3S1NJ

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1nJ00
1U9OA 2CU7A 2G0EA 5F0CA 3GTKJ 3S1NJ 1T33A 2E1OA 1ITYA 2NVTJ 4L5EA 2R93J 2K9QA 3S16J 2FJ1A 1IRZA 4C3HJ 1IDZA 2L7MP 5FKLA 1IC8A 3E7LA 5J3LA 2HXOA 1MH3A 1BA5A 1MSFC 1AKHA 1BW6A 1ETWA 1YRNA 2K9SA 4M3FA 2H8RA 1TWAJ 4RBOA 2LVSA 3Q0VA 1P7IA 1ORKA 3IH2A 3NAUA 4W97A 1QPIA 1AU7A 2M2EA 2XSDC 2E2HJ 1OFCX 2EZKA 3BG9A 4DYQA 5E3NA 1JUPA 1WPKA 2YS9A 4D5FA 2HXIA 3S1QJ 1B8IA 1RKTA 4A3DJ 2ME6A 1WH5A 5JLXA 4A3KJ 2ECCA 4A3MJ 3S17J 4BBSJ 3BQYA 3JR9A 2CUEA 4JX5A 5E3LA 1JUSA 3LSJA 1R9TJ 1LE8B 1G2HA 2ID3A 1U9NA 3OIOA 1UMQA 5EZHA 5J1YA 3Q0WA 3BT9A 1NK2P 3Q0UA 4DW6A 2VKVA 1BJZA 5FLMJ 2AHQA 5K7ZA 2LKXA 3HB9A 2O8KA 4AUXA 1IDYA 3NARA 4M3DA 3ZQCA 5F0FA 1HF0A 3VPRA 1TWCJ 3I4MJ 2EQRA 3PM1A 3HBLA 3JRCA 1XG1A 3CDLA 2O7OA 4B3AA 3QQAA 4FTHA 4D5CA 1JGGA 2RAEA 3BTIA 3ZQGA 4RDUA 1ZTRA 1ZR2A 2COBA 5IYBJ 4V2FA 1MBEA 5M5XJ 2R7ZJ 2DA7A 3GTOJ 2NS7A 3LOCA 1LE8A 2NVQJ 4X1EA 1I3QJ 1JUMA 3MKLA 1RKWA 1IG7A 1X2NA 2LFBA 1W0TA 4A3FJ 3IH3A 3CCYA 2E2IJ 1WGXA 5C3EJ 3RKQA 2IEKA 1X2MA 2LD5A 3RZOJ 3DCFA 2D5VA 3PO3J 5F04A 3A01B 3SJMA 1GV5A 1JTYA 2R5YA 2EBIA 3BTLA 2DMPA 1GT0C 1D5YA 5C44J 2JA5J 3S2HJ 3G1OA 2CQXA 2X6OA 4X6AJ 2MG4A 1JKPC 4A3BJ 4M6VA 1HCRA 4LOCA 5FKNA 1JKOC 5IYCJ 4MO7A 1GVDA 1TC3C 4BXXJ 2MW8A 4MFEA 2QF7A 1FIAA 4QIWN 2HQ5A 1POGA 3S14J 1I6HJ 2TCTA 1APLC 3MVPA 2H1KA 4UUSB 3S15J 2FD5A 5FKMA 3TEDA 3FIWA 1BL0A 4XRMA 3LSGA 2XPUA 4HNVA 2HI3A 3IH4A 1FTTA 1T56A 2DA6A 5HODA 3SFIA 1VI0A 5EG0B 1K61A 5F0HA 3BG3A 2K9NA 1GV2A 1UHSA 4QTRA 2XPWA 2CRGA 1GDTA 4ABZA 2LR8A 4M3EA 3FK6A 5J1UA 3G1LA 2DA1A 3H0GJ 2YU9J 3IV5A 2TRTA 4DYCA 4BBRJ 9ANTA 4XK4A 2CQQA 1OCPA 1RETA 3O8GA 4A3LJ 2YUSA 3BG5A 1WH7A 5EDNA 2DMNA 3D1NI 4A3JJ 2QCOA 2HOSA 1H89C 3LNQA 2VUMJ 5IYDJ 2JA7J 1K83J 2DTZA 4Y7NJ 5EG0A 2R5ZB 1NK3P 2I10A 4NDLA 2M9HA 2CUFA 5M3MJ 1EF4A 3M4OJ 1CQTA 1A5JA 1FIPA 1PUFB 3FKIJ 1JJ6C 2KT0A 2JN6A 3RZDJ 1B72B 2ID6A 5J1RA 1MBHA 2X9DA 1OJLA 3BR5A 4M3GA 1TWFJ 4J19A 1RR7A 2EZLA 4MLOA 3HOXJ 2N8GA 2LY9A 3HM5A 3F0CA 3TP3A 2L0KA 3QPLA 2XB5A 1E3OC 2FQ4A 2JK3A 4C3IJ 1HDPA 1QVUA 3QPSA 4JX6A 2VI6A 2EZIA 2XGCA 2CJJA 5EZGA 2WB1N 3BR3A 5FLVA 3Q3SA 3WHBA 1LFUP 2VPRA 1PUFA 2B63J 2DMTA 3CMYA 3B6AA 5IP7J 5FJ8J 3HOYJ 3L1PA 2Y31A 1MBKA 3OSGA 1B72A 2VKEA 1H88C 2WAQN 3HOUJ 2OPTA 4BKXA 1ETKA 2XPVA 1MBJA 5IOYA 3ZQIA 4XRSG 3GTMJ 2MGQA 4D7NA 5M3FJ 1F43A 4XRSA 3JRDA 3HDDA 1ZR4A 3ZOBA 3BTCA 1Y1VJ 5C4JJ 2GM4A 1P7JA 1HLVA 1H8AC 1ETOA 1ENHA 2DA5A 1IJWC 3SDGA 3GTGJ 1TWGJ 2X48A 3A03A 3G1MA 2R92J 1FTZA 1UG2A 2FX0A 1MBFA 2NS8A 3HOZJ 3GTQJ 5C4XJ 2DMUA 1ETVA 2ECBA 2W48A 2P81A 1VFCA 1Q1VA 1MBGA 4I76A 4FE4A 4B1RA 5IP9J 2ELKA 4IHYA 1RPWA 5GP9A 1ZGWA 3FISA 1IUFA 2ZB9A 4DZPA 4JP0A 5FKKA 4I6ZA 1U78A 3S2DJ 1FJLA 3O8HA 3FK7A 3WHCA 3TW6A 2M8GX 1MNMC 2XB0X 4S0HB 3A01A 3S1RJ 2PMZN 2MSYA 1QRYA 5F27A 2WV1A 2E19A 2GBYA 1YRNB 4DZJA 5K7FA 2L7ZA 3JRBA 2KDZA 2Y0SN 2NVYJ 3HOVJ 2DA4A 3TW7A 5EEAA 1NTCA 1IGNA 2HYJA 1VNDA 4XIDA 2GLOA 2HOAA 1LFBA 3A02A 3S1MJ 3GBGA 3K2AA 5IPAA 3BTJA 4B4CA 5F1JA 3HGGA 3TP0A 3BQZA 4AC0A 5FKOA 4MIMA 1F36A 1GUUA 3C2BA 3CQZJ 3HKZN 1U8BA 2NOGA 5E3OA 4CYCB 5M5WJ 2JA6J 3PO2J 5EF6A 3ZQHA 1ETXA 2HOTA 1JTXA 4UUSA 1TWHJ 3JRHA 1B8IB 4JX4A 4UUTA 5IP6A 2JJ7A 4IHWA 3HOWJ 2Y2ZA 3UKGA 1HDDC 2XGEA 4G12A 2R0QC 3LSRA 4C2MJ 3JRGA 2M0CA 2L7FP 5E3MA 3BR2A 1WCMJ 5IOZA 5EGOB 2LTPA 4XICA 1RESA 1Z0XA 2XGDA 4AYBN 2L9RA 4A3IJ 4CYCA 4FCYA 1XC5A 5F08A 2IAIA 1I50J 3BR1A 1JKQC 1JT6A 4EEFG 4BY7J 2DA2A 2Y9ZA 1JKRC 4D7MA 1SFOJ 3GTJJ 2OF7A 1OCTC 1ETYA 4IHXA 2LLKA 1VF9A 4DYRA 3GTPJ 4MFDA 3K7AJ 3JREA 1XS9A 1DU0A 4GFBA 5EYRA 4V2GA 5EGOA 1BW5A 2R5ZA 1IV6A 3JRIA 1ZKGA 3B6CA 4QSHA 5DTDA 4Y52J 5JLWA 4W1UA 4A69C 1S7EA 1Z77A 2DJNA 2DMQA 4M3BA 1WI3A 1X58A 3H3VK 1QVTA 3JRFA 2R5YB 4A93J 1O4XA 2LP0A 2EZHA 1W0UA 3ZQFA 1SANA 3BR6A 2K40A 2AO9A 5BNGA 3ZQLA 2DN0A 3RQIA 5DS9A 2JA8J 3HGYA 1JJ8C 5K7HA 1HOMA 2XRLA 3DEWA 2JMWA 3MN2A 2EH3A 3GTLJ 2ME0A 4FISA 1JT0A 1ZQ3P 2Y30A 2Y9YA 2JWTA 4FE7A 4IHVA 1A6IA 3LSPA 3BR0A 4A3CJ 5GPAA 1ZK8A 4A3GJ 2IBDA 4IEJA 4A3EJ 4BY1J 1DU6A 1AHDP 2E2JJ 1Y1WJ 3OOUA 2LK2A 2DA3A 5GPCA 1AKHB 3HEFA 4JYKA 5M5YJ 3I4NJ 1FEXA 1MSEC 3W6VA 2HDDA 2O9LA 3OSFA 3M3YJ 3JRAA 2M34A 2NVXJ 1MH4A 1ETQA 4C3JJ
chains in the Genus database with same CATH superfamily
4CO8A 2HKOA 2EFQA 3KP3A 3HZJA 1ZG5A 5LGUA 2WADA 2ZMEC 4CZCA 4EGYA 5L3FA 3HPGA 3FXRA 2LYCA 3WU1B 3HRUA 2O5RA 1YIOA 4BHPA 4BE2A 1YRNA 2K9SA 1OCRH 1U5TA 3K4JA 2OQRA 4W97A 4M6YA 3S93A 2E1CA 1OCZH 4M74A 1X1PA 2XSDC 4PGHA 4B09A 2M1BA 2XHKA 4NQWA 2ZJQF 4WCGA 1BI2A 2FF4A 1MW7A 4XNFA 5E3NA 4C2UA 2E71A 2HXIA 2E5NA 3BZ6A 3GZNB 3CUQC 3C7JA 4A3DJ 2ME6A 1E2XA 3R6SA 3LWFA 1WJAA 2ECCA 3BLYA 4XN0A 4A3MJ 4BBSJ 4XLFA 4P55A 4BYYA 3BQYA 3JR9A 1G59A 1IF1A 2Y0SA 1JUSA 2DOFA 2A68F 1Z05A 1LE8B 3PUBA 4RB0A 2L7KA 4ZJZA 5A2QK 5JVGF 3U1DA 3FZVA 2K3PA 3CF2A 1NK2P 1XCBA 3Q0UA 4DW6A 2Z9OA 2PFBA 1T6SA 5K7ZA 1IDYA 4R1HA 3NARA 4BU2A 3HOTA 3CUQB 3ZQCA 1O7LA 3DTEA 3PL8A 5LHHA 3PM1A 4L9TA 2KIFA 3JRCA 2L9SA 3GYHX 2EFPA 4G7OF 3CDIA 3QQAA 2RAEA 3BTIA 1IN5A 3ZQGA 4RDUA 3OY9A 2MLKA 5HLIA 5E79C 1OQYA 1Y8RB 2P5KA 3ZN1A 2CSOA 2ZSIB 3GTOJ 2R7TA 2NS7A 3LOCA 3ZN0A 2X6YA 4X1EA 4WF2A 3GFMA 1SFKA 5E17F 2HPIA 3K4MA 4PFOA 4G6TB 1LDJA 3IH3A 3CCYA 5JHFA 4HDUA 3M8FA 3SEZA 3RKQA 1X2MA 4ENKA 1WJDA 1S29A 4HEA2 5DM7F 4XLAA 1MNDA 2FOKA 3QODA 3PO3J 2AXTC 3A01B 3SJMA 2GAUA 2KP6A 5F6FA 1R1TA 4HSTA 1Z91A 4EQQA 4PUSA 1KQ9A 3X2QH 5LHGA 2IA0A 1X1BA 5FB2A 3KETA 1N78A 4UVBA 2BEOA 1F4KA 3WTYC 3WTTC 2XC7A 4H0EA 1D5YA 5C44J 4IPAA 3J7ZI 4ZYHA 3EETA 2CQXA 1YLFA 4HF1A 4RAGA 2A61A 2CW0F 3ASOH 2W00A 3IKVA 4E7HA 1ZREA 1ZARA 4E7ZA 2ETHA 2RVCA 2BXZA 3LA2A 4RB2C 4KDPA 4MO7A 4G8XA 2QF7A 4DGWB 1LFPA 2DXIA 4FHTA 3SQNA 1WJCA 2E60A 3S14J 1LKXA 4RS8A 1I6HJ 2L5QA 4NC6A 2STTA 4HV5A 1IRGA 4LB6B 4U87A 4S04A 2FD5A 2NYXA 1D0ZA 3TO9A 4NHJA 4HX4A 5TISC 1BL0A 2MD5A 3KIOA 4MTEA 2F4MB 2ADUA 3KP2A 3L7WA 2CH0A 2LF7A 5B3SH 1FTTA 1QZYA 3WODF 4LLLA 1T56A 2HDWA 4HNUA 3KCCA 4RM3A 4RMNA 3DKWA 2RKHA 3QAHA 3K4KA 1ZYRF 5F0HA 3DLLF 3RPUA 2KJBA 5LHIA 4QTRA 1KQ0A 1FP2A 2ICWG 2CFOA 5DCFA 3V8KA 1GDTA 1FBSA 3L9FA 4NUBA 5GADJ 1Z6RA 3GZ5A 4WX9A 2ZCWA 3H0DA 1J59A 2L9VA 4LK0F 1BR1A 2PX9A 1UHMA 1HA8A 2FBKA 4XK4A 1G6NA 5K5QA 4OAZA 1W36D 1RETA 1FP1D 4ZYGA 3TOAA 3QWLA 1FMWA 5CLSA 3RDIA 2DMNA 3EYIA 3CJNA 5DYMA 3GVAA 1XSDA 4XONA 3VYTB 3A0HC 4LG0B 3VSKA 4B43A 3ZP5A 2HDCA 2K5CA 4B8XA 2R7FA 2V9PA 2HZTA 2AQFA 2ELHA 2JN6A 3OIPA 3I59B 4BQNA 1GXQA 2VBZA 2X9DA 1OJLA 4RAFA 2MC3A 4DJAA 4J19A 1DDNA 1MJBA 1O7FA 2JA2A 1W5SA 3QPLA 2XB5A 2HEOA 1MJAA 3FXUA 1QVUA 1F1ZA 1XD7A 2DDBA 2P8TA 2VI6A 3CUOA 3P5JA 2FXAA 5J4VA 3MAJA 2W82A 2XGCA 4QPQA 1IRXA 5EZGA 2WB1N 1UB9A 3LA7A 2VPRA 1PUFA 4OIOF 5DV5A 5FJ8J 1XSXA 1UELB 3P7NA 3OWTA 1U3EM 1B72A 2VKEA 2DCEA 4I09A 2WAQN 4UY8I 2ACJA 2K3FA 1MBJA 4C30A 2OD5A 3HRTA 2QA4I 3A0BC 4XRSA 2VKHA 2HGCA 3JRDA 1X3ZB 1YQAA 4KA4A 4HLYA 4N0BA 1BIBA 3W6JB 1RR8C 1BJAA 1ETOA 3GFLA 3WTVC 2WY8Q 3BG6A 3SDGA 3WE2A 1Y0UA 2BY0A 3A03A 1Y56A 2CUZA 1FTZA 1KYZA 1UG2A 1YJWI 2NS8A 3HOZJ 5D5UB 4BE0A 3GTQJ 5LRSA 2J5OA 5TRDA 2DMUA 1TNTA 3KZYA 1Z7UA 2IA2A 2ECBA 1DP7P 2P81A 1VFCA 3RSNA 2CFXA 3C2GA 2J5PA 4IRHA 1Q1VA 1T2KA 1SAUA 1JHHA 1U5TC 2X51A 4U0VA 5IP9J 4HF2A 4IHYA 5GP9A 3L2RA 3QPTA 4UHTA 4JP0A 5FKKA 4PJJA 5IY5H 4OMYA 3L00A 1SFXA 3FK7A 4ZDPA 2UZKA 1MNMC 4S0HB 2A6EF 2R7SA 3TQNA 1HKSA 3F21A 1R23A 3D0SA 5LEJA 1R6RA 5H20A 1F9NA 2E19A 4PJMA 4EM0B 1FYMA 3GLXA 1YRNB 2EPFA 4A5MA 5K7FA 1EH7A 2KDZA 3F8BA 2CV0A 3EQLF 4HRIA 3KLNA 2NVYJ 3JSPA 3K2ZA 2E35A 1NTCA 1TW2A 4LB5A 4LMYA 1LFBA 4DBQA 1Z1DA 2WAEA 2MABA 4Y33A 4B4CA 2O0YA 4YELA 4AC0A 1GUUA 3DU6A 3CD6I 3HKZN 5H6QA 3MKYB 4I7HA 3PO2J 5EF6A 1ZN2A 3ZMUA 2HOTA 1ETXA 1JTXA 4OWRB 4JX4A 1MD0A 4UUTA 3K1PA 4GGGA 5IP6A 3D5RC 3T8RA 1PUEE 1R4MB 3CF5F 3UKGA 2CYYA 1FPQA 1X1DA 5CVJA 4AIKA 4ZZDA 3Q9SA 1JE8A 1S7AA 3JRGA 4YEJA 3CCQI 1S6LA 2XAUA 4XICA 2DOAA 2OV7A 1RESA 1Z0XA 4AYBN 2HS5A 3O3KA 2DLLA 4G94A 3K69A 3WU0A 2LH9A 4BHCA 1MDMB 5F08A 2OC6A 3IWZA 3PNYA 5JVTA 1JT6A 3F22A 4O5VA 3RCOA 1X4OA 1SFOJ 4E7KA 4L18B 1D1BA 4EMSA 2OTJI 3I64A 5L3GA 3M07A 1XMKA 1ETYA 1FSEA 1VF9A 2ZNZA 1ZLJA 2MYSA 2XAQA 2TDXA 1XS9A 1DU0A 4GFBA 4ETSA 2EWNA 2BW3B 4V2GA 1IUYA 3CC2I 1DPUA 2EINH 5CVVA 2V1DA 2Q1ZB 5GTHC 3ABKH 4I01A 2RNGA 4C2TA 4D1QA 1A31A 2DQLA 4W1UA 1YIJI 2CS3A 1LQ1A 2V26A 3JCUC 1S7EA 4RB3C 2DO7A 5EEHA 4M3BA 1YX3A 2KIQA 4A93J 4I99C 1OPCA 2EA2A 1YITI 1SAXA 2DFIA 4DNCA 2VXDA 4IHTA 1Y8QB 1BC7C 2AO9A 4R79A 1UJ8A 1RI7A 2CQKA 3KP4A 3MCZA 4CCLA 3MWMA 5K7HA 2HYFA 1P6RA 4IZZA 1R36A 2XRLA 2JMWA 4N9IA 2EH3A 1SFUA 2E34A 2QSGX 3WGHA 1K6YA 4AIDA 2XDVA 4FE7A 1RZ4A 3CCVI 3LSIA 3OYHA 1E0EA 4A3CJ 1T98A 3ZMTA 3B02A 4A3GJ 2QBYA 4BY1J 3OL4A 3I53A 1Y1WJ 2WB1A 2LK2A 1GVJA 2EIJH 1OLTA 1QPMA 4JYKA 3I4NJ 3K10A 5EEGA 1YS6A 2LG4A 2HDDA 2XV4S 3CDHA 2WAQA 4A6DA 3OSFA 3PQJA 1K78B 3O6BB 4RGXA 1S8NA 1I39A 4J01A 3RI4A 2V1XA 4HBLA 4HZFA 1IDZA 4UNOA 1U9OA 2CU7A 1MGTA 2L4MA 3GTKJ 1T33A 3Q9VA 2E1OA 3F8FA 5E18F 2QWWA 2VQHA 3C18A 3FXQA 1OISA 2K9QA 3S16J 2FJ1A 1IRZA 3HPHA 4KYWA 4F55A 5D4RA 5BS6A 2NNNA 4BDYA 1CGPA 1TT0A 3E7LA 1MZBA 5DDGA 1BW6A 1EH6A 1ETWA 2K86A 1HW1A 2E7XA 2CWEA 1YE9A 4E4HA 1BR4A 3FXJA 3LSTA 3TDZC 4ENJA 4RBOA 3CZ6A 3BJAA 3IH2A 3NAUA 5IT9Z 2M30A 3K1MA 3OYJA 1AU7A 1L3LA 1I27A 2HR3A 5KAIC 4YIFA 2DT7B 4P1WA 1I3AA 1DQUA 3BG9A 1R4NB 2VJIA 2YS9A 3D5SC 2LBFA 4D5FA 2HVRA 3RYRA 2QLZA 3DPLC 5DCMA 3SDBA 2K9MA 2VJ4A 2K27A 3EUKL 1ZRCA 1WH5A 3VEPA 4BQAA 3S17J 4JX5A 3LSJA 2DOEA 1G3TA 3HHHA 3SFZA 2ID3A 3OIOA 2GXBA 3WTSC 1HXDA 4O6JA 2PBIA 2JSPA 4RB1A 2BZTA 3HL2A 5FLMJ 1MJ9A 1ODDA 2V4JC 3HKZA 5ED4A 3VDXA 2XF6A 2UXNA 5F0FA 4BEHA 1HF0A 4IVNA 2O6GE 3CDLA 1Z67A 4B3AA 2AQEA 1HSTA 3L2UA 1ZTRA 3QP6A 4BE1A 2KJCA 3BDDA 2R7ZJ 4NC7A 4EJUA 2NNYA 5HS7A 2ZXHA 1USTA 2CMPA 2X1DA 4IOAF 1U6GA 1DUXC 3DKYA 1YJ9I 3OR1C 3H3UA 3MKLA 4PZJA 1QNTA 1RKWA 3B73A 4AIHA 2RDPA 1X2NA 2H6BA 2LFBA 3ESWB 1HSJA 2JVGA 3E6BA 3KLOA 4A3FJ 2VPLA 3RQ4A 1WGXA 2WAFA 3HTUA 2IEKA 4AYBA 3DFGA 1VQ9I 5DUKA 3RZOJ 3DCFA 4F7ZA 3W3CA 2RREA 5HLHA 2HTJA 2MA3A 4XSXF 3EDPA 3IRQA 1J2XA 2DJIA 1GV5A 2DPUA 2R5YA 2OQGA 2XUBA 2EBIA 3BTLA 4AM3A 4HX7A 5GTIC 4I02A 5KHDA 4N4NB 1HKTA 2ZFWA 2COMA 2CO5A 3HG9A 5B1AH 2QSHX 3TO7A 5HVQC 3WGIA 3W2AA 3K1NA 4LG3A 1XGMA 2FSWA 4ZYEA 2W7NA 4G9YA 2VE8A 4IXAA 3DKXA 4LOCA 1CF7A 1ZRFA 5IYCJ 1TC3C 3PSIA 4MFEA 1FIAA 4M72A 4B44A 2HQ5A 4HYEA 5E20A 2JPCA 1REPC 1IAWA 3ZQ7A 3CMAI 3V7SA 1OYWA 2GXAA 2DK8A 3S15J 5GAEJ 3TEDA 3H9JA 3ZXSA 2HQAA 3T0YA 4XRMA 3BG7A 3NWTA 2NXNB 4HNVA 1SD6A 3IH4A 2WV0A 3WTZA 2DPDA 2PJRA 3DXJF 3C3WA 1RIOH 5HODA 2LDUA 3TOBA 2ELJA 3FXOA 3GF2A 2EFNA 1K61A 4ESBA 3WU2C 2K9NA 3ZMSA 1GV2A 4LIUA 3M8JA 3VB2A 2GA1A 1NH3A 2BVMA 1F5TA 4JBAA 3ELKA 3GXOA 3BJ6A 2LR8A 1XX5A 3BPXA 5J1UA 2ZMEB 2YU9J 2PI0A 3OYLA 3G6EI 3E6DA 3LSHA 3ZCOA 4DYCA 1W5CC 5E1XA 4CA0A 4UUVA 9ANTA 5CJ9A 2VQLA 3O8GA 3IUOA 2XGXA 3FHZA 2YSRA 2VC0A 3BG5A 5KNLA 2CG4A 2HPMA 3D1NI 2HOSA 3FMSA 1H89C 5IYDJ 2W84A 2DTZA 1YOVB 5EG0A 5ICGA 4XKBA 2R4GA 5M3MJ 3M4OJ 1CQTA 2L4AA 1IXRC 3RZDJ 2HOEA 1WJFA 2ZNYA 1S3JA 3JAMZ 4CUGA 2Z99A 1TWFJ 2HFHA 1B9MA 2MBFA 3H9QA 1MKMA 3GEZA 1RR7A 2M87A 2LY9A 3F0CA 2YX7A 4HF0A 3TP3A 2VOOA 3CLQA 2JK3A 4C3IJ 4DOZA 4JX6A 1UCRA 2R7OA 2M7BA 4G6QA 3K70C 1K4SA 2CW7A 1RC9A 5ICCA 3BR3A 1IV8A 3H3ZA 1LFUP 4IHSA 2DMTA 5IP7J 1FNNA 1FOYA 5DD8A 3GX4X 1XMAA 5HOOA 2OPTA 1D8KA 1D0YA 2RQQA 5J4YA 3PUFA 3OIQA 5CVUA 3E6MA 5KAFC 2HU9A 3GTMJ 2VT2A 2XVCA 3KEQA 3J80Z 1HKQA 5E8GA 3OYDA 3WG9A 1F43A 4RLFA 5BPIA 1RNLA 3HIFA 4E7IA 2HZDA 5C4JJ 3GUDA 2KRHA 1P7JA 2KPMA 1LNWA 1H8AC 2QBYB 2R3SA 3ULQB 1FY7A 1EH8A 4GXOA 4ZYAA 1TWGJ 5D8LB 3P9KA 3AG4H 4KN4X 1PP8F 2ZSHB 2K85A 3DEUA 3OMYA 3FM3A 4LITA 4CCMA 5JHUA 1X3WB 3KE2A 4YIIA 4FE4A 2P7CB 5CQEA 4B1RA 1BIAA 1RPWA 4BHBA 2VOPA 1WJBA 2AS5F 3S2DJ 1IXCA 3WHCA 1T39A 2ZJ2A 5JI6A 2M8GX 3C2HA 1QBJA 4LGWA 2NS0A 3S1RJ 5HLGA 2DU9A 3PJRA 2PMZN 4RM2A 3DQVC 3J7AY 1QRYA 4G7HF 3G71I 1BR2A 3ZQQA 4F52A 1ZG1A 4BL0B 3FDYA 3SXYA 2EILH 1PP7U 2GBYA 5HDKA 4DZJA 1I5ZA 2HVQA 5AIQA 3JRBA 2DA4A 4KFCA 3U1KA 1VQNI 3TW7A 5EEAA 4XKCA 5BPDA 2VBXA 1FBQA 5E1ZB 2GLOA 1ONVA 3S1MJ 3K2AA 1IZ1A 3M1CA 5J6XA 2K4JA 3QPHA 3C2BA 4I98B 2BBYA 1U8BA 2UWMA 2NOGA 5E3OA 2JA6J 3ERMA 2L01A 2IS1A 4HSRA 3ZQHA 3HJEA 3MZYA 1TQPA 1O57A 4U88A 1YG2A 2JJ7A 4DQ2A 4IO9F 1VQPI 2Y2ZA 4YG2F 2XROA 2AXLA 2XGEA 2A07F 1IN8A 4NC8A 2R0QC 3IWFA 2KRCA 4UVCA 1LPQA 3L2VA 3VWBA 5FLXZ 3GLLA 1X19A 1K7AA 1EV7A 3H35A 1I6XA 1YHQI 4LIVA 2HQRA 1V5GA 2XGDA 1W4MA 2XIGA 3KPHA 2Q8KA 4A3IJ 2QSFX 4CYCA 1LEBA 3VYUB 4RA2A 4A0ZA 1XC5A 2CQNA 1I50J 3BR1A 1B6AA 4EEFG 3R4KA 2OCCH 2DA2A 4IOCF 3AKZA 4N4OB 4XLCA 4EGZA 1OCTC 4EM1A 1TP4A 2F4OB 1SMTA 4YRVA 2IT0A 4DYRA 2YX4A 3JREA 1VQMI 3PFYA 4B3XA 3RYPA 5EYRA 4QLCU 3FXKA 3OS0A 5EGOA 4X0GA 1BW5A 2O3FA 3IL2A 3DF8A 4ZC3A 1PJRA 1S5LC 2WA0A 4ITVA 2PMHA 2X6XA 4QSHA 3KYCB 3CO6C 4KIGA 3SZTA 2K4BA 4A69C 1LVAA 5DEQA 1Z77A 2DJNA 5FD5A 1Z3XA 2DMQA 3RPUD 4L9JA 3OYCA 4UV8A 1WI3A 3H3VK 3K4BA 2JTVA 3OYMA 2R5YB 4BACA 3ZRGA 1K6OA 1W0UA 4RGUA 3N4MA 4A12A 2M3AA 4E70A 1Z21A 3HSRA 1IN4A 2BY1A 2DN0A 1JXSA 3AG1H 2BY2A 5J8FA 1T0FA 3F6OA 1HOMA 1KGSA 4CH7A 4HOBA 5AONA 3QRFF 1BI0A 1E3HA 1IO2A 1R7JA 3N05A 2Y30A 1XGSA 2VKDA 4CGZA 1WQ2A 2JT1A 1A6IA 3LSPA 1Z7LA 1VTNC 2IJLA 3H5AA 1KU9A 3F72A 1WHUA 4HAMA 4JOMA 4BGDA 4XOPA 4IEJA 3GMEA 5HS8A 3E0JB 1DU6A 2HWVA 1AHDP 3KZZA 4FT8A 1JI8A 1NG7A 1DP3A 2E2JJ 2PJRB 3OOUA 1WWXA 2F5FA 2FNAA 5M5YJ 1TT5B 2M0MA 1MSEC 1U5TB 2LRDA 2O9LA 3VYSB 1VZ0A 1D5VA 1IRFA 4CICA 5FO5A 3JRAA 3G4SI 2M34A 2L9NA 4IF4A 1H9TA 1ZGJA 1NG6A 5F64A 2GQQA 4GYGA 2A5WA 1XSVA 1ETQA 4NQWB 3RIRA 1Z9CA 2A5YB 1SD5A 2Q2EA 2K9LA 2M7AA 3G3ZA 5F0CA 4E6KG 3S1NJ 1P4XA 4XLEA 2IXSA 1AOYA 2Y75A 2NVTJ 3BY6A 4L5EA 1BI1A 1YS7A 2JPBA 2L7MP 3BZKA 2ESHA 1NHAA 4HW0A 2HXOA 2YR2A 1MSFC 1AKHA 3WTWC 3SEQA 2D1VA 2FE3A 2XSJC 3HXLA 4B47A 1E3PA 1TWAJ 1HC8A 2LVSA 3Q0VA 1BC8C 1P7IA 2NAZA 4OAYA 4KMFA 3BWGA 2R7QA 2QKLB 4KITB 2Z2SB 2ZC2A 3MEXA 3DLAA 1QPIA 4P9FA 4CDGA 2ZFUA 1FBUA 2M45A 5TJJA 2V7FA 3CLOA 2L3DA 3DEEA 1ZAOA 3FM5A 2IGOA 1FWZA 3E1SA 3K9TA 4HG2A 2QVOA 3S1QJ 2PMZA 1MMGA 1EKEA 4Y3OA 3V8JA 3RKYA 1VQ5I 1RKTA 2F6CA 2VT3A 3M9AA 3OYNA 1LDDA 1YI2I 2P6SA 4ZH4F 2E1MC 1ON2A 2QENA 1BM9A 2CUEA 1J9IA 4MQVA 1R9TJ 3AG2H 2IVMA 2PLYA 2GOXB 1WZ2A 1G2HA 4ZDOA 4Q4ZF 4BJTA 4BAYA 5J1YA 4ENNA 2I8DA 2X0LA 2BE5F 4G6DA 4Q48A 2VQCA 2DW4A 4AIJA 4ASNA 1MMAA 2VKVA 1MMNA 2LREA 3CJRB 1XCVA 4XM3A 2KZVA 3HB9A 4KJZA 3CCEI 2O8KA 4KISA 4M3DA 4HX8A 3VPRA 1TWCJ 4LFUA 3HBLA 2FOWA 2BHZA 2O7OA 5H6RA 4MQ9F 1T38A 4KT6A 2KIMA 2V9KA 3O2PE 1JGGA 1ZR2A 2ISZA 3S3MA 2COBA 1P2FA 4GDFA 4V2FA 3I56I 5LGTA 4BNCA 1KYWA 2DA7A 1STZA 3I0TA 1LE8A 3S2WA 1W1WE 2DFHA 2EV5A 1I3QJ 3N97A 1V54H 4BXFA 1IG7A 2LY2A 1GXPA 2G7UA 1W0TA 1QU3A 5C3EJ 3H9GA 4FETA 2LD5A 2DYSH 4PK4A 3J7YJ 3I54A 2V6CA 2D5VA 4ESJA 1JHFA 1JTYA 3FXLA 3FF5A 3OR2C 1ON1A 2BXYA 5CVIA 3S8PA 3CO7C 2IS4A 3WE3A 1O3TA 2RV8A 3AL0C 2DMPA 2XAGA 1GT0C 2GZWA 4E7JA 5EJCA 5BMZA 3IC7A 3BCAA 3V42A 2D45A 2OBPA 3G1OA 1LJ9A 2IGKA 2OZUA 3H5RA 2X6OA 4A5NA 1X1CA 4X6AJ 1R5HA 4XSZF 2MG4A 1LEAA 4ZTJA 4A3BJ 1VQ6I 4A6EA 1V3FA 4CCJA 1OKRA 5D4SA 4HV6A 1JKOC 3MMYB 1GVDA 3K4LA 4QIWN 2VBYA 2QQ9A 2XAJA 5D8KB 2MC4A 1POGA 1B1BA 2TCTA 2H8WA 1XB4A 3HTSB 4A2UA 2PEXA 2H1KA 4HPQA 5FKMA 1Y6IA 4P96A 3FIWA 2LF8A 1V4RA 4GRIA 5KVRA 3GFIA 2MD0A 1OR7A 2LOOA 3T5XA 2G9WA 2K7LA 4HQMA 3LSGA 2XPUA 2HI3A 4HNTA 2DA6A 4KIFA 2LSOA 3SFIA 1V5FA 2JRTA 2FMYA 2PN6A 4L9VA 3BG3A 2DT5A 3VSLA 4YFNF 1UHSA 1TBXA 1Z3YA 2GA2A 3LSMA 2XPWA 2CRGA 2BGCA 2O8XA 5D6FA 2XF7A 4HLXA 3T1BA 3HUGA 4M3EA 3FK6A 5H2FC 4NNJA 2DA1A 3CC4I 2EB7A 1S72I 2VB6A 3KEYA 3IV5A 4EATA 1QGPA 4MEYF 4BBRJ 4QPOA 5DUIA 3E5UA 3REOA 1SD4A 3CP2A 1WH7A 5EDNA 3W6KB 3K70D 4A3JJ 3KEOA 3LNQA 2JA7J 2DBBA 1K83J 1O3SA 4Y7NJ 2F48A 1NK3P 2CV1A 1P4WA 1W7PA 2G7HA 1TZLA 2CUFA 4OOIA 1PVEA 1EF4A 1T0FC 1FIPA 1PUFB 1JJ6C 2DI3A 4L9NA 1B72B 3KYDB 5J1RA 1J5YA 3D5LA 5JR3A 2D2WA 1OYYA 2EZLA 1J0RA 2F5CA 2FEZA 3HOXJ 2V9VA 3IP4B 3S3OA 2L0KA 2FQ4A 2P4WA 3FHNA 3QPSA 4L5IA 5J40A 4HQEA 2QQAA 4F93B 1R5ID 2EZIA 3V7RA 1U8RA 4LG0A 4ON0A 2CJJA 4OU0A 2R7UA 5IT9K 4BQQA 3A1YA 1S9HA 4U0WA 4UXNA 4J00A 3HOYJ 3CMYA 3B6AA 4Y15A 2HVSA 1MBKA 1H88C 5JFRA 3QYEA 3JTGA 4BKXA 1QZEA 3GCMA 2XPVA 3KP6A 3PFIA 5DM6F 4XOTA 4NBQA 3ZQIA 3PNVA 3ZMZA 2MGQA 3TO6A 4D7NA 4BQOA 4CXFA 1ACIA 2DFEA 2QQBA 2CW8A 1O3RA 4PFPA 2DT6A 2UUZA 3BTCA 3ZMVA 1Y1VJ 1ZR4A 5L3DA 2F5VA 2XKPA 1HLVA 3LQRA 4WXDA 1TTYA 3MKWB 2VQGA 5LRRA 2UV1A 3GTGJ 4Y17A 4KT5C 1W5TA 1H9GA 3G1MA 2R7DA 3ASNH 3FX3A 2FX0A 5ICFA 3SYTA 3U2RA 2R92J 1XTAA 1MBFA 1V55H 3CJQB 4II2A 3R60A 1ETVA 1VQ7I 4BH9A 1FT9A 1MBGA 2A6HF 4KN7X 1D8JA 4L5JA 2PQ8A 3V7CA 3UNGC 3FISA 2ESNA 2ZB9A 3CCUI 5FFXA 2DTRA 3V4GA 4I6ZA 1R1VA 4P5OA 2FMLA 2H94A 2WTEA 5HNFA 3M8EA 3TW6A 2NVUB 4G7ZF 2XB0X 2Z16A 3CMEI 4IL6C 4CCOA 3ROUA 1D3YA 4F92B 5J8CA 2MSYA 4EJWA 4II3A 5F27A 3S32A 2VIXA 1SD7A 2L7ZA 1YTYA 3EUAA 1DGWY 5CQGA 2LKSA 3JSOA 4LK1F 1BOAA 3DU5A 2HOAA 3A02A 3CCRI 3BOQA 3BTJA 2CQ7A 2IS2A 3HGGA 3TP0A 2H09A 3FMQA 2FU4A 5A2QZ 4OMZA 1RRJA 1F36A 1QO0D 3K4CA 3M1EA 1HW2A 1ZGAA 4UUSA 2RC4A 5FRNA 1A36A 3QP5A 2RNJA 1BI3A 3AFHA 2ZO4A 4F91B 3PIOF 2ZJRF 1FYKA 1HDDC 3PIPF 3LSRA 4C2MJ 2L2OA 3OYKA 2RQPA 2IPQX 4UB6C 1FC3A 5E3MA 3BR2A 1WCMJ 5IOZA 5J47A 2F5DA 2FNPA 2LTPA 3ECOA 1K79A 4C9YA 3CMMA 4KIBA 2L9RA 1HW5A 1KU2A 1Z6TA 2DDAA 4IJAA 3BPVA 2WBMA 2VL8A 4LD5A 4BJ6C 2KIUA 1LDKB 1JKQC 1TLHB 2XKOA 1R1UA 2Y9ZA 2VE9A 4PCQA 5FGMA 1UZCA 2KMUA 3ZMDA 4IHXA 1IN7A 1UAAA 3TL4X 5B5EC 3GTPJ 3E6CC 3ABLH 1LB2A 3OYAA 2EFWA 1G3SA 3MQ0A 3E97A 1KU3A 5L3CA 2R5ZA 3TDUC 4L0ZB 4FX0A 4ZZLA 3JRIA 3VFZA 1IV6A 2JSCA 3E5XA 3B6CA 1IN6A 3LMMA 2OJED 2A6TA 4Y52J 1D0XA 5JLWA 2EV6A 4IRGA 1MDMA 1KA8A 4JQFA 5D5XB 2Z33A 2FA5A 4XBFA 1X58A 1QVTA 5B1BH 3JRFA 2H6CA 1O4XA 2M4GA 2LP0A 5KCMA 3RKXA 3ZQFA 4HDVA 4KICA 2RGVA 1FX7A 2K40A 4P9UA 3IKTA 3F3XA 2WY7Q 2W25A 2MLGA 4A0XA 2QZ8A 1KQ8A 1OR7C 1YX5A 2BW3A 3RQIA 5DS9A 2JA8J 2VC1A 2STWA 1UFMA 4CCNA 2DAOA 2OZ6A 3BP8A 3CJTB 4YFXF 2XF5A 3DEWA 2KLOA 2EJRA 2MH2A 3JAMK 4WWCA 2EIMH 3H92A 2ME0A 4FISA 3ABTA 3BCBA 3CCJI 4B48A 3WG7H 2JWTA 4XQFA 3CCMI 2XRNA 1D1CA 3WGGA 4XLPF 2E1NA 4I2OA 4L0YB 2B7EA 3ML6A 1QHHD 3BZCA 3PSFA 1C0WA 3WTUC 1WRJA 3IAS2 3W2WA 4ZDLA 4BJ5C 2H1LA 3RPQA 5ILVA 2IBDA 4PSWA 4A3EJ 5HLTA 4Z6YA 2UXXA 2KHMA 1ERDA 2K02A 1LUJB 4I0BA 2Z5UA 3COAC 3R61A 1EJ9A 2KISA 1QZZA 4PSXA 5GPCA 4ZYDA 3JTHA 3HOSA 2IGNA 2X4HA 3HEFA 3TMOA 1IXSB 4Y13A 1FEXA 3QU3A 3F23A 2HYGD 2OCEA 3P9CA 2BV6A 3J80K 3M3YJ 2WWYA 4FX4A 2HTSA 1WSUA 1P4AA 4IKFA 2EK5A 3G73A 3MZHA 2NVXJ 3HUGB 2ZBKA 4C3JJ 1Y39A 2QM3A 4PJ0C 3KYLA 3DWLE 2BVLA 2NOJB 2G0EA 2V1NA 2P5VA 3ERED 4LLNA 2FUG2 3ECHA 3EUHA 1ITYA 2LBFB 1SVLA 3NQOA 2R93J 3ZR8X 4C3HJ 2IW5A 3QYBA 5DCMB 5FKLA 5CVRA 1IC8A 3I5UA 1H0MA 1UHWA 5J3LA 1MH3A 1BA5A 3U21A 5F1RA 4M3FA 2M4KA 2H8RA 5LGNA 1W7PB 1FOXA 1TQMA 4UV9A 1ORKA 4XR6A 2HKXA 4AVPA 1K78A 4EVIA 1G8XA 2M2EA 2KFDA 5GAGJ 4QWQA 3CTAA 2XASA 2IRFG 2E2HJ 1I1SA 1USSA 1WVRA 2JVHA 1OFCX 2EZKA 2E7WA 4U7DA 2LMDA 4DYQA 2PMUA 1JUPA 1WPKA 2A69F 4BEHB 1B8IA 5ILSA 3ISPA 1K4TA 5JLXA 4A3KJ 1YW8A 4Q47A 1T8IA 2PJPA 3KP5A 2L02A 2PG4A 4MNUA 5E3LA 5CKTA 4E7LA 1N77A 2B0LA 5D6EA 4RGRA 1U9NA 1UMQA 5EZHA 3FMRA 3Q0WA 1XDUA 3BT9A 3BJOA 1GLNA 2LC2A 1A6QA 2IGMA 1BJZA 2AHQA 3H1CA 4F3QA 2LKXA 5ERIA 4AUXA 4PJLA 1OMIA 3I4PA 4K2EA 1VQLI 4OIQF 3I4MJ 2EQRA 1T95A 3L2QA 3CCLI 2CV2A 4OIPF 1XG1A 1QA6A 4U0YA 4CCKA 4FTHA 4D5CA 1XN7A 1S7OA 1Q1HA 5IYBJ 1SEUA 3LQQA 1MBEA 5M5XJ 2IP2A 4PDKA 5CPRB 5FLXK 3F8NA 2OA4A 2KKOA 1D1AA 5LEKA 2NVQJ 4YFKF 1N75A 4IRIA 1ULYA 2M8EA 3I71A 1VQKI 1JUMA 5AIPA 2VXZA 4KNYA 2O03A 4BXUA 4ESFA 5L3BA 3HRMA 2E2IJ 3MFKA 1G3WA 4MHGA 2ZXWH 1CF7B 3NRVA 3GW2A 3R0AA 2FBIA 1R49A 1M1EB 2OTLI 3QOEA 1EA3A 4UB8C 3IHUA 4WXCA 3HSEA 5F04A 3CCSI 2ZXJA 4XMYA 4LJZF 2DK5A 3ABMH 2GXGA 3IRRA 4O3MA 2JA5J 3S2HJ 3ZGKA 1TNSA 3VODA 3G2BA 2FBHA 4M71A 4Q5SF 2V6EA 1JKPC 4IQJA 4M6VA 3A4CA 3TKYA 1MMSA 2P0WA 1Y0NA 1IW7F 2R7VA 3NWSA 4EJOA 3OYIA 2P6TA 1HCRA 2QGUA 1ZHFA 5FKNA 4AU7A 3LFKA 1SVOA 4BXXJ 1OCCH 2MW8A 2JUGA 5LLQA 5LD2C 2Y48A 3I9V2 3CESA 5HDNA 3F6VA 1APLC 3DV8A 3MVPA 3ZPLA 2HQNA 1VQ4I 1OCOH 1SFEA 4UUSB 3MZ8A 4XN3A 2JQ7A 2JRMA 3VOEA 1UG0A 5HNHA 3LFUA 5DD4A 1I1GA 3EPZA 2LNBA 3FBIB 4D9JA 4XL9A 3L09A 5FRMA 3FWEA 4AD9A 2BYVE 2W24A 3RKWA 3BROA 6PAXA 2OAZA 4CHUA 2B9SA 2E36A 1VI0A 5EG0B 4IQ4A 3K0LA 3M7GA 4LLGF 5CYVA 2V1UA 1MIJA 2F2EA 2Z3YA 3DPUA 5IT3A 1FMVA 3F8CA 5BOXA 1L0OC 3OOPA 2Y69H 3KP7A 4ABZA 4EV0A 1VQOI 3KX2A 3G1LA 3H0GJ 1ZH5A 2CGPA 2ZKZA 1KONA 4XLHA 2VLAA 2R7WA 3A2KA 2TRTA 3QU6A 4M9XA 2C6YA 4CYDA 2CQQA 1OCPA 2M5WA 2I5UA 2R7RA 4A3LJ 2YUSA 1PYVA 3HYIA 1SMYF 1O3QA 4RAZA 2QCOA 2VUMJ 1BN5A 4M73A 2R5ZB 2I10A 4NDLA 4RGSA 2M9HA 4U7BA 1MNEA 2GWRA 1A5JA 3FKIJ 1FOWA 2KT0A 3KZIC 4N9HA 5L3EA 1R58A 1WKMA 2ID6A 2VN2A 2QEXI 5E1WA 1MBHA 1YW9A 3DTKA 1U0JA 2YU3A 3BR5A 4M3GA 2ZMEA 3P9IA 4M9ZA 1BOBA 2ZXIA 4M9SA 3DBRB 4MLOA 2N8GA 3HM5A 2LKPA 2Q0OA 3RJPA 1P9QC 5LFAA 3J81Z 1FOKA 1W36C 2XAFA 3S3NA 3OYEA 1E3OC 1HDPA 2E1MB 3ONQA 3TBIA 1MMDA 3EYYA 2MH9A 2YPRA 3CC7I 3RTRA 1B9NA 5FLVA 2EFOA 3Q3SA 3WHBA 1DGRM 5ICEA 3GZ6A 2ZJPF 2GIZA 3I55I 2B63J 2A3SA 2BHYA 2Y31A 3L1PA 2JUCA 4Z2YA 3OSGA 3HOUJ 3F8MA 2XAHA 4EJTA 1FLIA 1ETKA 2QQ8A 2Y0MA 5IOYA 4MGRA 4XRSG 3GFJA 4AVZA 4ZTFA 4EM2A 5M3FJ 3CUQA 5E8IA 3SZPA 1N25A 3L2WA 3HDDA 1XGOA 3U9GA 2F5EA 3ZOBA 3K6GA 4FQGA 4RLQA 1A35A 2GM4A 2QYOA 1RUOA 1ENHA 2DA5A 2QUFA 3EUHC 1IJWC 2X48A 3FBNB 2L54A 1WI9A 5C4XJ 3E5QA 2EV0A 2W48A 3HRSA 3T8TA 2DYRH 1R5GA 2MFZA 3DTIA 4I76A 2W4SA 1LVKA 2ELKA 4MEXF 1ZGWA 3H5NA 3J81K 1IUFA 1ZELA 3HHGA 4BUPA 2OUMA 1TW3A 2Z1DA 1XMXA 3QYFA 4DZPA 1U78A 1B4AA 1FJLA 3O8HA 4DIQA 1R22A 3JW4A 3R0JA 4GYIA 2JZYA 3A01A 2OU2A 3HSFA 3AL0B 4PGGA 1X1AA 2VASA 5K5OA 1G3YA 2KRFA 5FROA 1TL8A 3OS2A 3FKJA 2WV1A 2W1OA 3OV8A 1XPXA 4CZZA 2KDOA 2KQRA 2Y0SN 4OINF 3HOVJ 1WJEA 5K5RA 2VODA 1IGNA 4RAYA 2HYJA 1PDNC 1VNDA 4XIDA 1HQCA 3GBGA 3Q5FA 4NB5A 3E3VA 5TGTA 4EJVA 5IPAA 5F1JA 3AAFA 3BQZA 3GWZA 5FKOA 4MIMA 3CQZJ 4WXHA 1QQIA 1XGNA 4CYCB 5M5WJ 5D5WB 5FFZA 1XDSA 3DPTA 2CUJA 1GHCA 4BS9A 3I58A 3LAPA 1TWHJ 3JRHA 1B8IB 3VYRB 2VONA 2V79A 1YW7A 3OYFA 4IHWA 4CSWA 3HOWJ 3SZGA 3K4NA 4OIRF 4DBRA 4G12A 3C1DA 1QHGA 1G4DA 4M6XA 2M0CA 2L7FP 5BQTA 1VQ8I 2X85A 2EA4A 5EGOB 2KL4A 3QOPA 1E17A 1X4PA 3SHFA 1ZLKA 1KU7A 4MTDA 1YO5C 1OYIA 1R00A 2DODA 5LBQA 3F9KA 5KK1A 1J7KA 4XKVA 3HC7A 2EIKH 4YIRX 1B59A 4FCYA 3GO5A 2F4IA 2IAIA 1V5EA 2A05A 4BY7J 2X1CA 2X1EA 2LY1A 5D5VB 1JKRC 4XRFA 4D7MA 3BC8A 3GTJJ 1FYLA 2OF7A 2DQRA 3OL3A 1KZHA 2W57A 4WK8F 3DBLB 4KMUX 4IX7A 4UVAA 2LLKA 1ZRDA 2IS6A 2VBWA 4HA8A 1HBXG 4MFDA 3K7AJ 3MKZA 1FSHA 2RN7A 4R8HA 3PNTA 3I3LA 3LSKA 2X6WA 3L2CA 1WFXA 3H36A 2DFFA 1ZKGA 1AWCA 3AG3H 1AA7A 2D1HA 5DTDA 3WTXC 1J75A 5FD6A 3I59A 2R7XA 1P92A 4TV7A 1U2WA 3OS1A 4ENMA 5HS9A 1SC7A 4XKWA 5ILUA 2P5LC 1SVMA 4I0AA 2EZHA 3ABUA 2GOMA 1SANA 3BR6A 3OYGA 4BDZA 2FRHA 3IAM2 1X3UA 1DPRA 5BNGA 5GAHJ 3ZQLA 3LAJA 2GIVA 4XLNF 2KZGA 3HGYA 1JJ8C 4H4KC 1BBYA 3MN2A 2FQ3A 2WC2A 4GO1A 3GTLJ 3KFWX 1JT0A 1ZQ3P 2H27A 1W7PD 2Y9YA 1YJNI 2HNHA 2VJ5A 4JK1X 2W85A 3PQKA 5K1YA 2VJJA 3LL7A 4IHVA 5HDGA 2BOLA 4FASD 4V19K 1ZG3A 1J09A 2IA1A 3BR0A 2Q2EB 5GPAA 1ZK8A 4GCVA 4AWXB 3OYBA 3LA3A 2P7VB 3CP8A 4A0YA 3DBHB 3W2VA 2NRAC 4Y4RA 3FXMA 4D0PA 2ISYA 4S05A 1A04A 2QKMB 4ANJA 1YFHA 1RUNA 3MD2A 1JGSA 2DA3A 1AKHB 5B66C 4KUMA 3DP7A 3V8LA 2O61A 1R71A 1WJ5A 3W6VA 3J7AO 1TQIA 3NEUA 4XORA 3TGNA 1T08B 1YYVA 2BY3A 2E5ZA 4E7SA 1FZPB 4PJNA 1MH4A 3UR3C
chains in the Genus database with same CATH topology
1U9OA 2CU7A 2G0EA 5F0CA 3GTKJ 3S1NJ 1T33A 2E1OA 1ITYA 2NVTJ 4L5EA 2R93J 2K9QA 3S16J 2FJ1A 1IRZA 4C3HJ 1IDZA 2L7MP 5FKLA 1IC8A 3E7LA 5J3LA 2HXOA 1MH3A 1BA5A 1MSFC 1AKHA 1BW6A 1ETWA 1YRNA 2K9SA 4M3FA 2H8RA 1TWAJ 4RBOA 2LVSA 3Q0VA 1P7IA 1ORKA 3IH2A 3NAUA 4W97A 1QPIA 1AU7A 2M2EA 2XSDC 2E2HJ 1OFCX 2EZKA 3BG9A 4DYQA 5E3NA 1JUPA 1WPKA 2YS9A 4D5FA 2HXIA 3S1QJ 1B8IA 1RKTA 4A3DJ 2ME6A 1WH5A 5JLXA 4A3KJ 2ECCA 4A3MJ 3S17J 4BBSJ 3BQYA 3JR9A 2CUEA 4JX5A 5E3LA 1JUSA 3LSJA 1R9TJ 1LE8B 1G2HA 2ID3A 1U9NA 3OIOA 1UMQA 5EZHA 5J1YA 3Q0WA 3BT9A 1NK2P 3Q0UA 4DW6A 2VKVA 1BJZA 5FLMJ 2AHQA 5K7ZA 2LKXA 3HB9A 2O8KA 4AUXA 1IDYA 3NARA 4M3DA 3ZQCA 5F0FA 1HF0A 3VPRA 1TWCJ 3I4MJ 2EQRA 3PM1A 3HBLA 3JRCA 1XG1A 3CDLA 2O7OA 4B3AA 3QQAA 4FTHA 4D5CA 1JGGA 2RAEA 3BTIA 3ZQGA 4RDUA 1ZTRA 1ZR2A 2COBA 5IYBJ 4V2FA 1MBEA 5M5XJ 2R7ZJ 2DA7A 3GTOJ 2NS7A 3LOCA 1LE8A 2NVQJ 4X1EA 1I3QJ 1JUMA 3MKLA 1RKWA 1IG7A 1X2NA 2LFBA 1W0TA 4A3FJ 3IH3A 3CCYA 2E2IJ 1WGXA 5C3EJ 3RKQA 2IEKA 1X2MA 2LD5A 3RZOJ 3DCFA 2D5VA 3PO3J 5F04A 3A01B 3SJMA 1GV5A 1JTYA 2R5YA 2EBIA 3BTLA 2DMPA 1GT0C 1D5YA 5C44J 2JA5J 3S2HJ 3G1OA 2CQXA 2X6OA 4X6AJ 2MG4A 1JKPC 4A3BJ 4M6VA 1HCRA 4LOCA 5FKNA 1JKOC 5IYCJ 4MO7A 1GVDA 1TC3C 4BXXJ 2MW8A 4MFEA 2QF7A 1FIAA 4QIWN 2HQ5A 1POGA 3S14J 1I6HJ 2TCTA 1APLC 3MVPA 2H1KA 4UUSB 3S15J 2FD5A 5FKMA 3TEDA 3FIWA 1BL0A 4XRMA 3LSGA 2XPUA 4HNVA 2HI3A 3IH4A 1FTTA 1T56A 2DA6A 5HODA 3SFIA 1VI0A 5EG0B 1K61A 5F0HA 3BG3A 2K9NA 1GV2A 1UHSA 4QTRA 2XPWA 2CRGA 1GDTA 4ABZA 2LR8A 4M3EA 3FK6A 5J1UA 3G1LA 2DA1A 3H0GJ 2YU9J 3IV5A 2TRTA 4DYCA 4BBRJ 9ANTA 4XK4A 2CQQA 1OCPA 1RETA 3O8GA 4A3LJ 2YUSA 3BG5A 1WH7A 5EDNA 2DMNA 3D1NI 4A3JJ 2QCOA 2HOSA 1H89C 3LNQA 2VUMJ 5IYDJ 2JA7J 1K83J 2DTZA 4Y7NJ 5EG0A 2R5ZB 1NK3P 2I10A 4NDLA 2M9HA 2CUFA 5M3MJ 1EF4A 3M4OJ 1CQTA 1A5JA 1FIPA 1PUFB 3FKIJ 1JJ6C 2KT0A 2JN6A 3RZDJ 1B72B 2ID6A 5J1RA 1MBHA 2X9DA 1OJLA 3BR5A 4M3GA 1TWFJ 4J19A 1RR7A 2EZLA 4MLOA 3HOXJ 2N8GA 2LY9A 3HM5A 3F0CA 3TP3A 2L0KA 3QPLA 2XB5A 1E3OC 2FQ4A 2JK3A 4C3IJ 1HDPA 1QVUA 3QPSA 4JX6A 2VI6A 2EZIA 2XGCA 2CJJA 5EZGA 2WB1N 3BR3A 5FLVA 3Q3SA 3WHBA 1LFUP 2VPRA 1PUFA 2B63J 2DMTA 3CMYA 3B6AA 5IP7J 5FJ8J 3HOYJ 3L1PA 2Y31A 1MBKA 3OSGA 1B72A 2VKEA 1H88C 2WAQN 3HOUJ 2OPTA 4BKXA 1ETKA 2XPVA 1MBJA 5IOYA 3ZQIA 4XRSG 3GTMJ 2MGQA 4D7NA 5M3FJ 1F43A 4XRSA 3JRDA 3HDDA 1ZR4A 3ZOBA 3BTCA 1Y1VJ 5C4JJ 2GM4A 1P7JA 1HLVA 1H8AC 1ETOA 1ENHA 2DA5A 1IJWC 3SDGA 3GTGJ 1TWGJ 2X48A 3A03A 3G1MA 2R92J 1FTZA 1UG2A 2FX0A 1MBFA 2NS8A 3HOZJ 3GTQJ 5C4XJ 2DMUA 1ETVA 2ECBA 2W48A 2P81A 1VFCA 1Q1VA 1MBGA 4I76A 4FE4A 4B1RA 5IP9J 2ELKA 4IHYA 1RPWA 5GP9A 1ZGWA 3FISA 1IUFA 2ZB9A 4DZPA 4JP0A 5FKKA 4I6ZA 1U78A 3S2DJ 1FJLA 3O8HA 3FK7A 3WHCA 3TW6A 2M8GX 1MNMC 2XB0X 4S0HB 3A01A 3S1RJ 2PMZN 2MSYA 1QRYA 5F27A 2WV1A 2E19A 2GBYA 1YRNB 4DZJA 5K7FA 2L7ZA 3JRBA 2KDZA 2Y0SN 2NVYJ 3HOVJ 2DA4A 3TW7A 5EEAA 1NTCA 1IGNA 2HYJA 1VNDA 4XIDA 2GLOA 2HOAA 1LFBA 3A02A 3S1MJ 3GBGA 3K2AA 5IPAA 3BTJA 4B4CA 5F1JA 3HGGA 3TP0A 3BQZA 4AC0A 5FKOA 4MIMA 1F36A 1GUUA 3C2BA 3CQZJ 3HKZN 1U8BA 2NOGA 5E3OA 4CYCB 5M5WJ 2JA6J 3PO2J 5EF6A 3ZQHA 1ETXA 2HOTA 1JTXA 4UUSA 1TWHJ 3JRHA 1B8IB 4JX4A 4UUTA 5IP6A 2JJ7A 4IHWA 3HOWJ 2Y2ZA 3UKGA 1HDDC 2XGEA 4G12A 2R0QC 3LSRA 4C2MJ 3JRGA 2M0CA 2L7FP 5E3MA 3BR2A 1WCMJ 5IOZA 5EGOB 2LTPA 4XICA 1RESA 1Z0XA 2XGDA 4AYBN 2L9RA 4A3IJ 4CYCA 4FCYA 1XC5A 5F08A 2IAIA 1I50J 3BR1A 1JKQC 1JT6A 4EEFG 4BY7J 2DA2A 2Y9ZA 1JKRC 4D7MA 1SFOJ 3GTJJ 2OF7A 1OCTC 1ETYA 4IHXA 2LLKA 1VF9A 4DYRA 3GTPJ 4MFDA 3K7AJ 3JREA 1XS9A 1DU0A 4GFBA 5EYRA 4V2GA 5EGOA 1BW5A 2R5ZA 1IV6A 3JRIA 1ZKGA 3B6CA 4QSHA 5DTDA 4Y52J 5JLWA 4W1UA 4A69C 1S7EA 1Z77A 2DJNA 2DMQA 4M3BA 1WI3A 1X58A 3H3VK 1QVTA 3JRFA 2R5YB 4A93J 1O4XA 2LP0A 2EZHA 1W0UA 3ZQFA 1SANA 3BR6A 2K40A 2AO9A 5BNGA 3ZQLA 2DN0A 3RQIA 5DS9A 2JA8J 3HGYA 1JJ8C 5K7HA 1HOMA 2XRLA 3DEWA 2JMWA 3MN2A 2EH3A 3GTLJ 2ME0A 4FISA 1JT0A 1ZQ3P 2Y30A 2Y9YA 2JWTA 4FE7A 4IHVA 1A6IA 3LSPA 3BR0A 4A3CJ 5GPAA 1ZK8A 4A3GJ 2IBDA 4IEJA 4A3EJ 4BY1J 1DU6A 1AHDP 2E2JJ 1Y1WJ 3OOUA 2LK2A 2DA3A 5GPCA 1AKHB 3HEFA 4JYKA 5M5YJ 3I4NJ 1FEXA 1MSEC 3W6VA 2HDDA 2O9LA 3OSFA 3M3YJ 3JRAA 2M34A 2NVXJ 1MH4A 1ETQA 4C3JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9O A;  2CU7 A;  2G0E A;  5F0C A;  3GTK J;  3S1N J;  1T33 A;  2E1O A;  1ITY A;  2NVT J;  4L5E A;  2R93 J;  2K9Q A;  3S16 J;  2FJ1 A;  1IRZ A;  4C3H J;  1IDZ A;  2L7M P;  5FKL A;  1IC8 A;  3E7L A;  5J3L A;  2HXO A;  1MH3 A;  1BA5 A;  1MSF C;  1AKH A;  1BW6 A;  1ETW A;  1YRN A;  2K9S A;  4M3F A;  2H8R A;  1TWA J;  4RBO A;  2LVS A;  3Q0V A;  1P7I A;  1ORK A;  3IH2 A;  3NAU A;  4W97 A;  1QPI A;  1AU7 A;  2M2E A;  2XSD C;  2E2H J;  1OFC X;  2EZK A;  3BG9 A;  4DYQ A;  5E3N A;  1JUP A;  1WPK A;  2YS9 A;  4D5F A;  2HXI A;  3S1Q J;  1B8I A;  1RKT A;  4A3D J;  2ME6 A;  1WH5 A;  5JLX A;  4A3K J;  2ECC A;  4A3M J;  3S17 J;  4BBS J;  3BQY A;  3JR9 A;  2CUE A;  4JX5 A;  5E3L A;  1JUS A;  3LSJ A;  1R9T J;  1LE8 B;  1G2H A;  2ID3 A;  1U9N A;  3OIO A;  1UMQ A;  5EZH A;  5J1Y A;  3Q0W A;  3BT9 A;  1NK2 P;  3Q0U A;  4DW6 A;  2VKV A;  1BJZ A;  5FLM J;  2AHQ A;  5K7Z A;  2LKX A;  3HB9 A;  2O8K A;  4AUX A;  1IDY A;  3NAR A;  4M3D A;  3ZQC A;  5F0F A;  1HF0 A;  3VPR A;  1TWC J;  3I4M J;  2EQR A;  3PM1 A;  3HBL A;  3JRC A;  1XG1 A;  3CDL A;  2O7O A;  4B3A A;  3QQA A;  4FTH A;  4D5C A;  1JGG A;  2RAE A;  3BTI A;  3ZQG A;  4RDU A;  1ZTR A;  1ZR2 A;  2COB A;  5IYB J;  4V2F A;  1MBE A;  5M5X J;  2R7Z J;  2DA7 A;  3GTO J;  2NS7 A;  3LOC A;  1LE8 A;  2NVQ J;  4X1E A;  1I3Q J;  1JUM A;  3MKL A;  1RKW A;  1IG7 A;  1X2N A;  2LFB A;  1W0T A;  4A3F J;  3IH3 A;  3CCY A;  2E2I J;  1WGX A;  5C3E J;  3RKQ A;  2IEK A;  1X2M A;  2LD5 A;  3RZO J;  3DCF A;  2D5V A;  3PO3 J;  5F04 A;  3A01 B;  3SJM A;  1GV5 A;  1JTY A;  2R5Y A;  2EBI A;  3BTL A;  2DMP A;  1GT0 C;  1D5Y A;  5C44 J;  2JA5 J;  3S2H J;  3G1O A;  2CQX A;  2X6O A;  4X6A J;  2MG4 A;  1JKP C;  4A3B J;  4M6V A;  1HCR A;  4LOC A;  5FKN A;  1JKO C;  5IYC J;  4MO7 A;  1GVD A;  1TC3 C;  4BXX J;  2MW8 A;  4MFE A;  2QF7 A;  1FIA A;  4QIW N;  2HQ5 A;  1POG A;  3S14 J;  1I6H J;  2TCT A;  1APL C;  3MVP A;  2H1K A;  4UUS B;  3S15 J;  2FD5 A;  5FKM A;  3TED A;  3FIW A;  1BL0 A;  4XRM A;  3LSG A;  2XPU A;  4HNV A;  2HI3 A;  3IH4 A;  1FTT A;  1T56 A;  2DA6 A;  5HOD A;  3SFI A;  1VI0 A;  5EG0 B;  1K61 A;  5F0H A;  3BG3 A;  2K9N A;  1GV2 A;  1UHS A;  4QTR A;  2XPW A;  2CRG A;  1GDT A;  4ABZ A;  2LR8 A;  4M3E A;  3FK6 A;  5J1U A;  3G1L A;  2DA1 A;  3H0G J;  2YU9 J;  3IV5 A;  2TRT A;  4DYC A;  4BBR J;  9ANT A;  4XK4 A;  2CQQ A;  1OCP A;  1RET A;  3O8G A;  4A3L J;  2YUS A;  3BG5 A;  1WH7 A;  5EDN A;  2DMN A;  3D1N I;  4A3J J;  2QCO A;  2HOS A;  1H89 C;  3LNQ A;  2VUM J;  5IYD J;  2JA7 J;  1K83 J;  2DTZ A;  4Y7N J;  5EG0 A;  2R5Z B;  1NK3 P;  2I10 A;  4NDL A;  2M9H A;  2CUF A;  5M3M J;  1EF4 A;  3M4O J;  1CQT A;  1A5J A;  1FIP A;  1PUF B;  3FKI J;  1JJ6 C;  2KT0 A;  2JN6 A;  3RZD J;  1B72 B;  2ID6 A;  5J1R A;  1MBH A;  2X9D A;  1OJL A;  3BR5 A;  4M3G A;  1TWF J;  4J19 A;  1RR7 A;  2EZL A;  4MLO A;  3HOX J;  2N8G A;  2LY9 A;  3HM5 A;  3F0C A;  3TP3 A;  2L0K A;  3QPL A;  2XB5 A;  1E3O C;  2FQ4 A;  2JK3 A;  4C3I J;  1HDP A;  1QVU A;  3QPS A;  4JX6 A;  2VI6 A;  2EZI A;  2XGC A;  2CJJ A;  5EZG A;  2WB1 N;  3BR3 A;  5FLV A;  3Q3S A;  3WHB A;  1LFU P;  2VPR A;  1PUF A;  2B63 J;  2DMT A;  3CMY A;  3B6A A;  5IP7 J;  5FJ8 J;  3HOY J;  3L1P A;  2Y31 A;  1MBK A;  3OSG A;  1B72 A;  2VKE A;  1H88 C;  2WAQ N;  3HOU J;  2OPT A;  4BKX A;  1ETK A;  2XPV A;  1MBJ A;  5IOY A;  3ZQI A;  4XRS G;  3GTM J;  2MGQ A;  4D7N A;  5M3F J;  1F43 A;  4XRS A;  3JRD A;  3HDD A;  1ZR4 A;  3ZOB A;  3BTC A;  1Y1V J;  5C4J J;  2GM4 A;  1P7J A;  1HLV A;  1H8A C;  1ETO A;  1ENH A;  2DA5 A;  1IJW C;  3SDG A;  3GTG J;  1TWG J;  2X48 A;  3A03 A;  3G1M A;  2R92 J;  1FTZ A;  1UG2 A;  2FX0 A;  1MBF A;  2NS8 A;  3HOZ J;  3GTQ J;  5C4X J;  2DMU A;  1ETV A;  2ECB A;  2W48 A;  2P81 A;  1VFC A;  1Q1V A;  1MBG A;  4I76 A;  4FE4 A;  4B1R A;  5IP9 J;  2ELK A;  4IHY A;  1RPW A;  5GP9 A;  1ZGW A;  3FIS A;  1IUF A;  2ZB9 A;  4DZP A;  4JP0 A;  5FKK A;  4I6Z A;  1U78 A;  3S2D J;  1FJL A;  3O8H A;  3FK7 A;  3WHC A;  3TW6 A;  2M8G X;  1MNM C;  2XB0 X;  4S0H B;  3A01 A;  3S1R J;  2PMZ N;  2MSY A;  1QRY A;  5F27 A;  2WV1 A;  2E19 A;  2GBY A;  1YRN B;  4DZJ A;  5K7F A;  2L7Z A;  3JRB A;  2KDZ A;  2Y0S N;  2NVY J;  3HOV J;  2DA4 A;  3TW7 A;  5EEA A;  1NTC A;  1IGN A;  2HYJ A;  1VND A;  4XID A;  2GLO A;  2HOA A;  1LFB A;  3A02 A;  3S1M J;  3GBG A;  3K2A A;  5IPA A;  3BTJ A;  4B4C A;  5F1J A;  3HGG A;  3TP0 A;  3BQZ A;  4AC0 A;  5FKO A;  4MIM A;  1F36 A;  1GUU A;  3C2B A;  3CQZ J;  3HKZ N;  1U8B A;  2NOG A;  5E3O A;  4CYC B;  5M5W J;  2JA6 J;  3PO2 J;  5EF6 A;  3ZQH A;  1ETX A;  2HOT A;  1JTX A;  4UUS A;  1TWH J;  3JRH A;  1B8I B;  4JX4 A;  4UUT A;  5IP6 A;  2JJ7 A;  4IHW A;  3HOW J;  2Y2Z A;  3UKG A;  1HDD C;  2XGE A;  4G12 A;  2R0Q C;  3LSR A;  4C2M J;  3JRG A;  2M0C A;  2L7F P;  5E3M A;  3BR2 A;  1WCM J;  5IOZ A;  5EGO B;  2LTP A;  4XIC A;  1RES A;  1Z0X A;  2XGD A;  4AYB N;  2L9R A;  4A3I J;  4CYC A;  4FCY A;  1XC5 A;  5F08 A;  2IAI A;  1I50 J;  3BR1 A;  1JKQ C;  1JT6 A;  4EEF G;  4BY7 J;  2DA2 A;  2Y9Z A;  1JKR C;  4D7M A;  1SFO J;  3GTJ J;  2OF7 A;  1OCT C;  1ETY A;  4IHX A;  2LLK A;  1VF9 A;  4DYR A;  3GTP J;  4MFD A;  3K7A J;  3JRE A;  1XS9 A;  1DU0 A;  4GFB A;  5EYR A;  4V2G A;  5EGO A;  1BW5 A;  2R5Z A;  1IV6 A;  3JRI A;  1ZKG A;  3B6C A;  4QSH A;  5DTD A;  4Y52 J;  5JLW A;  4W1U A;  4A69 C;  1S7E A;  1Z77 A;  2DJN A;  2DMQ A;  4M3B A;  1WI3 A;  1X58 A;  3H3V K;  1QVT A;  3JRF A;  2R5Y B;  4A93 J;  1O4X A;  2LP0 A;  2EZH A;  1W0U A;  3ZQF A;  1SAN A;  3BR6 A;  2K40 A;  2AO9 A;  5BNG A;  3ZQL A;  2DN0 A;  3RQI A;  5DS9 A;  2JA8 J;  3HGY A;  1JJ8 C;  5K7H A;  1HOM A;  2XRL A;  3DEW A;  2JMW A;  3MN2 A;  2EH3 A;  3GTL J;  2ME0 A;  4FIS A;  1JT0 A;  1ZQ3 P;  2Y30 A;  2Y9Y A;  2JWT A;  4FE7 A;  4IHV A;  1A6I A;  3LSP A;  3BR0 A;  4A3C J;  5GPA A;  1ZK8 A;  4A3G J;  2IBD A;  4IEJ A;  4A3E J;  4BY1 J;  1DU6 A;  1AHD P;  2E2J J;  1Y1W J;  3OOU A;  2LK2 A;  2DA3 A;  5GPC A;  1AKH B;  3HEF A;  4JYK A;  5M5Y J;  3I4N J;  1FEX A;  1MSE C;  3W6V A;  2HDD A;  2O9L A;  3OSF A;  3M3Y J;  3JRA A;  2M34 A;  2NVX J;  1MH4 A;  1ETQ A;  4C3J J; 
#chains in the Genus database with same CATH topology
 4CO8 A;  2HKO A;  2EFQ A;  3KP3 A;  3HZJ A;  1ZG5 A;  5LGU A;  2WAD A;  2ZME C;  4CZC A;  4EGY A;  5L3F A;  3HPG A;  3FXR A;  2LYC A;  3WU1 B;  3HRU A;  2O5R A;  1YIO A;  4BHP A;  4BE2 A;  1YRN A;  2K9S A;  1OCR H;  1U5T A;  3K4J A;  2OQR A;  4W97 A;  4M6Y A;  3S93 A;  2E1C A;  1OCZ H;  4M74 A;  1X1P A;  2XSD C;  4PGH A;  4B09 A;  2M1B A;  2XHK A;  4NQW A;  2ZJQ F;  4WCG A;  1BI2 A;  2FF4 A;  1MW7 A;  4XNF A;  5E3N A;  4C2U A;  2E71 A;  2HXI A;  2E5N A;  3BZ6 A;  3GZN B;  3CUQ C;  3C7J A;  4A3D J;  2ME6 A;  1E2X A;  3R6S A;  3LWF A;  1WJA A;  2ECC A;  3BLY A;  4XN0 A;  4A3M J;  4BBS J;  4XLF A;  4P55 A;  4BYY A;  3BQY A;  3JR9 A;  1G59 A;  1IF1 A;  2Y0S A;  1JUS A;  2DOF A;  2A68 F;  1Z05 A;  1LE8 B;  3PUB A;  4RB0 A;  2L7K A;  4ZJZ A;  5A2Q K;  5JVG F;  3U1D A;  3FZV A;  2K3P A;  3CF2 A;  1NK2 P;  1XCB A;  3Q0U A;  4DW6 A;  2Z9O A;  2PFB A;  1T6S A;  5K7Z A;  1IDY A;  4R1H A;  3NAR A;  4BU2 A;  3HOT A;  3CUQ B;  3ZQC A;  1O7L A;  3DTE A;  3PL8 A;  5LHH A;  3PM1 A;  4L9T A;  2KIF A;  3JRC A;  2L9S A;  3GYH X;  2EFP A;  4G7O F;  3CDI A;  3QQA A;  2RAE A;  3BTI A;  1IN5 A;  3ZQG A;  4RDU A;  3OY9 A;  2MLK A;  5HLI A;  5E79 C;  1OQY A;  1Y8R B;  2P5K A;  3ZN1 A;  2CSO A;  2ZSI B;  3GTO J;  2R7T A;  2NS7 A;  3LOC A;  3ZN0 A;  2X6Y A;  4X1E A;  4WF2 A;  3GFM A;  1SFK A;  5E17 F;  2HPI A;  3K4M A;  4PFO A;  4G6T B;  1LDJ A;  3IH3 A;  3CCY A;  5JHF A;  4HDU A;  3M8F A;  3SEZ A;  3RKQ A;  1X2M A;  4ENK A;  1WJD A;  1S29 A;  4HEA 2;  5DM7 F;  4XLA A;  1MND A;  2FOK A;  3QOD A;  3PO3 J;  2AXT C;  3A01 B;  3SJM A;  2GAU A;  2KP6 A;  5F6F A;  1R1T A;  4HST A;  1Z91 A;  4EQQ A;  4PUS A;  1KQ9 A;  3X2Q H;  5LHG A;  2IA0 A;  1X1B A;  5FB2 A;  3KET A;  1N78 A;  4UVB A;  2BEO A;  1F4K A;  3WTY C;  3WTT C;  2XC7 A;  4H0E A;  1D5Y A;  5C44 J;  4IPA A;  3J7Z I;  4ZYH A;  3EET A;  2CQX A;  1YLF A;  4HF1 A;  4RAG A;  2A61 A;  2CW0 F;  3ASO H;  2W00 A;  3IKV A;  4E7H A;  1ZRE A;  1ZAR A;  4E7Z A;  2ETH A;  2RVC A;  2BXZ A;  3LA2 A;  4RB2 C;  4KDP A;  4MO7 A;  4G8X A;  2QF7 A;  4DGW B;  1LFP A;  2DXI A;  4FHT A;  3SQN A;  1WJC A;  2E60 A;  3S14 J;  1LKX A;  4RS8 A;  1I6H J;  2L5Q A;  4NC6 A;  2STT A;  4HV5 A;  1IRG A;  4LB6 B;  4U87 A;  4S04 A;  2FD5 A;  2NYX A;  1D0Z A;  3TO9 A;  4NHJ A;  4HX4 A;  5TIS C;  1BL0 A;  2MD5 A;  3KIO A;  4MTE A;  2F4M B;  2ADU A;  3KP2 A;  3L7W A;  2CH0 A;  2LF7 A;  5B3S H;  1FTT A;  1QZY A;  3WOD F;  4LLL A;  1T56 A;  2HDW A;  4HNU A;  3KCC A;  4RM3 A;  4RMN A;  3DKW A;  2RKH A;  3QAH A;  3K4K A;  1ZYR F;  5F0H A;  3DLL F;  3RPU A;  2KJB A;  5LHI A;  4QTR A;  1KQ0 A;  1FP2 A;  2ICW G;  2CFO A;  5DCF A;  3V8K A;  1GDT A;  1FBS A;  3L9F A;  4NUB A;  5GAD J;  1Z6R A;  3GZ5 A;  4WX9 A;  2ZCW A;  3H0D A;  1J59 A;  2L9V A;  4LK0 F;  1BR1 A;  2PX9 A;  1UHM A;  1HA8 A;  2FBK A;  4XK4 A;  1G6N A;  5K5Q A;  4OAZ A;  1W36 D;  1RET A;  1FP1 D;  4ZYG A;  3TOA A;  3QWL A;  1FMW A;  5CLS A;  3RDI A;  2DMN A;  3EYI A;  3CJN A;  5DYM A;  3GVA A;  1XSD A;  4XON A;  3VYT B;  3A0H C;  4LG0 B;  3VSK A;  4B43 A;  3ZP5 A;  2HDC A;  2K5C A;  4B8X A;  2R7F A;  2V9P A;  2HZT A;  2AQF A;  2ELH A;  2JN6 A;  3OIP A;  3I59 B;  4BQN A;  1GXQ A;  2VBZ A;  2X9D A;  1OJL A;  4RAF A;  2MC3 A;  4DJA A;  4J19 A;  1DDN A;  1MJB A;  1O7F A;  2JA2 A;  1W5S A;  3QPL A;  2XB5 A;  2HEO A;  1MJA A;  3FXU A;  1QVU A;  1F1Z A;  1XD7 A;  2DDB A;  2P8T A;  2VI6 A;  3CUO A;  3P5J A;  2FXA A;  5J4V A;  3MAJ A;  2W82 A;  2XGC A;  4QPQ A;  1IRX A;  5EZG A;  2WB1 N;  1UB9 A;  3LA7 A;  2VPR A;  1PUF A;  4OIO F;  5DV5 A;  5FJ8 J;  1XSX A;  1UEL B;  3P7N A;  3OWT A;  1U3E M;  1B72 A;  2VKE A;  2DCE A;  4I09 A;  2WAQ N;  4UY8 I;  2ACJ A;  2K3F A;  1MBJ A;  4C30 A;  2OD5 A;  3HRT A;  2QA4 I;  3A0B C;  4XRS A;  2VKH A;  2HGC A;  3JRD A;  1X3Z B;  1YQA A;  4KA4 A;  4HLY A;  4N0B A;  1BIB A;  3W6J B;  1RR8 C;  1BJA A;  1ETO A;  3GFL A;  3WTV C;  2WY8 Q;  3BG6 A;  3SDG A;  3WE2 A;  1Y0U A;  2BY0 A;  3A03 A;  1Y56 A;  2CUZ A;  1FTZ A;  1KYZ A;  1UG2 A;  1YJW I;  2NS8 A;  3HOZ J;  5D5U B;  4BE0 A;  3GTQ J;  5LRS A;  2J5O A;  5TRD A;  2DMU A;  1TNT A;  3KZY A;  1Z7U A;  2IA2 A;  2ECB A;  1DP7 P;  2P81 A;  1VFC A;  3RSN A;  2CFX A;  3C2G A;  2J5P A;  4IRH A;  1Q1V A;  1T2K A;  1SAU A;  1JHH A;  1U5T C;  2X51 A;  4U0V A;  5IP9 J;  4HF2 A;  4IHY A;  5GP9 A;  3L2R A;  3QPT A;  4UHT A;  4JP0 A;  5FKK A;  4PJJ A;  5IY5 H;  4OMY A;  3L00 A;  1SFX A;  3FK7 A;  4ZDP A;  2UZK A;  1MNM C;  4S0H B;  2A6E F;  2R7S A;  3TQN A;  1HKS A;  3F21 A;  1R23 A;  3D0S A;  5LEJ A;  1R6R A;  5H20 A;  1F9N A;  2E19 A;  4PJM A;  4EM0 B;  1FYM A;  3GLX A;  1YRN B;  2EPF A;  4A5M A;  5K7F A;  1EH7 A;  2KDZ A;  3F8B A;  2CV0 A;  3EQL F;  4HRI A;  3KLN A;  2NVY J;  3JSP A;  3K2Z A;  2E35 A;  1NTC A;  1TW2 A;  4LB5 A;  4LMY A;  1LFB A;  4DBQ A;  1Z1D A;  2WAE A;  2MAB A;  4Y33 A;  4B4C A;  2O0Y A;  4YEL A;  4AC0 A;  1GUU A;  3DU6 A;  3CD6 I;  3HKZ N;  5H6Q A;  3MKY B;  4I7H A;  3PO2 J;  5EF6 A;  1ZN2 A;  3ZMU A;  2HOT A;  1ETX A;  1JTX A;  4OWR B;  4JX4 A;  1MD0 A;  4UUT A;  3K1P A;  4GGG A;  5IP6 A;  3D5R C;  3T8R A;  1PUE E;  1R4M B;  3CF5 F;  3UKG A;  2CYY A;  1FPQ A;  1X1D A;  5CVJ A;  4AIK A;  4ZZD A;  3Q9S A;  1JE8 A;  1S7A A;  3JRG A;  4YEJ A;  3CCQ I;  1S6L A;  2XAU A;  4XIC A;  2DOA A;  2OV7 A;  1RES A;  1Z0X A;  4AYB N;  2HS5 A;  3O3K A;  2DLL A;  4G94 A;  3K69 A;  3WU0 A;  2LH9 A;  4BHC A;  1MDM B;  5F08 A;  2OC6 A;  3IWZ A;  3PNY A;  5JVT A;  1JT6 A;  3F22 A;  4O5V A;  3RCO A;  1X4O A;  1SFO J;  4E7K A;  4L18 B;  1D1B A;  4EMS A;  2OTJ I;  3I64 A;  5L3G A;  3M07 A;  1XMK A;  1ETY A;  1FSE A;  1VF9 A;  2ZNZ A;  1ZLJ A;  2MYS A;  2XAQ A;  2TDX A;  1XS9 A;  1DU0 A;  4GFB A;  4ETS A;  2EWN A;  2BW3 B;  4V2G A;  1IUY A;  3CC2 I;  1DPU A;  2EIN H;  5CVV A;  2V1D A;  2Q1Z B;  5GTH C;  3ABK H;  4I01 A;  2RNG A;  4C2T A;  4D1Q A;  1A31 A;  2DQL A;  4W1U A;  1YIJ I;  2CS3 A;  1LQ1 A;  2V26 A;  3JCU C;  1S7E A;  4RB3 C;  2DO7 A;  5EEH A;  4M3B A;  1YX3 A;  2KIQ A;  4A93 J;  4I99 C;  1OPC A;  2EA2 A;  1YIT I;  1SAX A;  2DFI A;  4DNC A;  2VXD A;  4IHT A;  1Y8Q B;  1BC7 C;  2AO9 A;  4R79 A;  1UJ8 A;  1RI7 A;  2CQK A;  3KP4 A;  3MCZ A;  4CCL A;  3MWM A;  5K7H A;  2HYF A;  1P6R A;  4IZZ A;  1R36 A;  2XRL A;  2JMW A;  4N9I A;  2EH3 A;  1SFU A;  2E34 A;  2QSG X;  3WGH A;  1K6Y A;  4AID A;  2XDV A;  4FE7 A;  1RZ4 A;  3CCV I;  3LSI A;  3OYH A;  1E0E A;  4A3C J;  1T98 A;  3ZMT A;  3B02 A;  4A3G J;  2QBY A;  4BY1 J;  3OL4 A;  3I53 A;  1Y1W J;  2WB1 A;  2LK2 A;  1GVJ A;  2EIJ H;  1OLT A;  1QPM A;  4JYK A;  3I4N J;  3K10 A;  5EEG A;  1YS6 A;  2LG4 A;  2HDD A;  2XV4 S;  3CDH A;  2WAQ A;  4A6D A;  3OSF A;  3PQJ A;  1K78 B;  3O6B B;  4RGX A;  1S8N A;  1I39 A;  4J01 A;  3RI4 A;  2V1X A;  4HBL A;  4HZF A;  1IDZ A;  4UNO A;  1U9O A;  2CU7 A;  1MGT A;  2L4M A;  3GTK J;  1T33 A;  3Q9V A;  2E1O A;  3F8F A;  5E18 F;  2QWW A;  2VQH A;  3C18 A;  3FXQ A;  1OIS A;  2K9Q A;  3S16 J;  2FJ1 A;  1IRZ A;  3HPH A;  4KYW A;  4F55 A;  5D4R A;  5BS6 A;  2NNN A;  4BDY A;  1CGP A;  1TT0 A;  3E7L A;  1MZB A;  5DDG A;  1BW6 A;  1EH6 A;  1ETW A;  2K86 A;  1HW1 A;  2E7X A;  2CWE A;  1YE9 A;  4E4H A;  1BR4 A;  3FXJ A;  3LST A;  3TDZ C;  4ENJ A;  4RBO A;  3CZ6 A;  3BJA A;  3IH2 A;  3NAU A;  5IT9 Z;  2M30 A;  3K1M A;  3OYJ A;  1AU7 A;  1L3L A;  1I27 A;  2HR3 A;  5KAI C;  4YIF A;  2DT7 B;  4P1W A;  1I3A A;  1DQU A;  3BG9 A;  1R4N B;  2VJI A;  2YS9 A;  3D5S C;  2LBF A;  4D5F A;  2HVR A;  3RYR A;  2QLZ A;  3DPL C;  5DCM A;  3SDB A;  2K9M A;  2VJ4 A;  2K27 A;  3EUK L;  1ZRC A;  1WH5 A;  3VEP A;  4BQA A;  3S17 J;  4JX5 A;  3LSJ A;  2DOE A;  1G3T A;  3HHH A;  3SFZ A;  2ID3 A;  3OIO A;  2GXB A;  3WTS C;  1HXD A;  4O6J A;  2PBI A;  2JSP A;  4RB1 A;  2BZT A;  3HL2 A;  5FLM J;  1MJ9 A;  1ODD A;  2V4J C;  3HKZ A;  5ED4 A;  3VDX A;  2XF6 A;  2UXN A;  5F0F A;  4BEH A;  1HF0 A;  4IVN A;  2O6G E;  3CDL A;  1Z67 A;  4B3A A;  2AQE A;  1HST A;  3L2U A;  1ZTR A;  3QP6 A;  4BE1 A;  2KJC A;  3BDD A;  2R7Z J;  4NC7 A;  4EJU A;  2NNY A;  5HS7 A;  2ZXH A;  1UST A;  2CMP A;  2X1D A;  4IOA F;  1U6G A;  1DUX C;  3DKY A;  1YJ9 I;  3OR1 C;  3H3U A;  3MKL A;  4PZJ A;  1QNT A;  1RKW A;  3B73 A;  4AIH A;  2RDP A;  1X2N A;  2H6B A;  2LFB A;  3ESW B;  1HSJ A;  2JVG A;  3E6B A;  3KLO A;  4A3F J;  2VPL A;  3RQ4 A;  1WGX A;  2WAF A;  3HTU A;  2IEK A;  4AYB A;  3DFG A;  1VQ9 I;  5DUK A;  3RZO J;  3DCF A;  4F7Z A;  3W3C A;  2RRE A;  5HLH A;  2HTJ A;  2MA3 A;  4XSX F;  3EDP A;  3IRQ A;  1J2X A;  2DJI A;  1GV5 A;  2DPU A;  2R5Y A;  2OQG A;  2XUB A;  2EBI A;  3BTL A;  4AM3 A;  4HX7 A;  5GTI C;  4I02 A;  5KHD A;  4N4N B;  1HKT A;  2ZFW A;  2COM A;  2CO5 A;  3HG9 A;  5B1A H;  2QSH X;  3TO7 A;  5HVQ C;  3WGI A;  3W2A A;  3K1N A;  4LG3 A;  1XGM A;  2FSW A;  4ZYE A;  2W7N A;  4G9Y A;  2VE8 A;  4IXA A;  3DKX A;  4LOC A;  1CF7 A;  1ZRF A;  5IYC J;  1TC3 C;  3PSI A;  4MFE A;  1FIA A;  4M72 A;  4B44 A;  2HQ5 A;  4HYE A;  5E20 A;  2JPC A;  1REP C;  1IAW A;  3ZQ7 A;  3CMA I;  3V7S A;  1OYW A;  2GXA A;  2DK8 A;  3S15 J;  5GAE J;  3TED A;  3H9J A;  3ZXS A;  2HQA A;  3T0Y A;  4XRM A;  3BG7 A;  3NWT A;  2NXN B;  4HNV A;  1SD6 A;  3IH4 A;  2WV0 A;  3WTZ A;  2DPD A;  2PJR A;  3DXJ F;  3C3W A;  1RIO H;  5HOD A;  2LDU A;  3TOB A;  2ELJ A;  3FXO A;  3GF2 A;  2EFN A;  1K61 A;  4ESB A;  3WU2 C;  2K9N A;  3ZMS A;  1GV2 A;  4LIU A;  3M8J A;  3VB2 A;  2GA1 A;  1NH3 A;  2BVM A;  1F5T A;  4JBA A;  3ELK A;  3GXO A;  3BJ6 A;  2LR8 A;  1XX5 A;  3BPX A;  5J1U A;  2ZME B;  2YU9 J;  2PI0 A;  3OYL A;  3G6E I;  3E6D A;  3LSH A;  3ZCO A;  4DYC A;  1W5C C;  5E1X A;  4CA0 A;  4UUV A;  9ANT A;  5CJ9 A;  2VQL A;  3O8G A;  3IUO A;  2XGX A;  3FHZ A;  2YSR A;  2VC0 A;  3BG5 A;  5KNL A;  2CG4 A;  2HPM A;  3D1N I;  2HOS A;  3FMS A;  1H89 C;  5IYD J;  2W84 A;  2DTZ A;  1YOV B;  5EG0 A;  5ICG A;  4XKB A;  2R4G A;  5M3M J;  3M4O J;  1CQT A;  2L4A A;  1IXR C;  3RZD J;  2HOE A;  1WJF A;  2ZNY A;  1S3J A;  3JAM Z;  4CUG A;  2Z99 A;  1TWF J;  2HFH A;  1B9M A;  2MBF A;  3H9Q A;  1MKM A;  3GEZ A;  1RR7 A;  2M87 A;  2LY9 A;  3F0C A;  2YX7 A;  4HF0 A;  3TP3 A;  2VOO A;  3CLQ A;  2JK3 A;  4C3I J;  4DOZ A;  4JX6 A;  1UCR A;  2R7O A;  2M7B A;  4G6Q A;  3K70 C;  1K4S A;  2CW7 A;  1RC9 A;  5ICC A;  3BR3 A;  1IV8 A;  3H3Z A;  1LFU P;  4IHS A;  2DMT A;  5IP7 J;  1FNN A;  1FOY A;  5DD8 A;  3GX4 X;  1XMA A;  5HOO A;  2OPT A;  1D8K A;  1D0Y A;  2RQQ A;  5J4Y A;  3PUF A;  3OIQ A;  5CVU A;  3E6M A;  5KAF C;  2HU9 A;  3GTM J;  2VT2 A;  2XVC A;  3KEQ A;  3J80 Z;  1HKQ A;  5E8G A;  3OYD A;  3WG9 A;  1F43 A;  4RLF A;  5BPI A;  1RNL A;  3HIF A;  4E7I A;  2HZD A;  5C4J J;  3GUD A;  2KRH A;  1P7J A;  2KPM A;  1LNW A;  1H8A C;  2QBY B;  2R3S A;  3ULQ B;  1FY7 A;  1EH8 A;  4GXO A;  4ZYA A;  1TWG J;  5D8L B;  3P9K A;  3AG4 H;  4KN4 X;  1PP8 F;  2ZSH B;  2K85 A;  3DEU A;  3OMY A;  3FM3 A;  4LIT A;  4CCM A;  5JHU A;  1X3W B;  3KE2 A;  4YII A;  4FE4 A;  2P7C B;  5CQE A;  4B1R A;  1BIA A;  1RPW A;  4BHB A;  2VOP A;  1WJB A;  2AS5 F;  3S2D J;  1IXC A;  3WHC A;  1T39 A;  2ZJ2 A;  5JI6 A;  2M8G X;  3C2H A;  1QBJ A;  4LGW A;  2NS0 A;  3S1R J;  5HLG A;  2DU9 A;  3PJR A;  2PMZ N;  4RM2 A;  3DQV C;  3J7A Y;  1QRY A;  4G7H F;  3G71 I;  1BR2 A;  3ZQQ A;  4F52 A;  1ZG1 A;  4BL0 B;  3FDY A;  3SXY A;  2EIL H;  1PP7 U;  2GBY A;  5HDK A;  4DZJ A;  1I5Z A;  2HVQ A;  5AIQ A;  3JRB A;  2DA4 A;  4KFC A;  3U1K A;  1VQN I;  3TW7 A;  5EEA A;  4XKC A;  5BPD A;  2VBX A;  1FBQ A;  5E1Z B;  2GLO A;  1ONV A;  3S1M J;  3K2A A;  1IZ1 A;  3M1C A;  5J6X A;  2K4J A;  3QPH A;  3C2B A;  4I98 B;  2BBY A;  1U8B A;  2UWM A;  2NOG A;  5E3O A;  2JA6 J;  3ERM A;  2L01 A;  2IS1 A;  4HSR A;  3ZQH A;  3HJE A;  3MZY A;  1TQP A;  1O57 A;  4U88 A;  1YG2 A;  2JJ7 A;  4DQ2 A;  4IO9 F;  1VQP I;  2Y2Z A;  4YG2 F;  2XRO A;  2AXL A;  2XGE A;  2A07 F;  1IN8 A;  4NC8 A;  2R0Q C;  3IWF A;  2KRC A;  4UVC A;  1LPQ A;  3L2V A;  3VWB A;  5FLX Z;  3GLL A;  1X19 A;  1K7A A;  1EV7 A;  3H35 A;  1I6X A;  1YHQ I;  4LIV A;  2HQR A;  1V5G A;  2XGD A;  1W4M A;  2XIG A;  3KPH A;  2Q8K A;  4A3I J;  2QSF X;  4CYC A;  1LEB A;  3VYU B;  4RA2 A;  4A0Z A;  1XC5 A;  2CQN A;  1I50 J;  3BR1 A;  1B6A A;  4EEF G;  3R4K A;  2OCC H;  2DA2 A;  4IOC F;  3AKZ A;  4N4O B;  4XLC A;  4EGZ A;  1OCT C;  4EM1 A;  1TP4 A;  2F4O B;  1SMT A;  4YRV A;  2IT0 A;  4DYR A;  2YX4 A;  3JRE A;  1VQM I;  3PFY A;  4B3X A;  3RYP A;  5EYR A;  4QLC U;  3FXK A;  3OS0 A;  5EGO A;  4X0G A;  1BW5 A;  2O3F A;  3IL2 A;  3DF8 A;  4ZC3 A;  1PJR A;  1S5L C;  2WA0 A;  4ITV A;  2PMH A;  2X6X A;  4QSH A;  3KYC B;  3CO6 C;  4KIG A;  3SZT A;  2K4B A;  4A69 C;  1LVA A;  5DEQ A;  1Z77 A;  2DJN A;  5FD5 A;  1Z3X A;  2DMQ A;  3RPU D;  4L9J A;  3OYC A;  4UV8 A;  1WI3 A;  3H3V K;  3K4B A;  2JTV A;  3OYM A;  2R5Y B;  4BAC A;  3ZRG A;  1K6O A;  1W0U A;  4RGU A;  3N4M A;  4A12 A;  2M3A A;  4E70 A;  1Z21 A;  3HSR A;  1IN4 A;  2BY1 A;  2DN0 A;  1JXS A;  3AG1 H;  2BY2 A;  5J8F A;  1T0F A;  3F6O A;  1HOM A;  1KGS A;  4CH7 A;  4HOB A;  5AON A;  3QRF F;  1BI0 A;  1E3H A;  1IO2 A;  1R7J A;  3N05 A;  2Y30 A;  1XGS A;  2VKD A;  4CGZ A;  1WQ2 A;  2JT1 A;  1A6I A;  3LSP A;  1Z7L A;  1VTN C;  2IJL A;  3H5A A;  1KU9 A;  3F72 A;  1WHU A;  4HAM A;  4JOM A;  4BGD A;  4XOP A;  4IEJ A;  3GME A;  5HS8 A;  3E0J B;  1DU6 A;  2HWV A;  1AHD P;  3KZZ A;  4FT8 A;  1JI8 A;  1NG7 A;  1DP3 A;  2E2J J;  2PJR B;  3OOU A;  1WWX A;  2F5F A;  2FNA A;  5M5Y J;  1TT5 B;  2M0M A;  1MSE C;  1U5T B;  2LRD A;  2O9L A;  3VYS B;  1VZ0 A;  1D5V A;  1IRF A;  4CIC A;  5FO5 A;  3JRA A;  3G4S I;  2M34 A;  2L9N A;  4IF4 A;  1H9T A;  1ZGJ A;  1NG6 A;  5F64 A;  2GQQ A;  4GYG A;  2A5W A;  1XSV A;  1ETQ A;  4NQW B;  3RIR A;  1Z9C A;  2A5Y B;  1SD5 A;  2Q2E A;  2K9L A;  2M7A A;  3G3Z A;  5F0C A;  4E6K G;  3S1N J;  1P4X A;  4XLE A;  2IXS A;  1AOY A;  2Y75 A;  2NVT J;  3BY6 A;  4L5E A;  1BI1 A;  1YS7 A;  2JPB A;  2L7M P;  3BZK A;  2ESH A;  1NHA A;  4HW0 A;  2HXO A;  2YR2 A;  1MSF C;  1AKH A;  3WTW C;  3SEQ A;  2D1V A;  2FE3 A;  2XSJ C;  3HXL A;  4B47 A;  1E3P A;  1TWA J;  1HC8 A;  2LVS A;  3Q0V A;  1BC8 C;  1P7I A;  2NAZ A;  4OAY A;  4KMF A;  3BWG A;  2R7Q A;  2QKL B;  4KIT B;  2Z2S B;  2ZC2 A;  3MEX A;  3DLA A;  1QPI A;  4P9F A;  4CDG A;  2ZFU A;  1FBU A;  2M45 A;  5TJJ A;  2V7F A;  3CLO A;  2L3D A;  3DEE A;  1ZAO A;  3FM5 A;  2IGO A;  1FWZ A;  3E1S A;  3K9T A;  4HG2 A;  2QVO A;  3S1Q J;  2PMZ A;  1MMG A;  1EKE A;  4Y3O A;  3V8J A;  3RKY A;  1VQ5 I;  1RKT A;  2F6C A;  2VT3 A;  3M9A A;  3OYN A;  1LDD A;  1YI2 I;  2P6S A;  4ZH4 F;  2E1M C;  1ON2 A;  2QEN A;  1BM9 A;  2CUE A;  1J9I A;  4MQV A;  1R9T J;  3AG2 H;  2IVM A;  2PLY A;  2GOX B;  1WZ2 A;  1G2H A;  4ZDO A;  4Q4Z F;  4BJT A;  4BAY A;  5J1Y A;  4ENN A;  2I8D A;  2X0L A;  2BE5 F;  4G6D A;  4Q48 A;  2VQC A;  2DW4 A;  4AIJ A;  4ASN A;  1MMA A;  2VKV A;  1MMN A;  2LRE A;  3CJR B;  1XCV A;  4XM3 A;  2KZV A;  3HB9 A;  4KJZ A;  3CCE I;  2O8K A;  4KIS A;  4M3D A;  4HX8 A;  3VPR A;  1TWC J;  4LFU A;  3HBL A;  2FOW A;  2BHZ A;  2O7O A;  5H6R A;  4MQ9 F;  1T38 A;  4KT6 A;  2KIM A;  2V9K A;  3O2P E;  1JGG A;  1ZR2 A;  2ISZ A;  3S3M A;  2COB A;  1P2F A;  4GDF A;  4V2F A;  3I56 I;  5LGT A;  4BNC A;  1KYW A;  2DA7 A;  1STZ A;  3I0T A;  1LE8 A;  3S2W A;  1W1W E;  2DFH A;  2EV5 A;  1I3Q J;  3N97 A;  1V54 H;  4BXF A;  1IG7 A;  2LY2 A;  1GXP A;  2G7U A;  1W0T A;  1QU3 A;  5C3E J;  3H9G A;  4FET A;  2LD5 A;  2DYS H;  4PK4 A;  3J7Y J;  3I54 A;  2V6C A;  2D5V A;  4ESJ A;  1JHF A;  1JTY A;  3FXL A;  3FF5 A;  3OR2 C;  1ON1 A;  2BXY A;  5CVI A;  3S8P A;  3CO7 C;  2IS4 A;  3WE3 A;  1O3T A;  2RV8 A;  3AL0 C;  2DMP A;  2XAG A;  1GT0 C;  2GZW A;  4E7J A;  5EJC A;  5BMZ A;  3IC7 A;  3BCA A;  3V42 A;  2D45 A;  2OBP A;  3G1O A;  1LJ9 A;  2IGK A;  2OZU A;  3H5R A;  2X6O A;  4A5N A;  1X1C A;  4X6A J;  1R5H A;  4XSZ F;  2MG4 A;  1LEA A;  4ZTJ A;  4A3B J;  1VQ6 I;  4A6E A;  1V3F A;  4CCJ A;  1OKR A;  5D4S A;  4HV6 A;  1JKO C;  3MMY B;  1GVD A;  3K4L A;  4QIW N;  2VBY A;  2QQ9 A;  2XAJ A;  5D8K B;  2MC4 A;  1POG A;  1B1B A;  2TCT A;  2H8W A;  1XB4 A;  3HTS B;  4A2U A;  2PEX A;  2H1K A;  4HPQ A;  5FKM A;  1Y6I A;  4P96 A;  3FIW A;  2LF8 A;  1V4R A;  4GRI A;  5KVR A;  3GFI A;  2MD0 A;  1OR7 A;  2LOO A;  3T5X A;  2G9W A;  2K7L A;  4HQM A;  3LSG A;  2XPU A;  2HI3 A;  4HNT A;  2DA6 A;  4KIF A;  2LSO A;  3SFI A;  1V5F A;  2JRT A;  2FMY A;  2PN6 A;  4L9V A;  3BG3 A;  2DT5 A;  3VSL A;  4YFN F;  1UHS A;  1TBX A;  1Z3Y A;  2GA2 A;  3LSM A;  2XPW A;  2CRG A;  2BGC A;  2O8X A;  5D6F A;  2XF7 A;  4HLX A;  3T1B A;  3HUG A;  4M3E A;  3FK6 A;  5H2F C;  4NNJ A;  2DA1 A;  3CC4 I;  2EB7 A;  1S72 I;  2VB6 A;  3KEY A;  3IV5 A;  4EAT A;  1QGP A;  4MEY F;  4BBR J;  4QPO A;  5DUI A;  3E5U A;  3REO A;  1SD4 A;  3CP2 A;  1WH7 A;  5EDN A;  3W6K B;  3K70 D;  4A3J J;  3KEO A;  3LNQ A;  2JA7 J;  2DBB A;  1K83 J;  1O3S A;  4Y7N J;  2F48 A;  1NK3 P;  2CV1 A;  1P4W A;  1W7P A;  2G7H A;  1TZL A;  2CUF A;  4OOI A;  1PVE A;  1EF4 A;  1T0F C;  1FIP A;  1PUF B;  1JJ6 C;  2DI3 A;  4L9N A;  1B72 B;  3KYD B;  5J1R A;  1J5Y A;  3D5L A;  5JR3 A;  2D2W A;  1OYY A;  2EZL A;  1J0R A;  2F5C A;  2FEZ A;  3HOX J;  2V9V A;  3IP4 B;  3S3O A;  2L0K A;  2FQ4 A;  2P4W A;  3FHN A;  3QPS A;  4L5I A;  5J40 A;  4HQE A;  2QQA A;  4F93 B;  1R5I D;  2EZI A;  3V7R A;  1U8R A;  4LG0 A;  4ON0 A;  2CJJ A;  4OU0 A;  2R7U A;  5IT9 K;  4BQQ A;  3A1Y A;  1S9H A;  4U0W A;  4UXN A;  4J00 A;  3HOY J;  3CMY A;  3B6A A;  4Y15 A;  2HVS A;  1MBK A;  1H88 C;  5JFR A;  3QYE A;  3JTG A;  4BKX A;  1QZE A;  3GCM A;  2XPV A;  3KP6 A;  3PFI A;  5DM6 F;  4XOT A;  4NBQ A;  3ZQI A;  3PNV A;  3ZMZ A;  2MGQ A;  3TO6 A;  4D7N A;  4BQO A;  4CXF A;  1ACI A;  2DFE A;  2QQB A;  2CW8 A;  1O3R A;  4PFP A;  2DT6 A;  2UUZ A;  3BTC A;  3ZMV A;  1Y1V J;  1ZR4 A;  5L3D A;  2F5V A;  2XKP A;  1HLV A;  3LQR A;  4WXD A;  1TTY A;  3MKW B;  2VQG A;  5LRR A;  2UV1 A;  3GTG J;  4Y17 A;  4KT5 C;  1W5T A;  1H9G A;  3G1M A;  2R7D A;  3ASN H;  3FX3 A;  2FX0 A;  5ICF A;  3SYT A;  3U2R A;  2R92 J;  1XTA A;  1MBF A;  1V55 H;  3CJQ B;  4II2 A;  3R60 A;  1ETV A;  1VQ7 I;  4BH9 A;  1FT9 A;  1MBG A;  2A6H F;  4KN7 X;  1D8J A;  4L5J A;  2PQ8 A;  3V7C A;  3UNG C;  3FIS A;  2ESN A;  2ZB9 A;  3CCU I;  5FFX A;  2DTR A;  3V4G A;  4I6Z A;  1R1V A;  4P5O A;  2FML A;  2H94 A;  2WTE A;  5HNF A;  3M8E A;  3TW6 A;  2NVU B;  4G7Z F;  2XB0 X;  2Z16 A;  3CME I;  4IL6 C;  4CCO A;  3ROU A;  1D3Y A;  4F92 B;  5J8C A;  2MSY A;  4EJW A;  4II3 A;  5F27 A;  3S32 A;  2VIX A;  1SD7 A;  2L7Z A;  1YTY A;  3EUA A;  1DGW Y;  5CQG A;  2LKS A;  3JSO A;  4LK1 F;  1BOA A;  3DU5 A;  2HOA A;  3A02 A;  3CCR I;  3BOQ A;  3BTJ A;  2CQ7 A;  2IS2 A;  3HGG A;  3TP0 A;  2H09 A;  3FMQ A;  2FU4 A;  5A2Q Z;  4OMZ A;  1RRJ A;  1F36 A;  1QO0 D;  3K4C A;  3M1E A;  1HW2 A;  1ZGA A;  4UUS A;  2RC4 A;  5FRN A;  1A36 A;  3QP5 A;  2RNJ A;  1BI3 A;  3AFH A;  2ZO4 A;  4F91 B;  3PIO F;  2ZJR F;  1FYK A;  1HDD C;  3PIP F;  3LSR A;  4C2M J;  2L2O A;  3OYK A;  2RQP A;  2IPQ X;  4UB6 C;  1FC3 A;  5E3M A;  3BR2 A;  1WCM J;  5IOZ A;  5J47 A;  2F5D A;  2FNP A;  2LTP A;  3ECO A;  1K79 A;  4C9Y A;  3CMM A;  4KIB A;  2L9R A;  1HW5 A;  1KU2 A;  1Z6T A;  2DDA A;  4IJA A;  3BPV A;  2WBM A;  2VL8 A;  4LD5 A;  4BJ6 C;  2KIU A;  1LDK B;  1JKQ C;  1TLH B;  2XKO A;  1R1U A;  2Y9Z A;  2VE9 A;  4PCQ A;  5FGM A;  1UZC A;  2KMU A;  3ZMD A;  4IHX A;  1IN7 A;  1UAA A;  3TL4 X;  5B5E C;  3GTP J;  3E6C C;  3ABL H;  1LB2 A;  3OYA A;  2EFW A;  1G3S A;  3MQ0 A;  3E97 A;  1KU3 A;  5L3C A;  2R5Z A;  3TDU C;  4L0Z B;  4FX0 A;  4ZZL A;  3JRI A;  3VFZ A;  1IV6 A;  2JSC A;  3E5X A;  3B6C A;  1IN6 A;  3LMM A;  2OJE D;  2A6T A;  4Y52 J;  1D0X A;  5JLW A;  2EV6 A;  4IRG A;  1MDM A;  1KA8 A;  4JQF A;  5D5X B;  2Z33 A;  2FA5 A;  4XBF A;  1X58 A;  1QVT A;  5B1B H;  3JRF A;  2H6C A;  1O4X A;  2M4G A;  2LP0 A;  5KCM A;  3RKX A;  3ZQF A;  4HDV A;  4KIC A;  2RGV A;  1FX7 A;  2K40 A;  4P9U A;  3IKT A;  3F3X A;  2WY7 Q;  2W25 A;  2MLG A;  4A0X A;  2QZ8 A;  1KQ8 A;  1OR7 C;  1YX5 A;  2BW3 A;  3RQI A;  5DS9 A;  2JA8 J;  2VC1 A;  2STW A;  1UFM A;  4CCN A;  2DAO A;  2OZ6 A;  3BP8 A;  3CJT B;  4YFX F;  2XF5 A;  3DEW A;  2KLO A;  2EJR A;  2MH2 A;  3JAM K;  4WWC A;  2EIM H;  3H92 A;  2ME0 A;  4FIS A;  3ABT A;  3BCB A;  3CCJ I;  4B48 A;  3WG7 H;  2JWT A;  4XQF A;  3CCM I;  2XRN A;  1D1C A;  3WGG A;  4XLP F;  2E1N A;  4I2O A;  4L0Y B;  2B7E A;  3ML6 A;  1QHH D;  3BZC A;  3PSF A;  1C0W A;  3WTU C;  1WRJ A;  3IAS 2;  3W2W A;  4ZDL A;  4BJ5 C;  2H1L A;  3RPQ A;  5ILV A;  2IBD A;  4PSW A;  4A3E J;  5HLT A;  4Z6Y A;  2UXX A;  2KHM A;  1ERD A;  2K02 A;  1LUJ B;  4I0B A;  2Z5U A;  3COA C;  3R61 A;  1EJ9 A;  2KIS A;  1QZZ A;  4PSX A;  5GPC A;  4ZYD A;  3JTH A;  3HOS A;  2IGN A;  2X4H A;  3HEF A;  3TMO A;  1IXS B;  4Y13 A;  1FEX A;  3QU3 A;  3F23 A;  2HYG D;  2OCE A;  3P9C A;  2BV6 A;  3J80 K;  3M3Y J;  2WWY A;  4FX4 A;  2HTS A;  1WSU A;  1P4A A;  4IKF A;  2EK5 A;  3G73 A;  3MZH A;  2NVX J;  3HUG B;  2ZBK A;  4C3J J;  1Y39 A;  2QM3 A;  4PJ0 C;  3KYL A;  3DWL E;  2BVL A;  2NOJ B;  2G0E A;  2V1N A;  2P5V A;  3ERE D;  4LLN A;  2FUG 2;  3ECH A;  3EUH A;  1ITY A;  2LBF B;  1SVL A;  3NQO A;  2R93 J;  3ZR8 X;  4C3H J;  2IW5 A;  3QYB A;  5DCM B;  5FKL A;  5CVR A;  1IC8 A;  3I5U A;  1H0M A;  1UHW A;  5J3L A;  1MH3 A;  1BA5 A;  3U21 A;  5F1R A;  4M3F A;  2M4K A;  2H8R A;  5LGN A;  1W7P B;  1FOX A;  1TQM A;  4UV9 A;  1ORK A;  4XR6 A;  2HKX A;  4AVP A;  1K78 A;  4EVI A;  1G8X A;  2M2E A;  2KFD A;  5GAG J;  4QWQ A;  3CTA A;  2XAS A;  2IRF G;  2E2H J;  1I1S A;  1USS A;  1WVR A;  2JVH A;  1OFC X;  2EZK A;  2E7W A;  4U7D A;  2LMD A;  4DYQ A;  2PMU A;  1JUP A;  1WPK A;  2A69 F;  4BEH B;  1B8I A;  5ILS A;  3ISP A;  1K4T A;  5JLX A;  4A3K J;  1YW8 A;  4Q47 A;  1T8I A;  2PJP A;  3KP5 A;  2L02 A;  2PG4 A;  4MNU A;  5E3L A;  5CKT A;  4E7L A;  1N77 A;  2B0L A;  5D6E A;  4RGR A;  1U9N A;  1UMQ A;  5EZH A;  3FMR A;  3Q0W A;  1XDU A;  3BT9 A;  3BJO A;  1GLN A;  2LC2 A;  1A6Q A;  2IGM A;  1BJZ A;  2AHQ A;  3H1C A;  4F3Q A;  2LKX A;  5ERI A;  4AUX A;  4PJL A;  1OMI A;  3I4P A;  4K2E A;  1VQL I;  4OIQ F;  3I4M J;  2EQR A;  1T95 A;  3L2Q A;  3CCL I;  2CV2 A;  4OIP F;  1XG1 A;  1QA6 A;  4U0Y A;  4CCK A;  4FTH A;  4D5C A;  1XN7 A;  1S7O A;  1Q1H A;  5IYB J;  1SEU A;  3LQQ A;  1MBE A;  5M5X J;  2IP2 A;  4PDK A;  5CPR B;  5FLX K;  3F8N A;  2OA4 A;  2KKO A;  1D1A A;  5LEK A;  2NVQ J;  4YFK F;  1N75 A;  4IRI A;  1ULY A;  2M8E A;  3I71 A;  1VQK I;  1JUM A;  5AIP A;  2VXZ A;  4KNY A;  2O03 A;  4BXU A;  4ESF A;  5L3B A;  3HRM A;  2E2I J;  3MFK A;  1G3W A;  4MHG A;  2ZXW H;  1CF7 B;  3NRV A;  3GW2 A;  3R0A A;  2FBI A;  1R49 A;  1M1E B;  2OTL I;  3QOE A;  1EA3 A;  4UB8 C;  3IHU A;  4WXC A;  3HSE A;  5F04 A;  3CCS I;  2ZXJ A;  4XMY A;  4LJZ F;  2DK5 A;  3ABM H;  2GXG A;  3IRR A;  4O3M A;  2JA5 J;  3S2H J;  3ZGK A;  1TNS A;  3VOD A;  3G2B A;  2FBH A;  4M71 A;  4Q5S F;  2V6E A;  1JKP C;  4IQJ A;  4M6V A;  3A4C A;  3TKY A;  1MMS A;  2P0W A;  1Y0N A;  1IW7 F;  2R7V A;  3NWS A;  4EJO A;  3OYI A;  2P6T A;  1HCR A;  2QGU A;  1ZHF A;  5FKN A;  4AU7 A;  3LFK A;  1SVO A;  4BXX J;  1OCC H;  2MW8 A;  2JUG A;  5LLQ A;  5LD2 C;  2Y48 A;  3I9V 2;  3CES A;  5HDN A;  3F6V A;  1APL C;  3DV8 A;  3MVP A;  3ZPL A;  2HQN A;  1VQ4 I;  1OCO H;  1SFE A;  4UUS B;  3MZ8 A;  4XN3 A;  2JQ7 A;  2JRM A;  3VOE A;  1UG0 A;  5HNH A;  3LFU A;  5DD4 A;  1I1G A;  3EPZ A;  2LNB A;  3FBI B;  4D9J A;  4XL9 A;  3L09 A;  5FRM A;  3FWE A;  4AD9 A;  2BYV E;  2W24 A;  3RKW A;  3BRO A;  6PAX A;  2OAZ A;  4CHU A;  2B9S A;  2E36 A;  1VI0 A;  5EG0 B;  4IQ4 A;  3K0L A;  3M7G A;  4LLG F;  5CYV A;  2V1U A;  1MIJ A;  2F2E A;  2Z3Y A;  3DPU A;  5IT3 A;  1FMV A;  3F8C A;  5BOX A;  1L0O C;  3OOP A;  2Y69 H;  3KP7 A;  4ABZ A;  4EV0 A;  1VQO I;  3KX2 A;  3G1L A;  3H0G J;  1ZH5 A;  2CGP A;  2ZKZ A;  1KON A;  4XLH A;  2VLA A;  2R7W A;  3A2K A;  2TRT A;  3QU6 A;  4M9X A;  2C6Y A;  4CYD A;  2CQQ A;  1OCP A;  2M5W A;  2I5U A;  2R7R A;  4A3L J;  2YUS A;  1PYV A;  3HYI A;  1SMY F;  1O3Q A;  4RAZ A;  2QCO A;  2VUM J;  1BN5 A;  4M73 A;  2R5Z B;  2I10 A;  4NDL A;  4RGS A;  2M9H A;  4U7B A;  1MNE A;  2GWR A;  1A5J A;  3FKI J;  1FOW A;  2KT0 A;  3KZI C;  4N9H A;  5L3E A;  1R58 A;  1WKM A;  2ID6 A;  2VN2 A;  2QEX I;  5E1W A;  1MBH A;  1YW9 A;  3DTK A;  1U0J A;  2YU3 A;  3BR5 A;  4M3G A;  2ZME A;  3P9I A;  4M9Z A;  1BOB A;  2ZXI A;  4M9S A;  3DBR B;  4MLO A;  2N8G A;  3HM5 A;  2LKP A;  2Q0O A;  3RJP A;  1P9Q C;  5LFA A;  3J81 Z;  1FOK A;  1W36 C;  2XAF A;  3S3N A;  3OYE A;  1E3O C;  1HDP A;  2E1M B;  3ONQ A;  3TBI A;  1MMD A;  3EYY A;  2MH9 A;  2YPR A;  3CC7 I;  3RTR A;  1B9N A;  5FLV A;  2EFO A;  3Q3S A;  3WHB A;  1DGR M;  5ICE A;  3GZ6 A;  2ZJP F;  2GIZ A;  3I55 I;  2B63 J;  2A3S A;  2BHY A;  2Y31 A;  3L1P A;  2JUC A;  4Z2Y A;  3OSG A;  3HOU J;  3F8M A;  2XAH A;  4EJT A;  1FLI A;  1ETK A;  2QQ8 A;  2Y0M A;  5IOY A;  4MGR A;  4XRS G;  3GFJ A;  4AVZ A;  4ZTF A;  4EM2 A;  5M3F J;  3CUQ A;  5E8I A;  3SZP A;  1N25 A;  3L2W A;  3HDD A;  1XGO A;  3U9G A;  2F5E A;  3ZOB A;  3K6G A;  4FQG A;  4RLQ A;  1A35 A;  2GM4 A;  2QYO A;  1RUO A;  1ENH A;  2DA5 A;  2QUF A;  3EUH C;  1IJW C;  2X48 A;  3FBN B;  2L54 A;  1WI9 A;  5C4X J;  3E5Q A;  2EV0 A;  2W48 A;  3HRS A;  3T8T A;  2DYR H;  1R5G A;  2MFZ A;  3DTI A;  4I76 A;  2W4S A;  1LVK A;  2ELK A;  4MEX F;  1ZGW A;  3H5N A;  3J81 K;  1IUF A;  1ZEL A;  3HHG A;  4BUP A;  2OUM A;  1TW3 A;  2Z1D A;  1XMX A;  3QYF A;  4DZP A;  1U78 A;  1B4A A;  1FJL A;  3O8H A;  4DIQ A;  1R22 A;  3JW4 A;  3R0J A;  4GYI A;  2JZY A;  3A01 A;  2OU2 A;  3HSF A;  3AL0 B;  4PGG A;  1X1A A;  2VAS A;  5K5O A;  1G3Y A;  2KRF A;  5FRO A;  1TL8 A;  3OS2 A;  3FKJ A;  2WV1 A;  2W1O A;  3OV8 A;  1XPX A;  4CZZ A;  2KDO A;  2KQR A;  2Y0S N;  4OIN F;  3HOV J;  1WJE A;  5K5R A;  2VOD A;  1IGN A;  4RAY A;  2HYJ A;  1PDN C;  1VND A;  4XID A;  1HQC A;  3GBG A;  3Q5F A;  4NB5 A;  3E3V A;  5TGT A;  4EJV A;  5IPA A;  5F1J A;  3AAF A;  3BQZ A;  3GWZ A;  5FKO A;  4MIM A;  3CQZ J;  4WXH A;  1QQI A;  1XGN A;  4CYC B;  5M5W J;  5D5W B;  5FFZ A;  1XDS A;  3DPT A;  2CUJ A;  1GHC A;  4BS9 A;  3I58 A;  3LAP A;  1TWH J;  3JRH A;  1B8I B;  3VYR B;  2VON A;  2V79 A;  1YW7 A;  3OYF A;  4IHW A;  4CSW A;  3HOW J;  3SZG A;  3K4N A;  4OIR F;  4DBR A;  4G12 A;  3C1D A;  1QHG A;  1G4D A;  4M6X A;  2M0C A;  2L7F P;  5BQT A;  1VQ8 I;  2X85 A;  2EA4 A;  5EGO B;  2KL4 A;  3QOP A;  1E17 A;  1X4P A;  3SHF A;  1ZLK A;  1KU7 A;  4MTD A;  1YO5 C;  1OYI A;  1R00 A;  2DOD A;  5LBQ A;  3F9K A;  5KK1 A;  1J7K A;  4XKV A;  3HC7 A;  2EIK H;  4YIR X;  1B59 A;  4FCY A;  3GO5 A;  2F4I A;  2IAI A;  1V5E A;  2A05 A;  4BY7 J;  2X1C A;  2X1E A;  2LY1 A;  5D5V B;  1JKR C;  4XRF A;  4D7M A;  3BC8 A;  3GTJ J;  1FYL A;  2OF7 A;  2DQR A;  3OL3 A;  1KZH A;  2W57 A;  4WK8 F;  3DBL B;  4KMU X;  4IX7 A;  4UVA A;  2LLK A;  1ZRD A;  2IS6 A;  2VBW A;  4HA8 A;  1HBX G;  4MFD A;  3K7A J;  3MKZ A;  1FSH A;  2RN7 A;  4R8H A;  3PNT A;  3I3L A;  3LSK A;  2X6W A;  3L2C A;  1WFX A;  3H36 A;  2DFF A;  1ZKG A;  1AWC A;  3AG3 H;  1AA7 A;  2D1H A;  5DTD A;  3WTX C;  1J75 A;  5FD6 A;  3I59 A;  2R7X A;  1P92 A;  4TV7 A;  1U2W A;  3OS1 A;  4ENM A;  5HS9 A;  1SC7 A;  4XKW A;  5ILU A;  2P5L C;  1SVM A;  4I0A A;  2EZH A;  3ABU A;  2GOM A;  1SAN A;  3BR6 A;  3OYG A;  4BDZ A;  2FRH A;  3IAM 2;  1X3U A;  1DPR A;  5BNG A;  5GAH J;  3ZQL A;  3LAJ A;  2GIV A;  4XLN F;  2KZG A;  3HGY A;  1JJ8 C;  4H4K C;  1BBY A;  3MN2 A;  2FQ3 A;  2WC2 A;  4GO1 A;  3GTL J;  3KFW X;  1JT0 A;  1ZQ3 P;  2H27 A;  1W7P D;  2Y9Y A;  1YJN I;  2HNH A;  2VJ5 A;  4JK1 X;  2W85 A;  3PQK A;  5K1Y A;  2VJJ A;  3LL7 A;  4IHV A;  5HDG A;  2BOL A;  4FAS D;  4V19 K;  1ZG3 A;  1J09 A;  2IA1 A;  3BR0 A;  2Q2E B;  5GPA A;  1ZK8 A;  4GCV A;  4AWX B;  3OYB A;  3LA3 A;  2P7V B;  3CP8 A;  4A0Y A;  3DBH B;  3W2V A;  2NRA C;  4Y4R A;  3FXM A;  4D0P A;  2ISY A;  4S05 A;  1A04 A;  2QKM B;  4ANJ A;  1YFH A;  1RUN A;  3MD2 A;  1JGS A;  2DA3 A;  1AKH B;  5B66 C;  4KUM A;  3DP7 A;  3V8L A;  2O61 A;  1R71 A;  1WJ5 A;  3W6V A;  3J7A O;  1TQI A;  3NEU A;  4XOR A;  3TGN A;  1T08 B;  1YYV A;  2BY3 A;  2E5Z A;  4E7S A;  1FZP B;  4PJN A;  1MH4 A;  3UR3 C; 
#chains in the Genus database with same CATH homology
 1U9O A;  2CU7 A;  2G0E A;  5F0C A;  3GTK J;  3S1N J;  1T33 A;  2E1O A;  1ITY A;  2NVT J;  4L5E A;  2R93 J;  2K9Q A;  3S16 J;  2FJ1 A;  1IRZ A;  4C3H J;  1IDZ A;  2L7M P;  5FKL A;  1IC8 A;  3E7L A;  5J3L A;  2HXO A;  1MH3 A;  1BA5 A;  1MSF C;  1AKH A;  1BW6 A;  1ETW A;  1YRN A;  2K9S A;  4M3F A;  2H8R A;  1TWA J;  4RBO A;  2LVS A;  3Q0V A;  1P7I A;  1ORK A;  3IH2 A;  3NAU A;  4W97 A;  1QPI A;  1AU7 A;  2M2E A;  2XSD C;  2E2H J;  1OFC X;  2EZK A;  3BG9 A;  4DYQ A;  5E3N A;  1JUP A;  1WPK A;  2YS9 A;  4D5F A;  2HXI A;  3S1Q J;  1B8I A;  1RKT A;  4A3D J;  2ME6 A;  1WH5 A;  5JLX A;  4A3K J;  2ECC A;  4A3M J;  3S17 J;  4BBS J;  3BQY A;  3JR9 A;  2CUE A;  4JX5 A;  5E3L A;  1JUS A;  3LSJ A;  1R9T J;  1LE8 B;  1G2H A;  2ID3 A;  1U9N A;  3OIO A;  1UMQ A;  5EZH A;  5J1Y A;  3Q0W A;  3BT9 A;  1NK2 P;  3Q0U A;  4DW6 A;  2VKV A;  1BJZ A;  5FLM J;  2AHQ A;  5K7Z A;  2LKX A;  3HB9 A;  2O8K A;  4AUX A;  1IDY A;  3NAR A;  4M3D A;  3ZQC A;  5F0F A;  1HF0 A;  3VPR A;  1TWC J;  3I4M J;  2EQR A;  3PM1 A;  3HBL A;  3JRC A;  1XG1 A;  3CDL A;  2O7O A;  4B3A A;  3QQA A;  4FTH A;  4D5C A;  1JGG A;  2RAE A;  3BTI A;  3ZQG A;  4RDU A;  1ZTR A;  1ZR2 A;  2COB A;  5IYB J;  4V2F A;  1MBE A;  5M5X J;  2R7Z J;  2DA7 A;  3GTO J;  2NS7 A;  3LOC A;  1LE8 A;  2NVQ J;  4X1E A;  1I3Q J;  1JUM A;  3MKL A;  1RKW A;  1IG7 A;  1X2N A;  2LFB A;  1W0T A;  4A3F J;  3IH3 A;  3CCY A;  2E2I J;  1WGX A;  5C3E J;  3RKQ A;  2IEK A;  1X2M A;  2LD5 A;  3RZO J;  3DCF A;  2D5V A;  3PO3 J;  5F04 A;  3A01 B;  3SJM A;  1GV5 A;  1JTY A;  2R5Y A;  2EBI A;  3BTL A;  2DMP A;  1GT0 C;  1D5Y A;  5C44 J;  2JA5 J;  3S2H J;  3G1O A;  2CQX A;  2X6O A;  4X6A J;  2MG4 A;  1JKP C;  4A3B J;  4M6V A;  1HCR A;  4LOC A;  5FKN A;  1JKO C;  5IYC J;  4MO7 A;  1GVD A;  1TC3 C;  4BXX J;  2MW8 A;  4MFE A;  2QF7 A;  1FIA A;  4QIW N;  2HQ5 A;  1POG A;  3S14 J;  1I6H J;  2TCT A;  1APL C;  3MVP A;  2H1K A;  4UUS B;  3S15 J;  2FD5 A;  5FKM A;  3TED A;  3FIW A;  1BL0 A;  4XRM A;  3LSG A;  2XPU A;  4HNV A;  2HI3 A;  3IH4 A;  1FTT A;  1T56 A;  2DA6 A;  5HOD A;  3SFI A;  1VI0 A;  5EG0 B;  1K61 A;  5F0H A;  3BG3 A;  2K9N A;  1GV2 A;  1UHS A;  4QTR A;  2XPW A;  2CRG A;  1GDT A;  4ABZ A;  2LR8 A;  4M3E A;  3FK6 A;  5J1U A;  3G1L A;  2DA1 A;  3H0G J;  2YU9 J;  3IV5 A;  2TRT A;  4DYC A;  4BBR J;  9ANT A;  4XK4 A;  2CQQ A;  1OCP A;  1RET A;  3O8G A;  4A3L J;  2YUS A;  3BG5 A;  1WH7 A;  5EDN A;  2DMN A;  3D1N I;  4A3J J;  2QCO A;  2HOS A;  1H89 C;  3LNQ A;  2VUM J;  5IYD J;  2JA7 J;  1K83 J;  2DTZ A;  4Y7N J;  5EG0 A;  2R5Z B;  1NK3 P;  2I10 A;  4NDL A;  2M9H A;  2CUF A;  5M3M J;  1EF4 A;  3M4O J;  1CQT A;  1A5J A;  1FIP A;  1PUF B;  3FKI J;  1JJ6 C;  2KT0 A;  2JN6 A;  3RZD J;  1B72 B;  2ID6 A;  5J1R A;  1MBH A;  2X9D A;  1OJL A;  3BR5 A;  4M3G A;  1TWF J;  4J19 A;  1RR7 A;  2EZL A;  4MLO A;  3HOX J;  2N8G A;  2LY9 A;  3HM5 A;  3F0C A;  3TP3 A;  2L0K A;  3QPL A;  2XB5 A;  1E3O C;  2FQ4 A;  2JK3 A;  4C3I J;  1HDP A;  1QVU A;  3QPS A;  4JX6 A;  2VI6 A;  2EZI A;  2XGC A;  2CJJ A;  5EZG A;  2WB1 N;  3BR3 A;  5FLV A;  3Q3S A;  3WHB A;  1LFU P;  2VPR A;  1PUF A;  2B63 J;  2DMT A;  3CMY A;  3B6A A;  5IP7 J;  5FJ8 J;  3HOY J;  3L1P A;  2Y31 A;  1MBK A;  3OSG A;  1B72 A;  2VKE A;  1H88 C;  2WAQ N;  3HOU J;  2OPT A;  4BKX A;  1ETK A;  2XPV A;  1MBJ A;  5IOY A;  3ZQI A;  4XRS G;  3GTM J;  2MGQ A;  4D7N A;  5M3F J;  1F43 A;  4XRS A;  3JRD A;  3HDD A;  1ZR4 A;  3ZOB A;  3BTC A;  1Y1V J;  5C4J J;  2GM4 A;  1P7J A;  1HLV A;  1H8A C;  1ETO A;  1ENH A;  2DA5 A;  1IJW C;  3SDG A;  3GTG J;  1TWG J;  2X48 A;  3A03 A;  3G1M A;  2R92 J;  1FTZ A;  1UG2 A;  2FX0 A;  1MBF A;  2NS8 A;  3HOZ J;  3GTQ J;  5C4X J;  2DMU A;  1ETV A;  2ECB A;  2W48 A;  2P81 A;  1VFC A;  1Q1V A;  1MBG A;  4I76 A;  4FE4 A;  4B1R A;  5IP9 J;  2ELK A;  4IHY A;  1RPW A;  5GP9 A;  1ZGW A;  3FIS A;  1IUF A;  2ZB9 A;  4DZP A;  4JP0 A;  5FKK A;  4I6Z A;  1U78 A;  3S2D J;  1FJL A;  3O8H A;  3FK7 A;  3WHC A;  3TW6 A;  2M8G X;  1MNM C;  2XB0 X;  4S0H B;  3A01 A;  3S1R J;  2PMZ N;  2MSY A;  1QRY A;  5F27 A;  2WV1 A;  2E19 A;  2GBY A;  1YRN B;  4DZJ A;  5K7F A;  2L7Z A;  3JRB A;  2KDZ A;  2Y0S N;  2NVY J;  3HOV J;  2DA4 A;  3TW7 A;  5EEA A;  1NTC A;  1IGN A;  2HYJ A;  1VND A;  4XID A;  2GLO A;  2HOA A;  1LFB A;  3A02 A;  3S1M J;  3GBG A;  3K2A A;  5IPA A;  3BTJ A;  4B4C A;  5F1J A;  3HGG A;  3TP0 A;  3BQZ A;  4AC0 A;  5FKO A;  4MIM A;  1F36 A;  1GUU A;  3C2B A;  3CQZ J;  3HKZ N;  1U8B A;  2NOG A;  5E3O A;  4CYC B;  5M5W J;  2JA6 J;  3PO2 J;  5EF6 A;  3ZQH A;  1ETX A;  2HOT A;  1JTX A;  4UUS A;  1TWH J;  3JRH A;  1B8I B;  4JX4 A;  4UUT A;  5IP6 A;  2JJ7 A;  4IHW A;  3HOW J;  2Y2Z A;  3UKG A;  1HDD C;  2XGE A;  4G12 A;  2R0Q C;  3LSR A;  4C2M J;  3JRG A;  2M0C A;  2L7F P;  5E3M A;  3BR2 A;  1WCM J;  5IOZ A;  5EGO B;  2LTP A;  4XIC A;  1RES A;  1Z0X A;  2XGD A;  4AYB N;  2L9R A;  4A3I J;  4CYC A;  4FCY A;  1XC5 A;  5F08 A;  2IAI A;  1I50 J;  3BR1 A;  1JKQ C;  1JT6 A;  4EEF G;  4BY7 J;  2DA2 A;  2Y9Z A;  1JKR C;  4D7M A;  1SFO J;  3GTJ J;  2OF7 A;  1OCT C;  1ETY A;  4IHX A;  2LLK A;  1VF9 A;  4DYR A;  3GTP J;  4MFD A;  3K7A J;  3JRE A;  1XS9 A;  1DU0 A;  4GFB A;  5EYR A;  4V2G A;  5EGO A;  1BW5 A;  2R5Z A;  1IV6 A;  3JRI A;  1ZKG A;  3B6C A;  4QSH A;  5DTD A;  4Y52 J;  5JLW A;  4W1U A;  4A69 C;  1S7E A;  1Z77 A;  2DJN A;  2DMQ A;  4M3B A;  1WI3 A;  1X58 A;  3H3V K;  1QVT A;  3JRF A;  2R5Y B;  4A93 J;  1O4X A;  2LP0 A;  2EZH A;  1W0U A;  3ZQF A;  1SAN A;  3BR6 A;  2K40 A;  2AO9 A;  5BNG A;  3ZQL A;  2DN0 A;  3RQI A;  5DS9 A;  2JA8 J;  3HGY A;  1JJ8 C;  5K7H A;  1HOM A;  2XRL A;  3DEW A;  2JMW A;  3MN2 A;  2EH3 A;  3GTL J;  2ME0 A;  4FIS A;  1JT0 A;  1ZQ3 P;  2Y30 A;  2Y9Y A;  2JWT A;  4FE7 A;  4IHV A;  1A6I A;  3LSP A;  3BR0 A;  4A3C J;  5GPA A;  1ZK8 A;  4A3G J;  2IBD A;  4IEJ A;  4A3E J;  4BY1 J;  1DU6 A;  1AHD P;  2E2J J;  1Y1W J;  3OOU A;  2LK2 A;  2DA3 A;  5GPC A;  1AKH B;  3HEF A;  4JYK A;  5M5Y J;  3I4N J;  1FEX A;  1MSE C;  3W6V A;  2HDD A;  2O9L A;  3OSF A;  3M3Y J;  3JRA A;  2M34 A;  2NVX J;  1MH4 A;  1ETQ A;  4C3J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...