1LUJB

Crystal structure of the beta-catenin/icat complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
GAPAKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQAAEDVVMAFSRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Catenin beta-1
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2002-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1lujB01
1LUJB 1T08B 1M1EB
chains in the Genus database with same CATH superfamily
4XK4A 4EJVA 3UR3C 2E1OA 4GYIA 4XKCA 3BTLA 2RNGA 2PMZA 2Z5UA 2FNAA 2NYXA 1XGSA 1U6GA 3I4MJ 1FTZA 4L9TA 1QHHD 2ISYA 4D9JA 3ECOA 2M0CA 1SEUA 2MW8A 3LSJA 3C1DA 4MFEA 1OCTC 2DA6A 4IHXA 5K7ZA 1U8BA 5E79C 4EM2A 3CMEI 2LP0A 2CQXA 3FBIB 1K6OA 3L09A 2ME6A 4N4OB 1HW5A 3CP8A 3GF2A 2ME0A 4KN7X 4NDLA 4ZJZA 3JRIA 4LOCA 4UUVA 1YIOA 2X51A 2VLAA 2RV8A 2HVQA 2JRMA 2EWNA 3ONQA 4HYEA 3CCRI 3PNVA 4MQVA 2R7QA 5FRNA 2GLOA 2WWYA 4II3A 1E2XA 1FC3A 2VQCA 4JBAA 2KPMA 3FXJA 3BJAA 4OIRF 4A0XA 4OMYA 1R1VA 3EYYA 1MMGA 1WRJA 2E60A 3K4NA 2VASA 1STZA 2Y0SA 3CJRB 2QENA 4CYDA 1U2WA 3PO2J 3FMRA 1T56A 3DPUA 2KT0A 1UFMA 5LEKA 2X6YA 4PJLA 2KISA 3MKYB 2FUG2 3FMQA 3OOUA 3A2KA 1XMAA 2E7WA 1IV6A 4MEXF 1FIPA 1QPIA 2VXZA 2V6CA 4Z2YA 3GTPJ 1D8KA 1MW7A 2PMHA 3TW6A 1FTTA 5EEAA 2ELKA 3S2HJ 4ZYDA 5JLWA 1ZK8A 4M3BA 2LKSA 4E7LA 2VC1A 4AC0A 2VIXA 2K5CA 1WJ5A 2V1NA 5FB2A 1Z21A 4RGXA 2EH3A 1UG2A 4HPQA 2XF6A 4OMZA 2H8RA 1TWCJ 2KHMA 4DJAA 3MFKA 4U87A 2CG4A 3VB2A 1F9NA 2OA4A 4E7ZA 2Y0MA 4I6ZA 4ZDOA 1BW5A 2HOEA 3DPLC 2LFBA 1XN7A 5JHUA 4XLCA 1ZR4A 3H3ZA 3AAFA 3JRCA 2LY1A 5D5WB 1R4MB 2ZNYA 2L9VA 2BEOA 1KQ0A 2RDPA 2DMNA 4KIFA 1VQ9I 2H27A 4RM3A 3WG7H 2CQKA 1V5EA 4E4HA 3M1CA 1Y0UA 2VJJA 4YG2F 4BKXA 2XSJC 3BCBA 2CO5A 2WA0A 3K4JA 2DA4A 4RGUA 2ACJA 5B5EC 5K5QA 2LKXA 2BY1A 2DFFA 3PJRA 5C3EJ 1Z77A 4ESBA 3F6OA 2HI3A 2E2IJ 4ESJA 2VT3A 3BG5A 2DBBA 2VKHA 3H35A 1T33A 1EA3A 2R7FA 4JK1X 3RCOA 5LFAA 2BHZA 2FXAA 3ZMUA 3J80K 3EQLF 3SEQA 1B9MA 2ISZA 1AKHA 3C2BA 2HQ5A 2DT7B 1HXDA 2H6CA 2N8GA 1DP7P 1E0EA 1OCZH 3K4LA 3H0GJ 3CCEI 1DGRM 1USTA 1IRFA 3IH3A 2LBFB 4FT8A 4DOZA 3VODA 1IG7A 4IO9F 1VQKI 4IF4A 3TDZC 2GA1A 3RI4A 5LRSA 3DU6A 3JRDA 1IN6A 3IHUA 1SC7A 1R71A 1OQYA 3CC2I 2L4AA 3OR2C 1K78B 1X3UA 4NHJA 1EH8A 3DTIA 1WH5A 4GYGA 2MA3A 3KP4A 4B3AA 5IT9K 3ERMA 3CMYA 5TGTA 2HGCA 3T5XA 3B6CA 3DEWA 3K10A 2A6HF 3KLNA 2KIMA 3Q9SA 1MDMB 1U9OA 2CUZA 2Y2ZA 1U5TC 4CDGA 3HSFA 2PN6A 3S1NJ 2C6YA 1UHSA 2VI6A 2L5QA 3H9JA 1ZREA 3TL4X 3WTYC 3BZKA 2FMYA 2EFNA 1GV2A 2IJLA 3L1PA 2HKXA 2WAQA 3CMMA 1X4PA 1S6LA 3HEFA 5E18F 1RR8C 3OYAA 3FXRA 4TV7A 3OY9A 5HLGA 3QYBA 1MJ9A 3D5LA 1JTYA 3CDIA 3TOBA 2OBPA 4DYCA 2HZDA 1IN5A 1XGMA 1Z9CA 2MBFA 1ETYA 1H89C 4UVCA 2QEXI 3WTSC 2IT0A 2LK2A 4EEFG 3K0LA 1R36A 3O8GA 2YX4A 3C2GA 4BDYA 1AWCA 1Z6TA 4BS9A 1YOVB 3P7NA 3G73A 2R7DA 2O61A 5J1YA 2JJ7A 4ZC3A 4KDPA 1Z3XA 1TW2A 1ZGJA 2HZTA 3TP3A 3LSHA 2MC4A 1I39A 1Y6IA 5KHDA 3RZDJ 4DZJA 2A3SA 2E36A 1X58A 2D1VA 2EFQA 4A5MA 3QAHA 1HSJA 2KIFA 3E97A 1OJLA 1EKEA 5DM7F 4HG2A 2ECBA 1V3FA 4S05A 1P9QC 1K78A 2VQGA 2ZO4A 4YELA 3IKTA 2PX9A 1JKQC 2PG4A 3HPHA 3PNTA 4IPAA 5CVUA 4KA4A 1U9NA 3ZQFA 2WV0A 3GLXA 4ZH4F 1FBUA 4P96A 2X9DA 3OOPA 2K9NA 2QVOA 2K9SA 5IP7J 4BQNA 5CVRA 4IHWA 5J6XA 2A07F 3W6VA 2XAFA 3UKGA 4ON0A 5L3GA 3LWFA 3ESWB 1WH7A 4KYWA 5D8LB 1MSFC 3RKYA 3IAM2 4JQFA 5FJ8J 1I27A 5L3FA 1PP7U 2UV1A 2EB7A 1FBSA 3PFIA 2DA2A 5D4SA 4HF2A 3Q9VA 3U2RA 3CD6I 3CCLI 3KYDB 1OISA 2NNNA 1WPKA 3S3NA 4IVNA 2WBMA 3P9IA 2NNYA 3ZQIA 3FXMA 4BEHB 2VBXA 3ZMDA 2R7RA 2YSRA 4CCMA 3LAJA 3V8LA 2EINH 2FOKA 4WXHA 1HOMA 1Z7LA 2L9RA 4BY1J 3FKIJ 2YR2A 1EF4A 3HOTA 1YW9A 1YHQI 2ELHA 4XN0A 1G3TA 1HW1A 1OFCX 1P4AA 2NOJB 3VEPA 1T08B 5ED4A 1MSEC 3BR6A 2OCEA 1EH6A 2QF7A 1H0MA 1GVJA 3LFUA 4DBRA 1K4TA 1R58A 4EM0B 3TDUC 3W2WA 4U0YA 5CVIA 3KETA 5BPDA 1IGNA 4ABZA 5TJJA 4BBSJ 3HOVJ 2XB5A 1LJ9A 1LB2A 3L2QA 3S3OA 1BJZA 3ZN1A 3MQ0A 4Q4ZF 1WVRA 2D1HA 2ZXWH 4A3IJ 4IEJA 2WV1A 4C2TA 3MCZA 3I58A 1XD7A 5CVVA 4XRSA 3TMOA 1T0FA 3C3WA 1I1SA 3G71I 2HYGD 3RPUD 4QIWN 3H3UA 3OYNA 2HWVA 1QO0D 1Z7UA 3MKZA 2CGPA 1FOKA 1ZH5A 1ZGWA 2EFOA 3OYGA 3PIOF 1TNSA 3IH4A 2E7XA 4RAYA 4A0YA 4MNUA 4DYRA 1EJ9A 4CZCA 1A04A 2X1DA 5CVJA 2OU2A 4IX7A 5K1YA 2Y0SN 4Z6YA 2ZJ2A 1OR7A 5EEGA 3ABUA 4A3JJ 4IHVA 5E8GA 1HKTA 2Z3YA 3L00A 5DUKA 2ZMEB 5EZGA 3DKXA 2VQHA 1R5GA 5LHHA 3JRBA 2M3AA 2DOFA 3BZ6A 3NAUA 1P6RA 5D5VB 3WU2C 4OIPF 1RZ4A 3C18A 2E1MC 3FIWA 3LAPA 2HVSA 4F7ZA 4ENNA 2QLZA 1QU3A 3CTAA 3SZTA 3L2VA 2W1OA 2V9PA 1YJ9I 4ETSA 2YUSA 4B3XA 2DU9A 4KMUX 4XORA 5KVRA 5TISC 3OIQA 2R7XA 3S15J 1R5HA 4A3EJ 2XASA 2IGOA 2OCCH 1XSXA 2A05A 3ZMVA 5ICCA 1OCCH 3F6VA 5C4JJ 2NRAC 1J0RA 2FBKA 3NEUA 1I6HJ 2ESNA 4C9YA 1X1DA 2DFIA 1PP8F 2H8WA 2VODA 1Z91A 1GT0C 2XROA 2JMWA 1MBGA 2OZ6A 1TZLA 1TTYA 2DTZA 2FQ3A 1O4XA 1NK3P 2L7MP 3OYIA 4MHGA 2O9LA 3J81Z 2NVQJ 2F5VA 3ZMSA 5KAIC 1ON1A 5IOYA 1A6QA 2M30A 2IS1A 3IKVA 1K61A 1D3YA 2A6EF 1JKOC 4D5FA 4PZJA 2DJNA 5HS8A 4L9JA 1QVUA 2HDWA 1PVEA 3LA7A 1T38A 5M5XJ 5J4VA 4C2MJ 1MJBA 4OAZA 2H6BA 3IWFA 4AD9A 3DPTA 3KIOA 1MBKA 2ZXJA 3KP5A 3QYFA 5EG0B 2DLLA 1CQTA 3A02A 1K7AA 5L3BA 2CQ7A 3E6CC 1FY7A 1T6SA 3ABKH 3SQNA 2EV5A 1WCMJ 3CC4I 1JE8A 2HYJA 3MKLA 4N9IA 2FNPA 3M9AA 4UB6C 4E70A 3HUGA 2RQQA 2GIZA 5BS6A 2R93J 2E34A 2KMUA 4RGRA 2AQFA 3CLQA 3AG2H 1ETVA 2GM4A 5F6FA 3ZR8X 1YYVA 4BY7J 1ENHA 3OYCA 5JLXA 4FCYA 2LKPA 3BPVA 5IP6A 2L01A 2DMTA 3AKZA 3MZHA 2K3FA 2LH9A 4AVZA 1XDUA 3H5AA 3SXYA 5JI6A 1NG7A 2X6WA 3EETA 1X1BA 2IXSA 1YJWI 3REOA 3HOYJ 3OYEA 1BI2A 4PJ0C 1BA5A 3CMAI 1YE9A 1OKRA 4BXUA 1E3HA 4AU7A 3BG9A 3U21A 4X1EA 4U7BA 2DAOA 3ULQB 5GAGJ 2F5EA 1BOAA 1D1CA 3BJOA 3F8NA 4XLHA 4PUSA 3WGHA 4GGGA 3V42A 2GA2A 1B4AA 2L54A 2QSFX 3FWEA 4GRIA 1FOYA 2WAEA 4A3LJ 1BI0A 3GUDA 1LEBA 4AIJA 1VQ5I 2EV0A 3PSFA 1EH7A 5IYCJ 4GXOA 4KT6A 2XF7A 2VKDA 1I3QJ 1IUYA 4LIUA 2PFBA 4AM3A 3E6BA 3I64A 4FETA 4W1UA 5HDGA 1YTYA 1PDNC 4HV5A 4LLLA 3OV8A 4FE4A 2MLKA 1S7AA 2A68F 3I9V2 4BHCA 2OTJI 1SVOA 2DYRH 5F27A 4YEJA 1JKRC 5H6RA 4BE0A 1BI3A 2AXLA 3GBGA 2QM3A 1UG0A 2CUJA 1ERDA 2K7LA 1B8IA 3K9TA 1HDPA 5F0FA 1RI7A 1WJCA 1ETXA 2BY0A 4BYYA 2OJED 1XMKA 3HGYA 1A6IA 2P7CB 1XCVA 3RQ4A 2HQNA 3RTRA 2D5VA 3DWLE 5D8KB 5FLXK 1T95A 1OLTA 2FRHA 4JX6A 4M9XA 1O3RA 3RYRA 4E7KA 2KLOA 1OYIA 3PO3J 4N0BA 4WX9A 1T98A 3FHNA 1WI3A 3V7SA 1MGTA 4HF1A 5HLIA 3IC7A 3JAMZ 2FOWA 2V9KA 2E2HJ 5D6EA 4DBQA 3CQZJ 3A4CA 1MJAA 4UUSB 2UZKA 3CF5F 2DMPA 2NS0A 2ZXIA 5LGNA 2GZWA 4BE2A 1WJDA 1D5VA 5F64A 2YS9A 1HA8A 3BQYA 3BR1A 2PJPA 3HRMA 1RPWA 3K2ZA 3E3VA 3OIPA 3ZQLA 1H9TA 1X1CA 3W6JB 4HRIA 2BXZA 4YIFA 1MBFA 1R23A 1IV8A 1GUUA 3F72A 1FNNA 3DFGA 3T8RA 3KYLA 2QBYB 3GVAA 4RB3C 2ZKZA 3B6AA 2XB0X 2L7KA 5IY5H 2IAIA 3ECHA 2PJRA 2R7SA 2A61A 1IRZA 1IRGA 4ZYHA 1IDZA 3VYSB 3A01A 2VONA 3HTSB 3M8FA 4NUBA 4AUXA 2VE9A 3KZZA 2X4HA 1SAUA 2DDAA 3EUHC 1G59A 1Z6RA 2X6XA 3H92A 4B47A 5J8FA 4R79A 1U5TA 5J1UA 2MGQA 2ZBKA 1KQ9A 3D5RC 5J1RA 4LB5A 4ZYEA 3CUQA 4IL6C 2KJCA 5FKLA 4D5CA 1X3ZB 3IUOA 2OAZA 3DCFA 3PUFA 1IN4A 2P5KA 2KP6A 2RGVA 2EILH 4CGZA 3HOUJ 2KRCA 4S04A 5HDKA 1F36A 3R60A 1ULYA 5DEQA 3O3KA 4ZTFA 4C3HJ 2Z9OA 4I7HA 3SYTA 2ZNZA 1VNDA 3HKZA 1FZPB 4XOPA 3RKWA 1W5SA 2ZJQF 1BI1A 1JUSA 4M73A 3HOSA 1I3AA 1MNMC 3E0JB 5F04A 2LG4A 3DP7A 2R5ZA 3QU3A 2J5OA 3MMYB 1V5FA 2GOMA 4RLQA 3CO7C 2O3FA 2QA4I 4GDFA 1AHDP 3S16J 3C7JA 3GZ6A 3EDPA 5L3CA 4RMNA 4V2GA 4CCOA 2GBYA 3G6EI 3OSFA 2XDVA 5HLTA 1J09A 1OCPA 1J2XA 2P5VA 1Z05A 1P7IA 2LRDA 2DYSH 5CPRB 1K6YA 2G0EA 2MLGA 3PUBA 2XPWA 1L3LA 2WAQN 1IC8A 2QUFA 1UCRA 5EG0A 3K1NA 2BXYA 4WK8F 4Y52J 2DI3A 4WWCA 2RN7A 4I01A 5FGMA 3ASNH 1ZAOA 3CCVI 1T39A 1R22A 1ZRDA 3RDIA 2WY7Q 4EJUA 4M3FA 1NG6A 4BACA 1FPQA 2IS2A 2FMLA 4A2UA 5LLQA 1JKPC 2HKOA 4JP0A 2B63J 2ZMEC 4ENMA 3J7AO 2EZHA 4HZFA 2H94A 1YX3A 1LE8B 1W5TA 4PGGA 2DJIA 3HGGA 3N4MA 1SD4A 1WKMA 1V55H 1P92A 3I0TA 4LK1F 2R0QC 2QWWA 2V26A 1RR7A 1YO5C 2XUBA 4CZZA 1X2NA 1PYVA 1O7FA 4JX4A 5EYRA 4QTRA 4G8XA 2F2EA 1RNLA 2R7VA 4G6TB 3BCAA 4M71A 1T8IA 1HKQA 1ZYRF 1RC9A 1S8NA 2PI0A 2HTJA 2O03A 1FOXA 2UXXA 3KPHA 4RB2C 4I76A 5CKTA 4EJWA 3VYRB 1QNTA 2CS3A 4FISA 3QOEA 4YIRX 2DA1A 1FSEA 5KAFC 4MLOA 1VQNI 3LSIA 2VUMJ 1WJAA 4M3GA 2M1BA 4DNCA 3T8TA 3HHHA 4XNFA 2LMDA 4HF0A 2R4GA 3KP6A 1SD5A 1YX5A 3TGNA 1F4KA 3QU6A 2R7WA 3DEEA 5GPAA 1XGNA 3EYIA 2MYSA 4EGZA 1YRNB 1RKWA 3F23A 1XS9A 3CJNA 2V1DA 4UHTA 2LSOA 2RAEA 4QSHA 4FQGA 4BJTA 3SFZA 4ZYAA 1T0FC 3R61A 1ZGAA 4BL0B 4BGDA 2IP2A 2IRFG 1Y1VJ 2PMUA 5AIQA 1MBHA 2VE8A 3BC8A 4L9VA 3SDBA 3CJQB 4BBRJ 2AQEA 4IJAA 1TWAJ 3OYJA 2LVSA 3EUKL 1D1AA 2A69F 1SVMA 3OMYA 2Q2EA 2X1EA 3RKQA 4P9UA 4FHTA 3J7YJ 1E3OC 2YU9J 1Y56A 2H1LA 3K6GA 3ZQGA 3MKWB 3EPZA 3H9GA 5EF6A 4JOMA 3GTJJ 2OF7A 3GEZA 2HQRA 1OR7C 2UXNA 4B09A 2XGXA 1BW6A 4HDVA 5HNFA 2W57A 4HAMA 4LLNA 4BXXJ 1TL8A 3FXQA 2Q2EB 2CUEA 1D0XA 2OZUA 4BQQA 2XGDA 2XKOA 3G1LA 5M5WJ 3H5NA 4UV9A 1YIJI 2BV6A 1MNEA 4I02A 5F1JA 2K9LA 1J59A 3ZRGA 3L2CA 1DP3A 4XRMA 5GAEJ 2JTVA 4BNCA 3Q5FA 1B8IB 1TP4A 2NAZA 2JK3A 3R4KA 4G6DA 2HQAA 2O0YA 3O2PE 2E71A 3BR3A 3L7WA 5EJCA 3K2AA 3KEQA 1BOBA 2ECCA 3F8FA 5GPCA 3JRGA 1DQUA 4BEHA 4Q5SF 3GTMJ 1XTAA 3BG7A 3KCCA 3RZOJ 3SZGA 1ODDA 2DOAA 5ILUA 3OS2A 3A01B 1ON2A 2Y30A 4XMYA 1NTCA 2D45A 1FYLA 1YS7A 1WFXA 2A5WA 1JJ8C 5E3MA 3K4CA 1WZ2A 2EJRA 3SDGA 2L0KA 5M5YJ 2O8KA 4CCNA 2P5LC 1KGSA 4M3DA 1ONVA 1OPCA 5K7HA 1U3EM 2CRGA 3UNGC 3HXLA 4MFDA 3E5UA 2O7OA 2GXGA 4A69C 1JGGA 4C3JJ 2R5YB 2PEXA 1IW7F 2QQAA 3NQOA 2LY2A 4LMYA 1XDSA 3Q0VA 4CCKA 4IOAF 2QCOA 5FKNA 2VKVA 2M45A 2KL4A 2XAJA 2XGEA 1ETOA 2F5FA 3DBHB 3JR9A 4UB8C 3QYEA 1G3SA 1ZG3A 1ETQA 3GFJA 1JI8A 5FFZA 1MNDA 3FK7A 3MVPA 2XAUA 3RYPA 1A5JA 4MEYF 4MTDA 2O5RA 3V4GA 2CJJA 3ZN0A 2UWMA 3OL4A 4LIVA 5B1AH 1TBXA 5E20A 1PUEE 2JUCA 4UXNA 3G3ZA 1ZRCA 5LBQA 2DPDA 2O6GE 5IYDJ 1O3TA 3KX2A 4M74A 1VF9A 5CJ9A 1SMTA 5C44J 2KZVA 1YJNI 2L7ZA 1FP1D 2NXNB 3TQNA 4QLCU 2QQBA 5IT3A 1RRJA 2JWTA 2QBYA 5FROA 2HPMA 2F4MB 3I4NJ 2DK8A 2R7ZJ 4KITB 4A93J 5FD5A 1BIAA 5D5XB 3BR5A 1XSVA 1HSTA 1W4MA 4NC8A 4G12A 3PSIA 2F5CA 3RSNA 5DCMB 2Z16A 3F22A 5IP9J 1WHUA 1AOYA 1Z0XA 4DYQA 2VQLA 4E7HA 4EATA 2KFDA 4EM1A 4HA8A 1MH4A 1TW3A 4RAGA 5C4XJ 1JHFA 2G9WA 4Y17A 3RIRA 1PUFA 5DD4A 3BQZA 3GZNB 4LB6B 5GADJ 1MDMA 3AG4H 3GMEA 1BR4A 3E6DA 3TP0A 4WCGA 3OYKA 1RKTA 2JA8J 2V1XA 4HX8A 3U9GA 1HC8A 3PFYA 2CW8A 3S93A 2TRTA 1LFBA 4U88A 3T0YA 4KT5C 2LOOA 5BNGA 4DQ2A 2CQQA 1FBQA 2K4BA 3IH2A 2COMA 3N97A 3RPQA 4EQQA 1LFPA 5E17F 1HKSA 4YFKF 1H8AC 2X6OA 5CLSA 4D1QA 2AO9A 2JQ7A 3M7GA 4KISA 2VXDA 2STWA 3I55I 2EFWA 3GX4X 1OYYA 4XOTA 3S2WA 4IOCF 2VC0A 2RC4A 1BL0A 3LOCA 3CCJI 1IJWC 4OIQF 2K3PA 3S2DJ 3P5JA 3OYBA 2DT5A 2HNHA 1FYKA 3IL2A 4CO8A 2NVUB 4CUGA 2STTA 3K70D 2Y75A 1LUJB 4I09A 5HNHA 3S14J 4F3QA 1B9NA 3F8BA 2R92J 1VZ0A 2F48A 3ZXSA 1W0UA 3JAMK 5J8CA 2GIVA 3TOAA 4Y7NJ 3SJMA 1KZHA 3ZOBA 2DMUA 2RKHA 3ML6A 1R5ID 5CQEA 2ETHA 1W36C 1HQCA 2M34A 1QZEA 1MIJA 2I5UA 2WB1N 1HLVA 2W4SA 2CH0A 1MMAA 2KZGA 4Y3OA 5FO5A 3AG1H 2W7NA 4OAYA 1FX7A 3HOZJ 4BJ6C 4IHTA 1D5YA 1F1ZA 1BBYA 2ADUA 4XONA 4RLFA 3E1SA 5FKKA 1XX5A 4XM3A 2EV6A 2L02A 4KIGA 4ZDPA 2XAHA 2M8GX 1JJ6C 3JRFA 4HLXA 5HDNA 4KICA 2JPCA 4CSWA 4A3CJ 1J5YA 2XHKA 3KP2A 1P7JA 4ZDLA 3ABMH 5BQTA 1KONA 1JXSA 1CGPA 3GWZA 1HCRA 3CP2A 4B48A 3HB9A 1JUPA 4NNJA 3QODA 2KRHA 4FASD 3H5RA 1Z67A 4G94A 3TO7A 1KU7A 1FEXA 2QYOA 5ICFA 1VI0A 4WF2A 2VBWA 2DA5A 2MFZA 3LFKA 1E3PA 3LA2A 1POGA 4BH9A 4G7OF 1YRNA 4XLEA 1KU9A 4Y13A 3FXLA 4J19A 3HC7A 2RREA 1ZLJA 1ETWA 5LHIA 4O3MA 1UJ8A 4F55A 4XRSG 2V6EA 1IO2A 4EGYA 2L7FP 2PBIA 2JA5J 2IBDA 2ZJRF 1IUFA 4JX5A 4HNTA 5L3EA 4A3BJ 2X48A 4BQAA 5JFRA 2J5PA 5E3LA 3DEUA 1LNWA 3BROA 4IRHA 2DN0A 4LLGF 2VN2A 4M3EA 2ZJPF 4HDUA 1BC7C 2E1CA 1DPRA 2DOEA 2P0WA 3OIOA 4XLFA 3RQIA 1WGXA 3JSOA 1JGSA 2KDOA 3K7AJ 2EIKH 4N4NB 4XLAA 1R1TA 3JTGA 2JN6A 4B43A 2COBA 1G3WA 4L5JA 2R7TA 4E7IA 3M3YJ 1Y8RB 2BY2A 2L9NA 2MSYA 2M8EA 2TDXA 4N9HA 1YLFA 1C0WA 3HJEA 3JTHA 3V7RA 4A6EA 4KJZA 2Y48A 2VBZA 2OPTA 4RAFA 3NWTA 1FMVA 4OOIA 4HOBA 3MZ8A 4C30A 4KN4X 1H9GA 2EZKA 5BOXA 1J75A 1ORKA 2KRFA 3I59B 3BJ6A 4Q48A 2MG4A 4F93B 3I56I 1GXQA 1IF1A 3HOWJ 2CYYA 2EK5A 1ZHFA 2LD5A 2FD5A 2VT2A 4R8HA 3IP4B 3NWSA 4XKWA 4PCQA 2JUGA 2IS4A 1VQMI 1FSHA 1X19A 3K1MA 1MKMA 3M8JA 2XIGA 2WC2A 2ZMEA 4IZZA 3R0AA 3BZCA 3CESA 1YW8A 4AYBN 3VSLA 1TQIA 1JTXA 1W7PA 5HS7A 2LYCA 4HX7A 2XRLA 3CCQI 3WHBA 2ID6A 2HOSA 4L5EA 4L9NA 1VQ6I 4EJTA 3H36A 3V8KA 5BPIA 1ZKGA 2VL8A 2KDZA 1VTNC 1EV7A 2A5YB 4LG0B 2FU4A 2ZXHA 4HSTA 4I98B 1S7OA 2ID3A 3KP7A 4HX4A 4BJ5C 2EZIA 1P4WA 3KLOA 2M7BA 3ERED 1YI2I 3WTTC 4P5OA 4FX4A 4HBLA 4CCLA 5H20A 3GFMA 3CCSI 5EGOB 2DT6A 2ELJA 3BWGA 4A6DA 1N25A 2PMZN 4BUPA 3DTEA 5J47A 1B72B 5ICEA 5IT9Z 1BIBA 3I59A 3BTIA 3F8CA 3BP8A 1I1GA 4HSRA 4F92B 4OU0A 3PIPF 3F3XA 5FLMJ 4G7ZF 1QZYA 1SFXA 2DFHA 2LREA 4PSXA 1UHMA 4GO1A 4A5NA 2AS5F 3AL0B 1ZTRA 4I0BA 4CCJA 1XGOA 1IN7A 2EA2A 3P9KA 2KQRA 2ICWG 2CWEA 4NBQA 1GDTA 4BHPA 1D0ZA 2IGMA 1XMXA 5EDNA 1QA6A 2IA1A 1H88C 3I5UA 3B02A 3FZVA 3GCMA 5B3SH 5TRDA 1R6RA 3W6KB 3WG9A 1V54H 3DLLF 1A36A 4HNUA 3HOXJ 4CHUA 2P4WA 3QQAA 2L3DA 1P4XA 4HV6A 2HDDA 3ZQQA 3R0JA 1YW7A 4PJJA 3IRQA 3GFIA 2ZB9A 4C3IJ 4YFXF 1S7EA 1Q1HA 3HPGA 2HFHA 4XR6A 2FF4A 3V7CA 1UAAA 2D2WA 2JA6J 2OV7A 5F08A 2Q8KA 2DCEA 3WE3A 1RETA 5JHFA 3G1OA 2KIQA 2OD5A 2AHQA 3GZ5A 3TW7A 3BTJA 3WTWC 2RVCA 1XPXA 1UHWA 3HSRA 5CQGA 1W1WE 5F0HA 4A3KJ 2Q1ZB 4XLPF 2VBYA 2JA7J 3BR0A 2Y9ZA 1APLC 2JZYA 4QPQA 5KK1A 2M7AA 2M4KA 3JRHA 1B59A 3U1DA 5DCFA 3ABLH 3P9CA 1YQAA 4XN3A 4LGWA 4D7MA 4PJMA 2K40A 4H4KC 4NQWB 3DU5A 1TT5B 4UVAA 2CFOA 2XRNA 3A0HC 1WJFA 5LGUA 3L2WA 3FX3A 2LR8A 4F91B 2OC6A 3BPXA 1VFCA 2LF8A 3LSGA 2JRTA 4M6YA 4RBOA 4AVPA 3WU1B 2ZSIB 1FMWA 1R00A 3QP6A 4R1HA 1WSUA 5HODA 4RB1A 1SD6A 1OMIA 4ITVA 3AL0C 1IN8A 2BYVE 4HNVA 5ICGA 2L9SA 3S32A 2W24A 3BOQA 1ZLKA 2YPRA 1WJBA 2MABA 3A03A 3ZMZA 1R9TJ 5KCMA 1W0TA 2R3SA 3D1NI 3OYLA 3O6BB 3FXKA 2W84A 3K4KA 4KIBA 3VYTB 2QQ8A 4HQEA 4RGSA 3CDHA 3DV8A 3ABTA 5D6FA 3WGGA 4JYKA 2P81A 2OUMA 5M3MJ 2CSOA 1Q1VA 3IV5A 1ZQ3P 4A3DJ 2NS8A 3DTKA 5IYBJ 2GAUA 5B1BH 2VOOA 2WAFA 4FE7A 2F4OB 1SVLA 3GYHX 1OCOH 1VQLI 3K1PA 4EVIA 3QPTA 5JVTA 2JT1A 3LQQA 1GVDA 4OINF 2XSDC 4XBFA 4A3MJ 4DGWB 3FMSA 4UUTA 1FYMA 2NVXJ 5ERIA 2HXIA 4XKVA 2A6TA 1OCRH 2ESHA 3CUQC 4PSWA 3H9QA 2H09A 4XKBA 1G6NA 4A3GJ 1GXPA 1J9IA 1RESA 2DPUA 2IW5A 5GTHC 3FDYA 4CYCB 3I54A 5H2FC 1MH3A 3ZQ7A 2BVMA 1FOWA 1JT0A 1HBXG 5DS9A 2IEKA 1QPMA 4PDKA 1QQIA 2O8XA 3MD2A 1AKHB 2Y69H 1BN5A 1R7JA 3HHGA 3SHFA 3W3CA 4XSXF 3CC7I 1DU0A 4U0VA 2L2OA 4F52A 3WTUC 1ITYA 1W7PD 3TO6A 3PNYA 2G7UA 3CZ6A 5DV5A 1A31A 3LSPA 2V4JC 5JVGF 1Z3YA 5B66C 2F5DA 3PQKA 3PQJA 3E5XA 4L5IA 1QBJA 1HF0A 1FP2A 3A0BC 2JPBA 1GHCA 4CH7A 2GXBA 2VJ4A 4LITA 4CXFA 3JREA 3BR2A 1L0OC 4Y33A 1ZR2A 2CV1A 2VPRA 3DBLB 3CUOA 4G6QA 3DLAA 4X6AJ 1F5TA 1USSA 2HXOA 2XAQA 1X2MA 2XAGA 5A2QK 2ZFWA 1MMSA 4QWQA 5FKOA 1KA8A 2QSHX 5HLHA 4XIDA 1YG2A 4IQJA 1MD0A 2K85A 4HLYA 1CF7A 1IAWA 2R5ZB 2FA5A 2FEZA 3HIFA 2V79A 3X2QH 2E19A 2AXTC 2GXAA 2E1MB 3ZQHA 2OQRA 3O8HA 2VB6A 4B1RA 2E5NA 4CYCA 4IHYA 2QSGX 1AA7A 3VDXA 3BG3A 1A35A 3DBRB 4RS8A 3TEDA 2CV2A 4Y15A 2WY8Q 3TBIA 2BW3B 4E6KG 5FLXZ 3WTXC 3ZP5A 2DQRA 1N75A 2M2EA 1TNTA 2LBFA 2B9SA 2FBIA 5DM6F 2LY9A 1WQ2A 4XSZF 1JUMA 1XCBA 5AIPA 3CUQB 3WHCA 1IDYA 2DK5A 3HYIA 2BY3A 5IPAA 3BY6A 3R6SA 3RPUA 5JR3A 2W48A 3OS1A 3K69A 2V7FA 1LDJA 3LL7A 1R1UA 4UY8I 3I4PA 5E1XA 2GOXB 2MH2A 5K7FA 2LTPA 2VOPA 2R7UA 1KQ8A 3E7LA 3WODF 5DD8A 2F4IA 2LNBA 2FX0A 2Z2SB 1Y39A 3LSRA 3HUGB 3GTKJ 5DDGA 2CU7A 1QGPA 3BDDA 1Y1WJ 5FFXA 3GW2A 1VQPI 1NHAA 3GTOJ 4D0PA 5E1WA 1SFEA 2GQQA 2KIUA 4BXFA 2M5WA 3ZMTA 1RUNA 5AONA 2LF7A 2XPVA 3MAJA 4CICA 3F9KA 2K27A 2YU3A 2XC7A 1O7LA 2EZLA 2G7HA 1FJLA 2BW3A 2E35A 4BQOA 4U0WA 4MO7A 4ZZLA 4XRFA 2DA3A 2EIMH 2M9HA 4AWXB 3S3MA 5BMZA 2TCTA 4GFBA 1YITI 1MMNA 1SMYF 2ZSHB 4NC7A 3CLOA 4OWRB 4ESFA 4Q47A 5FKMA 4D7NA 5EEHA 5J3LA 3HDDA 4BAYA 1W5CC 3FK6A 1AU7A 1MMDA 1P2FA 2CV0A 1Y0NA 1DGWY 4J00A 1TQPA 3BT9A 1PUFB 1REPC 3LNQA 1SANA 1LKXA 1PJRA 3ZGKA 3WE2A 5ILVA 1S5LC 3NRVA 2IGNA 2IVMA 2KKOA 2FQ4A 2QQ9A 1YS6A 3ZQCA 5DCMA 4ZYGA 2R5YA 4IRIA 1Y8QB 4NB5A 3MWMA 1MZBA 1ZELA 5K5OA 3AG3H 5LHGA 2M87A 5D4RA 2Z33A 3GTQJ 1BR2A 2K86A 3VPRA 1DDNA 4U7DA 3VWBA 3FKJA 4RDUA 2I10A 3IAS2 2BVLA 2Z99A 2P7VB 3N05A 3QP5A 3A1YA 3CCUI 4W97A 1IXRC 3KYCB 3Q3SA 3PL8A 4LG3A 3LSTA 3VSKA 3KZIC 3Q0WA 4IRGA 3OS0A 5CYVA 1TWFJ 2P6SA 3ROUA 2EQRA 2FSWA 1QVTA 2NS7A 4ENJA 1IRXA 1UMQA 1V4RA 1T2KA 1VQ7I 1NH3A 2HOTA 4ZZDA 4KMFA 1Z1DA 2VJIA 3LSKA 4L0ZB 1DU6A 3BG6A 1FWZA 1VQ4I 4IXAA 3E5QA 1XC5A 4CA0A 1K79A 4MIMA 3OYHA 1DUXC 1JHHA 1SFKA 3WGIA 1TLHB 3HM5A 3G1MA 3AFHA 4EV0A 3FM5A 3DQVC 3Q0UA 4E7SA 3FXOA 1SD7A 4I2OA 3CCMI 3DXJF 2LLKA 1BJAA 2IS6A 3G2BA 4PGHA 3FF5A 4DW6A 1K83J 2XKPA 3BLYA 1U78A 1G2HA 1ZG5A 1KU2A 2HYFA 3HRUA 3TO9A 4EMSA 4UVBA 2CQNA 2X1CA 3S17J 1FT9A 2HEOA 3B73A 2DMQA 4DZPA 3QWLA 1B72A 3QPSA 1KYWA 4YIIA 3KEYA 4K2EA 2VKEA 4II2A 1CF7B 1LE8A 3D5SC 1LEAA 5E3OA 1QRYA 2BHYA 3ZCOA 3RJPA 5EGOA 2QGUA 3GLLA 5GAHJ 4V19K 1GLNA 3HKZN 5FRMA 5A2QZ 4WXDA 2K4JA 1D1BA 4V2FA 1U8RA 1FIAA 2DODA 5LRRA 4A3FJ 4LK0F 1XSDA 1JT6A 4BHBA 3FISA 4EJOA 1S3JA 1D0YA 2NVYJ 3S8PA 5E8IA 5LD2C 4IKFA 3FM3A 3SFIA 1KYZA 1UELB 2DDBA 4KNYA 1RIOH 4HQMA 4BE1A 2CFXA 1QZZA 4OIOF 2RNJA 4UV8A 3QPHA 3MN2A 1G8XA 3TKYA 2EIJH 3E6MA 3HL2A 3L9FA 2NVTJ 3NARA 1BM9A 1R49A 3F21A 4P1WA 5FLVA 4IHSA 4O6JA 2KJBA 1IXSB 2QZ8A 1UB9A 2QKMB 3WU0A 1B1BA 3H3VK 2IGKA 3COAC 4B4CA 4MQ9F 5E1ZB 5FD6A 2YX7A 2PLYA 4KUMA 1TWHJ 1SFOJ 2XF5A 3H0DA 1BR1A 5F0CA 5HS9A 3LSMA 3JSPA 2M4GA 2JVHA 2VJ5A 4PJNA 3WTVC 3EUAA 2HU9A 4ZTJA 4YFNF 3HSEA 3OR1C 3F8MA 3JRAA 3HRTA 2BZTA 6PAXA 1ETKA 3GFLA 3CJTB 3OL3A 3RKXA 1X4OA 3L2UA 4B44A 3FHZA 3S1QJ 1U0JA 2W82A 4ENKA 1LQ1A 2XV4S 1MBJA 2W00A 3IWZA 3MZYA 4LD5A 4S0HB 1O3SA 5D5UB 2X0LA 3KP3A 4G9YA 3S1RJ 3GO5A 2B0LA 2Y31A 1VQ8I 1U5TB 3H1CA 4PK4A 1HDDC 3J80Z 3IRRA 2UUZA 4M9ZA 4IQ4A 1LDKB 2OTLI 2MD5A 3ELKA 2BBYA 1M1EB 2W85A 3DKYA 3F0CA 3J7ZI 5GP9A 1SFUA 1LDDA 4H0EA 3HZJA 3VYUB 3ASOH 2DA7A 5DYMA 2CUFA 3JW4A 2FBHA 2V1UA 4Y4RA 2JA2A 1RUOA 4YRVA 3CO6C 2WADA 5DTDA 2LC2A 1X1AA 4HW0A 2BGCA 2EFPA 3HG9A 4FX0A 3M8EA 5GTIC 2GWRA 3MEXA 4XLNF 3LA3A 5ILSA 2EA4A 2WB1A 5K5RA 4UNOA 3GTGJ 3D0SA 1ACIA 2EPFA 5H6QA 3QRFF 2XGCA 2H1KA 3OYMA 1X1PA 2LDUA 1OYWA 1LVAA 3OSGA 5M3FJ 4AIKA 2BOLA 4XQFA 2JVGA 4G7HF 4ASNA 1I5ZA 9ANTA 1WWXA 4RM2A 1J7KA 4J01A 2IPQX 2JSPA 2HDCA 3KE2A 3SZPA 4UUSA 4O5VA 4BU2A 2MH9A 4X0GA 4L0YB 2R7OA 4AIDA 4P55A 4WXCA 4NQWA 3ISPA 5EZHA 4AIHA 3W2AA 2VPLA 2Q0OA 1ZRFA 2HTSA 4A12A 2NOGA 3G4SI 1N77A 3GXOA 3CF2A 2PQ8A 2CMPA 2P6TA 1B6AA 2HPIA 5HVQC 2IA2A 1MBEA 4I0AA 4L18B 2DXIA 1WI9A 1ZARA 2DW4A 3T1BA 1LPQA 4XICA 3W2VA 3I3LA 4PFOA 2ZC2A 1V5GA 4LG0A 1TWGJ 4M9SA 3K4MA 3VFZA 2K02A 3FXUA 2Y9YA 1K4SA 1G4DA 4M6VA 2HS5A 2WTEA 3KEOA 1W7PB 4GCVA 4LFUA 2XVCA 5L3DA 5DUIA 4QPOA 2QKLB 3PM1A 4KFCA 3WTZA 1ZG1A 1YFHA 5KNLA 3EUHA 3OWTA 3KZYA 3OYDA 4I99C 3LMMA 4RA2A 1TQMA 3K70C 2E5ZA 3GTLJ 5HOOA 3QOPA 2DQLA 2V9VA 3SEZA 2FE3A 2HOAA 1HW2A 1LVKA 1G3YA 1X3WB 1TT0A 1TC3C 2RQPA 3C2HA 2Z1DA 2XPUA 3CCYA 3FBNB 1ZN2A 4M72A 2JSCA 1LFUP 1W36D 2CW7A 2K9QA 3J7AY 4C2UA 3L2RA 3S1MJ 2B7EA 2MD0A 1E17A 1I50J 5IOZA 1R4NB 3HRSA 4RAZA 2HVRA 2DFEA 3M1EA 1GV5A 4MTEA 3M4OJ 4PFPA 2E1NA 4M6XA 4LJZF 4B8XA 3I71A 1S29A 3OYFA 5J40A 1F43A 2ZCWA 3CDLA 3M07A 1VQOI 4A0ZA 1UZCA 1FLIA 3ZPLA 4BDZA 3V8JA 1BC8C 4RB0A 1KU3A 4P9FA 1O3QA 3LQRA 2M0MA 4XL9A 3U1KA 4ANJA 2I8DA 4NC6A 5LGTA 2HR3A 1SAXA 3VOEA 2PJRB 1XG1A 1S72I 2BE5F 2DO7A 2FJ1A 1I6XA 2MC3A 3BTCA 1S9HA 2DTRA 3K4BA 1IZ1A 3DF8A 3HTUA 3QPLA 4DIQA 5J4YA 3DKWA 1DPUA 5E3NA 3HBLA 2W25A 2X85A 1N78A 1NK2P 2OQGA 2ZFUA 4HEA2 1XB4A 1D8JA 2P8TA 2EBIA 2F6CA 5LEJA 4E7JA 4MGRA 2E2JJ 3KFWX 2L4MA 3I53A 2CW0F 3JCUC 2K9MA 1QHGA 2IA0A 4AYBA 5F1RA 4FTHA 1WJEA 3J81K 1IXCA 1O57A
chains in the Genus database with same CATH topology
1LUJB 1T08B 1M1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUJ B;  1T08 B;  1M1E B; 
#chains in the Genus database with same CATH topology
 4XK4 A;  4EJV A;  3UR3 C;  2E1O A;  4GYI A;  4XKC A;  3BTL A;  2RNG A;  2PMZ A;  2Z5U A;  2FNA A;  2NYX A;  1XGS A;  1U6G A;  3I4M J;  1FTZ A;  4L9T A;  1QHH D;  2ISY A;  4D9J A;  3ECO A;  2M0C A;  1SEU A;  2MW8 A;  3LSJ A;  3C1D A;  4MFE A;  1OCT C;  2DA6 A;  4IHX A;  5K7Z A;  1U8B A;  5E79 C;  4EM2 A;  3CME I;  2LP0 A;  2CQX A;  3FBI B;  1K6O A;  3L09 A;  2ME6 A;  4N4O B;  1HW5 A;  3CP8 A;  3GF2 A;  2ME0 A;  4KN7 X;  4NDL A;  4ZJZ A;  3JRI A;  4LOC A;  4UUV A;  1YIO A;  2X51 A;  2VLA A;  2RV8 A;  2HVQ A;  2JRM A;  2EWN A;  3ONQ A;  4HYE A;  3CCR I;  3PNV A;  4MQV A;  2R7Q A;  5FRN A;  2GLO A;  2WWY A;  4II3 A;  1E2X A;  1FC3 A;  2VQC A;  4JBA A;  2KPM A;  3FXJ A;  3BJA A;  4OIR F;  4A0X A;  4OMY A;  1R1V A;  3EYY A;  1MMG A;  1WRJ A;  2E60 A;  3K4N A;  2VAS A;  1STZ A;  2Y0S A;  3CJR B;  2QEN A;  4CYD A;  1U2W A;  3PO2 J;  3FMR A;  1T56 A;  3DPU A;  2KT0 A;  1UFM A;  5LEK A;  2X6Y A;  4PJL A;  2KIS A;  3MKY B;  2FUG 2;  3FMQ A;  3OOU A;  3A2K A;  1XMA A;  2E7W A;  1IV6 A;  4MEX F;  1FIP A;  1QPI A;  2VXZ A;  2V6C A;  4Z2Y A;  3GTP J;  1D8K A;  1MW7 A;  2PMH A;  3TW6 A;  1FTT A;  5EEA A;  2ELK A;  3S2H J;  4ZYD A;  5JLW A;  1ZK8 A;  4M3B A;  2LKS A;  4E7L A;  2VC1 A;  4AC0 A;  2VIX A;  2K5C A;  1WJ5 A;  2V1N A;  5FB2 A;  1Z21 A;  4RGX A;  2EH3 A;  1UG2 A;  4HPQ A;  2XF6 A;  4OMZ A;  2H8R A;  1TWC J;  2KHM A;  4DJA A;  3MFK A;  4U87 A;  2CG4 A;  3VB2 A;  1F9N A;  2OA4 A;  4E7Z A;  2Y0M A;  4I6Z A;  4ZDO A;  1BW5 A;  2HOE A;  3DPL C;  2LFB A;  1XN7 A;  5JHU A;  4XLC A;  1ZR4 A;  3H3Z A;  3AAF A;  3JRC A;  2LY1 A;  5D5W B;  1R4M B;  2ZNY A;  2L9V A;  2BEO A;  1KQ0 A;  2RDP A;  2DMN A;  4KIF A;  1VQ9 I;  2H27 A;  4RM3 A;  3WG7 H;  2CQK A;  1V5E A;  4E4H A;  3M1C A;  1Y0U A;  2VJJ A;  4YG2 F;  4BKX A;  2XSJ C;  3BCB A;  2CO5 A;  2WA0 A;  3K4J A;  2DA4 A;  4RGU A;  2ACJ A;  5B5E C;  5K5Q A;  2LKX A;  2BY1 A;  2DFF A;  3PJR A;  5C3E J;  1Z77 A;  4ESB A;  3F6O A;  2HI3 A;  2E2I J;  4ESJ A;  2VT3 A;  3BG5 A;  2DBB A;  2VKH A;  3H35 A;  1T33 A;  1EA3 A;  2R7F A;  4JK1 X;  3RCO A;  5LFA A;  2BHZ A;  2FXA A;  3ZMU A;  3J80 K;  3EQL F;  3SEQ A;  1B9M A;  2ISZ A;  1AKH A;  3C2B A;  2HQ5 A;  2DT7 B;  1HXD A;  2H6C A;  2N8G A;  1DP7 P;  1E0E A;  1OCZ H;  3K4L A;  3H0G J;  3CCE I;  1DGR M;  1UST A;  1IRF A;  3IH3 A;  2LBF B;  4FT8 A;  4DOZ A;  3VOD A;  1IG7 A;  4IO9 F;  1VQK I;  4IF4 A;  3TDZ C;  2GA1 A;  3RI4 A;  5LRS A;  3DU6 A;  3JRD A;  1IN6 A;  3IHU A;  1SC7 A;  1R71 A;  1OQY A;  3CC2 I;  2L4A A;  3OR2 C;  1K78 B;  1X3U A;  4NHJ A;  1EH8 A;  3DTI A;  1WH5 A;  4GYG A;  2MA3 A;  3KP4 A;  4B3A A;  5IT9 K;  3ERM A;  3CMY A;  5TGT A;  2HGC A;  3T5X A;  3B6C A;  3DEW A;  3K10 A;  2A6H F;  3KLN A;  2KIM A;  3Q9S A;  1MDM B;  1U9O A;  2CUZ A;  2Y2Z A;  1U5T C;  4CDG A;  3HSF A;  2PN6 A;  3S1N J;  2C6Y A;  1UHS A;  2VI6 A;  2L5Q A;  3H9J A;  1ZRE A;  3TL4 X;  3WTY C;  3BZK A;  2FMY A;  2EFN A;  1GV2 A;  2IJL A;  3L1P A;  2HKX A;  2WAQ A;  3CMM A;  1X4P A;  1S6L A;  3HEF A;  5E18 F;  1RR8 C;  3OYA A;  3FXR A;  4TV7 A;  3OY9 A;  5HLG A;  3QYB A;  1MJ9 A;  3D5L A;  1JTY A;  3CDI A;  3TOB A;  2OBP A;  4DYC A;  2HZD A;  1IN5 A;  1XGM A;  1Z9C A;  2MBF A;  1ETY A;  1H89 C;  4UVC A;  2QEX I;  3WTS C;  2IT0 A;  2LK2 A;  4EEF G;  3K0L A;  1R36 A;  3O8G A;  2YX4 A;  3C2G A;  4BDY A;  1AWC A;  1Z6T A;  4BS9 A;  1YOV B;  3P7N A;  3G73 A;  2R7D A;  2O61 A;  5J1Y A;  2JJ7 A;  4ZC3 A;  4KDP A;  1Z3X A;  1TW2 A;  1ZGJ A;  2HZT A;  3TP3 A;  3LSH A;  2MC4 A;  1I39 A;  1Y6I A;  5KHD A;  3RZD J;  4DZJ A;  2A3S A;  2E36 A;  1X58 A;  2D1V A;  2EFQ A;  4A5M A;  3QAH A;  1HSJ A;  2KIF A;  3E97 A;  1OJL A;  1EKE A;  5DM7 F;  4HG2 A;  2ECB A;  1V3F A;  4S05 A;  1P9Q C;  1K78 A;  2VQG A;  2ZO4 A;  4YEL A;  3IKT A;  2PX9 A;  1JKQ C;  2PG4 A;  3HPH A;  3PNT A;  4IPA A;  5CVU A;  4KA4 A;  1U9N A;  3ZQF A;  2WV0 A;  3GLX A;  4ZH4 F;  1FBU A;  4P96 A;  2X9D A;  3OOP A;  2K9N A;  2QVO A;  2K9S A;  5IP7 J;  4BQN A;  5CVR A;  4IHW A;  5J6X A;  2A07 F;  3W6V A;  2XAF A;  3UKG A;  4ON0 A;  5L3G A;  3LWF A;  3ESW B;  1WH7 A;  4KYW A;  5D8L B;  1MSF C;  3RKY A;  3IAM 2;  4JQF A;  5FJ8 J;  1I27 A;  5L3F A;  1PP7 U;  2UV1 A;  2EB7 A;  1FBS A;  3PFI A;  2DA2 A;  5D4S A;  4HF2 A;  3Q9V A;  3U2R A;  3CD6 I;  3CCL I;  3KYD B;  1OIS A;  2NNN A;  1WPK A;  3S3N A;  4IVN A;  2WBM A;  3P9I A;  2NNY A;  3ZQI A;  3FXM A;  4BEH B;  2VBX A;  3ZMD A;  2R7R A;  2YSR A;  4CCM A;  3LAJ A;  3V8L A;  2EIN H;  2FOK A;  4WXH A;  1HOM A;  1Z7L A;  2L9R A;  4BY1 J;  3FKI J;  2YR2 A;  1EF4 A;  3HOT A;  1YW9 A;  1YHQ I;  2ELH A;  4XN0 A;  1G3T A;  1HW1 A;  1OFC X;  1P4A A;  2NOJ B;  3VEP A;  1T08 B;  5ED4 A;  1MSE C;  3BR6 A;  2OCE A;  1EH6 A;  2QF7 A;  1H0M A;  1GVJ A;  3LFU A;  4DBR A;  1K4T A;  1R58 A;  4EM0 B;  3TDU C;  3W2W A;  4U0Y A;  5CVI A;  3KET A;  5BPD A;  1IGN A;  4ABZ A;  5TJJ A;  4BBS J;  3HOV J;  2XB5 A;  1LJ9 A;  1LB2 A;  3L2Q A;  3S3O A;  1BJZ A;  3ZN1 A;  3MQ0 A;  4Q4Z F;  1WVR A;  2D1H A;  2ZXW H;  4A3I J;  4IEJ A;  2WV1 A;  4C2T A;  3MCZ A;  3I58 A;  1XD7 A;  5CVV A;  4XRS A;  3TMO A;  1T0F A;  3C3W A;  1I1S A;  3G71 I;  2HYG D;  3RPU D;  4QIW N;  3H3U A;  3OYN A;  2HWV A;  1QO0 D;  1Z7U A;  3MKZ A;  2CGP A;  1FOK A;  1ZH5 A;  1ZGW A;  2EFO A;  3OYG A;  3PIO F;  1TNS A;  3IH4 A;  2E7X A;  4RAY A;  4A0Y A;  4MNU A;  4DYR A;  1EJ9 A;  4CZC A;  1A04 A;  2X1D A;  5CVJ A;  2OU2 A;  4IX7 A;  5K1Y A;  2Y0S N;  4Z6Y A;  2ZJ2 A;  1OR7 A;  5EEG A;  3ABU A;  4A3J J;  4IHV A;  5E8G A;  1HKT A;  2Z3Y A;  3L00 A;  5DUK A;  2ZME B;  5EZG A;  3DKX A;  2VQH A;  1R5G A;  5LHH A;  3JRB A;  2M3A A;  2DOF A;  3BZ6 A;  3NAU A;  1P6R A;  5D5V B;  3WU2 C;  4OIP F;  1RZ4 A;  3C18 A;  2E1M C;  3FIW A;  3LAP A;  2HVS A;  4F7Z A;  4ENN A;  2QLZ A;  1QU3 A;  3CTA A;  3SZT A;  3L2V A;  2W1O A;  2V9P A;  1YJ9 I;  4ETS A;  2YUS A;  4B3X A;  2DU9 A;  4KMU X;  4XOR A;  5KVR A;  5TIS C;  3OIQ A;  2R7X A;  3S15 J;  1R5H A;  4A3E J;  2XAS A;  2IGO A;  2OCC H;  1XSX A;  2A05 A;  3ZMV A;  5ICC A;  1OCC H;  3F6V A;  5C4J J;  2NRA C;  1J0R A;  2FBK A;  3NEU A;  1I6H J;  2ESN A;  4C9Y A;  1X1D A;  2DFI A;  1PP8 F;  2H8W A;  2VOD A;  1Z91 A;  1GT0 C;  2XRO A;  2JMW A;  1MBG A;  2OZ6 A;  1TZL A;  1TTY A;  2DTZ A;  2FQ3 A;  1O4X A;  1NK3 P;  2L7M P;  3OYI A;  4MHG A;  2O9L A;  3J81 Z;  2NVQ J;  2F5V A;  3ZMS A;  5KAI C;  1ON1 A;  5IOY A;  1A6Q A;  2M30 A;  2IS1 A;  3IKV A;  1K61 A;  1D3Y A;  2A6E F;  1JKO C;  4D5F A;  4PZJ A;  2DJN A;  5HS8 A;  4L9J A;  1QVU A;  2HDW A;  1PVE A;  3LA7 A;  1T38 A;  5M5X J;  5J4V A;  4C2M J;  1MJB A;  4OAZ A;  2H6B A;  3IWF A;  4AD9 A;  3DPT A;  3KIO A;  1MBK A;  2ZXJ A;  3KP5 A;  3QYF A;  5EG0 B;  2DLL A;  1CQT A;  3A02 A;  1K7A A;  5L3B A;  2CQ7 A;  3E6C C;  1FY7 A;  1T6S A;  3ABK H;  3SQN A;  2EV5 A;  1WCM J;  3CC4 I;  1JE8 A;  2HYJ A;  3MKL A;  4N9I A;  2FNP A;  3M9A A;  4UB6 C;  4E70 A;  3HUG A;  2RQQ A;  2GIZ A;  5BS6 A;  2R93 J;  2E34 A;  2KMU A;  4RGR A;  2AQF A;  3CLQ A;  3AG2 H;  1ETV A;  2GM4 A;  5F6F A;  3ZR8 X;  1YYV A;  4BY7 J;  1ENH A;  3OYC A;  5JLX A;  4FCY A;  2LKP A;  3BPV A;  5IP6 A;  2L01 A;  2DMT A;  3AKZ A;  3MZH A;  2K3F A;  2LH9 A;  4AVZ A;  1XDU A;  3H5A A;  3SXY A;  5JI6 A;  1NG7 A;  2X6W A;  3EET A;  1X1B A;  2IXS A;  1YJW I;  3REO A;  3HOY J;  3OYE A;  1BI2 A;  4PJ0 C;  1BA5 A;  3CMA I;  1YE9 A;  1OKR A;  4BXU A;  1E3H A;  4AU7 A;  3BG9 A;  3U21 A;  4X1E A;  4U7B A;  2DAO A;  3ULQ B;  5GAG J;  2F5E A;  1BOA A;  1D1C A;  3BJO A;  3F8N A;  4XLH A;  4PUS A;  3WGH A;  4GGG A;  3V42 A;  2GA2 A;  1B4A A;  2L54 A;  2QSF X;  3FWE A;  4GRI A;  1FOY A;  2WAE A;  4A3L J;  1BI0 A;  3GUD A;  1LEB A;  4AIJ A;  1VQ5 I;  2EV0 A;  3PSF A;  1EH7 A;  5IYC J;  4GXO A;  4KT6 A;  2XF7 A;  2VKD A;  1I3Q J;  1IUY A;  4LIU A;  2PFB A;  4AM3 A;  3E6B A;  3I64 A;  4FET A;  4W1U A;  5HDG A;  1YTY A;  1PDN C;  4HV5 A;  4LLL A;  3OV8 A;  4FE4 A;  2MLK A;  1S7A A;  2A68 F;  3I9V 2;  4BHC A;  2OTJ I;  1SVO A;  2DYR H;  5F27 A;  4YEJ A;  1JKR C;  5H6R A;  4BE0 A;  1BI3 A;  2AXL A;  3GBG A;  2QM3 A;  1UG0 A;  2CUJ A;  1ERD A;  2K7L A;  1B8I A;  3K9T A;  1HDP A;  5F0F A;  1RI7 A;  1WJC A;  1ETX A;  2BY0 A;  4BYY A;  2OJE D;  1XMK A;  3HGY A;  1A6I A;  2P7C B;  1XCV A;  3RQ4 A;  2HQN A;  3RTR A;  2D5V A;  3DWL E;  5D8K B;  5FLX K;  1T95 A;  1OLT A;  2FRH A;  4JX6 A;  4M9X A;  1O3R A;  3RYR A;  4E7K A;  2KLO A;  1OYI A;  3PO3 J;  4N0B A;  4WX9 A;  1T98 A;  3FHN A;  1WI3 A;  3V7S A;  1MGT A;  4HF1 A;  5HLI A;  3IC7 A;  3JAM Z;  2FOW A;  2V9K A;  2E2H J;  5D6E A;  4DBQ A;  3CQZ J;  3A4C A;  1MJA A;  4UUS B;  2UZK A;  3CF5 F;  2DMP A;  2NS0 A;  2ZXI A;  5LGN A;  2GZW A;  4BE2 A;  1WJD A;  1D5V A;  5F64 A;  2YS9 A;  1HA8 A;  3BQY A;  3BR1 A;  2PJP A;  3HRM A;  1RPW A;  3K2Z A;  3E3V A;  3OIP A;  3ZQL A;  1H9T A;  1X1C A;  3W6J B;  4HRI A;  2BXZ A;  4YIF A;  1MBF A;  1R23 A;  1IV8 A;  1GUU A;  3F72 A;  1FNN A;  3DFG A;  3T8R A;  3KYL A;  2QBY B;  3GVA A;  4RB3 C;  2ZKZ A;  3B6A A;  2XB0 X;  2L7K A;  5IY5 H;  2IAI A;  3ECH A;  2PJR A;  2R7S A;  2A61 A;  1IRZ A;  1IRG A;  4ZYH A;  1IDZ A;  3VYS B;  3A01 A;  2VON A;  3HTS B;  3M8F A;  4NUB A;  4AUX A;  2VE9 A;  3KZZ A;  2X4H A;  1SAU A;  2DDA A;  3EUH C;  1G59 A;  1Z6R A;  2X6X A;  3H92 A;  4B47 A;  5J8F A;  4R79 A;  1U5T A;  5J1U A;  2MGQ A;  2ZBK A;  1KQ9 A;  3D5R C;  5J1R A;  4LB5 A;  4ZYE A;  3CUQ A;  4IL6 C;  2KJC A;  5FKL A;  4D5C A;  1X3Z B;  3IUO A;  2OAZ A;  3DCF A;  3PUF A;  1IN4 A;  2P5K A;  2KP6 A;  2RGV A;  2EIL H;  4CGZ A;  3HOU J;  2KRC A;  4S04 A;  5HDK A;  1F36 A;  3R60 A;  1ULY A;  5DEQ A;  3O3K A;  4ZTF A;  4C3H J;  2Z9O A;  4I7H A;  3SYT A;  2ZNZ A;  1VND A;  3HKZ A;  1FZP B;  4XOP A;  3RKW A;  1W5S A;  2ZJQ F;  1BI1 A;  1JUS A;  4M73 A;  3HOS A;  1I3A A;  1MNM C;  3E0J B;  5F04 A;  2LG4 A;  3DP7 A;  2R5Z A;  3QU3 A;  2J5O A;  3MMY B;  1V5F A;  2GOM A;  4RLQ A;  3CO7 C;  2O3F A;  2QA4 I;  4GDF A;  1AHD P;  3S16 J;  3C7J A;  3GZ6 A;  3EDP A;  5L3C A;  4RMN A;  4V2G A;  4CCO A;  2GBY A;  3G6E I;  3OSF A;  2XDV A;  5HLT A;  1J09 A;  1OCP A;  1J2X A;  2P5V A;  1Z05 A;  1P7I A;  2LRD A;  2DYS H;  5CPR B;  1K6Y A;  2G0E A;  2MLG A;  3PUB A;  2XPW A;  1L3L A;  2WAQ N;  1IC8 A;  2QUF A;  1UCR A;  5EG0 A;  3K1N A;  2BXY A;  4WK8 F;  4Y52 J;  2DI3 A;  4WWC A;  2RN7 A;  4I01 A;  5FGM A;  3ASN H;  1ZAO A;  3CCV I;  1T39 A;  1R22 A;  1ZRD A;  3RDI A;  2WY7 Q;  4EJU A;  4M3F A;  1NG6 A;  4BAC A;  1FPQ A;  2IS2 A;  2FML A;  4A2U A;  5LLQ A;  1JKP C;  2HKO A;  4JP0 A;  2B63 J;  2ZME C;  4ENM A;  3J7A O;  2EZH A;  4HZF A;  2H94 A;  1YX3 A;  1LE8 B;  1W5T A;  4PGG A;  2DJI A;  3HGG A;  3N4M A;  1SD4 A;  1WKM A;  1V55 H;  1P92 A;  3I0T A;  4LK1 F;  2R0Q C;  2QWW A;  2V26 A;  1RR7 A;  1YO5 C;  2XUB A;  4CZZ A;  1X2N A;  1PYV A;  1O7F A;  4JX4 A;  5EYR A;  4QTR A;  4G8X A;  2F2E A;  1RNL A;  2R7V A;  4G6T B;  3BCA A;  4M71 A;  1T8I A;  1HKQ A;  1ZYR F;  1RC9 A;  1S8N A;  2PI0 A;  2HTJ A;  2O03 A;  1FOX A;  2UXX A;  3KPH A;  4RB2 C;  4I76 A;  5CKT A;  4EJW A;  3VYR B;  1QNT A;  2CS3 A;  4FIS A;  3QOE A;  4YIR X;  2DA1 A;  1FSE A;  5KAF C;  4MLO A;  1VQN I;  3LSI A;  2VUM J;  1WJA A;  4M3G A;  2M1B A;  4DNC A;  3T8T A;  3HHH A;  4XNF A;  2LMD A;  4HF0 A;  2R4G A;  3KP6 A;  1SD5 A;  1YX5 A;  3TGN A;  1F4K A;  3QU6 A;  2R7W A;  3DEE A;  5GPA A;  1XGN A;  3EYI A;  2MYS A;  4EGZ A;  1YRN B;  1RKW A;  3F23 A;  1XS9 A;  3CJN A;  2V1D A;  4UHT A;  2LSO A;  2RAE A;  4QSH A;  4FQG A;  4BJT A;  3SFZ A;  4ZYA A;  1T0F C;  3R61 A;  1ZGA A;  4BL0 B;  4BGD A;  2IP2 A;  2IRF G;  1Y1V J;  2PMU A;  5AIQ A;  1MBH A;  2VE8 A;  3BC8 A;  4L9V A;  3SDB A;  3CJQ B;  4BBR J;  2AQE A;  4IJA A;  1TWA J;  3OYJ A;  2LVS A;  3EUK L;  1D1A A;  2A69 F;  1SVM A;  3OMY A;  2Q2E A;  2X1E A;  3RKQ A;  4P9U A;  4FHT A;  3J7Y J;  1E3O C;  2YU9 J;  1Y56 A;  2H1L A;  3K6G A;  3ZQG A;  3MKW B;  3EPZ A;  3H9G A;  5EF6 A;  4JOM A;  3GTJ J;  2OF7 A;  3GEZ A;  2HQR A;  1OR7 C;  2UXN A;  4B09 A;  2XGX A;  1BW6 A;  4HDV A;  5HNF A;  2W57 A;  4HAM A;  4LLN A;  4BXX J;  1TL8 A;  3FXQ A;  2Q2E B;  2CUE A;  1D0X A;  2OZU A;  4BQQ A;  2XGD A;  2XKO A;  3G1L A;  5M5W J;  3H5N A;  4UV9 A;  1YIJ I;  2BV6 A;  1MNE A;  4I02 A;  5F1J A;  2K9L A;  1J59 A;  3ZRG A;  3L2C A;  1DP3 A;  4XRM A;  5GAE J;  2JTV A;  4BNC A;  3Q5F A;  1B8I B;  1TP4 A;  2NAZ A;  2JK3 A;  3R4K A;  4G6D A;  2HQA A;  2O0Y A;  3O2P E;  2E71 A;  3BR3 A;  3L7W A;  5EJC A;  3K2A A;  3KEQ A;  1BOB A;  2ECC A;  3F8F A;  5GPC A;  3JRG A;  1DQU A;  4BEH A;  4Q5S F;  3GTM J;  1XTA A;  3BG7 A;  3KCC A;  3RZO J;  3SZG A;  1ODD A;  2DOA A;  5ILU A;  3OS2 A;  3A01 B;  1ON2 A;  2Y30 A;  4XMY A;  1NTC A;  2D45 A;  1FYL A;  1YS7 A;  1WFX A;  2A5W A;  1JJ8 C;  5E3M A;  3K4C A;  1WZ2 A;  2EJR A;  3SDG A;  2L0K A;  5M5Y J;  2O8K A;  4CCN A;  2P5L C;  1KGS A;  4M3D A;  1ONV A;  1OPC A;  5K7H A;  1U3E M;  2CRG A;  3UNG C;  3HXL A;  4MFD A;  3E5U A;  2O7O A;  2GXG A;  4A69 C;  1JGG A;  4C3J J;  2R5Y B;  2PEX A;  1IW7 F;  2QQA A;  3NQO A;  2LY2 A;  4LMY A;  1XDS A;  3Q0V A;  4CCK A;  4IOA F;  2QCO A;  5FKN A;  2VKV A;  2M45 A;  2KL4 A;  2XAJ A;  2XGE A;  1ETO A;  2F5F A;  3DBH B;  3JR9 A;  4UB8 C;  3QYE A;  1G3S A;  1ZG3 A;  1ETQ A;  3GFJ A;  1JI8 A;  5FFZ A;  1MND A;  3FK7 A;  3MVP A;  2XAU A;  3RYP A;  1A5J A;  4MEY F;  4MTD A;  2O5R A;  3V4G A;  2CJJ A;  3ZN0 A;  2UWM A;  3OL4 A;  4LIV A;  5B1A H;  1TBX A;  5E20 A;  1PUE E;  2JUC A;  4UXN A;  3G3Z A;  1ZRC A;  5LBQ A;  2DPD A;  2O6G E;  5IYD J;  1O3T A;  3KX2 A;  4M74 A;  1VF9 A;  5CJ9 A;  1SMT A;  5C44 J;  2KZV A;  1YJN I;  2L7Z A;  1FP1 D;  2NXN B;  3TQN A;  4QLC U;  2QQB A;  5IT3 A;  1RRJ A;  2JWT A;  2QBY A;  5FRO A;  2HPM A;  2F4M B;  3I4N J;  2DK8 A;  2R7Z J;  4KIT B;  4A93 J;  5FD5 A;  1BIA A;  5D5X B;  3BR5 A;  1XSV A;  1HST A;  1W4M A;  4NC8 A;  4G12 A;  3PSI A;  2F5C A;  3RSN A;  5DCM B;  2Z16 A;  3F22 A;  5IP9 J;  1WHU A;  1AOY A;  1Z0X A;  4DYQ A;  2VQL A;  4E7H A;  4EAT A;  2KFD A;  4EM1 A;  4HA8 A;  1MH4 A;  1TW3 A;  4RAG A;  5C4X J;  1JHF A;  2G9W A;  4Y17 A;  3RIR A;  1PUF A;  5DD4 A;  3BQZ A;  3GZN B;  4LB6 B;  5GAD J;  1MDM A;  3AG4 H;  3GME A;  1BR4 A;  3E6D A;  3TP0 A;  4WCG A;  3OYK A;  1RKT A;  2JA8 J;  2V1X A;  4HX8 A;  3U9G A;  1HC8 A;  3PFY A;  2CW8 A;  3S93 A;  2TRT A;  1LFB A;  4U88 A;  3T0Y A;  4KT5 C;  2LOO A;  5BNG A;  4DQ2 A;  2CQQ A;  1FBQ A;  2K4B A;  3IH2 A;  2COM A;  3N97 A;  3RPQ A;  4EQQ A;  1LFP A;  5E17 F;  1HKS A;  4YFK F;  1H8A C;  2X6O A;  5CLS A;  4D1Q A;  2AO9 A;  2JQ7 A;  3M7G A;  4KIS A;  2VXD A;  2STW A;  3I55 I;  2EFW A;  3GX4 X;  1OYY A;  4XOT A;  3S2W A;  4IOC F;  2VC0 A;  2RC4 A;  1BL0 A;  3LOC A;  3CCJ I;  1IJW C;  4OIQ F;  2K3P A;  3S2D J;  3P5J A;  3OYB A;  2DT5 A;  2HNH A;  1FYK A;  3IL2 A;  4CO8 A;  2NVU B;  4CUG A;  2STT A;  3K70 D;  2Y75 A;  1LUJ B;  4I09 A;  5HNH A;  3S14 J;  4F3Q A;  1B9N A;  3F8B A;  2R92 J;  1VZ0 A;  2F48 A;  3ZXS A;  1W0U A;  3JAM K;  5J8C A;  2GIV A;  3TOA A;  4Y7N J;  3SJM A;  1KZH A;  3ZOB A;  2DMU A;  2RKH A;  3ML6 A;  1R5I D;  5CQE A;  2ETH A;  1W36 C;  1HQC A;  2M34 A;  1QZE A;  1MIJ A;  2I5U A;  2WB1 N;  1HLV A;  2W4S A;  2CH0 A;  1MMA A;  2KZG A;  4Y3O A;  5FO5 A;  3AG1 H;  2W7N A;  4OAY A;  1FX7 A;  3HOZ J;  4BJ6 C;  4IHT A;  1D5Y A;  1F1Z A;  1BBY A;  2ADU A;  4XON A;  4RLF A;  3E1S A;  5FKK A;  1XX5 A;  4XM3 A;  2EV6 A;  2L02 A;  4KIG A;  4ZDP A;  2XAH A;  2M8G X;  1JJ6 C;  3JRF A;  4HLX A;  5HDN A;  4KIC A;  2JPC A;  4CSW A;  4A3C J;  1J5Y A;  2XHK A;  3KP2 A;  1P7J A;  4ZDL A;  3ABM H;  5BQT A;  1KON A;  1JXS A;  1CGP A;  3GWZ A;  1HCR A;  3CP2 A;  4B48 A;  3HB9 A;  1JUP A;  4NNJ A;  3QOD A;  2KRH A;  4FAS D;  3H5R A;  1Z67 A;  4G94 A;  3TO7 A;  1KU7 A;  1FEX A;  2QYO A;  5ICF A;  1VI0 A;  4WF2 A;  2VBW A;  2DA5 A;  2MFZ A;  3LFK A;  1E3P A;  3LA2 A;  1POG A;  4BH9 A;  4G7O F;  1YRN A;  4XLE A;  1KU9 A;  4Y13 A;  3FXL A;  4J19 A;  3HC7 A;  2RRE A;  1ZLJ A;  1ETW A;  5LHI A;  4O3M A;  1UJ8 A;  4F55 A;  4XRS G;  2V6E A;  1IO2 A;  4EGY A;  2L7F P;  2PBI A;  2JA5 J;  2IBD A;  2ZJR F;  1IUF A;  4JX5 A;  4HNT A;  5L3E A;  4A3B J;  2X48 A;  4BQA A;  5JFR A;  2J5P A;  5E3L A;  3DEU A;  1LNW A;  3BRO A;  4IRH A;  2DN0 A;  4LLG F;  2VN2 A;  4M3E A;  2ZJP F;  4HDU A;  1BC7 C;  2E1C A;  1DPR A;  2DOE A;  2P0W A;  3OIO A;  4XLF A;  3RQI A;  1WGX A;  3JSO A;  1JGS A;  2KDO A;  3K7A J;  2EIK H;  4N4N B;  4XLA A;  1R1T A;  3JTG A;  2JN6 A;  4B43 A;  2COB A;  1G3W A;  4L5J A;  2R7T A;  4E7I A;  3M3Y J;  1Y8R B;  2BY2 A;  2L9N A;  2MSY A;  2M8E A;  2TDX A;  4N9H A;  1YLF A;  1C0W A;  3HJE A;  3JTH A;  3V7R A;  4A6E A;  4KJZ A;  2Y48 A;  2VBZ A;  2OPT A;  4RAF A;  3NWT A;  1FMV A;  4OOI A;  4HOB A;  3MZ8 A;  4C30 A;  4KN4 X;  1H9G A;  2EZK A;  5BOX A;  1J75 A;  1ORK A;  2KRF A;  3I59 B;  3BJ6 A;  4Q48 A;  2MG4 A;  4F93 B;  3I56 I;  1GXQ A;  1IF1 A;  3HOW J;  2CYY A;  2EK5 A;  1ZHF A;  2LD5 A;  2FD5 A;  2VT2 A;  4R8H A;  3IP4 B;  3NWS A;  4XKW A;  4PCQ A;  2JUG A;  2IS4 A;  1VQM I;  1FSH A;  1X19 A;  3K1M A;  1MKM A;  3M8J A;  2XIG A;  2WC2 A;  2ZME A;  4IZZ A;  3R0A A;  3BZC A;  3CES A;  1YW8 A;  4AYB N;  3VSL A;  1TQI A;  1JTX A;  1W7P A;  5HS7 A;  2LYC A;  4HX7 A;  2XRL A;  3CCQ I;  3WHB A;  2ID6 A;  2HOS A;  4L5E A;  4L9N A;  1VQ6 I;  4EJT A;  3H36 A;  3V8K A;  5BPI A;  1ZKG A;  2VL8 A;  2KDZ A;  1VTN C;  1EV7 A;  2A5Y B;  4LG0 B;  2FU4 A;  2ZXH A;  4HST A;  4I98 B;  1S7O A;  2ID3 A;  3KP7 A;  4HX4 A;  4BJ5 C;  2EZI A;  1P4W A;  3KLO A;  2M7B A;  3ERE D;  1YI2 I;  3WTT C;  4P5O A;  4FX4 A;  4HBL A;  4CCL A;  5H20 A;  3GFM A;  3CCS I;  5EGO B;  2DT6 A;  2ELJ A;  3BWG A;  4A6D A;  1N25 A;  2PMZ N;  4BUP A;  3DTE A;  5J47 A;  1B72 B;  5ICE A;  5IT9 Z;  1BIB A;  3I59 A;  3BTI A;  3F8C A;  3BP8 A;  1I1G A;  4HSR A;  4F92 B;  4OU0 A;  3PIP F;  3F3X A;  5FLM J;  4G7Z F;  1QZY A;  1SFX A;  2DFH A;  2LRE A;  4PSX A;  1UHM A;  4GO1 A;  4A5N A;  2AS5 F;  3AL0 B;  1ZTR A;  4I0B A;  4CCJ A;  1XGO A;  1IN7 A;  2EA2 A;  3P9K A;  2KQR A;  2ICW G;  2CWE A;  4NBQ A;  1GDT A;  4BHP A;  1D0Z A;  2IGM A;  1XMX A;  5EDN A;  1QA6 A;  2IA1 A;  1H88 C;  3I5U A;  3B02 A;  3FZV A;  3GCM A;  5B3S H;  5TRD A;  1R6R A;  3W6K B;  3WG9 A;  1V54 H;  3DLL F;  1A36 A;  4HNU A;  3HOX J;  4CHU A;  2P4W A;  3QQA A;  2L3D A;  1P4X A;  4HV6 A;  2HDD A;  3ZQQ A;  3R0J A;  1YW7 A;  4PJJ A;  3IRQ A;  3GFI A;  2ZB9 A;  4C3I J;  4YFX F;  1S7E A;  1Q1H A;  3HPG A;  2HFH A;  4XR6 A;  2FF4 A;  3V7C A;  1UAA A;  2D2W A;  2JA6 J;  2OV7 A;  5F08 A;  2Q8K A;  2DCE A;  3WE3 A;  1RET A;  5JHF A;  3G1O A;  2KIQ A;  2OD5 A;  2AHQ A;  3GZ5 A;  3TW7 A;  3BTJ A;  3WTW C;  2RVC A;  1XPX A;  1UHW A;  3HSR A;  5CQG A;  1W1W E;  5F0H A;  4A3K J;  2Q1Z B;  4XLP F;  2VBY A;  2JA7 J;  3BR0 A;  2Y9Z A;  1APL C;  2JZY A;  4QPQ A;  5KK1 A;  2M7A A;  2M4K A;  3JRH A;  1B59 A;  3U1D A;  5DCF A;  3ABL H;  3P9C A;  1YQA A;  4XN3 A;  4LGW A;  4D7M A;  4PJM A;  2K40 A;  4H4K C;  4NQW B;  3DU5 A;  1TT5 B;  4UVA A;  2CFO A;  2XRN A;  3A0H C;  1WJF A;  5LGU A;  3L2W A;  3FX3 A;  2LR8 A;  4F91 B;  2OC6 A;  3BPX A;  1VFC A;  2LF8 A;  3LSG A;  2JRT A;  4M6Y A;  4RBO A;  4AVP A;  3WU1 B;  2ZSI B;  1FMW A;  1R00 A;  3QP6 A;  4R1H A;  1WSU A;  5HOD A;  4RB1 A;  1SD6 A;  1OMI A;  4ITV A;  3AL0 C;  1IN8 A;  2BYV E;  4HNV A;  5ICG A;  2L9S A;  3S32 A;  2W24 A;  3BOQ A;  1ZLK A;  2YPR A;  1WJB A;  2MAB A;  3A03 A;  3ZMZ A;  1R9T J;  5KCM A;  1W0T A;  2R3S A;  3D1N I;  3OYL A;  3O6B B;  3FXK A;  2W84 A;  3K4K A;  4KIB A;  3VYT B;  2QQ8 A;  4HQE A;  4RGS A;  3CDH A;  3DV8 A;  3ABT A;  5D6F A;  3WGG A;  4JYK A;  2P81 A;  2OUM A;  5M3M J;  2CSO A;  1Q1V A;  3IV5 A;  1ZQ3 P;  4A3D J;  2NS8 A;  3DTK A;  5IYB J;  2GAU A;  5B1B H;  2VOO A;  2WAF A;  4FE7 A;  2F4O B;  1SVL A;  3GYH X;  1OCO H;  1VQL I;  3K1P A;  4EVI A;  3QPT A;  5JVT A;  2JT1 A;  3LQQ A;  1GVD A;  4OIN F;  2XSD C;  4XBF A;  4A3M J;  4DGW B;  3FMS A;  4UUT A;  1FYM A;  2NVX J;  5ERI A;  2HXI A;  4XKV A;  2A6T A;  1OCR H;  2ESH A;  3CUQ C;  4PSW A;  3H9Q A;  2H09 A;  4XKB A;  1G6N A;  4A3G J;  1GXP A;  1J9I A;  1RES A;  2DPU A;  2IW5 A;  5GTH C;  3FDY A;  4CYC B;  3I54 A;  5H2F C;  1MH3 A;  3ZQ7 A;  2BVM A;  1FOW A;  1JT0 A;  1HBX G;  5DS9 A;  2IEK A;  1QPM A;  4PDK A;  1QQI A;  2O8X A;  3MD2 A;  1AKH B;  2Y69 H;  1BN5 A;  1R7J A;  3HHG A;  3SHF A;  3W3C A;  4XSX F;  3CC7 I;  1DU0 A;  4U0V A;  2L2O A;  4F52 A;  3WTU C;  1ITY A;  1W7P D;  3TO6 A;  3PNY A;  2G7U A;  3CZ6 A;  5DV5 A;  1A31 A;  3LSP A;  2V4J C;  5JVG F;  1Z3Y A;  5B66 C;  2F5D A;  3PQK A;  3PQJ A;  3E5X A;  4L5I A;  1QBJ A;  1HF0 A;  1FP2 A;  3A0B C;  2JPB A;  1GHC A;  4CH7 A;  2GXB A;  2VJ4 A;  4LIT A;  4CXF A;  3JRE A;  3BR2 A;  1L0O C;  4Y33 A;  1ZR2 A;  2CV1 A;  2VPR A;  3DBL B;  3CUO A;  4G6Q A;  3DLA A;  4X6A J;  1F5T A;  1USS A;  2HXO A;  2XAQ A;  1X2M A;  2XAG A;  5A2Q K;  2ZFW A;  1MMS A;  4QWQ A;  5FKO A;  1KA8 A;  2QSH X;  5HLH A;  4XID A;  1YG2 A;  4IQJ A;  1MD0 A;  2K85 A;  4HLY A;  1CF7 A;  1IAW A;  2R5Z B;  2FA5 A;  2FEZ A;  3HIF A;  2V79 A;  3X2Q H;  2E19 A;  2AXT C;  2GXA A;  2E1M B;  3ZQH A;  2OQR A;  3O8H A;  2VB6 A;  4B1R A;  2E5N A;  4CYC A;  4IHY A;  2QSG X;  1AA7 A;  3VDX A;  3BG3 A;  1A35 A;  3DBR B;  4RS8 A;  3TED A;  2CV2 A;  4Y15 A;  2WY8 Q;  3TBI A;  2BW3 B;  4E6K G;  5FLX Z;  3WTX C;  3ZP5 A;  2DQR A;  1N75 A;  2M2E A;  1TNT A;  2LBF A;  2B9S A;  2FBI A;  5DM6 F;  2LY9 A;  1WQ2 A;  4XSZ F;  1JUM A;  1XCB A;  5AIP A;  3CUQ B;  3WHC A;  1IDY A;  2DK5 A;  3HYI A;  2BY3 A;  5IPA A;  3BY6 A;  3R6S A;  3RPU A;  5JR3 A;  2W48 A;  3OS1 A;  3K69 A;  2V7F A;  1LDJ A;  3LL7 A;  1R1U A;  4UY8 I;  3I4P A;  5E1X A;  2GOX B;  2MH2 A;  5K7F A;  2LTP A;  2VOP A;  2R7U A;  1KQ8 A;  3E7L A;  3WOD F;  5DD8 A;  2F4I A;  2LNB A;  2FX0 A;  2Z2S B;  1Y39 A;  3LSR A;  3HUG B;  3GTK J;  5DDG A;  2CU7 A;  1QGP A;  3BDD A;  1Y1W J;  5FFX A;  3GW2 A;  1VQP I;  1NHA A;  3GTO J;  4D0P A;  5E1W A;  1SFE A;  2GQQ A;  2KIU A;  4BXF A;  2M5W A;  3ZMT A;  1RUN A;  5AON A;  2LF7 A;  2XPV A;  3MAJ A;  4CIC A;  3F9K A;  2K27 A;  2YU3 A;  2XC7 A;  1O7L A;  2EZL A;  2G7H A;  1FJL A;  2BW3 A;  2E35 A;  4BQO A;  4U0W A;  4MO7 A;  4ZZL A;  4XRF A;  2DA3 A;  2EIM H;  2M9H A;  4AWX B;  3S3M A;  5BMZ A;  2TCT A;  4GFB A;  1YIT I;  1MMN A;  1SMY F;  2ZSH B;  4NC7 A;  3CLO A;  4OWR B;  4ESF A;  4Q47 A;  5FKM A;  4D7N A;  5EEH A;  5J3L A;  3HDD A;  4BAY A;  1W5C C;  3FK6 A;  1AU7 A;  1MMD A;  1P2F A;  2CV0 A;  1Y0N A;  1DGW Y;  4J00 A;  1TQP A;  3BT9 A;  1PUF B;  1REP C;  3LNQ A;  1SAN A;  1LKX A;  1PJR A;  3ZGK A;  3WE2 A;  5ILV A;  1S5L C;  3NRV A;  2IGN A;  2IVM A;  2KKO A;  2FQ4 A;  2QQ9 A;  1YS6 A;  3ZQC A;  5DCM A;  4ZYG A;  2R5Y A;  4IRI A;  1Y8Q B;  4NB5 A;  3MWM A;  1MZB A;  1ZEL A;  5K5O A;  3AG3 H;  5LHG A;  2M87 A;  5D4R A;  2Z33 A;  3GTQ J;  1BR2 A;  2K86 A;  3VPR A;  1DDN A;  4U7D A;  3VWB A;  3FKJ A;  4RDU A;  2I10 A;  3IAS 2;  2BVL A;  2Z99 A;  2P7V B;  3N05 A;  3QP5 A;  3A1Y A;  3CCU I;  4W97 A;  1IXR C;  3KYC B;  3Q3S A;  3PL8 A;  4LG3 A;  3LST A;  3VSK A;  3KZI C;  3Q0W A;  4IRG A;  3OS0 A;  5CYV A;  1TWF J;  2P6S A;  3ROU A;  2EQR A;  2FSW A;  1QVT A;  2NS7 A;  4ENJ A;  1IRX A;  1UMQ A;  1V4R A;  1T2K A;  1VQ7 I;  1NH3 A;  2HOT A;  4ZZD A;  4KMF A;  1Z1D A;  2VJI A;  3LSK A;  4L0Z B;  1DU6 A;  3BG6 A;  1FWZ A;  1VQ4 I;  4IXA A;  3E5Q A;  1XC5 A;  4CA0 A;  1K79 A;  4MIM A;  3OYH A;  1DUX C;  1JHH A;  1SFK A;  3WGI A;  1TLH B;  3HM5 A;  3G1M A;  3AFH A;  4EV0 A;  3FM5 A;  3DQV C;  3Q0U A;  4E7S A;  3FXO A;  1SD7 A;  4I2O A;  3CCM I;  3DXJ F;  2LLK A;  1BJA A;  2IS6 A;  3G2B A;  4PGH A;  3FF5 A;  4DW6 A;  1K83 J;  2XKP A;  3BLY A;  1U78 A;  1G2H A;  1ZG5 A;  1KU2 A;  2HYF A;  3HRU A;  3TO9 A;  4EMS A;  4UVB A;  2CQN A;  2X1C A;  3S17 J;  1FT9 A;  2HEO A;  3B73 A;  2DMQ A;  4DZP A;  3QWL A;  1B72 A;  3QPS A;  1KYW A;  4YII A;  3KEY A;  4K2E A;  2VKE A;  4II2 A;  1CF7 B;  1LE8 A;  3D5S C;  1LEA A;  5E3O A;  1QRY A;  2BHY A;  3ZCO A;  3RJP A;  5EGO A;  2QGU A;  3GLL A;  5GAH J;  4V19 K;  1GLN A;  3HKZ N;  5FRM A;  5A2Q Z;  4WXD A;  2K4J A;  1D1B A;  4V2F A;  1U8R A;  1FIA A;  2DOD A;  5LRR A;  4A3F J;  4LK0 F;  1XSD A;  1JT6 A;  4BHB A;  3FIS A;  4EJO A;  1S3J A;  1D0Y A;  2NVY J;  3S8P A;  5E8I A;  5LD2 C;  4IKF A;  3FM3 A;  3SFI A;  1KYZ A;  1UEL B;  2DDB A;  4KNY A;  1RIO H;  4HQM A;  4BE1 A;  2CFX A;  1QZZ A;  4OIO F;  2RNJ A;  4UV8 A;  3QPH A;  3MN2 A;  1G8X A;  3TKY A;  2EIJ H;  3E6M A;  3HL2 A;  3L9F A;  2NVT J;  3NAR A;  1BM9 A;  1R49 A;  3F21 A;  4P1W A;  5FLV A;  4IHS A;  4O6J A;  2KJB A;  1IXS B;  2QZ8 A;  1UB9 A;  2QKM B;  3WU0 A;  1B1B A;  3H3V K;  2IGK A;  3COA C;  4B4C A;  4MQ9 F;  5E1Z B;  5FD6 A;  2YX7 A;  2PLY A;  4KUM A;  1TWH J;  1SFO J;  2XF5 A;  3H0D A;  1BR1 A;  5F0C A;  5HS9 A;  3LSM A;  3JSP A;  2M4G A;  2JVH A;  2VJ5 A;  4PJN A;  3WTV C;  3EUA A;  2HU9 A;  4ZTJ A;  4YFN F;  3HSE A;  3OR1 C;  3F8M A;  3JRA A;  3HRT A;  2BZT A;  6PAX A;  1ETK A;  3GFL A;  3CJT B;  3OL3 A;  3RKX A;  1X4O A;  3L2U A;  4B44 A;  3FHZ A;  3S1Q J;  1U0J A;  2W82 A;  4ENK A;  1LQ1 A;  2XV4 S;  1MBJ A;  2W00 A;  3IWZ A;  3MZY A;  4LD5 A;  4S0H B;  1O3S A;  5D5U B;  2X0L A;  3KP3 A;  4G9Y A;  3S1R J;  3GO5 A;  2B0L A;  2Y31 A;  1VQ8 I;  1U5T B;  3H1C A;  4PK4 A;  1HDD C;  3J80 Z;  3IRR A;  2UUZ A;  4M9Z A;  4IQ4 A;  1LDK B;  2OTL I;  2MD5 A;  3ELK A;  2BBY A;  1M1E B;  2W85 A;  3DKY A;  3F0C A;  3J7Z I;  5GP9 A;  1SFU A;  1LDD A;  4H0E A;  3HZJ A;  3VYU B;  3ASO H;  2DA7 A;  5DYM A;  2CUF A;  3JW4 A;  2FBH A;  2V1U A;  4Y4R A;  2JA2 A;  1RUO A;  4YRV A;  3CO6 C;  2WAD A;  5DTD A;  2LC2 A;  1X1A A;  4HW0 A;  2BGC A;  2EFP A;  3HG9 A;  4FX0 A;  3M8E A;  5GTI C;  2GWR A;  3MEX A;  4XLN F;  3LA3 A;  5ILS A;  2EA4 A;  2WB1 A;  5K5R A;  4UNO A;  3GTG J;  3D0S A;  1ACI A;  2EPF A;  5H6Q A;  3QRF F;  2XGC A;  2H1K A;  3OYM A;  1X1P A;  2LDU A;  1OYW A;  1LVA A;  3OSG A;  5M3F J;  4AIK A;  2BOL A;  4XQF A;  2JVG A;  4G7H F;  4ASN A;  1I5Z A;  9ANT A;  1WWX A;  4RM2 A;  1J7K A;  4J01 A;  2IPQ X;  2JSP A;  2HDC A;  3KE2 A;  3SZP A;  4UUS A;  4O5V A;  4BU2 A;  2MH9 A;  4X0G A;  4L0Y B;  2R7O A;  4AID A;  4P55 A;  4WXC A;  4NQW A;  3ISP A;  5EZH A;  4AIH A;  3W2A A;  2VPL A;  2Q0O A;  1ZRF A;  2HTS A;  4A12 A;  2NOG A;  3G4S I;  1N77 A;  3GXO A;  3CF2 A;  2PQ8 A;  2CMP A;  2P6T A;  1B6A A;  2HPI A;  5HVQ C;  2IA2 A;  1MBE A;  4I0A A;  4L18 B;  2DXI A;  1WI9 A;  1ZAR A;  2DW4 A;  3T1B A;  1LPQ A;  4XIC A;  3W2V A;  3I3L A;  4PFO A;  2ZC2 A;  1V5G A;  4LG0 A;  1TWG J;  4M9S A;  3K4M A;  3VFZ A;  2K02 A;  3FXU A;  2Y9Y A;  1K4S A;  1G4D A;  4M6V A;  2HS5 A;  2WTE A;  3KEO A;  1W7P B;  4GCV A;  4LFU A;  2XVC A;  5L3D A;  5DUI A;  4QPO A;  2QKL B;  3PM1 A;  4KFC A;  3WTZ A;  1ZG1 A;  1YFH A;  5KNL A;  3EUH A;  3OWT A;  3KZY A;  3OYD A;  4I99 C;  3LMM A;  4RA2 A;  1TQM A;  3K70 C;  2E5Z A;  3GTL J;  5HOO A;  3QOP A;  2DQL A;  2V9V A;  3SEZ A;  2FE3 A;  2HOA A;  1HW2 A;  1LVK A;  1G3Y A;  1X3W B;  1TT0 A;  1TC3 C;  2RQP A;  3C2H A;  2Z1D A;  2XPU A;  3CCY A;  3FBN B;  1ZN2 A;  4M72 A;  2JSC A;  1LFU P;  1W36 D;  2CW7 A;  2K9Q A;  3J7A Y;  4C2U A;  3L2R A;  3S1M J;  2B7E A;  2MD0 A;  1E17 A;  1I50 J;  5IOZ A;  1R4N B;  3HRS A;  4RAZ A;  2HVR A;  2DFE A;  3M1E A;  1GV5 A;  4MTE A;  3M4O J;  4PFP A;  2E1N A;  4M6X A;  4LJZ F;  4B8X A;  3I71 A;  1S29 A;  3OYF A;  5J40 A;  1F43 A;  2ZCW A;  3CDL A;  3M07 A;  1VQO I;  4A0Z A;  1UZC A;  1FLI A;  3ZPL A;  4BDZ A;  3V8J A;  1BC8 C;  4RB0 A;  1KU3 A;  4P9F A;  1O3Q A;  3LQR A;  2M0M A;  4XL9 A;  3U1K A;  4ANJ A;  2I8D A;  4NC6 A;  5LGT A;  2HR3 A;  1SAX A;  3VOE A;  2PJR B;  1XG1 A;  1S72 I;  2BE5 F;  2DO7 A;  2FJ1 A;  1I6X A;  2MC3 A;  3BTC A;  1S9H A;  2DTR A;  3K4B A;  1IZ1 A;  3DF8 A;  3HTU A;  3QPL A;  4DIQ A;  5J4Y A;  3DKW A;  1DPU A;  5E3N A;  3HBL A;  2W25 A;  2X85 A;  1N78 A;  1NK2 P;  2OQG A;  2ZFU A;  4HEA 2;  1XB4 A;  1D8J A;  2P8T A;  2EBI A;  2F6C A;  5LEJ A;  4E7J A;  4MGR A;  2E2J J;  3KFW X;  2L4M A;  3I53 A;  2CW0 F;  3JCU C;  2K9M A;  1QHG A;  2IA0 A;  4AYB A;  5F1R A;  4FTH A;  1WJE A;  3J81 K;  1IXC A;  1O57 A; 
#chains in the Genus database with same CATH homology
 1LUJ B;  1T08 B;  1M1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...