3S1NJ

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1nJ00
2NS8A 1B72A 1JKQC 2KDZA 3FIWA 2R0QC 4MLOA 1I6HJ 1TWHJ 3BTLA 3S2HJ 2X6OA 2X9DA 1R9TJ 1ZGWA 3HGGA 3OSGA 3JRAA 1JKPC 2DJNA 1Z0XA 3JR9A 3RQIA 4JP0A 2YU9J 3C2BA 2E2JJ 3G1LA 2CRGA 2LVSA 4A3KJ 2K40A 4FE7A 4W97A 4V2GA 1XG1A 3BT9A 4C3HJ 2DN0A 1VFCA 3O8HA 3QPSA 2QCOA 2Y9YA 3GTGJ 1B8IA 3PO2J 3E7LA 2HXOA 4XK4A 3TW6A 5K7FA 4LOCA 1MBKA 3BR6A 3ZQGA 3HBLA 2JK3A 1ZTRA 1MSFC 1X2NA 3GTPJ 1BW6A 4MO7A 3BR2A 3K7AJ 1IC8A 1G2HA 1D5YA 3GBGA 3HOUJ 2N8GA 2DMQA 5F1JA 4UUSA 1WI3A 4ABZA 2M2EA 3A02A 3M3YJ 4A3MJ 1ZR4A 3LOCA 1HDDC 2OF7A 4NDLA 2D5VA 5DTDA 2XGDA 2WV1A 5EGOA 1NK2P 1RESA 1OFCX 1H8AC 1AU7A 1EF4A 1IDZA 1T56A 1OCPA 3B6AA 3OOUA 3F0CA 4C2MJ 5EG0B 1GT0C 4IHVA 1HOMA 2H8RA 1T33A 1ZKGA 5EZGA 2XGCA 3BR5A 4JYKA 2R5YA 5IYBJ 1XS9A 1X58A 5IPAA 2FQ4A 4IHWA 2L7ZA 2O7OA 3NARA 5J1YA 4M3BA 2DTZA 1JUPA 4DZPA 2ME6A 1QRYA 3RZOJ 1IUFA 3DEWA 5IP9J 3VPRA 2DA5A 4M6VA 4I76A 2ELKA 3RZDJ 5JLXA 2E2HJ 2VKVA 1MBHA 2HOAA 2LK2A 2XB5A 2NVXJ 4MIMA 1HCRA 5EYRA 1LE8B 1MBJA 1U8BA 1O4XA 4AUXA 1RPWA 2HXIA 1POGA 1PUFB 1ENHA 2JWTA 3JRFA 4JX6A 3QPLA 3D1NI 2NVQJ 4BXXJ 1ETWA 1U9NA 2CJJA 1ETXA 5C4JJ 5M5YJ 3FISA 5EF6A 2X48A 3S17J 1WH5A 1HF0A 2EZIA 3S14J 3FK7A 2K9NA 2VI6A 2Y9ZA 1IJWC 2R92J 2EZKA 4MFDA 1RETA 2GBYA 2JMWA 2LP0A 3OSFA 4FCYA 3TEDA 1UMQA 1OCTC 4A3LJ 3GTQJ 2HYJA 3G1MA 5GPCA 3BR0A 2YUSA 3BTJA 2HOSA 3Q3SA 1ZR2A 1IV6A 5IP6A 3A03A 2VPRA 5FLMJ 1JUMA 1LFUP 4FE4A 1MH4A 4A3IJ 2M34A 2QF7A 1ETKA 1JJ8C 3S1MJ 2M8GX 3SDGA 1NTCA 3IV5A 4A3JJ 1RKTA 5M3MJ 3HB9A 1P7IA 2IBDA 3TP0A 5M3FJ 5E3LA 1BJZA 5E3NA 2XPUA 1U78A 4A3EJ 2RAEA 2CQQA 3JRCA 5E3OA 1MH3A 4X1EA 3MKLA 4D7MA 2CU7A 4XRSG 4X6AJ 3WHBA 4XRMA 3NAUA 2DA6A 1JT0A 3PO3J 4C3JJ 3QQAA 3A01B 4D5FA 9ANTA 1WGXA 5EG0A 1MBFA 3ZQFA 5F04A 3GTLJ 3I4MJ 4B1RA 3ZQLA 2R7ZJ 4D5CA 5EZHA 4B4CA 2Y2ZA 5IOYA 3DCFA 5K7HA 1BA5A 4FTHA 4M3GA 4FISA 4QIWN 1E3OC 2L7MP 1IDYA 3L1PA 5FJ8J 3OIOA 5F0FA 5J3LA 4BY7J 3O8GA 3I4NJ 3LSPA 2O8KA 2NVYJ 2M9HA 4EEFG 3HGYA 2L9RA 3UKGA 1FIAA 3BTIA 2M0CA 3JRBA 1JUSA 1FIPA 2EBIA 2R5ZB 1LE8A 1ORKA 1FTZA 1MSEC 1I3QJ 3CDLA 3H3VK 5FKMA 3FK6A 1AKHB 3MVPA 1CQTA 4M3EA 1PUFA 3TW7A 5J1RA 1QPIA 1Y1VJ 2MGQA 3BG5A 4DYRA 1ETVA 4V2FA 2NVTJ 5FKLA 2MG4A 3CCYA 3LSGA 5C3EJ 2LTPA 5F08A 2COBA 2YS9A 3S15J 2AHQA 1VI0A 4QSHA 2JA6J 2LLKA 3GTMJ 1H89C 5C4XJ 1ITYA 1JKOC 4RBOA 3LSJA 2O9LA 1RR7A 1GV2A 2PMZN 3S1QJ 3S16J 1Z77A 3Q0WA 1U9OA 1HDPA 3JRGA 5IYCJ 2ME0A 2GLOA 2K9QA 2XPWA 3B6CA 3JRIA 2HDDA 1DU0A 2K9SA 1UHSA 1BW5A 2MSYA 3JREA 1MBGA 3IH4A 1VNDA 5EDNA 1S7EA 2VUMJ 2AO9A 2HQ5A 4BBRJ 1JTYA 5M5WJ 2Y30A 2E2IJ 3BQZA 1WH7A 3HDDA 3PM1A 3CQZJ 1Y1WJ 4CYCB 3WHCA 3ZQHA 3LSRA 1YRNB 1A6IA 2P81A 2EH3A 2CQXA 1ETQA 2JJ7A 2ECCA 2JA7J 2W48A 4A3CJ 1P7JA 2FD5A 4B3AA 1H88C 2DA1A 3BQYA 4L5EA 1IRZA 2IEKA 2ID6A 1X2MA 2Y0SN 3A01A 5JLWA 2DA7A 4AC0A 3HOVJ 5J1UA 2E19A 5GPAA 2DA4A 5C44J 5M5XJ 2XRLA 4A3DJ 2EZHA 2L0KA 3BG9A 3JRHA 1BL0A 5F0CA 1QVTA 2OPTA 5GP9A 5FKNA 1GUUA 3RKQA 4G12A 1ZK8A 2DA3A 1LFBA 1FJLA 2DMPA 2WAQN 1F36A 5BNGA 3W6VA 4A93J 4BY1J 2ID3A 1B72B 5FLVA 4XIDA 2R5ZA 4I6ZA 3K2AA 1HLVA 1WPKA 1JT6A 3FKIJ 1ZQ3P 4QTRA 2L7FP 1GDTA 1TC3C 1AKHA 2GM4A 1JKRC 5F0HA 1TWAJ 3TP3A 1OJLA 1GV5A 1IG7A 3BR1A 1Q1VA 2CUEA 4JX4A 3HKZN 2G0EA 2LR8A 5K7ZA 5DS9A 2DMTA 3MN2A 2FX0A 4A3BJ 4A69C 4DYCA 1APLC 4Y52J 1SANA 3HOYJ 3S1NJ 1B8IB 1W0UA 3ZQIA 1MNMC 1GVDA 3IH2A 2XSDC 3GTKJ 2IAIA 1ETOA 4Y7NJ 2DMNA 3SFIA 4DYQA 4J19A 5IP7J 1JGGA 2KT0A 2NOGA 1NK3P 2CUFA 4IEJA 1A5JA 1DU6A 2E1OA 2XB0X 3BR3A 3JRDA 4W1UA 1AHDP 1IGNA 1FTTA 2JN6A 4S0HB 1RKWA 4UUSB 2EQRA 2JA8J 3GTJJ 5F27A 5FKKA 2FJ1A 1SFOJ 2B63J 3HOZJ 3LNQA 5EGOB 3HOWJ 1TWCJ 1W0TA 4AYBN 2TCTA 4M3FA 1XC5A 1WCMJ 4CYCA 2ZB9A 2WB1N 1YRNA 3GTOJ 4RDUA 3S1RJ 3SJMA 5IOZA 2LKXA 1I50J 4MFEA 1K83J 2MW8A 4BBSJ 3HEFA 2TRTA 2R5YB 3H0GJ 1F43A 2XPVA 4XICA 3ZQCA 1FEXA 1JJ6C 1K61A 2HOTA 2VKEA 4BKXA 4IHXA 4DW6A 5EEAA 3HM5A 4JX5A 4IHYA 5E3MA 4D7NA 3G1OA 2LFBA 4GFBA 2ECBA 3Q0VA 2JA5J 2NS7A 1QVUA 4DZJA 3ZOBA 3Q0UA 3HOXJ 4C3IJ 3BG3A 1JTXA 5FKOA 2HI3A 1UG2A 2H1KA 2LY9A 1TWFJ 1VF9A 4A3FJ 3S2DJ 2LD5A 1ETYA 2EZLA 5IYDJ 1MBEA 3BTCA 2R93J 2I10A 2Y31A 4UUTA 4A3GJ 3CMYA 4M3DA 3M4OJ 1TWGJ 5HODA 2DA2A 2XGEA 3IH3A 4HNVA 2DMUA 4XRSA
chains in the Genus database with same CATH superfamily
1B4AA 3GXOA 5J8FA 4PGHA 4E7LA 3MD2A 4I98B 5IT9Z 1T39A 3FIWA 4CSWA 1HW1A 1VQMI 1I6HJ 1TWHJ 3OL3A 2X6OA 3CJRB 5HDKA 3BC8A 1U5TC 3JRAA 3BP8A 1G59A 4E7KA 2OZUA 4JP0A 3CTAA 4H4KC 4CA0A 4IRHA 1P4AA 4V2GA 4EATA 5BMZA 3PSIA 4U7BA 1XG1A 3BT9A 3NWSA 2DN0A 2H1LA 3K2ZA 3GTGJ 4CYDA 4I2OA 2EFOA 2WV0A 3TW6A 4KUMA 5K7FA 2EFNA 3R61A 3GWZA 3WG7H 3ZMZA 2E35A 5A2QZ 3KZIC 2PLYA 4B09A 1QZZA 1BW6A 2PMZA 3BR2A 1MNEA 2DU9A 2W1OA 3WTXC 3JAMK 4LG0A 3TOBA 3V8KA 1YE9A 1W5TA 2DMQA 4KIBA 4KFCA 4UUSA 1YS6A 2M2EA 4ABZA 4NDLA 5DTDA 3IAS2 4XR6A 5ILUA 1BJAA 1Z05A 3DF8A 1DP3A 1AU7A 1KGSA 2EIMH 3R0AA 1IDZA 3B6AA 3OOUA 4C2MJ 4IHVA 1LDKB 4EV0A 3HOTA 2H8RA 1T33A 4LB6B 3V8LA 3BR5A 3BZKA 3ZMDA 2DODA 2R5YA 5IYBJ 5J6XA 2VJ5A 3SZGA 4XSZF 2H94A 3IKTA 2O7OA 2HVQA 2A6EF 2DOFA 4OWRB 2KIMA 2BY3A 2MD5A 2DTZA 4G7HF 3DQVC 4DZPA 4ZYDA 1BOBA 2QA4I 1TQMA 2LKPA 3DEWA 4S04A 2FMYA 4I76A 2ELKA 1ZHFA 4HV5A 2DBBA 1D8KA 1X19A 2VBWA 2E2HJ 2VKVA 5JFRA 5L3BA 1VZ0A 1GXPA 1P4XA 4P55A 4FETA 2M7BA 5L3EA 3E6CC 2XB5A 2KHMA 1U5TB 5EYRA 2V9PA 4H0EA 3FF5A 5HVQC 4U88A 4XONA 2HDCA 4E7SA 1IF1A 2H09A 3DPTA 5ICFA 2EILH 1KU9A 1Y0NA 4HF2A 2UWMA 1J9IA 2HWVA 2IP2A 4Z6YA 1TNTA 1X3ZB 3ZMUA 4JX6A 3D1NI 1WWXA 2MD0A 2K9MA 1ETXA 2KJCA 3NQOA 3OS2A 2ZJRF 2FSWA 5DM7F 2E71A 3MEXA 5L3GA 2FBKA 1WH5A 1MJAA 5B66C 2F2EA 3K4JA 1SD5A 5JVGF 3FK7A 3H1CA 1J5YA 1IJWC 2R92J 4MFDA 1MGTA 2IA2A 1N25A 2M4GA 2JMWA 3LMMA 4F7ZA 3TEDA 1W5CC 3DKWA 3L7WA 2QENA 3GTQJ 2RNJA 3E3VA 3BPXA 2V1NA 3IKVA 2HOSA 5ED4A 3Q3SA 4UV9A 5IP6A 3JSPA 2VPRA 1FOKA 5HNHA 1FPQA 4BUPA 1W4MA 4EMSA 3I4PA 4I7HA 2P5KA 2M34A 1JE8A 1W7PB 3ZXSA 1UJ8A 3VYUB 3R60A 1A04A 1X1AA 2E60A 2M8GX 3SDGA 3DFGA 3HB9A 1T0FC 3M8FA 4XNFA 3TP0A 4PJ0C 3CCJI 2VONA 1O7LA 4G9YA 1X1BA 4GO1A 3W2VA 5E3NA 1FYLA 1FC3A 2CG4A 2CW7A 2QQ9A 4IJAA 1D5VA 3SQNA 1QZYA 2VXDA 3T1BA 2A5WA 5E3OA 1S72I 4OMYA 1UHWA 1G3SA 2DDAA 4YFNF 2X6XA 2BXZA 2ZSHB 1WVRA 2Q0OA 2L4MA 1SFKA 1ZARA 4G6DA 4XRMA 1HW5A 1LQ1A 1JT0A 3C2HA 3OYLA 2B7EA 3A01B 1HW2A 2GXAA 4RAZA 3EYIA 2CFXA 5FFXA 1KU2A 3E6BA 5EG0A 3GTLJ 2EWNA 1OPCA 3L2VA 5D8LB 1KQ0A 2LY1A 2R3SA 2K4BA 4UXNA 3AFHA 4NQWB 4FTHA 1DPUA 3COAC 4FISA 2HKXA 2L7MP 2HZDA 4B44A 1BIBA 5L3DA 5DV5A 2W84A 5LLQA 2H6CA 2IVMA 2ZJPF 4XOPA 2DW4A 2RQPA 4AIJA 2D2WA 4BL0B 4XLPF 3LSPA 3PNYA 5TGTA 3TDZC 4KYWA 4BJ6C 3HGYA 5ILVA 3AL0C 4DIQA 1FIAA 3MCZA 3BTIA 2LDUA 2UUZA 2WA0A 1V5GA 3JRBA 1DPRA 3IWFA 3O2PE 1E2XA 4EJUA 5DCFA 4PUSA 1MSEC 1Y0UA 3L2UA 4JK1X 1I3QJ 3H3VK 3WTSC 1MMGA 1XMXA 2VBXA 1PUFA 2DK5A 3VFZA 4U0VA 3BG5A 1ETVA 2HDWA 2I8DA 3CJQB 2XAFA 4FX4A 4YRVA 2COBA 1V3FA 3JCUC 3S15J 2FF4A 2AHQA 1S29A 2BBYA 2W7NA 2P6TA 1N75A 2H6BA 2BXYA 2M5WA 5C4XJ 3IP4B 1F1ZA 4ZZLA 2V1UA 3BZCA 2O9LA 1RR7A 2PMZN 2M7AA 2X6WA 2GQQA 4F93B 1TNSA 2P8TA 5K5RA 1G3YA 2K9SA 3CMMA 1DU0A 2PBIA 4YFKF 3K10A 1RRJA 3H5NA 3IH4A 1LEBA 4HF0A 1K78A 3J80K 2VUMJ 2AO9A 3LQRA 2VODA 4ITVA 3BQZA 2GOMA 1WH7A 5DEQA 4ZTFA 3M07A 3CQZJ 4G7OF 3ULQB 3ZQHA 2CGPA 1QA6A 1A6IA 4FX0A 2CQXA 1ETQA 2ACJA 1S7OA 2JJ7A 2F5FA 3H9QA 4A3CJ 2WAFA 1ACIA 2FD5A 3FXRA 4XLAA 1XN7A 4B3AA 4CDGA 4L5EA 1KU3A 3BQYA 1HKTA 2IEKA 1X4PA 2MLGA 4PDKA 2DTRA 3W6KB 4EJWA 1ON2A 1KA8A 5EEGA 2R7UA 2BZTA 3FM5A 2L2OA 3U2RA 4B47A 1HA8A 3HOVJ 4V19K 3AL0B 2E19A 4P96A 1LDJA 2QQBA 2QBYA 4B3XA 1EH8A 1R4NB 2ZBKA 4A3DJ 1MMSA 3FHZA 2IS1A 3HPGA 2NXNB 3HSEA 1VQLI 2M0MA 1VQOI 3W2AA 1HKQA 3FX3A 2VJJA 1WKMA 1G3WA 2K9LA 5LRSA 3CUQA 1GUUA 4BH9A 4KIGA 2B9SA 3RKQA 1WJFA 3CF5F 1LFBA 3S8PA 2DMPA 3ECHA 1K4SA 2WB1A 2QYOA 1FMWA 4A93J 1ERDA 1U6GA 5FLVA 2PEXA 3OYAA 3HSFA 2PMHA 3IAM2 5ERIA 3M9AA 1FLIA 1XGNA 2P5LC 4DBQA 4F52A 2JA2A 3DU6A 3K2AA 2B0LA 3D5LA 4BHPA 4EM0B 1WPKA 2NNNA 4I6ZA 1HBXG 1ZQ3P 3A1YA 2OZ6A 2FEZA 1FMVA 1RR8C 2OAZA 2LY2A 1JKRC 4R8HA 5F0HA 1JXSA 2IA0A 1OISA 2V9KA 4XMYA 2FBIA 1S6LA 1IXSB 3ECOA 2CUEA 5FO5A 4JX4A 3HKZN 1A31A 4HQMA 1TBXA 2LR8A 4YEJA 2Z2SB 3DKYA 2DMTA 4OAYA 5EJCA 2FX0A 2XV4S 5ICCA 4KT6A 2CV1A 3HOYJ 4N9HA 2PQ8A 1W0UA 1GXQA 5CPRB 1B8IB 3IH2A 5KAFC 1MNMC 3GTKJ 4FHTA 2MA3A 2DLLA 4L9VA 1ETOA 4Z2YA 1LDDA 2DFIA 4KICA 3JTGA 4E70A 2R7RA 4NNJA 2VPLA 3ZN0A 4BXUA 4XLCA 1W5SA 4A5NA 4IOCF 4A0ZA 2CYYA 4LD5A 1RIOH 4HLXA 4EM1A 1AHDP 4O3MA 4JBAA 1V5EA 4WXCA 3WE2A 2BE5F 3E5QA 2EQRA 4MTDA 3T5XA 2JA8J 5FKKA 2FJ1A 1NHAA 3ZR8X 1SFOJ 5LBQA 2ZXWH 4LIUA 4ESJA 2HQAA 2Q2EA 2DQLA 4HBLA 4NB5A 1JHHA 1XC5A 5JVTA 1CF7B 1SFEA 4CYCA 3U9GA 3OYNA 4IQ4A 3A2KA 3KZYA 4PSXA 2STTA 2UXXA 3S1RJ 1YW9A 1I50J 2HEOA 2MW8A 4BBSJ 4HX8A 3H3UA 1FP2A 5HLIA 5JHFA 3ZMSA 4XICA 4ZDLA 1QU3A 1JJ6C 5IT9K 2HOTA 2VKEA 1HXDA 3LA2A 4ZDPA 4M9ZA 3HM5A 3K4CA 5BOXA 5LHGA 4BEHB 4J00A 2HYFA 5E3MA 3G1OA 1MNDA 3F3XA 3K4NA 3LSMA 1B9NA 1D1AA 1QVUA 3ONQA 4DZJA 3HOXJ 2XSJC 2ZMEA 3FZVA 3MKYB 3H35A 3SHFA 4L0YB 2HI3A 1UG2A 1WFXA 2H1KA 4UV8A 4NBQA 4CO8A 3GW2A 3HRUA 3FXKA 2CH0A 3HPHA 5CYVA 2NYXA 1XMKA 1YOVB 3CMYA 3M4OJ 4OIOF 1TWGJ 2RQQA 5GADJ 3LSTA 5HODA 2XGEA 3KYDB 3SXYA 4HNVA 2NS8A 5A2QK 1B72A 2XAUA 1JKQC 2KDZA 4MLOA 2XRNA 4KDPA 3J80Z 1YX3A 3C18A 2WY7Q 4ENNA 4MTEA 1ZGWA 3F9KA 1R23A 1YJ9I 1E3PA 1ULYA 2QSFX 1JKPC 4XLFA 4HLYA 3RQIA 3MZ8A 2YU9J 3GEZA 3C2BA 2CRGA 2KIFA 2LRDA 3CJNA 2L9NA 1VQ9I 3DV8A 4A3KJ 1SD4A 4Q48A 1I5ZA 1ZLKA 3OYJA 1MMAA 1XCBA 2COMA 1VFCA 4HX4A 3WTYC 1H9TA 2P6SA 1BI3A 5J40A 2MLKA 3TL4X 3E6DA 3PO2J 3E7LA 1LEAA 3ASNH 2CW0F 3L2RA 2FBHA 2KISA 1MBKA 4UY8I 1Z6RA 3DBHB 2F5DA 2JK3A 1KZHA 3WU2C 1BR1A 1ZRDA 1MSFC 3BY6A 4EGZA 1XMAA 1X2NA 3O6BB 3LSHA 2H27A 3GTPJ 3A0HC 1NG6A 3K9TA 4U7DA 2X1CA 5DCMA 4FT8A 2MC3A 3QODA 3WTVC 1TW3A 2VN2A 1LJ9A 3GBGA 3FBNB 2LYCA 2Z16A 4HDUA 3A02A 3B73A 1ZR4A 2D5VA 2OF7A 4QPOA 5EGOA 1NK2P 4PCQA 1RESA 3QOPA 3PUBA 1EF4A 3N4MA 3AG2H 1T56A 4EM2A 1STZA 1OCPA 1A35A 1P4WA 4AIHA 1OMIA 1YIOA 3WGGA 1K6YA 4HOBA 4R79A 3GUDA 3DLLF 4RM3A 2HQRA 1YFHA 1PP7U 3H5AA 2XGCA 2BHZA 5LD2C 3GLLA 4I02A 1BC8C 1QQIA 1X58A 3E5UA 5J1YA 1XSDA 1TP4A 4DQ2A 4XL9A 1O3RA 1ZYRF 2LMDA 4OU0A 5FROA 4AVPA 1QRYA 4CCOA 3N97A 2STWA 4AVZA 1UAAA 2BV6A 1VQ6I 2DA5A 1FNNA 1WJDA 2ZNZA 5B1AH 4YG2F 2K02A 2HOAA 2VL8A 2ZXIA 1G4DA 3EPZA 2BVLA 4M6XA 1Z7UA 3ASOH 1LE8B 1U8BA 1CGPA 3KP4A 1FSHA 3I3LA 1X3UA 1FOYA 1RPWA 4MEYF 4HRIA 2CQNA 5HLTA 4CICA 2VE9A 2HXIA 2JWTA 4IPAA 3JRFA 3I54A 4BU2A 3PFYA 2CUJA 3QPLA 2W82A 1DGWY 2NVQJ 4QWQA 1BC7C 1ETWA 2CJJA 4CCKA 4BXXJ 5C4JJ 1UB9A 4EQQA 5M5YJ 4HYEA 5LFAA 3PJRA 2YSRA 3MZYA 3RDIA 3S17J 2WY8Q 1PUEE 4WCGA 1HF0A 2OC6A 1FSEA 2RVCA 4LITA 3IHUA 1MW7A 2BGCA 1X1CA 2QWWA 1OCRH 3VDXA 2JUCA 1SVOA 1V54H 4LG3A 2GBYA 2LP0A 4I01A 1IZ1A 3M1EA 2EIJH 5GPCA 2CS3A 2V1DA 2QZ8A 3KP6A 4UB6C 1ZR2A 1IV6A 2XHKA 4FE4A 4L9NA 1J2XA 2KP6A 5D4SA 2F5EA 1MMNA 2HFHA 2OUMA 2QF7A 4AU7A 2Z33A 2GA1A 3FMSA 1J0RA 1EV7A 1YI2I 1H9GA 5DUIA 3IV5A 3TOAA 1RZ4A 1P7IA 2IBDA 2LC2A 1Y56A 3F8MA 1AWCA 3LFUA 1U78A 5B5EC 2RAEA 2GXBA 2VJIA 1XD7A 2MH2A 2XGXA 4RB1A 1KONA 4XN3A 3PL8A 1IO2A 2JPBA 4GGGA 4X1EA 5CLSA 3OYKA 3MKLA 3H5RA 5LEJA 3V8JA 4X6AJ 2KIQA 3K70C 3HTSB 3OYDA 5JR3A 3WHBA 1EKEA 1R7JA 5E1XA 4IRIA 3A4CA 3QQAA 3BJOA 2XROA 3RKXA 1F4KA 3D0SA 3ZQ7A 4ESFA 5D5WB 4O6JA 4RLFA 2KRCA 1XPXA 3DTEA 3I4MJ 3ZQLA 3KE2A 4RAYA 4HNUA 1T2KA 4IZZA 3G71I 2VBYA 5IOYA 2V9VA 2JVHA 2LG4A 4M72A 4O5VA 3HXLA 1BR2A 1EA3A 4FQGA 3OIOA 3U21A 4LK0F 3O3KA 3EUHC 4BACA 3CCSI 5E8IA 4C2UA 3I4NJ 1OR7C 1V4RA 2BHYA 3WTTC 2EPFA 4A0YA 4IO9F 3CJTB 3DLAA 4G8XA 4ZYEA 2M0CA 1ON1A 1LKXA 1JUSA 4ZDOA 1U5TA 1X4OA 2R5ZB 2CMPA 1X1DA 2GIZA 1J75A 1J59A 1ORKA 1MJ9A 1ZG3A 3CDLA 5FKMA 3FK6A 1AKHB 3ZRGA 3QP6A 1R4MB 3M7GA 3GZ5A 3UNGC 1CQTA 4IL6C 2M8EA 3KEOA 2E1CA 2KZGA 4II3A 1GVJA 3VYSB 2MG4A 3LSGA 1R00A 1YITI 1O3SA 2I5UA 2YS9A 1N77A 4ASNA 2FMLA 2GIVA 1R71A 2HVRA 2EINH 4QSHA 2TDXA 2LLKA 2O0YA 1XSVA 1VQPI 3GTMJ 1H89C 1ITYA 2M45A 2PG4A 1JKOC 3RIRA 3LSJA 1GV2A 3D5RC 4BHBA 4KITB 3Q0WA 1I1SA 1OKRA 3PUFA 4YIIA 1R1TA 5LRRA 2FUG2 3JRGA 5BPDA 2XF7A 3B6CA 1XSXA 3JRIA 4Q4ZF 1W7PA 2UZKA 1NG7A 2LH9A 2MSYA 3RKYA 2R4GA 1RNLA 4ESBA 1S7EA 3GFMA 2RGVA 1GLNA 2ZJ2A 4BBRJ 3I0TA 1JTYA 5HOOA 1BI0A 5E18F 3GCMA 4EJVA 2E2IJ 4BQAA 3KYCB 3JSOA 1Y1WJ 3OL4A 4IHTA 2HR3A 5FRMA 1LVKA 3HKZA 1YRNB 2HYGD 5FRNA 2EH3A 1XDUA 3DBRB 3F72A 2JT1A 3BJ6A 2ECCA 3DTIA 4LK1F 3DXJF 4ENMA 2KFDA 1P7JA 2GOXB 3I59A 4E7JA 1IN8A 3BOQA 3VSKA 2O6GE 4PK4A 2Y69H 1UHMA 3RPUA 3F8NA 4L18B 4DGWB 4ENJA 1X2MA 2Y0SN 3A01A 1UG0A 3U1DA 2DA4A 5C44J 5D6EA 3F8BA 3BJAA 2FE3A 2XF6A 3FMQA 4E6KG 3L00A 4NQWA 3BG9A 4L5JA 1SVMA 4BNCA 2R7SA 4NHJA 3QU3A 3I59B 5F0CA 3OWTA 3I53A 2OPTA 4EJOA 5J47A 5LGTA 4IKFA 2K7LA 2DA3A 1D0YA 4A12A 2BYVE 5BNGA 5K5QA 3ABTA 3H36A 4MHGA 4G6TB 1NH3A 1Y8RB 4OIQF 2Z9OA 2QVOA 2EFPA 1HLVA 1GDTA 2IPQX 1T98A 2GWRA 3FXJA 6PAXA 1SD7A 3SZTA 4HEA2 1WSUA 3SDBA 2IS2A 3HUGB 2JRMA 1R6RA 1Z6TA 5IY5H 1Q1VA 2DXIA 2IA1A 2K27A 2VXZA 5DS9A 3MN2A 2L7KA 1IN6A 4DYCA 2HKOA 1SANA 4EVIA 3P7NA 5KCMA 3S1NJ 3ZQIA 1GVDA 1P2FA 1T0FA 3N05A 2XSDC 3VYTB 2IAIA 2F5CA 3KEYA 4ZZDA 1FX7A 1R5ID 3AG3H 3G4SI 4KMUX 3J7YJ 5CQGA 5E17F 2HVSA 2KKOA 5E20A 4J19A 2WADA 4NUBA 1Z7LA 1O7FA 4U87A 4BDZA 2KT0A 2D1HA 3FXMA 4FASD 2CUFA 4IEJA 1NK3P 1A5JA 4CH7A 2O61A 4RGSA 4W1UA 2Z5UA 1FTTA 2JN6A 3WTUC 3PFIA 2HZTA 1RKWA 2XAHA 5L3FA 3TO9A 3PNTA 3HOSA 2XIGA 5K1YA 3R4KA 2DAOA 3NEUA 2VJ4A 5AONA 3LNQA 3BCBA 2BY1A 2FXAA 5E1ZB 4M3FA 4PSWA 2ZB9A 2GAUA 4BQOA 3GZNB 1TTYA 4XKVA 2M87A 3CP2A 4XLHA 4RB0A 4RDUA 2A6HF 5IOZA 2LKXA 3K69A 4MFEA 3HEFA 2TRTA 1F43A 3ZQCA 2G9WA 4RGUA 5J4YA 2KLOA 1SC7A 1XB4A 4IF4A 4GYGA 4IHXA 4DW6A 3EDPA 5EEAA 4G7ZF 1SD6A 3MFKA 1J7KA 4GFBA 2ECBA 1RC9A 4UVBA 3H0DA 2QQ8A 3ZOBA 4BYYA 5TRDA 4B43A 3ZPLA 2A69F 4ZYHA 3T0YA 3BG3A 2R7WA 3CC4I 3CCMI 3MMYB 1TWFJ 3OIPA 4A3FJ 3S2DJ 4MQVA 2AXTC 2EZLA 3K6GA 3LAJA 5IYDJ 3K4KA 3QYBA 3CLOA 2R93J 3ERED 2I10A 3ZQQA 4UUTA 4A3GJ 2A68F 2A5YB 4XLNF 1YLFA 4WXDA 2Z99A 3IH3A 1SMYF 2CW8A 5GAHJ 2Y0MA 3RYRA 2ZSIB 3G73A 1YX5A 2KL4A 3OS0A 2R0QC 3UR3C 2VIXA 2FU4A 2KRHA 5GTHC 2BW3A 5HNFA 2MBFA 2OD5A 1R9TJ 3S2HJ 2EK5A 3HGGA 3OSGA 2X51A 3QYEA 4BQNA 2PJRB 1OYWA 1Z0XA 4LMYA 3JR9A 2FA5A 2DOAA 3C3WA 3HIFA 3G1LA 2MYSA 2V6CA 3P9CA 3DEEA 4FE7A 1XX5A 2M3AA 5H6RA 2E36A 2CV2A 3PQJA 2PFBA 4A0XA 4C3HJ 1PDNC 2ZXJA 3O8HA 2QQAA 2Y9YA 1UCRA 2UXNA 1B8IA 2BW3B 2HXOA 2ISYA 2XAQA 4XK4A 4YELA 3RQ4A 5DD8A 4Q47A 2DPDA 3L2WA 4LOCA 3CC7I 1TLHB 3BR6A 3CDHA 3ZQGA 3Q5FA 3QPHA 3G2BA 1SAXA 1ZTRA 2WAEA 2ZC2A 4NC6A 1PYVA 3GO5A 4RS8A 1Z9CA 3ERMA 3RYPA 1IC8A 3ML6A 4L0ZB 1G2HA 4D0PA 2N8GA 3KPHA 2OA4A 5F1JA 1WI3A 2XAGA 4A3MJ 4S05A 1HDDC 4G6QA 3FM3A 2XGDA 3IUOA 2WV1A 5F64A 5KAIC 3J7AO 1SFUA 5HS7A 1H8AC 3CCQI 1R1UA 2K3FA 1ZELA 1CF7A 2JQ7A 2KQRA 4Y3OA 2W24A 2YU3A 4HZFA 2HTJA 1VQKI 3BROA 3I71A 5EZGA 2P0WA 1IN7A 3P9IA 3S3OA 4I0AA 3BG7A 2FQ4A 4IHWA 2L7ZA 4I0BA 1DQUA 3QWLA 1JUPA 3RZOJ 4BEHA 1OCZH 5IP9J 3VPRA 1E0EA 4L9JA 1O3TA 3RZDJ 4II2A 1BOAA 1ZGAA 2QLZA 2L4AA 2EA4A 4KA4A 1TW2A 4Y17A 3KETA 2MC4A 1TZLA 2LK2A 3CD6I 3AKZA 3VYRB 3BCAA 3HTUA 5FLXZ 2PX9A 1MBJA 3H9GA 1Y39A 2A07F 2ESHA 3CCRI 1S8NA 2NRAC 3OYGA 3L9FA 3KP3A 2R7DA 2XASA 1POGA 5DDGA 2ZNYA 2BOLA 1QBJA 2A05A 3BG6A 3KP7A 3ZMTA 2DFEA 2AQEA 3DP7A 3LQQA 1TQPA 3OYFA 3FISA 3LL7A 5EF6A 2X48A 2W4SA 1YW8A 3GFJA 3B02A 4HW0A 2EZIA 3S14J 1MDMB 2VI6A 2Q1ZB 1G8XA 1RETA 1FY7A 2CFOA 4A3LJ 2VE8A 4M6YA 3I9V2 2YUSA 3BTJA 2Y75A 2BY2A 2LBFB 1S5LC 1KU7A 2CQKA 2V79A 1DDNA 1LFUP 4UVAA 1MH4A 4A3IJ 5BPIA 1ZRCA 2OTJI 1QPMA 1JJ8C 5IT3A 3DTKA 3S1MJ 1NTCA 1RKTA 3CCEI 4HSTA 3I56I 4HX7A 5M3FJ 2XPUA 2F4OB 1DGRM 2CQQA 2P7VB 4Y33A 3GYHX 3KIOA 3JRCA 5CVIA 1MH3A 1D0XA 5LGUA 4D7MA 3M8EA 2CU7A 4ENKA 2HNHA 2IS4A 2WBMA 4ZC3A 4BJ5C 3NAUA 2DA6A 3OY9A 1PVEA 4WXHA 1I27A 2VKDA 2BY0A 3PO3J 4C3JJ 1UELB 3K1NA 5HDGA 4D5FA 4BDYA 1OLTA 1MBFA 3ZQFA 1Y8QB 5F04A 4I09A 4B1RA 3OYEA 2DDBA 2DT6A 4L9TA 5EZHA 4B4CA 3IWZA 3G3ZA 4WX9A 5F6FA 1USTA 3CO7C 1KYWA 4D9JA 4CXFA 4M3GA 1E3OC 4E7ZA 2QGUA 2ELHA 3U1KA 3FMRA 2V6EA 4KJZA 4XSXF 4OIPF 4F55A 5J3LA 2F6CA 1ZG1A 1RI7A 3O8GA 2O3FA 5DM6F 1BBYA 2W85A 1QGPA 1UZCA 4E7HA 4GYIA 1XGSA 2NVYJ 3A0BC 5CKTA 4EEFG 1I39A 2X6YA 3DWLE 1K4TA 3FXUA 2XKPA 2OQRA 4F3QA 3G6EI 2DQRA 1HKSA 2EBIA 4KN7X 1LE8A 3MAJA 3S32A 4WF2A 1WJAA 4PJJA 1JGSA 3V42A 1T6SA 1YS7A 2ADUA 4LLLA 3CO6C 4ANJA 2VT3A 2Y0SA 3MVPA 4M3EA 4LLNA 3TW7A 4DOZA 1SVLA 1TQIA 2WTEA 1B59A 4MNUA 2DFHA 4DYRA 2HPMA 4G94A 1SFXA 4OMZA 3W3CA 3CCYA 1IN4A 4XBFA 2RV8A 3DPUA 4XKCA 4B48A 1HSJA 3FWEA 3J7ZI 4RM2A 3AG4H 2KPMA 4KISA 2HQNA 1R1VA 3FDYA 3OIQA 1IAWA 3KFWX 4LFUA 5B3SH 1YW7A 3KLNA 1LVAA 3S1QJ 5IYCJ 5KHDA 4DJAA 2K9QA 2XPWA 2HDDA 1UHSA 1BW5A 5BS6A 1I3AA 4N4NB 3H9JA 4BXFA 1MBGA 3NWTA 4ZJZA 1VNDA 2IJLA 4ZYGA 1T95A 2Y30A 1ZAOA 2BVMA 3CLQA 3HDDA 3PM1A 3PIOF 4BE1A 3WHCA 2HU9A 1H0MA 3WU0A 4NC8A 5JHUA 4RGXA 3WODF 2P81A 4BHCA 1EH7A 1YTYA 1O3QA 5LHIA 3W2WA 2X4HA 4B8XA 2JA7J 3BPVA 1ODDA 3ABLH 4OINF 5BQTA 1T38A 1H88C 2DA1A 2F48A 1IRZA 3V7SA 4IX7A 4E4HA 2KIUA 5TISC 4A5MA 2CQ7A 5FFZA 3MKWB 1B9MA 1MD0A 2P4WA 2K5CA 3OR1C 4M74A 1R49A 2R7VA 2LF7A 3CMAI 2L9VA 3JRHA 1BL0A 2E1NA 3DPLC 4XKBA 4CZZA 5GP9A 3CUOA 5FKNA 3WGHA 4AIKA 4IOAF 4HDVA 1Z67A 3DU5A 4YIFA 3I58A 2VBZA 5CVVA 2LREA 2WAQN 3KEQA 4BE2A 3W6VA 4BY1J 5HS8A 4C2TA 2Y48A 4XORA 1RUOA 2XF5A 1LNWA 2XVCA 4XIDA 4UNOA 4RGRA 1U0JA 2W25A 2R5ZA 1FOXA 4XLEA 3EUKL 2VOOA 2KMUA 2L5QA 4P9UA 1C0WA 1LUJB 1S7AA 1AKHA 2VC0A 3PNVA 3MZHA 4BE0A 1TWAJ 2QKMB 2P5VA 4OOIA 3TP3A 5E8GA 1IUYA 2R7XA 2VOPA 5FGMA 2PI0A 2XAJA 2G0EA 2PMUA 3LA7A 1XGOA 4I99C 5K7ZA 2NS0A 2VQCA 2Z3YA 4A3BJ 1UFMA 4A69C 4CCLA 1APLC 4D1QA 3L2QA 4PGGA 4Y52J 2J5PA 2OV7A 3GX4X 1IV8A 3TBIA 3TGNA 3TO7A 2HGCA 4A2UA 5F1RA 1E17A 3L2CA 2JPCA 2IS6A 3JW4A 2L9SA 4U0WA 2DO7A 2DMNA 2DCEA 2BEOA 4DYQA 3PSFA 5K5OA 1QHHD 5IP7J 2DFFA 3J81Z 1JGGA 3VODA 2E1OA 3NRVA 3SEZA 4LG0B 3F22A 2XB0X 3BR3A 2IRFG 2FOWA 1BIAA 3Q9VA 3HC7A 1MIJA 4BAYA 2FOKA 2V4JC 4S0HB 4UUSB 3GTJJ 1G6NA 4RB2C 3OV8A 1HQCA 3HOZJ 4DNCA 1B6AA 3BDDA 1TWCJ 1BI2A 1SAUA 5H6QA 1WCMJ 2QEXI 5D5VB 5CJ9A 1P9QC 2C6YA 3TDUC 3VSLA 3CZ6A 1YRNA 1EH6A 3GTOJ 3GZ6A 1P92A 4CZCA 4GXOA 1K83J 1IXCA 2R5YB 3H0GJ 3WU1B 3I64A 2MFZA 2RC4A 3ZP5A 3CCVI 3EUHA 5H2FC 2V7FA 3VOEA 1OR7A 2G7UA 1WJ5A 4PFPA 1I6XA 4IHSA 3WG9A 4JX5A 3C7JA 1VQ5I 5D5XB 3GFLA 4IHYA 3ZN1A 2DT5A 4HPQA 5CVJA 2K4JA 3FHNA 2A3SA 3Q0VA 5LGNA 2VLAA 2GXGA 2DYRH 2YPRA 5HDNA 1OCCH 3CMEI 1VQ8I 3BLYA 2NVUB 3QAHA 3VWBA 4CUGA 4JQFA 3OYBA 3BTCA 2O5RA 2QUFA 4NC7A 1FWZA 2MH9A 2OCCH 3HZJA 1U2WA 3RTRA 2DA2A 1FT9A 1I1GA 2R7FA 5E1WA 3F8CA 3CC2I 4RAGA 3HL2A 2R7TA 3HG9A 3RPQA 3BTLA 5FD6A 2X9DA 1XGMA 2ZJQF 1J09A 2E7WA 5ICGA 2VB6A 3ISPA 2DJNA 4KIFA 1V55H 1E3HA 4QLCU 2LOOA 3TKYA 1IRGA 3HUGA 4LLGF 4UHTA 3FXLA 4YFXF 2E2JJ 1KQ9A 2CO5A 2EV0A 2LVSA 4ZTJA 3DKXA 1IN5A 2QKLB 4ETSA 2K40A 4W97A 2E1MC 3V4GA 2HOEA 3WE3A 3HYIA 2W00A 4KN4X 1R5HA 3QPSA 2QCOA 4F92B 1D1CA 1X1PA 2YX7A 4XRFA 3EQLF 5GAGJ 1ZN2A 3H3ZA 1L0OC 3HBLA 2AXLA 3VEPA 5E79C 4PFOA 3KX2A 4MO7A 3RSNA 3OYMA 1F9NA 3K7AJ 2GA2A 1LFPA 1D5YA 1F5TA 3HOUJ 2QSHX 1R22A 3OYHA 2DK8A 5KK1A 4CGZA 1W36D 3M3YJ 3BZ6A 3MQ0A 3LOCA 2PN6A 2A6TA 3RI4A 3SZPA 2CSOA 1HSTA 3CESA 1OFCX 1D0ZA 3WTZA 3GVAA 4IQJA 5FLXK 1BI1A 1IXRC 2MABA 3FKJA 4XKWA 2OTLI 2VT2A 2M30A 1D3YA 3F0CA 5EG0B 1GT0C 4WWCA 1HOMA 5HLHA 2DYSH 4Q5SF 1ZKGA 4IRGA 4DBRA 3HRSA 3K4MA 3MWMA 4JYKA 1O57A 4ZYAA 1XS9A 2EV6A 2W57A 5IPAA 3P9KA 4HSRA 1T08B 2HS5A 3NARA 3Q9SA 4KT5C 2UV1A 4M3BA 3LAPA 1DUXC 3RCOA 3C2GA 2ME6A 1OQYA 3HHHA 2OCEA 1IUFA 2OJED 5CVUA 3JAMZ 4RAFA 3WGIA 4M6VA 3KP2A 5JLXA 4M71A 1BM9A 1JI8A 1MBHA 1R5GA 1YYVA 4HAMA 1YIJI 2CV0A 4A6EA 1YJNI 3KP5A 1D1BA 2NVXJ 4MIMA 2QM3A 1HCRA 3ESWB 3T8TA 1XCVA 1O4XA 4C9YA 4AUXA 4TV7A 4RA2A 3TMOA 4EJTA 4Y13A 1KQ8A 4PJLA 3CP8A 3FBIB 1FP1D 3CUQC 1PUFB 1ENHA 3OOPA 2DJIA 2E1MB 1MMDA 3M1CA 2OBPA 1QNTA 5ICEA 4GCVA 2PJPA 2NOJB 4E7IA 1U9NA 2AQFA 1FOWA 1K6OA 1TL8A 2EFWA 1LPQA 1Z1DA 1VQ7I 4PZJA 1ZRFA 1AA7A 1WJBA 1Z91A 2HTSA 3BWGA 2RKHA 3M8JA 3F8FA 3REOA 3PIPF 2K9NA 2Y9ZA 2PJRA 2IGMA 2EZKA 2RNGA 1ONVA 2J5OA 3OSFA 4FCYA 3S3NA 1UMQA 1XDSA 2LNBA 1OCTC 1OYYA 2ZFWA 4XM3A 3QYFA 2HYJA 3G1MA 5DUKA 3ABUA 3BR0A 3ABMH 3HRMA 3S93A 2VQLA 3TO6A 4P1WA 3A03A 1RUNA 5FLMJ 2RDPA 1JUMA 2FQ3A 5HLGA 4GRIA 4U0YA 2LKSA 2F5VA 1Y6IA 1T8IA 2JRTA 1ETKA 4RB3C 1FZPB 2CWEA 2QSGX 2JVGA 4LIVA 1EJ9A 1K78B 4A3JJ 5M3MJ 1USSA 1HC8A 1K79A 5E3LA 1KYZA 1BJZA 2IGKA 2H8WA 4QPQA 3EYYA 2G7HA 4A3EJ 1LB2A 3JTHA 3K0LA 2X1DA 4OAZA 1W1WE 4KNYA 3HHGA 1FBSA 2KDOA 2F4MB 2VQHA 4PJMA 1VQNI 4BJTA 3R0JA 4XRSG 1L3LA 2DI3A 2HPIA 2XUBA 1PJRA 3E6MA 2ZCWA 5KNLA 2VKHA 5ILSA 3GMEA 5D6FA 4WK8F 1U8RA 5HS9A 4AYBA 5FD5A 9ANTA 3K1PA 1WGXA 5EEHA 1TT5B 2O03A 2ZXHA 2JSCA 2R7ZJ 2M1BA 2RREA 4D5CA 2P7CB 2QBYB 5J4VA 2VC1A 2M4KA 2Y2ZA 3DCFA 5K7HA 1BA5A 3E97A 4RMNA 1VQ4I 4QIWN 3SFZA 4PJNA 3CCLI 1IDYA 2L02A 3FXQA 1N78A 2EV5A 3L1PA 3CUQB 2ESNA 5FJ8J 5F0FA 4BY7J 1XTAA 2DPUA 2JSPA 4KMFA 4A6DA 3SEQA 2O8KA 3S2WA 2KZVA 3CF2A 4IVNA 2M9HA 2FNPA 2D1VA 2IGNA 2FRHA 2L9RA 3UKGA 2LF8A 4CCMA 1Z3YA 3QOEA 4XQFA 1FIPA 3E5XA 1A6QA 2IGOA 3L09A 2ZMEC 5L3CA 5CQEA 5LEKA 1OCOH 1FTZA 2OQGA 1ZG5A 3TQNA 4XOTA 5H20A 3QRFF 4RLQA 2OU2A 1ZREA 1OYIA 4R1HA 5GAEJ 5J1RA 1QPIA 1Y1VJ 2MGQA 2E5NA 3KCCA 1ZH5A 3RKWA 3V7RA 3MKZA 4V2FA 2YX4A 2ZFUA 5FKLA 2NVTJ 2O8XA 2JUGA 4L5IA 5C3EJ 4AWXB 2X0LA 2LTPA 3E0JB 5DYMA 5F08A 2ISZA 2X85A 5FB2A 4P9FA 1S9HA 4HQEA 3HSRA 3I55I 1VI0A 3H92A 3J7AY 1MDMA 1W36C 3K1MA 2JA6J 2ZKZA 2IXSA 4RBOA 1ZLJA 2L01A 2WAQA 3OR2C 3S16J 1Z77A 3AG1H 1QZEA 1U9OA 2LBFA 3LWFA 1HDPA 4JOMA 2DT7B 2ME0A 2GLOA 3OS1A 4M9XA 3CDIA 3JREA 4IXAA 1YHQI 2D45A 4XN0A 3ROUA 4GDFA 4HF1A 3OMYA 5D5UB 5D4RA 5EDNA 2HQ5A 2WC2A 4UVCA 5M5WJ 1IRXA 2Q2EB 1P6RA 3IRRA 1M1EB 1QO0D 1WJEA 4CYCB 4MEXF 2ETHA 3LSRA 1WRJA 2L54A 2ICWG 1WHUA 1A36A 2EB7A 3X2QH 2A61A 3K70D 2W48A 3DEUA 4N4OB 3I5UA 1BN5A 4Y15A 3FXOA 3EETA 2ID6A 1JHFA 3HJEA 2ELJA 3LSKA 2AS5F 5JLWA 2DA7A 4AC0A 5J1UA 3SYTA 1FBQA 2ZO4A 5GPAA 1Q1HA 1S3JA 5M5XJ 2XRLA 2EJRA 3IL2A 1MZBA 3EUAA 3ZMVA 2K86A 4CHUA 2EZHA 2ZMEB 3HRTA 2L0KA 4MGRA 2LSOA 4AD9A 1W7PD 1QVTA 4LGWA 3W6JB 3F21A 1SEUA 2E5ZA 5GTIC 2NAZA 2R7QA 3F6OA 5CVRA 2KRFA 3E1SA 4J01A 2V26A 3KLOA 1ZGJA 3ABKH 1ZK8A 4G12A 4K2EA 5D8KB 1YG2A 1FJLA 1F36A 4CCNA 4X0GA 3R6SA 4C30A 2ID3A 1B72B 2EFQA 2VASA 4Y4RA 2GZWA 1B1BA 3KZZA 1K7AA 5AIPA 4BS9A 3J81K 2YR2A 3LFKA 4HA8A 4M9SA 1IW7F 3T8RA 4UUVA 4P5OA 2JZYA 1JT6A 1TT0A 3FKIJ 4QTRA 2K85A 2L7FP 4EGYA 1TC3C 2IT0A 3RPUD 4HG2A 2GM4A 3ZGKA 1G3TA 1SMTA 1R36A 4ON0A 4BQQA 3K4BA 5KVRA 1OJLA 5J8CA 1GV5A 1IG7A 1FYKA 3BR1A 2EA2A 4BGDA 1YJWI 1FBUA 3F23A 4LJZF 2CUZA 1IRFA 1FYMA 4N9IA 3F6VA 3ZCOA 1V5FA 2X1EA 2E7XA 3P5JA 4LB5A 2EIKH 4Y7NJ 5LHHA 1MKMA 3SFIA 2R7OA 3LSIA 2V1XA 1AOYA 5TJJA 1Z21A 2NOGA 1DU6A 5JI6A 5DCMB 3V7CA 1GHCA 3JRDA 1IGNA 2K3PA 2XKOA 3OYCA 4HNTA 5B1BH 3RJPA 5F27A 4F91B 2DOEA 3VB2A 3AAFA 2B63J 4AM3A 2FNAA 5EGOB 3HOWJ 4UB8C 1WZ2A 1W0TA 4ZH4F 3QP5A 3QU6A 2RN7A 4AYBN 2TCTA 1YQAA 1D8JA 3ELKA 2WB1N 4YIRX 1MJBA 2NNYA 2Q8KA 3PQKA 3K4LA 1WI9A 1YO5C 3OYIA 3SJMA 3LA3A 1R58A 5DD4A 4N0BA 3WTWC 3DBLB 2XPVA 1FEXA 2IW5A 1K61A 4BKXA 2Z1DA 2KJBA 2XC7A 3GFIA 1WJCA 3QPTA 4D7NA 2F4IA 4M73A 1QHGA 1Z3XA 2LFBA 2VQGA 2WWYA 2JA5J 3KYLA 2NS7A 4CCJA 3Q0UA 2XDVA 3IRQA 4AIDA 4C3IJ 1REPC 1JTXA 3C1DA 5FKOA 1WQ2A 1DP7P 1PP8F 5AIQA 2LY9A 3S3MA 4OIRF 1VF9A 2LD5A 1ETYA 1VTNC 3GLXA 1MBEA 2E34A 1BR4A 2Y31A 1U3EM 2L3DA 4M3DA 3GF2A 4HV6A 1X3WB 2JTVA 3D5SC 3IC7A 4MQ9F 2DMUA 4XRSA 3CCUI
chains in the Genus database with same CATH topology
2NS8A 1B72A 1JKQC 2KDZA 3FIWA 2R0QC 4MLOA 1I6HJ 1TWHJ 3BTLA 3S2HJ 2X6OA 2X9DA 1R9TJ 1ZGWA 3HGGA 3OSGA 3JRAA 1JKPC 2DJNA 1Z0XA 3JR9A 3RQIA 4JP0A 2YU9J 3C2BA 2E2JJ 3G1LA 2CRGA 2LVSA 4A3KJ 2K40A 4FE7A 4W97A 4V2GA 1XG1A 3BT9A 4C3HJ 2DN0A 1VFCA 3O8HA 3QPSA 2QCOA 2Y9YA 3GTGJ 1B8IA 3PO2J 3E7LA 2HXOA 4XK4A 3TW6A 5K7FA 4LOCA 1MBKA 3BR6A 3ZQGA 3HBLA 2JK3A 1ZTRA 1MSFC 1X2NA 3GTPJ 1BW6A 4MO7A 3BR2A 3K7AJ 1IC8A 1G2HA 1D5YA 3GBGA 3HOUJ 2N8GA 2DMQA 5F1JA 4UUSA 1WI3A 4ABZA 2M2EA 3A02A 3M3YJ 4A3MJ 1ZR4A 3LOCA 1HDDC 2OF7A 4NDLA 2D5VA 5DTDA 2XGDA 2WV1A 5EGOA 1NK2P 1RESA 1OFCX 1H8AC 1AU7A 1EF4A 1IDZA 1T56A 1OCPA 3B6AA 3OOUA 3F0CA 4C2MJ 5EG0B 1GT0C 4IHVA 1HOMA 2H8RA 1T33A 1ZKGA 5EZGA 2XGCA 3BR5A 4JYKA 2R5YA 5IYBJ 1XS9A 1X58A 5IPAA 2FQ4A 4IHWA 2L7ZA 2O7OA 3NARA 5J1YA 4M3BA 2DTZA 1JUPA 4DZPA 2ME6A 1QRYA 3RZOJ 1IUFA 3DEWA 5IP9J 3VPRA 2DA5A 4M6VA 4I76A 2ELKA 3RZDJ 5JLXA 2E2HJ 2VKVA 1MBHA 2HOAA 2LK2A 2XB5A 2NVXJ 4MIMA 1HCRA 5EYRA 1LE8B 1MBJA 1U8BA 1O4XA 4AUXA 1RPWA 2HXIA 1POGA 1PUFB 1ENHA 2JWTA 3JRFA 4JX6A 3QPLA 3D1NI 2NVQJ 4BXXJ 1ETWA 1U9NA 2CJJA 1ETXA 5C4JJ 5M5YJ 3FISA 5EF6A 2X48A 3S17J 1WH5A 1HF0A 2EZIA 3S14J 3FK7A 2K9NA 2VI6A 2Y9ZA 1IJWC 2R92J 2EZKA 4MFDA 1RETA 2GBYA 2JMWA 2LP0A 3OSFA 4FCYA 3TEDA 1UMQA 1OCTC 4A3LJ 3GTQJ 2HYJA 3G1MA 5GPCA 3BR0A 2YUSA 3BTJA 2HOSA 3Q3SA 1ZR2A 1IV6A 5IP6A 3A03A 2VPRA 5FLMJ 1JUMA 1LFUP 4FE4A 1MH4A 4A3IJ 2M34A 2QF7A 1ETKA 1JJ8C 3S1MJ 2M8GX 3SDGA 1NTCA 3IV5A 4A3JJ 1RKTA 5M3MJ 3HB9A 1P7IA 2IBDA 3TP0A 5M3FJ 5E3LA 1BJZA 5E3NA 2XPUA 1U78A 4A3EJ 2RAEA 2CQQA 3JRCA 5E3OA 1MH3A 4X1EA 3MKLA 4D7MA 2CU7A 4XRSG 4X6AJ 3WHBA 4XRMA 3NAUA 2DA6A 1JT0A 3PO3J 4C3JJ 3QQAA 3A01B 4D5FA 9ANTA 1WGXA 5EG0A 1MBFA 3ZQFA 5F04A 3GTLJ 3I4MJ 4B1RA 3ZQLA 2R7ZJ 4D5CA 5EZHA 4B4CA 2Y2ZA 5IOYA 3DCFA 5K7HA 1BA5A 4FTHA 4M3GA 4FISA 4QIWN 1E3OC 2L7MP 1IDYA 3L1PA 5FJ8J 3OIOA 5F0FA 5J3LA 4BY7J 3O8GA 3I4NJ 3LSPA 2O8KA 2NVYJ 2M9HA 4EEFG 3HGYA 2L9RA 3UKGA 1FIAA 3BTIA 2M0CA 3JRBA 1JUSA 1FIPA 2EBIA 2R5ZB 1LE8A 1ORKA 1FTZA 1MSEC 1I3QJ 3CDLA 3H3VK 5FKMA 3FK6A 1AKHB 3MVPA 1CQTA 4M3EA 1PUFA 3TW7A 5J1RA 1QPIA 1Y1VJ 2MGQA 3BG5A 4DYRA 1ETVA 4V2FA 2NVTJ 5FKLA 2MG4A 3CCYA 3LSGA 5C3EJ 2LTPA 5F08A 2COBA 2YS9A 3S15J 2AHQA 1VI0A 4QSHA 2JA6J 2LLKA 3GTMJ 1H89C 5C4XJ 1ITYA 1JKOC 4RBOA 3LSJA 2O9LA 1RR7A 1GV2A 2PMZN 3S1QJ 3S16J 1Z77A 3Q0WA 1U9OA 1HDPA 3JRGA 5IYCJ 2ME0A 2GLOA 2K9QA 2XPWA 3B6CA 3JRIA 2HDDA 1DU0A 2K9SA 1UHSA 1BW5A 2MSYA 3JREA 1MBGA 3IH4A 1VNDA 5EDNA 1S7EA 2VUMJ 2AO9A 2HQ5A 4BBRJ 1JTYA 5M5WJ 2Y30A 2E2IJ 3BQZA 1WH7A 3HDDA 3PM1A 3CQZJ 1Y1WJ 4CYCB 3WHCA 3ZQHA 3LSRA 1YRNB 1A6IA 2P81A 2EH3A 2CQXA 1ETQA 2JJ7A 2ECCA 2JA7J 2W48A 4A3CJ 1P7JA 2FD5A 4B3AA 1H88C 2DA1A 3BQYA 4L5EA 1IRZA 2IEKA 2ID6A 1X2MA 2Y0SN 3A01A 5JLWA 2DA7A 4AC0A 3HOVJ 5J1UA 2E19A 5GPAA 2DA4A 5C44J 5M5XJ 2XRLA 4A3DJ 2EZHA 2L0KA 3BG9A 3JRHA 1BL0A 5F0CA 1QVTA 2OPTA 5GP9A 5FKNA 1GUUA 3RKQA 4G12A 1ZK8A 2DA3A 1LFBA 1FJLA 2DMPA 2WAQN 1F36A 5BNGA 3W6VA 4A93J 4BY1J 2ID3A 1B72B 5FLVA 4XIDA 2R5ZA 4I6ZA 3K2AA 1HLVA 1WPKA 1JT6A 3FKIJ 1ZQ3P 4QTRA 2L7FP 1GDTA 1TC3C 1AKHA 2GM4A 1JKRC 5F0HA 1TWAJ 3TP3A 1OJLA 1GV5A 1IG7A 3BR1A 1Q1VA 2CUEA 4JX4A 3HKZN 2G0EA 2LR8A 5K7ZA 5DS9A 2DMTA 3MN2A 2FX0A 4A3BJ 4A69C 4DYCA 1APLC 4Y52J 1SANA 3HOYJ 3S1NJ 1B8IB 1W0UA 3ZQIA 1MNMC 1GVDA 3IH2A 2XSDC 3GTKJ 2IAIA 1ETOA 4Y7NJ 2DMNA 3SFIA 4DYQA 4J19A 5IP7J 1JGGA 2KT0A 2NOGA 1NK3P 2CUFA 4IEJA 1A5JA 1DU6A 2E1OA 2XB0X 3BR3A 3JRDA 4W1UA 1AHDP 1IGNA 1FTTA 2JN6A 4S0HB 1RKWA 4UUSB 2EQRA 2JA8J 3GTJJ 5F27A 5FKKA 2FJ1A 1SFOJ 2B63J 3HOZJ 3LNQA 5EGOB 3HOWJ 1TWCJ 1W0TA 4AYBN 2TCTA 4M3FA 1XC5A 1WCMJ 4CYCA 2ZB9A 2WB1N 1YRNA 3GTOJ 4RDUA 3S1RJ 3SJMA 5IOZA 2LKXA 1I50J 4MFEA 1K83J 2MW8A 4BBSJ 3HEFA 2TRTA 2R5YB 3H0GJ 1F43A 2XPVA 4XICA 3ZQCA 1FEXA 1JJ6C 1K61A 2HOTA 2VKEA 4BKXA 4IHXA 4DW6A 5EEAA 3HM5A 4JX5A 4IHYA 5E3MA 4D7NA 3G1OA 2LFBA 4GFBA 2ECBA 3Q0VA 2JA5J 2NS7A 1QVUA 4DZJA 3ZOBA 3Q0UA 3HOXJ 4C3IJ 3BG3A 1JTXA 5FKOA 2HI3A 1UG2A 2H1KA 2LY9A 1TWFJ 1VF9A 4A3FJ 3S2DJ 2LD5A 1ETYA 2EZLA 5IYDJ 1MBEA 3BTCA 2R93J 2I10A 2Y31A 4UUTA 4A3GJ 3CMYA 4M3DA 3M4OJ 1TWGJ 5HODA 2DA2A 2XGEA 3IH3A 4HNVA 2DMUA 4XRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  1B72 A;  1JKQ C;  2KDZ A;  3FIW A;  2R0Q C;  4MLO A;  1I6H J;  1TWH J;  3BTL A;  3S2H J;  2X6O A;  2X9D A;  1R9T J;  1ZGW A;  3HGG A;  3OSG A;  3JRA A;  1JKP C;  2DJN A;  1Z0X A;  3JR9 A;  3RQI A;  4JP0 A;  2YU9 J;  3C2B A;  2E2J J;  3G1L A;  2CRG A;  2LVS A;  4A3K J;  2K40 A;  4FE7 A;  4W97 A;  4V2G A;  1XG1 A;  3BT9 A;  4C3H J;  2DN0 A;  1VFC A;  3O8H A;  3QPS A;  2QCO A;  2Y9Y A;  3GTG J;  1B8I A;  3PO2 J;  3E7L A;  2HXO A;  4XK4 A;  3TW6 A;  5K7F A;  4LOC A;  1MBK A;  3BR6 A;  3ZQG A;  3HBL A;  2JK3 A;  1ZTR A;  1MSF C;  1X2N A;  3GTP J;  1BW6 A;  4MO7 A;  3BR2 A;  3K7A J;  1IC8 A;  1G2H A;  1D5Y A;  3GBG A;  3HOU J;  2N8G A;  2DMQ A;  5F1J A;  4UUS A;  1WI3 A;  4ABZ A;  2M2E A;  3A02 A;  3M3Y J;  4A3M J;  1ZR4 A;  3LOC A;  1HDD C;  2OF7 A;  4NDL A;  2D5V A;  5DTD A;  2XGD A;  2WV1 A;  5EGO A;  1NK2 P;  1RES A;  1OFC X;  1H8A C;  1AU7 A;  1EF4 A;  1IDZ A;  1T56 A;  1OCP A;  3B6A A;  3OOU A;  3F0C A;  4C2M J;  5EG0 B;  1GT0 C;  4IHV A;  1HOM A;  2H8R A;  1T33 A;  1ZKG A;  5EZG A;  2XGC A;  3BR5 A;  4JYK A;  2R5Y A;  5IYB J;  1XS9 A;  1X58 A;  5IPA A;  2FQ4 A;  4IHW A;  2L7Z A;  2O7O A;  3NAR A;  5J1Y A;  4M3B A;  2DTZ A;  1JUP A;  4DZP A;  2ME6 A;  1QRY A;  3RZO J;  1IUF A;  3DEW A;  5IP9 J;  3VPR A;  2DA5 A;  4M6V A;  4I76 A;  2ELK A;  3RZD J;  5JLX A;  2E2H J;  2VKV A;  1MBH A;  2HOA A;  2LK2 A;  2XB5 A;  2NVX J;  4MIM A;  1HCR A;  5EYR A;  1LE8 B;  1MBJ A;  1U8B A;  1O4X A;  4AUX A;  1RPW A;  2HXI A;  1POG A;  1PUF B;  1ENH A;  2JWT A;  3JRF A;  4JX6 A;  3QPL A;  3D1N I;  2NVQ J;  4BXX J;  1ETW A;  1U9N A;  2CJJ A;  1ETX A;  5C4J J;  5M5Y J;  3FIS A;  5EF6 A;  2X48 A;  3S17 J;  1WH5 A;  1HF0 A;  2EZI A;  3S14 J;  3FK7 A;  2K9N A;  2VI6 A;  2Y9Z A;  1IJW C;  2R92 J;  2EZK A;  4MFD A;  1RET A;  2GBY A;  2JMW A;  2LP0 A;  3OSF A;  4FCY A;  3TED A;  1UMQ A;  1OCT C;  4A3L J;  3GTQ J;  2HYJ A;  3G1M A;  5GPC A;  3BR0 A;  2YUS A;  3BTJ A;  2HOS A;  3Q3S A;  1ZR2 A;  1IV6 A;  5IP6 A;  3A03 A;  2VPR A;  5FLM J;  1JUM A;  1LFU P;  4FE4 A;  1MH4 A;  4A3I J;  2M34 A;  2QF7 A;  1ETK A;  1JJ8 C;  3S1M J;  2M8G X;  3SDG A;  1NTC A;  3IV5 A;  4A3J J;  1RKT A;  5M3M J;  3HB9 A;  1P7I A;  2IBD A;  3TP0 A;  5M3F J;  5E3L A;  1BJZ A;  5E3N A;  2XPU A;  1U78 A;  4A3E J;  2RAE A;  2CQQ A;  3JRC A;  5E3O A;  1MH3 A;  4X1E A;  3MKL A;  4D7M A;  2CU7 A;  4XRS G;  4X6A J;  3WHB A;  4XRM A;  3NAU A;  2DA6 A;  1JT0 A;  3PO3 J;  4C3J J;  3QQA A;  3A01 B;  4D5F A;  9ANT A;  1WGX A;  5EG0 A;  1MBF A;  3ZQF A;  5F04 A;  3GTL J;  3I4M J;  4B1R A;  3ZQL A;  2R7Z J;  4D5C A;  5EZH A;  4B4C A;  2Y2Z A;  5IOY A;  3DCF A;  5K7H A;  1BA5 A;  4FTH A;  4M3G A;  4FIS A;  4QIW N;  1E3O C;  2L7M P;  1IDY A;  3L1P A;  5FJ8 J;  3OIO A;  5F0F A;  5J3L A;  4BY7 J;  3O8G A;  3I4N J;  3LSP A;  2O8K A;  2NVY J;  2M9H A;  4EEF G;  3HGY A;  2L9R A;  3UKG A;  1FIA A;  3BTI A;  2M0C A;  3JRB A;  1JUS A;  1FIP A;  2EBI A;  2R5Z B;  1LE8 A;  1ORK A;  1FTZ A;  1MSE C;  1I3Q J;  3CDL A;  3H3V K;  5FKM A;  3FK6 A;  1AKH B;  3MVP A;  1CQT A;  4M3E A;  1PUF A;  3TW7 A;  5J1R A;  1QPI A;  1Y1V J;  2MGQ A;  3BG5 A;  4DYR A;  1ETV A;  4V2F A;  2NVT J;  5FKL A;  2MG4 A;  3CCY A;  3LSG A;  5C3E J;  2LTP A;  5F08 A;  2COB A;  2YS9 A;  3S15 J;  2AHQ A;  1VI0 A;  4QSH A;  2JA6 J;  2LLK A;  3GTM J;  1H89 C;  5C4X J;  1ITY A;  1JKO C;  4RBO A;  3LSJ A;  2O9L A;  1RR7 A;  1GV2 A;  2PMZ N;  3S1Q J;  3S16 J;  1Z77 A;  3Q0W A;  1U9O A;  1HDP A;  3JRG A;  5IYC J;  2ME0 A;  2GLO A;  2K9Q A;  2XPW A;  3B6C A;  3JRI A;  2HDD A;  1DU0 A;  2K9S A;  1UHS A;  1BW5 A;  2MSY A;  3JRE A;  1MBG A;  3IH4 A;  1VND A;  5EDN A;  1S7E A;  2VUM J;  2AO9 A;  2HQ5 A;  4BBR J;  1JTY A;  5M5W J;  2Y30 A;  2E2I J;  3BQZ A;  1WH7 A;  3HDD A;  3PM1 A;  3CQZ J;  1Y1W J;  4CYC B;  3WHC A;  3ZQH A;  3LSR A;  1YRN B;  1A6I A;  2P81 A;  2EH3 A;  2CQX A;  1ETQ A;  2JJ7 A;  2ECC A;  2JA7 J;  2W48 A;  4A3C J;  1P7J A;  2FD5 A;  4B3A A;  1H88 C;  2DA1 A;  3BQY A;  4L5E A;  1IRZ A;  2IEK A;  2ID6 A;  1X2M A;  2Y0S N;  3A01 A;  5JLW A;  2DA7 A;  4AC0 A;  3HOV J;  5J1U A;  2E19 A;  5GPA A;  2DA4 A;  5C44 J;  5M5X J;  2XRL A;  4A3D J;  2EZH A;  2L0K A;  3BG9 A;  3JRH A;  1BL0 A;  5F0C A;  1QVT A;  2OPT A;  5GP9 A;  5FKN A;  1GUU A;  3RKQ A;  4G12 A;  1ZK8 A;  2DA3 A;  1LFB A;  1FJL A;  2DMP A;  2WAQ N;  1F36 A;  5BNG A;  3W6V A;  4A93 J;  4BY1 J;  2ID3 A;  1B72 B;  5FLV A;  4XID A;  2R5Z A;  4I6Z A;  3K2A A;  1HLV A;  1WPK A;  1JT6 A;  3FKI J;  1ZQ3 P;  4QTR A;  2L7F P;  1GDT A;  1TC3 C;  1AKH A;  2GM4 A;  1JKR C;  5F0H A;  1TWA J;  3TP3 A;  1OJL A;  1GV5 A;  1IG7 A;  3BR1 A;  1Q1V A;  2CUE A;  4JX4 A;  3HKZ N;  2G0E A;  2LR8 A;  5K7Z A;  5DS9 A;  2DMT A;  3MN2 A;  2FX0 A;  4A3B J;  4A69 C;  4DYC A;  1APL C;  4Y52 J;  1SAN A;  3HOY J;  3S1N J;  1B8I B;  1W0U A;  3ZQI A;  1MNM C;  1GVD A;  3IH2 A;  2XSD C;  3GTK J;  2IAI A;  1ETO A;  4Y7N J;  2DMN A;  3SFI A;  4DYQ A;  4J19 A;  5IP7 J;  1JGG A;  2KT0 A;  2NOG A;  1NK3 P;  2CUF A;  4IEJ A;  1A5J A;  1DU6 A;  2E1O A;  2XB0 X;  3BR3 A;  3JRD A;  4W1U A;  1AHD P;  1IGN A;  1FTT A;  2JN6 A;  4S0H B;  1RKW A;  4UUS B;  2EQR A;  2JA8 J;  3GTJ J;  5F27 A;  5FKK A;  2FJ1 A;  1SFO J;  2B63 J;  3HOZ J;  3LNQ A;  5EGO B;  3HOW J;  1TWC J;  1W0T A;  4AYB N;  2TCT A;  4M3F A;  1XC5 A;  1WCM J;  4CYC A;  2ZB9 A;  2WB1 N;  1YRN A;  3GTO J;  4RDU A;  3S1R J;  3SJM A;  5IOZ A;  2LKX A;  1I50 J;  4MFE A;  1K83 J;  2MW8 A;  4BBS J;  3HEF A;  2TRT A;  2R5Y B;  3H0G J;  1F43 A;  2XPV A;  4XIC A;  3ZQC A;  1FEX A;  1JJ6 C;  1K61 A;  2HOT A;  2VKE A;  4BKX A;  4IHX A;  4DW6 A;  5EEA A;  3HM5 A;  4JX5 A;  4IHY A;  5E3M A;  4D7N A;  3G1O A;  2LFB A;  4GFB A;  2ECB A;  3Q0V A;  2JA5 J;  2NS7 A;  1QVU A;  4DZJ A;  3ZOB A;  3Q0U A;  3HOX J;  4C3I J;  3BG3 A;  1JTX A;  5FKO A;  2HI3 A;  1UG2 A;  2H1K A;  2LY9 A;  1TWF J;  1VF9 A;  4A3F J;  3S2D J;  2LD5 A;  1ETY A;  2EZL A;  5IYD J;  1MBE A;  3BTC A;  2R93 J;  2I10 A;  2Y31 A;  4UUT A;  4A3G J;  3CMY A;  4M3D A;  3M4O J;  1TWG J;  5HOD A;  2DA2 A;  2XGE A;  3IH3 A;  4HNV A;  2DMU A;  4XRS A; 
#chains in the Genus database with same CATH topology
 1B4A A;  3GXO A;  5J8F A;  4PGH A;  4E7L A;  3MD2 A;  4I98 B;  5IT9 Z;  1T39 A;  3FIW A;  4CSW A;  1HW1 A;  1VQM I;  1I6H J;  1TWH J;  3OL3 A;  2X6O A;  3CJR B;  5HDK A;  3BC8 A;  1U5T C;  3JRA A;  3BP8 A;  1G59 A;  4E7K A;  2OZU A;  4JP0 A;  3CTA A;  4H4K C;  4CA0 A;  4IRH A;  1P4A A;  4V2G A;  4EAT A;  5BMZ A;  3PSI A;  4U7B A;  1XG1 A;  3BT9 A;  3NWS A;  2DN0 A;  2H1L A;  3K2Z A;  3GTG J;  4CYD A;  4I2O A;  2EFO A;  2WV0 A;  3TW6 A;  4KUM A;  5K7F A;  2EFN A;  3R61 A;  3GWZ A;  3WG7 H;  3ZMZ A;  2E35 A;  5A2Q Z;  3KZI C;  2PLY A;  4B09 A;  1QZZ A;  1BW6 A;  2PMZ A;  3BR2 A;  1MNE A;  2DU9 A;  2W1O A;  3WTX C;  3JAM K;  4LG0 A;  3TOB A;  3V8K A;  1YE9 A;  1W5T A;  2DMQ A;  4KIB A;  4KFC A;  4UUS A;  1YS6 A;  2M2E A;  4ABZ A;  4NDL A;  5DTD A;  3IAS 2;  4XR6 A;  5ILU A;  1BJA A;  1Z05 A;  3DF8 A;  1DP3 A;  1AU7 A;  1KGS A;  2EIM H;  3R0A A;  1IDZ A;  3B6A A;  3OOU A;  4C2M J;  4IHV A;  1LDK B;  4EV0 A;  3HOT A;  2H8R A;  1T33 A;  4LB6 B;  3V8L A;  3BR5 A;  3BZK A;  3ZMD A;  2DOD A;  2R5Y A;  5IYB J;  5J6X A;  2VJ5 A;  3SZG A;  4XSZ F;  2H94 A;  3IKT A;  2O7O A;  2HVQ A;  2A6E F;  2DOF A;  4OWR B;  2KIM A;  2BY3 A;  2MD5 A;  2DTZ A;  4G7H F;  3DQV C;  4DZP A;  4ZYD A;  1BOB A;  2QA4 I;  1TQM A;  2LKP A;  3DEW A;  4S04 A;  2FMY A;  4I76 A;  2ELK A;  1ZHF A;  4HV5 A;  2DBB A;  1D8K A;  1X19 A;  2VBW A;  2E2H J;  2VKV A;  5JFR A;  5L3B A;  1VZ0 A;  1GXP A;  1P4X A;  4P55 A;  4FET A;  2M7B A;  5L3E A;  3E6C C;  2XB5 A;  2KHM A;  1U5T B;  5EYR A;  2V9P A;  4H0E A;  3FF5 A;  5HVQ C;  4U88 A;  4XON A;  2HDC A;  4E7S A;  1IF1 A;  2H09 A;  3DPT A;  5ICF A;  2EIL H;  1KU9 A;  1Y0N A;  4HF2 A;  2UWM A;  1J9I A;  2HWV A;  2IP2 A;  4Z6Y A;  1TNT A;  1X3Z B;  3ZMU A;  4JX6 A;  3D1N I;  1WWX A;  2MD0 A;  2K9M A;  1ETX A;  2KJC A;  3NQO A;  3OS2 A;  2ZJR F;  2FSW A;  5DM7 F;  2E71 A;  3MEX A;  5L3G A;  2FBK A;  1WH5 A;  1MJA A;  5B66 C;  2F2E A;  3K4J A;  1SD5 A;  5JVG F;  3FK7 A;  3H1C A;  1J5Y A;  1IJW C;  2R92 J;  4MFD A;  1MGT A;  2IA2 A;  1N25 A;  2M4G A;  2JMW A;  3LMM A;  4F7Z A;  3TED A;  1W5C C;  3DKW A;  3L7W A;  2QEN A;  3GTQ J;  2RNJ A;  3E3V A;  3BPX A;  2V1N A;  3IKV A;  2HOS A;  5ED4 A;  3Q3S A;  4UV9 A;  5IP6 A;  3JSP A;  2VPR A;  1FOK A;  5HNH A;  1FPQ A;  4BUP A;  1W4M A;  4EMS A;  3I4P A;  4I7H A;  2P5K A;  2M34 A;  1JE8 A;  1W7P B;  3ZXS A;  1UJ8 A;  3VYU B;  3R60 A;  1A04 A;  1X1A A;  2E60 A;  2M8G X;  3SDG A;  3DFG A;  3HB9 A;  1T0F C;  3M8F A;  4XNF A;  3TP0 A;  4PJ0 C;  3CCJ I;  2VON A;  1O7L A;  4G9Y A;  1X1B A;  4GO1 A;  3W2V A;  5E3N A;  1FYL A;  1FC3 A;  2CG4 A;  2CW7 A;  2QQ9 A;  4IJA A;  1D5V A;  3SQN A;  1QZY A;  2VXD A;  3T1B A;  2A5W A;  5E3O A;  1S72 I;  4OMY A;  1UHW A;  1G3S A;  2DDA A;  4YFN F;  2X6X A;  2BXZ A;  2ZSH B;  1WVR A;  2Q0O A;  2L4M A;  1SFK A;  1ZAR A;  4G6D A;  4XRM A;  1HW5 A;  1LQ1 A;  1JT0 A;  3C2H A;  3OYL A;  2B7E A;  3A01 B;  1HW2 A;  2GXA A;  4RAZ A;  3EYI A;  2CFX A;  5FFX A;  1KU2 A;  3E6B A;  5EG0 A;  3GTL J;  2EWN A;  1OPC A;  3L2V A;  5D8L B;  1KQ0 A;  2LY1 A;  2R3S A;  2K4B A;  4UXN A;  3AFH A;  4NQW B;  4FTH A;  1DPU A;  3COA C;  4FIS A;  2HKX A;  2L7M P;  2HZD A;  4B44 A;  1BIB A;  5L3D A;  5DV5 A;  2W84 A;  5LLQ A;  2H6C A;  2IVM A;  2ZJP F;  4XOP A;  2DW4 A;  2RQP A;  4AIJ A;  2D2W A;  4BL0 B;  4XLP F;  3LSP A;  3PNY A;  5TGT A;  3TDZ C;  4KYW A;  4BJ6 C;  3HGY A;  5ILV A;  3AL0 C;  4DIQ A;  1FIA A;  3MCZ A;  3BTI A;  2LDU A;  2UUZ A;  2WA0 A;  1V5G A;  3JRB A;  1DPR A;  3IWF A;  3O2P E;  1E2X A;  4EJU A;  5DCF A;  4PUS A;  1MSE C;  1Y0U A;  3L2U A;  4JK1 X;  1I3Q J;  3H3V K;  3WTS C;  1MMG A;  1XMX A;  2VBX A;  1PUF A;  2DK5 A;  3VFZ A;  4U0V A;  3BG5 A;  1ETV A;  2HDW A;  2I8D A;  3CJQ B;  2XAF A;  4FX4 A;  4YRV A;  2COB A;  1V3F A;  3JCU C;  3S15 J;  2FF4 A;  2AHQ A;  1S29 A;  2BBY A;  2W7N A;  2P6T A;  1N75 A;  2H6B A;  2BXY A;  2M5W A;  5C4X J;  3IP4 B;  1F1Z A;  4ZZL A;  2V1U A;  3BZC A;  2O9L A;  1RR7 A;  2PMZ N;  2M7A A;  2X6W A;  2GQQ A;  4F93 B;  1TNS A;  2P8T A;  5K5R A;  1G3Y A;  2K9S A;  3CMM A;  1DU0 A;  2PBI A;  4YFK F;  3K10 A;  1RRJ A;  3H5N A;  3IH4 A;  1LEB A;  4HF0 A;  1K78 A;  3J80 K;  2VUM J;  2AO9 A;  3LQR A;  2VOD A;  4ITV A;  3BQZ A;  2GOM A;  1WH7 A;  5DEQ A;  4ZTF A;  3M07 A;  3CQZ J;  4G7O F;  3ULQ B;  3ZQH A;  2CGP A;  1QA6 A;  1A6I A;  4FX0 A;  2CQX A;  1ETQ A;  2ACJ A;  1S7O A;  2JJ7 A;  2F5F A;  3H9Q A;  4A3C J;  2WAF A;  1ACI A;  2FD5 A;  3FXR A;  4XLA A;  1XN7 A;  4B3A A;  4CDG A;  4L5E A;  1KU3 A;  3BQY A;  1HKT A;  2IEK A;  1X4P A;  2MLG A;  4PDK A;  2DTR A;  3W6K B;  4EJW A;  1ON2 A;  1KA8 A;  5EEG A;  2R7U A;  2BZT A;  3FM5 A;  2L2O A;  3U2R A;  4B47 A;  1HA8 A;  3HOV J;  4V19 K;  3AL0 B;  2E19 A;  4P96 A;  1LDJ A;  2QQB A;  2QBY A;  4B3X A;  1EH8 A;  1R4N B;  2ZBK A;  4A3D J;  1MMS A;  3FHZ A;  2IS1 A;  3HPG A;  2NXN B;  3HSE A;  1VQL I;  2M0M A;  1VQO I;  3W2A A;  1HKQ A;  3FX3 A;  2VJJ A;  1WKM A;  1G3W A;  2K9L A;  5LRS A;  3CUQ A;  1GUU A;  4BH9 A;  4KIG A;  2B9S A;  3RKQ A;  1WJF A;  3CF5 F;  1LFB A;  3S8P A;  2DMP A;  3ECH A;  1K4S A;  2WB1 A;  2QYO A;  1FMW A;  4A93 J;  1ERD A;  1U6G A;  5FLV A;  2PEX A;  3OYA A;  3HSF A;  2PMH A;  3IAM 2;  5ERI A;  3M9A A;  1FLI A;  1XGN A;  2P5L C;  4DBQ A;  4F52 A;  2JA2 A;  3DU6 A;  3K2A A;  2B0L A;  3D5L A;  4BHP A;  4EM0 B;  1WPK A;  2NNN A;  4I6Z A;  1HBX G;  1ZQ3 P;  3A1Y A;  2OZ6 A;  2FEZ A;  1FMV A;  1RR8 C;  2OAZ A;  2LY2 A;  1JKR C;  4R8H A;  5F0H A;  1JXS A;  2IA0 A;  1OIS A;  2V9K A;  4XMY A;  2FBI A;  1S6L A;  1IXS B;  3ECO A;  2CUE A;  5FO5 A;  4JX4 A;  3HKZ N;  1A31 A;  4HQM A;  1TBX A;  2LR8 A;  4YEJ A;  2Z2S B;  3DKY A;  2DMT A;  4OAY A;  5EJC A;  2FX0 A;  2XV4 S;  5ICC A;  4KT6 A;  2CV1 A;  3HOY J;  4N9H A;  2PQ8 A;  1W0U A;  1GXQ A;  5CPR B;  1B8I B;  3IH2 A;  5KAF C;  1MNM C;  3GTK J;  4FHT A;  2MA3 A;  2DLL A;  4L9V A;  1ETO A;  4Z2Y A;  1LDD A;  2DFI A;  4KIC A;  3JTG A;  4E70 A;  2R7R A;  4NNJ A;  2VPL A;  3ZN0 A;  4BXU A;  4XLC A;  1W5S A;  4A5N A;  4IOC F;  4A0Z A;  2CYY A;  4LD5 A;  1RIO H;  4HLX A;  4EM1 A;  1AHD P;  4O3M A;  4JBA A;  1V5E A;  4WXC A;  3WE2 A;  2BE5 F;  3E5Q A;  2EQR A;  4MTD A;  3T5X A;  2JA8 J;  5FKK A;  2FJ1 A;  1NHA A;  3ZR8 X;  1SFO J;  5LBQ A;  2ZXW H;  4LIU A;  4ESJ A;  2HQA A;  2Q2E A;  2DQL A;  4HBL A;  4NB5 A;  1JHH A;  1XC5 A;  5JVT A;  1CF7 B;  1SFE A;  4CYC A;  3U9G A;  3OYN A;  4IQ4 A;  3A2K A;  3KZY A;  4PSX A;  2STT A;  2UXX A;  3S1R J;  1YW9 A;  1I50 J;  2HEO A;  2MW8 A;  4BBS J;  4HX8 A;  3H3U A;  1FP2 A;  5HLI A;  5JHF A;  3ZMS A;  4XIC A;  4ZDL A;  1QU3 A;  1JJ6 C;  5IT9 K;  2HOT A;  2VKE A;  1HXD A;  3LA2 A;  4ZDP A;  4M9Z A;  3HM5 A;  3K4C A;  5BOX A;  5LHG A;  4BEH B;  4J00 A;  2HYF A;  5E3M A;  3G1O A;  1MND A;  3F3X A;  3K4N A;  3LSM A;  1B9N A;  1D1A A;  1QVU A;  3ONQ A;  4DZJ A;  3HOX J;  2XSJ C;  2ZME A;  3FZV A;  3MKY B;  3H35 A;  3SHF A;  4L0Y B;  2HI3 A;  1UG2 A;  1WFX A;  2H1K A;  4UV8 A;  4NBQ A;  4CO8 A;  3GW2 A;  3HRU A;  3FXK A;  2CH0 A;  3HPH A;  5CYV A;  2NYX A;  1XMK A;  1YOV B;  3CMY A;  3M4O J;  4OIO F;  1TWG J;  2RQQ A;  5GAD J;  3LST A;  5HOD A;  2XGE A;  3KYD B;  3SXY A;  4HNV A;  2NS8 A;  5A2Q K;  1B72 A;  2XAU A;  1JKQ C;  2KDZ A;  4MLO A;  2XRN A;  4KDP A;  3J80 Z;  1YX3 A;  3C18 A;  2WY7 Q;  4ENN A;  4MTE A;  1ZGW A;  3F9K A;  1R23 A;  1YJ9 I;  1E3P A;  1ULY A;  2QSF X;  1JKP C;  4XLF A;  4HLY A;  3RQI A;  3MZ8 A;  2YU9 J;  3GEZ A;  3C2B A;  2CRG A;  2KIF A;  2LRD A;  3CJN A;  2L9N A;  1VQ9 I;  3DV8 A;  4A3K J;  1SD4 A;  4Q48 A;  1I5Z A;  1ZLK A;  3OYJ A;  1MMA A;  1XCB A;  2COM A;  1VFC A;  4HX4 A;  3WTY C;  1H9T A;  2P6S A;  1BI3 A;  5J40 A;  2MLK A;  3TL4 X;  3E6D A;  3PO2 J;  3E7L A;  1LEA A;  3ASN H;  2CW0 F;  3L2R A;  2FBH A;  2KIS A;  1MBK A;  4UY8 I;  1Z6R A;  3DBH B;  2F5D A;  2JK3 A;  1KZH A;  3WU2 C;  1BR1 A;  1ZRD A;  1MSF C;  3BY6 A;  4EGZ A;  1XMA A;  1X2N A;  3O6B B;  3LSH A;  2H27 A;  3GTP J;  3A0H C;  1NG6 A;  3K9T A;  4U7D A;  2X1C A;  5DCM A;  4FT8 A;  2MC3 A;  3QOD A;  3WTV C;  1TW3 A;  2VN2 A;  1LJ9 A;  3GBG A;  3FBN B;  2LYC A;  2Z16 A;  4HDU A;  3A02 A;  3B73 A;  1ZR4 A;  2D5V A;  2OF7 A;  4QPO A;  5EGO A;  1NK2 P;  4PCQ A;  1RES A;  3QOP A;  3PUB A;  1EF4 A;  3N4M A;  3AG2 H;  1T56 A;  4EM2 A;  1STZ A;  1OCP A;  1A35 A;  1P4W A;  4AIH A;  1OMI A;  1YIO A;  3WGG A;  1K6Y A;  4HOB A;  4R79 A;  3GUD A;  3DLL F;  4RM3 A;  2HQR A;  1YFH A;  1PP7 U;  3H5A A;  2XGC A;  2BHZ A;  5LD2 C;  3GLL A;  4I02 A;  1BC8 C;  1QQI A;  1X58 A;  3E5U A;  5J1Y A;  1XSD A;  1TP4 A;  4DQ2 A;  4XL9 A;  1O3R A;  1ZYR F;  2LMD A;  4OU0 A;  5FRO A;  4AVP A;  1QRY A;  4CCO A;  3N97 A;  2STW A;  4AVZ A;  1UAA A;  2BV6 A;  1VQ6 I;  2DA5 A;  1FNN A;  1WJD A;  2ZNZ A;  5B1A H;  4YG2 F;  2K02 A;  2HOA A;  2VL8 A;  2ZXI A;  1G4D A;  3EPZ A;  2BVL A;  4M6X A;  1Z7U A;  3ASO H;  1LE8 B;  1U8B A;  1CGP A;  3KP4 A;  1FSH A;  3I3L A;  1X3U A;  1FOY A;  1RPW A;  4MEY F;  4HRI A;  2CQN A;  5HLT A;  4CIC A;  2VE9 A;  2HXI A;  2JWT A;  4IPA A;  3JRF A;  3I54 A;  4BU2 A;  3PFY A;  2CUJ A;  3QPL A;  2W82 A;  1DGW Y;  2NVQ J;  4QWQ A;  1BC7 C;  1ETW A;  2CJJ A;  4CCK A;  4BXX J;  5C4J J;  1UB9 A;  4EQQ A;  5M5Y J;  4HYE A;  5LFA A;  3PJR A;  2YSR A;  3MZY A;  3RDI A;  3S17 J;  2WY8 Q;  1PUE E;  4WCG A;  1HF0 A;  2OC6 A;  1FSE A;  2RVC A;  4LIT A;  3IHU A;  1MW7 A;  2BGC A;  1X1C A;  2QWW A;  1OCR H;  3VDX A;  2JUC A;  1SVO A;  1V54 H;  4LG3 A;  2GBY A;  2LP0 A;  4I01 A;  1IZ1 A;  3M1E A;  2EIJ H;  5GPC A;  2CS3 A;  2V1D A;  2QZ8 A;  3KP6 A;  4UB6 C;  1ZR2 A;  1IV6 A;  2XHK A;  4FE4 A;  4L9N A;  1J2X A;  2KP6 A;  5D4S A;  2F5E A;  1MMN A;  2HFH A;  2OUM A;  2QF7 A;  4AU7 A;  2Z33 A;  2GA1 A;  3FMS A;  1J0R A;  1EV7 A;  1YI2 I;  1H9G A;  5DUI A;  3IV5 A;  3TOA A;  1RZ4 A;  1P7I A;  2IBD A;  2LC2 A;  1Y56 A;  3F8M A;  1AWC A;  3LFU A;  1U78 A;  5B5E C;  2RAE A;  2GXB A;  2VJI A;  1XD7 A;  2MH2 A;  2XGX A;  4RB1 A;  1KON A;  4XN3 A;  3PL8 A;  1IO2 A;  2JPB A;  4GGG A;  4X1E A;  5CLS A;  3OYK A;  3MKL A;  3H5R A;  5LEJ A;  3V8J A;  4X6A J;  2KIQ A;  3K70 C;  3HTS B;  3OYD A;  5JR3 A;  3WHB A;  1EKE A;  1R7J A;  5E1X A;  4IRI A;  3A4C A;  3QQA A;  3BJO A;  2XRO A;  3RKX A;  1F4K A;  3D0S A;  3ZQ7 A;  4ESF A;  5D5W B;  4O6J A;  4RLF A;  2KRC A;  1XPX A;  3DTE A;  3I4M J;  3ZQL A;  3KE2 A;  4RAY A;  4HNU A;  1T2K A;  4IZZ A;  3G71 I;  2VBY A;  5IOY A;  2V9V A;  2JVH A;  2LG4 A;  4M72 A;  4O5V A;  3HXL A;  1BR2 A;  1EA3 A;  4FQG A;  3OIO A;  3U21 A;  4LK0 F;  3O3K A;  3EUH C;  4BAC A;  3CCS I;  5E8I A;  4C2U A;  3I4N J;  1OR7 C;  1V4R A;  2BHY A;  3WTT C;  2EPF A;  4A0Y A;  4IO9 F;  3CJT B;  3DLA A;  4G8X A;  4ZYE A;  2M0C A;  1ON1 A;  1LKX A;  1JUS A;  4ZDO A;  1U5T A;  1X4O A;  2R5Z B;  2CMP A;  1X1D A;  2GIZ A;  1J75 A;  1J59 A;  1ORK A;  1MJ9 A;  1ZG3 A;  3CDL A;  5FKM A;  3FK6 A;  1AKH B;  3ZRG A;  3QP6 A;  1R4M B;  3M7G A;  3GZ5 A;  3UNG C;  1CQT A;  4IL6 C;  2M8E A;  3KEO A;  2E1C A;  2KZG A;  4II3 A;  1GVJ A;  3VYS B;  2MG4 A;  3LSG A;  1R00 A;  1YIT I;  1O3S A;  2I5U A;  2YS9 A;  1N77 A;  4ASN A;  2FML A;  2GIV A;  1R71 A;  2HVR A;  2EIN H;  4QSH A;  2TDX A;  2LLK A;  2O0Y A;  1XSV A;  1VQP I;  3GTM J;  1H89 C;  1ITY A;  2M45 A;  2PG4 A;  1JKO C;  3RIR A;  3LSJ A;  1GV2 A;  3D5R C;  4BHB A;  4KIT B;  3Q0W A;  1I1S A;  1OKR A;  3PUF A;  4YII A;  1R1T A;  5LRR A;  2FUG 2;  3JRG A;  5BPD A;  2XF7 A;  3B6C A;  1XSX A;  3JRI A;  4Q4Z F;  1W7P A;  2UZK A;  1NG7 A;  2LH9 A;  2MSY A;  3RKY A;  2R4G A;  1RNL A;  4ESB A;  1S7E A;  3GFM A;  2RGV A;  1GLN A;  2ZJ2 A;  4BBR J;  3I0T A;  1JTY A;  5HOO A;  1BI0 A;  5E18 F;  3GCM A;  4EJV A;  2E2I J;  4BQA A;  3KYC B;  3JSO A;  1Y1W J;  3OL4 A;  4IHT A;  2HR3 A;  5FRM A;  1LVK A;  3HKZ A;  1YRN B;  2HYG D;  5FRN A;  2EH3 A;  1XDU A;  3DBR B;  3F72 A;  2JT1 A;  3BJ6 A;  2ECC A;  3DTI A;  4LK1 F;  3DXJ F;  4ENM A;  2KFD A;  1P7J A;  2GOX B;  3I59 A;  4E7J A;  1IN8 A;  3BOQ A;  3VSK A;  2O6G E;  4PK4 A;  2Y69 H;  1UHM A;  3RPU A;  3F8N A;  4L18 B;  4DGW B;  4ENJ A;  1X2M A;  2Y0S N;  3A01 A;  1UG0 A;  3U1D A;  2DA4 A;  5C44 J;  5D6E A;  3F8B A;  3BJA A;  2FE3 A;  2XF6 A;  3FMQ A;  4E6K G;  3L00 A;  4NQW A;  3BG9 A;  4L5J A;  1SVM A;  4BNC A;  2R7S A;  4NHJ A;  3QU3 A;  3I59 B;  5F0C A;  3OWT A;  3I53 A;  2OPT A;  4EJO A;  5J47 A;  5LGT A;  4IKF A;  2K7L A;  2DA3 A;  1D0Y A;  4A12 A;  2BYV E;  5BNG A;  5K5Q A;  3ABT A;  3H36 A;  4MHG A;  4G6T B;  1NH3 A;  1Y8R B;  4OIQ F;  2Z9O A;  2QVO A;  2EFP A;  1HLV A;  1GDT A;  2IPQ X;  1T98 A;  2GWR A;  3FXJ A;  6PAX A;  1SD7 A;  3SZT A;  4HEA 2;  1WSU A;  3SDB A;  2IS2 A;  3HUG B;  2JRM A;  1R6R A;  1Z6T A;  5IY5 H;  1Q1V A;  2DXI A;  2IA1 A;  2K27 A;  2VXZ A;  5DS9 A;  3MN2 A;  2L7K A;  1IN6 A;  4DYC A;  2HKO A;  1SAN A;  4EVI A;  3P7N A;  5KCM A;  3S1N J;  3ZQI A;  1GVD A;  1P2F A;  1T0F A;  3N05 A;  2XSD C;  3VYT B;  2IAI A;  2F5C A;  3KEY A;  4ZZD A;  1FX7 A;  1R5I D;  3AG3 H;  3G4S I;  4KMU X;  3J7Y J;  5CQG A;  5E17 F;  2HVS A;  2KKO A;  5E20 A;  4J19 A;  2WAD A;  4NUB A;  1Z7L A;  1O7F A;  4U87 A;  4BDZ A;  2KT0 A;  2D1H A;  3FXM A;  4FAS D;  2CUF A;  4IEJ A;  1NK3 P;  1A5J A;  4CH7 A;  2O61 A;  4RGS A;  4W1U A;  2Z5U A;  1FTT A;  2JN6 A;  3WTU C;  3PFI A;  2HZT A;  1RKW A;  2XAH A;  5L3F A;  3TO9 A;  3PNT A;  3HOS A;  2XIG A;  5K1Y A;  3R4K A;  2DAO A;  3NEU A;  2VJ4 A;  5AON A;  3LNQ A;  3BCB A;  2BY1 A;  2FXA A;  5E1Z B;  4M3F A;  4PSW A;  2ZB9 A;  2GAU A;  4BQO A;  3GZN B;  1TTY A;  4XKV A;  2M87 A;  3CP2 A;  4XLH A;  4RB0 A;  4RDU A;  2A6H F;  5IOZ A;  2LKX A;  3K69 A;  4MFE A;  3HEF A;  2TRT A;  1F43 A;  3ZQC A;  2G9W A;  4RGU A;  5J4Y A;  2KLO A;  1SC7 A;  1XB4 A;  4IF4 A;  4GYG A;  4IHX A;  4DW6 A;  3EDP A;  5EEA A;  4G7Z F;  1SD6 A;  3MFK A;  1J7K A;  4GFB A;  2ECB A;  1RC9 A;  4UVB A;  3H0D A;  2QQ8 A;  3ZOB A;  4BYY A;  5TRD A;  4B43 A;  3ZPL A;  2A69 F;  4ZYH A;  3T0Y A;  3BG3 A;  2R7W A;  3CC4 I;  3CCM I;  3MMY B;  1TWF J;  3OIP A;  4A3F J;  3S2D J;  4MQV A;  2AXT C;  2EZL A;  3K6G A;  3LAJ A;  5IYD J;  3K4K A;  3QYB A;  3CLO A;  2R93 J;  3ERE D;  2I10 A;  3ZQQ A;  4UUT A;  4A3G J;  2A68 F;  2A5Y B;  4XLN F;  1YLF A;  4WXD A;  2Z99 A;  3IH3 A;  1SMY F;  2CW8 A;  5GAH J;  2Y0M A;  3RYR A;  2ZSI B;  3G73 A;  1YX5 A;  2KL4 A;  3OS0 A;  2R0Q C;  3UR3 C;  2VIX A;  2FU4 A;  2KRH A;  5GTH C;  2BW3 A;  5HNF A;  2MBF A;  2OD5 A;  1R9T J;  3S2H J;  2EK5 A;  3HGG A;  3OSG A;  2X51 A;  3QYE A;  4BQN A;  2PJR B;  1OYW A;  1Z0X A;  4LMY A;  3JR9 A;  2FA5 A;  2DOA A;  3C3W A;  3HIF A;  3G1L A;  2MYS A;  2V6C A;  3P9C A;  3DEE A;  4FE7 A;  1XX5 A;  2M3A A;  5H6R A;  2E36 A;  2CV2 A;  3PQJ A;  2PFB A;  4A0X A;  4C3H J;  1PDN C;  2ZXJ A;  3O8H A;  2QQA A;  2Y9Y A;  1UCR A;  2UXN A;  1B8I A;  2BW3 B;  2HXO A;  2ISY A;  2XAQ A;  4XK4 A;  4YEL A;  3RQ4 A;  5DD8 A;  4Q47 A;  2DPD A;  3L2W A;  4LOC A;  3CC7 I;  1TLH B;  3BR6 A;  3CDH A;  3ZQG A;  3Q5F A;  3QPH A;  3G2B A;  1SAX A;  1ZTR A;  2WAE A;  2ZC2 A;  4NC6 A;  1PYV A;  3GO5 A;  4RS8 A;  1Z9C A;  3ERM A;  3RYP A;  1IC8 A;  3ML6 A;  4L0Z B;  1G2H A;  4D0P A;  2N8G A;  3KPH A;  2OA4 A;  5F1J A;  1WI3 A;  2XAG A;  4A3M J;  4S05 A;  1HDD C;  4G6Q A;  3FM3 A;  2XGD A;  3IUO A;  2WV1 A;  5F64 A;  5KAI C;  3J7A O;  1SFU A;  5HS7 A;  1H8A C;  3CCQ I;  1R1U A;  2K3F A;  1ZEL A;  1CF7 A;  2JQ7 A;  2KQR A;  4Y3O A;  2W24 A;  2YU3 A;  4HZF A;  2HTJ A;  1VQK I;  3BRO A;  3I71 A;  5EZG A;  2P0W A;  1IN7 A;  3P9I A;  3S3O A;  4I0A A;  3BG7 A;  2FQ4 A;  4IHW A;  2L7Z A;  4I0B A;  1DQU A;  3QWL A;  1JUP A;  3RZO J;  4BEH A;  1OCZ H;  5IP9 J;  3VPR A;  1E0E A;  4L9J A;  1O3T A;  3RZD J;  4II2 A;  1BOA A;  1ZGA A;  2QLZ A;  2L4A A;  2EA4 A;  4KA4 A;  1TW2 A;  4Y17 A;  3KET A;  2MC4 A;  1TZL A;  2LK2 A;  3CD6 I;  3AKZ A;  3VYR B;  3BCA A;  3HTU A;  5FLX Z;  2PX9 A;  1MBJ A;  3H9G A;  1Y39 A;  2A07 F;  2ESH A;  3CCR I;  1S8N A;  2NRA C;  3OYG A;  3L9F A;  3KP3 A;  2R7D A;  2XAS A;  1POG A;  5DDG A;  2ZNY A;  2BOL A;  1QBJ A;  2A05 A;  3BG6 A;  3KP7 A;  3ZMT A;  2DFE A;  2AQE A;  3DP7 A;  3LQQ A;  1TQP A;  3OYF A;  3FIS A;  3LL7 A;  5EF6 A;  2X48 A;  2W4S A;  1YW8 A;  3GFJ A;  3B02 A;  4HW0 A;  2EZI A;  3S14 J;  1MDM B;  2VI6 A;  2Q1Z B;  1G8X A;  1RET A;  1FY7 A;  2CFO A;  4A3L J;  2VE8 A;  4M6Y A;  3I9V 2;  2YUS A;  3BTJ A;  2Y75 A;  2BY2 A;  2LBF B;  1S5L C;  1KU7 A;  2CQK A;  2V79 A;  1DDN A;  1LFU P;  4UVA A;  1MH4 A;  4A3I J;  5BPI A;  1ZRC A;  2OTJ I;  1QPM A;  1JJ8 C;  5IT3 A;  3DTK A;  3S1M J;  1NTC A;  1RKT A;  3CCE I;  4HST A;  3I56 I;  4HX7 A;  5M3F J;  2XPU A;  2F4O B;  1DGR M;  2CQQ A;  2P7V B;  4Y33 A;  3GYH X;  3KIO A;  3JRC A;  5CVI A;  1MH3 A;  1D0X A;  5LGU A;  4D7M A;  3M8E A;  2CU7 A;  4ENK A;  2HNH A;  2IS4 A;  2WBM A;  4ZC3 A;  4BJ5 C;  3NAU A;  2DA6 A;  3OY9 A;  1PVE A;  4WXH A;  1I27 A;  2VKD A;  2BY0 A;  3PO3 J;  4C3J J;  1UEL B;  3K1N A;  5HDG A;  4D5F A;  4BDY A;  1OLT A;  1MBF A;  3ZQF A;  1Y8Q B;  5F04 A;  4I09 A;  4B1R A;  3OYE A;  2DDB A;  2DT6 A;  4L9T A;  5EZH A;  4B4C A;  3IWZ A;  3G3Z A;  4WX9 A;  5F6F A;  1UST A;  3CO7 C;  1KYW A;  4D9J A;  4CXF A;  4M3G A;  1E3O C;  4E7Z A;  2QGU A;  2ELH A;  3U1K A;  3FMR A;  2V6E A;  4KJZ A;  4XSX F;  4OIP F;  4F55 A;  5J3L A;  2F6C A;  1ZG1 A;  1RI7 A;  3O8G A;  2O3F A;  5DM6 F;  1BBY A;  2W85 A;  1QGP A;  1UZC A;  4E7H A;  4GYI A;  1XGS A;  2NVY J;  3A0B C;  5CKT A;  4EEF G;  1I39 A;  2X6Y A;  3DWL E;  1K4T A;  3FXU A;  2XKP A;  2OQR A;  4F3Q A;  3G6E I;  2DQR A;  1HKS A;  2EBI A;  4KN7 X;  1LE8 A;  3MAJ A;  3S32 A;  4WF2 A;  1WJA A;  4PJJ A;  1JGS A;  3V42 A;  1T6S A;  1YS7 A;  2ADU A;  4LLL A;  3CO6 C;  4ANJ A;  2VT3 A;  2Y0S A;  3MVP A;  4M3E A;  4LLN A;  3TW7 A;  4DOZ A;  1SVL A;  1TQI A;  2WTE A;  1B59 A;  4MNU A;  2DFH A;  4DYR A;  2HPM A;  4G94 A;  1SFX A;  4OMZ A;  3W3C A;  3CCY A;  1IN4 A;  4XBF A;  2RV8 A;  3DPU A;  4XKC A;  4B48 A;  1HSJ A;  3FWE A;  3J7Z I;  4RM2 A;  3AG4 H;  2KPM A;  4KIS A;  2HQN A;  1R1V A;  3FDY A;  3OIQ A;  1IAW A;  3KFW X;  4LFU A;  5B3S H;  1YW7 A;  3KLN A;  1LVA A;  3S1Q J;  5IYC J;  5KHD A;  4DJA A;  2K9Q A;  2XPW A;  2HDD A;  1UHS A;  1BW5 A;  5BS6 A;  1I3A A;  4N4N B;  3H9J A;  4BXF A;  1MBG A;  3NWT A;  4ZJZ A;  1VND A;  2IJL A;  4ZYG A;  1T95 A;  2Y30 A;  1ZAO A;  2BVM A;  3CLQ A;  3HDD A;  3PM1 A;  3PIO F;  4BE1 A;  3WHC A;  2HU9 A;  1H0M A;  3WU0 A;  4NC8 A;  5JHU A;  4RGX A;  3WOD F;  2P81 A;  4BHC A;  1EH7 A;  1YTY A;  1O3Q A;  5LHI A;  3W2W A;  2X4H A;  4B8X A;  2JA7 J;  3BPV A;  1ODD A;  3ABL H;  4OIN F;  5BQT A;  1T38 A;  1H88 C;  2DA1 A;  2F48 A;  1IRZ A;  3V7S A;  4IX7 A;  4E4H A;  2KIU A;  5TIS C;  4A5M A;  2CQ7 A;  5FFZ A;  3MKW B;  1B9M A;  1MD0 A;  2P4W A;  2K5C A;  3OR1 C;  4M74 A;  1R49 A;  2R7V A;  2LF7 A;  3CMA I;  2L9V A;  3JRH A;  1BL0 A;  2E1N A;  3DPL C;  4XKB A;  4CZZ A;  5GP9 A;  3CUO A;  5FKN A;  3WGH A;  4AIK A;  4IOA F;  4HDV A;  1Z67 A;  3DU5 A;  4YIF A;  3I58 A;  2VBZ A;  5CVV A;  2LRE A;  2WAQ N;  3KEQ A;  4BE2 A;  3W6V A;  4BY1 J;  5HS8 A;  4C2T A;  2Y48 A;  4XOR A;  1RUO A;  2XF5 A;  1LNW A;  2XVC A;  4XID A;  4UNO A;  4RGR A;  1U0J A;  2W25 A;  2R5Z A;  1FOX A;  4XLE A;  3EUK L;  2VOO A;  2KMU A;  2L5Q A;  4P9U A;  1C0W A;  1LUJ B;  1S7A A;  1AKH A;  2VC0 A;  3PNV A;  3MZH A;  4BE0 A;  1TWA J;  2QKM B;  2P5V A;  4OOI A;  3TP3 A;  5E8G A;  1IUY A;  2R7X A;  2VOP A;  5FGM A;  2PI0 A;  2XAJ A;  2G0E A;  2PMU A;  3LA7 A;  1XGO A;  4I99 C;  5K7Z A;  2NS0 A;  2VQC A;  2Z3Y A;  4A3B J;  1UFM A;  4A69 C;  4CCL A;  1APL C;  4D1Q A;  3L2Q A;  4PGG A;  4Y52 J;  2J5P A;  2OV7 A;  3GX4 X;  1IV8 A;  3TBI A;  3TGN A;  3TO7 A;  2HGC A;  4A2U A;  5F1R A;  1E17 A;  3L2C A;  2JPC A;  2IS6 A;  3JW4 A;  2L9S A;  4U0W A;  2DO7 A;  2DMN A;  2DCE A;  2BEO A;  4DYQ A;  3PSF A;  5K5O A;  1QHH D;  5IP7 J;  2DFF A;  3J81 Z;  1JGG A;  3VOD A;  2E1O A;  3NRV A;  3SEZ A;  4LG0 B;  3F22 A;  2XB0 X;  3BR3 A;  2IRF G;  2FOW A;  1BIA A;  3Q9V A;  3HC7 A;  1MIJ A;  4BAY A;  2FOK A;  2V4J C;  4S0H B;  4UUS B;  3GTJ J;  1G6N A;  4RB2 C;  3OV8 A;  1HQC A;  3HOZ J;  4DNC A;  1B6A A;  3BDD A;  1TWC J;  1BI2 A;  1SAU A;  5H6Q A;  1WCM J;  2QEX I;  5D5V B;  5CJ9 A;  1P9Q C;  2C6Y A;  3TDU C;  3VSL A;  3CZ6 A;  1YRN A;  1EH6 A;  3GTO J;  3GZ6 A;  1P92 A;  4CZC A;  4GXO A;  1K83 J;  1IXC A;  2R5Y B;  3H0G J;  3WU1 B;  3I64 A;  2MFZ A;  2RC4 A;  3ZP5 A;  3CCV I;  3EUH A;  5H2F C;  2V7F A;  3VOE A;  1OR7 A;  2G7U A;  1WJ5 A;  4PFP A;  1I6X A;  4IHS A;  3WG9 A;  4JX5 A;  3C7J A;  1VQ5 I;  5D5X B;  3GFL A;  4IHY A;  3ZN1 A;  2DT5 A;  4HPQ A;  5CVJ A;  2K4J A;  3FHN A;  2A3S A;  3Q0V A;  5LGN A;  2VLA A;  2GXG A;  2DYR H;  2YPR A;  5HDN A;  1OCC H;  3CME I;  1VQ8 I;  3BLY A;  2NVU B;  3QAH A;  3VWB A;  4CUG A;  4JQF A;  3OYB A;  3BTC A;  2O5R A;  2QUF A;  4NC7 A;  1FWZ A;  2MH9 A;  2OCC H;  3HZJ A;  1U2W A;  3RTR A;  2DA2 A;  1FT9 A;  1I1G A;  2R7F A;  5E1W A;  3F8C A;  3CC2 I;  4RAG A;  3HL2 A;  2R7T A;  3HG9 A;  3RPQ A;  3BTL A;  5FD6 A;  2X9D A;  1XGM A;  2ZJQ F;  1J09 A;  2E7W A;  5ICG A;  2VB6 A;  3ISP A;  2DJN A;  4KIF A;  1V55 H;  1E3H A;  4QLC U;  2LOO A;  3TKY A;  1IRG A;  3HUG A;  4LLG F;  4UHT A;  3FXL A;  4YFX F;  2E2J J;  1KQ9 A;  2CO5 A;  2EV0 A;  2LVS A;  4ZTJ A;  3DKX A;  1IN5 A;  2QKL B;  4ETS A;  2K40 A;  4W97 A;  2E1M C;  3V4G A;  2HOE A;  3WE3 A;  3HYI A;  2W00 A;  4KN4 X;  1R5H A;  3QPS A;  2QCO A;  4F92 B;  1D1C A;  1X1P A;  2YX7 A;  4XRF A;  3EQL F;  5GAG J;  1ZN2 A;  3H3Z A;  1L0O C;  3HBL A;  2AXL A;  3VEP A;  5E79 C;  4PFO A;  3KX2 A;  4MO7 A;  3RSN A;  3OYM A;  1F9N A;  3K7A J;  2GA2 A;  1LFP A;  1D5Y A;  1F5T A;  3HOU J;  2QSH X;  1R22 A;  3OYH A;  2DK8 A;  5KK1 A;  4CGZ A;  1W36 D;  3M3Y J;  3BZ6 A;  3MQ0 A;  3LOC A;  2PN6 A;  2A6T A;  3RI4 A;  3SZP A;  2CSO A;  1HST A;  3CES A;  1OFC X;  1D0Z A;  3WTZ A;  3GVA A;  4IQJ A;  5FLX K;  1BI1 A;  1IXR C;  2MAB A;  3FKJ A;  4XKW A;  2OTL I;  2VT2 A;  2M30 A;  1D3Y A;  3F0C A;  5EG0 B;  1GT0 C;  4WWC A;  1HOM A;  5HLH A;  2DYS H;  4Q5S F;  1ZKG A;  4IRG A;  4DBR A;  3HRS A;  3K4M A;  3MWM A;  4JYK A;  1O57 A;  4ZYA A;  1XS9 A;  2EV6 A;  2W57 A;  5IPA A;  3P9K A;  4HSR A;  1T08 B;  2HS5 A;  3NAR A;  3Q9S A;  4KT5 C;  2UV1 A;  4M3B A;  3LAP A;  1DUX C;  3RCO A;  3C2G A;  2ME6 A;  1OQY A;  3HHH A;  2OCE A;  1IUF A;  2OJE D;  5CVU A;  3JAM Z;  4RAF A;  3WGI A;  4M6V A;  3KP2 A;  5JLX A;  4M71 A;  1BM9 A;  1JI8 A;  1MBH A;  1R5G A;  1YYV A;  4HAM A;  1YIJ I;  2CV0 A;  4A6E A;  1YJN I;  3KP5 A;  1D1B A;  2NVX J;  4MIM A;  2QM3 A;  1HCR A;  3ESW B;  3T8T A;  1XCV A;  1O4X A;  4C9Y A;  4AUX A;  4TV7 A;  4RA2 A;  3TMO A;  4EJT A;  4Y13 A;  1KQ8 A;  4PJL A;  3CP8 A;  3FBI B;  1FP1 D;  3CUQ C;  1PUF B;  1ENH A;  3OOP A;  2DJI A;  2E1M B;  1MMD A;  3M1C A;  2OBP A;  1QNT A;  5ICE A;  4GCV A;  2PJP A;  2NOJ B;  4E7I A;  1U9N A;  2AQF A;  1FOW A;  1K6O A;  1TL8 A;  2EFW A;  1LPQ A;  1Z1D A;  1VQ7 I;  4PZJ A;  1ZRF A;  1AA7 A;  1WJB A;  1Z91 A;  2HTS A;  3BWG A;  2RKH A;  3M8J A;  3F8F A;  3REO A;  3PIP F;  2K9N A;  2Y9Z A;  2PJR A;  2IGM A;  2EZK A;  2RNG A;  1ONV A;  2J5O A;  3OSF A;  4FCY A;  3S3N A;  1UMQ A;  1XDS A;  2LNB A;  1OCT C;  1OYY A;  2ZFW A;  4XM3 A;  3QYF A;  2HYJ A;  3G1M A;  5DUK A;  3ABU A;  3BR0 A;  3ABM H;  3HRM A;  3S93 A;  2VQL A;  3TO6 A;  4P1W A;  3A03 A;  1RUN A;  5FLM J;  2RDP A;  1JUM A;  2FQ3 A;  5HLG A;  4GRI A;  4U0Y A;  2LKS A;  2F5V A;  1Y6I A;  1T8I A;  2JRT A;  1ETK A;  4RB3 C;  1FZP B;  2CWE A;  2QSG X;  2JVG A;  4LIV A;  1EJ9 A;  1K78 B;  4A3J J;  5M3M J;  1USS A;  1HC8 A;  1K79 A;  5E3L A;  1KYZ A;  1BJZ A;  2IGK A;  2H8W A;  4QPQ A;  3EYY A;  2G7H A;  4A3E J;  1LB2 A;  3JTH A;  3K0L A;  2X1D A;  4OAZ A;  1W1W E;  4KNY A;  3HHG A;  1FBS A;  2KDO A;  2F4M B;  2VQH A;  4PJM A;  1VQN I;  4BJT A;  3R0J A;  4XRS G;  1L3L A;  2DI3 A;  2HPI A;  2XUB A;  1PJR A;  3E6M A;  2ZCW A;  5KNL A;  2VKH A;  5ILS A;  3GME A;  5D6F A;  4WK8 F;  1U8R A;  5HS9 A;  4AYB A;  5FD5 A;  9ANT A;  3K1P A;  1WGX A;  5EEH A;  1TT5 B;  2O03 A;  2ZXH A;  2JSC A;  2R7Z J;  2M1B A;  2RRE A;  4D5C A;  2P7C B;  2QBY B;  5J4V A;  2VC1 A;  2M4K A;  2Y2Z A;  3DCF A;  5K7H A;  1BA5 A;  3E97 A;  4RMN A;  1VQ4 I;  4QIW N;  3SFZ A;  4PJN A;  3CCL I;  1IDY A;  2L02 A;  3FXQ A;  1N78 A;  2EV5 A;  3L1P A;  3CUQ B;  2ESN A;  5FJ8 J;  5F0F A;  4BY7 J;  1XTA A;  2DPU A;  2JSP A;  4KMF A;  4A6D A;  3SEQ A;  2O8K A;  3S2W A;  2KZV A;  3CF2 A;  4IVN A;  2M9H A;  2FNP A;  2D1V A;  2IGN A;  2FRH A;  2L9R A;  3UKG A;  2LF8 A;  4CCM A;  1Z3Y A;  3QOE A;  4XQF A;  1FIP A;  3E5X A;  1A6Q A;  2IGO A;  3L09 A;  2ZME C;  5L3C A;  5CQE A;  5LEK A;  1OCO H;  1FTZ A;  2OQG A;  1ZG5 A;  3TQN A;  4XOT A;  5H20 A;  3QRF F;  4RLQ A;  2OU2 A;  1ZRE A;  1OYI A;  4R1H A;  5GAE J;  5J1R A;  1QPI A;  1Y1V J;  2MGQ A;  2E5N A;  3KCC A;  1ZH5 A;  3RKW A;  3V7R A;  3MKZ A;  4V2F A;  2YX4 A;  2ZFU A;  5FKL A;  2NVT J;  2O8X A;  2JUG A;  4L5I A;  5C3E J;  4AWX B;  2X0L A;  2LTP A;  3E0J B;  5DYM A;  5F08 A;  2ISZ A;  2X85 A;  5FB2 A;  4P9F A;  1S9H A;  4HQE A;  3HSR A;  3I55 I;  1VI0 A;  3H92 A;  3J7A Y;  1MDM A;  1W36 C;  3K1M A;  2JA6 J;  2ZKZ A;  2IXS A;  4RBO A;  1ZLJ A;  2L01 A;  2WAQ A;  3OR2 C;  3S16 J;  1Z77 A;  3AG1 H;  1QZE A;  1U9O A;  2LBF A;  3LWF A;  1HDP A;  4JOM A;  2DT7 B;  2ME0 A;  2GLO A;  3OS1 A;  4M9X A;  3CDI A;  3JRE A;  4IXA A;  1YHQ I;  2D45 A;  4XN0 A;  3ROU A;  4GDF A;  4HF1 A;  3OMY A;  5D5U B;  5D4R A;  5EDN A;  2HQ5 A;  2WC2 A;  4UVC A;  5M5W J;  1IRX A;  2Q2E B;  1P6R A;  3IRR A;  1M1E B;  1QO0 D;  1WJE A;  4CYC B;  4MEX F;  2ETH A;  3LSR A;  1WRJ A;  2L54 A;  2ICW G;  1WHU A;  1A36 A;  2EB7 A;  3X2Q H;  2A61 A;  3K70 D;  2W48 A;  3DEU A;  4N4O B;  3I5U A;  1BN5 A;  4Y15 A;  3FXO A;  3EET A;  2ID6 A;  1JHF A;  3HJE A;  2ELJ A;  3LSK A;  2AS5 F;  5JLW A;  2DA7 A;  4AC0 A;  5J1U A;  3SYT A;  1FBQ A;  2ZO4 A;  5GPA A;  1Q1H A;  1S3J A;  5M5X J;  2XRL A;  2EJR A;  3IL2 A;  1MZB A;  3EUA A;  3ZMV A;  2K86 A;  4CHU A;  2EZH A;  2ZME B;  3HRT A;  2L0K A;  4MGR A;  2LSO A;  4AD9 A;  1W7P D;  1QVT A;  4LGW A;  3W6J B;  3F21 A;  1SEU A;  2E5Z A;  5GTI C;  2NAZ A;  2R7Q A;  3F6O A;  5CVR A;  2KRF A;  3E1S A;  4J01 A;  2V26 A;  3KLO A;  1ZGJ A;  3ABK H;  1ZK8 A;  4G12 A;  4K2E A;  5D8K B;  1YG2 A;  1FJL A;  1F36 A;  4CCN A;  4X0G A;  3R6S A;  4C30 A;  2ID3 A;  1B72 B;  2EFQ A;  2VAS A;  4Y4R A;  2GZW A;  1B1B A;  3KZZ A;  1K7A A;  5AIP A;  4BS9 A;  3J81 K;  2YR2 A;  3LFK A;  4HA8 A;  4M9S A;  1IW7 F;  3T8R A;  4UUV A;  4P5O A;  2JZY A;  1JT6 A;  1TT0 A;  3FKI J;  4QTR A;  2K85 A;  2L7F P;  4EGY A;  1TC3 C;  2IT0 A;  3RPU D;  4HG2 A;  2GM4 A;  3ZGK A;  1G3T A;  1SMT A;  1R36 A;  4ON0 A;  4BQQ A;  3K4B A;  5KVR A;  1OJL A;  5J8C A;  1GV5 A;  1IG7 A;  1FYK A;  3BR1 A;  2EA2 A;  4BGD A;  1YJW I;  1FBU A;  3F23 A;  4LJZ F;  2CUZ A;  1IRF A;  1FYM A;  4N9I A;  3F6V A;  3ZCO A;  1V5F A;  2X1E A;  2E7X A;  3P5J A;  4LB5 A;  2EIK H;  4Y7N J;  5LHH A;  1MKM A;  3SFI A;  2R7O A;  3LSI A;  2V1X A;  1AOY A;  5TJJ A;  1Z21 A;  2NOG A;  1DU6 A;  5JI6 A;  5DCM B;  3V7C A;  1GHC A;  3JRD A;  1IGN A;  2K3P A;  2XKO A;  3OYC A;  4HNT A;  5B1B H;  3RJP A;  5F27 A;  4F91 B;  2DOE A;  3VB2 A;  3AAF A;  2B63 J;  4AM3 A;  2FNA A;  5EGO B;  3HOW J;  4UB8 C;  1WZ2 A;  1W0T A;  4ZH4 F;  3QP5 A;  3QU6 A;  2RN7 A;  4AYB N;  2TCT A;  1YQA A;  1D8J A;  3ELK A;  2WB1 N;  4YIR X;  1MJB A;  2NNY A;  2Q8K A;  3PQK A;  3K4L A;  1WI9 A;  1YO5 C;  3OYI A;  3SJM A;  3LA3 A;  1R58 A;  5DD4 A;  4N0B A;  3WTW C;  3DBL B;  2XPV A;  1FEX A;  2IW5 A;  1K61 A;  4BKX A;  2Z1D A;  2KJB A;  2XC7 A;  3GFI A;  1WJC A;  3QPT A;  4D7N A;  2F4I A;  4M73 A;  1QHG A;  1Z3X A;  2LFB A;  2VQG A;  2WWY A;  2JA5 J;  3KYL A;  2NS7 A;  4CCJ A;  3Q0U A;  2XDV A;  3IRQ A;  4AID A;  4C3I J;  1REP C;  1JTX A;  3C1D A;  5FKO A;  1WQ2 A;  1DP7 P;  1PP8 F;  5AIQ A;  2LY9 A;  3S3M A;  4OIR F;  1VF9 A;  2LD5 A;  1ETY A;  1VTN C;  3GLX A;  1MBE A;  2E34 A;  1BR4 A;  2Y31 A;  1U3E M;  2L3D A;  4M3D A;  3GF2 A;  4HV6 A;  1X3W B;  2JTV A;  3D5S C;  3IC7 A;  4MQ9 F;  2DMU A;  4XRS A;  3CCU I; 
#chains in the Genus database with same CATH homology
 2NS8 A;  1B72 A;  1JKQ C;  2KDZ A;  3FIW A;  2R0Q C;  4MLO A;  1I6H J;  1TWH J;  3BTL A;  3S2H J;  2X6O A;  2X9D A;  1R9T J;  1ZGW A;  3HGG A;  3OSG A;  3JRA A;  1JKP C;  2DJN A;  1Z0X A;  3JR9 A;  3RQI A;  4JP0 A;  2YU9 J;  3C2B A;  2E2J J;  3G1L A;  2CRG A;  2LVS A;  4A3K J;  2K40 A;  4FE7 A;  4W97 A;  4V2G A;  1XG1 A;  3BT9 A;  4C3H J;  2DN0 A;  1VFC A;  3O8H A;  3QPS A;  2QCO A;  2Y9Y A;  3GTG J;  1B8I A;  3PO2 J;  3E7L A;  2HXO A;  4XK4 A;  3TW6 A;  5K7F A;  4LOC A;  1MBK A;  3BR6 A;  3ZQG A;  3HBL A;  2JK3 A;  1ZTR A;  1MSF C;  1X2N A;  3GTP J;  1BW6 A;  4MO7 A;  3BR2 A;  3K7A J;  1IC8 A;  1G2H A;  1D5Y A;  3GBG A;  3HOU J;  2N8G A;  2DMQ A;  5F1J A;  4UUS A;  1WI3 A;  4ABZ A;  2M2E A;  3A02 A;  3M3Y J;  4A3M J;  1ZR4 A;  3LOC A;  1HDD C;  2OF7 A;  4NDL A;  2D5V A;  5DTD A;  2XGD A;  2WV1 A;  5EGO A;  1NK2 P;  1RES A;  1OFC X;  1H8A C;  1AU7 A;  1EF4 A;  1IDZ A;  1T56 A;  1OCP A;  3B6A A;  3OOU A;  3F0C A;  4C2M J;  5EG0 B;  1GT0 C;  4IHV A;  1HOM A;  2H8R A;  1T33 A;  1ZKG A;  5EZG A;  2XGC A;  3BR5 A;  4JYK A;  2R5Y A;  5IYB J;  1XS9 A;  1X58 A;  5IPA A;  2FQ4 A;  4IHW A;  2L7Z A;  2O7O A;  3NAR A;  5J1Y A;  4M3B A;  2DTZ A;  1JUP A;  4DZP A;  2ME6 A;  1QRY A;  3RZO J;  1IUF A;  3DEW A;  5IP9 J;  3VPR A;  2DA5 A;  4M6V A;  4I76 A;  2ELK A;  3RZD J;  5JLX A;  2E2H J;  2VKV A;  1MBH A;  2HOA A;  2LK2 A;  2XB5 A;  2NVX J;  4MIM A;  1HCR A;  5EYR A;  1LE8 B;  1MBJ A;  1U8B A;  1O4X A;  4AUX A;  1RPW A;  2HXI A;  1POG A;  1PUF B;  1ENH A;  2JWT A;  3JRF A;  4JX6 A;  3QPL A;  3D1N I;  2NVQ J;  4BXX J;  1ETW A;  1U9N A;  2CJJ A;  1ETX A;  5C4J J;  5M5Y J;  3FIS A;  5EF6 A;  2X48 A;  3S17 J;  1WH5 A;  1HF0 A;  2EZI A;  3S14 J;  3FK7 A;  2K9N A;  2VI6 A;  2Y9Z A;  1IJW C;  2R92 J;  2EZK A;  4MFD A;  1RET A;  2GBY A;  2JMW A;  2LP0 A;  3OSF A;  4FCY A;  3TED A;  1UMQ A;  1OCT C;  4A3L J;  3GTQ J;  2HYJ A;  3G1M A;  5GPC A;  3BR0 A;  2YUS A;  3BTJ A;  2HOS A;  3Q3S A;  1ZR2 A;  1IV6 A;  5IP6 A;  3A03 A;  2VPR A;  5FLM J;  1JUM A;  1LFU P;  4FE4 A;  1MH4 A;  4A3I J;  2M34 A;  2QF7 A;  1ETK A;  1JJ8 C;  3S1M J;  2M8G X;  3SDG A;  1NTC A;  3IV5 A;  4A3J J;  1RKT A;  5M3M J;  3HB9 A;  1P7I A;  2IBD A;  3TP0 A;  5M3F J;  5E3L A;  1BJZ A;  5E3N A;  2XPU A;  1U78 A;  4A3E J;  2RAE A;  2CQQ A;  3JRC A;  5E3O A;  1MH3 A;  4X1E A;  3MKL A;  4D7M A;  2CU7 A;  4XRS G;  4X6A J;  3WHB A;  4XRM A;  3NAU A;  2DA6 A;  1JT0 A;  3PO3 J;  4C3J J;  3QQA A;  3A01 B;  4D5F A;  9ANT A;  1WGX A;  5EG0 A;  1MBF A;  3ZQF A;  5F04 A;  3GTL J;  3I4M J;  4B1R A;  3ZQL A;  2R7Z J;  4D5C A;  5EZH A;  4B4C A;  2Y2Z A;  5IOY A;  3DCF A;  5K7H A;  1BA5 A;  4FTH A;  4M3G A;  4FIS A;  4QIW N;  1E3O C;  2L7M P;  1IDY A;  3L1P A;  5FJ8 J;  3OIO A;  5F0F A;  5J3L A;  4BY7 J;  3O8G A;  3I4N J;  3LSP A;  2O8K A;  2NVY J;  2M9H A;  4EEF G;  3HGY A;  2L9R A;  3UKG A;  1FIA A;  3BTI A;  2M0C A;  3JRB A;  1JUS A;  1FIP A;  2EBI A;  2R5Z B;  1LE8 A;  1ORK A;  1FTZ A;  1MSE C;  1I3Q J;  3CDL A;  3H3V K;  5FKM A;  3FK6 A;  1AKH B;  3MVP A;  1CQT A;  4M3E A;  1PUF A;  3TW7 A;  5J1R A;  1QPI A;  1Y1V J;  2MGQ A;  3BG5 A;  4DYR A;  1ETV A;  4V2F A;  2NVT J;  5FKL A;  2MG4 A;  3CCY A;  3LSG A;  5C3E J;  2LTP A;  5F08 A;  2COB A;  2YS9 A;  3S15 J;  2AHQ A;  1VI0 A;  4QSH A;  2JA6 J;  2LLK A;  3GTM J;  1H89 C;  5C4X J;  1ITY A;  1JKO C;  4RBO A;  3LSJ A;  2O9L A;  1RR7 A;  1GV2 A;  2PMZ N;  3S1Q J;  3S16 J;  1Z77 A;  3Q0W A;  1U9O A;  1HDP A;  3JRG A;  5IYC J;  2ME0 A;  2GLO A;  2K9Q A;  2XPW A;  3B6C A;  3JRI A;  2HDD A;  1DU0 A;  2K9S A;  1UHS A;  1BW5 A;  2MSY A;  3JRE A;  1MBG A;  3IH4 A;  1VND A;  5EDN A;  1S7E A;  2VUM J;  2AO9 A;  2HQ5 A;  4BBR J;  1JTY A;  5M5W J;  2Y30 A;  2E2I J;  3BQZ A;  1WH7 A;  3HDD A;  3PM1 A;  3CQZ J;  1Y1W J;  4CYC B;  3WHC A;  3ZQH A;  3LSR A;  1YRN B;  1A6I A;  2P81 A;  2EH3 A;  2CQX A;  1ETQ A;  2JJ7 A;  2ECC A;  2JA7 J;  2W48 A;  4A3C J;  1P7J A;  2FD5 A;  4B3A A;  1H88 C;  2DA1 A;  3BQY A;  4L5E A;  1IRZ A;  2IEK A;  2ID6 A;  1X2M A;  2Y0S N;  3A01 A;  5JLW A;  2DA7 A;  4AC0 A;  3HOV J;  5J1U A;  2E19 A;  5GPA A;  2DA4 A;  5C44 J;  5M5X J;  2XRL A;  4A3D J;  2EZH A;  2L0K A;  3BG9 A;  3JRH A;  1BL0 A;  5F0C A;  1QVT A;  2OPT A;  5GP9 A;  5FKN A;  1GUU A;  3RKQ A;  4G12 A;  1ZK8 A;  2DA3 A;  1LFB A;  1FJL A;  2DMP A;  2WAQ N;  1F36 A;  5BNG A;  3W6V A;  4A93 J;  4BY1 J;  2ID3 A;  1B72 B;  5FLV A;  4XID A;  2R5Z A;  4I6Z A;  3K2A A;  1HLV A;  1WPK A;  1JT6 A;  3FKI J;  1ZQ3 P;  4QTR A;  2L7F P;  1GDT A;  1TC3 C;  1AKH A;  2GM4 A;  1JKR C;  5F0H A;  1TWA J;  3TP3 A;  1OJL A;  1GV5 A;  1IG7 A;  3BR1 A;  1Q1V A;  2CUE A;  4JX4 A;  3HKZ N;  2G0E A;  2LR8 A;  5K7Z A;  5DS9 A;  2DMT A;  3MN2 A;  2FX0 A;  4A3B J;  4A69 C;  4DYC A;  1APL C;  4Y52 J;  1SAN A;  3HOY J;  3S1N J;  1B8I B;  1W0U A;  3ZQI A;  1MNM C;  1GVD A;  3IH2 A;  2XSD C;  3GTK J;  2IAI A;  1ETO A;  4Y7N J;  2DMN A;  3SFI A;  4DYQ A;  4J19 A;  5IP7 J;  1JGG A;  2KT0 A;  2NOG A;  1NK3 P;  2CUF A;  4IEJ A;  1A5J A;  1DU6 A;  2E1O A;  2XB0 X;  3BR3 A;  3JRD A;  4W1U A;  1AHD P;  1IGN A;  1FTT A;  2JN6 A;  4S0H B;  1RKW A;  4UUS B;  2EQR A;  2JA8 J;  3GTJ J;  5F27 A;  5FKK A;  2FJ1 A;  1SFO J;  2B63 J;  3HOZ J;  3LNQ A;  5EGO B;  3HOW J;  1TWC J;  1W0T A;  4AYB N;  2TCT A;  4M3F A;  1XC5 A;  1WCM J;  4CYC A;  2ZB9 A;  2WB1 N;  1YRN A;  3GTO J;  4RDU A;  3S1R J;  3SJM A;  5IOZ A;  2LKX A;  1I50 J;  4MFE A;  1K83 J;  2MW8 A;  4BBS J;  3HEF A;  2TRT A;  2R5Y B;  3H0G J;  1F43 A;  2XPV A;  4XIC A;  3ZQC A;  1FEX A;  1JJ6 C;  1K61 A;  2HOT A;  2VKE A;  4BKX A;  4IHX A;  4DW6 A;  5EEA A;  3HM5 A;  4JX5 A;  4IHY A;  5E3M A;  4D7N A;  3G1O A;  2LFB A;  4GFB A;  2ECB A;  3Q0V A;  2JA5 J;  2NS7 A;  1QVU A;  4DZJ A;  3ZOB A;  3Q0U A;  3HOX J;  4C3I J;  3BG3 A;  1JTX A;  5FKO A;  2HI3 A;  1UG2 A;  2H1K A;  2LY9 A;  1TWF J;  1VF9 A;  4A3F J;  3S2D J;  2LD5 A;  1ETY A;  2EZL A;  5IYD J;  1MBE A;  3BTC A;  2R93 J;  2I10 A;  2Y31 A;  4UUT A;  4A3G J;  3CMY A;  4M3D A;  3M4O J;  1TWG J;  5HOD A;  2DA2 A;  2XGE A;  3IH3 A;  4HNV A;  2DMU A;  4XRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...