2E5NA

Solution structure of the ell_n2 domain of target of rna polymerase ii elongation factor ell2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
GSSGSSGTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II elongation factor ELL2
publication title Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2
rcsb
source organism Homo sapiens
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e5nA00
2E5NA 2DOAA
chains in the Genus database with same CATH superfamily
4ZZLA 1W5CC 3A1YA 4ZYAA 2VT2A 2EV5A 2H6CA 3V8LA 4EM0B 1A31A 1RETA 3BPVA 5EZHA 1YIJI 4ON0A 4ENNA 5HS7A 1HDPA 4LB5A 1S72I 3HXLA 3TGNA 3FHZA 3VYRB 2WAEA 5DYMA 3RCOA 5F0HA 3KE2A 1TTYA 3W3CA 1S9HA 4UV8A 1YX3A 1QNTA 3UNGC 3GYHX 2ZSHB 4FE7A 1D0ZA 2XGXA 1YJWI 1BC7C 3GXOA 4BHBA 2OC6A 2V9VA 3KCCA 4WK8F 1SFEA 4KFCA 3FXKA 1MH3A 1F1ZA 1X19A 4HNVA 3OL3A 1EV7A 3IC7A 3NAUA 1I6XA 2FNAA 5AIPA 2CQQA 3C18A 4Q48A 3JTHA 2E2HJ 3CC4I 1BR2A 2ZMEB 2CV2A 2W25A 3ML6A 2X9DA 3HKZN 1ONVA 1Z7UA 1OISA 2CW8A 5FKOA 3FMRA 4HZFA 1UHSA 2AS5F 1J7KA 2Z9OA 3ZQIA 5GAEJ 3FKJA 4PK4A 4LGWA 3EUHC 4PJLA 4FHTA 1MMDA 3IH3A 1SANA 3HOXJ 5KK1A 2M87A 1A5JA 2BV6A 2BBYA 3DPLC 1IO2A 1BBYA 3F8FA 3JRAA 5HDKA 4IEJA 1S29A 2XF6A 1MBHA 2KZGA 3KYDB 3MD2A 1X3WB 5E3NA 2W82A 2EK5A 1LEAA 4G7HF 1OMIA 3IWZA 1GLNA 2CUEA 5DDGA 1VTNC 2P7VB 1LDJA 2LDUA 1VI0A 2DMQA 2A5YB 1D5YA 1V5EA 4HQMA 4QLCU 1K83J 2V6EA 2VKDA 3PSIA 1G3YA 3TP0A 2A3SA 1GV5A 4ENMA 5EJCA 4RBOA 3S17J 3H5RA 3BG5A 3RKWA 2R7ZJ 4M6XA 4DIQA 3B6CA 4YRVA 3ZGKA 1WJDA 3V8KA 3RQ4A 4M9SA 2NNNA 3HOSA 2WWYA 4L5JA 4YIIA 1I1GA 5FFXA 1LDDA 2RV8A 2K9NA 4NC7A 4OMZA 3ECHA 4IVNA 3ABUA 3LSPA 2ZO4A 1IN6A 3OYMA 3HUGA 5K7ZA 2K9MA 1JE8A 1BIBA 4E7IA 4NHJA 3PO2J 4HF0A 4BQQA 3BG9A 4HW0A 4EV0A 3JRDA 1O3RA 1RKTA 4D5CA 4CYCB 3JTGA 2IW5A 3SQNA 4F91B 5DD4A 1E0EA 3CUOA 3HKZA 5CVRA 1G8XA 1WI3A 4B1RA 4Z6YA 1V5FA 3OYLA 4B3XA 3H9QA 4XICA 2HOAA 4B4CA 2DOAA 2VI6A 2M2EA 2OQGA 1UMQA 3OY9A 3VSKA 3QYBA 2OZUA 1F43A 1AKHB 2EZIA 2XIGA 5F1JA 2QQAA 4BKXA 2O7OA 1JJ8C 2WY8Q 1A6IA 1IXRC 2X4HA 1QZZA 3OSFA 1BM9A 4NNJA 1PDNC 3ZCOA 2HTJA 3P9IA 2ZBKA 1ZR4A 1UZCA 3CCJI 4UVCA 4MFEA 3EETA 4Y3OA 1BA5A 3JRIA 2V9PA 3BR5A 2J5PA 4ESBA 2VPRA 3TOBA 5BQTA 1HBXG 2YS9A 5EG0B 1T8IA 3TMOA 2HZTA 4JBAA 1OLTA 3H5AA 3M8FA 4PCQA 1JTYA 2Q8KA 2JSCA 4QTRA 2EILH 1K7AA 3SHFA 4II2A 1U78A 1QZEA 4RGXA 1B72A 4ETSA 4F7ZA 4DZJA 1ERDA 3WTVC 2NYXA 1LVKA 1VQMI 4IHYA 3L7WA 3WE2A 2CMPA 3QPTA 3JW4A 2LOOA 2EFNA 3VYTB 4BJTA 2YU3A 4M73A 1A35A 4PJ0C 2M1BA 1XMKA 1RUNA 2A6HF 2LLKA 2UUZA 1VQ4I 4EEFG 5JR3A 1NTCA 2BGCA 4IF4A 1QQIA 3QP5A 2XB5A 1OYYA 3RZDJ 1R5HA 1ZGAA 2DN0A 4X0GA 4BQNA 3HHGA 4XN0A 3SFZA 1P9QC 1TQPA 1EH8A 2VBWA 4BE0A 4NC8A 2IA0A 1EH7A 3VDXA 2L54A 2CRGA 2VC0A 1HKQA 2CQNA 1X3UA 2KQRA 1U8RA 3ASOH 1SEUA 1C0WA 2ELKA 2FA5A 1TBXA 4A3MJ 3WTTC 1QPMA 3BJOA 1W36D 1JKPC 1YW9A 2LREA 2AXTC 4BE1A 1TWHJ 2EA4A 5GPCA 4WWCA 1ORKA 2PEXA 3CC2I 3CP8A 3TO7A 3FXLA 3OS2A 5CQGA 1DP3A 4AIDA 3NWSA 3OYCA 3PQKA 4PFOA 1IDZA 1LB2A 1FEXA 4BBRJ 5K1YA 3QP6A 5KVRA 1FYKA 3TOAA 3JRGA 5D4SA 1BI2A 1OFCX 3KZIC 3FXJA 3ABTA 1YHQI 4HV6A 1I5ZA 1ZTRA 2JVGA 3S93A 5GP9A 2YR2A 1VFCA 3AG1H 3K6GA 3HJEA 2UXNA 3K4LA 3V7CA 2OJED 2F5EA 2HOSA 4CZCA 4K2EA 2VQHA 5LEJA 4A3JJ 4HLXA 4XN3A 5CVIA 3BJAA 4IKFA 1Y0UA 1K4SA 2JTVA 2JPCA 4KA4A 4LFUA 5H6QA 3LQQA 4PSXA 5E20A 3JSOA 2R7FA 4FISA 4D5FA 2R7DA 2K9QA 4JOMA 3LSRA 3ZQQA 3ULQB 4UNOA 2A5WA 2H09A 2STWA 5DEQA 1H88C 1USSA 4L5IA 2BW3B 5H6RA 1FZPB 2BVMA 2VQLA 4C2MJ 3CCVI 4IXAA 2HQAA 4HEA2 4LLLA 2EFPA 2L4MA 2H94A 3I5UA 1O3QA 4NUBA 5C3EJ 1G2HA 5FB2A 2HKXA 2OCEA 2L0KA 1NK3P 3CCSI 2E36A 2P0WA 3EUAA 5LEKA 1S7OA 2Z3YA 5GTIC 2W57A 3GEZA 4NQWA 1X1CA 5F64A 1TT0A 2KJCA 1TWFJ 2FBHA 5D8KB 1SAXA 1Z05A 3IH2A 5L3DA 1PYVA 4RB1A 1JGGA 2DFHA 4I7HA 3T8TA 3OIQA 1MJ9A 2IGOA 1IAWA 5EZGA 1IRFA 4BDZA 3S3OA 2CUFA 3L9FA 1AHDP 4CYDA 3QYFA 1SVLA 1FOWA 4CO8A 4KDPA 3MMYB 4CCNA 5FRNA 4D1QA 2RC4A 3H36A 1VQLI 3F9KA 4Y7NJ 3MZYA 1MNDA 5TJJA 1SD5A 2HVQA 2LFBA 2EH3A 4G6QA 4RS8A 3PUFA 3SDBA 3CQZJ 3WU2C 1O57A 2GXAA 4MQVA 2PJPA 1FT9A 1VQNI 3H35A 3ZXSA 2L5QA 2QVOA 2ELHA 2FQ4A 3F8CA 3I53A 1DU6A 2RKHA 1X1AA 1S6LA 3EDPA 3A4CA 4CZZA 2LK2A 2I5UA 2CW0F 3LL7A 1UCRA 1G3TA 5IYCJ 3H92A 1ZQ3P 4HYEA 4KUMA 1SFOJ 1LNWA 1X4PA 5HVQC 3F23A 3K4BA 4FE4A 2V9KA 2DT5A 2H6BA 4XORA 2Q1ZB 3ZMVA 1TLHB 2CQXA 2QLZA 4I09A 5HLIA 3HM5A 4LB6B 3V42A 3BT9A 5LLQA 4U7BA 3A01A 2H1LA 3CMEI 2R7XA 1Z21A 2CSOA 1TWCJ 1D0YA 2E1OA 4KT6A 1H0MA 4QWQA 4UUVA 3DP7A 5AONA 4A5NA 3ABMH 3GTJJ 1HSTA 2IPQX 2Y69H 1OYWA 2KPMA 2JZYA 2HPMA 3REOA 1LPQA 4PSWA 1ZRCA 2IGMA 3S2WA 3KETA 4C2UA 5CVJA 3T5XA 2MG4A 1PUEE 2XSJC 4HSRA 3I64A 4FETA 3BR6A 3KEYA 3GLLA 4MQ9F 5J6XA 2P81A 3CLOA 1K78B 1MSFC 4GRIA 5EGOB 1MKMA 1S8NA 2YX4A 2DYRH 4UVBA 2IGNA 4L0YB 4XKBA 3KP5A 2ZMEA 1WRJA 2ECCA 4M72A 2M7BA 5DS9A 2QGUA 4D9JA 1H9TA 4CA0A 3BZCA 3OR2C 2KZVA 2WV0A 2DLLA 3O3KA 4HQEA 2DXIA 5F04A 2R7WA 2WBMA 1R58A 1TWGJ 5GTHC 4A3FJ 2RVCA 1R5GA 3ZOBA 2BVLA 1ZREA 3QRFF 2F5DA 5E79C 1J2XA 1T95A 4Y13A 5FKMA 1YITI 1BR4A 2EV0A 4AVZA 1R5ID 1EF4A 1H9GA 4LITA 3SXYA 3N4MA 4A2UA 3SYTA 1W36C 2VXZA 2NS7A 4WXCA 4IHXA 2BEOA 2OTLI 5E1ZB 2YU9J 1M1EB 4P5OA 1A6QA 3G6EI 2FBKA 3K69A 3TW7A 1B8IB 3S3NA 2XAQA 4NBQA 4B09A 2XSDC 2W00A 3CO7C 4M3FA 4UB8C 2A6EF 3BROA 5IT9Z 4BS9A 2L9SA 2LY9A 5D6FA 4A0XA 3EUHA 1XPXA 1N25A 2R7UA 1GV2A 3ERMA 1BL0A 1TQMA 1QO0D 4A6EA 4OIOF 3MQ0A 2ELJA 2LR8A 3S14J 2CV1A 2B7EA 3CCUI 3L09A 1LE8B 3HSRA 4AC0A 3L2RA 3ONQA 3GTGJ 5DD8A 3BDDA 3OSGA 4G8XA 2K27A 2IS2A 4J01A 1JGSA 2GBYA 2VJIA 3PL8A 4CCMA 4FTHA 1WFXA 4CYCA 2CO5A 3FXOA 1RR8C 1UFMA 2K9LA 5IYBJ 3ERED 3HIFA 1K79A 2HOTA 3DKWA 3OV8A 2GIZA 1YJ9I 4KITB 3Q5FA 1BW6A 3L2UA 3VOEA 1KU7A 1TW3A 5HDGA 2JT1A 4UY8I 1WGXA 4CSWA 1P2FA 1Q1VA 1AKHA 1WJAA 2MABA 4M3BA 3ZR8X 1VQOI 3GFLA 2ACJA 3DBRB 2K5CA 1Q1HA 2ZNYA 4RM2A 2X6OA 4KN4X 3A2KA 2GLOA 1U9NA 4A6DA 3WTYC 1UELB 4M3EA 2EWNA 1UG2A 2HZDA 2XPVA 4IQJA 3MEXA 2VJ5A 2KIMA 4BXFA 1Y1WJ 1KA8A 5EG0A 3OOUA 4ZJZA 5HS9A 3C2GA 1Y0NA 1D1AA 4G6DA 1FC3A 3B02A 3LA3A 3C2HA 4RAGA 1E3OC 1LVAA 5L3FA 2OA4A 1X2NA 1IN5A 4G12A 2RAEA 1O3SA 5E8IA 3DLAA 2X6YA 5LGNA 1G4DA 5J1RA 1FSEA 1EH6A 2LC2A 4XLAA 4MO7A 2A07F 4Y15A 4HF1A 1XS9A 4MLOA 2DQLA 3DKYA 4FCYA 1D0XA 4HNTA 1MNEA 1LJ9A 1K61A 1FYLA 5FD5A 1W7PB 1MH4A 3BG6A 1OCZH 5FO5A 4E7LA 3LSKA 3Q3SA 3DF8A 3F6OA 3S1QJ 1TNSA 2KRFA 4LG0B 2GIVA 2EB7A 4RGSA 1SVMA 4LLGF 4BY1J 4BJ6C 1V54H 5HOOA 2W84A 1MBEA 1BOAA 2L2OA 1FTTA 1IN8A 4FX0A 2CJJA 1J9IA 1I3AA 2F5FA 3JREA 4W1UA 1QU3A 4H4KC 2WY7Q 4X6AJ 2FNPA 1SFUA 1Z91A 4MTDA 1FP1D 2GWRA 4DYQA 1W5SA 1MMNA 3BY6A 2VJ4A 2VKVA 4L5EA 4L9TA 5M3FJ 1T08B 4RB2C 3NWTA 1IN7A 3P7NA 2Y30A 2BZTA 2MBFA 2VB6A 5F6FA 3W6JB 3A03A 3W6KB 2LF8A 2HI3A 3U1KA 4KMFA 2R7QA 4KT5C 4KISA 3BR1A 2ECBA 4DJAA 2FMYA 2ZMEC 1FOYA 3GF2A 2M8GX 4W97A 1XD7A 3L2QA 1ZG1A 4AYBA 2GQQA 3S1MJ 2W1OA 1FLIA 2M4GA 3BQYA 2LVSA 4JX4A 5LHIA 3DPTA 5CJ9A 1T2KA 1SMYF 4CICA 3EUKL 2OF7A 4IHSA 3NQOA 2RNJA 3CCMI 4UXNA 2M9HA 3CMYA 2K86A 2L01A 1X2MA 2XKOA 2XV4S 4II3A 4PJMA 4E7ZA 2DW4A 2BW3A 3BR3A 1ULYA 3HHHA 5ICGA 3CC7I 1HXDA 3I0TA 2QBYB 4CCJA 2XUBA 4PGGA 3OS1A 3HSEA 1BI3A 2OAZA 3HPHA 1J75A 1FMWA 1QZYA 1XN7A 4A3KJ 4YFXF 1YW8A 3OS0A 3LA2A 2DA2A 2RN7A 5DV5A 1YIOA 4E7SA 5HLHA 2VKEA 1JKQC 2NS0A 2OCCH 4RAYA 2GM4A 4OINF 1TQIA 1ZH5A 2WV1A 2RREA 2P4WA 4PUSA 3OMYA 3M07A 1GHCA 1X1DA 3SEZA 3KYCB 3IV5A 1ETYA 1GT0C 4E4HA 1R1TA 2JUGA 5J40A 3H3ZA 5KAFC 4EGYA 3DCFA 3FIWA 1FBQA 3UR3C 5K5OA 3BG3A 5HLGA 1ENHA 4XLEA 2YUSA 1WKMA 4WF2A 3F8MA 2K7LA 3H1CA 3V7RA 3L2CA 2Q2EB 3FWEA 3I54A 2XC7A 4KMUX 5M5YJ 4XR6A 4XIDA 4IRGA 1J09A 5D5VB 2V4JC 3DTIA 1IRZA 1ZLJA 1KQ9A 4Y4RA 4CDGA 5D6EA 3PFYA 3FK7A 2LG4A 1I3QJ 2R3SA 3HOTA 1NHAA 5E18F 1KYWA 1VF9A 2CGPA 3R61A 2WC2A 4UV9A 2O9LA 2DQRA 2NVTJ 4UB6C 2IJLA 3GWZA 3GZ5A 3OYDA 4L18B 2BY3A 2X6WA 1Y8RB 4OAZA 1TWAJ 1MNMC 3FZVA 5TISC 1KONA 2M0MA 2XAJA 1IC8A 3KZZA 4O3MA 1N78A 3DBHB 2E7XA 2LSOA 2LYCA 1GXPA 3KFWX 3WTWC 4XMYA 3ZQLA 2HNHA 2VBYA 3RTRA 2GXBA 4MIMA 1Z67A 4XL9A 2JA2A 5E3OA 3S16J 4YEJA 3K4KA 2O0YA 3CMMA 2QKLB 3V4GA 2VODA 2CW7A 2LP0A 4AWXB 4B8XA 1ZR2A 5EEAA 2E1MB 3I56I 1RUOA 3VYSB 2N8GA 5LFAA 2HVRA 5LRRA 1SVOA 1U6GA 3BOQA 3J80K 4G6TB 4N0BA 3I4MJ 2Y2ZA 3SZPA 1LKXA 4BNCA 3A0HC 2RQPA 1ZGJA 1R00A 2CUJA 3DU5A 2IA1A 3EYYA 1OCRH 3Q9VA 2HXIA 1MJAA 1G3SA 3M8EA 3E5XA 1LFPA 3P9KA 3VWBA 1RNLA 2O8XA 3H9JA 1I39A 1K78A 1Y1VJ 5EGOA 1P4AA 2WB1A 4EVIA 4N9HA 5IOYA 3QOPA 1PP7U 2DFFA 5LBQA 4LOCA 1AU7A 5M5XJ 1WZ2A 4BXXJ 3E6MA 1MGTA 4RLFA 1HKTA 3J81K 3ZRGA 3MN2A 3V7SA 2Y0MA 3BC8A 2LNBA 2XB0X 3M4OJ 4EGZA 1EJ9A 2OD5A 3GCMA 3TP3A 2DA1A 3OOPA 1MBKA 3BTCA 5K5RA 2KKOA 1HC8A 2H1KA 3VEPA 5CQEA 3WHBA 3H5NA 2X85A 3VODA 2HGCA 4PGHA 1ZRFA 3E1SA 1B9NA 3QQAA 1YFHA 2BY1A 3CUQB 1APLC 2VPLA 3AG4H 3WGHA 1O7LA 4HRIA 1DU0A 2G9WA 2BHYA 1R36A 1XB4A 2FXAA 2EZLA 2TCTA 3D5LA 4OWRB 3S1RJ 2CYYA 3CF2A 1B8IA 5E3MA 2ZCWA 1BI1A 4A0ZA 4DYCA 2KDZA 4M3DA 4IJAA 2ZXJA 4I0AA 3FX3A 1GDTA 2F5VA 3DXJF 1L0OC 1ZARA 1UG0A 4DNCA 3ZMSA 1R4NB 1FTZA 2KJBA 1Z3XA 1QPIA 3JRFA 4MFDA 2TRTA 3O8HA 3F8BA 1LE8A 1GUUA 2KIFA 4JX5A 3X2QH 1DUXC 3HL2A 3JAMK 2DA5A 4U88A 3ZPLA 5CKTA 1KU9A 4IL6C 4F52A 2NS8A 2HQNA 4XQFA 2CV0A 1OCOH 5C44J 4RB3C 1FBSA 2A68F 3HBLA 5M5WJ 1XX5A 3ABLH 3E5UA 3KIOA 1LDKB 1FJLA 1GVDA 3KP2A 1XGSA 2A61A 1T56A 2VUMJ 1G6NA 2EFWA 1IRXA 5HLTA 3CF5F 1JI8A 4I6ZA 1A36A 3GBGA 3QAHA 1BC8C 4GYGA 4HF2A 2M3AA 1GXQA 2XGCA 2ZJRF 6PAXA 2YSRA 2XGEA 3IWFA 1IG7A 5JHFA 3IRQA 2ZJ2A 4DZPA 3RQIA 1N75A 2XAHA 3MCZA 5KHDA 2K85A 1V4RA 4R79A 4BBSJ 3TO9A 4NDLA 1IDYA 5IT3A 5FLMJ 1WSUA 2JQ7A 2NVYJ 1U5TC 2DOEA 2DMUA 2G0EA 1ZKGA 3KPHA 1B4AA 3GUDA 3GZNB 1R71A 2ZXWH 3KP3A 4ZDPA 1X4OA 3D5RC 5K5QA 5FLXK 2D45A 1TW2A 1V55H 3ZQGA 1HQCA 4ZTJA 1R9TJ 4BACA 4LIUA 3J7ZI 4OMYA 2HTSA 1F36A 2L9NA 4FQGA 5L3CA 1YS7A 4ZTFA 3TL4X 1MW7A 4OIPF 2E7WA 3JCUC 4IPAA 3WU1B 3HEFA 1POGA 2TDXA 1B9MA 1W7PD 5DUKA 3CCQI 2JUCA 1RI7A 1Y6IA 1IZ1A 2IT0A 1IXSB 2E5ZA 2Y75A 2BE5F 4ENKA 1W7PA 1ETXA 2DAOA 1Z9CA 2FRHA 2KLOA 1U5TB 2PJRB 1HA8A 1HW1A 1CGPA 2PMZA 2MD0A 3CCYA 2QZ8A 4LG0A 2MYSA 5J4VA 4U0YA 1PVEA 2BOLA 2R7VA 2DT6A 4A5MA 5L3GA 3HPGA 4DW6A 4F55A 1GVJA 1IJWC 1IF1A 2E19A 1XC5A 3GLXA 3CD6I 4CCKA 2FD5A 3HOWJ 3RYRA 3ZMDA 1PUFB 3DTKA 5EF6A 3R60A 1T38A 1B6AA 2UXXA 2WAQA 3DU6A 1LQ1A 2JN6A 2LKPA 1XDSA 3M8JA 5A2QK 4AU7A 1YX5A 2FSWA 5FJ8J 2K3FA 3IHUA 1T0FA 4XRSG 3K70C 4Q5SF 2LY1A 3QYEA 2R5YB 2XVCA 3CP2A 3TW6A 5CPRB 4F3QA 2CH0A 2V7FA 3KEOA 2O5RA 5J1YA 3K1PA 1B59A 1Y56A 4OOIA 1MSEC 2R4GA 1BI0A 3ZMUA 1BN5A 2DA4A 3LSIA 1B1BA 3RJPA 4M9XA 2PBIA 2E34A 5LGTA 3HOYJ 3LFKA 4GFBA 1P7JA 1FIAA 2ETHA 2KFDA 3LSJA 1OCCH 5J3LA 1Z7LA 3RDIA 1T39A 3AL0C 2BXYA 3G73A 3E5QA 1E2XA 2DA3A 4YG2F 3L2VA 1TC3C 2QBYA 3J7AY 4A3DJ 2RNGA 3LQRA 2E60A 3OL4A 1FNNA 4G7ZF 4ITVA 4GO1A 2ZKZA 4DBQA 4IOCF 4B44A 4ZYEA 3LA7A 2ZC2A 5BMZA 3G3ZA 4R1HA 2R7SA 3HTUA 2X51A 3TKYA 3S2HJ 5HODA 2P8TA 2CS3A 3FXRA 2AQEA 5LD2C 5C4XJ 2XAGA 3J7YJ 4I76A 3QPSA 3I55I 2GA1A 2NAZA 1FY7A 3FISA 4YIRX 3FXQA 3ZQCA 2V26A 3C3WA 1FX7A 1STZA 1XDUA 1T33A 5B1AH 1UJ8A 3GX4X 4C9YA 2D5VA 1W4MA 2VLAA 2XASA 4DOZA 5IP9J 4IRHA 4Z2YA 2K4BA 1AWCA 3AL0B 3GTKJ 4EJWA 2VT3A 2DTRA 4XLNF 2VKHA 4F93B 2ZXIA 1H8AC 2H8RA 4B47A 3ECOA 1W0UA 4FASD 2JPBA 1WVRA 1QVTA 2Q2EA 3IL2A 4MEXF 3R0JA 1JUPA 3CCEI 3RIRA 3QPHA 3O8GA 5FKNA 1VQ9I 3BWGA 1Z6TA 4XKVA 3WU0A 3BP8A 3UKGA 3DLLF 1J5YA 3KYLA 1OR7C 2CQKA 3RPQA 3LFUA 1EKEA 1YYVA 4PDKA 5JI6A 4XRSA 2OBPA 1F5TA 2V1UA 4A3GJ 4RM3A 1YG2A 2OV7A 5J47A 1ZGWA 3LAPA 5DCMB 4WXHA 3GZ6A 1P4XA 1ON1A 4I99C 3PO3J 2A69F 3I58A 1NG6A 4XOTA 3I59B 1HDDC 2DPDA 2MFZA 4LG3A 2L7FP 1T98A 4U7DA 1FMVA 1X58A 3WTUC 3MKYB 2LMDA 3GTOJ 2DDAA 2Y31A 3TO6A 1MBJA 1Z0XA 2QSHX 3DPUA 4QPQA 4JQFA 2LKXA 3BLYA 1L3LA 3QPLA 4KIGA 2EJRA 1E3HA 2OU2A 2MH9A 4J19A 2BY0A 3LOCA 2Z16A 3W2AA 2Y0SA 3PSFA 2L7KA 3BQZA 2E5NA 3ISPA 1FWZA 2F5CA 2D1VA 2FOKA 3EPZA 2V6CA 1P92A 3F6VA 3KP4A 2M7AA 4D0PA 3OYGA 2PMUA 1JHFA 3ROUA 2ZJQF 1TNTA 4BEHB 3KZYA 3G71I 5CVVA 1TZLA 1OPCA 1XSDA 1S7EA 2VE8A 4L9NA 3E7LA 1ON2A 2A05A 1U3EM 2H8WA 3MKZA 2MLGA 3IRRA 3CESA 1WHUA 2VBXA 1O7FA 3A0BC 3E6CC 2B0LA 2IEKA 2EZKA 4ASNA 4EJOA 3GVAA 5FKKA 1MJBA 2JA6J 3GW2A 4JP0A 2QQBA 2DT7B 2XPUA 4EJTA 2CG4A 3K1NA 5B1BH 5F0CA 4AYBN 4LLNA 2EFOA 3F3XA 2E2JJ 4Q47A 4PJNA 1K6YA 3U1DA 1JTXA 3CUQA 2L4AA 3D0SA 4PJJA 3V8JA 2IP2A 3ZQFA 3K10A 5K7HA 1R23A 1WJ5A 2JVHA 4BQAA 3R0AA 2VASA 3E3VA 4O6JA 4ZH4F 1YI2I 3G1OA 1SD6A 2PLYA 2ZFWA 1IUFA 2ZB9A 2QQ9A 2M4KA 2MC4A 3C2BA 4RMNA 3K1MA 4PZJA 1P6RA 1WJCA 1Z77A 3CJNA 1YS6A 3D1NI 3VB2A 3ZN1A 1QGPA 3CDIA 3EYIA 1R22A 5FGMA 1T0FC 2R93J 4XM3A 1V3FA 3HGGA 3PQJA 4YFKF 1D8JA 2DK5A 4S0HB 1JUSA 4BU2A 4ZZDA 2DFIA 2ESHA 3ZMTA 4E7HA 2CQ7A 2O8KA 3GFIA 1D8KA 4XRMA 1ETWA 2ZJPF 3HDDA 3KP6A 3MZHA 2HR3A 5FRMA 1KYZA 1UB9A 3MKWB 2X0LA 2W7NA 3FF5A 3TBIA 4IZZA 1VQ6I 2EPFA 2Y9YA 2O03A 1ETVA 2ID3A 3CO6C 3QODA 3C7JA 4DQ2A 3OYIA 2EINH 2DYSH 1YOVB 3GMEA 5C4JJ 1NH3A 3K4CA 4ZYDA 1SD4A 3A02A 1PP8F 3WODF 4C30A 2FOWA 2ME6A 4ZC3A 4M74A 5FLVA 3RKYA 1CF7B 2QCOA 2YPRA 4A69C 2OUMA 2CFXA 4P9FA 2E1CA 1JT0A 5JVTA 2KRHA 3JRCA 3PJRA 1Y39A 2WA0A 3AFHA 2F2EA 3H0DA 3DEWA 1BR1A 2L7MP 4MGRA 2EIJH 2XROA 5DM7F 1VNDA 3H3UA 2Z33A 2DPUA 4OU0A 5BPIA 3T1BA 2DODA 5LRSA 4XRFA 2P7CB 2EBIA 5ICEA 3HB9A 1YLFA 3DWLE 3JR9A 3COAC 4I02A 3K4NA 2IAIA 3TEDA 2IS1A 4A12A 2AHQA 3OYEA 1E17A 2GOMA 3BPXA 1KQ0A 1YRNB 1RESA 3T0YA 5ILSA 4I98B 3ABKH 5DCFA 2KT0A 3TQNA 3QU3A 3M3YJ 3I71A 1YE9A 3WTSC 2DMTA 5FKLA 1ODDA 4QPOA 2DMPA 1LEBA 4BAYA 4C2TA 3F72A 1OYIA 1KU3A 3O2PE 3TDZC 1MBGA 4I2OA 2Z2SB 1HF0A 3MKLA 2M30A 4XLCA 3AKZA 2EA2A 2OPTA 2M5WA 2Q0OA 3BR0A 1MDMB 1DP7P 2FEZA 4I01A 4G9YA 2NNYA 2RGVA 2PI0A 1WQ2A 3MWMA 3FDYA 2WTEA 3H0GJ 4KIFA 4CCLA 3PNYA 3L2WA 1JXSA 2FQ3A 3H3VK 3CTAA 2UV1A 3CDLA 3I9V2 2C6YA 1U5TA 4C3JJ 5ICCA 2PJRA 4IHTA 2HDWA 3W6VA 2VBZA 1FP2A 4S05A 2WB1N 2NXNB 3BJ6A 3M1EA 4EJUA 1W0TA 3M7GA 3HC7A 1XGOA 1X1BA 1DGRM 2COMA 3VFZA 5JFRA 3HSFA 5FROA 3WTXC 2HS5A 1ZLKA 2COBA 1DQUA 2E1MC 1TP4A 4RGUA 2NVXJ 5E17F 3OYNA 3CZ6A 2JMWA 2VN2A 4BXUA 2HDCA 2DTZA 1VQ5I 2DBBA 3HOZJ 1BOBA 4KIBA 4CHUA 5B3SH 3WHCA 4XOPA 1PUFA 1W5TA 3PNVA 2VIXA 3MZ8A 1MZBA 2R0QC 1K4TA 1H89C 2O6GE 3ELKA 1XMXA 4BY7J 1F4KA 1WJBA 1ZK8A 5H20A 4ZYGA 4A3CJ 2KL4A 2MGQA 2KHMA 3TDUC 3DTEA 1U2WA 4UUSB 3T8RA 3HOUJ 3IH4A 4BHCA 5EEHA 2PQ8A 1D5VA 4Y52J 2GOXB 1MMSA 2MC3A 2R5YA 2DOFA 1HW5A 4A0YA 3CCLI 3B6AA 4HPQA 5EYRA 3WGGA 2MH2A 5DM6F 3J80Z 4KNYA 1RIOH 3JSPA 2QQ8A 3U2RA 5BNGA 2HEOA 2LRDA 4XLHA 2B9SA 2NOJB 5F1RA 5BS6A 4QSHA 1CQTA 5J4YA 3K4MA 2B63J 2W24A 4OAYA 4B3AA 1WJEA 5HNHA 2E35A 1P7IA 2FE3A 3DFGA 4V2FA 1JJ6C 3H9GA 1FPQA 3CUQC 1WCMJ 3BCAA 4KICA 2HFHA 4U0VA 1OCTC 3DEUA 2R5ZB 3K70D 3F0CA 1O3TA 2K3PA 1G3WA 2FBIA 2EIMH 2GZWA 2R7RA 4IO9F 5E3LA 3LAJA 1U8BA 3LSHA 2DCEA 2XGDA 4M3GA 3BCBA 4GCVA 2V1DA 4XLPF 3J81Z 2H27A 2FX0A 5ED4A 2K9SA 2XRNA 4XKCA 2A6TA 3P9CA 4ESJA 1D1BA 3K4JA 3OYFA 4QIWN 1IXCA 3LWFA 2VOOA 5D5XB 3PUBA 4HAMA 3BZKA 4XK4A 1MMAA 3DQVC 5LGUA 4OIQF 1J0RA 2JA7J 2DA7A 4V19K 5IP6A 1KZHA 3SZTA 4LK1F 1JUMA 1I27A 3FK6A 4HV5A 2CFOA 1UHWA 2WADA 4DYRA 4ZDOA 2Z1DA 3I3LA 2HYFA 3IUOA 1ETKA 2K40A 2VL8A 2XHKA 4N9IA 4E6KG 1FBUA 5IP7J 5EEGA 4EATA 1IV6A 1QHHD 5DTDA 2R7TA 3BZ6A 2HU9A 3JRHA 2LBFB 4ZYHA 4IX7A 4M9ZA 5D5WB 1SC7A 4RB0A 3KP7A 3HTSB 4NC6A 5B5EC 1WH5A 1YQAA 2M0CA 1QA6A 2EQRA 2JWTA 2HDDA 1OKRA 2IXSA 5B66C 4BL0B 2EV6A 2LH9A 3WTZA 4AIHA 1E3PA 4Q4ZF 2ID6A 4U87A 3ZP5A 2KRCA 1DGWY 1MMGA 4KN7X 4D7NA 2E2IJ 4A93J 1DDNA 1KU2A 1XGMA 3JAMZ 1IW7F 3HYIA 2BY2A 1UAAA 2P6TA 3SJMA 5DCMA 4AM3A 4D7MA 4N4NB 1XSVA 2X1EA 1KGSA 4P9UA 1PJRA 3OIOA 4M6YA 3BG7A 3I59A 2V79A 2HKOA 5LHGA 3P5JA 2DI3A 3ZMZA 2IGKA 5FFZA 2J5OA 4C3IJ 3U9GA 4EMSA 2PMZN 2FMLA 5CLSA 2ZFUA 2L9VA 2XDVA 4CUGA 2ZSIB 4MEYF 3C1DA 2IRFG 4JYKA 3R6SA 4A3LJ 2X48A 3S32A 4AVPA 1HW2A 2XRLA 1OR7A 4XNFA 4LMYA 3ZN0A 3L1PA 1WWXA 2QKMB 2X1DA 1BW5A 3E6DA 4O5VA 5JLWA 2JRMA 4RAFA 2JA8J 5JHUA 3HRTA 3Q0UA 3ZQ7A 4LJZF 1HSJA 4XKWA 4Y17A 2BXZA 2NVUB 4BEHA 2JSPA 1ZN2A 3MVPA 4HX7A 2KISA 1ZG5A 2D1HA 2CU7A 5GADJ 2DDBA 1IN4A 3HRUA 4XONA 2WAQN 5IOZA 5FLXZ 1LUJB 1HKSA 3LSTA 3VSLA 2HWVA 1WJFA 5H2FC 1RC9A 2P5VA 2AXLA 1FYMA 3IAS2 3OR1C 3Q0VA 1EA3A 1RKWA 3BTIA 3L00A 5E8GA 5J8FA 4FX4A 5M3MJ 5DUIA 3I4PA 2QF7A 4EJVA 3WG7H 2NVQJ 1OQYA 4HLYA 2IS6A 2LD5A 3RKXA 4HDUA 4NB5A 1VZ0A 3WGIA 3PM1A 1XMAA 4EM1A 2KMUA 4RAZA 4XLFA 9ANTA 4A3BJ 2G7HA 2EFQA 4UVAA 2ICWG 2RQQA 2VC1A 2Z5UA 4P55A 4WCGA 5J1UA 1USTA 2L7ZA 2MW8A 3G1MA 4AUXA 3GTQJ 2ME0A 3IAM2 1J59A 4E7JA 2G7UA 5IPAA 3GTMJ 2V1NA 4HNUA 3GTLJ 4BJ5C 1QVUA 1D3YA 2I10A 2BYVE 2V1XA 1VQ7I 2JK3A 4E70A 4JX6A 3K9TA 1XCBA 5FD6A 3FXUA 2STTA 3RYPA 4M6VA 1MD0A 2LY2A 5D8LB 3FM5A 4HBLA 2QEXI 2QYOA 3KLNA 2OTJI 2HQRA 1R7JA 4YELA 4XSXF 1REPC 4V2GA 5A2QZ 3HZJA 1MIJA 1QRYA 1FOXA 1SFXA 2UWMA 4EM2A 2FUG2 3OIPA 5CYVA 2CUZA 4HOBA 4RGRA 4WX9A 2O3FA 1RRJA 4KYWA 2MA3A 2HYJA 5GAGJ 4B43A 1F9NA 2NRAC 1CF7A 3W2WA 3IP4B 2HOEA 2ISYA 3JRBA 3VPRA 3HGYA 5E1WA 4DGWB 1FOKA 4AIKA 3E0JB 3ESWB 2DFEA 1BIAA 2FF4A 1DPRA 3ASNH 3R4KA 3HUGB 4U0WA 5HNFA 1Z1DA 2NOGA 1MBFA 1IV8A 4LK0F 2ZNZA 2XF5A 1K6OA 4L9JA 2WAFA 2JJ7A 3VYUB 4A3EJ 2DK8A 3N97A 3S8PA 3WE3A 1BJAA 5BOXA 3Q0WA 4LD5A 4HSTA 2BHZA 3CJRB 3I4NJ 3EQLF 1U9OA 5D4RA 1YRNA 3CLQA 4P96A 2KDOA 2P6SA 3FM3A 2FJ1A 2W85A 2PG4A 1R49A 3K2ZA 4CCOA 1O4XA 4R8HA 1SMTA 1SD7A 2DJNA 2EIKH 4Y33A 4BDYA 4BQOA 5IYDJ 3CDHA 1ZAOA 4AD9A 3RZOJ 4HDVA 4BE2A 5KCMA 4KJZA 2IVMA 1MDMA 2JA5J 4TV7A 2XF7A 2HXOA 3NARA 3G4SI 3QOEA 3BTLA 1SFKA 1W1WE 4N4OB 3HRMA 2Y0SN 2K02A 1UHMA 3BTJA 1SAUA 4G94A 5AIQA 5ICFA 2QUFA 1P4WA 2FU4A 2HQ5A 5K7FA 3KLOA 4A3IJ 1YO5C 2Y48A 2UZKA 3BR2A 4UHTA 3OYJA 3SEQA 4G7OF 1TL8A 3GO5A 1R6RA 1IGNA 4WXDA 4XBFA 1JKOC 1DPUA 5ERIA 1X1PA 1B72B 1QHGA 1S5LC 2CWEA 4L0ZB 2GAUA 1ETOA 2LF7A 1R1UA 1JHHA 2R7OA 3GFMA 4C3HJ 2ISZA 1XGNA 4YFNF 3F8NA 4CGZA 3S2DJ 4IOAF 5L3EA 4CXFA 3GTPJ 3PIOF 4IRIA 1QBJA 4MHGA 1VQ8I 5F0FA 1ZRDA 4J00A 5CVUA 2GXGA 3K0LA 3LSMA 1WI9A 1XG1A 2L02A 2W48A 1RR7A 5D5UB 2DU9A 5E1XA 1LFBA 2L9RA 4ENJA 2MD5A 3AG3H 2I8DA 3FKIJ 1ZYRF 2Y9ZA 3K7AJ 3PNTA 3IKTA 1I50J 1N77A 4UUSA 3CJTB 2VONA 3FMQA 1RZ4A 3DKXA 3S15J 1A04A 2DO7A 2F4OB 3MAJA 1T6SA 4ABZA 4GGGA 2OZ6A 1RPWA 3B73A 5TRDA 2F4MB 1OJLA 4RDUA 4RA2A 5IT9K 5ILUA 1XCVA 5F27A 3FHNA 4BGDA 1I1SA 3J7AO 2X1CA 3ZQHA 2EZHA 1NK2P 1R1VA 3OYKA 5L3BA 4MNUA 4JK1X 3CMAI 2ADUA 2P5KA 2RDPA 3DV8A 3S1NJ 3WG9A 4BUPA 5ILVA 4AIJA 3N05A 2LKSA 4GXOA 4BYYA 1S7AA 3OYBA 2R92J 2MLKA 2R5ZA 2M45A 2IA2A 2DJIA 2D2WA 2YX7A 1ZHFA 4HX8A 4X1EA 5KAIC 3G2BA 3RPUD 3W2VA 5HS8A 2VE9A 1NG7A 1FSHA 2F4IA 4BHPA 3FMSA 4P1WA 1HLVA 2DMNA 4YIFA 1WH7A 1BJZA 1HCRA 5GPAA 3HG9A 5IY5H 3KEQA 3RPUA 3O6BB 2M34A 2Z99A 3LMMA 4MTEA 2M8EA 4B48A 3OYAA 2F6CA 3F22A 3F21A 1ACIA 2GA2A 4BH9A 1D1CA 3OWTA 3CCRI 3FXMA 2HPIA 1U0JA 2XPWA 2KIUA 2QSGX 2XAFA 3KX2A 2KP6A 4S04A 2VOPA 3RI4A 1KQ8A 1Y8QB 2O61A 2QM3A 5JVGF 3M9AA 1OCPA 5HDNA 1Z6RA 2PX9A 3OYHA 3Q9SA 4FT8A 2F48A 1VQPI 5JLXA 3SZGA 4LIVA 5F08A 4HG2A 2LBFA 3M1CA 2OQRA 4HA8A 4UUTA 3NEUA 2HVSA 4EQQA 3G1LA 1V5GA 2LTPA 4H0EA 4IHWA 1ETQA 3SDGA 4IHVA 1IUYA 4CH7A 1AA7A 5KNLA 1YTYA 3SFIA 4NQWB 3MFKA 2AQFA 1AOYA 1X3ZB 3DEEA 2QA4I 3CJQB 3PFIA 2L3DA 1IRGA 2VJJA 1XTAA 2W4SA 2IBDA 2VQCA 3RKQA 2AO9A 3IKVA 3E6BA 1I6HJ 2X6XA 1HOMA 3RSNA 4OIRF 1ITYA 1Z3YA 2E71A 3QU6A 3DBLB 2DA6A 2PN6A 2KIQA 3LSGA 3D5SC 1ZELA 2PFBA 4ANJA 3HRSA 3GFJA 2IS4A 1JT6A 3FBIB 3NRVA 3LNQA 3HOVJ 4DBRA 4M71A 4GDFA 3FBNB 3S3MA 4L9VA 2ESNA 1YJNI 1YW7A 2XKPA 2ZXHA 5GAHJ 3AAFA 5J8CA 2XAUA 1TT5B 3AG2H 4ZDLA 2PMHA 2P5LC 4PFPA 3QWLA 2K4JA 1WPKA 4ESFA 3K2AA 1VQKI 2VQGA 4XSZF 2JRTA 5LHHA 3E97A 2MSYA 2QWWA 1FIPA 4IQ4A 4E7KA 2QENA 1LFUP 2QSFX 4RLQA 1ZG3A 1R4MB 2E1NA 5BPDA 3PIPF 1S3JA 3U21A 1G59A 2VXDA 4F92B 3A01B 4HX4A 2HYGD 4GYIA 4I0BA 1XSXA 1JKRC 5TGTA 5EDNA
chains in the Genus database with same CATH topology
2CV1A 3A1YA 2MD0A 4ZYAA 3L2RA 3ONQA 2CFOA 2WADA 2MYSA 4ZDOA 2Z1DA 3I3LA 3IUOA 2BOLA 2R7VA 3HXLA 2DT6A 2VL8A 4E6KG 3VYRB 2WAEA 3RCOA 2IS2A 4J01A 4EATA 2R7TA 1QHHD 2VJIA 3W3CA 2HU9A 3PL8A 1S9HA 3HPGA 4CCMA 1WFXA 4F55A 2LBFB 1YX3A 4IX7A 3UNGC 2K9LA 2ZSHB 1D0ZA 2OC6A 4CCKA 4KITB 2IXSA 4BL0B 3L2UA 1X19A 2LH9A 3DTKA 3OL3A 4U87A 2WAQA 3DU6A 2KRCA 4CSWA 1WJAA 2MABA 3M8JA 3ZR8X 4AU7A 1DGWY 1MMGA 2K5CA 4RM2A 1BR2A 1YX5A 3A2KA 2CV2A 3K70C 2LY1A 3QYEA 2CW8A 3CP2A 1UELB 4N4NB 5CPRB 2X1EA 3FKJA 4F3QA 4PK4A 2CH0A 2V7FA 2O5RA 3EUHC 2HZDA 1Y56A 4PJLA 1MMDA 4IQJA 1PJRA 2R4GA 3BG7A 2VJ5A 4BXFA 3LSIA 3OOUA 4ZJZA 3DPLC 3C2GA 2IGKA 1D1AA 2XF6A 3C2HA 3MD2A 3AL0C 1Z7LA 2W82A 2ZFUA 4CUGA 2XDVA 3L2VA 2ZSIB 1GLNA 3J7AY 3DLAA 2X6YA 2RNGA 2E60A 3OL4A 3S32A 4ITVA 4XNFA 1V5EA 2X1DA 2QKMB 2LC2A 4DBQA 2V6EA 2VKDA 4XLAA 4B44A 2R7SA 3PSIA 2X51A 2CS3A 4MLOA 3DKYA 1D0XA 3H5RA 4XKWA 1MNEA 2AQEA 4HNTA 5LD2C 4DIQA 4BEHA 4YRVA 3ZGKA 2JSPA 1WJDA 3RQ4A 3HOSA 2V26A 3BG6A 4E7LA 4NC7A 3LSKA 4C9YA 4XONA 3OYMA 3VSLA 4BJ6C 2K9MA 1WJFA 2VLAA 4DOZA 5HOOA 4E7IA 3AL0B 4BQQA 2L2OA 3IAS2 3OR1C 1EA3A 1QU3A 2VKHA 4H4KC 4F93B 2ZXIA 2WY7Q 4F91B 1E0EA 4B47A 3HKZA 1G8XA 4FASD 1V5FA 3OYLA 4B3XA 3H9QA 2DOAA 1MMNA 2VJ4A 3OY9A 2IS6A 3VSKA 3QYBA 1VZ0A 3NWTA 4XKVA 2KMUA 4XLFA 2VB6A 2RQQA 3KYLA 1OR7C 3LFUA 2R7QA 2WY8Q 4KISA 3IAM2 4E7JA 2V1NA 4RM3A 4DJAA 4NNJA 4BJ5C 4HNUA 2OV7A 3ZCOA 3L2QA 4AYBA 2W1OA 2M4GA 1NG6A 4XOTA 4Y3OA 3DPTA 3EUKL 2MFZA 4LG3A 1FMVA 2LY2A 3TMOA 1OLTA 3MKYB 3H5AA 4II3A 4PJMA 4E7ZA 4II2A 2BW3A 3DPUA 4YELA 4JQFA 4QPQA 1ERDA 1LVKA 3BLYA 2CMPA 4CCJA 2LOOA 3VYTB 3OS1A 2UWMA 4BJTA 2FUG2 3OIPA 2Z16A 3W2AA 3HPHA 2CUZA 2Y0SA 3PSFA 2L7KA 1FMWA 2E5NA 2UUZA 3OS0A 3EPZA 4E7SA 4B43A 3W2WA 3IP4B 2M7AA 3OYGA 2RREA 4X0GA 4PUSA 4XN0A 4BEHB 3OMYA 4BQNA 4DGWB 1P9QC 1X1DA 4BE0A 1TZLA 3SEZA 4NC8A 3VDXA 3E0JB 3MKZA 3CESA 4E4HA 5HNFA 3HUGB 2KQRA 2JUGA 2XF5A 2WAFA 3VYUB 1W36D 3UR3C 3S8PA 2DT7B 2LREA 4BE1A 4XLEA 3CP8A 4HSTA 3CJRB 4PJNA 2Q2EB 3OS2A 5CQGA 1DP3A 3NWSA 1K6YA 2XC7A 3OYCA 4PFOA 4XR6A 2KDOA 4PJJA 1J09A 2V4JC 3K10A 3DTIA 1WJ5A 2JVHA 4CCOA 2VASA 4Y4RA 3PFYA 2LG4A 4Y33A 4BDYA 4BQOA 3HOTA 2M4KA 2MC4A 5KCMA 4BE2A 3S93A 2JVGA 4RMNA 4KJZA 1WJCA 3K6GA 3OYDA 2XF7A 2X6WA 3K4LA 4OAZA 4CZCA 3QOEA 2VQHA 1SFKA 1T0FC 4XN3A 1KONA 2M0MA 4N4OB 4XM3A 4IKFA 1N78A 2LYCA 1SAUA 4XMYA 4PSXA 2HNHA 3RTRA 3OYJA 4BU2A 4E7HA 4XL9A 2JA2A 3SEQA 1R6RA 4JOMA 3ZQQA 4YEJA 3K4KA 3CMMA 2QKLB 2A5WA 5FRMA 2CW7A 3MKWB 2BW3B 1QHGA 2W7NA 2E1MB 3TBIA 2BVMA 2VQLA 4IZZA 2R7OA 3VYSB 5LFAA 2HVRA 2HQAA 4HEA2 3QODA 3OYIA 4G6TB 1LKXA 4NUBA 3K4CA 3DU5A 2CUJA 4J00A 4C30A 3LSMA 2P0WA 4ZC3A 3EUAA 3VWBA 1LFPA 3H9JA 1X1CA 2OUMA 2WB1A 1TT0A 2KRHA 2I8DA 3PJRA 2WA0A 3AFHA 3H0DA 1BR1A 3PNTA 1PYVA 1N77A 3DKXA 4RLFA 3ZRGA 3OIQA 2IGOA 3BC8A 4BDZA 3S3OA 3QYFA 5FRNA 3DWLE 3MMYB 4CCNA 4D1QA 3F9KA 3FHNA 4BGDA 3K4NA 2X1CA 1MNDA 5CQEA 2HVQA 3H5NA 3OYKA 2X85A 2IS1A 3OYEA 2GOMA 3SDBA 3E1SA 2VPLA 1YE9A 3H35A 2L5QA 3ZXSA 4HRIA 4BUPA 3N05A 1X1AA 3A4CA 4QPOA 3OYBA 4C2TA 2DJIA 3RPUD 3G2BA 3W2VA 2Z2SB 1NG7A 3LL7A 2F4IA 4XLCA 3AKZA 3D5LA 4OWRB 3CF2A 4P1WA 1X4PA 5HVQC 3HG9A 3K4BA 2V9KA 2F5VA 3FDYA 3LMMA 4XORA 1UG0A 2Q1ZB 3PNYA 3V42A 4B48A 4CCLA 4U7BA 3OYAA 2F6CA 3L2WA 2R7XA 2UV1A 3I9V2 1Z21A 1D1CA 1Z3XA 3OWTA 2PJRA 1D0YA 2HDWA 4KT6A 2HPIA 1U0JA 3KX2A 2KP6A 3HL2A 3HC7A 5CKTA 3OYHA 1X1BA 4F52A 1DGRM 5FROA 2KPMA 4XQFA 3SZGA 2HPMA 4LIVA 2CV0A 4HG2A 1DQUA 2LBFA 3M1CA 2E1MC 2HVSA 4PSWA 3OYNA 3CZ6A 2IGMA 1V5GA 1LDKB 1BOBA 4C2UA 4CH7A 1AA7A 2XSJC 4XOPA 5KNLA 4HSRA 1IRXA 4FETA 5HLTA 3KEYA 3PNVA 1JI8A 2VIXA 3GBGA 4NQWB 2AQFA 4GRIA 3DEEA 2M3AA 3CJQB 1WJBA 2KL4A 2KHMA 2IGNA 2VJJA 2W4SA 2VQCA 3DTEA 4XKBA 5JHFA 2M7BA 4D9JA 4CA0A 2GOXB 1N75A 3OR2C 2KZVA 2X6XA 3RSNA 5KHDA 1Z3YA 4R79A 2DXIA 4HPQA 2R7WA 2WBMA 3LSGA 3D5SC 1ZELA 2LRDA 4ANJA 2BVLA 4XLHA 2IS4A 2NOJB 3FBIB 4DBRA 1T95A 3K4MA 3FBNB 4OAYA 1BR4A 3S3MA 4ZDPA 1X4OA 3D5RC 1WJEA 4AVZA 5HNHA 4LITA 1W36C 2ZXHA 3H9GA 3SYTA 2VXZA 3BCAA 4ZTJA 2XAUA 4BACA 4ZDLA 4LIUA 3K70D 4PFPA 2K3PA 2L9NA 4P5OA 2R7RA 1UAAA 2VQGA 3LSHA 2DCEA 4ZTFA 3TL4X 3BCBA 1MW7A 3S3NA 4IQ4A 4XKCA 2A6TA 4E7KA 1Y6IA 1D1BA 2W00A 3K4JA 4RLQA 3OYFA 3U21A 1G59A 2VXDA 2E5ZA 4BS9A 2L9SA 4F92B 3PUBA 2KLOA 2R7UA 1MMAA 3DQVC 2PJRB 1HA8A 5TGTA 2ELJA 2PMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5N A;  2DOA A; 
#chains in the Genus database with same CATH topology
 4ZZL A;  1W5C C;  3A1Y A;  4ZYA A;  2VT2 A;  2EV5 A;  2H6C A;  3V8L A;  4EM0 B;  1A31 A;  1RET A;  3BPV A;  5EZH A;  1YIJ I;  4ON0 A;  4ENN A;  5HS7 A;  1HDP A;  4LB5 A;  1S72 I;  3HXL A;  3TGN A;  3FHZ A;  3VYR B;  2WAE A;  5DYM A;  3RCO A;  5F0H A;  3KE2 A;  1TTY A;  3W3C A;  1S9H A;  4UV8 A;  1YX3 A;  1QNT A;  3UNG C;  3GYH X;  2ZSH B;  4FE7 A;  1D0Z A;  2XGX A;  1YJW I;  1BC7 C;  3GXO A;  4BHB A;  2OC6 A;  2V9V A;  3KCC A;  4WK8 F;  1SFE A;  4KFC A;  3FXK A;  1MH3 A;  1F1Z A;  1X19 A;  4HNV A;  3OL3 A;  1EV7 A;  3IC7 A;  3NAU A;  1I6X A;  2FNA A;  5AIP A;  2CQQ A;  3C18 A;  4Q48 A;  3JTH A;  2E2H J;  3CC4 I;  1BR2 A;  2ZME B;  2CV2 A;  2W25 A;  3ML6 A;  2X9D A;  3HKZ N;  1ONV A;  1Z7U A;  1OIS A;  2CW8 A;  5FKO A;  3FMR A;  4HZF A;  1UHS A;  2AS5 F;  1J7K A;  2Z9O A;  3ZQI A;  5GAE J;  3FKJ A;  4PK4 A;  4LGW A;  3EUH C;  4PJL A;  4FHT A;  1MMD A;  3IH3 A;  1SAN A;  3HOX J;  5KK1 A;  2M87 A;  1A5J A;  2BV6 A;  2BBY A;  3DPL C;  1IO2 A;  1BBY A;  3F8F A;  3JRA A;  5HDK A;  4IEJ A;  1S29 A;  2XF6 A;  1MBH A;  2KZG A;  3KYD B;  3MD2 A;  1X3W B;  5E3N A;  2W82 A;  2EK5 A;  1LEA A;  4G7H F;  1OMI A;  3IWZ A;  1GLN A;  2CUE A;  5DDG A;  1VTN C;  2P7V B;  1LDJ A;  2LDU A;  1VI0 A;  2DMQ A;  2A5Y B;  1D5Y A;  1V5E A;  4HQM A;  4QLC U;  1K83 J;  2V6E A;  2VKD A;  3PSI A;  1G3Y A;  3TP0 A;  2A3S A;  1GV5 A;  4ENM A;  5EJC A;  4RBO A;  3S17 J;  3H5R A;  3BG5 A;  3RKW A;  2R7Z J;  4M6X A;  4DIQ A;  3B6C A;  4YRV A;  3ZGK A;  1WJD A;  3V8K A;  3RQ4 A;  4M9S A;  2NNN A;  3HOS A;  2WWY A;  4L5J A;  4YII A;  1I1G A;  5FFX A;  1LDD A;  2RV8 A;  2K9N A;  4NC7 A;  4OMZ A;  3ECH A;  4IVN A;  3ABU A;  3LSP A;  2ZO4 A;  1IN6 A;  3OYM A;  3HUG A;  5K7Z A;  2K9M A;  1JE8 A;  1BIB A;  4E7I A;  4NHJ A;  3PO2 J;  4HF0 A;  4BQQ A;  3BG9 A;  4HW0 A;  4EV0 A;  3JRD A;  1O3R A;  1RKT A;  4D5C A;  4CYC B;  3JTG A;  2IW5 A;  3SQN A;  4F91 B;  5DD4 A;  1E0E A;  3CUO A;  3HKZ A;  5CVR A;  1G8X A;  1WI3 A;  4B1R A;  4Z6Y A;  1V5F A;  3OYL A;  4B3X A;  3H9Q A;  4XIC A;  2HOA A;  4B4C A;  2DOA A;  2VI6 A;  2M2E A;  2OQG A;  1UMQ A;  3OY9 A;  3VSK A;  3QYB A;  2OZU A;  1F43 A;  1AKH B;  2EZI A;  2XIG A;  5F1J A;  2QQA A;  4BKX A;  2O7O A;  1JJ8 C;  2WY8 Q;  1A6I A;  1IXR C;  2X4H A;  1QZZ A;  3OSF A;  1BM9 A;  4NNJ A;  1PDN C;  3ZCO A;  2HTJ A;  3P9I A;  2ZBK A;  1ZR4 A;  1UZC A;  3CCJ I;  4UVC A;  4MFE A;  3EET A;  4Y3O A;  1BA5 A;  3JRI A;  2V9P A;  3BR5 A;  2J5P A;  4ESB A;  2VPR A;  3TOB A;  5BQT A;  1HBX G;  2YS9 A;  5EG0 B;  1T8I A;  3TMO A;  2HZT A;  4JBA A;  1OLT A;  3H5A A;  3M8F A;  4PCQ A;  1JTY A;  2Q8K A;  2JSC A;  4QTR A;  2EIL H;  1K7A A;  3SHF A;  4II2 A;  1U78 A;  1QZE A;  4RGX A;  1B72 A;  4ETS A;  4F7Z A;  4DZJ A;  1ERD A;  3WTV C;  2NYX A;  1LVK A;  1VQM I;  4IHY A;  3L7W A;  3WE2 A;  2CMP A;  3QPT A;  3JW4 A;  2LOO A;  2EFN A;  3VYT B;  4BJT A;  2YU3 A;  4M73 A;  1A35 A;  4PJ0 C;  2M1B A;  1XMK A;  1RUN A;  2A6H F;  2LLK A;  2UUZ A;  1VQ4 I;  4EEF G;  5JR3 A;  1NTC A;  2BGC A;  4IF4 A;  1QQI A;  3QP5 A;  2XB5 A;  1OYY A;  3RZD J;  1R5H A;  1ZGA A;  2DN0 A;  4X0G A;  4BQN A;  3HHG A;  4XN0 A;  3SFZ A;  1P9Q C;  1TQP A;  1EH8 A;  2VBW A;  4BE0 A;  4NC8 A;  2IA0 A;  1EH7 A;  3VDX A;  2L54 A;  2CRG A;  2VC0 A;  1HKQ A;  2CQN A;  1X3U A;  2KQR A;  1U8R A;  3ASO H;  1SEU A;  1C0W A;  2ELK A;  2FA5 A;  1TBX A;  4A3M J;  3WTT C;  1QPM A;  3BJO A;  1W36 D;  1JKP C;  1YW9 A;  2LRE A;  2AXT C;  4BE1 A;  1TWH J;  2EA4 A;  5GPC A;  4WWC A;  1ORK A;  2PEX A;  3CC2 I;  3CP8 A;  3TO7 A;  3FXL A;  3OS2 A;  5CQG A;  1DP3 A;  4AID A;  3NWS A;  3OYC A;  3PQK A;  4PFO A;  1IDZ A;  1LB2 A;  1FEX A;  4BBR J;  5K1Y A;  3QP6 A;  5KVR A;  1FYK A;  3TOA A;  3JRG A;  5D4S A;  1BI2 A;  1OFC X;  3KZI C;  3FXJ A;  3ABT A;  1YHQ I;  4HV6 A;  1I5Z A;  1ZTR A;  2JVG A;  3S93 A;  5GP9 A;  2YR2 A;  1VFC A;  3AG1 H;  3K6G A;  3HJE A;  2UXN A;  3K4L A;  3V7C A;  2OJE D;  2F5E A;  2HOS A;  4CZC A;  4K2E A;  2VQH A;  5LEJ A;  4A3J J;  4HLX A;  4XN3 A;  5CVI A;  3BJA A;  4IKF A;  1Y0U A;  1K4S A;  2JTV A;  2JPC A;  4KA4 A;  4LFU A;  5H6Q A;  3LQQ A;  4PSX A;  5E20 A;  3JSO A;  2R7F A;  4FIS A;  4D5F A;  2R7D A;  2K9Q A;  4JOM A;  3LSR A;  3ZQQ A;  3ULQ B;  4UNO A;  2A5W A;  2H09 A;  2STW A;  5DEQ A;  1H88 C;  1USS A;  4L5I A;  2BW3 B;  5H6R A;  1FZP B;  2BVM A;  2VQL A;  4C2M J;  3CCV I;  4IXA A;  2HQA A;  4HEA 2;  4LLL A;  2EFP A;  2L4M A;  2H94 A;  3I5U A;  1O3Q A;  4NUB A;  5C3E J;  1G2H A;  5FB2 A;  2HKX A;  2OCE A;  2L0K A;  1NK3 P;  3CCS I;  2E36 A;  2P0W A;  3EUA A;  5LEK A;  1S7O A;  2Z3Y A;  5GTI C;  2W57 A;  3GEZ A;  4NQW A;  1X1C A;  5F64 A;  1TT0 A;  2KJC A;  1TWF J;  2FBH A;  5D8K B;  1SAX A;  1Z05 A;  3IH2 A;  5L3D A;  1PYV A;  4RB1 A;  1JGG A;  2DFH A;  4I7H A;  3T8T A;  3OIQ A;  1MJ9 A;  2IGO A;  1IAW A;  5EZG A;  1IRF A;  4BDZ A;  3S3O A;  2CUF A;  3L9F A;  1AHD P;  4CYD A;  3QYF A;  1SVL A;  1FOW A;  4CO8 A;  4KDP A;  3MMY B;  4CCN A;  5FRN A;  4D1Q A;  2RC4 A;  3H36 A;  1VQL I;  3F9K A;  4Y7N J;  3MZY A;  1MND A;  5TJJ A;  1SD5 A;  2HVQ A;  2LFB A;  2EH3 A;  4G6Q A;  4RS8 A;  3PUF A;  3SDB A;  3CQZ J;  3WU2 C;  1O57 A;  2GXA A;  4MQV A;  2PJP A;  1FT9 A;  1VQN I;  3H35 A;  3ZXS A;  2L5Q A;  2QVO A;  2ELH A;  2FQ4 A;  3F8C A;  3I53 A;  1DU6 A;  2RKH A;  1X1A A;  1S6L A;  3EDP A;  3A4C A;  4CZZ A;  2LK2 A;  2I5U A;  2CW0 F;  3LL7 A;  1UCR A;  1G3T A;  5IYC J;  3H92 A;  1ZQ3 P;  4HYE A;  4KUM A;  1SFO J;  1LNW A;  1X4P A;  5HVQ C;  3F23 A;  3K4B A;  4FE4 A;  2V9K A;  2DT5 A;  2H6B A;  4XOR A;  2Q1Z B;  3ZMV A;  1TLH B;  2CQX A;  2QLZ A;  4I09 A;  5HLI A;  3HM5 A;  4LB6 B;  3V42 A;  3BT9 A;  5LLQ A;  4U7B A;  3A01 A;  2H1L A;  3CME I;  2R7X A;  1Z21 A;  2CSO A;  1TWC J;  1D0Y A;  2E1O A;  4KT6 A;  1H0M A;  4QWQ A;  4UUV A;  3DP7 A;  5AON A;  4A5N A;  3ABM H;  3GTJ J;  1HST A;  2IPQ X;  2Y69 H;  1OYW A;  2KPM A;  2JZY A;  2HPM A;  3REO A;  1LPQ A;  4PSW A;  1ZRC A;  2IGM A;  3S2W A;  3KET A;  4C2U A;  5CVJ A;  3T5X A;  2MG4 A;  1PUE E;  2XSJ C;  4HSR A;  3I64 A;  4FET A;  3BR6 A;  3KEY A;  3GLL A;  4MQ9 F;  5J6X A;  2P81 A;  3CLO A;  1K78 B;  1MSF C;  4GRI A;  5EGO B;  1MKM A;  1S8N A;  2YX4 A;  2DYR H;  4UVB A;  2IGN A;  4L0Y B;  4XKB A;  3KP5 A;  2ZME A;  1WRJ A;  2ECC A;  4M72 A;  2M7B A;  5DS9 A;  2QGU A;  4D9J A;  1H9T A;  4CA0 A;  3BZC A;  3OR2 C;  2KZV A;  2WV0 A;  2DLL A;  3O3K A;  4HQE A;  2DXI A;  5F04 A;  2R7W A;  2WBM A;  1R58 A;  1TWG J;  5GTH C;  4A3F J;  2RVC A;  1R5G A;  3ZOB A;  2BVL A;  1ZRE A;  3QRF F;  2F5D A;  5E79 C;  1J2X A;  1T95 A;  4Y13 A;  5FKM A;  1YIT I;  1BR4 A;  2EV0 A;  4AVZ A;  1R5I D;  1EF4 A;  1H9G A;  4LIT A;  3SXY A;  3N4M A;  4A2U A;  3SYT A;  1W36 C;  2VXZ A;  2NS7 A;  4WXC A;  4IHX A;  2BEO A;  2OTL I;  5E1Z B;  2YU9 J;  1M1E B;  4P5O A;  1A6Q A;  3G6E I;  2FBK A;  3K69 A;  3TW7 A;  1B8I B;  3S3N A;  2XAQ A;  4NBQ A;  4B09 A;  2XSD C;  2W00 A;  3CO7 C;  4M3F A;  4UB8 C;  2A6E F;  3BRO A;  5IT9 Z;  4BS9 A;  2L9S A;  2LY9 A;  5D6F A;  4A0X A;  3EUH A;  1XPX A;  1N25 A;  2R7U A;  1GV2 A;  3ERM A;  1BL0 A;  1TQM A;  1QO0 D;  4A6E A;  4OIO F;  3MQ0 A;  2ELJ A;  2LR8 A;  3S14 J;  2CV1 A;  2B7E A;  3CCU I;  3L09 A;  1LE8 B;  3HSR A;  4AC0 A;  3L2R A;  3ONQ A;  3GTG J;  5DD8 A;  3BDD A;  3OSG A;  4G8X A;  2K27 A;  2IS2 A;  4J01 A;  1JGS A;  2GBY A;  2VJI A;  3PL8 A;  4CCM A;  4FTH A;  1WFX A;  4CYC A;  2CO5 A;  3FXO A;  1RR8 C;  1UFM A;  2K9L A;  5IYB J;  3ERE D;  3HIF A;  1K79 A;  2HOT A;  3DKW A;  3OV8 A;  2GIZ A;  1YJ9 I;  4KIT B;  3Q5F A;  1BW6 A;  3L2U A;  3VOE A;  1KU7 A;  1TW3 A;  5HDG A;  2JT1 A;  4UY8 I;  1WGX A;  4CSW A;  1P2F A;  1Q1V A;  1AKH A;  1WJA A;  2MAB A;  4M3B A;  3ZR8 X;  1VQO I;  3GFL A;  2ACJ A;  3DBR B;  2K5C A;  1Q1H A;  2ZNY A;  4RM2 A;  2X6O A;  4KN4 X;  3A2K A;  2GLO A;  1U9N A;  4A6D A;  3WTY C;  1UEL B;  4M3E A;  2EWN A;  1UG2 A;  2HZD A;  2XPV A;  4IQJ A;  3MEX A;  2VJ5 A;  2KIM A;  4BXF A;  1Y1W J;  1KA8 A;  5EG0 A;  3OOU A;  4ZJZ A;  5HS9 A;  3C2G A;  1Y0N A;  1D1A A;  4G6D A;  1FC3 A;  3B02 A;  3LA3 A;  3C2H A;  4RAG A;  1E3O C;  1LVA A;  5L3F A;  2OA4 A;  1X2N A;  1IN5 A;  4G12 A;  2RAE A;  1O3S A;  5E8I A;  3DLA A;  2X6Y A;  5LGN A;  1G4D A;  5J1R A;  1FSE A;  1EH6 A;  2LC2 A;  4XLA A;  4MO7 A;  2A07 F;  4Y15 A;  4HF1 A;  1XS9 A;  4MLO A;  2DQL A;  3DKY A;  4FCY A;  1D0X A;  4HNT A;  1MNE A;  1LJ9 A;  1K61 A;  1FYL A;  5FD5 A;  1W7P B;  1MH4 A;  3BG6 A;  1OCZ H;  5FO5 A;  4E7L A;  3LSK A;  3Q3S A;  3DF8 A;  3F6O A;  3S1Q J;  1TNS A;  2KRF A;  4LG0 B;  2GIV A;  2EB7 A;  4RGS A;  1SVM A;  4LLG F;  4BY1 J;  4BJ6 C;  1V54 H;  5HOO A;  2W84 A;  1MBE A;  1BOA A;  2L2O A;  1FTT A;  1IN8 A;  4FX0 A;  2CJJ A;  1J9I A;  1I3A A;  2F5F A;  3JRE A;  4W1U A;  1QU3 A;  4H4K C;  2WY7 Q;  4X6A J;  2FNP A;  1SFU A;  1Z91 A;  4MTD A;  1FP1 D;  2GWR A;  4DYQ A;  1W5S A;  1MMN A;  3BY6 A;  2VJ4 A;  2VKV A;  4L5E A;  4L9T A;  5M3F J;  1T08 B;  4RB2 C;  3NWT A;  1IN7 A;  3P7N A;  2Y30 A;  2BZT A;  2MBF A;  2VB6 A;  5F6F A;  3W6J B;  3A03 A;  3W6K B;  2LF8 A;  2HI3 A;  3U1K A;  4KMF A;  2R7Q A;  4KT5 C;  4KIS A;  3BR1 A;  2ECB A;  4DJA A;  2FMY A;  2ZME C;  1FOY A;  3GF2 A;  2M8G X;  4W97 A;  1XD7 A;  3L2Q A;  1ZG1 A;  4AYB A;  2GQQ A;  3S1M J;  2W1O A;  1FLI A;  2M4G A;  3BQY A;  2LVS A;  4JX4 A;  5LHI A;  3DPT A;  5CJ9 A;  1T2K A;  1SMY F;  4CIC A;  3EUK L;  2OF7 A;  4IHS A;  3NQO A;  2RNJ A;  3CCM I;  4UXN A;  2M9H A;  3CMY A;  2K86 A;  2L01 A;  1X2M A;  2XKO A;  2XV4 S;  4II3 A;  4PJM A;  4E7Z A;  2DW4 A;  2BW3 A;  3BR3 A;  1ULY A;  3HHH A;  5ICG A;  3CC7 I;  1HXD A;  3I0T A;  2QBY B;  4CCJ A;  2XUB A;  4PGG A;  3OS1 A;  3HSE A;  1BI3 A;  2OAZ A;  3HPH A;  1J75 A;  1FMW A;  1QZY A;  1XN7 A;  4A3K J;  4YFX F;  1YW8 A;  3OS0 A;  3LA2 A;  2DA2 A;  2RN7 A;  5DV5 A;  1YIO A;  4E7S A;  5HLH A;  2VKE A;  1JKQ C;  2NS0 A;  2OCC H;  4RAY A;  2GM4 A;  4OIN F;  1TQI A;  1ZH5 A;  2WV1 A;  2RRE A;  2P4W A;  4PUS A;  3OMY A;  3M07 A;  1GHC A;  1X1D A;  3SEZ A;  3KYC B;  3IV5 A;  1ETY A;  1GT0 C;  4E4H A;  1R1T A;  2JUG A;  5J40 A;  3H3Z A;  5KAF C;  4EGY A;  3DCF A;  3FIW A;  1FBQ A;  3UR3 C;  5K5O A;  3BG3 A;  5HLG A;  1ENH A;  4XLE A;  2YUS A;  1WKM A;  4WF2 A;  3F8M A;  2K7L A;  3H1C A;  3V7R A;  3L2C A;  2Q2E B;  3FWE A;  3I54 A;  2XC7 A;  4KMU X;  5M5Y J;  4XR6 A;  4XID A;  4IRG A;  1J09 A;  5D5V B;  2V4J C;  3DTI A;  1IRZ A;  1ZLJ A;  1KQ9 A;  4Y4R A;  4CDG A;  5D6E A;  3PFY A;  3FK7 A;  2LG4 A;  1I3Q J;  2R3S A;  3HOT A;  1NHA A;  5E18 F;  1KYW A;  1VF9 A;  2CGP A;  3R61 A;  2WC2 A;  4UV9 A;  2O9L A;  2DQR A;  2NVT J;  4UB6 C;  2IJL A;  3GWZ A;  3GZ5 A;  3OYD A;  4L18 B;  2BY3 A;  2X6W A;  1Y8R B;  4OAZ A;  1TWA J;  1MNM C;  3FZV A;  5TIS C;  1KON A;  2M0M A;  2XAJ A;  1IC8 A;  3KZZ A;  4O3M A;  1N78 A;  3DBH B;  2E7X A;  2LSO A;  2LYC A;  1GXP A;  3KFW X;  3WTW C;  4XMY A;  3ZQL A;  2HNH A;  2VBY A;  3RTR A;  2GXB A;  4MIM A;  1Z67 A;  4XL9 A;  2JA2 A;  5E3O A;  3S16 J;  4YEJ A;  3K4K A;  2O0Y A;  3CMM A;  2QKL B;  3V4G A;  2VOD A;  2CW7 A;  2LP0 A;  4AWX B;  4B8X A;  1ZR2 A;  5EEA A;  2E1M B;  3I56 I;  1RUO A;  3VYS B;  2N8G A;  5LFA A;  2HVR A;  5LRR A;  1SVO A;  1U6G A;  3BOQ A;  3J80 K;  4G6T B;  4N0B A;  3I4M J;  2Y2Z A;  3SZP A;  1LKX A;  4BNC A;  3A0H C;  2RQP A;  1ZGJ A;  1R00 A;  2CUJ A;  3DU5 A;  2IA1 A;  3EYY A;  1OCR H;  3Q9V A;  2HXI A;  1MJA A;  1G3S A;  3M8E A;  3E5X A;  1LFP A;  3P9K A;  3VWB A;  1RNL A;  2O8X A;  3H9J A;  1I39 A;  1K78 A;  1Y1V J;  5EGO A;  1P4A A;  2WB1 A;  4EVI A;  4N9H A;  5IOY A;  3QOP A;  1PP7 U;  2DFF A;  5LBQ A;  4LOC A;  1AU7 A;  5M5X J;  1WZ2 A;  4BXX J;  3E6M A;  1MGT A;  4RLF A;  1HKT A;  3J81 K;  3ZRG A;  3MN2 A;  3V7S A;  2Y0M A;  3BC8 A;  2LNB A;  2XB0 X;  3M4O J;  4EGZ A;  1EJ9 A;  2OD5 A;  3GCM A;  3TP3 A;  2DA1 A;  3OOP A;  1MBK A;  3BTC A;  5K5R A;  2KKO A;  1HC8 A;  2H1K A;  3VEP A;  5CQE A;  3WHB A;  3H5N A;  2X85 A;  3VOD A;  2HGC A;  4PGH A;  1ZRF A;  3E1S A;  1B9N A;  3QQA A;  1YFH A;  2BY1 A;  3CUQ B;  1APL C;  2VPL A;  3AG4 H;  3WGH A;  1O7L A;  4HRI A;  1DU0 A;  2G9W A;  2BHY A;  1R36 A;  1XB4 A;  2FXA A;  2EZL A;  2TCT A;  3D5L A;  4OWR B;  3S1R J;  2CYY A;  3CF2 A;  1B8I A;  5E3M A;  2ZCW A;  1BI1 A;  4A0Z A;  4DYC A;  2KDZ A;  4M3D A;  4IJA A;  2ZXJ A;  4I0A A;  3FX3 A;  1GDT A;  2F5V A;  3DXJ F;  1L0O C;  1ZAR A;  1UG0 A;  4DNC A;  3ZMS A;  1R4N B;  1FTZ A;  2KJB A;  1Z3X A;  1QPI A;  3JRF A;  4MFD A;  2TRT A;  3O8H A;  3F8B A;  1LE8 A;  1GUU A;  2KIF A;  4JX5 A;  3X2Q H;  1DUX C;  3HL2 A;  3JAM K;  2DA5 A;  4U88 A;  3ZPL A;  5CKT A;  1KU9 A;  4IL6 C;  4F52 A;  2NS8 A;  2HQN A;  4XQF A;  2CV0 A;  1OCO H;  5C44 J;  4RB3 C;  1FBS A;  2A68 F;  3HBL A;  5M5W J;  1XX5 A;  3ABL H;  3E5U A;  3KIO A;  1LDK B;  1FJL A;  1GVD A;  3KP2 A;  1XGS A;  2A61 A;  1T56 A;  2VUM J;  1G6N A;  2EFW A;  1IRX A;  5HLT A;  3CF5 F;  1JI8 A;  4I6Z A;  1A36 A;  3GBG A;  3QAH A;  1BC8 C;  4GYG A;  4HF2 A;  2M3A A;  1GXQ A;  2XGC A;  2ZJR F;  6PAX A;  2YSR A;  2XGE A;  3IWF A;  1IG7 A;  5JHF A;  3IRQ A;  2ZJ2 A;  4DZP A;  3RQI A;  1N75 A;  2XAH A;  3MCZ A;  5KHD A;  2K85 A;  1V4R A;  4R79 A;  4BBS J;  3TO9 A;  4NDL A;  1IDY A;  5IT3 A;  5FLM J;  1WSU A;  2JQ7 A;  2NVY J;  1U5T C;  2DOE A;  2DMU A;  2G0E A;  1ZKG A;  3KPH A;  1B4A A;  3GUD A;  3GZN B;  1R71 A;  2ZXW H;  3KP3 A;  4ZDP A;  1X4O A;  3D5R C;  5K5Q A;  5FLX K;  2D45 A;  1TW2 A;  1V55 H;  3ZQG A;  1HQC A;  4ZTJ A;  1R9T J;  4BAC A;  4LIU A;  3J7Z I;  4OMY A;  2HTS A;  1F36 A;  2L9N A;  4FQG A;  5L3C A;  1YS7 A;  4ZTF A;  3TL4 X;  1MW7 A;  4OIP F;  2E7W A;  3JCU C;  4IPA A;  3WU1 B;  3HEF A;  1POG A;  2TDX A;  1B9M A;  1W7P D;  5DUK A;  3CCQ I;  2JUC A;  1RI7 A;  1Y6I A;  1IZ1 A;  2IT0 A;  1IXS B;  2E5Z A;  2Y75 A;  2BE5 F;  4ENK A;  1W7P A;  1ETX A;  2DAO A;  1Z9C A;  2FRH A;  2KLO A;  1U5T B;  2PJR B;  1HA8 A;  1HW1 A;  1CGP A;  2PMZ A;  2MD0 A;  3CCY A;  2QZ8 A;  4LG0 A;  2MYS A;  5J4V A;  4U0Y A;  1PVE A;  2BOL A;  2R7V A;  2DT6 A;  4A5M A;  5L3G A;  3HPG A;  4DW6 A;  4F55 A;  1GVJ A;  1IJW C;  1IF1 A;  2E19 A;  1XC5 A;  3GLX A;  3CD6 I;  4CCK A;  2FD5 A;  3HOW J;  3RYR A;  3ZMD A;  1PUF B;  3DTK A;  5EF6 A;  3R60 A;  1T38 A;  1B6A A;  2UXX A;  2WAQ A;  3DU6 A;  1LQ1 A;  2JN6 A;  2LKP A;  1XDS A;  3M8J A;  5A2Q K;  4AU7 A;  1YX5 A;  2FSW A;  5FJ8 J;  2K3F A;  3IHU A;  1T0F A;  4XRS G;  3K70 C;  4Q5S F;  2LY1 A;  3QYE A;  2R5Y B;  2XVC A;  3CP2 A;  3TW6 A;  5CPR B;  4F3Q A;  2CH0 A;  2V7F A;  3KEO A;  2O5R A;  5J1Y A;  3K1P A;  1B59 A;  1Y56 A;  4OOI A;  1MSE C;  2R4G A;  1BI0 A;  3ZMU A;  1BN5 A;  2DA4 A;  3LSI A;  1B1B A;  3RJP A;  4M9X A;  2PBI A;  2E34 A;  5LGT A;  3HOY J;  3LFK A;  4GFB A;  1P7J A;  1FIA A;  2ETH A;  2KFD A;  3LSJ A;  1OCC H;  5J3L A;  1Z7L A;  3RDI A;  1T39 A;  3AL0 C;  2BXY A;  3G73 A;  3E5Q A;  1E2X A;  2DA3 A;  4YG2 F;  3L2V A;  1TC3 C;  2QBY A;  3J7A Y;  4A3D J;  2RNG A;  3LQR A;  2E60 A;  3OL4 A;  1FNN A;  4G7Z F;  4ITV A;  4GO1 A;  2ZKZ A;  4DBQ A;  4IOC F;  4B44 A;  4ZYE A;  3LA7 A;  2ZC2 A;  5BMZ A;  3G3Z A;  4R1H A;  2R7S A;  3HTU A;  2X51 A;  3TKY A;  3S2H J;  5HOD A;  2P8T A;  2CS3 A;  3FXR A;  2AQE A;  5LD2 C;  5C4X J;  2XAG A;  3J7Y J;  4I76 A;  3QPS A;  3I55 I;  2GA1 A;  2NAZ A;  1FY7 A;  3FIS A;  4YIR X;  3FXQ A;  3ZQC A;  2V26 A;  3C3W A;  1FX7 A;  1STZ A;  1XDU A;  1T33 A;  5B1A H;  1UJ8 A;  3GX4 X;  4C9Y A;  2D5V A;  1W4M A;  2VLA A;  2XAS A;  4DOZ A;  5IP9 J;  4IRH A;  4Z2Y A;  2K4B A;  1AWC A;  3AL0 B;  3GTK J;  4EJW A;  2VT3 A;  2DTR A;  4XLN F;  2VKH A;  4F93 B;  2ZXI A;  1H8A C;  2H8R A;  4B47 A;  3ECO A;  1W0U A;  4FAS D;  2JPB A;  1WVR A;  1QVT A;  2Q2E A;  3IL2 A;  4MEX F;  3R0J A;  1JUP A;  3CCE I;  3RIR A;  3QPH A;  3O8G A;  5FKN A;  1VQ9 I;  3BWG A;  1Z6T A;  4XKV A;  3WU0 A;  3BP8 A;  3UKG A;  3DLL F;  1J5Y A;  3KYL A;  1OR7 C;  2CQK A;  3RPQ A;  3LFU A;  1EKE A;  1YYV A;  4PDK A;  5JI6 A;  4XRS A;  2OBP A;  1F5T A;  2V1U A;  4A3G J;  4RM3 A;  1YG2 A;  2OV7 A;  5J47 A;  1ZGW A;  3LAP A;  5DCM B;  4WXH A;  3GZ6 A;  1P4X A;  1ON1 A;  4I99 C;  3PO3 J;  2A69 F;  3I58 A;  1NG6 A;  4XOT A;  3I59 B;  1HDD C;  2DPD A;  2MFZ A;  4LG3 A;  2L7F P;  1T98 A;  4U7D A;  1FMV A;  1X58 A;  3WTU C;  3MKY B;  2LMD A;  3GTO J;  2DDA A;  2Y31 A;  3TO6 A;  1MBJ A;  1Z0X A;  2QSH X;  3DPU A;  4QPQ A;  4JQF A;  2LKX A;  3BLY A;  1L3L A;  3QPL A;  4KIG A;  2EJR A;  1E3H A;  2OU2 A;  2MH9 A;  4J19 A;  2BY0 A;  3LOC A;  2Z16 A;  3W2A A;  2Y0S A;  3PSF A;  2L7K A;  3BQZ A;  2E5N A;  3ISP A;  1FWZ A;  2F5C A;  2D1V A;  2FOK A;  3EPZ A;  2V6C A;  1P92 A;  3F6V A;  3KP4 A;  2M7A A;  4D0P A;  3OYG A;  2PMU A;  1JHF A;  3ROU A;  2ZJQ F;  1TNT A;  4BEH B;  3KZY A;  3G71 I;  5CVV A;  1TZL A;  1OPC A;  1XSD A;  1S7E A;  2VE8 A;  4L9N A;  3E7L A;  1ON2 A;  2A05 A;  1U3E M;  2H8W A;  3MKZ A;  2MLG A;  3IRR A;  3CES A;  1WHU A;  2VBX A;  1O7F A;  3A0B C;  3E6C C;  2B0L A;  2IEK A;  2EZK A;  4ASN A;  4EJO A;  3GVA A;  5FKK A;  1MJB A;  2JA6 J;  3GW2 A;  4JP0 A;  2QQB A;  2DT7 B;  2XPU A;  4EJT A;  2CG4 A;  3K1N A;  5B1B H;  5F0C A;  4AYB N;  4LLN A;  2EFO A;  3F3X A;  2E2J J;  4Q47 A;  4PJN A;  1K6Y A;  3U1D A;  1JTX A;  3CUQ A;  2L4A A;  3D0S A;  4PJJ A;  3V8J A;  2IP2 A;  3ZQF A;  3K10 A;  5K7H A;  1R23 A;  1WJ5 A;  2JVH A;  4BQA A;  3R0A A;  2VAS A;  3E3V A;  4O6J A;  4ZH4 F;  1YI2 I;  3G1O A;  1SD6 A;  2PLY A;  2ZFW A;  1IUF A;  2ZB9 A;  2QQ9 A;  2M4K A;  2MC4 A;  3C2B A;  4RMN A;  3K1M A;  4PZJ A;  1P6R A;  1WJC A;  1Z77 A;  3CJN A;  1YS6 A;  3D1N I;  3VB2 A;  3ZN1 A;  1QGP A;  3CDI A;  3EYI A;  1R22 A;  5FGM A;  1T0F C;  2R93 J;  4XM3 A;  1V3F A;  3HGG A;  3PQJ A;  4YFK F;  1D8J A;  2DK5 A;  4S0H B;  1JUS A;  4BU2 A;  4ZZD A;  2DFI A;  2ESH A;  3ZMT A;  4E7H A;  2CQ7 A;  2O8K A;  3GFI A;  1D8K A;  4XRM A;  1ETW A;  2ZJP F;  3HDD A;  3KP6 A;  3MZH A;  2HR3 A;  5FRM A;  1KYZ A;  1UB9 A;  3MKW B;  2X0L A;  2W7N A;  3FF5 A;  3TBI A;  4IZZ A;  1VQ6 I;  2EPF A;  2Y9Y A;  2O03 A;  1ETV A;  2ID3 A;  3CO6 C;  3QOD A;  3C7J A;  4DQ2 A;  3OYI A;  2EIN H;  2DYS H;  1YOV B;  3GME A;  5C4J J;  1NH3 A;  3K4C A;  4ZYD A;  1SD4 A;  3A02 A;  1PP8 F;  3WOD F;  4C30 A;  2FOW A;  2ME6 A;  4ZC3 A;  4M74 A;  5FLV A;  3RKY A;  1CF7 B;  2QCO A;  2YPR A;  4A69 C;  2OUM A;  2CFX A;  4P9F A;  2E1C A;  1JT0 A;  5JVT A;  2KRH A;  3JRC A;  3PJR A;  1Y39 A;  2WA0 A;  3AFH A;  2F2E A;  3H0D A;  3DEW A;  1BR1 A;  2L7M P;  4MGR A;  2EIJ H;  2XRO A;  5DM7 F;  1VND A;  3H3U A;  2Z33 A;  2DPU A;  4OU0 A;  5BPI A;  3T1B A;  2DOD A;  5LRS A;  4XRF A;  2P7C B;  2EBI A;  5ICE A;  3HB9 A;  1YLF A;  3DWL E;  3JR9 A;  3COA C;  4I02 A;  3K4N A;  2IAI A;  3TED A;  2IS1 A;  4A12 A;  2AHQ A;  3OYE A;  1E17 A;  2GOM A;  3BPX A;  1KQ0 A;  1YRN B;  1RES A;  3T0Y A;  5ILS A;  4I98 B;  3ABK H;  5DCF A;  2KT0 A;  3TQN A;  3QU3 A;  3M3Y J;  3I71 A;  1YE9 A;  3WTS C;  2DMT A;  5FKL A;  1ODD A;  4QPO A;  2DMP A;  1LEB A;  4BAY A;  4C2T A;  3F72 A;  1OYI A;  1KU3 A;  3O2P E;  3TDZ C;  1MBG A;  4I2O A;  2Z2S B;  1HF0 A;  3MKL A;  2M30 A;  4XLC A;  3AKZ A;  2EA2 A;  2OPT A;  2M5W A;  2Q0O A;  3BR0 A;  1MDM B;  1DP7 P;  2FEZ A;  4I01 A;  4G9Y A;  2NNY A;  2RGV A;  2PI0 A;  1WQ2 A;  3MWM A;  3FDY A;  2WTE A;  3H0G J;  4KIF A;  4CCL A;  3PNY A;  3L2W A;  1JXS A;  2FQ3 A;  3H3V K;  3CTA A;  2UV1 A;  3CDL A;  3I9V 2;  2C6Y A;  1U5T A;  4C3J J;  5ICC A;  2PJR A;  4IHT A;  2HDW A;  3W6V A;  2VBZ A;  1FP2 A;  4S05 A;  2WB1 N;  2NXN B;  3BJ6 A;  3M1E A;  4EJU A;  1W0T A;  3M7G A;  3HC7 A;  1XGO A;  1X1B A;  1DGR M;  2COM A;  3VFZ A;  5JFR A;  3HSF A;  5FRO A;  3WTX C;  2HS5 A;  1ZLK A;  2COB A;  1DQU A;  2E1M C;  1TP4 A;  4RGU A;  2NVX J;  5E17 F;  3OYN A;  3CZ6 A;  2JMW A;  2VN2 A;  4BXU A;  2HDC A;  2DTZ A;  1VQ5 I;  2DBB A;  3HOZ J;  1BOB A;  4KIB A;  4CHU A;  5B3S H;  3WHC A;  4XOP A;  1PUF A;  1W5T A;  3PNV A;  2VIX A;  3MZ8 A;  1MZB A;  2R0Q C;  1K4T A;  1H89 C;  2O6G E;  3ELK A;  1XMX A;  4BY7 J;  1F4K A;  1WJB A;  1ZK8 A;  5H20 A;  4ZYG A;  4A3C J;  2KL4 A;  2MGQ A;  2KHM A;  3TDU C;  3DTE A;  1U2W A;  4UUS B;  3T8R A;  3HOU J;  3IH4 A;  4BHC A;  5EEH A;  2PQ8 A;  1D5V A;  4Y52 J;  2GOX B;  1MMS A;  2MC3 A;  2R5Y A;  2DOF A;  1HW5 A;  4A0Y A;  3CCL I;  3B6A A;  4HPQ A;  5EYR A;  3WGG A;  2MH2 A;  5DM6 F;  3J80 Z;  4KNY A;  1RIO H;  3JSP A;  2QQ8 A;  3U2R A;  5BNG A;  2HEO A;  2LRD A;  4XLH A;  2B9S A;  2NOJ B;  5F1R A;  5BS6 A;  4QSH A;  1CQT A;  5J4Y A;  3K4M A;  2B63 J;  2W24 A;  4OAY A;  4B3A A;  1WJE A;  5HNH A;  2E35 A;  1P7I A;  2FE3 A;  3DFG A;  4V2F A;  1JJ6 C;  3H9G A;  1FPQ A;  3CUQ C;  1WCM J;  3BCA A;  4KIC A;  2HFH A;  4U0V A;  1OCT C;  3DEU A;  2R5Z B;  3K70 D;  3F0C A;  1O3T A;  2K3P A;  1G3W A;  2FBI A;  2EIM H;  2GZW A;  2R7R A;  4IO9 F;  5E3L A;  3LAJ A;  1U8B A;  3LSH A;  2DCE A;  2XGD A;  4M3G A;  3BCB A;  4GCV A;  2V1D A;  4XLP F;  3J81 Z;  2H27 A;  2FX0 A;  5ED4 A;  2K9S A;  2XRN A;  4XKC A;  2A6T A;  3P9C A;  4ESJ A;  1D1B A;  3K4J A;  3OYF A;  4QIW N;  1IXC A;  3LWF A;  2VOO A;  5D5X B;  3PUB A;  4HAM A;  3BZK A;  4XK4 A;  1MMA A;  3DQV C;  5LGU A;  4OIQ F;  1J0R A;  2JA7 J;  2DA7 A;  4V19 K;  5IP6 A;  1KZH A;  3SZT A;  4LK1 F;  1JUM A;  1I27 A;  3FK6 A;  4HV5 A;  2CFO A;  1UHW A;  2WAD A;  4DYR A;  4ZDO A;  2Z1D A;  3I3L A;  2HYF A;  3IUO A;  1ETK A;  2K40 A;  2VL8 A;  2XHK A;  4N9I A;  4E6K G;  1FBU A;  5IP7 J;  5EEG A;  4EAT A;  1IV6 A;  1QHH D;  5DTD A;  2R7T A;  3BZ6 A;  2HU9 A;  3JRH A;  2LBF B;  4ZYH A;  4IX7 A;  4M9Z A;  5D5W B;  1SC7 A;  4RB0 A;  3KP7 A;  3HTS B;  4NC6 A;  5B5E C;  1WH5 A;  1YQA A;  2M0C A;  1QA6 A;  2EQR A;  2JWT A;  2HDD A;  1OKR A;  2IXS A;  5B66 C;  4BL0 B;  2EV6 A;  2LH9 A;  3WTZ A;  4AIH A;  1E3P A;  4Q4Z F;  2ID6 A;  4U87 A;  3ZP5 A;  2KRC A;  1DGW Y;  1MMG A;  4KN7 X;  4D7N A;  2E2I J;  4A93 J;  1DDN A;  1KU2 A;  1XGM A;  3JAM Z;  1IW7 F;  3HYI A;  2BY2 A;  1UAA A;  2P6T A;  3SJM A;  5DCM A;  4AM3 A;  4D7M A;  4N4N B;  1XSV A;  2X1E A;  1KGS A;  4P9U A;  1PJR A;  3OIO A;  4M6Y A;  3BG7 A;  3I59 A;  2V79 A;  2HKO A;  5LHG A;  3P5J A;  2DI3 A;  3ZMZ A;  2IGK A;  5FFZ A;  2J5O A;  4C3I J;  3U9G A;  4EMS A;  2PMZ N;  2FML A;  5CLS A;  2ZFU A;  2L9V A;  2XDV A;  4CUG A;  2ZSI B;  4MEY F;  3C1D A;  2IRF G;  4JYK A;  3R6S A;  4A3L J;  2X48 A;  3S32 A;  4AVP A;  1HW2 A;  2XRL A;  1OR7 A;  4XNF A;  4LMY A;  3ZN0 A;  3L1P A;  1WWX A;  2QKM B;  2X1D A;  1BW5 A;  3E6D A;  4O5V A;  5JLW A;  2JRM A;  4RAF A;  2JA8 J;  5JHU A;  3HRT A;  3Q0U A;  3ZQ7 A;  4LJZ F;  1HSJ A;  4XKW A;  4Y17 A;  2BXZ A;  2NVU B;  4BEH A;  2JSP A;  1ZN2 A;  3MVP A;  4HX7 A;  2KIS A;  1ZG5 A;  2D1H A;  2CU7 A;  5GAD J;  2DDB A;  1IN4 A;  3HRU A;  4XON A;  2WAQ N;  5IOZ A;  5FLX Z;  1LUJ B;  1HKS A;  3LST A;  3VSL A;  2HWV A;  1WJF A;  5H2F C;  1RC9 A;  2P5V A;  2AXL A;  1FYM A;  3IAS 2;  3OR1 C;  3Q0V A;  1EA3 A;  1RKW A;  3BTI A;  3L00 A;  5E8G A;  5J8F A;  4FX4 A;  5M3M J;  5DUI A;  3I4P A;  2QF7 A;  4EJV A;  3WG7 H;  2NVQ J;  1OQY A;  4HLY A;  2IS6 A;  2LD5 A;  3RKX A;  4HDU A;  4NB5 A;  1VZ0 A;  3WGI A;  3PM1 A;  1XMA A;  4EM1 A;  2KMU A;  4RAZ A;  4XLF A;  9ANT A;  4A3B J;  2G7H A;  2EFQ A;  4UVA A;  2ICW G;  2RQQ A;  2VC1 A;  2Z5U A;  4P55 A;  4WCG A;  5J1U A;  1UST A;  2L7Z A;  2MW8 A;  3G1M A;  4AUX A;  3GTQ J;  2ME0 A;  3IAM 2;  1J59 A;  4E7J A;  2G7U A;  5IPA A;  3GTM J;  2V1N A;  4HNU A;  3GTL J;  4BJ5 C;  1QVU A;  1D3Y A;  2I10 A;  2BYV E;  2V1X A;  1VQ7 I;  2JK3 A;  4E70 A;  4JX6 A;  3K9T A;  1XCB A;  5FD6 A;  3FXU A;  2STT A;  3RYP A;  4M6V A;  1MD0 A;  2LY2 A;  5D8L B;  3FM5 A;  4HBL A;  2QEX I;  2QYO A;  3KLN A;  2OTJ I;  2HQR A;  1R7J A;  4YEL A;  4XSX F;  1REP C;  4V2G A;  5A2Q Z;  3HZJ A;  1MIJ A;  1QRY A;  1FOX A;  1SFX A;  2UWM A;  4EM2 A;  2FUG 2;  3OIP A;  5CYV A;  2CUZ A;  4HOB A;  4RGR A;  4WX9 A;  2O3F A;  1RRJ A;  4KYW A;  2MA3 A;  2HYJ A;  5GAG J;  4B43 A;  1F9N A;  2NRA C;  1CF7 A;  3W2W A;  3IP4 B;  2HOE A;  2ISY A;  3JRB A;  3VPR A;  3HGY A;  5E1W A;  4DGW B;  1FOK A;  4AIK A;  3E0J B;  3ESW B;  2DFE A;  1BIA A;  2FF4 A;  1DPR A;  3ASN H;  3R4K A;  3HUG B;  4U0W A;  5HNF A;  1Z1D A;  2NOG A;  1MBF A;  1IV8 A;  4LK0 F;  2ZNZ A;  2XF5 A;  1K6O A;  4L9J A;  2WAF A;  2JJ7 A;  3VYU B;  4A3E J;  2DK8 A;  3N97 A;  3S8P A;  3WE3 A;  1BJA A;  5BOX A;  3Q0W A;  4LD5 A;  4HST A;  2BHZ A;  3CJR B;  3I4N J;  3EQL F;  1U9O A;  5D4R A;  1YRN A;  3CLQ A;  4P96 A;  2KDO A;  2P6S A;  3FM3 A;  2FJ1 A;  2W85 A;  2PG4 A;  1R49 A;  3K2Z A;  4CCO A;  1O4X A;  4R8H A;  1SMT A;  1SD7 A;  2DJN A;  2EIK H;  4Y33 A;  4BDY A;  4BQO A;  5IYD J;  3CDH A;  1ZAO A;  4AD9 A;  3RZO J;  4HDV A;  4BE2 A;  5KCM A;  4KJZ A;  2IVM A;  1MDM A;  2JA5 J;  4TV7 A;  2XF7 A;  2HXO A;  3NAR A;  3G4S I;  3QOE A;  3BTL A;  1SFK A;  1W1W E;  4N4O B;  3HRM A;  2Y0S N;  2K02 A;  1UHM A;  3BTJ A;  1SAU A;  4G94 A;  5AIQ A;  5ICF A;  2QUF A;  1P4W A;  2FU4 A;  2HQ5 A;  5K7F A;  3KLO A;  4A3I J;  1YO5 C;  2Y48 A;  2UZK A;  3BR2 A;  4UHT A;  3OYJ A;  3SEQ A;  4G7O F;  1TL8 A;  3GO5 A;  1R6R A;  1IGN A;  4WXD A;  4XBF A;  1JKO C;  1DPU A;  5ERI A;  1X1P A;  1B72 B;  1QHG A;  1S5L C;  2CWE A;  4L0Z B;  2GAU A;  1ETO A;  2LF7 A;  1R1U A;  1JHH A;  2R7O A;  3GFM A;  4C3H J;  2ISZ A;  1XGN A;  4YFN F;  3F8N A;  4CGZ A;  3S2D J;  4IOA F;  5L3E A;  4CXF A;  3GTP J;  3PIO F;  4IRI A;  1QBJ A;  4MHG A;  1VQ8 I;  5F0F A;  1ZRD A;  4J00 A;  5CVU A;  2GXG A;  3K0L A;  3LSM A;  1WI9 A;  1XG1 A;  2L02 A;  2W48 A;  1RR7 A;  5D5U B;  2DU9 A;  5E1X A;  1LFB A;  2L9R A;  4ENJ A;  2MD5 A;  3AG3 H;  2I8D A;  3FKI J;  1ZYR F;  2Y9Z A;  3K7A J;  3PNT A;  3IKT A;  1I50 J;  1N77 A;  4UUS A;  3CJT B;  2VON A;  3FMQ A;  1RZ4 A;  3DKX A;  3S15 J;  1A04 A;  2DO7 A;  2F4O B;  3MAJ A;  1T6S A;  4ABZ A;  4GGG A;  2OZ6 A;  1RPW A;  3B73 A;  5TRD A;  2F4M B;  1OJL A;  4RDU A;  4RA2 A;  5IT9 K;  5ILU A;  1XCV A;  5F27 A;  3FHN A;  4BGD A;  1I1S A;  3J7A O;  2X1C A;  3ZQH A;  2EZH A;  1NK2 P;  1R1V A;  3OYK A;  5L3B A;  4MNU A;  4JK1 X;  3CMA I;  2ADU A;  2P5K A;  2RDP A;  3DV8 A;  3S1N J;  3WG9 A;  4BUP A;  5ILV A;  4AIJ A;  3N05 A;  2LKS A;  4GXO A;  4BYY A;  1S7A A;  3OYB A;  2R92 J;  2MLK A;  2R5Z A;  2M45 A;  2IA2 A;  2DJI A;  2D2W A;  2YX7 A;  1ZHF A;  4HX8 A;  4X1E A;  5KAI C;  3G2B A;  3RPU D;  3W2V A;  5HS8 A;  2VE9 A;  1NG7 A;  1FSH A;  2F4I A;  4BHP A;  3FMS A;  4P1W A;  1HLV A;  2DMN A;  4YIF A;  1WH7 A;  1BJZ A;  1HCR A;  5GPA A;  3HG9 A;  5IY5 H;  3KEQ A;  3RPU A;  3O6B B;  2M34 A;  2Z99 A;  3LMM A;  4MTE A;  2M8E A;  4B48 A;  3OYA A;  2F6C A;  3F22 A;  3F21 A;  1ACI A;  2GA2 A;  4BH9 A;  1D1C A;  3OWT A;  3CCR I;  3FXM A;  2HPI A;  1U0J A;  2XPW A;  2KIU A;  2QSG X;  2XAF A;  3KX2 A;  2KP6 A;  4S04 A;  2VOP A;  3RI4 A;  1KQ8 A;  1Y8Q B;  2O61 A;  2QM3 A;  5JVG F;  3M9A A;  1OCP A;  5HDN A;  1Z6R A;  2PX9 A;  3OYH A;  3Q9S A;  4FT8 A;  2F48 A;  1VQP I;  5JLX A;  3SZG A;  4LIV A;  5F08 A;  4HG2 A;  2LBF A;  3M1C A;  2OQR A;  4HA8 A;  4UUT A;  3NEU A;  2HVS A;  4EQQ A;  3G1L A;  1V5G A;  2LTP A;  4H0E A;  4IHW A;  1ETQ A;  3SDG A;  4IHV A;  1IUY A;  4CH7 A;  1AA7 A;  5KNL A;  1YTY A;  3SFI A;  4NQW B;  3MFK A;  2AQF A;  1AOY A;  1X3Z B;  3DEE A;  2QA4 I;  3CJQ B;  3PFI A;  2L3D A;  1IRG A;  2VJJ A;  1XTA A;  2W4S A;  2IBD A;  2VQC A;  3RKQ A;  2AO9 A;  3IKV A;  3E6B A;  1I6H J;  2X6X A;  1HOM A;  3RSN A;  4OIR F;  1ITY A;  1Z3Y A;  2E71 A;  3QU6 A;  3DBL B;  2DA6 A;  2PN6 A;  2KIQ A;  3LSG A;  3D5S C;  1ZEL A;  2PFB A;  4ANJ A;  3HRS A;  3GFJ A;  2IS4 A;  1JT6 A;  3FBI B;  3NRV A;  3LNQ A;  3HOV J;  4DBR A;  4M71 A;  4GDF A;  3FBN B;  3S3M A;  4L9V A;  2ESN A;  1YJN I;  1YW7 A;  2XKP A;  2ZXH A;  5GAH J;  3AAF A;  5J8C A;  2XAU A;  1TT5 B;  3AG2 H;  4ZDL A;  2PMH A;  2P5L C;  4PFP A;  3QWL A;  2K4J A;  1WPK A;  4ESF A;  3K2A A;  1VQK I;  2VQG A;  4XSZ F;  2JRT A;  5LHH A;  3E97 A;  2MSY A;  2QWW A;  1FIP A;  4IQ4 A;  4E7K A;  2QEN A;  1LFU P;  2QSF X;  4RLQ A;  1ZG3 A;  1R4M B;  2E1N A;  5BPD A;  3PIP F;  1S3J A;  3U21 A;  1G59 A;  2VXD A;  4F92 B;  3A01 B;  4HX4 A;  2HYG D;  4GYI A;  4I0B A;  1XSX A;  1JKR C;  5TGT A;  5EDN A; 
#chains in the Genus database with same CATH homology
 2CV1 A;  3A1Y A;  2MD0 A;  4ZYA A;  3L2R A;  3ONQ A;  2CFO A;  2WAD A;  2MYS A;  4ZDO A;  2Z1D A;  3I3L A;  3IUO A;  2BOL A;  2R7V A;  3HXL A;  2DT6 A;  2VL8 A;  4E6K G;  3VYR B;  2WAE A;  3RCO A;  2IS2 A;  4J01 A;  4EAT A;  2R7T A;  1QHH D;  2VJI A;  3W3C A;  2HU9 A;  3PL8 A;  1S9H A;  3HPG A;  4CCM A;  1WFX A;  4F55 A;  2LBF B;  1YX3 A;  4IX7 A;  3UNG C;  2K9L A;  2ZSH B;  1D0Z A;  2OC6 A;  4CCK A;  4KIT B;  2IXS A;  4BL0 B;  3L2U A;  1X19 A;  2LH9 A;  3DTK A;  3OL3 A;  4U87 A;  2WAQ A;  3DU6 A;  2KRC A;  4CSW A;  1WJA A;  2MAB A;  3M8J A;  3ZR8 X;  4AU7 A;  1DGW Y;  1MMG A;  2K5C A;  4RM2 A;  1BR2 A;  1YX5 A;  3A2K A;  2CV2 A;  3K70 C;  2LY1 A;  3QYE A;  2CW8 A;  3CP2 A;  1UEL B;  4N4N B;  5CPR B;  2X1E A;  3FKJ A;  4F3Q A;  4PK4 A;  2CH0 A;  2V7F A;  2O5R A;  3EUH C;  2HZD A;  1Y56 A;  4PJL A;  1MMD A;  4IQJ A;  1PJR A;  2R4G A;  3BG7 A;  2VJ5 A;  4BXF A;  3LSI A;  3OOU A;  4ZJZ A;  3DPL C;  3C2G A;  2IGK A;  1D1A A;  2XF6 A;  3C2H A;  3MD2 A;  3AL0 C;  1Z7L A;  2W82 A;  2ZFU A;  4CUG A;  2XDV A;  3L2V A;  2ZSI B;  1GLN A;  3J7A Y;  3DLA A;  2X6Y A;  2RNG A;  2E60 A;  3OL4 A;  3S32 A;  4ITV A;  4XNF A;  1V5E A;  2X1D A;  2QKM B;  2LC2 A;  4DBQ A;  2V6E A;  2VKD A;  4XLA A;  4B44 A;  2R7S A;  3PSI A;  2X51 A;  2CS3 A;  4MLO A;  3DKY A;  1D0X A;  3H5R A;  4XKW A;  1MNE A;  2AQE A;  4HNT A;  5LD2 C;  4DIQ A;  4BEH A;  4YRV A;  3ZGK A;  2JSP A;  1WJD A;  3RQ4 A;  3HOS A;  2V26 A;  3BG6 A;  4E7L A;  4NC7 A;  3LSK A;  4C9Y A;  4XON A;  3OYM A;  3VSL A;  4BJ6 C;  2K9M A;  1WJF A;  2VLA A;  4DOZ A;  5HOO A;  4E7I A;  3AL0 B;  4BQQ A;  2L2O A;  3IAS 2;  3OR1 C;  1EA3 A;  1QU3 A;  2VKH A;  4H4K C;  4F93 B;  2ZXI A;  2WY7 Q;  4F91 B;  1E0E A;  4B47 A;  3HKZ A;  1G8X A;  4FAS D;  1V5F A;  3OYL A;  4B3X A;  3H9Q A;  2DOA A;  1MMN A;  2VJ4 A;  3OY9 A;  2IS6 A;  3VSK A;  3QYB A;  1VZ0 A;  3NWT A;  4XKV A;  2KMU A;  4XLF A;  2VB6 A;  2RQQ A;  3KYL A;  1OR7 C;  3LFU A;  2R7Q A;  2WY8 Q;  4KIS A;  3IAM 2;  4E7J A;  2V1N A;  4RM3 A;  4DJA A;  4NNJ A;  4BJ5 C;  4HNU A;  2OV7 A;  3ZCO A;  3L2Q A;  4AYB A;  2W1O A;  2M4G A;  1NG6 A;  4XOT A;  4Y3O A;  3DPT A;  3EUK L;  2MFZ A;  4LG3 A;  1FMV A;  2LY2 A;  3TMO A;  1OLT A;  3MKY B;  3H5A A;  4II3 A;  4PJM A;  4E7Z A;  4II2 A;  2BW3 A;  3DPU A;  4YEL A;  4JQF A;  4QPQ A;  1ERD A;  1LVK A;  3BLY A;  2CMP A;  4CCJ A;  2LOO A;  3VYT B;  3OS1 A;  2UWM A;  4BJT A;  2FUG 2;  3OIP A;  2Z16 A;  3W2A A;  3HPH A;  2CUZ A;  2Y0S A;  3PSF A;  2L7K A;  1FMW A;  2E5N A;  2UUZ A;  3OS0 A;  3EPZ A;  4E7S A;  4B43 A;  3W2W A;  3IP4 B;  2M7A A;  3OYG A;  2RRE A;  4X0G A;  4PUS A;  4XN0 A;  4BEH B;  3OMY A;  4BQN A;  4DGW B;  1P9Q C;  1X1D A;  4BE0 A;  1TZL A;  3SEZ A;  4NC8 A;  3VDX A;  3E0J B;  3MKZ A;  3CES A;  4E4H A;  5HNF A;  3HUG B;  2KQR A;  2JUG A;  2XF5 A;  2WAF A;  3VYU B;  1W36 D;  3UR3 C;  3S8P A;  2DT7 B;  2LRE A;  4BE1 A;  4XLE A;  3CP8 A;  4HST A;  3CJR B;  4PJN A;  2Q2E B;  3OS2 A;  5CQG A;  1DP3 A;  3NWS A;  1K6Y A;  2XC7 A;  3OYC A;  4PFO A;  4XR6 A;  2KDO A;  4PJJ A;  1J09 A;  2V4J C;  3K10 A;  3DTI A;  1WJ5 A;  2JVH A;  4CCO A;  2VAS A;  4Y4R A;  3PFY A;  2LG4 A;  4Y33 A;  4BDY A;  4BQO A;  3HOT A;  2M4K A;  2MC4 A;  5KCM A;  4BE2 A;  3S93 A;  2JVG A;  4RMN A;  4KJZ A;  1WJC A;  3K6G A;  3OYD A;  2XF7 A;  2X6W A;  3K4L A;  4OAZ A;  4CZC A;  3QOE A;  2VQH A;  1SFK A;  1T0F C;  4XN3 A;  1KON A;  2M0M A;  4N4O B;  4XM3 A;  4IKF A;  1N78 A;  2LYC A;  1SAU A;  4XMY A;  4PSX A;  2HNH A;  3RTR A;  3OYJ A;  4BU2 A;  4E7H A;  4XL9 A;  2JA2 A;  3SEQ A;  1R6R A;  4JOM A;  3ZQQ A;  4YEJ A;  3K4K A;  3CMM A;  2QKL B;  2A5W A;  5FRM A;  2CW7 A;  3MKW B;  2BW3 B;  1QHG A;  2W7N A;  2E1M B;  3TBI A;  2BVM A;  2VQL A;  4IZZ A;  2R7O A;  3VYS B;  5LFA A;  2HVR A;  2HQA A;  4HEA 2;  3QOD A;  3OYI A;  4G6T B;  1LKX A;  4NUB A;  3K4C A;  3DU5 A;  2CUJ A;  4J00 A;  4C30 A;  3LSM A;  2P0W A;  4ZC3 A;  3EUA A;  3VWB A;  1LFP A;  3H9J A;  1X1C A;  2OUM A;  2WB1 A;  1TT0 A;  2KRH A;  2I8D A;  3PJR A;  2WA0 A;  3AFH A;  3H0D A;  1BR1 A;  3PNT A;  1PYV A;  1N77 A;  3DKX A;  4RLF A;  3ZRG A;  3OIQ A;  2IGO A;  3BC8 A;  4BDZ A;  3S3O A;  3QYF A;  5FRN A;  3DWL E;  3MMY B;  4CCN A;  4D1Q A;  3F9K A;  3FHN A;  4BGD A;  3K4N A;  2X1C A;  1MND A;  5CQE A;  2HVQ A;  3H5N A;  3OYK A;  2X85 A;  2IS1 A;  3OYE A;  2GOM A;  3SDB A;  3E1S A;  2VPL A;  1YE9 A;  3H35 A;  2L5Q A;  3ZXS A;  4HRI A;  4BUP A;  3N05 A;  1X1A A;  3A4C A;  4QPO A;  3OYB A;  4C2T A;  2DJI A;  3RPU D;  3G2B A;  3W2V A;  2Z2S B;  1NG7 A;  3LL7 A;  2F4I A;  4XLC A;  3AKZ A;  3D5L A;  4OWR B;  3CF2 A;  4P1W A;  1X4P A;  5HVQ C;  3HG9 A;  3K4B A;  2V9K A;  2F5V A;  3FDY A;  3LMM A;  4XOR A;  1UG0 A;  2Q1Z B;  3PNY A;  3V42 A;  4B48 A;  4CCL A;  4U7B A;  3OYA A;  2F6C A;  3L2W A;  2R7X A;  2UV1 A;  3I9V 2;  1Z21 A;  1D1C A;  1Z3X A;  3OWT A;  2PJR A;  1D0Y A;  2HDW A;  4KT6 A;  2HPI A;  1U0J A;  3KX2 A;  2KP6 A;  3HL2 A;  3HC7 A;  5CKT A;  3OYH A;  1X1B A;  4F52 A;  1DGR M;  5FRO A;  2KPM A;  4XQF A;  3SZG A;  2HPM A;  4LIV A;  2CV0 A;  4HG2 A;  1DQU A;  2LBF A;  3M1C A;  2E1M C;  2HVS A;  4PSW A;  3OYN A;  3CZ6 A;  2IGM A;  1V5G A;  1LDK B;  1BOB A;  4C2U A;  4CH7 A;  1AA7 A;  2XSJ C;  4XOP A;  5KNL A;  4HSR A;  1IRX A;  4FET A;  5HLT A;  3KEY A;  3PNV A;  1JI8 A;  2VIX A;  3GBG A;  4NQW B;  2AQF A;  4GRI A;  3DEE A;  2M3A A;  3CJQ B;  1WJB A;  2KL4 A;  2KHM A;  2IGN A;  2VJJ A;  2W4S A;  2VQC A;  3DTE A;  4XKB A;  5JHF A;  2M7B A;  4D9J A;  4CA0 A;  2GOX B;  1N75 A;  3OR2 C;  2KZV A;  2X6X A;  3RSN A;  5KHD A;  1Z3Y A;  4R79 A;  2DXI A;  4HPQ A;  2R7W A;  2WBM A;  3LSG A;  3D5S C;  1ZEL A;  2LRD A;  4ANJ A;  2BVL A;  4XLH A;  2IS4 A;  2NOJ B;  3FBI B;  4DBR A;  1T95 A;  3K4M A;  3FBN B;  4OAY A;  1BR4 A;  3S3M A;  4ZDP A;  1X4O A;  3D5R C;  1WJE A;  4AVZ A;  5HNH A;  4LIT A;  1W36 C;  2ZXH A;  3H9G A;  3SYT A;  2VXZ A;  3BCA A;  4ZTJ A;  2XAU A;  4BAC A;  4ZDL A;  4LIU A;  3K70 D;  4PFP A;  2K3P A;  2L9N A;  4P5O A;  2R7R A;  1UAA A;  2VQG A;  3LSH A;  2DCE A;  4ZTF A;  3TL4 X;  3BCB A;  1MW7 A;  3S3N A;  4IQ4 A;  4XKC A;  2A6T A;  4E7K A;  1Y6I A;  1D1B A;  2W00 A;  3K4J A;  4RLQ A;  3OYF A;  3U21 A;  1G59 A;  2VXD A;  2E5Z A;  4BS9 A;  2L9S A;  4F92 B;  3PUB A;  2KLO A;  2R7U A;  1MMA A;  3DQV C;  2PJR B;  1HA8 A;  5TGT A;  2ELJ A;  2PMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...