2HI3A

Solution structure of the homeodomain-only protein hop
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MSAQTVSGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeodomain-only protein
publication title Analysis of the structure and function of the transcriptional coregulator HOP
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hi3A01
2HQ5A 3LSPA 5J1UA 1MSEC 1LFUP 1MBKA 2AO9A 2M9HA 2O7OA 3BR5A 2D5VA 2HOAA 3BG3A 2NVYJ 3I4NJ 1IGNA 1AHDP 1ETWA 4QIWN 5F04A 2XB0X 2VKEA 5IOYA 2XSDC 9ANTA 3MKLA 3ZQCA 3Q3SA 2GBYA 1F36A 3C2BA 4DW6A 3SFIA 1FJLA 1JUMA 3ZQLA 3D1NI 2DMNA 2ID6A 3GTJJ 2E2IJ 3BTLA 3HEFA 1T56A 3S2HJ 2L9RA 2NOGA 4BKXA 2E2JJ 1BW5A 1ITYA 2EBIA 2JMWA 3HOVJ 1GV5A 2N8GA 2KT0A 1MNMC 4A3BJ 5M3MJ 3VPRA 3O8GA 5EG0A 1OCPA 1B8IA 4XICA 3A02A 4D5FA 3JRFA 4J19A 5EG0B 1Y1WJ 2VUMJ 2IAIA 3BT9A 4RDUA 3FK7A 1B8IB 3CDLA 1GDTA 1FIAA 1VNDA 1RR7A 1NK2P 1JUSA 1ZGWA 4C3JJ 3OOUA 5DS9A 5F0FA 2DA7A 1K61A 5IYBJ 2TRTA 1POGA 2TCTA 3RKQA 1RESA 1Z77A 1X2MA 2HOSA 1U78A 3HOYJ 1DU6A 1JKPC 3BTIA 5F0HA 2OPTA 4XRSG 3CCYA 5JLWA 4Y7NJ 3L1PA 1ETQA 2ME0A 5IP6A 1JJ8C 4D7MA 1ZK8A 4IHWA 3RZDJ 2K9NA 1XG1A 2VPRA 4V2FA 5EZHA 3ZQIA 3LOCA 2LVSA 5E3MA 3S2DJ 1IG7A 1JUPA 3FIWA 3BTJA 2HOTA 2M8GX 2R0QC 1BL0A 3GTOJ 1FEXA 1WCMJ 3QPSA 2AHQA 2DA1A 3TW6A 4BY1J 1SFOJ 2EZIA 3H0GJ 4JX4A 4M3DA 3HGYA 4FCYA 2Y30A 3ZQHA 3HOXJ 2E2HJ 1RKWA 2FQ4A 4LOCA 1UHSA 5FKMA 1H88C 3HM5A 5J1YA 2ID3A 1P7IA 2HI3A 2L7ZA 3TEDA 3IH3A 2HXIA 3DEWA 5IOZA 3GTLJ 3S16J 1I6HJ 2DMTA 3NAUA 4A93J 4A3GJ 1TWFJ 1D5YA 3GBGA 3GTPJ 1W0TA 4A3MJ 2Y9YA 2E19A 4M3FA 2K9SA 1S7EA 1ZR4A 5F1JA 5M5YJ 5J1RA 4B1RA 2XB5A 5E3LA 2G0EA 4S0HB 2WB1N 2NVTJ 1MH4A 4A3KJ 3QPLA 1MBEA 5BNGA 2RAEA 2Y31A 1WPKA 5E3OA 1MBFA 2I10A 3CQZJ 4DZJA 1AU7A 1JTXA 2P81A 5HODA 4D5CA 2ECCA 4UUTA 1BW6A 4QSHA 2R7ZJ 3JREA 2JA5J 1DU0A 3A03A 4FTHA 2LP0A 1K83J 2HYJA 1MBJA 2EQRA 4IEJA 4A3LJ 4XRSA 2M0CA 3LSJA 4FE7A 4M3BA 2MW8A 3RQIA 5FJ8J 1HF0A 2CUFA 3G1OA 1IC8A 3S15J 3JRHA 1HLVA 1SANA 2X6OA 4V2GA 3JR9A 1ETYA 5IP7J 4BXXJ 1I50J 1YRNB 1Z0XA 2IBDA 3HGGA 2O9LA 4XRMA 4A69C 4M3GA 4M6VA 5IYCJ 1HDPA 1JT6A 1VF9A 4MFDA 3I4MJ 3SJMA 1APLC 3HKZN 4MO7A 2GM4A 2DA4A 3Q0VA 2QF7A 3HBLA 3F0CA 1WH5A 1Q1VA 4RBOA 2H8RA 5K7FA 5C3EJ 3M3YJ 2CJJA 4QTRA 3NARA 2DA5A 4BBRJ 5GPCA 4B3AA 3PO2J 1FTTA 3BR2A 3FK6A 3G1MA 1U9OA 3JRIA 5C44J 3JRDA 2Y9ZA 4ABZA 4C3HJ 4UUSA 2XPWA 2NS8A 4JYKA 2XPVA 4X1EA 3S14J 3BR0A 3BQYA 3LNQA 4UUSB 1NTCA 2LKXA 1JKOC 1FTZA 3S1NJ 1JTYA 1WI3A 4FISA 4BY7J 2LK2A 3BR6A 4A3DJ 2DA2A 2JK3A 1VI0A 3W6VA 2JWTA 2R5YA 1ZQ3P 5C4JJ 1TWAJ 1ETKA 1TWHJ 3BR1A 3MN2A 2R5YB 2COBA 3E7LA 3TP0A 5GPAA 3PM1A 4HNVA 4CYCB 2R93J 5F27A 1P7JA 2DTZA 5IYDJ 4JP0A 3TW7A 2MG4A 1OCTC 3B6AA 5FKNA 2LR8A 2W48A 2DMQA 2WV1A 1RKTA 1HDDC 1NK3P 4NDLA 4I76A 2XGDA 3BG5A 1B72A 2Y0SN 5FKLA 4DZPA 3RZOJ 4BBSJ 4GFBA 1B72B 1U9NA 3HOWJ 3WHBA 2LFBA 4C3IJ 1ZR2A 2O8KA 5C4XJ 2WAQN 4G12A 1RPWA 2YUSA 2DJNA 1XC5A 2E1OA 3BTCA 2ELKA 4EEFG 2XGCA 1IRZA 4D7NA 1UMQA 5F0CA 5EGOA 4A3EJ 3K2AA 1MSFC 1WH7A 5FLVA 2CU7A 3SDGA 5EGOB 1ZTRA 2NVQJ 1HOMA 4Y52J 3CMYA 4W1UA 4I6ZA 4FE4A 3TP3A 4XK4A 2LY9A 5M5XJ 1TC3C 1UG2A 2LTPA 3HDDA 3HOZJ 3IH2A 1QVUA 4MFEA 3O8HA 2VI6A 2PMZN 4MLOA 4X6AJ 2LLKA 4XIDA 1U8BA 1ORKA 3S17J 1A5JA 2MSYA 2DA3A 2XRLA 3G1LA 4AC0A 3BR3A 3QQAA 5K7HA 3OSGA 2JA6J 2MGQA 2EZLA 3HB9A 2YU9J 4A3IJ 3BQZA 1ETXA 5FLMJ 3IH4A 2DA6A 2VKVA 2NS7A 5FKKA 3S1QJ 1E3OC 5EZGA 1PUFA 1ETVA 1R9TJ 1YRNA 3LSRA 5E3NA 2DMUA 1BA5A 1TWGJ 3GTGJ 1LE8A 3BG9A 1PUFB 1JKQC 1GT0C 1LE8B 2FD5A 4MIMA 1H8AC 1WGXA 2L0KA 2DMPA 2L7MP 2ZB9A 3OIOA 4A3JJ 1MBHA 2R5ZA 2XGEA 4M3EA 2LD5A 4DYRA 5M5WJ 1IDZA 2R5ZB 1GVDA 1Y1VJ 4AUXA 3GTKJ 5EEAA 2B63J 1RETA 3GTQJ 5DTDA 2L7FP 5FKOA 1X58A 2IEKA 3JRGA 2FJ1A 1EF4A 5EDNA 1IDYA 3Q0UA 1VFCA 5F08A 5EYRA 1FIPA 3ZQFA 1I3QJ 2K9QA 3IV5A 2ECBA 4IHVA 2HXOA 3M4OJ 2R92J 5K7ZA 1JJ6C 3FKIJ 2FX0A 3ZQGA 2XPUA 2M34A 1OFCX 3HOUJ 3MVPA 1MBGA 4A3FJ 4W97A 1ETOA 1H89C 4A3CJ 2JA8J 1T33A 2OF7A 3DCFA 2NVXJ 1GV2A 3JRAA 1XS9A 1JT0A 3LSGA 1MH3A 4CYCA 1CQTA 2JN6A 5J3LA 3A01A 3FISA 1HCRA 4DYCA 2EH3A 2QCOA 1IJWC 2CUEA 2EZKA 3A01B 2X48A 3JRBA 1IUFA 4C2MJ 1G2HA 1IV6A 2CQQA 2JA7J 1GUUA 3WHCA 4DYQA 2HDDA 2KDZA 2YS9A 3B6CA 5JLXA 4AYBN 5EF6A 2GLOA 1ENHA 4JX6A 2EZHA 2X9DA 4JX5A 1OJLA 5M3FJ 3UKGA 2CQXA 1X2NA 5IPAA 2H1KA 2CRGA 5IP9J 1TWCJ 1LFBA 2Y2ZA 3Q0WA 3S1RJ 2JJ7A 3H3VK 5GP9A 1F43A 3PO3J 1QRYA 1AKHA 1JKRC 4IHXA 2K40A 1QVTA 1A6IA 1ZKGA 1JGGA 1BJZA 3K7AJ 3S1MJ 4B4CA 3OSFA 1AKHB 1W0UA 2M2EA 2ME6A 1QPIA 2DN0A 4L5EA 3GTMJ 4IHYA 1O4XA 3ZOBA 3JRCA
chains in the Genus database with same CATH superfamily
4LJZF 4BJTA 2DBBA 5J1UA 1J59A 3EUHA 1T95A 2IGKA 1MBKA 3JAMK 2KL4A 3N05A 1FOWA 3S3MA 2PJPA 3HSEA 4PJMA 4AYBA 3MKWB 2WC2A 4BHBA 4XORA 4M73A 3ZQCA 4XLFA 3CUOA 4DW6A 3OYJA 3OY9A 2VIXA 1JUMA 3D1NI 4MNUA 4UB8C 3TQNA 3WTWC 4PJJA 3ZMDA 2E2IJ 3KLOA 4YRVA 1Z1DA 4BKXA 4DJAA 3CCQI 3BPVA 5F1RA 2N8GA 1QU3A 2A68F 4A3BJ 5M3MJ 1Y39A 3VPRA 4OIRF 1WKMA 3W2WA 5TISC 2E35A 3ZMTA 1UHWA 4II2A 1OISA 4P55A 4XICA 2ZXJA 1V5FA 4UVCA 3HPHA 1WHUA 1WJ5A 3QRFF 1K7AA 4G7HF 3BT9A 4LIVA 1LJ9A 4XONA 4ZYHA 5KAFC 4ZYAA 4LFUA 5F64A 3JTGA 3U9GA 1FIAA 3CF2A 1NK2P 2RV8A 1ZGWA 2QLZA 4IL6C 1Y0NA 1K61A 2Y75A 2XASA 2I5UA 1B9MA 3LWFA 3ZGKA 1EV7A 3FF5A 1XX5A 1BM9A 3RKQA 1RESA 3H5RA 2DAOA 2CSOA 3CMAI 5E79C 3F23A 2D1HA 4O3MA 4UUVA 4A12A 2EK5A 4Y7NJ 3HOTA 3COAC 5IP6A 2GIVA 3T8RA 1VQOI 1WSUA 2M7BA 3K6GA 4G7ZF 3QODA 4RAZA 2BY0A 5LGUA 3GZ6A 2A3SA 2K9NA 1XG1A 3BCAA 1LKXA 5EZHA 4LD5A 2VE8A 2E7WA 2QQ9A 5E3MA 1IG7A 3S2DJ 2M8GX 5DCMA 1QHGA 4EJVA 3EDPA 1X19A 2XAJA 2AHQA 5DCMB 2V1DA 2P7VB 2CO5A 1YJNI 4OOIA 4BY1J 3TL4X 2CG4A 4ENMA 1P9QC 1OCOH 2EINH 1TQPA 2JVHA 5CVRA 3BY6A 4LOCA 3I71A 4BACA 2M8EA 5J1YA 1KA8A 1V4RA 4A0XA 2XV4S 2HXIA 5CVIA 5BPDA 5JI6A 4A93J 4A3GJ 1LUJB 5J8CA 5ERIA 3E97A 4OU0A 2P6SA 2B9SA 3R0AA 1S7AA 1UFMA 4M3FA 3LSHA 2K9SA 2GQQA 2A6EF 2KJBA 3I9V2 4YFKF 4D1QA 2WBMA 1YW9A 5HLIA 5F1JA 2YSRA 2JRMA 5M5YJ 2F4IA 2IPQX 5HDNA 4XKBA 1LNWA 2G0EA 2WB1N 2MLKA 3PL8A 4A3KJ 1XGSA 1S29A 1QQIA 3W3CA 1T8IA 2RAEA 2Y31A 1WPKA 5E3OA 2HR3A 1HC8A 1YW7A 1T0FA 1XD7A 1JTXA 5J40A 1H9GA 4D5CA 3KP3A 4UUTA 2KDOA 2Z99A 3K0LA 5AIQA 4RMNA 4PDKA 5E8IA 3H3ZA 2DJIA 4FTHA 2D2WA 2Y0SA 2WTEA 2LP0A 1YE9A 1RIOH 4EJUA 2HDCA 2EQRA 4XRSA 2XKOA 2MW8A 5FJ8J 4WX9A 2WY7Q 5K5QA 2M45A 1ZLJA 3U21A 2VKDA 3IAM2 2R7XA 2STTA 3JR9A 5IP7J 1G59A 3ZMSA 1E0EA 2X1DA 2A05A 4AIDA 2VJ5A 3H0DA 2O9LA 2Q2EA 3GLLA 3DQVC 3WG7H 2Q2EB 1JT6A 2IA1A 4LLGF 2ISYA 3KCCA 3HHHA 4QLCU 4UV8A 3E3VA 2DA4A 3Q0VA 4OIOF 4JOMA 5K7FA 4HQMA 5C3EJ 1D3YA 1IW7F 3H5AA 3F8CA 1MMSA 2PMZA 3FMSA 4RM3A 5GTIC 4BBRJ 3LAPA 1KQ8A 4I99C 2DPDA 1FTTA 3BR2A 5KK1A 4HF2A 2XF6A 1BI1A 1LFPA 3IC7A 1VQKI 4ZJZA 2RQPA 5C44J 3JRDA 3IUOA 1MJAA 4ABZA 4UUSA 4AM3A 4JYKA 1YITI 1KYZA 2KIMA 2KLOA 3S14J 3BQYA 4UUSB 1YG2A 4EGYA 4LB6B 3GWZA 2RKHA 1PVEA 1JTYA 1WI3A 3LSKA 4FISA 4CCOA 5H20A 2P6TA 2KIQA 1IF1A 1MKMA 3HJEA 2LF8A 2EJRA 3DBLB 3DP7A 2JK3A 1U0JA 5AONA 4E7LA 3PQJA 4Y15A 2IS6A 3KIOA 2V7FA 3KPHA 3MN2A 4ZZLA 3E7LA 4FASD 3QOPA 5GPAA 4AIJA 5F6FA 4HNVA 4CYCB 1U3EM 5B66C 1A6QA 4XLNF 4JP0A 2VUMJ 1VQPI 1OCTC 3K4MA 2UXXA 3CO6C 1IN7A 3J80K 3J7YJ 3T0YA 3JTHA 1RKTA 2X6XA 3L9FA 4L5JA 1NK3P 1IN8A 3MD2A 4NDLA 4P9FA 4HLXA 2XGDA 4A2UA 4CH7A 1G4DA 1B72A 5CJ9A 4KFCA 2VBXA 3LA3A 1B72B 3WHBA 1ZR2A 3KP2A 1W4MA 4ENKA 5D8KB 5IT9K 1REPC 3W6JB 4G12A 1GVJA 2YUSA 2HPIA 1Z9CA 4CCLA 1ZGAA 2ELKA 4ASNA 5ILSA 3LSMA 3K2AA 2Y69H 1WH7A 5FLVA 3FXRA 2Z1DA 3SDGA 4IRHA 1FBUA 2H09A 2K5CA 3E5QA 3E5XA 2V6CA 4KMFA 4FE4A 5DD4A 4XK4A 2VLAA 1TC3C 2M0MA 3DKWA 4O5VA 2CV1A 2E36A 1R58A 2LTPA 3M8JA 2K4BA 1VQ9I 2RNJA 2VASA 3DTEA 2VI6A 3GX4X 1GXPA 4X6AJ 2H8WA 3HSFA 4KA4A 3S17J 2L54A 1DPUA 1SMYF 1QZYA 4WXCA 3ECOA 3OMYA 3QOEA 5LRSA 2HFHA 3E5UA 3DEEA 1GHCA 2KJCA 1FYMA 3I64A 1BI0A 1N25A 4IPAA 3F8MA 4R8HA 4EMSA 1YQAA 4LGWA 1YRNA 1N78A 4I98B 5KVRA 5E3NA 2DMUA 4GO1A 1XB4A 2JVGA 2AQEA 1BR1A 3AG4H 4EJTA 1LB2A 1VQ5I 2G9WA 1GT0C 2KRFA 2HYFA 3CDHA 1ACIA 1IAWA 2L7MP 3V7SA 1HW5A 3OIOA 5TRDA 2G7UA 3OYLA 4L18B 3MKYB 2WV0A 2WADA 3HYIA 5FO5A 4L9VA 1KU9A 2EIJH 3DTKA 1UZCA 4HG2A 4EJOA 2B63J 1ZREA 3HIFA 5D5UB 1VZ0A 1IV8A 1ON2A 2EA2A 2BVLA 3ONQA 5H2FC 3Q0UA 3IL2A 2IGNA 3RIRA 1G3YA 2FE3A 2K86A 3QU3A 1I3QJ 3GFIA 2HXOA 4L0YB 3T5XA 5H6QA 4ON0A 1TL8A 4BEHA 2M34A 3C18A 1KQ9A 1BOAA 1MBGA 4A3FJ 3SDBA 1LDDA 3TKYA 2P5LC 4BEHB 4B8XA 4A3CJ 4PGHA 5BPIA 2JA8J 1UAAA 4CGZA 2ZJRF 2BOLA 2M7AA 3ELKA 1J75A 2F5EA 3CCJI 1FYKA 1CQTA 2LNBA 1KGSA 2JN6A 3R60A 4QWQA 4BE2A 1MW7A 3FBIB 1D8KA 1HCRA 2QCOA 2PG4A 5HS7A 2ZFUA 2X48A 2P5KA 1D0ZA 3BJ6A 3CESA 2CQQA 4IX7A 4DYQA 4YFNF 2KDZA 2IRFG 2C6YA 1QO0D 1YOVB 4IRGA 4M6XA 1ENHA 1NH3A 2CFXA 1Y6IA 2IJLA 3ZXSA 5JR3A 4AD9A 4CUGA 2RQQA 4NC8A 3KEOA 2Y0MA 5K1YA 3F8FA 1TWCJ 2CMPA 3G2BA 3S1RJ 3RSNA 1BR4A 2JJ7A 3H3VK 2LRDA 1QRYA 1AKHA 1ZH5A 1JGGA 1ZKGA 4Z2YA 1FT9A 1SD6A 5B3SH 5LHGA 1AKHB 1SMTA 4M74A 1IZ1A 5HDGA 4XKWA 1VTNC 4IHYA 2HNHA 2VPLA 2W1OA 3KLNA 2Z16A 5EEHA 5E17F 4IOAF 3VOEA 4BU2A 2HYGD 2AS5F 2ZMEB 5LLQA 1LFUP 3F6VA 3UR3C 4ZC3A 3BG3A 2D5VA 3I4NJ 1IGNA 1AHDP 2QZ8A 1ETWA 2LF7A 2L2OA 3H36A 4KICA 5LGTA 2BY2A 2RC4A 3RPUD 2A5WA 3C3WA 5IOYA 3T1BA 4BQAA 3AL0C 3A1YA 3Q3SA 1F36A 1DUXC 2MFZA 5BMZA 3C2BA 1RI7A 2O5RA 2OZ6A 3ZQLA 5JHFA 4D9JA 5DDGA 2QBYA 2VJIA 2QVOA 1OR7A 4AVPA 4AVZA 3GTJJ 4XM3A 3S2HJ 1FYLA 2GZWA 5KHDA 2E2JJ 2PBIA 2E7XA 2QBYB 1ITYA 4KN4X 3HOVJ 3HTUA 4E70A 2MLGA 1MNMC 1MMDA 4XLEA 1OCPA 4WXHA 1B8IA 1Q1HA 2VBZA 2BXZA 5D4SA 4F3QA 4RLFA 4IZZA 1O3QA 3CJQB 2L4MA 3REOA 3TOAA 1R1TA 3H3UA 4E7ZA 4RDUA 1B8IB 4IRIA 1FBSA 5HLGA 1AWCA 1Z67A 3MEXA 4B3XA 1K6YA 4PK4A 1EJ9A 1P4AA 2IS2A 1JUSA 4KN7X 2BV6A 3BP8A 3OOUA 3V8LA 2WB1A 2DA7A 1I5ZA 3P7NA 1LPQA 2V1NA 4UNOA 2CQNA 2QGUA 3LA2A 3BCBA 2KIFA 4LG0A 2HKOA 4G6DA 2HOSA 1U78A 3HRUA 5DYMA 1FC3A 3WTVC 5JVTA 4LG0B 3KEYA 2X51A 2XAFA 4XRSG 3CCYA 4I09A 1YYVA 4LIUA 1MNEA 3P9IA 4FETA 3J7ZI 2ME0A 1R4NB 1NG7A 4RLQA 4L0ZB 5FRNA 2EILH 4D7MA 3CCSI 3MCZA 3CO7C 1ZYRF 1SFEA 3PNTA 1VQ7I 4IHWA 3BG6A 1TTYA 3NWTA 4OMZA 2OC6A 4I02A 3DV8A 2A6HF 2VE9A 2VXZA 4G94A 3ZQIA 1U5TA 3DPLC 3H5NA 2LVSA 1DP7P 3KE2A 5EJCA 1JUPA 2J5PA 1XMXA 2VOPA 2DTRA 3BTJA 2HOTA 1U5TB 3OIQA 1YO5C 3GTOJ 1MDMA 1H9TA 1R7JA 4L9JA 2VT2A 3V8JA 3QPSA 3ULQB 2B0LA 1M1EB 1FOKA 2DA1A 1MDMB 2TDXA 3H0GJ 3HRSA 4JX4A 1RZ4A 3K1NA 4M3DA 4QPQA 2STWA 4UB6C 3ABKH 1UELB 2DT6A 1Y8QB 2BW3B 3ZQHA 1TQIA 4KUMA 3HM5A 2ID3A 2HI3A 4XOTA 4HA8A 1S8NA 2EFNA 4PFOA 5LEKA 1T39A 5IOZA 5D6FA 2IGMA 2W84A 3D5SC 5L3DA 1OQYA 4XN3A 3OYMA 1R1UA 3PIOF 3K70C 1TWFJ 4WF2A 3GBGA 4N9IA 5DCFA 1D5YA 3HPGA 2ZJQF 3GTPJ 1YJWI 5D6EA 2K3FA 3CMMA 2H6BA 2Z5UA 1W0TA 4KIFA 4KMUX 4A3MJ 2E19A 2K85A 3F21A 1FZPB 3E0JB 1W5SA 1YFHA 1NG6A 1ZR4A 2KZGA 5E1ZB 3I54A 1SD4A 2H1LA 2L3DA 3KP5A 5FD5A 1I6XA 4S0HB 4MQ9F 2QQBA 4EM0B 1TBXA 3QYEA 1VQ8I 3V42A 2X1CA 1MBEA 4IKFA 1O3RA 1I1GA 4GDFA 4U7BA 1FWZA 3SQNA 4G9YA 3EYIA 4N9HA 4ZDLA 2EB7A 1XDUA 4I01A 1H0MA 1KU3A 1YLFA 2BY1A 4QSHA 5JHUA 3QU6A 3QP5A 2EFWA 2JA5J 1IRXA 2E1CA 2PN6A 1OMIA 4K2EA 1MBJA 3FMRA 4IEJA 3RCOA 3WODF 4I2OA 4A3LJ 2M0CA 3OYFA 3LSJA 2Q8KA 2FUG2 3KYLA 2DFFA 3RQIA 1IUYA 3F9KA 2VKHA 1K4TA 2XC7A 1MJ9A 2OJED 1EH6A 2X6OA 1I50J 3RQ4A 1Z0XA 2O0YA 2RVCA 4RGXA 3IKTA 2UXNA 3A0BC 3ZR8X 4A69C 2MD5A 3M8FA 5IYCJ 1XDSA 1XMKA 3Q9SA 1JGSA 4MFDA 2ZNZA 4PZJA 3I4MJ 1APLC 1R22A 3HKZN 4MO7A 2GM4A 3MKZA 1Z3XA 2NYXA 3HBLA 4LMYA 1Q1VA 1X3UA 1G6NA 3M3YJ 1HKSA 3QAHA 2V9PA 3VEPA 2OAZA 3CTAA 2DA5A 4JK1X 3GZNB 1LEAA 4JBAA 4B3AA 3FK6A 1JE8A 2FF4A 2VJ4A 2CW0F 3I4PA 1U9OA 3HXLA 3JRIA 2HZDA 2Y9ZA 2XPWA 1Z21A 2XPVA 4RAYA 1YIJI 4U7DA 3GFLA 5CQEA 1X1PA 1SAXA 2DYRH 3VWBA 4L5IA 5FLXK 4KIGA 2M3AA 1X1DA 4Y13A 1BIAA 1R00A 3VYTB 2QYOA 2GOXB 1TW3A 1FP2A 2LH9A 3OS1A 1XSVA 3W6VA 3CLOA 3V7CA 1ZQ3P 1TWAJ 2COBA 1R4MB 3H1CA 5HVQC 2VQHA 2VBWA 3ZP5A 2JA2A 3WTXC 3VSKA 2FXAA 3ISPA 1P7JA 3TMOA 1YTYA 5E18F 4U0WA 1LQ1A 3TW7A 1DP3A 2CQKA 4BH9A 4XKVA 5J4YA 2LR8A 4NHJA 1WWXA 1KU2A 4RS8A 2ADUA 3BG5A 3MWMA 4HX4A 2EV0A 2XSJC 1GLNA 1E3HA 3HOWJ 5C4XJ 3KP6A 2WWYA 2O8KA 1QGPA 2WAQN 4BGDA 4I0BA 3U1DA 1IN4A 4YFXF 1VQ6I 4KIBA 2OTJI 1XC5A 2QUFA 4EEFG 3BG7A 2UV1A 2XGCA 1UMQA 2XGXA 4S05A 4Z6YA 1U6GA 2CU7A 2XUBA 2EFQA 3QWLA 1EH7A 2ACJA 2P5VA 2NVQJ 4Y52J 2A69F 4W1UA 3K4KA 3CMYA 4I6ZA 3BZCA 2DODA 2O3FA 2KZVA 3FXKA 2DOAA 3RPUA 5D5VB 4MFEA 4ESBA 4A6DA 3O8HA 2JQ7A 2BE5F 2M4GA 4XIDA 4KT5C 2LBFA 2HU9A 3PUBA 2NNNA 1UG0A 2JA6J 1XCBA 4A3IJ 2LBFB 2NNYA 1XGOA 5DUIA 5FLMJ 4U0YA 1AA7A 2ZBKA 1YIOA 3PFYA 4RM2A 3I0TA 5FKKA 1RRJA 2MH9A 3S1QJ 4CXFA 2OU2A 2DCEA 1ZHFA 1ETVA 4A5MA 3LSRA 1R5GA 2W25A 1TWGJ 2V26A 3GTGJ 4EM1A 1X1AA 4H0EA 4DOZA 2JTVA 1OYIA 4CCKA 5LRRA 1OYYA 3TO9A 5HLTA 4EGZA 4HF1A 4EVIA 3EQLF 1G3TA 3CJNA 3L00A 2FOKA 3BWGA 1STZA 1PP7U 2F5DA 3WGGA 2HQRA 2XGEA 3QP6A 1XN7A 1VQ4I 4UXNA 5M5WJ 4BE0A 1O3TA 1XMAA 4BE1A 2I8DA 2JUCA 2MBFA 1Y1VJ 4Q48A 3GTKJ 3T8TA 1RETA 3GTQJ 2RNGA 5DTDA 1WRJA 2ISZA 1V55H 3CMEI 2ESNA 2CFOA 3BJOA 1ODDA 2ZNYA 3GCMA 2NRAC 1LDJA 2QENA 3CDIA 2FNAA 4CZCA 2HQAA 1YX3A 3EYYA 5CVUA 1CF7A 2K9QA 3M4OJ 4EQQA 2R92J 3GLXA 5K7ZA 1CF7B 2FX0A 4XOPA 1J9IA 1PP8F 2XPUA 2FBIA 4I7HA 3DU5A 1HW2A 4WK8F 2NVUB 2KISA 2MD0A 1LVKA 2ZXIA 4W97A 3RDIA 1T33A 2FBHA 2OF7A 1F9NA 4PSWA 3SZPA 2FMLA 4CICA 3CC7I 3EUKL 1GV2A 1A04A 1XPXA 4CYCA 2V1XA 4OMYA 5JFRA 4A0YA 5FB2A 1TW2A 2D1VA 2XRNA 5A2QZ 2WA0A 2Z9OA 3K70D 2CGPA 1B1BA 2DFEA 3CJRB 2EZKA 3KEQA 3QPHA 2R7TA 1YX5A 2V6EA 1Z7LA 1IUFA 3JCUC 2EPFA 1JHHA 1OPCA 3BC8A 2JA7J 4YELA 3HRMA 5CPRB 2HDDA 4IOCF 1EH8A 3B6CA 3K4CA 3O2PE 3ZCOA 4AYBN 1CGPA 5EF6A 1TP4A 4JX6A 1OCRH 1Z6RA 2EZHA 2LOOA 2X9DA 4L9NA 1FLIA 4JX5A 4NNJA 3K9TA 1OJLA 5M3FJ 3UKGA 2UWMA 2KRHA 2BVMA 5BQTA 1LFBA 3Q0WA 1E3PA 3HHGA 2H94A 3WGIA 1JXSA 2KQRA 2JT1A 5GP9A 4IHXA 1QVTA 1A6IA 1J7KA 4OAZA 3P9CA 4FT8A 3K7AJ 4FHTA 2CQ7A 1T98A 1TT5B 2E5ZA 1R1VA 2HQNA 1QPIA 3J81K 3K4LA 4HV6A 1SVMA 2IXSA 2R7OA 5LHHA 2QA4I 4IHTA 3JAMZ 3FXJA 1ONVA 2DK5A 2VQGA 3F72A 5DD8A 5LGNA 1WZ2A 4E4HA 3LL7A 2AO9A 3BR5A 2O7OA 3U1KA 3SHFA 3F6OA 2IVMA 4QIWN 2K7LA 2DQLA 2IA2A 2DI3A 2XB0X 2VKEA 5FGMA 3RKXA 3GZ5A 3FHZA 2XSDC 9ANTA 4P1WA 5E8GA 1NHAA 4F92B 1MGTA 2L9SA 4V19K 4HPQA 2ZKZA 2ZSIB 4U0VA 3L2VA 1V3FA 2PMHA 4HDUA 3SFIA 5LHIA 1FMWA 2DMNA 5DUKA 3M9AA 3AG1H 2XDVA 4HX7A 1IXCA 2IS4A 4UVAA 3BTLA 3HEFA 2L9RA 2NOGA 3DTIA 2L4AA 4NC7A 3SXYA 3GO5A 2JMWA 4XKCA 3V7RA 1AOYA 1IXRC 3O6BB 2ZCWA 3O8GA 4HNTA 5EG0A 3PNVA 2ZXHA 1GXQA 3A02A 3JRFA 2WY8Q 5EG0B 3OYIA 3OL3A 1A31A 3ZMVA 1QPMA 1X4OA 2F4MB 2H6CA 2OUMA 3CDLA 1USSA 4S04A 1W36C 1GDTA 3JSPA 4UV9A 2ZC2A 3M07A 3BDDA 5IT3A 4F93B 5DS9A 2W4SA 4DNCA 2W57A 3QPTA 2TRTA 4PSXA 1POGA 2B7EA 1MD0A 3LSTA 1K78A 4LLLA 2LKPA 1JKPC 3BTIA 3CF5F 1X1BA 2OPTA 3AG3H 3G4SI 3OS2A 1K78B 1G3SA 2NXNB 2K27A 1MMGA 2V9VA 3R61A 5JLWA 3L1PA 4OINF 1ETQA 1QA6A 2M87A 1Z91A 2DLLA 3GUDA 4HF0A 2O61A 4UY8I 2P4WA 3OYBA 1ZK8A 4RB3C 3RJPA 4GCVA 3TBIA 1SFUA 1Z05A 2K4JA 3RZDJ 3B02A 2VPRA 3S3NA 1P6RA 4HX8A 2R7RA 4NBQA 5D8LB 5HS8A 3J7AO 3LOCA 3VYRB 1TQMA 1LEBA 3H9QA 2FQ3A 2KFDA 1BL0A 4G7OF 1FEXA 4ZDPA 2CUJA 3U2RA 4B44A 1WCMJ 3LA7A 1HW1A 3TW6A 4WCGA 2CYYA 2V4JC 5DV5A 3E6DA 1SFOJ 2HVRA 2CWEA 4UHTA 5L3EA 2W82A 3HGYA 4FCYA 3HKZA 2Y30A 4OAYA 2KP6A 5H6RA 5LBQA 3OYDA 2E2HJ 3CCLI 2DYSH 4YIIA 2FQ4A 1UHSA 5FKMA 1H88C 1B59A 1PDNC 2L7ZA 5ICCA 4CA0A 2LC2A 4IHSA 2HVSA 3GF2A 3W2VA 2A61A 2IA0A 2R7VA 3LQRA 3GMEA 4ANJA 4IXAA 4RAFA 4PJ0C 4IQ4A 1JHFA 4H4KC 2LSOA 3SYTA 3AL0B 2KHMA 3CUQC 4LB5A 3SEZA 1ZN2A 4OIQF 2F4OB 4PJLA 2F5FA 2Y9YA 2ZMEA 5FFZA 4MEXF 1X1CA 3S93A 3EUAA 2YU3A 4CO8A 3CD6I 4HAMA 3CCEI 3L2UA 3C7JA 4ESFA 4X0GA 2ZXWH 5J1RA 4B1RA 3PSIA 1DGWY 5D5WB 4GGGA 2R7WA 1MH4A 2JPCA 3QPLA 4QPOA 3CCMI 3BZ6A 2EIMH 3ERED 4BL0B 2I10A 4IJAA 4DZJA 1MMNA 3K4JA 3K69A 1AU7A 2P81A 2OCEA 3ZMUA 2RREA 4Y4RA 3CC2I 4YIRX 2QSHX 2X6YA 3JREA 2QWWA 3IAS2 3W2AA 3A03A 1FY7A 4ITVA 2HS5A 1K83J 2CH0A 2RGVA 4XMYA 1K4SA 3CLQA 2CW7A 4FE7A 2WAQA 1ZRFA 4M3BA 3LAJA 3TDUC 1HF0A 2CUFA 1D0XA 4HLYA 1YHQI 3G1OA 1IC8A 1T08B 1VQMI 3JRHA 5FFXA 1HLVA 1SANA 3ZQ7A 4V2GA 4YG2F 1ETYA 1RNLA 2W00A 3QYBA 3SEQA 1TNSA 1KONA 2E5NA 3KYDB 4HW0A 2ZJ2A 3K10A 3HGGA 4XRMA 3ZMZA 4M3GA 3OS0A 2VQCA 4M6VA 3GVAA 1BI2A 4HSRA 1WJAA 2FBKA 3SJMA 1XGMA 1MIJA 2ZFWA 3LMMA 3KP4A 4P5OA 2ESHA 3F0CA 1WH5A 5J47A 2KIUA 5TJJA 4NC6A 2H8RA 4HRIA 1P92A 2UZKA 1L3LA 2VONA 4P9UA 1K79A 4BYYA 3WTZA 4ENJA 2CJJA 1IN6A 4QTRA 3PJRA 5GPCA 2W7NA 4IQJA 1B4AA 3PO2J 3G1MA 4N4NB 2D45A 2OCCH 1TLHB 4ZYGA 1WQ2A 4N4OB 1DPRA 2IT0A 3OOPA 2NS8A 2KRCA 1WJCA 1FPQA 3QYFA 4B09A 2LKXA 1JKOC 2PX9A 1VQLI 1HSJA 4ZYEA 4HV5A 3HG9A 5L3BA 4BY7J 4HDVA 1B9NA 4E7SA 1FSEA 4WXDA 4F91B 1D0YA 2DA2A 3OR1C 3I58A 3PSFA 2W24A 2M30A 2LYCA 5J4VA 5HNHA 4XLCA 4M6YA 3IRQA 4D0PA 1BC8C 2BW3A 2P0WA 4XL9A 5C4JJ 2G7HA 1W1WE 3MFKA 1RR8C 1HKQA 4LG3A 1R6RA 2OD5A 2OTLI 1ETKA 1TWHJ 3JSOA 2PJRA 3BR1A 3TP0A 2L02A 1OKRA 3NQOA 3PFIA 3VDXA 2E34A 2PJRB 2DTZA 3J80Z 4BUPA 3BZKA 4FX0A 2EWNA 3VSLA 2R7FA 1YI2I 2ICWG 1BJAA 5BOXA 3C2GA 1S3JA 5A2QK 2W48A 2DMQA 3FXQA 5GAGJ 3WU1B 2WV1A 3FZVA 4BJ6C 3N4MA 5ICEA 5B1AH 4C2UA 4HSTA 5IT9Z 4HOBA 3WE2A 3AAFA 3NRVA 4BQQA 3AG2H 4DZPA 4BBSJ 3K1MA 3FX3A 4C3IJ 1FOXA 3ROUA 2GIZA 3MAJA 3LSIA 2W85A 1RPWA 4BHCA 3S2WA 2DJNA 3HTSB 4ENNA 1HXDA 2QEXI 3BTCA 1Y8RB 1BC7C 4D7NA 5F0CA 4PCQA 1TZLA 5EGOA 3R0JA 4A3EJ 1MSFC 2R7QA 2XKPA 5J8FA 5EGOB 1ZG5A 1BOBA 5LEJA 1ZTRA 2OQRA 3RTRA 1HA8A 1ZARA 4RB0A 4NQWA 5M5XJ 2E1MC 3BOQA 1UG2A 3DKXA 3FM3A 3WU2C 2VB6A 3F22A 3NWSA 1FNNA 4NQWB 4L9TA 4U87A 4E6KG 3IH2A 1QVUA 4CZZA 5HDKA 4MLOA 2LLKA 1ORKA 1ZG1A 1A5JA 4KISA 1G8XA 1I1SA 3G1LA 3BR3A 3DBRB 3QQAA 5K7HA 2MYSA 4NB5A 3MZHA 3BQZA 1ULYA 5HS9A 1W36D 1ETXA 1B6AA 1F4KA 1WJEA 3FWEA 4LK0F 1PJRA 2FOWA 2VKVA 2X0LA 2EIKH 3L7WA 1VQNI 3MMYB 3CCUI 4XSZF 5EZGA 1PUFA 1MZBA 3LFKA 4XR6A 3VODA 1PUFB 1ZGJA 1FBQA 4XNFA 1JKQC 2V79A 3HUGA 4O6JA 2AQFA 4DQ2A 1W7PD 5DEQA 1J5YA 1WFXA 2FD5A 4J00A 1OYWA 1H8AC 1WGXA 3HUGB 2DMPA 3FXMA 2ZB9A 2A5YB 3EUHC 3R4KA 3FHNA 1BI3A 4CYDA 5GAHJ 4E7JA 4M3EA 1MNDA 2LD5A 3IP4B 4AU7A 4B43A 3AKZA 1Z3YA 5EEAA 1IO2A 5D5XB 2EV5A 3HRTA 3AFHA 5FKOA 4RA2A 5HOOA 3RKWA 2IEKA 4HYEA 1R5HA 2FJ1A 2OBPA 3CZ6A 1IDYA 2E60A 2KPMA 4GXOA 4MQVA 4OIPF 2MH2A 4CCJA 5EYRA 1FIPA 3IV5A 4IHVA 2ECBA 4ETSA 3I55I 3FKIJ 3ZQGA 2GWRA 1OFCX 3FXUA 3HOUJ 3LQQA 3CCVI 3DEUA 1OLTA 4AIKA 2COMA 3C1DA 1H89C 3ZN0A 1W5TA 2GA1A 2QSFX 1C0WA 3VYSB 3L09A 1WI9A 2PFBA 3K4BA 4PUSA 3K1PA 3JRAA 4E7IA 5DM6F 1XS9A 1WJBA 2QKMB 1JT0A 2Z2SB 3FXLA 3LSGA 1MH3A 3SFZA 1J09A 3SZGA 3KP7A 5J3LA 3A01A 4DYCA 2DXIA 3BLYA 1J0RA 2VXDA 2KKOA 1IJWC 2F48A 3A01B 4XRFA 1E2XA 1UJ8A 1PUEE 3JRBA 1HKTA 3ERMA 1KU7A 2R7UA 2VOOA 1I39A 1G2HA 1D1AA 1IV6A 2OQGA 1GUUA 2K9MA 5CQGA 5ILUA 2YS9A 5JLXA 2M5WA 3ABMH 5BS6A 3G3ZA 3IHUA 3ZN1A 3IWZA 2JPBA 3I56I 3OYCA 5IPAA 5KAIC 2IS1A 4MGRA 2PQ8A 2O6GE 3N97A 2Y2ZA 4FX4A 1S7OA 1Y56A 4WWCA 2PEXA 2ZJPF 2ELHA 5ICGA 4ZTJA 4B4CA 1O57A 3OSFA 2V1UA 3KZZA 4BHPA 2XAGA 3JW4A 2M2EA 5CKTA 1R23A 1W0UA 2DN0A 1P4XA 4Q4ZF 2EA4A 2NOJB 2HPMA 4XLHA 1O4XA 3G73A 4OWRB 5CVVA 3JRCA 2HQ5A 2L7KA 3ZQQA 3CP2A 1IXSB 3LSPA 1MSEC 3RYPA 2F5VA 2M9HA 3A4CA 2HOAA 4ZTFA 2NVYJ 3IWFA 3H9JA 4AIHA 3ML6A 3FMQA 2XF5A 4R79A 4BDZA 5FROA 5F04A 3DLAA 1KQ0A 2EFOA 3HSRA 3MKLA 3GFMA 1SC7A 2DPUA 2GBYA 4KDPA 2F6CA 5GAEJ 2ZO4A 1RUNA 1V5GA 4RAGA 3J7AY 2FU4A 1FJLA 2DO7A 2HKXA 4XSXF 1YS7A 4AWXB 2DQRA 3KZIC 1X3WB 2ID6A 3UNGC 3DF8A 1T56A 3OYEA 5KCMA 1U2WA 1JI8A 1BW5A 3TOBA 2EBIA 1GV5A 4Q47A 2PLYA 2KT0A 1X4PA 1P2FA 2DFIA 3H9GA 4PGGA 4HQEA 2EV6A 1T2KA 1S72I 5K5OA 1RUOA 3CCRI 4D5FA 3PQKA 1ZRDA 1UB9A 1LDKB 3O3KA 4J19A 2V9KA 1Y1WJ 2HEOA 2IAIA 3FK7A 1EA3A 2XAQA 1QNTA 1TNTA 3KX2A 3I53A 4A0ZA 3WTSC 2GAUA 1VNDA 1RR7A 3HZJA 1T0FC 4CHUA 1S6LA 4C3JJ 5CVJA 2HTJA 5F0FA 3ASNH 4F7ZA 4P96A 2FEZA 2XROA 3RPQA 4KYWA 5IYBJ 4CCNA 1A36A 4XLAA 3ESWB 1YS6A 3ABUA 2TCTA 2HTSA 1Z77A 1X2MA 1TT0A 3HOYJ 1DU6A 1SD5A 5F0HA 2DFHA 4RGUA 3WU0A 3HC7A 2VL8A 1XSDA 3W6KB 2BHYA 3ASOH 4ZH4F 1JJ8C 1IN5A 3GFJA 4B48A 3KFWX 4U88A 3WG9A 2IW5A 3MQ0A 4EJWA 4V2FA 1SAUA 1YW8A 1QBJA 1ZG3A 2R7SA 1ZELA 1HSTA 1V54H 3DPUA 3FIWA 4B47A 1SVLA 2R0QC 2RN7A 2H27A 1WJFA 3L2RA 3K2ZA 2HOEA 1ERDA 5CLSA 1QZEA 2EZIA 2X1EA 2DW4A 2XAUA 1T38A 3X2QH 4I0AA 2KMUA 3HOXJ 1N75A 2HVQA 1RKWA 2FRHA 5FD6A 1P4WA 2HWVA 2R3SA 5E1XA 1O3SA 1P7IA 5D4RA 3TEDA 3IH3A 3EETA 3DEWA 1LVAA 1FMVA 1Z6TA 3M1CA 4CCMA 2Z33A 3GTLJ 3S16J 1I6HJ 3ECHA 2DMTA 3NAUA 2CV2A 2LG4A 3PNYA 1DGRM 4JQFA 3H35A 3E6MA 2DT7B 2DU9A 4BXUA 3DKYA 3OYHA 2YX7A 2OV7A 3A0HC 3GEZA 3A2KA 5E1WA 3DU6A 2RDPA 2VQLA 1S7EA 2PI0A 4MTDA 2ETHA 2F2EA 3R6SA 4XLPF 2FSWA 5L3FA 2XB5A 2X4HA 5E3LA 5FRMA 1W5CC 2NVTJ 3LFUA 1SFXA 3F8NA 2QKLB 2BXYA 3GW2A 5BNGA 2K9LA 2YX4A 2R4GA 1MBFA 2Q1ZB 3OL4A 3CQZJ 4YIFA 1R36A 2WAEA 4CSWA 2BYVE 3BJAA 5B1BH 1QHHD 5HODA 1YJ9I 2ECCA 1J2XA 2QSGX 1BW6A 3F3XA 3IRRA 2VODA 2R7ZJ 3P9KA 1D1BA 4BXFA 3Q5FA 1DU0A 3NEUA 2OZUA 1W7PA 1XSXA 2HYJA 1Y0UA 4XN0A 3GYHX 1W7PB 2IGOA 5ICFA 4RB1A 2LY2A 4C2TA 3TO7A 3FXOA 3OYNA 4MEYF 3S15J 4G6QA 3TO6A 1SVOA 4BXXJ 1D8JA 3B73A 2LKSA 1YRNB 2WAFA 2IBDA 5TGTA 4E7HA 4BJ5C 3I5UA 2X6WA 1HDPA 2A07F 5IY5H 2M4KA 1VF9A 2LY1A 2QM3A 3S8PA 1F1ZA 3DWLE 2Q0OA 2QF7A 5L3GA 4RBOA 3V8KA 4II3A 4DBRA 5LD2C 1V5EA 3E6BA 1R71A 3D0SA 1SFKA 1X3ZB 4NUBA 2FNPA 5B5EC 4BNCA 4LLNA 2ZSHB 3DXJF 3NARA 1I27A 2GXBA 2NAZA 1FP1D 2JRTA 4C3HJ 5KNLA 1RC9A 4X1EA 5FLXZ 2BBYA 2E71A 3BR0A 3DFGA 3IKVA 3WGHA 3LNQA 4MTEA 1MJBA 2LMDA 1NTCA 4N0BA 2EFPA 1FTZA 3S1NJ 3H92A 2MABA 1U8RA 2LK2A 3BR6A 4BS9A 1IRFA 2HDWA 1HQCA 2Z3YA 3V4GA 4A3DJ 3K4NA 2DK8A 2CS3A 1BIBA 4J01A 3L2WA 1VI0A 3CUQA 3ZRGA 2JWTA 1T6SA 2R5YA 1WJDA 2JSCA 3VFZA 2VC1A 2XHKA 3CUQB 1ZLKA 2DDAA 2R5YB 3CC4I 3DBHB 5L3CA 3MZYA 3PM1A 5CYVA 2R93J 5F27A 2BHZA 1QZZA 5IYDJ 4IVNA 2MG4A 3B6AA 3M8EA 5FKNA 4E7KA 4Q5SF 1HDDC 2NS0A 3WE3A 1KYWA 1E17A 4I76A 2YPRA 2XAHA 4G8XA 2Y0SN 3OYGA 1FSHA 5FKLA 4XBFA 5ED4A 2VT3A 4FQGA 2XIGA 3RZOJ 4GFBA 2VN2A 1U9NA 2E1NA 2LFBA 2AXLA 3S3OA 3CJTB 3DLLF 3OR2C 2JUGA 1SD7A 3FDYA 4MHGA 3E1SA 4Y3OA 2Y48A 4EV0A 1MMAA 2ELJA 2E1OA 2UUZA 2P7CB 1IRZA 1UHMA 2L9VA 4EM2A 3I3LA 4BQNA 4DGWB 3L2QA 3RYRA 2BZTA 6PAXA 1HOMA 1F5TA 1EKEA 2DDBA 3TP3A 1R5ID 2LY9A 3TGNA 3D5RC 2MC3A 3HDDA 1O7FA 3HOZJ 1A35A 1BBYA 3VYUB 2GA2A 2PMZN 2O8XA 5ILVA 1U8BA 2DT5A 4HNUA 5K5RA 3D5LA 2MSYA 1R49A 2DA3A 2XRLA 3C2HA 3P5JA 3WTTC 4AC0A 3OSGA 3FBNB 2K02A 2EZLA 2MGQA 3HB9A 4UVBA 2PMUA 3RKYA 3HOSA 3EPZA 4M71A 2YU9J 2DOFA 5GADJ 3OWTA 1USTA 3IH4A 1DQUA 2DA6A 3OIPA 2NS7A 4KNYA 2F5CA 3FM5A 2IP2A 2BGCA 1E3OC 2QQ8A 4F52A 1R9TJ 4LK1F 1BA5A 4ESJA 4GYIA 1LE8A 3BG9A 4GRIA 2ZMEC 4R1HA 2YR2A 1LE8B 3OV8A 4MIMA 4BDYA 4M9ZA 2L0KA 4TV7A 3SZTA 3VB2A 4XQFA 1K6OA 4A3JJ 2AXTC 3GXOA 5GTHC 1MBHA 4KJZA 2R5ZA 4IF4A 1XCVA 3G6EI 1KZHA 2CV0A 4DYRA 5JVGF 2CUZA 1IDZA 1BN5A 2R5ZB 5EEGA 1GVDA 3DPTA 3PIPF 4AUXA 3BROA 2L7FP 2A6TA 2VJJA 1OCCH 5J6XA 1X58A 3MZ8A 1D5VA 3JRGA 1HBXG 3KYCB 4DIQA 5DM7F 2HGCA 1EF4A 5EDNA 2GXAA 1XGNA 2P8TA 1VFCA 5F08A 2XVCA 1S5LC 3S32A 4PFPA 1OR7C 4BAYA 3ZQFA 4A5NA 4YEJA 2MC4A 2VC0A 4KT6A 2CW8A 2DOEA 1JJ6C 1ZRCA 3MVPA 4LITA 2LREA 4RGSA 3M1EA 1ETOA 3ABTA 2HZTA 2OA4A 2GOMA 3FKJA 3DCFA 1L0OC 4C9YA 2NVXJ 3Q9VA 3BPXA 4DBQA 3OYAA 2K3PA 1Z7UA 2L5QA 4RGRA 3L2CA 3WTUC 3I59A 1XTAA 1D1CA 2BEOA 3M7GA 4IO9F 3ZPLA 3FISA 3I59B 2EH3A 4F55A 4HBLA 2L01A 4ZDOA 3CP8A 2CUEA 5HNFA 2FMYA 2L9NA 3ABLH 4C2MJ 4EATA 1ON1A 2FA5A 4RB2C 1OCZH 4HZFA 1O7LA 1PYVA 4PJNA 1FX7A 3TDZC 1SEUA 3WHCA 2O03A 2MA3A 5E20A 1DDNA 3OYKA 4Y17A 5LFAA 2GLOA 2GXGA 4ZZDA 2E1MB 3RI4A 2VBYA 4Y33A 4GYGA 3F8BA 2JSPA 5HLHA 2LDUA 5AIPA 4C30A 2BY3A 2CQXA 1X2NA 1BR2A 1S9HA 4A6EA 3G71I 1N77A 4KITB 2H1KA 2CRGA 5IP9J 4M9SA 4BQOA 2R7DA 3E6CC 1F43A 3PO3J 3HL2A 1IRGA 3KETA 1JKRC 1U5TC 1UCRA 2K40A 3J81Z 1FOYA 2JZYA 1BJZA 3S1MJ 1I3AA 3KZYA 2ME6A 4HEA2 4CDGA 2QQAA 4L5EA 3GTMJ 2J5OA 2XF7A 3WTYC 4M72A 1ZAOA 3PUFA 1G3WA 4ZYDA 1WVRA 4G6TB 3ZOBA 4M9XA 2X85A 2M1BA
chains in the Genus database with same CATH topology
2HQ5A 3LSPA 5J1UA 1MSEC 1LFUP 1MBKA 2AO9A 2M9HA 2O7OA 3BR5A 2D5VA 2HOAA 3BG3A 2NVYJ 3I4NJ 1IGNA 1AHDP 1ETWA 4QIWN 5F04A 2XB0X 2VKEA 5IOYA 2XSDC 9ANTA 3MKLA 3ZQCA 3Q3SA 2GBYA 1F36A 3C2BA 4DW6A 3SFIA 1FJLA 1JUMA 3ZQLA 3D1NI 2DMNA 2ID6A 3GTJJ 2E2IJ 3BTLA 3HEFA 1T56A 3S2HJ 2L9RA 2NOGA 4BKXA 2E2JJ 1BW5A 1ITYA 2EBIA 2JMWA 3HOVJ 1GV5A 2N8GA 2KT0A 1MNMC 4A3BJ 5M3MJ 3VPRA 3O8GA 5EG0A 1OCPA 1B8IA 4XICA 3A02A 4D5FA 3JRFA 4J19A 5EG0B 1Y1WJ 2VUMJ 2IAIA 3BT9A 4RDUA 3FK7A 1B8IB 3CDLA 1GDTA 1FIAA 1VNDA 1RR7A 1NK2P 1JUSA 1ZGWA 4C3JJ 3OOUA 5DS9A 5F0FA 2DA7A 1K61A 5IYBJ 2TRTA 1POGA 2TCTA 3RKQA 1RESA 1Z77A 1X2MA 2HOSA 1U78A 3HOYJ 1DU6A 1JKPC 3BTIA 5F0HA 2OPTA 4XRSG 3CCYA 5JLWA 4Y7NJ 3L1PA 1ETQA 2ME0A 5IP6A 1JJ8C 4D7MA 1ZK8A 4IHWA 3RZDJ 2K9NA 1XG1A 2VPRA 4V2FA 5EZHA 3ZQIA 3LOCA 2LVSA 5E3MA 3S2DJ 1IG7A 1JUPA 3FIWA 3BTJA 2HOTA 2M8GX 2R0QC 1BL0A 3GTOJ 1FEXA 1WCMJ 3QPSA 2AHQA 2DA1A 3TW6A 4BY1J 1SFOJ 2EZIA 3H0GJ 4JX4A 4M3DA 3HGYA 4FCYA 2Y30A 3ZQHA 3HOXJ 2E2HJ 1RKWA 2FQ4A 4LOCA 1UHSA 5FKMA 1H88C 3HM5A 5J1YA 2ID3A 1P7IA 2HI3A 2L7ZA 3TEDA 3IH3A 2HXIA 3DEWA 5IOZA 3GTLJ 3S16J 1I6HJ 2DMTA 3NAUA 4A93J 4A3GJ 1TWFJ 1D5YA 3GBGA 3GTPJ 1W0TA 4A3MJ 2Y9YA 2E19A 4M3FA 2K9SA 1S7EA 1ZR4A 5F1JA 5M5YJ 5J1RA 4B1RA 2XB5A 5E3LA 2G0EA 4S0HB 2WB1N 2NVTJ 1MH4A 4A3KJ 3QPLA 1MBEA 5BNGA 2RAEA 2Y31A 1WPKA 5E3OA 1MBFA 2I10A 3CQZJ 4DZJA 1AU7A 1JTXA 2P81A 5HODA 4D5CA 2ECCA 4UUTA 1BW6A 4QSHA 2R7ZJ 3JREA 2JA5J 1DU0A 3A03A 4FTHA 2LP0A 1K83J 2HYJA 1MBJA 2EQRA 4IEJA 4A3LJ 4XRSA 2M0CA 3LSJA 4FE7A 4M3BA 2MW8A 3RQIA 5FJ8J 1HF0A 2CUFA 3G1OA 1IC8A 3S15J 3JRHA 1HLVA 1SANA 2X6OA 4V2GA 3JR9A 1ETYA 5IP7J 4BXXJ 1I50J 1YRNB 1Z0XA 2IBDA 3HGGA 2O9LA 4XRMA 4A69C 4M3GA 4M6VA 5IYCJ 1HDPA 1JT6A 1VF9A 4MFDA 3I4MJ 3SJMA 1APLC 3HKZN 4MO7A 2GM4A 2DA4A 3Q0VA 2QF7A 3HBLA 3F0CA 1WH5A 1Q1VA 4RBOA 2H8RA 5K7FA 5C3EJ 3M3YJ 2CJJA 4QTRA 3NARA 2DA5A 4BBRJ 5GPCA 4B3AA 3PO2J 1FTTA 3BR2A 3FK6A 3G1MA 1U9OA 3JRIA 5C44J 3JRDA 2Y9ZA 4ABZA 4C3HJ 4UUSA 2XPWA 2NS8A 4JYKA 2XPVA 4X1EA 3S14J 3BR0A 3BQYA 3LNQA 4UUSB 1NTCA 2LKXA 1JKOC 1FTZA 3S1NJ 1JTYA 1WI3A 4FISA 4BY7J 2LK2A 3BR6A 4A3DJ 2DA2A 2JK3A 1VI0A 3W6VA 2JWTA 2R5YA 1ZQ3P 5C4JJ 1TWAJ 1ETKA 1TWHJ 3BR1A 3MN2A 2R5YB 2COBA 3E7LA 3TP0A 5GPAA 3PM1A 4HNVA 4CYCB 2R93J 5F27A 1P7JA 2DTZA 5IYDJ 4JP0A 3TW7A 2MG4A 1OCTC 3B6AA 5FKNA 2LR8A 2W48A 2DMQA 2WV1A 1RKTA 1HDDC 1NK3P 4NDLA 4I76A 2XGDA 3BG5A 1B72A 2Y0SN 5FKLA 4DZPA 3RZOJ 4BBSJ 4GFBA 1B72B 1U9NA 3HOWJ 3WHBA 2LFBA 4C3IJ 1ZR2A 2O8KA 5C4XJ 2WAQN 4G12A 1RPWA 2YUSA 2DJNA 1XC5A 2E1OA 3BTCA 2ELKA 4EEFG 2XGCA 1IRZA 4D7NA 1UMQA 5F0CA 5EGOA 4A3EJ 3K2AA 1MSFC 1WH7A 5FLVA 2CU7A 3SDGA 5EGOB 1ZTRA 2NVQJ 1HOMA 4Y52J 3CMYA 4W1UA 4I6ZA 4FE4A 3TP3A 4XK4A 2LY9A 5M5XJ 1TC3C 1UG2A 2LTPA 3HDDA 3HOZJ 3IH2A 1QVUA 4MFEA 3O8HA 2VI6A 2PMZN 4MLOA 4X6AJ 2LLKA 4XIDA 1U8BA 1ORKA 3S17J 1A5JA 2MSYA 2DA3A 2XRLA 3G1LA 4AC0A 3BR3A 3QQAA 5K7HA 3OSGA 2JA6J 2MGQA 2EZLA 3HB9A 2YU9J 4A3IJ 3BQZA 1ETXA 5FLMJ 3IH4A 2DA6A 2VKVA 2NS7A 5FKKA 3S1QJ 1E3OC 5EZGA 1PUFA 1ETVA 1R9TJ 1YRNA 3LSRA 5E3NA 2DMUA 1BA5A 1TWGJ 3GTGJ 1LE8A 3BG9A 1PUFB 1JKQC 1GT0C 1LE8B 2FD5A 4MIMA 1H8AC 1WGXA 2L0KA 2DMPA 2L7MP 2ZB9A 3OIOA 4A3JJ 1MBHA 2R5ZA 2XGEA 4M3EA 2LD5A 4DYRA 5M5WJ 1IDZA 2R5ZB 1GVDA 1Y1VJ 4AUXA 3GTKJ 5EEAA 2B63J 1RETA 3GTQJ 5DTDA 2L7FP 5FKOA 1X58A 2IEKA 3JRGA 2FJ1A 1EF4A 5EDNA 1IDYA 3Q0UA 1VFCA 5F08A 5EYRA 1FIPA 3ZQFA 1I3QJ 2K9QA 3IV5A 2ECBA 4IHVA 2HXOA 3M4OJ 2R92J 5K7ZA 1JJ6C 3FKIJ 2FX0A 3ZQGA 2XPUA 2M34A 1OFCX 3HOUJ 3MVPA 1MBGA 4A3FJ 4W97A 1ETOA 1H89C 4A3CJ 2JA8J 1T33A 2OF7A 3DCFA 2NVXJ 1GV2A 3JRAA 1XS9A 1JT0A 3LSGA 1MH3A 4CYCA 1CQTA 2JN6A 5J3LA 3A01A 3FISA 1HCRA 4DYCA 2EH3A 2QCOA 1IJWC 2CUEA 2EZKA 3A01B 2X48A 3JRBA 1IUFA 4C2MJ 1G2HA 1IV6A 2CQQA 2JA7J 1GUUA 3WHCA 4DYQA 2HDDA 2KDZA 2YS9A 3B6CA 5JLXA 4AYBN 5EF6A 2GLOA 1ENHA 4JX6A 2EZHA 2X9DA 4JX5A 1OJLA 5M3FJ 3UKGA 2CQXA 1X2NA 5IPAA 2H1KA 2CRGA 5IP9J 1TWCJ 1LFBA 2Y2ZA 3Q0WA 3S1RJ 2JJ7A 3H3VK 5GP9A 1F43A 3PO3J 1QRYA 1AKHA 1JKRC 4IHXA 2K40A 1QVTA 1A6IA 1ZKGA 1JGGA 1BJZA 3K7AJ 3S1MJ 4B4CA 3OSFA 1AKHB 1W0UA 2M2EA 2ME6A 1QPIA 2DN0A 4L5EA 3GTMJ 4IHYA 1O4XA 3ZOBA 3JRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQ5 A;  3LSP A;  5J1U A;  1MSE C;  1LFU P;  1MBK A;  2AO9 A;  2M9H A;  2O7O A;  3BR5 A;  2D5V A;  2HOA A;  3BG3 A;  2NVY J;  3I4N J;  1IGN A;  1AHD P;  1ETW A;  4QIW N;  5F04 A;  2XB0 X;  2VKE A;  5IOY A;  2XSD C;  9ANT A;  3MKL A;  3ZQC A;  3Q3S A;  2GBY A;  1F36 A;  3C2B A;  4DW6 A;  3SFI A;  1FJL A;  1JUM A;  3ZQL A;  3D1N I;  2DMN A;  2ID6 A;  3GTJ J;  2E2I J;  3BTL A;  3HEF A;  1T56 A;  3S2H J;  2L9R A;  2NOG A;  4BKX A;  2E2J J;  1BW5 A;  1ITY A;  2EBI A;  2JMW A;  3HOV J;  1GV5 A;  2N8G A;  2KT0 A;  1MNM C;  4A3B J;  5M3M J;  3VPR A;  3O8G A;  5EG0 A;  1OCP A;  1B8I A;  4XIC A;  3A02 A;  4D5F A;  3JRF A;  4J19 A;  5EG0 B;  1Y1W J;  2VUM J;  2IAI A;  3BT9 A;  4RDU A;  3FK7 A;  1B8I B;  3CDL A;  1GDT A;  1FIA A;  1VND A;  1RR7 A;  1NK2 P;  1JUS A;  1ZGW A;  4C3J J;  3OOU A;  5DS9 A;  5F0F A;  2DA7 A;  1K61 A;  5IYB J;  2TRT A;  1POG A;  2TCT A;  3RKQ A;  1RES A;  1Z77 A;  1X2M A;  2HOS A;  1U78 A;  3HOY J;  1DU6 A;  1JKP C;  3BTI A;  5F0H A;  2OPT A;  4XRS G;  3CCY A;  5JLW A;  4Y7N J;  3L1P A;  1ETQ A;  2ME0 A;  5IP6 A;  1JJ8 C;  4D7M A;  1ZK8 A;  4IHW A;  3RZD J;  2K9N A;  1XG1 A;  2VPR A;  4V2F A;  5EZH A;  3ZQI A;  3LOC A;  2LVS A;  5E3M A;  3S2D J;  1IG7 A;  1JUP A;  3FIW A;  3BTJ A;  2HOT A;  2M8G X;  2R0Q C;  1BL0 A;  3GTO J;  1FEX A;  1WCM J;  3QPS A;  2AHQ A;  2DA1 A;  3TW6 A;  4BY1 J;  1SFO J;  2EZI A;  3H0G J;  4JX4 A;  4M3D A;  3HGY A;  4FCY A;  2Y30 A;  3ZQH A;  3HOX J;  2E2H J;  1RKW A;  2FQ4 A;  4LOC A;  1UHS A;  5FKM A;  1H88 C;  3HM5 A;  5J1Y A;  2ID3 A;  1P7I A;  2HI3 A;  2L7Z A;  3TED A;  3IH3 A;  2HXI A;  3DEW A;  5IOZ A;  3GTL J;  3S16 J;  1I6H J;  2DMT A;  3NAU A;  4A93 J;  4A3G J;  1TWF J;  1D5Y A;  3GBG A;  3GTP J;  1W0T A;  4A3M J;  2Y9Y A;  2E19 A;  4M3F A;  2K9S A;  1S7E A;  1ZR4 A;  5F1J A;  5M5Y J;  5J1R A;  4B1R A;  2XB5 A;  5E3L A;  2G0E A;  4S0H B;  2WB1 N;  2NVT J;  1MH4 A;  4A3K J;  3QPL A;  1MBE A;  5BNG A;  2RAE A;  2Y31 A;  1WPK A;  5E3O A;  1MBF A;  2I10 A;  3CQZ J;  4DZJ A;  1AU7 A;  1JTX A;  2P81 A;  5HOD A;  4D5C A;  2ECC A;  4UUT A;  1BW6 A;  4QSH A;  2R7Z J;  3JRE A;  2JA5 J;  1DU0 A;  3A03 A;  4FTH A;  2LP0 A;  1K83 J;  2HYJ A;  1MBJ A;  2EQR A;  4IEJ A;  4A3L J;  4XRS A;  2M0C A;  3LSJ A;  4FE7 A;  4M3B A;  2MW8 A;  3RQI A;  5FJ8 J;  1HF0 A;  2CUF A;  3G1O A;  1IC8 A;  3S15 J;  3JRH A;  1HLV A;  1SAN A;  2X6O A;  4V2G A;  3JR9 A;  1ETY A;  5IP7 J;  4BXX J;  1I50 J;  1YRN B;  1Z0X A;  2IBD A;  3HGG A;  2O9L A;  4XRM A;  4A69 C;  4M3G A;  4M6V A;  5IYC J;  1HDP A;  1JT6 A;  1VF9 A;  4MFD A;  3I4M J;  3SJM A;  1APL C;  3HKZ N;  4MO7 A;  2GM4 A;  2DA4 A;  3Q0V A;  2QF7 A;  3HBL A;  3F0C A;  1WH5 A;  1Q1V A;  4RBO A;  2H8R A;  5K7F A;  5C3E J;  3M3Y J;  2CJJ A;  4QTR A;  3NAR A;  2DA5 A;  4BBR J;  5GPC A;  4B3A A;  3PO2 J;  1FTT A;  3BR2 A;  3FK6 A;  3G1M A;  1U9O A;  3JRI A;  5C44 J;  3JRD A;  2Y9Z A;  4ABZ A;  4C3H J;  4UUS A;  2XPW A;  2NS8 A;  4JYK A;  2XPV A;  4X1E A;  3S14 J;  3BR0 A;  3BQY A;  3LNQ A;  4UUS B;  1NTC A;  2LKX A;  1JKO C;  1FTZ A;  3S1N J;  1JTY A;  1WI3 A;  4FIS A;  4BY7 J;  2LK2 A;  3BR6 A;  4A3D J;  2DA2 A;  2JK3 A;  1VI0 A;  3W6V A;  2JWT A;  2R5Y A;  1ZQ3 P;  5C4J J;  1TWA J;  1ETK A;  1TWH J;  3BR1 A;  3MN2 A;  2R5Y B;  2COB A;  3E7L A;  3TP0 A;  5GPA A;  3PM1 A;  4HNV A;  4CYC B;  2R93 J;  5F27 A;  1P7J A;  2DTZ A;  5IYD J;  4JP0 A;  3TW7 A;  2MG4 A;  1OCT C;  3B6A A;  5FKN A;  2LR8 A;  2W48 A;  2DMQ A;  2WV1 A;  1RKT A;  1HDD C;  1NK3 P;  4NDL A;  4I76 A;  2XGD A;  3BG5 A;  1B72 A;  2Y0S N;  5FKL A;  4DZP A;  3RZO J;  4BBS J;  4GFB A;  1B72 B;  1U9N A;  3HOW J;  3WHB A;  2LFB A;  4C3I J;  1ZR2 A;  2O8K A;  5C4X J;  2WAQ N;  4G12 A;  1RPW A;  2YUS A;  2DJN A;  1XC5 A;  2E1O A;  3BTC A;  2ELK A;  4EEF G;  2XGC A;  1IRZ A;  4D7N A;  1UMQ A;  5F0C A;  5EGO A;  4A3E J;  3K2A A;  1MSF C;  1WH7 A;  5FLV A;  2CU7 A;  3SDG A;  5EGO B;  1ZTR A;  2NVQ J;  1HOM A;  4Y52 J;  3CMY A;  4W1U A;  4I6Z A;  4FE4 A;  3TP3 A;  4XK4 A;  2LY9 A;  5M5X J;  1TC3 C;  1UG2 A;  2LTP A;  3HDD A;  3HOZ J;  3IH2 A;  1QVU A;  4MFE A;  3O8H A;  2VI6 A;  2PMZ N;  4MLO A;  4X6A J;  2LLK A;  4XID A;  1U8B A;  1ORK A;  3S17 J;  1A5J A;  2MSY A;  2DA3 A;  2XRL A;  3G1L A;  4AC0 A;  3BR3 A;  3QQA A;  5K7H A;  3OSG A;  2JA6 J;  2MGQ A;  2EZL A;  3HB9 A;  2YU9 J;  4A3I J;  3BQZ A;  1ETX A;  5FLM J;  3IH4 A;  2DA6 A;  2VKV A;  2NS7 A;  5FKK A;  3S1Q J;  1E3O C;  5EZG A;  1PUF A;  1ETV A;  1R9T J;  1YRN A;  3LSR A;  5E3N A;  2DMU A;  1BA5 A;  1TWG J;  3GTG J;  1LE8 A;  3BG9 A;  1PUF B;  1JKQ C;  1GT0 C;  1LE8 B;  2FD5 A;  4MIM A;  1H8A C;  1WGX A;  2L0K A;  2DMP A;  2L7M P;  2ZB9 A;  3OIO A;  4A3J J;  1MBH A;  2R5Z A;  2XGE A;  4M3E A;  2LD5 A;  4DYR A;  5M5W J;  1IDZ A;  2R5Z B;  1GVD A;  1Y1V J;  4AUX A;  3GTK J;  5EEA A;  2B63 J;  1RET A;  3GTQ J;  5DTD A;  2L7F P;  5FKO A;  1X58 A;  2IEK A;  3JRG A;  2FJ1 A;  1EF4 A;  5EDN A;  1IDY A;  3Q0U A;  1VFC A;  5F08 A;  5EYR A;  1FIP A;  3ZQF A;  1I3Q J;  2K9Q A;  3IV5 A;  2ECB A;  4IHV A;  2HXO A;  3M4O J;  2R92 J;  5K7Z A;  1JJ6 C;  3FKI J;  2FX0 A;  3ZQG A;  2XPU A;  2M34 A;  1OFC X;  3HOU J;  3MVP A;  1MBG A;  4A3F J;  4W97 A;  1ETO A;  1H89 C;  4A3C J;  2JA8 J;  1T33 A;  2OF7 A;  3DCF A;  2NVX J;  1GV2 A;  3JRA A;  1XS9 A;  1JT0 A;  3LSG A;  1MH3 A;  4CYC A;  1CQT A;  2JN6 A;  5J3L A;  3A01 A;  3FIS A;  1HCR A;  4DYC A;  2EH3 A;  2QCO A;  1IJW C;  2CUE A;  2EZK A;  3A01 B;  2X48 A;  3JRB A;  1IUF A;  4C2M J;  1G2H A;  1IV6 A;  2CQQ A;  2JA7 J;  1GUU A;  3WHC A;  4DYQ A;  2HDD A;  2KDZ A;  2YS9 A;  3B6C A;  5JLX A;  4AYB N;  5EF6 A;  2GLO A;  1ENH A;  4JX6 A;  2EZH A;  2X9D A;  4JX5 A;  1OJL A;  5M3F J;  3UKG A;  2CQX A;  1X2N A;  5IPA A;  2H1K A;  2CRG A;  5IP9 J;  1TWC J;  1LFB A;  2Y2Z A;  3Q0W A;  3S1R J;  2JJ7 A;  3H3V K;  5GP9 A;  1F43 A;  3PO3 J;  1QRY A;  1AKH A;  1JKR C;  4IHX A;  2K40 A;  1QVT A;  1A6I A;  1ZKG A;  1JGG A;  1BJZ A;  3K7A J;  3S1M J;  4B4C A;  3OSF A;  1AKH B;  1W0U A;  2M2E A;  2ME6 A;  1QPI A;  2DN0 A;  4L5E A;  3GTM J;  4IHY A;  1O4X A;  3ZOB A;  3JRC A; 
#chains in the Genus database with same CATH topology
 4LJZ F;  4BJT A;  2DBB A;  5J1U A;  1J59 A;  3EUH A;  1T95 A;  2IGK A;  1MBK A;  3JAM K;  2KL4 A;  3N05 A;  1FOW A;  3S3M A;  2PJP A;  3HSE A;  4PJM A;  4AYB A;  3MKW B;  2WC2 A;  4BHB A;  4XOR A;  4M73 A;  3ZQC A;  4XLF A;  3CUO A;  4DW6 A;  3OYJ A;  3OY9 A;  2VIX A;  1JUM A;  3D1N I;  4MNU A;  4UB8 C;  3TQN A;  3WTW C;  4PJJ A;  3ZMD A;  2E2I J;  3KLO A;  4YRV A;  1Z1D A;  4BKX A;  4DJA A;  3CCQ I;  3BPV A;  5F1R A;  2N8G A;  1QU3 A;  2A68 F;  4A3B J;  5M3M J;  1Y39 A;  3VPR A;  4OIR F;  1WKM A;  3W2W A;  5TIS C;  2E35 A;  3ZMT A;  1UHW A;  4II2 A;  1OIS A;  4P55 A;  4XIC A;  2ZXJ A;  1V5F A;  4UVC A;  3HPH A;  1WHU A;  1WJ5 A;  3QRF F;  1K7A A;  4G7H F;  3BT9 A;  4LIV A;  1LJ9 A;  4XON A;  4ZYH A;  5KAF C;  4ZYA A;  4LFU A;  5F64 A;  3JTG A;  3U9G A;  1FIA A;  3CF2 A;  1NK2 P;  2RV8 A;  1ZGW A;  2QLZ A;  4IL6 C;  1Y0N A;  1K61 A;  2Y75 A;  2XAS A;  2I5U A;  1B9M A;  3LWF A;  3ZGK A;  1EV7 A;  3FF5 A;  1XX5 A;  1BM9 A;  3RKQ A;  1RES A;  3H5R A;  2DAO A;  2CSO A;  3CMA I;  5E79 C;  3F23 A;  2D1H A;  4O3M A;  4UUV A;  4A12 A;  2EK5 A;  4Y7N J;  3HOT A;  3COA C;  5IP6 A;  2GIV A;  3T8R A;  1VQO I;  1WSU A;  2M7B A;  3K6G A;  4G7Z F;  3QOD A;  4RAZ A;  2BY0 A;  5LGU A;  3GZ6 A;  2A3S A;  2K9N A;  1XG1 A;  3BCA A;  1LKX A;  5EZH A;  4LD5 A;  2VE8 A;  2E7W A;  2QQ9 A;  5E3M A;  1IG7 A;  3S2D J;  2M8G X;  5DCM A;  1QHG A;  4EJV A;  3EDP A;  1X19 A;  2XAJ A;  2AHQ A;  5DCM B;  2V1D A;  2P7V B;  2CO5 A;  1YJN I;  4OOI A;  4BY1 J;  3TL4 X;  2CG4 A;  4ENM A;  1P9Q C;  1OCO H;  2EIN H;  1TQP A;  2JVH A;  5CVR A;  3BY6 A;  4LOC A;  3I71 A;  4BAC A;  2M8E A;  5J1Y A;  1KA8 A;  1V4R A;  4A0X A;  2XV4 S;  2HXI A;  5CVI A;  5BPD A;  5JI6 A;  4A93 J;  4A3G J;  1LUJ B;  5J8C A;  5ERI A;  3E97 A;  4OU0 A;  2P6S A;  2B9S A;  3R0A A;  1S7A A;  1UFM A;  4M3F A;  3LSH A;  2K9S A;  2GQQ A;  2A6E F;  2KJB A;  3I9V 2;  4YFK F;  4D1Q A;  2WBM A;  1YW9 A;  5HLI A;  5F1J A;  2YSR A;  2JRM A;  5M5Y J;  2F4I A;  2IPQ X;  5HDN A;  4XKB A;  1LNW A;  2G0E A;  2WB1 N;  2MLK A;  3PL8 A;  4A3K J;  1XGS A;  1S29 A;  1QQI A;  3W3C A;  1T8I A;  2RAE A;  2Y31 A;  1WPK A;  5E3O A;  2HR3 A;  1HC8 A;  1YW7 A;  1T0F A;  1XD7 A;  1JTX A;  5J40 A;  1H9G A;  4D5C A;  3KP3 A;  4UUT A;  2KDO A;  2Z99 A;  3K0L A;  5AIQ A;  4RMN A;  4PDK A;  5E8I A;  3H3Z A;  2DJI A;  4FTH A;  2D2W A;  2Y0S A;  2WTE A;  2LP0 A;  1YE9 A;  1RIO H;  4EJU A;  2HDC A;  2EQR A;  4XRS A;  2XKO A;  2MW8 A;  5FJ8 J;  4WX9 A;  2WY7 Q;  5K5Q A;  2M45 A;  1ZLJ A;  3U21 A;  2VKD A;  3IAM 2;  2R7X A;  2STT A;  3JR9 A;  5IP7 J;  1G59 A;  3ZMS A;  1E0E A;  2X1D A;  2A05 A;  4AID A;  2VJ5 A;  3H0D A;  2O9L A;  2Q2E A;  3GLL A;  3DQV C;  3WG7 H;  2Q2E B;  1JT6 A;  2IA1 A;  4LLG F;  2ISY A;  3KCC A;  3HHH A;  4QLC U;  4UV8 A;  3E3V A;  2DA4 A;  3Q0V A;  4OIO F;  4JOM A;  5K7F A;  4HQM A;  5C3E J;  1D3Y A;  1IW7 F;  3H5A A;  3F8C A;  1MMS A;  2PMZ A;  3FMS A;  4RM3 A;  5GTI C;  4BBR J;  3LAP A;  1KQ8 A;  4I99 C;  2DPD A;  1FTT A;  3BR2 A;  5KK1 A;  4HF2 A;  2XF6 A;  1BI1 A;  1LFP A;  3IC7 A;  1VQK I;  4ZJZ A;  2RQP A;  5C44 J;  3JRD A;  3IUO A;  1MJA A;  4ABZ A;  4UUS A;  4AM3 A;  4JYK A;  1YIT I;  1KYZ A;  2KIM A;  2KLO A;  3S14 J;  3BQY A;  4UUS B;  1YG2 A;  4EGY A;  4LB6 B;  3GWZ A;  2RKH A;  1PVE A;  1JTY A;  1WI3 A;  3LSK A;  4FIS A;  4CCO A;  5H20 A;  2P6T A;  2KIQ A;  1IF1 A;  1MKM A;  3HJE A;  2LF8 A;  2EJR A;  3DBL B;  3DP7 A;  2JK3 A;  1U0J A;  5AON A;  4E7L A;  3PQJ A;  4Y15 A;  2IS6 A;  3KIO A;  2V7F A;  3KPH A;  3MN2 A;  4ZZL A;  3E7L A;  4FAS D;  3QOP A;  5GPA A;  4AIJ A;  5F6F A;  4HNV A;  4CYC B;  1U3E M;  5B66 C;  1A6Q A;  4XLN F;  4JP0 A;  2VUM J;  1VQP I;  1OCT C;  3K4M A;  2UXX A;  3CO6 C;  1IN7 A;  3J80 K;  3J7Y J;  3T0Y A;  3JTH A;  1RKT A;  2X6X A;  3L9F A;  4L5J A;  1NK3 P;  1IN8 A;  3MD2 A;  4NDL A;  4P9F A;  4HLX A;  2XGD A;  4A2U A;  4CH7 A;  1G4D A;  1B72 A;  5CJ9 A;  4KFC A;  2VBX A;  3LA3 A;  1B72 B;  3WHB A;  1ZR2 A;  3KP2 A;  1W4M A;  4ENK A;  5D8K B;  5IT9 K;  1REP C;  3W6J B;  4G12 A;  1GVJ A;  2YUS A;  2HPI A;  1Z9C A;  4CCL A;  1ZGA A;  2ELK A;  4ASN A;  5ILS A;  3LSM A;  3K2A A;  2Y69 H;  1WH7 A;  5FLV A;  3FXR A;  2Z1D A;  3SDG A;  4IRH A;  1FBU A;  2H09 A;  2K5C A;  3E5Q A;  3E5X A;  2V6C A;  4KMF A;  4FE4 A;  5DD4 A;  4XK4 A;  2VLA A;  1TC3 C;  2M0M A;  3DKW A;  4O5V A;  2CV1 A;  2E36 A;  1R58 A;  2LTP A;  3M8J A;  2K4B A;  1VQ9 I;  2RNJ A;  2VAS A;  3DTE A;  2VI6 A;  3GX4 X;  1GXP A;  4X6A J;  2H8W A;  3HSF A;  4KA4 A;  3S17 J;  2L54 A;  1DPU A;  1SMY F;  1QZY A;  4WXC A;  3ECO A;  3OMY A;  3QOE A;  5LRS A;  2HFH A;  3E5U A;  3DEE A;  1GHC A;  2KJC A;  1FYM A;  3I64 A;  1BI0 A;  1N25 A;  4IPA A;  3F8M A;  4R8H A;  4EMS A;  1YQA A;  4LGW A;  1YRN A;  1N78 A;  4I98 B;  5KVR A;  5E3N A;  2DMU A;  4GO1 A;  1XB4 A;  2JVG A;  2AQE A;  1BR1 A;  3AG4 H;  4EJT A;  1LB2 A;  1VQ5 I;  2G9W A;  1GT0 C;  2KRF A;  2HYF A;  3CDH A;  1ACI A;  1IAW A;  2L7M P;  3V7S A;  1HW5 A;  3OIO A;  5TRD A;  2G7U A;  3OYL A;  4L18 B;  3MKY B;  2WV0 A;  2WAD A;  3HYI A;  5FO5 A;  4L9V A;  1KU9 A;  2EIJ H;  3DTK A;  1UZC A;  4HG2 A;  4EJO A;  2B63 J;  1ZRE A;  3HIF A;  5D5U B;  1VZ0 A;  1IV8 A;  1ON2 A;  2EA2 A;  2BVL A;  3ONQ A;  5H2F C;  3Q0U A;  3IL2 A;  2IGN A;  3RIR A;  1G3Y A;  2FE3 A;  2K86 A;  3QU3 A;  1I3Q J;  3GFI A;  2HXO A;  4L0Y B;  3T5X A;  5H6Q A;  4ON0 A;  1TL8 A;  4BEH A;  2M34 A;  3C18 A;  1KQ9 A;  1BOA A;  1MBG A;  4A3F J;  3SDB A;  1LDD A;  3TKY A;  2P5L C;  4BEH B;  4B8X A;  4A3C J;  4PGH A;  5BPI A;  2JA8 J;  1UAA A;  4CGZ A;  2ZJR F;  2BOL A;  2M7A A;  3ELK A;  1J75 A;  2F5E A;  3CCJ I;  1FYK A;  1CQT A;  2LNB A;  1KGS A;  2JN6 A;  3R60 A;  4QWQ A;  4BE2 A;  1MW7 A;  3FBI B;  1D8K A;  1HCR A;  2QCO A;  2PG4 A;  5HS7 A;  2ZFU A;  2X48 A;  2P5K A;  1D0Z A;  3BJ6 A;  3CES A;  2CQQ A;  4IX7 A;  4DYQ A;  4YFN F;  2KDZ A;  2IRF G;  2C6Y A;  1QO0 D;  1YOV B;  4IRG A;  4M6X A;  1ENH A;  1NH3 A;  2CFX A;  1Y6I A;  2IJL A;  3ZXS A;  5JR3 A;  4AD9 A;  4CUG A;  2RQQ A;  4NC8 A;  3KEO A;  2Y0M A;  5K1Y A;  3F8F A;  1TWC J;  2CMP A;  3G2B A;  3S1R J;  3RSN A;  1BR4 A;  2JJ7 A;  3H3V K;  2LRD A;  1QRY A;  1AKH A;  1ZH5 A;  1JGG A;  1ZKG A;  4Z2Y A;  1FT9 A;  1SD6 A;  5B3S H;  5LHG A;  1AKH B;  1SMT A;  4M74 A;  1IZ1 A;  5HDG A;  4XKW A;  1VTN C;  4IHY A;  2HNH A;  2VPL A;  2W1O A;  3KLN A;  2Z16 A;  5EEH A;  5E17 F;  4IOA F;  3VOE A;  4BU2 A;  2HYG D;  2AS5 F;  2ZME B;  5LLQ A;  1LFU P;  3F6V A;  3UR3 C;  4ZC3 A;  3BG3 A;  2D5V A;  3I4N J;  1IGN A;  1AHD P;  2QZ8 A;  1ETW A;  2LF7 A;  2L2O A;  3H36 A;  4KIC A;  5LGT A;  2BY2 A;  2RC4 A;  3RPU D;  2A5W A;  3C3W A;  5IOY A;  3T1B A;  4BQA A;  3AL0 C;  3A1Y A;  3Q3S A;  1F36 A;  1DUX C;  2MFZ A;  5BMZ A;  3C2B A;  1RI7 A;  2O5R A;  2OZ6 A;  3ZQL A;  5JHF A;  4D9J A;  5DDG A;  2QBY A;  2VJI A;  2QVO A;  1OR7 A;  4AVP A;  4AVZ A;  3GTJ J;  4XM3 A;  3S2H J;  1FYL A;  2GZW A;  5KHD A;  2E2J J;  2PBI A;  2E7X A;  2QBY B;  1ITY A;  4KN4 X;  3HOV J;  3HTU A;  4E70 A;  2MLG A;  1MNM C;  1MMD A;  4XLE A;  1OCP A;  4WXH A;  1B8I A;  1Q1H A;  2VBZ A;  2BXZ A;  5D4S A;  4F3Q A;  4RLF A;  4IZZ A;  1O3Q A;  3CJQ B;  2L4M A;  3REO A;  3TOA A;  1R1T A;  3H3U A;  4E7Z A;  4RDU A;  1B8I B;  4IRI A;  1FBS A;  5HLG A;  1AWC A;  1Z67 A;  3MEX A;  4B3X A;  1K6Y A;  4PK4 A;  1EJ9 A;  1P4A A;  2IS2 A;  1JUS A;  4KN7 X;  2BV6 A;  3BP8 A;  3OOU A;  3V8L A;  2WB1 A;  2DA7 A;  1I5Z A;  3P7N A;  1LPQ A;  2V1N A;  4UNO A;  2CQN A;  2QGU A;  3LA2 A;  3BCB A;  2KIF A;  4LG0 A;  2HKO A;  4G6D A;  2HOS A;  1U78 A;  3HRU A;  5DYM A;  1FC3 A;  3WTV C;  5JVT A;  4LG0 B;  3KEY A;  2X51 A;  2XAF A;  4XRS G;  3CCY A;  4I09 A;  1YYV A;  4LIU A;  1MNE A;  3P9I A;  4FET A;  3J7Z I;  2ME0 A;  1R4N B;  1NG7 A;  4RLQ A;  4L0Z B;  5FRN A;  2EIL H;  4D7M A;  3CCS I;  3MCZ A;  3CO7 C;  1ZYR F;  1SFE A;  3PNT A;  1VQ7 I;  4IHW A;  3BG6 A;  1TTY A;  3NWT A;  4OMZ A;  2OC6 A;  4I02 A;  3DV8 A;  2A6H F;  2VE9 A;  2VXZ A;  4G94 A;  3ZQI A;  1U5T A;  3DPL C;  3H5N A;  2LVS A;  1DP7 P;  3KE2 A;  5EJC A;  1JUP A;  2J5P A;  1XMX A;  2VOP A;  2DTR A;  3BTJ A;  2HOT A;  1U5T B;  3OIQ A;  1YO5 C;  3GTO J;  1MDM A;  1H9T A;  1R7J A;  4L9J A;  2VT2 A;  3V8J A;  3QPS A;  3ULQ B;  2B0L A;  1M1E B;  1FOK A;  2DA1 A;  1MDM B;  2TDX A;  3H0G J;  3HRS A;  4JX4 A;  1RZ4 A;  3K1N A;  4M3D A;  4QPQ A;  2STW A;  4UB6 C;  3ABK H;  1UEL B;  2DT6 A;  1Y8Q B;  2BW3 B;  3ZQH A;  1TQI A;  4KUM A;  3HM5 A;  2ID3 A;  2HI3 A;  4XOT A;  4HA8 A;  1S8N A;  2EFN A;  4PFO A;  5LEK A;  1T39 A;  5IOZ A;  5D6F A;  2IGM A;  2W84 A;  3D5S C;  5L3D A;  1OQY A;  4XN3 A;  3OYM A;  1R1U A;  3PIO F;  3K70 C;  1TWF J;  4WF2 A;  3GBG A;  4N9I A;  5DCF A;  1D5Y A;  3HPG A;  2ZJQ F;  3GTP J;  1YJW I;  5D6E A;  2K3F A;  3CMM A;  2H6B A;  2Z5U A;  1W0T A;  4KIF A;  4KMU X;  4A3M J;  2E19 A;  2K85 A;  3F21 A;  1FZP B;  3E0J B;  1W5S A;  1YFH A;  1NG6 A;  1ZR4 A;  2KZG A;  5E1Z B;  3I54 A;  1SD4 A;  2H1L A;  2L3D A;  3KP5 A;  5FD5 A;  1I6X A;  4S0H B;  4MQ9 F;  2QQB A;  4EM0 B;  1TBX A;  3QYE A;  1VQ8 I;  3V42 A;  2X1C A;  1MBE A;  4IKF A;  1O3R A;  1I1G A;  4GDF A;  4U7B A;  1FWZ A;  3SQN A;  4G9Y A;  3EYI A;  4N9H A;  4ZDL A;  2EB7 A;  1XDU A;  4I01 A;  1H0M A;  1KU3 A;  1YLF A;  2BY1 A;  4QSH A;  5JHU A;  3QU6 A;  3QP5 A;  2EFW A;  2JA5 J;  1IRX A;  2E1C A;  2PN6 A;  1OMI A;  4K2E A;  1MBJ A;  3FMR A;  4IEJ A;  3RCO A;  3WOD F;  4I2O A;  4A3L J;  2M0C A;  3OYF A;  3LSJ A;  2Q8K A;  2FUG 2;  3KYL A;  2DFF A;  3RQI A;  1IUY A;  3F9K A;  2VKH A;  1K4T A;  2XC7 A;  1MJ9 A;  2OJE D;  1EH6 A;  2X6O A;  1I50 J;  3RQ4 A;  1Z0X A;  2O0Y A;  2RVC A;  4RGX A;  3IKT A;  2UXN A;  3A0B C;  3ZR8 X;  4A69 C;  2MD5 A;  3M8F A;  5IYC J;  1XDS A;  1XMK A;  3Q9S A;  1JGS A;  4MFD A;  2ZNZ A;  4PZJ A;  3I4M J;  1APL C;  1R22 A;  3HKZ N;  4MO7 A;  2GM4 A;  3MKZ A;  1Z3X A;  2NYX A;  3HBL A;  4LMY A;  1Q1V A;  1X3U A;  1G6N A;  3M3Y J;  1HKS A;  3QAH A;  2V9P A;  3VEP A;  2OAZ A;  3CTA A;  2DA5 A;  4JK1 X;  3GZN B;  1LEA A;  4JBA A;  4B3A A;  3FK6 A;  1JE8 A;  2FF4 A;  2VJ4 A;  2CW0 F;  3I4P A;  1U9O A;  3HXL A;  3JRI A;  2HZD A;  2Y9Z A;  2XPW A;  1Z21 A;  2XPV A;  4RAY A;  1YIJ I;  4U7D A;  3GFL A;  5CQE A;  1X1P A;  1SAX A;  2DYR H;  3VWB A;  4L5I A;  5FLX K;  4KIG A;  2M3A A;  1X1D A;  4Y13 A;  1BIA A;  1R00 A;  3VYT B;  2QYO A;  2GOX B;  1TW3 A;  1FP2 A;  2LH9 A;  3OS1 A;  1XSV A;  3W6V A;  3CLO A;  3V7C A;  1ZQ3 P;  1TWA J;  2COB A;  1R4M B;  3H1C A;  5HVQ C;  2VQH A;  2VBW A;  3ZP5 A;  2JA2 A;  3WTX C;  3VSK A;  2FXA A;  3ISP A;  1P7J A;  3TMO A;  1YTY A;  5E18 F;  4U0W A;  1LQ1 A;  3TW7 A;  1DP3 A;  2CQK A;  4BH9 A;  4XKV A;  5J4Y A;  2LR8 A;  4NHJ A;  1WWX A;  1KU2 A;  4RS8 A;  2ADU A;  3BG5 A;  3MWM A;  4HX4 A;  2EV0 A;  2XSJ C;  1GLN A;  1E3H A;  3HOW J;  5C4X J;  3KP6 A;  2WWY A;  2O8K A;  1QGP A;  2WAQ N;  4BGD A;  4I0B A;  3U1D A;  1IN4 A;  4YFX F;  1VQ6 I;  4KIB A;  2OTJ I;  1XC5 A;  2QUF A;  4EEF G;  3BG7 A;  2UV1 A;  2XGC A;  1UMQ A;  2XGX A;  4S05 A;  4Z6Y A;  1U6G A;  2CU7 A;  2XUB A;  2EFQ A;  3QWL A;  1EH7 A;  2ACJ A;  2P5V A;  2NVQ J;  4Y52 J;  2A69 F;  4W1U A;  3K4K A;  3CMY A;  4I6Z A;  3BZC A;  2DOD A;  2O3F A;  2KZV A;  3FXK A;  2DOA A;  3RPU A;  5D5V B;  4MFE A;  4ESB A;  4A6D A;  3O8H A;  2JQ7 A;  2BE5 F;  2M4G A;  4XID A;  4KT5 C;  2LBF A;  2HU9 A;  3PUB A;  2NNN A;  1UG0 A;  2JA6 J;  1XCB A;  4A3I J;  2LBF B;  2NNY A;  1XGO A;  5DUI A;  5FLM J;  4U0Y A;  1AA7 A;  2ZBK A;  1YIO A;  3PFY A;  4RM2 A;  3I0T A;  5FKK A;  1RRJ A;  2MH9 A;  3S1Q J;  4CXF A;  2OU2 A;  2DCE A;  1ZHF A;  1ETV A;  4A5M A;  3LSR A;  1R5G A;  2W25 A;  1TWG J;  2V26 A;  3GTG J;  4EM1 A;  1X1A A;  4H0E A;  4DOZ A;  2JTV A;  1OYI A;  4CCK A;  5LRR A;  1OYY A;  3TO9 A;  5HLT A;  4EGZ A;  4HF1 A;  4EVI A;  3EQL F;  1G3T A;  3CJN A;  3L00 A;  2FOK A;  3BWG A;  1STZ A;  1PP7 U;  2F5D A;  3WGG A;  2HQR A;  2XGE A;  3QP6 A;  1XN7 A;  1VQ4 I;  4UXN A;  5M5W J;  4BE0 A;  1O3T A;  1XMA A;  4BE1 A;  2I8D A;  2JUC A;  2MBF A;  1Y1V J;  4Q48 A;  3GTK J;  3T8T A;  1RET A;  3GTQ J;  2RNG A;  5DTD A;  1WRJ A;  2ISZ A;  1V55 H;  3CME I;  2ESN A;  2CFO A;  3BJO A;  1ODD A;  2ZNY A;  3GCM A;  2NRA C;  1LDJ A;  2QEN A;  3CDI A;  2FNA A;  4CZC A;  2HQA A;  1YX3 A;  3EYY A;  5CVU A;  1CF7 A;  2K9Q A;  3M4O J;  4EQQ A;  2R92 J;  3GLX A;  5K7Z A;  1CF7 B;  2FX0 A;  4XOP A;  1J9I A;  1PP8 F;  2XPU A;  2FBI A;  4I7H A;  3DU5 A;  1HW2 A;  4WK8 F;  2NVU B;  2KIS A;  2MD0 A;  1LVK A;  2ZXI A;  4W97 A;  3RDI A;  1T33 A;  2FBH A;  2OF7 A;  1F9N A;  4PSW A;  3SZP A;  2FML A;  4CIC A;  3CC7 I;  3EUK L;  1GV2 A;  1A04 A;  1XPX A;  4CYC A;  2V1X A;  4OMY A;  5JFR A;  4A0Y A;  5FB2 A;  1TW2 A;  2D1V A;  2XRN A;  5A2Q Z;  2WA0 A;  2Z9O A;  3K70 D;  2CGP A;  1B1B A;  2DFE A;  3CJR B;  2EZK A;  3KEQ A;  3QPH A;  2R7T A;  1YX5 A;  2V6E A;  1Z7L A;  1IUF A;  3JCU C;  2EPF A;  1JHH A;  1OPC A;  3BC8 A;  2JA7 J;  4YEL A;  3HRM A;  5CPR B;  2HDD A;  4IOC F;  1EH8 A;  3B6C A;  3K4C A;  3O2P E;  3ZCO A;  4AYB N;  1CGP A;  5EF6 A;  1TP4 A;  4JX6 A;  1OCR H;  1Z6R A;  2EZH A;  2LOO A;  2X9D A;  4L9N A;  1FLI A;  4JX5 A;  4NNJ A;  3K9T A;  1OJL A;  5M3F J;  3UKG A;  2UWM A;  2KRH A;  2BVM A;  5BQT A;  1LFB A;  3Q0W A;  1E3P A;  3HHG A;  2H94 A;  3WGI A;  1JXS A;  2KQR A;  2JT1 A;  5GP9 A;  4IHX A;  1QVT A;  1A6I A;  1J7K A;  4OAZ A;  3P9C A;  4FT8 A;  3K7A J;  4FHT A;  2CQ7 A;  1T98 A;  1TT5 B;  2E5Z A;  1R1V A;  2HQN A;  1QPI A;  3J81 K;  3K4L A;  4HV6 A;  1SVM A;  2IXS A;  2R7O A;  5LHH A;  2QA4 I;  4IHT A;  3JAM Z;  3FXJ A;  1ONV A;  2DK5 A;  2VQG A;  3F72 A;  5DD8 A;  5LGN A;  1WZ2 A;  4E4H A;  3LL7 A;  2AO9 A;  3BR5 A;  2O7O A;  3U1K A;  3SHF A;  3F6O A;  2IVM A;  4QIW N;  2K7L A;  2DQL A;  2IA2 A;  2DI3 A;  2XB0 X;  2VKE A;  5FGM A;  3RKX A;  3GZ5 A;  3FHZ A;  2XSD C;  9ANT A;  4P1W A;  5E8G A;  1NHA A;  4F92 B;  1MGT A;  2L9S A;  4V19 K;  4HPQ A;  2ZKZ A;  2ZSI B;  4U0V A;  3L2V A;  1V3F A;  2PMH A;  4HDU A;  3SFI A;  5LHI A;  1FMW A;  2DMN A;  5DUK A;  3M9A A;  3AG1 H;  2XDV A;  4HX7 A;  1IXC A;  2IS4 A;  4UVA A;  3BTL A;  3HEF A;  2L9R A;  2NOG A;  3DTI A;  2L4A A;  4NC7 A;  3SXY A;  3GO5 A;  2JMW A;  4XKC A;  3V7R A;  1AOY A;  1IXR C;  3O6B B;  2ZCW A;  3O8G A;  4HNT A;  5EG0 A;  3PNV A;  2ZXH A;  1GXQ A;  3A02 A;  3JRF A;  2WY8 Q;  5EG0 B;  3OYI A;  3OL3 A;  1A31 A;  3ZMV A;  1QPM A;  1X4O A;  2F4M B;  2H6C A;  2OUM A;  3CDL A;  1USS A;  4S04 A;  1W36 C;  1GDT A;  3JSP A;  4UV9 A;  2ZC2 A;  3M07 A;  3BDD A;  5IT3 A;  4F93 B;  5DS9 A;  2W4S A;  4DNC A;  2W57 A;  3QPT A;  2TRT A;  4PSX A;  1POG A;  2B7E A;  1MD0 A;  3LST A;  1K78 A;  4LLL A;  2LKP A;  1JKP C;  3BTI A;  3CF5 F;  1X1B A;  2OPT A;  3AG3 H;  3G4S I;  3OS2 A;  1K78 B;  1G3S A;  2NXN B;  2K27 A;  1MMG A;  2V9V A;  3R61 A;  5JLW A;  3L1P A;  4OIN F;  1ETQ A;  1QA6 A;  2M87 A;  1Z91 A;  2DLL A;  3GUD A;  4HF0 A;  2O61 A;  4UY8 I;  2P4W A;  3OYB A;  1ZK8 A;  4RB3 C;  3RJP A;  4GCV A;  3TBI A;  1SFU A;  1Z05 A;  2K4J A;  3RZD J;  3B02 A;  2VPR A;  3S3N A;  1P6R A;  4HX8 A;  2R7R A;  4NBQ A;  5D8L B;  5HS8 A;  3J7A O;  3LOC A;  3VYR B;  1TQM A;  1LEB A;  3H9Q A;  2FQ3 A;  2KFD A;  1BL0 A;  4G7O F;  1FEX A;  4ZDP A;  2CUJ A;  3U2R A;  4B44 A;  1WCM J;  3LA7 A;  1HW1 A;  3TW6 A;  4WCG A;  2CYY A;  2V4J C;  5DV5 A;  3E6D A;  1SFO J;  2HVR A;  2CWE A;  4UHT A;  5L3E A;  2W82 A;  3HGY A;  4FCY A;  3HKZ A;  2Y30 A;  4OAY A;  2KP6 A;  5H6R A;  5LBQ A;  3OYD A;  2E2H J;  3CCL I;  2DYS H;  4YII A;  2FQ4 A;  1UHS A;  5FKM A;  1H88 C;  1B59 A;  1PDN C;  2L7Z A;  5ICC A;  4CA0 A;  2LC2 A;  4IHS A;  2HVS A;  3GF2 A;  3W2V A;  2A61 A;  2IA0 A;  2R7V A;  3LQR A;  3GME A;  4ANJ A;  4IXA A;  4RAF A;  4PJ0 C;  4IQ4 A;  1JHF A;  4H4K C;  2LSO A;  3SYT A;  3AL0 B;  2KHM A;  3CUQ C;  4LB5 A;  3SEZ A;  1ZN2 A;  4OIQ F;  2F4O B;  4PJL A;  2F5F A;  2Y9Y A;  2ZME A;  5FFZ A;  4MEX F;  1X1C A;  3S93 A;  3EUA A;  2YU3 A;  4CO8 A;  3CD6 I;  4HAM A;  3CCE I;  3L2U A;  3C7J A;  4ESF A;  4X0G A;  2ZXW H;  5J1R A;  4B1R A;  3PSI A;  1DGW Y;  5D5W B;  4GGG A;  2R7W A;  1MH4 A;  2JPC A;  3QPL A;  4QPO A;  3CCM I;  3BZ6 A;  2EIM H;  3ERE D;  4BL0 B;  2I10 A;  4IJA A;  4DZJ A;  1MMN A;  3K4J A;  3K69 A;  1AU7 A;  2P81 A;  2OCE A;  3ZMU A;  2RRE A;  4Y4R A;  3CC2 I;  4YIR X;  2QSH X;  2X6Y A;  3JRE A;  2QWW A;  3IAS 2;  3W2A A;  3A03 A;  1FY7 A;  4ITV A;  2HS5 A;  1K83 J;  2CH0 A;  2RGV A;  4XMY A;  1K4S A;  3CLQ A;  2CW7 A;  4FE7 A;  2WAQ A;  1ZRF A;  4M3B A;  3LAJ A;  3TDU C;  1HF0 A;  2CUF A;  1D0X A;  4HLY A;  1YHQ I;  3G1O A;  1IC8 A;  1T08 B;  1VQM I;  3JRH A;  5FFX A;  1HLV A;  1SAN A;  3ZQ7 A;  4V2G A;  4YG2 F;  1ETY A;  1RNL A;  2W00 A;  3QYB A;  3SEQ A;  1TNS A;  1KON A;  2E5N A;  3KYD B;  4HW0 A;  2ZJ2 A;  3K10 A;  3HGG A;  4XRM A;  3ZMZ A;  4M3G A;  3OS0 A;  2VQC A;  4M6V A;  3GVA A;  1BI2 A;  4HSR A;  1WJA A;  2FBK A;  3SJM A;  1XGM A;  1MIJ A;  2ZFW A;  3LMM A;  3KP4 A;  4P5O A;  2ESH A;  3F0C A;  1WH5 A;  5J47 A;  2KIU A;  5TJJ A;  4NC6 A;  2H8R A;  4HRI A;  1P92 A;  2UZK A;  1L3L A;  2VON A;  4P9U A;  1K79 A;  4BYY A;  3WTZ A;  4ENJ A;  2CJJ A;  1IN6 A;  4QTR A;  3PJR A;  5GPC A;  2W7N A;  4IQJ A;  1B4A A;  3PO2 J;  3G1M A;  4N4N B;  2D45 A;  2OCC H;  1TLH B;  4ZYG A;  1WQ2 A;  4N4O B;  1DPR A;  2IT0 A;  3OOP A;  2NS8 A;  2KRC A;  1WJC A;  1FPQ A;  3QYF A;  4B09 A;  2LKX A;  1JKO C;  2PX9 A;  1VQL I;  1HSJ A;  4ZYE A;  4HV5 A;  3HG9 A;  5L3B A;  4BY7 J;  4HDV A;  1B9N A;  4E7S A;  1FSE A;  4WXD A;  4F91 B;  1D0Y A;  2DA2 A;  3OR1 C;  3I58 A;  3PSF A;  2W24 A;  2M30 A;  2LYC A;  5J4V A;  5HNH A;  4XLC A;  4M6Y A;  3IRQ A;  4D0P A;  1BC8 C;  2BW3 A;  2P0W A;  4XL9 A;  5C4J J;  2G7H A;  1W1W E;  3MFK A;  1RR8 C;  1HKQ A;  4LG3 A;  1R6R A;  2OD5 A;  2OTL I;  1ETK A;  1TWH J;  3JSO A;  2PJR A;  3BR1 A;  3TP0 A;  2L02 A;  1OKR A;  3NQO A;  3PFI A;  3VDX A;  2E34 A;  2PJR B;  2DTZ A;  3J80 Z;  4BUP A;  3BZK A;  4FX0 A;  2EWN A;  3VSL A;  2R7F A;  1YI2 I;  2ICW G;  1BJA A;  5BOX A;  3C2G A;  1S3J A;  5A2Q K;  2W48 A;  2DMQ A;  3FXQ A;  5GAG J;  3WU1 B;  2WV1 A;  3FZV A;  4BJ6 C;  3N4M A;  5ICE A;  5B1A H;  4C2U A;  4HST A;  5IT9 Z;  4HOB A;  3WE2 A;  3AAF A;  3NRV A;  4BQQ A;  3AG2 H;  4DZP A;  4BBS J;  3K1M A;  3FX3 A;  4C3I J;  1FOX A;  3ROU A;  2GIZ A;  3MAJ A;  3LSI A;  2W85 A;  1RPW A;  4BHC A;  3S2W A;  2DJN A;  3HTS B;  4ENN A;  1HXD A;  2QEX I;  3BTC A;  1Y8R B;  1BC7 C;  4D7N A;  5F0C A;  4PCQ A;  1TZL A;  5EGO A;  3R0J A;  4A3E J;  1MSF C;  2R7Q A;  2XKP A;  5J8F A;  5EGO B;  1ZG5 A;  1BOB A;  5LEJ A;  1ZTR A;  2OQR A;  3RTR A;  1HA8 A;  1ZAR A;  4RB0 A;  4NQW A;  5M5X J;  2E1M C;  3BOQ A;  1UG2 A;  3DKX A;  3FM3 A;  3WU2 C;  2VB6 A;  3F22 A;  3NWS A;  1FNN A;  4NQW B;  4L9T A;  4U87 A;  4E6K G;  3IH2 A;  1QVU A;  4CZZ A;  5HDK A;  4MLO A;  2LLK A;  1ORK A;  1ZG1 A;  1A5J A;  4KIS A;  1G8X A;  1I1S A;  3G1L A;  3BR3 A;  3DBR B;  3QQA A;  5K7H A;  2MYS A;  4NB5 A;  3MZH A;  3BQZ A;  1ULY A;  5HS9 A;  1W36 D;  1ETX A;  1B6A A;  1F4K A;  1WJE A;  3FWE A;  4LK0 F;  1PJR A;  2FOW A;  2VKV A;  2X0L A;  2EIK H;  3L7W A;  1VQN I;  3MMY B;  3CCU I;  4XSZ F;  5EZG A;  1PUF A;  1MZB A;  3LFK A;  4XR6 A;  3VOD A;  1PUF B;  1ZGJ A;  1FBQ A;  4XNF A;  1JKQ C;  2V79 A;  3HUG A;  4O6J A;  2AQF A;  4DQ2 A;  1W7P D;  5DEQ A;  1J5Y A;  1WFX A;  2FD5 A;  4J00 A;  1OYW A;  1H8A C;  1WGX A;  3HUG B;  2DMP A;  3FXM A;  2ZB9 A;  2A5Y B;  3EUH C;  3R4K A;  3FHN A;  1BI3 A;  4CYD A;  5GAH J;  4E7J A;  4M3E A;  1MND A;  2LD5 A;  3IP4 B;  4AU7 A;  4B43 A;  3AKZ A;  1Z3Y A;  5EEA A;  1IO2 A;  5D5X B;  2EV5 A;  3HRT A;  3AFH A;  5FKO A;  4RA2 A;  5HOO A;  3RKW A;  2IEK A;  4HYE A;  1R5H A;  2FJ1 A;  2OBP A;  3CZ6 A;  1IDY A;  2E60 A;  2KPM A;  4GXO A;  4MQV A;  4OIP F;  2MH2 A;  4CCJ A;  5EYR A;  1FIP A;  3IV5 A;  4IHV A;  2ECB A;  4ETS A;  3I55 I;  3FKI J;  3ZQG A;  2GWR A;  1OFC X;  3FXU A;  3HOU J;  3LQQ A;  3CCV I;  3DEU A;  1OLT A;  4AIK A;  2COM A;  3C1D A;  1H89 C;  3ZN0 A;  1W5T A;  2GA1 A;  2QSF X;  1C0W A;  3VYS B;  3L09 A;  1WI9 A;  2PFB A;  3K4B A;  4PUS A;  3K1P A;  3JRA A;  4E7I A;  5DM6 F;  1XS9 A;  1WJB A;  2QKM B;  1JT0 A;  2Z2S B;  3FXL A;  3LSG A;  1MH3 A;  3SFZ A;  1J09 A;  3SZG A;  3KP7 A;  5J3L A;  3A01 A;  4DYC A;  2DXI A;  3BLY A;  1J0R A;  2VXD A;  2KKO A;  1IJW C;  2F48 A;  3A01 B;  4XRF A;  1E2X A;  1UJ8 A;  1PUE E;  3JRB A;  1HKT A;  3ERM A;  1KU7 A;  2R7U A;  2VOO A;  1I39 A;  1G2H A;  1D1A A;  1IV6 A;  2OQG A;  1GUU A;  2K9M A;  5CQG A;  5ILU A;  2YS9 A;  5JLX A;  2M5W A;  3ABM H;  5BS6 A;  3G3Z A;  3IHU A;  3ZN1 A;  3IWZ A;  2JPB A;  3I56 I;  3OYC A;  5IPA A;  5KAI C;  2IS1 A;  4MGR A;  2PQ8 A;  2O6G E;  3N97 A;  2Y2Z A;  4FX4 A;  1S7O A;  1Y56 A;  4WWC A;  2PEX A;  2ZJP F;  2ELH A;  5ICG A;  4ZTJ A;  4B4C A;  1O57 A;  3OSF A;  2V1U A;  3KZZ A;  4BHP A;  2XAG A;  3JW4 A;  2M2E A;  5CKT A;  1R23 A;  1W0U A;  2DN0 A;  1P4X A;  4Q4Z F;  2EA4 A;  2NOJ B;  2HPM A;  4XLH A;  1O4X A;  3G73 A;  4OWR B;  5CVV A;  3JRC A;  2HQ5 A;  2L7K A;  3ZQQ A;  3CP2 A;  1IXS B;  3LSP A;  1MSE C;  3RYP A;  2F5V A;  2M9H A;  3A4C A;  2HOA A;  4ZTF A;  2NVY J;  3IWF A;  3H9J A;  4AIH A;  3ML6 A;  3FMQ A;  2XF5 A;  4R79 A;  4BDZ A;  5FRO A;  5F04 A;  3DLA A;  1KQ0 A;  2EFO A;  3HSR A;  3MKL A;  3GFM A;  1SC7 A;  2DPU A;  2GBY A;  4KDP A;  2F6C A;  5GAE J;  2ZO4 A;  1RUN A;  1V5G A;  4RAG A;  3J7A Y;  2FU4 A;  1FJL A;  2DO7 A;  2HKX A;  4XSX F;  1YS7 A;  4AWX B;  2DQR A;  3KZI C;  1X3W B;  2ID6 A;  3UNG C;  3DF8 A;  1T56 A;  3OYE A;  5KCM A;  1U2W A;  1JI8 A;  1BW5 A;  3TOB A;  2EBI A;  1GV5 A;  4Q47 A;  2PLY A;  2KT0 A;  1X4P A;  1P2F A;  2DFI A;  3H9G A;  4PGG A;  4HQE A;  2EV6 A;  1T2K A;  1S72 I;  5K5O A;  1RUO A;  3CCR I;  4D5F A;  3PQK A;  1ZRD A;  1UB9 A;  1LDK B;  3O3K A;  4J19 A;  2V9K A;  1Y1W J;  2HEO A;  2IAI A;  3FK7 A;  1EA3 A;  2XAQ A;  1QNT A;  1TNT A;  3KX2 A;  3I53 A;  4A0Z A;  3WTS C;  2GAU A;  1VND A;  1RR7 A;  3HZJ A;  1T0F C;  4CHU A;  1S6L A;  4C3J J;  5CVJ A;  2HTJ A;  5F0F A;  3ASN H;  4F7Z A;  4P96 A;  2FEZ A;  2XRO A;  3RPQ A;  4KYW A;  5IYB J;  4CCN A;  1A36 A;  4XLA A;  3ESW B;  1YS6 A;  3ABU A;  2TCT A;  2HTS A;  1Z77 A;  1X2M A;  1TT0 A;  3HOY J;  1DU6 A;  1SD5 A;  5F0H A;  2DFH A;  4RGU A;  3WU0 A;  3HC7 A;  2VL8 A;  1XSD A;  3W6K B;  2BHY A;  3ASO H;  4ZH4 F;  1JJ8 C;  1IN5 A;  3GFJ A;  4B48 A;  3KFW X;  4U88 A;  3WG9 A;  2IW5 A;  3MQ0 A;  4EJW A;  4V2F A;  1SAU A;  1YW8 A;  1QBJ A;  1ZG3 A;  2R7S A;  1ZEL A;  1HST A;  1V54 H;  3DPU A;  3FIW A;  4B47 A;  1SVL A;  2R0Q C;  2RN7 A;  2H27 A;  1WJF A;  3L2R A;  3K2Z A;  2HOE A;  1ERD A;  5CLS A;  1QZE A;  2EZI A;  2X1E A;  2DW4 A;  2XAU A;  1T38 A;  3X2Q H;  4I0A A;  2KMU A;  3HOX J;  1N75 A;  2HVQ A;  1RKW A;  2FRH A;  5FD6 A;  1P4W A;  2HWV A;  2R3S A;  5E1X A;  1O3S A;  1P7I A;  5D4R A;  3TED A;  3IH3 A;  3EET A;  3DEW A;  1LVA A;  1FMV A;  1Z6T A;  3M1C A;  4CCM A;  2Z33 A;  3GTL J;  3S16 J;  1I6H J;  3ECH A;  2DMT A;  3NAU A;  2CV2 A;  2LG4 A;  3PNY A;  1DGR M;  4JQF A;  3H35 A;  3E6M A;  2DT7 B;  2DU9 A;  4BXU A;  3DKY A;  3OYH A;  2YX7 A;  2OV7 A;  3A0H C;  3GEZ A;  3A2K A;  5E1W A;  3DU6 A;  2RDP A;  2VQL A;  1S7E A;  2PI0 A;  4MTD A;  2ETH A;  2F2E A;  3R6S A;  4XLP F;  2FSW A;  5L3F A;  2XB5 A;  2X4H A;  5E3L A;  5FRM A;  1W5C C;  2NVT J;  3LFU A;  1SFX A;  3F8N A;  2QKL B;  2BXY A;  3GW2 A;  5BNG A;  2K9L A;  2YX4 A;  2R4G A;  1MBF A;  2Q1Z B;  3OL4 A;  3CQZ J;  4YIF A;  1R36 A;  2WAE A;  4CSW A;  2BYV E;  3BJA A;  5B1B H;  1QHH D;  5HOD A;  1YJ9 I;  2ECC A;  1J2X A;  2QSG X;  1BW6 A;  3F3X A;  3IRR A;  2VOD A;  2R7Z J;  3P9K A;  1D1B A;  4BXF A;  3Q5F A;  1DU0 A;  3NEU A;  2OZU A;  1W7P A;  1XSX A;  2HYJ A;  1Y0U A;  4XN0 A;  3GYH X;  1W7P B;  2IGO A;  5ICF A;  4RB1 A;  2LY2 A;  4C2T A;  3TO7 A;  3FXO A;  3OYN A;  4MEY F;  3S15 J;  4G6Q A;  3TO6 A;  1SVO A;  4BXX J;  1D8J A;  3B73 A;  2LKS A;  1YRN B;  2WAF A;  2IBD A;  5TGT A;  4E7H A;  4BJ5 C;  3I5U A;  2X6W A;  1HDP A;  2A07 F;  5IY5 H;  2M4K A;  1VF9 A;  2LY1 A;  2QM3 A;  3S8P A;  1F1Z A;  3DWL E;  2Q0O A;  2QF7 A;  5L3G A;  4RBO A;  3V8K A;  4II3 A;  4DBR A;  5LD2 C;  1V5E A;  3E6B A;  1R71 A;  3D0S A;  1SFK A;  1X3Z B;  4NUB A;  2FNP A;  5B5E C;  4BNC A;  4LLN A;  2ZSH B;  3DXJ F;  3NAR A;  1I27 A;  2GXB A;  2NAZ A;  1FP1 D;  2JRT A;  4C3H J;  5KNL A;  1RC9 A;  4X1E A;  5FLX Z;  2BBY A;  2E71 A;  3BR0 A;  3DFG A;  3IKV A;  3WGH A;  3LNQ A;  4MTE A;  1MJB A;  2LMD A;  1NTC A;  4N0B A;  2EFP A;  1FTZ A;  3S1N J;  3H92 A;  2MAB A;  1U8R A;  2LK2 A;  3BR6 A;  4BS9 A;  1IRF A;  2HDW A;  1HQC A;  2Z3Y A;  3V4G A;  4A3D J;  3K4N A;  2DK8 A;  2CS3 A;  1BIB A;  4J01 A;  3L2W A;  1VI0 A;  3CUQ A;  3ZRG A;  2JWT A;  1T6S A;  2R5Y A;  1WJD A;  2JSC A;  3VFZ A;  2VC1 A;  2XHK A;  3CUQ B;  1ZLK A;  2DDA A;  2R5Y B;  3CC4 I;  3DBH B;  5L3C A;  3MZY A;  3PM1 A;  5CYV A;  2R93 J;  5F27 A;  2BHZ A;  1QZZ A;  5IYD J;  4IVN A;  2MG4 A;  3B6A A;  3M8E A;  5FKN A;  4E7K A;  4Q5S F;  1HDD C;  2NS0 A;  3WE3 A;  1KYW A;  1E17 A;  4I76 A;  2YPR A;  2XAH A;  4G8X A;  2Y0S N;  3OYG A;  1FSH A;  5FKL A;  4XBF A;  5ED4 A;  2VT3 A;  4FQG A;  2XIG A;  3RZO J;  4GFB A;  2VN2 A;  1U9N A;  2E1N A;  2LFB A;  2AXL A;  3S3O A;  3CJT B;  3DLL F;  3OR2 C;  2JUG A;  1SD7 A;  3FDY A;  4MHG A;  3E1S A;  4Y3O A;  2Y48 A;  4EV0 A;  1MMA A;  2ELJ A;  2E1O A;  2UUZ A;  2P7C B;  1IRZ A;  1UHM A;  2L9V A;  4EM2 A;  3I3L A;  4BQN A;  4DGW B;  3L2Q A;  3RYR A;  2BZT A;  6PAX A;  1HOM A;  1F5T A;  1EKE A;  2DDB A;  3TP3 A;  1R5I D;  2LY9 A;  3TGN A;  3D5R C;  2MC3 A;  3HDD A;  1O7F A;  3HOZ J;  1A35 A;  1BBY A;  3VYU B;  2GA2 A;  2PMZ N;  2O8X A;  5ILV A;  1U8B A;  2DT5 A;  4HNU A;  5K5R A;  3D5L A;  2MSY A;  1R49 A;  2DA3 A;  2XRL A;  3C2H A;  3P5J A;  3WTT C;  4AC0 A;  3OSG A;  3FBN B;  2K02 A;  2EZL A;  2MGQ A;  3HB9 A;  4UVB A;  2PMU A;  3RKY A;  3HOS A;  3EPZ A;  4M71 A;  2YU9 J;  2DOF A;  5GAD J;  3OWT A;  1UST A;  3IH4 A;  1DQU A;  2DA6 A;  3OIP A;  2NS7 A;  4KNY A;  2F5C A;  3FM5 A;  2IP2 A;  2BGC A;  1E3O C;  2QQ8 A;  4F52 A;  1R9T J;  4LK1 F;  1BA5 A;  4ESJ A;  4GYI A;  1LE8 A;  3BG9 A;  4GRI A;  2ZME C;  4R1H A;  2YR2 A;  1LE8 B;  3OV8 A;  4MIM A;  4BDY A;  4M9Z A;  2L0K A;  4TV7 A;  3SZT A;  3VB2 A;  4XQF A;  1K6O A;  4A3J J;  2AXT C;  3GXO A;  5GTH C;  1MBH A;  4KJZ A;  2R5Z A;  4IF4 A;  1XCV A;  3G6E I;  1KZH A;  2CV0 A;  4DYR A;  5JVG F;  2CUZ A;  1IDZ A;  1BN5 A;  2R5Z B;  5EEG A;  1GVD A;  3DPT A;  3PIP F;  4AUX A;  3BRO A;  2L7F P;  2A6T A;  2VJJ A;  1OCC H;  5J6X A;  1X58 A;  3MZ8 A;  1D5V A;  3JRG A;  1HBX G;  3KYC B;  4DIQ A;  5DM7 F;  2HGC A;  1EF4 A;  5EDN A;  2GXA A;  1XGN A;  2P8T A;  1VFC A;  5F08 A;  2XVC A;  1S5L C;  3S32 A;  4PFP A;  1OR7 C;  4BAY A;  3ZQF A;  4A5N A;  4YEJ A;  2MC4 A;  2VC0 A;  4KT6 A;  2CW8 A;  2DOE A;  1JJ6 C;  1ZRC A;  3MVP A;  4LIT A;  2LRE A;  4RGS A;  3M1E A;  1ETO A;  3ABT A;  2HZT A;  2OA4 A;  2GOM A;  3FKJ A;  3DCF A;  1L0O C;  4C9Y A;  2NVX J;  3Q9V A;  3BPX A;  4DBQ A;  3OYA A;  2K3P A;  1Z7U A;  2L5Q A;  4RGR A;  3L2C A;  3WTU C;  3I59 A;  1XTA A;  1D1C A;  2BEO A;  3M7G A;  4IO9 F;  3ZPL A;  3FIS A;  3I59 B;  2EH3 A;  4F55 A;  4HBL A;  2L01 A;  4ZDO A;  3CP8 A;  2CUE A;  5HNF A;  2FMY A;  2L9N A;  3ABL H;  4C2M J;  4EAT A;  1ON1 A;  2FA5 A;  4RB2 C;  1OCZ H;  4HZF A;  1O7L A;  1PYV A;  4PJN A;  1FX7 A;  3TDZ C;  1SEU A;  3WHC A;  2O03 A;  2MA3 A;  5E20 A;  1DDN A;  3OYK A;  4Y17 A;  5LFA A;  2GLO A;  2GXG A;  4ZZD A;  2E1M B;  3RI4 A;  2VBY A;  4Y33 A;  4GYG A;  3F8B A;  2JSP A;  5HLH A;  2LDU A;  5AIP A;  4C30 A;  2BY3 A;  2CQX A;  1X2N A;  1BR2 A;  1S9H A;  4A6E A;  3G71 I;  1N77 A;  4KIT B;  2H1K A;  2CRG A;  5IP9 J;  4M9S A;  4BQO A;  2R7D A;  3E6C C;  1F43 A;  3PO3 J;  3HL2 A;  1IRG A;  3KET A;  1JKR C;  1U5T C;  1UCR A;  2K40 A;  3J81 Z;  1FOY A;  2JZY A;  1BJZ A;  3S1M J;  1I3A A;  3KZY A;  2ME6 A;  4HEA 2;  4CDG A;  2QQA A;  4L5E A;  3GTM J;  2J5O A;  2XF7 A;  3WTY C;  4M72 A;  1ZAO A;  3PUF A;  1G3W A;  4ZYD A;  1WVR A;  4G6T B;  3ZOB A;  4M9X A;  2X85 A;  2M1B A; 
#chains in the Genus database with same CATH homology
 2HQ5 A;  3LSP A;  5J1U A;  1MSE C;  1LFU P;  1MBK A;  2AO9 A;  2M9H A;  2O7O A;  3BR5 A;  2D5V A;  2HOA A;  3BG3 A;  2NVY J;  3I4N J;  1IGN A;  1AHD P;  1ETW A;  4QIW N;  5F04 A;  2XB0 X;  2VKE A;  5IOY A;  2XSD C;  9ANT A;  3MKL A;  3ZQC A;  3Q3S A;  2GBY A;  1F36 A;  3C2B A;  4DW6 A;  3SFI A;  1FJL A;  1JUM A;  3ZQL A;  3D1N I;  2DMN A;  2ID6 A;  3GTJ J;  2E2I J;  3BTL A;  3HEF A;  1T56 A;  3S2H J;  2L9R A;  2NOG A;  4BKX A;  2E2J J;  1BW5 A;  1ITY A;  2EBI A;  2JMW A;  3HOV J;  1GV5 A;  2N8G A;  2KT0 A;  1MNM C;  4A3B J;  5M3M J;  3VPR A;  3O8G A;  5EG0 A;  1OCP A;  1B8I A;  4XIC A;  3A02 A;  4D5F A;  3JRF A;  4J19 A;  5EG0 B;  1Y1W J;  2VUM J;  2IAI A;  3BT9 A;  4RDU A;  3FK7 A;  1B8I B;  3CDL A;  1GDT A;  1FIA A;  1VND A;  1RR7 A;  1NK2 P;  1JUS A;  1ZGW A;  4C3J J;  3OOU A;  5DS9 A;  5F0F A;  2DA7 A;  1K61 A;  5IYB J;  2TRT A;  1POG A;  2TCT A;  3RKQ A;  1RES A;  1Z77 A;  1X2M A;  2HOS A;  1U78 A;  3HOY J;  1DU6 A;  1JKP C;  3BTI A;  5F0H A;  2OPT A;  4XRS G;  3CCY A;  5JLW A;  4Y7N J;  3L1P A;  1ETQ A;  2ME0 A;  5IP6 A;  1JJ8 C;  4D7M A;  1ZK8 A;  4IHW A;  3RZD J;  2K9N A;  1XG1 A;  2VPR A;  4V2F A;  5EZH A;  3ZQI A;  3LOC A;  2LVS A;  5E3M A;  3S2D J;  1IG7 A;  1JUP A;  3FIW A;  3BTJ A;  2HOT A;  2M8G X;  2R0Q C;  1BL0 A;  3GTO J;  1FEX A;  1WCM J;  3QPS A;  2AHQ A;  2DA1 A;  3TW6 A;  4BY1 J;  1SFO J;  2EZI A;  3H0G J;  4JX4 A;  4M3D A;  3HGY A;  4FCY A;  2Y30 A;  3ZQH A;  3HOX J;  2E2H J;  1RKW A;  2FQ4 A;  4LOC A;  1UHS A;  5FKM A;  1H88 C;  3HM5 A;  5J1Y A;  2ID3 A;  1P7I A;  2HI3 A;  2L7Z A;  3TED A;  3IH3 A;  2HXI A;  3DEW A;  5IOZ A;  3GTL J;  3S16 J;  1I6H J;  2DMT A;  3NAU A;  4A93 J;  4A3G J;  1TWF J;  1D5Y A;  3GBG A;  3GTP J;  1W0T A;  4A3M J;  2Y9Y A;  2E19 A;  4M3F A;  2K9S A;  1S7E A;  1ZR4 A;  5F1J A;  5M5Y J;  5J1R A;  4B1R A;  2XB5 A;  5E3L A;  2G0E A;  4S0H B;  2WB1 N;  2NVT J;  1MH4 A;  4A3K J;  3QPL A;  1MBE A;  5BNG A;  2RAE A;  2Y31 A;  1WPK A;  5E3O A;  1MBF A;  2I10 A;  3CQZ J;  4DZJ A;  1AU7 A;  1JTX A;  2P81 A;  5HOD A;  4D5C A;  2ECC A;  4UUT A;  1BW6 A;  4QSH A;  2R7Z J;  3JRE A;  2JA5 J;  1DU0 A;  3A03 A;  4FTH A;  2LP0 A;  1K83 J;  2HYJ A;  1MBJ A;  2EQR A;  4IEJ A;  4A3L J;  4XRS A;  2M0C A;  3LSJ A;  4FE7 A;  4M3B A;  2MW8 A;  3RQI A;  5FJ8 J;  1HF0 A;  2CUF A;  3G1O A;  1IC8 A;  3S15 J;  3JRH A;  1HLV A;  1SAN A;  2X6O A;  4V2G A;  3JR9 A;  1ETY A;  5IP7 J;  4BXX J;  1I50 J;  1YRN B;  1Z0X A;  2IBD A;  3HGG A;  2O9L A;  4XRM A;  4A69 C;  4M3G A;  4M6V A;  5IYC J;  1HDP A;  1JT6 A;  1VF9 A;  4MFD A;  3I4M J;  3SJM A;  1APL C;  3HKZ N;  4MO7 A;  2GM4 A;  2DA4 A;  3Q0V A;  2QF7 A;  3HBL A;  3F0C A;  1WH5 A;  1Q1V A;  4RBO A;  2H8R A;  5K7F A;  5C3E J;  3M3Y J;  2CJJ A;  4QTR A;  3NAR A;  2DA5 A;  4BBR J;  5GPC A;  4B3A A;  3PO2 J;  1FTT A;  3BR2 A;  3FK6 A;  3G1M A;  1U9O A;  3JRI A;  5C44 J;  3JRD A;  2Y9Z A;  4ABZ A;  4C3H J;  4UUS A;  2XPW A;  2NS8 A;  4JYK A;  2XPV A;  4X1E A;  3S14 J;  3BR0 A;  3BQY A;  3LNQ A;  4UUS B;  1NTC A;  2LKX A;  1JKO C;  1FTZ A;  3S1N J;  1JTY A;  1WI3 A;  4FIS A;  4BY7 J;  2LK2 A;  3BR6 A;  4A3D J;  2DA2 A;  2JK3 A;  1VI0 A;  3W6V A;  2JWT A;  2R5Y A;  1ZQ3 P;  5C4J J;  1TWA J;  1ETK A;  1TWH J;  3BR1 A;  3MN2 A;  2R5Y B;  2COB A;  3E7L A;  3TP0 A;  5GPA A;  3PM1 A;  4HNV A;  4CYC B;  2R93 J;  5F27 A;  1P7J A;  2DTZ A;  5IYD J;  4JP0 A;  3TW7 A;  2MG4 A;  1OCT C;  3B6A A;  5FKN A;  2LR8 A;  2W48 A;  2DMQ A;  2WV1 A;  1RKT A;  1HDD C;  1NK3 P;  4NDL A;  4I76 A;  2XGD A;  3BG5 A;  1B72 A;  2Y0S N;  5FKL A;  4DZP A;  3RZO J;  4BBS J;  4GFB A;  1B72 B;  1U9N A;  3HOW J;  3WHB A;  2LFB A;  4C3I J;  1ZR2 A;  2O8K A;  5C4X J;  2WAQ N;  4G12 A;  1RPW A;  2YUS A;  2DJN A;  1XC5 A;  2E1O A;  3BTC A;  2ELK A;  4EEF G;  2XGC A;  1IRZ A;  4D7N A;  1UMQ A;  5F0C A;  5EGO A;  4A3E J;  3K2A A;  1MSF C;  1WH7 A;  5FLV A;  2CU7 A;  3SDG A;  5EGO B;  1ZTR A;  2NVQ J;  1HOM A;  4Y52 J;  3CMY A;  4W1U A;  4I6Z A;  4FE4 A;  3TP3 A;  4XK4 A;  2LY9 A;  5M5X J;  1TC3 C;  1UG2 A;  2LTP A;  3HDD A;  3HOZ J;  3IH2 A;  1QVU A;  4MFE A;  3O8H A;  2VI6 A;  2PMZ N;  4MLO A;  4X6A J;  2LLK A;  4XID A;  1U8B A;  1ORK A;  3S17 J;  1A5J A;  2MSY A;  2DA3 A;  2XRL A;  3G1L A;  4AC0 A;  3BR3 A;  3QQA A;  5K7H A;  3OSG A;  2JA6 J;  2MGQ A;  2EZL A;  3HB9 A;  2YU9 J;  4A3I J;  3BQZ A;  1ETX A;  5FLM J;  3IH4 A;  2DA6 A;  2VKV A;  2NS7 A;  5FKK A;  3S1Q J;  1E3O C;  5EZG A;  1PUF A;  1ETV A;  1R9T J;  1YRN A;  3LSR A;  5E3N A;  2DMU A;  1BA5 A;  1TWG J;  3GTG J;  1LE8 A;  3BG9 A;  1PUF B;  1JKQ C;  1GT0 C;  1LE8 B;  2FD5 A;  4MIM A;  1H8A C;  1WGX A;  2L0K A;  2DMP A;  2L7M P;  2ZB9 A;  3OIO A;  4A3J J;  1MBH A;  2R5Z A;  2XGE A;  4M3E A;  2LD5 A;  4DYR A;  5M5W J;  1IDZ A;  2R5Z B;  1GVD A;  1Y1V J;  4AUX A;  3GTK J;  5EEA A;  2B63 J;  1RET A;  3GTQ J;  5DTD A;  2L7F P;  5FKO A;  1X58 A;  2IEK A;  3JRG A;  2FJ1 A;  1EF4 A;  5EDN A;  1IDY A;  3Q0U A;  1VFC A;  5F08 A;  5EYR A;  1FIP A;  3ZQF A;  1I3Q J;  2K9Q A;  3IV5 A;  2ECB A;  4IHV A;  2HXO A;  3M4O J;  2R92 J;  5K7Z A;  1JJ6 C;  3FKI J;  2FX0 A;  3ZQG A;  2XPU A;  2M34 A;  1OFC X;  3HOU J;  3MVP A;  1MBG A;  4A3F J;  4W97 A;  1ETO A;  1H89 C;  4A3C J;  2JA8 J;  1T33 A;  2OF7 A;  3DCF A;  2NVX J;  1GV2 A;  3JRA A;  1XS9 A;  1JT0 A;  3LSG A;  1MH3 A;  4CYC A;  1CQT A;  2JN6 A;  5J3L A;  3A01 A;  3FIS A;  1HCR A;  4DYC A;  2EH3 A;  2QCO A;  1IJW C;  2CUE A;  2EZK A;  3A01 B;  2X48 A;  3JRB A;  1IUF A;  4C2M J;  1G2H A;  1IV6 A;  2CQQ A;  2JA7 J;  1GUU A;  3WHC A;  4DYQ A;  2HDD A;  2KDZ A;  2YS9 A;  3B6C A;  5JLX A;  4AYB N;  5EF6 A;  2GLO A;  1ENH A;  4JX6 A;  2EZH A;  2X9D A;  4JX5 A;  1OJL A;  5M3F J;  3UKG A;  2CQX A;  1X2N A;  5IPA A;  2H1K A;  2CRG A;  5IP9 J;  1TWC J;  1LFB A;  2Y2Z A;  3Q0W A;  3S1R J;  2JJ7 A;  3H3V K;  5GP9 A;  1F43 A;  3PO3 J;  1QRY A;  1AKH A;  1JKR C;  4IHX A;  2K40 A;  1QVT A;  1A6I A;  1ZKG A;  1JGG A;  1BJZ A;  3K7A J;  3S1M J;  4B4C A;  3OSF A;  1AKH B;  1W0U A;  2M2E A;  2ME6 A;  1QPI A;  2DN0 A;  4L5E A;  3GTM J;  4IHY A;  1O4X A;  3ZOB A;  3JRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...