3ZR8X

Crystal structure of rxlr effector avr3a11 from phytophthora capsici
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
GPTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AVR3A11
publication title Structures of Phytophthora Rxlr Effector Proteins: A Conserved But Adaptable Fold Underpins Functional Diversity.
pubmed doi rcsb
source organism Phytophthora capsici
molecule tags Protein binding
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF16810 RXLR RXLR phytopathogen effector protein, Avirulence activity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zr8X00
3ZR8X 2LC2A 3ZGKA
chains in the Genus database with same CATH superfamily
3CCSI 3T1BA 2CV0A 2GZWA 2OBPA 3E6MA 2GM4A 2XROA 2LTPA 2LF8A 2L4AA 3I71A 3HC7A 2MBFA 2BEOA 4A3GJ 4XK4A 1U9NA 3GTLJ 1T38A 2X9DA 5D5XB 2XRNA 5L3BA 1OCOH 3JRFA 4MLOA 4CH7A 3LMMA 1F9NA 3OIPA 5EDNA 6PAXA 1U5TB 1G3YA 5E1WA 3L2CA 4XLNF 2BHYA 3CDHA 1W5CC 3KP6A 4HPQA 1GXPA 2KRFA 4RAFA 3OYBA 2CW0F 3WGHA 3WTUC 3PO2J 4OMYA 4HOBA 3CJRB 3IHUA 3MWMA 3OYNA 1MH3A 3VYSB 1QPIA 3WG7H 1TBXA 4YIFA 4P55A 4YIIA 5M3FJ 1TC3C 5IYDJ 5L3GA 3BR0A 2R7TA 1U0JA 3KZYA 1WKMA 4ESJA 4V2GA 3TOAA 4A0YA 1A31A 2E1MC 2V1XA 5D4SA 3DKWA 3DF8A 2M0CA 3T8RA 5HLGA 2YR2A 3KP5A 3BY6A 1UHMA 4KN4X 4CDGA 4UB8C 2HXOA 1TNTA 3OWTA 2OCCH 2YX4A 3FXUA 4M73A 5J40A 5GAHJ 2E1OA 2KL4A 1L0OC 2R7FA 4MIMA 5ICCA 4CCNA 1U5TC 3KP4A 5CVRA 2PJRB 2GOMA 3BR3A 1ZAOA 3B6AA 1IO2A 3ZP5A 2R7OA 2CYYA 1D8KA 2FMLA 1BI0A 1WPKA 4BHPA 3RYRA 1YITI 3JREA 3L2WA 5IT9Z 5AIPA 1J09A 2EB7A 3R61A 3WU1B 1WCMJ 2G7HA 2HDCA 5K5OA 5E18F 1OLTA 4MQVA 5LRRA 5K7HA 2PEXA 2M7AA 2IS4A 2DODA 1TW2A 1LDKB 1V5GA 1FIPA 3FBNB 3R0JA 1A6IA 4XONA 2Q1ZB 3ROUA 4M74A 3QPTA 1B8IB 5GPCA 1KGSA 4ZJZA 4I2OA 3DCFA 2XRLA 3ZMTA 1LFPA 1D1CA 5EZHA 4XSXF 5E8GA 1TZLA 3TKYA 3BP8A 4RGSA 5HDNA 1FOYA 4XNFA 3TP3A 2XVCA 2VKDA 4F7ZA 3VPRA 4YFXF 1KQ8A 4XBFA 1R22A 1RNLA 4WWCA 2ISZA 3JAMK 4II3A 1YI2I 4J00A 1K6YA 3BG6A 4JOMA 4HLYA 1QO0D 3S17J 4J19A 2Z5UA 5LD2C 1U8RA 3HXLA 4G94A 2E19A 3ABLH 2XSDC 3IH2A 2R7SA 1X4PA 3VYTB 2KLOA 4AYBN 3S3MA 4NUBA 3BT9A 1RUOA 3FMSA 1ON1A 1IV6A 1ONVA 5J8FA 3MCZA 4XRSG 4UNOA 4CCMA 4BXFA 3BDDA 4EEFG 4U7DA 5EF6A 5M5WJ 2XIGA 3LA3A 2DAOA 2CU7A 2EZHA 1U3EM 3MKWB 1T98A 5JR3A 2RNGA 1BC8C 3K4BA 5M5XJ 1TNSA 2M7BA 1TWCJ 4RB2C 1LVKA 1TWGJ 2QLZA 2LRDA 4BU2A 2KPMA 1MBEA 5JHUA 1MNMC 4XRSA 5CQEA 1K4SA 4DIQA 4DYCA 1ZRFA 2CUZA 4LMYA 2P7CB 2F4IA 4LLGF 1WFXA 2L0KA 3CUQC 5M5YJ 3ERMA 5BPIA 1UAAA 2DOAA 2CQKA 2HOEA 2ZO4A 3FK7A 2E35A 2VQHA 3KLNA 3C18A 3NQOA 1ENHA 4E7LA 2XV4S 1QU3A 4X1EA 2L9NA 2IS1A 1JGSA 3NWSA 5KAFC 1FLIA 1YFHA 2F5CA 4JYKA 2GQQA 2K4BA 2M2EA 1FYKA 2VBYA 4CZCA 2OCEA 3JCUC 4A3JJ 2KP6A 3LSGA 4DOZA 2DJNA 3AL0B 3GUDA 1XX5A 2ZFUA 4BHCA 3GTGJ 5F0FA 1WZ2A 1ZRCA 1FEXA 3H3ZA 2ZFWA 4HEA2 4Y7NJ 5KK1A 2XF6A 5K7FA 4EMSA 2JZYA 3M7GA 5J1YA 1P92A 2VJ4A 3EYYA 1OCRH 5AIQA 4PSXA 2L5QA 1S29A 1G59A 2I8DA 1YOVB 1DPRA 3WU0A 2QBYA 3DXJF 2R7XA 4WK8F 2QQAA 1HOMA 3KYDB 3DV8A 1IRGA 4UUSA 3WGGA 1LFBA 2NS8A 3MKYB 4OINF 3ZMDA 1PUEE 2MD5A 1H9TA 1PUFB 3NAUA 1PJRA 3ZGKA 2DPDA 4HYEA 4IRIA 1R9TJ 3PSFA 2EFPA 2DA5A 2M4KA 1ZARA 4RM3A 3JRBA 1KU2A 5D5WB 5E1XA 3ZQFA 3V7RA 2HR3A 3FDYA 3AL0C 1T33A 3FWEA 2OPTA 2VASA 2DYSH 3Q3SA 3HIFA 5EGOA 1LEAA 2V4JC 3KEOA 5TRDA 1IXCA 2WADA 3SXYA 4PUSA 3VODA 3K70C 4BUPA 4ZZDA 1ETVA 1LUJB 4WXCA 2Y9YA 3ASOH 3TQNA 1BI2A 3OSFA 3C2GA 2P81A 2LDUA 5E17F 1TL8A 2J5OA 4BQQA 2UV1A 3HHHA 1UB9A 4E4HA 1RETA 2EV6A 3HOZJ 4M6YA 3I64A 4GRIA 5F0CA 1TT5B 1UHSA 4HV5A 5CQGA 2EWNA 2MW8A 3BCAA 5LEKA 3EPZA 3W6KB 3CCJI 2HYFA 3CCQI 1VQ8I 4N9HA 1FBSA 5KHDA 1SFEA 4G8XA 4EJVA 3GBGA 2O03A 2R7QA 3S2WA 3ZOBA 3CCYA 2XAFA 3CC4I 2TDXA 1MJBA 3J7ZI 1X3WB 1ETXA 2K9MA 2Q2EB 1H8AC 4PZJA 3H9GA 1X1BA 3FXJA 5FO5A 2OC6A 5LGTA 4DZPA 1FIAA 2OF7A 2A6HF 1FBUA 1OYWA 4ZDOA 1AOYA 3K7AJ 2BOLA 2M1BA 2CQXA 1ZQ3P 1FMVA 2JPCA 5J1UA 2E34A 3LWFA 3HOUJ 1LDJA 4RS8A 3V7SA 4YIRX 2R5YA 3MZYA 4AVPA 4AC0A 1G3WA 2OJED 4X6AJ 3JSOA 3CC2I 3ELKA 2KDOA 4ZDLA 1J59A 3OOPA 2GOXB 2VPRA 3DBLB 4GYIA 1ETWA 3H36A 4I99C 3CDIA 2R5ZB 1BJZA 2PI0A 3BQZA 4LLNA 4P9FA 2OTLI 4I09A 3EQLF 2CO5A 3TW7A 2DTZA 4AUXA 2X1CA 3JRIA 2LBFA 1F5TA 2VJ5A 2L4MA 4R79A 3FXOA 1KQ0A 3OYAA 3VYUB 4CHUA 2V9PA 4C2TA 1FOWA 1O7FA 5L3FA 2MFZA 1TQMA 3B02A 4XKVA 3TW6A 1B1BA 1Y0NA 1JXSA 5IOZA 2PMZA 2K7LA 4EV0A 1AHDP 4YRVA 2LY2A 1LE8A 3NEUA 1FBQA 4KT5C 3RJPA 3GLXA 3I5UA 1T0FA 1O3QA 4KMFA 4I6ZA 3DP7A 3ECHA 2L7FP 3K69A 2R7WA 4D5CA 3BG9A 3ASNH 4M3EA 5E3LA 1JHHA 2MGQA 5B3SH 1RRJA 4EJTA 4OAZA 1K6OA 1F1ZA 5KAIC 2PJPA 3R6SA 1M1EB 4L9TA 2GAUA 3MKZA 2PFBA 2QZ8A 4Y33A 4XRMA 1BL0A 2ZKZA 2I10A 1ZR4A 5DCMB 2R92J 2V6CA 3SHFA 4BKXA 2WV0A 4ESFA 3HSFA 2ADUA 4ENKA 3SYTA 2A68F 1D3YA 1ERDA 2M8EA 3DTKA 2KJBA 2IPQX 3HOTA 5BS6A 5ICGA 3S2DJ 1R00A 2ELJA 3RCOA 4EM2A 1K79A 3A01B 5F64A 1YS6A 3I56I 1HKQA 2FBIA 4UHTA 2DQLA 2V1NA 2VXDA 3GMEA 5FD5A 3JAMZ 1R6RA 2Z2SB 3L2QA 2V1UA 2XASA 1O3RA 2M87A 1GT0C 3BJAA 2WB1A 2CUEA 2V1DA 3GX4X 4ENJA 4EATA 5C4XJ 1UCRA 5D8KB 2KIMA 5JLWA 3HPHA 3I59B 1QZEA 2HS5A 2LKSA 3ZMUA 5LRSA 2WAQA 3TL4X 2ZJPF 3F8MA 3PFYA 3CMAI 1UELB 3LSJA 4IZZA 2QCOA 2RQPA 3E3VA 4G7HF 1K78B 5H6QA 4F3QA 3EUAA 3Q0WA 3HRSA 2BXZA 3HGGA 2NXNB 3LSHA 3RPUD 2VIXA 2X6XA 2E60A 4OAYA 4RB1A 4BE1A 2OV7A 4LG3A 3BQYA 4S0HB 3F21A 3LAJA 2L3DA 2K02A 1RUNA 3FHZA 2VC1A 3FHNA 3TDUC 1IAWA 1W36D 2NVUB 3EUKL 2BGCA 3K1PA 2BY0A 3UNGC 4BYYA 2QM3A 2FNPA 2XKPA 4GDFA 4A5MA 2VT2A 4LB5A 3SFIA 4CUGA 3OYCA 2W1OA 1YRNB 3IL2A 2KMUA 2KQRA 4YFKF 1TTYA 1FP2A 4WCGA 4B1RA 1BC7C 2K3FA 1I6HJ 1OR7C 2XGDA 5F6FA 2GLOA 5DEQA 3SEQA 4ENNA 2HVQA 4M3GA 2LOOA 2D5VA 4ZTFA 1P7JA 1X3UA 4WXDA 2O9LA 2NVXJ 3DTIA 5LHHA 5J6XA 2B9SA 4KNYA 4IPAA 4NB5A 3H35A 3GF2A 1SVOA 3CLOA 2PMUA 1QZZA 5ILUA 2DYRH 3JR9A 1OYIA 2D1HA 3HSRA 4TV7A 5FD6A 2FXAA 3F6OA 2DDBA 2Y0SN 3BR5A 3JRDA 3L7WA 4BQNA 5C44J 3DLLF 3CCRI 3M07A 1NTCA 2VKEA 1U5TA 3CCVI 2K9LA 1BJAA 3GCMA 3QWLA 3WODF 2L02A 4DYQA 1EA3A 3SJMA 1I27A 2RAEA 2Y30A 3IH3A 1AKHB 3A4CA 1JKRC 1I1SA 1MNDA 2FJ1A 3KPHA 3H9QA 1NG7A 4D9JA 3K4CA 2R7DA 3QPSA 3G4SI 1MGTA 2OU2A 4RBOA 4MGRA 4YEJA 5FRMA 3EDPA 3PFIA 1LVAA 1O4XA 1WWXA 1IN7A 1WJFA 3WHBA 2VOPA 4UY8I 2FU4A 3LNQA 4I7HA 1CF7B 2VJIA 2CS3A 2VC0A 4I02A 4AYBA 3UKGA 1VZ0A 1S9HA 2DA6A 3KIOA 1HKSA 1ZH5A 1BOAA 2JJ7A 3BOQA 2HEOA 4CO8A 4W97A 3DU5A 4IVNA 3DLAA 5ICEA 1QVTA 2E2IJ 1R36A 2ZXJA 2O0YA 1D0YA 4HDVA 4CYDA 1YQAA 4F55A 1RZ4A 4Y17A 1WI3A 4LFUA 1TWAJ 4H4KC 2A61A 3S93A 1IUYA 3FMRA 5K1YA 2IVMA 3TO6A 3LA7A 3GTMJ 2NVTJ 4FE7A 4M9SA 4OIPF 3RI4A 3H5AA 4MTDA 5HS9A 1R7JA 2RNJA 2QA4I 2L54A 2PJRA 3HZJA 1XMAA 3F8NA 1Y8RB 5FLVA 5E20A 3I4MJ 3K70D 2W48A 1ZG3A 4CCJA 3K1NA 3D5LA 1BIAA 4GYGA 1SAUA 1R71A 4XL9A 2EH3A 2F5FA 3G73A 4FISA 1BR2A 2P6TA 4Y4RA 4DBQA 5B66C 3BROA 3HUGB 1FC3A 2XAQA 3T8TA 1IXRC 2AQEA 3BC8A 3HDDA 1G3SA 2IGOA 3QODA 2PMZN 1J0RA 3H9JA 4HW0A 1BW6A 1ORKA 2ZJRF 1ZK8A 3ZQ7A 4H0EA 1B9NA 4HNUA 1FTZA 4RDUA 3B73A 1OCZH 2M0MA 2PN6A 1MDMB 2H09A 4A5NA 1IN6A 3TBIA 1B8IA 1XB4A 1S3JA 3C2HA 4D5FA 2DT7B 1BR4A 3W2VA 1FX7A 1E3OC 4IF4A 5FKOA 2QQBA 3GFMA 5JLXA 5FROA 1LFUP 3I53A 2MC4A 2JSPA 3TMOA 2HQ5A 2ZXIA 2CGPA 2XHKA 4N9IA 1WJDA 3GFJA 4JX6A 1TQPA 1VQ9I 3FISA 2COBA 4LD5A 1Y8QB 1V5EA 1GHCA 3CUQA 2FMYA 3N4MA 1QHGA 4NDLA 4ANJA 4QTRA 3QAHA 4HQEA 2CRGA 2X6YA 4MFEA 1XGOA 2XF7A 4NC8A 4A3IJ 1VQPI 5DUKA 2Y9ZA 2WC2A 1GXQA 1GVJA 1QNTA 2E36A 3O8HA 1XMXA 1EJ9A 4HAMA 4Y15A 4EM1A 2VONA 4L5JA 1SD5A 2WB1N 4I76A 2H6CA 3GZNB 3AG2H 4BE2A 2WAQN 3F8CA 4E7JA 1YJNI 4RGXA 4A69C 3GVAA 4IRGA 2DN0A 3S15J 3H1CA 2LH9A 1SD6A 2EJRA 5F04A 2IW5A 5GADJ 5B1AH 5ED4A 3OR1C 3PNVA 5J4VA 5GP9A 4B4CA 1FWZA 4XN0A 1K4TA 2C6YA 5EEAA 5L3DA 2X1DA 1R5HA 1UJ8A 2X51A 4FX0A 3OYLA 4PJNA 5F1JA 1XCVA 3S14J 2HOAA 3GFLA 3OYMA 4EGYA 1MSFC 1MIJA 3VFZA 1W5TA 2IXSA 3RPQA 2H8WA 2JTVA 4BQOA 2LK2A 1OMIA 5HDKA 4IHTA 5IYCJ 4XICA 2AS5F 1WI9A 1GDTA 2JA5J 1Z6TA 2IBDA 4A6EA 4FCYA 2LFBA 1V55H 1ITYA 3RKWA 4PJ0C 4AWXB 3IRRA 4Z6YA 2VKHA 2BE5F 4B09A 3QP5A 4RAYA 4YELA 4ZC3A 4CA0A 3E6BA 2A05A 1YG2A 2YU3A 5C3EJ 1REPC 2IS2A 4UUVA 3P9KA 4IHYA 3HYIA 2EA2A 1AA7A 4KIBA 1J5YA 5F0HA 1D0XA 2F4OB 4MFDA 4X0GA 1GUUA 1RR7A 4XIDA 2ZSIB 3CF5F 2UZKA 5CVJA 2HU9A 4S05A 3S1RJ 3PM1A 1GV5A 3S1NJ 3CCUI 1KU3A 2IAIA 5LBQA 3LOCA 2COMA 4MEYF 2DO7A 3KP3A 3OYHA 2UWMA 1D8JA 3JRCA 2BW3B 2CMPA 2L01A 4HG2A 4B43A 3M9AA 1HLVA 1USSA 4FT8A 1FTTA 3RQIA 4LJZF 3F0CA 2WY7Q 4UUTA 5BPDA 4XLCA 3U2RA 5DS9A 4A3MJ 3ZQCA 1A36A 2GA2A 4HNVA 3LSTA 2V9KA 5EZGA 1YW7A 4OWRB 4MTEA 3ZCOA 4UVAA 1W36C 1SAXA 1MBHA 3SZGA 4P5OA 2M34A 4N0BA 3OS1A 1WH5A 5JVGF 1ZGAA 3M4OJ 2V6EA 2CFOA 2CH0A 2LG4A 2MG4A 3I58A 1QZYA 3LSIA 4ZH4F 1V5FA 2LMDA 1U9OA 4DW6A 4QPQA 1GLNA 2E2JJ 3HM5A 2VUMJ 2P6SA 2XKOA 4CGZA 1P4XA 3H0DA 1LNWA 4RB0A 3QYBA 1DQUA 3VDXA 4CICA 1P7IA 2OQGA 4OIOF 5JI6A 3FXKA 2LR8A 2Q2EA 1G6NA 5ILSA 2HQNA 5KCMA 3E7LA 4IHVA 4FE4A 1GVDA 4BEHB 5J8CA 3GTJJ 3BZCA 4XOTA 4A2UA 2IGNA 1XG1A 1A5JA 2AXLA 4FQGA 4HX8A 3WTYC 1K7AA 2KFDA 4Y52J 4KIFA 1KU9A 2TCTA 2STTA 3ABKH 2R7ZJ 1OPCA 3CP2A 5B5EC 5FLMJ 1SFXA 2LKXA 1U8BA 2ACJA 4G7ZF 1E0EA 3EUHC 2OAZA 2ZC2A 5E3MA 3S8PA 2I5UA 3FXLA 3FKIJ 3K4LA 3DBHB 5LHIA 2M8GX 2IP2A 3QYFA 3QRFF 2A5WA 2H1KA 4HA8A 1B4AA 1VQNI 1G8XA 2UXXA 1TT0A 4HSTA 3OOUA 2WAEA 5TGTA 3RYPA 1T95A 2B7EA 2ZSHB 1I50J 3A03A 2DA4A 2WBMA 2FQ4A 1MSEC 3MEXA 1P9QC 3EYIA 2VN2A 5EYRA 3H92A 3LAPA 5DYMA 4CSWA 1MNEA 2YS9A 3AG3H 4DJAA 2VI6A 3MZHA 3N97A 1O3SA 4A3LJ 2M30A 5IP9J 1X58A 2HTSA 4A0ZA 4C3HJ 3VB2A 3I9V2 4U7BA 1RKWA 4C9YA 1HXDA 3HOVJ 3BR1A 3CJQB 2MLGA 3ABMH 3HRMA 5B1BH 4O5VA 5BQTA 2FOKA 2H27A 4Q5SF 2EK5A 1DUXC 3O2PE 2L9RA 3KCCA 2EQRA 1IN4A 3HKZN 2HQAA 2X4HA 2ZMEB 1W7PB 2NS0A 4ITVA 3HOXJ 4Y3OA 1ZGWA 3DEEA 1NHAA 2RDPA 5BNGA 4G6TB 3U9GA 5HNHA 1XN7A 3NARA 2WV1A 3GTQJ 2XF5A 2BYVE 4ZYEA 2ZNYA 2LYCA 2Y0MA 4E6KG 1RI7A 4MNUA 1Z3YA 4BBRJ 3K9TA 1E3HA 3BR6A 4L5EA 2KISA 2RKHA 3GTKJ 2OUMA 2D1VA 1XGMA 4IXAA 1MBJA 3OY9A 4MEXF 4L0YB 1DGWY 1U2WA 3HTUA 1S7AA 2EPFA 3WTVC 1N78A 2BY1A 2Y0SA 1I3QJ 4IHXA 3A2KA 1AU7A 3E6CC 5LHGA 3A01A 1ZKGA 1WQ2A 2H1LA 3GLLA 5HOOA 2XDVA 2EBIA 1IDZA 5HDGA 2BY2A 3OYFA 2GA1A 3DFGA 4B44A 3OS2A 1Z67A 2ZMEC 3CMEI 2NOJB 2VOOA 5EEGA 4EQQA 1ETYA 5FKLA 3GW2A 2M9HA 1OR7A 3F72A 2H8RA 2ESHA 4XKWA 2UXNA 1MMNA 4E7SA 2F6CA 2ISYA 1S5LC 4IEJA 3V7CA 1IG7A 4FX4A 5DTDA 3G1LA 2NNYA 1XGSA 2Y69H 1K78A 4BDYA 2E1NA 4BNCA 2G9WA 5H6RA 5F08A 3X2QH 2WTEA 3J81K 3VEPA 4V2FA 2L9VA 1XC5A 5EJCA 3O8GA 4LLLA 3ERED 2E1CA 3SZPA 1TLHB 2NVYJ 2DOFA 1S7OA 2VKVA 5JVTA 3COAC 3V8LA 4NQWA 4DGWB 1XGNA 4UVBA 3RDIA 3OR2C 1N77A 3W2WA 3KEYA 5HLTA 5IP6A 4AIJA 1YRNA 1V4RA 3Q9VA 1OCTC 1Z6RA 5D5UB 3D1NI 4GCVA 4DNCA 4DBRA 3WG9A 5JHFA 3JSPA 2DT6A 2GIZA 2HGCA 4G12A 5IP7J 1ETQA 2WWYA 1SFOJ 3QU6A 4BXUA 2IJLA 1HF0A 2PMHA 2BHZA 2VQLA 2XB0X 5EG0B 1USTA 3IAM2 2W84A 1OCCH 1YHQI 3BZ6A 2PBIA 2DMNA 4NC6A 3KFWX 4P96A 2JA2A 3HOYJ 1Z9CA 4IJAA 2V9VA 5CJ9A 3G71I 2ECBA 2CV2A 2LY1A 3QYEA 3V42A 1I1GA 2X85A 1RPWA 1Z77A 3WE3A 3GYHX 4UB6C 3D0SA 2K27A 5ILVA 3CO6C 1EH6A 4HZFA 1SMYF 4M6XA 1X19A 1AKHA 5C4JJ 2CWEA 1HC8A 4M3DA 1R4MB 1RESA 1T8IA 3W6VA 2QQ9A 2TRTA 2M5WA 3Q0UA 4XSZF 3E5QA 4PSWA 1VTNC 2DPUA 2DTRA 4OOIA 4E7ZA 2DI3A 5ICFA 4HV6A 4A0XA 4UXNA 1YW9A 2XPVA 4PFPA 1HBXG 3KETA 1YIOA 4ZYHA 2ICWG 4LGWA 4CCLA 3JRAA 4KJZA 2N8GA 2DW4A 1HSTA 2IEKA 4II2A 3O6BB 2EV5A 5CKTA 1JGGA 2HOSA 2PQ8A 1MH4A 4A93J 2RN7A 1FSEA 1X2NA 4OU0A 1VFCA 1JT6A 1G4DA 2QUFA 3OIOA 1YJ9I 1W5SA 2NOGA 2K4JA 2OA4A 3ESWB 3ZN0A 2VQCA 3RTRA 2LSOA 1R23A 2MYSA 4CYCA 1X4OA 4KIGA 1WJ5A 2P4WA 1Z7LA 1JUMA 1SD7A 5CVUA 3GO5A 2DXIA 3CCEI 2YX7A 3I4PA 2JVGA 3J7YJ 1I5ZA 4I98B 2R3SA 2ID6A 2DLLA 2RGVA 3HUGA 5HLHA 4LIUA 4IRHA 3L00A 3O3KA 5IYBJ 2ZJQF 4CXFA 4E7KA 3S1QJ 5LLQA 1UMQA 4ZDPA 3KYCB 2R5YB 1NG6A 2VBZA 2JRTA 1F36A 3QP6A 1BN5A 2GWRA 4LG0A 3S3NA 2Y75A 2BV6A 2LNBA 3K6GA 3REOA 2HPIA 2AO9A 2OZ6A 4PGGA 3ZN1A 3F8FA 1IRZA 3ZQGA 2KT0A 2VL8A 1JI8A 3CCLI 2CFXA 2XGXA 2O5RA 4GGGA 2J5PA 2YUSA 1H89C 3CMYA 2EIMH 3K2ZA 1HSJA 5FFZA 1G3TA 4P1WA 4EM0B 1MMDA 3QOEA 3F23A 2FBKA 1YX5A 3HJEA 4BY1J 3S32A 2KHMA 3HOWJ 3MZ8A 2HQRA 3TOBA 2IRFG 1IN8A 2LBFB 3CUOA 3BZKA 5FKMA 4ASNA 4G6DA 1ZLJA 1UFMA 3S1MJ 1IW7F 4PJMA 2DA2A 4NC7A 2YSRA 4GFBA 2X0LA 1JE8A 2HKXA 5TJJA 3OIQA 4C3IJ 3IRQA 4HLXA 2HOTA 2W82A 1LE8B 2Q8KA 2DK8A 2JA7J 5DD8A 1R1VA 3KYLA 5FJ8J 3L1PA 4HSRA 1LPQA 4AIKA 1P2FA 5ERIA 2MLKA 3ISPA 1YIJI 1P6RA 3DU6A 1N75A 2EILH 4N4NB 4QWQA 2FNAA 2P0WA 3FBIB 4BQAA 1BA5A 4XN3A 1ETOA 4ZTJA 4O3MA 3Q0VA 3K4MA 3HOSA 1TWHJ 2K85A 2HYJA 3CC7I 2AHQA 3CJTB 2G0EA 2EZLA 2JK3A 3BG5A 1AWCA 1QA6A 1STZA 2W4SA 1Q1VA 4CCKA 3ABTA 1KONA 4PGHA 4HDUA 1TQIA 1Y6IA 4L0ZB 5FLXZ 4E7HA 3RIRA 3WTTC 1BI3A 3K10A 2PG4A 2OQRA 4BJTA 4UV9A 4KUMA 4A3DJ 1YJWI 5F27A 1W1WE 3R4KA 1Y1WJ 1OJLA 2NNNA 4U0YA 1JUSA 3TGNA 4BGDA 4J01A 2ZXWH 2EINH 2BY3A 2P5KA 1I3AA 3DPLC 2KIFA 1QPMA 4KT6A 4EVIA 4B3AA 2A5YB 4XOPA 1LKXA 4P9UA 3WTZA 4M9XA 2DMQA 3W3CA 1B59A 5E8IA 4Q48A 3OYIA 1D0ZA 2ECCA 5FB2A 1JKOC 3GTOJ 2DU9A 3RPUA 1IRXA 2DFHA 3OSGA 3FXRA 1APLC 4XMYA 3PL8A 3ZQLA 3M3YJ 5HNFA 3K4JA 5FFXA 1W0UA 3BTCA 1XTAA 4B3XA 3OYDA 1YS7A 2FA5A 2FBHA 2ZJ2A 2B0LA 2LD5A 3UR3C 2JA6J 2A07F 3ZPLA 4EJUA 4GXOA 3M8FA 4BE0A 3U21A 2FUG2 2JWTA 2JN6A 3Q5FA 1FPQA 3IH4A 3K0LA 2ZCWA 3KX2A 1IXSB 3QU3A 1BIBA 1OYYA 2UUZA 4EGZA 4G9YA 3F9KA 5IOYA 3FK6A 4KMUX 3TO9A 3RKYA 2F48A 4I0BA 2KIUA 3H3VK 3DEWA 2HZTA 4GO1A 1W7PD 3K4KA 3BJOA 2XSJC 3L2UA 1F43A 4U87A 2BW3A 2LVSA 2IA0A 2NYXA 3J81Z 1QBJA 1LB2A 2Y48A 3AFHA 2L7ZA 1L3LA 1BBYA 2QGUA 2MH2A 1J9IA 5AONA 4JX4A 2VXZA 5DM7F 1RR8C 1UG2A 2M4GA 1H0MA 4BS9A 2MSYA 1IDYA 2QF7A 3ZQQA 4L9JA 2NS7A 3OMYA 2E1MB 3M1EA 5KNLA 3I4NJ 1Z3XA 4V19K 3QPLA 3KP7A 3MQ0A 3WU2C 1ZR2A 2H94A 2OZUA 4BY7J 2W85A 3F22A 1ULYA 3AG4H 1YX3A 2Z99A 1IV8A 3EUHA 2G7UA 1MJAA 2F2EA 4U88A 5LGNA 4KITB 1SVMA 3HKZA 4JQFA 2Y31A 1CQTA 2QQ8A 3J80K 1T6SA 1Z91A 1JT0A 1G2HA 1ZHFA 3DPTA 1R5GA 2YPRA 3BCBA 4HF1A 4KDPA 4BJ6C 2AQFA 2VPLA 1R5ID 2KRCA 1UG0A 3LA2A 4Z2YA 2IGKA 3ZR8X 2ZNZA 4OMZA 4CZZA 3G6EI 1V54H 2CUJA 5A2QZ 1WH7A 3PNTA 4HBLA 1JUPA 1ON2A 2NRAC 3FF5A 2QYOA 4BEHA 3L09A 2XAJA 3CLQA 2A6EF 3NRVA 3ABUA 3F8BA 1Z21A 3SQNA 4ON0A 3LQRA 4U0WA 3CCMI 1I6XA 3DQVC 4IHWA 5CYVA 2R7RA 2CUFA 1NK3P 1FOKA 4DZJA 1NH3A 1X2MA 2DA7A 1X1CA 2PLYA 1XD7A 3OYKA 2FRHA 2DFFA 4YG2F 3HSEA 2JSCA 1VI0A 2JA8J 5HLIA 4PK4A 3RZDJ 4XORA 4W1UA 2M45A 2DFIA 1FNNA 1FOXA 1T2KA 1S8NA 2LLKA 3PQKA 1IUFA 5D8LB 1DGRM 2Z1DA 3F6VA 1XDUA 2LC2A 3CDLA 1HCRA 2KIQA 2F5DA 4RM2A 1MMGA 5CPRB 2P7VB 1R58A 3ML6A 4NBQA 1XDSA 4A3FJ 2Z3YA 3KE2A 3VSKA 1PUFA 3A0BC 3CZ6A 5KVRA 3CESA 1A04A 4EJOA 5GTIC 3HBLA 3OV8A 4K2EA 2K86A 1Z05A 1FY7A 2JQ7A 1VF9A 3BWGA 1D1BA 2E7XA 2KRHA 4L9NA 5GPAA 5F1RA 5D6FA 3FM3A 3KP2A 2R4GA 1OKRA 5GAGJ 4C30A 1FZPB 1WJAA 4I01A 1B72B 2ZMEA 1ZGJA 3FXQA 1W7PA 3V8KA 4AU7A 5D6EA 2E7WA 4XKBA 2DOEA 3BJ6A 1HDPA 2XPWA 1HA8A 2QKLB 5E3NA 4MO7A 3BR2A 2JRMA 3E6DA 4JP0A 4FTHA 2EIKH 1EKEA 4UVCA 2DMPA 1PDNC 2XPUA 2DBBA 3D5RC 4A3KJ 3BTLA 1X1AA 3CUQB 1PYVA 5BOXA 2D45A 1R1TA 3CF2A 3T5XA 1JJ8C 1Y39A 1P4AA 1UZCA 1BM9A 5LGUA 2W00A 3D5SC 2O61A 2BZTA 1XMKA 1VQ4I 2X6WA 4D7MA 3BPXA 3RQ4A 5D4RA 3RKQA 1VQKI 4XLAA 2IS6A 2O7OA 4KFCA 1MBGA 3IP4B 4M3FA 3JTGA 1XPXA 5HS8A 4PFOA 5FGMA 1O7LA 1WJCA 1SFUA 3LSKA 1WRJA 4RLQA 2LREA 1YW8A 1BOBA 4N4OB 2QSHX 4JX5A 2CW8A 2FF4A 3V4GA 4U0VA 4B8XA 3WE2A 4IHSA 3BLYA 5FRNA 5H2FC 4ABZA 3JRGA 3OYEA 1E17A 3TO7A 2P5VA 3FXMA 1MMAA 2QVOA 2HZDA 2GXGA 4Q4ZF 4XR6A 4AIHA 2QENA 4Q47A 3OYGA 5DM6F 1OISA 1FYMA 2O8KA 3L2RA 4OIRF 4RAZA 2VLAA 1KU7A 1DP3A 4M71A 4XM3A 2ID3A 2F4MB 1ETKA 3K4NA 3KLOA 1W4MA 4C3JJ 5L3EA 1C0WA 1YE9A 3VYRB 4D7NA 1DU6A 4O6JA 2GXAA 5LEJA 3BG3A 2R5ZA 4CCOA 3FMQA 3Q9SA 3DKYA 4ZZLA 4DQ2A 4A6DA 3TP0A 1MKMA 1GV2A 1QQIA 2CJJA 2XGEA 1S6LA 1J7KA 4RB3C 2CQ7A 1NK2P 3HG9A 3R60A 1FT9A 3GFIA 1QRYA 4JBAA 4AD9A 2H6BA 2HVSA 5CLSA 4LOCA 2DT5A 4HRIA 2KZGA 1X1PA 2EZKA 4F93B 1WHUA 3JW4A 2DFEA 1FYLA 1VQMI 2VQGA 2WAFA 5J47A 4L18B 1T56A 1WGXA 4KICA 5EG0A 3S16J 2DJIA 4AVZA 4ZYAA 4Y13A 2EFWA 1XSVA 2R7UA 3C7JA 3ZMSA 1JKPC 2BBYA 3MD2A 1IC8A 3I54A 5FLXK 1JJ6C 3C3WA 1J2XA 4HF2A 2Y2ZA 5L3CA 3ZMZA 4IX7A 4RLFA 1Y0UA 1Z1DA 2CQNA 3SDGA 2E71A 2A6TA 2JPBA 3G2BA 3W2AA 1B6AA 3C2BA 3BG7A 3QQAA 2E5ZA 2DA1A 1VQLI 4QSHA 3L9FA 5DCMA 1SEUA 5H20A 2RREA 3BPVA 2FQ3A 3U1KA 3ZXSA 3PIPF 4IQJA 1ODDA 2ME0A 2FEZA 3EETA 3GXOA 2R0QC 3P9IA 2L9SA 2BXYA 4PJJA 1QGPA 1SFKA 2CW7A 1YO5C 1E2XA 1FMWA 3OS0A 3G1OA 3HRTA 3E5UA 3HGYA 2LF7A 1DPUA 2Z16A 2HNHA 3H0GJ 2KZVA 5D5VB 1X1DA 4KA4A 1ZG5A 1PP8F 1KZHA 2WA0A 2E5NA 3U1DA 4HNTA 3VSLA 2XUBA 1TW3A 1N25A 4RGUA 3I59A 3V8JA 1EV7A 1HQCA 2EFNA 2HDWA 4M9ZA 2L7MP 3OYJA 3M8EA 2EV0A 1FJLA 4RA2A 4R8HA 2VE8A 3FZVA 4L5IA 1KYWA 4M72A 5EEHA 2ELHA 3OL4A 5K5QA 2CV1A 3IKTA 2DQRA 1VNDA 4FHTA 3IKVA 3J80Z 1HW1A 3DEUA 1MD0A 2JVHA 1W0TA 1ZTRA 2BVLA 5FKKA 1X3ZB 5J1RA 4S04A 1OCPA 1S72I 2EFQA 1MW7A 3NWTA 1T08B 3E1SA 4BHBA 3PJRA 2OTJI 3FM5A 2DA3A 4FETA 3LSMA 3OL3A 3RKXA 3M8JA 2AXTC 1MZBA 1QHHD 2K3PA 4F92B 3GZ5A 3IC7A 3ZRGA 2EIJH 3ULQB 3SEZA 2HWVA 4IO9F 3ONQA 4A3BJ 2MH9A 3FIWA 3K1MA 5IT3A 4LB6B 5BMZA 3LQQA 4FASD 1HW5A 3I3LA 1YYVA 3S3OA 4OIQF 4MQ9F 2QBYB 2HPMA 3A0HC 3WGIA 4ZYDA 2RV8A 4XLFA 4KN7X 4UUSB 1T39A 1VQ7I 5J4YA 1V3FA 1LDDA 2W24A 4PDKA 4AIDA 5DCFA 1XS9A 4C2UA 4B47A 1O3TA 2MD0A 1IN5A 2A3SA 5A2QK 3J7AY 3LFKA 1TWFJ 3WTSC 4L9VA 3FKJA 3LSPA 3S2HJ 4UV8A 2LKPA 4HX4A 3I0TA 3HB9A 4BH9A 3L2VA 2XAUA 4G6QA 2ELKA 1SMTA 5GAEJ 4A12A 2O8XA 3BTIA 1RKTA 3DBRB 1KQ9A 3DPUA 4M6VA 5EGOB 4IQ4A 3MN2A 2L2OA 3MFKA 5HS7A 4XLEA 1EH8A 2MA3A 2RC4A 4WF2A 3PQJA 2V26A 2DDAA 2CG4A 4E70A 2P8TA 4C2MJ 4G7OF 3GWZA 1CF7A 4XQFA 1U78A 1EF4A 3KZZA 3DTEA 5HODA 1FP1D 1SVLA 1D1AA 2VJJA 4B48A 2HFHA 4WX9A 2O3FA 3MMYB 2HXIA 1WJEA 2P5LC 2STWA 3WHCA 5JFRA 3K2AA 2GXBA 5DD4A 2X48A 2JUCA 1WSUA 1Z0XA 4ZYGA 4PCQA 1Z7UA 1MBKA 3G1MA 4JK1X 1PVEA 5IT9K 1D5YA 4PJLA 5DV5A 1KYZA 1IRFA 2W25A 3CQZJ 3N05A 3HL2A 2DMUA 2R93J 2M3AA 2DMTA 1PP7U 1ACIA 3T0YA 1JTYA 1LQ1A 3ZMVA 2XGCA 4ETSA 2NAZA 5FKNA 3I55I 1RIOH 3VWBA 2CQQA 2LY9A 3CMMA 3LSRA 3GTPJ 3KEQA 2XB5A 5HVQC 1XCBA 4IL6C 1VQ6I 1A6QA 2F5EA 2FD5A 1SD4A 2OD5A 4MHGA 3SDBA 2E2HJ 3WTWC 2MC3A 3W6JB 1R4NB 2W57A 2V7FA 1JKQC 3B6CA 3VOEA 4BACA 2DK5A 4HQMA 3E97A 3IV5A 1QVUA 2VE9A 2ZXHA 3CO7C 4DYRA 4XRFA 2GBYA 4QPOA 4BJ5C 1LEBA 1B9MA 4EJWA 4XLHA 1MDMA 4ESBA 1IJWC 1D5VA 2B63J 1MMSA 5DUIA 2HI3A 1XSDA 1MBFA 5CVVA 2R7VA 1ZYRF 2LP0A 4D1QA 1WVRA 2RQQA 1HDDC 3AKZA 3LL7A 2ME6A 5IPAA 2Z9OA 2YU9J 4IKFA 2GIVA 4F52A 1R1UA 1DDNA 4NQWB 4I0AA 2XAHA 2XAGA 4RGRA 2HVRA 3CTAA 2K40A 1ZLKA 1RC9A 3DWLE 2QSGX 5E1ZB 2HTJA 3BTJA 2HDDA 3GZ6A 2X1EA 2JUGA 2FX0A 3RSNA 1OFCX 3TEDA 2FOWA 3R0AA 5K7ZA 1ZG1A 3SFZA 4R1HA 3PUBA 2KJCA 3MVPA 1E3PA 3F3XA 1VQOI 1S7EA 3AAFA 2ZB9A 4RMNA 3QPHA 1K83J 3PIOF 1HW2A 3H3UA 1Y1VJ 3CD6I 5GTHC 2KDZA 1BR1A 4IOCF 2FE3A 1IF1A 2A69F 4WXHA 5TISC 2IT0A 5CVIA 3HRUA 1U6GA 2VBXA 4BAYA 3G3ZA 3A02A 1POGA 4IOAF 3IUOA 4BBSJ 4BXXJ 1I39A 2Z33A 1WJBA 2EZIA 2VODA 2V79A 1P4WA 4RAGA 3ZQHA 4ENMA 4BL0B 2HKOA 3IWFA 3PUFA 4XKCA 4HX7A 3CJNA 2VT3A 1LJ9A 4XLPF 1BW5A 3J7AO 2QSFX 1ZRDA 3PO3J 2W7NA 2F5VA 4M3BA 2HYGD 2D2WA 2K9QA 4LK1F 5J3LA 2RVCA 4D0PA 3PSIA 5K5RA 1XSXA 2CSOA 3QOPA 5E3OA 3JRHA 2JMWA 4YFNF 1H9GA 1IZ1A 2K9NA 1TP4A 3HTSB 3E5XA 1F4KA 2IA1A 1IGNA 4BDZA 2K5CA 1T0FC 3MAJA 3P7NA 5DDGA 1YTYA 1JHFA 1UHWA 2EA4A 5IY5H 3WTXC 4NNJA 4E7IA 1BI1A 1A35A 9ANTA 3HEFA 2L7KA 1MJ9A 3PNYA 2PX9A 5M3MJ 4KYWA 3P5JA 1H88C 2ESNA 2EFOA 2KKOA 4QIWN 1DP7P 2BVMA 2QWWA 2X6OA 3LFUA 3MKLA 4NHJA 1HKTA 2IGMA 4KISA 4A3CJ 1JTXA 4CYCB 2VBWA 4A3EJ 2Q0OA 3P9CA 2MABA 3CP8A 1J75A 2NVQJ 2IA2A 2VB6A 1KA8A 1O57A 3C1DA 3IWZA 3E0JB 4HF0A 3TDZC 1K61A 2FSWA 1CGPA 1Q1HA 3ZQIA 1Y56A 2O6GE 1ZELA 3IAS2 1VQ5I 4AM3A 2K9SA 1FSHA 3HHGA 3H5RA 4LG0B 4QLCU 1ZREA 5E79C 1SANA 2ZBKA 2JT1A 3KZIC 1DU0A 3DKXA 3ECOA 1SC7A 3JTHA 3M1CA 3A1YA 1YLFA 5LFAA 3GEZA 3RZOJ 3SZTA 3H5NA 3HPGA 2XC7A 3FX3A 1ZN2A 1EH7A 2ETHA 2DCEA 4LITA 4LIVA 4LK0F 2QEXI 1B72A 1OQYA 3AG1H 2WY8Q 1R49A 2QKMB 4F91B
chains in the Genus database with same CATH topology
4XLAA 2IS6A 3FHNA 2CV0A 1W36D 3EUKL 4XKWA 1MMNA 4E7SA 3IP4B 2F6CA 3HC7A 3UNGC 4PFOA 1WJCA 3LSKA 4RLQA 4BDYA 2LREA 1BOBA 4N4OB 4CUGA 3OYCA 2CW8A 2W1OA 2KMUA 2KQRA 4MLOA 3BLYA 4CH7A 3LMMA 5FRNA 3OIPA 3OYEA 1OR7C 3SEQA 2HVQA 2LOOA 1MMAA 4ZTFA 2HZDA 4XR6A 4HPQA 3OYGA 3DTIA 3OYBA 3H35A 4DGWB 3L2RA 3CJRB 3OR2C 3OYNA 2VLAA 4XM3A 3W2WA 1N77A 3KEYA 1DP3A 5HLTA 3VYSB 3K4NA 1YE9A 3VYRB 4DBRA 5JHFA 2DT6A 4BQNA 4CCOA 3W2AA 2R7TA 2K9LA 1U0JA 1EA3A 2VQLA 3DKYA 2E1MC 3IAM2 3A4CA 1MNDA 2JA2A 3H9QA 1NG7A 4D9JA 3K4CA 3HG9A 3OWTA 2HVSA 4YEJA 5FRMA 2KL4A 4HRIA 2CV2A 4F93B 2LY1A 1WJFA 3QYEA 3V42A 4CCNA 2X85A 2GOMA 2PJRB 2VQGA 2VJIA 2WAFA 2CS3A 4AYBA 1VZ0A 1S9HA 2R7OA 3DU5A 3DLAA 1X19A 2DJIA 4AVZA 4ZYAA 1D0YA 2R7UA 4F55A 3MD2A 4H4KC 3S93A 3L2WA 1J09A 4PSWA 4E7ZA 4IX7A 4RLFA 3H5AA 4PFPA 3G2BA 2A6TA 2PJRA 1OLTA 4CCLA 4KJZA 2M7AA 3BG7A 2IS4A 1LDKB 1V5GA 2E5ZA 3FBNB 3K70D 4II2A 4XONA 4CCJA 3D5LA 2Q1ZB 1SAUA 4XL9A 5CKTA 2RREA 1BR2A 4ZJZA 4Y4RA 4DBQA 3HUGB 3ZXSA 1LFPA 1D1CA 4IQJA 1TZLA 2AQEA 3BC8A 2IGOA 3QODA 3H9JA 4XNFA 2VQCA 2VKDA 3RTRA 2L9SA 4PJJA 2MYSA 1X4OA 1SFKA 2CW7A 1WJ5A 4HNUA 1FMWA 3OS0A 4II3A 1Z7LA 4J00A 2M0MA 1K6YA 2DXIA 3BG6A 4JOMA 2Z16A 2HNHA 3TBIA 2JVGA 2KZVA 5LD2C 1X1DA 3HXLA 2WA0A 2E5NA 4HNTA 3C2HA 3VSLA 2DT7B 1BR4A 3W2VA 2R7SA 1X4PA 4LIUA 2KLOA 3VYTB 2HDWA 3S3MA 4NUBA 3OYJA 4E7KA 5FROA 2MC4A 2JSPA 3TMOA 4ZDPA 2ZXIA 1NG6A 1WJDA 4CCMA 4BXFA 3S3NA 1V5EA 3OL4A 3K6GA 2CV1A 3MKWB 2HPIA 2RNGA 3K4BA 2VL8A 2M7BA 1JI8A 1QHGA 4ANJA 2JVHA 2O5RA 2BVLA 1LVKA 2X6YA 4P1WA 2XF7A 4NC8A 1MW7A 3NWTA 2LRDA 3E1SA 4BU2A 1MMDA 3QOEA 2KPMA 3PJRA 1YX5A 3S32A 2KHMA 4FETA 5CQEA 3LSMA 3OL3A 4DIQA 2CUZA 2LBFB 3M8JA 2F4IA 1WFXA 1QHHD 2K3PA 4F92B 3ZRGA 1UAAA 2DOAA 3SEZA 2VQHA 4PJMA 4E7LA 1QU3A 3ONQA 2L9NA 4BE2A 4E7JA 2IS1A 3NWSA 4FASD 4NC7A 3I3LA 3S3OA 2LH9A 3OIQA 4CZCA 2HPMA 2W82A 2KP6A 3LSGA 4DOZA 3AL0B 3OR1C 3PNVA 4XLFA 3KYLA 2ZFUA 4HSRA 4XN0A 3DU6A 4C2UA 1N75A 2X1DA 4N4NB 2MD0A 4B47A 4HEA2 2X51A 3OYLA 3J7AY 2XF6A 4PJNA 2P0WA 3FBIB 4XN3A 4ZTJA 2VJ4A 3FKJA 3K4MA 3HOSA 3OYMA 4PSXA 2L5QA 1G59A 2I8DA 3L2VA 2IXSA 2XAUA 4BQOA 2W4SA 2R7XA 4CCKA 3DPUA 4IQ4A 1KONA 1Y6IA 4E7HA 3MKYB 2L2OA 3K10A 4BJTA 4XLEA 1PJRA 3ZGKA 2V26A 3PSFA 4BGDA 2VKHA 4J01A 2M4KA 4RM3A 4XQFA 4YELA 4ZC3A 4CA0A 3DPLC 3DTEA 2IS2A 4KT6A 1D1AA 2VJJA 3FDYA 4B48A 3AL0C 2VASA 1AA7A 4XOPA 3MMYB 1LKXA 1WJEA 1D0XA 2V4JC 3W3CA 2WADA 4PUSA 3K70C 3OYIA 4BUPA 4X0GA 1D0ZA 2ZSIB 1IRXA 4PJLA 3C2GA 2HU9A 3N05A 4XMYA 3PL8A 3HL2A 4BQQA 5HNFA 2UV1A 2M3AA 3K4JA 4E4HA 4B3XA 3OYDA 2UWMA 3OYHA 4GRIA 3UR3C 2BW3B 2CMPA 4HG2A 4B43A 3VWBA 5CQGA 3CMMA 3BCAA 5HVQC 4BE0A 3U21A 3EPZA 2FUG2 2WY7Q 3SDBA 4XLCA 3KX2A 2V7FA 5KHDA 2UUZA 4BACA 3F9KA 3GBGA 2V9KA 2ZXHA 2R7QA 3ZCOA 4OWRB 4QPOA 4BJ5C 1W36C 3K4KA 3L2UA 2XSJC 2K9MA 2Q2EB 3SZGA 4P5OA 4U87A 2BW3A 3H9GA 1X1BA 4XLHA 3AFHA 3OS1A 2OC6A 2V6EA 2CFOA 2CH0A 2LG4A 2VXZA 3LSIA 4ZDOA 2R7VA 2M4GA 1V5FA 4BS9A 2BOLA 1GLNA 4QPQA 4D1QA 2RQQA 1FMVA 3AKZA 3LL7A 3ZQQA 4IKFA 3H0DA 3OMYA 2E1MB 4F52A 5KNLA 1Z3XA 3QYBA 1DQUA 3VDXA 4NQWB 2HVRA 1YX3A 2KDOA 4ZDLA 3DWLE 5KCMA 2GOXB 4KITB 3HKZA 4BEHB 4JQFA 2X1EA 2JUGA 4XOTA 3RSNA 2IGNA 3DPTA 3BCBA 4BJ6C 2AQFA 2VPLA 3PUBA 2KRCA 3CP2A 1UG0A 2X1CA 2IGKA 4RMNA 3ZR8X 2LBFA 1E0EA 2CUJA 2VJ5A 3EUHC 3S8PA 1BR1A 3PNTA 4R79A 3K4LA 3OYAA 3VYUB 4C2TA 3QYFA 4BEHA 2A5WA 2MFZA 4XKVA 3IUOA 1G8XA 1Z21A 1TT0A 4HSTA 1WJBA 2WAEA 3OOUA 5TGTA 2PMZA 3DQVC 1T95A 4YRVA 2LY2A 2R7RA 2ZSHB 1X1CA 4BL0B 2WBMA 4XKCA 3OYKA 1P9QC 2R7WA 4CSWA 2W7NA 2F5VA 1MNEA 4DJAA 4PK4A 3PSIA 4XORA 4U7BA 3I9V2 4OAZA 4C9YA 3CJQB 1DGRM 2Z1DA 3MKZA 4BDZA 2LC2A 2K5CA 4Y33A 1T0FC 2HQAA 1MMGA 4RM2A 4NNJA 5CPRB 4E7IA 2L7KA 4ITVA 3PNYA 3VSKA 4Y3OA 3CZ6A 3SYTA 1ERDA 3CESA 3DEEA 3DTKA 2BVMA 4G6TB 5HNHA 3HOTA 3LFUA 2IGMA 2ELJA 3RCOA 4KISA 2XF5A 4E6KG 2LYCA 2V1NA 2VXDA 1D1BA 1R6RA 2KRHA 2Z2SB 1Z3YA 3L2QA 2R4GA 2MABA 3CP8A 4C30A 1WJAA 2WB1A 2OUMA 2VB6A 4EATA 4AU7A 3OY9A 3E0JB 4XKBA 1DGWY 3HPHA 1Y56A 2WAQA 3TL4X 1ZELA 1N78A 2Y0SA 3IAS2 3A2KA 1HA8A 3PFYA 2QKLB 1UELB 4IZZA 3H5RA 5HOOA 2XDVA 4F3QA 3EUAA 3DKXA 3D5RC 3RPUD 3LSHA 3M1CA 1X1AA 3A1YA 2VIXA 4B44A 2X6XA 1PYVA 5LFAA 3OS2A 3OYFA 2E60A 3H5NA 3CF2A 3HPGA 2NOJB 4OAYA 2XC7A 2DCEA 4LITA 4LIVA 2OV7A 4LG3A 4BE1A 2W00A 2WY8Q 3D5SC 2QKMB 2X6WA 4F91B 3RQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR8 X;  2LC2 A;  3ZGK A; 
#chains in the Genus database with same CATH topology
 3CCS I;  3T1B A;  2CV0 A;  2GZW A;  2OBP A;  3E6M A;  2GM4 A;  2XRO A;  2LTP A;  2LF8 A;  2L4A A;  3I71 A;  3HC7 A;  2MBF A;  2BEO A;  4A3G J;  4XK4 A;  1U9N A;  3GTL J;  1T38 A;  2X9D A;  5D5X B;  2XRN A;  5L3B A;  1OCO H;  3JRF A;  4MLO A;  4CH7 A;  3LMM A;  1F9N A;  3OIP A;  5EDN A;  6PAX A;  1U5T B;  1G3Y A;  5E1W A;  3L2C A;  4XLN F;  2BHY A;  3CDH A;  1W5C C;  3KP6 A;  4HPQ A;  1GXP A;  2KRF A;  4RAF A;  3OYB A;  2CW0 F;  3WGH A;  3WTU C;  3PO2 J;  4OMY A;  4HOB A;  3CJR B;  3IHU A;  3MWM A;  3OYN A;  1MH3 A;  3VYS B;  1QPI A;  3WG7 H;  1TBX A;  4YIF A;  4P55 A;  4YII A;  5M3F J;  1TC3 C;  5IYD J;  5L3G A;  3BR0 A;  2R7T A;  1U0J A;  3KZY A;  1WKM A;  4ESJ A;  4V2G A;  3TOA A;  4A0Y A;  1A31 A;  2E1M C;  2V1X A;  5D4S A;  3DKW A;  3DF8 A;  2M0C A;  3T8R A;  5HLG A;  2YR2 A;  3KP5 A;  3BY6 A;  1UHM A;  4KN4 X;  4CDG A;  4UB8 C;  2HXO A;  1TNT A;  3OWT A;  2OCC H;  2YX4 A;  3FXU A;  4M73 A;  5J40 A;  5GAH J;  2E1O A;  2KL4 A;  1L0O C;  2R7F A;  4MIM A;  5ICC A;  4CCN A;  1U5T C;  3KP4 A;  5CVR A;  2PJR B;  2GOM A;  3BR3 A;  1ZAO A;  3B6A A;  1IO2 A;  3ZP5 A;  2R7O A;  2CYY A;  1D8K A;  2FML A;  1BI0 A;  1WPK A;  4BHP A;  3RYR A;  1YIT I;  3JRE A;  3L2W A;  5IT9 Z;  5AIP A;  1J09 A;  2EB7 A;  3R61 A;  3WU1 B;  1WCM J;  2G7H A;  2HDC A;  5K5O A;  5E18 F;  1OLT A;  4MQV A;  5LRR A;  5K7H A;  2PEX A;  2M7A A;  2IS4 A;  2DOD A;  1TW2 A;  1LDK B;  1V5G A;  1FIP A;  3FBN B;  3R0J A;  1A6I A;  4XON A;  2Q1Z B;  3ROU A;  4M74 A;  3QPT A;  1B8I B;  5GPC A;  1KGS A;  4ZJZ A;  4I2O A;  3DCF A;  2XRL A;  3ZMT A;  1LFP A;  1D1C A;  5EZH A;  4XSX F;  5E8G A;  1TZL A;  3TKY A;  3BP8 A;  4RGS A;  5HDN A;  1FOY A;  4XNF A;  3TP3 A;  2XVC A;  2VKD A;  4F7Z A;  3VPR A;  4YFX F;  1KQ8 A;  4XBF A;  1R22 A;  1RNL A;  4WWC A;  2ISZ A;  3JAM K;  4II3 A;  1YI2 I;  4J00 A;  1K6Y A;  3BG6 A;  4JOM A;  4HLY A;  1QO0 D;  3S17 J;  4J19 A;  2Z5U A;  5LD2 C;  1U8R A;  3HXL A;  4G94 A;  2E19 A;  3ABL H;  2XSD C;  3IH2 A;  2R7S A;  1X4P A;  3VYT B;  2KLO A;  4AYB N;  3S3M A;  4NUB A;  3BT9 A;  1RUO A;  3FMS A;  1ON1 A;  1IV6 A;  1ONV A;  5J8F A;  3MCZ A;  4XRS G;  4UNO A;  4CCM A;  4BXF A;  3BDD A;  4EEF G;  4U7D A;  5EF6 A;  5M5W J;  2XIG A;  3LA3 A;  2DAO A;  2CU7 A;  2EZH A;  1U3E M;  3MKW B;  1T98 A;  5JR3 A;  2RNG A;  1BC8 C;  3K4B A;  5M5X J;  1TNS A;  2M7B A;  1TWC J;  4RB2 C;  1LVK A;  1TWG J;  2QLZ A;  2LRD A;  4BU2 A;  2KPM A;  1MBE A;  5JHU A;  1MNM C;  4XRS A;  5CQE A;  1K4S A;  4DIQ A;  4DYC A;  1ZRF A;  2CUZ A;  4LMY A;  2P7C B;  2F4I A;  4LLG F;  1WFX A;  2L0K A;  3CUQ C;  5M5Y J;  3ERM A;  5BPI A;  1UAA A;  2DOA A;  2CQK A;  2HOE A;  2ZO4 A;  3FK7 A;  2E35 A;  2VQH A;  3KLN A;  3C18 A;  3NQO A;  1ENH A;  4E7L A;  2XV4 S;  1QU3 A;  4X1E A;  2L9N A;  2IS1 A;  1JGS A;  3NWS A;  5KAF C;  1FLI A;  1YFH A;  2F5C A;  4JYK A;  2GQQ A;  2K4B A;  2M2E A;  1FYK A;  2VBY A;  4CZC A;  2OCE A;  3JCU C;  4A3J J;  2KP6 A;  3LSG A;  4DOZ A;  2DJN A;  3AL0 B;  3GUD A;  1XX5 A;  2ZFU A;  4BHC A;  3GTG J;  5F0F A;  1WZ2 A;  1ZRC A;  1FEX A;  3H3Z A;  2ZFW A;  4HEA 2;  4Y7N J;  5KK1 A;  2XF6 A;  5K7F A;  4EMS A;  2JZY A;  3M7G A;  5J1Y A;  1P92 A;  2VJ4 A;  3EYY A;  1OCR H;  5AIQ A;  4PSX A;  2L5Q A;  1S29 A;  1G59 A;  2I8D A;  1YOV B;  1DPR A;  3WU0 A;  2QBY A;  3DXJ F;  2R7X A;  4WK8 F;  2QQA A;  1HOM A;  3KYD B;  3DV8 A;  1IRG A;  4UUS A;  3WGG A;  1LFB A;  2NS8 A;  3MKY B;  4OIN F;  3ZMD A;  1PUE E;  2MD5 A;  1H9T A;  1PUF B;  3NAU A;  1PJR A;  3ZGK A;  2DPD A;  4HYE A;  4IRI A;  1R9T J;  3PSF A;  2EFP A;  2DA5 A;  2M4K A;  1ZAR A;  4RM3 A;  3JRB A;  1KU2 A;  5D5W B;  5E1X A;  3ZQF A;  3V7R A;  2HR3 A;  3FDY A;  3AL0 C;  1T33 A;  3FWE A;  2OPT A;  2VAS A;  2DYS H;  3Q3S A;  3HIF A;  5EGO A;  1LEA A;  2V4J C;  3KEO A;  5TRD A;  1IXC A;  2WAD A;  3SXY A;  4PUS A;  3VOD A;  3K70 C;  4BUP A;  4ZZD A;  1ETV A;  1LUJ B;  4WXC A;  2Y9Y A;  3ASO H;  3TQN A;  1BI2 A;  3OSF A;  3C2G A;  2P81 A;  2LDU A;  5E17 F;  1TL8 A;  2J5O A;  4BQQ A;  2UV1 A;  3HHH A;  1UB9 A;  4E4H A;  1RET A;  2EV6 A;  3HOZ J;  4M6Y A;  3I64 A;  4GRI A;  5F0C A;  1TT5 B;  1UHS A;  4HV5 A;  5CQG A;  2EWN A;  2MW8 A;  3BCA A;  5LEK A;  3EPZ A;  3W6K B;  3CCJ I;  2HYF A;  3CCQ I;  1VQ8 I;  4N9H A;  1FBS A;  5KHD A;  1SFE A;  4G8X A;  4EJV A;  3GBG A;  2O03 A;  2R7Q A;  3S2W A;  3ZOB A;  3CCY A;  2XAF A;  3CC4 I;  2TDX A;  1MJB A;  3J7Z I;  1X3W B;  1ETX A;  2K9M A;  2Q2E B;  1H8A C;  4PZJ A;  3H9G A;  1X1B A;  3FXJ A;  5FO5 A;  2OC6 A;  5LGT A;  4DZP A;  1FIA A;  2OF7 A;  2A6H F;  1FBU A;  1OYW A;  4ZDO A;  1AOY A;  3K7A J;  2BOL A;  2M1B A;  2CQX A;  1ZQ3 P;  1FMV A;  2JPC A;  5J1U A;  2E34 A;  3LWF A;  3HOU J;  1LDJ A;  4RS8 A;  3V7S A;  4YIR X;  2R5Y A;  3MZY A;  4AVP A;  4AC0 A;  1G3W A;  2OJE D;  4X6A J;  3JSO A;  3CC2 I;  3ELK A;  2KDO A;  4ZDL A;  1J59 A;  3OOP A;  2GOX B;  2VPR A;  3DBL B;  4GYI A;  1ETW A;  3H36 A;  4I99 C;  3CDI A;  2R5Z B;  1BJZ A;  2PI0 A;  3BQZ A;  4LLN A;  4P9F A;  2OTL I;  4I09 A;  3EQL F;  2CO5 A;  3TW7 A;  2DTZ A;  4AUX A;  2X1C A;  3JRI A;  2LBF A;  1F5T A;  2VJ5 A;  2L4M A;  4R79 A;  3FXO A;  1KQ0 A;  3OYA A;  3VYU B;  4CHU A;  2V9P A;  4C2T A;  1FOW A;  1O7F A;  5L3F A;  2MFZ A;  1TQM A;  3B02 A;  4XKV A;  3TW6 A;  1B1B A;  1Y0N A;  1JXS A;  5IOZ A;  2PMZ A;  2K7L A;  4EV0 A;  1AHD P;  4YRV A;  2LY2 A;  1LE8 A;  3NEU A;  1FBQ A;  4KT5 C;  3RJP A;  3GLX A;  3I5U A;  1T0F A;  1O3Q A;  4KMF A;  4I6Z A;  3DP7 A;  3ECH A;  2L7F P;  3K69 A;  2R7W A;  4D5C A;  3BG9 A;  3ASN H;  4M3E A;  5E3L A;  1JHH A;  2MGQ A;  5B3S H;  1RRJ A;  4EJT A;  4OAZ A;  1K6O A;  1F1Z A;  5KAI C;  2PJP A;  3R6S A;  1M1E B;  4L9T A;  2GAU A;  3MKZ A;  2PFB A;  2QZ8 A;  4Y33 A;  4XRM A;  1BL0 A;  2ZKZ A;  2I10 A;  1ZR4 A;  5DCM B;  2R92 J;  2V6C A;  3SHF A;  4BKX A;  2WV0 A;  4ESF A;  3HSF A;  2ADU A;  4ENK A;  3SYT A;  2A68 F;  1D3Y A;  1ERD A;  2M8E A;  3DTK A;  2KJB A;  2IPQ X;  3HOT A;  5BS6 A;  5ICG A;  3S2D J;  1R00 A;  2ELJ A;  3RCO A;  4EM2 A;  1K79 A;  3A01 B;  5F64 A;  1YS6 A;  3I56 I;  1HKQ A;  2FBI A;  4UHT A;  2DQL A;  2V1N A;  2VXD A;  3GME A;  5FD5 A;  3JAM Z;  1R6R A;  2Z2S B;  3L2Q A;  2V1U A;  2XAS A;  1O3R A;  2M87 A;  1GT0 C;  3BJA A;  2WB1 A;  2CUE A;  2V1D A;  3GX4 X;  4ENJ A;  4EAT A;  5C4X J;  1UCR A;  5D8K B;  2KIM A;  5JLW A;  3HPH A;  3I59 B;  1QZE A;  2HS5 A;  2LKS A;  3ZMU A;  5LRS A;  2WAQ A;  3TL4 X;  2ZJP F;  3F8M A;  3PFY A;  3CMA I;  1UEL B;  3LSJ A;  4IZZ A;  2QCO A;  2RQP A;  3E3V A;  4G7H F;  1K78 B;  5H6Q A;  4F3Q A;  3EUA A;  3Q0W A;  3HRS A;  2BXZ A;  3HGG A;  2NXN B;  3LSH A;  3RPU D;  2VIX A;  2X6X A;  2E60 A;  4OAY A;  4RB1 A;  4BE1 A;  2OV7 A;  4LG3 A;  3BQY A;  4S0H B;  3F21 A;  3LAJ A;  2L3D A;  2K02 A;  1RUN A;  3FHZ A;  2VC1 A;  3FHN A;  3TDU C;  1IAW A;  1W36 D;  2NVU B;  3EUK L;  2BGC A;  3K1P A;  2BY0 A;  3UNG C;  4BYY A;  2QM3 A;  2FNP A;  2XKP A;  4GDF A;  4A5M A;  2VT2 A;  4LB5 A;  3SFI A;  4CUG A;  3OYC A;  2W1O A;  1YRN B;  3IL2 A;  2KMU A;  2KQR A;  4YFK F;  1TTY A;  1FP2 A;  4WCG A;  4B1R A;  1BC7 C;  2K3F A;  1I6H J;  1OR7 C;  2XGD A;  5F6F A;  2GLO A;  5DEQ A;  3SEQ A;  4ENN A;  2HVQ A;  4M3G A;  2LOO A;  2D5V A;  4ZTF A;  1P7J A;  1X3U A;  4WXD A;  2O9L A;  2NVX J;  3DTI A;  5LHH A;  5J6X A;  2B9S A;  4KNY A;  4IPA A;  4NB5 A;  3H35 A;  3GF2 A;  1SVO A;  3CLO A;  2PMU A;  1QZZ A;  5ILU A;  2DYR H;  3JR9 A;  1OYI A;  2D1H A;  3HSR A;  4TV7 A;  5FD6 A;  2FXA A;  3F6O A;  2DDB A;  2Y0S N;  3BR5 A;  3JRD A;  3L7W A;  4BQN A;  5C44 J;  3DLL F;  3CCR I;  3M07 A;  1NTC A;  2VKE A;  1U5T A;  3CCV I;  2K9L A;  1BJA A;  3GCM A;  3QWL A;  3WOD F;  2L02 A;  4DYQ A;  1EA3 A;  3SJM A;  1I27 A;  2RAE A;  2Y30 A;  3IH3 A;  1AKH B;  3A4C A;  1JKR C;  1I1S A;  1MND A;  2FJ1 A;  3KPH A;  3H9Q A;  1NG7 A;  4D9J A;  3K4C A;  2R7D A;  3QPS A;  3G4S I;  1MGT A;  2OU2 A;  4RBO A;  4MGR A;  4YEJ A;  5FRM A;  3EDP A;  3PFI A;  1LVA A;  1O4X A;  1WWX A;  1IN7 A;  1WJF A;  3WHB A;  2VOP A;  4UY8 I;  2FU4 A;  3LNQ A;  4I7H A;  1CF7 B;  2VJI A;  2CS3 A;  2VC0 A;  4I02 A;  4AYB A;  3UKG A;  1VZ0 A;  1S9H A;  2DA6 A;  3KIO A;  1HKS A;  1ZH5 A;  1BOA A;  2JJ7 A;  3BOQ A;  2HEO A;  4CO8 A;  4W97 A;  3DU5 A;  4IVN A;  3DLA A;  5ICE A;  1QVT A;  2E2I J;  1R36 A;  2ZXJ A;  2O0Y A;  1D0Y A;  4HDV A;  4CYD A;  1YQA A;  4F55 A;  1RZ4 A;  4Y17 A;  1WI3 A;  4LFU A;  1TWA J;  4H4K C;  2A61 A;  3S93 A;  1IUY A;  3FMR A;  5K1Y A;  2IVM A;  3TO6 A;  3LA7 A;  3GTM J;  2NVT J;  4FE7 A;  4M9S A;  4OIP F;  3RI4 A;  3H5A A;  4MTD A;  5HS9 A;  1R7J A;  2RNJ A;  2QA4 I;  2L54 A;  2PJR A;  3HZJ A;  1XMA A;  3F8N A;  1Y8R B;  5FLV A;  5E20 A;  3I4M J;  3K70 D;  2W48 A;  1ZG3 A;  4CCJ A;  3K1N A;  3D5L A;  1BIA A;  4GYG A;  1SAU A;  1R71 A;  4XL9 A;  2EH3 A;  2F5F A;  3G73 A;  4FIS A;  1BR2 A;  2P6T A;  4Y4R A;  4DBQ A;  5B66 C;  3BRO A;  3HUG B;  1FC3 A;  2XAQ A;  3T8T A;  1IXR C;  2AQE A;  3BC8 A;  3HDD A;  1G3S A;  2IGO A;  3QOD A;  2PMZ N;  1J0R A;  3H9J A;  4HW0 A;  1BW6 A;  1ORK A;  2ZJR F;  1ZK8 A;  3ZQ7 A;  4H0E A;  1B9N A;  4HNU A;  1FTZ A;  4RDU A;  3B73 A;  1OCZ H;  2M0M A;  2PN6 A;  1MDM B;  2H09 A;  4A5N A;  1IN6 A;  3TBI A;  1B8I A;  1XB4 A;  1S3J A;  3C2H A;  4D5F A;  2DT7 B;  1BR4 A;  3W2V A;  1FX7 A;  1E3O C;  4IF4 A;  5FKO A;  2QQB A;  3GFM A;  5JLX A;  5FRO A;  1LFU P;  3I53 A;  2MC4 A;  2JSP A;  3TMO A;  2HQ5 A;  2ZXI A;  2CGP A;  2XHK A;  4N9I A;  1WJD A;  3GFJ A;  4JX6 A;  1TQP A;  1VQ9 I;  3FIS A;  2COB A;  4LD5 A;  1Y8Q B;  1V5E A;  1GHC A;  3CUQ A;  2FMY A;  3N4M A;  1QHG A;  4NDL A;  4ANJ A;  4QTR A;  3QAH A;  4HQE A;  2CRG A;  2X6Y A;  4MFE A;  1XGO A;  2XF7 A;  4NC8 A;  4A3I J;  1VQP I;  5DUK A;  2Y9Z A;  2WC2 A;  1GXQ A;  1GVJ A;  1QNT A;  2E36 A;  3O8H A;  1XMX A;  1EJ9 A;  4HAM A;  4Y15 A;  4EM1 A;  2VON A;  4L5J A;  1SD5 A;  2WB1 N;  4I76 A;  2H6C A;  3GZN B;  3AG2 H;  4BE2 A;  2WAQ N;  3F8C A;  4E7J A;  1YJN I;  4RGX A;  4A69 C;  3GVA A;  4IRG A;  2DN0 A;  3S15 J;  3H1C A;  2LH9 A;  1SD6 A;  2EJR A;  5F04 A;  2IW5 A;  5GAD J;  5B1A H;  5ED4 A;  3OR1 C;  3PNV A;  5J4V A;  5GP9 A;  4B4C A;  1FWZ A;  4XN0 A;  1K4T A;  2C6Y A;  5EEA A;  5L3D A;  2X1D A;  1R5H A;  1UJ8 A;  2X51 A;  4FX0 A;  3OYL A;  4PJN A;  5F1J A;  1XCV A;  3S14 J;  2HOA A;  3GFL A;  3OYM A;  4EGY A;  1MSF C;  1MIJ A;  3VFZ A;  1W5T A;  2IXS A;  3RPQ A;  2H8W A;  2JTV A;  4BQO A;  2LK2 A;  1OMI A;  5HDK A;  4IHT A;  5IYC J;  4XIC A;  2AS5 F;  1WI9 A;  1GDT A;  2JA5 J;  1Z6T A;  2IBD A;  4A6E A;  4FCY A;  2LFB A;  1V55 H;  1ITY A;  3RKW A;  4PJ0 C;  4AWX B;  3IRR A;  4Z6Y A;  2VKH A;  2BE5 F;  4B09 A;  3QP5 A;  4RAY A;  4YEL A;  4ZC3 A;  4CA0 A;  3E6B A;  2A05 A;  1YG2 A;  2YU3 A;  5C3E J;  1REP C;  2IS2 A;  4UUV A;  3P9K A;  4IHY A;  3HYI A;  2EA2 A;  1AA7 A;  4KIB A;  1J5Y A;  5F0H A;  1D0X A;  2F4O B;  4MFD A;  4X0G A;  1GUU A;  1RR7 A;  4XID A;  2ZSI B;  3CF5 F;  2UZK A;  5CVJ A;  2HU9 A;  4S05 A;  3S1R J;  3PM1 A;  1GV5 A;  3S1N J;  3CCU I;  1KU3 A;  2IAI A;  5LBQ A;  3LOC A;  2COM A;  4MEY F;  2DO7 A;  3KP3 A;  3OYH A;  2UWM A;  1D8J A;  3JRC A;  2BW3 B;  2CMP A;  2L01 A;  4HG2 A;  4B43 A;  3M9A A;  1HLV A;  1USS A;  4FT8 A;  1FTT A;  3RQI A;  4LJZ F;  3F0C A;  2WY7 Q;  4UUT A;  5BPD A;  4XLC A;  3U2R A;  5DS9 A;  4A3M J;  3ZQC A;  1A36 A;  2GA2 A;  4HNV A;  3LST A;  2V9K A;  5EZG A;  1YW7 A;  4OWR B;  4MTE A;  3ZCO A;  4UVA A;  1W36 C;  1SAX A;  1MBH A;  3SZG A;  4P5O A;  2M34 A;  4N0B A;  3OS1 A;  1WH5 A;  5JVG F;  1ZGA A;  3M4O J;  2V6E A;  2CFO A;  2CH0 A;  2LG4 A;  2MG4 A;  3I58 A;  1QZY A;  3LSI A;  4ZH4 F;  1V5F A;  2LMD A;  1U9O A;  4DW6 A;  4QPQ A;  1GLN A;  2E2J J;  3HM5 A;  2VUM J;  2P6S A;  2XKO A;  4CGZ A;  1P4X A;  3H0D A;  1LNW A;  4RB0 A;  3QYB A;  1DQU A;  3VDX A;  4CIC A;  1P7I A;  2OQG A;  4OIO F;  5JI6 A;  3FXK A;  2LR8 A;  2Q2E A;  1G6N A;  5ILS A;  2HQN A;  5KCM A;  3E7L A;  4IHV A;  4FE4 A;  1GVD A;  4BEH B;  5J8C A;  3GTJ J;  3BZC A;  4XOT A;  4A2U A;  2IGN A;  1XG1 A;  1A5J A;  2AXL A;  4FQG A;  4HX8 A;  3WTY C;  1K7A A;  2KFD A;  4Y52 J;  4KIF A;  1KU9 A;  2TCT A;  2STT A;  3ABK H;  2R7Z J;  1OPC A;  3CP2 A;  5B5E C;  5FLM J;  1SFX A;  2LKX A;  1U8B A;  2ACJ A;  4G7Z F;  1E0E A;  3EUH C;  2OAZ A;  2ZC2 A;  5E3M A;  3S8P A;  2I5U A;  3FXL A;  3FKI J;  3K4L A;  3DBH B;  5LHI A;  2M8G X;  2IP2 A;  3QYF A;  3QRF F;  2A5W A;  2H1K A;  4HA8 A;  1B4A A;  1VQN I;  1G8X A;  2UXX A;  1TT0 A;  4HST A;  3OOU A;  2WAE A;  5TGT A;  3RYP A;  1T95 A;  2B7E A;  2ZSH B;  1I50 J;  3A03 A;  2DA4 A;  2WBM A;  2FQ4 A;  1MSE C;  3MEX A;  1P9Q C;  3EYI A;  2VN2 A;  5EYR A;  3H92 A;  3LAP A;  5DYM A;  4CSW A;  1MNE A;  2YS9 A;  3AG3 H;  4DJA A;  2VI6 A;  3MZH A;  3N97 A;  1O3S A;  4A3L J;  2M30 A;  5IP9 J;  1X58 A;  2HTS A;  4A0Z A;  4C3H J;  3VB2 A;  3I9V 2;  4U7B A;  1RKW A;  4C9Y A;  1HXD A;  3HOV J;  3BR1 A;  3CJQ B;  2MLG A;  3ABM H;  3HRM A;  5B1B H;  4O5V A;  5BQT A;  2FOK A;  2H27 A;  4Q5S F;  2EK5 A;  1DUX C;  3O2P E;  2L9R A;  3KCC A;  2EQR A;  1IN4 A;  3HKZ N;  2HQA A;  2X4H A;  2ZME B;  1W7P B;  2NS0 A;  4ITV A;  3HOX J;  4Y3O A;  1ZGW A;  3DEE A;  1NHA A;  2RDP A;  5BNG A;  4G6T B;  3U9G A;  5HNH A;  1XN7 A;  3NAR A;  2WV1 A;  3GTQ J;  2XF5 A;  2BYV E;  4ZYE A;  2ZNY A;  2LYC A;  2Y0M A;  4E6K G;  1RI7 A;  4MNU A;  1Z3Y A;  4BBR J;  3K9T A;  1E3H A;  3BR6 A;  4L5E A;  2KIS A;  2RKH A;  3GTK J;  2OUM A;  2D1V A;  1XGM A;  4IXA A;  1MBJ A;  3OY9 A;  4MEX F;  4L0Y B;  1DGW Y;  1U2W A;  3HTU A;  1S7A A;  2EPF A;  3WTV C;  1N78 A;  2BY1 A;  2Y0S A;  1I3Q J;  4IHX A;  3A2K A;  1AU7 A;  3E6C C;  5LHG A;  3A01 A;  1ZKG A;  1WQ2 A;  2H1L A;  3GLL A;  5HOO A;  2XDV A;  2EBI A;  1IDZ A;  5HDG A;  2BY2 A;  3OYF A;  2GA1 A;  3DFG A;  4B44 A;  3OS2 A;  1Z67 A;  2ZME C;  3CME I;  2NOJ B;  2VOO A;  5EEG A;  4EQQ A;  1ETY A;  5FKL A;  3GW2 A;  2M9H A;  1OR7 A;  3F72 A;  2H8R A;  2ESH A;  4XKW A;  2UXN A;  1MMN A;  4E7S A;  2F6C A;  2ISY A;  1S5L C;  4IEJ A;  3V7C A;  1IG7 A;  4FX4 A;  5DTD A;  3G1L A;  2NNY A;  1XGS A;  2Y69 H;  1K78 A;  4BDY A;  2E1N A;  4BNC A;  2G9W A;  5H6R A;  5F08 A;  3X2Q H;  2WTE A;  3J81 K;  3VEP A;  4V2F A;  2L9V A;  1XC5 A;  5EJC A;  3O8G A;  4LLL A;  3ERE D;  2E1C A;  3SZP A;  1TLH B;  2NVY J;  2DOF A;  1S7O A;  2VKV A;  5JVT A;  3COA C;  3V8L A;  4NQW A;  4DGW B;  1XGN A;  4UVB A;  3RDI A;  3OR2 C;  1N77 A;  3W2W A;  3KEY A;  5HLT A;  5IP6 A;  4AIJ A;  1YRN A;  1V4R A;  3Q9V A;  1OCT C;  1Z6R A;  5D5U B;  3D1N I;  4GCV A;  4DNC A;  4DBR A;  3WG9 A;  5JHF A;  3JSP A;  2DT6 A;  2GIZ A;  2HGC A;  4G12 A;  5IP7 J;  1ETQ A;  2WWY A;  1SFO J;  3QU6 A;  4BXU A;  2IJL A;  1HF0 A;  2PMH A;  2BHZ A;  2VQL A;  2XB0 X;  5EG0 B;  1UST A;  3IAM 2;  2W84 A;  1OCC H;  1YHQ I;  3BZ6 A;  2PBI A;  2DMN A;  4NC6 A;  3KFW X;  4P96 A;  2JA2 A;  3HOY J;  1Z9C A;  4IJA A;  2V9V A;  5CJ9 A;  3G71 I;  2ECB A;  2CV2 A;  2LY1 A;  3QYE A;  3V42 A;  1I1G A;  2X85 A;  1RPW A;  1Z77 A;  3WE3 A;  3GYH X;  4UB6 C;  3D0S A;  2K27 A;  5ILV A;  3CO6 C;  1EH6 A;  4HZF A;  1SMY F;  4M6X A;  1X19 A;  1AKH A;  5C4J J;  2CWE A;  1HC8 A;  4M3D A;  1R4M B;  1RES A;  1T8I A;  3W6V A;  2QQ9 A;  2TRT A;  2M5W A;  3Q0U A;  4XSZ F;  3E5Q A;  4PSW A;  1VTN C;  2DPU A;  2DTR A;  4OOI A;  4E7Z A;  2DI3 A;  5ICF A;  4HV6 A;  4A0X A;  4UXN A;  1YW9 A;  2XPV A;  4PFP A;  1HBX G;  3KET A;  1YIO A;  4ZYH A;  2ICW G;  4LGW A;  4CCL A;  3JRA A;  4KJZ A;  2N8G A;  2DW4 A;  1HST A;  2IEK A;  4II2 A;  3O6B B;  2EV5 A;  5CKT A;  1JGG A;  2HOS A;  2PQ8 A;  1MH4 A;  4A93 J;  2RN7 A;  1FSE A;  1X2N A;  4OU0 A;  1VFC A;  1JT6 A;  1G4D A;  2QUF A;  3OIO A;  1YJ9 I;  1W5S A;  2NOG A;  2K4J A;  2OA4 A;  3ESW B;  3ZN0 A;  2VQC A;  3RTR A;  2LSO A;  1R23 A;  2MYS A;  4CYC A;  1X4O A;  4KIG A;  1WJ5 A;  2P4W A;  1Z7L A;  1JUM A;  1SD7 A;  5CVU A;  3GO5 A;  2DXI A;  3CCE I;  2YX7 A;  3I4P A;  2JVG A;  3J7Y J;  1I5Z A;  4I98 B;  2R3S A;  2ID6 A;  2DLL A;  2RGV A;  3HUG A;  5HLH A;  4LIU A;  4IRH A;  3L00 A;  3O3K A;  5IYB J;  2ZJQ F;  4CXF A;  4E7K A;  3S1Q J;  5LLQ A;  1UMQ A;  4ZDP A;  3KYC B;  2R5Y B;  1NG6 A;  2VBZ A;  2JRT A;  1F36 A;  3QP6 A;  1BN5 A;  2GWR A;  4LG0 A;  3S3N A;  2Y75 A;  2BV6 A;  2LNB A;  3K6G A;  3REO A;  2HPI A;  2AO9 A;  2OZ6 A;  4PGG A;  3ZN1 A;  3F8F A;  1IRZ A;  3ZQG A;  2KT0 A;  2VL8 A;  1JI8 A;  3CCL I;  2CFX A;  2XGX A;  2O5R A;  4GGG A;  2J5P A;  2YUS A;  1H89 C;  3CMY A;  2EIM H;  3K2Z A;  1HSJ A;  5FFZ A;  1G3T A;  4P1W A;  4EM0 B;  1MMD A;  3QOE A;  3F23 A;  2FBK A;  1YX5 A;  3HJE A;  4BY1 J;  3S32 A;  2KHM A;  3HOW J;  3MZ8 A;  2HQR A;  3TOB A;  2IRF G;  1IN8 A;  2LBF B;  3CUO A;  3BZK A;  5FKM A;  4ASN A;  4G6D A;  1ZLJ A;  1UFM A;  3S1M J;  1IW7 F;  4PJM A;  2DA2 A;  4NC7 A;  2YSR A;  4GFB A;  2X0L A;  1JE8 A;  2HKX A;  5TJJ A;  3OIQ A;  4C3I J;  3IRQ A;  4HLX A;  2HOT A;  2W82 A;  1LE8 B;  2Q8K A;  2DK8 A;  2JA7 J;  5DD8 A;  1R1V A;  3KYL A;  5FJ8 J;  3L1P A;  4HSR A;  1LPQ A;  4AIK A;  1P2F A;  5ERI A;  2MLK A;  3ISP A;  1YIJ I;  1P6R A;  3DU6 A;  1N75 A;  2EIL H;  4N4N B;  4QWQ A;  2FNA A;  2P0W A;  3FBI B;  4BQA A;  1BA5 A;  4XN3 A;  1ETO A;  4ZTJ A;  4O3M A;  3Q0V A;  3K4M A;  3HOS A;  1TWH J;  2K85 A;  2HYJ A;  3CC7 I;  2AHQ A;  3CJT B;  2G0E A;  2EZL A;  2JK3 A;  3BG5 A;  1AWC A;  1QA6 A;  1STZ A;  2W4S A;  1Q1V A;  4CCK A;  3ABT A;  1KON A;  4PGH A;  4HDU A;  1TQI A;  1Y6I A;  4L0Z B;  5FLX Z;  4E7H A;  3RIR A;  3WTT C;  1BI3 A;  3K10 A;  2PG4 A;  2OQR A;  4BJT A;  4UV9 A;  4KUM A;  4A3D J;  1YJW I;  5F27 A;  1W1W E;  3R4K A;  1Y1W J;  1OJL A;  2NNN A;  4U0Y A;  1JUS A;  3TGN A;  4BGD A;  4J01 A;  2ZXW H;  2EIN H;  2BY3 A;  2P5K A;  1I3A A;  3DPL C;  2KIF A;  1QPM A;  4KT6 A;  4EVI A;  4B3A A;  2A5Y B;  4XOP A;  1LKX A;  4P9U A;  3WTZ A;  4M9X A;  2DMQ A;  3W3C A;  1B59 A;  5E8I A;  4Q48 A;  3OYI A;  1D0Z A;  2ECC A;  5FB2 A;  1JKO C;  3GTO J;  2DU9 A;  3RPU A;  1IRX A;  2DFH A;  3OSG A;  3FXR A;  1APL C;  4XMY A;  3PL8 A;  3ZQL A;  3M3Y J;  5HNF A;  3K4J A;  5FFX A;  1W0U A;  3BTC A;  1XTA A;  4B3X A;  3OYD A;  1YS7 A;  2FA5 A;  2FBH A;  2ZJ2 A;  2B0L A;  2LD5 A;  3UR3 C;  2JA6 J;  2A07 F;  3ZPL A;  4EJU A;  4GXO A;  3M8F A;  4BE0 A;  3U21 A;  2FUG 2;  2JWT A;  2JN6 A;  3Q5F A;  1FPQ A;  3IH4 A;  3K0L A;  2ZCW A;  3KX2 A;  1IXS B;  3QU3 A;  1BIB A;  1OYY A;  2UUZ A;  4EGZ A;  4G9Y A;  3F9K A;  5IOY A;  3FK6 A;  4KMU X;  3TO9 A;  3RKY A;  2F48 A;  4I0B A;  2KIU A;  3H3V K;  3DEW A;  2HZT A;  4GO1 A;  1W7P D;  3K4K A;  3BJO A;  2XSJ C;  3L2U A;  1F43 A;  4U87 A;  2BW3 A;  2LVS A;  2IA0 A;  2NYX A;  3J81 Z;  1QBJ A;  1LB2 A;  2Y48 A;  3AFH A;  2L7Z A;  1L3L A;  1BBY A;  2QGU A;  2MH2 A;  1J9I A;  5AON A;  4JX4 A;  2VXZ A;  5DM7 F;  1RR8 C;  1UG2 A;  2M4G A;  1H0M A;  4BS9 A;  2MSY A;  1IDY A;  2QF7 A;  3ZQQ A;  4L9J A;  2NS7 A;  3OMY A;  2E1M B;  3M1E A;  5KNL A;  3I4N J;  1Z3X A;  4V19 K;  3QPL A;  3KP7 A;  3MQ0 A;  3WU2 C;  1ZR2 A;  2H94 A;  2OZU A;  4BY7 J;  2W85 A;  3F22 A;  1ULY A;  3AG4 H;  1YX3 A;  2Z99 A;  1IV8 A;  3EUH A;  2G7U A;  1MJA A;  2F2E A;  4U88 A;  5LGN A;  4KIT B;  1SVM A;  3HKZ A;  4JQF A;  2Y31 A;  1CQT A;  2QQ8 A;  3J80 K;  1T6S A;  1Z91 A;  1JT0 A;  1G2H A;  1ZHF A;  3DPT A;  1R5G A;  2YPR A;  3BCB A;  4HF1 A;  4KDP A;  4BJ6 C;  2AQF A;  2VPL A;  1R5I D;  2KRC A;  1UG0 A;  3LA2 A;  4Z2Y A;  2IGK A;  3ZR8 X;  2ZNZ A;  4OMZ A;  4CZZ A;  3G6E I;  1V54 H;  2CUJ A;  5A2Q Z;  1WH7 A;  3PNT A;  4HBL A;  1JUP A;  1ON2 A;  2NRA C;  3FF5 A;  2QYO A;  4BEH A;  3L09 A;  2XAJ A;  3CLQ A;  2A6E F;  3NRV A;  3ABU A;  3F8B A;  1Z21 A;  3SQN A;  4ON0 A;  3LQR A;  4U0W A;  3CCM I;  1I6X A;  3DQV C;  4IHW A;  5CYV A;  2R7R A;  2CUF A;  1NK3 P;  1FOK A;  4DZJ A;  1NH3 A;  1X2M A;  2DA7 A;  1X1C A;  2PLY A;  1XD7 A;  3OYK A;  2FRH A;  2DFF A;  4YG2 F;  3HSE A;  2JSC A;  1VI0 A;  2JA8 J;  5HLI A;  4PK4 A;  3RZD J;  4XOR A;  4W1U A;  2M45 A;  2DFI A;  1FNN A;  1FOX A;  1T2K A;  1S8N A;  2LLK A;  3PQK A;  1IUF A;  5D8L B;  1DGR M;  2Z1D A;  3F6V A;  1XDU A;  2LC2 A;  3CDL A;  1HCR A;  2KIQ A;  2F5D A;  4RM2 A;  1MMG A;  5CPR B;  2P7V B;  1R58 A;  3ML6 A;  4NBQ A;  1XDS A;  4A3F J;  2Z3Y A;  3KE2 A;  3VSK A;  1PUF A;  3A0B C;  3CZ6 A;  5KVR A;  3CES A;  1A04 A;  4EJO A;  5GTI C;  3HBL A;  3OV8 A;  4K2E A;  2K86 A;  1Z05 A;  1FY7 A;  2JQ7 A;  1VF9 A;  3BWG A;  1D1B A;  2E7X A;  2KRH A;  4L9N A;  5GPA A;  5F1R A;  5D6F A;  3FM3 A;  3KP2 A;  2R4G A;  1OKR A;  5GAG J;  4C30 A;  1FZP B;  1WJA A;  4I01 A;  1B72 B;  2ZME A;  1ZGJ A;  3FXQ A;  1W7P A;  3V8K A;  4AU7 A;  5D6E A;  2E7W A;  4XKB A;  2DOE A;  3BJ6 A;  1HDP A;  2XPW A;  1HA8 A;  2QKL B;  5E3N A;  4MO7 A;  3BR2 A;  2JRM A;  3E6D A;  4JP0 A;  4FTH A;  2EIK H;  1EKE A;  4UVC A;  2DMP A;  1PDN C;  2XPU A;  2DBB A;  3D5R C;  4A3K J;  3BTL A;  1X1A A;  3CUQ B;  1PYV A;  5BOX A;  2D45 A;  1R1T A;  3CF2 A;  3T5X A;  1JJ8 C;  1Y39 A;  1P4A A;  1UZC A;  1BM9 A;  5LGU A;  2W00 A;  3D5S C;  2O61 A;  2BZT A;  1XMK A;  1VQ4 I;  2X6W A;  4D7M A;  3BPX A;  3RQ4 A;  5D4R A;  3RKQ A;  1VQK I;  4XLA A;  2IS6 A;  2O7O A;  4KFC A;  1MBG A;  3IP4 B;  4M3F A;  3JTG A;  1XPX A;  5HS8 A;  4PFO A;  5FGM A;  1O7L A;  1WJC A;  1SFU A;  3LSK A;  1WRJ A;  4RLQ A;  2LRE A;  1YW8 A;  1BOB A;  4N4O B;  2QSH X;  4JX5 A;  2CW8 A;  2FF4 A;  3V4G A;  4U0V A;  4B8X A;  3WE2 A;  4IHS A;  3BLY A;  5FRN A;  5H2F C;  4ABZ A;  3JRG A;  3OYE A;  1E17 A;  3TO7 A;  2P5V A;  3FXM A;  1MMA A;  2QVO A;  2HZD A;  2GXG A;  4Q4Z F;  4XR6 A;  4AIH A;  2QEN A;  4Q47 A;  3OYG A;  5DM6 F;  1OIS A;  1FYM A;  2O8K A;  3L2R A;  4OIR F;  4RAZ A;  2VLA A;  1KU7 A;  1DP3 A;  4M71 A;  4XM3 A;  2ID3 A;  2F4M B;  1ETK A;  3K4N A;  3KLO A;  1W4M A;  4C3J J;  5L3E A;  1C0W A;  1YE9 A;  3VYR B;  4D7N A;  1DU6 A;  4O6J A;  2GXA A;  5LEJ A;  3BG3 A;  2R5Z A;  4CCO A;  3FMQ A;  3Q9S A;  3DKY A;  4ZZL A;  4DQ2 A;  4A6D A;  3TP0 A;  1MKM A;  1GV2 A;  1QQI A;  2CJJ A;  2XGE A;  1S6L A;  1J7K A;  4RB3 C;  2CQ7 A;  1NK2 P;  3HG9 A;  3R60 A;  1FT9 A;  3GFI A;  1QRY A;  4JBA A;  4AD9 A;  2H6B A;  2HVS A;  5CLS A;  4LOC A;  2DT5 A;  4HRI A;  2KZG A;  1X1P A;  2EZK A;  4F93 B;  1WHU A;  3JW4 A;  2DFE A;  1FYL A;  1VQM I;  2VQG A;  2WAF A;  5J47 A;  4L18 B;  1T56 A;  1WGX A;  4KIC A;  5EG0 A;  3S16 J;  2DJI A;  4AVZ A;  4ZYA A;  4Y13 A;  2EFW A;  1XSV A;  2R7U A;  3C7J A;  3ZMS A;  1JKP C;  2BBY A;  3MD2 A;  1IC8 A;  3I54 A;  5FLX K;  1JJ6 C;  3C3W A;  1J2X A;  4HF2 A;  2Y2Z A;  5L3C A;  3ZMZ A;  4IX7 A;  4RLF A;  1Y0U A;  1Z1D A;  2CQN A;  3SDG A;  2E71 A;  2A6T A;  2JPB A;  3G2B A;  3W2A A;  1B6A A;  3C2B A;  3BG7 A;  3QQA A;  2E5Z A;  2DA1 A;  1VQL I;  4QSH A;  3L9F A;  5DCM A;  1SEU A;  5H20 A;  2RRE A;  3BPV A;  2FQ3 A;  3U1K A;  3ZXS A;  3PIP F;  4IQJ A;  1ODD A;  2ME0 A;  2FEZ A;  3EET A;  3GXO A;  2R0Q C;  3P9I A;  2L9S A;  2BXY A;  4PJJ A;  1QGP A;  1SFK A;  2CW7 A;  1YO5 C;  1E2X A;  1FMW A;  3OS0 A;  3G1O A;  3HRT A;  3E5U A;  3HGY A;  2LF7 A;  1DPU A;  2Z16 A;  2HNH A;  3H0G J;  2KZV A;  5D5V B;  1X1D A;  4KA4 A;  1ZG5 A;  1PP8 F;  1KZH A;  2WA0 A;  2E5N A;  3U1D A;  4HNT A;  3VSL A;  2XUB A;  1TW3 A;  1N25 A;  4RGU A;  3I59 A;  3V8J A;  1EV7 A;  1HQC A;  2EFN A;  2HDW A;  4M9Z A;  2L7M P;  3OYJ A;  3M8E A;  2EV0 A;  1FJL A;  4RA2 A;  4R8H A;  2VE8 A;  3FZV A;  4L5I A;  1KYW A;  4M72 A;  5EEH A;  2ELH A;  3OL4 A;  5K5Q A;  2CV1 A;  3IKT A;  2DQR A;  1VND A;  4FHT A;  3IKV A;  3J80 Z;  1HW1 A;  3DEU A;  1MD0 A;  2JVH A;  1W0T A;  1ZTR A;  2BVL A;  5FKK A;  1X3Z B;  5J1R A;  4S04 A;  1OCP A;  1S72 I;  2EFQ A;  1MW7 A;  3NWT A;  1T08 B;  3E1S A;  4BHB A;  3PJR A;  2OTJ I;  3FM5 A;  2DA3 A;  4FET A;  3LSM A;  3OL3 A;  3RKX A;  3M8J A;  2AXT C;  1MZB A;  1QHH D;  2K3P A;  4F92 B;  3GZ5 A;  3IC7 A;  3ZRG A;  2EIJ H;  3ULQ B;  3SEZ A;  2HWV A;  4IO9 F;  3ONQ A;  4A3B J;  2MH9 A;  3FIW A;  3K1M A;  5IT3 A;  4LB6 B;  5BMZ A;  3LQQ A;  4FAS D;  1HW5 A;  3I3L A;  1YYV A;  3S3O A;  4OIQ F;  4MQ9 F;  2QBY B;  2HPM A;  3A0H C;  3WGI A;  4ZYD A;  2RV8 A;  4XLF A;  4KN7 X;  4UUS B;  1T39 A;  1VQ7 I;  5J4Y A;  1V3F A;  1LDD A;  2W24 A;  4PDK A;  4AID A;  5DCF A;  1XS9 A;  4C2U A;  4B47 A;  1O3T A;  2MD0 A;  1IN5 A;  2A3S A;  5A2Q K;  3J7A Y;  3LFK A;  1TWF J;  3WTS C;  4L9V A;  3FKJ A;  3LSP A;  3S2H J;  4UV8 A;  2LKP A;  4HX4 A;  3I0T A;  3HB9 A;  4BH9 A;  3L2V A;  2XAU A;  4G6Q A;  2ELK A;  1SMT A;  5GAE J;  4A12 A;  2O8X A;  3BTI A;  1RKT A;  3DBR B;  1KQ9 A;  3DPU A;  4M6V A;  5EGO B;  4IQ4 A;  3MN2 A;  2L2O A;  3MFK A;  5HS7 A;  4XLE A;  1EH8 A;  2MA3 A;  2RC4 A;  4WF2 A;  3PQJ A;  2V26 A;  2DDA A;  2CG4 A;  4E70 A;  2P8T A;  4C2M J;  4G7O F;  3GWZ A;  1CF7 A;  4XQF A;  1U78 A;  1EF4 A;  3KZZ A;  3DTE A;  5HOD A;  1FP1 D;  1SVL A;  1D1A A;  2VJJ A;  4B48 A;  2HFH A;  4WX9 A;  2O3F A;  3MMY B;  2HXI A;  1WJE A;  2P5L C;  2STW A;  3WHC A;  5JFR A;  3K2A A;  2GXB A;  5DD4 A;  2X48 A;  2JUC A;  1WSU A;  1Z0X A;  4ZYG A;  4PCQ A;  1Z7U A;  1MBK A;  3G1M A;  4JK1 X;  1PVE A;  5IT9 K;  1D5Y A;  4PJL A;  5DV5 A;  1KYZ A;  1IRF A;  2W25 A;  3CQZ J;  3N05 A;  3HL2 A;  2DMU A;  2R93 J;  2M3A A;  2DMT A;  1PP7 U;  1ACI A;  3T0Y A;  1JTY A;  1LQ1 A;  3ZMV A;  2XGC A;  4ETS A;  2NAZ A;  5FKN A;  3I55 I;  1RIO H;  3VWB A;  2CQQ A;  2LY9 A;  3CMM A;  3LSR A;  3GTP J;  3KEQ A;  2XB5 A;  5HVQ C;  1XCB A;  4IL6 C;  1VQ6 I;  1A6Q A;  2F5E A;  2FD5 A;  1SD4 A;  2OD5 A;  4MHG A;  3SDB A;  2E2H J;  3WTW C;  2MC3 A;  3W6J B;  1R4N B;  2W57 A;  2V7F A;  1JKQ C;  3B6C A;  3VOE A;  4BAC A;  2DK5 A;  4HQM A;  3E97 A;  3IV5 A;  1QVU A;  2VE9 A;  2ZXH A;  3CO7 C;  4DYR A;  4XRF A;  2GBY A;  4QPO A;  4BJ5 C;  1LEB A;  1B9M A;  4EJW A;  4XLH A;  1MDM A;  4ESB A;  1IJW C;  1D5V A;  2B63 J;  1MMS A;  5DUI A;  2HI3 A;  1XSD A;  1MBF A;  5CVV A;  2R7V A;  1ZYR F;  2LP0 A;  4D1Q A;  1WVR A;  2RQQ A;  1HDD C;  3AKZ A;  3LL7 A;  2ME6 A;  5IPA A;  2Z9O A;  2YU9 J;  4IKF A;  2GIV A;  4F52 A;  1R1U A;  1DDN A;  4NQW B;  4I0A A;  2XAH A;  2XAG A;  4RGR A;  2HVR A;  3CTA A;  2K40 A;  1ZLK A;  1RC9 A;  3DWL E;  2QSG X;  5E1Z B;  2HTJ A;  3BTJ A;  2HDD A;  3GZ6 A;  2X1E A;  2JUG A;  2FX0 A;  3RSN A;  1OFC X;  3TED A;  2FOW A;  3R0A A;  5K7Z A;  1ZG1 A;  3SFZ A;  4R1H A;  3PUB A;  2KJC A;  3MVP A;  1E3P A;  3F3X A;  1VQO I;  1S7E A;  3AAF A;  2ZB9 A;  4RMN A;  3QPH A;  1K83 J;  3PIO F;  1HW2 A;  3H3U A;  1Y1V J;  3CD6 I;  5GTH C;  2KDZ A;  1BR1 A;  4IOC F;  2FE3 A;  1IF1 A;  2A69 F;  4WXH A;  5TIS C;  2IT0 A;  5CVI A;  3HRU A;  1U6G A;  2VBX A;  4BAY A;  3G3Z A;  3A02 A;  1POG A;  4IOA F;  3IUO A;  4BBS J;  4BXX J;  1I39 A;  2Z33 A;  1WJB A;  2EZI A;  2VOD A;  2V79 A;  1P4W A;  4RAG A;  3ZQH A;  4ENM A;  4BL0 B;  2HKO A;  3IWF A;  3PUF A;  4XKC A;  4HX7 A;  3CJN A;  2VT3 A;  1LJ9 A;  4XLP F;  1BW5 A;  3J7A O;  2QSF X;  1ZRD A;  3PO3 J;  2W7N A;  2F5V A;  4M3B A;  2HYG D;  2D2W A;  2K9Q A;  4LK1 F;  5J3L A;  2RVC A;  4D0P A;  3PSI A;  5K5R A;  1XSX A;  2CSO A;  3QOP A;  5E3O A;  3JRH A;  2JMW A;  4YFN F;  1H9G A;  1IZ1 A;  2K9N A;  1TP4 A;  3HTS B;  3E5X A;  1F4K A;  2IA1 A;  1IGN A;  4BDZ A;  2K5C A;  1T0F C;  3MAJ A;  3P7N A;  5DDG A;  1YTY A;  1JHF A;  1UHW A;  2EA4 A;  5IY5 H;  3WTX C;  4NNJ A;  4E7I A;  1BI1 A;  1A35 A;  9ANT A;  3HEF A;  2L7K A;  1MJ9 A;  3PNY A;  2PX9 A;  5M3M J;  4KYW A;  3P5J A;  1H88 C;  2ESN A;  2EFO A;  2KKO A;  4QIW N;  1DP7 P;  2BVM A;  2QWW A;  2X6O A;  3LFU A;  3MKL A;  4NHJ A;  1HKT A;  2IGM A;  4KIS A;  4A3C J;  1JTX A;  4CYC B;  2VBW A;  4A3E J;  2Q0O A;  3P9C A;  2MAB A;  3CP8 A;  1J75 A;  2NVQ J;  2IA2 A;  2VB6 A;  1KA8 A;  1O57 A;  3C1D A;  3IWZ A;  3E0J B;  4HF0 A;  3TDZ C;  1K61 A;  2FSW A;  1CGP A;  1Q1H A;  3ZQI A;  1Y56 A;  2O6G E;  1ZEL A;  3IAS 2;  1VQ5 I;  4AM3 A;  2K9S A;  1FSH A;  3HHG A;  3H5R A;  4LG0 B;  4QLC U;  1ZRE A;  5E79 C;  1SAN A;  2ZBK A;  2JT1 A;  3KZI C;  1DU0 A;  3DKX A;  3ECO A;  1SC7 A;  3JTH A;  3M1C A;  3A1Y A;  1YLF A;  5LFA A;  3GEZ A;  3RZO J;  3SZT A;  3H5N A;  3HPG A;  2XC7 A;  3FX3 A;  1ZN2 A;  1EH7 A;  2ETH A;  2DCE A;  4LIT A;  4LIV A;  4LK0 F;  2QEX I;  1B72 A;  1OQY A;  3AG1 H;  2WY8 Q;  1R49 A;  2QKM B;  4F91 B; 
#chains in the Genus database with same CATH homology
 4XLA A;  2IS6 A;  3FHN A;  2CV0 A;  1W36 D;  3EUK L;  4XKW A;  1MMN A;  4E7S A;  3IP4 B;  2F6C A;  3HC7 A;  3UNG C;  4PFO A;  1WJC A;  3LSK A;  4RLQ A;  4BDY A;  2LRE A;  1BOB A;  4N4O B;  4CUG A;  3OYC A;  2CW8 A;  2W1O A;  2KMU A;  2KQR A;  4MLO A;  3BLY A;  4CH7 A;  3LMM A;  5FRN A;  3OIP A;  3OYE A;  1OR7 C;  3SEQ A;  2HVQ A;  2LOO A;  1MMA A;  4ZTF A;  2HZD A;  4XR6 A;  4HPQ A;  3OYG A;  3DTI A;  3OYB A;  3H35 A;  4DGW B;  3L2R A;  3CJR B;  3OR2 C;  3OYN A;  2VLA A;  4XM3 A;  3W2W A;  1N77 A;  3KEY A;  1DP3 A;  5HLT A;  3VYS B;  3K4N A;  1YE9 A;  3VYR B;  4DBR A;  5JHF A;  2DT6 A;  4BQN A;  4CCO A;  3W2A A;  2R7T A;  2K9L A;  1U0J A;  1EA3 A;  2VQL A;  3DKY A;  2E1M C;  3IAM 2;  3A4C A;  1MND A;  2JA2 A;  3H9Q A;  1NG7 A;  4D9J A;  3K4C A;  3HG9 A;  3OWT A;  2HVS A;  4YEJ A;  5FRM A;  2KL4 A;  4HRI A;  2CV2 A;  4F93 B;  2LY1 A;  1WJF A;  3QYE A;  3V42 A;  4CCN A;  2X85 A;  2GOM A;  2PJR B;  2VQG A;  2VJI A;  2WAF A;  2CS3 A;  4AYB A;  1VZ0 A;  1S9H A;  2R7O A;  3DU5 A;  3DLA A;  1X19 A;  2DJI A;  4AVZ A;  4ZYA A;  1D0Y A;  2R7U A;  4F55 A;  3MD2 A;  4H4K C;  3S93 A;  3L2W A;  1J09 A;  4PSW A;  4E7Z A;  4IX7 A;  4RLF A;  3H5A A;  4PFP A;  3G2B A;  2A6T A;  2PJR A;  1OLT A;  4CCL A;  4KJZ A;  2M7A A;  3BG7 A;  2IS4 A;  1LDK B;  1V5G A;  2E5Z A;  3FBN B;  3K70 D;  4II2 A;  4XON A;  4CCJ A;  3D5L A;  2Q1Z B;  1SAU A;  4XL9 A;  5CKT A;  2RRE A;  1BR2 A;  4ZJZ A;  4Y4R A;  4DBQ A;  3HUG B;  3ZXS A;  1LFP A;  1D1C A;  4IQJ A;  1TZL A;  2AQE A;  3BC8 A;  2IGO A;  3QOD A;  3H9J A;  4XNF A;  2VQC A;  2VKD A;  3RTR A;  2L9S A;  4PJJ A;  2MYS A;  1X4O A;  1SFK A;  2CW7 A;  1WJ5 A;  4HNU A;  1FMW A;  3OS0 A;  4II3 A;  1Z7L A;  4J00 A;  2M0M A;  1K6Y A;  2DXI A;  3BG6 A;  4JOM A;  2Z16 A;  2HNH A;  3TBI A;  2JVG A;  2KZV A;  5LD2 C;  1X1D A;  3HXL A;  2WA0 A;  2E5N A;  4HNT A;  3C2H A;  3VSL A;  2DT7 B;  1BR4 A;  3W2V A;  2R7S A;  1X4P A;  4LIU A;  2KLO A;  3VYT B;  2HDW A;  3S3M A;  4NUB A;  3OYJ A;  4E7K A;  5FRO A;  2MC4 A;  2JSP A;  3TMO A;  4ZDP A;  2ZXI A;  1NG6 A;  1WJD A;  4CCM A;  4BXF A;  3S3N A;  1V5E A;  3OL4 A;  3K6G A;  2CV1 A;  3MKW B;  2HPI A;  2RNG A;  3K4B A;  2VL8 A;  2M7B A;  1JI8 A;  1QHG A;  4ANJ A;  2JVH A;  2O5R A;  2BVL A;  1LVK A;  2X6Y A;  4P1W A;  2XF7 A;  4NC8 A;  1MW7 A;  3NWT A;  2LRD A;  3E1S A;  4BU2 A;  1MMD A;  3QOE A;  2KPM A;  3PJR A;  1YX5 A;  3S32 A;  2KHM A;  4FET A;  5CQE A;  3LSM A;  3OL3 A;  4DIQ A;  2CUZ A;  2LBF B;  3M8J A;  2F4I A;  1WFX A;  1QHH D;  2K3P A;  4F92 B;  3ZRG A;  1UAA A;  2DOA A;  3SEZ A;  2VQH A;  4PJM A;  4E7L A;  1QU3 A;  3ONQ A;  2L9N A;  4BE2 A;  4E7J A;  2IS1 A;  3NWS A;  4FAS D;  4NC7 A;  3I3L A;  3S3O A;  2LH9 A;  3OIQ A;  4CZC A;  2HPM A;  2W82 A;  2KP6 A;  3LSG A;  4DOZ A;  3AL0 B;  3OR1 C;  3PNV A;  4XLF A;  3KYL A;  2ZFU A;  4HSR A;  4XN0 A;  3DU6 A;  4C2U A;  1N75 A;  2X1D A;  4N4N B;  2MD0 A;  4B47 A;  4HEA 2;  2X51 A;  3OYL A;  3J7A Y;  2XF6 A;  4PJN A;  2P0W A;  3FBI B;  4XN3 A;  4ZTJ A;  2VJ4 A;  3FKJ A;  3K4M A;  3HOS A;  3OYM A;  4PSX A;  2L5Q A;  1G59 A;  2I8D A;  3L2V A;  2IXS A;  2XAU A;  4BQO A;  2W4S A;  2R7X A;  4CCK A;  3DPU A;  4IQ4 A;  1KON A;  1Y6I A;  4E7H A;  3MKY B;  2L2O A;  3K10 A;  4BJT A;  4XLE A;  1PJR A;  3ZGK A;  2V26 A;  3PSF A;  4BGD A;  2VKH A;  4J01 A;  2M4K A;  4RM3 A;  4XQF A;  4YEL A;  4ZC3 A;  4CA0 A;  3DPL C;  3DTE A;  2IS2 A;  4KT6 A;  1D1A A;  2VJJ A;  3FDY A;  4B48 A;  3AL0 C;  2VAS A;  1AA7 A;  4XOP A;  3MMY B;  1LKX A;  1WJE A;  1D0X A;  2V4J C;  3W3C A;  2WAD A;  4PUS A;  3K70 C;  3OYI A;  4BUP A;  4X0G A;  1D0Z A;  2ZSI B;  1IRX A;  4PJL A;  3C2G A;  2HU9 A;  3N05 A;  4XMY A;  3PL8 A;  3HL2 A;  4BQQ A;  5HNF A;  2UV1 A;  2M3A A;  3K4J A;  4E4H A;  4B3X A;  3OYD A;  2UWM A;  3OYH A;  4GRI A;  3UR3 C;  2BW3 B;  2CMP A;  4HG2 A;  4B43 A;  3VWB A;  5CQG A;  3CMM A;  3BCA A;  5HVQ C;  4BE0 A;  3U21 A;  3EPZ A;  2FUG 2;  2WY7 Q;  3SDB A;  4XLC A;  3KX2 A;  2V7F A;  5KHD A;  2UUZ A;  4BAC A;  3F9K A;  3GBG A;  2V9K A;  2ZXH A;  2R7Q A;  3ZCO A;  4OWR B;  4QPO A;  4BJ5 C;  1W36 C;  3K4K A;  3L2U A;  2XSJ C;  2K9M A;  2Q2E B;  3SZG A;  4P5O A;  4U87 A;  2BW3 A;  3H9G A;  1X1B A;  4XLH A;  3AFH A;  3OS1 A;  2OC6 A;  2V6E A;  2CFO A;  2CH0 A;  2LG4 A;  2VXZ A;  3LSI A;  4ZDO A;  2R7V A;  2M4G A;  1V5F A;  4BS9 A;  2BOL A;  1GLN A;  4QPQ A;  4D1Q A;  2RQQ A;  1FMV A;  3AKZ A;  3LL7 A;  3ZQQ A;  4IKF A;  3H0D A;  3OMY A;  2E1M B;  4F52 A;  5KNL A;  1Z3X A;  3QYB A;  1DQU A;  3VDX A;  4NQW B;  2HVR A;  1YX3 A;  2KDO A;  4ZDL A;  3DWL E;  5KCM A;  2GOX B;  4KIT B;  3HKZ A;  4BEH B;  4JQF A;  2X1E A;  2JUG A;  4XOT A;  3RSN A;  2IGN A;  3DPT A;  3BCB A;  4BJ6 C;  2AQF A;  2VPL A;  3PUB A;  2KRC A;  3CP2 A;  1UG0 A;  2X1C A;  2IGK A;  4RMN A;  3ZR8 X;  2LBF A;  1E0E A;  2CUJ A;  2VJ5 A;  3EUH C;  3S8P A;  1BR1 A;  3PNT A;  4R79 A;  3K4L A;  3OYA A;  3VYU B;  4C2T A;  3QYF A;  4BEH A;  2A5W A;  2MFZ A;  4XKV A;  3IUO A;  1G8X A;  1Z21 A;  1TT0 A;  4HST A;  1WJB A;  2WAE A;  3OOU A;  5TGT A;  2PMZ A;  3DQV C;  1T95 A;  4YRV A;  2LY2 A;  2R7R A;  2ZSH B;  1X1C A;  4BL0 B;  2WBM A;  4XKC A;  3OYK A;  1P9Q C;  2R7W A;  4CSW A;  2W7N A;  2F5V A;  1MNE A;  4DJA A;  4PK4 A;  3PSI A;  4XOR A;  4U7B A;  3I9V 2;  4OAZ A;  4C9Y A;  3CJQ B;  1DGR M;  2Z1D A;  3MKZ A;  4BDZ A;  2LC2 A;  2K5C A;  4Y33 A;  1T0F C;  2HQA A;  1MMG A;  4RM2 A;  4NNJ A;  5CPR B;  4E7I A;  2L7K A;  4ITV A;  3PNY A;  3VSK A;  4Y3O A;  3CZ6 A;  3SYT A;  1ERD A;  3CES A;  3DEE A;  3DTK A;  2BVM A;  4G6T B;  5HNH A;  3HOT A;  3LFU A;  2IGM A;  2ELJ A;  3RCO A;  4KIS A;  2XF5 A;  4E6K G;  2LYC A;  2V1N A;  2VXD A;  1D1B A;  1R6R A;  2KRH A;  2Z2S B;  1Z3Y A;  3L2Q A;  2R4G A;  2MAB A;  3CP8 A;  4C30 A;  1WJA A;  2WB1 A;  2OUM A;  2VB6 A;  4EAT A;  4AU7 A;  3OY9 A;  3E0J B;  4XKB A;  1DGW Y;  3HPH A;  1Y56 A;  2WAQ A;  3TL4 X;  1ZEL A;  1N78 A;  2Y0S A;  3IAS 2;  3A2K A;  1HA8 A;  3PFY A;  2QKL B;  1UEL B;  4IZZ A;  3H5R A;  5HOO A;  2XDV A;  4F3Q A;  3EUA A;  3DKX A;  3D5R C;  3RPU D;  3LSH A;  3M1C A;  1X1A A;  3A1Y A;  2VIX A;  4B44 A;  2X6X A;  1PYV A;  5LFA A;  3OS2 A;  3OYF A;  2E60 A;  3H5N A;  3CF2 A;  3HPG A;  2NOJ B;  4OAY A;  2XC7 A;  2DCE A;  4LIT A;  4LIV A;  2OV7 A;  4LG3 A;  4BE1 A;  2W00 A;  2WY8 Q;  3D5S C;  2QKM B;  2X6W A;  4F91 B;  3RQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...