4JQFA

Structure of the c-terminal domain of human telomeric stn1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
168
Chain Sequence
b'AEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 59
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2013-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jqfA02
1.10.10.980 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4jqfA01
1W5SA 1ZRFA 4AIHA 3BPVA 3HIFA 1XD7A 1S6LA 4KICA 2XAFA 3F8NA 3J81K 1WI9A 2QM3A 3SFZA 1TW3A 1J5YA 4CHUA 1L0OC 1HSTA 5LHIA 2FE3A 3ABTA 5D6FA 1LEBA 1S3JA 4CYDA 5ICFA 4A5NA 1ZG1A 4ENNA 4MNUA 3QPHA 1MJ9A 1ZAOA 3QPTA 4IRIA 2IA0A 4LGWA 1U2WA 2V1XA 4PZJA 1ZRDA 1FBQA 1IAWA 1BOAA 1TW2A 1UCRA 2MH2A 3BJAA 4HDUA 3WE2A 2P4WA 3Q9SA 5F1RA 4I01A 4A2UA 3ZPLA 3J80Z 3DP7A 2XVCA 1RIOH 3VB2A 3GF2A 2HR3A 2PLYA 1FOKA 2UXXA 5ICEA 5HOOA 3DPLC 3R0JA 1ZGAA 5D5UB 4KFCA 2CYYA 1T2KA 3BZ6A 3N97A 1Z05A 2OA4A 3LQQA 1GXPA 1ZRCA 2G7UA 4G94A 2UWMA 4A6DA 4U7BA 1T6SA 5L3GA 5AONA 3WGHA 3SQNA 5IT9K 2EA2A 2IPQX 1CF7B 4A0XA 2R7DA 1K79A 1G3TA 2PQ8A 1OPCA 4HQMA 3NQOA 1YIOA 4CDGA 4HQEA 3WGGA 1G4DA 1YQAA 1J75A 1U3EM 1SFXA 1XCBA 5DUIA 2ISZA 1HKQA 3H3UA 3I64A 2D45A 4MGRA 4ZZDA 2XAJA 1Z6RA 4LLNA 5LLQA 1YW9A 4R1HA 3CUQA 1I1SA 1X3UA 3Q9VA 1DPUA 2EV6A 4F7ZA 2E7WA 4OIRF 3MAJA 3JW4A 3O3KA 3HTSB 3RDIA 4HX4A 2OQRA 3KP5A 5K1YA 2TDXA 2QBYA 3C18A 1IN6A 5LGNA 3QP5A 3RJPA 4EJUA 5E17F 4IJAA 2ZFWA 2RV8A 3MZHA 4BAYA 3U9GA 2FNPA 1ZLJA 1YO5C 1IW7F 1U8RA 1F5TA 4L9VA 2HFHA 5LRSA 3KFWX 1GHCA 4UV9A 3BP8A 3FXRA 1RUNA 3ELKA 4LG0B 3ECHA 4KN4X 4YFXF 3NRVA 2QENA 3V8JA 3ZP5A 3M8EA 2K27A 3MCZA 5HS8A 4EM2A 2LSOA 4FX0A 4A5MA 3R60A 3HRUA 2QUFA 3F8MA 1V3FA 2J5OA 3M8FA 1J9IA 1USSA 3I58A 3TGNA 1TNSA 2A3SA 3JTGA 2A5YB 1ODDA 1O7FA 3OV8A 2KIMA 1BM9A 1XDUA 1D8KA 3ZMDA 1LB2A 4M9SA 1B6AA 4RB1A 2CSOA 1I6XA 3EQLF 2JZYA 5LBQA 2WTEA 5FFZA 5HDKA 1W7PD 1FSHA 4HYEA 4RS8A 5LEJA 1LQ1A 4KMFA 2IT0A 2P7VB 2DFIA 1ON2A 2RKHA 5D8KB 4CXFA 1G3YA 2Q0OA 4KN7X 3L09A 1SD6A 3WGIA 4RAZA 4FT8A 4HDVA 1WWXA 4EMSA 1I27A 4LB6B 4Y15A 1Z6TA 3W6KB 1KU2A 1D3YA 2E1NA 1ZLKA 4M6XA 2FMLA 3E6BA 4EV0A 5HS7A 1MJAA 2FBIA 1ZYRF 2QVOA 1DP7P 4E70A 2EV0A 4ENMA 4JQFA 4IXAA 3J80K 3MZYA 4NQWA 1ZG3A 3K69A 2ESHA 5E18F 2K4BA 4U7DA 5EEHA 2EWNA 2XROA 2UZKA 3TKYA 4ZYEA 3K1PA 2HOEA 3JSOA 2CG4A 2QZ8A 2DQLA 2BBYA 2P6SA 1PDNC 1P92A 3H3ZA 2DAOA 5TJJA 4A12A 5JFRA 2PG4A 4LK1F 1W7PB 2EFNA 2Y48A 4U0VA 4UXNA 3FMSA 3DKWA 3C3WA 2DT5A 3IHUA 2M30A 1RUOA 3LA2A 1HKSA 3TOAA 3GWZA 1YW8A 1QPMA 2L3DA 2O6GE 3ZN0A 4WXCA 5LGTA 4UNOA 3FF5A 2VOOA 1T38A 2F5EA 4UUVA 2DI3A 3GW2A 5DCMB 1R5HA 2VODA 1KYZA 4L9TA 4I7HA 5CVUA 2VC0A 2O8XA 2Z9OA 4XSZF 2DK8A 4EVIA 4G7OF 3RKWA 4P9FA 4M72A 5DCFA 3E6CC 1SFUA 4Y17A 4I0AA 4LLGF 1WSUA 4HAMA 4P5OA 4QWQA 3WU1B 1UHWA 1BJAA 2NS0A 2CWEA 3C7JA 2KIUA 3WTSC 3T8RA 1EV7A 2MD5A 3NEUA 2H6CA 1OKRA 5FGMA 2XIGA 1IXRC 5ERIA 1WJ5A 5LGUA 1LDDA 1WKMA 1V4RA 5E20A 3J7AO 1U5TB 3V7SA 2QYOA 2ESNA 1SMYF 1K78B 1O57A 2K86A 2HZTA 3LQRA 1P2FA 5F64A 2FOKA 4OIPF 4Z2YA 4KDPA 3ECOA 3LAPA 1R5GA 3ISPA 1IN5A 5HLGA 2O61A 2EFWA 3E97A 3WTUC 1QZYA 2BV6A 4CO8A 5L3FA 4I02A 2F2EA 5D4SA 4EQQA 2EJRA 1IRFA 2XAQA 3GZ5A 2EB7A 1Q1HA 1YLFA 1CF7A 4HBLA 3JTHA 1KA8A 1WQ2A 2VBZA 3FMRA 2PMHA 3FZVA 3JSPA 1OYIA 4PDKA 2L4MA 1R22A 1TQMA 1HQCA 2GXGA 4GXOA 2EFPA 4D0PA 4A0YA 5FB2A 1FP2A 1Y0UA 2NRAC 4IF4A 2W25A 2EK5A 4KIFA 5DD4A 2FRHA 4Q4ZF 5J8CA 1T0FA 3BJ6A 2P6TA 2M8EA 2V79A 2FEZA 4HV5A 3I71A 1K6OA 2MBFA 3KE2A 4HLYA 5HLIA 1BI1A 4Q47A 1J2XA 1MDMA 4G9YA 3IRRA 3RPQA 2NNYA 5JI6A 5AIQA 2IJLA 3FMQA 4RGRA 3U2RA 1KU3A 4LB5A 4DNCA 1XSXA 5D5XB 4OIQF 1H0MA 2Y75A 4AD9A 1BC8C 2OBPA 4XSXF 4G7HF 5D8LB 1YS6A 4Q5SF 1O3QA 2VBWA 3GXOA 4LG0A 2FQ3A 4GO1A 5CVIA 5BOXA 4RB3C 3TDUC 3KP6A 2WC2A 3GFMA 2A6HF 1F1ZA 1SD4A 3CO6C 3TDZC 1KQ8A 3V8KA 4G8XA 3VOEA 4WCGA 1DPRA 4EJTA 3IL2A 3ML6A 4MHGA 2DPDA 2GWRA 1P4WA 2V1UA 4O6JA 3W6JB 2CFXA 4RAYA 1FZPB 3BWGA 4IVNA 1XSVA 2EV5A 1EH7A 1R58A 4OINF 3MQ0A 3EETA 3F6VA 3IC7A 2MLGA 3D5LA 4Y13A 2Q2EA 1RNLA 2KKOA 2CW0F 3PQKA 1ZG5A 1LVAA 3TQNA 2PI0A 3WTVC 5H20A 2IP2A 2KJBA 1TNTA 3BDDA 1BC7C 1UB9A 2J5PA 4L5IA 1XGMA 2DO7A 1J59A 4WF2A 1XDSA 1HW5A 4EJVA 2HEOA 4L0YB 1KU9A 3FXUA 4B09A 3CJNA 1FY7A 1FBUA 2PJPA 1FP1D 1P4AA 4YIFA 1OYYA 4N9IA 3HRMA 1TQPA 4EM0B 5HLHA 4BHPA 1IN7A 4CZZA 3ZMTA 1UFMA 3ABUA 2QQ9A 5ILSA 2HWVA 3GX4X 1G3WA 3E5QA 2W85A 1RZ4A 2Z33A 4H0EA 4M6YA 2OZ6A 5DD8A 1ULYA 3WTYC 3G3ZA 2H6BA 3DEUA 5D5WB 1YS7A 3REOA 4IRHA 3I59B 1BI0A 4KT5C 3K1NA 2PFBA 4LLLA 1R7JA 1FYMA 4XLNF 3KP4A 4HX8A 1STZA 2HKXA 3KP7A 1HKTA 3B73A 2L4AA 5TRDA 3WTTC 3RYRA 4IHSA 5HVQC 2XUBA 2V6CA 1IXCA 1PUEE 5E8GA 2GXBA 4M74A 2DTRA 3R0AA 2A68F 4OIOF 1TTYA 2M87A 2STTA 4BH9A 1FYKA 3DPTA 4GCVA 1R23A 3FXQA 4IHTA 3F23A 3WE3A 3S2WA 3HSEA 3O2PE 3GEZA 1MJBA 2ZBKA 3M1EA 5DCMA 1OR7A 4M73A 1S29A 3FHZA 2ETHA 3BY6A 1DDNA 1G3SA 1SMTA 2IA1A 3HHHA 1J0RA 4R79A 2XKPA 5D5VB 2FNAA 2Y0MA 3GVAA 3GYHX 2VT3A 1LJ9A 2HYGD 4L18B 3GUDA 4L0ZB 4M9XA 2YX7A 5CVVA 1P6RA 2XKOA 3ULQB 2GAUA 1MZBA 2LDUA 2ZNYA 1XMKA 1U78A 1YFHA 3EUHA 2EFQA 2VC1A 3R4KA 4WXDA 3LA7A 2HQNA 2ZKZA 4ENKA 4KYWA 4CICA 2HGCA 5E1WA 3LA3A 4BXUA 4KIBA 4ZH4F 4IRGA 2ZXJA 4BQAA 4YFKF 5LEKA 5J6XA 1LEAA 1MKMA 2O3FA 2PBIA 1U5TA 1H9GA 4OOIA 1K78A 2Z5UA 4I0BA 3KEQA 3FWEA 4LFUA 2IW5A 1R00A 4LJZF 3RKYA 4ZZLA 2XAHA 4B8XA 5FO5A 2ZNZA 1HW2A 3ZMUA 4U0YA 3OOPA 2EA4A 1A04A 1LDJA 3MWMA 1XSDA 5K5RA 2D1HA 1TQIA 3SHFA 4G6DA 3KZZA 1Z1DA 2DW4A 2V9VA 2VT2A 4YFNF 4ESJA 3JAMK 1JHFA 4JK1X 3RIRA 1O3TA 5LRRA 3I4PA 4EGYA 1SD5A 4HLXA 3LWFA 2QWWA 2ZMEB 4AIJA 2G9WA 4I98B 5ICGA 2ADUA 4I2OA 3PQJA 5H6RA 1PP7U 2K7LA 3KLNA 3WU0A 3QOPA 1U6GA 3R61A 1ZARA 2BYVE 4HW0A 3WG9A 3E5XA 1EH6A 6PAXA 1I5ZA 1XGSA 4UVCA 2L02A 5KVRA 3KLOA 3IKTA 4TV7A 3V4GA 2M1BA 2VBXA 3DFGA 2O0YA 1XGNA 3EDPA 1FX7A 5CVRA 4ETSA 2FU4A 2FMYA 1BIAA 5AIPA 3E6MA 3IRQA 1TLHB 1QO0D 1QBJA 3HRSA 2VXZA 3ROUA 3F8CA 4G6QA 2GQQA 4P9UA 3HUGA 1R1TA 2YR2A 3P9IA 3L7WA 5LHHA 4FX4A 4OMYA 4P96A 4S05A 3I54A 1W4MA 4PGHA 1KQ0A 2YX4A 4LMYA 5DEQA 2NNNA 3CDHA 1KYWA 1P4XA 3V7RA 4HOBA 1SAXA 1O3SA 3VODA 3DF8A 4O3MA 1I1GA 4IPAA 4QLCU 4RB2C 2GIVA 2ZO4A 1XGOA 3HSRA 1BI2A 3TO7A 1H9TA 1FBSA 1XB4A 4XRFA 3ZMZA 4UV8A 3TO6A 4L9JA 1JGSA 4MTDA 3T8TA 5K5OA 2NYXA 3F8FA 4AWXB 2OD5A 1O7LA 2ZJ2A 3KP3A 4UVBA 1B9MA 4MQ9F 5JHUA 5ILVA 4XBFA 1YTYA 4M71A 4OMZA 4EM1A 4EGZA 2ACJA 1YG2A 1JHHA 4RGSA 1TBXA 2HKOA 4OU0A 5ILUA 2LF7A 3EYIA 1KU7A 2F5CA 2CO5A 3RI4A 2O03A 4ASNA 1T98A 2X0LA 5DV5A 3WTXC 2OQGA 1OYWA 1MGTA 2P8TA 1F4KA 4GYGA 2A69F 5KK1A 1DUXC 4NHJA 1ZN2A 5FLXZ 1U5TC 5CVJA 1MD0A 2XASA 3BPXA 2K4JA 1GXQA 2XGXA 4ZYHA 4P55A 4GGGA 2P5VA 3I53A 4Q48A 5D4RA 1LNWA 2L01A 1R1VA 2VN2A 2CGPA 1IRGA 2H27A 2DPUA 5BPDA 3PFIA 1BIBA 1B9NA 3DQVC 2QQBA 3VEPA 2HDCA 2R7FA 2FBKA 2V1DA 3H92A 4GYIA 1KQ9A 3E3VA 5ICCA 3I59A 3T5XA 1O3RA 2FA5A 4K2EA 4UHTA 3T0YA 4N9HA 5JR3A 3K9TA 4ON0A 2FF4A 3DXJF 3KP2A 1HXDA 2JPCA 2VE9A 3F8BA 3HTUA 4A6EA 5H6QA 2FBHA 1E2XA 3SXYA 1FC3A 2QLZA 2RC4A 4CGZA 2JSCA 5EEGA 3JAMZ 1S7AA 3F21A 1T39A 3GZ6A 1FLIA 3L00A 1FPQA 1EH8A 3FM5A 2YU3A 3ZN1A 2Z3YA 2RNJA 3F72A 3P7NA 2RN7A 1F9NA 2IRFG 2C6YA 3QAHA 3FX3A 3C1DA 2ELHA 4BHCA 1YW7A 3TO9A 1MDMB 2A07F 1D5VA 2VE8A 1NHAA 2MH9A 5F6FA 3LAJA 3RTRA 2F5FA 2P5KA 2H09A 4BHBA 2DBBA 2HS5A 3B02A 2GA1A 4MTEA 2E7XA 2BGCA 3QRFF 1B59A 4HV6A 3SZTA 3O6BB 4HA8A 3HHGA 4YG2F 4AIKA 2OAZA 4KA4A 2GZWA 4WX9A 2W57A 4ESFA 2DK5A 5L3BA 1R36A 3LSTA 4WK8F 2LF8A 4A0ZA 5FFXA 4JBAA 2RDPA 3WTZA 4PGGA 1UHMA 1L3LA 4LD5A 5CYVA 4MQVA 1USTA 5IT3A 3G73A 3IKVA 3E6DA 5E8IA 3K0LA 2PMUA 1W7PA 4HF1A 1C0WA 3M7GA 4HZFA 2MC3A 4G7ZF 2KJCA 3TOBA 2K02A 5J8FA 2BE5F 1AOYA 1E17A 5BMZA 4KMUX 3K2ZA 4WXHA 4WWCA 3U1DA 1B1BA 3IWZA 2XHKA 4RGUA 2VBYA 4AVPA 1S7OA 4KIGA 2JPBA 3QU3A 1FYLA 3CUQB 2B0LA 2IVMA 4N0BA 5A2QZ 1S8NA 1YYVA 5LHGA 4DQ2A 3VFZA 1W5TA 2F5DA 3CLOA 3MFKA 1IZ1A 2WV0A 2LKPA 3F6OA 1PP8F 3WODF 2OZUA 5JVTA 3ERED 2STWA 4HF0A 4MEXF 4RB0A 1WRJA 2QBYB 2KRFA 3V8LA 5D6EA 3HYIA 2COMA 5E1ZB 1FSEA 5E1XA 3J81Z 1ON1A 4HF2A 5DUKA 2VOPA 4ZYDA 1G6NA 4EJOA 3M9AA 2ZMEA 1ONVA 4L9NA 4ESBA 2YSRA 1ZREA 1FNNA 1K7AA 2P7CB 3ZQ7A 1D8JA 3L2CA 2L54A 2PN6A 5CJ9A 3P9CA 3CTAA 2E1CA 3I5UA 2NAZA 2DLLA 5CLSA 1HSJA 5L3DA 2JT1A 2D2WA 1QNTA 5FLXK 1SFEA 1Z91A 2WWYA 2EFOA 2RGVA 3RPUA 2A6EF 3V7CA 5L3EA 4HX7A 3N4MA 1B4AA 3R6SA 3SZPA 3P9KA 1JE8A 4FHTA 4U0WA 1SD7A 3QP6A 2D1VA 2UXNA 3LFKA 5FD5A 5ED4A 3I0TA 2JTVA 2P5LC 2ZCWA 5IT9Z 1XCVA 3IWFA 2YPRA 2AXLA 5HDNA 3KZYA 3T1BA 4LK0F 3CUOA 4U88A 2QQAA 3BROA 3COAC 4UVAA 3ZMVA 1ZH5A 1IN8A 1BBYA 3AAFA 4R8HA 3E5UA 3RKXA 1FT9A 4S04A 2MLKA 1IN4A 1IF1A 1GVJA 1REPC 1ZHFA 1QZZA 5BQTA 5K5QA 3K1MA 3CUQC 3CO7C 1HW1A 2W24A 3GFLA 1AWCA 2KIFA 2Z99A 4M9ZA 1XN7A 2Q8KA 4XLPF 3GFJA 5HDGA 1R1UA 4BYYA 1Z9CA 3HSFA 2A61A 2XV4S 1QGPA 4YIIA 2OU2A 5BPIA 3HOSA 4BNCA 2MA3A 1BI3A 2FXAA 1RI7A 2ISYA 1JXSA 3BJOA 2RVCA 4ENJA 2DU9A 1BN5A 2CQKA 3GO5A 2HYFA 5BS6A 1VTNC 1QQIA 1Z7UA 4RGXA 5HS9A 4EJWA 3EYYA 2M5WA 4MEYF 2BEOA 3RYPA 3HOTA 1IXSB 3HRTA 2AS5F 3Q5FA 3L9FA 2PEXA 2RQPA 4ZYGA 3GLXA 2HTJA 4KUMA 4KNYA 1XMAA 1ZGJA 2XRNA 3ZMSA 3KETA 5FD6A 5L3CA 2IA2A 2JRTA 3FM3A 1J7KA 2W84A 2H94A 3WTWC 3DV8A 2X4HA 3GFIA 2XAGA 1LDKB 3MEXA 5DDGA 3D0SA 3F22A 1IUYA 4I09A 1KGSA 3BOQA 3KCCA 3QU6A 1CGPA 2HTSA 1OMIA 2G7HA 4PCQA 2VONA 4NB5A 5DYMA 1HBXG 1FWZA 5A2QK 3F3XA 4O5VA 2DQRA 2GA2A 2R3SA 4L5JA 2FSWA 2HQRA 2M45A 3KEOA 2LNBA
chains in the Genus database with same CATH superfamily
1WI3A 1W5SA 3S3MA 1ZRFA 2K85A 4B1RA 4AIHA 3BPVA 3BG6A 3HIFA 2HOSA 4M6VA 3S2HJ 1WH7A 2JUCA 2BHYA 1XD7A 2VKVA 3JREA 1S6LA 4KICA 2OV7A 1Q1VA 4RDUA 2PMZA 2XAFA 3F8NA 3J81K 1WI9A 5EGOB 2F5VA 2BY1A 1JGGA 2QM3A 1Y8RB 4RAFA 1TW3A 1J5YA 3SFZA 4CHUA 2ZMEC 1L0OC 1MBKA 3S15J 1HSTA 5LHIA 2FE3A 2EQRA 3ABTA 5D6FA 5GP9A 1S3JA 1LEBA 4CYDA 5ICFA 4A5NA 1ERDA 1X1DA 4AYBA 1ZG1A 2EZKA 4ENNA 4MNUA 3FISA 1R4MB 3QPHA 1MJ9A 1ZAOA 3QPTA 3RKQA 1T95A 1IUFA 4IRIA 2F48A 2IA0A 4LGWA 1U2WA 3EUAA 3TEDA 2V1XA 4PZJA 1ZRDA 4IKFA 1FBQA 1YOVB 1IAWA 1BOAA 1TW2A 1UCRA 2MH2A 3ASNH 5FKMA 3BJAA 4HDUA 3WE2A 3H0DA 2EINH 5HNHA 2P4WA 1Y39A 3E1SA 3Q9SA 5F1RA 4I01A 5E3OA 1UJ8A 3HOXJ 4A2UA 1IDYA 3ZPLA 3J80Z 3DP7A 2R7QA 2JWTA 2XVCA 4A3LJ 3OYCA 2BXYA 1RIOH 3VB2A 1VQ5I 1JKOC 1ETXA 3PIOF 1DGRM 2VB6A 3GF2A 2NVTJ 2HR3A 2E2IJ 2Y0SN 3HJEA 5J4VA 4NNJA 1JUSA 2Y9YA 5HODA 1FMWA 1U9NA 2PLYA 3QPSA 1FOKA 2LBFB 2UXXA 5ICEA 5IY5H 5HOOA 1VF9A 3DPLC 1NH3A 3R0JA 1D0XA 1ZGAA 1D1CA 3L2QA 5D5UB 4KFCA 2CYYA 3FXOA 3CCRI 2E1OA 1T2KA 3BZ6A 2ICWG 3N97A 5FKNA 1Z05A 2OA4A 3LQQA 1D0ZA 1GXPA 3KX2A 1ZRCA 2G7UA 2DMNA 1UG2A 3CF5F 3HOZJ 4G94A 2UWMA 4A6DA 4E7KA 4U7BA 1T6SA 2PMZN 1VQLI 3CJTB 3DEEA 5L3GA 5AONA 3WGHA 3SQNA 5IT9K 2EA2A 2IPQX 2EILH 2H8RA 3BG9A 3OIOA 5C3EJ 1K4TA 1CF7B 2HNHA 3LNQA 3IH3A 2KIQA 4A3MJ 2E2JJ 4A0XA 2LY1A 3JRDA 4C9YA 2R7SA 2I10A 4AYBN 1OJLA 1P9QC 2R7DA 1MMNA 4BL0B 1K79A 2OUMA 3K10A 4RAGA 1G3TA 2PQ8A 1OPCA 4HQMA 2OJED 2ZXWH 3NQOA 2R7ZJ 1Y0NA 5TGTA 1YIOA 3BQZA 3K4CA 3LSPA 2DA3A 4CDGA 3CC2I 4HQEA 3WGGA 1G4DA 1LVKA 1SAUA 1YQAA 2GOXB 1TT5B 1XTAA 2IGNA 4CYCB 1J75A 1QZEA 1HDDC 4IHVA 3FBNB 2NVYJ 2BVLA 2K9MA 2WAFA 1U3EM 1JKRC 2CUFA 1SFXA 1XCBA 5DUIA 1FOYA 2ISZA 3FXKA 2HVRA 4BQNA 3M1CA 1HKQA 3H3UA 3I64A 2D45A 4IQ4A 4MGRA 2F6CA 4ZZDA 2XAJA 1Z6RA 4LLNA 5LLQA 2E5NA 3G71I 1YW9A 4R1HA 3CUQA 1B8IB 1I1SA 2XC7A 1X3UA 4A3DJ 3Q9VA 3S1NJ 1DPUA 2ELJA 2EV6A 2TCTA 2A6TA 4KJZA 2X51A 5KCMA 4F7ZA 4EEFG 2IBDA 2E7WA 4B48A 4OIRF 3OL4A 3GTMJ 2QGUA 2M7BA 1SC7A 1YIJI 3HXLA 3MAJA 2DA4A 2HXIA 3JW4A 3O3KA 2JK3A 3HTSB 2LYCA 2W7NA 3RDIA 4AVZA 1Z77A 4HX4A 1HCRA 2OQRA 1X58A 3KP5A 5K1YA 2TDXA 2QBYA 3C18A 1IN6A 3D1NI 5LGNA 3QP5A 3RJPA 4EJUA 2M4GA 5E17F 5BNGA 2IS4A 4IJAA 2ZFWA 2RV8A 3DU5A 1N75A 2DJIA 3MZHA 3LFUA 4BQOA 4BAYA 3U9GA 2FNPA 3H35A 1ZLJA 3ZGKA 5E3MA 1X3WB 3OWTA 1YO5C 1IW7F 1VQMI 1U8RA 3QODA 1F5TA 4L9VA 2R5ZA 2HFHA 4ZDPA 2NS8A 2HOTA 5LRSA 1YE9A 3KFWX 1GHCA 4UV9A 1H88C 3BP8A 3FXRA 2F4OB 1RUNA 3ELKA 4LG0B 3ECHA 4KN4X 3PO2J 3C2BA 1WGXA 4HG2A 2V9PA 3NRVA 4YFXF 2VIXA 4PJMA 3CJQB 2QENA 3WU2C 3V8JA 2Y30A 3PSFA 4AUXA 3ZP5A 4X6AJ 1TWGJ 3M8EA 2K27A 2LC2A 4IHYA 4B44A 3MCZA 5HS8A 4EM2A 3KYLA 2DN0A 1HC8A 1LFPA 2DA6A 2LSOA 4FX0A 4A5MA 3DWLE 3GTKJ 3S1QJ 5JLXA 2ZJRF 2ZFUA 3R60A 3HRUA 2QUFA 3F8MA 1V3FA 2J5OA 3GCMA 3M8FA 5HLTA 2XPVA 1J9IA 1USSA 3I58A 3TGNA 1TNSA 2A3SA 3JTGA 2A5YB 1ODDA 3DTKA 4XIDA 2I5UA 1O7FA 3OV8A 2KIMA 1WHUA 3JCUC 2PJRA 2DMUA 1BM9A 2VASA 1XDUA 1D8KA 2DMPA 2XSDC 3ZMDA 1Z21A 1LB2A 1SANA 5HNFA 3I4NJ 4M9SA 2E1MC 1B6AA 4RB1A 4NUBA 2CSOA 2KLOA 1I6XA 4FQGA 2XDVA 3EQLF 4XKCA 3OS2A 1FTZA 2JZYA 2Q2EB 2QF7A 3DEWA 1RR7A 5LBQA 1MSFC 3W2WA 2WTEA 5FFZA 5HDKA 5EG0B 4HPQA 4FE7A 1W7PD 1Y6IA 1FSHA 3GZNB 4HYEA 2HVSA 1IC8A 4RS8A 3FXMA 4BEHB 5TISC 5LEJA 1LQ1A 2P7VB 2IT0A 4KMFA 2JA7J 2DFIA 1ON2A 2RKHA 3HZJA 5D8KB 4CXFA 1X1BA 2H1KA 1G3YA 4W1UA 3L2UA 3HKZN 2Q0OA 3OIQA 1SEUA 2Y31A 3OL3A 4KN7X 3L09A 1SD6A 3WGIA 2MABA 2VXDA 4RAZA 4FT8A 4G12A 5IOZA 3CDLA 4HDVA 1WWXA 4EMSA 5FKLA 1I27A 1T0FC 2WAQA 3I9V2 4LB6B 3QPLA 4Y15A 3K4BA 1Z6TA 3W6KB 1KU2A 1D3YA 2E1NA 2CV0A 1ZLKA 1GT0C 4M6XA 2FMLA 4BJTA 1E3HA 3E6BA 4EV0A 5HS7A 1MJAA 2X1EA 1JUPA 4E7IA 2FBIA 1ZYRF 4HSTA 2QVOA 1PUFB 1DP7P 2NS7A 4E70A 2EV0A 3PL8A 1QHHD 1BA5A 4ENMA 4V2FA 4JQFA 2CW8A 4IXAA 3J80K 1VQOI 2JQ7A 4OAYA 3MZYA 1DU6A 1S9HA 4NQWA 1ORKA 1ZG3A 3DPUA 3K69A 5GAHJ 2ESHA 4CCOA 5E18F 2K4BA 4A3IJ 4U7DA 1U8BA 1YITI 1IV8A 1NTCA 5EEHA 2DYSH 3CCMI 2EWNA 2XROA 2UZKA 1HA8A 2WA0A 3A0HC 3VYUB 4ZTJA 3TKYA 4ZYEA 3K1PA 3DBHB 2HOEA 5C4JJ 3JSOA 2CG4A 2QZ8A 3G6EI 3OOUA 2NVUB 2DQLA 2DTZA 1BW6A 2BBYA 4IX7A 4F55A 2P6SA 3A01A 1PVEA 1P92A 1PDNC 3H3ZA 2DAOA 1LFBA 5TJJA 1RKWA 4A12A 4NDLA 3S93A 5JFRA 1XPXA 1B72B 1MMSA 1JTXA 9ANTA 4E7ZA 2PG4A 4UB8C 4LK1F 1W7PB 3MMYB 1UAAA 3B6AA 3FXLA 2E2HJ 2EFNA 2Y48A 4U0VA 1RC9A 2ME6A 2DOFA 5JHFA 4UXNA 3KYDB 1X4OA 2FUG2 1VQ8I 5IP9J 3FMSA 2WAQN 3DKWA 5F04A 3C3WA 2DT5A 1YRNB 3IHUA 1WCMJ 2M30A 1RUOA 1WJDA 3LA2A 1HKSA 3ZQQA 2LRDA 3TOAA 3JRBA 2L2OA 2KQRA 3GWZA 3OS0A 3H5RA 5DM6F 2CV2A 1YHQI 1IV6A 3ABMH 1YW8A 1QPMA 2ELKA 1RESA 2KISA 2L3DA 2E5ZA 3ZN0A 2O6GE 4WXCA 4F52A 5LGTA 1SFOJ 4UNOA 3CMEI 3BR5A 1Z3YA 3C2HA 1QA6A 3FF5A 5EZGA 2DA5A 2VOOA 1AHDP 1YX3A 1O4XA 2VUMJ 1FMVA 1T38A 2F5EA 4UUVA 2IAIA 2DI3A 5LD2C 3MZ8A 1DQUA 3GW2A 3VYRB 5DCMB 1OFCX 3WHBA 3TP3A 1TP4A 1R5HA 2L7ZA 4F3QA 2VODA 1KYZA 4L9TA 1IO2A 2OCCH 4UUSB 1A5JA 1F43A 4I7HA 2AQFA 2XF6A 4ITVA 5CVUA 1QVTA 2VC0A 2O8XA 2R7RA 4W97A 1BR1A 2KT0A 3HL2A 2Z9OA 4XSZF 4HSRA 2HZDA 2DK8A 2LK2A 4EVIA 3A1YA 4G7OF 3RKWA 4P9FA 4M72A 5DCFA 3CCSI 4KT6A 1FOWA 1V5GA 2E60A 2K40A 3E6CC 1SFUA 2EZHA 4Y17A 4I0AA 4XL9A 2GOMA 3M3YJ 4LLGF 1WSUA 2GLOA 5EGOA 5LFAA 1YJWI 4NC6A 4XLAA 4ZDLA 4RMNA 4HAMA 1Y1WJ 4P5OA 4QWQA 3WU1B 3VWBA 3OYGA 3ZXSA 1UHWA 1TZLA 1BJAA 2NS0A 2ECBA 1ETVA 4XOTA 3MKZA 2CWEA 3HC7A 3C7JA 1GLNA 5E3NA 2KIUA 4IOCF 1Y8QB 3WTSC 3ABKH 1U0JA 3T8RA 1EV7A 2MD5A 3GTJJ 3NEUA 2AXTC 1RETA 3FKIJ 2K9SA 2H6CA 4XN0A 1OKRA 3PSIA 5FGMA 5IYDJ 4BBSJ 3BC8A 2XIGA 1IXRC 5ERIA 4D7MA 4F92B 3CD6I 3IUOA 4EATA 2LVSA 3BCAA 4MLOA 4A3BJ 1WJ5A 2V6EA 5LGUA 3GTQJ 1LDDA 1GV5A 2GXAA 1WKMA 1V4RA 5E20A 3J7AO 2R7VA 1U5TB 3V7SA 1P7IA 2QYOA 2ESNA 4PSXA 2OTLI 3RSNA 1SMYF 3OYJA 1JKQC 1K78B 3MKLA 2EH3A 1O57A 3CMMA 2K86A 2H1LA 2HZTA 3LQRA 1P2FA 5F64A 3NAUA 2LBFA 3LOCA 2FOKA 3OSGA 3K2AA 4OIPF 4Z2YA 1K83J 3ECOA 3LAPA 1R5GA 4XKBA 4KDPA 3AG3H 3ISPA 3FIWA 1MBJA 3S1RJ 1IN5A 5HLGA 3SDGA 2R0QC 2O61A 2EFWA 3E97A 3WTUC 3GTOJ 5FRMA 2Y2ZA 4UB6C 1QZYA 2BV6A 4BE0A 4IHWA 2ZXIA 4CO8A 3ZQHA 5L3FA 2IGMA 2OC6A 4I02A 2R5YB 2F2EA 3VPRA 2CV1A 5D4SA 4EQQA 2EJRA 3BTIA 1IRFA 1ETWA 3A02A 2LTPA 2XAQA 2CUZA 1D0YA 3GZ5A 2VJ5A 2DMQA 1YI2I 1W36D 3A4CA 2EB7A 4Y3OA 2LY2A 4NBQA 4B3XA 2MFZA 1Q1HA 1YLFA 1CF7A 2AO9A 2KZVA 4HBLA 3JTHA 1KA8A 1WQ2A 4D9JA 2X1DA 2VBZA 3FMRA 3O8GA 2PMHA 1QU3A 3FZVA 4OWRB 3JSPA 1WJAA 1OYIA 2K3PA 1EJ9A 1G8XA 3WHCA 4PDKA 3S3NA 2L4MA 1R22A 1TQMA 1HQCA 3MKYB 4D5FA 5FROA 2GXGA 4GXOA 4CYCA 2EFPA 2KFDA 4D0PA 4A0YA 3TP0A 2EIJH 1OR7C 2DA7A 5FB2A 1FP2A 1Y0UA 2NRAC 2MC4A 5FKKA 2LKXA 4IF4A 4XRSA 2W25A 4DJAA 2KZGA 2EK5A 1D5YA 4KIFA 2IS1A 4QSHA 2LOOA 5DD4A 2FRHA 3VYSB 5J8CA 4Q4ZF 3NARA 1T0FA 2A5WA 1WZ2A 3BJ6A 4HNVA 1HLVA 2P6TA 1B8IA 2HI3A 2M8EA 4M3FA 2V79A 2FEZA 1LPQA 4HV5A 1V5EA 4BACA 5GAEJ 3I71A 4JX5A 1I3AA 3WG7H 2GM4A 1K6OA 2MBFA 5GPAA 4HNTA 3BZCA 3KE2A 3CCVI 4HLYA 3A2KA 5HLIA 1Z0XA 4IO9F 1BI1A 5IYCJ 2Z2SB 1R5ID 4Q47A 1J2XA 2RREA 5EF6A 2VQLA 1MDMA 4G9YA 3IRRA 2JRMA 3RPQA 4AU7A 2O8KA 1XX5A 2NNYA 5JI6A 3EPZA 5AIQA 2COBA 2IJLA 3FMQA 4RGRA 3U2RA 2V4JC 1KU3A 1Y1VJ 4LB5A 4DNCA 1XSXA 5D5XB 5C44J 4OIQF 3HUGB 1H0MA 3BT9A 2Y75A 4AD9A 3OY9A 1BC8C 1MMGA 4JX6A 2OBPA 4XSXF 4G7HF 5D8LB 1YS6A 4Q5SF 4F91B 4KITB 2CJJA 1O3QA 2HDDA 5KAIC 2VBWA 3HBLA 3GXOA 1XC5A 5GPCA 1R71A 2XPWA 4GDFA 4LG0A 2FQ3A 4GO1A 5CVIA 5BOXA 4XNFA 1ITYA 5M3MJ 4RB3C 3TDUC 3KP6A 2WC2A 1BR2A 3GFMA 2CS3A 3K70C 2A6HF 1F1ZA 1SVLA 3ZRGA 4XRMA 3OYLA 1JKPC 3BR6A 1MIJA 2VKDA 1SD4A 1ZQ3P 3JRIA 1T08B 3CO6C 3TDZC 1NG7A 2EPFA 2MG4A 1KQ8A 3V8KA 4A93J 2Y69H 4G8XA 2WADA 3VOEA 2R93J 4WCGA 1DPRA 1P7JA 1LKXA 3HEFA 3PUFA 4EJTA 1WJBA 3ML6A 3IL2A 4MHGA 2DPDA 3ABLH 2CMPA 3BCBA 3CLQA 3PFYA 1I6HJ 2GWRA 1P4WA 3ZQCA 2V1UA 1BL0A 2CFOA 4O6JA 1FEXA 3W6JB 2CFXA 4RAYA 4FCYA 4Y7NJ 3IV5A 4XMYA 1TT0A 4DBRA 1BOBA 1FZPB 1EA3A 3BWGA 3PUBA 4IVNA 3AL0C 1S72I 2CU7A 3P5JA 1XSVA 1YX5A 1A35A 2EV5A 4QTRA 1EH7A 1R58A 4OINF 3MQ0A 3EETA 2X1CA 3F6VA 3BR0A 4PUSA 1QVUA 4BE2A 3S3OA 3IC7A 4M3DA 2MLGA 3OYEA 2K5CA 5F08A 2M2EA 4CCLA 3D5LA 1DP3A 4Y13A 2HDWA 2Q2EA 4BY1J 1RNLA 2ZSHB 2KKOA 3S8PA 5EG0A 2CW0F 4ZC3A 3PQKA 1ZG5A 4DW6A 1LVAA 4BEHA 3CDIA 2E36A 2MYSA 2XF7A 1VQ4I 3TQNA 2PI0A 2LH9A 3H5AA 3WTVC 5H20A 1A36A 1TC3C 1LFUP 1JT0A 1IG7A 4XLCA 2IP2A 4D5CA 2IEKA 2KJBA 1TNTA 3BDDA 1BC7C 2DMTA 2NOGA 4XOPA 1WPKA 2MGQA 1UB9A 1GVDA 2J5PA 1HOMA 4M3BA 1EKEA 4L5IA 1BJZA 2JUGA 1XGMA 3CESA 2DO7A 3KPHA 1MH3A 4FETA 2XGCA 3S32A 1J59A 4WF2A 1XDSA 1HW5A 4EJVA 2HEOA 3BQYA 4L0YB 1KU9A 1Z7LA 5E3LA 3FXUA 4B09A 1X1AA 3CJNA 4BS9A 1FY7A 1FBUA 3CC7I 2W1OA 2PJPA 5IP7J 4XLHA 2KRHA 1PUFA 1FP1D 1P4AA 4YIFA 2BY2A 2EBIA 1OYYA 3S17J 4N9IA 4ZDOA 3HRMA 4IOAF 1TQPA 4EM0B 2L9RA 5HLHA 2BY0A 1ZKGA 1SVMA 4BHPA 4PJ0C 1IN7A 4CZZA 3HGYA 3SDBA 3ZMTA 1UFMA 3ABUA 1X2MA 2QQ9A 3TBIA 5J1RA 5ILSA 2HWVA 1K4SA 4DOZA 2DOEA 3GX4X 1X4PA 1G3WA 3E5QA 4H4KC 2W85A 2HVQA 2QSGX 1RZ4A 2XAUA 2Z33A 4H0EA 4M6YA 2DODA 2OZ6A 5DD8A 1N77A 3BR1A 1ULYA 2K9QA 4CZCA 3WTYC 3G3ZA 4DBQA 2H6BA 3DEUA 4E6KG 2I8DA 4N4OB 1M1EB 5D5WB 1YS7A 4PJJA 4IRHA 3REOA 3MN2A 3I59B 4Z6YA 1BI0A 4KT5C 3K1NA 3J7YJ 2PFBA 2WV1A 3G1OA 4LLLA 1MBEA 4E7LA 1R7JA 1B72A 1QRYA 1YJNI 1VQKI 3DTEA 5GAGJ 2EIKH 2HPMA 1FYMA 4XLNF 3KP4A 2EZIA 3BTJA 4HX8A 3PO3J 1STZA 4BJ6C 2HKXA 3KP7A 1WJEA 4XR6A 1HKTA 3B73A 3ESWB 2L4AA 4RM3A 2CW7A 3H36A 1MBHA 4QPOA 1FIPA 5TRDA 3D5SC 3WTTC 4HEA2 3RYRA 4IHSA 5HVQC 3OYAA 1YRNA 3CCUI 2XUBA 2V6CA 1IXCA 2NOJB 1PUEE 1X2NA 1GUUA 3OMYA 2P0WA 3AFHA 5E8GA 2GXBA 2R7UA 2L9NA 4M74A 4BUPA 1W5CC 3HPHA 2DTRA 3ONQA 3R0AA 3HOUJ 3FHNA 2DDAA 5F0FA 3HOYJ 2KRCA 5IYBJ 4A3EJ 2A68F 2BY3A 1RR8C 5DTDA 2M7AA 4FISA 4OIOF 1TTYA 2M87A 2JA8J 2STTA 4BH9A 1FYKA 5H2FC 4LIUA 3DPTA 4GCVA 1RRJA 1R23A 3FXQA 4IHTA 3ZQFA 4PK4A 2KP6A 3F23A 4XKVA 2LREA 2ZC2A 5DS9A 3WE3A 1H89C 2RQQA 3S2WA 3HSEA 3O2PE 3GEZA 1MJBA 2ZBKA 3M1EA 5DCMA 3GTGJ 1OR7A 3KEYA 4M73A 1S29A 5B1BH 1ETQA 2R4GA 3FHZA 3OYDA 2ETHA 3BY6A 4RLFA 1DDNA 4CUGA 1G3SA 1SMTA 2IA1A 2V9KA 4F93B 3HHHA 1J0RA 3BZKA 2QEXI 2UUZA 4I76A 4C3HJ 4R79A 3L2WA 2XKPA 3D5RC 5EYRA 2M3AA 4AC0A 2L7KA 1LUJB 5D5VB 3UKGA 2FNAA 4BKXA 3F9KA 4NC7A 4DZPA 2Y0MA 3E7LA 3S1MJ 3GVAA 2JVHA 3GYHX 2VT3A 4C2UA 1LJ9A 2HYGD 1R6RA 3HPGA 4L18B 3GUDA 4L0ZB 4M9XA 2YX7A 5CVVA 1P6RA 2JJ7A 2XKOA 2L7MP 3A03A 3ULQB 2GAUA 1MZBA 3ASOH 4XK4A 2LDUA 2LG4A 2ZNYA 3A0BC 3GTPJ 1XMKA 3H9JA 1U78A 1YFHA 1VZ0A 3EUHA 4E7JA 2EFQA 2VC1A 3R4KA 5J3LA 1W1WE 4WXDA 3LA7A 1TWHJ 1I39A 2HQNA 2ZKZA 4ENKA 4LOCA 5E79C 4CICA 4KYWA 2HGCA 2OPTA 5E1WA 3LA3A 4BXUA 4KIBA 1VNDA 1XG1A 5F27A 4ZH4F 3NWSA 1RPWA 4IRGA 3TW6A 2ZXJA 2LR8A 2CQ7A 3H0GJ 3HOVJ 4LIVA 2WY8Q 4BQAA 4CCJA 4YFKF 4C3IJ 5LEKA 5KNLA 1MSEC 5J6XA 1LEAA 1MKMA 2O3FA 2PBIA 3RPUD 1U5TA 1H9GA 4P1WA 4AIDA 3CCEI 3C2GA 4OOIA 2ZJQF 1K78A 3AG4H 4JYKA 2Z5UA 1MMAA 4I0BA 1VFCA 2VPRA 3KEQA 3FWEA 2JMWA 2IW5A 4LFUA 1R00A 4LJZF 1ZELA 3RKYA 4DYQA 3JRAA 4ZZLA 3QQAA 4C2MJ 4N4NB 2M4KA 1LE8B 2NXNB 3OYKA 4FASD 2XAHA 1OCTC 4B8XA 5FO5A 2ZNZA 5M5YJ 1HW2A 3ZMUA 2LP0A 4U0YA 2NVQJ 3OOPA 3IP4B 4B43A 2EA4A 1A04A 1IJWC 2L0KA 1FIAA 1ENHA 1LDJA 3MWMA 1XSDA 3W2VA 5K5RA 2D1HA 1TQIA 2IGKA 4XRSG 3SHFA 4G6DA 3KZZA 1ACIA 2M34A 1Z1DA 2DW4A 4HNUA 2V9VA 2IXSA 2VT2A 2WB1A 4YFNF 4ESJA 1X19A 1OCOH 3JAMK 3N05A 1I3QJ 1NG6A 2W4SA 3Q0WA 1JHFA 4JK1X 3K6GA 3RIRA 2VQGA 2R7TA 1O3TA 5LRRA 3RZDJ 3I4PA 4EGYA 1SD5A 4HLXA 3SEZA 3LWFA 4Y4RA 3HDDA 2QWWA 2ZMEB 4AIJA 2G9WA 2GIZA 2HQ5A 4I98B 4PFPA 3OR2C 3BR3A 2F4MB 5ICGA 1MNEA 2DJNA 2UV1A 5IOYA 2DDBA 3OYHA 1AKHB 2ADUA 3G1MA 2K9LA 4I2OA 1IRZA 3PQJA 5H6RA 3GBGA 1PP7U 2PX9A 2L7FP 2K7LA 1MH4A 1JJ6C 1APLC 4M3EA 2VL8A 2VI6A 4D1QA 3KLNA 5JLWA 2O5RA 4RBOA 1OCPA 2R7WA 3HG9A 3VYTB 3WU0A 2ZB9A 1FOXA 1AA7A 3QOPA 5J4YA 3CCLI 3G4SI 3KYCB 1U6GA 1W0TA 4BBRJ 3R61A 5K7FA 4BXXJ 1ZARA 2BYVE 4HW0A 3WG9A 3E5XA 4XICA 1EH6A 6PAXA 1XS9A 1BW5A 1I5ZA 4GRIA 5DM7F 1XGSA 2JSPA 3OSFA 4UVCA 2L02A 2O9LA 5KVRA 2W82A 3KLOA 3RQIA 5FLMJ 1G2HA 3IKTA 4TV7A 3V4GA 2M1BA 2VBXA 2LD5A 3HB9A 3DFGA 2O0YA 1XGNA 3EDPA 1FX7A 5CVRA 4ETSA 2FU4A 1XMXA 2ECCA 4V2GA 2FMYA 2K9NA 2KDZA 1BIAA 3TMOA 3UNGC 4CCMA 5AIPA 3MD2A 1WH5A 3E6MA 4XQFA 3BLYA 3IRQA 3W3CA 1TLHB 1QO0D 1QBJA 3HRSA 3CC4I 1WJFA 3O8HA 2VXZA 3LSIA 3ROUA 3F8CA 4G6QA 1N78A 2M8GX 1R4NB 3OR1C 2GQQA 3PNTA 3NWTA 3ZQIA 4P9UA 5J1UA 2X85A 3HUGA 1R1TA 2XB5A 2WY7Q 2YR2A 3P9IA 3L7WA 5LHHA 3DTIA 4FX4A 1PJRA 1UZCA 2XB0X 5F1JA 4OMYA 1T56A 4D7NA 1MBFA 4P96A 4S05A 3ZCOA 3CQZJ 3I54A 1W4MA 4PGHA 1KQ0A 2YX4A 2CH0A 4LMYA 5DEQA 4QPQA 1X1PA 2NNNA 3CDHA 1KYWA 2VKHA 1X1CA 2P81A 1P4XA 3V7RA 4HOBA 1SAXA 1O3SA 3VODA 3DF8A 5B3SH 3FK6A 3OIPA 4O3MA 2Y0SA 1I1GA 3DLAA 4IPAA 4QLCU 4RB2C 4BGDA 2GIVA 2BOLA 3AG2H 2AHQA 3SFIA 2ZO4A 1XGOA 3U21A 3S14J 2WAEA 3K4MA 3HSRA 1ZTRA 4UY8I 5CPRB 4CA0A 4BDZA 4BY7J 1BI2A 2JN6A 3TO7A 2VPLA 1H9TA 1FBSA 1XB4A 4XRFA 3ZMZA 4UV8A 3TO6A 4L9JA 3I55I 2G0EA 1JGSA 1JUMA 4MTDA 3T8TA 5K5OA 1ZGWA 2NYXA 3F8FA 4AWXB 3LSMA 3ZR8X 3JR9A 1E0EA 2OD5A 3DKYA 1O7LA 5J1YA 2ZJ2A 1SVOA 3KP3A 4LG3A 4UVBA 1B9MA 1KZHA 1IRXA 4LITA 4MQ9F 2X6XA 1UHSA 1S5LC 4B47A 5JHUA 5ILVA 4XBFA 2X48A 1PYVA 3L2VA 1YTYA 3RCOA 4A69C 3L1PA 4M71A 1WFXA 4OMZA 4C3JJ 3SZGA 3PJRA 3HM5A 4EM1A 1Z67A 2L9VA 3CJRB 4EGZA 2L9SA 2ACJA 1CQTA 2AQEA 1YG2A 4PJNA 1JHHA 4ZJZA 2VLAA 2BW3B 3BG5A 4RGSA 5EEAA 3ERMA 4M3GA 3HOWJ 4XLFA 1TBXA 2HKOA 4OU0A 5ILUA 3PNVA 2LF7A 3EYIA 3X2QH 5KAFC 1KU7A 2F5CA 3EUHC 1I50J 2CO5A 2DT7B 3RI4A 2O03A 4ASNA 4RLQA 1R9TJ 1T98A 3S2DJ 2X0LA 4YEJA 5DV5A 2R7OA 1A6QA 2OTJI 1MMDA 4QIWN 3ZOBA 3WTXC 2OQGA 5EJCA 2HYJA 1OYWA 2M0CA 3Q3SA 3CCJI 1MGTA 3TL4X 2XSJC 2P8TA 3CCQI 1F4KA 1OCZH 3BTLA 2B9SA 4GYGA 2A69F 5KK1A 4BJ5C 1DUXC 1QPIA 4NHJA 1ZN2A 5FLXZ 1NK2P 5B5EC 2ID6A 4IQJA 1U5TC 2B7EA 5CVJA 1MD0A 2XASA 5B66C 3BPXA 3AG1H 2K4JA 1GXQA 2Z1DA 3CCYA 2YS9A 4B3AA 2XGXA 4ZYHA 4P55A 4GGGA 2P5VA 3I53A 4Q48A 1FJLA 5D4RA 1LNWA 2L01A 1R1VA 2KHMA 5FLVA 2HQAA 4DYRA 1MNDA 2VN2A 2CGPA 1IRGA 4A3KJ 2H27A 2DPUA 5BPDA 3PFIA 1BIBA 1B9NA 3DQVC 4MO7A 2QQBA 1HF0A 2V7FA 3VEPA 2HDCA 2K3FA 2R7FA 4KISA 2FBKA 2V1DA 3DU6A 2BVMA 3H92A 5F0CA 2QCOA 5IPAA 5EZHA 4GYIA 1KQ9A 3E3VA 5ICCA 3I59A 2XF5A 3T5XA 1O3RA 2FA5A 4K2EA 4U87A 4UHTA 3T0YA 2E1MB 4N9HA 5JR3A 3K9TA 4XLEA 4ON0A 2JA6J 2FF4A 3JRCA 1E3OC 1ETOA 3DXJF 3OS1A 3KP2A 1HXDA 4L5EA 2NVXJ 2JPCA 3LMMA 2VE9A 3F8BA 2HOAA 3HTUA 4A6EA 3BG3A 5H6QA 2FBHA 1E2XA 2DT6A 3SXYA 1FC3A 2QSFX 2QSHX 2QLZA 2RC4A 4CGZA 2JSCA 5EEGA 3JAMZ 1S7AA 3GLLA 5J47A 3I3LA 3MVPA 3F21A 1T39A 3GZ6A 1FLIA 2MD0A 2Q1ZB 3RQ4A 3L00A 1FPQA 2W00A 1EH8A 3FM5A 1W0UA 3J7AY 2YU3A 3ZN1A 2Z3YA 2DOAA 2RNJA 1A31A 2X6YA 3F72A 4BQQA 2VQHA 3P7NA 2DFHA 2RN7A 1F9NA 1IDZA 2IRFG 2BXZA 3I4MJ 3UR3C 5M5WJ 1QHGA 2XGDA 2BZTA 1V55H 3QAHA 2C6YA 3FX3A 5JVGF 4FTHA 5FRNA 4YRVA 3C1DA 2ELHA 4RM2A 1VQ7I 4BHCA 1YW7A 3TO9A 1MDMB 1TWCJ 2HPIA 4XORA 2A07F 4MFDA 2DXIA 1D5VA 1ETKA 2VE8A 2A05A 1NHAA 2MH9A 5F6FA 3QYBA 5K7HA 3LAJA 3RTRA 2F5FA 2P5KA 4Y33A 5FKOA 4CH7A 2H09A 2KDOA 4BHBA 2DBBA 2DFFA 2HS5A 2XGEA 2VQCA 3B02A 1K6YA 2GA1A 2FX0A 4MTEA 3M07A 1WVRA 2E7XA 2ZXHA 2BGCA 3QRFF 1B59A 3CMYA 4HV6A 3SZTA 3O6BB 3JRGA 4HA8A 3HHGA 4YG2F 5IP6A 4AIKA 2OAZA 3K7AJ 4KA4A 2V1NA 2GZWA 4DYCA 4WX9A 5KHDA 2W57A 3CZ6A 4ESFA 2DK5A 1U9OA 1JJ8C 4II3A 4YELA 3HKZA 3U1KA 1T8IA 3EUKL 5L3BA 3I56I 1R36A 1W36C 3LSTA 4WK8F 1TWAJ 4V19K 2LF8A 4A0ZA 4B4CA 5FFXA 2RNGA 4JBAA 1V5FA 2RDPA 3WTZA 3BR2A 3H9QA 4PGGA 4C2TA 2V26A 1UHMA 1L3LA 5CQGA 4A3CJ 2VJ4A 4LD5A 5CYVA 3H9GA 5K7ZA 3E0JB 4MQVA 3AKZA 3JRHA 1USTA 1D1BA 1Y56A 5IT3A 3V42A 4JX4A 4BXFA 3G73A 3HGGA 3IKVA 3LSJA 1MW7A 3E6DA 5EDNA 2ZJPF 3DCFA 1UG0A 5E8IA 3K0LA 2PMUA 4XONA 1W7PA 4HF1A 1C0WA 2B63J 5CKTA 3M7GA 4HZFA 2MC3A 4JOMA 2KJCA 3FKJA 3TOBA 2K02A 2EZLA 2GBYA 4S0HB 4G7ZF 5J8FA 4GFBA 2BE5F 3SEQA 3J7ZI 1AOYA 1E17A 5BMZA 4KMUX 3K2ZA 3F0CA 2QQ8A 1OLTA 4WXHA 4WWCA 3U1DA 4IL6C 4BU2A 2R92J 1UMQA 4J00A 4A3GJ 1B1BA 5F0HA 3IWZA 4AM3A 2XHKA 4J01A 1OQYA 2FJ1A 4RGUA 5C4XJ 3G1LA 2VBYA 4AVPA 1S7OA 1RKTA 3FBIB 4KIGA 2JPBA 3QU3A 1FYLA 3CUQB 2LFBA 3DKXA 2B0LA 2IVMA 4N0BA 2N8GA 1LE8A 5A2QZ 1S8NA 1YYVA 4E7SA 5LHGA 1GV2A 1VQ6I 3KZIC 4DQ2A 1GDTA 3VFZA 2QA4I 1W5TA 2CQQA 2E34A 2F5DA 3CLOA 4II2A 3MFKA 1IZ1A 2WV0A 3OYBA 2LKPA 3F6OA 4XKWA 1PP8F 2MSYA 1D1AA 5GTIC 4X0GA 2EIMH 3WODF 2OZUA 5JVTA 3OYFA 3ERED 5GADJ 3S16J 3M4OJ 2ZSIB 2STWA 4HF0A 4MEXF 2HU9A 3GMEA 4RB0A 1WRJA 2QBYB 2KRFA 2VJIA 3V8LA 5D6EA 3K4LA 3HYIA 2COMA 5E1ZB 1YJ9I 4UUSA 3DLLF 1FSEA 1DU0A 5E1XA 3J81Z 1ON1A 4HF2A 5DUKA 1ZR4A 4BDYA 2WBMA 2VOPA 4ZYDA 2LKSA 1H8AC 4ZTFA 1G6NA 4EJOA 3FK7A 4RA2A 5GTHC 3M9AA 4YIRX 5J40A 2ZMEA 1ONVA 2XRLA 2CQXA 2R5ZB 4L9NA 2QKLB 3PIPF 4ESBA 2YSRA 2XPUA 4JP0A 1ZREA 4DZJA 4ANJA 1JI8A 1TL8A 1AKHA 1FNNA 1K7AA 3DBRB 2P7CB 2IGOA 3ZQ7A 3FDYA 1D8JA 2MW8A 2DA1A 3VSLA 3L2CA 2L54A 2PN6A 5CJ9A 1S7EA 3P9CA 1SFKA 1VQ9I 3M8JA 4MIMA 4PFOA 3CTAA 2DCEA 2E1CA 3I5UA 2R7XA 2ID3A 2NAZA 1TWFJ 2DLLA 5CLSA 1HSJA 2X6OA 5L3DA 2JT1A 2D2WA 2IS2A 1QNTA 4C30A 5FLXK 1SFEA 1VQNI 1Z91A 3MKWB 2WWYA 2EFOA 2RGVA 1HDPA 3RPUA 2A6EF 1BR4A 3V7CA 5L3EA 4HX7A 3N4MA 1G59A 2VKEA 1B4AA 3R6SA 4CCKA 4ZYAA 3SZPA 3P9KA 2L5QA 1JE8A 4A3FJ 3H3VK 4FHTA 1WJCA 4U0WA 2X6WA 2E35A 1SD7A 3QP6A 2D1VA 3K4NA 2PJRB 4OAZA 2UXNA 5FJ8J 3H1CA 3LFKA 3VSKA 4DIQA 3G2BA 2O7OA 1ZK8A 3BG7A 1A6IA 2OCEA 2H8WA 3QOEA 1E3PA 5FD5A 3ZQLA 5ED4A 3CP2A 3I0TA 2JTVA 2IS6A 3BTCA 2P5LC 2ZCWA 5IT9Z 1XCVA 1ETYA 1KONA 3H5NA 3IWFA 2YPRA 2AXLA 5HDNA 2OF7A 3KZYA 3T1BA 4LK0F 3CUOA 4U88A 2QQAA 3BROA 3COAC 1NK3P 4UVAA 3ZMVA 1ZH5A 1IN8A 3KIOA 1BBYA 2R5YA 2FOWA 3AAFA 4R8HA 3LSKA 3E5UA 4E7HA 3RKXA 2ME0A 2M9HA 1FT9A 3CMAI 3Q0UA 4S04A 2MLKA 1IN4A 1IF1A 1GVJA 1REPC 1ZHFA 1JTYA 1QZZA 3CP8A 3K70D 5CQEA 3QYFA 2Z16A 5BQTA 4X1EA 5K5QA 2YU9J 3K1MA 4Y52J 3CUQC 4IHXA 3CO7C 1HW1A 2W24A 3GFLA 1AWCA 2KIFA 2Z99A 4FE4A 4M9ZA 1K61A 1POGA 1XN7A 3DBLB 2Q8KA 4XLPF 4XN3A 3GFJA 5HDGA 1UELB 1R1UA 4PSWA 4BYYA 1Z9CA 3HSFA 1X3ZB 3K4JA 2A61A 4IZZA 4HRIA 2FD5A 2XV4S 2CUEA 2JVGA 3OYIA 1QGPA 4NQWB 5M5XJ 2CRGA 3GTLJ 3IH2A 4YIIA 2Y9ZA 2OU2A 4IEJA 4MFEA 3TW7A 2KPMA 3VDXA 5BPIA 3HOSA 2DA2A 4XM3A 1EF4A 1OISA 2JA5J 4BNCA 2MA3A 2LLKA 1BI3A 2FXAA 1RI7A 2ISYA 1JXSA 1VI0A 2X9DA 3SYTA 2KL4A 2E19A 3BJOA 2F4IA 2RAEA 2RVCA 2YUSA 4ENJA 2DU9A 1BN5A 2CQKA 4PJLA 3GO5A 2HYFA 1AU7A 5BS6A 3IAS2 1VTNC 4NC8A 2BHZA 2E71A 1QQIA 1Z7UA 1T33A 4RGXA 4I99C 3LL7A 5HS9A 4EJWA 3A01B 3EYYA 2M5WA 4MEYF 1F36A 3B6CA 4E4HA 4BE1A 2JA2A 3IH4A 3W2AA 2BEOA 3RYPA 3HOTA 2D5VA 2BW3A 1J09A 1IXSB 2LY9A 4ABZA 3FXJA 1N25A 3HRTA 1R49A 1OCCH 2W48A 2AS5F 4I6ZA 3Q5FA 3IAM2 3L9FA 2PEXA 2RQPA 4ZYGA 3GLXA 2HTJA 2KMUA 4KUMA 4KNYA 3CF2A 2WB1N 1XMAA 3QYEA 1OCRH 1ZGJA 2XRNA 3ZMSA 2FQ4A 3KETA 4CCNA 5FD6A 3LSHA 2QKMB 2DYRH 3K4KA 3W6VA 5L3CA 3JRFA 2CUJA 1JT6A 1IGNA 2IA2A 2JRTA 3FM3A 1DGWY 1J7KA 2W84A 5M3FJ 3Q0VA 1MBGA 2H94A 2VJJA 2M0MA 3DV8A 3WTWC 2X4HA 4G6TB 3L2RA 3GFIA 2XAGA 4A3JJ 1LDKB 1ZR2A 3MEXA 1MNMC 5DDGA 4CSWA 3D0SA 3F22A 1IUYA 4I09A 3SJMA 1KGSA 2CQNA 3OYMA 3BOQA 3KCCA 3LSRA 3QU6A 3RZOJ 4UUTA 1CGPA 2DFEA 2HTSA 1OMIA 1VQPI 3PNYA 2G7HA 4PCQA 3OYNA 4J19A 5B1AH 2VONA 4NB5A 5DYMA 4DGWB 1HBXG 1FWZA 3AL0B 3QWLA 5A2QK 3F3XA 3LSGA 2HXOA 4O5VA 2DQRA 1V54H 2R3SA 2GA2A 4L5JA 2FSWA 3ZQGA 2HQRA 2M45A 3KEOA 1FTTA 2TRTA 3PM1A 2LNBA 1Z3XA 2LMDA
chains in the Genus database with same CATH topology
1W5SA 1ZRFA 3S3MA 4AIHA 3BPVA 3BG6A 3HIFA 1XD7A 1S6LA 4KICA 2OV7A 2PMZA 2XAFA 3F8NA 3J81K 1WI9A 2F5VA 2QM3A 3SFZA 1TW3A 1J5YA 4CHUA 1L0OC 1HSTA 5LHIA 2FE3A 3ABTA 5D6FA 1LEBA 1S3JA 4CYDA 5ICFA 4A5NA 1ERDA 1X1DA 4AYBA 1ZG1A 4ENNA 4MNUA 3QPHA 1MJ9A 1ZAOA 3QPTA 1T95A 4IRIA 2IA0A 4LGWA 1U2WA 3EUAA 4IKFA 2V1XA 4PZJA 1ZRDA 1FBQA 1IAWA 1BOAA 1TW2A 1UCRA 2MH2A 3BJAA 4HDUA 3WE2A 3H0DA 5HNHA 2P4WA 3Q9SA 5F1RA 3E1SA 4I01A 4A2UA 3ZPLA 3J80Z 3DP7A 2R7QA 2XVCA 3OYCA 1RIOH 3VB2A 1DGRM 2VB6A 3GF2A 2HR3A 4NNJA 2PLYA 1FMWA 1FOKA 2LBFB 2UXXA 5ICEA 5HOOA 3DPLC 3R0JA 1ZGAA 1D0XA 1D1CA 3L2QA 5D5UB 4KFCA 2CYYA 1T2KA 3BZ6A 3N97A 1Z05A 2OA4A 3LQQA 1D0ZA 1GXPA 3KX2A 1ZRCA 2G7UA 4G94A 2UWMA 4A6DA 4E7KA 4U7BA 1T6SA 3DEEA 5L3GA 5AONA 3WGHA 3SQNA 5IT9K 2EA2A 2IPQX 1CF7B 2HNHA 4A0XA 2LY1A 2R7SA 4C9YA 1P9QC 2R7DA 1MMNA 4BL0B 1K79A 2OUMA 3K10A 1G3TA 2PQ8A 1OPCA 4HQMA 3NQOA 5TGTA 1YIOA 3K4CA 4CDGA 4HQEA 3WGGA 1G4DA 1LVKA 1YQAA 1SAUA 2GOXB 2IGNA 1J75A 3FBNB 2BVLA 2K9MA 2WAFA 1U3EM 1SFXA 1XCBA 5DUIA 2ISZA 2HVRA 4BQNA 3M1CA 1HKQA 3H3UA 3I64A 2D45A 4IQ4A 4MGRA 4ZZDA 2F6CA 2XAJA 1Z6RA 4LLNA 5LLQA 2E5NA 1YW9A 4R1HA 3CUQA 1I1SA 2XC7A 1X3UA 3Q9VA 1DPUA 2ELJA 2EV6A 2A6TA 4KJZA 2X51A 5KCMA 4F7ZA 2E7WA 4B48A 4OIRF 3OL4A 2M7BA 3MAJA 3HXLA 3JW4A 3O3KA 3HTSB 2LYCA 2W7NA 3RDIA 4AVZA 4HX4A 2OQRA 3KP5A 5K1YA 2TDXA 2QBYA 3C18A 1IN6A 5LGNA 3QP5A 3RJPA 4EJUA 2M4GA 5E17F 2IS4A 4IJAA 2ZFWA 2RV8A 3DU5A 1N75A 2DJIA 3MZHA 3LFUA 4BQOA 4BAYA 3U9GA 2FNPA 3H35A 1ZLJA 3ZGKA 1YO5C 3OWTA 1IW7F 1U8RA 1F5TA 3QODA 4L9VA 2HFHA 4ZDPA 5LRSA 1YE9A 3KFWX 1GHCA 4UV9A 3BP8A 3FXRA 1RUNA 3ELKA 4LG0B 3ECHA 4KN4X 4YFXF 3NRVA 4HG2A 2VIXA 4PJMA 3CJQB 2QENA 3V8JA 3PSFA 3ZP5A 3M8EA 2K27A 2LC2A 4B44A 3MCZA 5HS8A 4EM2A 3KYLA 1LFPA 2LSOA 4FX0A 4A5MA 3DWLE 2ZFUA 3R60A 3HRUA 2QUFA 3F8MA 1V3FA 2J5OA 3M8FA 5HLTA 1J9IA 1USSA 3I58A 3TGNA 1TNSA 2A3SA 3JTGA 2A5YB 1ODDA 3DTKA 1O7FA 3OV8A 2KIMA 2PJRA 1BM9A 2VASA 1XDUA 1D8KA 3ZMDA 1Z21A 1LB2A 5HNFA 4M9SA 2E1MC 1B6AA 4RB1A 4NUBA 2CSOA 2KLOA 1I6XA 3EQLF 2XDVA 4XKCA 3OS2A 2JZYA 2Q2EB 5LBQA 3W2WA 2WTEA 5FFZA 5HDKA 4HPQA 1W7PD 1Y6IA 1FSHA 4HYEA 2HVSA 4RS8A 5LEJA 1LQ1A 4KMFA 4BEHB 2IT0A 2P7VB 2DFIA 1ON2A 2RKHA 5D8KB 4CXFA 1X1BA 1G3YA 3L2UA 2Q0OA 3OIQA 3OL3A 4KN7X 3L09A 1SD6A 3WGIA 2MABA 4RAZA 2VXDA 4FT8A 4HDVA 1WWXA 4EMSA 1I27A 1T0FC 2WAQA 4LB6B 3I9V2 4Y15A 3K4BA 1Z6TA 3W6KB 1KU2A 1D3YA 2E1NA 2CV0A 1ZLKA 4M6XA 2FMLA 4BJTA 3E6BA 4EV0A 5HS7A 1MJAA 2X1EA 4E7IA 2FBIA 1ZYRF 4HSTA 2QVOA 1DP7P 4E70A 2EV0A 3PL8A 1QHHD 4ENMA 4JQFA 2CW8A 4IXAA 3J80K 4OAYA 3MZYA 1S9HA 4NQWA 1ZG3A 3DPUA 3K69A 2ESHA 4CCOA 5E18F 2K4BA 4U7DA 5EEHA 2EWNA 2XROA 2UZKA 1HA8A 2WA0A 3VYUB 4ZTJA 3TKYA 4ZYEA 3K1PA 2HOEA 3JSOA 2CG4A 2QZ8A 3OOUA 2DQLA 4IX7A 2BBYA 4F55A 2P6SA 1PDNC 1P92A 3H3ZA 2DAOA 5TJJA 4A12A 5JFRA 3S93A 4E7ZA 2PG4A 4LK1F 1W7PB 3MMYB 1UAAA 2EFNA 2Y48A 4U0VA 5JHFA 4UXNA 1X4OA 2FUG2 3FMSA 3DKWA 3C3WA 2DT5A 3IHUA 2M30A 1RUOA 1WJDA 3LA2A 1HKSA 3ZQQA 2LRDA 3TOAA 2L2OA 2KQRA 3GWZA 3OS0A 3H5RA 2CV2A 1YW8A 1QPMA 2L3DA 2O6GE 3ZN0A 2E5ZA 4WXCA 4F52A 5LGTA 4UNOA 1Z3YA 3C2HA 3FF5A 2VOOA 1YX3A 1FMVA 1T38A 2F5EA 4UUVA 2DI3A 5LD2C 1DQUA 3GW2A 3VYRB 5DCMB 1R5HA 4F3QA 2VODA 1KYZA 4L9TA 4I7HA 5CVUA 2AQFA 2XF6A 4ITVA 2VC0A 2O8XA 2R7RA 1BR1A 2Z9OA 3HL2A 4XSZF 4HSRA 2HZDA 2DK8A 4EVIA 3A1YA 4G7OF 3RKWA 4P9FA 4M72A 5DCFA 4KT6A 1V5GA 2E60A 3E6CC 1SFUA 4Y17A 4I0AA 4XL9A 2GOMA 4LLGF 1WSUA 5LFAA 4XLAA 4ZDLA 4RMNA 4HAMA 4P5OA 4QWQA 3WU1B 3VWBA 3OYGA 3ZXSA 1UHWA 1TZLA 1BJAA 2NS0A 4XOTA 3MKZA 2CWEA 3HC7A 3C7JA 1GLNA 2KIUA 3WTSC 1U0JA 3T8RA 1EV7A 2MD5A 3NEUA 2H6CA 4XN0A 1OKRA 5FGMA 3PSIA 3BC8A 2XIGA 1IXRC 5ERIA 4F92B 3IUOA 4EATA 3BCAA 4MLOA 1WJ5A 2V6EA 5LGUA 1LDDA 1WKMA 1V4RA 5E20A 3J7AO 2R7VA 1U5TB 3V7SA 2QYOA 2ESNA 4PSXA 3RSNA 1SMYF 3OYJA 1K78B 1O57A 3CMMA 2K86A 2HZTA 3LQRA 1P2FA 5F64A 2LBFA 2FOKA 4OIPF 4Z2YA 4KDPA 3ECOA 3LAPA 1R5GA 4XKBA 3ISPA 1IN5A 5HLGA 2O61A 2EFWA 3E97A 3WTUC 5FRMA 1QZYA 2BV6A 4BE0A 4CO8A 2ZXIA 5L3FA 2IGMA 2OC6A 4I02A 2F2EA 2CV1A 5D4SA 4EQQA 2EJRA 1IRFA 2XAQA 2CUZA 3GZ5A 1D0YA 2VJ5A 1W36D 3A4CA 2EB7A 4Y3OA 2LY2A 4B3XA 2MFZA 1Q1HA 1YLFA 1CF7A 2KZVA 4HBLA 3JTHA 1KA8A 1WQ2A 4D9JA 2X1DA 2VBZA 3FMRA 2PMHA 1QU3A 3FZVA 4OWRB 3JSPA 1WJAA 1OYIA 2K3PA 1G8XA 4PDKA 3S3NA 2L4MA 1R22A 1TQMA 1HQCA 3MKYB 5FROA 2GXGA 4GXOA 2EFPA 4D0PA 4A0YA 1OR7C 5FB2A 1FP2A 1Y0UA 2NRAC 2MC4A 4IF4A 2W25A 4DJAA 2EK5A 4KIFA 2IS1A 5DD4A 2LOOA 2FRHA 4Q4ZF 5J8CA 3VYSB 1T0FA 2A5WA 3BJ6A 2P6TA 2M8EA 2V79A 2FEZA 4HV5A 1V5EA 4BACA 3I71A 1K6OA 2MBFA 4HNTA 3KE2A 4HLYA 3A2KA 5HLIA 1BI1A 2Z2SB 4Q47A 1J2XA 2RREA 2VQLA 1MDMA 4G9YA 3IRRA 3RPQA 4AU7A 2NNYA 5JI6A 3EPZA 5AIQA 2IJLA 3FMQA 4RGRA 3U2RA 2V4JC 1KU3A 4LB5A 4DNCA 1XSXA 5D5XB 4OIQF 1H0MA 3HUGB 2Y75A 4AD9A 3OY9A 1BC8C 1MMGA 2OBPA 4XSXF 4G7HF 5D8LB 1YS6A 4Q5SF 4F91B 4KITB 1O3QA 2VBWA 3GXOA 4LG0A 2FQ3A 4GO1A 5CVIA 5BOXA 4XNFA 4RB3C 3TDUC 3KP6A 2WC2A 1BR2A 3GFMA 2CS3A 3K70C 2A6HF 1F1ZA 3ZRGA 3OYLA 2VKDA 1SD4A 3CO6C 3TDZC 1NG7A 1KQ8A 3V8KA 4G8XA 2WADA 3VOEA 4WCGA 1DPRA 1LKXA 4EJTA 3IL2A 3ML6A 1WJBA 4MHGA 2DPDA 2CMPA 3BCBA 3PFYA 2GWRA 1P4WA 2V1UA 4O6JA 2CFOA 3W6JB 2CFXA 4RAYA 4XMYA 1TT0A 4DBRA 1FZPB 1BOBA 3BWGA 1EA3A 4IVNA 3PUBA 3AL0C 1XSVA 1YX5A 2EV5A 1EH7A 1R58A 4OINF 3MQ0A 3EETA 3F6VA 2X1CA 4PUSA 4BE2A 3S3OA 3IC7A 2MLGA 3OYEA 2K5CA 4CCLA 3D5LA 1DP3A 4Y13A 2HDWA 2Q2EA 1RNLA 2ZSHB 2KKOA 3S8PA 2CW0F 4ZC3A 3PQKA 1ZG5A 1LVAA 4BEHA 2MYSA 2XF7A 3TQNA 2PI0A 2LH9A 3H5AA 3WTVC 5H20A 4XLCA 2IP2A 2KJBA 1TNTA 3BDDA 1BC7C 4XOPA 1UB9A 2J5PA 4L5IA 2JUGA 1XGMA 3CESA 2DO7A 4FETA 3S32A 1J59A 4WF2A 1XDSA 1HW5A 4EJVA 2HEOA 4L0YB 1KU9A 1Z7LA 3FXUA 4B09A 1X1AA 3CJNA 4BS9A 1FY7A 1FBUA 2W1OA 2PJPA 4XLHA 2KRHA 1FP1D 1P4AA 4YIFA 1OYYA 4N9IA 4ZDOA 3HRMA 1TQPA 4EM0B 5HLHA 4BHPA 1IN7A 4CZZA 3SDBA 3ZMTA 1UFMA 3ABUA 3TBIA 2QQ9A 5ILSA 2HWVA 4DOZA 3GX4X 1X4PA 1G3WA 3E5QA 4H4KC 2W85A 2HVQA 1RZ4A 2Z33A 2XAUA 4H0EA 4M6YA 2OZ6A 5DD8A 1N77A 1ULYA 4CZCA 3WTYC 3G3ZA 4DBQA 2H6BA 3DEUA 4E6KG 2I8DA 4N4OB 5D5WB 1YS7A 4PJJA 3REOA 4IRHA 3I59B 1BI0A 4KT5C 3K1NA 2PFBA 4LLLA 4E7LA 1R7JA 3DTEA 2HPMA 1FYMA 4XLNF 3KP4A 4HX8A 1STZA 4BJ6C 2HKXA 3KP7A 1HKTA 1WJEA 4XR6A 3B73A 2L4AA 4RM3A 2CW7A 4QPOA 5TRDA 3D5SC 3WTTC 4HEA2 3RYRA 4IHSA 5HVQC 3OYAA 2XUBA 2V6CA 1IXCA 1PUEE 2NOJB 3OMYA 2P0WA 5E8GA 3AFHA 2GXBA 2R7UA 4M74A 2L9NA 4BUPA 3HPHA 2DTRA 3ONQA 3R0AA 3FHNA 2KRCA 2A68F 4OIOF 2M7AA 1TTYA 2M87A 2STTA 4BH9A 1FYKA 4LIUA 3DPTA 4GCVA 1R23A 3FXQA 4IHTA 4PK4A 2KP6A 3F23A 4XKVA 2LREA 3WE3A 2RQQA 3S2WA 3HSEA 3O2PE 3GEZA 1MJBA 2ZBKA 3M1EA 5DCMA 1OR7A 3KEYA 4M73A 1S29A 2R4GA 3FHZA 3OYDA 2ETHA 3BY6A 1DDNA 4RLFA 4CUGA 1G3SA 1SMTA 2IA1A 2V9KA 4F93B 3HHHA 1J0RA 2UUZA 4R79A 3L2WA 2XKPA 3D5RC 5D5VB 2M3AA 2L7KA 2FNAA 3F9KA 4NC7A 2Y0MA 3GVAA 2JVHA 3GYHX 2VT3A 4C2UA 1LJ9A 2HYGD 1R6RA 3HPGA 4L18B 3GUDA 4L0ZB 4M9XA 2YX7A 5CVVA 1P6RA 2XKOA 3ULQB 2GAUA 1MZBA 2LDUA 2LG4A 2ZNYA 1XMKA 3H9JA 1U78A 1YFHA 1VZ0A 3EUHA 4E7JA 2EFQA 2VC1A 3R4KA 4WXDA 3LA7A 2HQNA 2ZKZA 4ENKA 4KYWA 4CICA 2HGCA 5E1WA 3LA3A 4BXUA 4KIBA 4ZH4F 3NWSA 4IRGA 2ZXJA 4LIVA 2WY8Q 4BQAA 4CCJA 4YFKF 5LEKA 5KNLA 5J6XA 1LEAA 1MKMA 2O3FA 2PBIA 3RPUD 1U5TA 1H9GA 4P1WA 3C2GA 4OOIA 1K78A 2Z5UA 4I0BA 1MMAA 3KEQA 3FWEA 4LFUA 2IW5A 1R00A 4LJZF 1ZELA 3RKYA 4ZZLA 4N4NB 2M4KA 3OYKA 4FASD 2XAHA 4B8XA 5FO5A 2ZNZA 1HW2A 3ZMUA 4U0YA 3OOPA 3IP4B 4B43A 2EA4A 1A04A 1LDJA 3MWMA 1XSDA 5K5RA 3W2VA 2D1HA 1TQIA 2IGKA 3SHFA 4G6DA 3KZZA 1Z1DA 2DW4A 4HNUA 2V9VA 2IXSA 2VT2A 2WB1A 4YFNF 4ESJA 1X19A 3JAMK 3N05A 1NG6A 2W4SA 1JHFA 4JK1X 3K6GA 3RIRA 2VQGA 2R7TA 1O3TA 5LRRA 3I4PA 4EGYA 1SD5A 4HLXA 3SEZA 3LWFA 4Y4RA 2QWWA 2ZMEB 4AIJA 2G9WA 4I98B 4PFPA 3OR2C 5ICGA 1MNEA 2UV1A 3OYHA 2ADUA 4I2OA 2K9LA 3PQJA 5H6RA 3GBGA 1PP7U 2K7LA 2VL8A 4D1QA 3KLNA 2O5RA 2R7WA 3HG9A 3VYTB 3WU0A 3QOPA 1AA7A 1U6GA 3R61A 1ZARA 2BYVE 4HW0A 3WG9A 3E5XA 1EH6A 6PAXA 1I5ZA 4GRIA 1XGSA 2JSPA 4UVCA 2L02A 5KVRA 2W82A 3KLOA 3IKTA 4TV7A 3V4GA 2M1BA 2VBXA 3DFGA 2O0YA 1XGNA 3EDPA 1FX7A 5CVRA 4ETSA 2FU4A 2FMYA 1BIAA 3TMOA 3UNGC 4CCMA 5AIPA 3MD2A 3E6MA 4XQFA 3IRQA 3BLYA 3W3CA 1TLHB 1QO0D 1QBJA 3HRSA 1WJFA 2VXZA 3LSIA 3ROUA 3F8CA 4G6QA 1N78A 3OR1C 2GQQA 3PNTA 3NWTA 4P9UA 2X85A 3HUGA 1R1TA 2WY7Q 2YR2A 3P9IA 3L7WA 5LHHA 3DTIA 4FX4A 1PJRA 4OMYA 4P96A 4S05A 3ZCOA 3I54A 1W4MA 4PGHA 1KQ0A 2YX4A 2CH0A 4LMYA 5DEQA 4QPQA 2NNNA 3CDHA 1KYWA 2VKHA 1X1CA 1P4XA 3V7RA 4HOBA 1SAXA 1O3SA 3VODA 3DF8A 3OIPA 4O3MA 2Y0SA 1I1GA 4IPAA 4QLCU 3DLAA 4RB2C 4BGDA 2GIVA 2BOLA 2ZO4A 1XGOA 3U21A 2WAEA 3K4MA 3HSRA 5CPRB 4CA0A 4BDZA 1BI2A 3TO7A 2VPLA 1H9TA 1FBSA 1XB4A 4XRFA 3ZMZA 4UV8A 3TO6A 4L9JA 1JGSA 4MTDA 3T8TA 5K5OA 2NYXA 3F8FA 4AWXB 3LSMA 3ZR8X 1E0EA 2OD5A 3DKYA 1O7LA 2ZJ2A 3KP3A 4UVBA 4LG3A 1B9MA 1IRXA 4LITA 4MQ9F 2X6XA 4B47A 5JHUA 5ILVA 4XBFA 1PYVA 3L2VA 1YTYA 3RCOA 4M71A 1WFXA 4OMZA 3SZGA 3PJRA 4EM1A 3CJRB 4EGZA 2L9SA 2ACJA 2AQEA 1YG2A 4PJNA 1JHHA 4ZJZA 2VLAA 2BW3B 4RGSA 4XLFA 1TBXA 2HKOA 4OU0A 5ILUA 3PNVA 2LF7A 3EYIA 1KU7A 2F5CA 3EUHC 2CO5A 2DT7B 3RI4A 2O03A 4ASNA 4RLQA 1T98A 2X0LA 4YEJA 5DV5A 2R7OA 1MMDA 3WTXC 2OQGA 1OYWA 1MGTA 3TL4X 2XSJC 2P8TA 1F4KA 4GYGA 2A69F 5KK1A 4BJ5C 1DUXC 4NHJA 1ZN2A 5FLXZ 4IQJA 1U5TC 5CVJA 1MD0A 2XASA 3BPXA 2K4JA 1GXQA 2Z1DA 2XGXA 4ZYHA 4P55A 4GGGA 2P5VA 3I53A 4Q48A 5D4RA 1LNWA 2L01A 1R1VA 2KHMA 2HQAA 1MNDA 2VN2A 2CGPA 1IRGA 2H27A 2DPUA 5BPDA 3PFIA 1BIBA 1B9NA 3DQVC 2QQBA 2V7FA 3VEPA 2HDCA 2R7FA 4KISA 2FBKA 2V1DA 3H92A 2BVMA 3DU6A 4GYIA 1KQ9A 3E3VA 5ICCA 3I59A 3T5XA 1O3RA 2XF5A 2FA5A 4K2EA 4U87A 4UHTA 3T0YA 2E1MB 4N9HA 5JR3A 3K9TA 4XLEA 4ON0A 2FF4A 3DXJF 3OS1A 3KP2A 1HXDA 2JPCA 3LMMA 2VE9A 3F8BA 3HTUA 4A6EA 5H6QA 2FBHA 1E2XA 3SXYA 2DT6A 1FC3A 2QLZA 2RC4A 4CGZA 2JSCA 5EEGA 3JAMZ 1S7AA 3I3LA 3F21A 1T39A 3GZ6A 1FLIA 2MD0A 2Q1ZB 3RQ4A 3L00A 1FPQA 2W00A 1EH8A 3FM5A 3J7AY 2YU3A 3ZN1A 2Z3YA 2RNJA 2DOAA 2X6YA 3F72A 4BQQA 3P7NA 2VQHA 2RN7A 1F9NA 2IRFG 3UR3C 1QHGA 2C6YA 3QAHA 3FX3A 5FRNA 4YRVA 3C1DA 2ELHA 4RM2A 4BHCA 1YW7A 3TO9A 1MDMB 2A07F 2HPIA 4XORA 2DXIA 1D5VA 2VE8A 1NHAA 2MH9A 5F6FA 3QYBA 3LAJA 3RTRA 2F5FA 2P5KA 4Y33A 4CH7A 2H09A 2KDOA 4BHBA 2DBBA 2HS5A 2VQCA 3B02A 1K6YA 2GA1A 4MTEA 2E7XA 2ZXHA 2BGCA 3QRFF 1B59A 4HV6A 3SZTA 3O6BB 4HA8A 3HHGA 4YG2F 4AIKA 2OAZA 4KA4A 2V1NA 2GZWA 4WX9A 5KHDA 2W57A 4ESFA 3CZ6A 2DK5A 4II3A 4YELA 3HKZA 3EUKL 5L3BA 1R36A 1W36C 3LSTA 4WK8F 2LF8A 4A0ZA 5FFXA 4JBAA 2RNGA 1V5FA 2RDPA 3WTZA 3H9QA 4PGGA 4C2TA 2V26A 1UHMA 1L3LA 5CQGA 4LD5A 5CYVA 2VJ4A 3H9GA 3E0JB 4MQVA 3AKZA 1USTA 5IT3A 1D1BA 1Y56A 3V42A 4BXFA 3G73A 3IKVA 3E6DA 1MW7A 5E8IA 1UG0A 3K0LA 2PMUA 4XONA 1W7PA 4HF1A 1C0WA 5CKTA 3M7GA 4HZFA 2MC3A 4G7ZF 2KJCA 3TOBA 3FKJA 2K02A 4JOMA 5J8FA 2BE5F 3SEQA 1AOYA 1E17A 5BMZA 4KMUX 3K2ZA 1OLTA 4WXHA 4WWCA 3U1DA 4BU2A 4J00A 1B1BA 3IWZA 2XHKA 4J01A 4RGUA 2VBYA 4AVPA 1S7OA 3FBIB 4KIGA 2JPBA 3QU3A 1FYLA 3CUQB 3DKXA 2B0LA 2IVMA 4N0BA 5A2QZ 1S8NA 1YYVA 5LHGA 4E7SA 4DQ2A 3VFZA 1W5TA 2F5DA 3CLOA 4II2A 3MFKA 1IZ1A 2WV0A 3OYBA 2LKPA 3F6OA 1PP8F 4XKWA 1D1AA 4X0GA 3WODF 2OZUA 5JVTA 3OYFA 3ERED 2ZSIB 2STWA 4HF0A 4MEXF 4RB0A 2HU9A 1WRJA 2QBYB 2KRFA 3V8LA 2VJIA 5D6EA 3K4LA 3HYIA 2COMA 5E1ZB 1FSEA 5E1XA 3J81Z 1ON1A 4HF2A 5DUKA 4BDYA 2WBMA 2VOPA 4ZYDA 4ZTFA 1G6NA 4EJOA 3M9AA 2ZMEA 1ONVA 4L9NA 2QKLB 4ESBA 2YSRA 1ZREA 1JI8A 4ANJA 1FNNA 1K7AA 2P7CB 2IGOA 3ZQ7A 3FDYA 1D8JA 3L2CA 3VSLA 2L54A 2PN6A 5CJ9A 3P9CA 1SFKA 3M8JA 4PFOA 3CTAA 2DCEA 2E1CA 3I5UA 2R7XA 2NAZA 2DLLA 5CLSA 1HSJA 5L3DA 2JT1A 2D2WA 2IS2A 1QNTA 5FLXK 4C30A 1SFEA 1Z91A 3MKWB 2WWYA 2EFOA 2RGVA 3RPUA 2A6EF 3V7CA 1BR4A 5L3EA 4HX7A 3N4MA 1G59A 1B4AA 3R6SA 4CCKA 4ZYAA 3SZPA 3P9KA 2L5QA 1JE8A 4FHTA 1WJCA 4U0WA 2X6WA 1SD7A 3QP6A 2D1VA 3K4NA 2PJRB 4OAZA 2UXNA 3LFKA 3VSKA 4DIQA 3G2BA 3BG7A 3QOEA 5FD5A 5ED4A 3CP2A 3I0TA 2JTVA 2IS6A 2P5LC 2ZCWA 5IT9Z 1XCVA 1KONA 3H5NA 3IWFA 2YPRA 2AXLA 5HDNA 3KZYA 3T1BA 4LK0F 3CUOA 4U88A 2QQAA 3BROA 3COAC 4UVAA 3ZMVA 1ZH5A 1IN8A 1BBYA 3AAFA 4R8HA 3LSKA 3E5UA 4E7HA 3RKXA 1FT9A 4S04A 2MLKA 1IN4A 1IF1A 1GVJA 1REPC 1ZHFA 1QZZA 3CP8A 3K70D 5CQEA 3QYFA 2Z16A 5BQTA 5K5QA 3K1MA 3CUQC 3CO7C 1HW1A 2W24A 3GFLA 1AWCA 2KIFA 2Z99A 4M9ZA 1XN7A 2Q8KA 4XLPF 4XN3A 3GFJA 5HDGA 1UELB 1R1UA 4PSWA 4BYYA 1Z9CA 3HSFA 3K4JA 2A61A 4IZZA 4HRIA 2XV4S 2JVGA 3OYIA 1QGPA 4NQWB 4YIIA 2OU2A<