3DF8A

The crystal structure of a possible hxlr family transcriptional factor from thermoplasma volcanium gss1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
109
structure length
109
Chain Sequence
SNAMLRYGDTEICIDPSESVLHLLGKKYTMLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMNVRNSLMPLLQYISVLDRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords possible HxlR family transcriptional factor
publication title The crystal structure of a possible HxlR family transcriptional factor from Thermoplasma volcanium GSS1
rcsb
source organism Thermoplasma volcanium
total genus 33
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3df8A00
2ZBKA 3WTUC 1BI0A 4L0ZB 1G6NA 2GA1A 3VB2A 1JHFA 4B8XA 1WRJA 1PUEE 1KYWA 1R5HA 5ICEA 4CDGA 4EJWA 2H09A 4EVIA 1P4AA 3LFKA 5FGMA 4OINF 3SXYA 2DI3A 4EGYA 2H6BA 2F5FA 4YIIA 5CYVA 4LG0B 4XSZF 5BOXA 1E17A 2L4AA 2L01A 1IW7F 4IPAA 3MCZA 3G3ZA 4IRIA 4EV0A 1FBSA 3WODF 3NQOA 5FD6A 5LHHA 2P6SA 4HZFA 3CJNA 1KYZA 3GW2A 3IC7A 4HF2A 5K5OA 1R7JA 1HKSA 4IHTA 5D8KB 1J0RA 1HW5A 4KA4A 2LF7A 4LK1F 3LA7A 5HVQC 3L00A 1LNWA 1IN7A 4CXFA 3BP8A 1X3UA 1XD7A 1R00A 3IRRA 1U78A 2DPDA 2Y0MA 3HTSB 5KK1A 4XLNF 2OU2A 2PFBA 2ZO4A 5HLIA 4RB2C 4KDPA 2OQRA 3L7WA 1LDDA 3B73A 3F8NA 2HDCA 1TNTA 3IWZA 3CUQB 3QU3A 2IPQX 2O0YA 4A5MA 3LA2A 4RAZA 5FB2A 2EFQA 1B4AA 1P92A 3R60A 2QENA 2RNJA 4KNYA 5LHIA 4KIFA 3LA3A 2FEZA 1QNTA 1FBUA 2MA3A 3FXUA 5D8LB 1ZLJA 5K1YA 4XRFA 2V1XA 4ENJA 4ZZDA 2IA1A 5H20A 3E6BA 3J81K 2FF4A 2VBYA 1FP2A 2WV0A 2QYOA 1MDMA 5CVVA 2Z99A 2JT1A 3GFMA 3DQVC 3K0LA 3LQQA 4I0AA 1SAXA 3R0JA 1UHWA 3GWZA 4JQFA 4F7ZA 1LJ9A 2M87A 1QZZA 3AAFA 2XASA 1YQAA 4TV7A 5IT9K 4MTDA 1Z6TA 2ELHA 1T2KA 3O3KA 2VBWA 5BPIA 5E8IA 1FBQA 2EFOA 3WTSC 4IVNA 1IXRC 3GF2A 2CSOA 3BROA 3HOTA 2VXZA 2OZ6A 3KEQA 5E18F 3COAC 3ABTA 4IRHA 1J2XA 4GGGA 4KICA 4HAMA 4L5IA 3KP3A 2P5VA 2QQBA 1B9MA 3T8TA 2W25A 3KEOA 2XIGA 3JAMK 3RYRA 3VODA 4I01A 3V4GA 2DO7A 4BXUA 1IN4A 1OYYA 1KU9A 4G6DA 3K2ZA 5DD4A 1RNLA 2EV6A 5FFXA 2QVOA 3HOSA 2B0LA 1R1VA 4A2UA 4RGUA 4UNOA 2KRFA 4UVBA 1ZG3A 4YFNF 4ZYEA 2VT2A 2RGVA 1EH6A 1HQCA 3GFIA 2W85A 2IJLA 3ZMTA 1CGPA 2DLLA 2GXBA 1USSA 4Y17A 2WC2A 3SQNA 2MD5A 1BJAA 3DPLC 3F6OA 5JHUA 2CYYA 5F6FA 3DF8A 1H0MA 3CUQC 4KUMA 5L3GA 1D3YA 2O61A 3RYPA 4RB0A 5D5XB 2ZNZA 3WTWC 1REPC 5FO5A 3E6CC 4OOIA 2V9VA 1PP8F 4KT5C 3EYIA 3V7CA 2QM3A 1BC8C 2CO5A 2Y48A 3PQKA 3MFKA 1K78B 3I54A 4M6YA 2P4WA 2HZTA 2VBXA 2FOKA 1RI7A 2COMA 1W7PB 4CZZA 3KP7A 4BAYA 1WWXA 1ZG1A 2OBPA 2PMUA 1FNNA 1QGPA 3GLXA 1IUYA 3MWMA 2OAZA 2X0LA 2HQRA 2EA2A 1WKMA 3F3XA 4HV5A 5JVTA 3C18A 1I5ZA 2M8EA 2ZMEB 6PAXA 2FRHA 4YFXF 3IKTA 1ODDA 4G7HF 2EFNA 3Q9VA 2ZCWA 4L18B 3J80Z 4ZYHA 4QWQA 2VBZA 4MQ9F 1J7KA 2V1UA 5CVIA 5DYMA 4KFCA 3QP5A 3HRTA 2EWNA 2GWRA 2YX4A 5LEJA 2E7WA 5ERIA 1T0FA 4PDKA 1KQ0A 5DDGA 3BDDA 5LRSA 1ZN2A 4HX8A 3KP4A 1UCRA 5ILUA 5LGUA 2STWA 1QO0D 1JE8A 1QBJA 1ZH5A 2H6CA 2ZKZA 2JSCA 1VTNC 1FY7A 2XV4S 3CO6C 1S7AA 1IXSB 1V4RA 1SFEA 2IP2A 2FBHA 4UUVA 4WX9A 3LAJA 4ETSA 4S04A 3E97A 2MC3A 2XRNA 1S8NA 1SFXA 2ADUA 2Z9OA 2D45A 2PQ8A 1OPCA 2P5KA 4NHJA 2R7FA 1TLHB 2DQLA 3P7NA 1ZGAA 2UXXA 2CG4A 1XGSA 3ZPLA 3E6DA 1G3YA 1Z9CA 3ROUA 3V8KA 2VC1A 2HGCA 3C7JA 3WG9A 3ISPA 1SD5A 3GEZA 3JTHA 5D4SA 1XGMA 1Z6RA 2FNPA 3W6KB 2D2WA 2K4BA 3U1DA 3RIRA 3R6SA 1YYVA 1XMKA 4LMYA 4MHGA 4P9FA 5ICCA 2GA2A 2FA5A 3D0SA 2DFIA 4WWCA 4U0VA 5CVJA 4G94A 1O3RA 2XUBA 3TOBA 4HQMA 3CUOA 2KIUA 2EV0A 2IRFG 1J5YA 1T98A 2QZ8A 1OYWA 1IRGA 5CJ9A 4HLXA 4A6DA 3K1PA 4LLLA 5DCMB 2VT3A 4LB5A 2K86A 5A2QK 3FWEA 3CO7C 2P7VB 4FT8A 3EETA 1BIBA 4L9NA 1MJAA 4UXNA 2O8XA 4P55A 4HX7A 5J8CA 3ULQB 3E5XA 2IA0A 3S2WA 5BQTA 1KU7A 1W5SA 5LBQA 3M1EA 2O03A 1RUOA 5CVUA 1HW2A 2C6YA 4YG2F 5FLXZ 1ZAOA 1U6GA 5F64A 1TW3A 1SMYF 3QPHA 1C0WA 2XAHA 2HS5A 1G3TA 3Q5FA 1O3SA 1L0OC 3LSTA 3J7AO 1JGSA 1IXCA 2GIVA 4U0YA 3ZMZA 2KIFA 4N9IA 4Q5SF 3GFLA 3JSOA 3HIFA 1KU3A 1OYIA 2BBYA 2P8TA 5LGNA 1R22A 4Z2YA 3TQNA 3NRVA 4ENNA 4BH9A 3E5QA 1K6OA 2YSRA 4HQEA 1TQMA 5CLSA 1PDNC 4HV6A 3BOQA 1SFUA 1YW8A 4O3MA 4HDUA 1KQ9A 3I59B 2MBFA 1WSUA 2ISZA 1JHHA 4HDVA 1XSDA 3HTUA 2HWVA 1ZRDA 1BN5A 2FMYA 4EJTA 1Q1HA 4HF0A 3F8CA 1W7PD 4KIBA 4RB1A 2VE9A 3GZ5A 2JRTA 5E8GA 1IF1A 2M5WA 1LVAA 5ILVA 4LLGF 4DQ2A 1O57A 1R36A 3I64A 3I4PA 1YS7A 3ZMUA 2KKOA 3QAHA 3RPQA 1NHAA 5LEKA 4D0PA 2Y75A 2E1NA 1KQ8A 4BQAA 1W5TA 2X4HA 1YTYA 2NRAC 4R1HA 3CDHA 1BM9A 2XAJA 3KLNA 3LAPA 2IT0A 2G9WA 3ZMDA 4G9YA 3WTZA 3TDUC 4A12A 4CO8A 3F21A 2VONA 1RZ4A 3ZMSA 1SD6A 3HRUA 4MEYF 1XMAA 3QU6A 2JTVA 2MLGA 3EYYA 1L3LA 1A04A 4CGZA 2IVMA 2K7LA 4R79A 2VN2A 2AS5F 1TW2A 4LFUA 1DUXC 1JXSA 1YFHA 2TDXA 5LLQA 3RI4A 2ISYA 3DXJF 3IKVA 1YW9A 3C3WA 5KVRA 2QQ9A 2HEOA 3N97A 1YG2A 4A0ZA 1BC7C 3MAJA 2IW5A 3PQJA 1S3JA 3HRMA 2LDUA 4GYGA 2PEXA 3K9TA 5TJJA 3JW4A 4M9XA 3V7SA 3SZPA 4M6XA 1USTA 2IA2A 5EEGA 1SD4A 4ZZLA 1ULYA 3TO6A 2EB7A 4HW0A 1R5GA 5DUIA 3V8LA 3T1BA 3P9CA 4M72A 4XBFA 1MGTA 4ASNA 5HLHA 2XVCA 1MJ9A 2BE5F 1LQ1A 3LQRA 4DNCA 4A6EA 4P96A 2ETHA 3WE3A 4MEXF 4YIFA 3WTTC 3D5LA 2RKHA 2NAZA 2R7DA 4XLPF 4NQWA 1XDUA 5FLXK 2QBYA 4OMYA 1FSEA 1F5TA 1XGNA 4BHCA 1YO5C 4M9SA 4G7OF 2Z3YA 4LJZF 2XKOA 4WK8F 3QRFF 1UHMA 1D8JA 2M45A 2A5YB 5AONA 1DPUA 1QPMA 4MQVA 2W57A 4ZYGA 1FWZA 4G8XA 3P9IA 1MDMB 4QLCU 3ZP5A 2LSOA 4IJAA 5HLGA 4JK1X 3FXQA 3HHGA 2VODA 1FX7A 1GHCA 2NNNA 1STZA 2FSWA 1HSJA 4XSXF 3FXRA 1DPRA 4FX4A 2V6CA 3WTXC 4K2EA 4LGWA 2UWMA 2JPBA 4Q48A 4AIHA 1FSHA 2RVCA 4L9JA 4ON0A 5D4RA 3HHHA 3LWFA 3JSPA 1I27A 2KJCA 4GCVA 5K5QA 4EGZA 2HYFA 2MH2A 3KZZA 4MNUA 2CGPA 5D5UB 3HYIA 2LF8A 4OU0A 1U2WA 4O5VA 4KMFA 1FYMA 2FBIA 4R8HA 2L4MA 4I7HA 3JTGA 3CTAA 1TQPA 3VFZA 3KZYA 5E1WA 1XB4A 3EDPA 2OA4A 3F6VA 1ZREA 3T0YA 1J59A 1WQ2A 4HA8A 5HDNA 3ML6A 1YLFA 4GO1A 1DDNA 4Q4ZF 2OD5A 4I2OA 1BI3A 1XGOA 1HBXG 1U3EM 1V3FA 3O6BB 5L3EA 2DAOA 4LK0F 1UB9A 4YFKF 2HTJA 2F2EA 3V8JA 1P6RA 1RUNA 4I98B 2L54A 2A6EF 2YU3A 2PMHA 3F23A 1Y0UA 1FT9A 1Z7UA 1MD0A 3E6MA 4U88A 1XCVA 3BZ6A 2V1DA 3FM3A 3FZVA 3RKYA 2DQRA 3WGHA 3H92A 2K02A 1G3WA 3MZYA 4IF4A 2VOOA 3NEUA 2LNBA 4WXDA 5ICGA 1ZHFA 3I0TA 2A69F 4LG0A 1H9GA 5AIPA 4ZH4F 2D1HA 4UVCA 4BHBA 2RN7A 2ZJ2A 3ABUA 3DFGA 4IRGA 5ICFA 3ELKA 2F5DA 2BYVE 3CLOA 3O2PE 2FMLA 2WTEA 5HS8A 1FYLA 1I6XA 3WTYC 3J81Z 3BJAA 1IN8A 3M9AA 3ERED 1QZYA 3KP2A 4EMSA 2XAGA 1DP7P 5ED4A 2XROA 2GZWA 5K5RA 4EM0B 5DD8A 3F8MA 1AWCA 1ZRCA 1G4DA 4WXHA 4U0WA 2NS0A 2ESHA 4M9ZA 4HX4A 5IT9Z 2F5EA 5FFZA 4OIRF 3ZQ7A 3G73A 1W4MA 2ESNA 1IN6A 4AVPA 2A68F 1D8KA 4EQQA 2HTSA 3IL2A 4L9TA 2EA4A 3I71A 4MTEA 1R23A 1LB2A 4MGRA 3IWFA 2XGXA 4GXOA 3CUQA 3TO7A 3QOPA 5HS9A 3JAMZ 2DW4A 1SMTA 5LHGA 1MJBA 4Q47A 5J8FA 4UHTA 4LD5A 4OIQF 5E1ZB 1OKRA 1KU2A 1ONVA 2VOPA 3FMRA 3GVAA 3R61A 2ZFWA 2EV5A 5HOOA 4AIJA 4RS8A 3B02A 5BS6A 2DPUA 1ZG5A 3MZHA 2E7XA 1P4XA 4KYWA 1IZ1A 3OOPA 2Z33A 2PJPA 5JI6A 1J75A 1ZLKA 4HLYA 1G3SA 3QP6A 1XCBA 4HF1A 1WI9A 3J80K 4B09A 1F1ZA 3SFZA 3IHUA 1K7AA 2HQNA 1KGSA 2A3SA 1OR7A 4I09A 2V79A 3T5XA 3VEPA 2HFHA 5CVRA 1XDSA 2EJRA 1ZRFA 1BBYA 5HDGA 3WGIA 3TKYA 2A6HF 2P6TA 4P5OA 2LKPA 2P5LC 2CWEA 4ESBA 4Y15A 4FHTA 1S6LA 2AXLA 3FHZA 1HKQA 4AD9A 1ZYRF 1OMIA 1ON2A 2RC4A 4BNCA 4UV8A 1KA8A 3EUHA 4A0YA 2DU9A 3HSRA 2Q2EA 3TGNA 4PZJA 3U9GA 2L3DA 5ILSA 2QQAA 2HR3A 1GVJA 3KP6A 3MEXA 4L9VA 3T8RA 1EV7A 3RKWA 1TBXA 4ENMA 4ZYDA 1E2XA 4LLNA 1MKMA 2H27A 1T39A 2XAFA 1YIOA 1HXDA 1LDKB 2JPCA 3KETA 5D5WB 5E1XA 2DK8A 3F22A 1U5TA 3GUDA 3RJPA 1GXPA 2FBKA 2G7UA 1T38A 5TRDA 1LDJA 2A61A 1K78A 1F4KA 3WE2A 2GAUA 1HKTA 3RTRA 2WWYA 4RGXA 5L3CA 3WTVC 2PG4A 1W7PA 4KN4X 3R0AA 2KJBA 3I58A 3E3VA 2FQ3A 3W6JB 4HYEA 4RGSA 1O3QA 4IXAA 2M1BA 3F8BA 3L9FA 4P9UA 1CF7A 5DUKA 2ZMEA 4JBAA 2PBIA 3IRQA 3H3ZA 4H0EA 1BOAA 4WF2A 3PFIA 1U8RA 1P2FA 3C1DA 3M8EA 1I1GA 3GFJA 4L0YB 4WXCA 2UZKA 3HRSA 1FLIA 2O6GE 4BYYA 5BMZA 4AIKA 2GQQA 1I1SA 3E5UA 2GXGA 2NNYA 4E70A 2QLZA 2H94A 2DTRA 1F9NA 2FNAA 3ZMVA 2FXAA 5H6RA 2DK5A 3HSFA 3FX3A 3I5UA 3FM5A 2YPRA 4EM2A 1IRFA 4UVAA 3DV8A 2PI0A 3K1MA 5DCFA 2BGCA 5LRRA 4PCQA 4ESFA 1QQIA 5DEQA 2XKPA 2G7HA 1IAWA 4UV9A 4IHSA 1B6AA 4CHUA 3DKWA 4PGHA 3RDIA 1IN5A 2UXNA 3SZTA 5L3BA 5LGTA 3FF5A 4N0BA 4U7DA 2Q8KA 3P9KA 3TOAA 4A5NA 5A2QZ 1EH7A 2QUFA 2CFXA 1PP7U 3ECHA 2RDPA 3HUGA 1BI2A 3M8FA 1ZARA 4HBLA 2F5CA 1U5TB 2OZUA 1XN7A 1YW7A 3WU0A 2PN6A 4GYIA 1XSXA 4WCGA 1O7LA 2VC0A 3BJ6A 1BIAA 2K4JA 3DPTA 3L09A 1P4WA 5L3FA 4FX0A 4M74A 3DP7A 1RIOH 1S7OA 5E17F 3BY6A 1ON1A 3KE2A 2FE3A 1YS6A 3GYHX 3F72A 4LB6B 1FPQA 3GX4X 5F1RA 3TDZC 2Z5UA 3ZN0A 2A07F 2HKXA 3SHFA 1CF7B 4ESJA 1Z91A 4AWXB 3RKXA 1FZPB 2YR2A 3FMSA 1BI1A 4G7ZF 4Y13A 3VOEA 2W24A 2L02A 1MZBA 3H3UA 4N9HA 3WU1B 1FOKA 2XAQA 3N4MA 2P7CB 2STTA 4U7BA 3U2RA 3REOA 2ZXJA 2ACJA 4EM1A 2EK5A 4I02A 5AIQA 3R4KA 5DCMA 1TNSA 2D1VA 2K27A 3KLOA 5IT3A 4RAYA 2Q0OA 3EQLF 2EFPA 4I0BA 1TQIA 5EEHA 2QBYB 1FP1D 3ECOA 3V7RA 2NYXA 2J5PA 1FYKA 2EFWA 4KMUX 3K1NA 2MLKA 4CICA 1K79A 3ZN1A 4NB5A 1B9NA 4KIGA 2VE8A 3TO9A 1R58A 2ZNYA 4G6QA 2BEOA 1UFMA 4BHPA 5J6XA 1GXQA 5JFRA 1HSTA 1O7FA 4EJVA 4S05A 2J5OA 2HOEA 3M7GA 1B59A 1R1TA 5FD5A 5HS7A 1R1UA 1LEBA 3BJOA 3HSEA 1HW1A 2E1CA 1EH8A 2OQGA 3K69A 3QPTA 4EJOA 5L3DA 5DV5A 3F8FA 2HYGD 4CYDA 1FC3A 1TTYA 5D5VB 1U5TC 2O3FA 4O6JA 5E20A 2XHKA 1J9IA 1H9TA 2JZYA 3I59A 4M73A 3DEUA 4OIPF 2FU4A 2YX7A 5JR3A 4RB3C 2MH9A 2W84A 5D6FA 5BPDA 5D6EA 1T6SA 1XSVA 2M30A 1D5VA 2DBBA 4HOBA 2RV8A 3I53A 3BWGA 3WGGA 4EJUA 4PGGA 5H6QA 1Z1DA 3MQ0A 1AOYA 2CW0F 3KFWX 3Q9SA 2PLYA 3BPXA 4OIOF 4ENKA 1Z05A 3GO5A 3RPUA 1S29A 4OMZA 4A0XA 1O3TA 1LEAA 2RQPA 1B1BA 2CQKA 3GZ6A 3KCCA 3BPVA 5HDKA 2R3SA 2HKOA 1ZGJA 4L5JA 2DT5A 3GXOA 3KP5A 3OV8A 3L2CA 2KIMA 3FMQA 4KN7X 4RGRA 2BV6A 4M71A 1SD7A 2QWWA
chains in the Genus database with same CATH superfamily
1QHHD 2ZBKA 5EDNA 3ZQHA 2WY8Q 4YEJA 3WTUC 2HVRA 5F1JA 1BI0A 3S3OA 2KLOA 4L0ZB 1G6NA 2CUJA 2GA1A 2E34A 2HQ5A 2MC4A 1K4TA 2M4KA 3VB2A 1JJ8C 1Z21A 1JHFA 3I3LA 3BR6A 1K6YA 4B8XA 1W5CC 1WRJA 2LC2A 1KYWA 3CESA 1R5HA 2HVQA 5ICEA 1PUEE 4CDGA 4DJAA 4EJWA 2H09A 2CV2A 3UKGA 5M5XJ 4EVIA 3DBRB 1P4AA 4A3CJ 3LFKA 5FGMA 2L0KA 4OINF 1KZHA 3SXYA 2V6EA 4N4NB 4XMYA 3K4BA 2DI3A 4EGYA 2EIJH 1XMXA 2H6BA 2F5FA 3H5NA 1VQ9I 4J19A 4YIIA 5CYVA 4LG0B 4XSZF 5BOXA 1E17A 2L4AA 2LRDA 2L01A 3H0DA 1IW7F 1EA3A 4IPAA 1FTTA 3MCZA 3G3ZA 4IRIA 4EV0A 3HXLA 3AL0C 1FBSA 3WODF 3NQOA 4AM3A 5FD6A 5LHHA 3G71I 2P6SA 4HZFA 3CJNA 5B1BH 1BR4A 1KYZA 1R6RA 2R92J 3AG4H 3GW2A 1WH7A 3H9QA 3IC7A 4HF2A 3A2KA 5TISC 5K5OA 3CCVI 1R7JA 4A3GJ 1HKSA 1B8IB 1Y8RB 1ZELA 4IHTA 5D8KB 1J0RA 1HW5A 4KA4A 2QSGX 3C2HA 2LF7A 4LK1F 3LA7A 5HVQC 4BE1A 2EINH 4HPQA 3L00A 1LNWA 1MW7A 2DN0A 1GLNA 3FIWA 5EJCA 3DU5A 5FRMA 2KL4A 2JJ7A 2QGUA 3CCUI 3L2UA 2WY7Q 3FXLA 4MIMA 1IN7A 4CXFA 1ITYA 3BP8A 2WBMA 1X3UA 3JREA 2WADA 1XD7A 3F0CA 3PUBA 5TGTA 4E4HA 3QYBA 1R00A 3IRRA 4D5FA 4I76A 2M0CA 3HG9A 4RA2A 3VYSB 1U78A 2DPDA 2Y0MA 3HTSB 5KK1A 4XLNF 2OU2A 4XR6A 2PFBA 2ZO4A 2R7RA 1HOMA 3ZQFA 2R7UA 5HLIA 4RB2C 4KDPA 2OQRA 4B3AA 3PNYA 2IAIA 3L7WA 1IJWC 1LDDA 3GBGA 3JR9A 3B73A 4N4OB 5GP9A 4YELA 3F8NA 3FK6A 1E0EA 1TWCJ 2HDCA 1TNTA 1DU0A 4BS9A 3IWZA 1HF0A 3CUQB 3QU3A 2IPQX 1P9QC 2O0YA 4P1WA 4HSRA 4W97A 4A5MA 3LA2A 4RAZA 3OYKA 5FB2A 2EFQA 4ABZA 3HPHA 1B4AA 1P92A 1I39A 3R60A 2QENA 3OIOA 3K6GA 2RNJA 2PJRA 4KNYA 3G2BA 5LHIA 2BOLA 3A01B 4KIFA 1XS9A 1OISA 2ZB9A 3AG2H 1J09A 3LA3A 1WZ2A 1UZCA 1QNTA 1FBUA 2FEZA 2MA3A 2MD0A 3FXUA 5C4XJ 5D8LB 1RKWA 5KCMA 1ZLJA 5K1YA 4D1QA 4XRFA 5JHFA 1AU7A 3PO2J 2V1XA 2M7BA 4ENJA 4ZZDA 2IA1A 3DEEA 4AYBN 4IO9F 3ZR8X 5H20A 3E6BA 3J81K 2FF4A 2VBYA 3LSGA 1FP2A 3CCLI 4HNUA 2WV0A 1DP3A 2QYOA 2M7AA 1MDMA 4AVZA 5CVVA 2R0QC 1ZKGA 2Z99A 4XKBA 1W36D 1V54H 2GXAA 2JT1A 3GFMA 5FLMJ 3NARA 3DQVC 2A05A 1OCOH 3BT9A 3K0LA 3LQQA 5DTDA 4I0AA 1SAXA 2VASA 3R0JA 1UHWA 3GWZA 4JQFA 1NG6A 2KDZA 4F7ZA 1LJ9A 2M87A 1QZZA 3L2WA 3M3YJ 3AAFA 2XASA 2V1NA 1YQAA 3HEFA 4TV7A 3CJTB 5IT9K 4B43A 4CUGA 4MTDA 1Z6TA 3EUAA 4XIDA 2ELHA 2KP6A 1T2KA 1SC7A 3O3KA 1MMDA 2KRHA 2VBWA 1FJLA 5BPIA 5E8IA 4ZJZA 1FBQA 4XN0A 3ZGKA 2EFOA 2EZLA 4IVNA 3WTSC 2JN6A 2DA6A 3BZKA 1IXRC 4A3FJ 3GF2A 2CSOA 3BROA 4IZZA 3HOTA 2VXZA 2OZ6A 3KEQA 3VYRB 5E18F 1F36A 2ZSHB 3ABTA 3COAC 1YJ9I 4IRHA 1J2XA 4GDFA 2DA2A 2ZJRF 2EZHA 3G1MA 4GGGA 4KICA 4UUSB 5LFAA 4HAMA 4L5IA 3KP3A 3S2DJ 4A3MJ 1Z77A 4GRIA 2P5VA 2QQBA 2HYJA 1B9MA 2PX9A 4G6TB 3SZGA 3T8TA 2W25A 3KEOA 2XIGA 3ZQCA 1FEXA 3JAMK 3RYRA 1WPKA 2KISA 4RMNA 2MYSA 3VODA 2JUCA 2XRLA 2LYCA 3K4MA 2R7WA 4I01A 3DKXA 3V4GA 2DO7A 2R5YB 4DW6A 2Y0SA 5JLXA 3BG9A 1JTXA 1WJFA 2F5VA 1IN4A 4U87A 1OYYA 1KU9A 4LG3A 4BXUA 1GDTA 5KAIC 4G6DA 1WVRA 3K2ZA 5DD4A 1RNLA 2EV6A 3RKQA 1GV2A 5FFXA 2QVOA 4CCMA 3HOSA 1D0XA 1R1VA 2B0LA 4A2UA 2Q2EB 4RGUA 3CCQI 4UNOA 2KRFA 4UVBA 1ZG3A 2ZJPF 4YFNF 2LD5A 4ZYEA 5J47A 4G12A 1Y1WJ 2VT2A 1ETOA 3ASNH 2B9SA 3LSRA 2KIQA 2RGVA 2CQXA 1EH6A 1HQCA 3FKIJ 3GFIA 2W85A 4X1EA 2IJLA 2DMTA 2VQCA 1JKOC 3ZMTA 2KZVA 1CGPA 2DLLA 2GXBA 1USSA 4HEA2 3S17J 4Y17A 2WC2A 3SQNA 5IOZA 5EEAA 1PJRA 4M3BA 4KJZA 2L9RA 2MD5A 2XGEA 4ITVA 1BJAA 2GOMA 3DPLC 3F6OA 5JHUA 3UR3C 2DYSH 2CYYA 5F6FA 3DF8A 1H0MA 3CUQC 4KUMA 1O4XA 3DCFA 5L3GA 1D3YA 2IGOA 1X19A 2X6XA 2M8GX 3NAUA 2O61A 3RYPA 4RB0A 1MIJA 5D5XB 2ZNZA 3WTWC 1SVMA 1REPC 2K85A 5FO5A 3IUOA 4OOIA 3E6CC 2V9VA 1PP8F 4KT5C 3K7AJ 3KPHA 2KQRA 3EYIA 3V7CA 2QM3A 1BC8C 2CO5A 4JX4A 2Y48A 4ZDOA 1Z67A 2VLAA 1ETXA 3PQKA 3G1OA 3MFKA 2DOAA 2K9SA 2KZGA 1K78B 4MO7A 3I54A 3D1NI 4M6YA 3GTLJ 2P4WA 2L7FP 3JRHA 2HZTA 4LIVA 2EQRA 1ETWA 2VBXA 2FOKA 1P7JA 2M9HA 3L2QA 1RI7A 2COMA 1W7PB 4OAZA 3MVPA 3TP0A 4CZZA 3KP7A 4BAYA 1WWXA 1ZG1A 3ZQLA 2OBPA 1X3ZB 2PMUA 4ZTFA 1FNNA 1QGPA 1YOVB 2GBYA 4BDZA 3H1CA 3GLXA 1IUYA 1D5YA 2QA4I 3GTKJ 3MWMA 2OAZA 2X0LA 2HQRA 2EA2A 4XKCA 3DBHB 1XC5A 2R7XA 1WKMA 2ME6A 2L2OA 2TCTA 3F3XA 2EPFA 4HV5A 5JVTA 3MKYB 3C18A 1I5ZA 2M8EA 2ZMEB 6PAXA 2FRHA 3SDGA 4YFXF 3IKTA 1LVKA 4C3HJ 1ODDA 1GUUA 3UNGC 4G7HF 4EATA 1ZK8A 5J1YA 3ESWB 2EFNA 2O7OA 3Q9VA 4OAYA 2QSHX 1E3PA 3OYCA 1OR7C 4XORA 5J1UA 2ZCWA 4L18B 3J80Z 3OYBA 4ZYHA 2H8RA 1Y8QB 3A0BC 3MZ8A 4QWQA 2V9PA 2L7ZA 2W00A 3CC2I 2VBZA 4MQ9F 1J7KA 2V1UA 2V9KA 4XICA 1UG0A 1RR7A 4C2TA 5CVIA 5DYMA 3ASOH 4KFCA 3QP5A 4B3XA 1ZR4A 4BXFA 3HRTA 2WAQN 2EWNA 1FOXA 2GWRA 1Z3XA 2YX4A 2XPVA 3CF2A 3GZNB 2X1DA 5LEJA 2E7WA 5ERIA 1T0FA 1WI3A 4BBRJ 1JGGA 1K61A 4PDKA 1KQ0A 1IV8A 5DDGA 2EBIA 3BDDA 5LRSA 1ZN2A 4HX8A 1JI8A 2CH0A 1X3WB 3KP4A 1G2HA 1UCRA 5EGOB 1BOBA 3EPZA 5ILUA 1TWGJ 2BW3B 5GAGJ 3BG5A 3EUHC 5LGUA 5B66C 2STWA 1QO0D 1JE8A 1RETA 1QBJA 1ZH5A 2PMZA 4I6ZA 1B72B 4BJTA 5EF6A 2H6CA 3ZXSA 2ZKZA 4Y33A 2JSCA 1VTNC 2IGNA 1FY7A 2ECCA 2XV4S 3CO6C 4CYCA 1RKTA 1S7AA 1IXSB 3HGGA 4B4CA 1V4RA 3LSHA 4FQGA 1SFEA 2IP2A 4DIQA 2LY1A 2FBHA 2XAUA 4UUVA 4WX9A 3A0HC 1SVOA 3LAJA 4BQNA 4ETSA 3DWLE 4S04A 3E97A 2WV1A 2R7TA 1JKPC 1YE9A 3ABMH 2MC3A 2XRNA 3DTEA 2DT6A 1S8NA 2K9LA 1SFXA 2ADUA 2DT7B 3BR3A 3WU2C 2E71A 1VQPI 2PQ8A 2D45A 1OPCA 2P5KA 2Z9OA 4NHJA 2R7FA 1TLHB 1PUFA 2FD5A 3HUGB 4Z6YA 2M2EA 4M3FA 2DQLA 3P7NA 2RQQA 1ZGAA 2NS7A 2UXXA 2CG4A 1XGSA 3ZPLA 1M1EB 3E6DA 5C3EJ 1QU3A 2B7EA 4GFBA 1G3YA 1Z9CA 3ROUA 1WJEA 3S1MJ 3V8KA 1W1WE 2VC1A 5J40A 2DCEA 2HGCA 3C7JA 2DA4A 3WG9A 2ZC2A 3CP2A 1VQMI 5IP9J 5E3LA 4F52A 3ISPA 1SD5A 3GEZA 3JTHA 5D4SA 1XGMA 2QF7A 1PYVA 1Z6RA 3I4MJ 1R9TJ 1N78A 2FNPA 3ZRGA 1ENHA 2VXDA 1QVUA 3W6KB 2D2WA 2O9LA 2K4BA 3U1DA 3RIRA 4CH7A 3RCOA 3ZQGA 3PIOF 3R6SA 1YYVA 2H1KA 1XMKA 4LMYA 2VQGA 5KNLA 3BTJA 4MHGA 4P9FA 5ICCA 2GA2A 2FA5A 3D0SA 1VF9A 2DFIA 2L9NA 3W2AA 4WWCA 4U0VA 5CVJA 4G94A 2CV1A 1O3RA 2XUBA 2XPUA 3TOBA 2W1OA 2ZMEC 4BQOA 4HQMA 1W0UA 4IHYA 3CUOA 1I6HJ 2DFFA 2KIUA 1K4SA 1FMVA 1VQ6I 2EV0A 3WG7H 1T95A 2I5UA 1R49A 4DGWB 2LBFB 2IRFG 1J5YA 4DBRA 1T98A 3H9GA 4NBQA 3L1PA 2LKXA 1XPXA 2QZ8A 1OYWA 3I9V2 1IRGA 1YRNA 4BACA 5CJ9A 3HOVJ 4HLXA 3VDXA 2CQQA 1SFKA 4A6DA 3K1PA 3GLLA 4LLLA 2E1OA 5E3MA 2WAFA 5DCMB 2OTJI 3PFYA 2VT3A 1QVTA 4LB5A 2K86A 3ERMA 2LG4A 1X1DA 1R71A 2V4JC 5A2QK 3FWEA 3OY9A 3CO7C 2N8GA 2P7VB 4FT8A 3EETA 1BIBA 5FJ8J 4L9NA 1MJAA 3IH4A 4UXNA 2O8XA 4P55A 3CC4I 4HX7A 5J4YA 5J8CA 3ULQB 5EZGA 3E5XA 2V26A 3OYDA 2JVHA 2F4OB 5FKOA 2IA0A 4ZC3A 5J4VA 3S2WA 3ZOBA 1YHQI 5BQTA 1MNEA 3JRDA 4XKWA 3HL2A 1KU7A 3CMYA 1W5SA 5LBQA 1IDZA 3M1EA 3LNQA 3W6VA 2O03A 2HDWA 3H3VK 5F04A 1RUOA 2E1MC 5CVUA 2YU9J 1HW2A 2C6YA 2RNGA 4YG2F 5FLXZ 1ZAOA 1U6GA 5F64A 1TW3A 4L5EA 1SMYF 4XK4A 3QPHA 3TW6A 1C0WA 2XAHA 2MG4A 4JP0A 2HS5A 3G4SI 2DFEA 1VQNI 2X48A 1T8IA 1G3TA 3Q5FA 4BU2A 2HI3A 2Y2ZA 1O3SA 2BY3A 1L0OC 1VFCA 1HDPA 3LSTA 3J7AO 1JGSA 3K70C 4CCKA 1IXCA 2GIVA 2Q1ZB 2DODA 4U0YA 2HNHA 3ZMZA 2KIFA 3OS1A 5C4JJ 4N9IA 4Q5SF 3GFLA 3JSOA 1IG7A 3HIFA 3HKZA 2CMPA 1KU3A 1OYIA 3QOEA 4Y7NJ 3B6AA 2X1CA 4QTRA 2BBYA 2P8TA 3D5RC 5LGNA 1R22A 4Z2YA 4PSWA 4DZJA 3TQNA 4CCOA 4BDYA 3NRVA 4E7KA 4ENNA 4BH9A 3I55I 3E5QA 3SYTA 1F43A 1K6OA 2YSRA 2DTZA 4HQEA 1TQMA 5HNFA 2Z1DA 5H2FC 3ZQIA 1XX5A 5CLSA 1PDNC 2Z2SB 4HV6A 3M1CA 3BOQA 3JCUC 1SFUA 1YW8A 3S1QJ 4BGDA 4O3MA 5GAHJ 1KQ9A 3CQZJ 4HDUA 1IRZA 4E6KG 3I59B 3RQ4A 2TRTA 2MBFA 4PFOA 1WSUA 2ISZA 4IQ4A 3MN2A 1JHHA 4HDVA 1XSDA 1D0ZA 2DA7A 3FBNB 3HTUA 4HG2A 2HWVA 1ZRDA 2DFHA 4RBOA 1BN5A 2FMYA 4EJTA 4V2GA 1Y1VJ 4I99C 2AXTC 1Q1HA 2HOSA 3DTKA 4HF0A 3F8CA 1W7PD 3ABKH 4KIBA 2VJJA 4RB1A 2VE9A 2E35A 2K9NA 4A3KJ 3GZ5A 1FTZA 3Q0VA 2JRTA 4C3JJ 2QSFX 1OCRH 5E8GA 2NVXJ 1CQTA 1MNMC 1IF1A 2M5WA 1LVAA 4QIWN 1BJZA 2CQNA 5EG0B 3CJRB 1A6IA 5ILVA 1WHUA 3HOZJ 3OWTA 4LLGF 3PIPF 3GCMA 4DQ2A 1O57A 5IP7J 1R36A 3I64A 3DBLB 3I4PA 1YS7A 1K83J 3ZMUA 3GTPJ 4LITA 2LR8A 2KKOA 3QAHA 3BCBA 3RPQA 1NHAA 3J7ZI 1R4NB 1EKEA 5LEKA 1SAUA 1TT0A 1YX3A 4D0PA 1IO2A 2Y75A 4JX6A 2K9MA 3OR2C 2E1NA 1LE8A 1KQ8A 4F3QA 3BLYA 1IUFA 2LREA 4M3EA 2FOWA 4BQAA 1W5TA 1T56A 2X4HA 2CW8A 2F6CA 3G1LA 1YTYA 2NRAC 4B47A 3SDBA 4R1HA 3CDHA 1HLVA 2IXSA 1BM9A 2XAJA 5B5EC 3KLNA 3J7AY 4DZPA 3LAPA 2IT0A 2HQAA 3ONQA 2G9WA 3K2AA 3ZMDA 4G9YA 1T0FC 3WTZA 3TDUC 3PO3J 1RESA 4A12A 4CO8A 3F21A 4BY7J 2ZXWH 2VKVA 2VONA 1RZ4A 3S3MA 3CCEI 3ZMSA 1YJWI 1SD6A 3HRUA 2CJJA 3CF5F 4BXXJ 1WFXA 4MEYF 1XMAA 2JSPA 3VPRA 3OL4A 3QU6A 2JTVA 2MLGA 3EYYA 3FXKA 1N75A 1L3LA 1A04A 4CGZA 2IVMA 2K7LA 4R79A 5FKNA 2VN2A 2AS5F 4II2A 1ETYA 3W2VA 3U1KA 1TW2A 4FCYA 2XDVA 1G8XA 3MMYB 4LFUA 1XG1A 1D0YA 1DUXC 2NVQJ 4A3LJ 2IS6A 1JXSA 1YFHA 2TDXA 5LLQA 4CCJA 3RI4A 3MD2A 1GT0C 2ISYA 3DXJF 3IKVA 1YW9A 3C3WA 5KVRA 1MBKA 2QQ9A 4EEFG 2HEOA 1TZLA 2CFOA 3N97A 3K70D 1YG2A 4A0ZA 1BC7C 3SJMA 2X6YA 3MAJA 2IW5A 3PQJA 1JT6A 1S3JA 3OL3A 3GTMJ 2JK3A 3HRMA 2LDUA 4YRVA 4GYGA 2XB0X 2PEXA 3K9TA 5TJJA 3JW4A 5K7FA 4M9XA 3CCJI 2LH9A 1HCRA 3V7SA 3SZPA 1UELB 2VKEA 4CZCA 2IS4A 4M6XA 1USTA 2IA2A 5EEGA 1SD4A 1X2NA 4ZZLA 4F92B 3HDDA 1ULYA 3TO6A 5FKKA 2EB7A 1LPQA 4HW0A 1R5GA 3T1BA 4XBFA 3V8LA 3P9CA 4M72A 5DUIA 1MGTA 4QPOA 1R4MB 4ASNA 2B63J 1D1AA 5HLHA 3VWBA 2XVCA 1MJ9A 3DKYA 2BE5F 2O8KA 1AHDP 2ID6A 4XOTA 1LQ1A 3LQRA 4DNCA 4A6EA 1HDDC 1X1BA 4P96A 2UUZA 2VUMJ 3E7LA 2ETHA 3WE3A 3S2HJ 4MEXF 4E7JA 4YIFA 3JRCA 3WTTC 1PVEA 2AO9A 3D5LA 1V5GA 4D5CA 2L7MP 2R7OA 2RKHA 2ECBA 2NAZA 1JUPA 2R7DA 4XLPF 4RDUA 2CUEA 4NQWA 5BNGA 5HLTA 2R5ZA 4DBQA 1XDUA 5FLXK 2QBYA 2Z16A 4OMYA 1FSEA 4J00A 3I4NJ 4XRSG 1F5TA 2X51A 1WJDA 2HPIA 3LSKA 1ORKA 1MBJA 3FK7A 3J7YJ 4A3EJ 1XGNA 4BHCA 2W7NA 2L9SA 1YO5C 4M9SA 3A02A 3PL8A 4G7OF 2Z3YA 4LJZF 2XKOA 2OUMA 3OR1C 4UB8C 4WK8F 2DMPA 3QODA 2VJ4A 1MH3A 2AQFA 3BTIA 3OYFA 3QRFF 2D5VA 1A5JA 1UHMA 2PJRB 3HB9A 2E2HJ 1D8JA 2M45A 3AKZA 4ZDLA 2FUG2 4X0GA 1TT5B 4RLFA 4MFEA 2HZDA 2NS8A 1VQ7I 3MKZA 2A5YB 3OYGA 2WB1A 2CRGA 5AONA 1N77A 2BY0A 1DPUA 1QPMA 4MQVA 1U9OA 2W57A 4CSWA 4ZYGA 1VQ4I 1FWZA 3U21A 1I50J 4G8XA 3P9IA 4NC6A 2E5NA 1MDMB 4QLCU 3ZP5A 2LSOA 4IJAA 3HM5A 4XQFA 3O8GA 5HLGA 3QPSA 1X1CA 4JK1X 4XONA 3IP4B 3FXQA 4AYBA 3HHGA 1BL0A 2VODA 2GM4A 4HRIA 2DYRH 1FX7A 3K4NA 1GHCA 2NNNA 1X1PA 4HNVA 1STZA 3LOCA 2FSWA 1HSJA 3LSMA 3FXRA 1X58A 4XSXF 4DOZA 4XN3A 1DPRA 1U8BA 4FX4A 2V6CA 4B48A 3WTXC 3MKWB 2ZFUA 4K2EA 4LGWA 2UWMA 2JPBA 4C9YA 4Q48A 5M3FJ 1YI2I 4AIHA 2JA2A 1FSHA 2ICWG 1RC9A 2RVCA 2VIXA 2Y30A 2YS9A 4L9JA 4ON0A 5D4RA 3HHHA 2CU7A 2ZXIA 3LWFA 3JSPA 5IYBJ 1I27A 2NOJB 2KJCA 4GCVA 2OCCH 3HBLA 3KYDB 5K5QA 2DDBA 2X6WA 4EGZA 2HYFA 4E7HA 2MH2A 4XOPA 3KZZA 4MNUA 1AKHA 1TL8A 3HOYJ 2CGPA 3HOXJ 1N25A 1KONA 5D5UB 2EZIA 5E3NA 3HYIA 2LF8A 1JJ6C 4JX5A 3LSPA 4OU0A 1U2WA 4O5VA 4KMFA 1FYMA 2FBIA 1ERDA 4R8HA 2L4MA 4I7HA 4M3GA 3JTGA 3CDIA 5C44J 1ZGWA 3CTAA 1TQPA 3VFZA 4PSXA 1WJCA 3KZYA 5E1WA 2IS2A 2VI6A 1XB4A 3EDPA 2OA4A 4PJJA 3F6VA 1ZREA 5IYDJ 2R7QA 3T0YA 1J59A 3RZDJ 1W0TA 1WQ2A 4HA8A 4PJNA 4M3DA 1YJNI 5HDNA 3ML6A 4ZTJA 1H89C 2JMWA 2JA5J 1QHGA 1YLFA 4GO1A 1DDNA 4Q4ZF 2OD5A 4I2OA 1BI3A 1XGOA 2BXZA 4W1UA 1HBXG 2CV0A 1MH4A 1BW6A 1U3EM 1VQ8I 3L2VA 1V3FA 2E1MB 3O6BB 5L3EA 2DAOA 4LK0F 1S5LC 2E5ZA 4BEHA 2IGMA 1UB9A 4YFKF 2HTJA 2F2EA 3V8JA 1P6RA 3BZCA 2DA3A 1RUNA 3B6CA 4I98B 2L54A 2A6EF 2YU3A 2PMHA 3F23A 1Y0UA 1Y6IA 1FIAA 5IP6A 1FT9A 4FTHA 2DOEA 1UHSA 4BY1J 1Z7UA 1MD0A 3E6MA 4U88A 1XCVA 3BZ6A 2OPTA 2V1DA 3FM3A 4J01A 3FZVA 2G0EA 2LFBA 3RKYA 2DQRA 5GPCA 3WGHA 3H92A 4A3DJ 2K02A 1G3WA 3F9KA 3MZYA 3VYTB 4UY8I 3HKZN 5GTHC 4IF4A 2VOOA 2VQHA 1DQUA 3NEUA 5F08A 2LNBA 4WXDA 5ICGA 1ZHFA 3IH3A 1WGXA 1NTCA 3I0TA 1MSFC 1VNDA 4IEJA 3RQIA 2A69F 2MSYA 2MGQA 1EF4A 1DU6A 1Z3YA 4LG0A 3PJRA 2WA0A 1H9GA 5AIPA 4S0HB 1ACIA 2MFZA 4ZH4F 2D1HA 4UVCA 2QEXI 4BHBA 2RN7A 2VKHA 2ZJ2A 3FXOA 3ABUA 3DFGA 4NNJA 4IRGA 5ICFA 5CKTA 1S72I 3ELKA 2F5DA 1VZ0A 2BYVE 4UUTA 3CLOA 2DMQA 2R7VA 2JVGA 3O2PE 2LLKA 2FMLA 3HZJA 2WTEA 5HS8A 1FYLA 4IQJA 1I6XA 4A69C 2XGDA 4AU7A 3WTYC 3J81Z 3BJAA 2F4MB 1VQKI 2XF7A 3CDLA 2R93J 1MMSA 3S93A 1IN8A 3M9AA 2VJIA 3S8PA 2HOTA 3ERED 1QZYA 5FLVA 3KP2A 4EMSA 4KITB 1RR8C 4II3A 2XAGA 1DP7P 5ED4A 2XROA 2GZWA 5K5RA 2LOOA 4EM0B 5DD8A 3F8MA 1AWCA 1FMWA 1ZRCA 1G4DA 4WXHA 5K7ZA 4IHWA 2LY2A 4U0WA 5KHDA 2NS0A 3HOUJ 2ESHA 4M9ZA 4HX4A 5IT9Z 2F5EA 5FFZA 2VPRA 2P81A 2JQ7A 5F0CA 4OIRF 4PUSA 1D1BA 4PJ0C 3A1YA 3N05A 1OQYA 4BKXA 3DPUA 3ZQ7A 1Z7LA 3G73A 1W4MA 2QKLB 2ESNA 1IN6A 3QQAA 4AVPA 3DTIA 2W4SA 3JRFA 2F4IA 2YUSA 2F48A 3TP3A 2BY2A 2A68F 2CW7A 4NC7A 1D8KA 3OS2A 2KT0A 4EQQA 2HTSA 4F93B 3IL2A 1IRXA 4L9TA 2EA4A 3JRIA 1JUMA 3I71A 4MTEA 4D9JA 3TEDA 1R23A 3C2GA 3AG3H 2LKSA 1VQOI 3BG3A 1LB2A 4MGRA 3IWFA 3VSKA 2XGXA 4GXOA 3CUQA 3TO7A 3OYHA 3QOPA 2QKMB 5HS9A 3FBIB 2IBDA 3LSIA 3JAMZ 2DW4A 1SMTA 5LHGA 1MJBA 4Q47A 1TWAJ 2HU9A 2L7KA 3CP8A 3SEZA 5J8FA 2OV7A 4PJLA 1D1CA 4D7MA 4E7IA 4UHTA 3LMMA 1BR1A 4E7ZA 1QA6A 4LD5A 4BBSJ 5IOYA 4OIQF 5E1ZB 1OKRA 3A01A 1KU2A 1ONVA 3OYNA 2VOPA 1Y56A 2VQLA 3FMRA 1FIPA 3GVAA 3R61A 1MMGA 2ZFWA 2WAEA 3PSFA 4CYCB 2ZSIB 2EV5A 5HOOA 4BJ5C 4AIJA 3VYUB 5JVGF 1VI0A 3WHBA 4RS8A 1JKRC 3B02A 4RM2A 3TL4X 1IDYA 2RAEA 1W36C 3GTOJ 5BS6A 2HXOA 3OSFA 2DPUA 1ZG5A 3MZHA 1VQ5I 3DEWA 3JRAA 3JRGA 4PK4A 4X6AJ 2E36A 1E3HA 1V5FA 2NVTJ 2KHMA 1E3OC 2ME0A 2W48A 5FKLA 2FJ1A 2E7XA 5J3LA 1P4XA 1YITI 1MMNA 5CQGA 3S32A 2JUGA 2XF5A 4PJMA 4KYWA 3GTGJ 1PUFB 1IZ1A 2JA8J 3OOPA 5GTIC 2Z33A 2K3PA 1DGWY 1U0JA 4NC8A 5JI6A 2PJPA 2R7SA 1J75A 1ZLKA 1Y0NA 4HLYA 1G3SA 1NK3P 3QWLA 5CPRB 3QP6A 3S1RJ 1MBGA 3QPLA 3S15J 1XCBA 4HF1A 1WI9A 2M4GA 3J80K 4B09A 1F1ZA 3SFZA 1A35A 3CMEI 1UG2A 3H35A 3IHUA 1K7AA 2HQNA 1KGSA 4HNTA 2A3SA 4F91B 2H8WA 3ZCOA 1OR7A 4I09A 2V79A 4IHVA 3BCAA 3T5XA 5J1RA 3VEPA 2JA6J 2HFHA 2NXNB 2DDAA 5CVRA 1MNDA 1XDSA 4V19K 5IY5H 2EJRA 1WCMJ 2XC7A 1Q1VA 1ZRFA 1BBYA 1JUSA 5HDGA 3WGIA 5EZHA 2Y0SN 3TKYA 4UUSA 4FASD 1HA8A 1WJAA 2A6HF 2P6TA 4P5OA 2LKPA 3K4CA 1R5ID 1V5EA 2P5LC 2CWEA 2IEKA 4ESBA 4JOMA 9ANTA 4Y15A 3SFIA 4KISA 4FHTA 4QSHA 2R4GA 1OLTA 2K5CA 1S6LA 2XPWA 2AXLA 3GMEA 3FHZA 1HKQA 1GV5A 4ANJA 3G6EI 4AD9A 5E79C 2R5YA 1ZYRF 1OMIA 1ON2A 2K40A 2RC4A 3ABLH 1OCPA 2VB6A 2XF6A 4BNCA 2KFDA 4CCNA 4UV8A 2BZTA 3CD6I 1TWFJ 4H4KC 1KA8A 3NWSA 3EUHA 4A0YA 2DU9A 2ZJQF 1ETQA 3HSRA 2X85A 2Y69H 1YRNB 4BQQA 2Q2EA 3TGNA 4PZJA 4IHXA 3U9GA 4NDLA 2L3DA 1LFBA 5ILSA 4CCLA 3OYEA 1WH5A 2CUZA 2QQAA 2HR3A 1GVJA 4E7SA 3FXJA 1XTAA 3Q0WA 3KP6A 3MEXA 1IV6A 4L9VA 3T8RA 1ZR2A 2E2JJ 1EV7A 3RKWA 3JRBA 1TBXA 4ENMA 4ZYDA 1E2XA 4LLNA 1MKMA 2H27A 1T39A 2Y9YA 1MMAA 2XAFA 3W3CA 4XLHA 5FKMA 2RREA 1YIOA 3KEYA 4C2MJ 1HXDA 1RPWA 2WB1N 1LDKB 2V7FA 1ETVA 3SEQA 2JPCA 3KETA 5D5WB 5E1XA 4XRSA 3H0GJ 4BJ6C 1QPIA 2DK8A 1IC8A 2BHZA 1LUJB 3HC7A 2W82A 2IGKA 3M07A 3F22A 1U5TA 2LTPA 3GUDA 3RJPA 3X2QH 1GXPA 2FBKA 2G7UA 1T38A 4IX7A 5TRDA 1LDJA 3BQYA 3CCYA 3FDYA 4LIUA 2A61A 1K78A 5B3SH 1F4KA 2NVYJ 2BVMA 2DJNA 3WE2A 1T33A 2BXYA 2GAUA 5DS9A 1HKTA 3MKLA 1SVLA 1JTYA 3RTRA 2M0MA 1A6QA 2WWYA 2ELJA 3LSJA 3VSLA 2R7ZJ 4RGXA 1Z0XA 5L3CA 3WTVC 2PG4A 5GADJ 1W7PA 4KN4X 3R0AA 1UJ8A 2KJBA 3I58A 2OC6A 4RAFA 3E3VA 2FQ3A 3W6JB 1BA5A 4FETA 1I3QJ 4HYEA 3CJQB 4RGSA 3V42A 3A4CA 3L2RA 1O3QA 2DJIA 3BTCA 3S16J 3O8HA 4IXAA 4C30A 4FISA 2CUFA 4NUBA 1ZQ3P 2M1BA 1NK2P 2M34A 2P0WA 3F8BA 3IAS2 3OIQA 3OIPA 3L9FA 3PNTA 4P9UA 1CF7A 5DUKA 1SEUA 2LK2A 2ZMEA 2Y9ZA 4JBAA 2PBIA 3IRQA 3H3ZA 4H0EA 1BOAA 3QYFA 4LOCA 4WF2A 3PFIA 3CZ6A 3PSIA 1U8RA 4FE4A 1P2FA 1NH3A 3C1DA 2VPLA 2ELKA 3M8EA 2O5RA 1I1GA 5F0HA 3GFJA 4L0YB 2L5QA 2GOXB 2KPMA 4WXCA 1YIJI 4A3BJ 3S3NA 2UZKA 3HRSA 4JYKA 3D5SC 1FLIA 2O6GE 4BYYA 4QPQA 3BC8A 3OOUA 5F27A 4UB6C 5BMZA 3BR2A 4IOAF 2NOGA 5DM7F 3NWTA 4AIKA 2GQQA 3QYEA 1MBEA 3E5UA 4D7NA 1I1SA 4IL6C 4C3IJ 2GXGA 1SANA 2NNYA 5LD2C 1ETKA 4E70A 1I3AA 2QLZA 3K4LA 2H94A 2DTRA 2DA1A 2PMZN 2HVSA 1F9NA 2FNAA 2M3AA 3ZMVA 2FXAA 2ID3A 2X9DA 1Y39A 5H6RA 2DK5A 3HSFA 3FX3A 3I5UA 4OWRB 3FKJA 4XRMA 5EGOA 3FM5A 2E19A 2YPRA 4EM2A 2BW3A 1IRFA 1GVDA 4UVAA 4IKFA 3DV8A 4XLCA 2PI0A 3K1MA 5DCFA 2BGCA 5LRRA 4AUXA 3KIOA 1B72A 5IYCJ 3IH2A 1LE8B 1A36A 4PCQA 4ZYAA 3KX2A 1TWHJ 3DLLF 2OF7A 4ESFA 1BW5A 3H9JA 1QQIA 3K10A 3TMOA 3E0JB 1MBHA 5DEQA 3M4OJ 2XKPA 2G7HA 4BUPA 1MBFA 3OYIA 1JT0A 1IAWA 4UV9A 2JWTA 3BQZA 4RLQA 4IHSA 1B6AA 4CHUA 3DKWA 4PGHA 3RDIA 1IN5A 2KDOA 1LKXA 2UXNA 3SZTA 5L3BA 5LGTA 3CMAI 3FF5A 2BHYA 4N0BA 3OYLA 1FOYA 2HXIA 2Q8KA 4U7DA 3P9KA 3CMMA 3TOAA 4A5NA 5A2QZ 1EH7A 1P7IA 4BE0A 2GLOA 2QUFA 2CFXA 2EH3A 1PP7U 3H36A 3ECHA 2RDPA 3HUGA 1BI2A 3K4JA 3M8FA 2HOAA 1ZARA 2E60A 4HBLA 5GAEJ 5K7HA 3S14J 2F5CA 1U5TB 1TC3C 2OZUA 1XN7A 1YW7A 3WU0A 2PN6A 3DU6A 2XB5A 4MFDA 2LP0A 4GYIA 4XL9A 3KYLA 2DA5A 1XSXA 3OSGA 2EILH 1O7LA 2EIMH 2VC0A 3BJ6A 4WCGA 4M6VA 1BIAA 1S9HA 2BY1A 3M8JA 4HSTA 4DYCA 2K4JA 2BVLA 3DPTA 3L09A 1P4WA 5HODA 3P5JA 1HC8A 5L3FA 5DM6F 4FX0A 4M74A 3IAM2 3DP7A 2K9QA 2EIKH 1RIOH 2AQEA 1S7OA 4DYQA 3BY6A 5E17F 2DXIA 1ON1A 2IS1A 1DGRM 1X2MA 3KE2A 3CCSI 2FE3A 1YS6A 3GYHX 3F72A 3CLQA 4LB6B 1FPQA 3GX4X 4AC0A 5F1RA 3EUKL 4C2UA 1WJBA 3TDZC 2Z5UA 3ZN0A 4CA0A 2HPMA 2A07F 2HKXA 3A03A 3SHFA 4A3JJ 2CQ7A 2QCOA 4ESJA 1CF7B 1Z91A 4BE2A 4AWXB 3CCRI 3RKXA 1FZPB 2GIZA 1BR2A 2YR2A 3FMSA 3GTQJ 1BI1A 4FE7A 4G7ZF 4Y13A 3VOEA 2A6TA 2W24A 1FOWA 2L02A 1MZBA 1VQLI 1OCZH 3H3UA 1V55H 4N9HA 3H5RA 5FROA 2H1LA 3WU1B 1FOKA 3OMYA 2LBFA 3FISA 4B44A 1OFCX 2JRMA 2XAQA 3N4MA 2UV1A 3E1SA 2VJ5A 1X4OA 2P7CB 2KMUA 1LFUP 2STTA 4U7BA 3KZIC 3U2RA 2X6OA 3REOA 2ZXJA 4DYRA 2ACJA 4EM1A 2EK5A 4I02A 5AIQA 2VL8A 3R4KA 4ZDPA 5DCMA 3CC7I 4F55A 2E2IJ 1TNSA 2D1VA 2I8DA 3BR5A 3LFUA 1MSEC 5FRNA 3K4KA 4RM3A 2K27A 3KLOA 1ZTRA 2OCEA 5IT3A 4RAYA 3OS0A 2Q0OA 3EQLF 2EFPA 4NQWB 4I0BA 1UAAA 2R5ZB 4MLOA 1TQIA 5EEHA 3AFHA 2QBYB 3Q3SA 1FP1D 3ECOA 3V7RA 2X1EA 2OJED 3I56I 2NYXA 2Y31A 2J5PA 3PM1A 1YX5A 1FYKA 3RZOJ 3PNVA 2EFWA 4KMUX 3BR1A 3K1NA 2AHQA 4IOCF 2MLKA 4XLAA 4CICA 1K79A 3ZN1A 4NB5A 5CQEA 5GPAA 2K3FA 1B9NA 4KIGA 2VE8A 3DLAA 2MW8A 3HOWJ 3TO9A 1H8AC 1R58A 1S7EA 4YIRX 2ZNYA 1NG7A 3IV5A 1X1AA 4G6QA 2BEOA 4KT6A 1UFMA 1UMQA 4BHPA 5J6XA 1GXQA 5JFRA 3OYMA 5HNHA 3H5AA 1HSTA 3RPUD 1O7FA 4EJVA 3HJEA 4S05A 2DMNA 3KYCB 1T08B 2J5OA 3S1NJ 2I10A 5E3OA 3BG6A 2HOEA 4V2FA 3GTJJ 5M3MJ 3M7GA 1B59A 1R1TA 2L9VA 2LY9A 3FHNA 5FD5A 3OYJA 4A3IJ 1H88C 5HS7A 1R1UA 3AL0B 1LEBA 3BJOA 5KAFC 3HSEA 1RRJA 1HW1A 1WJ5A 4Y4RA 2MABA 2E1CA 1AA7A 1EH8A 5EYRA 2NVUB 2OQGA 3K69A 3QPTA 4EJOA 5M5WJ 3CCMI 5L3DA 5DV5A 3F8FA 1OCCH 2HYGD 4CYDA 1FC3A 1TTYA 5JLWA 5D5VB 1U5TC 2O3FA 2OTLI 1OCTC 2LMDA 4O6JA 5E20A 2XHKA 1J9IA 2DOFA 2XSDC 1B8IA 4Y3OA 3OYAA 1H9TA 2JZYA 3I59A 2EZKA 5IPAA 4M73A 2QQ8A 3DEUA 4OIPF 2FU4A 2YX7A 5M5YJ 4A93J 3RSNA 5JR3A 3HPGA 4RB3C 2MH9A 2W84A 3BG7A 5D6FA 1TP4A 5BPDA 5D6EA 1T6SA 1XSVA 2M30A 2VKDA 2DBBA 1D5VA 4PFPA 1AKHB 3WHCA 3ZQQA 4HOBA 5B1AH 2RV8A 3I53A 2DMUA 3BWGA 3WGGA 1QRYA 3AG1H 3TBIA 1IGNA 3PUFA 4EJUA 1U9NA 4PGGA 5H6QA 5EG0A 3W2WA 1Z1DA 1X4PA 4XLEA 2LVSA 2KRCA 1EJ9A 3MQ0A 4XM3A 1AOYA 2CW0F 3KFWX 3Q9SA 4AIDA 2FQ4A 4XLFA 3HGYA 2PLYA 3C2BA 3Q0UA 1JKQC 1G59A 5F0FA 4XNFA 4B1RA 3BPXA 3BR0A 4OIOF 4Y52J 3BTLA 2ZXHA 4ENKA 1Z05A 3GO5A 3RPUA 1S29A 4OMZA 4RAGA 4A0XA 2HDDA 1LFPA 1SFOJ 1OJLA 1O3TA 2A5WA 2CS3A 1LEAA 2RQPA 1B1BA 3LL7A 2CQKA 2XSJC 3GZ6A 3KCCA 1POGA 2WAQA 3TW7A 3BPVA 2COBA 5HDKA 2JA7J 2R3SA 4XKVA 2HKOA 1ZGJA 4L5JA 2DT5A 3GXOA 1QZEA 3KP5A 4BL0B 2FX0A 3OV8A 4BEHB 3FXMA 3L2CA 2KIMA 3FMQA 4KN7X 4RGRA 2BV6A 2XGCA 4M71A 4E7LA 1APLC 1SD7A 2QWWA 1A31A
chains in the Genus database with same CATH topology
2ZBKA 3WTUC 1BI0A 4L0ZB 1G6NA 2GA1A 3VB2A 1JHFA 4B8XA 1WRJA 1PUEE 1KYWA 1R5HA 5ICEA 4CDGA 4EJWA 2H09A 4EVIA 1P4AA 3LFKA 5FGMA 4OINF 3SXYA 2DI3A 4EGYA 2H6BA 2F5FA 4YIIA 5CYVA 4LG0B 4XSZF 5BOXA 1E17A 2L4AA 2L01A 1IW7F 4IPAA 3MCZA 3G3ZA 4IRIA 4EV0A 1FBSA 3WODF 3NQOA 5FD6A 5LHHA 2P6SA 4HZFA 3CJNA 1KYZA 3GW2A 3IC7A 4HF2A 5K5OA 1R7JA 1HKSA 4IHTA 5D8KB 1J0RA 1HW5A 4KA4A 2LF7A 4LK1F 3LA7A 5HVQC 3L00A 1LNWA 1IN7A 4CXFA 3BP8A 1X3UA 1XD7A 1R00A 3IRRA 1U78A 2DPDA 2Y0MA 3HTSB 5KK1A 4XLNF 2OU2A 2PFBA 2ZO4A 5HLIA 4RB2C 4KDPA 2OQRA 3L7WA 1LDDA 3B73A 3F8NA 2HDCA 1TNTA 3IWZA 3CUQB 3QU3A 2IPQX 2O0YA 4A5MA 3LA2A 4RAZA 5FB2A 2EFQA 1B4AA 1P92A 3R60A 2QENA 2RNJA 4KNYA 5LHIA 4KIFA 3LA3A 2FEZA 1QNTA 1FBUA 2MA3A 3FXUA 5D8LB 1ZLJA 5K1YA 4XRFA 2V1XA 4ENJA 4ZZDA 2IA1A 5H20A 3E6BA 3J81K 2FF4A 2VBYA 1FP2A 2WV0A 2QYOA 1MDMA 5CVVA 2Z99A 2JT1A 3GFMA 3DQVC 3K0LA 3LQQA 4I0AA 1SAXA 3R0JA 1UHWA 3GWZA 4JQFA 4F7ZA 1LJ9A 2M87A 1QZZA 3AAFA 2XASA 1YQAA 4TV7A 5IT9K 4MTDA 1Z6TA 2ELHA 1T2KA 3O3KA 2VBWA 5BPIA 5E8IA 1FBQA 2EFOA 3WTSC 4IVNA 1IXRC 3GF2A 2CSOA 3BROA 3HOTA 2VXZA 2OZ6A 3KEQA 5E18F 3COAC 3ABTA 4IRHA 1J2XA 4GGGA 4KICA 4HAMA 4L5IA 3KP3A 2P5VA 2QQBA 1B9MA 3T8TA 2W25A 3KEOA 2XIGA 3JAMK 3RYRA 3VODA 4I01A 3V4GA 2DO7A 4BXUA 1IN4A 1OYYA 1KU9A 4G6DA 3K2ZA 5DD4A 1RNLA 2EV6A 5FFXA 2QVOA 3HOSA 2B0LA 1R1VA 4A2UA 4RGUA 4UNOA 2KRFA 4UVBA 1ZG3A 4YFNF 4ZYEA 2VT2A 2RGVA 1EH6A 1HQCA 3GFIA 2W85A 2IJLA 3ZMTA 1CGPA 2DLLA 2GXBA 1USSA 4Y17A 2WC2A 3SQNA 2MD5A 1BJAA 3DPLC 3F6OA 5JHUA 2CYYA 5F6FA 3DF8A 1H0MA 3CUQC 4KUMA 5L3GA 1D3YA 2O61A 3RYPA 4RB0A 5D5XB 2ZNZA 3WTWC 1REPC 5FO5A 3E6CC 4OOIA 2V9VA 1PP8F 4KT5C 3EYIA 3V7CA 2QM3A 1BC8C 2CO5A 2Y48A 3PQKA 3MFKA 1K78B 3I54A 4M6YA 2P4WA 2HZTA 2VBXA 2FOKA 1RI7A 2COMA 1W7PB 4CZZA 3KP7A 4BAYA 1WWXA 1ZG1A 2OBPA 2PMUA 1FNNA 1QGPA 3GLXA 1IUYA 3MWMA 2OAZA 2X0LA 2HQRA 2EA2A 1WKMA 3F3XA 4HV5A 5JVTA 3C18A 1I5ZA 2M8EA 2ZMEB 6PAXA 2FRHA 4YFXF 3IKTA 1ODDA 4G7HF 2EFNA 3Q9VA 2ZCWA 4L18B 3J80Z 4ZYHA 4QWQA 2VBZA 4MQ9F 1J7KA 2V1UA 5CVIA 5DYMA 4KFCA 3QP5A 3HRTA 2EWNA 2GWRA 2YX4A 5LEJA 2E7WA 5ERIA 1T0FA 4PDKA 1KQ0A 5DDGA 3BDDA 5LRSA 1ZN2A 4HX8A 3KP4A 1UCRA 5ILUA 5LGUA 2STWA 1QO0D 1JE8A 1QBJA 1ZH5A 2H6CA 2ZKZA 2JSCA 1VTNC 1FY7A 2XV4S 3CO6C 1S7AA 1IXSB 1V4RA 1SFEA 2IP2A 2FBHA 4UUVA 4WX9A 3LAJA 4ETSA 4S04A 3E97A 2MC3A 2XRNA 1S8NA 1SFXA 2ADUA 2Z9OA 2D45A 2PQ8A 1OPCA 2P5KA 4NHJA 2R7FA 1TLHB 2DQLA 3P7NA 1ZGAA 2UXXA 2CG4A 1XGSA 3ZPLA 3E6DA 1G3YA 1Z9CA 3ROUA 3V8KA 2VC1A 2HGCA 3C7JA 3WG9A 3ISPA 1SD5A 3GEZA 3JTHA 5D4SA 1XGMA 1Z6RA 2FNPA 3W6KB 2D2WA 2K4BA 3U1DA 3RIRA 3R6SA 1YYVA 1XMKA 4LMYA 4MHGA 4P9FA 5ICCA 2GA2A 2FA5A 3D0SA 2DFIA 4WWCA 4U0VA 5CVJA 4G94A 1O3RA 2XUBA 3TOBA 4HQMA 3CUOA 2KIUA 2EV0A 2IRFG 1J5YA 1T98A 2QZ8A 1OYWA 1IRGA 5CJ9A 4HLXA 4A6DA 3K1PA 4LLLA 5DCMB 2VT3A 4LB5A 2K86A 5A2QK 3FWEA 3CO7C 2P7VB 4FT8A 3EETA 1BIBA 4L9NA 1MJAA 4UXNA 2O8XA 4P55A 4HX7A 5J8CA 3ULQB 3E5XA 2IA0A 3S2WA 5BQTA 1KU7A 1W5SA 5LBQA 3M1EA 2O03A 1RUOA 5CVUA 1HW2A 2C6YA 4YG2F 5FLXZ 1ZAOA 1U6GA 5F64A 1TW3A 1SMYF 3QPHA 1C0WA 2XAHA 2HS5A 1G3TA 3Q5FA 1O3SA 1L0OC 3LSTA 3J7AO 1JGSA 1IXCA 2GIVA 4U0YA 3ZMZA 2KIFA 4N9IA 4Q5SF 3GFLA 3JSOA 3HIFA 1KU3A 1OYIA 2BBYA 2P8TA 5LGNA 1R22A 4Z2YA 3TQNA 3NRVA 4ENNA 4BH9A 3E5QA 1K6OA 2YSRA 4HQEA 1TQMA 5CLSA 1PDNC 4HV6A 3BOQA 1SFUA 1YW8A 4O3MA 4HDUA 1KQ9A 3I59B 2MBFA 1WSUA 2ISZA 1JHHA 4HDVA 1XSDA 3HTUA 2HWVA 1ZRDA 1BN5A 2FMYA 4EJTA 1Q1HA 4HF0A 3F8CA 1W7PD 4KIBA 4RB1A 2VE9A 3GZ5A 2JRTA 5E8GA 1IF1A 2M5WA 1LVAA 5ILVA 4LLGF 4DQ2A 1O57A 1R36A 3I64A 3I4PA 1YS7A 3ZMUA 2KKOA 3QAHA 3RPQA 1NHAA 5LEKA 4D0PA 2Y75A 2E1NA 1KQ8A 4BQAA 1W5TA 2X4HA 1YTYA 2NRAC 4R1HA 3CDHA 1BM9A 2XAJA 3KLNA 3LAPA 2IT0A 2G9WA 3ZMDA 4G9YA 3WTZA 3TDUC 4A12A 4CO8A 3F21A 2VONA 1RZ4A 3ZMSA 1SD6A 3HRUA 4MEYF 1XMAA 3QU6A 2JTVA 2MLGA 3EYYA 1L3LA 1A04A 4CGZA 2IVMA 2K7LA 4R79A 2VN2A 2AS5F 1TW2A 4LFUA 1DUXC 1JXSA 1YFHA 2TDXA 5LLQA 3RI4A 2ISYA 3DXJF 3IKVA 1YW9A 3C3WA 5KVRA 2QQ9A 2HEOA 3N97A 1YG2A 4A0ZA 1BC7C 3MAJA 2IW5A 3PQJA 1S3JA 3HRMA 2LDUA 4GYGA 2PEXA 3K9TA 5TJJA 3JW4A 4M9XA 3V7SA 3SZPA 4M6XA 1USTA 2IA2A 5EEGA 1SD4A 4ZZLA 1ULYA 3TO6A 2EB7A 4HW0A 1R5GA 5DUIA 3V8LA 3T1BA 3P9CA 4M72A 4XBFA 1MGTA 4ASNA 5HLHA 2XVCA 1MJ9A 2BE5F 1LQ1A 3LQRA 4DNCA 4A6EA 4P96A 2ETHA 3WE3A 4MEXF 4YIFA 3WTTC 3D5LA 2RKHA 2NAZA 2R7DA 4XLPF 4NQWA 1XDUA 5FLXK 2QBYA 4OMYA 1FSEA 1F5TA 1XGNA 4BHCA 1YO5C 4M9SA 4G7OF 2Z3YA 4LJZF 2XKOA 4WK8F 3QRFF 1UHMA 1D8JA 2M45A 2A5YB 5AONA 1DPUA 1QPMA 4MQVA 2W57A 4ZYGA 1FWZA 4G8XA 3P9IA 1MDMB 4QLCU 3ZP5A 2LSOA 4IJAA 5HLGA 4JK1X 3FXQA 3HHGA 2VODA 1FX7A 1GHCA 2NNNA 1STZA 2FSWA 1HSJA 4XSXF 3FXRA 1DPRA 4FX4A 2V6CA 3WTXC 4K2EA 4LGWA 2UWMA 2JPBA 4Q48A 4AIHA 1FSHA 2RVCA 4L9JA 4ON0A 5D4RA 3HHHA 3LWFA 3JSPA 1I27A 2KJCA 4GCVA 5K5QA 4EGZA 2HYFA 2MH2A 3KZZA 4MNUA 2CGPA 5D5UB 3HYIA 2LF8A 4OU0A 1U2WA 4O5VA 4KMFA 1FYMA 2FBIA 4R8HA 2L4MA 4I7HA 3JTGA 3CTAA 1TQPA 3VFZA 3KZYA 5E1WA 1XB4A 3EDPA 2OA4A 3F6VA 1ZREA 3T0YA 1J59A 1WQ2A 4HA8A 5HDNA 3ML6A 1YLFA 4GO1A 1DDNA 4Q4ZF 2OD5A 4I2OA 1BI3A 1XGOA 1HBXG 1U3EM 1V3FA 3O6BB 5L3EA 2DAOA 4LK0F 1UB9A 4YFKF 2HTJA 2F2EA 3V8JA 1P6RA 1RUNA 4I98B 2L54A 2A6EF 2YU3A 2PMHA 3F23A 1Y0UA 1FT9A 1Z7UA 1MD0A 3E6MA 4U88A 1XCVA 3BZ6A 2V1DA 3FM3A 3FZVA 3RKYA 2DQRA 3WGHA 3H92A 2K02A 1G3WA 3MZYA 4IF4A 2VOOA 3NEUA 2LNBA 4WXDA 5ICGA 1ZHFA 3I0TA 2A69F 4LG0A 1H9GA 5AIPA 4ZH4F 2D1HA 4UVCA 4BHBA 2RN7A 2ZJ2A 3ABUA 3DFGA 4IRGA 5ICFA 3ELKA 2F5DA 2BYVE 3CLOA 3O2PE 2FMLA 2WTEA 5HS8A 1FYLA 1I6XA 3WTYC 3J81Z 3BJAA 1IN8A 3M9AA 3ERED 1QZYA 3KP2A 4EMSA 2XAGA 1DP7P 5ED4A 2XROA 2GZWA 5K5RA 4EM0B 5DD8A 3F8MA 1AWCA 1ZRCA 1G4DA 4WXHA 4U0WA 2NS0A 2ESHA 4M9ZA 4HX4A 5IT9Z 2F5EA 5FFZA 4OIRF 3ZQ7A 3G73A 1W4MA 2ESNA 1IN6A 4AVPA 2A68F 1D8KA 4EQQA 2HTSA 3IL2A 4L9TA 2EA4A 3I71A 4MTEA 1R23A 1LB2A 4MGRA 3IWFA 2XGXA 4GXOA 3CUQA 3TO7A 3QOPA 5HS9A 3JAMZ 2DW4A 1SMTA 5LHGA 1MJBA 4Q47A 5J8FA 4UHTA 4LD5A 4OIQF 5E1ZB 1OKRA 1KU2A 1ONVA 2VOPA 3FMRA 3GVAA 3R61A 2ZFWA 2EV5A 5HOOA 4AIJA 4RS8A 3B02A 5BS6A 2DPUA 1ZG5A 3MZHA 2E7XA 1P4XA 4KYWA 1IZ1A 3OOPA 2Z33A 2PJPA 5JI6A 1J75A 1ZLKA 4HLYA 1G3SA 3QP6A 1XCBA 4HF1A 1WI9A 3J80K 4B09A 1F1ZA 3SFZA 3IHUA 1K7AA 2HQNA 1KGSA 2A3SA 1OR7A 4I09A 2V79A 3T5XA 3VEPA 2HFHA 5CVRA 1XDSA 2EJRA 1ZRFA 1BBYA 5HDGA 3WGIA 3TKYA 2A6HF 2P6TA 4P5OA 2LKPA 2P5LC 2CWEA 4ESBA 4Y15A 4FHTA 1S6LA 2AXLA 3FHZA 1HKQA 4AD9A 1ZYRF 1OMIA 1ON2A 2RC4A 4BNCA 4UV8A 1KA8A 3EUHA 4A0YA 2DU9A 3HSRA 2Q2EA 3TGNA 4PZJA 3U9GA 2L3DA 5ILSA 2QQAA 2HR3A 1GVJA 3KP6A 3MEXA 4L9VA 3T8RA 1EV7A 3RKWA 1TBXA 4ENMA 4ZYDA 1E2XA 4LLNA 1MKMA 2H27A 1T39A 2XAFA 1YIOA 1HXDA 1LDKB 2JPCA 3KETA 5D5WB 5E1XA 2DK8A 3F22A 1U5TA 3GUDA 3RJPA 1GXPA 2FBKA 2G7UA 1T38A 5TRDA 1LDJA 2A61A 1K78A 1F4KA 3WE2A 2GAUA 1HKTA 3RTRA 2WWYA 4RGXA 5L3CA 3WTVC 2PG4A 1W7PA 4KN4X 3R0AA 2KJBA 3I58A 3E3VA 2FQ3A 3W6JB 4HYEA 4RGSA 1O3QA 4IXAA 2M1BA 3F8BA 3L9FA 4P9UA 1CF7A 5DUKA 2ZMEA 4JBAA 2PBIA 3IRQA 3H3ZA 4H0EA 1BOAA 4WF2A 3PFIA 1U8RA 1P2FA 3C1DA 3M8EA 1I1GA 3GFJA 4L0YB 4WXCA 2UZKA 3HRSA 1FLIA 2O6GE 4BYYA 5BMZA 4AIKA 2GQQA 1I1SA 3E5UA 2GXGA 2NNYA 4E70A 2QLZA 2H94A 2DTRA 1F9NA 2FNAA 3ZMVA 2FXAA 5H6RA 2DK5A 3HSFA 3FX3A 3I5UA 3FM5A 2YPRA 4EM2A 1IRFA 4UVAA 3DV8A 2PI0A 3K1MA 5DCFA 2BGCA 5LRRA 4PCQA 4ESFA 1QQIA 5DEQA 2XKPA 2G7HA 1IAWA 4UV9A 4IHSA 1B6AA 4CHUA 3DKWA 4PGHA 3RDIA 1IN5A 2UXNA 3SZTA 5L3BA 5LGTA 3FF5A 4N0BA 4U7DA 2Q8KA 3P9KA 3TOAA 4A5NA 5A2QZ 1EH7A 2QUFA 2CFXA 1PP7U 3ECHA 2RDPA 3HUGA 1BI2A 3M8FA 1ZARA 4HBLA 2F5CA 1U5TB 2OZUA 1XN7A 1YW7A 3WU0A 2PN6A 4GYIA 1XSXA 4WCGA 1O7LA 2VC0A 3BJ6A 1BIAA 2K4JA 3DPTA 3L09A 1P4WA 5L3FA 4FX0A 4M74A 3DP7A 1RIOH 1S7OA 5E17F 3BY6A 1ON1A 3KE2A 2FE3A 1YS6A 3GYHX 3F72A 4LB6B 1FPQA 3GX4X 5F1RA 3TDZC 2Z5UA 3ZN0A 2A07F 2HKXA 3SHFA 1CF7B 4ESJA 1Z91A 4AWXB 3RKXA 1FZPB 2YR2A 3FMSA 1BI1A 4G7ZF 4Y13A 3VOEA 2W24A 2L02A 1MZBA 3H3UA 4N9HA 3WU1B 1FOKA 2XAQA 3N4MA 2P7CB 2STTA 4U7BA 3U2RA 3REOA 2ZXJA 2ACJA 4EM1A 2EK5A 4I02A 5AIQA 3R4KA 5DCMA 1TNSA 2D1VA 2K27A 3KLOA 5IT3A 4RAYA 2Q0OA 3EQLF 2EFPA 4I0BA 1TQIA 5EEHA 2QBYB 1FP1D 3ECOA 3V7RA 2NYXA 2J5PA 1FYKA 2EFWA 4KMUX 3K1NA 2MLKA 4CICA 1K79A 3ZN1A 4NB5A 1B9NA 4KIGA 2VE8A 3TO9A 1R58A 2ZNYA 4G6QA 2BEOA 1UFMA 4BHPA 5J6XA 1GXQA 5JFRA 1HSTA 1O7FA 4EJVA 4S05A 2J5OA 2HOEA 3M7GA 1B59A 1R1TA 5FD5A 5HS7A 1R1UA 1LEBA 3BJOA 3HSEA 1HW1A 2E1CA 1EH8A 2OQGA 3K69A 3QPTA 4EJOA 5L3DA 5DV5A 3F8FA 2HYGD 4CYDA 1FC3A 1TTYA 5D5VB 1U5TC 2O3FA 4O6JA 5E20A 2XHKA 1J9IA 1H9TA 2JZYA 3I59A 4M73A 3DEUA 4OIPF 2FU4A 2YX7A 5JR3A 4RB3C 2MH9A 2W84A 5D6FA 5BPDA 5D6EA 1T6SA 1XSVA 2M30A 1D5VA 2DBBA 4HOBA 2RV8A 3I53A 3BWGA 3WGGA 4EJUA 4PGGA 5H6QA 1Z1DA 3MQ0A 1AOYA 2CW0F 3KFWX 3Q9SA 2PLYA 3BPXA 4OIOF 4ENKA 1Z05A 3GO5A 3RPUA 1S29A 4OMZA 4A0XA 1O3TA 1LEAA 2RQPA 1B1BA 2CQKA 3GZ6A 3KCCA 3BPVA 5HDKA 2R3SA 2HKOA 1ZGJA 4L5JA 2DT5A 3GXOA 3KP5A 3OV8A 3L2CA 2KIMA 3FMQA 4KN7X 4RGRA 2BV6A 4M71A 1SD7A 2QWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBK A;  3WTU C;  1BI0 A;  4L0Z B;  1G6N A;  2GA1 A;  3VB2 A;  1JHF A;  4B8X A;  1WRJ A;  1PUE E;  1KYW A;  1R5H A;  5ICE A;  4CDG A;  4EJW A;  2H09 A;  4EVI A;  1P4A A;  3LFK A;  5FGM A;  4OIN F;  3SXY A;  2DI3 A;  4EGY A;  2H6B A;  2F5F A;  4YII A;  5CYV A;  4LG0 B;  4XSZ F;  5BOX A;  1E17 A;  2L4A A;  2L01 A;  1IW7 F;  4IPA A;  3MCZ A;  3G3Z A;  4IRI A;  4EV0 A;  1FBS A;  3WOD F;  3NQO A;  5FD6 A;  5LHH A;  2P6S A;  4HZF A;  3CJN A;  1KYZ A;  3GW2 A;  3IC7 A;  4HF2 A;  5K5O A;  1R7J A;  1HKS A;  4IHT A;  5D8K B;  1J0R A;  1HW5 A;  4KA4 A;  2LF7 A;  4LK1 F;  3LA7 A;  5HVQ C;  3L00 A;  1LNW A;  1IN7 A;  4CXF A;  3BP8 A;  1X3U A;  1XD7 A;  1R00 A;  3IRR A;  1U78 A;  2DPD A;  2Y0M A;  3HTS B;  5KK1 A;  4XLN F;  2OU2 A;  2PFB A;  2ZO4 A;  5HLI A;  4RB2 C;  4KDP A;  2OQR A;  3L7W A;  1LDD A;  3B73 A;  3F8N A;  2HDC A;  1TNT A;  3IWZ A;  3CUQ B;  3QU3 A;  2IPQ X;  2O0Y A;  4A5M A;  3LA2 A;  4RAZ A;  5FB2 A;  2EFQ A;  1B4A A;  1P92 A;  3R60 A;  2QEN A;  2RNJ A;  4KNY A;  5LHI A;  4KIF A;  3LA3 A;  2FEZ A;  1QNT A;  1FBU A;  2MA3 A;  3FXU A;  5D8L B;  1ZLJ A;  5K1Y A;  4XRF A;  2V1X A;  4ENJ A;  4ZZD A;  2IA1 A;  5H20 A;  3E6B A;  3J81 K;  2FF4 A;  2VBY A;  1FP2 A;  2WV0 A;  2QYO A;  1MDM A;  5CVV A;  2Z99 A;  2JT1 A;  3GFM A;  3DQV C;  3K0L A;  3LQQ A;  4I0A A;  1SAX A;  3R0J A;  1UHW A;  3GWZ A;  4JQF A;  4F7Z A;  1LJ9 A;  2M87 A;  1QZZ A;  3AAF A;  2XAS A;  1YQA A;  4TV7 A;  5IT9 K;  4MTD A;  1Z6T A;  2ELH A;  1T2K A;  3O3K A;  2VBW A;  5BPI A;  5E8I A;  1FBQ A;  2EFO A;  3WTS C;  4IVN A;  1IXR C;  3GF2 A;  2CSO A;  3BRO A;  3HOT A;  2VXZ A;  2OZ6 A;  3KEQ A;  5E18 F;  3COA C;  3ABT A;  4IRH A;  1J2X A;  4GGG A;  4KIC A;  4HAM A;  4L5I A;  3KP3 A;  2P5V A;  2QQB A;  1B9M A;  3T8T A;  2W25 A;  3KEO A;  2XIG A;  3JAM K;  3RYR A;  3VOD A;  4I01 A;  3V4G A;  2DO7 A;  4BXU A;  1IN4 A;  1OYY A;  1KU9 A;  4G6D A;  3K2Z A;  5DD4 A;  1RNL A;  2EV6 A;  5FFX A;  2QVO A;  3HOS A;  2B0L A;  1R1V A;  4A2U A;  4RGU A;  4UNO A;  2KRF A;  4UVB A;  1ZG3 A;  4YFN F;  4ZYE A;  2VT2 A;  2RGV A;  1EH6 A;  1HQC A;  3GFI A;  2W85 A;  2IJL A;  3ZMT A;  1CGP A;  2DLL A;  2GXB A;  1USS A;  4Y17 A;  2WC2 A;  3SQN A;  2MD5 A;  1BJA A;  3DPL C;  3F6O A;  5JHU A;  2CYY A;  5F6F A;  3DF8 A;  1H0M A;  3CUQ C;  4KUM A;  5L3G A;  1D3Y A;  2O61 A;  3RYP A;  4RB0 A;  5D5X B;  2ZNZ A;  3WTW C;  1REP C;  5FO5 A;  3E6C C;  4OOI A;  2V9V A;  1PP8 F;  4KT5 C;  3EYI A;  3V7C A;  2QM3 A;  1BC8 C;  2CO5 A;  2Y48 A;  3PQK A;  3MFK A;  1K78 B;  3I54 A;  4M6Y A;  2P4W A;  2HZT A;  2VBX A;  2FOK A;  1RI7 A;  2COM A;  1W7P B;  4CZZ A;  3KP7 A;  4BAY A;  1WWX A;  1ZG1 A;  2OBP A;  2PMU A;  1FNN A;  1QGP A;  3GLX A;  1IUY A;  3MWM A;  2OAZ A;  2X0L A;  2HQR A;  2EA2 A;  1WKM A;  3F3X A;  4HV5 A;  5JVT A;  3C18 A;  1I5Z A;  2M8E A;  2ZME B;  6PAX A;  2FRH A;  4YFX F;  3IKT A;  1ODD A;  4G7H F;  2EFN A;  3Q9V A;  2ZCW A;  4L18 B;  3J80 Z;  4ZYH A;  4QWQ A;  2VBZ A;  4MQ9 F;  1J7K A;  2V1U A;  5CVI A;  5DYM A;  4KFC A;  3QP5 A;  3HRT A;  2EWN A;  2GWR A;  2YX4 A;  5LEJ A;  2E7W A;  5ERI A;  1T0F A;  4PDK A;  1KQ0 A;  5DDG A;  3BDD A;  5LRS A;  1ZN2 A;  4HX8 A;  3KP4 A;  1UCR A;  5ILU A;  5LGU A;  2STW A;  1QO0 D;  1JE8 A;  1QBJ A;  1ZH5 A;  2H6C A;  2ZKZ A;  2JSC A;  1VTN C;  1FY7 A;  2XV4 S;  3CO6 C;  1S7A A;  1IXS B;  1V4R A;  1SFE A;  2IP2 A;  2FBH A;  4UUV A;  4WX9 A;  3LAJ A;  4ETS A;  4S04 A;  3E97 A;  2MC3 A;  2XRN A;  1S8N A;  1SFX A;  2ADU A;  2Z9O A;  2D45 A;  2PQ8 A;  1OPC A;  2P5K A;  4NHJ A;  2R7F A;  1TLH B;  2DQL A;  3P7N A;  1ZGA A;  2UXX A;  2CG4 A;  1XGS A;  3ZPL A;  3E6D A;  1G3Y A;  1Z9C A;  3ROU A;  3V8K A;  2VC1 A;  2HGC A;  3C7J A;  3WG9 A;  3ISP A;  1SD5 A;  3GEZ A;  3JTH A;  5D4S A;  1XGM A;  1Z6R A;  2FNP A;  3W6K B;  2D2W A;  2K4B A;  3U1D A;  3RIR A;  3R6S A;  1YYV A;  1XMK A;  4LMY A;  4MHG A;  4P9F A;  5ICC A;  2GA2 A;  2FA5 A;  3D0S A;  2DFI A;  4WWC A;  4U0V A;  5CVJ A;  4G94 A;  1O3R A;  2XUB A;  3TOB A;  4HQM A;  3CUO A;  2KIU A;  2EV0 A;  2IRF G;  1J5Y A;  1T98 A;  2QZ8 A;  1OYW A;  1IRG A;  5CJ9 A;  4HLX A;  4A6D A;  3K1P A;  4LLL A;  5DCM B;  2VT3 A;  4LB5 A;  2K86 A;  5A2Q K;  3FWE A;  3CO7 C;  2P7V B;  4FT8 A;  3EET A;  1BIB A;  4L9N A;  1MJA A;  4UXN A;  2O8X A;  4P55 A;  4HX7 A;  5J8C A;  3ULQ B;  3E5X A;  2IA0 A;  3S2W A;  5BQT A;  1KU7 A;  1W5S A;  5LBQ A;  3M1E A;  2O03 A;  1RUO A;  5CVU A;  1HW2 A;  2C6Y A;  4YG2 F;  5FLX Z;  1ZAO A;  1U6G A;  5F64 A;  1TW3 A;  1SMY F;  3QPH A;  1C0W A;  2XAH A;  2HS5 A;  1G3T A;  3Q5F A;  1O3S A;  1L0O C;  3LST A;  3J7A O;  1JGS A;  1IXC A;  2GIV A;  4U0Y A;  3ZMZ A;  2KIF A;  4N9I A;  4Q5S F;  3GFL A;  3JSO A;  3HIF A;  1KU3 A;  1OYI A;  2BBY A;  2P8T A;  5LGN A;  1R22 A;  4Z2Y A;  3TQN A;  3NRV A;  4ENN A;  4BH9 A;  3E5Q A;  1K6O A;  2YSR A;  4HQE A;  1TQM A;  5CLS A;  1PDN C;  4HV6 A;  3BOQ A;  1SFU A;  1YW8 A;  4O3M A;  4HDU A;  1KQ9 A;  3I59 B;  2MBF A;  1WSU A;  2ISZ A;  1JHH A;  4HDV A;  1XSD A;  3HTU A;  2HWV A;  1ZRD A;  1BN5 A;  2FMY A;  4EJT A;  1Q1H A;  4HF0 A;  3F8C A;  1W7P D;  4KIB A;  4RB1 A;  2VE9 A;  3GZ5 A;  2JRT A;  5E8G A;  1IF1 A;  2M5W A;  1LVA A;  5ILV A;  4LLG F;  4DQ2 A;  1O57 A;  1R36 A;  3I64 A;  3I4P A;  1YS7 A;  3ZMU A;  2KKO A;  3QAH A;  3RPQ A;  1NHA A;  5LEK A;  4D0P A;  2Y75 A;  2E1N A;  1KQ8 A;  4BQA A;  1W5T A;  2X4H A;  1YTY A;  2NRA C;  4R1H A;  3CDH A;  1BM9 A;  2XAJ A;  3KLN A;  3LAP A;  2IT0 A;  2G9W A;  3ZMD A;  4G9Y A;  3WTZ A;  3TDU C;  4A12 A;  4CO8 A;  3F21 A;  2VON A;  1RZ4 A;  3ZMS A;  1SD6 A;  3HRU A;  4MEY F;  1XMA A;  3QU6 A;  2JTV A;  2MLG A;  3EYY A;  1L3L A;  1A04 A;  4CGZ A;  2IVM A;  2K7L A;  4R79 A;  2VN2 A;  2AS5 F;  1TW2 A;  4LFU A;  1DUX C;  1JXS A;  1YFH A;  2TDX A;  5LLQ A;  3RI4 A;  2ISY A;  3DXJ F;  3IKV A;  1YW9 A;  3C3W A;  5KVR A;  2QQ9 A;  2HEO A;  3N97 A;  1YG2 A;  4A0Z A;  1BC7 C;  3MAJ A;  2IW5 A;  3PQJ A;  1S3J A;  3HRM A;  2LDU A;  4GYG A;  2PEX A;  3K9T A;  5TJJ A;  3JW4 A;  4M9X A;  3V7S A;  3SZP A;  4M6X A;  1UST A;  2IA2 A;  5EEG A;  1SD4 A;  4ZZL A;  1ULY A;  3TO6 A;  2EB7 A;  4HW0 A;  1R5G A;  5DUI A;  3V8L A;  3T1B A;  3P9C A;  4M72 A;  4XBF A;  1MGT A;  4ASN A;  5HLH A;  2XVC A;  1MJ9 A;  2BE5 F;  1LQ1 A;  3LQR A;  4DNC A;  4A6E A;  4P96 A;  2ETH A;  3WE3 A;  4MEX F;  4YIF A;  3WTT C;  3D5L A;  2RKH A;  2NAZ A;  2R7D A;  4XLP F;  4NQW A;  1XDU A;  5FLX K;  2QBY A;  4OMY A;  1FSE A;  1F5T A;  1XGN A;  4BHC A;  1YO5 C;  4M9S A;  4G7O F;  2Z3Y A;  4LJZ F;  2XKO A;  4WK8 F;  3QRF F;  1UHM A;  1D8J A;  2M45 A;  2A5Y B;  5AON A;  1DPU A;  1QPM A;  4MQV A;  2W57 A;  4ZYG A;  1FWZ A;  4G8X A;  3P9I A;  1MDM B;  4QLC U;  3ZP5 A;  2LSO A;  4IJA A;  5HLG A;  4JK1 X;  3FXQ A;  3HHG A;  2VOD A;  1FX7 A;  1GHC A;  2NNN A;  1STZ A;  2FSW A;  1HSJ A;  4XSX F;  3FXR A;  1DPR A;  4FX4 A;  2V6C A;  3WTX C;  4K2E A;  4LGW A;  2UWM A;  2JPB A;  4Q48 A;  4AIH A;  1FSH A;  2RVC A;  4L9J A;  4ON0 A;  5D4R A;  3HHH A;  3LWF A;  3JSP A;  1I27 A;  2KJC A;  4GCV A;  5K5Q A;  4EGZ A;  2HYF A;  2MH2 A;  3KZZ A;  4MNU A;  2CGP A;  5D5U B;  3HYI A;  2LF8 A;  4OU0 A;  1U2W A;  4O5V A;  4KMF A;  1FYM A;  2FBI A;  4R8H A;  2L4M A;  4I7H A;  3JTG A;  3CTA A;  1TQP A;  3VFZ A;  3KZY A;  5E1W A;  1XB4 A;  3EDP A;  2OA4 A;  3F6V A;  1ZRE A;  3T0Y A;  1J59 A;  1WQ2 A;  4HA8 A;  5HDN A;  3ML6 A;  1YLF A;  4GO1 A;  1DDN A;  4Q4Z F;  2OD5 A;  4I2O A;  1BI3 A;  1XGO A;  1HBX G;  1U3E M;  1V3F A;  3O6B B;  5L3E A;  2DAO A;  4LK0 F;  1UB9 A;  4YFK F;  2HTJ A;  2F2E A;  3V8J A;  1P6R A;  1RUN A;  4I98 B;  2L54 A;  2A6E F;  2YU3 A;  2PMH A;  3F23 A;  1Y0U A;  1FT9 A;  1Z7U A;  1MD0 A;  3E6M A;  4U88 A;  1XCV A;  3BZ6 A;  2V1D A;  3FM3 A;  3FZV A;  3RKY A;  2DQR A;  3WGH A;  3H92 A;  2K02 A;  1G3W A;  3MZY A;  4IF4 A;  2VOO A;  3NEU A;  2LNB A;  4WXD A;  5ICG A;  1ZHF A;  3I0T A;  2A69 F;  4LG0 A;  1H9G A;  5AIP A;  4ZH4 F;  2D1H A;  4UVC A;  4BHB A;  2RN7 A;  2ZJ2 A;  3ABU A;  3DFG A;  4IRG A;  5ICF A;  3ELK A;  2F5D A;  2BYV E;  3CLO A;  3O2P E;  2FML A;  2WTE A;  5HS8 A;  1FYL A;  1I6X A;  3WTY C;  3J81 Z;  3BJA A;  1IN8 A;  3M9A A;  3ERE D;  1QZY A;  3KP2 A;  4EMS A;  2XAG A;  1DP7 P;  5ED4 A;  2XRO A;  2GZW A;  5K5R A;  4EM0 B;  5DD8 A;  3F8M A;  1AWC A;  1ZRC A;  1G4D A;  4WXH A;  4U0W A;  2NS0 A;  2ESH A;  4M9Z A;  4HX4 A;  5IT9 Z;  2F5E A;  5FFZ A;  4OIR F;  3ZQ7 A;  3G73 A;  1W4M A;  2ESN A;  1IN6 A;  4AVP A;  2A68 F;  1D8K A;  4EQQ A;  2HTS A;  3IL2 A;  4L9T A;  2EA4 A;  3I71 A;  4MTE A;  1R23 A;  1LB2 A;  4MGR A;  3IWF A;  2XGX A;  4GXO A;  3CUQ A;  3TO7 A;  3QOP A;  5HS9 A;  3JAM Z;  2DW4 A;  1SMT A;  5LHG A;  1MJB A;  4Q47 A;  5J8F A;  4UHT A;  4LD5 A;  4OIQ F;  5E1Z B;  1OKR A;  1KU2 A;  1ONV A;  2VOP A;  3FMR A;  3GVA A;  3R61 A;  2ZFW A;  2EV5 A;  5HOO A;  4AIJ A;  4RS8 A;  3B02 A;  5BS6 A;  2DPU A;  1ZG5 A;  3MZH A;  2E7X A;  1P4X A;  4KYW A;  1IZ1 A;  3OOP A;  2Z33 A;  2PJP A;  5JI6 A;  1J75 A;  1ZLK A;  4HLY A;  1G3S A;  3QP6 A;  1XCB A;  4HF1 A;  1WI9 A;  3J80 K;  4B09 A;  1F1Z A;  3SFZ A;  3IHU A;  1K7A A;  2HQN A;  1KGS A;  2A3S A;  1OR7 A;  4I09 A;  2V79 A;  3T5X A;  3VEP A;  2HFH A;  5CVR A;  1XDS A;  2EJR A;  1ZRF A;  1BBY A;  5HDG A;  3WGI A;  3TKY A;  2A6H F;  2P6T A;  4P5O A;  2LKP A;  2P5L C;  2CWE A;  4ESB A;  4Y15 A;  4FHT A;  1S6L A;  2AXL A;  3FHZ A;  1HKQ A;  4AD9 A;  1ZYR F;  1OMI A;  1ON2 A;  2RC4 A;  4BNC A;  4UV8 A;  1KA8 A;  3EUH A;  4A0Y A;  2DU9 A;  3HSR A;  2Q2E A;  3TGN A;  4PZJ A;  3U9G A;  2L3D A;  5ILS A;  2QQA A;  2HR3 A;  1GVJ A;  3KP6 A;  3MEX A;  4L9V A;  3T8R A;  1EV7 A;  3RKW A;  1TBX A;  4ENM A;  4ZYD A;  1E2X A;  4LLN A;  1MKM A;  2H27 A;  1T39 A;  2XAF A;  1YIO A;  1HXD A;  1LDK B;  2JPC A;  3KET A;  5D5W B;  5E1X A;  2DK8 A;  3F22 A;  1U5T A;  3GUD A;  3RJP A;  1GXP A;  2FBK A;  2G7U A;  1T38 A;  5TRD A;  1LDJ A;  2A61 A;  1K78 A;  1F4K A;  3WE2 A;  2GAU A;  1HKT A;  3RTR A;  2WWY A;  4RGX A;  5L3C A;  3WTV C;  2PG4 A;  1W7P A;  4KN4 X;  3R0A A;  2KJB A;  3I58 A;  3E3V A;  2FQ3 A;  3W6J B;  4HYE A;  4RGS A;  1O3Q A;  4IXA A;  2M1B A;  3F8B A;  3L9F A;  4P9U A;  1CF7 A;  5DUK A;  2ZME A;  4JBA A;  2PBI A;  3IRQ A;  3H3Z A;  4H0E A;  1BOA A;  4WF2 A;  3PFI A;  1U8R A;  1P2F A;  3C1D A;  3M8E A;  1I1G A;  3GFJ A;  4L0Y B;  4WXC A;  2UZK A;  3HRS A;  1FLI A;  2O6G E;  4BYY A;  5BMZ A;  4AIK A;  2GQQ A;  1I1S A;  3E5U A;  2GXG A;  2NNY A;  4E70 A;  2QLZ A;  2H94 A;  2DTR A;  1F9N A;  2FNA A;  3ZMV A;  2FXA A;  5H6R A;  2DK5 A;  3HSF A;  3FX3 A;  3I5U A;  3FM5 A;  2YPR A;  4EM2 A;  1IRF A;  4UVA A;  3DV8 A;  2PI0 A;  3K1M A;  5DCF A;  2BGC A;  5LRR A;  4PCQ A;  4ESF A;  1QQI A;  5DEQ A;  2XKP A;  2G7H A;  1IAW A;  4UV9 A;  4IHS A;  1B6A A;  4CHU A;  3DKW A;  4PGH A;  3RDI A;  1IN5 A;  2UXN A;  3SZT A;  5L3B A;  5LGT A;  3FF5 A;  4N0B A;  4U7D A;  2Q8K A;  3P9K A;  3TOA A;  4A5N A;  5A2Q Z;  1EH7 A;  2QUF A;  2CFX A;  1PP7 U;  3ECH A;  2RDP A;  3HUG A;  1BI2 A;  3M8F A;  1ZAR A;  4HBL A;  2F5C A;  1U5T B;  2OZU A;  1XN7 A;  1YW7 A;  3WU0 A;  2PN6 A;  4GYI A;  1XSX A;  4WCG A;  1O7L A;  2VC0 A;  3BJ6 A;  1BIA A;  2K4J A;  3DPT A;  3L09 A;  1P4W A;  5L3F A;  4FX0 A;  4M74 A;  3DP7 A;  1RIO H;  1S7O A;  5E17 F;  3BY6 A;  1ON1 A;  3KE2 A;  2FE3 A;  1YS6 A;  3GYH X;  3F72 A;  4LB6 B;  1FPQ A;  3GX4 X;  5F1R A;  3TDZ C;  2Z5U A;  3ZN0 A;  2A07 F;  2HKX A;  3SHF A;  1CF7 B;  4ESJ A;  1Z91 A;  4AWX B;  3RKX A;  1FZP B;  2YR2 A;  3FMS A;  1BI1 A;  4G7Z F;  4Y13 A;  3VOE A;  2W24 A;  2L02 A;  1MZB A;  3H3U A;  4N9H A;  3WU1 B;  1FOK A;  2XAQ A;  3N4M A;  2P7C B;  2STT A;  4U7B A;  3U2R A;  3REO A;  2ZXJ A;  2ACJ A;  4EM1 A;  2EK5 A;  4I02 A;  5AIQ A;  3R4K A;  5DCM A;  1TNS A;  2D1V A;  2K27 A;  3KLO A;  5IT3 A;  4RAY A;  2Q0O A;  3EQL F;  2EFP A;  4I0B A;  1TQI A;  5EEH A;  2QBY B;  1FP1 D;  3ECO A;  3V7R A;  2NYX A;  2J5P A;  1FYK A;  2EFW A;  4KMU X;  3K1N A;  2MLK A;  4CIC A;  1K79 A;  3ZN1 A;  4NB5 A;  1B9N A;  4KIG A;  2VE8 A;  3TO9 A;  1R58 A;  2ZNY A;  4G6Q A;  2BEO A;  1UFM A;  4BHP A;  5J6X A;  1GXQ A;  5JFR A;  1HST A;  1O7F A;  4EJV A;  4S05 A;  2J5O A;  2HOE A;  3M7G A;  1B59 A;  1R1T A;  5FD5 A;  5HS7 A;  1R1U A;  1LEB A;  3BJO A;  3HSE A;  1HW1 A;  2E1C A;  1EH8 A;  2OQG A;  3K69 A;  3QPT A;  4EJO A;  5L3D A;  5DV5 A;  3F8F A;  2HYG D;  4CYD A;  1FC3 A;  1TTY A;  5D5V B;  1U5T C;  2O3F A;  4O6J A;  5E20 A;  2XHK A;  1J9I A;  1H9T A;  2JZY A;  3I59 A;  4M73 A;  3DEU A;  4OIP F;  2FU4 A;  2YX7 A;  5JR3 A;  4RB3 C;  2MH9 A;  2W84 A;  5D6F A;  5BPD A;  5D6E A;  1T6S A;  1XSV A;  2M30 A;  1D5V A;  2DBB A;  4HOB A;  2RV8 A;  3I53 A;  3BWG A;  3WGG A;  4EJU A;  4PGG A;  5H6Q A;  1Z1D A;  3MQ0 A;  1AOY A;  2CW0 F;  3KFW X;  3Q9S A;  2PLY A;  3BPX A;  4OIO F;  4ENK A;  1Z05 A;  3GO5 A;  3RPU A;  1S29 A;  4OMZ A;  4A0X A;  1O3T A;  1LEA A;  2RQP A;  1B1B A;  2CQK A;  3GZ6 A;  3KCC A;  3BPV A;  5HDK A;  2R3S A;  2HKO A;  1ZGJ A;  4L5J A;  2DT5 A;  3GXO A;  3KP5 A;  3OV8 A;  3L2C A;  2KIM A;  3FMQ A;  4KN7 X;  4RGR A;  2BV6 A;  4M71 A;  1SD7 A;  2QWW A; 
#chains in the Genus database with same CATH topology
 1QHH D;  2ZBK A;  5EDN A;  3ZQH A;  2WY8 Q;  4YEJ A;  3WTU C;  2HVR A;  5F1J A;  1BI0 A;  3S3O A;  2KLO A;  4L0Z B;  1G6N A;  2CUJ A;  2GA1 A;  2E34 A;  2HQ5 A;  2MC4 A;  1K4T A;  2M4K A;  3VB2 A;  1JJ8 C;  1Z21 A;  1JHF A;  3I3L A;  3BR6 A;  1K6Y A;  4B8X A;  1W5C C;  1WRJ A;  2LC2 A;  1KYW A;  3CES A;  1R5H A;  2HVQ A;  5ICE A;  1PUE E;  4CDG A;  4DJA A;  4EJW A;  2H09 A;  2CV2 A;  3UKG A;  5M5X J;  4EVI A;  3DBR B;  1P4A A;  4A3C J;  3LFK A;  5FGM A;  2L0K A;  4OIN F;  1KZH A;  3SXY A;  2V6E A;  4N4N B;  4XMY A;  3K4B A;  2DI3 A;  4EGY A;  2EIJ H;  1XMX A;  2H6B A;  2F5F A;  3H5N A;  1VQ9 I;  4J19 A;  4YII A;  5CYV A;  4LG0 B;  4XSZ F;  5BOX A;  1E17 A;  2L4A A;  2LRD A;  2L01 A;  3H0D A;  1IW7 F;  1EA3 A;  4IPA A;  1FTT A;  3MCZ A;  3G3Z A;  4IRI A;  4EV0 A;  3HXL A;  3AL0 C;  1FBS A;  3WOD F;  3NQO A;  4AM3 A;  5FD6 A;  5LHH A;  3G71 I;  2P6S A;  4HZF A;  3CJN A;  5B1B H;  1BR4 A;  1KYZ A;  1R6R A;  2R92 J;  3AG4 H;  3GW2 A;  1WH7 A;  3H9Q A;  3IC7 A;  4HF2 A;  3A2K A;  5TIS C;  5K5O A;  3CCV I;  1R7J A;  4A3G J;  1HKS A;  1B8I B;  1Y8R B;  1ZEL A;  4IHT A;  5D8K B;  1J0R A;  1HW5 A;  4KA4 A;  2QSG X;  3C2H A;  2LF7 A;  4LK1 F;  3LA7 A;  5HVQ C;  4BE1 A;  2EIN H;  4HPQ A;  3L00 A;  1LNW A;  1MW7 A;  2DN0 A;  1GLN A;  3FIW A;  5EJC A;  3DU5 A;  5FRM A;  2KL4 A;  2JJ7 A;  2QGU A;  3CCU I;  3L2U A;  2WY7 Q;  3FXL A;  4MIM A;  1IN7 A;  4CXF A;  1ITY A;  3BP8 A;  2WBM A;  1X3U A;  3JRE A;  2WAD A;  1XD7 A;  3F0C A;  3PUB A;  5TGT A;  4E4H A;  3QYB A;  1R00 A;  3IRR A;  4D5F A;  4I76 A;  2M0C A;  3HG9 A;  4RA2 A;  3VYS B;  1U78 A;  2DPD A;  2Y0M A;  3HTS B;  5KK1 A;  4XLN F;  2OU2 A;  4XR6 A;  2PFB A;  2ZO4 A;  2R7R A;  1HOM A;  3ZQF A;  2R7U A;  5HLI A;  4RB2 C;  4KDP A;  2OQR A;  4B3A A;  3PNY A;  2IAI A;  3L7W A;  1IJW C;  1LDD A;  3GBG A;  3JR9 A;  3B73 A;  4N4O B;  5GP9 A;  4YEL A;  3F8N A;  3FK6 A;  1E0E A;  1TWC J;  2HDC A;  1TNT A;  1DU0 A;  4BS9 A;  3IWZ A;  1HF0 A;  3CUQ B;  3QU3 A;  2IPQ X;  1P9Q C;  2O0Y A;  4P1W A;  4HSR A;  4W97 A;  4A5M A;  3LA2 A;  4RAZ A;  3OYK A;  5FB2 A;  2EFQ A;  4ABZ A;  3HPH A;  1B4A A;  1P92 A;  1I39 A;  3R60 A;  2QEN A;  3OIO A;  3K6G A;  2RNJ A;  2PJR A;  4KNY A;  3G2B A;  5LHI A;  2BOL A;  3A01 B;  4KIF A;  1XS9 A;  1OIS A;  2ZB9 A;  3AG2 H;  1J09 A;  3LA3 A;  1WZ2 A;  1UZC A;  1QNT A;  1FBU A;  2FEZ A;  2MA3 A;  2MD0 A;  3FXU A;  5C4X J;  5D8L B;  1RKW A;  5KCM A;  1ZLJ A;  5K1Y A;  4D1Q A;  4XRF A;  5JHF A;  1AU7 A;  3PO2 J;  2V1X A;  2M7B A;  4ENJ A;  4ZZD A;  2IA1 A;  3DEE A;  4AYB N;  4IO9 F;  3ZR8 X;  5H20 A;  3E6B A;  3J81 K;  2FF4 A;  2VBY A;  3LSG A;  1FP2 A;  3CCL I;  4HNU A;  2WV0 A;  1DP3 A;  2QYO A;  2M7A A;  1MDM A;  4AVZ A;  5CVV A;  2R0Q C;  1ZKG A;  2Z99 A;  4XKB A;  1W36 D;  1V54 H;  2GXA A;  2JT1 A;  3GFM A;  5FLM J;  3NAR A;  3DQV C;  2A05 A;  1OCO H;  3BT9 A;  3K0L A;  3LQQ A;  5DTD A;  4I0A A;  1SAX A;  2VAS A;  3R0J A;  1UHW A;  3GWZ A;  4JQF A;  1NG6 A;  2KDZ A;  4F7Z A;  1LJ9 A;  2M87 A;  1QZZ A;  3L2W A;  3M3Y J;  3AAF A;  2XAS A;  2V1N A;  1YQA A;  3HEF A;  4TV7 A;  3CJT B;  5IT9 K;  4B43 A;  4CUG A;  4MTD A;  1Z6T A;  3EUA A;  4XID A;  2ELH A;  2KP6 A;  1T2K A;  1SC7 A;  3O3K A;  1MMD A;  2KRH A;  2VBW A;  1FJL A;  5BPI A;  5E8I A;  4ZJZ A;  1FBQ A;  4XN0 A;  3ZGK A;  2EFO A;  2EZL A;  4IVN A;  3WTS C;  2JN6 A;  2DA6 A;  3BZK A;  1IXR C;  4A3F J;  3GF2 A;  2CSO A;  3BRO A;  4IZZ A;  3HOT A;  2VXZ A;  2OZ6 A;  3KEQ A;  3VYR B;  5E18 F;  1F36 A;  2ZSH B;  3ABT A;  3COA C;  1YJ9 I;  4IRH A;  1J2X A;  4GDF A;  2DA2 A;  2ZJR F;  2EZH A;  3G1M A;  4GGG A;  4KIC A;  4UUS B;  5LFA A;  4HAM A;  4L5I A;  3KP3 A;  3S2D J;  4A3M J;  1Z77 A;  4GRI A;  2P5V A;  2QQB A;  2HYJ A;  1B9M A;  2PX9 A;  4G6T B;  3SZG A;  3T8T A;  2W25 A;  3KEO A;  2XIG A;  3ZQC A;  1FEX A;  3JAM K;  3RYR A;  1WPK A;  2KIS A;  4RMN A;  2MYS A;  3VOD A;  2JUC A;  2XRL A;  2LYC A;  3K4M A;  2R7W A;  4I01 A;  3DKX A;  3V4G A;  2DO7 A;  2R5Y B;  4DW6 A;  2Y0S A;  5JLX A;  3BG9 A;  1JTX A;  1WJF A;  2F5V A;  1IN4 A;  4U87 A;  1OYY A;  1KU9 A;  4LG3 A;  4BXU A;  1GDT A;  5KAI C;  4G6D A;  1WVR A;  3K2Z A;  5DD4 A;  1RNL A;  2EV6 A;  3RKQ A;  1GV2 A;  5FFX A;  2QVO A;  4CCM A;  3HOS A;  1D0X A;  1R1V A;  2B0L A;  4A2U A;  2Q2E B;  4RGU A;  3CCQ I;  4UNO A;  2KRF A;  4UVB A;  1ZG3 A;  2ZJP F;  4YFN F;  2LD5 A;  4ZYE A;  5J47 A;  4G12 A;  1Y1W J;  2VT2 A;  1ETO A;  3ASN H;  2B9S A;  3LSR A;  2KIQ A;  2RGV A;  2CQX A;  1EH6 A;  1HQC A;  3FKI J;  3GFI A;  2W85 A;  4X1E A;  2IJL A;  2DMT A;  2VQC A;  1JKO C;  3ZMT A;  2KZV A;  1CGP A;  2DLL A;  2GXB A;  1USS A;  4HEA 2;  3S17 J;  4Y17 A;  2WC2 A;  3SQN A;  5IOZ A;  5EEA A;  1PJR A;  4M3B A;  4KJZ A;  2L9R A;  2MD5 A;  2XGE A;  4ITV A;  1BJA A;  2GOM A;  3DPL C;  3F6O A;  5JHU A;  3UR3 C;  2DYS H;  2CYY A;  5F6F A;  3DF8 A;  1H0M A;  3CUQ C;  4KUM A;  1O4X A;  3DCF A;  5L3G A;  1D3Y A;  2IGO A;  1X19 A;  2X6X A;  2M8G X;  3NAU A;  2O61 A;  3RYP A;  4RB0 A;  1MIJ A;  5D5X B;  2ZNZ A;  3WTW C;  1SVM A;  1REP C;  2K85 A;  5FO5 A;  3IUO A;  4OOI A;  3E6C C;  2V9V A;  1PP8 F;  4KT5 C;  3K7A J;  3KPH A;  2KQR A;  3EYI A;  3V7C A;  2QM3 A;  1BC8 C;  2CO5 A;  4JX4 A;  2Y48 A;  4ZDO A;  1Z67 A;  2VLA A;  1ETX A;  3PQK A;  3G1O A;  3MFK A;  2DOA A;  2K9S A;  2KZG A;  1K78 B;  4MO7 A;  3I54 A;  3D1N I;  4M6Y A;  3GTL J;  2P4W A;  2L7F P;  3JRH A;  2HZT A;  4LIV A;  2EQR A;  1ETW A;  2VBX A;  2FOK A;  1P7J A;  2M9H A;  3L2Q A;  1RI7 A;  2COM A;  1W7P B;  4OAZ A;  3MVP A;  3TP0 A;  4CZZ A;  3KP7 A;  4BAY A;  1WWX A;  1ZG1 A;  3ZQL A;  2OBP A;  1X3Z B;  2PMU A;  4ZTF A;  1FNN A;  1QGP A;  1YOV B;  2GBY A;  4BDZ A;  3H1C A;  3GLX A;  1IUY A;  1D5Y A;  2QA4 I;  3GTK J;  3MWM A;  2OAZ A;  2X0L A;  2HQR A;  2EA2 A;  4XKC A;  3DBH B;  1XC5 A;  2R7X A;  1WKM A;  2ME6 A;  2L2O A;  2TCT A;  3F3X A;  2EPF A;  4HV5 A;  5JVT A;  3MKY B;  3C18 A;  1I5Z A;  2M8E A;  2ZME B;  6PAX A;  2FRH A;  3SDG A;  4YFX F;  3IKT A;  1LVK A;  4C3H J;  1ODD A;  1GUU A;  3UNG C;  4G7H F;  4EAT A;  1ZK8 A;  5J1Y A;  3ESW B;  2EFN A;  2O7O A;  3Q9V A;  4OAY A;  2QSH X;  1E3P A;  3OYC A;  1OR7 C;  4XOR A;  5J1U A;  2ZCW A;  4L18 B;  3J80 Z;  3OYB A;  4ZYH A;  2H8R A;  1Y8Q B;  3A0B C;  3MZ8 A;  4QWQ A;  2V9P A;  2L7Z A;  2W00 A;  3CC2 I;  2VBZ A;  4MQ9 F;  1J7K A;  2V1U A;  2V9K A;  4XIC A;  1UG0 A;  1RR7 A;  4C2T A;  5CVI A;  5DYM A;  3ASO H;  4KFC A;  3QP5 A;  4B3X A;  1ZR4 A;  4BXF A;  3HRT A;  2WAQ N;  2EWN A;  1FOX A;  2GWR A;  1Z3X A;  2YX4 A;  2XPV A;  3CF2 A;  3GZN B;  2X1D A;  5LEJ A;  2E7W A;  5ERI A;  1T0F A;  1WI3 A;  4BBR J;  1JGG A;  1K61 A;  4PDK A;  1KQ0 A;  1IV8 A;  5DDG A;  2EBI A;  3BDD A;  5LRS A;  1ZN2 A;  4HX8 A;  1JI8 A;  2CH0 A;  1X3W B;  3KP4 A;  1G2H A;  1UCR A;  5EGO B;  1BOB A;  3EPZ A;  5ILU A;  1TWG J;  2BW3 B;  5GAG J;  3BG5 A;  3EUH C;  5LGU A;  5B66 C;  2STW A;  1QO0 D;  1JE8 A;  1RET A;  1QBJ A;  1ZH5 A;  2PMZ A;  4I6Z A;  1B72 B;  4BJT A;  5EF6 A;  2H6C A;  3ZXS A;  2ZKZ A;  4Y33 A;  2JSC A;  1VTN C;  2IGN A;  1FY7 A;  2ECC A;  2XV4 S;  3CO6 C;  4CYC A;  1RKT A;  1S7A A;  1IXS B;  3HGG A;  4B4C A;  1V4R A;  3LSH A;  4FQG A;  1SFE A;  2IP2 A;  4DIQ A;  2LY1 A;  2FBH A;  2XAU A;  4UUV A;  4WX9 A;  3A0H C;  1SVO A;  3LAJ A;  4BQN A;  4ETS A;  3DWL E;  4S04 A;  3E97 A;  2WV1 A;  2R7T A;  1JKP C;  1YE9 A;  3ABM H;  2MC3 A;  2XRN A;  3DTE A;  2DT6 A;  1S8N A;  2K9L A;  1SFX A;  2ADU A;  2DT7 B;  3BR3 A;  3WU2 C;  2E71 A;  1VQP I;  2PQ8 A;  2D45 A;  1OPC A;  2P5K A;  2Z9O A;  4NHJ A;  2R7F A;  1TLH B;  1PUF A;  2FD5 A;  3HUG B;  4Z6Y A;  2M2E A;  4M3F A;  2DQL A;  3P7N A;  2RQQ A;  1ZGA A;  2NS7 A;  2UXX A;  2CG4 A;  1XGS A;  3ZPL A;  1M1E B;  3E6D A;  5C3E J;  1QU3 A;  2B7E A;  4GFB A;  1G3Y A;  1Z9C A;  3ROU A;  1WJE A;  3S1M J;  3V8K A;  1W1W E;  2VC1 A;  5J40 A;  2DCE A;  2HGC A;  3C7J A;  2DA4 A;  3WG9 A;  2ZC2 A;  3CP2 A;  1VQM I;  5IP9 J;  5E3L A;  4F52 A;  3ISP A;  1SD5 A;  3GEZ A;  3JTH A;  5D4S A;  1XGM A;  2QF7 A;  1PYV A;  1Z6R A;  3I4M J;  1R9T J;  1N78 A;  2FNP A;  3ZRG A;  1ENH A;  2VXD A;  1QVU A;  3W6K B;  2D2W A;  2O9L A;  2K4B A;  3U1D A;  3RIR A;  4CH7 A;  3RCO A;  3ZQG A;  3PIO F;  3R6S A;  1YYV A;  2H1K A;  1XMK A;  4LMY A;  2VQG A;  5KNL A;  3BTJ A;  4MHG A;  4P9F A;  5ICC A;  2GA2 A;  2FA5 A;  3D0S A;  1VF9 A;  2DFI A;  2L9N A;  3W2A A;  4WWC A;  4U0V A;  5CVJ A;  4G94 A;  2CV1 A;  1O3R A;  2XUB A;  2XPU A;  3TOB A;  2W1O A;  2ZME C;  4BQO A;  4HQM A;  1W0U A;  4IHY A;  3CUO A;  1I6H J;  2DFF A;  2KIU A;  1K4S A;  1FMV A;  1VQ6 I;  2EV0 A;  3WG7 H;  1T95 A;  2I5U A;  1R49 A;  4DGW B;  2LBF B;  2IRF G;  1J5Y A;  4DBR A;  1T98 A;  3H9G A;  4NBQ A;  3L1P A;  2LKX A;  1XPX A;  2QZ8 A;  1OYW A;  3I9V 2;  1IRG A;  1YRN A;  4BAC A;  5CJ9 A;  3HOV J;  4HLX A;  3VDX A;  2CQQ A;  1SFK A;  4A6D A;  3K1P A;  3GLL A;  4LLL A;  2E1O A;  5E3M A;  2WAF A;  5DCM B;  2OTJ I;  3PFY A;  2VT3 A;  1QVT A;  4LB5 A;  2K86 A;  3ERM A;  2LG4 A;  1X1D A;  1R71 A;  2V4J C;  5A2Q K;  3FWE A;  3OY9 A;  3CO7 C;  2N8G A;  2P7V B;  4FT8 A;  3EET A;  1BIB A;  5FJ8 J;  4L9N A;  1MJA A;  3IH4 A;  4UXN A;  2O8X A;  4P55 A;  3CC4 I;  4HX7 A;  5J4Y A;  5J8C A;  3ULQ B;  5EZG A;  3E5X A;  2V26 A;  3OYD A;  2JVH A;  2F4O B;  5FKO A;  2IA0 A;  4ZC3 A;  5J4V A;  3S2W A;  3ZOB A;  1YHQ I;  5BQT A;  1MNE A;  3JRD A;  4XKW A;  3HL2 A;  1KU7 A;  3CMY A;  1W5S A;  5LBQ A;  1IDZ A;  3M1E A;  3LNQ A;  3W6V A;  2O03 A;  2HDW A;  3H3V K;  5F04 A;  1RUO A;  2E1M C;  5CVU A;  2YU9 J;  1HW2 A;  2C6Y A;  2RNG A;  4YG2 F;  5FLX Z;  1ZAO A;  1U6G A;  5F64 A;  1TW3 A;  4L5E A;  1SMY F;  4XK4 A;  3QPH A;  3TW6 A;  1C0W A;  2XAH A;  2MG4 A;  4JP0 A;  2HS5 A;  3G4S I;  2DFE A;  1VQN I;  2X48 A;  1T8I A;  1G3T A;  3Q5F A;  4BU2 A;  2HI3 A;  2Y2Z A;  1O3S A;  2BY3 A;  1L0O C;  1VFC A;  1HDP A;  3LST A;  3J7A O;  1JGS A;  3K70 C;  4CCK A;  1IXC A;  2GIV A;  2Q1Z B;  2DOD A;  4U0Y A;  2HNH A;  3ZMZ A;  2KIF A;  3OS1 A;  5C4J J;  4N9I A;  4Q5S F;  3GFL A;  3JSO A;  1IG7 A;  3HIF A;  3HKZ A;  2CMP A;  1KU3 A;  1OYI A;  3QOE A;  4Y7N J;  3B6A A;  2X1C A;  4QTR A;  2BBY A;  2P8T A;  3D5R C;  5LGN A;  1R22 A;  4Z2Y A;  4PSW A;  4DZJ A;  3TQN A;  4CCO A;  4BDY A;  3NRV A;  4E7K A;  4ENN A;  4BH9 A;  3I55 I;  3E5Q A;  3SYT A;  1F43 A;  1K6O A;  2YSR A;  2DTZ A;  4HQE A;  1TQM A;  5HNF A;  2Z1D A;  5H2F C;  3ZQI A;  1XX5 A;  5CLS A;  1PDN C;  2Z2S B;  4HV6 A;  3M1C A;  3BOQ A;  3JCU C;  1SFU A;  1YW8 A;  3S1Q J;  4BGD A;  4O3M A;  5GAH J;  1KQ9 A;  3CQZ J;  4HDU A;  1IRZ A;  4E6K G;  3I59 B;  3RQ4 A;  2TRT A;  2MBF A;  4PFO A;  1WSU A;  2ISZ A;  4IQ4 A;  3MN2 A;  1JHH A;  4HDV A;  1XSD A;  1D0Z A;  2DA7 A;  3FBN B;  3HTU A;  4HG2 A;  2HWV A;  1ZRD A;  2DFH A;  4RBO A;  1BN5 A;  2FMY A;  4EJT A;  4V2G A;  1Y1V J;  4I99 C;  2AXT C;  1Q1H A;  2HOS A;  3DTK A;  4HF0 A;  3F8C A;  1W7P D;  3ABK H;  4KIB A;  2VJJ A;  4RB1 A;  2VE9 A;  2E35 A;  2K9N A;  4A3K J;  3GZ5 A;  1FTZ A;  3Q0V A;  2JRT A;  4C3J J;  2QSF X;  1OCR H;  5E8G A;  2NVX J;  1CQT A;  1MNM C;  1IF1 A;  2M5W A;  1LVA A;  4QIW N;  1BJZ A;  2CQN A;  5EG0 B;  3CJR B;  1A6I A;  5ILV A;  1WHU A;  3HOZ J;  3OWT A;  4LLG F;  3PIP F;  3GCM A;  4DQ2 A;  1O57 A;  5IP7 J;  1R36 A;  3I64 A;  3DBL B;  3I4P A;  1YS7 A;  1K83 J;  3ZMU A;  3GTP J;  4LIT A;  2LR8 A;  2KKO A;  3QAH A;  3BCB A;  3RPQ A;  1NHA A;  3J7Z I;  1R4N B;  1EKE A;  5LEK A;  1SAU A;  1TT0 A;  1YX3 A;  4D0P A;  1IO2 A;  2Y75 A;  4JX6 A;  2K9M A;  3OR2 C;  2E1N A;  1LE8 A;  1KQ8 A;  4F3Q A;  3BLY A;  1IUF A;  2LRE A;  4M3E A;  2FOW A;  4BQA A;  1W5T A;  1T56 A;  2X4H A;  2CW8 A;  2F6C A;  3G1L A;  1YTY A;  2NRA C;  4B47 A;  3SDB A;  4R1H A;  3CDH A;  1HLV A;  2IXS A;  1BM9 A;  2XAJ A;  5B5E C;  3KLN A;  3J7A Y;  4DZP A;  3LAP A;  2IT0 A;  2HQA A;  3ONQ A;  2G9W A;  3K2A A;  3ZMD A;  4G9Y A;  1T0F C;  3WTZ A;  3TDU C;  3PO3 J;  1RES A;  4A12 A;  4CO8 A;  3F21 A;  4BY7 J;  2ZXW H;  2VKV A;  2VON A;  1RZ4 A;  3S3M A;  3CCE I;  3ZMS A;  1YJW I;  1SD6 A;  3HRU A;  2CJJ A;  3CF5 F;  4BXX J;  1WFX A;  4MEY F;  1XMA A;  2JSP A;  3VPR A;  3OL4 A;  3QU6 A;  2JTV A;  2MLG A;  3EYY A;  3FXK A;  1N75 A;  1L3L A;  1A04 A;  4CGZ A;  2IVM A;  2K7L A;  4R79 A;  5FKN A;  2VN2 A;  2AS5 F;  4II2 A;  1ETY A;  3W2V A;  3U1K A;  1TW2 A;  4FCY A;  2XDV A;  1G8X A;  3MMY B;  4LFU A;  1XG1 A;  1D0Y A;  1DUX C;  2NVQ J;  4A3L J;  2IS6 A;  1JXS A;  1YFH A;  2TDX A;  5LLQ A;  4CCJ A;  3RI4 A;  3MD2 A;  1GT0 C;  2ISY A;  3DXJ F;  3IKV A;  1YW9 A;  3C3W A;  5KVR A;  1MBK A;  2QQ9 A;  4EEF G;  2HEO A;  1TZL A;  2CFO A;  3N97 A;  3K70 D;  1YG2 A;  4A0Z A;  1BC7 C;  3SJM A;  2X6Y A;  3MAJ A;  2IW5 A;  3PQJ A;  1JT6 A;  1S3J A;  3OL3 A;  3GTM J;  2JK3 A;  3HRM A;  2LDU A;  4YRV A;  4GYG A;  2XB0 X;  2PEX A;  3K9T A;  5TJJ A;  3JW4 A;  5K7F A;  4M9X A;  3CCJ I;  2LH9 A;  1HCR A;  3V7S A;  3SZP A;  1UEL B;  2VKE A;  4CZC A;  2IS4 A;  4M6X A;  1UST A;  2IA2 A;  5EEG A;  1SD4 A;  1X2N A;  4ZZL A;  4F92 B;  3HDD A;  1ULY A;  3TO6 A;  5FKK A;  2EB7 A;  1LPQ A;  4HW0 A;  1R5G A;  3T1B A;  4XBF A;  3V8L A;  3P9C A;  4M72 A;  5DUI A;  1MGT A;  4QPO A;  1R4M B;  4ASN A;  2B63 J;  1D1A A;  5HLH A;  3VWB A;  2XVC A;  1MJ9 A;  3DKY A;  2BE5 F;  2O8K A;  1AHD P;  2ID6 A;  4XOT A;  1LQ1 A;  3LQR A;  4DNC A;  4A6E A;  1HDD C;  1X1B A;  4P96 A;  2UUZ A;  2VUM J;  3E7L A;  2ETH A;  3WE3 A;  3S2H J;  4MEX F;  4E7J A;  4YIF A;  3JRC A;  3WTT C;  1PVE A;  2AO9 A;  3D5L A;  1V5G A;  4D5C A;  2L7M P;  2R7O A;  2RKH A;  2ECB A;  2NAZ A;  1JUP A;  2R7D A;  4XLP F;  4RDU A;  2CUE A;  4NQW A;  5BNG A;  5HLT A;  2R5Z A;  4DBQ A;  1XDU A;  5FLX K;  2QBY A;  2Z16 A;  4OMY A;  1FSE A;  4J00 A;  3I4N J;  4XRS G;  1F5T A;  2X51 A;  1WJD A;  2HPI A;  3LSK A;  1ORK A;  1MBJ A;  3FK7 A;  3J7Y J;  4A3E J;  1XGN A;  4BHC A;  2W7N A;  2L9S A;  1YO5 C;  4M9S A;  3A02 A;  3PL8 A;  4G7O F;  2Z3Y A;  4LJZ F;  2XKO A;  2OUM A;  3OR1 C;  4UB8 C;  4WK8 F;  2DMP A;  3QOD A;  2VJ4 A;  1MH3 A;  2AQF A;  3BTI A;  3OYF A;  3QRF F;  2D5V A;  1A5J A;  1UHM A;  2PJR B;  3HB9 A;  2E2H J;  1D8J A;  2M45 A;  3AKZ A;  4ZDL A;  2FUG 2;  4X0G A;  1TT5 B;  4RLF A;  4MFE A;  2HZD A;  2NS8 A;  1VQ7 I;  3MKZ A;  2A5Y B;  3OYG A;  2WB1 A;  2CRG A;  5AON A;  1N77 A;  2BY0 A;  1DPU A;  1QPM A;  4MQV A;  1U9O A;  2W57 A;  4CSW A;  4ZYG A;  1VQ4 I;  1FWZ A;  3U21 A;  1I50 J;  4G8X A;  3P9I A;  4NC6 A;  2E5N A;  1MDM B;  4QLC U;  3ZP5 A;  2LSO A;  4IJA A;  3HM5 A;  4XQF A;  3O8G A;  5HLG A;  3QPS A;  1X1C A;  4JK1 X;  4XON A;  3IP4 B;  3FXQ A;  4AYB A;  3HHG A;  1BL0 A;  2VOD A;  2GM4 A;  4HRI A;  2DYR H;  1FX7 A;  3K4N A;  1GHC A;  2NNN A;  1X1P A;  4HNV A;  1STZ A;  3LOC A;  2FSW A;  1HSJ A;  3LSM A;  3FXR A;  1X58 A;  4XSX F;  4DOZ A;  4XN3 A;  1DPR A;  1U8B A;  4FX4 A;  2V6C A;  4B48 A;  3WTX C;  3MKW B;  2ZFU A;  4K2E A;  4LGW A;  2UWM A;  2JPB A;  4C9Y A;  4Q48 A;  5M3F J;  1YI2 I;  4AIH A;  2JA2 A;  1FSH A;  2ICW G;  1RC9 A;  2RVC A;  2VIX A;  2Y30 A;  2YS9 A;  4L9J A;  4ON0 A;  5D4R A;  3HHH A;  2CU7 A;  2ZXI A;  3LWF A;  3JSP A;  5IYB J;  1I27 A;  2NOJ B;  2KJC A;  4GCV A;  2OCC H;  3HBL A;  3KYD B;  5K5Q A;  2DDB A;  2X6W A;  4EGZ A;  2HYF A;  4E7H A;  2MH2 A;  4XOP A;  3KZZ A;  4MNU A;  1AKH A;  1TL8 A;  3HOY J;  2CGP A;  3HOX J;  1N25 A;  1KON A;  5D5U B;  2EZI A;  5E3N A;  3HYI A;  2LF8 A;  1JJ6 C;  4JX5 A;  3LSP A;  4OU0 A;  1U2W A;  4O5V A;  4KMF A;  1FYM A;  2FBI A;  1ERD A;  4R8H A;  2L4M A;  4I7H A;  4M3G A;  3JTG A;  3CDI A;  5C44 J;  1ZGW A;  3CTA A;  1TQP A;  3VFZ A;  4PSX A;  1WJC A;  3KZY A;  5E1W A;  2IS2 A;  2VI6 A;  1XB4 A;  3EDP A;  2OA4 A;  4PJJ A;  3F6V A;  1ZRE A;  5IYD J;  2R7Q A;  3T0Y A;  1J59 A;  3RZD J;  1W0T A;  1WQ2 A;  4HA8 A;  4PJN A;  4M3D A;  1YJN I;  5HDN A;  3ML6 A;  4ZTJ A;  1H89 C;  2JMW A;  2JA5 J;  1QHG A;  1YLF A;  4GO1 A;  1DDN A;  4Q4Z F;  2OD5 A;  4I2O A;  1BI3 A;  1XGO A;  2BXZ A;  4W1U A;  1HBX G;  2CV0 A;  1MH4 A;  1BW6 A;  1U3E M;  1VQ8 I;  3L2V A;  1V3F A;  2E1M B;  3O6B B;  5L3E A;  2DAO A;  4LK0 F;  1S5L C;  2E5Z A;  4BEH A;  2IGM A;  1UB9 A;  4YFK F;  2HTJ A;  2F2E A;  3V8J A;  1P6R A;  3BZC A;  2DA3 A;  1RUN A;  3B6C A;  4I98 B;  2L54 A;  2A6E F;  2YU3 A;  2PMH A;  3F23 A;  1Y0U A;  1Y6I A;  1FIA A;  5IP6 A;  1FT9 A;  4FTH A;  2DOE A;  1UHS A;  4BY1 J;  1Z7U A;  1MD0 A;  3E6M A;  4U88 A;  1XCV A;  3BZ6 A;  2OPT A;  2V1D A;  3FM3 A;  4J01 A;  3FZV A;  2G0E A;  2LFB A;  3RKY A;  2DQR A;  5GPC A;  3WGH A;  3H92 A;  4A3D J;  2K02 A;  1G3W A;  3F9K A;  3MZY A;  3VYT B;  4UY8 I;  3HKZ N;  5GTH C;  4IF4 A;  2VOO A;  2VQH A;  1DQU A;  3NEU A;  5F08 A;  2LNB A;  4WXD A;  5ICG A;  1ZHF A;  3IH3 A;  1WGX A;  1NTC A;  3I0T A;  1MSF C;  1VND A;  4IEJ A;  3RQI A;  2A69 F;  2MSY A;  2MGQ A;  1EF4 A;  1DU6 A;  1Z3Y A;  4LG0 A;  3PJR A;  2WA0 A;  1H9G A;  5AIP A;  4S0H B;  1ACI A;  2MFZ A;  4ZH4 F;  2D1H A;  4UVC A;  2QEX I;  4BHB A;  2RN7 A;  2VKH A;  2ZJ2 A;  3FXO A;  3ABU A;  3DFG A;  4NNJ A;  4IRG A;  5ICF A;  5CKT A;  1S72 I;  3ELK A;  2F5D A;  1VZ0 A;  2BYV E;  4UUT A;  3CLO A;  2DMQ A;  2R7V A;  2JVG A;  3O2P E;  2LLK A;  2FML A;  3HZJ A;  2WTE A;  5HS8 A;  1FYL A;  4IQJ A;  1I6X A;  4A69 C;  2XGD A;  4AU7 A;  3WTY C;  3J81 Z;  3BJA A;  2F4M B;  1VQK I;  2XF7 A;  3CDL A;  2R93 J;  1MMS A;  3S93 A;  1IN8 A;  3M9A A;  2VJI A;  3S8P A;  2HOT A;  3ERE D;  1QZY A;  5FLV A;  3KP2 A;  4EMS A;  4KIT B;  1RR8 C;  4II3 A;  2XAG A;  1DP7 P;  5ED4 A;  2XRO A;  2GZW A;  5K5R A;  2LOO A;  4EM0 B;  5DD8 A;  3F8M A;  1AWC A;  1FMW A;  1ZRC A;  1G4D A;  4WXH A;  5K7Z A;  4IHW A;  2LY2 A;  4U0W A;  5KHD A;  2NS0 A;  3HOU J;  2ESH A;  4M9Z A;  4HX4 A;  5IT9 Z;  2F5E A;  5FFZ A;  2VPR A;  2P81 A;  2JQ7 A;  5F0C A;  4OIR F;  4PUS A;  1D1B A;  4PJ0 C;  3A1Y A;  3N05 A;  1OQY A;  4BKX A;  3DPU A;  3ZQ7 A;  1Z7L A;  3G73 A;  1W4M A;  2QKL B;  2ESN A;  1IN6 A;  3QQA A;  4AVP A;  3DTI A;  2W4S A;  3JRF A;  2F4I A;  2YUS A;  2F48 A;  3TP3 A;  2BY2 A;  2A68 F;  2CW7 A;  4NC7 A;  1D8K A;  3OS2 A;  2KT0 A;  4EQQ A;  2HTS A;  4F93 B;  3IL2 A;  1IRX A;  4L9T A;  2EA4 A;  3JRI A;  1JUM A;  3I71 A;  4MTE A;  4D9J A;  3TED A;  1R23 A;  3C2G A;  3AG3 H;  2LKS A;  1VQO I;  3BG3 A;  1LB2 A;  4MGR A;  3IWF A;  3VSK A;  2XGX A;  4GXO A;  3CUQ A;  3TO7 A;  3OYH A;  3QOP A;  2QKM B;  5HS9 A;  3FBI B;  2IBD A;  3LSI A;  3JAM Z;  2DW4 A;  1SMT A;  5LHG A;  1MJB A;  4Q47 A;  1TWA J;  2HU9 A;  2L7K A;  3CP8 A;  3SEZ A;  5J8F A;  2OV7 A;  4PJL A;  1D1C A;  4D7M A;  4E7I A;  4UHT A;  3LMM A;  1BR1 A;  4E7Z A;  1QA6 A;  4LD5 A;  4BBS J;  5IOY A;  4OIQ F;  5E1Z B;  1OKR A;  3A01 A;  1KU2 A;  1ONV A;  3OYN A;  2VOP A;  1Y56 A;  2VQL A;  3FMR A;  1FIP A;  3GVA A;  3R61 A;  1MMG A;  2ZFW A;  2WAE A;  3PSF A;  4CYC B;  2ZSI B;  2EV5 A;  5HOO A;  4BJ5 C;  4AIJ A;  3VYU B;  5JVG F;  1VI0 A;  3WHB A;  4RS8 A;  1JKR C;  3B02 A;  4RM2 A;  3TL4 X;  1IDY A;  2RAE A;  1W36 C;  3GTO J;  5BS6 A;  2HXO A;  3OSF A;  2DPU A;  1ZG5 A;  3MZH A;  1VQ5 I;  3DEW A;  3JRA A;  3JRG A;  4PK4 A;  4X6A J;  2E36 A;  1E3H A;  1V5F A;  2NVT J;  2KHM A;  1E3O C;  2ME0 A;  2W48 A;  5FKL A;  2FJ1 A;  2E7X A;  5J3L A;  1P4X A;  1YIT I;  1MMN A;  5CQG A;  3S32 A;  2JUG A;  2XF5 A;  4PJM A;  4KYW A;  3GTG J;  1PUF B;  1IZ1 A;  2JA8 J;  3OOP A;  5GTI C;  2Z33 A;  2K3P A;  1DGW Y;  1U0J A;  4NC8 A;  5JI6 A;  2PJP A;  2R7S A;  1J75 A;  1ZLK A;  1Y0N A;  4HLY A;  1G3S A;  1NK3 P;  3QWL A;  5CPR B;  3QP6 A;  3S1R J;  1MBG A;  3QPL A;  3S15 J;  1XCB A;  4HF1 A;  1WI9 A;  2M4G A;  3J80 K;  4B09 A;  1F1Z A;  3SFZ A;  1A35 A;  3CME I;  1UG2 A;  3H35 A;  3IHU A;  1K7A A;  2HQN A;  1KGS A;  4HNT A;  2A3S A;  4F91 B;  2H8W A;  3ZCO A;  1OR7 A;  4I09 A;  2V79 A;  4IHV A;  3BCA A;  3T5X A;  5J1R A;  3VEP A;  2JA6 J;  2HFH A;  2NXN B;  2DDA A;  5CVR A;  1MND A;  1XDS A;  4V19 K;  5IY5 H;  2EJR A;  1WCM J;  2XC7 A;  1Q1V A;  1ZRF A;  1BBY A;  1JUS A;  5HDG A;  3WGI A;  5EZH A;  2Y0S N;  3TKY A;  4UUS A;  4FAS D;  1HA8 A;  1WJA A;  2A6H F;  2P6T A;  4P5O A;  2LKP A;  3K4C A;  1R5I D;  1V5E A;  2P5L C;  2CWE A;  2IEK A;  4ESB A;  4JOM A;  9ANT A;  4Y15 A;  3SFI A;  4KIS A;  4FHT A;  4QSH A;  2R4G A;  1OLT A;  2K5C A;  1S6L A;  2XPW A;  2AXL A;  3GME A;  3FHZ A;  1HKQ A;  1GV5 A;  4ANJ A;  3G6E I;  4AD9 A;  5E79 C;  2R5Y A;  1ZYR F;  1OMI A;  1ON2 A;  2K40 A;  2RC4 A;  3ABL H;  1OCP A;  2VB6 A;  2XF6 A;  4BNC A;  2KFD A;  4CCN A;  4UV8 A;  2BZT A;  3CD6 I;  1TWF J;  4H4K C;  1KA8 A;  3NWS A;  3EUH A;  4A0Y A;  2DU9 A;  2ZJQ F;  1ETQ A;  3HSR A;  2X85 A;  2Y69 H;  1YRN B;  4BQQ A;  2Q2E A;  3TGN A;  4PZJ A;  4IHX A;  3U9G A;  4NDL A;  2L3D A;  1LFB A;  5ILS A;  4CCL A;  3OYE A;  1WH5 A;  2CUZ A;  2QQA A;  2HR3 A;  1GVJ A;  4E7S A;  3FXJ A;  1XTA A;  3Q0W A;  3KP6 A;  3MEX A;  1IV6 A;  4L9V A;  3T8R A;  1ZR2 A;  2E2J J;  1EV7 A;  3RKW A;  3JRB A;  1TBX A;  4ENM A;  4ZYD A;  1E2X A;  4LLN A;  1MKM A;  2H27 A;  1T39 A;  2Y9Y A;  1MMA A;  2XAF A;  3W3C A;  4XLH A;  5FKM A;  2RRE A;  1YIO A;  3KEY A;  4C2M J;  1HXD A;  1RPW A;  2WB1 N;  1LDK B;  2V7F A;  1ETV A;  3SEQ A;  2JPC A;  3KET A;  5D5W B;  5E1X A;  4XRS A;  3H0G J;  4BJ6 C;  1QPI A;  2DK8 A;  1IC8 A;  2BHZ A;  1LUJ B;  3HC7 A;  2W82 A;  2IGK A;  3M07 A;  3F22 A;  1U5T A;  2LTP A;  3GUD A;  3RJP A;  3X2Q H;  1GXP A;  2FBK A;  2G7U A;  1T38 A;  4IX7 A;  5TRD A;  1LDJ A;  3BQY A;  3CCY A;  3FDY A;  4LIU A;  2A61 A;  1K78 A;  5B3S H;  1F4K A;  2NVY J;  2BVM A;  2DJN A;  3WE2 A;  1T33 A;  2BXY A;  2GAU A;  5DS9 A;  1HKT A;  3MKL A;  1SVL A;  1JTY A;  3RTR A;  2M0M A;  1A6Q A;  2WWY A;  2ELJ A;  3LSJ A;  3VSL A;  2R7Z J;  4RGX A;  1Z0X A;  5L3C A;  3WTV C;  2PG4 A;  5GAD J;  1W7P A;  4KN4 X;  3R0A A;  1UJ8 A;  2KJB A;  3I58 A;  2OC6 A;  4RAF A;  3E3V A;  2FQ3 A;  3W6J B;  1BA5 A;  4FET A;  1I3Q J;  4HYE A;  3CJQ B;  4RGS A;  3V42 A;  3A4C A;  3L2R A;  1O3Q A;  2DJI A;  3BTC A;  3S16 J;  3O8H A;  4IXA A;  4C30 A;  4FIS A;  2CUF A;  4NUB A;  1ZQ3 P;  2M1B A;  1NK2 P;  2M34 A;  2P0W A;  3F8B A;  3IAS 2;  3OIQ A;  3OIP A;  3L9F A;  3PNT A;  4P9U A;  1CF7 A;  5DUK A;  1SEU A;  2LK2 A;  2ZME A;  2Y9Z A;  4JBA A;  2PBI A;  3IRQ A;  3H3Z A;  4H0E A;  1BOA A;  3QYF A;  4LOC A;  4WF2 A;  3PFI A;  3CZ6 A;  3PSI A;  1U8R A;  4FE4 A;  1P2F A;  1NH3 A;  3C1D A;  2VPL A;  2ELK A;  3M8E A;  2O5R A;  1I1G A;  5F0H A;  3GFJ A;  4L0Y B;  2L5Q A;  2GOX B;  2KPM A;  4WXC A;  1YIJ I;  4A3B J;  3S3N A;  2UZK A;  3HRS A;  4JYK A;  3D5S C;  1FLI A;  2O6G E;  4BYY A;  4QPQ A;  3BC8 A;  3OOU A;  5F27 A;  4UB6 C;  5BMZ A;  3BR2 A;  4IOA F;  2NOG A;  5DM7 F;  3NWT A;  4AIK A;  2GQQ A;  3QYE A;  1MBE A;  3E5U A;  4D7N A;  1I1S A;  4IL6 C;  4C3I J;  2GXG A;  1SAN A;  2NNY A;  5LD2 C;  1ETK A;  4E70 A;  1I3A A;  2QLZ A;  3K4L A;  2H94 A;  2DTR A;  2DA1 A;  2PMZ N;  2HVS A;  1F9N A;  2FNA A;  2M3A A;  3ZMV A;  2FXA A;  2ID3 A;  2X9D A;  1Y39 A;  5H6R A;  2DK5 A;  3HSF A;  3FX3 A;  3I5U A;  4OWR B;  3FKJ A;  4XRM A;  5EGO A;  3FM5 A;  2E19 A;  2YPR A;  4EM2 A;  2BW3 A;  1IRF A;  1GVD A;  4UVA A;  4IKF A;  3DV8 A;  4XLC A;  2PI0 A;  3K1M A;  5DCF A;  2BGC A;  5LRR A;  4AUX A;  3KIO A;  1B72 A;  5IYC J;  3IH2 A;  1LE8 B;  1A36 A;  4PCQ A;  4ZYA A;  3KX2 A;  1TWH J;  3DLL F;  2OF7 A;  4ESF A;  1BW5 A;  3H9J A;  1QQI A;  3K10 A;  3TMO A;  3E0J B;  1MBH A;  5DEQ A;  3M4O J;  2XKP A;  2G7H A;  4BUP A;  1MBF A;  3OYI A;  1JT0 A;  1IAW A;  4UV9 A;  2JWT A;  3BQZ A;  4RLQ A;  4IHS A;  1B6A A;  4CHU A;  3DKW A;  4PGH A;  3RDI A;  1IN5 A;  2KDO A;  1LKX A;  2UXN A;  3SZT A;  5L3B A;  5LGT A;  3CMA I;  3FF5 A;  2BHY A;  4N0B A;  3OYL A;  1FOY A;  2HXI A;  2Q8K A;  4U7D A;  3P9K A;  3CMM A;  3TOA A;  4A5N A;  5A2Q Z;  1EH7 A;  1P7I A;  4BE0 A;  2GLO A;  2QUF A;  2CFX A;  2EH3 A;  1PP7 U;  3H36 A;  3ECH A;  2RDP A;  3HUG A;  1BI2 A;  3K4J A;  3M8F A;  2HOA A;  1ZAR A;  2E60 A;  4HBL A;  5GAE J;  5K7H A;  3S14 J;  2F5C A;  1U5T B;  1TC3 C;  2OZU A;  1XN7 A;  1YW7 A;  3WU0 A;  2PN6 A;  3DU6 A;  2XB5 A;  4MFD A;  2LP0 A;  4GYI A;  4XL9 A;  3KYL A;  2DA5 A;  1XSX A;  3OSG A;  2EIL H;  1O7L A;  2EIM H;  2VC0 A;  3BJ6 A;  4WCG A;  4M6V A;  1BIA A;  1S9H A;  2BY1 A;  3M8J A;  4HST A;  4DYC A;  2K4J A;  2BVL A;  3DPT A;  3L09 A;  1P4W A;  5HOD A;  3P5J A;  1HC8 A;  5L3F A;  5DM6 F;  4FX0 A;  4M74 A;  3IAM 2;  3DP7 A;  2K9Q A;  2EIK H;  1RIO H;  2AQE A;  1S7O A;  4DYQ A;  3BY6 A;  5E17 F;  2DXI A;  1ON1 A;  2IS1 A;  1DGR M;  1X2M A;  3KE2 A;  3CCS I;  2FE3 A;  1YS6 A;  3GYH X;  3F72 A;  3CLQ A;  4LB6 B;  1FPQ A;  3GX4 X;  4AC0 A;  5F1R A;  3EUK L;  4C2U A;  1WJB A;  3TDZ C;  2Z5U A;  3ZN0 A;  4CA0 A;  2HPM A;  2A07 F;  2HKX A;  3A03 A;  3SHF A;  4A3J J;  2CQ7 A;  2QCO A;  4ESJ A;  1CF7 B;  1Z91 A;  4BE2 A;  4AWX B;  3CCR I;  3RKX A;  1FZP B;  2GIZ A;  1BR2 A;  2YR2 A;  3FMS A;  3GTQ J;  1BI1 A;  4FE7 A;  4G7Z F;  4Y13 A;  3VOE A;  2A6T A;  2W24 A;  1FOW A;  2L02 A;  1MZB A;  1VQL I;  1OCZ H;  3H3U A;  1V55 H;  4N9H A;  3H5R A;  5FRO A;  2H1L A;  3WU1 B;  1FOK A;  3OMY A;  2LBF A;  3FIS A;  4B44 A;  1OFC X;  2JRM A;  2XAQ A;  3N4M A;  2UV1 A;  3E1S A;  2VJ5 A;  1X4O A;  2P7C B;  2KMU A;  1LFU P;  2STT A;  4U7B A;  3KZI C;  3U2R A;  2X6O A;  3REO A;  2ZXJ A;  4DYR A;  2ACJ A;  4EM1 A;  2EK5 A;  4I02 A;  5AIQ A;  2VL8 A;  3R4K A;  4ZDP A;  5DCM A;  3CC7 I;  4F55 A;  2E2I J;  1TNS A;  2D1V A;  2I8D A;  3BR5 A;  3LFU A;  1MSE C;  5FRN A;  3K4K A;  4RM3 A;  2K27 A;  3KLO A;  1ZTR A;  2OCE A;  5IT3 A;  4RAY A;  3OS0 A;  2Q0O A;  3EQL F;  2EFP A;  4NQW B;  4I0B A;  1UAA A;  2R5Z B;  4MLO A;  1TQI A;  5EEH A;  3AFH A;  2QBY B;  3Q3S A;  1FP1 D;  3ECO A;  3V7R A;  2X1E A;  2OJE D;  3I56 I;  2NYX A;  2Y31 A;  2J5P A;  3PM1 A;  1YX5 A;  1FYK A;  3RZO J;  3PNV A;  2EFW A;  4KMU X;  3BR1 A;  3K1N A;  2AHQ A;  4IOC F;  2MLK A;  4XLA A;  4CIC A;  1K79 A;  3ZN1 A;  4NB5 A;  5CQE A;  5GPA A;  2K3F A;  1B9N A;  4KIG A;  2VE8 A;  3DLA A;  2MW8 A;  3HOW J;  3TO9 A;  1H8A C;  1R58 A;  1S7E A;  4YIR X;  2ZNY A;  1NG7 A;  3IV5 A;  1X1A A;  4G6Q A;  2BEO A;  4KT6 A;  1UFM A;  1UMQ A;  4BHP A;  5J6X A;  1GXQ A;  5JFR A;  3OYM A;  5HNH A;  3H5A A;  1HST A;  3RPU D;  1O7F A;  4EJV A;  3HJE A;  4S05 A;  2DMN A;  3KYC B;  1T08 B;  2J5O A;  3S1N J;  2I10 A;  5E3O A;  3BG6 A;  2HOE A;  4V2F A;  3GTJ J;  5M3M J;  3M7G A;  1B59 A;  1R1T A;  2L9V A;  2LY9 A;  3FHN A;  5FD5 A;  3OYJ A;  4A3I J;  1H88 C;  5HS7 A;  1R1U A;  3AL0 B;  1LEB A;  3BJO A;  5KAF C;  3HSE A;  1RRJ A;  1HW1 A;  1WJ5 A;  4Y4R A;  2MAB A;  2E1C A;  1AA7 A;  1EH8 A;  5EYR A;  2NVU B;  2OQG A;  3K69 A;  3QPT A;  4EJO A;  5M5W J;  3CCM I;  5L3D A;  5DV5 A;  3F8F A;  1OCC H;  2HYG D;  4CYD A;  1FC3 A;  1TTY A;  5JLW A;  5D5V B;  1U5T C;  2O3F A;  2OTL I;  1OCT C;  2LMD A;  4O6J A;  5E20 A;  2XHK A;  1J9I A;  2DOF A;  2XSD C;  1B8I A;  4Y3O A;  3OYA A;  1H9T A;  2JZY A;  3I59 A;  2EZK A;  5IPA A;  4M73 A;  2QQ8 A;  3DEU A;  4OIP F;  2FU4 A;  2YX7 A;  5M5Y J;  4A93 J;  3RSN A;  5JR3 A;  3HPG A;  4RB3 C;  2MH9 A;  2W84 A;  3BG7 A;  5D6F A;  1TP4 A;  5BPD A;  5D6E A;  1T6S A;  1XSV A;  2M30 A;  2VKD A;  2DBB A;  1D5V A;  4PFP A;  1AKH B;  3WHC A;  3ZQQ A;  4HOB A;  5B1A H;  2RV8 A;  3I53 A;  2DMU A;  3BWG A;  3WGG A;  1QRY A;  3AG1 H;  3TBI A;  1IGN A;  3PUF A;  4EJU A;  1U9N A;  4PGG A;  5H6Q A;  5EG0 A;  3W2W A;  1Z1D A;  1X4P A;  4XLE A;  2LVS A;  2KRC A;  1EJ9 A;  3MQ0 A;  4XM3 A;  1AOY A;  2CW0 F;  3KFW X;  3Q9S A;  4AID A;  2FQ4 A;  4XLF A;  3HGY A;  2PLY A;  3C2B A;  3Q0U A;  1JKQ C;  1G59 A;  5F0F A;  4XNF A;  4B1R A;  3BPX A;  3BR0 A;  4OIO F;  4Y52 J;  3BTL A;  2ZXH A;  4ENK A;  1Z05 A;  3GO5 A;  3RPU A;  1S29 A;  4OMZ A;  4RAG A;  4A0X A;  2HDD A;  1LFP A;  1SFO J;  1OJL A;  1O3T A;  2A5W A;  2CS3 A;  1LEA A;  2RQP A;  1B1B A;  3LL7 A;  2CQK A;  2XSJ C;  3GZ6 A;  3KCC A;  1POG A;  2WAQ A;  3TW7 A;  3BPV A;  2COB A;  5HDK A;  2JA7 J;  2R3S A;  4XKV A;  2HKO A;  1ZGJ A;  4L5J A;  2DT5 A;  3GXO A;  1QZE A;  3KP5 A;  4BL0 B;  2FX0 A;  3OV8 A;  4BEH B;  3FXM A;  3L2C A;  2KIM A;  3FMQ A;  4KN7 X;  4RGR A;  2BV6 A;  2XGC A;  4M71 A;  4E7L A;  1APL C;  1SD7 A;  2QWW A;  1A31 A; 
#chains in the Genus database with same CATH homology
 2ZBK A;  3WTU C;  1BI0 A;  4L0Z B;  1G6N A;  2GA1 A;  3VB2 A;  1JHF A;  4B8X A;  1WRJ A;  1PUE E;  1KYW A;  1R5H A;  5ICE A;  4CDG A;  4EJW A;  2H09 A;  4EVI A;  1P4A A;  3LFK A;  5FGM A;  4OIN F;  3SXY A;  2DI3 A;  4EGY A;  2H6B A;  2F5F A;  4YII A;  5CYV A;  4LG0 B;  4XSZ F;  5BOX A;  1E17 A;  2L4A A;  2L01 A;  1IW7 F;  4IPA A;  3MCZ A;  3G3Z A;  4IRI A;  4EV0 A;  1FBS A;  3WOD F;  3NQO A;  5FD6 A;  5LHH A;  2P6S A;  4HZF A;  3CJN A;  1KYZ A;  3GW2 A;  3IC7 A;  4HF2 A;  5K5O A;  1R7J A;  1HKS A;  4IHT A;  5D8K B;  1J0R A;  1HW5 A;  4KA4 A;  2LF7 A;  4LK1 F;  3LA7 A;  5HVQ C;  3L00 A;  1LNW A;  1IN7 A;  4CXF A;  3BP8 A;  1X3U A;  1XD7 A;  1R00 A;  3IRR A;  1U78 A;  2DPD A;  2Y0M A;  3HTS B;  5KK1 A;  4XLN F;  2OU2 A;  2PFB A;  2ZO4 A;  5HLI A;  4RB2 C;  4KDP A;  2OQR A;  3L7W A;  1LDD A;  3B73 A;  3F8N A;  2HDC A;  1TNT A;  3IWZ A;  3CUQ B;  3QU3 A;  2IPQ X;  2O0Y A;  4A5M A;  3LA2 A;  4RAZ A;  5FB2 A;  2EFQ A;  1B4A A;  1P92 A;  3R60 A;  2QEN A;  2RNJ A;  4KNY A;  5LHI A;  4KIF A;  3LA3 A;  2FEZ A;  1QNT A;  1FBU A;  2MA3 A;  3FXU A;  5D8L B;  1ZLJ A;  5K1Y A;  4XRF A;  2V1X A;  4ENJ A;  4ZZD A;  2IA1 A;  5H20 A;  3E6B A;  3J81 K;  2FF4 A;  2VBY A;  1FP2 A;  2WV0 A;  2QYO A;  1MDM A;  5CVV A;  2Z99 A;  2JT1 A;  3GFM A;  3DQV C;  3K0L A;  3LQQ A;  4I0A A;  1SAX A;  3R0J A;  1UHW A;  3GWZ A;  4JQF A;  4F7Z A;  1LJ9 A;  2M87 A;  1QZZ A;  3AAF A;  2XAS A;  1YQA A;  4TV7 A;  5IT9 K;  4MTD A;  1Z6T A;  2ELH A;  1T2K A;  3O3K A;  2VBW A;  5BPI A;  5E8I A;  1FBQ A;  2EFO A;  3WTS C;  4IVN A;  1IXR C;  3GF2 A;  2CSO A;  3BRO A;  3HOT A;  2VXZ A;  2OZ6 A;  3KEQ A;  5E18 F;  3COA C;  3ABT A;  4IRH A;  1J2X A;  4GGG A;  4KIC A;  4HAM A;  4L5I A;  3KP3 A;  2P5V A;  2QQB A;  1B9M A;  3T8T A;  2W25 A;  3KEO A;  2XIG A;  3JAM K;  3RYR A;  3VOD A;  4I01 A;  3V4G A;  2DO7 A;  4BXU A;  1IN4 A;  1OYY A;  1KU9 A;  4G6D A;  3K2Z A;  5DD4 A;  1RNL A;  2EV6 A;  5FFX A;  2QVO A;  3HOS A;  2B0L A;  1R1V A;  4A2U A;  4RGU A;  4UNO A;  2KRF A;  4UVB A;  1ZG3 A;  4YFN F;  4ZYE A;  2VT2 A;  2RGV A;  1EH6 A;  1HQC A;  3GFI A;  2W85 A;  2IJL A;  3ZMT A;  1CGP A;  2DLL A;  2GXB A;  1USS A;  4Y17 A;  2WC2 A;  3SQN A;  2MD5 A;  1BJA A;  3DPL C;  3F6O A;  5JHU A;  2CYY A;  5F6F A;  3DF8 A;  1H0M A;  3CUQ C;  4KUM A;  5L3G A;  1D3Y A;  2O61 A;  3RYP A;  4RB0 A;  5D5X B;  2ZNZ A;  3WTW C;  1REP C;  5FO5 A;  3E6C C;  4OOI A;  2V9V A;  1PP8 F;  4KT5 C;  3EYI A;  3V7C A;  2QM3 A;  1BC8 C;  2CO5 A;  2Y48 A;  3PQK A;  3MFK A;  1K78 B;  3I54 A;  4M6Y A;  2P4W A;  2HZT A;  2VBX A;  2FOK A;  1RI7 A;  2COM A;  1W7P B;  4CZZ A;  3KP7 A;  4BAY A;  1WWX A;  1ZG1 A;  2OBP A;  2PMU A;  1FNN A;  1QGP A;  3GLX A;  1IUY A;  3MWM A;  2OAZ A;  2X0L A;  2HQR A;  2EA2 A;  1WKM A;  3F3X A;  4HV5 A;  5JVT A;  3C18 A;  1I5Z A;  2M8E A;  2ZME B;  6PAX A;  2FRH A;  4YFX F;  3IKT A;  1ODD A;  4G7H F;  2EFN A;  3Q9V A;  2ZCW A;  4L18 B;  3J80 Z;  4ZYH A;  4QWQ A;  2VBZ A;  4MQ9 F;  1J7K A;  2V1U A;  5CVI A;  5DYM A;  4KFC A;  3QP5 A;  3HRT A;  2EWN A;  2GWR A;  2YX4 A;  5LEJ A;  2E7W A;  5ERI A;  1T0F A;  4PDK A;  1KQ0 A;  5DDG A;  3BDD A;  5LRS A;  1ZN2 A;  4HX8 A;  3KP4 A;  1UCR A;  5ILU A;  5LGU A;  2STW A;  1QO0 D;  1JE8 A;  1QBJ A;  1ZH5 A;  2H6C A;  2ZKZ A;  2JSC A;  1VTN C;  1FY7 A;  2XV4 S;  3CO6 C;  1S7A A;  1IXS B;  1V4R A;  1SFE A;  2IP2 A;  2FBH A;  4UUV A;  4WX9 A;  3LAJ A;  4ETS A;  4S04 A;  3E97 A;  2MC3 A;  2XRN A;  1S8N A;  1SFX A;  2ADU A;  2Z9O A;  2D45 A;  2PQ8 A;  1OPC A;  2P5K A;  4NHJ A;  2R7F A;  1TLH B;  2DQL A;  3P7N A;  1ZGA A;  2UXX A;  2CG4 A;  1XGS A;  3ZPL A;  3E6D A;  1G3Y A;  1Z9C A;  3ROU A;  3V8K A;  2VC1 A;  2HGC A;  3C7J A;  3WG9 A;  3ISP A;  1SD5 A;  3GEZ A;  3JTH A;  5D4S A;  1XGM A;  1Z6R A;  2FNP A;  3W6K B;  2D2W A;  2K4B A;  3U1D A;  3RIR A;  3R6S A;  1YYV A;  1XMK A;  4LMY A;  4MHG A;  4P9F A;  5ICC A;  2GA2 A;  2FA5 A;  3D0S A;  2DFI A;  4WWC A;  4U0V A;  5CVJ A;  4G94 A;  1O3R A;  2XUB A;  3TOB A;  4HQM A;  3CUO A;  2KIU A;  2EV0 A;  2IRF G;  1J5Y A;  1T98 A;  2QZ8 A;  1OYW A;  1IRG A;  5CJ9 A;  4HLX A;  4A6D A;  3K1P A;  4LLL A;  5DCM B;  2VT3 A;  4LB5 A;  2K86 A;  5A2Q K;  3FWE A;  3CO7 C;  2P7V B;  4FT8 A;  3EET A;  1BIB A;  4L9N A;  1MJA A;  4UXN A;  2O8X A;  4P55 A;  4HX7 A;  5J8C A;  3ULQ B;  3E5X A;  2IA0 A;  3S2W A;  5BQT A;  1KU7 A;  1W5S A;  5LBQ A;  3M1E A;  2O03 A;  1RUO A;  5CVU A;  1HW2 A;  2C6Y A;  4YG2 F;  5FLX Z;  1ZAO A;  1U6G A;  5F64 A;  1TW3 A;  1SMY F;  3QPH A;  1C0W A;  2XAH A;  2HS5 A;  1G3T A;  3Q5F A;  1O3S A;  1L0O C;  3LST A;  3J7A O;  1JGS A;  1IXC A;  2GIV A;  4U0Y A;  3ZMZ A;  2KIF A;  4N9I A;  4Q5S F;  3GFL A;  3JSO A;  3HIF A;  1KU3 A;  1OYI A;  2BBY A;  2P8T A;  5LGN A;  1R22 A;  4Z2Y A;  3TQN A;  3NRV A;  4ENN A;  4BH9 A;  3E5Q A;  1K6O A;  2YSR A;  4HQE A;  1TQM A;  5CLS A;  1PDN C;  4HV6 A;  3BOQ A;  1SFU A;  1YW8 A;  4O3M A;  4HDU A;  1KQ9 A;  3I59 B;  2MBF A;  1WSU A;  2ISZ A;  1JHH A;  4HDV A;  1XSD A;  3HTU A;  2HWV A;  1ZRD A;  1BN5 A;  2FMY A;  4EJT A;  1Q1H A;  4HF0 A;  3F8C A;  1W7P D;  4KIB A;  4RB1 A;  2VE9 A;  3GZ5 A;  2JRT A;  5E8G A;  1IF1 A;  2M5W A;  1LVA A;  5ILV A;  4LLG F;  4DQ2 A;  1O57 A;  1R36 A;  3I64 A;  3I4P A;  1YS7 A;  3ZMU A;  2KKO A;  3QAH A;  3RPQ A;  1NHA A;  5LEK A;  4D0P A;  2Y75 A;  2E1N A;  1KQ8 A;  4BQA A;  1W5T A;  2X4H A;  1YTY A;  2NRA C;  4R1H A;  3CDH A;  1BM9 A;  2XAJ A;  3KLN A;  3LAP A;  2IT0 A;  2G9W A;  3ZMD A;  4G9Y A;  3WTZ A;  3TDU C;  4A12 A;  4CO8 A;  3F21 A;  2VON A;  1RZ4 A;  3ZMS A;  1SD6 A;  3HRU A;  4MEY F;  1XMA A;  3QU6 A;  2JTV A;  2MLG A;  3EYY A;  1L3L A;  1A04 A;  4CGZ A;  2IVM A;  2K7L A;  4R79 A;  2VN2 A;  2AS5 F;  1TW2 A;  4LFU A;  1DUX C;  1JXS A;  1YFH A;  2TDX A;  5LLQ A;  3RI4 A;  2ISY A;  3DXJ F;  3IKV A;  1YW9 A;  3C3W A;  5KVR A;  2QQ9 A;  2HEO A;  3N97 A;  1YG2 A;  4A0Z A;  1BC7 C;  3MAJ A;  2IW5 A;  3PQJ A;  1S3J A;  3HRM A;  2LDU A;  4GYG A;  2PEX A;  3K9T A;  5TJJ A;  3JW4 A;  4M9X A;  3V7S A;  3SZP A;  4M6X A;  1UST A;  2IA2 A;  5EEG A;  1SD4 A;  4ZZL A;  1ULY A;  3TO6 A;  2EB7 A;  4HW0 A;  1R5G A;  5DUI A;  3V8L A;  3T1B A;  3P9C A;  4M72 A;  4XBF A;  1MGT A;  4ASN A;  5HLH A;  2XVC A;  1MJ9 A;  2BE5 F;  1LQ1 A;  3LQR A;  4DNC A;  4A6E A;  4P96 A;  2ETH A;  3WE3 A;  4MEX F;  4YIF A;  3WTT C;  3D5L A;  2RKH A;  2NAZ A;  2R7D A;  4XLP F;  4NQW A;  1XDU A;  5FLX K;  2QBY A;  4OMY A;  1FSE A;  1F5T A;  1XGN A;  4BHC A;  1YO5 C;  4M9S A;  4G7O F;  2Z3Y A;  4LJZ F;  2XKO A;  4WK8 F;  3QRF F;  1UHM A;  1D8J A;  2M45 A;  2A5Y B;  5AON A;  1DPU A;  1QPM A;  4MQV A;  2W57 A;  4ZYG A;  1FWZ A;  4G8X A;  3P9I A;  1MDM B;  4QLC U;  3ZP5 A;  2LSO A;  4IJA A;  5HLG A;  4JK1 X;  3FXQ A;  3HHG A;  2VOD A;  1FX7 A;  1GHC A;  2NNN A;  1STZ A;  2FSW A;  1HSJ A;  4XSX F;  3FXR A;  1DPR A;  4FX4 A;  2V6C A;  3WTX C;  4K2E A;  4LGW A;  2UWM A;  2JPB A;  4Q48 A;  4AIH A;  1FSH A;  2RVC A;  4L9J A;  4ON0 A;  5D4R A;  3HHH A;  3LWF A;  3JSP A;  1I27 A;  2KJC A;  4GCV A;  5K5Q A;  4EGZ A;  2HYF A;  2MH2 A;  3KZZ A;  4MNU A;  2CGP A;  5D5U B;  3HYI A;  2LF8 A;  4OU0 A;  1U2W A;  4O5V A;  4KMF A;  1FYM A;  2FBI A;  4R8H A;  2L4M A;  4I7H A;  3JTG A;  3CTA A;  1TQP A;  3VFZ A;  3KZY A;  5E1W A;  1XB4 A;  3EDP A;  2OA4 A;  3F6V A;  1ZRE A;  3T0Y A;  1J59 A;  1WQ2 A;  4HA8 A;  5HDN A;  3ML6 A;  1YLF A;  4GO1 A;  1DDN A;  4Q4Z F;  2OD5 A;  4I2O A;  1BI3 A;  1XGO A;  1HBX G;  1U3E M;  1V3F A;  3O6B B;  5L3E A;  2DAO A;  4LK0 F;  1UB9 A;  4YFK F;  2HTJ A;  2F2E A;  3V8J A;  1P6R A;  1RUN A;  4I98 B;  2L54 A;  2A6E F;  2YU3 A;  2PMH A;  3F23 A;  1Y0U A;  1FT9 A;  1Z7U A;  1MD0 A;  3E6M A;  4U88 A;  1XCV A;  3BZ6 A;  2V1D A;  3FM3 A;  3FZV A;  3RKY A;  2DQR A;  3WGH A;  3H92 A;  2K02 A;  1G3W A;  3MZY A;  4IF4 A;  2VOO A;  3NEU A;  2LNB A;  4WXD A;  5ICG A;  1ZHF A;  3I0T A;  2A69 F;  4LG0 A;  1H9G A;  5AIP A;  4ZH4 F;  2D1H A;  4UVC A;  4BHB A;  2RN7 A;  2ZJ2 A;  3ABU A;  3DFG A;  4IRG A;  5ICF A;  3ELK A;  2F5D A;  2BYV E;  3CLO A;  3O2P E;  2FML A;  2WTE A;  5HS8 A;  1FYL A;  1I6X A;  3WTY C;  3J81 Z;  3BJA A;  1IN8 A;  3M9A A;  3ERE D;  1QZY A;  3KP2 A;  4EMS A;  2XAG A;  1DP7 P;  5ED4 A;  2XRO A;  2GZW A;  5K5R A;  4EM0 B;  5DD8 A;  3F8M A;  1AWC A;  1ZRC A;  1G4D A;  4WXH A;  4U0W A;  2NS0 A;  2ESH A;  4M9Z A;  4HX4 A;  5IT9 Z;  2F5E A;  5FFZ A;  4OIR F;  3ZQ7 A;  3G73 A;  1W4M A;  2ESN A;  1IN6 A;  4AVP A;  2A68 F;  1D8K A;  4EQQ A;  2HTS A;  3IL2 A;  4L9T A;  2EA4 A;  3I71 A;  4MTE A;  1R23 A;  1LB2 A;  4MGR A;  3IWF A;  2XGX A;  4GXO A;  3CUQ A;  3TO7 A;  3QOP A;  5HS9 A;  3JAM Z;  2DW4 A;  1SMT A;  5LHG A;  1MJB A;  4Q47 A;  5J8F A;  4UHT A;  4LD5 A;  4OIQ F;  5E1Z B;  1OKR A;  1KU2 A;  1ONV A;  2VOP A;  3FMR A;  3GVA A;  3R61 A;  2ZFW A;  2EV5 A;  5HOO A;  4AIJ A;  4RS8 A;  3B02 A;  5BS6 A;  2DPU A;  1ZG5 A;  3MZH A;  2E7X A;  1P4X A;  4KYW A;  1IZ1 A;  3OOP A;  2Z33 A;  2PJP A;  5JI6 A;  1J75 A;  1ZLK A;  4HLY A;  1G3S A;  3QP6 A;  1XCB A;  4HF1 A;  1WI9 A;  3J80 K;  4B09 A;  1F1Z A;  3SFZ A;  3IHU A;  1K7A A;  2HQN A;  1KGS A;  2A3S A;  1OR7 A;  4I09 A;  2V79 A;  3T5X A;  3VEP A;  2HFH A;  5CVR A;  1XDS A;  2EJR A;  1ZRF A;  1BBY A;  5HDG A;  3WGI A;  3TKY A;  2A6H F;  2P6T A;  4P5O A;  2LKP A;  2P5L C;  2CWE A;  4ESB A;  4Y15 A;  4FHT A;  1S6L A;  2AXL A;  3FHZ A;  1HKQ A;  4AD9 A;  1ZYR F;  1OMI A;  1ON2 A;  2RC4 A;  4BNC A;  4UV8 A;  1KA8 A;  3EUH A;  4A0Y A;  2DU9 A;  3HSR A;  2Q2E A;  3TGN A;  4PZJ A;  3U9G A;  2L3D A;  5ILS A;  2QQA A;  2HR3 A;  1GVJ A;  3KP6 A;  3MEX A;  4L9V A;  3T8R A;  1EV7 A;  3RKW A;  1TBX A;  4ENM A;  4ZYD A;  1E2X A;  4LLN A;  1MKM A;  2H27 A;  1T39 A;  2XAF A;  1YIO A;  1HXD A;  1LDK B;  2JPC A;  3KET A;  5D5W B;  5E1X A;  2DK8 A;  3F22 A;  1U5T A;  3GUD A;  3RJP A;  1GXP A;  2FBK A;  2G7U A;  1T38 A;  5TRD A;  1LDJ A;  2A61 A;  1K78 A;  1F4K A;  3WE2 A;  2GAU A;  1HKT A;  3RTR A;  2WWY A;  4RGX A;  5L3C A;  3WTV C;  2PG4 A;  1W7P A;  4KN4 X;  3R0A A;  2KJB A;  3I58 A;  3E3V A;  2FQ3 A;  3W6J B;  4HYE A;  4RGS A;  1O3Q A;  4IXA A;  2M1B A;  3F8B A;  3L9F A;  4P9U A;  1CF7 A;  5DUK A;  2ZME A;  4JBA A;  2PBI A;  3IRQ A;  3H3Z A;  4H0E A;  1BOA A;  4WF2 A;  3PFI A;  1U8R A;  1P2F A;  3C1D A;  3M8E A;  1I1G A;  3GFJ A;  4L0Y B;  4WXC A;  2UZK A;  3HRS A;  1FLI A;  2O6G E;  4BYY A;  5BMZ A;  4AIK A;  2GQQ A;  1I1S A;  3E5U A;  2GXG A;  2NNY A;  4E70 A;  2QLZ A;  2H94 A;  2DTR A;  1F9N A;  2FNA A;  3ZMV A;  2FXA A;  5H6R A;  2DK5 A;  3HSF A;  3FX3 A;  3I5U A;  3FM5 A;  2YPR A;  4EM2 A;  1IRF A;  4UVA A;  3DV8 A;  2PI0 A;  3K1M A;  5DCF A;  2BGC A;  5LRR A;  4PCQ A;  4ESF A;  1QQI A;  5DEQ A;  2XKP A;  2G7H A;  1IAW A;  4UV9 A;  4IHS A;  1B6A A;  4CHU A;  3DKW A;  4PGH A;  3RDI A;  1IN5 A;  2UXN A;  3SZT A;  5L3B A;  5LGT A;  3FF5 A;  4N0B A;  4U7D A;  2Q8K A;  3P9K A;  3TOA A;  4A5N A;  5A2Q Z;  1EH7 A;  2QUF A;  2CFX A;  1PP7 U;  3ECH A;  2RDP A;  3HUG A;  1BI2 A;  3M8F A;  1ZAR A;  4HBL A;  2F5C A;  1U5T B;  2OZU A;  1XN7 A;  1YW7 A;  3WU0 A;  2PN6 A;  4GYI A;  1XSX A;  4WCG A;  1O7L A;  2VC0 A;  3BJ6 A;  1BIA A;  2K4J A;  3DPT A;  3L09 A;  1P4W A;  5L3F A;  4FX0 A;  4M74 A;  3DP7 A;  1RIO H;  1S7O A;  5E17 F;  3BY6 A;  1ON1 A;  3KE2 A;  2FE3 A;  1YS6 A;  3GYH X;  3F72 A;  4LB6 B;  1FPQ A;  3GX4 X;  5F1R A;  3TDZ C;  2Z5U A;  3ZN0 A;  2A07 F;  2HKX A;  3SHF A;  1CF7 B;  4ESJ A;  1Z91 A;  4AWX B;  3RKX A;  1FZP B;  2YR2 A;  3FMS A;  1BI1 A;  4G7Z F;  4Y13 A;  3VOE A;  2W24 A;  2L02 A;  1MZB A;  3H3U A;  4N9H A;  3WU1 B;  1FOK A;  2XAQ A;  3N4M A;  2P7C B;  2STT A;  4U7B A;  3U2R A;  3REO A;  2ZXJ A;  2ACJ A;  4EM1 A;  2EK5 A;  4I02 A;  5AIQ A;  3R4K A;  5DCM A;  1TNS A;  2D1V A;  2K27 A;  3KLO A;  5IT3 A;  4RAY A;  2Q0O A;  3EQL F;  2EFP A;  4I0B A;  1TQI A;  5EEH A;  2QBY B;  1FP1 D;  3ECO A;  3V7R A;  2NYX A;  2J5P A;  1FYK A;  2EFW A;  4KMU X;  3K1N A;  2MLK A;  4CIC A;  1K79 A;  3ZN1 A;  4NB5 A;  1B9N A;  4KIG A;  2VE8 A;  3TO9 A;  1R58 A;  2ZNY A;  4G6Q A;  2BEO A;  1UFM A;  4BHP A;  5J6X A;  1GXQ A;  5JFR A;  1HST A;  1O7F A;  4EJV A;  4S05 A;  2J5O A;  2HOE A;  3M7G A;  1B59 A;  1R1T A;  5FD5 A;  5HS7 A;  1R1U A;  1LEB A;  3BJO A;  3HSE A;  1HW1 A;  2E1C A;  1EH8 A;  2OQG A;  3K69 A;  3QPT A;  4EJO A;  5L3D A;  5DV5 A;  3F8F A;  2HYG D;  4CYD A;  1FC3 A;  1TTY A;  5D5V B;  1U5T C;  2O3F A;  4O6J A;  5E20 A;  2XHK A;  1J9I A;  1H9T A;  2JZY A;  3I59 A;  4M73 A;  3DEU A;  4OIP F;  2FU4 A;  2YX7 A;  5JR3 A;  4RB3 C;  2MH9 A;  2W84 A;  5D6F A;  5BPD A;  5D6E A;  1T6S A;  1XSV A;  2M30 A;  1D5V A;  2DBB A;  4HOB A;  2RV8 A;  3I53 A;  3BWG A;  3WGG A;  4EJU A;  4PGG A;  5H6Q A;  1Z1D A;  3MQ0 A;  1AOY A;  2CW0 F;  3KFW X;  3Q9S A;  2PLY A;  3BPX A;  4OIO F;  4ENK A;  1Z05 A;  3GO5 A;  3RPU A;  1S29 A;  4OMZ A;  4A0X A;  1O3T A;  1LEA A;  2RQP A;  1B1B A;  2CQK A;  3GZ6 A;  3KCC A;  3BPV A;  5HDK A;  2R3S A;  2HKO A;  1ZGJ A;  4L5J A;  2DT5 A;  3GXO A;  3KP5 A;  3OV8 A;  3L2C A;  2KIM A;  3FMQ A;  4KN7 X;  4RGR A;  2BV6 A;  4M71 A;  1SD7 A;  2QWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...