1LUJB

Crystal structure of the beta-catenin/icat complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
GAPAKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVSSQLSQLPQHSIDQAAEDVVMAFSRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catenin beta-1
publication title The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2002-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1lujB01
1T08B 1LUJB 1M1EB
chains in the Genus database with same CATH superfamily
1V5EA 1W0TA 1DPRA 1SAUA 2LRDA 3DEUA 1STZA 1W7PD 4X0GA 1A31A 4BEHB 3JRAA 1JUSA 2K4JA 2O5RA 3A0BC 1N25A 2DK8A 2R5YB 3CC2I 2AQEA 2K85A 1JKRC 2GM4A 4RLQA 2F2EA 1TBXA 1QU3A 1UJ8A 3W2AA 2NS8A 1DU6A 2ZB9A 2XRLA 1E3HA 2HGCA 3M7GA 1FBSA 3V8LA 5D5XB 2DFFA 2MA3A 5FKLA 5B1BH 2LMDA 4NUBA 2VXZA 1U5TB 2OQGA 1ON1A 3N05A 3CZ6A 4FE7A 5D8LB 1TT0A 1JT6A 4A12A 3GEZA 3RI4A 1APLC 1O4XA 2DMTA 1K78B 3HUGA 3PQKA 1YI2I 4B3XA 3CJRB 3FF5A 3CQZJ 3TL4X 3TMOA 3DKXA 1YRNA 4CDGA 3WG7H 2IS6A 5F0HA 1YW8A 1FEXA 3F3XA 3M3YJ 3WGIA 2ME0A 1USSA 4LLLA 2KT0A 1Z1DA 2V4JC 4HG2A 3H9GA 4WXCA 1XSDA 1TWGJ 2BBYA 2HOSA 3BJOA 2IGNA 3CUQB 4YG2F 3DTKA 2YUSA 2HWVA 4MO7A 3U1DA 1T6SA 3ZQHA 2XV4S 4E7IA 1RZ4A 3DQVC 2W48A 1OCCH 5J6XA 1SD7A 4BXXJ 3REOA 3AFHA 3DTEA 3JTHA 2BW3A 2WTEA 4G12A 3FMRA 5B1AH 4RB2C 3FK7A 5DM6F 1HLVA 1OCRH 2QENA 2OC6A 3D0SA 3DP7A 4F7ZA 2V9VA 2L2OA 5C44J 3JSPA 2HOAA 1P4AA 2W00A 4AIJA 5DCFA 3HC7A 2QSHX 3OV8A 2RAEA 4A5MA 3R4KA 4E7ZA 1YO5C 2LBFB 3V8JA 3LSIA 4CYDA 3O3KA 2PJRA 3CCUI 3NWTA 2E2IJ 2OA4A 2A6HF 3VYUB 5M5YJ 1SMYF 2LREA 2YR2A 1TT5B 4IPAA 5IYBJ 3OSGA 4JOMA 1J7KA 3MN2A 5GAEJ 2W84A 3LAPA 4HF0A 1ZRFA 2KDOA 3AG3H 2NXNB 3K4CA 2R7XA 1IXRC 2IEKA 5EZHA 4RGRA 1TP4A 2FNAA 4YIRX 3FM5A 3OYNA 4G6TB 2QKLB 4O6JA 1XCVA 3ML6A 2W7NA 4BACA 1CGPA 2V7FA 2L4AA 4B8XA 1MBKA 3VYSB 1FOXA 5GAGJ 2NOJB 2DQLA 3HUGB 3JREA 2EILH 2EH3A 3M1EA 3E3VA 1YITI 5FKNA 4BL0B 2EIKH 3IH3A 3ZR8X 3FKJA 1UZCA 5ICCA 4LMYA 1T33A 3D5SC 1S7EA 5CQGA 1VQ7I 5IOZA 2H8WA 4KITB 4YEJA 4CH7A 3L1PA 1Y1WJ 2DYRH 4ZDLA 3J7AY 4XL9A 5FGMA 1BC7C 1UFMA 1Z9CA 2PMZA 4ZC3A 4XLHA 1D3YA 5J4VA 3O8GA 4AU7A 1IUFA 3TDZC 5GPCA 4IJAA 1GXPA 2WB1N 1U3EM 1R9TJ 2FSWA 5K7FA 3OYGA 3CMMA 3H1CA 1JJ6C 4KMUX 3V7RA 4E4HA 1DP7P 2NVYJ 4M9SA 3OIPA 4BHCA 1XD7A 1RR7A 3A01B 1B59A 2BW3B 3H5RA 3DF8A 2A69F 1PUFA 3BZ6A 5F1JA 4ESFA 4RMNA 1D5VA 1B6AA 3K70C 2HVQA 4N9IA 3BG6A 4PGGA 1LDJA 2EV5A 1GT0C 3HRTA 1L0OC 4RAFA 4TV7A 1XGNA 2P6TA 2X6OA 3IWZA 1XMKA 3D5LA 3HHGA 5HLGA 3RJPA 2KP6A 2EV0A 1WJFA 5HOOA 1IG7A 4XKBA 3GTGJ 3ABLH 4XLAA 3KP3A 4LD5A 1VQ5I 1S7OA 5FRNA 2FF4A 1VQ6I 4IOCF 2LK2A 2DCEA 2OAZA 4I0BA 5L3DA 2FEZA 2VXDA 2M0MA 5HDKA 4A6DA 2YSRA 4BQOA 4F3QA 1MZBA 3VEPA 3KE2A 2K9MA 1ETWA 2ZXIA 4JYKA 3C7JA 3GBGA 3CF2A 4BXFA 3R61A 2VOOA 4XORA 2KRFA 3EUHA 3GTLJ 1BR1A 1G6NA 3GF2A 5DDGA 1SFXA 2WADA 3WTVC 5FLXZ 4HPQA 1P7JA 2CQXA 3GTJJ 1WRJA 1USTA 1XDUA 2HDDA 3C2GA 1O57A 1JT0A 3A1YA 3OYBA 3L2QA 1BI2A 4HNVA 4IL6C 2JA8J 1V3FA 5CVVA 2VJ4A 4AM3A 3DTIA 2AXLA 3K7AJ 4BKXA 2KFDA 4PCQA 4WXHA 2IS4A 3QAHA 2CUFA 4LK1F 3FHZA 3GZNB 4OAZA 1OCTC 2DDAA 2EB7A 2ELKA 4QPQA 3BCAA 4MQ9F 4ESJA 1Z67A 3KZYA 1LEBA 2HVSA 5AIPA 4BUPA 5FKMA 2TCTA 5D4RA 1BR2A 3QU3A 1MMGA 2HPIA 2WV0A 2XGEA 3IHUA 1FJLA 2XRNA 5H6RA 4G9YA 1R5ID 3TOBA 3OR2C 2K5CA 5HNFA 3HOVJ 3H36A 2FE3A 3FX3A 3ECOA 3OWTA 2K27A 1PUFB 3JW4A 1VQPI 1D1AA 3L2CA 3WU0A 4AIKA 3DU5A 2DT7B 2CW0F 1IF1A 1SANA 2G7HA 3WTZA 4BGDA 2BVMA 2W25A 4ENNA 1ORKA 5DCMB 5CVIA 1ZK8A 3ROUA 3TEDA 3GTOJ 4FETA 2LFBA 4KICA 1IV6A 2QCOA 3IAM2 1UHSA 1G8XA 3TOAA 2DI3A 3SZTA 2GXAA 4Q47A 5JVTA 3RKXA 2D2WA 3LSKA 5TISC 4BQNA 2OCEA 4GRIA 5DS9A 1S72I 3KEOA 3RPUA 2K3PA 1Y39A 4LG0A 1O7FA 2VBXA 1X2NA 2DA2A 1W7PA 4MFEA 3S17J 3BTJA 1O7LA 4S05A 3I54A 2MD5A 2AXTC 4HX8A 1OLTA 3CCLI 2BE5F 3J81K 1Z91A 2UV1A 2AHQA 1J2XA 3BR0A 4G7OF 1LVAA 2ESHA 5CVRA 3ZQGA 4C3JJ 3QRFF 1XSXA 3BCBA 1RI7A 3EQLF 4E6KG 4ITVA 1BOAA 2ZO4A 3E0JB 2JJ7A 2RVCA 2N8GA 4ENKA 1Y56A 4BAYA 3P9CA 4EGZA 2RV8A 2WAQN 3OIOA 2RKHA 4UVAA 2DTRA 2QQAA 3SQNA 1YX3A 3I3LA 2R7QA 3DXJF 3Q0UA 1Q1HA 2ADUA 2KJCA 1HKSA 2XAFA 3F0CA 3K4KA 2ID3A 3TDUC 1LDKB 3HHHA 4NBQA 4C9YA 2QA4I 3W6VA 3ZQ7A 4ZH4F 1K6OA 4HRIA 2E1NA 1Z6RA 2V9KA 4IQJA 4I98B 2XIGA 4HA8A 3SJMA 3GYHX 3HOWJ 1ETYA 1ZARA 1J09A 1Z77A 2DA7A 4YFXF 2GBYA 3M9AA 4D5FA 5IYCJ 3E6MA 1IJWC 2JWTA 3NRVA 2R5ZB 3K1PA 4FX4A 1IW7F 3G71I 1FPQA 2VJ5A 1FY7A 3BR3A 3BTCA 3G2BA 5CJ9A 1D1CA 1F36A 1OCOH 3I71A 4RS8A 4A3EJ 1XGMA 2X6XA 4BYYA 2ZJRF 1ONVA 4BE2A 3S8PA 4K2EA 5EDNA 2R7RA 4MFDA 2DOAA 1MJAA 5LLQA 2GLOA 2M45A 3Q9VA 1Z3XA 3BR6A 4CZCA 1VF9A 2ZJ2A 3CF5F 1HSTA 1A35A 3A2KA 1H9GA 3KP4A 3NEUA 3HOXJ 5LHHA 4B47A 4UUSB 3ZMSA 4IHVA 1R36A 1WH7A 2STTA 3CC4I 2LR8A 3RZOJ 2Z16A 1K4SA 1F43A 2LP0A 4GGGA 5J4YA 2FA5A 1QPIA 3OOPA 4ZTJA 3S3OA 5H2FC 1A6IA 2DMPA 1HDDC 4HF1A 3V7SA 2KIFA 4XKWA 2O3FA 3CCMI 2XKOA 1FYKA 2MABA 2G0EA 2XASA 3K4LA 1IO2A 3H3VK 5E3NA 2VBZA 5BOXA 4ASNA 4F92B 1PP7U 2L02A 1ENHA 3LA2A 1O3TA 5ED4A 2ICWG 4XK4A 3ZMUA 4V19K 1P4XA 2Y48A 1QRYA 1FYLA 1CF7A 1GV5A 2VJIA 2GAUA 5HVQC 4U88A 4W1UA 1WI9A 1RRJA 4RM2A 2GXGA 3J7YJ 4PJJA 2JQ7A 1QZYA 2F48A 2EA2A 4BJ5C 5A2QZ 3LSRA 4BBRJ 3PO3J 4YIFA 4A3BJ 4OIRF 4OAYA 1B72A 1MKMA 1OCPA 1S5LC 4LGWA 2ACJA 4M3DA 4MNUA 1V55H 1YQAA 2EZKA 3KP2A 1NK3P 1FIAA 4EM1A 1A5JA 2F6CA 2MD0A 3T8TA 4HYEA 3SZPA 1QHGA 2M34A 1LB2A 5HDNA 3GZ5A 4EQQA 1U78A 3SDBA 4P9FA 1YJWI 2M5WA 1X3WB 1QGPA 3L09A 1ULYA 2DMQA 2DBBA 1MMAA 4F93B 2GZWA 2MC3A 1KU9A 1KU2A 1GUUA 1ZG3A 1G4DA 2L7FP 3DEEA 2JUGA 3VSLA 1FSHA 3IP4B 2VC0A 2VBYA 3EDPA 1HW1A 4EJVA 1MBHA 5EZGA 2BGCA 5F6FA 2ELHA 1IGNA 3I59A 4DBQA 4O5VA 2PJPA 2CFOA 1DPUA 4PDKA 1LEAA 2MYSA 1G59A 3KLNA 1ZQ3P 3QOPA 5HS8A 1ZLJA 3AG1H 3ZN0A 4UB6C 1NG6A 1YJNI 3DPUA 4NDLA 3BDDA 1R1UA 5F0FA 3HOUJ 2CO5A 2M1BA 1JKOC 4JK1X 2CFXA 1BI3A 2HQ5A 2L9RA 4FX0A 5J8FA 2J5OA 3I53A 3MQ0A 4IVNA 5CYVA 1FX7A 4XLPF 4J00A 5HLTA 2DLLA 3JRIA 2EQRA 3Q9SA 3OS2A 2F5VA 2R3SA 3J80K 3GTPJ 3JR9A 1SFUA 1HW2A 4A3GJ 2FMLA 2CG4A 2R5YA 4P9UA 3CCEI 2E7XA 1MJ9A 2NNNA 4C2TA 4W97A 2M3AA 1FZPB 4DJAA 4NHJA 1HOMA 5LEKA 2E1CA 3A0HC 2KZVA 5LEJA 1VFCA 3BROA 5GP9A 4F91B 3G1OA 1B72B 3AG2H 1X1DA 5E3OA 4D0PA 1FT9A 3ZQCA 2FJ1A 3LOCA 1BN5A 2QZ8A 3HRMA 3U2RA 2WWYA 1U5TA 3PUBA 2M7AA 6PAXA 3S1RJ 3BY6A 1MMDA 1GLNA 1BIBA 1KU3A 1V5FA 2H6CA 4CHUA 2EFWA 3FISA 4S04A 1VNDA 1E2XA 3M07A 3FXRA 4WX9A 4NC7A 1IN4A 1UG0A 3GX4X 5AIQA 2QQ9A 5DD4A 2GOMA 4LFUA 4B4CA 4DYQA 2E71A 3HKZA 2CQ7A 3P7NA 1D0YA 2OF7A 2LG4A 2P5VA 2HXIA 2Y0MA 3WGGA 1TWAJ 3QYFA 3ZN1A 3JRBA 1OR7A 2HTJA 3OL3A 1U8BA 1T08B 4I7HA 1N78A 2UXXA 2G9WA 2VT3A 3OYEA 2LD5A 3TP0A 2CV1A 3OS1A 5IOYA 3I59B 1ZG1A 3MKWB 4UVBA 4FCYA 3MKYB 3PNTA 4FQGA 3HDDA 3F22A 2HNHA 3S3NA 1XMXA 2LVSA 1IN7A 3WHCA 4G8XA 1EJ9A 1Z7LA 1SMTA 2DU9A 2DAOA 4I01A 2FBHA 1R58A 3BZKA 2O61A 4HSRA 3BC8A 2LYCA 5IY5H 1WWXA 4A3CJ 3HZJA 2CMPA 2Z1DA 1R6RA 3GXOA 2OTJI 4UVCA 4BS9A 3C1DA 3WTSC 1IXSB 3DKYA 1MD0A 3A02A 2LY1A 2MSYA 3BR1A 3CTAA 5HODA 3S14J 2X6YA 3VYTB 5K7HA 2KJBA 3TW6A 1HKQA 3IKTA 4Q5SF 3BP8A 2RDPA 2V9PA 3EYYA 2VPLA 1X4OA 1MH4A 2HQNA 1MH3A 2AS5F 5JHFA 3HIFA 3I4MJ 1E0EA 4A6EA 4ZTFA 5LRRA 3ERED 3CC7I 2KLOA 3IRRA 1ETOA 2Z99A 1OKRA 2PI0A 3TP3A 1WHUA 1JKPC 1MMSA 1WI3A 2QUFA 5CVJA 1DQUA 5FRMA 1XCBA 5FO5A 1IZ1A 1W1WE 1VQKI 2Y0SN 1M1EB 2HQAA 2A61A 2XB0X 4XM3A 5ILSA 3AAFA 2AO9A 3BLYA 3MZYA 2WV1A 5DYMA 1QVUA 2B7EA 2M4GA 3GFIA 3B02A 4E7SA 3T1BA 3FMSA 3LA7A 3GO5A 2K4BA 1FLIA 2JSPA 3BTIA 3OR1C 1P9QC 4M74A 4AC0A 1W5SA 3FXQA 4KJZA 2HR3A 2MW8A 5BNGA 1N77A 3U1KA 4H0EA 4CYCA 3K1NA 5CKTA 3HSFA 3I55I 1ZYRF 2OPTA 3EUHC 1FOYA 1ZELA 1HF0A 1SFEA 3OYFA 1W4MA 1ODDA 4ZYEA 2GIVA 1J75A 3S1NJ 3HTSB 3IL2A 1X58A 1BA5A 3BWGA 2BZTA 4D9JA 3PM1A 5CPRB 2A6EF 2DK5A 3F6VA 3VSKA 4JX6A 3A01A 4XMYA 3JRFA 1VQLI 2Q2EB 1KGSA 1ACIA 4IHYA 3QYBA 4IHWA 4LK0F 2RNGA 4L9VA 1ON2A 4IOAF 1DGRM 2D45A 4EJUA 3L2VA 4KT5C 3IV5A 1GDTA 4J01A 5L3CA 3EYIA 1XB4A 3I4PA 3KZZA 1WJCA 4BHBA 5H6QA 2P5KA 2P0WA 1R4MB 5TGTA 3UKGA 3PJRA 1ETVA 2F5EA 2LTPA 3RIRA 4M3GA 4ZYDA 1TZLA 1XX5A 2TDXA 3CUOA 4BNCA 1YIOA 4RDUA 2OZUA 4RAYA 4FTHA 3MAJA 1F5TA 4LJZF 1W36D 1QZEA 2KDZA 2FRHA 3LL7A 3BG5A 1XDSA 4EVIA 3OYKA 3MVPA 4P1WA 1F9NA 3IH4A 3HOSA 1T56A 1X3UA 3RQIA 1PUEE 1ZR4A 2DFIA 4DW6A 4IXAA 4UV8A 1LFBA 4RB1A 3S93A 4R8HA 4PJLA 4X6AJ 1MBEA 1R49A 2GA2A 2OUMA 4JBAA 1YW9A 4OOIA 2IW5A 3RYRA 1D0ZA 3VOEA 2QSFX 1JJ8C 2NVXJ 2L7MP 3T5XA 3TKYA 4I6ZA 3RTRA 2R92J 3OYAA 4P55A 3ZQQA 2FOWA 4BQAA 1N75A 2X6WA 2HFHA 3R0JA 5M3FJ 1ZTRA 2DJNA 3HRSA 2DOEA 2P7CB 1EV7A 1NG7A 3GFLA 2R7WA 1RUNA 3K4BA 4RGUA 2CRGA 3V8KA 1XPXA 1TLHB 1K7AA 2IS2A 2JRMA 3IAS2 3OS0A 4CYCB 1GV2A 3E5QA 3Q0VA 1T95A 2ZNYA 2QWWA 1Y1VJ 3KP5A 1RKWA 1B8IB 5LRSA 2STWA 4QWQA 1MBGA 2VE9A 1ZHFA 4D7MA 2ETHA 3L00A 3TO9A 4MIMA 1Z21A 2DA6A 2ZJQF 4CO8A 2FBIA 2BVLA 5M5XJ 3OY9A 3F23A 3W6JB 2E1MB 5JVGF 1VQ4I 4PK4A 1RIOH 5TRDA 4HSTA 2PN6A 5HNHA 2PBIA 3W3CA 1UCRA 2Z3YA 4FHTA 4Y4RA 3QQAA 2OU2A 4I2OA 1R5GA 5L3FA 3EETA 1ZLKA 2HKOA 2BV6A 1UELB 4L5IA 5ICFA 3ABMH 2VN2A 1I39A 4PSWA 2O0YA 4ZJZA 4PFPA 5FKOA 4IO9F 4ENMA 5DCMA 2MH2A 2A6TA 2BOLA 2QGUA 3H9JA 4MGRA 1LKXA 4HAMA 2MH9A 3MCZA 1SEUA 3ZCOA 2CUZA 4DZPA 4E7JA 5J1YA 2JA6J 3H92A 4A3IJ 2ISZA 4UUVA 2J5PA 4M9ZA 1FBUA 1QNTA 1SVMA 2COMA 3CCQI 2CJJA 4UV9A 1R7JA 3ZMVA 4CCLA 1VQ8I 2LOOA 2DO7A 3E5XA 2OTLI 3M8JA 1JUMA 1WFXA 1X3ZB 2IGKA 4IQ4A 2ZSIB 5E1ZB 4D5CA 1L3LA 4BH9A 4KA4A 3GZ6A 1UG2A 5ILVA 1Y0NA 3L2WA 4LLNA 4XSZF 3M1CA 3LSGA 2W4SA 4ZYGA 2O9LA 2BY1A 2CV0A 3LSHA 3HL2A 2RQPA 2PG4A 3IKVA 3TQNA 2ZMEB 1I6HJ 3VFZA 1XMAA 2IPQX 3QODA 1D8JA 1XGOA 3HPHA 3PL8A 3KX2A 1JTYA 1W5TA 2EFOA 5E1XA 3DEWA 4RAGA 2LF7A 4DYCA 1B9NA 4WCGA 1QBJA 1X1AA 1OYYA 3ABKH 2LKPA 3D5RC 3K4JA 4Y3OA 4EM0B 3RKQA 2V1UA 3JAMZ 4UNOA 2IGMA 1B9MA 5FLMJ 3FM3A 4FISA 4KNYA 1FMWA 2X0LA 2P6SA 2EK5A 4XKVA 2FUG2 1H8AC 1I1GA 2WAQA 1BC8C 1SVLA 2PMZN 3O8HA 3DBRB 2IT0A 1WKMA 2LY2A 4A3JJ 2W24A 5DUIA 3FBNB 3RCOA 4RA2A 2HOEA 2DTZA 3FDYA 3ZPLA 2E1OA 3T0YA 2NS0A 4A5NA 3HGGA 2DODA 1TQMA 1P7IA 4IHSA 1KQ0A 1G3YA 1LNWA 2R5ZA 2Z5UA 2NNYA 1E17A 2ZXWH 2MG4A 1GXQA 4OINF 5FJ8J 3SXYA 1NHAA 2DPDA 3Q0WA 4ZYHA 4BDYA 3FWEA 1G2HA 1AU7A 3CCJI 2JPBA 3DWLE 3S15J 4I02A 1I6XA 1Z0XA 2ESNA 5J1RA 5F0CA 2QBYB 3KYLA 1OYIA 2DT6A 1W0UA 1OPCA 2VKDA 3ASNH 4OIQF 5FLXK 4L9JA 3DCFA 3N97A 3E6DA 1Z3YA 4UUSA 2ISYA 1YYVA 3U21A 1PYVA 3NARA 1WCMJ 4HEA2 3KIOA 3HEFA 3GTMJ 1I3QJ 3JSOA 3CO6C 1LE8A 4L5JA 3H5AA 2TRTA 5LD2C 1T8IA 1FBQA 3PNVA 4B3AA 5E79C 3K6GA 4BQQA 1IRGA 2XPUA 2CS3A 2E34A 4Z2YA 4PJ0C 4BY7J 4WWCA 3RKYA 2LKXA 3KYCB 1BIAA 1FTTA 2E60A 3ASOH 1Y8RB 1WJEA 3PSIA 4BJTA 4XQFA 3PO2J 2EFPA 2JRTA 2IS1A 5HDGA 3GTKJ 5EJCA 3JTGA 1UHMA 4YFKF 5D4SA 1XS9A 1X1CA 3ECHA 4GYGA 2HYGD 4LITA 4L18B 5BMZA 5LFAA 4M3FA 3UR3C 3PNYA 4XRMA 2DA4A 2GWRA 3E6CC 2XHKA 3HXLA 2FU4A 2HU9A 1D0XA 3K69A 3BG7A 3OSFA 1EF4A 4OU0A 1R71A 1AHDP 4KUMA 1TW3A 1MMNA 1WJDA 4I0AA 2PFBA 4BE0A 3TW7A 2A3SA 1IN8A 3L2RA 4H4KC 5JLXA 3TBIA 1VTNC 2L3DA 2B9SA 5CVUA 2BXZA 3BQZA 2LSOA 4CICA 3F8CA 2HTSA 1FOKA 3P5JA 3U9GA 3I0TA 3ZMZA 1MGTA 2MGQA 1U5TC 1K79A 2A68F 3VPRA 5C4XJ 4CUGA 2FNPA 5C4JJ 2O8KA 2DMNA 1MJBA 2RQQA 4NNJA 4N9HA 3P9KA 4V2FA 4EMSA 2Y9ZA 4KIBA 4UY8I 3IC7A 1LE8B 1T0FA 4BDZA 3H5NA 1VQOI 2R7VA 1WQ2A 1JHFA 4XOPA 1JHHA 1HSJA 3J7AO 3PSFA 3R60A 4DYRA 1YE9A 2XVCA 2A5WA 5D8KB 1ZGWA 2V6CA 1OR7C 2E5ZA 2H27A 2LNBA 2KZGA 4G94A 3CUQC 1HA8A 2JA5J 2EBIA 2PMUA 2MLKA 2ID6A 4IF4A 4XICA 4CCNA 2VBWA 2Y9YA 3CJNA 5IT3A 1YFHA 2XAHA 2OCCH 2NOGA 2R4GA 5KAFC 2C6YA 5JFRA 4NC8A 2JPCA 4M6XA 4R79A 2Q8KA 4X1EA 2V79A 3B6CA 1I27A 2KL4A 3MD2A 2F4IA 3H0DA 2M9HA 1RC9A 3G6EI 1P4WA 2KISA 4AYBN 3JRGA 1X2MA 2Y75A 4UB8C 3UNGC 1JXSA 1S3JA 1P92A 1LJ9A 2KHMA 3BR2A 1RKTA 5DD8A 4ABZA 1DU0A 2O03A 2XPVA 4L0YB 1V54H 5IP9J 3WTYC 3IUOA 3ABUA 2X4HA 1TQPA 2EINH 4GCVA 2QQ8A 5K7ZA 2H6BA 4DOZA 1AOYA 5HS7A 1K83J 5GADJ 2YS9A 5FLVA 1I1SA 4RLFA 4DNCA 4WF2A 5EEAA 3RSNA 1O3QA 2DN0A 2ME6A 5ERIA 4E7HA 1LUJB 4CCJA 4Z6YA 1ZRCA 2BHZA 5HS9A 2B0LA 1S29A 2BEOA 4B09A 4PJMA 1ETKA 2XAJA 4L9NA 1Y6IA 4OIPF 1X4PA 2L01A 5KHDA 2HYFA 5JR3A 1UHWA 1RESA 4M3BA 3CESA 5C3EJ 5BPDA 2FOKA 4QSHA 1BR4A 3MFKA 5GTHC 2JK3A 4IRHA 2XAGA 2HZDA 4XRSG 2HOTA 4IHTA 2PX9A 3BOQA 5K5QA 5JLWA 2R7ZJ 3LWFA 2XUBA 1YJ9I 4HLXA 4AVZA 1D1BA 4E70A 1A6QA 2XB5A 3ISPA 1SD5A 3ZXSA 3QP6A 2KIQA 3OYHA 3Q3SA 3JRCA 2R7FA 5E3LA 2E36A 2FQ3A 2UWMA 3WTUC 2DA1A 1H0MA 3ELKA 1J59A 3HOYJ 2PEXA 5D6FA 2E1MC 3GTQJ 2E35A 4ZZDA 3HPGA 3OYJA 3AL0B 4MTEA 1T2KA 4HNTA 3D1NI 4LG3A 4EJOA 2ELJA 1Z7UA 3DBHB 3CMYA 1B1BA 1A04A 1G3WA 4UXNA 2K3FA 4L5EA 3M8FA 2Z33A 2I8DA 3CJQB 4U7DA 3QOEA 1H9TA 2NS7A 3GLLA 4LB5A 1WSUA 4LIVA 3GCMA 1MSEC 2IP2A 1J5YA 2DW4A 2OQRA 4B43A 4DZJA 5F27A 2FX0A 1ZGAA 5DM7F 2IJLA 2JN6A 2JVGA 2WA0A 2XAQA 4A0XA 2XROA 4HDUA 3KPHA 3ZRGA 3ZMDA 2CV2A 1A36A 1POGA 1V5GA 2VIXA 2Y0SA 5FFXA 5IT9Z 4KMFA 2W85A 2DFEA 3HM5A 3FXMA 1QZZA 1R4NB 3F8NA 2BY2A 5GTIC 5J47A 5JHUA 4DIQA 4PGHA 3B6AA 1PP8F 1G3SA 3I58A 2F4MB 2ZKZA 1IV8A 4RBOA 3PQJA 5LGTA 4JX4A 3GWZA 1HBXG 3G1LA 2K9NA 4J19A 2ZCWA 2VQGA 3VYRB 1WVRA 3FXJA 1BW5A 2DXIA 2P7VB 5FD5A 2F5FA 1SFKA 2DQRA 1MBFA 2MFZA 3OYCA 1ZRDA 2DT5A 4UHTA 1HC8A 3AKZA 1DGWY 4OMZA 4S0HB 2UUZA 1XGSA 2Q2EA 3CP2A 1TC3C 1OFCX 1ZG5A 5LGUA 2WY7Q 2RN7A 3MZ8A 1EH7A 3HGYA 2GA1A 5E3MA 3H3UA 2JTVA 2E7WA 2L54A 2LDUA 3A4CA 4Y15A 5LGNA 4CXFA 1VQNI 1PVEA 1JGGA 3BQYA 1MDMB 2DDBA 2XSJC 3LNQA 1RNLA 2A5YB 2JT1A 2V1XA 5FFZA 3A03A 3GUDA 4KN4X 3BG3A 2HPMA 2VPRA 3K0LA 4BJ6C 4HW0A 1TWFJ 2M8GX 4M73A 3V4GA 3QYEA 2P4WA 2R0QC 1KA8A 2Y30A 3K2AA 3W6KB 4ETSA 3K1MA 3MKLA 4N4NB 2L7KA 1ZKGA 2YPRA 2EIMH 1C0WA 3ZP5A 5L3BA 2FQ4A 2JMWA 4ANJA 2KRHA 4EJWA 2IXSA 2H94A 5D6EA 2IVMA 2LY9A 3M4OJ 4PUSA 1WH5A 2VQCA 3V7CA 2R7UA 2CH0A 2RNJA 3S16J 1YOVB 3H35A 3S32A 4KYWA 3BZCA 1I5ZA 3PUFA 1BM9A 3OOUA 2VI6A 3DKWA 5FB2A 2KPMA 4AUXA 1MNMC 2LF8A 2V6EA 4A3LJ 2QM3A 1GHCA 3N4MA 2RGVA 4QIWN 1B8IA 3HKZN 3K70D 2QKMB 2HS5A 2IA2A 3BJ6A 3CD6I 5B66C 3LMMA 3PFYA 2B63J 3SEZA 4LB6B 1ZH5A 2WB1A 2Y2ZA 1TL8A 5J40A 2X1EA 4QLCU 1OCZH 2EZHA 3BJAA 3HJEA 4RGXA 2CUJA 1OYWA 3BT9A 1EKEA 2KRCA 1YLFA 3R0AA 1SAXA 2P8TA 1U6GA 3F8FA 3CCRI 3LSPA 1RR8C 2R7OA 2IBDA 1ZGJA 3L9FA 4XNFA 1R22A 1I50J 3WE3A 3ZQIA 2HKXA 5DUKA 2A05A 3F21A 4WXDA 5F64A 5K1YA 4XKCA 5BS6A 3MWMA 3WODF 4HV6A 1ZN2A 3KLOA 1AKHB 3FZVA 3I56I 4O3MA 2Y69H 2D1HA 1S6LA 1BW6A 3GFJA 1PDNC 2ZXJA 5ICGA 3QPLA 2XC7A 1FWZA 3DFGA 2QLZA 4BHPA 2RREA 4HX4A 1ZAOA 2FBKA 3VODA 5ICEA 1S9HA 3KFWX 1T98A 1EA3A 2LH9A 3ZMTA 3VWBA 1E3PA 2E19A 2VKVA 4U87A 2ZMEA 1KQ8A 2R93J 4M71A 4Y33A 4C2UA 1JUPA 2OD5A 4A3FJ 4KIFA 2HXOA 3ZOBA 5EEHA 4ESBA 1JTXA 4EEFG 1WJAA 2VODA 2RC4A 3JRHA 4GXOA 2NVTJ 1GVJA 4XN3A 3RQ4A 3WTWC 1FYMA 5H20A 2ECCA 3W2WA 4M72A 5EYRA 1IRXA 3NAUA 2OV7A 2XGXA 4HZFA 1YRNB 1D8KA 3HOTA 2VOPA 1HDPA 2V1NA 4DBRA 4CCKA 4EV0A 4KDPA 4GDFA 5TJJA 3EPZA 1BOBA 5FROA 3SFIA 4U7BA 3HTUA 1X1BA 3FBIB 1J0RA 4EGYA 3K2ZA 3OL4A 2WAFA 1GVDA 3C2BA 1W5CC 5KCMA 4G7HF 1WZ2A 4HOBA 3SZGA 2EWNA 2M4KA 2XGDA 3GFMA 4CSWA 1XG1A 2HVRA 2EZIA 3E5UA 4PZJA 3BG9A 4DGWB 4YFNF 3HBLA 2YX4A 4C30A 3CMAI 4XRSA 4ZDOA 2CSOA 1ZREA 3QP5A 2D1VA 5M5WJ 4CZZA 1KZHA 1IXCA 2K9QA 2K9LA 1ERDA 5L3GA 5KNLA 2BYVE 2F5CA 2BHYA 1O3RA 4ZZLA 1J9IA 4IRGA 3BPVA 3FKIJ 1H89C 3QPSA 4PJNA 4MQVA 1P2FA 2X85A 4PSXA 1KQ9A 3NQOA 2PJRB 2Z9OA 1R23A 1TQIA 2I10A 5ILUA 4C3HJ 4ENJA 4NC6A 5DV5A 4KISA 3FK6A 2X51A 2XPWA 4G6QA 1FMVA 2OZ6A 2PMHA 3I64A 4XRFA 2Z2SB 3RZDJ 2OBPA 4XLNF 2WY8Q 2H8RA 4CA0A 2KIUA 4XR6A 1HCRA 1WJBA 1BJZA 1BBYA 2JA7J 1R00A 5LHIA 3OIQA 4GFBA 1Z05A 1DDNA 2JUCA 4RM3A 5AONA 3SDGA 2GIZA 3BTLA 2X1CA 2FMYA 4HV5A 4EATA 1T0FC 2ZSHB 1UB9A 2MLGA 3W2VA 1B4AA 1W36C 1KONA 4HBLA 3QWLA 2VQLA 4A3KJ 3ERMA 3DLLF 1VI0A 1IC8A 2I5UA 2QF7A 3ULQB 3OYIA 1OQYA 2LLKA 1K61A 4XIDA 3OMYA 5HLHA 2DOFA 2VKEA 2O8XA 3J81Z 4AD9A 1LFPA 3EUAA 4KT6A 4BU2A 4JQFA 1QO0D 1ZR2A 1O3SA 5IP6A 3GVAA 4II2A 2M8EA 2LC2A 4A0YA 4MTDA 1RETA 3WTTC 4RB0A 1K4TA 5IP7J 4M6YA 4G7ZF 1XN7A 4R1HA 3AL0C 4CGZA 2OJED 1TNSA 1TTYA 4P5OA 3KP7A 3LFKA 1X1PA 2D5VA 3LSJA 2WAEA 2ZJPF 3S2HJ 1VZ0A 3LSTA 1KYZA 5E20A 3DPTA 5M3MJ 1ETXA 1OISA 3FXUA 3S2DJ 3CMEI 1YX5A 1R1TA 3TO6A 3FXLA 3V42A 4IEJA 4M9XA 3X2QH 4GO1A 3SEQA 2ZC2A 3LAJA 4XLFA 1NH3A 2M87A 3BR5A 2VE8A 2ZBKA 9ANTA 3T8RA 5IYDJ 1EH6A 1LPQA 5J3LA 3R6SA 3WGHA 1IDZA 1SFOJ 2V26A 2NRAC 1U0JA 5E8IA 3JAMK 1U2WA 1FTZA 4Y13A 2E5NA 4FASD 2GOXB 5EF6A 4B44A 3P9IA 2L9NA 2NAZA 1BL0A 2BXYA 2XF7A 1IN5A 3J7ZI 1CQTA 1WJ5A 1YG2A 3KYDB 4MHGA 4F52A 2R7SA 1KU7A 4XSXF 3F72A 4IHXA 3C18A 3HRUA 4FT8A 1WGXA 3KZIC 2KIMA 5F1RA 4KFCA 3QPTA 4N0BA 3HG9A 1D5YA 1BI0A 2HEOA 5E1WA 4I76A 2HZTA 4XONA 4RB3C 3DU6A 1OJLA 1QHHD 5B5EC 1FOWA 2EV6A 5D5VB 1IUYA 2E2JJ 3K4NA 1K6YA 2F5DA 4LIUA 2W57A 4Y7NJ 4ZYAA 4KIGA 3H3ZA 3CDIA 1TNTA 2VKHA 3TO7A 2X1DA 4I99C 2L9SA 4ON0A 4QPOA 3VDXA 4HQMA 2L9VA 3S3MA 2EIJH 3B73A 1VQMI 1YHQI 2H1LA 3FMQA 2VUMJ 3RPQA 4N4OB 5D5WB 2QYOA 1TW2A 3ESWB 1OMIA 3PIOF 1REPC 2CUEA 2WBMA 1SD6A 5KVRA 4AYBA 5BPIA 1ETQA 1MNDA 1IDYA 1JI8A 3CP8A 1E3OC 3ONQA 3WG9A 4AVPA 3JCUC 4E7LA 1SD4A 4NQWA 2QEXI 3RDIA 4I09A 1U8RA 2IGOA 2E2HJ 2EFNA 1QA6A 3IWFA 2M30A 2EFQA 1S8NA 3I9V2 2QVOA 2NVUB 2KMUA 1MNEA 5FKKA 4MLOA 3WTXC 5F04A 3S1MJ 1FC3A 2KKOA 5LHGA 5DEQA 5L3EA 3KEYA 2Q0OA 5K5RA 1JGSA 5E18F 2CQNA 4U0YA 1G3TA 3KP6A 3DPLC 2HYJA 3CLQA 3EUKL 3ABTA 1H88C 3FIWA 2X9DA 2JVHA 2VT2A 3WE2A 3E1SA 1S7AA 2IRFG 3GW2A 2DJIA 3L7WA 2JSCA 4A69C 3KCCA 4BE1A 2MC4A 2PQ8A 4LG0B 3BPXA 1W7PB 3O2PE 2O6GE 2GQQA 2KQRA 4QTRA 4AWXB 2CQQA 2Y31A 2CGPA 4CCOA 5HLIA 3LSMA 3SYTA 3CJTB 3M8EA 1LVKA 4YIIA 3FHNA 2EPFA 2M7BA 3HSEA 1MBJA 1FSEA 2CW7A 3ZQFA 2W82A 1DP3A 5EEGA 3C2HA 1HW5A 3AG4H 2VJJA 2YU9J 4G6DA 1ITYA 3DV8A 2BY0A 4Q4ZF 2V1DA 1PJRA 4M6VA 2ZNZA 4A3MJ 3H0GJ 4HX7A 1T38A 4KN7X 5IPAA 4U0WA 2A07F 3LFUA 3PIPF 1TWHJ 1YTYA 3RKWA 1RUOA 4PFOA 4LOCA 3HB9A 4XLEA 4IRIA 3TGNA 4E7KA 3G73A 1BI1A 2L5QA 4Y17A 3L2UA 4JX5A 4HDVA 1Q1VA 1DUXC 5CQEA 1IN6A 4NQWB 2CU7A 4BY1J 2CYYA 3CLOA 2LKSA 2XF5A 1HQCA 4D1QA 3LQQA 3NWSA 3OYMA 2P5LC 4F55A 3J80Z 5GAHJ 5J8CA 4OIOF 4V2GA 3HOZJ 3G3ZA 5E17F 1IAWA 2K9SA 1UMQA 2CW8A 2M2EA 3WU2C 1LDDA 2ECBA 3FXOA 1RPWA 4A2UA 2COBA 5EGOA 4P96A 2XAUA 1YIJI 2FD5A 3K10A 2CWEA 4XOTA 3HSRA 4YELA 1JE8A 1FP1D 2HDWA 3CDLA 2VC1A 4M3EA 3SHFA 4D7NA 1FP2A 1XTAA 2P81A 4FE4A 2ZXHA 2HQRA 2O7OA 2UZKA 1YS6A 4NB5A 4MEYF 2FXAA 4XN0A 4IKFA 5JI6A 2K86A 1FIPA 2L4MA 3G4SI 2Q1ZB 4B1RA 4OMYA 3Q5FA 4MEXF 3FXKA 2MBFA 1U9NA 5EG0A 4XLCA 3C3WA 1WPKA 1AWCA 5A2QK 2DMUA 1MDMA 2IAIA 2XKPA 1TWCJ 3DBLB 3PFIA 3F8MA 1SVOA 1JKQC 3ZGKA 3WHBA 5E8GA 4DQ2A 1NK2P 2WC2A 1Y8QB 2L7ZA 3QU6A 2DPUA 1LQ1A 3IRQA 4Y52J 1QVTA 2YU3A 3MZHA 3QPHA 4EM2A 4HQEA 1R5HA 2F4OB 2HDCA 5KAIC 2M0CA 3COAC 4U0VA 4AIDA 1MSFC 4IX7A 3VB2A 3DLAA 2ZFUA 4BEHA 4Q48A 5D5UB 1CF7B 2G7UA 1FNNA 2AQFA 2DA3A 2VQHA 3IH2A 5FD6A 2EA4A 4LLGF 4RGSA 2IA1A 5BQTA 4B48A 2EJRA 3RYPA 2XGCA 3HYIA 2YX7A 3I5UA 3F9KA 1XSVA 2K7LA 4RAZA 3MKZA 3G1MA 2IA0A 4II3A 2R7TA 3CCYA 4L0ZB 3OYDA 4OWRB 1F1ZA 2XDVA 2ZFWA 1AA7A 4ZDPA 5J1UA 5B3SH 1YW7A 4UUTA 4AIHA 4A93J 2VL8A 2QBYA 2K40A 3O6BB 2QQBA 1KYWA 4EJTA 4BBSJ 1K78A 5EGOB 1I3AA 2XF6A 1LFUP 3S2WA 4CCMA 3GMEA 5LBQA 2UXNA 2JZYA 3JRDA 2ZMEC 4HNUA 1SC7A 3OYLA 1YS7A 4L9TA 3E7LA 3KEQA 2BY3A 4A0ZA 2XSDC 4WK8F 4HLYA 3WU1B 2H09A 4YRVA 3CO7C 5DTDA 4IZZA 1V4RA 2H1KA 3MMYB 1QQIA 2CQKA 1P6RA 3E97A 2R7DA 1Y0UA 1Z6TA 1VQ9I 4BXUA 3I4NJ 3H9QA 5K5OA 2QSGX 2NYXA 2W1OA 1X19A 2VB6A 3CUQA 1QPMA 3LQRA 4HF2A 5EG0B 3LA3A 1EH8A 1MIJA 2HI3A 4JP0A 1XC5A 5KK1A 2L0KA 3F8BA 3MEXA 5CLSA 2K02A 1F4KA 2DYSH 5F08A 1U9OA 2PLYA 2GXBA 3CDHA 4A3DJ 3K9TA 1R1VA 2EZLA 1IRZA 3S1QJ 2JA2A 3GLXA 2VONA 1NTCA 2DA5A 2VLAA 1UAAA 4C3IJ 1T39A 1IRFA 2DFHA 3SFZA 1HXDA 3F6OA 3KETA 4C2MJ 3CCVI 1BJAA 3E6BA 1HKTA 1AKHA 4XBFA 3K4MA 5GPAA 3CCSI 2NVQJ 2X48A 4GYIA 2LBFA 3ZQLA 5IT9K 3RPUD 2VASA 1MW7A
chains in the Genus database with same CATH topology
1T08B 1LUJB 1M1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T08 B;  1LUJ B;  1M1E B; 
#chains in the Genus database with same CATH topology
 1V5E A;  1W0T A;  1DPR A;  1SAU A;  2LRD A;  3DEU A;  1STZ A;  1W7P D;  4X0G A;  1A31 A;  4BEH B;  3JRA A;  1JUS A;  2K4J A;  2O5R A;  3A0B C;  1N25 A;  2DK8 A;  2R5Y B;  3CC2 I;  2AQE A;  2K85 A;  1JKR C;  2GM4 A;  4RLQ A;  2F2E A;  1TBX A;  1QU3 A;  1UJ8 A;  3W2A A;  2NS8 A;  1DU6 A;  2ZB9 A;  2XRL A;  1E3H A;  2HGC A;  3M7G A;  1FBS A;  3V8L A;  5D5X B;  2DFF A;  2MA3 A;  5FKL A;  5B1B H;  2LMD A;  4NUB A;  2VXZ A;  1U5T B;  2OQG A;  1ON1 A;  3N05 A;  3CZ6 A;  4FE7 A;  5D8L B;  1TT0 A;  1JT6 A;  4A12 A;  3GEZ A;  3RI4 A;  1APL C;  1O4X A;  2DMT A;  1K78 B;  3HUG A;  3PQK A;  1YI2 I;  4B3X A;  3CJR B;  3FF5 A;  3CQZ J;  3TL4 X;  3TMO A;  3DKX A;  1YRN A;  4CDG A;  3WG7 H;  2IS6 A;  5F0H A;  1YW8 A;  1FEX A;  3F3X A;  3M3Y J;  3WGI A;  2ME0 A;  1USS A;  4LLL A;  2KT0 A;  1Z1D A;  2V4J C;  4HG2 A;  3H9G A;  4WXC A;  1XSD A;  1TWG J;  2BBY A;  2HOS A;  3BJO A;  2IGN A;  3CUQ B;  4YG2 F;  3DTK A;  2YUS A;  2HWV A;  4MO7 A;  3U1D A;  1T6S A;  3ZQH A;  2XV4 S;  4E7I A;  1RZ4 A;  3DQV C;  2W48 A;  1OCC H;  5J6X A;  1SD7 A;  4BXX J;  3REO A;  3AFH A;  3DTE A;  3JTH A;  2BW3 A;  2WTE A;  4G12 A;  3FMR A;  5B1A H;  4RB2 C;  3FK7 A;  5DM6 F;  1HLV A;  1OCR H;  2QEN A;  2OC6 A;  3D0S A;  3DP7 A;  4F7Z A;  2V9V A;  2L2O A;  5C44 J;  3JSP A;  2HOA A;  1P4A A;  2W00 A;  4AIJ A;  5DCF A;  3HC7 A;  2QSH X;  3OV8 A;  2RAE A;  4A5M A;  3R4K A;  4E7Z A;  1YO5 C;  2LBF B;  3V8J A;  3LSI A;  4CYD A;  3O3K A;  2PJR A;  3CCU I;  3NWT A;  2E2I J;  2OA4 A;  2A6H F;  3VYU B;  5M5Y J;  1SMY F;  2LRE A;  2YR2 A;  1TT5 B;  4IPA A;  5IYB J;  3OSG A;  4JOM A;  1J7K A;  3MN2 A;  5GAE J;  2W84 A;  3LAP A;  4HF0 A;  1ZRF A;  2KDO A;  3AG3 H;  2NXN B;  3K4C A;  2R7X A;  1IXR C;  2IEK A;  5EZH A;  4RGR A;  1TP4 A;  2FNA A;  4YIR X;  3FM5 A;  3OYN A;  4G6T B;  2QKL B;  4O6J A;  1XCV A;  3ML6 A;  2W7N A;  4BAC A;  1CGP A;  2V7F A;  2L4A A;  4B8X A;  1MBK A;  3VYS B;  1FOX A;  5GAG J;  2NOJ B;  2DQL A;  3HUG B;  3JRE A;  2EIL H;  2EH3 A;  3M1E A;  3E3V A;  1YIT I;  5FKN A;  4BL0 B;  2EIK H;  3IH3 A;  3ZR8 X;  3FKJ A;  1UZC A;  5ICC A;  4LMY A;  1T33 A;  3D5S C;  1S7E A;  5CQG A;  1VQ7 I;  5IOZ A;  2H8W A;  4KIT B;  4YEJ A;  4CH7 A;  3L1P A;  1Y1W J;  2DYR H;  4ZDL A;  3J7A Y;  4XL9 A;  5FGM A;  1BC7 C;  1UFM A;  1Z9C A;  2PMZ A;  4ZC3 A;  4XLH A;  1D3Y A;  5J4V A;  3O8G A;  4AU7 A;  1IUF A;  3TDZ C;  5GPC A;  4IJA A;  1GXP A;  2WB1 N;  1U3E M;  1R9T J;  2FSW A;  5K7F A;  3OYG A;  3CMM A;  3H1C A;  1JJ6 C;  4KMU X;  3V7R A;  4E4H A;  1DP7 P;  2NVY J;  4M9S A;  3OIP A;  4BHC A;  1XD7 A;  1RR7 A;  3A01 B;  1B59 A;  2BW3 B;  3H5R A;  3DF8 A;  2A69 F;  1PUF A;  3BZ6 A;  5F1J A;  4ESF A;  4RMN A;  1D5V A;  1B6A A;  3K70 C;  2HVQ A;  4N9I A;  3BG6 A;  4PGG A;  1LDJ A;  2EV5 A;  1GT0 C;  3HRT A;  1L0O C;  4RAF A;  4TV7 A;  1XGN A;  2P6T A;  2X6O A;  3IWZ A;  1XMK A;  3D5L A;  3HHG A;  5HLG A;  3RJP A;  2KP6 A;  2EV0 A;  1WJF A;  5HOO A;  1IG7 A;  4XKB A;  3GTG J;  3ABL H;  4XLA A;  3KP3 A;  4LD5 A;  1VQ5 I;  1S7O A;  5FRN A;  2FF4 A;  1VQ6 I;  4IOC F;  2LK2 A;  2DCE A;  2OAZ A;  4I0B A;  5L3D A;  2FEZ A;  2VXD A;  2M0M A;  5HDK A;  4A6D A;  2YSR A;  4BQO A;  4F3Q A;  1MZB A;  3VEP A;  3KE2 A;  2K9M A;  1ETW A;  2ZXI A;  4JYK A;  3C7J A;  3GBG A;  3CF2 A;  4BXF A;  3R61 A;  2VOO A;  4XOR A;  2KRF A;  3EUH A;  3GTL J;  1BR1 A;  1G6N A;  3GF2 A;  5DDG A;  1SFX A;  2WAD A;  3WTV C;  5FLX Z;  4HPQ A;  1P7J A;  2CQX A;  3GTJ J;  1WRJ A;  1UST A;  1XDU A;  2HDD A;  3C2G A;  1O57 A;  1JT0 A;  3A1Y A;  3OYB A;  3L2Q A;  1BI2 A;  4HNV A;  4IL6 C;  2JA8 J;  1V3F A;  5CVV A;  2VJ4 A;  4AM3 A;  3DTI A;  2AXL A;  3K7A J;  4BKX A;  2KFD A;  4PCQ A;  4WXH A;  2IS4 A;  3QAH A;  2CUF A;  4LK1 F;  3FHZ A;  3GZN B;  4OAZ A;  1OCT C;  2DDA A;  2EB7 A;  2ELK A;  4QPQ A;  3BCA A;  4MQ9 F;  4ESJ A;  1Z67 A;  3KZY A;  1LEB A;  2HVS A;  5AIP A;  4BUP A;  5FKM A;  2TCT A;  5D4R A;  1BR2 A;  3QU3 A;  1MMG A;  2HPI A;  2WV0 A;  2XGE A;  3IHU A;  1FJL A;  2XRN A;  5H6R A;  4G9Y A;  1R5I D;  3TOB A;  3OR2 C;  2K5C A;  5HNF A;  3HOV J;  3H36 A;  2FE3 A;  3FX3 A;  3ECO A;  3OWT A;  2K27 A;  1PUF B;  3JW4 A;  1VQP I;  1D1A A;  3L2C A;  3WU0 A;  4AIK A;  3DU5 A;  2DT7 B;  2CW0 F;  1IF1 A;  1SAN A;  2G7H A;  3WTZ A;  4BGD A;  2BVM A;  2W25 A;  4ENN A;  1ORK A;  5DCM B;  5CVI A;  1ZK8 A;  3ROU A;  3TED A;  3GTO J;  4FET A;  2LFB A;  4KIC A;  1IV6 A;  2QCO A;  3IAM 2;  1UHS A;  1G8X A;  3TOA A;  2DI3 A;  3SZT A;  2GXA A;  4Q47 A;  5JVT A;  3RKX A;  2D2W A;  3LSK A;  5TIS C;  4BQN A;  2OCE A;  4GRI A;  5DS9 A;  1S72 I;  3KEO A;  3RPU A;  2K3P A;  1Y39 A;  4LG0 A;  1O7F A;  2VBX A;  1X2N A;  2DA2 A;  1W7P A;  4MFE A;  3S17 J;  3BTJ A;  1O7L A;  4S05 A;  3I54 A;  2MD5 A;  2AXT C;  4HX8 A;  1OLT A;  3CCL I;  2BE5 F;  3J81 K;  1Z91 A;  2UV1 A;  2AHQ A;  1J2X A;  3BR0 A;  4G7O F;  1LVA A;  2ESH A;  5CVR A;  3ZQG A;  4C3J J;  3QRF F;  1XSX A;  3BCB A;  1RI7 A;  3EQL F;  4E6K G;  4ITV A;  1BOA A;  2ZO4 A;  3E0J B;  2JJ7 A;  2RVC A;  2N8G A;  4ENK A;  1Y56 A;  4BAY A;  3P9C A;  4EGZ A;  2RV8 A;  2WAQ N;  3OIO A;  2RKH A;  4UVA A;  2DTR A;  2QQA A;  3SQN A;  1YX3 A;  3I3L A;  2R7Q A;  3DXJ F;  3Q0U A;  1Q1H A;  2ADU A;  2KJC A;  1HKS A;  2XAF A;  3F0C A;  3K4K A;  2ID3 A;  3TDU C;  1LDK B;  3HHH A;  4NBQ A;  4C9Y A;  2QA4 I;  3W6V A;  3ZQ7 A;  4ZH4 F;  1K6O A;  4HRI A;  2E1N A;  1Z6R A;  2V9K A;  4IQJ A;  4I98 B;  2XIG A;  4HA8 A;  3SJM A;  3GYH X;  3HOW J;  1ETY A;  1ZAR A;  1J09 A;  1Z77 A;  2DA7 A;  4YFX F;  2GBY A;  3M9A A;  4D5F A;  5IYC J;  3E6M A;  1IJW C;  2JWT A;  3NRV A;  2R5Z B;  3K1P A;  4FX4 A;  1IW7 F;  3G71 I;  1FPQ A;  2VJ5 A;  1FY7 A;  3BR3 A;  3BTC A;  3G2B A;  5CJ9 A;  1D1C A;  1F36 A;  1OCO H;  3I71 A;  4RS8 A;  4A3E J;  1XGM A;  2X6X A;  4BYY A;  2ZJR F;  1ONV A;  4BE2 A;  3S8P A;  4K2E A;  5EDN A;  2R7R A;  4MFD A;  2DOA A;  1MJA A;  5LLQ A;  2GLO A;  2M45 A;  3Q9V A;  1Z3X A;  3BR6 A;  4CZC A;  1VF9 A;  2ZJ2 A;  3CF5 F;  1HST A;  1A35 A;  3A2K A;  1H9G A;  3KP4 A;  3NEU A;  3HOX J;  5LHH A;  4B47 A;  4UUS B;  3ZMS A;  4IHV A;  1R36 A;  1WH7 A;  2STT A;  3CC4 I;  2LR8 A;  3RZO J;  2Z16 A;  1K4S A;  1F43 A;  2LP0 A;  4GGG A;  5J4Y A;  2FA5 A;  1QPI A;  3OOP A;  4ZTJ A;  3S3O A;  5H2F C;  1A6I A;  2DMP A;  1HDD C;  4HF1 A;  3V7S A;  2KIF A;  4XKW A;  2O3F A;  3CCM I;  2XKO A;  1FYK A;  2MAB A;  2G0E A;  2XAS A;  3K4L A;  1IO2 A;  3H3V K;  5E3N A;  2VBZ A;  5BOX A;  4ASN A;  4F92 B;  1PP7 U;  2L02 A;  1ENH A;  3LA2 A;  1O3T A;  5ED4 A;  2ICW G;  4XK4 A;  3ZMU A;  4V19 K;  1P4X A;  2Y48 A;  1QRY A;  1FYL A;  1CF7 A;  1GV5 A;  2VJI A;  2GAU A;  5HVQ C;  4U88 A;  4W1U A;  1WI9 A;  1RRJ A;  4RM2 A;  2GXG A;  3J7Y J;  4PJJ A;  2JQ7 A;  1QZY A;  2F48 A;  2EA2 A;  4BJ5 C;  5A2Q Z;  3LSR A;  4BBR J;  3PO3 J;  4YIF A;  4A3B J;  4OIR F;  4OAY A;  1B72 A;  1MKM A;  1OCP A;  1S5L C;  4LGW A;  2ACJ A;  4M3D A;  4MNU A;  1V55 H;  1YQA A;  2EZK A;  3KP2 A;  1NK3 P;  1FIA A;  4EM1 A;  1A5J A;  2F6C A;  2MD0 A;  3T8T A;  4HYE A;  3SZP A;  1QHG A;  2M34 A;  1LB2 A;  5HDN A;  3GZ5 A;  4EQQ A;  1U78 A;  3SDB A;  4P9F A;  1YJW I;  2M5W A;  1X3W B;  1QGP A;  3L09 A;  1ULY A;  2DMQ A;  2DBB A;  1MMA A;  4F93 B;  2GZW A;  2MC3 A;  1KU9 A;  1KU2 A;  1GUU A;  1ZG3 A;  1G4D A;  2L7F P;  3DEE A;  2JUG A;  3VSL A;  1FSH A;  3IP4 B;  2VC0 A;  2VBY A;  3EDP A;  1HW1 A;  4EJV A;  1MBH A;  5EZG A;  2BGC A;  5F6F A;  2ELH A;  1IGN A;  3I59 A;  4DBQ A;  4O5V A;  2PJP A;  2CFO A;  1DPU A;  4PDK A;  1LEA A;  2MYS A;  1G59 A;  3KLN A;  1ZQ3 P;  3QOP A;  5HS8 A;  1ZLJ A;  3AG1 H;  3ZN0 A;  4UB6 C;  1NG6 A;  1YJN I;  3DPU A;  4NDL A;  3BDD A;  1R1U A;  5F0F A;  3HOU J;  2CO5 A;  2M1B A;  1JKO C;  4JK1 X;  2CFX A;  1BI3 A;  2HQ5 A;  2L9R A;  4FX0 A;  5J8F A;  2J5O A;  3I53 A;  3MQ0 A;  4IVN A;  5CYV A;  1FX7 A;  4XLP F;  4J00 A;  5HLT A;  2DLL A;  3JRI A;  2EQR A;  3Q9S A;  3OS2 A;  2F5V A;  2R3S A;  3J80 K;  3GTP J;  3JR9 A;  1SFU A;  1HW2 A;  4A3G J;  2FML A;  2CG4 A;  2R5Y A;  4P9U A;  3CCE I;  2E7X A;  1MJ9 A;  2NNN A;  4C2T A;  4W97 A;  2M3A A;  1FZP B;  4DJA A;  4NHJ A;  1HOM A;  5LEK A;  2E1C A;  3A0H C;  2KZV A;  5LEJ A;  1VFC A;  3BRO A;  5GP9 A;  4F91 B;  3G1O A;  1B72 B;  3AG2 H;  1X1D A;  5E3O A;  4D0P A;  1FT9 A;  3ZQC A;  2FJ1 A;  3LOC A;  1BN5 A;  2QZ8 A;  3HRM A;  3U2R A;  2WWY A;  1U5T A;  3PUB A;  2M7A A;  6PAX A;  3S1R J;  3BY6 A;  1MMD A;  1GLN A;  1BIB A;  1KU3 A;  1V5F A;  2H6C A;  4CHU A;  2EFW A;  3FIS A;  4S04 A;  1VND A;  1E2X A;  3M07 A;  3FXR A;  4WX9 A;  4NC7 A;  1IN4 A;  1UG0 A;  3GX4 X;  5AIQ A;  2QQ9 A;  5DD4 A;  2GOM A;  4LFU A;  4B4C A;  4DYQ A;  2E71 A;  3HKZ A;  2CQ7 A;  3P7N A;  1D0Y A;  2OF7 A;  2LG4 A;  2P5V A;  2HXI A;  2Y0M A;  3WGG A;  1TWA J;  3QYF A;  3ZN1 A;  3JRB A;  1OR7 A;  2HTJ A;  3OL3 A;  1U8B A;  1T08 B;  4I7H A;  1N78 A;  2UXX A;  2G9W A;  2VT3 A;  3OYE A;  2LD5 A;  3TP0 A;  2CV1 A;  3OS1 A;  5IOY A;  3I59 B;  1ZG1 A;  3MKW B;  4UVB A;  4FCY A;  3MKY B;  3PNT A;  4FQG A;  3HDD A;  3F22 A;  2HNH A;  3S3N A;  1XMX A;  2LVS A;  1IN7 A;  3WHC A;  4G8X A;  1EJ9 A;  1Z7L A;  1SMT A;  2DU9 A;  2DAO A;  4I01 A;  2FBH A;  1R58 A;  3BZK A;  2O61 A;  4HSR A;  3BC8 A;  2LYC A;  5IY5 H;  1WWX A;  4A3C J;  3HZJ A;  2CMP A;  2Z1D A;  1R6R A;  3GXO A;  2OTJ I;  4UVC A;  4BS9 A;  3C1D A;  3WTS C;  1IXS B;  3DKY A;  1MD0 A;  3A02 A;  2LY1 A;  2MSY A;  3BR1 A;  3CTA A;  5HOD A;  3S14 J;  2X6Y A;  3VYT B;  5K7H A;  2KJB A;  3TW6 A;  1HKQ A;  3IKT A;  4Q5S F;  3BP8 A;  2RDP A;  2V9P A;  3EYY A;  2VPL A;  1X4O A;  1MH4 A;  2HQN A;  1MH3 A;  2AS5 F;  5JHF A;  3HIF A;  3I4M J;  1E0E A;  4A6E A;  4ZTF A;  5LRR A;  3ERE D;  3CC7 I;  2KLO A;  3IRR A;  1ETO A;  2Z99 A;  1OKR A;  2PI0 A;  3TP3 A;  1WHU A;  1JKP C;  1MMS A;  1WI3 A;  2QUF A;  5CVJ A;  1DQU A;  5FRM A;  1XCB A;  5FO5 A;  1IZ1 A;  1W1W E;  1VQK I;  2Y0S N;  1M1E B;  2HQA A;  2A61 A;  2XB0 X;  4XM3 A;  5ILS A;  3AAF A;  2AO9 A;  3BLY A;  3MZY A;  2WV1 A;  5DYM A;  1QVU A;  2B7E A;  2M4G A;  3GFI A;  3B02 A;  4E7S A;  3T1B A;  3FMS A;  3LA7 A;  3GO5 A;  2K4B A;  1FLI A;  2JSP A;  3BTI A;  3OR1 C;  1P9Q C;  4M74 A;  4AC0 A;  1W5S A;  3FXQ A;  4KJZ A;  2HR3 A;  2MW8 A;  5BNG A;  1N77 A;  3U1K A;  4H0E A;  4CYC A;  3K1N A;  5CKT A;  3HSF A;  3I55 I;  1ZYR F;  2OPT A;  3EUH C;  1FOY A;  1ZEL A;  1HF0 A;  1SFE A;  3OYF A;  1W4M A;  1ODD A;  4ZYE A;  2GIV A;  1J75 A;  3S1N J;  3HTS B;  3IL2 A;  1X58 A;  1BA5 A;  3BWG A;  2BZT A;  4D9J A;  3PM1 A;  5CPR B;  2A6E F;  2DK5 A;  3F6V A;  3VSK A;  4JX6 A;  3A01 A;  4XMY A;  3JRF A;  1VQL I;  2Q2E B;  1KGS A;  1ACI A;  4IHY A;  3QYB A;  4IHW A;  4LK0 F;  2RNG A;  4L9V A;  1ON2 A;  4IOA F;  1DGR M;  2D45 A;  4EJU A;  3L2V A;  4KT5 C;  3IV5 A;  1GDT A;  4J01 A;  5L3C A;  3EYI A;  1XB4 A;  3I4P A;  3KZZ A;  1WJC A;  4BHB A;  5H6Q A;  2P5K A;  2P0W A;  1R4M B;  5TGT A;  3UKG A;  3PJR A;  1ETV A;  2F5E A;  2LTP A;  3RIR A;  4M3G A;  4ZYD A;  1TZL A;  1XX5 A;  2TDX A;  3CUO A;  4BNC A;  1YIO A;  4RDU A;  2OZU A;  4RAY A;  4FTH A;  3MAJ A;  1F5T A;  4LJZ F;  1W36 D;  1QZE A;  2KDZ A;  2FRH A;  3LL7 A;  3BG5 A;  1XDS A;  4EVI A;  3OYK A;  3MVP A;  4P1W A;  1F9N A;  3IH4 A;  3HOS A;  1T56 A;  1X3U A;  3RQI A;  1PUE E;  1ZR4 A;  2DFI A;  4DW6 A;  4IXA A;  4UV8 A;  1LFB A;  4RB1 A;  3S93 A;  4R8H A;  4PJL A;  4X6A J;  1MBE A;  1R49 A;  2GA2 A;  2OUM A;  4JBA A;  1YW9 A;  4OOI A;  2IW5 A;  3RYR A;  1D0Z A;  3VOE A;  2QSF X;  1JJ8 C;  2NVX J;  2L7M P;  3T5X A;  3TKY A;  4I6Z A;  3RTR A;  2R92 J;  3OYA A;  4P55 A;  3ZQQ A;  2FOW A;  4BQA A;  1N75 A;  2X6W A;  2HFH A;  3R0J A;  5M3F J;  1ZTR A;  2DJN A;  3HRS A;  2DOE A;  2P7C B;  1EV7 A;  1NG7 A;  3GFL A;  2R7W A;  1RUN A;  3K4B A;  4RGU A;  2CRG A;  3V8K A;  1XPX A;  1TLH B;  1K7A A;  2IS2 A;  2JRM A;  3IAS 2;  3OS0 A;  4CYC B;  1GV2 A;  3E5Q A;  3Q0V A;  1T95 A;  2ZNY A;  2QWW A;  1Y1V J;  3KP5 A;  1RKW A;  1B8I B;  5LRS A;  2STW A;  4QWQ A;  1MBG A;  2VE9 A;  1ZHF A;  4D7M A;  2ETH A;  3L00 A;  3TO9 A;  4MIM A;  1Z21 A;  2DA6 A;  2ZJQ F;  4CO8 A;  2FBI A;  2BVL A;  5M5X J;  3OY9 A;  3F23 A;  3W6J B;  2E1M B;  5JVG F;  1VQ4 I;  4PK4 A;  1RIO H;  5TRD A;  4HST A;  2PN6 A;  5HNH A;  2PBI A;  3W3C A;  1UCR A;  2Z3Y A;  4FHT A;  4Y4R A;  3QQA A;  2OU2 A;  4I2O A;  1R5G A;  5L3F A;  3EET A;  1ZLK A;  2HKO A;  2BV6 A;  1UEL B;  4L5I A;  5ICF A;  3ABM H;  2VN2 A;  1I39 A;  4PSW A;  2O0Y A;  4ZJZ A;  4PFP A;  5FKO A;  4IO9 F;  4ENM A;  5DCM A;  2MH2 A;  2A6T A;  2BOL A;  2QGU A;  3H9J A;  4MGR A;  1LKX A;  4HAM A;  2MH9 A;  3MCZ A;  1SEU A;  3ZCO A;  2CUZ A;  4DZP A;  4E7J A;  5J1Y A;  2JA6 J;  3H92 A;  4A3I J;  2ISZ A;  4UUV A;  2J5P A;  4M9Z A;  1FBU A;  1QNT A;  1SVM A;  2COM A;  3CCQ I;  2CJJ A;  4UV9 A;  1R7J A;  3ZMV A;  4CCL A;  1VQ8 I;  2LOO A;  2DO7 A;  3E5X A;  2OTL I;  3M8J A;  1JUM A;  1WFX A;  1X3Z B;  2IGK A;  4IQ4 A;  2ZSI B;  5E1Z B;  4D5C A;  1L3L A;  4BH9 A;  4KA4 A;  3GZ6 A;  1UG2 A;  5ILV A;  1Y0N A;  3L2W A;  4LLN A;  4XSZ F;  3M1C A;  3LSG A;  2W4S A;  4ZYG A;  2O9L A;  2BY1 A;  2CV0 A;  3LSH A;  3HL2 A;  2RQP A;  2PG4 A;  3IKV A;  3TQN A;  2ZME B;  1I6H J;  3VFZ A;  1XMA A;  2IPQ X;  3QOD A;  1D8J A;  1XGO A;  3HPH A;  3PL8 A;  3KX2 A;  1JTY A;  1W5T A;  2EFO A;  5E1X A;  3DEW A;  4RAG A;  2LF7 A;  4DYC A;  1B9N A;  4WCG A;  1QBJ A;  1X1A A;  1OYY A;  3ABK H;  2LKP A;  3D5R C;  3K4J A;  4Y3O A;  4EM0 B;  3RKQ A;  2V1U A;  3JAM Z;  4UNO A;  2IGM A;  1B9M A;  5FLM J;  3FM3 A;  4FIS A;  4KNY A;  1FMW A;  2X0L A;  2P6S A;  2EK5 A;  4XKV A;  2FUG 2;  1H8A C;  1I1G A;  2WAQ A;  1BC8 C;  1SVL A;  2PMZ N;  3O8H A;  3DBR B;  2IT0 A;  1WKM A;  2LY2 A;  4A3J J;  2W24 A;  5DUI A;  3FBN B;  3RCO A;  4RA2 A;  2HOE A;  2DTZ A;  3FDY A;  3ZPL A;  2E1O A;  3T0Y A;  2NS0 A;  4A5N A;  3HGG A;  2DOD A;  1TQM A;  1P7I A;  4IHS A;  1KQ0 A;  1G3Y A;  1LNW A;  2R5Z A;  2Z5U A;  2NNY A;  1E17 A;  2ZXW H;  2MG4 A;  1GXQ A;  4OIN F;  5FJ8 J;  3SXY A;  1NHA A;  2DPD A;  3Q0W A;  4ZYH A;  4BDY A;  3FWE A;  1G2H A;  1AU7 A;  3CCJ I;  2JPB A;  3DWL E;  3S15 J;  4I02 A;  1I6X A;  1Z0X A;  2ESN A;  5J1R A;  5F0C A;  2QBY B;  3KYL A;  1OYI A;  2DT6 A;  1W0U A;  1OPC A;  2VKD A;  3ASN H;  4OIQ F;  5FLX K;  4L9J A;  3DCF A;  3N97 A;  3E6D A;  1Z3Y A;  4UUS A;  2ISY A;  1YYV A;  3U21 A;  1PYV A;  3NAR A;  1WCM J;  4HEA 2;  3KIO A;  3HEF A;  3GTM J;  1I3Q J;  3JSO A;  3CO6 C;  1LE8 A;  4L5J A;  3H5A A;  2TRT A;  5LD2 C;  1T8I A;  1FBQ A;  3PNV A;  4B3A A;  5E79 C;  3K6G A;  4BQQ A;  1IRG A;  2XPU A;  2CS3 A;  2E34 A;  4Z2Y A;  4PJ0 C;  4BY7 J;  4WWC A;  3RKY A;  2LKX A;  3KYC B;  1BIA A;  1FTT A;  2E60 A;  3ASO H;  1Y8R B;  1WJE A;  3PSI A;  4BJT A;  4XQF A;  3PO2 J;  2EFP A;  2JRT A;  2IS1 A;  5HDG A;  3GTK J;  5EJC A;  3JTG A;  1UHM A;  4YFK F;  5D4S A;  1XS9 A;  1X1C A;  3ECH A;  4GYG A;  2HYG D;  4LIT A;  4L18 B;  5BMZ A;  5LFA A;  4M3F A;  3UR3 C;  3PNY A;  4XRM A;  2DA4 A;  2GWR A;  3E6C C;  2XHK A;  3HXL A;  2FU4 A;  2HU9 A;  1D0X A;  3K69 A;  3BG7 A;  3OSF A;  1EF4 A;  4OU0 A;  1R71 A;  1AHD P;  4KUM A;  1TW3 A;  1MMN A;  1WJD A;  4I0A A;  2PFB A;  4BE0 A;  3TW7 A;  2A3S A;  1IN8 A;  3L2R A;  4H4K C;  5JLX A;  3TBI A;  1VTN C;  2L3D A;  2B9S A;  5CVU A;  2BXZ A;  3BQZ A;  2LSO A;  4CIC A;  3F8C A;  2HTS A;  1FOK A;  3P5J A;  3U9G A;  3I0T A;  3ZMZ A;  1MGT A;  2MGQ A;  1U5T C;  1K79 A;  2A68 F;  3VPR A;  5C4X J;  4CUG A;  2FNP A;  5C4J J;  2O8K A;  2DMN A;  1MJB A;  2RQQ A;  4NNJ A;  4N9H A;  3P9K A;  4V2F A;  4EMS A;  2Y9Z A;  4KIB A;  4UY8 I;  3IC7 A;  1LE8 B;  1T0F A;  4BDZ A;  3H5N A;  1VQO I;  2R7V A;  1WQ2 A;  1JHF A;  4XOP A;  1JHH A;  1HSJ A;  3J7A O;  3PSF A;  3R60 A;  4DYR A;  1YE9 A;  2XVC A;  2A5W A;  5D8K B;  1ZGW A;  2V6C A;  1OR7 C;  2E5Z A;  2H27 A;  2LNB A;  2KZG A;  4G94 A;  3CUQ C;  1HA8 A;  2JA5 J;  2EBI A;  2PMU A;  2MLK A;  2ID6 A;  4IF4 A;  4XIC A;  4CCN A;  2VBW A;  2Y9Y A;  3CJN A;  5IT3 A;  1YFH A;  2XAH A;  2OCC H;  2NOG A;  2R4G A;  5KAF C;  2C6Y A;  5JFR A;  4NC8 A;  2JPC A;  4M6X A;  4R79 A;  2Q8K A;  4X1E A;  2V79 A;  3B6C A;  1I27 A;  2KL4 A;  3MD2 A;  2F4I A;  3H0D A;  2M9H A;  1RC9 A;  3G6E I;  1P4W A;  2KIS A;  4AYB N;  3JRG A;  1X2M A;  2Y75 A;  4UB8 C;  3UNG C;  1JXS A;  1S3J A;  1P92 A;  1LJ9 A;  2KHM A;  3BR2 A;  1RKT A;  5DD8 A;  4ABZ A;  1DU0 A;  2O03 A;  2XPV A;  4L0Y B;  1V54 H;  5IP9 J;  3WTY C;  3IUO A;  3ABU A;  2X4H A;  1TQP A;  2EIN H;  4GCV A;  2QQ8 A;  5K7Z A;  2H6B A;  4DOZ A;  1AOY A;  5HS7 A;  1K83 J;  5GAD J;  2YS9 A;  5FLV A;  1I1S A;  4RLF A;  4DNC A;  4WF2 A;  5EEA A;  3RSN A;  1O3Q A;  2DN0 A;  2ME6 A;  5ERI A;  4E7H A;  1LUJ B;  4CCJ A;  4Z6Y A;  1ZRC A;  2BHZ A;  5HS9 A;  2B0L A;  1S29 A;  2BEO A;  4B09 A;  4PJM A;  1ETK A;  2XAJ A;  4L9N A;  1Y6I A;  4OIP F;  1X4P A;  2L01 A;  5KHD A;  2HYF A;  5JR3 A;  1UHW A;  1RES A;  4M3B A;  3CES A;  5C3E J;  5BPD A;  2FOK A;  4QSH A;  1BR4 A;  3MFK A;  5GTH C;  2JK3 A;  4IRH A;  2XAG A;  2HZD A;  4XRS G;  2HOT A;  4IHT A;  2PX9 A;  3BOQ A;  5K5Q A;  5JLW A;  2R7Z J;  3LWF A;  2XUB A;  1YJ9 I;  4HLX A;  4AVZ A;  1D1B A;  4E70 A;  1A6Q A;  2XB5 A;  3ISP A;  1SD5 A;  3ZXS A;  3QP6 A;  2KIQ A;  3OYH A;  3Q3S A;  3JRC A;  2R7F A;  5E3L A;  2E36 A;  2FQ3 A;  2UWM A;  3WTU C;  2DA1 A;  1H0M A;  3ELK A;  1J59 A;  3HOY J;  2PEX A;  5D6F A;  2E1M C;  3GTQ J;  2E35 A;  4ZZD A;  3HPG A;  3OYJ A;  3AL0 B;  4MTE A;  1T2K A;  4HNT A;  3D1N I;  4LG3 A;  4EJO A;  2ELJ A;  1Z7U A;  3DBH B;  3CMY A;  1B1B A;  1A04 A;  1G3W A;  4UXN A;  2K3F A;  4L5E A;  3M8F A;  2Z33 A;  2I8D A;  3CJQ B;  4U7D A;  3QOE A;  1H9T A;  2NS7 A;  3GLL A;  4LB5 A;  1WSU A;  4LIV A;  3GCM A;  1MSE C;  2IP2 A;  1J5Y A;  2DW4 A;  2OQR A;  4B43 A;  4DZJ A;  5F27 A;  2FX0 A;  1ZGA A;  5DM7 F;  2IJL A;  2JN6 A;  2JVG A;  2WA0 A;  2XAQ A;  4A0X A;  2XRO A;  4HDU A;  3KPH A;  3ZRG A;  3ZMD A;  2CV2 A;  1A36 A;  1POG A;  1V5G A;  2VIX A;  2Y0S A;  5FFX A;  5IT9 Z;  4KMF A;  2W85 A;  2DFE A;  3HM5 A;  3FXM A;  1QZZ A;  1R4N B;  3F8N A;  2BY2 A;  5GTI C;  5J47 A;  5JHU A;  4DIQ A;  4PGH A;  3B6A A;  1PP8 F;  1G3S A;  3I58 A;  2F4M B;  2ZKZ A;  1IV8 A;  4RBO A;  3PQJ A;  5LGT A;  4JX4 A;  3GWZ A;  1HBX G;  3G1L A;  2K9N A;  4J19 A;  2ZCW A;  2VQG A;  3VYR B;  1WVR A;  3FXJ A;  1BW5 A;  2DXI A;  2P7V B;  5FD5 A;  2F5F A;  1SFK A;  2DQR A;  1MBF A;  2MFZ A;  3OYC A;  1ZRD A;  2DT5 A;  4UHT A;  1HC8 A;  3AKZ A;  1DGW Y;  4OMZ A;  4S0H B;  2UUZ A;  1XGS A;  2Q2E A;  3CP2 A;  1TC3 C;  1OFC X;  1ZG5 A;  5LGU A;  2WY7 Q;  2RN7 A;  3MZ8 A;  1EH7 A;  3HGY A;  2GA1 A;  5E3M A;  3H3U A;  2JTV A;  2E7W A;  2L54 A;  2LDU A;  3A4C A;  4Y15 A;  5LGN A;  4CXF A;  1VQN I;  1PVE A;  1JGG A;  3BQY A;  1MDM B;  2DDB A;  2XSJ C;  3LNQ A;  1RNL A;  2A5Y B;  2JT1 A;  2V1X A;  5FFZ A;  3A03 A;  3GUD A;  4KN4 X;  3BG3 A;  2HPM A;  2VPR A;  3K0L A;  4BJ6 C;  4HW0 A;  1TWF J;  2M8G X;  4M73 A;  3V4G A;  3QYE A;  2P4W A;  2R0Q C;  1KA8 A;  2Y30 A;  3K2A A;  3W6K B;  4ETS A;  3K1M A;  3MKL A;  4N4N B;  2L7K A;  1ZKG A;  2YPR A;  2EIM H;  1C0W A;  3ZP5 A;  5L3B A;  2FQ4 A;  2JMW A;  4ANJ A;  2KRH A;  4EJW A;  2IXS A;  2H94 A;  5D6E A;  2IVM A;  2LY9 A;  3M4O J;  4PUS A;  1WH5 A;  2VQC A;  3V7C A;  2R7U A;  2CH0 A;  2RNJ A;  3S16 J;  1YOV B;  3H35 A;  3S32 A;  4KYW A;  3BZC A;  1I5Z A;  3PUF A;  1BM9 A;  3OOU A;  2VI6 A;  3DKW A;  5FB2 A;  2KPM A;  4AUX A;  1MNM C;  2LF8 A;  2V6E A;  4A3L J;  2QM3 A;  1GHC A;  3N4M A;  2RGV A;  4QIW N;  1B8I A;  3HKZ N;  3K70 D;  2QKM B;  2HS5 A;  2IA2 A;  3BJ6 A;  3CD6 I;  5B66 C;  3LMM A;  3PFY A;  2B63 J;  3SEZ A;  4LB6 B;  1ZH5 A;  2WB1 A;  2Y2Z A;  1TL8 A;  5J40 A;  2X1E A;  4QLC U;  1OCZ H;  2EZH A;  3BJA A;  3HJE A;  4RGX A;  2CUJ A;  1OYW A;  3BT9 A;  1EKE A;  2KRC A;  1YLF A;  3R0A A;  1SAX A;  2P8T A;  1U6G A;  3F8F A;  3CCR I;  3LSP A;  1RR8 C;  2R7O A;  2IBD A;  1ZGJ A;  3L9F A;  4XNF A;  1R22 A;  1I50 J;  3WE3 A;  3ZQI A;  2HKX A;  5DUK A;  2A05 A;  3F21 A;  4WXD A;  5F64 A;  5K1Y A;  4XKC A;  5BS6 A;  3MWM A;  3WOD F;  4HV6 A;  1ZN2 A;  3KLO A;  1AKH B;  3FZV A;  3I56 I;  4O3M A;  2Y69 H;  2D1H A;  1S6L A;  1BW6 A;  3GFJ A;  1PDN C;  2ZXJ A;  5ICG A;  3QPL A;  2XC7 A;  1FWZ A;  3DFG A;  2QLZ A;  4BHP A;  2RRE A;  4HX4 A;  1ZAO A;  2FBK A;  3VOD A;  5ICE A;  1S9H A;  3KFW X;  1T98 A;  1EA3 A;  2LH9 A;  3ZMT A;  3VWB A;  1E3P A;  2E19 A;  2VKV A;  4U87 A;  2ZME A;  1KQ8 A;  2R93 J;  4M71 A;  4Y33 A;  4C2U A;  1JUP A;  2OD5 A;  4A3F J;  4KIF A;  2HXO A;  3ZOB A;  5EEH A;  4ESB A;  1JTX A;  4EEF G;  1WJA A;  2VOD A;  2RC4 A;  3JRH A;  4GXO A;  2NVT J;  1GVJ A;  4XN3 A;  3RQ4 A;  3WTW C;  1FYM A;  5H20 A;  2ECC A;  3W2W A;  4M72 A;  5EYR A;  1IRX A;  3NAU A;  2OV7 A;  2XGX A;  4HZF A;  1YRN B;  1D8K A;  3HOT A;  2VOP A;  1HDP A;  2V1N A;  4DBR A;  4CCK A;  4EV0 A;  4KDP A;  4GDF A;  5TJJ A;  3EPZ A;  1BOB A;  5FRO A;  3SFI A;  4U7B A;  3HTU A;  1X1B A;  3FBI B;  1J0R A;  4EGY A;  3K2Z A;  3OL4 A;  2WAF A;  1GVD A;  3C2B A;  1W5C C;  5KCM A;  4G7H F;  1WZ2 A;  4HOB A;  3SZG A;  2EWN A;  2M4K A;  2XGD A;  3GFM A;  4CSW A;  1XG1 A;  2HVR A;  2EZI A;  3E5U A;  4PZJ A;  3BG9 A;  4DGW B;  4YFN F;  3HBL A;  2YX4 A;  4C30 A;  3CMA I;  4XRS A;  4ZDO A;  2CSO A;  1ZRE A;  3QP5 A;  2D1V A;  5M5W J;  4CZZ A;  1KZH A;  1IXC A;  2K9Q A;  2K9L A;  1ERD A;  5L3G A;  5KNL A;  2BYV E;  2F5C A;  2BHY A;  1O3R A;  4ZZL A;  1J9I A;  4IRG A;  3BPV A;  3FKI J;  1H89 C;  3QPS A;  4PJN A;  4MQV A;  1P2F A;  2X85 A;  4PSX A;  1KQ9 A;  3NQO A;  2PJR B;  2Z9O A;  1R23 A;  1TQI A;  2I10 A;  5ILU A;  4C3H J;  4ENJ A;  4NC6 A;  5DV5 A;  4KIS A;  3FK6 A;  2X51 A;  2XPW A;  4G6Q A;  1FMV A;  2OZ6 A;  2PMH A;  3I64 A;  4XRF A;  2Z2S B;  3RZD J;  2OBP A;  4XLN F;  2WY8 Q;  2H8R A;  4CA0 A;  2KIU A;  4XR6 A;  1HCR A;  1WJB A;  1BJZ A;  1BBY A;  2JA7 J;  1R00 A;  5LHI A;  3OIQ A;  4GFB A;  1Z05 A;  1DDN A;  2JUC A;  4RM3 A;  5AON A;  3SDG A;  2GIZ A;  3BTL A;  2X1C A;  2FMY A;  4HV5 A;  4EAT A;  1T0F C;  2ZSH B;  1UB9 A;  2MLG A;  3W2V A;  1B4A A;  1W36 C;  1KON A;  4HBL A;  3QWL A;  2VQL A;  4A3K J;  3ERM A;  3DLL F;  1VI0 A;  1IC8 A;  2I5U A;  2QF7 A;  3ULQ B;  3OYI A;  1OQY A;  2LLK A;  1K61 A;  4XID A;  3OMY A;  5HLH A;  2DOF A;  2VKE A;  2O8X A;  3J81 Z;  4AD9 A;  1LFP A;  3EUA A;  4KT6 A;  4BU2 A;  4JQF A;  1QO0 D;  1ZR2 A;  1O3S A;  5IP6 A;  3GVA A;  4II2 A;  2M8E A;  2LC2 A;  4A0Y A;  4MTD A;  1RET A;  3WTT C;  4RB0 A;  1K4T A;  5IP7 J;  4M6Y A;  4G7Z F;  1XN7 A;  4R1H A;  3AL0 C;  4CGZ A;  2OJE D;  1TNS A;  1TTY A;  4P5O A;  3KP7 A;  3LFK A;  1X1P A;  2D5V A;  3LSJ A;  2WAE A;  2ZJP F;  3S2H J;  1VZ0 A;  3LST A;  1KYZ A;  5E20 A;  3DPT A;  5M3M J;  1ETX A;  1OIS A;  3FXU A;  3S2D J;  3CME I;  1YX5 A;  1R1T A;  3TO6 A;  3FXL A;  3V42 A;  4IEJ A;  4M9X A;  3X2Q H;  4GO1 A;  3SEQ A;  2ZC2 A;  3LAJ A;  4XLF A;  1NH3 A;  2M87 A;  3BR5 A;  2VE8 A;  2ZBK A;  9ANT A;  3T8R A;  5IYD J;  1EH6 A;  1LPQ A;  5J3L A;  3R6S A;  3WGH A;  1IDZ A;  1SFO J;  2V26 A;  2NRA C;  1U0J A;  5E8I A;  3JAM K;  1U2W A;  1FTZ A;  4Y13 A;  2E5N A;  4FAS D;  2GOX B;  5EF6 A;  4B44 A;  3P9I A;  2L9N A;  2NAZ A;  1BL0 A;  2BXY A;  2XF7 A;  1IN5 A;  3J7Z I;  1CQT A;  1WJ5 A;  1YG2 A;  3KYD B;  4MHG A;  4F52 A;  2R7S A;  1KU7 A;  4XSX F;  3F72 A;  4IHX A;  3C18 A;  3HRU A;  4FT8 A;  1WGX A;  3KZI C;  2KIM A;  5F1R A;  4KFC A;  3QPT A;  4N0B A;  3HG9 A;  1D5Y A;  1BI0 A;  2HEO A;  5E1W A;  4I76 A;  2HZT A;  4XON A;  4RB3 C;  3DU6 A;  1OJL A;  1QHH D;  5B5E C;  1FOW A;  2EV6 A;  5D5V B;  1IUY A;  2E2J J;  3K4N A;  1K6Y A;  2F5D A;  4LIU A;  2W57 A;  4Y7N J;  4ZYA A;  4KIG A;  3H3Z A;  3CDI A;  1TNT A;  2VKH A;  3TO7 A;  2X1D A;  4I99 C;  2L9S A;  4ON0 A;  4QPO A;  3VDX A;  4HQM A;  2L9V A;  3S3M A;  2EIJ H;  3B73 A;  1VQM I;  1YHQ I;  2H1L A;  3FMQ A;  2VUM J;  3RPQ A;  4N4O B;  5D5W B;  2QYO A;  1TW2 A;  3ESW B;  1OMI A;  3PIO F;  1REP C;  2CUE A;  2WBM A;  1SD6 A;  5KVR A;  4AYB A;  5BPI A;  1ETQ A;  1MND A;  1IDY A;  1JI8 A;  3CP8 A;  1E3O C;  3ONQ A;  3WG9 A;  4AVP A;  3JCU C;  4E7L A;  1SD4 A;  4NQW A;  2QEX I;  3RDI A;  4I09 A;  1U8R A;  2IGO A;  2E2H J;  2EFN A;  1QA6 A;  3IWF A;  2M30 A;  2EFQ A;  1S8N A;  3I9V 2;  2QVO A;  2NVU B;  2KMU A;  1MNE A;  5FKK A;  4MLO A;  3WTX C;  5F04 A;  3S1M J;  1FC3 A;  2KKO A;  5LHG A;  5DEQ A;  5L3E A;  3KEY A;  2Q0O A;  5K5R A;  1JGS A;  5E18 F;  2CQN A;  4U0Y A;  1G3T A;  3KP6 A;  3DPL C;  2HYJ A;  3CLQ A;  3EUK L;  3ABT A;  1H88 C;  3FIW A;  2X9D A;  2JVH A;  2VT2 A;  3WE2 A;  3E1S A;  1S7A A;  2IRF G;  3GW2 A;  2DJI A;  3L7W A;  2JSC A;  4A69 C;  3KCC A;  4BE1 A;  2MC4 A;  2PQ8 A;  4LG0 B;  3BPX A;  1W7P B;  3O2P E;  2O6G E;  2GQQ A;  2KQR A;  4QTR A;  4AWX B;  2CQQ A;  2Y31 A;  2CGP A;  4CCO A;  5HLI A;  3LSM A;  3SYT A;  3CJT B;  3M8E A;  1LVK A;  4YII A;  3FHN A;  2EPF A;  2M7B A;  3HSE A;  1MBJ A;  1FSE A;  2CW7 A;  3ZQF A;  2W82 A;  1DP3 A;  5EEG A;  3C2H A;  1HW5 A;  3AG4 H;  2VJJ A;  2YU9 J;  4G6D A;  1ITY A;  3DV8 A;  2BY0 A;  4Q4Z F;  2V1D A;  1PJR A;  4M6V A;  2ZNZ A;  4A3M J;  3H0G J;  4HX7 A;  1T38 A;  4KN7 X;  5IPA A;  4U0W A;  2A07 F;  3LFU A;  3PIP F;  1TWH J;  1YTY A;  3RKW A;  1RUO A;  4PFO A;  4LOC A;  3HB9 A;  4XLE A;  4IRI A;  3TGN A;  4E7K A;  3G73 A;  1BI1 A;  2L5Q A;  4Y17 A;  3L2U A;  4JX5 A;  4HDV A;  1Q1V A;  1DUX C;  5CQE A;  1IN6 A;  4NQW B;  2CU7 A;  4BY1 J;  2CYY A;  3CLO A;  2LKS A;  2XF5 A;  1HQC A;  4D1Q A;  3LQQ A;  3NWS A;  3OYM A;  2P5L C;  4F55 A;  3J80 Z;  5GAH J;  5J8C A;  4OIO F;  4V2G A;  3HOZ J;  3G3Z A;  5E17 F;  1IAW A;  2K9S A;  1UMQ A;  2CW8 A;  2M2E A;  3WU2 C;  1LDD A;  2ECB A;  3FXO A;  1RPW A;  4A2U A;  2COB A;  5EGO A;  4P96 A;  2XAU A;  1YIJ I;  2FD5 A;  3K10 A;  2CWE A;  4XOT A;  3HSR A;  4YEL A;  1JE8 A;  1FP1 D;  2HDW A;  3CDL A;  2VC1 A;  4M3E A;  3SHF A;  4D7N A;  1FP2 A;  1XTA A;  2P81 A;  4FE4 A;  2ZXH A;  2HQR A;  2O7O A;  2UZK A;  1YS6 A;  4NB5 A;  4MEY F;  2FXA A;  4XN0 A;  4IKF A;  5JI6 A;  2K86 A;  1FIP A;  2L4M A;  3G4S I;  2Q1Z B;  4B1R A;  4OMY A;  3Q5F A;  4MEX F;  3FXK A;  2MBF A;  1U9N A;  5EG0 A;  4XLC A;  3C3W A;  1WPK A;  1AWC A;  5A2Q K;  2DMU A;  1MDM A;  2IAI A;  2XKP A;  1TWC J;  3DBL B;  3PFI A;  3F8M A;  1SVO A;  1JKQ C;  3ZGK A;  3WHB A;  5E8G A;  4DQ2 A;  1NK2 P;  2WC2 A;  1Y8Q B;  2L7Z A;  3QU6 A;  2DPU A;  1LQ1 A;  3IRQ A;  4Y52 J;  1QVT A;  2YU3 A;  3MZH A;  3QPH A;  4EM2 A;  4HQE A;  1R5H A;  2F4O B;  2HDC A;  5KAI C;  2M0C A;  3COA C;  4U0V A;  4AID A;  1MSF C;  4IX7 A;  3VB2 A;  3DLA A;  2ZFU A;  4BEH A;  4Q48 A;  5D5U B;  1CF7 B;  2G7U A;  1FNN A;  2AQF A;  2DA3 A;  2VQH A;  3IH2 A;  5FD6 A;  2EA4 A;  4LLG F;  4RGS A;  2IA1 A;  5BQT A;  4B48 A;  2EJR A;  3RYP A;  2XGC A;  3HYI A;  2YX7 A;  3I5U A;  3F9K A;  1XSV A;  2K7L A;  4RAZ A;  3MKZ A;  3G1M A;  2IA0 A;  4II3 A;  2R7T A;  3CCY A;  4L0Z B;  3OYD A;  4OWR B;  1F1Z A;  2XDV A;  2ZFW A;  1AA7 A;  4ZDP A;  5J1U A;  5B3S H;  1YW7 A;  4UUT A;  4AIH A;  4A93 J;  2VL8 A;  2QBY A;  2K40 A;  3O6B B;  2QQB A;  1KYW A;  4EJT A;  4BBS J;  1K78 A;  5EGO B;  1I3A A;  2XF6 A;  1LFU P;  3S2W A;  4CCM A;  3GME A;  5LBQ A;  2UXN A;  2JZY A;  3JRD A;  2ZME C;  4HNU A;  1SC7 A;  3OYL A;  1YS7 A;  4L9T A;  3E7L A;  3KEQ A;  2BY3 A;  4A0Z A;  2XSD C;  4WK8 F;  4HLY A;  3WU1 B;  2H09 A;  4YRV A;  3CO7 C;  5DTD A;  4IZZ A;  1V4R A;  2H1K A;  3MMY B;  1QQI A;  2CQK A;  1P6R A;  3E97 A;  2R7D A;  1Y0U A;  1Z6T A;  1VQ9 I;  4BXU A;  3I4N J;  3H9Q A;  5K5O A;  2QSG X;  2NYX A;  2W1O A;  1X19 A;  2VB6 A;  3CUQ A;  1QPM A;  3LQR A;  4HF2 A;  5EG0 B;  3LA3 A;  1EH8 A;  1MIJ A;  2HI3 A;  4JP0 A;  1XC5 A;  5KK1 A;  2L0K A;  3F8B A;  3MEX A;  5CLS A;  2K02 A;  1F4K A;  2DYS H;  5F08 A;  1U9O A;  2PLY A;  2GXB A;  3CDH A;  4A3D J;  3K9T A;  1R1V A;  2EZL A;  1IRZ A;  3S1Q J;  2JA2 A;  3GLX A;  2VON A;  1NTC A;  2DA5 A;  2VLA A;  1UAA A;  4C3I J;  1T39 A;  1IRF A;  2DFH A;  3SFZ A;  1HXD A;  3F6O A;  3KET A;  4C2M J;  3CCV I;  1BJA A;  3E6B A;  1HKT A;  1AKH A;  4XBF A;  3K4M A;  5GPA A;  3CCS I;  2NVQ J;  2X48 A;  4GYI A;  2LBF A;  3ZQL A;  5IT9 K;  3RPU D;  2VAS A;  1MW7 A; 
#chains in the Genus database with same CATH homology
 1T08 B;  1LUJ B;  1M1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...