3ZR8X

Crystal structure of rxlr effector avr3a11 from phytophthora capsici
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'GPTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AVR3A11
publication title Structures of Phytophthora Rxlr Effector Proteins: A Conserved But Adaptable Fold Underpins Functional Diversity.
pubmed doi rcsb
source organism Phytophthora capsici
molecule tags Protein binding
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF16810 RXLR RXLR phytopathogen effector protein, Avirulence activity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zr8X00
3ZR8X 2LC2A 3ZGKA
chains in the Genus database with same CATH superfamily
2HKOA 3FF5A 3HJEA 3ZQHA 4FE4A 4ENNA 2ESHA 2XASA 5BS6A 3OIOA 4BBRJ 1MBFA 1FZPB 4XKVA 2XUBA 2OJED 1F1ZA 2KIMA 3KCCA 2BEOA 3BLYA 3I3LA 3H9QA 2PMUA 4KMFA 5GADJ 4LLLA 1VTNC 2KJBA 4IHWA 5LHHA 2E1OA 2UXNA 5K5QA 1T39A 2D1HA 4IOAF 1S8NA 3QYBA 2L02A 3CCLI 2J5PA 3ZMDA 2BVMA 4IPAA 2TRTA 1ON1A 1TNTA 3AG2H 2DXIA 2WA0A 3W3CA 5K7FA 1GLNA 2ELJA 1YHQI 1YRNB 1FYKA 3PM1A 1OCPA 2H8WA 2M8EA 2GXGA 3HPGA 3RKXA 3CZ6A 2P6TA 3E6DA 3QYFA 2IEKA 3OMYA 4OAZA 4L9NA 5K7ZA 5HDGA 1R6RA 5TJJA 5J1YA 4HDVA 4UV8A 1EA3A 3O2PE 3KETA 3C2BA 2K4BA 2L4AA 5D5VB 1WJ5A 3DKXA 2XF7A 3DKWA 3R0JA 2GBYA 4HZFA 4PJMA 4CCKA 5ICCA 1S3JA 5FRMA 3QYEA 4ZYHA 3K7AJ 3H5NA 3SHFA 4BAYA 3W2AA 2M30A 1T33A 1B8IA 2EPFA 4RBOA 4AD9A 1PVEA 3BR0A 1VQ4I 2UWMA 1WFXA 3OYMA 5LFAA 3HG9A 1FPQA 1SD6A 2GM4A 1WWXA 2RQQA 2X1CA 2JMWA 3E6MA 3KP6A 3DCFA 3HSRA 3L2UA 1IRGA 4I02A 3WGGA 2EFPA 4C3JJ 2GOMA 3BG6A 3S2HJ 1VQNI 2M4KA 3OYDA 3LSJA 5ED4A 1J2XA 4UUVA 2F5CA 2EFNA 2ZMEB 3PIPF 1B72A 2E1MB 3R61A 2O3FA 2DFHA 1WJFA 2FQ4A 3HZJA 4GXOA 1WVRA 1F9NA 1YX3A 2DA6A 4QPOA 1UG2A 4ZDPA 5HLTA 4WK8F 2A3SA 3HOYJ 1QRYA 2VKHA 3K2ZA 4S0HB 1ITYA 5A2QK 4Z2YA 1SD4A 3KP2A 3ML6A 1TWHJ 2FXAA 2ID6A 5F6FA 1OCCH 1LE8A 2OPTA 2FNPA 4BBSJ 2XV4S 2KPMA 2VUMJ 4J19A 3F6OA 1XDSA 4AIKA 4CSWA 3CUQB 2Y0SA 3HB9A 3CDHA 2VODA 3DXJF 1GXQA 5JR3A 1ZR2A 1FT9A 2MLGA 3SXYA 2R7FA 2YSRA 1DPRA 3FKJA 1XSVA 1PJRA 5JHUA 1IG7A 1TT5B 2VI6A 4B3AA 4BHPA 3CO6C 2P5VA 2FBIA 3JSOA 3D5SC 5ICFA 3ZQCA 4UY8I 1LDKB 3K4JA 1IV8A 4B3XA 4PUSA 1EV7A 3GF2A 2ADUA 3OYJA 1TW2A 5B66C 1NHAA 1RUNA 2QKLB 3L9FA 4BEHB 3BTJA 2UV1A 2BY0A 4XK4A 2FMLA 2NNYA 4BYYA 1ZN2A 1K7AA 4A3JJ 2Y2ZA 2YR2A 5DV5A 2HDDA 3IAS2 5CVIA 1ZHFA 1KONA 3IWZA 3NWTA 1FMVA 4XQFA 2HQAA 3I4MJ 3ABTA 3RZOJ 2R92J 4F92B 1JJ8C 1GVDA 3OL4A 3ZQQA 2PEXA 5HNHA 3TO6A 4RS8A 2UZKA 4A2UA 3ZP5A 1RKTA 4I01A 2R7UA 2VXZA 4KT5C 3W2VA 4IX7A 4A3MJ 4BY1J 2L4MA 4XONA 3RSNA 3EUHA 5HNFA 4CCJA 4A69C 2O8KA 3AL0C 5CPRB 2VBXA 3BZCA 3DEWA 5LRSA 3S1NJ 5J4YA 2F4OB 1UHWA 3E6BA 5HDKA 3FXOA 3BZ6A 1X1AA 3CCMI 3ZRGA 2LY9A 3KEOA 3Q9VA 4MTEA 3SZTA 4LG0B 4BHBA 3GW2A 3I54A 3FM5A 1NTCA 4EGYA 3BCAA 3CCUI 2F6CA 3BR3A 1MNEA 2DK8A 2OU2A 5IYCJ 4DZPA 1T0FA 3S16J 2KIQA 3I4PA 4FISA 4AIHA 4R1HA 4I6ZA 2JA2A 1E2XA 1PUFB 1K78A 4RAGA 3Q0WA 4NHJA 5L3CA 1ZLJA 2QBYB 4XLCA 1WKMA 1DQUA 3LFKA 1Z21A 2YX4A 2CRGA 2HI3A 2JUCA 3OWTA 4XM3A 5F1RA 3MN2A 3ABUA 5AIQA 3G73A 4I2OA 4UHTA 5FD6A 1MGTA 4ZYGA 2H8RA 2OA4A 4ESJA 1C0WA 1P4AA 3T8RA 1HLVA 1N75A 2HDWA 3K0LA 4D7MA 4EJWA 5EJCA 1OR7A 4LLGF 2M4GA 3ZQ7A 1XG1A 4YEJA 2FBHA 1K6YA 1Y8QB 3QWLA 4M71A 3FIWA 5C44J 3CMEI 1ZGWA 5HS8A 4GDFA 2EV0A 5FLXK 4IF4A 4BE1A 1W0TA 4PK4A 3LL7A 4II3A 3RJPA 5TISC 2AXTC 2F5VA 2K9NA 3A2KA 4RGXA 1U5TC 3SYTA 4XNFA 4IRHA 2DJNA 5HLGA 4AM3A 2VPRA 4YRVA 2KISA 2CYYA 5JI6A 3K70D 3BTLA 4F52A 3LA3A 5KVRA 4GYIA 3IP4B 2LVSA 1LNWA 2HVSA 4V2GA 2ZJ2A 1BOAA 4HYEA 1BBYA 4XORA 2WV1A 2AXLA 1S29A 1VQOI 1FBSA 2A5WA 3L2WA 3M8JA 3GX4X 4HLXA 4KIFA 3C2HA 5JLXA 4D9JA 2XSDC 3S1RJ 3RZDJ 3JRBA 2VIXA 2RQPA 1SMTA 5E8IA 3BG5A 2CQQA 4L5EA 1RUOA 5HLIA 3GZNB 3RKQA 2L0KA 1BJAA 3HTSB 1VQLI 2RVCA 5FFXA 2QEXI 2XB5A 2K5CA 4E70A 4HG2A 5KHDA 3LSPA 3PQJA 3QRFF 3WTYC 3LNQA 2EZHA 2BY2A 3GLXA 4HEA2 1VQ7I 3RI4A 1YQAA 1A35A 2H6BA 2R7QA 5HS9A 3LAPA 2PG4A 4DYRA 1ZTRA 3LA7A 5EDNA 1S7EA 3NRVA 1FP1D 1S5LC 2RN7A 3BPXA 5D4SA 1Z6TA 4ZZLA 3R0AA 2K9MA 3IAM2 2EIMH 5L3BA 1JUSA 2W84A 5JVTA 2DT7B 3MCZA 1X3WB 1AOYA 4N9IA 2NS8A 2WAQN 1U8BA 4L0YB 1P6RA 2W57A 2M3AA 4MFDA 4U7BA 3CO7C 1XDUA 2KZGA 4YELA 1I1SA 3I53A 5J1RA 2L9NA 3OYIA 3HIFA 3S3NA 2ZSHB 3K6GA 1MJAA 2QENA 1W5SA 2JQ7A 3X2QH 5EEAA 3KP4A 1NG6A 2BHYA 1X2NA 3CCSI 1IRFA 3GCMA 3KZYA 3WTUC 1YFHA 4NC7A 4U0WA 4PCQA 3LSTA 1R7JA 1S72I 3DTKA 3C1DA 1W7PB 2XAUA 2DCEA 1EH7A 4KICA 4AYBA 4HAMA 1R23A 1YJ9I 2YU9J 4L9VA 3BC8A 2F5FA 1MMNA 2VQGA 1CF7A 3CF5F 1TLHB 5E3NA 4HV6A 1X1BA 2KFDA 2B9SA 2F5DA 2JK3A 4QWQA 3I71A 4RGUA 2FU4A 1Z0XA 1XGOA 3IC7A 2YX7A 2DPDA 3RCOA 3RIRA 4BQOA 1LVKA 2HOEA 3CTAA 3LAJA 2COBA 1I6HJ 3ERED 1IDZA 1H9GA 4U87A 2LKXA 5KAIC 2OQGA 4OMZA 1XSDA 2QYOA 4I0AA 1XMKA 2O8XA 2IA2A 1R1VA 1R4MB 1SAUA 4FT8A 3OYFA 5IT9K 1Z05A 2PN6A 2R7VA 3KLNA 3FZVA 3OOPA 1S6LA 2D1VA 1LPQA 1KGSA 4D5CA 4ENJA 1BN5A 3J81K 2HOAA 3VYTB 2ESNA 1VNDA 1F43A 1LDDA 1FOXA 3ERMA 4EVIA 2LLKA 2M8GX 1B6AA 4V2FA 3VWBA 2KHMA 3ASOH 1M1EB 1TWAJ 3IHUA 4BHCA 4QPQA 4CH7A 2QGUA 1W36D 3G71I 1XGSA 3JRAA 2VQLA 1PDNC 1BI0A 4LK1F 3W6JB 2DMNA 1A5JA 4RB0A 5LGNA 4E4HA 4PSXA 5DD8A 1X3UA 2O0YA 2Z2SB 1X58A 1ZG5A 3HOTA 1D5YA 2V7FA 3GFMA 5FGMA 3WODF 3HKZN 1TZLA 3GTMJ 5FKLA 4QLCU 4RM2A 5LEJA 1APLC 4LIVA 1HDDC 1UMQA 3O3KA 5CQEA 4UXNA 2EBIA 4AC0A 2A07F 2QQAA 5J40A 1L3LA 4O3MA 1QZZA 4Y52J 5GAGJ 3FXQA 3QPLA 3WTSC 2Q1ZB 2Y75A 1JKOC 2DA1A 1T6SA 4LLNA 3TGNA 4A3FJ 3LSKA 3TO9A 5LEKA 4HX8A 1SC7A 2M0MA 5F0CA 5EG0A 5FKMA 4UUSB 5H6QA 4D7NA 2HPIA 2EH3A 3L1PA 4DYQA 1FC3A 1VI0A 3LMMA 1TC3C 2ISYA 4AVZA 1REPC 1IXCA 2Y9YA 1FLIA 1QVTA 3I9V2 2IGNA 2R5YA 2HKXA 1Z6RA 2DA4A 3ZR8X 4Y7NJ 4UVCA 2JA5J 2WV0A 3U2RA 3G3ZA 4A0ZA 3O8HA 3OIQA 4XN3A 4IHVA 4G7ZF 4OIQF 1K83J 5C4JJ 2ELHA 3ZQIA 2MA3A 2E1NA 2ISZA 3KIOA 3AG3H 4Y33A 1SMYF 2R7WA 4TV7A 1OCOH 2JRTA 3K4CA 2XC7A 1Y39A 1IN4A 1X4OA 3ZMUA 1WI3A 1G3YA 3EUHC 3AAFA 4IZZA 3VPRA 4CZZA 3GTKJ 1JKRC 4M3GA 4WXCA 3DV8A 5H2FC 4A6EA 4RB1A 4CYCA 1ZREA 3H9GA 1U5TA 3DLLF 1P9QC 2FOWA 3DEUA 4G6DA 3ZGKA 2DPUA 2OAZA 1R1TA 2IGMA 3HYIA 1BI3A 2IVMA 2OF7A 1T56A 4X0GA 4UUTA 4D5FA 5EGOA 2Z3YA 2CQ7A 1QPMA 4OINF 2LH9A 4IHYA 1SVOA 3GTJJ 3F6VA 1Y8RB 3QPTA 1VQKI 1WJBA 1TP4A 2L3DA 2DN0A 4KN4X 2CW7A 2NAZA 4M9XA 1UB9A 3BP8A 3OY9A 3UKGA 4PJLA 1ZELA 1QA6A 1BR1A 2MD0A 3HHHA 1VQPI 1OCRH 3SZPA 5IP7J 3IWFA 4JOMA 5E20A 3U9GA 3CP2A 2JVGA 2Y48A 3PQKA 3I5UA 1HXDA 5A2QZ 1R1UA 2FJ1A 3DTIA 3LSHA 4QIWN 4XRSG 2ZKZA 5BNGA 1OR7C 3BG3A 1FIAA 3J7AY 2KDOA 3KYDB 2Q8KA 3EYYA 2XRLA 2K7LA 1D1BA 2ZO4A 2WY7Q 3OR2C 2MH9A 1UFMA 2JZYA 2WB1N 2KRFA 3S8PA 4N4OB 4C30A 4KIGA 1I6XA 2TCTA 1O7FA 3QQAA 4BACA 1UCRA 2XDVA 4DNCA 2DAOA 2H94A 4MIMA 3RYPA 4J01A 1SEUA 4WXDA 4CZCA 5DM7F 3OYKA 4BE0A 4A12A 2O7OA 2NRAC 2PJPA 4UVAA 4CXFA 3BJAA 1OCZH 1W5TA 4NB5A 4O5VA 4E7ZA 3K4KA 5KK1A 5HDNA 4PZJA 2XVCA 4XMYA 3H1CA 2F4IA 3QP6A 1KYZA 1P7JA 2R7SA 1DDNA 2COMA 3JTGA 1E3PA 3Q9SA 3V8LA 4GFBA 2MC3A 3FMQA 3L00A 5CQGA 2NVUB 2XB0X 4KFCA 1S9HA 4A93J 1UG0A 5M5YJ 2VJJA 2EV5A 2HTSA 1V3FA 3T0YA 1SAXA 2VOOA 2NOGA 2XKOA 4LMYA 5ICGA 1XGMA 3HHGA 2W1OA 3V7SA 4G6TB 5D5WB 2IP2A 2G9WA 2K9LA 4WX9A 4JK1X 3H3VK 3GBGA 1K78B 3PJRA 2GAUA 2VBYA 2HYGD 2LF7A 1T2KA 1XCVA 2E5NA 4HF1A 4L9TA 4BQAA 3RPUD 3BQYA 4YFNF 4XLAA 2VC1A 1MH3A 1XB4A 3ULQB 1T08B 2JTVA 3IRQA 2CUEA 3MD2A 1MW7A 3V8JA 3JRIA 1RESA 1YS6A 1BC7C 1HKTA 2BXYA 3D0SA 2BE5F 2HQNA 1X1CA 2RNJA 2FBKA 1ZAOA 3RTRA 2DK5A 3CC2I 1R71A 2HZTA 2A6TA 2L7KA 1O3TA 3GTLJ 4Y17A 5KAFC 3L2RA 4BKXA 2ZSIB 3M7GA 4AWXB 4IHSA 5FKNA 2IS4A 1W7PD 3WE2A 1VZ0A 3CP8A 5H20A 2XAHA 2V79A 2IXSA 2JPCA 3EDPA 3ABMH 1GV2A 3FXRA 2DFFA 5HVQC 3BR1A 4U0VA 4PGGA 5FKOA 3WGHA 2E35A 3R60A 4JX5A 3ZCOA 5JFRA 3OYNA 4HRIA 5ERIA 3PSIA 4A3LJ 3DFGA 2PJRA 4OIOF 5FLXZ 1JT6A 2JT1A 2ME0A 2RDPA 3MEXA 2X4HA 1L0OC 2AHQA 5B5EC 3K4BA 1SFKA 2L7FP 2ECBA 1MJ9A 1ZLKA 2VASA 1BA5A 1USTA 3QOEA 1SFOJ 1TWGJ 4BL0B 3WTVC 2CU7A 3PNTA 2DT5A 3OS2A 2NXNB 2KZVA 3F8NA 2CH0A 3GZ5A 3J7YJ 3EUKL 4I0BA 3ASNH 1WH7A 1WJEA 1MMAA 1BI1A 1JTYA 4KN7X 1WSUA 3S1QJ 1ETYA 4KISA 2WWYA 5DS9A 4HSRA 2EQRA 3FBNB 1OYYA 2K3FA 3FXUA 3P5JA 4W97A 1OCTC 1G3SA 3MZHA 3BR5A 4CCLA 1FY7A 1YS7A 4N4NB 2K3PA 5EEHA 3ZN1A 1FBQA 5B1AH 3ZPLA 3BJOA 1BIAA 1P7IA 4QTRA 2ZXIA 3LFUA 4M6YA 3HOZJ 2OTLI 2M0CA 1EF4A 3OYEA 1D1AA 1JHHA 4XLFA 2HU9A 3F8FA 3Q3SA 3HUGB 3GYHX 4ZYDA 4IHXA 4OWRB 1ZQ3P 1FTZA 2DA3A 4G9YA 2KRCA 2OTJI 3A01A 2ECCA 4IJAA 1GXPA 4MEXF 2HOSA 5EF6A 3G1MA 1U9NA 1RR7A 1RETA 3TQNA 4LG3A 2OC6A 3SJMA 5GTHC 2W48A 1G2HA 4WXHA 3K9TA 2A68F 3GUDA 4KUMA 5J8FA 5LLQA 1B9NA 4HLYA 3IH4A 3S3OA 1J5YA 1MZBA 3CQZJ 2K86A 1YITI 4V19K 3J80K 2KP6A 1DU6A 3V42A 3VEPA 3PSFA 3BG7A 2VXDA 1FX7A 2JJ7A 3OYAA 2NVTJ 3RPQA 2H6CA 4KMUX 1G8XA 3TP0A 4DJAA 2L01A 2JUGA 4NQWB 5AIPA 1FSHA 3M07A 2V4JC 3COAC 1EKEA 2QSGX 3GTPJ 2CJJA 1GHCA 2WAQA 2O6GE 3GLLA 5ILSA 3WHCA 3F9KA 1JT0A 4ON0A 1QPIA 1CF7B 4Y3OA 2E60A 2XGCA 3HM5A 1WZ2A 2KT0A 1PP8F 4FX0A 4CA0A 4ZZDA 2DOEA 2P6SA 2FD5A 4A3GJ 2NVYJ 1RI7A 2IS2A 4RLQA 2ACJA 5DCMA 4CCOA 5DYMA 3U1KA 3JTHA 1DPUA 4LITA 2W7NA 3E5XA 5D6FA 2CQKA 3QU6A 2GLOA 3BT9A 3TDZC 3KP5A 4EJOA 4Q47A 2HFHA 1FNNA 1JGSA 4DGWB 4XLHA 5CVRA 3QAHA 1MDMB 3HSEA 5CYVA 1E3HA 2AQFA 4XR6A 2ZXJA 3Q0VA 2DMUA 4D1QA 4XOTA 2EFQA 2FE3A 2VJ5A 4ZDLA 2FQ3A 5F08A 2ZJRF 1MJBA 4XKBA 1W1WE 2WBMA 5BMZA 1Y1WJ 2KKOA 2EFOA 2QWWA 1V5EA 2QA4I 3GO5A 1SD7A 5CVJA 2R7RA 4XRMA 4WCGA 1J59A 4HX7A 2E2JJ 5IT9Z 3KFWX 2OCCH 4G8XA 2X6WA 1TNSA 2EWNA 3VOEA 2DQLA 4NBQA 2Q2EA 2BBYA 3DBLB 2V6EA 3J81Z 3JRGA 1H0MA 1VQ9I 5L3GA 1K6OA 2OZUA 2Q0OA 2L9RA 4M6XA 3TW7A 5EYRA 3MKLA 9ANTA 2RV8A 3LA2A 3E0JB 4S05A 3CJQB 1MMDA 2KLOA 2ZMEA 2XAQA 2IT0A 1QGPA 3H36A 2E7XA 1HQCA 2CUFA 2FUG2 4E7LA 1Z9CA 3AL0B 4NUBA 1Y6IA 2DDAA 2M87A 3QOPA 1BW6A 5JLWA 3LSGA 3TOAA 2E1CA 1HSTA 4RA2A 4OAYA 1AWCA 2MYSA 3KP3A 2DQRA 1Z7UA 1G4DA 5IYDJ 3S15J 2GIVA 4EM2A 1MNMC 5L3DA 3MKWB 3FM3A 3E1SA 2F5EA 3K69A 5D8LB 3DU5A 2FF4A 1LEAA 3PUFA 3AG4H 3BR6A 3HKZA 3T5XA 4EQQA 4F91B 2ZNZA 4U7DA 3S14J 4A3DJ 3OIPA 2DA2A 4EATA 1BIBA 2YUSA 3GTGJ 2V1UA 1N78A 1O3SA 2O5RA 3D5RC 2VJ4A 5L3FA 4ASNA 1G59A 3GEZA 3ZQGA 3KYLA 3GMEA 4RLFA 2CV2A 1QQIA 1KZHA 1EJ9A 1FYLA 2ZC2A 2AS5F 3L2QA 1FSEA 4KT6A 3BTIA 4Y4RA 3VDXA 2GWRA 3L2CA 4LIUA 2BW3A 5JHFA 4E7KA 5ILVA 4IRIA 1T38A 4F7ZA 5J4VA 3CC4I 2X48A 2XAFA 4HSTA 2VE8A 3CMMA 2L54A 5IP6A 2Y9ZA 1WRJA 4O6JA 2YS9A 5CJ9A 4BU2A 2BV6A 3CDLA 5F27A 1UZCA 3CMYA 5K5OA 1QZEA 2W00A 4F93B 1X4PA 1LJ9A 2ICWG 3I59A 1I5ZA 1HKSA 1Y1VJ 3FK6A 5K7HA 4RGSA 4XRFA 1BW5A 1ZG3A 2LY2A 2DTRA 1MMGA 4L5IA 4B43A 4CYCB 3C3WA 5D5UB 1U5TB 4LJZF 2UUZA 4P96A 2HDCA 1S7AA 4HV5A 3GFJA 1JTXA 4JBAA 2BOLA 1F4KA 4HNUA 1LVAA 2HR3A 4IQJA 5EGOB 1AKHA 3JCUC 3KZIC 4BJTA 4FASD 1IN8A 1KQ0A 3G6EI 3W2WA 3JRHA 3TL4X 1IN6A 2A61A 4HPQA 2B7EA 2BYVE 2Z33A 1TT0A 1OFCX 2QCOA 4RMNA 1I27A 4HOBA 2LF8A 4M3EA 5HS7A 2NOJB 3FX3A 5LBQA 2HEOA 4GRIA 3ZQFA 2VLAA 4LB5A 2DA7A 2W25A 3SEZA 4P55A 1JUPA 4YG2F 2JA7J 1OKRA 5E79C 3QPHA 4ABZA 1XTAA 2Y31A 2ZFWA 3C2GA 2HXOA 5HOOA 3JRFA 2RGVA 4M73A 1JJ6C 5FROA 2EZLA 2FOKA 2XGEA 1BJZA 5C4XJ 3BJ6A 4PSWA 3H0GJ 4MFEA 4GYGA 5EZGA 1X1PA 4R8HA 1HOMA 4M9ZA 5ILUA 2VONA 1QU3A 3WU2C 3OS0A 4W1UA 2R7ZJ 1PUFA 1A6IA 2IA1A 1LFPA 5B1BH 4JP0A 5AONA 5GP9A 1O7LA 2K85A 3G2BA 2QBYA 1YTYA 2RKHA 4F55A 5GPAA 2VKEA 3TOBA 3WG9A 3JRCA 3I4NJ 1OQYA 2VL8A 4B44A 4YIIA 3D1NI 2OZ6A 1IUYA 1Z67A 5L3EA 4M3FA 4Q48A 2YU3A 4A3KJ 3K4MA 3RQ4A 4AVPA 5DDGA 1HW1A 1GVJA 3H0DA 3HGYA 4K2EA 2Z5UA 5M3FJ 1WQ2A 1GT0C 4WWCA 1YE9A 1XC5A 4UVBA 4OMYA 1VQ6I 5HLHA 1FOKA 1YW8A 2IBDA 1RRJA 2CGPA 2C6YA 1YIJI 3VSLA 3KPHA 3HOSA 2N8GA 3ZMSA 1YJNI 4UNOA 1Q1VA 1Q1HA 2WB1A 2I10A 3B6CA 4YIRX 1FJLA 5FRNA 1N77A 3ZMZA 4GCVA 1JHFA 3OYBA 3OYLA 2Z16A 1WJCA 1QVUA 5FO5A 3SQNA 5IP9J 2GOXB 1UHMA 2DMQA 4BJ5C 2R4GA 2PLYA 3K70C 1T95A 3CF2A 3ONQA 2NS0A 4L5JA 1O3QA 1H89C 3ZN0A 1ZH5A 2O03A 3C7JA 3MAJA 3OYGA 1D8JA 3DQVC 5IOZA 4BS9A 1FWZA 3FKIJ 3CD6I 5EZHA 5F1JA 4IRGA 4RM3A 5LHIA 2HQRA 2PMZN 4KJZA 3A1YA 2IRFG 2DI3A 4XSXF 1A36A 1ON2A 4Q4ZF 3I55I 2CUJA 2QUFA 1MH4A 3FWEA 4I98B 1IV6A 2EJRA 4RAZA 1KU9A 2LMDA 2MD5A 3IRRA 3VB2A 3TEDA 2HWVA 5DM6F 1XPXA 2OUMA 1B8IB 2LBFA 3LSRA 5K5RA 3T1BA 3SEQA 3B73A 4ETSA 3HRSA 1YIOA 2VOPA 1HKQA 2QM3A 3L7WA 3OSFA 1XSXA 2A69F 1JKQC 3CCRI 3IH2A 3GFIA 5BPDA 1OISA 2KQRA 2QLZA 3FXKA 3MKZA 2K02A 1J9IA 3IKVA 2L2OA 2EZIA 3FXJA 3OOUA 1FOYA 1DP7P 3DPLC 1VQ8I 4CHUA 2JSPA 1X19A 4FE7A 4HBLA 1V55H 2GXAA 3CLQA 3H3ZA 4BXUA 2M45A 5E1ZB 3RPUA 5FLVA 2GA1A 1B72B 2LOOA 5DUKA 2B63J 3GTQJ 4KDPA 3HPHA 2DYRH 1JE8A 2LSOA 4DYCA 4IQ4A 2RREA 1UJ8A 4I7HA 5FFZA 1TTYA 3NARA 4HQEA 4FETA 1IO2A 2QVOA 1Z3XA 2CWEA 5IOYA 4Q5SF 2CV0A 3MZ8A 2PJRB 4L0ZB 1ETQA 4BJ6C 4C2MJ 5HODA 1LE8B 1LB2A 4YFKF 2DO7A 3CUOA 5E3MA 2H1LA 4BDYA 3DKYA 2FA5A 1ZG1A 3S3MA 1I50J 1W7PA 1YI2I 4CO8A 3LQRA 3BCBA 2AQEA 4ZJZA 4ANJA 2OQRA 4CYDA 3M1CA 4EJUA 3U21A 4L18B 2FSWA 1R5HA 2EIJH 5TGTA 4B4CA 2Z9OA 2X1DA 5J8CA 1WI9A 2L5QA 1XMXA 1ONVA 1P2FA 3DEEA 3OS1A 1A31A 2CFXA 1T98A 4HNTA 3P9CA 2H1KA 4BUPA 2D45A 1AA7A 2ZXHA 1BL0A 2MSYA 3EYIA 1P4XA 4P9UA 1IW7F 2QQ8A 3N4MA 3J7ZI 3F8CA 3ZOBA 2MLKA 2KJCA 5H6RA 2BVLA 4GO1A 1K4TA 2CW0F 2MC4A 1IN5A 1YW9A 2M2EA 5F0FA 1SFEA 2EA2A 4M74A 1U8RA 2F48A 2STTA 2R7TA 5JVGF 5F64A 3A0BC 4IEJA 5D4RA 2HXIA 4IKFA 1B4AA 3CCEI 2I5UA 1DUXC 1IF1A 2A5YB 2VJIA 3OYHA 5BPIA 4IL6C 5DUIA 5C3EJ 1RKWA 3TMOA 4I99C 3I64A 5BQTA 2CG4A 1F36A 1W0UA 1TL8A 4ESBA 2X51A 2ZMEC 2E1MC 1J0RA 3SZGA 3HRMA 2XAJA 5CLSA 1R5GA 3QP5A 3WG7H 4XN0A 4M3BA 1W36C 5IT3A 1U2WA 1WPKA 2MGQA 3B02A 1BR4A 2W24A 2E7WA 3CCQI 4II2A 2R93J 5E1XA 5F0HA 2XPWA 1BI2A 2EZKA 4HF0A 2PX9A 4MHGA 3MMYB 1K4SA 2W4SA 2ELKA 3CUQC 3IV5A 4ZTFA 1XN7A 2XAGA 3J80Z 1MKMA 2P7VB 4KITB 3FBIB 2DFIA 2W82A 2PBIA 2X0LA 3K1NA 4JX6A 1VQ5I 5DCMB 3FISA 1R58A 4FX4A 1XX5A 2LDUA 1RPWA 1TQPA 4M72A 2R5ZA 1IDYA 3F3XA 1J7KA 3E7LA 1YW7A 1DU0A 4XBFA 2LNBA 1MSEC 3LSIA 1O3RA 3ZMVA 2JA8J 5LGUA 3ECHA 4OIPF 3F23A 3L09A 2HOTA 1WCMJ 2IGKA 4UUSA 4A3EJ 1IJWC 5D6EA 2I8DA 2G7HA 2CSOA 2TDXA 2V9KA 5CKTA 2DMPA 4BQQA 3MQ0A 3OR1C 5ICEA 2R7OA 3CESA 4LFUA 3JAMK 4NC6A 4YIFA 1KA8A 2P7CB 4LGWA 2GA2A 1HW2A 4C2UA 1KU3A 1G6NA 3N05A 5CVUA 2AO9A 3WE3A 1D3YA 2XROA 4AIJA 3KX2A 2OCEA 3IH3A 4P9FA 3S32A 5FJ8J 1F5TA 3PL8A 2LY1A 4IOCF 3HOVJ 3S1MJ 2CS3A 2IS6A 1U78A 2OV7A 2D2WA 2K40A 3REOA 5FB2A 4MGRA 3M3YJ 1NK2P 1Z77A 2ID3A 2VBWA 1ZRCA 4XLNF 3FMRA 3V7CA 2IS1A 3RYRA 3M4OJ 2Q2EB 3ABLH 4DOZA 2RNGA 2D5VA 3E3VA 5J6XA 3AG1H 1KQ8A 4ZYEA 1RNLA 1Y0UA 4XRSA 3MZYA 1JI8A 5FD5A 1G3TA 4PDKA 2E2IJ 3H3UA 1QZYA 1AHDP 4G12A 2E19A 1E0EA 1E17A 1YOVB 1W5CC 4IHTA 4B48A 3CCYA 5TRDA 4E7SA 5LHGA 5IY5H 5D8KB 3TP3A 6PAXA 2X1EA 3PFIA 3PFYA 1R36A 2IA0A 4AU7A 2JN6A 1NG7A 2HPMA 2JSCA 1WJDA 2R7XA 1KU2A 1HCRA 3H5RA 2VC0A 3CJNA 4CDGA 2M34A 1JKPC 3CCVI 1RZ4A 3OL3A 2DOAA 4DZJA 3SDBA 2G7UA 1AU7A 1ERDA 2E5ZA 5DEQA 4BNCA 1D0YA 3NEUA 5IPAA 4B47A 2CW8A 1ETWA 1OPCA 2MABA 2QQ9A 4XICA 2LG4A 1HC8A 2P0WA 4C3IJ 3Q0UA 2W85A 3DBHB 4A6DA 2IW5A 2VQCA 2F2EA 2EIKH 1X2MA 4RAFA 4AUXA 1SFXA 1YO5C 2STWA 5E3OA 3L2VA 4ZYAA 3BWGA 3S17J 2MW8A 2BW3B 3H5AA 4BY7J 2VN2A 2WAEA 2X6YA 3A4CA 3BQZA 3ZXSA 4DBRA 5M5WJ 1T8IA 3S2DJ 4G7HF 2VQHA 2LFBA 1IRXA 3ROUA 1X1DA 4ENMA 1HA8A 1R9TJ 1MBGA 1ZR4A 1QBJA 3FXMA 2X6OA 3WGIA 1Z1DA 2DDBA 4QSHA 3I59B 3VYUB 1E3OC 3SFIA 3HSFA 5J47A 4H4KC 1R5ID 3OV8A 1YJWI 1FMWA 2CO5A 5K1YA 1FBUA 1NK3P 3DBRB 3C18A 4G7OF 3K10A 2R7DA 3S2WA 4YFXF 2QSFX 2V26A 4OIRF 2M7AA 3JRDA 3WHBA 1GUUA 2QF7A 3HEFA 1UELB 1ZGAA 1BC8C 3BTCA 3LSMA 4CICA 1ZRDA 1IZ1A 1AKHB 3DPUA 3CMAI 3NWSA 3CLOA 3HL2A 4JQFA 3ESWB 4RB2C 2V6CA 3RQIA 2DBBA 2QZ8A 2ZXWH 3RKWA 4X1EA 4BGDA 3W6KB 2LREA 3DF8A 3JR9A 1QO0D 1TQIA 4J00A 3BY6A 1J75A 4RGRA 1MIJA 1ZARA 1BOBA 2ZCWA 1V4RA 3DLAA 4LOCA 1POGA 1TWCJ 2JRMA 4GGGA 3NAUA 2X9DA 4E6KG 4FCYA 3HC7A 1CGPA 1H9TA 1GV5A 5GTIC 3F0CA 2ZNYA 2DW4A 5E1WA 4EV0A 1YRNA 4HQMA 1YG2A 2XSJC 2A6EF 3MWMA 3G4SI 1I3AA 4B1RA 1IUFA 4ENKA 1O4XA 5FLMJ 5D5XB 1IGNA 1UAAA 1WHUA 4A0YA 3VSKA 4A3CJ 4XIDA 2HVQA 2XGXA 4F3QA 3O6BB 1U3EM 3UR3C 4M9SA 2NS7A 3LQQA 1TWFJ 2P5LC 5FKKA 4N0BA 2LRDA 2FEZA 2MFZA 3H35A 1RR8C 3OSGA 2E36A 3BZKA 4BDZA 2UXXA 2QQBA 4EMSA 1R49A 1BM9A 2HNHA 1MD0A 1WGXA 2HGCA 1QHHD 4BQNA 2BY3A 1LFUP 1OYIA 3TO7A 5E3LA 4EM1A 1D8KA 3VYRB 1EH6A 2Y0SN 2HYJA 4L9JA 1ETKA 4D0PA 3RDIA 4DIQA 1EH8A 1OMIA 1MBKA 2V9PA 3QU3A 2JWTA 3FK7A 1IAWA 1J09A 2VPLA 1STZA 5IYBJ 1LEBA 3F72A 2G0EA 4I76A 2QSHX 1WH5A 4EGZA 1X3ZB 2HYFA 1W4MA 1XMAA 1MMSA 1TQMA 2XIGA 3F8BA 2X6XA 2WTEA 3ZQLA 1XGNA 4PFPA 1MBJA 1H8AC 5EG0B 2ZBKA 4UB6C 3CUQA 3EQLF 1USSA 5DD4A 1O57A 2KIFA 4DW6A 2V1XA 3E97A 4IVNA 3HRUA 4HDUA 4EJTA 3JW4A 2NVQJ 3BDDA 1FOWA 2MBFA 4A5MA 2IGOA 1FYMA 1YLFA 2B0LA 3KYCB 1FIPA 2R5YB 1HF0A 4C9YA 3CDIA 3KEYA 4OU0A 2NNNA 3I58A 2XKPA 3BROA 4BE2A 1SFUA 4CCMA 2LKSA 5BOXA 5B3SH 3DPTA 4HA8A 2LBFB 1DP3A 1MSFC 1HDPA 1SVMA 3E5QA 1BR2A 2FRHA 1MNDA 2HVRA 1HSJA 1WJAA 3PIOF 2IAIA 4BEHA 3WU1B 2CQXA 3AKZA 3JREA 1KYWA 3F8MA 3Q5FA 4RDUA 1B1BA 3DTEA 3EPZA 2PMZA 2DA5A 4XKCA 2HQ5A 3OYCA 1P92A 3P7NA 4XSZF 2CUZA 4KIBA 2PMHA 5DTDA 3HUGA 3ABKH 4CUGA 4CGZA 4B09A 2VT2A 3GZ6A 2CMPA 4CCNA 4M6VA 2DODA 3HBLA 4ITVA 3CJRB 2L9VA 5EEGA 2R3SA 1VF9A 2VKDA 2HZDA 1ENHA 2WAFA 4BXXJ 4HF2A 1LUJB 3K1PA 2GXBA 1D5VA 2LTPA 1ODDA 3H92A 3R4KA 2MH2A 4BH9A 3TDUC 3SFZA 4N9HA 3M8FA 5J3LA 2E71A 4C3HJ 1OLTA 4MQ9F 2KL4A 1ZRFA 1ULYA 2XF6A 3NQOA 3ELKA 2K9QA 3MVPA 2LD5A 1QHGA 2L9SA 4MO7A 1FP2A 4XOPA 3AFHA 4R79A 1DGRM 1Z7LA 2XGDA 5E18F 2VE9A 4NQWA 1PUEE 4PFOA 3CCJI 4A3BJ 3WTXC 1YYVA 3TBIA 2H27A 3H9JA 3PNYA 3TW6A 4DQ2A 3A03A 4PGHA 3K2AA 1JXSA 3DU6A 1N25A 1TBXA 4LG0A 1ZKGA 3HTUA 3VFZA 4HNVA 3MFKA 5LD2C 2VT3A 3G1OA 4MQVA 1IRZA 2GQQA 3GXOA 2LYCA 4EM0B 1LQ1A 2E2HJ 3SDGA 1XD7A 2DOFA 4E7IA 4ZTJA 1A6QA 3F22A 3TKYA 2CFOA 3FHNA 2XRNA 5GAHJ 3PO3J 5J1UA 4WF2A 2DMTA 4G94A 2NVXJ 2P5KA 1R4NB 4NNJA 2LP0A 3HOWJ 2LK2A 4KNYA 2JA6J 3PUBA 4NC8A 3T8TA 4BXFA 4PJNA 1MDMA 3FXLA 2DT6A 1V5FA 2EILH 4PJ0C 1CQTA 1UHSA 3EETA 3FDYA 3VODA 4MTDA 2CV1A 2LKPA 2XHKA 3FHZA 2HS5A 4E7HA 1KQ9A 1IXSB 2GIZA 3A0HC 1D0ZA 2VB6A 2Z1DA 3VYSB 1LFBA 1ETXA 5DCFA 1R22A 2DU9A 1PP7U 5M5XJ 2O9LA 3I56I 1FTTA 4U0YA 1ETOA 2CQNA 3HXLA 5F04A 2J5OA 3G1LA 4C2TA 3CJTB 3JSPA 2OD5A 3A02A 1JGGA 3ISPA 4U88A 3V7RA 4Y15A 3ZMTA 2Y30A 2ZB9A 4ZH4F 2XPUA 2EV6A 3E6CC 4RB3C 4ESFA 2DLLA 2O61A 1XCBA 1PYVA 3P9KA 4DBQA 1U6GA 1IC8A 2EK5A 2ZJQF 2M9HA 1Z3YA 1OYWA 3BPVA 2XF5A 2E34A 2HTJA 5E17F 3BOQA 3R6SA 3N97A 3K1MA 1ZYRF 1MBEA 2V1DA 4FHTA 1DGWY 2BXZA 2GZWA 2PQ8A 4Z6YA 5M3MJ 4EEFG 4KYWA 2BZTA 2OBPA 1K61A 2FMYA 3KE2A 1SVLA 3M9AA 2PFBA 1SANA 2K27A 2M1BA 2R5ZB 2WADA 3PNVA 2FNAA 4P1WA 3GFLA 3FMSA 2P81A 1K79A 2P8TA 3HOXJ 1RIOH 3UNGC 1ZGJA 5GAEJ 3U1DA 4AIDA 3P9IA 4LD5A 5KCMA 1I1GA 5LGTA 3KP7A 4ZC3A 1D0XA 2Z99A 3IL2A 4MNUA 4I09A 3PO2J 3KLOA 4XKWA 4MLOA 1HW5A 1P4WA 1ETVA 1B59A 2DTZA 2V9VA 4NDLA 1NH3A 1TW3A 2JVHA 1VQMI 4XL9A 3HRTA 2KMUA 2KIUA 1OJLA 1LKXA 1A04A 2M5WA 4G6QA 2K4JA 4EJVA 3D5LA 3ECOA 5GPCA 4JYKA 2LC2A 3K4NA 4HW0A 4AYBN 3W6VA 2L7MP 3K4LA 4X6AJ 4JX4A 1V5GA 2H09A 1FEXA 1GDTA 4ZDOA 2KRHA 4OOIA 1D1CA 4A5NA 3JAMZ 2EINH 3LOCA 1G3WA 2ZJPF 2ME6A 2VBZA 2F4MB 4MEYF 1V54H 2EFWA 2BGCA 3RKYA 1U0JA 4HX4A 3QPSA 3DWLE 4LK0F 1S7OA 2A6HF 4IXAA 2IPQX 3GWZA 5LRRA 4Y13A 1Z91A 4IO9F 1XS9A 2DJIA 3I0TA 4P5OA 3E5UA 1ZK8A 2K9SA 2Y0MA 2DYSH 2PI0A 1YX5A 5CVVA 5E8GA 1ORKA 2BY1A 2VKVA 4XLEA 1MBHA 4XLPF 2DFEA 3BR2A 3V4GA 3F21A 1T0FC 2JPBA 3IKTA 3QODA 4FQGA 4S04A 3WTTC 2BHZA 3WU0A 2RC4A 2RAEA 2XPVA 1SD5A 2LR8A 2WC2A 1VFCA 3B6AA 3DP7A 3IUOA 3O8GA 5KNLA 1IN7A 3J7AO 3MKYB 2M7BA 4H0EA 3WTZA 4M3DA 1QNTA 3HDDA 2P4WA 2R0QC 3EUAA 1ACIA 2IJLA 2QKMB 4LB6B 3M8EA 3V8KA 4B8XA 3LWFA 1U9OA 1Y56A 4PJJA 4UB8C 1LDJA 2ZFUA 3BG9A 2V1NA 1HBXG 3CC7I 3A01B 3KZZA 2MG4A 1B9MA 2X85A 4FTHA 1IXRC 3HOUJ 2A05A 2EA4A 2L7ZA 1Y0NA 4KA4A 3HGGA 2KDZA 2ETHA 1I3QJ 3GVAA 2WY8Q 2NYXA 1I39A 1R00A 1H88C 4UV9A 2EB7A 1RC9A 2FX0A 1JUMA 4E7JA 2Y69H 3GTOJ 2YPRA 4RAYA 4A0XA 3KEQA 3S93A 3M1EA 3WTWC 4A3IJ 1KU7A
chains in the Genus database with same CATH topology
4RLFA 1X1DA 1HA8A 2CV2A 3LSKA 3VYUB 3L2QA 2M0MA 4KT6A 4XKVA 4Y4RA 3VDXA 4E7KA 4LIUA 2BW3A 4H4KC 5JHFA 1FMWA 2HPIA 4HSTA 3BLYA 3CMMA 3I3LA 3H9QA 3K10A 3LMMA 4BU2A 2V26A 4AVZA 2M7AA 1UELB 3I9V2 3LSMA 2IGNA 2W00A 4F93B 1X4PA 3QYBA 3DPUA 3ZR8X 3NWSA 2BVMA 3HL2A 2DXIA 4JQFA 2WA0A 3W3CA 1GLNA 3OIQA 4XN3A 2LY2A 1MMGA 4BGDA 2ELJA 2LREA 4B43A 4J00A 3HPGA 3CZ6A 3QYFA 2UUZA 4Y33A 3OMYA 1BOBA 4OAZA 2BOLA 1R6RA 4HNUA 4IQJA 2R7WA 1EA3A 3DLAA 3K4CA 1WJ5A 3DKXA 2XF7A 4PJMA 4E6KG 4BJTA 2XC7A 4FASD 4CCKA 1X4OA 3HC7A 3W2WA 5FRMA 3QYEA 3TL4X 3EUHC 4HPQA 4IZZA 3H5NA 1TT0A 4RMNA 3W2AA 2UWMA 1WFXA 2XSJC 2NOJB 3OYMA 3H9GA 4GRIA 5LFAA 1P9QC 2VLAA 3HG9A 3SEZA 3ZGKA 2IGMA 1UAAA 2RQQA 2X1CA 3VSKA 4X0GA 2HVQA 3L2UA 3C2GA 4F3QA 5HOOA 2LH9A 2GOMA 3BG6A 3UR3C 2M4KA 3OYDA 5FROA 1WJBA 2LRDA 2CW7A 2MFZA 4PSWA 3H35A 2E1MB 1WJFA 3OY9A 1QU3A 4PJLA 1ZELA 1YX3A 5HLTA 4ZDPA 4QPOA 3OS0A 1BR1A 2MD0A 4BDZA 1LFPA 2VKHA 2HNHA 4JOMA 3G2BA 4F55A 1QHHD 4BQNA 3CP2A 2JVGA 3VYRB 2KPMA 2VL8A 4B44A 3DTIA 4DIQA 3LSHA 4CSWA 2Y0SA 1J09A 3K4MA 3RQ4A 2VPLA 1OR7C 3H0DA 3J7AY 2KDOA 1YE9A 3FKJA 1D1BA 1PJRA 2WY7Q 3OR2C 3VSLA 3HOSA 2X6XA 4PFPA 3S8PA 4N4OB 4C30A 3D5SC 4BACA 1LDKB 3K4JA 2WB1A 4B3XA 4PUSA 5FRNA 2XDVA 1N77A 3OYJA 2QKLB 3OYBA 3OYLA 2Z16A 4BEHB 4J01A 1WJCA 4CZCA 3OYKA 2UV1A 4BE0A 2GOXB 2IGOA 4BJ5C 2R4GA 4C9YA 3K70C 3KEYA 4E7ZA 1T95A 3CF2A 3ONQA 3K4KA 3IAS2 4BE2A 1KONA 4XMYA 2F4IA 4CCMA 3OYGA 3DPTA 3NWTA 2LBFB 1FMVA 3DQVC 4XQFA 2R7SA 4BS9A 1DP3A 2HQAA 1BR2A 1MNDA 2HVRA 1WJAA 4RM3A 4BEHA 4F92B 3OL4A 3ZQQA 3AKZA 4KJZA 3A1YA 5CQGA 5HNHA 3DTEA 3EPZA 2CUJA 1S9HA 2PMZA 3OYCA 4XKCA 1UG0A 2VJJA 2R7UA 2CUZA 2VXZA 4IX7A 3W2VA 4XONA 3RSNA 4CUGA 5HNFA 4CCJA 3AL0C 2OUMA 2LBFA 2CMPA 5CPRB 4CCNA 2W1OA 4ITVA 3CJRB 4G6TB 2VKDA 2HZDA 2WAFA 3SEQA 2K9LA 3GBGA 1X1AA 3ZRGA 3PJRA 2KQRA 2E5NA 3MKZA 2L2OA 3OOUA 3RPUD 1OLTA 2KL4A 3DPLC 2XF6A 2JSPA 4XLAA 1X19A 3BCAA 2F6CA 1MNEA 1QHGA 2L9SA 4XOPA 4R79A 3AFHA 3MD2A 1DGRM 1Z7LA 1MW7A 2LOOA 4PFOA 3HPHA 3TBIA 2JA2A 3H9JA 3PNYA 4IQ4A 2RREA 1X1CA 4XLCA 3DU6A 3RTRA 4FETA 5LD2C 1DQUA 1Z3XA 2A6TA 2L7KA 1Z21A 2LYCA 2CV0A 2PJRB 4BJ6C 3L2RA 3OWTA 2ZSIB 4XM3A 2IS4A 4BDYA 4E7IA 4ZTJA 1VZ0A 3DKYA 2CFOA 3CP8A 3FHNA 3S3MA 1N75A 2HDWA 2IXSA 3BCBA 2M4GA 2AQEA 4NNJA 4YEJA 4ZJZA 5HVQC 4ANJA 3PUBA 1K6YA 3M1CA 3ZCOA 4HRIA 3OYNA 3U21A 4NC8A 4BE1A 3PSIA 4PK4A 4BXFA 3LL7A 4II3A 5TGTA 4PJNA 2PJRA 3KYLA 2DT6A 1V5FA 3A2KA 2F5VA 2X1DA 2L5QA 3DEEA 3K4BA 3OS1A 3SYTA 1SFKA 4XNFA 4HNTA 3FDYA 2VASA 4BUPA 3QOEA 2CV1A 1AA7A 2ZXHA 4BL0B 4YRVA 3PNTA 3OS2A 4E7HA 3K70D 4F52A 1D0ZA 2VB6A 2KZVA 2Z1DA 3VYSB 3IP4B 2BVLA 2HVSA 2CH0A 3EUKL 1WJEA 2MC4A 1MMAA 4XORA 4KISA 3HXLA 2R7TA 4HSRA 4C2TA 2A5WA 3L2WA 3M8JA 4IKFA 3FBNB 3C2HA 4D9JA 2VJIA 2VIXA 3OYHA 4CCLA 4N4NB 2K3PA 3TMOA 1PYVA 4DBQA 2ZXIA 3LFUA 1Z3YA 2XF5A 2K5CA 3OYEA 4HG2A 1D1AA 5KHDA 4XLFA 2HU9A 2X51A 3HUGB 2E1MC 3SZGA 1DGWY 4OWRB 4HEA2 2KRCA 2R7QA 4XN0A 1W36C 2WADA 3PNVA 4P1WA 1BR4A 4LG3A 2OC6A 4II2A 3UNGC 3S3OA 5KCMA 3MMYB 2KP6A 2K9MA 2W4SA 3IAM2 3V42A 3PSFA 3BG7A 2VXDA 4ZTFA 4ZC3A 2DT7B 4KITB 3OYAA 3FBIB 1D0XA 1G8XA 2W82A 4DJAA 2JUGA 4NQWB 2V4JC 2M3AA 4XKWA 4MLOA 4U7BA 4YELA 2WAQA 3F9KA 2JVHA 2L9NA 3OYIA 3S3NA 2ZSHB 3K6GA 4XL9A 1NG6A 3LSIA 4Y3OA 2E60A 2KMUA 2IGKA 4CA0A 1LKXA 4NC7A 2I8DA 3D5LA 2V9KA 5CKTA 4RLQA 4BQQA 2IS2A 3OR1C 3DTKA 2LC2A 2R7OA 3K4NA 4CCOA 3CESA 4LITA 3K4LA 2W7NA 1V5GA 2XAUA 2DCEA 4ZDOA 2KRHA 4AYBA 1D1CA 3BC8A 4C2UA 1MMNA 2VQGA 3N05A 3KX2A 1X1BA 3S32A 4DGWB 4XLHA 3PL8A 2LY1A 2IS6A 2CS3A 2AQFA 2OV7A 4XR6A 4D1QA 1U0JA 4XOTA 3RCOA 2VJ5A 3DWLE 1LVKA 4BQOA 2IS1A 4ZDLA 2Q2EB 4XKBA 4DOZA 2RNGA 2WBMA 1V5EA 4U87A 2DJIA 4P5OA 2R7RA 1JI8A 1YX5A 1SAUA 3OYFA 4XLEA 1E0EA 2R7VA 4B48A 1T0FC 2X6WA 4E7SA 3QODA 2X1EA 3PFYA 2V6EA 3VYTB 4AU7A 1NG7A 2HPMA 1WJDA 2R7XA 3IUOA 5KNLA 3H5RA 3OL3A 3VWBA 2DOAA 1ERDA 3SDBA 3MKYB 2KHMA 3E0JB 2E5ZA 2M7BA 1D0YA 3CJQB 4QPQA 1MMDA 2KLOA 4CH7A 4B47A 2CW8A 3EUAA 1W36D 2QKMB 2MABA 2FUG2 4E7LA 2LG4A 2VQLA 3AL0B 1Y56A 4NUBA 4PJJA 1Y6IA 2ZFUA 2V1NA 2P0WA 3LSGA 4E4HA 4PSXA 2X85A 4OAYA 2MYSA 2Z2SB 2VQCA 3HOTA 2V7FA 3MKWB 1TZLA 3E1SA 4RM2A 4LIVA 3DU5A 5CQEA 4ZYAA 3L2VA 3HKZA 4F91B 2BW3B 2WY8Q 3H5AA 3OIPA 4EATA 2WAEA 2X6YA 4E7JA 3A4CA 1N78A 3ZXSA 4DBRA 2O5RA 3D5RC 2Q1ZB 3S93A 2VJ4A 1G59A 2VQHA 1IRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR8 X;  2LC2 A;  3ZGK A; 
#chains in the Genus database with same CATH topology
 2HKO A;  3FF5 A;  3HJE A;  3ZQH A;  4FE4 A;  4ENN A;  2ESH A;  2XAS A;  5BS6 A;  3OIO A;  4BBR J;  1MBF A;  1FZP B;  4XKV A;  2XUB A;  2OJE D;  1F1Z A;  2KIM A;  3KCC A;  2BEO A;  3BLY A;  3I3L A;  3H9Q A;  2PMU A;  4KMF A;  5GAD J;  4LLL A;  1VTN C;  2KJB A;  4IHW A;  5LHH A;  2E1O A;  2UXN A;  5K5Q A;  1T39 A;  2D1H A;  4IOA F;  1S8N A;  3QYB A;  2L02 A;  3CCL I;  2J5P A;  3ZMD A;  2BVM A;  4IPA A;  2TRT A;  1ON1 A;  1TNT A;  3AG2 H;  2DXI A;  2WA0 A;  3W3C A;  5K7F A;  1GLN A;  2ELJ A;  1YHQ I;  1YRN B;  1FYK A;  3PM1 A;  1OCP A;  2H8W A;  2M8E A;  2GXG A;  3HPG A;  3RKX A;  3CZ6 A;  2P6T A;  3E6D A;  3QYF A;  2IEK A;  3OMY A;  4OAZ A;  4L9N A;  5K7Z A;  5HDG A;  1R6R A;  5TJJ A;  5J1Y A;  4HDV A;  4UV8 A;  1EA3 A;  3O2P E;  3KET A;  3C2B A;  2K4B A;  2L4A A;  5D5V B;  1WJ5 A;  3DKX A;  2XF7 A;  3DKW A;  3R0J A;  2GBY A;  4HZF A;  4PJM A;  4CCK A;  5ICC A;  1S3J A;  5FRM A;  3QYE A;  4ZYH A;  3K7A J;  3H5N A;  3SHF A;  4BAY A;  3W2A A;  2M30 A;  1T33 A;  1B8I A;  2EPF A;  4RBO A;  4AD9 A;  1PVE A;  3BR0 A;  1VQ4 I;  2UWM A;  1WFX A;  3OYM A;  5LFA A;  3HG9 A;  1FPQ A;  1SD6 A;  2GM4 A;  1WWX A;  2RQQ A;  2X1C A;  2JMW A;  3E6M A;  3KP6 A;  3DCF A;  3HSR A;  3L2U A;  1IRG A;  4I02 A;  3WGG A;  2EFP A;  4C3J J;  2GOM A;  3BG6 A;  3S2H J;  1VQN I;  2M4K A;  3OYD A;  3LSJ A;  5ED4 A;  1J2X A;  4UUV A;  2F5C A;  2EFN A;  2ZME B;  3PIP F;  1B72 A;  2E1M B;  3R61 A;  2O3F A;  2DFH A;  1WJF A;  2FQ4 A;  3HZJ A;  4GXO A;  1WVR A;  1F9N A;  1YX3 A;  2DA6 A;  4QPO A;  1UG2 A;  4ZDP A;  5HLT A;  4WK8 F;  2A3S A;  3HOY J;  1QRY A;  2VKH A;  3K2Z A;  4S0H B;  1ITY A;  5A2Q K;  4Z2Y A;  1SD4 A;  3KP2 A;  3ML6 A;  1TWH J;  2FXA A;  2ID6 A;  5F6F A;  1OCC H;  1LE8 A;  2OPT A;  2FNP A;  4BBS J;  2XV4 S;  2KPM A;  2VUM J;  4J19 A;  3F6O A;  1XDS A;  4AIK A;  4CSW A;  3CUQ B;  2Y0S A;  3HB9 A;  3CDH A;  2VOD A;  3DXJ F;  1GXQ A;  5JR3 A;  1ZR2 A;  1FT9 A;  2MLG A;  3SXY A;  2R7F A;  2YSR A;  1DPR A;  3FKJ A;  1XSV A;  1PJR A;  5JHU A;  1IG7 A;  1TT5 B;  2VI6 A;  4B3A A;  4BHP A;  3CO6 C;  2P5V A;  2FBI A;  3JSO A;  3D5S C;  5ICF A;  3ZQC A;  4UY8 I;  1LDK B;  3K4J A;  1IV8 A;  4B3X A;  4PUS A;  1EV7 A;  3GF2 A;  2ADU A;  3OYJ A;  1TW2 A;  5B66 C;  1NHA A;  1RUN A;  2QKL B;  3L9F A;  4BEH B;  3BTJ A;  2UV1 A;  2BY0 A;  4XK4 A;  2FML A;  2NNY A;  4BYY A;  1ZN2 A;  1K7A A;  4A3J J;  2Y2Z A;  2YR2 A;  5DV5 A;  2HDD A;  3IAS 2;  5CVI A;  1ZHF A;  1KON A;  3IWZ A;  3NWT A;  1FMV A;  4XQF A;  2HQA A;  3I4M J;  3ABT A;  3RZO J;  2R92 J;  4F92 B;  1JJ8 C;  1GVD A;  3OL4 A;  3ZQQ A;  2PEX A;  5HNH A;  3TO6 A;  4RS8 A;  2UZK A;  4A2U A;  3ZP5 A;  1RKT A;  4I01 A;  2R7U A;  2VXZ A;  4KT5 C;  3W2V A;  4IX7 A;  4A3M J;  4BY1 J;  2L4M A;  4XON A;  3RSN A;  3EUH A;  5HNF A;  4CCJ A;  4A69 C;  2O8K A;  3AL0 C;  5CPR B;  2VBX A;  3BZC A;  3DEW A;  5LRS A;  3S1N J;  5J4Y A;  2F4O B;  1UHW A;  3E6B A;  5HDK A;  3FXO A;  3BZ6 A;  1X1A A;  3CCM I;  3ZRG A;  2LY9 A;  3KEO A;  3Q9V A;  4MTE A;  3SZT A;  4LG0 B;  4BHB A;  3GW2 A;  3I54 A;  3FM5 A;  1NTC A;  4EGY A;  3BCA A;  3CCU I;  2F6C A;  3BR3 A;  1MNE A;  2DK8 A;  2OU2 A;  5IYC J;  4DZP A;  1T0F A;  3S16 J;  2KIQ A;  3I4P A;  4FIS A;  4AIH A;  4R1H A;  4I6Z A;  2JA2 A;  1E2X A;  1PUF B;  1K78 A;  4RAG A;  3Q0W A;  4NHJ A;  5L3C A;  1ZLJ A;  2QBY B;  4XLC A;  1WKM A;  1DQU A;  3LFK A;  1Z21 A;  2YX4 A;  2CRG A;  2HI3 A;  2JUC A;  3OWT A;  4XM3 A;  5F1R A;  3MN2 A;  3ABU A;  5AIQ A;  3G73 A;  4I2O A;  4UHT A;  5FD6 A;  1MGT A;  4ZYG A;  2H8R A;  2OA4 A;  4ESJ A;  1C0W A;  1P4A A;  3T8R A;  1HLV A;  1N75 A;  2HDW A;  3K0L A;  4D7M A;  4EJW A;  5EJC A;  1OR7 A;  4LLG F;  2M4G A;  3ZQ7 A;  1XG1 A;  4YEJ A;  2FBH A;  1K6Y A;  1Y8Q B;  3QWL A;  4M71 A;  3FIW A;  5C44 J;  3CME I;  1ZGW A;  5HS8 A;  4GDF A;  2EV0 A;  5FLX K;  4IF4 A;  4BE1 A;  1W0T A;  4PK4 A;  3LL7 A;  4II3 A;  3RJP A;  5TIS C;  2AXT C;  2F5V A;  2K9N A;  3A2K A;  4RGX A;  1U5T C;  3SYT A;  4XNF A;  4IRH A;  2DJN A;  5HLG A;  4AM3 A;  2VPR A;  4YRV A;  2KIS A;  2CYY A;  5JI6 A;  3K70 D;  3BTL A;  4F52 A;  3LA3 A;  5KVR A;  4GYI A;  3IP4 B;  2LVS A;  1LNW A;  2HVS A;  4V2G A;  2ZJ2 A;  1BOA A;  4HYE A;  1BBY A;  4XOR A;  2WV1 A;  2AXL A;  1S29 A;  1VQO I;  1FBS A;  2A5W A;  3L2W A;  3M8J A;  3GX4 X;  4HLX A;  4KIF A;  3C2H A;  5JLX A;  4D9J A;  2XSD C;  3S1R J;  3RZD J;  3JRB A;  2VIX A;  2RQP A;  1SMT A;  5E8I A;  3BG5 A;  2CQQ A;  4L5E A;  1RUO A;  5HLI A;  3GZN B;  3RKQ A;  2L0K A;  1BJA A;  3HTS B;  1VQL I;  2RVC A;  5FFX A;  2QEX I;  2XB5 A;  2K5C A;  4E70 A;  4HG2 A;  5KHD A;  3LSP A;  3PQJ A;  3QRF F;  3WTY C;  3LNQ A;  2EZH A;  2BY2 A;  3GLX A;  4HEA 2;  1VQ7 I;  3RI4 A;  1YQA A;  1A35 A;  2H6B A;  2R7Q A;  5HS9 A;  3LAP A;  2PG4 A;  4DYR A;  1ZTR A;  3LA7 A;  5EDN A;  1S7E A;  3NRV A;  1FP1 D;  1S5L C;  2RN7 A;  3BPX A;  5D4S A;  1Z6T A;  4ZZL A;  3R0A A;  2K9M A;  3IAM 2;  2EIM H;  5L3B A;  1JUS A;  2W84 A;  5JVT A;  2DT7 B;  3MCZ A;  1X3W B;  1AOY A;  4N9I A;  2NS8 A;  2WAQ N;  1U8B A;  4L0Y B;  1P6R A;  2W57 A;  2M3A A;  4MFD A;  4U7B A;  3CO7 C;  1XDU A;  2KZG A;  4YEL A;  1I1S A;  3I53 A;  5J1R A;  2L9N A;  3OYI A;  3HIF A;  3S3N A;  2ZSH B;  3K6G A;  1MJA A;  2QEN A;  1W5S A;  2JQ7 A;  3X2Q H;  5EEA A;  3KP4 A;  1NG6 A;  2BHY A;  1X2N A;  3CCS I;  1IRF A;  3GCM A;  3KZY A;  3WTU C;  1YFH A;  4NC7 A;  4U0W A;  4PCQ A;  3LST A;  1R7J A;  1S72 I;  3DTK A;  3C1D A;  1W7P B;  2XAU A;  2DCE A;  1EH7 A;  4KIC A;  4AYB A;  4HAM A;  1R23 A;  1YJ9 I;  2YU9 J;  4L9V A;  3BC8 A;  2F5F A;  1MMN A;  2VQG A;  1CF7 A;  3CF5 F;  1TLH B;  5E3N A;  4HV6 A;  1X1B A;  2KFD A;  2B9S A;  2F5D A;  2JK3 A;  4QWQ A;  3I71 A;  4RGU A;  2FU4 A;  1Z0X A;  1XGO A;  3IC7 A;  2YX7 A;  2DPD A;  3RCO A;  3RIR A;  4BQO A;  1LVK A;  2HOE A;  3CTA A;  3LAJ A;  2COB A;  1I6H J;  3ERE D;  1IDZ A;  1H9G A;  4U87 A;  2LKX A;  5KAI C;  2OQG A;  4OMZ A;  1XSD A;  2QYO A;  4I0A A;  1XMK A;  2O8X A;  2IA2 A;  1R1V A;  1R4M B;  1SAU A;  4FT8 A;  3OYF A;  5IT9 K;  1Z05 A;  2PN6 A;  2R7V A;  3KLN A;  3FZV A;  3OOP A;  1S6L A;  2D1V A;  1LPQ A;  1KGS A;  4D5C A;  4ENJ A;  1BN5 A;  3J81 K;  2HOA A;  3VYT B;  2ESN A;  1VND A;  1F43 A;  1LDD A;  1FOX A;  3ERM A;  4EVI A;  2LLK A;  2M8G X;  1B6A A;  4V2F A;  3VWB A;  2KHM A;  3ASO H;  1M1E B;  1TWA J;  3IHU A;  4BHC A;  4QPQ A;  4CH7 A;  2QGU A;  1W36 D;  3G71 I;  1XGS A;  3JRA A;  2VQL A;  1PDN C;  1BI0 A;  4LK1 F;  3W6J B;  2DMN A;  1A5J A;  4RB0 A;  5LGN A;  4E4H A;  4PSX A;  5DD8 A;  1X3U A;  2O0Y A;  2Z2S B;  1X58 A;  1ZG5 A;  3HOT A;  1D5Y A;  2V7F A;  3GFM A;  5FGM A;  3WOD F;  3HKZ N;  1TZL A;  3GTM J;  5FKL A;  4QLC U;  4RM2 A;  5LEJ A;  1APL C;  4LIV A;  1HDD C;  1UMQ A;  3O3K A;  5CQE A;  4UXN A;  2EBI A;  4AC0 A;  2A07 F;  2QQA A;  5J40 A;  1L3L A;  4O3M A;  1QZZ A;  4Y52 J;  5GAG J;  3FXQ A;  3QPL A;  3WTS C;  2Q1Z B;  2Y75 A;  1JKO C;  2DA1 A;  1T6S A;  4LLN A;  3TGN A;  4A3F J;  3LSK A;  3TO9 A;  5LEK A;  4HX8 A;  1SC7 A;  2M0M A;  5F0C A;  5EG0 A;  5FKM A;  4UUS B;  5H6Q A;  4D7N A;  2HPI A;  2EH3 A;  3L1P A;  4DYQ A;  1FC3 A;  1VI0 A;  3LMM A;  1TC3 C;  2ISY A;  4AVZ A;  1REP C;  1IXC A;  2Y9Y A;  1FLI A;  1QVT A;  3I9V 2;  2IGN A;  2R5Y A;  2HKX A;  1Z6R A;  2DA4 A;  3ZR8 X;  4Y7N J;  4UVC A;  2JA5 J;  2WV0 A;  3U2R A;  3G3Z A;  4A0Z A;  3O8H A;  3OIQ A;  4XN3 A;  4IHV A;  4G7Z F;  4OIQ F;  1K83 J;  5C4J J;  2ELH A;  3ZQI A;  2MA3 A;  2E1N A;  2ISZ A;  3KIO A;  3AG3 H;  4Y33 A;  1SMY F;  2R7W A;  4TV7 A;  1OCO H;  2JRT A;  3K4C A;  2XC7 A;  1Y39 A;  1IN4 A;  1X4O A;  3ZMU A;  1WI3 A;  1G3Y A;  3EUH C;  3AAF A;  4IZZ A;  3VPR A;  4CZZ A;  3GTK J;  1JKR C;  4M3G A;  4WXC A;  3DV8 A;  5H2F C;  4A6E A;  4RB1 A;  4CYC A;  1ZRE A;  3H9G A;  1U5T A;  3DLL F;  1P9Q C;  2FOW A;  3DEU A;  4G6D A;  3ZGK A;  2DPU A;  2OAZ A;  1R1T A;  2IGM A;  3HYI A;  1BI3 A;  2IVM A;  2OF7 A;  1T56 A;  4X0G A;  4UUT A;  4D5F A;  5EGO A;  2Z3Y A;  2CQ7 A;  1QPM A;  4OIN F;  2LH9 A;  4IHY A;  1SVO A;  3GTJ J;  3F6V A;  1Y8R B;  3QPT A;  1VQK I;  1WJB A;  1TP4 A;  2L3D A;  2DN0 A;  4KN4 X;  2CW7 A;  2NAZ A;  4M9X A;  1UB9 A;  3BP8 A;  3OY9 A;  3UKG A;  4PJL A;  1ZEL A;  1QA6 A;  1BR1 A;  2MD0 A;  3HHH A;  1VQP I;  1OCR H;  3SZP A;  5IP7 J;  3IWF A;  4JOM A;  5E20 A;  3U9G A;  3CP2 A;  2JVG A;  2Y48 A;  3PQK A;  3I5U A;  1HXD A;  5A2Q Z;  1R1U A;  2FJ1 A;  3DTI A;  3LSH A;  4QIW N;  4XRS G;  2ZKZ A;  5BNG A;  1OR7 C;  3BG3 A;  1FIA A;  3J7A Y;  2KDO A;  3KYD B;  2Q8K A;  3EYY A;  2XRL A;  2K7L A;  1D1B A;  2ZO4 A;  2WY7 Q;  3OR2 C;  2MH9 A;  1UFM A;  2JZY A;  2WB1 N;  2KRF A;  3S8P A;  4N4O B;  4C30 A;  4KIG A;  1I6X A;  2TCT A;  1O7F A;  3QQA A;  4BAC A;  1UCR A;  2XDV A;  4DNC A;  2DAO A;  2H94 A;  4MIM A;  3RYP A;  4J01 A;  1SEU A;  4WXD A;  4CZC A;  5DM7 F;  3OYK A;  4BE0 A;  4A12 A;  2O7O A;  2NRA C;  2PJP A;  4UVA A;  4CXF A;  3BJA A;  1OCZ H;  1W5T A;  4NB5 A;  4O5V A;  4E7Z A;  3K4K A;  5KK1 A;  5HDN A;  4PZJ A;  2XVC A;  4XMY A;  3H1C A;  2F4I A;  3QP6 A;  1KYZ A;  1P7J A;  2R7S A;  1DDN A;  2COM A;  3JTG A;  1E3P A;  3Q9S A;  3V8L A;  4GFB A;  2MC3 A;  3FMQ A;  3L00 A;  5CQG A;  2NVU B;  2XB0 X;  4KFC A;  1S9H A;  4A93 J;  1UG0 A;  5M5Y J;  2VJJ A;  2EV5 A;  2HTS A;  1V3F A;  3T0Y A;  1SAX A;  2VOO A;  2NOG A;  2XKO A;  4LMY A;  5ICG A;  1XGM A;  3HHG A;  2W1O A;  3V7S A;  4G6T B;  5D5W B;  2IP2 A;  2G9W A;  2K9L A;  4WX9 A;  4JK1 X;  3H3V K;  3GBG A;  1K78 B;  3PJR A;  2GAU A;  2VBY A;  2HYG D;  2LF7 A;  1T2K A;  1XCV A;  2E5N A;  4HF1 A;  4L9T A;  4BQA A;  3RPU D;  3BQY A;  4YFN F;  4XLA A;  2VC1 A;  1MH3 A;  1XB4 A;  3ULQ B;  1T08 B;  2JTV A;  3IRQ A;  2CUE A;  3MD2 A;  1MW7 A;  3V8J A;  3JRI A;  1RES A;  1YS6 A;  1BC7 C;  1HKT A;  2BXY A;  3D0S A;  2BE5 F;  2HQN A;  1X1C A;  2RNJ A;  2FBK A;  1ZAO A;  3RTR A;  2DK5 A;  3CC2 I;  1R71 A;  2HZT A;  2A6T A;  2L7K A;  1O3T A;  3GTL J;  4Y17 A;  5KAF C;  3L2R A;  4BKX A;  2ZSI B;  3M7G A;  4AWX B;  4IHS A;  5FKN A;  2IS4 A;  1W7P D;  3WE2 A;  1VZ0 A;  3CP8 A;  5H20 A;  2XAH A;  2V79 A;  2IXS A;  2JPC A;  3EDP A;  3ABM H;  1GV2 A;  3FXR A;  2DFF A;  5HVQ C;  3BR1 A;  4U0V A;  4PGG A;  5FKO A;  3WGH A;  2E35 A;  3R60 A;  4JX5 A;  3ZCO A;  5JFR A;  3OYN A;  4HRI A;  5ERI A;  3PSI A;  4A3L J;  3DFG A;  2PJR A;  4OIO F;  5FLX Z;  1JT6 A;  2JT1 A;  2ME0 A;  2RDP A;  3MEX A;  2X4H A;  1L0O C;  2AHQ A;  5B5E C;  3K4B A;  1SFK A;  2L7F P;  2ECB A;  1MJ9 A;  1ZLK A;  2VAS A;  1BA5 A;  1UST A;  3QOE A;  1SFO J;  1TWG J;  4BL0 B;  3WTV C;  2CU7 A;  3PNT A;  2DT5 A;  3OS2 A;  2NXN B;  2KZV A;  3F8N A;  2CH0 A;  3GZ5 A;  3J7Y J;  3EUK L;  4I0B A;  3ASN H;  1WH7 A;  1WJE A;  1MMA A;  1BI1 A;  1JTY A;  4KN7 X;  1WSU A;  3S1Q J;  1ETY A;  4KIS A;  2WWY A;  5DS9 A;  4HSR A;  2EQR A;  3FBN B;  1OYY A;  2K3F A;  3FXU A;  3P5J A;  4W97 A;  1OCT C;  1G3S A;  3MZH A;  3BR5 A;  4CCL A;  1FY7 A;  1YS7 A;  4N4N B;  2K3P A;  5EEH A;  3ZN1 A;  1FBQ A;  5B1A H;  3ZPL A;  3BJO A;  1BIA A;  1P7I A;  4QTR A;  2ZXI A;  3LFU A;  4M6Y A;  3HOZ J;  2OTL I;  2M0C A;  1EF4 A;  3OYE A;  1D1A A;  1JHH A;  4XLF A;  2HU9 A;  3F8F A;  3Q3S A;  3HUG B;  3GYH X;  4ZYD A;  4IHX A;  4OWR B;  1ZQ3 P;  1FTZ A;  2DA3 A;  4G9Y A;  2KRC A;  2OTJ I;  3A01 A;  2ECC A;  4IJA A;  1GXP A;  4MEX F;  2HOS A;  5EF6 A;  3G1M A;  1U9N A;  1RR7 A;  1RET A;  3TQN A;  4LG3 A;  2OC6 A;  3SJM A;  5GTH C;  2W48 A;  1G2H A;  4WXH A;  3K9T A;  2A68 F;  3GUD A;  4KUM A;  5J8F A;  5LLQ A;  1B9N A;  4HLY A;  3IH4 A;  3S3O A;  1J5Y A;  1MZB A;  3CQZ J;  2K86 A;  1YIT I;  4V19 K;  3J80 K;  2KP6 A;  1DU6 A;  3V42 A;  3VEP A;  3PSF A;  3BG7 A;  2VXD A;  1FX7 A;  2JJ7 A;  3OYA A;  2NVT J;  3RPQ A;  2H6C A;  4KMU X;  1G8X A;  3TP0 A;  4DJA A;  2L01 A;  2JUG A;  4NQW B;  5AIP A;  1FSH A;  3M07 A;  2V4J C;  3COA C;  1EKE A;  2QSG X;  3GTP J;  2CJJ A;  1GHC A;  2WAQ A;  2O6G E;  3GLL A;  5ILS A;  3WHC A;  3F9K A;  1JT0 A;  4ON0 A;  1QPI A;  1CF7 B;  4Y3O A;  2E60 A;  2XGC A;  3HM5 A;  1WZ2 A;  2KT0 A;  1PP8 F;  4FX0 A;  4CA0 A;  4ZZD A;  2DOE A;  2P6S A;  2FD5 A;  4A3G J;  2NVY J;  1RI7 A;  2IS2 A;  4RLQ A;  2ACJ A;  5DCM A;  4CCO A;  5DYM A;  3U1K A;  3JTH A;  1DPU A;  4LIT A;  2W7N A;  3E5X A;  5D6F A;  2CQK A;  3QU6 A;  2GLO A;  3BT9 A;  3TDZ C;  3KP5 A;  4EJO A;  4Q47 A;  2HFH A;  1FNN A;  1JGS A;  4DGW B;  4XLH A;  5CVR A;  3QAH A;  1MDM B;  3HSE A;  5CYV A;  1E3H A;  2AQF A;  4XR6 A;  2ZXJ A;  3Q0V A;  2DMU A;  4D1Q A;  4XOT A;  2EFQ A;  2FE3 A;  2VJ5 A;  4ZDL A;  2FQ3 A;  5F08 A;  2ZJR F;  1MJB A;  4XKB A;  1W1W E;  2WBM A;  5BMZ A;  1Y1W J;  2KKO A;  2EFO A;  2QWW A;  1V5E A;  2QA4 I;  3GO5 A;  1SD7 A;  5CVJ A;  2R7R A;  4XRM A;  4WCG A;  1J59 A;  4HX7 A;  2E2J J;  5IT9 Z;  3KFW X;  2OCC H;  4G8X A;  2X6W A;  1TNS A;  2EWN A;  3VOE A;  2DQL A;  4NBQ A;  2Q2E A;  2BBY A;  3DBL B;  2V6E A;  3J81 Z;  3JRG A;  1H0M A;  1VQ9 I;  5L3G A;  1K6O A;  2OZU A;  2Q0O A;  2L9R A;  4M6X A;  3TW7 A;  5EYR A;  3MKL A;  9ANT A;  2RV8 A;  3LA2 A;  3E0J B;  4S05 A;  3CJQ B;  1MMD A;  2KLO A;  2ZME A;  2XAQ A;  2IT0 A;  1QGP A;  3H36 A;  2E7X A;  1HQC A;  2CUF A;  2FUG 2;  4E7L A;  1Z9C A;  3AL0 B;  4NUB A;  1Y6I A;  2DDA A;  2M87 A;  3QOP A;  1BW6 A;  5JLW A;  3LSG A;  3TOA A;  2E1C A;  1HST A;  4RA2 A;  4OAY A;  1AWC A;  2MYS A;  3KP3 A;  2DQR A;  1Z7U A;  1G4D A;  5IYD J;  3S15 J;  2GIV A;  4EM2 A;  1MNM C;  5L3D A;  3MKW B;  3FM3 A;  3E1S A;  2F5E A;  3K69 A;  5D8L B;  3DU5 A;  2FF4 A;  1LEA A;  3PUF A;  3AG4 H;  3BR6 A;  3HKZ A;  3T5X A;  4EQQ A;  4F91 B;  2ZNZ A;  4U7D A;  3S14 J;  4A3D J;  3OIP A;  2DA2 A;  4EAT A;  1BIB A;  2YUS A;  3GTG J;  2V1U A;  1N78 A;  1O3S A;  2O5R A;  3D5R C;  2VJ4 A;  5L3F A;  4ASN A;  1G59 A;  3GEZ A;  3ZQG A;  3KYL A;  3GME A;  4RLF A;  2CV2 A;  1QQI A;  1KZH A;  1EJ9 A;  1FYL A;  2ZC2 A;  2AS5 F;  3L2Q A;  1FSE A;  4KT6 A;  3BTI A;  4Y4R A;  3VDX A;  2GWR A;  3L2C A;  4LIU A;  2BW3 A;  5JHF A;  4E7K A;  5ILV A;  4IRI A;  1T38 A;  4F7Z A;  5J4V A;  3CC4 I;  2X48 A;  2XAF A;  4HST A;  2VE8 A;  3CMM A;  2L54 A;  5IP6 A;  2Y9Z A;  1WRJ A;  4O6J A;  2YS9 A;  5CJ9 A;  4BU2 A;  2BV6 A;  3CDL A;  5F27 A;  1UZC A;  3CMY A;  5K5O A;  1QZE A;  2W00 A;  4F93 B;  1X4P A;  1LJ9 A;  2ICW G;  3I59 A;  1I5Z A;  1HKS A;  1Y1V J;  3FK6 A;  5K7H A;  4RGS A;  4XRF A;  1BW5 A;  1ZG3 A;  2LY2 A;  2DTR A;  1MMG A;  4L5I A;  4B43 A;  4CYC B;  3C3W A;  5D5U B;  1U5T B;  4LJZ F;  2UUZ A;  4P96 A;  2HDC A;  1S7A A;  4HV5 A;  3GFJ A;  1JTX A;  4JBA A;  2BOL A;  1F4K A;  4HNU A;  1LVA A;  2HR3 A;  4IQJ A;  5EGO B;  1AKH A;  3JCU C;  3KZI C;  4BJT A;  4FAS D;  1IN8 A;  1KQ0 A;  3G6E I;  3W2W A;  3JRH A;  3TL4 X;  1IN6 A;  2A61 A;  4HPQ A;  2B7E A;  2BYV E;  2Z33 A;  1TT0 A;  1OFC X;  2QCO A;  4RMN A;  1I27 A;  4HOB A;  2LF8 A;  4M3E A;  5HS7 A;  2NOJ B;  3FX3 A;  5LBQ A;  2HEO A;  4GRI A;  3ZQF A;  2VLA A;  4LB5 A;  2DA7 A;  2W25 A;  3SEZ A;  4P55 A;  1JUP A;  4YG2 F;  2JA7 J;  1OKR A;  5E79 C;  3QPH A;  4ABZ A;  1XTA A;  2Y31 A;  2ZFW A;  3C2G A;  2HXO A;  5HOO A;  3JRF A;  2RGV A;  4M73 A;  1JJ6 C;  5FRO A;  2EZL A;  2FOK A;  2XGE A;  1BJZ A;  5C4X J;  3BJ6 A;  4PSW A;  3H0G J;  4MFE A;  4GYG A;  5EZG A;  1X1P A;  4R8H A;  1HOM A;  4M9Z A;  5ILU A;  2VON A;  1QU3 A;  3WU2 C;  3OS0 A;  4W1U A;  2R7Z J;  1PUF A;  1A6I A;  2IA1 A;  1LFP A;  5B1B H;  4JP0 A;  5AON A;  5GP9 A;  1O7L A;  2K85 A;  3G2B A;  2QBY A;  1YTY A;  2RKH A;  4F55 A;  5GPA A;  2VKE A;  3TOB A;  3WG9 A;  3JRC A;  3I4N J;  1OQY A;  2VL8 A;  4B44 A;  4YII A;  3D1N I;  2OZ6 A;  1IUY A;  1Z67 A;  5L3E A;  4M3F A;  4Q48 A;  2YU3 A;  4A3K J;  3K4M A;  3RQ4 A;  4AVP A;  5DDG A;  1HW1 A;  1GVJ A;  3H0D A;  3HGY A;  4K2E A;  2Z5U A;  5M3F J;  1WQ2 A;  1GT0 C;  4WWC A;  1YE9 A;  1XC5 A;  4UVB A;  4OMY A;  1VQ6 I;  5HLH A;  1FOK A;  1YW8 A;  2IBD A;  1RRJ A;  2CGP A;  2C6Y A;  1YIJ I;  3VSL A;  3KPH A;  3HOS A;  2N8G A;  3ZMS A;  1YJN I;  4UNO A;  1Q1V A;  1Q1H A;  2WB1 A;  2I10 A;  3B6C A;  4YIR X;  1FJL A;  5FRN A;  1N77 A;  3ZMZ A;  4GCV A;  1JHF A;  3OYB A;  3OYL A;  2Z16 A;  1WJC A;  1QVU A;  5FO5 A;  3SQN A;  5IP9 J;  2GOX B;  1UHM A;  2DMQ A;  4BJ5 C;  2R4G A;  2PLY A;  3K70 C;  1T95 A;  3CF2 A;  3ONQ A;  2NS0 A;  4L5J A;  1O3Q A;  1H89 C;  3ZN0 A;  1ZH5 A;  2O03 A;  3C7J A;  3MAJ A;  3OYG A;  1D8J A;  3DQV C;  5IOZ A;  4BS9 A;  1FWZ A;  3FKI J;  3CD6 I;  5EZH A;  5F1J A;  4IRG A;  4RM3 A;  5LHI A;  2HQR A;  2PMZ N;  4KJZ A;  3A1Y A;  2IRF G;  2DI3 A;  4XSX F;  1A36 A;  1ON2 A;  4Q4Z F;  3I55 I;  2CUJ A;  2QUF A;  1MH4 A;  3FWE A;  4I98 B;  1IV6 A;  2EJR A;  4RAZ A;  1KU9 A;  2LMD A;  2MD5 A;  3IRR A;  3VB2 A;  3TED A;  2HWV A;  5DM6 F;  1XPX A;  2OUM A;  1B8I B;  2LBF A;  3LSR A;  5K5R A;  3T1B A;  3SEQ A;  3B73 A;  4ETS A;  3HRS A;  1YIO A;  2VOP A;  1HKQ A;  2QM3 A;  3L7W A;  3OSF A;  1XSX A;  2A69 F;  1JKQ C;  3CCR I;  3IH2 A;  3GFI A;  5BPD A;  1OIS A;  2KQR A;  2QLZ A;  3FXK A;  3MKZ A;  2K02 A;  1J9I A;  3IKV A;  2L2O A;  2EZI A;  3FXJ A;  3OOU A;  1FOY A;  1DP7 P;  3DPL C;  1VQ8 I;  4CHU A;  2JSP A;  1X19 A;  4FE7 A;  4HBL A;  1V55 H;  2GXA A;  3CLQ A;  3H3Z A;  4BXU A;  2M45 A;  5E1Z B;  3RPU A;  5FLV A;  2GA1 A;  1B72 B;  2LOO A;  5DUK A;  2B63 J;  3GTQ J;  4KDP A;  3HPH A;  2DYR H;  1JE8 A;  2LSO A;  4DYC A;  4IQ4 A;  2RRE A;  1UJ8 A;  4I7H A;  5FFZ A;  1TTY A;  3NAR A;  4HQE A;  4FET A;  1IO2 A;  2QVO A;  1Z3X A;  2CWE A;  5IOY A;  4Q5S F;  2CV0 A;  3MZ8 A;  2PJR B;  4L0Z B;  1ETQ A;  4BJ6 C;  4C2M J;  5HOD A;  1LE8 B;  1LB2 A;  4YFK F;  2DO7 A;  3CUO A;  5E3M A;  2H1L A;  4BDY A;  3DKY A;  2FA5 A;  1ZG1 A;  3S3M A;  1I50 J;  1W7P A;  1YI2 I;  4CO8 A;  3LQR A;  3BCB A;  2AQE A;  4ZJZ A;  4ANJ A;  2OQR A;  4CYD A;  3M1C A;  4EJU A;  3U21 A;  4L18 B;  2FSW A;  1R5H A;  2EIJ H;  5TGT A;  4B4C A;  2Z9O A;  2X1D A;  5J8C A;  1WI9 A;  2L5Q A;  1XMX A;  1ONV A;  1P2F A;  3DEE A;  3OS1 A;  1A31 A;  2CFX A;  1T98 A;  4HNT A;  3P9C A;  2H1K A;  4BUP A;  2D45 A;  1AA7 A;  2ZXH A;  1BL0 A;  2MSY A;  3EYI A;  1P4X A;  4P9U A;  1IW7 F;  2QQ8 A;  3N4M A;  3J7Z I;  3F8C A;  3ZOB A;  2MLK A;  2KJC A;  5H6R A;  2BVL A;  4GO1 A;  1K4T A;  2CW0 F;  2MC4 A;  1IN5 A;  1YW9 A;  2M2E A;  5F0F A;  1SFE A;  2EA2 A;  4M74 A;  1U8R A;  2F48 A;  2STT A;  2R7T A;  5JVG F;  5F64 A;  3A0B C;  4IEJ A;  5D4R A;  2HXI A;  4IKF A;  1B4A A;  3CCE I;  2I5U A;  1DUX C;  1IF1 A;  2A5Y B;  2VJI A;  3OYH A;  5BPI A;  4IL6 C;  5DUI A;  5C3E J;  1RKW A;  3TMO A;  4I99 C;  3I64 A;  5BQT A;  2CG4 A;  1F36 A;  1W0U A;  1TL8 A;  4ESB A;  2X51 A;  2ZME C;  2E1M C;  1J0R A;  3SZG A;  3HRM A;  2XAJ A;  5CLS A;  1R5G A;  3QP5 A;  3WG7 H;  4XN0 A;  4M3B A;  1W36 C;  5IT3 A;  1U2W A;  1WPK A;  2MGQ A;  3B02 A;  1BR4 A;  2W24 A;  2E7W A;  3CCQ I;  4II2 A;  2R93 J;  5E1X A;  5F0H A;  2XPW A;  1BI2 A;  2EZK A;  4HF0 A;  2PX9 A;  4MHG A;  3MMY B;  1K4S A;  2W4S A;  2ELK A;  3CUQ C;  3IV5 A;  4ZTF A;  1XN7 A;  2XAG A;  3J80 Z;  1MKM A;  2P7V B;  4KIT B;  3FBI B;  2DFI A;  2W82 A;  2PBI A;  2X0L A;  3K1N A;  4JX6 A;  1VQ5 I;  5DCM B;  3FIS A;  1R58 A;  4FX4 A;  1XX5 A;  2LDU A;  1RPW A;  1TQP A;  4M72 A;  2R5Z A;  1IDY A;  3F3X A;  1J7K A;  3E7L A;  1YW7 A;  1DU0 A;  4XBF A;  2LNB A;  1MSE C;  3LSI A;  1O3R A;  3ZMV A;  2JA8 J;  5LGU A;  3ECH A;  4OIP F;  3F23 A;  3L09 A;  2HOT A;  1WCM J;  2IGK A;  4UUS A;  4A3E J;  1IJW C;  5D6E A;  2I8D A;  2G7H A;  2CSO A;  2TDX A;  2V9K A;  5CKT A;  2DMP A;  4BQQ A;  3MQ0 A;  3OR1 C;  5ICE A;  2R7O A;  3CES A;  4LFU A;  3JAM K;  4NC6 A;  4YIF A;  1KA8 A;  2P7C B;  4LGW A;  2GA2 A;  1HW2 A;  4C2U A;  1KU3 A;  1G6N A;  3N05 A;  5CVU A;  2AO9 A;  3WE3 A;  1D3Y A;  2XRO A;  4AIJ A;  3KX2 A;  2OCE A;  3IH3 A;  4P9F A;  3S32 A;  5FJ8 J;  1F5T A;  3PL8 A;  2LY1 A;  4IOC F;  3HOV J;  3S1M J;  2CS3 A;  2IS6 A;  1U78 A;  2OV7 A;  2D2W A;  2K40 A;  3REO A;  5FB2 A;  4MGR A;  3M3Y J;  1NK2 P;  1Z77 A;  2ID3 A;  2VBW A;  1ZRC A;  4XLN F;  3FMR A;  3V7C A;  2IS1 A;  3RYR A;  3M4O J;  2Q2E B;  3ABL H;  4DOZ A;  2RNG A;  2D5V A;  3E3V A;  5J6X A;  3AG1 H;  1KQ8 A;  4ZYE A;  1RNL A;  1Y0U A;  4XRS A;  3MZY A;  1JI8 A;  5FD5 A;  1G3T A;  4PDK A;  2E2I J;  3H3U A;  1QZY A;  1AHD P;  4G12 A;  2E19 A;  1E0E A;  1E17 A;  1YOV B;  1W5C C;  4IHT A;  4B48 A;  3CCY A;  5TRD A;  4E7S A;  5LHG A;  5IY5 H;  5D8K B;  3TP3 A;  6PAX A;  2X1E A;  3PFI A;  3PFY A;  1R36 A;  2IA0 A;  4AU7 A;  2JN6 A;  1NG7 A;  2HPM A;  2JSC A;  1WJD A;  2R7X A;  1KU2 A;  1HCR A;  3H5R A;  2VC0 A;  3CJN A;  4CDG A;  2M34 A;  1JKP C;  3CCV I;  1RZ4 A;  3OL3 A;  2DOA A;  4DZJ A;  3SDB A;  2G7U A;  1AU7 A;  1ERD A;  2E5Z A;  5DEQ A;  4BNC A;  1D0Y A;  3NEU A;  5IPA A;  4B47 A;  2CW8 A;  1ETW A;  1OPC A;  2MAB A;  2QQ9 A;  4XIC A;  2LG4 A;  1HC8 A;  2P0W A;  4C3I J;  3Q0U A;  2W85 A;  3DBH B;  4A6D A;  2IW5 A;  2VQC A;  2F2E A;  2EIK H;  1X2M A;  4RAF A;  4AUX A;  1SFX A;  1YO5 C;  2STW A;  5E3O A;  3L2V A;  4ZYA A;  3BWG A;  3S17 J;  2MW8 A;  2BW3 B;  3H5A A;  4BY7 J;  2VN2 A;  2WAE A;  2X6Y A;  3A4C A;  3BQZ A;  3ZXS A;  4DBR A;  5M5W J;  1T8I A;  3S2D J;  4G7H F;  2VQH A;  2LFB A;  1IRX A;  3ROU A;  1X1D A;  4ENM A;  1HA8 A;  1R9T J;  1MBG A;  1ZR4 A;  1QBJ A;  3FXM A;  2X6O A;  3WGI A;  1Z1D A;  2DDB A;  4QSH A;  3I59 B;  3VYU B;  1E3O C;  3SFI A;  3HSF A;  5J47 A;  4H4K C;  1R5I D;  3OV8 A;  1YJW I;  1FMW A;  2CO5 A;  5K1Y A;  1FBU A;  1NK3 P;  3DBR B;  3C18 A;  4G7O F;  3K10 A;  2R7D A;  3S2W A;  4YFX F;  2QSF X;  2V26 A;  4OIR F;  2M7A A;  3JRD A;  3WHB A;  1GUU A;  2QF7 A;  3HEF A;  1UEL B;  1ZGA A;  1BC8 C;  3BTC A;  3LSM A;  4CIC A;  1ZRD A;  1IZ1 A;  1AKH B;  3DPU A;  3CMA I;  3NWS A;  3CLO A;  3HL2 A;  4JQF A;  3ESW B;  4RB2 C;  2V6C A;  3RQI A;  2DBB A;  2QZ8 A;  2ZXW H;  3RKW A;  4X1E A;  4BGD A;  3W6K B;  2LRE A;  3DF8 A;  3JR9 A;  1QO0 D;  1TQI A;  4J00 A;  3BY6 A;  1J75 A;  4RGR A;  1MIJ A;  1ZAR A;  1BOB A;  2ZCW A;  1V4R A;  3DLA A;  4LOC A;  1POG A;  1TWC J;  2JRM A;  4GGG A;  3NAU A;  2X9D A;  4E6K G;  4FCY A;  3HC7 A;  1CGP A;  1H9T A;  1GV5 A;  5GTI C;  3F0C A;  2ZNY A;  2DW4 A;  5E1W A;  4EV0 A;  1YRN A;  4HQM A;  1YG2 A;  2XSJ C;  2A6E F;  3MWM A;  3G4S I;  1I3A A;  4B1R A;  1IUF A;  4ENK A;  1O4X A;  5FLM J;  5D5X B;  1IGN A;  1UAA A;  1WHU A;  4A0Y A;  3VSK A;  4A3C J;  4XID A;  2HVQ A;  2XGX A;  4F3Q A;  3O6B B;  1U3E M;  3UR3 C;  4M9S A;  2NS7 A;  3LQQ A;  1TWF J;  2P5L C;  5FKK A;  4N0B A;  2LRD A;  2FEZ A;  2MFZ A;  3H35 A;  1RR8 C;  3OSG A;  2E36 A;  3BZK A;  4BDZ A;  2UXX A;  2QQB A;  4EMS A;  1R49 A;  1BM9 A;  2HNH A;  1MD0 A;  1WGX A;  2HGC A;  1QHH D;  4BQN A;  2BY3 A;  1LFU P;  1OYI A;  3TO7 A;  5E3L A;  4EM1 A;  1D8K A;  3VYR B;  1EH6 A;  2Y0S N;  2HYJ A;  4L9J A;  1ETK A;  4D0P A;  3RDI A;  4DIQ A;  1EH8 A;  1OMI A;  1MBK A;  2V9P A;  3QU3 A;  2JWT A;  3FK7 A;  1IAW A;  1J09 A;  2VPL A;  1STZ A;  5IYB J;  1LEB A;  3F72 A;  2G0E A;  4I76 A;  2QSH X;  1WH5 A;  4EGZ A;  1X3Z B;  2HYF A;  1W4M A;  1XMA A;  1MMS A;  1TQM A;  2XIG A;  3F8B A;  2X6X A;  2WTE A;  3ZQL A;  1XGN A;  4PFP A;  1MBJ A;  1H8A C;  5EG0 B;  2ZBK A;  4UB6 C;  3CUQ A;  3EQL F;  1USS A;  5DD4 A;  1O57 A;  2KIF A;  4DW6 A;  2V1X A;  3E97 A;  4IVN A;  3HRU A;  4HDU A;  4EJT A;  3JW4 A;  2NVQ J;  3BDD A;  1FOW A;  2MBF A;  4A5M A;  2IGO A;  1FYM A;  1YLF A;  2B0L A;  3KYC B;  1FIP A;  2R5Y B;  1HF0 A;  4C9Y A;  3CDI A;  3KEY A;  4OU0 A;  2NNN A;  3I58 A;  2XKP A;  3BRO A;  4BE2 A;  1SFU A;  4CCM A;  2LKS A;  5BOX A;  5B3S H;  3DPT A;  4HA8 A;  2LBF B;  1DP3 A;  1MSF C;  1HDP A;  1SVM A;  3E5Q A;  1BR2 A;  2FRH A;  1MND A;  2HVR A;  1HSJ A;  1WJA A;  3PIO F;  2IAI A;  4BEH A;  3WU1 B;  2CQX A;  3AKZ A;  3JRE A;  1KYW A;  3F8M A;  3Q5F A;  4RDU A;  1B1B A;  3DTE A;  3EPZ A;  2PMZ A;  2DA5 A;  4XKC A;  2HQ5 A;  3OYC A;  1P92 A;  3P7N A;  4XSZ F;  2CUZ A;  4KIB A;  2PMH A;  5DTD A;  3HUG A;  3ABK H;  4CUG A;  4CGZ A;  4B09 A;  2VT2 A;  3GZ6 A;  2CMP A;  4CCN A;  4M6V A;  2DOD A;  3HBL A;  4ITV A;  3CJR B;  2L9V A;  5EEG A;  2R3S A;  1VF9 A;  2VKD A;  2HZD A;  1ENH A;  2WAF A;  4BXX J;  4HF2 A;  1LUJ B;  3K1P A;  2GXB A;  1D5V A;  2LTP A;  1ODD A;  3H92 A;  3R4K A;  2MH2 A;  4BH9 A;  3TDU C;  3SFZ A;  4N9H A;  3M8F A;  5J3L A;  2E71 A;  4C3H J;  1OLT A;  4MQ9 F;  2KL4 A;  1ZRF A;  1ULY A;  2XF6 A;  3NQO A;  3ELK A;  2K9Q A;  3MVP A;  2LD5 A;  1QHG A;  2L9S A;  4MO7 A;  1FP2 A;  4XOP A;  3AFH A;  4R79 A;  1DGR M;  1Z7L A;  2XGD A;  5E18 F;  2VE9 A;  4NQW A;  1PUE E;  4PFO A;  3CCJ I;  4A3B J;  3WTX C;  1YYV A;  3TBI A;  2H27 A;  3H9J A;  3PNY A;  3TW6 A;  4DQ2 A;  3A03 A;  4PGH A;  3K2A A;  1JXS A;  3DU6 A;  1N25 A;  1TBX A;  4LG0 A;  1ZKG A;  3HTU A;  3VFZ A;  4HNV A;  3MFK A;  5LD2 C;  2VT3 A;  3G1O A;  4MQV A;  1IRZ A;  2GQQ A;  3GXO A;  2LYC A;  4EM0 B;  1LQ1 A;  2E2H J;  3SDG A;  1XD7 A;  2DOF A;  4E7I A;  4ZTJ A;  1A6Q A;  3F22 A;  3TKY A;  2CFO A;  3FHN A;  2XRN A;  5GAH J;  3PO3 J;  5J1U A;  4WF2 A;  2DMT A;  4G94 A;  2NVX J;  2P5K A;  1R4N B;  4NNJ A;  2LP0 A;  3HOW J;  2LK2 A;  4KNY A;  2JA6 J;  3PUB A;  4NC8 A;  3T8T A;  4BXF A;  4PJN A;  1MDM A;  3FXL A;  2DT6 A;  1V5F A;  2EIL H;  4PJ0 C;  1CQT A;  1UHS A;  3EET A;  3FDY A;  3VOD A;  4MTD A;  2CV1 A;  2LKP A;  2XHK A;  3FHZ A;  2HS5 A;  4E7H A;  1KQ9 A;  1IXS B;  2GIZ A;  3A0H C;  1D0Z A;  2VB6 A;  2Z1D A;  3VYS B;  1LFB A;  1ETX A;  5DCF A;  1R22 A;  2DU9 A;  1PP7 U;  5M5X J;  2O9L A;  3I56 I;  1FTT A;  4U0Y A;  1ETO A;  2CQN A;  3HXL A;  5F04 A;  2J5O A;  3G1L A;  4C2T A;  3CJT B;  3JSP A;  2OD5 A;  3A02 A;  1JGG A;  3ISP A;  4U88 A;  3V7R A;  4Y15 A;  3ZMT A;  2Y30 A;  2ZB9 A;  4ZH4 F;  2XPU A;  2EV6 A;  3E6C C;  4RB3 C;  4ESF A;  2DLL A;  2O61 A;  1XCB A;  1PYV A;  3P9K A;  4DBQ A;  1U6G A;  1IC8 A;  2EK5 A;  2ZJQ F;  2M9H A;  1Z3Y A;  1OYW A;  3BPV A;  2XF5 A;  2E34 A;  2HTJ A;  5E17 F;  3BOQ A;  3R6S A;  3N97 A;  3K1M A;  1ZYR F;  1MBE A;  2V1D A;  4FHT A;  1DGW Y;  2BXZ A;  2GZW A;  2PQ8 A;  4Z6Y A;  5M3M J;  4EEF G;  4KYW A;  2BZT A;  2OBP A;  1K61 A;  2FMY A;  3KE2 A;  1SVL A;  3M9A A;  2PFB A;  1SAN A;  2K27 A;  2M1B A;  2R5Z B;  2WAD A;  3PNV A;  2FNA A;  4P1W A;  3GFL A;  3FMS A;  2P81 A;  1K79 A;  2P8T A;  3HOX J;  1RIO H;  3UNG C;  1ZGJ A;  5GAE J;  3U1D A;  4AID A;  3P9I A;  4LD5 A;  5KCM A;  1I1G A;  5LGT A;  3KP7 A;  4ZC3 A;  1D0X A;  2Z99 A;  3IL2 A;  4MNU A;  4I09 A;  3PO2 J;  3KLO A;  4XKW A;  4MLO A;  1HW5 A;  1P4W A;  1ETV A;  1B59 A;  2DTZ A;  2V9V A;  4NDL A;  1NH3 A;  1TW3 A;  2JVH A;  1VQM I;  4XL9 A;  3HRT A;  2KMU A;  2KIU A;  1OJL A;  1LKX A;  1A04 A;  2M5W A;  4G6Q A;  2K4J A;  4EJV A;  3D5L A;  3ECO A;  5GPC A;  4JYK A;  2LC2 A;  3K4N A;  4HW0 A;  4AYB N;  3W6V A;  2L7M P;  3K4L A;  4X6A J;  4JX4 A;  1V5G A;  2H09 A;  1FEX A;  1GDT A;  4ZDO A;  2KRH A;  4OOI A;  1D1C A;  4A5N A;  3JAM Z;  2EIN H;  3LOC A;  1G3W A;  2ZJP F;  2ME6 A;  2VBZ A;  2F4M B;  4MEY F;  1V54 H;  2EFW A;  2BGC A;  3RKY A;  1U0J A;  4HX4 A;  3QPS A;  3DWL E;  4LK0 F;  1S7O A;  2A6H F;  4IXA A;  2IPQ X;  3GWZ A;  5LRR A;  4Y13 A;  1Z91 A;  4IO9 F;  1XS9 A;  2DJI A;  3I0T A;  4P5O A;  3E5U A;  1ZK8 A;  2K9S A;  2Y0M A;  2DYS H;  2PI0 A;  1YX5 A;  5CVV A;  5E8G A;  1ORK A;  2BY1 A;  2VKV A;  4XLE A;  1MBH A;  4XLP F;  2DFE A;  3BR2 A;  3V4G A;  3F21 A;  1T0F C;  2JPB A;  3IKT A;  3QOD A;  4FQG A;  4S04 A;  3WTT C;  2BHZ A;  3WU0 A;  2RC4 A;  2RAE A;  2XPV A;  1SD5 A;  2LR8 A;  2WC2 A;  1VFC A;  3B6A A;  3DP7 A;  3IUO A;  3O8G A;  5KNL A;  1IN7 A;  3J7A O;  3MKY B;  2M7B A;  4H0E A;  3WTZ A;  4M3D A;  1QNT A;  3HDD A;  2P4W A;  2R0Q C;  3EUA A;  1ACI A;  2IJL A;  2QKM B;  4LB6 B;  3M8E A;  3V8K A;  4B8X A;  3LWF A;  1U9O A;  1Y56 A;  4PJJ A;  4UB8 C;  1LDJ A;  2ZFU A;  3BG9 A;  2V1N A;  1HBX G;  3CC7 I;  3A01 B;  3KZZ A;  2MG4 A;  1B9M A;  2X85 A;  4FTH A;  1IXR C;  3HOU J;  2A05 A;  2EA4 A;  2L7Z A;  1Y0N A;  4KA4 A;  3HGG A;  2KDZ A;  2ETH A;  1I3Q J;  3GVA A;  2WY8 Q;  2NYX A;  1I39 A;  1R00 A;  1H88 C;  4UV9 A;  2EB7 A;  1RC9 A;  2FX0 A;  1JUM A;  4E7J A;  2Y69 H;  3GTO J;  2YPR A;  4RAY A;  4A0X A;  3KEQ A;  3S93 A;  3M1E A;  3WTW C;  4A3I J;  1KU7 A; 
#chains in the Genus database with same CATH homology
 4RLF A;  1X1D A;  1HA8 A;  2CV2 A;  3LSK A;  3VYU B;  3L2Q A;  2M0M A;  4KT6 A;  4XKV A;  4Y4R A;  3VDX A;  4E7K A;  4LIU A;  2BW3 A;  4H4K C;  5JHF A;  1FMW A;  2HPI A;  4HST A;  3BLY A;  3CMM A;  3I3L A;  3H9Q A;  3K10 A;  3LMM A;  4BU2 A;  2V26 A;  4AVZ A;  2M7A A;  1UEL B;  3I9V 2;  3LSM A;  2IGN A;  2W00 A;  4F93 B;  1X4P A;  3QYB A;  3DPU A;  3ZR8 X;  3NWS A;  2BVM A;  3HL2 A;  2DXI A;  4JQF A;  2WA0 A;  3W3C A;  1GLN A;  3OIQ A;  4XN3 A;  2LY2 A;  1MMG A;  4BGD A;  2ELJ A;  2LRE A;  4B43 A;  4J00 A;  3HPG A;  3CZ6 A;  3QYF A;  2UUZ A;  4Y33 A;  3OMY A;  1BOB A;  4OAZ A;  2BOL A;  1R6R A;  4HNU A;  4IQJ A;  2R7W A;  1EA3 A;  3DLA A;  3K4C A;  1WJ5 A;  3DKX A;  2XF7 A;  4PJM A;  4E6K G;  4BJT A;  2XC7 A;  4FAS D;  4CCK A;  1X4O A;  3HC7 A;  3W2W A;  5FRM A;  3QYE A;  3TL4 X;  3EUH C;  4HPQ A;  4IZZ A;  3H5N A;  1TT0 A;  4RMN A;  3W2A A;  2UWM A;  1WFX A;  2XSJ C;  2NOJ B;  3OYM A;  3H9G A;  4GRI A;  5LFA A;  1P9Q C;  2VLA A;  3HG9 A;  3SEZ A;  3ZGK A;  2IGM A;  1UAA A;  2RQQ A;  2X1C A;  3VSK A;  4X0G A;  2HVQ A;  3L2U A;  3C2G A;  4F3Q A;  5HOO A;  2LH9 A;  2GOM A;  3BG6 A;  3UR3 C;  2M4K A;  3OYD A;  5FRO A;  1WJB A;  2LRD A;  2CW7 A;  2MFZ A;  4PSW A;  3H35 A;  2E1M B;  1WJF A;  3OY9 A;  1QU3 A;  4PJL A;  1ZEL A;  1YX3 A;  5HLT A;  4ZDP A;  4QPO A;  3OS0 A;  1BR1 A;  2MD0 A;  4BDZ A;  1LFP A;  2VKH A;  2HNH A;  4JOM A;  3G2B A;  4F55 A;  1QHH D;  4BQN A;  3CP2 A;  2JVG A;  3VYR B;  2KPM A;  2VL8 A;  4B44 A;  3DTI A;  4DIQ A;  3LSH A;  4CSW A;  2Y0S A;  1J09 A;  3K4M A;  3RQ4 A;  2VPL A;  1OR7 C;  3H0D A;  3J7A Y;  2KDO A;  1YE9 A;  3FKJ A;  1D1B A;  1PJR A;  2WY7 Q;  3OR2 C;  3VSL A;  3HOS A;  2X6X A;  4PFP A;  3S8P A;  4N4O B;  4C30 A;  3D5S C;  4BAC A;  1LDK B;  3K4J A;  2WB1 A;  4B3X A;  4PUS A;  5FRN A;  2XDV A;  1N77 A;  3OYJ A;  2QKL B;  3OYB A;  3OYL A;  2Z16 A;  4BEH B;  4J01 A;  1WJC A;  4CZC A;  3OYK A;  2UV1 A;  4BE0 A;  2GOX B;  2IGO A;  4BJ5 C;  2R4G A;  4C9Y A;  3K70 C;  3KEY A;  4E7Z A;  1T95 A;  3CF2 A;  3ONQ A;  3K4K A;  3IAS 2;  4BE2 A;  1KON A;  4XMY A;  2F4I A;  4CCM A;  3OYG A;  3DPT A;  3NWT A;  2LBF B;  1FMV A;  3DQV C;  4XQF A;  2R7S A;  4BS9 A;  1DP3 A;  2HQA A;  1BR2 A;  1MND A;  2HVR A;  1WJA A;  4RM3 A;  4BEH A;  4F92 B;  3OL4 A;  3ZQQ A;  3AKZ A;  4KJZ A;  3A1Y A;  5CQG A;  5HNH A;  3DTE A;  3EPZ A;  2CUJ A;  1S9H A;  2PMZ A;  3OYC A;  4XKC A;  1UG0 A;  2VJJ A;  2R7U A;  2CUZ A;  2VXZ A;  4IX7 A;  3W2V A;  4XON A;  3RSN A;  4CUG A;  5HNF A;  4CCJ A;  3AL0 C;  2OUM A;  2LBF A;  2CMP A;  5CPR B;  4CCN A;  2W1O A;  4ITV A;  3CJR B;  4G6T B;  2VKD A;  2HZD A;  2WAF A;  3SEQ A;  2K9L A;  3GBG A;  1X1A A;  3ZRG A;  3PJR A;  2KQR A;  2E5N A;  3MKZ A;  2L2O A;  3OOU A;  3RPU D;  1OLT A;  2KL4 A;  3DPL C;  2XF6 A;  2JSP A;  4XLA A;  1X19 A;  3BCA A;  2F6C A;  1MNE A;  1QHG A;  2L9S A;  4XOP A;  4R79 A;  3AFH A;  3MD2 A;  1DGR M;  1Z7L A;  1MW7 A;  2LOO A;  4PFO A;  3HPH A;  3TBI A;  2JA2 A;  3H9J A;  3PNY A;  4IQ4 A;  2RRE A;  1X1C A;  4XLC A;  3DU6 A;  3RTR A;  4FET A;  5LD2 C;  1DQU A;  1Z3X A;  2A6T A;  2L7K A;  1Z21 A;  2LYC A;  2CV0 A;  2PJR B;  4BJ6 C;  3L2R A;  3OWT A;  2ZSI B;  4XM3 A;  2IS4 A;  4BDY A;  4E7I A;  4ZTJ A;  1VZ0 A;  3DKY A;  2CFO A;  3CP8 A;  3FHN A;  3S3M A;  1N75 A;  2HDW A;  2IXS A;  3BCB A;  2M4G A;  2AQE A;  4NNJ A;  4YEJ A;  4ZJZ A;  5HVQ C;  4ANJ A;  3PUB A;  1K6Y A;  3M1C A;  3ZCO A;  4HRI A;  3OYN A;  3U21 A;  4NC8 A;  4BE1 A;  3PSI A;  4PK4 A;  4BXF A;  3LL7 A;  4II3 A;  5TGT A;  4PJN A;  2PJR A;  3KYL A;  2DT6 A;  1V5F A;  3A2K A;  2F5V A;  2X1D A;  2L5Q A;  3DEE A;  3K4B A;  3OS1 A;  3SYT A;  1SFK A;  4XNF A;  4HNT A;  3FDY A;  2VAS A;  4BUP A;  3QOE A;  2CV1 A;  1AA7 A;  2ZXH A;  4BL0 B;  4YRV A;  3PNT A;  3OS2 A;  4E7H A;  3K70 D;  4F52 A;  1D0Z A;  2VB6 A;  2KZV A;  2Z1D A;  3VYS B;  3IP4 B;  2BVL A;  2HVS A;  2CH0 A;  3EUK L;  1WJE A;  2MC4 A;  1MMA A;  4XOR A;  4KIS A;  3HXL A;  2R7T A;  4HSR A;  4C2T A;  2A5W A;  3L2W A;  3M8J A;  4IKF A;  3FBN B;  3C2H A;  4D9J A;  2VJI A;  2VIX A;  3OYH A;  4CCL A;  4N4N B;  2K3P A;  3TMO A;  1PYV A;  4DBQ A;  2ZXI A;  3LFU A;  1Z3Y A;  2XF5 A;  2K5C A;  3OYE A;  4HG2 A;  1D1A A;  5KHD A;  4XLF A;  2HU9 A;  2X51 A;  3HUG B;  2E1M C;  3SZG A;  1DGW Y;  4OWR B;  4HEA 2;  2KRC A;  2R7Q A;  4XN0 A;  1W36 C;  2WAD A;  3PNV A;  4P1W A;  1BR4 A;  4LG3 A;  2OC6 A;  4II2 A;  3UNG C;  3S3O A;  5KCM A;  3MMY B;  2KP6 A;  2K9M A;  2W4S A;  3IAM 2;  3V42 A;  3PSF A;  3BG7 A;  2VXD A;  4ZTF A;  4ZC3 A;  2DT7 B;  4KIT B;  3OYA A;  3FBI B;  1D0X A;  1G8X A;  2W82 A;  4DJA A;  2JUG A;  4NQW B;  2V4J C;  2M3A A;  4XKW A;  4MLO A;  4U7B A;  4YEL A;  2WAQ A;  3F9K A;  2JVH A;  2L9N A;  3OYI A;  3S3N A;  2ZSH B;  3K6G A;  4XL9 A;  1NG6 A;  3LSI A;  4Y3O A;  2E60 A;  2KMU A;  2IGK A;  4CA0 A;  1LKX A;  4NC7 A;  2I8D A;  3D5L A;  2V9K A;  5CKT A;  4RLQ A;  4BQQ A;  2IS2 A;  3OR1 C;  3DTK A;  2LC2 A;  2R7O A;  3K4N A;  4CCO A;  3CES A;  4LIT A;  3K4L A;  2W7N A;  1V5G A;  2XAU A;  2DCE A;  4ZDO A;  2KRH A;  4AYB A;  1D1C A;  3BC8 A;  4C2U A;  1MMN A;  2VQG A;  3N05 A;  3KX2 A;  1X1B A;  3S32 A;  4DGW B;  4XLH A;  3PL8 A;  2LY1 A;  2IS6 A;  2CS3 A;  2AQF A;  2OV7 A;  4XR6 A;  4D1Q A;  1U0J A;  4XOT A;  3RCO A;  2VJ5 A;  3DWL E;  1LVK A;  4BQO A;  2IS1 A;  4ZDL A;  2Q2E B;  4XKB A;  4DOZ A;  2RNG A;  2WBM A;  1V5E A;  4U87 A;  2DJI A;  4P5O A;  2R7R A;  1JI8 A;  1YX5 A;  1SAU A;  3OYF A;  4XLE A;  1E0E A;  2R7V A;  4B48 A;  1T0F C;  2X6W A;  4E7S A;  3QOD A;  2X1E A;  3PFY A;  2V6E A;  3VYT B;  4AU7 A;  1NG7 A;  2HPM A;  1WJD A;  2R7X A;  3IUO A;  5KNL A;  3H5R A;  3OL3 A;  3VWB A;  2DOA A;  1ERD A;  3SDB A;  3MKY B;  2KHM A;  3E0J B;  2E5Z A;  2M7B A;  1D0Y A;  3CJQ B;  4QPQ A;  1MMD A;  2KLO A;  4CH7 A;  4B47 A;  2CW8 A;  3EUA A;  1W36 D;  2QKM B;  2MAB A;  2FUG 2;  4E7L A;  2LG4 A;  2VQL A;  3AL0 B;  1Y56 A;  4NUB A;  4PJJ A;  1Y6I A;  2ZFU A;  2V1N A;  2P0W A;  3LSG A;  4E4H A;  4PSX A;  2X85 A;  4OAY A;  2MYS A;  2Z2S B;  2VQC A;  3HOT A;  2V7F A;  3MKW B;  1TZL A;  3E1S A;  4RM2 A;  4LIV A;  3DU5 A;  5CQE A;  4ZYA A;  3L2V A;  3HKZ A;  4F91 B;  2BW3 B;  2WY8 Q;  3H5A A;  3OIP A;  4EAT A;  2WAE A;  2X6Y A;  4E7J A;  3A4C A;  1N78 A;  3ZXS A;  4DBR A;  2O5R A;  3D5R C;  2Q1Z B;  3S93 A;  2VJ4 A;  1G59 A;  2VQH A;  1IRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...