2KPMA

Solution nmr structure of uncharacterized protein from gene locus ne0665 of nitrosomonas europaea. northeast structural genomics target ner103a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A
rcsb
source organism Nitrosomonas europaea
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kpmA01
2LH9A 2KZVA 2LY1A 2KPMA 3S93A 2LY2A 3RCOA
chains in the Genus database with same CATH superfamily
1T0FA 1WI9A 3L2CA 4C2TA 3CMEI 3S17J 3VYRB 1R23A 4C2MJ 2KMUA 4AWXB 3OYHA 3BDDA 2HDCA 5GP9A 3DTIA 2W85A 2NAZA 5TRDA 1NK3P 3FXQA 1KU9A 4HV6A 4LITA 3P9IA 5ICCA 3KP3A 2L54A 2R7RA 3CO7C 3HPGA 4WX9A 4JX5A 3CCYA 1UAAA 3GBGA 2EZHA 4RB0A 3H9QA 3SYTA 4B8XA 2HR3A 4BYYA 1ETWA 5FO5A 3KP6A 2OZUA 3GZNB 2ID6A 1RR7A 5D8LB 2VPLA 3RSNA 1YE9A 2PBIA 4I09A 3U1KA 3I53A 1E3HA 2WY8Q 4F3QA 5EGOA 2KIFA 2IW5A 1KU3A 3VYTB 3O2PE 5FJ8J 2ZJPF 3BY6A 2COMA 2CW0F 4MTDA 2XASA 3HJEA 3HOZJ 2VC0A 4XICA 1Y0NA 2VT2A 1ZGAA 2UZKA 2F4IA 2A6HF 2X4HA 3CCEI 1ZRFA 1F4KA 3PIPF 1UHMA 2CQQA 3QOPA 3JRCA 2HEOA 4MO7A 2LFBA 5FKLA 2IAIA 5GADJ 1K61A 4M6YA 1ZN2A 2MLKA 4ENNA 1FTZA 4FHTA 3DBLB 3K69A 4IXAA 3QYFA 3JCUC 3M3YJ 2DMUA 3LSHA 4KICA 2VL8A 1MNDA 1ZG1A 1R71A 2GQQA 2H6BA 5F0CA 1QPIA 5H6RA 4GO1A 5LBQA 5F0HA 2LKPA 1OKRA 3GZ6A 4A0XA 3GTOJ 3KP4A 3WE2A 5EJCA 3PQJA 4ABZA 2E1OA 2E34A 4ZZDA 3GMEA 1IXSB 5HS9A 3SJMA 5K5RA 4ENKA 4U0WA 2MG4A 3DPTA 1TZLA 1EA3A 2LP0A 3D5LA 1Z91A 2MC4A 2C6YA 4BEHA 1DP3A 3HTUA 1H0MA 2OV7A 1T56A 4Y13A 2XAHA 2AS5F 3CZ6A 2L9SA 1SD4A 2M9HA 3VSKA 2L2OA 1FBSA 5FLMJ 3CCSI 2A5WA 1XGSA 3KPHA 4AIKA 1EJ9A 1NH3A 1QPMA 1FY7A 4C2UA 2R7OA 1LJ9A 4RA2A 4HBLA 5J8FA 1L3LA 3HUGB 5D6EA 5ICEA 3BG6A 5DDGA 2L0KA 3HZJA 3I4PA 2R92J 1AU7A 2QQ8A 3BCBA 2KZVA 2ZJ2A 4BS9A 1XMKA 4F52A 2EPFA 2KIUA 3SHFA 4I02A 2DYSH 2HXIA 5H20A 3I0TA 1P7JA 2L7KA 3O6BB 3C7JA 1V55H 5IYBJ 1TL8A 2K4BA 1B1BA 3RJPA 4A6EA 1IZ1A 4A3JJ 1MDMB 3ZQFA 1SFXA 3CMAI 2WC2A 1BIAA 1Y1VJ 1Z0XA 4L5JA 3CTAA 4NC6A 3BP8A 1ZAOA 3K1MA 1MNEA 5TJJA 3D5SC 1JE8A 1ZYRF 1OCRH 4C3IJ 3CDHA 1MSFC 1BL0A 3MD2A 5JHFA 5IY5H 1P4AA 2CFXA 2RKHA 3LSRA 3LQRA 3M8EA 3BCAA 3PUFA 4EM0B 5FRNA 3HOUJ 4G12A 4M3FA 3ABMH 1WH5A 2QGUA 5JR3A 1ACIA 5TISC 1N25A 1OYWA 4ON0A 4A3CJ 1FLIA 4Y15A 3ISPA 3LSIA 3QP5A 4Y52J 4HF1A 3H9JA 2LBFA 4CYDA 3LSPA 4ZTJA 2X6OA 3IHUA 3LFKA 3HL2A 1LQ1A 1XB4A 3TDUC 5C4JJ 2M8EA 1BIBA 2HQ5A 5FFXA 1W36D 3HPHA 2OQRA 3M1CA 3BR3A 1MNMC 3E5QA 3BTIA 4BY1J 3S3NA 2HTJA 2WTEA 5DM7F 3FXKA 2KRHA 5GPCA 1OR7C 2AQFA 3VPRA 5BOXA 1ETYA 5HDKA 2GIVA 3E97A 3DP7A 2B9SA 4RAZA 1ZRDA 2I8DA 1Z3XA 3KFWX 3H1CA 1JTYA 2BHZA 1W0TA 1RRJA 2VKVA 1FZPB 2UUZA 2R7UA 1S72I 4MIMA 1ZK8A 2K3FA 2DA6A 4PUSA 4BJ6C 2ZMEA 1J09A 3OYEA 1ZHFA 2BOLA 1SD5A 3JRFA 1MMDA 3DPUA 4MFEA 1P4WA 3CF2A 5FD5A 2ZNZA 4D7MA 1UHSA 3GTQJ 3LNQA 3HHGA 4A3KJ 3CDIA 2A5YB 1SAUA 4LLNA 5D8KB 3CCLI 4DOZA 3ZQIA 2CU7A 2AXTC 2R5YB 3HOVJ 2GLOA 1YW9A 3HXLA 2QLZA 3S14J 3T8RA 4CCMA 1B72B 4ZDLA 3JRIA 1UHWA 1YIOA 3FMQA 4HNTA 5KK1A 4Y7NJ 1POGA 5FKNA 4FQGA 2QKLB 2X1CA 5DD4A 3QPTA 3H3ZA 1BI2A 1EV7A 4BQNA 1BW5A 1DU6A 2QZ8A 2HPMA 2I10A 2HZTA 4NUBA 2MA3A 2Q2EA 2KZGA 4XMYA 3PJRA 1O4XA 3HGGA 1TNTA 2VN2A 1FSHA 2OUMA 2KRCA 1U8RA 3E6BA 5CYVA 3FXRA 5E20A 2DI3A 2PMUA 3V8KA 1XCBA 4BE0A 4DYQA 5K5QA 4BE1A 3I4MJ 3G3ZA 3ZQHA 1ETVA 3CP2A 5L3FA 3X2QH 5LEJA 3K7AJ 1J7KA 5FD6A 4CA0A 1SEUA 3WG9A 2GXBA 4ZH4F 3CQZJ 4ETSA 3DXJF 1GXQA 1RKWA 2M4KA 2L9NA 4GFBA 2K85A 2FX0A 4EGYA 3ABTA 3A01B 5D4RA 2EV5A 5IP9J 4CCKA 1LFPA 2HTSA 3OYGA 3EDPA 1E0EA 1VTNC 2EIKH 1BM9A 2HOEA 2JPBA 1MD0A 2TRTA 2WAFA 2HQAA 4UVCA 1XN7A 3I55I 4LG3A 5F04A 2JA5J 2YX4A 1XX5A 3WTSC 1IDYA 5EDNA 4OAZA 3DU6A 4WXHA 2JPCA 4AIDA 2W24A 4ESBA 2A61A 1ETKA 2WV1A 1PP7U 2XC7A 2LREA 4QLCU 2HOTA 2HDWA 1B59A 1ZLKA 1Y56A 3C3WA 3CMMA 5L3CA 3CMYA 1ORKA 2K7LA 1QGPA 4U0VA 4RLQA 3WG7H 4DJAA 3QOEA 4L9JA 1ZTRA 2LNBA 1U78A 3FK6A 4XKVA 1RPWA 2BVLA 2QM3A 2BE5F 2YR2A 1XG1A 1CGPA 4CYCB 2LOOA 4UVBA 3BG7A 2G0EA 4CH7A 5ILUA 2DA3A 2QA4I 1Y6IA 4ITVA 1FYMA 3SDGA 1N77A 1T2KA 1MJBA 3FK7A 3FWEA 1U5TA 3FKIJ 5HDNA 4PZJA 1J2XA 1ZARA 3GTJJ 1IRFA 4PJMA 3DWLE 2CV2A 1R4NB 3K2ZA 2EIJH 1J9IA 3K6GA 4XLAA 3RTRA 2FU4A 4FTHA 5E18F 2EINH 3LA2A 3I59A 4AIHA 2HYGD 4WXDA 4UB8C 1IO2A 4AVPA 3K1NA 4B4CA 1I1GA 4B47A 4G94A 5HLTA 2V9KA 2YPRA 3R61A 5AIQA 4U7DA 3K70D 3MKYB 1QQIA 5LGTA 1D1CA 3WHCA 4EJVA 1OCTC 2DOEA 3A4CA 3EUHC 2JN6A 2ZCWA 2MABA 4Q5SF 3ABKH 3G2BA 3I3LA 2ETHA 4HEA2 3S93A 3B6AA 1RC9A 1HLVA 3MWMA 2NVQJ 4G7OF 3ONQA 1E2XA 2IXSA 1U0JA 3JR9A 1I27A 1B9MA 2OZ6A 2P81A 2E2IJ 3OOPA 3MKZA 3D5RC 4N9IA 3GCMA 5H6QA 3SZGA 2NOGA 2M2EA 2XIGA 5CPRB 4DNCA 4BXXJ 2V1DA 3H5RA 5DUIA 4E7SA 2Y9YA 5FLXK 2M1BA 3L09A 1PUFB 3E6DA 4A93J 2IA1A 1SMYF 3TKYA 4E4HA 1NK2P 2ESHA 3F8BA 4HA8A 2F2EA 5F0FA 2ZXJA 2H1LA 1WVRA 1W5CC 3NWSA 3OIPA 4KITB 4FETA 3FKJA 2VJJA 4GGGA 2ACJA 1X4PA 3KLOA 3DKXA 3TW6A 3F8FA 1MKMA 2HQNA 2X6XA 4IHTA 1KGSA 2BY2A 3DV8A 4AC0A 1PUEE 2EILH 3KZYA 2GM4A 1M1EB 2DQRA 4XIDA 3R60A 2CGPA 5HLIA 4AM3A 1SD7A 3HC7A 5GPAA 2IEKA 2V1XA 4F91B 3JSPA 4HDVA 3U2RA 1I39A 1RESA 3ESWB 2DLLA 1SFUA 3MFKA 3K4LA 2JTVA 5IYCJ 2CFOA 1VQ7I 1TW2A 3QQAA 5FKKA 2MGQA 4P55A 2P5VA 3HRTA 4XN0A 3MQ0A 2LBFB 1TLHB 2XPWA 3J7ZI 3DLAA 3PL8A 3ECHA 2X1EA 2NVYJ 5JLWA 3PUBA 4I7HA 4P9UA 3LSMA 5J1UA 2K3PA 4OOIA 1XSDA 1TW3A 3RPQA 2FBKA 2E7WA 3LFUA 3L1PA 2WADA 3OYLA 4CZZA 4OIQF 3GTGJ 2EA2A 1I3QJ 3IAS2 1IXCA 3VODA 1FYKA 3ECOA 3TDZC 1MH4A 1NHAA 2HVRA 1GVJA 2XAGA 4AD9A 4GCVA 2HFHA 4M3BA 1PYVA 1JGSA 2PJRA 4F55A 4L5IA 1W7PB 2CQNA 2R7WA 1F36A 3RZDJ 3CDLA 3AAFA 3QYBA 4WCGA 2XGCA 3A03A 3C18A 4U87A 3QAHA 3MKWB 3I64A 1O3SA 1Z1DA 3U9GA 3OYNA 5J1RA 3QU6A 1ON1A 4A5MA 4CCNA 2N8GA 3K4CA 3S15J 3V7RA 3PSIA 4HV5A 3LSKA 2KIQA 4CCOA 2AXLA 2OCCH 3F9KA 1P7IA 3ABUA 3PQKA 2HU9A 4PFOA 2H8RA 1H89C 4W97A 2QKMB 3ZMTA 3GEZA 2KHMA 4B44A 2DYRH 3K0LA 1G2HA 1ZG3A 3R0JA 2O6GE 1AKHA 1GV2A 4BJTA 1DGRM 3I5UA 3BR1A 1Z05A 4IRGA 1ENHA 2G7HA 1C0WA 3BG9A 3OYCA 4AYBA 2CUFA 3G1MA 4DBQA 2ZC2A 2H09A 2IGNA 3FDYA 2LLKA 4UVAA 2BW3A 5JVTA 5B1AH 4HYEA 4BE2A 3I9V2 2KIMA 3CESA 2PEXA 1H8AC 2JK3A 2CMPA 2GZWA 1BN5A 2JA6J 2W84A 2R4GA 4OWRB 3CD6I 4S05A 5L3BA 4X0GA 2KLOA 3I4NJ 1YIJI 4DW6A 2RQQA 1ZGJA 3WTWC 3F23A 2JVGA 2L4AA 2IGMA 3OS2A 4KN7X 3FXMA 2DFIA 2P5KA 2X9DA 3CJNA 5CLSA 3OOUA 1A31A 3TO7A 2F4MB 5AIPA 1W4MA 4KISA 4WWCA 1LFBA 3MCZA 3W6JB 2M3AA 1T6SA 3GLLA 1B4AA 3DPLC 1I1SA 1T98A 3DBRB 2L01A 1TWHJ 4GRIA 4N9HA 4EQQA 5LEKA 1BI3A 1ZGWA 5E8GA 2IA0A 1K78A 4M73A 2EFPA 3B02A 3IKTA 2GWRA 3ROUA 5ILVA 4J19A 1GHCA 2KT0A 2DPDA 5D5UB 1F43A 2VODA 2MH2A 1XGOA 2ZFWA 1FJLA 5DV5A 2A05A 2XROA 4ZYDA 2HGCA 4HNVA 3AKZA 4M72A 3ZGKA 4XBFA 1FBUA 3CLOA 2FOWA 2DK8A 2H8WA 1XSXA 3KZIC 3T1BA 3GTKJ 2ZSHB 3HRUA 3BOQA 4HQMA 4XSZF 4HF2A 4XRMA 1G59A 1H9GA 4KIGA 2GA2A 4R79A 3W3CA 2OPTA 3BPVA 1SFKA 5M3MJ 1QA6A 3DKYA 1WGXA 2MW8A 2FQ4A 2ISYA 3SQNA 3ULQB 1JTXA 2PLYA 4E7ZA 1Z3YA 2E71A 1YTYA 1QO0D 3AFHA 2QF7A 3PNYA 2R5ZA 4Y17A 3HOYJ 2LC2A 2RV8A 2M4GA 4D0PA 1BOAA 3DKWA 3Q9VA 2M34A 2D45A 4YEJA 1S9HA 1MBGA 2H94A 2K02A 3RCOA 4ESFA 1VQOI 2VJIA 4CGZA 2BXZA 2KISA 2BY0A 2CQKA 3IL2A 4LGWA 4PSWA 4HOBA 4OMZA 2W25A 3FHZA 3L7WA 2XGEA 3CC2I 1X1PA 2CW7A 3CJRB 1IG7A 1A36A 4ZDOA 1W5SA 2DN0A 3BT9A 1IN4A 1VQKI 1FOYA 4XR6A 3K4JA 4JP0A 5EZGA 1O3QA 2I5UA 1F9NA 1T38A 3ZN0A 1OCOH 2LG4A 4IRHA 5E3MA 1FEXA 4KIBA 2ZBKA 4A0YA 1VQLI 2KJBA 3E1SA 4IHSA 3QYEA 2K9SA 5K7HA 2GXGA 4X1EA 4MNUA 4LG0A 1S29A 5ED4A 4EATA 3VB2A 4DGWB 3TO9A 3ZMVA 1IN8A 3HKZA 2ZB9A 1D3YA 4NB5A 1NG7A 1BR2A 1O3RA 2ZJQF 3V7CA 2VLAA 3MKLA 1Q1HA 2M5WA 3VFZA 1I50J 2DDBA 1K83J 2VONA 5CVVA 1IUYA 1I6HJ 5EEHA 2EH3A 3HB9A 2Y0SA 3FIWA 2QUFA 2ZXIA 4I2OA 1R4MB 3F22A 5CVRA 2WAQN 3HRMA 3MZ8A 3HG9A 5HDGA 1VF9A 4D5CA 3LA3A 3RIRA 3BTJA 5F6FA 3A02A 1WJFA 3K1PA 5JLXA 1XS9A 2VASA 5GTHC 4FE7A 3BR2A 1TWAJ 3DU5A 1T33A 1EF4A 1YS6A 1TWFJ 2YS9A 2CH0A 4KUMA 3W6VA 1JT6A 2DA2A 5TGTA 4JBAA 3TMOA 2XGXA 5DYMA 3LOCA 1LE8A 2EBIA 5E3NA 2W82A 3CC7I 3R0AA 1E3PA 6PAXA 4PCQA 1IRZA 3U21A 1R00A 2RQPA 4FE4A 1HSJA 3RPUD 1R5ID 2EZKA 5CJ9A 1G3SA 2M0CA 1SVMA 1ZREA 2ELHA 3HEFA 2HWVA 2Z33A 1FMVA 4NC7A 1WPKA 3HGYA 4IOAF 2VIXA 3BTLA 3IH2A 2FRHA 1MJAA 5IT3A 1TWCJ 4G6QA 3ML6A 2EA4A 3GZ5A 3P5JA 4OIRF 4OU0A 2DT5A 5CKTA 3AG2H 2EB7A 3H3VK 3DTEA 2Y75A 2V79A 1OQYA 3F8NA 5J47A 1YG2A 2LTPA 1G3WA 3TGNA 1SVOA 2DA5A 4IL6C 5L3EA 3I58A 4BHBA 2V9PA 3H5AA 2P5LC 3BJAA 1MBJA 1QVTA 2M45A 1YI2I 3BJOA 4YG2F 1LKXA 5FLXZ 5DS9A 3EYYA 3HDDA 5CVIA 4CICA 1ZELA 4FASD 1YYVA 2R7ZJ 5GAHJ 4FX4A 1PVEA 5CVJA 4IHVA 3L00A 5FROA 2FXAA 2XF5A 2XAFA 1Y39A 1TWGJ 1R1VA 4KT6A 4G6TB 1YJWI 2R7DA 1X19A 5K5OA 2NNYA 4G9YA 2M8GX 3N4MA 2XAJA 1U2WA 3EPZA 4F92B 4ZYEA 2E1CA 4IHYA 3ERMA 2VXDA 2X85A 1F1ZA 2IS4A 3FISA 4MHGA 3A1YA 3J7AO 2NYXA 4MEXF 3LSTA 2ADUA 1FOKA 2DJNA 2A3SA 1HDPA 4N4OB 3BG5A 5GTIC 5ICFA 1KA8A 2CSOA 1HBXG 1V5EA 2ZKZA 3FX3A 3V8LA 1AKHB 2DOAA 3GTPJ 2XSJC 1HSTA 2GBYA 4XLEA 4FT8A 2W7NA 4IX7A 2E1MB 3SZPA 1JKPC 3S32A 5GAGJ 5C3EJ 2ID3A 2FD5A 2UXXA 2QEXI 4OMYA 1X1CA 4UB6C 2JUCA 1VQ8I 2IT0A 3JRDA 1PJRA 2QBYA 5KAFC 1WZ2A 2BZTA 5DD8A 1VQPI 3OL4A 1TC3C 3CUQA 4XKWA 5FGMA 5IP7J 4D1QA 2Z2SB 2HPIA 4CXFA 2IA2A 1RUOA 2V1NA 3F8MA 4ZZLA 3L2RA 4IPAA 3GVAA 3ASOH 3M8JA 3NAUA 3PIOF 1X3WB 1S7OA 5BS6A 2DW4A 2PFBA 2VBZA 3IRRA 3JRHA 1JHFA 5HS7A 5M5WJ 4M71A 2LY1A 1BR4A 2CWEA 3OYIA 2MD5A 2DDAA 2PI0A 2ME0A 2VOPA 4BJ5C 1Y0UA 2O8KA 4RBOA 9ANTA 1K78B 2VBYA 2KP6A 2RN7A 1A6IA 1UMQA 5HODA 5JHUA 2XAUA 4BL0B 5EYRA 3W2WA 1YHQI 2L7MP 2LH9A 5D4SA 2O5RA 1MBKA 4L0YB 3M1EA 1WJ5A 3E7LA 2RGVA 1RUNA 2J5PA 1WKMA 5D5XB 2Y69H 1BBYA 1XMAA 3HSEA 4EM1A 2DFHA 3HYIA 1DPRA 3W2AA 2DOFA 1W0UA 2HKOA 3BR0A 5FKOA 3QU3A 1JXSA 4RAFA 3F72A 2AQEA 2BGCA 2Y2ZA 2H6CA 1XGNA 2X6YA 1D1BA 2L3DA 1FIPA 2PMZN 1XDUA 3IP4B 4Y33A 1HKTA 3G6EI 2ISZA 2HKXA 4Y3OA 2HDDA 3AL0B 3H3UA 4RM3A 5DCMA 2CQ7A 5EGOB 4Z2YA 4RDUA 2P7CB 4ANJA 5HLGA 4XQFA 3RQIA 4LK1F 4XNFA 4JK1X 2DQLA 2DK5A 4A6DA 4XLPF 4XSXF 2OCEA 4NQWA 1VNDA 2IGKA 3LMMA 1UG0A 3H92A 4GYIA 4BHCA 2EV0A 3ZQGA 2VOOA 1RIOH 3ZMSA 1S3JA 1YOVB 5ICGA 2Y30A 1Z9CA 3VWBA 1VQ6I 3F6VA 1MBFA 4PJJA 3TO6A 1TNSA 4LLGF 2DO7A 4OIPF 5E8IA 4MFDA 4OAYA 4LG0B 3G73A 3SFZA 2Y48A 1USTA 1OCZH 1UELB 2KDOA 2V6EA 2L9VA 3WU0A 1U9NA 3PO2J 5IOYA 4KYWA 3TP3A 4XL9A 5FB2A 3J7YJ 2LRDA 4EJWA 3TOBA 1DQUA 3H0GJ 5D5VB 1X2NA 2F48A 3FBIB 5FKMA 2R7SA 3OYAA 3RQ4A 3ABLH 2HYJA 2OJED 1W7PD 3NWTA 4HPQA 1WCMJ 4A3DJ 1RZ4A 4CO8A 1FOXA 3W6KB 1L0OC 3FHNA 3D1NI 4XRFA 3WTTC 1WJAA 1VQMI 4U88A 3BG3A 3IC7A 4BEHB 1JKRC 2E1MC 1YRNA 2YSRA 2CG4A 1W1WE 3IWFA 3G71I 1ONVA 1PDNC 1U3EM 1GVDA 2K9QA 2DXIA 3HRSA 1TBXA 4EVIA 2HQRA 1MIJA 2BV6A 3CO6C 3PO3J 1OMIA 2AO9A 3MN2A 4M3DA 1Y8RB 4BQQA 2FF4A 3FBNB 3J80Z 1Z7LA 2STWA 2MH9A 5E1XA 3BTCA 3S1NJ 2P7VB 2OQGA 3KETA 2L7FP 3KYDB 1D8KA 3P9KA 2LDUA 1B8IA 1BJAA 1LE8B 3RKWA 2FJ1A 2OA4A 1HKQA 2QENA 2O7OA 4J01A 4UY8I 2YU3A 2MYSA 1ZR2A 2IS1A 5JVGF 4G6DA 1FBQA 2D5VA 3EQLF 3K4BA 1T95A 5K7ZA 5E17F 5BPDA 2MFZA 2JA8J 2QVOA 3Q0VA 3L2QA 1K6OA 3N97A 5AONA 2Z3YA 3H5NA 3WTXC 3B73A 3WU1B 1USSA 5K7FA 4H4KC 1Z21A 2X51A 1G8XA 1WRJA 2Y0MA 2EFOA 1ZR4A 2B0LA 1X1BA 3GF2A 1HXDA 3QRFF 1OJLA 2V1UA 3GFIA 4UXNA 2FOKA 3KZZA 1P4XA 2CW8A 3OYJA 2QSHX 2OBPA 2PN6A 3H35A 4UUSA 1FP1D 4M9ZA 2LSOA 5D5WB 4JX6A 5HNFA 2OF7A 2O9LA 3DQVC 4KFCA 1IRGA 4BUPA 5FLVA 2K5CA 2ZNYA 1IF1A 3GO5A 4IF4A 5F08A 4IJAA 2K9LA 4WF2A 1QZZA 5LFAA 1T0FC 4D7NA 4MGRA 2NVUB 3IH3A 3K4MA 3ASNH 1STZA 3S1MJ 5C4XJ 3HUGA 3BZ6A 5J8CA 1KONA 3IKVA 1OYIA 4II2A 4MTEA 1CF7A 3M8FA 1IJWC 2IPQX 4ESJA 1X4OA 3ZRGA 4XRSG 2D1HA 5L3GA 1D1AA 4MEYF 2ICWG 2PX9A 2XF7A 4NC8A 1IV6A 1ZH5A 3PSFA 1J0RA 2RC4A 4C3JJ 4QTRA 2E5ZA 2Y0SN 2KFDA 3D0SA 1TP4A 1X58A 5F1JA 4BDYA 3AL0C 4LJZF 4UUTA 1ETOA 5ILSA 3GFLA 3CP8A 2VKEA 1ETXA 5CQEA 4IO9F 4L9NA 3L9FA 1P9QC 2DMTA 3IUOA 4PGHA 3QPSA 1T39A 3LWFA 4ASNA 1MDMA 3HTSB 1DP7P 4XM3A 3NQOA 3ZN1A 3J7AY 4G7ZF 1HW1A 3BJ6A 5EEAA 2CYYA 4ZYAA 3BR6A 1WJBA 4LFUA 5JFRA 1LVKA 2ZMEB 3LA7A 2M87A 1XD7A 2TDXA 2VB6A 4K2EA 5M5YJ 1R5GA 3HOXJ 3ERED 3CC4I 4HX8A 2X6WA 4G8XA 1H88C 4NHJA 4BBSJ 2EJRA 1VQ4I 1HA8A 1ZLJA 1S6LA 4CSWA 4F93B 2E2JJ 2K86A 3ZMUA 2H27A 3CCRI 2JSPA 2KKOA 2Y9ZA 2QBYB 1R58A 1RETA 3NEUA 4JX4A 1X1DA 2MSYA 2HXOA 1KQ0A 1ETQA 3N05A 4Z6YA 5F1RA 4M9SA 1JHHA 1SAXA 4BH9A 1A5JA 3RI4A 3GLXA 3P7NA 4FCYA 1BC7C 2CUZA 3FXLA 3BQZA 2DMPA 5J6XA 3A0HC 2DFEA 3LL7A 2VC1A 4O6JA 4RB1A 3OWTA 1R9TJ 4FISA 4A3GJ 4JYKA 1UB9A 1K7AA 1MSEC 3OMYA 3BR5A 5J1YA 1ON2A 1SFOJ 1R49A 2RNJA 4RGSA 4RB3C 1DPUA 2QSFX 2Q2EB 3V42A 2GOXB 1QBJA 2UV1A 4KT5C 1JJ6C 2X48A 5LLQA 3TW7A 5IP6A 1FNNA 3WODF 2VUMJ 3IV5A 2A6TA 1JT0A 2B63J 1MMSA 4I99C 4NNJA 4D9JA 3I71A 1ZQ3P 4ZDPA 2LR8A 1FPQA 4E7HA 1TTYA 4ZC3A 4B3AA 3E6MA 3HHHA 3PFIA 2DPUA 3CJTB 1IV8A 3S3MA 3SEZA 4GYGA 4XLCA 3L2WA 3ZPLA 3GTLJ 4HSRA 4A69C 4EMSA 4XKBA 2VJ5A 2V9VA 3AG4H 3V7SA 4CCJA 2KPMA 4CUGA 1OISA 1FC3A 1HKSA 4V2GA 4UV8A 1R36A 2XDVA 2DCEA 3TOAA 2R5YA 2A69F 2ZSIB 1FT9A 1YITI 4M6XA 2ECCA 2JA7J 1FP2A 1LUJB 4ENJA 1B72A 1IDZA 1B9NA 1P2FA 4EEFG 2VBXA 1NTCA 5LHIA 1J59A 2IRFG 1YLFA 4BXUA 2VXZA 1K6YA 5M3FJ 2K9MA 2FNPA 3K4KA 4BGDA 2R7XA 4EJUA 1MZBA 1V54H 2HS5A 3O3KA 4A12A 1HOMA 2JZYA 4DYCA 3CCMI 4E7IA 2W48A 4BKXA 1MMGA 4C3HJ 4HRIA 2HYFA 1T8IA 5BPIA 2GAUA 3HIFA 4HSTA 3W2VA 1QNTA 1Q1VA 4YIIA 3GW2A 2VBWA 3FF5A 4PGGA 3SEQA 1K4TA 4KA4A 1OPCA 1R5HA 1BJZA 1BA5A 3AG3H 2XGDA 2K4JA 1WJEA 2QCOA 4ENMA 3I56I 2EK5A 3JREA 4IEJA 4HLXA 3E6CC 3CCJI 2P4WA 2E60A 4PJLA 1R7JA 3OL3A 4DYRA 3GFMA 2DT7B 4Q48A 2HVSA 3IWZA 3MZYA 4DZPA 3J80K 2P6TA 1UG2A 3GXOA 5LGUA 5C44J 1U9OA 3MEXA 2HI3A 1U5TB 2MBFA 3T5XA 4ZTFA 3A01A 1LB2A 1JGGA 4GDFA 4H0EA 3CCUI 3DTKA 1VQ9I 4A3LJ 3BZCA 2IS2A 2CQXA 3Q0UA 3DEEA 1J5YA 4LIUA 4XORA 2R7VA 2O0YA 3JAMZ 1MJ9A 4HX4A 3S3OA 4XN3A 2PJPA 2ZMEC 3G1OA 3OSFA 2VPRA 3I59B 4XLNF 4J00A 2WA0A 1YRNB 4LLLA 2R7FA 5GAEJ 5B3SH 1XTAA 1KYWA 2L4MA 4NDLA 4M3GA 5LHGA 3JW4A 4E7KA 1TQMA 1WI3A 1R6RA 1O57A 2JRMA 2VQHA 2WB1A 4EM2A 2W1OA 4Y4RA 1B8IB 2OTLI 3UNGC 3FM3A 3LQQA 2A68F 2ESNA 1HDDC 1F5TA 3KP2A 3CUQC 2P6SA 1ERDA 4RGRA 4RLFA 1VI0A 2MLGA 1XMXA 1DGWY 1Y8QB 2M0MA 5E3LA 1JI8A 1AA7A 2XPVA 1IUFA 4ZJZA 1N78A 4L5EA 5IYDJ 1IN6A 3OIQA 2EZLA 5EEGA 4ZYHA 3K70C 4YIRX 1VFCA 3EUKL 3K4NA 5EZHA 3F6OA 4I0BA 4CYCA 2VT3A 3RDIA 4EJTA 1DDNA 1DU0A 1IXRC 1E17A 5FRMA 3OR2C 2MD0A 2FUG2 4PJ0C 2Z1DA 5LGNA 1RI7A 4B48A 3WU2C 2RREA 5IT9Z 2JWTA 5KCMA 2F6CA 4UUSB 2V26A 4HZFA 3COAC 3BWGA 4BBRJ 3HOSA 3OYBA 4RB2C 2L7ZA 2ZXHA 3DF8A 4L9TA 1T08B 2DA4A 1FMWA 4BQOA 1IAWA 3P9CA 2W4SA 3UKGA 5K1YA 3OS0A 2HOSA 4KNYA 1EH6A 2WV0A 2F5VA 5L3DA 1G3YA 3IH4A 3HOTA 2QQBA 2XRLA 4RS8A 2Z9OA 1XPXA 1IGNA 1YFHA 1D5VA 2JVHA 1TQIA 2V7FA 2FMLA 3MVPA 1CF7B 4LOCA 5EG0A 1SVLA 2JRTA 4KMUX 1GLNA 3JTGA 2O8XA 2AHQA 3SFIA 2R0QC 1FIAA 3MAJA 1O3TA 3OIOA 2Z99A 4UHTA 2LD5A 2E35A 1QVUA 1WSUA 2KL4A 2VKHA 2FEZA 2FNAA 2RNGA 4BY7J 2VI6A 2VE8A 5KVRA 1UFMA 3CUOA 2OC6A 2YX7A 3FXJA 1TT0A 4LD5A 2ECBA 1PUFA 2FMYA 1FYLA 3RZOJ 4I76A 3PNVA 1AHDP 2NXNB 3KP7A 4XKCA 1Z67A 4RM2A 2COBA 2PJRB 4RAGA 4P1WA 2XVCA 2JT1A 1RNLA 2CJJA 4IZZA 1HW2A 4N0BA 3WE3A 3WTVC 1P92A 1REPC 2L5QA 3JRGA 3KEYA 3QWLA 1VZ0A 3VSLA 1EH7A 5E79C 3CCQI 4IQJA 2XF6A 2CUJA 1HC8A 2KDZA 2JA2A 1XSVA 1UJ8A 3DBHB 5KAIC 3NARA 1Z6TA 4B09A 1V4RA 4BNCA 2RDPA 1U5TC 2JUGA 4KJZA 3M07A 4E70A 4NBQA 4G7HF 5F27A 2NS8A 2DA7A 2BHYA 2GOMA 1A6QA 2WBMA 2DTRA 2QSGX 2KRFA 4V2FA 2JSCA 4OIOF 2VQCA 2BYVE 4LMYA 3QPHA 4U7BA 2W00A 5DCFA 1LPQA 2IBDA 3DEWA 3KYLA 4L18B 2G9WA 5LRRA 2EZIA 2LMDA 3DCFA 2K9NA 3KLNA 3C2GA 1FTTA 2LF8A 1IW7F 3Q0WA 1IC8A 2EIMH 1BI1A 3KEOA 3V8JA 2DFFA 4LIVA 4A2UA 2BW3B 2M30A 4XLHA 1FX7A 2DTZA 3H9GA 4YFKF 1GUUA 3A0BC 4L0ZB 1O7LA 3OS1A 4L9VA 3Q5FA 3KEQA 3O8GA 4HW0A 2STTA 2A6EF 1S7AA 5E1WA 3CCVI 3V4GA 1WJDA 5DEQA 1W7PA 2IVMA 4UV9A 2XRNA 4W1UA 4QIWN 3RKQA 4WXCA 2OAZA 5HVQC 2O03A 1ITYA 1I5ZA 2VJ4A 5JI6A 4LB5A 3ZP5A 2VKDA 4EGZA 5BMZA 2F5EA 1YW7A 4AIJA 1V5FA 4YRVA 4I01A 3IAM2 2EV6A 4S0HB 1D0ZA 5D6FA 3WGHA 1IN5A 3PNTA 3DEUA 1MMAA 2XAQA 3R4KA 4AVZA 1OCCH 3SXYA 5B66C 4HLYA 5EF6A 1Y1WJ 1JUMA 2NNNA 4IKFA 3KX2A 5A2QZ 4GXOA 1J75A 3EUAA 3S2HJ 2XB0X 2ZFUA 2HVQA 4M9XA 3OSGA 1KU2A 4XLFA 2JQ7A 3L2VA 3PFYA 4RMNA 2M7BA 3BPXA 3DLLF 3RKYA 4I6ZA 2QWWA 1BC8C 3LSJA 1R22A 3KP5A 3EETA 3E3VA 3JAMK 1S8NA 1ODDA 1ZG5A 2V4JC 5H2FC 2DJIA 3ELKA 5LD2C 1RKTA 3RYPA 2E1NA 4DIQA 1UCRA 3F21A 2K27A 4A3MJ 1WHUA 2EFWA 5HOOA 3VDXA 2BBYA 2VQGA 1W5TA 4U0YA 3S2DJ 3T0YA 3GYHX 2M7AA 3BC8A 5HNHA 2R5ZB 3VOEA 4LB6B 1BI0A 1B6AA 2LF7A 4RGUA 2CV1A 4A3EJ 1KQ8A 3UR3C 3K2AA 3FZVA 3J81Z 2KQRA 2R3SA 4A0ZA 2O3FA 1Z77A 2ELKA 4QPOA 3FMRA 4AYBN 2QYOA 4XOPA 4E7LA 2JMWA 3CF5F 1D0XA 1CQTA 3HOWJ 5J40A 2GIZA 2WWYA 2CUEA 2PMHA 4C30A 5DM6F 4FX0A 1VQ5I 2WAQA 2G7UA 3F8CA 4YFXF 3BROA 5B1BH 4YFNF 3OYDA 3R6SA 3CLQA 2ZXWH 1YO5C 3KYCB 4BHPA 3ZXSA 1LEAA 1XC5A 4IQ4A 5J4VA 4HQEA 4M6VA 1LDKB 2PQ8A 1MMNA 2KJCA 1ZKGA 4MLOA 5IT9K 1P6RA 1S7EA 1QRYA 5ERIA 5E3OA 2W57A 5J4YA 3LAJA 3EYIA 1QZEA 3E0JB 1V3FA 1K4SA 4R1HA 4DBRA 4BACA 2EFNA 2ELJA 3C2BA 2BY1A 3ZMZA 1AOYA 2JJ7A 1LDJA 4E6KG 3GWZA 4E7JA 2HOAA 2R93J 1JKOC 1OLTA 4RGXA 2BXYA 2D2WA 2O61A 1WJCA 3A2KA 2YU9J 2LKSA 3REOA 1R1UA 2DT6A 1IRXA 3QP6A 2F5FA 5E1ZB 3BZKA 3KE2A 3M9AA 4II3A 1G4DA 4IHWA 1KYZA 4PSXA 5DTDA 1MW7A 4AU7A 4ZYGA 1RR8C 1DUXC 4Q4ZF 2OTJI 2E2HJ 2DAOA 1A04A 2RVCA 3RKXA 1QHGA 1OR7A 2LK2A 2XKPA 3DFGA 3GTMJ 3JTHA 1YX5A 1ZRCA 4B43A 3I54A 2P0WA 1SD6A 2ZO4A 2LY2A 5DUKA 4M74A 2ME6A 1JUPA 1OFCX 3QPLA 2FA5A 2QQ9A 4UUVA 2IGOA 3H0DA 4P9FA 1FWZA 3VEPA 2DBBA 2Y31A 4AUXA 4Q47A 1KQ9A 2Q1ZB 3ZOBA 1ULYA 1IN7A 1FSEA 2OU2A 3KCCA 3LSGA 3S2WA 3JSOA 1K79A 4CZCA 4PFPA 4UNOA 4HX7A 1TT5B 3HBLA 2CV0A 4X6AJ 3QODA 3FXUA 4JQFA 4JOMA 2NS7A 3GFJA 1FOWA 3ZQ7A 2F5CA 3OYMA 2QQAA 1MH3A 5EG0B 2Q0OA 3OV8A 2Q8KA 3ZCOA 2A07F 1LEBA 3LAPA 4HF0A 5KNLA 4IVNA 3ZQCA 3GUDA 1HCRA 1HF0A 4XK4A 3K9TA 1HW5A 1WFXA 2NVXJ 2EFQA 4DQ2A 4F7ZA 3U1DA 5BQTA 3HSFA 4MQVA 3E5UA 2FBHA 1BR1A 3OYFA 3K10A 1X3UA 3TQNA 1OYYA 3ZQQA 3MMYB 1Z7UA 2P8TA 2IP2A 4XOTA 2LKXA 1YX3A 3BLYA 1GXPA 1JUSA 2VQLA 2WB1N 3F3XA 3HKZN 5M5XJ 1GDTA 4D5FA 5LRSA 4TV7A 1APLC 2DMNA 2X1DA 1X2MA 1I3AA 1TQPA 2F5DA 4QWQA 2XKOA 4CHUA 4A5NA 1KZHA 3FM5A 3ZMDA 3ZR8X 4IHXA 1YQAA 2D1VA 2E19A 3HM5A 4C9YA 2UWMA 3VYUB 3MZHA 4XRSA 3SDBA 4HDUA 3ZQLA 1GV5A 1QZYA 3H36A 2MC3A 1I6XA 1A35A 3KIOA 3WGIA 1R1TA 1SFEA 2LVSA 4XONA 2LY9A 4KMFA 1X3ZB 1O7FA 2FSWA 2XPUA 4B3XA 2DU9A 2XSDC 1LDDA 2XUBA 4PJNA 4QSHA 2L9RA 2X0LA 2E7XA 1JJ8C 2Z5UA 3HSRA 3TEDA 2NS0A 5IOZA 4BXFA 3SZTA 5HS8A 1BOBA 4RAYA 1W36C 2IJLA 4DZJA 4P5OA 3M4OJ 5B5EC 3B6CA 2NVTJ 4I98B 2XB5A 2TCTA 2WAEA 5A2QK 1N75A 4N4NB 1EH8A 1GT0C 1WQ2A 1WH7A 3FMSA 2BY3A 4BQAA 2UXNA 1U6GA 3CUQB 3PM1A 4HG2A 2NRAC 3IRQA 3RYRA 1AWCA 2B7EA 4I0AA 3OYKA 2FE3A 1SMTA 1G3TA 3JRBA 2BEOA 4LK0F 2J5OA 2NOJB 3G4SI 2DODA 1NG6A 4P96A 3S1RJ 1QU3A 2R7TA 4IRIA 4A3FJ 3TBIA 3L2UA 1D0YA 3WTYC 4KN4X 5LHHA 2CS3A 4PDKA 4BAYA 4CCLA 2PMZA 4EJOA 2RAEA 1BW6A 1X1AA 4BDZA 1PP8F 2K40A 3S16J 4QPQA 3GX4X 3AG1H 1U8BA 1E3OC 2XHKA 1KU7A 5IPAA 2OD5A 3J81K 2LYCA 1S5LC 1XDSA 2PG4A 2ZJRF 5CVUA 3Q9SA 1OCPA 3G1LA 2DMQA 4O5VA 5KHDA 3FXOA 2V6CA 3CJQB 1H9TA 2VE9A 2WY7Q 1D8JA 4A3BJ 4KIFA 2YUSA 5BNGA 4M3EA 2HNHA 4KDPA 2XV4S 1YW8A 3EUHA 2CRGA 4B1RA 4BU2A 4MQ9F 1LNWA 1QHHD 1XCVA 2GA1A 1SANA 2DA1A 4V19K 3O8HA 5FFZA 2BVMA 4YIFA 4YELA 1YJNI 3WHBA 2E5NA 2R7QA 4R8HA 3WTZA 2L02A 5HLHA 4PK4A 1YJ9I 2E36A 1Z6RA 3M7GA 4WK8F 1MBHA 1EKEA 2FQ3A 3NRVA 4HNUA 5J3LA 3JRAA 3T8TA 2FBIA 3VYSB 3TL4X 2HZDA 3S1QJ 5DCMB 3RPUA 3F0CA 4S04A 3C1DA 4A3IJ 3OR1C 4HAMA 1UZCA 5F64A 2GXAA 1JKQC 4OINF 4EV0A 1VQNI 4IOCF 1SC7A 2EWNA 1D5YA 2EQRA 4NQWB 1LFUP 1LVAA 3TP0A 3S8PA 1MGTA 2Z16A 3BQYA 1G6NA 5CQGA 3OY9A 3WGGA 3WTUC 3E5XA 1WWXA 3C2HA 1V5GA 3Q3SA 1HQCA 2F4OB 4O3MA 1XGMA 1MBEA 2H1KA 2CO5A 2IS6A 1YS7A 4CDGA
chains in the Genus database with same CATH topology
4ANJA 3DLAA 4C2TA 4XQFA 3VYRB 2L5QA 3PL8A 4XNFA 2KMUA 3KEYA 3OYHA 1VZ0A 2X1EA 3VSLA 3PUBA 4IQJA 3LSMA 2XF6A 2CUJA 3DTIA 2K3PA 2IGKA 3LMMA 2JA2A 1UG0A 4LITA 2R7RA 3LFUA 3HPGA 2WADA 3OYLA 3VWBA 2JUGA 4PJJA 1UAAA 3GBGA 3H9QA 3SYTA 4KJZA 3IAS2 2VPLA 4OAYA 2GOMA 2WBMA 3RSNA 1YE9A 2HVRA 4F3QA 2WY8Q 1PYVA 1UELB 2KDOA 2PJRA 2V6EA 4F55A 2VQCA 4U7BA 3VYTB 2W00A 2R7WA 4XL9A 3KYLA 2LRDA 3QYBA 1DQUA 2R7SA 3FBIB 3C2GA 3OYAA 3RQ4A 2F4IA 3NWTA 4HPQA 4U87A 3MKWB 3OYNA 3FHNA 4LIVA 4CCNA 3K4CA 1WJAA 2BW3B 4XLHA 4BEHB 3H9GA 3PSIA 3LSKA 3OS1A 2E1MC 4CCOA 3F9KA 3QYFA 2DXIA 3LSHA 2VL8A 1WJDA 4PFOA 2HU9A 1MNDA 2QKMB 4BQQA 2KHMA 4B44A 3FBNB 5HVQC 4BJTA 1Z7LA 1DGRM 2VJ4A 3OYCA 4AYBA 2VKDA 4DBQA 4J01A 3FDYA 2IGNA 1V5FA 2MYSA 3DPTA 1TZLA 1EA3A 2BW3A 4YRVA 2IS1A 3D5LA 3IAM2 2MC4A 4BE2A 1DP3A 4BEHA 3I9V2 1D0ZA 3K4BA 1T95A 2OV7A 3CESA 2MFZA 2CMPA 3PNTA 1MMAA 3L2QA 3CZ6A 2L9SA 2R4GA 4OWRB 4AVZA 3H5NA 3VSKA 2L2OA 3KX2A 4X0GA 4IKFA 2KLOA 4H4KC 1Z21A 2RQQA 2X51A 2A5WA 3EUAA 1G8XA 2ZFUA 2HVQA 1X1BA 4C2UA 2JVGA 2R7OA 4XLFA 2IGMA 3OS2A 3L2VA 2CW8A 3HUGB 3PFYA 4RMNA 3BG6A 3OYJA 2M7BA 3OOUA 3H35A 3BCBA 2KZVA 4KISA 4BS9A 5HNFA 4F52A 3DQVC 4BUPA 2K5CA 2M3AA 2V4JC 2DJIA 5LD2C 3DPLC 4DIQA 2K9LA 2L7KA 4GRIA 5HOOA 5LFAA 1T0FC 3VDXA 2VQGA 2M7AA 3BC8A 5HNHA 3K4MA 2CV1A 3UR3C 1KONA 4II2A 3AKZA 1X4OA 2KQRA 3ZGKA 3ZRGA 1D1AA 1MNEA 4NC8A 2XF7A 2ZSHB 3D5SC 4QPOA 3PSFA 1G59A 2E5ZA 4R79A 4XOPA 3W3CA 4BDYA 4E7LA 1SFKA 1D0XA 3AL0C 3MD2A 3DKYA 5JHFA 3CP8A 5CQEA 4C30A 2WAQA 1P9QC 1Z3YA 3IUOA 4E7ZA 3BCAA 5FRNA 3AFHA 3PNYA 3OYDA 2LC2A 2M4GA 3ZXSA 4XM3A 4IQ4A 4YEJA 1S9HA 1LDKB 1MMNA 3J7AY 3RCOA 2VJIA 4MLOA 3LSIA 4ZYAA 3H9JA 1WJBA 2LBFA 4ZTJA 1LVKA 4PSWA 3E0JB 2VB6A 3HL2A 4DBRA 4BACA 2ELJA 2CW7A 3CJRB 4ZDOA 2X6WA 4XR6A 1W36D 3HPHA 3M1CA 3K4JA 1HA8A 4E6KG 4E7JA 3S3NA 4CSWA 1OLTA 4F93B 1WJCA 2KRHA 2JSPA 2LG4A 3A2KA 1OR7C 2AQFA 2DT6A 1IRXA 3E1SA 3QYEA 1X1DA 4II3A 3N05A 2I8DA 1Z3XA 4PSXA 1MW7A 4AU7A 2UUZA 2R7UA 4EATA 2CUZA 4PUSA 4BJ6C 4DGWB 1J09A 3HKZA 3LL7A 3OYEA 2BOLA 3OWTA 1MMDA 3DPUA 1NG7A 1BR2A 1QHGA 3OMYA 2VLAA 1YX5A 3CF2A 4B43A 2P0WA 2Q2EB 3V42A 2LY2A 2GOXB 1SAUA 2UV1A 4DOZA 2Y0SA 2IGOA 3H0DA 2ZXIA 3HXLA 2A6TA 3HG9A 4CCMA 2Q1ZB 4ZDLA 4NNJA 4D9JA 4HNTA 3LSGA 4ZDPA 1WJFA 4CZCA 4PFPA 4E7HA 2VASA 2CV0A 4ZC3A 3QODA 4JOMA 3DU5A 4JQFA 2QKLB 2X1CA 2CH0A 3OYMA 4BQNA 3S3MA 3SEZA 4XLCA 3L2WA 3ZCOA 2HPMA 5TGTA 4HSRA 3TMOA 5KNLA 4NUBA 4XKBA 2VJ5A 4CCJA 4XMYA 2KPMA 2W82A 4CUGA 3PJRA 2XDVA 1WFXA 2DCEA 2OUMA 2KRCA 3U21A 2ZSIB 3RPUD 1BR1A 3OYFA 3K10A 1FMVA 4NC7A 4BE0A 2VXZA 4BE1A 1K6YA 3ZQQA 2K9MA 3MMYB 3K4KA 3CP2A 4XOTA 4BGDA 2R7XA 1YX3A 2VIXA 3BLYA 2VQLA 4CA0A 4E7IA 1MMGA 4HRIA 2M4KA 2X1DA 2L9NA 4HSTA 3W2VA 3SEQA 5CKTA 3ZR8X 3DTEA 4CCKA 1LFPA 1WJEA 3OYGA 4C9YA 2UWMA 3VYUB 1E0EA 3SDBA 2WAFA 2HQAA 3H5AA 2E60A 4LG3A 4PJLA 3OL3A 4XONA 2DT7B 2HVSA 4OAZA 3DU6A 4B3XA 1LKXA 2XC7A 2LREA 4PJNA 4ZTFA 2HDWA 1Y56A 1ZELA 4FASD 3CMMA 3DTKA 5FROA 2IS2A 4BXFA 2XF5A 3DEEA 4KT6A 1BOBA 4G6TB 4LIUA 4XORA 2R7VA 1X19A 4RLQA 4DJAA 1W36C 3QOEA 3EPZA 4XN3A 4P5OA 3S3OA 4F92B 4XKVA 2VXDA 2BVLA 2X85A 4J00A 2IS4A 2WAEA 2WA0A 3A1YA 1N75A 4N4NB 2LOOA 4N4OB 3BG7A 4CH7A 1Y6IA 4ITVA 1N77A 4E7KA 4HG2A 1R6RA 1V5EA 2VQHA 2WB1A 2DOAA 2XSJC 4XLEA 2W1OA 4Y4RA 3OYKA 4PJMA 3DWLE 2E1MB 3UNGC 2W7NA 4IX7A 2CV2A 3S32A 3K6GA 1ERDA 2NOJB 4XLAA 4RLFA 3RTRA 1JI8A 1X1CA 1DGWY 2M0MA 1AA7A 1NG6A 4ZJZA 1N78A 1QU3A 2R7TA 1PJRA 3OIQA 3TBIA 3L2UA 1D0YA 4B47A 3K70C 2CS3A 5HLTA 2V9KA 3K70D 3EUKL 3K4NA 3MKYB 4CCLA 2PMZA 1D1CA 1X1AA 4BDZA 3OL4A 4QPQA 3A4CA 5FRMA 4XKWA 3EUHC 3OR2C 2MABA 3G2BA 2MD0A 3I3LA 2Z2SB 2FUG2 4HEA2 2HPIA 3S93A 2LYCA 4D1QA 2Z1DA 4B48A 2RREA 2V1NA 3L2RA 5KCMA 5KHDA 2F6CA 3M8JA 3ONQA 3CJQB 2IXSA 2WY7Q 2V26A 1U0JA 3HOSA 3OYBA 2LY1A 1BR4A 2HNHA 2ZXHA 3MKZA 3D5RC 3OYIA 4BU2A 1QHHD 1FMWA 3SZGA 4BQOA 2W4SA 2BVMA 3OS0A 4YELA 2E5NA 4BJ5C 5CPRB 2F5VA 2R7QA 3HOTA 4PK4A 2KP6A 3H5RA 4E7SA 2XAUA 4BL0B 3W2WA 2LH9A 2JVHA 2O5RA 4HNUA 2V7FA 3VYSB 4E4HA 3TL4X 2HZDA 1WJ5A 4KITB 3NWSA 3OIPA 1GLNA 4FETA 3FKJA 3OR1C 2VJJA 1X4PA 3DKXA 2X6XA 4NQWB 2KL4A 3W2AA 2VKHA 2RNGA 3S8PA 2Z16A 2AQEA 5CQGA 3OY9A 2X6YA 1D1BA 3HC7A 2OC6A 4F91B 3IP4B 4Y33A 1TT0A 3C2HA 1V5GA 3K4LA 2CFOA 3PNVA 4Y3OA 3AL0B 4XKCA 4RM3A 4RM2A 2PJRB 2IS6A 4XN0A 2LBFB 4P1WA 4IZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LH9 A;  2KZV A;  2LY1 A;  2KPM A;  3S93 A;  2LY2 A;  3RCO A; 
#chains in the Genus database with same CATH topology
 1T0F A;  1WI9 A;  3L2C A;  4C2T A;  3CME I;  3S17 J;  3VYR B;  1R23 A;  4C2M J;  2KMU A;  4AWX B;  3OYH A;  3BDD A;  2HDC A;  5GP9 A;  3DTI A;  2W85 A;  2NAZ A;  5TRD A;  1NK3 P;  3FXQ A;  1KU9 A;  4HV6 A;  4LIT A;  3P9I A;  5ICC A;  3KP3 A;  2L54 A;  2R7R A;  3CO7 C;  3HPG A;  4WX9 A;  4JX5 A;  3CCY A;  1UAA A;  3GBG A;  2EZH A;  4RB0 A;  3H9Q A;  3SYT A;  4B8X A;  2HR3 A;  4BYY A;  1ETW A;  5FO5 A;  3KP6 A;  2OZU A;  3GZN B;  2ID6 A;  1RR7 A;  5D8L B;  2VPL A;  3RSN A;  1YE9 A;  2PBI A;  4I09 A;  3U1K A;  3I53 A;  1E3H A;  2WY8 Q;  4F3Q A;  5EGO A;  2KIF A;  2IW5 A;  1KU3 A;  3VYT B;  3O2P E;  5FJ8 J;  2ZJP F;  3BY6 A;  2COM A;  2CW0 F;  4MTD A;  2XAS A;  3HJE A;  3HOZ J;  2VC0 A;  4XIC A;  1Y0N A;  2VT2 A;  1ZGA A;  2UZK A;  2F4I A;  2A6H F;  2X4H A;  3CCE I;  1ZRF A;  1F4K A;  3PIP F;  1UHM A;  2CQQ A;  3QOP A;  3JRC A;  2HEO A;  4MO7 A;  2LFB A;  5FKL A;  2IAI A;  5GAD J;  1K61 A;  4M6Y A;  1ZN2 A;  2MLK A;  4ENN A;  1FTZ A;  4FHT A;  3DBL B;  3K69 A;  4IXA A;  3QYF A;  3JCU C;  3M3Y J;  2DMU A;  3LSH A;  4KIC A;  2VL8 A;  1MND A;  1ZG1 A;  1R71 A;  2GQQ A;  2H6B A;  5F0C A;  1QPI A;  5H6R A;  4GO1 A;  5LBQ A;  5F0H A;  2LKP A;  1OKR A;  3GZ6 A;  4A0X A;  3GTO J;  3KP4 A;  3WE2 A;  5EJC A;  3PQJ A;  4ABZ A;  2E1O A;  2E34 A;  4ZZD A;  3GME A;  1IXS B;  5HS9 A;  3SJM A;  5K5R A;  4ENK A;  4U0W A;  2MG4 A;  3DPT A;  1TZL A;  1EA3 A;  2LP0 A;  3D5L A;  1Z91 A;  2MC4 A;  2C6Y A;  4BEH A;  1DP3 A;  3HTU A;  1H0M A;  2OV7 A;  1T56 A;  4Y13 A;  2XAH A;  2AS5 F;  3CZ6 A;  2L9S A;  1SD4 A;  2M9H A;  3VSK A;  2L2O A;  1FBS A;  5FLM J;  3CCS I;  2A5W A;  1XGS A;  3KPH A;  4AIK A;  1EJ9 A;  1NH3 A;  1QPM A;  1FY7 A;  4C2U A;  2R7O A;  1LJ9 A;  4RA2 A;  4HBL A;  5J8F A;  1L3L A;  3HUG B;  5D6E A;  5ICE A;  3BG6 A;  5DDG A;  2L0K A;  3HZJ A;  3I4P A;  2R92 J;  1AU7 A;  2QQ8 A;  3BCB A;  2KZV A;  2ZJ2 A;  4BS9 A;  1XMK A;  4F52 A;  2EPF A;  2KIU A;  3SHF A;  4I02 A;  2DYS H;  2HXI A;  5H20 A;  3I0T A;  1P7J A;  2L7K A;  3O6B B;  3C7J A;  1V55 H;  5IYB J;  1TL8 A;  2K4B A;  1B1B A;  3RJP A;  4A6E A;  1IZ1 A;  4A3J J;  1MDM B;  3ZQF A;  1SFX A;  3CMA I;  2WC2 A;  1BIA A;  1Y1V J;  1Z0X A;  4L5J A;  3CTA A;  4NC6 A;  3BP8 A;  1ZAO A;  3K1M A;  1MNE A;  5TJJ A;  3D5S C;  1JE8 A;  1ZYR F;  1OCR H;  4C3I J;  3CDH A;  1MSF C;  1BL0 A;  3MD2 A;  5JHF A;  5IY5 H;  1P4A A;  2CFX A;  2RKH A;  3LSR A;  3LQR A;  3M8E A;  3BCA A;  3PUF A;  4EM0 B;  5FRN A;  3HOU J;  4G12 A;  4M3F A;  3ABM H;  1WH5 A;  2QGU A;  5JR3 A;  1ACI A;  5TIS C;  1N25 A;  1OYW A;  4ON0 A;  4A3C J;  1FLI A;  4Y15 A;  3ISP A;  3LSI A;  3QP5 A;  4Y52 J;  4HF1 A;  3H9J A;  2LBF A;  4CYD A;  3LSP A;  4ZTJ A;  2X6O A;  3IHU A;  3LFK A;  3HL2 A;  1LQ1 A;  1XB4 A;  3TDU C;  5C4J J;  2M8E A;  1BIB A;  2HQ5 A;  5FFX A;  1W36 D;  3HPH A;  2OQR A;  3M1C A;  3BR3 A;  1MNM C;  3E5Q A;  3BTI A;  4BY1 J;  3S3N A;  2HTJ A;  2WTE A;  5DM7 F;  3FXK A;  2KRH A;  5GPC A;  1OR7 C;  2AQF A;  3VPR A;  5BOX A;  1ETY A;  5HDK A;  2GIV A;  3E97 A;  3DP7 A;  2B9S A;  4RAZ A;  1ZRD A;  2I8D A;  1Z3X A;  3KFW X;  3H1C A;  1JTY A;  2BHZ A;  1W0T A;  1RRJ A;  2VKV A;  1FZP B;  2UUZ A;  2R7U A;  1S72 I;  4MIM A;  1ZK8 A;  2K3F A;  2DA6 A;  4PUS A;  4BJ6 C;  2ZME A;  1J09 A;  3OYE A;  1ZHF A;  2BOL A;  1SD5 A;  3JRF A;  1MMD A;  3DPU A;  4MFE A;  1P4W A;  3CF2 A;  5FD5 A;  2ZNZ A;  4D7M A;  1UHS A;  3GTQ J;  3LNQ A;  3HHG A;  4A3K J;  3CDI A;  2A5Y B;  1SAU A;  4LLN A;  5D8K B;  3CCL I;  4DOZ A;  3ZQI A;  2CU7 A;  2AXT C;  2R5Y B;  3HOV J;  2GLO A;  1YW9 A;  3HXL A;  2QLZ A;  3S14 J;  3T8R A;  4CCM A;  1B72 B;  4ZDL A;  3JRI A;  1UHW A;  1YIO A;  3FMQ A;  4HNT A;  5KK1 A;  4Y7N J;  1POG A;  5FKN A;  4FQG A;  2QKL B;  2X1C A;  5DD4 A;  3QPT A;  3H3Z A;  1BI2 A;  1EV7 A;  4BQN A;  1BW5 A;  1DU6 A;  2QZ8 A;  2HPM A;  2I10 A;  2HZT A;  4NUB A;  2MA3 A;  2Q2E A;  2KZG A;  4XMY A;  3PJR A;  1O4X A;  3HGG A;  1TNT A;  2VN2 A;  1FSH A;  2OUM A;  2KRC A;  1U8R A;  3E6B A;  5CYV A;  3FXR A;  5E20 A;  2DI3 A;  2PMU A;  3V8K A;  1XCB A;  4BE0 A;  4DYQ A;  5K5Q A;  4BE1 A;  3I4M J;  3G3Z A;  3ZQH A;  1ETV A;  3CP2 A;  5L3F A;  3X2Q H;  5LEJ A;  3K7A J;  1J7K A;  5FD6 A;  4CA0 A;  1SEU A;  3WG9 A;  2GXB A;  4ZH4 F;  3CQZ J;  4ETS A;  3DXJ F;  1GXQ A;  1RKW A;  2M4K A;  2L9N A;  4GFB A;  2K85 A;  2FX0 A;  4EGY A;  3ABT A;  3A01 B;  5D4R A;  2EV5 A;  5IP9 J;  4CCK A;  1LFP A;  2HTS A;  3OYG A;  3EDP A;  1E0E A;  1VTN C;  2EIK H;  1BM9 A;  2HOE A;  2JPB A;  1MD0 A;  2TRT A;  2WAF A;  2HQA A;  4UVC A;  1XN7 A;  3I55 I;  4LG3 A;  5F04 A;  2JA5 J;  2YX4 A;  1XX5 A;  3WTS C;  1IDY A;  5EDN A;  4OAZ A;  3DU6 A;  4WXH A;  2JPC A;  4AID A;  2W24 A;  4ESB A;  2A61 A;  1ETK A;  2WV1 A;  1PP7 U;  2XC7 A;  2LRE A;  4QLC U;  2HOT A;  2HDW A;  1B59 A;  1ZLK A;  1Y56 A;  3C3W A;  3CMM A;  5L3C A;  3CMY A;  1ORK A;  2K7L A;  1QGP A;  4U0V A;  4RLQ A;  3WG7 H;  4DJA A;  3QOE A;  4L9J A;  1ZTR A;  2LNB A;  1U78 A;  3FK6 A;  4XKV A;  1RPW A;  2BVL A;  2QM3 A;  2BE5 F;  2YR2 A;  1XG1 A;  1CGP A;  4CYC B;  2LOO A;  4UVB A;  3BG7 A;  2G0E A;  4CH7 A;  5ILU A;  2DA3 A;  2QA4 I;  1Y6I A;  4ITV A;  1FYM A;  3SDG A;  1N77 A;  1T2K A;  1MJB A;  3FK7 A;  3FWE A;  1U5T A;  3FKI J;  5HDN A;  4PZJ A;  1J2X A;  1ZAR A;  3GTJ J;  1IRF A;  4PJM A;  3DWL E;  2CV2 A;  1R4N B;  3K2Z A;  2EIJ H;  1J9I A;  3K6G A;  4XLA A;  3RTR A;  2FU4 A;  4FTH A;  5E18 F;  2EIN H;  3LA2 A;  3I59 A;  4AIH A;  2HYG D;  4WXD A;  4UB8 C;  1IO2 A;  4AVP A;  3K1N A;  4B4C A;  1I1G A;  4B47 A;  4G94 A;  5HLT A;  2V9K A;  2YPR A;  3R61 A;  5AIQ A;  4U7D A;  3K70 D;  3MKY B;  1QQI A;  5LGT A;  1D1C A;  3WHC A;  4EJV A;  1OCT C;  2DOE A;  3A4C A;  3EUH C;  2JN6 A;  2ZCW A;  2MAB A;  4Q5S F;  3ABK H;  3G2B A;  3I3L A;  2ETH A;  4HEA 2;  3S93 A;  3B6A A;  1RC9 A;  1HLV A;  3MWM A;  2NVQ J;  4G7O F;  3ONQ A;  1E2X A;  2IXS A;  1U0J A;  3JR9 A;  1I27 A;  1B9M A;  2OZ6 A;  2P81 A;  2E2I J;  3OOP A;  3MKZ A;  3D5R C;  4N9I A;  3GCM A;  5H6Q A;  3SZG A;  2NOG A;  2M2E A;  2XIG A;  5CPR B;  4DNC A;  4BXX J;  2V1D A;  3H5R A;  5DUI A;  4E7S A;  2Y9Y A;  5FLX K;  2M1B A;  3L09 A;  1PUF B;  3E6D A;  4A93 J;  2IA1 A;  1SMY F;  3TKY A;  4E4H A;  1NK2 P;  2ESH A;  3F8B A;  4HA8 A;  2F2E A;  5F0F A;  2ZXJ A;  2H1L A;  1WVR A;  1W5C C;  3NWS A;  3OIP A;  4KIT B;  4FET A;  3FKJ A;  2VJJ A;  4GGG A;  2ACJ A;  1X4P A;  3KLO A;  3DKX A;  3TW6 A;  3F8F A;  1MKM A;  2HQN A;  2X6X A;  4IHT A;  1KGS A;  2BY2 A;  3DV8 A;  4AC0 A;  1PUE E;  2EIL H;  3KZY A;  2GM4 A;  1M1E B;  2DQR A;  4XID A;  3R60 A;  2CGP A;  5HLI A;  4AM3 A;  1SD7 A;  3HC7 A;  5GPA A;  2IEK A;  2V1X A;  4F91 B;  3JSP A;  4HDV A;  3U2R A;  1I39 A;  1RES A;  3ESW B;  2DLL A;  1SFU A;  3MFK A;  3K4L A;  2JTV A;  5IYC J;  2CFO A;  1VQ7 I;  1TW2 A;  3QQA A;  5FKK A;  2MGQ A;  4P55 A;  2P5V A;  3HRT A;  4XN0 A;  3MQ0 A;  2LBF B;  1TLH B;  2XPW A;  3J7Z I;  3DLA A;  3PL8 A;  3ECH A;  2X1E A;  2NVY J;  5JLW A;  3PUB A;  4I7H A;  4P9U A;  3LSM A;  5J1U A;  2K3P A;  4OOI A;  1XSD A;  1TW3 A;  3RPQ A;  2FBK A;  2E7W A;  3LFU A;  3L1P A;  2WAD A;  3OYL A;  4CZZ A;  4OIQ F;  3GTG J;  2EA2 A;  1I3Q J;  3IAS 2;  1IXC A;  3VOD A;  1FYK A;  3ECO A;  3TDZ C;  1MH4 A;  1NHA A;  2HVR A;  1GVJ A;  2XAG A;  4AD9 A;  4GCV A;  2HFH A;  4M3B A;  1PYV A;  1JGS A;  2PJR A;  4F55 A;  4L5I A;  1W7P B;  2CQN A;  2R7W A;  1F36 A;  3RZD J;  3CDL A;  3AAF A;  3QYB A;  4WCG A;  2XGC A;  3A03 A;  3C18 A;  4U87 A;  3QAH A;  3MKW B;  3I64 A;  1O3S A;  1Z1D A;  3U9G A;  3OYN A;  5J1R A;  3QU6 A;  1ON1 A;  4A5M A;  4CCN A;  2N8G A;  3K4C A;  3S15 J;  3V7R A;  3PSI A;  4HV5 A;  3LSK A;  2KIQ A;  4CCO A;  2AXL A;  2OCC H;  3F9K A;  1P7I A;  3ABU A;  3PQK A;  2HU9 A;  4PFO A;  2H8R A;  1H89 C;  4W97 A;  2QKM B;  3ZMT A;  3GEZ A;  2KHM A;  4B44 A;  2DYR H;  3K0L A;  1G2H A;  1ZG3 A;  3R0J A;  2O6G E;  1AKH A;  1GV2 A;  4BJT A;  1DGR M;  3I5U A;  3BR1 A;  1Z05 A;  4IRG A;  1ENH A;  2G7H A;  1C0W A;  3BG9 A;  3OYC A;  4AYB A;  2CUF A;  3G1M A;  4DBQ A;  2ZC2 A;  2H09 A;  2IGN A;  3FDY A;  2LLK A;  4UVA A;  2BW3 A;  5JVT A;  5B1A H;  4HYE A;  4BE2 A;  3I9V 2;  2KIM A;  3CES A;  2PEX A;  1H8A C;  2JK3 A;  2CMP A;  2GZW A;  1BN5 A;  2JA6 J;  2W84 A;  2R4G A;  4OWR B;  3CD6 I;  4S05 A;  5L3B A;  4X0G A;  2KLO A;  3I4N J;  1YIJ I;  4DW6 A;  2RQQ A;  1ZGJ A;  3WTW C;  3F23 A;  2JVG A;  2L4A A;  2IGM A;  3OS2 A;  4KN7 X;  3FXM A;  2DFI A;  2P5K A;  2X9D A;  3CJN A;  5CLS A;  3OOU A;  1A31 A;  3TO7 A;  2F4M B;  5AIP A;  1W4M A;  4KIS A;  4WWC A;  1LFB A;  3MCZ A;  3W6J B;  2M3A A;  1T6S A;  3GLL A;  1B4A A;  3DPL C;  1I1S A;  1T98 A;  3DBR B;  2L01 A;  1TWH J;  4GRI A;  4N9H A;  4EQQ A;  5LEK A;  1BI3 A;  1ZGW A;  5E8G A;  2IA0 A;  1K78 A;  4M73 A;  2EFP A;  3B02 A;  3IKT A;  2GWR A;  3ROU A;  5ILV A;  4J19 A;  1GHC A;  2KT0 A;  2DPD A;  5D5U B;  1F43 A;  2VOD A;  2MH2 A;  1XGO A;  2ZFW A;  1FJL A;  5DV5 A;  2A05 A;  2XRO A;  4ZYD A;  2HGC A;  4HNV A;  3AKZ A;  4M72 A;  3ZGK A;  4XBF A;  1FBU A;  3CLO A;  2FOW A;  2DK8 A;  2H8W A;  1XSX A;  3KZI C;  3T1B A;  3GTK J;  2ZSH B;  3HRU A;  3BOQ A;  4HQM A;  4XSZ F;  4HF2 A;  4XRM A;  1G59 A;  1H9G A;  4KIG A;  2GA2 A;  4R79 A;  3W3C A;  2OPT A;  3BPV A;  1SFK A;  5M3M J;  1QA6 A;  3DKY A;  1WGX A;  2MW8 A;  2FQ4 A;  2ISY A;  3SQN A;  3ULQ B;  1JTX A;  2PLY A;  4E7Z A;  1Z3Y A;  2E71 A;  1YTY A;  1QO0 D;  3AFH A;  2QF7 A;  3PNY A;  2R5Z A;  4Y17 A;  3HOY J;  2LC2 A;  2RV8 A;  2M4G A;  4D0P A;  1BOA A;  3DKW A;  3Q9V A;  2M34 A;  2D45 A;  4YEJ A;  1S9H A;  1MBG A;  2H94 A;  2K02 A;  3RCO A;  4ESF A;  1VQO I;  2VJI A;  4CGZ A;  2BXZ A;  2KIS A;  2BY0 A;  2CQK A;  3IL2 A;  4LGW A;  4PSW A;  4HOB A;  4OMZ A;  2W25 A;  3FHZ A;  3L7W A;  2XGE A;  3CC2 I;  1X1P A;  2CW7 A;  3CJR B;  1IG7 A;  1A36 A;  4ZDO A;  1W5S A;  2DN0 A;  3BT9 A;  1IN4 A;  1VQK I;  1FOY A;  4XR6 A;  3K4J A;  4JP0 A;  5EZG A;  1O3Q A;  2I5U A;  1F9N A;  1T38 A;  3ZN0 A;  1OCO H;  2LG4 A;  4IRH A;  5E3M A;  1FEX A;  4KIB A;  2ZBK A;  4A0Y A;  1VQL I;  2KJB A;  3E1S A;  4IHS A;  3QYE A;  2K9S A;  5K7H A;  2GXG A;  4X1E A;  4MNU A;  4LG0 A;  1S29 A;  5ED4 A;  4EAT A;  3VB2 A;  4DGW B;  3TO9 A;  3ZMV A;  1IN8 A;  3HKZ A;  2ZB9 A;  1D3Y A;  4NB5 A;  1NG7 A;  1BR2 A;  1O3R A;  2ZJQ F;  3V7C A;  2VLA A;  3MKL A;  1Q1H A;  2M5W A;  3VFZ A;  1I50 J;  2DDB A;  1K83 J;  2VON A;  5CVV A;  1IUY A;  1I6H J;  5EEH A;  2EH3 A;  3HB9 A;  2Y0S A;  3FIW A;  2QUF A;  2ZXI A;  4I2O A;  1R4M B;  3F22 A;  5CVR A;  2WAQ N;  3HRM A;  3MZ8 A;  3HG9 A;  5HDG A;  1VF9 A;  4D5C A;  3LA3 A;  3RIR A;  3BTJ A;  5F6F A;  3A02 A;  1WJF A;  3K1P A;  5JLX A;  1XS9 A;  2VAS A;  5GTH C;  4FE7 A;  3BR2 A;  1TWA J;  3DU5 A;  1T33 A;  1EF4 A;  1YS6 A;  1TWF J;  2YS9 A;  2CH0 A;  4KUM A;  3W6V A;  1JT6 A;  2DA2 A;  5TGT A;  4JBA A;  3TMO A;  2XGX A;  5DYM A;  3LOC A;  1LE8 A;  2EBI A;  5E3N A;  2W82 A;  3CC7 I;  3R0A A;  1E3P A;  6PAX A;  4PCQ A;  1IRZ A;  3U21 A;  1R00 A;  2RQP A;  4FE4 A;  1HSJ A;  3RPU D;  1R5I D;  2EZK A;  5CJ9 A;  1G3S A;  2M0C A;  1SVM A;  1ZRE A;  2ELH A;  3HEF A;  2HWV A;  2Z33 A;  1FMV A;  4NC7 A;  1WPK A;  3HGY A;  4IOA F;  2VIX A;  3BTL A;  3IH2 A;  2FRH A;  1MJA A;  5IT3 A;  1TWC J;  4G6Q A;  3ML6 A;  2EA4 A;  3GZ5 A;  3P5J A;  4OIR F;  4OU0 A;  2DT5 A;  5CKT A;  3AG2 H;  2EB7 A;  3H3V K;  3DTE A;  2Y75 A;  2V79 A;  1OQY A;  3F8N A;  5J47 A;  1YG2 A;  2LTP A;  1G3W A;  3TGN A;  1SVO A;  2DA5 A;  4IL6 C;  5L3E A;  3I58 A;  4BHB A;  2V9P A;  3H5A A;  2P5L C;  3BJA A;  1MBJ A;  1QVT A;  2M45 A;  1YI2 I;  3BJO A;  4YG2 F;  1LKX A;  5FLX Z;  5DS9 A;  3EYY A;  3HDD A;  5CVI A;  4CIC A;  1ZEL A;  4FAS D;  1YYV A;  2R7Z J;  5GAH J;  4FX4 A;  1PVE A;  5CVJ A;  4IHV A;  3L00 A;  5FRO A;  2FXA A;  2XF5 A;  2XAF A;  1Y39 A;  1TWG J;  1R1V A;  4KT6 A;  4G6T B;  1YJW I;  2R7D A;  1X19 A;  5K5O A;  2NNY A;  4G9Y A;  2M8G X;  3N4M A;  2XAJ A;  1U2W A;  3EPZ A;  4F92 B;  4ZYE A;  2E1C A;  4IHY A;  3ERM A;  2VXD A;  2X85 A;  1F1Z A;  2IS4 A;  3FIS A;  4MHG A;  3A1Y A;  3J7A O;  2NYX A;  4MEX F;  3LST A;  2ADU A;  1FOK A;  2DJN A;  2A3S A;  1HDP A;  4N4O B;  3BG5 A;  5GTI C;  5ICF A;  1KA8 A;  2CSO A;  1HBX G;  1V5E A;  2ZKZ A;  3FX3 A;  3V8L A;  1AKH B;  2DOA A;  3GTP J;  2XSJ C;  1HST A;  2GBY A;  4XLE A;  4FT8 A;  2W7N A;  4IX7 A;  2E1M B;  3SZP A;  1JKP C;  3S32 A;  5GAG J;  5C3E J;  2ID3 A;  2FD5 A;  2UXX A;  2QEX I;  4OMY A;  1X1C A;  4UB6 C;  2JUC A;  1VQ8 I;  2IT0 A;  3JRD A;  1PJR A;  2QBY A;  5KAF C;  1WZ2 A;  2BZT A;  5DD8 A;  1VQP I;  3OL4 A;  1TC3 C;  3CUQ A;  4XKW A;  5FGM A;  5IP7 J;  4D1Q A;  2Z2S B;  2HPI A;  4CXF A;  2IA2 A;  1RUO A;  2V1N A;  3F8M A;  4ZZL A;  3L2R A;  4IPA A;  3GVA A;  3ASO H;  3M8J A;  3NAU A;  3PIO F;  1X3W B;  1S7O A;  5BS6 A;  2DW4 A;  2PFB A;  2VBZ A;  3IRR A;  3JRH A;  1JHF A;  5HS7 A;  5M5W J;  4M71 A;  2LY1 A;  1BR4 A;  2CWE A;  3OYI A;  2MD5 A;  2DDA A;  2PI0 A;  2ME0 A;  2VOP A;  4BJ5 C;  1Y0U A;  2O8K A;  4RBO A;  9ANT A;  1K78 B;  2VBY A;  2KP6 A;  2RN7 A;  1A6I A;  1UMQ A;  5HOD A;  5JHU A;  2XAU A;  4BL0 B;  5EYR A;  3W2W A;  1YHQ I;  2L7M P;  2LH9 A;  5D4S A;  2O5R A;  1MBK A;  4L0Y B;  3M1E A;  1WJ5 A;  3E7L A;  2RGV A;  1RUN A;  2J5P A;  1WKM A;  5D5X B;  2Y69 H;  1BBY A;  1XMA A;  3HSE A;  4EM1 A;  2DFH A;  3HYI A;  1DPR A;  3W2A A;  2DOF A;  1W0U A;  2HKO A;  3BR0 A;  5FKO A;  3QU3 A;  1JXS A;  4RAF A;  3F72 A;  2AQE A;  2BGC A;  2Y2Z A;  2H6C A;  1XGN A;  2X6Y A;  1D1B A;  2L3D A;  1FIP A;  2PMZ N;  1XDU A;  3IP4 B;  4Y33 A;  1HKT A;  3G6E I;  2ISZ A;  2HKX A;  4Y3O A;  2HDD A;  3AL0 B;  3H3U A;  4RM3 A;  5DCM A;  2CQ7 A;  5EGO B;  4Z2Y A;  4RDU A;  2P7C B;  4ANJ A;  5HLG A;  4XQF A;  3RQI A;  4LK1 F;  4XNF A;  4JK1 X;  2DQL A;  2DK5 A;  4A6D A;  4XLP F;  4XSX F;  2OCE A;  4NQW A;  1VND A;  2IGK A;  3LMM A;  1UG0 A;  3H92 A;  4GYI A;  4BHC A;  2EV0 A;  3ZQG A;  2VOO A;  1RIO H;  3ZMS A;  1S3J A;  1YOV B;  5ICG A;  2Y30 A;  1Z9C A;  3VWB A;  1VQ6 I;  3F6V A;  1MBF A;  4PJJ A;  3TO6 A;  1TNS A;  4LLG F;  2DO7 A;  4OIP F;  5E8I A;  4MFD A;  4OAY A;  4LG0 B;  3G73 A;  3SFZ A;  2Y48 A;  1UST A;  1OCZ H;  1UEL B;  2KDO A;  2V6E A;  2L9V A;  3WU0 A;  1U9N A;  3PO2 J;  5IOY A;  4KYW A;  3TP3 A;  4XL9 A;  5FB2 A;  3J7Y J;  2LRD A;  4EJW A;  3TOB A;  1DQU A;  3H0G J;  5D5V B;  1X2N A;  2F48 A;  3FBI B;  5FKM A;  2R7S A;  3OYA A;  3RQ4 A;  3ABL H;  2HYJ A;  2OJE D;  1W7P D;  3NWT A;  4HPQ A;  1WCM J;  4A3D J;  1RZ4 A;  4CO8 A;  1FOX A;  3W6K B;  1L0O C;  3FHN A;  3D1N I;  4XRF A;  3WTT C;  1WJA A;  1VQM I;  4U88 A;  3BG3 A;  3IC7 A;  4BEH B;  1JKR C;  2E1M C;  1YRN A;  2YSR A;  2CG4 A;  1W1W E;  3IWF A;  3G71 I;  1ONV A;  1PDN C;  1U3E M;  1GVD A;  2K9Q A;  2DXI A;  3HRS A;  1TBX A;  4EVI A;  2HQR A;  1MIJ A;  2BV6 A;  3CO6 C;  3PO3 J;  1OMI A;  2AO9 A;  3MN2 A;  4M3D A;  1Y8R B;  4BQQ A;  2FF4 A;  3FBN B;  3J80 Z;  1Z7L A;  2STW A;  2MH9 A;  5E1X A;  3BTC A;  3S1N J;  2P7V B;  2OQG A;  3KET A;  2L7F P;  3KYD B;  1D8K A;  3P9K A;  2LDU A;  1B8I A;  1BJA A;  1LE8 B;  3RKW A;  2FJ1 A;  2OA4 A;  1HKQ A;  2QEN A;  2O7O A;  4J01 A;  4UY8 I;  2YU3 A;  2MYS A;  1ZR2 A;  2IS1 A;  5JVG F;  4G6D A;  1FBQ A;  2D5V A;  3EQL F;  3K4B A;  1T95 A;  5K7Z A;  5E17 F;  5BPD A;  2MFZ A;  2JA8 J;  2QVO A;  3Q0V A;  3L2Q A;  1K6O A;  3N97 A;  5AON A;  2Z3Y A;  3H5N A;  3WTX C;  3B73 A;  3WU1 B;  1USS A;  5K7F A;  4H4K C;  1Z21 A;  2X51 A;  1G8X A;  1WRJ A;  2Y0M A;  2EFO A;  1ZR4 A;  2B0L A;  1X1B A;  3GF2 A;  1HXD A;  3QRF F;  1OJL A;  2V1U A;  3GFI A;  4UXN A;  2FOK A;  3KZZ A;  1P4X A;  2CW8 A;  3OYJ A;  2QSH X;  2OBP A;  2PN6 A;  3H35 A;  4UUS A;  1FP1 D;  4M9Z A;  2LSO A;  5D5W B;  4JX6 A;  5HNF A;  2OF7 A;  2O9L A;  3DQV C;  4KFC A;  1IRG A;  4BUP A;  5FLV A;  2K5C A;  2ZNY A;  1IF1 A;  3GO5 A;  4IF4 A;  5F08 A;  4IJA A;  2K9L A;  4WF2 A;  1QZZ A;  5LFA A;  1T0F C;  4D7N A;  4MGR A;  2NVU B;  3IH3 A;  3K4M A;  3ASN H;  1STZ A;  3S1M J;  5C4X J;  3HUG A;  3BZ6 A;  5J8C A;  1KON A;  3IKV A;  1OYI A;  4II2 A;  4MTE A;  1CF7 A;  3M8F A;  1IJW C;  2IPQ X;  4ESJ A;  1X4O A;  3ZRG A;  4XRS G;  2D1H A;  5L3G A;  1D1A A;  4MEY F;  2ICW G;  2PX9 A;  2XF7 A;  4NC8 A;  1IV6 A;  1ZH5 A;  3PSF A;  1J0R A;  2RC4 A;  4C3J J;  4QTR A;  2E5Z A;  2Y0S N;  2KFD A;  3D0S A;  1TP4 A;  1X58 A;  5F1J A;  4BDY A;  3AL0 C;  4LJZ F;  4UUT A;  1ETO A;  5ILS A;  3GFL A;  3CP8 A;  2VKE A;  1ETX A;  5CQE A;  4IO9 F;  4L9N A;  3L9F A;  1P9Q C;  2DMT A;  3IUO A;  4PGH A;  3QPS A;  1T39 A;  3LWF A;  4ASN A;  1MDM A;  3HTS B;  1DP7 P;  4XM3 A;  3NQO A;  3ZN1 A;  3J7A Y;  4G7Z F;  1HW1 A;  3BJ6 A;  5EEA A;  2CYY A;  4ZYA A;  3BR6 A;  1WJB A;  4LFU A;  5JFR A;  1LVK A;  2ZME B;  3LA7 A;  2M87 A;  1XD7 A;  2TDX A;  2VB6 A;  4K2E A;  5M5Y J;  1R5G A;  3HOX J;  3ERE D;  3CC4 I;  4HX8 A;  2X6W A;  4G8X A;  1H88 C;  4NHJ A;  4BBS J;  2EJR A;  1VQ4 I;  1HA8 A;  1ZLJ A;  1S6L A;  4CSW A;  4F93 B;  2E2J J;  2K86 A;  3ZMU A;  2H27 A;  3CCR I;  2JSP A;  2KKO A;  2Y9Z A;  2QBY B;  1R58 A;  1RET A;  3NEU A;  4JX4 A;  1X1D A;  2MSY A;  2HXO A;  1KQ0 A;  1ETQ A;  3N05 A;  4Z6Y A;  5F1R A;  4M9S A;  1JHH A;  1SAX A;  4BH9 A;  1A5J A;  3RI4 A;  3GLX A;  3P7N A;  4FCY A;  1BC7 C;  2CUZ A;  3FXL A;  3BQZ A;  2DMP A;  5J6X A;  3A0H C;  2DFE A;  3LL7 A;  2VC1 A;  4O6J A;  4RB1 A;  3OWT A;  1R9T J;  4FIS A;  4A3G J;  4JYK A;  1UB9 A;  1K7A A;  1MSE C;  3OMY A;  3BR5 A;  5J1Y A;  1ON2 A;  1SFO J;  1R49 A;  2RNJ A;  4RGS A;  4RB3 C;  1DPU A;  2QSF X;  2Q2E B;  3V42 A;  2GOX B;  1QBJ A;  2UV1 A;  4KT5 C;  1JJ6 C;  2X48 A;  5LLQ A;  3TW7 A;  5IP6 A;  1FNN A;  3WOD F;  2VUM J;  3IV5 A;  2A6T A;  1JT0 A;  2B63 J;  1MMS A;  4I99 C;  4NNJ A;  4D9J A;  3I71 A;  1ZQ3 P;  4ZDP A;  2LR8 A;  1FPQ A;  4E7H A;  1TTY A;  4ZC3 A;  4B3A A;  3E6M A;  3HHH A;  3PFI A;  2DPU A;  3CJT B;  1IV8 A;  3S3M A;  3SEZ A;  4GYG A;  4XLC A;  3L2W A;  3ZPL A;  3GTL J;  4HSR A;  4A69 C;  4EMS A;  4XKB A;  2VJ5 A;  2V9V A;  3AG4 H;  3V7S A;  4CCJ A;  2KPM A;  4CUG A;  1OIS A;  1FC3 A;  1HKS A;  4V2G A;  4UV8 A;  1R36 A;  2XDV A;  2DCE A;  3TOA A;  2R5Y A;  2A69 F;  2ZSI B;  1FT9 A;  1YIT I;  4M6X A;  2ECC A;  2JA7 J;  1FP2 A;  1LUJ B;  4ENJ A;  1B72 A;  1IDZ A;  1B9N A;  1P2F A;  4EEF G;  2VBX A;  1NTC A;  5LHI A;  1J59 A;  2IRF G;  1YLF A;  4BXU A;  2VXZ A;  1K6Y A;  5M3F J;  2K9M A;  2FNP A;  3K4K A;  4BGD A;  2R7X A;  4EJU A;  1MZB A;  1V54 H;  2HS5 A;  3O3K A;  4A12 A;  1HOM A;  2JZY A;  4DYC A;  3CCM I;  4E7I A;  2W48 A;  4BKX A;  1MMG A;  4C3H J;  4HRI A;  2HYF A;  1T8I A;  5BPI A;  2GAU A;  3HIF A;  4HST A;  3W2V A;  1QNT A;  1Q1V A;  4YII A;  3GW2 A;  2VBW A;  3FF5 A;  4PGG A;  3SEQ A;  1K4T A;  4KA4 A;  1OPC A;  1R5H A;  1BJZ A;  1BA5 A;  3AG3 H;  2XGD A;  2K4J A;  1WJE A;  2QCO A;  4ENM A;  3I56 I;  2EK5 A;  3JRE A;  4IEJ A;  4HLX A;  3E6C C;  3CCJ I;  2P4W A;  2E60 A;  4PJL A;  1R7J A;  3OL3 A;  4DYR A;  3GFM A;  2DT7 B;  4Q48 A;  2HVS A;  3IWZ A;  3MZY A;  4DZP A;  3J80 K;  2P6T A;  1UG2 A;  3GXO A;  5LGU A;  5C44 J;  1U9O A;  3MEX A;  2HI3 A;  1U5T B;  2MBF A;  3T5X A;  4ZTF A;  3A01 A;  1LB2 A;  1JGG A;  4GDF A;  4H0E A;  3CCU I;  3DTK A;  1VQ9 I;  4A3L J;  3BZC A;  2IS2 A;  2CQX A;  3Q0U A;  3DEE A;  1J5Y A;  4LIU A;  4XOR A;  2R7V A;  2O0Y A;  3JAM Z;  1MJ9 A;  4HX4 A;  3S3O A;  4XN3 A;  2PJP A;  2ZME C;  3G1O A;  3OSF A;  2VPR A;  3I59 B;  4XLN F;  4J00 A;  2WA0 A;  1YRN B;  4LLL A;  2R7F A;  5GAE J;  5B3S H;  1XTA A;  1KYW A;  2L4M A;  4NDL A;  4M3G A;  5LHG A;  3JW4 A;  4E7K A;  1TQM A;  1WI3 A;  1R6R A;  1O57 A;  2JRM A;  2VQH A;  2WB1 A;  4EM2 A;  2W1O A;  4Y4R A;  1B8I B;  2OTL I;  3UNG C;  3FM3 A;  3LQQ A;  2A68 F;  2ESN A;  1HDD C;  1F5T A;  3KP2 A;  3CUQ C;  2P6S A;  1ERD A;  4RGR A;  4RLF A;  1VI0 A;  2MLG A;  1XMX A;  1DGW Y;  1Y8Q B;  2M0M A;  5E3L A;  1JI8 A;  1AA7 A;  2XPV A;  1IUF A;  4ZJZ A;  1N78 A;  4L5E A;  5IYD J;  1IN6 A;  3OIQ A;  2EZL A;  5EEG A;  4ZYH A;  3K70 C;  4YIR X;  1VFC A;  3EUK L;  3K4N A;  5EZH A;  3F6O A;  4I0B A;  4CYC A;  2VT3 A;  3RDI A;  4EJT A;  1DDN A;  1DU0 A;  1IXR C;  1E17 A;  5FRM A;  3OR2 C;  2MD0 A;  2FUG 2;  4PJ0 C;  2Z1D A;  5LGN A;  1RI7 A;  4B48 A;  3WU2 C;  2RRE A;  5IT9 Z;  2JWT A;  5KCM A;  2F6C A;  4UUS B;  2V26 A;  4HZF A;  3COA C;  3BWG A;  4BBR J;  3HOS A;  3OYB A;  4RB2 C;  2L7Z A;  2ZXH A;  3DF8 A;  4L9T A;  1T08 B;  2DA4 A;  1FMW A;  4BQO A;  1IAW A;  3P9C A;  2W4S A;  3UKG A;  5K1Y A;  3OS0 A;  2HOS A;  4KNY A;  1EH6 A;  2WV0 A;  2F5V A;  5L3D A;  1G3Y A;  3IH4 A;  3HOT A;  2QQB A;  2XRL A;  4RS8 A;  2Z9O A;  1XPX A;  1IGN A;  1YFH A;  1D5V A;  2JVH A;  1TQI A;  2V7F A;  2FML A;  3MVP A;  1CF7 B;  4LOC A;  5EG0 A;  1SVL A;  2JRT A;  4KMU X;  1GLN A;  3JTG A;  2O8X A;  2AHQ A;  3SFI A;  2R0Q C;  1FIA A;  3MAJ A;  1O3T A;  3OIO A;  2Z99 A;  4UHT A;  2LD5 A;  2E35 A;  1QVU A;  1WSU A;  2KL4 A;  2VKH A;  2FEZ A;  2FNA A;  2RNG A;  4BY7 J;  2VI6 A;  2VE8 A;  5KVR A;  1UFM A;  3CUO A;  2OC6 A;  2YX7 A;  3FXJ A;  1TT0 A;  4LD5 A;  2ECB A;  1PUF A;  2FMY A;  1FYL A;  3RZO J;  4I76 A;  3PNV A;  1AHD P;  2NXN B;  3KP7 A;  4XKC A;  1Z67 A;  4RM2 A;  2COB A;  2PJR B;  4RAG A;  4P1W A;  2XVC A;  2JT1 A;  1RNL A;  2CJJ A;  4IZZ A;  1HW2 A;  4N0B A;  3WE3 A;  3WTV C;  1P92 A;  1REP C;  2L5Q A;  3JRG A;  3KEY A;  3QWL A;  1VZ0 A;  3VSL A;  1EH7 A;  5E79 C;  3CCQ I;  4IQJ A;  2XF6 A;  2CUJ A;  1HC8 A;  2KDZ A;  2JA2 A;  1XSV A;  1UJ8 A;  3DBH B;  5KAI C;  3NAR A;  1Z6T A;  4B09 A;  1V4R A;  4BNC A;  2RDP A;  1U5T C;  2JUG A;  4KJZ A;  3M07 A;  4E70 A;  4NBQ A;  4G7H F;  5F27 A;  2NS8 A;  2DA7 A;  2BHY A;  2GOM A;  1A6Q A;  2WBM A;  2DTR A;  2QSG X;  2KRF A;  4V2F A;  2JSC A;  4OIO F;  2VQC A;  2BYV E;  4LMY A;  3QPH A;  4U7B A;  2W00 A;  5DCF A;  1LPQ A;  2IBD A;  3DEW A;  3KYL A;  4L18 B;  2G9W A;  5LRR A;  2EZI A;  2LMD A;  3DCF A;  2K9N A;  3KLN A;  3C2G A;  1FTT A;  2LF8 A;  1IW7 F;  3Q0W A;  1IC8 A;  2EIM H;  1BI1 A;  3KEO A;  3V8J A;  2DFF A;  4LIV A;  4A2U A;  2BW3 B;  2M30 A;  4XLH A;  1FX7 A;  2DTZ A;  3H9G A;  4YFK F;  1GUU A;  3A0B C;  4L0Z B;  1O7L A;  3OS1 A;  4L9V A;  3Q5F A;  3KEQ A;  3O8G A;  4HW0 A;  2STT A;  2A6E F;  1S7A A;  5E1W A;  3CCV I;  3V4G A;  1WJD A;  5DEQ A;  1W7P A;  2IVM A;  4UV9 A;  2XRN A;  4W1U A;  4QIW N;  3RKQ A;  4WXC A;  2OAZ A;  5HVQ C;  2O03 A;  1ITY A;  1I5Z A;  2VJ4 A;  5JI6 A;  4LB5 A;  3ZP5 A;  2VKD A;  4EGZ A;  5BMZ A;  2F5E A;  1YW7 A;  4AIJ A;  1V5F A;  4YRV A;  4I01 A;  3IAM 2;  2EV6 A;  4S0H B;  1D0Z A;  5D6F A;  3WGH A;  1IN5 A;  3PNT A;  3DEU A;  1MMA A;  2XAQ A;  3R4K A;  4AVZ A;  1OCC H;  3SXY A;  5B66 C;  4HLY A;  5EF6 A;  1Y1W J;  1JUM A;  2NNN A;  4IKF A;  3KX2 A;  5A2Q Z;  4GXO A;  1J75 A;  3EUA A;  3S2H J;  2XB0 X;  2ZFU A;  2HVQ A;  4M9X A;  3OSG A;  1KU2 A;  4XLF A;  2JQ7 A;  3L2V A;  3PFY A;  4RMN A;  2M7B A;  3BPX A;  3DLL F;  3RKY A;  4I6Z A;  2QWW A;  1BC8 C;  3LSJ A;  1R22 A;  3KP5 A;  3EET A;  3E3V A;  3JAM K;  1S8N A;  1ODD A;  1ZG5 A;  2V4J C;  5H2F C;  2DJI A;  3ELK A;  5LD2 C;  1RKT A;  3RYP A;  2E1N A;  4DIQ A;  1UCR A;  3F21 A;  2K27 A;  4A3M J;  1WHU A;  2EFW A;  5HOO A;  3VDX A;  2BBY A;  2VQG A;  1W5T A;  4U0Y A;  3S2D J;  3T0Y A;  3GYH X;  2M7A A;  3BC8 A;  5HNH A;  2R5Z B;  3VOE A;  4LB6 B;  1BI0 A;  1B6A A;  2LF7 A;  4RGU A;  2CV1 A;  4A3E J;  1KQ8 A;  3UR3 C;  3K2A A;  3FZV A;  3J81 Z;  2KQR A;  2R3S A;  4A0Z A;  2O3F A;  1Z77 A;  2ELK A;  4QPO A;  3FMR A;  4AYB N;  2QYO A;  4XOP A;  4E7L A;  2JMW A;  3CF5 F;  1D0X A;  1CQT A;  3HOW J;  5J40 A;  2GIZ A;  2WWY A;  2CUE A;  2PMH A;  4C30 A;  5DM6 F;  4FX0 A;  1VQ5 I;  2WAQ A;  2G7U A;  3F8C A;  4YFX F;  3BRO A;  5B1B H;  4YFN F;  3OYD A;  3R6S A;  3CLQ A;  2ZXW H;  1YO5 C;  3KYC B;  4BHP A;  3ZXS A;  1LEA A;  1XC5 A;  4IQ4 A;  5J4V A;  4HQE A;  4M6V A;  1LDK B;  2PQ8 A;  1MMN A;  2KJC A;  1ZKG A;  4MLO A;  5IT9 K;  1P6R A;  1S7E A;  1QRY A;  5ERI A;  5E3O A;  2W57 A;  5J4Y A;  3LAJ A;  3EYI A;  1QZE A;  3E0J B;  1V3F A;  1K4S A;  4R1H A;  4DBR A;  4BAC A;  2EFN A;  2ELJ A;  3C2B A;  2BY1 A;  3ZMZ A;  1AOY A;  2JJ7 A;  1LDJ A;  4E6K G;  3GWZ A;  4E7J A;  2HOA A;  2R93 J;  1JKO C;  1OLT A;  4RGX A;  2BXY A;  2D2W A;  2O61 A;  1WJC A;  3A2K A;  2YU9 J;  2LKS A;  3REO A;  1R1U A;  2DT6 A;  1IRX A;  3QP6 A;  2F5F A;  5E1Z B;  3BZK A;  3KE2 A;  3M9A A;  4II3 A;  1G4D A;  4IHW A;  1KYZ A;  4PSX A;  5DTD A;  1MW7 A;  4AU7 A;  4ZYG A;  1RR8 C;  1DUX C;  4Q4Z F;  2OTJ I;  2E2H J;  2DAO A;  1A04 A;  2RVC A;  3RKX A;  1QHG A;  1OR7 A;  2LK2 A;  2XKP A;  3DFG A;  3GTM J;  3JTH A;  1YX5 A;  1ZRC A;  4B43 A;  3I54 A;  2P0W A;  1SD6 A;  2ZO4 A;  2LY2 A;  5DUK A;  4M74 A;  2ME6 A;  1JUP A;  1OFC X;  3QPL A;  2FA5 A;  2QQ9 A;  4UUV A;  2IGO A;  3H0D A;  4P9F A;  1FWZ A;  3VEP A;  2DBB A;  2Y31 A;  4AUX A;  4Q47 A;  1KQ9 A;  2Q1Z B;  3ZOB A;  1ULY A;  1IN7 A;  1FSE A;  2OU2 A;  3KCC A;  3LSG A;  3S2W A;  3JSO A;  1K79 A;  4CZC A;  4PFP A;  4UNO A;  4HX7 A;  1TT5 B;  3HBL A;  2CV0 A;  4X6A J;  3QOD A;  3FXU A;  4JQF A;  4JOM A;  2NS7 A;  3GFJ A;  1FOW A;  3ZQ7 A;  2F5C A;  3OYM A;  2QQA A;  1MH3 A;  5EG0 B;  2Q0O A;  3OV8 A;  2Q8K A;  3ZCO A;  2A07 F;  1LEB A;  3LAP A;  4HF0 A;  5KNL A;  4IVN A;  3ZQC A;  3GUD A;  1HCR A;  1HF0 A;  4XK4 A;  3K9T A;  1HW5 A;  1WFX A;  2NVX J;  2EFQ A;  4DQ2 A;  4F7Z A;  3U1D A;  5BQT A;  3HSF A;  4MQV A;  3E5U A;  2FBH A;  1BR1 A;  3OYF A;  3K10 A;  1X3U A;  3TQN A;  1OYY A;  3ZQQ A;  3MMY B;  1Z7U A;  2P8T A;  2IP2 A;  4XOT A;  2LKX A;  1YX3 A;  3BLY A;  1GXP A;  1JUS A;  2VQL A;  2WB1 N;  3F3X A;  3HKZ N;  5M5X J;  1GDT A;  4D5F A;  5LRS A;  4TV7 A;  1APL C;  2DMN A;  2X1D A;  1X2M A;  1I3A A;  1TQP A;  2F5D A;  4QWQ A;  2XKO A;  4CHU A;  4A5N A;  1KZH A;  3FM5 A;  3ZMD A;  3ZR8 X;  4IHX A;  1YQA A;  2D1V A;  2E19 A;  3HM5 A;  4C9Y A;  2UWM A;  3VYU B;  3MZH A;  4XRS A;  3SDB A;  4HDU A;  3ZQL A;  1GV5 A;  1QZY A;  3H36 A;  2MC3 A;  1I6X A;  1A35 A;  3KIO A;  3WGI A;  1R1T A;  1SFE A;  2LVS A;  4XON A;  2LY9 A;  4KMF A;  1X3Z B;  1O7F A;  2FSW A;  2XPU A;  4B3X A;  2DU9 A;  2XSD C;  1LDD A;  2XUB A;  4PJN A;  4QSH A;  2L9R A;  2X0L A;  2E7X A;  1JJ8 C;  2Z5U A;  3HSR A;  3TED A;  2NS0 A;  5IOZ A;  4BXF A;  3SZT A;  5HS8 A;  1BOB A;  4RAY A;  1W36 C;  2IJL A;  4DZJ A;  4P5O A;  3M4O J;  5B5E C;  3B6C A;  2NVT J;  4I98 B;  2XB5 A;  2TCT A;  2WAE A;  5A2Q K;  1N75 A;  4N4N B;  1EH8 A;  1GT0 C;  1WQ2 A;  1WH7 A;  3FMS A;  2BY3 A;  4BQA A;  2UXN A;  1U6G A;  3CUQ B;  3PM1 A;  4HG2 A;  2NRA C;  3IRQ A;  3RYR A;  1AWC A;  2B7E A;  4I0A A;  3OYK A;  2FE3 A;  1SMT A;  1G3T A;  3JRB A;  2BEO A;  4LK0 F;  2J5O A;  2NOJ B;  3G4S I;  2DOD A;  1NG6 A;  4P96 A;  3S1R J;  1QU3 A;  2R7T A;  4IRI A;  4A3F J;  3TBI A;  3L2U A;  1D0Y A;  3WTY C;  4KN4 X;  5LHH A;  2CS3 A;  4PDK A;  4BAY A;  4CCL A;  2PMZ A;  4EJO A;  2RAE A;  1BW6 A;  1X1A A;  4BDZ A;  1PP8 F;  2K40 A;  3S16 J;  4QPQ A;  3GX4 X;  3AG1 H;  1U8B A;  1E3O C;  2XHK A;  1KU7 A;  5IPA A;  2OD5 A;  3J81 K;  2LYC A;  1S5L C;  1XDS A;  2PG4 A;  2ZJR F;  5CVU A;  3Q9S A;  1OCP A;  3G1L A;  2DMQ A;  4O5V A;  5KHD A;  3FXO A;  2V6C A;  3CJQ B;  1H9T A;  2VE9 A;  2WY7 Q;  1D8J A;  4A3B J;  4KIF A;  2YUS A;  5BNG A;  4M3E A;  2HNH A;  4KDP A;  2XV4 S;  1YW8 A;  3EUH A;  2CRG A;  4B1R A;  4BU2 A;  4MQ9 F;  1LNW A;  1QHH D;  1XCV A;  2GA1 A;  1SAN A;  2DA1 A;  4V19 K;  3O8H A;  5FFZ A;  2BVM A;  4YIF A;  4YEL A;  1YJN I;  3WHB A;  2E5N A;  2R7Q A;  4R8H A;  3WTZ A;  2L02 A;  5HLH A;  4PK4 A;  1YJ9 I;  2E36 A;  1Z6R A;  3M7G A;  4WK8 F;  1MBH A;  1EKE A;  2FQ3 A;  3NRV A;  4HNU A;  5J3L A;  3JRA A;  3T8T A;  2FBI A;  3VYS B;  3TL4 X;  2HZD A;  3S1Q J;  5DCM B;  3RPU A;  3F0C A;  4S04 A;  3C1D A;  4A3I J;  3OR1 C;  4HAM A;  1UZC A;  5F64 A;  2GXA A;  1JKQ C;  4OIN F;  4EV0 A;  1VQN I;  4IOC F;  1SC7 A;  2EWN A;  1D5Y A;  2EQR A;  4NQW B;  1LFU P;  1LVA A;  3TP0 A;  3S8P A;  1MGT A;  2Z16 A;  3BQY A;  1G6N A;  5CQG A;  3OY9 A;  3WGG A;  3WTU C;  3E5X A;  1WWX A;  3C2H A;  1V5G A;  3Q3S A;  1HQC A;  2F4O B;  4O3M A;  1XGM A;  1MBE A;  2H1K A;  2CO5 A;  2IS6 A;  1YS7 A;  4CDG A; 
#chains in the Genus database with same CATH homology
 4ANJ A;  3DLA A;  4C2T A;  4XQF A;  3VYR B;  2L5Q A;  3PL8 A;  4XNF A;  2KMU A;  3KEY A;  3OYH A;  1VZ0 A;  2X1E A;  3VSL A;  3PUB A;  4IQJ A;  3LSM A;  2XF6 A;  2CUJ A;  3DTI A;  2K3P A;  2IGK A;  3LMM A;  2JA2 A;  1UG0 A;  4LIT A;  2R7R A;  3LFU A;  3HPG A;  2WAD A;  3OYL A;  3VWB A;  2JUG A;  4PJJ A;  1UAA A;  3GBG A;  3H9Q A;  3SYT A;  4KJZ A;  3IAS 2;  2VPL A;  4OAY A;  2GOM A;  2WBM A;  3RSN A;  1YE9 A;  2HVR A;  4F3Q A;  2WY8 Q;  1PYV A;  1UEL B;  2KDO A;  2PJR A;  2V6E A;  4F55 A;  2VQC A;  4U7B A;  3VYT B;  2W00 A;  2R7W A;  4XL9 A;  3KYL A;  2LRD A;  3QYB A;  1DQU A;  2R7S A;  3FBI B;  3C2G A;  3OYA A;  3RQ4 A;  2F4I A;  3NWT A;  4HPQ A;  4U87 A;  3MKW B;  3OYN A;  3FHN A;  4LIV A;  4CCN A;  3K4C A;  1WJA A;  2BW3 B;  4XLH A;  4BEH B;  3H9G A;  3PSI A;  3LSK A;  3OS1 A;  2E1M C;  4CCO A;  3F9K A;  3QYF A;  2DXI A;  3LSH A;  2VL8 A;  1WJD A;  4PFO A;  2HU9 A;  1MND A;  2QKM B;  4BQQ A;  2KHM A;  4B44 A;  3FBN B;  5HVQ C;  4BJT A;  1Z7L A;  1DGR M;  2VJ4 A;  3OYC A;  4AYB A;  2VKD A;  4DBQ A;  4J01 A;  3FDY A;  2IGN A;  1V5F A;  2MYS A;  3DPT A;  1TZL A;  1EA3 A;  2BW3 A;  4YRV A;  2IS1 A;  3D5L A;  3IAM 2;  2MC4 A;  4BE2 A;  1DP3 A;  4BEH A;  3I9V 2;  1D0Z A;  3K4B A;  1T95 A;  2OV7 A;  3CES A;  2MFZ A;  2CMP A;  3PNT A;  1MMA A;  3L2Q A;  3CZ6 A;  2L9S A;  2R4G A;  4OWR B;  4AVZ A;  3H5N A;  3VSK A;  2L2O A;  3KX2 A;  4X0G A;  4IKF A;  2KLO A;  4H4K C;  1Z21 A;  2RQQ A;  2X51 A;  2A5W A;  3EUA A;  1G8X A;  2ZFU A;  2HVQ A;  1X1B A;  4C2U A;  2JVG A;  2R7O A;  4XLF A;  2IGM A;  3OS2 A;  3L2V A;  2CW8 A;  3HUG B;  3PFY A;  4RMN A;  3BG6 A;  3OYJ A;  2M7B A;  3OOU A;  3H35 A;  3BCB A;  2KZV A;  4KIS A;  4BS9 A;  5HNF A;  4F52 A;  3DQV C;  4BUP A;  2K5C A;  2M3A A;  2V4J C;  2DJI A;  5LD2 C;  3DPL C;  4DIQ A;  2K9L A;  2L7K A;  4GRI A;  5HOO A;  5LFA A;  1T0F C;  3VDX A;  2VQG A;  2M7A A;  3BC8 A;  5HNH A;  3K4M A;  2CV1 A;  3UR3 C;  1KON A;  4II2 A;  3AKZ A;  1X4O A;  2KQR A;  3ZGK A;  3ZRG A;  1D1A A;  1MNE A;  4NC8 A;  2XF7 A;  2ZSH B;  3D5S C;  4QPO A;  3PSF A;  1G59 A;  2E5Z A;  4R79 A;  4XOP A;  3W3C A;  4BDY A;  4E7L A;  1SFK A;  1D0X A;  3AL0 C;  3MD2 A;  3DKY A;  5JHF A;  3CP8 A;  5CQE A;  4C30 A;  2WAQ A;  1P9Q C;  1Z3Y A;  3IUO A;  4E7Z A;  3BCA A;  5FRN A;  3AFH A;  3PNY A;  3OYD A;  2LC2 A;  2M4G A;  3ZXS A;  4XM3 A;  4IQ4 A;  4YEJ A;  1S9H A;  1LDK B;  1MMN A;  3J7A Y;  3RCO A;  2VJI A;  4MLO A;  3LSI A;  4ZYA A;  3H9J A;  1WJB A;  2LBF A;  4ZTJ A;  1LVK A;  4PSW A;  3E0J B;  2VB6 A;  3HL2 A;  4DBR A;  4BAC A;  2ELJ A;  2CW7 A;  3CJR B;  4ZDO A;  2X6W A;  4XR6 A;  1W36 D;  3HPH A;  3M1C A;  3K4J A;  1HA8 A;  4E6K G;  4E7J A;  3S3N A;  4CSW A;  1OLT A;  4F93 B;  1WJC A;  2KRH A;  2JSP A;  2LG4 A;  3A2K A;  1OR7 C;  2AQF A;  2DT6 A;  1IRX A;  3E1S A;  3QYE A;  1X1D A;  4II3 A;  3N05 A;  2I8D A;  1Z3X A;  4PSX A;  1MW7 A;  4AU7 A;  2UUZ A;  2R7U A;  4EAT A;  2CUZ A;  4PUS A;  4BJ6 C;  4DGW B;  1J09 A;  3HKZ A;  3LL7 A;  3OYE A;  2BOL A;  3OWT A;  1MMD A;  3DPU A;  1NG7 A;  1BR2 A;  1QHG A;  3OMY A;  2VLA A;  1YX5 A;  3CF2 A;  4B43 A;  2P0W A;  2Q2E B;  3V42 A;  2LY2 A;  2GOX B;  1SAU A;  2UV1 A;  4DOZ A;  2Y0S A;  2IGO A;  3H0D A;  2ZXI A;  3HXL A;  2A6T A;  3HG9 A;  4CCM A;  2Q1Z B;  4ZDL A;  4NNJ A;  4D9J A;  4HNT A;  3LSG A;  4ZDP A;  1WJF A;  4CZC A;  4PFP A;  4E7H A;  2VAS A;  2CV0 A;  4ZC3 A;  3QOD A;  4JOM A;  3DU5 A;  4JQF A;  2QKL B;  2X1C A;  2CH0 A;  3OYM A;  4BQN A;  3S3M A;  3SEZ A;  4XLC A;  3L2W A;  3ZCO A;  2HPM A;  5TGT A;  4HSR A;  3TMO A;  5KNL A;  4NUB A;  4XKB A;  2VJ5 A;  4CCJ A;  4XMY A;  2KPM A;  2W82 A;  4CUG A;  3PJR A;  2XDV A;  1WFX A;  2DCE A;  2OUM A;  2KRC A;  3U21 A;  2ZSI B;  3RPU D;  1BR1 A;  3OYF A;  3K10 A;  1FMV A;  4NC7 A;  4BE0 A;  2VXZ A;  4BE1 A;  1K6Y A;  3ZQQ A;  2K9M A;  3MMY B;  3K4K A;  3CP2 A;  4XOT A;  4BGD A;  2R7X A;  1YX3 A;  2VIX A;  3BLY A;  2VQL A;  4CA0 A;  4E7I A;  1MMG A;  4HRI A;  2M4K A;  2X1D A;  2L9N A;  4HST A;  3W2V A;  3SEQ A;  5CKT A;  3ZR8 X;  3DTE A;  4CCK A;  1LFP A;  1WJE A;  3OYG A;  4C9Y A;  2UWM A;  3VYU B;  1E0E A;  3SDB A;  2WAF A;  2HQA A;  3H5A A;  2E60 A;  4LG3 A;  4PJL A;  3OL3 A;  4XON A;  2DT7 B;  2HVS A;  4OAZ A;  3DU6 A;  4B3X A;  1LKX A;  2XC7 A;  2LRE A;  4PJN A;  4ZTF A;  2HDW A;  1Y56 A;  1ZEL A;  4FAS D;  3CMM A;  3DTK A;  5FRO A;  2IS2 A;  4BXF A;  2XF5 A;  3DEE A;  4KT6 A;  1BOB A;  4G6T B;  4LIU A;  4XOR A;  2R7V A;  1X19 A;  4RLQ A;  4DJA A;  1W36 C;  3QOE A;  3EPZ A;  4XN3 A;  4P5O A;  3S3O A;  4F92 B;  4XKV A;  2VXD A;  2BVL A;  2X85 A;  4J00 A;  2IS4 A;  2WAE A;  2WA0 A;  3A1Y A;  1N75 A;  4N4N B;  2LOO A;  4N4O B;  3BG7 A;  4CH7 A;  1Y6I A;  4ITV A;  1N77 A;  4E7K A;  4HG2 A;  1R6R A;  1V5E A;  2VQH A;  2WB1 A;  2DOA A;  2XSJ C;  4XLE A;  2W1O A;  4Y4R A;  3OYK A;  4PJM A;  3DWL E;  2E1M B;  3UNG C;  2W7N A;  4IX7 A;  2CV2 A;  3S32 A;  3K6G A;  1ERD A;  2NOJ B;  4XLA A;  4RLF A;  3RTR A;  1JI8 A;  1X1C A;  1DGW Y;  2M0M A;  1AA7 A;  1NG6 A;  4ZJZ A;  1N78 A;  1QU3 A;  2R7T A;  1PJR A;  3OIQ A;  3TBI A;  3L2U A;  1D0Y A;  4B47 A;  3K70 C;  2CS3 A;  5HLT A;  2V9K A;  3K70 D;  3EUK L;  3K4N A;  3MKY B;  4CCL A;  2PMZ A;  1D1C A;  1X1A A;  4BDZ A;  3OL4 A;  4QPQ A;  3A4C A;  5FRM A;  4XKW A;  3EUH C;  3OR2 C;  2MAB A;  3G2B A;  2MD0 A;  3I3L A;  2Z2S B;  2FUG 2;  4HEA 2;  2HPI A;  3S93 A;  2LYC A;  4D1Q A;  2Z1D A;  4B48 A;  2RRE A;  2V1N A;  3L2R A;  5KCM A;  5KHD A;  2F6C A;  3M8J A;  3ONQ A;  3CJQ B;  2IXS A;  2WY7 Q;  2V26 A;  1U0J A;  3HOS A;  3OYB A;  2LY1 A;  1BR4 A;  2HNH A;  2ZXH A;  3MKZ A;  3D5R C;  3OYI A;  4BU2 A;  1QHH D;  1FMW A;  3SZG A;  4BQO A;  2W4S A;  2BVM A;  3OS0 A;  4YEL A;  2E5N A;  4BJ5 C;  5CPR B;  2F5V A;  2R7Q A;  3HOT A;  4PK4 A;  2KP6 A;  3H5R A;  4E7S A;  2XAU A;  4BL0 B;  3W2W A;  2LH9 A;  2JVH A;  2O5R A;  4HNU A;  2V7F A;  3VYS B;  4E4H A;  3TL4 X;  2HZD A;  1WJ5 A;  4KIT B;  3NWS A;  3OIP A;  1GLN A;  4FET A;  3FKJ A;  3OR1 C;  2VJJ A;  1X4P A;  3DKX A;  2X6X A;  4NQW B;  2KL4 A;  3W2A A;  2VKH A;  2RNG A;  3S8P A;  2Z16 A;  2AQE A;  5CQG A;  3OY9 A;  2X6Y A;  1D1B A;  3HC7 A;  2OC6 A;  4F91 B;  3IP4 B;  4Y33 A;  1TT0 A;  3C2H A;  1V5G A;  3K4L A;  2CFO A;  3PNV A;  4Y3O A;  3AL0 B;  4XKC A;  4RM3 A;  4RM2 A;  2PJR B;  2IS6 A;  4XN0 A;  2LBF B;  4P1W A;  4IZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...