3I4NJ

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3i4nJ00
1X58A 1S7EA 1LE8A 2ZB9A 2WB1N 4CYCA 1QRYA 1ETXA 3GTJJ 3F0CA 5EYRA 4RDUA 2YU9J 4A3FJ 4A3GJ 2KT0A 2E2JJ 3WHCA 2DJNA 1G2HA 1D5YA 4MFDA 2Y31A 2YS9A 2DMNA 2Y9ZA 4JX5A 3QQAA 1JT6A 3GTGJ 2M8GX 2XGCA 4A69C 1A6IA 4C3HJ 1ENHA 1H89C 1OCTC 1Q1VA 3H3VK 2E2IJ 1YRNB 1JTXA 3FK7A 1GUUA 3GTMJ 5FKNA 3FKIJ 1BL0A 4FE4A 2DA4A 2CUEA 1ZKGA 5IOZA 1B8IA 1IGNA 2R5YA 4C2MJ 1UG2A 4XRSG 1BW5A 1RKTA 1BJZA 2Y2ZA 1VFCA 3JRHA 2LKXA 1UHSA 5IYCJ 4L5EA 1DU0A 1AHDP 3G1LA 2B63J 2EH3A 2NS7A 3NAUA 4A3IJ 4NDLA 3HM5A 4MO7A 3ZQFA 2FD5A 2LLKA 5IOYA 1EF4A 4XICA 3FISA 3PM1A 2K9NA 3CCYA 1GDTA 2JA6J 4A93J 5GPCA 5C44J 1SFOJ 1IG7A 3E7LA 2OPTA 1RPWA 2X9DA 5EF6A 5E3OA 4A3LJ 1ZK8A 5IP7J 2GM4A 2N8GA 3BT9A 5C4JJ 3OSFA 2Y30A 2FX0A 3BR2A 5F0FA 3BR0A 2CRGA 2IEKA 5IPAA 3S2DJ 3OIOA 5HODA 3MKLA 4DW6A 3S14J 2L9RA 4XRMA 3HKZN 1GV5A 1NK2P 3NARA 2R5ZA 1AU7A 3S1NJ 1JKRC 2HQ5A 2XB0X 5EGOB 2CU7A 4QTRA 2KDZA 2COBA 4X1EA 5M3MJ 2W48A 9ANTA 3A02A 5DS9A 5E3NA 2DA2A 2JA7J 1K61A 2MSYA 3BQYA 2EZIA 1ZGWA 5FJ8J 1U9OA 4I76A 5JLXA 3S15J 2OF7A 1WH7A 1VI0A 3LSJA 1HF0A 5FKKA 1FEXA 3Q0WA 2RAEA 1ETYA 1U9NA 1B72B 1TC3C 4B4CA 2H8RA 2ID3A 4BBSJ 5K7FA 2NVYJ 3DEWA 2P81A 1ETVA 1PUFA 1JT0A 1H8AC 2DA1A 3BR6A 5IYBJ 4BY1J 4QIWN 2CJJA 3I4MJ 2DN0A 4AUXA 3PO2J 2EZKA 2X48A 2FQ4A 2GLOA 1Y1VJ 3BG9A 5F0HA 1NK3P 2DMPA 5EZHA 1P7IA 1TWCJ 4S0HB 2VI6A 5J1RA 2I10A 1JKQC 3W6VA 2JK3A 1XC5A 3BG3A 5JLWA 4UUSA 3LSRA 1FIAA 3FIWA 2O9LA 2LY9A 3ZQIA 2EQRA 2LD5A 2WV1A 1TWAJ 1HLVA 4M3BA 1IDYA 2EBIA 5GPAA 4JP0A 1VF9A 1Y1WJ 4IEJA 5EG0B 4A3BJ 1BA5A 2XGDA 5FKOA 4IHVA 1Z77A 3HGYA 2DA3A 4QSHA 4JX4A 1AKHA 1K83J 3DCFA 4LOCA 5M5WJ 3PO3J 3GTPJ 3Q0UA 2XPUA 1FTZA 1I3QJ 3VPRA 3A01B 3H0GJ 3K7AJ 3BR1A 1U8BA 1JJ8C 1ZR4A 3OOUA 2XSDC 1JUMA 2EZHA 5M5YJ 4CYCB 3HOXJ 2MG4A 4JYKA 3GTOJ 4C3JJ 4A3JJ 4A3CJ 3S1RJ 2QF7A 1OCPA 2NVXJ 1HDDC 3D1NI 1GT0C 2M9HA 2YUSA 4MIMA 1MBFA 4IHWA 2JWTA 1QPIA 2LVSA 3HEFA 1MBKA 2DA7A 2L7MP 4UUTA 4AYBN 1POGA 1YRNA 2ECCA 3K2AA 1I6HJ 3BR3A 2NS8A 2IAIA 2DA5A 1TWGJ 3CMYA 2HOSA 1WI3A 3RKQA 3TEDA 4DZPA 1ORKA 2XB5A 4FCYA 1JUPA 2EZLA 1B8IB 3S2HJ 2R5YB 5F04A 4D7MA 4A3DJ 1WCMJ 4W1UA 1MBJA 2HOTA 1TWHJ 4JX6A 4A3EJ 1SANA 3Q3SA 2E2HJ 3UKGA 3O8HA 1A5JA 3CQZJ 1JGGA 3HOZJ 3TP3A 3Q0VA 1W0TA 4C3IJ 1JJ6C 3ZQCA 3HB9A 3SJMA 1IUFA 2GBYA 5DTDA 2M34A 4EEFG 3ZQHA 1LE8B 5FKMA 1MNMC 2TCTA 1HOMA 1X2MA 3RQIA 1H88C 2VUMJ 1VNDA 4G12A 3B6AA 4ABZA 1JTYA 4BY7J 3TP0A 1GV2A 5IP9J 1ITYA 4AC0A 5EEAA 1BW6A 1WH5A 1OJLA 1FIPA 2L7FP 5F27A 4DYRA 3L1PA 2G0EA 2L7ZA 2H1KA 2ME6A 1JUSA 2MGQA 5K7ZA 2XPWA 3HOUJ 4D5FA 2HI3A 4W97A 2HOAA 2O7OA 1HDPA 2E19A 4D5CA 1T33A 2MW8A 2JMWA 3LNQA 1ETQA 3S17J 1ZQ3P 1DU6A 4M3FA 1CQTA 1UMQA 1ZR2A 1LFUP 2AHQA 2K40A 4V2FA 1MH3A 3MVPA 4BKXA 1TWFJ 3JR9A 2DA6A 3JRFA 1RR7A 2LR8A 1ETWA 3HOYJ 1RESA 3B6CA 1QVUA 3LSGA 1APLC 5E3MA 1B72A 3OSGA 3IH2A 4GFBA 2VKVA 3JRAA 5FLMJ 1R9TJ 1E3OC 2R92J 5EZGA 2NVTJ 5M3FJ 3M4OJ 4D7NA 1X2NA 1RKWA 2HXOA 2K9SA 3LOCA 2R7ZJ 2XRLA 5GP9A 2HYJA 4M3DA 1MBGA 1RETA 2Y0SN 3BQZA 5IP6A 2JN6A 1IJWC 4J19A 1MBHA 2DMQA 5F0CA 3ZOBA 4DYCA 3HDDA 4DZJA 3GTQJ 2HXIA 3S1QJ 3BTIA 5M5XJ 3RZDJ 4MFEA 4XIDA 5K7HA 2NVQJ 1IRZA 4X6AJ 2VKEA 2IBDA 3FK6A 1WGXA 5J1UA 5FLVA 2Y9YA 1MSEC 2CUFA 1IV6A 2XGEA 3GTKJ 4UUSB 4HNVA 3S16J 2K9QA 5E3LA 4M3GA 3BG5A 2LK2A 2DMTA 2NOGA 3S1MJ 1OFCX 4MLOA 1I50J 2R5ZB 3BR5A 2LTPA 2CQXA 3M3YJ 5EGOA 3JRBA 1JKOC 3TW6A 4IHXA 4B1RA 2WAQN 4Y52J 3WHBA 5EG0A 2ID6A 2L0KA 3C2BA 3TW7A 4B3AA 3I4NJ 1JKPC 1QVTA 2M0CA 3HOVJ 1FJLA 3ZQLA 1AKHB 2DTZA 1IDZA 1MH4A 2M2EA 2R0QC 3IV5A 1FTTA 2TRTA 3A01A 3O8GA 2ECBA 4I6ZA 2VPRA 4XK4A 3HBLA 3JRGA 2E1OA 3HGGA 1F36A 1ETOA 3QPSA 4A3KJ 4Y7NJ 3IH4A 2JA8J 3SFIA 3JREA 5EDNA 2AO9A 2PMZN 3MN2A 4XRSA 1PUFB 5C4XJ 2D5VA 3LSPA 1F43A 1P7JA 1Z0XA 3JRCA 4FTHA 1NTCA 2JJ7A 5J1YA 3ZQGA 5C3EJ 2O8KA 1O4XA 1MBEA 2QCOA 1LFBA 4RBOA 3CDLA 3QPLA 2R93J 2ME0A 3BTLA 3JRDA 1MSFC 2DMUA 3JRIA 2XPVA 4FISA 2LFBA 5IYDJ 4FE7A 4BBRJ 1T56A 3BTCA 1XS9A 2HDDA 3G1OA 5F08A 3BTJA 4M6VA 3RZOJ 1ZTRA 1IC8A 3G1MA 2CQQA 1XG1A 4DYQA 5F1JA 1U78A 1ETKA 4BXXJ 5J3LA 3HOWJ 1GVDA 3SDGA 2X6OA 5FKLA 5BNGA 3GTLJ 1HCRA 2LP0A 3A03A 1WPKA 2JA5J 4IHYA 4A3MJ 1W0UA 2FJ1A 4V2GA 3IH3A 4M3EA 2ELKA 3GBGA
chains in the Genus database with same CATH superfamily
3DXJF 3PUBA 1LE8A 3KYDB 5E1XA 2ZNYA 2VXZA 5LEJA 1PVEA 3CTAA 1QA6A 1T0FC 1O7FA 5EYRA 1AA7A 4RDUA 3RPUA 2QSGX 2CH0A 3RQ4A 4TV7A 2EJRA 2KT0A 4UB8C 2Q2EB 1YQAA 1UFMA 3KYCB 4P1WA 3C7JA 2OTJI 4ENKA 2HVRA 1ON1A 4D9JA 2XAQA 2K3PA 4L5IA 1G3SA 5H6QA 2NVUB 4OIQF 2DO7A 3LL7A 2GWRA 2KLOA 4A69C 4HOBA 4CDGA 2FE3A 5CVUA 1H89C 1OCTC 4J01A 4GO1A 1VQMI 3FKIJ 1BL0A 3JW4A 2DA4A 3V8JA 2KDOA 4Y33A 1IN5A 4GYGA 3QYFA 4H4KC 1ZRFA 1BW5A 4BHBA 3I59A 2DAOA 1BJZA 1BR1A 4A6EA 2Y2ZA 3S3OA 1S6LA 4L5EA 3CCQI 1U5TC 2X51A 3G1LA 2B63J 3LSKA 4NDLA 3HM5A 4KIBA 1Y0NA 3ZQFA 3V42A 3FISA 3RKWA 3CCYA 1IRXA 1GDTA 3MKZA 5LFAA 3DP7A 5FD5A 5GPCA 5C44J 3E7LA 3CP2A 1RPWA 2Z33A 2LKSA 2VJ4A 5B1BH 1SEUA 3KP4A 5D5WB 5E3OA 2W82A 2WY7Q 1UB9A 5D5VB 1MJ9A 3DV8A 3K69A 4U0WA 1TTYA 5C4JJ 3OYAA 1LDJA 4HZFA 3CO6C 3WU2C 1VQ9I 3BR2A 4F92B 4OOIA 4II3A 4XONA 4DIQA 2X6YA 2CRGA 1HW1A 2OQGA 4ZTFA 5HNHA 1JHHA 2MD0A 2A69F 4ANJA 4E6KG 2W57A 5HODA 1NG6A 4F3QA 1WJCA 1FNNA 2E1MC 2L9RA 1R58A 3G3ZA 1A35A 5ED4A 4B44A 2A07F 5KCMA 1J0RA 3GF2A 3NARA 3FBNB 4O5VA 4ZZLA 1UG0A 3EUHC 1D0YA 3QOEA 5M3MJ 1B1BA 2W48A 3MKYB 2LC2A 3BPVA 4N9HA 4XKCA 2E7WA 5E3NA 3F6VA 1BR2A 5DUKA 1K61A 2KKOA 5FB2A 2HVSA 2IS1A 3KPHA 1VQ4I 1YS6A 3S15J 2OJED 1Z1DA 4EQQA 4C30A 2W00A 2ZNZA 1HF0A 2KMUA 5LHIA 5EEHA 1B72B 1T0FA 4NC8A 2H8RA 3QAHA 3CF2A 1P9QC 4Y13A 1H8AC 2QLZA 5CVIA 2EFQA 5D6FA 2ESHA 2V1UA 4UHTA 4I98B 2CJJA 3WTUC 3FM3A 3DF8A 3VEPA 1XMKA 1V55H 2O8XA 4HBLA 2VOPA 2FQ4A 4BJ6C 2ZJRF 2RREA 5ILUA 2XROA 1OPCA 4OU0A 3A4CA 3ZRGA 2KZGA 4S05A 1FY7A 2K27A 1BI3A 1LEAA 1P4XA 5JVTA 4OINF 1OYWA 2CS3A 4LGWA 2I10A 2VBZA 1KYWA 2GOMA 3ABLH 3ZGKA 3FIWA 4R79A 2JZYA 1TWAJ 3OY9A 1R7JA 2BY3A 3ABMH 4IEJA 5EG0B 1Y1WJ 3CC7I 3CJRB 3JTGA 2VLAA 1QZZA 4JQFA 5D8KB 1Z3XA 5M5WJ 3RPQA 1DGRM 4B09A 3DTIA 2XPUA 4MEXF 3VPRA 1BC7C 3A01B 3H0GJ 2DW4A 4LK0F 4LLGF 3BR1A 1OCRH 4XRFA 3WTXC 2JPCA 1ZR4A 3SFZA 3HPGA 5L3CA 4EVIA 5LGUA 3ULQB 4NC6A 3CF5F 3FXMA 1FC3A 1CF7A 1WJEA 2QF7A 1MMSA 2ETHA 2CUJA 2FBKA 3HG9A 2LYCA 3CCJI 3ZMTA 3H92A 3GFLA 3MZ8A 5A2QK 2YUSA 3CZ6A 4MIMA 2VC1A 2V26A 2R7XA 4IHWA 3J7AO 2Z9OA 2FEZA 4ZH4F 2ZMEA 1IF1A 1MBKA 3AFHA 3GZ6A 4NUBA 1POGA 3QP6A 3HC7A 3HRSA 5B3SH 3BR3A 4DBQA 2IAIA 3VB2A 5LD2C 2P7CB 1TWGJ 3CMYA 2CSOA 4RAYA 4LD5A 2BY0A 1IXCA 2ZSIB 1XSVA 3WU1B 2QQAA 3DTEA 6PAXA 3RPUD 2HQAA 2L4AA 2D45A 1XDSA 3NQOA 3GWZA 3QWLA 3W3CA 4EJWA 5LHGA 1BN5A 2A68F 1I1GA 2DBBA 4JX6A 3PNVA 3BG6A 3DEUA 4BQQA 4KN7X 4KDPA 4XNFA 2E2HJ 3UKGA 1FLIA 4MEYF 3JSPA 1N77A 4HF1A 3TP3A 3CUOA 1R36A 3BLYA 3Q0VA 5FROA 2QM3A 4C3IJ 2L5QA 3ZQCA 2V6EA 2R7UA 5FLXZ 1IUFA 2IGOA 2GBYA 5F1RA 1LE8B 1MNMC 3QODA 4MGRA 3ZN1A 2DK8A 3S8PA 4U0YA 1X2MA 3RQIA 1H88C 1SC7A 2KP6A 3EDPA 4G8XA 1NG7A 4ABZA 3FM5A 3VSLA 4BY7J 3TO6A 4HNTA 3MCZA 2Q2EA 4MQVA 3WODF 1GV2A 1IV8A 4AC0A 5J40A 4EATA 1WH5A 4DYRA 5F27A 3U9GA 1W5CC 1HQCA 3MWMA 1JUSA 1PDNC 4XOPA 1ZN2A 1FMWA 1QHHD 3DWLE 2DFIA 4ZYDA 4U7DA 4W97A 2EWNA 2BHZA 2E19A 2X0LA 4D5CA 5LLQA 1WSUA 1DGWY 4XLHA 3WGGA 2X85A 1UHMA 4O3MA 2LSOA 1PP8F 3K4MA 2WADA 1UMQA 4XLNF 1YE9A 3E1SA 2PEXA 1MH3A 4IVNA 2LY2A 3MVPA 2IXSA 4BHPA 2VKHA 2R7SA 2DA6A 3VOEA 1RR7A 1ULYA 1X1DA 3ECOA 1TT5B 1D1AA 3SEZA 3B6CA 1UZCA 3M8FA 2CQNA 4P96A 3CDHA 4RM3A 3TMOA 1EJ9A 2L54A 2VKVA 3A0BC 5CQEA 4KT6A 4XBFA 3OIPA 1R9TJ 1E3OC 3J7YJ 4KICA 2K85A 3QPHA 3LOCA 4II2A 2R7ZJ 2BBYA 1R5HA 4XOTA 2UXNA 4M3DA 3H9QA 3HHGA 4I0AA 5CYVA 1D5VA 4FX4A 3LAPA 2WBMA 5IP6A 5HOOA 4BYYA 4M9SA 3TQNA 2DMQA 1HSJA 4ETSA 1XCVA 5BS6A 2ZMEC 4X0GA 4Y3OA 1S29A 3GTQJ 5IT9Z 4LJZF 3S1QJ 5M5XJ 5DCMA 4XIDA 3C2HA 2A3SA 2B9SA 5HLHA 1HBXG 3FK6A 3HL2A 4WK8F 4XSZF 1W36D 2Y9YA 2P8TA 2DQRA 2PBIA 5TJJA 4UUSB 5HS7A 1BI2A 1YJNI 3S3MA 2LMDA 2A05A 1P6RA 3S1MJ 4KIFA 2VJ5A 1I50J 4ON0A 4G9YA 3TW6A 3BP8A 3LA2A 3LFKA 1FZPB 3ABUA 1Y8QB 2VOOA 2HU9A 2DLLA 2H94A 3C2BA 5IT3A 3K4LA 4WX9A 3CCMI 1W5TA 1HW5A 4P9FA 2DOAA 4GXOA 2DTZA 1QZEA 2R0QC 1LEBA 3IV5A 4WCGA 2HFHA 2HQNA 3ASOH 4I6ZA 1RIOH 2R7QA 3LQRA 3TO9A 3QPSA 4A3KJ 5FO5A 3R61A 2EK5A 4CCNA 2K4BA 3QP5A 3EUAA 2JA8J 3JREA 2D5VA 3M8JA 3HTSB 3I71A 2VBXA 1S7AA 3LSPA 2HKXA 3V7CA 5CJ9A 3PIPF 2H6CA 3K2ZA 3DEEA 2JJ7A 5J1YA 5C3EJ 4EMSA 1I27A 4BE1A 1YG2A 1SFUA 2LKPA 3WTYC 3KZZA 1XSXA 4BXUA 3LFUA 3JRDA 3BY6A 1YJ9I 2F5FA 3OYCA 4FISA 4UXNA 2PLYA 4GGGA 1ON2A 3OYFA 4BDZA 1MDMA 2QSHX 3HTUA 3T8RA 1OMIA 2HGCA 3G1OA 1H0MA 2WV0A 4M6VA 3SZPA 5DM6F 2LF7A 1LNWA 2NXNB 2H6BA 4PGHA 3W6KB 4YFXF 5F6FA 1IC8A 4AM3A 4G94A 3OS0A 2IS2A 4RAFA 2AS5F 1IN7A 2CQQA 4CXFA 1P4AA 2MFZA 3ZMDA 2XF7A 5ICFA 4DYQA 5F1JA 2A61A 3ZMSA 1WVRA 5LEKA 5J3LA 3OS2A 4IHSA 1KQ8A 5HS8A 5LRSA 2X6OA 5BNGA 3GTLJ 1V5EA 4XR6A 4KUMA 2IA0A 1VZ0A 4ZDPA 3U1KA 2WA0A 2M87A 3HSRA 3OIQA 4V2GA 2F6CA 2KISA 4HX8A 2WB1A 4M3EA 1YLFA 4P5OA 2FQ3A 1X58A 3M1CA 1D5YA 1UHWA 2HPIA 2Z2SB 3L09A 4XN0A 3K4NA 4J00A 2EIJH 1IN4A 4CCKA 2G9WA 1T08B 2DFEA 4L0ZB 4B8XA 2JUGA 2DJNA 3BDDA 3HKZA 2PFBA 2FU4A 2FNAA 2KRHA 3NWSA 4MFDA 4Y15A 1VQPI 3F22A 1GHCA 5L3FA 4IHTA 1JT6A 2RQPA 5LGNA 3GTGJ 2A5WA 3HZJA 5IY5H 3K1NA 4NQWB 2ZMEB 4C3HJ 1PYVA 1T95A 2VJIA 3G73A 2FRHA 1Q1VA 2H27A 1D3YA 2Q0OA 5FKNA 3VODA 1ZG3A 1ZLKA 5IOZA 2R7FA 3EPZA 1XMAA 2ISZA 2ZCWA 1XGSA 3O3KA 1I39A 2XKPA 1E2XA 1UG2A 5H20A 3TKYA 2ISYA 3BZ6A 4ITVA 1E3HA 1RKTA 3HPHA 3I54A 4LB6B 2LG4A 2EH3A 1WWXA 2NS7A 4M6XA 1WHUA 3NAUA 5HDNA 4A3IJ 4MO7A 3CC4I 1X19A 3LA3A 2LLKA 5IOYA 1RC9A 1A31A 4XICA 2BYVE 2E7XA 4HYEA 1B6AA 1ZG1A 3M07A 3DKWA 5DV5A 2VT2A 4A93J 1SFOJ 2STTA 1FOKA 3KEOA 4IPAA 4A3LJ 2ICWG 1T98A 1FYMA 2N8GA 2GM4A 1ERDA 3ABTA 1XGNA 4CCMA 1U3EM 3BR0A 2NYXA 2V4JC 2V79A 1Z21A 2R7RA 2IEKA 5E17F 2HR3A 1XX5A 4E4HA 5IPAA 3E6DA 1Y56A 3S2DJ 3MQ0A 4Q48A 5E8IA 4DJAA 3ZR8X 4XRMA 3HKZN 1J9IA 3E5XA 1X3UA 1GV5A 1BIBA 4BS9A 1B9NA 1AU7A 1SVMA 2HQ5A 2IW5A 4PFOA 2COMA 1TP4A 4QTRA 2KDZA 5AONA 2RC4A 3A02A 4ENNA 5LRRA 4EM1A 2IGNA 3SZGA 2E1NA 5DS9A 2IP2A 1B4AA 2DA2A 3OYLA 4BXFA 2VQCA 1IW7F 3GZ5A 4MNUA 1KZHA 2ZBKA 5ILVA 3CO7C 5FKKA 4U7BA 3PSIA 4OAYA 1SMTA 4EGZA 3Q0WA 2F5DA 5D5UB 2KRCA 3HOSA 1WJDA 2RAEA 1ETYA 2EFPA 5CLSA 3I55I 1TC3C 4B4CA 4QWQA 3RIRA 5A2QZ 1JT0A 3VYTB 1OYIA 3BR6A 4XSXF 4QIWN 2QEXI 4IOAF 4BGDA 3ZQQA 2X6WA 2RNJA 2EZKA 2X48A 1R5GA 1USSA 4IO9F 2GLOA 1Y1VJ 5GAHJ 3ISPA 3BOQA 5DCMB 3KYLA 3J7ZI 5EZHA 1P7IA 4CA0A 2XVCA 4S0HB 3LWFA 3FHNA 2Z99A 1MD0A 2E60A 3VFZA 2O0YA 3L2VA 4RMNA 4RAGA 1WQ2A 4RA2A 3OYKA 4UUSA 3FZVA 2LREA 2KZVA 5E1ZB 2WAQA 3K70C 2IS6A 3KEQA 3FMRA 4KMUX 1XTAA 4MQ9F 4AIJA 2LD5A 1HKTA 1IDYA 4XORA 4ZJZA 2K86A 1TT0A 1TLHB 3ROUA 2R3SA 1R1VA 1Z77A 2PQ8A 1IN8A 3HRMA 1J5YA 1SD6A 4ZYEA 4LOCA 3QU6A 3HHHA 3Q0UA 5DCFA 4CICA 4YRVA 4U88A 1I3QJ 3FBIB 4CYDA 5D4RA 1Q1HA 1U8BA 3CCEI 3CCSI 1TW2A 3I53A 4CYCB 2RV8A 1KQ9A 2I8DA 2MC4A 2MG4A 4RLQA 3CMEI 3GTOJ 4A3CJ 4F93B 5TISC 3WG7H 1UELB 3IKTA 1MGTA 1YTYA 1OLTA 2GAUA 2PX9A 1GT0C 1HDDC 2JSCA 2W1OA 4IRHA 4XN3A 2VB6A 2JWTA 4LFUA 2LVSA 1YITI 1FX7A 2XHKA 2L7MP 3IAS2 4O6JA 4AYBN 3FHZA 3T5XA 4E7KA 1YRNA 2ECCA 2L9NA 1H9GA 3ERMA 2DT5A 2NS8A 4LITA 1V4RA 4DBRA 3HOTA 3N05A 1RI7A 4M74A 1R6RA 3VWBA 4DZPA 1DPUA 2XB5A 4FCYA 3R60A 1B8IB 3S2HJ 1MDMB 1LVAA 4I02A 2WY8Q 2HYFA 5EEGA 2L4MA 3N4MA 3NWTA 5GAGJ 1WCMJ 2K4JA 2BOLA 2ESNA 1XGOA 2ZXJA 4L9TA 1T2KA 2M4GA 4W1UA 1MBJA 4A3EJ 2GZWA 3K1PA 5KVRA 1U0JA 2OCEA 5CVJA 1YIJI 3PQKA 2OQRA 4A0XA 1W5SA 3CQZJ 3FWEA 4L9VA 2M7BA 1JGGA 5DYMA 5K5RA 1HW2A 3HOZJ 1SVLA 3GFIA 1LJ9A 1JJ6C 2QA4I 2AXLA 2ELHA 2O03A 1T38A 1F4KA 1S72I 2ZO4A 1W4MA 2M34A 2KJBA 4XKWA 3VSKA 1FOYA 1Z3YA 4PDKA 1OR7A 4AIDA 5ERIA 4BUPA 1F9NA 3M7GA 3TDUC 1VNDA 3B6AA 2KJCA 3LSIA 1XCBA 2BY1A 3OWTA 4YFKF 3TOAA 1GXPA 2E1MB 2K5CA 4BACA 1O3SA 2VT3A 2HZTA 2BW3A 4PZJA 3EYYA 2L7FP 4NB5A 3G6EI 2VASA 2L7ZA 2H1KA 1WKMA 3GMEA 2ME6A 1OYYA 2E36A 4LLNA 4IL6C 4UUVA 4IQJA 1EH8A 3TOBA 4M9XA 2G7HA 3MFKA 5JVGF 1K4SA 1X1BA 4NQWA 2HI3A 2J5OA 4A2UA 1T33A 2CWEA 2XASA 2D2WA 2VN2A 3AG4H 3ERED 2TDXA 3K70D 1VQ7I 3Q5FA 3I9V2 4M3FA 1CQTA 1IZ1A 2DU9A 2M8EA 2CQ7A 1X1CA 3GFMA 4V2FA 4K2EA 2FF4A 3VYSB 5CVRA 4GCVA 4UVAA 5CQGA 1ZRDA 1E17A 2HYGD 4OWRB 1X3ZB 3BWGA 2Q1ZB 4UVBA 2FMLA 3PUFA 4EM0B 3HOYJ 1RESA 4C2TA 2W25A 3GZNB 1QVUA 5HDKA 3BJ6A 3PFYA 1BOBA 2EIMH 3KIOA 2MD5A 3IH2A 4NBQA 2KQRA 2R92J 1DDNA 1VTNC 2NVTJ 1BM9A 4XQFA 2MH9A 1RKWA 3TBIA 3OYNA 1OKRA 2XRLA 3K4KA 1BC8C 1MBGA 4IX7A 2Y0SN 2EILH 3V8KA 4C2UA 2IPQX 2OC6A 3H5RA 5B1AH 4YIFA 2NOJB 5F0CA 3HDDA 2F4OB 3GFJA 4DZJA 3D5RC 1L0OC 4HX7A 3L2QA 4MFEA 3U2RA 5K7HA 2NVQJ 1JI8A 1R22A 4X6AJ 1F1ZA 2IBDA 1I6XA 4UV8A 1N78A 2VJJA 2DCEA 5J1UA 1Z7LA 4PK4A 4ZZDA 5GTIC 1YYVA 3CCLI 1MSEC 4BQOA 2EV5A 1V54H 1IV6A 2DJIA 2W85A 3S16J 3AL0C 2NS0A 2ZJPF 2LK2A 2DMTA 4CGZA 1TNSA 1R49A 3N97A 3IKVA 4OIRF 3JRBA 1T6SA 3JAMZ 4IHXA 4B1RA 2DPUA 2WAQN 5J4VA 2IS4A 4Y52J 3E3VA 1RR8C 1ZREA 2CW0F 4FQGA 3TW7A 2M0CA 2L2OA 2QYOA 1AKHB 5L3GA 3GO5A 4LG3A 3L2CA 2M2EA 1S7OA 2JTVA 1IUYA 3CMMA 2A5YB 3O8GA 2O6GE 2V1XA 2WAFA 4HRIA 3CDIA 3HGGA 1R71A 3ASNH 3R4KA 5LHHA 3LSTA 3IAM2 2E5ZA 4G6DA 1W7PD 3SQNA 5BMZA 4PCQA 2PJRB 2VIXA 1R00A 2PMZN 4Z2YA 2ADUA 3EUKL 4CCLA 3TGNA 4DGWB 4ZYHA 5FLXK 1F43A 3ZXSA 1Z0XA 4ZYAA 4FTHA 2Z5UA 3O2PE 5D6EA 3OYIA 4BU2A 4QLCU 2XGXA 2QCOA 1YJWI 4RBOA 3QPLA 2IJLA 2Y0SA 4FETA 4ESJA 1G6NA 1HXDA 2XPVA 2V1DA 4M6YA 4WF2A 1VQLI 2MH2A 5IYDJ 4B47A 4AYBA 2NNNA 2LF8A 1ZARA 3BCAA 2XAUA 3F6OA 2VQGA 5F08A 3BTJA 3RSNA 2BV6A 3RZOJ 1D8JA 4KYWA 3QU3A 5H6RA 5GTHC 4GYIA 2VODA 4HV5A 1IAWA 1DPRA 1S9HA 2EA4A 1YX3A 3AG1H 5J8CA 4A12A 3GYHX 1U78A 1ETKA 1MIJA 3I58A 4BXXJ 3L9FA 3FXOA 3SDGA 3SEQA 3A03A 4A3MJ 1W0UA 2FJ1A 2HKOA 4HAMA 3D5LA 3GBGA 3EQLF 5E8GA 2OBPA 3HOXJ 3J80K 4CYCA 2X1EA 1QRYA 1ETXA 3GTJJ 3DKYA 3F0CA 1JXSA 1OISA 1YW9A 4A3FJ 3W6JB 2E2JJ 3WHCA 2L7KA 2QWWA 3GUDA 2WTEA 2GXBA 3CUQC 2V9PA 5ICEA 1TL8A 2YS9A 2DMNA 4BL0B 2H8WA 2PMZA 1G3YA 4I99C 3QQAA 3J7AY 4A6DA 2DDBA 2CO5A 4YIRX 2M8GX 2IRFG 1A6IA 1ACIA 3J80Z 2D1VA 5FGMA 1ENHA 3WTSC 3H3VK 2E2IJ 1YRNB 1UAAA 3FK7A 2FOKA 1GUUA 3IC7A 4FE4A 1HKQA 1WI9A 5FD6A 4CZCA 4AIHA 4HF2A 1MMAA 1ZKGA 1ZYRF 2FUG2 4ESBA 2R7WA 4PGGA 1B8IA 1IGNA 4BAYA 3AG3H 1HA8A 4C2MJ 1FWZA 3AL0B 1S8NA 2P6SA 4XRSG 4OIOF 1VQNI 2RGVA 3TL4X 1UHSA 4XLAA 2LH9A 2JT1A 3GW2A 1AHDP 1DU0A 3VYRB 2STWA 4JBAA 3MD2A 1OQYA 1KGSA 2YU3A 1W7PA 4IZZA 2CFXA 2FD5A 3WU0A 4L9NA 3PM1A 2ZFWA 4XLEA 3C2GA 2HS5A 3H9JA 1X1AA 1FBUA 3V7RA 3REOA 5DUIA 2LDUA 5ICCA 5EF6A 2NAZA 1J09A 5IP7J 3LAJA 1BI0A 5FRNA 2L3DA 1VQ6I 2CUZA 1KU2A 2Y30A 3F23A 3OSFA 2FX0A 1LFPA 2MBFA 4NC7A 1EH6A 5HVQC 4G7ZF 4LLLA 3OR2C 1PJRA 1P4WA 2JVGA 5F0FA 3I56I 2R7TA 4LMYA 4QPOA 3G4SI 2BW3B 3GLXA 1RRJA 4KNYA 3HUGA 2W24A 2F5CA 2Z16A 1FBSA 3BJOA 3F72A 3MKLA 3UNGC 1SAXA 3S14J 1RUNA 3MKWB 3QYBA 2JPBA 4L5JA 3KLOA 3C18A 1G3TA 2M3AA 3HYIA 4EJVA 1LDKB 2R5ZA 3S1NJ 1ZGJA 2P0WA 2XB0X 1JKRC 2RNGA 4X1EA 3KCCA 3ZQ7A 1BJAA 5KHDA 1WFXA 1P92A 2WAEA 3OYDA 1O7LA 4WWCA 2XKOA 2JA7J 2MSYA 3BQYA 5DD8A 4ZDLA 4HLXA 5JR3A 2K9LA 2EA2A 3E0JB 2HNHA 2OF7A 5JLXA 3SHFA 1U6GA 1VI0A 3CMAI 3PNYA 3LSJA 1FEXA 1B59A 3FXUA 4PJMA 2H1LA 3AG2H 2DQLA 1D0ZA 3SZTA 2ID3A 2KIUA 2BEOA 4BBSJ 3BG7A 3BZKA 5K7FA 2XIGA 2P81A 1ETVA 1PUFA 2W4SA 3HRUA 5EJCA 3KETA 1XSDA 1D1CA 4BY1J 4HSTA 2MLKA 2GXGA 2EV6A 2YR2A 4QPQA 3OYJA 2IA2A 1X4OA 1OR7C 2HTJA 2HOEA 1J2XA 5E1WA 1J7KA 4LK1F 4ZC3A 5F0HA 2DMPA 4RGSA 4BNCA 1QPMA 4HNUA 3CC2I 1MJAA 2QBYA 2V9KA 2OA4A 5J1RA 4D0PA 3W6VA 4A5NA 2JK3A 2O61A 4I7HA 3LSRA 1HC8A 2MA3A 2F5VA 1SAUA 2BZTA 2O9LA 1FYLA 3ZQIA 2EQRA 3LSMA 2WV1A 4KT5C 2IGMA 4ZTJA 2LY1A 1HLVA 2YPRA 4M3BA 2M4KA 5GPAA 3JSOA 3A2KA 4JP0A 1HKSA 1VF9A 4A3BJ 2DDAA 1H9TA 5AIPA 1SD7A 1BA5A 2XGDA 5DD4A 5J8FA 2DA3A 3CLQA 4JX4A 1AKHA 3WE3A 1V5GA 3BROA 1K83J 3PO3J 1YO5C 1FBQA 4YIIA 3ZP5A 1J75A 1BIAA 1KA8A 2QZ8A 2IGKA 4AVZA 3K7AJ 4FASD 1MMGA 4N9IA 3DQVC 4E7ZA 1JHFA 1JJ8C 2DFHA 3MZHA 4HLYA 1WJ5A 4UB6C 1E3PA 2KIFA 2PJRA 3Q9SA 4XLPF 4C3JJ 2GOXB 1YW8A 3S1RJ 3BPXA 1EA3A 1MZBA 1IXRC 4XM3A 1OCPA 1J59A 2RVCA 3KP3A 1U5TB 4FHTA 4OMZA 4WXDA 2NVXJ 2LOOA 3D1NI 2GA1A 3F21A 2M9HA 2Q8KA 1MBFA 3DU6A 2UV1A 2BXYA 2X1CA 4KJZA 1W36C 2DA7A 3RCOA 4ESFA 4UUTA 5K5QA 1KQ0A 3JAMK 1I6HJ 2HEOA 3ZPLA 5KAFC 1ZAOA 1WI3A 3RKQA 2ZJ2A 5CVVA 4CSWA 2RN7A 3TEDA 1ORKA 2CV1A 2DXIA 2NNYA 2R5YB 5LGTA 2GXAA 2HDWA 2E71A 5F04A 3RYPA 4JK1X 1JGSA 4D7MA 1I1SA 3FXKA 3IP4B 1AOYA 2EPFA 2LRDA 1LQ1A 1TWHJ 1LUJB 2EFNA 1FYKA 1SANA 1TQPA 2AXTC 2IA1A 4CHUA 1W1WE 3Q3SA 3A0HC 2VBWA 4HQMA 1A5JA 1IRGA 4LIUA 4RGRA 1K78A 3D5SC 5FFZA 4BQNA 2M30A 3OYHA 2B7EA 1Z91A 3SJMA 5DTDA 4EEFG 5FKMA 4PJ0C 2TCTA 1FP2A 3SDBA 3T8TA 5KK1A 2DK5A 1HSTA 3TP0A 4KISA 2OCCH 1YFHA 2PN6A 5CKTA 2ZXIA 5IP9J 2NRAC 2VE9A 3PL8A 1ITYA 2PMUA 5EEAA 1BW6A 1OJLA 1FIPA 3L1PA 5H2FC 2G0EA 3IUOA 4D1QA 4M71A 2ZKZA 2P5LC 1D1BA 5K7ZA 1R4NB 1Z7UA 1D0XA 1KU9A 4MTEA 4D5FA 2O7OA 1YS7A 3S3NA 2AQEA 2MW8A 3LNQA 1ETQA 4CZZA 2DOEA 4HDVA 3S17J 1ZQ3P 4B43A 4G6TB 2A6HF 3CCVI 3K4JA 3K0LA 3C1DA 4E7HA 1ZR2A 4MHGA 2K40A 3KP5A 2VPLA 2LBFB 3MAJA 4EJUA 2W7NA 2QVOA 1KONA 2QUFA 3JR9A 3PIOF 4YG2F 2MABA 1LKXA 3JRFA 3E5QA 3I5UA 3PJRA 1D8KA 2MLGA 2A6TA 3LSGA 2G7UA 1W7PB 5L3BA 4V19K 1APLC 1XB4A 2FMYA 4DNCA 5E3MA 5IT9K 3H36A 3OSGA 2GQQA 4GFBA 3RJPA 5FLMJ 4MTDA 2DFFA 5EZGA 3M4OJ 4D7NA 5JI6A 1OCOH 1QQIA 1X2NA 3FDYA 2HXOA 2K9SA 2DYSH 2VXDA 4RGUA 3Q9VA 5GP9A 1SFXA 2HYJA 1RETA 3P7NA 1N25A 2QSFX 3P9CA 4J19A 1IJWC 5GADJ 3HSEA 1YW7A 3ZOBA 4AD9A 3DBHB 2HXIA 2CG4A 2FBIA 4P9UA 1REPC 3HXLA 4UVCA 4R1HA 3HUGB 2QENA 2L9SA 2KPMA 2XF5A 4KITB 4P55A 2XGEA 2E5NA 3GTKJ 2PG4A 2BE5F 2K9QA 1T8IA 5CPRB 1K79A 2CV2A 4CH7A 1O3RA 3K4CA 1A36A 2NOGA 4JOMA 2R5ZB 2CQXA 2KRFA 2WC2A 1QO0D 1AWCA 3FKJA 3SXYA 1R23A 3T0YA 3F8FA 2KL4A 2L0KA 2ZFUA 1QGPA 4RGXA 2ZXWH 1OCZH 4B3AA 2XSJC 1JKPC 3JTHA 3HOVJ 1FJLA 3E6MA 4HA8A 2VKDA 3M9AA 2BXZA 5KAIC 1Y0UA 2FSWA 3B73A 3QOPA 1FSHA 3PSFA 5BQTA 1FTTA 3FXLA 2BHYA 3OYBA 2EFWA 2M0MA 4ENJA 2VPRA 2P4WA 3HBLA 1DQUA 1ETOA 1F36A 1FPQA 2JQ7A 3KP6A 1R1TA 5KNLA 3G71I 4A0YA 2I5UA 3IH4A 3SFIA 1T39A 3HRTA 2KIMA 1SD5A 3DTKA 3RDIA 4LB5A 2AO9A 1ZGAA 1PUFB 1WJAA 3QYEA 4G7OF 4Y17A 3S2WA 1XN7A 3JRCA 2ACJA 2VONA 3KE2A 3ZQGA 4S04A 1SVOA 1Z05A 1MBEA 1LFBA 4EM2A 4E7JA 4I01A 3CDLA 3KFWX 2R93J 4HF0A 4UV9A 3BTLA 3CJQB 1MSFC 5ICGA 3CJTB 4L9JA 1PP7U 1WJFA 4BQAA 4OMYA 2QBYB 1Y39A 1WJBA 1B9MA 1YI2I 5BPIA 2LFBA 3KZYA 1ZLJA 2HTSA 3FMQA 3KZIC 4FE7A 3OYEA 3IRRA 1XS9A 3BTCA 4YELA 4A0ZA 1UJ8A 2XC7A 1RUOA 1ZTRA 3KEYA 3G1MA 3ECHA 1YIOA 2RDPA 4IOCF 1IXSB 3CUQA 1QHGA 1UCRA 3GXOA 5L3EA 3VYUB 4IKFA 1GVDA 2HPMA 5FKLA 5HLTA 1HCRA 2UUZA 2LP0A 1Z67A 3SYTA 3P9KA 2JA5J 4IHYA 3B02A 3EUHA 3OS1A 3WE2A 4BE2A 3IH3A 3H35A 1DP3A 2L01A 2ELKA 2DI3A 4Z6YA 3MEXA 2CQKA 1S7EA 3VDXA 2JA2A 2ZB9A 1FMVA 2WB1N 2CV0A 3V8LA 1WRJA 4DOZA 2YU9J 4RB0A 4A5MA 4A3GJ 3ZMZA 2R4GA 3WTZA 2YX7A 3DPTA 2C6YA 2VC0A 1U5TA 5BPDA 2XAGA 1G2HA 1OCCH 2Y31A 3K1MA 4F91B 2Y9ZA 1XMXA 4JX5A 2GIZA 2PI0A 2P5KA 3E97A 4N4OB 4ASNA 2W84A 2XGCA 4RAZA 1JE8A 5DEQA 4M9ZA 1RNLA 4L0YB 1JTXA 3GTMJ 3H1CA 3EETA 3CLOA 2CUEA 1NH3A 1S5LC 2R5YA 2UXXA 1YHQI 2XAHA 1U8RA 4BJTA 1VFCA 3JRHA 1M1EB 2LKXA 5IYCJ 3D0SA 4PSXA 3PFIA 2P5VA 2VQHA 2YSRA 3KP7A 4IF4A 2BVMA 4OIPF 3H0DA 3BCBA 1EF4A 3A1YA 1GXQA 3CJNA 1ZHFA 2K9NA 2V1NA 1Y6IA 3FXJA 5K1YA 2JA6J 2ZXHA 1IG7A 2O5RA 2OPTA 2XRNA 2QKLB 1K78B 2X4HA 3OOPA 1FSEA 2X9DA 4IRGA 3OL4A 4G6QA 1ZK8A 2DTRA 2M7AA 4XMYA 4HPQA 5TGTA 3BT9A 1USTA 3CCRI 1V3FA 3OL3A 1G59A 5J47A 2EV0A 3OYGA 2V7FA 3L2UA 2RKHA 3M1EA 3K6GA 1LVKA 4HSRA 5DM7F 1FT9A 5ILSA 3FMSA 3OIOA 5FFXA 4DW6A 2H09A 2CFOA 3TDZC 4PUSA 5FRMA 4LG0A 2JRTA 1I5ZA 2L9VA 1KYZA 1GLNA 2HWVA 4CCJA 1NK2P 3W2VA 4I2OA 4HEA2 4PSWA 5EGOB 4AIKA 3BZCA 3I64A 2CU7A 2COBA 1TNTA 3DPUA 3T1BA 1G3WA 2JRMA 1FP1D 3KLNA 3F8BA 2BGCA 1G4DA 1VQKI 3ELKA 9ANTA 4Q47A 4EJTA 3P9IA 3E5UA 2X6XA 2OZUA 4IJAA 3L2WA 2F4IA 4E7LA 2LBFA 2VBYA 1BR4A 2EZIA 4ZDOA 3U1DA 1QNTA 1ZGWA 5FJ8J 1U9OA 1RZ4A 4I76A 3LMMA 5E20A 4C9YA 1QBJA 1WH7A 2DYRH 5GAEJ 3WGIA 4GDFA 4Q5SF 2ZSHB 1U9NA 3QPTA 2DT6A 3K4BA 1V5FA 1XGMA 3AAFA 2NVYJ 3DEWA 4BHCA 4R8HA 2DA1A 5IYBJ 2BVLA 4XL9A 2V9VA 1O3QA 3ABKH 3I4MJ 1CGPA 2DN0A 3U21A 4AVPA 1VQOI 1N75A 4KIGA 4AUXA 5B66C 3PO2J 4RB2C 1F5TA 1TQIA 3BC8A 3BG9A 3V4GA 1WZ2A 4WXCA 4BEHA 1NK3P 3DBRB 2EINH 1TWCJ 4OAZA 1Z6TA 2R7OA 4Y4RA 2F4MB 4RS8A 2VI6A 1MMNA 2ZJQF 4RM2A 3TO7A 2XAJA 3GCMA 3LSHA 1JKQC 1KU7A 1XC5A 1R5ID 1BOAA 3BG3A 5JLWA 3H9GA 3DLAA 1BI1A 1FIAA 3S93A 2LY9A 1SD4A 5L3DA 2UZKA 2EBIA 2DT7B 2M45A 4FT8A 3L2RA 2Y48A 2DPDA 2Z3YA 3DPLC 1O3TA 4U0VA 1YOVB 2EIKH 2CMPA 5FKOA 4IHVA 3P5JA 3HGYA 5HS9A 4QSHA 3DCFA 2X1DA 1Z6RA 3GTPJ 1MMDA 4NNJA 1FTZA 5K5OA 3IHUA 2KIQA 1K4TA 1TBXA 4E70A 1ZH5A 4FX0A 3OOUA 1S3JA 3NRVA 2XSDC 1K6OA 1JUMA 4I09A 2EZHA 2K02A 5M5YJ 2M5WA 2QQ9A 1STZA 5BOXA 4JYKA 2P7VB 3C3WA 4A3JJ 2VQLA 3J81K 3W2AA 3ML6A 5F64A 5HLIA 5J6XA 2Y75A 1I3AA 2FXAA 2OUMA 4YFNF 3PQJA 3ESWB 1QPIA 5JHFA 3HIFA 5AIQA 4UNOA 1KU3A 1MNDA 3HEFA 2R7VA 4ENMA 3ZMUA 5E18F 3CCUI 1ZELA 4BE0A 3K2AA 2FA5A 4LIVA 1X3WB 4KMFA 1L3LA 2DA5A 2GIVA 3ONQA 2HOSA 1K7AA 1LDDA 2K9MA 1JUPA 2EZLA 3RKYA 2JSPA 1MW7A 4PJJA 4EV0A 4Q4ZF 4KN4X 2O3FA 4M72A 4YEJA 3I59B 2P6TA 3CP8A 4A3DJ 1EV7A 2JVHA 2ZC2A 3F9KA 4IQ4A 3CUQB 2HOTA 1SMYF 4F52A 1TW3A 4BH9A 4I0BA 4ZYGA 3RI4A 3WTVC 1TQMA 2QQ8A 4EJOA 2CW7A 3O8HA 3QRFF 2OAZA 2YX4A 3FX3A 3S32A 3R6SA 1ODDA 2XUBA 2BY2A 1W0TA 1EH7A 1FOXA 1LPQA 4HDUA 4PFPA 2IT0A 2F5EA 1FOWA 2AQFA 2HZDA 3HB9A 1ONVA 2E34A 3DFGA 2HQRA 3FF5A 3ZQHA 1XD7A 2GA2A 5D5XB 4HX4A 1PUEE 1HOMA 3JCUC 2VUMJ 1GVJA 2R7DA 4G12A 1ZRCA 2M1BA 3F8MA 5JFRA 1JTYA 2V6CA 2K3FA 2VL8A 4XKVA 3NEUA 4U87A 2CW8A 4AWXB 3E6CC 1DUXC 4UY8I 2MGQA 3GVAA 2K7LA 3H5AA 3CD6I 2XPWA 3HOUJ 2D1HA 3FXQA 4EGYA 4RB1A 1X4PA 2HOAA 1HDPA 2OV7A 5B5EC 3GEZA 1QU3A 2JMWA 4L18B 1C0WA 4N0BA 3BJAA 1VQ8I 5LBQA 1IO2A 3OR1C 1DU6A 3IWFA 1QZYA 2XV4S 2JUCA 2Y69H 4F55A 3IL2A 3V7SA 1Z9CA 3I0TA 1LFUP 2AHQA 2VE8A 2F2EA 1BBYA 4BKXA 1TWFJ 3IRQA 3H3ZA 2HVQA 4KFCA 3HJEA 2LR8A 4XLFA 1ETWA 3KX2A 2DOFA 3W2WA 4B48A 3R0AA 3FXRA 1B72A 4AU7A 4NHJA 1EKEA 4KA4A 3JRAA 5DDGA 1P2FA 2XF6A 2A6EF 4XKBA 3LA7A 5M3FJ 2E35A 4CCOA 4H0EA 1G8XA 1K6YA 2WWYA 3WTTC 2KHMA 3BQZA 4HQEA 2JN6A 1MBHA 2OD5A 1LB2A 2F48A 4DYCA 2IVMA 5D8LB 3EYIA 2QKMB 3BTIA 4XLCA 3J81Z 3RZDJ 1XPXA 2PJPA 1IRZA 2VKEA 3IWZA 3DLLF 1ZG5A 1WGXA 5FLVA 5TRDA 1Y8RB 3AKZA 1A04A 2CUFA 4HNVA 4LG0B 5E3LA 4M3GA 3BG5A 2OZ6A 2RQQA 3K10A 3O6BB 1R1UA 5E79C 4DQ2A 4PJLA 3GX4X 1OFCX 3F8NA 4MLOA 1VQ5I 3BR5A 2LTPA 5HLGA 3ZCOA 3M3YJ 5EGOA 1JKOC 2MYSA 4GRIA 3WHBA 1XDUA 2PMHA 3RYRA 5EG0A 2FOWA 2ID6A 3ZN0A 1R4MB 3M8EA 4WXHA 2E1CA 3I4NJ 2QQBA 3WTWC 1QVTA 5JHUA 3E6BA 3H5NA 3ZQLA 3OYMA 2Y0MA 3HSFA 1IDZA 5HDGA 1SFKA 1MH4A 2Z1DA 3F3XA 3G2BA 2DODA 2TRTA 3A01A 2ECBA 4IXAA 2UWMA 5J4YA 1U2WA 2XDVA 4XK4A 3JRGA 4G7HF 2E1OA 2XAFA 3H3UA 2KFDA 2L02A 2FNPA 4CUGA 4Y7NJ 2OTLI 2HDCA 4RLFA 3RTRA 2ELJA 3DU5A 5EDNA 1CF7B 1NHAA 4XRSA 3MN2A 5C4XJ 2FBHA 3OMYA 4E7IA 3F8CA 1P7JA 2CYYA 1MNEA 1NTCA 3DBLB 3RKXA 4CO8A 3WGHA 3COAC 3LQQA 1O4XA 2O8KA 4F7ZA 1MJBA 3I3LA 4BEHB 1E0EA 2ME0A 3UR3C 2DMUA 2LNBA 3JRIA 3K9TA 2EFOA 3CESA 4BBRJ 3I4PA 2OU2A 1T56A 3X2QH 5HNFA 2HDDA 1MKMA 2CGPA 1O57A 3L00A 2QGUA 3WG9A 1SFEA 2EB7A 2MC3A 4M73A 4B3XA 3ZMVA 3OV8A 4HW0A 4PJNA 1XG1A 1A6QA 1YX5A 3DKXA 4BDYA 3PNTA 5D4SA 1DP7P 3HOWJ 4E7SA 2B0LA 3MMYB 3R0JA 3KP2A 4BJ5C 3L7WA 1WPKA 1TZLA 4N4NB 4RB3C 1IN6A 3MZYA 3GLLA 1IRFA 2J5PA 4HV6A 1X1PA 4HG2A 4IRIA
chains in the Genus database with same CATH topology
1X58A 1S7EA 1LE8A 2ZB9A 2WB1N 4CYCA 1QRYA 1ETXA 3GTJJ 3F0CA 5EYRA 4RDUA 2YU9J 4A3FJ 4A3GJ 2KT0A 2E2JJ 3WHCA 2DJNA 1G2HA 1D5YA 4MFDA 2Y31A 2YS9A 2DMNA 2Y9ZA 4JX5A 3QQAA 1JT6A 3GTGJ 2M8GX 2XGCA 4A69C 1A6IA 4C3HJ 1ENHA 1H89C 1OCTC 1Q1VA 3H3VK 2E2IJ 1YRNB 1JTXA 3FK7A 1GUUA 3GTMJ 5FKNA 3FKIJ 1BL0A 4FE4A 2DA4A 2CUEA 1ZKGA 5IOZA 1B8IA 1IGNA 2R5YA 4C2MJ 1UG2A 4XRSG 1BW5A 1RKTA 1BJZA 2Y2ZA 1VFCA 3JRHA 2LKXA 1UHSA 5IYCJ 4L5EA 1DU0A 1AHDP 3G1LA 2B63J 2EH3A 2NS7A 3NAUA 4A3IJ 4NDLA 3HM5A 4MO7A 3ZQFA 2FD5A 2LLKA 5IOYA 1EF4A 4XICA 3FISA 3PM1A 2K9NA 3CCYA 1GDTA 2JA6J 4A93J 5GPCA 5C44J 1SFOJ 1IG7A 3E7LA 2OPTA 1RPWA 2X9DA 5EF6A 5E3OA 4A3LJ 1ZK8A 5IP7J 2GM4A 2N8GA 3BT9A 5C4JJ 3OSFA 2Y30A 2FX0A 3BR2A 5F0FA 3BR0A 2CRGA 2IEKA 5IPAA 3S2DJ 3OIOA 5HODA 3MKLA 4DW6A 3S14J 2L9RA 4XRMA 3HKZN 1GV5A 1NK2P 3NARA 2R5ZA 1AU7A 3S1NJ 1JKRC 2HQ5A 2XB0X 5EGOB 2CU7A 4QTRA 2KDZA 2COBA 4X1EA 5M3MJ 2W48A 9ANTA 3A02A 5DS9A 5E3NA 2DA2A 2JA7J 1K61A 2MSYA 3BQYA 2EZIA 1ZGWA 5FJ8J 1U9OA 4I76A 5JLXA 3S15J 2OF7A 1WH7A 1VI0A 3LSJA 1HF0A 5FKKA 1FEXA 3Q0WA 2RAEA 1ETYA 1U9NA 1B72B 1TC3C 4B4CA 2H8RA 2ID3A 4BBSJ 5K7FA 2NVYJ 3DEWA 2P81A 1ETVA 1PUFA 1JT0A 1H8AC 2DA1A 3BR6A 5IYBJ 4BY1J 4QIWN 2CJJA 3I4MJ 2DN0A 4AUXA 3PO2J 2EZKA 2X48A 2FQ4A 2GLOA 1Y1VJ 3BG9A 5F0HA 1NK3P 2DMPA 5EZHA 1P7IA 1TWCJ 4S0HB 2VI6A 5J1RA 2I10A 1JKQC 3W6VA 2JK3A 1XC5A 3BG3A 5JLWA 4UUSA 3LSRA 1FIAA 3FIWA 2O9LA 2LY9A 3ZQIA 2EQRA 2LD5A 2WV1A 1TWAJ 1HLVA 4M3BA 1IDYA 2EBIA 5GPAA 4JP0A 1VF9A 1Y1WJ 4IEJA 5EG0B 4A3BJ 1BA5A 2XGDA 5FKOA 4IHVA 1Z77A 3HGYA 2DA3A 4QSHA 4JX4A 1AKHA 1K83J 3DCFA 4LOCA 5M5WJ 3PO3J 3GTPJ 3Q0UA 2XPUA 1FTZA 1I3QJ 3VPRA 3A01B 3H0GJ 3K7AJ 3BR1A 1U8BA 1JJ8C 1ZR4A 3OOUA 2XSDC 1JUMA 2EZHA 5M5YJ 4CYCB 3HOXJ 2MG4A 4JYKA 3GTOJ 4C3JJ 4A3JJ 4A3CJ 3S1RJ 2QF7A 1OCPA 2NVXJ 1HDDC 3D1NI 1GT0C 2M9HA 2YUSA 4MIMA 1MBFA 4IHWA 2JWTA 1QPIA 2LVSA 3HEFA 1MBKA 2DA7A 2L7MP 4UUTA 4AYBN 1POGA 1YRNA 2ECCA 3K2AA 1I6HJ 3BR3A 2NS8A 2IAIA 2DA5A 1TWGJ 3CMYA 2HOSA 1WI3A 3RKQA 3TEDA 4DZPA 1ORKA 2XB5A 4FCYA 1JUPA 2EZLA 1B8IB 3S2HJ 2R5YB 5F04A 4D7MA 4A3DJ 1WCMJ 4W1UA 1MBJA 2HOTA 1TWHJ 4JX6A 4A3EJ 1SANA 3Q3SA 2E2HJ 3UKGA 3O8HA 1A5JA 3CQZJ 1JGGA 3HOZJ 3TP3A 3Q0VA 1W0TA 4C3IJ 1JJ6C 3ZQCA 3HB9A 3SJMA 1IUFA 2GBYA 5DTDA 2M34A 4EEFG 3ZQHA 1LE8B 5FKMA 1MNMC 2TCTA 1HOMA 1X2MA 3RQIA 1H88C 2VUMJ 1VNDA 4G12A 3B6AA 4ABZA 1JTYA 4BY7J 3TP0A 1GV2A 5IP9J 1ITYA 4AC0A 5EEAA 1BW6A 1WH5A 1OJLA 1FIPA 2L7FP 5F27A 4DYRA 3L1PA 2G0EA 2L7ZA 2H1KA 2ME6A 1JUSA 2MGQA 5K7ZA 2XPWA 3HOUJ 4D5FA 2HI3A 4W97A 2HOAA 2O7OA 1HDPA 2E19A 4D5CA 1T33A 2MW8A 2JMWA 3LNQA 1ETQA 3S17J 1ZQ3P 1DU6A 4M3FA 1CQTA 1UMQA 1ZR2A 1LFUP 2AHQA 2K40A 4V2FA 1MH3A 3MVPA 4BKXA 1TWFJ 3JR9A 2DA6A 3JRFA 1RR7A 2LR8A 1ETWA 3HOYJ 1RESA 3B6CA 1QVUA 3LSGA 1APLC 5E3MA 1B72A 3OSGA 3IH2A 4GFBA 2VKVA 3JRAA 5FLMJ 1R9TJ 1E3OC 2R92J 5EZGA 2NVTJ 5M3FJ 3M4OJ 4D7NA 1X2NA 1RKWA 2HXOA 2K9SA 3LOCA 2R7ZJ 2XRLA 5GP9A 2HYJA 4M3DA 1MBGA 1RETA 2Y0SN 3BQZA 5IP6A 2JN6A 1IJWC 4J19A 1MBHA 2DMQA 5F0CA 3ZOBA 4DYCA 3HDDA 4DZJA 3GTQJ 2HXIA 3S1QJ 3BTIA 5M5XJ 3RZDJ 4MFEA 4XIDA 5K7HA 2NVQJ 1IRZA 4X6AJ 2VKEA 2IBDA 3FK6A 1WGXA 5J1UA 5FLVA 2Y9YA 1MSEC 2CUFA 1IV6A 2XGEA 3GTKJ 4UUSB 4HNVA 3S16J 2K9QA 5E3LA 4M3GA 3BG5A 2LK2A 2DMTA 2NOGA 3S1MJ 1OFCX 4MLOA 1I50J 2R5ZB 3BR5A 2LTPA 2CQXA 3M3YJ 5EGOA 3JRBA 1JKOC 3TW6A 4IHXA 4B1RA 2WAQN 4Y52J 3WHBA 5EG0A 2ID6A 2L0KA 3C2BA 3TW7A 4B3AA 3I4NJ 1JKPC 1QVTA 2M0CA 3HOVJ 1FJLA 3ZQLA 1AKHB 2DTZA 1IDZA 1MH4A 2M2EA 2R0QC 3IV5A 1FTTA 2TRTA 3A01A 3O8GA 2ECBA 4I6ZA 2VPRA 4XK4A 3HBLA 3JRGA 2E1OA 3HGGA 1F36A 1ETOA 3QPSA 4A3KJ 4Y7NJ 3IH4A 2JA8J 3SFIA 3JREA 5EDNA 2AO9A 2PMZN 3MN2A 4XRSA 1PUFB 5C4XJ 2D5VA 3LSPA 1F43A 1P7JA 1Z0XA 3JRCA 4FTHA 1NTCA 2JJ7A 5J1YA 3ZQGA 5C3EJ 2O8KA 1O4XA 1MBEA 2QCOA 1LFBA 4RBOA 3CDLA 3QPLA 2R93J 2ME0A 3BTLA 3JRDA 1MSFC 2DMUA 3JRIA 2XPVA 4FISA 2LFBA 5IYDJ 4FE7A 4BBRJ 1T56A 3BTCA 1XS9A 2HDDA 3G1OA 5F08A 3BTJA 4M6VA 3RZOJ 1ZTRA 1IC8A 3G1MA 2CQQA 1XG1A 4DYQA 5F1JA 1U78A 1ETKA 4BXXJ 5J3LA 3HOWJ 1GVDA 3SDGA 2X6OA 5FKLA 5BNGA 3GTLJ 1HCRA 2LP0A 3A03A 1WPKA 2JA5J 4IHYA 4A3MJ 1W0UA 2FJ1A 4V2GA 3IH3A 4M3EA 2ELKA 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X58 A;  1S7E A;  1LE8 A;  2ZB9 A;  2WB1 N;  4CYC A;  1QRY A;  1ETX A;  3GTJ J;  3F0C A;  5EYR A;  4RDU A;  2YU9 J;  4A3F J;  4A3G J;  2KT0 A;  2E2J J;  3WHC A;  2DJN A;  1G2H A;  1D5Y A;  4MFD A;  2Y31 A;  2YS9 A;  2DMN A;  2Y9Z A;  4JX5 A;  3QQA A;  1JT6 A;  3GTG J;  2M8G X;  2XGC A;  4A69 C;  1A6I A;  4C3H J;  1ENH A;  1H89 C;  1OCT C;  1Q1V A;  3H3V K;  2E2I J;  1YRN B;  1JTX A;  3FK7 A;  1GUU A;  3GTM J;  5FKN A;  3FKI J;  1BL0 A;  4FE4 A;  2DA4 A;  2CUE A;  1ZKG A;  5IOZ A;  1B8I A;  1IGN A;  2R5Y A;  4C2M J;  1UG2 A;  4XRS G;  1BW5 A;  1RKT A;  1BJZ A;  2Y2Z A;  1VFC A;  3JRH A;  2LKX A;  1UHS A;  5IYC J;  4L5E A;  1DU0 A;  1AHD P;  3G1L A;  2B63 J;  2EH3 A;  2NS7 A;  3NAU A;  4A3I J;  4NDL A;  3HM5 A;  4MO7 A;  3ZQF A;  2FD5 A;  2LLK A;  5IOY A;  1EF4 A;  4XIC A;  3FIS A;  3PM1 A;  2K9N A;  3CCY A;  1GDT A;  2JA6 J;  4A93 J;  5GPC A;  5C44 J;  1SFO J;  1IG7 A;  3E7L A;  2OPT A;  1RPW A;  2X9D A;  5EF6 A;  5E3O A;  4A3L J;  1ZK8 A;  5IP7 J;  2GM4 A;  2N8G A;  3BT9 A;  5C4J J;  3OSF A;  2Y30 A;  2FX0 A;  3BR2 A;  5F0F A;  3BR0 A;  2CRG A;  2IEK A;  5IPA A;  3S2D J;  3OIO A;  5HOD A;  3MKL A;  4DW6 A;  3S14 J;  2L9R A;  4XRM A;  3HKZ N;  1GV5 A;  1NK2 P;  3NAR A;  2R5Z A;  1AU7 A;  3S1N J;  1JKR C;  2HQ5 A;  2XB0 X;  5EGO B;  2CU7 A;  4QTR A;  2KDZ A;  2COB A;  4X1E A;  5M3M J;  2W48 A;  9ANT A;  3A02 A;  5DS9 A;  5E3N A;  2DA2 A;  2JA7 J;  1K61 A;  2MSY A;  3BQY A;  2EZI A;  1ZGW A;  5FJ8 J;  1U9O A;  4I76 A;  5JLX A;  3S15 J;  2OF7 A;  1WH7 A;  1VI0 A;  3LSJ A;  1HF0 A;  5FKK A;  1FEX A;  3Q0W A;  2RAE A;  1ETY A;  1U9N A;  1B72 B;  1TC3 C;  4B4C A;  2H8R A;  2ID3 A;  4BBS J;  5K7F A;  2NVY J;  3DEW A;  2P81 A;  1ETV A;  1PUF A;  1JT0 A;  1H8A C;  2DA1 A;  3BR6 A;  5IYB J;  4BY1 J;  4QIW N;  2CJJ A;  3I4M J;  2DN0 A;  4AUX A;  3PO2 J;  2EZK A;  2X48 A;  2FQ4 A;  2GLO A;  1Y1V J;  3BG9 A;  5F0H A;  1NK3 P;  2DMP A;  5EZH A;  1P7I A;  1TWC J;  4S0H B;  2VI6 A;  5J1R A;  2I10 A;  1JKQ C;  3W6V A;  2JK3 A;  1XC5 A;  3BG3 A;  5JLW A;  4UUS A;  3LSR A;  1FIA A;  3FIW A;  2O9L A;  2LY9 A;  3ZQI A;  2EQR A;  2LD5 A;  2WV1 A;  1TWA J;  1HLV A;  4M3B A;  1IDY A;  2EBI A;  5GPA A;  4JP0 A;  1VF9 A;  1Y1W J;  4IEJ A;  5EG0 B;  4A3B J;  1BA5 A;  2XGD A;  5FKO A;  4IHV A;  1Z77 A;  3HGY A;  2DA3 A;  4QSH A;  4JX4 A;  1AKH A;  1K83 J;  3DCF A;  4LOC A;  5M5W J;  3PO3 J;  3GTP J;  3Q0U A;  2XPU A;  1FTZ A;  1I3Q J;  3VPR A;  3A01 B;  3H0G J;  3K7A J;  3BR1 A;  1U8B A;  1JJ8 C;  1ZR4 A;  3OOU A;  2XSD C;  1JUM A;  2EZH A;  5M5Y J;  4CYC B;  3HOX J;  2MG4 A;  4JYK A;  3GTO J;  4C3J J;  4A3J J;  4A3C J;  3S1R J;  2QF7 A;  1OCP A;  2NVX J;  1HDD C;  3D1N I;  1GT0 C;  2M9H A;  2YUS A;  4MIM A;  1MBF A;  4IHW A;  2JWT A;  1QPI A;  2LVS A;  3HEF A;  1MBK A;  2DA7 A;  2L7M P;  4UUT A;  4AYB N;  1POG A;  1YRN A;  2ECC A;  3K2A A;  1I6H J;  3BR3 A;  2NS8 A;  2IAI A;  2DA5 A;  1TWG J;  3CMY A;  2HOS A;  1WI3 A;  3RKQ A;  3TED A;  4DZP A;  1ORK A;  2XB5 A;  4FCY A;  1JUP A;  2EZL A;  1B8I B;  3S2H J;  2R5Y B;  5F04 A;  4D7M A;  4A3D J;  1WCM J;  4W1U A;  1MBJ A;  2HOT A;  1TWH J;  4JX6 A;  4A3E J;  1SAN A;  3Q3S A;  2E2H J;  3UKG A;  3O8H A;  1A5J A;  3CQZ J;  1JGG A;  3HOZ J;  3TP3 A;  3Q0V A;  1W0T A;  4C3I J;  1JJ6 C;  3ZQC A;  3HB9 A;  3SJM A;  1IUF A;  2GBY A;  5DTD A;  2M34 A;  4EEF G;  3ZQH A;  1LE8 B;  5FKM A;  1MNM C;  2TCT A;  1HOM A;  1X2M A;  3RQI A;  1H88 C;  2VUM J;  1VND A;  4G12 A;  3B6A A;  4ABZ A;  1JTY A;  4BY7 J;  3TP0 A;  1GV2 A;  5IP9 J;  1ITY A;  4AC0 A;  5EEA A;  1BW6 A;  1WH5 A;  1OJL A;  1FIP A;  2L7F P;  5F27 A;  4DYR A;  3L1P A;  2G0E A;  2L7Z A;  2H1K A;  2ME6 A;  1JUS A;  2MGQ A;  5K7Z A;  2XPW A;  3HOU J;  4D5F A;  2HI3 A;  4W97 A;  2HOA A;  2O7O A;  1HDP A;  2E19 A;  4D5C A;  1T33 A;  2MW8 A;  2JMW A;  3LNQ A;  1ETQ A;  3S17 J;  1ZQ3 P;  1DU6 A;  4M3F A;  1CQT A;  1UMQ A;  1ZR2 A;  1LFU P;  2AHQ A;  2K40 A;  4V2F A;  1MH3 A;  3MVP A;  4BKX A;  1TWF J;  3JR9 A;  2DA6 A;  3JRF A;  1RR7 A;  2LR8 A;  1ETW A;  3HOY J;  1RES A;  3B6C A;  1QVU A;  3LSG A;  1APL C;  5E3M A;  1B72 A;  3OSG A;  3IH2 A;  4GFB A;  2VKV A;  3JRA A;  5FLM J;  1R9T J;  1E3O C;  2R92 J;  5EZG A;  2NVT J;  5M3F J;  3M4O J;  4D7N A;  1X2N A;  1RKW A;  2HXO A;  2K9S A;  3LOC A;  2R7Z J;  2XRL A;  5GP9 A;  2HYJ A;  4M3D A;  1MBG A;  1RET A;  2Y0S N;  3BQZ A;  5IP6 A;  2JN6 A;  1IJW C;  4J19 A;  1MBH A;  2DMQ A;  5F0C A;  3ZOB A;  4DYC A;  3HDD A;  4DZJ A;  3GTQ J;  2HXI A;  3S1Q J;  3BTI A;  5M5X J;  3RZD J;  4MFE A;  4XID A;  5K7H A;  2NVQ J;  1IRZ A;  4X6A J;  2VKE A;  2IBD A;  3FK6 A;  1WGX A;  5J1U A;  5FLV A;  2Y9Y A;  1MSE C;  2CUF A;  1IV6 A;  2XGE A;  3GTK J;  4UUS B;  4HNV A;  3S16 J;  2K9Q A;  5E3L A;  4M3G A;  3BG5 A;  2LK2 A;  2DMT A;  2NOG A;  3S1M J;  1OFC X;  4MLO A;  1I50 J;  2R5Z B;  3BR5 A;  2LTP A;  2CQX A;  3M3Y J;  5EGO A;  3JRB A;  1JKO C;  3TW6 A;  4IHX A;  4B1R A;  2WAQ N;  4Y52 J;  3WHB A;  5EG0 A;  2ID6 A;  2L0K A;  3C2B A;  3TW7 A;  4B3A A;  3I4N J;  1JKP C;  1QVT A;  2M0C A;  3HOV J;  1FJL A;  3ZQL A;  1AKH B;  2DTZ A;  1IDZ A;  1MH4 A;  2M2E A;  2R0Q C;  3IV5 A;  1FTT A;  2TRT A;  3A01 A;  3O8G A;  2ECB A;  4I6Z A;  2VPR A;  4XK4 A;  3HBL A;  3JRG A;  2E1O A;  3HGG A;  1F36 A;  1ETO A;  3QPS A;  4A3K J;  4Y7N J;  3IH4 A;  2JA8 J;  3SFI A;  3JRE A;  5EDN A;  2AO9 A;  2PMZ N;  3MN2 A;  4XRS A;  1PUF B;  5C4X J;  2D5V A;  3LSP A;  1F43 A;  1P7J A;  1Z0X A;  3JRC A;  4FTH A;  1NTC A;  2JJ7 A;  5J1Y A;  3ZQG A;  5C3E J;  2O8K A;  1O4X A;  1MBE A;  2QCO A;  1LFB A;  4RBO A;  3CDL A;  3QPL A;  2R93 J;  2ME0 A;  3BTL A;  3JRD A;  1MSF C;  2DMU A;  3JRI A;  2XPV A;  4FIS A;  2LFB A;  5IYD J;  4FE7 A;  4BBR J;  1T56 A;  3BTC A;  1XS9 A;  2HDD A;  3G1O A;  5F08 A;  3BTJ A;  4M6V A;  3RZO J;  1ZTR A;  1IC8 A;  3G1M A;  2CQQ A;  1XG1 A;  4DYQ A;  5F1J A;  1U78 A;  1ETK A;  4BXX J;  5J3L A;  3HOW J;  1GVD A;  3SDG A;  2X6O A;  5FKL A;  5BNG A;  3GTL J;  1HCR A;  2LP0 A;  3A03 A;  1WPK A;  2JA5 J;  4IHY A;  4A3M J;  1W0U A;  2FJ1 A;  4V2G A;  3IH3 A;  4M3E A;  2ELK A;  3GBG A; 
#chains in the Genus database with same CATH topology
 3DXJ F;  3PUB A;  1LE8 A;  3KYD B;  5E1X A;  2ZNY A;  2VXZ A;  5LEJ A;  1PVE A;  3CTA A;  1QA6 A;  1T0F C;  1O7F A;  5EYR A;  1AA7 A;  4RDU A;  3RPU A;  2QSG X;  2CH0 A;  3RQ4 A;  4TV7 A;  2EJR A;  2KT0 A;  4UB8 C;  2Q2E B;  1YQA A;  1UFM A;  3KYC B;  4P1W A;  3C7J A;  2OTJ I;  4ENK A;  2HVR A;  1ON1 A;  4D9J A;  2XAQ A;  2K3P A;  4L5I A;  1G3S A;  5H6Q A;  2NVU B;  4OIQ F;  2DO7 A;  3LL7 A;  2GWR A;  2KLO A;  4A69 C;  4HOB A;  4CDG A;  2FE3 A;  5CVU A;  1H89 C;  1OCT C;  4J01 A;  4GO1 A;  1VQM I;  3FKI J;  1BL0 A;  3JW4 A;  2DA4 A;  3V8J A;  2KDO A;  4Y33 A;  1IN5 A;  4GYG A;  3QYF A;  4H4K C;  1ZRF A;  1BW5 A;  4BHB A;  3I59 A;  2DAO A;  1BJZ A;  1BR1 A;  4A6E A;  2Y2Z A;  3S3O A;  1S6L A;  4L5E A;  3CCQ I;  1U5T C;  2X51 A;  3G1L A;  2B63 J;  3LSK A;  4NDL A;  3HM5 A;  4KIB A;  1Y0N A;  3ZQF A;  3V42 A;  3FIS A;  3RKW A;  3CCY A;  1IRX A;  1GDT A;  3MKZ A;  5LFA A;  3DP7 A;  5FD5 A;  5GPC A;  5C44 J;  3E7L A;  3CP2 A;  1RPW A;  2Z33 A;  2LKS A;  2VJ4 A;  5B1B H;  1SEU A;  3KP4 A;  5D5W B;  5E3O A;  2W82 A;  2WY7 Q;  1UB9 A;  5D5V B;  1MJ9 A;  3DV8 A;  3K69 A;  4U0W A;  1TTY A;  5C4J J;  3OYA A;  1LDJ A;  4HZF A;  3CO6 C;  3WU2 C;  1VQ9 I;  3BR2 A;  4F92 B;  4OOI A;  4II3 A;  4XON A;  4DIQ A;  2X6Y A;  2CRG A;  1HW1 A;  2OQG A;  4ZTF A;  5HNH A;  1JHH A;  2MD0 A;  2A69 F;  4ANJ A;  4E6K G;  2W57 A;  5HOD A;  1NG6 A;  4F3Q A;  1WJC A;  1FNN A;  2E1M C;  2L9R A;  1R58 A;  3G3Z A;  1A35 A;  5ED4 A;  4B44 A;  2A07 F;  5KCM A;  1J0R A;  3GF2 A;  3NAR A;  3FBN B;  4O5V A;  4ZZL A;  1UG0 A;  3EUH C;  1D0Y A;  3QOE A;  5M3M J;  1B1B A;  2W48 A;  3MKY B;  2LC2 A;  3BPV A;  4N9H A;  4XKC A;  2E7W A;  5E3N A;  3F6V A;  1BR2 A;  5DUK A;  1K61 A;  2KKO A;  5FB2 A;  2HVS A;  2IS1 A;  3KPH A;  1VQ4 I;  1YS6 A;  3S15 J;  2OJE D;  1Z1D A;  4EQQ A;  4C30 A;  2W00 A;  2ZNZ A;  1HF0 A;  2KMU A;  5LHI A;  5EEH A;  1B72 B;  1T0F A;  4NC8 A;  2H8R A;  3QAH A;  3CF2 A;  1P9Q C;  4Y13 A;  1H8A C;  2QLZ A;  5CVI A;  2EFQ A;  5D6F A;  2ESH A;  2V1U A;  4UHT A;  4I98 B;  2CJJ A;  3WTU C;  3FM3 A;  3DF8 A;  3VEP A;  1XMK A;  1V55 H;  2O8X A;  4HBL A;  2VOP A;  2FQ4 A;  4BJ6 C;  2ZJR F;  2RRE A;  5ILU A;  2XRO A;  1OPC A;  4OU0 A;  3A4C A;  3ZRG A;  2KZG A;  4S05 A;  1FY7 A;  2K27 A;  1BI3 A;  1LEA A;  1P4X A;  5JVT A;  4OIN F;  1OYW A;  2CS3 A;  4LGW A;  2I10 A;  2VBZ A;  1KYW A;  2GOM A;  3ABL H;  3ZGK A;  3FIW A;  4R79 A;  2JZY A;  1TWA J;  3OY9 A;  1R7J A;  2BY3 A;  3ABM H;  4IEJ A;  5EG0 B;  1Y1W J;  3CC7 I;  3CJR B;  3JTG A;  2VLA A;  1QZZ A;  4JQF A;  5D8K B;  1Z3X A;  5M5W J;  3RPQ A;  1DGR M;  4B09 A;  3DTI A;  2XPU A;  4MEX F;  3VPR A;  1BC7 C;  3A01 B;  3H0G J;  2DW4 A;  4LK0 F;  4LLG F;  3BR1 A;  1OCR H;  4XRF A;  3WTX C;  2JPC A;  1ZR4 A;  3SFZ A;  3HPG A;  5L3C A;  4EVI A;  5LGU A;  3ULQ B;  4NC6 A;  3CF5 F;  3FXM A;  1FC3 A;  1CF7 A;  1WJE A;  2QF7 A;  1MMS A;  2ETH A;  2CUJ A;  2FBK A;  3HG9 A;  2LYC A;  3CCJ I;  3ZMT A;  3H92 A;  3GFL A;  3MZ8 A;  5A2Q K;  2YUS A;  3CZ6 A;  4MIM A;  2VC1 A;  2V26 A;  2R7X A;  4IHW A;  3J7A O;  2Z9O A;  2FEZ A;  4ZH4 F;  2ZME A;  1IF1 A;  1MBK A;  3AFH A;  3GZ6 A;  4NUB A;  1POG A;  3QP6 A;  3HC7 A;  3HRS A;  5B3S H;  3BR3 A;  4DBQ A;  2IAI A;  3VB2 A;  5LD2 C;  2P7C B;  1TWG J;  3CMY A;  2CSO A;  4RAY A;  4LD5 A;  2BY0 A;  1IXC A;  2ZSI B;  1XSV A;  3WU1 B;  2QQA A;  3DTE A;  6PAX A;  3RPU D;  2HQA A;  2L4A A;  2D45 A;  1XDS A;  3NQO A;  3GWZ A;  3QWL A;  3W3C A;  4EJW A;  5LHG A;  1BN5 A;  2A68 F;  1I1G A;  2DBB A;  4JX6 A;  3PNV A;  3BG6 A;  3DEU A;  4BQQ A;  4KN7 X;  4KDP A;  4XNF A;  2E2H J;  3UKG A;  1FLI A;  4MEY F;  3JSP A;  1N77 A;  4HF1 A;  3TP3 A;  3CUO A;  1R36 A;  3BLY A;  3Q0V A;  5FRO A;  2QM3 A;  4C3I J;  2L5Q A;  3ZQC A;  2V6E A;  2R7U A;  5FLX Z;  1IUF A;  2IGO A;  2GBY A;  5F1R A;  1LE8 B;  1MNM C;  3QOD A;  4MGR A;  3ZN1 A;  2DK8 A;  3S8P A;  4U0Y A;  1X2M A;  3RQI A;  1H88 C;  1SC7 A;  2KP6 A;  3EDP A;  4G8X A;  1NG7 A;  4ABZ A;  3FM5 A;  3VSL A;  4BY7 J;  3TO6 A;  4HNT A;  3MCZ A;  2Q2E A;  4MQV A;  3WOD F;  1GV2 A;  1IV8 A;  4AC0 A;  5J40 A;  4EAT A;  1WH5 A;  4DYR A;  5F27 A;  3U9G A;  1W5C C;  1HQC A;  3MWM A;  1JUS A;  1PDN C;  4XOP A;  1ZN2 A;  1FMW A;  1QHH D;  3DWL E;  2DFI A;  4ZYD A;  4U7D A;  4W97 A;  2EWN A;  2BHZ A;  2E19 A;  2X0L A;  4D5C A;  5LLQ A;  1WSU A;  1DGW Y;  4XLH A;  3WGG A;  2X85 A;  1UHM A;  4O3M A;  2LSO A;  1PP8 F;  3K4M A;  2WAD A;  1UMQ A;  4XLN F;  1YE9 A;  3E1S A;  2PEX A;  1MH3 A;  4IVN A;  2LY2 A;  3MVP A;  2IXS A;  4BHP A;  2VKH A;  2R7S A;  2DA6 A;  3VOE A;  1RR7 A;  1ULY A;  1X1D A;  3ECO A;  1TT5 B;  1D1A A;  3SEZ A;  3B6C A;  1UZC A;  3M8F A;  2CQN A;  4P96 A;  3CDH A;  4RM3 A;  3TMO A;  1EJ9 A;  2L54 A;  2VKV A;  3A0B C;  5CQE A;  4KT6 A;  4XBF A;  3OIP A;  1R9T J;  1E3O C;  3J7Y J;  4KIC A;  2K85 A;  3QPH A;  3LOC A;  4II2 A;  2R7Z J;  2BBY A;  1R5H A;  4XOT A;  2UXN A;  4M3D A;  3H9Q A;  3HHG A;  4I0A A;  5CYV A;  1D5V A;  4FX4 A;  3LAP A;  2WBM A;  5IP6 A;  5HOO A;  4BYY A;  4M9S A;  3TQN A;  2DMQ A;  1HSJ A;  4ETS A;  1XCV A;  5BS6 A;  2ZME C;  4X0G A;  4Y3O A;  1S29 A;  3GTQ J;  5IT9 Z;  4LJZ F;  3S1Q J;  5M5X J;  5DCM A;  4XID A;  3C2H A;  2A3S A;  2B9S A;  5HLH A;  1HBX G;  3FK6 A;  3HL2 A;  4WK8 F;  4XSZ F;  1W36 D;  2Y9Y A;  2P8T A;  2DQR A;  2PBI A;  5TJJ A;  4UUS B;  5HS7 A;  1BI2 A;  1YJN I;  3S3M A;  2LMD A;  2A05 A;  1P6R A;  3S1M J;  4KIF A;  2VJ5 A;  1I50 J;  4ON0 A;  4G9Y A;  3TW6 A;  3BP8 A;  3LA2 A;  3LFK A;  1FZP B;  3ABU A;  1Y8Q B;  2VOO A;  2HU9 A;  2DLL A;  2H94 A;  3C2B A;  5IT3 A;  3K4L A;  4WX9 A;  3CCM I;  1W5T A;  1HW5 A;  4P9F A;  2DOA A;  4GXO A;  2DTZ A;  1QZE A;  2R0Q C;  1LEB A;  3IV5 A;  4WCG A;  2HFH A;  2HQN A;  3ASO H;  4I6Z A;  1RIO H;  2R7Q A;  3LQR A;  3TO9 A;  3QPS A;  4A3K J;  5FO5 A;  3R61 A;  2EK5 A;  4CCN A;  2K4B A;  3QP5 A;  3EUA A;  2JA8 J;  3JRE A;  2D5V A;  3M8J A;  3HTS B;  3I71 A;  2VBX A;  1S7A A;  3LSP A;  2HKX A;  3V7C A;  5CJ9 A;  3PIP F;  2H6C A;  3K2Z A;  3DEE A;  2JJ7 A;  5J1Y A;  5C3E J;  4EMS A;  1I27 A;  4BE1 A;  1YG2 A;  1SFU A;  2LKP A;  3WTY C;  3KZZ A;  1XSX A;  4BXU A;  3LFU A;  3JRD A;  3BY6 A;  1YJ9 I;  2F5F A;  3OYC A;  4FIS A;  4UXN A;  2PLY A;  4GGG A;  1ON2 A;  3OYF A;  4BDZ A;  1MDM A;  2QSH X;  3HTU A;  3T8R A;  1OMI A;  2HGC A;  3G1O A;  1H0M A;  2WV0 A;  4M6V A;  3SZP A;  5DM6 F;  2LF7 A;  1LNW A;  2NXN B;  2H6B A;  4PGH A;  3W6K B;  4YFX F;  5F6F A;  1IC8 A;  4AM3 A;  4G94 A;  3OS0 A;  2IS2 A;  4RAF A;  2AS5 F;  1IN7 A;  2CQQ A;  4CXF A;  1P4A A;  2MFZ A;  3ZMD A;  2XF7 A;  5ICF A;  4DYQ A;  5F1J A;  2A61 A;  3ZMS A;  1WVR A;  5LEK A;  5J3L A;  3OS2 A;  4IHS A;  1KQ8 A;  5HS8 A;  5LRS A;  2X6O A;  5BNG A;  3GTL J;  1V5E A;  4XR6 A;  4KUM A;  2IA0 A;  1VZ0 A;  4ZDP A;  3U1K A;  2WA0 A;  2M87 A;  3HSR A;  3OIQ A;  4V2G A;  2F6C A;  2KIS A;  4HX8 A;  2WB1 A;  4M3E A;  1YLF A;  4P5O A;  2FQ3 A;  1X58 A;  3M1C A;  1D5Y A;  1UHW A;  2HPI A;  2Z2S B;  3L09 A;  4XN0 A;  3K4N A;  4J00 A;  2EIJ H;  1IN4 A;  4CCK A;  2G9W A;  1T08 B;  2DFE A;  4L0Z B;  4B8X A;  2JUG A;  2DJN A;  3BDD A;  3HKZ A;  2PFB A;  2FU4 A;  2FNA A;  2KRH A;  3NWS A;  4MFD A;  4Y15 A;  1VQP I;  3F22 A;  1GHC A;  5L3F A;  4IHT A;  1JT6 A;  2RQP A;  5LGN A;  3GTG J;  2A5W A;  3HZJ A;  5IY5 H;  3K1N A;  4NQW B;  2ZME B;  4C3H J;  1PYV A;  1T95 A;  2VJI A;  3G73 A;  2FRH A;  1Q1V A;  2H27 A;  1D3Y A;  2Q0O A;  5FKN A;  3VOD A;  1ZG3 A;  1ZLK A;  5IOZ A;  2R7F A;  3EPZ A;  1XMA A;  2ISZ A;  2ZCW A;  1XGS A;  3O3K A;  1I39 A;  2XKP A;  1E2X A;  1UG2 A;  5H20 A;  3TKY A;  2ISY A;  3BZ6 A;  4ITV A;  1E3H A;  1RKT A;  3HPH A;  3I54 A;  4LB6 B;  2LG4 A;  2EH3 A;  1WWX A;  2NS7 A;  4M6X A;  1WHU A;  3NAU A;  5HDN A;  4A3I J;  4MO7 A;  3CC4 I;  1X19 A;  3LA3 A;  2LLK A;  5IOY A;  1RC9 A;  1A31 A;  4XIC A;  2BYV E;  2E7X A;  4HYE A;  1B6A A;  1ZG1 A;  3M07 A;  3DKW A;  5DV5 A;  2VT2 A;  4A93 J;  1SFO J;  2STT A;  1FOK A;  3KEO A;  4IPA A;  4A3L J;  2ICW G;  1T98 A;  1FYM A;  2N8G A;  2GM4 A;  1ERD A;  3ABT A;  1XGN A;  4CCM A;  1U3E M;  3BR0 A;  2NYX A;  2V4J C;  2V79 A;  1Z21 A;  2R7R A;  2IEK A;  5E17 F;  2HR3 A;  1XX5 A;  4E4H A;  5IPA A;  3E6D A;  1Y56 A;  3S2D J;  3MQ0 A;  4Q48 A;  5E8I A;  4DJA A;  3ZR8 X;  4XRM A;  3HKZ N;  1J9I A;  3E5X A;  1X3U A;  1GV5 A;  1BIB A;  4BS9 A;  1B9N A;  1AU7 A;  1SVM A;  2HQ5 A;  2IW5 A;  4PFO A;  2COM A;  1TP4 A;  4QTR A;  2KDZ A;  5AON A;  2RC4 A;  3A02 A;  4ENN A;  5LRR A;  4EM1 A;  2IGN A;  3SZG A;  2E1N A;  5DS9 A;  2IP2 A;  1B4A A;  2DA2 A;  3OYL A;  4BXF A;  2VQC A;  1IW7 F;  3GZ5 A;  4MNU A;  1KZH A;  2ZBK A;  5ILV A;  3CO7 C;  5FKK A;  4U7B A;  3PSI A;  4OAY A;  1SMT A;  4EGZ A;  3Q0W A;  2F5D A;  5D5U B;  2KRC A;  3HOS A;  1WJD A;  2RAE A;  1ETY A;  2EFP A;  5CLS A;  3I55 I;  1TC3 C;  4B4C A;  4QWQ A;  3RIR A;  5A2Q Z;  1JT0 A;  3VYT B;  1OYI A;  3BR6 A;  4XSX F;  4QIW N;  2QEX I;  4IOA F;  4BGD A;  3ZQQ A;  2X6W A;  2RNJ A;  2EZK A;  2X48 A;  1R5G A;  1USS A;  4IO9 F;  2GLO A;  1Y1V J;  5GAH J;  3ISP A;  3BOQ A;  5DCM B;  3KYL A;  3J7Z I;  5EZH A;  1P7I A;  4CA0 A;  2XVC A;  4S0H B;  3LWF A;  3FHN A;  2Z99 A;  1MD0 A;  2E60 A;  3VFZ A;  2O0Y A;  3L2V A;  4RMN A;  4RAG A;  1WQ2 A;  4RA2 A;  3OYK A;  4UUS A;  3FZV A;  2LRE A;  2KZV A;  5E1Z B;  2WAQ A;  3K70 C;  2IS6 A;  3KEQ A;  3FMR A;  4KMU X;  1XTA A;  4MQ9 F;  4AIJ A;  2LD5 A;  1HKT A;  1IDY A;  4XOR A;  4ZJZ A;  2K86 A;  1TT0 A;  1TLH B;  3ROU A;  2R3S A;  1R1V A;  1Z77 A;  2PQ8 A;  1IN8 A;  3HRM A;  1J5Y A;  1SD6 A;  4ZYE A;  4LOC A;  3QU6 A;  3HHH A;  3Q0U A;  5DCF A;  4CIC A;  4YRV A;  4U88 A;  1I3Q J;  3FBI B;  4CYD A;  5D4R A;  1Q1H A;  1U8B A;  3CCE I;  3CCS I;  1TW2 A;  3I53 A;  4CYC B;  2RV8 A;  1KQ9 A;  2I8D A;  2MC4 A;  2MG4 A;  4RLQ A;  3CME I;  3GTO J;  4A3C J;  4F93 B;  5TIS C;  3WG7 H;  1UEL B;  3IKT A;  1MGT A;  1YTY A;  1OLT A;  2GAU A;  2PX9 A;  1GT0 C;  1HDD C;  2JSC A;  2W1O A;  4IRH A;  4XN3 A;  2VB6 A;  2JWT A;  4LFU A;  2LVS A;  1YIT I;  1FX7 A;  2XHK A;  2L7M P;  3IAS 2;  4O6J A;  4AYB N;  3FHZ A;  3T5X A;  4E7K A;  1YRN A;  2ECC A;  2L9N A;  1H9G A;  3ERM A;  2DT5 A;  2NS8 A;  4LIT A;  1V4R A;  4DBR A;  3HOT A;  3N05 A;  1RI7 A;  4M74 A;  1R6R A;  3VWB A;  4DZP A;  1DPU A;  2XB5 A;  4FCY A;  3R60 A;  1B8I B;  3S2H J;  1MDM B;  1LVA A;  4I02 A;  2WY8 Q;  2HYF A;  5EEG A;  2L4M A;  3N4M A;  3NWT A;  5GAG J;  1WCM J;  2K4J A;  2BOL A;  2ESN A;  1XGO A;  2ZXJ A;  4L9T A;  1T2K A;  2M4G A;  4W1U A;  1MBJ A;  4A3E J;  2GZW A;  3K1P A;  5KVR A;  1U0J A;  2OCE A;  5CVJ A;  1YIJ I;  3PQK A;  2OQR A;  4A0X A;  1W5S A;  3CQZ J;  3FWE A;  4L9V A;  2M7B A;  1JGG A;  5DYM A;  5K5R A;  1HW2 A;  3HOZ J;  1SVL A;  3GFI A;  1LJ9 A;  1JJ6 C;  2QA4 I;  2AXL A;  2ELH A;  2O03 A;  1T38 A;  1F4K A;  1S72 I;  2ZO4 A;  1W4M A;  2M34 A;  2KJB A;  4XKW A;  3VSK A;  1FOY A;  1Z3Y A;  4PDK A;  1OR7 A;  4AID A;  5ERI A;  4BUP A;  1F9N A;  3M7G A;  3TDU C;  1VND A;  3B6A A;  2KJC A;  3LSI A;  1XCB A;  2BY1 A;  3OWT A;  4YFK F;  3TOA A;  1GXP A;  2E1M B;  2K5C A;  4BAC A;  1O3S A;  2VT3 A;  2HZT A;  2BW3 A;  4PZJ A;  3EYY A;  2L7F P;  4NB5 A;  3G6E I;  2VAS A;  2L7Z A;  2H1K A;  1WKM A;  3GME A;  2ME6 A;  1OYY A;  2E36 A;  4LLN A;  4IL6 C;  4UUV A;  4IQJ A;  1EH8 A;  3TOB A;  4M9X A;  2G7H A;  3MFK A;  5JVG F;  1K4S A;  1X1B A;  4NQW A;  2HI3 A;  2J5O A;  4A2U A;  1T33 A;  2CWE A;  2XAS A;  2D2W A;  2VN2 A;  3AG4 H;  3ERE D;  2TDX A;  3K70 D;  1VQ7 I;  3Q5F A;  3I9V 2;  4M3F A;  1CQT A;  1IZ1 A;  2DU9 A;  2M8E A;  2CQ7 A;  1X1C A;  3GFM A;  4V2F A;  4K2E A;  2FF4 A;  3VYS B;  5CVR A;  4GCV A;  4UVA A;  5CQG A;  1ZRD A;  1E17 A;  2HYG D;  4OWR B;  1X3Z B;  3BWG A;  2Q1Z B;  4UVB A;  2FML A;  3PUF A;  4EM0 B;  3HOY J;  1RES A;  4C2T A;  2W25 A;  3GZN B;  1QVU A;  5HDK A;  3BJ6 A;  3PFY A;  1BOB A;  2EIM H;  3KIO A;  2MD5 A;  3IH2 A;  4NBQ A;  2KQR A;  2R92 J;  1DDN A;  1VTN C;  2NVT J;  1BM9 A;  4XQF A;  2MH9 A;  1RKW A;  3TBI A;  3OYN A;  1OKR A;  2XRL A;  3K4K A;  1BC8 C;  1MBG A;  4IX7 A;  2Y0S N;  2EIL H;  3V8K A;  4C2U A;  2IPQ X;  2OC6 A;  3H5R A;  5B1A H;  4YIF A;  2NOJ B;  5F0C A;  3HDD A;  2F4O B;  3GFJ A;  4DZJ A;  3D5R C;  1L0O C;  4HX7 A;  3L2Q A;  4MFE A;  3U2R A;  5K7H A;  2NVQ J;  1JI8 A;  1R22 A;  4X6A J;  1F1Z A;  2IBD A;  1I6X A;  4UV8 A;  1N78 A;  2VJJ A;  2DCE A;  5J1U A;  1Z7L A;  4PK4 A;  4ZZD A;  5GTI C;  1YYV A;  3CCL I;  1MSE C;  4BQO A;  2EV5 A;  1V54 H;  1IV6 A;  2DJI A;  2W85 A;  3S16 J;  3AL0 C;  2NS0 A;  2ZJP F;  2LK2 A;  2DMT A;  4CGZ A;  1TNS A;  1R49 A;  3N97 A;  3IKV A;  4OIR F;  3JRB A;  1T6S A;  3JAM Z;  4IHX A;  4B1R A;  2DPU A;  2WAQ N;  5J4V A;  2IS4 A;  4Y52 J;  3E3V A;  1RR8 C;  1ZRE A;  2CW0 F;  4FQG A;  3TW7 A;  2M0C A;  2L2O A;  2QYO A;  1AKH B;  5L3G A;  3GO5 A;  4LG3 A;  3L2C A;  2M2E A;  1S7O A;  2JTV A;  1IUY A;  3CMM A;  2A5Y B;  3O8G A;  2O6G E;  2V1X A;  2WAF A;  4HRI A;  3CDI A;  3HGG A;  1R71 A;  3ASN H;  3R4K A;  5LHH A;  3LST A;  3IAM 2;  2E5Z A;  4G6D A;  1W7P D;  3SQN A;  5BMZ A;  4PCQ A;  2PJR B;  2VIX A;  1R00 A;  2PMZ N;  4Z2Y A;  2ADU A;  3EUK L;  4CCL A;  3TGN A;  4DGW B;  4ZYH A;  5FLX K;  1F43 A;  3ZXS A;  1Z0X A;  4ZYA A;  4FTH A;  2Z5U A;  3O2P E;  5D6E A;  3OYI A;  4BU2 A;  4QLC U;  2XGX A;  2QCO A;  1YJW I;  4RBO A;  3QPL A;  2IJL A;  2Y0S A;  4FET A;  4ESJ A;  1G6N A;  1HXD A;  2XPV A;  2V1D A;  4M6Y A;  4WF2 A;  1VQL I;  2MH2 A;  5IYD J;  4B47 A;  4AYB A;  2NNN A;  2LF8 A;  1ZAR A;  3BCA A;  2XAU A;  3F6O A;  2VQG A;  5F08 A;  3BTJ A;  3RSN A;  2BV6 A;  3RZO J;  1D8J A;  4KYW A;  3QU3 A;  5H6R A;  5GTH C;  4GYI A;  2VOD A;  4HV5 A;  1IAW A;  1DPR A;  1S9H A;  2EA4 A;  1YX3 A;  3AG1 H;  5J8C A;  4A12 A;  3GYH X;  1U78 A;  1ETK A;  1MIJ A;  3I58 A;  4BXX J;  3L9F A;  3FXO A;  3SDG A;  3SEQ A;  3A03 A;  4A3M J;  1W0U A;  2FJ1 A;  2HKO A;  4HAM A;  3D5L A;  3GBG A;  3EQL F;  5E8G A;  2OBP A;  3HOX J;  3J80 K;  4CYC A;  2X1E A;  1QRY A;  1ETX A;  3GTJ J;  3DKY A;  3F0C A;  1JXS A;  1OIS A;  1YW9 A;  4A3F J;  3W6J B;  2E2J J;  3WHC A;  2L7K A;  2QWW A;  3GUD A;  2WTE A;  2GXB A;  3CUQ C;  2V9P A;  5ICE A;  1TL8 A;  2YS9 A;  2DMN A;  4BL0 B;  2H8W A;  2PMZ A;  1G3Y A;  4I99 C;  3QQA A;  3J7A Y;  4A6D A;  2DDB A;  2CO5 A;  4YIR X;  2M8G X;  2IRF G;  1A6I A;  1ACI A;  3J80 Z;  2D1V A;  5FGM A;  1ENH A;  3WTS C;  3H3V K;  2E2I J;  1YRN B;  1UAA A;  3FK7 A;  2FOK A;  1GUU A;  3IC7 A;  4FE4 A;  1HKQ A;  1WI9 A;  5FD6 A;  4CZC A;  4AIH A;  4HF2 A;  1MMA A;  1ZKG A;  1ZYR F;  2FUG 2;  4ESB A;  2R7W A;  4PGG A;  1B8I A;  1IGN A;  4BAY A;  3AG3 H;  1HA8 A;  4C2M J;  1FWZ A;  3AL0 B;  1S8N A;  2P6S A;  4XRS G;  4OIO F;  1VQN I;  2RGV A;  3TL4 X;  1UHS A;  4XLA A;  2LH9 A;  2JT1 A;  3GW2 A;  1AHD P;  1DU0 A;  3VYR B;  2STW A;  4JBA A;  3MD2 A;  1OQY A;  1KGS A;  2YU3 A;  1W7P A;  4IZZ A;  2CFX A;  2FD5 A;  3WU0 A;  4L9N A;  3PM1 A;  2ZFW A;  4XLE A;  3C2G A;  2HS5 A;  3H9J A;  1X1A A;  1FBU A;  3V7R A;  3REO A;  5DUI A;  2LDU A;  5ICC A;  5EF6 A;  2NAZ A;  1J09 A;  5IP7 J;  3LAJ A;  1BI0 A;  5FRN A;  2L3D A;  1VQ6 I;  2CUZ A;  1KU2 A;  2Y30 A;  3F23 A;  3OSF A;  2FX0 A;  1LFP A;  2MBF A;  4NC7 A;  1EH6 A;  5HVQ C;  4G7Z F;  4LLL A;  3OR2 C;  1PJR A;  1P4W A;  2JVG A;  5F0F A;  3I56 I;  2R7T A;  4LMY A;  4QPO A;  3G4S I;  2BW3 B;  3GLX A;  1RRJ A;  4KNY A;  3HUG A;  2W24 A;  2F5C A;  2Z16 A;  1FBS A;  3BJO A;  3F72 A;  3MKL A;  3UNG C;  1SAX A;  3S14 J;  1RUN A;  3MKW B;  3QYB A;  2JPB A;  4L5J A;  3KLO A;  3C18 A;  1G3T A;  2M3A A;  3HYI A;  4EJV A;  1LDK B;  2R5Z A;  3S1N J;  1ZGJ A;  2P0W A;  2XB0 X;  1JKR C;  2RNG A;  4X1E A;  3KCC A;  3ZQ7 A;  1BJA A;  5KHD A;  1WFX A;  1P92 A;  2WAE A;  3OYD A;  1O7L A;  4WWC A;  2XKO A;  2JA7 J;  2MSY A;  3BQY A;  5DD8 A;  4ZDL A;  4HLX A;  5JR3 A;  2K9L A;  2EA2 A;  3E0J B;  2HNH A;  2OF7 A;  5JLX A;  3SHF A;  1U6G A;  1VI0 A;  3CMA I;  3PNY A;  3LSJ A;  1FEX A;  1B59 A;  3FXU A;  4PJM A;  2H1L A;  3AG2 H;  2DQL A;  1D0Z A;  3SZT A;  2ID3 A;  2KIU A;  2BEO A;  4BBS J;  3BG7 A;  3BZK A;  5K7F A;  2XIG A;  2P81 A;  1ETV A;  1PUF A;  2W4S A;  3HRU A;  5EJC A;  3KET A;  1XSD A;  1D1C A;  4BY1 J;  4HST A;  2MLK A;  2GXG A;  2EV6 A;  2YR2 A;  4QPQ A;  3OYJ A;  2IA2 A;  1X4O A;  1OR7 C;  2HTJ A;  2HOE A;  1J2X A;  5E1W A;  1J7K A;  4LK1 F;  4ZC3 A;  5F0H A;  2DMP A;  4RGS A;  4BNC A;  1QPM A;  4HNU A;  3CC2 I;  1MJA A;  2QBY A;  2V9K A;  2OA4 A;  5J1R A;  4D0P A;  3W6V A;  4A5N A;  2JK3 A;  2O61 A;  4I7H A;  3LSR A;  1HC8 A;  2MA3 A;  2F5V A;  1SAU A;  2BZT A;  2O9L A;  1FYL A;  3ZQI A;  2EQR A;  3LSM A;  2WV1 A;  4KT5 C;  2IGM A;  4ZTJ A;  2LY1 A;  1HLV A;  2YPR A;  4M3B A;  2M4K A;  5GPA A;  3JSO A;  3A2K A;  4JP0 A;  1HKS A;  1VF9 A;  4A3B J;  2DDA A;  1H9T A;  5AIP A;  1SD7 A;  1BA5 A;  2XGD A;  5DD4 A;  5J8F A;  2DA3 A;  3CLQ A;  4JX4 A;  1AKH A;  3WE3 A;  1V5G A;  3BRO A;  1K83 J;  3PO3 J;  1YO5 C;  1FBQ A;  4YII A;  3ZP5 A;  1J75 A;  1BIA A;  1KA8 A;  2QZ8 A;  2IGK A;  4AVZ A;  3K7A J;  4FAS D;  1MMG A;  4N9I A;  3DQV C;  4E7Z A;  1JHF A;  1JJ8 C;  2DFH A;  3MZH A;  4HLY A;  1WJ5 A;  4UB6 C;  1E3P A;  2KIF A;  2PJR A;  3Q9S A;  4XLP F;  4C3J J;  2GOX B;  1YW8 A;  3S1R J;  3BPX A;  1EA3 A;  1MZB A;  1IXR C;  4XM3 A;  1OCP A;  1J59 A;  2RVC A;  3KP3 A;  1U5T B;  4FHT A;  4OMZ A;  4WXD A;  2NVX J;  2LOO A;  3D1N I;  2GA1 A;  3F21 A;  2M9H A;  2Q8K A;  1MBF A;  3DU6 A;  2UV1 A;  2BXY A;  2X1C A;  4KJZ A;  1W36 C;  2DA7 A;  3RCO A;  4ESF A;  4UUT A;  5K5Q A;  1KQ0 A;  3JAM K;  1I6H J;  2HEO A;  3ZPL A;  5KAF C;  1ZAO A;  1WI3 A;  3RKQ A;  2ZJ2 A;  5CVV A;  4CSW A;  2RN7 A;  3TED A;  1ORK A;  2CV1 A;  2DXI A;  2NNY A;  2R5Y B;  5LGT A;  2GXA A;  2HDW A;  2E71 A;  5F04 A;  3RYP A;  4JK1 X;  1JGS A;  4D7M A;  1I1S A;  3FXK A;  3IP4 B;  1AOY A;  2EPF A;  2LRD A;  1LQ1 A;  1TWH J;  1LUJ B;  2EFN A;  1FYK A;  1SAN A;  1TQP A;  2AXT C;  2IA1 A;  4CHU A;  1W1W E;  3Q3S A;  3A0H C;  2VBW A;  4HQM A;  1A5J A;  1IRG A;  4LIU A;  4RGR A;  1K78 A;  3D5S C;  5FFZ A;  4BQN A;  2M30 A;  3OYH A;  2B7E A;  1Z91 A;  3SJM A;  5DTD A;  4EEF G;  5FKM A;  4PJ0 C;  2TCT A;  1FP2 A;  3SDB A;  3T8T A;  5KK1 A;  2DK5 A;  1HST A;  3TP0 A;  4KIS A;  2OCC H;  1YFH A;  2PN6 A;  5CKT A;  2ZXI A;  5IP9 J;  2NRA C;  2VE9 A;  3PL8 A;  1ITY A;  2PMU A;  5EEA A;  1BW6 A;  1OJL A;  1FIP A;  3L1P A;  5H2F C;  2G0E A;  3IUO A;  4D1Q A;  4M71 A;  2ZKZ A;  2P5L C;  1D1B A;  5K7Z A;  1R4N B;  1Z7U A;  1D0X A;  1KU9 A;  4MTE A;  4D5F A;  2O7O A;  1YS7 A;  3S3N A;  2AQE A;  2MW8 A;  3LNQ A;  1ETQ A;  4CZZ A;  2DOE A;  4HDV A;  3S17 J;  1ZQ3 P;  4B43 A;  4G6T B;  2A6H F;  3CCV I;  3K4J A;  3K0L A;  3C1D A;  4E7H A;  1ZR2 A;  4MHG A;  2K40 A;  3KP5 A;  2VPL A;  2LBF B;  3MAJ A;  4EJU A;  2W7N A;  2QVO A;  1KON A;  2QUF A;  3JR9 A;  3PIO F;  4YG2 F;  2MAB A;  1LKX A;  3JRF A;  3E5Q A;  3I5U A;  3PJR A;  1D8K A;  2MLG A;  2A6T A;  3LSG A;  2G7U A;  1W7P B;  5L3B A;  4V19 K;  1APL C;  1XB4 A;  2FMY A;  4DNC A;  5E3M A;  5IT9 K;  3H36 A;  3OSG A;  2GQQ A;  4GFB A;  3RJP A;  5FLM J;  4MTD A;  2DFF A;  5EZG A;  3M4O J;  4D7N A;  5JI6 A;  1OCO H;  1QQI A;  1X2N A;  3FDY A;  2HXO A;  2K9S A;  2DYS H;  2VXD A;  4RGU A;  3Q9V A;  5GP9 A;  1SFX A;  2HYJ A;  1RET A;  3P7N A;  1N25 A;  2QSF X;  3P9C A;  4J19 A;  1IJW C;  5GAD J;  3HSE A;  1YW7 A;  3ZOB A;  4AD9 A;  3DBH B;  2HXI A;  2CG4 A;  2FBI A;  4P9U A;  1REP C;  3HXL A;  4UVC A;  4R1H A;  3HUG B;  2QEN A;  2L9S A;  2KPM A;  2XF5 A;  4KIT B;  4P55 A;  2XGE A;  2E5N A;  3GTK J;  2PG4 A;  2BE5 F;  2K9Q A;  1T8I A;  5CPR B;  1K79 A;  2CV2 A;  4CH7 A;  1O3R A;  3K4C A;  1A36 A;  2NOG A;  4JOM A;  2R5Z B;  2CQX A;  2KRF A;  2WC2 A;  1QO0 D;  1AWC A;  3FKJ A;  3SXY A;  1R23 A;  3T0Y A;  3F8F A;  2KL4 A;  2L0K A;  2ZFU A;  1QGP A;  4RGX A;  2ZXW H;  1OCZ H;  4B3A A;  2XSJ C;  1JKP C;  3JTH A;  3HOV J;  1FJL A;  3E6M A;  4HA8 A;  2VKD A;  3M9A A;  2BXZ A;  5KAI C;  1Y0U A;  2FSW A;  3B73 A;  3QOP A;  1FSH A;  3PSF A;  5BQT A;  1FTT A;  3FXL A;  2BHY A;  3OYB A;  2EFW A;  2M0M A;  4ENJ A;  2VPR A;  2P4W A;  3HBL A;  1DQU A;  1ETO A;  1F36 A;  1FPQ A;  2JQ7 A;  3KP6 A;  1R1T A;  5KNL A;  3G71 I;  4A0Y A;  2I5U A;  3IH4 A;  3SFI A;  1T39 A;  3HRT A;  2KIM A;  1SD5 A;  3DTK A;  3RDI A;  4LB5 A;  2AO9 A;  1ZGA A;  1PUF B;  1WJA A;  3QYE A;  4G7O F;  4Y17 A;  3S2W A;  1XN7 A;  3JRC A;  2ACJ A;  2VON A;  3KE2 A;  3ZQG A;  4S04 A;  1SVO A;  1Z05 A;  1MBE A;  1LFB A;  4EM2 A;  4E7J A;  4I01 A;  3CDL A;  3KFW X;  2R93 J;  4HF0 A;  4UV9 A;  3BTL A;  3CJQ B;  1MSF C;  5ICG A;  3CJT B;  4L9J A;  1PP7 U;  1WJF A;  4BQA A;  4OMY A;  2QBY B;  1Y39 A;  1WJB A;  1B9M A;  1YI2 I;  5BPI A;  2LFB A;  3KZY A;  1ZLJ A;  2HTS A;  3FMQ A;  3KZI C;  4FE7 A;  3OYE A;  3IRR A;  1XS9 A;  3BTC A;  4YEL A;  4A0Z A;  1UJ8 A;  2XC7 A;  1RUO A;  1ZTR A;  3KEY A;  3G1M A;  3ECH A;  1YIO A;  2RDP A;  4IOC F;  1IXS B;  3CUQ A;  1QHG A;  1UCR A;  3GXO A;  5L3E A;  3VYU B;  4IKF A;  1GVD A;  2HPM A;  5FKL A;  5HLT A;  1HCR A;  2UUZ A;  2LP0 A;  1Z67 A;  3SYT A;  3P9K A;  2JA5 J;  4IHY A;  3B02 A;  3EUH A;  3OS1 A;  3WE2 A;  4BE2 A;  3IH3 A;  3H35 A;  1DP3 A;  2L01 A;  2ELK A;  2DI3 A;  4Z6Y A;  3MEX A;  2CQK A;  1S7E A;  3VDX A;  2JA2 A;  2ZB9 A;  1FMV A;  2WB1 N;  2CV0 A;  3V8L A;  1WRJ A;  4DOZ A;  2YU9 J;  4RB0 A;  4A5M A;  4A3G J;  3ZMZ A;  2R4G A;  3WTZ A;  2YX7 A;  3DPT A;  2C6Y A;  2VC0 A;  1U5T A;  5BPD A;  2XAG A;  1G2H A;  1OCC H;  2Y31 A;  3K1M A;  4F91 B;  2Y9Z A;  1XMX A;  4JX5 A;  2GIZ A;  2PI0 A;  2P5K A;  3E97 A;  4N4O B;  4ASN A;  2W84 A;  2XGC A;  4RAZ A;  1JE8 A;  5DEQ A;  4M9Z A;  1RNL A;  4L0Y B;  1JTX A;  3GTM J;  3H1C A;  3EET A;  3CLO A;  2CUE A;  1NH3 A;  1S5L C;  2R5Y A;  2UXX A;  1YHQ I;  2XAH A;  1U8R A;  4BJT A;  1VFC A;  3JRH A;  1M1E B;  2LKX A;  5IYC J;  3D0S A;  4PSX A;  3PFI A;  2P5V A;  2VQH A;  2YSR A;  3KP7 A;  4IF4 A;  2BVM A;  4OIP F;  3H0D A;  3BCB A;  1EF4 A;  3A1Y A;  1GXQ A;  3CJN A;  1ZHF A;  2K9N A;  2V1N A;  1Y6I A;  3FXJ A;  5K1Y A;  2JA6 J;  2ZXH A;  1IG7 A;  2O5R A;  2OPT A;  2XRN A;  2QKL B;  1K78 B;  2X4H A;  3OOP A;  1FSE A;  2X9D A;  4IRG A;  3OL4 A;  4G6Q A;  1ZK8 A;  2DTR A;  2M7A A;  4XMY A;  4HPQ A;  5TGT A;  3BT9 A;  1UST A;  3CCR I;  1V3F A;  3OL3 A;  1G59 A;  5J47 A;  2EV0 A;  3OYG A;  2V7F A;  3L2U A;  2RKH A;  3M1E A;  3K6G A;  1LVK A;  4HSR A;  5DM7 F;  1FT9 A;  5ILS A;  3FMS A;  3OIO A;  5FFX A;  4DW6 A;  2H09 A;  2CFO A;  3TDZ C;  4PUS A;  5FRM A;  4LG0 A;  2JRT A;  1I5Z A;  2L9V A;  1KYZ A;  1GLN A;  2HWV A;  4CCJ A;  1NK2 P;  3W2V A;  4I2O A;  4HEA 2;  4PSW A;  5EGO B;  4AIK A;  3BZC A;  3I64 A;  2CU7 A;  2COB A;  1TNT A;  3DPU A;  3T1B A;  1G3W A;  2JRM A;  1FP1 D;  3KLN A;  3F8B A;  2BGC A;  1G4D A;  1VQK I;  3ELK A;  9ANT A;  4Q47 A;  4EJT A;  3P9I A;  3E5U A;  2X6X A;  2OZU A;  4IJA A;  3L2W A;  2F4I A;  4E7L A;  2LBF A;  2VBY A;  1BR4 A;  2EZI A;  4ZDO A;  3U1D A;  1QNT A;  1ZGW A;  5FJ8 J;  1U9O A;  1RZ4 A;  4I76 A;  3LMM A;  5E20 A;  4C9Y A;  1QBJ A;  1WH7 A;  2DYR H;  5GAE J;  3WGI A;  4GDF A;  4Q5S F;  2ZSH B;  1U9N A;  3QPT A;  2DT6 A;  3K4B A;  1V5F A;  1XGM A;  3AAF A;  2NVY J;  3DEW A;  4BHC A;  4R8H A;  2DA1 A;  5IYB J;  2BVL A;  4XL9 A;  2V9V A;  1O3Q A;  3ABK H;  3I4M J;  1CGP A;  2DN0 A;  3U21 A;  4AVP A;  1VQO I;  1N75 A;  4KIG A;  4AUX A;  5B66 C;  3PO2 J;  4RB2 C;  1F5T A;  1TQI A;  3BC8 A;  3BG9 A;  3V4G A;  1WZ2 A;  4WXC A;  4BEH A;  1NK3 P;  3DBR B;  2EIN H;  1TWC J;  4OAZ A;  1Z6T A;  2R7O A;  4Y4R A;  2F4M B;  4RS8 A;  2VI6 A;  1MMN A;  2ZJQ F;  4RM2 A;  3TO7 A;  2XAJ A;  3GCM A;  3LSH A;  1JKQ C;  1KU7 A;  1XC5 A;  1R5I D;  1BOA A;  3BG3 A;  5JLW A;  3H9G A;  3DLA A;  1BI1 A;  1FIA A;  3S93 A;  2LY9 A;  1SD4 A;  5L3D A;  2UZK A;  2EBI A;  2DT7 B;  2M45 A;  4FT8 A;  3L2R A;  2Y48 A;  2DPD A;  2Z3Y A;  3DPL C;  1O3T A;  4U0V A;  1YOV B;  2EIK H;  2CMP A;  5FKO A;  4IHV A;  3P5J A;  3HGY A;  5HS9 A;  4QSH A;  3DCF A;  2X1D A;  1Z6R A;  3GTP J;  1MMD A;  4NNJ A;  1FTZ A;  5K5O A;  3IHU A;  2KIQ A;  1K4T A;  1TBX A;  4E70 A;  1ZH5 A;  4FX0 A;  3OOU A;  1S3J A;  3NRV A;  2XSD C;  1K6O A;  1JUM A;  4I09 A;  2EZH A;  2K02 A;  5M5Y J;  2M5W A;  2QQ9 A;  1STZ A;  5BOX A;  4JYK A;  2P7V B;  3C3W A;  4A3J J;  2VQL A;  3J81 K;  3W2A A;  3ML6 A;  5F64 A;  5HLI A;  5J6X A;  2Y75 A;  1I3A A;  2FXA A;  2OUM A;  4YFN F;  3PQJ A;  3ESW B;  1QPI A;  5JHF A;  3HIF A;  5AIQ A;  4UNO A;  1KU3 A;  1MND A;  3HEF A;  2R7V A;  4ENM A;  3ZMU A;  5E18 F;  3CCU I;  1ZEL A;  4BE0 A;  3K2A A;  2FA5 A;  4LIV A;  1X3W B;  4KMF A;  1L3L A;  2DA5 A;  2GIV A;  3ONQ A;  2HOS A;  1K7A A;  1LDD A;  2K9M A;  1JUP A;  2EZL A;  3RKY A;  2JSP A;  1MW7 A;  4PJJ A;  4EV0 A;  4Q4Z F;  4KN4 X;  2O3F A;  4M72 A;  4YEJ A;  3I59 B;  2P6T A;  3CP8 A;  4A3D J;  1EV7 A;  2JVH A;  2ZC2 A;  3F9K A;  4IQ4 A;  3CUQ B;  2HOT A;  1SMY F;  4F52 A;  1TW3 A;  4BH9 A;  4I0B A;  4ZYG A;  3RI4 A;  3WTV C;  1TQM A;  2QQ8 A;  4EJO A;  2CW7 A;  3O8H A;  3QRF F;  2OAZ A;  2YX4 A;  3FX3 A;  3S32 A;  3R6S A;  1ODD A;  2XUB A;  2BY2 A;  1W0T A;  1EH7 A;  1FOX A;  1LPQ A;  4HDU A;  4PFP A;  2IT0 A;  2F5E A;  1FOW A;  2AQF A;  2HZD A;  3HB9 A;  1ONV A;  2E34 A;  3DFG A;  2HQR A;  3FF5 A;  3ZQH A;  1XD7 A;  2GA2 A;  5D5X B;  4HX4 A;  1PUE E;  1HOM A;  3JCU C;  2VUM J;  1GVJ A;  2R7D A;  4G12 A;  1ZRC A;  2M1B A;  3F8M A;  5JFR A;  1JTY A;  2V6C A;  2K3F A;  2VL8 A;  4XKV A;  3NEU A;  4U87 A;  2CW8 A;  4AWX B;  3E6C C;  1DUX C;  4UY8 I;  2MGQ A;  3GVA A;  2K7L A;  3H5A A;  3CD6 I;  2XPW A;  3HOU J;  2D1H A;  3FXQ A;  4EGY A;  4RB1 A;  1X4P A;  2HOA A;  1HDP A;  2OV7 A;  5B5E C;  3GEZ A;  1QU3 A;  2JMW A;  4L18 B;  1C0W A;  4N0B A;  3BJA A;  1VQ8 I;  5LBQ A;  1IO2 A;  3OR1 C;  1DU6 A;  3IWF A;  1QZY A;  2XV4 S;  2JUC A;  2Y69 H;  4F55 A;  3IL2 A;  3V7S A;  1Z9C A;  3I0T A;  1LFU P;  2AHQ A;  2VE8 A;  2F2E A;  1BBY A;  4BKX A;  1TWF J;  3IRQ A;  3H3Z A;  2HVQ A;  4KFC A;  3HJE A;  2LR8 A;  4XLF A;  1ETW A;  3KX2 A;  2DOF A;  3W2W A;  4B48 A;  3R0A A;  3FXR A;  1B72 A;  4AU7 A;  4NHJ A;  1EKE A;  4KA4 A;  3JRA A;  5DDG A;  1P2F A;  2XF6 A;  2A6E F;  4XKB A;  3LA7 A;  5M3F J;  2E35 A;  4CCO A;  4H0E A;  1G8X A;  1K6Y A;  2WWY A;  3WTT C;  2KHM A;  3BQZ A;  4HQE A;  2JN6 A;  1MBH A;  2OD5 A;  1LB2 A;  2F48 A;  4DYC A;  2IVM A;  5D8L B;  3EYI A;  2QKM B;  3BTI A;  4XLC A;  3J81 Z;  3RZD J;  1XPX A;  2PJP A;  1IRZ A;  2VKE A;  3IWZ A;  3DLL F;  1ZG5 A;  1WGX A;  5FLV A;  5TRD A;  1Y8R B;  3AKZ A;  1A04 A;  2CUF A;  4HNV A;  4LG0 B;  5E3L A;  4M3G A;  3BG5 A;  2OZ6 A;  2RQQ A;  3K10 A;  3O6B B;  1R1U A;  5E79 C;  4DQ2 A;  4PJL A;  3GX4 X;  1OFC X;  3F8N A;  4MLO A;  1VQ5 I;  3BR5 A;  2LTP A;  5HLG A;  3ZCO A;  3M3Y J;  5EGO A;  1JKO C;  2MYS A;  4GRI A;  3WHB A;  1XDU A;  2PMH A;  3RYR A;  5EG0 A;  2FOW A;  2ID6 A;  3ZN0 A;  1R4M B;  3M8E A;  4WXH A;  2E1C A;  3I4N J;  2QQB A;  3WTW C;  1QVT A;  5JHU A;  3E6B A;  3H5N A;  3ZQL A;  3OYM A;  2Y0M A;  3HSF A;  1IDZ A;  5HDG A;  1SFK A;  1MH4 A;  2Z1D A;  3F3X A;  3G2B A;  2DOD A;  2TRT A;  3A01 A;  2ECB A;  4IXA A;  2UWM A;  5J4Y A;  1U2W A;  2XDV A;  4XK4 A;  3JRG A;  4G7H F;  2E1O A;  2XAF A;  3H3U A;  2KFD A;  2L02 A;  2FNP A;  4CUG A;  4Y7N J;  2OTL I;  2HDC A;  4RLF A;  3RTR A;  2ELJ A;  3DU5 A;  5EDN A;  1CF7 B;  1NHA A;  4XRS A;  3MN2 A;  5C4X J;  2FBH A;  3OMY A;  4E7I A;  3F8C A;  1P7J A;  2CYY A;  1MNE A;  1NTC A;  3DBL B;  3RKX A;  4CO8 A;  3WGH A;  3COA C;  3LQQ A;  1O4X A;  2O8K A;  4F7Z A;  1MJB A;  3I3L A;  4BEH B;  1E0E A;  2ME0 A;  3UR3 C;  2DMU A;  2LNB A;  3JRI A;  3K9T A;  2EFO A;  3CES A;  4BBR J;  3I4P A;  2OU2 A;  1T56 A;  3X2Q H;  5HNF A;  2HDD A;  1MKM A;  2CGP A;  1O57 A;  3L00 A;  2QGU A;  3WG9 A;  1SFE A;  2EB7 A;  2MC3 A;  4M73 A;  4B3X A;  3ZMV A;  3OV8 A;  4HW0 A;  4PJN A;  1XG1 A;  1A6Q A;  1YX5 A;  3DKX A;  4BDY A;  3PNT A;  5D4S A;  1DP7 P;  3HOW J;  4E7S A;  2B0L A;  3MMY B;  3R0J A;  3KP2 A;  4BJ5 C;  3L7W A;  1WPK A;  1TZL A;  4N4N B;  4RB3 C;  1IN6 A;  3MZY A;  3GLL A;  1IRF A;  2J5P A;  4HV6 A;  1X1P A;  4HG2 A;  4IRI A; 
#chains in the Genus database with same CATH homology
 1X58 A;  1S7E A;  1LE8 A;  2ZB9 A;  2WB1 N;  4CYC A;  1QRY A;  1ETX A;  3GTJ J;  3F0C A;  5EYR A;  4RDU A;  2YU9 J;  4A3F J;  4A3G J;  2KT0 A;  2E2J J;  3WHC A;  2DJN A;  1G2H A;  1D5Y A;  4MFD A;  2Y31 A;  2YS9 A;  2DMN A;  2Y9Z A;  4JX5 A;  3QQA A;  1JT6 A;  3GTG J;  2M8G X;  2XGC A;  4A69 C;  1A6I A;  4C3H J;  1ENH A;  1H89 C;  1OCT C;  1Q1V A;  3H3V K;  2E2I J;  1YRN B;  1JTX A;  3FK7 A;  1GUU A;  3GTM J;  5FKN A;  3FKI J;  1BL0 A;  4FE4 A;  2DA4 A;  2CUE A;  1ZKG A;  5IOZ A;  1B8I A;  1IGN A;  2R5Y A;  4C2M J;  1UG2 A;  4XRS G;  1BW5 A;  1RKT A;  1BJZ A;  2Y2Z A;  1VFC A;  3JRH A;  2LKX A;  1UHS A;  5IYC J;  4L5E A;  1DU0 A;  1AHD P;  3G1L A;  2B63 J;  2EH3 A;  2NS7 A;  3NAU A;  4A3I J;  4NDL A;  3HM5 A;  4MO7 A;  3ZQF A;  2FD5 A;  2LLK A;  5IOY A;  1EF4 A;  4XIC A;  3FIS A;  3PM1 A;  2K9N A;  3CCY A;  1GDT A;  2JA6 J;  4A93 J;  5GPC A;  5C44 J;  1SFO J;  1IG7 A;  3E7L A;  2OPT A;  1RPW A;  2X9D A;  5EF6 A;  5E3O A;  4A3L J;  1ZK8 A;  5IP7 J;  2GM4 A;  2N8G A;  3BT9 A;  5C4J J;  3OSF A;  2Y30 A;  2FX0 A;  3BR2 A;  5F0F A;  3BR0 A;  2CRG A;  2IEK A;  5IPA A;  3S2D J;  3OIO A;  5HOD A;  3MKL A;  4DW6 A;  3S14 J;  2L9R A;  4XRM A;  3HKZ N;  1GV5 A;  1NK2 P;  3NAR A;  2R5Z A;  1AU7 A;  3S1N J;  1JKR C;  2HQ5 A;  2XB0 X;  5EGO B;  2CU7 A;  4QTR A;  2KDZ A;  2COB A;  4X1E A;  5M3M J;  2W48 A;  9ANT A;  3A02 A;  5DS9 A;  5E3N A;  2DA2 A;  2JA7 J;  1K61 A;  2MSY A;  3BQY A;  2EZI A;  1ZGW A;  5FJ8 J;  1U9O A;  4I76 A;  5JLX A;  3S15 J;  2OF7 A;  1WH7 A;  1VI0 A;  3LSJ A;  1HF0 A;  5FKK A;  1FEX A;  3Q0W A;  2RAE A;  1ETY A;  1U9N A;  1B72 B;  1TC3 C;  4B4C A;  2H8R A;  2ID3 A;  4BBS J;  5K7F A;  2NVY J;  3DEW A;  2P81 A;  1ETV A;  1PUF A;  1JT0 A;  1H8A C;  2DA1 A;  3BR6 A;  5IYB J;  4BY1 J;  4QIW N;  2CJJ A;  3I4M J;  2DN0 A;  4AUX A;  3PO2 J;  2EZK A;  2X48 A;  2FQ4 A;  2GLO A;  1Y1V J;  3BG9 A;  5F0H A;  1NK3 P;  2DMP A;  5EZH A;  1P7I A;  1TWC J;  4S0H B;  2VI6 A;  5J1R A;  2I10 A;  1JKQ C;  3W6V A;  2JK3 A;  1XC5 A;  3BG3 A;  5JLW A;  4UUS A;  3LSR A;  1FIA A;  3FIW A;  2O9L A;  2LY9 A;  3ZQI A;  2EQR A;  2LD5 A;  2WV1 A;  1TWA J;  1HLV A;  4M3B A;  1IDY A;  2EBI A;  5GPA A;  4JP0 A;  1VF9 A;  1Y1W J;  4IEJ A;  5EG0 B;  4A3B J;  1BA5 A;  2XGD A;  5FKO A;  4IHV A;  1Z77 A;  3HGY A;  2DA3 A;  4QSH A;  4JX4 A;  1AKH A;  1K83 J;  3DCF A;  4LOC A;  5M5W J;  3PO3 J;  3GTP J;  3Q0U A;  2XPU A;  1FTZ A;  1I3Q J;  3VPR A;  3A01 B;  3H0G J;  3K7A J;  3BR1 A;  1U8B A;  1JJ8 C;  1ZR4 A;  3OOU A;  2XSD C;  1JUM A;  2EZH A;  5M5Y J;  4CYC B;  3HOX J;  2MG4 A;  4JYK A;  3GTO J;  4C3J J;  4A3J J;  4A3C J;  3S1R J;  2QF7 A;  1OCP A;  2NVX J;  1HDD C;  3D1N I;  1GT0 C;  2M9H A;  2YUS A;  4MIM A;  1MBF A;  4IHW A;  2JWT A;  1QPI A;  2LVS A;  3HEF A;  1MBK A;  2DA7 A;  2L7M P;  4UUT A;  4AYB N;  1POG A;  1YRN A;  2ECC A;  3K2A A;  1I6H J;  3BR3 A;  2NS8 A;  2IAI A;  2DA5 A;  1TWG J;  3CMY A;  2HOS A;  1WI3 A;  3RKQ A;  3TED A;  4DZP A;  1ORK A;  2XB5 A;  4FCY A;  1JUP A;  2EZL A;  1B8I B;  3S2H J;  2R5Y B;  5F04 A;  4D7M A;  4A3D J;  1WCM J;  4W1U A;  1MBJ A;  2HOT A;  1TWH J;  4JX6 A;  4A3E J;  1SAN A;  3Q3S A;  2E2H J;  3UKG A;  3O8H A;  1A5J A;  3CQZ J;  1JGG A;  3HOZ J;  3TP3 A;  3Q0V A;  1W0T A;  4C3I J;  1JJ6 C;  3ZQC A;  3HB9 A;  3SJM A;  1IUF A;  2GBY A;  5DTD A;  2M34 A;  4EEF G;  3ZQH A;  1LE8 B;  5FKM A;  1MNM C;  2TCT A;  1HOM A;  1X2M A;  3RQI A;  1H88 C;  2VUM J;  1VND A;  4G12 A;  3B6A A;  4ABZ A;  1JTY A;  4BY7 J;  3TP0 A;  1GV2 A;  5IP9 J;  1ITY A;  4AC0 A;  5EEA A;  1BW6 A;  1WH5 A;  1OJL A;  1FIP A;  2L7F P;  5F27 A;  4DYR A;  3L1P A;  2G0E A;  2L7Z A;  2H1K A;  2ME6 A;  1JUS A;  2MGQ A;  5K7Z A;  2XPW A;  3HOU J;  4D5F A;  2HI3 A;  4W97 A;  2HOA A;  2O7O A;  1HDP A;  2E19 A;  4D5C A;  1T33 A;  2MW8 A;  2JMW A;  3LNQ A;  1ETQ A;  3S17 J;  1ZQ3 P;  1DU6 A;  4M3F A;  1CQT A;  1UMQ A;  1ZR2 A;  1LFU P;  2AHQ A;  2K40 A;  4V2F A;  1MH3 A;  3MVP A;  4BKX A;  1TWF J;  3JR9 A;  2DA6 A;  3JRF A;  1RR7 A;  2LR8 A;  1ETW A;  3HOY J;  1RES A;  3B6C A;  1QVU A;  3LSG A;  1APL C;  5E3M A;  1B72 A;  3OSG A;  3IH2 A;  4GFB A;  2VKV A;  3JRA A;  5FLM J;  1R9T J;  1E3O C;  2R92 J;  5EZG A;  2NVT J;  5M3F J;  3M4O J;  4D7N A;  1X2N A;  1RKW A;  2HXO A;  2K9S A;  3LOC A;  2R7Z J;  2XRL A;  5GP9 A;  2HYJ A;  4M3D A;  1MBG A;  1RET A;  2Y0S N;  3BQZ A;  5IP6 A;  2JN6 A;  1IJW C;  4J19 A;  1MBH A;  2DMQ A;  5F0C A;  3ZOB A;  4DYC A;  3HDD A;  4DZJ A;  3GTQ J;  2HXI A;  3S1Q J;  3BTI A;  5M5X J;  3RZD J;  4MFE A;  4XID A;  5K7H A;  2NVQ J;  1IRZ A;  4X6A J;  2VKE A;  2IBD A;  3FK6 A;  1WGX A;  5J1U A;  5FLV A;  2Y9Y A;  1MSE C;  2CUF A;  1IV6 A;  2XGE A;  3GTK J;  4UUS B;  4HNV A;  3S16 J;  2K9Q A;  5E3L A;  4M3G A;  3BG5 A;  2LK2 A;  2DMT A;  2NOG A;  3S1M J;  1OFC X;  4MLO A;  1I50 J;  2R5Z B;  3BR5 A;  2LTP A;  2CQX A;  3M3Y J;  5EGO A;  3JRB A;  1JKO C;  3TW6 A;  4IHX A;  4B1R A;  2WAQ N;  4Y52 J;  3WHB A;  5EG0 A;  2ID6 A;  2L0K A;  3C2B A;  3TW7 A;  4B3A A;  3I4N J;  1JKP C;  1QVT A;  2M0C A;  3HOV J;  1FJL A;  3ZQL A;  1AKH B;  2DTZ A;  1IDZ A;  1MH4 A;  2M2E A;  2R0Q C;  3IV5 A;  1FTT A;  2TRT A;  3A01 A;  3O8G A;  2ECB A;  4I6Z A;  2VPR A;  4XK4 A;  3HBL A;  3JRG A;  2E1O A;  3HGG A;  1F36 A;  1ETO A;  3QPS A;  4A3K J;  4Y7N J;  3IH4 A;  2JA8 J;  3SFI A;  3JRE A;  5EDN A;  2AO9 A;  2PMZ N;  3MN2 A;  4XRS A;  1PUF B;  5C4X J;  2D5V A;  3LSP A;  1F43 A;  1P7J A;  1Z0X A;  3JRC A;  4FTH A;  1NTC A;  2JJ7 A;  5J1Y A;  3ZQG A;  5C3E J;  2O8K A;  1O4X A;  1MBE A;  2QCO A;  1LFB A;  4RBO A;  3CDL A;  3QPL A;  2R93 J;  2ME0 A;  3BTL A;  3JRD A;  1MSF C;  2DMU A;  3JRI A;  2XPV A;  4FIS A;  2LFB A;  5IYD J;  4FE7 A;  4BBR J;  1T56 A;  3BTC A;  1XS9 A;  2HDD A;  3G1O A;  5F08 A;  3BTJ A;  4M6V A;  3RZO J;  1ZTR A;  1IC8 A;  3G1M A;  2CQQ A;  1XG1 A;  4DYQ A;  5F1J A;  1U78 A;  1ETK A;  4BXX J;  5J3L A;  3HOW J;  1GVD A;  3SDG A;  2X6O A;  5FKL A;  5BNG A;  3GTL J;  1HCR A;  2LP0 A;  3A03 A;  1WPK A;  2JA5 J;  4IHY A;  4A3M J;  1W0U A;  2FJ1 A;  4V2G A;  3IH3 A;  4M3E A;  2ELK A;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...