3I4NJ

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3i4nJ00
5F08A 1H88C 3CCYA 1Q1VA 2R92J 4M6VA 2EZHA 4DYCA 1TWFJ 2ECCA 3HKZN 5IYDJ 3Q3SA 3S15J 4A3IJ 3TEDA 5E3MA 3RKQA 1VI0A 1FIAA 3CDLA 1HLVA 5FJ8J 3LSRA 3HEFA 3S14J 2R5YA 2K9SA 1AKHB 3M4OJ 1IG7A 4C3IJ 1HDPA 2JN6A 3S1NJ 5F27A 1ETVA 1B72B 1WCMJ 3DCFA 1TC3C 3L1PA 2H1KA 3RZOJ 1BA5A 4FCYA 3GBGA 5E3NA 4Y7NJ 5DTDA 3A01B 1MNMC 1JKOC 4BY7J 2M34A 4MFDA 4A3GJ 2DN0A 2EZLA 3CMYA 2LD5A 3ZQLA 1YRNB 2L0KA 1ETKA 2TCTA 3BG5A 1P7JA 2DMNA 4AC0A 3JRCA 2HXIA 5FKOA 2B63J 1OJLA 1Y1VJ 1ETWA 2ELKA 4DYQA 1GUUA 1FEXA 3HDDA 4MO7A 2XB5A 3OOUA 5C3EJ 4M3GA 4XRSG 4W1UA 4D7NA 2JMWA 3I4NJ 2E2IJ 1S7EA 2L7ZA 4XICA 4M3BA 2JWTA 3HOVJ 1UG2A 3B6AA 1RKTA 4BBRJ 1JUPA 1HOMA 1RETA 4MIMA 1B72A 5DS9A 4DZJA 2EZIA 4QTRA 2HXOA 1OFCX 3VPRA 4GFBA 1VNDA 1IUFA 3S2HJ 2EBIA 5IOYA 1B8IB 3HOXJ 1Z0XA 2QF7A 3NARA 3HOWJ 1X58A 1ZQ3P 3TW6A 1X2MA 4RDUA 2K9QA 4A3JJ 1UHSA 2X48A 1MBFA 2E19A 2YS9A 1JKPC 1XC5A 3GTQJ 1POGA 2Y31A 3BQZA 1LFBA 3JRFA 1U9OA 1BW5A 2JA7J 2O9LA 1SANA 4QSHA 4IHYA 1JT6A 2Y0SN 5FKNA 4JX4A 2YUSA 4C3JJ 3M3YJ 1FTTA 2LK2A 1LE8B 3IV5A 5EG0B 1FJLA 1ZTRA 3I4MJ 1MH4A 5J1RA 3S2DJ 3BTLA 4I6ZA 3BG9A 1QPIA 2XPWA 2LFBA 2LR8A 1K83J 2L9RA 1T33A 2DMTA 3NAUA 1ZR2A 4JX5A 2ME0A 1I6HJ 2O7OA 1QRYA 3ZQCA 3BR5A 2VI6A 1QVTA 2GLOA 2NOGA 2OF7A 5FKLA 1BJZA 1JJ6C 4S0HB 1JKRC 4IHXA 1IC8A 1TWAJ 3HGGA 1R9TJ 2FD5A 3ZQIA 4A3EJ 2CQXA 1PUFA 2WB1N 2D5VA 3PM1A 1WH7A 4XIDA 4UUSA 2E2HJ 1JGGA 2GM4A 4FTHA 1JKQC 4V2FA 2NVQJ 4C3HJ 3A02A 3TP0A 3WHBA 3JREA 5C4XJ 4DYRA 4BY1J 4M3EA 3BG3A 5FKMA 3FKIJ 4XRMA 5EGOB 1RKWA 2NVTJ 3BT9A 3LSJA 2R0QC 2QCOA 4NDLA 2CRGA 4MFEA 5IP9J 2X9DA 2DA7A 3SJMA 1LE8A 1NK3P 2VUMJ 5EG0A 2ZB9A 3Q0WA 3MKLA 2DMPA 3O8HA 3JRHA 5J1YA 3GTJJ 5JLWA 2R93J 4D5FA 2NVYJ 3K7AJ 3O8GA 1WPKA 3OSFA 1MSFC 4A3BJ 2DA6A 1MBHA 2MG4A 1HF0A 1WGXA 3HM5A 2FX0A 2G0EA 1ORKA 4A3CJ 3SFIA 1H89C 2Y9ZA 5M3MJ 2R5ZB 1ZGWA 2LLKA 1MH3A 3G1LA 1NK2P 2O8KA 1RESA 4JX6A 1JTXA 2ID3A 4AUXA 5E3LA 2W48A 4UUTA 3HBLA 1ZR4A 1U8BA 4Y52J 1UMQA 3BTIA 4B4CA 2JA5J 4G12A 1AKHA 2IBDA 4D7MA 2MW8A 2GBYA 3GTMJ 2VKEA 1WI3A 4J19A 1RR7A 5M5WJ 2KT0A 3Q0VA 2IEKA 3WHCA 1VFCA 3A01A 1HDDC 3E7LA 1XG1A 4A3MJ 1SFOJ 4IHVA 5K7FA 1ETXA 1ITYA 5GP9A 4CYCB 2KDZA 3HOYJ 1YRNA 1APLC 1DU0A 1ZKGA 4BKXA 4L5EA 5IP6A 4LOCA 2AO9A 2EH3A 3QPLA 2XSDC 5F0FA 2K9NA 3S1RJ 3IH4A 4B3AA 5M5YJ 1ENHA 2HDDA 5F0CA 2L7FP 1IDYA 1G2HA 4M3FA 2M9HA 4C2MJ 3UKGA 1JJ8C 1MBKA 1TWGJ 2DA2A 1GT0C 2OPTA 1NTCA 2WAQN 2EQRA 4IEJA 2DA3A 1IJWC 3F0CA 5FLMJ 1MBGA 1MSEC 3ZQFA 4DW6A 1DU6A 1K61A 3LSGA 2CUEA 5IYCJ 2DA4A 3OSGA 2NVXJ 1IGNA 3JRDA 3MN2A 3FK7A 1TWHJ 3K2AA 2X6OA 3IH3A 4I76A 1ETYA 5K7ZA 3PO3J 3OIOA 3BR3A 2XGEA 5GPCA 5IYBJ 3C2BA 2HYJA 2R5YB 3B6CA 1JTYA 2P81A 5EZHA 1B8IA 1QVUA 2Y30A 3S16J 4RBOA 3G1MA 2IAIA 1T56A 1Y1WJ 2HOAA 5F1JA 1I3QJ 2DJNA 2CJJA 4FE4A 1ETOA 2R7ZJ 3BR1A 4X6AJ 1U78A 5FKKA 3GTLJ 4A3LJ 2NS7A 5EDNA 1IRZA 2M8GX 5F0HA 1Z77A 2HOSA 2XPVA 1HCRA 2LVSA 1ETQA 1JUMA 3GTOJ 1MBEA 1MBJA 2TRTA 4D5CA 3DEWA 2Y2ZA 5FLVA 3QPSA 3ZQGA 2H8RA 3FIWA 1U9NA 1IV6A 1OCPA 3JRGA 1O4XA 3LNQA 4EEFG 2LKXA 3S1MJ 2XRLA 5EF6A 3H3VK 1FIPA 3JR9A 1ZK8A 5M3FJ 5J3LA 4QIWN 1JT0A 3LSPA 1VF9A 5C4JJ 2N8GA 2CUFA 3HGYA 3IH2A 2DTZA 2RAEA 3ZQHA 1CQTA 1X2NA 1I50J 1XS9A 3Q0UA 4B1RA 4IHWA 3HOUJ 3MVPA 1BL0A 5EGOA 3GTPJ 3PO2J 2M0CA 2JJ7A 3A03A 4BXXJ 3FISA 1GVDA 3RZDJ 2VPRA 2L7MP 1GDTA 2EZKA 2MSYA 3CQZJ 1OCTC 3HOZJ 4A3DJ 2M2EA 3S17J 3HB9A 2LTPA 5HODA 4FISA 4FE7A 2K40A 3GTGJ 1GV2A 1IDZA 2LP0A 1TWCJ 4AYBN 1LFUP 2YU9J 2XGDA 2Y9YA 1GV5A 2E1OA 4A3FJ 5EZGA 4MLOA 5F04A 2HI3A 4A69C 4V2GA 2E2JJ 2JA6J 3G1OA 3W6VA 3QQAA 2COBA 2JK3A 2I10A 2FJ1A 2ECBA 4XK4A 3JRAA 2R5ZA 5K7HA 4W97A 4A93J 2FQ4A 3BTCA 1RPWA 1D5YA 1H8AC 3LOCA 1E3OC 1BW6A 3TP3A 2DA1A 3TW7A 1W0UA 1P7IA 4X1EA 5BNGA 4XRSA 5IP7J 2PMZN 1W0TA 1F43A 5EYRA 1PUFB 3BR0A 1A6IA 1AU7A 1WH5A 3RQIA 3GTKJ 5IOZA 2VKVA 1FTZA 5C44J 2HQ5A 2ID6A 2AHQA 4UUSB 3JRBA 2JA8J 4A3KJ 3FK6A 4M3DA 3BTJA 4DZPA 1EF4A 2DMUA 5M5XJ 1A5JA 3D1NI 3JRIA 4BBSJ 2DMQA 2HOTA 4HNVA 3BR2A 2WV1A 5J1UA 3S1QJ 2MGQA 1F36A 2ME6A 4CYCA 5GPAA 4JP0A 9ANTA 2CU7A 2NS8A 3BQYA 3BR6A 4ABZA 1AHDP 2LY9A 4JYKA 5JLXA 3SDGA 5EEAA 2DA5A 2XPUA 1JUSA 2XB0X 5IPAA 3H0GJ 3ZOBA 2CQQA 2XGCA 5E3OA
chains in the Genus database with same CATH superfamily
2JSCA 2V9VA 1Y39A 1TTYA 2VBWA 4ZYGA 1Q1VA 4DYCA 1TZLA 3HKZN 2QBYA 2E5NA 2K3FA 4HX4A 1IN8A 4A3IJ 4I2OA 3TEDA 4KYWA 2Q2EB 3KEQA 1YIJI 4Z6YA 2VJ5A 1L3LA 3CDLA 2GA2A 2DPDA 4EV0A 4UV9A 4G7ZF 5FJ8J 3ISPA 1SMYF 1S6LA 1GXQA 3LSRA 3BCAA 1AKHB 3M4OJ 3CUQB 2ETHA 4C3IJ 3L2RA 1QGPA 2JN6A 4FASD 1IG7A 3S1NJ 2E7XA 1KQ8A 1SVMA 4XORA 3TDZC 3DCFA 2H1KA 4IRGA 3A0BC 2LNBA 2VN2A 5E3NA 2HTSA 5L3CA 2QEXI 2BW3A 4BY7J 1ZARA 5FRNA 4A3GJ 2P5LC 1DGWY 2GIZA 3OYAA 1ONVA 2CS3A 1QZEA 4UVBA 3VEPA 1EV7A 1R1VA 4LIUA 2TCTA 3OIPA 2PJRA 3KIOA 1SMTA 4BDYA 5E8IA 3A0HC 2DMNA 4AC0A 4QLCU 4HLXA 2HXIA 1KU2A 5B3SH 4E7ZA 1OJLA 4XM3A 3LWFA 1MJBA 3CJRB 4B43A 4P1WA 1ETWA 4DYQA 1MIJA 1IN5A 1IRGA 2ACJA 3HDDA 5C3EJ 3DKXA 1FP2A 2R7WA 2IGKA 4IZZA 3QAHA 3ELKA 1S7EA 3ZMUA 4BHPA 2JWTA 3K4NA 2XVCA 1UG2A 1FBUA 1RKTA 4N9HA 4C9YA 1LFPA 2G9WA 4CHUA 2HOEA 1O3QA 5FB2A 2CUJA 5DEQA 3E5UA 3WU0A 1O57A 3GFIA 3I56I 1SD4A 3FXUA 2K02A 1P6RA 4RB0A 1AWCA 3J81K 2A6TA 2HGCA 1CGPA 1UELB 3U2RA 4GFBA 1VNDA 4YEJA 3S2HJ 3ZMSA 3QYBA 3RIRA 3ABTA 3SEQA 3K70D 2X0LA 1B6AA 1PP7U 4ASNA 1ZHFA 1Z7UA 1WWXA 3I71A 4KNYA 4P5OA 4A3JJ 4IOAF 2RV8A 3F21A 5CVJA 2DK8A 2YS9A 1G3YA 1IO2A 4ZDLA 5GAEJ 3GTQJ 2LY2A 4M74A 3TO7A 4B44A 5E79C 4XKCA 3IRRA 2XV4S 4IHYA 5FKNA 3SEZA 4C3JJ 3G3ZA 4XLCA 2LK2A 1G3WA 2E35A 2IXSA 5EG0B 2P7CB 3EYIA 2PMZA 3E6DA 3ULQB 3ABMH 3R4KA 4RM2A 5J1RA 3S2DJ 4JOMA 3CMMA 3QU3A 4LG0B 1ZAOA 2LFBA 2UXNA 4M9ZA 4NHJA 1ZR2A 4N4OB 3HSFA 2HYFA 4JX5A 1XN7A 4CYDA 2V1NA 1I6HJ 1K4SA 3ZQCA 3OR2C 2VI6A 3HPHA 1JKRC 4S0HB 1NH3A 1TWAJ 3LQRA 4EJTA 3IAM2 2FD5A 4NC6A 4CCOA 1K6OA 4KICA 2E1MC 1BIAA 1ZH5A 3PM1A 2KJBA 1WH7A 2P5VA 4WF2A 2E2HJ 3O6BB 2LY1A 1JGGA 4V2FA 5D5WB 2DYRH 3A02A 3M7GA 2QQ8A 4A2UA 4DYRA 4BY1J 3K2ZA 5JI6A 1SFXA 3CO6C 4IRIA 3BG3A 1SAUA 3FKIJ 2EILH 2XAJA 3T1BA 2QCOA 2BZTA 2VQCA 4HYEA 2O8XA 2EJRA 3B02A 2F5VA 2X9DA 2H09A 2ZFUA 2DA7A 4PFPA 2JQ7A 1NK3P 2VUMJ 5LGTA 2WY8Q 3TOBA 1OR7A 3Q0WA 3MKLA 5TISC 3ZMZA 3IAS2 3O8HA 3JRHA 3TQNA 3HOTA 3J81Z 2OA4A 2K86A 3VYTB 1P2FA 2KRFA 3IP4B 5DD4A 1KU7A 3HKZA 3DKYA 3K4BA 3KEYA 2QWWA 1HF0A 1MW7A 1WGXA 2K4JA 1J59A 4GDFA 4KT6A 2VIXA 4BJ6C 1ZRCA 1ORKA 4A3CJ 2WAEA 4JQFA 1R58A 3WE2A 3VOEA 5CJ9A 2K3PA 2O03A 2FEZA 2Y9ZA 4Y13A 1Z3XA 3W6JB 4L0ZB 2KMUA 3G1LA 2UV1A 2ZXJA 2X51A 1NK2P 3RPUA 1HW5A 1SC7A 2OQRA 1JTXA 2ID3A 2QA4I 4BUPA 3OYMA 1ZELA 2L3DA 2MA3A 1RUNA 2QSHX 1D0ZA 4DQ2A 2VJIA 2DO7A 4F3QA 4B4CA 2EK5A 2RDPA 2XASA 3DBLB 2K7LA 5JHUA 2IBDA 3WGGA 2OZ6A 5DV5A 2NS0A 3CJTB 4JK1X 4GGGA 4IHSA 3QOEA 2VKEA 1P4AA 1WI3A 2CQNA 3F6VA 4UVAA 4JBAA 3PIPF 1RR7A 1EH7A 4J19A 1CF7A 2OU2A 5D5VB 3TO9A 3OYBA 2KIFA 3DV8A 3WHCA 3A01A 3HJEA 4HOBA 1SFOJ 1XG1A 5DM7F 4UUVA 4BXUA 2FRHA 5K7FA 1T0FA 1WJCA 3CZ6A 3C3WA 4CYCB 1BN5A 1YRNA 1APLC 1DU0A 5IP6A 2B7EA 3C7JA 4LOCA 5FRMA 2DT5A 1USTA 2QM3A 1N78A 3S1RJ 2HYGD 3K4KA 5HLHA 3IH4A 1R00A 2L7FP 2WV0A 4HA8A 3DKWA 5F0CA 3HG9A 4M3FA 3OYGA 1MZBA 1DQUA 1G2HA 4C2MJ 1J2XA 2F4OB 1V55H 1STZA 1NTCA 2DTRA 2WAQN 3GLLA 4BAYA 4IEJA 3MKWB 2DK5A 3JTGA 3COAC 2VE9A 3DTKA 2OBPA 2ZMEA 5HDKA 1R5ID 1MBGA 4HZFA 2EIJH 4DW6A 1QQIA 5ICCA 1VQ5I 4LMYA 2IJLA 2X6YA 3OSGA 4LJZF 2DAOA 2KP6A 1W5SA 3F23A 2B0LA 2OTLI 3FK7A 3KP4A 3C1DA 4Y33A 3MZYA 1J75A 4AVPA 2X6OA 2QGUA 4P9UA 1YFHA 2HPMA 1ETYA 1UHWA 4YRVA 4NQWB 5GPCA 4M6YA 3C2BA 2HYJA 2XAUA 3TO6A 3CTAA 4AIDA 1JTYA 1B8IA 2Y30A 4F92B 2KDOA 2V4JC 3S16J 3F72A 1VQ7I 2O3FA 4HG2A 5F1JA 3G4SI 1Q1HA 1FMWA 3EUHA 1PUEE 1D5VA 2BVLA 2HFHA 1OR7C 1H9GA 1U78A 4Z2YA 4A3LJ 2MH2A 4I0AA 4KITB 1YQAA 1YJWI 5F0HA 2HOSA 1EKEA 5AIQA 1X3ZB 2A05A 4NC8A 2ZJQF 1YS7A 2A61A 2W85A 3ZRGA 3G71I 4BEHA 4OU0A 1XSDA 3OYKA 1IF1A 4PK4A 1E3PA 2WWYA 1Z3YA 5FLVA 2H8RA 3AG3H 3HZJA 3VYUB 2AXTC 4CDGA 4Y15A 4DJAA 4Y17A 2VKDA 1R23A 1U9NA 4PDKA 3LNQA 2M5WA 1R4NB 2CO5A 3VYRB 4E7JA 3PFIA 4V19K 2XRLA 4HDVA 3M1EA 3ZCOA 3FBNB 3JR9A 2OUMA 4BDZA 5M3FJ 2COMA 1JT0A 1O7FA 4RAZA 4EGZA 1YOVB 4A5NA 2M7BA 4E7LA 5K5OA 1TT0A 3V8JA 2OTJI 5CVRA 2MH9A 5FGMA 2CFOA 1X2NA 2IS2A 3H5RA 1FYLA 1WJAA 4YELA 3GW2A 4XKWA 4A0YA 1U5TB 1VQLI 2ZJRF 3BZKA 3HOUJ 5CLSA 1ULYA 3A03A 2JPCA 2WY7Q 2R7RA 2GXAA 2VPRA 4BQOA 4ZJZA 3HOZJ 2M1BA 3K4MA 5E17F 2XF6A 2R7DA 1IUYA 4FE7A 2K40A 3E3VA 4A0XA 1XDUA 3VYSB 1GV2A 4AYBN 1X1BA 2E1OA 4QPOA 2MYSA 4HV6A 1IRFA 3OYEA 1LDJA 2KFDA 3AL0B 2JA6J 4OAYA 3ZQQA 5F64A 3QQAA 2X6XA 2QSFX 2JK3A 2I10A 3P9KA 4M9XA 2VXZA 4XK4A 2R7FA 2BBYA 3HL2A 4RS8A 5K7HA 1V5GA 1R7JA 4DOZA 5L3EA 2JUGA 3GYHX 3CCEI 1D5YA 3LOCA 1KZHA 1BW6A 2B9SA 1EH8A 4BE0A 3ZPLA 1XGOA 2JSPA 5K5RA 4XLPF 3HC7A 3HRSA 3GTKJ 3RQIA 3OWTA 2E71A 1BI3A 1QNTA 2ELHA 1L0OC 2AHQA 3JRBA 2XHKA 1FLIA 1O7LA 4M3DA 3U9GA 2IA2A 1EF4A 4M72A 2DMUA 1C0WA 1A5JA 3D1NI 2XIGA 5J47A 3OYLA 2Z1DA 3C2HA 2BY3A 1OLTA 3FXJA 2DOEA 4ON0A 4HNVA 2ESHA 3PNYA 2CQ7A 2KISA 2WV1A 5J1UA 3G6EI 1QU3A 3EUHC 2O61A 3GFJA 4MQ9F 5H6QA 2VBXA 4RAGA 3CMEI 3H3ZA 2Y0SA 4HV5A 2YX7A 2WAQA 4JP0A 3CCVI 2IA1A 2PFBA 2KJCA 4Y4RA 3TDUC 3BR6A 3P9CA 3WTVC 4RLQA 5JLXA 1LB2A 2RQPA 3OIQA 1XB4A 3BLYA 3RYPA 3PL8A 3PQKA 1A6QA 1DPRA 3H0GJ 3OL3A 3LSMA 1XD7A 4CH7A 3S2WA 4NUBA 3CCYA 1W1WE 2PJPA 3KX2A 2EZHA 2FOKA 1U3EM 4GRIA 1SEUA 2VQHA 4CCKA 2XAGA 1I5ZA 2Q8KA 1G4DA 4YFNF 4WWCA 4RLFA 5IYDJ 5KAIC 3S15J 1W36C 5E3MA 4WCGA 3MKYB 1T2KA 5CVVA 1SFUA 1BOAA 1VI0A 1FIAA 1D0XA 4EQQA 4HNUA 1GHCA 2BHYA 2XGXA 3M07A 3VB2A 4L18B 2QKMB 3HEFA 4E7HA 2BVMA 2NVUB 2R5YA 2K9SA 4KIFA 5E20A 2JVHA 4G6QA 5F27A 5HLIA 5J6XA 2VJ4A 1KA8A 1QZZA 3HUGB 4WXHA 1B72B 4I7HA 1TC3C 3LAJA 1XGNA 3PSIA 5DM6F 3VSLA 3Q9VA 4FCYA 4PJLA 5DYMA 2UZKA 1MNMC 2BHZA 3TGNA 3TMOA 1OCCH 3U1DA 5KAFC 1BBYA 2M34A 4EJVA 3QP5A 2A5WA 1WSUA 2F4IA 3F8CA 3S3OA 4M6XA 4MNUA 2LD5A 3ZQLA 4ITVA 3IWFA 1U6GA 3SXYA 2LBFB 1VZ0A 2VBZA 1X19A 5D4RA 3QYEA 4UVCA 1BI0A 1F9NA 3S93A 1A36A 3EUAA 3CP8A 1VQPI 2KRCA 1W7PA 3ZGKA 4EATA 1TW2A 1S72I 2EB7A 1Y1VJ 3CCUI 3W2AA 2OV7A 4DNCA 2Q2EA 3E0JB 3FM3A 3KP6A 4XLFA 2VOPA 1FEXA 4UB6C 1QO0D 4HRIA 4MO7A 2XB5A 3OOUA 3KP3A 1TT5B 4M3GA 4XRSG 3Q5FA 4W1UA 2JMWA 2JTVA 2VJJA 1YIOA 4RGUA 1TLHB 3V8KA 3I58A 4M3BA 2L4MA 2M87A 3R0JA 4R1HA 1YI2I 4H4KC 1I39A 1JUPA 1PDNC 1D0YA 2Z2SB 4MIMA 4YFKF 2V7FA 2PQ8A 3CJQB 5L3FA 2BY2A 2WBMA 1BR2A 3HTSB 2HXOA 2E34A 2K9MA 3KP2A 1TQIA 3H9GA 1SD7A 1I27A 3ROUA 1IUFA 2EBIA 3WTTC 5HVQC 2F2EA 4BQAA 4AYBA 3DBHB 2Z33A 1DPUA 1Z0XA 1WI9A 2ZXHA 4E7SA 1I1GA 5ILVA 3HOWJ 1X58A 2FE3A 3TW6A 2Z16A 3CD6I 1UHSA 2X48A 1LKXA 2E19A 2XSJC 1JKPC 3GUDA 1XC5A 3AG4H 3V4GA 1W4MA 2IRFG 1BIBA 1LFBA 2VXDA 1U9OA 2ZNYA 2JA7J 4O3MA 3J7AY 1FBQA 1JT6A 4EGYA 3RQ4A 1J09A 4EJOA 3GFLA 1Z67A 4AVZA 2CGPA 1FTTA 1LE8B 3HOSA 1FJLA 1UFMA 3WODF 2HEOA 3KZIC 3BDDA 2AS5F 2ADUA 2LR8A 1K83J 3NAUA 2DMTA 3WTWC 3F8BA 2WTEA 2ME0A 2ZNZA 3KP7A 3I59B 2VE8A 2QQAA 2EA4A 1IW7F 2LG4A 3BR5A 4EM1A 1RUOA 1RI7A 4MGRA 1QVTA 2GLOA 4LLNA 2NOGA 1MNEA 1WQ2A 3MAJA 2LRDA 5ICEA 2CQXA 2P0WA 1WJ5A 1SFEA 2WB1N 4ZTJA 2LF7A 1VTNC 4A0ZA 4PJNA 3NQOA 2HVRA 3BWGA 2VPLA 3X2QH 4XIDA 2GM4A 4EMSA 4RM3A 4XOTA 3S3MA 2LKSA 2FU4A 4M3EA 5ICGA 3G73A 4U0YA 5EGOB 3OYFA 3KEOA 4L9TA 3CF5F 3FWEA 3DEEA 2XUBA 4NDLA 2RGVA 4MFEA 3M8JA 3CF2A 3DP7A 3H9QA 3HXLA 1T95A 5EG0A 4IX7A 3DQVC 1XMXA 3GTJJ 5CVUA 1R36A 2R93J 4D5FA 3K7AJ 5KVRA 3CCQI 4A3BJ 1MSFC 2MG4A 3WE3A 3HM5A 3WTUC 2GXBA 3GXOA 4C2TA 1MMSA 1NG6A 4PCQA 5E18F 1ZRDA 1K6YA 5JHFA 2W24A 4FX0A 3DU6A 2VC0A 2YX4A 2R5ZB 2D45A 2OZUA 4BH9A 4RGRA 2Q0OA 3WG7H 5A2QK 2I8DA 2LREA 3A2KA 5E3LA 5HLTA 1RRJA 2FUG2 2P8TA 1PP8F 1D1BA 4HEA2 1ZR4A 1U8BA 1XCVA 2A07F 4B8XA 4ETSA 2FA5A 2KKOA 5CQEA 3H5NA 5E1XA 3I3LA 1K78B 1X1PA 2MLKA 3BTIA 2Y0MA 2DBBA 3HHHA 2PN6A 3BROA 5DD8A 2M7AA 1M1EB 3BP8A 3WGHA 2GBYA 2P6SA 1TNTA 3NWTA 3LQQA 1ZGAA 3Q0VA 1VFCA 1HDDC 1DP7P 4A3MJ 4IHVA 5BS6A 4GYGA 3UR3C 4I0BA 5FROA 2KDZA 4ZH4F 3H5AA 2EFQA 4L5EA 2AO9A 2OCEA 2RC4A 2EH3A 3QPLA 2GOMA 5EEHA 2XSDC 2K9NA 2Y69H 5E1WA 1Z05A 4U7BA 2HDDA 1PYVA 1MD0A 2W25A 3PJRA 3P5JA 1KONA 1USSA 1IRXA 2JRTA 1JJ8C 3GZNB 1S5LC 2DA2A 4S05A 4RGXA 2OPTA 1YJ9I 4M73A 2DA3A 4ZYHA 4LGWA 1U0JA 2NNYA 1Z7LA 3H35A 5H6RA 3QYFA 5D5XB 3ZQFA 1XCBA 3OYNA 1S7AA 2QBYB 1YW9A 5IYCJ 4C30A 2DA4A 3QOPA 3FHNA 2RREA 2NVXJ 2OC6A 1IGNA 3JRDA 1QPMA 3E1SA 2E1MB 1NHAA 3I0TA 3L2VA 3K2AA 3ZXSA 1KGSA 1ZN2A 1YE9A 5D8KB 2CV1A 2QSGX 4KMFA 2VL8A 2VB6A 2L01A 3OIOA 3PO3J 4HSTA 3VSKA 2ZC2A 3ASOH 1T98A 5IYBJ 4E70A 3EUKL 2H94A 3AG1H 3RJPA 5EZHA 3FMQA 1SVOA 5A2QZ 1TQMA 2R7SA 1YLFA 4RBOA 3G1MA 2MABA 4L0YB 2HOAA 2DJNA 5H20A 1V54H 2A69F 5ED4A 3I55I 1Z91A 3FXLA 1IAWA 5FKKA 1IRZA 2XPVA 2CWEA 2LVSA 1ETQA 2PJRB 1JUMA 3GTOJ 2IGMA 3ZMVA 1MBJA 2TRTA 2PMUA 4I99C 1K7AA 2EIMH 1R1UA 2KLOA 2WB1A 1MJ9A 3QPSA 2VLAA 2DT6A 1H9TA 4ANJA 2DOAA 5EEGA 4KDPA 1TNSA 3JRGA 1BI1A 2DODA 1N25A 4EEFG 2LKXA 3RPQA 3S1MJ 4UXNA 3OS2A 1QBJA 3CO7C 1LQ1A 4A5MA 1ZK8A 4F91B 5CQGA 2X1DA 2G7HA 2DT7B 3MMYB 2N8GA 2CUFA 2F5FA 2QYOA 3HGYA 1ON1A 1IZ1A 1FOYA 2RAEA 3S32A 1CQTA 4XL9A 4NBQA 4XSXF 5KK1A 1R22A 2W82A 1I50J 1HBXG 2PEXA 3JCUC 3QODA 3FXRA 4B1RA 4AD9A 1BL0A 3KZYA 1Z1DA 3GTPJ 3R60A 4S04A 2JJ7A 1FY7A 3KLOA 4BXXJ 2YR2A 3FMSA 1MMDA 2XAFA 2X6WA 2O0YA 1GVDA 4HLYA 1X4OA 2L7MP 4IO9F 5DCFA 4BXFA 2MSYA 1S8NA 3O3KA 3VWBA 4DBQA 4BQQA 5B66C 2M4KA 1UZCA 2R7QA 4CCNA 2WA0A 4ESJA 4HF1A 3JSOA 4IF4A 1IDZA 3DPUA 2EA2A 1TWCJ 2JUCA 2LP0A 1LFUP 2Z99A 2BEOA 2OJED 2QVOA 4G94A 4FHTA 2F6CA 4AIJA 1TL8A 2FBHA 5F04A 4A69C 4V2GA 2E2JJ 3W6VA 3L2UA 2IT0A 2COBA 1WHUA 2MC4A 2P4WA 1BM9A 3V42A 2CV0A 5TGTA 3JRAA 3LSKA 4W97A 3JSPA 4A93J 3M9AA 4FX4A 3D0SA 1RPWA 2DPUA 2X1CA 1KU9A 1MDMB 3CCLI 1W0UA 3TW7A 1P7IA 4PFOA 3HRTA 4XRSA 2IA0A 5IP7J 3DLLF 5LHHA 1KYZA 1F43A 4FQGA 2BGCA 4IVNA 5CYVA 1P4XA 3BR0A 1A6IA 1AU7A 1WH5A 3F8MA 3FXMA 1FTZA 4F7ZA 2ID6A 4CXFA 4A3KJ 3FK6A 3A4CA 3BY6A 4DZPA 4L5IA 4HQMA 2DCEA 5M5XJ 4CA0A 4WXCA 2VODA 2BY0A 2HPIA 1YTYA 1MMGA 2DMQA 2H6CA 3ABLH 3WU2C 3ZR8X 2V79A 4OIQF 3S1QJ 1Y8QB 2V9KA 5HNFA 4XLEA 1OKRA 2DU9A 5LLQA 5J40A 2J5OA 2ZBKA 5E1ZB 1OISA 2L54A 4ABZA 2L9VA 2XF5A 1O3SA 3IUOA 3SDGA 4IRHA 1MMAA 2XPUA 3BG6A 1JUSA 4XNFA 3OYIA 1T08B 2QLZA 3RPUD 4E6KG 5DUIA 2XGCA 2OF7A 2IGNA 2VKHA 4CICA 2TDXA 4PGGA 2JVGA 3D5RC 3FKJA 1VQOI 4M6VA 3EDPA 2AQEA 1BI2A 1FT9A 2JPBA 1J7KA 4HQEA 2K4BA 3BOQA 1FP1D 4UY8I 4A6EA 1NG7A 3Q3SA 3IHUA 1VQ6I 4PGHA 1E2XA 5F1RA 2LYCA 2Q1ZB 4G7HF 2DFFA 1HLVA 2M45A 3HRUA 4BJ5C 3S14J 3GMEA 3DBRB 2RKHA 3LSTA 3L2QA 1HDPA 1ETVA 4D0PA 2YU3A 1WCMJ 4ZYDA 3L1PA 3RZOJ 3H1CA 1BA5A 4IPAA 5DUKA 2P5KA 3GBGA 1UB9A 2BY1A 2DQRA 2QENA 4Y7NJ 3A01B 4U7DA 3ZN1A 2JA2A 2VQLA 4DIQA 4MFDA 1LVAA 3OV8A 2DN0A 1AOYA 1VQ4I 2EZLA 2F48A 3PNTA 1FMVA 2CUZA 2KRHA 2DI3A 1YRNB 4MEXF 4LITA 1BR1A 1SFKA 2F5CA 1LPQA 1ETKA 5LRRA 1XMAA 5GTHC 2A68F 4IOCF 3BG5A 2HZDA 1T0FC 1ACIA 5FKOA 2V1DA 2HQNA 3FM5A 1YS6A 2VT2A 1S29A 3T8RA 2ELKA 3PSFA 2BOLA 2D1VA 2ZCWA 1EA3A 4D7NA 2HR3A 2IPQX 1WFXA 3HPGA 1XGMA 2E2IJ 1R5GA 5HDGA 1FSEA 4BQNA 3B6AA 3E5QA 4BBRJ 3D5SC 1Y0UA 5CKTA 1B72A 3HUGA 2ZMEC 1E17A 5D8LB 2Z9OA 3FZVA 3W2VA 1G3SA 5GADJ 4CO8A 2KQRA 3D5LA 4XLHA 5IOYA 1EJ9A 1QZYA 4IL6C 1B8IB 2IVMA 2QF7A 4XN0A 3NARA 4MHGA 1XTAA 4P96A 3S3NA 3WTXC 5L3BA 2LBFA 1OPCA 2K9QA 1JHFA 4Q48A 2O6GE 1E3HA 5IY5H 2NXNB 5JFRA 4HDUA 4RGSA 2STWA 5CVIA 1BW5A 2O9LA 1EH6A 3NWSA 4QSHA 1ON2A 4JX4A 2YUSA 3SQNA 3M3YJ 5TJJA 4YIIA 1TP4A 1WRJA 1OCZH 2V26A 2XKOA 3W3CA 3CCMI 1ZTRA 3BC8A 4MEYF 1KQ9A 4BEHB 3BTLA 3TOAA 2JT1A 1QPIA 2XPWA 3F22A 2UWMA 1T33A 4U88A 3K10A 3RYRA 4E4HA 4N9IA 1W36D 1QRYA 4UNOA 1WKMA 2GAUA 5FKLA 3R0AA 1JJ6C 4YG2F 4IHXA 1PJRA 1IC8A 2OD5A 3K9TA 2P7VB 4GCVA 3VFZA 1R9TJ 1QHHD 1PUFA 3ML6A 5DDGA 2D5VA 5D6EA 2K5CA 3I9V2 3KYDB 5LGUA 4L9JA 4UUSA 3K1NA 3J7AO 2VONA 3T0YA 2CFXA 2NVQJ 4C3HJ 1SD5A 3MCZA 5KHDA 2QQBA 3C18A 2EFPA 3RKWA 5FKMA 5E8GA 1RKWA 3AG2H 3BT9A 3LSJA 3OR1C 5J4YA 2R0QC 2DQLA 3OYJA 2VBYA 3HRMA 3VODA 5KCMA 3L2WA 3LSIA 5IP9J 3KPHA 4PUSA 1IXSB 1MGTA 1B9NA 4L5JA 3SJMA 1LE8A 4II3A 5FLXK 2XRNA 3I4PA 4FETA 1UG0A 2DMPA 3DEUA 1HQCA 4HNTA 5JLWA 1AA7A 1LDDA 4IJAA 3LL7A 3NEUA 1Y0NA 2NVYJ 2IGOA 3O8GA 5B5EC 3OSFA 3N4MA 4XSZF 1MBHA 1B9MA 2A6EF 1FOWA 1ZGJA 2G0EA 2GIVA 1IXCA 2QUFA 3CLOA 3SFIA 3WGIA 1RZ4A 2R7XA 2RVCA 1D1AA 4G6TB 5M3MJ 3GVAA 5J8FA 4LLLA 2ISYA 1X4PA 2LLKA 1MH3A 1MNDA 2KIQA 2OQGA 1A31A 4KMUX 1F4KA 3K69A 4LG3A 2PX9A 1RESA 4JX6A 4LK0F 4AUXA 4BU2A 3H0DA 1K79A 2W48A 1RIOH 4BGDA 4QPQA 3HBLA 2M8EA 4ZZLA 3CCRI 1YITI 1FC3A 4Y52J 2FMLA 2V9PA 4QWQA 4N0BA 1TBXA 5HLGA 1AKHA 3CUQA 3MZ8A 5DCMB 3KETA 2MW8A 3EYYA 3GTMJ 1P92A 2CH0A 2EWNA 1Z6RA 2RQQA 3GCMA 2FXAA 4OOIA 4CCLA 2KT0A 2IEKA 2YSRA 5B1AH 2F5EA 3UNGC 3E7LA 1FYKA 1MJAA 2E1NA 5CPRB 1ETXA 3K1MA 5GP9A 4BHBA 1ITYA 1HA8A 1LDKB 2CMPA 1FPQA 2XAHA 2ZSIB 3HOYJ 4EVIA 3J80K 2LKPA 3LA7A 4M9SA 1H0MA 2FNAA 1QHGA 5F0FA 1TW3A 2FOWA 1W5TA 4B3AA 5M5YJ 2XDVA 3ASNH 2QQ9A 1ENHA 2HQAA 4PJJA 2EPFA 1B59A 2M9HA 4KN4X 2ZXIA 3FXKA 3M1CA 2UUZA 1MBKA 3T5XA 1TWGJ 1GT0C 3K6GA 5L3DA 5FLXZ 4HF2A 2EQRA 1IN6A 1VQMI 4ESFA 1IJWC 5FLMJ 4F93B 1MSEC 3ESWB 3LSGA 1YX3A 2GA1A 3PFYA 1U8RA 4CCJA 2GQQA 2K9LA 4KT5C 3H3UA 2MBFA 3K4CA 3MN2A 2D1HA 5AIPA 1FBSA 2FBKA 1A35A 2MLGA 4DGWB 5HOOA 4TV7A 1X3WB 1OYWA 2JRMA 5LBQA 3BR3A 4OWRB 2R5YB 2NOJB 3B6CA 3OY9A 2P81A 3AAFA 3RSNA 2CW8A 1O3TA 1T56A 1I3QJ 2CJJA 1B4AA 2DYSH 2HWVA 2VOOA 3ZMDA 2MC3A 4LLGF 2R7ZJ 3BR1A 3DPTA 4X6AJ 3HTUA 1HW2A 5LEJA 3OYHA 3H92A 2FF4A 5EDNA 3QPTA 4XBFA 4GO1A 1OCOH 3ZP5A 2R7UA 3ECOA 1W7PD 4HF0A 2D2WA 4WXDA 1O3RA 1K4TA 3N05A 4D5CA 2Y2ZA 2PBIA 2HDCA 4LG0A 3RTRA 1W7PB 4KA4A 2CSOA 2EFOA 4Y3OA 3FIWA 1OCPA 3JW4A 2LSOA 3BJOA 4EM2A 4EJUA 1RNLA 4II2A 3J80Z 3GX4X 2VQGA 5EF6A 3H3VK 3FXQA 4QIWN 5ILUA 1VF9A 5LFAA 4WX9A 5C4JJ 2FBIA 2X4HA 5TRDA 2DTZA 2VT3A 2DFHA 4CSWA 5JR3A 3ZQHA 4CCMA 4XKBA 1FOXA 1YW7A 2W57A 2M4GA 2YPRA 3V7CA 1WJFA 1XS9A 3Q0UA 4IHWA 3CUQC 1XSVA 3MVPA 5D6FA 3RCOA 2M0CA 2R4GA 3FISA 4Q4ZF 1UHMA 4ENJA 3F6OA 2LF8A 2L4AA 4MTEA 2EZKA 1TQPA 1I6XA 2L9NA 3CQZJ 4A3DJ 3GFMA 2ESNA 3SYTA 3U1KA 4R79A 3HB9A 3GTGJ 2ZFWA 2DOFA 4HAMA 4PZJA 3GLXA 4BNCA 2L5QA 2YU9J 5LEKA 2XGDA 4HBLA 1I3AA 2Y9YA 2E1CA 1GV5A 4Q5SF 1G3TA 2MFZA 4RB1A 1FYMA 5EZGA 1RC9A 2HI3A 3I5UA 2ZO4A 2DDBA 3V7SA 2AXLA 2ECBA 2HVQA 3MQ0A 1BOBA 3BTCA 1N77A 3FDYA 1H8AC 3LMMA 4G9YA 1FSHA 1E3OC 2CYYA 3MFKA 1KQ0A 4LFUA 2DA1A 3CCSI 4BS9A 5BNGA 4X1EA 4YIFA 1VQNI 1F1ZA 1J5YA 3MZHA 2E7WA 1W0TA 1XSXA 1WJEA 5EYRA 4LD5A 3I64A 5H2FC 2E5ZA 3RKYA 3OYCA 2VASA 3K0LA 5C44J 2HQ5A 4CZZA 2JA8J 4XQFA 2PI0A 4PSWA 3IC7A 2K27A 1LEBA 1U2WA 2HS5A 3CLQA 4A6DA 2VC1A 1ODDA 1X1CA 5HNHA 4BJTA 4AIKA 2IW5A 2IS4A 2EIKH 2MGQA 4ENMA 3KYCB 2Z3YA 2P6TA 3OS0A 3K70C 1F36A 1HSTA 4F55A 1E0EA 4CYCA 5BPDA 5KNLA 3SZTA 2MD5A 2CU7A 1ZG5A 5D5UB 3FMRA 1FZPB 1HKSA 1R6RA 1A04A 2BW3B 2V6EA 3J7ZI 4KJZA 3SZGA 4B09A 5EEAA 2J5PA 1MDMA 1B1BA 2XB0X 1S3JA 5IPAA 5HDNA 3ZOBA 3GF2A 3DFGA 3VDXA 3WTSC 1JHHA 2PLYA 5F08A 1XPXA 1H88C 2EFNA 4LB6B 2R92J 3RI4A 1Z9CA 3Q9SA 5HS9A 1TWFJ 2ECCA 2KZVA 4XOPA 2Z5UA 3GEZA 3HSEA 2RN7A 4G6DA 4OMYA 4XLNF 1IN4A 5ILSA 2RNJA 4L9VA 3RKQA 3CUOA 4GXOA 4RA2A 3F3XA 1UJ8A 1ZRFA 2CW7A 3QPHA 1FOKA 4NQWA 4XKVA 2XC7A 4NB5A 3GO5A 1ZG3A 2I5UA 2UXXA 4B47A 4BYYA 4ZZDA 3IRQA 2H27A 1JE8A 2XKPA 3FX3A 3CC4I 1JXSA 3E6BA 3SZPA 3S8PA 2W7NA 4HX7A 2L2OA 4LB5A 4F52A 5DTDA 1LEAA 4U87A 1JKOC 3GZ6A 3DF8A 4E7IA 4D9JA 3CMYA 1SAXA 4OINF 3V8LA 2L0KA 3WU1B 3KCCA 3DU5A 3FHZA 1P7JA 3CDHA 3JRCA 4KIBA 3I53A 3QRFF 2R7VA 1YYVA 5LD2C 4ZDOA 2B63J 3EPZA 1Z21A 2ZJPF 1GUUA 1R49A 1D3YA 4J00A 1Z6TA 3I4NJ 4ZYEA 1W5CC 2L7ZA 4XICA 3CJNA 3ZN0A 3GWZA 1YHQI 3HOVJ 1UCRA 2OCCH 2XAQA 2A6HF 1YG2A 2Y48A 3KP5A 1HOMA 1RETA 2STTA 5GAGJ 2KPMA 5DS9A 4DZJA 2EZIA 4BE1A 1LNWA 2LDUA 3LA3A 1YW8A 4QTRA 1T39A 1G8XA 4RB2C 3L2CA 5JVGF 3ABUA 2E60A 1OFCX 3TBIA 3VPRA 3W2WA 3CC2I 1U5TA 2L9SA 4UHTA 3T8TA 1HW1A 3HOXJ 3DXJF 5J4VA 1IV8A 4MTDA 1R5HA 1ZQ3P 2C6YA 1XGSA 3OL4A 4R8HA 1X2MA 4RDUA 2X1EA 4L9NA 1MBFA 2W4SA 1POGA 2Y31A 2A3SA 4ZDPA 5FFZA 3SHFA 3BQZA 4NC7A 3JRFA 1BR4A 1RR8C 1HKQA 2NAZA 2NRAC 4PJMA 1SANA 3BZCA 2Y0SN 5F6FA 2X85A 1ZG1A 3IV5A 4C2UA 3I4MJ 2CG4A 3ECHA 1FNNA 1HC8A 1MH4A 3EQLF 3NRVA 1WJBA 3E6MA 4I6ZA 2KHMA 3BG9A 1ZLKA 2M3AA 4D1QA 1DUXC 2L9RA 5JVTA 3AKZA 2HVSA 3I54A 5EJCA 2O7OA 3REOA 3ERMA 4LIVA 3BJAA 2GWRA 4PSXA 1DP3A 3B73A 1BJZA 2W00A 3E97A 5IT9K 3L7WA 2ZXWH 3HGGA 4XLAA 1HXDA 1XDSA 5FD6A 3ZQIA 4A3EJ 3LFKA 5J8CA 1IN7A 1PVEA 2BV6A 1J0RA 3BG7A 4P9FA 2PMHA 2MD0A 4FTHA 1S7OA 1JKQC 3TL4X 1T8IA 5HS8A 3TP0A 2FMYA 4YIRX 1WVRA 3EETA 3LFUA 3WHBA 3JREA 5C4XJ 2GXGA 3C2GA 3HIFA 2NYXA 5K1YA 4XRMA 3PQJA 2NVTJ 1OYIA 2E36A 1IXRC 4IXAA 2CRGA 3LA2A 3IKVA 3E6CC 2M30A 3QWLA 1DGRM 4CUGA 5GTIC 2ZB9A 2LMDA 1FX7A 4PJ0C 1XMKA 4RMNA 3K4JA 5J1YA 4BE2A 1CF7B 4BACA 1V3FA 3BJ6A 1WPKA 1Y8RB 5GAHJ 2BE5F 1D1CA 2LC2A 2DA6A 4LK1F 3R6SA 3QU6A 2FX0A 2H8WA 1GXPA 2BXZA 3JAMK 1YO5C 4OAZA 1H89C 2LH9A 1G59A 3OOPA 1ZGWA 2DXIA 2LOOA 2IS1A 3MWMA 3F9KA 2HQRA 3HHGA 5LGNA 2O8KA 4ENKA 1X3UA 1WZ2A 5ERIA 1X1AA 2A5YB 4UUTA 1DDNA 2BYVE 4HSRA 2KIUA 4P55A 1UMQA 2ZMEB 3DPLC 1QA6A 1P9QC 2JA5J 3KE2A 2DFEA 3TKYA 4G12A 2EV5A 1U5TC 2WADA 4D7MA 3WTZA 2ELJA 2K85A 2R7OA 4OIOF 3MD2A 5AONA 1OMIA 5IT9Z 4X0GA 5M5WJ 2GOXB 2O5RA 3LAPA 3HSRA 1T6SA 1OYYA 3BPXA 3IKTA 4I02A 4IQ4A 2EV0A 1VQ9I 3RDIA 1SD6A 3WG9A 1ZKGA 2JZYA 3R61A 4BKXA 3CCJI 1Y6IA 2H6BA 4OIRF 4EJWA 1XX5A 1IDYA 4B3XA 3AL0C 4NNJA 4MQVA 3PNVA 3UKGA 2FQ3A 2ZJ2A 4HX8A 4EM0B 1YX5A 1V4RA 2L7KA 3V7RA 3F0CA 3U21A 1DU6A 1K61A 4FT8A 2CUEA 3KYLA 3DTIA 4AWXB 5IT3A 2HDWA 1R71A 5L3GA 4HW0A 2G7UA 4XR6A 1LVKA 1WJDA 5DCMA 2IS6A 4RAFA 4GYIA 3JAMZ 1TWHJ 1MKMA 4CGZA 3IH3A 4I76A 4CZCA 5K7ZA 3CMAI 4K2EA 2CV2A 2XGEA 1R4MB 1V5FA 4O5VA 1D8KA 2FSWA 1LUJB 3L9FA 2W84A 4M71A 3RKXA 4IHTA 3ZMTA 1T38A 1QVUA 2IAIA 4B48A 2R7TA 3O2PE 3L00A 4RAYA 1Y1WJ 3JTHA 4FE4A 3FBIB 2F5DA 1P4WA 2GZWA 1ETOA 5BQTA 1YJNI 3OYDA 3CC7I 3M8EA 4BL0B 2V1UA 4AM3A 5B1BH 1I1SA 1MMNA 5D4SA 4OIPF 3GTLJ 2NS7A 3SFZA 2M8GX 1Z77A 4KFCA 1KU3A 1HCRA 3DTEA 5FFXA 5BOXA 3H36A 1GVJA 1MBEA 2CW0F 2XROA 1ERDA 2KL4A 2HKXA 4IQJA 2V1XA 3A1YA 4Q47A 3DEWA 3DWLE 1HSJA 3PUFA 3ZQGA 3OS1A 1VQ8I 2WC2A 5ICFA 1HKTA 1ZLJA 3F8NA 2EFWA 3FXOA 4XMYA 1BC7C 1FWZA 3I59A 1IV6A 1O4XA 1LJ9A 3BPVA 5FD5A 2V6CA 1FIPA 1V5EA 3OMYA 1X1DA 4O6JA 5J3LA 3F8FA 3LSPA 4KN7X 2DFIA 3QP6A 3IH2A 1ZREA 4U0VA 3K1PA 4ENNA 3M8FA 2W1OA 2EINH 1UAAA 3MKZA 3CESA 3ABKH 2ICWG 2DW4A 5EGOA 4UV8A 1F5TA 3PO2J 2HU9A 2KIMA 1J9IA 3FF5A 4ZTFA 4KISA 1VQKI 5LHGA 3J7YJ 2RNGA 3RZDJ 1D8JA 1GLNA 5LHIA 2DLLA 1GDTA 4I01A 1OCTC 2DJIA 2Y75A 2OAZA 2M2EA 3WTYC 3S17J 2ZSHB 4N4NB 2LTPA 5HODA 1Y56A 4FISA 4RB3C 2IP2A 3G2BA 4I09A 5HS7A 2NNNA 4U0WA 4OMZA 3ONQA 4AU7A 4A3FJ 2EV6A 2HTJA 3E5XA 1G6NA 3PUBA 4MLOA 4AIHA 3L09A 4XN3A 3G1OA 4G8XA 2CQKA 4UB8C 5FO5A 3IL2A 4H0EA 3LSHA 2H1LA 2FJ1A 5BPIA 2BXYA 2R5ZA 2KZGA 3BZ6A 1ZYRF 2M0MA 3P9IA 2FQ4A 2L02A 1S9HA 1SVLA 4KIGA 4ZYAA 3TP3A 4XRFA 2HKOA 3H9JA 4HPQA 4XONA 1OQYA 3ERED 2PMZN 3KZZA 1R1TA 2DDAA 3SDBA 1PUFB 4BHCA 3KFWX 4ESBA 2VKVA 1KYWA 3W6KB 5IOZA 1K78A 2HZTA 4UUSB 1BJAA 3BTJA 4YFXF 3HYIA 2F4MB 2HNHA 1JGSA 3ZQ7A 3PIOF 3JRIA 6PAXA 1REPC 2XF7A 2ISZA 4DBRA 4BBSJ 2QKLB 3KLNA 3P7NA 2HOTA 3K4LA 5LRSA 2AQFA 3BR2A 2WAFA 3N97A 5K5QA 3BCBA 3DLAA 2ME6A 2ZKZA 5BMZA 5GPAA 4A12A 4E7KA 9ANTA 2NS8A 1OCRH 3MEXA 3BQYA 4KUMA 4IKFA 3CDIA 2PG4A 4G7OF 3GZ5A 1AHDP 2LY9A 2QZ8A 4JYKA 4ZC3A 2FNPA 3AFHA 2DA5A 1N75A 1JI8A 4WK8F 3CP2A 4I98B 4J01A 3IWZA 2CQQA 2R3SA 1BC8C 5E3OA
chains in the Genus database with same CATH topology
5F08A 1H88C 3CCYA 1Q1VA 2R92J 4M6VA 2EZHA 4DYCA 1TWFJ 2ECCA 3HKZN 5IYDJ 3Q3SA 3S15J 4A3IJ 3TEDA 5E3MA 3RKQA 1VI0A 1FIAA 3CDLA 1HLVA 5FJ8J 3LSRA 3HEFA 3S14J 2R5YA 2K9SA 1AKHB 3M4OJ 1IG7A 4C3IJ 1HDPA 2JN6A 3S1NJ 5F27A 1ETVA 1B72B 1WCMJ 3DCFA 1TC3C 3L1PA 2H1KA 3RZOJ 1BA5A 4FCYA 3GBGA 5E3NA 4Y7NJ 5DTDA 3A01B 1MNMC 1JKOC 4BY7J 2M34A 4MFDA 4A3GJ 2DN0A 2EZLA 3CMYA 2LD5A 3ZQLA 1YRNB 2L0KA 1ETKA 2TCTA 3BG5A 1P7JA 2DMNA 4AC0A 3JRCA 2HXIA 5FKOA 2B63J 1OJLA 1Y1VJ 1ETWA 2ELKA 4DYQA 1GUUA 1FEXA 3HDDA 4MO7A 2XB5A 3OOUA 5C3EJ 4M3GA 4XRSG 4W1UA 4D7NA 2JMWA 3I4NJ 2E2IJ 1S7EA 2L7ZA 4XICA 4M3BA 2JWTA 3HOVJ 1UG2A 3B6AA 1RKTA 4BBRJ 1JUPA 1HOMA 1RETA 4MIMA 1B72A 5DS9A 4DZJA 2EZIA 4QTRA 2HXOA 1OFCX 3VPRA 4GFBA 1VNDA 1IUFA 3S2HJ 2EBIA 5IOYA 1B8IB 3HOXJ 1Z0XA 2QF7A 3NARA 3HOWJ 1X58A 1ZQ3P 3TW6A 1X2MA 4RDUA 2K9QA 4A3JJ 1UHSA 2X48A 1MBFA 2E19A 2YS9A 1JKPC 1XC5A 3GTQJ 1POGA 2Y31A 3BQZA 1LFBA 3JRFA 1U9OA 1BW5A 2JA7J 2O9LA 1SANA 4QSHA 4IHYA 1JT6A 2Y0SN 5FKNA 4JX4A 2YUSA 4C3JJ 3M3YJ 1FTTA 2LK2A 1LE8B 3IV5A 5EG0B 1FJLA 1ZTRA 3I4MJ 1MH4A 5J1RA 3S2DJ 3BTLA 4I6ZA 3BG9A 1QPIA 2XPWA 2LFBA 2LR8A 1K83J 2L9RA 1T33A 2DMTA 3NAUA 1ZR2A 4JX5A 2ME0A 1I6HJ 2O7OA 1QRYA 3ZQCA 3BR5A 2VI6A 1QVTA 2GLOA 2NOGA 2OF7A 5FKLA 1BJZA 1JJ6C 4S0HB 1JKRC 4IHXA 1IC8A 1TWAJ 3HGGA 1R9TJ 2FD5A 3ZQIA 4A3EJ 2CQXA 1PUFA 2WB1N 2D5VA 3PM1A 1WH7A 4XIDA 4UUSA 2E2HJ 1JGGA 2GM4A 4FTHA 1JKQC 4V2FA 2NVQJ 4C3HJ 3A02A 3TP0A 3WHBA 3JREA 5C4XJ 4DYRA 4BY1J 4M3EA 3BG3A 5FKMA 3FKIJ 4XRMA 5EGOB 1RKWA 2NVTJ 3BT9A 3LSJA 2R0QC 2QCOA 4NDLA 2CRGA 4MFEA 5IP9J 2X9DA 2DA7A 3SJMA 1LE8A 1NK3P 2VUMJ 5EG0A 2ZB9A 3Q0WA 3MKLA 2DMPA 3O8HA 3JRHA 5J1YA 3GTJJ 5JLWA 2R93J 4D5FA 2NVYJ 3K7AJ 3O8GA 1WPKA 3OSFA 1MSFC 4A3BJ 2DA6A 1MBHA 2MG4A 1HF0A 1WGXA 3HM5A 2FX0A 2G0EA 1ORKA 4A3CJ 3SFIA 1H89C 2Y9ZA 5M3MJ 2R5ZB 1ZGWA 2LLKA 1MH3A 3G1LA 1NK2P 2O8KA 1RESA 4JX6A 1JTXA 2ID3A 4AUXA 5E3LA 2W48A 4UUTA 3HBLA 1ZR4A 1U8BA 4Y52J 1UMQA 3BTIA 4B4CA 2JA5J 4G12A 1AKHA 2IBDA 4D7MA 2MW8A 2GBYA 3GTMJ 2VKEA 1WI3A 4J19A 1RR7A 5M5WJ 2KT0A 3Q0VA 2IEKA 3WHCA 1VFCA 3A01A 1HDDC 3E7LA 1XG1A 4A3MJ 1SFOJ 4IHVA 5K7FA 1ETXA 1ITYA 5GP9A 4CYCB 2KDZA 3HOYJ 1YRNA 1APLC 1DU0A 1ZKGA 4BKXA 4L5EA 5IP6A 4LOCA 2AO9A 2EH3A 3QPLA 2XSDC 5F0FA 2K9NA 3S1RJ 3IH4A 4B3AA 5M5YJ 1ENHA 2HDDA 5F0CA 2L7FP 1IDYA 1G2HA 4M3FA 2M9HA 4C2MJ 3UKGA 1JJ8C 1MBKA 1TWGJ 2DA2A 1GT0C 2OPTA 1NTCA 2WAQN 2EQRA 4IEJA 2DA3A 1IJWC 3F0CA 5FLMJ 1MBGA 1MSEC 3ZQFA 4DW6A 1DU6A 1K61A 3LSGA 2CUEA 5IYCJ 2DA4A 3OSGA 2NVXJ 1IGNA 3JRDA 3MN2A 3FK7A 1TWHJ 3K2AA 2X6OA 3IH3A 4I76A 1ETYA 5K7ZA 3PO3J 3OIOA 3BR3A 2XGEA 5GPCA 5IYBJ 3C2BA 2HYJA 2R5YB 3B6CA 1JTYA 2P81A 5EZHA 1B8IA 1QVUA 2Y30A 3S16J 4RBOA 3G1MA 2IAIA 1T56A 1Y1WJ 2HOAA 5F1JA 1I3QJ 2DJNA 2CJJA 4FE4A 1ETOA 2R7ZJ 3BR1A 4X6AJ 1U78A 5FKKA 3GTLJ 4A3LJ 2NS7A 5EDNA 1IRZA 2M8GX 5F0HA 1Z77A 2HOSA 2XPVA 1HCRA 2LVSA 1ETQA 1JUMA 3GTOJ 1MBEA 1MBJA 2TRTA 4D5CA 3DEWA 2Y2ZA 5FLVA 3QPSA 3ZQGA 2H8RA 3FIWA 1U9NA 1IV6A 1OCPA 3JRGA 1O4XA 3LNQA 4EEFG 2LKXA 3S1MJ 2XRLA 5EF6A 3H3VK 1FIPA 3JR9A 1ZK8A 5M3FJ 5J3LA 4QIWN 1JT0A 3LSPA 1VF9A 5C4JJ 2N8GA 2CUFA 3HGYA 3IH2A 2DTZA 2RAEA 3ZQHA 1CQTA 1X2NA 1I50J 1XS9A 3Q0UA 4B1RA 4IHWA 3HOUJ 3MVPA 1BL0A 5EGOA 3GTPJ 3PO2J 2M0CA 2JJ7A 3A03A 4BXXJ 3FISA 1GVDA 3RZDJ 2VPRA 2L7MP 1GDTA 2EZKA 2MSYA 3CQZJ 1OCTC 3HOZJ 4A3DJ 2M2EA 3S17J 3HB9A 2LTPA 5HODA 4FISA 4FE7A 2K40A 3GTGJ 1GV2A 1IDZA 2LP0A 1TWCJ 4AYBN 1LFUP 2YU9J 2XGDA 2Y9YA 1GV5A 2E1OA 4A3FJ 5EZGA 4MLOA 5F04A 2HI3A 4A69C 4V2GA 2E2JJ 2JA6J 3G1OA 3W6VA 3QQAA 2COBA 2JK3A 2I10A 2FJ1A 2ECBA 4XK4A 3JRAA 2R5ZA 5K7HA 4W97A 4A93J 2FQ4A 3BTCA 1RPWA 1D5YA 1H8AC 3LOCA 1E3OC 1BW6A 3TP3A 2DA1A 3TW7A 1W0UA 1P7IA 4X1EA 5BNGA 4XRSA 5IP7J 2PMZN 1W0TA 1F43A 5EYRA 1PUFB 3BR0A 1A6IA 1AU7A 1WH5A 3RQIA 3GTKJ 5IOZA 2VKVA 1FTZA 5C44J 2HQ5A 2ID6A 2AHQA 4UUSB 3JRBA 2JA8J 4A3KJ 3FK6A 4M3DA 3BTJA 4DZPA 1EF4A 2DMUA 5M5XJ 1A5JA 3D1NI 3JRIA 4BBSJ 2DMQA 2HOTA 4HNVA 3BR2A 2WV1A 5J1UA 3S1QJ 2MGQA 1F36A 2ME6A 4CYCA 5GPAA 4JP0A 9ANTA 2CU7A 2NS8A 3BQYA 3BR6A 4ABZA 1AHDP 2LY9A 4JYKA 5JLXA 3SDGA 5EEAA 2DA5A 2XPUA 1JUSA 2XB0X 5IPAA 3H0GJ 3ZOBA 2CQQA 2XGCA 5E3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F08 A;  1H88 C;  3CCY A;  1Q1V A;  2R92 J;  4M6V A;  2EZH A;  4DYC A;  1TWF J;  2ECC A;  3HKZ N;  5IYD J;  3Q3S A;  3S15 J;  4A3I J;  3TED A;  5E3M A;  3RKQ A;  1VI0 A;  1FIA A;  3CDL A;  1HLV A;  5FJ8 J;  3LSR A;  3HEF A;  3S14 J;  2R5Y A;  2K9S A;  1AKH B;  3M4O J;  1IG7 A;  4C3I J;  1HDP A;  2JN6 A;  3S1N J;  5F27 A;  1ETV A;  1B72 B;  1WCM J;  3DCF A;  1TC3 C;  3L1P A;  2H1K A;  3RZO J;  1BA5 A;  4FCY A;  3GBG A;  5E3N A;  4Y7N J;  5DTD A;  3A01 B;  1MNM C;  1JKO C;  4BY7 J;  2M34 A;  4MFD A;  4A3G J;  2DN0 A;  2EZL A;  3CMY A;  2LD5 A;  3ZQL A;  1YRN B;  2L0K A;  1ETK A;  2TCT A;  3BG5 A;  1P7J A;  2DMN A;  4AC0 A;  3JRC A;  2HXI A;  5FKO A;  2B63 J;  1OJL A;  1Y1V J;  1ETW A;  2ELK A;  4DYQ A;  1GUU A;  1FEX A;  3HDD A;  4MO7 A;  2XB5 A;  3OOU A;  5C3E J;  4M3G A;  4XRS G;  4W1U A;  4D7N A;  2JMW A;  3I4N J;  2E2I J;  1S7E A;  2L7Z A;  4XIC A;  4M3B A;  2JWT A;  3HOV J;  1UG2 A;  3B6A A;  1RKT A;  4BBR J;  1JUP A;  1HOM A;  1RET A;  4MIM A;  1B72 A;  5DS9 A;  4DZJ A;  2EZI A;  4QTR A;  2HXO A;  1OFC X;  3VPR A;  4GFB A;  1VND A;  1IUF A;  3S2H J;  2EBI A;  5IOY A;  1B8I B;  3HOX J;  1Z0X A;  2QF7 A;  3NAR A;  3HOW J;  1X58 A;  1ZQ3 P;  3TW6 A;  1X2M A;  4RDU A;  2K9Q A;  4A3J J;  1UHS A;  2X48 A;  1MBF A;  2E19 A;  2YS9 A;  1JKP C;  1XC5 A;  3GTQ J;  1POG A;  2Y31 A;  3BQZ A;  1LFB A;  3JRF A;  1U9O A;  1BW5 A;  2JA7 J;  2O9L A;  1SAN A;  4QSH A;  4IHY A;  1JT6 A;  2Y0S N;  5FKN A;  4JX4 A;  2YUS A;  4C3J J;  3M3Y J;  1FTT A;  2LK2 A;  1LE8 B;  3IV5 A;  5EG0 B;  1FJL A;  1ZTR A;  3I4M J;  1MH4 A;  5J1R A;  3S2D J;  3BTL A;  4I6Z A;  3BG9 A;  1QPI A;  2XPW A;  2LFB A;  2LR8 A;  1K83 J;  2L9R A;  1T33 A;  2DMT A;  3NAU A;  1ZR2 A;  4JX5 A;  2ME0 A;  1I6H J;  2O7O A;  1QRY A;  3ZQC A;  3BR5 A;  2VI6 A;  1QVT A;  2GLO A;  2NOG A;  2OF7 A;  5FKL A;  1BJZ A;  1JJ6 C;  4S0H B;  1JKR C;  4IHX A;  1IC8 A;  1TWA J;  3HGG A;  1R9T J;  2FD5 A;  3ZQI A;  4A3E J;  2CQX A;  1PUF A;  2WB1 N;  2D5V A;  3PM1 A;  1WH7 A;  4XID A;  4UUS A;  2E2H J;  1JGG A;  2GM4 A;  4FTH A;  1JKQ C;  4V2F A;  2NVQ J;  4C3H J;  3A02 A;  3TP0 A;  3WHB A;  3JRE A;  5C4X J;  4DYR A;  4BY1 J;  4M3E A;  3BG3 A;  5FKM A;  3FKI J;  4XRM A;  5EGO B;  1RKW A;  2NVT J;  3BT9 A;  3LSJ A;  2R0Q C;  2QCO A;  4NDL A;  2CRG A;  4MFE A;  5IP9 J;  2X9D A;  2DA7 A;  3SJM A;  1LE8 A;  1NK3 P;  2VUM J;  5EG0 A;  2ZB9 A;  3Q0W A;  3MKL A;  2DMP A;  3O8H A;  3JRH A;  5J1Y A;  3GTJ J;  5JLW A;  2R93 J;  4D5F A;  2NVY J;  3K7A J;  3O8G A;  1WPK A;  3OSF A;  1MSF C;  4A3B J;  2DA6 A;  1MBH A;  2MG4 A;  1HF0 A;  1WGX A;  3HM5 A;  2FX0 A;  2G0E A;  1ORK A;  4A3C J;  3SFI A;  1H89 C;  2Y9Z A;  5M3M J;  2R5Z B;  1ZGW A;  2LLK A;  1MH3 A;  3G1L A;  1NK2 P;  2O8K A;  1RES A;  4JX6 A;  1JTX A;  2ID3 A;  4AUX A;  5E3L A;  2W48 A;  4UUT A;  3HBL A;  1ZR4 A;  1U8B A;  4Y52 J;  1UMQ A;  3BTI A;  4B4C A;  2JA5 J;  4G12 A;  1AKH A;  2IBD A;  4D7M A;  2MW8 A;  2GBY A;  3GTM J;  2VKE A;  1WI3 A;  4J19 A;  1RR7 A;  5M5W J;  2KT0 A;  3Q0V A;  2IEK A;  3WHC A;  1VFC A;  3A01 A;  1HDD C;  3E7L A;  1XG1 A;  4A3M J;  1SFO J;  4IHV A;  5K7F A;  1ETX A;  1ITY A;  5GP9 A;  4CYC B;  2KDZ A;  3HOY J;  1YRN A;  1APL C;  1DU0 A;  1ZKG A;  4BKX A;  4L5E A;  5IP6 A;  4LOC A;  2AO9 A;  2EH3 A;  3QPL A;  2XSD C;  5F0F A;  2K9N A;  3S1R J;  3IH4 A;  4B3A A;  5M5Y J;  1ENH A;  2HDD A;  5F0C A;  2L7F P;  1IDY A;  1G2H A;  4M3F A;  2M9H A;  4C2M J;  3UKG A;  1JJ8 C;  1MBK A;  1TWG J;  2DA2 A;  1GT0 C;  2OPT A;  1NTC A;  2WAQ N;  2EQR A;  4IEJ A;  2DA3 A;  1IJW C;  3F0C A;  5FLM J;  1MBG A;  1MSE C;  3ZQF A;  4DW6 A;  1DU6 A;  1K61 A;  3LSG A;  2CUE A;  5IYC J;  2DA4 A;  3OSG A;  2NVX J;  1IGN A;  3JRD A;  3MN2 A;  3FK7 A;  1TWH J;  3K2A A;  2X6O A;  3IH3 A;  4I76 A;  1ETY A;  5K7Z A;  3PO3 J;  3OIO A;  3BR3 A;  2XGE A;  5GPC A;  5IYB J;  3C2B A;  2HYJ A;  2R5Y B;  3B6C A;  1JTY A;  2P81 A;  5EZH A;  1B8I A;  1QVU A;  2Y30 A;  3S16 J;  4RBO A;  3G1M A;  2IAI A;  1T56 A;  1Y1W J;  2HOA A;  5F1J A;  1I3Q J;  2DJN A;  2CJJ A;  4FE4 A;  1ETO A;  2R7Z J;  3BR1 A;  4X6A J;  1U78 A;  5FKK A;  3GTL J;  4A3L J;  2NS7 A;  5EDN A;  1IRZ A;  2M8G X;  5F0H A;  1Z77 A;  2HOS A;  2XPV A;  1HCR A;  2LVS A;  1ETQ A;  1JUM A;  3GTO J;  1MBE A;  1MBJ A;  2TRT A;  4D5C A;  3DEW A;  2Y2Z A;  5FLV A;  3QPS A;  3ZQG A;  2H8R A;  3FIW A;  1U9N A;  1IV6 A;  1OCP A;  3JRG A;  1O4X A;  3LNQ A;  4EEF G;  2LKX A;  3S1M J;  2XRL A;  5EF6 A;  3H3V K;  1FIP A;  3JR9 A;  1ZK8 A;  5M3F J;  5J3L A;  4QIW N;  1JT0 A;  3LSP A;  1VF9 A;  5C4J J;  2N8G A;  2CUF A;  3HGY A;  3IH2 A;  2DTZ A;  2RAE A;  3ZQH A;  1CQT A;  1X2N A;  1I50 J;  1XS9 A;  3Q0U A;  4B1R A;  4IHW A;  3HOU J;  3MVP A;  1BL0 A;  5EGO A;  3GTP J;  3PO2 J;  2M0C A;  2JJ7 A;  3A03 A;  4BXX J;  3FIS A;  1GVD A;  3RZD J;  2VPR A;  2L7M P;  1GDT A;  2EZK A;  2MSY A;  3CQZ J;  1OCT C;  3HOZ J;  4A3D J;  2M2E A;  3S17 J;  3HB9 A;  2LTP A;  5HOD A;  4FIS A;  4FE7 A;  2K40 A;  3GTG J;  1GV2 A;  1IDZ A;  2LP0 A;  1TWC J;  4AYB N;  1LFU P;  2YU9 J;  2XGD A;  2Y9Y A;  1GV5 A;  2E1O A;  4A3F J;  5EZG A;  4MLO A;  5F04 A;  2HI3 A;  4A69 C;  4V2G A;  2E2J J;  2JA6 J;  3G1O A;  3W6V A;  3QQA A;  2COB A;  2JK3 A;  2I10 A;  2FJ1 A;  2ECB A;  4XK4 A;  3JRA A;  2R5Z A;  5K7H A;  4W97 A;  4A93 J;  2FQ4 A;  3BTC A;  1RPW A;  1D5Y A;  1H8A C;  3LOC A;  1E3O C;  1BW6 A;  3TP3 A;  2DA1 A;  3TW7 A;  1W0U A;  1P7I A;  4X1E A;  5BNG A;  4XRS A;  5IP7 J;  2PMZ N;  1W0T A;  1F43 A;  5EYR A;  1PUF B;  3BR0 A;  1A6I A;  1AU7 A;  1WH5 A;  3RQI A;  3GTK J;  5IOZ A;  2VKV A;  1FTZ A;  5C44 J;  2HQ5 A;  2ID6 A;  2AHQ A;  4UUS B;  3JRB A;  2JA8 J;  4A3K J;  3FK6 A;  4M3D A;  3BTJ A;  4DZP A;  1EF4 A;  2DMU A;  5M5X J;  1A5J A;  3D1N I;  3JRI A;  4BBS J;  2DMQ A;  2HOT A;  4HNV A;  3BR2 A;  2WV1 A;  5J1U A;  3S1Q J;  2MGQ A;  1F36 A;  2ME6 A;  4CYC A;  5GPA A;  4JP0 A;  9ANT A;  2CU7 A;  2NS8 A;  3BQY A;  3BR6 A;  4ABZ A;  1AHD P;  2LY9 A;  4JYK A;  5JLX A;  3SDG A;  5EEA A;  2DA5 A;  2XPU A;  1JUS A;  2XB0 X;  5IPA A;  3H0G J;  3ZOB A;  2CQQ A;  2XGC A;  5E3O A; 
#chains in the Genus database with same CATH topology
 2JSC A;  2V9V A;  1Y39 A;  1TTY A;  2VBW A;  4ZYG A;  1Q1V A;  4DYC A;  1TZL A;  3HKZ N;  2QBY A;  2E5N A;  2K3F A;  4HX4 A;  1IN8 A;  4A3I J;  4I2O A;  3TED A;  4KYW A;  2Q2E B;  3KEQ A;  1YIJ I;  4Z6Y A;  2VJ5 A;  1L3L A;  3CDL A;  2GA2 A;  2DPD A;  4EV0 A;  4UV9 A;  4G7Z F;  5FJ8 J;  3ISP A;  1SMY F;  1S6L A;  1GXQ A;  3LSR A;  3BCA A;  1AKH B;  3M4O J;  3CUQ B;  2ETH A;  4C3I J;  3L2R A;  1QGP A;  2JN6 A;  4FAS D;  1IG7 A;  3S1N J;  2E7X A;  1KQ8 A;  1SVM A;  4XOR A;  3TDZ C;  3DCF A;  2H1K A;  4IRG A;  3A0B C;  2LNB A;  2VN2 A;  5E3N A;  2HTS A;  5L3C A;  2QEX I;  2BW3 A;  4BY7 J;  1ZAR A;  5FRN A;  4A3G J;  2P5L C;  1DGW Y;  2GIZ A;  3OYA A;  1ONV A;  2CS3 A;  1QZE A;  4UVB A;  3VEP A;  1EV7 A;  1R1V A;  4LIU A;  2TCT A;  3OIP A;  2PJR A;  3KIO A;  1SMT A;  4BDY A;  5E8I A;  3A0H C;  2DMN A;  4AC0 A;  4QLC U;  4HLX A;  2HXI A;  1KU2 A;  5B3S H;  4E7Z A;  1OJL A;  4XM3 A;  3LWF A;  1MJB A;  3CJR B;  4B43 A;  4P1W A;  1ETW A;  4DYQ A;  1MIJ A;  1IN5 A;  1IRG A;  2ACJ A;  3HDD A;  5C3E J;  3DKX A;  1FP2 A;  2R7W A;  2IGK A;  4IZZ A;  3QAH A;  3ELK A;  1S7E A;  3ZMU A;  4BHP A;  2JWT A;  3K4N A;  2XVC A;  1UG2 A;  1FBU A;  1RKT A;  4N9H A;  4C9Y A;  1LFP A;  2G9W A;  4CHU A;  2HOE A;  1O3Q A;  5FB2 A;  2CUJ A;  5DEQ A;  3E5U A;  3WU0 A;  1O57 A;  3GFI A;  3I56 I;  1SD4 A;  3FXU A;  2K02 A;  1P6R A;  4RB0 A;  1AWC A;  3J81 K;  2A6T A;  2HGC A;  1CGP A;  1UEL B;  3U2R A;  4GFB A;  1VND A;  4YEJ A;  3S2H J;  3ZMS A;  3QYB A;  3RIR A;  3ABT A;  3SEQ A;  3K70 D;  2X0L A;  1B6A A;  1PP7 U;  4ASN A;  1ZHF A;  1Z7U A;  1WWX A;  3I71 A;  4KNY A;  4P5O A;  4A3J J;  4IOA F;  2RV8 A;  3F21 A;  5CVJ A;  2DK8 A;  2YS9 A;  1G3Y A;  1IO2 A;  4ZDL A;  5GAE J;  3GTQ J;  2LY2 A;  4M74 A;  3TO7 A;  4B44 A;  5E79 C;  4XKC A;  3IRR A;  2XV4 S;  4IHY A;  5FKN A;  3SEZ A;  4C3J J;  3G3Z A;  4XLC A;  2LK2 A;  1G3W A;  2E35 A;  2IXS A;  5EG0 B;  2P7C B;  3EYI A;  2PMZ A;  3E6D A;  3ULQ B;  3ABM H;  3R4K A;  4RM2 A;  5J1R A;  3S2D J;  4JOM A;  3CMM A;  3QU3 A;  4LG0 B;  1ZAO A;  2LFB A;  2UXN A;  4M9Z A;  4NHJ A;  1ZR2 A;  4N4O B;  3HSF A;  2HYF A;  4JX5 A;  1XN7 A;  4CYD A;  2V1N A;  1I6H J;  1K4S A;  3ZQC A;  3OR2 C;  2VI6 A;  3HPH A;  1JKR C;  4S0H B;  1NH3 A;  1TWA J;  3LQR A;  4EJT A;  3IAM 2;  2FD5 A;  4NC6 A;  4CCO A;  1K6O A;  4KIC A;  2E1M C;  1BIA A;  1ZH5 A;  3PM1 A;  2KJB A;  1WH7 A;  2P5V A;  4WF2 A;  2E2H J;  3O6B B;  2LY1 A;  1JGG A;  4V2F A;  5D5W B;  2DYR H;  3A02 A;  3M7G A;  2QQ8 A;  4A2U A;  4DYR A;  4BY1 J;  3K2Z A;  5JI6 A;  1SFX A;  3CO6 C;  4IRI A;  3BG3 A;  1SAU A;  3FKI J;  2EIL H;  2XAJ A;  3T1B A;  2QCO A;  2BZT A;  2VQC A;  4HYE A;  2O8X A;  2EJR A;  3B02 A;  2F5V A;  2X9D A;  2H09 A;  2ZFU A;  2DA7 A;  4PFP A;  2JQ7 A;  1NK3 P;  2VUM J;  5LGT A;  2WY8 Q;  3TOB A;  1OR7 A;  3Q0W A;  3MKL A;  5TIS C;  3ZMZ A;  3IAS 2;  3O8H A;  3JRH A;  3TQN A;  3HOT A;  3J81 Z;  2OA4 A;  2K86 A;  3VYT B;  1P2F A;  2KRF A;  3IP4 B;  5DD4 A;  1KU7 A;  3HKZ A;  3DKY A;  3K4B A;  3KEY A;  2QWW A;  1HF0 A;  1MW7 A;  1WGX A;  2K4J A;  1J59 A;  4GDF A;  4KT6 A;  2VIX A;  4BJ6 C;  1ZRC A;  1ORK A;  4A3C J;  2WAE A;  4JQF A;  1R58 A;  3WE2 A;  3VOE A;  5CJ9 A;  2K3P A;  2O03 A;  2FEZ A;  2Y9Z A;  4Y13 A;  1Z3X A;  3W6J B;  4L0Z B;  2KMU A;  3G1L A;  2UV1 A;  2ZXJ A;  2X51 A;  1NK2 P;  3RPU A;  1HW5 A;  1SC7 A;  2OQR A;  1JTX A;  2ID3 A;  2QA4 I;  4BUP A;  3OYM A;  1ZEL A;  2L3D A;  2MA3 A;  1RUN A;  2QSH X;  1D0Z A;  4DQ2 A;  2VJI A;  2DO7 A;  4F3Q A;  4B4C A;  2EK5 A;  2RDP A;  2XAS A;  3DBL B;  2K7L A;  5JHU A;  2IBD A;  3WGG A;  2OZ6 A;  5DV5 A;  2NS0 A;  3CJT B;  4JK1 X;  4GGG A;  4IHS A;  3QOE A;  2VKE A;  1P4A A;  1WI3 A;  2CQN A;  3F6V A;  4UVA A;  4JBA A;  3PIP F;  1RR7 A;  1EH7 A;  4J19 A;  1CF7 A;  2OU2 A;  5D5V B;  3TO9 A;  3OYB A;  2KIF A;  3DV8 A;  3WHC A;  3A01 A;  3HJE A;  4HOB A;  1SFO J;  1XG1 A;  5DM7 F;  4UUV A;  4BXU A;  2FRH A;  5K7F A;  1T0F A;  1WJC A;  3CZ6 A;  3C3W A;  4CYC B;  1BN5 A;  1YRN A;  1APL C;  1DU0 A;  5IP6 A;  2B7E A;  3C7J A;  4LOC A;  5FRM A;  2DT5 A;  1UST A;  2QM3 A;  1N78 A;  3S1R J;  2HYG D;  3K4K A;  5HLH A;  3IH4 A;  1R00 A;  2L7F P;  2WV0 A;  4HA8 A;  3DKW A;  5F0C A;  3HG9 A;  4M3F A;  3OYG A;  1MZB A;  1DQU A;  1G2H A;  4C2M J;  1J2X A;  2F4O B;  1V55 H;  1STZ A;  1NTC A;  2DTR A;  2WAQ N;  3GLL A;  4BAY A;  4IEJ A;  3MKW B;  2DK5 A;  3JTG A;  3COA C;  2VE9 A;  3DTK A;  2OBP A;  2ZME A;  5HDK A;  1R5I D;  1MBG A;  4HZF A;  2EIJ H;  4DW6 A;  1QQI A;  5ICC A;  1VQ5 I;  4LMY A;  2IJL A;  2X6Y A;  3OSG A;  4LJZ F;  2DAO A;  2KP6 A;  1W5S A;  3F23 A;  2B0L A;  2OTL I;  3FK7 A;  3KP4 A;  3C1D A;  4Y33 A;  3MZY A;  1J75 A;  4AVP A;  2X6O A;  2QGU A;  4P9U A;  1YFH A;  2HPM A;  1ETY A;  1UHW A;  4YRV A;  4NQW B;  5GPC A;  4M6Y A;  3C2B A;  2HYJ A;  2XAU A;  3TO6 A;  3CTA A;  4AID A;  1JTY A;  1B8I A;  2Y30 A;  4F92 B;  2KDO A;  2V4J C;  3S16 J;  3F72 A;  1VQ7 I;  2O3F A;  4HG2 A;  5F1J A;  3G4S I;  1Q1H A;  1FMW A;  3EUH A;  1PUE E;  1D5V A;  2BVL A;  2HFH A;  1OR7 C;  1H9G A;  1U78 A;  4Z2Y A;  4A3L J;  2MH2 A;  4I0A A;  4KIT B;  1YQA A;  1YJW I;  5F0H A;  2HOS A;  1EKE A;  5AIQ A;  1X3Z B;  2A05 A;  4NC8 A;  2ZJQ F;  1YS7 A;  2A61 A;  2W85 A;  3ZRG A;  3G71 I;  4BEH A;  4OU0 A;  1XSD A;  3OYK A;  1IF1 A;  4PK4 A;  1E3P A;  2WWY A;  1Z3Y A;  5FLV A;  2H8R A;  3AG3 H;  3HZJ A;  3VYU B;  2AXT C;  4CDG A;  4Y15 A;  4DJA A;  4Y17 A;  2VKD A;  1R23 A;  1U9N A;  4PDK A;  3LNQ A;  2M5W A;  1R4N B;  2CO5 A;  3VYR B;  4E7J A;  3PFI A;  4V19 K;  2XRL A;  4HDV A;  3M1E A;  3ZCO A;  3FBN B;  3JR9 A;  2OUM A;  4BDZ A;  5M3F J;  2COM A;  1JT0 A;  1O7F A;  4RAZ A;  4EGZ A;  1YOV B;  4A5N A;  2M7B A;  4E7L A;  5K5O A;  1TT0 A;  3V8J A;  2OTJ I;  5CVR A;  2MH9 A;  5FGM A;  2CFO A;  1X2N A;  2IS2 A;  3H5R A;  1FYL A;  1WJA A;  4YEL A;  3GW2 A;  4XKW A;  4A0Y A;  1U5T B;  1VQL I;  2ZJR F;  3BZK A;  3HOU J;  5CLS A;  1ULY A;  3A03 A;  2JPC A;  2WY7 Q;  2R7R A;  2GXA A;  2VPR A;  4BQO A;  4ZJZ A;  3HOZ J;  2M1B A;  3K4M A;  5E17 F;  2XF6 A;  2R7D A;  1IUY A;  4FE7 A;  2K40 A;  3E3V A;  4A0X A;  1XDU A;  3VYS B;  1GV2 A;  4AYB N;  1X1B A;  2E1O A;  4QPO A;  2MYS A;  4HV6 A;  1IRF A;  3OYE A;  1LDJ A;  2KFD A;  3AL0 B;  2JA6 J;  4OAY A;  3ZQQ A;  5F64 A;  3QQA A;  2X6X A;  2QSF X;  2JK3 A;  2I10 A;  3P9K A;  4M9X A;  2VXZ A;  4XK4 A;  2R7F A;  2BBY A;  3HL2 A;  4RS8 A;  5K7H A;  1V5G A;  1R7J A;  4DOZ A;  5L3E A;  2JUG A;  3GYH X;  3CCE I;  1D5Y A;  3LOC A;  1KZH A;  1BW6 A;  2B9S A;  1EH8 A;  4BE0 A;  3ZPL A;  1XGO A;  2JSP A;  5K5R A;  4XLP F;  3HC7 A;  3HRS A;  3GTK J;  3RQI A;  3OWT A;  2E71 A;  1BI3 A;  1QNT A;  2ELH A;  1L0O C;  2AHQ A;  3JRB A;  2XHK A;  1FLI A;  1O7L A;  4M3D A;  3U9G A;  2IA2 A;  1EF4 A;  4M72 A;  2DMU A;  1C0W A;  1A5J A;  3D1N I;  2XIG A;  5J47 A;  3OYL A;  2Z1D A;  3C2H A;  2BY3 A;  1OLT A;  3FXJ A;  2DOE A;  4ON0 A;  4HNV A;  2ESH A;  3PNY A;  2CQ7 A;  2KIS A;  2WV1 A;  5J1U A;  3G6E I;  1QU3 A;  3EUH C;  2O61 A;  3GFJ A;  4MQ9 F;  5H6Q A;  2VBX A;  4RAG A;  3CME I;  3H3Z A;  2Y0S A;  4HV5 A;  2YX7 A;  2WAQ A;  4JP0 A;  3CCV I;  2IA1 A;  2PFB A;  2KJC A;  4Y4R A;  3TDU C;  3BR6 A;  3P9C A;  3WTV C;  4RLQ A;  5JLX A;  1LB2 A;  2RQP A;  3OIQ A;  1XB4 A;  3BLY A;  3RYP A;  3PL8 A;  3PQK A;  1A6Q A;  1DPR A;  3H0G J;  3OL3 A;  3LSM A;  1XD7 A;  4CH7 A;  3S2W A;  4NUB A;  3CCY A;  1W1W E;  2PJP A;  3KX2 A;  2EZH A;  2FOK A;  1U3E M;  4GRI A;  1SEU A;  2VQH A;  4CCK A;  2XAG A;  1I5Z A;  2Q8K A;  1G4D A;  4YFN F;  4WWC A;  4RLF A;  5IYD J;  5KAI C;  3S15 J;  1W36 C;  5E3M A;  4WCG A;  3MKY B;  1T2K A;  5CVV A;  1SFU A;  1BOA A;  1VI0 A;  1FIA A;  1D0X A;  4EQQ A;  4HNU A;  1GHC A;  2BHY A;  2XGX A;  3M07 A;  3VB2 A;  4L18 B;  2QKM B;  3HEF A;  4E7H A;  2BVM A;  2NVU B;  2R5Y A;  2K9S A;  4KIF A;  5E20 A;  2JVH A;  4G6Q A;  5F27 A;  5HLI A;  5J6X A;  2VJ4 A;  1KA8 A;  1QZZ A;  3HUG B;  4WXH A;  1B72 B;  4I7H A;  1TC3 C;  3LAJ A;  1XGN A;  3PSI A;  5DM6 F;  3VSL A;  3Q9V A;  4FCY A;  4PJL A;  5DYM A;  2UZK A;  1MNM C;  2BHZ A;  3TGN A;  3TMO A;  1OCC H;  3U1D A;  5KAF C;  1BBY A;  2M34 A;  4EJV A;  3QP5 A;  2A5W A;  1WSU A;  2F4I A;  3F8C A;  3S3O A;  4M6X A;  4MNU A;  2LD5 A;  3ZQL A;  4ITV A;  3IWF A;  1U6G A;  3SXY A;  2LBF B;  1VZ0 A;  2VBZ A;  1X19 A;  5D4R A;  3QYE A;  4UVC A;  1BI0 A;  1F9N A;  3S93 A;  1A36 A;  3EUA A;  3CP8 A;  1VQP I;  2KRC A;  1W7P A;  3ZGK A;  4EAT A;  1TW2 A;  1S72 I;  2EB7 A;  1Y1V J;  3CCU I;  3W2A A;  2OV7 A;  4DNC A;  2Q2E A;  3E0J B;  3FM3 A;  3KP6 A;  4XLF A;  2VOP A;  1FEX A;  4UB6 C;  1QO0 D;  4HRI A;  4MO7 A;  2XB5 A;  3OOU A;  3KP3 A;  1TT5 B;  4M3G A;  4XRS G;  3Q5F A;  4W1U A;  2JMW A;  2JTV A;  2VJJ A;  1YIO A;  4RGU A;  1TLH B;  3V8K A;  3I58 A;  4M3B A;  2L4M A;  2M87 A;  3R0J A;  4R1H A;  1YI2 I;  4H4K C;  1I39 A;  1JUP A;  1PDN C;  1D0Y A;  2Z2S B;  4MIM A;  4YFK F;  2V7F A;  2PQ8 A;  3CJQ B;  5L3F A;  2BY2 A;  2WBM A;  1BR2 A;  3HTS B;  2HXO A;  2E34 A;  2K9M A;  3KP2 A;  1TQI A;  3H9G A;  1SD7 A;  1I27 A;  3ROU A;  1IUF A;  2EBI A;  3WTT C;  5HVQ C;  2F2E A;  4BQA A;  4AYB A;  3DBH B;  2Z33 A;  1DPU A;  1Z0X A;  1WI9 A;  2ZXH A;  4E7S A;  1I1G A;  5ILV A;  3HOW J;  1X58 A;  2FE3 A;  3TW6 A;  2Z16 A;  3CD6 I;  1UHS A;  2X48 A;  1LKX A;  2E19 A;  2XSJ C;  1JKP C;  3GUD A;  1XC5 A;  3AG4 H;  3V4G A;  1W4M A;  2IRF G;  1BIB A;  1LFB A;  2VXD A;  1U9O A;  2ZNY A;  2JA7 J;  4O3M A;  3J7A Y;  1FBQ A;  1JT6 A;  4EGY A;  3RQ4 A;  1J09 A;  4EJO A;  3GFL A;  1Z67 A;  4AVZ A;  2CGP A;  1FTT A;  1LE8 B;  3HOS A;  1FJL A;  1UFM A;  3WOD F;  2HEO A;  3KZI C;  3BDD A;  2AS5 F;  2ADU A;  2LR8 A;  1K83 J;  3NAU A;  2DMT A;  3WTW C;  3F8B A;  2WTE A;  2ME0 A;  2ZNZ A;  3KP7 A;  3I59 B;  2VE8 A;  2QQA A;  2EA4 A;  1IW7 F;  2LG4 A;  3BR5 A;  4EM1 A;  1RUO A;  1RI7 A;  4MGR A;  1QVT A;  2GLO A;  4LLN A;  2NOG A;  1MNE A;  1WQ2 A;  3MAJ A;  2LRD A;  5ICE A;  2CQX A;  2P0W A;  1WJ5 A;  1SFE A;  2WB1 N;  4ZTJ A;  2LF7 A;  1VTN C;  4A0Z A;  4PJN A;  3NQO A;  2HVR A;  3BWG A;  2VPL A;  3X2Q H;  4XID A;  2GM4 A;  4EMS A;  4RM3 A;  4XOT A;  3S3M A;  2LKS A;  2FU4 A;  4M3E A;  5ICG A;  3G73 A;  4U0Y A;  5EGO B;  3OYF A;  3KEO A;  4L9T A;  3CF5 F;  3FWE A;  3DEE A;  2XUB A;  4NDL A;  2RGV A;  4MFE A;  3M8J A;  3CF2 A;  3DP7 A;  3H9Q A;  3HXL A;  1T95 A;  5EG0 A;  4IX7 A;  3DQV C;  1XMX A;  3GTJ J;  5CVU A;  1R36 A;  2R93 J;  4D5F A;  3K7A J;  5KVR A;  3CCQ I;  4A3B J;  1MSF C;  2MG4 A;  3WE3 A;  3HM5 A;  3WTU C;  2GXB A;  3GXO A;  4C2T A;  1MMS A;  1NG6 A;  4PCQ A;  5E18 F;  1ZRD A;  1K6Y A;  5JHF A;  2W24 A;  4FX0 A;  3DU6 A;  2VC0 A;  2YX4 A;  2R5Z B;  2D45 A;  2OZU A;  4BH9 A;  4RGR A;  2Q0O A;  3WG7 H;  5A2Q K;  2I8D A;  2LRE A;  3A2K A;  5E3L A;  5HLT A;  1RRJ A;  2FUG 2;  2P8T A;  1PP8 F;  1D1B A;  4HEA 2;  1ZR4 A;  1U8B A;  1XCV A;  2A07 F;  4B8X A;  4ETS A;  2FA5 A;  2KKO A;  5CQE A;  3H5N A;  5E1X A;  3I3L A;  1K78 B;  1X1P A;  2MLK A;  3BTI A;  2Y0M A;  2DBB A;  3HHH A;  2PN6 A;  3BRO A;  5DD8 A;  2M7A A;  1M1E B;  3BP8 A;  3WGH A;  2GBY A;  2P6S A;  1TNT A;  3NWT A;  3LQQ A;  1ZGA A;  3Q0V A;  1VFC A;  1HDD C;  1DP7 P;  4A3M J;  4IHV A;  5BS6 A;  4GYG A;  3UR3 C;  4I0B A;  5FRO A;  2KDZ A;  4ZH4 F;  3H5A A;  2EFQ A;  4L5E A;  2AO9 A;  2OCE A;  2RC4 A;  2EH3 A;  3QPL A;  2GOM A;  5EEH A;  2XSD C;  2K9N A;  2Y69 H;  5E1W A;  1Z05 A;  4U7B A;  2HDD A;  1PYV A;  1MD0 A;  2W25 A;  3PJR A;  3P5J A;  1KON A;  1USS A;  1IRX A;  2JRT A;  1JJ8 C;  3GZN B;  1S5L C;  2DA2 A;  4S05 A;  4RGX A;  2OPT A;  1YJ9 I;  4M73 A;  2DA3 A;  4ZYH A;  4LGW A;  1U0J A;  2NNY A;  1Z7L A;  3H35 A;  5H6R A;  3QYF A;  5D5X B;  3ZQF A;  1XCB A;  3OYN A;  1S7A A;  2QBY B;  1YW9 A;  5IYC J;  4C30 A;  2DA4 A;  3QOP A;  3FHN A;  2RRE A;  2NVX J;  2OC6 A;  1IGN A;  3JRD A;  1QPM A;  3E1S A;  2E1M B;  1NHA A;  3I0T A;  3L2V A;  3K2A A;  3ZXS A;  1KGS A;  1ZN2 A;  1YE9 A;  5D8K B;  2CV1 A;  2QSG X;  4KMF A;  2VL8 A;  2VB6 A;  2L01 A;  3OIO A;  3PO3 J;  4HST A;  3VSK A;  2ZC2 A;  3ASO H;  1T98 A;  5IYB J;  4E70 A;  3EUK L;  2H94 A;  3AG1 H;  3RJP A;  5EZH A;  3FMQ A;  1SVO A;  5A2Q Z;  1TQM A;  2R7S A;  1YLF A;  4RBO A;  3G1M A;  2MAB A;  4L0Y B;  2HOA A;  2DJN A;  5H20 A;  1V54 H;  2A69 F;  5ED4 A;  3I55 I;  1Z91 A;  3FXL A;  1IAW A;  5FKK A;  1IRZ A;  2XPV A;  2CWE A;  2LVS A;  1ETQ A;  2PJR B;  1JUM A;  3GTO J;  2IGM A;  3ZMV A;  1MBJ A;  2TRT A;  2PMU A;  4I99 C;  1K7A A;  2EIM H;  1R1U A;  2KLO A;  2WB1 A;  1MJ9 A;  3QPS A;  2VLA A;  2DT6 A;  1H9T A;  4ANJ A;  2DOA A;  5EEG A;  4KDP A;  1TNS A;  3JRG A;  1BI1 A;  2DOD A;  1N25 A;  4EEF G;  2LKX A;  3RPQ A;  3S1M J;  4UXN A;  3OS2 A;  1QBJ A;  3CO7 C;  1LQ1 A;  4A5M A;  1ZK8 A;  4F91 B;  5CQG A;  2X1D A;  2G7H A;  2DT7 B;  3MMY B;  2N8G A;  2CUF A;  2F5F A;  2QYO A;  3HGY A;  1ON1 A;  1IZ1 A;  1FOY A;  2RAE A;  3S32 A;  1CQT A;  4XL9 A;  4NBQ A;  4XSX F;  5KK1 A;  1R22 A;  2W82 A;  1I50 J;  1HBX G;  2PEX A;  3JCU C;  3QOD A;  3FXR A;  4B1R A;  4AD9 A;  1BL0 A;  3KZY A;  1Z1D A;  3GTP J;  3R60 A;  4S04 A;  2JJ7 A;  1FY7 A;  3KLO A;  4BXX J;  2YR2 A;  3FMS A;  1MMD A;  2XAF A;  2X6W A;  2O0Y A;  1GVD A;  4HLY A;  1X4O A;  2L7M P;  4IO9 F;  5DCF A;  4BXF A;  2MSY A;  1S8N A;  3O3K A;  3VWB A;  4DBQ A;  4BQQ A;  5B66 C;  2M4K A;  1UZC A;  2R7Q A;  4CCN A;  2WA0 A;  4ESJ A;  4HF1 A;  3JSO A;  4IF4 A;  1IDZ A;  3DPU A;  2EA2 A;  1TWC J;  2JUC A;  2LP0 A;  1LFU P;  2Z99 A;  2BEO A;  2OJE D;  2QVO A;  4G94 A;  4FHT A;  2F6C A;  4AIJ A;  1TL8 A;  2FBH A;  5F04 A;  4A69 C;  4V2G A;  2E2J J;  3W6V A;  3L2U A;  2IT0 A;  2COB A;  1WHU A;  2MC4 A;  2P4W A;  1BM9 A;  3V42 A;  2CV0 A;  5TGT A;  3JRA A;  3LSK A;  4W97 A;  3JSP A;  4A93 J;  3M9A A;  4FX4 A;  3D0S A;  1RPW A;  2DPU A;  2X1C A;  1KU9 A;  1MDM B;  3CCL I;  1W0U A;  3TW7 A;  1P7I A;  4PFO A;  3HRT A;  4XRS A;  2IA0 A;  5IP7 J;  3DLL F;  5LHH A;  1KYZ A;  1F43 A;  4FQG A;  2BGC A;  4IVN A;  5CYV A;  1P4X A;  3BR0 A;  1A6I A;  1AU7 A;  1WH5 A;  3F8M A;  3FXM A;  1FTZ A;  4F7Z A;  2ID6 A;  4CXF A;  4A3K J;  3FK6 A;  3A4C A;  3BY6 A;  4DZP A;  4L5I A;  4HQM A;  2DCE A;  5M5X J;  4CA0 A;  4WXC A;  2VOD A;  2BY0 A;  2HPI A;  1YTY A;  1MMG A;  2DMQ A;  2H6C A;  3ABL H;  3WU2 C;  3ZR8 X;  2V79 A;  4OIQ F;  3S1Q J;  1Y8Q B;  2V9K A;  5HNF A;  4XLE A;  1OKR A;  2DU9 A;  5LLQ A;  5J40 A;  2J5O A;  2ZBK A;  5E1Z B;  1OIS A;  2L54 A;  4ABZ A;  2L9V A;  2XF5 A;  1O3S A;  3IUO A;  3SDG A;  4IRH A;  1MMA A;  2XPU A;  3BG6 A;  1JUS A;  4XNF A;  3OYI A;  1T08 B;  2QLZ A;  3RPU D;  4E6K G;  5DUI A;  2XGC A;  2OF7 A;  2IGN A;  2VKH A;  4CIC A;  2TDX A;  4PGG A;  2JVG A;  3D5R C;  3FKJ A;  1VQO I;  4M6V A;  3EDP A;  2AQE A;  1BI2 A;  1FT9 A;  2JPB A;  1J7K A;  4HQE A;  2K4B A;  3BOQ A;  1FP1 D;  4UY8 I;  4A6E A;  1NG7 A;  3Q3S A;  3IHU A;  1VQ6 I;  4PGH A;  1E2X A;  5F1R A;  2LYC A;  2Q1Z B;  4G7H F;  2DFF A;  1HLV A;  2M45 A;  3HRU A;  4BJ5 C;  3S14 J;  3GME A;  3DBR B;  2RKH A;  3LST A;  3L2Q A;  1HDP A;  1ETV A;  4D0P A;  2YU3 A;  1WCM J;  4ZYD A;  3L1P A;  3RZO J;  3H1C A;  1BA5 A;  4IPA A;  5DUK A;  2P5K A;  3GBG A;  1UB9 A;  2BY1 A;  2DQR A;  2QEN A;  4Y7N J;  3A01 B;  4U7D A;  3ZN1 A;  2JA2 A;  2VQL A;  4DIQ A;  4MFD A;  1LVA A;  3OV8 A;  2DN0 A;  1AOY A;  1VQ4 I;  2EZL A;  2F48 A;  3PNT A;  1FMV A;  2CUZ A;  2KRH A;  2DI3 A;  1YRN B;  4MEX F;  4LIT A;  1BR1 A;  1SFK A;  2F5C A;  1LPQ A;  1ETK A;  5LRR A;  1XMA A;  5GTH C;  2A68 F;  4IOC F;  3BG5 A;  2HZD A;  1T0F C;  1ACI A;  5FKO A;  2V1D A;  2HQN A;  3FM5 A;  1YS6 A;  2VT2 A;  1S29 A;  3T8R A;  2ELK A;  3PSF A;  2BOL A;  2D1V A;  2ZCW A;  1EA3 A;  4D7N A;  2HR3 A;  2IPQ X;  1WFX A;  3HPG A;  1XGM A;  2E2I J;  1R5G A;  5HDG A;  1FSE A;  4BQN A;  3B6A A;  3E5Q A;  4BBR J;  3D5S C;  1Y0U A;  5CKT A;  1B72 A;  3HUG A;  2ZME C;  1E17 A;  5D8L B;  2Z9O A;  3FZV A;  3W2V A;  1G3S A;  5GAD J;  4CO8 A;  2KQR A;  3D5L A;  4XLH A;  5IOY A;  1EJ9 A;  1QZY A;  4IL6 C;  1B8I B;  2IVM A;  2QF7 A;  4XN0 A;  3NAR A;  4MHG A;  1XTA A;  4P96 A;  3S3N A;  3WTX C;  5L3B A;  2LBF A;  1OPC A;  2K9Q A;  1JHF A;  4Q48 A;  2O6G E;  1E3H A;  5IY5 H;  2NXN B;  5JFR A;  4HDU A;  4RGS A;  2STW A;  5CVI A;  1BW5 A;  2O9L A;  1EH6 A;  3NWS A;  4QSH A;  1ON2 A;  4JX4 A;  2YUS A;  3SQN A;  3M3Y J;  5TJJ A;  4YII A;  1TP4 A;  1WRJ A;  1OCZ H;  2V26 A;  2XKO A;  3W3C A;  3CCM I;  1ZTR A;  3BC8 A;  4MEY F;  1KQ9 A;  4BEH B;  3BTL A;  3TOA A;  2JT1 A;  1QPI A;  2XPW A;  3F22 A;  2UWM A;  1T33 A;  4U88 A;  3K10 A;  3RYR A;  4E4H A;  4N9I A;  1W36 D;  1QRY A;  4UNO A;  1WKM A;  2GAU A;  5FKL A;  3R0A A;  1JJ6 C;  4YG2 F;  4IHX A;  1PJR A;  1IC8 A;  2OD5 A;  3K9T A;  2P7V B;  4GCV A;  3VFZ A;  1R9T J;  1QHH D;  1PUF A;  3ML6 A;  5DDG A;  2D5V A;  5D6E A;  2K5C A;  3I9V 2;  3KYD B;  5LGU A;  4L9J A;  4UUS A;  3K1N A;  3J7A O;  2VON A;  3T0Y A;  2CFX A;  2NVQ J;  4C3H J;  1SD5 A;  3MCZ A;  5KHD A;  2QQB A;  3C18 A;  2EFP A;  3RKW A;  5FKM A;  5E8G A;  1RKW A;  3AG2 H;  3BT9 A;  3LSJ A;  3OR1 C;  5J4Y A;  2R0Q C;  2DQL A;  3OYJ A;  2VBY A;  3HRM A;  3VOD A;  5KCM A;  3L2W A;  3LSI A;  5IP9 J;  3KPH A;  4PUS A;  1IXS B;  1MGT A;  1B9N A;  4L5J A;  3SJM A;  1LE8 A;  4II3 A;  5FLX K;  2XRN A;  3I4P A;  4FET A;  1UG0 A;  2DMP A;  3DEU A;  1HQC A;  4HNT A;  5JLW A;  1AA7 A;  1LDD A;  4IJA A;  3LL7 A;  3NEU A;  1Y0N A;  2NVY J;  2IGO A;  3O8G A;  5B5E C;  3OSF A;  3N4M A;  4XSZ F;  1MBH A;  1B9M A;  2A6E F;  1FOW A;  1ZGJ A;  2G0E A;  2GIV A;  1IXC A;  2QUF A;  3CLO A;  3SFI A;  3WGI A;  1RZ4 A;  2R7X A;  2RVC A;  1D1A A;  4G6T B;  5M3M J;  3GVA A;  5J8F A;  4LLL A;  2ISY A;  1X4P A;  2LLK A;  1MH3 A;  1MND A;  2KIQ A;  2OQG A;  1A31 A;  4KMU X;  1F4K A;  3K69 A;  4LG3 A;  2PX9 A;  1RES A;  4JX6 A;  4LK0 F;  4AUX A;  4BU2 A;  3H0D A;  1K79 A;  2W48 A;  1RIO H;  4BGD A;  4QPQ A;  3HBL A;  2M8E A;  4ZZL A;  3CCR I;  1YIT I;  1FC3 A;  4Y52 J;  2FML A;  2V9P A;  4QWQ A;  4N0B A;  1TBX A;  5HLG A;  1AKH A;  3CUQ A;  3MZ8 A;  5DCM B;  3KET A;  2MW8 A;  3EYY A;  3GTM J;  1P92 A;  2CH0 A;  2EWN A;  1Z6R A;  2RQQ A;  3GCM A;  2FXA A;  4OOI A;  4CCL A;  2KT0 A;  2IEK A;  2YSR A;  5B1A H;  2F5E A;  3UNG C;  3E7L A;  1FYK A;  1MJA A;  2E1N A;  5CPR B;  1ETX A;  3K1M A;  5GP9 A;  4BHB A;  1ITY A;  1HA8 A;  1LDK B;  2CMP A;  1FPQ A;  2XAH A;  2ZSI B;  3HOY J;  4EVI A;  3J80 K;  2LKP A;  3LA7 A;  4M9S A;  1H0M A;  2FNA A;  1QHG A;  5F0F A;  1TW3 A;  2FOW A;  1W5T A;  4B3A A;  5M5Y J;  2XDV A;  3ASN H;  2QQ9 A;  1ENH A;  2HQA A;  4PJJ A;  2EPF A;  1B59 A;  2M9H A;  4KN4 X;  2ZXI A;  3FXK A;  3M1C A;  2UUZ A;  1MBK A;  3T5X A;  1TWG J;  1GT0 C;  3K6G A;  5L3D A;  5FLX Z;  4HF2 A;  2EQR A;  1IN6 A;  1VQM I;  4ESF A;  1IJW C;  5FLM J;  4F93 B;  1MSE C;  3ESW B;  3LSG A;  1YX3 A;  2GA1 A;  3PFY A;  1U8R A;  4CCJ A;  2GQQ A;  2K9L A;  4KT5 C;  3H3U A;  2MBF A;  3K4C A;  3MN2 A;  2D1H A;  5AIP A;  1FBS A;  2FBK A;  1A35 A;  2MLG A;  4DGW B;  5HOO A;  4TV7 A;  1X3W B;  1OYW A;  2JRM A;  5LBQ A;  3BR3 A;  4OWR B;  2R5Y B;  2NOJ B;  3B6C A;  3OY9 A;  2P81 A;  3AAF A;  3RSN A;  2CW8 A;  1O3T A;  1T56 A;  1I3Q J;  2CJJ A;  1B4A A;  2DYS H;  2HWV A;  2VOO A;  3ZMD A;  2MC3 A;  4LLG F;  2R7Z J;  3BR1 A;  3DPT A;  4X6A J;  3HTU A;  1HW2 A;  5LEJ A;  3OYH A;  3H92 A;  2FF4 A;  5EDN A;  3QPT A;  4XBF A;  4GO1 A;  1OCO H;  3ZP5 A;  2R7U A;  3ECO A;  1W7P D;  4HF0 A;  2D2W A;  4WXD A;  1O3R A;  1K4T A;  3N05 A;  4D5C A;  2Y2Z A;  2PBI A;  2HDC A;  4LG0 A;  3RTR A;  1W7P B;  4KA4 A;  2CSO A;  2EFO A;  4Y3O A;  3FIW A;  1OCP A;  3JW4 A;  2LSO A;  3BJO A;  4EM2 A;  4EJU A;  1RNL A;  4II2 A;  3J80 Z;  3GX4 X;  2VQG A;  5EF6 A;  3H3V K;  3FXQ A;  4QIW N;  5ILU A;  1VF9 A;  5LFA A;  4WX9 A;  5C4J J;  2FBI A;  2X4H A;  5TRD A;  2DTZ A;  2VT3 A;  2DFH A;  4CSW A;  5JR3 A;  3ZQH A;  4CCM A;  4XKB A;  1FOX A;  1YW7 A;  2W57 A;  2M4G A;  2YPR A;  3V7C A;  1WJF A;  1XS9 A;  3Q0U A;  4IHW A;  3CUQ C;  1XSV A;  3MVP A;  5D6F A;  3RCO A;  2M0C A;  2R4G A;  3FIS A;  4Q4Z F;  1UHM A;  4ENJ A;  3F6O A;  2LF8 A;  2L4A A;  4MTE A;  2EZK A;  1TQP A;  1I6X A;  2L9N A;  3CQZ J;  4A3D J;  3GFM A;  2ESN A;  3SYT A;  3U1K A;  4R79 A;  3HB9 A;  3GTG J;  2ZFW A;  2DOF A;  4HAM A;  4PZJ A;  3GLX A;  4BNC A;  2L5Q A;  2YU9 J;  5LEK A;  2XGD A;  4HBL A;  1I3A A;  2Y9Y A;  2E1C A;  1GV5 A;  4Q5S F;  1G3T A;  2MFZ A;  4RB1 A;  1FYM A;  5EZG A;  1RC9 A;  2HI3 A;  3I5U A;  2ZO4 A;  2DDB A;  3V7S A;  2AXL A;  2ECB A;  2HVQ A;  3MQ0 A;  1BOB A;  3BTC A;  1N77 A;  3FDY A;  1H8A C;  3LMM A;  4G9Y A;  1FSH A;  1E3O C;  2CYY A;  3MFK A;  1KQ0 A;  4LFU A;  2DA1 A;  3CCS I;  4BS9 A;  5BNG A;  4X1E A;  4YIF A;  1VQN I;  1F1Z A;  1J5Y A;  3MZH A;  2E7W A;  1W0T A;  1XSX A;  1WJE A;  5EYR A;  4LD5 A;  3I64 A;  5H2F C;  2E5Z A;  3RKY A;  3OYC A;  2VAS A;  3K0L A;  5C44 J;  2HQ5 A;  4CZZ A;  2JA8 J;  4XQF A;  2PI0 A;  4PSW A;  3IC7 A;  2K27 A;  1LEB A;  1U2W A;  2HS5 A;  3CLQ A;  4A6D A;  2VC1 A;  1ODD A;  1X1C A;  5HNH A;  4BJT A;  4AIK A;  2IW5 A;  2IS4 A;  2EIK H;  2MGQ A;  4ENM A;  3KYC B;  2Z3Y A;  2P6T A;  3OS0 A;  3K70 C;  1F36 A;  1HST A;  4F55 A;  1E0E A;  4CYC A;  5BPD A;  5KNL A;  3SZT A;  2MD5 A;  2CU7 A;  1ZG5 A;  5D5U B;  3FMR A;  1FZP B;  1HKS A;  1R6R A;  1A04 A;  2BW3 B;  2V6E A;  3J7Z I;  4KJZ A;  3SZG A;  4B09 A;  5EEA A;  2J5P A;  1MDM A;  1B1B A;  2XB0 X;  1S3J A;  5IPA A;  5HDN A;  3ZOB A;  3GF2 A;  3DFG A;  3VDX A;  3WTS C;  1JHH A;  2PLY A;  5F08 A;  1XPX A;  1H88 C;  2EFN A;  4LB6 B;  2R92 J;  3RI4 A;  1Z9C A;  3Q9S A;  5HS9 A;  1TWF J;  2ECC A;  2KZV A;  4XOP A;  2Z5U A;  3GEZ A;  3HSE A;  2RN7 A;  4G6D A;  4OMY A;  4XLN F;  1IN4 A;  5ILS A;  2RNJ A;  4L9V A;  3RKQ A;  3CUO A;  4GXO A;  4RA2 A;  3F3X A;  1UJ8 A;  1ZRF A;  2CW7 A;  3QPH A;  1FOK A;  4NQW A;  4XKV A;  2XC7 A;  4NB5 A;  3GO5 A;  1ZG3 A;  2I5U A;  2UXX A;  4B47 A;  4BYY A;  4ZZD A;  3IRQ A;  2H27 A;  1JE8 A;  2XKP A;  3FX3 A;  3CC4 I;  1JXS A;  3E6B A;  3SZP A;  3S8P A;  2W7N A;  4HX7 A;  2L2O A;  4LB5 A;  4F52 A;  5DTD A;  1LEA A;  4U87 A;  1JKO C;  3GZ6 A;  3DF8 A;  4E7I A;  4D9J A;  3CMY A;  1SAX A;  4OIN F;  3V8L A;  2L0K A;  3WU1 B;  3KCC A;  3DU5 A;  3FHZ A;  1P7J A;  3CDH A;  3JRC A;  4KIB A;  3I53 A;  3QRF F;  2R7V A;  1YYV A;  5LD2 C;  4ZDO A;  2B63 J;  3EPZ A;  1Z21 A;  2ZJP F;  1GUU A;  1R49 A;  1D3Y A;  4J00 A;  1Z6T A;  3I4N J;  4ZYE A;  1W5C C;  2L7Z A;  4XIC A;  3CJN A;  3ZN0 A;  3GWZ A;  1YHQ I;  3HOV J;  1UCR A;  2OCC H;  2XAQ A;  2A6H F;  1YG2 A;  2Y48 A;  3KP5 A;  1HOM A;  1RET A;  2STT A;  5GAG J;  2KPM A;  5DS9 A;  4DZJ A;  2EZI A;  4BE1 A;  1LNW A;  2LDU A;  3LA3 A;  1YW8 A;  4QTR A;  1T39 A;  1G8X A;  4RB2 C;  3L2C A;  5JVG F;  3ABU A;  2E60 A;  1OFC X;  3TBI A;  3VPR A;  3W2W A;  3CC2 I;  1U5T A;  2L9S A;  4UHT A;  3T8T A;  1HW1 A;  3HOX J;  3DXJ F;  5J4V A;  1IV8 A;  4MTD A;  1R5H A;  1ZQ3 P;  2C6Y A;  1XGS A;  3OL4 A;  4R8H A;  1X2M A;  4RDU A;  2X1E A;  4L9N A;  1MBF A;  2W4S A;  1POG A;  2Y31 A;  2A3S A;  4ZDP A;  5FFZ A;  3SHF A;  3BQZ A;  4NC7 A;  3JRF A;  1BR4 A;  1RR8 C;  1HKQ A;  2NAZ A;  2NRA C;  4PJM A;  1SAN A;  3BZC A;  2Y0S N;  5F6F A;  2X85 A;  1ZG1 A;  3IV5 A;  4C2U A;  3I4M J;  2CG4 A;  3ECH A;  1FNN A;  1HC8 A;  1MH4 A;  3EQL F;  3NRV A;  1WJB A;  3E6M A;  4I6Z A;  2KHM A;  3BG9 A;  1ZLK A;  2M3A A;  4D1Q A;  1DUX C;  2L9R A;  5JVT A;  3AKZ A;  2HVS A;  3I54 A;  5EJC A;  2O7O A;  3REO A;  3ERM A;  4LIV A;  3BJA A;  2GWR A;  4PSX A;  1DP3 A;  3B73 A;  1BJZ A;  2W00 A;  3E97 A;  5IT9 K;  3L7W A;  2ZXW H;  3HGG A;  4XLA A;  1HXD A;  1XDS A;  5FD6 A;  3ZQI A;  4A3E J;  3LFK A;  5J8C A;  1IN7 A;  1PVE A;  2BV6 A;  1J0R A;  3BG7 A;  4P9F A;  2PMH A;  2MD0 A;  4FTH A;  1S7O A;  1JKQ C;  3TL4 X;  1T8I A;  5HS8 A;  3TP0 A;  2FMY A;  4YIR X;  1WVR A;  3EET A;  3LFU A;  3WHB A;  3JRE A;  5C4X J;  2GXG A;  3C2G A;  3HIF A;  2NYX A;  5K1Y A;  4XRM A;  3PQJ A;  2NVT J;  1OYI A;  2E36 A;  1IXR C;  4IXA A;  2CRG A;  3LA2 A;  3IKV A;  3E6C C;  2M30 A;  3QWL A;  1DGR M;  4CUG A;  5GTI C;  2ZB9 A;  2LMD A;  1FX7 A;  4PJ0 C;  1XMK A;  4RMN A;  3K4J A;  5J1Y A;  4BE2 A;  1CF7 B;  4BAC A;  1V3F A;  3BJ6 A;  1WPK A;  1Y8R B;  5GAH J;  2BE5 F;  1D1C A;  2LC2 A;  2DA6 A;  4LK1 F;  3R6S A;  3QU6 A;  2FX0 A;  2H8W A;  1GXP A;  2BXZ A;  3JAM K;  1YO5 C;  4OAZ A;  1H89 C;  2LH9 A;  1G59 A;  3OOP A;  1ZGW A;  2DXI A;  2LOO A;  2IS1 A;  3MWM A;  3F9K A;  2HQR A;  3HHG A;  5LGN A;  2O8K A;  4ENK A;  1X3U A;  1WZ2 A;  5ERI A;  1X1A A;  2A5Y B;  4UUT A;  1DDN A;  2BYV E;  4HSR A;  2KIU A;  4P55 A;  1UMQ A;  2ZME B;  3DPL C;  1QA6 A;  1P9Q C;  2JA5 J;  3KE2 A;  2DFE A;  3TKY A;  4G12 A;  2EV5 A;  1U5T C;  2WAD A;  4D7M A;  3WTZ A;  2ELJ A;  2K85 A;  2R7O A;  4OIO F;  3MD2 A;  5AON A;  1OMI A;  5IT9 Z;  4X0G A;  5M5W J;  2GOX B;  2O5R A;  3LAP A;  3HSR A;  1T6S A;  1OYY A;  3BPX A;  3IKT A;  4I02 A;  4IQ4 A;  2EV0 A;  1VQ9 I;  3RDI A;  1SD6 A;  3WG9 A;  1ZKG A;  2JZY A;  3R61 A;  4BKX A;  3CCJ I;  1Y6I A;  2H6B A;  4OIR F;  4EJW A;  1XX5 A;  1IDY A;  4B3X A;  3AL0 C;  4NNJ A;  4MQV A;  3PNV A;  3UKG A;  2FQ3 A;  2ZJ2 A;  4HX8 A;  4EM0 B;  1YX5 A;  1V4R A;  2L7K A;  3V7R A;  3F0C A;  3U21 A;  1DU6 A;  1K61 A;  4FT8 A;  2CUE A;  3KYL A;  3DTI A;  4AWX B;  5IT3 A;  2HDW A;  1R71 A;  5L3G A;  4HW0 A;  2G7U A;  4XR6 A;  1LVK A;  1WJD A;  5DCM A;  2IS6 A;  4RAF A;  4GYI A;  3JAM Z;  1TWH J;  1MKM A;  4CGZ A;  3IH3 A;  4I76 A;  4CZC A;  5K7Z A;  3CMA I;  4K2E A;  2CV2 A;  2XGE A;  1R4M B;  1V5F A;  4O5V A;  1D8K A;  2FSW A;  1LUJ B;  3L9F A;  2W84 A;  4M71 A;  3RKX A;  4IHT A;  3ZMT A;  1T38 A;  1QVU A;  2IAI A;  4B48 A;  2R7T A;  3O2P E;  3L00 A;  4RAY A;  1Y1W J;  3JTH A;  4FE4 A;  3FBI B;  2F5D A;  1P4W A;  2GZW A;  1ETO A;  5BQT A;  1YJN I;  3OYD A;  3CC7 I;  3M8E A;  4BL0 B;  2V1U A;  4AM3 A;  5B1B H;  1I1S A;  1MMN A;  5D4S A;  4OIP F;  3GTL J;  2NS7 A;  3SFZ A;  2M8G X;  1Z77 A;  4KFC A;  1KU3 A;  1HCR A;  3DTE A;  5FFX A;  5BOX A;  3H36 A;  1GVJ A;  1MBE A;  2CW0 F;  2XRO A;  1ERD A;  2KL4 A;  2HKX A;  4IQJ A;  2V1X A;  3A1Y A;  4Q47 A;  3DEW A;  3DWL E;  1HSJ A;  3PUF A;  3ZQG A;  3OS1 A;  1VQ8 I;  2WC2 A;  5ICF A;  1HKT A;  1ZLJ A;  3F8N A;  2EFW A;  3FXO A;  4XMY A;  1BC7 C;  1FWZ A;  3I59 A;  1IV6 A;  1O4X A;  1LJ9 A;  3BPV A;  5FD5 A;  2V6C A;  1FIP A;  1V5E A;  3OMY A;  1X1D A;  4O6J A;  5J3L A;  3F8F A;  3LSP A;  4KN7 X;  2DFI A;  3QP6 A;  3IH2 A;  1ZRE A;  4U0V A;  3K1P A;  4ENN A;  3M8F A;  2W1O A;  2EIN H;  1UAA A;  3MKZ A;  3CES A;  3ABK H;  2ICW G;  2DW4 A;  5EGO A;  4UV8 A;  1F5T A;  3PO2 J;  2HU9 A;  2KIM A;  1J9I A;  3FF5 A;  4ZTF A;  4KIS A;  1VQK I;  5LHG A;  3J7Y J;  2RNG A;  3RZD J;  1D8J A;  1GLN A;  5LHI A;  2DLL A;  1GDT A;  4I01 A;  1OCT C;  2DJI A;  2Y75 A;  2OAZ A;  2M2E A;  3WTY C;  3S17 J;  2ZSH B;  4N4N B;  2LTP A;  5HOD A;  1Y56 A;  4FIS A;  4RB3 C;  2IP2 A;  3G2B A;  4I09 A;  5HS7 A;  2NNN A;  4U0W A;  4OMZ A;  3ONQ A;  4AU7 A;  4A3F J;  2EV6 A;  2HTJ A;  3E5X A;  1G6N A;  3PUB A;  4MLO A;  4AIH A;  3L09 A;  4XN3 A;  3G1O A;  4G8X A;  2CQK A;  4UB8 C;  5FO5 A;  3IL2 A;  4H0E A;  3LSH A;  2H1L A;  2FJ1 A;  5BPI A;  2BXY A;  2R5Z A;  2KZG A;  3BZ6 A;  1ZYR F;  2M0M A;  3P9I A;  2FQ4 A;  2L02 A;  1S9H A;  1SVL A;  4KIG A;  4ZYA A;  3TP3 A;  4XRF A;  2HKO A;  3H9J A;  4HPQ A;  4XON A;  1OQY A;  3ERE D;  2PMZ N;  3KZZ A;  1R1T A;  2DDA A;  3SDB A;  1PUF B;  4BHC A;  3KFW X;  4ESB A;  2VKV A;  1KYW A;  3W6K B;  5IOZ A;  1K78 A;  2HZT A;  4UUS B;  1BJA A;  3BTJ A;  4YFX F;  3HYI A;  2F4M B;  2HNH A;  1JGS A;  3ZQ7 A;  3PIO F;  3JRI A;  6PAX A;  1REP C;  2XF7 A;  2ISZ A;  4DBR A;  4BBS J;  2QKL B;  3KLN A;  3P7N A;  2HOT A;  3K4L A;  5LRS A;  2AQF A;  3BR2 A;  2WAF A;  3N97 A;  5K5Q A;  3BCB A;  3DLA A;  2ME6 A;  2ZKZ A;  5BMZ A;  5GPA A;  4A12 A;  4E7K A;  9ANT A;  2NS8 A;  1OCR H;  3MEX A;  3BQY A;  4KUM A;  4IKF A;  3CDI A;  2PG4 A;  4G7O F;  3GZ5 A;  1AHD P;  2LY9 A;  2QZ8 A;  4JYK A;  4ZC3 A;  2FNP A;  3AFH A;  2DA5 A;  1N75 A;  1JI8 A;  4WK8 F;  3CP2 A;  4I98 B;  4J01 A;  3IWZ A;  2CQQ A;  2R3S A;  1BC8 C;  5E3O A; 
#chains in the Genus database with same CATH homology
 5F08 A;  1H88 C;  3CCY A;  1Q1V A;  2R92 J;  4M6V A;  2EZH A;  4DYC A;  1TWF J;  2ECC A;  3HKZ N;  5IYD J;  3Q3S A;  3S15 J;  4A3I J;  3TED A;  5E3M A;  3RKQ A;  1VI0 A;  1FIA A;  3CDL A;  1HLV A;  5FJ8 J;  3LSR A;  3HEF A;  3S14 J;  2R5Y A;  2K9S A;  1AKH B;  3M4O J;  1IG7 A;  4C3I J;  1HDP A;  2JN6 A;  3S1N J;  5F27 A;  1ETV A;  1B72 B;  1WCM J;  3DCF A;  1TC3 C;  3L1P A;  2H1K A;  3RZO J;  1BA5 A;  4FCY A;  3GBG A;  5E3N A;  4Y7N J;  5DTD A;  3A01 B;  1MNM C;  1JKO C;  4BY7 J;  2M34 A;  4MFD A;  4A3G J;  2DN0 A;  2EZL A;  3CMY A;  2LD5 A;  3ZQL A;  1YRN B;  2L0K A;  1ETK A;  2TCT A;  3BG5 A;  1P7J A;  2DMN A;  4AC0 A;  3JRC A;  2HXI A;  5FKO A;  2B63 J;  1OJL A;  1Y1V J;  1ETW A;  2ELK A;  4DYQ A;  1GUU A;  1FEX A;  3HDD A;  4MO7 A;  2XB5 A;  3OOU A;  5C3E J;  4M3G A;  4XRS G;  4W1U A;  4D7N A;  2JMW A;  3I4N J;  2E2I J;  1S7E A;  2L7Z A;  4XIC A;  4M3B A;  2JWT A;  3HOV J;  1UG2 A;  3B6A A;  1RKT A;  4BBR J;  1JUP A;  1HOM A;  1RET A;  4MIM A;  1B72 A;  5DS9 A;  4DZJ A;  2EZI A;  4QTR A;  2HXO A;  1OFC X;  3VPR A;  4GFB A;  1VND A;  1IUF A;  3S2H J;  2EBI A;  5IOY A;  1B8I B;  3HOX J;  1Z0X A;  2QF7 A;  3NAR A;  3HOW J;  1X58 A;  1ZQ3 P;  3TW6 A;  1X2M A;  4RDU A;  2K9Q A;  4A3J J;  1UHS A;  2X48 A;  1MBF A;  2E19 A;  2YS9 A;  1JKP C;  1XC5 A;  3GTQ J;  1POG A;  2Y31 A;  3BQZ A;  1LFB A;  3JRF A;  1U9O A;  1BW5 A;  2JA7 J;  2O9L A;  1SAN A;  4QSH A;  4IHY A;  1JT6 A;  2Y0S N;  5FKN A;  4JX4 A;  2YUS A;  4C3J J;  3M3Y J;  1FTT A;  2LK2 A;  1LE8 B;  3IV5 A;  5EG0 B;  1FJL A;  1ZTR A;  3I4M J;  1MH4 A;  5J1R A;  3S2D J;  3BTL A;  4I6Z A;  3BG9 A;  1QPI A;  2XPW A;  2LFB A;  2LR8 A;  1K83 J;  2L9R A;  1T33 A;  2DMT A;  3NAU A;  1ZR2 A;  4JX5 A;  2ME0 A;  1I6H J;  2O7O A;  1QRY A;  3ZQC A;  3BR5 A;  2VI6 A;  1QVT A;  2GLO A;  2NOG A;  2OF7 A;  5FKL A;  1BJZ A;  1JJ6 C;  4S0H B;  1JKR C;  4IHX A;  1IC8 A;  1TWA J;  3HGG A;  1R9T J;  2FD5 A;  3ZQI A;  4A3E J;  2CQX A;  1PUF A;  2WB1 N;  2D5V A;  3PM1 A;  1WH7 A;  4XID A;  4UUS A;  2E2H J;  1JGG A;  2GM4 A;  4FTH A;  1JKQ C;  4V2F A;  2NVQ J;  4C3H J;  3A02 A;  3TP0 A;  3WHB A;  3JRE A;  5C4X J;  4DYR A;  4BY1 J;  4M3E A;  3BG3 A;  5FKM A;  3FKI J;  4XRM A;  5EGO B;  1RKW A;  2NVT J;  3BT9 A;  3LSJ A;  2R0Q C;  2QCO A;  4NDL A;  2CRG A;  4MFE A;  5IP9 J;  2X9D A;  2DA7 A;  3SJM A;  1LE8 A;  1NK3 P;  2VUM J;  5EG0 A;  2ZB9 A;  3Q0W A;  3MKL A;  2DMP A;  3O8H A;  3JRH A;  5J1Y A;  3GTJ J;  5JLW A;  2R93 J;  4D5F A;  2NVY J;  3K7A J;  3O8G A;  1WPK A;  3OSF A;  1MSF C;  4A3B J;  2DA6 A;  1MBH A;  2MG4 A;  1HF0 A;  1WGX A;  3HM5 A;  2FX0 A;  2G0E A;  1ORK A;  4A3C J;  3SFI A;  1H89 C;  2Y9Z A;  5M3M J;  2R5Z B;  1ZGW A;  2LLK A;  1MH3 A;  3G1L A;  1NK2 P;  2O8K A;  1RES A;  4JX6 A;  1JTX A;  2ID3 A;  4AUX A;  5E3L A;  2W48 A;  4UUT A;  3HBL A;  1ZR4 A;  1U8B A;  4Y52 J;  1UMQ A;  3BTI A;  4B4C A;  2JA5 J;  4G12 A;  1AKH A;  2IBD A;  4D7M A;  2MW8 A;  2GBY A;  3GTM J;  2VKE A;  1WI3 A;  4J19 A;  1RR7 A;  5M5W J;  2KT0 A;  3Q0V A;  2IEK A;  3WHC A;  1VFC A;  3A01 A;  1HDD C;  3E7L A;  1XG1 A;  4A3M J;  1SFO J;  4IHV A;  5K7F A;  1ETX A;  1ITY A;  5GP9 A;  4CYC B;  2KDZ A;  3HOY J;  1YRN A;  1APL C;  1DU0 A;  1ZKG A;  4BKX A;  4L5E A;  5IP6 A;  4LOC A;  2AO9 A;  2EH3 A;  3QPL A;  2XSD C;  5F0F A;  2K9N A;  3S1R J;  3IH4 A;  4B3A A;  5M5Y J;  1ENH A;  2HDD A;  5F0C A;  2L7F P;  1IDY A;  1G2H A;  4M3F A;  2M9H A;  4C2M J;  3UKG A;  1JJ8 C;  1MBK A;  1TWG J;  2DA2 A;  1GT0 C;  2OPT A;  1NTC A;  2WAQ N;  2EQR A;  4IEJ A;  2DA3 A;  1IJW C;  3F0C A;  5FLM J;  1MBG A;  1MSE C;  3ZQF A;  4DW6 A;  1DU6 A;  1K61 A;  3LSG A;  2CUE A;  5IYC J;  2DA4 A;  3OSG A;  2NVX J;  1IGN A;  3JRD A;  3MN2 A;  3FK7 A;  1TWH J;  3K2A A;  2X6O A;  3IH3 A;  4I76 A;  1ETY A;  5K7Z A;  3PO3 J;  3OIO A;  3BR3 A;  2XGE A;  5GPC A;  5IYB J;  3C2B A;  2HYJ A;  2R5Y B;  3B6C A;  1JTY A;  2P81 A;  5EZH A;  1B8I A;  1QVU A;  2Y30 A;  3S16 J;  4RBO A;  3G1M A;  2IAI A;  1T56 A;  1Y1W J;  2HOA A;  5F1J A;  1I3Q J;  2DJN A;  2CJJ A;  4FE4 A;  1ETO A;  2R7Z J;  3BR1 A;  4X6A J;  1U78 A;  5FKK A;  3GTL J;  4A3L J;  2NS7 A;  5EDN A;  1IRZ A;  2M8G X;  5F0H A;  1Z77 A;  2HOS A;  2XPV A;  1HCR A;  2LVS A;  1ETQ A;  1JUM A;  3GTO J;  1MBE A;  1MBJ A;  2TRT A;  4D5C A;  3DEW A;  2Y2Z A;  5FLV A;  3QPS A;  3ZQG A;  2H8R A;  3FIW A;  1U9N A;  1IV6 A;  1OCP A;  3JRG A;  1O4X A;  3LNQ A;  4EEF G;  2LKX A;  3S1M J;  2XRL A;  5EF6 A;  3H3V K;  1FIP A;  3JR9 A;  1ZK8 A;  5M3F J;  5J3L A;  4QIW N;  1JT0 A;  3LSP A;  1VF9 A;  5C4J J;  2N8G A;  2CUF A;  3HGY A;  3IH2 A;  2DTZ A;  2RAE A;  3ZQH A;  1CQT A;  1X2N A;  1I50 J;  1XS9 A;  3Q0U A;  4B1R A;  4IHW A;  3HOU J;  3MVP A;  1BL0 A;  5EGO A;  3GTP J;  3PO2 J;  2M0C A;  2JJ7 A;  3A03 A;  4BXX J;  3FIS A;  1GVD A;  3RZD J;  2VPR A;  2L7M P;  1GDT A;  2EZK A;  2MSY A;  3CQZ J;  1OCT C;  3HOZ J;  4A3D J;  2M2E A;  3S17 J;  3HB9 A;  2LTP A;  5HOD A;  4FIS A;  4FE7 A;  2K40 A;  3GTG J;  1GV2 A;  1IDZ A;  2LP0 A;  1TWC J;  4AYB N;  1LFU P;  2YU9 J;  2XGD A;  2Y9Y A;  1GV5 A;  2E1O A;  4A3F J;  5EZG A;  4MLO A;  5F04 A;  2HI3 A;  4A69 C;  4V2G A;  2E2J J;  2JA6 J;  3G1O A;  3W6V A;  3QQA A;  2COB A;  2JK3 A;  2I10 A;  2FJ1 A;  2ECB A;  4XK4 A;  3JRA A;  2R5Z A;  5K7H A;  4W97 A;  4A93 J;  2FQ4 A;  3BTC A;  1RPW A;  1D5Y A;  1H8A C;  3LOC A;  1E3O C;  1BW6 A;  3TP3 A;  2DA1 A;  3TW7 A;  1W0U A;  1P7I A;  4X1E A;  5BNG A;  4XRS A;  5IP7 J;  2PMZ N;  1W0T A;  1F43 A;  5EYR A;  1PUF B;  3BR0 A;  1A6I A;  1AU7 A;  1WH5 A;  3RQI A;  3GTK J;  5IOZ A;  2VKV A;  1FTZ A;  5C44 J;  2HQ5 A;  2ID6 A;  2AHQ A;  4UUS B;  3JRB A;  2JA8 J;  4A3K J;  3FK6 A;  4M3D A;  3BTJ A;  4DZP A;  1EF4 A;  2DMU A;  5M5X J;  1A5J A;  3D1N I;  3JRI A;  4BBS J;  2DMQ A;  2HOT A;  4HNV A;  3BR2 A;  2WV1 A;  5J1U A;  3S1Q J;  2MGQ A;  1F36 A;  2ME6 A;  4CYC A;  5GPA A;  4JP0 A;  9ANT A;  2CU7 A;  2NS8 A;  3BQY A;  3BR6 A;  4ABZ A;  1AHD P;  2LY9 A;  4JYK A;  5JLX A;  3SDG A;  5EEA A;  2DA5 A;  2XPU A;  1JUS A;  2XB0 X;  5IPA A;  3H0G J;  3ZOB A;  2CQQ A;  2XGC A;  5E3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...