2HI3A

Solution structure of the homeodomain-only protein hop
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MSAQTVSGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeodomain-only protein
publication title Analysis of the structure and function of the transcriptional coregulator HOP
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hi3A01
1ITYA 2GBYA 3G1OA 1D5YA 4RBOA 5EYRA 1RETA 1P7IA 1G2HA 2DMUA 2N8GA 3D1NI 1H88C 2XB0X 4QTRA 3BT9A 3S16J 2EZIA 2WB1N 4IEJA 1DU0A 3B6AA 5JLWA 3M3YJ 3G1MA 3NAUA 1TWCJ 3BR3A 1S7EA 2QCOA 3GTGJ 4DW6A 3GTLJ 1ETYA 4W1UA 1TWGJ 3OOUA 5K7FA 1ZKGA 5GP9A 1WCMJ 2ME0A 1MBHA 3CMYA 3GTMJ 4A69C 2O7OA 1MBGA 1ETWA 4M3BA 2DN0A 3LOCA 1U9NA 2R93J 3Q0UA 2ECCA 5EEAA 1B72A 2LTPA 1RR7A 4V2GA 1Z0XA 3C2BA 2DA1A 2NVTJ 2R7ZJ 4X6AJ 3JRHA 5IP6A 4V2FA 2JA5J 2M0CA 3JR9A 5DTDA 4B3AA 4XIDA 3HEFA 3S1QJ 3OIOA 5J3LA 1ZR2A 1ETOA 5E3NA 5J1YA 2AHQA 5F08A 2JN6A 3HBLA 2XB5A 4LOCA 1AKHB 2YUSA 2L7MP 4FCYA 3Q0WA 3BR2A 1IDZA 2ID3A 1WGXA 3FIWA 3HB9A 1ZQ3P 1MBEA 2MW8A 3S2DJ 5FKOA 2E1OA 2O8KA 2I10A 5F0CA 3Q3SA 3BTCA 3MN2A 1RPWA 1K83J 3BTIA 2Y9ZA 1JKPC 4FE7A 2YS9A 3TW7A 3TP0A 1JUMA 2TRTA 3ZQGA 2FJ1A 4DZPA 1FTTA 1POGA 4FTHA 4DYQA 1WH5A 4JX5A 1HDPA 3CQZJ 1R9TJ 2B63J 3BG9A 4D7NA 3ZQCA 2DA4A 2WAQN 3JRGA 3RZOJ 1X2MA 1PUFB 2CRGA 4S0HB 2LR8A 4BBRJ 4AUXA 2Y0SN 1ORKA 3ZOBA 1QVTA 2DMTA 5FKNA 4MLOA 2NVXJ 4M3EA 5J1RA 1IC8A 1OCTC 3HGGA 3TW6A 2NVQJ 5IP9J 2CJJA 4X1EA 1MBJA 1JKOC 2R5ZA 1TC3C 2JA7J 1HOMA 3I4MJ 1U8BA 5EG0A 5FKLA 3QPSA 4UUSB 1Z77A 2OF7A 5E3LA 4AYBN 2K9NA 4EEFG 3HOUJ 2DA5A 5GPAA 5FLMJ 2LKXA 2K9SA 1ZR4A 2K40A 1T56A 2EZKA 4HNVA 1F36A 1H89C 3JRAA 4A3IJ 2R92J 3HM5A 4JX6A 1UHSA 1JKQC 2ELKA 1JKRC 1IG7A 2HXOA 1XS9A 3BR0A 1JTXA 3QQAA 1FTZA 1Y1WJ 3A01B 3CCYA 2M8GX 2L7FP 1A5JA 1VFCA 5F04A 5IYDJ 3IH3A 3IH2A 9ANTA 2EH3A 3BQYA 4A3DJ 2XPWA 2LLKA 4M3GA 3H3VK 2XRLA 3JRDA 3S2HJ 1TWAJ 1LFUP 2D5VA 1RESA 2ECBA 1IJWC 3ZQFA 3IV5A 4IHXA 5IP7J 3PO2J 1LE8B 3S1MJ 2DTZA 2KT0A 5K7ZA 1GDTA 2PMZN 1W0UA 1B8IA 1HCRA 5FLVA 4L5EA 2OPTA 4MIMA 2W48A 3JRFA 3HGYA 1JUPA 1JT6A 2MGQA 3BR6A 3S15J 3OSGA 1ETKA 4XRSA 5HODA 5EZGA 1FJLA 2NS7A 2XGEA 3LSGA 3MVPA 3PM1A 1ETQA 2EZHA 1BJZA 5FKKA 5IOYA 5C44J 4Y7NJ 1SFOJ 3A02A 1BW6A 3K2AA 5E3MA 3GBGA 3A03A 5JLXA 2VKVA 4BY7J 1BW5A 5M3MJ 3WHBA 1YRNA 1XC5A 2NOGA 4A3MJ 4DYRA 4FISA 2VKEA 2Y31A 2ZB9A 5EGOA 2JJ7A 2DA7A 4A3BJ 3JRCA 3UKGA 3L1PA 3HKZN 2LY9A 5C4JJ 2CU7A 3JRIA 4G12A 1IGNA 3Q0VA 2HOSA 1GV5A 3O8GA 3HOWJ 1GUUA 3RZDJ 3BR1A 1QPIA 4CYCA 3F0CA 4A3EJ 1B72B 4GFBA 1UMQA 3H0GJ 4DYCA 1HLVA 1XG1A 4BKXA 2L7ZA 5E3OA 2NS8A 5GPCA 3B6CA 3LSPA 4D7MA 2L9RA 4A3LJ 1I3QJ 2R0QC 3QPLA 2GM4A 1GVDA 3FKIJ 5C4XJ 1X58A 1AHDP 2P81A 4DZJA 2HOTA 2CUEA 2JA8J 4BBSJ 2DMPA 2YU9J 1MH3A 2LP0A 1K61A 1FEXA 2JA6J 4D5FA 1ZGWA 1APLC 2VI6A 4C3HJ 2FX0A 1BL0A 4W97A 1F43A 2LK2A 5K7HA 2IBDA 1P7JA 2Y2ZA 4XICA 5F1JA 5M3FJ 2AO9A 3MKLA 5M5XJ 1OCPA 4C3IJ 2CQQA 3ZQHA 3HDDA 4IHWA 1Q1VA 3S1NJ 3K7AJ 1OJLA 1LFBA 3BQZA 4I76A 1VNDA 2LVSA 2LD5A 4AC0A 1HDDC 3ZQLA 1NK2P 1IDYA 1WI3A 4J19A 2QF7A 1BA5A 4C3JJ 1GV2A 1IUFA 4QIWN 3HOXJ 4NDLA 1IV6A 5F0FA 3SDGA 2E2HJ 3BTLA 2EZLA 5EZHA 1FIPA 1JTYA 1IRZA 1U9OA 4B1RA 3S1RJ 2DMQA 1ZK8A 1I6HJ 2O9LA 1QRYA 3GTQJ 3JREA 5EF6A 2XGCA 2JK3A 4IHVA 1JUSA 3TEDA 2VUMJ 3FISA 4C2MJ 4A3JJ 1AKHA 1E3OC 2ME6A 1TWFJ 4A3CJ 3RQIA 2DMNA 2ID6A 3I4NJ 1DU6A 2HQ5A 2XGDA 2HDDA 4D5CA 2L0KA 2KDZA 2R5ZB 2X6OA 5IPAA 3GTJJ 5IYCJ 5F27A 2GLOA 3GTPJ 5EG0B 2LFBA 3G1LA 4JP0A 4A3GJ 3RKQA 4BY1J 2FQ4A 2X9DA 5IOZA 1JGGA 1WPKA 4XRSG 4XK4A 3BG5A 1I50J 1VI0A 2E2JJ 3S17J 2EQRA 3ZQIA 3OSFA 1JJ8C 3NARA 2Y9YA 4M6VA 2MG4A 4A3KJ 1CQTA 4MO7A 1A6IA 5FJ8J 4ABZA 1TWHJ 2DJNA 2XPUA 4UUTA 4QSHA 5IYBJ 5M5WJ 3SJMA 4Y52J 3SFIA 2JMWA 2DA3A 2H8RA 4A3FJ 1PUFA 1JT0A 5M5YJ 5FKMA 2HYJA 4JYKA 1AU7A 3DEWA 1ETXA 2K9QA 1JJ6C 2EBIA 2M9HA 3CDLA 3S14J 3WHCA 3LNQA 2NVYJ 3IH4A 3GTOJ 3LSJA 1MNMC 2M34A 1FIAA 4UUSA 1EF4A 3O8HA 1MSFC 2R5YA 1MSEC 1MH4A 2HXIA 2Y30A 3BTJA 1Y1VJ 1RKWA 5C3EJ 2DA2A 1B8IB 1OFCX 4RDUA 4A93J 3W6VA 1MBFA 2COBA 1HF0A 5J1UA 2MSYA 2XSDC 4M3DA 1NTCA 2XPVA 4M3FA 3FK6A 2G0EA 4BXXJ 1ZTRA 5F0HA 2TCTA 3A01A 1UG2A 3HOZJ 2DA6A 4MFDA 1X2NA 1RKTA 2IAIA 1O4XA 3M4OJ 3BR5A 4IHYA 2E2IJ 2CUFA 1QVUA 5DS9A 3DCFA 1WH7A 3HOVJ 1NK3P 2WV1A 1YRNB 3E7LA 2H1KA 1T33A 2HI3A 5EDNA 3PO3J 3GTKJ 1ETVA 2E19A 2M2EA 2JWTA 2X48A 5BNGA 3JRBA 5EGOB 3TP3A 4XRMA 2IEKA 3VPRA 1H8AC 2FD5A 4FE4A 3BG3A 4B4CA 1LE8A 2CQXA 3LSRA 1U78A 1VF9A 4JX4A 2R5YB 2RAEA 4MFEA 1ENHA 1GT0C 4CYCB 3FK7A 2HOAA 1SANA 4I6ZA 3HOYJ 1W0TA 1MBKA 2VPRA
chains in the Genus database with same CATH superfamily
4XBFA 1YI2I 3FWEA 1WI9A 1ZLKA 2F5FA 3SQNA 4RBOA 2VL8A 5CPRB 3VYUB 3MZYA 3W3CA 2K02A 3TQNA 1MNEA 2VPLA 2N8GA 2DK8A 3D1NI 2FE3A 3M1EA 2CS3A 2XB0X 2P8TA 5JFRA 3SZPA 1SAXA 2WB1N 3OS2A 1DU0A 3A1YA 5JLWA 4G7HF 2UWMA 3NAUA 2OJED 5E79C 3V7CA 3BR3A 1S7EA 1QBJA 4U88A 4WXDA 3GTLJ 1TWGJ 2DCEA 2O8XA 3OV8A 2NRAC 2X4HA 5K7FA 5FD5A 3ERMA 1T0FC 1O7FA 3CMYA 1I1SA 2VC0A 3T8RA 1K4SA 3CCVI 1BR1A 1FP2A 2G7HA 5TISC 5D8LB 4YFNF 3PIOF 3Q0UA 5DCFA 4OIOF 2VT3A 1OCCH 3C2BA 4CDGA 4M6YA 1QQIA 2HYFA 2VQGA 4K2EA 3R0JA 2ZMEA 3HTUA 2VOOA 1YQAA 5H6QA 2CO5A 5IP6A 1LNWA 2BY1A 3ZR8X 2DO7A 2DT5A 1OKRA 1R1UA 5FFZA 1JXSA 3HEFA 3TOBA 3S1QJ 4XNFA 1C0WA 4XL9A 2FMLA 3AFHA 1JHFA 5BS6A 3KP5A 2BYVE 5CQGA 1Z3XA 2YUSA 1BIBA 2L4AA 1NHAA 2K9LA 2L01A 1IDZA 2MLGA 5DUIA 1Z21A 2ZCWA 1Z7UA 2QLZA 4ZYAA 2ZXIA 4U0VA 3S2DJ 5EJCA 3BDDA 2QQ9A 2E1OA 3HSEA 3A4CA 2I10A 3L00A 3Q3SA 3BTCA 3L7WA 1RPWA 1JKPC 4FE7A 3RTRA 2YS9A 2OU2A 1VQOI 3ZQGA 3WGIA 1EH7A 2IS2A 5J8CA 2IGMA 1Y6IA 3I5UA 1IN7A 4OIQF 3QP6A 4LITA 3UNGC 4IVNA 5LRSA 2ZSIB 1R9TJ 2B63J 3BG9A 4D7NA 3ZQCA 3E5QA 3FXQA 4PFOA 1IUYA 2Y48A 2LR8A 5ILVA 1R5HA 1UCRA 3GFLA 1TW2A 3H5AA 5FKNA 4AYBA 5JHUA 4RMNA 2I5UA 4U7DA 4MLOA 1Z9CA 1I6XA 2NVXJ 2JA2A 5J1RA 1OCTC 2DPDA 2BY2A 2ZNZA 3HGGA 1ZGJA 1IN8A 4P9UA 5TJJA 2J5PA 3HJEA 4UV9A 2BVLA 2L9VA 1KGSA 1LUJB 4XKCA 5FKLA 2XC7A 1OLTA 2M0MA 5KAIC 2K9NA 5K5OA 3CUQB 3KYCB 2VJJA 3M8FA 3OIPA 4M73A 4U87A 3DBHB 5ICEA 2LKXA 1KYWA 4L9VA 2MD5A 1ZR4A 2RQPA 1T56A 2EZKA 4HNVA 1H89C 2ZKZA 3OL4A 4A0XA 5H2FC 1OYYA 3G2BA 2FSWA 1YO5C 3DQVC 1DP3A 4M9ZA 3F8MA 3QQAA 2O61A 3SXYA 3MCZA 2P5KA 3LSTA 3V42A 4IOCF 1VFCA 5IYDJ 3R4KA 4LLGF 4KUMA 3J7AY 9ANTA 4HW0A 1XDUA 3P9IA 4U0WA 5ICCA 2EH3A 3BQYA 2FA5A 3V8LA 4A3DJ 2Y69H 4E7ZA 3H3VK 4M3GA 2HVQA 1MZBA 2KRCA 2PMZA 2MBFA 3S2HJ 3HPHA 1AA7A 4PZJA 4KISA 3LSHA 2GA2A 2CGPA 1RESA 2NS0A 4HG2A 2AS5F 1AOYA 3Q5FA 2YX7A 2DJIA 2O0YA 3JCUC 2NAZA 5GAGJ 2PJPA 2OPTA 3HUGB 2PN6A 1T39A 1MDMA 1MMAA 1X19A 2GXBA 2VJIA 3H9QA 2DFIA 4BEHB 4ZZLA 3HTSB 4PGHA 4FX0A 1R7JA 4XRSA 3OSGA 3GUDA 3RPUD 1FJLA 3BCAA 1TTYA 5KVRA 3CD6I 4EJVA 1KQ9A 5EEGA 5IOYA 3H1CA 3H5RA 2ACJA 5C44J 5CVUA 5F1RA 2YSRA 2EPFA 1QGPA 3K2AA 5BMZA 5E3MA 1W1WE 4EM2A 3EYIA 2OC6A 2KJCA 2VKVA 1OCRH 3WHBA 1YRNA 3EUHC 3OYMA 2R7RA 3K2ZA 3CLOA 4GYIA 3U21A 2NOGA 2ISYA 3C3WA 3QYBA 5FD6A 4A3MJ 2EIKH 5DM7F 4FISA 1XPXA 4ENMA 2VKEA 4HV5A 4QLCU 4NQWA 4II2A 3JRCA 1HKQA 1N25A 3UKGA 2DFEA 3HKZN 4PFPA 2CU7A 4ZDLA 3K1NA 4EQQA 4ZZDA 4YIIA 1T6SA 1GV5A 3KZYA 4RAFA 3T0YA 2IXSA 1GUUA 1YYVA 3BR1A 5DEQA 1UAAA 1YS6A 4CYCA 1B72B 3H0GJ 3BZ6A 4BKXA 2OQRA 1GLNA 2L7ZA 2BW3B 2FMYA 4MQVA 5GPCA 1V5FA 4KYWA 2L9RA 3GYHX 4CCMA 4RM2A 3ECHA 3QPLA 3PIPF 4MGRA 4CCJA 3CF5F 4KMUX 1WSUA 1X58A 1AHDP 2F5EA 3CUQC 5DD4A 2DMPA 1X3UA 2KRHA 3ZRGA 2LP0A 1G3WA 1K61A 1FEXA 4EATA 4RB1A 4HLXA 5ERIA 2VI6A 2IVMA 2GA1A 2X51A 1T98A 1F43A 2IBDA 1P7JA 5K1YA 3OYLA 1ZELA 2WWYA 3C1DA 3MKLA 3HYIA 2CQQA 3HDDA 2IGKA 3D5SC 1Q1VA 3S1NJ 3K7AJ 4DIQA 3E6CC 2LC2A 1LFBA 3BQZA 3DFGA 4KT5C 1VNDA 2LVSA 4BU2A 2LD5A 2BVMA 2QSGX 5FGMA 1W7PD 3IKVA 2FBKA 2ESHA 4J19A 1BA5A 3BZKA 2BXZA 1IV6A 3ROUA 5F0FA 3SDGA 4A5MA 2E2HJ 3BTLA 4CCOA 2EZLA 5EZHA 1VZ0A 2QENA 1JTYA 2KJBA 1FP1D 3ZPLA 2WBMA 4RAGA 4CUGA 1MNDA 2QM3A 3WTYC 2XGCA 4BE0A 4BJ5C 4HF0A 4IHVA 2VUMJ 3TOAA 2JVHA 3FISA 5CKTA 1RI7A 4A3CJ 2VQHA 2IJLA 4BJ6C 5D6FA 1SFUA 1FOWA 1XB4A 1DU6A 2XGDA 2PFBA 2HTSA 2X6OA 4PJNA 4CCNA 5IYCJ 3GTPJ 5EG0B 2LFBA 2DOFA 2RGVA 3O3KA 1WJDA 2FQ4A 3M8JA 4I09A 1JGGA 3BPVA 1WPKA 2FXAA 4MEYF 2X6WA 3LSKA 5D8KB 2E35A 4J00A 3BG5A 2ZC2A 3K9TA 5A2QZ 3P5JA 1YITI 2Y9YA 3V7SA 4KA4A 2QKLB 2X1CA 4A3KJ 3T8TA 2Q2EB 4ON0A 3RKYA 2DK5A 3PQKA 2KISA 2VBYA 2DJNA 2XPUA 5IYBJ 4E6KG 5M5WJ 1HC8A 2OD5A 1PDNC 2JMWA 2YR2A 3R0AA 2ZXHA 3I71A 5IY5H 1JT0A 1OCOH 2HYJA 2A68F 2JTVA 2HQRA 4B44A 3RKXA 2K9QA 2M9HA 3MKZA 3LNQA 2NVYJ 1U5TB 3MAJA 1RUNA 2UXNA 1LVAA 2GOMA 3O2PE 4UVCA 3ULQB 2RREA 3KP3A 4JK1X 2LBFB 3O8HA 1R5ID 2EFQA 3MFKA 1MSEC 1YJNI 2D1HA 3I55I 5C3EJ 1B8IB 2ZNYA 5HLGA 1OCZH 3NRVA 2MSYA 2DFHA 5JVTA 4M3DA 1MMNA 2GOXB 3J80Z 1R49A 1XSVA 1TQMA 5AIQA 2R3SA 1D5VA 2F6CA 4F91B 5ICGA 3E97A 1X2NA 1E3HA 4KICA 4IHTA 1P9QC 3WGGA 2CUFA 1VQKI 2ESNA 1MJBA 2EA2A 5DS9A 4L9NA 5E1WA 4YIRX 1HW5A 2WV1A 3HHGA 5CLSA 4I98B 3GTKJ 2F5VA 2AXLA 2D2WA 4LG3A 1OR7A 1I5ZA 1IN6A 2CFOA 2MYSA 1R58A 1H9GA 4GRIA 4NNJA 5DD8A 4ENNA 4RM3A 4PJMA 2RVCA 5H6RA 1RZ4A 4XKWA 3CESA 5DM6F 1ZG3A 4C30A 5LHIA 1FZPB 4XSZF 4L18B 2IS4A 1VF9A 1W5CC 2RKHA 3ONQA 4JX4A 4ESJA 1KA8A 4HX4A 2OBPA 4OIRF 2CG4A 1PYVA 1GT0C 4ENKA 3GW2A 1W7PB 3FHZA 2VPRA 4AVPA 2FUG2 4DQ2A 3OR2C 2CV2A 3MQ0A 2L2OA 4OMZA 1QNTA 5EYRA 5L3DA 2EFPA 3B02A 2DMUA 2XF6A 3IKTA 3H36A 4IPAA 2M1BA 3D5LA 4HA8A 1PVEA 1LDJA 1PP8F 1QZEA 4QTRA 3OYGA 3L2WA 3ZP5A 4I0BA 3KEYA 4IEJA 3M3YJ 3VYRB 1EH6A 3G1MA 4UY8I 1FNNA 1ETYA 4OMYA 4BQQA 2X1DA 3LQQA 5GP9A 2EV5A 3WTUC 1FLIA 1R6RA 1D3YA 1MBGA 3FXJA 3K6GA 2HYGD 2HPMA 1ETWA 4M3BA 2P6SA 2DN0A 1I39A 1D0XA 2STTA 3JW4A 4CGZA 4R1HA 1XDSA 1MW7A 2DDAA 3CO6C 5IT9Z 4BS9A 4RB3C 2FEZA 3DKWA 3M7GA 3JRHA 2KMUA 5DCMB 2Y0MA 2WA0A 1FYMA 5ILUA 4BYYA 2ADUA 2M0CA 4XRFA 5DTDA 4XIDA 4D1QA 1UJ8A 3OIOA 5J3LA 2K4JA 3HG9A 5CQEA 1ZR2A 4AD9A 2HZTA 1JGSA 4G6QA 1TQIA 5F08A 2JN6A 3HBLA 2XB5A 2CW7A 4BE2A 1AKHB 3BOQA 2CQNA 2IT0A 2L7MP 2F48A 2LSOA 1WGXA 1AWCA 1ZQ3P 5TGTA 1MBEA 5FKOA 1ZRDA 4RGRA 2O8KA 4MTDA 3M8EA 5F0CA 2JSCA 5LBQA 2NNYA 1V4RA 3ABUA 3L09A 4LFUA 3MN2A 1K83J 2VODA 3BTIA 4AVZA 4EGYA 2YU3A 3L9FA 3TW7A 2V1UA 3KP7A 3DLAA 3F6VA 1FOKA 4ETSA 4DZPA 3ZCOA 1POGA 1WZ2A 2JUCA 1V5GA 1WQ2A 4JX5A 1Z6TA 3TDZC 2GIZA 4NUBA 1MD0A 5E8IA 3CQZJ 3ZXSA 1HBXG 1GHCA 1NG7A 3F22A 2HDWA 4LB6B 2IPQX 4MNUA 2V26A 1DPRA 4DBQA 2WAQN 3RZOJ 3VYTB 3CCLI 1U8RA 2CW0F 2JVGA 3ASNH 4NBQA 1PUFB 4HF2A 4S0HB 2M7AA 4AUXA 4I01A 5ICFA 1TT5B 2DMTA 4LMYA 4RS8A 4RLQA 4EJWA 2W7NA 4M3EA 2QWWA 2J5OA 2DQLA 3GVAA 3TW6A 5E20A 5IP9J 1MBJA 4LLLA 2R5ZA 1A6QA 3I4MJ 2E60A 1BI3A 1A31A 3FMQA 1SVLA 4UUSB 1ZARA 1XMKA 4CYDA 3HOUJ 3PSFA 1ZH5A 2BY3A 5GPAA 1IXSB 3QWLA 1YW9A 4KIGA 3JAMZ 2HGCA 4V19K 1WJ5A 3JRAA 2JPBA 3WTXC 2R92J 2KIQA 3RSNA 2E5NA 3ZMZA 2JSPA 4P96A 1IG7A 2C6YA 3GLXA 5FO5A 1RRJA 3FBIB 1IF1A 1FTZA 1Y1WJ 3K10A 1D0ZA 1FSHA 3CCYA 2M8GX 3VB2A 4TV7A 1MMDA 3FXKA 5DV5A 1A36A 3NQOA 3JSPA 2R7SA 1OYWA 3IH3A 1BOBA 1QZZA 2HDCA 2V6EA 1IV8A 2DQRA 2V4JC 4U0YA 3L2CA 2FNPA 2XPWA 2XRLA 2HQNA 4ZYEA 1ERDA 4PJLA 4I7HA 3CLQA 3K1PA 5HNHA 1J7KA 3QP5A 4ZYGA 2O03A 1TWAJ 3BZCA 4XLHA 2D5VA 2ECBA 1IJWC 2B7EA 3ZQFA 2A07F 2LF8A 2VT2A 4FT8A 2HS5A 1P6RA 5F64A 5JR3A 2K86A 3DKXA 1L3LA 1LE8B 2E7XA 2F4IA 2KT0A 2QUFA 1W0UA 1MKMA 5FLVA 4L5EA 1RUOA 3DTEA 4MIMA 3JRFA 2W24A 5EEHA 4Z2YA 1CF7A 3HGYA 2D45A 3OIQA 1JI8A 1JT6A 1R36A 5JHFA 4MTEA 3S15J 4WK8F 4F55A 1ETKA 4WXHA 5EZGA 3LSGA 3LAPA 3MVPA 2FQ3A 4IL6C 3GO5A 1G59A 2X1EA 4NC7A 1WFXA 4MQ9F 1SFEA 4Y7NJ 3GXOA 1KQ8A 4P55A 2M7BA 3HZJA 1F1ZA 4BY7J 1XC5A 4RGSA 3CP2A 2Z5UA 3VODA 3I59B 5EGOA 4G8XA 3F72A 4A3BJ 2EV6A 2HFHA 3OWTA 3RI4A 4H0EA 3L1PA 1UELB 4LB5A 2Y0SA 4CO8A 4AWXB 1IGNA 3OYNA 1K6OA 2FF4A 3O8GA 2OTLI 1REPC 2ZMEC 3FXLA 3RDIA 4Q4ZF 4M6XA 4NHJA 3RZDJ 1QU3A 2KIMA 2PEXA 2NOJB 3L2UA 1N77A 3F0CA 3T5XA 3HOTA 3QU6A 2K3FA 3BG7A 1XG1A 2XAFA 2PG4A 4XOTA 4CXFA 3I59A 3LSPA 3P9CA 2QSFX 2XVCA 1EA3A 3DPLC 3H0DA 2GM4A 3MZ8A 2LKSA 4JQFA 2XIGA 5D4SA 2V7FA 2P81A 3TO9A 4DZJA 1BI0A 2V9PA 2QSHX 4OU0A 4UUVA 3FXUA 3HPGA 2FOWA 2QZ8A 4ZH4F 1APLC 2COMA 1BL0A 3NEUA 4W97A 3I0TA 3RQ4A 3K4MA 5K7HA 3RYRA 1A04A 1XGNA 3N4MA 5F1JA 5M3FJ 4XN0A 3BG6A 1XSXA 2XHKA 4I99C 1J9IA 3MMYB 3SHFA 4QPOA 4KFCA 2AO9A 5ED4A 1WVRA 1H9TA 3KIOA 2PBIA 4BXFA 2VXZA 2JQ7A 3WTWC 3ZQQA 1LEBA 5B1AH 2ZJ2A 3W2AA 3UR3C 3ZQLA 4XQFA 1ON2A 4DJAA 1NK2P 1WI3A 3HXLA 4WCGA 1FWZA 3U2RA 1GV2A 2GQQA 3DPUA 2XF5A 1M1EB 4CICA 3EPZA 3SYTA 2FRHA 3GEZA 3LFKA 2TDXA 1LDDA 1WJBA 4BHBA 1VTNC 1I6HJ 1HW2A 2ZJRF 3A0BC 2GWRA 3EQLF 5EF6A 4L9JA 5HNFA 3RIRA 5TRDA 2JK3A 1QA6A 2VBXA 1LFPA 3ZMTA 4C2MJ 1SVMA 4AIKA 3JTHA 2F5CA 3RQIA 2ZJQF 5E18F 4ZYHA 2KRFA 4A0ZA 1I1GA 5IPAA 2W1OA 3OYKA 4Z6YA 3BLYA 1RR8C 3ECOA 4JP0A 1KZHA 3RKQA 4A3GJ 3KP4A 3K4JA 2OCEA 2H09A 2X9DA 4QPQA 3I9V2 3RJPA 1VQ8I 4R8HA 2FBHA 2MABA 1I50J 1VI0A 1ZHFA 4WWCA 2E2JJ 2A6HF 3KLNA 2V1DA 2JPCA 3SEQA 3PNVA 3C7JA 1JJ8C 3IAM2 3H5NA 4M6VA 1YIJI 3L2VA 2DYRH 1Z91A 1A6IA 1W5TA 3I58A 4ABZA 1FY7A 1TWHJ 4UUTA 3PFIA 5GTIC 4Y52J 3SFIA 1PP7U 4IO9F 5L3BA 1YW8A 2P4WA 5L3CA 5LHHA 2X85A 1LDKB 1BR4A 2R7TA 2XAGA 5GAHJ 3K4NA 1TT0A 2HKXA 3MWMA 4B43A 1FC3A 1W5SA 3LSIA 1ETXA 2EV0A 2EBIA 3CDLA 1F5TA 1YG2A 3WG7H 2HPIA 2HKOA 3IH4A 3GTOJ 3AAFA 3CCJI 2EINH 2DOAA 3ZQ7A 1MNMC 4JBAA 1Y39A 4BNCA 5KCMA 4E7IA 4IRIA 4YRVA 3I3LA 1K6YA 3DBLB 4KIFA 5LHGA 4M9SA 1EF4A 1DPUA 3HSRA 4HSRA 4KN4X 3CUQA 3G73A 5FB2A 1N75A 4CCLA 4BAYA 5GTHC 4HRIA 2DPUA 2BHZA 1P92A 1Y1VJ 1RKWA 3OMYA 2JRMA 4B48A 1BN5A 3X2QH 4HDVA 5AIPA 4FASD 2XF7A 1MBFA 3OYBA 2V1XA 5DYMA 1R4MB 2XROA 1NTCA 2QQ8A 2R7XA 1TP4A 4Y15A 4BXXJ 4L5JA 3VSKA 3LFUA 3D0SA 3J81Z 2QYOA 4IHSA 3CF2A 2VE9A 1UG2A 3FHNA 2ZFWA 3OYFA 4BHCA 2QBYA 3HOZJ 1TBXA 1RKTA 4BQAA 2XDVA 2O3FA 1R5GA 4E70A 2L3DA 1BBYA 3OL3A 1YIOA 1X1DA 3HOVJ 1TLHB 1TW3A 1NK3P 1IRXA 2K3PA 5EDNA 3ELKA 3L2RA 1ETVA 1WRJA 1O57A 2M5WA 3BJOA 2L9NA 2R7DA 3DEEA 3TP3A 4XRMA 4HEA2 2KKOA 3FDYA 4HYEA 3GZNB 2Z16A 3ML6A 2CUZA 5FROA 1XTAA 1FT9A 3PSIA 3BG3A 2FU4A 2CQXA 1U78A 4MHGA 2FOKA 2P7CB 4LGWA 2RAEA 4MFEA 2QEXI 3HUGA 1OYIA 4UVAA 1UB9A 2K27A 3AG1H 3EUKL 4DNCA 1P2FA 5CVRA 4C9YA 4BEHA 5A2QK 1K78B 1L0OC 2XAQA 3F8FA 1MBKA 3CMMA 1ITYA 5K5RA 1XGMA 1J59A 3OYHA 2GBYA 3G1OA 1D5YA 2BZTA 3TMOA 3C2GA 2PJRB 1P7IA 2XGXA 1G2HA 1V55H 4ZJZA 4N4OB 1P4AA 4IQ4A 1RNLA 1USSA 3CZ6A 1S9HA 3CC2I 1VQ7I 1Y8RB 3LQRA 3B6AA 4M72A 1WWXA 4XLAA 1SD7A 2KIFA 3ABMH 3CCQI 3S3MA 4LG0B 1VQ4I 3ABLH 3GTGJ 3GLLA 3OOUA 1ZKGA 1WCMJ 4LLNA 1MBHA 2WADA 5L3GA 3MZHA 3GTMJ 1HKSA 4XLNF 1OMIA 2BE5F 2KFDA 3FXOA 3LOCA 1KU2A 2R93J 4L5IA 3B73A 1SEUA 4G7ZF 2ECCA 1B72A 2LTPA 1RR7A 3ZMUA 1Z0XA 2NVTJ 4X6AJ 3PNYA 2BW3A 3VWBA 1BIAA 4XN3A 5J40A 3U1KA 3OYJA 3BC8A 4PJJA 6PAXA 5D5UB 4BHPA 1DQUA 2R7OA 3J7AO 2JA5J 4V2FA 2XRNA 1SC7A 3S93A 1W4MA 1DGWY 3JSOA 4UNOA 4BACA 1G8XA 1UFMA 5E3NA 3CCUI 4HX8A 3CCMI 1ZAOA 3LMMA 4CCKA 2R7WA 4FCYA 3BR2A 2ID3A 2MC3A 3FIWA 1UZCA 3HB9A 4EM0B 4Y17A 2EWNA 2MW8A 3RCOA 4ANJA 4II3A 3ASOH 4BUPA 3VYSB 2B0LA 2Y9ZA 1VQMI 4UB8C 1JUMA 2IGOA 2E1CA 2F5DA 2WAQA 1GXPA 4C2UA 5HLTA 4FTHA 1X3ZB 4DYQA 4IKFA 1WH5A 2Y75A 3KE2A 1QPMA 1XSDA 2Z99A 3ZGKA 2CQ7A 3TL4X 4YFKF 5L3FA 5E8GA 4A2UA 2PQ8A 1IRGA 2Z3YA 2DA4A 5CYVA 1X2MA 3F23A 3V8JA 4HNUA 3CJNA 3R61A 4BBRJ 1ZG1A 5D5VB 4XKVA 1B4AA 1ORKA 3S32A 2MH2A 3ZOBA 1QVTA 3LA7A 2BXYA 2A05A 1SMTA 5BQTA 4U7BA 2HEOA 5FLXZ 2MC4A 3S3NA 3WTTC 2LG4A 2L54A 2NXNB 3D5RC 1T2KA 2NVQJ 2CJJA 4X1EA 1TQPA 2X6XA 1V5EA 2EK5A 1JKOC 3Q9SA 1TC3C 3LWFA 2JA7J 1U8BA 2UV1A 5EG0A 2CV0A 1Z77A 2XAHA 4XLEA 1VQPI 2OF7A 3TKYA 2GZWA 1KONA 2KIUA 2W82A 2WC2A 2DA5A 5B66C 2DI3A 2CV1A 1O3RA 5FLMJ 2Q0OA 3BJ6A 4DBRA 2CSOA 1VQ5I 3P7NA 2DFFA 3ABKH 1F36A 4A3IJ 2E71A 2I8DA 3HC7A 3V8KA 2WB1A 4JX6A 1KU7A 4EMSA 3OOPA 1JKQC 2ELKA 1JKRC 2MH9A 2Q2EA 2HXOA 1XS9A 1I3AA 1JTXA 3RPUA 5IT9K 1IO2A 1BR2A 1O7LA 3A01B 4L0YB 4OOIA 3WTZA 2FNAA 2L7FP 3QPHA 4BH9A 3F8NA 2CMPA 5F04A 5E1ZB 3IH2A 3BCBA 2F4MB 4KN7X 1KU3A 2K9MA 4A5NA 2H27A 1Y0NA 1U5TA 1BM9A 5LLQA 2VKHA 2A3SA 1TNSA 1LFUP 4HAMA 4Q47A 4RGUA 2LBFA 4LJZF 2Z9OA 2F4OB 3I4PA 4ITVA 2QVOA 3BY6A 5IP7J 2Q1ZB 3S1MJ 2DTZA 3CJRB 3BROA 5K7ZA 1XCBA 1GXQA 1B8IA 1MMGA 2L5QA 2V9VA 2E34A 2RNGA 4X0GA 1JUPA 2H6BA 5AONA 3BR6A 4Y4RA 4AM3A 4O5VA 3KETA 1SFXA 2RC4A 3VFZA 1MJ9A 5HODA 3OYCA 1HA8A 2EZHA 5CJ9A 3RKWA 2W4SA 2W84A 5FKKA 4IJAA 3H3UA 1J5YA 1E0EA 1VQ6I 4ESFA 3AG2H 5CVJA 1SFOJ 3A02A 1BW6A 1YOVB 1ACIA 3GBGA 3A03A 5JLXA 3TDUC 1BW5A 5M3MJ 2L9SA 2HU9A 1ULYA 2E1NA 2KLOA 3F8CA 4ASNA 3TGNA 4FQGA 3M07A 4DYRA 3GX4X 3U9GA 2DOEA 4XLPF 4PSXA 4BDZA 5HDGA 2JJ7A 2EA4A 1MIJA 1WJFA 1ZLJA 3DTKA 2DA7A 3E6BA 3C18A 2Q8KA 1FYKA 3FM3A 3J7ZI 5J4YA 3OS0A 3ZN0A 4ZYDA 5LEJA 1DDNA 2LY9A 5C4JJ 1K79A 3QU3A 4NB5A 4GO1A 1R1TA 4G12A 3JRIA 5DDGA 3Q0VA 3FMRA 2W00A 5HLIA 2VXDA 1QPIA 4PDKA 4N0BA 4KDPA 2CQKA 4E4HA 3DKYA 3HHHA 2M3AA 4GXOA 2DLLA 3KZIC 4GFBA 1W7PA 3IUOA 2UUZA 2HVRA 2ELHA 2NS8A 3M1CA 2ZMEB 4DOZA 5D6EA 3LA2A 4B3XA 1I3QJ 1YTYA 3HSFA 1FOYA 5E1XA 3TO6A 5C4XJ 2H1LA 3FXMA 2Z1DA 2ZBKA 4UV8A 2CUEA 4BBSJ 3VDXA 5GAEJ 2YU9J 1Z67A 4GYGA 1WJEA 3F9KA 4F93B 3PUFA 3HL2A 2JA6J 2OZ6A 2E1MB 2OZUA 2OQGA 4IRHA 2DT6A 2DTRA 2LK2A 1B9MA 4XICA 3IL2A 3HRTA 3IP4B 2IP2A 5JVGF 3AL0C 4LIVA 3KZZA 4EJUA 3LSMA 5J8FA 1OJLA 3R6SA 4I76A 1HQCA 1K7AA 3MKYB 4ENJA 1XCVA 1KU9A 2HNHA 3E3VA 4WF2A 1HDDC 1T0FA 3GWZA 2QQAA 1R4NB 2XKPA 3KP2A 3WE3A 2QKMB 1IUFA 2XUBA 3PNTA 4NDLA 4QIWN 3HOXJ 1A35A 2IS1A 4XORA 5DCMA 4HF1A 4AU7A 2EFNA 3CC4I 1ZK8A 2A5WA 2O9LA 1S8NA 4S04A 3JREA 4CSWA 1IZ1A 2VONA 3A2KA 1JUSA 5JI6A 3TEDA 4R79A 4A3JJ 1MJAA 2BV6A 1AKHA 1BI2A 2GIVA 1UHMA 1E3OC 2ME6A 1W36C 3CC7I 3PJRA 4IRGA 1KQ0A 2NVUB 2DT7B 2V1NA 2ID6A 3I4NJ 3KP6A 2W57A 2HDDA 3E5XA 5LEKA 1H0MA 4D5CA 2L0KA 5F27A 1XX5A 2O6GE 2G7UA 2QQBA 2K4BA 1OPCA 3M9AA 3V7RA 3DEUA 2RDPA 1OISA 5H20A 5IT3A 5BPDA 5IOZA 2CUJA 2EFOA 2YPRA 1IAWA 2DAOA 2ETHA 3GFJA 4G9YA 4XRSG 4XMYA 2XAUA 1G3TA 2L4MA 3S17J 1ON1A 3ZQIA 3WE2A 4M71A 3KYLA 3OSFA 3NARA 1U3EM 3BPXA 3FZVA 1CQTA 5LRRA 5FJ8J 1EH8A 4GDFA 4FX4A 3SJMA 3OR1C 4Q5SF 1G3SA 2JRTA 2DA3A 2OAZA 2H8RA 3HKZA 4RGXA 2CWEA 3I54A 3KLOA 4A3FJ 1PUFA 3CCEI 5FKMA 2Z33A 4H4KC 4XOPA 2RN7A 3K4CA 4F7ZA 3DEWA 5BPIA 2LNBA 1JJ6C 4IOAF 2A61A 5L3EA 2MLKA 3S14J 2RV8A 3WHCA 1XGOA 5KK1A 2V79A 4KITB 3QOEA 2M34A 5LD2C 3ZMSA 1LEAA 1YW7A 1FIAA 1G4DA 4UUSA 1WJAA 1FBSA 4F3QA 2R5YA 1MSFC 2LY1A 1YHQI 1T8IA 2H94A 4CZZA 4XR6A 3OYEA 2Y30A 3BTJA 3AG3H 2DA2A 4A12A 1ZYRF 1YX3A 4RDUA 4A93J 4OWRB 2ELJA 3W6VA 2COBA 4PSWA 4HDUA 5J1UA 1MDMB 1FBQA 2WAFA 2G0EA 2O5RA 2E1MC 3K70D 1X3WB 4D0PA 5F0HA 3DXJF 3J7YJ 4HZFA 3H3ZA 2KHMA 1J75A 1T08B 3C2HA 4D9JA 5KHDA 3NWTA 3M4OJ 4DGWB 4IHYA 1Y56A 2E2IJ 4OAYA 2ZO4A 1T95A 3I56I 2ZSHB 2EFWA 1T38A 3HRSA 1QVUA 4M74A 3DCFA 4PCQA 1R71A 1YRNB 3ZMDA 3E7LA 4P9FA 1T33A 4XONA 2OCCH 1ZGAA 3PO3J 3QAHA 4CA0A 3EUAA 2JWTA 4NQWB 1SD5A 2WY7Q 4EGZA 1TL8A 4XSXF 4RB2C 1SAUA 3K69A 3VPRA 1S6LA 1U6GA 2FD5A 3IRRA 4IZZA 2VC1A 4FE4A 1LE8A 4B4CA 1B9NA 2ICWG 2DXIA 2R7VA 2W25A 3H9JA 4RLFA 4Q48A 3CJQB 2M4KA 4PGGA 5CVIA 3WU1B 4CYCB 2HOAA 2AQEA 2V9KA 3BWGA 4EVIA 3FM5A 3HOYJ 1EKEA 1W0TA 2MD0A 5D4RA 2BOLA 4L0ZB 2VN2A 3H92A 3A0HC 2PI0A 1X1PA 3SZTA 4HPQA 2HQAA 3CDIA 1RETA 3V4GA 3CMAI 2M45A 1V3FA 3K4BA 4RB0A 3CO7C 2QBYB 4BQOA 4AIJA 2PMHA 1H88C 3DF8A 1YJ9I 1RC9A 3PUBA 1O3TA 3BT9A 3P9KA 3S16J 2EZIA 1DUXC 1PUEE 4WX9A 1QO0D 2R7QA 3DU6A 3H9GA 1FSEA 4BXUA 2HZDA 1TWCJ 3REOA 2R7FA 2QCOA 2VBZA 4DW6A 4W1UA 2VLAA 3EUHA 1Z3YA 1FMVA 4HLYA 2ME0A 1S7AA 3OY9A 2P0WA 2QGUA 4A69C 2LF7A 2BY0A 2DU9A 2O7OA 2DYSH 2OUMA 4Y3OA 3CCRI 3ESWB 2LMDA 3S3OA 1U9NA 1X1BA 3LAJA 4XLCA 3KYDB 3OS1A 4KIBA 2BEOA 5EEAA 4V2GA 3DBRB 1ZN2A 2DA1A 3ZN1A 5J47A 2R7ZJ 2W85A 1YX5A 3G4SI 1S7OA 1YFHA 3JR9A 1IN4A 4B3AA 3J81K 3AKZA 2M4GA 1J09A 2MA3A 3K1MA 1ETOA 3IWZA 2IA1A 2OTJI 5J1YA 1BC8C 1O3SA 4YELA 1E2XA 2JUGA 2M8EA 3R60A 2AHQA 4LOCA 3HRMA 3F3XA 5HDKA 1LB2A 3Q0WA 1NG6A 3ISPA 3WTVC 1S29A 1QZYA 1YJWI 4BE1A 3G71I 4ZDOA 4EJTA 3SEZA 2BHYA 3TP0A 2TRTA 2MFZA 1IXCA 2KL4A 2FJ1A 4KNYA 1FTTA 4XKBA 4ZC3A 3IHUA 1FMWA 2H8WA 3PQJA 2QA4I 4YFXF 5E17F 5B3SH 4B09A 1HDPA 2KZVA 4P1WA 1X1CA 2VB6A 3T1BA 1IN5A 1OQYA 3EDPA 1MMSA 1DGRM 1D0YA 2RNJA 4L9TA 3JRGA 1FOXA 2BBYA 3QODA 4F92B 2CRGA 5HS9A 2Y0SN 2EB7A 3COAC 3SFZA 1Z6RA 1WJCA 3OYDA 4F52A 1B59A 1IC8A 5FFXA 4QWQA 4AIHA 1R23A 3G3ZA 3QYEA 1LVKA 1SMYF 4N9HA 5DUKA 1S5LC 1BJAA 4BQNA 1HOMA 4XM3A 3FXRA 3QPSA 4PK4A 3DTIA 5E3LA 1Y8QB 4AYBN 4EEFG 1UHWA 4G94A 2R7UA 3KEOA 1GVJA 3DV8A 2K9SA 3HOSA 1Z05A 4LIUA 2K40A 3CCSI 4NC6A 2GAUA 3EYYA 3HM5A 1UHSA 3VSLA 3F8BA 3H35A 3QOPA 3QRFF 3BR0A 3WODF 1D1CA 3RYPA 1YLFA 1XMAA 2LREA 3FMSA 5KAFC 4GCVA 1ONVA 2GXAA 1A5JA 4N9IA 3MEXA 1LQ1A 2OV7A 4LK1F 1F9NA 3E1SA 4Y33A 5LGNA 2ZJPF 2G9WA 1NH3A 3N05A 3CDHA 1DP7P 3QPTA 5CVVA 2LLKA 4HX7A 4EV0A 3JRDA 5LGTA 4BL0B 2NNNA 3WTSC 1HKTA 2DBBA 3KCCA 3SZGA 3FBNB 3N97A 1R00A 3E6MA 1VQ9I 1W36D 3HIFA 1U0JA 4MEXF 2LYCA 2L02A 2VQLA 3IV5A 2P5VA 3AG4H 4IHXA 3PO2J 3VOEA 1Q1HA 2LKPA 2XSJC 4UVBA 1VQLI 1GDTA 2PMZN 1P4XA 1STZA 1S72I 1HCRA 1R1VA 2EJRA 4LD5A 3U1DA 3W6KB 1FX7A 2W48A 2HOEA 3Q9VA 3TO7A 3J80K 4BDYA 2A6TA 3ZMVA 2MGQA 1HSJA 3K4LA 1EJ9A 3FF5A 4HSTA 2K5CA 4M9XA 4N4NB 2NS7A 2XGEA 3E6DA 3PM1A 1ETQA 1BJZA 3I64A 4C2TA 1I27A 4O6JA 4YIFA 4PJ0C 2A69F 2WTEA 1YS7A 4A0YA 2HVSA 2IRFG 2A6EF 2HWVA 3DWLE 5FRNA 3VEPA 1X1AA 5HLHA 2JT1A 2E5ZA 1J2XA 3GZ6A 3OYIA 5FLXK 3IC7A 3S8PA 1JHHA 2Y31A 2ZB9A 3DU5A 5D5WB 2VE8A 3KPHA 2CW8A 3K70C 5HDNA 1R22A 2X6YA 2LDUA 2KDOA 3E5UA 2AQFA 3WG9A 2HOSA 4ZDPA 2STWA 2CH0A 2NYXA 4ZTJA 1MGTA 3KX2A 2DODA 3HOWJ 2VOPA 1XD7A 3L2QA 3JTGA 3IWFA 4A3EJ 2X0LA 4G6TB 3F6OA 1V54H 3G6EI 1UMQA 1K78A 4DYCA 1HLVA 3CUOA 2P7VB 1SD4A 5E3OA 4B47A 1QHGA 3B6CA 4IXAA 4HV6A 4D7MA 1P4WA 2XKOA 2VJ5A 3FX3A 2OA4A 2LH9A 3CP8A 4UB6C 4XLFA 3GF2A 5B5EC 5J4VA 3IRQA 2R0QC 4YEJA 2PJRA 4A3LJ 3DLLF 2VBWA 1GVDA 3FKIJ 2HOTA 1IXRC 4HQEA 5HOOA 2JA8J 1N78A 4E7JA 4J01A 4UXNA 1IW7F 5J6XA 1G6NA 2KQRA 2H6CA 1MH3A 2UZKA 1O3QA 2PX9A 2M87A 3O6BB 4D5FA 1ZGWA 4FETA 4LK0F 2WAEA 2FX0A 4C3HJ 3W6JB 3BP8A 3HRUA 1JE8A 4LG0A 2AXTC 5FRMA 2K85A 2Y2ZA 5LFAA 1E17A 1TZLA 2Z2SB 1OCPA 2VJ4A 3WU0A 4C3IJ 5M5XJ 3ZQHA 4IHWA 2FBIA 5B1BH 3QYFA 5BOXA 3RPQA 4AC0A 4RAYA 2KPMA 1K4TA 3AL0B 2IA2A 3WU2C 1IDYA 1UG0A 3F21A 1WKMA 2QF7A 4C3JJ 1HSTA 4A6EA 1OR7C 4I2OA 1D8KA 1FIPA 1IRZA 1U2WA 2V6CA 1U9OA 4A6DA 4B1RA 3S1RJ 2DMQA 1QRYA 2LY2A 1CGPA 3GTQJ 3PL8A 3W2VA 1SFKA 3E0JB 3EETA 2XAJA 3GZ5A 4OAZA 4E7SA 4UHTA 1TNTA 1XMXA 5HS7A 2IW5A 1TWFJ 1IRFA 1X4OA 2DMNA 1ODDA 2YX4A 1J0RA 2HQ5A 1ZREA 2LRDA 2KDZA 2R5ZB 3GTJJ 2GLOA 1D1AA 3GCMA 3G1LA 4P5OA 1XN7A 1YE9A 4BY1J 4OINF 1SVOA 2PMUA 5KNLA 4XK4A 2KP6A 3MKWB 4I02A 1X4PA 4ZTFA 2EQRA 1BI1A 4FHTA 4GGGA 4AIDA 4B8XA 4IX7A 4PUSA 3CJTB 2WV0A 2MG4A 2M30A 4S05A 4MO7A 3PFYA 2RQQA 1FBUA 1PJRA 2IA0A 3LA3A 1SD6A 3CTAA 1XGSA 1B6AA 2LOOA 2R4GA 2WY8Q 2GXGA 4QSHA 1S3JA 4Y13A 2EIJH 2CYYA 1U5TC 2BGCA 3KFWX 3S2WA 4IQJA 5HS8A 5M5YJ 4JYKA 2KZGA 1AU7A 4ESBA 3K4KA 3GMEA 2B9SA 1ZRCA 1ZG5A 3TBIA 1BC7C 3K0LA 1USTA 1LJ9A 4HQMA 1ZRFA 1EV7A 1B1BA 3LSJA 4HOBA 4OIPF 2IGNA 3KEQA 2P5LC 2JZYA 3DPTA 4O3MA 4E7HA 4CH7A 1MH4A 1Z1DA 1FPQA 1E3PA 2VASA 4I0AA 2HXIA 4CZCA 4BGDA 3JAMK 4E7LA 4HBLA 3OYAA 4G7OF 1Y0UA 1LKXA 1KYZA 2ZFUA 1OFCX 4YG2F 2L7KA 4JOMA 2E7WA 4HNTA 1CF7B 4CHUA 1HF0A 2F2EA 2XSDC 2D1VA 2UXXA 3LL7A 1HW1A 3GFMA 4KT6A 5GADJ 2XPVA 5LGUA 4M3FA 3FK6A 5F6FA 4WXCA 2EILH 2VKDA 1ZTRA 2TCTA 3A01A 2E36A 2ZXJA 1BOAA 2DA6A 4MFDA 2IAIA 2ZXWH 2A5YB 4RA2A 1O4XA 3ABTA 3BR5A 4RAZA 1D1BA 4KMFA 1Z7LA 1VQNI 1QHHD 4KJZA 1WH7A 4EJOA 4NC8A 3WGHA 4IF4A 4BJTA 2P6TA 1F4KA 3CMEI 2H1KA 1RIOH 2HI3A 5D5XB 5K5QA 2ISZA 1WHUA 2E19A 2M2EA 2X48A 2IS6A 5BNGA 2XASA 3MD2A 5EGOB 3JRBA 5ILSA 4G6DA 3I53A 3SDBA 1D8JA 2IEKA 2K7LA 2DW4A 3NWSA 4EM1A 2EIMH 1LPQA 3BJAA 1FYLA 1H8AC 4E7KA 2HTJA 3W2WA 3LSRA 2CFXA 3GFIA 2R5YB 1ENHA 2PLYA 2DDBA 3FK7A 2HR3A 3IAS2 3FKJA 3DP7A 1HXDA 1G3YA 1SANA 5HVQC 4I6ZA 2XV4S 2VQCA 3ERED 2VIXA
chains in the Genus database with same CATH topology
1ITYA 2GBYA 3G1OA 1D5YA 4RBOA 5EYRA 1RETA 1P7IA 1G2HA 2DMUA 2N8GA 3D1NI 1H88C 2XB0X 4QTRA 3BT9A 3S16J 2EZIA 2WB1N 4IEJA 1DU0A 3B6AA 5JLWA 3M3YJ 3G1MA 3NAUA 1TWCJ 3BR3A 1S7EA 2QCOA 3GTGJ 4DW6A 3GTLJ 1ETYA 4W1UA 1TWGJ 3OOUA 5K7FA 1ZKGA 5GP9A 1WCMJ 2ME0A 1MBHA 3CMYA 3GTMJ 4A69C 2O7OA 1MBGA 1ETWA 4M3BA 2DN0A 3LOCA 1U9NA 2R93J 3Q0UA 2ECCA 5EEAA 1B72A 2LTPA 1RR7A 4V2GA 1Z0XA 3C2BA 2DA1A 2NVTJ 2R7ZJ 4X6AJ 3JRHA 5IP6A 4V2FA 2JA5J 2M0CA 3JR9A 5DTDA 4B3AA 4XIDA 3HEFA 3S1QJ 3OIOA 5J3LA 1ZR2A 1ETOA 5E3NA 5J1YA 2AHQA 5F08A 2JN6A 3HBLA 2XB5A 4LOCA 1AKHB 2YUSA 2L7MP 4FCYA 3Q0WA 3BR2A 1IDZA 2ID3A 1WGXA 3FIWA 3HB9A 1ZQ3P 1MBEA 2MW8A 3S2DJ 5FKOA 2E1OA 2O8KA 2I10A 5F0CA 3Q3SA 3BTCA 3MN2A 1RPWA 1K83J 3BTIA 2Y9ZA 1JKPC 4FE7A 2YS9A 3TW7A 3TP0A 1JUMA 2TRTA 3ZQGA 2FJ1A 4DZPA 1FTTA 1POGA 4FTHA 4DYQA 1WH5A 4JX5A 1HDPA 3CQZJ 1R9TJ 2B63J 3BG9A 4D7NA 3ZQCA 2DA4A 2WAQN 3JRGA 3RZOJ 1X2MA 1PUFB 2CRGA 4S0HB 2LR8A 4BBRJ 4AUXA 2Y0SN 1ORKA 3ZOBA 1QVTA 2DMTA 5FKNA 4MLOA 2NVXJ 4M3EA 5J1RA 1IC8A 1OCTC 3HGGA 3TW6A 2NVQJ 5IP9J 2CJJA 4X1EA 1MBJA 1JKOC 2R5ZA 1TC3C 2JA7J 1HOMA 3I4MJ 1U8BA 5EG0A 5FKLA 3QPSA 4UUSB 1Z77A 2OF7A 5E3LA 4AYBN 2K9NA 4EEFG 3HOUJ 2DA5A 5GPAA 5FLMJ 2LKXA 2K9SA 1ZR4A 2K40A 1T56A 2EZKA 4HNVA 1F36A 1H89C 3JRAA 4A3IJ 2R92J 3HM5A 4JX6A 1UHSA 1JKQC 2ELKA 1JKRC 1IG7A 2HXOA 1XS9A 3BR0A 1JTXA 3QQAA 1FTZA 1Y1WJ 3A01B 3CCYA 2M8GX 2L7FP 1A5JA 1VFCA 5F04A 5IYDJ 3IH3A 3IH2A 9ANTA 2EH3A 3BQYA 4A3DJ 2XPWA 2LLKA 4M3GA 3H3VK 2XRLA 3JRDA 3S2HJ 1TWAJ 1LFUP 2D5VA 1RESA 2ECBA 1IJWC 3ZQFA 3IV5A 4IHXA 5IP7J 3PO2J 1LE8B 3S1MJ 2DTZA 2KT0A 5K7ZA 1GDTA 2PMZN 1W0UA 1B8IA 1HCRA 5FLVA 4L5EA 2OPTA 4MIMA 2W48A 3JRFA 3HGYA 1JUPA 1JT6A 2MGQA 3BR6A 3S15J 3OSGA 1ETKA 4XRSA 5HODA 5EZGA 1FJLA 2NS7A 2XGEA 3LSGA 3MVPA 3PM1A 1ETQA 2EZHA 1BJZA 5FKKA 5IOYA 5C44J 4Y7NJ 1SFOJ 3A02A 1BW6A 3K2AA 5E3MA 3GBGA 3A03A 5JLXA 2VKVA 4BY7J 1BW5A 5M3MJ 3WHBA 1YRNA 1XC5A 2NOGA 4A3MJ 4DYRA 4FISA 2VKEA 2Y31A 2ZB9A 5EGOA 2JJ7A 2DA7A 4A3BJ 3JRCA 3UKGA 3L1PA 3HKZN 2LY9A 5C4JJ 2CU7A 3JRIA 4G12A 1IGNA 3Q0VA 2HOSA 1GV5A 3O8GA 3HOWJ 1GUUA 3RZDJ 3BR1A 1QPIA 4CYCA 3F0CA 4A3EJ 1B72B 4GFBA 1UMQA 3H0GJ 4DYCA 1HLVA 1XG1A 4BKXA 2L7ZA 5E3OA 2NS8A 5GPCA 3B6CA 3LSPA 4D7MA 2L9RA 4A3LJ 1I3QJ 2R0QC 3QPLA 2GM4A 1GVDA 3FKIJ 5C4XJ 1X58A 1AHDP 2P81A 4DZJA 2HOTA 2CUEA 2JA8J 4BBSJ 2DMPA 2YU9J 1MH3A 2LP0A 1K61A 1FEXA 2JA6J 4D5FA 1ZGWA 1APLC 2VI6A 4C3HJ 2FX0A 1BL0A 4W97A 1F43A 2LK2A 5K7HA 2IBDA 1P7JA 2Y2ZA 4XICA 5F1JA 5M3FJ 2AO9A 3MKLA 5M5XJ 1OCPA 4C3IJ 2CQQA 3ZQHA 3HDDA 4IHWA 1Q1VA 3S1NJ 3K7AJ 1OJLA 1LFBA 3BQZA 4I76A 1VNDA 2LVSA 2LD5A 4AC0A 1HDDC 3ZQLA 1NK2P 1IDYA 1WI3A 4J19A 2QF7A 1BA5A 4C3JJ 1GV2A 1IUFA 4QIWN 3HOXJ 4NDLA 1IV6A 5F0FA 3SDGA 2E2HJ 3BTLA 2EZLA 5EZHA 1FIPA 1JTYA 1IRZA 1U9OA 4B1RA 3S1RJ 2DMQA 1ZK8A 1I6HJ 2O9LA 1QRYA 3GTQJ 3JREA 5EF6A 2XGCA 2JK3A 4IHVA 1JUSA 3TEDA 2VUMJ 3FISA 4C2MJ 4A3JJ 1AKHA 1E3OC 2ME6A 1TWFJ 4A3CJ 3RQIA 2DMNA 2ID6A 3I4NJ 1DU6A 2HQ5A 2XGDA 2HDDA 4D5CA 2L0KA 2KDZA 2R5ZB 2X6OA 5IPAA 3GTJJ 5IYCJ 5F27A 2GLOA 3GTPJ 5EG0B 2LFBA 3G1LA 4JP0A 4A3GJ 3RKQA 4BY1J 2FQ4A 2X9DA 5IOZA 1JGGA 1WPKA 4XRSG 4XK4A 3BG5A 1I50J 1VI0A 2E2JJ 3S17J 2EQRA 3ZQIA 3OSFA 1JJ8C 3NARA 2Y9YA 4M6VA 2MG4A 4A3KJ 1CQTA 4MO7A 1A6IA 5FJ8J 4ABZA 1TWHJ 2DJNA 2XPUA 4UUTA 4QSHA 5IYBJ 5M5WJ 3SJMA 4Y52J 3SFIA 2JMWA 2DA3A 2H8RA 4A3FJ 1PUFA 1JT0A 5M5YJ 5FKMA 2HYJA 4JYKA 1AU7A 3DEWA 1ETXA 2K9QA 1JJ6C 2EBIA 2M9HA 3CDLA 3S14J 3WHCA 3LNQA 2NVYJ 3IH4A 3GTOJ 3LSJA 1MNMC 2M34A 1FIAA 4UUSA 1EF4A 3O8HA 1MSFC 2R5YA 1MSEC 1MH4A 2HXIA 2Y30A 3BTJA 1Y1VJ 1RKWA 5C3EJ 2DA2A 1B8IB 1OFCX 4RDUA 4A93J 3W6VA 1MBFA 2COBA 1HF0A 5J1UA 2MSYA 2XSDC 4M3DA 1NTCA 2XPVA 4M3FA 3FK6A 2G0EA 4BXXJ 1ZTRA 5F0HA 2TCTA 3A01A 1UG2A 3HOZJ 2DA6A 4MFDA 1X2NA 1RKTA 2IAIA 1O4XA 3M4OJ 3BR5A 4IHYA 2E2IJ 2CUFA 1QVUA 5DS9A 3DCFA 1WH7A 3HOVJ 1NK3P 2WV1A 1YRNB 3E7LA 2H1KA 1T33A 2HI3A 5EDNA 3PO3J 3GTKJ 1ETVA 2E19A 2M2EA 2JWTA 2X48A 5BNGA 3JRBA 5EGOB 3TP3A 4XRMA 2IEKA 3VPRA 1H8AC 2FD5A 4FE4A 3BG3A 4B4CA 1LE8A 2CQXA 3LSRA 1U78A 1VF9A 4JX4A 2R5YB 2RAEA 4MFEA 1ENHA 1GT0C 4CYCB 3FK7A 2HOAA 1SANA 4I6ZA 3HOYJ 1W0TA 1MBKA 2VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITY A;  2GBY A;  3G1O A;  1D5Y A;  4RBO A;  5EYR A;  1RET A;  1P7I A;  1G2H A;  2DMU A;  2N8G A;  3D1N I;  1H88 C;  2XB0 X;  4QTR A;  3BT9 A;  3S16 J;  2EZI A;  2WB1 N;  4IEJ A;  1DU0 A;  3B6A A;  5JLW A;  3M3Y J;  3G1M A;  3NAU A;  1TWC J;  3BR3 A;  1S7E A;  2QCO A;  3GTG J;  4DW6 A;  3GTL J;  1ETY A;  4W1U A;  1TWG J;  3OOU A;  5K7F A;  1ZKG A;  5GP9 A;  1WCM J;  2ME0 A;  1MBH A;  3CMY A;  3GTM J;  4A69 C;  2O7O A;  1MBG A;  1ETW A;  4M3B A;  2DN0 A;  3LOC A;  1U9N A;  2R93 J;  3Q0U A;  2ECC A;  5EEA A;  1B72 A;  2LTP A;  1RR7 A;  4V2G A;  1Z0X A;  3C2B A;  2DA1 A;  2NVT J;  2R7Z J;  4X6A J;  3JRH A;  5IP6 A;  4V2F A;  2JA5 J;  2M0C A;  3JR9 A;  5DTD A;  4B3A A;  4XID A;  3HEF A;  3S1Q J;  3OIO A;  5J3L A;  1ZR2 A;  1ETO A;  5E3N A;  5J1Y A;  2AHQ A;  5F08 A;  2JN6 A;  3HBL A;  2XB5 A;  4LOC A;  1AKH B;  2YUS A;  2L7M P;  4FCY A;  3Q0W A;  3BR2 A;  1IDZ A;  2ID3 A;  1WGX A;  3FIW A;  3HB9 A;  1ZQ3 P;  1MBE A;  2MW8 A;  3S2D J;  5FKO A;  2E1O A;  2O8K A;  2I10 A;  5F0C A;  3Q3S A;  3BTC A;  3MN2 A;  1RPW A;  1K83 J;  3BTI A;  2Y9Z A;  1JKP C;  4FE7 A;  2YS9 A;  3TW7 A;  3TP0 A;  1JUM A;  2TRT A;  3ZQG A;  2FJ1 A;  4DZP A;  1FTT A;  1POG A;  4FTH A;  4DYQ A;  1WH5 A;  4JX5 A;  1HDP A;  3CQZ J;  1R9T J;  2B63 J;  3BG9 A;  4D7N A;  3ZQC A;  2DA4 A;  2WAQ N;  3JRG A;  3RZO J;  1X2M A;  1PUF B;  2CRG A;  4S0H B;  2LR8 A;  4BBR J;  4AUX A;  2Y0S N;  1ORK A;  3ZOB A;  1QVT A;  2DMT A;  5FKN A;  4MLO A;  2NVX J;  4M3E A;  5J1R A;  1IC8 A;  1OCT C;  3HGG A;  3TW6 A;  2NVQ J;  5IP9 J;  2CJJ A;  4X1E A;  1MBJ A;  1JKO C;  2R5Z A;  1TC3 C;  2JA7 J;  1HOM A;  3I4M J;  1U8B A;  5EG0 A;  5FKL A;  3QPS A;  4UUS B;  1Z77 A;  2OF7 A;  5E3L A;  4AYB N;  2K9N A;  4EEF G;  3HOU J;  2DA5 A;  5GPA A;  5FLM J;  2LKX A;  2K9S A;  1ZR4 A;  2K40 A;  1T56 A;  2EZK A;  4HNV A;  1F36 A;  1H89 C;  3JRA A;  4A3I J;  2R92 J;  3HM5 A;  4JX6 A;  1UHS A;  1JKQ C;  2ELK A;  1JKR C;  1IG7 A;  2HXO A;  1XS9 A;  3BR0 A;  1JTX A;  3QQA A;  1FTZ A;  1Y1W J;  3A01 B;  3CCY A;  2M8G X;  2L7F P;  1A5J A;  1VFC A;  5F04 A;  5IYD J;  3IH3 A;  3IH2 A;  9ANT A;  2EH3 A;  3BQY A;  4A3D J;  2XPW A;  2LLK A;  4M3G A;  3H3V K;  2XRL A;  3JRD A;  3S2H J;  1TWA J;  1LFU P;  2D5V A;  1RES A;  2ECB A;  1IJW C;  3ZQF A;  3IV5 A;  4IHX A;  5IP7 J;  3PO2 J;  1LE8 B;  3S1M J;  2DTZ A;  2KT0 A;  5K7Z A;  1GDT A;  2PMZ N;  1W0U A;  1B8I A;  1HCR A;  5FLV A;  4L5E A;  2OPT A;  4MIM A;  2W48 A;  3JRF A;  3HGY A;  1JUP A;  1JT6 A;  2MGQ A;  3BR6 A;  3S15 J;  3OSG A;  1ETK A;  4XRS A;  5HOD A;  5EZG A;  1FJL A;  2NS7 A;  2XGE A;  3LSG A;  3MVP A;  3PM1 A;  1ETQ A;  2EZH A;  1BJZ A;  5FKK A;  5IOY A;  5C44 J;  4Y7N J;  1SFO J;  3A02 A;  1BW6 A;  3K2A A;  5E3M A;  3GBG A;  3A03 A;  5JLX A;  2VKV A;  4BY7 J;  1BW5 A;  5M3M J;  3WHB A;  1YRN A;  1XC5 A;  2NOG A;  4A3M J;  4DYR A;  4FIS A;  2VKE A;  2Y31 A;  2ZB9 A;  5EGO A;  2JJ7 A;  2DA7 A;  4A3B J;  3JRC A;  3UKG A;  3L1P A;  3HKZ N;  2LY9 A;  5C4J J;  2CU7 A;  3JRI A;  4G12 A;  1IGN A;  3Q0V A;  2HOS A;  1GV5 A;  3O8G A;  3HOW J;  1GUU A;  3RZD J;  3BR1 A;  1QPI A;  4CYC A;  3F0C A;  4A3E J;  1B72 B;  4GFB A;  1UMQ A;  3H0G J;  4DYC A;  1HLV A;  1XG1 A;  4BKX A;  2L7Z A;  5E3O A;  2NS8 A;  5GPC A;  3B6C A;  3LSP A;  4D7M A;  2L9R A;  4A3L J;  1I3Q J;  2R0Q C;  3QPL A;  2GM4 A;  1GVD A;  3FKI J;  5C4X J;  1X58 A;  1AHD P;  2P81 A;  4DZJ A;  2HOT A;  2CUE A;  2JA8 J;  4BBS J;  2DMP A;  2YU9 J;  1MH3 A;  2LP0 A;  1K61 A;  1FEX A;  2JA6 J;  4D5F A;  1ZGW A;  1APL C;  2VI6 A;  4C3H J;  2FX0 A;  1BL0 A;  4W97 A;  1F43 A;  2LK2 A;  5K7H A;  2IBD A;  1P7J A;  2Y2Z A;  4XIC A;  5F1J A;  5M3F J;  2AO9 A;  3MKL A;  5M5X J;  1OCP A;  4C3I J;  2CQQ A;  3ZQH A;  3HDD A;  4IHW A;  1Q1V A;  3S1N J;  3K7A J;  1OJL A;  1LFB A;  3BQZ A;  4I76 A;  1VND A;  2LVS A;  2LD5 A;  4AC0 A;  1HDD C;  3ZQL A;  1NK2 P;  1IDY A;  1WI3 A;  4J19 A;  2QF7 A;  1BA5 A;  4C3J J;  1GV2 A;  1IUF A;  4QIW N;  3HOX J;  4NDL A;  1IV6 A;  5F0F A;  3SDG A;  2E2H J;  3BTL A;  2EZL A;  5EZH A;  1FIP A;  1JTY A;  1IRZ A;  1U9O A;  4B1R A;  3S1R J;  2DMQ A;  1ZK8 A;  1I6H J;  2O9L A;  1QRY A;  3GTQ J;  3JRE A;  5EF6 A;  2XGC A;  2JK3 A;  4IHV A;  1JUS A;  3TED A;  2VUM J;  3FIS A;  4C2M J;  4A3J J;  1AKH A;  1E3O C;  2ME6 A;  1TWF J;  4A3C J;  3RQI A;  2DMN A;  2ID6 A;  3I4N J;  1DU6 A;  2HQ5 A;  2XGD A;  2HDD A;  4D5C A;  2L0K A;  2KDZ A;  2R5Z B;  2X6O A;  5IPA A;  3GTJ J;  5IYC J;  5F27 A;  2GLO A;  3GTP J;  5EG0 B;  2LFB A;  3G1L A;  4JP0 A;  4A3G J;  3RKQ A;  4BY1 J;  2FQ4 A;  2X9D A;  5IOZ A;  1JGG A;  1WPK A;  4XRS G;  4XK4 A;  3BG5 A;  1I50 J;  1VI0 A;  2E2J J;  3S17 J;  2EQR A;  3ZQI A;  3OSF A;  1JJ8 C;  3NAR A;  2Y9Y A;  4M6V A;  2MG4 A;  4A3K J;  1CQT A;  4MO7 A;  1A6I A;  5FJ8 J;  4ABZ A;  1TWH J;  2DJN A;  2XPU A;  4UUT A;  4QSH A;  5IYB J;  5M5W J;  3SJM A;  4Y52 J;  3SFI A;  2JMW A;  2DA3 A;  2H8R A;  4A3F J;  1PUF A;  1JT0 A;  5M5Y J;  5FKM A;  2HYJ A;  4JYK A;  1AU7 A;  3DEW A;  1ETX A;  2K9Q A;  1JJ6 C;  2EBI A;  2M9H A;  3CDL A;  3S14 J;  3WHC A;  3LNQ A;  2NVY J;  3IH4 A;  3GTO J;  3LSJ A;  1MNM C;  2M34 A;  1FIA A;  4UUS A;  1EF4 A;  3O8H A;  1MSF C;  2R5Y A;  1MSE C;  1MH4 A;  2HXI A;  2Y30 A;  3BTJ A;  1Y1V J;  1RKW A;  5C3E J;  2DA2 A;  1B8I B;  1OFC X;  4RDU A;  4A93 J;  3W6V A;  1MBF A;  2COB A;  1HF0 A;  5J1U A;  2MSY A;  2XSD C;  4M3D A;  1NTC A;  2XPV A;  4M3F A;  3FK6 A;  2G0E A;  4BXX J;  1ZTR A;  5F0H A;  2TCT A;  3A01 A;  1UG2 A;  3HOZ J;  2DA6 A;  4MFD A;  1X2N A;  1RKT A;  2IAI A;  1O4X A;  3M4O J;  3BR5 A;  4IHY A;  2E2I J;  2CUF A;  1QVU A;  5DS9 A;  3DCF A;  1WH7 A;  3HOV J;  1NK3 P;  2WV1 A;  1YRN B;  3E7L A;  2H1K A;  1T33 A;  2HI3 A;  5EDN A;  3PO3 J;  3GTK J;  1ETV A;  2E19 A;  2M2E A;  2JWT A;  2X48 A;  5BNG A;  3JRB A;  5EGO B;  3TP3 A;  4XRM A;  2IEK A;  3VPR A;  1H8A C;  2FD5 A;  4FE4 A;  3BG3 A;  4B4C A;  1LE8 A;  2CQX A;  3LSR A;  1U78 A;  1VF9 A;  4JX4 A;  2R5Y B;  2RAE A;  4MFE A;  1ENH A;  1GT0 C;  4CYC B;  3FK7 A;  2HOA A;  1SAN A;  4I6Z A;  3HOY J;  1W0T A;  1MBK A;  2VPR A; 
#chains in the Genus database with same CATH topology
 4XBF A;  1YI2 I;  3FWE A;  1WI9 A;  1ZLK A;  2F5F A;  3SQN A;  4RBO A;  2VL8 A;  5CPR B;  3VYU B;  3MZY A;  3W3C A;  2K02 A;  3TQN A;  1MNE A;  2VPL A;  2N8G A;  2DK8 A;  3D1N I;  2FE3 A;  3M1E A;  2CS3 A;  2XB0 X;  2P8T A;  5JFR A;  3SZP A;  1SAX A;  2WB1 N;  3OS2 A;  1DU0 A;  3A1Y A;  5JLW A;  4G7H F;  2UWM A;  3NAU A;  2OJE D;  5E79 C;  3V7C A;  3BR3 A;  1S7E A;  1QBJ A;  4U88 A;  4WXD A;  3GTL J;  1TWG J;  2DCE A;  2O8X A;  3OV8 A;  2NRA C;  2X4H A;  5K7F A;  5FD5 A;  3ERM A;  1T0F C;  1O7F A;  3CMY A;  1I1S A;  2VC0 A;  3T8R A;  1K4S A;  3CCV I;  1BR1 A;  1FP2 A;  2G7H A;  5TIS C;  5D8L B;  4YFN F;  3PIO F;  3Q0U A;  5DCF A;  4OIO F;  2VT3 A;  1OCC H;  3C2B A;  4CDG A;  4M6Y A;  1QQI A;  2HYF A;  2VQG A;  4K2E A;  3R0J A;  2ZME A;  3HTU A;  2VOO A;  1YQA A;  5H6Q A;  2CO5 A;  5IP6 A;  1LNW A;  2BY1 A;  3ZR8 X;  2DO7 A;  2DT5 A;  1OKR A;  1R1U A;  5FFZ A;  1JXS A;  3HEF A;  3TOB A;  3S1Q J;  4XNF A;  1C0W A;  4XL9 A;  2FML A;  3AFH A;  1JHF A;  5BS6 A;  3KP5 A;  2BYV E;  5CQG A;  1Z3X A;  2YUS A;  1BIB A;  2L4A A;  1NHA A;  2K9L A;  2L01 A;  1IDZ A;  2MLG A;  5DUI A;  1Z21 A;  2ZCW A;  1Z7U A;  2QLZ A;  4ZYA A;  2ZXI A;  4U0V A;  3S2D J;  5EJC A;  3BDD A;  2QQ9 A;  2E1O A;  3HSE A;  3A4C A;  2I10 A;  3L00 A;  3Q3S A;  3BTC A;  3L7W A;  1RPW A;  1JKP C;  4FE7 A;  3RTR A;  2YS9 A;  2OU2 A;  1VQO I;  3ZQG A;  3WGI A;  1EH7 A;  2IS2 A;  5J8C A;  2IGM A;  1Y6I A;  3I5U A;  1IN7 A;  4OIQ F;  3QP6 A;  4LIT A;  3UNG C;  4IVN A;  5LRS A;  2ZSI B;  1R9T J;  2B63 J;  3BG9 A;  4D7N A;  3ZQC A;  3E5Q A;  3FXQ A;  4PFO A;  1IUY A;  2Y48 A;  2LR8 A;  5ILV A;  1R5H A;  1UCR A;  3GFL A;  1TW2 A;  3H5A A;  5FKN A;  4AYB A;  5JHU A;  4RMN A;  2I5U A;  4U7D A;  4MLO A;  1Z9C A;  1I6X A;  2NVX J;  2JA2 A;  5J1R A;  1OCT C;  2DPD A;  2BY2 A;  2ZNZ A;  3HGG A;  1ZGJ A;  1IN8 A;  4P9U A;  5TJJ A;  2J5P A;  3HJE A;  4UV9 A;  2BVL A;  2L9V A;  1KGS A;  1LUJ B;  4XKC A;  5FKL A;  2XC7 A;  1OLT A;  2M0M A;  5KAI C;  2K9N A;  5K5O A;  3CUQ B;  3KYC B;  2VJJ A;  3M8F A;  3OIP A;  4M73 A;  4U87 A;  3DBH B;  5ICE A;  2LKX A;  1KYW A;  4L9V A;  2MD5 A;  1ZR4 A;  2RQP A;  1T56 A;  2EZK A;  4HNV A;  1H89 C;  2ZKZ A;  3OL4 A;  4A0X A;  5H2F C;  1OYY A;  3G2B A;  2FSW A;  1YO5 C;  3DQV C;  1DP3 A;  4M9Z A;  3F8M A;  3QQA A;  2O61 A;  3SXY A;  3MCZ A;  2P5K A;  3LST A;  3V42 A;  4IOC F;  1VFC A;  5IYD J;  3R4K A;  4LLG F;  4KUM A;  3J7A Y;  9ANT A;  4HW0 A;  1XDU A;  3P9I A;  4U0W A;  5ICC A;  2EH3 A;  3BQY A;  2FA5 A;  3V8L A;  4A3D J;  2Y69 H;  4E7Z A;  3H3V K;  4M3G A;  2HVQ A;  1MZB A;  2KRC A;  2PMZ A;  2MBF A;  3S2H J;  3HPH A;  1AA7 A;  4PZJ A;  4KIS A;  3LSH A;  2GA2 A;  2CGP A;  1RES A;  2NS0 A;  4HG2 A;  2AS5 F;  1AOY A;  3Q5F A;  2YX7 A;  2DJI A;  2O0Y A;  3JCU C;  2NAZ A;  5GAG J;  2PJP A;  2OPT A;  3HUG B;  2PN6 A;  1T39 A;  1MDM A;  1MMA A;  1X19 A;  2GXB A;  2VJI A;  3H9Q A;  2DFI A;  4BEH B;  4ZZL A;  3HTS B;  4PGH A;  4FX0 A;  1R7J A;  4XRS A;  3OSG A;  3GUD A;  3RPU D;  1FJL A;  3BCA A;  1TTY A;  5KVR A;  3CD6 I;  4EJV A;  1KQ9 A;  5EEG A;  5IOY A;  3H1C A;  3H5R A;  2ACJ A;  5C44 J;  5CVU A;  5F1R A;  2YSR A;  2EPF A;  1QGP A;  3K2A A;  5BMZ A;  5E3M A;  1W1W E;  4EM2 A;  3EYI A;  2OC6 A;  2KJC A;  2VKV A;  1OCR H;  3WHB A;  1YRN A;  3EUH C;  3OYM A;  2R7R A;  3K2Z A;  3CLO A;  4GYI A;  3U21 A;  2NOG A;  2ISY A;  3C3W A;  3QYB A;  5FD6 A;  4A3M J;  2EIK H;  5DM7 F;  4FIS A;  1XPX A;  4ENM A;  2VKE A;  4HV5 A;  4QLC U;  4NQW A;  4II2 A;  3JRC A;  1HKQ A;  1N25 A;  3UKG A;  2DFE A;  3HKZ N;  4PFP A;  2CU7 A;  4ZDL A;  3K1N A;  4EQQ A;  4ZZD A;  4YII A;  1T6S A;  1GV5 A;  3KZY A;  4RAF A;  3T0Y A;  2IXS A;  1GUU A;  1YYV A;  3BR1 A;  5DEQ A;  1UAA A;  1YS6 A;  4CYC A;  1B72 B;  3H0G J;  3BZ6 A;  4BKX A;  2OQR A;  1GLN A;  2L7Z A;  2BW3 B;  2FMY A;  4MQV A;  5GPC A;  1V5F A;  4KYW A;  2L9R A;  3GYH X;  4CCM A;  4RM2 A;  3ECH A;  3QPL A;  3PIP F;  4MGR A;  4CCJ A;  3CF5 F;  4KMU X;  1WSU A;  1X58 A;  1AHD P;  2F5E A;  3CUQ C;  5DD4 A;  2DMP A;  1X3U A;  2KRH A;  3ZRG A;  2LP0 A;  1G3W A;  1K61 A;  1FEX A;  4EAT A;  4RB1 A;  4HLX A;  5ERI A;  2VI6 A;  2IVM A;  2GA1 A;  2X51 A;  1T98 A;  1F43 A;  2IBD A;  1P7J A;  5K1Y A;  3OYL A;  1ZEL A;  2WWY A;  3C1D A;  3MKL A;  3HYI A;  2CQQ A;  3HDD A;  2IGK A;  3D5S C;  1Q1V A;  3S1N J;  3K7A J;  4DIQ A;  3E6C C;  2LC2 A;  1LFB A;  3BQZ A;  3DFG A;  4KT5 C;  1VND A;  2LVS A;  4BU2 A;  2LD5 A;  2BVM A;  2QSG X;  5FGM A;  1W7P D;  3IKV A;  2FBK A;  2ESH A;  4J19 A;  1BA5 A;  3BZK A;  2BXZ A;  1IV6 A;  3ROU A;  5F0F A;  3SDG A;  4A5M A;  2E2H J;  3BTL A;  4CCO A;  2EZL A;  5EZH A;  1VZ0 A;  2QEN A;  1JTY A;  2KJB A;  1FP1 D;  3ZPL A;  2WBM A;  4RAG A;  4CUG A;  1MND A;  2QM3 A;  3WTY C;  2XGC A;  4BE0 A;  4BJ5 C;  4HF0 A;  4IHV A;  2VUM J;  3TOA A;  2JVH A;  3FIS A;  5CKT A;  1RI7 A;  4A3C J;  2VQH A;  2IJL A;  4BJ6 C;  5D6F A;  1SFU A;  1FOW A;  1XB4 A;  1DU6 A;  2XGD A;  2PFB A;  2HTS A;  2X6O A;  4PJN A;  4CCN A;  5IYC J;  3GTP J;  5EG0 B;  2LFB A;  2DOF A;  2RGV A;  3O3K A;  1WJD A;  2FQ4 A;  3M8J A;  4I09 A;  1JGG A;  3BPV A;  1WPK A;  2FXA A;  4MEY F;  2X6W A;  3LSK A;  5D8K B;  2E35 A;  4J00 A;  3BG5 A;  2ZC2 A;  3K9T A;  5A2Q Z;  3P5J A;  1YIT I;  2Y9Y A;  3V7S A;  4KA4 A;  2QKL B;  2X1C A;  4A3K J;  3T8T A;  2Q2E B;  4ON0 A;  3RKY A;  2DK5 A;  3PQK A;  2KIS A;  2VBY A;  2DJN A;  2XPU A;  5IYB J;  4E6K G;  5M5W J;  1HC8 A;  2OD5 A;  1PDN C;  2JMW A;  2YR2 A;  3R0A A;  2ZXH A;  3I71 A;  5IY5 H;  1JT0 A;  1OCO H;  2HYJ A;  2A68 F;  2JTV A;  2HQR A;  4B44 A;  3RKX A;  2K9Q A;  2M9H A;  3MKZ A;  3LNQ A;  2NVY J;  1U5T B;  3MAJ A;  1RUN A;  2UXN A;  1LVA A;  2GOM A;  3O2P E;  4UVC A;  3ULQ B;  2RRE A;  3KP3 A;  4JK1 X;  2LBF B;  3O8H A;  1R5I D;  2EFQ A;  3MFK A;  1MSE C;  1YJN I;  2D1H A;  3I55 I;  5C3E J;  1B8I B;  2ZNY A;  5HLG A;  1OCZ H;  3NRV A;  2MSY A;  2DFH A;  5JVT A;  4M3D A;  1MMN A;  2GOX B;  3J80 Z;  1R49 A;  1XSV A;  1TQM A;  5AIQ A;  2R3S A;  1D5V A;  2F6C A;  4F91 B;  5ICG A;  3E97 A;  1X2N A;  1E3H A;  4KIC A;  4IHT A;  1P9Q C;  3WGG A;  2CUF A;  1VQK I;  2ESN A;  1MJB A;  2EA2 A;  5DS9 A;  4L9N A;  5E1W A;  4YIR X;  1HW5 A;  2WV1 A;  3HHG A;  5CLS A;  4I98 B;  3GTK J;  2F5V A;  2AXL A;  2D2W A;  4LG3 A;  1OR7 A;  1I5Z A;  1IN6 A;  2CFO A;  2MYS A;  1R58 A;  1H9G A;  4GRI A;  4NNJ A;  5DD8 A;  4ENN A;  4RM3 A;  4PJM A;  2RVC A;  5H6R A;  1RZ4 A;  4XKW A;  3CES A;  5DM6 F;  1ZG3 A;  4C30 A;  5LHI A;  1FZP B;  4XSZ F;  4L18 B;  2IS4 A;  1VF9 A;  1W5C C;  2RKH A;  3ONQ A;  4JX4 A;  4ESJ A;  1KA8 A;  4HX4 A;  2OBP A;  4OIR F;  2CG4 A;  1PYV A;  1GT0 C;  4ENK A;  3GW2 A;  1W7P B;  3FHZ A;  2VPR A;  4AVP A;  2FUG 2;  4DQ2 A;  3OR2 C;  2CV2 A;  3MQ0 A;  2L2O A;  4OMZ A;  1QNT A;  5EYR A;  5L3D A;  2EFP A;  3B02 A;  2DMU A;  2XF6 A;  3IKT A;  3H36 A;  4IPA A;  2M1B A;  3D5L A;  4HA8 A;  1PVE A;  1LDJ A;  1PP8 F;  1QZE A;  4QTR A;  3OYG A;  3L2W A;  3ZP5 A;  4I0B A;  3KEY A;  4IEJ A;  3M3Y J;  3VYR B;  1EH6 A;  3G1M A;  4UY8 I;  1FNN A;  1ETY A;  4OMY A;  4BQQ A;  2X1D A;  3LQQ A;  5GP9 A;  2EV5 A;  3WTU C;  1FLI A;  1R6R A;  1D3Y A;  1MBG A;  3FXJ A;  3K6G A;  2HYG D;  2HPM A;  1ETW A;  4M3B A;  2P6S A;  2DN0 A;  1I39 A;  1D0X A;  2STT A;  3JW4 A;  4CGZ A;  4R1H A;  1XDS A;  1MW7 A;  2DDA A;  3CO6 C;  5IT9 Z;  4BS9 A;  4RB3 C;  2FEZ A;  3DKW A;  3M7G A;  3JRH A;  2KMU A;  5DCM B;  2Y0M A;  2WA0 A;  1FYM A;  5ILU A;  4BYY A;  2ADU A;  2M0C A;  4XRF A;  5DTD A;  4XID A;  4D1Q A;  1UJ8 A;  3OIO A;  5J3L A;  2K4J A;  3HG9 A;  5CQE A;  1ZR2 A;  4AD9 A;  2HZT A;  1JGS A;  4G6Q A;  1TQI A;  5F08 A;  2JN6 A;  3HBL A;  2XB5 A;  2CW7 A;  4BE2 A;  1AKH B;  3BOQ A;  2CQN A;  2IT0 A;  2L7M P;  2F48 A;  2LSO A;  1WGX A;  1AWC A;  1ZQ3 P;  5TGT A;  1MBE A;  5FKO A;  1ZRD A;  4RGR A;  2O8K A;  4MTD A;  3M8E A;  5F0C A;  2JSC A;  5LBQ A;  2NNY A;  1V4R A;  3ABU A;  3L09 A;  4LFU A;  3MN2 A;  1K83 J;  2VOD A;  3BTI A;  4AVZ A;  4EGY A;  2YU3 A;  3L9F A;  3TW7 A;  2V1U A;  3KP7 A;  3DLA A;  3F6V A;  1FOK A;  4ETS A;  4DZP A;  3ZCO A;  1POG A;  1WZ2 A;  2JUC A;  1V5G A;  1WQ2 A;  4JX5 A;  1Z6T A;  3TDZ C;  2GIZ A;  4NUB A;  1MD0 A;  5E8I A;  3CQZ J;  3ZXS A;  1HBX G;  1GHC A;  1NG7 A;  3F22 A;  2HDW A;  4LB6 B;  2IPQ X;  4MNU A;  2V26 A;  1DPR A;  4DBQ A;  2WAQ N;  3RZO J;  3VYT B;  3CCL I;  1U8R A;  2CW0 F;  2JVG A;  3ASN H;  4NBQ A;  1PUF B;  4HF2 A;  4S0H B;  2M7A A;  4AUX A;  4I01 A;  5ICF A;  1TT5 B;  2DMT A;  4LMY A;  4RS8 A;  4RLQ A;  4EJW A;  2W7N A;  4M3E A;  2QWW A;  2J5O A;  2DQL A;  3GVA A;  3TW6 A;  5E20 A;  5IP9 J;  1MBJ A;  4LLL A;  2R5Z A;  1A6Q A;  3I4M J;  2E60 A;  1BI3 A;  1A31 A;  3FMQ A;  1SVL A;  4UUS B;  1ZAR A;  1XMK A;  4CYD A;  3HOU J;  3PSF A;  1ZH5 A;  2BY3 A;  5GPA A;  1IXS B;  3QWL A;  1YW9 A;  4KIG A;  3JAM Z;  2HGC A;  4V19 K;  1WJ5 A;  3JRA A;  2JPB A;  3WTX C;  2R92 J;  2KIQ A;  3RSN A;  2E5N A;  3ZMZ A;  2JSP A;  4P96 A;  1IG7 A;  2C6Y A;  3GLX A;  5FO5 A;  1RRJ A;  3FBI B;  1IF1 A;  1FTZ A;  1Y1W J;  3K10 A;  1D0Z A;  1FSH A;  3CCY A;  2M8G X;  3VB2 A;  4TV7 A;  1MMD A;  3FXK A;  5DV5 A;  1A36 A;  3NQO A;  3JSP A;  2R7S A;  1OYW A;  3IH3 A;  1BOB A;  1QZZ A;  2HDC A;  2V6E A;  1IV8 A;  2DQR A;  2V4J C;  4U0Y A;  3L2C A;  2FNP A;  2XPW A;  2XRL A;  2HQN A;  4ZYE A;  1ERD A;  4PJL A;  4I7H A;  3CLQ A;  3K1P A;  5HNH A;  1J7K A;  3QP5 A;  4ZYG A;  2O03 A;  1TWA J;  3BZC A;  4XLH A;  2D5V A;  2ECB A;  1IJW C;  2B7E A;  3ZQF A;  2A07 F;  2LF8 A;  2VT2 A;  4FT8 A;  2HS5 A;  1P6R A;  5F64 A;  5JR3 A;  2K86 A;  3DKX A;  1L3L A;  1LE8 B;  2E7X A;  2F4I A;  2KT0 A;  2QUF A;  1W0U A;  1MKM A;  5FLV A;  4L5E A;  1RUO A;  3DTE A;  4MIM A;  3JRF A;  2W24 A;  5EEH A;  4Z2Y A;  1CF7 A;  3HGY A;  2D45 A;  3OIQ A;  1JI8 A;  1JT6 A;  1R36 A;  5JHF A;  4MTE A;  3S15 J;  4WK8 F;  4F55 A;  1ETK A;  4WXH A;  5EZG A;  3LSG A;  3LAP A;  3MVP A;  2FQ3 A;  4IL6 C;  3GO5 A;  1G59 A;  2X1E A;  4NC7 A;  1WFX A;  4MQ9 F;  1SFE A;  4Y7N J;  3GXO A;  1KQ8 A;  4P55 A;  2M7B A;  3HZJ A;  1F1Z A;  4BY7 J;  1XC5 A;  4RGS A;  3CP2 A;  2Z5U A;  3VOD A;  3I59 B;  5EGO A;  4G8X A;  3F72 A;  4A3B J;  2EV6 A;  2HFH A;  3OWT A;  3RI4 A;  4H0E A;  3L1P A;  1UEL B;  4LB5 A;  2Y0S A;  4CO8 A;  4AWX B;  1IGN A;  3OYN A;  1K6O A;  2FF4 A;  3O8G A;  2OTL I;  1REP C;  2ZME C;  3FXL A;  3RDI A;  4Q4Z F;  4M6X A;  4NHJ A;  3RZD J;  1QU3 A;  2KIM A;  2PEX A;  2NOJ B;  3L2U A;  1N77 A;  3F0C A;  3T5X A;  3HOT A;  3QU6 A;  2K3F A;  3BG7 A;  1XG1 A;  2XAF A;  2PG4 A;  4XOT A;  4CXF A;  3I59 A;  3LSP A;  3P9C A;  2QSF X;  2XVC A;  1EA3 A;  3DPL C;  3H0D A;  2GM4 A;  3MZ8 A;  2LKS A;  4JQF A;  2XIG A;  5D4S A;  2V7F A;  2P81 A;  3TO9 A;  4DZJ A;  1BI0 A;  2V9P A;  2QSH X;  4OU0 A;  4UUV A;  3FXU A;  3HPG A;  2FOW A;  2QZ8 A;  4ZH4 F;  1APL C;  2COM A;  1BL0 A;  3NEU A;  4W97 A;  3I0T A;  3RQ4 A;  3K4M A;  5K7H A;  3RYR A;  1A04 A;  1XGN A;  3N4M A;  5F1J A;  5M3F J;  4XN0 A;  3BG6 A;  1XSX A;  2XHK A;  4I99 C;  1J9I A;  3MMY B;  3SHF A;  4QPO A;  4KFC A;  2AO9 A;  5ED4 A;  1WVR A;  1H9T A;  3KIO A;  2PBI A;  4BXF A;  2VXZ A;  2JQ7 A;  3WTW C;  3ZQQ A;  1LEB A;  5B1A H;  2ZJ2 A;  3W2A A;  3UR3 C;  3ZQL A;  4XQF A;  1ON2 A;  4DJA A;  1NK2 P;  1WI3 A;  3HXL A;  4WCG A;  1FWZ A;  3U2R A;  1GV2 A;  2GQQ A;  3DPU A;  2XF5 A;  1M1E B;  4CIC A;  3EPZ A;  3SYT A;  2FRH A;  3GEZ A;  3LFK A;  2TDX A;  1LDD A;  1WJB A;  4BHB A;  1VTN C;  1I6H J;  1HW2 A;  2ZJR F;  3A0B C;  2GWR A;  3EQL F;  5EF6 A;  4L9J A;  5HNF A;  3RIR A;  5TRD A;  2JK3 A;  1QA6 A;  2VBX A;  1LFP A;  3ZMT A;  4C2M J;  1SVM A;  4AIK A;  3JTH A;  2F5C A;  3RQI A;  2ZJQ F;  5E18 F;  4ZYH A;  2KRF A;  4A0Z A;  1I1G A;  5IPA A;  2W1O A;  3OYK A;  4Z6Y A;  3BLY A;  1RR8 C;  3ECO A;  4JP0 A;  1KZH A;  3RKQ A;  4A3G J;  3KP4 A;  3K4J A;  2OCE A;  2H09 A;  2X9D A;  4QPQ A;  3I9V 2;  3RJP A;  1VQ8 I;  4R8H A;  2FBH A;  2MAB A;  1I50 J;  1VI0 A;  1ZHF A;  4WWC A;  2E2J J;  2A6H F;  3KLN A;  2V1D A;  2JPC A;  3SEQ A;  3PNV A;  3C7J A;  1JJ8 C;  3IAM 2;  3H5N A;  4M6V A;  1YIJ I;  3L2V A;  2DYR H;  1Z91 A;  1A6I A;  1W5T A;  3I58 A;  4ABZ A;  1FY7 A;  1TWH J;  4UUT A;  3PFI A;  5GTI C;  4Y52 J;  3SFI A;  1PP7 U;  4IO9 F;  5L3B A;  1YW8 A;  2P4W A;  5L3C A;  5LHH A;  2X85 A;  1LDK B;  1BR4 A;  2R7T A;  2XAG A;  5GAH J;  3K4N A;  1TT0 A;  2HKX A;  3MWM A;  4B43 A;  1FC3 A;  1W5S A;  3LSI A;  1ETX A;  2EV0 A;  2EBI A;  3CDL A;  1F5T A;  1YG2 A;  3WG7 H;  2HPI A;  2HKO A;  3IH4 A;  3GTO J;  3AAF A;  3CCJ I;  2EIN H;  2DOA A;  3ZQ7 A;  1MNM C;  4JBA A;  1Y39 A;  4BNC A;  5KCM A;  4E7I A;  4IRI A;  4YRV A;  3I3L A;  1K6Y A;  3DBL B;  4KIF A;  5LHG A;  4M9S A;  1EF4 A;  1DPU A;  3HSR A;  4HSR A;  4KN4 X;  3CUQ A;  3G73 A;  5FB2 A;  1N75 A;  4CCL A;  4BAY A;  5GTH C;  4HRI A;  2DPU A;  2BHZ A;  1P92 A;  1Y1V J;  1RKW A;  3OMY A;  2JRM A;  4B48 A;  1BN5 A;  3X2Q H;  4HDV A;  5AIP A;  4FAS D;  2XF7 A;  1MBF A;  3OYB A;  2V1X A;  5DYM A;  1R4M B;  2XRO A;  1NTC A;  2QQ8 A;  2R7X A;  1TP4 A;  4Y15 A;  4BXX J;  4L5J A;  3VSK A;  3LFU A;  3D0S A;  3J81 Z;  2QYO A;  4IHS A;  3CF2 A;  2VE9 A;  1UG2 A;  3FHN A;  2ZFW A;  3OYF A;  4BHC A;  2QBY A;  3HOZ J;  1TBX A;  1RKT A;  4BQA A;  2XDV A;  2O3F A;  1R5G A;  4E70 A;  2L3D A;  1BBY A;  3OL3 A;  1YIO A;  1X1D A;  3HOV J;  1TLH B;  1TW3 A;  1NK3 P;  1IRX A;  2K3P A;  5EDN A;  3ELK A;  3L2R A;  1ETV A;  1WRJ A;  1O57 A;  2M5W A;  3BJO A;  2L9N A;  2R7D A;  3DEE A;  3TP3 A;  4XRM A;  4HEA 2;  2KKO A;  3FDY A;  4HYE A;  3GZN B;  2Z16 A;  3ML6 A;  2CUZ A;  5FRO A;  1XTA A;  1FT9 A;  3PSI A;  3BG3 A;  2FU4 A;  2CQX A;  1U78 A;  4MHG A;  2FOK A;  2P7C B;  4LGW A;  2RAE A;  4MFE A;  2QEX I;  3HUG A;  1OYI A;  4UVA A;  1UB9 A;  2K27 A;  3AG1 H;  3EUK L;  4DNC A;  1P2F A;  5CVR A;  4C9Y A;  4BEH A;  5A2Q K;  1K78 B;  1L0O C;  2XAQ A;  3F8F A;  1MBK A;  3CMM A;  1ITY A;  5K5R A;  1XGM A;  1J59 A;  3OYH A;  2GBY A;  3G1O A;  1D5Y A;  2BZT A;  3TMO A;  3C2G A;  2PJR B;  1P7I A;  2XGX A;  1G2H A;  1V55 H;  4ZJZ A;  4N4O B;  1P4A A;  4IQ4 A;  1RNL A;  1USS A;  3CZ6 A;  1S9H A;  3CC2 I;  1VQ7 I;  1Y8R B;  3LQR A;  3B6A A;  4M72 A;  1WWX A;  4XLA A;  1SD7 A;  2KIF A;  3ABM H;  3CCQ I;  3S3M A;  4LG0 B;  1VQ4 I;  3ABL H;  3GTG J;  3GLL A;  3OOU A;  1ZKG A;  1WCM J;  4LLN A;  1MBH A;  2WAD A;  5L3G A;  3MZH A;  3GTM J;  1HKS A;  4XLN F;  1OMI A;  2BE5 F;  2KFD A;  3FXO A;  3LOC A;  1KU2 A;  2R93 J;  4L5I A;  3B73 A;  1SEU A;  4G7Z F;  2ECC A;  1B72 A;  2LTP A;  1RR7 A;  3ZMU A;  1Z0X A;  2NVT J;  4X6A J;  3PNY A;  2BW3 A;  3VWB A;  1BIA A;  4XN3 A;  5J40 A;  3U1K A;  3OYJ A;  3BC8 A;  4PJJ A;  6PAX A;  5D5U B;  4BHP A;  1DQU A;  2R7O A;  3J7A O;  2JA5 J;  4V2F A;  2XRN A;  1SC7 A;  3S93 A;  1W4M A;  1DGW Y;  3JSO A;  4UNO A;  4BAC A;  1G8X A;  1UFM A;  5E3N A;  3CCU I;  4HX8 A;  3CCM I;  1ZAO A;  3LMM A;  4CCK A;  2R7W A;  4FCY A;  3BR2 A;  2ID3 A;  2MC3 A;  3FIW A;  1UZC A;  3HB9 A;  4EM0 B;  4Y17 A;  2EWN A;  2MW8 A;  3RCO A;  4ANJ A;  4II3 A;  3ASO H;  4BUP A;  3VYS B;  2B0L A;  2Y9Z A;  1VQM I;  4UB8 C;  1JUM A;  2IGO A;  2E1C A;  2F5D A;  2WAQ A;  1GXP A;  4C2U A;  5HLT A;  4FTH A;  1X3Z B;  4DYQ A;  4IKF A;  1WH5 A;  2Y75 A;  3KE2 A;  1QPM A;  1XSD A;  2Z99 A;  3ZGK A;  2CQ7 A;  3TL4 X;  4YFK F;  5L3F A;  5E8G A;  4A2U A;  2PQ8 A;  1IRG A;  2Z3Y A;  2DA4 A;  5CYV A;  1X2M A;  3F23 A;  3V8J A;  4HNU A;  3CJN A;  3R61 A;  4BBR J;  1ZG1 A;  5D5V B;  4XKV A;  1B4A A;  1ORK A;  3S32 A;  2MH2 A;  3ZOB A;  1QVT A;  3LA7 A;  2BXY A;  2A05 A;  1SMT A;  5BQT A;  4U7B A;  2HEO A;  5FLX Z;  2MC4 A;  3S3N A;  3WTT C;  2LG4 A;  2L54 A;  2NXN B;  3D5R C;  1T2K A;  2NVQ J;  2CJJ A;  4X1E A;  1TQP A;  2X6X A;  1V5E A;  2EK5 A;  1JKO C;  3Q9S A;  1TC3 C;  3LWF A;  2JA7 J;  1U8B A;  2UV1 A;  5EG0 A;  2CV0 A;  1Z77 A;  2XAH A;  4XLE A;  1VQP I;  2OF7 A;  3TKY A;  2GZW A;  1KON A;  2KIU A;  2W82 A;  2WC2 A;  2DA5 A;  5B66 C;  2DI3 A;  2CV1 A;  1O3R A;  5FLM J;  2Q0O A;  3BJ6 A;  4DBR A;  2CSO A;  1VQ5 I;  3P7N A;  2DFF A;  3ABK H;  1F36 A;  4A3I J;  2E71 A;  2I8D A;  3HC7 A;  3V8K A;  2WB1 A;  4JX6 A;  1KU7 A;  4EMS A;  3OOP A;  1JKQ C;  2ELK A;  1JKR C;  2MH9 A;  2Q2E A;  2HXO A;  1XS9 A;  1I3A A;  1JTX A;  3RPU A;  5IT9 K;  1IO2 A;  1BR2 A;  1O7L A;  3A01 B;  4L0Y B;  4OOI A;  3WTZ A;  2FNA A;  2L7F P;  3QPH A;  4BH9 A;  3F8N A;  2CMP A;  5F04 A;  5E1Z B;  3IH2 A;  3BCB A;  2F4M B;  4KN7 X;  1KU3 A;  2K9M A;  4A5N A;  2H27 A;  1Y0N A;  1U5T A;  1BM9 A;  5LLQ A;  2VKH A;  2A3S A;  1TNS A;  1LFU P;  4HAM A;  4Q47 A;  4RGU A;  2LBF A;  4LJZ F;  2Z9O A;  2F4O B;  3I4P A;  4ITV A;  2QVO A;  3BY6 A;  5IP7 J;  2Q1Z B;  3S1M J;  2DTZ A;  3CJR B;  3BRO A;  5K7Z A;  1XCB A;  1GXQ A;  1B8I A;  1MMG A;  2L5Q A;  2V9V A;  2E34 A;  2RNG A;  4X0G A;  1JUP A;  2H6B A;  5AON A;  3BR6 A;  4Y4R A;  4AM3 A;  4O5V A;  3KET A;  1SFX A;  2RC4 A;  3VFZ A;  1MJ9 A;  5HOD A;  3OYC A;  1HA8 A;  2EZH A;  5CJ9 A;  3RKW A;  2W4S A;  2W84 A;  5FKK A;  4IJA A;  3H3U A;  1J5Y A;  1E0E A;  1VQ6 I;  4ESF A;  3AG2 H;  5CVJ A;  1SFO J;  3A02 A;  1BW6 A;  1YOV B;  1ACI A;  3GBG A;  3A03 A;  5JLX A;  3TDU C;  1BW5 A;  5M3M J;  2L9S A;  2HU9 A;  1ULY A;  2E1N A;  2KLO A;  3F8C A;  4ASN A;  3TGN A;  4FQG A;  3M07 A;  4DYR A;  3GX4 X;  3U9G A;  2DOE A;  4XLP F;  4PSX A;  4BDZ A;  5HDG A;  2JJ7 A;  2EA4 A;  1MIJ A;  1WJF A;  1ZLJ A;  3DTK A;  2DA7 A;  3E6B A;  3C18 A;  2Q8K A;  1FYK A;  3FM3 A;  3J7Z I;  5J4Y A;  3OS0 A;  3ZN0 A;  4ZYD A;  5LEJ A;  1DDN A;  2LY9 A;  5C4J J;  1K79 A;  3QU3 A;  4NB5 A;  4GO1 A;  1R1T A;  4G12 A;  3JRI A;  5DDG A;  3Q0V A;  3FMR A;  2W00 A;  5HLI A;  2VXD A;  1QPI A;  4PDK A;  4N0B A;  4KDP A;  2CQK A;  4E4H A;  3DKY A;  3HHH A;  2M3A A;  4GXO A;  2DLL A;  3KZI C;  4GFB A;  1W7P A;  3IUO A;  2UUZ A;  2HVR A;  2ELH A;  2NS8 A;  3M1C A;  2ZME B;  4DOZ A;  5D6E A;  3LA2 A;  4B3X A;  1I3Q J;  1YTY A;  3HSF A;  1FOY A;  5E1X A;  3TO6 A;  5C4X J;  2H1L A;  3FXM A;  2Z1D A;  2ZBK A;  4UV8 A;  2CUE A;  4BBS J;  3VDX A;  5GAE J;  2YU9 J;  1Z67 A;  4GYG A;  1WJE A;  3F9K A;  4F93 B;  3PUF A;  3HL2 A;  2JA6 J;  2OZ6 A;  2E1M B;  2OZU A;  2OQG A;  4IRH A;  2DT6 A;  2DTR A;  2LK2 A;  1B9M A;  4XIC A;  3IL2 A;  3HRT A;  3IP4 B;  2IP2 A;  5JVG F;  3AL0 C;  4LIV A;  3KZZ A;  4EJU A;  3LSM A;  5J8F A;  1OJL A;  3R6S A;  4I76 A;  1HQC A;  1K7A A;  3MKY B;  4ENJ A;  1XCV A;  1KU9 A;  2HNH A;  3E3V A;  4WF2 A;  1HDD C;  1T0F A;  3GWZ A;  2QQA A;  1R4N B;  2XKP A;  3KP2 A;  3WE3 A;  2QKM B;  1IUF A;  2XUB A;  3PNT A;  4NDL A;  4QIW N;  3HOX J;  1A35 A;  2IS1 A;  4XOR A;  5DCM A;  4HF1 A;  4AU7 A;  2EFN A;  3CC4 I;  1ZK8 A;  2A5W A;  2O9L A;  1S8N A;  4S04 A;  3JRE A;  4CSW A;  1IZ1 A;  2VON A;  3A2K A;  1JUS A;  5JI6 A;  3TED A;  4R79 A;  4A3J J;  1MJA A;  2BV6 A;  1AKH A;  1BI2 A;  2GIV A;  1UHM A;  1E3O C;  2ME6 A;  1W36 C;  3CC7 I;  3PJR A;  4IRG A;  1KQ0 A;  2NVU B;  2DT7 B;  2V1N A;  2ID6 A;  3I4N J;  3KP6 A;  2W57 A;  2HDD A;  3E5X A;  5LEK A;  1H0M A;  4D5C A;  2L0K A;  5F27 A;  1XX5 A;  2O6G E;  2G7U A;  2QQB A;  2K4B A;  1OPC A;  3M9A A;  3V7R A;  3DEU A;  2RDP A;  1OIS A;  5H20 A;  5IT3 A;  5BPD A;  5IOZ A;  2CUJ A;  2EFO A;  2YPR A;  1IAW A;  2DAO A;  2ETH A;  3GFJ A;  4G9Y A;  4XRS G;  4XMY A;  2XAU A;  1G3T A;  2L4M A;  3S17 J;  1ON1 A;  3ZQI A;  3WE2 A;  4M71 A;  3KYL A;  3OSF A;  3NAR A;  1U3E M;  3BPX A;  3FZV A;  1CQT A;  5LRR A;  5FJ8 J;  1EH8 A;  4GDF A;  4FX4 A;  3SJM A;  3OR1 C;  4Q5S F;  1G3S A;  2JRT A;  2DA3 A;  2OAZ A;  2H8R A;  3HKZ A;  4RGX A;  2CWE A;  3I54 A;  3KLO A;  4A3F J;  1PUF A;  3CCE I;  5FKM A;  2Z33 A;  4H4K C;  4XOP A;  2RN7 A;  3K4C A;  4F7Z A;  3DEW A;  5BPI A;  2LNB A;  1JJ6 C;  4IOA F;  2A61 A;  5L3E A;  2MLK A;  3S14 J;  2RV8 A;  3WHC A;  1XGO A;  5KK1 A;  2V79 A;  4KIT B;  3QOE A;  2M34 A;  5LD2 C;  3ZMS A;  1LEA A;  1YW7 A;  1FIA A;  1G4D A;  4UUS A;  1WJA A;  1FBS A;  4F3Q A;  2R5Y A;  1MSF C;  2LY1 A;  1YHQ I;  1T8I A;  2H94 A;  4CZZ A;  4XR6 A;  3OYE A;  2Y30 A;  3BTJ A;  3AG3 H;  2DA2 A;  4A12 A;  1ZYR F;  1YX3 A;  4RDU A;  4A93 J;  4OWR B;  2ELJ A;  3W6V A;  2COB A;  4PSW A;  4HDU A;  5J1U A;  1MDM B;  1FBQ A;  2WAF A;  2G0E A;  2O5R A;  2E1M C;  3K70 D;  1X3W B;  4D0P A;  5F0H A;  3DXJ F;  3J7Y J;  4HZF A;  3H3Z A;  2KHM A;  1J75 A;  1T08 B;  3C2H A;  4D9J A;  5KHD A;  3NWT A;  3M4O J;  4DGW B;  4IHY A;  1Y56 A;  2E2I J;  4OAY A;  2ZO4 A;  1T95 A;  3I56 I;  2ZSH B;  2EFW A;  1T38 A;  3HRS A;  1QVU A;  4M74 A;  3DCF A;  4PCQ A;  1R71 A;  1YRN B;  3ZMD A;  3E7L A;  4P9F A;  1T33 A;  4XON A;  2OCC H;  1ZGA A;  3PO3 J;  3QAH A;  4CA0 A;  3EUA A;  2JWT A;  4NQW B;  1SD5 A;  2WY7 Q;  4EGZ A;  1TL8 A;  4XSX F;  4RB2 C;  1SAU A;  3K69 A;  3VPR A;  1S6L A;  1U6G A;  2FD5 A;  3IRR A;  4IZZ A;  2VC1 A;  4FE4 A;  1LE8 A;  4B4C A;  1B9N A;  2ICW G;  2DXI A;  2R7V A;  2W25 A;  3H9J A;  4RLF A;  4Q48 A;  3CJQ B;  2M4K A;  4PGG A;  5CVI A;  3WU1 B;  4CYC B;  2HOA A;  2AQE A;  2V9K A;  3BWG A;  4EVI A;  3FM5 A;  3HOY J;  1EKE A;  1W0T A;  2MD0 A;  5D4R A;  2BOL A;  4L0Z B;  2VN2 A;  3H92 A;  3A0H C;  2PI0 A;  1X1P A;  3SZT A;  4HPQ A;  2HQA A;  3CDI A;  1RET A;  3V4G A;  3CMA I;  2M45 A;  1V3F A;  3K4B A;  4RB0 A;  3CO7 C;  2QBY B;  4BQO A;  4AIJ A;  2PMH A;  1H88 C;  3DF8 A;  1YJ9 I;  1RC9 A;  3PUB A;  1O3T A;  3BT9 A;  3P9K A;  3S16 J;  2EZI A;  1DUX C;  1PUE E;  4WX9 A;  1QO0 D;  2R7Q A;  3DU6 A;  3H9G A;  1FSE A;  4BXU A;  2HZD A;  1TWC J;  3REO A;  2R7F A;  2QCO A;  2VBZ A;  4DW6 A;  4W1U A;  2VLA A;  3EUH A;  1Z3Y A;  1FMV A;  4HLY A;  2ME0 A;  1S7A A;  3OY9 A;  2P0W A;  2QGU A;  4A69 C;  2LF7 A;  2BY0 A;  2DU9 A;  2O7O A;  2DYS H;  2OUM A;  4Y3O A;  3CCR I;  3ESW B;  2LMD A;  3S3O A;  1U9N A;  1X1B A;  3LAJ A;  4XLC A;  3KYD B;  3OS1 A;  4KIB A;  2BEO A;  5EEA A;  4V2G A;  3DBR B;  1ZN2 A;  2DA1 A;  3ZN1 A;  5J47 A;  2R7Z J;  2W85 A;  1YX5 A;  3G4S I;  1S7O A;  1YFH A;  3JR9 A;  1IN4 A;  4B3A A;  3J81 K;  3AKZ A;  2M4G A;  1J09 A;  2MA3 A;  3K1M A;  1ETO A;  3IWZ A;  2IA1 A;  2OTJ I;  5J1Y A;  1BC8 C;  1O3S A;  4YEL A;  1E2X A;  2JUG A;  2M8E A;  3R60 A;  2AHQ A;  4LOC A;  3HRM A;  3F3X A;  5HDK A;  1LB2 A;  3Q0W A;  1NG6 A;  3ISP A;  3WTV C;  1S29 A;  1QZY A;  1YJW I;  4BE1 A;  3G71 I;  4ZDO A;  4EJT A;  3SEZ A;  2BHY A;  3TP0 A;  2TRT A;  2MFZ A;  1IXC A;  2KL4 A;  2FJ1 A;  4KNY A;  1FTT A;  4XKB A;  4ZC3 A;  3IHU A;  1FMW A;  2H8W A;  3PQJ A;  2QA4 I;  4YFX F;  5E17 F;  5B3S H;  4B09 A;  1HDP A;  2KZV A;  4P1W A;  1X1C A;  2VB6 A;  3T1B A;  1IN5 A;  1OQY A;  3EDP A;  1MMS A;  1DGR M;  1D0Y A;  2RNJ A;  4L9T A;  3JRG A;  1FOX A;  2BBY A;  3QOD A;  4F92 B;  2CRG A;  5HS9 A;  2Y0S N;  2EB7 A;  3COA C;  3SFZ A;  1Z6R A;  1WJC A;  3OYD A;  4F52 A;  1B59 A;  1IC8 A;  5FFX A;  4QWQ A;  4AIH A;  1R23 A;  3G3Z A;  3QYE A;  1LVK A;  1SMY F;  4N9H A;  5DUK A;  1S5L C;  1BJA A;  4BQN A;  1HOM A;  4XM3 A;  3FXR A;  3QPS A;  4PK4 A;  3DTI A;  5E3L A;  1Y8Q B;  4AYB N;  4EEF G;  1UHW A;  4G94 A;  2R7U A;  3KEO A;  1GVJ A;  3DV8 A;  2K9S A;  3HOS A;  1Z05 A;  4LIU A;  2K40 A;  3CCS I;  4NC6 A;  2GAU A;  3EYY A;  3HM5 A;  1UHS A;  3VSL A;  3F8B A;  3H35 A;  3QOP A;  3QRF F;  3BR0 A;  3WOD F;  1D1C A;  3RYP A;  1YLF A;  1XMA A;  2LRE A;  3FMS A;  5KAF C;  4GCV A;  1ONV A;  2GXA A;  1A5J A;  4N9I A;  3MEX A;  1LQ1 A;  2OV7 A;  4LK1 F;  1F9N A;  3E1S A;  4Y33 A;  5LGN A;  2ZJP F;  2G9W A;  1NH3 A;  3N05 A;  3CDH A;  1DP7 P;  3QPT A;  5CVV A;  2LLK A;  4HX7 A;  4EV0 A;  3JRD A;  5LGT A;  4BL0 B;  2NNN A;  3WTS C;  1HKT A;  2DBB A;  3KCC A;  3SZG A;  3FBN B;  3N97 A;  1R00 A;  3E6M A;  1VQ9 I;  1W36 D;  3HIF A;  1U0J A;  4MEX F;  2LYC A;  2L02 A;  2VQL A;  3IV5 A;  2P5V A;  3AG4 H;  4IHX A;  3PO2 J;  3VOE A;  1Q1H A;  2LKP A;  2XSJ C;  4UVB A;  1VQL I;  1GDT A;  2PMZ N;  1P4X A;  1STZ A;  1S72 I;  1HCR A;  1R1V A;  2EJR A;  4LD5 A;  3U1D A;  3W6K B;  1FX7 A;  2W48 A;  2HOE A;  3Q9V A;  3TO7 A;  3J80 K;  4BDY A;  2A6T A;  3ZMV A;  2MGQ A;  1HSJ A;  3K4L A;  1EJ9 A;  3FF5 A;  4HST A;  2K5C A;  4M9X A;  4N4N B;  2NS7 A;  2XGE A;  3E6D A;  3PM1 A;  1ETQ A;  1BJZ A;  3I64 A;  4C2T A;  1I27 A;  4O6J A;  4YIF A;  4PJ0 C;  2A69 F;  2WTE A;  1YS7 A;  4A0Y A;  2HVS A;  2IRF G;  2A6E F;  2HWV A;  3DWL E;  5FRN A;  3VEP A;  1X1A A;  5HLH A;  2JT1 A;  2E5Z A;  1J2X A;  3GZ6 A;  3OYI A;  5FLX K;  3IC7 A;  3S8P A;  1JHH A;  2Y31 A;  2ZB9 A;  3DU5 A;  5D5W B;  2VE8 A;  3KPH A;  2CW8 A;  3K70 C;  5HDN A;  1R22 A;  2X6Y A;  2LDU A;  2KDO A;  3E5U A;  2AQF A;  3WG9 A;  2HOS A;  4ZDP A;  2STW A;  2CH0 A;  2NYX A;  4ZTJ A;  1MGT A;  3KX2 A;  2DOD A;  3HOW J;  2VOP A;  1XD7 A;  3L2Q A;  3JTG A;  3IWF A;  4A3E J;  2X0L A;  4G6T B;  3F6O A;  1V54 H;  3G6E I;  1UMQ A;  1K78 A;  4DYC A;  1HLV A;  3CUO A;  2P7V B;  1SD4 A;  5E3O A;  4B47 A;  1QHG A;  3B6C A;  4IXA A;  4HV6 A;  4D7M A;  1P4W A;  2XKO A;  2VJ5 A;  3FX3 A;  2OA4 A;  2LH9 A;  3CP8 A;  4UB6 C;  4XLF A;  3GF2 A;  5B5E C;  5J4V A;  3IRQ A;  2R0Q C;  4YEJ A;  2PJR A;  4A3L J;  3DLL F;  2VBW A;  1GVD A;  3FKI J;  2HOT A;  1IXR C;  4HQE A;  5HOO A;  2JA8 J;  1N78 A;  4E7J A;  4J01 A;  4UXN A;  1IW7 F;  5J6X A;  1G6N A;  2KQR A;  2H6C A;  1MH3 A;  2UZK A;  1O3Q A;  2PX9 A;  2M87 A;  3O6B B;  4D5F A;  1ZGW A;  4FET A;  4LK0 F;  2WAE A;  2FX0 A;  4C3H J;  3W6J B;  3BP8 A;  3HRU A;  1JE8 A;  4LG0 A;  2AXT C;  5FRM A;  2K85 A;  2Y2Z A;  5LFA A;  1E17 A;  1TZL A;  2Z2S B;  1OCP A;  2VJ4 A;  3WU0 A;  4C3I J;  5M5X J;  3ZQH A;  4IHW A;  2FBI A;  5B1B H;  3QYF A;  5BOX A;  3RPQ A;  4AC0 A;  4RAY A;  2KPM A;  1K4T A;  3AL0 B;  2IA2 A;  3WU2 C;  1IDY A;  1UG0 A;  3F21 A;  1WKM A;  2QF7 A;  4C3J J;  1HST A;  4A6E A;  1OR7 C;  4I2O A;  1D8K A;  1FIP A;  1IRZ A;  1U2W A;  2V6C A;  1U9O A;  4A6D A;  4B1R A;  3S1R J;  2DMQ A;  1QRY A;  2LY2 A;  1CGP A;  3GTQ J;  3PL8 A;  3W2V A;  1SFK A;  3E0J B;  3EET A;  2XAJ A;  3GZ5 A;  4OAZ A;  4E7S A;  4UHT A;  1TNT A;  1XMX A;  5HS7 A;  2IW5 A;  1TWF J;  1IRF A;  1X4O A;  2DMN A;  1ODD A;  2YX4 A;  1J0R A;  2HQ5 A;  1ZRE A;  2LRD A;  2KDZ A;  2R5Z B;  3GTJ J;  2GLO A;  1D1A A;  3GCM A;  3G1L A;  4P5O A;  1XN7 A;  1YE9 A;  4BY1 J;  4OIN F;  1SVO A;  2PMU A;  5KNL A;  4XK4 A;  2KP6 A;  3MKW B;  4I02 A;  1X4P A;  4ZTF A;  2EQR A;  1BI1 A;  4FHT A;  4GGG A;  4AID A;  4B8X A;  4IX7 A;  4PUS A;  3CJT B;  2WV0 A;  2MG4 A;  2M30 A;  4S05 A;  4MO7 A;  3PFY A;  2RQQ A;  1FBU A;  1PJR A;  2IA0 A;  3LA3 A;  1SD6 A;  3CTA A;  1XGS A;  1B6A A;  2LOO A;  2R4G A;  2WY8 Q;  2GXG A;  4QSH A;  1S3J A;  4Y13 A;  2EIJ H;  2CYY A;  1U5T C;  2BGC A;  3KFW X;  3S2W A;  4IQJ A;  5HS8 A;  5M5Y J;  4JYK A;  2KZG A;  1AU7 A;  4ESB A;  3K4K A;  3GME A;  2B9S A;  1ZRC A;  1ZG5 A;  3TBI A;  1BC7 C;  3K0L A;  1UST A;  1LJ9 A;  4HQM A;  1ZRF A;  1EV7 A;  1B1B A;  3LSJ A;  4HOB A;  4OIP F;  2IGN A;  3KEQ A;  2P5L C;  2JZY A;  3DPT A;  4O3M A;  4E7H A;  4CH7 A;  1MH4 A;  1Z1D A;  1FPQ A;  1E3P A;  2VAS A;  4I0A A;  2HXI A;  4CZC A;  4BGD A;  3JAM K;  4E7L A;  4HBL A;  3OYA A;  4G7O F;  1Y0U A;  1LKX A;  1KYZ A;  2ZFU A;  1OFC X;  4YG2 F;  2L7K A;  4JOM A;  2E7W A;  4HNT A;  1CF7 B;  4CHU A;  1HF0 A;  2F2E A;  2XSD C;  2D1V A;  2UXX A;  3LL7 A;  1HW1 A;  3GFM A;  4KT6 A;  5GAD J;  2XPV A;  5LGU A;  4M3F A;  3FK6 A;  5F6F A;  4WXC A;  2EIL H;  2VKD A;  1ZTR A;  2TCT A;  3A01 A;  2E36 A;  2ZXJ A;  1BOA A;  2DA6 A;  4MFD A;  2IAI A;  2ZXW H;  2A5Y B;  4RA2 A;  1O4X A;  3ABT A;  3BR5 A;  4RAZ A;  1D1B A;  4KMF A;  1Z7L A;  1VQN I;  1QHH D;  4KJZ A;  1WH7 A;  4EJO A;  4NC8 A;  3WGH A;  4IF4 A;  4BJT A;  2P6T A;  1F4K A;  3CME I;  2H1K A;  1RIO H;  2HI3 A;  5D5X B;  5K5Q A;  2ISZ A;  1WHU A;  2E19 A;  2M2E A;  2X48 A;  2IS6 A;  5BNG A;  2XAS A;  3MD2 A;  5EGO B;  3JRB A;  5ILS A;  4G6D A;  3I53 A;  3SDB A;  1D8J A;  2IEK A;  2K7L A;  2DW4 A;  3NWS A;  4EM1 A;  2EIM H;  1LPQ A;  3BJA A;  1FYL A;  1H8A C;  4E7K A;  2HTJ A;  3W2W A;  3LSR A;  2CFX A;  3GFI A;  2R5Y B;  1ENH A;  2PLY A;  2DDB A;  3FK7 A;  2HR3 A;  3IAS 2;  3FKJ A;  3DP7 A;  1HXD A;  1G3Y A;  1SAN A;  5HVQ C;  4I6Z A;  2XV4 S;  2VQC A;  3ERE D;  2VIX A; 
#chains in the Genus database with same CATH homology
 1ITY A;  2GBY A;  3G1O A;  1D5Y A;  4RBO A;  5EYR A;  1RET A;  1P7I A;  1G2H A;  2DMU A;  2N8G A;  3D1N I;  1H88 C;  2XB0 X;  4QTR A;  3BT9 A;  3S16 J;  2EZI A;  2WB1 N;  4IEJ A;  1DU0 A;  3B6A A;  5JLW A;  3M3Y J;  3G1M A;  3NAU A;  1TWC J;  3BR3 A;  1S7E A;  2QCO A;  3GTG J;  4DW6 A;  3GTL J;  1ETY A;  4W1U A;  1TWG J;  3OOU A;  5K7F A;  1ZKG A;  5GP9 A;  1WCM J;  2ME0 A;  1MBH A;  3CMY A;  3GTM J;  4A69 C;  2O7O A;  1MBG A;  1ETW A;  4M3B A;  2DN0 A;  3LOC A;  1U9N A;  2R93 J;  3Q0U A;  2ECC A;  5EEA A;  1B72 A;  2LTP A;  1RR7 A;  4V2G A;  1Z0X A;  3C2B A;  2DA1 A;  2NVT J;  2R7Z J;  4X6A J;  3JRH A;  5IP6 A;  4V2F A;  2JA5 J;  2M0C A;  3JR9 A;  5DTD A;  4B3A A;  4XID A;  3HEF A;  3S1Q J;  3OIO A;  5J3L A;  1ZR2 A;  1ETO A;  5E3N A;  5J1Y A;  2AHQ A;  5F08 A;  2JN6 A;  3HBL A;  2XB5 A;  4LOC A;  1AKH B;  2YUS A;  2L7M P;  4FCY A;  3Q0W A;  3BR2 A;  1IDZ A;  2ID3 A;  1WGX A;  3FIW A;  3HB9 A;  1ZQ3 P;  1MBE A;  2MW8 A;  3S2D J;  5FKO A;  2E1O A;  2O8K A;  2I10 A;  5F0C A;  3Q3S A;  3BTC A;  3MN2 A;  1RPW A;  1K83 J;  3BTI A;  2Y9Z A;  1JKP C;  4FE7 A;  2YS9 A;  3TW7 A;  3TP0 A;  1JUM A;  2TRT A;  3ZQG A;  2FJ1 A;  4DZP A;  1FTT A;  1POG A;  4FTH A;  4DYQ A;  1WH5 A;  4JX5 A;  1HDP A;  3CQZ J;  1R9T J;  2B63 J;  3BG9 A;  4D7N A;  3ZQC A;  2DA4 A;  2WAQ N;  3JRG A;  3RZO J;  1X2M A;  1PUF B;  2CRG A;  4S0H B;  2LR8 A;  4BBR J;  4AUX A;  2Y0S N;  1ORK A;  3ZOB A;  1QVT A;  2DMT A;  5FKN A;  4MLO A;  2NVX J;  4M3E A;  5J1R A;  1IC8 A;  1OCT C;  3HGG A;  3TW6 A;  2NVQ J;  5IP9 J;  2CJJ A;  4X1E A;  1MBJ A;  1JKO C;  2R5Z A;  1TC3 C;  2JA7 J;  1HOM A;  3I4M J;  1U8B A;  5EG0 A;  5FKL A;  3QPS A;  4UUS B;  1Z77 A;  2OF7 A;  5E3L A;  4AYB N;  2K9N A;  4EEF G;  3HOU J;  2DA5 A;  5GPA A;  5FLM J;  2LKX A;  2K9S A;  1ZR4 A;  2K40 A;  1T56 A;  2EZK A;  4HNV A;  1F36 A;  1H89 C;  3JRA A;  4A3I J;  2R92 J;  3HM5 A;  4JX6 A;  1UHS A;  1JKQ C;  2ELK A;  1JKR C;  1IG7 A;  2HXO A;  1XS9 A;  3BR0 A;  1JTX A;  3QQA A;  1FTZ A;  1Y1W J;  3A01 B;  3CCY A;  2M8G X;  2L7F P;  1A5J A;  1VFC A;  5F04 A;  5IYD J;  3IH3 A;  3IH2 A;  9ANT A;  2EH3 A;  3BQY A;  4A3D J;  2XPW A;  2LLK A;  4M3G A;  3H3V K;  2XRL A;  3JRD A;  3S2H J;  1TWA J;  1LFU P;  2D5V A;  1RES A;  2ECB A;  1IJW C;  3ZQF A;  3IV5 A;  4IHX A;  5IP7 J;  3PO2 J;  1LE8 B;  3S1M J;  2DTZ A;  2KT0 A;  5K7Z A;  1GDT A;  2PMZ N;  1W0U A;  1B8I A;  1HCR A;  5FLV A;  4L5E A;  2OPT A;  4MIM A;  2W48 A;  3JRF A;  3HGY A;  1JUP A;  1JT6 A;  2MGQ A;  3BR6 A;  3S15 J;  3OSG A;  1ETK A;  4XRS A;  5HOD A;  5EZG A;  1FJL A;  2NS7 A;  2XGE A;  3LSG A;  3MVP A;  3PM1 A;  1ETQ A;  2EZH A;  1BJZ A;  5FKK A;  5IOY A;  5C44 J;  4Y7N J;  1SFO J;  3A02 A;  1BW6 A;  3K2A A;  5E3M A;  3GBG A;  3A03 A;  5JLX A;  2VKV A;  4BY7 J;  1BW5 A;  5M3M J;  3WHB A;  1YRN A;  1XC5 A;  2NOG A;  4A3M J;  4DYR A;  4FIS A;  2VKE A;  2Y31 A;  2ZB9 A;  5EGO A;  2JJ7 A;  2DA7 A;  4A3B J;  3JRC A;  3UKG A;  3L1P A;  3HKZ N;  2LY9 A;  5C4J J;  2CU7 A;  3JRI A;  4G12 A;  1IGN A;  3Q0V A;  2HOS A;  1GV5 A;  3O8G A;  3HOW J;  1GUU A;  3RZD J;  3BR1 A;  1QPI A;  4CYC A;  3F0C A;  4A3E J;  1B72 B;  4GFB A;  1UMQ A;  3H0G J;  4DYC A;  1HLV A;  1XG1 A;  4BKX A;  2L7Z A;  5E3O A;  2NS8 A;  5GPC A;  3B6C A;  3LSP A;  4D7M A;  2L9R A;  4A3L J;  1I3Q J;  2R0Q C;  3QPL A;  2GM4 A;  1GVD A;  3FKI J;  5C4X J;  1X58 A;  1AHD P;  2P81 A;  4DZJ A;  2HOT A;  2CUE A;  2JA8 J;  4BBS J;  2DMP A;  2YU9 J;  1MH3 A;  2LP0 A;  1K61 A;  1FEX A;  2JA6 J;  4D5F A;  1ZGW A;  1APL C;  2VI6 A;  4C3H J;  2FX0 A;  1BL0 A;  4W97 A;  1F43 A;  2LK2 A;  5K7H A;  2IBD A;  1P7J A;  2Y2Z A;  4XIC A;  5F1J A;  5M3F J;  2AO9 A;  3MKL A;  5M5X J;  1OCP A;  4C3I J;  2CQQ A;  3ZQH A;  3HDD A;  4IHW A;  1Q1V A;  3S1N J;  3K7A J;  1OJL A;  1LFB A;  3BQZ A;  4I76 A;  1VND A;  2LVS A;  2LD5 A;  4AC0 A;  1HDD C;  3ZQL A;  1NK2 P;  1IDY A;  1WI3 A;  4J19 A;  2QF7 A;  1BA5 A;  4C3J J;  1GV2 A;  1IUF A;  4QIW N;  3HOX J;  4NDL A;  1IV6 A;  5F0F A;  3SDG A;  2E2H J;  3BTL A;  2EZL A;  5EZH A;  1FIP A;  1JTY A;  1IRZ A;  1U9O A;  4B1R A;  3S1R J;  2DMQ A;  1ZK8 A;  1I6H J;  2O9L A;  1QRY A;  3GTQ J;  3JRE A;  5EF6 A;  2XGC A;  2JK3 A;  4IHV A;  1JUS A;  3TED A;  2VUM J;  3FIS A;  4C2M J;  4A3J J;  1AKH A;  1E3O C;  2ME6 A;  1TWF J;  4A3C J;  3RQI A;  2DMN A;  2ID6 A;  3I4N J;  1DU6 A;  2HQ5 A;  2XGD A;  2HDD A;  4D5C A;  2L0K A;  2KDZ A;  2R5Z B;  2X6O A;  5IPA A;  3GTJ J;  5IYC J;  5F27 A;  2GLO A;  3GTP J;  5EG0 B;  2LFB A;  3G1L A;  4JP0 A;  4A3G J;  3RKQ A;  4BY1 J;  2FQ4 A;  2X9D A;  5IOZ A;  1JGG A;  1WPK A;  4XRS G;  4XK4 A;  3BG5 A;  1I50 J;  1VI0 A;  2E2J J;  3S17 J;  2EQR A;  3ZQI A;  3OSF A;  1JJ8 C;  3NAR A;  2Y9Y A;  4M6V A;  2MG4 A;  4A3K J;  1CQT A;  4MO7 A;  1A6I A;  5FJ8 J;  4ABZ A;  1TWH J;  2DJN A;  2XPU A;  4UUT A;  4QSH A;  5IYB J;  5M5W J;  3SJM A;  4Y52 J;  3SFI A;  2JMW A;  2DA3 A;  2H8R A;  4A3F J;  1PUF A;  1JT0 A;  5M5Y J;  5FKM A;  2HYJ A;  4JYK A;  1AU7 A;  3DEW A;  1ETX A;  2K9Q A;  1JJ6 C;  2EBI A;  2M9H A;  3CDL A;  3S14 J;  3WHC A;  3LNQ A;  2NVY J;  3IH4 A;  3GTO J;  3LSJ A;  1MNM C;  2M34 A;  1FIA A;  4UUS A;  1EF4 A;  3O8H A;  1MSF C;  2R5Y A;  1MSE C;  1MH4 A;  2HXI A;  2Y30 A;  3BTJ A;  1Y1V J;  1RKW A;  5C3E J;  2DA2 A;  1B8I B;  1OFC X;  4RDU A;  4A93 J;  3W6V A;  1MBF A;  2COB A;  1HF0 A;  5J1U A;  2MSY A;  2XSD C;  4M3D A;  1NTC A;  2XPV A;  4M3F A;  3FK6 A;  2G0E A;  4BXX J;  1ZTR A;  5F0H A;  2TCT A;  3A01 A;  1UG2 A;  3HOZ J;  2DA6 A;  4MFD A;  1X2N A;  1RKT A;  2IAI A;  1O4X A;  3M4O J;  3BR5 A;  4IHY A;  2E2I J;  2CUF A;  1QVU A;  5DS9 A;  3DCF A;  1WH7 A;  3HOV J;  1NK3 P;  2WV1 A;  1YRN B;  3E7L A;  2H1K A;  1T33 A;  2HI3 A;  5EDN A;  3PO3 J;  3GTK J;  1ETV A;  2E19 A;  2M2E A;  2JWT A;  2X48 A;  5BNG A;  3JRB A;  5EGO B;  3TP3 A;  4XRM A;  2IEK A;  3VPR A;  1H8A C;  2FD5 A;  4FE4 A;  3BG3 A;  4B4C A;  1LE8 A;  2CQX A;  3LSR A;  1U78 A;  1VF9 A;  4JX4 A;  2R5Y B;  2RAE A;  4MFE A;  1ENH A;  1GT0 C;  4CYC B;  3FK7 A;  2HOA A;  1SAN A;  4I6Z A;  3HOY J;  1W0T A;  1MBK A;  2VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...