1LUJB

Crystal structure of the beta-catenin/icat complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
b'GAPAKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQAAEDVVMAFSRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catenin beta-1
molecule tags Structural protein
source organism Homo sapiens
publication title The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT.
pubmed doi rcsb
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2002-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1lujB01
1LUJB 1T08B 1M1EB
chains in the Genus database with same CATH superfamily
5D4SA 3JTGA 5FROA 2XAQA 3BPXA 3LSMA 2K9LA 5J3LA 2XKOA 2CYYA 2UXXA 3K4NA 4C3HJ 1BC7C 4KMFA 2VQLA 3I56I 3ZMDA 1ZQ3P 3H5NA 5IT9K 2PBIA 1D0XA 2XPVA 3S93A 1K6YA 4YIRX 2IS2A 3RPUA 3CD6I 1IO2A 4U7DA 1JT0A 2KKOA 1SVLA 3QOPA 1XCVA 2XAGA 4BEHB 2CRGA 3I3LA 3BG9A 1HDDC 1G6NA 5DV5A 4C3JJ 3TDUC 3GBGA 2B7EA 2K3PA 1A04A 4BAYA 5E3OA 1V4RA 4E7LA 3PFIA 2IAIA 1QGPA 2CQQA 3LWFA 3RI4A 2RVCA 4YELA 4A3IJ 4HA8A 3W6VA 4M3GA 4E6KG 1EH8A 4KICA 4UUTA 1RR8C 2OTLI 3LSJA 2M8GX 4CYDA 1MMDA 1OYWA 4PDKA 3WU0A 2MGQA 3ZMZA 9ANTA 1R1VA 3SZTA 5AIPA 1WI9A 1BR2A 3FXRA 5D5WB 1X19A 2R3SA 2ZSHB 4C2UA 1XMAA 5M5WJ 4IRIA 1WRJA 4FHTA 3W2AA 2QUFA 2L4AA 1CF7B 3F8NA 2FRHA 2FQ3A 3CUQA 3P5JA 4M9XA 3NRVA 5DM6F 1X1CA 3HOTA 1LNWA 4JX5A 1RESA 2F2EA 3DV8A 4V2GA 3C1DA 4A5NA 4U0YA 5DUIA 2ECBA 3ASOH 1MJ9A 2FU4A 2BY2A 3F21A 3MKZA 4KNYA 2HPMA 4BS9A 2FUG2 2FMLA 3I9V2 2LD5A 5J4YA 2CV1A 1WJDA 4AU7A 3BG7A 3FXQA 3KP7A 2X1EA 2ZC2A 2LVSA 5HLTA 1USSA 1P4XA 2EFPA 4P9FA 3HOWJ 2OA4A 5FFZA 4IHWA 1YS7A 2QQ9A 4AYBN 1FY7A 3UKGA 1U8BA 1T08B 3QOEA 4DZJA 2F6CA 3BR0A 3HIFA 4U0WA 3ZQ7A 2CFXA 4DOZA 3IKTA 4LGWA 2JPCA 3U9GA 2QLZA 1Y1VJ 4RGUA 3MQ0A 2IT0A 4NDLA 4WCGA 3NAUA 4RB0A 1IUFA 2LKPA 1IN6A 2P5KA 2LK2A 4MFDA 3K7AJ 2KJCA 2OCEA 4KIBA 4C30A 4MFEA 4EM0B 4LG3A 2QSGX 5CPRB 1GVDA 2I10A 3K1NA 1IW7F 1TLHB 4IRGA 2YU9J 2V1NA 4DZPA 2VPLA 3GUDA 1N25A 1B8IB 4U87A 1C0WA 3HOSA 4Y33A 1YJNI 4ENNA 2ZKZA 2HZDA 3L2VA 1ZAOA 3BTJA 3DPLC 2DLLA 3S16J 4MTEA 3ELKA 4XNFA 4HLXA 1DU0A 4P96A 2E36A 2XIGA 1Z6TA 2XSJC 1OR7C 1TW2A 2WAFA 4JQFA 4L0YB 4YIIA 3N05A 2EJRA 1T56A 4GYGA 4L5JA 4ZYEA 3KIOA 3LMMA 4YEJA 4U7BA 2PJPA 1D1CA 3O2PE 2VBWA 3FXLA 5FKNA 4XLFA 4FASD 1HW5A 5B1BH 5J6XA 4WXDA 1AU7A 2F5DA 4ETSA 2QA4I 3JR9A 3MZ8A 2MFZA 3KZZA 1ZR4A 1E3HA 2ZMEC 3GTQJ 3LSTA 1KU3A 4KMUX 3TKYA 4M6VA 3HJEA 5L3BA 5DUKA 3KEOA 1STZA 5ICFA 2DA2A 2L0KA 2X1DA 3M8JA 4BBRJ 3BJOA 1UHMA 4PZJA 4PK4A 1PYVA 3CC7I 2J5PA 2MLGA 3BJAA 3NWSA 2VKHA 4N9HA 5ERIA 4B4CA 3K1PA 2VQGA 2OAZA 3KE2A 4XSZF 3CJRB 2ZJPF 2W24A 2DMTA 3A2KA 4EM1A 1R36A 5LGTA 2BY3A 4CDGA 1TT0A 3EETA 5JFRA 4GDFA 2DQLA 3RPUD 5ED4A 4X1EA 1MH3A 1YI2I 3R60A 1YO5C 1F9NA 5BMZA 4ENMA 1D0ZA 3DKWA 3KP4A 1H88C 1BJZA 3MN2A 4P55A 5HS9A 1AKHB 5JVTA 3TP3A 4LD5A 2H8RA 1AKHA 3F8CA 4I0AA 4XICA 4M9SA 5J47A 1HW2A 4AVPA 1JTXA 4Y15A 3E1SA 4JX6A 2Z2SB 4BQAA 4L0ZB 1BR4A 4A3FJ 2MD0A 2B63J 3GFJA 3OYAA 3RZDJ 2F4IA 1E3OC 2IJLA 1ENHA 2H6CA 3G3ZA 1D3YA 1G3SA 4U88A 1V3FA 4J00A 3S1MJ 2ZCWA 2Z99A 5TRDA 3Q9SA 2VQHA 5K7HA 3GTJJ 1N75A 4BHPA 3G73A 5FRNA 3ZQCA 1XDSA 1XB4A 4MIMA 1SEUA 3HG9A 4A3MJ 3KYDB 2OPTA 1U78A 5GADJ 1X3UA 2R7WA 5CVVA 5CKTA 3RTRA 2VJIA 1SAUA 2P5VA 4BBSJ 4G7HF 2HVSA 2VPRA 2DN0A 2GIVA 3TW6A 1OYIA 4HNTA 3SFIA 1VQPI 3AG4H 2V79A 4PFPA 2FJ1A 4S04A 3OYJA 3CCEI 4IX7A 3GWZA 5LEKA 2XRNA 1TW3A 4G9YA 4Q48A 1JJ6C 1SD4A 2XB5A 5FKOA 1DQUA 1JHFA 4LB5A 4G94A 2DT6A 3JAMZ 1ETVA 2DK8A 3KLOA 3HOYJ 1BOAA 1F43A 2FEZA 5FLXZ 2QBYA 4OINF 5A2QK 2DTRA 3HSEA 3KFWX 2FE3A 1FP1D 2KHMA 5HDNA 5TGTA 3KP6A 3ML6A 1Y0NA 4IL6C 4GO1A 1J5YA 1O57A 2XGEA 2O5RA 4JYKA 4XL9A 2GA2A 2W84A 5GPCA 1WJCA 1YS6A 4LG0A 4IOAF 3IHUA 1V54H 4UVAA 1BI1A 5LRSA 4ENKA 3LSIA 3HRMA 3WU1B 3H5AA 5HLIA 2JT1A 5IP9J 3LA3A 4XRFA 5IYDJ 3K0LA 2W57A 4E4HA 3GO5A 4KFCA 3RJPA 1ZN2A 2AQEA 2HTSA 5J1YA 1T0FA 3DEWA 5LLQA 1A6IA 3S2WA 5CQEA 2Y0MA 4IVNA 3MKWB 2EFNA 4G8XA 1P7JA 1OFCX 3HC7A 1JKRC 4BE2A 3MZHA 5LEJA 3AAFA 1FLIA 2P5LC 3ZXSA 4D9JA 2JK3A 2R7XA 5LGNA 1V5EA 3KYLA 1R00A 2MD5A 4J01A 3TW7A 2K02A 2QBYB 2LY1A 4UV8A 3ZP5A 2E5ZA 3ECOA 4AWXB 3K2ZA 1V5FA 2BEOA 1R7JA 3KP2A 4B3AA 2DAOA 1T95A 1U8RA 4HAMA 1VNDA 4F93B 2E19A 1JTYA 1J2XA 1QO0D 1WSUA 1R6RA 3RDIA 1Y56A 3VFZA 1MJBA 3LA7A 3I58A 5TISC 5DTDA 4HDUA 3ZN1A 2HOAA 3HGGA 3GCMA 5AONA 5F6FA 4XRMA 2VONA 3HOUJ 3G1LA 1SFXA 5D5UB 4CUGA 2LDUA 5EDNA 3IH2A 3LSKA 3JAMK 2M1BA 4I0BA 3K4MA 1UFMA 2OU2A 3HGYA 4Q4ZF 4AYBA 4BUPA 5DEQA 1WJFA 4DBQA 2HOSA 2Q0OA 3QU3A 3GZ6A 1XX5A 1K61A 2VL8A 2WA0A 1KU7A 3K4BA 2DA4A 3PIOF 2QSHX 2YSRA 4KA4A 3L2UA 2M4KA 3DKXA 3IWZA 3B73A 5JHFA 4XKWA 4CCJA 1OMIA 2RNJA 4CGZA 1K79A 5H2FC 4S0HB 3HRSA 2RGVA 1ZRCA 1SFKA 2LREA 1E17A 1OQYA 3OYEA 1ERDA 3CP8A 3KX2A 5JI6A 4N4NB 2DTZA 2X9DA 1IXSB 4FE4A 4UNOA 2LG4A 5LBQA 3GFIA 1J75A 3MCZA 4A2UA 2CW8A 1TP4A 2OUMA 1JUSA 2COBA 3R0JA 2VKVA 1KU2A 3F3XA 1ZKGA 3H9QA 2BXZA 4HNVA 3ONQA 2XC7A 3M1EA 4MEYF 3MVPA 3I53A 3WTTC 3OYNA 2KFDA 1JT6A 2YU3A 1XCBA 3OL3A 5B5EC 2CU7A 2DYSH 3TMOA 3JSOA 1SVMA 2A05A 2NYXA 4OOIA 3I0TA 3FXOA 2ZNZA 2CJJA 5DCFA 1ZARA 1FEXA 3VEPA 4IZZA 1Y8RB 2F5EA 2F4MB 2WB1A 1G3TA 5K1YA 2BVMA 2HVQA 5EZGA 4KUMA 4E7KA 3QPLA 4LLGF 3COAC 2XAUA 2M9HA 3J80K 5EF6A 4EATA 5GAHJ 2QQAA 4HF2A 3PO2J 1XSVA 3U21A 3WTWC 3FISA 3BLYA 3HTSB 2K86A 2QKLB 4EJOA 2RV8A 1QVUA 2AXTC 2KP6A 5FO5A 4BL0B 4Y7NJ 2L9SA 3BP8A 3DXJF 4ON0A 5CLSA 3RZOJ 3N97A 3ZQFA 1NTCA 2DXIA 1DUXC 4GFBA 4UUSB 2BY1A 3CUOA 1REPC 3AG1H 2V7FA 1IJWC 2HKXA 2R93J 4F3QA 1SMTA 2ICWG 1U9NA 4EJVA 3HTUA 1A6QA 2D45A 4BGDA 2VBYA 3PQJA 5E8IA 3RYPA 3L2WA 4NNJA 4L18B 3A1YA 1TQMA 3PL8A 3E0JB 1PUFB 2X1CA 1Z91A 2MABA 1KZHA 2BGCA 2M45A 5HS8A 2IPQX 3EPZA 1MMGA 1OJLA 5B3SH 4A3KJ 2DU9A 3HHGA 2VJ4A 2HQNA 1W36C 2H27A 2ZFUA 2H94A 2JA2A 4RAGA 5DS9A 1FIAA 1P92A 1P7IA 3IC7A 3O8HA 4BNCA 3FM3A 2DMNA 2FF4A 2CUFA 1IN7A 3F6OA 3TEDA 3A01A 4ZZLA 1SD5A 2TCTA 1FBQA 2RQPA 2XF6A 4HYEA 4YIFA 1R5ID 4IQJA 2HYGD 5BS6A 1BBYA 4I7HA 4KT6A 1ON2A 3M07A 1MBJA 3JREA 3BTIA 4BEHA 4BHCA 4N4OB 1XC5A 1MBKA 3GZNB 1SAXA 2ZMEB 2DMQA 2NVQJ 1YJ9I 1ZYRF 2R7OA 1XG1A 1HA8A 3TGNA 2KPMA 5C3EJ 3LQQA 5B66C 5L3FA 1G8XA 2RC4A 5J4VA 5GTIC 2CQNA 2A6HF 2OZUA 1A31A 4FCYA 1I1GA 1VQOI 5BQTA 1R5HA 3D5RC 3CCLI 4M3BA 1U5TB 2HDWA 1CGPA 3B6CA 3T0YA 4BJ5C 1FYMA 1R49A 2K4BA 3CUQB 3OV8A 4AIDA 5E1ZB 1DPRA 5C4JJ 3HEFA 1U3EM 4U0VA 2V6EA 3L2RA 5ILVA 4K2EA 1RC9A 3BWGA 3DU5A 3VYRB 1UZCA 4HZFA 2WC2A 5F04A 2NS0A 4P1WA 2O7OA 4JBAA 2OC6A 3MMYB 1SVOA 3CCVI 1G2HA 5IP6A 1JUMA 2KMUA 1KU9A 3WG7H 4PJ0C 4LMYA 3SFZA 2Y48A 3FX3A 2IVMA 2ZJRF 4MNUA 2LF7A 1MGTA 2JQ7A 1MW7A 2F5CA 4OAZA 1FMWA 1ZTRA 4ZJZA 1BW6A 3H3ZA 1EF4A 2LBFA 3D5SC 2ESNA 3F8MA 3A0HC 3CP2A 1XMKA 2MBFA 5K7FA 1TT5B 4BQOA 3CUQC 3DU6A 3QPSA 4GCVA 3WG9A 5L3EA 4E70A 2NAZA 2P7CB 3F23A 4BDZA 2ETHA 1XGSA 3K4KA 1TWFJ 3CDHA 5L3GA 2VE9A 2XAFA 2DFFA 3KZIC 3HOXJ 4WXCA 2PN6A 3K1MA 4RB2C 1R1UA 1F1ZA 3S1QJ 1TNTA 2K40A 3HUGB 4A6DA 2XPWA 4M6XA 4XQFA 4PCQA 4ZTJA 1I50J 1Y8QB 4RAFA 1D0YA 4A5MA 2ESHA 4YG2F 1FPQA 4XBFA 2E2IJ 3MAJA 1KQ0A 1MKMA 3BQZA 4I09A 4XR6A 2QGUA 3RKYA 3R61A 3HOZJ 2HOEA 2KIQA 4RAZA 1QA6A 1YIJI 3J81K 4LK1F 2LSOA 2O61A 3RKQA 4OMYA 3ABUA 2P6TA 2Q1ZB 1U6GA 1LDDA 1LFBA 2F5VA 3I54A 2VLAA 2XF5A 3VOEA 1D8JA 1W4MA 2A61A 5GP9A 1X2NA 4ITVA 3JRFA 3I64A 4LB6B 4L9NA 4ZH4F 1I27A 4KIFA 2VT2A 2DA5A 4M73A 1MDMB 1ETKA 1VQ5I 2L02A 3CJTB 4HOBA 1R22A 5F64A 2CWEA 5HS7A 3GTKJ 2L01A 3M4OJ 2IGOA 4XN0A 3M9AA 4RDUA 1GV2A 1B9MA 1IZ1A 2FD5A 1MNDA 4LLLA 3TO9A 5GAGJ 2Z33A 1IG7A 3BCBA 3C7JA 3JRGA 2R7RA 1ONVA 2JPBA 2VKDA 1PP7U 3M3YJ 1GUUA 1YYVA 1FSHA 3G4SI 3TBIA 4ABZA 2K3FA 1FYLA 1Z7LA 4D7NA 1YJWI 2DK5A 3VYTB 3GTOJ 4LFUA 4JX4A 2BBYA 4IRHA 2PQ8A 1MD0A 4XM3A 4QPOA 5KAFC 3OSFA 4CZCA 3P9KA 4BJTA 1EKEA 4P9UA 2NVYJ 4FT8A 4RLQA 1ETXA 2EFQA 3BOQA 4CYCB 1FOYA 2XB0X 4EJWA 1D5YA 2EZKA 2Q2EA 1S8NA 2K7LA 4R1HA 3LSRA 3OYFA 2A6EF 2IS1A 4CA0A 2HTJA 2O0YA 1Z21A 4E7HA 2GAUA 5EGOA 4AVZA 3BR2A 2FSWA 1E2XA 1Y6IA 3WGIA 3K10A 3WTXC 3K4LA 3O3KA 3SZPA 2K9NA 4AM3A 1S7AA 2GQQA 1W36D 1WJAA 3KEQA 4AIHA 3FXJA 3VDXA 4NUBA 3TP0A 1OCTC 4MEXF 1Z05A 5EEAA 3DBLB 3LQRA 3A03A 2W82A 2V9VA 2E1OA 4OWRB 3QPTA 1JE8A 3I5UA 2FQ4A 4M3DA 3ROUA 4GYIA 4FISA 1O7FA 5FLVA 4B47A 1H9TA 1MMAA 3CMMA 1BOBA 2DOEA 2DW4A 3REOA 3ZMTA 2Y9YA 2XPUA 4FE7A 3LSPA 3AG3H 3IWFA 3LFKA 2XROA 4O5VA 3ZOBA 3BG3A 4NHJA 1ITYA 3O8GA 1ZG3A 3OR2C 1YW9A 4E7JA 2L9NA 4UXNA 2XV4S 3FBIB 4XLAA 1YG2A 2JTVA 2R5ZB 1ORKA 1B6AA 3T8TA 4E7IA 4IOCF 3N4MA 1Y39A 1P6RA 1VQ7I 1I6HJ 3X2QH 1VQMI 2NVXJ 1RETA 1RKWA 3I4NJ 2EWNA 1EV7A 2EZHA 2PJRA 3WTUC 1TWCJ 1TC3C 2J5OA 2KIUA 4CCOA 4D5CA 3S1RJ 4HDVA 3PO3J 2L3DA 2DT7B 3D1NI 3LAJA 2XGDA 2R0QC 2L2OA 3J7AY 5DYMA 3WTYC 3GXOA 1TWGJ 3HBLA 4RS8A 4IO9F 1JKQC 2LH9A 1RIOH 5E18F 1P4WA 1F5TA 3I59A 5FKLA 4CH7A 5FLMJ 3QP5A 3IL2A 3GTGJ 3ZMSA 4E7SA 2LFBA 5CVIA 2LMDA 1WJ5A 4D1QA 1ON1A 1BI2A 2EA2A 4BDYA 2EK5A 2JRTA 1IAWA 2GBYA 3E6MA 1BM9A 4DIQA 3FK6A 3SXYA 3HPHA 4TV7A 4RM3A 5C44J 4Z2YA 1IDYA 2H8WA 1W5SA 2EA4A 4MLOA 5TJJA 2DO7A 2E60A 2EPFA 4KDPA 4L9TA 2WWYA 1OCOH 2IA0A 4H0EA 3OR1C 1MSEC 1UHWA 4RGSA 3RYRA 3QU6A 3H9GA 1SFUA 2ECCA 3DF8A 4BXXJ 3UR3C 3L09A 4AIJA 2ZJ2A 1IV8A 1USTA 1WPKA 4Y4RA 1BI0A 5DD8A 2Q8KA 4XIDA 2R7SA 1E3PA 1QVTA 3WTZA 3I4MJ 2LTPA 4C9YA 1LVAA 3E6CC 4M3FA 3S32A 4X6AJ 4EQQA 2DFEA 1FJLA 1GT0C 1RUOA 4A3GJ 3BQYA 3V7SA 1UHSA 3DPUA 4M6YA 3TO6A 4IHSA 3H5RA 5L3DA 3CMYA 1EJ9A 1QZYA 1B8IA 4B44A 1LE8A 4UVCA 2KJBA 3OYGA 2ELHA 1LQ1A 3E5XA 2JVGA 2W48A 3ABMH 2DMUA 3CDIA 2PLYA 4XKCA 3FMSA 2IP2A 2XAJA 4HX4A 3G2BA 1ZLJA 1A5JA 2LNBA 2M0CA 1LVKA 2KQRA 3CESA 5CVRA 1FSEA 3BG5A 2HFHA 2HXOA 2OZ6A 2A5WA 3FKJA 2VE8A 1MNMC 3Q5FA 2O6GE 3HOVJ 3W2WA 4RGRA 5J1RA 4FX4A 3OYBA 3C2BA 1OR7A 1GHCA 2M2EA 3FMRA 3TO7A 1WFXA 1SD7A 5K5RA 1IN4A 1ZG5A 3KETA 3MKLA 1X1AA 1X1DA 5D5VB 3U1KA 2F4OB 4A3CJ 1D1BA 2RDPA 3CJNA 2ZBKA 3A4CA 3K70C 2HDDA 2DA6A 1R1TA 1S6LA 1K83J 2CUZA 1VQKI 2E2HJ 4GGGA 1I39A 3HL2A 1OCCH 1MIJA 3OIQA 5JVGF 4LLNA 4NQWB 3OL4A 4ZZDA 2HS5A 3DEUA 1CF7A 3FXUA 1QHGA 2JUGA 2X0LA 3OOPA 3VSKA 3H35A 1TWAJ 3IV5A 4BY7J 5EYRA 3G1MA 2VQCA 2OJED 1SFOJ 4CCLA 2M0MA 2EV6A 4HF0A 1Y0UA 2RKHA 4F92B 3SHFA 4V2FA 1MBHA 4ZC3A 1UAAA 2XUBA 3JTHA 2XSDC 3ABKH 3EYYA 2H1LA 4QIWN 1VQLI 4MQ9F 3OS1A 2E71A 1HW1A 4C2MJ 4HRIA 2Y0SA 4A3DJ 2PMZN 4L5EA 3C2GA 3CJQB 4BXUA 5K7ZA 1IN5A 4HSTA 4IXAA 4FX0A 3E5QA 5LHHA 3FXKA 2E1MB 2CUJA 1DP3A 4XLCA 2ZXHA 3ZR8X 2OBPA 2JSPA 1QRYA 1X1BA 4RM2A 4IHXA 5KHDA 2QVOA 3GVAA 1SC7A 1BR1A 2XGXA 4XONA 5EEGA 4HX7A 1VQNI 1FMVA 3CLQA 4XRSA 4B09A 2QYOA 2HQRA 3SJMA 3DLLF 4KN7X 1NHAA 2HR3A 4MO7A 3HSFA 1WH5A 2NVTJ 1BI3A 1HBXG 4NQWA 2JRMA 2HXIA 4LIUA 5DDGA 1NK3P 2GA1A 5B1AH 2KIMA 2X6OA 1FX7A 3FIWA 1KQ8A 2CSOA 4QPQA 3S3OA 1DDNA 2WY7Q 4KITB 5CYVA 4ZYAA 3ZCOA 3SZGA 1OCPA 1UG0A 2DT5A 2HQAA 2CQKA 2GOMA 3R4KA 4A12A 5FRMA 4PJJA 4ANJA 2TRTA 2ZMEA 2PX9A 1O3QA 5F1RA 1MSFC 2WAQN 4R8HA 1TL8A 4XOPA 3JW4A 2EBIA 2R7TA 2YS9A 1ZRDA 4WWCA 4M71A 1KA8A 2P4WA 2Z9OA 2XHKA 1K7AA 2W1OA 2EV5A 2CH0A 4ENJA 2Y69H 2R7QA 1XGOA 3ZQHA 1ZRFA 2JA7J 5GTHC 4IEJA 2E2JJ 2VASA 3W2VA 2ZO4A 4IJAA 2R7VA 3HKZN 2EFOA 5HNHA 2W7NA 5AIQA 3DLAA 3DP7A 3Q0UA 1VQ8I 3PFYA 5ILSA 2WAEA 2NOJB 3WHBA 2KRHA 1RI7A 3I71A 3P9IA 1HCRA 4HPQA 4EGZA 2IA1A 4UHTA 2Y0SN 5DCMA 4XORA 1Z77A 4I01A 2MA3A 2X85A 3VSLA 1V55H 5FD6A 2I8DA 1K78B 4QTRA 1IRGA 3BZKA 1S7OA 2P7VB 2DA7A 1PVEA 1T98A 4A0XA 3OIOA 3BROA 2EFWA 1FTZA 2V9PA 1FIPA 1YW7A 2DYRH 2V4JC 4DYQA 4HV5A 3FKIJ 3Q9VA 4CZZA 1PJRA 4B43A 5ICCA 3BG6A 2D2WA 1X3WB 4CCKA 4IKFA 1IRXA 3PNYA 4G6TB 4HBLA 4YRVA 1DGRM 1RNLA 2UZKA 1HKQA 2Z1DA 5CVUA 1B72B 3OOUA 1ZHFA 2MLKA 1YIOA 2ZSIB 4W1UA 4BU2A 2A69F 4A3JJ 3PIPF 3CCQI 4IQ4A 2R5YB 3HB9A 4I99C 1B1BA 3ZMVA 2DBBA 4KYWA 3TOBA 4F55A 5HVQC 3WHCA 3HYIA 3PUFA 3GYHX 1GXPA 3H9JA 4X0GA 2KRCA 5K5QA 2DDAA 2HYJA 2MH9A 3ZN0A 5LD2C 3I59B 2FXAA 1Q1HA 3W6KB 3M8FA 2V1UA 2KDZA 1APLC 4Y17A 2EV0A 2DCEA 2CW7A 2XASA 3ASNH 2H1KA 3V42A 2JZYA 1SANA 3PNTA 1R71A 2XF7A 2G7UA 3J80Z 1T8IA 4DGWB 2O9LA 5EEHA 2GWRA 2O8XA 3BR6A 3HKZA 2QCOA 5JLWA 3VYUB 1WVRA 4QWQA 3QQAA 3V4GA 2C6YA 4UY8I 2CQ7A 2X4HA 1J59A 3OYKA 4V19K 4D7MA 3TQNA 1LDJA 3DEEA 1LEBA 1RKTA 2ZXWH 4ESJA 3S3MA 5HLGA 2V9KA 1ETWA 1G3YA 3J7ZI 4RMNA 3G71I 3L2CA 1GDTA 3IKVA 1FNNA 3OYCA 2ACJA 3CCRI 1PP8F 1AHDP 2V1XA 5JHUA 2JVHA 3VPRA 2A5YB 2IXSA 3LAPA 1VTNC 5J1UA 1O7LA 3ZQLA 3FM5A 2CW0F 2DDBA 1BN5A 1D1AA 1YOVB 2BVLA 3ZMUA 1I5ZA 1ZGJA 1YE9A 4B8XA 1OYYA 2LYCA 4PSXA 3RPQA 2R92J 1MNEA 2VXDA 3GFLA 3TDZC 4HQEA 1U9OA 2L7KA 1JUPA 3OS0A 2KRFA 1VF9A 1MZBA 4I76A 4BE0A 3QPHA 2P81A 3RCOA 3ABLH 4BE1A 2F5FA 3EUHA 1I6XA 2M4GA 3PSFA 5F08A 2IEKA 1HLVA 1FP2A 4JP0A 3MFKA 5EG0B 2BHYA 2BHZA 2X51A 4I98B 2FBIA 4EJTA 4HX8A 3R6SA 3JRCA 2GXBA 3J7YJ 3L9FA 5E79C 1W0TA 1R4NB 2ZB9A 5M5YJ 1OISA 1H9GA 1QNTA 3FK7A 2FOWA 3EDPA 4II3A 3H92A 5E1XA 2NS7A 5HDKA 3S17J 5LHGA 3F22A 2B9SA 1TTYA 4IHVA 2YX7A 1YRNA 1UJ8A 4XLPF 5FLXK 1WI3A 3PSIA 3HSRA 2JA5J 3MZYA 3KPHA 1MH4A 1W5TA 4AC0A 3FMQA 2IRFG 3JRDA 4YFNF 1MJAA 4XKVA 1AA7A 1D5VA 3PQKA 2A6TA 1J9IA 3AG2H 3JRIA 2KDOA 2KT0A 1IXRC 2LRDA 2OTJI 1NH3A 1LE8B 5M5XJ 2FA5A 2M8EA 3IP4B 1Z1DA 3LL7A 3OSGA 2UWMA 3GTMJ 2EQRA 3H0DA 3RSNA 2Y75A 1FZPB 1ZR2A 3T5XA 1R9TJ 3FZVA 3ECHA 5EG0A 3U1DA 4MQVA 3I55I 5D6EA 3B02A 4BQNA 4ZDPA 1W7PB 3BR3A 1FT9A 2PEXA 5EZHA 4P5OA 3F72A 2A3SA 1PDNC 1ZLKA 2CS3A 3WU2C 2MC3A 5FFXA 1IRFA 2HPIA 3BPVA 4QSHA 3EYIA 2DOFA 1QQIA 1DP7P 1TBXA 4UV9A 4OAYA 1ACIA 1WQ2A 4DNCA 3NQOA 1WJEA 2N8GA 5J8FA 3GTPJ 1IV6A 5IT9Z 3CCYA 3CF5F 3LSGA 2Z16A 1L0OC 2X48A 3ZPLA 3H3VK 2FOKA 3V8LA 4LITA 5ILUA 1VZ0A 2BE5F 1K78A 3I4PA 5CVJA 1ZELA 3E6BA 1ULYA 3WGGA 1FOWA 1Z3XA 4OIRF 5DCMB 2JWTA 2DMPA 4KN4X 4HLYA 2RNGA 2BW3A 2G0EA 4HV6A 5E3NA 1KYZA 3S8PA 2BZTA 5IT3A 2HZTA 3F8FA 1T2KA 5D8LB 3U2RA 2X6XA 1BJAA 4A69C 3CLOA 2BYVE 2GZWA 2P0WA 1K6OA 2K9QA 1NG7A 3E3VA 1S29A 2MH2A 5EJCA 1UB9A 2ELKA 3H0GJ 2VT3A 4I6ZA 1XD7A 5IY5H 1XMXA 2JJ7A 3BDDA 3OWTA 1LEAA 3PNVA 2KL4A 4UVBA 2QZ8A 4DQ2A 2NVUB 2HU9A 2KISA 2PJRB 1W5CC 3WE2A 1YQAA 3ZQQA 1WHUA 3GW2A 4HW0A 3T8RA 3QODA 1X1PA 2R5ZA 3DBHB 3V7CA 1E0EA 5ICGA 5A2QZ 1FYKA 1IN8A 4XLEA 2EZLA 2VBXA 3FF5A 2STWA 4BACA 2Y31A 2QQBA 3B6AA 3LNQA 3TOAA 1FOXA 1U5TA 2VI6A 3D0SA 1U2WA 2RQQA 3S2HJ 3LFUA 3DTIA 2VUMJ 3CDLA 3AL0C 1HDPA 4NC7A 4ZYDA 1JJ8C 3TL4X 3S3NA 5FJ8J 4D0PA 4RA2A 1EH7A 5D4RA 1JGGA 1IRZA 1HOMA 2WV1A 2OCCH 3BTCA 5FB2A 3BJ6A 3H36A 4II2A 3OYHA 2DFIA 3R0AA 2W00A 3Q0WA 1G3WA 4N9IA 3EUKL 1ZK8A 1I3QJ 3S1NJ 4ZTFA 1WJBA 5E3LA 2OQRA 5HODA 2GLOA 3ZQGA 3M7GA 3SEZA 1UMQA 4BYYA 4Z6YA 4CHUA 1XGNA 1OCRH 1O3SA 1T6SA 3ZGKA 3T1BA 1NG6A 5H20A 4WF2A 4UB6C 4G7OF 1VQ4I 1B4AA 3ERED 3G1OA 2DQRA 1H89C 2L9RA 5H6RA 4GXOA 4F52A 2STTA 5C4XJ 1B59A 1LUJB 2ID3A 4CSWA 3DWLE 2EINH 3IH4A 2TDXA 3KYCB 4ESFA 2VIXA 2HNHA 4NC6A 4L5IA 1QZEA 4R79A 1PUFA 1RZ4A 4M74A 1GXQA 4A3BJ 2DI3A 1WGXA 4XK4A 2QWWA 3UNGC 4BKXA 2EIMH 1R23A 1UELB 2XDVA 4B48A 1HXDA 1W1WE 2ADUA 3Q3SA 5IYBJ 2HI3A 1WZ2A 1S5LC 5LFAA 1K4TA 1T33A 3M8EA 4XMYA 4UUSA 3DQVC 2L7FP 4ASNA 2BXYA 5FGMA 3OYDA 2COMA 2O3FA 5KCMA 1T39A 1P9QC 1ODDA 1U5TC 3D5LA 1Z6RA 3KP5A 1LPQA 5J40A 2PFBA 2XVCA 5FKMA 4HNUA 1OPCA 4A0YA 4N0BA 1D8KA 1WCMJ 3Q0VA 4PJLA 4UB8C 2CFOA 3RKXA 2JA6J 2O03A 3CC4I 3WE3A 2RN7A 1RR7A 2QM3A 3SDBA 3FBNB 2ID6A 3HDDA 4A0ZA 2R4GA 2DJIA 3L7WA 3SYTA 4S05A 1PUEE 1HC8A 3RIRA 2GOXB 1XS9A 3OYLA 2A07F 1VQ6I 3WODF 1FBSA 2NOGA 2YX4A 1LJ9A 3ESWB 1XSXA 1H8AC 2B0LA 2GM4A 4FETA 4F91B 2MSYA 5IOZA 1IF1A 1QBJA 2W4SA 1T0FC 1U0JA 4IPAA 3BY6A 2HQ5A 3G6EI 2E34A 3PJRA 4L9VA 3OY9A 3QRFF 4B1RA 3HUGA 2A68F 2HGCA 2KZGA 2LOOA 3GZ5A 2MW8A 1MMSA 1DU6A 1BL0A 2OQGA 2IA2A 2PMUA 2EILH 5E1WA 2DA1A 2IGMA 4MTDA 1XDUA 3VODA 1XGMA 5KNLA 2L7ZA 2L5QA 2FBKA 2CUEA 1X2MA 1XTAA 3L1PA 2DJNA 3K6GA 4M72A 3J81Z 1I1SA 5FKKA 3C3WA 2WADA 4ZYHA 2KIFA 1Z0XA 4O3MA 3HXLA 3GX4X 4KISA 2QENA 1HQCA 2ELJA 1HSTA 4WXHA 4EEFG 2VOPA 1YFHA 4KT5C 3KP3A 3C2HA 2DFHA 3GLLA 4I02A 1ZGAA 1LB2A 2IBDA 2NNYA 3ABTA 4RAYA 4DBRA 4EGYA 3S15J 3HM5A 4HG2A 1W7PD 2BV6A 4HQMA 2R7UA 1LFUP 4AD9A 4AIKA 6PAXA 4PSWA 1Y1WJ 3BT9A 1DGWY 1YITI 2DODA 5BPIA 4A3LJ 1JKOC 2E1CA 1R4MB 4XLNF 2XKPA 3CCSI 2L4MA 3M1CA 2XGCA 4G12A 1B9NA 1YW8A 1YTYA 4E7ZA 4FQGA 3V8JA 1KYWA 2VOOA 3JSPA 2KLOA 1QPMA 5IOYA 1OKRA 1T38A 4BJ6C 1EA3A 2RREA 3A02A 4EMSA 5L3CA 1YLFA 2M3AA 4IHYA 5CJ9A 3PM1A 3H3UA 2M5WA 1Z7UA 2M87A 2X6YA 3OS2A 4BY1J 3GF2A 1RPWA 1W0UA 2DPDA 5GPAA 2YPRA 4EJUA 1ZG1A 4A3EJ 2W25A 1TQPA 2IS4A 1HKTA 3EQLF 4Y3OA 3BZCA 1POGA 2FNPA 5IYCJ 2K5CA 3K70D 2LKSA 1YX5A 2PG4A 3CTAA 1X3ZB 5LHIA 2P8TA 2Z5UA 2PI0A 3CCJI 2VC0A 1LDKB 4KIGA 5F0CA 1CQTA 2LR8A 1RRJA 1XN7A 2K9SA 4DYCA 3DPTA 4B3XA 1QU3A 2QKMB 2VXZA 3MWMA 3LA2A 4PGHA 3J7AO 3F6VA 3JRAA 1GVJA 1IDZA 3W3CA 4G7ZF 1Z3YA 4EM2A 2WTEA 1BC8C 4Y52J 4OU0A 3GMEA 4Q5SF 2CMPA 4CICA 2NS8A 2BW3B 3C18A 4EV0A 1O4XA 1P4AA 1K4SA 5H6QA 3JCUC 5HNFA 1VFCA 2OF7A 5JR3A 3BC8A 5E20A 4IHTA 4YFXF 1WH7A 2UUZA 4RGXA 5D8KB 1VI0A 2JA8J 1AWCA 3VWBA 4XKBA 5F1JA 4CCNA 4HEA2 4FTHA 3K9TA 2O8KA 4WK8F 4M9ZA 1IGNA 2E7WA 1ZGWA 2ZXIA 1NK2P 3JRHA 1M1EB 2H09A 2YR2A 3VB2A 3F0CA 2ZJQF 2L54A 2R7FA 2H6BA 2CV0A 1W7PA 3E5UA 1J09A 5IP7J 1X4PA 4G6DA 4XLHA 5KK1A 2Q2EB 4PFOA 1FBUA 3BZ6A 1H0MA 3QAHA 3SDGA 2FBHA 4DW6A 3JRBA 1AOYA 2OD5A 5HLHA 5M3MJ 2LY9A 1JXSA 1MBEA 1WWXA 3QYBA 2IW5A 2V6CA 3IH3A 5F0FA 3CZ6A 2D1VA 2BOLA 2GXGA 4KJZA 2WAQA 2JSCA 4CXFA 4PUSA 4Y13A 4A6EA 2UXNA 3O6BB 1JGSA 2KZVA 2QSFX 4ZDLA 2DPUA 4RBOA 3OIPA 3SQNA 3GLXA 1YX3A 3CCMI 4XN3A 2DOAA 2AS5F 3QYEA 2JUCA 1TQIA 2IGKA 3QYFA 2K9MA 3DTKA 3FDYA 2ME6A 1V5GA 4BXFA 1YRNB 1Z67A 5KAIC 3MEXA 2Y30A 3KEYA 3SEQA 3HHHA 1DPUA 3CO7C 1MMNA 4A93J 1SD6A 4BH9A 2K85A 1FOKA 2W85A 3F9KA 1BW5A 2ME0A 4HF1A 4RB1A 2E7XA 2HYFA 2GXAA 2QQ8A 2NXNB 3K4JA 2M7BA 4DJAA 2V1DA 2HOTA 2IGNA 5DD4A 2AXLA 4YFKF 1X58A 2F48A 2AHQA 1F36A 3MD2A 3IRRA 1Z9CA 2HEOA 1O3RA 5D6FA 2ISYA 5K5OA 1O3TA 1N78A 2YUSA 4OIPF 3V7RA 2UV1A 2M7AA 1R5GA 4NB5A 4BQQA 3AKZA 3P9CA 1QZZA 1YHQI 3LOCA 4JK1X 3PUBA 1IC8A 4Q47A 5D5XB 4D5FA 3AL0B 2R7DA 3DCFA 1S3JA 1MBGA 1J7KA 1HF0A 1P2FA 5JLXA 3K4CA 4LIVA 4PJNA 5E8GA 3CC2I 3EUHC 2WB1N 4XOTA 1IUYA 2EH3A 3ULQB 2XRLA 3HPGA 2ZXJA 1JI8A 1S7EA 5F27A 4O6JA 4C2TA 3DBRB 2D5VA 1TNSA 5KVRA 5EGOB 3S2DJ 3BTLA 4AUXA 2VN2A 2LBFB 3AFHA 2PMZA 2MC4A 3V8KA 3KZYA 1KQ9A 1UCRA 2CG4A 3K2AA 3RQ4A 4J19A 1ZREA 4XRSG 3BR5A 3A0BC 2IS6A 3NWTA 2LLKA 1SFEA 4W97A 1QPIA 4OIOF 4H4KC 2LKXA 3VYSB 3BCAA 1LFPA 2MG4A 2VB6A 3ISPA 4WX9A 1HSJA 1G59A 4CO8A 4NBQA 5BOXA 4ZDOA 2LC2A 2X6WA 2CV2A 2RAEA 3DFGA 2K27A 4JOMA 3EUAA 3L00A 3OYIA 2HDCA 2EIJH 2DA3A 3IUOA 1JHHA 4IF4A 2ZNYA 1FWZA 2FX0A 1IXCA 2M34A 3CQZJ 3LSHA 1XPXA 2CO5A 1A36A 3W6JB 1A35A 4DYRA 2VJJA 1QHHD 1G4DA 1KGSA 1ETQA 2G9WA 3BR1A 5HDGA 4G6QA 3IAS2 2FNAA 2R5YA 2WY8Q 4LOCA 4MGRA 3RKWA 3GFMA 1MDMA 4CCMA 2Y2ZA 2L7MP 3HRUA 2E5NA 1VQ9I 1EH6A 1F4KA 3GEZA 1B72A 2JMWA 3WTVC 4OMZA 4LG0B 3QP6A 3NARA 3OMYA 2EZIA 1S9HA 5J8CA 5E17F 3NEUA 2V26A 3KCCA 1BIAA 2QEXI 2VODA 1J0RA 3CF2A 2D1HA 2OV7A 2Y9ZA 3KLNA 2ISZA 2E35A 2EB7A 3MKYB 4UUVA 2VKEA 3DTEA 5F0HA 3IRQA 1GV5A 3DKYA 5E3MA 5CQGA 2FMYA 3A01B 2HWVA 3ERMA 4C3IJ 3CMAI 2LP0A 4PJMA 3E7LA 3F8BA 1MBFA 5LRRA 3ZQIA 3RQIA 2LY2A 2NRAC 4I2OA 3S14J 3H1CA 1HKSA 2HVRA 2QF7A 2ZFWA 4RLFA 1ETYA 2AO9A 3L2QA 1BA5A 1GLNA 3FHNA 4CYCA 4MHGA 1S72I 2R7ZJ 3CCUI 5BPDA 1FTTA 5LGUA 3FWEA 5ICEA 4RB3C 1N77A 4GRIA 2E1NA 1OCZH 3HRTA 1BIBA 3IAM2 3WGHA 2GIZA 2E1MC 5GAEJ 2HKOA 3CMEI 2K4JA 2XAHA 2MYSA 2WBMA 2P6SA 2BY0A 4M3EA 1RUNA 1FC3A 2NNNA 4ZYGA 1JKPC 2AQFA 2M30A 1Q1VA 3FHZA 5HOOA 5FD5A 4EVIA 4OIQF 2VBZA 1SMYF 4HSRA 1TZLA 4NC8A 2CGPA 4LK0F 1TWHJ 1UG2A 1LKXA 1OLTA 3E6DA 2G7HA 2Z3YA 4QLCU 3CO6C 5IPAA 1ETOA 2LF8A 2PMHA 4XSXF 3ZRGA 4BHBA 1ZH5A 2JN6A 3QWLA 3P7NA 4F7ZA 2VJ5A 1KONA 3E97A 2EIKH 1XSDA 3FXMA 3K69A 5M3FJ 4L9JA 3WTSC 1R58A 3GTLJ 3HZJA 4LJZF 2I5UA 1WKMA 2CQXA 2WV0A 1X4OA 4ESBA 2VC1A 5BNGA 3OYMA 1I3AA 2L9VA 5DM7F 1L3LA 4PGGA
chains in the Genus database with same CATH topology
1LUJB 1T08B 1M1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUJ B;  1T08 B;  1M1E B; 
#chains in the Genus database with same CATH topology
 5D4S A;  3JTG A;  5FRO A;  2XAQ A;  3BPX A;  3LSM A;  2K9L A;  5J3L A;  2XKO A;  2CYY A;  2UXX A;  3K4N A;  4C3H J;  1BC7 C;  4KMF A;  2VQL A;  3I56 I;  3ZMD A;  1ZQ3 P;  3H5N A;  5IT9 K;  2PBI A;  1D0X A;  2XPV A;  3S93 A;  1K6Y A;  4YIR X;  2IS2 A;  3RPU A;  3CD6 I;  1IO2 A;  4U7D A;  1JT0 A;  2KKO A;  1SVL A;  3QOP A;  1XCV A;  2XAG A;  4BEH B;  2CRG A;  3I3L A;  3BG9 A;  1HDD C;  1G6N A;  5DV5 A;  4C3J J;  3TDU C;  3GBG A;  2B7E A;  2K3P A;  1A04 A;  4BAY A;  5E3O A;  1V4R A;  4E7L A;  3PFI A;  2IAI A;  1QGP A;  2CQQ A;  3LWF A;  3RI4 A;  2RVC A;  4YEL A;  4A3I J;  4HA8 A;  3W6V A;  4M3G A;  4E6K G;  1EH8 A;  4KIC A;  4UUT A;  1RR8 C;  2OTL I;  3LSJ A;  2M8G X;  4CYD A;  1MMD A;  1OYW A;  4PDK A;  3WU0 A;  2MGQ A;  3ZMZ A;  9ANT A;  1R1V A;  3SZT A;  5AIP A;  1WI9 A;  1BR2 A;  3FXR A;  5D5W B;  1X19 A;  2R3S A;  2ZSH B;  4C2U A;  1XMA A;  5M5W J;  4IRI A;  1WRJ A;  4FHT A;  3W2A A;  2QUF A;  2L4A A;  1CF7 B;  3F8N A;  2FRH A;  2FQ3 A;  3CUQ A;  3P5J A;  4M9X A;  3NRV A;  5DM6 F;  1X1C A;  3HOT A;  1LNW A;  4JX5 A;  1RES A;  2F2E A;  3DV8 A;  4V2G A;  3C1D A;  4A5N A;  4U0Y A;  5DUI A;  2ECB A;  3ASO H;  1MJ9 A;  2FU4 A;  2BY2 A;  3F21 A;  3MKZ A;  4KNY A;  2HPM A;  4BS9 A;  2FUG 2;  2FML A;  3I9V 2;  2LD5 A;  5J4Y A;  2CV1 A;  1WJD A;  4AU7 A;  3BG7 A;  3FXQ A;  3KP7 A;  2X1E A;  2ZC2 A;  2LVS A;  5HLT A;  1USS A;  1P4X A;  2EFP A;  4P9F A;  3HOW J;  2OA4 A;  5FFZ A;  4IHW A;  1YS7 A;  2QQ9 A;  4AYB N;  1FY7 A;  3UKG A;  1U8B A;  1T08 B;  3QOE A;  4DZJ A;  2F6C A;  3BR0 A;  3HIF A;  4U0W A;  3ZQ7 A;  2CFX A;  4DOZ A;  3IKT A;  4LGW A;  2JPC A;  3U9G A;  2QLZ A;  1Y1V J;  4RGU A;  3MQ0 A;  2IT0 A;  4NDL A;  4WCG A;  3NAU A;  4RB0 A;  1IUF A;  2LKP A;  1IN6 A;  2P5K A;  2LK2 A;  4MFD A;  3K7A J;  2KJC A;  2OCE A;  4KIB A;  4C30 A;  4MFE A;  4EM0 B;  4LG3 A;  2QSG X;  5CPR B;  1GVD A;  2I10 A;  3K1N A;  1IW7 F;  1TLH B;  4IRG A;  2YU9 J;  2V1N A;  4DZP A;  2VPL A;  3GUD A;  1N25 A;  1B8I B;  4U87 A;  1C0W A;  3HOS A;  4Y33 A;  1YJN I;  4ENN A;  2ZKZ A;  2HZD A;  3L2V A;  1ZAO A;  3BTJ A;  3DPL C;  2DLL A;  3S16 J;  4MTE A;  3ELK A;  4XNF A;  4HLX A;  1DU0 A;  4P96 A;  2E36 A;  2XIG A;  1Z6T A;  2XSJ C;  1OR7 C;  1TW2 A;  2WAF A;  4JQF A;  4L0Y B;  4YII A;  3N05 A;  2EJR A;  1T56 A;  4GYG A;  4L5J A;  4ZYE A;  3KIO A;  3LMM A;  4YEJ A;  4U7B A;  2PJP A;  1D1C A;  3O2P E;  2VBW A;  3FXL A;  5FKN A;  4XLF A;  4FAS D;  1HW5 A;  5B1B H;  5J6X A;  4WXD A;  1AU7 A;  2F5D A;  4ETS A;  2QA4 I;  3JR9 A;  3MZ8 A;  2MFZ A;  3KZZ A;  1ZR4 A;  1E3H A;  2ZME C;  3GTQ J;  3LST A;  1KU3 A;  4KMU X;  3TKY A;  4M6V A;  3HJE A;  5L3B A;  5DUK A;  3KEO A;  1STZ A;  5ICF A;  2DA2 A;  2L0K A;  2X1D A;  3M8J A;  4BBR J;  3BJO A;  1UHM A;  4PZJ A;  4PK4 A;  1PYV A;  3CC7 I;  2J5P A;  2MLG A;  3BJA A;  3NWS A;  2VKH A;  4N9H A;  5ERI A;  4B4C A;  3K1P A;  2VQG A;  2OAZ A;  3KE2 A;  4XSZ F;  3CJR B;  2ZJP F;  2W24 A;  2DMT A;  3A2K A;  4EM1 A;  1R36 A;  5LGT A;  2BY3 A;  4CDG A;  1TT0 A;  3EET A;  5JFR A;  4GDF A;  2DQL A;  3RPU D;  5ED4 A;  4X1E A;  1MH3 A;  1YI2 I;  3R60 A;  1YO5 C;  1F9N A;  5BMZ A;  4ENM A;  1D0Z A;  3DKW A;  3KP4 A;  1H88 C;  1BJZ A;  3MN2 A;  4P55 A;  5HS9 A;  1AKH B;  5JVT A;  3TP3 A;  4LD5 A;  2H8R A;  1AKH A;  3F8C A;  4I0A A;  4XIC A;  4M9S A;  5J47 A;  1HW2 A;  4AVP A;  1JTX A;  4Y15 A;  3E1S A;  4JX6 A;  2Z2S B;  4BQA A;  4L0Z B;  1BR4 A;  4A3F J;  2MD0 A;  2B63 J;  3GFJ A;  3OYA A;  3RZD J;  2F4I A;  1E3O C;  2IJL A;  1ENH A;  2H6C A;  3G3Z A;  1D3Y A;  1G3S A;  4U88 A;  1V3F A;  4J00 A;  3S1M J;  2ZCW A;  2Z99 A;  5TRD A;  3Q9S A;  2VQH A;  5K7H A;  3GTJ J;  1N75 A;  4BHP A;  3G73 A;  5FRN A;  3ZQC A;  1XDS A;  1XB4 A;  4MIM A;  1SEU A;  3HG9 A;  4A3M J;  3KYD B;  2OPT A;  1U78 A;  5GAD J;  1X3U A;  2R7W A;  5CVV A;  5CKT A;  3RTR A;  2VJI A;  1SAU A;  2P5V A;  4BBS J;  4G7H F;  2HVS A;  2VPR A;  2DN0 A;  2GIV A;  3TW6 A;  1OYI A;  4HNT A;  3SFI A;  1VQP I;  3AG4 H;  2V79 A;  4PFP A;  2FJ1 A;  4S04 A;  3OYJ A;  3CCE I;  4IX7 A;  3GWZ A;  5LEK A;  2XRN A;  1TW3 A;  4G9Y A;  4Q48 A;  1JJ6 C;  1SD4 A;  2XB5 A;  5FKO A;  1DQU A;  1JHF A;  4LB5 A;  4G94 A;  2DT6 A;  3JAM Z;  1ETV A;  2DK8 A;  3KLO A;  3HOY J;  1BOA A;  1F43 A;  2FEZ A;  5FLX Z;  2QBY A;  4OIN F;  5A2Q K;  2DTR A;  3HSE A;  3KFW X;  2FE3 A;  1FP1 D;  2KHM A;  5HDN A;  5TGT A;  3KP6 A;  3ML6 A;  1Y0N A;  4IL6 C;  4GO1 A;  1J5Y A;  1O57 A;  2XGE A;  2O5R A;  4JYK A;  4XL9 A;  2GA2 A;  2W84 A;  5GPC A;  1WJC A;  1YS6 A;  4LG0 A;  4IOA F;  3IHU A;  1V54 H;  4UVA A;  1BI1 A;  5LRS A;  4ENK A;  3LSI A;  3HRM A;  3WU1 B;  3H5A A;  5HLI A;  2JT1 A;  5IP9 J;  3LA3 A;  4XRF A;  5IYD J;  3K0L A;  2W57 A;  4E4H A;  3GO5 A;  4KFC A;  3RJP A;  1ZN2 A;  2AQE A;  2HTS A;  5J1Y A;  1T0F A;  3DEW A;  5LLQ A;  1A6I A;  3S2W A;  5CQE A;  2Y0M A;  4IVN A;  3MKW B;  2EFN A;  4G8X A;  1P7J A;  1OFC X;  3HC7 A;  1JKR C;  4BE2 A;  3MZH A;  5LEJ A;  3AAF A;  1FLI A;  2P5L C;  3ZXS A;  4D9J A;  2JK3 A;  2R7X A;  5LGN A;  1V5E A;  3KYL A;  1R00 A;  2MD5 A;  4J01 A;  3TW7 A;  2K02 A;  2QBY B;  2LY1 A;  4UV8 A;  3ZP5 A;  2E5Z A;  3ECO A;  4AWX B;  3K2Z A;  1V5F A;  2BEO A;  1R7J A;  3KP2 A;  4B3A A;  2DAO A;  1T95 A;  1U8R A;  4HAM A;  1VND A;  4F93 B;  2E19 A;  1JTY A;  1J2X A;  1QO0 D;  1WSU A;  1R6R A;  3RDI A;  1Y56 A;  3VFZ A;  1MJB A;  3LA7 A;  3I58 A;  5TIS C;  5DTD A;  4HDU A;  3ZN1 A;  2HOA A;  3HGG A;  3GCM A;  5AON A;  5F6F A;  4XRM A;  2VON A;  3HOU J;  3G1L A;  1SFX A;  5D5U B;  4CUG A;  2LDU A;  5EDN A;  3IH2 A;  3LSK A;  3JAM K;  2M1B A;  4I0B A;  3K4M A;  1UFM A;  2OU2 A;  3HGY A;  4Q4Z F;  4AYB A;  4BUP A;  5DEQ A;  1WJF A;  4DBQ A;  2HOS A;  2Q0O A;  3QU3 A;  3GZ6 A;  1XX5 A;  1K61 A;  2VL8 A;  2WA0 A;  1KU7 A;  3K4B A;  2DA4 A;  3PIO F;  2QSH X;  2YSR A;  4KA4 A;  3L2U A;  2M4K A;  3DKX A;  3IWZ A;  3B73 A;  5JHF A;  4XKW A;  4CCJ A;  1OMI A;  2RNJ A;  4CGZ A;  1K79 A;  5H2F C;  4S0H B;  3HRS A;  2RGV A;  1ZRC A;  1SFK A;  2LRE A;  1E17 A;  1OQY A;  3OYE A;  1ERD A;  3CP8 A;  3KX2 A;  5JI6 A;  4N4N B;  2DTZ A;  2X9D A;  1IXS B;  4FE4 A;  4UNO A;  2LG4 A;  5LBQ A;  3GFI A;  1J75 A;  3MCZ A;  4A2U A;  2CW8 A;  1TP4 A;  2OUM A;  1JUS A;  2COB A;  3R0J A;  2VKV A;  1KU2 A;  3F3X A;  1ZKG A;  3H9Q A;  2BXZ A;  4HNV A;  3ONQ A;  2XC7 A;  3M1E A;  4MEY F;  3MVP A;  3I53 A;  3WTT C;  3OYN A;  2KFD A;  1JT6 A;  2YU3 A;  1XCB A;  3OL3 A;  5B5E C;  2CU7 A;  2DYS H;  3TMO A;  3JSO A;  1SVM A;  2A05 A;  2NYX A;  4OOI A;  3I0T A;  3FXO A;  2ZNZ A;  2CJJ A;  5DCF A;  1ZAR A;  1FEX A;  3VEP A;  4IZZ A;  1Y8R B;  2F5E A;  2F4M B;  2WB1 A;  1G3T A;  5K1Y A;  2BVM A;  2HVQ A;  5EZG A;  4KUM A;  4E7K A;  3QPL A;  4LLG F;  3COA C;  2XAU A;  2M9H A;  3J80 K;  5EF6 A;  4EAT A;  5GAH J;  2QQA A;  4HF2 A;  3PO2 J;  1XSV A;  3U21 A;  3WTW C;  3FIS A;  3BLY A;  3HTS B;  2K86 A;  2QKL B;  4EJO A;  2RV8 A;  1QVU A;  2AXT C;  2KP6 A;  5FO5 A;  4BL0 B;  4Y7N J;  2L9S A;  3BP8 A;  3DXJ F;  4ON0 A;  5CLS A;  3RZO J;  3N97 A;  3ZQF A;  1NTC A;  2DXI A;  1DUX C;  4GFB A;  4UUS B;  2BY1 A;  3CUO A;  1REP C;  3AG1 H;  2V7F A;  1IJW C;  2HKX A;  2R93 J;  4F3Q A;  1SMT A;  2ICW G;  1U9N A;  4EJV A;  3HTU A;  1A6Q A;  2D45 A;  4BGD A;  2VBY A;  3PQJ A;  5E8I A;  3RYP A;  3L2W A;  4NNJ A;  4L18 B;  3A1Y A;  1TQM A;  3PL8 A;  3E0J B;  1PUF B;  2X1C A;  1Z91 A;  2MAB A;  1KZH A;  2BGC A;  2M45 A;  5HS8 A;  2IPQ X;  3EPZ A;  1MMG A;  1OJL A;  5B3S H;  4A3K J;  2DU9 A;  3HHG A;  2VJ4 A;  2HQN A;  1W36 C;  2H27 A;  2ZFU A;  2H94 A;  2JA2 A;  4RAG A;  5DS9 A;  1FIA A;  1P92 A;  1P7I A;  3IC7 A;  3O8H A;  4BNC A;  3FM3 A;  2DMN A;  2FF4 A;  2CUF A;  1IN7 A;  3F6O A;  3TED A;  3A01 A;  4ZZL A;  1SD5 A;  2TCT A;  1FBQ A;  2RQP A;  2XF6 A;  4HYE A;  4YIF A;  1R5I D;  4IQJ A;  2HYG D;  5BS6 A;  1BBY A;  4I7H A;  4KT6 A;  1ON2 A;  3M07 A;  1MBJ A;  3JRE A;  3BTI A;  4BEH A;  4BHC A;  4N4O B;  1XC5 A;  1MBK A;  3GZN B;  1SAX A;  2ZME B;  2DMQ A;  2NVQ J;  1YJ9 I;  1ZYR F;  2R7O A;  1XG1 A;  1HA8 A;  3TGN A;  2KPM A;  5C3E J;  3LQQ A;  5B66 C;  5L3F A;  1G8X A;  2RC4 A;  5J4V A;  5GTI C;  2CQN A;  2A6H F;  2OZU A;  1A31 A;  4FCY A;  1I1G A;  1VQO I;  5BQT A;  1R5H A;  3D5R C;  3CCL I;  4M3B A;  1U5T B;  2HDW A;  1CGP A;  3B6C A;  3T0Y A;  4BJ5 C;  1FYM A;  1R49 A;  2K4B A;  3CUQ B;  3OV8 A;  4AID A;  5E1Z B;  1DPR A;  5C4J J;  3HEF A;  1U3E M;  4U0V A;  2V6E A;  3L2R A;  5ILV A;  4K2E A;  1RC9 A;  3BWG A;  3DU5 A;  3VYR B;  1UZC A;  4HZF A;  2WC2 A;  5F04 A;  2NS0 A;  4P1W A;  2O7O A;  4JBA A;  2OC6 A;  3MMY B;  1SVO A;  3CCV I;  1G2H A;  5IP6 A;  1JUM A;  2KMU A;  1KU9 A;  3WG7 H;  4PJ0 C;  4LMY A;  3SFZ A;  2Y48 A;  3FX3 A;  2IVM A;  2ZJR F;  4MNU A;  2LF7 A;  1MGT A;  2JQ7 A;  1MW7 A;  2F5C A;  4OAZ A;  1FMW A;  1ZTR A;  4ZJZ A;  1BW6 A;  3H3Z A;  1EF4 A;  2LBF A;  3D5S C;  2ESN A;  3F8M A;  3A0H C;  3CP2 A;  1XMK A;  2MBF A;  5K7F A;  1TT5 B;  4BQO A;  3CUQ C;  3DU6 A;  3QPS A;  4GCV A;  3WG9 A;  5L3E A;  4E70 A;  2NAZ A;  2P7C B;  3F23 A;  4BDZ A;  2ETH A;  1XGS A;  3K4K A;  1TWF J;  3CDH A;  5L3G A;  2VE9 A;  2XAF A;  2DFF A;  3KZI C;  3HOX J;  4WXC A;  2PN6 A;  3K1M A;  4RB2 C;  1R1U A;  1F1Z A;  3S1Q J;  1TNT A;  2K40 A;  3HUG B;  4A6D A;  2XPW A;  4M6X A;  4XQF A;  4PCQ A;  4ZTJ A;  1I50 J;  1Y8Q B;  4RAF A;  1D0Y A;  4A5M A;  2ESH A;  4YG2 F;  1FPQ A;  4XBF A;  2E2I J;  3MAJ A;  1KQ0 A;  1MKM A;  3BQZ A;  4I09 A;  4XR6 A;  2QGU A;  3RKY A;  3R61 A;  3HOZ J;  2HOE A;  2KIQ A;  4RAZ A;  1QA6 A;  1YIJ I;  3J81 K;  4LK1 F;  2LSO A;  2O61 A;  3RKQ A;  4OMY A;  3ABU A;  2P6T A;  2Q1Z B;  1U6G A;  1LDD A;  1LFB A;  2F5V A;  3I54 A;  2VLA A;  2XF5 A;  3VOE A;  1D8J A;  1W4M A;  2A61 A;  5GP9 A;  1X2N A;  4ITV A;  3JRF A;  3I64 A;  4LB6 B;  4L9N A;  4ZH4 F;  1I27 A;  4KIF A;  2VT2 A;  2DA5 A;  4M73 A;  1MDM B;  1ETK A;  1VQ5 I;  2L02 A;  3CJT B;  4HOB A;  1R22 A;  5F64 A;  2CWE A;  5HS7 A;  3GTK J;  2L01 A;  3M4O J;  2IGO A;  4XN0 A;  3M9A A;  4RDU A;  1GV2 A;  1B9M A;  1IZ1 A;  2FD5 A;  1MND A;  4LLL A;  3TO9 A;  5GAG J;  2Z33 A;  1IG7 A;  3BCB A;  3C7J A;  3JRG A;  2R7R A;  1ONV A;  2JPB A;  2VKD A;  1PP7 U;  3M3Y J;  1GUU A;  1YYV A;  1FSH A;  3G4S I;  3TBI A;  4ABZ A;  2K3F A;  1FYL A;  1Z7L A;  4D7N A;  1YJW I;  2DK5 A;  3VYT B;  3GTO J;  4LFU A;  4JX4 A;  2BBY A;  4IRH A;  2PQ8 A;  1MD0 A;  4XM3 A;  4QPO A;  5KAF C;  3OSF A;  4CZC A;  3P9K A;  4BJT A;  1EKE A;  4P9U A;  2NVY J;  4FT8 A;  4RLQ A;  1ETX A;  2EFQ A;  3BOQ A;  4CYC B;  1FOY A;  2XB0 X;  4EJW A;  1D5Y A;  2EZK A;  2Q2E A;  1S8N A;  2K7L A;  4R1H A;  3LSR A;  3OYF A;  2A6E F;  2IS1 A;  4CA0 A;  2HTJ A;  2O0Y A;  1Z21 A;  4E7H A;  2GAU A;  5EGO A;  4AVZ A;  3BR2 A;  2FSW A;  1E2X A;  1Y6I A;  3WGI A;  3K10 A;  3WTX C;  3K4L A;  3O3K A;  3SZP A;  2K9N A;  4AM3 A;  1S7A A;  2GQQ A;  1W36 D;  1WJA A;  3KEQ A;  4AIH A;  3FXJ A;  3VDX A;  4NUB A;  3TP0 A;  1OCT C;  4MEX F;  1Z05 A;  5EEA A;  3DBL B;  3LQR A;  3A03 A;  2W82 A;  2V9V A;  2E1O A;  4OWR B;  3QPT A;  1JE8 A;  3I5U A;  2FQ4 A;  4M3D A;  3ROU A;  4GYI A;  4FIS A;  1O7F A;  5FLV A;  4B47 A;  1H9T A;  1MMA A;  3CMM A;  1BOB A;  2DOE A;  2DW4 A;  3REO A;  3ZMT A;  2Y9Y A;  2XPU A;  4FE7 A;  3LSP A;  3AG3 H;  3IWF A;  3LFK A;  2XRO A;  4O5V A;  3ZOB A;  3BG3 A;  4NHJ A;  1ITY A;  3O8G A;  1ZG3 A;  3OR2 C;  1YW9 A;  4E7J A;  2L9N A;  4UXN A;  2XV4 S;  3FBI B;  4XLA A;  1YG2 A;  2JTV A;  2R5Z B;  1ORK A;  1B6A A;  3T8T A;  4E7I A;  4IOC F;  3N4M A;  1Y39 A;  1P6R A;  1VQ7 I;  1I6H J;  3X2Q H;  1VQM I;  2NVX J;  1RET A;  1RKW A;  3I4N J;  2EWN A;  1EV7 A;  2EZH A;  2PJR A;  3WTU C;  1TWC J;  1TC3 C;  2J5O A;  2KIU A;  4CCO A;  4D5C A;  3S1R J;  4HDV A;  3PO3 J;  2L3D A;  2DT7 B;  3D1N I;  3LAJ A;  2XGD A;  2R0Q C;  2L2O A;  3J7A Y;  5DYM A;  3WTY C;  3GXO A;  1TWG J;  3HBL A;  4RS8 A;  4IO9 F;  1JKQ C;  2LH9 A;  1RIO H;  5E18 F;  1P4W A;  1F5T A;  3I59 A;  5FKL A;  4CH7 A;  5FLM J;  3QP5 A;  3IL2 A;  3GTG J;  3ZMS A;  4E7S A;  2LFB A;  5CVI A;  2LMD A;  1WJ5 A;  4D1Q A;  1ON1 A;  1BI2 A;  2EA2 A;  4BDY A;  2EK5 A;  2JRT A;  1IAW A;  2GBY A;  3E6M A;  1BM9 A;  4DIQ A;  3FK6 A;  3SXY A;  3HPH A;  4TV7 A;  4RM3 A;  5C44 J;  4Z2Y A;  1IDY A;  2H8W A;  1W5S A;  2EA4 A;  4MLO A;  5TJJ A;  2DO7 A;  2E60 A;  2EPF A;  4KDP A;  4L9T A;  2WWY A;  1OCO H;  2IA0 A;  4H0E A;  3OR1 C;  1MSE C;  1UHW A;  4RGS A;  3RYR A;  3QU6 A;  3H9G A;  1SFU A;  2ECC A;  3DF8 A;  4BXX J;  3UR3 C;  3L09 A;  4AIJ A;  2ZJ2 A;  1IV8 A;  1UST A;  1WPK A;  4Y4R A;  1BI0 A;  5DD8 A;  2Q8K A;  4XID A;  2R7S A;  1E3P A;  1QVT A;  3WTZ A;  3I4M J;  2LTP A;  4C9Y A;  1LVA A;  3E6C C;  4M3F A;  3S32 A;  4X6A J;  4EQQ A;  2DFE A;  1FJL A;  1GT0 C;  1RUO A;  4A3G J;  3BQY A;  3V7S A;  1UHS A;  3DPU A;  4M6Y A;  3TO6 A;  4IHS A;  3H5R A;  5L3D A;  3CMY A;  1EJ9 A;  1QZY A;  1B8I A;  4B44 A;  1LE8 A;  4UVC A;  2KJB A;  3OYG A;  2ELH A;  1LQ1 A;  3E5X A;  2JVG A;  2W48 A;  3ABM H;  2DMU A;  3CDI A;  2PLY A;  4XKC A;  3FMS A;  2IP2 A;  2XAJ A;  4HX4 A;  3G2B A;  1ZLJ A;  1A5J A;  2LNB A;  2M0C A;  1LVK A;  2KQR A;  3CES A;  5CVR A;  1FSE A;  3BG5 A;  2HFH A;  2HXO A;  2OZ6 A;  2A5W A;  3FKJ A;  2VE8 A;  1MNM C;  3Q5F A;  2O6G E;  3HOV J;  3W2W A;  4RGR A;  5J1R A;  4FX4 A;  3OYB A;  3C2B A;  1OR7 A;  1GHC A;  2M2E A;  3FMR A;  3TO7 A;  1WFX A;  1SD7 A;  5K5R A;  1IN4 A;  1ZG5 A;  3KET A;  3MKL A;  1X1A A;  1X1D A;  5D5V B;  3U1K A;  2F4O B;  4A3C J;  1D1B A;  2RDP A;  3CJN A;  2ZBK A;  3A4C A;  3K70 C;  2HDD A;  2DA6 A;  1R1T A;  1S6L A;  1K83 J;  2CUZ A;  1VQK I;  2E2H J;  4GGG A;  1I39 A;  3HL2 A;  1OCC H;  1MIJ A;  3OIQ A;  5JVG F;  4LLN A;  4NQW B;  3OL4 A;  4ZZD A;  2HS5 A;  3DEU A;  1CF7 A;  3FXU A;  1QHG A;  2JUG A;  2X0L A;  3OOP A;  3VSK A;  3H35 A;  1TWA J;  3IV5 A;  4BY7 J;  5EYR A;  3G1M A;  2VQC A;  2OJE D;  1SFO J;  4CCL A;  2M0M A;  2EV6 A;  4HF0 A;  1Y0U A;  2RKH A;  4F92 B;  3SHF A;  4V2F A;  1MBH A;  4ZC3 A;  1UAA A;  2XUB A;  3JTH A;  2XSD C;  3ABK H;  3EYY A;  2H1L A;  4QIW N;  1VQL I;  4MQ9 F;  3OS1 A;  2E71 A;  1HW1 A;  4C2M J;  4HRI A;  2Y0S A;  4A3D J;  2PMZ N;  4L5E A;  3C2G A;  3CJQ B;  4BXU A;  5K7Z A;  1IN5 A;  4HST A;  4IXA A;  4FX0 A;  3E5Q A;  5LHH A;  3FXK A;  2E1M B;  2CUJ A;  1DP3 A;  4XLC A;  2ZXH A;  3ZR8 X;  2OBP A;  2JSP A;  1QRY A;  1X1B A;  4RM2 A;  4IHX A;  5KHD A;  2QVO A;  3GVA A;  1SC7 A;  1BR1 A;  2XGX A;  4XON A;  5EEG A;  4HX7 A;  1VQN I;  1FMV A;  3CLQ A;  4XRS A;  4B09 A;  2QYO A;  2HQR A;  3SJM A;  3DLL F;  4KN7 X;  1NHA A;  2HR3 A;  4MO7 A;  3HSF A;  1WH5 A;  2NVT J;  1BI3 A;  1HBX G;  4NQW A;  2JRM A;  2HXI A;  4LIU A;  5DDG A;  1NK3 P;  2GA1 A;  5B1A H;  2KIM A;  2X6O A;  1FX7 A;  3FIW A;  1KQ8 A;  2CSO A;  4QPQ A;  3S3O A;  1DDN A;  2WY7 Q;  4KIT B;  5CYV A;  4ZYA A;  3ZCO A;  3SZG A;  1OCP A;  1UG0 A;  2DT5 A;  2HQA A;  2CQK A;  2GOM A;  3R4K A;  4A12 A;  5FRM A;  4PJJ A;  4ANJ A;  2TRT A;  2ZME A;  2PX9 A;  1O3Q A;  5F1R A;  1MSF C;  2WAQ N;  4R8H A;  1TL8 A;  4XOP A;  3JW4 A;  2EBI A;  2R7T A;  2YS9 A;  1ZRD A;  4WWC A;  4M71 A;  1KA8 A;  2P4W A;  2Z9O A;  2XHK A;  1K7A A;  2W1O A;  2EV5 A;  2CH0 A;  4ENJ A;  2Y69 H;  2R7Q A;  1XGO A;  3ZQH A;  1ZRF A;  2JA7 J;  5GTH C;  4IEJ A;  2E2J J;  2VAS A;  3W2V A;  2ZO4 A;  4IJA A;  2R7V A;  3HKZ N;  2EFO A;  5HNH A;  2W7N A;  5AIQ A;  3DLA A;  3DP7 A;  3Q0U A;  1VQ8 I;  3PFY A;  5ILS A;  2WAE A;  2NOJ B;  3WHB A;  2KRH A;  1RI7 A;  3I71 A;  3P9I A;  1HCR A;  4HPQ A;  4EGZ A;  2IA1 A;  4UHT A;  2Y0S N;  5DCM A;  4XOR A;  1Z77 A;  4I01 A;  2MA3 A;  2X85 A;  3VSL A;  1V55 H;  5FD6 A;  2I8D A;  1K78 B;  4QTR A;  1IRG A;  3BZK A;  1S7O A;  2P7V B;  2DA7 A;  1PVE A;  1T98 A;  4A0X A;  3OIO A;  3BRO A;  2EFW A;  1FTZ A;  2V9P A;  1FIP A;  1YW7 A;  2DYR H;  2V4J C;  4DYQ A;  4HV5 A;  3FKI J;  3Q9V A;  4CZZ A;  1PJR A;  4B43 A;  5ICC A;  3BG6 A;  2D2W A;  1X3W B;  4CCK A;  4IKF A;  1IRX A;  3PNY A;  4G6T B;  4HBL A;  4YRV A;  1DGR M;  1RNL A;  2UZK A;  1HKQ A;  2Z1D A;  5CVU A;  1B72 B;  3OOU A;  1ZHF A;  2MLK A;  1YIO A;  2ZSI B;  4W1U A;  4BU2 A;  2A69 F;  4A3J J;  3PIP F;  3CCQ I;  4IQ4 A;  2R5Y B;  3HB9 A;  4I99 C;  1B1B A;  3ZMV A;  2DBB A;  4KYW A;  3TOB A;  4F55 A;  5HVQ C;  3WHC A;  3HYI A;  3PUF A;  3GYH X;  1GXP A;  3H9J A;  4X0G A;  2KRC A;  5K5Q A;  2DDA A;  2HYJ A;  2MH9 A;  3ZN0 A;  5LD2 C;  3I59 B;  2FXA A;  1Q1H A;  3W6K B;  3M8F A;  2V1U A;  2KDZ A;  1APL C;  4Y17 A;  2EV0 A;  2DCE A;  2CW7 A;  2XAS A;  3ASN H;  2H1K A;  3V42 A;  2JZY A;  1SAN A;  3PNT A;  1R71 A;  2XF7 A;  2G7U A;  3J80 Z;  1T8I A;  4DGW B;  2O9L A;  5EEH A;  2GWR A;  2O8X A;  3BR6 A;  3HKZ A;  2QCO A;  5JLW A;  3VYU B;  1WVR A;  4QWQ A;  3QQA A;  3V4G A;  2C6Y A;  4UY8 I;  2CQ7 A;  2X4H A;  1J59 A;  3OYK A;  4V19 K;  4D7M A;  3TQN A;  1LDJ A;  3DEE A;  1LEB A;  1RKT A;  2ZXW H;  4ESJ A;  3S3M A;  5HLG A;  2V9K A;  1ETW A;  1G3Y A;  3J7Z I;  4RMN A;  3G71 I;  3L2C A;  1GDT A;  3IKV A;  1FNN A;  3OYC A;  2ACJ A;  3CCR I;  1PP8 F;  1AHD P;  2V1X A;  5JHU A;  2JVH A;  3VPR A;  2A5Y B;  2IXS A;  3LAP A;  1VTN C;  5J1U A;  1O7L A;  3ZQL A;  3FM5 A;  2CW0 F;  2DDB A;  1BN5 A;  1D1A A;  1YOV B;  2BVL A;  3ZMU A;  1I5Z A;  1ZGJ A;  1YE9 A;  4B8X A;  1OYY A;  2LYC A;  4PSX A;  3RPQ A;  2R92 J;  1MNE A;  2VXD A;  3GFL A;  3TDZ C;  4HQE A;  1U9O A;  2L7K A;  1JUP A;  3OS0 A;  2KRF A;  1VF9 A;  1MZB A;  4I76 A;  4BE0 A;  3QPH A;  2P81 A;  3RCO A;  3ABL H;  4BE1 A;  2F5F A;  3EUH A;  1I6X A;  2M4G A;  3PSF A;  5F08 A;  2IEK A;  1HLV A;  1FP2 A;  4JP0 A;  3MFK A;  5EG0 B;  2BHY A;  2BHZ A;  2X51 A;  4I98 B;  2FBI A;  4EJT A;  4HX8 A;  3R6S A;  3JRC A;  2GXB A;  3J7Y J;  3L9F A;  5E79 C;  1W0T A;  1R4N B;  2ZB9 A;  5M5Y J;  1OIS A;  1H9G A;  1QNT A;  3FK7 A;  2FOW A;  3EDP A;  4II3 A;  3H92 A;  5E1X A;  2NS7 A;  5HDK A;  3S17 J;  5LHG A;  3F22 A;  2B9S A;  1TTY A;  4IHV A;  2YX7 A;  1YRN A;  1UJ8 A;  4XLP F;  5FLX K;  1WI3 A;  3PSI A;  3HSR A;  2JA5 J;  3MZY A;  3KPH A;  1MH4 A;  1W5T A;  4AC0 A;  3FMQ A;  2IRF G;  3JRD A;  4YFN F;  1MJA A;  4XKV A;  1AA7 A;  1D5V A;  3PQK A;  2A6T A;  1J9I A;  3AG2 H;  3JRI A;  2KDO A;  2KT0 A;  1IXR C;  2LRD A;  2OTJ I;  1NH3 A;  1LE8 B;  5M5X J;  2FA5 A;  2M8E A;  3IP4 B;  1Z1D A;  3LL7 A;  3OSG A;  2UWM A;  3GTM J;  2EQR A;  3H0D A;  3RSN A;  2Y75 A;  1FZP B;  1ZR2 A;  3T5X A;  1R9T J;  3FZV A;  3ECH A;  5EG0 A;  3U1D A;  4MQV A;  3I55 I;  5D6E A;  3B02 A;  4BQN A;  4ZDP A;  1W7P B;  3BR3 A;  1FT9 A;  2PEX A;  5EZH A;  4P5O A;  3F72 A;  2A3S A;  1PDN C;  1ZLK A;  2CS3 A;  3WU2 C;  2MC3 A;  5FFX A;  1IRF A;  2HPI A;  3BPV A;  4QSH A;  3EYI A;  2DOF A;  1QQI A;  1DP7 P;  1TBX A;  4UV9 A;  4OAY A;  1ACI A;  1WQ2 A;  4DNC A;  3NQO A;  1WJE A;  2N8G A;  5J8F A;  3GTP J;  1IV6 A;  5IT9 Z;  3CCY A;  3CF5 F;  3LSG A;  2Z16 A;  1L0O C;  2X48 A;  3ZPL A;  3H3V K;  2FOK A;  3V8L A;  4LIT A;  5ILU A;  1VZ0 A;  2BE5 F;  1K78 A;  3I4P A;  5CVJ A;  1ZEL A;  3E6B A;  1ULY A;  3WGG A;  1FOW A;  1Z3X A;  4OIR F;  5DCM B;  2JWT A;  2DMP A;  4KN4 X;  4HLY A;  2RNG A;  2BW3 A;  2G0E A;  4HV6 A;  5E3N A;  1KYZ A;  3S8P A;  2BZT A;  5IT3 A;  2HZT A;  3F8F A;  1T2K A;  5D8L B;  3U2R A;  2X6X A;  1BJA A;  4A69 C;  3CLO A;  2BYV E;  2GZW A;  2P0W A;  1K6O A;  2K9Q A;  1NG7 A;  3E3V A;  1S29 A;  2MH2 A;  5EJC A;  1UB9 A;  2ELK A;  3H0G J;  2VT3 A;  4I6Z A;  1XD7 A;  5IY5 H;  1XMX A;  2JJ7 A;  3BDD A;  3OWT A;  1LEA A;  3PNV A;  2KL4 A;  4UVB A;  2QZ8 A;  4DQ2 A;  2NVU B;  2HU9 A;  2KIS A;  2PJR B;  1W5C C;  3WE2 A;  1YQA A;  3ZQQ A;  1WHU A;  3GW2 A;  4HW0 A;  3T8R A;  3QOD A;  1X1P A;  2R5Z A;  3DBH B;  3V7C A;  1E0E A;  5ICG A;  5A2Q Z;  1FYK A;  1IN8 A;  4XLE A;  2EZL A;  2VBX A;  3FF5 A;  2STW A;  4BAC A;  2Y31 A;  2QQB A;  3B6A A;  3LNQ A;  3TOA A;  1FOX A;  1U5T A;  2VI6 A;  3D0S A;  1U2W A;  2RQQ A;  3S2H J;  3LFU A;  3DTI A;  2VUM J;  3CDL A;  3AL0 C;  1HDP A;  4NC7 A;  4ZYD A;  1JJ8 C;  3TL4 X;  3S3N A;  5FJ8 J;  4D0P A;  4RA2 A;  1EH7 A;  5D4R A;  1JGG A;  1IRZ A;  1HOM A;  2WV1 A;  2OCC H;  3BTC A;  5FB2 A;  3BJ6 A;  3H36 A;  4II2 A;  3OYH A;  2DFI A;  3R0A A;  2W00 A;  3Q0W A;  1G3W A;  4N9I A;  3EUK L;  1ZK8 A;  1I3Q J;  3S1N J;  4ZTF A;  1WJB A;  5E3L A;  2OQR A;  5HOD A;  2GLO A;  3ZQG A;  3M7G A;  3SEZ A;  1UMQ A;  4BYY A;  4Z6Y A;  4CHU A;  1XGN A;  1OCR H;  1O3S A;  1T6S A;  3ZGK A;  3T1B A;  1NG6 A;  5H20 A;  4WF2 A;  4UB6 C;  4G7O F;  1VQ4 I;  1B4A A;  3ERE D;  3G1O A;  2DQR A;  1H89 C;  2L9R A;  5H6R A;  4GXO A;  4F52 A;  2STT A;  5C4X J;  1B59 A;  1LUJ B;  2ID3 A;  4CSW A;  3DWL E;  2EIN H;  3IH4 A;  2TDX A;  3KYC B;  4ESF A;  2VIX A;  2HNH A;  4NC6 A;  4L5I A;  1QZE A;  4R79 A;  1PUF A;  1RZ4 A;  4M74 A;  1GXQ A;  4A3B J;  2DI3 A;  1WGX A;  4XK4 A;  2QWW A;  3UNG C;  4BKX A;  2EIM H;  1R23 A;  1UEL B;  2XDV A;  4B48 A;  1HXD A;  1W1W E;  2ADU A;  3Q3S A;  5IYB J;  2HI3 A;  1WZ2 A;  1S5L C;  5LFA A;  1K4T A;  1T33 A;  3M8E A;  4XMY A;  4UUS A;  3DQV C;  2L7F P;  4ASN A;  2BXY A;  5FGM A;  3OYD A;  2COM A;  2O3F A;  5KCM A;  1T39 A;  1P9Q C;  1ODD A;  1U5T C;  3D5L A;  1Z6R A;  3KP5 A;  1LPQ A;  5J40 A;  2PFB A;  2XVC A;  5FKM A;  4HNU A;  1OPC A;  4A0Y A;  4N0B A;  1D8K A;  1WCM J;  3Q0V A;  4PJL A;  4UB8 C;  2CFO A;  3RKX A;  2JA6 J;  2O03 A;  3CC4 I;  3WE3 A;  2RN7 A;  1RR7 A;  2QM3 A;  3SDB A;  3FBN B;  2ID6 A;  3HDD A;  4A0Z A;  2R4G A;  2DJI A;  3L7W A;  3SYT A;  4S05 A;  1PUE E;  1HC8 A;  3RIR A;  2GOX B;  1XS9 A;  3OYL A;  2A07 F;  1VQ6 I;  3WOD F;  1FBS A;  2NOG A;  2YX4 A;  1LJ9 A;  3ESW B;  1XSX A;  1H8A C;  2B0L A;  2GM4 A;  4FET A;  4F91 B;  2MSY A;  5IOZ A;  1IF1 A;  1QBJ A;  2W4S A;  1T0F C;  1U0J A;  4IPA A;  3BY6 A;  2HQ5 A;  3G6E I;  2E34 A;  3PJR A;  4L9V A;  3OY9 A;  3QRF F;  4B1R A;  3HUG A;  2A68 F;  2HGC A;  2KZG A;  2LOO A;  3GZ5 A;  2MW8 A;  1MMS A;  1DU6 A;  1BL0 A;  2OQG A;  2IA2 A;  2PMU A;  2EIL H;  5E1W A;  2DA1 A;  2IGM A;  4MTD A;  1XDU A;  3VOD A;  1XGM A;  5KNL A;  2L7Z A;  2L5Q A;  2FBK A;  2CUE A;  1X2M A;  1XTA A;  3L1P A;  2DJN A;  3K6G A;  4M72 A;  3J81 Z;  1I1S A;  5FKK A;  3C3W A;  2WAD A;  4ZYH A;  2KIF A;  1Z0X A;  4O3M A;  3HXL A;  3GX4 X;  4KIS A;  2QEN A;  1HQC A;  2ELJ A;  1HST A;  4WXH A;  4EEF G;  2VOP A;  1YFH A;  4KT5 C;  3KP3 A;  3C2H A;  2DFH A;  3GLL A;  4I02 A;  1ZGA A;  1LB2 A;  2IBD A;  2NNY A;  3ABT A;  4RAY A;  4DBR A;  4EGY A;  3S15 J;  3HM5 A;  4HG2 A;  1W7P D;  2BV6 A;  4HQM A;  2R7U A;  1LFU P;  4AD9 A;  4AIK A;  6PAX A;  4PSW A;  1Y1W J;  3BT9 A;  1DGW Y;  1YIT I;  2DOD A;  5BPI A;  4A3L J;  1JKO C;  2E1C A;  1R4M B;  4XLN F;  2XKP A;  3CCS I;  2L4M A;  3M1C A;  2XGC A;  4G12 A;  1B9N A;  1YW8 A;  1YTY A;  4E7Z A;  4FQG A;  3V8J A;  1KYW A;  2VOO A;  3JSP A;  2KLO A;  1QPM A;  5IOY A;  1OKR A;  1T38 A;  4BJ6 C;  1EA3 A;  2RRE A;  3A02 A;  4EMS A;  5L3C A;  1YLF A;  2M3A A;  4IHY A;  5CJ9 A;  3PM1 A;  3H3U A;  2M5W A;  1Z7U A;  2M87 A;  2X6Y A;  3OS2 A;  4BY1 J;  3GF2 A;  1RPW A;  1W0U A;  2DPD A;  5GPA A;  2YPR A;  4EJU A;  1ZG1 A;  4A3E J;  2W25 A;  1TQP A;  2IS4 A;  1HKT A;  3EQL F;  4Y3O A;  3BZC A;  1POG A;  2FNP A;  5IYC J;  2K5C A;  3K70 D;  2LKS A;  1YX5 A;  2PG4 A;  3CTA A;  1X3Z B;  5LHI A;  2P8T A;  2Z5U A;  2PI0 A;  3CCJ I;  2VC0 A;  1LDK B;  4KIG A;  5F0C A;  1CQT A;  2LR8 A;  1RRJ A;  1XN7 A;  2K9S A;  4DYC A;  3DPT A;  4B3X A;  1QU3 A;  2QKM B;  2VXZ A;  3MWM A;  3LA2 A;  4PGH A;  3J7A O;  3F6V A;  3JRA A;  1GVJ A;  1IDZ A;  3W3C A;  4G7Z F;  1Z3Y A;  4EM2 A;  2WTE A;  1BC8 C;  4Y52 J;  4OU0 A;  3GME A;  4Q5S F;  2CMP A;  4CIC A;  2NS8 A;  2BW3 B;  3C18 A;  4EV0 A;  1O4X A;  1P4A A;  1K4S A;  5H6Q A;  3JCU C;  5HNF A;  1VFC A;  2OF7 A;  5JR3 A;  3BC8 A;  5E20 A;  4IHT A;  4YFX F;  1WH7 A;  2UUZ A;  4RGX A;  5D8K B;  1VI0 A;  2JA8 J;  1AWC A;  3VWB A;  4XKB A;  5F1J A;  4CCN A;  4HEA 2;  4FTH A;  3K9T A;  2O8K A;  4WK8 F;  4M9Z A;  1IGN A;  2E7W A;  1ZGW A;  2ZXI A;  1NK2 P;  3JRH A;  1M1E B;  2H09 A;  2YR2 A;  3VB2 A;  3F0C A;  2ZJQ F;  2L54 A;  2R7F A;  2H6B A;  2CV0 A;  1W7P A;  3E5U A;  1J09 A;  5IP7 J;  1X4P A;  4G6D A;  4XLH A;  5KK1 A;  2Q2E B;  4PFO A;  1FBU A;  3BZ6 A;  1H0M A;  3QAH A;  3SDG A;  2FBH A;  4DW6 A;  3JRB A;  1AOY A;  2OD5 A;  5HLH A;  5M3M J;  2LY9 A;  1JXS A;  1MBE A;  1WWX A;  3QYB A;  2IW5 A;  2V6C A;  3IH3 A;  5F0F A;  3CZ6 A;  2D1V A;  2BOL A;  2GXG A;  4KJZ A;  2WAQ A;  2JSC A;  4CXF A;  4PUS A;  4Y13 A;  4A6E A;  2UXN A;  3O6B B;  1JGS A;  2KZV A;  2QSF X;  4ZDL A;  2DPU A;  4RBO A;  3OIP A;  3SQN A;  3GLX A;  1YX3 A;  3CCM I;  4XN3 A;  2DOA A;  2AS5 F;  3QYE A;  2JUC A;  1TQI A;  2IGK A;  3QYF A;  2K9M A;  3DTK A;  3FDY A;  2ME6 A;  1V5G A;  4BXF A;  1YRN B;  1Z67 A;  5KAI C;  3MEX A;  2Y30 A;  3KEY A;  3SEQ A;  3HHH A;  1DPU A;  3CO7 C;  1MMN A;  4A93 J;  1SD6 A;  4BH9 A;  2K85 A;  1FOK A;  2W85 A;  3F9K A;  1BW5 A;  2ME0 A;  4HF1 A;  4RB1 A;  2E7X A;  2HYF A;  2GXA A;  2QQ8 A;  2NXN B;  3K4J A;  2M7B A;  4DJA A;  2V1D A;  2HOT A;  2IGN A;  5DD4 A;  2AXL A;  4YFK F;  1X58 A;  2F48 A;  2AHQ A;  1F36 A;  3MD2 A;  3IRR A;  1Z9C A;  2HEO A;  1O3R A;  5D6F A;  2ISY A;  5K5O A;  1O3T A;  1N78 A;  2YUS A;  4OIP F;  3V7R A;  2UV1 A;  2M7A A;  1R5G A;  4NB5 A;  4BQQ A;  3AKZ A;  3P9C A;  1QZZ A;  1YHQ I;  3LOC A;  4JK1 X;  3PUB A;  1IC8 A;  4Q47 A;  5D5X B;  4D5F A;  3AL0 B;  2R7D A;  3DCF A;  1S3J A;  1MBG A;  1J7K A;  1HF0 A;  1P2F A;  5JLX A;  3K4C A;  4LIV A;  4PJN A;  5E8G A;  3CC2 I;  3EUH C;  2WB1 N;  4XOT A;  1IUY A;  2EH3 A;  3ULQ B;  2XRL A;  3HPG A;  2ZXJ A;  1JI8 A;  1S7E A;  5F27 A;  4O6J A;  4C2T A;  3DBR B;  2D5V A;  1TNS A;  5KVR A;  5EGO B;  3S2D J;  3BTL A;  4AUX A;  2VN2 A;  2LBF B;  3AFH A;  2PMZ A;  2MC4 A;  3V8K A;  3KZY A;  1KQ9 A;  1UCR A;  2CG4 A;  3K2A A;  3RQ4 A;  4J19 A;  1ZRE A;  4XRS G;  3BR5 A;  3A0B C;  2IS6 A;  3NWT A;  2LLK A;  1SFE A;  4W97 A;  1QPI A;  4OIO F;  4H4K C;  2LKX A;  3VYS B;  3BCA A;  1LFP A;  2MG4 A;  2VB6 A;  3ISP A;  4WX9 A;  1HSJ A;  1G59 A;  4CO8 A;  4NBQ A;  5BOX A;  4ZDO A;  2LC2 A;  2X6W A;  2CV2 A;  2RAE A;  3DFG A;  2K27 A;  4JOM A;  3EUA A;  3L00 A;  3OYI A;  2HDC A;  2EIJ H;  2DA3 A;  3IUO A;  1JHH A;  4IF4 A;  2ZNY A;  1FWZ A;  2FX0 A;  1IXC A;  2M34 A;  3CQZ J;  3LSH A;  1XPX A;  2CO5 A;  1A36 A;  3W6J B;  1A35 A;  4DYR A;  2VJJ A;  1QHH D;  1G4D A;  1KGS A;  1ETQ A;  2G9W A;  3BR1 A;  5HDG A;  4G6Q A;  3IAS 2;  2FNA A;  2R5Y A;  2WY8 Q;  4LOC A;  4MGR A;  3RKW A;  3GFM A;  1MDM A;  4CCM A;  2Y2Z A;  2L7M P;  3HRU A;  2E5N A;  1VQ9 I;  1EH6 A;  1F4K A;  3GEZ A;  1B72 A;  2JMW A;  3WTV C;  4OMZ A;  4LG0 B;  3QP6 A;  3NAR A;  3OMY A;  2EZI A;  1S9H A;  5J8C A;  5E17 F;  3NEU A;  2V26 A;  3KCC A;  1BIA A;  2QEX I;  2VOD A;  1J0R A;  3CF2 A;  2D1H A;  2OV7 A;  2Y9Z A;  3KLN A;  2ISZ A;  2E35 A;  2EB7 A;  3MKY B;  4UUV A;  2VKE A;  3DTE A;  5F0H A;  3IRQ A;  1GV5 A;  3DKY A;  5E3M A;  5CQG A;  2FMY A;  3A01 B;  2HWV A;  3ERM A;  4C3I J;  3CMA I;  2LP0 A;  4PJM A;  3E7L A;  3F8B A;  1MBF A;  5LRR A;  3ZQI A;  3RQI A;  2LY2 A;  2NRA C;  4I2O A;  3S14 J;  3H1C A;  1HKS A;  2HVR A;  2QF7 A;  2ZFW A;  4RLF A;  1ETY A;  2AO9 A;  3L2Q A;  1BA5 A;  1GLN A;  3FHN A;  4CYC A;  4MHG A;  1S72 I;  2R7Z J;  3CCU I;  5BPD A;  1FTT A;  5LGU A;  3FWE A;  5ICE A;  4RB3 C;  1N77 A;  4GRI A;  2E1N A;  1OCZ H;  3HRT A;  1BIB A;  3IAM 2;  3WGH A;  2GIZ A;  2E1M C;  5GAE J;  2HKO A;  3CME I;  2K4J A;  2XAH A;  2MYS A;  2WBM A;  2P6S A;  2BY0 A;  4M3E A;  1RUN A;  1FC3 A;  2NNN A;  4ZYG A;  1JKP C;  2AQF A;  2M30 A;  1Q1V A;  3FHZ A;  5HOO A;  5FD5 A;  4EVI A;  4OIQ F;  2VBZ A;  1SMY F;  4HSR A;  1TZL A;  4NC8 A;  2CGP A;  4LK0 F;  1TWH J;  1UG2 A;  1LKX A;  1OLT A;  3E6D A;  2G7H A;  2Z3Y A;  4QLC U;  3CO6 C;  5IPA A;  1ETO A;  2LF8 A;  2PMH A;  4XSX F;  3ZRG A;  4BHB A;  1ZH5 A;  2JN6 A;  3QWL A;  3P7N A;  4F7Z A;  2VJ5 A;  1KON A;  3E97 A;  2EIK H;  1XSD A;  3FXM A;  3K69 A;  5M3F J;  4L9J A;  3WTS C;  1R58 A;  3GTL J;  3HZJ A;  4LJZ F;  2I5U A;  1WKM A;  2CQX A;  2WV0 A;  1X4O A;  4ESB A;  2VC1 A;  5BNG A;  3OYM A;  1I3A A;  2L9V A;  5DM7 F;  1L3L A;  4PGG A; 
#chains in the Genus database with same CATH homology
 1LUJ B;  1T08 B;  1M1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...