2KPMA

Solution nmr structure of uncharacterized protein from gene locus ne0665 of nitrosomonas europaea. northeast structural genomics target ner103a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kpmA01
2LH9A 2KPMA 3RCOA 2LY2A 2KZVA 3S93A 2LY1A
chains in the Genus database with same CATH superfamily
4N9IA 2LDUA 4PJJA 5BQTA 2UUZA 2Y9ZA 1ERDA 2COBA 4YIRX 1A5JA 4F92B 4IRIA 4I01A 3BR0A 3HHHA 5K7FA 4BACA 1O7LA 4N4NB 1KYZA 3FXRA 4HX4A 5JFRA 3QODA 2KJBA 3KYDB 1T39A 2DA1A 5K5OA 2EFQA 2NAZA 4XIDA 4V19K 2IA0A 2E34A 3DBLB 3HOUJ 3DTEA 1OKRA 1QQIA 5D5VB 3OYNA 2WB1A 3TL4X 3KP2A 1SAXA 3E5QA 2DTZA 3EYIA 2VE9A 4C9YA 3Q0VA 5CVVA 1IDZA 1LNWA 4AD9A 3E97A 3ZN1A 1E3PA 4IVNA 1USSA 1TT0A 2H6BA 4EGYA 4E7KA 1QPIA 5F0HA 5JR3A 1KQ0A 4OIOF 5FFZA 3W2WA 1PVEA 1R7JA 4IQJA 3QYFA 3KCCA 1N78A 1W7PB 3BTCA 4OAYA 2YUSA 1Z6TA 2ZCWA 3DV8A 3E6MA 3D1NI 3OYMA 3BCAA 2CUEA 2J5OA 4XLHA 3EUHC 1ZHFA 1KZHA 4D5CA 3E3VA 1FSHA 2B7EA 4BY7J 1OQYA 2L4AA 3H9GA 3K4MA 2DW4A 1JTXA 5CVJA 1BN5A 2GLOA 2KZVA 4ZYDA 3G4SI 2H8WA 3T8TA 1U2WA 2OZ6A 4GDFA 4B09A 2XUBA 1TT5B 3WU2C 2COMA 3BJ6A 3OS2A 1IV6A 2NVYJ 4BE1A 1NTCA 1LDJA 3ECHA 4MEYF 1HDPA 2IEKA 2M2EA 3IAM2 3C2HA 3PSFA 3W6VA 2JA8J 2YSRA 3J7AY 3NARA 4LITA 4WXHA 1IG7A 2O61A 3MVPA 3CLOA 2F2EA 2K27A 3AAFA 2HOAA 1Y56A 1JUMA 2PN6A 1FX7A 2ZXIA 4NQWA 5LHIA 5ILVA 4GO1A 2ZJPF 4AIDA 1V3FA 2WV1A 3O6BB 3PQKA 2YU9J 1PYVA 1W5TA 4E7LA 2M3AA 1YQAA 4YRVA 2M7AA 3CF5F 4CCKA 1D0XA 1SFOJ 5HLHA 3CCQI 2Z9OA 1VQPI 4M72A 2Z2SB 1WRJA 2RGVA 3FXKA 4BU2A 3JRIA 4EJOA 5AIQA 2KQRA 1ZELA 4JX6A 3CDIA 2HXOA 4CUGA 4CYCA 2GBYA 1MJ9A 3UKGA 1ZQ3P 3CC7I 3AKZA 2VOPA 1FP2A 3BZCA 3ZQLA 1MMDA 4YFXF 4ETSA 1VQNI 4XRFA 1P2FA 2EJRA 4NNJA 4CHUA 1QBJA 3OYEA 4L5IA 1OLTA 3ZMDA 4PUSA 5DD4A 4I0BA 3HYIA 1W0UA 5J6XA 2XAFA 1GXPA 1JJ6C 4XRMA 1HC8A 2MC4A 1VQOI 4AVZA 2HNHA 4LLGF 2B63J 2HTSA 3GCMA 2STWA 2PMUA 4LIVA 5K7HA 3F6OA 3CUQA 4YFNF 2ZXHA 3VPRA 2FF4A 3HKZA 4I98B 1WCMJ 4NC8A 3FXUA 1AKHA 2CS3A 1S5LC 4AYBN 3K4LA 3LSHA 2JVGA 4BUPA 4BJTA 4BQOA 2DA5A 2WADA 2KKOA 2R7RA 3K70D 4LG0B 1R5ID 2HQRA 2MW8A 5E3OA 3GW2A 3SJMA 3SDBA 2LK2A 2LYCA 2ECCA 2OA4A 1MIJA 1GDTA 2IBDA 2QCOA 4BQAA 2RAEA 4M3EA 1DP7P 1ZRFA 2ID6A 4ZYAA 2DN0A 2QSGX 2XGCA 1O3SA 5D6EA 3OV8A 2KIQA 4CZCA 5M5WJ 1MZBA 5L3GA 4A0XA 2FE3A 5ICGA 1YLFA 4MO7A 1MDMA 3RI4A 2HI3A 5D4RA 3IWFA 3LSIA 3DKWA 3NWTA 1WJFA 3FXQA 2XGDA 3S15J 2UWMA 3MQ0A 2NXNB 3M07A 2PJRA 3T0YA 2VQHA 2R5ZB 1RR7A 4XLCA 5CVIA 5DD8A 4J19A 3RZOJ 1RESA 4XMYA 4ON0A 1EH7A 2CFOA 2Z16A 4DJAA 3GF2A 2G9WA 3H3VK 1STZA 5FKNA 4E7SA 2PJPA 3L9FA 1VQ8I 5J3LA 2TRTA 3BG9A 4HNUA 2FX0A 2MC3A 2QM3A 3TDUC 2O8KA 2CWEA 4FE4A 4NHJA 3I0TA 2Z1DA 4RLQA 2Q0OA 1OCTC 2IP2A 5LLQA 2O3FA 3ABKH 1S29A 1B4AA 4BKXA 3T8RA 1UB9A 2PMZN 3BQZA 2JA7J 3IKTA 4B48A 4NUBA 3BOQA 4EM0B 5LEJA 2VOOA 2W4SA 4KN7X 4A93J 1BC7C 4QPQA 1YRNA 2WAEA 4A2UA 1Y39A 1MW7A 1DUXC 1O3QA 1QVUA 2W25A 3QOEA 1FSEA 2Y48A 5D5WB 2HQ5A 1ETKA 5IYDJ 2OQGA 3LQRA 3P9KA 3FWEA 3ESWB 1TQPA 4BEHA 1MNEA 1ZR4A 3GTLJ 3KEOA 5D5XB 3QPTA 3LSRA 3JW4A 1W4MA 3C18A 4WWCA 2NOJB 2M4KA 4A3JJ 1A31A 1G3WA 2RQQA 4ZDOA 4M3FA 4D9JA 3TW7A 3EUHA 2GIVA 2FD5A 3K1PA 3ERED 1XDUA 3A01B 4FX4A 5LHGA 2NVTJ 2JTVA 3M4OJ 4Q48A 1ON2A 2OZUA 4RBOA 5GTIC 4KYWA 3NRVA 3RIRA 5FLXK 1YYVA 3GX4X 3O2PE 2ZSIB 4EJVA 3TDZC 3AG2H 3LA7A 5D4SA 3L2QA 3BTLA 1IDYA 1GLNA 4BXXJ 1WJEA 3F72A 3WHCA 4AU7A 1E3HA 3MD2A 3R0AA 4KIFA 1MMGA 1OCRH 3KP6A 1S3JA 1ZGJA 2EZHA 1ORKA 3WG9A 2XC7A 1K4SA 3PO3J 2YR2A 3OIQA 2JSPA 1A6QA 3CP8A 3UR3C 1IV8A 1I3QJ 3JCUC 5HDNA 2CV1A 3PIPF 3A03A 5CQGA 2R5YA 5DEQA 2Y2ZA 5DV5A 3JAMZ 1USTA 3U21A 2OTJI 1ETYA 2BOLA 2Y9YA 3F8FA 5F1RA 5LGNA 2X51A 2KDZA 3M8EA 1B6AA 1W7PA 3FZVA 4JK1X 3ZMZA 1RKWA 4L9TA 5L3FA 2CH0A 4ABZA 1MBKA 1Z91A 1T98A 1IZ1A 1Q1HA 2W82A 4P1WA 4Y33A 5D6FA 4C2UA 3ZQCA 4PJMA 3VSKA 4GYGA 5C44J 2JQ7A 4KIBA 4OWRB 2L01A 2HKXA 2CRGA 3RTRA 4BXFA 1X4PA 1SFXA 2LC2A 3TO9A 5B3SH 3CCUI 5TRDA 2K02A 5FLMJ 4Q4ZF 5E8GA 3E6DA 5L3DA 4A6EA 4E70A 1TW3A 5DYMA 5BS6A 4A3DJ 3CJRB 4XSXF 1WPKA 3JR9A 1B59A 5JHFA 3K4JA 4G12A 3JAMK 3FX3A 3KX2A 1JJ8C 1XGMA 3LAJA 1CQTA 2D2WA 1O57A 1M1EB 3FBNB 1J2XA 2A07F 3M1EA 4AIJA 3OYIA 5EEGA 2GA1A 2LVSA 1SVLA 4ZTJA 3HTSB 4Z2YA 3WTUC 1F5TA 3PM1A 2P0WA 2UXNA 5F27A 4XONA 3L1PA 2WAQN 4II2A 2M5WA 3HOTA 1BM9A 1DGRM 4PJNA 4A3FJ 1K6OA 4BNCA 2WAQA 1MGTA 4IEJA 3FMSA 2EFPA 1F1ZA 2V6CA 5HS8A 4H0EA 2LSOA 3I59A 1POGA 3FM3A 5BNGA 2AHQA 2JA6J 1FMVA 5JHUA 3D5SC 5L3CA 4Y17A 2E7XA 2Q1ZB 5HODA 1RETA 3RSNA 5GPAA 3H9QA 1VQ5I 1BW5A 3L09A 1YFHA 3WTVC 2CQ7A 2W84A 4RGXA 2M9HA 1KGSA 3MKWB 4J00A 2R92J 3BR5A 2BW3A 2E35A 4CZZA 3S3OA 2XF7A 3ABUA 1OJLA 2OCEA 1IXSB 5EEAA 2CQKA 1U5TC 3CO6C 1ZREA 2AS5F 1MH3A 3C1DA 3JREA 1Q1VA 2R7OA 3PNYA 3JRAA 2XROA 2LOOA 2F5DA 3IH3A 1B72A 3CJQB 1LFPA 4XKVA 2V7FA 4UB6C 4L5EA 4GXOA 3VSLA 4N0BA 3BQYA 1K78B 4RB2C 3AG3H 4BL0B 2ZMEB 3TW6A 5J1UA 4ZH4F 2IGOA 2KL4A 4B44A 4BXUA 4I2OA 4UVBA 1MJAA 3KPHA 2QVOA 4E7JA 2X0LA 1FP1D 1O7FA 2L9SA 3L2WA 3CCLI 2ACJA 1UG2A 1MBHA 4PZJA 5DCFA 5H6QA 1J9IA 2DJNA 1UHSA 2LKPA 3NAUA 3QP6A 1NG7A 2XPWA 4HDUA 3WG7H 3I5UA 4OINF 5HOOA 3TKYA 1MKMA 1OISA 1X2NA 3QYEA 2YX7A 2ZC2A 2DOAA 4PGGA 4MHGA 1YX3A 4IHSA 4AM3A 2K9MA 3ZMUA 3P9IA 2E7WA 2IA2A 2E1OA 5EYRA 4NQWB 1J59A 1TC3C 3LSMA 4UNOA 3S14J 2HEOA 1G2HA 3HSRA 1RNLA 5B66C 1X19A 2MYSA 4CCJA 1SD6A 3S8PA 2FUG2 3HOXJ 2ZXJA 3MKYB 4O3MA 4EATA 1B1BA 2XRLA 2XB0X 2OQRA 1ETVA 2VKEA 3K69A 3RKYA 1XGOA 1DU0A 1UELB 2DT7B 1J7KA 4RLFA 3ABMH 3C3WA 1PUFA 2VUMJ 2FNAA 1Z3YA 4GCVA 2F6CA 2MABA 2VE8A 3QPHA 3RKXA 3ZGKA 3U1DA 2EINH 3DBRB 3EETA 3J7ZI 3FMQA 3PIOF 3A02A 4BE2A 1WGXA 2XKOA 2M8EA 4G6QA 4IHYA 3ZQ7A 3V42A 1P7JA 1MNDA 2VPLA 4WXCA 2G7UA 4F52A 4M74A 3HZJA 4S0HB 3SHFA 1XGSA 4CYCB 3F3XA 1L0OC 3H5AA 1IRXA 1Z6RA 2LH9A 3FXJA 5AONA 1F36A 1Z21A 2X6XA 3WE3A 1K61A 1SD4A 3CMYA 1V5FA 2K7LA 1SVOA 4DYQA 1R5HA 4LG0A 3ASOH 4HV6A 3PFYA 1XMAA 1SAUA 1ZG1A 5L3EA 1F4KA 3V8JA 1JI8A 1FY7A 2ZMEC 1HCRA 5FKKA 5HLGA 3G1LA 3SYTA 2RKHA 2M4GA 2Q8KA 1YITI 3F0CA 3RQIA 1W36D 4OAZA 4YIIA 1TWCJ 4A3MJ 4A0ZA 2DT5A 3ZMTA 4LLNA 1JGGA 1AHDP 2BXYA 1I6XA 3TP0A 3OOPA 1PP8F 2ISZA 1IXRC 3JTHA 2JA2A 2R5YB 1D1BA 4PJLA 1Y6IA 1W5CC 2IA1A 3DKXA 1Z1DA 3GYHX 1Y0NA 4MQ9F 3WODF 3WE2A 2QA4I 1OPCA 3WTYC 2P6TA 4W1UA 1O3RA 4XORA 2P8TA 3I54A 1TLHB 1SD7A 4DNCA 3ZPLA 1YW7A 3HPHA 2DA4A 2EIMH 5E17F 2XASA 2F5VA 4IRHA 2EFNA 1FWZA 4HNTA 1MD0A 4EEFG 1XSXA 1LVKA 2EH3A 2EIKH 3OMYA 2CO5A 4JP0A 2OTLI 2X1DA 3C2GA 2FBKA 2RN7A 3CUQB 3J7YJ 2OAZA 3BP8A 2VQLA 3WTWC 2LNBA 3H35A 4RGSA 2HKOA 3G6EI 2EV5A 3VYUB 2A5WA 4IKFA 2XB5A 2ZSHB 4KN4X 4XBFA 4S05A 3OYAA 5FO5A 2MGQA 5F6FA 5H20A 3PFIA 2OUMA 4B4CA 2MD0A 5FJ8J 3Q9SA 1BR4A 3B02A 3RPUA 3A0HC 2W1OA 2X9DA 3SZTA 3LSPA 3I58A 1R23A 3OYGA 4L9JA 3SDGA 3HGYA 5JVTA 5D8LB 1I3AA 3VB2A 4ESJA 2K40A 3HEFA 4IO9F 4KT6A 2ZJRF 5J47A 4IJAA 1FOKA 2H8RA 1IUYA 2JWTA 2HOSA 3JRDA 2XAGA 3NEUA 2GXBA 1XX5A 2PX9A 3H3UA 2L02A 3K0LA 3RKQA 4MTDA 4IL6C 2V9PA 1TWAJ 2DBBA 2LMDA 3WTSC 1VQ6I 3CDHA 3AL0C 1BJAA 3QWLA 2E5NA 4CA0A 1JE8A 2MG4A 3BG3A 1H8AC 2H1KA 2VB6A 1DPRA 2ELHA 1HF0A 4ZTFA 2EZLA 4CGZA 2CU7A 5JLXA 3HOZJ 3DP7A 2EV0A 3HOVJ 3J80K 2XVCA 2P5KA 2W7NA 4UUVA 3V7SA 1S6LA 1HLVA 1D8JA 1BOBA 3OYLA 4XNFA 4R1HA 5EZHA 2E2JJ 5FRNA 4AWXB 1ETXA 4XM3A 2L7FP 3MEXA 2K4JA 1MBGA 2DMPA 3QP5A 1R36A 4MIMA 1U8RA 4M6VA 2HQNA 4P9UA 1P4WA 2DA6A 3A4CA 4RAZA 3QQAA 4W97A 2R7QA 4XSZF 4Y13A 2UV1A 4LFUA 2UZKA 4Q47A 3ZQIA 2DMQA 3SZGA 5E3MA 1VTNC 1Y1WJ 4CH7A 2FBIA 5CJ9A 3VYRB 1OYYA 1ZN2A 4C3JJ 1AKHB 4LJZF 2E1NA 3T1BA 1QGPA 2XF6A 2BZTA 2F48A 2QBYB 1EH6A 4Y52J 3V8LA 3D0SA 3DU5A 4LB5A 1DDNA 3KP5A 1X1CA 3ISPA 1P92A 2VASA 4AYBA 3OYCA 2O0YA 2R4GA 4BJ5C 1ZH5A 3J81Z 4FETA 5C3EJ 1VQ9I 1FYMA 2QSFX 5TISC 4HEA2 1YE9A 4ZZLA 1Z7LA 2KISA 4DIQA 2L9RA 2P5LC 1XSVA 2M1BA 1GV2A 1JHHA 1HKQA 1X1PA 1D0ZA 2VQCA 1JT6A 2K9SA 2H27A 1XPXA 4BQNA 4PFPA 4G94A 3TO6A 2B9SA 1YJ9I 4UUSA 2AQFA 3DXJF 3ZP5A 3K7AJ 1RRJA 5J4YA 5CPRB 1RR8C 4H4KC 4NBQA 2JUGA 3KZZA 1AWCA 3GTKJ 4C3HJ 1X3WB 4U88A 4CCNA 3FM5A 4IZZA 3CCMI 3H1CA 1G4DA 2Z99A 2VBZA 3VEPA 4XQFA 4DYRA 3QPLA 4KUMA 4LB6B 1RKTA 3HRTA 2CV2A 2TDXA 1MBFA 2NVXJ 4KMFA 2VJJA 2ME6A 3VODA 4RA2A 2WBMA 3K4KA 5TJJA 3TMOA 2K85A 3W6JB 2KIUA 2QWWA 5IY5H 4B3XA 4ENJA 1LEBA 1TWGJ 3FDYA 3ULQB 1DQUA 1QZEA 1B9NA 5FD6A 4A69C 3CDLA 5DCMB 4MQVA 3R61A 3WGGA 2VL8A 1PUFB 3M8JA 4DGWB 4G7HF 4DZPA 2OF7A 2WTEA 3W2AA 1FMWA 4YIFA 5FKLA 2ZXWH 3CMAI 2VPRA 3OL4A 1E3OC 3ZR8X 3K4CA 1YW9A 2PMZA 3BG7A 3CD6I 9ANTA 3QRFF 2D1HA 1ZG3A 3HB9A 4P96A 5EG0B 3IUOA 3HM5A 3KLNA 4I99C 3V7CA 1YIJI 1ZARA 1NK2P 4OIRF 1LFUP 2M87A 2M30A 4IHVA 1QHGA 3CZ6A 4QPOA 3HSEA 1VZ0A 3U1KA 2X6WA 2UXXA 4V2FA 2WC2A 3OYJA 2VKVA 4I0AA 3H9JA 5E20A 2ZB9A 2H09A 1OCCH 3OIOA 5KK1A 3J7AO 5ED4A 4HRIA 5LBQA 1T8IA 3HUGA 1DP3A 1S7OA 4P9FA 3FK6A 1EA3A 2XSJC 3KEYA 2JPBA 2BGCA 1W36C 2HPIA 2Y0MA 3L00A 4A6DA 4FHTA 1YO5C 2XHKA 5HDGA 2VC1A 3SZPA 3N4MA 1R4NB 1BIAA 5ERIA 2HDDA 1B72B 1FBUA 2KPMA 2Y31A 4PFOA 4HF1A 3AL0B 1RI7A 3LA2A 5EZGA 1ZRDA 1IO2A 5L3BA 1ZYRF 1K78A 2G7HA 2ELKA 1WSUA 1AOYA 1TNTA 3JRBA 1OFCX 2NYXA 1WJCA 3KYLA 2LBFB 2JN6A 1KU7A 2F4MB 2R7XA 4G6TB 2BV6A 3FKJA 3K2ZA 3CLQA 3K70C 2KRFA 2DAOA 6PAXA 1LJ9A 1Z05A 4YFKF 3GLXA 3OR1C 3A1YA 1VQKI 1PUEE 4X1EA 2DXIA 2DT6A 2OC6A 4P5OA 2VBXA 3S1NJ 1JTYA 4UB8C 4U0VA 4Q5SF 2VBYA 4MFDA 4AUXA 3TOBA 4BJ6C 2QLZA 2WB1N 3V8KA 1REPC 4QLCU 1BBYA 3NWSA 1N25A 1LKXA 4UV8A 3RYPA 3FKIJ 4CCOA 2RNGA 5FD5A 3ZOBA 5EEHA 4RS8A 2ADUA 3L2RA 1XDSA 2YX4A 1GVJA 2RNJA 3TBIA 1BI2A 1R9TJ 2XPVA 4Y3OA 4F93B 4UVAA 1Y0UA 4N4OB 3JRHA 2XIGA 1UG0A 2MLGA 3BPVA 1X1AA 1J0RA 2DPUA 3SQNA 5M5XJ 5GAGJ 1R4MB 2K9QA 4LK1F 4XKWA 4CYDA 4S04A 1PJRA 1FT9A 1G59A 4Z6YA 1Z0XA 1QRYA 2I8DA 2KDOA 2LY1A 1A35A 3GEZA 2WY8Q 2LY2A 2PFBA 2HGCA 4HG2A 2L7KA 4HZFA 1IN8A 4LK0F 4L0YB 4HQEA 1J09A 2R7WA 1W7PD 3WTZA 2L9NA 2XRNA 1WI3A 2Z33A 5DUIA 5M5YJ 5HLTA 2XV4S 4XOPA 1K79A 3KYCB 3DBHB 3PL8A 3MZ8A 1ZG5A 2JT1A 2OU2A 1OR7C 4RAFA 2DMUA 4L9VA 2JMWA 4DW6A 5F1JA 3WGHA 2QUFA 2E1CA 1JXSA 1IW7F 4EMSA 2JSCA 4CDGA 4YELA 4ZYHA 2V26A 3OYDA 4XKBA 3WHBA 4A5NA 3S3MA 3HRSA 2P6SA 2XGEA 4BH9A 2HOTA 1U0JA 3F21A 3QU3A 3BZ6A 1WZ2A 2E36A 2HYJA 1ZKGA 2JK3A 2RC4A 5F04A 1HA8A 1IRFA 4HAMA 5JI6A 1OMIA 1WJDA 1UHWA 2HXIA 4CO8A 2HYGD 2OD5A 5KHDA 2F5FA 5CVRA 3DKYA 3GXOA 5E1XA 5A2QZ 5HNHA 1X3UA 4UUSB 1B8IA 2OBPA 2QQ8A 1JHFA 1HKTA 1BOAA 3CCEI 2ECBA 5DM7F 1JUSA 3ZMVA 4EQQA 2DTRA 2GIZA 4LLLA 3GLLA 5DS9A 3KIOA 4LGWA 2R5ZA 4U0WA 1U3EM 3VYTB 4KDPA 1OCOH 1G3SA 3K1NA 4OMYA 1NG6A 3I3LA 1T95A 1FBSA 2DMNA 1WQ2A 5JVGF 1APLC 1TP4A 2V1DA 1V54H 2LFBA 3ZQGA 3RQ4A 2E1MC 5F0FA 4O5VA 3F8MA 2ETHA 3HKZN 2QZ8A 1DGWY 3Q0UA 2CW8A 2DFEA 3BT9A 4QSHA 5F64A 1IN5A 1LDDA 1YIOA 2HYFA 1XC5A 1WJAA 2NS0A 3WU0A 2IT0A 3OSGA 3DPTA 3E6BA 3I53A 2F5EA 4JQFA 3KZYA 4KT5C 1O4XA 2XGXA 3HHGA 3K10A 1FOYA 4RGUA 3RDIA 5GAHJ 2R7TA 4WF2A 1Y8RB 1AA7A 1XMXA 2WAFA 4D5FA 4XLFA 4OMZA 5HS9A 4BGDA 4F55A 2BHZA 4A3KJ 2CSOA 2VBWA 1XD7A 4RAYA 1XSDA 4FCYA 2EILH 5E79C 1NK3P 2DFHA 1XN7A 3JSPA 5EGOB 4I7HA 5ICEA 1YRNB 2QENA 1YS6A 2HR3A 1RZ4A 4EGZA 2IAIA 1JUPA 4GYIA 3DPLC 2E71A 1N75A 2OPTA 1JKRC 5IOYA 1BI3A 1XMKA 3BZKA 3ERMA 1IGNA 4BDYA 1OYIA 2FOWA 3IRQA 4B8XA 1BR1A 1ETWA 3EDPA 5F0CA 2FXAA 2VJ4A 1YJWI 4ITVA 2OCCH 5GP9A 2ZMEA 1QHHD 4M9ZA 2XSDC 1P9QC 2QQ9A 3I71A 3HUGB 2NRAC 2FQ4A 1YOVB 1MJBA 1FYKA 3FIWA 2E19A 3PO2J 1F9NA 1DU6A 1EV7A 2M34A 4HQMA 2GXGA 3VYSB 3ECOA 2G0EA 3G1MA 4DOZA 5E1WA 4B47A 2HDWA 2AQEA 3IH2A 2EV6A 3AG1H 4CICA 3CO7C 1FTZA 4PGHA 3BWGA 1YTYA 1BJZA 3KP7A 3F22A 4BDZA 4IPAA 5CYVA 4FASD 4ENNA 2GA2A 1F43A 2DQLA 1GT0C 3L7WA 4XKCA 1WH7A 3GTGJ 1FJLA 4RM2A 1A36A 1JT0A 3F8NA 1P4XA 3SFZA 3ML6A 1QA6A 3F8BA 2MH9A 2BVMA 1NHAA 3GO5A 3CMEI 2P7VB 4G7OF 2BVLA 4NB5A 4KFCA 2ESHA 4AC0A 5IT3A 2V9KA 3MCZA 1U5TA 1GUUA 4GRIA 4EJUA 3JRFA 1T33A 2EA2A 2BY0A 3I4NJ 3BDDA 3IRRA 2I5UA 3DF8A 5GTHC 3L2VA 3OYFA 1ZR2A 2O7OA 2NNNA 2W57A 5FKMA 4A3LJ 2CUJA 2VKHA 2HDCA 2KRHA 4EM1A 4G7ZF 1I5ZA 2H6CA 2NNYA 2PQ8A 4MGRA 4XN0A 1WKMA 3IAS2 3S3NA 1TWFJ 3VOEA 4IHXA 4A3IJ 2IGNA 2DK5A 1OCPA 1R22A 2ZKZA 1XCBA 2P81A 1UCRA 2X85A 3VFZA 3ZXSA 2HU9A 2YPRA 5DTDA 3JRGA 4PK4A 2CQXA 2GAUA 2WA0A 1VQ7I 3BG6A 3GVAA 3LAPA 2A68F 2P5VA 3OL3A 4BBSJ 2HZDA 3H3ZA 1EF4A 3DEEA 3KLOA 1P7IA 2GM4A 2FMYA 4JX4A 2CW0F 3BJOA 1MMSA 2IGMA 1JGSA 3BTJA 3G71I 2Y0SA 1K4TA 2VIXA 1QPMA 4WX9A 3OOUA 3IKVA 2R7VA 3MKZA 5B1BH 2NVQJ 3R60A 2KRCA 3DU6A 1U8BA 2ESNA 2ISYA 2BE5F 2Q2EB 3LSJA 4M6XA 3U9GA 1LUJB 4BAYA 2RDPA 1BA5A 2VKDA 3CJTB 1BIBA 2LF7A 2DDAA 2WWYA 2TCTA 3COAC 1P6RA 1VF9A 1L3LA 1HBXG 2IS4A 1U6GA 2GWRA 1FEXA 2QGUA 1S72I 1TTYA 3F8CA 3S1MJ 1UAAA 3CC4I 2VN2A 1YG2A 2LREA 1D5YA 3I56I 3OSFA 2OJED 3SFIA 1X1DA 1U9NA 1I39A 4NDLA 2Z3YA 4CXFA 4LD5A 3S17J 3HIFA 1IN7A 1FC3A 3FMRA 4U7DA 2CQNA 1Y8QB 2RVCA 3RYRA 2CV0A 2HFHA 3KZIC 2A5YB 2DMTA 3S2DJ 1KA8A 2IS2A 1WVRA 1S9HA 3RCOA 3GTMJ 5B5EC 3C2BA 3BROA 3W2VA 4XLNF 4G9YA 2EIJH 3GFIA 1E2XA 5H2FC 3MKLA 2MSYA 2K4BA 2A69F 2FJ1A 3O8HA 1V5GA 1S8NA 2NOGA 3K2AA 2VXDA 1SEUA 2Y30A 1ON1A 5IP6A 3FF5A 2X6OA 1MNMC 1MBJA 1R1TA 2HS5A 4EM2A 3P9CA 4ENMA 4XOTA 2IJLA 2DI3A 2WY7Q 3CJNA 2CJJA 4NC7A 3I4PA 5BPDA 3Q5FA 1TQIA 4NC6A 4OU0A 5TGTA 5GPCA 3HL2A 3S93A 2HOEA 3IP4B 1HOMA 5ILUA 1R71A 3A2KA 2XAUA 4A3CJ 3CF2A 5FB2A 4PCQA 5DM6F 3D5LA 2LG4A 4LIUA 1LVAA 1R1VA 2FBHA 3N05A 3BJAA 2MBFA 3CUOA 5ICFA 1R6RA 3HRUA 2M7BA 1G3YA 4C30A 4TV7A 3ABLH 5FLXZ 2P7CB 2FA5A 2I10A 4ZYEA 4DYCA 2W48A 1PDNC 4DBQA 3G2BA 2L9VA 3GTOJ 4MEXF 2O03A 4C2TA 4HBLA 1V5EA 2JUCA 3ASNH 1ITYA 3GZ5A 1SD5A 3DTKA 2VT2A 1ONVA 1U9OA 2KP6A 2FOKA 1TNSA 4AVPA 3PQJA 3T5XA 1KU2A 2W00A 4HSTA 1ODDA 3RJPA 1DPUA 2BY2A 2QKLB 5M3FJ 1HQCA 2KJCA 4WK8F 3V4GA 3N97A 4GFBA 1QNTA 2Y75A 2JZYA 1KYWA 2M8GX 3R4KA 1R1UA 3HSFA 1VI0A 2X4HA 2E2IJ 1ZGWA 4PDKA 4F3QA 3CQZJ 4GGGA 1FZPB 5EJCA 5IP7J 2XKPA 3O8GA 5B1AH 3ZN0A 3HG9A 1UZCA 1ETQA 1YS7A 2E5ZA 2MA3A 3BR3A 5IYCJ 3FISA 4RAGA 4ZJZA 2ICWG 2F5CA 2KHMA 2YU3A 4R8HA 3I55I 4OIQF 3CTAA 2L7MP 1MMNA 3IWZA 3Q3SA 5FFXA 2QBYA 2QF7A 4F7ZA 3HXLA 3GBGA 3GFMA 5EGOA 4E4HA 1R58A 3ZRGA 2YS9A 5J8CA 2LBFA 4BHBA 4IHTA 3LL7A 1K6YA 4ENKA 4FE7A 4JOMA 5LD2C 4UUTA 1LEAA 2IW5A 2HWVA 3LA3A 2L5QA 2GOXB 3LSGA 1ZK8A 2HPMA 4ESFA 2R0QC 1G8XA 1HW5A 4MLOA 2R93J 1BI0A 2V79A 2EK5A 2IGKA 4M9SA 4EJTA 3QU6A 4KNYA 3IC7A 3UNGC 4BHPA 3HC7A 3CMMA 2F4IA 2DYRH 2FU4A 3DEUA 4B1RA 1B8IB 1U5TB 2K9LA 2BY1A 5HVQC 4OIPF 2CW7A 2AXLA 1CF7B 3E0JB 4JYKA 2E60A 1UFMA 2CGPA 2X1EA 1IF1A 2V1XA 4RB3C 2A05A 2ZJQF 5FLVA 2DOFA 3LNQA 2QYOA 3ZQQA 5KVRA 5BMZA 3H92A 3VWBA 1H89C 2QQAA 3WTXC 3ONQA 1SMTA 3B6CA 3K4NA 1RIOH 1LFBA 1SFKA 5CVUA 2AO9A 4HDVA 4IXAA 3ABTA 1UHMA 2LD5A 3GZNB 3CCSI 1HSTA 1ZAOA 3ELKA 3BPXA 3JSOA 5FGMA 1HKSA 5KNLA 3F9KA 4D7MA 1FIAA 3LFUA 3LSKA 5IT9Z 1BW6A 5J1YA 2GOMA 5C4JJ 2GQQA 3HPGA 4I76A 3JRCA 1XGNA 3H36A 2BXZA 4II3A 1FTTA 3KP3A 4HW0A 4L18B 4PJ0C 2HVSA 4A3EJ 1D3YA 3M1CA 4UXNA 3DQVC 3TGNA 2XF5A 1XTAA 4I6ZA 3FHZA 1Z77A 4Y4RA 4HNVA 2BEOA 4FTHA 3S2HJ 1WH5A 1J5YA 2ZO4A 4A3GJ 1LE8A 3D5RC 3H5RA 4Y15A 2JRTA 3F6VA 2V1NA 4KMUX 4XR6A 1QZYA 2IVMA 5E1ZB 2V1UA 2PEXA 5HNFA 1J75A 2BHYA 2R7FA 2RREA 4PSWA 3PNTA 2R7UA 1TW2A 1GHCA 5CLSA 2K5CA 1HW1A 3CCRI 2H1LA 2Y0SN 3WGIA 4IQ4A 3BY6A 1OYWA 3I64A 3DPUA 4HLXA 1IN6A 3K6GA 5E3LA 3ZMSA 3CESA 1V55H 2JVHA 2N8GA 3KE2A 3E6CC 2DFIA 2HQAA 1D1AA 2K9NA 2ZBKA 3E5UA 4HA8A 4BHCA 1YJNI 1X2MA 2FMLA 2HZTA 2PMHA 4O6JA 3TOAA 5K5RA 2EZIA 5BOXA 2DA3A 4IF4A 2VXZA 3OIPA 3OS0A 5C4XJ 3M7GA 1X58A 3OS1A 1T08B 2K86A 3HBLA 1T56A 3DFGA 4F91B 2A61A 5J4VA 5BPIA 3FHNA 3H0DA 1P4AA 1K83J 2CMPA 1IC8A 4IX7A 4MNUA 1BR2A 1QVTA 2NVUB 3WTTC 2KMUA 1ZLJA 1VNDA 2KIFA 3MN2A 4AIHA 4DZJA 2QQBA 4ANJA 3I9V2 2VI6A 4JX5A 2IS6A 1KONA 4EV0A 4K2EA 4XK4A 2LTPA 1O3TA 5LGTA 4D7NA 4J01A 2CUFA 3F23A 4A12A 2V4JC 2JRMA 4HX7A 2R7SA 1HXDA 4Y7NJ 4M3DA 2DK8A 3B6AA 3HDDA 4YG2F 3E5XA 5ILSA 3GZ6A 3W6KB 3IHUA 5CKTA 1JKPC 1Z7UA 2ME0A 4G6DA 1RPWA 5KCMA 5FROA 3V7RA 2FRHA 2EFWA 3P5JA 2PI0A 2P4WA 4QIWN 1A6IA 1TZLA 1I50J 2IRFG 2O6GE 2DFFA 1RUNA 2L4MA 2LKSA 2HVQA 3ZQFA 4BEHB 2AXTC 2EA4A 1ACIA 2K3PA 1Z9CA 1S7EA 4BY1J 1FOWA 1WWXA 1WJ5A 1KU9A 3BG5A 3M3YJ 3ROUA 2STTA 4UV9A 2R7DA 2VLAA 5IP9J 1KU3A 4BQQA 4FX0A 1UJ8A 1T38A 4B43A 2GZWA 4FT8A 2LLKA 2M0CA 2O5RA 4M71A 5M3MJ 4XICA 2V9VA 3HOSA 3MAJA 4ZC3A 3MFKA 3TQNA 4I02A 1NH3A 3OYHA 2FNPA 1JKOC 1TL8A 1E0EA 1W0TA 4C3IJ 3IL2A 3H5NA 3OYBA 2CQQA 3LFKA 4M9XA 3ZCOA 1MSFC 1B9MA 1SFUA 2KLOA 5CQEA 1LQ1A 3LSTA 2Q2EA 2RV8A 4HLYA 1VQ4I 4X6AJ 2V6EA 5E18F 3EPZA 5DDGA 2M0MA 1W5SA 1A04A 3X2QH 3RZDJ 2DPDA 1H9GA 1V4RA 3EUKL 1Y1VJ 3J80Z 4U7BA 4M73A 1D5VA 2IS1A 2LP0A 4KICA 3R6SA 2X1CA 4ZDPA 1H0MA 2DODA 3DEWA 5AIPA 4G8XA 3HTUA 3BLYA 3DWLE 3S1RJ 1XG1A 2DYSH 3G1OA 2JPCA 4D0PA 4FISA 1KQ8A 3GMEA 2E1MB 1U78A 2JA5J 4E7HA 2ZFWA 3BR6A 3MZHA 1H9TA 1LDKB 3L2UA 3QOPA 2VT3A 1SFEA 2WV0A 3R0JA 3G73A 4L0ZB 2W85A 1EJ9A 5EG0A 3GFJA 1T0FC 5KAFC 4IRGA 2KZGA 3S1QJ 3S32A 2XAHA 1HDDC 3CUQC 2A6EF 3OWTA 3G3ZA 5LRRA 1D8KA 1BI1A 3S16J 2DU9A 3FXLA 4KISA 3HOWJ 4BE0A 3QPSA 4L5JA 2C6YA 3K9TA 3Q0WA 4XRSA 4LMYA 5GAEJ 2JJ7A 3TP3A 4U0YA 1GXQA 1BC8C 4KJZA 5KAIC 4ESBA 1FLIA 3MWMA 1I6HJ 2PLYA 2EWNA 1IXCA 3CP2A 4I09A 4CSWA 5K5QA 2DCEA 2J5PA 1TWHJ 4FQGA 5D8KB 5J40A 1X3ZB 3HOYJ 1ZRCA 5LRSA 1MSEC 5IPAA 3GFLA 4HV5A 5LEKA 5J1RA 4HF0A 4HYEA 4HF2A 3DTIA 4DBRA 2VONA 4RB1A 3FK7A 3O3KA 5H6RA 5IT9K 2L54A 3HRMA 4ASNA 2VC0A 4BYYA 4BS9A 3SEQA 2XDVA 4YEJA 5A2QK 3E7LA 4P55A 3GUDA 1YW8A 2BY3A 3PNVA 4RB0A 2Z5UA 3FXMA 1T2KA 5D5UB 1UMQA 5EDNA 4XLPF 4A3BJ 3P7NA 3L2CA 3IV5A 3HJEA 3DCFA 1XS9A 2LR8A 5LHHA 4B3AA 4OOIA 2FQ3A 2CG4A 5F08A 2KIMA 2MLKA 2X48A 3EUAA 3CCJI 2W24A 1AU7A 1MDMB 4E7ZA 2B0LA 4L9NA 2BW3B 2O8XA 3RPUD 1E17A 2DLLA 5LFAA 3SEZA 1RC9A 3FXOA 4CCLA 2HTJA 2XAQA 2D45A 3A01A 5K7ZA 4R79A 3EYYA 1IUFA 1ZGAA 3KP4A 3RKWA 1N77A 1K7AA 3J81K 1X4OA 2K3FA 1R00A 2VODA 2DDBA 1G3TA 1FNNA 2FSWA 3OYKA 3CCYA 3M8FA 1FPQA 1T6SA 4IOAF 4V2GA 3JTGA 3RPQA 2ELJA 3K4BA 1ENHA 3SXYA 3CCVI 4DQ2A 3LWFA 1PP7U 2PG4A 2D5VA 1HW2A 2CFXA 3A0BC 1LPQA 2ZJ2A 2VJIA 2DQRA 4RDUA 3LOCA 1OCZH 1FYLA 2KFDA 2QKMB 4XRSG 4QTRA 1YHQI 4RM3A 4UVCA 3KETA 1QO0D 1SANA 1IN4A 3KFWX 5HDKA 3I4MJ 2A6HF 3PSIA 4D1QA 2RQPA 2GXAA 5FKOA 1ETOA 4QWQA 3C7JA 5HLIA 3PJRA 3WU1B 1QZZA 1HSJA 1BL0A 1I1SA 4LOCA 3MMYB 2QEXI 3QYBA 1KQ9A 1ZLKA 3NQOA 2Y69H 3QAHA 4AIKA 1D1CA 3S2WA 1IJWC 4HX8A 2MH2A 3MZYA 2HVRA 1WFXA 1W1WE 1SVMA 3BC8A 1WJBA 1EKEA 2H94A 4XL9A 3GTPJ 1YX5A 3BR2A 5LGUA 4N9HA 4IOCF 2NS7A 1QU3A 5EF6A 4ZYGA 1C0WA 1MMAA 3B73A 3GTJJ 2ZNZA 4MTEA 1TBXA 2EBIA 5K1YA 3GTQJ 2R7ZJ 1Z67A 3HGGA 1X1BA 3BTIA 4HPQA 4XLEA 4RGRA 2F4OB 3E1SA 2VJ5A 1G6NA 3REOA 3H0GJ 4A5MA 2EQRA 2D1VA 1XCVA 2PJRB 4WCGA 3AG4H 2LY9A 2CUZA 1H88C 2L2OA 4IHWA 2EB7A 1SC7A 1IRGA 1SMYF 3OY9A 1FOXA 2NS8A 1CGPA 4C2MJ 4MFEA 2A3SA 2A6TA 1WI9A 1JKQC 1WHUA 1MBEA 5IYBJ 2M45A 2FEZA 4M3GA 1IRZA 1VFCA 3KEQA 5DUKA 2DO7A 4KITB 1ULYA 3LMMA 3IH4A 4RMNA 5HS7A 4HOBA 1IAWA 2EPFA 4E6KG 2ID3A 4M6YA 2ZFUA 1XB4A 2O9LA 1I1GA 3PUBA 5ICCA 3Q9VA 3OR2C 2ZNYA 2MD5A 3EQLF 4WXDA 2BYVE 5JLWA 3BR1A 1T0FA 2LKXA 4KA4A 2MFZA 4M3BA 2DA2A 4X0GA 2CYYA 3TEDA 2R3SA 5E8IA 3BCBA 1CF7A 4ZDLA 4LG3A 1EH8A 1OR7A 2IXSA 1FIPA 2VQGA 1R5GA 2L7ZA 4CCMA 4UY8I 3M9AA 3DLLF 2L3DA 4PSXA 1LE8B 1R49A 1VQMI 3FBIB 2IPQX 4XLAA 4EJWA 1VQLI 3GWZA 1GV5A 1I27A 2DA7A 4ZZDA 2XAJA 2X6YA 1YI2I 1D0YA 4XN3A 2DOEA 2LF8A 2EZKA 4U87A 4HSRA 3TO7A 4UHTA 4JBAA 3PUFA 3ZQHA 1S7AA 5FRMA 5E3NA 1RUOA 1ZTRA 1FBQA 4E7IA 2OV7A 2E2HJ 2DJIA 3AFHA 2KT0A 2L0KA 3U2RA 2QSHX 3CC2I 2XPUA 1MH4A 1LB2A 3DLAA 3LQQA 3W3CA 3I59B 1TQMA 4BBRJ 5IOZA 5GADJ 5DCMA 2EFOA 1GVDA 4KIGA 3K1MA 4EVIA 2BBYA 4A0YA 2PBIA 3VDXA 1Z3XA 5J8FA 2LRDA
chains in the Genus database with same CATH topology
4PJJA 2GOMA 2UUZA 1OR7C 1ERDA 3HPGA 4F92B 4NQWB 4II3A 3LSMA 4BACA 4YELA 4N4NB 1X19A 2MYSA 2V26A 4CCJA 2HVSA 3OYDA 3M1CA 4XKBA 3S8PA 3QODA 3S3MA 2FUG2 3DQVC 2XF5A 1U0JA 3MKYB 4Y4RA 4EATA 3DTEA 1HA8A 3D5RC 3H5RA 3OYNA 2WB1A 3TL4X 1UELB 2DT7B 4XR6A 2V1NA 1WJDA 4RLFA 4C9YA 5HNFA 5KHDA 2RREA 4PSWA 3PNTA 1Z3YA 2R7UA 3DKYA 2F6CA 5HNHA 2MABA 2K5CA 1TT0A 4E7KA 3ZGKA 3W2WA 4IQ4A 4BE2A 4IQJA 3QYFA 3DPUA 1N78A 3K6GA 4OAYA 3CESA 2JVHA 3V42A 3VYTB 3OYMA 3BCAA 1MNDA 2HQAA 1D1AA 2VPLA 4XLHA 3EUHC 4F52A 1NG6A 3I3LA 1T95A 3H5AA 3H9GA 2VXZA 3K4MA 3OIPA 3OS0A 1IRXA 2LH9A 3RQ4A 2E1MC 1Z21A 2X6XA 2KZVA 3OS1A 1DGWY 4F91B 2CW8A 1V5FA 3FHNA 3H0DA 2CMPA 4IX7A 1BR2A 2KMUA 1WJAA 3PFYA 1SAUA 3OS2A 3DPTA 4BE1A 1JI8A 4JQFA 4ANJA 3I9V2 3IAM2 3C2HA 3K10A 3PSFA 2IS6A 1KONA 3J7AY 4LITA 3SYTA 2M4GA 2R7TA 1W36D 4J01A 4OAZA 1AA7A 2WAFA 1Y56A 2V4JC 4XLFA 4BGDA 4F55A 2R7SA 2ZXIA 2JA2A 1D1BA 1PYVA 4PJLA 5CKTA 4E7LA 1Y6IA 2M3AA 4YRVA 2M7AA 3DKXA 1D0XA 4CCKA 2Z2SB 3DPLC 5KCMA 1N75A 5FROA 4BU2A 4XORA 2KQRA 1ZELA 4CUGA 1TZLA 3HPHA 4BDYA 2HVQA 1BR1A 3AKZA 2VJ4A 2F5VA 1MMDA 4ITVA 4BEHB 2K3PA 1QHHD 4NNJA 1P9QC 4HNTA 3OYEA 1WJ5A 3HUGB 1OLTA 2VLAA 1LVKA 4PUSA 4BQQA 3OMYA 4B43A 2MC4A 4AVZA 2HNHA 2O5RA 3HOSA 2X1DA 3C2GA 4ZC3A 4LIVA 3VYSB 3OYHA 2ZXHA 4DOZA 1E0EA 4B47A 2VQLA 2HDWA 2AQEA 3H5NA 3HKZA 3H35A 4NC8A 3OYBA 2CS3A 3ZCOA 3VYUB 3K4LA 3LSHA 2A5WA 2JVGA 2KLOA 5CQEA 4BUPA 4IKFA 4BJTA 2ZSHB 2V6EA 4BQOA 4BDZA 2WADA 3OYAA 2R7RA 3EPZA 4FASD 3K70D 2M0MA 2OUMA 2MD0A 1BR4A 3EUKL 4XKCA 3SDBA 2LYCA 4U7BA 2W1OA 4RM2A 2IS1A 3OYGA 4ZDPA 2X1CA 2BVMA 4KT6A 4ZYAA 3BLYA 3DWLE 2BVLA 4CZCA 2E1MB 4E7HA 2V9KA 1LDKB 3L2UA 4GRIA 3LSIA 3NWTA 1WJFA 3AL0C 4CA0A 3L2VA 2E5NA 2UWMA 1T0FC 3OYFA 2VB6A 2PJRA 2VQHA 4XLCA 2CUJA 4ZTFA 2VKHA 3S32A 2KRHA 4XMYA 3OWTA 2Z16A 2CFOA 4DJAA 2W7NA 4XN0A 1BOBA 3OYLA 4KISA 3IAS2 4XNFA 3S3NA 4E7SA 4BE0A 2IGNA 5FRNA 3ZXSA 4XM3A 2X85A 2HU9A 4PK4A 4HNUA 2WA0A 3BG6A 3A4CA 4KJZA 3OL3A 2HZDA 2Z1DA 3DEEA 2R7QA 4RLQA 2IGMA 2UV1A 2Y0SA 2VIXA 3CP2A 3SZGA 4CSWA 2DCEA 3OOUA 4CH7A 2R7VA 3MKZA 3VYRB 2KRCA 3DU6A 2XF6A 4B48A 2Q2EB 4NUBA 2W4SA 3DTIA 4DBRA 3DU5A 2VKDA 4QPQA 1X1CA 2VASA 2WAEA 4AYBA 3OYCA 1MW7A 2R4GA 4BJ5C 2IS4A 3QOEA 4BS9A 4FETA 3SEQA 2XDVA 4YEJA 1UAAA 4HEA2 1YE9A 3PNVA 1Z7LA 4DIQA 2LREA 1X1DA 1D0ZA 2VQCA 4BEHA 1MNEA 4BQNA 4PFPA 2AQFA 3EUAA 2NOJB 2M4KA 5CPRB 2RQQA 2CV0A 4ZDOA 4E7ZA 4H4KC 4D9JA 2JUGA 2IS2A 2BW3B 3RPUD 1S9HA 5LFAA 3RCOA 3SEZA 3W2VA 4CCLA 4CCNA 4R79A 4IZZA 4XQFA 1N77A 1V5GA 1X4OA 2CV2A 2VXDA 2VJJA 3OYKA 2WBMA 3K4KA 3TMOA 2ZSIB 4XOTA 2WY7Q 4NC7A 3L2QA 2ELJA 3K4BA 4B3XA 1GLNA 3FDYA 1WJEA 5TGTA 1DQUA 4AU7A 2VJIA 3S93A 3MD2A 3HL2A 3IP4B 1MMGA 2QKMB 4RM3A 3A2KA 2XC7A 2XAUA 3CF2A 2VL8A 3PSIA 3M8JA 3OIQA 4DGWB 2JSPA 2LG4A 3CP8A 3D5LA 4LIUA 3UR3C 4D1QA 3PJRA 3N05A 3W2AA 1FMWA 1R6RA 2CV1A 2M7BA 5CQGA 3MMYB 4C30A 3QYBA 3OL4A 3U21A 2BOLA 1D1CA 3ZR8X 3K4CA 2X51A 2PMZA 4DBQA 3BG7A 3G2BA 2HVRA 1WFXA 3IUOA 2CH0A 3BC8A 4C2TA 1WJBA 1V5EA 2W82A 4P1WA 4Y33A 4C2UA 4XL9A 1YX5A 4PJMA 3VSKA 3DTKA 1QHGA 3CZ6A 4QPOA 1QU3A 2KP6A 1VZ0A 2X6WA 4OWRB 3OYJA 2W00A 4HSTA 1MMAA 3RTRA 3H9JA 4BXFA 1X4PA 2QKLB 2LC2A 4HRIA 1DP3A 1X1BA 1EA3A 2XSJC 4HPQA 4XLEA 3KEYA 3CJRB 3E1SA 5JHFA 2VJ5A 3K4JA 4F3QA 1W36C 2HPIA 3KX2A 2PJRB 2CUZA 2L2OA 3FBNB 3HG9A 3OYIA 2E5ZA 4ZTJA 4ZJZA 3OY9A 2KHMA 2KPMA 4PFOA 3AL0B 1MMNA 2A6TA 2P0WA 3LSKA 3HXLA 4XONA 3GBGA 4II2A 4E4HA 4KITB 3ZRGA 3HOTA 1DGRM 4PJNA 2LBFA 1WJCA 3KYLA 2LBFB 3LL7A 3LMMA 2R7XA 1K6YA 4G6TB 2WAQA 3FKJA 4RMNA 4JOMA 5LD2C 3K70C 3OR1C 3A1YA 1FMVA 2L5QA 4E6KG 2DT6A 2OC6A 3D5SC 2DXIA 2ZFUA 2GOXB 3LSGA 4P5OA 2HPMA 2Q1ZB 1G8XA 3PUBA 4MLOA 3RSNA 2IGKA 3H9QA 4BJ6C 3OR2C 3NWSA 3UNGC 1LKXA 3HC7A 3MKWB 2MFZA 2F4IA 2RNGA 3CMMA 4CCOA 4X0GA 4J00A 2K9LA 2BW3A 3BCBA 3S3OA 2XF7A 5HVQC 4ZDLA 4LG3A 2CW7A 3L2RA 2IXSA 3E0JB 2VQGA 2E60A 4CCMA 3TBIA 2X1EA 4Y3OA 3PNYA 2R7OA 4PSXA 4F93B 2LOOA 3CJQB 3FBIB 4N4OB 1LFPA 4XLAA 4XKVA 1UG0A 2V7FA 3ZQQA 3VSLA 1X1AA 3VWBA 2X6YA 4BL0B 1D0YA 4XN3A 2IGOA 2KL4A 3ONQA 4U87A 4B44A 4HSRA 4XKWA 3K4NA 5FRMA 1SFKA 4E7JA 1PJRA 1G59A 2L9SA 2I8DA 2KDOA 2DJIA 2LY1A 2OV7A 3AFHA 4E7IA 2WY8Q 3L2WA 2LY2A 4HG2A 2L7KA 3DLAA 1NG7A 1J09A 3W3CA 5KNLA 5HOOA 2R7WA 3F9KA 2L9NA 3LFUA 5HLTA 3QYEA 4XOPA 2DOAA 3VDXA 1YX3A 3PL8A 1Z3XA 2K9MA 2LRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LH9 A;  2KPM A;  3RCO A;  2LY2 A;  2KZV A;  3S93 A;  2LY1 A; 
#chains in the Genus database with same CATH topology
 4N9I A;  2LDU A;  4PJJ A;  5BQT A;  2UUZ A;  2Y9Z A;  1ERD A;  2COB A;  4YIR X;  1A5J A;  4F92 B;  4IRI A;  4I01 A;  3BR0 A;  3HHH A;  5K7F A;  4BAC A;  1O7L A;  4N4N B;  1KYZ A;  3FXR A;  4HX4 A;  5JFR A;  3QOD A;  2KJB A;  3KYD B;  1T39 A;  2DA1 A;  5K5O A;  2EFQ A;  2NAZ A;  4XID A;  4V19 K;  2IA0 A;  2E34 A;  3DBL B;  3HOU J;  3DTE A;  1OKR A;  1QQI A;  5D5V B;  3OYN A;  2WB1 A;  3TL4 X;  3KP2 A;  1SAX A;  3E5Q A;  2DTZ A;  3EYI A;  2VE9 A;  4C9Y A;  3Q0V A;  5CVV A;  1IDZ A;  1LNW A;  4AD9 A;  3E97 A;  3ZN1 A;  1E3P A;  4IVN A;  1USS A;  1TT0 A;  2H6B A;  4EGY A;  4E7K A;  1QPI A;  5F0H A;  5JR3 A;  1KQ0 A;  4OIO F;  5FFZ A;  3W2W A;  1PVE A;  1R7J A;  4IQJ A;  3QYF A;  3KCC A;  1N78 A;  1W7P B;  3BTC A;  4OAY A;  2YUS A;  1Z6T A;  2ZCW A;  3DV8 A;  3E6M A;  3D1N I;  3OYM A;  3BCA A;  2CUE A;  2J5O A;  4XLH A;  3EUH C;  1ZHF A;  1KZH A;  4D5C A;  3E3V A;  1FSH A;  2B7E A;  4BY7 J;  1OQY A;  2L4A A;  3H9G A;  3K4M A;  2DW4 A;  1JTX A;  5CVJ A;  1BN5 A;  2GLO A;  2KZV A;  4ZYD A;  3G4S I;  2H8W A;  3T8T A;  1U2W A;  2OZ6 A;  4GDF A;  4B09 A;  2XUB A;  1TT5 B;  3WU2 C;  2COM A;  3BJ6 A;  3OS2 A;  1IV6 A;  2NVY J;  4BE1 A;  1NTC A;  1LDJ A;  3ECH A;  4MEY F;  1HDP A;  2IEK A;  2M2E A;  3IAM 2;  3C2H A;  3PSF A;  3W6V A;  2JA8 J;  2YSR A;  3J7A Y;  3NAR A;  4LIT A;  4WXH A;  1IG7 A;  2O61 A;  3MVP A;  3CLO A;  2F2E A;  2K27 A;  3AAF A;  2HOA A;  1Y56 A;  1JUM A;  2PN6 A;  1FX7 A;  2ZXI A;  4NQW A;  5LHI A;  5ILV A;  4GO1 A;  2ZJP F;  4AID A;  1V3F A;  2WV1 A;  3O6B B;  3PQK A;  2YU9 J;  1PYV A;  1W5T A;  4E7L A;  2M3A A;  1YQA A;  4YRV A;  2M7A A;  3CF5 F;  4CCK A;  1D0X A;  1SFO J;  5HLH A;  3CCQ I;  2Z9O A;  1VQP I;  4M72 A;  2Z2S B;  1WRJ A;  2RGV A;  3FXK A;  4BU2 A;  3JRI A;  4EJO A;  5AIQ A;  2KQR A;  1ZEL A;  4JX6 A;  3CDI A;  2HXO A;  4CUG A;  4CYC A;  2GBY A;  1MJ9 A;  3UKG A;  1ZQ3 P;  3CC7 I;  3AKZ A;  2VOP A;  1FP2 A;  3BZC A;  3ZQL A;  1MMD A;  4YFX F;  4ETS A;  1VQN I;  4XRF A;  1P2F A;  2EJR A;  4NNJ A;  4CHU A;  1QBJ A;  3OYE A;  4L5I A;  1OLT A;  3ZMD A;  4PUS A;  5DD4 A;  4I0B A;  3HYI A;  1W0U A;  5J6X A;  2XAF A;  1GXP A;  1JJ6 C;  4XRM A;  1HC8 A;  2MC4 A;  1VQO I;  4AVZ A;  2HNH A;  4LLG F;  2B63 J;  2HTS A;  3GCM A;  2STW A;  2PMU A;  4LIV A;  5K7H A;  3F6O A;  3CUQ A;  4YFN F;  2ZXH A;  3VPR A;  2FF4 A;  3HKZ A;  4I98 B;  1WCM J;  4NC8 A;  3FXU A;  1AKH A;  2CS3 A;  1S5L C;  4AYB N;  3K4L A;  3LSH A;  2JVG A;  4BUP A;  4BJT A;  4BQO A;  2DA5 A;  2WAD A;  2KKO A;  2R7R A;  3K70 D;  4LG0 B;  1R5I D;  2HQR A;  2MW8 A;  5E3O A;  3GW2 A;  3SJM A;  3SDB A;  2LK2 A;  2LYC A;  2ECC A;  2OA4 A;  1MIJ A;  1GDT A;  2IBD A;  2QCO A;  4BQA A;  2RAE A;  4M3E A;  1DP7 P;  1ZRF A;  2ID6 A;  4ZYA A;  2DN0 A;  2QSG X;  2XGC A;  1O3S A;  5D6E A;  3OV8 A;  2KIQ A;  4CZC A;  5M5W J;  1MZB A;  5L3G A;  4A0X A;  2FE3 A;  5ICG A;  1YLF A;  4MO7 A;  1MDM A;  3RI4 A;  2HI3 A;  5D4R A;  3IWF A;  3LSI A;  3DKW A;  3NWT A;  1WJF A;  3FXQ A;  2XGD A;  3S15 J;  2UWM A;  3MQ0 A;  2NXN B;  3M07 A;  2PJR A;  3T0Y A;  2VQH A;  2R5Z B;  1RR7 A;  4XLC A;  5CVI A;  5DD8 A;  4J19 A;  3RZO J;  1RES A;  4XMY A;  4ON0 A;  1EH7 A;  2CFO A;  2Z16 A;  4DJA A;  3GF2 A;  2G9W A;  3H3V K;  1STZ A;  5FKN A;  4E7S A;  2PJP A;  3L9F A;  1VQ8 I;  5J3L A;  2TRT A;  3BG9 A;  4HNU A;  2FX0 A;  2MC3 A;  2QM3 A;  3TDU C;  2O8K A;  2CWE A;  4FE4 A;  4NHJ A;  3I0T A;  2Z1D A;  4RLQ A;  2Q0O A;  1OCT C;  2IP2 A;  5LLQ A;  2O3F A;  3ABK H;  1S29 A;  1B4A A;  4BKX A;  3T8R A;  1UB9 A;  2PMZ N;  3BQZ A;  2JA7 J;  3IKT A;  4B48 A;  4NUB A;  3BOQ A;  4EM0 B;  5LEJ A;  2VOO A;  2W4S A;  4KN7 X;  4A93 J;  1BC7 C;  4QPQ A;  1YRN A;  2WAE A;  4A2U A;  1Y39 A;  1MW7 A;  1DUX C;  1O3Q A;  1QVU A;  2W25 A;  3QOE A;  1FSE A;  2Y48 A;  5D5W B;  2HQ5 A;  1ETK A;  5IYD J;  2OQG A;  3LQR A;  3P9K A;  3FWE A;  3ESW B;  1TQP A;  4BEH A;  1MNE A;  1ZR4 A;  3GTL J;  3KEO A;  5D5X B;  3QPT A;  3LSR A;  3JW4 A;  1W4M A;  3C18 A;  4WWC A;  2NOJ B;  2M4K A;  4A3J J;  1A31 A;  1G3W A;  2RQQ A;  4ZDO A;  4M3F A;  4D9J A;  3TW7 A;  3EUH A;  2GIV A;  2FD5 A;  3K1P A;  3ERE D;  1XDU A;  3A01 B;  4FX4 A;  5LHG A;  2NVT J;  2JTV A;  3M4O J;  4Q48 A;  1ON2 A;  2OZU A;  4RBO A;  5GTI C;  4KYW A;  3NRV A;  3RIR A;  5FLX K;  1YYV A;  3GX4 X;  3O2P E;  2ZSI B;  4EJV A;  3TDZ C;  3AG2 H;  3LA7 A;  5D4S A;  3L2Q A;  3BTL A;  1IDY A;  1GLN A;  4BXX J;  1WJE A;  3F72 A;  3WHC A;  4AU7 A;  1E3H A;  3MD2 A;  3R0A A;  4KIF A;  1MMG A;  1OCR H;  3KP6 A;  1S3J A;  1ZGJ A;  2EZH A;  1ORK A;  3WG9 A;  2XC7 A;  1K4S A;  3PO3 J;  2YR2 A;  3OIQ A;  2JSP A;  1A6Q A;  3CP8 A;  3UR3 C;  1IV8 A;  1I3Q J;  3JCU C;  5HDN A;  2CV1 A;  3PIP F;  3A03 A;  5CQG A;  2R5Y A;  5DEQ A;  2Y2Z A;  5DV5 A;  3JAM Z;  1UST A;  3U21 A;  2OTJ I;  1ETY A;  2BOL A;  2Y9Y A;  3F8F A;  5F1R A;  5LGN A;  2X51 A;  2KDZ A;  3M8E A;  1B6A A;  1W7P A;  3FZV A;  4JK1 X;  3ZMZ A;  1RKW A;  4L9T A;  5L3F A;  2CH0 A;  4ABZ A;  1MBK A;  1Z91 A;  1T98 A;  1IZ1 A;  1Q1H A;  2W82 A;  4P1W A;  4Y33 A;  5D6F A;  4C2U A;  3ZQC A;  4PJM A;  3VSK A;  4GYG A;  5C44 J;  2JQ7 A;  4KIB A;  4OWR B;  2L01 A;  2HKX A;  2CRG A;  3RTR A;  4BXF A;  1X4P A;  1SFX A;  2LC2 A;  3TO9 A;  5B3S H;  3CCU I;  5TRD A;  2K02 A;  5FLM J;  4Q4Z F;  5E8G A;  3E6D A;  5L3D A;  4A6E A;  4E70 A;  1TW3 A;  5DYM A;  5BS6 A;  4A3D J;  3CJR B;  4XSX F;  1WPK A;  3JR9 A;  1B59 A;  5JHF A;  3K4J A;  4G12 A;  3JAM K;  3FX3 A;  3KX2 A;  1JJ8 C;  1XGM A;  3LAJ A;  1CQT A;  2D2W A;  1O57 A;  1M1E B;  3FBN B;  1J2X A;  2A07 F;  3M1E A;  4AIJ A;  3OYI A;  5EEG A;  2GA1 A;  2LVS A;  1SVL A;  4ZTJ A;  3HTS B;  4Z2Y A;  3WTU C;  1F5T A;  3PM1 A;  2P0W A;  2UXN A;  5F27 A;  4XON A;  3L1P A;  2WAQ N;  4II2 A;  2M5W A;  3HOT A;  1BM9 A;  1DGR M;  4PJN A;  4A3F J;  1K6O A;  4BNC A;  2WAQ A;  1MGT A;  4IEJ A;  3FMS A;  2EFP A;  1F1Z A;  2V6C A;  5HS8 A;  4H0E A;  2LSO A;  3I59 A;  1POG A;  3FM3 A;  5BNG A;  2AHQ A;  2JA6 J;  1FMV A;  5JHU A;  3D5S C;  5L3C A;  4Y17 A;  2E7X A;  2Q1Z B;  5HOD A;  1RET A;  3RSN A;  5GPA A;  3H9Q A;  1VQ5 I;  1BW5 A;  3L09 A;  1YFH A;  3WTV C;  2CQ7 A;  2W84 A;  4RGX A;  2M9H A;  1KGS A;  3MKW B;  4J00 A;  2R92 J;  3BR5 A;  2BW3 A;  2E35 A;  4CZZ A;  3S3O A;  2XF7 A;  3ABU A;  1OJL A;  2OCE A;  1IXS B;  5EEA A;  2CQK A;  1U5T C;  3CO6 C;  1ZRE A;  2AS5 F;  1MH3 A;  3C1D A;  3JRE A;  1Q1V A;  2R7O A;  3PNY A;  3JRA A;  2XRO A;  2LOO A;  2F5D A;  3IH3 A;  1B72 A;  3CJQ B;  1LFP A;  4XKV A;  2V7F A;  4UB6 C;  4L5E A;  4GXO A;  3VSL A;  4N0B A;  3BQY A;  1K78 B;  4RB2 C;  3AG3 H;  4BL0 B;  2ZME B;  3TW6 A;  5J1U A;  4ZH4 F;  2IGO A;  2KL4 A;  4B44 A;  4BXU A;  4I2O A;  4UVB A;  1MJA A;  3KPH A;  2QVO A;  4E7J A;  2X0L A;  1FP1 D;  1O7F A;  2L9S A;  3L2W A;  3CCL I;  2ACJ A;  1UG2 A;  1MBH A;  4PZJ A;  5DCF A;  5H6Q A;  1J9I A;  2DJN A;  1UHS A;  2LKP A;  3NAU A;  3QP6 A;  1NG7 A;  2XPW A;  4HDU A;  3WG7 H;  3I5U A;  4OIN F;  5HOO A;  3TKY A;  1MKM A;  1OIS A;  1X2N A;  3QYE A;  2YX7 A;  2ZC2 A;  2DOA A;  4PGG A;  4MHG A;  1YX3 A;  4IHS A;  4AM3 A;  2K9M A;  3ZMU A;  3P9I A;  2E7W A;  2IA2 A;  2E1O A;  5EYR A;  4NQW B;  1J59 A;  1TC3 C;  3LSM A;  4UNO A;  3S14 J;  2HEO A;  1G2H A;  3HSR A;  1RNL A;  5B66 C;  1X19 A;  2MYS A;  4CCJ A;  1SD6 A;  3S8P A;  2FUG 2;  3HOX J;  2ZXJ A;  3MKY B;  4O3M A;  4EAT A;  1B1B A;  2XRL A;  2XB0 X;  2OQR A;  1ETV A;  2VKE A;  3K69 A;  3RKY A;  1XGO A;  1DU0 A;  1UEL B;  2DT7 B;  1J7K A;  4RLF A;  3ABM H;  3C3W A;  1PUF A;  2VUM J;  2FNA A;  1Z3Y A;  4GCV A;  2F6C A;  2MAB A;  2VE8 A;  3QPH A;  3RKX A;  3ZGK A;  3U1D A;  2EIN H;  3DBR B;  3EET A;  3J7Z I;  3FMQ A;  3PIO F;  3A02 A;  4BE2 A;  1WGX A;  2XKO A;  2M8E A;  4G6Q A;  4IHY A;  3ZQ7 A;  3V42 A;  1P7J A;  1MND A;  2VPL A;  4WXC A;  2G7U A;  4F52 A;  4M74 A;  3HZJ A;  4S0H B;  3SHF A;  1XGS A;  4CYC B;  3F3X A;  1L0O C;  3H5A A;  1IRX A;  1Z6R A;  2LH9 A;  3FXJ A;  5AON A;  1F36 A;  1Z21 A;  2X6X A;  3WE3 A;  1K61 A;  1SD4 A;  3CMY A;  1V5F A;  2K7L A;  1SVO A;  4DYQ A;  1R5H A;  4LG0 A;  3ASO H;  4HV6 A;  3PFY A;  1XMA A;  1SAU A;  1ZG1 A;  5L3E A;  1F4K A;  3V8J A;  1JI8 A;  1FY7 A;  2ZME C;  1HCR A;  5FKK A;  5HLG A;  3G1L A;  3SYT A;  2RKH A;  2M4G A;  2Q8K A;  1YIT I;  3F0C A;  3RQI A;  1W36 D;  4OAZ A;  4YII A;  1TWC J;  4A3M J;  4A0Z A;  2DT5 A;  3ZMT A;  4LLN A;  1JGG A;  1AHD P;  2BXY A;  1I6X A;  3TP0 A;  3OOP A;  1PP8 F;  2ISZ A;  1IXR C;  3JTH A;  2JA2 A;  2R5Y B;  1D1B A;  4PJL A;  1Y6I A;  1W5C C;  2IA1 A;  3DKX A;  1Z1D A;  3GYH X;  1Y0N A;  4MQ9 F;  3WOD F;  3WE2 A;  2QA4 I;  1OPC A;  3WTY C;  2P6T A;  4W1U A;  1O3R A;  4XOR A;  2P8T A;  3I54 A;  1TLH B;  1SD7 A;  4DNC A;  3ZPL A;  1YW7 A;  3HPH A;  2DA4 A;  2EIM H;  5E17 F;  2XAS A;  2F5V A;  4IRH A;  2EFN A;  1FWZ A;  4HNT A;  1MD0 A;  4EEF G;  1XSX A;  1LVK A;  2EH3 A;  2EIK H;  3OMY A;  2CO5 A;  4JP0 A;  2OTL I;  2X1D A;  3C2G A;  2FBK A;  2RN7 A;  3CUQ B;  3J7Y J;  2OAZ A;  3BP8 A;  2VQL A;  3WTW C;  2LNB A;  3H35 A;  4RGS A;  2HKO A;  3G6E I;  2EV5 A;  3VYU B;  2A5W A;  4IKF A;  2XB5 A;  2ZSH B;  4KN4 X;  4XBF A;  4S05 A;  3OYA A;  5FO5 A;  2MGQ A;  5F6F A;  5H20 A;  3PFI A;  2OUM A;  4B4C A;  2MD0 A;  5FJ8 J;  3Q9S A;  1BR4 A;  3B02 A;  3RPU A;  3A0H C;  2W1O A;  2X9D A;  3SZT A;  3LSP A;  3I58 A;  1R23 A;  3OYG A;  4L9J A;  3SDG A;  3HGY A;  5JVT A;  5D8L B;  1I3A A;  3VB2 A;  4ESJ A;  2K40 A;  3HEF A;  4IO9 F;  4KT6 A;  2ZJR F;  5J47 A;  4IJA A;  1FOK A;  2H8R A;  1IUY A;  2JWT A;  2HOS A;  3JRD A;  2XAG A;  3NEU A;  2GXB A;  1XX5 A;  2PX9 A;  3H3U A;  2L02 A;  3K0L A;  3RKQ A;  4MTD A;  4IL6 C;  2V9P A;  1TWA J;  2DBB A;  2LMD A;  3WTS C;  1VQ6 I;  3CDH A;  3AL0 C;  1BJA A;  3QWL A;  2E5N A;  4CA0 A;  1JE8 A;  2MG4 A;  3BG3 A;  1H8A C;  2H1K A;  2VB6 A;  1DPR A;  2ELH A;  1HF0 A;  4ZTF A;  2EZL A;  4CGZ A;  2CU7 A;  5JLX A;  3HOZ J;  3DP7 A;  2EV0 A;  3HOV J;  3J80 K;  2XVC A;  2P5K A;  2W7N A;  4UUV A;  3V7S A;  1S6L A;  1HLV A;  1D8J A;  1BOB A;  3OYL A;  4XNF A;  4R1H A;  5EZH A;  2E2J J;  5FRN A;  4AWX B;  1ETX A;  4XM3 A;  2L7F P;  3MEX A;  2K4J A;  1MBG A;  2DMP A;  3QP5 A;  1R36 A;  4MIM A;  1U8R A;  4M6V A;  2HQN A;  4P9U A;  1P4W A;  2DA6 A;  3A4C A;  4RAZ A;  3QQA A;  4W97 A;  2R7Q A;  4XSZ F;  4Y13 A;  2UV1 A;  4LFU A;  2UZK A;  4Q47 A;  3ZQI A;  2DMQ A;  3SZG A;  5E3M A;  1VTN C;  1Y1W J;  4CH7 A;  2FBI A;  5CJ9 A;  3VYR B;  1OYY A;  1ZN2 A;  4C3J J;  1AKH B;  4LJZ F;  2E1N A;  3T1B A;  1QGP A;  2XF6 A;  2BZT A;  2F48 A;  2QBY B;  1EH6 A;  4Y52 J;  3V8L A;  3D0S A;  3DU5 A;  4LB5 A;  1DDN A;  3KP5 A;  1X1C A;  3ISP A;  1P92 A;  2VAS A;  4AYB A;  3OYC A;  2O0Y A;  2R4G A;  4BJ5 C;  1ZH5 A;  3J81 Z;  4FET A;  5C3E J;  1VQ9 I;  1FYM A;  2QSF X;  5TIS C;  4HEA 2;  1YE9 A;  4ZZL A;  1Z7L A;  2KIS A;  4DIQ A;  2L9R A;  2P5L C;  1XSV A;  2M1B A;  1GV2 A;  1JHH A;  1HKQ A;  1X1P A;  1D0Z A;  2VQC A;  1JT6 A;  2K9S A;  2H27 A;  1XPX A;  4BQN A;  4PFP A;  4G94 A;  3TO6 A;  2B9S A;  1YJ9 I;  4UUS A;  2AQF A;  3DXJ F;  3ZP5 A;  3K7A J;  1RRJ A;  5J4Y A;  5CPR B;  1RR8 C;  4H4K C;  4NBQ A;  2JUG A;  3KZZ A;  1AWC A;  3GTK J;  4C3H J;  1X3W B;  4U88 A;  4CCN A;  3FM5 A;  4IZZ A;  3CCM I;  3H1C A;  1G4D A;  2Z99 A;  2VBZ A;  3VEP A;  4XQF A;  4DYR A;  3QPL A;  4KUM A;  4LB6 B;  1RKT A;  3HRT A;  2CV2 A;  2TDX A;  1MBF A;  2NVX J;  4KMF A;  2VJJ A;  2ME6 A;  3VOD A;  4RA2 A;  2WBM A;  3K4K A;  5TJJ A;  3TMO A;  2K85 A;  3W6J B;  2KIU A;  2QWW A;  5IY5 H;  4B3X A;  4ENJ A;  1LEB A;  1TWG J;  3FDY A;  3ULQ B;  1DQU A;  1QZE A;  1B9N A;  5FD6 A;  4A69 C;  3CDL A;  5DCM B;  4MQV A;  3R61 A;  3WGG A;  2VL8 A;  1PUF B;  3M8J A;  4DGW B;  4G7H F;  4DZP A;  2OF7 A;  2WTE A;  3W2A A;  1FMW A;  4YIF A;  5FKL A;  2ZXW H;  3CMA I;  2VPR A;  3OL4 A;  1E3O C;  3ZR8 X;  3K4C A;  1YW9 A;  2PMZ A;  3BG7 A;  3CD6 I;  9ANT A;  3QRF F;  2D1H A;  1ZG3 A;  3HB9 A;  4P96 A;  5EG0 B;  3IUO A;  3HM5 A;  3KLN A;  4I99 C;  3V7C A;  1YIJ I;  1ZAR A;  1NK2 P;  4OIR F;  1LFU P;  2M87 A;  2M30 A;  4IHV A;  1QHG A;  3CZ6 A;  4QPO A;  3HSE A;  1VZ0 A;  3U1K A;  2X6W A;  2UXX A;  4V2F A;  2WC2 A;  3OYJ A;  2VKV A;  4I0A A;  3H9J A;  5E20 A;  2ZB9 A;  2H09 A;  1OCC H;  3OIO A;  5KK1 A;  3J7A O;  5ED4 A;  4HRI A;  5LBQ A;  1T8I A;  3HUG A;  1DP3 A;  1S7O A;  4P9F A;  3FK6 A;  1EA3 A;  2XSJ C;  3KEY A;  2JPB A;  2BGC A;  1W36 C;  2HPI A;  2Y0M A;  3L00 A;  4A6D A;  4FHT A;  1YO5 C;  2XHK A;  5HDG A;  2VC1 A;  3SZP A;  3N4M A;  1R4N B;  1BIA A;  5ERI A;  2HDD A;  1B72 B;  1FBU A;  2KPM A;  2Y31 A;  4PFO A;  4HF1 A;  3AL0 B;  1RI7 A;  3LA2 A;  5EZG A;  1ZRD A;  1IO2 A;  5L3B A;  1ZYR F;  1K78 A;  2G7H A;  2ELK A;  1WSU A;  1AOY A;  1TNT A;  3JRB A;  1OFC X;  2NYX A;  1WJC A;  3KYL A;  2LBF B;  2JN6 A;  1KU7 A;  2F4M B;  2R7X A;  4G6T B;  2BV6 A;  3FKJ A;  3K2Z A;  3CLQ A;  3K70 C;  2KRF A;  2DAO A;  6PAX A;  1LJ9 A;  1Z05 A;  4YFK F;  3GLX A;  3OR1 C;  3A1Y A;  1VQK I;  1PUE E;  4X1E A;  2DXI A;  2DT6 A;  2OC6 A;  4P5O A;  2VBX A;  3S1N J;  1JTY A;  4UB8 C;  4U0V A;  4Q5S F;  2VBY A;  4MFD A;  4AUX A;  3TOB A;  4BJ6 C;  2QLZ A;  2WB1 N;  3V8K A;  1REP C;  4QLC U;  1BBY A;  3NWS A;  1N25 A;  1LKX A;  4UV8 A;  3RYP A;  3FKI J;  4CCO A;  2RNG A;  5FD5 A;  3ZOB A;  5EEH A;  4RS8 A;  2ADU A;  3L2R A;  1XDS A;  2YX4 A;  1GVJ A;  2RNJ A;  3TBI A;  1BI2 A;  1R9T J;  2XPV A;  4Y3O A;  4F93 B;  4UVA A;  1Y0U A;  4N4O B;  3JRH A;  2XIG A;  1UG0 A;  2MLG A;  3BPV A;  1X1A A;  1J0R A;  2DPU A;  3SQN A;  5M5X J;  5GAG J;  1R4M B;  2K9Q A;  4LK1 F;  4XKW A;  4CYD A;  4S04 A;  1PJR A;  1FT9 A;  1G59 A;  4Z6Y A;  1Z0X A;  1QRY A;  2I8D A;  2KDO A;  2LY1 A;  1A35 A;  3GEZ A;  2WY8 Q;  2LY2 A;  2PFB A;  2HGC A;  4HG2 A;  2L7K A;  4HZF A;  1IN8 A;  4LK0 F;  4L0Y B;  4HQE A;  1J09 A;  2R7W A;  1W7P D;  3WTZ A;  2L9N A;  2XRN A;  1WI3 A;  2Z33 A;  5DUI A;  5M5Y J;  5HLT A;  2XV4 S;  4XOP A;  1K79 A;  3KYC B;  3DBH B;  3PL8 A;  3MZ8 A;  1ZG5 A;  2JT1 A;  2OU2 A;  1OR7 C;  4RAF A;  2DMU A;  4L9V A;  2JMW A;  4DW6 A;  5F1J A;  3WGH A;  2QUF A;  2E1C A;  1JXS A;  1IW7 F;  4EMS A;  2JSC A;  4CDG A;  4YEL A;  4ZYH A;  2V26 A;  3OYD A;  4XKB A;  3WHB A;  4A5N A;  3S3M A;  3HRS A;  2P6S A;  2XGE A;  4BH9 A;  2HOT A;  1U0J A;  3F21 A;  3QU3 A;  3BZ6 A;  1WZ2 A;  2E36 A;  2HYJ A;  1ZKG A;  2JK3 A;  2RC4 A;  5F04 A;  1HA8 A;  1IRF A;  4HAM A;  5JI6 A;  1OMI A;  1WJD A;  1UHW A;  2HXI A;  4CO8 A;  2HYG D;  2OD5 A;  5KHD A;  2F5F A;  5CVR A;  3DKY A;  3GXO A;  5E1X A;  5A2Q Z;  5HNH A;  1X3U A;  4UUS B;  1B8I A;  2OBP A;  2QQ8 A;  1JHF A;  1HKT A;  1BOA A;  3CCE I;  2ECB A;  5DM7 F;  1JUS A;  3ZMV A;  4EQQ A;  2DTR A;  2GIZ A;  4LLL A;  3GLL A;  5DS9 A;  3KIO A;  4LGW A;  2R5Z A;  4U0W A;  1U3E M;  3VYT B;  4KDP A;  1OCO H;  1G3S A;  3K1N A;  4OMY A;  1NG6 A;  3I3L A;  1T95 A;  1FBS A;  2DMN A;  1WQ2 A;  5JVG F;  1APL C;  1TP4 A;  2V1D A;  1V54 H;  2LFB A;  3ZQG A;  3RQ4 A;  2E1M C;  5F0F A;  4O5V A;  3F8M A;  2ETH A;  3HKZ N;  2QZ8 A;  1DGW Y;  3Q0U A;  2CW8 A;  2DFE A;  3BT9 A;  4QSH A;  5F64 A;  1IN5 A;  1LDD A;  1YIO A;  2HYF A;  1XC5 A;  1WJA A;  2NS0 A;  3WU0 A;  2IT0 A;  3OSG A;  3DPT A;  3E6B A;  3I53 A;  2F5E A;  4JQF A;  3KZY A;  4KT5 C;  1O4X A;  2XGX A;  3HHG A;  3K10 A;  1FOY A;  4RGU A;  3RDI A;  5GAH J;  2R7T A;  4WF2 A;  1Y8R B;  1AA7 A;  1XMX A;  2WAF A;  4D5F A;  4XLF A;  4OMZ A;  5HS9 A;  4BGD A;  4F55 A;  2BHZ A;  4A3K J;  2CSO A;  2VBW A;  1XD7 A;  4RAY A;  1XSD A;  4FCY A;  2EIL H;  5E79 C;  1NK3 P;  2DFH A;  1XN7 A;  3JSP A;  5EGO B;  4I7H A;  5ICE A;  1YRN B;  2QEN A;  1YS6 A;  2HR3 A;  1RZ4 A;  4EGZ A;  2IAI A;  1JUP A;  4GYI A;  3DPL C;  2E71 A;  1N75 A;  2OPT A;  1JKR C;  5IOY A;  1BI3 A;  1XMK A;  3BZK A;  3ERM A;  1IGN A;  4BDY A;  1OYI A;  2FOW A;  3IRQ A;  4B8X A;  1BR1 A;  1ETW A;  3EDP A;  5F0C A;  2FXA A;  2VJ4 A;  1YJW I;  4ITV A;  2OCC H;  5GP9 A;  2ZME A;  1QHH D;  4M9Z A;  2XSD C;  1P9Q C;  2QQ9 A;  3I71 A;  3HUG B;  2NRA C;  2FQ4 A;  1YOV B;  1MJB A;  1FYK A;  3FIW A;  2E19 A;  3PO2 J;  1F9N A;  1DU6 A;  1EV7 A;  2M34 A;  4HQM A;  2GXG A;  3VYS B;  3ECO A;  2G0E A;  3G1M A;  4DOZ A;  5E1W A;  4B47 A;  2HDW A;  2AQE A;  3IH2 A;  2EV6 A;  3AG1 H;  4CIC A;  3CO7 C;  1FTZ A;  4PGH A;  3BWG A;  1YTY A;  1BJZ A;  3KP7 A;  3F22 A;  4BDZ A;  4IPA A;  5CYV A;  4FAS D;  4ENN A;  2GA2 A;  1F43 A;  2DQL A;  1GT0 C;  3L7W A;  4XKC A;  1WH7 A;  3GTG J;  1FJL A;  4RM2 A;  1A36 A;  1JT0 A;  3F8N A;  1P4X A;  3SFZ A;  3ML6 A;  1QA6 A;  3F8B A;  2MH9 A;  2BVM A;  1NHA A;  3GO5 A;  3CME I;  2P7V B;  4G7O F;  2BVL A;  4NB5 A;  4KFC A;  2ESH A;  4AC0 A;  5IT3 A;  2V9K A;  3MCZ A;  1U5T A;  1GUU A;  4GRI A;  4EJU A;  3JRF A;  1T33 A;  2EA2 A;  2BY0 A;  3I4N J;  3BDD A;  3IRR A;  2I5U A;  3DF8 A;  5GTH C;  3L2V A;  3OYF A;  1ZR2 A;  2O7O A;  2NNN A;  2W57 A;  5FKM A;  4A3L J;  2CUJ A;  2VKH A;  2HDC A;  2KRH A;  4EM1 A;  4G7Z F;  1I5Z A;  2H6C A;  2NNY A;  2PQ8 A;  4MGR A;  4XN0 A;  1WKM A;  3IAS 2;  3S3N A;  1TWF J;  3VOE A;  4IHX A;  4A3I J;  2IGN A;  2DK5 A;  1OCP A;  1R22 A;  2ZKZ A;  1XCB A;  2P81 A;  1UCR A;  2X85 A;  3VFZ A;  3ZXS A;  2HU9 A;  2YPR A;  5DTD A;  3JRG A;  4PK4 A;  2CQX A;  2GAU A;  2WA0 A;  1VQ7 I;  3BG6 A;  3GVA A;  3LAP A;  2A68 F;  2P5V A;  3OL3 A;  4BBS J;  2HZD A;  3H3Z A;  1EF4 A;  3DEE A;  3KLO A;  1P7I A;  2GM4 A;  2FMY A;  4JX4 A;  2CW0 F;  3BJO A;  1MMS A;  2IGM A;  1JGS A;  3BTJ A;  3G71 I;  2Y0S A;  1K4T A;  2VIX A;  1QPM A;  4WX9 A;  3OOU A;  3IKV A;  2R7V A;  3MKZ A;  5B1B H;  2NVQ J;  3R60 A;  2KRC A;  3DU6 A;  1U8B A;  2ESN A;  2ISY A;  2BE5 F;  2Q2E B;  3LSJ A;  4M6X A;  3U9G A;  1LUJ B;  4BAY A;  2RDP A;  1BA5 A;  2VKD A;  3CJT B;  1BIB A;  2LF7 A;  2DDA A;  2WWY A;  2TCT A;  3COA C;  1P6R A;  1VF9 A;  1L3L A;  1HBX G;  2IS4 A;  1U6G A;  2GWR A;  1FEX A;  2QGU A;  1S72 I;  1TTY A;  3F8C A;  3S1M J;  1UAA A;  3CC4 I;  2VN2 A;  1YG2 A;  2LRE A;  1D5Y A;  3I56 I;  3OSF A;  2OJE D;  3SFI A;  1X1D A;  1U9N A;  1I39 A;  4NDL A;  2Z3Y A;  4CXF A;  4LD5 A;  3S17 J;  3HIF A;  1IN7 A;  1FC3 A;  3FMR A;  4U7D A;  2CQN A;  1Y8Q B;  2RVC A;  3RYR A;  2CV0 A;  2HFH A;  3KZI C;  2A5Y B;  2DMT A;  3S2D J;  1KA8 A;  2IS2 A;  1WVR A;  1S9H A;  3RCO A;  3GTM J;  5B5E C;  3C2B A;  3BRO A;  3W2V A;  4XLN F;  4G9Y A;  2EIJ H;  3GFI A;  1E2X A;  5H2F C;  3MKL A;  2MSY A;  2K4B A;  2A69 F;  2FJ1 A;  3O8H A;  1V5G A;  1S8N A;  2NOG A;  3K2A A;  2VXD A;  1SEU A;  2Y30 A;  1ON1 A;  5IP6 A;  3FF5 A;  2X6O A;  1MNM C;  1MBJ A;  1R1T A;  2HS5 A;  4EM2 A;  3P9C A;  4ENM A;  4XOT A;  2IJL A;  2DI3 A;  2WY7 Q;  3CJN A;  2CJJ A;  4NC7 A;  3I4P A;  5BPD A;  3Q5F A;  1TQI A;  4NC6 A;  4OU0 A;  5TGT A;  5GPC A;  3HL2 A;  3S93 A;  2HOE A;  3IP4 B;  1HOM A;  5ILU A;  1R71 A;  3A2K A;  2XAU A;  4A3C J;  3CF2 A;  5FB2 A;  4PCQ A;  5DM6 F;  3D5L A;  2LG4 A;  4LIU A;  1LVA A;  1R1V A;  2FBH A;  3N05 A;  3BJA A;  2MBF A;  3CUO A;  5ICF A;  1R6R A;  3HRU A;  2M7B A;  1G3Y A;  4C30 A;  4TV7 A;  3ABL H;  5FLX Z;  2P7C B;  2FA5 A;  2I10 A;  4ZYE A;  4DYC A;  2W48 A;  1PDN C;  4DBQ A;  3G2B A;  2L9V A;  3GTO J;  4MEX F;  2O03 A;  4C2T A;  4HBL A;  1V5E A;  2JUC A;  3ASN H;  1ITY A;  3GZ5 A;  1SD5 A;  3DTK A;  2VT2 A;  1ONV A;  1U9O A;  2KP6 A;  2FOK A;  1TNS A;  4AVP A;  3PQJ A;  3T5X A;  1KU2 A;  2W00 A;  4HST A;  1ODD A;  3RJP A;  1DPU A;  2BY2 A;  2QKL B;  5M3F J;  1HQC A;  2KJC A;  4WK8 F;  3V4G A;  3N97 A;  4GFB A;  1QNT A;  2Y75 A;  2JZY A;  1KYW A;  2M8G X;  3R4K A;  1R1U A;  3HSF A;  1VI0 A;  2X4H A;  2E2I J;  1ZGW A;  4PDK A;  4F3Q A;  3CQZ J;  4GGG A;  1FZP B;  5EJC A;  5IP7 J;  2XKP A;  3O8G A;  5B1A H;  3ZN0 A;  3HG9 A;  1UZC A;  1ETQ A;  1YS7 A;  2E5Z A;  2MA3 A;  3BR3 A;  5IYC J;  3FIS A;  4RAG A;  4ZJZ A;  2ICW G;  2F5C A;  2KHM A;  2YU3 A;  4R8H A;  3I55 I;  4OIQ F;  3CTA A;  2L7M P;  1MMN A;  3IWZ A;  3Q3S A;  5FFX A;  2QBY A;  2QF7 A;  4F7Z A;  3HXL A;  3GBG A;  3GFM A;  5EGO A;  4E4H A;  1R58 A;  3ZRG A;  2YS9 A;  5J8C A;  2LBF A;  4BHB A;  4IHT A;  3LL7 A;  1K6Y A;  4ENK A;  4FE7 A;  4JOM A;  5LD2 C;  4UUT A;  1LEA A;  2IW5 A;  2HWV A;  3LA3 A;  2L5Q A;  2GOX B;  3LSG A;  1ZK8 A;  2HPM A;  4ESF A;  2R0Q C;  1G8X A;  1HW5 A;  4MLO A;  2R93 J;  1BI0 A;  2V79 A;  2EK5 A;  2IGK A;  4M9S A;  4EJT A;  3QU6 A;  4KNY A;  3IC7 A;  3UNG C;  4BHP A;  3HC7 A;  3CMM A;  2F4I A;  2DYR H;  2FU4 A;  3DEU A;  4B1R A;  1B8I B;  1U5T B;  2K9L A;  2BY1 A;  5HVQ C;  4OIP F;  2CW7 A;  2AXL A;  1CF7 B;  3E0J B;  4JYK A;  2E60 A;  1UFM A;  2CGP A;  2X1E A;  1IF1 A;  2V1X A;  4RB3 C;  2A05 A;  2ZJQ F;  5FLV A;  2DOF A;  3LNQ A;  2QYO A;  3ZQQ A;  5KVR A;  5BMZ A;  3H92 A;  3VWB A;  1H89 C;  2QQA A;  3WTX C;  3ONQ A;  1SMT A;  3B6C A;  3K4N A;  1RIO H;  1LFB A;  1SFK A;  5CVU A;  2AO9 A;  4HDV A;  4IXA A;  3ABT A;  1UHM A;  2LD5 A;  3GZN B;  3CCS I;  1HST A;  1ZAO A;  3ELK A;  3BPX A;  3JSO A;  5FGM A;  1HKS A;  5KNL A;  3F9K A;  4D7M A;  1FIA A;  3LFU A;  3LSK A;  5IT9 Z;  1BW6 A;  5J1Y A;  2GOM A;  5C4J J;  2GQQ A;  3HPG A;  4I76 A;  3JRC A;  1XGN A;  3H36 A;  2BXZ A;  4II3 A;  1FTT A;  3KP3 A;  4HW0 A;  4L18 B;  4PJ0 C;  2HVS A;  4A3E J;  1D3Y A;  3M1C A;  4UXN A;  3DQV C;  3TGN A;  2XF5 A;  1XTA A;  4I6Z A;  3FHZ A;  1Z77 A;  4Y4R A;  4HNV A;  2BEO A;  4FTH A;  3S2H J;  1WH5 A;  1J5Y A;  2ZO4 A;  4A3G J;  1LE8 A;  3D5R C;  3H5R A;  4Y15 A;  2JRT A;  3F6V A;  2V1N A;  4KMU X;  4XR6 A;  1QZY A;  2IVM A;  5E1Z B;  2V1U A;  2PEX A;  5HNF A;  1J75 A;  2BHY A;  2R7F A;  2RRE A;  4PSW A;  3PNT A;  2R7U A;  1TW2 A;  1GHC A;  5CLS A;  2K5C A;  1HW1 A;  3CCR I;  2H1L A;  2Y0S N;  3WGI A;  4IQ4 A;  3BY6 A;  1OYW A;  3I64 A;  3DPU A;  4HLX A;  1IN6 A;  3K6G A;  5E3L A;  3ZMS A;  3CES A;  1V55 H;  2JVH A;  2N8G A;  3KE2 A;  3E6C C;  2DFI A;  2HQA A;  1D1A A;  2K9N A;  2ZBK A;  3E5U A;  4HA8 A;  4BHC A;  1YJN I;  1X2M A;  2FML A;  2HZT A;  2PMH A;  4O6J A;  3TOA A;  5K5R A;  2EZI A;  5BOX A;  2DA3 A;  4IF4 A;  2VXZ A;  3OIP A;  3OS0 A;  5C4X J;  3M7G A;  1X58 A;  3OS1 A;  1T08 B;  2K86 A;  3HBL A;  1T56 A;  3DFG A;  4F91 B;  2A61 A;  5J4V A;  5BPI A;  3FHN A;  3H0D A;  1P4A A;  1K83 J;  2CMP A;  1IC8 A;  4IX7 A;  4MNU A;  1BR2 A;  1QVT A;  2NVU B;  3WTT C;  2KMU A;  1ZLJ A;  1VND A;  2KIF A;  3MN2 A;  4AIH A;  4DZJ A;  2QQB A;  4ANJ A;  3I9V 2;  2VI6 A;  4JX5 A;  2IS6 A;  1KON A;  4EV0 A;  4K2E A;  4XK4 A;  2LTP A;  1O3T A;  5LGT A;  4D7N A;  4J01 A;  2CUF A;  3F23 A;  4A12 A;  2V4J C;  2JRM A;  4HX7 A;  2R7S A;  1HXD A;  4Y7N J;  4M3D A;  2DK8 A;  3B6A A;  3HDD A;  4YG2 F;  3E5X A;  5ILS A;  3GZ6 A;  3W6K B;  3IHU A;  5CKT A;  1JKP C;  1Z7U A;  2ME0 A;  4G6D A;  1RPW A;  5KCM A;  5FRO A;  3V7R A;  2FRH A;  2EFW A;  3P5J A;  2PI0 A;  2P4W A;  4QIW N;  1A6I A;  1TZL A;  1I50 J;  2IRF G;  2O6G E;  2DFF A;  1RUN A;  2L4M A;  2LKS A;  2HVQ A;  3ZQF A;  4BEH B;  2AXT C;  2EA4 A;  1ACI A;  2K3P A;  1Z9C A;  1S7E A;  4BY1 J;  1FOW A;  1WWX A;  1WJ5 A;  1KU9 A;  3BG5 A;  3M3Y J;  3ROU A;  2STT A;  4UV9 A;  2R7D A;  2VLA A;  5IP9 J;  1KU3 A;  4BQQ A;  4FX0 A;  1UJ8 A;  1T38 A;  4B43 A;  2GZW A;  4FT8 A;  2LLK A;  2M0C A;  2O5R A;  4M71 A;  5M3M J;  4XIC A;  2V9V A;  3HOS A;  3MAJ A;  4ZC3 A;  3MFK A;  3TQN A;  4I02 A;  1NH3 A;  3OYH A;  2FNP A;  1JKO C;  1TL8 A;  1E0E A;  1W0T A;  4C3I J;  3IL2 A;  3H5N A;  3OYB A;  2CQQ A;  3LFK A;  4M9X A;  3ZCO A;  1MSF C;  1B9M A;  1SFU A;  2KLO A;  5CQE A;  1LQ1 A;  3LST A;  2Q2E A;  2RV8 A;  4HLY A;  1VQ4 I;  4X6A J;  2V6E A;  5E18 F;  3EPZ A;  5DDG A;  2M0M A;  1W5S A;  1A04 A;  3X2Q H;  3RZD J;  2DPD A;  1H9G A;  1V4R A;  3EUK L;  1Y1V J;  3J80 Z;  4U7B A;  4M73 A;  1D5V A;  2IS1 A;  2LP0 A;  4KIC A;  3R6S A;  2X1C A;  4ZDP A;  1H0M A;  2DOD A;  3DEW A;  5AIP A;  4G8X A;  3HTU A;  3BLY A;  3DWL E;  3S1R J;  1XG1 A;  2DYS H;  3G1O A;  2JPC A;  4D0P A;  4FIS A;  1KQ8 A;  3GME A;  2E1M B;  1U78 A;  2JA5 J;  4E7H A;  2ZFW A;  3BR6 A;  3MZH A;  1H9T A;  1LDK B;  3L2U A;  3QOP A;  2VT3 A;  1SFE A;  2WV0 A;  3R0J A;  3G73 A;  4L0Z B;  2W85 A;  1EJ9 A;  5EG0 A;  3GFJ A;  1T0F C;  5KAF C;  4IRG A;  2KZG A;  3S1Q J;  3S32 A;  2XAH A;  1HDD C;  3CUQ C;  2A6E F;  3OWT A;  3G3Z A;  5LRR A;  1D8K A;  1BI1 A;  3S16 J;  2DU9 A;  3FXL A;  4KIS A;  3HOW J;  4BE0 A;  3QPS A;  4L5J A;  2C6Y A;  3K9T A;  3Q0W A;  4XRS A;  4LMY A;  5GAE J;  2JJ7 A;  3TP3 A;  4U0Y A;  1GXQ A;  1BC8 C;  4KJZ A;  5KAI C;  4ESB A;  1FLI A;  3MWM A;  1I6H J;  2PLY A;  2EWN A;  1IXC A;  3CP2 A;  4I09 A;  4CSW A;  5K5Q A;  2DCE A;  2J5P A;  1TWH J;  4FQG A;  5D8K B;  5J40 A;  1X3Z B;  3HOY J;  1ZRC A;  5LRS A;  1MSE C;  5IPA A;  3GFL A;  4HV5 A;  5LEK A;  5J1R A;  4HF0 A;  4HYE A;  4HF2 A;  3DTI A;  4DBR A;  2VON A;  4RB1 A;  3FK7 A;  3O3K A;  5H6R A;  5IT9 K;  2L54 A;  3HRM A;  4ASN A;  2VC0 A;  4BYY A;  4BS9 A;  3SEQ A;  2XDV A;  4YEJ A;  5A2Q K;  3E7L A;  4P55 A;  3GUD A;  1YW8 A;  2BY3 A;  3PNV A;  4RB0 A;  2Z5U A;  3FXM A;  1T2K A;  5D5U B;  1UMQ A;  5EDN A;  4XLP F;  4A3B J;  3P7N A;  3L2C A;  3IV5 A;  3HJE A;  3DCF A;  1XS9 A;  2LR8 A;  5LHH A;  4B3A A;  4OOI A;  2FQ3 A;  2CG4 A;  5F08 A;  2KIM A;  2MLK A;  2X48 A;  3EUA A;  3CCJ I;  2W24 A;  1AU7 A;  1MDM B;  4E7Z A;  2B0L A;  4L9N A;  2BW3 B;  2O8X A;  3RPU D;  1E17 A;  2DLL A;  5LFA A;  3SEZ A;  1RC9 A;  3FXO A;  4CCL A;  2HTJ A;  2XAQ A;  2D45 A;  3A01 A;  5K7Z A;  4R79 A;  3EYY A;  1IUF A;  1ZGA A;  3KP4 A;  3RKW A;  1N77 A;  1K7A A;  3J81 K;  1X4O A;  2K3F A;  1R00 A;  2VOD A;  2DDB A;  1G3T A;  1FNN A;  2FSW A;  3OYK A;  3CCY A;  3M8F A;  1FPQ A;  1T6S A;  4IOA F;  4V2G A;  3JTG A;  3RPQ A;  2ELJ A;  3K4B A;  1ENH A;  3SXY A;  3CCV I;  4DQ2 A;  3LWF A;  1PP7 U;  2PG4 A;  2D5V A;  1HW2 A;  2CFX A;  3A0B C;  1LPQ A;  2ZJ2 A;  2VJI A;  2DQR A;  4RDU A;  3LOC A;  1OCZ H;  1FYL A;  2KFD A;  2QKM B;  4XRS G;  4QTR A;  1YHQ I;  4RM3 A;  4UVC A;  3KET A;  1QO0 D;  1SAN A;  1IN4 A;  3KFW X;  5HDK A;  3I4M J;  2A6H F;  3PSI A;  4D1Q A;  2RQP A;  2GXA A;  5FKO A;  1ETO A;  4QWQ A;  3C7J A;  5HLI A;  3PJR A;  3WU1 B;  1QZZ A;  1HSJ A;  1BL0 A;  1I1S A;  4LOC A;  3MMY B;  2QEX I;  3QYB A;  1KQ9 A;  1ZLK A;  3NQO A;  2Y69 H;  3QAH A;  4AIK A;  1D1C A;  3S2W A;  1IJW C;  4HX8 A;  2MH2 A;  3MZY A;  2HVR A;  1WFX A;  1W1W E;  1SVM A;  3BC8 A;  1WJB A;  1EKE A;  2H94 A;  4XL9 A;  3GTP J;  1YX5 A;  3BR2 A;  5LGU A;  4N9H A;  4IOC F;  2NS7 A;  1QU3 A;  5EF6 A;  4ZYG A;  1C0W A;  1MMA A;  3B73 A;  3GTJ J;  2ZNZ A;  4MTE A;  1TBX A;  2EBI A;  5K1Y A;  3GTQ J;  2R7Z J;  1Z67 A;  3HGG A;  1X1B A;  3BTI A;  4HPQ A;  4XLE A;  4RGR A;  2F4O B;  3E1S A;  2VJ5 A;  1G6N A;  3REO A;  3H0G J;  4A5M A;  2EQR A;  2D1V A;  1XCV A;  2PJR B;  4WCG A;  3AG4 H;  2LY9 A;  2CUZ A;  1H88 C;  2L2O A;  4IHW A;  2EB7 A;  1SC7 A;  1IRG A;  1SMY F;  3OY9 A;  1FOX A;  2NS8 A;  1CGP A;  4C2M J;  4MFE A;  2A3S A;  2A6T A;  1WI9 A;  1JKQ C;  1WHU A;  1MBE A;  5IYB J;  2M45 A;  2FEZ A;  4M3G A;  1IRZ A;  1VFC A;  3KEQ A;  5DUK A;  2DO7 A;  4KIT B;  1ULY A;  3LMM A;  3IH4 A;  4RMN A;  5HS7 A;  4HOB A;  1IAW A;  2EPF A;  4E6K G;  2ID3 A;  4M6Y A;  2ZFU A;  1XB4 A;  2O9L A;  1I1G A;  3PUB A;  5ICC A;  3Q9V A;  3OR2 C;  2ZNY A;  2MD5 A;  3EQL F;  4WXD A;  2BYV E;  5JLW A;  3BR1 A;  1T0F A;  2LKX A;  4KA4 A;  2MFZ A;  4M3B A;  2DA2 A;  4X0G A;  2CYY A;  3TED A;  2R3S A;  5E8I A;  3BCB A;  1CF7 A;  4ZDL A;  4LG3 A;  1EH8 A;  1OR7 A;  2IXS A;  1FIP A;  2VQG A;  1R5G A;  2L7Z A;  4CCM A;  4UY8 I;  3M9A A;  3DLL F;  2L3D A;  4PSX A;  1LE8 B;  1R49 A;  1VQM I;  3FBI B;  2IPQ X;  4XLA A;  4EJW A;  1VQL I;  3GWZ A;  1GV5 A;  1I27 A;  2DA7 A;  4ZZD A;  2XAJ A;  2X6Y A;  1YI2 I;  1D0Y A;  4XN3 A;  2DOE A;  2LF8 A;  2EZK A;  4U87 A;  4HSR A;  3TO7 A;  4UHT A;  4JBA A;  3PUF A;  3ZQH A;  1S7A A;  5FRM A;  5E3N A;  1RUO A;  1ZTR A;  1FBQ A;  4E7I A;  2OV7 A;  2E2H J;  2DJI A;  3AFH A;  2KT0 A;  2L0K A;  3U2R A;  2QSH X;  3CC2 I;  2XPU A;  1MH4 A;  1LB2 A;  3DLA A;  3LQQ A;  3W3C A;  3I59 B;  1TQM A;  4BBR J;  5IOZ A;  5GAD J;  5DCM A;  2EFO A;  1GVD A;  4KIG A;  3K1M A;  4EVI A;  2BBY A;  4A0Y A;  2PBI A;  3VDX A;  1Z3X A;  5J8F A;  2LRD A; 
#chains in the Genus database with same CATH homology
 4PJJ A;  2GOM A;  2UUZ A;  1OR7 C;  1ERD A;  3HPG A;  4F92 B;  4NQW B;  4II3 A;  3LSM A;  4BAC A;  4YEL A;  4N4N B;  1X19 A;  2MYS A;  2V26 A;  4CCJ A;  2HVS A;  3OYD A;  3M1C A;  4XKB A;  3S8P A;  3QOD A;  3S3M A;  2FUG 2;  3DQV C;  2XF5 A;  1U0J A;  3MKY B;  4Y4R A;  4EAT A;  3DTE A;  1HA8 A;  3D5R C;  3H5R A;  3OYN A;  2WB1 A;  3TL4 X;  1UEL B;  2DT7 B;  4XR6 A;  2V1N A;  1WJD A;  4RLF A;  4C9Y A;  5HNF A;  5KHD A;  2RRE A;  4PSW A;  3PNT A;  1Z3Y A;  2R7U A;  3DKY A;  2F6C A;  5HNH A;  2MAB A;  2K5C A;  1TT0 A;  4E7K A;  3ZGK A;  3W2W A;  4IQ4 A;  4BE2 A;  4IQJ A;  3QYF A;  3DPU A;  1N78 A;  3K6G A;  4OAY A;  3CES A;  2JVH A;  3V42 A;  3VYT B;  3OYM A;  3BCA A;  1MND A;  2HQA A;  1D1A A;  2VPL A;  4XLH A;  3EUH C;  4F52 A;  1NG6 A;  3I3L A;  1T95 A;  3H5A A;  3H9G A;  2VXZ A;  3K4M A;  3OIP A;  3OS0 A;  1IRX A;  2LH9 A;  3RQ4 A;  2E1M C;  1Z21 A;  2X6X A;  2KZV A;  3OS1 A;  1DGW Y;  4F91 B;  2CW8 A;  1V5F A;  3FHN A;  3H0D A;  2CMP A;  4IX7 A;  1BR2 A;  2KMU A;  1WJA A;  3PFY A;  1SAU A;  3OS2 A;  3DPT A;  4BE1 A;  1JI8 A;  4JQF A;  4ANJ A;  3I9V 2;  3IAM 2;  3C2H A;  3K10 A;  3PSF A;  2IS6 A;  1KON A;  3J7A Y;  4LIT A;  3SYT A;  2M4G A;  2R7T A;  1W36 D;  4J01 A;  4OAZ A;  1AA7 A;  2WAF A;  1Y56 A;  2V4J C;  4XLF A;  4BGD A;  4F55 A;  2R7S A;  2ZXI A;  2JA2 A;  1D1B A;  1PYV A;  4PJL A;  5CKT A;  4E7L A;  1Y6I A;  2M3A A;  4YRV A;  2M7A A;  3DKX A;  1D0X A;  4CCK A;  2Z2S B;  3DPL C;  5KCM A;  1N75 A;  5FRO A;  4BU2 A;  4XOR A;  2KQR A;  1ZEL A;  4CUG A;  1TZL A;  3HPH A;  4BDY A;  2HVQ A;  1BR1 A;  3AKZ A;  2VJ4 A;  2F5V A;  1MMD A;  4ITV A;  4BEH B;  2K3P A;  1QHH D;  4NNJ A;  1P9Q C;  4HNT A;  3OYE A;  1WJ5 A;  3HUG B;  1OLT A;  2VLA A;  1LVK A;  4PUS A;  4BQQ A;  3OMY A;  4B43 A;  2MC4 A;  4AVZ A;  2HNH A;  2O5R A;  3HOS A;  2X1D A;  3C2G A;  4ZC3 A;  4LIV A;  3VYS B;  3OYH A;  2ZXH A;  4DOZ A;  1E0E A;  4B47 A;  2VQL A;  2HDW A;  2AQE A;  3H5N A;  3HKZ A;  3H35 A;  4NC8 A;  3OYB A;  2CS3 A;  3ZCO A;  3VYU B;  3K4L A;  3LSH A;  2A5W A;  2JVG A;  2KLO A;  5CQE A;  4BUP A;  4IKF A;  4BJT A;  2ZSH B;  2V6E A;  4BQO A;  4BDZ A;  2WAD A;  3OYA A;  2R7R A;  3EPZ A;  4FAS D;  3K70 D;  2M0M A;  2OUM A;  2MD0 A;  1BR4 A;  3EUK L;  4XKC A;  3SDB A;  2LYC A;  4U7B A;  2W1O A;  4RM2 A;  2IS1 A;  3OYG A;  4ZDP A;  2X1C A;  2BVM A;  4KT6 A;  4ZYA A;  3BLY A;  3DWL E;  2BVL A;  4CZC A;  2E1M B;  4E7H A;  2V9K A;  1LDK B;  3L2U A;  4GRI A;  3LSI A;  3NWT A;  1WJF A;  3AL0 C;  4CA0 A;  3L2V A;  2E5N A;  2UWM A;  1T0F C;  3OYF A;  2VB6 A;  2PJR A;  2VQH A;  4XLC A;  2CUJ A;  4ZTF A;  2VKH A;  3S32 A;  2KRH A;  4XMY A;  3OWT A;  2Z16 A;  2CFO A;  4DJA A;  2W7N A;  4XN0 A;  1BOB A;  3OYL A;  4KIS A;  3IAS 2;  4XNF A;  3S3N A;  4E7S A;  4BE0 A;  2IGN A;  5FRN A;  3ZXS A;  4XM3 A;  2X85 A;  2HU9 A;  4PK4 A;  4HNU A;  2WA0 A;  3BG6 A;  3A4C A;  4KJZ A;  3OL3 A;  2HZD A;  2Z1D A;  3DEE A;  2R7Q A;  4RLQ A;  2IGM A;  2UV1 A;  2Y0S A;  2VIX A;  3CP2 A;  3SZG A;  4CSW A;  2DCE A;  3OOU A;  4CH7 A;  2R7V A;  3MKZ A;  3VYR B;  2KRC A;  3DU6 A;  2XF6 A;  4B48 A;  2Q2E B;  4NUB A;  2W4S A;  3DTI A;  4DBR A;  3DU5 A;  2VKD A;  4QPQ A;  1X1C A;  2VAS A;  2WAE A;  4AYB A;  3OYC A;  1MW7 A;  2R4G A;  4BJ5 C;  2IS4 A;  3QOE A;  4BS9 A;  4FET A;  3SEQ A;  2XDV A;  4YEJ A;  1UAA A;  4HEA 2;  1YE9 A;  3PNV A;  1Z7L A;  4DIQ A;  2LRE A;  1X1D A;  1D0Z A;  2VQC A;  4BEH A;  1MNE A;  4BQN A;  4PFP A;  2AQF A;  3EUA A;  2NOJ B;  2M4K A;  5CPR B;  2RQQ A;  2CV0 A;  4ZDO A;  4E7Z A;  4H4K C;  4D9J A;  2JUG A;  2IS2 A;  2BW3 B;  3RPU D;  1S9H A;  5LFA A;  3RCO A;  3SEZ A;  3W2V A;  4CCL A;  4CCN A;  4R79 A;  4IZZ A;  4XQF A;  1N77 A;  1V5G A;  1X4O A;  2CV2 A;  2VXD A;  2VJJ A;  3OYK A;  2WBM A;  3K4K A;  3TMO A;  2ZSI B;  4XOT A;  2WY7 Q;  4NC7 A;  3L2Q A;  2ELJ A;  3K4B A;  4B3X A;  1GLN A;  3FDY A;  1WJE A;  5TGT A;  1DQU A;  4AU7 A;  2VJI A;  3S93 A;  3MD2 A;  3HL2 A;  3IP4 B;  1MMG A;  2QKM B;  4RM3 A;  3A2K A;  2XC7 A;  2XAU A;  3CF2 A;  2VL8 A;  3PSI A;  3M8J A;  3OIQ A;  4DGW B;  2JSP A;  2LG4 A;  3CP8 A;  3D5L A;  4LIU A;  3UR3 C;  4D1Q A;  3PJR A;  3N05 A;  3W2A A;  1FMW A;  1R6R A;  2CV1 A;  2M7B A;  5CQG A;  3MMY B;  4C30 A;  3QYB A;  3OL4 A;  3U21 A;  2BOL A;  1D1C A;  3ZR8 X;  3K4C A;  2X51 A;  2PMZ A;  4DBQ A;  3BG7 A;  3G2B A;  2HVR A;  1WFX A;  3IUO A;  2CH0 A;  3BC8 A;  4C2T A;  1WJB A;  1V5E A;  2W82 A;  4P1W A;  4Y33 A;  4C2U A;  4XL9 A;  1YX5 A;  4PJM A;  3VSK A;  3DTK A;  1QHG A;  3CZ6 A;  4QPO A;  1QU3 A;  2KP6 A;  1VZ0 A;  2X6W A;  4OWR B;  3OYJ A;  2W00 A;  4HST A;  1MMA A;  3RTR A;  3H9J A;  4BXF A;  1X4P A;  2QKL B;  2LC2 A;  4HRI A;  1DP3 A;  1X1B A;  1EA3 A;  2XSJ C;  4HPQ A;  4XLE A;  3KEY A;  3CJR B;  3E1S A;  5JHF A;  2VJ5 A;  3K4J A;  4F3Q A;  1W36 C;  2HPI A;  3KX2 A;  2PJR B;  2CUZ A;  2L2O A;  3FBN B;  3HG9 A;  3OYI A;  2E5Z A;  4ZTJ A;  4ZJZ A;  3OY9 A;  2KHM A;  2KPM A;  4PFO A;  3AL0 B;  1MMN A;  2A6T A;  2P0W A;  3LSK A;  3HXL A;  4XON A;  3GBG A;  4II2 A;  4E4H A;  4KIT B;  3ZRG A;  3HOT A;  1DGR M;  4PJN A;  2LBF A;  1WJC A;  3KYL A;  2LBF B;  3LL7 A;  3LMM A;  2R7X A;  1K6Y A;  4G6T B;  2WAQ A;  3FKJ A;  4RMN A;  4JOM A;  5LD2 C;  3K70 C;  3OR1 C;  3A1Y A;  1FMV A;  2L5Q A;  4E6K G;  2DT6 A;  2OC6 A;  3D5S C;  2DXI A;  2ZFU A;  2GOX B;  3LSG A;  4P5O A;  2HPM A;  2Q1Z B;  1G8X A;  3PUB A;  4MLO A;  3RSN A;  2IGK A;  3H9Q A;  4BJ6 C;  3OR2 C;  3NWS A;  3UNG C;  1LKX A;  3HC7 A;  3MKW B;  2MFZ A;  2F4I A;  2RNG A;  3CMM A;  4CCO A;  4X0G A;  4J00 A;  2K9L A;  2BW3 A;  3BCB A;  3S3O A;  2XF7 A;  5HVQ C;  4ZDL A;  4LG3 A;  2CW7 A;  3L2R A;  2IXS A;  3E0J B;  2VQG A;  2E60 A;  4CCM A;  3TBI A;  2X1E A;  4Y3O A;  3PNY A;  2R7O A;  4PSX A;  4F93 B;  2LOO A;  3CJQ B;  3FBI B;  4N4O B;  1LFP A;  4XLA A;  4XKV A;  1UG0 A;  2V7F A;  3ZQQ A;  3VSL A;  1X1A A;  3VWB A;  2X6Y A;  4BL0 B;  1D0Y A;  4XN3 A;  2IGO A;  2KL4 A;  3ONQ A;  4U87 A;  4B44 A;  4HSR A;  4XKW A;  3K4N A;  5FRM A;  1SFK A;  4E7J A;  1PJR A;  1G59 A;  2L9S A;  2I8D A;  2KDO A;  2DJI A;  2LY1 A;  2OV7 A;  3AFH A;  4E7I A;  2WY8 Q;  3L2W A;  2LY2 A;  4HG2 A;  2L7K A;  3DLA A;  1NG7 A;  1J09 A;  3W3C A;  5KNL A;  5HOO A;  2R7W A;  3F9K A;  2L9N A;  3LFU A;  5HLT A;  3QYE A;  4XOP A;  2DOA A;  3VDX A;  1YX3 A;  3PL8 A;  1Z3X A;  2K9M A;  2LRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...