2KPMA

Solution nmr structure of uncharacterized protein from gene locus ne0665 of nitrosomonas europaea. northeast structural genomics target ner103a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEERQVPGSTQKALYLRAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
total genus 18
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kpmA01
2LH9A 2KZVA 3RCOA 2LY1A 2KPMA 3S93A 2LY2A
chains in the Genus database with same CATH superfamily
2DTZA 2M3AA 3K4JA 3VSKA 1B72A 2Y30A 2DT6A 3LAPA 1VQ8I 3OYIA 1HQCA 2FXAA 2WB1N 1FIAA 3H9JA 3MEXA 1S72I 1TZLA 2DOAA 4G9YA 4PFOA 2PJRA 3W6VA 3V8LA 2NS8A 3ASOH 1AA7A 1WRJA 3H9QA 4RB0A 1JJ8C 4IXAA 4NDLA 3D5RC 3Q9SA 4QPOA 3CP2A 4B43A 2A69F 2KKOA 1W5SA 2MH9A 1D1BA 1W1WE 4CGZA 1OCOH 2NVUB 2BYVE 3ABTA 5A2QZ 2ZB9A 2QEXI 2ECCA 3P9KA 3M1EA 4B3AA 2ZKZA 2X6OA 2CS3A 4RGUA 3LSJA 4G12A 3M07A 1V5FA 1XTAA 2K9SA 2DMUA 1SVMA 1TL8A 3S17J 2DA6A 3WU2C 5IY5H 3SDGA 4BBRJ 2P7VB 1F43A 4BXFA 3S3OA 4A2UA 4GXOA 5E20A 2WC2A 3J7YJ 1I39A 2E7WA 2X0LA 3C7JA 3WU0A 4ASNA 2HOAA 2RGVA 1B8IA 2M30A 2UXXA 2Q1ZB 4HEA2 4F7ZA 3J7AO 1U0JA 2HS5A 3FMSA 2OCCH 1MBJA 1KQ8A 2L9RA 3ECHA 4CYDA 1Y1WJ 1JKOC 1IG7A 1BW5A 2EFWA 2FEZA 3ZQHA 4KN7X 1XMXA 4R1HA 5HNFA 2DAOA 3RYRA 1U9NA 2CRGA 3SZGA 2CO5A 1I6XA 3M4OJ 2HVSA 4HLXA 4RAYA 1HDDC 3E0JB 2EZHA 3QP5A 1QRYA 2HWVA 2P0WA 3FXMA 3PIOF 1ZG5A 2PQ8A 4RGRA 2FJ1A 3DPTA 4HBLA 1TP4A 4ESFA 2DA7A 1ZARA 3WG9A 3H35A 4KT5C 3DLLF 1TWGJ 2VC1A 2YU3A 1D8JA 4PJMA 2VBWA 2ZC2A 1WGXA 1YG2A 2LD5A 2KQRA 1MW7A 2BVLA 1P2FA 5E3MA 2WAQN 3RTRA 4G7ZF 2QQAA 1HDPA 3HOSA 2EH3A 1NG6A 1HLVA 2LP0A 3JRIA 1ZR4A 1WCMJ 2M4KA 3ESWB 1HBXG 1R22A 4I01A 2O5RA 3GLLA 3IKTA 4IEJA 2OUMA 4XN0A 3MKYB 3BT9A 3DEUA 4BU2A 3T8TA 1I27A 2BXYA 2XDVA 1RR8C 4HDVA 2ESNA 2ZCWA 4UB8C 3A2KA 2P6SA 4A69C 1Y6IA 4HQMA 4EMSA 4CDGA 1V55H 1X4OA 5CJ9A 4CZCA 5GPAA 5K7FA 3AG3H 3WTXC 1T38A 2EV6A 2KPMA 5LHIA 3BZ6A 4E7KA 1Z77A 4EJUA 3T8RA 5KAFC 3FHZA 4ZYHA 4I98B 1ZGJA 1A04A 5JVGF 2PMUA 1AHDP 2NOGA 2GA1A 4LD5A 4CCMA 1HSJA 4LIUA 4AVZA 3AAFA 1YW7A 5J40A 2VKVA 3PO3J 2HDWA 1CQTA 3RYPA 2KRCA 3K10A 3SYTA 5FLXZ 3W2AA 4L0ZB 3S16J 3KCCA 1LDKB 4BHPA 3ZQCA 4L18B 5DD8A 2BVMA 2A6EF 1K4TA 1OQYA 4OIQF 3QQAA 1BM9A 4LITA 1RETA 3MFKA 1WJBA 2Y31A 1XMAA 4EJOA 2R92J 2E2IJ 2HXIA 1NG7A 2XROA 1R6RA 3BQZA 2OPTA 3HZJA 1BR4A 2O03A 2DPUA 1OMIA 1YJWI 2Y9ZA 1DP7P 2E34A 1B59A 2TDXA 1YOVB 3OIOA 5EG0A 3CO7C 3WHCA 3ZR8X 1X1DA 1ZQ3P 4GGGA 2WAFA 2PMZN 4RM3A 4AIJA 2FRHA 2Z5UA 1MMSA 5E1XA 4P9UA 3RQ4A 2ACJA 4PFPA 5D6EA 4BHCA 2QUFA 3S2WA 1TBXA 3H3ZA 5C4JJ 4Z6YA 4E4HA 1LPQA 2A05A 3S14J 5EDNA 2DQLA 3V7CA 3JAMZ 3ABLH 3EUAA 3S2HJ 3S93A 2HOTA 2EFPA 2FNPA 5HLGA 1SD7A 4BBSJ 2PEXA 3HB9A 3IV5A 1MIJA 1LE8B 3FXUA 2WY8Q 2EJRA 3RZOJ 3FBNB 1VTNC 1ZHFA 4GFBA 3HJEA 1R36A 4IO9F 1ACIA 2HQAA 3BG6A 2DA2A 4JQFA 3DKYA 1SD5A 4Y7NJ 2P81A 3ZCOA 1T0FA 1FLIA 2R4GA 2F5FA 3OL3A 1CGPA 3HYIA 2VPLA 2VQLA 5BS6A 1IF1A 3ZQIA 4BJ6C 3HTUA 1LFBA 5E8IA 1AKHB 1R71A 3CF2A 2EA2A 1KU7A 5C44J 4B44A 1ZREA 2VIXA 3BJOA 3S15J 4N9HA 3BTIA 4M9ZA 3CMMA 1VQNI 1X1PA 2V9KA 2OV7A 3E97A 3L00A 3WG7H 1B72B 3T5XA 3V8KA 3LSTA 2W85A 4J00A 6PAXA 1ERDA 2CFXA 3IH4A 2KHMA 2HPIA 3C18A 1BC7C 4BQAA 2RREA 1WJFA 3J7ZI 2X1CA 4GO1A 3CZ6A 3CCEI 3L7WA 2VBXA 1Q1HA 2PJRB 1TW2A 5JLXA 5TGTA 1U5TA 1NH3A 4GRIA 2D2WA 4BY7J 2JA7J 2EV5A 3ZMSA 2FBKA 5FFZA 4FX4A 2XAQA 4A0YA 4DQ2A 4HW0A 3HKZA 4M3GA 2G0EA 3TW7A 1HKQA 1R49A 3I64A 4DZPA 5JLWA 1H8AC 4DYCA 4ETSA 4A0ZA 3WGGA 2FD5A 2M0CA 3BR0A 4C30A 1Y0NA 2W1OA 4M6YA 4KISA 3GFLA 3PNVA 4P9FA 2O9LA 3B6AA 4NNJA 3KPHA 4H0EA 1UJ8A 2I5UA 3KYLA 3FDYA 3F6OA 2NS0A 1ZTRA 3GYHX 1J09A 4XLCA 3TW6A 4YFKF 1ZG1A 4J19A 4ITVA 2D1VA 1B8IB 1WHUA 1MZBA 3CCYA 2PFBA 2V1DA 1O7FA 2IS6A 1OCPA 1LVKA 3ECOA 3WTZA 1I1GA 3UNGC 4CCKA 3RKXA 5K1YA 3JR9A 2Y0SA 1Z3YA 1AU7A 1X19A 2CFOA 5ICFA 4NC6A 2MD5A 5HNHA 2QKLB 2M0MA 4XOPA 1LKXA 2W7NA 2AS5F 1YJNI 4A0XA 2CQ7A 3AG2H 4PGHA 5B66C 4LIVA 3M7GA 4IQJA 2VQCA 3QPLA 4NC7A 4TV7A 2XPVA 4XORA 4EJVA 1WSUA 2CW8A 2FOKA 4D1QA 5L3BA 1MBGA 2QYOA 1O7LA 4PUSA 4C3IJ 2L7MP 4AIKA 5FO5A 3VDXA 3HIFA 3F8NA 4MFDA 3RZDJ 1VQ7I 4G6DA 2E1MB 1A36A 2WA0A 4B3XA 5JHFA 4KICA 2OD5A 5M3MJ 2LC2A 2M7BA 5J1YA 1WJDA 1XDSA 3LOCA 4BJ5C 1S6LA 3BOQA 3BG5A 3F6VA 4O6JA 5M5YJ 4JX6A 4HF1A 2WB1A 4MLOA 2BHZA 2E1MC 3DXJF 5DCMA 1VQLI 4XRSA 3GF2A 2ID3A 5E1WA 3RJPA 4BH9A 3TO7A 4M3EA 3WGIA 4IRIA 4CUGA 1FPQA 4XNFA 4S05A 2FU4A 2OZ6A 4F55A 5CQEA 4MFEA 3DEWA 5ERIA 4M6VA 1MJAA 1MNEA 4KIBA 5IP7J 3VSLA 1GXPA 1YLFA 3IWZA 4XKWA 5ILSA 1YIOA 3DKWA 1PUEE 3A0HC 2W48A 4I02A 1HKSA 3MD2A 3KLOA 4UV8A 4QIWN 5EGOA 2DCEA 4OWRB 4Q48A 3HHGA 1YQAA 4A3DJ 2X85A 1Z9CA 2R7TA 3H92A 3X2QH 1D0YA 3U1KA 2R0QC 3CLOA 4BE0A 1J59A 2EPFA 1N78A 3S1QJ 1Z3XA 4A5NA 2XF6A 5IYDJ 4DIQA 2VKEA 2CSOA 1XDUA 4UUTA 2AHQA 4E7HA 1WJ5A 2BY1A 4JX5A 1XSDA 2R7VA 5FFXA 5BPDA 3ULQB 5EG0B 3K4MA 3HRUA 1ZRDA 4B1RA 2IS4A 2YPRA 2K9NA 4IZZA 4ZYDA 4V2GA 3CJRB 5B1AH 1DP3A 4I09A 2KJCA 2HQRA 4AYBN 3WE2A 2DXIA 4L9VA 1VI0A 2ELJA 2I10A 5HDKA 2E2JJ 5DD4A 4WF2A 3PQKA 4ESJA 4C2MJ 4UVCA 1FX7A 1MD0A 2VC0A 3G4SI 3NRVA 3JRDA 2UUZA 1U3EM 2RAEA 2XF7A 2EFNA 2LNBA 4P55A 4BQOA 2VN2A 4M9XA 2LBFA 2AXLA 4Z2YA 3NWTA 1UZCA 3VODA 3DTEA 3ZMVA 5IT9K 3WE3A 1BIAA 4C2UA 3HOUJ 3QOPA 2NRAC 3DV8A 5F0HA 4I0AA 2WAQA 4MQVA 3LFUA 5IT3A 4IHWA 2GOMA 1SFKA 5F0CA 1XGNA 2HDCA 1OCTC 2MLKA 4G6TB 3AKZA 4IL6C 3CCUI 2V1NA 4X0GA 1ZYRF 4IF4A 2LFBA 4E6KG 4A3EJ 3FK6A 1XG1A 3PFYA 4XRMA 3JW4A 1SMTA 3DLAA 2DT5A 3V8JA 2V6EA 2HFHA 5AONA 1IN8A 3H3VK 4LFUA 2Y9YA 1T95A 3I59A 4EM0B 3OR2C 1ETWA 3IHUA 2ZSIB 1T0FC 1F4KA 4KYWA 4CCLA 4II3A 1YO5C 4IRGA 2COMA 3JTGA 4Q4ZF 5GTIC 5FRMA 3GEZA 4XBFA 3TOAA 1FZPB 1UELB 2DOFA 1FNNA 2LMDA 5KNLA 2JUGA 5FKLA 2PJPA 3LA3A 3RCOA 4YFXF 5JHUA 3PSFA 3IP4B 1IGNA 3SEQA 2FSWA 3PL8A 4X1EA 3O6BB 3L09A 1WFXA 3VYUB 4ZZDA 1UHSA 2H6BA 2QLZA 1U5TB 3QWLA 4D7NA 1Y8RB 4EATA 1GV2A 1LJ9A 4BQNA 3OOUA 2VASA 4BAYA 2PG4A 1QBJA 2OTLI 1ENHA 2DA4A 2GZWA 4OAYA 5TISC 1SFEA 1W36C 4HA8A 5DM7F 5J1UA 4WXHA 3CO6C 3HM5A 2FE3A 4H4KC 3N97A 2HZTA 4CYCA 4I6ZA 4AU7A 1U5TC 2NYXA 1KU9A 4CCNA 1IV6A 2QSFX 3S3NA 2P6TA 3KP7A 3J80K 1K79A 3CDIA 3RKQA 2MYSA 4OMZA 4XSZF 1APLC 3ZN0A 3D0SA 3FXOA 2HNHA 1UG2A 5L3DA 4CH7A 4P96A 3L2VA 2HXOA 1K6YA 3WGHA 2X6YA 1R1UA 2LY2A 5HLIA 4QLCU 4BDYA 5ICEA 5FB2A 1BW6A 5EEAA 5FJ8J 1IDZA 3H3UA 1SAUA 5LLQA 4UV9A 4EGZA 4RLQA 1V5GA 2V79A 4MQ9F 4V19K 3CCVI 1YHQI 3CTAA 3KE2A 2EV0A 5L3GA 1U2WA 3ZOBA 1FOKA 5DM6F 1X58A 3R6SA 1JGSA 3I58A 4II2A 2L7FP 3F8FA 3QAHA 1S7AA 1VQPI 1X2NA 1IRZA 2M34A 3WTUC 1D0XA 3BZCA 3K4CA 3P7NA 4ANJA 1FMVA 5FLMJ 3MKZA 3HC7A 3HXLA 4PSXA 2K9LA 2OAZA 3FWEA 1I3QJ 1QPMA 3FIWA 4P1WA 1IUFA 3JTHA 3IL2A 1R4MB 5DUKA 4I7HA 2CJJA 5B3SH 2WBMA 2NVTJ 3BG7A 3K4NA 1KONA 5IP6A 1W0UA 1U78A 5CPRB 1JI8A 1G6NA 1Y1VJ 2CUZA 2L3DA 5ICCA 2X9DA 1X2MA 1QZEA 2EIKH 2NS7A 2HTJA 2JSPA 3GMEA 4DW6A 2VONA 2FMYA 3ZMTA 4KT6A 4HX7A 4M71A 1BJZA 3KZIC 3EUHC 1FP1D 1MH4A 5DCMB 4AM3A 2XGXA 4IX7A 1USTA 2Z2SB 1RRJA 2KJBA 2XKPA 2XAHA 1EH7A 4FASD 3BJ6A 3G1LA 3K2ZA 2WADA 3FXQA 3HL2A 1ETYA 3S1MJ 3OOPA 5D6FA 3H5NA 3W6JB 3W2VA 1J9IA 1DQUA 1WI9A 1Z0XA 1R00A 1MJBA 3GX4X 2MC4A 2NAZA 3IH3A 2XB0X 3GFJA 3P9IA 2IPQX 3QYBA 4DJAA 4DBQA 3OYNA 4U87A 5H20A 3CLQA 4QWQA 3DTKA 2CGPA 3T1BA 2L9SA 3A1YA 3H0GJ 3OYJA 3LQQA 3MZYA 5EGOB 2GXBA 4YG2F 1A6IA 4OU0A 5EJCA 1RKTA 2CW7A 3DFGA 3R4KA 4KDPA 2YX7A 3A4CA 2DLLA 2JRTA 1ONVA 3AG1H 3OYFA 2WWYA 2LKSA 3S3MA 3L9FA 3P5JA 2EIJH 2M4GA 1MJ9A 1XSXA 2PBIA 1DPRA 1R7JA 3FXKA 5D5VB 2CYYA 1PP7U 1BL0A 4HZFA 1GT0C 5L3EA 1J5YA 1MBKA 5K7HA 3HGYA 4ENKA 1Y8QB 4A3FJ 1G8XA 3GZ5A 2QF7A 2ZXHA 1Z1DA 3QPHA 3ZQ7A 4J01A 3KP3A 2RNJA 1Q1VA 4QPQA 1Z67A 3W2WA 2DYRH 4G7HF 2VJIA 3NWSA 3QPSA 3EPZA 4XQFA 1R4NB 3DWLE 2LBFB 1K83J 2VQGA 4ESBA 1WJAA 1OCZH 2XVCA 3H5AA 3PNYA 2IGMA 3ZMDA 3LAJA 3CMEI 2LR8A 2STWA 2VXDA 3WODF 4IHVA 1P7JA 3Q0WA 4HNVA 1OJLA 3VYRB 4JOMA 1HOMA 1Y39A 1X1BA 2ADUA 1V5EA 2IA2A 1X3UA 3BR3A 4R79A 1GHCA 2JK3A 3OYKA 1S3JA 2R7ZJ 5A2QK 3CUQA 2K85A 3HDDA 2CUEA 3DBHB 3QU3A 2FBHA 4BE2A 4IOAF 4E7JA 1WJCA 2ZFUA 3I54A 4JYKA 2Z3YA 1RR7A 2QZ8A 4LB5A 2DDBA 2G7HA 4XKVA 3I59B 2A6HF 3QODA 3FHNA 4XOTA 4RDUA 2N8GA 4CZZA 1D1CA 4XIDA 4E7SA 2W00A 2K4BA 4L5JA 1OR7A 2V7FA 2IGKA 3R0AA 3K4BA 1IRGA 2JPBA 1VQMI 2K3PA 5DTDA 3HPHA 2K9QA 1W36D 4Q5SF 1IN5A 3FXRA 2VBYA 1CF7A 1AOYA 2OF7A 2CUJA 4HAMA 3PSIA 5AIPA 4ABZA 4UB6C 1T98A 3HTSB 3BPVA 4ENMA 4KA4A 1YX5A 2RV8A 3N4MA 2W57A 3TGNA 4ZDOA 2DFHA 4GYIA 1TWAJ 1BOBA 1X1AA 2HR3A 1GDTA 1KQ0A 3HSEA 5F08A 4C3HJ 3OS2A 4O3MA 4RB2C 3EETA 1P9QC 2MC3A 4UXNA 4K2EA 4CYCB 3ROUA 1MBHA 1BR2A 2OCEA 3H36A 2JPCA 2YS9A 1ETVA 3BR6A 2CQNA 1VQ4I 1S29A 1FOXA 4L5IA 1FT9A 5GAGJ 4YFNF 1RKWA 3Q9VA 4AYBA 3I0TA 1Z7UA 1R5GA 1JJ6C 2JWTA 1ETQA 5B1BH 5LD2C 1J2XA 1ZN2A 1DU0A 4RGXA 2K3FA 2CQQA 1BIBA 1HKTA 2DDAA 2MW8A 3HRSA 3O3KA 4L9JA 5H6RA 3PO2J 1FYKA 4BY1J 1MMGA 2HGCA 2A61A 1MH3A 1VQ5I 3CDLA 4AD9A 1FOYA 4FISA 5J4YA 3DU6A 2E2HJ 3JRAA 5CQGA 3ZN1A 4NQWA 4XLNF 2I8DA 3F22A 3OYCA 3MKLA 4FCYA 4ON0A 1FIPA 1XD7A 4I76A 3A01A 2Y0MA 1O57A 2GXAA 4UUVA 2L54A 2E19A 2QBYA 3E7LA 5JFRA 1M1EB 2E5ZA 4XRSG 4W1UA 1Z91A 3CC4I 1OCRH 4LLGF 4DGWB 3Q0VA 2QM3A 4AIHA 2XGCA 1XN7A 4OINF 1O3TA 4UNOA 2HKXA 5FLXK 2VJJA 2WV0A 4M3BA 3CJTB 2BBYA 1BJAA 4LJZF 3FXJA 4UVAA 2DOEA 4XICA 4ZDPA 4ZTFA 2WV1A 2EZLA 3GTGJ 2XAGA 3E6BA 4GDFA 1T39A 1KA8A 5HLHA 2IW5A 5HS8A 4HSRA 1BI1A 3HOVJ 2XASA 3F8CA 4PSWA 2V26A 3K6GA 3D5SC 2IVMA 4FT8A 2XRLA 1C0WA 1W7PA 1FP2A 1EA3A 1ZG3A 3DKXA 4LLLA 3C2HA 4PDKA 2OC6A 2IA0A 4ZZLA 2GAUA 2GA2A 1Z6RA 3HEFA 3O2PE 2K40A 4KN4X 4B47A 1XPXA 3AFHA 1UHMA 3GTQJ 1XB4A 3I56I 3JAMK 5M3FJ 3KIOA 5DCFA 2F4OB 1XSVA 5BNGA 4IQ4A 4Y13A 3OIQA 2R7OA 3HUGA 4HV5A 2X48A 4KIFA 3KEQA 3QYEA 1RC9A 1E3HA 1DGWY 1FY7A 3FM5A 5E79C 4RB1A 5LRRA 2GIVA 1XMKA 3C2BA 3F9KA 1A5JA 1B1BA 2IBDA 1XGSA 5LEJA 2GLOA 3GTOJ 3TP3A 3OS0A 1K61A 4U88A 5HODA 3VEPA 5GAHJ 3LWFA 3SDBA 4YRVA 1ZKGA 3D1NI 2DFIA 3FMQA 3WU1B 4L0YB 2JSCA 4XLPF 2ZFWA 4G6QA 1IJWC 2QSHX 2P8TA 1K6OA 1IW7F 2NOJB 2FQ4A 1JXSA 3WTWC 1HF0A 3KP5A 1PYVA 1F36A 4FX0A 3KEYA 3P9CA 3L1PA 1WI3A 4NBQA 4KMFA 4GYGA 4KJZA 3AL0C 5FKMA 1W0TA 1Z05A 3Q5FA 4A3BJ 2L4MA 2NXNB 5BOXA 2F48A 2R7XA 3A02A 2F5VA 3FZVA 4A3IJ 1LEAA 4LGWA 1PVEA 5EEHA 2FUG2 1OLTA 3SZPA 5KK1A 1IXSB 1TC3C 1G4DA 1QVUA 2E1OA 3FK7A 3SHFA 3BG9A 2L5QA 4DZJA 5K5RA 3JRBA 1Z7LA 2CMPA 5KCMA 4A3KJ 1EF4A 2VJ5A 5F04A 2KISA 3JRCA 4KIGA 1WVRA 2DN0A 2BY2A 3CQZJ 3I53A 2BXZA 3QP6A 2GBYA 4EJTA 2R93J 2MSYA 2A6TA 1VNDA 2MFZA 3EUHA 4KNYA 4O5VA 4A3JJ 1HXDA 1PJRA 4F3QA 3I71A 1OKRA 2M1BA 3RDIA 4BJTA 3E6CC 2ZJQF 1S7EA 3BC8A 1U8BA 1YITI 2QQ8A 5HVQC 3NAUA 2XSJC 5HS7A 3CUQB 4RB3C 2D5VA 2LVSA 4IHTA 2ZXWH 1SFOJ 2LRDA 5D4SA 1IN7A 1X1CA 4F92B 1IN4A 1H9GA 4XLHA 5F0FA 3GUDA 2X4HA 4LG0A 5HOOA 2Q2EA 3F8BA 1WZ2A 5HS9A 1LNWA 1XGMA 2M87A 3NQOA 1RNLA 3CUQC 3JSPA 2VT3A 1MBEA 1ZGWA 2IRFG 3LMMA 3W3CA 1P6RA 4UUSA 2O7OA 2WY7Q 5E18F 2VKDA 2H94A 3ERED 3CD6I 2R3SA 3U2RA 1YE9A 2JVHA 3AG4H 2R7WA 1CF7B 1I3AA 1POGA 2K86A 2P4WA 1OR7C 3ZXSA 2VKHA 1U6GA 1LB2A 1EV7A 1IDYA 3NARA 5HDGA 3OSFA 2OQGA 2XUBA 1G3TA 3L2QA 5D5UB 2D45A 1IRXA 5EZGA 4OAZA 2XPUA 3ZRGA 4JP0A 1RZ4A 4BKXA 1F1ZA 2IA1A 2HOEA 4Q47A 4Y4RA 1Y0UA 2DA1A 2E36A 3LSMA 2HQNA 3LA2A 1TQIA 2ZSHB 2KIMA 4NC8A 4X6AJ 3TQNA 3E6DA 1X3ZB 2R7FA 1R1VA 5FKOA 2V4JC 4HLYA 1G2HA 1FC3A 1UAAA 3HBLA 2L4AA 1FBSA 1YS7A 3QPTA 2JA5J 2E60A 4A3GJ 1BN5A 3FKIJ 3MVPA 4N0BA 2ZBKA 3TEDA 2GIZA 2FF4A 1HCRA 2CQKA 3ASNH 5IOYA 2C6YA 1T6SA 5E3OA 1YYVA 2EZKA 5DEQA 3HRMA 3CDHA 4ZJZA 2KIFA 3LNQA 3EUKL 5IPAA 5LHGA 3JRHA 2QSGX 2ZNYA 3OYGA 4NQWB 3SFZA 3COAC 4EJWA 4RMNA 1I6HJ 2BW3A 3A01B 3J81Z 3JCUC 3U1DA 4U0WA 3ABKH 4RLFA 2DK5A 4AIDA 2YR2A 2QBYB 2VJ4A 4B4CA 2JA6J 4DBRA 2BY0A 4FHTA 3S32A 3RKWA 2WAEA 2V9VA 3H5RA 1G3SA 2LF8A 2UV1A 2YSRA 4RAGA 1R5HA 3A03A 3GO5A 1R9TJ 4F52A 5D8KB 1TWHJ 2XAJA 4HF0A 1ZR2A 3F8MA 3CCSI 3MZ8A 1EJ9A 5CVRA 4DNCA 2DJIA 2RKHA 2RC4A 1LQ1A 1FSEA 1Z21A 3I9V2 1IV8A 3V7RA 2E1NA 1QZZA 2PX9A 4FQGA 1L3LA 2AQFA 5TRDA 5JR3A 2F4MB 1KU3A 3OYEA 2VE8A 3M8JA 4PK4A 3PUFA 2WTEA 1W7PB 2BE5F 2HYFA 5J6XA 2QENA 2R7SA 1Z6TA 2O0YA 2TRTA 3WTTC 2BGCA 4N4OB 1QPIA 4BXXJ 3RI4A 1GVJA 5J8CA 5DYMA 2M7AA 3BZKA 3ZP5A 2KP6A 1R1TA 4YELA 3BDDA 4EM1A 3DQVC 3L2CA 5LRSA 2YUSA 2UZKA 3RQIA 3HUGB 3ZQQA 1TT5B 1SVOA 2XPWA 1MMNA 1N77A 4FETA 2W24A 4XN3A 3Q3SA 3S8PA 2R5ZA 1IAWA 1WJEA 1A6QA 2NVXJ 3OYHA 2JA2A 1G3YA 5BPIA 2TCTA 1SEUA 3GZNB 1BI3A 3K7AJ 1SD4A 4U0YA 5E3LA 4CO8A 3ZPLA 5ED4A 2FQ3A 2DODA 2PN6A 3LA7A 5F1JA 2DMNA 3BR2A 3K69A 1GUUA 1QNTA 4CA0A 1XC5A 4Y17A 1IXCA 1LUJB 3G2BA 3RIRA 4MTDA 5TJJA 5L3CA 5E8GA 4F93B 2UXNA 5FRNA 2COBA 4YEJA 4DYQA 4D5CA 3TO9A 4G94A 1N75A 3FISA 5DDGA 1VQKI 3SEZA 1KZHA 1ON2A 2B7EA 1P7IA 4ZDLA 5M5WJ 1SFXA 3BR1A 4M3DA 2QGUA 4EQQA 1TNTA 4PZJA 1OYWA 5EEGA 1KU2A 3LFKA 3EYIA 1XS9A 3OR1C 3GTMJ 4KUMA 4XM3A 3BPXA 2LY1A 2BZTA 1G3WA 1SMYF 3R0JA 3VB2A 3K70C 2EBIA 2JJ7A 2VXZA 2CUFA 2IXSA 5EF6A 4G7OF 4UHTA 3IC7A 3FXLA 3VOEA 3E5UA 2P5KA 3PIPF 3M9AA 4HPQA 1V3FA 2OA4A 1QHHD 4EM2A 3BG3A 1FYLA 2GWRA 3GBGA 4U7BA 2PMHA 3RPUA 4N4NB 4BACA 1S8NA 1S5LC 3LSPA 3LSHA 1K78A 5H6QA 1BA5A 3M8FA 2OTJI 2M45A 4LG0B 2Q2EB 2KRHA 1S9HA 2XF5A 5H2FC 1BI2A 2K9MA 2V6CA 1H88C 3GTJJ 3CJNA 2B63J 2FX0A 1ULYA 4UUSB 1NHAA 5JVTA 2Y75A 5J1RA 2RVCA 3F21A 4EGYA 4RM2A 3CUOA 2BOLA 1H89C 4WK8F 2XAUA 3GCMA 5ICGA 5ILUA 3QU6A 2BHYA 4MNUA 4A6EA 5DS9A 4FE7A 2VBZA 5CVVA 3I3LA 3PM1A 1SD6A 4RGSA 1YJ9I 1UFMA 5BQTA 4AUXA 2XSDC 2ETHA 4XL9A 5FD6A 3BQYA 5LGUA 1YFHA 2PI0A 1J75A 3I5UA 1GVDA 3OY9A 2V1XA 3T0YA 1DUXC 1SANA 2RQPA 3L2RA 2Q0OA 2DW4A 2Q8KA 3MCZA 3CCMI 2EZIA 3CCLI 4IVNA 5DUIA 2QWWA 3C2GA 5DV5A 4KMUX 2AXTC 1FOWA 2LSOA 1TWCJ 2JTVA 1VQ9I 2DK8A 2XRNA 4HYEA 2QKMB 2L01A 2O61A 4RS8A 2ZXIA 1V54H 2KZGA 4DYRA 4MO7A 1IC8A 3ZQFA 4Y33A 2IAIA 4F91B 2DA3A 1U8RA 2VLAA 3QOEA 2EIMH 1ZH5A 5E1ZB 1ETOA 5KHDA 1FSHA 1WQ2A 2JZYA 3CF5F 2DMQA 1E3OC 4YIRX 4ZTJA 5D8LB 3QYFA 5J3LA 2X51A 4BDZA 2DA5A 3HPGA 4HX4A 3GXOA 5EZHA 3LSKA 1JUSA 1FWZA 2BW3B 1JHFA 1LFPA 3K2AA 3I4NJ 2M5WA 1JT6A 1UCRA 2Y2ZA 3JREA 4D9JA 1E17A 1S7OA 1MDMA 1MGTA 4XKCA 1H9TA 2IGOA 3G71I 4MEYF 2HKOA 2B0LA 2LREA 3OWTA 4LK0F 2EWNA 3SZTA 1QA6A 3RKYA 3MAJA 3MWMA 2ME0A 2EB7A 3KP2A 1P92A 3ABUA 1D0ZA 1QHGA 2ISZA 2IS2A 2CU7A 3EQLF 3KP4A 2EILH 2J5OA 4CCOA 3PQJA 3HOWJ 4BGDA 2JA8J 4I99C 2DPDA 1EKEA 3N05A 4XLAA 4LK1F 4PJNA 1ETKA 1W5CC 5IOZA 2HEOA 1UHWA 2MLGA 4XRFA 5LGTA 2E7XA 2OU2A 2CV0A 2M8GX 1VQ6I 1OYYA 4PJ0C 5CVIA 2D1HA 3MQ0A 3K9TA 5LEKA 1BR1A 1D3YA 2DBBA 3KX2A 5F6FA 3BCBA 2EFQA 1W7PD 2KLOA 1B4AA 3GWZA 2DYSH 1IUYA 4XLEA 2LKPA 1YS6A 4DOZA 4HOBA 2L7ZA 4C9YA 3L2WA 4ENNA 1TWFJ 2JRMA 5GADJ 3K1PA 3DCFA 3HGGA 5CVUA 1NTCA 4HX8A 3E3VA 3PNTA 1ITYA 4ZYAA 3B73A 3S1RJ 3MKWB 3GTKJ 1P4AA 2RDPA 3DPLC 1D5YA 2VPRA 2F5CA 2NNYA 4S0HB 3VWBA 5K7ZA 1O3SA 1RESA 3C3WA 4XSXF 2KL4A 2ZMEA 4GCVA 3F72A 1FBUA 3MMYB 5FLVA 1MKMA 4NUBA 1I5ZA 4ENJA 3OYBA 5D5XB 3OIPA 4EEFG 4AVPA 1A35A 1R5ID 2R5ZB 2K27A 4PJLA 2F2EA 3SQNA 3ZGKA 3VYTB 2PLYA 1WPKA 3DTIA 2CV2A 1YW8A 3RPQA 5B5EC 1OCCH 4G8XA 1ZGAA 1BI0A 3MN2A 3ABMH 3BCAA 2YX4A 1H0MA 2EFOA 3CJQB 3FM3A 4BNCA 4AWXB 2ECBA 2H6CA 1T2KA 2DT7B 4M73A 2DTRA 3B6CA 1RI7A 1LDJA 1KQ9A 3W6KB 3JSOA 2QQBA 2QVOA 1I1SA 1MMDA 3PUBA 5K5OA 2LG4A 3SFIA 2HTSA 2QQ9A 4XMYA 1YRNA 1SAXA 3IRRA 1J7KA 4M74A 1RUNA 2O6GE 4ZYEA 3K70D 3GTPJ 2E1CA 3HG9A 2R5YA 2Z33A 2VODA 1R23A 5J8FA 2XAFA 3KETA 2STTA 4WCGA 2RQQA 3G3ZA 1Y56A 2HOSA 4L5EA 4R8HA 1MSFC 2IEKA 4OIPF 4S04A 3DEEA 2W4SA 1GV5A 5FKNA 3KEOA 2H1KA 3BTJA 3LL7A 4UY8I 3ML6A 1P4WA 2ELKA 4A12A 2O8KA 2H8WA 2XGEA 1B9NA 4LOCA 4A3CJ 3WHBA 1DU6A 2KT0A 2J5PA 4MIMA 3LSGA 3O8GA 2XC7A 1QVTA 3E5QA 1TW3A 2R7DA 5IP9J 4HV6A 4IKFA 2NNNA 5J47A 1AWCA 2HU9A 2AO9A 2MBFA 1A31A 2NVQJ 2BV6A 4LB6B 5FROA 3F3XA 2VT2A 3K4LA 1K78B 2GQQA 4YIFA 4EV0A 3S2DJ 2M2EA 2GM4A 2V1UA 3CCRI 1JKQC 3TOBA 4HQEA 1ZRCA 2HZDA 2VL8A 4JBAA 4LG3A 4EVIA 5GTHC 3GZ6A 4IRHA 2BEOA 1WWXA 4KFCA 2Z9OA 4BS9A 4PGGA 3BROA 4YIIA 1YW9A 2JUCA 1ZRFA 2X1DA 4OIOF 1HA8A 3DF8A 1TLHB 3U21A 2ISYA 2HDDA 1K7AA 4L9TA 1XCBA 3IRQA 3L2UA 2L7KA 5GAEJ 4U7DA 3ONQA 2FA5A 3DBLB 2F5EA 3HOXJ 1O3RA 2NVYJ 3BR5A 4IHSA 4LMYA 3BLYA 2YU9J 4M9SA 3AL0B 3H0DA 1T08B 2KIUA 4FTHA 4P5OA 3Q0UA 3PFIA 1P4XA 1REPC 3IUOA 1V4RA 4BEHA 1RUOA 2ZJRF 3R61A 1OISA 4AC0A 2FBIA 2LY9A 2MH2A 4Y3OA 1ZLKA 1U9OA 4Y15A 1BC8C 2IGNA 3TKYA 2A3SA 3TBIA 3U9GA 2CW0F 2H8RA 2LDUA 3CC2I 4A3MJ 3UKGA 2MG4A 2ZJ2A 5CVJA 3B02A 2MA3A 2MGQA 5D4RA 4IHXA 5IYBJ 3KYCB 1ZELA 4JX4A 4B8XA 5L3FA 3IKVA 5KVRA 3FKJA 2X6XA 2BY3A 5FGMA 4BE1A 2CQXA 3HSFA 4L9NA 3C1DA 3G1OA 1PUFA 1YX3A 3M3YJ 4WX9A 4E70A 2LLKA 4BHBA 4ZH4F 2LOOA 2X6WA 2A68F 5C3EJ 2LK2A 1UB9A 2XGDA 3NEUA 3OYLA 4HF2A 3CCJI 2P5VA 2GOXB 4A5MA 1MNDA 1W4MA 1O3QA 4CSWA 3CCQI 1MSEC 4WXDA 3O8HA 1B9MA 2HPMA 4MEXF 3GLXA 3J7AY 2IS1A 3I4MJ 1HC8A 2Z99A 3V7SA 2DQRA 1ON1A 4BL0B 3TL4X 1MDMB 1QO0D 2RN7A 3BTLA 3OSGA 2EQRA 3ISPA 5AIQA 3MZHA 2DFEA 3LSIA 4HSTA 3GFIA 2ELHA 1D5VA 3FBIB 2FNAA 3ZQLA 1XX5A 1WH5A 1MBFA 3GW2A 3H9GA 4B09A 2L9VA 2O3FA 3IH2A 4E7LA 1DGRM 2E35A 1R58A 2W25A 3IAS2 3OYMA 4I0BA 3UR3C 4C2TA 2K4JA 1HW2A 3BY6A 3SXYA 1SC7A 2L9NA 3G73A 1MMAA 1RPWA 3RSNA 4W97A 4RAZA 2ESHA 3OYAA 3TDZC 2Z16A 3GTLJ 4A93J 1LFUP 4HNUA 4FE4A 4C3JJ 4KITB 1JKPC 2O8XA 5GP9A 2UWMA 2ZNZA 4MGRA 3I55I 2VI6A 3DU5A 4IJAA 3TO6A 5LBQA 5IT9Z 1TQPA 2DMTA 3K1NA 1T56A 3E5XA 1X4PA 2HYGD 9ANTA 2EINH 2MABA 4RAFA 2VUMJ 1GXQA 2E5NA 5D5WB 3FX3A 3VFZA 2ICWG 3HHHA 3CMYA 4ZC3A 2HVQA 2ZMEB 1OFCX 4JK1X 2RNGA 2ZXJA 1HW5A 5LGNA 3BP8A 3REOA 2LKXA 3E6MA 1JUPA 4CHUA 3I4PA 1PP8F 2R7RA 4I2OA 4A3LJ 1D1AA 2A5WA 1X3WB 4MTEA 2ZJPF 4V2FA 1QU3A 5BMZA 4OMYA 2KZVA 4Y52J 1FJLA 2DMPA 2L0KA 5HDNA 4LLNA 2ZMEC 1FTZA 5J4VA 4BYYA 1TQMA 1TT0A 2ID6A 3BJAA 3TP0A 4XKBA 2OQRA 2ME6A 1LEBA 3ELKA 1OYIA 5KAIC 5LHHA 1FBQA 1YRNB 4PCQA 1VFCA 2G9WA 1JTXA 2ZO4A 3G1MA 3LQRA 3PJRA 2GXGA 2R5YB 2HVRA 4HG2A 2VOPA 1L0OC 1JT0A 4UVBA 3HOYJ 1JGGA 4QTRA 3H1CA 1IRFA 3BTCA 3FMRA 2AQEA 1WH7A 2OZUA 3OMYA 3SJMA 2L02A 3K0LA 1ZAOA 2QA4I 3KZYA 1LVAA 4M72A 1OPCA 5E3NA 1DDNA 5C4XJ 3FF5A 2Y48A 3VPRA 2CWEA 2K5CA 1E2XA 1E3PA 3V42A 1QGPA 2JQ7A 2LF7A 2FMLA 3J80Z 3OS1A 1TTYA 2H1LA 3OV8A 1N25A 4A6DA 4XONA 1FEXA 1O4XA 3RPUD 1E0EA 3CC7I 2H09A 1STZA 2M9HA 4BUPA 3K1MA 1J0RA 3LSRA 2X1EA 2HYJA 3JRGA 4WXCA 3M1CA 1G59A 2KRFA 2DFFA 2E71A 2Y69H 5EYRA 1VF9A 5F27A 5CLSA 1EH8A 3ZMZA 4NHJA 4QSHA 3DPUA 1T33A 4XK4A 2VQHA 4XLFA 4D7MA 1IO2A 4CICA 2W82A 1W5TA 2JVGA 1SVLA 4N9IA 2EA4A 4U0VA 5ILVA 3A0BC 1KYWA 4M3FA 2HI3A 2XIGA 4CCJA 2EK5A 4IHYA 5FD5A 3V4GA 1SFUA 4XR6A 5F64A 2Z1DA 4M6XA 4PJJA 2DU9A 3VYSB 3D5LA 2A5YB 2QCOA 1JE8A 4RBOA 2VOOA 1ZLJA 1DPUA 1NK3P 2B9SA 1QZYA 2R7UA 1K4SA 2JT1A 2F4IA 1EH6A 1QQIA 2LTPA 1XGOA 3M8EA 2G7UA 3OYDA 4IOCF 3J81K 5E17F 3R60A 1YI2I 3TDUC 3K4KA 2FOWA 4BEHB 1TNSA 3KYDB 2L2OA 3DBRB 1XCVA 5K5QA 2CV1A 2DJNA 3HKZN 1HW1A 1FMWA 4CXFA 3KLNA 5M5XJ 1MNMC 1LDDA 4E7ZA 2KDOA 2K02A 2OBPA 3CP8A 5CKTA 2PMZA 2K7LA 3KFWX 1VQOI 1NK2P 3KP6A 3OL4A 1JHHA 2XV4S 1JUMA 5JI6A 1T8IA 4OIRF 1HSTA 3HSRA 2CG4A 2CH0A 3HOZJ 3HOTA 2OJED 5FKKA 4ZYGA 4D5FA 4BQQA 4HRIA 1B6AA 2KMUA 2LYCA 2DI3A 2LH9A 2VB6A 2V9PA 1FYMA 1PUFB 4E7IA 3CESA 2VE9A 4IPAA 4D0PA 1I50J 5GPCA 1VZ0A 3ZQGA 1KYZA 3IWFA 1PDNC 1YTYA 2H27A 4OOIA 2XKOA 4HDUA 4HNTA 1LE8A 3KZZA 1UMQA 1BOAA 3EDPA 2F5DA 2XB5A 2Y0SN 5HLTA 1GLNA 1ETXA 2DO7A 2JN6A 3F23A 1YIJI 1ORKA 2M8EA 2A07F 5LFAA 1KGSA 4BXUA 1F9NA 2F6CA 1RIOH 1USSA 2XHKA 1WKMA 2HQ5A 3HRTA 5F1RA 3TMOA 4B48A 3CMAI 3ZMUA 4MHGA 1JTYA 3WTYC 2R7QA 3WTVC 1FTTA 2IJLA 1UG0A 3F0CA 3WTSC 1ZK8A 2IT0A 1F5TA 3QRFF 1IXRC 4NB5A 5CYVA 2KFDA 3ERMA 1BBYA 2W84A 2P5LC 1IN6A 3DP7A 1JKRC 3GVAA 1AKHA 3EYYA 1IZ1A 2IP2A 3GFMA 5IYCJ 2P7CB 2KDZA 2MD0A 1D8KA 3BWGA 1ODDA 2JMWA 3IAM2 3S1NJ 2KIQA 4RA2A 3E1SA 3JRFA 3G6EI 4WWCA
chains in the Genus database with same CATH topology
2M3AA 2WAQA 3K4JA 3VSKA 3OIPA 3OYBA 2F5VA 3LFUA 2R7XA 2GOMA 1SFKA 2DT6A 4PJLA 3OYIA 4G6TB 2FUG2 1OLTA 3ZGKA 3AKZA 3VYTB 3H9JA 3DTIA 2V1NA 2CV2A 4X0GA 1TZLA 2L5QA 4E6KG 2DOAA 4PFOA 1Z7LA 2CMPA 5KCMA 3PFYA 2PJRA 3BCAA 3CJQB 2VJ5A 3DLAA 3H9QA 1AA7A 2V6EA 2DT7B 3D5RC 1T95A 4QPOA 3CP2A 4B43A 3OR2C 2ZSIB 1T0FC 1D1BA 4II3A 4CCLA 1MMDA 3PUBA 2LG4A 4XMYA 2A6TA 2MFZA 5FRMA 1UELB 3K70D 2CS3A 1PJRA 4F3QA 2JUGA 5KNLA 3HG9A 1V5FA 4BJTA 3RCOA 3BC8A 3PSFA 3IP4B 5HVQC 3SEQA 2XSJC 3PL8A 2RQQA 1Y56A 1WFXA 3VYUB 3DEEA 2W4SA 4BXFA 3S3OA 2LRDA 4EATA 3LL7A 4BQNA 1X1CA 4F92B 3OOUA 2VASA 4XLHA 5HOOA 4OAYA 1W36C 2Q1ZB 4HEA2 3LSGA 2XC7A 3LMMA 3W3CA 4H4KC 2WY7Q 1U0JA 4AU7A 2VKDA 4IKFA 2HU9A 4CCNA 1YE9A 2JVHA 3S3NA 2R7WA 2MYSA 5FROA 2HNHA 1OR7C 3ZXSA 5HNFA 2VKHA 3K4LA 3SZGA 2HVSA 4CH7A 3E0JB 3L2VA 1K6YA 3L2QA 2P0WA 2X6YA 1IRXA 2HZDA 2LY2A 4OAZA 4BDYA 2VL8A 3ZRGA 3DPTA 4LG3A 4Y4RA 1SAUA 3H35A 3LSMA 2ZSHB 4RLQA 1V5GA 4NC8A 4PJMA 4BS9A 2V4JC 2KQRA 2X1DA 1MW7A 2BVLA 1HA8A 3U21A 1UAAA 3RTRA 3L2UA 2L7KA 3HOSA 2E60A 1NG6A 3ONQA 4II2A 2M4KA 2O5RA 1D0XA 3K4CA 4ANJA 3MKZA 1FMVA 2OUMA 3HC7A 3HXLA 4XN0A 4PSXA 3MKYB 4BU2A 2K9LA 3BLYA 2XDVA 3AL0B 3H0DA 3A2KA 4P1WA 4P5OA 1Y6IA 4ZJZA 1X4OA 3IUOA 4BEHA 4CZCA 3EUKL 2KPMA 2WBMA 4Y3OA 3BG7A 3K4NA 1KONA 4NQWB 3OYGA 4E7KA 2IGNA 5CPRB 1JI8A 2CUZA 3TBIA 4RMNA 2JSPA 4CCMA 4LIUA 4AVZA 2BW3A 4KT6A 4RLFA 2HDWA 3EUHC 4IX7A 2KRCA 1ZELA 2VJ4A 2Z2SB 3K10A 3SYTA 3W2AA 1LDKB 3FKJA 4FASD 2X6XA 4DBRA 2BVMA 4BE1A 2WADA 3HL2A 4LITA 3H5NA 3S32A 3W2VA 1WJBA 1YX3A 2WAEA 3H5RA 1DQUA 1NG7A 1R6RA 2UV1A 2LOOA 2X6WA 1BR4A 3OYLA 2MC4A 4F52A 2GOXB 1MNDA 4CSWA 3QYBA 4DJAA 2HPMA 3ZR8X 1X1DA 3J7AY 2DJIA 4DBQA 3OYNA 4U87A 2IS1A 1Z21A 2WAFA 3I9V2 4BL0B 4RM3A 3TL4X 3DTKA 2L9SA 3A1YA 3OYJA 3RQ4A 4PFPA 2AQFA 3OYEA 3LSIA 3M8JA 4HSTA 2CW7A 4PK4A 3FBIB 4E4HA 3A4CA 2R7SA 3H9GA 3OYFA 3S3MA 3EUAA 4E7LA 1DGRM 2M4GA 3S93A 4N4OB 3OYMA 3IAS2 2M7AA 3UR3C 4C2TA 2WY8Q 2KP6A 4YELA 3FBNB 2L9NA 1MMAA 3DQVC 1G8XA 3RSNA 2ZXHA 3HUGB 3ZQQA 3OYAA 2HQAA 2Z16A 3BG6A 4JQFA 1MMNA 1N77A 4FETA 2DXIA 3DKYA 4XN3A 3S8PA 4HNUA 4KITB 1WJEA 4J01A 3ZCOA 3OYHA 2JA2A 4QPQA 2R4GA 3W2WA 2UWMA 3OL3A 3DU5A 2VPLA 2VQLA 2VJIA 3NWSA 4BJ6C 1X4PA 3EPZA 4XQFA 3CF2A 2MABA 4CA0A 3DWLE 2LBFB 2VQGA 1WJAA 2E5NA 3G2BA 4B44A 2VIXA 3H5AA 3PNYA 2IGMA 4ZC3A 2HVQA 2VXDA 4F93B 5FRNA 4YEJA 2RNGA 3CMMA 2V9KA 2OV7A 3VYRB 4JOMA 1X1BA 1N75A 1V5EA 2R7RA 4R79A 4J00A 1D1AA 2A5WA 3SEZA 1ERDA 3OYKA 4ZDLA 1QU3A 2KHMA 2KZVA 2HPIA 2RREA 1WJFA 2X1CA 3CZ6A 2PJRB 4BE2A 4E7JA 1WJCA 2ZFUA 5TGTA 4GRIA 1TT0A 3OR1C 4XKVA 4XKBA 3QODA 3FHNA 4XOTA 4XM3A 1D1CA 2LY1A 3K70C 3HKZA 4E7SA 2W00A 2VXZA 2V7FA 2IXSA 2IGKA 3K4BA 2K3PA 4C30A 3PJRA 2W1OA 3HPHA 1W36D 4KISA 3PNVA 2HVRA 4HG2A 4HPQA 4NNJA 1QHHD 2CUJA 3PSIA 3KYLA 3FDYA 3GBGA 2AQEA 3OMYA 4U7BA 4N4NB 4BACA 1J09A 1YX5A 4XLCA 3LSHA 4ZDOA 1BOBA 4ITVA 2K5CA 1X1AA 2Q2EB 2KRHA 1S9HA 3V42A 2XF5A 2K9MA 3OS2A 3OS1A 1P9QC 2IS6A 1LVKA 4XONA 3UNGC 4CCKA 1BR2A 2Y0SA 1Z3YA 4RM2A 2BOLA 1X19A 2CFOA 3RPUD 1E0EA 2XAUA 5HNHA 2QKLB 2M0MA 4XOPA 4BUPA 1LKXA 2W7NA 2X1EA 4AYBA 3M1CA 1G59A 3I3LA 4LIVA 5LD2C 4IQJA 2VQCA 4NC7A 4XORA 2CW8A 4D1QA 4XL9A 3DPUA 4PUSA 2VQHA 4XLFA 2W82A 3VDXA 3OY9A 2E1MB 1MMGA 2JVGA 3L2RA 2WA0A 4B3XA 5JHFA 3DU6A 4CCJA 5CQGA 2LC2A 2M7BA 3C2GA 1WJDA 4XR6A 2Z1DA 4BJ5C 4PJJA 3VYSB 3D5LA 2I8DA 2QKMB 3OYCA 2WB1A 4MLOA 2E1MC 2ZXIA 2R7UA 4Y33A 4F91B 2F4IA 2E5ZA 2VLAA 3QOEA 3OYDA 4DGWB 4CUGA 4XNFA 3K4KA 4BEHB 5KHDA 4F55A 5CQEA 2VJJA 2L2OA 2CV1A 4ZTJA 1FMWA 3QYFA 4E7ZA 2KDOA 1MNEA 3VSLA 2X51A 4ZTFA 4ZDPA 3CP8A 5CKTA 2PMZA 4BDZA 3HPGA 3LSKA 3OL4A 4XKWA 2BW3B 1LFPA 4D9JA 4XKCA 2CH0A 2IGOA 3MD2A 4HSRA 3HOTA 2LREA 3OWTA 4PSWA 2DCEA 4BQQA 4HRIA 4OWRB 2KMUA 2LYCA 2V26A 3K6GA 3D5SC 2LH9A 2VB6A 2X85A 2R7TA 1D0ZA 1QHGA 4E7IA 2IS2A 1D0YA 1EA3A 3DKXA 4BE0A 3CESA 4CCOA 3C2HA 2OC6A 4BGDA 1N78A 1VZ0A 1Z3XA 3N05A 2XF6A 4XLAA 4PJNA 4DIQA 4E7HA 1WJ5A 4B47A 2R7VA 4HNTA 3AFHA 2CV0A 5HLTA 1GLNA 3K4MA 2IS4A 4IQ4A 5LFAA 3OIQA 4IZZA 2R7OA 1BR1A 2F6CA 3CJRB 1DP3A 3KX2A 3QYEA 3BCBA 2KLOA 3TMOA 4B48A 1DGWY 4XLEA 2ELJA 3F9KA 4DOZA 2R7QA 4C9YA 1UG0A 3L2WA 3OS0A 2UUZA 3SDBA 4YRVA 2XF7A 3PNTA 4ZYAA 4BQOA 3MKWB 2LBFA 3DPLC 2MD0A 2NOJB 3NWTA 1PYVA 3VWBA 3DTEA 3IAM2 3KEYA 2KL4A 4C2UA 3E1SA 3MMYB 4KJZA 3AL0C 4NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LH9 A;  2KZV A;  3RCO A;  2LY1 A;  2KPM A;  3S93 A;  2LY2 A; 
#chains in the Genus database with same CATH topology
 2DTZ A;  2M3A A;  3K4J A;  3VSK A;  1B72 A;  2Y30 A;  2DT6 A;  3LAP A;  1VQ8 I;  3OYI A;  1HQC A;  2FXA A;  2WB1 N;  1FIA A;  3H9J A;  3MEX A;  1S72 I;  1TZL A;  2DOA A;  4G9Y A;  4PFO A;  2PJR A;  3W6V A;  3V8L A;  2NS8 A;  3ASO H;  1AA7 A;  1WRJ A;  3H9Q A;  4RB0 A;  1JJ8 C;  4IXA A;  4NDL A;  3D5R C;  3Q9S A;  4QPO A;  3CP2 A;  4B43 A;  2A69 F;  2KKO A;  1W5S A;  2MH9 A;  1D1B A;  1W1W E;  4CGZ A;  1OCO H;  2NVU B;  2BYV E;  3ABT A;  5A2Q Z;  2ZB9 A;  2QEX I;  2ECC A;  3P9K A;  3M1E A;  4B3A A;  2ZKZ A;  2X6O A;  2CS3 A;  4RGU A;  3LSJ A;  4G12 A;  3M07 A;  1V5F A;  1XTA A;  2K9S A;  2DMU A;  1SVM A;  1TL8 A;  3S17 J;  2DA6 A;  3WU2 C;  5IY5 H;  3SDG A;  4BBR J;  2P7V B;  1F43 A;  4BXF A;  3S3O A;  4A2U A;  4GXO A;  5E20 A;  2WC2 A;  3J7Y J;  1I39 A;  2E7W A;  2X0L A;  3C7J A;  3WU0 A;  4ASN A;  2HOA A;  2RGV A;  1B8I A;  2M30 A;  2UXX A;  2Q1Z B;  4HEA 2;  4F7Z A;  3J7A O;  1U0J A;  2HS5 A;  3FMS A;  2OCC H;  1MBJ A;  1KQ8 A;  2L9R A;  3ECH A;  4CYD A;  1Y1W J;  1JKO C;  1IG7 A;  1BW5 A;  2EFW A;  2FEZ A;  3ZQH A;  4KN7 X;  1XMX A;  4R1H A;  5HNF A;  2DAO A;  3RYR A;  1U9N A;  2CRG A;  3SZG A;  2CO5 A;  1I6X A;  3M4O J;  2HVS A;  4HLX A;  4RAY A;  1HDD C;  3E0J B;  2EZH A;  3QP5 A;  1QRY A;  2HWV A;  2P0W A;  3FXM A;  3PIO F;  1ZG5 A;  2PQ8 A;  4RGR A;  2FJ1 A;  3DPT A;  4HBL A;  1TP4 A;  4ESF A;  2DA7 A;  1ZAR A;  3WG9 A;  3H35 A;  4KT5 C;  3DLL F;  1TWG J;  2VC1 A;  2YU3 A;  1D8J A;  4PJM A;  2VBW A;  2ZC2 A;  1WGX A;  1YG2 A;  2LD5 A;  2KQR A;  1MW7 A;  2BVL A;  1P2F A;  5E3M A;  2WAQ N;  3RTR A;  4G7Z F;  2QQA A;  1HDP A;  3HOS A;  2EH3 A;  1NG6 A;  1HLV A;  2LP0 A;  3JRI A;  1ZR4 A;  1WCM J;  2M4K A;  3ESW B;  1HBX G;  1R22 A;  4I01 A;  2O5R A;  3GLL A;  3IKT A;  4IEJ A;  2OUM A;  4XN0 A;  3MKY B;  3BT9 A;  3DEU A;  4BU2 A;  3T8T A;  1I27 A;  2BXY A;  2XDV A;  1RR8 C;  4HDV A;  2ESN A;  2ZCW A;  4UB8 C;  3A2K A;  2P6S A;  4A69 C;  1Y6I A;  4HQM A;  4EMS A;  4CDG A;  1V55 H;  1X4O A;  5CJ9 A;  4CZC A;  5GPA A;  5K7F A;  3AG3 H;  3WTX C;  1T38 A;  2EV6 A;  2KPM A;  5LHI A;  3BZ6 A;  4E7K A;  1Z77 A;  4EJU A;  3T8R A;  5KAF C;  3FHZ A;  4ZYH A;  4I98 B;  1ZGJ A;  1A04 A;  5JVG F;  2PMU A;  1AHD P;  2NOG A;  2GA1 A;  4LD5 A;  4CCM A;  1HSJ A;  4LIU A;  4AVZ A;  3AAF A;  1YW7 A;  5J40 A;  2VKV A;  3PO3 J;  2HDW A;  1CQT A;  3RYP A;  2KRC A;  3K10 A;  3SYT A;  5FLX Z;  3W2A A;  4L0Z B;  3S16 J;  3KCC A;  1LDK B;  4BHP A;  3ZQC A;  4L18 B;  5DD8 A;  2BVM A;  2A6E F;  1K4T A;  1OQY A;  4OIQ F;  3QQA A;  1BM9 A;  4LIT A;  1RET A;  3MFK A;  1WJB A;  2Y31 A;  1XMA A;  4EJO A;  2R92 J;  2E2I J;  2HXI A;  1NG7 A;  2XRO A;  1R6R A;  3BQZ A;  2OPT A;  3HZJ A;  1BR4 A;  2O03 A;  2DPU A;  1OMI A;  1YJW I;  2Y9Z A;  1DP7 P;  2E34 A;  1B59 A;  2TDX A;  1YOV B;  3OIO A;  5EG0 A;  3CO7 C;  3WHC A;  3ZR8 X;  1X1D A;  1ZQ3 P;  4GGG A;  2WAF A;  2PMZ N;  4RM3 A;  4AIJ A;  2FRH A;  2Z5U A;  1MMS A;  5E1X A;  4P9U A;  3RQ4 A;  2ACJ A;  4PFP A;  5D6E A;  4BHC A;  2QUF A;  3S2W A;  1TBX A;  3H3Z A;  5C4J J;  4Z6Y A;  4E4H A;  1LPQ A;  2A05 A;  3S14 J;  5EDN A;  2DQL A;  3V7C A;  3JAM Z;  3ABL H;  3EUA A;  3S2H J;  3S93 A;  2HOT A;  2EFP A;  2FNP A;  5HLG A;  1SD7 A;  4BBS J;  2PEX A;  3HB9 A;  3IV5 A;  1MIJ A;  1LE8 B;  3FXU A;  2WY8 Q;  2EJR A;  3RZO J;  3FBN B;  1VTN C;  1ZHF A;  4GFB A;  3HJE A;  1R36 A;  4IO9 F;  1ACI A;  2HQA A;  3BG6 A;  2DA2 A;  4JQF A;  3DKY A;  1SD5 A;  4Y7N J;  2P81 A;  3ZCO A;  1T0F A;  1FLI A;  2R4G A;  2F5F A;  3OL3 A;  1CGP A;  3HYI A;  2VPL A;  2VQL A;  5BS6 A;  1IF1 A;  3ZQI A;  4BJ6 C;  3HTU A;  1LFB A;  5E8I A;  1AKH B;  1R71 A;  3CF2 A;  2EA2 A;  1KU7 A;  5C44 J;  4B44 A;  1ZRE A;  2VIX A;  3BJO A;  3S15 J;  4N9H A;  3BTI A;  4M9Z A;  3CMM A;  1VQN I;  1X1P A;  2V9K A;  2OV7 A;  3E97 A;  3L00 A;  3WG7 H;  1B72 B;  3T5X A;  3V8K A;  3LST A;  2W85 A;  4J00 A;  6PAX A;  1ERD A;  2CFX A;  3IH4 A;  2KHM A;  2HPI A;  3C18 A;  1BC7 C;  4BQA A;  2RRE A;  1WJF A;  3J7Z I;  2X1C A;  4GO1 A;  3CZ6 A;  3CCE I;  3L7W A;  2VBX A;  1Q1H A;  2PJR B;  1TW2 A;  5JLX A;  5TGT A;  1U5T A;  1NH3 A;  4GRI A;  2D2W A;  4BY7 J;  2JA7 J;  2EV5 A;  3ZMS A;  2FBK A;  5FFZ A;  4FX4 A;  2XAQ A;  4A0Y A;  4DQ2 A;  4HW0 A;  3HKZ A;  4M3G A;  2G0E A;  3TW7 A;  1HKQ A;  1R49 A;  3I64 A;  4DZP A;  5JLW A;  1H8A C;  4DYC A;  4ETS A;  4A0Z A;  3WGG A;  2FD5 A;  2M0C A;  3BR0 A;  4C30 A;  1Y0N A;  2W1O A;  4M6Y A;  4KIS A;  3GFL A;  3PNV A;  4P9F A;  2O9L A;  3B6A A;  4NNJ A;  3KPH A;  4H0E A;  1UJ8 A;  2I5U A;  3KYL A;  3FDY A;  3F6O A;  2NS0 A;  1ZTR A;  3GYH X;  1J09 A;  4XLC A;  3TW6 A;  4YFK F;  1ZG1 A;  4J19 A;  4ITV A;  2D1V A;  1B8I B;  1WHU A;  1MZB A;  3CCY A;  2PFB A;  2V1D A;  1O7F A;  2IS6 A;  1OCP A;  1LVK A;  3ECO A;  3WTZ A;  1I1G A;  3UNG C;  4CCK A;  3RKX A;  5K1Y A;  3JR9 A;  2Y0S A;  1Z3Y A;  1AU7 A;  1X19 A;  2CFO A;  5ICF A;  4NC6 A;  2MD5 A;  5HNH A;  2QKL B;  2M0M A;  4XOP A;  1LKX A;  2W7N A;  2AS5 F;  1YJN I;  4A0X A;  2CQ7 A;  3AG2 H;  4PGH A;  5B66 C;  4LIV A;  3M7G A;  4IQJ A;  2VQC A;  3QPL A;  4NC7 A;  4TV7 A;  2XPV A;  4XOR A;  4EJV A;  1WSU A;  2CW8 A;  2FOK A;  4D1Q A;  5L3B A;  1MBG A;  2QYO A;  1O7L A;  4PUS A;  4C3I J;  2L7M P;  4AIK A;  5FO5 A;  3VDX A;  3HIF A;  3F8N A;  4MFD A;  3RZD J;  1VQ7 I;  4G6D A;  2E1M B;  1A36 A;  2WA0 A;  4B3X A;  5JHF A;  4KIC A;  2OD5 A;  5M3M J;  2LC2 A;  2M7B A;  5J1Y A;  1WJD A;  1XDS A;  3LOC A;  4BJ5 C;  1S6L A;  3BOQ A;  3BG5 A;  3F6V A;  4O6J A;  5M5Y J;  4JX6 A;  4HF1 A;  2WB1 A;  4MLO A;  2BHZ A;  2E1M C;  3DXJ F;  5DCM A;  1VQL I;  4XRS A;  3GF2 A;  2ID3 A;  5E1W A;  3RJP A;  4BH9 A;  3TO7 A;  4M3E A;  3WGI A;  4IRI A;  4CUG A;  1FPQ A;  4XNF A;  4S05 A;  2FU4 A;  2OZ6 A;  4F55 A;  5CQE A;  4MFE A;  3DEW A;  5ERI A;  4M6V A;  1MJA A;  1MNE A;  4KIB A;  5IP7 J;  3VSL A;  1GXP A;  1YLF A;  3IWZ A;  4XKW A;  5ILS A;  1YIO A;  3DKW A;  1PUE E;  3A0H C;  2W48 A;  4I02 A;  1HKS A;  3MD2 A;  3KLO A;  4UV8 A;  4QIW N;  5EGO A;  2DCE A;  4OWR B;  4Q48 A;  3HHG A;  1YQA A;  4A3D J;  2X85 A;  1Z9C A;  2R7T A;  3H92 A;  3X2Q H;  1D0Y A;  3U1K A;  2R0Q C;  3CLO A;  4BE0 A;  1J59 A;  2EPF A;  1N78 A;  3S1Q J;  1Z3X A;  4A5N A;  2XF6 A;  5IYD J;  4DIQ A;  2VKE A;  2CSO A;  1XDU A;  4UUT A;  2AHQ A;  4E7H A;  1WJ5 A;  2BY1 A;  4JX5 A;  1XSD A;  2R7V A;  5FFX A;  5BPD A;  3ULQ B;  5EG0 B;  3K4M A;  3HRU A;  1ZRD A;  4B1R A;  2IS4 A;  2YPR A;  2K9N A;  4IZZ A;  4ZYD A;  4V2G A;  3CJR B;  5B1A H;  1DP3 A;  4I09 A;  2KJC A;  2HQR A;  4AYB N;  3WE2 A;  2DXI A;  4L9V A;  1VI0 A;  2ELJ A;  2I10 A;  5HDK A;  2E2J J;  5DD4 A;  4WF2 A;  3PQK A;  4ESJ A;  4C2M J;  4UVC A;  1FX7 A;  1MD0 A;  2VC0 A;  3G4S I;  3NRV A;  3JRD A;  2UUZ A;  1U3E M;  2RAE A;  2XF7 A;  2EFN A;  2LNB A;  4P55 A;  4BQO A;  2VN2 A;  4M9X A;  2LBF A;  2AXL A;  4Z2Y A;  3NWT A;  1UZC A;  3VOD A;  3DTE A;  3ZMV A;  5IT9 K;  3WE3 A;  1BIA A;  4C2U A;  3HOU J;  3QOP A;  2NRA C;  3DV8 A;  5F0H A;  4I0A A;  2WAQ A;  4MQV A;  3LFU A;  5IT3 A;  4IHW A;  2GOM A;  1SFK A;  5F0C A;  1XGN A;  2HDC A;  1OCT C;  2MLK A;  4G6T B;  3AKZ A;  4IL6 C;  3CCU I;  2V1N A;  4X0G A;  1ZYR F;  4IF4 A;  2LFB A;  4E6K G;  4A3E J;  3FK6 A;  1XG1 A;  3PFY A;  4XRM A;  3JW4 A;  1SMT A;  3DLA A;  2DT5 A;  3V8J A;  2V6E A;  2HFH A;  5AON A;  1IN8 A;  3H3V K;  4LFU A;  2Y9Y A;  1T95 A;  3I59 A;  4EM0 B;  3OR2 C;  1ETW A;  3IHU A;  2ZSI B;  1T0F C;  1F4K A;  4KYW A;  4CCL A;  4II3 A;  1YO5 C;  4IRG A;  2COM A;  3JTG A;  4Q4Z F;  5GTI C;  5FRM A;  3GEZ A;  4XBF A;  3TOA A;  1FZP B;  1UEL B;  2DOF A;  1FNN A;  2LMD A;  5KNL A;  2JUG A;  5FKL A;  2PJP A;  3LA3 A;  3RCO A;  4YFX F;  5JHU A;  3PSF A;  3IP4 B;  1IGN A;  3SEQ A;  2FSW A;  3PL8 A;  4X1E A;  3O6B B;  3L09 A;  1WFX A;  3VYU B;  4ZZD A;  1UHS A;  2H6B A;  2QLZ A;  1U5T B;  3QWL A;  4D7N A;  1Y8R B;  4EAT A;  1GV2 A;  1LJ9 A;  4BQN A;  3OOU A;  2VAS A;  4BAY A;  2PG4 A;  1QBJ A;  2OTL I;  1ENH A;  2DA4 A;  2GZW A;  4OAY A;  5TIS C;  1SFE A;  1W36 C;  4HA8 A;  5DM7 F;  5J1U A;  4WXH A;  3CO6 C;  3HM5 A;  2FE3 A;  4H4K C;  3N97 A;  2HZT A;  4CYC A;  4I6Z A;  4AU7 A;  1U5T C;  2NYX A;  1KU9 A;  4CCN A;  1IV6 A;  2QSF X;  3S3N A;  2P6T A;  3KP7 A;  3J80 K;  1K79 A;  3CDI A;  3RKQ A;  2MYS A;  4OMZ A;  4XSZ F;  1APL C;  3ZN0 A;  3D0S A;  3FXO A;  2HNH A;  1UG2 A;  5L3D A;  4CH7 A;  4P96 A;  3L2V A;  2HXO A;  1K6Y A;  3WGH A;  2X6Y A;  1R1U A;  2LY2 A;  5HLI A;  4QLC U;  4BDY A;  5ICE A;  5FB2 A;  1BW6 A;  5EEA A;  5FJ8 J;  1IDZ A;  3H3U A;  1SAU A;  5LLQ A;  4UV9 A;  4EGZ A;  4RLQ A;  1V5G A;  2V79 A;  4MQ9 F;  4V19 K;  3CCV I;  1YHQ I;  3CTA A;  3KE2 A;  2EV0 A;  5L3G A;  1U2W A;  3ZOB A;  1FOK A;  5DM6 F;  1X58 A;  3R6S A;  1JGS A;  3I58 A;  4II2 A;  2L7F P;  3F8F A;  3QAH A;  1S7A A;  1VQP I;  1X2N A;  1IRZ A;  2M34 A;  3WTU C;  1D0X A;  3BZC A;  3K4C A;  3P7N A;  4ANJ A;  1FMV A;  5FLM J;  3MKZ A;  3HC7 A;  3HXL A;  4PSX A;  2K9L A;  2OAZ A;  3FWE A;  1I3Q J;  1QPM A;  3FIW A;  4P1W A;  1IUF A;  3JTH A;  3IL2 A;  1R4M B;  5DUK A;  4I7H A;  2CJJ A;  5B3S H;  2WBM A;  2NVT J;  3BG7 A;  3K4N A;  1KON A;  5IP6 A;  1W0U A;  1U78 A;  5CPR B;  1JI8 A;  1G6N A;  1Y1V J;  2CUZ A;  2L3D A;  5ICC A;  2X9D A;  1X2M A;  1QZE A;  2EIK H;  2NS7 A;  2HTJ A;  2JSP A;  3GME A;  4DW6 A;  2VON A;  2FMY A;  3ZMT A;  4KT6 A;  4HX7 A;  4M71 A;  1BJZ A;  3KZI C;  3EUH C;  1FP1 D;  1MH4 A;  5DCM B;  4AM3 A;  2XGX A;  4IX7 A;  1UST A;  2Z2S B;  1RRJ A;  2KJB A;  2XKP A;  2XAH A;  1EH7 A;  4FAS D;  3BJ6 A;  3G1L A;  3K2Z A;  2WAD A;  3FXQ A;  3HL2 A;  1ETY A;  3S1M J;  3OOP A;  5D6F A;  3H5N A;  3W6J B;  3W2V A;  1J9I A;  1DQU A;  1WI9 A;  1Z0X A;  1R00 A;  1MJB A;  3GX4 X;  2MC4 A;  2NAZ A;  3IH3 A;  2XB0 X;  3GFJ A;  3P9I A;  2IPQ X;  3QYB A;  4DJA A;  4DBQ A;  3OYN A;  4U87 A;  5H20 A;  3CLQ A;  4QWQ A;  3DTK A;  2CGP A;  3T1B A;  2L9S A;  3A1Y A;  3H0G J;  3OYJ A;  3LQQ A;  3MZY A;  5EGO B;  2GXB A;  4YG2 F;  1A6I A;  4OU0 A;  5EJC A;  1RKT A;  2CW7 A;  3DFG A;  3R4K A;  4KDP A;  2YX7 A;  3A4C A;  2DLL A;  2JRT A;  1ONV A;  3AG1 H;  3OYF A;  2WWY A;  2LKS A;  3S3M A;  3L9F A;  3P5J A;  2EIJ H;  2M4G A;  1MJ9 A;  1XSX A;  2PBI A;  1DPR A;  1R7J A;  3FXK A;  5D5V B;  2CYY A;  1PP7 U;  1BL0 A;  4HZF A;  1GT0 C;  5L3E A;  1J5Y A;  1MBK A;  5K7H A;  3HGY A;  4ENK A;  1Y8Q B;  4A3F J;  1G8X A;  3GZ5 A;  2QF7 A;  2ZXH A;  1Z1D A;  3QPH A;  3ZQ7 A;  4J01 A;  3KP3 A;  2RNJ A;  1Q1V A;  4QPQ A;  1Z67 A;  3W2W A;  2DYR H;  4G7H F;  2VJI A;  3NWS A;  3QPS A;  3EPZ A;  4XQF A;  1R4N B;  3DWL E;  2LBF B;  1K83 J;  2VQG A;  4ESB A;  1WJA A;  1OCZ H;  2XVC A;  3H5A A;  3PNY A;  2IGM A;  3ZMD A;  3LAJ A;  3CME I;  2LR8 A;  2STW A;  2VXD A;  3WOD F;  4IHV A;  1P7J A;  3Q0W A;  4HNV A;  1OJL A;  3VYR B;  4JOM A;  1HOM A;  1Y39 A;  1X1B A;  2ADU A;  1V5E A;  2IA2 A;  1X3U A;  3BR3 A;  4R79 A;  1GHC A;  2JK3 A;  3OYK A;  1S3J A;  2R7Z J;  5A2Q K;  3CUQ A;  2K85 A;  3HDD A;  2CUE A;  3DBH B;  3QU3 A;  2FBH A;  4BE2 A;  4IOA F;  4E7J A;  1WJC A;  2ZFU A;  3I54 A;  4JYK A;  2Z3Y A;  1RR7 A;  2QZ8 A;  4LB5 A;  2DDB A;  2G7H A;  4XKV A;  3I59 B;  2A6H F;  3QOD A;  3FHN A;  4XOT A;  4RDU A;  2N8G A;  4CZZ A;  1D1C A;  4XID A;  4E7S A;  2W00 A;  2K4B A;  4L5J A;  1OR7 A;  2V7F A;  2IGK A;  3R0A A;  3K4B A;  1IRG A;  2JPB A;  1VQM I;  2K3P A;  5DTD A;  3HPH A;  2K9Q A;  1W36 D;  4Q5S F;  1IN5 A;  3FXR A;  2VBY A;  1CF7 A;  1AOY A;  2OF7 A;  2CUJ A;  4HAM A;  3PSI A;  5AIP A;  4ABZ A;  4UB6 C;  1T98 A;  3HTS B;  3BPV A;  4ENM A;  4KA4 A;  1YX5 A;  2RV8 A;  3N4M A;  2W57 A;  3TGN A;  4ZDO A;  2DFH A;  4GYI A;  1TWA J;  1BOB A;  1X1A A;  2HR3 A;  1GDT A;  1KQ0 A;  3HSE A;  5F08 A;  4C3H J;  3OS2 A;  4O3M A;  4RB2 C;  3EET A;  1P9Q C;  2MC3 A;  4UXN A;  4K2E A;  4CYC B;  3ROU A;  1MBH A;  1BR2 A;  2OCE A;  3H36 A;  2JPC A;  2YS9 A;  1ETV A;  3BR6 A;  2CQN A;  1VQ4 I;  1S29 A;  1FOX A;  4L5I A;  1FT9 A;  5GAG J;  4YFN F;  1RKW A;  3Q9V A;  4AYB A;  3I0T A;  1Z7U A;  1R5G A;  1JJ6 C;  2JWT A;  1ETQ A;  5B1B H;  5LD2 C;  1J2X A;  1ZN2 A;  1DU0 A;  4RGX A;  2K3F A;  2CQQ A;  1BIB A;  1HKT A;  2DDA A;  2MW8 A;  3HRS A;  3O3K A;  4L9J A;  5H6R A;  3PO2 J;  1FYK A;  4BY1 J;  1MMG A;  2HGC A;  2A61 A;  1MH3 A;  1VQ5 I;  3CDL A;  4AD9 A;  1FOY A;  4FIS A;  5J4Y A;  3DU6 A;  2E2H J;  3JRA A;  5CQG A;  3ZN1 A;  4NQW A;  4XLN F;  2I8D A;  3F22 A;  3OYC A;  3MKL A;  4FCY A;  4ON0 A;  1FIP A;  1XD7 A;  4I76 A;  3A01 A;  2Y0M A;  1O57 A;  2GXA A;  4UUV A;  2L54 A;  2E19 A;  2QBY A;  3E7L A;  5JFR A;  1M1E B;  2E5Z A;  4XRS G;  4W1U A;  1Z91 A;  3CC4 I;  1OCR H;  4LLG F;  4DGW B;  3Q0V A;  2QM3 A;  4AIH A;  2XGC A;  1XN7 A;  4OIN F;  1O3T A;  4UNO A;  2HKX A;  5FLX K;  2VJJ A;  2WV0 A;  4M3B A;  3CJT B;  2BBY A;  1BJA A;  4LJZ F;  3FXJ A;  4UVA A;  2DOE A;  4XIC A;  4ZDP A;  4ZTF A;  2WV1 A;  2EZL A;  3GTG J;  2XAG A;  3E6B A;  4GDF A;  1T39 A;  1KA8 A;  5HLH A;  2IW5 A;  5HS8 A;  4HSR A;  1BI1 A;  3HOV J;  2XAS A;  3F8C A;  4PSW A;  2V26 A;  3K6G A;  3D5S C;  2IVM A;  4FT8 A;  2XRL A;  1C0W A;  1W7P A;  1FP2 A;  1EA3 A;  1ZG3 A;  3DKX A;  4LLL A;  3C2H A;  4PDK A;  2OC6 A;  2IA0 A;  4ZZL A;  2GAU A;  2GA2 A;  1Z6R A;  3HEF A;  3O2P E;  2K40 A;  4KN4 X;  4B47 A;  1XPX A;  3AFH A;  1UHM A;  3GTQ J;  1XB4 A;  3I56 I;  3JAM K;  5M3F J;  3KIO A;  5DCF A;  2F4O B;  1XSV A;  5BNG A;  4IQ4 A;  4Y13 A;  3OIQ A;  2R7O A;  3HUG A;  4HV5 A;  2X48 A;  4KIF A;  3KEQ A;  3QYE A;  1RC9 A;  1E3H A;  1DGW Y;  1FY7 A;  3FM5 A;  5E79 C;  4RB1 A;  5LRR A;  2GIV A;  1XMK A;  3C2B A;  3F9K A;  1A5J A;  1B1B A;  2IBD A;  1XGS A;  5LEJ A;  2GLO A;  3GTO J;  3TP3 A;  3OS0 A;  1K61 A;  4U88 A;  5HOD A;  3VEP A;  5GAH J;  3LWF A;  3SDB A;  4YRV A;  1ZKG A;  3D1N I;  2DFI A;  3FMQ A;  3WU1 B;  4L0Y B;  2JSC A;  4XLP F;  2ZFW A;  4G6Q A;  1IJW C;  2QSH X;  2P8T A;  1K6O A;  1IW7 F;  2NOJ B;  2FQ4 A;  1JXS A;  3WTW C;  1HF0 A;  3KP5 A;  1PYV A;  1F36 A;  4FX0 A;  3KEY A;  3P9C A;  3L1P A;  1WI3 A;  4NBQ A;  4KMF A;  4GYG A;  4KJZ A;  3AL0 C;  5FKM A;  1W0T A;  1Z05 A;  3Q5F A;  4A3B J;  2L4M A;  2NXN B;  5BOX A;  2F48 A;  2R7X A;  3A02 A;  2F5V A;  3FZV A;  4A3I J;  1LEA A;  4LGW A;  1PVE A;  5EEH A;  2FUG 2;  1OLT A;  3SZP A;  5KK1 A;  1IXS B;  1TC3 C;  1G4D A;  1QVU A;  2E1O A;  3FK7 A;  3SHF A;  3BG9 A;  2L5Q A;  4DZJ A;  5K5R A;  3JRB A;  1Z7L A;  2CMP A;  5KCM A;  4A3K J;  1EF4 A;  2VJ5 A;  5F04 A;  2KIS A;  3JRC A;  4KIG A;  1WVR A;  2DN0 A;  2BY2 A;  3CQZ J;  3I53 A;  2BXZ A;  3QP6 A;  2GBY A;  4EJT A;  2R93 J;  2MSY A;  2A6T A;  1VND A;  2MFZ A;  3EUH A;  4KNY A;  4O5V A;  4A3J J;  1HXD A;  1PJR A;  4F3Q A;  3I71 A;  1OKR A;  2M1B A;  3RDI A;  4BJT A;  3E6C C;  2ZJQ F;  1S7E A;  3BC8 A;  1U8B A;  1YIT I;  2QQ8 A;  5HVQ C;  3NAU A;  2XSJ C;  5HS7 A;  3CUQ B;  4RB3 C;  2D5V A;  2LVS A;  4IHT A;  2ZXW H;  1SFO J;  2LRD A;  5D4S A;  1IN7 A;  1X1C A;  4F92 B;  1IN4 A;  1H9G A;  4XLH A;  5F0F A;  3GUD A;  2X4H A;  4LG0 A;  5HOO A;  2Q2E A;  3F8B A;  1WZ2 A;  5HS9 A;  1LNW A;  1XGM A;  2M87 A;  3NQO A;  1RNL A;  3CUQ C;  3JSP A;  2VT3 A;  1MBE A;  1ZGW A;  2IRF G;  3LMM A;  3W3C A;  1P6R A;  4UUS A;  2O7O A;  2WY7 Q;  5E18 F;  2VKD A;  2H94 A;  3ERE D;  3CD6 I;  2R3S A;  3U2R A;  1YE9 A;  2JVH A;  3AG4 H;  2R7W A;  1CF7 B;  1I3A A;  1POG A;  2K86 A;  2P4W A;  1OR7 C;  3ZXS A;  2VKH A;  1U6G A;  1LB2 A;  1EV7 A;  1IDY A;  3NAR A;  5HDG A;  3OSF A;  2OQG A;  2XUB A;  1G3T A;  3L2Q A;  5D5U B;  2D45 A;  1IRX A;  5EZG A;  4OAZ A;  2XPU A;  3ZRG A;  4JP0 A;  1RZ4 A;  4BKX A;  1F1Z A;  2IA1 A;  2HOE A;  4Q47 A;  4Y4R A;  1Y0U A;  2DA1 A;  2E36 A;  3LSM A;  2HQN A;  3LA2 A;  1TQI A;  2ZSH B;  2KIM A;  4NC8 A;  4X6A J;  3TQN A;  3E6D A;  1X3Z B;  2R7F A;  1R1V A;  5FKO A;  2V4J C;  4HLY A;  1G2H A;  1FC3 A;  1UAA A;  3HBL A;  2L4A A;  1FBS A;  1YS7 A;  3QPT A;  2JA5 J;  2E60 A;  4A3G J;  1BN5 A;  3FKI J;  3MVP A;  4N0B A;  2ZBK A;  3TED A;  2GIZ A;  2FF4 A;  1HCR A;  2CQK A;  3ASN H;  5IOY A;  2C6Y A;  1T6S A;  5E3O A;  1YYV A;  2EZK A;  5DEQ A;  3HRM A;  3CDH A;  4ZJZ A;  2KIF A;  3LNQ A;  3EUK L;  5IPA A;  5LHG A;  3JRH A;  2QSG X;  2ZNY A;  3OYG A;  4NQW B;  3SFZ A;  3COA C;  4EJW A;  4RMN A;  1I6H J;  2BW3 A;  3A01 B;  3J81 Z;  3JCU C;  3U1D A;  4U0W A;  3ABK H;  4RLF A;  2DK5 A;  4AID A;  2YR2 A;  2QBY B;  2VJ4 A;  4B4C A;  2JA6 J;  4DBR A;  2BY0 A;  4FHT A;  3S32 A;  3RKW A;  2WAE A;  2V9V A;  3H5R A;  1G3S A;  2LF8 A;  2UV1 A;  2YSR A;  4RAG A;  1R5H A;  3A03 A;  3GO5 A;  1R9T J;  4F52 A;  5D8K B;  1TWH J;  2XAJ A;  4HF0 A;  1ZR2 A;  3F8M A;  3CCS I;  3MZ8 A;  1EJ9 A;  5CVR A;  4DNC A;  2DJI A;  2RKH A;  2RC4 A;  1LQ1 A;  1FSE A;  1Z21 A;  3I9V 2;  1IV8 A;  3V7R A;  2E1N A;  1QZZ A;  2PX9 A;  4FQG A;  1L3L A;  2AQF A;  5TRD A;  5JR3 A;  2F4M B;  1KU3 A;  3OYE A;  2VE8 A;  3M8J A;  4PK4 A;  3PUF A;  2WTE A;  1W7P B;  2BE5 F;  2HYF A;  5J6X A;  2QEN A;  2R7S A;  1Z6T A;  2O0Y A;  2TRT A;  3WTT C;  2BGC A;  4N4O B;  1QPI A;  4BXX J;  3RI4 A;  1GVJ A;  5J8C A;  5DYM A;  2M7A A;  3BZK A;  3ZP5 A;  2KP6 A;  1R1T A;  4YEL A;  3BDD A;  4EM1 A;  3DQV C;  3L2C A;  5LRS A;  2YUS A;  2UZK A;  3RQI A;  3HUG B;  3ZQQ A;  1TT5 B;  1SVO A;  2XPW A;  1MMN A;  1N77 A;  4FET A;  2W24 A;  4XN3 A;  3Q3S A;  3S8P A;  2R5Z A;  1IAW A;  1WJE A;  1A6Q A;  2NVX J;  3OYH A;  2JA2 A;  1G3Y A;  5BPI A;  2TCT A;  1SEU A;  3GZN B;  1BI3 A;  3K7A J;  1SD4 A;  4U0Y A;  5E3L A;  4CO8 A;  3ZPL A;  5ED4 A;  2FQ3 A;  2DOD A;  2PN6 A;  3LA7 A;  5F1J A;  2DMN A;  3BR2 A;  3K69 A;  1GUU A;  1QNT A;  4CA0 A;  1XC5 A;  4Y17 A;  1IXC A;  1LUJ B;  3G2B A;  3RIR A;  4MTD A;  5TJJ A;  5L3C A;  5E8G A;  4F93 B;  2UXN A;  5FRN A;  2COB A;  4YEJ A;  4DYQ A;  4D5C A;  3TO9 A;  4G94 A;  1N75 A;  3FIS A;  5DDG A;  1VQK I;  3SEZ A;  1KZH A;  1ON2 A;  2B7E A;  1P7I A;  4ZDL A;  5M5W J;  1SFX A;  3BR1 A;  4M3D A;  2QGU A;  4EQQ A;  1TNT A;  4PZJ A;  1OYW A;  5EEG A;  1KU2 A;  3LFK A;  3EYI A;  1XS9 A;  3OR1 C;  3GTM J;  4KUM A;  4XM3 A;  3BPX A;  2LY1 A;  2BZT A;  1G3W A;  1SMY F;  3R0J A;  3VB2 A;  3K70 C;  2EBI A;  2JJ7 A;  2VXZ A;  2CUF A;  2IXS A;  5EF6 A;  4G7O F;  4UHT A;  3IC7 A;  3FXL A;  3VOE A;  3E5U A;  2P5K A;  3PIP F;  3M9A A;  4HPQ A;  1V3F A;  2OA4 A;  1QHH D;  4EM2 A;  3BG3 A;  1FYL A;  2GWR A;  3GBG A;  4U7B A;  2PMH A;  3RPU A;  4N4N B;  4BAC A;  1S8N A;  1S5L C;  3LSP A;  3LSH A;  1K78 A;  5H6Q A;  1BA5 A;  3M8F A;  2OTJ I;  2M45 A;  4LG0 B;  2Q2E B;  2KRH A;  1S9H A;  2XF5 A;  5H2F C;  1BI2 A;  2K9M A;  2V6C A;  1H88 C;  3GTJ J;  3CJN A;  2B63 J;  2FX0 A;  1ULY A;  4UUS B;  1NHA A;  5JVT A;  2Y75 A;  5J1R A;  2RVC A;  3F21 A;  4EGY A;  4RM2 A;  3CUO A;  2BOL A;  1H89 C;  4WK8 F;  2XAU A;  3GCM A;  5ICG A;  5ILU A;  3QU6 A;  2BHY A;  4MNU A;  4A6E A;  5DS9 A;  4FE7 A;  2VBZ A;  5CVV A;  3I3L A;  3PM1 A;  1SD6 A;  4RGS A;  1YJ9 I;  1UFM A;  5BQT A;  4AUX A;  2XSD C;  2ETH A;  4XL9 A;  5FD6 A;  3BQY A;  5LGU A;  1YFH A;  2PI0 A;  1J75 A;  3I5U A;  1GVD A;  3OY9 A;  2V1X A;  3T0Y A;  1DUX C;  1SAN A;  2RQP A;  3L2R A;  2Q0O A;  2DW4 A;  2Q8K A;  3MCZ A;  3CCM I;  2EZI A;  3CCL I;  4IVN A;  5DUI A;  2QWW A;  3C2G A;  5DV5 A;  4KMU X;  2AXT C;  1FOW A;  2LSO A;  1TWC J;  2JTV A;  1VQ9 I;  2DK8 A;  2XRN A;  4HYE A;  2QKM B;  2L01 A;  2O61 A;  4RS8 A;  2ZXI A;  1V54 H;  2KZG A;  4DYR A;  4MO7 A;  1IC8 A;  3ZQF A;  4Y33 A;  2IAI A;  4F91 B;  2DA3 A;  1U8R A;  2VLA A;  3QOE A;  2EIM H;  1ZH5 A;  5E1Z B;  1ETO A;  5KHD A;  1FSH A;  1WQ2 A;  2JZY A;  3CF5 F;  2DMQ A;  1E3O C;  4YIR X;  4ZTJ A;  5D8L B;  3QYF A;  5J3L A;  2X51 A;  4BDZ A;  2DA5 A;  3HPG A;  4HX4 A;  3GXO A;  5EZH A;  3LSK A;  1JUS A;  1FWZ A;  2BW3 B;  1JHF A;  1LFP A;  3K2A A;  3I4N J;  2M5W A;  1JT6 A;  1UCR A;  2Y2Z A;  3JRE A;  4D9J A;  1E17 A;  1S7O A;  1MDM A;  1MGT A;  4XKC A;  1H9T A;  2IGO A;  3G71 I;  4MEY F;  2HKO A;  2B0L A;  2LRE A;  3OWT A;  4LK0 F;  2EWN A;  3SZT A;  1QA6 A;  3RKY A;  3MAJ A;  3MWM A;  2ME0 A;  2EB7 A;  3KP2 A;  1P92 A;  3ABU A;  1D0Z A;  1QHG A;  2ISZ A;  2IS2 A;  2CU7 A;  3EQL F;  3KP4 A;  2EIL H;  2J5O A;  4CCO A;  3PQJ A;  3HOW J;  4BGD A;  2JA8 J;  4I99 C;  2DPD A;  1EKE A;  3N05 A;  4XLA A;  4LK1 F;  4PJN A;  1ETK A;  1W5C C;  5IOZ A;  2HEO A;  1UHW A;  2MLG A;  4XRF A;  5LGT A;  2E7X A;  2OU2 A;  2CV0 A;  2M8G X;  1VQ6 I;  1OYY A;  4PJ0 C;  5CVI A;  2D1H A;  3MQ0 A;  3K9T A;  5LEK A;  1BR1 A;  1D3Y A;  2DBB A;  3KX2 A;  5F6F A;  3BCB A;  2EFQ A;  1W7P D;  2KLO A;  1B4A A;  3GWZ A;  2DYS H;  1IUY A;  4XLE A;  2LKP A;  1YS6 A;  4DOZ A;  4HOB A;  2L7Z A;  4C9Y A;  3L2W A;  4ENN A;  1TWF J;  2JRM A;  5GAD J;  3K1P A;  3DCF A;  3HGG A;  5CVU A;  1NTC A;  4HX8 A;  3E3V A;  3PNT A;  1ITY A;  4ZYA A;  3B73 A;  3S1R J;  3MKW B;  3GTK J;  1P4A A;  2RDP A;  3DPL C;  1D5Y A;  2VPR A;  2F5C A;  2NNY A;  4S0H B;  3VWB A;  5K7Z A;  1O3S A;  1RES A;  3C3W A;  4XSX F;  2KL4 A;  2ZME A;  4GCV A;  3F72 A;  1FBU A;  3MMY B;  5FLV A;  1MKM A;  4NUB A;  1I5Z A;  4ENJ A;  3OYB A;  5D5X B;  3OIP A;  4EEF G;  4AVP A;  1A35 A;  1R5I D;  2R5Z B;  2K27 A;  4PJL A;  2F2E A;  3SQN A;  3ZGK A;  3VYT B;  2PLY A;  1WPK A;  3DTI A;  2CV2 A;  1YW8 A;  3RPQ A;  5B5E C;  1OCC H;  4G8X A;  1ZGA A;  1BI0 A;  3MN2 A;  3ABM H;  3BCA A;  2YX4 A;  1H0M A;  2EFO A;  3CJQ B;  3FM3 A;  4BNC A;  4AWX B;  2ECB A;  2H6C A;  1T2K A;  2DT7 B;  4M73 A;  2DTR A;  3B6C A;  1RI7 A;  1LDJ A;  1KQ9 A;  3W6K B;  3JSO A;  2QQB A;  2QVO A;  1I1S A;  1MMD A;  3PUB A;  5K5O A;  2LG4 A;  3SFI A;  2HTS A;  2QQ9 A;  4XMY A;  1YRN A;  1SAX A;  3IRR A;  1J7K A;  4M74 A;  1RUN A;  2O6G E;  4ZYE A;  3K70 D;  3GTP J;  2E1C A;  3HG9 A;  2R5Y A;  2Z33 A;  2VOD A;  1R23 A;  5J8F A;  2XAF A;  3KET A;  2STT A;  4WCG A;  2RQQ A;  3G3Z A;  1Y56 A;  2HOS A;  4L5E A;  4R8H A;  1MSF C;  2IEK A;  4OIP F;  4S04 A;  3DEE A;  2W4S A;  1GV5 A;  5FKN A;  3KEO A;  2H1K A;  3BTJ A;  3LL7 A;  4UY8 I;  3ML6 A;  1P4W A;  2ELK A;  4A12 A;  2O8K A;  2H8W A;  2XGE A;  1B9N A;  4LOC A;  4A3C J;  3WHB A;  1DU6 A;  2KT0 A;  2J5P A;  4MIM A;  3LSG A;  3O8G A;  2XC7 A;  1QVT A;  3E5Q A;  1TW3 A;  2R7D A;  5IP9 J;  4HV6 A;  4IKF A;  2NNN A;  5J47 A;  1AWC A;  2HU9 A;  2AO9 A;  2MBF A;  1A31 A;  2NVQ J;  2BV6 A;  4LB6 B;  5FRO A;  3F3X A;  2VT2 A;  3K4L A;  1K78 B;  2GQQ A;  4YIF A;  4EV0 A;  3S2D J;  2M2E A;  2GM4 A;  2V1U A;  3CCR I;  1JKQ C;  3TOB A;  4HQE A;  1ZRC A;  2HZD A;  2VL8 A;  4JBA A;  4LG3 A;  4EVI A;  5GTH C;  3GZ6 A;  4IRH A;  2BEO A;  1WWX A;  4KFC A;  2Z9O A;  4BS9 A;  4PGG A;  3BRO A;  4YII A;  1YW9 A;  2JUC A;  1ZRF A;  2X1D A;  4OIO F;  1HA8 A;  3DF8 A;  1TLH B;  3U21 A;  2ISY A;  2HDD A;  1K7A A;  4L9T A;  1XCB A;  3IRQ A;  3L2U A;  2L7K A;  5GAE J;  4U7D A;  3ONQ A;  2FA5 A;  3DBL B;  2F5E A;  3HOX J;  1O3R A;  2NVY J;  3BR5 A;  4IHS A;  4LMY A;  3BLY A;  2YU9 J;  4M9S A;  3AL0 B;  3H0D A;  1T08 B;  2KIU A;  4FTH A;  4P5O A;  3Q0U A;  3PFI A;  1P4X A;  1REP C;  3IUO A;  1V4R A;  4BEH A;  1RUO A;  2ZJR F;  3R61 A;  1OIS A;  4AC0 A;  2FBI A;  2LY9 A;  2MH2 A;  4Y3O A;  1ZLK A;  1U9O A;  4Y15 A;  1BC8 C;  2IGN A;  3TKY A;  2A3S A;  3TBI A;  3U9G A;  2CW0 F;  2H8R A;  2LDU A;  3CC2 I;  4A3M J;  3UKG A;  2MG4 A;  2ZJ2 A;  5CVJ A;  3B02 A;  2MA3 A;  2MGQ A;  5D4R A;  4IHX A;  5IYB J;  3KYC B;  1ZEL A;  4JX4 A;  4B8X A;  5L3F A;  3IKV A;  5KVR A;  3FKJ A;  2X6X A;  2BY3 A;  5FGM A;  4BE1 A;  2CQX A;  3HSF A;  4L9N A;  3C1D A;  3G1O A;  1PUF A;  1YX3 A;  3M3Y J;  4WX9 A;  4E70 A;  2LLK A;  4BHB A;  4ZH4 F;  2LOO A;  2X6W A;  2A68 F;  5C3E J;  2LK2 A;  1UB9 A;  2XGD A;  3NEU A;  3OYL A;  4HF2 A;  3CCJ I;  2P5V A;  2GOX B;  4A5M A;  1MND A;  1W4M A;  1O3Q A;  4CSW A;  3CCQ I;  1MSE C;  4WXD A;  3O8H A;  1B9M A;  2HPM A;  4MEX F;  3GLX A;  3J7A Y;  2IS1 A;  3I4M J;  1HC8 A;  2Z99 A;  3V7S A;  2DQR A;  1ON1 A;  4BL0 B;  3TL4 X;  1MDM B;  1QO0 D;  2RN7 A;  3BTL A;  3OSG A;  2EQR A;  3ISP A;  5AIQ A;  3MZH A;  2DFE A;  3LSI A;  4HST A;  3GFI A;  2ELH A;  1D5V A;  3FBI B;  2FNA A;  3ZQL A;  1XX5 A;  1WH5 A;  1MBF A;  3GW2 A;  3H9G A;  4B09 A;  2L9V A;  2O3F A;  3IH2 A;  4E7L A;  1DGR M;  2E35 A;  1R58 A;  2W25 A;  3IAS 2;  3OYM A;  4I0B A;  3UR3 C;  4C2T A;  2K4J A;  1HW2 A;  3BY6 A;  3SXY A;  1SC7 A;  2L9N A;  3G73 A;  1MMA A;  1RPW A;  3RSN A;  4W97 A;  4RAZ A;  2ESH A;  3OYA A;  3TDZ C;  2Z16 A;  3GTL J;  4A93 J;  1LFU P;  4HNU A;  4FE4 A;  4C3J J;  4KIT B;  1JKP C;  2O8X A;  5GP9 A;  2UWM A;  2ZNZ A;  4MGR A;  3I55 I;  2VI6 A;  3DU5 A;  4IJA A;  3TO6 A;  5LBQ A;  5IT9 Z;  1TQP A;  2DMT A;  3K1N A;  1T56 A;  3E5X A;  1X4P A;  2HYG D;  9ANT A;  2EIN H;  2MAB A;  4RAF A;  2VUM J;  1GXQ A;  2E5N A;  5D5W B;  3FX3 A;  3VFZ A;  2ICW G;  3HHH A;  3CMY A;  4ZC3 A;  2HVQ A;  2ZME B;  1OFC X;  4JK1 X;  2RNG A;  2ZXJ A;  1HW5 A;  5LGN A;  3BP8 A;  3REO A;  2LKX A;  3E6M A;  1JUP A;  4CHU A;  3I4P A;  1PP8 F;  2R7R A;  4I2O A;  4A3L J;  1D1A A;  2A5W A;  1X3W B;  4MTE A;  2ZJP F;  4V2F A;  1QU3 A;  5BMZ A;  4OMY A;  2KZV A;  4Y52 J;  1FJL A;  2DMP A;  2L0K A;  5HDN A;  4LLN A;  2ZME C;  1FTZ A;  5J4V A;  4BYY A;  1TQM A;  1TT0 A;  2ID6 A;  3BJA A;  3TP0 A;  4XKB A;  2OQR A;  2ME6 A;  1LEB A;  3ELK A;  1OYI A;  5KAI C;  5LHH A;  1FBQ A;  1YRN B;  4PCQ A;  1VFC A;  2G9W A;  1JTX A;  2ZO4 A;  3G1M A;  3LQR A;  3PJR A;  2GXG A;  2R5Y B;  2HVR A;  4HG2 A;  2VOP A;  1L0O C;  1JT0 A;  4UVB A;  3HOY J;  1JGG A;  4QTR A;  3H1C A;  1IRF A;  3BTC A;  3FMR A;  2AQE A;  1WH7 A;  2OZU A;  3OMY A;  3SJM A;  2L02 A;  3K0L A;  1ZAO A;  2QA4 I;  3KZY A;  1LVA A;  4M72 A;  1OPC A;  5E3N A;  1DDN A;  5C4X J;  3FF5 A;  2Y48 A;  3VPR A;  2CWE A;  2K5C A;  1E2X A;  1E3P A;  3V42 A;  1QGP A;  2JQ7 A;  2LF7 A;  2FML A;  3J80 Z;  3OS1 A;  1TTY A;  2H1L A;  3OV8 A;  1N25 A;  4A6D A;  4XON A;  1FEX A;  1O4X A;  3RPU D;  1E0E A;  3CC7 I;  2H09 A;  1STZ A;  2M9H A;  4BUP A;  3K1M A;  1J0R A;  3LSR A;  2X1E A;  2HYJ A;  3JRG A;  4WXC A;  3M1C A;  1G59 A;  2KRF A;  2DFF A;  2E71 A;  2Y69 H;  5EYR A;  1VF9 A;  5F27 A;  5CLS A;  1EH8 A;  3ZMZ A;  4NHJ A;  4QSH A;  3DPU A;  1T33 A;  4XK4 A;  2VQH A;  4XLF A;  4D7M A;  1IO2 A;  4CIC A;  2W82 A;  1W5T A;  2JVG A;  1SVL A;  4N9I A;  2EA4 A;  4U0V A;  5ILV A;  3A0B C;  1KYW A;  4M3F A;  2HI3 A;  2XIG A;  4CCJ A;  2EK5 A;  4IHY A;  5FD5 A;  3V4G A;  1SFU A;  4XR6 A;  5F64 A;  2Z1D A;  4M6X A;  4PJJ A;  2DU9 A;  3VYS B;  3D5L A;  2A5Y B;  2QCO A;  1JE8 A;  4RBO A;  2VOO A;  1ZLJ A;  1DPU A;  1NK3 P;  2B9S A;  1QZY A;  2R7U A;  1K4S A;  2JT1 A;  2F4I A;  1EH6 A;  1QQI A;  2LTP A;  1XGO A;  3M8E A;  2G7U A;  3OYD A;  4IOC F;  3J81 K;  5E17 F;  3R60 A;  1YI2 I;  3TDU C;  3K4K A;  2FOW A;  4BEH B;  1TNS A;  3KYD B;  2L2O A;  3DBR B;  1XCV A;  5K5Q A;  2CV1 A;  2DJN A;  3HKZ N;  1HW1 A;  1FMW A;  4CXF A;  3KLN A;  5M5X J;  1MNM C;  1LDD A;  4E7Z A;  2KDO A;  2K02 A;  2OBP A;  3CP8 A;  5CKT A;  2PMZ A;  2K7L A;  3KFW X;  1VQO I;  1NK2 P;  3KP6 A;  3OL4 A;  1JHH A;  2XV4 S;  1JUM A;  5JI6 A;  1T8I A;  4OIR F;  1HST A;  3HSR A;  2CG4 A;  2CH0 A;  3HOZ J;  3HOT A;  2OJE D;  5FKK A;  4ZYG A;  4D5F A;  4BQQ A;  4HRI A;  1B6A A;  2KMU A;  2LYC A;  2DI3 A;  2LH9 A;  2VB6 A;  2V9P A;  1FYM A;  1PUF B;  4E7I A;  3CES A;  2VE9 A;  4IPA A;  4D0P A;  1I50 J;  5GPC A;  1VZ0 A;  3ZQG A;  1KYZ A;  3IWF A;  1PDN C;  1YTY A;  2H27 A;  4OOI A;  2XKO A;  4HDU A;  4HNT A;  1LE8 A;  3KZZ A;  1UMQ A;  1BOA A;  3EDP A;  2F5D A;  2XB5 A;  2Y0S N;  5HLT A;  1GLN A;  1ETX A;  2DO7 A;  2JN6 A;  3F23 A;  1YIJ I;  1ORK A;  2M8E A;  2A07 F;  5LFA A;  1KGS A;  4BXU A;  1F9N A;  2F6C A;  1RIO H;  1USS A;  2XHK A;  1WKM A;  2HQ5 A;  3HRT A;  5F1R A;  3TMO A;  4B48 A;  3CMA I;  3ZMU A;  4MHG A;  1JTY A;  3WTY C;  2R7Q A;  3WTV C;  1FTT A;  2IJL A;  1UG0 A;  3F0C A;  3WTS C;  1ZK8 A;  2IT0 A;  1F5T A;  3QRF F;  1IXR C;  4NB5 A;  5CYV A;  2KFD A;  3ERM A;  1BBY A;  2W84 A;  2P5L C;  1IN6 A;  3DP7 A;  1JKR C;  3GVA A;  1AKH A;  3EYY A;  1IZ1 A;  2IP2 A;  3GFM A;  5IYC J;  2P7C B;  2KDZ A;  2MD0 A;  1D8K A;  3BWG A;  1ODD A;  2JMW A;  3IAM 2;  3S1N J;  2KIQ A;  4RA2 A;  3E1S A;  3JRF A;  3G6E I;  4WWC A; 
#chains in the Genus database with same CATH homology
 2M3A A;  2WAQ A;  3K4J A;  3VSK A;  3OIP A;  3OYB A;  2F5V A;  3LFU A;  2R7X A;  2GOM A;  1SFK A;  2DT6 A;  4PJL A;  3OYI A;  4G6T B;  2FUG 2;  1OLT A;  3ZGK A;  3AKZ A;  3VYT B;  3H9J A;  3DTI A;  2V1N A;  2CV2 A;  4X0G A;  1TZL A;  2L5Q A;  4E6K G;  2DOA A;  4PFO A;  1Z7L A;  2CMP A;  5KCM A;  3PFY A;  2PJR A;  3BCA A;  3CJQ B;  2VJ5 A;  3DLA A;  3H9Q A;  1AA7 A;  2V6E A;  2DT7 B;  3D5R C;  1T95 A;  4QPO A;  3CP2 A;  4B43 A;  3OR2 C;  2ZSI B;  1T0F C;  1D1B A;  4II3 A;  4CCL A;  1MMD A;  3PUB A;  2LG4 A;  4XMY A;  2A6T A;  2MFZ A;  5FRM A;  1UEL B;  3K70 D;  2CS3 A;  1PJR A;  4F3Q A;  2JUG A;  5KNL A;  3HG9 A;  1V5F A;  4BJT A;  3RCO A;  3BC8 A;  3PSF A;  3IP4 B;  5HVQ C;  3SEQ A;  2XSJ C;  3PL8 A;  2RQQ A;  1Y56 A;  1WFX A;  3VYU B;  3DEE A;  2W4S A;  4BXF A;  3S3O A;  2LRD A;  4EAT A;  3LL7 A;  4BQN A;  1X1C A;  4F92 B;  3OOU A;  2VAS A;  4XLH A;  5HOO A;  4OAY A;  1W36 C;  2Q1Z B;  4HEA 2;  3LSG A;  2XC7 A;  3LMM A;  3W3C A;  4H4K C;  2WY7 Q;  1U0J A;  4AU7 A;  2VKD A;  4IKF A;  2HU9 A;  4CCN A;  1YE9 A;  2JVH A;  3S3N A;  2R7W A;  2MYS A;  5FRO A;  2HNH A;  1OR7 C;  3ZXS A;  5HNF A;  2VKH A;  3K4L A;  3SZG A;  2HVS A;  4CH7 A;  3E0J B;  3L2V A;  1K6Y A;  3L2Q A;  2P0W A;  2X6Y A;  1IRX A;  2HZD A;  2LY2 A;  4OAZ A;  4BDY A;  2VL8 A;  3ZRG A;  3DPT A;  4LG3 A;  4Y4R A;  1SAU A;  3H35 A;  3LSM A;  2ZSH B;  4RLQ A;  1V5G A;  4NC8 A;  4PJM A;  4BS9 A;  2V4J C;  2KQR A;  2X1D A;  1MW7 A;  2BVL A;  1HA8 A;  3U21 A;  1UAA A;  3RTR A;  3L2U A;  2L7K A;  3HOS A;  2E60 A;  1NG6 A;  3ONQ A;  4II2 A;  2M4K A;  2O5R A;  1D0X A;  3K4C A;  4ANJ A;  3MKZ A;  1FMV A;  2OUM A;  3HC7 A;  3HXL A;  4XN0 A;  4PSX A;  3MKY B;  4BU2 A;  2K9L A;  3BLY A;  2XDV A;  3AL0 B;  3H0D A;  3A2K A;  4P1W A;  4P5O A;  1Y6I A;  4ZJZ A;  1X4O A;  3IUO A;  4BEH A;  4CZC A;  3EUK L;  2KPM A;  2WBM A;  4Y3O A;  3BG7 A;  3K4N A;  1KON A;  4NQW B;  3OYG A;  4E7K A;  2IGN A;  5CPR B;  1JI8 A;  2CUZ A;  3TBI A;  4RMN A;  2JSP A;  4CCM A;  4LIU A;  4AVZ A;  2BW3 A;  4KT6 A;  4RLF A;  2HDW A;  3EUH C;  4IX7 A;  2KRC A;  1ZEL A;  2VJ4 A;  2Z2S B;  3K10 A;  3SYT A;  3W2A A;  1LDK B;  3FKJ A;  4FAS D;  2X6X A;  4DBR A;  2BVM A;  4BE1 A;  2WAD A;  3HL2 A;  4LIT A;  3H5N A;  3S32 A;  3W2V A;  1WJB A;  1YX3 A;  2WAE A;  3H5R A;  1DQU A;  1NG7 A;  1R6R A;  2UV1 A;  2LOO A;  2X6W A;  1BR4 A;  3OYL A;  2MC4 A;  4F52 A;  2GOX B;  1MND A;  4CSW A;  3QYB A;  4DJA A;  2HPM A;  3ZR8 X;  1X1D A;  3J7A Y;  2DJI A;  4DBQ A;  3OYN A;  4U87 A;  2IS1 A;  1Z21 A;  2WAF A;  3I9V 2;  4BL0 B;  4RM3 A;  3TL4 X;  3DTK A;  2L9S A;  3A1Y A;  3OYJ A;  3RQ4 A;  4PFP A;  2AQF A;  3OYE A;  3LSI A;  3M8J A;  4HST A;  2CW7 A;  4PK4 A;  3FBI B;  4E4H A;  3A4C A;  2R7S A;  3H9G A;  3OYF A;  3S3M A;  3EUA A;  4E7L A;  1DGR M;  2M4G A;  3S93 A;  4N4O B;  3OYM A;  3IAS 2;  2M7A A;  3UR3 C;  4C2T A;  2WY8 Q;  2KP6 A;  4YEL A;  3FBN B;  2L9N A;  1MMA A;  3DQV C;  1G8X A;  3RSN A;  2ZXH A;  3HUG B;  3ZQQ A;  3OYA A;  2HQA A;  2Z16 A;  3BG6 A;  4JQF A;  1MMN A;  1N77 A;  4FET A;  2DXI A;  3DKY A;  4XN3 A;  3S8P A;  4HNU A;  4KIT B;  1WJE A;  4J01 A;  3ZCO A;  3OYH A;  2JA2 A;  4QPQ A;  2R4G A;  3W2W A;  2UWM A;  3OL3 A;  3DU5 A;  2VPL A;  2VQL A;  2VJI A;  3NWS A;  4BJ6 C;  1X4P A;  3EPZ A;  4XQF A;  3CF2 A;  2MAB A;  4CA0 A;  3DWL E;  2LBF B;  2VQG A;  1WJA A;  2E5N A;  3G2B A;  4B44 A;  2VIX A;  3H5A A;  3PNY A;  2IGM A;  4ZC3 A;  2HVQ A;  2VXD A;  4F93 B;  5FRN A;  4YEJ A;  2RNG A;  3CMM A;  2V9K A;  2OV7 A;  3VYR B;  4JOM A;  1X1B A;  1N75 A;  1V5E A;  2R7R A;  4R79 A;  4J00 A;  1D1A A;  2A5W A;  3SEZ A;  1ERD A;  3OYK A;  4ZDL A;  1QU3 A;  2KHM A;  2KZV A;  2HPI A;  2RRE A;  1WJF A;  2X1C A;  3CZ6 A;  2PJR B;  4BE2 A;  4E7J A;  1WJC A;  2ZFU A;  5TGT A;  4GRI A;  1TT0 A;  3OR1 C;  4XKV A;  4XKB A;  3QOD A;  3FHN A;  4XOT A;  4XM3 A;  1D1C A;  2LY1 A;  3K70 C;  3HKZ A;  4E7S A;  2W00 A;  2VXZ A;  2V7F A;  2IXS A;  2IGK A;  3K4B A;  2K3P A;  4C30 A;  3PJR A;  2W1O A;  3HPH A;  1W36 D;  4KIS A;  3PNV A;  2HVR A;  4HG2 A;  4HPQ A;  4NNJ A;  1QHH D;  2CUJ A;  3PSI A;  3KYL A;  3FDY A;  3GBG A;  2AQE A;  3OMY A;  4U7B A;  4N4N B;  4BAC A;  1J09 A;  1YX5 A;  4XLC A;  3LSH A;  4ZDO A;  1BOB A;  4ITV A;  2K5C A;  1X1A A;  2Q2E B;  2KRH A;  1S9H A;  3V42 A;  2XF5 A;  2K9M A;  3OS2 A;  3OS1 A;  1P9Q C;  2IS6 A;  1LVK A;  4XON A;  3UNG C;  4CCK A;  1BR2 A;  2Y0S A;  1Z3Y A;  4RM2 A;  2BOL A;  1X19 A;  2CFO A;  3RPU D;  1E0E A;  2XAU A;  5HNH A;  2QKL B;  2M0M A;  4XOP A;  4BUP A;  1LKX A;  2W7N A;  2X1E A;  4AYB A;  3M1C A;  1G59 A;  3I3L A;  4LIV A;  5LD2 C;  4IQJ A;  2VQC A;  4NC7 A;  4XOR A;  2CW8 A;  4D1Q A;  4XL9 A;  3DPU A;  4PUS A;  2VQH A;  4XLF A;  2W82 A;  3VDX A;  3OY9 A;  2E1M B;  1MMG A;  2JVG A;  3L2R A;  2WA0 A;  4B3X A;  5JHF A;  3DU6 A;  4CCJ A;  5CQG A;  2LC2 A;  2M7B A;  3C2G A;  1WJD A;  4XR6 A;  2Z1D A;  4BJ5 C;  4PJJ A;  3VYS B;  3D5L A;  2I8D A;  2QKM B;  3OYC A;  2WB1 A;  4MLO A;  2E1M C;  2ZXI A;  2R7U A;  4Y33 A;  4F91 B;  2F4I A;  2E5Z A;  2VLA A;  3QOE A;  3OYD A;  4DGW B;  4CUG A;  4XNF A;  3K4K A;  4BEH B;  5KHD A;  4F55 A;  5CQE A;  2VJJ A;  2L2O A;  2CV1 A;  4ZTJ A;  1FMW A;  3QYF A;  4E7Z A;  2KDO A;  1MNE A;  3VSL A;  2X51 A;  4ZTF A;  4ZDP A;  3CP8 A;  5CKT A;  2PMZ A;  4BDZ A;  3HPG A;  3LSK A;  3OL4 A;  4XKW A;  2BW3 B;  1LFP A;  4D9J A;  4XKC A;  2CH0 A;  2IGO A;  3MD2 A;  4HSR A;  3HOT A;  2LRE A;  3OWT A;  4PSW A;  2DCE A;  4BQQ A;  4HRI A;  4OWR B;  2KMU A;  2LYC A;  2V26 A;  3K6G A;  3D5S C;  2LH9 A;  2VB6 A;  2X85 A;  2R7T A;  1D0Z A;  1QHG A;  4E7I A;  2IS2 A;  1D0Y A;  1EA3 A;  3DKX A;  4BE0 A;  3CES A;  4CCO A;  3C2H A;  2OC6 A;  4BGD A;  1N78 A;  1VZ0 A;  1Z3X A;  3N05 A;  2XF6 A;  4XLA A;  4PJN A;  4DIQ A;  4E7H A;  1WJ5 A;  4B47 A;  2R7V A;  4HNT A;  3AFH A;  2CV0 A;  5HLT A;  1GLN A;  3K4M A;  2IS4 A;  4IQ4 A;  5LFA A;  3OIQ A;  4IZZ A;  2R7O A;  1BR1 A;  2F6C A;  3CJR B;  1DP3 A;  3KX2 A;  3QYE A;  3BCB A;  2KLO A;  3TMO A;  4B48 A;  1DGW Y;  4XLE A;  2ELJ A;  3F9K A;  4DOZ A;  2R7Q A;  4C9Y A;  1UG0 A;  3L2W A;  3OS0 A;  2UUZ A;  3SDB A;  4YRV A;  2XF7 A;  3PNT A;  4ZYA A;  4BQO A;  3MKW B;  2LBF A;  3DPL C;  2MD0 A;  2NOJ B;  3NWT A;  1PYV A;  3VWB A;  3DTE A;  3IAM 2;  3KEY A;  2KL4 A;  4C2U A;  3E1S A;  3MMY B;  4KJZ A;  3AL0 C;  4NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...