2HI3A

Solution structure of the homeodomain-only protein hop
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MSAQTVSGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeodomain-only protein
publication title Analysis of the structure and function of the transcriptional coregulator HOP
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hi3A01
3JRAA 5GP9A 1JJ6C 3H0GJ 5DS9A 1K83J 1K61A 2LTPA 2VKVA 3SDGA 3OSFA 1H88C 4X1EA 4BBSJ 3Q3SA 2JA7J 4A3JJ 1TWGJ 2Y2ZA 3FISA 2DA3A 2R92J 1XG1A 1P7JA 1B8IA 2HOTA 2WB1N 2DA6A 1U8BA 1S7EA 1AKHB 1POGA 4C3HJ 2JJ7A 2COBA 1ETWA 2FQ4A 4I76A 3G1MA 4DYCA 3JREA 2LVSA 1T33A 4D7MA 1TWFJ 1ETKA 4ABZA 1BA5A 1RKTA 4Y52J 4FTHA 2EZLA 1QPIA 2E2JJ 2B63J 2TRTA 3E7LA 2CUFA 3GTMJ 2YU9J 1X2NA 3S1QJ 5FKMA 4QTRA 2HDDA 1PUFB 3MKLA 2NVTJ 3ZQHA 1JUSA 2DMNA 4W97A 4FE4A 2DA2A 3FK7A 2EH3A 3IH2A 1RR7A 1AHDP 2HXIA 4A3LJ 1LFBA 5J1UA 3WHBA 1CQTA 1O4XA 2JMWA 3HOYJ 5J1YA 4D5CA 4UUSA 3D1NI 1B72A 2WAQN 3MN2A 4B4CA 2Y9ZA 1YRNA 3ZQCA 1ZKGA 1HLVA 2TCTA 4HNVA 3JRIA 1JTXA 2MW8A 3TW7A 4QIWN 5EG0A 1HDPA 1VNDA 3IV5A 1ITYA 1GVDA 1ZQ3P 2NVXJ 4L5EA 1HDDC 4G12A 3O8HA 3FK6A 1HOMA 1LE8A 4M3GA 1MBEA 3G1OA 3B6CA 5IPAA 2R5ZA 2HXOA 4BY1J 4BBRJ 2AHQA 1ZR2A 5EZGA 2JK3A 2M2EA 4DYQA 2ID6A 1QVUA 1B72B 2XGCA 1IUFA 4XRMA 3B6AA 4RBOA 3VPRA 3GTKJ 3H3VK 2DMPA 3ZQFA 4X6AJ 3HOZJ 2L7ZA 2ME0A 2CU7A 2M8GX 5EG0B 3UKGA 4XICA 2LY9A 3S1RJ 2XRLA 5E3NA 3LNQA 3CQZJ 4AYBN 3LOCA 5K7HA 4MFEA 2LKXA 1UHSA 2K9QA 2XB0X 3LSRA 4A3GJ 2W48A 2EZIA 3TP3A 1LE8B 4DW6A 3HOVJ 4A69C 4JYKA 2DMUA 4IHYA 2R5ZB 4RDUA 1I6HJ 2MG4A 1Z77A 2R5YA 1ZK8A 1AU7A 1RPWA 5EEAA 4M3BA 5FKLA 3RZOJ 2EZHA 1I50J 2DA4A 2QCOA 1MBFA 1ETVA 3HGGA 4JX6A 1BL0A 1ETXA 4MIMA 3RKQA 1PUFA 1MSFC 1JUMA 2DA5A 3GTGJ 3BR5A 1JT6A 3TEDA 1Q1VA 1UMQA 2NVQJ 4XK4A 1IDYA 3BR0A 2HOAA 4B3AA 2JA8J 5M3MJ 4XIDA 4S0HB 1ETYA 3GBGA 1MBJA 4A3KJ 2HOSA 3S17J 2HYJA 2HI3A 1JKRC 2Y31A 3LSJA 3OIOA 1ZGWA 3IH4A 5DTDA 3QQAA 4M6VA 4AC0A 2R5YB 1F36A 3BR2A 5E3OA 2G0EA 1GDTA 2P81A 3IH3A 1D5YA 1GV2A 1OJLA 1WH5A 2NS8A 3ZQGA 1W0UA 5EYRA 2NS7A 2XPWA 3M3YJ 1HF0A 1FJLA 3BT9A 1QRYA 1XC5A 9ANTA 2L0KA 5F0CA 2XSDC 5GPCA 5F0HA 4A3CJ 2R7ZJ 4IEJA 2JA6J 3HGYA 2XGDA 1X2MA 1W0TA 3HDDA 3O8GA 4IHWA 1MSEC 1WGXA 2O9LA 3GTQJ 4MO7A 1MBKA 4GFBA 5IYCJ 1IJWC 3S2DJ 4CYCA 3S16J 1IC8A 5C44J 1MH3A 5IYDJ 2VKEA 3RZDJ 2VUMJ 1EF4A 3LSPA 2ZB9A 1IGNA 2XB5A 2M9HA 5J1RA 2H8RA 3DCFA 3BTCA 2IBDA 1ORKA 2Y30A 4C3JJ 1XS9A 1VI0A 2R93J 2FJ1A 5IYBJ 5IP6A 1FEXA 2KT0A 3PO3J 4FE7A 3LSGA 2OF7A 3S14J 1WPKA 2DN0A 3BR6A 1ETOA 3FKIJ 4C3IJ 2CQQA 5FLMJ 5M3FJ 1H89C 1QVTA 4J19A 2XPUA 4C2MJ 3CCYA 4UUTA 1IV6A 1TWHJ 3I4NJ 1U9NA 5BNGA 4CYCB 1IG7A 2IAIA 2RAEA 2O7OA 3JR9A 1R9TJ 4M3EA 1TWCJ 3K7AJ 1G2HA 1A5JA 1RESA 2K9NA 5C4XJ 1I3QJ 1Y1VJ 1TWAJ 2LP0A 1JTYA 1BW6A 1A6IA 4DZPA 1WH7A 4FISA 3HM5A 1JJ8C 1ETQA 2D5VA 3Q0UA 1NTCA 1ZTRA 3JRBA 3GTPJ 2FX0A 2FD5A 3F0CA 2LR8A 3BR1A 3S15J 5C3EJ 4MFDA 3HOXJ 3I4MJ 3Q0WA 2K40A 3BTLA 2E2HJ 3OOUA 4D7NA 5K7ZA 4XRSG 4JP0A 3NARA 1NK3P 2DMTA 2LD5A 2JA5J 2CRGA 3M4OJ 4V2GA 2YS9A 4QSHA 2EQRA 3HOUJ 3L1PA 3BR3A 2DTZA 3QPSA 3ZOBA 1JUPA 3GTLJ 2M0CA 2OPTA 4XRSA 5E3MA 2MGQA 1HCRA 3MVPA 2K9SA 2WV1A 1OFCX 1P7IA 2I10A 5JLWA 3A01B 1JKOC 2L9RA 3RQIA 1BW5A 2LLKA 2GBYA 2X9DA 4A3DJ 2Y0SN 5IOZA 3CDLA 3G1LA 1RKWA 2DA7A 3HKZN 3S2HJ 2DA1A 5FKOA 1DU0A 3HOWJ 1MBGA 4B1RA 2VI6A 2LFBA 4D5FA 3BG9A 4A3EJ 1H8AC 1Y1WJ 5JLXA 1X58A 5FKNA 2EZKA 2M34A 2ME6A 3SJMA 4A3FJ 2JN6A 3CMYA 2PMZN 2QF7A 2X48A 3W6VA 5FJ8J 3JRHA 5EGOA 2DJNA 3K2AA 1E3OC 2GM4A 2NOGA 2Y9YA 5IOYA 3BTIA 1GT0C 1MNMC 5HODA 1T56A 1DU6A 1ENHA 5M5WJ 2E1OA 4W1UA 4A3MJ 4EEFG 2CJJA 4I6ZA 1B8IB 5IP9J 3PO2J 1FIPA 5EZHA 1SFOJ 3JRDA 2XPVA 2ELKA 1Z0XA 2YUSA 4A93J 5F04A 3NAUA 1WI3A 1MBHA 1IRZA 3DEWA 5C4JJ 2ECCA 3HB9A 2GLOA 2XGEA 1F43A 2MSYA 3BQZA 2CUEA 4IHVA 1JKQC 3PM1A 2N8GA 3FIWA 1RETA 4BY7J 4A3IJ 1GV5A 3A03A 5EDNA 5EGOB 5F27A 3GTOJ 2H1KA 1JT0A 3JRCA 1GUUA 1OCTC 3SFIA 2AO9A 4JX4A 2EBIA 1JKPC 2HQ5A 3ZQLA 2ECBA 5GPAA 4V2FA 3JRGA 2R0QC 4BXXJ 5EF6A 2VPRA 4IHXA 4M3DA 3C2BA 3A02A 4LOCA 4DZJA 5E3LA 2X6OA 2E19A 3WHCA 2O8KA 3BG3A 3HEFA 3ZQIA 2ID3A 1APLC 2L7MP 1IDZA 1FTTA 1U9OA 1ZR4A 4UUSB 4DYRA 2CQXA 5J3LA 5IP7J 3JRFA 3A01A 3QPLA 2JWTA 4NDLA 5F0FA 1YRNB 3OSGA 4MLOA 5M5YJ 1UG2A 3BQYA 1VFCA 2NVYJ 3TW6A 4FCYA 2LK2A 5FLVA 4Y7NJ 5F08A 3Q0VA 3GTJJ 3HBLA 4AUXA 1JGGA 3BTJA 1AKHA 1WCMJ 5FKKA 1FTZA 4BKXA 3BG5A 1SANA 1VF9A 1LFUP 2E2IJ 2IEKA 3S1MJ 3S1NJ 4M3FA 4A3BJ 1OCPA 4JX5A 5F1JA 2KDZA 1FIAA 1NK2P 1BJZA 3TP0A 5K7FA 5M5XJ 1TC3C 2L7FP 1U78A 1MH4A 2DMQA
chains in the Genus database with same CATH superfamily
1Y56A 3H0GJ 5DS9A 5HLGA 4HX8A 5E20A 5ICCA 1ZRFA 3MZYA 3OSFA 1SFUA 1ZHFA 4BBSJ 4A3JJ 1TWGJ 3NWSA 3FISA 2EPFA 2K4BA 2OQRA 4RGSA 4M71A 2DFHA 2FU4A 3BCBA 4CYDA 2R92J 1MDMB 5E17F 1B8IA 4XLFA 2WB1N 1RR8C 2QQBA 1P4WA 1S7EA 4GGGA 1XSVA 1IZ1A 2B0LA 2FMLA 1X19A 3MD2A 2EFPA 2LC2A 4WK8F 1POGA 3MKYB 2HVSA 2JJ7A 3A2KA 1BM9A 3T8RA 1MMNA 4KMUX 4WXCA 1A04A 2QZ8A 2K7LA 3KYDB 5L3DA 1R71A 5FO5A 2A05A 2OCCH 4A5NA 3ZMUA 3LQRA 4KYWA 4CO8A 2HVRA 1YTYA 1X2NA 3S1QJ 1BOBA 5DUIA 1BR1A 3TOBA 4WX9A 1JUSA 3WTYC 4W97A 1TT5B 3A1YA 2CWEA 2DA2A 1I39A 5D5WB 2A6EF 1STZA 2VQGA 1MMSA 3PL8A 2IA2A 4DYQA 3HPHA 1O4XA 3ZCOA 4XN0A 3ABLH 4IPAA 3FMRA 2EFWA 2ZXHA 2PMUA 4XQFA 3MN2A 3DEEA 4B4CA 2LOOA 3HTSB 2V1XA 3OYMA 1YRNA 1SVOA 4KNYA 3JTHA 4HNVA 2IGNA 3QYBA 3M07A 3L2WA 1YE9A 2MW8A 4QIWN 4MHGA 1VQ8I 5H2FC 2X51A 2G7HA 5BQTA 1TNTA 1FZPB 2XUBA 4E7IA 3O8HA 3FK6A 2DBBA 2KIQA 5IPAA 3FXKA 3C7JA 1DP7P 2B7EA 1UHWA 3CTAA 1W1WE 3RJPA 3MMYB 4AYBA 1VQPI 1BOAA 2LY1A 4F52A 1UELB 4A5MA 1XMKA 2DYSH 4XRMA 4RBOA 3GLXA 2VE8A 1XN7A 2CYYA 5CVJA 2DMPA 4CCJA 2QQ9A 1I3AA 1QA6A 2L7ZA 2ME0A 3KZYA 1MJAA 2M8GX 2FOWA 1YHQI 2VC1A 2KJCA 2KP6A 3FXJA 4KUMA 1BI2A 2LY9A 4A2UA 5K5RA 4XICA 3FMSA 3QP6A 1UCRA 3DPTA 5KK1A 5ED4A 2LKXA 1UHSA 1RRJA 1YITI 4IRHA 4A3GJ 1F9NA 4RM2A 4DW6A 4II3A 1LJ9A 4JYKA 3TOAA 3J80K 2WB1A 4RDUA 2F5DA 4PSXA 4ZYHA 1ZK8A 2CW7A 1SEUA 3RZOJ 3H5RA 1DDNA 1IV8A 1HKTA 2ETHA 2QCOA 1RC9A 4PJMA 3U1KA 1MBFA 3HGGA 4JX6A 1XSDA 1BL0A 2BOLA 4CCNA 2VKDA 4B3XA 1ETXA 4MIMA 1PUFA 3CCQI 1D5VA 4B47A 3EUAA 2ZSIB 3F3XA 2DDAA 2VPLA 4EMSA 2JA8J 4KN4X 2CQKA 2EIJH 4XIDA 3OIQA 2V1UA 5DD8A 4YG2F 1FBUA 5E8GA 1Y8RB 4A6DA 2JUCA 1KU9A 3S17J 5LEKA 5HS9A 2W84A 1JKRC 2EJRA 2Y31A 4M9ZA 1ZGWA 3IH4A 1QNTA 1QBJA 2VIXA 4M6VA 4AC0A 3GZ6A 2JRTA 1GDTA 2Q0OA 3VYTB 5CVVA 3FF5A 2V26A 2ZFWA 3KLOA 3RPQA 4CZCA 3ECOA 5EYRA 2R4GA 1I6XA 3BZ6A 3M1EA 3KX2A 2NVUB 1V4RA 3LSIA 4XOTA 1Z7UA 2QKMB 3CUOA 3HTUA 4MQVA 5FFZA 4A3CJ 2NOJB 4ZJZA 3GZNB 1FMWA 2HKXA 3DEUA 2HS5A 4BQOA 5L3BA 1JI8A 3ABUA 2OD5A 5FD5A 3RTRA 4KA4A 1TQIA 1TLHB 1R00A 5B1BH 5JFRA 1MSEC 4UV9A 4PJLA 4U7BA 1MMDA 3GW2A 2FQ3A 1FYKA 4BE0A 1WZ2A 1WJ5A 5IYDJ 2VKEA 2OCEA 3RZDJ 2A3SA 1EF4A 3EUHA 1IRFA 2F2EA 3LSPA 3EUHC 4RAFA 1IGNA 2P7VB 4JK1X 2L4AA 2ZKZA 3U9GA 2AXTC 2IBDA 3CF2A 4RB0A 4C3JJ 1VI0A 1LFPA 2W25A 5A2QZ 1P2FA 2DAOA 2OC6A 2PX9A 4FE7A 3TQNA 2OF7A 3TO6A 3K9TA 1H89C 1R1UA 5M3FJ 2VBYA 1A31A 2XIGA 2W7NA 1KYZA 4C2MJ 3HSFA 3CCYA 4UUTA 5HLIA 3J7AO 2GWRA 1JXSA 3CJQB 1EV7A 3K2ZA 2A69F 4I09A 3L2VA 4XLPF 4MTEA 5GADJ 1D8KA 2LBFB 1T98A 4WCGA 4GRIA 3KYLA 1R9TJ 3KYCB 3CCLI 3K7AJ 1G2HA 1S9HA 3G4SI 4V19K 3V7RA 5C4XJ 2R7OA 3D5RC 1XTAA 2LP0A 2Z5UA 1VQ9I 2XF7A 3J7AY 2M8EA 1WH7A 5DCMA 2XGXA 1JJ8C 1NTCA 2WY8Q 3GTPJ 2FX0A 2B9SA 3JW4A 3SZGA 2X6XA 2LNBA 2LR8A 4XM3A 1PUEE 1LB2A 5C3EJ 1P4AA 1FBQA 1B6AA 3N97A 3CC4I 2FBKA 4A0YA 3HC7A 4L9NA 2KMUA 2EB7A 5K7ZA 4JP0A 3NARA 1NK3P 2DMTA 2CRGA 4HW0A 4M6XA 4BEHB 2E7XA 4WWCA 1YFHA 2V4JC 2ISYA 1KQ0A 3HYIA 1Z9CA 1T6SA 5LHIA 3CCJI 4A6EA 3CDHA 1JUPA 2F48A 2OPTA 2RQPA 2LKSA 4ZYAA 3A4CA 2ZXJA 1IW7F 3BY6A 1HSJA 2VBXA 3CUQA 3L00A 3V7CA 3K4CA 1LEAA 4P9FA 1BR4A 5DCMB 1P7IA 1IO2A 2ZO4A 4EJVA 2I10A 2X1EA 3I5UA 2NAZA 3L09A 3SHFA 1KA8A 2MFZA 3GYHX 1KGSA 2BVMA 1N78A 3MKWB 2VJJA 2GBYA 2LF7A 3DU5A 1BC8C 2R7TA 2VXDA 1BN5A 3E6MA 2E5NA 1OR7C 1VQLI 3OV8A 2O0YA 2WTEA 3G1LA 3KLNA 1YJNI 2DFFA 4YRVA 2ICWG 2XRNA 5ERIA 5FKOA 2JSCA 3S2WA 5KCMA 1S29A 4AD9A 4B1RA 3QYEA 2LFBA 5JHUA 4D5FA 3BG9A 1E3PA 4O6JA 1X1BA 1LVKA 1YLFA 3ULQB 1X58A 4KIBA 5H20A 2ME6A 3HL2A 4ON0A 2ZJQF 2QKLB 1G59A 4KMFA 2A68F 3J81Z 1VTNC 2ZCWA 3CMAI 3OY9A 3CUQB 4B8XA 2DQRA 2H6CA 3I64A 2KJBA 2BVLA 3DV8A 3KP6A 2EIMH 2Z2SB 4HG2A 4FQGA 1MNMC 2HOEA 1GT0C 1J09A 2QQAA 4QPOA 4E6KG 4ASNA 1ZELA 2DCEA 4OIRF 4DJAA 1V54H 3WTTC 2DT5A 2G9WA 2LH9A 3JRDA 3DPUA 1FOWA 2MD0A 3FHNA 2RKHA 1Z0XA 3CF5F 3REOA 2V6EA 4BQAA 1LUJB 3DTEA 4UVAA 1O3RA 2L2OA 2UXXA 2MH9A 3HB9A 1J59A 3S3MA 3QYFA 3ZRGA 1FOKA 4Z6YA 4E7LA 2FF4A 2N8GA 1RETA 1ULYA 3SFZA 2L9SA 3CMEI 3A03A 5BMZA 3F23A 3JRCA 4OIQF 2E5ZA 2AO9A 1LPQA 1NG6A 4XKVA 4II2A 4XRFA 2V79A 2R7QA 4DIQA 3FKJA 3JRGA 2WAFA 4BXXJ 2VPRA 1Q1HA 4IHXA 4PCQA 5FROA 3A02A 1WJFA 2DOAA 3RIRA 2E19A 3I59A 1W36D 2O8KA 1WFXA 2EIKH 3HEFA 4IQ4A 1YS7A 2ID3A 1APLC 3K4JA 1IRGA 3OMYA 1OKRA 3LQQA 2ZC2A 4UUSB 1ZRDA 2KIMA 3E3VA 2VJ4A 4D1QA 2VODA 3JRFA 3R60A 3H0DA 1YW8A 3FXQA 2KLOA 1X3UA 2V1NA 3PSFA 2MYSA 2M1BA 2WC2A 2K4JA 5E79C 4BS9A 4EM0B 1UG2A 1IF1A 3LFUA 4RAYA 2NVYJ 2Y69H 3HIFA 4FCYA 3MAJA 1S7OA 2E71A 2X0LA 3IKVA 4HAMA 1KONA 4N0BA 2QWWA 4B44A 1R5GA 2VJ5A 2VQHA 3BTJA 3CP8A 2F5EA 1MMGA 1XGOA 3DPLC 4BU2A 2JZYA 2IS4A 3E5XA 2E2IJ 5J4VA 2VQCA 2XAQA 1S72I 3S1NJ 2XAFA 2BW3A 1EH7A 3I59B 5E1ZB 5TGTA 2VQLA 3BOQA 5M5XJ 4I0AA 2DMQA 3KP7A 4XLAA 3JRAA 1D1CA 3BG6A 1K83J 1K61A 3H1CA 1H0MA 3FZVA 3ESWB 2BY0A 2VONA 1RUNA 1V5FA 2M3AA 4IHTA 4CXFA 4OU0A 4C9YA 4HEA2 1P7JA 3CCVI 1U8BA 1H9TA 5L3EA 2BY1A 5GAEJ 3IP4B 1W5CC 4BXFA 2JVHA 3GX4X 3CLQA 4FHTA 2FQ4A 4M73A 5A2QK 2M45A 3TMOA 1W5TA 3K1MA 4D7MA 1D1AA 2BHZA 3WTWC 1PP7U 2W85A 3M8EA 4ABZA 3J7ZI 3BDDA 4Y52J 2L01A 1RUOA 2EZLA 4XBFA 3WODF 2LREA 2H6BA 2DTRA 4LGWA 1F5TA 3E97A 3BROA 1ZH5A 2TRTA 4G6TB 4E7HA 2CUFA 3T8TA 1YJ9I 1R1VA 4AVZA 2HDDA 3ZQHA 1TT0A 2KIFA 2DMNA 4C2UA 3HRTA 2XC7A 2BY2A 3ZXSA 2RN7A 2EH3A 3IH2A 3O3KA 4A3LJ 3WHBA 2XF6A 2Z33A 2XVCA 1BIBA 1P9QC 1CQTA 2JPCA 4UXNA 3ZMTA 5KAFC 3HOYJ 2VOOA 3OL3A 4YIRX 2HZTA 1ACIA 3OIPA 2KZVA 5TISC 2Q2EA 2DPDA 1B72A 1B1BA 2WAQN 2Y9ZA 3MKZA 3GXOA 1ZKGA 3PIPF 2TCTA 2A6HF 1ZYRF 1U5TA 3KETA 1U0JA 4M9SA 3TW7A 1U5TC 3F22A 2O3FA 3ZMDA 2O61A 4NNJA 5F64A 1OCZH 3I55I 3IUOA 3PNVA 3OYHA 3K70C 3OYJA 1XPXA 2NVXJ 1FNNA 4ITVA 2IA1A 4G12A 3AG1H 4G7ZF 1LE8A 1HOMA 3G1OA 1O7LA 1WSUA 1FMVA 1HQCA 1ZLJA 3RYPA 4GDFA 4P96A 1KU7A 2JK3A 2M2EA 3H92A 2GXGA 3P9IA 2LYCA 2ID6A 1G3YA 2F4OB 2VT2A 2XKPA 3LA2A 3RCOA 1T95A 3KP2A 4LG3A 1DGRM 4NBQA 4GYGA 3K10A 2ISZA 3M1CA 1B72B 1R4MB 1F4KA 1DPUA 2BY3A 4Y15A 3I58A 4X6AJ 3HZJA 4N9HA 4RGRA 4BACA 4ENNA 2XAHA 1YW7A 1U5TB 2CU7A 1WHUA 2PJRB 3UKGA 4B09A 3ONQA 1FWZA 3F21A 3WU1B 4UB8C 5E3NA 3CQZJ 4AYBN 4HRIA 3OYBA 3LOCA 3VYRB 4Y17A 2XB0X 1XGSA 2EZIA 4RB1A 3TP3A 1LE8B 3HOVJ 4GO1A 4A69C 3J81K 3OYCA 3V8LA 5H6RA 4XLNF 3GCMA 1I6HJ 1D8JA 2MG4A 3F8MA 2VL8A 4B43A 4YIIA 4XL9A 1G6NA 4DGWB 3KZZA 2KQRA 4U87A 5LBQA 1I50J 3ZMVA 1Z05A 4HOBA 4LITA 4BUPA 2ELJA 1GHCA 1R6RA 3MFKA 1TNSA 2P5LC 1JT6A 3TEDA 2EWNA 1DUXC 2LKPA 2NVQJ 1CF7A 1BI1A 3BR0A 4B3AA 2K3FA 3I56I 1ERDA 4JOMA 1FPQA 4BJ6C 3M7GA 3OWTA 5ILUA 1ZREA 4S0HB 3V8JA 3VOEA 3CESA 4HF1A 2STWA 1WVRA 5IY5H 4A3KJ 1MBJA 3P9CA 3FHZA 4ZDOA 3CCRI 4BDZA 1FOYA 1OISA 4G6QA 1G8XA 5DTDA 1PYVA 3M8FA 5L3GA 4C30A 4IOCF 1J2XA 4HYEA 5J4YA 1W7PA 3BR2A 4UVBA 2UZKA 2HEOA 2G0EA 1MZBA 4AM3A 3VDXA 4IHSA 2P81A 1D5YA 1GV2A 2NS8A 2OU2A 3KIOA 4Y33A 3ZQGA 3DQVC 3PIOF 1W0UA 2XPWA 1MKMA 2V9PA 2WAQA 3M3YJ 2CUZA 1YYVA 1MNDA 3DP7A 4UVCA 3HOSA 1VQ4I 2OZUA 2V6CA 3HPGA 3IAM2 2Z16A 1CF7B 2NYXA 1QRYA 2DOEA 9ANTA 3FXOA 2XSDC 4LLNA 4AWXB 1FYMA 2CSOA 3R6SA 3TBIA 5EJCA 4LJZF 1X2MA 3DTKA 4EJOA 2KZGA 4L9JA 4IO9F 3FXUA 1W0TA 5E18F 4HF2A 1JHHA 1WJEA 5HNHA 3F6VA 2HGCA 2O5RA 4LFUA 4XLCA 4IL6C 1X1DA 5CJ9A 4GFBA 5J8FA 2Y48A 1IJWC 2FNAA 2VJIA 4CYCA 1W7PB 3S2DJ 1FSEA 3OL4A 1MH3A 1X4PA 3ELKA 2HYFA 5FRNA 2VKHA 4FX4A 3BP8A 5KHDA 5K1YA 2XB5A 4LG0A 2F6CA 5D5VB 3WGHA 2RQQA 2H8RA 2DFEA 4AU7A 1J9IA 1IXCA 2DQLA 2K27A 3BTCA 3HSEA 3TDUC 4HQMA 2OUMA 4QLCU 3KP3A 3JCUC 2QQ8A 5IYBJ 4XNFA 3PO3J 2AS5F 2OQGA 4I0BA 1KQ9A 1WPKA 5GAGJ 4BGDA 2IS6A 2CQQA 2KRCA 4I7HA 3OYNA 1QVTA 4PK4A 2PG4A 2XPUA 5D5XB 2ACJA 4MNUA 3G3ZA 1Y39A 4PDKA 3I54A 3I4NJ 4CYCB 5J8CA 4L5JA 5DYMA 4PZJA 2D45A 1BR2A 4M3EA 4P55A 3K4NA 2VLAA 4IXAA 5TJJA 1QZEA 4U7DA 1Y1VJ 3AG4H 2ESHA 1JTYA 4LG0B 3C1DA 1A6IA 3E0JB 3RPUA 5ILSA 3Q0UA 2GA2A 1ZTRA 2D5VA 3TO9A 4DBRA 3LSTA 1HW1A 3NRVA 2FD5A 1L3LA 1SD4A 2K85A 1PVEA 1IAWA 1WQ2A 4HV6A 2JA2A 3GF2A 4YELA 3WU2C 5D6EA 3Q0WA 4CH7A 1QZZA 2K40A 3OYDA 3KCCA 3OOUA 1T38A 2LD5A 3I3LA 3IRQA 2JA5J 1HKQA 2X6WA 5FRMA 3KE2A 3ROUA 1FOXA 2Y0SA 4QSHA 2EQRA 3RI4A 4XOPA 2HWVA 4P9UA 3L1PA 3BR3A 3QPSA 2GOMA 3QAHA 2OTJI 4BJTA 3MVPA 2K9SA 2PFBA 5EEGA 3OOPA 2VE9A 2K9LA 1IN8A 5JLWA 2A6TA 1JKOC 2L9RA 3RQIA 1BW5A 5DEQA 2ESNA 4NUBA 4A3DJ 2CV0A 3ISPA 4CZZA 4Z2YA 3RPUD 4ESFA 1YG2A 1V55H 2DA7A 4BQQA 1JGSA 4XR6A 4E7SA 4HX4A 3T5XA 3CMMA 4ESBA 1DU0A 2MABA 2M0MA 2GZWA 2STTA 2V9KA 4ANJA 1BI3A 4OINF 3G2BA 1Y1WJ 4CDGA 1ZAOA 3NEUA 3IRRA 2OZ6A 1ON2A 2EZKA 2M34A 3HHGA 1K4SA 1T0FC 2JN6A 1YIOA 2PMZN 4LIUA 1HW5A 2C6YA 2X48A 4FASD 3O2PE 3W6VA 4EQQA 5CQGA 2DI3A 4LD5A 1E3OC 4IRIA 5K5OA 2NOGA 2KPMA 3WTZA 4XSXF 3VSKA 4E7ZA 2BHYA 2DU9A 1S7AA 1DU6A 1KQ8A 2XASA 5HS8A 2IXSA 2JTVA 2LBFA 2D1HA 2R7DA 2P0WA 4JBAA 2PBIA 1XGMA 4EEFG 4A3MJ 2CJJA 2R7RA 3L2RA 3IHUA 1FIPA 3E5UA 2RNJA 4G7HF 1TP4A 2P4WA 1LDKB 3AG2H 4OMZA 2XPVA 4M72A 2ZNZA 2O6GE 2GA1A 2GQQA 4HDUA 4CICA 5LRRA 2IRFG 3DEWA 2XAUA 3ZGKA 1F43A 5J47A 2CUEA 2XAGA 3L2QA 1BBYA 4RMNA 2DLLA 1FBSA 1FT9A 2DT7B 2F5CA 2FE3A 2QVOA 1SC7A 1YO5C 1UJ8A 5B1AH 5F27A 1B59A 2DK8A 2H1KA 1SD6A 1Z6RA 1GUUA 2IS1A 3SFIA 4K2EA 5B66C 3H35A 3K4BA 4U88A 4BEHA 4Q4ZF 2YSRA 1Z3YA 2WBMA 4V2FA 2HFHA 3JAMZ 4ZDPA 2Z1DA 3C2BA 4LOCA 5E3LA 3FBNB 1I5ZA 1P6RA 3BG3A 1D0YA 1IDZA 2L9VA 2CH0A 1ZRCA 5IP7J 2ZFUA 4XKBA 3BZCA 3LWFA 3QPLA 1NG7A 2CO5A 4EV0A 2CMPA 2BZTA 1H9GA 2R7UA 1ZG5A 2PI0A 3GWZA 3QPTA 4KIFA 1VFCA 3AL0C 2LK2A 4XONA 5HLHA 5GTHC 3OYLA 3Q0VA 2RV8A 2ZJ2A 2KISA 3CJRB 4AUXA 1AKHA 1WCMJ 5FKKA 2AQEA 2F5FA 4UV8A 1I1SA 2CV1A 3DBRB 4NC7A 1MIJA 3BG5A 1SANA 1HA8A 2M7BA 3FMQA 2IEKA 4XSZF 3SEQA 2CW0F 1T2KA 1LEBA 1WJCA 1OCOH 3OYIA 1VQ5I 3GLLA 3P9KA 5BOXA 2P7CB 3A0HC 3H5NA 1BJZA 2VB6A 3EDPA 4Y4RA 5K7FA 2RDPA 1TC3C 2L7FP 1U78A 4L0YB 3SQNA 3DU6A 2ZXIA 4HSTA 4DBQA 3CO6C 1PDNC 2R7VA 4M9XA 1JJ6C 3PNTA 2QM3A 2P5VA 3L9FA 3WTXC 2LTPA 2VKVA 5CPRB 2HKOA 2K9MA 2P6SA 2PMZA 3S8PA 3SDGA 4S05A 1OR7A 1H88C 6PAXA 3Q3SA 2JQ7A 2Y2ZA 5DM7F 3AL0B 3DTIA 3QU6A 2FRHA 2YPRA 2QSHX 4M74A 2R3SA 3K1PA 1AKHB 3FXLA 1ZGAA 4NB5A 3BLYA 4I76A 4DYCA 3RDIA 2LSOA 3JREA 3MEXA 1T33A 3DKYA 1ETKA 4BL0B 1HW2A 2CFXA 3RKWA 2ZMEC 2HQRA 1RKTA 3WG9A 4BQNA 5CYVA 2E2JJ 2DXIA 4U0WA 2B63J 2BEOA 3PQJA 1M1EB 3TL4X 2NNNA 4KDPA 1OYYA 3E7LA 1SD5A 2H1LA 1FY7A 2YU9J 3PUBA 5JHFA 3MKLA 5ICEA 3H5AA 2OBPA 3LAPA 4FE4A 3ZN0A 1RR7A 1AHDP 5LRSA 2HXIA 1DPRA 4EM2A 1LFBA 3OYKA 1MGTA 4MEYF 4BH9A 2IP2A 2JMWA 3OS2A 5J1YA 1X3WB 2FNPA 3DKXA 2PMHA 3GMEA 5J6XA 4UUSA 3D1NI 3O6BB 3CCMI 2EILH 3IWFA 4LMYA 2ZMEB 1Y0NA 5E1WA 2RNGA 5DM6F 4H0EA 1HLVA 2YX7A 2PJPA 1JTXA 1ODDA 3WGGA 1S5LC 2YR2A 4GYIA 4R79A 5EG0A 4EM1A 3IV5A 4XORA 1GVDA 1GXQA 4HPQA 4NC6A 1A36A 2H27A 1LDDA 4IX7A 4L5EA 5DV5A 1HDDC 3EPZA 2LG4A 4LIVA 1SMYF 1B9NA 4A0XA 2QYOA 3CZ6A 1JHFA 2R5ZA 4BY1J 1QGPA 3HUGA 4BBRJ 2AHQA 4F92B 1DGWY 3P5JA 4XKCA 5CQEA 2OJED 1ZR2A 1D1BA 2LMDA 4HDVA 4XLHA 3CD6I 4KITB 4I01A 2IT0A 2XGCA 5E8IA 5LLQA 3VPRA 3GTKJ 2F4MB 4E4HA 3H3VK 4D9JA 2GXBA 2X6YA 3AG3H 2XKOA 1X4OA 2JRMA 3F8BA 3VODA 5EG0B 2MLKA 3IWZA 1O7FA 2XRLA 3LNQA 4E70A 1XX5A 4ENJA 3HOTA 3M8JA 3WTUC 2K9QA 3BPVA 4LB5A 1VQOI 4R8HA 2W48A 2GIVA 4WXDA 2G7UA 2P8TA 2DMUA 4IHYA 4IRGA 3COAC 2R5ZB 3HUGB 1ONVA 2ZSHB 1IN6A 1AU7A 2EFQA 4NQWA 4L9TA 5LHHA 3FX3A 2DOFA 3K4MA 3KFWX 2KIUA 1ETVA 2OV7A 1Z21A 3ASOH 2IS2A 3OYFA 2PQ8A 1OYIA 4G8XA 1XDSA 3GFLA 1MSFC 2DA5A 3GTGJ 3BR5A 1K78A 1N75A 2J5OA 3BJOA 1IDYA 4BXUA 2HOAA 2XF5A 1V3FA 4RLFA 3V42A 1YQAA 4X0GA 1OYWA 2Q1ZB 4L5IA 4C2TA 3C2GA 1ETYA 1XGNA 2Z3YA 2L5QA 2XV4S 1P4XA 3ECHA 3GBGA 2HYJA 2MLGA 2HNHA 3SEZA 3WTSC 2M7AA 3LSJA 1EH6A 3OIOA 3N4MA 4WXHA 1MMAA 2L4MA 1MJ9A 2ZXWH 4B48A 3ABKH 5E3OA 1SAUA 2V7FA 4NQWB 4LB6B 1OCRH 3P7NA 1OJLA 2HQAA 4TV7A 1WH5A 3R4KA 2EFOA 4HX7A 3S3NA 1FJLA 1F1ZA 3JAMK 1K78B 4GCVA 1IXRC 2I5UA 3BT9A 4A12A 2NNYA 1XC5A 3PFYA 5IT9Z 5F0CA 5GPCA 5F0HA 2R7ZJ 4IJAA 2JA6J 5L3FA 3D0SA 3IL2A 2XGDA 3A0BC 4I02A 4F93B 2K02A 2UXNA 1IN7A 1D0XA 1T39A 3HDDA 3VWBA 2L3DA 3O8GA 2FXAA 4IHWA 1Y8QB 2O9LA 4EJWA 4Y3OA 3QWLA 1R22A 4E7JA 4PJNA 1IC8A 1YW9A 4ZC3A 5C44J 4MGRA 4KT6A 3W3CA 3W2AA 3CJNA 2QEXI 3C2HA 4A0ZA 2PJRA 2CS3A 2X4HA 3F8CA 5DD4A 2E60A 1P92A 2M9HA 3AAFA 4OIOF 2Q8KA 3QPHA 3R0JA 4O3MA 3OYGA 1XS9A 1VQKI 2FJ1A 1X1AA 4IQJA 5IP6A 3K4LA 4KJZA 1UB9A 2HPIA 5CVUA 3TKYA 1ETOA 1YIJI 3FKIJ 2ZBKA 4C3IJ 2XHKA 5FLMJ 1USTA 2F4IA 1N25A 4J19A 4CGZA 1IV6A 3V8KA 3IC7A 4AIHA 5FLXZ 3E6DA 4UUVA 1U9NA 3WU0A 2EK5A 4PFOA 1IUYA 2RAEA 2O7OA 3S32A 4RGUA 4ENMA 3E6BA 1TWCJ 2HYGD 1A5JA 1RESA 1TWAJ 1TQPA 1XCBA 2RGVA 1HKSA 3GEZA 3R0AA 3KP4A 5D6FA 4DZPA 4FISA 5ICFA 1ETQA 1V5GA 3DLLF 3JRBA 2X85A 3I53A 2IA0A 2UUZA 5D5UB 3I71A 3BR1A 3S15J 1FSHA 3ZN1A 3K70D 3HOXJ 2HTSA 2WA0A 2CQNA 5E1XA 4Y13A 2HU9A 2K86A 3ERED 3BTLA 2OA4A 4YEJA 1OQYA 3ZQ7A 3BWGA 3EQLF 3OYEA 3NWTA 2IGOA 4N4OB 1LQ1A 3K1NA 3M4OJ 2YS9A 1WJAA 2GAUA 2VXZA 4CCKA 3EUKL 2DTZA 3AKZA 1XCVA 4XRSA 3GTLJ 3WGIA 5E3MA 1W5SA 1C0WA 4DOZA 2KKOA 1WJBA 3FXRA 1ZG3A 4HLXA 5FB2A 1HCRA 1I1GA 1XMAA 2WV1A 5HNFA 1OFCX 1X3ZB 3OS1A 4ETSA 3A01B 1SVMA 4HQEA 2LLKA 4HLYA 2X9DA 2COMA 1G3TA 2Y0SN 5IOZA 2CW8A 2QSGX 3F9KA 3CCSI 4OOIA 3MZHA 1WJDA 2DA1A 3GFMA 4ZYEA 2WADA 5CVRA 3HOWJ 1MBGA 2E35A 5LHGA 2A61A 2L02A 2HR3A 1H8AC 1RNLA 3D5LA 3HG9A 3LL7A 5FKNA 3G6EI 1Z7LA 3BJ6A 4A3FJ 3SDBA 2EV5A 4OWRB 2VN2A 1MNEA 2H8WA 1X1CA 3N05A 5J40A 2QBYB 4MTDA 4OIPF 4N4NB 1QHGA 2DT6A 5EGOA 3HRSA 4ZZLA 2GM4A 2HPMA 2LDUA 5IOYA 5LGNA 1NHAA 2O03A 4AVPA 5HODA 3BZKA 2M4KA 1ZLKA 4N9IA 5M5WJ 1LDJA 2E1OA 5KAIC 5LGUA 3L2CA 4W1UA 1NH3A 3U21A 1OPCA 4DNCA 4AIKA 4I6ZA 3GO5A 1U6GA 1B8IB 3WE3A 5IP9J 4PGGA 3PO2J 5EZHA 3V4GA 1W7PD 1UFMA 4ZTFA 4J01A 2ELKA 2YUSA 4A93J 3DKWA 3K6GA 3CO7C 1WI3A 4CSWA 3DF8A 2BGCA 1MBHA 3QU3A 2W57A 4IF4A 3ZQQA 1GVJA 2W82A 2XGEA 1UG0A 1E17A 3WE2A 3CDIA 3PM1A 3FIWA 3MQ0A 3HHHA 4A3IJ 4ZZDA 1EH8A 4PSWA 3S3OA 5EDNA 1SFEA 2ZJPF 2BXZA 2R7FA 5EGOB 5D4RA 5K5QA 2OAZA 1JKPC 3CJTB 2EBIA 2HQ5A 4R1HA 3VFZA 3ZQLA 3RQ4A 4RA2A 4HV5A 2ECBA 3FM3A 5IT3A 4PUSA 3J7YJ 2W1OA 5GPAA 4XMYA 3DXJF 5BPDA 3TO7A 2VASA 5HOOA 3TGNA 3CC7I 3WHCA 4EATA 3K0LA 1FTTA 1Y6IA 1U9OA 1ZR4A 1QU3A 1R1TA 4UB6C 1U2WA 2JVGA 5F0FA 3OYAA 1YRNB 3Q5FA 3OSGA 2QGUA 3JSPA 4MLOA 5M5YJ 5D8LB 3BQYA 3M9AA 4P1WA 4Q47A 1B4AA 5FLVA 1FYLA 4BHCA 1R23A 4Y7NJ 5F08A 2M4GA 3GTJJ 3HBLA 2WV0A 3OS0A 2E7WA 4CCLA 2IW5A 3VSLA 5IT9K 2HVQA 2WAEA 1VQMI 2I8DA 1DQUA 2DFIA 1VQNI 1VF9A 1LFUP 2EV0A 1E3HA 1I27A 1K7AA 1WRJA 4M3FA 1XDUA 5DUKA 2QSFX 1T08B 4JX5A 1VZ0A 3WTVC 3SXYA 2WWYA 1FIAA 2AXLA 4RB2C 3C18A 2XROA 1MH4A 4G7OF 2F5VA 4UNOA 2Z99A 5GP9A 5GTIC 3GFIA 2XSJC 4G9YA 4ZYGA 1VQ6I 1XB4A 2IPQX 2W4SA 4X1EA 3F8FA 2JA7J 2ZJRF 2DA3A 2A07F 5HLTA 1XG1A 2X1DA 2HOTA 3DFGA 2PLYA 2DA6A 2K5CA 3ZP5A 4G94A 4PFPA 5ILVA 4EJUA 2O8XA 4Q5SF 3KEOA 4C3HJ 2E1NA 1WWXA 2COBA 1ETWA 4H4KC 3G1MA 1TW3A 4O5VA 3KP5A 2LVSA 4CUGA 2FSWA 1T0FA 1TWFJ 2FA5A 3DWLE 2L9NA 1BA5A 2MA3A 2Y0MA 5LEJA 4FTHA 2XAJA 3Q9VA 5CKTA 1QPIA 4LLGF 2EA4A 4EGYA 3U1DA 4FX0A 5FLXK 4MEXF 2DJIA 4HA8A 1SD7A 1PP8F 3GTMJ 2L54A 3BC8A 4PJJA 1ZARA 5FKMA 4QTRA 2NVTJ 3LA3A 1PUFB 1REPC 3IAS2 3ABTA 2FEZA 2QUFA 2NS0A 3FK7A 2MD5A 4BE1A 5J1UA 2RVCA 4ESJA 1LVAA 1IRXA 4D5CA 1A6QA 2JT1A 4LK1F 1J5YA 3EYYA 2J5PA 3UNGC 2IJLA 4L18B 3NQOA 3ZQCA 1OCCH 1YX3A 3JRIA 3RKYA 3H3UA 1MD0A 4HNTA 1V5EA 1HDPA 1VNDA 2ELHA 2A5YB 1Z67A 4XN3A 2VC0A 2CGPA 1ITYA 2KFDA 5L3CA 1ZQ3P 1TZLA 2PN6A 2QA4I 1FC3A 3ZMSA 2JSPA 4M3GA 4UY8I 1MBEA 3B6CA 3FBIB 2HXOA 3CC2I 3RKXA 5JVTA 3OR1C 2GIZA 3G71I 3X2QH 5EZGA 2R7WA 1MW7A 1QVUA 1SMTA 1BI0A 3CP2A 3PNYA 1IUFA 1KU2A 3B6AA 4Q48A 3L7WA 3ZQFA 1OMIA 4OAYA 4IKFA 1AA7A 3HOZJ 1O3SA 2YU3A 4GXOA 3DLAA 3E5QA 4OAZA 4EGZA 1HC8A 4I99C 3L2UA 2LF8A 4KISA 3W2VA 1QQIA 2V9VA 1VQ7I 3CLOA 3S1RJ 3RYRA 1RIOH 3QODA 2M30A 1YS6A 2JPBA 5K7HA 2KHMA 4MFEA 3LSRA 2EA2A 2GOXB 2BBYA 3GUDA 4BHBA 1D0ZA 2D1VA 1UAAA 2FBIA 1Z77A 2R5YA 4L9VA 2DODA 1X1PA 2H09A 1RPWA 5EEAA 4M3BA 5FKLA 3E6CC 2HDWA 3GZ5A 2EZHA 3GFJA 2DA4A 3U2RA 1ZGJA 1CGPA 2P6TA 4YFNF 5CVIA 1UHMA 3PUFA 4KT5C 4ZYDA 1J75A 1S6LA 5EEHA 2GXAA 2Z9OA 2AQFA 3RKQA 5DCFA 2PEXA 1JUMA 5HS7A 1Q1VA 1OLTA 1UMQA 2M87A 3GVAA 4XK4A 3CCEI 3RSNA 4L0ZB 3KEQA 5HDNA 1D3YA 5M3MJ 3BPXA 4LK0F 3CUQC 1J7KA 3CCUI 2HOSA 1MJBA 1QHHD 2HI3A 5B5EC 2H94A 1K6OA 2BV6A 2VOPA 2DDBA 3V7SA 3G73A 2UV1A 3QQAA 2IGKA 3B73A 3ZPLA 1TQMA 2ZMEA 2BE5F 2R5YB 1F36A 1G3SA 3ZR8X 5JR3A 4HSRA 3VYSB 1Z6TA 3IH3A 2NRAC 1U3EM 4IOAF 5F1RA 4BNCA 2CFOA 3PSIA 2NS7A 4RAZA 3MWMA 4BE2A 4F3QA 2EINH 1HF0A 1R4NB 3TDZC 3HSRA 4YIFA 1ON1A 1A35A 4S04A 2L0KA 1AOYA 5LGTA 2CQ7A 3QOEA 4IEJA 3K69A 2HQNA 2QENA 1YI2I 1B9MA 3HGYA 3T0YA 5D8KB 3Q9SA 1TW2A 1BIAA 5KVRA 2IGMA 2E1MC 1WGXA 2IVMA 4MO7A 3GTQJ 1MBKA 2L7KA 1WKMA 5IYCJ 4FETA 3S16J 1KU3A 1W36C 2ZNYA 3R61A 2VUMJ 3H9GA 4KICA 5B3SH 3JSOA 2KRFA 1FLIA 3MZ8A 3DBLB 2WY7Q 3F8NA 2HZDA 2ZB9A 2YX4A 3SZPA 1HSTA 5D4SA 1U8RA 5J1RA 3DCFA 1K79A 1EA3A 1W4MA 1WI9A 3KZIC 3W6JB 1ORKA 2Y30A 3JTGA 1SAXA 2R93J 3VEPA 4M6YA 4RLQA 4U0VA 4BDYA 3FWEA 1FEXA 1R36A 1Z1DA 2KT0A 3LSGA 4F91B 3S14J 4ZDLA 2VT3A 2DN0A 3BR6A 3I0TA 4RS8A 5FGMA 3W2WA 4CCOA 2W00A 4U0YA 2E1MB 1J0RA 2DPUA 4HNUA 1TWHJ 3LA7A 1PJRA 2FBHA 5BNGA 1GXPA 1IG7A 2IAIA 1T8IA 4RM3A 3H9JA 3JR9A 3QOPA 4PJ0C 2UWMA 1ZN2A 2NXNB 4F55A 2K9NA 2KRHA 1I3QJ 1E2XA 1XSXA 3AFHA 1BW6A 2LY2A 1AWCA 3HM5A 2KL4A 1GLNA 3PFIA 2DK5A 1TBXA 2MH2A 4NHJA 3F0CA 1TTYA 1LKXA 4RB3C 4MFDA 5HDGA 3I4MJ 2E34A 3I4PA 3T1BA 2E2HJ 2P5KA 4D7NA 2LRDA 4XRSG 1L0OC 3MCZA 5KNLA 1K4TA 3BCAA 1USSA 1Z3XA 4BAYA 4V2GA 4HBLA 3ERMA 3H3ZA 3K4KA 1ZG1A 5AIPA 2VBWA 3HOUJ 1IXSB 4CA0A 3ZOBA 1DP3A 2DO7A 2M0CA 2CUJA 2EFNA 1RI7A 2MGQA 3LSKA 4D0PA 2HDCA 4AIJA 1BJAA 3ABMH 1IN4A 4G6DA 4IVNA 4KIGA 3HRUA 1YJWI 1R49A 1HXDA 5CLSA 4LLLA 1BC7C 4PGHA 3B02A 1S8NA 3BG7A 3WG7H 1O3TA 2R7SA 3S93A 4EVIA 2W24A 2FMYA 3D5SC 4XLEA 3CDLA 3VB2A 1IN5A 3ML6A 1RKWA 2OTLI 2K3PA 3HKZN 3S2HJ 3E1SA 4XKWA 4HF0A 1JE8A 5GAHJ 3LSHA 4QWQA 1G3WA 3FXMA 2VI6A 5ICGA 3QRFF 4QPQA 4A3EJ 4RGXA 1RZ4A 5JLXA 4I98B 3LFKA 3KEYA 3DBHB 2JUGA 5LFAA 3SJMA 2CV2A 2FUG2 4E7KA 3QP5A 3CMYA 2QF7A 2BW3B 1G4DA 1XMXA 3J80Z 4KN7X 4ENKA 1QZYA 3LSMA 1UZCA 3H9QA 1HBXG 1R58A 3PJRA 5FJ8J 2TDXA 3JRHA 2DJNA 4DQ2A 3K2AA 4HZFA 3PQKA 4AIDA 2Y9YA 1SFXA 2HTJA 4YFXF 3BTIA 4I2OA 1T56A 4F7ZA 1ENHA 5JI6A 3F6OA 3OR2C 4MQ9F 1TL8A 3H36A 2MC3A 5F6FA 1Y0UA 1K6YA 2RC4A 3IKTA 3LAJA 4JQFA 1SFOJ 2E1CA 5F04A 1O57A 4IZZA 3LMMA 3NAUA 5LD2C 4OMYA 3W6KB 2A5WA 2RREA 3FDYA 5C4JJ 1IRZA 2ECCA 5TRDA 2GLOA 5FFXA 1QO0D 2MSYA 3BQZA 5AONA 4IHVA 1JKQC 1YOVB 5JVGF 4BY7J 2FOKA 4ZH4F 5HVQC 3EETA 1R5HA 3F72A 1GV5A 3GTOJ 2KDOA 4UHTA 1JT0A 1OCTC 4JX4A 2V1DA 3C3WA 2BYVE 2R7XA 3UR3C 1SVLA 4WF2A 2ADUA 2R0QC 3ZMZA 4NC8A 2D2WA 5EF6A 3FM5A 2VBZA 4RAGA 4M3DA 4BHPA 1XD7A 5AIQA 2MBFA 4DZJA 2Y75A 2X6OA 4YFKF 1QPMA 1N77A 4EJTA 5BS6A 3ZQIA 1O3QA 1FP2A 1R7JA 2L7MP 5BPIA 1EJ9A 2Q2EB 2CQXA 1Z91A 3HXLA 5H6QA 5J3LA 4P5OA 3SYTA 4DYRA 2DYRH 3A01A 3VYUB 2JWTA 4NDLA 4KFCA 2DW4A 1LNWA 4CHUA 1FX7A 4J00A 2E36A 1EKEA 3I9V2 3SZTA 2MC4A 2BXYA 1SFKA 1FP1D 2X1CA 5HDKA 3TW6A 1R5ID 1MDMA 2CG4A 2QLZA 4ZTJA 1JGGA 1KYWA 3EYIA 3KPHA 4BJ5C 3BJAA 1E0EA 1FTZA 3ASNH 2EV6A 1KZHA 4BKXA 3HJEA 4FT8A 3HKZA 1S3JA 3S1MJ 4A3BJ 1OCPA 2XDVA 3HRMA 5F1JA 2KDZA 4BYYA 5FD6A 1NK2P 2QBYA 2M5WA 3TP0A 4CCMA 1YX5A 5DDGA
chains in the Genus database with same CATH topology
3JRAA 5GP9A 1JJ6C 3H0GJ 5DS9A 1K83J 1K61A 2LTPA 2VKVA 3SDGA 3OSFA 1H88C 4X1EA 4BBSJ 3Q3SA 2JA7J 4A3JJ 1TWGJ 2Y2ZA 3FISA 2DA3A 2R92J 1XG1A 1P7JA 1B8IA 2HOTA 2WB1N 2DA6A 1U8BA 1S7EA 1AKHB 1POGA 4C3HJ 2JJ7A 2COBA 1ETWA 2FQ4A 4I76A 3G1MA 4DYCA 3JREA 2LVSA 1T33A 4D7MA 1TWFJ 1ETKA 4ABZA 1BA5A 1RKTA 4Y52J 4FTHA 2EZLA 1QPIA 2E2JJ 2B63J 2TRTA 3E7LA 2CUFA 3GTMJ 2YU9J 1X2NA 3S1QJ 5FKMA 4QTRA 2HDDA 1PUFB 3MKLA 2NVTJ 3ZQHA 1JUSA 2DMNA 4W97A 4FE4A 2DA2A 3FK7A 2EH3A 3IH2A 1RR7A 1AHDP 2HXIA 4A3LJ 1LFBA 5J1UA 3WHBA 1CQTA 1O4XA 2JMWA 3HOYJ 5J1YA 4D5CA 4UUSA 3D1NI 1B72A 2WAQN 3MN2A 4B4CA 2Y9ZA 1YRNA 3ZQCA 1ZKGA 1HLVA 2TCTA 4HNVA 3JRIA 1JTXA 2MW8A 3TW7A 4QIWN 5EG0A 1HDPA 1VNDA 3IV5A 1ITYA 1GVDA 1ZQ3P 2NVXJ 4L5EA 1HDDC 4G12A 3O8HA 3FK6A 1HOMA 1LE8A 4M3GA 1MBEA 3G1OA 3B6CA 5IPAA 2R5ZA 2HXOA 4BY1J 4BBRJ 2AHQA 1ZR2A 5EZGA 2JK3A 2M2EA 4DYQA 2ID6A 1QVUA 1B72B 2XGCA 1IUFA 4XRMA 3B6AA 4RBOA 3VPRA 3GTKJ 3H3VK 2DMPA 3ZQFA 4X6AJ 3HOZJ 2L7ZA 2ME0A 2CU7A 2M8GX 5EG0B 3UKGA 4XICA 2LY9A 3S1RJ 2XRLA 5E3NA 3LNQA 3CQZJ 4AYBN 3LOCA 5K7HA 4MFEA 2LKXA 1UHSA 2K9QA 2XB0X 3LSRA 4A3GJ 2W48A 2EZIA 3TP3A 1LE8B 4DW6A 3HOVJ 4A69C 4JYKA 2DMUA 4IHYA 2R5ZB 4RDUA 1I6HJ 2MG4A 1Z77A 2R5YA 1ZK8A 1AU7A 1RPWA 5EEAA 4M3BA 5FKLA 3RZOJ 2EZHA 1I50J 2DA4A 2QCOA 1MBFA 1ETVA 3HGGA 4JX6A 1BL0A 1ETXA 4MIMA 3RKQA 1PUFA 1MSFC 1JUMA 2DA5A 3GTGJ 3BR5A 1JT6A 3TEDA 1Q1VA 1UMQA 2NVQJ 4XK4A 1IDYA 3BR0A 2HOAA 4B3AA 2JA8J 5M3MJ 4XIDA 4S0HB 1ETYA 3GBGA 1MBJA 4A3KJ 2HOSA 3S17J 2HYJA 2HI3A 1JKRC 2Y31A 3LSJA 3OIOA 1ZGWA 3IH4A 5DTDA 3QQAA 4M6VA 4AC0A 2R5YB 1F36A 3BR2A 5E3OA 2G0EA 1GDTA 2P81A 3IH3A 1D5YA 1GV2A 1OJLA 1WH5A 2NS8A 3ZQGA 1W0UA 5EYRA 2NS7A 2XPWA 3M3YJ 1HF0A 1FJLA 3BT9A 1QRYA 1XC5A 9ANTA 2L0KA 5F0CA 2XSDC 5GPCA 5F0HA 4A3CJ 2R7ZJ 4IEJA 2JA6J 3HGYA 2XGDA 1X2MA 1W0TA 3HDDA 3O8GA 4IHWA 1MSEC 1WGXA 2O9LA 3GTQJ 4MO7A 1MBKA 4GFBA 5IYCJ 1IJWC 3S2DJ 4CYCA 3S16J 1IC8A 5C44J 1MH3A 5IYDJ 2VKEA 3RZDJ 2VUMJ 1EF4A 3LSPA 2ZB9A 1IGNA 2XB5A 2M9HA 5J1RA 2H8RA 3DCFA 3BTCA 2IBDA 1ORKA 2Y30A 4C3JJ 1XS9A 1VI0A 2R93J 2FJ1A 5IYBJ 5IP6A 1FEXA 2KT0A 3PO3J 4FE7A 3LSGA 2OF7A 3S14J 1WPKA 2DN0A 3BR6A 1ETOA 3FKIJ 4C3IJ 2CQQA 5FLMJ 5M3FJ 1H89C 1QVTA 4J19A 2XPUA 4C2MJ 3CCYA 4UUTA 1IV6A 1TWHJ 3I4NJ 1U9NA 5BNGA 4CYCB 1IG7A 2IAIA 2RAEA 2O7OA 3JR9A 1R9TJ 4M3EA 1TWCJ 3K7AJ 1G2HA 1A5JA 1RESA 2K9NA 5C4XJ 1I3QJ 1Y1VJ 1TWAJ 2LP0A 1JTYA 1BW6A 1A6IA 4DZPA 1WH7A 4FISA 3HM5A 1JJ8C 1ETQA 2D5VA 3Q0UA 1NTCA 1ZTRA 3JRBA 3GTPJ 2FX0A 2FD5A 3F0CA 2LR8A 3BR1A 3S15J 5C3EJ 4MFDA 3HOXJ 3I4MJ 3Q0WA 2K40A 3BTLA 2E2HJ 3OOUA 4D7NA 5K7ZA 4XRSG 4JP0A 3NARA 1NK3P 2DMTA 2LD5A 2JA5J 2CRGA 3M4OJ 4V2GA 2YS9A 4QSHA 2EQRA 3HOUJ 3L1PA 3BR3A 2DTZA 3QPSA 3ZOBA 1JUPA 3GTLJ 2M0CA 2OPTA 4XRSA 5E3MA 2MGQA 1HCRA 3MVPA 2K9SA 2WV1A 1OFCX 1P7IA 2I10A 5JLWA 3A01B 1JKOC 2L9RA 3RQIA 1BW5A 2LLKA 2GBYA 2X9DA 4A3DJ 2Y0SN 5IOZA 3CDLA 3G1LA 1RKWA 2DA7A 3HKZN 3S2HJ 2DA1A 5FKOA 1DU0A 3HOWJ 1MBGA 4B1RA 2VI6A 2LFBA 4D5FA 3BG9A 4A3EJ 1H8AC 1Y1WJ 5JLXA 1X58A 5FKNA 2EZKA 2M34A 2ME6A 3SJMA 4A3FJ 2JN6A 3CMYA 2PMZN 2QF7A 2X48A 3W6VA 5FJ8J 3JRHA 5EGOA 2DJNA 3K2AA 1E3OC 2GM4A 2NOGA 2Y9YA 5IOYA 3BTIA 1GT0C 1MNMC 5HODA 1T56A 1DU6A 1ENHA 5M5WJ 2E1OA 4W1UA 4A3MJ 4EEFG 2CJJA 4I6ZA 1B8IB 5IP9J 3PO2J 1FIPA 5EZHA 1SFOJ 3JRDA 2XPVA 2ELKA 1Z0XA 2YUSA 4A93J 5F04A 3NAUA 1WI3A 1MBHA 1IRZA 3DEWA 5C4JJ 2ECCA 3HB9A 2GLOA 2XGEA 1F43A 2MSYA 3BQZA 2CUEA 4IHVA 1JKQC 3PM1A 2N8GA 3FIWA 1RETA 4BY7J 4A3IJ 1GV5A 3A03A 5EDNA 5EGOB 5F27A 3GTOJ 2H1KA 1JT0A 3JRCA 1GUUA 1OCTC 3SFIA 2AO9A 4JX4A 2EBIA 1JKPC 2HQ5A 3ZQLA 2ECBA 5GPAA 4V2FA 3JRGA 2R0QC 4BXXJ 5EF6A 2VPRA 4IHXA 4M3DA 3C2BA 3A02A 4LOCA 4DZJA 5E3LA 2X6OA 2E19A 3WHCA 2O8KA 3BG3A 3HEFA 3ZQIA 2ID3A 1APLC 2L7MP 1IDZA 1FTTA 1U9OA 1ZR4A 4UUSB 4DYRA 2CQXA 5J3LA 5IP7J 3JRFA 3A01A 3QPLA 2JWTA 4NDLA 5F0FA 1YRNB 3OSGA 4MLOA 5M5YJ 1UG2A 3BQYA 1VFCA 2NVYJ 3TW6A 4FCYA 2LK2A 5FLVA 4Y7NJ 5F08A 3Q0VA 3GTJJ 3HBLA 4AUXA 1JGGA 3BTJA 1AKHA 1WCMJ 5FKKA 1FTZA 4BKXA 3BG5A 1SANA 1VF9A 1LFUP 2E2IJ 2IEKA 3S1MJ 3S1NJ 4M3FA 4A3BJ 1OCPA 4JX5A 5F1JA 2KDZA 1FIAA 1NK2P 1BJZA 3TP0A 5K7FA 5M5XJ 1TC3C 2L7FP 1U78A 1MH4A 2DMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRA A;  5GP9 A;  1JJ6 C;  3H0G J;  5DS9 A;  1K83 J;  1K61 A;  2LTP A;  2VKV A;  3SDG A;  3OSF A;  1H88 C;  4X1E A;  4BBS J;  3Q3S A;  2JA7 J;  4A3J J;  1TWG J;  2Y2Z A;  3FIS A;  2DA3 A;  2R92 J;  1XG1 A;  1P7J A;  1B8I A;  2HOT A;  2WB1 N;  2DA6 A;  1U8B A;  1S7E A;  1AKH B;  1POG A;  4C3H J;  2JJ7 A;  2COB A;  1ETW A;  2FQ4 A;  4I76 A;  3G1M A;  4DYC A;  3JRE A;  2LVS A;  1T33 A;  4D7M A;  1TWF J;  1ETK A;  4ABZ A;  1BA5 A;  1RKT A;  4Y52 J;  4FTH A;  2EZL A;  1QPI A;  2E2J J;  2B63 J;  2TRT A;  3E7L A;  2CUF A;  3GTM J;  2YU9 J;  1X2N A;  3S1Q J;  5FKM A;  4QTR A;  2HDD A;  1PUF B;  3MKL A;  2NVT J;  3ZQH A;  1JUS A;  2DMN A;  4W97 A;  4FE4 A;  2DA2 A;  3FK7 A;  2EH3 A;  3IH2 A;  1RR7 A;  1AHD P;  2HXI A;  4A3L J;  1LFB A;  5J1U A;  3WHB A;  1CQT A;  1O4X A;  2JMW A;  3HOY J;  5J1Y A;  4D5C A;  4UUS A;  3D1N I;  1B72 A;  2WAQ N;  3MN2 A;  4B4C A;  2Y9Z A;  1YRN A;  3ZQC A;  1ZKG A;  1HLV A;  2TCT A;  4HNV A;  3JRI A;  1JTX A;  2MW8 A;  3TW7 A;  4QIW N;  5EG0 A;  1HDP A;  1VND A;  3IV5 A;  1ITY A;  1GVD A;  1ZQ3 P;  2NVX J;  4L5E A;  1HDD C;  4G12 A;  3O8H A;  3FK6 A;  1HOM A;  1LE8 A;  4M3G A;  1MBE A;  3G1O A;  3B6C A;  5IPA A;  2R5Z A;  2HXO A;  4BY1 J;  4BBR J;  2AHQ A;  1ZR2 A;  5EZG A;  2JK3 A;  2M2E A;  4DYQ A;  2ID6 A;  1QVU A;  1B72 B;  2XGC A;  1IUF A;  4XRM A;  3B6A A;  4RBO A;  3VPR A;  3GTK J;  3H3V K;  2DMP A;  3ZQF A;  4X6A J;  3HOZ J;  2L7Z A;  2ME0 A;  2CU7 A;  2M8G X;  5EG0 B;  3UKG A;  4XIC A;  2LY9 A;  3S1R J;  2XRL A;  5E3N A;  3LNQ A;  3CQZ J;  4AYB N;  3LOC A;  5K7H A;  4MFE A;  2LKX A;  1UHS A;  2K9Q A;  2XB0 X;  3LSR A;  4A3G J;  2W48 A;  2EZI A;  3TP3 A;  1LE8 B;  4DW6 A;  3HOV J;  4A69 C;  4JYK A;  2DMU A;  4IHY A;  2R5Z B;  4RDU A;  1I6H J;  2MG4 A;  1Z77 A;  2R5Y A;  1ZK8 A;  1AU7 A;  1RPW A;  5EEA A;  4M3B A;  5FKL A;  3RZO J;  2EZH A;  1I50 J;  2DA4 A;  2QCO A;  1MBF A;  1ETV A;  3HGG A;  4JX6 A;  1BL0 A;  1ETX A;  4MIM A;  3RKQ A;  1PUF A;  1MSF C;  1JUM A;  2DA5 A;  3GTG J;  3BR5 A;  1JT6 A;  3TED A;  1Q1V A;  1UMQ A;  2NVQ J;  4XK4 A;  1IDY A;  3BR0 A;  2HOA A;  4B3A A;  2JA8 J;  5M3M J;  4XID A;  4S0H B;  1ETY A;  3GBG A;  1MBJ A;  4A3K J;  2HOS A;  3S17 J;  2HYJ A;  2HI3 A;  1JKR C;  2Y31 A;  3LSJ A;  3OIO A;  1ZGW A;  3IH4 A;  5DTD A;  3QQA A;  4M6V A;  4AC0 A;  2R5Y B;  1F36 A;  3BR2 A;  5E3O A;  2G0E A;  1GDT A;  2P81 A;  3IH3 A;  1D5Y A;  1GV2 A;  1OJL A;  1WH5 A;  2NS8 A;  3ZQG A;  1W0U A;  5EYR A;  2NS7 A;  2XPW A;  3M3Y J;  1HF0 A;  1FJL A;  3BT9 A;  1QRY A;  1XC5 A;  9ANT A;  2L0K A;  5F0C A;  2XSD C;  5GPC A;  5F0H A;  4A3C J;  2R7Z J;  4IEJ A;  2JA6 J;  3HGY A;  2XGD A;  1X2M A;  1W0T A;  3HDD A;  3O8G A;  4IHW A;  1MSE C;  1WGX A;  2O9L A;  3GTQ J;  4MO7 A;  1MBK A;  4GFB A;  5IYC J;  1IJW C;  3S2D J;  4CYC A;  3S16 J;  1IC8 A;  5C44 J;  1MH3 A;  5IYD J;  2VKE A;  3RZD J;  2VUM J;  1EF4 A;  3LSP A;  2ZB9 A;  1IGN A;  2XB5 A;  2M9H A;  5J1R A;  2H8R A;  3DCF A;  3BTC A;  2IBD A;  1ORK A;  2Y30 A;  4C3J J;  1XS9 A;  1VI0 A;  2R93 J;  2FJ1 A;  5IYB J;  5IP6 A;  1FEX A;  2KT0 A;  3PO3 J;  4FE7 A;  3LSG A;  2OF7 A;  3S14 J;  1WPK A;  2DN0 A;  3BR6 A;  1ETO A;  3FKI J;  4C3I J;  2CQQ A;  5FLM J;  5M3F J;  1H89 C;  1QVT A;  4J19 A;  2XPU A;  4C2M J;  3CCY A;  4UUT A;  1IV6 A;  1TWH J;  3I4N J;  1U9N A;  5BNG A;  4CYC B;  1IG7 A;  2IAI A;  2RAE A;  2O7O A;  3JR9 A;  1R9T J;  4M3E A;  1TWC J;  3K7A J;  1G2H A;  1A5J A;  1RES A;  2K9N A;  5C4X J;  1I3Q J;  1Y1V J;  1TWA J;  2LP0 A;  1JTY A;  1BW6 A;  1A6I A;  4DZP A;  1WH7 A;  4FIS A;  3HM5 A;  1JJ8 C;  1ETQ A;  2D5V A;  3Q0U A;  1NTC A;  1ZTR A;  3JRB A;  3GTP J;  2FX0 A;  2FD5 A;  3F0C A;  2LR8 A;  3BR1 A;  3S15 J;  5C3E J;  4MFD A;  3HOX J;  3I4M J;  3Q0W A;  2K40 A;  3BTL A;  2E2H J;  3OOU A;  4D7N A;  5K7Z A;  4XRS G;  4JP0 A;  3NAR A;  1NK3 P;  2DMT A;  2LD5 A;  2JA5 J;  2CRG A;  3M4O J;  4V2G A;  2YS9 A;  4QSH A;  2EQR A;  3HOU J;  3L1P A;  3BR3 A;  2DTZ A;  3QPS A;  3ZOB A;  1JUP A;  3GTL J;  2M0C A;  2OPT A;  4XRS A;  5E3M A;  2MGQ A;  1HCR A;  3MVP A;  2K9S A;  2WV1 A;  1OFC X;  1P7I A;  2I10 A;  5JLW A;  3A01 B;  1JKO C;  2L9R A;  3RQI A;  1BW5 A;  2LLK A;  2GBY A;  2X9D A;  4A3D J;  2Y0S N;  5IOZ A;  3CDL A;  3G1L A;  1RKW A;  2DA7 A;  3HKZ N;  3S2H J;  2DA1 A;  5FKO A;  1DU0 A;  3HOW J;  1MBG A;  4B1R A;  2VI6 A;  2LFB A;  4D5F A;  3BG9 A;  4A3E J;  1H8A C;  1Y1W J;  5JLX A;  1X58 A;  5FKN A;  2EZK A;  2M34 A;  2ME6 A;  3SJM A;  4A3F J;  2JN6 A;  3CMY A;  2PMZ N;  2QF7 A;  2X48 A;  3W6V A;  5FJ8 J;  3JRH A;  5EGO A;  2DJN A;  3K2A A;  1E3O C;  2GM4 A;  2NOG A;  2Y9Y A;  5IOY A;  3BTI A;  1GT0 C;  1MNM C;  5HOD A;  1T56 A;  1DU6 A;  1ENH A;  5M5W J;  2E1O A;  4W1U A;  4A3M J;  4EEF G;  2CJJ A;  4I6Z A;  1B8I B;  5IP9 J;  3PO2 J;  1FIP A;  5EZH A;  1SFO J;  3JRD A;  2XPV A;  2ELK A;  1Z0X A;  2YUS A;  4A93 J;  5F04 A;  3NAU A;  1WI3 A;  1MBH A;  1IRZ A;  3DEW A;  5C4J J;  2ECC A;  3HB9 A;  2GLO A;  2XGE A;  1F43 A;  2MSY A;  3BQZ A;  2CUE A;  4IHV A;  1JKQ C;  3PM1 A;  2N8G A;  3FIW A;  1RET A;  4BY7 J;  4A3I J;  1GV5 A;  3A03 A;  5EDN A;  5EGO B;  5F27 A;  3GTO J;  2H1K A;  1JT0 A;  3JRC A;  1GUU A;  1OCT C;  3SFI A;  2AO9 A;  4JX4 A;  2EBI A;  1JKP C;  2HQ5 A;  3ZQL A;  2ECB A;  5GPA A;  4V2F A;  3JRG A;  2R0Q C;  4BXX J;  5EF6 A;  2VPR A;  4IHX A;  4M3D A;  3C2B A;  3A02 A;  4LOC A;  4DZJ A;  5E3L A;  2X6O A;  2E19 A;  3WHC A;  2O8K A;  3BG3 A;  3HEF A;  3ZQI A;  2ID3 A;  1APL C;  2L7M P;  1IDZ A;  1FTT A;  1U9O A;  1ZR4 A;  4UUS B;  4DYR A;  2CQX A;  5J3L A;  5IP7 J;  3JRF A;  3A01 A;  3QPL A;  2JWT A;  4NDL A;  5F0F A;  1YRN B;  3OSG A;  4MLO A;  5M5Y J;  1UG2 A;  3BQY A;  1VFC A;  2NVY J;  3TW6 A;  4FCY A;  2LK2 A;  5FLV A;  4Y7N J;  5F08 A;  3Q0V A;  3GTJ J;  3HBL A;  4AUX A;  1JGG A;  3BTJ A;  1AKH A;  1WCM J;  5FKK A;  1FTZ A;  4BKX A;  3BG5 A;  1SAN A;  1VF9 A;  1LFU P;  2E2I J;  2IEK A;  3S1M J;  3S1N J;  4M3F A;  4A3B J;  1OCP A;  4JX5 A;  5F1J A;  2KDZ A;  1FIA A;  1NK2 P;  1BJZ A;  3TP0 A;  5K7F A;  5M5X J;  1TC3 C;  2L7F P;  1U78 A;  1MH4 A;  2DMQ A; 
#chains in the Genus database with same CATH topology
 1Y56 A;  3H0G J;  5DS9 A;  5HLG A;  4HX8 A;  5E20 A;  5ICC A;  1ZRF A;  3MZY A;  3OSF A;  1SFU A;  1ZHF A;  4BBS J;  4A3J J;  1TWG J;  3NWS A;  3FIS A;  2EPF A;  2K4B A;  2OQR A;  4RGS A;  4M71 A;  2DFH A;  2FU4 A;  3BCB A;  4CYD A;  2R92 J;  1MDM B;  5E17 F;  1B8I A;  4XLF A;  2WB1 N;  1RR8 C;  2QQB A;  1P4W A;  1S7E A;  4GGG A;  1XSV A;  1IZ1 A;  2B0L A;  2FML A;  1X19 A;  3MD2 A;  2EFP A;  2LC2 A;  4WK8 F;  1POG A;  3MKY B;  2HVS A;  2JJ7 A;  3A2K A;  1BM9 A;  3T8R A;  1MMN A;  4KMU X;  4WXC A;  1A04 A;  2QZ8 A;  2K7L A;  3KYD B;  5L3D A;  1R71 A;  5FO5 A;  2A05 A;  2OCC H;  4A5N A;  3ZMU A;  3LQR A;  4KYW A;  4CO8 A;  2HVR A;  1YTY A;  1X2N A;  3S1Q J;  1BOB A;  5DUI A;  1BR1 A;  3TOB A;  4WX9 A;  1JUS A;  3WTY C;  4W97 A;  1TT5 B;  3A1Y A;  2CWE A;  2DA2 A;  1I39 A;  5D5W B;  2A6E F;  1STZ A;  2VQG A;  1MMS A;  3PL8 A;  2IA2 A;  4DYQ A;  3HPH A;  1O4X A;  3ZCO A;  4XN0 A;  3ABL H;  4IPA A;  3FMR A;  2EFW A;  2ZXH A;  2PMU A;  4XQF A;  3MN2 A;  3DEE A;  4B4C A;  2LOO A;  3HTS B;  2V1X A;  3OYM A;  1YRN A;  1SVO A;  4KNY A;  3JTH A;  4HNV A;  2IGN A;  3QYB A;  3M07 A;  3L2W A;  1YE9 A;  2MW8 A;  4QIW N;  4MHG A;  1VQ8 I;  5H2F C;  2X51 A;  2G7H A;  5BQT A;  1TNT A;  1FZP B;  2XUB A;  4E7I A;  3O8H A;  3FK6 A;  2DBB A;  2KIQ A;  5IPA A;  3FXK A;  3C7J A;  1DP7 P;  2B7E A;  1UHW A;  3CTA A;  1W1W E;  3RJP A;  3MMY B;  4AYB A;  1VQP I;  1BOA A;  2LY1 A;  4F52 A;  1UEL B;  4A5M A;  1XMK A;  2DYS H;  4XRM A;  4RBO A;  3GLX A;  2VE8 A;  1XN7 A;  2CYY A;  5CVJ A;  2DMP A;  4CCJ A;  2QQ9 A;  1I3A A;  1QA6 A;  2L7Z A;  2ME0 A;  3KZY A;  1MJA A;  2M8G X;  2FOW A;  1YHQ I;  2VC1 A;  2KJC A;  2KP6 A;  3FXJ A;  4KUM A;  1BI2 A;  2LY9 A;  4A2U A;  5K5R A;  4XIC A;  3FMS A;  3QP6 A;  1UCR A;  3DPT A;  5KK1 A;  5ED4 A;  2LKX A;  1UHS A;  1RRJ A;  1YIT I;  4IRH A;  4A3G J;  1F9N A;  4RM2 A;  4DW6 A;  4II3 A;  1LJ9 A;  4JYK A;  3TOA A;  3J80 K;  2WB1 A;  4RDU A;  2F5D A;  4PSX A;  4ZYH A;  1ZK8 A;  2CW7 A;  1SEU A;  3RZO J;  3H5R A;  1DDN A;  1IV8 A;  1HKT A;  2ETH A;  2QCO A;  1RC9 A;  4PJM A;  3U1K A;  1MBF A;  3HGG A;  4JX6 A;  1XSD A;  1BL0 A;  2BOL A;  4CCN A;  2VKD A;  4B3X A;  1ETX A;  4MIM A;  1PUF A;  3CCQ I;  1D5V A;  4B47 A;  3EUA A;  2ZSI B;  3F3X A;  2DDA A;  2VPL A;  4EMS A;  2JA8 J;  4KN4 X;  2CQK A;  2EIJ H;  4XID A;  3OIQ A;  2V1U A;  5DD8 A;  4YG2 F;  1FBU A;  5E8G A;  1Y8R B;  4A6D A;  2JUC A;  1KU9 A;  3S17 J;  5LEK A;  5HS9 A;  2W84 A;  1JKR C;  2EJR A;  2Y31 A;  4M9Z A;  1ZGW A;  3IH4 A;  1QNT A;  1QBJ A;  2VIX A;  4M6V A;  4AC0 A;  3GZ6 A;  2JRT A;  1GDT A;  2Q0O A;  3VYT B;  5CVV A;  3FF5 A;  2V26 A;  2ZFW A;  3KLO A;  3RPQ A;  4CZC A;  3ECO A;  5EYR A;  2R4G A;  1I6X A;  3BZ6 A;  3M1E A;  3KX2 A;  2NVU B;  1V4R A;  3LSI A;  4XOT A;  1Z7U A;  2QKM B;  3CUO A;  3HTU A;  4MQV A;  5FFZ A;  4A3C J;  2NOJ B;  4ZJZ A;  3GZN B;  1FMW A;  2HKX A;  3DEU A;  2HS5 A;  4BQO A;  5L3B A;  1JI8 A;  3ABU A;  2OD5 A;  5FD5 A;  3RTR A;  4KA4 A;  1TQI A;  1TLH B;  1R00 A;  5B1B H;  5JFR A;  1MSE C;  4UV9 A;  4PJL A;  4U7B A;  1MMD A;  3GW2 A;  2FQ3 A;  1FYK A;  4BE0 A;  1WZ2 A;  1WJ5 A;  5IYD J;  2VKE A;  2OCE A;  3RZD J;  2A3S A;  1EF4 A;  3EUH A;  1IRF A;  2F2E A;  3LSP A;  3EUH C;  4RAF A;  1IGN A;  2P7V B;  4JK1 X;  2L4A A;  2ZKZ A;  3U9G A;  2AXT C;  2IBD A;  3CF2 A;  4RB0 A;  4C3J J;  1VI0 A;  1LFP A;  2W25 A;  5A2Q Z;  1P2F A;  2DAO A;  2OC6 A;  2PX9 A;  4FE7 A;  3TQN A;  2OF7 A;  3TO6 A;  3K9T A;  1H89 C;  1R1U A;  5M3F J;  2VBY A;  1A31 A;  2XIG A;  2W7N A;  1KYZ A;  4C2M J;  3HSF A;  3CCY A;  4UUT A;  5HLI A;  3J7A O;  2GWR A;  1JXS A;  3CJQ B;  1EV7 A;  3K2Z A;  2A69 F;  4I09 A;  3L2V A;  4XLP F;  4MTE A;  5GAD J;  1D8K A;  2LBF B;  1T98 A;  4WCG A;  4GRI A;  3KYL A;  1R9T J;  3KYC B;  3CCL I;  3K7A J;  1G2H A;  1S9H A;  3G4S I;  4V19 K;  3V7R A;  5C4X J;  2R7O A;  3D5R C;  1XTA A;  2LP0 A;  2Z5U A;  1VQ9 I;  2XF7 A;  3J7A Y;  2M8E A;  1WH7 A;  5DCM A;  2XGX A;  1JJ8 C;  1NTC A;  2WY8 Q;  3GTP J;  2FX0 A;  2B9S A;  3JW4 A;  3SZG A;  2X6X A;  2LNB A;  2LR8 A;  4XM3 A;  1PUE E;  1LB2 A;  5C3E J;  1P4A A;  1FBQ A;  1B6A A;  3N97 A;  3CC4 I;  2FBK A;  4A0Y A;  3HC7 A;  4L9N A;  2KMU A;  2EB7 A;  5K7Z A;  4JP0 A;  3NAR A;  1NK3 P;  2DMT A;  2CRG A;  4HW0 A;  4M6X A;  4BEH B;  2E7X A;  4WWC A;  1YFH A;  2V4J C;  2ISY A;  1KQ0 A;  3HYI A;  1Z9C A;  1T6S A;  5LHI A;  3CCJ I;  4A6E A;  3CDH A;  1JUP A;  2F48 A;  2OPT A;  2RQP A;  2LKS A;  4ZYA A;  3A4C A;  2ZXJ A;  1IW7 F;  3BY6 A;  1HSJ A;  2VBX A;  3CUQ A;  3L00 A;  3V7C A;  3K4C A;  1LEA A;  4P9F A;  1BR4 A;  5DCM B;  1P7I A;  1IO2 A;  2ZO4 A;  4EJV A;  2I10 A;  2X1E A;  3I5U A;  2NAZ A;  3L09 A;  3SHF A;  1KA8 A;  2MFZ A;  3GYH X;  1KGS A;  2BVM A;  1N78 A;  3MKW B;  2VJJ A;  2GBY A;  2LF7 A;  3DU5 A;  1BC8 C;  2R7T A;  2VXD A;  1BN5 A;  3E6M A;  2E5N A;  1OR7 C;  1VQL I;  3OV8 A;  2O0Y A;  2WTE A;  3G1L A;  3KLN A;  1YJN I;  2DFF A;  4YRV A;  2ICW G;  2XRN A;  5ERI A;  5FKO A;  2JSC A;  3S2W A;  5KCM A;  1S29 A;  4AD9 A;  4B1R A;  3QYE A;  2LFB A;  5JHU A;  4D5F A;  3BG9 A;  1E3P A;  4O6J A;  1X1B A;  1LVK A;  1YLF A;  3ULQ B;  1X58 A;  4KIB A;  5H20 A;  2ME6 A;  3HL2 A;  4ON0 A;  2ZJQ F;  2QKL B;  1G59 A;  4KMF A;  2A68 F;  3J81 Z;  1VTN C;  2ZCW A;  3CMA I;  3OY9 A;  3CUQ B;  4B8X A;  2DQR A;  2H6C A;  3I64 A;  2KJB A;  2BVL A;  3DV8 A;  3KP6 A;  2EIM H;  2Z2S B;  4HG2 A;  4FQG A;  1MNM C;  2HOE A;  1GT0 C;  1J09 A;  2QQA A;  4QPO A;  4E6K G;  4ASN A;  1ZEL A;  2DCE A;  4OIR F;  4DJA A;  1V54 H;  3WTT C;  2DT5 A;  2G9W A;  2LH9 A;  3JRD A;  3DPU A;  1FOW A;  2MD0 A;  3FHN A;  2RKH A;  1Z0X A;  3CF5 F;  3REO A;  2V6E A;  4BQA A;  1LUJ B;  3DTE A;  4UVA A;  1O3R A;  2L2O A;  2UXX A;  2MH9 A;  3HB9 A;  1J59 A;  3S3M A;  3QYF A;  3ZRG A;  1FOK A;  4Z6Y A;  4E7L A;  2FF4 A;  2N8G A;  1RET A;  1ULY A;  3SFZ A;  2L9S A;  3CME I;  3A03 A;  5BMZ A;  3F23 A;  3JRC A;  4OIQ F;  2E5Z A;  2AO9 A;  1LPQ A;  1NG6 A;  4XKV A;  4II2 A;  4XRF A;  2V79 A;  2R7Q A;  4DIQ A;  3FKJ A;  3JRG A;  2WAF A;  4BXX J;  2VPR A;  1Q1H A;  4IHX A;  4PCQ A;  5FRO A;  3A02 A;  1WJF A;  2DOA A;  3RIR A;  2E19 A;  3I59 A;  1W36 D;  2O8K A;  1WFX A;  2EIK H;  3HEF A;  4IQ4 A;  1YS7 A;  2ID3 A;  1APL C;  3K4J A;  1IRG A;  3OMY A;  1OKR A;  3LQQ A;  2ZC2 A;  4UUS B;  1ZRD A;  2KIM A;  3E3V A;  2VJ4 A;  4D1Q A;  2VOD A;  3JRF A;  3R60 A;  3H0D A;  1YW8 A;  3FXQ A;  2KLO A;  1X3U A;  2V1N A;  3PSF A;  2MYS A;  2M1B A;  2WC2 A;  2K4J A;  5E79 C;  4BS9 A;  4EM0 B;  1UG2 A;  1IF1 A;  3LFU A;  4RAY A;  2NVY J;  2Y69 H;  3HIF A;  4FCY A;  3MAJ A;  1S7O A;  2E71 A;  2X0L A;  3IKV A;  4HAM A;  1KON A;  4N0B A;  2QWW A;  4B44 A;  1R5G A;  2VJ5 A;  2VQH A;  3BTJ A;  3CP8 A;  2F5E A;  1MMG A;  1XGO A;  3DPL C;  4BU2 A;  2JZY A;  2IS4 A;  3E5X A;  2E2I J;  5J4V A;  2VQC A;  2XAQ A;  1S72 I;  3S1N J;  2XAF A;  2BW3 A;  1EH7 A;  3I59 B;  5E1Z B;  5TGT A;  2VQL A;  3BOQ A;  5M5X J;  4I0A A;  2DMQ A;  3KP7 A;  4XLA A;  3JRA A;  1D1C A;  3BG6 A;  1K83 J;  1K61 A;  3H1C A;  1H0M A;  3FZV A;  3ESW B;  2BY0 A;  2VON A;  1RUN A;  1V5F A;  2M3A A;  4IHT A;  4CXF A;  4OU0 A;  4C9Y A;  4HEA 2;  1P7J A;  3CCV I;  1U8B A;  1H9T A;  5L3E A;  2BY1 A;  5GAE J;  3IP4 B;  1W5C C;  4BXF A;  2JVH A;  3GX4 X;  3CLQ A;  4FHT A;  2FQ4 A;  4M73 A;  5A2Q K;  2M45 A;  3TMO A;  1W5T A;  3K1M A;  4D7M A;  1D1A A;  2BHZ A;  3WTW C;  1PP7 U;  2W85 A;  3M8E A;  4ABZ A;  3J7Z I;  3BDD A;  4Y52 J;  2L01 A;  1RUO A;  2EZL A;  4XBF A;  3WOD F;  2LRE A;  2H6B A;  2DTR A;  4LGW A;  1F5T A;  3E97 A;  3BRO A;  1ZH5 A;  2TRT A;  4G6T B;  4E7H A;  2CUF A;  3T8T A;  1YJ9 I;  1R1V A;  4AVZ A;  2HDD A;  3ZQH A;  1TT0 A;  2KIF A;  2DMN A;  4C2U A;  3HRT A;  2XC7 A;  2BY2 A;  3ZXS A;  2RN7 A;  2EH3 A;  3IH2 A;  3O3K A;  4A3L J;  3WHB A;  2XF6 A;  2Z33 A;  2XVC A;  1BIB A;  1P9Q C;  1CQT A;  2JPC A;  4UXN A;  3ZMT A;  5KAF C;  3HOY J;  2VOO A;  3OL3 A;  4YIR X;  2HZT A;  1ACI A;  3OIP A;  2KZV A;  5TIS C;  2Q2E A;  2DPD A;  1B72 A;  1B1B A;  2WAQ N;  2Y9Z A;  3MKZ A;  3GXO A;  1ZKG A;  3PIP F;  2TCT A;  2A6H F;  1ZYR F;  1U5T A;  3KET A;  1U0J A;  4M9S A;  3TW7 A;  1U5T C;  3F22 A;  2O3F A;  3ZMD A;  2O61 A;  4NNJ A;  5F64 A;  1OCZ H;  3I55 I;  3IUO A;  3PNV A;  3OYH A;  3K70 C;  3OYJ A;  1XPX A;  2NVX J;  1FNN A;  4ITV A;  2IA1 A;  4G12 A;  3AG1 H;  4G7Z F;  1LE8 A;  1HOM A;  3G1O A;  1O7L A;  1WSU A;  1FMV A;  1HQC A;  1ZLJ A;  3RYP A;  4GDF A;  4P96 A;  1KU7 A;  2JK3 A;  2M2E A;  3H92 A;  2GXG A;  3P9I A;  2LYC A;  2ID6 A;  1G3Y A;  2F4O B;  2VT2 A;  2XKP A;  3LA2 A;  3RCO A;  1T95 A;  3KP2 A;  4LG3 A;  1DGR M;  4NBQ A;  4GYG A;  3K10 A;  2ISZ A;  3M1C A;  1B72 B;  1R4M B;  1F4K A;  1DPU A;  2BY3 A;  4Y15 A;  3I58 A;  4X6A J;  3HZJ A;  4N9H A;  4RGR A;  4BAC A;  4ENN A;  2XAH A;  1YW7 A;  1U5T B;  2CU7 A;  1WHU A;  2PJR B;  3UKG A;  4B09 A;  3ONQ A;  1FWZ A;  3F21 A;  3WU1 B;  4UB8 C;  5E3N A;  3CQZ J;  4AYB N;  4HRI A;  3OYB A;  3LOC A;  3VYR B;  4Y17 A;  2XB0 X;  1XGS A;  2EZI A;  4RB1 A;  3TP3 A;  1LE8 B;  3HOV J;  4GO1 A;  4A69 C;  3J81 K;  3OYC A;  3V8L A;  5H6R A;  4XLN F;  3GCM A;  1I6H J;  1D8J A;  2MG4 A;  3F8M A;  2VL8 A;  4B43 A;  4YII A;  4XL9 A;  1G6N A;  4DGW B;  3KZZ A;  2KQR A;  4U87 A;  5LBQ A;  1I50 J;  3ZMV A;  1Z05 A;  4HOB A;  4LIT A;  4BUP A;  2ELJ A;  1GHC A;  1R6R A;  3MFK A;  1TNS A;  2P5L C;  1JT6 A;  3TED A;  2EWN A;  1DUX C;  2LKP A;  2NVQ J;  1CF7 A;  1BI1 A;  3BR0 A;  4B3A A;  2K3F A;  3I56 I;  1ERD A;  4JOM A;  1FPQ A;  4BJ6 C;  3M7G A;  3OWT A;  5ILU A;  1ZRE A;  4S0H B;  3V8J A;  3VOE A;  3CES A;  4HF1 A;  2STW A;  1WVR A;  5IY5 H;  4A3K J;  1MBJ A;  3P9C A;  3FHZ A;  4ZDO A;  3CCR I;  4BDZ A;  1FOY A;  1OIS A;  4G6Q A;  1G8X A;  5DTD A;  1PYV A;  3M8F A;  5L3G A;  4C30 A;  4IOC F;  1J2X A;  4HYE A;  5J4Y A;  1W7P A;  3BR2 A;  4UVB A;  2UZK A;  2HEO A;  2G0E A;  1MZB A;  4AM3 A;  3VDX A;  4IHS A;  2P81 A;  1D5Y A;  1GV2 A;  2NS8 A;  2OU2 A;  3KIO A;  4Y33 A;  3ZQG A;  3DQV C;  3PIO F;  1W0U A;  2XPW A;  1MKM A;  2V9P A;  2WAQ A;  3M3Y J;  2CUZ A;  1YYV A;  1MND A;  3DP7 A;  4UVC A;  3HOS A;  1VQ4 I;  2OZU A;  2V6C A;  3HPG A;  3IAM 2;  2Z16 A;  1CF7 B;  2NYX A;  1QRY A;  2DOE A;  9ANT A;  3FXO A;  2XSD C;  4LLN A;  4AWX B;  1FYM A;  2CSO A;  3R6S A;  3TBI A;  5EJC A;  4LJZ F;  1X2M A;  3DTK A;  4EJO A;  2KZG A;  4L9J A;  4IO9 F;  3FXU A;  1W0T A;  5E18 F;  4HF2 A;  1JHH A;  1WJE A;  5HNH A;  3F6V A;  2HGC A;  2O5R A;  4LFU A;  4XLC A;  4IL6 C;  1X1D A;  5CJ9 A;  4GFB A;  5J8F A;  2Y48 A;  1IJW C;  2FNA A;  2VJI A;  4CYC A;  1W7P B;  3S2D J;  1FSE A;  3OL4 A;  1MH3 A;  1X4P A;  3ELK A;  2HYF A;  5FRN A;  2VKH A;  4FX4 A;  3BP8 A;  5KHD A;  5K1Y A;  2XB5 A;  4LG0 A;  2F6C A;  5D5V B;  3WGH A;  2RQQ A;  2H8R A;  2DFE A;  4AU7 A;  1J9I A;  1IXC A;  2DQL A;  2K27 A;  3BTC A;  3HSE A;  3TDU C;  4HQM A;  2OUM A;  4QLC U;  3KP3 A;  3JCU C;  2QQ8 A;  5IYB J;  4XNF A;  3PO3 J;  2AS5 F;  2OQG A;  4I0B A;  1KQ9 A;  1WPK A;  5GAG J;  4BGD A;  2IS6 A;  2CQQ A;  2KRC A;  4I7H A;  3OYN A;  1QVT A;  4PK4 A;  2PG4 A;  2XPU A;  5D5X B;  2ACJ A;  4MNU A;  3G3Z A;  1Y39 A;  4PDK A;  3I54 A;  3I4N J;  4CYC B;  5J8C A;  4L5J A;  5DYM A;  4PZJ A;  2D45 A;  1BR2 A;  4M3E A;  4P55 A;  3K4N A;  2VLA A;  4IXA A;  5TJJ A;  1QZE A;  4U7D A;  1Y1V J;  3AG4 H;  2ESH A;  1JTY A;  4LG0 B;  3C1D A;  1A6I A;  3E0J B;  3RPU A;  5ILS A;  3Q0U A;  2GA2 A;  1ZTR A;  2D5V A;  3TO9 A;  4DBR A;  3LST A;  1HW1 A;  3NRV A;  2FD5 A;  1L3L A;  1SD4 A;  2K85 A;  1PVE A;  1IAW A;  1WQ2 A;  4HV6 A;  2JA2 A;  3GF2 A;  4YEL A;  3WU2 C;  5D6E A;  3Q0W A;  4CH7 A;  1QZZ A;  2K40 A;  3OYD A;  3KCC A;  3OOU A;  1T38 A;  2LD5 A;  3I3L A;  3IRQ A;  2JA5 J;  1HKQ A;  2X6W A;  5FRM A;  3KE2 A;  3ROU A;  1FOX A;  2Y0S A;  4QSH A;  2EQR A;  3RI4 A;  4XOP A;  2HWV A;  4P9U A;  3L1P A;  3BR3 A;  3QPS A;  2GOM A;  3QAH A;  2OTJ I;  4BJT A;  3MVP A;  2K9S A;  2PFB A;  5EEG A;  3OOP A;  2VE9 A;  2K9L A;  1IN8 A;  5JLW A;  2A6T A;  1JKO C;  2L9R A;  3RQI A;  1BW5 A;  5DEQ A;  2ESN A;  4NUB A;  4A3D J;  2CV0 A;  3ISP A;  4CZZ A;  4Z2Y A;  3RPU D;  4ESF A;  1YG2 A;  1V55 H;  2DA7 A;  4BQQ A;  1JGS A;  4XR6 A;  4E7S A;  4HX4 A;  3T5X A;  3CMM A;  4ESB A;  1DU0 A;  2MAB A;  2M0M A;  2GZW A;  2STT A;  2V9K A;  4ANJ A;  1BI3 A;  4OIN F;  3G2B A;  1Y1W J;  4CDG A;  1ZAO A;  3NEU A;  3IRR A;  2OZ6 A;  1ON2 A;  2EZK A;  2M34 A;  3HHG A;  1K4S A;  1T0F C;  2JN6 A;  1YIO A;  2PMZ N;  4LIU A;  1HW5 A;  2C6Y A;  2X48 A;  4FAS D;  3O2P E;  3W6V A;  4EQQ A;  5CQG A;  2DI3 A;  4LD5 A;  1E3O C;  4IRI A;  5K5O A;  2NOG A;  2KPM A;  3WTZ A;  4XSX F;  3VSK A;  4E7Z A;  2BHY A;  2DU9 A;  1S7A A;  1DU6 A;  1KQ8 A;  2XAS A;  5HS8 A;  2IXS A;  2JTV A;  2LBF A;  2D1H A;  2R7D A;  2P0W A;  4JBA A;  2PBI A;  1XGM A;  4EEF G;  4A3M J;  2CJJ A;  2R7R A;  3L2R A;  3IHU A;  1FIP A;  3E5U A;  2RNJ A;  4G7H F;  1TP4 A;  2P4W A;  1LDK B;  3AG2 H;  4OMZ A;  2XPV A;  4M72 A;  2ZNZ A;  2O6G E;  2GA1 A;  2GQQ A;  4HDU A;  4CIC A;  5LRR A;  2IRF G;  3DEW A;  2XAU A;  3ZGK A;  1F43 A;  5J47 A;  2CUE A;  2XAG A;  3L2Q A;  1BBY A;  4RMN A;  2DLL A;  1FBS A;  1FT9 A;  2DT7 B;  2F5C A;  2FE3 A;  2QVO A;  1SC7 A;  1YO5 C;  1UJ8 A;  5B1A H;  5F27 A;  1B59 A;  2DK8 A;  2H1K A;  1SD6 A;  1Z6R A;  1GUU A;  2IS1 A;  3SFI A;  4K2E A;  5B66 C;  3H35 A;  3K4B A;  4U88 A;  4BEH A;  4Q4Z F;  2YSR A;  1Z3Y A;  2WBM A;  4V2F A;  2HFH A;  3JAM Z;  4ZDP A;  2Z1D A;  3C2B A;  4LOC A;  5E3L A;  3FBN B;  1I5Z A;  1P6R A;  3BG3 A;  1D0Y A;  1IDZ A;  2L9V A;  2CH0 A;  1ZRC A;  5IP7 J;  2ZFU A;  4XKB A;  3BZC A;  3LWF A;  3QPL A;  1NG7 A;  2CO5 A;  4EV0 A;  2CMP A;  2BZT A;  1H9G A;  2R7U A;  1ZG5 A;  2PI0 A;  3GWZ A;  3QPT A;  4KIF A;  1VFC A;  3AL0 C;  2LK2 A;  4XON A;  5HLH A;  5GTH C;  3OYL A;  3Q0V A;  2RV8 A;  2ZJ2 A;  2KIS A;  3CJR B;  4AUX A;  1AKH A;  1WCM J;  5FKK A;  2AQE A;  2F5F A;  4UV8 A;  1I1S A;  2CV1 A;  3DBR B;  4NC7 A;  1MIJ A;  3BG5 A;  1SAN A;  1HA8 A;  2M7B A;  3FMQ A;  2IEK A;  4XSZ F;  3SEQ A;  2CW0 F;  1T2K A;  1LEB A;  1WJC A;  1OCO H;  3OYI A;  1VQ5 I;  3GLL A;  3P9K A;  5BOX A;  2P7C B;  3A0H C;  3H5N A;  1BJZ A;  2VB6 A;  3EDP A;  4Y4R A;  5K7F A;  2RDP A;  1TC3 C;  2L7F P;  1U78 A;  4L0Y B;  3SQN A;  3DU6 A;  2ZXI A;  4HST A;  4DBQ A;  3CO6 C;  1PDN C;  2R7V A;  4M9X A;  1JJ6 C;  3PNT A;  2QM3 A;  2P5V A;  3L9F A;  3WTX C;  2LTP A;  2VKV A;  5CPR B;  2HKO A;  2K9M A;  2P6S A;  2PMZ A;  3S8P A;  3SDG A;  4S05 A;  1OR7 A;  1H88 C;  6PAX A;  3Q3S A;  2JQ7 A;  2Y2Z A;  5DM7 F;  3AL0 B;  3DTI A;  3QU6 A;  2FRH A;  2YPR A;  2QSH X;  4M74 A;  2R3S A;  3K1P A;  1AKH B;  3FXL A;  1ZGA A;  4NB5 A;  3BLY A;  4I76 A;  4DYC A;  3RDI A;  2LSO A;  3JRE A;  3MEX A;  1T33 A;  3DKY A;  1ETK A;  4BL0 B;  1HW2 A;  2CFX A;  3RKW A;  2ZME C;  2HQR A;  1RKT A;  3WG9 A;  4BQN A;  5CYV A;  2E2J J;  2DXI A;  4U0W A;  2B63 J;  2BEO A;  3PQJ A;  1M1E B;  3TL4 X;  2NNN A;  4KDP A;  1OYY A;  3E7L A;  1SD5 A;  2H1L A;  1FY7 A;  2YU9 J;  3PUB A;  5JHF A;  3MKL A;  5ICE A;  3H5A A;  2OBP A;  3LAP A;  4FE4 A;  3ZN0 A;  1RR7 A;  1AHD P;  5LRS A;  2HXI A;  1DPR A;  4EM2 A;  1LFB A;  3OYK A;  1MGT A;  4MEY F;  4BH9 A;  2IP2 A;  2JMW A;  3OS2 A;  5J1Y A;  1X3W B;  2FNP A;  3DKX A;  2PMH A;  3GME A;  5J6X A;  4UUS A;  3D1N I;  3O6B B;  3CCM I;  2EIL H;  3IWF A;  4LMY A;  2ZME B;  1Y0N A;  5E1W A;  2RNG A;  5DM6 F;  4H0E A;  1HLV A;  2YX7 A;  2PJP A;  1JTX A;  1ODD A;  3WGG A;  1S5L C;  2YR2 A;  4GYI A;  4R79 A;  5EG0 A;  4EM1 A;  3IV5 A;  4XOR A;  1GVD A;  1GXQ A;  4HPQ A;  4NC6 A;  1A36 A;  2H27 A;  1LDD A;  4IX7 A;  4L5E A;  5DV5 A;  1HDD C;  3EPZ A;  2LG4 A;  4LIV A;  1SMY F;  1B9N A;  4A0X A;  2QYO A;  3CZ6 A;  1JHF A;  2R5Z A;  4BY1 J;  1QGP A;  3HUG A;  4BBR J;  2AHQ A;  4F92 B;  1DGW Y;  3P5J A;  4XKC A;  5CQE A;  2OJE D;  1ZR2 A;  1D1B A;  2LMD A;  4HDV A;  4XLH A;  3CD6 I;  4KIT B;  4I01 A;  2IT0 A;  2XGC A;  5E8I A;  5LLQ A;  3VPR A;  3GTK J;  2F4M B;  4E4H A;  3H3V K;  4D9J A;  2GXB A;  2X6Y A;  3AG3 H;  2XKO A;  1X4O A;  2JRM A;  3F8B A;  3VOD A;  5EG0 B;  2MLK A;  3IWZ A;  1O7F A;  2XRL A;  3LNQ A;  4E70 A;  1XX5 A;  4ENJ A;  3HOT A;  3M8J A;  3WTU C;  2K9Q A;  3BPV A;  4LB5 A;  1VQO I;  4R8H A;  2W48 A;  2GIV A;  4WXD A;  2G7U A;  2P8T A;  2DMU A;  4IHY A;  4IRG A;  3COA C;  2R5Z B;  3HUG B;  1ONV A;  2ZSH B;  1IN6 A;  1AU7 A;  2EFQ A;  4NQW A;  4L9T A;  5LHH A;  3FX3 A;  2DOF A;  3K4M A;  3KFW X;  2KIU A;  1ETV A;  2OV7 A;  1Z21 A;  3ASO H;  2IS2 A;  3OYF A;  2PQ8 A;  1OYI A;  4G8X A;  1XDS A;  3GFL A;  1MSF C;  2DA5 A;  3GTG J;  3BR5 A;  1K78 A;  1N75 A;  2J5O A;  3BJO A;  1IDY A;  4BXU A;  2HOA A;  2XF5 A;  1V3F A;  4RLF A;  3V42 A;  1YQA A;  4X0G A;  1OYW A;  2Q1Z B;  4L5I A;  4C2T A;  3C2G A;  1ETY A;  1XGN A;  2Z3Y A;  2L5Q A;  2XV4 S;  1P4X A;  3ECH A;  3GBG A;  2HYJ A;  2MLG A;  2HNH A;  3SEZ A;  3WTS C;  2M7A A;  3LSJ A;  1EH6 A;  3OIO A;  3N4M A;  4WXH A;  1MMA A;  2L4M A;  1MJ9 A;  2ZXW H;  4B48 A;  3ABK H;  5E3O A;  1SAU A;  2V7F A;  4NQW B;  4LB6 B;  1OCR H;  3P7N A;  1OJL A;  2HQA A;  4TV7 A;  1WH5 A;  3R4K A;  2EFO A;  4HX7 A;  3S3N A;  1FJL A;  1F1Z A;  3JAM K;  1K78 B;  4GCV A;  1IXR C;  2I5U A;  3BT9 A;  4A12 A;  2NNY A;  1XC5 A;  3PFY A;  5IT9 Z;  5F0C A;  5GPC A;  5F0H A;  2R7Z J;  4IJA A;  2JA6 J;  5L3F A;  3D0S A;  3IL2 A;  2XGD A;  3A0B C;  4I02 A;  4F93 B;  2K02 A;  2UXN A;  1IN7 A;  1D0X A;  1T39 A;  3HDD A;  3VWB A;  2L3D A;  3O8G A;  2FXA A;  4IHW A;  1Y8Q B;  2O9L A;  4EJW A;  4Y3O A;  3QWL A;  1R22 A;  4E7J A;  4PJN A;  1IC8 A;  1YW9 A;  4ZC3 A;  5C44 J;  4MGR A;  4KT6 A;  3W3C A;  3W2A A;  3CJN A;  2QEX I;  3C2H A;  4A0Z A;  2PJR A;  2CS3 A;  2X4H A;  3F8C A;  5DD4 A;  2E60 A;  1P92 A;  2M9H A;  3AAF A;  4OIO F;  2Q8K A;  3QPH A;  3R0J A;  4O3M A;  3OYG A;  1XS9 A;  1VQK I;  2FJ1 A;  1X1A A;  4IQJ A;  5IP6 A;  3K4L A;  4KJZ A;  1UB9 A;  2HPI A;  5CVU A;  3TKY A;  1ETO A;  1YIJ I;  3FKI J;  2ZBK A;  4C3I J;  2XHK A;  5FLM J;  1UST A;  2F4I A;  1N25 A;  4J19 A;  4CGZ A;  1IV6 A;  3V8K A;  3IC7 A;  4AIH A;  5FLX Z;  3E6D A;  4UUV A;  1U9N A;  3WU0 A;  2EK5 A;  4PFO A;  1IUY A;  2RAE A;  2O7O A;  3S32 A;  4RGU A;  4ENM A;  3E6B A;  1TWC J;  2HYG D;  1A5J A;  1RES A;  1TWA J;  1TQP A;  1XCB A;  2RGV A;  1HKS A;  3GEZ A;  3R0A A;  3KP4 A;  5D6F A;  4DZP A;  4FIS A;  5ICF A;  1ETQ A;  1V5G A;  3DLL F;  3JRB A;  2X85 A;  3I53 A;  2IA0 A;  2UUZ A;  5D5U B;  3I71 A;  3BR1 A;  3S15 J;  1FSH A;  3ZN1 A;  3K70 D;  3HOX J;  2HTS A;  2WA0 A;  2CQN A;  5E1X A;  4Y13 A;  2HU9 A;  2K86 A;  3ERE D;  3BTL A;  2OA4 A;  4YEJ A;  1OQY A;  3ZQ7 A;  3BWG A;  3EQL F;  3OYE A;  3NWT A;  2IGO A;  4N4O B;  1LQ1 A;  3K1N A;  3M4O J;  2YS9 A;  1WJA A;  2GAU A;  2VXZ A;  4CCK A;  3EUK L;  2DTZ A;  3AKZ A;  1XCV A;  4XRS A;  3GTL J;  3WGI A;  5E3M A;  1W5S A;  1C0W A;  4DOZ A;  2KKO A;  1WJB A;  3FXR A;  1ZG3 A;  4HLX A;  5FB2 A;  1HCR A;  1I1G A;  1XMA A;  2WV1 A;  5HNF A;  1OFC X;  1X3Z B;  3OS1 A;  4ETS A;  3A01 B;  1SVM A;  4HQE A;  2LLK A;  4HLY A;  2X9D A;  2COM A;  1G3T A;  2Y0S N;  5IOZ A;  2CW8 A;  2QSG X;  3F9K A;  3CCS I;  4OOI A;  3MZH A;  1WJD A;  2DA1 A;  3GFM A;  4ZYE A;  2WAD A;  5CVR A;  3HOW J;  1MBG A;  2E35 A;  5LHG A;  2A61 A;  2L02 A;  2HR3 A;  1H8A C;  1RNL A;  3D5L A;  3HG9 A;  3LL7 A;  5FKN A;  3G6E I;  1Z7L A;  3BJ6 A;  4A3F J;  3SDB A;  2EV5 A;  4OWR B;  2VN2 A;  1MNE A;  2H8W A;  1X1C A;  3N05 A;  5J40 A;  2QBY B;  4MTD A;  4OIP F;  4N4N B;  1QHG A;  2DT6 A;  5EGO A;  3HRS A;  4ZZL A;  2GM4 A;  2HPM A;  2LDU A;  5IOY A;  5LGN A;  1NHA A;  2O03 A;  4AVP A;  5HOD A;  3BZK A;  2M4K A;  1ZLK A;  4N9I A;  5M5W J;  1LDJ A;  2E1O A;  5KAI C;  5LGU A;  3L2C A;  4W1U A;  1NH3 A;  3U21 A;  1OPC A;  4DNC A;  4AIK A;  4I6Z A;  3GO5 A;  1U6G A;  1B8I B;  3WE3 A;  5IP9 J;  4PGG A;  3PO2 J;  5EZH A;  3V4G A;  1W7P D;  1UFM A;  4ZTF A;  4J01 A;  2ELK A;  2YUS A;  4A93 J;  3DKW A;  3K6G A;  3CO7 C;  1WI3 A;  4CSW A;  3DF8 A;  2BGC A;  1MBH A;  3QU3 A;  2W57 A;  4IF4 A;  3ZQQ A;  1GVJ A;  2W82 A;  2XGE A;  1UG0 A;  1E17 A;  3WE2 A;  3CDI A;  3PM1 A;  3FIW A;  3MQ0 A;  3HHH A;  4A3I J;  4ZZD A;  1EH8 A;  4PSW A;  3S3O A;  5EDN A;  1SFE A;  2ZJP F;  2BXZ A;  2R7F A;  5EGO B;  5D4R A;  5K5Q A;  2OAZ A;  1JKP C;  3CJT B;  2EBI A;  2HQ5 A;  4R1H A;  3VFZ A;  3ZQL A;  3RQ4 A;  4RA2 A;  4HV5 A;  2ECB A;  3FM3 A;  5IT3 A;  4PUS A;  3J7Y J;  2W1O A;  5GPA A;  4XMY A;  3DXJ F;  5BPD A;  3TO7 A;  2VAS A;  5HOO A;  3TGN A;  3CC7 I;  3WHC A;  4EAT A;  3K0L A;  1FTT A;  1Y6I A;  1U9O A;  1ZR4 A;  1QU3 A;  1R1T A;  4UB6 C;  1U2W A;  2JVG A;  5F0F A;  3OYA A;  1YRN B;  3Q5F A;  3OSG A;  2QGU A;  3JSP A;  4MLO A;  5M5Y J;  5D8L B;  3BQY A;  3M9A A;  4P1W A;  4Q47 A;  1B4A A;  5FLV A;  1FYL A;  4BHC A;  1R23 A;  4Y7N J;  5F08 A;  2M4G A;  3GTJ J;  3HBL A;  2WV0 A;  3OS0 A;  2E7W A;  4CCL A;  2IW5 A;  3VSL A;  5IT9 K;  2HVQ A;  2WAE A;  1VQM I;  2I8D A;  1DQU A;  2DFI A;  1VQN I;  1VF9 A;  1LFU P;  2EV0 A;  1E3H A;  1I27 A;  1K7A A;  1WRJ A;  4M3F A;  1XDU A;  5DUK A;  2QSF X;  1T08 B;  4JX5 A;  1VZ0 A;  3WTV C;  3SXY A;  2WWY A;  1FIA A;  2AXL A;  4RB2 C;  3C18 A;  2XRO A;  1MH4 A;  4G7O F;  2F5V A;  4UNO A;  2Z99 A;  5GP9 A;  5GTI C;  3GFI A;  2XSJ C;  4G9Y A;  4ZYG A;  1VQ6 I;  1XB4 A;  2IPQ X;  2W4S A;  4X1E A;  3F8F A;  2JA7 J;  2ZJR F;  2DA3 A;  2A07 F;  5HLT A;  1XG1 A;  2X1D A;  2HOT A;  3DFG A;  2PLY A;  2DA6 A;  2K5C A;  3ZP5 A;  4G94 A;  4PFP A;  5ILV A;  4EJU A;  2O8X A;  4Q5S F;  3KEO A;  4C3H J;  2E1N A;  1WWX A;  2COB A;  1ETW A;  4H4K C;  3G1M A;  1TW3 A;  4O5V A;  3KP5 A;  2LVS A;  4CUG A;  2FSW A;  1T0F A;  1TWF J;  2FA5 A;  3DWL E;  2L9N A;  1BA5 A;  2MA3 A;  2Y0M A;  5LEJ A;  4FTH A;  2XAJ A;  3Q9V A;  5CKT A;  1QPI A;  4LLG F;  2EA4 A;  4EGY A;  3U1D A;  4FX0 A;  5FLX K;  4MEX F;  2DJI A;  4HA8 A;  1SD7 A;  1PP8 F;  3GTM J;  2L54 A;  3BC8 A;  4PJJ A;  1ZAR A;  5FKM A;  4QTR A;  2NVT J;  3LA3 A;  1PUF B;  1REP C;  3IAS 2;  3ABT A;  2FEZ A;  2QUF A;  2NS0 A;  3FK7 A;  2MD5 A;  4BE1 A;  5J1U A;  2RVC A;  4ESJ A;  1LVA A;  1IRX A;  4D5C A;  1A6Q A;  2JT1 A;  4LK1 F;  1J5Y A;  3EYY A;  2J5P A;  3UNG C;  2IJL A;  4L18 B;  3NQO A;  3ZQC A;  1OCC H;  1YX3 A;  3JRI A;  3RKY A;  3H3U A;  1MD0 A;  4HNT A;  1V5E A;  1HDP A;  1VND A;  2ELH A;  2A5Y B;  1Z67 A;  4XN3 A;  2VC0 A;  2CGP A;  1ITY A;  2KFD A;  5L3C A;  1ZQ3 P;  1TZL A;  2PN6 A;  2QA4 I;  1FC3 A;  3ZMS A;  2JSP A;  4M3G A;  4UY8 I;  1MBE A;  3B6C A;  3FBI B;  2HXO A;  3CC2 I;  3RKX A;  5JVT A;  3OR1 C;  2GIZ A;  3G71 I;  3X2Q H;  5EZG A;  2R7W A;  1MW7 A;  1QVU A;  1SMT A;  1BI0 A;  3CP2 A;  3PNY A;  1IUF A;  1KU2 A;  3B6A A;  4Q48 A;  3L7W A;  3ZQF A;  1OMI A;  4OAY A;  4IKF A;  1AA7 A;  3HOZ J;  1O3S A;  2YU3 A;  4GXO A;  3DLA A;  3E5Q A;  4OAZ A;  4EGZ A;  1HC8 A;  4I99 C;  3L2U A;  2LF8 A;  4KIS A;  3W2V A;  1QQI A;  2V9V A;  1VQ7 I;  3CLO A;  3S1R J;  3RYR A;  1RIO H;  3QOD A;  2M30 A;  1YS6 A;  2JPB A;  5K7H A;  2KHM A;  4MFE A;  3LSR A;  2EA2 A;  2GOX B;  2BBY A;  3GUD A;  4BHB A;  1D0Z A;  2D1V A;  1UAA A;  2FBI A;  1Z77 A;  2R5Y A;  4L9V A;  2DOD A;  1X1P A;  2H09 A;  1RPW A;  5EEA A;  4M3B A;  5FKL A;  3E6C C;  2HDW A;  3GZ5 A;  2EZH A;  3GFJ A;  2DA4 A;  3U2R A;  1ZGJ A;  1CGP A;  2P6T A;  4YFN F;  5CVI A;  1UHM A;  3PUF A;  4KT5 C;  4ZYD A;  1J75 A;  1S6L A;  5EEH A;  2GXA A;  2Z9O A;  2AQF A;  3RKQ A;  5DCF A;  2PEX A;  1JUM A;  5HS7 A;  1Q1V A;  1OLT A;  1UMQ A;  2M87 A;  3GVA A;  4XK4 A;  3CCE I;  3RSN A;  4L0Z B;  3KEQ A;  5HDN A;  1D3Y A;  5M3M J;  3BPX A;  4LK0 F;  3CUQ C;  1J7K A;  3CCU I;  2HOS A;  1MJB A;  1QHH D;  2HI3 A;  5B5E C;  2H94 A;  1K6O A;  2BV6 A;  2VOP A;  2DDB A;  3V7S A;  3G73 A;  2UV1 A;  3QQA A;  2IGK A;  3B73 A;  3ZPL A;  1TQM A;  2ZME A;  2BE5 F;  2R5Y B;  1F36 A;  1G3S A;  3ZR8 X;  5JR3 A;  4HSR A;  3VYS B;  1Z6T A;  3IH3 A;  2NRA C;  1U3E M;  4IOA F;  5F1R A;  4BNC A;  2CFO A;  3PSI A;  2NS7 A;  4RAZ A;  3MWM A;  4BE2 A;  4F3Q A;  2EIN H;  1HF0 A;  1R4N B;  3TDZ C;  3HSR A;  4YIF A;  1ON1 A;  1A35 A;  4S04 A;  2L0K A;  1AOY A;  5LGT A;  2CQ7 A;  3QOE A;  4IEJ A;  3K69 A;  2HQN A;  2QEN A;  1YI2 I;  1B9M A;  3HGY A;  3T0Y A;  5D8K B;  3Q9S A;  1TW2 A;  1BIA A;  5KVR A;  2IGM A;  2E1M C;  1WGX A;  2IVM A;  4MO7 A;  3GTQ J;  1MBK A;  2L7K A;  1WKM A;  5IYC J;  4FET A;  3S16 J;  1KU3 A;  1W36 C;  2ZNY A;  3R61 A;  2VUM J;  3H9G A;  4KIC A;  5B3S H;  3JSO A;  2KRF A;  1FLI A;  3MZ8 A;  3DBL B;  2WY7 Q;  3F8N A;  2HZD A;  2ZB9 A;  2YX4 A;  3SZP A;  1HST A;  5D4S A;  1U8R A;  5J1R A;  3DCF A;  1K79 A;  1EA3 A;  1W4M A;  1WI9 A;  3KZI C;  3W6J B;  1ORK A;  2Y30 A;  3JTG A;  1SAX A;  2R93 J;  3VEP A;  4M6Y A;  4RLQ A;  4U0V A;  4BDY A;  3FWE A;  1FEX A;  1R36 A;  1Z1D A;  2KT0 A;  3LSG A;  4F91 B;  3S14 J;  4ZDL A;  2VT3 A;  2DN0 A;  3BR6 A;  3I0T A;  4RS8 A;  5FGM A;  3W2W A;  4CCO A;  2W00 A;  4U0Y A;  2E1M B;  1J0R A;  2DPU A;  4HNU A;  1TWH J;  3LA7 A;  1PJR A;  2FBH A;  5BNG A;  1GXP A;  1IG7 A;  2IAI A;  1T8I A;  4RM3 A;  3H9J A;  3JR9 A;  3QOP A;  4PJ0 C;  2UWM A;  1ZN2 A;  2NXN B;  4F55 A;  2K9N A;  2KRH A;  1I3Q J;  1E2X A;  1XSX A;  3AFH A;  1BW6 A;  2LY2 A;  1AWC A;  3HM5 A;  2KL4 A;  1GLN A;  3PFI A;  2DK5 A;  1TBX A;  2MH2 A;  4NHJ A;  3F0C A;  1TTY A;  1LKX A;  4RB3 C;  4MFD A;  5HDG A;  3I4M J;  2E34 A;  3I4P A;  3T1B A;  2E2H J;  2P5K A;  4D7N A;  2LRD A;  4XRS G;  1L0O C;  3MCZ A;  5KNL A;  1K4T A;  3BCA A;  1USS A;  1Z3X A;  4BAY A;  4V2G A;  4HBL A;  3ERM A;  3H3Z A;  3K4K A;  1ZG1 A;  5AIP A;  2VBW A;  3HOU J;  1IXS B;  4CA0 A;  3ZOB A;  1DP3 A;  2DO7 A;  2M0C A;  2CUJ A;  2EFN A;  1RI7 A;  2MGQ A;  3LSK A;  4D0P A;  2HDC A;  4AIJ A;  1BJA A;  3ABM H;  1IN4 A;  4G6D A;  4IVN A;  4KIG A;  3HRU A;  1YJW I;  1R49 A;  1HXD A;  5CLS A;  4LLL A;  1BC7 C;  4PGH A;  3B02 A;  1S8N A;  3BG7 A;  3WG7 H;  1O3T A;  2R7S A;  3S93 A;  4EVI A;  2W24 A;  2FMY A;  3D5S C;  4XLE A;  3CDL A;  3VB2 A;  1IN5 A;  3ML6 A;  1RKW A;  2OTL I;  2K3P A;  3HKZ N;  3S2H J;  3E1S A;  4XKW A;  4HF0 A;  1JE8 A;  5GAH J;  3LSH A;  4QWQ A;  1G3W A;  3FXM A;  2VI6 A;  5ICG A;  3QRF F;  4QPQ A;  4A3E J;  4RGX A;  1RZ4 A;  5JLX A;  4I98 B;  3LFK A;  3KEY A;  3DBH B;  2JUG A;  5LFA A;  3SJM A;  2CV2 A;  2FUG 2;  4E7K A;  3QP5 A;  3CMY A;  2QF7 A;  2BW3 B;  1G4D A;  1XMX A;  3J80 Z;  4KN7 X;  4ENK A;  1QZY A;  3LSM A;  1UZC A;  3H9Q A;  1HBX G;  1R58 A;  3PJR A;  5FJ8 J;  2TDX A;  3JRH A;  2DJN A;  4DQ2 A;  3K2A A;  4HZF A;  3PQK A;  4AID A;  2Y9Y A;  1SFX A;  2HTJ A;  4YFX F;  3BTI A;  4I2O A;  1T56 A;  4F7Z A;  1ENH A;  5JI6 A;  3F6O A;  3OR2 C;  4MQ9 F;  1TL8 A;  3H36 A;  2MC3 A;  5F6F A;  1Y0U A;  1K6Y A;  2RC4 A;  3IKT A;  3LAJ A;  4JQF A;  1SFO J;  2E1C A;  5F04 A;  1O57 A;  4IZZ A;  3LMM A;  3NAU A;  5LD2 C;  4OMY A;  3W6K B;  2A5W A;  2RRE A;  3FDY A;  5C4J J;  1IRZ A;  2ECC A;  5TRD A;  2GLO A;  5FFX A;  1QO0 D;  2MSY A;  3BQZ A;  5AON A;  4IHV A;  1JKQ C;  1YOV B;  5JVG F;  4BY7 J;  2FOK A;  4ZH4 F;  5HVQ C;  3EET A;  1R5H A;  3F72 A;  1GV5 A;  3GTO J;  2KDO A;  4UHT A;  1JT0 A;  1OCT C;  4JX4 A;  2V1D A;  3C3W A;  2BYV E;  2R7X A;  3UR3 C;  1SVL A;  4WF2 A;  2ADU A;  2R0Q C;  3ZMZ A;  4NC8 A;  2D2W A;  5EF6 A;  3FM5 A;  2VBZ A;  4RAG A;  4M3D A;  4BHP A;  1XD7 A;  5AIQ A;  2MBF A;  4DZJ A;  2Y75 A;  2X6O A;  4YFK F;  1QPM A;  1N77 A;  4EJT A;  5BS6 A;  3ZQI A;  1O3Q A;  1FP2 A;  1R7J A;  2L7M P;  5BPI A;  1EJ9 A;  2Q2E B;  2CQX A;  1Z91 A;  3HXL A;  5H6Q A;  5J3L A;  4P5O A;  3SYT A;  4DYR A;  2DYR H;  3A01 A;  3VYU B;  2JWT A;  4NDL A;  4KFC A;  2DW4 A;  1LNW A;  4CHU A;  1FX7 A;  4J00 A;  2E36 A;  1EKE A;  3I9V 2;  3SZT A;  2MC4 A;  2BXY A;  1SFK A;  1FP1 D;  2X1C A;  5HDK A;  3TW6 A;  1R5I D;  1MDM A;  2CG4 A;  2QLZ A;  4ZTJ A;  1JGG A;  1KYW A;  3EYI A;  3KPH A;  4BJ5 C;  3BJA A;  1E0E A;  1FTZ A;  3ASN H;  2EV6 A;  1KZH A;  4BKX A;  3HJE A;  4FT8 A;  3HKZ A;  1S3J A;  3S1M J;  4A3B J;  1OCP A;  2XDV A;  3HRM A;  5F1J A;  2KDZ A;  4BYY A;  5FD6 A;  1NK2 P;  2QBY A;  2M5W A;  3TP0 A;  4CCM A;  1YX5 A;  5DDG A; 
#chains in the Genus database with same CATH homology
 3JRA A;  5GP9 A;  1JJ6 C;  3H0G J;  5DS9 A;  1K83 J;  1K61 A;  2LTP A;  2VKV A;  3SDG A;  3OSF A;  1H88 C;  4X1E A;  4BBS J;  3Q3S A;  2JA7 J;  4A3J J;  1TWG J;  2Y2Z A;  3FIS A;  2DA3 A;  2R92 J;  1XG1 A;  1P7J A;  1B8I A;  2HOT A;  2WB1 N;  2DA6 A;  1U8B A;  1S7E A;  1AKH B;  1POG A;  4C3H J;  2JJ7 A;  2COB A;  1ETW A;  2FQ4 A;  4I76 A;  3G1M A;  4DYC A;  3JRE A;  2LVS A;  1T33 A;  4D7M A;  1TWF J;  1ETK A;  4ABZ A;  1BA5 A;  1RKT A;  4Y52 J;  4FTH A;  2EZL A;  1QPI A;  2E2J J;  2B63 J;  2TRT A;  3E7L A;  2CUF A;  3GTM J;  2YU9 J;  1X2N A;  3S1Q J;  5FKM A;  4QTR A;  2HDD A;  1PUF B;  3MKL A;  2NVT J;  3ZQH A;  1JUS A;  2DMN A;  4W97 A;  4FE4 A;  2DA2 A;  3FK7 A;  2EH3 A;  3IH2 A;  1RR7 A;  1AHD P;  2HXI A;  4A3L J;  1LFB A;  5J1U A;  3WHB A;  1CQT A;  1O4X A;  2JMW A;  3HOY J;  5J1Y A;  4D5C A;  4UUS A;  3D1N I;  1B72 A;  2WAQ N;  3MN2 A;  4B4C A;  2Y9Z A;  1YRN A;  3ZQC A;  1ZKG A;  1HLV A;  2TCT A;  4HNV A;  3JRI A;  1JTX A;  2MW8 A;  3TW7 A;  4QIW N;  5EG0 A;  1HDP A;  1VND A;  3IV5 A;  1ITY A;  1GVD A;  1ZQ3 P;  2NVX J;  4L5E A;  1HDD C;  4G12 A;  3O8H A;  3FK6 A;  1HOM A;  1LE8 A;  4M3G A;  1MBE A;  3G1O A;  3B6C A;  5IPA A;  2R5Z A;  2HXO A;  4BY1 J;  4BBR J;  2AHQ A;  1ZR2 A;  5EZG A;  2JK3 A;  2M2E A;  4DYQ A;  2ID6 A;  1QVU A;  1B72 B;  2XGC A;  1IUF A;  4XRM A;  3B6A A;  4RBO A;  3VPR A;  3GTK J;  3H3V K;  2DMP A;  3ZQF A;  4X6A J;  3HOZ J;  2L7Z A;  2ME0 A;  2CU7 A;  2M8G X;  5EG0 B;  3UKG A;  4XIC A;  2LY9 A;  3S1R J;  2XRL A;  5E3N A;  3LNQ A;  3CQZ J;  4AYB N;  3LOC A;  5K7H A;  4MFE A;  2LKX A;  1UHS A;  2K9Q A;  2XB0 X;  3LSR A;  4A3G J;  2W48 A;  2EZI A;  3TP3 A;  1LE8 B;  4DW6 A;  3HOV J;  4A69 C;  4JYK A;  2DMU A;  4IHY A;  2R5Z B;  4RDU A;  1I6H J;  2MG4 A;  1Z77 A;  2R5Y A;  1ZK8 A;  1AU7 A;  1RPW A;  5EEA A;  4M3B A;  5FKL A;  3RZO J;  2EZH A;  1I50 J;  2DA4 A;  2QCO A;  1MBF A;  1ETV A;  3HGG A;  4JX6 A;  1BL0 A;  1ETX A;  4MIM A;  3RKQ A;  1PUF A;  1MSF C;  1JUM A;  2DA5 A;  3GTG J;  3BR5 A;  1JT6 A;  3TED A;  1Q1V A;  1UMQ A;  2NVQ J;  4XK4 A;  1IDY A;  3BR0 A;  2HOA A;  4B3A A;  2JA8 J;  5M3M J;  4XID A;  4S0H B;  1ETY A;  3GBG A;  1MBJ A;  4A3K J;  2HOS A;  3S17 J;  2HYJ A;  2HI3 A;  1JKR C;  2Y31 A;  3LSJ A;  3OIO A;  1ZGW A;  3IH4 A;  5DTD A;  3QQA A;  4M6V A;  4AC0 A;  2R5Y B;  1F36 A;  3BR2 A;  5E3O A;  2G0E A;  1GDT A;  2P81 A;  3IH3 A;  1D5Y A;  1GV2 A;  1OJL A;  1WH5 A;  2NS8 A;  3ZQG A;  1W0U A;  5EYR A;  2NS7 A;  2XPW A;  3M3Y J;  1HF0 A;  1FJL A;  3BT9 A;  1QRY A;  1XC5 A;  9ANT A;  2L0K A;  5F0C A;  2XSD C;  5GPC A;  5F0H A;  4A3C J;  2R7Z J;  4IEJ A;  2JA6 J;  3HGY A;  2XGD A;  1X2M A;  1W0T A;  3HDD A;  3O8G A;  4IHW A;  1MSE C;  1WGX A;  2O9L A;  3GTQ J;  4MO7 A;  1MBK A;  4GFB A;  5IYC J;  1IJW C;  3S2D J;  4CYC A;  3S16 J;  1IC8 A;  5C44 J;  1MH3 A;  5IYD J;  2VKE A;  3RZD J;  2VUM J;  1EF4 A;  3LSP A;  2ZB9 A;  1IGN A;  2XB5 A;  2M9H A;  5J1R A;  2H8R A;  3DCF A;  3BTC A;  2IBD A;  1ORK A;  2Y30 A;  4C3J J;  1XS9 A;  1VI0 A;  2R93 J;  2FJ1 A;  5IYB J;  5IP6 A;  1FEX A;  2KT0 A;  3PO3 J;  4FE7 A;  3LSG A;  2OF7 A;  3S14 J;  1WPK A;  2DN0 A;  3BR6 A;  1ETO A;  3FKI J;  4C3I J;  2CQQ A;  5FLM J;  5M3F J;  1H89 C;  1QVT A;  4J19 A;  2XPU A;  4C2M J;  3CCY A;  4UUT A;  1IV6 A;  1TWH J;  3I4N J;  1U9N A;  5BNG A;  4CYC B;  1IG7 A;  2IAI A;  2RAE A;  2O7O A;  3JR9 A;  1R9T J;  4M3E A;  1TWC J;  3K7A J;  1G2H A;  1A5J A;  1RES A;  2K9N A;  5C4X J;  1I3Q J;  1Y1V J;  1TWA J;  2LP0 A;  1JTY A;  1BW6 A;  1A6I A;  4DZP A;  1WH7 A;  4FIS A;  3HM5 A;  1JJ8 C;  1ETQ A;  2D5V A;  3Q0U A;  1NTC A;  1ZTR A;  3JRB A;  3GTP J;  2FX0 A;  2FD5 A;  3F0C A;  2LR8 A;  3BR1 A;  3S15 J;  5C3E J;  4MFD A;  3HOX J;  3I4M J;  3Q0W A;  2K40 A;  3BTL A;  2E2H J;  3OOU A;  4D7N A;  5K7Z A;  4XRS G;  4JP0 A;  3NAR A;  1NK3 P;  2DMT A;  2LD5 A;  2JA5 J;  2CRG A;  3M4O J;  4V2G A;  2YS9 A;  4QSH A;  2EQR A;  3HOU J;  3L1P A;  3BR3 A;  2DTZ A;  3QPS A;  3ZOB A;  1JUP A;  3GTL J;  2M0C A;  2OPT A;  4XRS A;  5E3M A;  2MGQ A;  1HCR A;  3MVP A;  2K9S A;  2WV1 A;  1OFC X;  1P7I A;  2I10 A;  5JLW A;  3A01 B;  1JKO C;  2L9R A;  3RQI A;  1BW5 A;  2LLK A;  2GBY A;  2X9D A;  4A3D J;  2Y0S N;  5IOZ A;  3CDL A;  3G1L A;  1RKW A;  2DA7 A;  3HKZ N;  3S2H J;  2DA1 A;  5FKO A;  1DU0 A;  3HOW J;  1MBG A;  4B1R A;  2VI6 A;  2LFB A;  4D5F A;  3BG9 A;  4A3E J;  1H8A C;  1Y1W J;  5JLX A;  1X58 A;  5FKN A;  2EZK A;  2M34 A;  2ME6 A;  3SJM A;  4A3F J;  2JN6 A;  3CMY A;  2PMZ N;  2QF7 A;  2X48 A;  3W6V A;  5FJ8 J;  3JRH A;  5EGO A;  2DJN A;  3K2A A;  1E3O C;  2GM4 A;  2NOG A;  2Y9Y A;  5IOY A;  3BTI A;  1GT0 C;  1MNM C;  5HOD A;  1T56 A;  1DU6 A;  1ENH A;  5M5W J;  2E1O A;  4W1U A;  4A3M J;  4EEF G;  2CJJ A;  4I6Z A;  1B8I B;  5IP9 J;  3PO2 J;  1FIP A;  5EZH A;  1SFO J;  3JRD A;  2XPV A;  2ELK A;  1Z0X A;  2YUS A;  4A93 J;  5F04 A;  3NAU A;  1WI3 A;  1MBH A;  1IRZ A;  3DEW A;  5C4J J;  2ECC A;  3HB9 A;  2GLO A;  2XGE A;  1F43 A;  2MSY A;  3BQZ A;  2CUE A;  4IHV A;  1JKQ C;  3PM1 A;  2N8G A;  3FIW A;  1RET A;  4BY7 J;  4A3I J;  1GV5 A;  3A03 A;  5EDN A;  5EGO B;  5F27 A;  3GTO J;  2H1K A;  1JT0 A;  3JRC A;  1GUU A;  1OCT C;  3SFI A;  2AO9 A;  4JX4 A;  2EBI A;  1JKP C;  2HQ5 A;  3ZQL A;  2ECB A;  5GPA A;  4V2F A;  3JRG A;  2R0Q C;  4BXX J;  5EF6 A;  2VPR A;  4IHX A;  4M3D A;  3C2B A;  3A02 A;  4LOC A;  4DZJ A;  5E3L A;  2X6O A;  2E19 A;  3WHC A;  2O8K A;  3BG3 A;  3HEF A;  3ZQI A;  2ID3 A;  1APL C;  2L7M P;  1IDZ A;  1FTT A;  1U9O A;  1ZR4 A;  4UUS B;  4DYR A;  2CQX A;  5J3L A;  5IP7 J;  3JRF A;  3A01 A;  3QPL A;  2JWT A;  4NDL A;  5F0F A;  1YRN B;  3OSG A;  4MLO A;  5M5Y J;  1UG2 A;  3BQY A;  1VFC A;  2NVY J;  3TW6 A;  4FCY A;  2LK2 A;  5FLV A;  4Y7N J;  5F08 A;  3Q0V A;  3GTJ J;  3HBL A;  4AUX A;  1JGG A;  3BTJ A;  1AKH A;  1WCM J;  5FKK A;  1FTZ A;  4BKX A;  3BG5 A;  1SAN A;  1VF9 A;  1LFU P;  2E2I J;  2IEK A;  3S1M J;  3S1N J;  4M3F A;  4A3B J;  1OCP A;  4JX5 A;  5F1J A;  2KDZ A;  1FIA A;  1NK2 P;  1BJZ A;  3TP0 A;  5K7F A;  5M5X J;  1TC3 C;  2L7F P;  1U78 A;  1MH4 A;  2DMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...