WA 2IGOA 2R7OA 4B43A 4E6KG 4PK4A 4C2UA 2CFOA 1PYVA 5HOOA 2HZDA 2AQEA 2VJ4A 1BR4A 3KEYA 4CCOA 2LREA 4QPQA 2X6YA 4PJMA 3S3MA 4LIVA 2PJRB 4QPOA 3PFYA 2V26A 2HVRA 3K10A 4ZYAA 2KP6A 2WY8Q 2HPIA 3W3CA 2V4JC 1Y6IA 4XKWA 3QOEA 4HNUA 3DPUA 3PSIA 1W36C 3SEZA 4AYBA 4XN3A 2M3AA 4CCNA 3IAS2 3RPUD 4BJTA 3S3NA 4ZTFA 2CH0A 4XR6A 3SZGA 3K4LA 3S93A 4XL9A 4ZDOA 3RTRA 3PNVA 1ERDA 2JVGA 5TGTA 2KL4A 3DWLE 2JUGA 1V5FA 2K3PA 2BW3B 4F52A 1N77A 3H5AA 1D1BA 2ZSHB 4PSXA 2MABA 4XKCA 3K4NA 3NWSA 3ZR8X 4E7JA 1WFXA 2IS1A 5CKTA 2LG4A 4BE2A 2HU9A 3I3LA 4D9JA 4XLAA 3OMYA 3S32A 2LC2A 2VQLA 3DPTA 2E60A 1X19A 4XKVA 3RQ4A 2VQHA 4IQJA 1S9HA 1X4OA 2K5CA 3MMYB 2MD0A 4BJ5C 3BC8A 3OIQA 1TT0A 4RLFA 2XF7A 2M0MA 1D0XA 3OY9A 4XOPA 3OYJA 1WJBA 3EUAA 4XOTA 4BQQA 2OC6A 3H5RA 4BS9A 4ZDPA 1E0EA 2JA2A 3VSKA 2E5ZA 1R6RA 1SAUA 3LSGA 2VQGA 1MMAA 2VJ5A 1BR1A 2HPMA 2PJRA 3CZ6A 3LSHA 2V6EA 2X85A 4C9YA 1MNEA 3H9GA 4JOMA 5FRMA 3AKZA 3OR2C 2XF5A 1YX3A 3F9KA 4KISA 4PSWA 4XKBA 1MMDA 2L9SA 1WJ5A 4DBQA 3VYTB 4RM3A 4C30A 2MFZA 2RREA 4XLFA 1P9QC 4CCLA 3OS0A 5FROA 3L2QA 4CUGA 2BW3A 2WAEA 4OWRB 4BU2A 4JQFA 3DQVC 2Q1ZB 4NUBA 3LFUA 4BJ6C 3K4MA 3H35A 4D1QA 3OYAA 3AL0C 2Z16A 2V1NA 4B48A 3K6GA 5KNLA 1LVKA 4Y33A 1WJEA 1LDKB 4N4NB 3HOSA 4E7ZA 2WBMA 3K4KA 3OOUA 3HC7A 2P0WA 2VJJA 2Z1DA 1EA3A 2UWMA 4G6TB 3RCOA 4HRIA 4DIQA 1X1AA 3EPZA 3OYMA 1D0YA 2DT6A 4YEJA 2VQCA 1W36D 3K4BA 5FRNA 3HPGA 2R7SA 4F93B 5CQGA 3HUGB 4B3XA 3UR3C 3ONQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5N A;  2DOA A; 
#chains in the Genus database with same CATH topology
 1E3H A;  4FX4 A;  2O8K A;  3DTK A;  1MIJ A;  2MC3 A;  2Y0S A;  3KP6 A;  2CMP A;  1MW7 A;  2DQR A;  5K5O A;  2RQQ A;  1SD7 A;  1SAN A;  2H09 A;  2X1E A;  3HSR A;  2E1N A;  3OIO A;  2Z9O A;  2EBI A;  2XF6 A;  1UMQ A;  4XN0 A;  2IA1 A;  1TP4 A;  3MWM A;  3VPR A;  1O3T A;  1EV7 A;  1UHM A;  1YTY A;  1OIS A;  4HNV A;  2H1K A;  4UXN A;  1PJR A;  4DJA A;  2F5V A;  1X1C A;  4GFB A;  2H8R A;  1FMW A;  2JWT A;  3G2B A;  2R0Q C;  1SMY F;  3ZMD A;  1SFO J;  3CF5 F;  2O8X A;  3M8J A;  3ML6 A;  5CVJ A;  4IHY A;  3MN2 A;  1TWG J;  1V5E A;  4BXF A;  2KZV A;  1LPQ A;  3CCQ I;  2B9S A;  3DBL B;  3E6D A;  2TDX A;  5F04 A;  1KU2 A;  1OFC X;  1Y0U A;  2P4W A;  2NVY J;  4K2E A;  3FKI J;  4HQM A;  1ZRC A;  1HSJ A;  1XX5 A;  4QLC U;  3K4C A;  3GWZ A;  2IS6 A;  5HLH A;  1R9T J;  1BI3 A;  2JTV A;  4UHT A;  5J1Y A;  1TNT A;  2LDU A;  1J5Y A;  3CUO A;  4AIH A;  1W7P B;  4IO9 F;  2XGC A;  4HF1 A;  3E3V A;  4RA2 A;  2E1M B;  2FF4 A;  1RI7 A;  1EH7 A;  2PN6 A;  4E7S A;  3QPS A;  1CGP A;  4DYR A;  1DU0 A;  3RKW A;  3OYN A;  4IQ4 A;  5HS7 A;  3ABM H;  3VYU B;  4BKX A;  5D6E A;  2VOD A;  4CXF A;  5TIS C;  3MD2 A;  2IGK A;  2DO7 A;  4E7H A;  1O7F A;  3GXO A;  1ZRF A;  2R7R A;  2CQ7 A;  4DBR A;  2M9H A;  2VUM J;  2R7X A;  2L5Q A;  3LST A;  3QAH A;  1I1S A;  2V1D A;  2ISY A;  2ELJ A;  4YG2 F;  2DQL A;  5J3L A;  3H3Z A;  3D0S A;  2VOP A;  4BQO A;  4MHG A;  1YHQ I;  3DEW A;  2FQ3 A;  1C0W A;  3KZY A;  1J7K A;  1D3Y A;  2TRT A;  1FLI A;  3DFG A;  1K61 A;  2ZFU A;  2LH9 A;  2PMZ A;  4Y4R A;  5F6F A;  3DU6 A;  2DA7 A;  3HPH A;  5FGM A;  4BBS J;  2VN2 A;  3P9C A;  1JTY A;  3GTL J;  3VB2 A;  4QWQ A;  3DTE A;  5LHG A;  3H0D A;  3S17 J;  5D5U B;  5J4V A;  2H6C A;  3S2H J;  3F0C A;  1P7I A;  4EAT A;  3WGI A;  2X9D A;  2PQ8 A;  2G7H A;  3MAJ A;  1HA8 A;  2CW7 A;  1ETY A;  3ECH A;  2FBH A;  5IP9 J;  3LAJ A;  5FD5 A;  2HQR A;  1SMT A;  3TBI A;  1R00 A;  4BE0 A;  3M8F A;  2BE5 F;  2EFN A;  3MVP A;  2ZJ2 A;  2LKX A;  4OAZ A;  2VBY A;  2YX4 A;  1B72 B;  3M4O J;  5H2F C;  1F1Z A;  2E1O A;  2P5L C;  2NVT J;  3M8E A;  2NS0 A;  3GFI A;  5LBQ A;  3OYL A;  1MNM C;  4C2M J;  2BY2 A;  4G7Z F;  3QOD A;  1P92 A;  1ZK8 A;  3MKY B;  3IRQ A;  1I1G A;  2RNJ A;  1OKR A;  2VBX A;  2R3S A;  1VI0 A;  4DGW B;  1B8I B;  3IWF A;  3EQL F;  1BBY A;  5IT9 Z;  1OR7 C;  1YQA A;  3ULQ B;  4XLP F;  2WAQ A;  2YUS A;  4KNY A;  3OSF A;  1MDM A;  3AAF A;  4OIQ F;  2Z33 A;  1ORK A;  3VDX A;  2PMU A;  5DD4 A;  1LFB A;  2DN0 A;  2ZO4 A;  5E17 F;  3GTO J;  4IHS A;  2WWY A;  2ECB A;  2FSW A;  4NC6 A;  3HUG B;  5M3M J;  3EDP A;  1AU7 A;  4ZYG A;  3FHN A;  2VBZ A;  2IJL A;  4JX5 A;  2BY3 A;  4EM1 A;  1DGW Y;  4A12 A;  2F6C A;  4HV6 A;  3K70 D;  3L2W A;  2PLY A;  3CP8 A;  4B4C A;  1O3R A;  3FIW A;  3HXL A;  1OQY A;  4UVA A;  3AL0 B;  3ASO H;  1PP7 U;  4I6Z A;  4NQW B;  2DDB A;  1I6X A;  3GX4 X;  1SD5 A;  1O3S A;  3ABL H;  3ZQG A;  1FWZ A;  5E8G A;  1ZAO A;  4EJV A;  1UEL B;  2ID6 A;  2DOD A;  2FNA A;  2DAO A;  3JTH A;  3IH2 A;  3OYE A;  4I99 C;  2M45 A;  5E79 C;  2V79 A;  1ZR2 A;  4EJO A;  2LP0 A;  2HKX A;  3FK6 A;  4BHB A;  3VFZ A;  3RJP A;  1YW9 A;  1GHC A;  1G8X A;  1A6Q A;  3GUD A;  1A6I A;  3K9T A;  4I01 A;  3ZMT A;  1L0O C;  4B09 A;  1ZEL A;  2IXS A;  4UY8 I;  4J19 A;  1G4D A;  5JI6 A;  2G9W A;  2XB5 A;  2STT A;  1OYI A;  5IY5 H;  4LLN A;  2JPC A;  1XN7 A;  4RM2 A;  5B66 C;  1TL8 A;  1P4W A;  2P8T A;  3SDB A;  1V5G A;  4AC0 A;  2OZU A;  1FY7 A;  4BY7 J;  4BEH B;  3LMM A;  2XAJ A;  2CYY A;  3G73 A;  3R60 A;  2K9N A;  2BY1 A;  3OYF A;  4WK8 F;  4E7I A;  2IBD A;  2LBF A;  1BI1 A;  3QOP A;  2R7Z J;  3AFH A;  2LKS A;  3PUB A;  1S3J A;  3KX2 A;  3DLA A;  3GFL A;  2EA4 A;  2B7E A;  1HDP A;  1OPC A;  3FXM A;  1X3W B;  2QF7 A;  5EEG A;  4YFX F;  5FLX Z;  2LSO A;  4A0X A;  4A3L J;  4FET A;  5B1A H;  5KHD A;  5DEQ A;  1BN5 A;  4IF4 A;  1P7J A;  4KA4 A;  2XPU A;  4PFO A;  1K4T A;  4UB6 C;  5HNH A;  4G8X A;  2W00 A;  3ZMS A;  1B59 A;  1RES A;  3LSR A;  4IRH A;  1RIO H;  4CSW A;  3Q9V A;  2XIG A;  4L9J A;  2GXA A;  2J5P A;  3IRR A;  4MLO A;  4Y17 A;  1J0R A;  2R5Y B;  3VOE A;  4UUV A;  2R7D A;  3BJ6 A;  3JRI A;  4EGZ A;  2MD5 A;  1PUF A;  3Q0V A;  4BDZ A;  4CIC A;  1U2W A;  1ZLK A;  1I27 A;  2BVL A;  1MGT A;  2M7A A;  3RYR A;  3ZPL A;  1W1W E;  1NG6 A;  3CUQ B;  4PUS A;  3TW7 A;  2GM4 A;  2LLK A;  1ULY A;  2LMD A;  2Q2E A;  3LSJ A;  1GXQ A;  1UFM A;  2XGD A;  1WRJ A;  4EV0 A;  1HF0 A;  4E4H A;  3CME I;  4H0E A;  4L0Z B;  3HSF A;  3TL4 X;  4MFD A;  2CV0 A;  3R6S A;  4ENK A;  2LY1 A;  4FIS A;  3FDY A;  5LGU A;  3HYI A;  2KHM A;  2PBI A;  4II3 A;  2F4O B;  3ELK A;  3X2Q H;  2HWV A;  2H27 A;  1FOX A;  2HXI A;  1ZN2 A;  3F6O A;  1XG1 A;  5CQE A;  5KAI C;  5LD2 C;  2VC0 A;  2L9N A;  5D8K B;  4B47 A;  3DKW A;  2RAE A;  3A2K A;  2JUC A;  4W97 A;  3FK7 A;  1NK3 P;  2NYX A;  2P5K A;  3V4G A;  2GAU A;  5E3N A;  4NNJ A;  3NRV A;  1VQ6 I;  4E70 A;  4ZJZ A;  1EKE A;  2E1M C;  1LDJ A;  2HOE A;  4N0B A;  4B43 A;  4PK4 A;  4U0W A;  2K3F A;  2L7F P;  5HOO A;  3KEO A;  1O3Q A;  3C7J A;  4KN4 X;  4XRS G;  1IF1 A;  2HI3 A;  4ENN A;  1REP C;  2X6Y A;  1OCP A;  2HFH A;  4RGX A;  4MGR A;  5HDG A;  5LRS A;  2A69 F;  2JZY A;  1HKT A;  1OCR H;  3I53 A;  5ILS A;  5H20 A;  4XLN F;  2WY8 Q;  3W3C A;  4I0B A;  4MFE A;  4PDK A;  1VQ8 I;  4CCN A;  4CYC B;  3RPU D;  4ZTF A;  3HGY A;  5CVV A;  3JRF A;  4HQE A;  3K4L A;  1RKT A;  2NVU B;  3DLL F;  1ERD A;  3HHG A;  2KL4 A;  1APL C;  3HZJ A;  2JUG A;  2EFO A;  3SDG A;  3LA7 A;  2EV6 A;  4F52 A;  1S72 I;  3JR9 A;  2QSF X;  1FIA A;  3HRM A;  1UZC A;  2MAB A;  3I0T A;  1WFX A;  1FIP A;  2LG4 A;  3L1P A;  4JYK A;  2GZW A;  4RAZ A;  2COB A;  3JSP A;  2HU9 A;  3F6V A;  3K2A A;  3KZZ A;  2CJJ A;  1N25 A;  1K79 A;  1B6A A;  1RR7 A;  2YX7 A;  3HRS A;  3OMY A;  4GXO A;  1EF4 A;  3O3K A;  4JP0 A;  4M9X A;  1YJW I;  3DPT A;  4AD9 A;  3RQ4 A;  1F43 A;  1EH8 A;  4KDP A;  2XHK A;  1S9H A;  1X4O A;  2K5C A;  4Q48 A;  1WHU A;  3TQN A;  2HYG D;  4BJ5 C;  3BC8 A;  3OIQ A;  1DPR A;  5LHH A;  2JA5 J;  1UJ8 A;  1YRN A;  1O7L A;  2M0M A;  1WJB A;  4XOT A;  2V1U A;  4KMU X;  4F7Z A;  1K78 B;  1WPK A;  1RET A;  2DOE A;  3ISP A;  3MQ0 A;  5DUI A;  1T38 A;  2BHY A;  2IAI A;  3K2Z A;  2VQG A;  5LGN A;  3E7L A;  2TCT A;  2X4H A;  4HX8 A;  2FJ1 A;  3GO5 A;  4JBA A;  1CF7 A;  3LSH A;  5AON A;  3W6K B;  2Y75 A;  1OYW A;  1ZAR A;  1YW8 A;  5F0F A;  5GAE J;  1KYZ A;  1Z77 A;  4D0P A;  4ENM A;  2QM3 A;  3N97 A;  1AKH A;  5IYC J;  1NHA A;  4XKB A;  2L9S A;  1JGS A;  2VT2 A;  3VYT B;  1I50 J;  1GT0 C;  1OR7 A;  2WAE A;  4OWR B;  4R8H A;  5IYD J;  4ZYH A;  5LHI A;  2MBF A;  1TW3 A;  1VQO I;  3L09 A;  1V54 H;  3AL0 C;  3I4M J;  2Z16 A;  2N8G A;  3EYI A;  3I64 A;  5DTD A;  1TQP A;  2XPW A;  4L18 B;  3K6G A;  3O2P E;  1FYK A;  1LVK A;  1Z67 A;  5GTI C;  3HOS A;  1ZQ3 P;  4HX4 A;  2WBM A;  4R1H A;  2VJJ A;  2OU2 A;  2PEX A;  1U78 A;  2VKE A;  2QQ8 A;  1X1A A;  3EPZ A;  3CCY A;  2PI0 A;  3A01 A;  1T39 A;  3RI4 A;  2VQC A;  5EZG A;  2I10 A;  3HPG A;  3CDH A;  3BDD A;  5CYV A;  4F93 B;  5DS9 A;  3CCU I;  1VTN C;  4IHX A;  2R7S A;  5CQG A;  1XSV A;  1XGN A;  3ONQ A;  4A3K J;  3LQR A;  2QQA A;  1X58 A;  2V9K A;  3CJQ B;  2P5V A;  4G6D A;  5F0H A;  1A5J A;  5EGO A;  4UV9 A;  5AIQ A;  1D8K A;  1XMA A;  5KAF C;  1D5V A;  3BCA A;  1R49 A;  3BPV A;  1M1E B;  2DTZ A;  2JVH A;  4NBQ A;  1MSE C;  1KYW A;  3GZ6 A;  4HLX A;  1OCT C;  2NVX J;  4HA8 A;  4ETS A;  4A3M J;  3MKW B;  2KLO A;  3FXO A;  3M1C A;  3BOQ A;  5BS6 A;  2K4B A;  2DXI A;  3PO2 J;  1F4K A;  2MLK A;  1QVT A;  2DTR A;  4U7B A;  4I09 A;  2DA2 A;  2R5Z A;  3BR2 A;  3C18 A;  1IRX A;  3CTA A;  3IV5 A;  2Y31 A;  1F5T A;  5K7F A;  3KCC A;  2Y2Z A;  2XSJ C;  1W0U A;  1XGS A;  2DT7 B;  3LA3 A;  1FPQ A;  1BJA A;  2K9S A;  4F91 B;  4DZP A;  2LRD A;  5DCM B;  3WG7 H;  2ZFW A;  4MQV A;  3WTX C;  3K1N A;  3JRC A;  2DA5 A;  1U0J A;  2R4G A;  3GZ5 A;  2WAQ N;  4XLC A;  3WTY C;  3JCU C;  1ON1 A;  2JJ7 A;  4HW0 A;  2CS3 A;  3S3O A;  5ILU A;  2MLG A;  1WSU A;  3K1M A;  3ZN1 A;  2OAZ A;  3PUF A;  3T8T A;  4XNF A;  1ITY A;  3DKY A;  3TGN A;  1JJ6 C;  5LGT A;  2ZXI A;  3V42 A;  3WTZ A;  3OS2 A;  2CUE A;  2EA2 A;  1VFC A;  2LFB A;  4BQN A;  2IW5 A;  3HUG A;  5IPA A;  2K02 A;  2XC7 A;  2FML A;  4AIJ A;  2P7V B;  5DDG A;  4CDG A;  1BIB A;  4D7N A;  4U88 A;  4M6Y A;  4QIW N;  2QZ8 A;  5L3C A;  3ZOB A;  1J59 A;  2ZME B;  2CGP A;  2P6S A;  1R58 A;  2WY7 Q;  3H92 A;  5JVG F;  2VIX A;  3TO6 A;  5D4R A;  3H1C A;  3V8J A;  1IN6 A;  2AS5 F;  2A3S A;  3PL8 A;  1Q1H A;  2XKO A;  2VAS A;  2XDV A;  2L54 A;  1ETK A;  3FXQ A;  4UUS B;  2KIU A;  4XLH A;  2A61 A;  4WF2 A;  3NAU A;  1W5C C;  3BZ6 A;  1QHH D;  2W1O A;  3R0A A;  1YE9 A;  1U9N A;  4YIR X;  2XRO A;  2ZJP F;  3OL4 A;  1K7A A;  1SD4 A;  4AID A;  2LOO A;  3GME A;  3V7R A;  1AA7 A;  3D5R C;  1FOK A;  3JRD A;  3ROU A;  1XB4 A;  2EIN H;  3QYF A;  4GRI A;  2EB7 A;  2M4K A;  2DDA A;  3A0H C;  1DGR M;  1LE8 B;  5M3F J;  1MND A;  3RSN A;  3PIP F;  3ZQF A;  4UB8 C;  3K69 A;  3FM3 A;  3CMM A;  3D5L A;  1E2X A;  3OIP A;  2BBY A;  2JT1 A;  3LOC A;  1H89 C;  4KT6 A;  3C1D A;  1AHD P;  3G1O A;  4CCJ A;  4IHW A;  5ICE A;  4IVN A;  4A5M A;  3DKX A;  1XDS A;  1RZ4 A;  4MQ9 F;  1QPM A;  3TW6 A;  4GO1 A;  4J00 A;  1V3F A;  3VWB A;  1R1V A;  1R1T A;  3MKZ A;  3OS1 A;  3D5S C;  4A93 J;  1HKQ A;  2I8D A;  3BR3 A;  3W2A A;  1D8J A;  2A05 A;  1IDY A;  1P2F A;  5EG0 B;  3LL7 A;  3ZRG A;  2QEX I;  2MGQ A;  2CUZ A;  3GF2 A;  2GXB A;  2X0L A;  1O57 A;  2DA6 A;  3H3V K;  3OYB A;  4HDU A;  4G94 A;  3I4P A;  3T0Y A;  2DA3 A;  5ICF A;  5HNF A;  3PIO F;  3IAM 2;  1DP3 A;  3WTU C;  3FZV A;  3G4S I;  1U9O A;  5JVT A;  4KFC A;  3NQO A;  2CV2 A;  3V7S A;  3E0J B;  4ANJ A;  4FE7 A;  3QP5 A;  3Q5F A;  3DU5 A;  5K1Y A;  2L7M P;  1GV2 A;  5GTH C;  4OMY A;  1R36 A;  3KLO A;  4OIO F;  4ITV A;  2OD5 A;  2KJC A;  3OYD A;  1WWX A;  2O5R A;  3CF2 A;  3KPH A;  3U9G A;  1ETW A;  4AWX B;  2XRN A;  3BG9 A;  1SAX A;  5J1U A;  1A04 A;  1B72 A;  1S29 A;  2HDW A;  2FE3 A;  4IX7 A;  1LJ9 A;  1IJW C;  4BNC A;  4LG3 A;  2PFB A;  4WXC A;  3H0G J;  1ZHF A;  2E36 A;  1YS6 A;  3PQJ A;  1CQT A;  3KE2 A;  5L3B A;  2DFF A;  2H6B A;  1GXP A;  1MJA A;  1P4X A;  2VXZ A;  1K6Y A;  3E5Q A;  2Y9Y A;  2RQP A;  4N4O B;  4X6A J;  5EDN A;  3SFI A;  2ESN A;  1WI9 A;  4DYC A;  4AIK A;  3TP3 A;  4HZF A;  2YU9 J;  1FMV A;  2ETH A;  3KP3 A;  1YJ9 I;  3HL2 A;  3OOP A;  1Z3X A;  3BZC A;  5FD6 A;  4XRM A;  3QYB A;  2PX9 A;  2R7T A;  2DFI A;  4LD5 A;  4CZC A;  2EFW A;  3R61 A;  5A2Q K;  3RZO J;  1QGP A;  2PJP A;  1JT0 A;  1Z05 A;  5FLM J;  3H9Q A;  2L3D A;  1WJD A;  4OMZ A;  4U7D A;  2RNG A;  2H94 A;  1SEU A;  2MA3 A;  3M1E A;  4U0V A;  4O3M A;  4ZC3 A;  1TQI A;  5J8F A;  3WHC A;  5ICC A;  3R4K A;  5DM6 F;  3WTS C;  2F4M B;  4A5N A;  3VYS B;  1IGN A;  4NQW A;  3L2R A;  3L2V A;  2EH3 A;  1GVJ A;  3BJA A;  5GAH J;  1B4A A;  2FUG 2;  3CMA I;  3O8G A;  3ABT A;  4ESB A;  3C2H A;  2L2O A;  2W25 A;  4JX6 A;  4DOZ A;  1ENH A;  1X1B A;  3CDI A;  1YI2 I;  4MEY F;  5IOY A;  3J81 K;  2NOJ B;  5HLI A;  3REO A;  2KDZ A;  2VE9 A;  5M5W J;  1S8N A;  2Y0M A;  1XGO A;  4I2O A;  2CUF A;  1Y1V J;  2X6W A;  1X3U A;  5HLG A;  2KQR A;  4Y3O A;  3OYK A;  2OJE D;  4OIN F;  1EJ9 A;  2OPT A;  4S05 A;  2NVQ J;  1LFU P;  3LNQ A;  3DV8 A;  4BEH A;  1FP2 A;  4A3E J;  5HDK A;  5CLS A;  1VQ4 I;  2IS2 A;  5E3L A;  1BA5 A;  1HST A;  4N9I A;  5E3M A;  2HGC A;  3E5U A;  4P9U A;  4DNC A;  1PUE E;  1VQL I;  3G3Z A;  4CCK A;  1OCZ H;  4Z6Y A;  3LSK A;  2JRM A;  2M7B A;  4MO7 A;  2HZT A;  3BR5 A;  2FOK A;  1BOA A;  3IP4 B;  2WAF A;  4CA0 A;  3BZK A;  4A69 C;  2XAG A;  3GBG A;  3LSI A;  1FX7 A;  2LNB A;  3J80 Z;  5ERI A;  4RAF A;  2HTJ A;  2KT0 A;  3VSL A;  2ACJ A;  3H9J A;  5CVI A;  2CV1 A;  6PAX A;  2AXT C;  2BVM A;  4P96 A;  5DCF A;  2LD5 A;  2JA7 J;  3W2W A;  2QEN A;  4ZYE A;  3CJN A;  4C2U A;  1PYV A;  2ZCW A;  2BEO A;  2EFQ A;  3FXJ A;  2AQE A;  3KEY A;  1YLF A;  1P4A A;  1RPW A;  5L3F A;  3DBR B;  3QP6 A;  3JRA A;  4PJM A;  3S3M A;  1SFU A;  4LIV A;  2PJR B;  1BI2 A;  4QPO A;  1ZG5 A;  2W24 A;  4KYW A;  3CCS I;  3K10 A;  4ZYA A;  2WC2 A;  1ZLJ A;  2KP6 A;  3I55 I;  2V4J C;  2PMH A;  3S14 J;  3S1Q J;  1Y6I A;  2R5Y A;  2O6G E;  4BAY A;  2KFD A;  2RDP A;  3QOE A;  3DPU A;  3G1L A;  2AXL A;  2ZME C;  3WOD F;  1IRF A;  1I3A A;  3IAS 2;  2WTE A;  2XAH A;  4BJT A;  4A3I J;  2CH0 A;  3SZG A;  3S93 A;  4L9N A;  1W0T A;  2P6T A;  3T5X A;  3ESW B;  3DWL E;  5GP9 A;  3CLO A;  1V5F A;  2K3P A;  2BW3 B;  1TBX A;  3F8C A;  5GAG J;  1KQ8 A;  2HDD A;  1MBG A;  5E1Z B;  3H5A A;  4IRI A;  1D1B A;  4PSX A;  3NWS A;  3HM5 A;  1B9M A;  1JUP A;  4FHT A;  5GPC A;  2HEO A;  1HOM A;  1K4S A;  4TV7 A;  4D9J A;  4XLA A;  1ETX A;  3JAM Z;  4EM0 B;  1R5G A;  2KIM A;  1X19 A;  1MKM A;  2VQH A;  4IQJ A;  5FB2 A;  1HW1 A;  3Q0U A;  2KJB A;  2M1B A;  4BQA A;  3GCM A;  4LK1 F;  4XOP A;  4AVP A;  4CO8 A;  4A3J J;  1WH7 A;  1FOW A;  2A6E F;  4A6E A;  2OC6 A;  1HW5 A;  1V4R A;  4BS9 A;  1RUO A;  3ZQL A;  3HOZ J;  2DT5 A;  1MDM B;  5C4X J;  3CCM I;  1R6R A;  2P81 A;  2Q0O A;  1TTY A;  2A07 F;  3TDU C;  1DDN A;  3FF5 A;  3ZMV A;  1W5T A;  5F08 A;  4FTH A;  3E6M A;  1MMA A;  1BR1 A;  4KIF A;  3S1R J;  1HC8 A;  3A03 A;  2E2I J;  3SZT A;  1Z0X A;  3IKT A;  3W6V A;  3SHF A;  4C9Y A;  5FRM A;  3AKZ A;  5AIP A;  2I5U A;  4Y7N J;  2L01 A;  3OR2 C;  2XF5 A;  2FBI A;  2W85 A;  4KIS A;  4DBQ A;  4IOA F;  2YS9 A;  5JHU A;  4CCL A;  1P9Q C;  4CUG A;  4BXU A;  2XGX A;  3DQV C;  3L2C A;  2X6O A;  4NUB A;  3A02 A;  1R4M B;  3LFU A;  4BJ6 C;  2M87 A;  5KNL A;  4Y33 A;  5E8I A;  3JW4 A;  1BC7 C;  2VC1 A;  2XAF A;  3K4K A;  3OOU A;  3HC7 A;  1KA8 A;  2Z1D A;  2STW A;  4G6T B;  1BW6 A;  2EFP A;  4NDL A;  2FD5 A;  4DIQ A;  3FMQ A;  3HOX J;  3CCJ I;  1HCR A;  4M3B A;  2EV5 A;  1UHW A;  4G9Y A;  4O5V A;  1IXS B;  2IRF G;  3HOU J;  3CJT B;  3F3X A;  4HYE A;  3ZQC A;  1ETO A;  3UR3 C;  5D5W B;  1BJZ A;  4RGR A;  4IXA A;  2X1C A;  1ZRD A;  4M3F A;  4XRS A;  3ZMU A;  2UXN A;  1JKQ C;  5FJ8 J;  9ANT A;  4V19 K;  2WV1 A;  2ZJR F;  5TRD A;  3H5N A;  3PSF A;  1ON2 A;  3B6C A;  1ZR4 A;  3O8H A;  1OCC H;  5J4Y A;  4ENJ A;  3WU0 A;  1I3Q J;  3BR6 A;  3HKZ A;  4C3J J;  1T33 A;  2VLA A;  1AOY A;  2HVS A;  1Z21 A;  3KP5 A;  3I9V 2;  3BCB A;  5IOZ A;  1H9T A;  2IP2 A;  3K1P A;  2DJI A;  2FQ4 A;  2RGV A;  5LRR A;  4B44 A;  3LFK A;  1L3L A;  1QRY A;  3ZQ7 A;  4HEA 2;  3ASN H;  4D5F A;  3WE2 A;  1USS A;  4MNU A;  1VQ7 I;  2GA2 A;  3DEU A;  3EUH C;  4Q47 A;  3HEF A;  3BTL A;  2K9L A;  2IT0 A;  1QBJ A;  3IC7 A;  5C3E J;  3BT9 A;  1I6H J;  1LVA A;  3TDZ C;  1VQN I;  4RGU A;  2K27 A;  1T2K A;  3QU6 A;  4YRV A;  2EIK H;  4XK4 A;  5J47 A;  4A3G J;  2UXX A;  4RS8 A;  2AO9 A;  4BGD A;  1TW2 A;  4BH9 A;  4M74 A;  4AU7 A;  5EYR A;  4C3I J;  3QPL A;  1KGS A;  3OL3 A;  1PDN C;  1T6S A;  2F5E A;  3J7Y J;  2O61 A;  1POG A;  4RAY A;  2AQF A;  4HG2 A;  1UG2 A;  2FX0 A;  4OU0 A;  2VB6 A;  3LAP A;  1YYV A;  2JQ7 A;  2M0C A;  3KFW X;  2UZK A;  1I5Z A;  3ZMZ A;  1YX5 A;  2NXN B;  2V9P A;  2J5O A;  2YR2 A;  1KON A;  3IKV A;  5EZH A;  1QPI A;  2W4S A;  3FMR A;  4XRF A;  3P5J A;  3OR1 C;  2E7X A;  2MYS A;  2V1X A;  4M6V A;  1R22 A;  4XID A;  3CJR B;  1YJN I;  3E1S A;  4AVZ A;  1PVE A;  2HQ5 A;  5HVQ C;  3M7G A;  5IP6 A;  2CU7 A;  3CCE I;  3UKG A;  2L0K A;  3HG9 A;  5EEA A;  3G1M A;  3TP0 A;  3U1K A;  2E35 A;  1S6L A;  5H6R A;  1SFE A;  1YFH A;  5JLW A;  4I7H A;  1YIT I;  2FOW A;  2O03 A;  3U21 A;  1JI8 A;  5J1R A;  1HKS A;  2FRH A;  4PJL A;  3NAR A;  1ZGA A;  1U5T B;  5FKO A;  1ZG1 A;  1WH5 A;  5DM7 F;  2R7Q A;  4A3D J;  2EZL A;  1VQP I;  1JKP C;  1LFP A;  1MJ9 A;  5DCM A;  1WJA A;  4BDY A;  3SEQ A;  2R7W A;  1XC5 A;  4E7K A;  3FXL A;  1HXD A;  4HV5 A;  1MBE A;  1FP1 D;  1TZL A;  2DOA A;  4XOR A;  4A6D A;  4IKF A;  4A3F J;  3FMS A;  2DMU A;  4WXH A;  1T0F C;  2K40 A;  3O6B B;  2FU4 A;  1ZRE A;  2JSC A;  1A35 A;  2HS5 A;  4LLG F;  3AG3 H;  2XKP A;  3QRF F;  1G6N A;  2MC4 A;  1BIA A;  1ETV A;  4IRG A;  2Y9Z A;  2A6H F;  2NRA C;  2YU3 A;  1DQU A;  1R5I D;  3CDL A;  2EZH A;  4IPA A;  1IUY A;  4YII A;  1BI0 A;  4M72 A;  2VKV A;  2NNN A;  5DV5 A;  5FFZ A;  5K5R A;  2EZK A;  2GOM A;  3GLL A;  3RKX A;  4D5C A;  2ZME A;  4IEJ A;  3EYY A;  2Y48 A;  3ZQQ A;  2ZB9 A;  3J7Z I;  2UV1 A;  4LG0 B;  2E2H J;  3MZY A;  5IYB J;  1MBK A;  4UUS A;  2QKL B;  3V8L A;  4EVI A;  3JRH A;  4F92 B;  5BPD A;  2LF8 A;  3KLN A;  5BMZ A;  2NAZ A;  5TJJ A;  3S8P A;  2X51 A;  2DPU A;  1XD7 A;  2DCE A;  2OF7 A;  3IWZ A;  3NWT A;  1CF7 B;  3ZQI A;  1T95 A;  3CP2 A;  3VOD A;  3F8B A;  3I58 A;  2DMQ A;  2KKO A;  4I76 A;  2JSP A;  2LK2 A;  4FAS D;  4S04 A;  1WZ2 A;  4GGG A;  4C3H J;  2EK5 A;  5IT9 K;  2QBY B;  1SD6 A;  3F72 A;  1FYM A;  2VBW A;  4XQF A;  1TWH J;  5HS9 A;  2EV0 A;  4OAY A;  2QKM B;  3GZN B;  1G3T A;  2LR8 A;  3T1B A;  4B1R A;  1TT5 B;  4C2T A;  1LE8 A;  2GIZ A;  5KK1 A;  2VKD A;  3K70 C;  4QTR A;  2HYJ A;  2IA0 A;  1G59 A;  4FX0 A;  5ILV A;  1WQ2 A;  2DLL A;  1G3S A;  3DEE A;  2HQA A;  4CH7 A;  1QNT A;  3BG3 A;  4YFK F;  3JRG A;  4F55 A;  1S5L C;  4XON A;  5F1R A;  2ZSI B;  4KIB A;  2CQX A;  3CUQ C;  4BBR J;  2COM A;  2E34 A;  2W82 A;  1Z7L A;  1DU6 A;  1GVD A;  4BAC A;  2XUB A;  4Y52 J;  5H6Q A;  2LVS A;  3UNG C;  4LFU A;  1ACI A;  1IV8 A;  2QYO A;  1XMK A;  2DW4 A;  4KIG A;  5EG0 A;  1AWC A;  2OBP A;  3PNT A;  1J9I A;  4RLQ A;  2QSG X;  2Z5U A;  2DYS H;  2EIL H;  2OCC H;  1FEX A;  1J75 A;  2DMN A;  3M07 A;  3CCL I;  1Y56 A;  5JFR A;  4IOC F;  1FBS A;  3BQZ A;  1JUS A;  4PFP A;  3KEQ A;  4UUT A;  2L02 A;  2A5W A;  3TOA A;  1D1A A;  4ZDL A;  2ID3 A;  3I59 B;  1SC7 A;  2VE8 A;  3HOT A;  4XSZ F;  2ME6 A;  2JA6 J;  5B1B H;  5LEJ A;  4NC7 A;  4BYY A;  5M5Y J;  1MMN A;  2V6C A;  1RR8 C;  4ESF A;  4NC8 A;  1Z6R A;  1S7E A;  5JHF A;  3QQA A;  2R7U A;  3RKY A;  2Z2S B;  5HDN A;  2CUJ A;  3WTW C;  4Y13 A;  1N75 A;  3OYI A;  3BWG A;  4B3A A;  4WX9 A;  2OUM A;  2VOO A;  2CW0 F;  4F3Q A;  1K6O A;  4L9V A;  1W7P A;  4L5E A;  4ZTJ A;  1G2H A;  2WB1 A;  2DK8 A;  2Y69 H;  5D8L B;  2FXA A;  2K86 A;  5E18 F;  1W4M A;  5FLX K;  1XDU A;  3BTC A;  4LMY A;  3CCR I;  2IS4 A;  3FBN B;  4NB5 A;  1NTC A;  2DPD A;  4LIU A;  2CQK A;  3LQQ A;  3FBI B;  2GA1 A;  4LB5 A;  1BOB A;  5HS8 A;  2OQG A;  4YEL A;  3BR1 A;  3AG1 H;  4EM2 A;  1VND A;  4U0Y A;  4UVC A;  3FXK A;  3WTV C;  2V9V A;  4ABZ A;  2VI6 A;  3IHU A;  4OIR F;  3JTG A;  2RC4 A;  2A6T A;  3KYC B;  1OJL A;  3U2R A;  3C2G A;  1RRJ A;  4Z2Y A;  4IJA A;  1GDT A;  2F4I A;  3EUH A;  1TQM A;  2A5Y B;  3K7A J;  1BR2 A;  1X2N A;  4P9F A;  2WA0 A;  2IGO A;  2R7O A;  5C44 J;  1DPU A;  2CFO A;  2FBK A;  3PO3 J;  3ERE D;  2VJ4 A;  1BR4 A;  1XSD A;  3B73 A;  3IL2 A;  2LRE A;  4QPQ A;  4JK1 X;  4OOI A;  1QZE A;  3SQN A;  1XSX A;  2V26 A;  3LA2 A;  2HVR A;  1F36 A;  5BOX A;  4WCG A;  2HPI A;  2ESH A;  3M3Y J;  1ZTR A;  3KYD B;  4M3G A;  4XKW A;  3C2B A;  4PGG A;  3L9F A;  3SEZ A;  4UVB A;  1KQ9 A;  4XN3 A;  2M3A A;  3W6J B;  2ELH A;  1UB9 A;  4EEF G;  4I98 B;  2Y30 A;  3CLQ A;  4XR6 A;  4XL9 A;  2JPB A;  3CD6 I;  4A2U A;  4ZDO A;  1A36 A;  3ERM A;  1SVM A;  5TGT A;  2OA4 A;  2K4J A;  4HOB A;  2DK5 A;  4ZYD A;  4PJ0 C;  2B0L A;  5FO5 A;  2NNY A;  3S1M J;  3GTG J;  2ZBK A;  1ETQ A;  3ZQH A;  4A0Z A;  1N77 A;  1QA6 A;  4E7J A;  2ZSH B;  3K4N A;  3ZR8 X;  2ZJQ F;  4FQG A;  4LGW A;  2GLO A;  2JA8 J;  1MJB A;  1B8I A;  3GW2 A;  3GVA A;  5B5E C;  1TWA J;  2CSO A;  4P55 A;  4BE2 A;  2F48 A;  1XMX A;  3FX3 A;  2OCE A;  1LEA A;  3E5X A;  2BYV E;  3WU2 C;  1FZP B;  1Z9C A;  3BG5 A;  1RC9 A;  1U5T C;  2OZ6 A;  2JK3 A;  2QVO A;  3S32 A;  4CZZ A;  2QWW A;  1GV5 A;  2LC2 A;  2DU9 A;  3CQZ J;  2KIF A;  2E60 A;  4XKV A;  2Q8K A;  2CWE A;  1Y8R B;  2XRL A;  2MD0 A;  2E2J J;  3TOB A;  3HHH A;  4ZZD A;  2MG4 A;  1BC8 C;  5B3S H;  1D0X A;  3OY9 A;  2FA5 A;  3OYJ A;  3HKZ N;  2IEK A;  1T8I A;  3EUA A;  4BQQ A;  4DW6 A;  3H5R A;  4BY1 J;  4ZDP A;  2EPF A;  4O6J A;  1E0E A;  5LLQ A;  2E5Z A;  1Z7U A;  2P7C B;  1SAU A;  3LSG A;  4BHP A;  4M3D A;  1FYL A;  1WGX A;  3S16 J;  2RVC A;  2PJR A;  2ZNY A;  1MZB A;  2E71 A;  2V6E A;  1IZ1 A;  3LSP A;  2X85 A;  3H9G A;  3FM5 A;  4GCV A;  2H1L A;  4I0A A;  2W84 A;  1UCR A;  3G71 I;  3F9K A;  1WKM A;  1T0F A;  3BPX A;  4PSW A;  2IA2 A;  3B6A A;  1B1B A;  1KZH A;  3KP4 A;  4RM3 A;  4C30 A;  1YIO A;  2RRE A;  4XLF A;  3G6E I;  3OS0 A;  3L2Q A;  2FMY A;  1H88 C;  2BW3 A;  4PZJ A;  2DOF A;  4JQF A;  3PFI A;  2R92 J;  1GUU A;  3GLX A;  1E3P A;  2Q1Z B;  3MKL A;  3OYA A;  3K4M A;  2K85 A;  4GDF A;  1SFX A;  1Y8Q B;  4G7H F;  3F8F A;  1KU7 A;  2V1N A;  2HOT A;  4N4N B;  1HBX G;  1Y0N A;  4E7Z A;  4L5J A;  5DD8 A;  3HIF A;  4YIF A;  2P0W A;  3TO7 A;  1EA3 A;  2OTL I;  4EGY A;  1LB2 A;  2IVM A;  3RCO A;  2NS7 A;  2RN7 A;  3K0L A;  1TNS A;  4LLL A;  1R5H A;  2ZC2 A;  5CVR A;  1W36 D;  3S1N J;  4I02 A;  4KN7 X;  4B3X A;  1B9N A;  2HR3 A;  5K5Q A;  4KIT B;  2LF7 A;  1QO0 D;  5F1J A;  1E3O C;  3U1D A;  3OYH A;  2CG4 A;  1QU3 A;  4XLE A;  1IDZ A;  1MSF C;  2R93 J;  3DCF A;  3L2U A;  1U6G A;  5BNG A;  3DPL C;  1FJL A;  4KJZ A;  2GIV A;  3RIR A;  4LB6 B;  4BE1 A;  1T56 A;  1ZG3 A;  4EJU A;  3ZGK A;  3CC2 I;  4A3B J;  4HF2 A;  2HNH A;  4EQQ A;  2HDC A;  5KVR A;  3OYG A;  1HQC A;  4FE4 A;  3SYT A;  1HLV A;  4KT5 C;  3TKY A;  1QVU A;  1R1U A;  1ZH5 A;  4HAM A;  5E20 A;  1G3W A;  2VL8 A;  3DXJ F;  2MSY A;  4EJT A;  1D1C A;  5GAD J;  5CVU A;  1IG7 A;  1NH3 A;  1SVO A;  3CUQ A;  5D4S A;  1FBU A;  5DYM A;  3L00 A;  5K7H A;  1D0Z A;  3CMY A;  1Z3Y A;  2VT3 A;  3EET A;  5CJ9 A;  2ZXH A;  3DF8 A;  4CHU A;  2IGN A;  3W2V A;  3GTK J;  4XMY A;  3A0B C;  4X0G A;  3QU3 A;  2QUF A;  2DI3 A;  5CPR B;  3ABU A;  2BXZ A;  3MCZ A;  1T08 B;  2GOX B;  4PJN A;  3KET A;  1Y39 A;  3TO9 A;  3VEP A;  4ON0 A;  2K9Q A;  2JMW A;  2WAD A;  1IO2 A;  3FXU A;  3I54 A;  3HBL A;  4P1W A;  1J09 A;  4ASN A;  1BW5 A;  5GPA A;  2B63 J;  2X48 A;  1J2X A;  4M71 A;  4XIC A;  1Q1V A;  2CO5 A;  3GTM J;  4AUX A;  1VZ0 A;  1IN4 A;  1OCO H;  5L3E A;  5ICG A;  3FWE A;  1HW2 A;  3OSG A;  1IN5 A;  2W57 A;  3PJR A;  2DA1 A;  5FKK A;  2MW8 A;  5HLT A;  3D1N I;  1VQ5 I;  4RB1 A;  2M5W A;  2ZXJ A;  3TMO A;  3HTU A;  4L9T A;  2BV6 A;  1MD0 A;  1OLT A;  3VYR B;  2VXD A;  3AG4 H;  1PP8 F;  3J7A Y;  3BG7 A;  1TLH B;  2HTS A;  4BL0 B;  2XPV A;  4PGH A;  5KCM A;  2KDO A;  3IH4 A;  1JKR C;  2H8W A;  4HX7 A;  2KRC A;  3Q9S A;  4KMF A;  3HOW J;  4II2 A;  1IN8 A;  2F5F A;  3HB9 A;  4AYB N;  4H4K C;  2VKH A;  4LK0 F;  4CYC A;  3F23 A;  3J7A O;  4GYG A;  1LKX A;  2XB0 X;  4KIC A;  2M8E A;  4HPQ A;  3QYE A;  3H36 A;  4M6X A;  4L0Y B;  3GFM A;  2EJR A;  1YIJ I;  3F21 A;  1KQ0 A;  3JRE A;  2A68 F;  3AG2 H;  2LY9 A;  4CYD A;  1ONV A;  4AM3 A;  2LTP A;  1MH4 A;  5F0C A;  3TED A;  1FT9 A;  2BGC A;  1JUM A;  1IV6 A;  3ZP5 A;  3GTP J;  4RB0 A;  4IHT A;  5K7Z A;  3GEZ A;  4J01 A;  5FFX A;  2BOL A;  4RBO A;  3B02 A;  2E7W A;  2KZG A;  2KRH A;  4RAG A;  1H0M A;  2CRG A;  1TC3 C;  1A31 A;  2G0E A;  3RPQ A;  3OWT A;  3HDD A;  5D5X B;  2X6X A;  3E97 A;  2R7V A;  4A0Y A;  1RKW A;  1YOV B;  2CW8 A;  2M4G A;  2LBF B;  1WJC A;  5E1W A;  2L4M A;  2ZKZ A;  1K78 A;  1LUJ B;  1LEB A;  2X1D A;  3S15 J;  3CES A;  2QGU A;  4LIT A;  4M9Z A;  4ZH4 F;  2QA4 I;  3PQK A;  3SFZ A;  4E7L A;  1N78 A;  1R4N B;  1MBF A;  1UG0 A;  5J6X A;  4PJJ A;  3BTI A;  1X4P A;  5LFA A;  5FLV A;  4WXD A;  2HVQ A;  1BM9 A;  1LNW A;  3HJE A;  3FHZ A;  1XGM A;  2DFH A;  3DTI A;  4B8X A;  5D6F A;  2VJI A;  3KZI C;  1MH3 A;  2BXY A;  3F8M A;  3BLY A;  3HOV J;  1TWF J;  2ZXW H;  1X2M A;  1S7O A;  1QZZ A;  3A4C A;  3HRT A;  2JRT A;  4IZZ A;  4OIP F;  4GYI A;  2VPL A;  1MBH A;  4R79 A;  4M3E A;  3BY6 A;  3QPH A;  3K4J A;  3LSM A;  2L9R A;  3BG6 A;  1IAW A;  2HQN A;  3GTQ J;  5J8C A;  1JT6 A;  2WB1 N;  3PNY A;  2EIJ H;  5J40 A;  1SFK A;  2D45 A;  5FKM A;  4FT8 A;  1U5T A;  1PUF B;  4V2F A;  4DQ2 A;  1LDD A;  3RPU A;  3OYC A;  1VQM I;  1KU3 A;  5A2Q Z;  4UNO A;  1ZKG A;  2OV7 A;  3T8R A;  5BQT A;  3F8N A;  3KIO A;  3SJM A;  2Q2E B;  4RMN A;  1ZGW A;  2DYR H;  3V8K A;  1E17 A;  2DFE A;  2E5N A;  4HNT A;  3WHB A;  2F5D A;  3QWL A;  4RGS A;  1O4X A;  2D1V A;  1UST A;  1YG2 A;  1Z91 A;  3J81 Z;  2KIQ A;  3F22 A;  3KYL A;  2GWR A;  4Q5S F;  2Y0S N;  2ELK A;  2CQQ A;  4RB2 C;  1W5S A;  3MEX A;  2IGM A;  2LKP A;  2LYC A;  4V2G A;  3I4N J;  3P9I A;  3BR0 A;  3HRU A;  2DMT A;  4LG0 A;  1FC3 A;  3N05 A;  2CQN A;  4XBF A;  4HBL A;  1YS7 A;  2AHQ A;  4CGZ A;  2ADU A;  3E6B A;  5M5X J;  4WWC A;  1P6R A;  3S2W A;  3P9K A;  1ODD A;  2ME0 A;  3IH3 A;  1FSH A;  1SVL A;  3IUO A;  2DA4 A;  3MFK A;  3WG9 A;  4HLY A;  4HST A;  3I5U A;  2KPM A;  4IL6 C;  1WJF A;  3JRB A;  1D5Y A;  1R7J A;  3A1Y A;  1JHH A;  1UAA A;  1X1D A;  2XSD C;  4BUP A;  1JJ8 C;  1YW7 A;  3GYH X;  4DYQ A;  2HXO A;  1ZGJ A;  1JGG A;  3PM1 A;  1MBJ A;  3SXY A;  2EIM H;  2K9M A;  2RKH A;  4KUM A;  2QBY A;  2XAU A;  1LQ1 A;  4P5O A;  2QCO A;  4CCM A;  1I39 A;  5DUK A;  1IRG A;  3FXR A;  3NEU A;  2V7F A;  2UUZ A;  4ESJ A;  2LY2 A;  5C4J J;  2Z99 A;  1XTA A;  2IPQ X;  2WV0 A;  3WGG A;  3ZXS A;  3N4M A;  3OV8 A;  2KMU A;  1NG7 A;  3RYP A;  4XM3 A;  2L4A A;  1MMG A;  4HSR A;  3HGG A;  3DBH B;  2JN6 A;  4Q4Z F;  4HDV A;  4NHJ A;  2DMP A;  5L3D A;  2M8G X;  2BY0 A;  1QHG A;  4MEX F;  3ZN0 A;  2L7K A;  2XGE A;  5D5V B;  4U87 A;  4RDU A;  5IT3 A;  3JSO A;  3ZCO A;  3RQI A;  1GLN A;  4S0H B;  1VQ9 I;  2BHZ A;  4M73 A;  1JE8 A;  2F5C A;  2ICW G;  3EUK L;  3FKJ A;  5L3G A;  4EMS A;  5JLX A;  4D7M A;  2DBB A;  4UV8 A;  3CO7 C;  1IN7 A;  3CC4 I;  2W7N A;  1R23 A;  3V7C A;  4QSH A;  1YRN B;  4G12 A;  2OTJ I;  4DZJ A;  1XCV A;  3E6C C;  4LJZ F;  4E6K G;  1FSE A;  1JKO C;  2KIS A;  2F2E A;  1OYY A;  2HZD A;  1IUF A;  1IW7 F;  2L7Z A;  3I59 A;  4CCO A;  2PMZ N;  1OMI A;  2GXG A;  4W1U A;  2E1C A;  4A3C J;  3PFY A;  5FKL A;  1IXR C;  1G3Y A;  1IXC A;  2DJN A;  3WU1 B;  3RZD J;  3LWF A;  3S2D J;  3SZP A;  2ECC A;  5E3O A;  3WTT C;  2MH2 A;  4MTD A;  4HNU A;  4M9S A;  5F27 A;  4RB3 C;  1V55 H;  3PSI A;  1UHS A;  4AYB A;  1W36 C;  5EJC A;  1QZY A;  3ABK H;  1AKH B;  3S3N A;  1FOY A;  1TWC J;  3P7N A;  2O9L A;  4N9H A;  2W48 A;  3HTS B;  4IHV A;  3RTR A;  3PNV A;  5LEK A;  2JVG A;  1HDD C;  3DP7 A;  2M34 A;  2D2W A;  3J80 K;  4EJW A;  3FIS A;  1STZ A;  1JHF A;  4XKC A;  2QQ9 A;  3RDI A;  5ED4 A;  5BPI A;  3CO6 C;  2IS1 A;  1DP7 P;  5CKT A;  1K83 J;  3WGH A;  2O7O A;  1U3E M;  2XAS A;  1S7A A;  3I71 A;  4X1E A;  3I3L A;  2GQQ A;  2NOG A;  2L9V A;  2EQR A;  3ECO A;  1FNN A;  3BTJ A;  2VQL A;  3KP7 A;  2K7L A;  3A01 B;  2ISZ A;  2XV4 S;  3MMY B;  4MIM A;  2D5V A;  1QQI A;  1TT0 A;  4LOC A;  4RLF A;  2CFX A;  1DUX C;  2VON A;  2XF7 A;  3BQY A;  1RNL A;  2PG4 A;  1Z1D A;  3CCV I;  3RKQ A;  5HOD A;  1ZYR F;  1IRZ A;  4YFN F;  1T98 A;  3KP2 A;  3WE3 A;  2JA2 A;  1WCM J;  3VSK A;  3QPT A;  3GFJ A;  1MMS A;  3L7W A;  2QLZ A;  3HOY J;  2M30 A;  3H3U A;  5EGO B;  1JTX A;  3HSE A;  1FTZ A;  3BJO A;  2VJ5 A;  2HPM A;  2O0Y A;  1XCB A;  1WVR A;  2QQB A;  2O3F A;  2YPR A;  5E1X A;  2QSH X;  2KRF A;  1VF9 A;  3CZ6 A;  2FEZ A;  1U8B A;  1MNE A;  2HKO A;  4JOM A;  4ZZL A;  2EWN A;  1H9G A;  3GTJ J;  1WI3 A;  4L5I A;  4MTE A;  1XPX A;  1U8R A;  1YX3 A;  3R0J A;  2ZNZ A;  4HF0 A;  1YO5 C;  2D1H A;  4XSX F;  2NS8 A;  4PCQ A;  2XAQ A;  3JAM K;  2YSR A;  1MMD A;  2R7F A;  1WJ5 A;  2HOA A;  3C3W A;  5FKN A;  2R5Z B;  2C6Y A;  1H8A C;  2FNP A;  1FTT A;  3Q0W A;  2MFZ A;  5FRO A;  2EZI A;  1W7P D;  5EF6 A;  4G7O F;  4Y15 A;  1XS9 A;  1F9N A;  4BU2 A;  2XVC A;  1R71 A;  3H35 A;  3BP8 A;  4D1Q A;  3COA C;  5JR3 A;  1BL0 A;  1Z6T A;  4B48 A;  1IC8 A;  1EH6 A;  3Q3S A;  1WJE A;  1LDK B;  3I56 I;  1X1P A;  1FBQ A;  4G6Q A;  5F64 A;  5IP7 J;  2VPR A;  3BRO A;  1RUN A;  2HOS A;  2UWM A;  4JX4 A;  2G7U A;  3M9A A;  2OQR A;  1NK2 P;  1JXS A;  4HRI A;  2BZT A;  3OYM A;  4BXX J;  3CC7 I;  1D0Y A;  2E19 A;  2DT6 A;  2RV8 A;  5EEH A;  1KU9 A;  4YEJ A;  1VQK I;  4FCY A;  3MZH A;  3K4B A;  4BHC A;  5FRN A;  1X3Z B;  2M2E A;  2HYF A;  2GBY A;  3MZ8 A;  1Y1W J;  2MH9 A;  2Z3Y A; 
#chains in the Genus database with same CATH homology
 2X1C A;  4KIT B;  3DTK A;  2V9K A;  2Y0S A;  3CJQ B;  3OYH A;  2CMP A;  1MW7 A;  1QU3 A;  4XLE A;  2RQQ A;  3H5N A;  3PSF A;  2X1E A;  3L2U A;  2XF6 A;  3BCA A;  4XN0 A;  3DPL C;  4KJZ A;  4BE1 A;  3HKZ A;  2JVH A;  3ZGK A;  2VLA A;  2HVS A;  2HNH A;  1Z21 A;  3I9V 2;  3BCB A;  3OYG A;  1PJR A;  4DJA A;  2F5V A;  1X1C A;  2DJI A;  3SYT A;  1FMW A;  4B44 A;  3G2B A;  3MKW B;  2KLO A;  4HEA 2;  3M1C A;  2VL8 A;  1D1C A;  3M8J A;  2DXI A;  3EUH C;  4U7B A;  2K9L A;  1D0Z A;  4BXF A;  1V5E A;  1Z3Y A;  2KZV A;  1IRX A;  2ZXH A;  2IGN A;  2XSJ C;  3W2V A;  2DT7 B;  4XMY A;  3K4C A;  4X0G A;  2IS6 A;  4YRV A;  5CPR B;  4F91 B;  2LRD A;  2GOX B;  4BGD A;  4PJN A;  1U0J A;  2R4G A;  4XLC A;  4AU7 A;  3OL3 A;  2WAD A;  2CS3 A;  4P1W A;  1J09 A;  3S3O A;  2E1M B;  2AQF A;  4HG2 A;  4E7S A;  1VZ0 A;  2VB6 A;  4XNF A;  3DKY A;  2ZXI A;  3V42 A;  3OYN A;  3OS2 A;  1YX5 A;  4IQ4 A;  3VYU B;  3PJR A;  4BQN A;  1KON A;  3MD2 A;  2XC7 A;  2IGK A;  5HLT A;  2W4S A;  3TMO A;  4E7H A;  1OLT A;  3OR1 C;  3VYR B;  2MYS A;  2VXD A;  2R7R A;  4DBR A;  2R7X A;  3CJR B;  3J7A Y;  2L5Q A;  3BG7 A;  3E1S A;  4AVZ A;  4BL0 B;  5HVQ C;  2WY7 Q;  5KCM A;  2KDO A;  2VIX A;  2ELJ A;  3PL8 A;  4BQO A;  3HG9 A;  2KRC A;  2VAS A;  2XDV A;  4XLH A;  4II2 A;  2ZFU A;  2LH9 A;  2PMZ A;  4Y4R A;  3DU6 A;  3HPH A;  4H4K C;  2VKH A;  1QHH D;  2W1O A;  1LKX A;  1YE9 A;  3DTE A;  4HPQ A;  3H0D A;  3U21 A;  3OL4 A;  3QYE A;  1JI8 A;  2LOO A;  4PJL A;  4EAT A;  1AA7 A;  3D5R C;  1HA8 A;  2R7Q A;  2CW7 A;  3QYF A;  4GRI A;  3TBI A;  4BE0 A;  2M4K A;  1LFP A;  1WJA A;  4BDY A;  1DGR M;  3SEQ A;  2R7W A;  4OAZ A;  1MND A;  3RSN A;  4E7K A;  4J01 A;  2BOL A;  1TZL A;  2DOA A;  4XOR A;  3CMM A;  3D5L A;  4IKF A;  2KRH A;  3OIP A;  3OYL A;  3QOD A;  4KT6 A;  3MKY B;  1T0F C;  4CCJ A;  3OWT A;  2X6X A;  3DKX A;  2R7V A;  4DGW B;  4J00 A;  2CW8 A;  2M4G A;  2LBF B;  1WJC A;  3VWB A;  2MC4 A;  1OR7 C;  3MKZ A;  3OS1 A;  3D5S C;  2WAQ A;  2I8D A;  1DQU A;  3W2A A;  2X1D A;  3CES A;  4LIT A;  3LL7 A;  3VDX A;  3ZRG A;  1N78 A;  4E7L A;  1UG0 A;  2CUZ A;  2GOM A;  4PJJ A;  1X4P A;  5LFA A;  3ZQQ A;  3OYB A;  2HVQ A;  2UV1 A;  3DTI A;  3FHN A;  5HNF A;  2VJI A;  2QKL B;  1DGW Y;  3BLY A;  2F6C A;  3IAM 2;  1DP3 A;  3K70 D;  4F92 B;  3L2W A;  3A4C A;  4IZZ A;  3CP8 A;  2CV2 A;  2VPL A;  3HXL A;  3S8P A;  3E0J B;  4R79 A;  3AL0 B;  4ANJ A;  2X51 A;  3K4J A;  4NQW B;  2DCE A;  3LSM A;  3BG6 A;  3NWT A;  3DU5 A;  1T95 A;  3CP2 A;  3PNY A;  1SFK A;  1UEL B;  2JSP A;  4FAS D;  3OYE A;  4ITV A;  3OYC A;  3OYD A;  2O5R A;  3CF2 A;  4XQF A;  4OAY A;  2QKM B;  1G8X A;  2OV7 A;  4C2T A;  1ZEL A;  2IXS A;  3K70 C;  2VKD A;  1G59 A;  2HDW A;  2Q2E B;  4IX7 A;  3DEE A;  2HQA A;  4LG3 A;  4CH7 A;  4RM2 A;  4F55 A;  4RMN A;  3SDB A;  4XON A;  1V5G A;  4BEH B;  2ZSI B;  3LMM A;  2E5N A;  4HNT A;  3OYF A;  2VXZ A;  2W82 A;  1K6Y A;  1Z7L A;  4E7I A;  4N4O B;  2LBF A;  4BAC A;  3AFH A;  3PUB A;  3UNG C;  3KX2 A;  1FMV A;  3DLA A;  3KYL A;  3HL2 A;  1Z3X A;  3PNT A;  2IGM A;  2LYC A;  3QYB A;  4RLQ A;  2R7T A;  3N05 A;  4FET A;  4CZC A;  5KHD A;  1Y56 A;  4PFP A;  3H9Q A;  2A5W A;  1WJD A;  1D1A A;  4ZDL A;  4PFO A;  2RNG A;  5HNH A;  4ZC3 A;  3IUO A;  2W00 A;  3HOT A;  3VYS B;  4CSW A;  4HST A;  2KPM A;  1WJF A;  3L2R A;  3L2V A;  1UAA A;  3A1Y A;  1X1D A;  4BUP A;  4MLO A;  4NC7 A;  1MMN A;  4NC8 A;  2FUG 2;  5JHF A;  2R7U A;  2Z2S B;  4BDZ A;  3C2H A;  2CUJ A;  2K9M A;  2BVL A;  2L2O A;  1N75 A;  2M7A A;  2XAU A;  4DOZ A;  3OYI A;  4P5O A;  1X1B A;  4CCM A;  2NOJ B;  2OUM A;  2V7F A;  2UUZ A;  1NG6 A;  4F3Q A;  2LY2 A;  4PUS A;  3ZXS A;  4ZTJ A;  2WB1 A;  2KMU A;  1NG7 A;  2X6W A;  4XM3 A;  4HSR A;  1MMG A;  2KQR A;  4Y3O A;  3OYK A;  2IS4 A;  3FBN B;  4E4H A;  4BEH A;  4LIU A;  2IS2 A;  3TL4 X;  3FBI B;  2CV0 A;  1BOB A;  1QHG A;  2LY1 A;  4YEL A;  2L7K A;  4CCK A;  4U87 A;  3LSK A;  3FDY A;  3ZCO A;  2KHM A;  1GLN A;  2M7B A;  4II3 A;  3EUK L;  3FKJ A;  3IP4 B;  5CQE A;  2WAF A;  4CA0 A;  5LD2 C;  2A6T A;  2L9N A;  4B47 A;  3GBG A;  3LSI A;  3C2G A;  3A2K A;  2W7N A;  3VSL A;  3H9J A;  2CV1 A;  2F4I A;  4NNJ A;  2BVM A;  4ZJZ A;  1BR2 A;  2E1M C;  2WA0 A;  3W2W A;  2IGO A;  2R7O A;  4B43 A;  4E6K G;  4PK4 A;  4C2U A;  2CFO A;  1PYV A;  5HOO A;  2HZD A;  2AQE A;  2VJ4 A;  1BR4 A;  3KEY A;  4CCO A;  2LRE A;  4QPQ A;  2X6Y A;  4PJM A;  3S3M A;  4LIV A;  2PJR B;  4QPO A;  3PFY A;  2V26 A;  2HVR A;  3K10 A;  4ZYA A;  2KP6 A;  2WY8 Q;  2HPI A;  3W3C A;  2V4J C;  1Y6I A;  4XKW A;  3QOE A;  4HNU A;  3DPU A;  3PSI A;  1W36 C;  3SEZ A;  4AYB A;  4XN3 A;  2M3A A;  4CCN A;  3IAS 2;  3RPU D;  4BJT A;  3S3N A;  4ZTF A;  2CH0 A;  4XR6 A;  3SZG A;  3K4L A;  3S93 A;  4XL9 A;  4ZDO A;  3RTR A;  3PNV A;  1ERD A;  2JVG A;  5TGT A;  2KL4 A;  3DWL E;  2JUG A;  1V5F A;  2K3P A;  2BW3 B;  4F52 A;  1N77 A;  3H5A A;  1D1B A;  2ZSH B;  4PSX A;  2MAB A;  4XKC A;  3K4N A;  3NWS A;  3ZR8 X;  4E7J A;  1WFX A;  2IS1 A;  5CKT A;  2LG4 A;  4BE2 A;  2HU9 A;  3I3L A;  4D9J A;  4XLA A;  3OMY A;  3S32 A;  2LC2 A;  2VQL A;  3DPT A;  2E60 A;  1X19 A;  4XKV A;  3RQ4 A;  2VQH A;  4IQJ A;  1S9H A;  1X4O A;  2K5C A;  3MMY B;  2MD0 A;  4BJ5 C;  3BC8 A;  3OIQ A;  1TT0 A;  4RLF A;  2XF7 A;  2M0M A;  1D0X A;  3OY9 A;  4XOP A;  3OYJ A;  1WJB A;  3EUA A;  4XOT A;  4BQQ A;  2OC6 A;  3H5R A;  4BS9 A;  4ZDP A;  1E0E A;  2JA2 A;  3VSK A;  2E5Z A;  1R6R A;  1SAU A;  3LSG A;  2VQG A;  1MMA A;  2VJ5 A;  1BR1 A;  2HPM A;  2PJR A;  3CZ6 A;  3LSH A;  2V6E A;  2X85 A;  4C9Y A;  1MNE A;  3H9G A;  4JOM A;  5FRM A;  3AKZ A;  3OR2 C;  2XF5 A;  1YX3 A;  3F9K A;  4KIS A;  4PSW A;  4XKB A;  1MMD A;  2L9S A;  1WJ5 A;  4DBQ A;  3VYT B;  4RM3 A;  4C30 A;  2MFZ A;  2RRE A;  4XLF A;  1P9Q C;  4CCL A;  3OS0 A;  5FRO A;  3L2Q A;  4CUG A;  2BW3 A;  2WAE A;  4OWR B;  4BU2 A;  4JQF A;  3DQV C;  2Q1Z B;  4NUB A;  3LFU A;  4BJ6 C;  3K4M A;  3H35 A;  4D1Q A;  3OYA A;  3AL0 C;  2Z16 A;  2V1N A;  4B48 A;  3K6G A;  5KNL A;  1LVK A;  4Y33 A;  1WJE A;  1LDK B;  4N4N B;  3HOS A;  4E7Z A;  2WBM A;  3K4K A;  3OOU A;  3HC7 A;  2P0W A;  2VJJ A;  2Z1D A;  1EA3 A;  2UWM A;  4G6T B;  3RCO A;  4HRI A;  4DIQ A;  1X1A A;  3EPZ A;  3OYM A;  1D0Y A;  2DT6 A;  4YEJ A;  2VQC A;  1W36 D;  3K4B A;  5FRN A;  3HPG A;  2R7S A;  4F93 B;  5CQG A;  3HUG B;  4B3X A;  3UR3 C;  3ONQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...