4JQFA

Structure of the c-terminal domain of human telomeric stn1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
168
Chain Sequence
AEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2013-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4jqfA02
1.10.10.980 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4jqfA01
4CZZA 1K78B 4A6DA 3WGIA 3U9GA 2O61A 4LD5A 1XGSA 1Z9CA 4Y17A 2HTJA 3L9FA 3EETA 2PLYA 1LVAA 2E1NA 1I6XA 5LGTA 2FEZA 4L5IA 3T8RA 4U7BA 2Q8KA 2P4WA 2DK8A 2VN2A 3RKXA 5JHUA 3GO5A 4WCGA 3GFMA 1NHAA 2DQRA 3ABUA 3EYYA 1IXCA 4EJWA 3FMRA 4OMYA 4HX8A 1W7PD 1ON1A 4HF1A 1ZLJA 4P5OA 1ZGAA 4A0ZA 3O2PE 3IKTA 3FF5A 4E70A 1LQ1A 2PMUA 3DKWA 4KN7X 1B1BA 1XD7A 2FXAA 1VTNC 5D5UB 1ZRCA 3WU1B 1YIOA 5DEQA 1U5TB 3RDIA 1OMIA 1I27A 1FSEA 1OYYA 5DDGA 3LQQA 3KETA 2ESHA 4G8XA 2QBYA 4WX9A 2EFOA 2GZWA 5ILSA 1O3TA 2YR2A 1K78A 3HRUA 1RIOH 1DDNA 5L3EA 2LNBA 3F3XA 3HYIA 3J81Z 3GX4X 1XSXA 3SZTA 2B0LA 3SHFA 4MEXF 1I5ZA 4HLXA 5ILVA 1FBQA 3PFIA 3F8BA 2HDCA 2GQQA 4LLLA 2XHKA 2M87A 4KIBA 4I09A 2ELHA 3E6DA 2F2EA 1FP2A 1WQ2A 2QM3A 1Z7UA 3RPQA 2BYVE 1H9TA 5D5WB 4G7OF 2STTA 3VEPA 3WE2A 3K9TA 2ZMEB 3C18A 4OU0A 1R1VA 1YYVA 2ZNYA 2GAUA 1DPUA 4OINF 4LB5A 2RNJA 1U5TA 2PN6A 1R1UA 1XSDA 3KLOA 1HBXG 2Y0MA 1TQPA 4GXOA 2HFHA 4HQMA 3G73A 2QUFA 5FO5A 2V1XA 1W4MA 4RGUA 2WWYA 1HSTA 4I98B 1IW7F 2TDXA 4NQWA 3CJNA 4GYGA 4HDUA 4RS8A 2YSRA 3PQKA 1O3SA 3ELKA 2A61A 1O3RA 3LA3A 3I0TA 4IRGA 2VT3A 1D8KA 1FT9A 2V1DA 4Q47A 1S29A 2PG4A 3E3VA 2IA1A 2ISZA 3LAJA 1L0OC 1XGOA 1YQAA 3QP6A 2JZYA 1U3EM 5E18F 3ULQB 2ZMEA 1KA8A 3EUHA 1OYWA 1TNSA 4YG2F 1FYKA 4M73A 3KEQA 1BM9A 2Y48A 3FWEA 3M7GA 1Z6TA 2KIUA 3ZMVA 1P6RA 1LDJA 3FZVA 1T2KA 4ZH4F 3CUQC 1KYZA 3K1PA 2PI0A 2EJRA 3BJAA 4MQVA 2EK5A 3DQVC 2FBHA 2CGPA 1RUOA 3ZMZA 4UVBA 5HS8A 4RB1A 2DBBA 3HHHA 4EJVA 3I53A 2GWRA 3Q9VA 1XCBA 2JTVA 2RN7A 3MZYA 3I5UA 5DCMB 2JPCA 3N4MA 3E6BA 4YIIA 1KYWA 4IJAA 4XRFA 3BDDA 1QBJA 4WK8F 2D45A 3L09A 5EEGA 2C6YA 1FYMA 2FF4A 5FD5A 5K5QA 3ZMSA 1CF7B 1W5SA 4D0PA 4WXCA 1J59A 4GCVA 2CO5A 2EFWA 5LEKA 4IVNA 3GUDA 1XGMA 3BROA 1HXDA 3CO6C 4XSXF 5CVIA 2K4BA 5BMZA 1KQ0A 3D0SA 5E1WA 1P4WA 1B6AA 5FFZA 2EA2A 1QQIA 2IW5A 2A69F 2K02A 4G9YA 3SXYA 2NAZA 4I01A 3KCCA 2D1HA 2P8TA 2W85A 3ECOA 1REPC 2VONA 4XLNF 2P5VA 4MNUA 4P9FA 2MA3A 4ESBA 1MJBA 4A12A 2EA4A 4IPAA 4GYIA 4HQEA 4PDKA 3EQLF 3OOPA 2H27A 3MCZA 2VBYA 5EEHA 2XASA 1IN7A 5DCMA 4KDPA 1BIAA 2UWMA 1LEAA 1ZG5A 2H09A 5ICFA 1HW1A 5FB2A 2A6EF 3QPTA 3V8KA 4H0EA 4RGXA 2HKOA 1PUEE 1ULYA 3AAFA 2NNNA 5D4RA 2G7HA 2VOOA 3R0AA 1CF7A 2XV4S 3C3WA 1R5HA 2DW4A 1LEBA 1DP7P 4M9SA 2V79A 3PQJA 3HOTA 1X3UA 1HKTA 4I0AA 4LB6B 3EDPA 1KQ8A 1J75A 5D8KB 5JFRA 4BNCA 2JRTA 3RIRA 2XAQA 3WTVC 2RDPA 1A04A 2K27A 4AIKA 1ZG3A 1O3QA 3E6MA 1QZZA 1AOYA 2LDUA 3KP5A 5CJ9A 1E17A 3JTGA 4BH9A 3R61A 1CGPA 3GF2A 3NEUA 4F7ZA 3U1DA 1D5VA 4EJTA 2PEXA 3LFKA 3JSOA 4HLYA 1G3SA 2V6CA 4HV6A 4HYEA 1QGPA 3MFKA 1WKMA 1U8RA 1V3FA 3GW2A 1QNTA 2HR3A 3BY6A 2R7FA 1YTYA 4ENKA 3P7NA 4MEYF 1GVJA 3OV8A 2H6CA 1YW9A 4HDVA 2IVMA 4Q5SF 5HVQC 2Z33A 4A2UA 4M9XA 1KU9A 4EV0A 3SZPA 3KEOA 1SMYF 4ON0A 3TO6A 3MWMA 5CLSA 1IN4A 2PBIA 3HUGA 1D8JA 3KZZA 2RV8A 2XKPA 3M1EA 2CW0F 2Z99A 2OD5A 1G3TA 2W57A 5JI6A 4B8XA 2V9VA 1S7AA 1XSVA 2A07F 2EFQA 2OBPA 1R5GA 2ETHA 5FD6A 3L7WA 1WRJA 1FZPB 1OYIA 3KP4A 4N9IA 3ZN0A 4YIFA 4UHTA 4LMYA 2VODA 3T8TA 4FHTA 4G7ZF 1PP8F 3SFZA 5ED4A 2HWVA 1ZRDA 4RB3C 4ASNA 4ETSA 2CFXA 3VOEA 5CVRA 4MTDA 3J80K 5AONA 4OIPF 4ZYEA 1T98A 4FX4A 1GXPA 2QQBA 3P9KA 3TDUC 4L0YB 1RUNA 3RTRA 2XKOA 2BV6A 3H92A 4KNYA 2XAGA 4LLGF 5FGMA 5ICGA 1LJ9A 1K79A 2FMYA 4ZYGA 3TOAA 3BPVA 5DUKA 5A2QK 4IHTA 2LSOA 1T39A 1FNNA 4CO8A 2HEOA 3HTSB 1G3YA 2A3SA 1ZRFA 1YLFA 2G7UA 4RAYA 3M8FA 2DAOA 2HQRA 1K6OA 1P92A 1L3LA 1T0FA 3R60A 1UCRA 3K2ZA 3WTXC 5F64A 4YFNF 1FWZA 2K86A 4HW0A 5IT9K 5HS9A 1TNTA 1ZREA 3V8JA 3F6OA 5D8LB 3NQOA 2L4MA 3GEZA 3WE3A 1TQIA 2XROA 3CLOA 3W6KB 1SMTA 4PGGA 3F22A 1FOKA 1JHFA 4JK1X 3F6VA 2COMA 2R3SA 2KJBA 3DF8A 3BJ6A 2IJLA 2A6HF 2QQ9A 3B73A 1JXSA 2BGCA 3COAC 4YFKF 2BEOA 1ZN2A 2L4AA 1LB2A 5ICCA 4HA8A 1O7FA 4ZYDA 3ABTA 3EYIA 4OOIA 3TQNA 2ZBKA 3E5XA 2ZKZA 4BHPA 3I59B 3ERED 3W6JB 1QZYA 2XAFA 4G94A 2DTRA 5E8GA 5HLHA 3TO9A 1SD4A 3ZMTA 4KT5C 3CO7C 3F8NA 1SD5A 5H6QA 2MD5A 5F1RA 3FX3A 1ZG1A 4NHJA 5FFXA 1RI7A 5LHHA 2GA2A 3CUQB 4A0XA 2AS5F 5LGNA 3TGNA 1USSA 3GVAA 2V1UA 2Q0OA 3FXQA 3TOBA 3CDHA 2M45A 2O6GE 3V7CA 4I2OA 1LNWA 2MC3A 4B09A 3ZMDA 2GXBA 5ICEA 1U2WA 2OQGA 3HSFA 5D5XB 2WV0A 1G3WA 1F1ZA 2ESNA 2DLLA 3I58A 1YW8A 4IRHA 4WF2A 3KP7A 4O3MA 2PJPA 4XLPF 2M8EA 2CG4A 1I1SA 3H3UA 1J0RA 4LJZF 2Z3YA 2ZCWA 2ZO4A 1ZAOA 2P5LC 1R36A 3J80Z 2XRNA 3JTHA 2IRFG 3WTWC 2F5EA 2HQNA 1WJ5A 1WWXA 5HLGA 2NRAC 2DPUA 2L01A 3K0LA 3JW4A 1SFUA 3I59A 5J6XA 1TLHB 4ZYHA 3O6BB 4A5NA 1ZARA 5K1YA 3R6SA 3F8FA 2VOPA 1SD6A 1ON2A 3ZPLA 2XGXA 4P9UA 5A2QZ 4NB5A 2FA5A 2VE8A 2FRHA 4AVPA 5E1XA 2JT1A 1FX7A 5DD8A 5CVVA 1W5TA 3FXRA 5KVRA 3VODA 3CUQA 5DCFA 5CVUA 3KP2A 1FY7A 3IHUA 4DNCA 1K7AA 1R23A 2O8XA 3BWGA 4HBLA 2XVCA 3U2RA 5IT9Z 2R7DA 4YFXF 2L02A 1HKSA 2HKXA 2HS5A 1Z05A 2KKOA 3REOA 1T6SA 4Y15A 3BPXA 3QP5A 4JQFA 2J5PA 1ZYRF 1BBYA 2W24A 3JSPA 1O7LA 5D6FA 1IN6A 2CWEA 1F4KA 3WGHA 2DPDA 1KQ9A 5E17F 4ZZDA 1YG2A 3ML6A 1ZH5A 1E2XA 4HOBA 5CYVA 1W7PB 1IRFA 4WXHA 1B9NA 5JR3A 4GGGA 1MZBA 2IT0A 4IF4A 2ZFWA 2QENA 1U6GA 5E8IA 2EB7A 3GYHX 1Z91A 3E97A 5TJJA 3GFJA 2CSOA 2UZKA 1USTA 3F8CA 2D1VA 3QU6A 1SD7A 1Q1HA 1FC3A 2YX4A 1IZ1A 2PFBA 2HGCA 2JSCA 1KU3A 4PGHA 4ENNA 1BI3A 4M71A 3RJPA 2VT2A 3S2WA 2RKHA 3V4GA 2O3FA 2H6BA 1EH7A 4KN4X 1UB9A 3KFWX 5D4SA 4LK1F 2A5YB 1B9MA 4RB2C 2MH9A 3I64A 1J9IA 4GO1A 1FBUA 2EFPA 2VBWA 4EM0B 2EWNA 3T5XA 2ZJ2A 4EGYA 3L2CA 4CDGA 1YS6A 5LLQA 1S6LA 4CGZA 2OQRA 3RKWA 4KMFA 1W7PA 2YPRA 4CYDA 4N0BA 1IN5A 5LBQA 5K5RA 2L54A 3QU3A 5DV5A 2HZTA 5E20A 3KZYA 2YU3A 2W84A 2JPBA 4ENJA 1P4AA 3ZN1A 1Y0UA 4R1HA 4HZFA 3IRQA 4XSZF 2QLZA 3QOPA 1F9NA 1MD0A 2F5FA 5DD4A 5HDKA 3L00A 2M30A 1XMKA 4A0YA 4M74A 1GHCA 5LGUA 1ONVA 3LWFA 5FLXK 5BPDA 4U0WA 1ZGJA 5LHIA 5HOOA 4WWCA 2E7XA 1TBXA 3R4KA 4O6JA 4A5MA 4AIJA 2DK5A 1HKQA 4MGRA 1JGSA 2OU2A 2Y75A 1BJAA 1H0MA 2E7WA 2W25A 3WTSC 2O03A 3V7SA 4IHSA 4CHUA 4IRIA 2VC0A 2K4JA 3FMSA 4WXDA 1G6NA 5J8FA 2X4HA 1D3YA 1I1GA 1MJ9A 1C0WA 2GA1A 4ESJA 2HOEA 4UNOA 1V4RA 1FLIA 4OIRF 4K2EA 4KIFA 3N97A 1BI0A 4BHCA 4LG0B 2ISYA 2H94A 5CVJA 2VE9A 2XAHA 1YO5C 3CUOA 4R79A 3WTYC 4AWXB 2F5CA 2L3DA 5H6RA 1IRGA 4HX4A 1DPRA 1KGSA 2P5KA 3V8LA 1XDUA 4QWQA 1UHWA 3I4PA 3FMQA 3ROUA 4HV5A 3NRVA 2VC1A 3P9CA 3LSTA 3IWZA 3DV8A 2ADUA 2WC2A 4S05A 2DI3A 1B4AA 2AXLA 3RYPA 5H20A 3KE2A 2FNAA 3HIFA 3HTUA 2GXGA 4G6DA 3IWFA 1YFHA 2NYXA 2P6SA 2XIGA 1FYLA 4HF2A 1BN5A 3FM5A 3LA7A 2P6TA 2OZ6A 4P55A 3IKVA 2D2WA 4PCQA 1XN7A 2EV6A 5BPIA 1Z1DA 3TDZC 2MLGA 1BI2A 4KICA 2OAZA 3T1BA 2FSWA 3M9AA 5L3CA 3DXJF 1JE8A 2MBFA 1EH8A 4LG0A 1OKRA 3HSRA 3F21A 4OIOF 3JAMK 1FP1D 2UXXA 1TTYA 2M1BA 4L9TA 2RQPA 1MJAA 1R22A 2GIVA 3WTZA 4AD9A 4BXUA 5L3FA 3GWZA 2NNYA 3GZ5A 3ZQ7A 3Q9SA 5ERIA 5KK1A 4I7HA 1YS7A 2DO7A 3BJOA 2KJCA 4M72A 2E1CA 5LRRA 1Z6RA 1XB4A 1F5TA 4BYYA 3KP6A 3WODF 1UFMA 2BE5F 5F6FA 3GLXA 5FLXZ 3WTUC 3DFGA 2ACJA 4U88A 4M6XA 4G7HF 4HX7A 4OIQF 3VFZA 3HOSA 1IAWA 5HDNA 1SAXA 2DU9A 3QRFF 1O57A 3WTTC 5HDGA 1J2XA 3M8EA 3FM3A 5AIQA 1HSJA 2BBYA 1DUXC 1U5TC 2G9WA 5ILUA 3BZ6A 4ZZLA 1IXRC 2X0LA 5HS7A 2FE3A 2DT5A 4L9NA 2FOKA 2IA2A 1JHHA 1R00A 3K69A 4MHGA 3BP8A 2FMLA 4RB0A 3GZ6A 3QAHA 3BOQA 4M9ZA 4ENMA 1BC7C 2NS0A 5HLIA 1WSUA 1BIBA 1FSHA 2QZ8A 3HRTA 4UV9A 1B59A 2CQKA 2EV0A 4BHBA 3MEXA 4U7DA 1XCVA 4KUMA 2HYGD 3F8MA 2ZXJA 3RPUA 4KIGA 3DP7A 3TKYA 1BI1A 1SFXA 5BQTA 3F23A 4TV7A 2DFIA 2QYOA 4OMZA 4RGSA 1STZA 3E6CC 2XUBA 4O5VA 4RGRA 1S7OA 3H3ZA 1T38A 1BOAA 2Z5UA 3WU0A 3SQNA 3IRRA 4I0BA 3I54A 2QVOA 2VBZA 2WTEA 1MGTA 3KP3A 1TQMA 4I02A 3MZHA 1IN8A 4G6QA 2IPQX 2K7LA 4UUVA 2YX7A 4L5JA 3TO7A 1IXSB 4Y13A 1HQCA 2A68F 1LDDA 3KLNA 4L18B 3GFIA 2Z9OA 1RNLA 3G3ZA 4EGZA 3LAPA 4A6EA 2MLKA 1P2FA 4PZJA 2FQ3A 4EQQA 2QQAA 4L9VA 3DEUA 1IUYA 3K1NA 1H9GA 4KMUX 4FT8A 1EH6A 2DQLA 3C7JA 2VBXA 3HRSA 1OR7A 3JAMZ 1FBSA 3RYRA 3MQ0A 1AWCA 4Z2YA 3WGGA 1OPCA 3LA2A 3IL2A 4CXFA 5DYMA 2RC4A 3F72A 4U0VA 2O0YA 2RGVA 4EJUA 1KU2A 1BC8C 1PP7U 2F5DA 1HW5A 1S3JA 1RZ4A 4RAZA 3VB2A 2OZUA 4BQAA 4UVCA 3QPHA 1XDSA 2M5WA 3DPTA 3E5UA 2LKPA 4AIHA 1G4DA 2FNPA 3D5LA 2RVCA 1UHMA 2FU4A 2OA4A 3MAJA 3HSEA 4EM2A 1WI9A 3RI4A 2HYFA 4L0ZB 2QWWA 4JBAA 5D5VB 1R1TA 2P7VB 5TRDA 3RKYA 2PMHA 4EVIA 4QLCU 2IP2A 4IXAA 2STWA 1J7KA 3ZMUA 5J8CA 4DQ2A 4HAMA 6PAXA 3J7AO 4Q4ZF 1EV7A 4LK0F 3R0JA 4CICA 3Q5FA 2MH2A 5LEJA 3E5QA 3FHZA 1S8NA 2EV5A 4BAYA 5BS6A 1R7JA 4M6YA 1SFEA 3B02A 2ZNZA 4KFCA 3WG9A 3C1DA 2LF7A 4LGWA 1FPQA 1MDMB 4P96A 3J81K 2PQ8A 1GXQA 1ZHFA 2J5OA 5L3DA 5DUIA 1XMAA 1MKMA 1QPMA 2UXNA 4HF0A 1YW7A 2KIFA 4KA4A 4EJOA 3V7RA 1HW2A 2KRFA 3O3KA 4U0YA 4LFUA 1LDKB 2VXZA 4Q48A 1P4XA 5E1ZB 3ZP5A 3ISPA 4LLNA 1ZLKA 1KU7A 4MTEA 4UVAA 3IC7A 4UV8A 1QO0D 3T0YA 2EFNA 1XGNA 3LQRA 5LHGA 3DPLC 4ESFA 1J5YA 1U78A 3CTAA 2IA0A 2XAJA 3ECHA 4MQ9F 4UXNA 1ODDA 4N9HA 3GXOA 4KYWA 3GFLA 5K5OA 4R8HA 3P9IA 1TW2A 1R58A 4XBFA 3K1MA 4EM1A 4S04A 3I71A 4EMSA 5JVTA 5BOXA 5L3BA 2FBKA 5AIPA 2CYYA 2KIMA 1TW3A 5LRSA 4FX0A 2LF8A 2HTSA 1IF1A 2P7CB 5L3GA 3HRMA 4L9JA 3FXUA 5IT3A 2QBYB 2FBIA 5D6EA 3HHGA 1MDMA 2Q2EA 1PDNC
chains in the Genus database with same CATH superfamily
3HM5A 4OWRB 4A93J 4CZZA 2M34A 3GTQJ 4NC6A 1K78B 5EZGA 1WHUA 2L2OA 4A6DA 3LSKA 3RZOJ 1XTAA 3WGIA 2F4MB 3U9GA 1WI3A 2O61A 4LD5A 2K9NA 1XGSA 1Z9CA 1MBHA 2R7OA 4W97A 4Y17A 2HTJA 3L9FA 3EETA 4Y7NJ 4A3GJ 3TMOA 3D1NI 4NDLA 2PLYA 1LVAA 2E1NA 1I6XA 5LGTA 1X58A 1RRJA 1WFXA 2FEZA 4IQ4A 2CUJA 4L5IA 1I3AA 1JUSA 3T8RA 4U7BA 2Q8KA 2DA1A 2P4WA 2BHZA 3QYEA 2DK8A 2XPVA 2DMPA 2VN2A 3RKXA 5JHUA 3GO5A 4WCGA 3MKWB 3GFMA 3OOUA 1W36C 1EA3A 5EGOB 1NHAA 2DQRA 3ABUA 3EYYA 1IXCA 3J7YJ 4EJWA 3FMRA 3IV5A 3O8GA 1OCRH 4HX8A 2EIMH 4OMYA 1W7PD 2E1MC 1ON1A 5KAIC 5J4YA 3IP4B 4HF1A 5E79C 3A2KA 4I76A 1ZLJA 2KISA 4P5OA 1ZGAA 4A0ZA 3O2PE 2MYSA 3SEQA 3IKTA 2DN0A 3FF5A 4E70A 1OLTA 1LQ1A 3QQAA 2PMUA 1AA7A 3DKWA 1Z77A 5FKKA 3M8JA 4KN7X 1B1BA 2KZGA 1NH3A 3CCSI 4AC0A 1FTZA 1XD7A 2FXAA 1VTNC 5D5UB 1ZRCA 4RAFA 3WU1B 1WJDA 3S1MJ 2LMDA 1YIOA 5DEQA 4B1RA 1U5TB 4RAGA 3VYTB 3RDIA 4PFOA 1OMIA 1MH4A 2DOEA 2EPFA 2LBFB 3GCMA 1I27A 1FSEA 2DA6A 1OYYA 5B1AH 1RR8C 5DDGA 3LQQA 3KETA 2ESHA 2QSFX 4G8XA 4XKVA 2Y30A 2QBYA 4WX9A 1N77A 2EFOA 1FOWA 2GZWA 4M3FA 3CCEI 3H0GJ 5ILSA 5M3FJ 1O3TA 4AYBN 2YR2A 1K78A 3HRUA 1RIOH 1DDNA 2KZVA 5L3EA 2LNBA 3F3XA 3HYIA 3J81Z 2DA2A 5C44J 4NQWB 3GX4X 1RETA 4XOPA 1XSXA 3TW7A 1RESA 3SZTA 2B0LA 1LVKA 2RNGA 3SHFA 4MEXF 2W1OA 1I5ZA 2X9DA 4HLXA 2YU9J 5ILVA 2QSGX 1FBQA 3PFIA 2XF7A 3F8BA 2HDCA 2VASA 3H0DA 2GQQA 4LLLA 1PYVA 2XHKA 2M87A 5K7FA 1M1EB 1BW6A 4KIBA 3A0HC 2KRCA 3K6GA 4I09A 2ELHA 4BDZA 5EGOA 2X85A 2K40A 2ZB9A 3E6DA 1IV6A 2F2EA 1U0JA 1RKTA 3QPSA 1FP2A 2W7NA 1PVEA 1WQ2A 2QM3A 3LFUA 1Z7UA 3RPQA 3BR3A 2BYVE 2Z16A 1H9TA 4NBQA 5D5WB 4G7OF 2STTA 1S5LC 3VEPA 2RAEA 3WE2A 3K9TA 2JN6A 5CKTA 1H8AC 4FISA 2ZMEB 3C18A 4YIRX 3DU6A 4OU0A 3FK7A 3ASOH 2CRGA 1R1VA 1W0TA 1IG7A 4HSTA 1YYVA 4LOCA 2ZNYA 2YUSA 4D7MA 3H9JA 2GAUA 4D7NA 2ME0A 2FD5A 4OINF 1DPUA 1MW7A 4LB5A 2RNJA 2AXTC 1U5TA 1TWGJ 2PN6A 3ZR8X 1R1UA 2Y0SA 2CW7A 4IHYA 1XSDA 2LBFA 3HKZN 3KLOA 1D0XA 1D5YA 3G6EI 1HBXG 2Y0MA 1TQPA 4QIWN 5IPAA 4GXOA 2HFHA 4HQMA 2F5VA 2ECBA 3OIOA 3G73A 1X1AA 2QUFA 1QA6A 2ZSIB 9ANTA 5FO5A 2V1XA 1W4MA 2DXIA 4RGUA 3QPLA 5F0HA 3LSGA 2WWYA 1MBEA 4QPOA 4AIDA 1MSEC 3LSMA 4CH7A 1HSTA 4C30A 4I98B 1IW7F 2TDXA 3FDYA 3KEYA 2Y2ZA 4NQWA 3CJNA 2JSPA 2BY2A 2L9RA 4GYGA 4HDUA 4RS8A 2YSRA 3PQKA 4P1WA 1O3SA 3HOVJ 1HDDC 4GFBA 3CF5F 3ELKA 2JQ7A 2A61A 1O3RA 3LA3A 4HNTA 4BBSJ 1YI2I 3BTCA 1E0EA 3I0TA 4BKXA 3OY9A 1AHDP 3U21A 4IRGA 2VT3A 2VJ4A 1D8KA 2HVQA 3DWLE 3S14J 3OYJA 1EF4A 3B6AA 1FT9A 2CV2A 2V1DA 4Q47A 2HDWA 4XN0A 1S29A 2PG4A 2VXDA 4MO7A 3E3VA 2IA1A 2ISZA 3K4LA 4IOCF 2K5CA 3LAJA 1H88C 2CJJA 1L0OC 1XGOA 4DBQA 4PSXA 1YQAA 2ZMEC 3QP6A 2E35A 2LYCA 3HB9A 3WG7H 2JZYA 2B63J 1U3EM 3VSLA 1MNMC 5E18F 3ULQB 1IRZA 2R7QA 2ZMEA 1KA8A 3EUHA 2HVRA 1OYWA 1TNSA 4N4NB 4YG2F 1FYKA 4IHVA 4M73A 2HOSA 3KEQA 3FBNB 1BM9A 2Y48A 3FWEA 4PSWA 3BC8A 3M7GA 1Z6TA 3HOXJ 1ETWA 2KIUA 1ZK8A 3ZMVA 3OYEA 1P6RA 2E2HJ 1LDJA 3FZVA 1T2KA 3I55I 4ZH4F 3CUQC 1KYZA 4V19K 3K1PA 1JJ6C 3CCLI 2PI0A 2EJRA 1WH5A 2CW8A 3BJAA 4MQVA 2EK5A 3ZRGA 3DQVC 3EUAA 2FBHA 5F08A 2CGPA 1RUOA 3ZMZA 4UVBA 4IHXA 4ZTFA 5HS8A 4RB1A 3DLLF 2DBBA 3HHHA 4EJVA 3I53A 2G0EA 2GWRA 3Q9VA 3F9KA 3KX2A 1XCBA 2OCCH 1OCPA 2JTVA 4C2UA 1SC7A 2RN7A 1IC8A 2LR8A 4CCLA 3MZYA 3G1OA 4Y4RA 3K70C 3I5UA 2CUEA 5DCMB 2JPCA 3N4MA 3OYAA 3E6BA 4YIIA 4AM3A 3ZQQA 1UG2A 2B7EA 4XNFA 4PJMA 1KYWA 4IJAA 4XRFA 3BDDA 1QBJA 2WAQN 4XLFA 4WK8F 3L09A 2D45A 4IHWA 1DP3A 5EEGA 4E7IA 2C6YA 1FYMA 2FF4A 2HQ5A 2DT6A 4IO9F 1F43A 5FD5A 5K5QA 3E1SA 2HVSA 1WPKA 5CQGA 3ZMSA 3AKZA 1W5SA 4D0PA 1K61A 1CF7B 4WXCA 3H5NA 1J59A 4GCVA 2CO5A 1I50J 2AQFA 2EFWA 1PUFB 5LEKA 4IVNA 3GUDA 1XGMA 3BROA 1HXDA 3CO6C 2JA2A 4XSXF 4C9YA 1ZR2A 5CVIA 3VYUB 3K4JA 2L9NA 3C2BA 1HF0A 2K4BA 2VIXA 3CF2A 5BMZA 4BQOA 1KQ0A 3G1MA 4AYBA 3D0SA 2Y31A 1GLNA 5E1WA 2NOJB 2VQLA 2X6WA 1P4WA 1B6AA 5FFZA 1HDPA 2EA2A 1QQIA 3FXOA 2ELKA 3CDLA 2IW5A 1T8IA 4UB6C 4XLCA 5EZHA 2A69F 2JVHA 2K02A 4G9YA 3SXYA 4A3JJ 2XF5A 1ITYA 1IGNA 1ZTRA 5B66C 2NAZA 4I01A 5FLVA 4HEA2 1VF9A 3KCCA 4CZCA 2D1HA 3X2QH 2P8TA 2W85A 3ECOA 2LG4A 1REPC 2VONA 4XLNF 2P5VA 1MBKA 4MNUA 4P9FA 3M3YJ 2DTZA 2MA3A 1E3HA 2FJ1A 2QCOA 4IZZA 4ZYAA 4ESBA 2NVQJ 1MJBA 2LY2A 3HPHA 4A12A 2EA4A 2JUGA 3MKYB 3TP3A 1MSFC 1SEUA 5FKLA 1ETYA 1I3QJ 2VQCA 4KJZA 5JVGF 4IPAA 4GYIA 4HQEA 4PDKA 3EQLF 3OOPA 4CCJA 2V9KA 2H27A 3D5SC 4DYRA 3MCZA 2VBYA 5EEHA 2XASA 1JTXA 3ZQFA 1IN7A 5DCMA 4KDPA 1BIAA 2UWMA 2RREA 5E3NA 1LEAA 1ZG5A 1KONA 2H09A 5ICFA 3BG5A 1HW1A 5FB2A 2QSHX 2R7TA 2KT0A 2A6EF 3QPTA 3V8KA 2HDDA 4GRIA 5FJ8J 3CJTB 4RGXA 2HKOA 4H0EA 4BJTA 1ULYA 3AAFA 1PUEE 2NNNA 5D4RA 1U9OA 3BQYA 2G7HA 2VOOA 3R0AA 2RQQA 4DZPA 4D5FA 4JX5A 3BG3A 3HUGB 2DFFA 1CF7A 2BXYA 2XV4S 2JWTA 3C3WA 2OCEA 2OUMA 1R5HA 2DW4A 2LVSA 1LEBA 1DP7P 4M9SA 1PUFA 2V79A 3PQJA 3IH4A 2DMNA 1X3UA 3HOTA 5GPAA 4I0AA 1HKTA 4LB6B 2FUG2 3EDPA 1KQ8A 1J75A 5FROA 4XR6A 3JRGA 1TT5B 5D8KB 5KHDA 5JFRA 4BNCA 1K83J 3S1QJ 2JRTA 3OYNA 3S2HJ 2R7VA 3RIRA 5TGTA 4YRVA 2XAQA 4DIQA 3FISA 3WTVC 2RDPA 1A04A 2K27A 4AIKA 1ZG3A 1R5ID 1VQPI 1O3QA 4LIVA 1YX5A 3E6MA 1QZZA 2KP6A 1KZHA 4RBOA 3J7AY 1AOYA 2M0MA 2R7ZJ 4C2TA 2LDUA 2LK2A 1T08B 1G2HA 3KP5A 5CJ9A 3LSPA 1E17A 2CUZA 3JTGA 3AG3H 2L9VA 4BH9A 3K4NA 3R61A 1CGPA 3FKIJ 3GF2A 2PMZN 3NEUA 1W0UA 3KYCB 4F7ZA 3U1DA 1D5VA 4RDUA 4EJTA 4ABZA 2M3AA 2PEXA 3LFKA 4C2MJ 2BY0A 2VKEA 3JSOA 2KQRA 4HLYA 1G3SA 3TP0A 1YJ9I 2V6CA 4HV6A 4MIMA 1VQ8I 4HYEA 1QGPA 3DCFA 3PIOF 3MFKA 1WKMA 4N4OB 1U8RA 5BNGA 2B9SA 1V3FA 3GW2A 1QNTA 2HR3A 4BE2A 1V54H 3BY6A 2R7FA 1YTYA 2E1MB 4ENKA 3P7NA 1A36A 4MEYF 5M3MJ 3DEEA 1GVJA 3OV8A 2H6CA 1YW9A 2HXIA 4HDVA 2HPMA 3OIQA 2IVMA 4Q5SF 5HVQC 3OS2A 2Z33A 1VQNI 4A2UA 2OJED 4M9XA 2ZSHB 1KU9A 4JP0A 4EV0A 3SZPA 2VJ5A 3K4KA 3KEOA 4A3MJ 1SMYF 3RQ4A 4ON0A 3M4OJ 3TO6A 2LKSA 4DZJA 2L7KA 5DTDA 3ESWB 1Y8QB 2R93J 1VQOI 1BL0A 1Z21A 3MWMA 5CLSA 1IN4A 2PBIA 3HUGA 4IL6C 4A3DJ 1D8JA 2XC7A 3KZZA 2RV8A 2XKPA 4ZDLA 1BJZA 2NS7A 3M1EA 5J40A 2CW0F 2Z99A 2WA0A 4MFDA 2OD5A 3PL8A 1G3TA 4B44A 3BLYA 2W57A 2XRLA 5JI6A 2IXSA 3I9V2 4MLOA 2JA6J 2QKMB 4KISA 1IDYA 4B8XA 2V9VA 1S7AA 1XSVA 2A07F 2EFQA 2DFHA 2OBPA 1R5GA 2ETHA 5FD6A 3OIPA 3S3MA 3L7WA 1WRJA 2CFOA 1Z3XA 1FZPB 4BBRJ 1OYIA 3KP4A 4N9IA 3ZN0A 4YIFA 4M3EA 4UHTA 4LMYA 2VODA 1MIJA 1X1CA 4FHTA 3T8TA 1O4XA 2KLOA 4G7ZF 1D1CA 2YS9A 3SFZA 1PP8F 3GMEA 5ED4A 3SDGA 2XF6A 2HWVA 1JTYA 5DM6F 1ZRDA 4PK4A 3C2HA 4ASNA 2E34A 4ETSA 4RB3C 2CFXA 3VOEA 5CVRA 3A02A 4MTDA 3J80K 1ZKGA 5AONA 2ZXWH 3OS1A 4OIPF 3B6CA 1N78A 1LFUP 4ZYEA 3JRDA 3DTIA 1T98A 2NXNB 2DA3A 2E36A 2NVYJ 5IY5H 2R5YB 2M2EA 4RLFA 4FX4A 3H9GA 3PNVA 2VJIA 2CQ7A 1IRXA 3DLAA 1GXPA 3LNQA 2QQBA 2X1CA 2V4JC 3P9KA 3LOCA 2W00A 3TDUC 1FTTA 4L0YB 4JX4A 3RTRA 1RUNA 5E3OA 3G4SI 2XKOA 2BV6A 3H92A 4KNYA 2DMQA 2ZJRF 2XAGA 4LLGF 5FGMA 3JREA 3SJMA 5ICGA 1LJ9A 2ELJA 3SFIA 1K79A 1QZEA 1V5EA 4OAZA 1MMDA 1G59A 4GDFA 2FMYA 3VDXA 4ZYGA 2JJ7A 3TOAA 1XG1A 3BPVA 2QA4I 5DUKA 2X6OA 5A2QK 4IHTA 2LSOA 3PO2J 2DOAA 2JRMA 5J1UA 1T39A 1FNNA 2K85A 4CO8A 3OSFA 2HEOA 3HTSB 5B3SH 4IQJA 1G3YA 2A3SA 2GM4A 1ZRFA 1GT0C 1YLFA 2WB1N 1T0FC 2G7UA 4RAYA 3M8FA 2DAOA 1WH7A 2K3PA 3SEZA 3OYIA 3K7AJ 2HQRA 5CPRB 1K6OA 1P92A 1L3LA 1T0FA 3R60A 4F3QA 4HNUA 1UCRA 3RZDJ 3K2ZA 4UB8C 3WTXC 5F64A 4YFNF 3N05A 1FWZA 1WCMJ 1QVUA 2K86A 4DOZA 1TP4A 4HW0A 5IT9K 5HS9A 3NWSA 2KRHA 1TNTA 2L0KA 4BXFA 1ZREA 3V8JA 1A6IA 4B47A 5M5YJ 3BG9A 3F6OA 1WJBA 3TL4X 3JRAA 5D8LB 4ZDPA 3NQOA 4RA2A 2L4MA 3GEZA 3WE3A 1TQIA 2XROA 3CLOA 3W6KB 3BR6A 2VL8A 3ASNH 1JT0A 4B43A 1ENHA 1X3WB 3AL0C 3GBGA 1Y6IA 5DS9A 1Y8RB 1SMTA 3GTJJ 4PGGA 3HXLA 1GVDA 4UUTA 3HOWJ 4C3IJ 2DDBA 3F22A 4FTHA 1FOKA 1JHFA 4JK1X 1HCRA 3F6VA 2COMA 2LRDA 4XLHA 4QSHA 2R3SA 2VPLA 2KJBA 3HC7A 3DF8A 3A01B 1JKRC 3BJ6A 2IJLA 1MMGA 2A6HF 2QQ9A 3B73A 1JXSA 1WZ2A 2BGCA 1F36A 1K4SA 3LMMA 3TW6A 1S7EA 2DA4A 3COAC 2R5YA 4E7LA 5GAEJ 4YELA 1XX5A 4YFKF 2BEOA 1ZN2A 2L4AA 3S2DJ 1LB2A 2FOWA 3OS0A 1DU0A 5ICCA 4HA8A 4XONA 1O7FA 3OL3A 2A6TA 2PX9A 4ZYDA 4IKFA 3ABTA 3ZQCA 3EYIA 2VQGA 4OOIA 2OPTA 3TQNA 2ZBKA 3E5XA 1V55H 2ZKZA 4BHPA 3I59B 4JOMA 3MD2A 3ERED 5FRMA 3DBRB 3W6JB 1QZYA 2XAFA 4G94A 2DTRA 5E8GA 1JT6A 2EBIA 4IOAF 4X6AJ 5HLHA 4XL9A 1SD4A 3TO9A 1XC5A 3ZMTA 4KT5C 3CO7C 2PMZA 2WY8Q 3F8NA 1SD5A 2VKHA 5H6QA 2MD5A 5F1RA 3FX3A 4BY1J 1ZG1A 4DYCA 4NHJA 5FFXA 1RI7A 5LHHA 2GA2A 3CUQB 1X2MA 1TWCJ 2TCTA 4A0XA 2AS5F 3CJRB 3U1KA 3OYBA 5LGNA 1USSA 3TGNA 3DKYA 3GVAA 2Q0OA 3FXQA 2V1UA 3TOBA 2L5QA 5LFAA 3CDHA 2M45A 1UELB 2E2IJ 3QYFA 2O6GE 3V7CA 4I2OA 1LNWA 2MC3A 3OYKA 4B09A 1YHQI 1LE8B 5HODA 3ZMDA 2GXBA 5ICEA 4ZTJA 3ZXSA 3O8HA 1U2WA 3TEDA 5GTHC 2OQGA 3HSFA 5D5XB 4E7KA 4BDYA 1S72I 4PJJA 1W36D 2WV0A 5KAFC 1G3WA 1F1ZA 2L7MP 2ESNA 2LKXA 3KYDB 3L2VA 1QVTA 3CCRI 2DLLA 3I58A 4FQGA 3A01A 1YW8A 1YJWI 4IRHA 4WF2A 3KP7A 4DW6A 4O3MA 2PJPA 2L7FP 5J1YA 4XLPF 3MKZA 2M8EA 4A3IJ 2CG4A 4M3BA 3A1YA 1I1SA 3H3UA 1J0RA 4LJZF 2Z3YA 2ZCWA 1R49A 2ZJPF 4OAYA 2ZO4A 2HU9A 1ZAOA 5KCMA 1R36A 4KITB 2XRNA 3ZCOA 3JTHA 4XRMA 3J80Z 2P5LC 3CC4I 2F4IA 2IRFG 3JCUC 2VB6A 4W1UA 4ZJZA 3WTWC 3CC7I 2F5EA 2BOLA 1FEXA 4LG3A 2HQNA 1WJ5A 1RKWA 1WWXA 5HLGA 3CP8A 5IYBJ 2NRAC 1HA8A 3HBLA 2BHYA 2QKLB 2L01A 2DPUA 3K0LA 2WADA 3JW4A 1SFUA 3I59A 5J6XA 1TLHB 4ZYHA 3O6BB 4A5NA 1ZARA 1D0ZA 3UNGC 3EPZA 5K1YA 3R6SA 3F8FA 4A69C 2TRTA 2VOPA 2D5VA 3V42A 1SD6A 1ON2A 5E3MA 2E2JJ 3ZPLA 2XGXA 3L1PA 3DPUA 2X48A 4P9UA 2LP0A 4NB5A 5A2QZ 2BXZA 2FA5A 2VE8A 4X0GA 2FRHA 2HXOA 4AVPA 5E1XA 2JT1A 1T33A 4B3AA 1FX7A 1Z67A 5DD8A 5CVVA 1OQYA 1W5TA 3FXRA 2Y9ZA 5KVRA 1OFCX 3VODA 3CUQA 3PSFA 5DCFA 4S0HB 2CUFA 5CVUA 3KP2A 1APLC 3NARA 2LH9A 1FY7A 2W82A 3IHUA 4DNCA 1VQMI 1K7AA 1R23A 2MGQA 4PJLA 1WGXA 2O8XA 3BWGA 1D0YA 4A3BJ 4HBLA 2ECCA 5HNFA 1YX3A 2XVCA 3U2RA 1LE8A 5IT9Z 1I6HJ 2R7DA 3BR1A 4YFXF 1TL8A 2L02A 1IJWC 2M0CA 1HKSA 2HKXA 2HS5A 1Z05A 2M7BA 2KKOA 2X51A 3REOA 1T6SA 4Y15A 3L2QA 3BPXA 3LSJA 3QP5A 1WJFA 4JQFA 2J5PA 1ZYRF 1BBYA 3QWLA 1SFKA 2W24A 2MFZA 3JSPA 1O7LA 5D6FA 1IN6A 2CWEA 2IGMA 2WB1A 1F4KA 2F48A 3WGHA 5KNLA 2DMTA 5JLWA 1TWAJ 3Q0UA 2DPDA 3K4BA 4CCMA 4BJ5C 2XGCA 3LSIA 1KQ9A 5E17F 2XGDA 4ZZDA 3FBIB 1YG2A 3ML6A 4BEHB 2V9PA 2ID3A 1UJ8A 1YJNI 1ZH5A 1IDZA 3OR1C 3CCJI 1E2XA 4HOBA 5CYVA 1W7PB 1IRFA 3DU5A 1OCCH 5FKNA 4WXHA 1B9NA 2DODA 5JR3A 1BR1A 2EZLA 1POGA 3MN2A 3CESA 4GGGA 1MZBA 2IT0A 2KIQA 4IF4A 5C4XJ 2ZFWA 2QENA 1U6GA 5GPCA 5E8IA 1NK2P 1LFPA 2EB7A 2ID6A 3GYHX 2W4SA 1Z91A 3E97A 5TJJA 3GFJA 1MMNA 2COBA 2CSOA 2UZKA 3FXJA 4C3HJ 1USTA 3CMAI 3F8CA 1UHSA 3S3OA 4J01A 2D1VA 2DYSH 1UMQA 3QU6A 4E4HA 1SD7A 1Q1HA 5GADJ 1FC3A 2YX4A 1IZ1A 2Y69H 2PFBA 1U8BA 2HGCA 2JSCA 1V5GA 1KU3A 4PGHA 1Z3YA 1MBFA 4ENNA 4HG2A 1BI3A 4M71A 3RJPA 2VT2A 2DOFA 2LC2A 2XSJC 3K4CA 1OCZH 3S2WA 3HDDA 2RKHA 2M4KA 1R6RA 3V4GA 4EEFG 2O3FA 2H6BA 1EH7A 5IOZA 4KN4X 1UB9A 1ORKA 2H1LA 3KFWX 2P0WA 5D4SA 4LK1F 3W2VA 2A5YB 2KL4A 4ITVA 4F55A 3HEFA 1B9MA 5IYCJ 4RB2C 3E7LA 2BW3B 3GZNB 1DGRM 2MH9A 3SDBA 3I64A 5GTIC 1J9IA 4GO1A 2CQXA 4B3XA 3CQZJ 3KZIC 1FBUA 2EFPA 1ZGWA 2VBWA 1IUFA 3OMYA 1X3ZB 4EM0B 2EWNA 4BE0A 1FJLA 2DYRH 3T5XA 2ZJ2A 2V7FA 4M3DA 1WJCA 4EGYA 3L2CA 2L7ZA 3WU2C 4CDGA 1YIJI 3HKZA 2CV0A 1U9NA 1YS6A 4BEHA 2JUCA 5E3LA 5LLQA 2JK3A 1S6LA 2EIJH 4CGZA 2OQRA 2XPWA 1XS9A 3RKWA 4KMFA 5HNHA 1W7PA 2YPRA 4CYDA 4N0BA 2I8DA 2K9QA 2DCEA 1IN5A 5F27A 1R4MB 2NOGA 5LBQA 5K5RA 1ZR4A 1R4NB 3RQIA 2EH3A 2IGKA 2LY1A 2L54A 2UV1A 3QU3A 1ETOA 2NVTJ 5DV5A 2HZTA 2K3FA 3FXMA 3BCAA 1UG0A 5E20A 3BZCA 3KZYA 1VI0A 2YU3A 4XLAA 1QU3A 2W84A 2JPBA 1LFBA 1P4AA 1IV8A 3ZN1A 1Y0UA 3AFHA 4R1HA 4ENJA 4HZFA 1MNEA 2IS1A 3IRQA 2KPMA 4XSZF 2H8RA 3W2WA 2V26A 2QLZA 3A0BC 3QOPA 1SVLA 1F9NA 1MD0A 4PUSA 1H89C 2F5FA 3DBLB 4F52A 4M3GA 1ERDA 1MBGA 1LPQA 5EG0B 5DD4A 5HDKA 3L00A 4F93B 1VQKI 2M30A 1XMKA 4A0YA 3CP2A 3HZJA 4M74A 1Y39A 3S17J 3BTJA 2E5NA 3IH3A 1GHCA 3G1LA 2GXAA 5LGUA 1ONVA 3L2UA 2XSDC 3GTOJ 5LD2C 1HOMA 2MG4A 4D1QA 3K70D 3LWFA 2LY9A 5FLXK 5BPDA 4U0WA 1ZGJA 3JRFA 1VQ9I 5LHIA 5HOOA 4WWCA 1BR4A 2E7XA 1TBXA 3CCYA 2GOMA 3JRHA 1K4TA 2BW3A 2BVLA 2WY7Q 5FKMA 3R4KA 4O6JA 1X19A 2ZJQF 4A5MA 2I5UA 5TISC 5J4VA 4AIJA 3PO3J 3IAM2 2DK5A 1HKQA 1G8XA 1GV5A 4MGRA 1JGSA 4HNVA 3CJQB 3OR2C 4UUSB 3RCOA 2Q1ZB 2OU2A 4J19A 2Y75A 3HJEA 1BJAA 1H0MA 1JUPA 3QYBA 4HPQA 1JKQC 1ZQ3P 2E7WA 2W25A 3WTSC 4CCOA 2O03A 3V7SA 4IHSA 3JRBA 4CCKA 4CHUA 4IRIA 1LKXA 2VQHA 1Z0XA 2VC0A 2K4JA 3FMSA 3FK6A 2ZXIA 5GP9A 3H5RA 2ICWG 2O8KA 4WXDA 1G6NA 1E3OC 2QEXI 2GOXB 4DJAA 3PUBA 5J8FA 2X4HA 3CDIA 1D3YA 1I1GA 1MJ9A 2IS4A 1Y56A 1C0WA 2LREA 2GA1A 4ESJA 2HOEA 4UNOA 1V4RA 3BTIA 1FLIA 4OIRF 2DT7B 1IO2A 4DYQA 3PNTA 1X1DA 4BUPA 4K2EA 1R71A 2H1KA 3FKJA 4KIFA 3PSIA 4XMYA 3Q0VA 2K9SA 5F0FA 4A3LJ 3BR5A 4FASD 2IEKA 3VWBA 1EKEA 5EEAA 2K9MA 3ZQLA 1N75A 3N97A 1BI0A 4BHCA 2E5ZA 4J00A 4LG0B 3AL0B 2ISYA 1UZCA 2H94A 3SZGA 1TT0A 5CVJA 5EG0A 2VE9A 2WAQA 3G2BA 1TC3C 3Q0WA 2CS3A 1OCTC 2XAHA 1YITI 1YO5C 4BS9A 4HSRA 3CUOA 2WV1A 2EINH 4HRIA 4PFPA 4R79A 1E3PA 3JR9A 3WTYC 5J3LA 4AWXB 3CLQA 3S93A 3TBIA 3IAS2 2F5CA 2L3DA 2XPUA 3S32A 2KFDA 5H6RA 2JA5J 2HI3A 1IRGA 2OF7A 1T95A 4HX4A 1DPRA 2P81A 1QPIA 1KGSA 2P5KA 3EUKL 3V8LA 1XDUA 4QWQA 3K4MA 1UHWA 3I4PA 3FMQA 3ROUA 5F1JA 4NC7A 4HV5A 5C3EJ 1QHHD 3ZQIA 3NRVA 2EZIA 1MMAA 1Q1VA 2VC1A 3DKXA 3P9CA 1WJEA 2M8GX 3LSTA 3PUFA 3OYCA 3IWZA 2DMUA 3DV8A 3JRCA 1DGWY 4RM2A 2ADUA 2WC2A 4S05A 2DI3A 1B4AA 2DA5A 2IGNA 4UUSA 2AXLA 3RYPA 1D1AA 5H20A 1FMWA 3KE2A 2FNAA 5K7HA 1X1BA 4CSWA 3KYLA 3HIFA 3HTUA 2GXGA 2V1NA 4G6DA 4I6ZA 3IWFA 2VJJA 1YFHA 2IAIA 2EILH 2NYXA 2OC6A 2P6SA 1MBJA 2XIGA 1FYLA 4NUBA 2LOOA 2ZC2A 3BCBA 3GLLA 4CA0A 2FQ4A 4HF2A 1BN5A 3FM5A 2I10A 1RR7A 1P7IA 2M4GA 4BJ6C 3LA7A 2P6TA 2OZ6A 4P55A 3BR0A 3IKVA 2GBYA 2A05A 2D2WA 4PCQA 1T56A 5IOYA 3CCVI 1XN7A 2EV6A 2HQAA 2JVGA 4XORA 2LD5A 3GTPJ 2E19A 4XK4A 5BPIA 1DQUA 1Z1DA 2N8GA 2VUMJ 3TDZC 2F4OB 4IEJA 1SVOA 2MLGA 1BI2A 1CQTA 4KICA 2OAZA 3T1BA 1NK3P 1VQLI 1AU7A 2FSWA 3M9AA 4YEJA 5L3CA 1SANA 3DXJF 1JE8A 2MBFA 1EH8A 4LG0A 2BY1A 4XIDA 3JRIA 3E0JB 1NG6A 1OKRA 3HSRA 3F21A 3CMYA 4OIOF 3CD6I 3JAMK 1FP1D 2UXXA 1TTYA 3M07A 2M1BA 2JA7J 2VKVA 4L9TA 2RQPA 1MJAA 1R22A 5EDNA 2GIVA 3WTZA 2IS2A 4AD9A 4BXUA 5L3FA 2MABA 4FETA 2AO9A 3GWZA 2Y9YA 2NNYA 3GZ5A 3ZQ7A 1EJ9A 3Q9SA 5ERIA 5KK1A 2Z2SB 4I7HA 1JI8A 1YS7A 2DO7A 3BJOA 2KJCA 3MZ8A 4M72A 2E1CA 3HOYJ 2E71A 3VSKA 5LRRA 5DM7F 4UY8I 4V2GA 3VYRB 1X4PA 1Z6RA 3ONQA 1XB4A 3I4NJ 1F5TA 4BYYA 3KP6A 3PNYA 1LUJB 5J47A 1GDTA 3WODF 5M5XJ 1UFMA 2BE5F 3CMMA 3UR3C 1V5FA 2DJIA 3GLXA 5F6FA 5FLXZ 3WTUC 3AG2H 3IH2A 3DFGA 3Q3SA 3SYTA 1VFCA 3ABKH 2IS6A 2ACJA 3S3NA 3WHCA 4U88A 4M6XA 1ACIA 4D5CA 4G7HF 4HX7A 3OYFA 4OIQF 3DTEA 3VFZA 3OYDA 3HOSA 1IAWA 4AVZA 5HDNA 1SAXA 2DU9A 5H2FC 3QRFF 4G12A 5FLMJ 2AQEA 1O57A 5J1RA 3WTTC 5HDGA 2O7OA 1OISA 2MC4A 3CC2I 1X1PA 1J2XA 3H35A 2QQ8A 3M8EA 3FM3A 3H3VK 5AIQA 2XB0X 1HSJA 2BZTA 2BBYA 3ZQHA 1DUXC 4XKWA 3NWTA 1U5TC 3QODA 2G9WA 2CH0A 3MKLA 2GLOA 4BY7J 4BGDA 1WVRA 5ILUA 2DFEA 3PM1A 3BZ6A 4AUXA 3LL7A 2OV7A 1A5JA 1DU6A 4ZZLA 1IXRC 2X0LA 5HS7A 1B8IB 2FE3A 2DT5A 1A31A 3D5RC 4L9NA 3HL2A 4A3EJ 2FOKA 2IA2A 2WBMA 1JHHA 1R00A 3KPHA 2BY3A 3K69A 4MHGA 3BP8A 4II2A 4IX7A 2CQNA 3DBHB 2FMLA 4RB0A 4NC8A 3GZ6A 3QAHA 2OTLI 3I56I 5B1BH 3BR2A 3BOQA 3DEWA 1JKOC 4M9ZA 4BL0B 4ENMA 1HLVA 5M5WJ 1BC7C 2NS0A 2DDAA 5HLIA 4LIUA 1WSUA 1BIBA 1FSHA 2KDZA 2QZ8A 3HRTA 4UV9A 1B59A 2EZKA 2IGOA 3BZKA 2R7RA 2CQKA 2EV0A 4BHBA 3MEXA 4U7DA 2LFBA 3W2AA 1XCVA 4KUMA 3BG7A 1D1BA 2HYGD 2XB5A 3F8MA 2HNHA 2ZXJA 3RPUA 4KIGA 3DP7A 2HOAA 3TKYA 1BI1A 1ZELA 1SFXA 5BQTA 2VI6A 3ZQGA 4B48A 4TV7A 3F23A 5FRNA 2DFIA 2QYOA 1ETXA 4OMZA 4RGSA 1STZA 3AG4H 3ZGKA 4CYCB 3E6CC 3HOUJ 2XUBA 4O5VA 1ETKA 4X1EA 3EUHC 4RGRA 5IP7J 4PJ0C 3LSRA 2EZHA 4BXXJ 1S7OA 3H3ZA 2X1EA 5IP9J 1OJLA 1T38A 4FCYA 5EF6A 1BOAA 2Z5UA 4XN3A 3WU0A 3SQNA 4BQQA 5GAHJ 4XICA 1XMXA 3IRRA 4I0BA 3I54A 1JUMA 2Z1DA 2QVOA 2VBZA 2CV1A 2WTEA 2AHQA 2JA8J 2KHMA 1MGTA 2XAUA 3KP3A 1TQMA 2MD0A 2MW8A 4I02A 5B5EC 3L2RA 4C3JJ 3MZHA 1IN8A 5F04A 4G6QA 1MH3A 2EIKH 2IPQX 2K7LA 4UUVA 1B8IA 2YX7A 4L5JA 3L2WA 3TO7A 3GTGJ 2QF7A 3OSGA 3OYMA 1IXSB 2IBDA 4Y13A 2E1OA 1HQCA 4XRSA 2A68F 1LDDA 3HPGA 3KLNA 4L18B 3GFIA 2Z9OA 1RNLA 3UKGA 3LSHA 3ABLH 3G3ZA 2ZXHA 4EGZA 3S8PA 3LAPA 4A6EA 2MLKA 1P2FA 4PZJA 2FQ3A 4EQQA 3S1RJ 2QQAA 4L9VA 1TWFJ 3DEUA 1IUYA 4XKCA 3K1NA 3FXLA 4LITA 3W6VA 1H9GA 3HOZJ 1Y0NA 4KMUX 1OR7C 4EATA 1FOXA 2QGUA 3MVPA 4FT8A 3PIPF 1EH6A 1N25A 2DQLA 3C7JA 5CQEA 4CCNA 2VBXA 4E7ZA 1X2NA 2HYJA 2F6CA 3HRSA 1OR7A 3DTKA 2X6YA 3JAMZ 5C4JJ 4XM3A 4A3FJ 3NAUA 1FBSA 2LLKA 1FIPA 3RYRA 1SAUA 3MQ0A 1AWCA 4Z2YA 3RSNA 4DBRA 1FOYA 1K6YA 1RC9A 3BT9A 1TZLA 3WGGA 4XLEA 1OPCA 3LA2A 2H8WA 3OYGA 3IL2A 4CXFA 5DYMA 2CU7A 2RC4A 4XRSG 3F72A 1BA5A 4U0VA 2O0YA 2RGVA 4XKBA 2X6XA 1XPXA 4EJUA 1KU2A 2R7SA 3VYSB 1BC8C 1PP7U 1BR2A 3G71I 2F5DA 1HW5A 1S3JA 3MMYB 4RM3A 1RZ4A 4CUGA 4RAZA 3VB2A 2OZUA 4CYCA 4BQAA 2O5RA 4UVCA 3QPHA 3J7ZI 1XDSA 3C2GA 2HZDA 2M5WA 3DPTA 1X4OA 4MFEA 3QOEA 1WJAA 2R92J 5F0CA 1ETQA 2DA7A 1R9TJ 3E5UA 3CMEI 2VKDA 1YOVB 5K7ZA 2WAFA 2LKPA 2LTPA 4AIHA 1G4DA 2FNPA 4FE4A 4RLQA 4E7HA 3H9QA 3D5LA 3CCMI 5IYDJ 2RVCA 2XGEA 1P7JA 4E7JA 1B72B 1UHMA 2M7AA 3ZOBA 2FU4A 5IP6A 2OA4A 1VQ6I 3MAJA 4ZDOA 3HSEA 1NTCA 5EYRA 4EM2A 3BG6A 1FIAA 2VLAA 3A03A 2PJRB 3PFYA 2DJNA 4FE7A 4A3CJ 1Y1VJ 3BTLA 4A3KJ 1WI9A 3BQZA 4I99C 1ETVA 2EQRA 2R4GA 3AG1H 4XQFA 4F91B 1MMSA 3ERMA 3RI4A 2HYFA 4RMNA 4XOTA 1A35A 1PJRA 4L0ZB 2R5ZB 4BACA 1GUUA 4Y52J 2QWWA 4JBAA 5D5VB 1R1TA 2XDVA 2R0QC 2P7VB 5TRDA 4L5EA 1J09A 3RKYA 2PMHA 3RPUD 2R7UA 1VZ0A 4EVIA 4QLCU 2IP2A 4IXAA 2STWA 4ZC3A 1J7KA 2KMUA 3ZMUA 5J8CA 4DQ2A 1YRNB 4HAMA 2CMPA 2WAEA 4DGWB 3HGYA 6PAXA 4BE1A 3J7AO 4Q4ZF 1EV7A 3IUOA 2X1DA 1AKHB 4LK0F 2M9HA 4D9JA 3H1CA 2FX0A 1VQ4I 2V6EA 3R0JA 4CICA 4B4CA 4JYKA 2MH2A 3Q5FA 2O9LA 5LEJA 3E5QA 3FHZA 3OYLA 3CCQI 3ABMH 1P9QC 1S8NA 2UUZA 2EV5A 4BAYA 3RKQA 2E60A 5BS6A 1HC8A 4BQNA 2ZFUA 1R7JA 2NVUB 1FMVA 2NS8A 2HOTA 4M6YA 1SFEA 3B02A 2ZNZA 1TWHJ 4KFCA 1Y1WJ 1Z7LA 3WG9A 3C1DA 4Z6YA 2LF7A 4LGWA 1FPQA 1MDMB 4P96A 4Y3OA 2Q2EB 4QTRA 4AU7A 3J81K 3PJRA 2PQ8A 1GXQA 2OTJI 1ZHFA 3P5JA 1W5CC 2J5OA 5L3DA 1XMAA 5DUIA 2HPIA 1MKMA 4E7SA 2NVXJ 1QPMA 2UXNA 3F0CA 3FXKA 1BOBA 2K9LA 1UAAA 2L9SA 5HLTA 4HF0A 4M6VA 3GTLJ 1BW5A 1QRYA 3HGGA 1YW7A 2W48A 3W3CA 2GIZA 1QHGA 2KIFA 4KA4A 1B72A 5JHFA 3OWTA 4EJOA 3V7RA 2Y0SN 4G6TB 4II3A 1YE9A 1HW2A 3H36A 2KRFA 3O3KA 4PJNA 4H4KC 4LFUA 5FKOA 1LDKB 4U0YA 3OYHA 2VXZA 1A6QA 4Q48A 3GTKJ 1P4XA 5E1ZB 3ZP5A 2JMWA 4NNJA 2R7WA 4E6KG 3ISPA 2PJRA 5JLXA 4LLNA 1ZLKA 1JKPC 1KU7A 4MTEA 3S16J 4UVAA 3IC7A 3OL4A 4QPQA 1OCOH 4UV8A 5GAGJ 1QO0D 3T0YA 4F92B 2EFNA 1XGNA 3LQRA 2A5WA 2R5ZA 1JJ8C 5EJCA 3KIOA 2BVMA 5LHGA 1JGGA 2R7XA 3DPLC 4ESFA 1J5YA 1U78A 3CTAA 4BU2A 3VPRA 3CZ6A 3HG9A 3CCUI 2IA0A 2XAJA 3ECHA 4MQ9F 4UXNA 1SVMA 1ODDA 1VNDA 4N9HA 4V2FA 3GXOA 2MSYA 3GFLA 5K5OA 4KYWA 2KDOA 1YRNA 3S15J 4R8HA 3P9IA 3K2AA 1I39A 1TW2A 1R58A 4XBFA 3FIWA 3H5AA 4KT6A 2VPRA 3K1MA 4EM1A 3A4CA 4S04A 4Y33A 3I71A 3FHNA 4EMSA 5JVTA 1SFOJ 5BOXA 5L3BA 2FBKA 1AKHA 1S9HA 2CQQA 1MNDA 3GTMJ 3I4MJ 1RPWA 3K10A 4U87A 5AIPA 4ANJA 2CYYA 2KIMA 1TW3A 1NG7A 5LRSA 4FX0A 2LF8A 2HTSA 1IF1A 2ME6A 1VQ5I 2P7CB 1GV2A 3WHBA 5L3GA 3HRMA 3I3LA 4L9JA 1VQ7I 3FXUA 3M1CA 5IT3A 2QBYB 2FBIA 3S1NJ 5D6EA 3HHGA 1W1WE 2Q2EA 1MDMA 4JX6A 1PDNC
chains in the Genus database with same CATH topology
4OWRB 4CZZA 1K78B 4A6DA 2L2OA 3LSKA 3WGIA 3U9GA 2O61A 4LD5A 1XGSA 1Z9CA 2R7OA 4Y17A 2HTJA 3L9FA 3EETA 3TMOA 2PLYA 1LVAA 2E1NA 1I6XA 5LGTA 1WFXA 2FEZA 4IQ4A 2CUJA 4L5IA 3T8RA 4U7BA 2Q8KA 2P4WA 3QYEA 2DK8A 2VN2A 3RKXA 5JHUA 3GO5A 4WCGA 3MKWB 3GFMA 3OOUA 1W36C 1EA3A 1NHAA 2DQRA 3ABUA 3EYYA 1IXCA 4EJWA 3FMRA 4OMYA 4HX8A 1W7PD 2E1MC 1ON1A 3IP4B 4HF1A 3A2KA 1ZLJA 4P5OA 1ZGAA 4A0ZA 3O2PE 2MYSA 3SEQA 3IKTA 3FF5A 4E70A 1OLTA 1LQ1A 2PMUA 3DKWA 1AA7A 4KN7X 3M8JA 1B1BA 1XD7A 2FXAA 1VTNC 5D5UB 1ZRCA 3WU1B 1WJDA 1YIOA 5DEQA 1U5TB 3VYTB 3RDIA 4PFOA 1OMIA 2LBFB 1I27A 1FSEA 1OYYA 5DDGA 3LQQA 3KETA 2ESHA 4G8XA 4XKVA 2QBYA 4WX9A 1N77A 2EFOA 2GZWA 5ILSA 1O3TA 2YR2A 1K78A 3HRUA 1RIOH 1DDNA 2KZVA 5L3EA 2LNBA 3F3XA 3HYIA 3J81Z 4NQWB 3GX4X 4XOPA 1XSXA 3SZTA 2B0LA 3SHFA 4MEXF 1LVKA 2RNGA 2W1OA 1I5ZA 4HLXA 5ILVA 1FBQA 3PFIA 3F8BA 2XF7A 2HDCA 2VASA 3H0DA 2GQQA 4LLLA 1PYVA 2XHKA 2M87A 4KIBA 4BDZA 2KRCA 3K6GA 4I09A 2ELHA 2X85A 3E6DA 2F2EA 1U0JA 1FP2A 2W7NA 1WQ2A 2QM3A 3LFUA 1Z7UA 3RPQA 2BYVE 2Z16A 1H9TA 5D5WB 4G7OF 2STTA 3VEPA 3WE2A 3K9TA 5CKTA 2ZMEB 3C18A 3DU6A 4OU0A 1R1VA 4HSTA 1YYVA 2ZNYA 3H9JA 2GAUA 1DPUA 4OINF 1MW7A 4LB5A 2RNJA 1U5TA 2PN6A 3ZR8X 1R1UA 2Y0SA 2CW7A 1XSDA 2LBFA 3KLOA 1D0XA 1HBXG 2Y0MA 1TQPA 4GXOA 2HFHA 4HQMA 2F5VA 3G73A 2QUFA 1X1AA 2ZSIB 5FO5A 2V1XA 1W4MA 2DXIA 4RGUA 3LSGA 2WWYA 4QPOA 3LSMA 4CH7A 1HSTA 4C30A 4I98B 1IW7F 2TDXA 3FDYA 3KEYA 4NQWA 3CJNA 2JSPA 4GYGA 4HDUA 4RS8A 2YSRA 3PQKA 1O3SA 4P1WA 3ELKA 2A61A 1O3RA 3LA3A 4HNTA 1E0EA 3I0TA 3OY9A 3U21A 4IRGA 2VT3A 2VJ4A 1D8KA 2HVQA 3DWLE 3OYJA 1FT9A 2CV2A 2V1DA 4Q47A 2HDWA 4XN0A 1S29A 2PG4A 2VXDA 3E3VA 2IA1A 2ISZA 3K4LA 2K5CA 3LAJA 1L0OC 1XGOA 4DBQA 4PSXA 1YQAA 3QP6A 2LYCA 2JZYA 1U3EM 3VSLA 5E18F 3ULQB 2R7QA 2ZMEA 1KA8A 3EUHA 2HVRA 1OYWA 1TNSA 4N4NB 4YG2F 1FYKA 4M73A 3KEQA 3FBNB 1BM9A 2Y48A 3FWEA 4PSWA 3BC8A 3M7GA 1Z6TA 2KIUA 3ZMVA 3OYEA 1P6RA 1LDJA 3FZVA 1T2KA 4ZH4F 3CUQC 1KYZA 3K1PA 2PI0A 2EJRA 3BJAA 2CW8A 4MQVA 2EK5A 3ZRGA 3DQVC 3EUAA 2FBHA 2CGPA 1RUOA 3ZMZA 4UVBA 4ZTFA 5HS8A 4RB1A 2DBBA 3HHHA 4EJVA 3I53A 2GWRA 3Q9VA 3F9KA 3KX2A 1XCBA 4C2UA 2JTVA 2RN7A 4CCLA 3MZYA 4Y4RA 3K70C 3I5UA 5DCMB 2JPCA 3N4MA 3OYAA 3E6BA 4YIIA 3ZQQA 4XNFA 4PJMA 1KYWA 4IJAA 4XRFA 3BDDA 1QBJA 4WK8F 2D45A 4XLFA 3L09A 1DP3A 5EEGA 2C6YA 4E7IA 1FYMA 2FF4A 2DT6A 5FD5A 5K5QA 3E1SA 2HVSA 5CQGA 3ZMSA 1CF7B 1W5SA 4D0PA 3AKZA 4WXCA 3H5NA 1J59A 4GCVA 2CO5A 2AQFA 2EFWA 5LEKA 4IVNA 3GUDA 1XGMA 3BROA 1HXDA 3CO6C 2JA2A 4XSXF 4C9YA 5CVIA 3VYUB 3K4JA 2L9NA 2K4BA 2VIXA 3CF2A 5BMZA 4BQOA 1KQ0A 4AYBA 3D0SA 1GLNA 5E1WA 2NOJB 2VQLA 2X6WA 1P4WA 1B6AA 5FFZA 2EA2A 1QQIA 2IW5A 4XLCA 2A69F 2K02A 4G9YA 3SXYA 2JVHA 2XF5A 2NAZA 4I01A 4HEA2 3KCCA 4CZCA 2D1HA 2P8TA 2W85A 3ECOA 2LG4A 1REPC 2VONA 4XLNF 2P5VA 4MNUA 4P9FA 2MA3A 4IZZA 4ESBA 4ZYAA 1MJBA 4A12A 2LY2A 3HPHA 2EA4A 2JUGA 3MKYB 2VQCA 4KJZA 4IPAA 4GYIA 4HQEA 4PDKA 3EQLF 3OOPA 4CCJA 2V9KA 2H27A 3D5SC 3MCZA 2VBYA 5EEHA 2XASA 1IN7A 5DCMA 4KDPA 1BIAA 2UWMA 2RREA 1LEAA 1ZG5A 2H09A 5ICFA 1KONA 1HW1A 5FB2A 2R7TA 2A6EF 3QPTA 3V8KA 4GRIA 4H0EA 4RGXA 2HKOA 1PUEE 4BJTA 1ULYA 3AAFA 2NNNA 5D4RA 2G7HA 2VOOA 3R0AA 2RQQA 3HUGB 1CF7A 2XV4S 3C3WA 2OUMA 1R5HA 2DW4A 1LEBA 1DP7P 4M9SA 2V79A 3PQJA 3HOTA 1X3UA 1HKTA 4I0AA 4LB6B 2FUG2 3EDPA 1KQ8A 1J75A 5FROA 4XR6A 5KHDA 5D8KB 5JFRA 4BNCA 2JRTA 3OYNA 2R7VA 3RIRA 5TGTA 4YRVA 2XAQA 4DIQA 3WTVC 2RDPA 1A04A 2K27A 4AIKA 1ZG3A 1O3QA 4LIVA 1YX5A 3E6MA 1QZZA 2KP6A 3J7AY 1AOYA 2M0MA 4C2TA 2LDUA 3KP5A 5CJ9A 1E17A 2CUZA 3JTGA 4BH9A 3K4NA 3R61A 1CGPA 3GF2A 3NEUA 4F7ZA 3U1DA 1D5VA 4EJTA 2M3AA 2PEXA 3LFKA 3JSOA 2KQRA 4HLYA 1G3SA 2V6CA 4HV6A 4HYEA 1QGPA 3MFKA 1WKMA 4N4OB 1U8RA 1V3FA 3GW2A 1QNTA 2HR3A 4BE2A 3BY6A 2R7FA 1YTYA 2E1MB 4ENKA 3P7NA 4MEYF 3DEEA 1GVJA 3OV8A 2H6CA 1YW9A 4HDVA 2HPMA 3OIQA 2IVMA 4Q5SF 5HVQC 2Z33A 3OS2A 4A2UA 4M9XA 2ZSHB 1KU9A 4EV0A 3SZPA 2VJ5A 3K4KA 3KEOA 1SMYF 3RQ4A 4ON0A 3TO6A 2L7KA 1Z21A 3MWMA 5CLSA 1IN4A 2PBIA 3HUGA 1D8JA 2XC7A 3KZZA 2RV8A 2XKPA 4ZDLA 3M1EA 2CW0F 2Z99A 2WA0A 2OD5A 3PL8A 1G3TA 4B44A 3BLYA 2W57A 5JI6A 2IXSA 3I9V2 4MLOA 2QKMB 4KISA 4B8XA 2V9VA 1S7AA 1XSVA 2A07F 2EFQA 2OBPA 1R5GA 2ETHA 5FD6A 3OIPA 3S3MA 3L7WA 1WRJA 2CFOA 1Z3XA 1FZPB 1OYIA 3KP4A 4N9IA 3ZN0A 4YIFA 4UHTA 4LMYA 2VODA 3T8TA 4FHTA 1X1CA 2KLOA 4G7ZF 1PP8F 3SFZA 1D1CA 5ED4A 2XF6A 2HWVA 1ZRDA 4RB3C 4ASNA 3C2HA 4ETSA 4PK4A 2CFXA 3VOEA 5CVRA 4MTDA 3J80K 5AONA 4OIPF 3OS1A 1N78A 4ZYEA 3DTIA 1T98A 4RLFA 4FX4A 3H9GA 3PNVA 2VJIA 1IRXA 3DLAA 1GXPA 2QQBA 2X1CA 2V4JC 3P9KA 2W00A 3TDUC 4L0YB 1RUNA 3RTRA 2XKOA 2BV6A 3H92A 4KNYA 2XAGA 4LLGF 5FGMA 5ICGA 1LJ9A 2ELJA 1K79A 1V5EA 4OAZA 1MMDA 1G59A 2FMYA 4ZYGA 3VDXA 3TOAA 3BPVA 5DUKA 5A2QK 4IHTA 2LSOA 2DOAA 1T39A 1FNNA 4CO8A 2HEOA 3HTSB 4IQJA 1G3YA 2A3SA 1ZRFA 1YLFA 1T0FC 2G7UA 4RAYA 3M8FA 2DAOA 2K3PA 3SEZA 3OYIA 2HQRA 5CPRB 1K6OA 1P92A 1L3LA 1T0FA 3R60A 4F3QA 4HNUA 1UCRA 3K2ZA 3WTXC 5F64A 4YFNF 3N05A 1FWZA 2K86A 4DOZA 4HW0A 5IT9K 5HS9A 3NWSA 2KRHA 1TNTA 1ZREA 4BXFA 3V8JA 4B47A 3F6OA 1WJBA 3TL4X 5D8LB 4ZDPA 3NQOA 2L4MA 3GEZA 3WE3A 1TQIA 2XROA 3CLOA 3W6KB 2VL8A 4B43A 3AL0C 3GBGA 1Y6IA 1SMTA 4PGGA 3HXLA 3F22A 1FOKA 1JHFA 4JK1X 3F6VA 2COMA 2LRDA 4XLHA 2R3SA 2VPLA 2KJBA 3HC7A 3DF8A 3BJ6A 2IJLA 1MMGA 2A6HF 2QQ9A 3B73A 1JXSA 2BGCA 3LMMA 3COAC 4E7LA 4YELA 4YFKF 2BEOA 1ZN2A 2L4AA 1LB2A 3OS0A 5ICCA 4HA8A 4XONA 1O7FA 3OL3A 2A6TA 4ZYDA 4IKFA 3ABTA 3EYIA 2VQGA 4OOIA 3TQNA 2ZBKA 3E5XA 2ZKZA 4BHPA 3I59B 4JOMA 3MD2A 3ERED 5FRMA 3W6JB 1QZYA 2XAFA 4G94A 2DTRA 5E8GA 5HLHA 3TO9A 1SD4A 4XL9A 3ZMTA 4KT5C 3CO7C 2PMZA 2WY8Q 3F8NA 1SD5A 5H6QA 2VKHA 2MD5A 5F1RA 3FX3A 1ZG1A 4NHJA 5FFXA 1RI7A 5LHHA 2GA2A 3CUQB 4A0XA 2AS5F 3CJRB 3OYBA 5LGNA 3TGNA 1USSA 3GVAA 2V1UA 2Q0OA 3FXQA 3DKYA 3TOBA 2L5QA 5LFAA 3CDHA 2M45A 1UELB 3QYFA 2O6GE 3V7CA 4I2OA 1LNWA 2MC3A 3OYKA 4B09A 3ZMDA 2GXBA 5ICEA 4ZTJA 3ZXSA 1U2WA 2OQGA 3HSFA 5D5XB 4E7KA 4BDYA 4PJJA 1W36D 2WV0A 1G3WA 1F1ZA 2ESNA 3L2VA 2DLLA 3I58A 1YW8A 4IRHA 4WF2A 3KP7A 4O3MA 2PJPA 4XLPF 3MKZA 2M8EA 2CG4A 3A1YA 1I1SA 3H3UA 1J0RA 4LJZF 2Z3YA 2ZCWA 4OAYA 2ZO4A 2HU9A 1ZAOA 2P5LC 1R36A 3J80Z 2XRNA 5KCMA 3JTHA 3ZCOA 4KITB 2IRFG 2F4IA 4ZJZA 2VB6A 3WTWC 2F5EA 2BOLA 4LG3A 2HQNA 1WJ5A 1WWXA 5HLGA 2NRAC 3CP8A 1HA8A 2DPUA 2L01A 2QKLB 3K0LA 2WADA 3JW4A 1SFUA 3I59A 5J6XA 1TLHB 4ZYHA 3O6BB 4A5NA 1ZARA 1D0ZA 3UNGC 5K1YA 3EPZA 3R6SA 3F8FA 2VOPA 3V42A 1SD6A 1ON2A 3ZPLA 2XGXA 3DPUA 4P9UA 5A2QZ 4NB5A 2FA5A 2VE8A 4X0GA 2FRHA 4AVPA 5E1XA 2JT1A 1FX7A 5DD8A 5CVVA 1W5TA 3FXRA 5KVRA 3VODA 3CUQA 3PSFA 5DCFA 5CVUA 3KP2A 2LH9A 1FY7A 2W82A 3IHUA 4DNCA 1K7AA 1R23A 4PJLA 2O8XA 3BWGA 1D0YA 4HBLA 5HNFA 1YX3A 2XVCA 3U2RA 5IT9Z 2R7DA 4YFXF 2L02A 1HKSA 2HKXA 2HS5A 1Z05A 2M7BA 2KKOA 2X51A 3REOA 1T6SA 4Y15A 3L2QA 3BPXA 3QP5A 1WJFA 4JQFA 2J5PA 1ZYRF 1BBYA 1SFKA 2W24A 2MFZA 3JSPA 1O7LA 5D6FA 1IN6A 2CWEA 2IGMA 2WB1A 1F4KA 3WGHA 5KNLA 2DPDA 3K4BA 4CCMA 4BJ5C 3LSIA 1KQ9A 5E17F 4ZZDA 3FBIB 1YG2A 3ML6A 4BEHB 1ZH5A 3OR1C 1E2XA 4HOBA 5CYVA 1W7PB 1IRFA 3DU5A 4WXHA 1B9NA 5JR3A 1BR1A 3CESA 4GGGA 1MZBA 2IT0A 4IF4A 2ZFWA 2QENA 1U6GA 5E8IA 1LFPA 2EB7A 3GYHX 2W4SA 1Z91A 3E97A 5TJJA 3GFJA 1MMNA 2CSOA 2UZKA 1USTA 3F8CA 3S3OA 4J01A 2D1VA 3QU6A 4E4HA 1SD7A 1Q1HA 1FC3A 2YX4A 1IZ1A 2PFBA 2HGCA 2JSCA 1V5GA 1KU3A 4PGHA 1Z3YA 4ENNA 4HG2A 1BI3A 4M71A 3RJPA 2VT2A 2LC2A 2XSJC 3K4CA 3S2WA 2RKHA 2M4KA 3V4GA 1R6RA 2O3FA 2H6BA 1EH7A 4KN4X 1UB9A 3KFWX 2P0WA 5D4SA 4LK1F 3W2VA 2A5YB 2KL4A 4ITVA 4F55A 1B9MA 4RB2C 2BW3B 2MH9A 1DGRM 3SDBA 3I64A 1J9IA 4GO1A 4B3XA 1FBUA 2EFPA 2VBWA 3OMYA 4EM0B 2EWNA 4BE0A 3T5XA 2ZJ2A 2V7FA 4EGYA 1WJCA 3L2CA 4CDGA 3HKZA 2CV0A 1YS6A 4BEHA 5LLQA 1S6LA 4CGZA 2OQRA 3RKWA 4KMFA 5HNHA 1W7PA 2YPRA 4CYDA 4N0BA 2I8DA 2DCEA 1IN5A 5LBQA 5K5RA 2IGKA 2LY1A 2L54A 3QU3A 2UV1A 5DV5A 2HZTA 1UG0A 5E20A 3BCAA 3KZYA 2YU3A 4XLAA 1QU3A 2W84A 2JPBA 4ENJA 1P4AA 3ZN1A 1Y0UA 4R1HA 3AFHA 4HZFA 1MNEA 2IS1A 3IRQA 2KPMA 4XSZF 3W2WA 2V26A 2QLZA 3QOPA 1F9NA 1MD0A 4PUSA 2F5FA 4F52A 1ERDA 5DD4A 5HDKA 3L00A 4F93B 2M30A 1XMKA 4A0YA 3CP2A 4M74A 1GHCA 2E5NA 5LGUA 1ONVA 3L2UA 5LD2C 4D1QA 3K70D 3LWFA 5FLXK 5BPDA 4U0WA 1ZGJA 5LHIA 5HOOA 4WWCA 2E7XA 1BR4A 1TBXA 2GOMA 2BW3A 2BVLA 2WY7Q 3R4KA 4O6JA 1X19A 4A5MA 4AIJA 3IAM2 2DK5A 1HKQA 1G8XA 4MGRA 1JGSA 3CJQB 3OR2C 3RCOA 2Q1ZB 2OU2A 2Y75A 1BJAA 1H0MA 3QYBA 4HPQA 2E7WA 2W25A 3WTSC 4CCOA 2O03A 3V7SA 4IHSA 4CCKA 4CHUA 4IRIA 1LKXA 2VQHA 2VC0A 2K4JA 3FMSA 2ZXIA 3H5RA 4WXDA 1G6NA 2GOXB 4DJAA 3PUBA 5J8FA 2X4HA 1D3YA 1I1GA 1MJ9A 2IS4A 1C0WA 1Y56A 2LREA 2GA1A 4ESJA 2HOEA 4UNOA 1V4RA 1FLIA 4OIRF 2DT7B 3PNTA 1X1DA 4BUPA 4K2EA 3FKJA 4KIFA 3PSIA 4XMYA 4FASD 3VWBA 2K9MA 1N75A 3N97A 1BI0A 4BHCA 4LG0B 2E5ZA 4J00A 3AL0B 2ISYA 2H94A 3SZGA 1TT0A 5CVJA 2VE9A 2WAQA 3G2BA 2CS3A 2XAHA 1YO5C 4BS9A 4HSRA 3CUOA 4HRIA 4PFPA 4R79A 3WTYC 4AWXB 3S93A 3TBIA 3IAS2 2F5CA 2L3DA 3S32A 5H6RA 1IRGA 1T95A 4HX4A 1DPRA 1KGSA 2P5KA 3V8LA 3EUKL 1XDUA 4QWQA 3K4MA 1UHWA 3I4PA 3FMQA 3ROUA 4NC7A 4HV5A 1QHHD 3NRVA 1MMAA 2VC1A 3DKXA 3P9CA 1WJEA 3LSTA 3OYCA 3IWZA 3DV8A 1DGWY 4RM2A 2ADUA 2WC2A 4S05A 2DI3A 1B4AA 2IGNA 2AXLA 3RYPA 1D1AA 5H20A 1FMWA 3KE2A 2FNAA 1X1BA 4CSWA 3KYLA 3HIFA 3HTUA 2GXGA 2V1NA 4G6DA 3IWFA 1YFHA 2VJJA 2OC6A 2NYXA 2P6SA 2XIGA 1FYLA 4NUBA 2LOOA 3BCBA 4CA0A 4HF2A 1BN5A 3FM5A 2M4GA 4BJ6C 3LA7A 2P6TA 2OZ6A 4P55A 3IKVA 2D2WA 4PCQA 1XN7A 2EV6A 2HQAA 2JVGA 4XORA 5BPIA 1DQUA 1Z1DA 3TDZC 2MLGA 1BI2A 4KICA 2OAZA 3T1BA 2FSWA 3M9AA 5L3CA 4YEJA 3DXJF 1JE8A 2MBFA 1EH8A 4LG0A 3E0JB 1NG6A 1OKRA 3HSRA 3F21A 4OIOF 3JAMK 1FP1D 2UXXA 1TTYA 2M1BA 4L9TA 2RQPA 1MJAA 1R22A 2GIVA 3WTZA 2IS2A 4AD9A 4BXUA 5L3FA 2MABA 4FETA 3GWZA 2NNYA 3GZ5A 3ZQ7A 3Q9SA 5ERIA 5KK1A 4I7HA 2Z2SB 1JI8A 1YS7A 2DO7A 3BJOA 2KJCA 4M72A 2E1CA 3VSKA 5LRRA 3VYRB 1X4PA 1Z6RA 3ONQA 1XB4A 1F5TA 4BYYA 3KP6A 3PNYA 3WODF 1UFMA 2BE5F 3CMMA 3UR3C 1V5FA 5F6FA 3GLXA 2DJIA 5FLXZ 3WTUC 3DFGA 3SYTA 2IS6A 2ACJA 3S3NA 4U88A 4M6XA 4G7HF 4HX7A 4OIQF 3OYFA 3VFZA 3DTEA 3OYDA 3HOSA 1IAWA 4AVZA 5HDNA 1SAXA 2DU9A 3QRFF 2AQEA 1O57A 3WTTC 5HDGA 2MC4A 1J2XA 3H35A 3M8EA 3FM3A 5AIQA 1HSJA 2BBYA 1DUXC 4XKWA 3NWTA 1U5TC 3QODA 2G9WA 2CH0A 4BGDA 5ILUA 3BZ6A 3LL7A 2OV7A 4ZZLA 1IXRC 2X0LA 5HS7A 2FE3A 2DT5A 3D5RC 4L9NA 3HL2A 2FOKA 2IA2A 2WBMA 1JHHA 1R00A 3K69A 4MHGA 3BP8A 4II2A 4IX7A 2FMLA 4RB0A 4NC8A 3GZ6A 3QAHA 3BOQA 4M9ZA 4BL0B 4ENMA 1BC7C 2NS0A 5HLIA 4LIUA 1WSUA 1BIBA 1FSHA 2QZ8A 3HRTA 4UV9A 1B59A 2IGOA 2R7RA 2CQKA 2EV0A 4BHBA 3MEXA 4U7DA 3W2AA 1XCVA 4KUMA 3BG7A 1D1BA 2HYGD 3F8MA 2HNHA 2ZXJA 3RPUA 4KIGA 3DP7A 3TKYA 1BI1A 1ZELA 1SFXA 5BQTA 4B48A 3F23A 4TV7A 5FRNA 2DFIA 2QYOA 4OMZA 4RGSA 1STZA 3ZGKA 3E6CC 2XUBA 4O5VA 3EUHC 4RGRA 1S7OA 3H3ZA 2X1EA 1T38A 1BOAA 2Z5UA 3WU0A 4XN3A 3SQNA 4BQQA 3IRRA 4I0BA 3I54A 2Z1DA 2QVOA 2VBZA 2CV1A 2WTEA 2KHMA 1MGTA 2XAUA 3KP3A 1TQMA 2MD0A 4I02A 3L2RA 3MZHA 1IN8A 4G6QA 2IPQX 2K7LA 4UUVA 2YX7A 4L5JA 3L2WA 3TO7A 3OYMA 1IXSB 4Y13A 1HQCA 2A68F 1LDDA 3HPGA 3KLNA 4L18B 3GFIA 2Z9OA 1RNLA 3LSHA 3G3ZA 2ZXHA 4EGZA 3S8PA 3LAPA 4A6EA 2MLKA 1P2FA 4PZJA 2FQ3A 4EQQA 2QQAA 4L9VA 3DEUA 1IUYA 4XKCA 3K1NA 4LITA 1H9GA 4KMUX 1OR7C 4EATA 4FT8A 1EH6A 2DQLA 3C7JA 5CQEA 4CCNA 2VBXA 4E7ZA 3HRSA 2F6CA 1OR7A 3DTKA 2X6YA 3JAMZ 4XM3A 1FBSA 3RYRA 1SAUA 3MQ0A 1AWCA 4Z2YA 3RSNA 4DBRA 1K6YA 3WGGA 1TZLA 4XLEA 1OPCA 3LA2A 3IL2A 3OYGA 4CXFA 5DYMA 2RC4A 3F72A 4U0VA 2O0YA 2RGVA 4XKBA 2X6XA 4EJUA 1KU2A 2R7SA 3VYSB 1BC8C 1PP7U 1BR2A 2F5DA 1HW5A 1S3JA 3MMYB 4RM3A 1RZ4A 4CUGA 4RAZA 3VB2A 2OZUA 4BQAA 2O5RA 4UVCA 3QPHA 1XDSA 3C2GA 2HZDA 2M5WA 3DPTA 1X4OA 3QOEA 1WJAA 3E5UA 2VKDA 2WAFA 2LKPA 4AIHA 1G4DA 2FNPA 4RLQA 4E7HA 3H9QA 3D5LA 2RVCA 4E7JA 1UHMA 2M7AA 2FU4A 2OA4A 3MAJA 4ZDOA 3HSEA 4EM2A 3BG6A 2VLAA 2PJRB 3PFYA 1WI9A 2R4GA 4F91B 4XQFA 3RI4A 2HYFA 4RMNA 4XOTA 4L0ZB 1PJRA 4BACA 2QWWA 4JBAA 5D5VB 1R1TA 2XDVA 2P7VB 5TRDA 1J09A 3RKYA 2PMHA 3RPUD 2R7UA 1VZ0A 4EVIA 4QLCU 2IP2A 4IXAA 2STWA 4ZC3A 1J7KA 2KMUA 3ZMUA 5J8CA 4DQ2A 4HAMA 2CMPA 2WAEA 4DGWB 6PAXA 4BE1A 3J7AO 4Q4ZF 1EV7A 3IUOA 2X1DA 4LK0F 4D9JA 2V6EA 3R0JA 4CICA 3Q5FA 2MH2A 5LEJA 3E5QA 3FHZA 3OYLA 1P9QC 1S8NA 2UUZA 2EV5A 4BAYA 5BS6A 2E60A 4BQNA 2ZFUA 1R7JA 1FMVA 4M6YA 1SFEA 3B02A 2ZNZA 4KFCA 1Z7LA 3WG9A 3C1DA 2LF7A 4LGWA 1FPQA 1MDMB 4P96A 4Y3OA 2Q2EB 3J81K 4AU7A 3PJRA 2PQ8A 1GXQA 1ZHFA 2J5OA 5L3DA 5DUI