2E5NA

Solution structure of the ell_n2 domain of target of rna polymerase ii elongation factor ell2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
GSSGSSGTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II elongation factor ELL2
publication title Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e5nA00
2DOAA 2E5NA
chains in the Genus database with same CATH superfamily
4E6KG 2M0CA 2I8DA 1DPRA 1W5SA 1Q1HA 2UUZA 1V5EA 3S16J 3NQOA 1YQAA 3L09A 2DK8A 1R1VA 3KZZA 4LJZF 3VSLA 1LVAA 2GA1A 1T0FA 5AIQA 2V4JC 4M9ZA 2HU9A 2ECCA 2F2EA 2MABA 2R5ZA 1W1WE 1GV5A 2CW0F 2LREA 1T0FC 4W97A 4AYBN 4QTRA 3CMYA 5FRNA 3GF2A 4KUMA 1YLFA 2OA4A 4RLQA 4IRHA 4RM3A 3RDIA 3JRBA 1Y8QB 2ICWG 2HDDA 2WAQA 3W6VA 1RKWA 3HGGA 3GFMA 1MNEA 4RAZA 3DV8A 5CJ9A 2XAUA 4A6EA 4UV9A 1H9TA 4HEA2 4OIPF 3U1DA 2PX9A 1WVRA 1Z6RA 2W48A 4ZYGA 1UELB 2RAEA 3E1SA 5K7HA 4XORA 1SFOJ 4C2TA 1UCRA 3CESA 1ETQA 2EBIA 4IZZA 4L0YB 1U2WA 3KYCB 1JKOC 5IP9J 4NC7A 2F5VA 3HRSA 3KEOA 3A01A 2JN6A 1IRZA 4A2UA 3JRFA 2CW8A 2NRAC 2GA2A 3DTKA 4XRMA 4XL9A 2Q1ZB 3RZDJ 3QAHA 4Y15A 1LKXA 3HOZJ 3TGNA 2W84A 2RN7A 4YFXF 3MKYB 4BQNA 1U9OA 3CF2A 2KMUA 2MLKA 2HR3A 4LK0F 2LY9A 1D0YA 1WI3A 3J7ZI 4Y13A 5FKOA 3E6MA 3L2UA 3A0BC 1U5TA 1HW1A 3JRAA 1V3FA 2WB1A 3R0JA 4AD9A 1HC8A 2IGMA 2XGXA 2H09A 2WTEA 2JA2A 1I5ZA 1ZRDA 2QGUA 3F8NA 2R7DA 1LEAA 3FXRA 2RGVA 2ZXIA 4U87A 2NS0A 1PUEE 2FXAA 5H6RA 4EJUA 4WXCA 2R93J 3HSRA 5LEKA 1EA3A 1BI2A 3LSIA 1Y1VJ 2B63J 1EV7A 1P4XA 1UJ8A 1S5LC 4PFPA 1IW7F 2E60A 1DPUA 2LSOA 1WJDA 3FZVA 1TQPA 3WG7H 1IUYA 3S1MJ 3OYFA 1IDZA 1KZHA 3OMYA 1MBKA 4G12A 2IA1A 5FLXZ 3HPHA 2Z2SB 1Z1DA 3TEDA 2Q8KA 1QPIA 1OCPA 3KZIC 4XN3A 3H92A 3R61A 4NQWA 4FISA 3OOPA 5HLGA 2DMTA 3E7LA 4XONA 3T5XA 3P9KA 5DUIA 1YJNI 2QBYA 2V7FA 2EZIA 3D5SC 2F5FA 3OIPA 1XGNA 5D5XB 2HTSA 1VQ8I 3PL8A 2PMHA 2WAEA 2R7VA 2C6YA 4XICA 3IWFA 2CW7A 3IH4A 1GLNA 4M3DA 2OQGA 4HDVA 4NUBA 5B1AH 2FNAA 1S6LA 2YSRA 1JXSA 2JSPA 2GLOA 5DCFA 2HVRA 1F9NA 1MMAA 5K5OA 4QPOA 2HYJA 2HVQA 1EH7A 3ZQFA 5E8IA 1B1BA 2DDAA 4ESFA 1W36C 1BC7C 2RQQA 3W2WA 2R7OA 2FOWA 1YX3A 4YFNF 1ACIA 2CRGA 4ZDPA 3BZCA 3K4MA 1MDMA 1JUMA 4DGWB 1YTYA 4E70A 1AU7A 1USTA 2LTPA 5BQTA 1EH8A 2J5OA 3BG9A 2XDVA 4JX4A 2AS5F 3HHHA 5D8LB 2OTLI 1K79A 5ICEA 4WX9A 1R58A 2HOEA 5L3DA 5LRRA 1RNLA 2JRMA 3FM3A 2NVQJ 3QU3A 3CDHA 4BACA 4F7ZA 1SMYF 3CO7C 2V6EA 4A3CJ 1I3AA 3KFWX 2E34A 1X4PA 4FE4A 2COMA 3B02A 4LLLA 3RQIA 3S8PA 1SANA 1DP3A 4A5MA 4GXOA 3J81K 2K86A 2GIVA 4XRFA 1FBUA 5CYVA 3K1PA 3IAM2 4YIIA 1ETOA 2QVOA 1IN5A 2JTVA 4EJWA 3J80K 1YO5C 1O7FA 5E3OA 2IAIA 1YIJI 2XRNA 1I6HJ 2W82A 3SZTA 3KEYA 5B1BH 3G6EI 3KETA 5EEHA 3LSMA 2EZLA 3E5QA 4Y7NJ 5HLTA 4A6DA 1R4MB 4XKBA 3TKYA 2EJRA 3OYNA 1IXSB 1PDNC 2V6CA 1F1ZA 4WWCA 3GTPJ 3C3WA 4XLFA 3WG9A 4KITB 5C44J 1ERDA 5JHUA 3FKJA 1XMAA 3FXUA 4B3XA 2ID3A 3OYLA 1IUFA 4O6JA 4BEHA 3ZQIA 3DKWA 3PFYA 1O7LA 1IV8A 2RV8A 1HW5A 1MJBA 2JK3A 3L1PA 2DLLA 2DTRA 4DBRA 1SD6A 2AHQA 3E97A 3HKZA 4M6YA 2VJIA 5FKNA 3BR1A 2MG4A 3CUQA 3NARA 1ZQ3P 1XDUA 2IS2A 3BZ6A 2X1DA 1KQ8A 2CUJA 2L3DA 2EFQA 2F4OB 2RNGA 4Y17A 5IOZA 3QPTA 3N05A 1REPC 3ELKA 5BS6A 3K70D 3C2BA 3DCFA 1LFUP 3OYCA 2O8XA 1G4DA 1EJ9A 2QCOA 2NYXA 2XGEA 3OIOA 1U8BA 1DUXC 1X1DA 1VQ9I 4BXFA 3TDUC 3PIOF 4I2OA 1T98A 3JCUC 2IW5A 2Z3YA 2EZKA 3I4NJ 2Z16A 1R5GA 3OY9A 2CV1A 5CVUA 2HDWA 3MD2A 4KN4X 2CH0A 3LFUA 2CUZA 2K4JA 4IRGA 3REOA 3BT9A 2Y9ZA 2TRTA 5DV5A 1PP7U 3HSEA 2E2IJ 3ABMH 4DQ2A 2K4BA 3QODA 1UG0A 2DFHA 1WFXA 3BCAA 3MQ0A 4FASD 2M4GA 2QF7A 3VYSB 1DU0A 4YIRX 3I9V2 3ZOBA 1BJZA 3K6GA 4HX8A 2GXBA 2UXNA 4I0BA 4HV5A 4K2EA 3EPZA 1XGSA 4DOZA 4RB2C 1I1GA 3HC7A 1S72I 4EJTA 2R5ZB 5D6EA 4Q47A 1FC3A 2KRCA 4BYYA 2BY0A 3FMSA 2LD5A 1QPMA 4I7HA 3KE2A 1C0WA 2P0WA 4AVPA 3S3MA 5F6FA 3DU5A 2FBHA 2I10A 4G6DA 3EQLF 5C3EJ 1LE8A 2DYSH 4CICA 2VJ5A 1Z0XA 1T6SA 2DMPA 2DN0A 1HF0A 3QOEA 1GV2A 2K5CA 3GCMA 2K3FA 3ABKH 3PQJA 4N4OB 5HS9A 2O8KA 3RYRA 3A01B 2KHMA 4C30A 3CO6C 1NHAA 4U7BA 1PVEA 1MZBA 5F04A 4CYDA 1D0XA 1U0JA 5KHDA 4EJOA 3O8HA 1OCCH 3FHZA 1HKQA 3GFLA 5JVGF 5F0HA 1AKHA 5IYBJ 3M3YJ 3LSGA 1XX5A 2CG4A 2WAFA 4I09A 3ZMSA 3OS0A 4KA4A 1E17A 3L2RA 2A5YB 4A3EJ 3DQVC 4IQJA 1TTYA 2CQQA 2G7HA 1U5TB 1KA8A 5D6FA 2A6TA 4UVBA 5GP9A 2JRTA 1TT0A 2FD5A 3C1DA 3LSKA 4A3GJ 1G8XA 1P9QC 4Y4RA 4H4KC 2JA7J 1ZR4A 4HAMA 2YUSA 4AIKA 2NS7A 4IPAA 2JUGA 4JK1X 3HRUA 4D9JA 3PO3J 3L2QA 2DT7B 1IG7A 2B9SA 2EINH 5TISC 4Y52J 1SFUA 4FTHA 1FX7A 3R60A 2P4WA 1V55H 5CVRA 5LBQA 3J7YJ 2OCEA 4B1RA 1EH6A 3HBLA 3CUOA 3OR1C 2NOJB 3H36A 1VF9A 1B6AA 2BY1A 2O03A 3DEEA 1XSXA 2FQ4A 4NC6A 4XNFA 5DEQA 1POGA 1MMNA 2WV1A 2XASA 1WJEA 1JGGA 4HW0A 4E7KA 5CLSA 2L9SA 5LRSA 2NOGA 2L4MA 2KJBA 1HA8A 4AM3A 2XF6A 1XCVA 4NQWB 2EIMH 4KDPA 2M30A 2EIKH 1I27A 2IT0A 4MO7A 2QBYB 2AO9A 2BBYA 4OMYA 3FHNA 3KCCA 5BOXA 1W0UA 4CYCA 5EJCA 2GQQA 2KLOA 2PQ8A 3BJ6A 4ANJA 1G6NA 1TWAJ 1KQ0A 5JI6A 3KYDB 1T2KA 3JRDA 2R7QA 2WA0A 4OU0A 4PZJA 2VBZA 3ZPLA 2L0KA 4DBQA 1W0TA 3DBRB 4HRIA 4EVIA 3DFGA 5D5UB 1KU7A 4BKXA 4QIWN 2P7VB 2KIUA 4QSHA 2P81A 3S3OA 2LF7A 4B47A 4EM1A 5FO5A 4BDZA 2VQLA 3LQRA 3LWFA 1RESA 1XB4A 2EA4A 2R7XA 3S17J 9ANTA 2DTZA 2ZXJA 1MDMB 3SDGA 4ZZLA 2F5DA 1ZG5A 2NXNB 5IY5H 2AXTC 2P6TA 2P8TA 2PMUA 1R22A 2H94A 1YHQI 4W1UA 3KX2A 2W57A 1FOXA 4LLGF 1O3RA 1TNSA 5J8CA 3UNGC 3IKVA 4UB8C 3K69A 2FOKA 3FBIB 2FF4A 1XSVA 1LUJB 2X6YA 5FRMA 2HFHA 2ME0A 2JA6J 2WADA 5F64A 5J8FA 3IL2A 1K7AA 2JA5J 1HKSA 4MGRA 3U2RA 4BH9A 3O2PE 4BY1J 1YW9A 1S9HA 5IP6A 2MD0A 2V9VA 2ZNZA 1MGTA 2CO5A 1A35A 2VL8A 2Y31A 3FXKA 2DXIA 1LFBA 4ETSA 2EFNA 1Y8RB 2NVYJ 3K4CA 3K4LA 3ZQHA 4A3DJ 2YS9A 2XKPA 4XLNF 1OYWA 2PMZN 3L2VA 3HXLA 3BTJA 3WU2C 3GTQJ 1ZREA 2M7BA 3DTIA 3ABUA 4IOCF 4UV8A 4RB0A 1IAWA 1OR7C 4HSTA 2MW8A 4XOTA 3QYEA 3OS1A 2Z9OA 2ETHA 2LH9A 2OPTA 3F22A 4A0YA 5A2QZ 4RMNA 1SC7A 4HLYA 1IV6A 2JUCA 4F3QA 1SVLA 3ERMA 4XBFA 2RVCA 1NTCA 4BEHB 1QNTA 2EIJH 1FJLA 2RNJA 2OU2A 4CXFA 4GFBA 1OCZH 4F91B 2VN2A 3CUQB 1MJAA 2DYRH 1Z7LA 4HQEA 2R92J 3HEFA 5IYCJ 3OL3A 3CZ6A 3Q0UA 4D7MA 4EEFG 3TO7A 4L0ZB 6PAXA 5EZHA 3KYLA 2JT1A 5EYRA 2HGCA 5ILVA 3GLXA 3I53A 3P5JA 5HDGA 1WJCA 3CTAA 5FD5A 4YIFA 3M1EA 2F6CA 2FRHA 4HX7A 1J59A 2DJNA 2DO7A 3CF5F 2VI6A 1N77A 3FXMA 4KIFA 1SVMA 2DJIA 1VTNC 2D2WA 3LL7A 1R7JA 3S14J 5E79C 2VQGA 4XKCA 3PNVA 3BR6A 3QWLA 4F55A 2GAUA 3FXOA 4WF2A 2BVMA 3CQZJ 3M9AA 1Z3YA 1WJFA 3CCVI 2XF7A 3ASNH 1MD0A 2MC4A 2MH2A 1O3TA 1GUUA 4ENMA 4MTDA 3V7SA 1J2XA 3F23A 1ZGWA 2LBFA 1ZGJA 4EM2A 2IA0A 3PUFA 1E3HA 3MWMA 3L00A 3B73A 2X6WA 2VODA 3T8RA 2M8GX 1BC8C 1YX5A 3PJRA 5D4SA 3K1MA 2QQ8A 3RPUA 4CSWA 2HPIA 3SFIA 1SD5A 2P5KA 3ECOA 2YX4A 2E35A 5FKKA 4G7ZF 2OZ6A 4ZTFA 4OOIA 5IP7J 5KAFC 2PJRA 3TO6A 2V1NA 5BPIA 3WTUC 3HDDA 2A05A 3RI4A 1MBGA 2KRHA 1WSUA 3U1KA 1FLIA 2HOTA 1LNWA 4L9VA 3E6CC 2ZKZA 1SAXA 4M3BA 1QHGA 2O61A 1LE8B 2M9HA 2DMQA 2R3SA 2HI3A 1NK2P 3MZHA 2VT2A 1ZYRF 2F5EA 2E5ZA 2DMNA 2A6EF 2FA5A 2IPQX 4BS9A 4YEJA 3J7AY 3IRRA 1JE8A 1FYLA 1SFKA 1YI2I 4FE7A 3SHFA 4J19A 1YITI 2QQBA 4ENKA 4MLOA 1RC9A 3DKYA 4UUSA 2H6BA 1JTXA 1OYIA 4H0EA 3HYIA 2L01A 4AC0A 1VQOI 2X51A 3AG2H 3RCOA 1TBXA 2XC7A 1Z77A 2CJJA 4M9SA 1D0ZA 4II3A 1FOYA 4KIGA 1BR4A 3T8TA 3CP2A 4OWRB 3LFKA 4IO9F 2VOPA 4XLEA 4CZZA 2Z33A 3RIRA 1OKRA 3F6OA 1K4TA 1QU3A 1QRYA 2GWRA 1T56A 1VFCA 2E2JJ 3PQKA 4C3IJ 3VWBA 3BOQA 1OPCA 1AKHB 1UHWA 3H9JA 1R49A 4HF2A 2GM4A 4E7LA 1CF7A 1D1AA 2QLZA 4CGZA 3KLNA 1XPXA 3F0CA 1WJAA 5F1JA 3C18A 1FPQA 3CC4I 2XSDC 4RBOA 1IN8A 3GUDA 2DU9A 2E7XA 2QKLB 3I71A 3Q0WA 5J3LA 2XPVA 2E1CA 1ZTRA 3FIWA 1T38A 1WCMJ 1B72A 3K4KA 1H0MA 1MIJA 3BY6A 2AQEA 1K78A 1TNTA 1JJ6C 5LGNA 1JT6A 2CSOA 1LVKA 3H3ZA 2ZMEC 1ENHA 1OCRH 3FM5A 2HOAA 3OR2C 5CVIA 3V7RA 2JPCA 3S2WA 2HYGD 1VQNI 1YW7A 5JFRA 2ZJPF 5E1XA 5FGMA 1MMDA 4RS8A 4WK8F 2A69F 4HG2A 2K9MA 2HQAA 4BY7J 4BE1A 2Z5UA 2O3FA 1J75A 1I6XA 3I58A 3ERED 2HOSA 1E0EA 3VDXA 2E36A 1WWXA 2KDZA 1OISA 3DTEA 1KU3A 2ZO4A 2KFDA 3BR3A 3CCJI 2JPBA 1QBJA 3AKZA 1ETYA 1TZLA 4XK4A 3K7AJ 1OQYA 4JQFA 1Y56A 1UZCA 4BE2A 4N9IA 3BTIA 2X1EA 2LFBA 1BI0A 3EETA 3E5UA 1NH3A 4NC8A 1B8IB 2HPMA 3IH3A 2W1OA 5FJ8J 1RIOH 2F48A 3VFZA 2CUFA 2X4HA 2QENA 4YRVA 2QKMB 4CYCB 1PJRA 1S7OA 4MFDA 2FMYA 4RGUA 2L02A 3LSTA 1FBSA 2BW3A 3FXLA 3IUOA 4BJ6C 1ZARA 1Q1VA 2FNPA 2VE8A 3S93A 2K9LA 1J7KA 3VEPA 3WTTC 2XSJC 5D4RA 2MBFA 4PJJA 2M7AA 3HG9A 4CCJA 5LLQA 4A3IJ 2BGCA 5M3MJ 1ODDA 2RC4A 3HOVJ 3I4PA 3VODA 2J5PA 2JSCA 3K2AA 2WB1N 4KNYA 3OSFA 3TMOA 3H9QA 4PJMA 4BHBA 4ENNA 3JRIA 2M34A 5B66C 3S1QJ 1JKPC 4C3JJ 2E5NA 3JR9A 3WU1B 1BIAA 3JAMZ 2MYSA 3LNQA 5EEGA 3EYIA 3BR5A 3VSKA 4HX4A 4G7HF 1PYVA 2VC0A 5B5EC 3KP6A 2H1LA 1LPQA 3LA2A 1B9NA 2IA2A 1H88C 2KL4A 2ME6A 1APLC 3ZCOA 2BHYA 3VYTB 4XSXF 1MKMA 2LKPA 4NDLA 1G3YA 2L7MP 4RGRA 3MEXA 3RKWA 2NS8A 1LDJA 1D5YA 2R5YA 2H1KA 1Y0UA 5GAGJ 4ZZDA 1TWCJ 3DF8A 1FNNA 2AQFA 3D1NI 1F43A 3MVPA 1K6YA 2M45A 3WTSC 3WTWC 1R5ID 2F4MB 2XHKA 3EUKL 2VLAA 3G2BA 3D5LA 4BDYA 2PLYA 5K7ZA 3KLOA 3OYDA 1FBQA 2CQNA 2L7KA 2EWNA 5ICFA 1ETXA 3QYBA 4A69C 2MSYA 4CDGA 4NHJA 4Q4ZF 1Z91A 2OTJI 1I50J 4CCOA 3U9GA 3I59A 3WTZA 4BAYA 3EUAA 1WI9A 2VQCA 2ZBKA 1OFCX 2VC1A 3FK7A 2QSHX 3JW4A 2P5LC 3HOYJ 3SDBA 4U0WA 1GDTA 2X0LA 4AWXB 4V19K 4A3BJ 3BC8A 5JR3A 4D5FA 3FMQA 4GDFA 2H27A 2YU3A 2DOAA 4L5IA 2QEXI 2G9WA 4PGGA 5HDKA 2Y0SN 2R7FA 1XG1A 5FFXA 5K1YA 4CHUA 4O3MA 4DYCA 3BWGA 1XGMA 2BY2A 4M73A 5F0FA 2IEKA 2X6OA 1A6QA 2XROA 3LMMA 4U0YA 1Z67A 4HLXA 2QWWA 2NNYA 3DP7A 3FX3A 2FX0A 1OCOH 2PI0A 2UXXA 3RKQA 2R0QC 4GCVA 2ZXWH 4M3EA 4BBRJ 1Y6IA 2XRLA 3CCQI 3TOBA 3CDIA 2GZWA 3TO9A 1BIBA 3QRFF 1D8KA 4IHVA 2K27A 4LK1F 2Y69H 1TWGJ 2QSFX 2L54A 2XAQA 3CLQA 3OWTA 5GAHJ 3N97A 1JKRC 3OIQA 1IGNA 2KIFA 5JLWA 4CCMA 3V4GA 1JUSA 2XIGA 2R7UA 5E18F 2OBPA 2BYVE 1BJAA 4HZFA 3Q0VA 2P6SA 2LBFB 1R1UA 3SYTA 4RB3C 4OAYA 4HSRA 2MC3A 3BZKA 4YG2F 1P6RA 5FB2A 4KJZA 3EYYA 2WV0A 3GBGA 1E3PA 1R23A 2ISZA 3LAJA 1TWFJ 4BQAA 3T0YA 1P2FA 2XPWA 3GTKJ 1R9TJ 4ZH4F 3HOTA 1J9IA 2YU9J 3QQAA 5CKTA 5AIPA 1K4SA 4BXUA 2BXYA 4MTEA 1PP8F 3VPRA 2PJRB 2ZSHB 2CGPA 4XKVA 4PFOA 1R5HA 2XVCA 2H8WA 2M0MA 2HTJA 4IF4A 1P4WA 3HKZN 4RAGA 3GZ6A 3MFKA 2IXSA 2FE3A 5DD8A 5TGTA 2D1HA 1WQ2A 2PG4A 3OYHA 2BY3A 3H5AA 1WKMA 2A68F 2DI3A 5ILUA 1G59A 1MMSA 4DZJA 3TOAA 3BQYA 3JSOA 4UY8I 1JTYA 1QGPA 2M4KA 1I1SA 4RB1A 4F52A 3G3ZA 1LDDA 1HW2A 4JBAA 4TV7A 1FOWA 4IKFA 4UUSB 2UZKA 3ZQGA 4CH7A 4LIVA 2HNHA 1MSEC 5E17F 5J47A 1HBXG 1TLHB 3K10A 5C4JJ 5A2QK 3B6AA 1YYVA 4U0VA 1TP4A 2IP2A 3ZQCA 1HOMA 4LITA 3GTLJ 4PSWA 5JVTA 4LMYA 2V79A 1VI0A 2GOXB 3E0JB 5HLIA 3NRVA 1DU6A 3HGYA 2Z1DA 2IRFG 2HDCA 1IZ1A 3LSJA 1JJ8C 4HPQA 5FLVA 5DD4A 1FYKA 3PNTA 1CF7B 3R6SA 1IN6A 3DKXA 2ACJA 3MN2A 5IT9K 2QZ8A 4M71A 4F93B 2DFIA 1RKTA 3VB2A 5C4XJ 1V5GA 2BXZA 5D5WB 1RR8C 3BROA 2E1NA 2ZCWA 1Y1WJ 3CCYA 3RPUD 2V1XA 4OIQF 4EATA 2M2EA 5DTDA 3HOUJ 1Z21A 1B72B 3OYIA 1ZLJA 3SEQA 3J81Z 2X9DA 2IVMA 4IHTA 3KPHA 2ZJQF 1G3SA 1K78B 4CCNA 3WHCA 3I3LA 2M8EA 3W6JB 1DGRM 1QVUA 4Z6YA 3J80Z 5J1UA 3LSRA 3BPXA 2PEXA 4P96A 2KISA 5IT3A 3QPLA 1YJWI 1ZH5A 4UVAA 1IN7A 4L9NA 3G73A 3ZXSA 2IGNA 2F5CA 2XF5A 1HLVA 4XR6A 2NVXJ 1N25A 3LSPA 2FMLA 3R0AA 5J4VA 2OUMA 4IX7A 1RR7A 3RKXA 1R1TA 2ZFUA 2CV2A 3ABLH 4WXDA 3BQZA 2GIZA 1Z7UA 4A0ZA 4MEXF 1W7PA 4LIUA 1XCBA 5ILSA 1B8IA 3H35A 1J5YA 1AA7A 1TQMA 4IJAA 1MNDA 1MBHA 3AL0C 3I56I 3KP2A 4CO8A 4LB5A 1A5JA 1HQCA 2M87A 2L9NA 1BOBA 4V2GA 1JI8A 3Q9VA 5E3LA 4PK4A 5KCMA 3SQNA 2QUFA 1O3SA 1JHFA 2BW3B 2G0EA 4BUPA 1SD4A 3EUHC 5FD6A 1OMIA 2V9KA 2VKDA 3NAUA 1HSJA 1JKQC 1A6IA 4PJ0C 1Y39A 4RGSA 1KU9A 2FSWA 3KP4A 1GT0C 4N4NB 4BHPA 2LDUA 2TCTA 5CVJA 5F27A 2K9QA 3Q5FA 2XKOA 1K61A 1GVDA 2LNBA 2LY2A 4HF0A 2O9LA 3WE3A 3ZQ7A 1VZ0A 4PSXA 3HUGA 1VQ4I 5CQEA 4EGYA 4ZDLA 1WHUA 4BBSJ 4IHXA 3OYGA 1D1CA 1FMVA 2DA7A 1J09A 4CCLA 4GYGA 1WRJA 1RRJA 2PBIA 2VASA 4F92B 1ETWA 3I55I 4LFUA 5B3SH 4MHGA 5DDGA 4HNUA 5ICCA 3HOXJ 1ZKGA 3V42A 5E1ZB 4EJVA 5E3MA 1QZZA 2HS5A 3JTGA 1G2HA 1T39A 1FWZA 2DPDA 1YJ9I 2CFXA 3HB9A 4DZPA 1T95A 1HSTA 3WE2A 4ITVA 3CMMA 5HNFA 3FBNB 4RAFA 1FOKA 4S05A 5HVQC 2E1MC 1K6OA 1Z05A 2Q2EA 3Q3SA 4G6QA 4BL0B 5JHFA 4HQMA 5KVRA 3RKYA 2R5YB 2Y75A 2D1VA 5DUKA 1R00A 1UMQA 1MBJA 1OR7A 3K70C 4FX4A 5M3FJ 3NWTA 4S04A 4A3KJ 1LFPA 2F4IA 5J1RA 1Z6TA 4XQFA 3ECHA 1S8NA 5DCMB 1MH3A 3H0DA 4L18B 2UV1A 4JP0A 3CCLI 2ESNA 3ABTA 2CQXA 2G7UA 2DPUA 1WJ5A 3QPHA 1W36D 5FFZA 2X6XA 5BMZA 3GTJJ 5M5WJ 4HNTA 1YG2A 4OIOF 2V1DA 2OQRA 4UB6C 2KRFA 1W5CC 5TJJA 3I54A 3I59B 3F8FA 2ZJRF 5FLXK 4AYBA 3ONQA 2W7NA 1X4OA 3BCBA 3W6KB 4QWQA 2H8RA 3HIFA 4FHTA 2ZB9A 4HA8A 1RI7A 2DW4A 2GBYA 2BOLA 3QOPA 1HCRA 3ZN1A 3AAFA 2BE5F 5FKMA 4PGHA 3COAC 4EM0B 4M3FA 4N0BA 3SXYA 2A3SA 2DOFA 3BP8A 3I4MJ 1AHDP 4E7ZA 3GFJA 3HZJA 4EQQA 3EDPA 1OCTC 3LA7A 2R4GA 2GXAA 3AFHA 3H5RA 4OAZA 3P9CA 5KAIC 3IV5A 1RPWA 5IOYA 1E2XA 3PM1A 3HOSA 4UUVA 2BV6A 3CC7I 4KMFA 2MGQA 3V7CA 1TQIA 1A31A 2B0LA 4PCQA 1UFMA 1A04A 3H9GA 4L5JA 3LA3A 3E6BA 3M1CA 2ESHA 1ETKA 3CCEI 2OCCH 4XRSA 5E8GA 5FLMJ 1F36A 1IO2A 1MH4A 3WU0A 2O7OA 1P7IA 4FX0A 1WH5A 5BPDA 2VUMJ 2GXGA 4BJ5C 2KPMA 2N8GA 2DFFA 3JAMK 4MNUA 3ZQQA 3JRGA 4BHCA 2EILH 1RZ4A 1MMGA 2MFZA 3QU6A 1D1BA 3LAPA 2EK5A 1ON1A 3PIPF 1BOAA 2VKHA 3K1NA 3DPLC 1FIPA 2VB6A 2ZC2A 4KN7X 4M3GA 3ROUA 4C9YA 2EFWA 5GPCA 3RQ4A 2E7WA 2ELKA 3O3KA 2ZSIB 1WZ2A 5LD2C 4B8XA 1YE9A 2ADUA 4LB6B 2Z99A 1VQMI 1T8IA 4KIBA 1OJLA 3MKLA 4IVNA 3ULQB 2KT0A 3L9FA 4RGXA 5LFAA 4ENJA 3TP0A 4XSZF 1ZELA 2BHZA 2VBXA 2HYFA 3MMYB 3H5NA 4MIMA 5DS9A 3V8LA 3ZMTA 3FKIJ 2DA5A 3GFIA 5D8KB 3H0GJ 3P9IA 3G4SI 2LKXA 1F5TA 5D5VB 4G6TB 1MBFA 1ZR2A 5CQGA 4U7DA 1O3QA 5F08A 2A61A 4KYWA 2COBA 3F21A 2X1CA 3F3XA 2STWA 1WGXA 1R6RA 5L3GA 5E3NA 5K5RA 2XV4S 4G94A 4XKWA 3VYRB 4ESBA 2NAZA 3ZMDA 3HTUA 3FXQA 3HHGA 3WGHA 1O57A 2LKSA 4CUGA 2W00A 2OD5A 2VXZA 1EF4A 3RYPA 1RUNA 2QM3A 4JX6A 4O5VA 3CCUI 2R7ZJ 4BQQA 2RREA 4Q5SF 1R36A 5IPAA 4UNOA 1ZN2A 3DLAA 3CP8A 2EB7A 4C3HJ 4BXXJ 1IDYA 1SD7A 3BTLA 2E19A 2KJCA 2M1BA 2HKOA 1U6GA 1W4MA 2XUBA 2VKEA 4S0HB 3GTOJ 2CMPA 2EFOA 2HQNA 4XN0A 2Y30A 4BJTA 3HL2A 1ON2A 2EFPA 1SVOA 4C2UA 1SFXA 2XB5A 4B09A 4X1EA 5H20A 4JYKA 1YRNA 4LOCA 2L4AA 2ZMEA 4PDKA 1OLTA 1ZG1A 1JUPA 2P7CB 3DLLF 1H9GA 2KZVA 2XAJA 2Y2ZA 4M6VA 4EV0A 5J4YA 2WAQN 2WBMA 1J0RA 4GRIA 5FKLA 1X3UA 3ISPA 3OYBA 1PUFA 2XAFA 4HBLA 2K40A 4MEYF 1U5TC 4FT8A 3DPUA 4Y33A 3C2HA 3FMRA 4CZCA 5KNLA 1LJ9A 4U88A 1GXQA 1ZK8A 4KT5C 3AG3H 3I64A 4A5NA 3KZYA 4R8HA 2CUEA 4BU2A 1ONVA 3ZMUA 5GAEJ 3AL0B 3K2ZA 2HXOA 1FSHA 1LEBA 2WY7Q 3DWLE 2VQHA 3BJAA 1W7PB 1YS7A 1CGPA 4D5CA 1V54H 2JVGA 4NNJA 4EMSA 3MZ8A 2HWVA 1X1PA 4XLHA 3DU6A 3C2GA 1V5FA 2WC2A 2ELHA 3SZGA 5CPRB 5TRDA 1ZLKA 4A12A 1P4AA 4R79A 3L2WA 5JLXA 4GO1A 4HV6A 3GO5A 3KP5A 1X1BA 3GW2A 1SMTA 4HOBA 1D3YA 5HS7A 2BVLA 4KICA 2LOOA 2Y9YA 2OZUA 4ZYEA 2YR2A 4MQVA 2O0YA 3W3CA 2O5RA 4FQGA 5HOOA 3SFZA 5HNHA 2HZDA 5HDNA 1VQ7I 2FBIA 3X2QH 1MBEA 2IBDA 2L2OA 4G8XA 1D8JA 3CJTB 3K4BA 4XLAA 1VQLI 1ZHFA 3T1BA 4RAYA 4QPQA 2JQ7A 4A3FJ 1BI3A 5GTIC 1U9NA 1ZG3A 4M9XA 2WY8Q 3BLYA 3A1YA 3HUGB 2LC2A 4Q48A 3BG6A 3IHUA 3HRMA 4A3JJ 2EV6A 1P7JA 2CQKA 1ETVA 4IXAA 1DDNA 2QQAA 3GWZA 1GXPA 1IRFA 2Y0SA 3B6CA 1ZRCA 3SZPA 2E2HJ 1UHMA 2EPFA 4E7JA 1FYMA 3S15J 2L9RA 1FEXA 2K9SA 4LLNA 2E1MB 1S7EA 4XLCA 1X3ZB 5KK1A 5HODA 5M5YJ 2ZNYA 4A3MJ 1VQ5I 2HVSA 3QPSA 3HTSB 3OS2A 2ID6A 2XAHA 2EA2A 4E7IA 3FISA 3GYHX 3SJMA 2Q2EB 3HM5A 4M6XA 1W7PD 4QLCU 3A4CA 4IHWA 2Y0MA 2A6HF 2DT6A 2LY1A 2VIXA 3HSFA 1N78A 2FQ3A 5DCMA 3RZOJ 3RPQA 1LQ1A 2EH3A 5J6XA 3DEUA 3TW6A 2LK2A 1AOYA 3M07A 3QP5A 2PFBA 4J01A 2V1UA 5EF6A 5EGOA 2IGKA 2XPUA 4Y3OA 1QZEA 3R4KA 1Z3XA 3JTHA 2A07F 3PFIA 2VKVA 3F8CA 2ELJA 5EG0A 4B3AA 1QO0D 2EQRA 3DBLB 3HPGA 4D0PA 1ZAOA 1UG2A 2W85A 1X3WB 4XLPF 4UUTA 3F72A 1QQIA 4P1WA 3JRHA 4ZYHA 2LYCA 3HJEA 3NWSA 1WH7A 1XN7A 1B59A 2CYYA 2DA6A 2VE9A 5EEAA 3OYEA 1NK3P 4I98B 2X48A 1VQ6I 5M5XJ 2CFOA 3OOUA 5LGUA 2X85A 2HEOA 4B48A 4P9FA 3V8KA 2DK5A 2L7ZA 3C7JA 3FF5A 4E7SA 4LG0A 2LLKA 4HYEA 1S7AA 2NVUB 3WTYC 1KONA 3OYJA 2ZFWA 1FP1D 3O8GA 4BE0A 1W5TA 2LRDA 3I5UA 3G1OA 2EZHA 3ML6A 2I5UA 2JVHA 2K85A 4AIJA 3K0LA 4ZDOA 1B9MA 4OIRF 4HF1A 4G7OF 2KKOA 2MD5A 3CUQC 2D45A 3S1NJ 3LOCA 1UHSA 4I02A 4ON0A 1FMWA 1T08B 3J7AO 3E5XA 5ICGA 4ABZA 5LEJA 3CCMI 2VBYA 3KP7A 3OYKA 1A36A 1L3LA 2NNNA 4EGZA 1XC5A 4YELA 3A2KA 4CCKA 1TL8A 1YOVB 2IGOA 4LD5A 4D7NA 2DQRA 4B43A 3A02A 4ESJA 1D5VA 2JZYA 3CD6I 1N75A 1LDKB 3ZN0A 4XM3A 1FIAA 1AWCA 2L5QA 2PN6A 3I0TA 3BTCA 4AU7A 4DNCA 4KFCA 1QHHD 2EV0A 3FXJA 1R4NB 1KU2A 3P7NA 1Y0NA 2E71A 5E1WA 2DDBA 3FDYA 1P92A 3D5RC 2CV0A 1JGSA 4DJAA 5LHIA 4BGDA 5DM7F 3WGGA 5GADJ 5HLHA 3W2VA 1YFHA 2L9VA 3JREA 4X6AJ 1SAUA 4XRSG 4ZYAA 4IHSA 4FETA 1MJ9A 2ZXHA 3M8FA 3DEWA 1FZPB 2Q0OA 2UWMA 2DT5A 2D5VA 3CJNA 2VBWA 3S1RJ 5L3FA 4B4CA 2EV5A 1RETA 3ZMZA 1JHHA 1ZRFA 3BG7A 3BG5A 2RDPA 1R71A 2CU7A 2JWTA 2MLGA 1FSEA 4UXNA 2K7LA 2DCEA 3BJOA 2AXLA 1ORKA 4L9TA 4CA0A 2WWYA 1QA6A 2IS6A 4M74A 4JX5A 3OYAA 2JA8J 5GTHC 5L3CA 3M8EA 2DA1A 2KIQA 3CDLA 1KQ9A 3RJPA 2MA3A 4DIQA 2DAOA 3M8JA 2R7TA 4IQ4A 1DGWY 1FP2A 5BNGA 2XAGA 3G1MA 1Z9CA 1FTZA 1BBYA 4XOPA 2XB0X 4P9UA 1ULYA 4ASNA 2LG4A 5K5QA 3MCZA 2FEZA 4XMYA 1GHCA 5L3BA 2ZJ2A 4M72A 2O6GE 2CS3A 1H89C 1IRXA 3S2HJ 3TQNA 1TT5B 1ZGAA 3FWEA 3H1CA 2LVSA 4ZYDA 1L0OC 3JSPA 4A93J 1XDSA 3WTVC 2DOEA 3ZGKA 3H3UA 1FT9A 1HXDA 2OV7A 3QP6A 1YRNB 3K9TA 2ZMEB 3ZRGA 3ESWB 3GXOA 3ZP5A 3S3NA 2IS4A 1RUOA 3H3VK 4ZC3A 1YS6A 5ED4A 3U21A 4JOMA 3UKGA 1BA5A 1PUFB 3PUBA 5K7FA 1OYYA 1X2NA 2YPRA 1VQPI 2KDOA 2DMUA 3GMEA 1QVTA 3GX4X 3Q9SA 4C2MJ 3CC2I 1XTAA 3O6BB 2LP0A 4LGWA 2VPLA 3CJQB 1NG6A 1X2MA 2A5WA 2OF7A 3BR0A 2DODA 3ZMVA 3KEQA 2STTA 4KISA 5DM6F 2KP6A 3WGIA 2BZTA 2V9PA 4P55A 1HKTA 1K83J 3N4MA 3PO2J 3BR2A 4E4HA 2OC6A 3MKWB 2BEOA 4I6ZA 2MH9A 2IJLA 2H6CA 1HDDC 2W24A 4A0XA 3V8JA 1TW3A 2K3PA 1E3OC 4DYRA 3EUHA 2B7EA 4DW6A 3GTMJ 4NB5A 1FTTA 1T33A 1EKEA 3DXJF 5EZGA 2HKXA 4A3LJ 1IN4A 1STZA 3K4JA 4I01A 5CVVA 4D1QA 3CCRI 1IF1A 2KQRA 2GOMA 2PMZA 2LMDA 3S2DJ 2DQLA 5H2FC 5HS8A 4I76A 4WCGA 4OINF 2KZGA 4E7HA 4IEJA 2VXDA 2NVTJ 4GGGA 1BR1A 3OYMA 3IC7A 3L7WA 1X1AA 3OL4A 4AIHA 2HXIA 1YW8A 1KYZA 3IKTA 1SFEA 3HOWJ 1BW5A 3WODF 2E1OA 5GPAA 4IHYA 1TWHJ 3QYFA 2VOOA 3WTXC 3W2AA 3OSGA 2V26A 4RDUA 1CQTA 3M7GA 1SEUA 1GVJA 3BPVA 5FROA 1U3EM 1TC3C 3F9KA 1F4KA 3PSIA 3JRCA 4Z2YA 3G71I 1XD7A 3CJRB 3L2CA 1IJWC 2ECBA 2HQRA 4IOAF 3TL4X 4KT6A 4IL6C 3SEZA 4B44A 3GEZA 5DYMA 1IRGA 3OV8A 4PUSA 3PNYA 2VT3A 2VONA 3GTGJ 2OJED 2HZTA 4PJNA 3CMAI 5F1RA 4P5OA 3FK6A 3TDZC 3TP3A 2IS1A 1YIOA 4G9YA 1G3WA 1ITYA 4BNCA 1IC8A 1I3QJ 1NG7A 4N9HA 3TW7A 4ZTJA 3LQQA 3G1LA 4V2FA 3IWZA 2W25A 3MAJA 5J1YA 2ISYA 4II2A 3DPTA 1LB2A 2YX7A 3E6DA 4J00A 3KIOA 3TBIA 3GZ5A 1MNMC 3F6VA 1U78A 3A0HC 5LHHA 1DP7P 3UR3C 3F8BA 5J40A 4GYIA 5L3EA 3MKZA 3ZQLA 1H8AC 1BM9A 2OAZA 2P5VA 5LHGA 2K02A 2DA4A 4RLFA 4X0GA 1G3TA 2DBBA 2XGDA 4AVZA 2QSGX 1X58A 2LR8A 5EGOB 1XMXA 3E3VA 5EDNA 4KMUX 1USSA 1U8RA 3CCSI 2JJ7A 2M5WA 3WHBA 3ZR8X 1MW7A 3ASOH 1FY7A 5AONA 5EG0B 3IRQA 5IYDJ 2CQ7A 1X1CA 3HRTA 1S3JA 2DA2A 3K4NA 5E20A 2Y48A 3CLOA 3VYUB 3LSHA 5F0CA 1BI1A 4DYQA 3RSNA 2VJJA 4XIDA 3IH2A 1M1EB 2DFEA 4I99C 5ERIA 3GVAA 2QQ9A 2QYOA 1QZYA 4YFKF 3AG4H 2R7WA 3M4OJ 1WPKA 3GZNB 4MFEA 3KP3A 4AIDA 2FU4A 1XS9A 1KYWA 1XGOA 2HQ5A 1B4AA 4OMZA 4ZJZA 3F8MA 2PJPA 2VJ4A 1VQKI 4L9JA 1VNDA 2LF8A 3PSFA 4UVCA 1BL0A 1UAAA 4LG0B 2M3AA 2TDXA 1JT0A 1S29A 3RTRA 3IAS2 3GLLA 4L5EA 2KIMA 3A03A 4WXHA 2QA4I 4IRIA 1V4RA 4AUXA 5LGTA 4FCYA 3D0SA 3S32A 3MZYA 3NEUA 1UB9A 1XSDA 2DA3A 2R7SA 4NBQA 5IT9Z 3IP4B 2W4SA 3AG1H 2R7RA 2CWEA 1BR2A 1XMKA 3BG3A 2XGCA 1WJBA 2K9NA 1KGSA 1O4XA 1MSFC 2JMWA 4RA2A 2L7FP 1BN5A 4R1HA 1IXCA 4BQOA 2FJ1A 1X19A 4HDUA 2FUG2 2RQPA 1I39A 3DBHB 4I0AA 4RM2A 1IXRC 4UHTA 5H6QA 2RKHA 1BW6A 3BDDA 1HDPA 4PJLA 3CMEI 3VOEA 2FBKA 4LG3A 2VPRA 4MQ9F 4HNVA 1TW2A 1DQUA
chains in the Genus database with same CATH topology
4CCMA 4E6KG 4ANJA 2I8DA 2R7UA 2UUZA 1X1BA 1V5EA 2R7QA 2LBFB 2WA0A 2BVLA 2LOOA 3SYTA 3VSLA 4DBQA 4OAYA 4HSRA 3W3CA 4HRIA 2V4JC 2O5RA 5HOOA 5HNHA 2HZDA 4KJZA 3S3OA 4B47A 2HU9A 3GBGA 2L2OA 4BDZA 3K4BA 2VQLA 2MABA 4XLAA 2LREA 1T0FC 4QPQA 5FRNA 2R7XA 3HOTA 5CKTA 4RLQA 2WY8Q 3BLYA 4RM3A 3A1YA 3HUGB 2PJRB 2LC2A 2ZSHB 3BG6A 4XKVA 4PFOA 2WAQA 1MNEA 2M0MA 2Y0SA 2XAUA 2IXSA 5TGTA 3OYHA 4HEA2 3KX2A 3H5AA 4E7JA 1G59A 1UELB 2E1MB 4XLCA 3UNGC 3E1SA 4XORA 3FBIB 2HVSA 4C2TA 2M4KA 2X6YA 3CESA 5FRMA 3OS2A 4F52A 4IZZA 2WADA 4E7IA 4IKFA 2Q2EB 4NC7A 2F5VA 4CH7A 4LIVA 2HNHA 3A4CA 3K10A 1S9HA 2MD0A 2CW8A 2DT6A 2LY1A 2VIXA 1N78A 3DTKA 2VL8A 4XL9A 2Q1ZB 2DXIA 4LITA 4PSWA 1LKXA 3K4LA 3K4CA 4J01A 2GOXB 3E0JB 2IGKA 3L2VA 4Y3OA 2Z1DA 3MKYB 3HXLA 4BQNA 1Z3XA 2M7BA 3DTIA 3CF2A 2KMUA 4HPQA 2ELJA 1OR7C 3HPGA 3PNTA 1D0YA 3QYEA 4HSTA 4XOTA 3OS1A 2LH9A 3DKXA 4F93B 4P1WA 2LYCA 3L2UA 3NWSA 4RMNA 1V5GA 4F3QA 2WB1A 3OYEA 2IGMA 3RPUD 2JA2A 2CFOA 3OOUA 4EATA 2X85A 4B48A 1Z21A 3OYIA 3SEQA 4BEHB 2ZXIA 4U87A 4CCNA 3I3LA 4E7SA 1DGRM 4F91B 1KONA 1EA3A 3OYJA 1Z7LA 3LSIA 4BE0A 3OL3A 3CZ6A 4PFPA 3ZXSA 2E60A 2IGNA 2LRDA 2XF5A 3KYLA 4XR6A 1WJDA 2JVHA 4ZDOA 2OUMA 1WJCA 3OYFA 4IX7A 3OMYA 2ZFUA 2F6CA 2CV2A 3HPHA 2Z2SB 1N77A 2DJIA 4LIUA 3LL7A 1FMWA 4XN3A 3H35A 1AA7A 2VQGA 4XKCA 1MNDA 3OYKA 3AL0C 3PNVA 4XONA 4YELA 3A2KA 4CCKA 4F55A 2IGOA 2L9NA 2V7FA 3D5SC 2BVMA 1BOBA 3OIPA 1Z3YA 1WJFA 2XF7A 4B43A 1JI8A 4PK4A 5KCMA 2MC4A 3PL8A 2WAEA 2R7VA 1N75A 2CW7A 1LDKB 2BW3B 1GLNA 4XM3A 2LBFA 4NUBA 2L5QA 4BUPA 4AU7A 1QHHD 3EUHC 2JSPA 2HVRA 2V9KA 2VKDA 2X6WA 1MMAA 4QPOA 3FDYA 2HVQA 3D5RC 1YX5A 2CV0A 4DJAA 3PJRA 4N4NB 1W36C 4BGDA 4CSWA 2HPIA 2RQQA 3W2WA 2R7OA 2LY2A 3W2VA 1YX3A 1SAUA 4ZDPA 4ZTFA 3K4MA 1VZ0A 4ZYAA 4PSXA 4DGWB 4FETA 2ZXHA 2PJRA 2V1NA 5CQEA 4ZDLA 2UWMA 3OYGA 1D1CA 1FMVA 2KRHA 1J09A 4CCLA 2VASA 2XDVA 4F92B 3BG7A 1QHGA 4HNUA 3V42A 2E5ZA 4BS9A 2DCEA 4YEJA 3J7AY 4CA0A 1SFKA 1T95A 2IS6A 4ITVA 3CMMA 5HNFA 3OYAA 3FBNB 4MLOA 4BACA 3DKYA 5HVQC 2E1MC 2V6EA 4BL0B 5JHFA 1X4PA 4DIQA 3M8JA 2R7TA 4IQ4A 3S8PA 2X51A 3RCOA 1DP3A 1DGWY 2XC7A 3K70C 1D0ZA 4II3A 3NWTA 1BR4A 4XOPA 3IAM2 1LFPA 2F4IA 3CP2A 4OWRB 2LG4A 4XQFA 4XLEA 4XMYA 3H0DA 2UV1A 1QU3A 1WJ5A 2W82A 1W36D 3KEYA 2CS3A 2X6XA 1IRXA 4HNTA 3VWBA 3H9JA 3LSMA 4E7LA 5HLTA 1D1AA 1WJAA 3ZGKA 4XKBA 3OYNA 2OV7A 4AYBA 3ONQA 3S3NA 3ZRGA 2W7NA 1X4OA 2QKLB 4XLFA 4KITB 2IS4A 3BCBA 1ERDA 4ZC3A 3U21A 3FKJA 4B3XA 3OYLA 3K4KA 4BEHA 3PFYA 4JOMA 2AQEA 2BOLA 3PUBA 4DBRA 1LVKA 2KDOA 3HKZA 2VJIA 3OR2C 2IS2A 2VPLA 1MMDA 2X1DA 3CJQB 1NG6A 2A5WA 4E7ZA 4HG2A 2CUJA 2K9MA 2RNGA 2HQAA 2R4GA 3AFHA 4KISA 3H5RA 4OAZA 4BE1A 2KP6A 3N05A 3HOSA 3K70D 1E0EA 3VDXA 3OYCA 3DTEA 4E4HA 1X1DA 2OC6A 3AKZA 4BXFA 1TZLA 3MKWB 3H9GA 4JQFA 1Y56A 4BE2A 3M1CA 2Z16A 2K3PA 2X1EA 3OY9A 4NC8A 2HPMA 2CV1A 2W1OA 2HDWA 3MD2A 2CH0A 3LFUA 3K4JA 4YRVA 2CUZA 2QKMB 4D1QA 1PJRA 2KQRA 2GOMA 2PMZA 4BJ5C 2KPMA 2BW3A 3IUOA 4E7HA 4BJ6C 2VXDA 1UG0A 3QODA 3ZQQA 1WFXA 3BCAA 4FASD 2M4GA 1BR1A 1MMGA 2K9LA 2MFZA 1D1BA 3S93A 2XSJC 3VYSB 3OYMA 1X1AA 3OL4A 3I9V2 2VKHA 4PJJA 3DPLC 2M7AA 2VB6A 3K6GA 4C9YA 3HG9A 4CCJA 3RQ4A 3EPZA 2ZSIB 3QYFA 4DOZA 5LD2C 3W2AA 3HC7A 2V26A 1YE9A 2KRCA 5FROA 3TMOA 3H9QA 4PJMA 3F9KA 5LFAA 3PSIA 2E5NA 1ZELA 3CJRB 2MYSA 3MMYB 3H5NA 2P0WA 4KT6A 3TL4X 3SEZA 4B44A 3S3MA 3VSKA 3DU5A 1PYVA 4PUSA 3PNYA 4PJNA 4P5OA 2VJ5A 2KL4A 4G6TB 2IS1A 5CQGA 3ZCOA 1NG7A 2X1CA 3VYTB 4ZTJA 3QOEA 1R6RA 4XKWA 2K5CA 3VYRB 4II2A 3DPTA 4N4OB 4J00A 3TBIA 4CUGA 2KHMA 2VXZA 2W00A 4C30A 4U7BA 3UR3C 1D0XA 1U0JA 2AQFA 3MKZA 4BQQA 2RREA 5KHDA 1K6YA 4RLFA 4X0GA 3DLAA 3CP8A 3EUKL 4AVZA 2VLAA 3G2BA 3D5LA 4BDYA 3OYDA 2L7KA 2CMPA 3QYBA 3ZR8X 1MW7A 4XN0A 4BJTA 4CCOA 3HL2A 3LSGA 1X1CA 2WAFA 3OS0A 3K4NA 4C2UA 3L2RA 3EUAA 3VYUB 3LSHA 2VQCA 3DQVC 4IQJA 3RSNA 2A6TA 2VJJA 1TT0A 3SDBA 1OLTA 3LSKA 1G8XA 1P9QC 4Y4RA 4H4KC 3BC8A 2R7WA 2KZVA 2WBMA 2DOAA 4ZJZA 4GRIA 3OYBA 2JUGA 2VJ4A 4D9JA 3PSFA 3L2QA 2DT7B 1UAAA 2M3AA 3RTRA 3DPUA 4Y33A 3IAS2 3C2HA 4CZCA 5KNLA 3LMMA 3OR1C 2NOJB 3S32A 2R7SA 3DEEA 4BU2A 4XNFA 1Y6IA 3IP4B 1MMNA 2W4SA 2R7RA 1BR2A 1WJEA 3AL0B 4E7KA 2WY7Q 2L9SA 1WJBA 3DWLE 2VQHA 1HA8A 2XF6A 4NNJA 2JVGA 4BQOA 4NQWB 1X19A 4XLHA 3DU6A 2FUG2 1V5FA 3C2GA 4RM2A 3OWTA 3FHNA 4PJLA 3SZGA 3OIQA 5CPRB 4LG3A 4R79A 2KLOA 3L2WA 1DQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOA A;  2E5N A; 
#chains in the Genus database with same CATH topology
 4E6K G;  2M0C A;  2I8D A;  1DPR A;  1W5S A;  1Q1H A;  2UUZ A;  1V5E A;  3S16 J;  3NQO A;  1YQA A;  3L09 A;  2DK8 A;  1R1V A;  3KZZ A;  4LJZ F;  3VSL A;  1LVA A;  2GA1 A;  1T0F A;  5AIQ A;  2V4J C;  4M9Z A;  2HU9 A;  2ECC A;  2F2E A;  2MAB A;  2R5Z A;  1W1W E;  1GV5 A;  2CW0 F;  2LRE A;  1T0F C;  4W97 A;  4AYB N;  4QTR A;  3CMY A;  5FRN A;  3GF2 A;  4KUM A;  1YLF A;  2OA4 A;  4RLQ A;  4IRH A;  4RM3 A;  3RDI A;  3JRB A;  1Y8Q B;  2ICW G;  2HDD A;  2WAQ A;  3W6V A;  1RKW A;  3HGG A;  3GFM A;  1MNE A;  4RAZ A;  3DV8 A;  5CJ9 A;  2XAU A;  4A6E A;  4UV9 A;  1H9T A;  4HEA 2;  4OIP F;  3U1D A;  2PX9 A;  1WVR A;  1Z6R A;  2W48 A;  4ZYG A;  1UEL B;  2RAE A;  3E1S A;  5K7H A;  4XOR A;  1SFO J;  4C2T A;  1UCR A;  3CES A;  1ETQ A;  2EBI A;  4IZZ A;  4L0Y B;  1U2W A;  3KYC B;  1JKO C;  5IP9 J;  4NC7 A;  2F5V A;  3HRS A;  3KEO A;  3A01 A;  2JN6 A;  1IRZ A;  4A2U A;  3JRF A;  2CW8 A;  2NRA C;  2GA2 A;  3DTK A;  4XRM A;  4XL9 A;  2Q1Z B;  3RZD J;  3QAH A;  4Y15 A;  1LKX A;  3HOZ J;  3TGN A;  2W84 A;  2RN7 A;  4YFX F;  3MKY B;  4BQN A;  1U9O A;  3CF2 A;  2KMU A;  2MLK A;  2HR3 A;  4LK0 F;  2LY9 A;  1D0Y A;  1WI3 A;  3J7Z I;  4Y13 A;  5FKO A;  3E6M A;  3L2U A;  3A0B C;  1U5T A;  1HW1 A;  3JRA A;  1V3F A;  2WB1 A;  3R0J A;  4AD9 A;  1HC8 A;  2IGM A;  2XGX A;  2H09 A;  2WTE A;  2JA2 A;  1I5Z A;  1ZRD A;  2QGU A;  3F8N A;  2R7D A;  1LEA A;  3FXR A;  2RGV A;  2ZXI A;  4U87 A;  2NS0 A;  1PUE E;  2FXA A;  5H6R A;  4EJU A;  4WXC A;  2R93 J;  3HSR A;  5LEK A;  1EA3 A;  1BI2 A;  3LSI A;  1Y1V J;  2B63 J;  1EV7 A;  1P4X A;  1UJ8 A;  1S5L C;  4PFP A;  1IW7 F;  2E60 A;  1DPU A;  2LSO A;  1WJD A;  3FZV A;  1TQP A;  3WG7 H;  1IUY A;  3S1M J;  3OYF A;  1IDZ A;  1KZH A;  3OMY A;  1MBK A;  4G12 A;  2IA1 A;  5FLX Z;  3HPH A;  2Z2S B;  1Z1D A;  3TED A;  2Q8K A;  1QPI A;  1OCP A;  3KZI C;  4XN3 A;  3H92 A;  3R61 A;  4NQW A;  4FIS A;  3OOP A;  5HLG A;  2DMT A;  3E7L A;  4XON A;  3T5X A;  3P9K A;  5DUI A;  1YJN I;  2QBY A;  2V7F A;  2EZI A;  3D5S C;  2F5F A;  3OIP A;  1XGN A;  5D5X B;  2HTS A;  1VQ8 I;  3PL8 A;  2PMH A;  2WAE A;  2R7V A;  2C6Y A;  4XIC A;  3IWF A;  2CW7 A;  3IH4 A;  1GLN A;  4M3D A;  2OQG A;  4HDV A;  4NUB A;  5B1A H;  2FNA A;  1S6L A;  2YSR A;  1JXS A;  2JSP A;  2GLO A;  5DCF A;  2HVR A;  1F9N A;  1MMA A;  5K5O A;  4QPO A;  2HYJ A;  2HVQ A;  1EH7 A;  3ZQF A;  5E8I A;  1B1B A;  2DDA A;  4ESF A;  1W36 C;  1BC7 C;  2RQQ A;  3W2W A;  2R7O A;  2FOW A;  1YX3 A;  4YFN F;  1ACI A;  2CRG A;  4ZDP A;  3BZC A;  3K4M A;  1MDM A;  1JUM A;  4DGW B;  1YTY A;  4E70 A;  1AU7 A;  1UST A;  2LTP A;  5BQT A;  1EH8 A;  2J5O A;  3BG9 A;  2XDV A;  4JX4 A;  2AS5 F;  3HHH A;  5D8L B;  2OTL I;  1K79 A;  5ICE A;  4WX9 A;  1R58 A;  2HOE A;  5L3D A;  5LRR A;  1RNL A;  2JRM A;  3FM3 A;  2NVQ J;  3QU3 A;  3CDH A;  4BAC A;  4F7Z A;  1SMY F;  3CO7 C;  2V6E A;  4A3C J;  1I3A A;  3KFW X;  2E34 A;  1X4P A;  4FE4 A;  2COM A;  3B02 A;  4LLL A;  3RQI A;  3S8P A;  1SAN A;  1DP3 A;  4A5M A;  4GXO A;  3J81 K;  2K86 A;  2GIV A;  4XRF A;  1FBU A;  5CYV A;  3K1P A;  3IAM 2;  4YII A;  1ETO A;  2QVO A;  1IN5 A;  2JTV A;  4EJW A;  3J80 K;  1YO5 C;  1O7F A;  5E3O A;  2IAI A;  1YIJ I;  2XRN A;  1I6H J;  2W82 A;  3SZT A;  3KEY A;  5B1B H;  3G6E I;  3KET A;  5EEH A;  3LSM A;  2EZL A;  3E5Q A;  4Y7N J;  5HLT A;  4A6D A;  1R4M B;  4XKB A;  3TKY A;  2EJR A;  3OYN A;  1IXS B;  1PDN C;  2V6C A;  1F1Z A;  4WWC A;  3GTP J;  3C3W A;  4XLF A;  3WG9 A;  4KIT B;  5C44 J;  1ERD A;  5JHU A;  3FKJ A;  1XMA A;  3FXU A;  4B3X A;  2ID3 A;  3OYL A;  1IUF A;  4O6J A;  4BEH A;  3ZQI A;  3DKW A;  3PFY A;  1O7L A;  1IV8 A;  2RV8 A;  1HW5 A;  1MJB A;  2JK3 A;  3L1P A;  2DLL A;  2DTR A;  4DBR A;  1SD6 A;  2AHQ A;  3E97 A;  3HKZ A;  4M6Y A;  2VJI A;  5FKN A;  3BR1 A;  2MG4 A;  3CUQ A;  3NAR A;  1ZQ3 P;  1XDU A;  2IS2 A;  3BZ6 A;  2X1D A;  1KQ8 A;  2CUJ A;  2L3D A;  2EFQ A;  2F4O B;  2RNG A;  4Y17 A;  5IOZ A;  3QPT A;  3N05 A;  1REP C;  3ELK A;  5BS6 A;  3K70 D;  3C2B A;  3DCF A;  1LFU P;  3OYC A;  2O8X A;  1G4D A;  1EJ9 A;  2QCO A;  2NYX A;  2XGE A;  3OIO A;  1U8B A;  1DUX C;  1X1D A;  1VQ9 I;  4BXF A;  3TDU C;  3PIO F;  4I2O A;  1T98 A;  3JCU C;  2IW5 A;  2Z3Y A;  2EZK A;  3I4N J;  2Z16 A;  1R5G A;  3OY9 A;  2CV1 A;  5CVU A;  2HDW A;  3MD2 A;  4KN4 X;  2CH0 A;  3LFU A;  2CUZ A;  2K4J A;  4IRG A;  3REO A;  3BT9 A;  2Y9Z A;  2TRT A;  5DV5 A;  1PP7 U;  3HSE A;  2E2I J;  3ABM H;  4DQ2 A;  2K4B A;  3QOD A;  1UG0 A;  2DFH A;  1WFX A;  3BCA A;  3MQ0 A;  4FAS D;  2M4G A;  2QF7 A;  3VYS B;  1DU0 A;  4YIR X;  3I9V 2;  3ZOB A;  1BJZ A;  3K6G A;  4HX8 A;  2GXB A;  2UXN A;  4I0B A;  4HV5 A;  4K2E A;  3EPZ A;  1XGS A;  4DOZ A;  4RB2 C;  1I1G A;  3HC7 A;  1S72 I;  4EJT A;  2R5Z B;  5D6E A;  4Q47 A;  1FC3 A;  2KRC A;  4BYY A;  2BY0 A;  3FMS A;  2LD5 A;  1QPM A;  4I7H A;  3KE2 A;  1C0W A;  2P0W A;  4AVP A;  3S3M A;  5F6F A;  3DU5 A;  2FBH A;  2I10 A;  4G6D A;  3EQL F;  5C3E J;  1LE8 A;  2DYS H;  4CIC A;  2VJ5 A;  1Z0X A;  1T6S A;  2DMP A;  2DN0 A;  1HF0 A;  3QOE A;  1GV2 A;  2K5C A;  3GCM A;  2K3F A;  3ABK H;  3PQJ A;  4N4O B;  5HS9 A;  2O8K A;  3RYR A;  3A01 B;  2KHM A;  4C30 A;  3CO6 C;  1NHA A;  4U7B A;  1PVE A;  1MZB A;  5F04 A;  4CYD A;  1D0X A;  1U0J A;  5KHD A;  4EJO A;  3O8H A;  1OCC H;  3FHZ A;  1HKQ A;  3GFL A;  5JVG F;  5F0H A;  1AKH A;  5IYB J;  3M3Y J;  3LSG A;  1XX5 A;  2CG4 A;  2WAF A;  4I09 A;  3ZMS A;  3OS0 A;  4KA4 A;  1E17 A;  3L2R A;  2A5Y B;  4A3E J;  3DQV C;  4IQJ A;  1TTY A;  2CQQ A;  2G7H A;  1U5T B;  1KA8 A;  5D6F A;  2A6T A;  4UVB A;  5GP9 A;  2JRT A;  1TT0 A;  2FD5 A;  3C1D A;  3LSK A;  4A3G J;  1G8X A;  1P9Q C;  4Y4R A;  4H4K C;  2JA7 J;  1ZR4 A;  4HAM A;  2YUS A;  4AIK A;  2NS7 A;  4IPA A;  2JUG A;  4JK1 X;  3HRU A;  4D9J A;  3PO3 J;  3L2Q A;  2DT7 B;  1IG7 A;  2B9S A;  2EIN H;  5TIS C;  4Y52 J;  1SFU A;  4FTH A;  1FX7 A;  3R60 A;  2P4W A;  1V55 H;  5CVR A;  5LBQ A;  3J7Y J;  2OCE A;  4B1R A;  1EH6 A;  3HBL A;  3CUO A;  3OR1 C;  2NOJ B;  3H36 A;  1VF9 A;  1B6A A;  2BY1 A;  2O03 A;  3DEE A;  1XSX A;  2FQ4 A;  4NC6 A;  4XNF A;  5DEQ A;  1POG A;  1MMN A;  2WV1 A;  2XAS A;  1WJE A;  1JGG A;  4HW0 A;  4E7K A;  5CLS A;  2L9S A;  5LRS A;  2NOG A;  2L4M A;  2KJB A;  1HA8 A;  4AM3 A;  2XF6 A;  1XCV A;  4NQW B;  2EIM H;  4KDP A;  2M30 A;  2EIK H;  1I27 A;  2IT0 A;  4MO7 A;  2QBY B;  2AO9 A;  2BBY A;  4OMY A;  3FHN A;  3KCC A;  5BOX A;  1W0U A;  4CYC A;  5EJC A;  2GQQ A;  2KLO A;  2PQ8 A;  3BJ6 A;  4ANJ A;  1G6N A;  1TWA J;  1KQ0 A;  5JI6 A;  3KYD B;  1T2K A;  3JRD A;  2R7Q A;  2WA0 A;  4OU0 A;  4PZJ A;  2VBZ A;  3ZPL A;  2L0K A;  4DBQ A;  1W0T A;  3DBR B;  4HRI A;  4EVI A;  3DFG A;  5D5U B;  1KU7 A;  4BKX A;  4QIW N;  2P7V B;  2KIU A;  4QSH A;  2P81 A;  3S3O A;  2LF7 A;  4B47 A;  4EM1 A;  5FO5 A;  4BDZ A;  2VQL A;  3LQR A;  3LWF A;  1RES A;  1XB4 A;  2EA4 A;  2R7X A;  3S17 J;  9ANT A;  2DTZ A;  2ZXJ A;  1MDM B;  3SDG A;  4ZZL A;  2F5D A;  1ZG5 A;  2NXN B;  5IY5 H;  2AXT C;  2P6T A;  2P8T A;  2PMU A;  1R22 A;  2H94 A;  1YHQ I;  4W1U A;  3KX2 A;  2W57 A;  1FOX A;  4LLG F;  1O3R A;  1TNS A;  5J8C A;  3UNG C;  3IKV A;  4UB8 C;  3K69 A;  2FOK A;  3FBI B;  2FF4 A;  1XSV A;  1LUJ B;  2X6Y A;  5FRM A;  2HFH A;  2ME0 A;  2JA6 J;  2WAD A;  5F64 A;  5J8F A;  3IL2 A;  1K7A A;  2JA5 J;  1HKS A;  4MGR A;  3U2R A;  4BH9 A;  3O2P E;  4BY1 J;  1YW9 A;  1S9H A;  5IP6 A;  2MD0 A;  2V9V A;  2ZNZ A;  1MGT A;  2CO5 A;  1A35 A;  2VL8 A;  2Y31 A;  3FXK A;  2DXI A;  1LFB A;  4ETS A;  2EFN A;  1Y8R B;  2NVY J;  3K4C A;  3K4L A;  3ZQH A;  4A3D J;  2YS9 A;  2XKP A;  4XLN F;  1OYW A;  2PMZ N;  3L2V A;  3HXL A;  3BTJ A;  3WU2 C;  3GTQ J;  1ZRE A;  2M7B A;  3DTI A;  3ABU A;  4IOC F;  4UV8 A;  4RB0 A;  1IAW A;  1OR7 C;  4HST A;  2MW8 A;  4XOT A;  3QYE A;  3OS1 A;  2Z9O A;  2ETH A;  2LH9 A;  2OPT A;  3F22 A;  4A0Y A;  5A2Q Z;  4RMN A;  1SC7 A;  4HLY A;  1IV6 A;  2JUC A;  4F3Q A;  1SVL A;  3ERM A;  4XBF A;  2RVC A;  1NTC A;  4BEH B;  1QNT A;  2EIJ H;  1FJL A;  2RNJ A;  2OU2 A;  4CXF A;  4GFB A;  1OCZ H;  4F91 B;  2VN2 A;  3CUQ B;  1MJA A;  2DYR H;  1Z7L A;  4HQE A;  2R92 J;  3HEF A;  5IYC J;  3OL3 A;  3CZ6 A;  3Q0U A;  4D7M A;  4EEF G;  3TO7 A;  4L0Z B;  6PAX A;  5EZH A;  3KYL A;  2JT1 A;  5EYR A;  2HGC A;  5ILV A;  3GLX A;  3I53 A;  3P5J A;  5HDG A;  1WJC A;  3CTA A;  5FD5 A;  4YIF A;  3M1E A;  2F6C A;  2FRH A;  4HX7 A;  1J59 A;  2DJN A;  2DO7 A;  3CF5 F;  2VI6 A;  1N77 A;  3FXM A;  4KIF A;  1SVM A;  2DJI A;  1VTN C;  2D2W A;  3LL7 A;  1R7J A;  3S14 J;  5E79 C;  2VQG A;  4XKC A;  3PNV A;  3BR6 A;  3QWL A;  4F55 A;  2GAU A;  3FXO A;  4WF2 A;  2BVM A;  3CQZ J;  3M9A A;  1Z3Y A;  1WJF A;  3CCV I;  2XF7 A;  3ASN H;  1MD0 A;  2MC4 A;  2MH2 A;  1O3T A;  1GUU A;  4ENM A;  4MTD A;  3V7S A;  1J2X A;  3F23 A;  1ZGW A;  2LBF A;  1ZGJ A;  4EM2 A;  2IA0 A;  3PUF A;  1E3H A;  3MWM A;  3L00 A;  3B73 A;  2X6W A;  2VOD A;  3T8R A;  2M8G X;  1BC8 C;  1YX5 A;  3PJR A;  5D4S A;  3K1M A;  2QQ8 A;  3RPU A;  4CSW A;  2HPI A;  3SFI A;  1SD5 A;  2P5K A;  3ECO A;  2YX4 A;  2E35 A;  5FKK A;  4G7Z F;  2OZ6 A;  4ZTF A;  4OOI A;  5IP7 J;  5KAF C;  2PJR A;  3TO6 A;  2V1N A;  5BPI A;  3WTU C;  3HDD A;  2A05 A;  3RI4 A;  1MBG A;  2KRH A;  1WSU A;  3U1K A;  1FLI A;  2HOT A;  1LNW A;  4L9V A;  3E6C C;  2ZKZ A;  1SAX A;  4M3B A;  1QHG A;  2O61 A;  1LE8 B;  2M9H A;  2DMQ A;  2R3S A;  2HI3 A;  1NK2 P;  3MZH A;  2VT2 A;  1ZYR F;  2F5E A;  2E5Z A;  2DMN A;  2A6E F;  2FA5 A;  2IPQ X;  4BS9 A;  4YEJ A;  3J7A Y;  3IRR A;  1JE8 A;  1FYL A;  1SFK A;  1YI2 I;  4FE7 A;  3SHF A;  4J19 A;  1YIT I;  2QQB A;  4ENK A;  4MLO A;  1RC9 A;  3DKY A;  4UUS A;  2H6B A;  1JTX A;  1OYI A;  4H0E A;  3HYI A;  2L01 A;  4AC0 A;  1VQO I;  2X51 A;  3AG2 H;  3RCO A;  1TBX A;  2XC7 A;  1Z77 A;  2CJJ A;  4M9S A;  1D0Z A;  4II3 A;  1FOY A;  4KIG A;  1BR4 A;  3T8T A;  3CP2 A;  4OWR B;  3LFK A;  4IO9 F;  2VOP A;  4XLE A;  4CZZ A;  2Z33 A;  3RIR A;  1OKR A;  3F6O A;  1K4T A;  1QU3 A;  1QRY A;  2GWR A;  1T56 A;  1VFC A;  2E2J J;  3PQK A;  4C3I J;  3VWB A;  3BOQ A;  1OPC A;  1AKH B;  1UHW A;  3H9J A;  1R49 A;  4HF2 A;  2GM4 A;  4E7L A;  1CF7 A;  1D1A A;  2QLZ A;  4CGZ A;  3KLN A;  1XPX A;  3F0C A;  1WJA A;  5F1J A;  3C18 A;  1FPQ A;  3CC4 I;  2XSD C;  4RBO A;  1IN8 A;  3GUD A;  2DU9 A;  2E7X A;  2QKL B;  3I71 A;  3Q0W A;  5J3L A;  2XPV A;  2E1C A;  1ZTR A;  3FIW A;  1T38 A;  1WCM J;  1B72 A;  3K4K A;  1H0M A;  1MIJ A;  3BY6 A;  2AQE A;  1K78 A;  1TNT A;  1JJ6 C;  5LGN A;  1JT6 A;  2CSO A;  1LVK A;  3H3Z A;  2ZME C;  1ENH A;  1OCR H;  3FM5 A;  2HOA A;  3OR2 C;  5CVI A;  3V7R A;  2JPC A;  3S2W A;  2HYG D;  1VQN I;  1YW7 A;  5JFR A;  2ZJP F;  5E1X A;  5FGM A;  1MMD A;  4RS8 A;  4WK8 F;  2A69 F;  4HG2 A;  2K9M A;  2HQA A;  4BY7 J;  4BE1 A;  2Z5U A;  2O3F A;  1J75 A;  1I6X A;  3I58 A;  3ERE D;  2HOS A;  1E0E A;  3VDX A;  2E36 A;  1WWX A;  2KDZ A;  1OIS A;  3DTE A;  1KU3 A;  2ZO4 A;  2KFD A;  3BR3 A;  3CCJ I;  2JPB A;  1QBJ A;  3AKZ A;  1ETY A;  1TZL A;  4XK4 A;  3K7A J;  1OQY A;  4JQF A;  1Y56 A;  1UZC A;  4BE2 A;  4N9I A;  3BTI A;  2X1E A;  2LFB A;  1BI0 A;  3EET A;  3E5U A;  1NH3 A;  4NC8 A;  1B8I B;  2HPM A;  3IH3 A;  2W1O A;  5FJ8 J;  1RIO H;  2F48 A;  3VFZ A;  2CUF A;  2X4H A;  2QEN A;  4YRV A;  2QKM B;  4CYC B;  1PJR A;  1S7O A;  4MFD A;  2FMY A;  4RGU A;  2L02 A;  3LST A;  1FBS A;  2BW3 A;  3FXL A;  3IUO A;  4BJ6 C;  1ZAR A;  1Q1V A;  2FNP A;  2VE8 A;  3S93 A;  2K9L A;  1J7K A;  3VEP A;  3WTT C;  2XSJ C;  5D4R A;  2MBF A;  4PJJ A;  2M7A A;  3HG9 A;  4CCJ A;  5LLQ A;  4A3I J;  2BGC A;  5M3M J;  1ODD A;  2RC4 A;  3HOV J;  3I4P A;  3VOD A;  2J5P A;  2JSC A;  3K2A A;  2WB1 N;  4KNY A;  3OSF A;  3TMO A;  3H9Q A;  4PJM A;  4BHB A;  4ENN A;  3JRI A;  2M34 A;  5B66 C;  3S1Q J;  1JKP C;  4C3J J;  2E5N A;  3JR9 A;  3WU1 B;  1BIA A;  3JAM Z;  2MYS A;  3LNQ A;  5EEG A;  3EYI A;  3BR5 A;  3VSK A;  4HX4 A;  4G7H F;  1PYV A;  2VC0 A;  5B5E C;  3KP6 A;  2H1L A;  1LPQ A;  3LA2 A;  1B9N A;  2IA2 A;  1H88 C;  2KL4 A;  2ME6 A;  1APL C;  3ZCO A;  2BHY A;  3VYT B;  4XSX F;  1MKM A;  2LKP A;  4NDL A;  1G3Y A;  2L7M P;  4RGR A;  3MEX A;  3RKW A;  2NS8 A;  1LDJ A;  1D5Y A;  2R5Y A;  2H1K A;  1Y0U A;  5GAG J;  4ZZD A;  1TWC J;  3DF8 A;  1FNN A;  2AQF A;  3D1N I;  1F43 A;  3MVP A;  1K6Y A;  2M45 A;  3WTS C;  3WTW C;  1R5I D;  2F4M B;  2XHK A;  3EUK L;  2VLA A;  3G2B A;  3D5L A;  4BDY A;  2PLY A;  5K7Z A;  3KLO A;  3OYD A;  1FBQ A;  2CQN A;  2L7K A;  2EWN A;  5ICF A;  1ETX A;  3QYB A;  4A69 C;  2MSY A;  4CDG A;  4NHJ A;  4Q4Z F;  1Z91 A;  2OTJ I;  1I50 J;  4CCO A;  3U9G A;  3I59 A;  3WTZ A;  4BAY A;  3EUA A;  1WI9 A;  2VQC A;  2ZBK A;  1OFC X;  2VC1 A;  3FK7 A;  2QSH X;  3JW4 A;  2P5L C;  3HOY J;  3SDB A;  4U0W A;  1GDT A;  2X0L A;  4AWX B;  4V19 K;  4A3B J;  3BC8 A;  5JR3 A;  4D5F A;  3FMQ A;  4GDF A;  2H27 A;  2YU3 A;  2DOA A;  4L5I A;  2QEX I;  2G9W A;  4PGG A;  5HDK A;  2Y0S N;  2R7F A;  1XG1 A;  5FFX A;  5K1Y A;  4CHU A;  4O3M A;  4DYC A;  3BWG A;  1XGM A;  2BY2 A;  4M73 A;  5F0F A;  2IEK A;  2X6O A;  1A6Q A;  2XRO A;  3LMM A;  4U0Y A;  1Z67 A;  4HLX A;  2QWW A;  2NNY A;  3DP7 A;  3FX3 A;  2FX0 A;  1OCO H;  2PI0 A;  2UXX A;  3RKQ A;  2R0Q C;  4GCV A;  2ZXW H;  4M3E A;  4BBR J;  1Y6I A;  2XRL A;  3CCQ I;  3TOB A;  3CDI A;  2GZW A;  3TO9 A;  1BIB A;  3QRF F;  1D8K A;  4IHV A;  2K27 A;  4LK1 F;  2Y69 H;  1TWG J;  2QSF X;  2L54 A;  2XAQ A;  3CLQ A;  3OWT A;  5GAH J;  3N97 A;  1JKR C;  3OIQ A;  1IGN A;  2KIF A;  5JLW A;  4CCM A;  3V4G A;  1JUS A;  2XIG A;  2R7U A;  5E18 F;  2OBP A;  2BYV E;  1BJA A;  4HZF A;  3Q0V A;  2P6S A;  2LBF B;  1R1U A;  3SYT A;  4RB3 C;  4OAY A;  4HSR A;  2MC3 A;  3BZK A;  4YG2 F;  1P6R A;  5FB2 A;  4KJZ A;  3EYY A;  2WV0 A;  3GBG A;  1E3P A;  1R23 A;  2ISZ A;  3LAJ A;  1TWF J;  4BQA A;  3T0Y A;  1P2F A;  2XPW A;  3GTK J;  1R9T J;  4ZH4 F;  3HOT A;  1J9I A;  2YU9 J;  3QQA A;  5CKT A;  5AIP A;  1K4S A;  4BXU A;  2BXY A;  4MTE A;  1PP8 F;  3VPR A;  2PJR B;  2ZSH B;  2CGP A;  4XKV A;  4PFO A;  1R5H A;  2XVC A;  2H8W A;  2M0M A;  2HTJ A;  4IF4 A;  1P4W A;  3HKZ N;  4RAG A;  3GZ6 A;  3MFK A;  2IXS A;  2FE3 A;  5DD8 A;  5TGT A;  2D1H A;  1WQ2 A;  2PG4 A;  3OYH A;  2BY3 A;  3H5A A;  1WKM A;  2A68 F;  2DI3 A;  5ILU A;  1G59 A;  1MMS A;  4DZJ A;  3TOA A;  3BQY A;  3JSO A;  4UY8 I;  1JTY A;  1QGP A;  2M4K A;  1I1S A;  4RB1 A;  4F52 A;  3G3Z A;  1LDD A;  1HW2 A;  4JBA A;  4TV7 A;  1FOW A;  4IKF A;  4UUS B;  2UZK A;  3ZQG A;  4CH7 A;  4LIV A;  2HNH A;  1MSE C;  5E17 F;  5J47 A;  1HBX G;  1TLH B;  3K10 A;  5C4J J;  5A2Q K;  3B6A A;  1YYV A;  4U0V A;  1TP4 A;  2IP2 A;  3ZQC A;  1HOM A;  4LIT A;  3GTL J;  4PSW A;  5JVT A;  4LMY A;  2V79 A;  1VI0 A;  2GOX B;  3E0J B;  5HLI A;  3NRV A;  1DU6 A;  3HGY A;  2Z1D A;  2IRF G;  2HDC A;  1IZ1 A;  3LSJ A;  1JJ8 C;  4HPQ A;  5FLV A;  5DD4 A;  1FYK A;  3PNT A;  1CF7 B;  3R6S A;  1IN6 A;  3DKX A;  2ACJ A;  3MN2 A;  5IT9 K;  2QZ8 A;  4M71 A;  4F93 B;  2DFI A;  1RKT A;  3VB2 A;  5C4X J;  1V5G A;  2BXZ A;  5D5W B;  1RR8 C;  3BRO A;  2E1N A;  2ZCW A;  1Y1W J;  3CCY A;  3RPU D;  2V1X A;  4OIQ F;  4EAT A;  2M2E A;  5DTD A;  3HOU J;  1Z21 A;  1B72 B;  3OYI A;  1ZLJ A;  3SEQ A;  3J81 Z;  2X9D A;  2IVM A;  4IHT A;  3KPH A;  2ZJQ F;  1G3S A;  1K78 B;  4CCN A;  3WHC A;  3I3L A;  2M8E A;  3W6J B;  1DGR M;  1QVU A;  4Z6Y A;  3J80 Z;  5J1U A;  3LSR A;  3BPX A;  2PEX A;  4P96 A;  2KIS A;  5IT3 A;  3QPL A;  1YJW I;  1ZH5 A;  4UVA A;  1IN7 A;  4L9N A;  3G73 A;  3ZXS A;  2IGN A;  2F5C A;  2XF5 A;  1HLV A;  4XR6 A;  2NVX J;  1N25 A;  3LSP A;  2FML A;  3R0A A;  5J4V A;  2OUM A;  4IX7 A;  1RR7 A;  3RKX A;  1R1T A;  2ZFU A;  2CV2 A;  3ABL H;  4WXD A;  3BQZ A;  2GIZ A;  1Z7U A;  4A0Z A;  4MEX F;  1W7P A;  4LIU A;  1XCB A;  5ILS A;  1B8I A;  3H35 A;  1J5Y A;  1AA7 A;  1TQM A;  4IJA A;  1MND A;  1MBH A;  3AL0 C;  3I56 I;  3KP2 A;  4CO8 A;  4LB5 A;  1A5J A;  1HQC A;  2M87 A;  2L9N A;  1BOB A;  4V2G A;  1JI8 A;  3Q9V A;  5E3L A;  4PK4 A;  5KCM A;  3SQN A;  2QUF A;  1O3S A;  1JHF A;  2BW3 B;  2G0E A;  4BUP A;  1SD4 A;  3EUH C;  5FD6 A;  1OMI A;  2V9K A;  2VKD A;  3NAU A;  1HSJ A;  1JKQ C;  1A6I A;  4PJ0 C;  1Y39 A;  4RGS A;  1KU9 A;  2FSW A;  3KP4 A;  1GT0 C;  4N4N B;  4BHP A;  2LDU A;  2TCT A;  5CVJ A;  5F27 A;  2K9Q A;  3Q5F A;  2XKO A;  1K61 A;  1GVD A;  2LNB A;  2LY2 A;  4HF0 A;  2O9L A;  3WE3 A;  3ZQ7 A;  1VZ0 A;  4PSX A;  3HUG A;  1VQ4 I;  5CQE A;  4EGY A;  4ZDL A;  1WHU A;  4BBS J;  4IHX A;  3OYG A;  1D1C A;  1FMV A;  2DA7 A;  1J09 A;  4CCL A;  4GYG A;  1WRJ A;  1RRJ A;  2PBI A;  2VAS A;  4F92 B;  1ETW A;  3I55 I;  4LFU A;  5B3S H;  4MHG A;  5DDG A;  4HNU A;  5ICC A;  3HOX J;  1ZKG A;  3V42 A;  5E1Z B;  4EJV A;  5E3M A;  1QZZ A;  2HS5 A;  3JTG A;  1G2H A;  1T39 A;  1FWZ A;  2DPD A;  1YJ9 I;  2CFX A;  3HB9 A;  4DZP A;  1T95 A;  1HST A;  3WE2 A;  4ITV A;  3CMM A;  5HNF A;  3FBN B;  4RAF A;  1FOK A;  4S05 A;  5HVQ C;  2E1M C;  1K6O A;  1Z05 A;  2Q2E A;  3Q3S A;  4G6Q A;  4BL0 B;  5JHF A;  4HQM A;  5KVR A;  3RKY A;  2R5Y B;  2Y75 A;  2D1V A;  5DUK A;  1R00 A;  1UMQ A;  1MBJ A;  1OR7 A;  3K70 C;  4FX4 A;  5M3F J;  3NWT A;  4S04 A;  4A3K J;  1LFP A;  2F4I A;  5J1R A;  1Z6T A;  4XQF A;  3ECH A;  1S8N A;  5DCM B;  1MH3 A;  3H0D A;  4L18 B;  2UV1 A;  4JP0 A;  3CCL I;  2ESN A;  3ABT A;  2CQX A;  2G7U A;  2DPU A;  1WJ5 A;  3QPH A;  1W36 D;  5FFZ A;  2X6X A;  5BMZ A;  3GTJ J;  5M5W J;  4HNT A;  1YG2 A;  4OIO F;  2V1D A;  2OQR A;  4UB6 C;  2KRF A;  1W5C C;  5TJJ A;  3I54 A;  3I59 B;  3F8F A;  2ZJR F;  5FLX K;  4AYB A;  3ONQ A;  2W7N A;  1X4O A;  3BCB A;  3W6K B;  4QWQ A;  2H8R A;  3HIF A;  4FHT A;  2ZB9 A;  4HA8 A;  1RI7 A;  2DW4 A;  2GBY A;  2BOL A;  3QOP A;  1HCR A;  3ZN1 A;  3AAF A;  2BE5 F;  5FKM A;  4PGH A;  3COA C;  4EM0 B;  4M3F A;  4N0B A;  3SXY A;  2A3S A;  2DOF A;  3BP8 A;  3I4M J;  1AHD P;  4E7Z A;  3GFJ A;  3HZJ A;  4EQQ A;  3EDP A;  1OCT C;  3LA7 A;  2R4G A;  2GXA A;  3AFH A;  3H5R A;  4OAZ A;  3P9C A;  5KAI C;  3IV5 A;  1RPW A;  5IOY A;  1E2X A;  3PM1 A;  3HOS A;  4UUV A;  2BV6 A;  3CC7 I;  4KMF A;  2MGQ A;  3V7C A;  1TQI A;  1A31 A;  2B0L A;  4PCQ A;  1UFM A;  1A04 A;  3H9G A;  4L5J A;  3LA3 A;  3E6B A;  3M1C A;  2ESH A;  1ETK A;  3CCE I;  2OCC H;  4XRS A;  5E8G A;  5FLM J;  1F36 A;  1IO2 A;  1MH4 A;  3WU0 A;  2O7O A;  1P7I A;  4FX0 A;  1WH5 A;  5BPD A;  2VUM J;  2GXG A;  4BJ5 C;  2KPM A;  2N8G A;  2DFF A;  3JAM K;  4MNU A;  3ZQQ A;  3JRG A;  4BHC A;  2EIL H;  1RZ4 A;  1MMG A;  2MFZ A;  3QU6 A;  1D1B A;  3LAP A;  2EK5 A;  1ON1 A;  3PIP F;  1BOA A;  2VKH A;  3K1N A;  3DPL C;  1FIP A;  2VB6 A;  2ZC2 A;  4KN7 X;  4M3G A;  3ROU A;  4C9Y A;  2EFW A;  5GPC A;  3RQ4 A;  2E7W A;  2ELK A;  3O3K A;  2ZSI B;  1WZ2 A;  5LD2 C;  4B8X A;  1YE9 A;  2ADU A;  4LB6 B;  2Z99 A;  1VQM I;  1T8I A;  4KIB A;  1OJL A;  3MKL A;  4IVN A;  3ULQ B;  2KT0 A;  3L9F A;  4RGX A;  5LFA A;  4ENJ A;  3TP0 A;  4XSZ F;  1ZEL A;  2BHZ A;  2VBX A;  2HYF A;  3MMY B;  3H5N A;  4MIM A;  5DS9 A;  3V8L A;  3ZMT A;  3FKI J;  2DA5 A;  3GFI A;  5D8K B;  3H0G J;  3P9I A;  3G4S I;  2LKX A;  1F5T A;  5D5V B;  4G6T B;  1MBF A;  1ZR2 A;  5CQG A;  4U7D A;  1O3Q A;  5F08 A;  2A61 A;  4KYW A;  2COB A;  3F21 A;  2X1C A;  3F3X A;  2STW A;  1WGX A;  1R6R A;  5L3G A;  5E3N A;  5K5R A;  2XV4 S;  4G94 A;  4XKW A;  3VYR B;  4ESB A;  2NAZ A;  3ZMD A;  3HTU A;  3FXQ A;  3HHG A;  3WGH A;  1O57 A;  2LKS A;  4CUG A;  2W00 A;  2OD5 A;  2VXZ A;  1EF4 A;  3RYP A;  1RUN A;  2QM3 A;  4JX6 A;  4O5V A;  3CCU I;  2R7Z J;  4BQQ A;  2RRE A;  4Q5S F;  1R36 A;  5IPA A;  4UNO A;  1ZN2 A;  3DLA A;  3CP8 A;  2EB7 A;  4C3H J;  4BXX J;  1IDY A;  1SD7 A;  3BTL A;  2E19 A;  2KJC A;  2M1B A;  2HKO A;  1U6G A;  1W4M A;  2XUB A;  2VKE A;  4S0H B;  3GTO J;  2CMP A;  2EFO A;  2HQN A;  4XN0 A;  2Y30 A;  4BJT A;  3HL2 A;  1ON2 A;  2EFP A;  1SVO A;  4C2U A;  1SFX A;  2XB5 A;  4B09 A;  4X1E A;  5H20 A;  4JYK A;  1YRN A;  4LOC A;  2L4A A;  2ZME A;  4PDK A;  1OLT A;  1ZG1 A;  1JUP A;  2P7C B;  3DLL F;  1H9G A;  2KZV A;  2XAJ A;  2Y2Z A;  4M6V A;  4EV0 A;  5J4Y A;  2WAQ N;  2WBM A;  1J0R A;  4GRI A;  5FKL A;  1X3U A;  3ISP A;  3OYB A;  1PUF A;  2XAF A;  4HBL A;  2K40 A;  4MEY F;  1U5T C;  4FT8 A;  3DPU A;  4Y33 A;  3C2H A;  3FMR A;  4CZC A;  5KNL A;  1LJ9 A;  4U88 A;  1GXQ A;  1ZK8 A;  4KT5 C;  3AG3 H;  3I64 A;  4A5N A;  3KZY A;  4R8H A;  2CUE A;  4BU2 A;  1ONV A;  3ZMU A;  5GAE J;  3AL0 B;  3K2Z A;  2HXO A;  1FSH A;  1LEB A;  2WY7 Q;  3DWL E;  2VQH A;  3BJA A;  1W7P B;  1YS7 A;  1CGP A;  4D5C A;  1V54 H;  2JVG A;  4NNJ A;  4EMS A;  3MZ8 A;  2HWV A;  1X1P A;  4XLH A;  3DU6 A;  3C2G A;  1V5F A;  2WC2 A;  2ELH A;  3SZG A;  5CPR B;  5TRD A;  1ZLK A;  4A12 A;  1P4A A;  4R79 A;  3L2W A;  5JLX A;  4GO1 A;  4HV6 A;  3GO5 A;  3KP5 A;  1X1B A;  3GW2 A;  1SMT A;  4HOB A;  1D3Y A;  5HS7 A;  2BVL A;  4KIC A;  2LOO A;  2Y9Y A;  2OZU A;  4ZYE A;  2YR2 A;  4MQV A;  2O0Y A;  3W3C A;  2O5R A;  4FQG A;  5HOO A;  3SFZ A;  5HNH A;  2HZD A;  5HDN A;  1VQ7 I;  2FBI A;  3X2Q H;  1MBE A;  2IBD A;  2L2O A;  4G8X A;  1D8J A;  3CJT B;  3K4B A;  4XLA A;  1VQL I;  1ZHF A;  3T1B A;  4RAY A;  4QPQ A;  2JQ7 A;  4A3F J;  1BI3 A;  5GTI C;  1U9N A;  1ZG3 A;  4M9X A;  2WY8 Q;  3BLY A;  3A1Y A;  3HUG B;  2LC2 A;  4Q48 A;  3BG6 A;  3IHU A;  3HRM A;  4A3J J;  2EV6 A;  1P7J A;  2CQK A;  1ETV A;  4IXA A;  1DDN A;  2QQA A;  3GWZ A;  1GXP A;  1IRF A;  2Y0S A;  3B6C A;  1ZRC A;  3SZP A;  2E2H J;  1UHM A;  2EPF A;  4E7J A;  1FYM A;  3S15 J;  2L9R A;  1FEX A;  2K9S A;  4LLN A;  2E1M B;  1S7E A;  4XLC A;  1X3Z B;  5KK1 A;  5HOD A;  5M5Y J;  2ZNY A;  4A3M J;  1VQ5 I;  2HVS A;  3QPS A;  3HTS B;  3OS2 A;  2ID6 A;  2XAH A;  2EA2 A;  4E7I A;  3FIS A;  3GYH X;  3SJM A;  2Q2E B;  3HM5 A;  4M6X A;  1W7P D;  4QLC U;  3A4C A;  4IHW A;  2Y0M A;  2A6H F;  2DT6 A;  2LY1 A;  2VIX A;  3HSF A;  1N78 A;  2FQ3 A;  5DCM A;  3RZO J;  3RPQ A;  1LQ1 A;  2EH3 A;  5J6X A;  3DEU A;  3TW6 A;  2LK2 A;  1AOY A;  3M07 A;  3QP5 A;  2PFB A;  4J01 A;  2V1U A;  5EF6 A;  5EGO A;  2IGK A;  2XPU A;  4Y3O A;  1QZE A;  3R4K A;  1Z3X A;  3JTH A;  2A07 F;  3PFI A;  2VKV A;  3F8C A;  2ELJ A;  5EG0 A;  4B3A A;  1QO0 D;  2EQR A;  3DBL B;  3HPG A;  4D0P A;  1ZAO A;  1UG2 A;  2W85 A;  1X3W B;  4XLP F;  4UUT A;  3F72 A;  1QQI A;  4P1W A;  3JRH A;  4ZYH A;  2LYC A;  3HJE A;  3NWS A;  1WH7 A;  1XN7 A;  1B59 A;  2CYY A;  2DA6 A;  2VE9 A;  5EEA A;  3OYE A;  1NK3 P;  4I98 B;  2X48 A;  1VQ6 I;  5M5X J;  2CFO A;  3OOU A;  5LGU A;  2X85 A;  2HEO A;  4B48 A;  4P9F A;  3V8K A;  2DK5 A;  2L7Z A;  3C7J A;  3FF5 A;  4E7S A;  4LG0 A;  2LLK A;  4HYE A;  1S7A A;  2NVU B;  3WTY C;  1KON A;  3OYJ A;  2ZFW A;  1FP1 D;  3O8G A;  4BE0 A;  1W5T A;  2LRD A;  3I5U A;  3G1O A;  2EZH A;  3ML6 A;  2I5U A;  2JVH A;  2K85 A;  4AIJ A;  3K0L A;  4ZDO A;  1B9M A;  4OIR F;  4HF1 A;  4G7O F;  2KKO A;  2MD5 A;  3CUQ C;  2D45 A;  3S1N J;  3LOC A;  1UHS A;  4I02 A;  4ON0 A;  1FMW A;  1T08 B;  3J7A O;  3E5X A;  5ICG A;  4ABZ A;  5LEJ A;  3CCM I;  2VBY A;  3KP7 A;  3OYK A;  1A36 A;  1L3L A;  2NNN A;  4EGZ A;  1XC5 A;  4YEL A;  3A2K A;  4CCK A;  1TL8 A;  1YOV B;  2IGO A;  4LD5 A;  4D7N A;  2DQR A;  4B43 A;  3A02 A;  4ESJ A;  1D5V A;  2JZY A;  3CD6 I;  1N75 A;  1LDK B;  3ZN0 A;  4XM3 A;  1FIA A;  1AWC A;  2L5Q A;  2PN6 A;  3I0T A;  3BTC A;  4AU7 A;  4DNC A;  4KFC A;  1QHH D;  2EV0 A;  3FXJ A;  1R4N B;  1KU2 A;  3P7N A;  1Y0N A;  2E71 A;  5E1W A;  2DDB A;  3FDY A;  1P92 A;  3D5R C;  2CV0 A;  1JGS A;  4DJA A;  5LHI A;  4BGD A;  5DM7 F;  3WGG A;  5GAD J;  5HLH A;  3W2V A;  1YFH A;  2L9V A;  3JRE A;  4X6A J;  1SAU A;  4XRS G;  4ZYA A;  4IHS A;  4FET A;  1MJ9 A;  2ZXH A;  3M8F A;  3DEW A;  1FZP B;  2Q0O A;  2UWM A;  2DT5 A;  2D5V A;  3CJN A;  2VBW A;  3S1R J;  5L3F A;  4B4C A;  2EV5 A;  1RET A;  3ZMZ A;  1JHH A;  1ZRF A;  3BG7 A;  3BG5 A;  2RDP A;  1R71 A;  2CU7 A;  2JWT A;  2MLG A;  1FSE A;  4UXN A;  2K7L A;  2DCE A;  3BJO A;  2AXL A;  1ORK A;  4L9T A;  4CA0 A;  2WWY A;  1QA6 A;  2IS6 A;  4M74 A;  4JX5 A;  3OYA A;  2JA8 J;  5GTH C;  5L3C A;  3M8E A;  2DA1 A;  2KIQ A;  3CDL A;  1KQ9 A;  3RJP A;  2MA3 A;  4DIQ A;  2DAO A;  3M8J A;  2R7T A;  4IQ4 A;  1DGW Y;  1FP2 A;  5BNG A;  2XAG A;  3G1M A;  1Z9C A;  1FTZ A;  1BBY A;  4XOP A;  2XB0 X;  4P9U A;  1ULY A;  4ASN A;  2LG4 A;  5K5Q A;  3MCZ A;  2FEZ A;  4XMY A;  1GHC A;  5L3B A;  2ZJ2 A;  4M72 A;  2O6G E;  2CS3 A;  1H89 C;  1IRX A;  3S2H J;  3TQN A;  1TT5 B;  1ZGA A;  3FWE A;  3H1C A;  2LVS A;  4ZYD A;  1L0O C;  3JSP A;  4A93 J;  1XDS A;  3WTV C;  2DOE A;  3ZGK A;  3H3U A;  1FT9 A;  1HXD A;  2OV7 A;  3QP6 A;  1YRN B;  3K9T A;  2ZME B;  3ZRG A;  3ESW B;  3GXO A;  3ZP5 A;  3S3N A;  2IS4 A;  1RUO A;  3H3V K;  4ZC3 A;  1YS6 A;  5ED4 A;  3U21 A;  4JOM A;  3UKG A;  1BA5 A;  1PUF B;  3PUB A;  5K7F A;  1OYY A;  1X2N A;  2YPR A;  1VQP I;  2KDO A;  2DMU A;  3GME A;  1QVT A;  3GX4 X;  3Q9S A;  4C2M J;  3CC2 I;  1XTA A;  3O6B B;  2LP0 A;  4LGW A;  2VPL A;  3CJQ B;  1NG6 A;  1X2M A;  2A5W A;  2OF7 A;  3BR0 A;  2DOD A;  3ZMV A;  3KEQ A;  2STT A;  4KIS A;  5DM6 F;  2KP6 A;  3WGI A;  2BZT A;  2V9P A;  4P55 A;  1HKT A;  1K83 J;  3N4M A;  3PO2 J;  3BR2 A;  4E4H A;  2OC6 A;  3MKW B;  2BEO A;  4I6Z A;  2MH9 A;  2IJL A;  2H6C A;  1HDD C;  2W24 A;  4A0X A;  3V8J A;  1TW3 A;  2K3P A;  1E3O C;  4DYR A;  3EUH A;  2B7E A;  4DW6 A;  3GTM J;  4NB5 A;  1FTT A;  1T33 A;  1EKE A;  3DXJ F;  5EZG A;  2HKX A;  4A3L J;  1IN4 A;  1STZ A;  3K4J A;  4I01 A;  5CVV A;  4D1Q A;  3CCR I;  1IF1 A;  2KQR A;  2GOM A;  2PMZ A;  2LMD A;  3S2D J;  2DQL A;  5H2F C;  5HS8 A;  4I76 A;  4WCG A;  4OIN F;  2KZG A;  4E7H A;  4IEJ A;  2VXD A;  2NVT J;  4GGG A;  1BR1 A;  3OYM A;  3IC7 A;  3L7W A;  1X1A A;  3OL4 A;  4AIH A;  2HXI A;  1YW8 A;  1KYZ A;  3IKT A;  1SFE A;  3HOW J;  1BW5 A;  3WOD F;  2E1O A;  5GPA A;  4IHY A;  1TWH J;  3QYF A;  2VOO A;  3WTX C;  3W2A A;  3OSG A;  2V26 A;  4RDU A;  1CQT A;  3M7G A;  1SEU A;  1GVJ A;  3BPV A;  5FRO A;  1U3E M;  1TC3 C;  3F9K A;  1F4K A;  3PSI A;  3JRC A;  4Z2Y A;  3G71 I;  1XD7 A;  3CJR B;  3L2C A;  1IJW C;  2ECB A;  2HQR A;  4IOA F;  3TL4 X;  4KT6 A;  4IL6 C;  3SEZ A;  4B44 A;  3GEZ A;  5DYM A;  1IRG A;  3OV8 A;  4PUS A;  3PNY A;  2VT3 A;  2VON A;  3GTG J;  2OJE D;  2HZT A;  4PJN A;  3CMA I;  5F1R A;  4P5O A;  3FK6 A;  3TDZ C;  3TP3 A;  2IS1 A;  1YIO A;  4G9Y A;  1G3W A;  1ITY A;  4BNC A;  1IC8 A;  1I3Q J;  1NG7 A;  4N9H A;  3TW7 A;  4ZTJ A;  3LQQ A;  3G1L A;  4V2F A;  3IWZ A;  2W25 A;  3MAJ A;  5J1Y A;  2ISY A;  4II2 A;  3DPT A;  1LB2 A;  2YX7 A;  3E6D A;  4J00 A;  3KIO A;  3TBI A;  3GZ5 A;  1MNM C;  3F6V A;  1U78 A;  3A0H C;  5LHH A;  1DP7 P;  3UR3 C;  3F8B A;  5J40 A;  4GYI A;  5L3E A;  3MKZ A;  3ZQL A;  1H8A C;  1BM9 A;  2OAZ A;  2P5V A;  5LHG A;  2K02 A;  2DA4 A;  4RLF A;  4X0G A;  1G3T A;  2DBB A;  2XGD A;  4AVZ A;  2QSG X;  1X58 A;  2LR8 A;  5EGO B;  1XMX A;  3E3V A;  5EDN A;  4KMU X;  1USS A;  1U8R A;  3CCS I;  2JJ7 A;  2M5W A;  3WHB A;  3ZR8 X;  1MW7 A;  3ASO H;  1FY7 A;  5AON A;  5EG0 B;  3IRQ A;  5IYD J;  2CQ7 A;  1X1C A;  3HRT A;  1S3J A;  2DA2 A;  3K4N A;  5E20 A;  2Y48 A;  3CLO A;  3VYU B;  3LSH A;  5F0C A;  1BI1 A;  4DYQ A;  3RSN A;  2VJJ A;  4XID A;  3IH2 A;  1M1E B;  2DFE A;  4I99 C;  5ERI A;  3GVA A;  2QQ9 A;  2QYO A;  1QZY A;  4YFK F;  3AG4 H;  2R7W A;  3M4O J;  1WPK A;  3GZN B;  4MFE A;  3KP3 A;  4AID A;  2FU4 A;  1XS9 A;  1KYW A;  1XGO A;  2HQ5 A;  1B4A A;  4OMZ A;  4ZJZ A;  3F8M A;  2PJP A;  2VJ4 A;  1VQK I;  4L9J A;  1VND A;  2LF8 A;  3PSF A;  4UVC A;  1BL0 A;  1UAA A;  4LG0 B;  2M3A A;  2TDX A;  1JT0 A;  1S29 A;  3RTR A;  3IAS 2;  3GLL A;  4L5E A;  2KIM A;  3A03 A;  4WXH A;  2QA4 I;  4IRI A;  1V4R A;  4AUX A;  5LGT A;  4FCY A;  3D0S A;  3S32 A;  3MZY A;  3NEU A;  1UB9 A;  1XSD A;  2DA3 A;  2R7S A;  4NBQ A;  5IT9 Z;  3IP4 B;  2W4S A;  3AG1 H;  2R7R A;  2CWE A;  1BR2 A;  1XMK A;  3BG3 A;  2XGC A;  1WJB A;  2K9N A;  1KGS A;  1O4X A;  1MSF C;  2JMW A;  4RA2 A;  2L7F P;  1BN5 A;  4R1H A;  1IXC A;  4BQO A;  2FJ1 A;  1X19 A;  4HDU A;  2FUG 2;  2RQP A;  1I39 A;  3DBH B;  4I0A A;  4RM2 A;  1IXR C;  4UHT A;  5H6Q A;  2RKH A;  1BW6 A;  3BDD A;  1HDP A;  4PJL A;  3CME I;  3VOE A;  2FBK A;  4LG3 A;  2VPR A;  4MQ9 F;  4HNV A;  1TW2 A;  1DQU A; 
#chains in the Genus database with same CATH homology
 4CCM A;  4E6K G;  4ANJ A;  2I8D A;  2R7U A;  2UUZ A;  1X1B A;  1V5E A;  2R7Q A;  2LBF B;  2WA0 A;  2BVL A;  2LOO A;  3SYT A;  3VSL A;  4DBQ A;  4OAY A;  4HSR A;  3W3C A;  4HRI A;  2V4J C;  2O5R A;  5HOO A;  5HNH A;  2HZD A;  4KJZ A;  3S3O A;  4B47 A;  2HU9 A;  3GBG A;  2L2O A;  4BDZ A;  3K4B A;  2VQL A;  2MAB A;  4XLA A;  2LRE A;  1T0F C;  4QPQ A;  5FRN A;  2R7X A;  3HOT A;  5CKT A;  4RLQ A;  2WY8 Q;  3BLY A;  4RM3 A;  3A1Y A;  3HUG B;  2PJR B;  2LC2 A;  2ZSH B;  3BG6 A;  4XKV A;  4PFO A;  2WAQ A;  1MNE A;  2M0M A;  2Y0S A;  2XAU A;  2IXS A;  5TGT A;  3OYH A;  4HEA 2;  3KX2 A;  3H5A A;  4E7J A;  1G59 A;  1UEL B;  2E1M B;  4XLC A;  3UNG C;  3E1S A;  4XOR A;  3FBI B;  2HVS A;  4C2T A;  2M4K A;  2X6Y A;  3CES A;  5FRM A;  3OS2 A;  4F52 A;  4IZZ A;  2WAD A;  4E7I A;  4IKF A;  2Q2E B;  4NC7 A;  2F5V A;  4CH7 A;  4LIV A;  2HNH A;  3A4C A;  3K10 A;  1S9H A;  2MD0 A;  2CW8 A;  2DT6 A;  2LY1 A;  2VIX A;  1N78 A;  3DTK A;  2VL8 A;  4XL9 A;  2Q1Z B;  2DXI A;  4LIT A;  4PSW A;  1LKX A;  3K4L A;  3K4C A;  4J01 A;  2GOX B;  3E0J B;  2IGK A;  3L2V A;  4Y3O A;  2Z1D A;  3MKY B;  3HXL A;  4BQN A;  1Z3X A;  2M7B A;  3DTI A;  3CF2 A;  2KMU A;  4HPQ A;  2ELJ A;  1OR7 C;  3HPG A;  3PNT A;  1D0Y A;  3QYE A;  4HST A;  4XOT A;  3OS1 A;  2LH9 A;  3DKX A;  4F93 B;  4P1W A;  2LYC A;  3L2U A;  3NWS A;  4RMN A;  1V5G A;  4F3Q A;  2WB1 A;  3OYE A;  2IGM A;  3RPU D;  2JA2 A;  2CFO A;  3OOU A;  4EAT A;  2X85 A;  4B48 A;  1Z21 A;  3OYI A;  3SEQ A;  4BEH B;  2ZXI A;  4U87 A;  4CCN A;  3I3L A;  4E7S A;  1DGR M;  4F91 B;  1KON A;  1EA3 A;  3OYJ A;  1Z7L A;  3LSI A;  4BE0 A;  3OL3 A;  3CZ6 A;  4PFP A;  3ZXS A;  2E60 A;  2IGN A;  2LRD A;  2XF5 A;  3KYL A;  4XR6 A;  1WJD A;  2JVH A;  4ZDO A;  2OUM A;  1WJC A;  3OYF A;  4IX7 A;  3OMY A;  2ZFU A;  2F6C A;  2CV2 A;  3HPH A;  2Z2S B;  1N77 A;  2DJI A;  4LIU A;  3LL7 A;  1FMW A;  4XN3 A;  3H35 A;  1AA7 A;  2VQG A;  4XKC A;  1MND A;  3OYK A;  3AL0 C;  3PNV A;  4XON A;  4YEL A;  3A2K A;  4CCK A;  4F55 A;  2IGO A;  2L9N A;  2V7F A;  3D5S C;  2BVM A;  1BOB A;  3OIP A;  1Z3Y A;  1WJF A;  2XF7 A;  4B43 A;  1JI8 A;  4PK4 A;  5KCM A;  2MC4 A;  3PL8 A;  2WAE A;  2R7V A;  1N75 A;  2CW7 A;  1LDK B;  2BW3 B;  1GLN A;  4XM3 A;  2LBF A;  4NUB A;  2L5Q A;  4BUP A;  4AU7 A;  1QHH D;  3EUH C;  2JSP A;  2HVR A;  2V9K A;  2VKD A;  2X6W A;  1MMA A;  4QPO A;  3FDY A;  2HVQ A;  3D5R C;  1YX5 A;  2CV0 A;  4DJA A;  3PJR A;  4N4N B;  1W36 C;  4BGD A;  4CSW A;  2HPI A;  2RQQ A;  3W2W A;  2R7O A;  2LY2 A;  3W2V A;  1YX3 A;  1SAU A;  4ZDP A;  4ZTF A;  3K4M A;  1VZ0 A;  4ZYA A;  4PSX A;  4DGW B;  4FET A;  2ZXH A;  2PJR A;  2V1N A;  5CQE A;  4ZDL A;  2UWM A;  3OYG A;  1D1C A;  1FMV A;  2KRH A;  1J09 A;  4CCL A;  2VAS A;  2XDV A;  4F92 B;  3BG7 A;  1QHG A;  4HNU A;  3V42 A;  2E5Z A;  4BS9 A;  2DCE A;  4YEJ A;  3J7A Y;  4CA0 A;  1SFK A;  1T95 A;  2IS6 A;  4ITV A;  3CMM A;  5HNF A;  3OYA A;  3FBN B;  4MLO A;  4BAC A;  3DKY A;  5HVQ C;  2E1M C;  2V6E A;  4BL0 B;  5JHF A;  1X4P A;  4DIQ A;  3M8J A;  2R7T A;  4IQ4 A;  3S8P A;  2X51 A;  3RCO A;  1DP3 A;  1DGW Y;  2XC7 A;  3K70 C;  1D0Z A;  4II3 A;  3NWT A;  1BR4 A;  4XOP A;  3IAM 2;  1LFP A;  2F4I A;  3CP2 A;  4OWR B;  2LG4 A;  4XQF A;  4XLE A;  4XMY A;  3H0D A;  2UV1 A;  1QU3 A;  1WJ5 A;  2W82 A;  1W36 D;  3KEY A;  2CS3 A;  2X6X A;  1IRX A;  4HNT A;  3VWB A;  3H9J A;  3LSM A;  4E7L A;  5HLT A;  1D1A A;  1WJA A;  3ZGK A;  4XKB A;  3OYN A;  2OV7 A;  4AYB A;  3ONQ A;  3S3N A;  3ZRG A;  2W7N A;  1X4O A;  2QKL B;  4XLF A;  4KIT B;  2IS4 A;  3BCB A;  1ERD A;  4ZC3 A;  3U21 A;  3FKJ A;  4B3X A;  3OYL A;  3K4K A;  4BEH A;  3PFY A;  4JOM A;  2AQE A;  2BOL A;  3PUB A;  4DBR A;  1LVK A;  2KDO A;  3HKZ A;  2VJI A;  3OR2 C;  2IS2 A;  2VPL A;  1MMD A;  2X1D A;  3CJQ B;  1NG6 A;  2A5W A;  4E7Z A;  4HG2 A;  2CUJ A;  2K9M A;  2RNG A;  2HQA A;  2R4G A;  3AFH A;  4KIS A;  3H5R A;  4OAZ A;  4BE1 A;  2KP6 A;  3N05 A;  3HOS A;  3K70 D;  1E0E A;  3VDX A;  3OYC A;  3DTE A;  4E4H A;  1X1D A;  2OC6 A;  3AKZ A;  4BXF A;  1TZL A;  3MKW B;  3H9G A;  4JQF A;  1Y56 A;  4BE2 A;  3M1C A;  2Z16 A;  2K3P A;  2X1E A;  3OY9 A;  4NC8 A;  2HPM A;  2CV1 A;  2W1O A;  2HDW A;  3MD2 A;  2CH0 A;  3LFU A;  3K4J A;  4YRV A;  2CUZ A;  2QKM B;  4D1Q A;  1PJR A;  2KQR A;  2GOM A;  2PMZ A;  4BJ5 C;  2KPM A;  2BW3 A;  3IUO A;  4E7H A;  4BJ6 C;  2VXD A;  1UG0 A;  3QOD A;  3ZQQ A;  1WFX A;  3BCA A;  4FAS D;  2M4G A;  1BR1 A;  1MMG A;  2K9L A;  2MFZ A;  1D1B A;  3S93 A;  2XSJ C;  3VYS B;  3OYM A;  1X1A A;  3OL4 A;  3I9V 2;  2VKH A;  4PJJ A;  3DPL C;  2M7A A;  2VB6 A;  3K6G A;  4C9Y A;  3HG9 A;  4CCJ A;  3RQ4 A;  3EPZ A;  2ZSI B;  3QYF A;  4DOZ A;  5LD2 C;  3W2A A;  3HC7 A;  2V26 A;  1YE9 A;  2KRC A;  5FRO A;  3TMO A;  3H9Q A;  4PJM A;  3F9K A;  5LFA A;  3PSI A;  2E5N A;  1ZEL A;  3CJR B;  2MYS A;  3MMY B;  3H5N A;  2P0W A;  4KT6 A;  3TL4 X;  3SEZ A;  4B44 A;  3S3M A;  3VSK A;  3DU5 A;  1PYV A;  4PUS A;  3PNY A;  4PJN A;  4P5O A;  2VJ5 A;  2KL4 A;  4G6T B;  2IS1 A;  5CQG A;  3ZCO A;  1NG7 A;  2X1C A;  3VYT B;  4ZTJ A;  3QOE A;  1R6R A;  4XKW A;  2K5C A;  3VYR B;  4II2 A;  3DPT A;  4N4O B;  4J00 A;  3TBI A;  4CUG A;  2KHM A;  2VXZ A;  2W00 A;  4C30 A;  4U7B A;  3UR3 C;  1D0X A;  1U0J A;  2AQF A;  3MKZ A;  4BQQ A;  2RRE A;  5KHD A;  1K6Y A;  4RLF A;  4X0G A;  3DLA A;  3CP8 A;  3EUK L;  4AVZ A;  2VLA A;  3G2B A;  3D5L A;  4BDY A;  3OYD A;  2L7K A;  2CMP A;  3QYB A;  3ZR8 X;  1MW7 A;  4XN0 A;  4BJT A;  4CCO A;  3HL2 A;  3LSG A;  1X1C A;  2WAF A;  3OS0 A;  3K4N A;  4C2U A;  3L2R A;  3EUA A;  3VYU B;  3LSH A;  2VQC A;  3DQV C;  4IQJ A;  3RSN A;  2A6T A;  2VJJ A;  1TT0 A;  3SDB A;  1OLT A;  3LSK A;  1G8X A;  1P9Q C;  4Y4R A;  4H4K C;  3BC8 A;  2R7W A;  2KZV A;  2WBM A;  2DOA A;  4ZJZ A;  4GRI A;  3OYB A;  2JUG A;  2VJ4 A;  4D9J A;  3PSF A;  3L2Q A;  2DT7 B;  1UAA A;  2M3A A;  3RTR A;  3DPU A;  4Y33 A;  3IAS 2;  3C2H A;  4CZC A;  5KNL A;  3LMM A;  3OR1 C;  2NOJ B;  3S32 A;  2R7S A;  3DEE A;  4BU2 A;  4XNF A;  1Y6I A;  3IP4 B;  1MMN A;  2W4S A;  2R7R A;  1BR2 A;  1WJE A;  3AL0 B;  4E7K A;  2WY7 Q;  2L9S A;  1WJB A;  3DWL E;  2VQH A;  1HA8 A;  2XF6 A;  4NNJ A;  2JVG A;  4BQO A;  4NQW B;  1X19 A;  4XLH A;  3DU6 A;  2FUG 2;  1V5F A;  3C2G A;  4RM2 A;  3OWT A;  3FHN A;  4PJL A;  3SZG A;  3OIQ A;  5CPR B;  4LG3 A;  4R79 A;  2KLO A;  3L2W A;  1DQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...