1LUJB

Crystal structure of the beta-catenin/icat complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
GAPAKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQAAEDVVMAFSRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catenin beta-1
publication title The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2002-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1lujB01
1M1EB 1LUJB 1T08B
chains in the Genus database with same CATH superfamily
2AQFA 2BXZA 4KA4A 2NS8A 4DYRA 2DK5A 3SZPA 2DA2A 2HDDA 3SEZA 3OYFA 2V6CA 3S1QJ 3K1MA 1W0TA 1XMXA 5E1WA 3TGNA 2JSCA 3F6VA 3WTYC 2VASA 1LEBA 1T0FC 4IF4A 2FQ3A 2MGQA 1FOKA 3I4MJ 2CMPA 1I6HJ 4ZJZA 4LG0A 3HRMA 3TDUC 3OS1A 3FXUA 1S7OA 2E2JJ 1ORKA 4WXCA 2VPLA 3JR9A 4GO1A 4EATA 5BPDA 3LMMA 4WWCA 2DOFA 5DTDA 3O8HA 1U8BA 3T8TA 2XF6A 2LH9A 2OD5A 2WWYA 2EFNA 4YRVA 1Y0UA 1PUFA 3QP6A 3ROUA 3V42A 4UY8I 3BZ6A 1DGRM 2Z3YA 2K3FA 1TWGJ 4WXDA 1KU2A 1OYYA 2NNNA 3MVPA 2O03A 2HZTA 2M34A 1G3TA 4P9UA 4Q5SF 3CMAI 3F23A 4U88A 2E1CA 3H5RA 1BC7C 2VE8A 1MDMA 3CJTB 4OIRF 2ESHA 1G3SA 3GTJJ 2KIQA 2Y0SA 3VYSB 4CICA 4M6VA 1FSHA 2QKMB 4JQFA 2QA4I 3IAS2 1FOYA 3BR1A 1MBFA 1QQIA 2UUZA 5K1YA 1ZHFA 4BNCA 2NAZA 1HF0A 2D1VA 4ZYGA 1YIJI 4C3JJ 3GTQJ 2PLYA 3NQOA 5C4XJ 3KETA 3M07A 3DP7A 3R6SA 3JTHA 4RAGA 4FX0A 1HSTA 1V54H 2YR2A 2ME0A 4M74A 3BQYA 3K4BA 1V5EA 2LDUA 3L2CA 4D5CA 4A3FJ 2QSGX 3HPGA 4M72A 4V2FA 1W7PA 3Q9VA 3CMMA 2DJNA 2XGEA 3IV5A 5J8FA 5LHGA 3K2ZA 4XKBA 5HODA 3WTXC 4RGRA 3WODF 4AYBA 4ZTJA 2HOSA 3CDLA 1JJ8C 1XCBA 3FF5A 3MD2A 4XORA 1QZZA 1JXSA 4CHUA 4BHBA 2ZBKA 1PYVA 1T38A 3F22A 3AFHA 3BZKA 1W5TA 2F6CA 1VQMI 1E0EA 1A6IA 2LKSA 3DU6A 5H6RA 2QZ8A 4DZJA 2L7FP 3T5XA 4BXXJ 3VSKA 5J4YA 3WTVC 4G94A 5TISC 3KP3A 2MFZA 2M0CA 4A3GJ 1X1AA 2V1NA 4XRFA 4YFXF 1M1EB 4PGHA 1R5ID 2H8WA 1XD7A 3A03A 3J81K 2A5WA 2X51A 2ETHA 2VKDA 1SAUA 1U9OA 5LRSA 3FBNB 3FISA 3HUGA 3Q0UA 2Z9OA 1WH5A 3SEQA 1D0XA 2KQRA 3HB9A 3BJAA 4CH7A 1YLFA 4II3A 3BQZA 1TT0A 4HSTA 2OUMA 5K5QA 4GCVA 3VWBA 1S5LC 3FKJA 3L2QA 2BGCA 2PQ8A 1LE8A 1ETKA 3S2DJ 2VQGA 3M8EA 5IY5H 2VUMJ 3P9IA 1DPUA 1RUOA 1MJAA 3TQNA 4EV0A 5CKTA 3ZQHA 4IEJA 1R1UA 4KISA 4BS9A 4F3QA 1K4SA 2A69F 2PEXA 2JQ7A 3OYKA 1R58A 3KLNA 2XV4S 2KIMA 3LSKA 2K02A 1E3PA 4I98B 4IJAA 5CJ9A 2CUZA 1BJZA 2EZKA 3CJRB 1GXQA 1TT5B 4B8XA 5J1UA 2O8XA 3FBIB 2UWMA 1ZGAA 3DQVC 3UNGC 1RZ4A 1X19A 9ANTA 2ESNA 1I6XA 1LB2A 3RKYA 2HFHA 4HX7A 1YI2I 4BL0B 2FMLA 2M5WA 2F48A 1LDDA 3BG5A 4H4KC 2LVSA 2DFHA 1FYMA 3DFGA 1JUPA 4I76A 2CSOA 2K9QA 2O8KA 1J2XA 1R22A 4L5IA 4YFKF 2JTVA 2E7WA 3H5NA 3I4PA 3JTGA 1LJ9A 2ZKZA 1TBXA 1VQ6I 4KMFA 4AIKA 1XB4A 1Y1WJ 3PL8A 4KIBA 2PX9A 2HQNA 2IXSA 2YSRA 3G1LA 3D5LA 1U78A 2X48A 3OYDA 4S0HB 1ZG1A 2GA1A 1H9TA 5DD4A 4CYCB 3ABUA 1VQ4I 3K7AJ 4M9XA 1MMSA 3FMQA 4R8HA 4QPQA 4BE1A 2H09A 5IYDJ 1QGPA 3FM5A 4PUSA 2LR8A 3KEOA 2BY0A 3SJMA 2UV1A 4RM3A 2VIXA 3G73A 2L7MP 1YJ9I 3MMYB 3EPZA 3HKZN 3ERMA 3GTOJ 1WJEA 5F0FA 5JFRA 3HGGA 2JA5J 2JWTA 3LA3A 1GV5A 3LSRA 4NUBA 2HPMA 5K5RA 1BR4A 1O57A 2M45A 2QYOA 5H20A 3QYEA 5IP6A 3ZMTA 3W2WA 2ME6A 1BL0A 5DM6F 1N77A 1MMDA 2QF7A 3CCSI 5EF6A 4M3FA 5DV5A 1MMAA 3F8MA 1X58A 1S8NA 3ZMVA 2P6TA 2VJJA 5LGTA 3MZHA 3W6VA 1ZR4A 3I9V2 5CVVA 4FTHA 2JPCA 1FOWA 2Y9ZA 2M1BA 3KZZA 4I01A 3CC4I 4AVZA 5FFZA 5D4SA 2NOJB 2YU3A 1WHUA 3AL0B 1MBHA 2BY2A 2K85A 2Y31A 5D8LB 3FHNA 4FX4A 3HGYA 4Z6YA 4YFNF 4Y15A 2CQKA 2JVHA 5FD6A 4LJZF 4CSWA 3BR6A 5F6FA 1KU9A 2ISZA 1IJWC 3DBHB 2BY1A 2KP6A 4IQ4A 2ZJPF 5IT9Z 2W7NA 2EFQA 4YIFA 3KZYA 4EJVA 1XN7A 2WY8Q 3BPVA 5E8IA 2A6HF 2MH2A 4M3GA 5EG0B 3LOCA 5FKKA 2M7BA 3ESWB 3BOQA 4KMUX 1MH3A 3S2WA 3ZMSA 3DBRB 4HDUA 2A68F 3IWZA 2XAFA 1N25A 3TBIA 3SYTA 1TNSA 5DCMA 2GM4A 1PP7U 3GO5A 1P7IA 3PFIA 3M4OJ 1X1CA 5L3EA 2EV0A 5DYMA 1Z77A 1IDZA 1A31A 5HNHA 1W36C 2AS5F 3CUQA 2O5RA 3L09A 3L7WA 2DN0A 4IHXA 3VSLA 5M5WJ 3MZ8A 2CU7A 1B1BA 4LITA 2ADUA 4PDKA 1IAWA 1CGPA 3AAFA 1FZPB 5C44J 2FNPA 4NBQA 4Y33A 4ANJA 1QZEA 2CUJA 3L1PA 4S05A 2KDZA 3S1MJ 5TRDA 1USSA 1T2KA 1B9MA 2YPRA 1W7PD 4A0ZA 4IHYA 3MKZA 2O61A 2HEOA 4M3DA 3FXKA 1U3EM 3KZIC 3NARA 5JI6A 1RKWA 2XRLA 1WJ5A 3I59B 4LIVA 4C3HJ 1SFKA 3CCMI 4CCJA 1WQ2A 4C30A 2VODA 2MYSA 2VC1A 2K27A 1PVEA 4A5MA 1B9NA 2R7FA 2CQNA 2XUBA 3K70D 1ZH5A 1U5TA 3FWEA 5L3CA 4L9VA 2XROA 3OYLA 5BQTA 1Y8QB 2FJ1A 1JTXA 1YW9A 2MD5A 1UB9A 1X2MA 3K2AA 2O6GE 4M3EA 5F1JA 1AA7A 1W4MA 3CTAA 4E7IA 4N4NB 2HOEA 3G71I 4F52A 4G6QA 1JHFA 3DBLB 1IN6A 2KZVA 2DMUA 4MTEA 1IXSB 4FASD 5E1XA 2VQHA 2ZCWA 3SDGA 4BEHA 2E35A 1IG7A 3JRCA 5K7FA 1KQ9A 1FBQA 2DT5A 4UHTA 2IEKA 2DJIA 5BNGA 2KKOA 2EA2A 2EILH 2HQRA 1ZGWA 2G0EA 2XKOA 3TO9A 1A6QA 1ZRCA 4IHTA 4BDYA 1Y6IA 1ZAOA 2E71A 2OQGA 3LWFA 3EUHA 1WI9A 2M3AA 3C3WA 3M7GA 4N0BA 4D9JA 3LSJA 4KNYA 3CMEI 3GWZA 4I02A 5FROA 5LHIA 2K4BA 4PGGA 1R7JA 1LQ1A 1POGA 2FBHA 2K86A 3V8JA 1TQIA 4A3IJ 5C3EJ 3GZ6A 4IXAA 1IN8A 4G9YA 4ENNA 3NWTA 3TL4X 4I7HA 1B8IA 4FE4A 5AONA 1BI1A 4M9SA 3LA7A 5LGUA 3ML6A 5LD2C 3CCQI 3A2KA 5LEKA 5JR3A 3C2BA 2UZKA 4GDFA 4BKXA 1NHAA 1SVMA 3OL4A 4G6TB 1AKHA 3FK6A 1IXCA 3I55I 4E70A 5D4RA 3AG3H 5IYBJ 1RC9A 3KYCB 4E7JA 1Z6TA 2MA3A 1HKTA 1WWXA 3ZP5A 2DOEA 4UUSB 2ID6A 2EV6A 2IPQX 3GXOA 2Q8KA 5A2QK 3CCVI 2FRHA 3BCBA 3DXJF 2X1EA 1Z3XA 1FIPA 2QQBA 3S3MA 1FLIA 4I0BA 5JLXA 1T98A 1OQYA 4EJWA 2EJRA 1BR1A 1KGSA 2KPMA 2WADA 2LP0A 5HDKA 4WF2A 1FC3A 3B6AA 1G6NA 3DKYA 2HXOA 1BI0A 2A6EF 3ZMZA 2ZXWH 3OYIA 1ZK8A 2M87A 3WTUC 2JA6J 2V1DA 1I1GA 2TRTA 3HJEA 3FXRA 2VE9A 1OKRA 2RQPA 4NC6A 3ZR8X 2B7EA 1ZLKA 2DYRH 3OYJA 1MMGA 3IRQA 1R71A 3HXLA 3AG2H 2STTA 1T0FA 4GXOA 1BIAA 5LBQA 1UMQA 4EJOA 3DEEA 1F43A 3ASOH 3OYCA 3TOAA 5FKOA 1BIBA 1SFOJ 5E3NA 1RETA 2DAOA 2MC4A 4HF2A 2FF4A 4F55A 5D6EA 2EK5A 3BG7A 3J81Z 2IGOA 2ZMEB 3GUDA 3F8BA 1MSEC 2RNGA 1FNNA 1QHHD 3ZQLA 4EQQA 2QENA 3VB2A 1LFUP 4GFBA 2VJ5A 4ZDLA 3S3NA 4E7ZA 4Y7NJ 2H8RA 1R5HA 2RDPA 5AIQA 1SANA 1USTA 4ABZA 5TGTA 2DFIA 1KA8A 4PJMA 3LAJA 1UHMA 4M9ZA 2LC2A 1BR2A 4P9FA 2P0WA 1FSEA 3BR5A 4K2EA 3OYGA 3VYUB 1W5CC 1J5YA 4BBSJ 1JE8A 2Y9YA 4F91B 1S3JA 5FD5A 2O9LA 1XX5A 3H9GA 2CO5A 3E0JB 3H0GJ 3JRHA 4UB6C 1AU7A 2QUFA 3L9FA 1Y0NA 3FXMA 2JUGA 4D0PA 3H3UA 3SXYA 2KISA 2LFBA 3L2UA 1AOYA 1EF4A 1FOXA 1FBUA 3HC7A 2WAQN 2W57A 3RKQA 5FKLA 2DA3A 3WE3A 4DYCA 2ICWG 5HOOA 2JPBA 4BY1J 3GVAA 4A69C 3WTWC 4XOPA 3GLXA 2GWRA 2DMPA 3DPTA 1LDKB 4RS8A 3C18A 3NEUA 2DOAA 5EJCA 1C0WA 1Z6RA 1GXPA 1BC8C 3MCZA 3O2PE 1MMNA 1RR7A 1YFHA 1B59A 4LIUA 2A6TA 4NC7A 1B72A 3ERED 2JZYA 3ZOBA 2DFEA 4XLAA 3RQ4A 2OTJI 3D5SC 3LNQA 3T8RA 2LY9A 4G12A 2IBDA 1WH7A 2KFDA 1YX5A 4R1HA 5HS7A 3EETA 4A3KJ 1ENHA 1E17A 3RSNA 3CF2A 3OV8A 2N8GA 4II2A 2BVMA 2BV6A 2STWA 3BR2A 2QCOA 2FEZA 3FMRA 1K7AA 4AIJA 1MSFC 2NVQJ 2K9NA 3TDZC 2HTSA 4HOBA 2LD5A 1GV2A 3HOXJ 2M8GX 3SQNA 2KT0A 1I5ZA 3P9KA 3WGHA 5GPAA 1UZCA 4ZDOA 1LFPA 3G4SI 2E5NA 2FOWA 3EUKL 4IZZA 2LSOA 1S9HA 4D5FA 4E7LA 2EH3A 1ITYA 1FIAA 3F8CA 2GXAA 2R4GA 3K6GA 2MLKA 4MHGA 3LSMA 1RR8C 3DTIA 3G6EI 4UVBA 1JTYA 4DBQA 2JRTA 1ZRFA 2F5EA 4RDUA 1H8AC 5HS9A 2IS6A 1YRNB 4BU2A 3BTJA 2OV7A 2PN6A 2CYYA 2DK8A 1XGNA 3VDXA 1NTCA 2V9PA 1HCRA 2VQCA 5DEQA 3F8FA 2R7SA 2KDOA 3F0CA 1YW7A 3DKWA 3L2VA 4D7NA 1MNMC 1MW7A 1UFMA 5B1BH 4HX4A 2RREA 3W3CA 4S04A 2X4HA 3PUFA 4ZYEA 2DA6A 3GTLJ 2O0YA 1ULYA 2GZWA 2V79A 2X0LA 3AG4H 4U0YA 3PNVA 1TP4A 2W24A 4RB0A 1AHDP 4AC0A 5IOYA 1Y56A 2K3PA 1HW5A 2OU2A 5BS6A 3BPXA 1X4PA 1YE9A 3KP4A 4J01A 4XKCA 3ZQ7A 3I64A 1OCPA 1S6LA 1WI3A 5E79C 2DQRA 4PSXA 1OFCX 3DU5A 1S29A 2VKVA 3IC7A 3QOEA 1F9NA 4XLHA 2E2IJ 2VBYA 4RA2A 5E3OA 2PG4A 4XLFA 1TC3C 5E18F 4ZTFA 2A61A 2BHZA 2VOPA 4IQJA 4HQEA 2Z1DA 2P7CB 4RM2A 5EDNA 2X6WA 3M1CA 4KT6A 1X4OA 2CV1A 3UR3C 1CQTA 1MBEA 3CJNA 1XS9A 2FUG2 3BTLA 1SC7A 4B48A 3ZRGA 4B43A 1UAAA 2LYCA 1KQ0A 3PNYA 3CD6I 3AG1H 3L00A 3HSFA 5EEAA 2E5ZA 2P5VA 4P96A 1FX7A 3GBGA 4DQ2A 1TLHB 1OPCA 1Z7LA 2R7UA 1T08B 3KYLA 5J1YA 2E1MB 2CUEA 1SFEA 4A3BJ 2QBYB 4Z2YA 4XRMA 1LKXA 3CCYA 1U0JA 4E7HA 1WJAA 1FBSA 1KYZA 3CP8A 4HF1A 2BW3A 3FXQA 3I56I 3CC2I 3ECHA 3FHZA 4BAYA 2M0MA 2YX4A 2L02A 2LMDA 2XIGA 2VC0A 1U9NA 4PSWA 3FKIJ 2HZDA 3P7NA 1KZHA 1OLTA 3JSOA 2M2EA 5LEJA 3K4JA 4XNFA 2PMHA 2GA2A 4EGZA 4LG0B 4NB5A 3FM3A 1WJCA 3IKVA 1K6YA 3PNTA 2EV5A 5D5UB 5B66C 4BQQA 4A2UA 2D2WA 1TTYA 2IA0A 3JCUC 3MFKA 2NNYA 3BR0A 4XLCA 1RKTA 1OCCH 3R61A 3TKYA 2K9MA 3HKZA 2RV8A 2TCTA 4I09A 2OQRA 4XK4A 1PUFB 4CA0A 4GYIA 4OU0A 4CUGA 1ZELA 2BXYA 2WC2A 5CQEA 4CO8A 5HDNA 2A5YB 3GZNB 3K69A 1ZLJA 1W5SA 3QYBA 3D0SA 1RESA 4KUMA 5FKMA 1HDPA 3MN2A 2E1MC 1SEUA 1GVJA 1K61A 3DPLC 3BROA 2DPUA 5ILSA 2M9HA 3GMEA 1QBJA 4RGXA 4DW6A 3J7ZI 3HDDA 2DO7A 1ZR2A 4XLPF 4MFEA 3RTRA 3A01B 1G2HA 1FMVA 2QQ9A 3M3YJ 2M4KA 5DS9A 1OYIA 2MH9A 4PFOA 2PMUA 2PI0A 3BG3A 2JA2A 4DGWB 3OS0A 1DUXC 3VFZA 3S14J 5FKNA 2DA1A 4HAMA 1IUFA 4PZJA 2P7VB 2GAUA 2HQ5A 1PJRA 4XR6A 5K5OA 4O3MA 2W00A 1KONA 4BDZA 4B3AA 2R0QC 1D3YA 3Q0VA 1LNWA 5E20A 3TMOA 2OAZA 3VEPA 1RIOH 4QPOA 2OZUA 1G3YA 4DOZA 1W7PB 3T1BA 1HSJA 2I10A 4DNCA 1O3RA 3CCUI 4YG2F 2XPVA 2F2EA 4NQWA 4UNOA 5IT3A 4P1WA 5KAFC 2XAUA 1ON2A 2FBIA 3ZGKA 2P8TA 1ACIA 1FPQA 5KK1A 4IX7A 3KPHA 2COMA 1LFBA 1Z7UA 2AXLA 5A2QZ 4J00A 2XB5A 2GOMA 3WU2C 1WSUA 3OIOA 4XONA 1R6RA 3OIQA 4C3IJ 4IO9F 1QA6A 5L3FA 3I58A 3G1OA 1WCMJ 1IUYA 1IXRC 2WTEA 3WHCA 2X1DA 3H9JA 1K78A 5EZHA 3HOYJ 1D8JA 3OMYA 3BP8A 1K6OA 4EGYA 2IRFG 3HOVJ 2LTPA 4O6JA 4UVCA 2FA5A 3K4CA 3HUGB 3CLQA 1Z0XA 1G4DA 2VB6A 1X1PA 2IGNA 3ONQA 4IHVA 3HOWJ 1FMWA 4PFPA 3GF2A 4N9HA 1OCOH 1QZYA 2R7OA 2DFFA 2HDWA 4BACA 4OIOF 4HV6A 1D5YA 1LE8B 4X1EA 1QNTA 2EFWA 4HNTA 2VQLA 2WA0A 1YW8A 2UXNA 2ZJRF 3GFJA 2H6CA 2HKXA 3V8LA 2VXDA 3I54A 1YQAA 1OMIA 4RBOA 2CV2A 4HV5A 3RCOA 2W4SA 4ASNA 1BI2A 3NAUA 3VYRB 3SZGA 5KHDA 3E3VA 5FRNA 5KAIC 3S8PA 2VI6A 1J75A 3H5AA 1P7JA 5HDGA 5J47A 1FY7A 4U0VA 3CCLI 2WAFA 4E6KG 2KRHA 1GLNA 2XPUA 2EFOA 1HBXG 2GLOA 1SVOA 3CP2A 3K70C 2EFPA 3HOUJ 1E3HA 3LSGA 4B09A 4FISA 2DT6A 4RGUA 4QLCU 2K9LA 1V5GA 1IRFA 1NG6A 1KYWA 3TOBA 2HYGD 3DV8A 3MAJA 4O5VA 2FNAA 4CCKA 1X3ZB 3MKYB 1O7LA 3IRRA 3KP5A 2B63J 2MBFA 2ZXJA 3QQAA 2FX0A 2KRCA 4IOCF 5BMZA 2OCEA 5F0CA 3E6BA 1UCRA 2BY3A 2VN2A 2Z33A 4UV9A 4U87A 3HSEA 3AL0C 2XC7A 3HRUA 4Q4ZF 1XSXA 1XSVA 2HR3A 3N97A 1ZN2A 4ZYDA 3CCRI 2L54A 5ED4A 4BHCA 2ECCA 5KNLA 2B9SA 3U1KA 5IP9J 4XRSG 2JVGA 2Y30A 2R5ZA 1REPC 3F8NA 2CQQA 1DQUA 2DMQA 2JMWA 1RNLA 1X3WB 2LRDA 4LK0F 1VQKI 4MEYF 4HPQA 3Q0WA 1N78A 1UHSA 2QLZA 3HRTA 4U7DA 2LY2A 5J3LA 1JGGA 3H1CA 2E34A 5KVRA 4XN0A 2GIVA 3TO7A 2XAQA 3BDDA 4IPAA 1E3OC 4OAZA 3ZMUA 4F93B 3BJOA 3HG9A 3V7RA 2VBXA 3ZQGA 4UB8C 3RPQA 1G59A 2K7LA 3BWGA 1QPIA 1UELB 1F5TA 2OCCH 1XGSA 2L5QA 2Y69H 2W84A 3Q3SA 2KRFA 2XHKA 5HNFA 1N75A 1OR7A 3JSPA 3G2BA 4BXFA 3TW7A 4HLXA 2HOTA 1IO2A 1V3FA 1X2NA 3DLAA 4L9TA 1FTZA 3FIWA 1D1BA 3HYIA 3I71A 1MD0A 3VOEA 3K1PA 4RB2C 1YOVB 2HPIA 2XSJC 5LHHA 2NS7A 1Q1HA 2ZC2A 5E3LA 1PUEE 3GTGJ 2PFBA 2OJED 4XL9A 1FJLA 3S1NJ 1LEAA 4Y13A 2Q1ZB 4XRSA 4Q47A 3PFYA 4LLLA 3K0LA 4HX8A 3QYFA 2ACJA 2X1CA 3ABTA 1TW2A 1VNDA 6PAXA 2BZTA 4M6YA 3FXLA 1VQ9I 3TO6A 5E3MA 2ZJQF 3S17J 4JX4A 2M8EA 3OSGA 2L2OA 4HBLA 4IRIA 2QKLB 4E7SA 1JGSA 1MBKA 5L3DA 3LA2A 5J1RA 4XOTA 1R00A 2DQLA 2CWEA 5DCMB 1O3QA 3B73A 2PMZN 1FP2A 1ERDA 2X6YA 5L3GA 2EBIA 2KIFA 2VJ4A 4MGRA 4OIQF 3QRFF 5LFAA 3LQQA 3CUQB 3HHHA 5JVTA 2HS5A 2FE3A 2GIZA 3HHGA 4ENKA 3QAHA 5E8GA 4MLOA 1KU3A 5GPCA 1FP1D 1LDJA 4PK4A 4QTRA 1T6SA 1Z3YA 2XGXA 1J9IA 4QIWN 4ZYHA 3DCFA 5BPIA 1CF7A 2E1OA 1SD7A 4A3LJ 1MBJA 4JK1X 2VONA 1X1DA 1ZG3A 2KJCA 3CCEI 1JT0A 3RJPA 1DGWY 1GDTA 4ZZDA 4XBFA 3C7JA 1MJ9A 3KFWX 4ZDPA 2HTJA 4MQ9F 3A0HC 3GYHX 5FFXA 5D8KB 2DBBA 4OINF 1EV7A 2KJBA 1Y1VJ 2OTLI 3P9CA 4KT5C 4Y17A 4MEXF 2YS9A 5FLVA 5FB2A 4CGZA 4A3DJ 3PQJA 4DBRA 3L2WA 2RKHA 2XB0X 2QQ8A 2IS4A 5F27A 1DU6A 4YIRX 2DXIA 1F36A 4U7BA 1S7EA 4C2TA 1U5TB 2XRNA 4UUVA 3ISPA 4WK8F 3CUQC 1P4WA 2P5KA 2LBFA 1R4NB 3F9KA 3PSIA 1Z21A 5DM7F 3CLOA 3O8GA 2XF7A 3ABKH 1ZARA 3SHFA 5FJ8J 4P55A 3IKTA 1JJ6C 4HW0A 2IS2A 4BGDA 2WAQA 2LREA 1LPQA 3K1NA 5JHUA 2L7KA 3J7AY 5FGMA 1F1ZA 2X85A 4GRIA 1TL8A 1YG2A 4L0YB 2F5CA 2LG4A 3BCAA 4P5OA 2R5YA 4FQGA 1XCVA 3PO2J 1I1SA 2Q2EB 1IRGA 4BEHB 4XSZF 2PJPA 5EGOA 3CZ6A 2JJ7A 3A1YA 5CVUA 4BQNA 4AM3A 2PJRA 1VQLI 4CYDA 2MD0A 4UUTA 2VT3A 1YHQI 3FZVA 5CYVA 1EH6A 2IJLA 3HOSA 1ON1A 1TWAJ 1F4KA 2QSHX 3M1EA 2GXGA 1Z9CA 3KIOA 5HLHA 2DTRA 1G3WA 1XGOA 4BE0A 2L9SA 3W6KB 4CZZA 2ZSHB 4L5EA 4MTDA 1WJDA 3DEUA 3BR3A 4OMYA 2XAJA 4LB6B 4A12A 1B8IB 3B02A 4BUPA 1IN7A 3GZ5A 4L18B 2EA4A 5HVQC 4XSXF 2CRGA 4LLNA 1EJ9A 1IZ1A 3RYPA 2XKPA 1JHHA 2EIKH 3QU6A 1LUJB 1ETOA 1R9TJ 1AKHB 3BJ6A 2E60A 4M71A 1OCZH 3JRBA 4OAYA 2GXBA 3OWTA 2I8DA 3PM1A 2EWNA 3E5QA 2G7HA 2FMYA 5EZGA 2RN7A 1YTYA 5GADJ 2R92J 3AKZA 2KHMA 5DUIA 1XPXA 3QPTA 2P5LC 2EZLA 2ZMEC 2NOGA 3KX2A 4F92B 2NVTJ 1QPMA 3JRDA 3GTPJ 2W1OA 3TP0A 3S1RJ 2EIJH 1XC5A 1BA5A 1IDYA 4WCGA 5F08A 1D1CA 3H3ZA 2XDVA 2WB1N 3K4NA 5EEHA 4B4CA 3JREA 1Z67A 4FE7A 3BC8A 4AWXB 2ZB9A 2QQAA 3HEFA 3RIRA 3SDBA 4D1QA 1I3AA 2CFOA 3NWSA 4PJNA 1JUSA 4JX6A 1FEXA 1Y8RB 3RKWA 2ELKA 1O3TA 2FSWA 3HIFA 3O3KA 5ICCA 1I27A 2HKOA 3CDIA 2L9NA 1P4XA 3ULQB 1YO5C 5CVIA 5FO5A 2F5DA 3IL2A 3JAMK 3J7YJ 4D7MA 3A02A 2CGPA 1ETXA 2DA7A 5CLSA 1UJ8A 1V5FA 2HXIA 4F7ZA 4FCYA 4M6XA 3UKGA 3D1NI 1PDNC 1ETVA 3CJQB 2XGDA 2HU9A 2V1UA 2R7WA 5ILVA 1X1BA 2IS1A 2V4JC 3REOA 2KMUA 3U2RA 3SFIA 1S72I 3V8KA 1RUNA 5HLGA 1Y39A 2Y0MA 2F5FA 5LRRA 4B1RA 4BH9A 1TWCJ 2VT2A 3J80K 1R49A 3HZJA 3A4CA 1WZ2A 2BEOA 1WKMA 4B44A 1TWFJ 2J5PA 5CVJA 1T8IA 4UVAA 2MG4A 2VBZA 3I3LA 3LL7A 1QU3A 1BBYA 3Q9SA 5HS8A 1HA8A 3KP7A 3QPLA 3H3VK 2JSPA 2F5VA 4HNUA 2DU9A 4A93J 3I4NJ 4ZC3A 2DDAA 3WTZA 4NNJA 4W97A 3S3OA 2FU4A 1SMTA 3DLLF 3RQIA 2HDCA 4M3BA 4MO7A 3OYNA 4CDGA 4YEJA 1MH4A 1H89C 2YUSA 3GLLA 3DF8A 1RI7A 3W2AA 4KICA 2BBYA 4Y4RA 3DTEA 3GX4X 3QOPA 4XKWA 2CV0A 4LK1F 3R0JA 3K4KA 2A3SA 1AWCA 1VQOI 1MNEA 4NC8A 4BE2A 5FRMA 1YYVA 1A04A 2Y48A 3PSFA 4V19K 1W1WE 1H0MA 2IVMA 1P6RA 3ZCOA 3G3ZA 3V7SA 3ZQCA 1WJFA 4BJ5C 2W25A 4IHWA 2L4AA 3PUBA 1WRJA 2FQ4A 2ELJA 2ZFWA 3S15J 2Y75A 2RNJA 1B72B 3I53A 2DT7B 5GAGJ 2K4JA 3ZN0A 2CW7A 5M5YJ 1OYWA 5GTHC 4ITVA 2NVUB 1ONVA 3JRFA 5ICFA 4RAFA 3H92A 3U21A 3A01A 4M73A 4DYQA 3EYIA 2JK3A 5DCFA 2J5OA 5F04A 1IV8A 1IN5A 1NH3A 5DUKA 3A0BC 2F4OB 3HRSA 4AIHA 2LOOA 5HLIA 4EJUA 5J8CA 1P92A 2L01A 4HDVA 1DU0A 2IT0A 3WHBA 2EZHA 2E19A 2RQQA 4EM2A 1Q1VA 4AVPA 4C2UA 1JI8A 3K9TA 2QWWA 3BY6A 3GCMA 3RYRA 2X6OA 2WY7Q 2ECBA 4CZCA 5FLXK 4CYCA 2YX7A 2KLOA 1T33A 2JA8J 1K4TA 1YIOA 2IAIA 1YJNI 3S16J 5CVRA 4HEA2 2LF7A 3HTUA 3MKLA 3QPSA 4HF0A 2EZIA 2A07F 1MIJA 3PIPF 3SFZA 5GAHJ 2ZFUA 1U8RA 5J4VA 1P9QC 4L0ZB 5F1RA 1FYKA 3ZXSA 5D5VB 1R36A 1HW2A 1D8KA 1QVTA 2Z16A 2NVXJ 1R5GA 1ZGJA 4B3XA 2WBMA 1R4MB 1FWZA 2Y0SN 4I99C 3BTIA 4JOMA 4I2OA 3E5XA 2COBA 2Q0OA 2ZXIA 4WXHA 5M3FJ 2ZJ2A 4AIDA 3ELKA 3KCCA 3WE2A 2NVYJ 1NK3P 4LB5A 1MDMB 2MW8A 3LSIA 1KQ8A 4E7KA 2D45A 4FHTA 3LFUA 1VQ5I 1D1AA 1YS7A 2CW0F 3QP5A 2IP2A 2VKEA 1RRJA 4IRHA 2ISYA 4ESFA 3LFKA 2K40A 1L0OC 5B3SH 2IA2A 1EA3A 3IH3A 3MWMA 3DEWA 4NDLA 4AYBN 1MNDA 1EH8A 1IRXA 1I3QJ 2WV0A 4KN4X 5EG0A 3BG9A 1VQNI 3COAC 2WAEA 4G7ZF 4ETSA 2LF8A 4A0YA 2HVQA 3V7CA 1FYLA 1ETQA 1T56A 2Z99A 3LQRA 3C2HA 2HVRA 4RB1A 4DJAA 2VBWA 2LKPA 3M9AA 4IL6C 2HOAA 2Z5UA 1IV6A 2LY1A 3BZCA 1XTAA 2YU9J 1J09A 1BJAA 1ETWA 2V9KA 3ABMH 2GOXB 4L9JA 2H1LA 2WV1A 4RLFA 2VKHA 1UG2A 3DKXA 1HC8A 1BW5A 2X6XA 3E1SA 1DP7P 1GUUA 3ZQIA 1U2WA 3TEDA 3QU3A 3DWLE 3I0TA 3WGIA 3BG6A 1P2FA 1TNTA 1EH7A 2BW3B 5B1AH 3KYDB 4RAYA 2M30A 3H36A 2R3SA 1A35A 4G7OF 2H27A 3E5UA 1BM9A 3FXOA 5CQGA 5JHFA 1VQPI 2QGUA 3HTSB 1ZTRA 1J7KA 2JUCA 3EYYA 1W0UA 1GT0C 2DTZA 2OZ6A 1HKSA 3I5UA 1JT6A 3F6OA 4UV8A 2NRAC 2JRMA 3HPHA 4CCLA 1JKPC 5LLQA 3LAPA 3I59A 3CO7C 1IRZA 1IF1A 2OC6A 2LLKA 2L9RA 3LSTA 1DDNA 2R7DA 3PIOF 4ENMA 4A0XA 1B6AA 3CDHA 3S93A 2JA7J 3HOZJ 4MQVA 1P4AA 2XGCA 4XIDA 3W2VA 2O3FA 3BTCA 3ZQQA 3SZTA 2OPTA 1ZKGA 4RMNA 1QRYA 3LSPA 3MKWB 2CQ7A 1Z1DA 4E4HA 2XAHA 1EKEA 1OCRH 3JRGA 1JKOC 2DMNA 4GGGA 2HWVA 3F3XA 4A3MJ 5LGNA 2P4WA 2LK2A 5H2FC 2VJIA 2TDXA 3RDIA 2KIUA 3HL2A 3IAM2 2HVSA 3H35A 4OOIA 3DTKA 4ZH4F 4IVNA 5D6FA 3VODA 2CS3A 4KN7X 1HKQA 4JX5A 1MBGA 4HG2A 2CG4A 4Y3OA 1SFXA 3HBLA 3WG9A 1TQPA 1MGTA 3RKXA 4RGSA 3IHUA 3K10A 4XQFA 3CC7I 2BYVE 4IHSA 3FDYA 1QVUA 2JN6A 2DA4A 2DI3A 2CW8A 5IYCJ 1E2XA 4XKVA 2GBYA 4PJ0C 2R7ZJ 2R7XA 5E17F 1H88C 1XMKA 3R0AA 4LMYA 1XGMA 5J40A 4NQWB 3J7AO 1VI0A 2W85A 5AIPA 4A5NA 3E97A 1SD4A 3OOPA 4W1UA 4XLEA 4DZPA 4RB3C 1YX3A 4ENJA 3GEZA 3GTKJ 3M8JA 4I0AA 3RPUA 3CO6C 3U1DA 4HYEA 4EM1A 1WFXA 2ZXHA 3N4MA 2PMZA 2R7VA 3OY9A 1T39A 1WVRA 2XPWA 3CUOA 2L9VA 2HI3A 4HA8A 5J6XA 4YIIA 1U6GA 1VZ0A 4GYGA 1K78B 1ZRDA 2HYFA 2LNBA 2XVCA 1ZQ3P 2D5VA 1LVKA 4G6DA 4YELA 2QEXI 2CQXA 1A36A 5GP9A 4UUSA 4Y52J 5D5WB 1R23A 4LD5A 4LGWA 2LKXA 3TP3A 2FXAA 2AHQA 4IKFA 2HQAA 4XMYA 1GHCA 2B0LA 2OA4A 1SAXA 4EJTA 3TW6A 3CESA 4EEFG 1BN5A 3B6CA 1UG0A 2R7RA 1WGXA 3FK7A 2BVLA 1TWHJ 2PBIA 3JAMZ 2HYJA 2RC4A 5GTIC 5ICEA 3ECOA 5F0HA 3IH2A 2QSFX 2L0KA 3OS2A 2VLAA 4ESJA 1TW3A 2MSYA 1HW1A 4KIFA 3W6JB 2R7TA 2DDBA 2F4IA 1R1VA 1L3LA 5C4JJ 2L3DA 2GQQA 1HDDC 2FBKA 3KE2A 4QSHA 1WPKA 3WGGA 5D5XB 1W36D 3K4LA 3EUAA 1QHGA 4PJJA 4ON0A 2Q2EA 4EVIA 4WX9A 5H6QA 5L3BA 2D1HA 2ZNZA 4EM0B 3J80Z 3F21A 3FMSA 4AUXA 3OSFA 2G7UA 3ZMDA 5GAEJ 5K7ZA 3OYHA 3QODA 4HRIA 3WG7H 4EMSA 2VOOA 5TJJA 4Q48A 1XDUA 2ELHA 2EQRA 2F4MB 4RAZA 2ZMEA 4ZZLA 4A6EA 3GFLA 4KDPA 4I6ZA 3O6BB 4X6AJ 1J59A 1XSDA 4IOAF 1TZLA 2MLGA 3WTSC 3JW4A 3IUOA 2VPRA 1STZA 5FLMJ 3S32A 1UHWA 1IN4A 2HNHA 4KIGA 2NYXA 3F72A 3NRVA 3V4GA 1R1TA 4L9NA 2IA1A 2OBPA 1DPRA 3OOUA 5F64A 1MZBA 5M3MJ 1DP3A 2AO9A 3R4KA 3P5JA 5KCMA 3GFMA 1YS6A 2UXXA 3WU0A 2XF5A 1D0ZA 2G9WA 2R5ZB 2Y2ZA 1VQ7I 3ABLH 1FTTA 1OCTC 1BW6A 3OR1C 2W48A 3DPUA 2E36A 1NG7A 1HOMA 3K4MA 4BJTA 5JVGF 3M8FA 1OISA 3CQZJ 3OYEA 1S7AA 4A3CJ 2EIMH 2EINH 2NS0A 2NXNB 3G1MA 4UXNA 5CPRB 2M7AA 1ETYA 3ASNH 1ZG5A 1XG1A 3OYBA 4N9IA 2L4MA 2V7FA 2XAGA 4MNUA 1J0RA 2H6BA 2ZNYA 4BHPA 1OJLA 4AD9A 3KP6A 4HLYA 1SFUA 2AQEA 4MFDA 3OYMA 3H0DA 4LLGF 1O7FA 2E2HJ 4G8XA 1TQMA 3KP2A 3PJRA 3E6MA 2XSDC 5BOXA 4AU7A 4PCQA 2V6EA 3IP4B 5JLWA 1HQCA 1IW7F 3U9GA 2DCEA 3IWFA 2L7ZA 4BBRJ 4C9YA 1ZYRF 2DODA 1BI3A 1IC8A 2X9DA 3CMYA 1GVDA 4KJZA 1VFCA 4XM3A 2FOKA 2ZO4A 4CCMA 1A5JA 3N05A 3PO3J 5IP7J 1D5VA 3MQ0A 5B5EC 1X3UA 4H0EA 2W82A 4JYKA 4NHJA 2H1KA 3ZQFA 4A3EJ 3KLOA 4LFUA 1BOAA 5FLXZ 3VYTB 1V4RA 2WB1A 4LOCA 2DPDA 4J19A 1LVAA 3RZDJ 3QPHA 2CJJA 4IRGA 3KEQA 4A6DA 4XICA 1ZREA 3MZYA 1MKMA 3WTTC 3C1DA 4CCOA 4OWRB 4PJLA 1PP8F 5E1ZB 2OF7A 4L5JA 1HXDA 2JT1A 1RPWA 4FT8A 5IT9K 2KZGA 1U5TC 2EB7A 2R7QA 4KFCA 2VL8A 2RVCA 4G7HF 4C2MJ 1XMAA 3LSHA 4BJ6C 1OR7C 3Q5FA 3CCJI 1YITI 2QVOA 3EQLF 3CF5F 1VQ8I 3S2HJ 2V26A 2IGMA 3HM5A 4TV7A 2ID3A 5DD8A 3ZN1A 1APLC 3X2QH 2P81A 4RLQA 2K5CA 4CCNA 3QWLA 1JKRC 2BOLA 3RI4A 3VPRA 1KU7A 1YRNA 2K9SA 4BQOA 2V9VA 1CF7B 5IPAA 2I5UA 2BE5F 2DW4A 4DIQA 4HSRA 4X0GA 3E6DA 2E1NA 3R60A 2RGVA 3OR2C 4QWQA 2VXZA 5EYRA 4FETA 3BT9A 1K83J 4MIMA 1HLVA 1XDSA 4OIPF 3FX3A 2CFXA 3OYAA 5ERIA 1O4XA 4OMZA 1SD6A 1T95A 2ZSIB 1FT9A 3IH4A 4ESBA 1SD5A 4JP0A 5HLTA 3HOTA 2MC3A 4JBAA 5M5XJ 3OL3A 3EUHC 2R93J 3GTMJ 3OIPA 3T0YA 2M4GA 3RPUD 1MJBA 1V55H 1Z91A 4R79A 5IOZA 1H9GA 3JRAA 1I50J 2O7OA 3BLYA 4CXFA 1NK2P 3RZOJ 3GW2A 2A05A 2H94A 2RAEA 2LBFB 4BY7J 2BHYA 4KITB 1WJBA 2P6SA 2E7XA 1JKQC 2IGKA 3FXJA 2HGCA 1B4AA 4B47A 5ILUA 2DYSH 2AXTC 1JUMA 2C6YA 5K7HA 2QM3A 2FD5A 2EPFA 3D5RC 1SVLA 3H9QA 3C2GA 4N4OB 2KL4A 4BXUA 2DA5A 2R5YB 1Z05A 1G8XA 4ZYAA 1VF9A 1ODDA 5EGOB 3JRIA 1VTNC 1QO0D 2MABA 1BOBA 4BQAA 2DLLA 2XASA 3ZPLA 3PQKA 4KYWA 2PJRB 3KEYA 1O3SA 3E6CC 1I39A 3GFIA 4HZFA 2CUFA 2CH0A 2IW5A 3MEXA 3HSRA 4U0WA 1D0YA 2DMTA 3L2RA 4XN3A 5EEGA 1K79A 4HNVA 2Z2SB 4A3JJ 4XLNF 4V2GA 5ICGA 1YJWI 4LG3A 3E7LA 4HQMA 3WU1B 2QBYA 2V1XA 4BYYA 1SMYF 3EDPA 1IGNA 5DDGA
chains in the Genus database with same CATH topology
1M1EB 1LUJB 1T08B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1E B;  1LUJ B;  1T08 B; 
#chains in the Genus database with same CATH topology
 2AQF A;  2BXZ A;  4KA4 A;  2NS8 A;  4DYR A;  2DK5 A;  3SZP A;  2DA2 A;  2HDD A;  3SEZ A;  3OYF A;  2V6C A;  3S1Q J;  3K1M A;  1W0T A;  1XMX A;  5E1W A;  3TGN A;  2JSC A;  3F6V A;  3WTY C;  2VAS A;  1LEB A;  1T0F C;  4IF4 A;  2FQ3 A;  2MGQ A;  1FOK A;  3I4M J;  2CMP A;  1I6H J;  4ZJZ A;  4LG0 A;  3HRM A;  3TDU C;  3OS1 A;  3FXU A;  1S7O A;  2E2J J;  1ORK A;  4WXC A;  2VPL A;  3JR9 A;  4GO1 A;  4EAT A;  5BPD A;  3LMM A;  4WWC A;  2DOF A;  5DTD A;  3O8H A;  1U8B A;  3T8T A;  2XF6 A;  2LH9 A;  2OD5 A;  2WWY A;  2EFN A;  4YRV A;  1Y0U A;  1PUF A;  3QP6 A;  3ROU A;  3V42 A;  4UY8 I;  3BZ6 A;  1DGR M;  2Z3Y A;  2K3F A;  1TWG J;  4WXD A;  1KU2 A;  1OYY A;  2NNN A;  3MVP A;  2O03 A;  2HZT A;  2M34 A;  1G3T A;  4P9U A;  4Q5S F;  3CMA I;  3F23 A;  4U88 A;  2E1C A;  3H5R A;  1BC7 C;  2VE8 A;  1MDM A;  3CJT B;  4OIR F;  2ESH A;  1G3S A;  3GTJ J;  2KIQ A;  2Y0S A;  3VYS B;  4CIC A;  4M6V A;  1FSH A;  2QKM B;  4JQF A;  2QA4 I;  3IAS 2;  1FOY A;  3BR1 A;  1MBF A;  1QQI A;  2UUZ A;  5K1Y A;  1ZHF A;  4BNC A;  2NAZ A;  1HF0 A;  2D1V A;  4ZYG A;  1YIJ I;  4C3J J;  3GTQ J;  2PLY A;  3NQO A;  5C4X J;  3KET A;  3M07 A;  3DP7 A;  3R6S A;  3JTH A;  4RAG A;  4FX0 A;  1HST A;  1V54 H;  2YR2 A;  2ME0 A;  4M74 A;  3BQY A;  3K4B A;  1V5E A;  2LDU A;  3L2C A;  4D5C A;  4A3F J;  2QSG X;  3HPG A;  4M72 A;  4V2F A;  1W7P A;  3Q9V A;  3CMM A;  2DJN A;  2XGE A;  3IV5 A;  5J8F A;  5LHG A;  3K2Z A;  4XKB A;  5HOD A;  3WTX C;  4RGR A;  3WOD F;  4AYB A;  4ZTJ A;  2HOS A;  3CDL A;  1JJ8 C;  1XCB A;  3FF5 A;  3MD2 A;  4XOR A;  1QZZ A;  1JXS A;  4CHU A;  4BHB A;  2ZBK A;  1PYV A;  1T38 A;  3F22 A;  3AFH A;  3BZK A;  1W5T A;  2F6C A;  1VQM I;  1E0E A;  1A6I A;  2LKS A;  3DU6 A;  5H6R A;  2QZ8 A;  4DZJ A;  2L7F P;  3T5X A;  4BXX J;  3VSK A;  5J4Y A;  3WTV C;  4G94 A;  5TIS C;  3KP3 A;  2MFZ A;  2M0C A;  4A3G J;  1X1A A;  2V1N A;  4XRF A;  4YFX F;  1M1E B;  4PGH A;  1R5I D;  2H8W A;  1XD7 A;  3A03 A;  3J81 K;  2A5W A;  2X51 A;  2ETH A;  2VKD A;  1SAU A;  1U9O A;  5LRS A;  3FBN B;  3FIS A;  3HUG A;  3Q0U A;  2Z9O A;  1WH5 A;  3SEQ A;  1D0X A;  2KQR A;  3HB9 A;  3BJA A;  4CH7 A;  1YLF A;  4II3 A;  3BQZ A;  1TT0 A;  4HST A;  2OUM A;  5K5Q A;  4GCV A;  3VWB A;  1S5L C;  3FKJ A;  3L2Q A;  2BGC A;  2PQ8 A;  1LE8 A;  1ETK A;  3S2D J;  2VQG A;  3M8E A;  5IY5 H;  2VUM J;  3P9I A;  1DPU A;  1RUO A;  1MJA A;  3TQN A;  4EV0 A;  5CKT A;  3ZQH A;  4IEJ A;  1R1U A;  4KIS A;  4BS9 A;  4F3Q A;  1K4S A;  2A69 F;  2PEX A;  2JQ7 A;  3OYK A;  1R58 A;  3KLN A;  2XV4 S;  2KIM A;  3LSK A;  2K02 A;  1E3P A;  4I98 B;  4IJA A;  5CJ9 A;  2CUZ A;  1BJZ A;  2EZK A;  3CJR B;  1GXQ A;  1TT5 B;  4B8X A;  5J1U A;  2O8X A;  3FBI B;  2UWM A;  1ZGA A;  3DQV C;  3UNG C;  1RZ4 A;  1X19 A;  9ANT A;  2ESN A;  1I6X A;  1LB2 A;  3RKY A;  2HFH A;  4HX7 A;  1YI2 I;  4BL0 B;  2FML A;  2M5W A;  2F48 A;  1LDD A;  3BG5 A;  4H4K C;  2LVS A;  2DFH A;  1FYM A;  3DFG A;  1JUP A;  4I76 A;  2CSO A;  2K9Q A;  2O8K A;  1J2X A;  1R22 A;  4L5I A;  4YFK F;  2JTV A;  2E7W A;  3H5N A;  3I4P A;  3JTG A;  1LJ9 A;  2ZKZ A;  1TBX A;  1VQ6 I;  4KMF A;  4AIK A;  1XB4 A;  1Y1W J;  3PL8 A;  4KIB A;  2PX9 A;  2HQN A;  2IXS A;  2YSR A;  3G1L A;  3D5L A;  1U78 A;  2X48 A;  3OYD A;  4S0H B;  1ZG1 A;  2GA1 A;  1H9T A;  5DD4 A;  4CYC B;  3ABU A;  1VQ4 I;  3K7A J;  4M9X A;  1MMS A;  3FMQ A;  4R8H A;  4QPQ A;  4BE1 A;  2H09 A;  5IYD J;  1QGP A;  3FM5 A;  4PUS A;  2LR8 A;  3KEO A;  2BY0 A;  3SJM A;  2UV1 A;  4RM3 A;  2VIX A;  3G73 A;  2L7M P;  1YJ9 I;  3MMY B;  3EPZ A;  3HKZ N;  3ERM A;  3GTO J;  1WJE A;  5F0F A;  5JFR A;  3HGG A;  2JA5 J;  2JWT A;  3LA3 A;  1GV5 A;  3LSR A;  4NUB A;  2HPM A;  5K5R A;  1BR4 A;  1O57 A;  2M45 A;  2QYO A;  5H20 A;  3QYE A;  5IP6 A;  3ZMT A;  3W2W A;  2ME6 A;  1BL0 A;  5DM6 F;  1N77 A;  1MMD A;  2QF7 A;  3CCS I;  5EF6 A;  4M3F A;  5DV5 A;  1MMA A;  3F8M A;  1X58 A;  1S8N A;  3ZMV A;  2P6T A;  2VJJ A;  5LGT A;  3MZH A;  3W6V A;  1ZR4 A;  3I9V 2;  5CVV A;  4FTH A;  2JPC A;  1FOW A;  2Y9Z A;  2M1B A;  3KZZ A;  4I01 A;  3CC4 I;  4AVZ A;  5FFZ A;  5D4S A;  2NOJ B;  2YU3 A;  1WHU A;  3AL0 B;  1MBH A;  2BY2 A;  2K85 A;  2Y31 A;  5D8L B;  3FHN A;  4FX4 A;  3HGY A;  4Z6Y A;  4YFN F;  4Y15 A;  2CQK A;  2JVH A;  5FD6 A;  4LJZ F;  4CSW A;  3BR6 A;  5F6F A;  1KU9 A;  2ISZ A;  1IJW C;  3DBH B;  2BY1 A;  2KP6 A;  4IQ4 A;  2ZJP F;  5IT9 Z;  2W7N A;  2EFQ A;  4YIF A;  3KZY A;  4EJV A;  1XN7 A;  2WY8 Q;  3BPV A;  5E8I A;  2A6H F;  2MH2 A;  4M3G A;  5EG0 B;  3LOC A;  5FKK A;  2M7B A;  3ESW B;  3BOQ A;  4KMU X;  1MH3 A;  3S2W A;  3ZMS A;  3DBR B;  4HDU A;  2A68 F;  3IWZ A;  2XAF A;  1N25 A;  3TBI A;  3SYT A;  1TNS A;  5DCM A;  2GM4 A;  1PP7 U;  3GO5 A;  1P7I A;  3PFI A;  3M4O J;  1X1C A;  5L3E A;  2EV0 A;  5DYM A;  1Z77 A;  1IDZ A;  1A31 A;  5HNH A;  1W36 C;  2AS5 F;  3CUQ A;  2O5R A;  3L09 A;  3L7W A;  2DN0 A;  4IHX A;  3VSL A;  5M5W J;  3MZ8 A;  2CU7 A;  1B1B A;  4LIT A;  2ADU A;  4PDK A;  1IAW A;  1CGP A;  3AAF A;  1FZP B;  5C44 J;  2FNP A;  4NBQ A;  4Y33 A;  4ANJ A;  1QZE A;  2CUJ A;  3L1P A;  4S05 A;  2KDZ A;  3S1M J;  5TRD A;  1USS A;  1T2K A;  1B9M A;  2YPR A;  1W7P D;  4A0Z A;  4IHY A;  3MKZ A;  2O61 A;  2HEO A;  4M3D A;  3FXK A;  1U3E M;  3KZI C;  3NAR A;  5JI6 A;  1RKW A;  2XRL A;  1WJ5 A;  3I59 B;  4LIV A;  4C3H J;  1SFK A;  3CCM I;  4CCJ A;  1WQ2 A;  4C30 A;  2VOD A;  2MYS A;  2VC1 A;  2K27 A;  1PVE A;  4A5M A;  1B9N A;  2R7F A;  2CQN A;  2XUB A;  3K70 D;  1ZH5 A;  1U5T A;  3FWE A;  5L3C A;  4L9V A;  2XRO A;  3OYL A;  5BQT A;  1Y8Q B;  2FJ1 A;  1JTX A;  1YW9 A;  2MD5 A;  1UB9 A;  1X2M A;  3K2A A;  2O6G E;  4M3E A;  5F1J A;  1AA7 A;  1W4M A;  3CTA A;  4E7I A;  4N4N B;  2HOE A;  3G71 I;  4F52 A;  4G6Q A;  1JHF A;  3DBL B;  1IN6 A;  2KZV A;  2DMU A;  4MTE A;  1IXS B;  4FAS D;  5E1X A;  2VQH A;  2ZCW A;  3SDG A;  4BEH A;  2E35 A;  1IG7 A;  3JRC A;  5K7F A;  1KQ9 A;  1FBQ A;  2DT5 A;  4UHT A;  2IEK A;  2DJI A;  5BNG A;  2KKO A;  2EA2 A;  2EIL H;  2HQR A;  1ZGW A;  2G0E A;  2XKO A;  3TO9 A;  1A6Q A;  1ZRC A;  4IHT A;  4BDY A;  1Y6I A;  1ZAO A;  2E71 A;  2OQG A;  3LWF A;  3EUH A;  1WI9 A;  2M3A A;  3C3W A;  3M7G A;  4N0B A;  4D9J A;  3LSJ A;  4KNY A;  3CME I;  3GWZ A;  4I02 A;  5FRO A;  5LHI A;  2K4B A;  4PGG A;  1R7J A;  1LQ1 A;  1POG A;  2FBH A;  2K86 A;  3V8J A;  1TQI A;  4A3I J;  5C3E J;  3GZ6 A;  4IXA A;  1IN8 A;  4G9Y A;  4ENN A;  3NWT A;  3TL4 X;  4I7H A;  1B8I A;  4FE4 A;  5AON A;  1BI1 A;  4M9S A;  3LA7 A;  5LGU A;  3ML6 A;  5LD2 C;  3CCQ I;  3A2K A;  5LEK A;  5JR3 A;  3C2B A;  2UZK A;  4GDF A;  4BKX A;  1NHA A;  1SVM A;  3OL4 A;  4G6T B;  1AKH A;  3FK6 A;  1IXC A;  3I55 I;  4E70 A;  5D4R A;  3AG3 H;  5IYB J;  1RC9 A;  3KYC B;  4E7J A;  1Z6T A;  2MA3 A;  1HKT A;  1WWX A;  3ZP5 A;  2DOE A;  4UUS B;  2ID6 A;  2EV6 A;  2IPQ X;  3GXO A;  2Q8K A;  5A2Q K;  3CCV I;  2FRH A;  3BCB A;  3DXJ F;  2X1E A;  1Z3X A;  1FIP A;  2QQB A;  3S3M A;  1FLI A;  4I0B A;  5JLX A;  1T98 A;  1OQY A;  4EJW A;  2EJR A;  1BR1 A;  1KGS A;  2KPM A;  2WAD A;  2LP0 A;  5HDK A;  4WF2 A;  1FC3 A;  3B6A A;  1G6N A;  3DKY A;  2HXO A;  1BI0 A;  2A6E F;  3ZMZ A;  2ZXW H;  3OYI A;  1ZK8 A;  2M87 A;  3WTU C;  2JA6 J;  2V1D A;  1I1G A;  2TRT A;  3HJE A;  3FXR A;  2VE9 A;  1OKR A;  2RQP A;  4NC6 A;  3ZR8 X;  2B7E A;  1ZLK A;  2DYR H;  3OYJ A;  1MMG A;  3IRQ A;  1R71 A;  3HXL A;  3AG2 H;  2STT A;  1T0F A;  4GXO A;  1BIA A;  5LBQ A;  1UMQ A;  4EJO A;  3DEE A;  1F43 A;  3ASO H;  3OYC A;  3TOA A;  5FKO A;  1BIB A;  1SFO J;  5E3N A;  1RET A;  2DAO A;  2MC4 A;  4HF2 A;  2FF4 A;  4F55 A;  5D6E A;  2EK5 A;  3BG7 A;  3J81 Z;  2IGO A;  2ZME B;  3GUD A;  3F8B A;  1MSE C;  2RNG A;  1FNN A;  1QHH D;  3ZQL A;  4EQQ A;  2QEN A;  3VB2 A;  1LFU P;  4GFB A;  2VJ5 A;  4ZDL A;  3S3N A;  4E7Z A;  4Y7N J;  2H8R A;  1R5H A;  2RDP A;  5AIQ A;  1SAN A;  1UST A;  4ABZ A;  5TGT A;  2DFI A;  1KA8 A;  4PJM A;  3LAJ A;  1UHM A;  4M9Z A;  2LC2 A;  1BR2 A;  4P9F A;  2P0W A;  1FSE A;  3BR5 A;  4K2E A;  3OYG A;  3VYU B;  1W5C C;  1J5Y A;  4BBS J;  1JE8 A;  2Y9Y A;  4F91 B;  1S3J A;  5FD5 A;  2O9L A;  1XX5 A;  3H9G A;  2CO5 A;  3E0J B;  3H0G J;  3JRH A;  4UB6 C;  1AU7 A;  2QUF A;  3L9F A;  1Y0N A;  3FXM A;  2JUG A;  4D0P A;  3H3U A;  3SXY A;  2KIS A;  2LFB A;  3L2U A;  1AOY A;  1EF4 A;  1FOX A;  1FBU A;  3HC7 A;  2WAQ N;  2W57 A;  3RKQ A;  5FKL A;  2DA3 A;  3WE3 A;  4DYC A;  2ICW G;  5HOO A;  2JPB A;  4BY1 J;  3GVA A;  4A69 C;  3WTW C;  4XOP A;  3GLX A;  2GWR A;  2DMP A;  3DPT A;  1LDK B;  4RS8 A;  3C18 A;  3NEU A;  2DOA A;  5EJC A;  1C0W A;  1Z6R A;  1GXP A;  1BC8 C;  3MCZ A;  3O2P E;  1MMN A;  1RR7 A;  1YFH A;  1B59 A;  4LIU A;  2A6T A;  4NC7 A;  1B72 A;  3ERE D;  2JZY A;  3ZOB A;  2DFE A;  4XLA A;  3RQ4 A;  2OTJ I;  3D5S C;  3LNQ A;  3T8R A;  2LY9 A;  4G12 A;  2IBD A;  1WH7 A;  2KFD A;  1YX5 A;  4R1H A;  5HS7 A;  3EET A;  4A3K J;  1ENH A;  1E17 A;  3RSN A;  3CF2 A;  3OV8 A;  2N8G A;  4II2 A;  2BVM A;  2BV6 A;  2STW A;  3BR2 A;  2QCO A;  2FEZ A;  3FMR A;  1K7A A;  4AIJ A;  1MSF C;  2NVQ J;  2K9N A;  3TDZ C;  2HTS A;  4HOB A;  2LD5 A;  1GV2 A;  3HOX J;  2M8G X;  3SQN A;  2KT0 A;  1I5Z A;  3P9K A;  3WGH A;  5GPA A;  1UZC A;  4ZDO A;  1LFP A;  3G4S I;  2E5N A;  2FOW A;  3EUK L;  4IZZ A;  2LSO A;  1S9H A;  4D5F A;  4E7L A;  2EH3 A;  1ITY A;  1FIA A;  3F8C A;  2GXA A;  2R4G A;  3K6G A;  2MLK A;  4MHG A;  3LSM A;  1RR8 C;  3DTI A;  3G6E I;  4UVB A;  1JTY A;  4DBQ A;  2JRT A;  1ZRF A;  2F5E A;  4RDU A;  1H8A C;  5HS9 A;  2IS6 A;  1YRN B;  4BU2 A;  3BTJ A;  2OV7 A;  2PN6 A;  2CYY A;  2DK8 A;  1XGN A;  3VDX A;  1NTC A;  2V9P A;  1HCR A;  2VQC A;  5DEQ A;  3F8F A;  2R7S A;  2KDO A;  3F0C A;  1YW7 A;  3DKW A;  3L2V A;  4D7N A;  1MNM C;  1MW7 A;  1UFM A;  5B1B H;  4HX4 A;  2RRE A;  3W3C A;  4S04 A;  2X4H A;  3PUF A;  4ZYE A;  2DA6 A;  3GTL J;  2O0Y A;  1ULY A;  2GZW A;  2V79 A;  2X0L A;  3AG4 H;  4U0Y A;  3PNV A;  1TP4 A;  2W24 A;  4RB0 A;  1AHD P;  4AC0 A;  5IOY A;  1Y56 A;  2K3P A;  1HW5 A;  2OU2 A;  5BS6 A;  3BPX A;  1X4P A;  1YE9 A;  3KP4 A;  4J01 A;  4XKC A;  3ZQ7 A;  3I64 A;  1OCP A;  1S6L A;  1WI3 A;  5E79 C;  2DQR A;  4PSX A;  1OFC X;  3DU5 A;  1S29 A;  2VKV A;  3IC7 A;  3QOE A;  1F9N A;  4XLH A;  2E2I J;  2VBY A;  4RA2 A;  5E3O A;  2PG4 A;  4XLF A;  1TC3 C;  5E18 F;  4ZTF A;  2A61 A;  2BHZ A;  2VOP A;  4IQJ A;  4HQE A;  2Z1D A;  2P7C B;  4RM2 A;  5EDN A;  2X6W A;  3M1C A;  4KT6 A;  1X4O A;  2CV1 A;  3UR3 C;  1CQT A;  1MBE A;  3CJN A;  1XS9 A;  2FUG 2;  3BTL A;  1SC7 A;  4B48 A;  3ZRG A;  4B43 A;  1UAA A;  2LYC A;  1KQ0 A;  3PNY A;  3CD6 I;  3AG1 H;  3L00 A;  3HSF A;  5EEA A;  2E5Z A;  2P5V A;  4P96 A;  1FX7 A;  3GBG A;  4DQ2 A;  1TLH B;  1OPC A;  1Z7L A;  2R7U A;  1T08 B;  3KYL A;  5J1Y A;  2E1M B;  2CUE A;  1SFE A;  4A3B J;  2QBY B;  4Z2Y A;  4XRM A;  1LKX A;  3CCY A;  1U0J A;  4E7H A;  1WJA A;  1FBS A;  1KYZ A;  3CP8 A;  4HF1 A;  2BW3 A;  3FXQ A;  3I56 I;  3CC2 I;  3ECH A;  3FHZ A;  4BAY A;  2M0M A;  2YX4 A;  2L02 A;  2LMD A;  2XIG A;  2VC0 A;  1U9N A;  4PSW A;  3FKI J;  2HZD A;  3P7N A;  1KZH A;  1OLT A;  3JSO A;  2M2E A;  5LEJ A;  3K4J A;  4XNF A;  2PMH A;  2GA2 A;  4EGZ A;  4LG0 B;  4NB5 A;  3FM3 A;  1WJC A;  3IKV A;  1K6Y A;  3PNT A;  2EV5 A;  5D5U B;  5B66 C;  4BQQ A;  4A2U A;  2D2W A;  1TTY A;  2IA0 A;  3JCU C;  3MFK A;  2NNY A;  3BR0 A;  4XLC A;  1RKT A;  1OCC H;  3R61 A;  3TKY A;  2K9M A;  3HKZ A;  2RV8 A;  2TCT A;  4I09 A;  2OQR A;  4XK4 A;  1PUF B;  4CA0 A;  4GYI A;  4OU0 A;  4CUG A;  1ZEL A;  2BXY A;  2WC2 A;  5CQE A;  4CO8 A;  5HDN A;  2A5Y B;  3GZN B;  3K69 A;  1ZLJ A;  1W5S A;  3QYB A;  3D0S A;  1RES A;  4KUM A;  5FKM A;  1HDP A;  3MN2 A;  2E1M C;  1SEU A;  1GVJ A;  1K61 A;  3DPL C;  3BRO A;  2DPU A;  5ILS A;  2M9H A;  3GME A;  1QBJ A;  4RGX A;  4DW6 A;  3J7Z I;  3HDD A;  2DO7 A;  1ZR2 A;  4XLP F;  4MFE A;  3RTR A;  3A01 B;  1G2H A;  1FMV A;  2QQ9 A;  3M3Y J;  2M4K A;  5DS9 A;  1OYI A;  2MH9 A;  4PFO A;  2PMU A;  2PI0 A;  3BG3 A;  2JA2 A;  4DGW B;  3OS0 A;  1DUX C;  3VFZ A;  3S14 J;  5FKN A;  2DA1 A;  4HAM A;  1IUF A;  4PZJ A;  2P7V B;  2GAU A;  2HQ5 A;  1PJR A;  4XR6 A;  5K5O A;  4O3M A;  2W00 A;  1KON A;  4BDZ A;  4B3A A;  2R0Q C;  1D3Y A;  3Q0V A;  1LNW A;  5E20 A;  3TMO A;  2OAZ A;  3VEP A;  1RIO H;  4QPO A;  2OZU A;  1G3Y A;  4DOZ A;  1W7P B;  3T1B A;  1HSJ A;  2I10 A;  4DNC A;  1O3R A;  3CCU I;  4YG2 F;  2XPV A;  2F2E A;  4NQW A;  4UNO A;  5IT3 A;  4P1W A;  5KAF C;  2XAU A;  1ON2 A;  2FBI A;  3ZGK A;  2P8T A;  1ACI A;  1FPQ A;  5KK1 A;  4IX7 A;  3KPH A;  2COM A;  1LFB A;  1Z7U A;  2AXL A;  5A2Q Z;  4J00 A;  2XB5 A;  2GOM A;  3WU2 C;  1WSU A;  3OIO A;  4XON A;  1R6R A;  3OIQ A;  4C3I J;  4IO9 F;  1QA6 A;  5L3F A;  3I58 A;  3G1O A;  1WCM J;  1IUY A;  1IXR C;  2WTE A;  3WHC A;  2X1D A;  3H9J A;  1K78 A;  5EZH A;  3HOY J;  1D8J A;  3OMY A;  3BP8 A;  1K6O A;  4EGY A;  2IRF G;  3HOV J;  2LTP A;  4O6J A;  4UVC A;  2FA5 A;  3K4C A;  3HUG B;  3CLQ A;  1Z0X A;  1G4D A;  2VB6 A;  1X1P A;  2IGN A;  3ONQ A;  4IHV A;  3HOW J;  1FMW A;  4PFP A;  3GF2 A;  4N9H A;  1OCO H;  1QZY A;  2R7O A;  2DFF A;  2HDW A;  4BAC A;  4OIO F;  4HV6 A;  1D5Y A;  1LE8 B;  4X1E A;  1QNT A;  2EFW A;  4HNT A;  2VQL A;  2WA0 A;  1YW8 A;  2UXN A;  2ZJR F;  3GFJ A;  2H6C A;  2HKX A;  3V8L A;  2VXD A;  3I54 A;  1YQA A;  1OMI A;  4RBO A;  2CV2 A;  4HV5 A;  3RCO A;  2W4S A;  4ASN A;  1BI2 A;  3NAU A;  3VYR B;  3SZG A;  5KHD A;  3E3V A;  5FRN A;  5KAI C;  3S8P A;  2VI6 A;  1J75 A;  3H5A A;  1P7J A;  5HDG A;  5J47 A;  1FY7 A;  4U0V A;  3CCL I;  2WAF A;  4E6K G;  2KRH A;  1GLN A;  2XPU A;  2EFO A;  1HBX G;  2GLO A;  1SVO A;  3CP2 A;  3K70 C;  2EFP A;  3HOU J;  1E3H A;  3LSG A;  4B09 A;  4FIS A;  2DT6 A;  4RGU A;  4QLC U;  2K9L A;  1V5G A;  1IRF A;  1NG6 A;  1KYW A;  3TOB A;  2HYG D;  3DV8 A;  3MAJ A;  4O5V A;  2FNA A;  4CCK A;  1X3Z B;  3MKY B;  1O7L A;  3IRR A;  3KP5 A;  2B63 J;  2MBF A;  2ZXJ A;  3QQA A;  2FX0 A;  2KRC A;  4IOC F;  5BMZ A;  2OCE A;  5F0C A;  3E6B A;  1UCR A;  2BY3 A;  2VN2 A;  2Z33 A;  4UV9 A;  4U87 A;  3HSE A;  3AL0 C;  2XC7 A;  3HRU A;  4Q4Z F;  1XSX A;  1XSV A;  2HR3 A;  3N97 A;  1ZN2 A;  4ZYD A;  3CCR I;  2L54 A;  5ED4 A;  4BHC A;  2ECC A;  5KNL A;  2B9S A;  3U1K A;  5IP9 J;  4XRS G;  2JVG A;  2Y30 A;  2R5Z A;  1REP C;  3F8N A;  2CQQ A;  1DQU A;  2DMQ A;  2JMW A;  1RNL A;  1X3W B;  2LRD A;  4LK0 F;  1VQK I;  4MEY F;  4HPQ A;  3Q0W A;  1N78 A;  1UHS A;  2QLZ A;  3HRT A;  4U7D A;  2LY2 A;  5J3L A;  1JGG A;  3H1C A;  2E34 A;  5KVR A;  4XN0 A;  2GIV A;  3TO7 A;  2XAQ A;  3BDD A;  4IPA A;  1E3O C;  4OAZ A;  3ZMU A;  4F93 B;  3BJO A;  3HG9 A;  3V7R A;  2VBX A;  3ZQG A;  4UB8 C;  3RPQ A;  1G59 A;  2K7L A;  3BWG A;  1QPI A;  1UEL B;  1F5T A;  2OCC H;  1XGS A;  2L5Q A;  2Y69 H;  2W84 A;  3Q3S A;  2KRF A;  2XHK A;  5HNF A;  1N75 A;  1OR7 A;  3JSP A;  3G2B A;  4BXF A;  3TW7 A;  4HLX A;  2HOT A;  1IO2 A;  1V3F A;  1X2N A;  3DLA A;  4L9T A;  1FTZ A;  3FIW A;  1D1B A;  3HYI A;  3I71 A;  1MD0 A;  3VOE A;  3K1P A;  4RB2 C;  1YOV B;  2HPI A;  2XSJ C;  5LHH A;  2NS7 A;  1Q1H A;  2ZC2 A;  5E3L A;  1PUE E;  3GTG J;  2PFB A;  2OJE D;  4XL9 A;  1FJL A;  3S1N J;  1LEA A;  4Y13 A;  2Q1Z B;  4XRS A;  4Q47 A;  3PFY A;  4LLL A;  3K0L A;  4HX8 A;  3QYF A;  2ACJ A;  2X1C A;  3ABT A;  1TW2 A;  1VND A;  6PAX A;  2BZT A;  4M6Y A;  3FXL A;  1VQ9 I;  3TO6 A;  5E3M A;  2ZJQ F;  3S17 J;  4JX4 A;  2M8E A;  3OSG A;  2L2O A;  4HBL A;  4IRI A;  2QKL B;  4E7S A;  1JGS A;  1MBK A;  5L3D A;  3LA2 A;  5J1R A;  4XOT A;  1R00 A;  2DQL A;  2CWE A;  5DCM B;  1O3Q A;  3B73 A;  2PMZ N;  1FP2 A;  1ERD A;  2X6Y A;  5L3G A;  2EBI A;  2KIF A;  2VJ4 A;  4MGR A;  4OIQ F;  3QRF F;  5LFA A;  3LQQ A;  3CUQ B;  3HHH A;  5JVT A;  2HS5 A;  2FE3 A;  2GIZ A;  3HHG A;  4ENK A;  3QAH A;  5E8G A;  4MLO A;  1KU3 A;  5GPC A;  1FP1 D;  1LDJ A;  4PK4 A;  4QTR A;  1T6S A;  1Z3Y A;  2XGX A;  1J9I A;  4QIW N;  4ZYH A;  3DCF A;  5BPI A;  1CF7 A;  2E1O A;  1SD7 A;  4A3L J;  1MBJ A;  4JK1 X;  2VON A;  1X1D A;  1ZG3 A;  2KJC A;  3CCE I;  1JT0 A;  3RJP A;  1DGW Y;  1GDT A;  4ZZD A;  4XBF A;  3C7J A;  1MJ9 A;  3KFW X;  4ZDP A;  2HTJ A;  4MQ9 F;  3A0H C;  3GYH X;  5FFX A;  5D8K B;  2DBB A;  4OIN F;  1EV7 A;  2KJB A;  1Y1V J;  2OTL I;  3P9C A;  4KT5 C;  4Y17 A;  4MEX F;  2YS9 A;  5FLV A;  5FB2 A;  4CGZ A;  4A3D J;  3PQJ A;  4DBR A;  3L2W A;  2RKH A;  2XB0 X;  2QQ8 A;  2IS4 A;  5F27 A;  1DU6 A;  4YIR X;  2DXI A;  1F36 A;  4U7B A;  1S7E A;  4C2T A;  1U5T B;  2XRN A;  4UUV A;  3ISP A;  4WK8 F;  3CUQ C;  1P4W A;  2P5K A;  2LBF A;  1R4N B;  3F9K A;  3PSI A;  1Z21 A;  5DM7 F;  3CLO A;  3O8G A;  2XF7 A;  3ABK H;  1ZAR A;  3SHF A;  5FJ8 J;  4P55 A;  3IKT A;  1JJ6 C;  4HW0 A;  2IS2 A;  4BGD A;  2WAQ A;  2LRE A;  1LPQ A;  3K1N A;  5JHU A;  2L7K A;  3J7A Y;  5FGM A;  1F1Z A;  2X85 A;  4GRI A;  1TL8 A;  1YG2 A;  4L0Y B;  2F5C A;  2LG4 A;  3BCA A;  4P5O A;  2R5Y A;  4FQG A;  1XCV A;  3PO2 J;  1I1S A;  2Q2E B;  1IRG A;  4BEH B;  4XSZ F;  2PJP A;  5EGO A;  3CZ6 A;  2JJ7 A;  3A1Y A;  5CVU A;  4BQN A;  4AM3 A;  2PJR A;  1VQL I;  4CYD A;  2MD0 A;  4UUT A;  2VT3 A;  1YHQ I;  3FZV A;  5CYV A;  1EH6 A;  2IJL A;  3HOS A;  1ON1 A;  1TWA J;  1F4K A;  2QSH X;  3M1E A;  2GXG A;  1Z9C A;  3KIO A;  5HLH A;  2DTR A;  1G3W A;  1XGO A;  4BE0 A;  2L9S A;  3W6K B;  4CZZ A;  2ZSH B;  4L5E A;  4MTD A;  1WJD A;  3DEU A;  3BR3 A;  4OMY A;  2XAJ A;  4LB6 B;  4A12 A;  1B8I B;  3B02 A;  4BUP A;  1IN7 A;  3GZ5 A;  4L18 B;  2EA4 A;  5HVQ C;  4XSX F;  2CRG A;  4LLN A;  1EJ9 A;  1IZ1 A;  3RYP A;  2XKP A;  1JHH A;  2EIK H;  3QU6 A;  1LUJ B;  1ETO A;  1R9T J;  1AKH B;  3BJ6 A;  2E60 A;  4M71 A;  1OCZ H;  3JRB A;  4OAY A;  2GXB A;  3OWT A;  2I8D A;  3PM1 A;  2EWN A;  3E5Q A;  2G7H A;  2FMY A;  5EZG A;  2RN7 A;  1YTY A;  5GAD J;  2R92 J;  3AKZ A;  2KHM A;  5DUI A;  1XPX A;  3QPT A;  2P5L C;  2EZL A;  2ZME C;  2NOG A;  3KX2 A;  4F92 B;  2NVT J;  1QPM A;  3JRD A;  3GTP J;  2W1O A;  3TP0 A;  3S1R J;  2EIJ H;  1XC5 A;  1BA5 A;  1IDY A;  4WCG A;  5F08 A;  1D1C A;  3H3Z A;  2XDV A;  2WB1 N;  3K4N A;  5EEH A;  4B4C A;  3JRE A;  1Z67 A;  4FE7 A;  3BC8 A;  4AWX B;  2ZB9 A;  2QQA A;  3HEF A;  3RIR A;  3SDB A;  4D1Q A;  1I3A A;  2CFO A;  3NWS A;  4PJN A;  1JUS A;  4JX6 A;  1FEX A;  1Y8R B;  3RKW A;  2ELK A;  1O3T A;  2FSW A;  3HIF A;  3O3K A;  5ICC A;  1I27 A;  2HKO A;  3CDI A;  2L9N A;  1P4X A;  3ULQ B;  1YO5 C;  5CVI A;  5FO5 A;  2F5D A;  3IL2 A;  3JAM K;  3J7Y J;  4D7M A;  3A02 A;  2CGP A;  1ETX A;  2DA7 A;  5CLS A;  1UJ8 A;  1V5F A;  2HXI A;  4F7Z A;  4FCY A;  4M6X A;  3UKG A;  3D1N I;  1PDN C;  1ETV A;  3CJQ B;  2XGD A;  2HU9 A;  2V1U A;  2R7W A;  5ILV A;  1X1B A;  2IS1 A;  2V4J C;  3REO A;  2KMU A;  3U2R A;  3SFI A;  1S72 I;  3V8K A;  1RUN A;  5HLG A;  1Y39 A;  2Y0M A;  2F5F A;  5LRR A;  4B1R A;  4BH9 A;  1TWC J;  2VT2 A;  3J80 K;  1R49 A;  3HZJ A;  3A4C A;  1WZ2 A;  2BEO A;  1WKM A;  4B44 A;  1TWF J;  2J5P A;  5CVJ A;  1T8I A;  4UVA A;  2MG4 A;  2VBZ A;  3I3L A;  3LL7 A;  1QU3 A;  1BBY A;  3Q9S A;  5HS8 A;  1HA8 A;  3KP7 A;  3QPL A;  3H3V K;  2JSP A;  2F5V A;  4HNU A;  2DU9 A;  4A93 J;  3I4N J;  4ZC3 A;  2DDA A;  3WTZ A;  4NNJ A;  4W97 A;  3S3O A;  2FU4 A;  1SMT A;  3DLL F;  3RQI A;  2HDC A;  4M3B A;  4MO7 A;  3OYN A;  4CDG A;  4YEJ A;  1MH4 A;  1H89 C;  2YUS A;  3GLL A;  3DF8 A;  1RI7 A;  3W2A A;  4KIC A;  2BBY A;  4Y4R A;  3DTE A;  3GX4 X;  3QOP A;  4XKW A;  2CV0 A;  4LK1 F;  3R0J A;  3K4K A;  2A3S A;  1AWC A;  1VQO I;  1MNE A;  4NC8 A;  4BE2 A;  5FRM A;  1YYV A;  1A04 A;  2Y48 A;  3PSF A;  4V19 K;  1W1W E;  1H0M A;  2IVM A;  1P6R A;  3ZCO A;  3G3Z A;  3V7S A;  3ZQC A;  1WJF A;  4BJ5 C;  2W25 A;  4IHW A;  2L4A A;  3PUB A;  1WRJ A;  2FQ4 A;  2ELJ A;  2ZFW A;  3S15 J;  2Y75 A;  2RNJ A;  1B72 B;  3I53 A;  2DT7 B;  5GAG J;  2K4J A;  3ZN0 A;  2CW7 A;  5M5Y J;  1OYW A;  5GTH C;  4ITV A;  2NVU B;  1ONV A;  3JRF A;  5ICF A;  4RAF A;  3H92 A;  3U21 A;  3A01 A;  4M73 A;  4DYQ A;  3EYI A;  2JK3 A;  5DCF A;  2J5O A;  5F04 A;  1IV8 A;  1IN5 A;  1NH3 A;  5DUK A;  3A0B C;  2F4O B;  3HRS A;  4AIH A;  2LOO A;  5HLI A;  4EJU A;  5J8C A;  1P92 A;  2L01 A;  4HDV A;  1DU0 A;  2IT0 A;  3WHB A;  2EZH A;  2E19 A;  2RQQ A;  4EM2 A;  1Q1V A;  4AVP A;  4C2U A;  1JI8 A;  3K9T A;  2QWW A;  3BY6 A;  3GCM A;  3RYR A;  2X6O A;  2WY7 Q;  2ECB A;  4CZC A;  5FLX K;  4CYC A;  2YX7 A;  2KLO A;  1T33 A;  2JA8 J;  1K4T A;  1YIO A;  2IAI A;  1YJN I;  3S16 J;  5CVR A;  4HEA 2;  2LF7 A;  3HTU A;  3MKL A;  3QPS A;  4HF0 A;  2EZI A;  2A07 F;  1MIJ A;  3PIP F;  3SFZ A;  5GAH J;  2ZFU A;  1U8R A;  5J4V A;  1P9Q C;  4L0Z B;  5F1R A;  1FYK A;  3ZXS A;  5D5V B;  1R36 A;  1HW2 A;  1D8K A;  1QVT A;  2Z16 A;  2NVX J;  1R5G A;  1ZGJ A;  4B3X A;  2WBM A;  1R4M B;  1FWZ A;  2Y0S N;  4I99 C;  3BTI A;  4JOM A;  4I2O A;  3E5X A;  2COB A;  2Q0O A;  2ZXI A;  4WXH A;  5M3F J;  2ZJ2 A;  4AID A;  3ELK A;  3KCC A;  3WE2 A;  2NVY J;  1NK3 P;  4LB5 A;  1MDM B;  2MW8 A;  3LSI A;  1KQ8 A;  4E7K A;  2D45 A;  4FHT A;  3LFU A;  1VQ5 I;  1D1A A;  1YS7 A;  2CW0 F;  3QP5 A;  2IP2 A;  2VKE A;  1RRJ A;  4IRH A;  2ISY A;  4ESF A;  3LFK A;  2K40 A;  1L0O C;  5B3S H;  2IA2 A;  1EA3 A;  3IH3 A;  3MWM A;  3DEW A;  4NDL A;  4AYB N;  1MND A;  1EH8 A;  1IRX A;  1I3Q J;  2WV0 A;  4KN4 X;  5EG0 A;  3BG9 A;  1VQN I;  3COA C;  2WAE A;  4G7Z F;  4ETS A;  2LF8 A;  4A0Y A;  2HVQ A;  3V7C A;  1FYL A;  1ETQ A;  1T56 A;  2Z99 A;  3LQR A;  3C2H A;  2HVR A;  4RB1 A;  4DJA A;  2VBW A;  2LKP A;  3M9A A;  4IL6 C;  2HOA A;  2Z5U A;  1IV6 A;  2LY1 A;  3BZC A;  1XTA A;  2YU9 J;  1J09 A;  1BJA A;  1ETW A;  2V9K A;  3ABM H;  2GOX B;  4L9J A;  2H1L A;  2WV1 A;  4RLF A;  2VKH A;  1UG2 A;  3DKX A;  1HC8 A;  1BW5 A;  2X6X A;  3E1S A;  1DP7 P;  1GUU A;  3ZQI A;  1U2W A;  3TED A;  3QU3 A;  3DWL E;  3I0T A;  3WGI A;  3BG6 A;  1P2F A;  1TNT A;  1EH7 A;  2BW3 B;  5B1A H;  3KYD B;  4RAY A;  2M30 A;  3H36 A;  2R3S A;  1A35 A;  4G7O F;  2H27 A;  3E5U A;  1BM9 A;  3FXO A;  5CQG A;  5JHF A;  1VQP I;  2QGU A;  3HTS B;  1ZTR A;  1J7K A;  2JUC A;  3EYY A;  1W0U A;  1GT0 C;  2DTZ A;  2OZ6 A;  1HKS A;  3I5U A;  1JT6 A;  3F6O A;  4UV8 A;  2NRA C;  2JRM A;  3HPH A;  4CCL A;  1JKP C;  5LLQ A;  3LAP A;  3I59 A;  3CO7 C;  1IRZ A;  1IF1 A;  2OC6 A;  2LLK A;  2L9R A;  3LST A;  1DDN A;  2R7D A;  3PIO F;  4ENM A;  4A0X A;  1B6A A;  3CDH A;  3S93 A;  2JA7 J;  3HOZ J;  4MQV A;  1P4A A;  2XGC A;  4XID A;  3W2V A;  2O3F A;  3BTC A;  3ZQQ A;  3SZT A;  2OPT A;  1ZKG A;  4RMN A;  1QRY A;  3LSP A;  3MKW B;  2CQ7 A;  1Z1D A;  4E4H A;  2XAH A;  1EKE A;  1OCR H;  3JRG A;  1JKO C;  2DMN A;  4GGG A;  2HWV A;  3F3X A;  4A3M J;  5LGN A;  2P4W A;  2LK2 A;  5H2F C;  2VJI A;  2TDX A;  3RDI A;  2KIU A;  3HL2 A;  3IAM 2;  2HVS A;  3H35 A;  4OOI A;  3DTK A;  4ZH4 F;  4IVN A;  5D6F A;  3VOD A;  2CS3 A;  4KN7 X;  1HKQ A;  4JX5 A;  1MBG A;  4HG2 A;  2CG4 A;  4Y3O A;  1SFX A;  3HBL A;  3WG9 A;  1TQP A;  1MGT A;  3RKX A;  4RGS A;  3IHU A;  3K10 A;  4XQF A;  3CC7 I;  2BYV E;  4IHS A;  3FDY A;  1QVU A;  2JN6 A;  2DA4 A;  2DI3 A;  2CW8 A;  5IYC J;  1E2X A;  4XKV A;  2GBY A;  4PJ0 C;  2R7Z J;  2R7X A;  5E17 F;  1H88 C;  1XMK A;  3R0A A;  4LMY A;  1XGM A;  5J40 A;  4NQW B;  3J7A O;  1VI0 A;  2W85 A;  5AIP A;  4A5N A;  3E97 A;  1SD4 A;  3OOP A;  4W1U A;  4XLE A;  4DZP A;  4RB3 C;  1YX3 A;  4ENJ A;  3GEZ A;  3GTK J;  3M8J A;  4I0A A;  3RPU A;  3CO6 C;  3U1D A;  4HYE A;  4EM1 A;  1WFX A;  2ZXH A;  3N4M A;  2PMZ A;  2R7V A;  3OY9 A;  1T39 A;  1WVR A;  2XPW A;  3CUO A;  2L9V A;  2HI3 A;  4HA8 A;  5J6X A;  4YII A;  1U6G A;  1VZ0 A;  4GYG A;  1K78 B;  1ZRD A;  2HYF A;  2LNB A;  2XVC A;  1ZQ3 P;  2D5V A;  1LVK A;  4G6D A;  4YEL A;  2QEX I;  2CQX A;  1A36 A;  5GP9 A;  4UUS A;  4Y52 J;  5D5W B;  1R23 A;  4LD5 A;  4LGW A;  2LKX A;  3TP3 A;  2FXA A;  2AHQ A;  4IKF A;  2HQA A;  4XMY A;  1GHC A;  2B0L A;  2OA4 A;  1SAX A;  4EJT A;  3TW6 A;  3CES A;  4EEF G;  1BN5 A;  3B6C A;  1UG0 A;  2R7R A;  1WGX A;  3FK7 A;  2BVL A;  1TWH J;  2PBI A;  3JAM Z;  2HYJ A;  2RC4 A;  5GTI C;  5ICE A;  3ECO A;  5F0H A;  3IH2 A;  2QSF X;  2L0K A;  3OS2 A;  2VLA A;  4ESJ A;  1TW3 A;  2MSY A;  1HW1 A;  4KIF A;  3W6J B;  2R7T A;  2DDB A;  2F4I A;  1R1V A;  1L3L A;  5C4J J;  2L3D A;  2GQQ A;  1HDD C;  2FBK A;  3KE2 A;  4QSH A;  1WPK A;  3WGG A;  5D5X B;  1W36 D;  3K4L A;  3EUA A;  1QHG A;  4PJJ A;  4ON0 A;  2Q2E A;  4EVI A;  4WX9 A;  5H6Q A;  5L3B A;  2D1H A;  2ZNZ A;  4EM0 B;  3J80 Z;  3F21 A;  3FMS A;  4AUX A;  3OSF A;  2G7U A;  3ZMD A;  5GAE J;  5K7Z A;  3OYH A;  3QOD A;  4HRI A;  3WG7 H;  4EMS A;  2VOO A;  5TJJ A;  4Q48 A;  1XDU A;  2ELH A;  2EQR A;  2F4M B;  4RAZ A;  2ZME A;  4ZZL A;  4A6E A;  3GFL A;  4KDP A;  4I6Z A;  3O6B B;  4X6A J;  1J59 A;  1XSD A;  4IOA F;  1TZL A;  2MLG A;  3WTS C;  3JW4 A;  3IUO A;  2VPR A;  1STZ A;  5FLM J;  3S32 A;  1UHW A;  1IN4 A;  2HNH A;  4KIG A;  2NYX A;  3F72 A;  3NRV A;  3V4G A;  1R1T A;  4L9N A;  2IA1 A;  2OBP A;  1DPR A;  3OOU A;  5F64 A;  1MZB A;  5M3M J;  1DP3 A;  2AO9 A;  3R4K A;  3P5J A;  5KCM A;  3GFM A;  1YS6 A;  2UXX A;  3WU0 A;  2XF5 A;  1D0Z A;  2G9W A;  2R5Z B;  2Y2Z A;  1VQ7 I;  3ABL H;  1FTT A;  1OCT C;  1BW6 A;  3OR1 C;  2W48 A;  3DPU A;  2E36 A;  1NG7 A;  1HOM A;  3K4M A;  4BJT A;  5JVG F;  3M8F A;  1OIS A;  3CQZ J;  3OYE A;  1S7A A;  4A3C J;  2EIM H;  2EIN H;  2NS0 A;  2NXN B;  3G1M A;  4UXN A;  5CPR B;  2M7A A;  1ETY A;  3ASN H;  1ZG5 A;  1XG1 A;  3OYB A;  4N9I A;  2L4M A;  2V7F A;  2XAG A;  4MNU A;  1J0R A;  2H6B A;  2ZNY A;  4BHP A;  1OJL A;  4AD9 A;  3KP6 A;  4HLY A;  1SFU A;  2AQE A;  4MFD A;  3OYM A;  3H0D A;  4LLG F;  1O7F A;  2E2H J;  4G8X A;  1TQM A;  3KP2 A;  3PJR A;  3E6M A;  2XSD C;  5BOX A;  4AU7 A;  4PCQ A;  2V6E A;  3IP4 B;  5JLW A;  1HQC A;  1IW7 F;  3U9G A;  2DCE A;  3IWF A;  2L7Z A;  4BBR J;  4C9Y A;  1ZYR F;  2DOD A;  1BI3 A;  1IC8 A;  2X9D A;  3CMY A;  1GVD A;  4KJZ A;  1VFC A;  4XM3 A;  2FOK A;  2ZO4 A;  4CCM A;  1A5J A;  3N05 A;  3PO3 J;  5IP7 J;  1D5V A;  3MQ0 A;  5B5E C;  1X3U A;  4H0E A;  2W82 A;  4JYK A;  4NHJ A;  2H1K A;  3ZQF A;  4A3E J;  3KLO A;  4LFU A;  1BOA A;  5FLX Z;  3VYT B;  1V4R A;  2WB1 A;  4LOC A;  2DPD A;  4J19 A;  1LVA A;  3RZD J;  3QPH A;  2CJJ A;  4IRG A;  3KEQ A;  4A6D A;  4XIC A;  1ZRE A;  3MZY A;  1MKM A;  3WTT C;  3C1D A;  4CCO A;  4OWR B;  4PJL A;  1PP8 F;  5E1Z B;  2OF7 A;  4L5J A;  1HXD A;  2JT1 A;  1RPW A;  4FT8 A;  5IT9 K;  2KZG A;  1U5T C;  2EB7 A;  2R7Q A;  4KFC A;  2VL8 A;  2RVC A;  4G7H F;  4C2M J;  1XMA A;  3LSH A;  4BJ6 C;  1OR7 C;  3Q5F A;  3CCJ I;  1YIT I;  2QVO A;  3EQL F;  3CF5 F;  1VQ8 I;  3S2H J;  2V26 A;  2IGM A;  3HM5 A;  4TV7 A;  2ID3 A;  5DD8 A;  3ZN1 A;  1APL C;  3X2Q H;  2P81 A;  4RLQ A;  2K5C A;  4CCN A;  3QWL A;  1JKR C;  2BOL A;  3RI4 A;  3VPR A;  1KU7 A;  1YRN A;  2K9S A;  4BQO A;  2V9V A;  1CF7 B;  5IPA A;  2I5U A;  2BE5 F;  2DW4 A;  4DIQ A;  4HSR A;  4X0G A;  3E6D A;  2E1N A;  3R60 A;  2RGV A;  3OR2 C;  4QWQ A;  2VXZ A;  5EYR A;  4FET A;  3BT9 A;  1K83 J;  4MIM A;  1HLV A;  1XDS A;  4OIP F;  3FX3 A;  2CFX A;  3OYA A;  5ERI A;  1O4X A;  4OMZ A;  1SD6 A;  1T95 A;  2ZSI B;  1FT9 A;  3IH4 A;  4ESB A;  1SD5 A;  4JP0 A;  5HLT A;  3HOT A;  2MC3 A;  4JBA A;  5M5X J;  3OL3 A;  3EUH C;  2R93 J;  3GTM J;  3OIP A;  3T0Y A;  2M4G A;  3RPU D;  1MJB A;  1V55 H;  1Z91 A;  4R79 A;  5IOZ A;  1H9G A;  3JRA A;  1I50 J;  2O7O A;  3BLY A;  4CXF A;  1NK2 P;  3RZO J;  3GW2 A;  2A05 A;  2H94 A;  2RAE A;  2LBF B;  4BY7 J;  2BHY A;  4KIT B;  1WJB A;  2P6S A;  2E7X A;  1JKQ C;  2IGK A;  3FXJ A;  2HGC A;  1B4A A;  4B47 A;  5ILU A;  2DYS H;  2AXT C;  1JUM A;  2C6Y A;  5K7H A;  2QM3 A;  2FD5 A;  2EPF A;  3D5R C;  1SVL A;  3H9Q A;  3C2G A;  4N4O B;  2KL4 A;  4BXU A;  2DA5 A;  2R5Y B;  1Z05 A;  1G8X A;  4ZYA A;  1VF9 A;  1ODD A;  5EGO B;  3JRI A;  1VTN C;  1QO0 D;  2MAB A;  1BOB A;  4BQA A;  2DLL A;  2XAS A;  3ZPL A;  3PQK A;  4KYW A;  2PJR B;  3KEY A;  1O3S A;  3E6C C;  1I39 A;  3GFI A;  4HZF A;  2CUF A;  2CH0 A;  2IW5 A;  3MEX A;  3HSR A;  4U0W A;  1D0Y A;  2DMT A;  3L2R A;  4XN3 A;  5EEG A;  1K79 A;  4HNV A;  2Z2S B;  4A3J J;  4XLN F;  4V2G A;  5ICG A;  1YJW I;  4LG3 A;  3E7L A;  4HQM A;  3WU1 B;  2QBY A;  2V1X A;  4BYY A;  1SMY F;  3EDP A;  1IGN A;  5DDG A; 
#chains in the Genus database with same CATH homology
 1M1E B;  1LUJ B;  1T08 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...