2KPMA

Solution nmr structure of uncharacterized protein from gene locus ne0665 of nitrosomonas europaea. northeast structural genomics target ner103a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kpmA01
2LY1A 3S93A 2KZVA 2KPMA 2LH9A 3RCOA 2LY2A
chains in the Genus database with same CATH superfamily
2WBMA 1G4DA 2ACJA 3P9KA 1E2XA 3AAFA 1G2HA 3PFIA 3FX3A 5DD8A 3OYLA 4A3CJ 1P7IA 1WH5A 5CVRA 3FKJA 4WF2A 1X1BA 2M9HA 4C9YA 2V1XA 1Y8RB 1O3RA 5DM7F 2H6CA 3CCJI 2K4JA 2Q0OA 2HU9A 1U2WA 2COBA 2IVMA 4NQWA 1JKRC 2JA7J 2KMUA 4M3BA 4HX8A 1VQLI 1ENHA 3TKYA 3DXJF 4QSHA 3NWTA 1QQIA 5JVGF 2JRMA 1BBYA 5E3MA 4ZZLA 1BW5A 3CQZJ 1JUPA 2DJNA 1D3YA 4UUSA 2IBDA 1XMXA 3D0SA 3DP7A 3HSEA 3DKWA 3BOQA 3MCZA 5JLXA 5DEQA 4II3A 1P4AA 2ZMEC 4YFNF 3QPLA 4OMZA 2W4SA 1KU9A 1FOYA 2OPTA 4G6QA 2ECCA 3OYAA 4A0YA 2R93J 2M4KA 1P92A 1Z7LA 3H9JA 1QZEA 5ICCA 2V1UA 4YRVA 3CUQC 4BE1A 2MC4A 4OIRF 1Y6IA 5H6RA 2E34A 3PUFA 2XRNA 1LFUP 1ETWA 3FBNB 4OIPF 1JUSA 4LG0A 4RB3C 1RR7A 1JT0A 2JA8J 2A69F 4HNTA 2DTZA 5LRRA 5IYDJ 4M9XA 1FYKA 4N4NB 1I5ZA 1XMAA 3A1YA 3E5QA 1RESA 3SZPA 3NAUA 4E7HA 1Y39A 1SANA 4LJZF 2HR3A 4II2A 4A12A 1YIJI 5GAHJ 3OYBA 3RKYA 2X6OA 2Y9ZA 4DOZA 4GDFA 3CTAA 1JKQC 1FY7A 4HEA2 5CYVA 4OU0A 3A01B 3ERED 4FQGA 1F1ZA 1WWXA 2FQ4A 2FOKA 3ZQFA 4BDYA 3MKYB 1S5LC 2DODA 2EWNA 3OYDA 9ANTA 4HF1A 3WTSC 3WG7H 4JX5A 2CV1A 2E5NA 1ONVA 2VT2A 1OPCA 2QBYA 1DU6A 4KJZA 3W2AA 4KDPA 3I0TA 1TTYA 3OR1C 4OAZA 2BHZA 2V6CA 3OYIA 3BG6A 2XPVA 1SMYF 1V54H 1R1VA 3GTKJ 3A01A 3PQKA 1BR2A 2CW8A 2L9RA 3JRAA 1CGPA 5F0FA 3MKLA 2FA5A 1X1DA 4E7ZA 3IH4A 2OQRA 3ABKH 4I98B 3U21A 4XQFA 5J4VA 3NARA 3TO9A 1XD7A 1P4XA 3U2RA 2FXAA 3IUOA 5L3EA 4LITA 5IT9Z 3GZ6A 5D8LB 4BJ6C 4Q48A 2HVRA 2GBYA 4IF4A 5DV5A 1TWFJ 4OOIA 2V1DA 3GO5A 4A3MJ 1FT9A 2BE5F 4KYWA 1Z91A 1Z0XA 4RGRA 5BPIA 1ZR2A 4PJMA 5J8CA 2ZO4A 1HA8A 4XK4A 3P9CA 4CA0A 3SDBA 3IRQA 2XGXA 4ENJA 2VN2A 4KIGA 1R49A 4ZDPA 5C3EJ 3GTOJ 1SVOA 2A6TA 2Q8KA 1A35A 1Z3YA 4CCLA 5M3MJ 2OD5A 3EPZA 1UHWA 4Y13A 3KLNA 1OCZH 3HEFA 3WHCA 2VB6A 1VQ9I 1L0OC 1W36C 3FM3A 5KVRA 2XPUA 1VQ4I 1GHCA 4RGXA 1GDTA 1UFMA 2MABA 2EK5A 2GXGA 4HW0A 4OWRB 4BAYA 3B73A 3ZMSA 4A3KJ 2OC6A 3GFIA 1IRXA 2FF4A 3V8KA 2XAUA 1KA8A 3LSRA 2OUMA 3CESA 3GUDA 4MLOA 2M5WA 1SAXA 2IAIA 3S3NA 1LQ1A 3JAMK 1MIJA 2FMLA 3F8CA 3QODA 4PJNA 4XLEA 4UUSB 5H6QA 3RYPA 4PJLA 5FKNA 3BY6A 1HF0A 1AU7A 4L18B 2JPBA 1V5FA 4XICA 2A61A 3L9FA 3R60A 1HKQA 2PMHA 4EM1A 1LVAA 4RGSA 4H0EA 4BKXA 3HTSB 2HVQA 4ZC3A 1ZAOA 1SD6A 1IN7A 3ZN1A 2Y30A 3AFHA 1LDDA 4AD9A 1CF7A 2PN6A 1M1EB 3TDZC 2P0WA 5M3FJ 2LBFB 1W5TA 2K40A 4HV5A 2CUJA 4CXFA 5JR3A 3C3WA 1TT5B 2VQCA 2W24A 2XB0X 3KP3A 3OL3A 2BXZA 4XR6A 1ZRCA 2KDOA 5HODA 3AG3H 1IRGA 1ORKA 5DTDA 1ZGJA 2RVCA 2PJPA 4J00A 4C3JJ 3T5XA 3BR2A 5CQGA 3HKZA 3NWSA 3I5UA 3OYMA 3BJ6A 4PK4A 1JI8A 2RC4A 2DMPA 1OLTA 2LKPA 2L0KA 3I59A 3PSFA 2Y31A 4U88A 3LMMA 2WA0A 3IHUA 5B3SH 5B66C 1R6RA 2OQGA 4LGWA 1ETQA 2LD5A 2LDUA 4CCMA 2IT0A 5F04A 3S93A 3SQNA 4A3JJ 2WAQA 1FMVA 2X1DA 3QAHA 1LPQA 1WJDA 5LHIA 3BDDA 4KISA 4DNCA 2Y0MA 4IHTA 1YITI 1V5GA 2E2JJ 2LR8A 5LHGA 1O3QA 1DP7P 3DEUA 4XRSG 3ZXSA 4BY1J 3AL0C 2LOOA 3G3ZA 3PNYA 2DU9A 1I1SA 5D5WB 5K7ZA 5C4XJ 1QVTA 2E19A 2OZUA 3GTMJ 2CG4A 3F8FA 1LE8B 2EFQA 3K69A 2RGVA 3CCEI 1WFXA 2XAJA 3BR1A 3W2VA 5L3FA 4L5JA 3GWZA 2BY0A 2KISA 1EH7A 2XF5A 3HG9A 3RQ4A 2QSGX 2H1KA 3A02A 2KZVA 2AQEA 2RV8A 2CQ7A 4BXXJ 1QU3A 1S72I 2F5FA 3GVAA 3GBGA 3Q0VA 3J81Z 2HKXA 3OV8A 1TW3A 3FXOA 4ASNA 1BN5A 1Y1WJ 4UUVA 1EH8A 3MN2A 2XIGA 5D8KB 3MFKA 3HSRA 4BXFA 2CQKA 2R5YB 2EFOA 1IXSB 4BYYA 1I1GA 4ETSA 3F6OA 2ESHA 1N78A 2X85A 4ZDOA 1J5YA 2HQNA 3OS2A 2XRLA 3CJNA 3ZP5A 1P6RA 2BEOA 3A0HC 3OYNA 4HX7A 2BVLA 2QZ8A 5E17F 4LK1F 1K78B 5ILVA 3HIFA 4CHUA 2VOPA 2IGMA 3V7RA 2R5YA 2JWTA 4IO9F 2L9SA 4I0AA 4O5VA 1AWCA 2P6SA 1LNWA 1MJAA 2GA1A 3ZMVA 3L2UA 2R7SA 3ZMTA 5LHHA 3CCVI 3E6DA 1OFCX 2R7UA 2A05A 4HRIA 5E3LA 1FIPA 3VSKA 5DCFA 5J1YA 1VQ7I 3S2HJ 3IRRA 2L3DA 4A5MA 2OF7A 1FTTA 4A6EA 1F36A 4CSWA 2LLKA 2K9QA 4CCNA 5LBQA 2NNYA 3GZ5A 4RAYA 1BR1A 4XBFA 4EGYA 5HOOA 1YW8A 2YR2A 1T2KA 1FBQA 3TDUC 3CUOA 2E2IJ 5F08A 1I6HJ 5CQEA 4Q5SF 2EBIA 5FGMA 3HUGB 5HS9A 3S14J 3C2GA 3X2QH 3H92A 4YELA 3DLLF 3OIPA 2VJIA 3CJRB 2D45A 2DA1A 3OWTA 1TWHJ 2COMA 3ASOH 5EJCA 4BJTA 2HXOA 3U1DA 4DIQA 1ERDA 3RKXA 3JRBA 1OYWA 1JJ8C 2Q1ZB 5CPRB 2JA2A 3TP3A 3LA2A 2FE3A 1MW7A 1KGSA 2ME6A 4C2UA 1WQ2A 2A3SA 3KE2A 3E6CC 3OR2C 1U9NA 1YIOA 2X6XA 1TLHB 3FISA 1NHAA 5FLVA 3HB9A 2FU4A 3FXMA 3OIOA 2ZXWH 3F8BA 1T95A 2XF7A 1AHDP 2KPMA 3LSTA 2Y48A 1TC3C 2IS6A 4HOBA 1FEXA 5M5YJ 1O3SA 4YG2F 2WY7Q 1FOKA 3K4CA 2W1OA 4L9JA 2IS2A 2B0LA 2EZLA 3CO7C 1A5JA 4KN4X 3VYUB 4OIOF 3K4LA 1C0WA 1VI0A 2UWMA 1IG7A 5H2FC 3TGNA 2GXAA 1LDJA 2CO5A 1S7AA 3KP4A 2MLGA 1KONA 1S6LA 2DA6A 2LH9A 3Q0UA 4RLQA 1F4KA 3K70D 1B59A 2VKDA 4BU2A 1MBEA 1TQPA 5BPDA 1R36A 1PUEE 3FMQA 2NRAC 3C7JA 2K9NA 4MEYF 1XMKA 3S1RJ 1GT0C 3CLOA 4FE7A 2LKXA 3S16J 1IV8A 2QA4I 2JJ7A 2Y69H 1T0FC 2ZFWA 4LLNA 3LL7A 2G0EA 2UXXA 5D4SA 2DYRH 3ECHA 2ESNA 1MSEC 4DQ2A 4WXDA 5H20A 2UV1A 1HSTA 1B8IA 2H94A 1ETYA 2LYCA 1ZELA 5GTIC 1TNSA 2AXTC 3O3KA 3CF2A 2FOWA 2CRGA 1ZG3A 3J81K 2CSOA 5K7FA 2M8GX 3FDYA 2HDDA 5E8IA 3BP8A 1MBGA 5GAGJ 1X4PA 2VQGA 3C2HA 1YRNA 3H35A 2K4BA 3PQJA 5K7HA 1ULYA 2Z2SB 2DI3A 3NRVA 2CV2A 1B4AA 4F93B 1WI3A 2K3FA 3F8MA 2HZTA 2W25A 5DDGA 5KK1A 4DW6A 1XDSA 3CC4I 2DOAA 3SXYA 2VT3A 4P55A 3WTVC 3CD6I 1W4MA 4N0BA 4DZJA 3PM1A 1H9GA 1W7PB 3VYTB 3AL0B 3F0CA 1VQ8I 1D8KA 4HBLA 1FP2A 2E7WA 4X1EA 1MH3A 1K83J 4LIUA 2F5EA 1BI1A 5JLWA 1WKMA 2O6GE 2M0CA 2V79A 1I3QJ 5ED4A 2QKLB 1MD0A 3LQRA 2VOOA 2ID3A 2XASA 2YU9J 2O3FA 5IOZA 2BY3A 3OYHA 3G6EI 3J7ZI 1JHFA 3VB2A 3GTQJ 4G7HF 4AM3A 2IS4A 4M3GA 1IZ1A 2Y9YA 3BZ6A 4RBOA 1JE8A 1FSHA 2G9WA 4GXOA 2BOLA 4EVIA 4Z6YA 1TT0A 3QOEA 3WODF 3DTIA 1JKPC 4BH9A 2IW5A 2OJED 4BHBA 5EEHA 3HOUJ 3PUBA 2HTJA 2HPMA 3DPTA 4I99C 2L2OA 4PCQA 4XRFA 1UHSA 1BI2A 2AO9A 2MA3A 4D9JA 1N75A 4F7ZA 4OIQF 1SD7A 3PNTA 2PFBA 1R00A 1ZHFA 4HF2A 4QPQA 2XGCA 1QA6A 1UG0A 4XSZF 3KZZA 2STTA 1IN8A 2PQ8A 1OCOH 2X6YA 1T0FA 4G7OF 1SEUA 1BIBA 1IXCA 2A5WA 2HTSA 2EQRA 3G1MA 4U0VA 4DBRA 2RKHA 4IQ4A 1N77A 4A93J 2LP0A 2P4WA 5D4RA 1JUMA 2FD5A 5M5WJ 2X48A 3TEDA 3OSFA 5ILUA 3DEWA 5DD4A 2XC7A 1XSDA 4KFCA 1U5TB 1XG1A 2OU2A 4MTDA 4G7ZF 4Q47A 5HDGA 1MZBA 1A6IA 2KIQA 4LD5A 3RJPA 1MSFC 3M1CA 3K4NA 5IOYA 4A69C 2E71A 2KHMA 1YHQI 3EUHC 4E4HA 3PO3J 3VPRA 4HG2A 2RNGA 2PG4A 1WJ5A 2A6HF 1YJ9I 1LUJB 4MQ9F 3ZQLA 2H1LA 2C6YA 2HYGD 3A03A 2KFDA 4HQMA 5TGTA 3GEZA 4IHYA 3ZRGA 3CCRI 1TL8A 1T8IA 3MD2A 1FTZA 3J7AY 3EYYA 2X9DA 3F72A 2FMYA 5F64A 4MHGA 3K4MA 2DO7A 3KP5A 2AXLA 2P5KA 1DPUA 1O3TA 4F91B 5HLTA 2MSYA 2R7ZJ 2IP2A 1W1WE 4N4OB 1BJAA 3WTZA 3I4MJ 5D5VB 3JRGA 3E97A 3RI4A 2R7VA 2PMZA 3E3VA 2XDVA 3N97A 2NS8A 5DM6F 2CH0A 2M87A 3RSNA 5ERIA 2EIKH 3PNVA 2YS9A 4UNOA 3MEXA 1R4MB 3VYSB 1RUOA 2JK3A 1QRYA 3VDXA 4B48A 1MMAA 2V7FA 3NQOA 5BQTA 2KIFA 3IAM2 1ZLKA 2OBPA 2QQAA 1YRNB 3RPUA 5IP7J 1K6OA 2O8KA 3WG9A 2IS1A 4OAYA 5LGNA 4E7LA 4QPOA 5GPAA 3B6AA 1MMSA 1QHGA 3ABMH 4ITVA 4RAFA 5LEKA 4DYQA 3L1PA 2HWVA 2R7RA 3JSPA 3FWEA 4EV0A 3N05A 2VBZA 2HZDA 2VKEA 3BQYA 3QP6A 4UVAA 4XNFA 3ZQHA 3EYIA 2H09A 2JA6J 2M45A 3PFYA 4MNUA 3E1SA 1GXPA 3A0BC 4XM3A 3HXLA 3O8GA 3HHHA 2MG4A 5JHFA 4ZYAA 1KQ8A 4M9SA 2KIMA 2EJRA 2P6TA 4I2OA 5CVJA 1SFOJ 4YIIA 5FLMJ 1XN7A 4JYKA 1D1CA 1TQIA 2TCTA 3R61A 5HLIA 1T56A 2K5CA 1U8BA 5J4YA 4G9YA 4P5OA 3RIRA 1JGSA 3QQAA 4X0GA 1G6NA 3E6BA 2OTLI 3CC7I 3HOWJ 3L2WA 2QKMB 3AG1H 2K86A 1S8NA 1HKSA 2IA1A 2DQRA 5CLSA 4LB5A 4FTHA 2CYYA 2MD0A 2XAGA 3EETA 2EZIA 2AQFA 4P1WA 4XKBA 1ON1A 2EV0A 2XAHA 3E6MA 1E3OC 1LE8A 4WCGA 3WHBA 1YG2A 1XGSA 4HSTA 1OYYA 3Q9SA 4KIBA 4EEFG 3CMEI 2QQ8A 4NBQA 5BOXA 2NYXA 1OCTC 3EQLF 4R1HA 2L54A 1WJAA 2R7XA 1P2FA 4S04A 1I6XA 4QTRA 3IWZA 3HRSA 3CJQB 1OJLA 1STZA 3DFGA 5HNHA 3DTKA 3HPHA 3LA7A 4DYCA 1BIAA 2CJJA 3HZJA 3FXQA 3TMOA 4CGZA 3T1BA 2R5ZB 2OA4A 2HPIA 3L00A 4AIJA 3HOZJ 1RC9A 2ZNYA 1Y1VJ 2E1NA 1ZLJA 4AYBA 3DF8A 2FEZA 5FD6A 1MDMA 2PMUA 1GLNA 2WAFA 4EM2A 1YQAA 1YX5A 1XX5A 4WX9A 1K4SA 1S29A 2M7BA 2QSFX 2K3PA 3C18A 1RETA 3CMMA 2HGCA 2M3AA 5IYCJ 3QWLA 1DUXC 2GA2A 2L4AA 2A6EF 2M0MA 2WAEA 4KIFA 2XVCA 3FIWA 3S1QJ 2JUCA 1RR8C 3LNQA 3BZCA 1IN6A 2PX9A 1T39A 2CFXA 1VNDA 3S32A 4AIKA 4KT6A 2I5UA 2X1CA 3FXLA 3TL4X 2L02A 4ABZA 4H4KC 1YI2I 4W97A 2A07F 4M6VA 4UV9A 3OY9A 1ZN2A 3R6SA 3TO7A 4RB2C 5FD5A 3DPUA 2EINH 1PP7U 3KP6A 3KEQA 2K9MA 4ENKA 3MVPA 1GV2A 5DUKA 5ICFA 2KQRA 2VKHA 2ZJQF 4B47A 3W6KB 1D8JA 4NB5A 2ISZA 3IAS2 1X1CA 3DBHB 5LRSA 3H5AA 3B6CA 5LFAA 1IF1A 4BL0B 5B1AH 1ODDA 4M3DA 4AWXB 4ESJA 3GTGJ 1B72B 3OSGA 1K78A 4Y7NJ 1U0JA 1ZK8A 3TOBA 1SFEA 4BJ5C 4O6JA 1WGXA 2P7CB 3ABUA 3J80K 5DYMA 1LJ9A 2UUZA 3LSJA 1ZG1A 2V1NA 2QGUA 4U0WA 4A2UA 5JVTA 2JUGA 3GTJJ 3MQ0A 3GZNB 4L9VA 4BDZA 5F0CA 4QWQA 4ZYGA 2ZJRF 2LC2A 3DU6A 3P9IA 5JFRA 3HSFA 4PFPA 4EJVA 1SMTA 1QHHD 1B72A 2LBFA 2ZKZA 1BJZA 2VUMJ 5HLGA 1R22A 5FRMA 2JN6A 1S7EA 1X3ZB 1OYIA 4M74A 3KZYA 3CMYA 1W0UA 2GZWA 1ZARA 4GFBA 4XL9A 3I54A 3OOUA 3BWGA 3BTLA 2DN0A 5IYBJ 3LWFA 4WXCA 2XUBA 4LG3A 4KNYA 3G2BA 4L5EA 4RAZA 2GLOA 2J5PA 4UHTA 3K2ZA 3M1EA 5K5RA 3CDIA 4A3LJ 3CZ6A 5EZGA 4I02A 4V2FA 3TQNA 5K5QA 5K5OA 2JTVA 3LFUA 3JRHA 2CV0A 3HC7A 1XPXA 1NG6A 1QVUA 5E8GA 5EGOA 1X4OA 2JZYA 4HLXA 4XRMA 3IKTA 1HSJA 4B4CA 3GFJA 3KYLA 2BV6A 2R92J 2FNPA 5FRNA 2VBYA 4MGRA 1J0RA 1XS9A 1R5HA 3W2WA 3WGGA 4BUPA 3CLQA 2CFOA 3KPHA 3LAPA 2ZXJA 3I55I 2KL4A 4RM2A 4BY7J 1E3HA 4OINF 2QF7A 3I4PA 2QSHX 2MBFA 2PEXA 5J47A 3MZYA 1KYZA 4YIRX 2F6CA 2R4GA 1AA7A 4YFXF 3M07A 3HOVJ 4U7BA 2B63J 4Y4RA 4JBAA 1NK3P 3O8HA 3JCUC 1SC7A 3VWBA 2LFBA 4I0BA 4BGDA 2WWYA 1RNLA 2VL8A 1MDMB 2KJBA 2L5QA 1G8XA 1ZH5A 1JKOC 1FIAA 3S1NJ 3REOA 4RM3A 3BROA 3R0JA 3GX4X 3KCCA 1R1UA 4LLLA 1H8AC 2L7ZA 1LDKB 3WTYC 4ZH4F 2JT1A 1SFUA 3TW7A 1MNEA 3ZN0A 2DCEA 1UELB 3GMEA 1IJWC 5FKOA 3GTPJ 4MQVA 1W7PA 3BPVA 5C44J 3GTLJ 4UB8C 1TP4A 2LG4A 4KMUX 5M5XJ 1EF4A 5KNLA 3U9GA 3QP5A 2ME0A 2QCOA 4G8XA 1X1AA 3IH2A 1R58A 3GFMA 2BVMA 5D6FA 4BEHB 2P5LC 1PVEA 2L9NA 2E35A 4A5NA 2QYOA 3ZQCA 4DGWB 3BJAA 4EMSA 1RRJA 2KRHA 4ZYEA 2QVOA 3ECOA 4HV6A 2QQ9A 1BL0A 1OCRH 3J7AO 1W5CC 3S17J 4IHSA 4ZYHA 2Z3YA 3VSLA 3HOYJ 3V7SA 5EG0B 1YJNI 4A0ZA 2V4JC 3PIPF 1B1BA 2ISYA 1Q1HA 1XDUA 3CCMI 3KFWX 1FJLA 3QOPA 2R7DA 2VKVA 4LIVA 2UXNA 4D7NA 2FQ3A 4IHVA 4NC7A 3CCQI 1APLC 3K9TA 1FLIA 1WJFA 2LSOA 3IV5A 1QNTA 3IC7A 3L2RA 3F9KA 1HW5A 4FETA 2VQHA 2HYJA 2EIJH 3BC8A 3KZIC 4CYCA 2EZHA 1Z21A 1HBXG 3IWFA 1NH3A 3WGHA 3HTUA 1T6SA 1F43A 2W00A 2JSPA 3VFZA 4DYRA 1PUFA 2Q2EA 1Z3XA 5FB2A 4NC8A 2IPQX 4LOCA 4UXNA 2EPFA 2Y0SN 4YFKF 2MH2A 2B9SA 1WJBA 2CS3A 5FROA 2CGPA 3JREA 3CO6C 1YFHA 3V8JA 3KYCB 4B09A 2ADUA 4Y33A 2DA3A 1BOAA 1R5ID 2W57A 3KEYA 1OKRA 1U78A 5E20A 4EATA 2YU3A 2TRTA 1XB4A 2CQXA 4HPQA 4P9UA 3NEUA 2WADA 3JTGA 2LTPA 1QGPA 3CUQA 1WRJA 4M3FA 2GWRA 3DWLE 3M8EA 3W3CA 4I6ZA 4P96A 2UZKA 2XV4S 4XN3A 2PLYA 2LK2A 3EUHA 3BTJA 1AKHA 2XHKA 4GRIA 2BW3A 3BCBA 1R4NB 2EV6A 3LSGA 2F4MB 2G7HA 1R23A 2OV7A 1ZQ3P 1MBKA 1BC7C 5BS6A 2DA5A 3BLYA 4I7HA 4PZJA 3FHZA 1UAAA 1T98A 2ZBKA 1VQNI 1XCBA 3ZMUA 4XIDA 3M4OJ 1R71A 1QZZA 2ZB9A 2Z99A 4JQFA 5FKLA 4EJWA 2PMZN 1H88C 4C3HJ 4RDUA 3CMAI 3BPXA 4P9FA 2PI0A 3JRIA 4PUSA 4MFDA 2IJLA 1G3SA 1ZYRF 3H9QA 3ZQQA 4BBRJ 4CYDA 3JW4A 2I8DA 2B7EA 3PL8A 2LVSA 5K1YA 1FYMA 3EUKL 2R0QC 4E7IA 3SYTA 4DBQA 2HOTA 4FE4A 3BG7A 1ETXA 5CJ9A 3G1LA 2E1MC 4BQOA 2IGKA 2DT7B 3VEPA 3UR3C 1CQTA 2VLAA 1HQCA 5FJ8J 2KRCA 4LFUA 4UY8I 1ZGAA 3COAC 3CP2A 2Z9OA 4TV7A 5ILSA 3FXRA 2F4IA 4WWCA 1XGNA 1WSUA 4BXUA 4M73A 3SZTA 3ZQIA 4YIFA 1SVMA 1W36D 3F3XA 2M2EA 2ZCWA 3ERMA 5J1RA 5GTHC 2EFWA 3RTRA 2BY1A 2V9VA 5ICGA 4ANJA 3F6VA 4RA2A 5AIQA 3L2QA 2G7UA 4B3AA 1SFXA 4IXAA 4D1QA 3KP2A 4XORA 2LY2A 1HCRA 3DKYA 4L0ZB 2VC1A 2P81A 2R7FA 2LRDA 2XB5A 2K9LA 3DCFA 4ZZDA 3SDGA 2YUSA 1LFPA 1ETKA 4S05A 2R3SA 5JHUA 1IGNA 1DP3A 1Z7UA 3WE2A 3HYIA 3FZVA 4GGGA 1NTCA 3PSIA 3KYDB 1J9IA 1R7JA 3BG5A 1IN5A 5J3LA 1WZ2A 2M34A 4PDKA 3S15J 3DQVC 3FXKA 1F9NA 5GADJ 1XTAA 4KICA 1PYVA 1IN4A 2KZGA 3BG9A 4L9TA 2DMNA 1D1AA 4AUXA 4J01A 4IOAF 4U7DA 2V26A 3TW6A 2QM3A 1MNDA 1R1TA 2HS5A 2Y0SA 4EGZA 1J59A 3CDHA 3L7WA 4I01A 5L3CA 5GP9A 4XLHA 5HNFA 3OYGA 1RKTA 1QPIA 4XOTA 3LAJA 2DPUA 3ZR8X 2Z1DA 3QPHA 2ZC2A 3GLXA 4D5FA 2DA7A 4BE2A 4BQAA 5LEJA 3HL2A 1SFKA 3H3ZA 1D0XA 2LKSA 1J09A 1L3LA 5LD2C 1O7LA 3K4BA 3E5XA 2ZFUA 3M8FA 2XPWA 4HNVA 1ETVA 3DV8A 4Y52J 2KIUA 2IA0A 3ASNH 2DAOA 3TO6A 3K4KA 4M6XA 1SAUA 2YPRA 2OZ6A 4ZYDA 1ZREA 1KYWA 3KX2A 1POGA 2E7XA 2DQLA 2FUG2 1YO5C 5E3OA 1K4TA 3M7GA 2LMDA 2MYSA 1DGRM 1PDNC 3SEQA 4BS9A 3FKIJ 3SEZA 3F21A 5HLHA 4HLYA 1KQ0A 3H5RA 1VQPI 4MIMA 2LREA 3BJOA 3FM5A 4U87A 3HRTA 1I3AA 3KLOA 3SFIA 3VOEA 4QIWN 2DOFA 1AKHB 3DBLB 4AU7A 3ZQ7A 1XCVA 2O8XA 2CW7A 2CUEA 1Y8QB 1D1BA 4KT5C 2DDBA 5HDKA 3S3OA 4NHJA 5BNGA 3S3MA 2ID6A 2X51A 2VODA 4IX7A 3OYJA 2VJ5A 1Z6TA 2WAQN 3I53A 4HDUA 1ZRDA 3MMYB 3FHNA 5DUIA 4ON0A 3Q5FA 3WTTC 5TRDA 5KCMA 1YS7A 3LSPA 2F4OB 4XOPA 1BI3A 4QLCU 2HFHA 4FCYA 4U0YA 2NVXJ 5L3GA 2D5VA 2M30A 2DA4A 2DFEA 2F48A 2EA4A 1NG7A 1X19A 4B3XA 2XSDC 2EFNA 2IXSA 1XGMA 3BR3A 5L3DA 1IUYA 2DMQA 1HDDC 3F22A 4A3EJ 3TP0A 5LGUA 4UUTA 3TBIA 2HOEA 3S8PA 2DDAA 1IAWA 5E79C 3BQZA 4L9NA 3E5UA 5FKMA 3V8LA 4HQEA 1X3WB 2LNBA 1MBFA 2M8EA 2QENA 4FX0A 4RB1A 4KA4A 3B02A 2A5YB 4HZFA 4ENNA 1J7KA 3I56I 4LG0B 5E3NA 4RAGA 4JX6A 4NNJA 1TW2A 2P5VA 1IRFA 2CW0F 2RQQA 3K1NA 2W7NA 1OQYA 2CUZA 1KZHA 1PP8F 3FMRA 2FBHA 1U8RA 2WB1N 2LY9A 2L4MA 3ZPLA 3HOTA 2YX7A 4C2MJ 5EEAA 4M6YA 2Z33A 4A3IJ 2NS0A 3G71I 2NVUB 4I76A 4XLCA 3Q0WA 1DQUA 2JMWA 5DCMA 3JRCA 1SVLA 4KITB 4IQJA 3S1MJ 2VJ4A 5E1ZB 3CP8A 4ESBA 2DFIA 1WI9A 2O0YA 1MGTA 2GOXB 5TISC 3ABTA 3HOSA 4IPAA 1FX7A 1MMNA 4UVCA 1D0YA 4FT8A 4A3DJ 3FBIB 4Q4ZF 5BMZA 2KP6A 4IEJA 1VTNC 4M3EA 2DPDA 3HHGA 4PJJA 1OISA 1UCRA 1JXSA 2ETHA 1FBUA 1MJBA 3LQQA 5J8FA 2JRTA 3ULQB 2NOGA 2W85A 3H9GA 2AS5F 1K7AA 5TJJA 2DYSH 2ICWG 3K6GA 4XKVA 3WTUC 5FFXA 4AVZA 4NQWB 3DKXA 4IHXA 1I39A 3UNGC 2GOMA 1KU3A 2GM4A 3V4GA 2ZNZA 5B1BH 1MH4A 3WTWC 2JVGA 3LOCA 2JSCA 4E7SA 3EUAA 3JTHA 3CF5F 1DGWY 4A3BJ 3HDDA 5AIPA 3CCYA 4IL6C 1RPWA 5JI6A 1USTA 2YX4A 2KT0A 1FSEA 1V4RA 3U1KA 3H0DA 4MO7A 4IOCF 4EJTA 1FWZA 3HRMA 1RUNA 1WPKA 1WVRA 1TNTA 4PJ0C 1Z9CA 2O9LA 2JVHA 4BNCA 3JAMZ 5D5XB 1A6QA 3QYFA 1ZGWA 1TWAJ 4F55A 1FPQA 3GF2A 5KAFC 3MKZA 1WJEA 2DA2A 2DJIA 2VXZA 5CKTA 2IEKA 2WV1A 3H3UA 1EA3A 2VQLA 1IC8A 1YX3A 5IT3A 2FBIA 4G6DA 3WU1B 3SHFA 1YE9A 1I27A 1H9TA 1FZPB 4C30A 1QO0D 2MD5A 4RB0A 1IUFA 2YSRA 4WXHA 2CQNA 3QPTA 4GYGA 4IRIA 1V55H 3BT9A 5IP9J 3BTIA 3H1CA 1RKWA 4XSXF 1X2MA 4LK0F 4C3IJ 2M4GA 1LKXA 3WU2C 1D5VA 3A4CA 2JQ7A 3HOXJ 2EFPA 1D5YA 5D6EA 1OCCH 4X6AJ 1K6YA 2BW3B 2IGNA 4S0HB 2LY1A 2MGQA 3T0YA 4M9ZA 3O6BB 1U3EM 2BYVE 2E36A 1U9OA 4DZPA 4MTEA 2GQQA 3HPGA 4Y15A 4CCKA 1IDYA 2GAUA 4GCVA 2VC0A 3RZOJ 3FF5A 1ACIA 2W82A 2L01A 3M8JA 4D5CA 3L09A 2QUFA 1I50J 4XN0A 3LSIA 4R79A 1RI7A 2L9VA 4AIHA 1OR7C 4W1UA 2VONA 4R8HA 4HDVA 3DTEA 4E70A 3UKGA 2IGOA 3K1PA 3ONQA 5C4JJ 3ZMZA 4RS8A 1Z67A 3H0GJ 4YEJA 3WU0A 1G3YA 4PSWA 4NC6A 6PAXA 1FNNA 3RZDJ 2LF8A 2E1CA 2CU7A 2R7QA 3CC2I 2EB7A 4XLAA 3ESWB 3C2BA 3LFKA 2X0LA 1XSVA 4WK8F 5EDNA 2DW4A 4AIDA 4ESFA 3H3VK 2VE9A 2XSJC 1FYLA 2HEOA 4JX4A 1BW6A 4AYBN 2HNHA 4IRGA 5KAIC 4HF0A 2VXDA 4CH7A 3EDPA 4DJAA 4CICA 5FFZA 2H8RA 1J75A 2DLLA 3K7AJ 4E7JA 2W48A 1PJRA 1S7OA 3GFLA 1FP1D 4JOMA 5FKKA 3M3YJ 2FRHA 1Z1DA 3JRDA 2X6WA 1Y56A 1OR7A 1UMQA 4GYIA 5E1XA 4CO8A 2ZJPF 1EH6A 4G94A 5F1RA 4GO1A 3CJTB 3H5NA 4BQNA 2FNAA 3K4JA 3OMYA 1JHHA 2M7AA 3SZGA 4O3MA 5CVIA 2XROA 3L2CA 1YS6A 4N9IA 5HDNA 1MMDA 1BR4A 3QU6A 5AONA 4V19K 2D1VA 2HKOA 3RYRA 1T38A 2O61A 3HGGA 3RQIA 1IXRC 1BOBA 5EGOB 2K02A 2HI3A 1VZ0A 5E1WA 1WHUA 3MKWB 1MNMC 3IKVA 2V6EA 3HGYA 4BEHA 2P8TA 4LMYA 1NK2P 1VF9A 1WH7A 3DBRB 4ZTFA 1KU7A 2K7LA 1O7FA 4XMYA 4FHTA 4FISA 3HBLA 3KIOA 3QYBA 1W7PD 2WTEA 1ZG5A 1MBHA 5F0HA 1CF7B 2E5ZA 3WTXC 3FK6A 2STWA 3GLLA 2AHQA 2L7MP 2NNNA 4NUBA 2BY2A 1T33A 3KP7A 4HNUA 3D1NI 4IKFA 3CCSI 2TDXA 2F5VA 3R4KA 5FLXZ 5EG0A 1V5EA 1JT6A 2BGCA 3WGIA 1JGGA 2HQAA 2XKOA 1TBXA 5IY5H 1QBJA 3OYEA 1YW9A 4CYCB 2QBYB 2CQQA 5GPCA 1E0EA 1D0ZA 5J1UA 3OS0A 2QEXI 1U5TC 5A2QK 1B8IB 4EQQA 1KU2A 1TWGJ 2J5OA 2ELJA 1FOWA 1EJ9A 4RLFA 1ON2A 2NAZA 5HS8A 3P5JA 4K2EA 1A04A 2NVYJ 3KEOA 3I3LA 2BZTA 2E1MB 2QWWA 3I59B 3WE3A 1YJWI 5EEGA 3S2WA 2K85A 4Y17A 5A2QZ 2DFFA 2F5CA 2PJRB 1OMIA 1GUUA 1Q1VA 3I64A 2O7OA 3SFZA 1K61A 3LSMA 1ITYA 2H6BA 1BM9A 1GVJA 2HOAA 3E7LA 1T08B 4CCOA 5LGTA 1MMGA 5DCMB 3K10A 2DOEA 4ZJZA 2V9KA 3HKZN 1YLFA 1Z77A 4I09A 1B6AA 3IP4B 3R0AA 1DPRA 2KLOA 1ZR4A 1R9TJ 2XF6A 2OTJI 4B1RA 3I9V2 3MZHA 2GXBA 5L3BA 1YOVB 2BBYA 1WJCA 2CWEA 2O03A 3HRUA 3K2AA 1LEAA 2E60A 3HJEA 4XLFA 5J40A 3G4SI 2X1EA 2KDZA 2WV0A 3ZGKA 3L2VA 1VQ5I 2PJRA 3JSOA 3M9AA 1YTYA 2OCCH 1Z05A 3VYRB 3F23A 1ETOA 2LF7A 1GV5A 5ICEA 3BR5A 3I4NJ 2M1BA 4RMNA 3Q9VA 2NOJB 3HM5A 2EA2A 4A3GJ 1DU0A 1X58A 4ZDLA 4B43A 2EIMH 4UV8A 1O4XA 2HQ5A 1P7JA 2IA2A 1B9NA 2DT5A 2ZXIA 3RKQA 4IRHA 4LLGF 1UZCA 4BACA 3JRFA 2Z5UA 3T8TA 2I10A 2GIVA 4JK1X 3H36A 3ZOBA 1USSA 4L5IA 1U5TA 3GXOA 2HQRA 5F6FA 2VI6A 2Y75A 2R7WA 5EYRA 3ZMDA 5DS9A 4A0XA 4BHPA 1H0MA 1B9MA 2ZSIB 3F8NA 2VE8A 1XSXA 1MKMA 2DTRA 3FXUA 3ROUA 4PGGA 3MWMA 2L7KA 3W6JB 4CZZA 1IDZA 2RDPA 1X1PA 1G3WA 2CMPA 4ZTJA 5E18F 3GCMA 3I58A 2XGDA 3DU5A 3PIOF 3AG4H 3DEEA 2F5DA 2E1OA 4OMYA 1UG2A 2R7OA 1PUFB 3ML6A 1ZKGA 2JPCA 2ECBA 1GVDA 3P7NA 1VQ6I 4LB6B 2MFZA 1MJ9A 4Z2YA 4G6TB 3KETA 2ZMEB 4HA8A 5EF6A 2HVSA 4N9HA 3LA3A 4M72A 1TWCJ 3RPUD 2HOSA 3LSHA 2K27A 1YYVA 3MZ8A 4JP0A 1UJ8A 2KJCA 2QQBA 3K1MA 4D0PA 5FO5A 2X4HA 1FC3A 2HYFA 3FK7A 3LSKA 2HXIA 3BTCA 2OAZA 2IRFG 4L0YB 1TZLA 1V3FA 3CUQB 4CZCA 3RKWA 3D5SC 3SJMA 1LEBA 1FOXA 3BCAA 2EV5A 4BBSJ 2MC3A 1G59A 3G1OA 1X3UA 2GIZA 1K79A 4BHCA 3QPSA 4IZZA 4A3FJ 1JJ6C 1BC8C 2W84A 2RNJA 4Y3OA 3IL2A 4UVBA 1ZRFA 3OYKA 3DLAA 2DXIA 2ZJ2A 3VODA 2NVQJ 2HDWA 3J7YJ 5IPAA 3ZQGA 2DBBA 1LFBA 3RCOA 2HDCA 3N4MA 3E0JB 1BA5A 2DMUA 3RDIA 3OS1A 1VQMI 1SD4A 3BR6A 3I71A 3QU3A 4F52A 1XC5A 4XRSA 3D5LA 3GW2A 2L7FP 1HOMA 4B8XA 2FX0A 2Q2EB 1O57A 1EV7A 1UB9A 2VIXA 3OIQA 5GAEJ 4FX4A 3C1DA 3QYEA 3CCLI 2VPLA 2BHYA 2FJ1A 4D7MA 5IP6A 1GXQA 1QPMA 1HW1A 4J19A 5IT9K 3K70C 2BXYA 2EH3A 1JTYA 2EILH 2QLZA 1F5TA 2VBWA 3O2PE 2H27A 1REPC 4XONA 1W5SA 1VFCA 1BI0A 1TQMA 3OYCA 4AVPA 5EZHA 2P7VB 2WY8Q 3FXJA 2MLKA 2KKOA 5KHDA 1JTXA 1RZ4A 3CDLA 1U6GA 2VJJA 3ELKA 2CUFA 4UB6C 4XLNF 3IH3A 4CDGA 4EJOA 1J2XA 1AOYA 4M71A 3G73A 1XGOA 4A6DA 4KUMA 5CVUA 2PBIA 2D2WA 1LVKA 3OYFA 1RIOH 5HVQC 3BG3A 2V9PA 1VQKI 2K9SA 2NXNB 2RAEA 3T8RA 1IV6A 3ISPA 2VPRA 2RN7A 1SD5A 2FBKA 4IJAA 1LB2A 4XKWA 1KQ9A 3D5RC 3PO2J 4PFOA 3ABLH 1HW2A 2KRFA 4BQQA 5D5UB 2E2HJ 5CVVA 4E6KG 1W0TA 4HX4A 3A2KA 1Y0NA 3QRFF 5HS7A 2N8GA 2NVTJ 5FLXK 2VASA 2WC2A 4CUGA 2EZKA 4B44A 2R7TA 1E17A 1E3PA 3PJRA 1N25A 1QZYA 2ZXHA 5F1JA 3AKZA 3J80Z 1H89C 2DT6A 2WB1A 1HXDA 1HDPA 2RQPA 3S2DJ 3V42A 3AG2H 1G3TA 3DPLC 2ZSHB 4KN7X 1S3JA 1P9QC 4NDLA 2O5RA 1OCPA 4AC0A 4KMFA 3RPQA 1IO2A 3BR0A 2H8WA 5J6XA 4MFEA 1Z6RA 2XAQA 2ZMEA 3W6VA 2D1HA 2MH9A 4HYEA 3CCUI 2JA5J 4XLPF 4G12A 2DFHA 1ZTRA 3K0LA 4IVNA 4ENMA 3BZKA 5LLQA 1A31A 1HLVA 3JR9A 4FASD 3MAJA 2Z16A 4MEXF 5F27A 1FMWA 4PGHA 3V7CA 1Y0UA 4C2TA 2DMTA 2XKPA 2OCEA 4CCJA 3ZCOA 2XAFA 2R5ZA 2FSWA 4HSRA 2ELKA 5B5EC 1A36A 2NS7A 4BE0A 4EJUA 3OL4A 1FBSA 1X2NA 1YW7A 3OOPA 2XGEA 2DK8A 1IRZA 3GYHX 4PSXA 3TOAA 3Q3SA 4XKCA 1HC8A 3FMSA 4RGUA 4EM0B 2ELHA 1R5GA 3HUGA 2RREA 1P4WA 1S9HA 2A68F 4E7KA 2VBXA 2Y2ZA 1WCMJ 4IHWA 1IW7F 1MBJA 4HAMA 2DK5A 2F2EA 4V2GA 1UHMA 1HKTA 2MW8A 1VQOI 1EKEA 1DDNA 4F3QA 4F92B
chains in the Genus database with same CATH topology
2WBMA 2LY1A 2Z2SB 3OYLA 2LG4A 3FKJA 4F93B 5KNLA 4CCKA 3HPGA 1X1BA 4C9YA 2DOAA 1X1AA 2W82A 4BEHB 2BVMA 3M8JA 4XN0A 2L9NA 3LSIA 2HU9A 4R79A 4DGWB 1OR7C 2KMUA 2KRHA 3VYTB 3DTEA 3AL0B 2IGOA 3NWTA 3ONQA 3VSLA 4YEJA 4PSWA 2V4JC 2R7QA 4LIUA 4XLAA 4LIVA 4NC7A 4II3A 1WJFA 2W4SA 3L2RA 3F9KA 2QKLB 2XSJC 4FETA 2VQHA 3BC8A 1Z21A 2HNHA 3OYAA 3OYHA 2VXDA 4CH7A 2W00A 2M4KA 4DJAA 2JSPA 3H9JA 1Z7LA 1Z3XA 4NC8A 2IS4A 4YRVA 4BE1A 4E7JA 1PJRA 2MC4A 4JOMA 1WJBA 1Y6IA 2CS3A 2X6WA 1Y56A 5FROA 4Y33A 3FBNB 3KEYA 3H5NA 4BQNA 2BOLA 3K4JA 3OMYA 1TT0A 3QOEA 4EATA 2M7AA 4HNTA 4HPQA 3SZGA 3DTIA 2WADA 4N4NB 1MMDA 1BR4A 3A1YA 3DWLE 3W3CA 3PUBA 2HPMA 4XN3A 3DPTA 4E7HA 4GRIA 2BW3A 2L2OA 3BCBA 4II2A 3LSGA 1BOBA 3OYBA 1VZ0A 4D9JA 1N75A 4DOZA 3MKWB 2V6EA 4BEHA 3PNTA 4HEA2 2OV7A 4QPQA 1UG0A 4ZTFA 3BLYA 4BDYA 3MKYB 4XMYA 1UAAA 2X6YA 3OYDA 3QYBA 2CV1A 2E5NA 2E5ZA 4KJZA 3W2AA 2A5WA 3OR1C 4DBRA 4NUBA 4OAZA 4JQFA 4IQ4A 1N77A 3OYIA 3BG6A 4HNUA 4IKFA 4PUSA 1BR2A 2CW8A 2F5VA 2XC7A 1V5EA 3H9QA 3ZQQA 2HQAA 2I8DA 1X1DA 4E7ZA 3PL8A 3OYEA 3EUKL 3U21A 3M1CA 3K4NA 4XQFA 1E0EA 4E7IA 1D0ZA 2KHMA 3SYTA 4DBQA 3OS0A 3EUHC 3IUOA 4E4HA 4LITA 3BG7A 4BJ6C 2HVRA 4HG2A 2E1MC 2RNGA 4BQOA 1WJ5A 2IGKA 2DT7B 2ELJA 4RLFA 3UR3C 2VLAA 2KRCA 5TGTA 4PJMA 3ZRGA 3I3LA 1HA8A 2E1MB 3CP2A 4CA0A 3MD2A 3SDBA 2F4IA 3J7AY 4ZDPA 2PJRB 3K4MA 2A6TA 1Z3YA 3LSMA 4CCLA 3EPZA 4F91B 2VB6A 4CCOA 5HLTA 1MMGA 1W36C 1W36D 3K10A 4ZJZA 4N4OB 2V9KA 3RTRA 4OWRB 2MABA 2R7VA 2PMZA 3IP4B 4ANJA 2XDVA 2OC6A 1IRXA 2KLOA 3L2QA 2XAUA 2XF6A 3I9V2 2CH0A 2OUMA 3CESA 3RSNA 4D1QA 1WJCA 4XLFA 3PNVA 4MLOA 2E60A 4XORA 2X1EA 3ZGKA 2LY2A 3L2VA 3S3NA 3VYSB 2PJRA 3VDXA 4B48A 3DKYA 3QODA 3VYRB 4XLEA 4PJNA 1MMAA 2V7FA 4PJLA 3IAM2 4RMNA 2NOJB 2LRDA 1V5FA 4ZDLA 2IS1A 2K9LA 4OAYA 4B43A 4E7LA 4QPOA 1LFPA 2HVQA 1QHGA 4ZC3A 4ITVA 1DP3A 2ZXIA 2R7RA 3PSIA 3AFHA 4BACA 2P0WA 2LBFB 3N05A 2HZDA 4XNFA 3DQVC 3PFYA 2CUJA 3E1SA 3OL3A 2VQCA 4XM3A 4XR6A 3HXLA 1PYVA 2KDOA 2R7WA 5JHFA 4ZYAA 4J01A 1D1AA 2V26A 2ZSIB 1MNDA 4J00A 2Y0SA 1D1CA 5CQGA 3HKZA 3NWSA 3OYMA 1JI8A 4PK4A 2K5CA 1OLTA 3OYGA 2L7KA 4XLHA 5HNFA 4P5OA 3PSFA 4XOTA 2CMPA 4X0GA 3ZR8X 4ZTJA 3L2WA 2Z1DA 2QKMB 3LMMA 2WA0A 1R6RA 4BE2A 3DU5A 3DEEA 4CCMA 3HL2A 1SFKA 3S93A 1D0XA 1J09A 2R7OA 5LD2C 2MD0A 3K4BA 2WAQA 2ZFUA 1FMVA 2X1DA 2AQFA 4P1WA 4XKBA 1WJDA 4HSTA 4KISA 2MFZA 3K4KA 1V5GA 4G6TB 1SAUA 3ZXSA 2HVSA 3AL0C 1WJAA 2LOOA 3RPUD 3LSHA 2R7XA 3KX2A 3PNYA 2FUG2 3CJQB 2MYSA 1DGRM 3SEQA 4BS9A 3LSKA 3SEZA 5HNHA 1TZLA 3H5RA 1WFXA 3DTKA 3W2VA 2LREA 3HPHA 4U87A 2XF5A 3HG9A 3TMOA 4CZCA 3RQ4A 3D5SC 4AU7A 2HPIA 2KZVA 3BCAA 2AQEA 2CW7A 4AYBA 1D1BA 1G59A 2CV2A 1GLNA 2WAFA 1QU3A 3S3OA 1YX5A 4IZZA 3GBGA 2M7BA 3S3MA 2K3PA 2X51A 4Y3OA 3CMMA 4IX7A 3OYJA 2VJ5A 3OYKA 2M3AA 3DLAA 3MMYB 2DXIA 4BXFA 3FHNA 2M0MA 5KCMA 2WAEA 4XOPA 2HDWA 1N78A 2X85A 4ZDOA 3S32A 3OS2A 4KT6A 3RCOA 2X1CA 3OYNA 2BVLA 3E0JB 1NG7A 3TL4X 4H4KC 3OY9A 1X19A 4B3XA 2IXSA 3OS1A 2IGMA 3DPUA 4F52A 3D5LA 2L9SA 2K9MA 3TBIA 3S8PA 2Q2EB 3OIQA 2VIXA 2KQRA 2VKHA 3QYEA 4B47A 3L2UA 2R7SA 2VPLA 3IAS2 1X1CA 2R7UA 3H5AA 5LFAA 4HRIA 4BL0B 3K70C 3VSKA 4NNJA 1U0JA 4CSWA 4XONA 2RQQA 4BJ5C 4CCNA 3OYCA 2W7NA 2WY8Q 2CUZA 5KHDA 1BR1A 2UUZA 2V1NA 5HOOA 2VJJA 2JUGA 5CQEA 4BDZA 3HOTA 3HUGB 2LC2A 3C2GA 3DU6A 4YELA 4PFPA 1QHHD 4XLCA 1DQUA 3OIPA 2LBFA 4KITB 4IQJA 2VJIA 2VJ4A 3CJRB 3CP8A 1LVKA 3OWTA 5FRMA 3OYFA 5HVQC 2GOXB 4BJTA 3HOSA 1MMNA 1D0YA 4DIQA 1ERDA 3FBIB 2KP6A 2Q1ZB 4XL9A 5CPRB 2JA2A 3OOUA 4XKWA 3D5RC 1MW7A 4PJJA 4PFOA 4BQQA 4LG3A 4C2UA 4E6KG 3G2BA 3H9GA 3A2KA 3OR2C 2X6XA 3K6GA 4XKVA 4AVZA 4NQWB 3DKXA 2VASA 3CZ6A 4CUGA 1T95A 3LFUA 2XF7A 4B44A 2KPMA 3UNGC 2GOMA 2CV0A 2R7TA 3HC7A 1NG6A 2JVGA 3PJRA 2ZXHA 3AKZA 2IS6A 4E7SA 1X4OA 3EUAA 2WY7Q 2DT6A 3K4CA 1DGWY 2W1OA 2IS2A 2WB1A 3KYLA 3VYUB 3K4LA 3V42A 5FRNA 3H0DA 2ZSHB 3DPLC 2UWMA 1P9QC 2O5RA 3W2WA 4BUPA 2CFOA 2JVHA 1KONA 2LH9A 2KL4A 4RM2A 4RLQA 3K70D 2VKDA 3QYFA 4BU2A 4F55A 3MKZA 1WJEA 2DJIA 2VXZA 4FASD 2Z16A 2F6CA 2R4GA 1AA7A 5CKTA 1FMWA 4U7BA 4Y4RA 1EA3A 4C2TA 2VQLA 1YX3A 4CCJA 3ZCOA 3VWBA 4HSRA 1YE9A 4BGDA 1T0FC 2VL8A 4BE0A 3LL7A 4C30A 3OL4A 1G8XA 2L5QA 4PSXA 4RM3A 4XKCA 2UV1A 2M4GA 1LKXA 3A4CA 2LYCA 1ZELA 2RREA 3CF2A 1S9HA 4E7KA 1LDKB 3FDYA 1MNEA 1K6YA 1X4PA 2BW3B 2DCEA 2VQGA 2IGNA 3C2HA 3H35A 1UELB 4F3QA 4F92B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY1 A;  3S93 A;  2KZV A;  2KPM A;  2LH9 A;  3RCO A;  2LY2 A; 
#chains in the Genus database with same CATH topology
 2WBM A;  1G4D A;  2ACJ A;  3P9K A;  1E2X A;  3AAF A;  1G2H A;  3PFI A;  3FX3 A;  5DD8 A;  3OYL A;  4A3C J;  1P7I A;  1WH5 A;  5CVR A;  3FKJ A;  4WF2 A;  1X1B A;  2M9H A;  4C9Y A;  2V1X A;  1Y8R B;  1O3R A;  5DM7 F;  2H6C A;  3CCJ I;  2K4J A;  2Q0O A;  2HU9 A;  1U2W A;  2COB A;  2IVM A;  4NQW A;  1JKR C;  2JA7 J;  2KMU A;  4M3B A;  4HX8 A;  1VQL I;  1ENH A;  3TKY A;  3DXJ F;  4QSH A;  3NWT A;  1QQI A;  5JVG F;  2JRM A;  1BBY A;  5E3M A;  4ZZL A;  1BW5 A;  3CQZ J;  1JUP A;  2DJN A;  1D3Y A;  4UUS A;  2IBD A;  1XMX A;  3D0S A;  3DP7 A;  3HSE A;  3DKW A;  3BOQ A;  3MCZ A;  5JLX A;  5DEQ A;  4II3 A;  1P4A A;  2ZME C;  4YFN F;  3QPL A;  4OMZ A;  2W4S A;  1KU9 A;  1FOY A;  2OPT A;  4G6Q A;  2ECC A;  3OYA A;  4A0Y A;  2R93 J;  2M4K A;  1P92 A;  1Z7L A;  3H9J A;  1QZE A;  5ICC A;  2V1U A;  4YRV A;  3CUQ C;  4BE1 A;  2MC4 A;  4OIR F;  1Y6I A;  5H6R A;  2E34 A;  3PUF A;  2XRN A;  1LFU P;  1ETW A;  3FBN B;  4OIP F;  1JUS A;  4LG0 A;  4RB3 C;  1RR7 A;  1JT0 A;  2JA8 J;  2A69 F;  4HNT A;  2DTZ A;  5LRR A;  5IYD J;  4M9X A;  1FYK A;  4N4N B;  1I5Z A;  1XMA A;  3A1Y A;  3E5Q A;  1RES A;  3SZP A;  3NAU A;  4E7H A;  1Y39 A;  1SAN A;  4LJZ F;  2HR3 A;  4II2 A;  4A12 A;  1YIJ I;  5GAH J;  3OYB A;  3RKY A;  2X6O A;  2Y9Z A;  4DOZ A;  4GDF A;  3CTA A;  1JKQ C;  1FY7 A;  4HEA 2;  5CYV A;  4OU0 A;  3A01 B;  3ERE D;  4FQG A;  1F1Z A;  1WWX A;  2FQ4 A;  2FOK A;  3ZQF A;  4BDY A;  3MKY B;  1S5L C;  2DOD A;  2EWN A;  3OYD A;  9ANT A;  4HF1 A;  3WTS C;  3WG7 H;  4JX5 A;  2CV1 A;  2E5N A;  1ONV A;  2VT2 A;  1OPC A;  2QBY A;  1DU6 A;  4KJZ A;  3W2A A;  4KDP A;  3I0T A;  1TTY A;  3OR1 C;  4OAZ A;  2BHZ A;  2V6C A;  3OYI A;  3BG6 A;  2XPV A;  1SMY F;  1V54 H;  1R1V A;  3GTK J;  3A01 A;  3PQK A;  1BR2 A;  2CW8 A;  2L9R A;  3JRA A;  1CGP A;  5F0F A;  3MKL A;  2FA5 A;  1X1D A;  4E7Z A;  3IH4 A;  2OQR A;  3ABK H;  4I98 B;  3U21 A;  4XQF A;  5J4V A;  3NAR A;  3TO9 A;  1XD7 A;  1P4X A;  3U2R A;  2FXA A;  3IUO A;  5L3E A;  4LIT A;  5IT9 Z;  3GZ6 A;  5D8L B;  4BJ6 C;  4Q48 A;  2HVR A;  2GBY A;  4IF4 A;  5DV5 A;  1TWF J;  4OOI A;  2V1D A;  3GO5 A;  4A3M J;  1FT9 A;  2BE5 F;  4KYW A;  1Z91 A;  1Z0X A;  4RGR A;  5BPI A;  1ZR2 A;  4PJM A;  5J8C A;  2ZO4 A;  1HA8 A;  4XK4 A;  3P9C A;  4CA0 A;  3SDB A;  3IRQ A;  2XGX A;  4ENJ A;  2VN2 A;  4KIG A;  1R49 A;  4ZDP A;  5C3E J;  3GTO J;  1SVO A;  2A6T A;  2Q8K A;  1A35 A;  1Z3Y A;  4CCL A;  5M3M J;  2OD5 A;  3EPZ A;  1UHW A;  4Y13 A;  3KLN A;  1OCZ H;  3HEF A;  3WHC A;  2VB6 A;  1VQ9 I;  1L0O C;  1W36 C;  3FM3 A;  5KVR A;  2XPU A;  1VQ4 I;  1GHC A;  4RGX A;  1GDT A;  1UFM A;  2MAB A;  2EK5 A;  2GXG A;  4HW0 A;  4OWR B;  4BAY A;  3B73 A;  3ZMS A;  4A3K J;  2OC6 A;  3GFI A;  1IRX A;  2FF4 A;  3V8K A;  2XAU A;  1KA8 A;  3LSR A;  2OUM A;  3CES A;  3GUD A;  4MLO A;  2M5W A;  1SAX A;  2IAI A;  3S3N A;  1LQ1 A;  3JAM K;  1MIJ A;  2FML A;  3F8C A;  3QOD A;  4PJN A;  4XLE A;  4UUS B;  5H6Q A;  3RYP A;  4PJL A;  5FKN A;  3BY6 A;  1HF0 A;  1AU7 A;  4L18 B;  2JPB A;  1V5F A;  4XIC A;  2A61 A;  3L9F A;  3R60 A;  1HKQ A;  2PMH A;  4EM1 A;  1LVA A;  4RGS A;  4H0E A;  4BKX A;  3HTS B;  2HVQ A;  4ZC3 A;  1ZAO A;  1SD6 A;  1IN7 A;  3ZN1 A;  2Y30 A;  3AFH A;  1LDD A;  4AD9 A;  1CF7 A;  2PN6 A;  1M1E B;  3TDZ C;  2P0W A;  5M3F J;  2LBF B;  1W5T A;  2K40 A;  4HV5 A;  2CUJ A;  4CXF A;  5JR3 A;  3C3W A;  1TT5 B;  2VQC A;  2W24 A;  2XB0 X;  3KP3 A;  3OL3 A;  2BXZ A;  4XR6 A;  1ZRC A;  2KDO A;  5HOD A;  3AG3 H;  1IRG A;  1ORK A;  5DTD A;  1ZGJ A;  2RVC A;  2PJP A;  4J00 A;  4C3J J;  3T5X A;  3BR2 A;  5CQG A;  3HKZ A;  3NWS A;  3I5U A;  3OYM A;  3BJ6 A;  4PK4 A;  1JI8 A;  2RC4 A;  2DMP A;  1OLT A;  2LKP A;  2L0K A;  3I59 A;  3PSF A;  2Y31 A;  4U88 A;  3LMM A;  2WA0 A;  3IHU A;  5B3S H;  5B66 C;  1R6R A;  2OQG A;  4LGW A;  1ETQ A;  2LD5 A;  2LDU A;  4CCM A;  2IT0 A;  5F04 A;  3S93 A;  3SQN A;  4A3J J;  2WAQ A;  1FMV A;  2X1D A;  3QAH A;  1LPQ A;  1WJD A;  5LHI A;  3BDD A;  4KIS A;  4DNC A;  2Y0M A;  4IHT A;  1YIT I;  1V5G A;  2E2J J;  2LR8 A;  5LHG A;  1O3Q A;  1DP7 P;  3DEU A;  4XRS G;  3ZXS A;  4BY1 J;  3AL0 C;  2LOO A;  3G3Z A;  3PNY A;  2DU9 A;  1I1S A;  5D5W B;  5K7Z A;  5C4X J;  1QVT A;  2E19 A;  2OZU A;  3GTM J;  2CG4 A;  3F8F A;  1LE8 B;  2EFQ A;  3K69 A;  2RGV A;  3CCE I;  1WFX A;  2XAJ A;  3BR1 A;  3W2V A;  5L3F A;  4L5J A;  3GWZ A;  2BY0 A;  2KIS A;  1EH7 A;  2XF5 A;  3HG9 A;  3RQ4 A;  2QSG X;  2H1K A;  3A02 A;  2KZV A;  2AQE A;  2RV8 A;  2CQ7 A;  4BXX J;  1QU3 A;  1S72 I;  2F5F A;  3GVA A;  3GBG A;  3Q0V A;  3J81 Z;  2HKX A;  3OV8 A;  1TW3 A;  3FXO A;  4ASN A;  1BN5 A;  1Y1W J;  4UUV A;  1EH8 A;  3MN2 A;  2XIG A;  5D8K B;  3MFK A;  3HSR A;  4BXF A;  2CQK A;  2R5Y B;  2EFO A;  1IXS B;  4BYY A;  1I1G A;  4ETS A;  3F6O A;  2ESH A;  1N78 A;  2X85 A;  4ZDO A;  1J5Y A;  2HQN A;  3OS2 A;  2XRL A;  3CJN A;  3ZP5 A;  1P6R A;  2BEO A;  3A0H C;  3OYN A;  4HX7 A;  2BVL A;  2QZ8 A;  5E17 F;  4LK1 F;  1K78 B;  5ILV A;  3HIF A;  4CHU A;  2VOP A;  2IGM A;  3V7R A;  2R5Y A;  2JWT A;  4IO9 F;  2L9S A;  4I0A A;  4O5V A;  1AWC A;  2P6S A;  1LNW A;  1MJA A;  2GA1 A;  3ZMV A;  3L2U A;  2R7S A;  3ZMT A;  5LHH A;  3CCV I;  3E6D A;  1OFC X;  2R7U A;  2A05 A;  4HRI A;  5E3L A;  1FIP A;  3VSK A;  5DCF A;  5J1Y A;  1VQ7 I;  3S2H J;  3IRR A;  2L3D A;  4A5M A;  2OF7 A;  1FTT A;  4A6E A;  1F36 A;  4CSW A;  2LLK A;  2K9Q A;  4CCN A;  5LBQ A;  2NNY A;  3GZ5 A;  4RAY A;  1BR1 A;  4XBF A;  4EGY A;  5HOO A;  1YW8 A;  2YR2 A;  1T2K A;  1FBQ A;  3TDU C;  3CUO A;  2E2I J;  5F08 A;  1I6H J;  5CQE A;  4Q5S F;  2EBI A;  5FGM A;  3HUG B;  5HS9 A;  3S14 J;  3C2G A;  3X2Q H;  3H92 A;  4YEL A;  3DLL F;  3OIP A;  2VJI A;  3CJR B;  2D45 A;  2DA1 A;  3OWT A;  1TWH J;  2COM A;  3ASO H;  5EJC A;  4BJT A;  2HXO A;  3U1D A;  4DIQ A;  1ERD A;  3RKX A;  3JRB A;  1OYW A;  1JJ8 C;  2Q1Z B;  5CPR B;  2JA2 A;  3TP3 A;  3LA2 A;  2FE3 A;  1MW7 A;  1KGS A;  2ME6 A;  4C2U A;  1WQ2 A;  2A3S A;  3KE2 A;  3E6C C;  3OR2 C;  1U9N A;  1YIO A;  2X6X A;  1TLH B;  3FIS A;  1NHA A;  5FLV A;  3HB9 A;  2FU4 A;  3FXM A;  3OIO A;  2ZXW H;  3F8B A;  1T95 A;  2XF7 A;  1AHD P;  2KPM A;  3LST A;  2Y48 A;  1TC3 C;  2IS6 A;  4HOB A;  1FEX A;  5M5Y J;  1O3S A;  4YG2 F;  2WY7 Q;  1FOK A;  3K4C A;  2W1O A;  4L9J A;  2IS2 A;  2B0L A;  2EZL A;  3CO7 C;  1A5J A;  4KN4 X;  3VYU B;  4OIO F;  3K4L A;  1C0W A;  1VI0 A;  2UWM A;  1IG7 A;  5H2F C;  3TGN A;  2GXA A;  1LDJ A;  2CO5 A;  1S7A A;  3KP4 A;  2MLG A;  1KON A;  1S6L A;  2DA6 A;  2LH9 A;  3Q0U A;  4RLQ A;  1F4K A;  3K70 D;  1B59 A;  2VKD A;  4BU2 A;  1MBE A;  1TQP A;  5BPD A;  1R36 A;  1PUE E;  3FMQ A;  2NRA C;  3C7J A;  2K9N A;  4MEY F;  1XMK A;  3S1R J;  1GT0 C;  3CLO A;  4FE7 A;  2LKX A;  3S16 J;  1IV8 A;  2QA4 I;  2JJ7 A;  2Y69 H;  1T0F C;  2ZFW A;  4LLN A;  3LL7 A;  2G0E A;  2UXX A;  5D4S A;  2DYR H;  3ECH A;  2ESN A;  1MSE C;  4DQ2 A;  4WXD A;  5H20 A;  2UV1 A;  1HST A;  1B8I A;  2H94 A;  1ETY A;  2LYC A;  1ZEL A;  5GTI C;  1TNS A;  2AXT C;  3O3K A;  3CF2 A;  2FOW A;  2CRG A;  1ZG3 A;  3J81 K;  2CSO A;  5K7F A;  2M8G X;  3FDY A;  2HDD A;  5E8I A;  3BP8 A;  1MBG A;  5GAG J;  1X4P A;  2VQG A;  3C2H A;  1YRN A;  3H35 A;  2K4B A;  3PQJ A;  5K7H A;  1ULY A;  2Z2S B;  2DI3 A;  3NRV A;  2CV2 A;  1B4A A;  4F93 B;  1WI3 A;  2K3F A;  3F8M A;  2HZT A;  2W25 A;  5DDG A;  5KK1 A;  4DW6 A;  1XDS A;  3CC4 I;  2DOA A;  3SXY A;  2VT3 A;  4P55 A;  3WTV C;  3CD6 I;  1W4M A;  4N0B A;  4DZJ A;  3PM1 A;  1H9G A;  1W7P B;  3VYT B;  3AL0 B;  3F0C A;  1VQ8 I;  1D8K A;  4HBL A;  1FP2 A;  2E7W A;  4X1E A;  1MH3 A;  1K83 J;  4LIU A;  2F5E A;  1BI1 A;  5JLW A;  1WKM A;  2O6G E;  2M0C A;  2V79 A;  1I3Q J;  5ED4 A;  2QKL B;  1MD0 A;  3LQR A;  2VOO A;  2ID3 A;  2XAS A;  2YU9 J;  2O3F A;  5IOZ A;  2BY3 A;  3OYH A;  3G6E I;  3J7Z I;  1JHF A;  3VB2 A;  3GTQ J;  4G7H F;  4AM3 A;  2IS4 A;  4M3G A;  1IZ1 A;  2Y9Y A;  3BZ6 A;  4RBO A;  1JE8 A;  1FSH A;  2G9W A;  4GXO A;  2BOL A;  4EVI A;  4Z6Y A;  1TT0 A;  3QOE A;  3WOD F;  3DTI A;  1JKP C;  4BH9 A;  2IW5 A;  2OJE D;  4BHB A;  5EEH A;  3HOU J;  3PUB A;  2HTJ A;  2HPM A;  3DPT A;  4I99 C;  2L2O A;  4PCQ A;  4XRF A;  1UHS A;  1BI2 A;  2AO9 A;  2MA3 A;  4D9J A;  1N75 A;  4F7Z A;  4OIQ F;  1SD7 A;  3PNT A;  2PFB A;  1R00 A;  1ZHF A;  4HF2 A;  4QPQ A;  2XGC A;  1QA6 A;  1UG0 A;  4XSZ F;  3KZZ A;  2STT A;  1IN8 A;  2PQ8 A;  1OCO H;  2X6Y A;  1T0F A;  4G7O F;  1SEU A;  1BIB A;  1IXC A;  2A5W A;  2HTS A;  2EQR A;  3G1M A;  4U0V A;  4DBR A;  2RKH A;  4IQ4 A;  1N77 A;  4A93 J;  2LP0 A;  2P4W A;  5D4R A;  1JUM A;  2FD5 A;  5M5W J;  2X48 A;  3TED A;  3OSF A;  5ILU A;  3DEW A;  5DD4 A;  2XC7 A;  1XSD A;  4KFC A;  1U5T B;  1XG1 A;  2OU2 A;  4MTD A;  4G7Z F;  4Q47 A;  5HDG A;  1MZB A;  1A6I A;  2KIQ A;  4LD5 A;  3RJP A;  1MSF C;  3M1C A;  3K4N A;  5IOY A;  4A69 C;  2E71 A;  2KHM A;  1YHQ I;  3EUH C;  4E4H A;  3PO3 J;  3VPR A;  4HG2 A;  2RNG A;  2PG4 A;  1WJ5 A;  2A6H F;  1YJ9 I;  1LUJ B;  4MQ9 F;  3ZQL A;  2H1L A;  2C6Y A;  2HYG D;  3A03 A;  2KFD A;  4HQM A;  5TGT A;  3GEZ A;  4IHY A;  3ZRG A;  3CCR I;  1TL8 A;  1T8I A;  3MD2 A;  1FTZ A;  3J7A Y;  3EYY A;  2X9D A;  3F72 A;  2FMY A;  5F64 A;  4MHG A;  3K4M A;  2DO7 A;  3KP5 A;  2AXL A;  2P5K A;  1DPU A;  1O3T A;  4F91 B;  5HLT A;  2MSY A;  2R7Z J;  2IP2 A;  1W1W E;  4N4O B;  1BJA A;  3WTZ A;  3I4M J;  5D5V B;  3JRG A;  3E97 A;  3RI4 A;  2R7V A;  2PMZ A;  3E3V A;  2XDV A;  3N97 A;  2NS8 A;  5DM6 F;  2CH0 A;  2M87 A;  3RSN A;  5ERI A;  2EIK H;  3PNV A;  2YS9 A;  4UNO A;  3MEX A;  1R4M B;  3VYS B;  1RUO A;  2JK3 A;  1QRY A;  3VDX A;  4B48 A;  1MMA A;  2V7F A;  3NQO A;  5BQT A;  2KIF A;  3IAM 2;  1ZLK A;  2OBP A;  2QQA A;  1YRN B;  3RPU A;  5IP7 J;  1K6O A;  2O8K A;  3WG9 A;  2IS1 A;  4OAY A;  5LGN A;  4E7L A;  4QPO A;  5GPA A;  3B6A A;  1MMS A;  1QHG A;  3ABM H;  4ITV A;  4RAF A;  5LEK A;  4DYQ A;  3L1P A;  2HWV A;  2R7R A;  3JSP A;  3FWE A;  4EV0 A;  3N05 A;  2VBZ A;  2HZD A;  2VKE A;  3BQY A;  3QP6 A;  4UVA A;  4XNF A;  3ZQH A;  3EYI A;  2H09 A;  2JA6 J;  2M45 A;  3PFY A;  4MNU A;  3E1S A;  1GXP A;  3A0B C;  4XM3 A;  3HXL A;  3O8G A;  3HHH A;  2MG4 A;  5JHF A;  4ZYA A;  1KQ8 A;  4M9S A;  2KIM A;  2EJR A;  2P6T A;  4I2O A;  5CVJ A;  1SFO J;  4YII A;  5FLM J;  1XN7 A;  4JYK A;  1D1C A;  1TQI A;  2TCT A;  3R61 A;  5HLI A;  1T56 A;  2K5C A;  1U8B A;  5J4Y A;  4G9Y A;  4P5O A;  3RIR A;  1JGS A;  3QQA A;  4X0G A;  1G6N A;  3E6B A;  2OTL I;  3CC7 I;  3HOW J;  3L2W A;  2QKM B;  3AG1 H;  2K86 A;  1S8N A;  1HKS A;  2IA1 A;  2DQR A;  5CLS A;  4LB5 A;  4FTH A;  2CYY A;  2MD0 A;  2XAG A;  3EET A;  2EZI A;  2AQF A;  4P1W A;  4XKB A;  1ON1 A;  2EV0 A;  2XAH A;  3E6M A;  1E3O C;  1LE8 A;  4WCG A;  3WHB A;  1YG2 A;  1XGS A;  4HST A;  1OYY A;  3Q9S A;  4KIB A;  4EEF G;  3CME I;  2QQ8 A;  4NBQ A;  5BOX A;  2NYX A;  1OCT C;  3EQL F;  4R1H A;  2L54 A;  1WJA A;  2R7X A;  1P2F A;  4S04 A;  1I6X A;  4QTR A;  3IWZ A;  3HRS A;  3CJQ B;  1OJL A;  1STZ A;  3DFG A;  5HNH A;  3DTK A;  3HPH A;  3LA7 A;  4DYC A;  1BIA A;  2CJJ A;  3HZJ A;  3FXQ A;  3TMO A;  4CGZ A;  3T1B A;  2R5Z B;  2OA4 A;  2HPI A;  3L00 A;  4AIJ A;  3HOZ J;  1RC9 A;  2ZNY A;  1Y1V J;  2E1N A;  1ZLJ A;  4AYB A;  3DF8 A;  2FEZ A;  5FD6 A;  1MDM A;  2PMU A;  1GLN A;  2WAF A;  4EM2 A;  1YQA A;  1YX5 A;  1XX5 A;  4WX9 A;  1K4S A;  1S29 A;  2M7B A;  2QSF X;  2K3P A;  3C18 A;  1RET A;  3CMM A;  2HGC A;  2M3A A;  5IYC J;  3QWL A;  1DUX C;  2GA2 A;  2L4A A;  2A6E F;  2M0M A;  2WAE A;  4KIF A;  2XVC A;  3FIW A;  3S1Q J;  2JUC A;  1RR8 C;  3LNQ A;  3BZC A;  1IN6 A;  2PX9 A;  1T39 A;  2CFX A;  1VND A;  3S32 A;  4AIK A;  4KT6 A;  2I5U A;  2X1C A;  3FXL A;  3TL4 X;  2L02 A;  4ABZ A;  4H4K C;  1YI2 I;  4W97 A;  2A07 F;  4M6V A;  4UV9 A;  3OY9 A;  1ZN2 A;  3R6S A;  3TO7 A;  4RB2 C;  5FD5 A;  3DPU A;  2EIN H;  1PP7 U;  3KP6 A;  3KEQ A;  2K9M A;  4ENK A;  3MVP A;  1GV2 A;  5DUK A;  5ICF A;  2KQR A;  2VKH A;  2ZJQ F;  4B47 A;  3W6K B;  1D8J A;  4NB5 A;  2ISZ A;  3IAS 2;  1X1C A;  3DBH B;  5LRS A;  3H5A A;  3B6C A;  5LFA A;  1IF1 A;  4BL0 B;  5B1A H;  1ODD A;  4M3D A;  4AWX B;  4ESJ A;  3GTG J;  1B72 B;  3OSG A;  1K78 A;  4Y7N J;  1U0J A;  1ZK8 A;  3TOB A;  1SFE A;  4BJ5 C;  4O6J A;  1WGX A;  2P7C B;  3ABU A;  3J80 K;  5DYM A;  1LJ9 A;  2UUZ A;  3LSJ A;  1ZG1 A;  2V1N A;  2QGU A;  4U0W A;  4A2U A;  5JVT A;  2JUG A;  3GTJ J;  3MQ0 A;  3GZN B;  4L9V A;  4BDZ A;  5F0C A;  4QWQ A;  4ZYG A;  2ZJR F;  2LC2 A;  3DU6 A;  3P9I A;  5JFR A;  3HSF A;  4PFP A;  4EJV A;  1SMT A;  1QHH D;  1B72 A;  2LBF A;  2ZKZ A;  1BJZ A;  2VUM J;  5HLG A;  1R22 A;  5FRM A;  2JN6 A;  1S7E A;  1X3Z B;  1OYI A;  4M74 A;  3KZY A;  3CMY A;  1W0U A;  2GZW A;  1ZAR A;  4GFB A;  4XL9 A;  3I54 A;  3OOU A;  3BWG A;  3BTL A;  2DN0 A;  5IYB J;  3LWF A;  4WXC A;  2XUB A;  4LG3 A;  4KNY A;  3G2B A;  4L5E A;  4RAZ A;  2GLO A;  2J5P A;  4UHT A;  3K2Z A;  3M1E A;  5K5R A;  3CDI A;  4A3L J;  3CZ6 A;  5EZG A;  4I02 A;  4V2F A;  3TQN A;  5K5Q A;  5K5O A;  2JTV A;  3LFU A;  3JRH A;  2CV0 A;  3HC7 A;  1XPX A;  1NG6 A;  1QVU A;  5E8G A;  5EGO A;  1X4O A;  2JZY A;  4HLX A;  4XRM A;  3IKT A;  1HSJ A;  4B4C A;  3GFJ A;  3KYL A;  2BV6 A;  2R92 J;  2FNP A;  5FRN A;  2VBY A;  4MGR A;  1J0R A;  1XS9 A;  1R5H A;  3W2W A;  3WGG A;  4BUP A;  3CLQ A;  2CFO A;  3KPH A;  3LAP A;  2ZXJ A;  3I55 I;  2KL4 A;  4RM2 A;  4BY7 J;  1E3H A;  4OIN F;  2QF7 A;  3I4P A;  2QSH X;  2MBF A;  2PEX A;  5J47 A;  3MZY A;  1KYZ A;  4YIR X;  2F6C A;  2R4G A;  1AA7 A;  4YFX F;  3M07 A;  3HOV J;  4U7B A;  2B63 J;  4Y4R A;  4JBA A;  1NK3 P;  3O8H A;  3JCU C;  1SC7 A;  3VWB A;  2LFB A;  4I0B A;  4BGD A;  2WWY A;  1RNL A;  2VL8 A;  1MDM B;  2KJB A;  2L5Q A;  1G8X A;  1ZH5 A;  1JKO C;  1FIA A;  3S1N J;  3REO A;  4RM3 A;  3BRO A;  3R0J A;  3GX4 X;  3KCC A;  1R1U A;  4LLL A;  1H8A C;  2L7Z A;  1LDK B;  3WTY C;  4ZH4 F;  2JT1 A;  1SFU A;  3TW7 A;  1MNE A;  3ZN0 A;  2DCE A;  1UEL B;  3GME A;  1IJW C;  5FKO A;  3GTP J;  4MQV A;  1W7P A;  3BPV A;  5C44 J;  3GTL J;  4UB8 C;  1TP4 A;  2LG4 A;  4KMU X;  5M5X J;  1EF4 A;  5KNL A;  3U9G A;  3QP5 A;  2ME0 A;  2QCO A;  4G8X A;  1X1A A;  3IH2 A;  1R58 A;  3GFM A;  2BVM A;  5D6F A;  4BEH B;  2P5L C;  1PVE A;  2L9N A;  2E35 A;  4A5N A;  2QYO A;  3ZQC A;  4DGW B;  3BJA A;  4EMS A;  1RRJ A;  2KRH A;  4ZYE A;  2QVO A;  3ECO A;  4HV6 A;  2QQ9 A;  1BL0 A;  1OCR H;  3J7A O;  1W5C C;  3S17 J;  4IHS A;  4ZYH A;  2Z3Y A;  3VSL A;  3HOY J;  3V7S A;  5EG0 B;  1YJN I;  4A0Z A;  2V4J C;  3PIP F;  1B1B A;  2ISY A;  1Q1H A;  1XDU A;  3CCM I;  3KFW X;  1FJL A;  3QOP A;  2R7D A;  2VKV A;  4LIV A;  2UXN A;  4D7N A;  2FQ3 A;  4IHV A;  4NC7 A;  3CCQ I;  1APL C;  3K9T A;  1FLI A;  1WJF A;  2LSO A;  3IV5 A;  1QNT A;  3IC7 A;  3L2R A;  3F9K A;  1HW5 A;  4FET A;  2VQH A;  2HYJ A;  2EIJ H;  3BC8 A;  3KZI C;  4CYC A;  2EZH A;  1Z21 A;  1HBX G;  3IWF A;  1NH3 A;  3WGH A;  3HTU A;  1T6S A;  1F43 A;  2W00 A;  2JSP A;  3VFZ A;  4DYR A;  1PUF A;  2Q2E A;  1Z3X A;  5FB2 A;  4NC8 A;  2IPQ X;  4LOC A;  4UXN A;  2EPF A;  2Y0S N;  4YFK F;  2MH2 A;  2B9S A;  1WJB A;  2CS3 A;  5FRO A;  2CGP A;  3JRE A;  3CO6 C;  1YFH A;  3V8J A;  3KYC B;  4B09 A;  2ADU A;  4Y33 A;  2DA3 A;  1BOA A;  1R5I D;  2W57 A;  3KEY A;  1OKR A;  1U78 A;  5E20 A;  4EAT A;  2YU3 A;  2TRT A;  1XB4 A;  2CQX A;  4HPQ A;  4P9U A;  3NEU A;  2WAD A;  3JTG A;  2LTP A;  1QGP A;  3CUQ A;  1WRJ A;  4M3F A;  2GWR A;  3DWL E;  3M8E A;  3W3C A;  4I6Z A;  4P96 A;  2UZK A;  2XV4 S;  4XN3 A;  2PLY A;  2LK2 A;  3EUH A;  3BTJ A;  1AKH A;  2XHK A;  4GRI A;  2BW3 A;  3BCB A;  1R4N B;  2EV6 A;  3LSG A;  2F4M B;  2G7H A;  1R23 A;  2OV7 A;  1ZQ3 P;  1MBK A;  1BC7 C;  5BS6 A;  2DA5 A;  3BLY A;  4I7H A;  4PZJ A;  3FHZ A;  1UAA A;  1T98 A;  2ZBK A;  1VQN I;  1XCB A;  3ZMU A;  4XID A;  3M4O J;  1R71 A;  1QZZ A;  2ZB9 A;  2Z99 A;  4JQF A;  5FKL A;  4EJW A;  2PMZ N;  1H88 C;  4C3H J;  4RDU A;  3CMA I;  3BPX A;  4P9F A;  2PI0 A;  3JRI A;  4PUS A;  4MFD A;  2IJL A;  1G3S A;  1ZYR F;  3H9Q A;  3ZQQ A;  4BBR J;  4CYD A;  3JW4 A;  2I8D A;  2B7E A;  3PL8 A;  2LVS A;  5K1Y A;  1FYM A;  3EUK L;  2R0Q C;  4E7I A;  3SYT A;  4DBQ A;  2HOT A;  4FE4 A;  3BG7 A;  1ETX A;  5CJ9 A;  3G1L A;  2E1M C;  4BQO A;  2IGK A;  2DT7 B;  3VEP A;  3UR3 C;  1CQT A;  2VLA A;  1HQC A;  5FJ8 J;  2KRC A;  4LFU A;  4UY8 I;  1ZGA A;  3COA C;  3CP2 A;  2Z9O A;  4TV7 A;  5ILS A;  3FXR A;  2F4I A;  4WWC A;  1XGN A;  1WSU A;  4BXU A;  4M73 A;  3SZT A;  3ZQI A;  4YIF A;  1SVM A;  1W36 D;  3F3X A;  2M2E A;  2ZCW A;  3ERM A;  5J1R A;  5GTH C;  2EFW A;  3RTR A;  2BY1 A;  2V9V A;  5ICG A;  4ANJ A;  3F6V A;  4RA2 A;  5AIQ A;  3L2Q A;  2G7U A;  4B3A A;  1SFX A;  4IXA A;  4D1Q A;  3KP2 A;  4XOR A;  2LY2 A;  1HCR A;  3DKY A;  4L0Z B;  2VC1 A;  2P81 A;  2R7F A;  2LRD A;  2XB5 A;  2K9L A;  3DCF A;  4ZZD A;  3SDG A;  2YUS A;  1LFP A;  1ETK A;  4S05 A;  2R3S A;  5JHU A;  1IGN A;  1DP3 A;  1Z7U A;  3WE2 A;  3HYI A;  3FZV A;  4GGG A;  1NTC A;  3PSI A;  3KYD B;  1J9I A;  1R7J A;  3BG5 A;  1IN5 A;  5J3L A;  1WZ2 A;  2M34 A;  4PDK A;  3S15 J;  3DQV C;  3FXK A;  1F9N A;  5GAD J;  1XTA A;  4KIC A;  1PYV A;  1IN4 A;  2KZG A;  3BG9 A;  4L9T A;  2DMN A;  1D1A A;  4AUX A;  4J01 A;  4IOA F;  4U7D A;  2V26 A;  3TW6 A;  2QM3 A;  1MND A;  1R1T A;  2HS5 A;  2Y0S A;  4EGZ A;  1J59 A;  3CDH A;  3L7W A;  4I01 A;  5L3C A;  5GP9 A;  4XLH A;  5HNF A;  3OYG A;  1RKT A;  1QPI A;  4XOT A;  3LAJ A;  2DPU A;  3ZR8 X;  2Z1D A;  3QPH A;  2ZC2 A;  3GLX A;  4D5F A;  2DA7 A;  4BE2 A;  4BQA A;  5LEJ A;  3HL2 A;  1SFK A;  3H3Z A;  1D0X A;  2LKS A;  1J09 A;  1L3L A;  5LD2 C;  1O7L A;  3K4B A;  3E5X A;  2ZFU A;  3M8F A;  2XPW A;  4HNV A;  1ETV A;  3DV8 A;  4Y52 J;  2KIU A;  2IA0 A;  3ASN H;  2DAO A;  3TO6 A;  3K4K A;  4M6X A;  1SAU A;  2YPR A;  2OZ6 A;  4ZYD A;  1ZRE A;  1KYW A;  3KX2 A;  1POG A;  2E7X A;  2DQL A;  2FUG 2;  1YO5 C;  5E3O A;  1K4T A;  3M7G A;  2LMD A;  2MYS A;  1DGR M;  1PDN C;  3SEQ A;  4BS9 A;  3FKI J;  3SEZ A;  3F21 A;  5HLH A;  4HLY A;  1KQ0 A;  3H5R A;  1VQP I;  4MIM A;  2LRE A;  3BJO A;  3FM5 A;  4U87 A;  3HRT A;  1I3A A;  3KLO A;  3SFI A;  3VOE A;  4QIW N;  2DOF A;  1AKH B;  3DBL B;  4AU7 A;  3ZQ7 A;  1XCV A;  2O8X A;  2CW7 A;  2CUE A;  1Y8Q B;  1D1B A;  4KT5 C;  2DDB A;  5HDK A;  3S3O A;  4NHJ A;  5BNG A;  3S3M A;  2ID6 A;  2X51 A;  2VOD A;  4IX7 A;  3OYJ A;  2VJ5 A;  1Z6T A;  2WAQ N;  3I53 A;  4HDU A;  1ZRD A;  3MMY B;  3FHN A;  5DUI A;  4ON0 A;  3Q5F A;  3WTT C;  5TRD A;  5KCM A;  1YS7 A;  3LSP A;  2F4O B;  4XOP A;  1BI3 A;  4QLC U;  2HFH A;  4FCY A;  4U0Y A;  2NVX J;  5L3G A;  2D5V A;  2M30 A;  2DA4 A;  2DFE A;  2F48 A;  2EA4 A;  1NG7 A;  1X19 A;  4B3X A;  2XSD C;  2EFN A;  2IXS A;  1XGM A;  3BR3 A;  5L3D A;  1IUY A;  2DMQ A;  1HDD C;  3F22 A;  4A3E J;  3TP0 A;  5LGU A;  4UUT A;  3TBI A;  2HOE A;  3S8P A;  2DDA A;  1IAW A;  5E79 C;  3BQZ A;  4L9N A;  3E5U A;  5FKM A;  3V8L A;  4HQE A;  1X3W B;  2LNB A;  1MBF A;  2M8E A;  2QEN A;  4FX0 A;  4RB1 A;  4KA4 A;  3B02 A;  2A5Y B;  4HZF A;  4ENN A;  1J7K A;  3I56 I;  4LG0 B;  5E3N A;  4RAG A;  4JX6 A;  4NNJ A;  1TW2 A;  2P5V A;  1IRF A;  2CW0 F;  2RQQ A;  3K1N A;  2W7N A;  1OQY A;  2CUZ A;  1KZH A;  1PP8 F;  3FMR A;  2FBH A;  1U8R A;  2WB1 N;  2LY9 A;  2L4M A;  3ZPL A;  3HOT A;  2YX7 A;  4C2M J;  5EEA A;  4M6Y A;  2Z33 A;  4A3I J;  2NS0 A;  3G71 I;  2NVU B;  4I76 A;  4XLC A;  3Q0W A;  1DQU A;  2JMW A;  5DCM A;  3JRC A;  1SVL A;  4KIT B;  4IQJ A;  3S1M J;  2VJ4 A;  5E1Z B;  3CP8 A;  4ESB A;  2DFI A;  1WI9 A;  2O0Y A;  1MGT A;  2GOX B;  5TIS C;  3ABT A;  3HOS A;  4IPA A;  1FX7 A;  1MMN A;  4UVC A;  1D0Y A;  4FT8 A;  4A3D J;  3FBI B;  4Q4Z F;  5BMZ A;  2KP6 A;  4IEJ A;  1VTN C;  4M3E A;  2DPD A;  3HHG A;  4PJJ A;  1OIS A;  1UCR A;  1JXS A;  2ETH A;  1FBU A;  1MJB A;  3LQQ A;  5J8F A;  2JRT A;  3ULQ B;  2NOG A;  2W85 A;  3H9G A;  2AS5 F;  1K7A A;  5TJJ A;  2DYS H;  2ICW G;  3K6G A;  4XKV A;  3WTU C;  5FFX A;  4AVZ A;  4NQW B;  3DKX A;  4IHX A;  1I39 A;  3UNG C;  2GOM A;  1KU3 A;  2GM4 A;  3V4G A;  2ZNZ A;  5B1B H;  1MH4 A;  3WTW C;  2JVG A;  3LOC A;  2JSC A;  4E7S A;  3EUA A;  3JTH A;  3CF5 F;  1DGW Y;  4A3B J;  3HDD A;  5AIP A;  3CCY A;  4IL6 C;  1RPW A;  5JI6 A;  1UST A;  2YX4 A;  2KT0 A;  1FSE A;  1V4R A;  3U1K A;  3H0D A;  4MO7 A;  4IOC F;  4EJT A;  1FWZ A;  3HRM A;  1RUN A;  1WPK A;  1WVR A;  1TNT A;  4PJ0 C;  1Z9C A;  2O9L A;  2JVH A;  4BNC A;  3JAM Z;  5D5X B;  1A6Q A;  3QYF A;  1ZGW A;  1TWA J;  4F55 A;  1FPQ A;  3GF2 A;  5KAF C;  3MKZ A;  1WJE A;  2DA2 A;  2DJI A;  2VXZ A;  5CKT A;  2IEK A;  2WV1 A;  3H3U A;  1EA3 A;  2VQL A;  1IC8 A;  1YX3 A;  5IT3 A;  2FBI A;  4G6D A;  3WU1 B;  3SHF A;  1YE9 A;  1I27 A;  1H9T A;  1FZP B;  4C30 A;  1QO0 D;  2MD5 A;  4RB0 A;  1IUF A;  2YSR A;  4WXH A;  2CQN A;  3QPT A;  4GYG A;  4IRI A;  1V55 H;  3BT9 A;  5IP9 J;  3BTI A;  3H1C A;  1RKW A;  4XSX F;  1X2M A;  4LK0 F;  4C3I J;  2M4G A;  1LKX A;  3WU2 C;  1D5V A;  3A4C A;  2JQ7 A;  3HOX J;  2EFP A;  1D5Y A;  5D6E A;  1OCC H;  4X6A J;  1K6Y A;  2BW3 B;  2IGN A;  4S0H B;  2LY1 A;  2MGQ A;  3T0Y A;  4M9Z A;  3O6B B;  1U3E M;  2BYV E;  2E36 A;  1U9O A;  4DZP A;  4MTE A;  2GQQ A;  3HPG A;  4Y15 A;  4CCK A;  1IDY A;  2GAU A;  4GCV A;  2VC0 A;  3RZO J;  3FF5 A;  1ACI A;  2W82 A;  2L01 A;  3M8J A;  4D5C A;  3L09 A;  2QUF A;  1I50 J;  4XN0 A;  3LSI A;  4R79 A;  1RI7 A;  2L9V A;  4AIH A;  1OR7 C;  4W1U A;  2VON A;  4R8H A;  4HDV A;  3DTE A;  4E70 A;  3UKG A;  2IGO A;  3K1P A;  3ONQ A;  5C4J J;  3ZMZ A;  4RS8 A;  1Z67 A;  3H0G J;  4YEJ A;  3WU0 A;  1G3Y A;  4PSW A;  4NC6 A;  6PAX A;  1FNN A;  3RZD J;  2LF8 A;  2E1C A;  2CU7 A;  2R7Q A;  3CC2 I;  2EB7 A;  4XLA A;  3ESW B;  3C2B A;  3LFK A;  2X0L A;  1XSV A;  4WK8 F;  5EDN A;  2DW4 A;  4AID A;  4ESF A;  3H3V K;  2VE9 A;  2XSJ C;  1FYL A;  2HEO A;  4JX4 A;  1BW6 A;  4AYB N;  2HNH A;  4IRG A;  5KAI C;  4HF0 A;  2VXD A;  4CH7 A;  3EDP A;  4DJA A;  4CIC A;  5FFZ A;  2H8R A;  1J75 A;  2DLL A;  3K7A J;  4E7J A;  2W48 A;  1PJR A;  1S7O A;  3GFL A;  1FP1 D;  4JOM A;  5FKK A;  3M3Y J;  2FRH A;  1Z1D A;  3JRD A;  2X6W A;  1Y56 A;  1OR7 A;  1UMQ A;  4GYI A;  5E1X A;  4CO8 A;  2ZJP F;  1EH6 A;  4G94 A;  5F1R A;  4GO1 A;  3CJT B;  3H5N A;  4BQN A;  2FNA A;  3K4J A;  3OMY A;  1JHH A;  2M7A A;  3SZG A;  4O3M A;  5CVI A;  2XRO A;  3L2C A;  1YS6 A;  4N9I A;  5HDN A;  1MMD A;  1BR4 A;  3QU6 A;  5AON A;  4V19 K;  2D1V A;  2HKO A;  3RYR A;  1T38 A;  2O61 A;  3HGG A;  3RQI A;  1IXR C;  1BOB A;  5EGO B;  2K02 A;  2HI3 A;  1VZ0 A;  5E1W A;  1WHU A;  3MKW B;  1MNM C;  3IKV A;  2V6E A;  3HGY A;  4BEH A;  2P8T A;  4LMY A;  1NK2 P;  1VF9 A;  1WH7 A;  3DBR B;  4ZTF A;  1KU7 A;  2K7L A;  1O7F A;  4XMY A;  4FHT A;  4FIS A;  3HBL A;  3KIO A;  3QYB A;  1W7P D;  2WTE A;  1ZG5 A;  1MBH A;  5F0H A;  1CF7 B;  2E5Z A;  3WTX C;  3FK6 A;  2STW A;  3GLL A;  2AHQ A;  2L7M P;  2NNN A;  4NUB A;  2BY2 A;  1T33 A;  3KP7 A;  4HNU A;  3D1N I;  4IKF A;  3CCS I;  2TDX A;  2F5V A;  3R4K A;  5FLX Z;  5EG0 A;  1V5E A;  1JT6 A;  2BGC A;  3WGI A;  1JGG A;  2HQA A;  2XKO A;  1TBX A;  5IY5 H;  1QBJ A;  3OYE A;  1YW9 A;  4CYC B;  2QBY B;  2CQQ A;  5GPC A;  1E0E A;  1D0Z A;  5J1U A;  3OS0 A;  2QEX I;  1U5T C;  5A2Q K;  1B8I B;  4EQQ A;  1KU2 A;  1TWG J;  2J5O A;  2ELJ A;  1FOW A;  1EJ9 A;  4RLF A;  1ON2 A;  2NAZ A;  5HS8 A;  3P5J A;  4K2E A;  1A04 A;  2NVY J;  3KEO A;  3I3L A;  2BZT A;  2E1M B;  2QWW A;  3I59 B;  3WE3 A;  1YJW I;  5EEG A;  3S2W A;  2K85 A;  4Y17 A;  5A2Q Z;  2DFF A;  2F5C A;  2PJR B;  1OMI A;  1GUU A;  1Q1V A;  3I64 A;  2O7O A;  3SFZ A;  1K61 A;  3LSM A;  1ITY A;  2H6B A;  1BM9 A;  1GVJ A;  2HOA A;  3E7L A;  1T08 B;  4CCO A;  5LGT A;  1MMG A;  5DCM B;  3K10 A;  2DOE A;  4ZJZ A;  2V9K A;  3HKZ N;  1YLF A;  1Z77 A;  4I09 A;  1B6A A;  3IP4 B;  3R0A A;  1DPR A;  2KLO A;  1ZR4 A;  1R9T J;  2XF6 A;  2OTJ I;  4B1R A;  3I9V 2;  3MZH A;  2GXB A;  5L3B A;  1YOV B;  2BBY A;  1WJC A;  2CWE A;  2O03 A;  3HRU A;  3K2A A;  1LEA A;  2E60 A;  3HJE A;  4XLF A;  5J40 A;  3G4S I;  2X1E A;  2KDZ A;  2WV0 A;  3ZGK A;  3L2V A;  1VQ5 I;  2PJR A;  3JSO A;  3M9A A;  1YTY A;  2OCC H;  1Z05 A;  3VYR B;  3F23 A;  1ETO A;  2LF7 A;  1GV5 A;  5ICE A;  3BR5 A;  3I4N J;  2M1B A;  4RMN A;  3Q9V A;  2NOJ B;  3HM5 A;  2EA2 A;  4A3G J;  1DU0 A;  1X58 A;  4ZDL A;  4B43 A;  2EIM H;  4UV8 A;  1O4X A;  2HQ5 A;  1P7J A;  2IA2 A;  1B9N A;  2DT5 A;  2ZXI A;  3RKQ A;  4IRH A;  4LLG F;  1UZC A;  4BAC A;  3JRF A;  2Z5U A;  3T8T A;  2I10 A;  2GIV A;  4JK1 X;  3H36 A;  3ZOB A;  1USS A;  4L5I A;  1U5T A;  3GXO A;  2HQR A;  5F6F A;  2VI6 A;  2Y75 A;  2R7W A;  5EYR A;  3ZMD A;  5DS9 A;  4A0X A;  4BHP A;  1H0M A;  1B9M A;  2ZSI B;  3F8N A;  2VE8 A;  1XSX A;  1MKM A;  2DTR A;  3FXU A;  3ROU A;  4PGG A;  3MWM A;  2L7K A;  3W6J B;  4CZZ A;  1IDZ A;  2RDP A;  1X1P A;  1G3W A;  2CMP A;  4ZTJ A;  5E18 F;  3GCM A;  3I58 A;  2XGD A;  3DU5 A;  3PIO F;  3AG4 H;  3DEE A;  2F5D A;  2E1O A;  4OMY A;  1UG2 A;  2R7O A;  1PUF B;  3ML6 A;  1ZKG A;  2JPC A;  2ECB A;  1GVD A;  3P7N A;  1VQ6 I;  4LB6 B;  2MFZ A;  1MJ9 A;  4Z2Y A;  4G6T B;  3KET A;  2ZME B;  4HA8 A;  5EF6 A;  2HVS A;  4N9H A;  3LA3 A;  4M72 A;  1TWC J;  3RPU D;  2HOS A;  3LSH A;  2K27 A;  1YYV A;  3MZ8 A;  4JP0 A;  1UJ8 A;  2KJC A;  2QQB A;  3K1M A;  4D0P A;  5FO5 A;  2X4H A;  1FC3 A;  2HYF A;  3FK7 A;  3LSK A;  2HXI A;  3BTC A;  2OAZ A;  2IRF G;  4L0Y B;  1TZL A;  1V3F A;  3CUQ B;  4CZC A;  3RKW A;  3D5S C;  3SJM A;  1LEB A;  1FOX A;  3BCA A;  2EV5 A;  4BBS J;  2MC3 A;  1G59 A;  3G1O A;  1X3U A;  2GIZ A;  1K79 A;  4BHC A;  3QPS A;  4IZZ A;  4A3F J;  1JJ6 C;  1BC8 C;  2W84 A;  2RNJ A;  4Y3O A;  3IL2 A;  4UVB A;  1ZRF A;  3OYK A;  3DLA A;  2DXI A;  2ZJ2 A;  3VOD A;  2NVQ J;  2HDW A;  3J7Y J;  5IPA A;  3ZQG A;  2DBB A;  1LFB A;  3RCO A;  2HDC A;  3N4M A;  3E0J B;  1BA5 A;  2DMU A;  3RDI A;  3OS1 A;  1VQM I;  1SD4 A;  3BR6 A;  3I71 A;  3QU3 A;  4F52 A;  1XC5 A;  4XRS A;  3D5L A;  3GW2 A;  2L7F P;  1HOM A;  4B8X A;  2FX0 A;  2Q2E B;  1O57 A;  1EV7 A;  1UB9 A;  2VIX A;  3OIQ A;  5GAE J;  4FX4 A;  3C1D A;  3QYE A;  3CCL I;  2VPL A;  2BHY A;  2FJ1 A;  4D7M A;  5IP6 A;  1GXQ A;  1QPM A;  1HW1 A;  4J19 A;  5IT9 K;  3K70 C;  2BXY A;  2EH3 A;  1JTY A;  2EIL H;  2QLZ A;  1F5T A;  2VBW A;  3O2P E;  2H27 A;  1REP C;  4XON A;  1W5S A;  1VFC A;  1BI0 A;  1TQM A;  3OYC A;  4AVP A;  5EZH A;  2P7V B;  2WY8 Q;  3FXJ A;  2MLK A;  2KKO A;  5KHD A;  1JTX A;  1RZ4 A;  3CDL A;  1U6G A;  2VJJ A;  3ELK A;  2CUF A;  4UB6 C;  4XLN F;  3IH3 A;  4CDG A;  4EJO A;  1J2X A;  1AOY A;  4M71 A;  3G73 A;  1XGO A;  4A6D A;  4KUM A;  5CVU A;  2PBI A;  2D2W A;  1LVK A;  3OYF A;  1RIO H;  5HVQ C;  3BG3 A;  2V9P A;  1VQK I;  2K9S A;  2NXN B;  2RAE A;  3T8R A;  1IV6 A;  3ISP A;  2VPR A;  2RN7 A;  1SD5 A;  2FBK A;  4IJA A;  1LB2 A;  4XKW A;  1KQ9 A;  3D5R C;  3PO2 J;  4PFO A;  3ABL H;  1HW2 A;  2KRF A;  4BQQ A;  5D5U B;  2E2H J;  5CVV A;  4E6K G;  1W0T A;  4HX4 A;  3A2K A;  1Y0N A;  3QRF F;  5HS7 A;  2N8G A;  2NVT J;  5FLX K;  2VAS A;  2WC2 A;  4CUG A;  2EZK A;  4B44 A;  2R7T A;  1E17 A;  1E3P A;  3PJR A;  1N25 A;  1QZY A;  2ZXH A;  5F1J A;  3AKZ A;  3J80 Z;  1H89 C;  2DT6 A;  2WB1 A;  1HXD A;  1HDP A;  2RQP A;  3S2D J;  3V42 A;  3AG2 H;  1G3T A;  3DPL C;  2ZSH B;  4KN7 X;  1S3J A;  1P9Q C;  4NDL A;  2O5R A;  1OCP A;  4AC0 A;  4KMF A;  3RPQ A;  1IO2 A;  3BR0 A;  2H8W A;  5J6X A;  4MFE A;  1Z6R A;  2XAQ A;  2ZME A;  3W6V A;  2D1H A;  2MH9 A;  4HYE A;  3CCU I;  2JA5 J;  4XLP F;  4G12 A;  2DFH A;  1ZTR A;  3K0L A;  4IVN A;  4ENM A;  3BZK A;  5LLQ A;  1A31 A;  1HLV A;  3JR9 A;  4FAS D;  3MAJ A;  2Z16 A;  4MEX F;  5F27 A;  1FMW A;  4PGH A;  3V7C A;  1Y0U A;  4C2T A;  2DMT A;  2XKP A;  2OCE A;  4CCJ A;  3ZCO A;  2XAF A;  2R5Z A;  2FSW A;  4HSR A;  2ELK A;  5B5E C;  1A36 A;  2NS7 A;  4BE0 A;  4EJU A;  3OL4 A;  1FBS A;  1X2N A;  1YW7 A;  3OOP A;  2XGE A;  2DK8 A;  1IRZ A;  3GYH X;  4PSX A;  3TOA A;  3Q3S A;  4XKC A;  1HC8 A;  3FMS A;  4RGU A;  4EM0 B;  2ELH A;  1R5G A;  3HUG A;  2RRE A;  1P4W A;  1S9H A;  2A68 F;  4E7K A;  2VBX A;  2Y2Z A;  1WCM J;  4IHW A;  1IW7 F;  1MBJ A;  4HAM A;  2DK5 A;  2F2E A;  4V2G A;  1UHM A;  1HKT A;  2MW8 A;  1VQO I;  1EKE A;  1DDN A;  4F3Q A;  4F92 B; 
#chains in the Genus database with same CATH homology
 2WBM A;  2LY1 A;  2Z2S B;  3OYL A;  2LG4 A;  3FKJ A;  4F93 B;  5KNL A;  4CCK A;  3HPG A;  1X1B A;  4C9Y A;  2DOA A;  1X1A A;  2W82 A;  4BEH B;  2BVM A;  3M8J A;  4XN0 A;  2L9N A;  3LSI A;  2HU9 A;  4R79 A;  4DGW B;  1OR7 C;  2KMU A;  2KRH A;  3VYT B;  3DTE A;  3AL0 B;  2IGO A;  3NWT A;  3ONQ A;  3VSL A;  4YEJ A;  4PSW A;  2V4J C;  2R7Q A;  4LIU A;  4XLA A;  4LIV A;  4NC7 A;  4II3 A;  1WJF A;  2W4S A;  3L2R A;  3F9K A;  2QKL B;  2XSJ C;  4FET A;  2VQH A;  3BC8 A;  1Z21 A;  2HNH A;  3OYA A;  3OYH A;  2VXD A;  4CH7 A;  2W00 A;  2M4K A;  4DJA A;  2JSP A;  3H9J A;  1Z7L A;  1Z3X A;  4NC8 A;  2IS4 A;  4YRV A;  4BE1 A;  4E7J A;  1PJR A;  2MC4 A;  4JOM A;  1WJB A;  1Y6I A;  2CS3 A;  2X6W A;  1Y56 A;  5FRO A;  4Y33 A;  3FBN B;  3KEY A;  3H5N A;  4BQN A;  2BOL A;  3K4J A;  3OMY A;  1TT0 A;  3QOE A;  4EAT A;  2M7A A;  4HNT A;  4HPQ A;  3SZG A;  3DTI A;  2WAD A;  4N4N B;  1MMD A;  1BR4 A;  3A1Y A;  3DWL E;  3W3C A;  3PUB A;  2HPM A;  4XN3 A;  3DPT A;  4E7H A;  4GRI A;  2BW3 A;  2L2O A;  3BCB A;  4II2 A;  3LSG A;  1BOB A;  3OYB A;  1VZ0 A;  4D9J A;  1N75 A;  4DOZ A;  3MKW B;  2V6E A;  4BEH A;  3PNT A;  4HEA 2;  2OV7 A;  4QPQ A;  1UG0 A;  4ZTF A;  3BLY A;  4BDY A;  3MKY B;  4XMY A;  1UAA A;  2X6Y A;  3OYD A;  3QYB A;  2CV1 A;  2E5N A;  2E5Z A;  4KJZ A;  3W2A A;  2A5W A;  3OR1 C;  4DBR A;  4NUB A;  4OAZ A;  4JQF A;  4IQ4 A;  1N77 A;  3OYI A;  3BG6 A;  4HNU A;  4IKF A;  4PUS A;  1BR2 A;  2CW8 A;  2F5V A;  2XC7 A;  1V5E A;  3H9Q A;  3ZQQ A;  2HQA A;  2I8D A;  1X1D A;  4E7Z A;  3PL8 A;  3OYE A;  3EUK L;  3U21 A;  3M1C A;  3K4N A;  4XQF A;  1E0E A;  4E7I A;  1D0Z A;  2KHM A;  3SYT A;  4DBQ A;  3OS0 A;  3EUH C;  3IUO A;  4E4H A;  4LIT A;  3BG7 A;  4BJ6 C;  2HVR A;  4HG2 A;  2E1M C;  2RNG A;  4BQO A;  1WJ5 A;  2IGK A;  2DT7 B;  2ELJ A;  4RLF A;  3UR3 C;  2VLA A;  2KRC A;  5TGT A;  4PJM A;  3ZRG A;  3I3L A;  1HA8 A;  2E1M B;  3CP2 A;  4CA0 A;  3MD2 A;  3SDB A;  2F4I A;  3J7A Y;  4ZDP A;  2PJR B;  3K4M A;  2A6T A;  1Z3Y A;  3LSM A;  4CCL A;  3EPZ A;  4F91 B;  2VB6 A;  4CCO A;  5HLT A;  1MMG A;  1W36 C;  1W36 D;  3K10 A;  4ZJZ A;  4N4O B;  2V9K A;  3RTR A;  4OWR B;  2MAB A;  2R7V A;  2PMZ A;  3IP4 B;  4ANJ A;  2XDV A;  2OC6 A;  1IRX A;  2KLO A;  3L2Q A;  2XAU A;  2XF6 A;  3I9V 2;  2CH0 A;  2OUM A;  3CES A;  3RSN A;  4D1Q A;  1WJC A;  4XLF A;  3PNV A;  4MLO A;  2E60 A;  4XOR A;  2X1E A;  3ZGK A;  2LY2 A;  3L2V A;  3S3N A;  3VYS B;  2PJR A;  3VDX A;  4B48 A;  3DKY A;  3QOD A;  3VYR B;  4XLE A;  4PJN A;  1MMA A;  2V7F A;  4PJL A;  3IAM 2;  4RMN A;  2NOJ B;  2LRD A;  1V5F A;  4ZDL A;  2IS1 A;  2K9L A;  4OAY A;  4B43 A;  4E7L A;  4QPO A;  1LFP A;  2HVQ A;  1QHG A;  4ZC3 A;  4ITV A;  1DP3 A;  2ZXI A;  2R7R A;  3PSI A;  3AFH A;  4BAC A;  2P0W A;  2LBF B;  3N05 A;  2HZD A;  4XNF A;  3DQV C;  3PFY A;  2CUJ A;  3E1S A;  3OL3 A;  2VQC A;  4XM3 A;  4XR6 A;  3HXL A;  1PYV A;  2KDO A;  2R7W A;  5JHF A;  4ZYA A;  4J01 A;  1D1A A;  2V26 A;  2ZSI B;  1MND A;  4J00 A;  2Y0S A;  1D1C A;  5CQG A;  3HKZ A;  3NWS A;  3OYM A;  1JI8 A;  4PK4 A;  2K5C A;  1OLT A;  3OYG A;  2L7K A;  4XLH A;  5HNF A;  4P5O A;  3PSF A;  4XOT A;  2CMP A;  4X0G A;  3ZR8 X;  4ZTJ A;  3L2W A;  2Z1D A;  2QKM B;  3LMM A;  2WA0 A;  1R6R A;  4BE2 A;  3DU5 A;  3DEE A;  4CCM A;  3HL2 A;  1SFK A;  3S93 A;  1D0X A;  1J09 A;  2R7O A;  5LD2 C;  2MD0 A;  3K4B A;  2WAQ A;  2ZFU A;  1FMV A;  2X1D A;  2AQF A;  4P1W A;  4XKB A;  1WJD A;  4HST A;  4KIS A;  2MFZ A;  3K4K A;  1V5G A;  4G6T B;  1SAU A;  3ZXS A;  2HVS A;  3AL0 C;  1WJA A;  2LOO A;  3RPU D;  3LSH A;  2R7X A;  3KX2 A;  3PNY A;  2FUG 2;  3CJQ B;  2MYS A;  1DGR M;  3SEQ A;  4BS9 A;  3LSK A;  3SEZ A;  5HNH A;  1TZL A;  3H5R A;  1WFX A;  3DTK A;  3W2V A;  2LRE A;  3HPH A;  4U87 A;  2XF5 A;  3HG9 A;  3TMO A;  4CZC A;  3RQ4 A;  3D5S C;  4AU7 A;  2HPI A;  2KZV A;  3BCA A;  2AQE A;  2CW7 A;  4AYB A;  1D1B A;  1G59 A;  2CV2 A;  1GLN A;  2WAF A;  1QU3 A;  3S3O A;  1YX5 A;  4IZZ A;  3GBG A;  2M7B A;  3S3M A;  2K3P A;  2X51 A;  4Y3O A;  3CMM A;  4IX7 A;  3OYJ A;  2VJ5 A;  3OYK A;  2M3A A;  3DLA A;  3MMY B;  2DXI A;  4BXF A;  3FHN A;  2M0M A;  5KCM A;  2WAE A;  4XOP A;  2HDW A;  1N78 A;  2X85 A;  4ZDO A;  3S32 A;  3OS2 A;  4KT6 A;  3RCO A;  2X1C A;  3OYN A;  2BVL A;  3E0J B;  1NG7 A;  3TL4 X;  4H4K C;  3OY9 A;  1X19 A;  4B3X A;  2IXS A;  3OS1 A;  2IGM A;  3DPU A;  4F52 A;  3D5L A;  2L9S A;  2K9M A;  3TBI A;  3S8P A;  2Q2E B;  3OIQ A;  2VIX A;  2KQR A;  2VKH A;  3QYE A;  4B47 A;  3L2U A;  2R7S A;  2VPL A;  3IAS 2;  1X1C A;  2R7U A;  3H5A A;  5LFA A;  4HRI A;  4BL0 B;  3K70 C;  3VSK A;  4NNJ A;  1U0J A;  4CSW A;  4XON A;  2RQQ A;  4BJ5 C;  4CCN A;  3OYC A;  2W7N A;  2WY8 Q;  2CUZ A;  5KHD A;  1BR1 A;  2UUZ A;  2V1N A;  5HOO A;  2VJJ A;  2JUG A;  5CQE A;  4BDZ A;  3HOT A;  3HUG B;  2LC2 A;  3C2G A;  3DU6 A;  4YEL A;  4PFP A;  1QHH D;  4XLC A;  1DQU A;  3OIP A;  2LBF A;  4KIT B;  4IQJ A;  2VJI A;  2VJ4 A;  3CJR B;  3CP8 A;  1LVK A;  3OWT A;  5FRM A;  3OYF A;  5HVQ C;  2GOX B;  4BJT A;  3HOS A;  1MMN A;  1D0Y A;  4DIQ A;  1ERD A;  3FBI B;  2KP6 A;  2Q1Z B;  4XL9 A;  5CPR B;  2JA2 A;  3OOU A;  4XKW A;  3D5R C;  1MW7 A;  4PJJ A;  4PFO A;  4BQQ A;  4LG3 A;  4C2U A;  4E6K G;  3G2B A;  3H9G A;  3A2K A;  3OR2 C;  2X6X A;  3K6G A;  4XKV A;  4AVZ A;  4NQW B;  3DKX A;  2VAS A;  3CZ6 A;  4CUG A;  1T95 A;  3LFU A;  2XF7 A;  4B44 A;  2KPM A;  3UNG C;  2GOM A;  2CV0 A;  2R7T A;  3HC7 A;  1NG6 A;  2JVG A;  3PJR A;  2ZXH A;  3AKZ A;  2IS6 A;  4E7S A;  1X4O A;  3EUA A;  2WY7 Q;  2DT6 A;  3K4C A;  1DGW Y;  2W1O A;  2IS2 A;  2WB1 A;  3KYL A;  3VYU B;  3K4L A;  3V42 A;  5FRN A;  3H0D A;  2ZSH B;  3DPL C;  2UWM A;  1P9Q C;  2O5R A;  3W2W A;  4BUP A;  2CFO A;  2JVH A;  1KON A;  2LH9 A;  2KL4 A;  4RM2 A;  4RLQ A;  3K70 D;  2VKD A;  3QYF A;  4BU2 A;  4F55 A;  3MKZ A;  1WJE A;  2DJI A;  2VXZ A;  4FAS D;  2Z16 A;  2F6C A;  2R4G A;  1AA7 A;  5CKT A;  1FMW A;  4U7B A;  4Y4R A;  1EA3 A;  4C2T A;  2VQL A;  1YX3 A;  4CCJ A;  3ZCO A;  3VWB A;  4HSR A;  1YE9 A;  4BGD A;  1T0F C;  2VL8 A;  4BE0 A;  3LL7 A;  4C30 A;  3OL4 A;  1G8X A;  2L5Q A;  4PSX A;  4RM3 A;  4XKC A;  2UV1 A;  2M4G A;  1LKX A;  3A4C A;  2LYC A;  1ZEL A;  2RRE A;  3CF2 A;  1S9H A;  4E7K A;  1LDK B;  3FDY A;  1MNE A;  1K6Y A;  1X4P A;  2BW3 B;  2DCE A;  2VQG A;  2IGN A;  3C2H A;  3H35 A;  1UEL B;  4F3Q A;  4F92 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...