3ZR8X

Crystal structure of rxlr effector avr3a11 from phytophthora capsici
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
GPTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords AVR3A11
publication title Structures of Phytophthora Rxlr Effector Proteins: A Conserved But Adaptable Fold Underpins Functional Diversity.
pubmed doi rcsb
source organism Phytophthora capsici
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF16810 RXLR RXLR phytopathogen effector protein, Avirulence activity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zr8X00
2LC2A 3ZGKA 3ZR8X
chains in the Genus database with same CATH superfamily
5GAGJ 2EZHA 2ID3A 1MGTA 3IUOA 3QOPA 5F04A 4BAYA 1BI3A 2XHKA 1TW2A 2IA2A 3N05A 1VZ0A 3BG9A 2A6EF 1NK3P 4ENJA 4BNCA 1R22A 2IVMA 3L1PA 1Y56A 2ETHA 3HHGA 1OKRA 2E36A 3AG2H 3GTJJ 1HA8A 1DGWY 1DP7P 4F91B 2LH9A 3HOSA 2V1DA 1LFPA 4XKBA 3ZMDA 4A3LJ 4D7NA 4G7HF 4ZDOA 3FXQA 3W3CA 1QGPA 1QU3A 1XG1A 2FOWA 2MC3A 1R6RA 4AWXB 3N4MA 3JRCA 1JGSA 1MMAA 3MEXA 4PK4A 2Q2EA 3OL3A 2ISYA 4P5OA 4MHGA 3ZN1A 2Z33A 2A68F 3F6VA 4LG3A 2KHMA 1SFOJ 4L9TA 1HOMA 3DEUA 3KEOA 2KIFA 3OSGA 2DA7A 4CDGA 1B59A 4FETA 5BPDA 2O03A 3GLLA 2XKOA 5HS8A 2L7KA 3L2VA 1JUSA 4V2GA 5LEJA 2X0LA 1MBEA 2JVHA 3C2HA 1NK2P 5M5YJ 1WH7A 4G6TB 4R1HA 1JKPC 1DQUA 2TCTA 3BTCA 4IOAF 2L9SA 3QPLA 4DJAA 3F23A 3MWMA 3CCJI 1ZARA 1P6RA 2KJCA 2WY8Q 3WU0A 2CW8A 3OYEA 1I6XA 1JUPA 2V4JC 3H36A 3TW6A 4HV5A 2O6GE 3SFZA 3IP4B 2MLKA 2LC2A 5J6XA 2P5LC 1XGMA 4U87A 1TQIA 3NEUA 2FMLA 3W6KB 5CVVA 3J7AO 2DDAA 1XCVA 3FDYA 3I58A 3FF5A 1WWXA 4D0PA 1NG7A 3P9KA 4KJZA 1HKSA 4P9FA 5J4VA 2DTRA 3JRGA 1RUOA 3OS0A 1J9IA 2O0YA 4ZZDA 3LQRA 2JRMA 4KN4X 3GVAA 2GXBA 2WB1N 2ID6A 3HOYJ 4U0WA 3TKYA 3MZHA 2Y0MA 2H8RA 3IAS2 1LJ9A 3WG9A 5FD5A 4NQWB 3JRDA 2LVSA 3OYGA 4CHUA 4BE2A 4CCJA 2DQLA 3FHNA 1R1VA 1XB4A 3FXLA 1A6IA 3TP0A 1VQLI 1FIAA 1F43A 1YITI 2M0CA 1IXCA 4RAGA 3GF2A 1BW5A 5CJ9A 2A6HF 3J7YJ 3CUOA 2W25A 2WWYA 2IT0A 4HBLA 2Q1ZB 2R7FA 1JUMA 3FKIJ 1FTZA 3CCLI 1QBJA 1IN6A 2LFBA 2VOOA 1R5ID 3K9TA 4XICA 4ZTJA 1FPQA 3PUFA 4WK8F 1YI2I 4A2UA 1KYWA 1U5TC 2L4MA 2BW3A 4OINF 2BY2A 4KICA 3JSPA 4BQQA 3K6GA 2YU9J 2VKEA 1SD7A 2LBFA 2LTPA 4G8XA 2R7RA 1RETA 5EJCA 2QQ8A 1PVEA 3ZQCA 2KISA 1A04A 1SFXA 4EGYA 4M73A 2I5UA 2CQXA 1MBFA 5J1YA 4RB3C 2XSDC 1E3OC 5DTDA 3TOAA 2RNJA 2IGNA 2P81A 3KP6A 4ZH4F 1XDUA 5K7FA 1R1UA 4UUSA 2COBA 4A3JJ 1AKHA 3LA2A 5D8KB 2PG4A 2PEXA 2AO9A 5GPAA 3CLOA 1B4AA 3LSKA 2X6OA 2LNBA 3BDDA 4Y4RA 3SXYA 2IS4A 4PJ0C 3CCQI 3E5XA 3JREA 3DXJF 3M9AA 3ZQGA 1IV8A 2DK5A 1FY7A 1S7OA 5FLMJ 5DD8A 5A2QZ 1DGRM 2FSWA 5J1UA 2K27A 2PX9A 2O8KA 3WU2C 4UVAA 5CVRA 4OU0A 2CMPA 3VEPA 5DUIA 2DI3A 1B72A 2ZMEC 2OQRA 3LFKA 2BHZA 2I8DA 3P7NA 4AVPA 2Y0SN 1C0WA 4LIUA 1I1GA 3PNTA 3VSKA 2B0LA 4BJTA 3DTEA 4AD9A 3TO7A 3F21A 4BL0B 3TMOA 4E6KG 3V8LA 5J8FA 5KAFC 1ZG3A 1WFXA 1WJ5A 3DWLE 3V7CA 4HSTA 1Q1VA 1ZHFA 1OCCH 3HG9A 3CCSI 1RKWA 5FLXZ 2QBYA 4IHSA 4TV7A 3GFJA 3GW2A 3VYUB 2ZXIA 4AYBN 5B66C 2M7BA 4M9XA 1CGPA 2DOFA 2GBYA 3CMAI 2NS7A 4G9YA 2A61A 3G1LA 5J1RA 5DS9A 1X2NA 2VKHA 4C2UA 1IG7A 1GXQA 3BPXA 3NRVA 4QWQA 3PO3J 4NHJA 4ESBA 4BJ6C 3CQZJ 2L0KA 1ZGJA 1H88C 1XSDA 2JK3A 2F4MB 1IUYA 4L18B 2ADUA 3SEQA 2DFHA 2L9NA 3IRQA 2F2EA 3W2AA 2CH0A 1HW5A 3ZGKA 1QHGA 3HPGA 3J81Z 3A03A 1MBGA 3CJTB 1VQPI 3HTUA 2R7SA 3FKJA 1U2WA 4WX9A 1QHHD 3LMMA 3OYNA 2ESNA 4ESJA 2NVUB 1MD0A 3AG3H 5F0CA 4PZJA 2EZIA 4YG2F 3BG3A 4N0BA 3WTZA 1R7JA 5IOZA 3CJRB 4OMYA 4E7SA 2PMUA 5E20A 5CVJA 3PFIA 1P9QC 4DNCA 3REOA 3SJMA 1EV7A 2CQKA 4NBQA 1OYIA 2K5CA 1T8IA 2NS0A 2FQ4A 3FK7A 3B02A 2G9WA 3HRTA 4OIOF 3JSOA 1GHCA 3KP2A 3RJPA 2OJED 3R6SA 4YIIA 2M0MA 2DMNA 4JX5A 5BOXA 3DFGA 2Y9ZA 4RLFA 1HKTA 5FKLA 1X58A 3I9V2 3SQNA 2FNAA 5DCMB 1VQMI 2OZ6A 5EYRA 1HC8A 4Q5SF 5GADJ 1QA6A 5LFAA 3UR3C 1N25A 4RM3A 3H9QA 2CV2A 2XGXA 3S2WA 4B48A 4EVIA 1W36C 3F22A 4LITA 3KFWX 2HDWA 4RAYA 4IZZA 3BG7A 4BACA 4BDYA 3W2VA 3WGHA 4PFPA 3I5UA 1HW1A 3D0SA 1RPWA 4XRFA 1WJDA 1XSVA 4PSXA 3QU6A 3BG6A 1JJ6C 1S5LC 1WQ2A 4IO9F 2L01A 2EILH 5E1ZB 2BOLA 2K7LA 1IDZA 1J7KA 3BCAA 4HQEA 3FXRA 2B63J 2M45A 4RAZA 3HOXJ 2VJ4A 4EM2A 2ME6A 4CZZA 4OWRB 3OV8A 4EJTA 2Y0SA 4CH7A 3M8JA 2DU9A 5D6FA 3HGYA 4Y13A 4FTHA 3OIOA 4N9IA 2VI6A 3FXMA 2ZJPF 3EYIA 3WGIA 4DBRA 2YS9A 4AUXA 1XN7A 2LP0A 1UB9A 2C6YA 5GPCA 1ZKGA 3IWFA 1ON1A 3PIOF 2GLOA 2M1BA 5DCFA 1FOXA 2JA8J 2DCEA 2CUZA 4CCNA 4I6ZA 1FP2A 2E5NA 2LF8A 2XUBA 1SD6A 3HKZA 2CUEA 4XN0A 1UHMA 5AIQA 5DUKA 4F3QA 4G6QA 4A6EA 2DN0A 3MZYA 1NTCA 2W57A 3B6AA 1J75A 2A05A 3PM1A 2ZMEA 2L54A 3WE3A 5CVIA 1G4DA 1QVUA 1J0RA 5IYBJ 1YJNI 1MZBA 2CQNA 5L3CA 4UB6C 4LB6B 5HLIA 5GTHC 3CUQA 1RRJA 4HX7A 3CO7C 2DYSH 2X1EA 4B43A 2WBMA 3K70D 2LRDA 3CDLA 1ZR4A 2RVCA 3QQAA 4CO8A 4LGWA 1H9TA 1DU0A 2FF4A 1PYVA 1YIOA 4FE4A 2EV6A 5ILVA 1G6NA 3RKQA 3ZMUA 4JX6A 9ANTA 2OV7A 3PFYA 2R7DA 2X48A 2HWVA 3QOEA 4FT8A 2E60A 2V1NA 2ELKA 2WTEA 4JP0A 2QF7A 1HLVA 5E3NA 5D8LB 2GOMA 3R0AA 5FRNA 3HSFA 2WC2A 3DV8A 4NDLA 3VB2A 2OU2A 3RPUA 4HSRA 4BY7J 4XOTA 2AQFA 2OQGA 2KL4A 4GYGA 4HW0A 1LUJB 4OAZA 3BQYA 4ITVA 1UMQA 1QRYA 1ETOA 2VKDA 2NVQJ 1Z6TA 1B8IB 2XAQA 3LSRA 4CUGA 3MKYB 1GVJA 3U2RA 3CF5F 3L09A 4XLNF 2IS1A 1IC8A 3RI4A 2XGEA 3HUGA 2HR3A 5AONA 2GAUA 2NNYA 4D5FA 1HKQA 2E19A 3IH3A 3NQOA 4UV9A 4CZCA 1RI7A 3K4JA 3VPRA 5LBQA 2X51A 1QZEA 1TWGJ 3TQNA 1GV2A 5E8IA 3J7AY 1LQ1A 1SFUA 2UV1A 2AQEA 1R5GA 3DEEA 4HLYA 4IRHA 4E4HA 2QUFA 2IEKA 1D5VA 3AL0C 5A2QK 3VOEA 3CMMA 2DA4A 3GZNB 3C3WA 2CSOA 5HS7A 2FX0A 2YUSA 3PO2J 1FOYA 3TDZC 4JK1X 3DTKA 2KZVA 5F0FA 2QYOA 2EIJH 4IXAA 1OYWA 3LAPA 1IJWC 1OR7A 4CYDA 4QLCU 4B09A 4GFBA 3QODA 3VYSB 2YX7A 3VODA 2MBFA 4IHWA 2R7ZJ 3V42A 1X3WB 2W85A 4S0HB 5D5XB 4II3A 2FD5A 1K7AA 3E1SA 4XORA 5F08A 5ICCA 3CO6C 5FD6A 1LFUP 3EETA 1VTNC 5FLXK 5E3LA 1I6HJ 3WE2A 2BXZA 2K9LA 4BKXA 4N9HA 3SYTA 4I2OA 4FASD 2Y30A 4JX4A 3TDUC 4HF0A 1KU7A 1W7PA 1F9NA 1R00A 5ILUA 2CUJA 4U88A 3GZ6A 1TQPA 3CP8A 4MEYF 1RUNA 3PQJA 4B8XA 4XBFA 4KISA 1FMVA 3KX2A 1XGNA 2QENA 5IYDJ 1U6GA 2M7AA 3F8FA 5K5RA 2OCEA 2GQQA 3QAHA 2MW8A 4CCOA 3CMEI 1KU9A 2W24A 3DU5A 3J81K 4II2A 3K1MA 2VQCA 2V6EA 3ZN0A 2DT6A 3GCMA 3ISPA 1UHWA 2NRAC 4CYCB 3KZIC 4LLGF 3U1DA 1T0FA 2CUFA 4BXUA 3R0JA 1X1DA 3JAMZ 4AC0A 1YQAA 5ILSA 3E6MA 2OA4A 4UV8A 1MW7A 2E1MB 5K7HA 2XAHA 2VXDA 2DPUA 3ABLH 1TNSA 1X3ZB 1TP4A 1JTXA 4UXNA 3HGGA 2NYXA 2GIVA 2PJRA 3OSFA 1ETQA 2P4WA 5CQGA 3TP3A 5HS9A 4RB1A 2Y31A 4ZC3A 4G12A 3HJEA 1OYYA 3BY6A 4B4CA 1N78A 3LFUA 2HKOA 4P96A 5E79C 1YW9A 5LRSA 2ZFUA 3A2KA 2M4KA 3HBLA 4XRSA 3HRSA 4I99C 2DYRH 1P7JA 3F8MA 3NWTA 1APLC 3X2QH 1UZCA 2MLGA 3BQZA 1FOKA 2ZJRF 1WZ2A 2Q2EB 4RBOA 5LEKA 2R5ZB 3HB9A 2XROA 1A35A 2ELJA 3DTIA 1E0EA 3O8HA 2TRTA 3HZJA 3LNQA 4ENNA 5CQEA 3FMRA 4BDZA 3F8BA 1HDPA 3E6BA 4Y33A 5F27A 4J00A 4KMUX 2VBXA 3KEQA 1VQ5I 2P7CB 5H2FC 4BHBA 2RN7A 5E3MA 1SEUA 4P1WA 1WKMA 1Z3XA 4OIPF 3OL4A 2W48A 2XRNA 2HQNA 3KP3A 1FEXA 2W7NA 1EA3A 1D8JA 3D5LA 1EF4A 4MQVA 3S93A 4H0EA 4YELA 4MLOA 3H3UA 2CYYA 3HC7A 4M3DA 2EA4A 3DKYA 3Q0UA 4W97A 2D45A 1TC3C 3MQ0A 2R4GA 3KCCA 4ABZA 2ZJQF 2FUG2 5LHIA 3ZQ7A 3JW4A 3WTSC 2DFEA 2VQLA 4A0ZA 1O3SA 3M8FA 4EJVA 5L3BA 3BZKA 3JR9A 1F36A 1MMNA 1SC7A 3H1CA 1VQ7I 2NAZA 1YTYA 4HX8A 2BY1A 4XM3A 1Z9CA 2W84A 1FZPB 1WJCA 1UJ8A 4ETSA 3GFLA 3E6DA 2YR2A 1FJLA 4D7MA 2IGKA 2ZSHB 4KT6A 5M3MJ 4L0YB 2CG4A 5B1AH 1EH6A 1G2HA 2MABA 4E7IA 1FT9A 2HOAA 4GO1A 4FX4A 3K4KA 2XVCA 3QYFA 2A5WA 3TL4X 4B3XA 3EUHA 2EV0A 3BOQA 1YJWI 2PN6A 3K69A 3WG7H 2WAQA 5F0HA 2PI0A 2P7VB 2VT2A 4IHYA 1BW6A 3BJOA 2F6CA 2V1UA 2NS8A 4O3MA 2Z1DA 2RQPA 2X9DA 4DYRA 3LL7A 1UG0A 2QQ9A 1SFEA 2UUZA 1Y39A 1V54H 3BLYA 1Z6RA 2JRTA 5TRDA 4HF1A 2LR8A 3G1MA 4RMNA 3FHZA 3DP7A 1LE8B 1PUFA 4UB8C 2RDPA 2ME0A 3H9GA 5D5UB 2NOGA 4RLQA 4KT5C 2DFFA 4BHCA 4ON0A 2DW4A 3BWGA 1IUFA 2H8WA 3QWLA 3ASOH 4BY1J 1Z77A 3CCYA 2E34A 3A0BC 5J47A 3BZ6A 1T2KA 4BQNA 5LGNA 1BI2A 1IRFA 1IN4A 3LA7A 4BYYA 1SFKA 1PUEE 2OD5A 2JT1A 4XSXF 1QQIA 5C4XJ 1MNMC 3L7WA 3ZCOA 3MKLA 1P4WA 4R8HA 3GTOJ 4BXXJ 4BU2A 3HRMA 1T56A 1SD5A 4RGRA 1MNDA 1I39A 2GOXB 4IKFA 3DPLC 1AU7A 2X1CA 2DDBA 1TWHJ 2BV6A 1BI0A 2ZKZA 5M5XJ 5JHUA 1AA7A 5KCMA 4ZYDA 5BPIA 1XPXA 1VQ6I 4AVZA 1E3HA 4KUMA 1REPC 2ZSIB 2EZLA 2XF6A 3GLXA 4NC6A 3I0TA 1U3EM 1QZZA 2LY1A 3WTYC 2QA4I 2HVSA 1KQ0A 1Z91A 3ONQA 2TDXA 1TNTA 2HTJA 1OCOH 2FU4A 1ACIA 3K4NA 2NXNB 5CPRB 4CCKA 4BS9A 1G59A 4GCVA 2ZXHA 4U0YA 3H5NA 2XAGA 3C18A 1TZLA 2BE5F 3E97A 2PFBA 4V19K 5L3GA 5B3SH 4MFDA 1O7FA 3OYKA 3ABMH 4EJOA 3H3VK 4W1UA 3EYYA 2UXXA 3OYBA 1ZG1A 5ICGA 3HRUA 4B47A 5LRRA 3PJRA 3GTQJ 2VN2A 1OCZH 1FC3A 4NUBA 1VQOI 3T0YA 4HF2A 3HM5A 4G7OF 4HV6A 2HDDA 4A5NA 4A3DJ 2VL8A 4L5IA 1S72I 3HIFA 3PL8A 5HODA 2QBYB 3EUKL 4RB0A 3S17J 5KHDA 2VKVA 2BVMA 1Q1HA 2F5EA 3OR2C 2R92J 1IAWA 1JI8A 3ZR8X 3H0DA 1QPMA 1YX3A 2IRFG 3S3MA 1K78B 4ZJZA 4XR6A 3IWZA 1D1AA 1FOWA 1WSUA 1BJAA 1TT5B 5HDGA 3S1MJ 1YO5C 4NQWA 3ASNH 3CCMI 1B9NA 3RKWA 1T38A 4DZPA 3FMSA 3QYBA 1W0TA 1JT6A 2O3FA 5ERIA 1BN5A 4UHTA 4EM0B 4HNVA 2CS3A 5B1BH 2XKPA 5HOOA 4XLEA 4M9SA 3CCUI 1H89C 2F5CA 3D5SC 3Q5FA 1I5ZA 1V4RA 3GEZA 3JAMK 3IRRA 2RV8A 3GTKJ 1ENHA 2I10A 1WJEA 2LYCA 1D3YA 3RIRA 4GRIA 2QQAA 1JHHA 3VFZA 2DMUA 2YX4A 2L7ZA 2F5FA 1XGOA 1RC9A 3CD6I 5HLGA 1HSTA 2HXOA 2LK2A 2H94A 1MJ9A 1MMDA 3GZ5A 1BOAA 1X19A 1ZH5A 3NARA 5ICFA 4KYWA 4XOPA 2NVXJ 1KU3A 3QU3A 4HLXA 3TGNA 3HKZN 2KZGA 3CCVI 3I4NJ 1CF7B 3AG1H 1O7LA 1LEBA 2CWEA 3HOVJ 2H09A 3OYFA 3OS2A 1VF9A 4RB2C 2DAOA 4XK4A 3GFMA 4G7ZF 3K2ZA 3RDIA 2R7XA 1G8XA 2LMDA 1E3PA 3CJQB 1RESA 2F5VA 3JTHA 1GUUA 4RGSA 3SFIA 1R58A 3S3OA 5F1RA 3W6VA 2X1DA 1MDMB 3OYAA 2VONA 5M5WJ 5DD4A 2F5DA 1Z1DA 2K9QA 4JBAA 5IP9J 1USTA 3F6OA 2R7UA 2X6YA 1R5HA 1JGGA 2JQ7A 2VJIA 1YE9A 3ABTA 2EV5A 3BJ6A 5HLTA 1FIPA 1O4XA 4FHTA 3MVPA 2ZBKA 3GTMJ 4WCGA 2VODA 2KFDA 1IRXA 2LREA 3A0HC 4HPQA 3SZGA 3FK6A 4S04A 4XQFA 1LEAA 1J2XA 3DPTA 2FXAA 5E1XA 3I56I 2E71A 3ECOA 3DKXA 3I59B 2R7WA 1AOYA 4MQ9F 3KIOA 3E7LA 1WJBA 2Z9OA 2HFHA 1W5TA 2DO7A 3L2QA 3GTLJ 1O3RA 2XPUA 2D1HA 2K3PA 3RPUD 3MZ8A 5K5OA 5EZHA 3HTSB 3H0GJ 3WHCA 5C4JJ 1OCPA 3WTVC 2KP6A 4XKCA 2V7FA 1A6QA 3MKWB 3CCEI 1CQTA 2EIKH 4XKVA 2VT3A 3CC2I 1X1BA 4RGXA 1Y0NA 3OYDA 1P4AA 4EQQA 2P5KA 1YOVB 4OAYA 1U5TA 3VSLA 1X1AA 3Q0VA 4Q4ZF 2DA3A 3H3ZA 5K7ZA 1S29A 4FCYA 2DK8A 1T33A 5TISC 5AIPA 2V6CA 3W6JB 2V1XA 3G71I 2HPIA 5HVQC 4RGUA 2K02A 1TWFJ 4E7KA 1S7AA 1BIBA 2L7MP 1IV6A 4OIQF 2L4AA 3CUQB 2ZNZA 4DBQA 4PJLA 3BT9A 1V5GA 5EG0B 4JYKA 3ZMTA 4UNOA 3RPQA 2XRLA 5IT9K 5D4RA 2CJJA 2EINH 4KMFA 2R7QA 4HG2A 3BTLA 4DZJA 4HNTA 4L9NA 3QRFF 1HCRA 3BG5A 3A02A 3OWTA 1X2MA 3L9FA 2DA5A 2AXLA 2M5WA 1W36D 5JI6A 4M3BA 1ZN2A 2MA3A 4CA0A 4KITB 1HDDC 1NH3A 3K2AA 2A07F 5LGTA 2QVOA 1LDKB 3ABKH 1TQMA 5F6FA 1O3TA 3B6CA 2CO5A 1K78A 2LF7A 3OS1A 1K6OA 3IC7A 4MTDA 4L5JA 2DPDA 3L2RA 3U21A 1A31A 5CYVA 2KRHA 2X85A 5EEHA 3P9IA 2FA5A 3DCFA 5C3EJ 2XIGA 1QPIA 3MD2A 1TTYA 3O8GA 1L3LA 3IKTA 3K70C 5L3DA 2BY0A 1OISA 3BR3A 4Z6YA 4A3KJ 3S1QJ 3HUGB 2K3FA 4ENMA 1R1TA 5DCMA 3J7ZI 3TEDA 2E1NA 4IQ4A 3RTRA 4PDKA 3IL2A 1FSHA 1LVAA 2DA1A 5KVRA 4UUTA 5E18F 3K4LA 1G3YA 5L3FA 2K9NA 1DPRA 2J5OA 4A69C 2MD5A 3FXKA 4A3CJ 2Y75A 3F8NA 3TO6A 3HDDA 2KT0A 2D5VA 5JVGF 1BL0A 2OBPA 5GAEJ 2EFWA 3DF8A 2L5QA 1R36A 2DQRA 2D2WA 3GMEA 2M3AA 2ZXWH 3ML6A 2FBIA 4AIJA 5HNHA 3L2WA 1ZELA 1LKXA 4XSZF 1W5CC 4QPOA 1YW8A 4AIKA 4ZTFA 2CV0A 2P8TA 1GVDA 3A01B 1QVTA 2QSGX 3GTPJ 2LSOA 2P6SA 5FFZA 4JOMA 1I50J 1RZ4A 2KDOA 2CRGA 4L9VA 3HEFA 1I1SA 1OCRH 1YIJI 3FXUA 2M4GA 2FBKA 2M87A 4FX0A 1R4NB 3KPHA 3OYLA 2D1VA 5KK1A 2R5YA 1D0XA 3GFIA 2KQRA 3BZCA 1IO2A 2IBDA 3VYTB 3JRFA 2LY2A 2YPRA 4RS8A 4XIDA 4A6DA 1W5SA 4A3IJ 1D8KA 3WGGA 3OOUA 3CP2A 1B9MA 3GX4X 2VLAA 4P55A 2VB6A 3TOBA 1Y6IA 3K4CA 1GDTA 3DLAA 4LJZF 1S8NA 5J3LA 1QZYA 4LIVA 2IGOA 4AIHA 1G3SA 4A3EJ 3OIQA 1WJFA 2K9MA 5CLSA 3ZQHA 1FBQA 1FNNA 1OMIA 2IGMA 2E1MC 2GM4A 3OOPA 1ZGWA 2NVTJ 1BR1A 2HEOA 2IA0A 2AXTC 1K4TA 3QPTA 2DTZA 5ED4A 2JUGA 1IDYA 1SMTA 2JA5J 2JWTA 2KPMA 1V3FA 5JVTA 3CDHA 5TJJA 5D5VB 1OCTC 2HVRA 4M6YA 5JFRA 4P9UA 1O3QA 2IS2A 1Y8RB 3MAJA 3L00A 4RAFA 1EKEA 3EUAA 3JRHA 1BBYA 4RM2A 2E7WA 1I3QJ 1Z3YA 4QIWN 3DEWA 4BJ5C 2K4JA 2EB7A 4LG0B 2JPBA 3P9CA 5HDNA 1VQNI 5EGOB 6PAXA 1SVOA 4YEJA 3L2UA 4YIFA 1N75A 1TWAJ 2ZCWA 3FX3A 1RR8C 2PMZN 5LHGA 1D0ZA 4A3BJ 1Z7UA 2E7XA 1STZA 5H20A 5FJ8J 2YU3A 2RQQA 3BC8A 2GA2A 1BC7C 2Y69H 2PLYA 1G3WA 3OIPA 4DOZA 5D4SA 1B8IA 1ZRFA 2FBHA 4MTEA 2VBYA 1MJBA 1UHSA 1X4OA 1WVRA 2ZNYA 1X4PA 3HXLA 1L0OC 2K4BA 2QGUA 5JLXA 1WI3A 2QSFX 2NVYJ 1YS7A 2FE3A 3ZQLA 1WHUA 2WAQN 2KIMA 4HQMA 4L0ZB 1T95A 2XF7A 1XMAA 3TW7A 2ZFWA 1X1CA 2LG4A 2EBIA 2EPFA 4GDFA 5LGUA 3K4MA 2KIUA 3HHHA 2JN6A 2MSYA 2K86A 4KIBA 4IRGA 1KQ8A 1LB2A 2ESHA 2YSRA 2OZUA 3GO5A 4A3FJ 2IS6A 1XDSA 3LSJA 4OMZA 3PQKA 4DGWB 2ZO4A 1ETKA 2G7UA 5FLVA 2F4OB 2DT7B 3IKVA 4I02A 2EFPA 1WPKA 2OTLI 5FGMA 1G3TA 2UXNA 2W00A 2XSJC 1SMYF 1ONVA 3OYHA 4XNFA 2XB0X 3GYHX 3C2GA 3HOZJ 1QO0D 3PSFA 2VBWA 4ASNA 1RR7A 1VI0A 3M1CA 1D5YA 3BR5A 4F52A 1N77A 2EH3A 4PGHA 3IH2A 5D6EA 3BROA 3F8CA 4HDVA 2CFOA 3KEYA 3LQQA 1OJLA 4BGDA 5J4YA 3LSPA 1ZLKA 1ZLJA 3JRAA 1YRNA 3A4CA 2HYGD 2M8EA 1KYZA 3M8EA 1BA5A 2LKPA 4QSHA 4ANJA 3I54A 2JMWA 1TLHB 5IPAA 5GTIC 4IL6C 4E7HA 5FKKA 1JKOC 3N97A 3E3VA 2RC4A 1KQ9A 2KIQA 5IY5H 3FXOA 4ZYAA 2DMQA 2QM3A 5DYMA 2W82A 2G7HA 1VFCA 1R23A 1FLIA 3AKZA 1S7EA 3BTIA 4H4KC 3H35A 4M9ZA 1H8AC 4QPQA 2Q8KA 4M71A 4PGGA 4IF4A 3FM5A 1K61A 5FROA 1T6SA 1K83J 4LFUA 2R0QC 1KGSA 4M6XA 4X1EA 2K40A 3KETA 2HPMA 2O8XA 4XN3A 1F5TA 1WI9A 1XCBA 2K85A 4GGGA 1ZQ3P 2OF7A 2B9SA 2WAFA 3BCBA 2DT5A 4XMYA 1PUFB 2OPTA 4CYCA 4F92B 4Y17A 3K1PA 4BEHA 2VE9A 1LPQA 3LA3A 1VQ9I 1J59A 1S3JA 1IN8A 3E5UA 3OYIA 3VWBA 4LK1F 2XAFA 1U78A 5BS6A 3LSHA 1K6YA 3U1KA 1W0UA 2PMZA 1JE8A 2PMHA 2Q0OA 1IZ1A 1DP3A 2DOEA 1F1ZA 3RZDJ 1FX7A 3H5RA 2ECBA 1R9TJ 2KKOA 2VQGA 4C3IJ 4HDUA 2Z3YA 4KIFA 4EMSA 5H6QA 2RAEA 4UVCA 3L2CA 5DDGA 4BE1A 3HOUJ 2OAZA 3FWEA 3V7SA 3V7RA 1JJ8C 2LD5A 2VXZA 2CGPA 3IHUA 3S15J 2MGQA 2BZTA 2H27A 4I0BA 3G6EI 1MSEC 4HX4A 1SAXA 2WADA 2R5ZA 1ERDA 4KNYA 2KDZA 2ZC2A 2AHQA 2DJNA 2IPQX 4WF2A 1FP1D 5IT9Z 3KLOA 2DMTA 1Y8QB 2BEOA 2IP2A 1ZGAA 5LD2C 3PNYA 5EZGA 1FYMA 4J19A 1ETWA 3AG4H 3SDBA 1XMKA 1MH3A 2A6TA 2HOTA 1HF0A 1GT0C 2VUMJ 1BC8C 4C2TA 1OLTA 2L9VA 2BW3B 1KA8A 1HBXG 5BQTA 2MYSA 5JHFA 4A12A 1O57A 2STWA 4B3AA 2FEZA 3G4SI 4LLNA 5D5WB 4BQOA 1XC5A 2LBFB 5LLQA 1SVMA 2HZTA 2R3SA 2HS5A 4A5MA 2O7OA 3ZXSA 4IOCF 4F93B 3T1BA 1D1BA 1Z0XA 5EF6A 3G2BA 1RNLA 1NG6A 4ENKA 1LDDA 2QWWA 3ZRGA 2E5ZA 4Y15A 3F9KA 2EWNA 2IW5A 4LLLA 3IV5A 2X6XA 4A0YA 4UUSB 1USSA 3MKZA 4EEFG 1R71A 1AKHB 1Y0UA 3FXJA 3U9GA 4Y7NJ 2WV1A 2XPWA 2NNNA 3QYEA 3LOCA 3RCOA 2V79A 2CFXA 4O6JA 3T8TA 5F1JA 3AAFA 1S6LA 3KYCB 1SANA 3K4BA 4O5VA 1BI1A 4AM3A 1Z05A 4S05A 1AWCA 5LHHA 2HQ5A 2ZXJA 2L7FP 5JR3A 5EEGA 4KN7X 2XV4S 4M3FA 2M9HA 2V9VA 3BJAA 2EFOA 1K79A 2GXAA 4YRVA 1JXSA 2BXYA 3COAC 4C2MJ 1U8RA 1B72B 4HZFA 4EATA 4QTRA 3GWZA 2EA2A 3HPHA 4RDUA 2ZJ2A 2R7TA 4KA4A 3FISA 4JQFA 1LE8A 2DLLA 3EPZA 2IXSA 1ZAOA 4M3GA 2XAJA 1JTYA 2M8GX 3FBIB 4E70A 1ZTRA 2BHYA 5FKOA 2N8GA 2RNGA 1IW7F 2EFNA 4R79A 3JRBA 4ESFA 1RIOH 5E8GA 1ETYA 3R61A 4I09A 3DU6A 3ZPLA 5FRMA 4XRSG 1LDJA 3CLQA 2H1KA 2RKHA 1BIAA 3EQLF 3ZQQA 1SD4A 1DPUA 3CJNA 3O3KA 1A36A 3M1EA 1XMXA 4BE0A 3CTAA 4DYQA 1PP8F 2JSPA 3KLNA 4A3GJ 1JT0A 2Y48A 1UCRA 3G3ZA 1YFHA 3BTJA 1ON2A 2H6CA 3P5JA 2E2IJ 4OOIA 4XKWA 3SHFA 3NWSA 3DBHB 3HSRA 1M1EB 1OFCX 2VQHA 3H9JA 3TBIA 4A3MJ 4Q47A 4M3EA 2RGVA 3TO9A 2DJIA 1DUXC 3LSGA 4FQGA 1Y1WJ 3SZPA 2PJPA 1MH4A 5IOYA 4XRMA 2Y2ZA 2ISZA 1FBSA 3NAUA 4HOBA 2LLKA 1B1BA 5TGTA 5J40A 1MNEA 3J80Z 1U9OA 4MEXF 2G0EA 1Z67A 1JKRC 4HYEA 3ESWB 2ECCA 1ZRCA 2JA7J 3KYDB 4XLFA 3DLLF 3M3YJ 4D1QA 1EJ9A 1X3UA 1ZR2A 2DBBA 2IAIA 4I01A 2RREA 1VNDA 2P5VA 4C30A 4KDPA 2JUCA 4XLCA 3I3LA 3CC7I 3CUQC 4D5CA 3R4KA 3D5RC 2BGCA 1B6AA 1WJAA 2FQ3A 2XB5A 5J8CA 1D0YA 4I0AA 3RZOJ 3E6CC 5GAHJ 2GIZA 1U5TB 4UVBA 2MC4A 4G94A 2O5RA 1J09A 2BBYA 2M34A 2BYVE 3SEZA 4CSWA 2WB1A 4EJWA 1IRGA 3WTUC 3H92A 4CCMA 2HKXA 4NNJA 4LK0F 1UELB 3ZMZA 2O61A 2V9KA 2XDVA 1IXSB 3BR1A 3FMQA 3IAM2 3M7GA 3VYRB 1GV5A 4F7ZA 1EH8A 1W4MA 4YFNF 3WTTC 3JTGA 2F4IA 4ZYEA 2MG4A 1FWZA 3RYRA 1XTAA 1BJZA 3FIWA 4PFOA 2VPLA 2QZ8A 1JHFA 3S2DJ 2LY9A 3IH4A 4M74A 4DIQA 4X0GA 2L3DA 3DQVC 4DW6A 1T98A 2HXIA 2WAEA 2VC0A 4BBRJ 1TL8A 2V26A 4K2EA 1PDNC 1Z7LA 2CW0F 3C1DA 4C3HJ 4IX7A 4YFXF 3K0LA 2COMA 1IXRC 4IVNA 1PP7U 1FBUA 1DDNA 2L9RA 3B73A 2F48A 4PJNA 1X1PA 2FMYA 3CC4I 2JVGA 1POGA 2BY3A 1I3AA 1Z21A 4X6AJ 1MMSA 1W1WE 4LMYA 3OY9A 4FE7A 1YYVA 3F72A 4DYCA 3Q9VA 1MJAA 3DBRB 3CDIA 4BUPA 2O9LA 5KNLA 2ZMEB 1HXDA 2VIXA 5F64A 4XLPF 2QLZA 2LKXA 2H1LA 5BNGA 1V5FA 1CF7A 2CV1A 2VASA 1T39A 1IGNA 2JA2A 2OTJI 4XLAA 2QCOA 2GXGA 1U9NA 2X4HA 2XASA 2WA0A 1BOBA 4PUSA 4WXCA 3SDGA 3HYIA 2GWRA 2HYFA 4ZYGA 5IT3A 1OR7C 2OCCH 2QKLB 2JSCA 1ETVA 4MO7A 1VQ4I 4RA2A 1PJRA 3O2PE 4HNUA 3K10A 3ZP5A 1V55H 4C9YA 4EGZA 1RKTA 2HOEA 5K5QA 1MDMA 3V8JA 2VJJA 3SZTA 2Z2SB 5HDKA 1D1CA 4J01A 3UKGA 3R60A 2B7EA 4Z2YA 2AS5F 2P0WA 2NOJB 5H6RA 3WTXC 4B44A 1R49A 4OIRF 4IHVA 4ZZLA 1K4SA 2QKMB 2CQQA 2HU9A 4G6DA 2HZDA 4BXFA 3MMYB 2KLOA 1UG2A 3Q0WA 4I76A 3WHBA 3W2WA 3Q9SA 1F4KA 3CMYA 4EJUA 3V4GA 3S2HJ 1ZREA 2DA2A 4ZDLA 5B5EC 3I4MJ 3BP8A 1NHAA 1SAUA 2QQBA 3I59A 4WXDA 3UNGC 1HSJA 3D1NI 2EJRA 4I7HA 3PSIA 1AHDP 1FYLA 3GXOA 4ZYHA 2ZB9A 1HQCA 1E17A 1BR2A 3QPHA 3FBNB 3I55I 1W7PD 3I53A 2R5YB 1MKMA 2FNPA 2FRHA 2H6BA 4KIGA 3I64A 1JKQC 1IRZA 4PJMA 3LSTA 4BHPA 2OC6A 4AYBA 2M30A 4UY8I 5KAIC 2VJ5A 3K1NA 4DQ2A 2ACJA 1MSFC 5HLHA 2UZKA 2R93J 2CQ7A 5DM7F 1U8BA 3ECHA 3HOTA 4IEJA 1T0FC 2EK5A 2BVLA 2JPCA 4CCLA 2MFZA 2OUMA 2EZKA 1H9GA 2XGCA 4N4OB 2L2OA 3DKWA 2GA1A 3F3XA 1T08B 3DPUA 2EQRA 5E1WA 5E17F 1ZRDA 1R4MB 3LSIA 1I27A 2M2EA 5EG0A 3ERED 1MBKA 3V8KA 2QSHX 4GXOA 3FZVA 2JZYA 1IF1A 1LFBA 3A1YA 1XD7A 4AIDA 4NC8A 4PJJA 1EH7A 2E2JJ 1XS9A 4HEA2 4F55A 2JA6J 5L3EA 2UWMA 1OPCA 2DODA 4BQAA 3ROUA 2Z99A 3KP4A 3RYPA 5DM6F 3BR0A 1YJ9I 2EIMH 2FOKA 4I98B 1MIJA 1MBHA 3OYCA 4A93J 4CICA 4YIRX 3CESA 1UAAA 1V5EA 1HW2A 3CF2A 3LWFA 2P6TA 2Y9YA 1WRJA 1Y1VJ 3GBGA 3BPVA 2HGCA 1W7PB 2LKSA 4U0VA 2HVQA 3PNVA 4M72A 3ZOBA 1FMWA 1IN7A 1QNTA 2DFIA 5ICEA 3M4OJ 1GLNA 5EDNA 3H5AA 1TT0A 2V9PA 3KP7A 3GTGJ 3RSNA 2W1OA 2E1OA 2VC1A 3CZ6A 3HL2A 1FSEA 4UUVA 2L02A 1XGSA 2WV0A 3OYJA 4HA8A 4MGRA 4IPAA 2STTA 5BMZA 3ABUA 1KZHA 2IA1A 2VBZA 3JCUC 3WTWC 3RQIA 2J5PA 1MBJA 3WODF 3S16J 4U7DA 4EM1A 2KRFA 4NB5A 3CCRI 1TWCJ 1FTTA 1E2XA 1H0MA 4E7ZA 3RKXA 5K1YA 3J80K 1YLFA 4IQJA 4Y52J 3DBLB 3E5QA 3KYLA 1P92A 1ODDA 5IP7J 3PUBA 3E0JB 1KONA 2A5YB 5FO5A 1BM9A 3O6BB 4YFKF 5GP9A 1KU2A 3FM3A 2PJRB 1YHQI 1P2FA 3ERMA 4M6VA 3I71A 3MN2A 5DV5A 4IHTA 2W4SA 1P4XA 4FISA 2E1CA 1ZYRF 4V2FA 3A01A 5FFXA 4WXHA 3ELKA 2XF5A 2Z16A 3EUHC 3VDXA 4AU7A 2XC7A 3LAJA 1YRNB 2DXIA 2R7VA 1SVLA 1TBXA 3MCZA 2CW7A 5M3FJ 2JJ7A 2XAUA 4LD5A 4L5EA 4MFEA 2EFQA 5FKMA 2ELHA 2K9SA 5EEAA 2KJBA 3ULQB 3S32A 4GYIA 3ZMSA 3BR6A 4NC7A 2HOSA 2DA6A 2IJLA 3KZYA 2HI3A 2GZWA 1U0JA 1LVKA 1ZK8A 2A69F 4CGZA 1WH5A 1BR4A 3RQ4A 1YX5A 2PQ8A 1J5YA 3OR1C 4WWCA 4E7JA 3S3NA 5E3OA 2WY7Q 3EDPA 2JTVA 3GUDA 1WCMJ 1ULYA 2DMPA 5C44J 2A3SA 2MH2A 1OQYA 2LOOA 1ETXA 3C2BA 1ITYA 3F0CA 1FYKA 4MNUA 4U7BA 3JRIA 1UFMA 2X6WA 4IHXA 5DEQA 4BEHB 2E2HJ 3Q3SA 4N4NB 4Y3OA 4B1RA 2HQRA 1XX5A 2HTSA 4HRIA 3AL0B 3M07A 3S1NJ 3ZMVA 2XGDA 4ZDPA 2VE8A 2VOPA 3I4PA 1WGXA 4LG0A 1GXPA 5EGOA 2DOAA 5IP6A 2PBIA 2HDCA 3QP6A 3HOWJ 5FB2A 2HYJA 3KP5A 4Q48A 5FKNA 4L9JA 4PSWA 3AFHA 2R7OA 1YS6A 2MH9A 4HAMA 2HNHA 3OYMA 4C3JJ 2VPRA 1YW7A 1A5JA 2XPVA 2E35A 4EV0A 1YG2A 5HNFA 5CVUA 1TW3A 3KZZA 4IRIA 1MMGA 2FJ1A 4IJAA 5IYCJ 4MIMA 5JLWA 1P7IA 3PIPF 4XL9A 1IN5A 4BBSJ 4XONA 2MD0A 3KE2A 3OMYA 3T8RA 2LDUA 4E7LA 1ORKA 4A0XA 3HSEA 3MFKA 2Z5UA 4LB5A 3K7AJ 3S1RJ 4CXFA 1S9HA 3C7JA 3RKYA 3G1OA 4KFCA 1DU6A 1LNWA 4BH9A 3G73A 2QEXI 2HQAA 4PCQA 3WU1B 3S8PA 3QPSA 4XLHA 1ZG5A 1XSXA 2KMUA 2ICWG 3BR2A 3LSMA 3S14J 3ZQIA 4LOCA 4D9JA 3ZQFA 5CKTA 3QP5A 3T5XA 1VQKI 2CU7A 1VQ8I 2KRCA
chains in the Genus database with same CATH topology
5HVQC 3IUOA 4E7KA 3ZQQA 3N05A 1VZ0A 4DBQA 3DTKA 2KZVA 4BE0A 4PJLA 1V5GA 1Y56A 2JSPA 1HA8A 1DGWY 3QODA 4F91B 2LH9A 3VYSB 3HOSA 1LFPA 4XKBA 4ZDOA 4XKWA 2R7QA 3V42A 3W3CA 3NWSA 1QU3A 4HG2A 3TBIA 3H9JA 2VQHA 1R6RA 4HNTA 4II3A 1MMAA 3E1SA 4XORA 3OWTA 2DJIA 4PK4A 3LSGA 3OL3A 1W36D 4P5OA 4KITB 4CA0A 4LG3A 1LDKB 2KHMA 2K9LA 4FETA 3SYTA 4FASD 3OS1A 5TGTA 1MNEA 2L7KA 3L2VA 3L2RA 2CUJA 3U21A 2JVHA 3CP8A 2KRHA 2X85A 3C2HA 2KRCA 4KISA 4XLFA 1FMVA 3KX2A 3MD2A 4D1QA 4G6TB 3K70C 2M7AA 1DQUA 2RREA 4C30A 4CCOA 3HUGB 4XLCA 3DU5A 3I3LA 2L9SA 4DJAA 3D5RC 4II2A 3RTRA 4IQ4A 2VQCA 2V6EA 1WJAA 2DT6A 2WY8Q 2CW8A 3OYEA 1D0YA 2V4JC 3K4LA 3IP4B 2LC2A 2MC4A 1X1DA 2O5RA 4U87A 1J09A 3SEZA 4CSWA 2WB1A 3FDYA 4CCMA 4NNJA 1MW7A 1NG7A 2L5QA 4KJZA 1UELB 2E1MB 3OS0A 2V9KA 2M3AA 2VXDA 2XDVA 3IAM2 3VYRB 2F4IA 2PJRA 5HNHA 5CQGA 3L2WA 3IAS2 4PFOA 1ZELA 1LKXA 4ZC3A 2VPLA 4NQWB 4QPOA 3OYGA 1N78A 3LFUA 4ZTFA 4DIQA 4X0GA 4BE2A 2CV0A 2ZFUA 4CCJA 2M4KA 3FHNA 3DQVC 3A2KA 3NWTA 4JOMA 2WAEA 2KDOA 2V26A 1Z7LA 2M4GA 2Q2EB 4IX7A 3OYLA 1E0EA 2ELJA 3DTIA 1D0XA 2Q1ZB 2KQRA 4PJNA 2JVGA 5CQEA 4BDZA 3VYTB 4Y33A 1Z21A 2LY2A 4J00A 4ZTJA 3OY9A 3OOUA 3CP2A 2VLAA 4P1WA 2VB6A 1Z3XA 1Y6IA 3K4CA 2BW3A 3OL4A 3DLAA 4BUPA 5KNLA 2W7NA 1EA3A 4LIVA 3D5LA 4BQQA 2IGOA 3S93A 3K6GA 2VIXA 3OIQA 1WJFA 2K9MA 2LBFA 4YELA 1V5FA 4MLOA 2IGMA 2E1MC 2R7RA 2CV1A 2VASA 3HC7A 1BR1A 5FRMA 2JA2A 3DKYA 4XLAA 2WA0A 1BOBA 2JUGA 4PUSA 2KPMA 2R4GA 2HVRA 2FUG2 1OR7C 2IGNA 2QKLB 1PJRA 2VQLA 2IS2A 4HNUA 3K10A 4C9YA 3EUAA 1MMNA 2VJJA 4RM2A 2Z2SB 1D1CA 4J01A 1Z3YA 2P0WA 4BJ5C 2NOJB 4XM3A 3LSKA 4B44A 1WJCA 2QKMB 4Y4RA 2HU9A 2IS4A 2HZDA 4BXFA 3MMYB 2KLOA 4YEJA 3L2UA 1N75A 2IGKA 2ZSHB 4KT6A 3W2WA 1D0ZA 2MABA 1DGRM 4E7IA 2RQQA 3BC8A 3K4KA 4ZDLA 3QYFA 2A5WA 3TL4X 4B3XA 1SAUA 3OIPA 3UNGC 4DOZA 2CMPA 3PSIA 2WAQA 1X4OA 2I8DA 1BR2A 2F6CA 3FBNB 1X4PA 4LIUA 3VSKA 3PNTA 3HXLA 2Z1DA 4BJTA 3DTEA 4PJMA 3LL7A 1UG0A 2UUZA 3BLYA 4BL0B 3TMOA 4E6KG 2OC6A 1T95A 2XF7A 4AYBA 3DWLE 1WFXA 1WJ5A 1X1CA 2LG4A 4RMNA 2VJ5A 4HSTA 3K4MA 3HG9A 3H9GA 3HOTA 4RLQA 1T0FC 2IS6A 4DGWB 2BVLA 3VYUB 2ZXIA 2DT7B 4CCLA 2M7BA 2MFZA 2OUMA 4BQNA 2W00A 2XSJC 4N4OB 2L2OA 3OYHA 4XNFA 1SFKA 2VKHA 4C2UA 3C2GA 3DPUA 3ZCOA 3PSFA 3LSIA 4BU2A 4BJ6C 3M1CA 4F52A 1N77A 3SEQA 2L9NA 1MNDA 2GOXB 4IKFA 3A1YA 3DPLC 3W2AA 2CFOA 2CH0A 2X1CA 3KEYA 3ZGKA 1QHGA 4BGDA 3HPGA 4NC8A 4PJJA 4HEA2 4F55A 3A4CA 1AA7A 5KCMA 2UWMA 2R7SA 3FKJA 4AVZA 2ZSIB 1QHHD 3OYCA 2XF6A 3LMMA 3OYNA 3CESA 2LY1A 4ANJA 1UAAA 2HVSA 1V5EA 3ONQA 4E7HA 3CF2A 3CJRB 4E7SA 4ZYAA 3GBGA 2W82A 1P9QC 3K4NA 5CPRB 4BS9A 4CCKA 1G59A 2ZXHA 2K5CA 2HVQA 3H5NA 3PNVA 3AKZA 1TZLA 4H4KC 1FMWA 3H35A 4QPQA 3OYKA 1GLNA 3H5AA 2M0MA 5FROA 3OYBA 1TT0A 4RLFA 3RSNA 2W1OA 3CZ6A 3HL2A 2HPMA 3I9V2 4B47A 4XN3A 3PJRA 3OYJA 4NUBA 2WAFA 3BCBA 3UR3C 5LFAA 4XMYA 4RM3A 3H9QA 2VL8A 4F92B 2CV2A 4BEHA 3PL8A 4B48A 1W36C 4LITA 3EUKL 2HDWA 3OYIA 3VWBA 4IZZA 3BG7A 4BACA 5KHDA 4BDYA 2BVMA 3W2VA 4E7ZA 3LSHA 1K6YA 4PFPA 2PMZA 3OR2C 1WJDA 4IQJA 4PSXA 3BG6A 1JI8A 3ZR8X 3KYLA 3H0DA 1DP3A 1YX3A 3S3MA 3PUBA 3H5RA 3E0JB 4ZJZA 1KONA 4XR6A 1D1AA 2VQGA 2BOLA 2PJRB 3BCAA 4BE1A 2VJ4A 2W4SA 4OWRB 2Y0SA 4CH7A 3M8JA 2VXZA 3QYBA 2XF5A 2Z16A 3EUHC 3VDXA 4AU7A 2XC7A 2DXIA 2R7VA 2CW7A 4DBRA 2WADA 2CS3A 1ERDA 2XAUA 5HOOA 4XLEA 3D5SC 3S32A 5LD2C 3PNYA 1WJEA 2LYCA 4NC7A 3SDBA 2DCEA 4GRIA 2CUZA 2A6TA 4CCNA 2E5NA 3HKZA 4XN0A 4F3QA 1U0JA 1LVKA 4C2TA 1OLTA 1BR4A 3RQ4A 1YX5A 2BW3B 1MMDA 3OR1C 4E7JA 1X19A 3S3NA 2MYSA 5JHFA 2WY7Q 4XOPA 4BQOA 2LBFB 2LOOA 3OYFA 3ZXSA 3OS2A 4F93B 4U7BA 1D1BA 2X1EA 4B43A 2WBMA 3K70D 2LRDA 2R7XA 3G2BA 2X6WA 1NG6A 1G8XA 4BEHB 3CJQB 3ZRGA 2E5ZA 1PYVA 2F5VA 3S3OA 3F9KA 4N4NB 2X1DA 4Y3OA 2X6XA 3OYAA 3MKZA 4HRIA 3AL0B 4ZDPA 2OV7A 2R7UA 2X6YA 3PFYA 3QYEA 2VJIA 3QOEA 1YE9A 2DOAA 2E60A 2V1NA 3RCOA 5HLTA 3K4BA 4PSWA 3AFHA 2R7OA 2GOMA 5FRNA 1IRXA 2HNHA 2LREA 3OYMA 4HPQA 3SZGA 4XQFA 3DPTA 5HNFA 4HSRA 4XOTA 2AQFA 1MMGA 2KL4A 4OAZA 3DKXA 4XL9A 4ITVA 2R7WA 4XONA 2MD0A 2VKDA 3OMYA 4E7LA 1WJBA 4YRVA 4CUGA 3MKYB 3L2QA 2K3PA 3RPUD 4EATA 2IS1A 1S9HA 2KP6A 3HPHA 4XKCA 2V7FA 3MKWB 4XKVA 2R7TA 2HQAA 4JQFA 1X1BA 4CZCA 3S8PA 3EPZA 2IXSA 4XLHA 3OYDA 3K4JA 3FBIB 2KMUA 2X51A 2RNGA 4OAYA 3VSLA 1X1AA 3J7AY 3LSMA 2UV1A 4R79A 2AQEA 3DEEA 4D9JA 5CKTA 4E4HA 3AL0C 3DU6A 3CMMA 2HPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LC2 A;  3ZGK A;  3ZR8 X; 
#chains in the Genus database with same CATH topology
 5GAG J;  2EZH A;  2ID3 A;  1MGT A;  3IUO A;  3QOP A;  5F04 A;  4BAY A;  1BI3 A;  2XHK A;  1TW2 A;  2IA2 A;  3N05 A;  1VZ0 A;  3BG9 A;  2A6E F;  1NK3 P;  4ENJ A;  4BNC A;  1R22 A;  2IVM A;  3L1P A;  1Y56 A;  2ETH A;  3HHG A;  1OKR A;  2E36 A;  3AG2 H;  3GTJ J;  1HA8 A;  1DGW Y;  1DP7 P;  4F91 B;  2LH9 A;  3HOS A;  2V1D A;  1LFP A;  4XKB A;  3ZMD A;  4A3L J;  4D7N A;  4G7H F;  4ZDO A;  3FXQ A;  3W3C A;  1QGP A;  1QU3 A;  1XG1 A;  2FOW A;  2MC3 A;  1R6R A;  4AWX B;  3N4M A;  3JRC A;  1JGS A;  1MMA A;  3MEX A;  4PK4 A;  2Q2E A;  3OL3 A;  2ISY A;  4P5O A;  4MHG A;  3ZN1 A;  2Z33 A;  2A68 F;  3F6V A;  4LG3 A;  2KHM A;  1SFO J;  4L9T A;  1HOM A;  3DEU A;  3KEO A;  2KIF A;  3OSG A;  2DA7 A;  4CDG A;  1B59 A;  4FET A;  5BPD A;  2O03 A;  3GLL A;  2XKO A;  5HS8 A;  2L7K A;  3L2V A;  1JUS A;  4V2G A;  5LEJ A;  2X0L A;  1MBE A;  2JVH A;  3C2H A;  1NK2 P;  5M5Y J;  1WH7 A;  4G6T B;  4R1H A;  1JKP C;  1DQU A;  2TCT A;  3BTC A;  4IOA F;  2L9S A;  3QPL A;  4DJA A;  3F23 A;  3MWM A;  3CCJ I;  1ZAR A;  1P6R A;  2KJC A;  2WY8 Q;  3WU0 A;  2CW8 A;  3OYE A;  1I6X A;  1JUP A;  2V4J C;  3H36 A;  3TW6 A;  4HV5 A;  2O6G E;  3SFZ A;  3IP4 B;  2MLK A;  2LC2 A;  5J6X A;  2P5L C;  1XGM A;  4U87 A;  1TQI A;  3NEU A;  2FML A;  3W6K B;  5CVV A;  3J7A O;  2DDA A;  1XCV A;  3FDY A;  3I58 A;  3FF5 A;  1WWX A;  4D0P A;  1NG7 A;  3P9K A;  4KJZ A;  1HKS A;  4P9F A;  5J4V A;  2DTR A;  3JRG A;  1RUO A;  3OS0 A;  1J9I A;  2O0Y A;  4ZZD A;  3LQR A;  2JRM A;  4KN4 X;  3GVA A;  2GXB A;  2WB1 N;  2ID6 A;  3HOY J;  4U0W A;  3TKY A;  3MZH A;  2Y0M A;  2H8R A;  3IAS 2;  1LJ9 A;  3WG9 A;  5FD5 A;  4NQW B;  3JRD A;  2LVS A;  3OYG A;  4CHU A;  4BE2 A;  4CCJ A;  2DQL A;  3FHN A;  1R1V A;  1XB4 A;  3FXL A;  1A6I A;  3TP0 A;  1VQL I;  1FIA A;  1F43 A;  1YIT I;  2M0C A;  1IXC A;  4RAG A;  3GF2 A;  1BW5 A;  5CJ9 A;  2A6H F;  3J7Y J;  3CUO A;  2W25 A;  2WWY A;  2IT0 A;  4HBL A;  2Q1Z B;  2R7F A;  1JUM A;  3FKI J;  1FTZ A;  3CCL I;  1QBJ A;  1IN6 A;  2LFB A;  2VOO A;  1R5I D;  3K9T A;  4XIC A;  4ZTJ A;  1FPQ A;  3PUF A;  4WK8 F;  1YI2 I;  4A2U A;  1KYW A;  1U5T C;  2L4M A;  2BW3 A;  4OIN F;  2BY2 A;  4KIC A;  3JSP A;  4BQQ A;  3K6G A;  2YU9 J;  2VKE A;  1SD7 A;  2LBF A;  2LTP A;  4G8X A;  2R7R A;  1RET A;  5EJC A;  2QQ8 A;  1PVE A;  3ZQC A;  2KIS A;  1A04 A;  1SFX A;  4EGY A;  4M73 A;  2I5U A;  2CQX A;  1MBF A;  5J1Y A;  4RB3 C;  2XSD C;  1E3O C;  5DTD A;  3TOA A;  2RNJ A;  2IGN A;  2P81 A;  3KP6 A;  4ZH4 F;  1XDU A;  5K7F A;  1R1U A;  4UUS A;  2COB A;  4A3J J;  1AKH A;  3LA2 A;  5D8K B;  2PG4 A;  2PEX A;  2AO9 A;  5GPA A;  3CLO A;  1B4A A;  3LSK A;  2X6O A;  2LNB A;  3BDD A;  4Y4R A;  3SXY A;  2IS4 A;  4PJ0 C;  3CCQ I;  3E5X A;  3JRE A;  3DXJ F;  3M9A A;  3ZQG A;  1IV8 A;  2DK5 A;  1FY7 A;  1S7O A;  5FLM J;  5DD8 A;  5A2Q Z;  1DGR M;  2FSW A;  5J1U A;  2K27 A;  2PX9 A;  2O8K A;  3WU2 C;  4UVA A;  5CVR A;  4OU0 A;  2CMP A;  3VEP A;  5DUI A;  2DI3 A;  1B72 A;  2ZME C;  2OQR A;  3LFK A;  2BHZ A;  2I8D A;  3P7N A;  4AVP A;  2Y0S N;  1C0W A;  4LIU A;  1I1G A;  3PNT A;  3VSK A;  2B0L A;  4BJT A;  3DTE A;  4AD9 A;  3TO7 A;  3F21 A;  4BL0 B;  3TMO A;  4E6K G;  3V8L A;  5J8F A;  5KAF C;  1ZG3 A;  1WFX A;  1WJ5 A;  3DWL E;  3V7C A;  4HST A;  1Q1V A;  1ZHF A;  1OCC H;  3HG9 A;  3CCS I;  1RKW A;  5FLX Z;  2QBY A;  4IHS A;  4TV7 A;  3GFJ A;  3GW2 A;  3VYU B;  2ZXI A;  4AYB N;  5B66 C;  2M7B A;  4M9X A;  1CGP A;  2DOF A;  2GBY A;  3CMA I;  2NS7 A;  4G9Y A;  2A61 A;  3G1L A;  5J1R A;  5DS9 A;  1X2N A;  2VKH A;  4C2U A;  1IG7 A;  1GXQ A;  3BPX A;  3NRV A;  4QWQ A;  3PO3 J;  4NHJ A;  4ESB A;  4BJ6 C;  3CQZ J;  2L0K A;  1ZGJ A;  1H88 C;  1XSD A;  2JK3 A;  2F4M B;  1IUY A;  4L18 B;  2ADU A;  3SEQ A;  2DFH A;  2L9N A;  3IRQ A;  2F2E A;  3W2A A;  2CH0 A;  1HW5 A;  3ZGK A;  1QHG A;  3HPG A;  3J81 Z;  3A03 A;  1MBG A;  3CJT B;  1VQP I;  3HTU A;  2R7S A;  3FKJ A;  1U2W A;  4WX9 A;  1QHH D;  3LMM A;  3OYN A;  2ESN A;  4ESJ A;  2NVU B;  1MD0 A;  3AG3 H;  5F0C A;  4PZJ A;  2EZI A;  4YG2 F;  3BG3 A;  4N0B A;  3WTZ A;  1R7J A;  5IOZ A;  3CJR B;  4OMY A;  4E7S A;  2PMU A;  5E20 A;  5CVJ A;  3PFI A;  1P9Q C;  4DNC A;  3REO A;  3SJM A;  1EV7 A;  2CQK A;  4NBQ A;  1OYI A;  2K5C A;  1T8I A;  2NS0 A;  2FQ4 A;  3FK7 A;  3B02 A;  2G9W A;  3HRT A;  4OIO F;  3JSO A;  1GHC A;  3KP2 A;  3RJP A;  2OJE D;  3R6S A;  4YII A;  2M0M A;  2DMN A;  4JX5 A;  5BOX A;  3DFG A;  2Y9Z A;  4RLF A;  1HKT A;  5FKL A;  1X58 A;  3I9V 2;  3SQN A;  2FNA A;  5DCM B;  1VQM I;  2OZ6 A;  5EYR A;  1HC8 A;  4Q5S F;  5GAD J;  1QA6 A;  5LFA A;  3UR3 C;  1N25 A;  4RM3 A;  3H9Q A;  2CV2 A;  2XGX A;  3S2W A;  4B48 A;  4EVI A;  1W36 C;  3F22 A;  4LIT A;  3KFW X;  2HDW A;  4RAY A;  4IZZ A;  3BG7 A;  4BAC A;  4BDY A;  3W2V A;  3WGH A;  4PFP A;  3I5U A;  1HW1 A;  3D0S A;  1RPW A;  4XRF A;  1WJD A;  1XSV A;  4PSX A;  3QU6 A;  3BG6 A;  1JJ6 C;  1S5L C;  1WQ2 A;  4IO9 F;  2L01 A;  2EIL H;  5E1Z B;  2BOL A;  2K7L A;  1IDZ A;  1J7K A;  3BCA A;  4HQE A;  3FXR A;  2B63 J;  2M45 A;  4RAZ A;  3HOX J;  2VJ4 A;  4EM2 A;  2ME6 A;  4CZZ A;  4OWR B;  3OV8 A;  4EJT A;  2Y0S A;  4CH7 A;  3M8J A;  2DU9 A;  5D6F A;  3HGY A;  4Y13 A;  4FTH A;  3OIO A;  4N9I A;  2VI6 A;  3FXM A;  2ZJP F;  3EYI A;  3WGI A;  4DBR A;  2YS9 A;  4AUX A;  1XN7 A;  2LP0 A;  1UB9 A;  2C6Y A;  5GPC A;  1ZKG A;  3IWF A;  1ON1 A;  3PIO F;  2GLO A;  2M1B A;  5DCF A;  1FOX A;  2JA8 J;  2DCE A;  2CUZ A;  4CCN A;  4I6Z A;  1FP2 A;  2E5N A;  2LF8 A;  2XUB A;  1SD6 A;  3HKZ A;  2CUE A;  4XN0 A;  1UHM A;  5AIQ A;  5DUK A;  4F3Q A;  4G6Q A;  4A6E A;  2DN0 A;  3MZY A;  1NTC A;  2W57 A;  3B6A A;  1J75 A;  2A05 A;  3PM1 A;  2ZME A;  2L54 A;  3WE3 A;  5CVI A;  1G4D A;  1QVU A;  1J0R A;  5IYB J;  1YJN I;  1MZB A;  2CQN A;  5L3C A;  4UB6 C;  4LB6 B;  5HLI A;  5GTH C;  3CUQ A;  1RRJ A;  4HX7 A;  3CO7 C;  2DYS H;  2X1E A;  4B43 A;  2WBM A;  3K70 D;  2LRD A;  3CDL A;  1ZR4 A;  2RVC A;  3QQA A;  4CO8 A;  4LGW A;  1H9T A;  1DU0 A;  2FF4 A;  1PYV A;  1YIO A;  4FE4 A;  2EV6 A;  5ILV A;  1G6N A;  3RKQ A;  3ZMU A;  4JX6 A;  9ANT A;  2OV7 A;  3PFY A;  2R7D A;  2X48 A;  2HWV A;  3QOE A;  4FT8 A;  2E60 A;  2V1N A;  2ELK A;  2WTE A;  4JP0 A;  2QF7 A;  1HLV A;  5E3N A;  5D8L B;  2GOM A;  3R0A A;  5FRN A;  3HSF A;  2WC2 A;  3DV8 A;  4NDL A;  3VB2 A;  2OU2 A;  3RPU A;  4HSR A;  4BY7 J;  4XOT A;  2AQF A;  2OQG A;  2KL4 A;  4GYG A;  4HW0 A;  1LUJ B;  4OAZ A;  3BQY A;  4ITV A;  1UMQ A;  1QRY A;  1ETO A;  2VKD A;  2NVQ J;  1Z6T A;  1B8I B;  2XAQ A;  3LSR A;  4CUG A;  3MKY B;  1GVJ A;  3U2R A;  3CF5 F;  3L09 A;  4XLN F;  2IS1 A;  1IC8 A;  3RI4 A;  2XGE A;  3HUG A;  2HR3 A;  5AON A;  2GAU A;  2NNY A;  4D5F A;  1HKQ A;  2E19 A;  3IH3 A;  3NQO A;  4UV9 A;  4CZC A;  1RI7 A;  3K4J A;  3VPR A;  5LBQ A;  2X51 A;  1QZE A;  1TWG J;  3TQN A;  1GV2 A;  5E8I A;  3J7A Y;  1LQ1 A;  1SFU A;  2UV1 A;  2AQE A;  1R5G A;  3DEE A;  4HLY A;  4IRH A;  4E4H A;  2QUF A;  2IEK A;  1D5V A;  3AL0 C;  5A2Q K;  3VOE A;  3CMM A;  2DA4 A;  3GZN B;  3C3W A;  2CSO A;  5HS7 A;  2FX0 A;  2YUS A;  3PO2 J;  1FOY A;  3TDZ C;  4JK1 X;  3DTK A;  2KZV A;  5F0F A;  2QYO A;  2EIJ H;  4IXA A;  1OYW A;  3LAP A;  1IJW C;  1OR7 A;  4CYD A;  4QLC U;  4B09 A;  4GFB A;  3QOD A;  3VYS B;  2YX7 A;  3VOD A;  2MBF A;  4IHW A;  2R7Z J;  3V42 A;  1X3W B;  2W85 A;  4S0H B;  5D5X B;  4II3 A;  2FD5 A;  1K7A A;  3E1S A;  4XOR A;  5F08 A;  5ICC A;  3CO6 C;  5FD6 A;  1LFU P;  3EET A;  1VTN C;  5FLX K;  5E3L A;  1I6H J;  3WE2 A;  2BXZ A;  2K9L A;  4BKX A;  4N9H A;  3SYT A;  4I2O A;  4FAS D;  2Y30 A;  4JX4 A;  3TDU C;  4HF0 A;  1KU7 A;  1W7P A;  1F9N A;  1R00 A;  5ILU A;  2CUJ A;  4U88 A;  3GZ6 A;  1TQP A;  3CP8 A;  4MEY F;  1RUN A;  3PQJ A;  4B8X A;  4XBF A;  4KIS A;  1FMV A;  3KX2 A;  1XGN A;  2QEN A;  5IYD J;  1U6G A;  2M7A A;  3F8F A;  5K5R A;  2OCE A;  2GQQ A;  3QAH A;  2MW8 A;  4CCO A;  3CME I;  1KU9 A;  2W24 A;  3DU5 A;  3J81 K;  4II2 A;  3K1M A;  2VQC A;  2V6E A;  3ZN0 A;  2DT6 A;  3GCM A;  3ISP A;  1UHW A;  2NRA C;  4CYC B;  3KZI C;  4LLG F;  3U1D A;  1T0F A;  2CUF A;  4BXU A;  3R0J A;  1X1D A;  3JAM Z;  4AC0 A;  1YQA A;  5ILS A;  3E6M A;  2OA4 A;  4UV8 A;  1MW7 A;  2E1M B;  5K7H A;  2XAH A;  2VXD A;  2DPU A;  3ABL H;  1TNS A;  1X3Z B;  1TP4 A;  1JTX A;  4UXN A;  3HGG A;  2NYX A;  2GIV A;  2PJR A;  3OSF A;  1ETQ A;  2P4W A;  5CQG A;  3TP3 A;  5HS9 A;  4RB1 A;  2Y31 A;  4ZC3 A;  4G12 A;  3HJE A;  1OYY A;  3BY6 A;  4B4C A;  1N78 A;  3LFU A;  2HKO A;  4P96 A;  5E79 C;  1YW9 A;  5LRS A;  2ZFU A;  3A2K A;  2M4K A;  3HBL A;  4XRS A;  3HRS A;  4I99 C;  2DYR H;  1P7J A;  3F8M A;  3NWT A;  1APL C;  3X2Q H;  1UZC A;  2MLG A;  3BQZ A;  1FOK A;  2ZJR F;  1WZ2 A;  2Q2E B;  4RBO A;  5LEK A;  2R5Z B;  3HB9 A;  2XRO A;  1A35 A;  2ELJ A;  3DTI A;  1E0E A;  3O8H A;  2TRT A;  3HZJ A;  3LNQ A;  4ENN A;  5CQE A;  3FMR A;  4BDZ A;  3F8B A;  1HDP A;  3E6B A;  4Y33 A;  5F27 A;  4J00 A;  4KMU X;  2VBX A;  3KEQ A;  1VQ5 I;  2P7C B;  5H2F C;  4BHB A;  2RN7 A;  5E3M A;  1SEU A;  4P1W A;  1WKM A;  1Z3X A;  4OIP F;  3OL4 A;  2W48 A;  2XRN A;  2HQN A;  3KP3 A;  1FEX A;  2W7N A;  1EA3 A;  1D8J A;  3D5L A;  1EF4 A;  4MQV A;  3S93 A;  4H0E A;  4YEL A;  4MLO A;  3H3U A;  2CYY A;  3HC7 A;  4M3D A;  2EA4 A;  3DKY A;  3Q0U A;  4W97 A;  2D45 A;  1TC3 C;  3MQ0 A;  2R4G A;  3KCC A;  4ABZ A;  2ZJQ F;  2FUG 2;  5LHI A;  3ZQ7 A;  3JW4 A;  3WTS C;  2DFE A;  2VQL A;  4A0Z A;  1O3S A;  3M8F A;  4EJV A;  5L3B A;  3BZK A;  3JR9 A;  1F36 A;  1MMN A;  1SC7 A;  3H1C A;  1VQ7 I;  2NAZ A;  1YTY A;  4HX8 A;  2BY1 A;  4XM3 A;  1Z9C A;  2W84 A;  1FZP B;  1WJC A;  1UJ8 A;  4ETS A;  3GFL A;  3E6D A;  2YR2 A;  1FJL A;  4D7M A;  2IGK A;  2ZSH B;  4KT6 A;  5M3M J;  4L0Y B;  2CG4 A;  5B1A H;  1EH6 A;  1G2H A;  2MAB A;  4E7I A;  1FT9 A;  2HOA A;  4GO1 A;  4FX4 A;  3K4K A;  2XVC A;  3QYF A;  2A5W A;  3TL4 X;  4B3X A;  3EUH A;  2EV0 A;  3BOQ A;  1YJW I;  2PN6 A;  3K69 A;  3WG7 H;  2WAQ A;  5F0H A;  2PI0 A;  2P7V B;  2VT2 A;  4IHY A;  1BW6 A;  3BJO A;  2F6C A;  2V1U A;  2NS8 A;  4O3M A;  2Z1D A;  2RQP A;  2X9D A;  4DYR A;  3LL7 A;  1UG0 A;  2QQ9 A;  1SFE A;  2UUZ A;  1Y39 A;  1V54 H;  3BLY A;  1Z6R A;  2JRT A;  5TRD A;  4HF1 A;  2LR8 A;  3G1M A;  4RMN A;  3FHZ A;  3DP7 A;  1LE8 B;  1PUF A;  4UB8 C;  2RDP A;  2ME0 A;  3H9G A;  5D5U B;  2NOG A;  4RLQ A;  4KT5 C;  2DFF A;  4BHC A;  4ON0 A;  2DW4 A;  3BWG A;  1IUF A;  2H8W A;  3QWL A;  3ASO H;  4BY1 J;  1Z77 A;  3CCY A;  2E34 A;  3A0B C;  5J47 A;  3BZ6 A;  1T2K A;  4BQN A;  5LGN A;  1BI2 A;  1IRF A;  1IN4 A;  3LA7 A;  4BYY A;  1SFK A;  1PUE E;  2OD5 A;  2JT1 A;  4XSX F;  1QQI A;  5C4X J;  1MNM C;  3L7W A;  3ZCO A;  3MKL A;  1P4W A;  4R8H A;  3GTO J;  4BXX J;  4BU2 A;  3HRM A;  1T56 A;  1SD5 A;  4RGR A;  1MND A;  1I39 A;  2GOX B;  4IKF A;  3DPL C;  1AU7 A;  2X1C A;  2DDB A;  1TWH J;  2BV6 A;  1BI0 A;  2ZKZ A;  5M5X J;  5JHU A;  1AA7 A;  5KCM A;  4ZYD A;  5BPI A;  1XPX A;  1VQ6 I;  4AVZ A;  1E3H A;  4KUM A;  1REP C;  2ZSI B;  2EZL A;  2XF6 A;  3GLX A;  4NC6 A;  3I0T A;  1U3E M;  1QZZ A;  2LY1 A;  3WTY C;  2QA4 I;  2HVS A;  1KQ0 A;  1Z91 A;  3ONQ A;  2TDX A;  1TNT A;  2HTJ A;  1OCO H;  2FU4 A;  1ACI A;  3K4N A;  2NXN B;  5CPR B;  4CCK A;  4BS9 A;  1G59 A;  4GCV A;  2ZXH A;  4U0Y A;  3H5N A;  2XAG A;  3C18 A;  1TZL A;  2BE5 F;  3E97 A;  2PFB A;  4V19 K;  5L3G A;  5B3S H;  4MFD A;  1O7F A;  3OYK A;  3ABM H;  4EJO A;  3H3V K;  4W1U A;  3EYY A;  2UXX A;  3OYB A;  1ZG1 A;  5ICG A;  3HRU A;  4B47 A;  5LRR A;  3PJR A;  3GTQ J;  2VN2 A;  1OCZ H;  1FC3 A;  4NUB A;  1VQO I;  3T0Y A;  4HF2 A;  3HM5 A;  4G7O F;  4HV6 A;  2HDD A;  4A5N A;  4A3D J;  2VL8 A;  4L5I A;  1S72 I;  3HIF A;  3PL8 A;  5HOD A;  2QBY B;  3EUK L;  4RB0 A;  3S17 J;  5KHD A;  2VKV A;  2BVM A;  1Q1H A;  2F5E A;  3OR2 C;  2R92 J;  1IAW A;  1JI8 A;  3ZR8 X;  3H0D A;  1QPM A;  1YX3 A;  2IRF G;  3S3M A;  1K78 B;  4ZJZ A;  4XR6 A;  3IWZ A;  1D1A A;  1FOW A;  1WSU A;  1BJA A;  1TT5 B;  5HDG A;  3S1M J;  1YO5 C;  4NQW A;  3ASN H;  3CCM I;  1B9N A;  3RKW A;  1T38 A;  4DZP A;  3FMS A;  3QYB A;  1W0T A;  1JT6 A;  2O3F A;  5ERI A;  1BN5 A;  4UHT A;  4EM0 B;  4HNV A;  2CS3 A;  5B1B H;  2XKP A;  5HOO A;  4XLE A;  4M9S A;  3CCU I;  1H89 C;  2F5C A;  3D5S C;  3Q5F A;  1I5Z A;  1V4R A;  3GEZ A;  3JAM K;  3IRR A;  2RV8 A;  3GTK J;  1ENH A;  2I10 A;  1WJE A;  2LYC A;  1D3Y A;  3RIR A;  4GRI A;  2QQA A;  1JHH A;  3VFZ A;  2DMU A;  2YX4 A;  2L7Z A;  2F5F A;  1XGO A;  1RC9 A;  3CD6 I;  5HLG A;  1HST A;  2HXO A;  2LK2 A;  2H94 A;  1MJ9 A;  1MMD A;  3GZ5 A;  1BOA A;  1X19 A;  1ZH5 A;  3NAR A;  5ICF A;  4KYW A;  4XOP A;  2NVX J;  1KU3 A;  3QU3 A;  4HLX A;  3TGN A;  3HKZ N;  2KZG A;  3CCV I;  3I4N J;  1CF7 B;  3AG1 H;  1O7L A;  1LEB A;  2CWE A;  3HOV J;  2H09 A;  3OYF A;  3OS2 A;  1VF9 A;  4RB2 C;  2DAO A;  4XK4 A;  3GFM A;  4G7Z F;  3K2Z A;  3RDI A;  2R7X A;  1G8X A;  2LMD A;  1E3P A;  3CJQ B;  1RES A;  2F5V A;  3JTH A;  1GUU A;  4RGS A;  3SFI A;  1R58 A;  3S3O A;  5F1R A;  3W6V A;  2X1D A;  1MDM B;  3OYA A;  2VON A;  5M5W J;  5DD4 A;  2F5D A;  1Z1D A;  2K9Q A;  4JBA A;  5IP9 J;  1UST A;  3F6O A;  2R7U A;  2X6Y A;  1R5H A;  1JGG A;  2JQ7 A;  2VJI A;  1YE9 A;  3ABT A;  2EV5 A;  3BJ6 A;  5HLT A;  1FIP A;  1O4X A;  4FHT A;  3MVP A;  2ZBK A;  3GTM J;  4WCG A;  2VOD A;  2KFD A;  1IRX A;  2LRE A;  3A0H C;  4HPQ A;  3SZG A;  3FK6 A;  4S04 A;  4XQF A;  1LEA A;  1J2X A;  3DPT A;  2FXA A;  5E1X A;  3I56 I;  2E71 A;  3ECO A;  3DKX A;  3I59 B;  2R7W A;  1AOY A;  4MQ9 F;  3KIO A;  3E7L A;  1WJB A;  2Z9O A;  2HFH A;  1W5T A;  2DO7 A;  3L2Q A;  3GTL J;  1O3R A;  2XPU A;  2D1H A;  2K3P A;  3RPU D;  3MZ8 A;  5K5O A;  5EZH A;  3HTS B;  3H0G J;  3WHC A;  5C4J J;  1OCP A;  3WTV C;  2KP6 A;  4XKC A;  2V7F A;  1A6Q A;  3MKW B;  3CCE I;  1CQT A;  2EIK H;  4XKV A;  2VT3 A;  3CC2 I;  1X1B A;  4RGX A;  1Y0N A;  3OYD A;  1P4A A;  4EQQ A;  2P5K A;  1YOV B;  4OAY A;  1U5T A;  3VSL A;  1X1A A;  3Q0V A;  4Q4Z F;  2DA3 A;  3H3Z A;  5K7Z A;  1S29 A;  4FCY A;  2DK8 A;  1T33 A;  5TIS C;  5AIP A;  2V6C A;  3W6J B;  2V1X A;  3G71 I;  2HPI A;  5HVQ C;  4RGU A;  2K02 A;  1TWF J;  4E7K A;  1S7A A;  1BIB A;  2L7M P;  1IV6 A;  4OIQ F;  2L4A A;  3CUQ B;  2ZNZ A;  4DBQ A;  4PJL A;  3BT9 A;  1V5G A;  5EG0 B;  4JYK A;  3ZMT A;  4UNO A;  3RPQ A;  2XRL A;  5IT9 K;  5D4R A;  2CJJ A;  2EIN H;  4KMF A;  2R7Q A;  4HG2 A;  3BTL A;  4DZJ A;  4HNT A;  4L9N A;  3QRF F;  1HCR A;  3BG5 A;  3A02 A;  3OWT A;  1X2M A;  3L9F A;  2DA5 A;  2AXL A;  2M5W A;  1W36 D;  5JI6 A;  4M3B A;  1ZN2 A;  2MA3 A;  4CA0 A;  4KIT B;  1HDD C;  1NH3 A;  3K2A A;  2A07 F;  5LGT A;  2QVO A;  1LDK B;  3ABK H;  1TQM A;  5F6F A;  1O3T A;  3B6C A;  2CO5 A;  1K78 A;  2LF7 A;  3OS1 A;  1K6O A;  3IC7 A;  4MTD A;  4L5J A;  2DPD A;  3L2R A;  3U21 A;  1A31 A;  5CYV A;  2KRH A;  2X85 A;  5EEH A;  3P9I A;  2FA5 A;  3DCF A;  5C3E J;  2XIG A;  1QPI A;  3MD2 A;  1TTY A;  3O8G A;  1L3L A;  3IKT A;  3K70 C;  5L3D A;  2BY0 A;  1OIS A;  3BR3 A;  4Z6Y A;  4A3K J;  3S1Q J;  3HUG B;  2K3F A;  4ENM A;  1R1T A;  5DCM A;  3J7Z I;  3TED A;  2E1N A;  4IQ4 A;  3RTR A;  4PDK A;  3IL2 A;  1FSH A;  1LVA A;  2DA1 A;  5KVR A;  4UUT A;  5E18 F;  3K4L A;  1G3Y A;  5L3F A;  2K9N A;  1DPR A;  2J5O A;  4A69 C;  2MD5 A;  3FXK A;  4A3C J;  2Y75 A;  3F8N A;  3TO6 A;  3HDD A;  2KT0 A;  2D5V A;  5JVG F;  1BL0 A;  2OBP A;  5GAE J;  2EFW A;  3DF8 A;  2L5Q A;  1R36 A;  2DQR A;  2D2W A;  3GME A;  2M3A A;  2ZXW H;  3ML6 A;  2FBI A;  4AIJ A;  5HNH A;  3L2W A;  1ZEL A;  1LKX A;  4XSZ F;  1W5C C;  4QPO A;  1YW8 A;  4AIK A;  4ZTF A;  2CV0 A;  2P8T A;  1GVD A;  3A01 B;  1QVT A;  2QSG X;  3GTP J;  2LSO A;  2P6S A;  5FFZ A;  4JOM A;  1I50 J;  1RZ4 A;  2KDO A;  2CRG A;  4L9V A;  3HEF A;  1I1S A;  1OCR H;  1YIJ I;  3FXU A;  2M4G A;  2FBK A;  2M87 A;  4FX0 A;  1R4N B;  3KPH A;  3OYL A;  2D1V A;  5KK1 A;  2R5Y A;  1D0X A;  3GFI A;  2KQR A;  3BZC A;  1IO2 A;  2IBD A;  3VYT B;  3JRF A;  2LY2 A;  2YPR A;  4RS8 A;  4XID A;  4A6D A;  1W5S A;  4A3I J;  1D8K A;  3WGG A;  3OOU A;  3CP2 A;  1B9M A;  3GX4 X;  2VLA A;  4P55 A;  2VB6 A;  3TOB A;  1Y6I A;  3K4C A;  1GDT A;  3DLA A;  4LJZ F;  1S8N A;  5J3L A;  1QZY A;  4LIV A;  2IGO A;  4AIH A;  1G3S A;  4A3E J;  3OIQ A;  1WJF A;  2K9M A;  5CLS A;  3ZQH A;  1FBQ A;  1FNN A;  1OMI A;  2IGM A;  2E1M C;  2GM4 A;  3OOP A;  1ZGW A;  2NVT J;  1BR1 A;  2HEO A;  2IA0 A;  2AXT C;  1K4T A;  3QPT A;  2DTZ A;  5ED4 A;  2JUG A;  1IDY A;  1SMT A;  2JA5 J;  2JWT A;  2KPM A;  1V3F A;  5JVT A;  3CDH A;  5TJJ A;  5D5V B;  1OCT C;  2HVR A;  4M6Y A;  5JFR A;  4P9U A;  1O3Q A;  2IS2 A;  1Y8R B;  3MAJ A;  3L00 A;  4RAF A;  1EKE A;  3EUA A;  3JRH A;  1BBY A;  4RM2 A;  2E7W A;  1I3Q J;  1Z3Y A;  4QIW N;  3DEW A;  4BJ5 C;  2K4J A;  2EB7 A;  4LG0 B;  2JPB A;  3P9C A;  5HDN A;  1VQN I;  5EGO B;  6PAX A;  1SVO A;  4YEJ A;  3L2U A;  4YIF A;  1N75 A;  1TWA J;  2ZCW A;  3FX3 A;  1RR8 C;  2PMZ N;  5LHG A;  1D0Z A;  4A3B J;  1Z7U A;  2E7X A;  1STZ A;  5H20 A;  5FJ8 J;  2YU3 A;  2RQQ A;  3BC8 A;  2GA2 A;  1BC7 C;  2Y69 H;  2PLY A;  1G3W A;  3OIP A;  4DOZ A;  5D4S A;  1B8I A;  1ZRF A;  2FBH A;  4MTE A;  2VBY A;  1MJB A;  1UHS A;  1X4O A;  1WVR A;  2ZNY A;  1X4P A;  3HXL A;  1L0O C;  2K4B A;  2QGU A;  5JLX A;  1WI3 A;  2QSF X;  2NVY J;  1YS7 A;  2FE3 A;  3ZQL A;  1WHU A;  2WAQ N;  2KIM A;  4HQM A;  4L0Z B;  1T95 A;  2XF7 A;  1XMA A;  3TW7 A;  2ZFW A;  1X1C A;  2LG4 A;  2EBI A;  2EPF A;  4GDF A;  5LGU A;  3K4M A;  2KIU A;  3HHH A;  2JN6 A;  2MSY A;  2K86 A;  4KIB A;  4IRG A;  1KQ8 A;  1LB2 A;  2ESH A;  2YSR A;  2OZU A;  3GO5 A;  4A3F J;  2IS6 A;  1XDS A;  3LSJ A;  4OMZ A;  3PQK A;  4DGW B;  2ZO4 A;  1ETK A;  2G7U A;  5FLV A;  2F4O B;  2DT7 B;  3IKV A;  4I02 A;  2EFP A;  1WPK A;  2OTL I;  5FGM A;  1G3T A;  2UXN A;  2W00 A;  2XSJ C;  1SMY F;  1ONV A;  3OYH A;  4XNF A;  2XB0 X;  3GYH X;  3C2G A;  3HOZ J;  1QO0 D;  3PSF A;  2VBW A;  4ASN A;  1RR7 A;  1VI0 A;  3M1C A;  1D5Y A;  3BR5 A;  4F52 A;  1N77 A;  2EH3 A;  4PGH A;  3IH2 A;  5D6E A;  3BRO A;  3F8C A;  4HDV A;  2CFO A;  3KEY A;  3LQQ A;  1OJL A;  4BGD A;  5J4Y A;  3LSP A;  1ZLK A;  1ZLJ A;  3JRA A;  1YRN A;  3A4C A;  2HYG D;  2M8E A;  1KYZ A;  3M8E A;  1BA5 A;  2LKP A;  4QSH A;  4ANJ A;  3I54 A;  2JMW A;  1TLH B;  5IPA A;  5GTI C;  4IL6 C;  4E7H A;  5FKK A;  1JKO C;  3N97 A;  3E3V A;  2RC4 A;  1KQ9 A;  2KIQ A;  5IY5 H;  3FXO A;  4ZYA A;  2DMQ A;  2QM3 A;  5DYM A;  2W82 A;  2G7H A;  1VFC A;  1R23 A;  1FLI A;  3AKZ A;  1S7E A;  3BTI A;  4H4K C;  3H35 A;  4M9Z A;  1H8A C;  4QPQ A;  2Q8K A;  4M71 A;  4PGG A;  4IF4 A;  3FM5 A;  1K61 A;  5FRO A;  1T6S A;  1K83 J;  4LFU A;  2R0Q C;  1KGS A;  4M6X A;  4X1E A;  2K40 A;  3KET A;  2HPM A;  2O8X A;  4XN3 A;  1F5T A;  1WI9 A;  1XCB A;  2K85 A;  4GGG A;  1ZQ3 P;  2OF7 A;  2B9S A;  2WAF A;  3BCB A;  2DT5 A;  4XMY A;  1PUF B;  2OPT A;  4CYC A;  4F92 B;  4Y17 A;  3K1P A;  4BEH A;  2VE9 A;  1LPQ A;  3LA3 A;  1VQ9 I;  1J59 A;  1S3J A;  1IN8 A;  3E5U A;  3OYI A;  3VWB A;  4LK1 F;  2XAF A;  1U78 A;  5BS6 A;  3LSH A;  1K6Y A;  3U1K A;  1W0U A;  2PMZ A;  1JE8 A;  2PMH A;  2Q0O A;  1IZ1 A;  1DP3 A;  2DOE A;  1F1Z A;  3RZD J;  1FX7 A;  3H5R A;  2ECB A;  1R9T J;  2KKO A;  2VQG A;  4C3I J;  4HDU A;  2Z3Y A;  4KIF A;  4EMS A;  5H6Q A;  2RAE A;  4UVC A;  3L2C A;  5DDG A;  4BE1 A;  3HOU J;  2OAZ A;  3FWE A;  3V7S A;  3V7R A;  1JJ8 C;  2LD5 A;  2VXZ A;  2CGP A;  3IHU A;  3S15 J;  2MGQ A;  2BZT A;  2H27 A;  4I0B A;  3G6E I;  1MSE C;  4HX4 A;  1SAX A;  2WAD A;  2R5Z A;  1ERD A;  4KNY A;  2KDZ A;  2ZC2 A;  2AHQ A;  2DJN A;  2IPQ X;  4WF2 A;  1FP1 D;  5IT9 Z;  3KLO A;  2DMT A;  1Y8Q B;  2BEO A;  2IP2 A;  1ZGA A;  5LD2 C;  3PNY A;  5EZG A;  1FYM A;  4J19 A;  1ETW A;  3AG4 H;  3SDB A;  1XMK A;  1MH3 A;  2A6T A;  2HOT A;  1HF0 A;  1GT0 C;  2VUM J;  1BC8 C;  4C2T A;  1OLT A;  2L9V A;  2BW3 B;  1KA8 A;  1HBX G;  5BQT A;  2MYS A;  5JHF A;  4A12 A;  1O57 A;  2STW A;  4B3A A;  2FEZ A;  3G4S I;  4LLN A;  5D5W B;  4BQO A;  1XC5 A;  2LBF B;  5LLQ A;  1SVM A;  2HZT A;  2R3S A;  2HS5 A;  4A5M A;  2O7O A;  3ZXS A;  4IOC F;  4F93 B;  3T1B A;  1D1B A;  1Z0X A;  5EF6 A;  3G2B A;  1RNL A;  1NG6 A;  4ENK A;  1LDD A;  2QWW A;  3ZRG A;  2E5Z A;  4Y15 A;  3F9K A;  2EWN A;  2IW5 A;  4LLL A;  3IV5 A;  2X6X A;  4A0Y A;  4UUS B;  1USS A;  3MKZ A;  4EEF G;  1R71 A;  1AKH B;  1Y0U A;  3FXJ A;  3U9G A;  4Y7N J;  2WV1 A;  2XPW A;  2NNN A;  3QYE A;  3LOC A;  3RCO A;  2V79 A;  2CFX A;  4O6J A;  3T8T A;  5F1J A;  3AAF A;  1S6L A;  3KYC B;  1SAN A;  3K4B A;  4O5V A;  1BI1 A;  4AM3 A;  1Z05 A;  4S05 A;  1AWC A;  5LHH A;  2HQ5 A;  2ZXJ A;  2L7F P;  5JR3 A;  5EEG A;  4KN7 X;  2XV4 S;  4M3F A;  2M9H A;  2V9V A;  3BJA A;  2EFO A;  1K79 A;  2GXA A;  4YRV A;  1JXS A;  2BXY A;  3COA C;  4C2M J;  1U8R A;  1B72 B;  4HZF A;  4EAT A;  4QTR A;  3GWZ A;  2EA2 A;  3HPH A;  4RDU A;  2ZJ2 A;  2R7T A;  4KA4 A;  3FIS A;  4JQF A;  1LE8 A;  2DLL A;  3EPZ A;  2IXS A;  1ZAO A;  4M3G A;  2XAJ A;  1JTY A;  2M8G X;  3FBI B;  4E70 A;  1ZTR A;  2BHY A;  5FKO A;  2N8G A;  2RNG A;  1IW7 F;  2EFN A;  4R79 A;  3JRB A;  4ESF A;  1RIO H;  5E8G A;  1ETY A;  3R61 A;  4I09 A;  3DU6 A;  3ZPL A;  5FRM A;  4XRS G;  1LDJ A;  3CLQ A;  2H1K A;  2RKH A;  1BIA A;  3EQL F;  3ZQQ A;  1SD4 A;  1DPU A;  3CJN A;  3O3K A;  1A36 A;  3M1E A;  1XMX A;  4BE0 A;  3CTA A;  4DYQ A;  1PP8 F;  2JSP A;  3KLN A;  4A3G J;  1JT0 A;  2Y48 A;  1UCR A;  3G3Z A;  1YFH A;  3BTJ A;  1ON2 A;  2H6C A;  3P5J A;  2E2I J;  4OOI A;  4XKW A;  3SHF A;  3NWS A;  3DBH B;  3HSR A;  1M1E B;  1OFC X;  2VQH A;  3H9J A;  3TBI A;  4A3M J;  4Q47 A;  4M3E A;  2RGV A;  3TO9 A;  2DJI A;  1DUX C;  3LSG A;  4FQG A;  1Y1W J;  3SZP A;  2PJP A;  1MH4 A;  5IOY A;  4XRM A;  2Y2Z A;  2ISZ A;  1FBS A;  3NAU A;  4HOB A;  2LLK A;  1B1B A;  5TGT A;  5J40 A;  1MNE A;  3J80 Z;  1U9O A;  4MEX F;  2G0E A;  1Z67 A;  1JKR C;  4HYE A;  3ESW B;  2ECC A;  1ZRC A;  2JA7 J;  3KYD B;  4XLF A;  3DLL F;  3M3Y J;  4D1Q A;  1EJ9 A;  1X3U A;  1ZR2 A;  2DBB A;  2IAI A;  4I01 A;  2RRE A;  1VND A;  2P5V A;  4C30 A;  4KDP A;  2JUC A;  4XLC A;  3I3L A;  3CC7 I;  3CUQ C;  4D5C A;  3R4K A;  3D5R C;  2BGC A;  1B6A A;  1WJA A;  2FQ3 A;  2XB5 A;  5J8C A;  1D0Y A;  4I0A A;  3RZO J;  3E6C C;  5GAH J;  2GIZ A;  1U5T B;  4UVB A;  2MC4 A;  4G94 A;  2O5R A;  1J09 A;  2BBY A;  2M34 A;  2BYV E;  3SEZ A;  4CSW A;  2WB1 A;  4EJW A;  1IRG A;  3WTU C;  3H92 A;  4CCM A;  2HKX A;  4NNJ A;  4LK0 F;  1UEL B;  3ZMZ A;  2O61 A;  2V9K A;  2XDV A;  1IXS B;  3BR1 A;  3FMQ A;  3IAM 2;  3M7G A;  3VYR B;  1GV5 A;  4F7Z A;  1EH8 A;  1W4M A;  4YFN F;  3WTT C;  3JTG A;  2F4I A;  4ZYE A;  2MG4 A;  1FWZ A;  3RYR A;  1XTA A;  1BJZ A;  3FIW A;  4PFO A;  2VPL A;  2QZ8 A;  1JHF A;  3S2D J;  2LY9 A;  3IH4 A;  4M74 A;  4DIQ A;  4X0G A;  2L3D A;  3DQV C;  4DW6 A;  1T98 A;  2HXI A;  2WAE A;  2VC0 A;  4BBR J;  1TL8 A;  2V26 A;  4K2E A;  1PDN C;  1Z7L A;  2CW0 F;  3C1D A;  4C3H J;  4IX7 A;  4YFX F;  3K0L A;  2COM A;  1IXR C;  4IVN A;  1PP7 U;  1FBU A;  1DDN A;  2L9R A;  3B73 A;  2F48 A;  4PJN A;  1X1P A;  2FMY A;  3CC4 I;  2JVG A;  1POG A;  2BY3 A;  1I3A A;  1Z21 A;  4X6A J;  1MMS A;  1W1W E;  4LMY A;  3OY9 A;  4FE7 A;  1YYV A;  3F72 A;  4DYC A;  3Q9V A;  1MJA A;  3DBR B;  3CDI A;  4BUP A;  2O9L A;  5KNL A;  2ZME B;  1HXD A;  2VIX A;  5F64 A;  4XLP F;  2QLZ A;  2LKX A;  2H1L A;  5BNG A;  1V5F A;  1CF7 A;  2CV1 A;  2VAS A;  1T39 A;  1IGN A;  2JA2 A;  2OTJ I;  4XLA A;  2QCO A;  2GXG A;  1U9N A;  2X4H A;  2XAS A;  2WA0 A;  1BOB A;  4PUS A;  4WXC A;  3SDG A;  3HYI A;  2GWR A;  2HYF A;  4ZYG A;  5IT3 A;  1OR7 C;  2OCC H;  2QKL B;  2JSC A;  1ETV A;  4MO7 A;  1VQ4 I;  4RA2 A;  1PJR A;  3O2P E;  4HNU A;  3K10 A;  3ZP5 A;  1V55 H;  4C9Y A;  4EGZ A;  1RKT A;  2HOE A;  5K5Q A;  1MDM A;  3V8J A;  2VJJ A;  3SZT A;  2Z2S B;  5HDK A;  1D1C A;  4J01 A;  3UKG A;  3R60 A;  2B7E A;  4Z2Y A;  2AS5 F;  2P0W A;  2NOJ B;  5H6R A;  3WTX C;  4B44 A;  1R49 A;  4OIR F;  4IHV A;  4ZZL A;  1K4S A;  2QKM B;  2CQQ A;  2HU9 A;  4G6D A;  2HZD A;  4BXF A;  3MMY B;  2KLO A;  1UG2 A;  3Q0W A;  4I76 A;  3WHB A;  3W2W A;  3Q9S A;  1F4K A;  3CMY A;  4EJU A;  3V4G A;  3S2H J;  1ZRE A;  2DA2 A;  4ZDL A;  5B5E C;  3I4M J;  3BP8 A;  1NHA A;  1SAU A;  2QQB A;  3I59 A;  4WXD A;  3UNG C;  1HSJ A;  3D1N I;  2EJR A;  4I7H A;  3PSI A;  1AHD P;  1FYL A;  3GXO A;  4ZYH A;  2ZB9 A;  1HQC A;  1E17 A;  1BR2 A;  3QPH A;  3FBN B;  3I55 I;  1W7P D;  3I53 A;  2R5Y B;  1MKM A;  2FNP A;  2FRH A;  2H6B A;  4KIG A;  3I64 A;  1JKQ C;  1IRZ A;  4PJM A;  3LST A;  4BHP A;  2OC6 A;  4AYB A;  2M30 A;  4UY8 I;  5KAI C;  2VJ5 A;  3K1N A;  4DQ2 A;  2ACJ A;  1MSF C;  5HLH A;  2UZK A;  2R93 J;  2CQ7 A;  5DM7 F;  1U8B A;  3ECH A;  3HOT A;  4IEJ A;  1T0F C;  2EK5 A;  2BVL A;  2JPC A;  4CCL A;  2MFZ A;  2OUM A;  2EZK A;  1H9G A;  2XGC A;  4N4O B;  2L2O A;  3DKW A;  2GA1 A;  3F3X A;  1T08 B;  3DPU A;  2EQR A;  5E1W A;  5E17 F;  1ZRD A;  1R4M B;  3LSI A;  1I27 A;  2M2E A;  5EG0 A;  3ERE D;  1MBK A;  3V8K A;  2QSH X;  4GXO A;  3FZV A;  2JZY A;  1IF1 A;  1LFB A;  3A1Y A;  1XD7 A;  4AID A;  4NC8 A;  4PJJ A;  1EH7 A;  2E2J J;  1XS9 A;  4HEA 2;  4F55 A;  2JA6 J;  5L3E A;  2UWM A;  1OPC A;  2DOD A;  4BQA A;  3ROU A;  2Z99 A;  3KP4 A;  3RYP A;  5DM6 F;  3BR0 A;  1YJ9 I;  2EIM H;  2FOK A;  4I98 B;  1MIJ A;  1MBH A;  3OYC A;  4A93 J;  4CIC A;  4YIR X;  3CES A;  1UAA A;  1V5E A;  1HW2 A;  3CF2 A;  3LWF A;  2P6T A;  2Y9Y A;  1WRJ A;  1Y1V J;  3GBG A;  3BPV A;  2HGC A;  1W7P B;  2LKS A;  4U0V A;  2HVQ A;  3PNV A;  4M72 A;  3ZOB A;  1FMW A;  1IN7 A;  1QNT A;  2DFI A;  5ICE A;  3M4O J;  1GLN A;  5EDN A;  3H5A A;  1TT0 A;  2V9P A;  3KP7 A;  3GTG J;  3RSN A;  2W1O A;  2E1O A;  2VC1 A;  3CZ6 A;  3HL2 A;  1FSE A;  4UUV A;  2L02 A;  1XGS A;  2WV0 A;  3OYJ A;  4HA8 A;  4MGR A;  4IPA A;  2STT A;  5BMZ A;  3ABU A;  1KZH A;  2IA1 A;  2VBZ A;  3JCU C;  3WTW C;  3RQI A;  2J5P A;  1MBJ A;  3WOD F;  3S16 J;  4U7D A;  4EM1 A;  2KRF A;  4NB5 A;  3CCR I;  1TWC J;  1FTT A;  1E2X A;  1H0M A;  4E7Z A;  3RKX A;  5K1Y A;  3J80 K;  1YLF A;  4IQJ A;  4Y52 J;  3DBL B;  3E5Q A;  3KYL A;  1P92 A;  1ODD A;  5IP7 J;  3PUB A;  3E0J B;  1KON A;  2A5Y B;  5FO5 A;  1BM9 A;  3O6B B;  4YFK F;  5GP9 A;  1KU2 A;  3FM3 A;  2PJR B;  1YHQ I;  1P2F A;  3ERM A;  4M6V A;  3I71 A;  3MN2 A;  5DV5 A;  4IHT A;  2W4S A;  1P4X A;  4FIS A;  2E1C A;  1ZYR F;  4V2F A;  3A01 A;  5FFX A;  4WXH A;  3ELK A;  2XF5 A;  2Z16 A;  3EUH C;  3VDX A;  4AU7 A;  2XC7 A;  3LAJ A;  1YRN B;  2DXI A;  2R7V A;  1SVL A;  1TBX A;  3MCZ A;  2CW7 A;  5M3F J;  2JJ7 A;  2XAU A;  4LD5 A;  4L5E A;  4MFE A;  2EFQ A;  5FKM A;  2ELH A;  2K9S A;  5EEA A;  2KJB A;  3ULQ B;  3S32 A;  4GYI A;  3ZMS A;  3BR6 A;  4NC7 A;  2HOS A;  2DA6 A;  2IJL A;  3KZY A;  2HI3 A;  2GZW A;  1U0J A;  1LVK A;  1ZK8 A;  2A69 F;  4CGZ A;  1WH5 A;  1BR4 A;  3RQ4 A;  1YX5 A;  2PQ8 A;  1J5Y A;  3OR1 C;  4WWC A;  4E7J A;  3S3N A;  5E3O A;  2WY7 Q;  3EDP A;  2JTV A;  3GUD A;  1WCM J;  1ULY A;  2DMP A;  5C44 J;  2A3S A;  2MH2 A;  1OQY A;  2LOO A;  1ETX A;  3C2B A;  1ITY A;  3F0C A;  1FYK A;  4MNU A;  4U7B A;  3JRI A;  1UFM A;  2X6W A;  4IHX A;  5DEQ A;  4BEH B;  2E2H J;  3Q3S A;  4N4N B;  4Y3O A;  4B1R A;  2HQR A;  1XX5 A;  2HTS A;  4HRI A;  3AL0 B;  3M07 A;  3S1N J;  3ZMV A;  2XGD A;  4ZDP A;  2VE8 A;  2VOP A;  3I4P A;  1WGX A;  4LG0 A;  1GXP A;  5EGO A;  2DOA A;  5IP6 A;  2PBI A;  2HDC A;  3QP6 A;  3HOW J;  5FB2 A;  2HYJ A;  3KP5 A;  4Q48 A;  5FKN A;  4L9J A;  4PSW A;  3AFH A;  2R7O A;  1YS6 A;  2MH9 A;  4HAM A;  2HNH A;  3OYM A;  4C3J J;  2VPR A;  1YW7 A;  1A5J A;  2XPV A;  2E35 A;  4EV0 A;  1YG2 A;  5HNF A;  5CVU A;  1TW3 A;  3KZZ A;  4IRI A;  1MMG A;  2FJ1 A;  4IJA A;  5IYC J;  4MIM A;  5JLW A;  1P7I A;  3PIP F;  4XL9 A;  1IN5 A;  4BBS J;  4XON A;  2MD0 A;  3KE2 A;  3OMY A;  3T8R A;  2LDU A;  4E7L A;  1ORK A;  4A0X A;  3HSE A;  3MFK A;  2Z5U A;  4LB5 A;  3K7A J;  3S1R J;  4CXF A;  1S9H A;  3C7J A;  3RKY A;  3G1O A;  4KFC A;  1DU6 A;  1LNW A;  4BH9 A;  3G73 A;  2QEX I;  2HQA A;  4PCQ A;  3WU1 B;  3S8P A;  3QPS A;  4XLH A;  1ZG5 A;  1XSX A;  2KMU A;  2ICW G;  3BR2 A;  3LSM A;  3S14 J;  3ZQI A;  4LOC A;  4D9J A;  3ZQF A;  5CKT A;  3QP5 A;  3T5X A;  1VQK I;  2CU7 A;  1VQ8 I;  2KRC A; 
#chains in the Genus database with same CATH homology
 5HVQ C;  3IUO A;  4E7K A;  3ZQQ A;  3N05 A;  1VZ0 A;  4DBQ A;  3DTK A;  2KZV A;  4BE0 A;  4PJL A;  1V5G A;  1Y56 A;  2JSP A;  1HA8 A;  1DGW Y;  3QOD A;  4F91 B;  2LH9 A;  3VYS B;  3HOS A;  1LFP A;  4XKB A;  4ZDO A;  4XKW A;  2R7Q A;  3V42 A;  3W3C A;  3NWS A;  1QU3 A;  4HG2 A;  3TBI A;  3H9J A;  2VQH A;  1R6R A;  4HNT A;  4II3 A;  1MMA A;  3E1S A;  4XOR A;  3OWT A;  2DJI A;  4PK4 A;  3LSG A;  3OL3 A;  1W36 D;  4P5O A;  4KIT B;  4CA0 A;  4LG3 A;  1LDK B;  2KHM A;  2K9L A;  4FET A;  3SYT A;  4FAS D;  3OS1 A;  5TGT A;  1MNE A;  2L7K A;  3L2V A;  3L2R A;  2CUJ A;  3U21 A;  2JVH A;  3CP8 A;  2KRH A;  2X85 A;  3C2H A;  2KRC A;  4KIS A;  4XLF A;  1FMV A;  3KX2 A;  3MD2 A;  4D1Q A;  4G6T B;  3K70 C;  2M7A A;  1DQU A;  2RRE A;  4C30 A;  4CCO A;  3HUG B;  4XLC A;  3DU5 A;  3I3L A;  2L9S A;  4DJA A;  3D5R C;  4II2 A;  3RTR A;  4IQ4 A;  2VQC A;  2V6E A;  1WJA A;  2DT6 A;  2WY8 Q;  2CW8 A;  3OYE A;  1D0Y A;  2V4J C;  3K4L A;  3IP4 B;  2LC2 A;  2MC4 A;  1X1D A;  2O5R A;  4U87 A;  1J09 A;  3SEZ A;  4CSW A;  2WB1 A;  3FDY A;  4CCM A;  4NNJ A;  1MW7 A;  1NG7 A;  2L5Q A;  4KJZ A;  1UEL B;  2E1M B;  3OS0 A;  2V9K A;  2M3A A;  2VXD A;  2XDV A;  3IAM 2;  3VYR B;  2F4I A;  2PJR A;  5HNH A;  5CQG A;  3L2W A;  3IAS 2;  4PFO A;  1ZEL A;  1LKX A;  4ZC3 A;  2VPL A;  4NQW B;  4QPO A;  3OYG A;  1N78 A;  3LFU A;  4ZTF A;  4DIQ A;  4X0G A;  4BE2 A;  2CV0 A;  2ZFU A;  4CCJ A;  2M4K A;  3FHN A;  3DQV C;  3A2K A;  3NWT A;  4JOM A;  2WAE A;  2KDO A;  2V26 A;  1Z7L A;  2M4G A;  2Q2E B;  4IX7 A;  3OYL A;  1E0E A;  2ELJ A;  3DTI A;  1D0X A;  2Q1Z B;  2KQR A;  4PJN A;  2JVG A;  5CQE A;  4BDZ A;  3VYT B;  4Y33 A;  1Z21 A;  2LY2 A;  4J00 A;  4ZTJ A;  3OY9 A;  3OOU A;  3CP2 A;  2VLA A;  4P1W A;  2VB6 A;  1Z3X A;  1Y6I A;  3K4C A;  2BW3 A;  3OL4 A;  3DLA A;  4BUP A;  5KNL A;  2W7N A;  1EA3 A;  4LIV A;  3D5L A;  4BQQ A;  2IGO A;  3S93 A;  3K6G A;  2VIX A;  3OIQ A;  1WJF A;  2K9M A;  2LBF A;  4YEL A;  1V5F A;  4MLO A;  2IGM A;  2E1M C;  2R7R A;  2CV1 A;  2VAS A;  3HC7 A;  1BR1 A;  5FRM A;  2JA2 A;  3DKY A;  4XLA A;  2WA0 A;  1BOB A;  2JUG A;  4PUS A;  2KPM A;  2R4G A;  2HVR A;  2FUG 2;  1OR7 C;  2IGN A;  2QKL B;  1PJR A;  2VQL A;  2IS2 A;  4HNU A;  3K10 A;  4C9Y A;  3EUA A;  1MMN A;  2VJJ A;  4RM2 A;  2Z2S B;  1D1C A;  4J01 A;  1Z3Y A;  2P0W A;  4BJ5 C;  2NOJ B;  4XM3 A;  3LSK A;  4B44 A;  1WJC A;  2QKM B;  4Y4R A;  2HU9 A;  2IS4 A;  2HZD A;  4BXF A;  3MMY B;  2KLO A;  4YEJ A;  3L2U A;  1N75 A;  2IGK A;  2ZSH B;  4KT6 A;  3W2W A;  1D0Z A;  2MAB A;  1DGR M;  4E7I A;  2RQQ A;  3BC8 A;  3K4K A;  4ZDL A;  3QYF A;  2A5W A;  3TL4 X;  4B3X A;  1SAU A;  3OIP A;  3UNG C;  4DOZ A;  2CMP A;  3PSI A;  2WAQ A;  1X4O A;  2I8D A;  1BR2 A;  2F6C A;  3FBN B;  1X4P A;  4LIU A;  3VSK A;  3PNT A;  3HXL A;  2Z1D A;  4BJT A;  3DTE A;  4PJM A;  3LL7 A;  1UG0 A;  2UUZ A;  3BLY A;  4BL0 B;  3TMO A;  4E6K G;  2OC6 A;  1T95 A;  2XF7 A;  4AYB A;  3DWL E;  1WFX A;  1WJ5 A;  1X1C A;  2LG4 A;  4RMN A;  2VJ5 A;  4HST A;  3K4M A;  3HG9 A;  3H9G A;  3HOT A;  4RLQ A;  1T0F C;  2IS6 A;  4DGW B;  2BVL A;  3VYU B;  2ZXI A;  2DT7 B;  4CCL A;  2M7B A;  2MFZ A;  2OUM A;  4BQN A;  2W00 A;  2XSJ C;  4N4O B;  2L2O A;  3OYH A;  4XNF A;  1SFK A;  2VKH A;  4C2U A;  3C2G A;  3DPU A;  3ZCO A;  3PSF A;  3LSI A;  4BU2 A;  4BJ6 C;  3M1C A;  4F52 A;  1N77 A;  3SEQ A;  2L9N A;  1MND A;  2GOX B;  4IKF A;  3A1Y A;  3DPL C;  3W2A A;  2CFO A;  2CH0 A;  2X1C A;  3KEY A;  3ZGK A;  1QHG A;  4BGD A;  3HPG A;  4NC8 A;  4PJJ A;  4HEA 2;  4F55 A;  3A4C A;  1AA7 A;  5KCM A;  2UWM A;  2R7S A;  3FKJ A;  4AVZ A;  2ZSI B;  1QHH D;  3OYC A;  2XF6 A;  3LMM A;  3OYN A;  3CES A;  2LY1 A;  4ANJ A;  1UAA A;  2HVS A;  1V5E A;  3ONQ A;  4E7H A;  3CF2 A;  3CJR B;  4E7S A;  4ZYA A;  3GBG A;  2W82 A;  1P9Q C;  3K4N A;  5CPR B;  4BS9 A;  4CCK A;  1G59 A;  2ZXH A;  2K5C A;  2HVQ A;  3H5N A;  3PNV A;  3AKZ A;  1TZL A;  4H4K C;  1FMW A;  3H35 A;  4QPQ A;  3OYK A;  1GLN A;  3H5A A;  2M0M A;  5FRO A;  3OYB A;  1TT0 A;  4RLF A;  3RSN A;  2W1O A;  3CZ6 A;  3HL2 A;  2HPM A;  3I9V 2;  4B47 A;  4XN3 A;  3PJR A;  3OYJ A;  4NUB A;  2WAF A;  3BCB A;  3UR3 C;  5LFA A;  4XMY A;  4RM3 A;  3H9Q A;  2VL8 A;  4F92 B;  2CV2 A;  4BEH A;  3PL8 A;  4B48 A;  1W36 C;  4LIT A;  3EUK L;  2HDW A;  3OYI A;  3VWB A;  4IZZ A;  3BG7 A;  4BAC A;  5KHD A;  4BDY A;  2BVM A;  3W2V A;  4E7Z A;  3LSH A;  1K6Y A;  4PFP A;  2PMZ A;  3OR2 C;  1WJD A;  4IQJ A;  4PSX A;  3BG6 A;  1JI8 A;  3ZR8 X;  3KYL A;  3H0D A;  1DP3 A;  1YX3 A;  3S3M A;  3PUB A;  3H5R A;  3E0J B;  4ZJZ A;  1KON A;  4XR6 A;  1D1A A;  2VQG A;  2BOL A;  2PJR B;  3BCA A;  4BE1 A;  2VJ4 A;  2W4S A;  4OWR B;  2Y0S A;  4CH7 A;  3M8J A;  2VXZ A;  3QYB A;  2XF5 A;  2Z16 A;  3EUH C;  3VDX A;  4AU7 A;  2XC7 A;  2DXI A;  2R7V A;  2CW7 A;  4DBR A;  2WAD A;  2CS3 A;  1ERD A;  2XAU A;  5HOO A;  4XLE A;  3D5S C;  3S32 A;  5LD2 C;  3PNY A;  1WJE A;  2LYC A;  4NC7 A;  3SDB A;  2DCE A;  4GRI A;  2CUZ A;  2A6T A;  4CCN A;  2E5N A;  3HKZ A;  4XN0 A;  4F3Q A;  1U0J A;  1LVK A;  4C2T A;  1OLT A;  1BR4 A;  3RQ4 A;  1YX5 A;  2BW3 B;  1MMD A;  3OR1 C;  4E7J A;  1X19 A;  3S3N A;  2MYS A;  5JHF A;  2WY7 Q;  4XOP A;  4BQO A;  2LBF B;  2LOO A;  3OYF A;  3ZXS A;  3OS2 A;  4F93 B;  4U7B A;  1D1B A;  2X1E A;  4B43 A;  2WBM A;  3K70 D;  2LRD A;  2R7X A;  3G2B A;  2X6W A;  1NG6 A;  1G8X A;  4BEH B;  3CJQ B;  3ZRG A;  2E5Z A;  1PYV A;  2F5V A;  3S3O A;  3F9K A;  4N4N B;  2X1D A;  4Y3O A;  2X6X A;  3OYA A;  3MKZ A;  4HRI A;  3AL0 B;  4ZDP A;  2OV7 A;  2R7U A;  2X6Y A;  3PFY A;  3QYE A;  2VJI A;  3QOE A;  1YE9 A;  2DOA A;  2E60 A;  2V1N A;  3RCO A;  5HLT A;  3K4B A;  4PSW A;  3AFH A;  2R7O A;  2GOM A;  5FRN A;  1IRX A;  2HNH A;  2LRE A;  3OYM A;  4HPQ A;  3SZG A;  4XQF A;  3DPT A;  5HNF A;  4HSR A;  4XOT A;  2AQF A;  1MMG A;  2KL4 A;  4OAZ A;  3DKX A;  4XL9 A;  4ITV A;  2R7W A;  4XON A;  2MD0 A;  2VKD A;  3OMY A;  4E7L A;  1WJB A;  4YRV A;  4CUG A;  3MKY B;  3L2Q A;  2K3P A;  3RPU D;  4EAT A;  2IS1 A;  1S9H A;  2KP6 A;  3HPH A;  4XKC A;  2V7F A;  3MKW B;  4XKV A;  2R7T A;  2HQA A;  4JQF A;  1X1B A;  4CZC A;  3S8P A;  3EPZ A;  2IXS A;  4XLH A;  3OYD A;  3K4J A;  3FBI B;  2KMU A;  2X51 A;  2RNG A;  4OAY A;  3VSL A;  1X1A A;  3J7A Y;  3LSM A;  2UV1 A;  4R79 A;  2AQE A;  3DEE A;  4D9J A;  5CKT A;  4E4H A;  3AL0 C;  3DU6 A;  3CMM A;  2HPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...