4HDVA

Crystal structure of s. pombe atl1 in complex with damaged dna containing 2,6-diaminopurine
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
publication title Alkyltransferase-like protein (Atl1) distinguishes alkylated guanines for DNA repair using cation-{pi} interactions.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hdvA00
1HW5A 1YS7A 5E1XA 5CVRA 3CO7C 2QUFA 3V7CA 3FX3A 2DTRA 1BJAA 1UCRA 5K5QA 1FX7A 2FQ3A 4B8XA 1O7LA 3BPVA 4LGWA 1IN5A 4RAZA 1SD4A 1KYWA 2XHKA 4U7DA 4QLCU 2IPQX 3RKWA 2ACJA 1BI1A 1J5YA 5HS7A 3EYIA 3GWZA 4LD5A 3SHFA 5BMZA 2K7LA 5HDNA 1TQMA 2L54A 4FX4A 2VOPA 1WI9A 2VE8A 3ZMDA 1G3SA 2BBYA 3RKXA 3COAC 3WTWC 4G7OF 2V1XA 5TJJA 2EV6A 4A6EA 3IKTA 5TRDA 4Q5SF 2XAJA 1D5VA 3HOSA 1UB9A 2XAGA 3T1BA 1B4AA 3KEQA 5LHHA 5IT9K 1WWXA 2OU2A 4M9ZA 5HS9A 3VODA 3DXJF 2HZTA 5DD8A 2QQ9A 3LQQA 1H0MA 4A0XA 3DP7A 1HSTA 1U5TC 2NYXA 1XCVA 1G6NA 3F6VA 2DBBA 5CVUA 2FNPA 3J81K 4PGHA 1FY7A 5HDGA 1F9NA 1XD7A 2ADUA 2FU4A 1FZPB 2IJLA 1T98A 2R7FA 2VN2A 4MQ9F 3IC7A 3FMSA 4PCQA 5CVIA 4BHCA 1L3LA 3KCCA 4Y17A 4CYDA 1FBUA 2D1HA 3RYPA 3WTZA 5CVJA 1FC3A 1S7AA 1ZRDA 4R8HA 5K5RA 2LKPA 2G7UA 3U2RA 3V7SA 2XVCA 3MAJA 1LDJA 4IPAA 3QAHA 4WWCA 3ISPA 3FMQA 3TOBA 5DCMB 3KP2A 3TO9A 1H9GA 4ZZDA 2PI0A 2M1BA 1F1ZA 4OMZA 3R4KA 5A2QK 1I27A 5LGUA 2FSWA 4LG0B 4NB5A 2Z33A 1XMKA 2IA1A 4IJAA 1L0OC 1JE8A 1JHFA 4BXUA 1JXSA 4L9JA 5DEQA 2PBIA 1TW3A 1OKRA 4HBLA 5D5VB 4A0ZA 5JHUA 2ZFWA 4UVAA 2VC1A 4HQEA 4N0BA 2ELHA 5BOXA 3KP6A 1HXDA 2EV5A 2WWYA 4XRFA 4EV0A 1GVJA 4GO1A 1LQ1A 4G6QA 1R7JA 3KP5A 4EVIA 4KMUX 3HTUA 4ZYEA 1EV7A 1U5TA 3ECHA 4HX8A 5E18F 4MTEA 2PN6A 1EH6A 3SZPA 3CJNA 3B73A 1T6SA 2WV0A 3WTXC 4G94A 2DLLA 3FXUA 3QP6A 1HKSA 3HRSA 4G9YA 5BPIA 2HDCA 3KEOA 2MBFA 2DW4A 2HEOA 1DPRA 4KIFA 4YIIA 1Z6RA 2OD5A 2RC4A 4LFUA 1U2WA 3P9KA 5DD4A 1G4DA 4DQ2A 1YYVA 3C18A 3SXYA 2VT3A 1FLIA 4I09A 1UHMA 1ZARA 4EM1A 2ZCWA 2A5YB 3J7AO 3KE2A 3DF8A 5LGTA 2DFIA 1W7PB 5LEJA 2XGXA 4I7HA 1B6AA 3HRTA 4MQVA 5AONA 2LF8A 2FF4A 4Q48A 1R5HA 3MZHA 1ZHFA 1IUYA 3JSPA 1RUOA 1O3QA 1G3YA 4HA8A 4ESJA 3WGIA 2DPUA 1DDNA 5J8FA 2KJCA 4EJUA 1ZG3A 4IXAA 5D5XB 1KU2A 5FD5A 1KU7A 1V3FA 3DV8A 3KLNA 2ESNA 1OMIA 1P92A 1R22A 1E17A 3L00A 2OZ6A 1K7AA 3ULQB 2D2WA 4AWXB 2K27A 4LMYA 2CSOA 1FBSA 3BDDA 4G6DA 2F5FA 3LSTA 5E1ZB 3GFIA 2VC0A 3BJAA 2QENA 5LHGA 3O2PE 1HSJA 1TLHB 2PLYA 4KA4A 4A6DA 2V9VA 3F23A 3TDZC 1J59A 1MD0A 4KIGA 2K4JA 1ZREA 4UHTA 2M8EA 4M6YA 3HOTA 3DQVC 4UVCA 4LJZF 4P96A 1WSUA 2M30A 3I71A 3F8FA 2H09A 5ICFA 4P9FA 2K4BA 2EA4A 1XB4A 4YIFA 2L3DA 3EDPA 3W6JB 1IXCA 3T8RA 5DCMA 2K02A 2H94A 3G73A 1BI0A 2E7XA 4KDPA 2IA2A 2Z3YA 3E6MA 5ILUA 5D6FA 4EJVA 2HYGD 1IXSB 3WU0A 3E3VA 5HLGA 4LG0A 1ZG5A 2P8TA 2V1UA 1IRFA 4Q4ZF 2BV6A 1QZYA 4RAYA 4HOBA 4P9UA 4RGXA 4FT8A 2D1VA 2L01A 5A2QZ 1KQ9A 2PQ8A 3K1NA 3U9GA 4EM2A 2HS5A 2A68F 2V79A 1J0RA 2WC2A 4Y15A 1QPMA 4L5JA 1IN8A 3ECOA 5CJ9A 3SQNA 4WXHA 1R5GA 5FB2A 1ZGJA 2GWRA 4CICA 2IW5A 4LLNA 2F2EA 2P7VB 4GYGA 1Y0UA 1FYMA 1UFMA 2R3SA 1IW7F 3R60A 5FD6A 1BC7C 1Z05A 5D5WB 4BAYA 1RI7A 2P5KA 3WTSC 1KYZA 4WCGA 3GLXA 3C7JA 1QQIA 4A5NA 2ZNYA 5HLHA 4G8XA 3GYHX 4HF1A 3P7NA 4ZYGA 1U8RA 3K9TA 3GUDA 2A3SA 2JTVA 1IN7A 1I1GA 1YQAA 2X0LA 2FNAA 1TW2A 2O8XA 1XDSA 4U7BA 5E20A 4L0YB 2PJPA 2VXZA 2WTEA 5CVVA 2J5PA 1W7PA 4LLLA 2CGPA 1SFXA 3WGGA 2H27A 6PAXA 4XSZF 1MJ9A 5E8GA 5EEHA 4HX4A 4M6XA 3DEUA 3LFKA 1W7PD 4OINF 5F6FA 2EFOA 2W57A 3WODF 3GZ6A 2YX4A 3FXRA 3LA3A 1R58A 4HV5A 1Z7UA 3KLOA 4WF2A 2L02A 2RN7A 2OA4A 4AIHA 5FLXZ 3V8LA 1YIOA 2W25A 5ICGA 3HSRA 2XAHA 3S2WA 3LAJA 4CZZA 1FP1D 2ZJ2A 2PG4A 1B9MA 1IZ1A 3WE2A 5H6RA 2FBHA 2VE9A 1OYYA 2QLZA 1ZRCA 1IN4A 3L2CA 1W4MA 3BJ6A 3ML6A 3TO7A 4HV6A 4RB0A 3QOPA 3CDHA 2Y48A 1W5TA 4PZJA 5ILSA 5JFRA 1QNTA 4MHGA 2OQGA 1REPC 2G7HA 4IRGA 3OV8A 4OIRF 4S05A 3LA7A 2DT5A 2KIUA 2AXLA 1XMAA 4HYEA 2XRNA 1O7FA 2QYOA 4FHTA 3H3UA 3FHZA 2DPDA 2JZYA 4YFXF 2RV8A 4HW0A 3QPTA 3LA2A 1H9TA 4S04A 2EJRA 4KNYA 1QZZA 1QGPA 3SZTA 2G9WA 4KN7X 4ENNA 1FYKA 2IA0A 4RGRA 4P55A 1FSEA 2Z5UA 1Q1HA 2M45A 4A12A 3RJPA 1LB2A 2LNBA 4BHBA 2F5EA 4HX7A 1R00A 4EJTA 1MGTA 5D5UB 4QWQA 2Q2EA 5HDKA 3P9CA 4ENKA 4WK8F 4UVBA 3WTUC 2W24A 1SAXA 1O3SA 1VTNC 2MH2A 1R36A 4LK1F 3QU3A 1ODDA 2XAFA 4KT5C 1O3RA 3I4PA 3H92A 4CXFA 3TOAA 3J80K 1G3WA 5L3EA 1T2KA 2EFNA 2VBZA 3O3KA 2Q0OA 1X3UA 3JTHA 3NEUA 1GXPA 3PQJA 2HKXA 4DNCA 4L9VA 4JK1X 2CO5A 2UZKA 1T39A 4HLXA 2CG4A 2CWEA 3IRRA 3KP7A 5BPDA 2O0YA 5LLQA 5DCFA 3ZMSA 3ROUA 2FRHA 4A5MA 1I6XA 3IWFA 5HLIA 3HHHA 3WTYC 4M73A 4HDVA 1PDNC 1CGPA 1GHCA 3K1PA 2W84A 2HYFA 2CYYA 5ED4A 2ESHA 3M1EA 2ZXJA 2DI3A 1FYLA 2AS5F 2O03A 3ZP5A 1HQCA 3JW4A 3V4GA 2EA2A 2QM3A 1TQIA 2EFWA 2UXXA 3P9IA 4IRHA 4UUVA 2O6GE 1K78B 3R6SA 3MWMA 5ERIA 2OAZA 2RDPA 2KKOA 5F64A 1KGSA 2H6BA 2LSOA 4I98B 4EJWA 5DUKA 2KJBA 2GXGA 5LRSA 4OIPF 4EQQA 1BI2A 1LNWA 4KFCA 3V8JA 2QBYB 1J7KA 3G3ZA 1OYWA 2YU3A 1FSHA 3KZYA 3GFLA 1G3TA 2MLKA 2XKOA 2EK5A 1HW2A 3K2ZA 1R1UA 1FWZA 1TNTA 2H6CA 1ZLKA 5E8IA 3BJOA 5LHIA 2F5CA 2P4WA 1HBXG 4D0PA 4M71A 1GXQA 2NS0A 5FO5A 2CW0F 2R7DA 1CF7B 4OIOF 1BM9A 1D8KA 1U3EM 1MKMA 2IRFG 3ZN1A 2JPCA 3GXOA 4IVNA 4NQWA 1V4RA 2VONA 3N97A 2UXNA 1ULYA 1BOAA 2DQLA 2HWVA 2EB7A 4H0EA 3E6DA 1J9IA 3RYRA 1I1SA 3CUQB 1ON2A 3DPLC 1RUNA 3RI4A 3IRQA 2W85A 1LEAA 2IVMA 1SD5A 5IT9Z 1MJAA 2MLGA 2VBYA 1LVAA 2Z99A 2Y75A 2PMHA 4OOIA 1YG2A 4KMFA 2HFHA 2EV0A 2HTJA 3QU6A 4U0YA 4U0WA 3W6KB 4IHTA 1ZGAA 3ELKA 2BEOA 4L5IA 5JI6A 4I2OA 3HSFA 3J81Z 1ZLJA 3V8KA 4CDGA 3RDIA 3Q5FA 1P6RA 4I0BA 1P4AA 3LAPA 2VOOA 3T5XA 2HQNA 5D8LB 4XLNF 3E6BA 4I01A 1WKMA 1XGMA 3HRMA 5LRRA 5FGMA 1BBYA 2EFPA 1E2XA 4CGZA 1XGNA 2GA1A 3R0JA 2ISYA 2YX7A 4HLYA 3M8FA 2DO7A 3KZZA 1IAWA 1ZN2A 1TTYA 2M87A 2PMUA 4JQFA 2Y0MA 2ZMEB 3ABTA 2VT2A 2KRFA 3Q9SA 2LDUA 1Z91A 4MTDA 4M72A 3GX4X 2V6CA 4AIKA 2B0LA 3JAMK 1HKTA 1P4WA 3HHGA 4N9HA 2JRTA 4R79A 1K6OA 4KICA 4WX9A 4KUMA 1MDMB 5DUIA 2MD5A 5HOOA 2O3FA 3O6BB 4UNOA 4E70A 1BIAA 1XGSA 2PFBA 2ZO4A 2MH9A 1T38A 4GXOA 5H6QA 3GFJA 3R0AA 1HKQA 2GQQA 1TQPA 5KK1A 4O6JA 3QRFF 3N4MA 1RNLA 2VODA 1FPQA 2XUBA 5ILVA 4HZFA 1K78A 2HKOA 3GFMA 5DDGA 3L9FA 1F4KA 3CUQC 1ZG1A 1WQ2A 5L3CA 4ASNA 1LJ9A 4U88A 4RB3C 4A2UA 3I54A 4N9IA 3I5UA 4ENJA 3DKWA 4UV8A 4ZZLA 1NHAA 1KA8A 1F5TA 1YO5C 3EUHA 5LBQA 2QBYA 4HQMA 2RVCA 3F8BA 3FM5A 3WTTC 5K1YA 3RIRA 1C0WA 3EYYA 4HDUA 3MCZA 3F6OA 1Z9CA 2TDXA 1R1VA 2HR3A 1O3TA 4HAMA 4B09A 3C1DA 2XASA 3BZ6A 2NRAC 5E17F 5FFXA 3HYIA 4RGSA 1SD6A 3JSOA 3MZYA 1FP2A 1S7OA 1D3YA 1PP8F 2A6EF 1CF7A 1USTA 1Z1DA 3VFZA 3F8NA 1ONVA 1HW1A 5HVQC 4F7ZA 1YW9A 4LLGF 5L3BA 4M9XA 4M74A 5L3GA 4EM0B 2LF7A 3CUQA 4BYYA 4O5VA 4CHUA 1ZRFA 2P5LC 1TNSA 4I0AA 2XIGA 1IN6A 3L7WA 3MFKA 3AAFA 1YLFA 5ICCA 4GYIA 1S8NA 2OQRA 1FT9A 3MEXA 1SFEA 5DV5A 3WU1B 4XBFA 1LDKB 5L3DA 2FE3A 2NNNA 2EFQA 1SMYF 3IHUA 3EETA 1TBXA 5J6XA 4ESFA 2E1CA 2BGCA 3FF5A 3E5UA 3PFIA 3IKVA 4ZYDA 3MQ0A 3WE3A 1YFHA 4M9SA 1XSVA 2PEXA 1OR7A 1BC8C 3TO6A 1ZAOA 4IHSA 1FBQA 4OMYA 1IRGA 5IT3A 5AIQA 2ZMEA 4LB5A 1U6GA 1XGOA 1S6LA 2RQPA 1OPCA 3RPQA 3K0LA 3I0TA 1STZA 4LK0F 2GXBA 4AD9A 4L18B 2MA3A 3BOQA 4L9TA 5JR3A 2QQBA 1MDMA 2GAUA 5H20A 2DK8A 3ZMUA 5E1WA 2CQKA 5AIPA 3JAMZ 4L0ZB 3ZMTA 5BS6A 2FBKA 1J75A 4JBAA 3BP8A 3GF2A 1K79A 3HSEA 3M8EA 2K86A 1XN7A 2A69F 1RIOH 2V1DA 2HGCA 3QP5A 1U78A 3RTRA 2HTSA 3C3WA 3BPXA 2O61A 4K2EA 2NAZA 2VBWA 2GIVA 2QZ8A 3ZMVA 2M5WA 3GO5A 3HTSB 2BE5F 3K69A 3L09A 4TV7A 1Z6TA 5LEKA 3U1DA 1YS6A 2KIFA 2GA2A 3F72A 4MNUA 5JVTA 3F8MA 3I58A 1FNNA 4XLPF 2JPBA 1B1BA 2NNYA 2OZUA 4AIJA 5ICEA 2XAQA 4RS8A 1DUXC 4YFKF 4RB1A 5D8KB 4UV9A 2DQRA 4GGGA 4BHPA 2JSCA 1P4XA 3ABUA 3M9AA 3ZQ7A 2FMLA 2ZBKA 4FX0A 5F1RA 1ON1A 2A61A 2ZKZA 4XSXF 4EMSA 1I5ZA 4NHJA 2QWWA 4WXDA 3RKYA 2YSRA 1SD7A 4CO8A 3I59B 4P5OA 2XKPA 4G7HF 2D45A 4Z2YA 3IWZA 1IXRC 1DP7P 3CLOA 5LGNA 2ISZA 4ETSA 5FLXK 3VOEA 5DYMA 4LB6B 3I53A 3IL2A 4KN4X 3F8CA 1UHWA 4KYWA 3BWGA 4YG2F 4RB2C 2C6YA 1JGSA 3OOPA 4BQAA 1B9NA 3ZN0A 2DU9A 2Z9OA 3CTAA 2Q8KA 5J8CA 5D4RA 3ZMZA 1KU3A 3B02A 2CFXA 3DFGA 2STWA 3KFWX 2FEZA 3E5QA 1SFUA 1XSXA 1XCBA 1BI3A 2E7WA 3T0YA 2JT1A 2RKHA 4IF4A 1A04A 4ZYHA 1QO0D 3TDUC 2QQAA 2E1NA 2MC3A 4OIQF 3FM3A 4PGGA 3R61A 3GZ5A 3TQNA 1KU9A 1O57A 1S29A 4I02A 5BQTA 4EGZA 2OBPA 5K5OA 2F5DA 5D6EA 4EGYA 3CUOA 3D5LA 4ESBA 1W5SA 1QBJA 1MJBA 4RGUA 3E97A 4MEYF 4ZH4F 5FFZA 4YFNF 3FXQA 2BYVE 5EEGA 4WXCA 3VB2A 4L9NA 1MZBA 1EH7A 3KP4A 2HOEA 1YW8A 3DPTA 3WGHA 1BIBA 3BY6A 3WG9A 3J80Z 1XSDA 4HF0A 1ZH5A 1DPUA 2FOKA 2P7CB 4Q47A 4U0VA 2UWMA 5D4SA 2GZWA 3WTVC 1RZ4A 4MEXF 2A6HF 4Y13A 1EH8A 3HRUA 3FWEA 2COMA 4O3MA 3GW2A 1YW7A 4KIBA 3E5XA 4IRIA 4R1HA 2IP2A 3PQKA 2YPRA 3BROA 3V7RA 1D8JA 2J5OA 5KVRA 2XROA 3F22A 4ENMA 4ON0A 3I64A 3KP3A 1LDDA 1P2FA 2X4HA 3FMRA 2YR2A 3JTGA 2STTA 5L3FA 1BN5A 1XDUA 5HS8A 1IF1A 4OU0A 3NQOA 3ZPLA 1KQ0A 3Q9VA 2ZNZA 4EJOA 2L4AA 3CO6C 1R1TA 2P6TA 2RNJA 2FA5A 2KIMA 1PP7U 3E6CC 3LWFA 3M7GA 1AWCA 4GCVA 2ETHA 3F21A 1WRJA 2RGVA 3FZVA 4G7ZF 2FMYA 1YTYA 1USSA 4AVPA 2DAOA 1S3JA 2IT0A 3EQLF 4PDKA 3H3ZA 3K1MA 3I59A 2P5VA 2VBXA 1LEBA 1OYIA 3QPHA 3REOA 2HQRA 4UXNA 3GEZA 3GVAA 2FBIA 3HUGA 4BH9A 1SMTA 5CYVA 1U5TB 2A07F 3D0SA 4MGRA 3TGNA 3F3XA 5CLSA 2P6SA 1R23A 2XV4S 1JHHA 1KQ8A 3LQRA 1B59A 2QVOA 4HF2A 3HIFA 1FOKA 4A0YA 3T8TA 1J2XA 3ERED 2DK5A 3SFZA 4BNCA 3RPUA 3NRVA 2L4MA 1T0FA 2FXAA 2EWNA 1PUEE 3KETA 3VEPA 1AOYA 1ZYRF 3TKYA
chains in the Genus database with same CATH superfamily
1HW5A 1YS7A 5E1XA 4UY8I 5CVRA 4A69C 5FLVA 3CO7C 4UUSA 5DM6F 2QUFA 3CF2A 2E2JJ 9ANTA 3V7CA 3RPUD 4AYBN 3HDDA 4JP0A 3FX3A 2EZHA 2VXDA 2DTRA 1BJAA 2RAEA 3BQZA 1UCRA 1GT0C 2RREA 4XK4A 2DA4A 1XPXA 1SFKA 5K5QA 3S2HJ 1Y56A 2HI3A 2L2OA 1FX7A 1EF4A 4F52A 2FQ3A 4B4CA 4B8XA 4UB8C 1O7LA 3BPVA 4LGWA 1IN5A 4RAZA 1SD4A 1YX3A 4YIRX 1KYWA 2XHKA 3VPRA 4U7DA 4QLCU 1R49A 2IPQX 3RKWA 3FIWA 5KHDA 2ACJA 1BI1A 1WJBA 1J5YA 5HS7A 5GPAA 1V5GA 3EYIA 2R7UA 3GWZA 4LD5A 4DOZA 3BZKA 3SHFA 1ZGWA 3QYFA 5BMZA 2K7LA 5HDNA 1AHDP 1V5FA 1TQMA 2L54A 4FX4A 4ZDOA 2VOPA 1WI9A 2VE8A 2E19A 3ZMDA 1JJ6C 3DBRB 1G3SA 2BBYA 3RKXA 3Q0VA 3COAC 3RSNA 4FE4A 1JGGA 3WTWC 3ZOBA 3LSIA 1BOBA 4G7OF 2MABA 2R7RA 2V1XA 5TJJA 2EV6A 4FISA 4A6EA 3IKTA 5TRDA 4Q5SF 2XAJA 1D5VA 3H1CA 4KITB 3HOSA 1UB9A 2XAGA 5H2FC 5IYDJ 1BL0A 2HXOA 2X6WA 3T1BA 1B4AA 4JX5A 2R0QC 3OYFA 3KEQA 4B44A 5LHHA 5IT9K 1VI0A 1JKRC 1WWXA 1Y6IA 2OU2A 3OWTA 4M9ZA 5HS9A 3DTKA 3HGYA 3VODA 3DXJF 5GTIC 2HZTA 3BR2A 5DD8A 2IS6A 2QQ9A 2OPTA 3FK7A 3LQQA 3NARA 1H0MA 2E60A 4IKFA 4DYRA 4A0XA 3DP7A 1HSTA 1U5TC 2NYXA 1XCVA 1G6NA 3F6VA 2DBBA 5CVUA 4XN3A 2FNPA 3J81K 3JRBA 1ZQ3P 4PGHA 1FY7A 5HDGA 1F9NA 1S9HA 3S3NA 1VQOI 1SEUA 2DXIA 2JA6J 1XD7A 3AKZA 2ADUA 2FU4A 1W36D 1FZPB 3W6VA 2F4OB 2IJLA 1T98A 2R7FA 2VN2A 4MQ9F 3L2RA 3IC7A 3FMSA 4PCQA 5CVIA 4BHCA 1L3LA 4M3BA 3KCCA 4Y17A 4CYDA 5J1UA 1FBUA 2D1HA 3CMEI 3RYPA 1ETWA 3WTZA 3PO2J 1WI3A 5CVJA 1FC3A 4ITVA 3S93A 1S7AA 2LK2A 4R8HA 5K5RA 1ZRDA 2LKPA 3AL0C 2G7UA 3U2RA 3LOCA 3V7SA 2XVCA 3MAJA 1LDJA 2KDOA 4IPAA 3TP0A 2L9VA 3QAHA 4WWCA 1HA8A 1PUFA 3H0GJ 3ISPA 3FMQA 1OCPA 2FUG2 3TOBA 5DCMB 3KP2A 3TO9A 1H9GA 4ZZDA 2PI0A 2NVQJ 2M1BA 1F1ZA 4OMZA 3R4KA 5A2QK 3S1NJ 4HG2A 1I27A 2COBA 1X58A 1B72B 5LGUA 2FSWA 3OYHA 1IGNA 4LG0B 4NB5A 2Z33A 4RMNA 1XMKA 2IA1A 4IJAA 3A0HC 1L0OC 1JE8A 1JHFA 4BXUA 1JXSA 2EILH 1T56A 4L9JA 5DEQA 2W1OA 2PBIA 3BLYA 2VB6A 2X85A 1BA5A 5HLTA 1TW3A 1OKRA 4HBLA 5D5VB 1UELB 5F08A 4A0ZA 5JHUA 2ZFWA 4UVAA 2VC1A 1JKQC 2M34A 5C4XJ 4HQEA 4A3LJ 4N0BA 2ELHA 3FXJA 4LG3A 2EZKA 1ENHA 5BOXA 3ZQGA 3KP6A 1HXDA 4IQ4A 1I3QJ 4IQJA 3JCUC 2F4IA 2EV5A 2WWYA 4XRFA 4PJJA 5JLXA 4D1QA 3E1SA 3ZQCA 4EV0A 1GVJA 4GO1A 1LQ1A 1X2NA 4G6QA 1R7JA 3KP5A 3GBGA 4UB6C 4I99C 3DEEA 1DQUA 2K9SA 4EVIA 3I56I 2V1NA 1D0ZA 2M0CA 3S1QJ 4KMUX 4I76A 3HTUA 5BNGA 4ZYEA 1D1CA 3HC7A 1LE8B 1EV7A 2JN6A 1U5TA 3TL4X 3ECHA 4HX8A 3I9V2 5E18F 4MTEA 4CUGA 5DS9A 4JX4A 2PN6A 1EH6A 2XGCA 3SZPA 4E7IA 3CJNA 5CQGA 3A01A 3B73A 1T6SA 2WV0A 4NBQA 1U9NA 5J47A 4G94A 3WTXC 2DLLA 3FXUA 3QP6A 2M9HA 1HKSA 2WAFA 3HRSA 4G9YA 5BPIA 4BE1A 4E7SA 2HDCA 1VFCA 3KEOA 1ETOA 2MBFA 4BXXJ 2DW4A 2HEOA 1DPRA 1WH5A 1TZLA 2LY2A 4KIFA 4YIIA 1Z6RA 2OD5A 2WBMA 5B66C 3IAM2 2RC4A 4BL0B 4LFUA 1U2WA 3P9KA 3M1CA 5J1YA 5DD4A 4J00A 1G4DA 4DQ2A 3RZOJ 2CUZA 1YYVA 4LIUA 3C18A 3OR1C 3SXYA 3CC7I 2VT3A 1FLIA 4I09A 1UHMA 2PMZN 5M5XJ 3GTLJ 1ZARA 5HNFA 4EM1A 2ZCWA 2A5YB 3L2UA 3J7AO 3KE2A 3DF8A 5LGTA 2DFIA 3QPSA 1W7PB 5LEJA 2XB5A 3TW7A 1JUSA 2XGXA 4I7HA 1B6AA 3HRTA 4DYCA 4X0GA 4MQVA 2EINH 5AONA 2ZJQF 2LF8A 4IOAF 2FF4A 2W4SA 2PJRB 2OF7A 4RM3A 1MMNA 4Q48A 1TT5B 1R5HA 1T08B 3MZHA 1ZHFA 3RZDJ 5GTHC 2DFFA 1IUYA 2CMPA 3JSPA 1W0UA 2DOFA 1RUOA 1X2MA 3VSKA 1O3QA 1G3YA 3HB9A 4HA8A 4ESJA 3PUFA 3WGIA 3KEYA 2DPUA 1DDNA 3SZGA 3B6AA 2HOAA 3DTEA 1N75A 3ZR8X 3C2BA 5J8FA 2KJCA 3M07A 2EH3A 4EJUA 2LOOA 1ZG3A 3DPUA 1YITI 1RESA 4IXAA 5D5XB 1AA7A 1KU2A 5FD5A 1KU7A 1FOWA 1A6QA 1V3FA 3DV8A 3K4NA 3KLNA 4AVZA 3FHNA 2ESNA 1ETKA 2E71A 2YU9J 2W7NA 2O7OA 1OMIA 1P92A 1OQYA 1R22A 1E17A 3DCFA 1HC8A 3L00A 4Z6YA 2OZ6A 2CUEA 2BY3A 4QTRA 1K7AA 3ULQB 3CCEI 3GTQJ 2LG4A 2D2WA 4AWXB 1ACIA 2X6XA 2K27A 4LMYA 5K7HA 2CSOA 1FBSA 3OL3A 3BDDA 4G6DA 2IS4A 3QODA 1IV8A 2LMDA 5E79C 2F5FA 3LSTA 5E1ZB 4B43A 3ASNH 3GFIA 1DP3A 5FROA 2CQXA 2VC0A 3BJAA 2QENA 4XORA 1U8BA 5LHGA 4BE2A 2VKHA 2JUCA 3MKLA 3O2PE 4PJLA 3EUKL 1HSJA 1TLHB 1V54H 2PLYA 1D1BA 3CDIA 2R5ZB 4KA4A 2JA7J 2WY7Q 4A6DA 1A31A 1JKOC 2V9VA 3F23A 4ABZA 3TDZC 1X3WB 3QOEA 4CCOA 1J59A 1MD0A 2EZIA 4KIGA 2K4JA 1ZREA 4UHTA 1YE9A 1I39A 4NUBA 2R93J 2M8EA 4M6YA 3HOTA 2LP0A 3ERMA 3DQVC 1KZHA 4UVCA 3FXLA 2WADA 2Y0SN 5TGTA 2V7FA 4LJZF 4P96A 5M3FJ 3S1MJ 5IYCJ 1WSUA 2M30A 4UUTA 3I71A 3TBIA 3CMAI 2VQHA 3F8FA 3HOUJ 1TP4A 2H09A 5ICFA 4BQNA 4CA0A 1MSFC 4P9FA 2K4BA 2EA4A 4NC8A 4MIMA 5FKLA 1XB4A 4YIFA 2L3DA 2OCEA 3EDPA 3W6JB 2CV1A 1IXCA 3T8RA 5DCMA 3WHCA 2K02A 2H94A 4ANJA 1JT0A 5M5YJ 3G73A 1BI0A 2E7XA 4H4KC 1N77A 4KDPA 2IA2A 5JVGF 3C2HA 2QGUA 2I10A 1OCOH 1Y8QB 2Z3YA 3E6MA 2L9SA 2Q2EB 3G6EI 3CCLI 5ILUA 2ME0A 5D6FA 1F36A 3FISA 3JRGA 4A3BJ 4EJVA 2HYGD 1IXSB 3WU0A 3E3VA 1B72A 3EUAA 5HLGA 4LG0A 1ZG5A 4M6VA 2P8TA 1YJNI 2DT7B 2V1UA 2NOGA 2F6CA 1IRFA 3A03A 4Q4ZF 2BV6A 1QZYA 4RAYA 4HOBA 1OLTA 2IGMA 4E6KG 4QIWN 1Y39A 2E36A 4B3XA 4P9UA 2VPLA 4RGXA 4FT8A 4DBQA 3MN2A 2D1VA 2L01A 1KQ9A 2DA7A 2PQ8A 5A2QZ 2HDDA 4GFBA 3K1NA 1X4PA 3U9GA 4EM2A 1LFBA 2HS5A 2A68F 2RQQA 2GXAA 3LMMA 3JRCA 2V79A 1J0RA 2WC2A 4Y15A 1ETVA 1QPMA 4L5JA 1IN8A 3ECOA 5CJ9A 3SQNA 3OYKA 4RDUA 2OUMA 4WXHA 3L2WA 4Y4RA 1R5GA 5IP7J 1APLC 5FB2A 1ZGJA 2GWRA 4CICA 3ABKH 2AQEA 2IW5A 4AYBA 5J4YA 3FXOA 3CQZJ 3OYEA 4E7LA 4PFPA 4LLNA 2F2EA 1SAUA 2CS3A 3K10A 2P7VB 4GYGA 3FBIB 1LFPA 1Y0UA 4E7HA 1FYMA 5F0CA 1MH3A 3AFHA 2ZSIB 1UFMA 1D0YA 2R3SA 2WV1A 1IW7F 3LL7A 1LE8A 3R60A 5FD6A 1BC7C 1Z05A 2Y69H 4BAYA 1RI7A 5D5WB 2P5KA 1TWGJ 3WTSC 4XKVA 2NVUB 2E5ZA 1KYZA 4NDLA 3LSJA 2DDAA 4OWRB 2QKLB 4WCGA 3GLXA 3C7JA 1QQIA 3PJRA 4A5NA 4IHYA 2HVSA 3QPLA 2ZNYA 4P1WA 5HLHA 4G8XA 3GYHX 3H36A 4DZPA 4FASD 1U9OA 2M7AA 4HF1A 2DJNA 3P7NA 4ZYGA 1OCZH 4QPQA 1U8RA 3K9TA 3GUDA 2A3SA 2IGKA 2LD5A 2JTVA 1IN7A 4BY1J 4JOMA 4BJTA 3A2KA 1I1GA 1YQAA 2X0LA 2FNAA 4IHVA 3M8JA 2ICWG 1TW2A 2O8XA 1X1BA 5FKNA 4AU7A 1XDSA 2NXNB 4U7BA 3HOVJ 5E20A 2JQ7A 4L0YB 1SANA 3G1LA 2X6YA 2PJPA 2VXZA 4E7JA 2WTEA 5CVVA 2DDBA 2J5PA 1EKEA 1G59A 1W7PA 1OCCH 4LLLA 2CGPA 1SFXA 2HQAA 3CJTB 3WGGA 2H27A 5KAFC 1MMDA 3SEZA 6PAXA 3H9QA 3FBNB 4HPQA 4XSZF 4BDYA 1MJ9A 4PJMA 5E8GA 3HOXJ 3IAS2 5F04A 1I6HJ 2MC4A 5EEHA 4HX4A 4M6XA 2HNHA 3DEUA 3LFKA 1VZ0A 2FOWA 1W7PD 4OINF 1B8IB 5F6FA 2EFOA 2W57A 3WODF 2VI6A 3UR3C 3RCOA 4C3JJ 3JR9A 2M0MA 3GZ6A 2YX4A 1CQTA 1TWCJ 1YRNA 3FXRA 3LA3A 1R58A 4HV5A 4HEA2 1K83J 1Z7UA 3KLOA 4WF2A 2L02A 2RN7A 3CJRB 2OA4A 3DBHB 4A3KJ 1PVEA 1MSEC 4AIHA 5FLXZ 3V8LA 2HXIA 3BTCA 1YIOA 3CMMA 2W25A 4YELA 1W36C 5ICGA 2EIMH 4AUXA 3FKJA 3HGGA 3HSRA 3PSIA 3ZQHA 2XAHA 5LFAA 3S2WA 3LAJA 4CZZA 1FP1D 4DGWB 2ZJ2A 2PG4A 1B9MA 1S5LC 3Q0WA 1IZ1A 4D9JA 3WE2A 2WAEA 5H6RA 4XONA 1NG7A 2FBHA 1OYYA 2O5RA 3OIQA 2VE9A 2QLZA 3QQAA 1QZEA 3BG9A 3CCMI 1R71A 1ZRCA 1IN4A 3L2CA 3DBLB 2X1EA 3Q3SA 1W4MA 1MH4A 3BJ6A 3ML6A 3D5RC 4BACA 4A3JJ 3DWLE 3TO7A 4HV6A 4RB0A 3KIOA 3QOPA 3CDHA 5C3EJ 2V9KA 2Y48A 1W5TA 3J7AY 4PZJA 1MBEA 1GLNA 1QNTA 5ILSA 5JFRA 1NK3P 2X1CA 2X1DA 2ECBA 2EZLA 1S7EA 4MHGA 2OQGA 3M3YJ 1REPC 4BGDA 2G7HA 4BKXA 2IS2A 1W5CC 2DA5A 2Q1ZB 2OV7A 2EPFA 4C2TA 4IRGA 3OV8A 4OIRF 3LA7A 4S05A 4FCYA 2DT5A 2G0EA 2R5ZA 2K9MA 2KIUA 2AXLA 1XMAA 4HYEA 2XRNA 2L7KA 1O7FA 2E1MB 2FJ1A 2QYOA 3NWSA 1X1PA 4FHTA 2ZJRF 3ABLH 4RA2A 3ZGKA 2Z2SB 3H3UA 3FHZA 4IZZA 2JZYA 2DPDA 4XKBA 2KDZA 1KONA 2RV8A 4HW0A 4YFXF 2JVHA 3QPTA 3HOWJ 3LA2A 1H9TA 4S04A 3H3VK 2EJRA 4KNYA 2IAIA 3O8HA 5CKTA 1QZZA 1QGPA 2DA3A 3H9JA 3RQ4A 3SZTA 2G9WA 4KN7X 4ENNA 1P7JA 1GVDA 1FYKA 2IA0A 4RGRA 4P55A 2BVLA 1FSEA 1Z7LA 1FMWA 2LKXA 3BQYA 2Z5UA 1YI2I 1Q1HA 3BG5A 4RAGA 3HOYJ 4A3DJ 3L1PA 3DEWA 2M45A 3G1MA 4A12A 2DA6A 3PNVA 3RJPA 4BU2A 4XICA 4Y52J 4NQWB 2FX0A 2LNBA 2ME6A 2X51A 1LB2A 4C2UA 4IOCF 2X9DA 5M3MJ 4BHBA 2F5EA 4HX7A 4J19A 1R00A 4EJTA 1MGTA 5D5UB 3CD6I 1ZKGA 4QWQA 2Q2EA 4IL6C 3P9CA 5HDKA 1ZR2A 4HNTA 4XM3A 4ENKA 3BCAA 4CYCB 2KFDA 4WK8F 4UVBA 3WTUC 1HDPA 2W24A 2VKDA 2L5QA 3K7AJ 1Y8RB 1DU6A 1SAXA 1O3SA 2EBIA 1VTNC 2LTPA 2MH2A 1R36A 3OSGA 1ETQA 4LK1F 2BHZA 2JMWA 4B3AA 3QU3A 2CRGA 1ODDA 3BR6A 4ZC3A 2HOSA 1YJWI 2XAFA 4KT5C 4HNUA 4AM3A 1O3RA 2AHQA 3I4PA 3W2VA 3HBLA 1WGXA 2PMZA 1DGWY 2DMUA 1V5EA 2B7EA 3H92A 5IP6A 4CXFA 3ZQFA 3B6CA 2CQQA 3O8GA 3TOAA 3OYJA 3UNGC 2KZGA 1ZK8A 2OC6A 3A4CA 2CU7A 3J80K 1G3WA 4BE0A 4NNJA 2VKEA 5L3EA 3OYNA 1T2KA 2EFNA 2VBZA 1BW6A 3PO3J 3O3KA 4BQQA 2Q0OA 2L7MP 1ZR4A 1X3UA 3JTHA 3NEUA 1GXPA 4FE7A 3PQJA 1D5YA 3BTIA 2HKXA 1FMVA 1I50J 4OAYA 1MW7A 4XR6A 2V26A 4DNCA 1WCMJ 4MLOA 4L9VA 1VQ9I 4JK1X 1Z77A 2CO5A 2E2HJ 2UZKA 1JUPA 1T39A 1VQ4I 4CCKA 4HLXA 2CG4A 4II2A 1XS9A 3DKXA 2N8GA 2CWEA 3IH3A 2E2IJ 5IOYA 3IRRA 3HPGA 1IRXA 1AKHB 3KP7A 5BPDA 1QHGA 1UZCA 1GDTA 5GAEJ 4DJAA 2B9SA 2O0YA 5LLQA 2Y31A 4AIDA 4A3EJ 1BW5A 2XSJC 2LY1A 5DCFA 3ZMSA 3SJMA 3ROUA 1MIJA 1U0JA 1X1CA 2E1MC 2FRHA 2ZFUA 4A5MA 1XMXA 1RKTA 4CCJA 1I6XA 3IWFA 5HLIA 3PIPF 3H5NA 5K7ZA 4M3DA 3H5AA 3HHHA 3WTYC 4MFEA 3HZJA 5IY5H 4M73A 4HDVA 3S15J 1VQ6I 3FXKA 1PDNC 4RBOA 2P0WA 1CGPA 1GHCA 3LNQA 3K1PA 2W84A 3KYDB 2HYFA 2CYYA 5ED4A 1QA6A 3S17J 2ESHA 3M1EA 2ZXJA 2DI3A 4KT6A 3OSFA 1FYLA 1DGRM 4XOTA 3K70C 1JJ8C 2AS5F 2W82A 1G8XA 2O03A 1J09A 4E7ZA 2ZB9A 1B8IA 3FXMA 3ZP5A 1HQCA 3JW4A 3V4GA 3ZQLA 2EA2A 2QKMB 2K85A 2QM3A 1SC7A 3JRHA 1TQIA 2W00A 2EFWA 1H8AC 2UXXA 5CPRB 2GLOA 3P9IA 4II3A 1WHUA 4IRHA 4UUVA 2O6GE 2VJ4A 3K4MA 2LFBA 1HCRA 4CZCA 1K78B 3R6SA 3MWMA 5ERIA 2OAZA 5E3OA 3CMYA 3OYMA 2JA5J 2RDPA 2V9PA 2KKOA 2KRCA 5TISC 5F64A 2Y0SA 4BEHA 1KGSA 1D1AA 2H6BA 2R5YB 1LPQA 1VQPI 3H5RA 2LSOA 4I98B 3Q0UA 3I3LA 2PX9A 4LITA 5FLMJ 4EJWA 2QA4I 5DUKA 2KJBA 3PSFA 2TRTA 2GXGA 2LVSA 5LRSA 2R92J 3OL4A 3H35A 3HKZN 4OIPF 4EQQA 4XRSA 2O8KA 4XOPA 1BI2A 1LNWA 4KFCA 3V8JA 2QBYB 1J7KA 3F9KA 1S72I 3G3ZA 3FK6A 3OMYA 2B63J 2CUFA 2H8RA 1TWHJ 5IYBJ 4B47A 1OYWA 4BJ5C 4YRVA 3N05A 1WH7A 1R5ID 2V4JC 2YU3A 1FSHA 2OTJI 3KZYA 3F0CA 1YRNB 1OFCX 3GFLA 1G3TA 2ZXIA 2MLKA 2RNGA 2XKOA 2EK5A 1FOYA 5CQEA 3IV5A 2ZXWH 3OYCA 1HW2A 3DLLF 2XGEA 2DT6A 4XLEA 3K2ZA 1LFUP 3CP2A 1R1UA 2VQGA 5EEAA 1FWZA 2KMUA 1TNTA 2XF6A 2H6CA 1ZLKA 2KLOA 3CJQB 3K4LA 2JRMA 3CCQI 2BVMA 2KL4A 5E8IA 3BJOA 2XPWA 3SDBA 5LHIA 2F5CA 2P4WA 4FTHA 3W2WA 1HBXG 2UUZA 2NVYJ 4D0PA 3BZCA 4M71A 4M3EA 1GXQA 2NS0A 3PNTA 5FO5A 2CW0F 1HF0A 2BZTA 5K7FA 3BTLA 2R7DA 1FEXA 1CF7B 4OIOF 1BM9A 4XL9A 3BTJA 2NS8A 1D8KA 1U3EM 1MKMA 4ZYAA 2IRFG 3ZN1A 1A36A 1WJAA 2K9QA 2JPCA 3GXOA 4IVNA 5GAHJ 5EDNA 1FTTA 2HVRA 4NQWA 2KHMA 1V4RA 1Z67A 2VONA 4F55A 2ZC2A 3N97A 3GTGJ 2UXNA 3K70D 1ULYA 4XLAA 1BOAA 3PIOF 2IBDA 2DQLA 2HWVA 2EB7A 2CJJA 3AG1H 1MBGA 3JRIA 3JRAA 1TT0A 4H0EA 3E6DA 1J9IA 3S3MA 3RYRA 1I1SA 1TWAJ 3CUQB 3WU2C 1ON2A 3DPLC 1RUNA 4CYCA 3RKQA 1WPKA 3C2GA 3RI4A 3IRQA 1JTYA 2W85A 1LEAA 3QYBA 2IVMA 2GM4A 1SD5A 5KAIC 5IT9Z 1MJAA 2MLGA 2R7VA 2VBYA 1LVAA 3GCMA 2Z99A 2Y75A 1BR4A 2PMHA 4CH7A 4OOIA 1WZ2A 1YG2A 3ZCOA 4KMFA 3NAUA 4XLFA 2R4GA 2HFHA 2EV0A 2HTJA 3QU6A 4U0YA 3OS2A 4U0WA 3W6KB 2ZSHB 1H89C 3ABMH 1SVLA 4IHTA 1ZGAA 4Y7NJ 2V6EA 3ELKA 2BEOA 4L5IA 5JI6A 4I2OA 3HSFA 3P5JA 3J81Z 1UAAA 1ZLJA 4E7KA 4V19K 3V8KA 4DW6A 4CDGA 3RDIA 3VYSB 2BXZA 3Q5FA 1P6RA 2FQ4A 2MG4A 4I0BA 5GAGJ 4PSXA 1P4AA 4BY7J 3LAPA 3MD2A 2VOOA 1NG6A 3T5XA 1YHQI 2HQNA 5D8LB 4XLNF 2LREA 3E6BA 4I01A 1WKMA 1XGMA 3HRMA 2KIQA 5LRRA 2HOTA 5FGMA 1BBYA 2EFPA 1E2XA 4CGZA 4CCLA 1H88C 4BBRJ 1A6IA 1XGNA 2GA1A 3R0JA 2ISYA 3EUHC 3KPHA 2YX7A 4HLYA 3M8FA 1MNDA 3BG3A 3G1OA 2DO7A 3KZZA 1IAWA 1ZN2A 1TTYA 5J3LA 2NOJB 2M87A 2GOXB 2PMUA 4JQFA 4F91B 2Y0MA 2ZMEB 5GPCA 3ABTA 2JSPA 2VT2A 1AKHA 2KRFA 2IGOA 4BQOA 1T33A 3Q9SA 2LDUA 3A1YA 1HLVA 1Z91A 3FKIJ 1SVOA 2BOLA 4MTDA 4M72A 3GX4X 2JK3A 2V6CA 2LKSA 4X1EA 2EQRA 2DCEA 4AIKA 3S1RJ 2B0LA 3TP3A 3JAMK 2KZVA 1HKTA 1P4WA 1ERDA 1WVRA 3HHGA 3JRFA 4N9HA 2JRTA 1VQKI 1VQ5I 2R7XA 4R79A 2QSHX 1K6OA 4KICA 4WX9A 4KUMA 1MDMB 2VUMJ 5DUIA 2MD5A 5HOOA 2O3FA 5F0FA 4JX6A 3O6BB 1BR1A 4M3FA 4XLHA 4N4NB 4UNOA 4E70A 2DOAA 1BIAA 1XGSA 2PFBA 2ZO4A 2MH9A 3ESWB 3GTKJ 1WJ5A 2BY1A 2Z16A 4PJ0C 4D5FA 3OYAA 1T38A 4GXOA 5H6QA 3GFJA 3R0AA 3WG7H 1HKQA 1OCTC 2GQQA 4X6AJ 1X1DA 1TQPA 1K6YA 4G12A 4CCMA 5KK1A 4O6JA 2DMNA 2KP6A 3DU5A 4F3QA 2DMQA 3QRFF 3N4MA 3GTOJ 1RNLA 2VODA 2BY0A 1FPQA 2YS9A 4FQGA 2XUBA 4XKWA 2EIJH 1T8IA 5ILVA 3L2VA 4HZFA 1K78A 1N78A 2HKOA 3GFMA 5DDGA 3L9FA 1ETYA 1F4KA 3CUQC 1Y0NA 1ZG1A 2E5NA 1WQ2A 2JWTA 5L3CA 4ASNA 2R5YA 1LJ9A 3GTPJ 2BW3B 4U88A 2ELJA 3DLAA 4RB3C 3D1NI 2BHYA 4BXFA 4A2UA 3I54A 1NH3A 3SEQA 5C4JJ 1XC5A 4N9IA 2I8DA 1IO2A 3I5UA 2L0KA 4ENJA 3DKWA 3M4OJ 4UV8A 1OISA 4ZZLA 3V42A 1NHAA 3BR3A 2Y9ZA 1KA8A 1RC9A 3LSGA 2M8GX 1F5TA 1YO5C 3EUHA 2BXYA 1NK2P 5LBQA 2OJED 2QBYA 1Q1VA 1IV6A 4HQMA 2RVCA 2AQFA 3F8BA 3BT9A 3FM5A 3WTTC 5K1YA 1TL8A 2M4KA 3RIRA 1C0WA 5LD2C 3SDGA 3EYYA 3MKWB 5C44J 3CP8A 1RETA 4HDUA 3MCZA 3LSPA 2JA8J 2MSYA 3OS0A 3F6OA 1XG1A 1Z9CA 2A05A 2TDXA 3IH2A 4CCNA 2DMTA 1A5JA 1R1VA 5FKKA 2HR3A 2L7FP 1O3TA 3S32A 4HAMA 2M7BA 2Y2ZA 3PFYA 4B09A 3CCJI 1E3OC 1Z3YA 2VIXA 3C1DA 4BEHB 4V2GA 1OR7C 4DZJA 2P81A 2XASA 1SVMA 3BZ6A 3PL8A 2TCTA 1K4TA 1YIJI 2NRAC 3A0BC 5E17F 1X19A 5FFXA 3HYIA 4RGSA 1SD6A 4C3HJ 2ZMEC 3JSOA 1GV5A 3MZYA 1MNMC 3K4JA 1FP2A 1S7OA 1SFOJ 1D3YA 2DMPA 1PP8F 2A6EF 1CF7A 1USTA 1Z1DA 3VFZA 3F8NA 1ONVA 3DTIA 1HW1A 5HVQC 4F7ZA 2HVQA 5FKOA 4E4HA 3J7ZI 4PUSA 1YW9A 4LLGF 3JRDA 2ZJPF 2CFOA 5L3BA 4M9XA 3VDXA 3S2DJ 4M74A 3H0DA 2HQ5A 1RRJA 5L3GA 4EM0B 1IC8A 1FIPA 1EJ9A 3HL2A 1FIAA 3HPHA 3VYTB 2LF7A 3OYIA 3CUQA 4BYYA 4FETA 4O5VA 4CHUA 1ZRFA 5F1JA 4PJNA 3BR5A 2P5LC 4W1UA 5IPAA 4BDZA 1TNSA 4I0AA 2JA2A 4IHWA 2XIGA 2Y9YA 3ZQIA 1IN6A 2NVXJ 3SYTA 1UJ8A 4XMYA 3L7WA 1E0EA 3MFKA 3AAFA 1YLFA 5ICCA 2L7ZA 4GYIA 1RR8C 1S8NA 3W3CA 2OQRA 4W97A 1FT9A 3MEXA 1SFEA 5DV5A 4C3IJ 3WU1B 2KISA 2ID3A 2CW8A 4XBFA 1YX5A 2VJJA 1LDKB 2XDVA 2FE3A 2NNNA 5L3DA 2EFQA 3IUOA 3OYBA 4IEJA 5EJCA 1SMYF 3TEDA 1N25A 3IHUA 5J4VA 3EETA 2DA1A 1F43A 1TBXA 5J6XA 4ESFA 4IO9F 5EF6A 2F4MB 2E1CA 3LFUA 2BGCA 4NC7A 3FF5A 2K3PA 3E5UA 5JLWA 3PFIA 4XRMA 3IKVA 4BBSJ 3S14J 4Y3OA 2KRHA 3S3OA 3CF5F 1WJDA 4ZYDA 5IP9J 4XKCA 2R7TA 3MQ0A 3WE3A 1YFHA 4M9SA 1XSVA 2PEXA 2VQLA 1OR7A 3GTMJ 1BC8C 3TO6A 3I55I 3H9GA 1ZAOA 4IHSA 1FBQA 4OMYA 2R7WA 1IRGA 2HPIA 3KYCB 3OYDA 1K4SA 5IT3A 5AIQA 3KYLA 4V2FA 2ZMEA 4LB5A 1U6GA 1EA3A 5EGOB 1UG2A 3PUBA 1XGOA 1UHSA 1MBFA 1S6LA 2RQPA 1OPCA 2CQNA 2VLAA 2NVTJ 3RPQA 1JT6A 2X6OA 3I0TA 3K0LA 2XGDA 2KT0A 1STZA 2WAQN 4XNFA 3LSHA 4LK0F 1OJLA 2XF7A 4ZDLA 4ZJZA 3K4CA 5JHFA 2GXBA 4AD9A 4L18B 1HDDC 1VQNI 3HKZA 2MA3A 1RPWA 2DYRH 3BOQA 2CQ7A 1I3AA 1P9QC 3MKYB 1MNEA 5EZGA 4L9TA 5JR3A 3CLQA 1G2HA 1IDYA 2LYCA 2QQBA 2QSGX 1TC3C 1MDMA 2IXSA 2WB1N 2GAUA 5H20A 1R6RA 2AXTC 3OIPA 2DK8A 1IG7A 3ZMUA 5E1WA 2OCCH 4AC0A 5FRNA 2CQKA 5AIPA 3JAMZ 4L0ZB 1ZTRA 4HRIA 1M1EB 3ZMTA 3K2AA 5BS6A 1MMSA 2FBKA 1J75A 1T95A 4JBAA 3BP8A 3GF2A 3I4MJ 2DTZA 1LKXA 2HDWA 2LRDA 1K79A 3CESA 3HSEA 2XB0X 2HU9A 3M8EA 2KPMA 4GRIA 2K86A 4MO7A 2D5VA 2OTLI 1E3PA 2F5VA 5EG0B 3OR2C 2O9LA 5J1RA 1Y1WJ 5KNLA 1XN7A 2A69F 1RIOH 2V1DA 2HGCA 3QP5A 4CSWA 4A3IJ 1U78A 3RTRA 2VKVA 3E0JB 2BW3A 2HTSA 1MBKA 3C3WA 2IS1A 3BPXA 2O61A 1Z0XA 4K2EA 3QWLA 2NAZA 3ZQQA 1JI8A 2VBWA 2GIVA 3E7LA 1QVTA 1BJZA 3K4KA 2QZ8A 3QYEA 3ZMVA 2JUGA 3ZXSA 2CV2A 2M5WA 3GO5A 2VQCA 4HSTA 2GBYA 2Z1DA 2QEXI 4C30A 2VJIA 2GOMA 3GLLA 2WA0A 3HTSB 2VASA 2BE5F 3D5SC 3K69A 3L09A 4OAZA 2HZDA 4TV7A 1Z6TA 3AG3H 1UMQA 5LEKA 3PM1A 3U1DA 2I5UA 1IDZA 1R9TJ 1YS6A 2KIFA 3G2BA 2Y30A 2GA2A 1TWFJ 1X4OA 4D5CA 2FD5A 3F72A 4MNUA 5JVTA 3F8MA 3I58A 1FNNA 4XLPF 1P7IA 2JPBA 1B1BA 2NNYA 3U1KA 1W0TA 2OZUA 1WFXA 4AIJA 2W48A 1VNDA 2R7ZJ 5ICEA 1FOXA 2EIKH 4BJ6C 2XAQA 2VPRA 2LC2A 5GP9A 4RS8A 1A35A 1ORKA 1DUXC 3KZIC 4YFKF 4RB1A 3LSRA 5D8KB 4U87A 4UV9A 3W2AA 2DQRA 4GGGA 4BHPA 4XIDA 1IUFA 2DJIA 2JSCA 2K3FA 1P4XA 3ABUA 3M9AA 3ZQ7A 2FMLA 2ZBKA 4FX0A 5F1RA 1ON1A 4GDFA 2A61A 2ZKZA 3OS1A 1V55H 1RR7A 4XSXF 1UG0A 3MVPA 3ZRGA 5EZHA 4EMSA 4S0HB 1I5ZA 4MFDA 5HNHA 4NHJA 4I6ZA 3ONQA 3TW6A 5GADJ 1YOVB 1GV2A 2K9NA 3CCRI 2E1OA 4RLQA 2QWWA 4WXDA 1JKPC 3RKYA 4F93B 2YSRA 2VL8A 5J40A 1SD7A 4CO8A 3KX2A 3I59B 4P5OA 4G6TB 5DTDA 3CC2I 2XKPA 4B1RA 1MMAA 1R4NB 4G7HF 2D45A 4Z2YA 3IWZA 3HUGB 1IXRC 4Y33A 1DP7P 3CLOA 1XX5A 3CZ6A 5LGNA 2ISZA 1QPIA 2KQRA 4ETSA 5FLXK 3VOEA 4A3FJ 5DYMA 4LB6B 2M4GA 3VSLA 3I53A 4A3CJ 3I4NJ 3IL2A 4KN4X 3F8CA 1UHWA 4KYWA 1WJFA 3BWGA 3J7YJ 2L9NA 2DA2A 5IOZA 4J01A 4YG2F 4RB2C 2CUJA 5E3LA 1JGSA 3G4SI 2C6YA 3OOPA 3MZ8A 4BQAA 4A93J 1PJRA 1B9NA 1ZELA 3ZN0A 1LVKA 2DU9A 1Z21A 3CTAA 4LIVA 2Q8KA 4A3MJ 2Z9OA 2XF5A 5FRMA 3OOUA 5J8CA 2XAUA 5D4RA 3ZMZA 1OCRH 2LBFB 1O4XA 1KU3A 3B02A 3K6GA 5M5WJ 3PNYA 2CFXA 3DFGA 2STWA 3KFWX 2FEZA 3GMEA 3E5QA 1QU3A 1SFUA 1FJLA 1XSXA 2DYSH 3BG6A 1XCBA 3EPZA 4UUSB 3LSKA 1Y1VJ 2UV1A 2H1KA 1BI3A 2E7WA 3T0YA 2JT1A 2RKHA 4IF4A 1A04A 3RQIA 4ZYHA 1QO0D 3TDUC 2QQAA 3MMYB 4HSRA 2E1NA 2MC3A 3K4BA 2CV0A 4OIQF 2LY9A 3FM3A 3S8PA 2VJ5A 4PGGA 3AG2H 1WJCA 2CH0A 3GZ5A 3R61A 3TQNA 4EATA 3OYLA 3AG4H 4L5EA 1KU9A 1O57A 1S29A 1MBJA 2ZXHA 1HOMA 4I02A 5EGOA 5BQTA 2XC7A 4EGZA 2OBPA 2A6TA 4N4OB 1X3ZB 4IHXA 4XRSG 5K5OA 1VF9A 2F5DA 5F27A 4NC6A 4YEJA 5D6EA 1VQ7I 4KJZA 3S16J 4EGYA 2YUSA 3CUOA 3D5LA 4ESBA 3BR1A 1W5SA 4C9YA 3NWTA 1MJBA 1QBJA 1QRYA 2DODA 3LSMA 4RGUA 5E3NA 2M3AA 4A3GJ 3E97A 4RLFA 1W1WE 1VQLI 2E34A 4MEYF 4ZH4F 1X1AA 5FFZA 4YFNF 3FXQA 2BYVE 5EEGA 2JJ7A 4WXCA 3VB2A 4L9NA 1MZBA 1EH7A 3KP4A 5E3MA 3MKZA 2HOEA 1YW8A 2K9LA 3HG9A 1NTCA 3IP4B 3DPTA 3GZNB 1BR2A 3WGHA 2QSFX 1XTAA 1BIBA 3BY6A 1DU0A 3WG9A 3J80Z 3GTJJ 1XSDA 3OY9A 5KCMA 4HF0A 1ZH5A 4XQFA 1DPUA 3IH4A 2FOKA 4ZTJA 2P7CB 5EG0A 4Q47A 1POGA 4U0VA 2LH9A 3HXLA 2UWMA 1PYVA 4XN0A 5D4SA 2GZWA 2LLKA 3WTVC 1RZ4A 4MEXF 3U21A 2A6HF 2NS7A 4Y13A 1LUJB 1EH8A 2JVGA 3HRUA 3FWEA 2COMA 1K61A 2DOEA 4O3MA 3GW2A 4DIQA 1MBHA 1YW7A 2MGQA 4KIBA 3E5XA 4IRIA 4R1HA 4RAFA 4LOCA 3FDYA 2H8WA 2QF7A 2IP2A 3TMOA 3PQKA 3X2QH 4DBRA 2YPRA 4PFOA 2DFHA 3BROA 5DM7F 3V7RA 1D8JA 3ASOH 1FTZA 5FJ8J 2F48A 2WY8Q 2XPUA 3HOZJ 2J5OA 5KVRA 3HEFA 2XROA 5B1BH 2HPMA 3F22A 3OIOA 4ENMA 4D7MA 4ON0A 3I64A 3KP3A 2ID6A 1PUFB 2GIZA 1LDDA 1T0FC 1P2FA 3CCYA 2X4HA 3FMRA 2YR2A 4PSWA 3JTGA 2STTA 1IRZA 5L3FA 5B1AH 1BN5A 5B3SH 1YJ9I 1XDUA 5HS8A 2IEKA 1IF1A 3DU6A 4OU0A 3HJEA 3NQOA 4JYKA 4F92B 3CCVI 3ZPLA 2X48A 1JUMA 1KQ0A 5HODA 1VQMI 2MW8A 3Q9VA 4BUPA 2ZNZA 4EJOA 2L4AA 2E35A 3CO6C 1IJWC 1R1TA 3VYRB 2P6TA 4XLCA 2RNJA 2FA5A 2KIMA 2H1LA 1PP7U 3E6CC 2K5CA 4B48A 2MYSA 3LWFA 3M7GA 1AWCA 3OYGA 1Z3XA 4GCVA 2ETHA 2QCOA 3F21A 1WRJA 2RGVA 3FZVA 3CDLA 2FMYA 4G7ZF 1YTYA 1ITYA 1USSA 4AVPA 2DAOA 3BG7A 1S3JA 1MMGA 3CCSI 2ECCA 2IT0A 3EQLF 2L9RA 4PDKA 1WJEA 2R7OA 3H3ZA 3WHBA 3K1MA 3I59A 1AU7A 2P5VA 1RKWA 2VBXA 1LEBA 1OYIA 5B5EC 3QPHA 4EEFG 3REOA 2XPVA 2HQRA 3BCBA 4QPOA 3JREA 3CCUI 4UXNA 3GEZA 3GVAA 2FBIA 3HUGA 4RM2A 3VYUB 4C2MJ 1JTXA 3BR0A 1D0XA 4HNVA 3L2QA 4BH9A 1SMTA 3DKYA 5CYVA 1U5TB 2PJRA 2A07F 2HYJA 3D0SA 4MGRA 3TGNA 3F3XA 2BY2A 2A5WA 2MD0A 5CLSA 3SFIA 3A01B 1E3HA 2IGNA 2P6SA 1ETXA 2MFZA 2XRLA 2DN0A 1R23A 2XV4S 1JHHA 2M2EA 3LQRA 1KQ8A 1B59A 4BS9A 2WAQA 3A02A 5FKMA 1GUUA 2QVOA 3G71I 4HF2A 5EYRA 2LR8A 2DFEA 3HIFA 1FOKA 1QHHD 3AL0B 4DYQA 2AO9A 4A0YA 3T8TA 4PK4A 4ZDPA 1J2XA 5F0HA 3ERED 4ZTFA 3VWBA 3BC8A 2DK5A 2ELKA 3SFZA 4BNCA 2K40A 3RPUA 3NRVA 2LBFA 1QVUA 3UKGA 2L4MA 4QSHA 1T0FA 4KISA 2FXAA 3HM5A 2CW7A 2WB1A 4D7NA 2R7SA 2XSDC 4M3GA 2EWNA 3CC4I 2QQ8A 1R4MB 3KETA 3VEPA 4IX7A 1PUEE 1AOYA 1ZYRF 1VQ8I 2R7QA 3TKYA
chains in the Genus database with same CATH topology
1HW5A 1YS7A 5E1XA 5CVRA 3CO7C 2QUFA 3V7CA 3FX3A 2DTRA 1BJAA 1UCRA 5K5QA 1FX7A 2FQ3A 4B8XA 1O7LA 3BPVA 4LGWA 1IN5A 4RAZA 1SD4A 1KYWA 2XHKA 4U7DA 4QLCU 2IPQX 3RKWA 2ACJA 1BI1A 1J5YA 5HS7A 3EYIA 3GWZA 4LD5A 3SHFA 5BMZA 2K7LA 5HDNA 1TQMA 2L54A 4FX4A 2VOPA 1WI9A 2VE8A 3ZMDA 1G3SA 2BBYA 3RKXA 3COAC 3WTWC 4G7OF 2V1XA 5TJJA 2EV6A 4A6EA 3IKTA 5TRDA 4Q5SF 2XAJA 1D5VA 3HOSA 1UB9A 2XAGA 3T1BA 1B4AA 3KEQA 5LHHA 5IT9K 1WWXA 2OU2A 4M9ZA 5HS9A 3VODA 3DXJF 2HZTA 5DD8A 2QQ9A 3LQQA 1H0MA 4A0XA 3DP7A 1HSTA 1U5TC 2NYXA 1XCVA 1G6NA 3F6VA 2DBBA 5CVUA 2FNPA 3J81K 4PGHA 1FY7A 5HDGA 1F9NA 1XD7A 2ADUA 2FU4A 1FZPB 2IJLA 1T98A 2R7FA 2VN2A 4MQ9F 3IC7A 3FMSA 4PCQA 5CVIA 4BHCA 1L3LA 3KCCA 4Y17A 4CYDA 1FBUA 2D1HA 3RYPA 3WTZA 5CVJA 1FC3A 1S7AA 1ZRDA 4R8HA 5K5RA 2LKPA 2G7UA 3U2RA 3V7SA 2XVCA 3MAJA 1LDJA 4IPAA 3QAHA 4WWCA 3ISPA 3FMQA 3TOBA 5DCMB 3KP2A 3TO9A 1H9GA 4ZZDA 2PI0A 2M1BA 1F1ZA 4OMZA 3R4KA 5A2QK 1I27A 5LGUA 2FSWA 4LG0B 4NB5A 2Z33A 1XMKA 2IA1A 4IJAA 1L0OC 1JE8A 1JHFA 4BXUA 1JXSA 4L9JA 5DEQA 2PBIA 1TW3A 1OKRA 4HBLA 5D5VB 4A0ZA 5JHUA 2ZFWA 4UVAA 2VC1A 4HQEA 4N0BA 2ELHA 5BOXA 3KP6A 1HXDA 2EV5A 2WWYA 4XRFA 4EV0A 1GVJA 4GO1A 1LQ1A 4G6QA 1R7JA 3KP5A 4EVIA 4KMUX 3HTUA 4ZYEA 1EV7A 1U5TA 3ECHA 4HX8A 5E18F 4MTEA 2PN6A 1EH6A 3SZPA 3CJNA 3B73A 1T6SA 2WV0A 3WTXC 4G94A 2DLLA 3FXUA 3QP6A 1HKSA 3HRSA 4G9YA 5BPIA 2HDCA 3KEOA 2MBFA 2DW4A 2HEOA 1DPRA 4KIFA 4YIIA 1Z6RA 2OD5A 2RC4A 4LFUA 1U2WA 3P9KA 5DD4A 1G4DA 4DQ2A 1YYVA 3C18A 3SXYA 2VT3A 1FLIA 4I09A 1UHMA 1ZARA 4EM1A 2ZCWA 2A5YB 3J7AO 3KE2A 3DF8A 5LGTA 2DFIA 1W7PB 5LEJA 2XGXA 4I7HA 1B6AA 3HRTA 4MQVA 5AONA 2LF8A 2FF4A 4Q48A 1R5HA 3MZHA 1ZHFA 1IUYA 3JSPA 1RUOA 1O3QA 1G3YA 4HA8A 4ESJA 3WGIA 2DPUA 1DDNA 5J8FA 2KJCA 4EJUA 1ZG3A 4IXAA 5D5XB 1KU2A 5FD5A 1KU7A 1V3FA 3DV8A 3KLNA 2ESNA 1OMIA 1P92A 1R22A 1E17A 3L00A 2OZ6A 1K7AA 3ULQB 2D2WA 4AWXB 2K27A 4LMYA 2CSOA 1FBSA 3BDDA 4G6DA 2F5FA 3LSTA 5E1ZB 3GFIA 2VC0A 3BJAA 2QENA 5LHGA 3O2PE 1HSJA 1TLHB 2PLYA 4KA4A 4A6DA 2V9VA 3F23A 3TDZC 1J59A 1MD0A 4KIGA 2K4JA 1ZREA 4UHTA 2M8EA 4M6YA 3HOTA 3DQVC 4UVCA 4LJZF 4P96A 1WSUA 2M30A 3I71A 3F8FA 2H09A 5ICFA 4P9FA 2K4BA 2EA4A 1XB4A 4YIFA 2L3DA 3EDPA 3W6JB 1IXCA 3T8RA 5DCMA 2K02A 2H94A 3G73A 1BI0A 2E7XA 4KDPA 2IA2A 2Z3YA 3E6MA 5ILUA 5D6FA 4EJVA 2HYGD 1IXSB 3WU0A 3E3VA 5HLGA 4LG0A 1ZG5A 2P8TA 2V1UA 1IRFA 4Q4ZF 2BV6A 1QZYA 4RAYA 4HOBA 4P9UA 4RGXA 4FT8A 2D1VA 2L01A 5A2QZ 1KQ9A 2PQ8A 3K1NA 3U9GA 4EM2A 2HS5A 2A68F 2V79A 1J0RA 2WC2A 4Y15A 1QPMA 4L5JA 1IN8A 3ECOA 5CJ9A 3SQNA 4WXHA 1R5GA 5FB2A 1ZGJA 2GWRA 4CICA 2IW5A 4LLNA 2F2EA 2P7VB 4GYGA 1Y0UA 1FYMA 1UFMA 2R3SA 1IW7F 3R60A 5FD6A 1BC7C 1Z05A 5D5WB 4BAYA 1RI7A 2P5KA 3WTSC 1KYZA 4WCGA 3GLXA 3C7JA 1QQIA 4A5NA 2ZNYA 5HLHA 4G8XA 3GYHX 4HF1A 3P7NA 4ZYGA 1U8RA 3K9TA 3GUDA 2A3SA 2JTVA 1IN7A 1I1GA 1YQAA 2X0LA 2FNAA 1TW2A 2O8XA 1XDSA 4U7BA 5E20A 4L0YB 2PJPA 2VXZA 2WTEA 5CVVA 2J5PA 1W7PA 4LLLA 2CGPA 1SFXA 3WGGA 2H27A 6PAXA 4XSZF 1MJ9A 5E8GA 5EEHA 4HX4A 4M6XA 3DEUA 3LFKA 1W7PD 4OINF 5F6FA 2EFOA 2W57A 3WODF 3GZ6A 2YX4A 3FXRA 3LA3A 1R58A 4HV5A 1Z7UA 3KLOA 4WF2A 2L02A 2RN7A 2OA4A 4AIHA 5FLXZ 3V8LA 1YIOA 2W25A 5ICGA 3HSRA 2XAHA 3S2WA 3LAJA 4CZZA 1FP1D 2ZJ2A 2PG4A 1B9MA 1IZ1A 3WE2A 5H6RA 2FBHA 2VE9A 1OYYA 2QLZA 1ZRCA 1IN4A 3L2CA 1W4MA 3BJ6A 3ML6A 3TO7A 4HV6A 4RB0A 3QOPA 3CDHA 2Y48A 1W5TA 4PZJA 5ILSA 5JFRA 1QNTA 4MHGA 2OQGA 1REPC 2G7HA 4IRGA 3OV8A 4OIRF 4S05A 3LA7A 2DT5A 2KIUA 2AXLA 1XMAA 4HYEA 2XRNA 1O7FA 2QYOA 4FHTA 3H3UA 3FHZA 2DPDA 2JZYA 4YFXF 2RV8A 4HW0A 3QPTA 3LA2A 1H9TA 4S04A 2EJRA 4KNYA 1QZZA 1QGPA 3SZTA 2G9WA 4KN7X 4ENNA 1FYKA 2IA0A 4RGRA 4P55A 1FSEA 2Z5UA 1Q1HA 2M45A 4A12A 3RJPA 1LB2A 2LNBA 4BHBA 2F5EA 4HX7A 1R00A 4EJTA 1MGTA 5D5UB 4QWQA 2Q2EA 5HDKA 3P9CA 4ENKA 4WK8F 4UVBA 3WTUC 2W24A 1SAXA 1O3SA 1VTNC 2MH2A 1R36A 4LK1F 3QU3A 1ODDA 2XAFA 4KT5C 1O3RA 3I4PA 3H92A 4CXFA 3TOAA 3J80K 1G3WA 5L3EA 1T2KA 2EFNA 2VBZA 3O3KA 2Q0OA 1X3UA 3JTHA 3NEUA 1GXPA 3PQJA 2HKXA 4DNCA 4L9VA 4JK1X 2CO5A 2UZKA 1T39A 4HLXA 2CG4A 2CWEA 3IRRA 3KP7A 5BPDA 2O0YA 5LLQA 5DCFA 3ZMSA 3ROUA 2FRHA 4A5MA 1I6XA 3IWFA 5HLIA 3HHHA 3WTYC 4M73A 4HDVA 1PDNC 1CGPA 1GHCA 3K1PA 2W84A 2HYFA 2CYYA 5ED4A 2ESHA 3M1EA 2ZXJA 2DI3A 1FYLA 2AS5F 2O03A 3ZP5A 1HQCA 3JW4A 3V4GA 2EA2A 2QM3A 1TQIA 2EFWA 2UXXA 3P9IA 4IRHA 4UUVA 2O6GE 1K78B 3R6SA 3MWMA 5ERIA 2OAZA 2RDPA 2KKOA 5F64A 1KGSA 2H6BA 2LSOA 4I98B 4EJWA 5DUKA 2KJBA 2GXGA 5LRSA 4OIPF 4EQQA 1BI2A 1LNWA 4KFCA 3V8JA 2QBYB 1J7KA 3G3ZA 1OYWA 2YU3A 1FSHA 3KZYA 3GFLA 1G3TA 2MLKA 2XKOA 2EK5A 1HW2A 3K2ZA 1R1UA 1FWZA 1TNTA 2H6CA 1ZLKA 5E8IA 3BJOA 5LHIA 2F5CA 2P4WA 1HBXG 4D0PA 4M71A 1GXQA 2NS0A 5FO5A 2CW0F 2R7DA 1CF7B 4OIOF 1BM9A 1D8KA 1U3EM 1MKMA 2IRFG 3ZN1A 2JPCA 3GXOA 4IVNA 4NQWA 1V4RA 2VONA 3N97A 2UXNA 1ULYA 1BOAA 2DQLA 2HWVA 2EB7A 4H0EA 3E6DA 1J9IA 3RYRA 1I1SA 3CUQB 1ON2A 3DPLC 1RUNA 3RI4A 3IRQA 2W85A 1LEAA 2IVMA 1SD5A 5IT9Z 1MJAA 2MLGA 2VBYA 1LVAA 2Z99A 2Y75A 2PMHA 4OOIA 1YG2A 4KMFA 2HFHA 2EV0A 2HTJA 3QU6A 4U0YA 4U0WA 3W6KB 4IHTA 1ZGAA 3ELKA 2BEOA 4L5IA 5JI6A 4I2OA 3HSFA 3J81Z 1ZLJA 3V8KA 4CDGA 3RDIA 3Q5FA 1P6RA 4I0BA 1P4AA 3LAPA 2VOOA 3T5XA 2HQNA 5D8LB 4XLNF 3E6BA 4I01A 1WKMA 1XGMA 3HRMA 5LRRA 5FGMA 1BBYA 2EFPA 1E2XA 4CGZA 1XGNA 2GA1A 3R0JA 2ISYA 2YX7A 4HLYA 3M8FA 2DO7A 3KZZA 1IAWA 1ZN2A 1TTYA 2M87A 2PMUA 4JQFA 2Y0MA 2ZMEB 3ABTA 2VT2A 2KRFA 3Q9SA 2LDUA 1Z91A 4MTDA 4M72A 3GX4X 2V6CA 4AIKA 2B0LA 3JAMK 1HKTA 1P4WA 3HHGA 4N9HA 2JRTA 4R79A 1K6OA 4KICA 4WX9A 4KUMA 1MDMB 5DUIA 2MD5A 5HOOA 2O3FA 3O6BB 4UNOA 4E70A 1BIAA 1XGSA 2PFBA 2ZO4A 2MH9A 1T38A 4GXOA 5H6QA 3GFJA 3R0AA 1HKQA 2GQQA 1TQPA 5KK1A 4O6JA 3QRFF 3N4MA 1RNLA 2VODA 1FPQA 2XUBA 5ILVA 4HZFA 1K78A 2HKOA 3GFMA 5DDGA 3L9FA 1F4KA 3CUQC 1ZG1A 1WQ2A 5L3CA 4ASNA 1LJ9A 4U88A 4RB3C 4A2UA 3I54A 4N9IA 3I5UA 4ENJA 3DKWA 4UV8A 4ZZLA 1NHAA 1KA8A 1F5TA 1YO5C 3EUHA 5LBQA 2QBYA 4HQMA 2RVCA 3F8BA 3FM5A 3WTTC 5K1YA 3RIRA 1C0WA 3EYYA 4HDUA 3MCZA 3F6OA 1Z9CA 2TDXA 1R1VA 2HR3A 1O3TA 4HAMA 4B09A 3C1DA 2XASA 3BZ6A 2NRAC 5E17F 5FFXA 3HYIA 4RGSA 1SD6A 3JSOA 3MZYA 1FP2A 1S7OA 1D3YA 1PP8F 2A6EF 1CF7A 1USTA 1Z1DA 3VFZA 3F8NA 1ONVA 1HW1A 5HVQC 4F7ZA 1YW9A 4LLGF 5L3BA 4M9XA 4M74A 5L3GA 4EM0B 2LF7A 3CUQA 4BYYA 4O5VA 4CHUA 1ZRFA 2P5LC 1TNSA 4I0AA 2XIGA 1IN6A 3L7WA 3MFKA 3AAFA 1YLFA 5ICCA 4GYIA 1S8NA 2OQRA 1FT9A 3MEXA 1SFEA 5DV5A 3WU1B 4XBFA 1LDKB 5L3DA 2FE3A 2NNNA 2EFQA 1SMYF 3IHUA 3EETA 1TBXA 5J6XA 4ESFA 2E1CA 2BGCA 3FF5A 3E5UA 3PFIA 3IKVA 4ZYDA 3MQ0A 3WE3A 1YFHA 4M9SA 1XSVA 2PEXA 1OR7A 1BC8C 3TO6A 1ZAOA 4IHSA 1FBQA 4OMYA 1IRGA 5IT3A 5AIQA 2ZMEA 4LB5A 1U6GA 1XGOA 1S6LA 2RQPA 1OPCA 3RPQA 3K0LA 3I0TA 1STZA 4LK0F 2GXBA 4AD9A 4L18B 2MA3A 3BOQA 4L9TA 5JR3A 2QQBA 1MDMA 2GAUA 5H20A 2DK8A 3ZMUA 5E1WA 2CQKA 5AIPA 3JAMZ 4L0ZB 3ZMTA 5BS6A 2FBKA 1J75A 4JBAA 3BP8A 3GF2A 1K79A 3HSEA 3M8EA 2K86A 1XN7A 2A69F 1RIOH 2V1DA 2HGCA 3QP5A 1U78A 3RTRA 2HTSA 3C3WA 3BPXA 2O61A 4K2EA 2NAZA 2VBWA 2GIVA 2QZ8A 3ZMVA 2M5WA 3GO5A 3HTSB 2BE5F 3K69A 3L09A 4TV7A 1Z6TA 5LEKA 3U1DA 1YS6A 2KIFA 2GA2A 3F72A 4MNUA 5JVTA 3F8MA 3I58A 1FNNA 4XLPF 2JPBA 1B1BA 2NNYA 2OZUA 4AIJA 5ICEA 2XAQA 4RS8A 1DUXC 4YFKF 4RB1A 5D8KB 4UV9A 2DQRA 4GGGA 4BHPA 2JSCA 1P4XA 3ABUA 3M9AA 3ZQ7A 2FMLA 2ZBKA 4FX0A 5F1RA 1ON1A 2A61A 2ZKZA 4XSXF 4EMSA 1I5ZA 4NHJA 2QWWA 4WXDA 3RKYA 2YSRA 1SD7A 4CO8A 3I59B 4P5OA 2XKPA 4G7HF 2D45A 4Z2YA 3IWZA 1IXRC 1DP7P 3CLOA 5LGNA 2ISZA 4ETSA 5FLXK 3VOEA 5DYMA 4LB6B 3I53A 3IL2A 4KN4X 3F8CA 1UHWA 4KYWA 3BWGA 4YG2F 4RB2C 2C6YA 1JGSA 3OOPA 4BQAA 1B9NA 3ZN0A 2DU9A 2Z9OA 3CTAA 2Q8KA 5J8CA 5D4RA 3ZMZA 1KU3A 3B02A 2CFXA 3DFGA 2STWA 3KFWX 2FEZA 3E5QA 1SFUA 1XSXA 1XCBA 1BI3A 2E7WA 3T0YA 2JT1A 2RKHA 4IF4A 1A04A 4ZYHA 1QO0D 3TDUC 2QQAA 2E1NA 2MC3A 4OIQF 3FM3A 4PGGA 3R61A 3GZ5A 3TQNA 1KU9A 1O57A 1S29A 4I02A 5BQTA 4EGZA 2OBPA 5K5OA 2F5DA 5D6EA 4EGYA 3CUOA 3D5LA 4ESBA 1W5SA 1QBJA 1MJBA 4RGUA 3E97A 4MEYF 4ZH4F 5FFZA 4YFNF 3FXQA 2BYVE 5EEGA 4WXCA 3VB2A 4L9NA 1MZBA 1EH7A 3KP4A 2HOEA 1YW8A 3DPTA 3WGHA 1BIBA 3BY6A 3WG9A 3J80Z 1XSDA 4HF0A 1ZH5A 1DPUA 2FOKA 2P7CB 4Q47A 4U0VA 2UWMA 5D4SA 2GZWA 3WTVC 1RZ4A 4MEXF 2A6HF 4Y13A 1EH8A 3HRUA 3FWEA 2COMA 4O3MA 3GW2A 1YW7A 4KIBA 3E5XA 4IRIA 4R1HA 2IP2A 3PQKA 2YPRA 3BROA 3V7RA 1D8JA 2J5OA 5KVRA 2XROA 3F22A 4ENMA 4ON0A 3I64A 3KP3A 1LDDA 1P2FA 2X4HA 3FMRA 2YR2A 3JTGA 2STTA 5L3FA 1BN5A 1XDUA 5HS8A 1IF1A 4OU0A 3NQOA 3ZPLA 1KQ0A 3Q9VA 2ZNZA 4EJOA 2L4AA 3CO6C 1R1TA 2P6TA 2RNJA 2FA5A 2KIMA 1PP7U 3E6CC 3LWFA 3M7GA 1AWCA 4GCVA 2ETHA 3F21A 1WRJA 2RGVA 3FZVA 4G7ZF 2FMYA 1YTYA 1USSA 4AVPA 2DAOA 1S3JA 2IT0A 3EQLF 4PDKA 3H3ZA 3K1MA 3I59A 2P5VA 2VBXA 1LEBA 1OYIA 3QPHA 3REOA 2HQRA 4UXNA 3GEZA 3GVAA 2FBIA 3HUGA 4BH9A 1SMTA 5CYVA 1U5TB 2A07F 3D0SA 4MGRA 3TGNA 3F3XA 5CLSA 2P6SA 1R23A 2XV4S 1JHHA 1KQ8A 3LQRA 1B59A 2QVOA 4HF2A 3HIFA 1FOKA 4A0YA 3T8TA 1J2XA 3ERED 2DK5A 3SFZA 4BNCA 3RPUA 3NRVA 2L4MA 1T0FA 2FXAA 2EWNA 1PUEE 3KETA 3VEPA 1AOYA 1ZYRF 3TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW5 A;  1YS7 A;  5E1X A;  5CVR A;  3CO7 C;  2QUF A;  3V7C A;  3FX3 A;  2DTR A;  1BJA A;  1UCR A;  5K5Q A;  1FX7 A;  2FQ3 A;  4B8X A;  1O7L A;  3BPV A;  4LGW A;  1IN5 A;  4RAZ A;  1SD4 A;  1KYW A;  2XHK A;  4U7D A;  4QLC U;  2IPQ X;  3RKW A;  2ACJ A;  1BI1 A;  1J5Y A;  5HS7 A;  3EYI A;  3GWZ A;  4LD5 A;  3SHF A;  5BMZ A;  2K7L A;  5HDN A;  1TQM A;  2L54 A;  4FX4 A;  2VOP A;  1WI9 A;  2VE8 A;  3ZMD A;  1G3S A;  2BBY A;  3RKX A;  3COA C;  3WTW C;  4G7O F;  2V1X A;  5TJJ A;  2EV6 A;  4A6E A;  3IKT A;  5TRD A;  4Q5S F;  2XAJ A;  1D5V A;  3HOS A;  1UB9 A;  2XAG A;  3T1B A;  1B4A A;  3KEQ A;  5LHH A;  5IT9 K;  1WWX A;  2OU2 A;  4M9Z A;  5HS9 A;  3VOD A;  3DXJ F;  2HZT A;  5DD8 A;  2QQ9 A;  3LQQ A;  1H0M A;  4A0X A;  3DP7 A;  1HST A;  1U5T C;  2NYX A;  1XCV A;  1G6N A;  3F6V A;  2DBB A;  5CVU A;  2FNP A;  3J81 K;  4PGH A;  1FY7 A;  5HDG A;  1F9N A;  1XD7 A;  2ADU A;  2FU4 A;  1FZP B;  2IJL A;  1T98 A;  2R7F A;  2VN2 A;  4MQ9 F;  3IC7 A;  3FMS A;  4PCQ A;  5CVI A;  4BHC A;  1L3L A;  3KCC A;  4Y17 A;  4CYD A;  1FBU A;  2D1H A;  3RYP A;  3WTZ A;  5CVJ A;  1FC3 A;  1S7A A;  1ZRD A;  4R8H A;  5K5R A;  2LKP A;  2G7U A;  3U2R A;  3V7S A;  2XVC A;  3MAJ A;  1LDJ A;  4IPA A;  3QAH A;  4WWC A;  3ISP A;  3FMQ A;  3TOB A;  5DCM B;  3KP2 A;  3TO9 A;  1H9G A;  4ZZD A;  2PI0 A;  2M1B A;  1F1Z A;  4OMZ A;  3R4K A;  5A2Q K;  1I27 A;  5LGU A;  2FSW A;  4LG0 B;  4NB5 A;  2Z33 A;  1XMK A;  2IA1 A;  4IJA A;  1L0O C;  1JE8 A;  1JHF A;  4BXU A;  1JXS A;  4L9J A;  5DEQ A;  2PBI A;  1TW3 A;  1OKR A;  4HBL A;  5D5V B;  4A0Z A;  5JHU A;  2ZFW A;  4UVA A;  2VC1 A;  4HQE A;  4N0B A;  2ELH A;  5BOX A;  3KP6 A;  1HXD A;  2EV5 A;  2WWY A;  4XRF A;  4EV0 A;  1GVJ A;  4GO1 A;  1LQ1 A;  4G6Q A;  1R7J A;  3KP5 A;  4EVI A;  4KMU X;  3HTU A;  4ZYE A;  1EV7 A;  1U5T A;  3ECH A;  4HX8 A;  5E18 F;  4MTE A;  2PN6 A;  1EH6 A;  3SZP A;  3CJN A;  3B73 A;  1T6S A;  2WV0 A;  3WTX C;  4G94 A;  2DLL A;  3FXU A;  3QP6 A;  1HKS A;  3HRS A;  4G9Y A;  5BPI A;  2HDC A;  3KEO A;  2MBF A;  2DW4 A;  2HEO A;  1DPR A;  4KIF A;  4YII A;  1Z6R A;  2OD5 A;  2RC4 A;  4LFU A;  1U2W A;  3P9K A;  5DD4 A;  1G4D A;  4DQ2 A;  1YYV A;  3C18 A;  3SXY A;  2VT3 A;  1FLI A;  4I09 A;  1UHM A;  1ZAR A;  4EM1 A;  2ZCW A;  2A5Y B;  3J7A O;  3KE2 A;  3DF8 A;  5LGT A;  2DFI A;  1W7P B;  5LEJ A;  2XGX A;  4I7H A;  1B6A A;  3HRT A;  4MQV A;  5AON A;  2LF8 A;  2FF4 A;  4Q48 A;  1R5H A;  3MZH A;  1ZHF A;  1IUY A;  3JSP A;  1RUO A;  1O3Q A;  1G3Y A;  4HA8 A;  4ESJ A;  3WGI A;  2DPU A;  1DDN A;  5J8F A;  2KJC A;  4EJU A;  1ZG3 A;  4IXA A;  5D5X B;  1KU2 A;  5FD5 A;  1KU7 A;  1V3F A;  3DV8 A;  3KLN A;  2ESN A;  1OMI A;  1P92 A;  1R22 A;  1E17 A;  3L00 A;  2OZ6 A;  1K7A A;  3ULQ B;  2D2W A;  4AWX B;  2K27 A;  4LMY A;  2CSO A;  1FBS A;  3BDD A;  4G6D A;  2F5F A;  3LST A;  5E1Z B;  3GFI A;  2VC0 A;  3BJA A;  2QEN A;  5LHG A;  3O2P E;  1HSJ A;  1TLH B;  2PLY A;  4KA4 A;  4A6D A;  2V9V A;  3F23 A;  3TDZ C;  1J59 A;  1MD0 A;  4KIG A;  2K4J A;  1ZRE A;  4UHT A;  2M8E A;  4M6Y A;  3HOT A;  3DQV C;  4UVC A;  4LJZ F;  4P96 A;  1WSU A;  2M30 A;  3I71 A;  3F8F A;  2H09 A;  5ICF A;  4P9F A;  2K4B A;  2EA4 A;  1XB4 A;  4YIF A;  2L3D A;  3EDP A;  3W6J B;  1IXC A;  3T8R A;  5DCM A;  2K02 A;  2H94 A;  3G73 A;  1BI0 A;  2E7X A;  4KDP A;  2IA2 A;  2Z3Y A;  3E6M A;  5ILU A;  5D6F A;  4EJV A;  2HYG D;  1IXS B;  3WU0 A;  3E3V A;  5HLG A;  4LG0 A;  1ZG5 A;  2P8T A;  2V1U A;  1IRF A;  4Q4Z F;  2BV6 A;  1QZY A;  4RAY A;  4HOB A;  4P9U A;  4RGX A;  4FT8 A;  2D1V A;  2L01 A;  5A2Q Z;  1KQ9 A;  2PQ8 A;  3K1N A;  3U9G A;  4EM2 A;  2HS5 A;  2A68 F;  2V79 A;  1J0R A;  2WC2 A;  4Y15 A;  1QPM A;  4L5J A;  1IN8 A;  3ECO A;  5CJ9 A;  3SQN A;  4WXH A;  1R5G A;  5FB2 A;  1ZGJ A;  2GWR A;  4CIC A;  2IW5 A;  4LLN A;  2F2E A;  2P7V B;  4GYG A;  1Y0U A;  1FYM A;  1UFM A;  2R3S A;  1IW7 F;  3R60 A;  5FD6 A;  1BC7 C;  1Z05 A;  5D5W B;  4BAY A;  1RI7 A;  2P5K A;  3WTS C;  1KYZ A;  4WCG A;  3GLX A;  3C7J A;  1QQI A;  4A5N A;  2ZNY A;  5HLH A;  4G8X A;  3GYH X;  4HF1 A;  3P7N A;  4ZYG A;  1U8R A;  3K9T A;  3GUD A;  2A3S A;  2JTV A;  1IN7 A;  1I1G A;  1YQA A;  2X0L A;  2FNA A;  1TW2 A;  2O8X A;  1XDS A;  4U7B A;  5E20 A;  4L0Y B;  2PJP A;  2VXZ A;  2WTE A;  5CVV A;  2J5P A;  1W7P A;  4LLL A;  2CGP A;  1SFX A;  3WGG A;  2H27 A;  6PAX A;  4XSZ F;  1MJ9 A;  5E8G A;  5EEH A;  4HX4 A;  4M6X A;  3DEU A;  3LFK A;  1W7P D;  4OIN F;  5F6F A;  2EFO A;  2W57 A;  3WOD F;  3GZ6 A;  2YX4 A;  3FXR A;  3LA3 A;  1R58 A;  4HV5 A;  1Z7U A;  3KLO A;  4WF2 A;  2L02 A;  2RN7 A;  2OA4 A;  4AIH A;  5FLX Z;  3V8L A;  1YIO A;  2W25 A;  5ICG A;  3HSR A;  2XAH A;  3S2W A;  3LAJ A;  4CZZ A;  1FP1 D;  2ZJ2 A;  2PG4 A;  1B9M A;  1IZ1 A;  3WE2 A;  5H6R A;  2FBH A;  2VE9 A;  1OYY A;  2QLZ A;  1ZRC A;  1IN4 A;  3L2C A;  1W4M A;  3BJ6 A;  3ML6 A;  3TO7 A;  4HV6 A;  4RB0 A;  3QOP A;  3CDH A;  2Y48 A;  1W5T A;  4PZJ A;  5ILS A;  5JFR A;  1QNT A;  4MHG A;  2OQG A;  1REP C;  2G7H A;  4IRG A;  3OV8 A;  4OIR F;  4S05 A;  3LA7 A;  2DT5 A;  2KIU A;  2AXL A;  1XMA A;  4HYE A;  2XRN A;  1O7F A;  2QYO A;  4FHT A;  3H3U A;  3FHZ A;  2DPD A;  2JZY A;  4YFX F;  2RV8 A;  4HW0 A;  3QPT A;  3LA2 A;  1H9T A;  4S04 A;  2EJR A;  4KNY A;  1QZZ A;  1QGP A;  3SZT A;  2G9W A;  4KN7 X;  4ENN A;  1FYK A;  2IA0 A;  4RGR A;  4P55 A;  1FSE A;  2Z5U A;  1Q1H A;  2M45 A;  4A12 A;  3RJP A;  1LB2 A;  2LNB A;  4BHB A;  2F5E A;  4HX7 A;  1R00 A;  4EJT A;  1MGT A;  5D5U B;  4QWQ A;  2Q2E A;  5HDK A;  3P9C A;  4ENK A;  4WK8 F;  4UVB A;  3WTU C;  2W24 A;  1SAX A;  1O3S A;  1VTN C;  2MH2 A;  1R36 A;  4LK1 F;  3QU3 A;  1ODD A;  2XAF A;  4KT5 C;  1O3R A;  3I4P A;  3H92 A;  4CXF A;  3TOA A;  3J80 K;  1G3W A;  5L3E A;  1T2K A;  2EFN A;  2VBZ A;  3O3K A;  2Q0O A;  1X3U A;  3JTH A;  3NEU A;  1GXP A;  3PQJ A;  2HKX A;  4DNC A;  4L9V A;  4JK1 X;  2CO5 A;  2UZK A;  1T39 A;  4HLX A;  2CG4 A;  2CWE A;  3IRR A;  3KP7 A;  5BPD A;  2O0Y A;  5LLQ A;  5DCF A;  3ZMS A;  3ROU A;  2FRH A;  4A5M A;  1I6X A;  3IWF A;  5HLI A;  3HHH A;  3WTY C;  4M73 A;  4HDV A;  1PDN C;  1CGP A;  1GHC A;  3K1P A;  2W84 A;  2HYF A;  2CYY A;  5ED4 A;  2ESH A;  3M1E A;  2ZXJ A;  2DI3 A;  1FYL A;  2AS5 F;  2O03 A;  3ZP5 A;  1HQC A;  3JW4 A;  3V4G A;  2EA2 A;  2QM3 A;  1TQI A;  2EFW A;  2UXX A;  3P9I A;  4IRH A;  4UUV A;  2O6G E;  1K78 B;  3R6S A;  3MWM A;  5ERI A;  2OAZ A;  2RDP A;  2KKO A;  5F64 A;  1KGS A;  2H6B A;  2LSO A;  4I98 B;  4EJW A;  5DUK A;  2KJB A;  2GXG A;  5LRS A;  4OIP F;  4EQQ A;  1BI2 A;  1LNW A;  4KFC A;  3V8J A;  2QBY B;  1J7K A;  3G3Z A;  1OYW A;  2YU3 A;  1FSH A;  3KZY A;  3GFL A;  1G3T A;  2MLK A;  2XKO A;  2EK5 A;  1HW2 A;  3K2Z A;  1R1U A;  1FWZ A;  1TNT A;  2H6C A;  1ZLK A;  5E8I A;  3BJO A;  5LHI A;  2F5C A;  2P4W A;  1HBX G;  4D0P A;  4M71 A;  1GXQ A;  2NS0 A;  5FO5 A;  2CW0 F;  2R7D A;  1CF7 B;  4OIO F;  1BM9 A;  1D8K A;  1U3E M;  1MKM A;  2IRF G;  3ZN1 A;  2JPC A;  3GXO A;  4IVN A;  4NQW A;  1V4R A;  2VON A;  3N97 A;  2UXN A;  1ULY A;  1BOA A;  2DQL A;  2HWV A;  2EB7 A;  4H0E A;  3E6D A;  1J9I A;  3RYR A;  1I1S A;  3CUQ B;  1ON2 A;  3DPL C;  1RUN A;  3RI4 A;  3IRQ A;  2W85 A;  1LEA A;  2IVM A;  1SD5 A;  5IT9 Z;  1MJA A;  2MLG A;  2VBY A;  1LVA A;  2Z99 A;  2Y75 A;  2PMH A;  4OOI A;  1YG2 A;  4KMF A;  2HFH A;  2EV0 A;  2HTJ A;  3QU6 A;  4U0Y A;  4U0W A;  3W6K B;  4IHT A;  1ZGA A;  3ELK A;  2BEO A;  4L5I A;  5JI6 A;  4I2O A;  3HSF A;  3J81 Z;  1ZLJ A;  3V8K A;  4CDG A;  3RDI A;  3Q5F A;  1P6R A;  4I0B A;  1P4A A;  3LAP A;  2VOO A;  3T5X A;  2HQN A;  5D8L B;  4XLN F;  3E6B A;  4I01 A;  1WKM A;  1XGM A;  3HRM A;  5LRR A;  5FGM A;  1BBY A;  2EFP A;  1E2X A;  4CGZ A;  1XGN A;  2GA1 A;  3R0J A;  2ISY A;  2YX7 A;  4HLY A;  3M8F A;  2DO7 A;  3KZZ A;  1IAW A;  1ZN2 A;  1TTY A;  2M87 A;  2PMU A;  4JQF A;  2Y0M A;  2ZME B;  3ABT A;  2VT2 A;  2KRF A;  3Q9S A;  2LDU A;  1Z91 A;  4MTD A;  4M72 A;  3GX4 X;  2V6C A;  4AIK A;  2B0L A;  3JAM K;  1HKT A;  1P4W A;  3HHG A;  4N9H A;  2JRT A;  4R79 A;  1K6O A;  4KIC A;  4WX9 A;  4KUM A;  1MDM B;  5DUI A;  2MD5 A;  5HOO A;  2O3F A;  3O6B B;  4UNO A;  4E70 A;  1BIA A;  1XGS A;  2PFB A;  2ZO4 A;  2MH9 A;  1T38 A;  4GXO A;  5H6Q A;  3GFJ A;  3R0A A;  1HKQ A;  2GQQ A;  1TQP A;  5KK1 A;  4O6J A;  3QRF F;  3N4M A;  1RNL A;  2VOD A;  1FPQ A;  2XUB A;  5ILV A;  4HZF A;  1K78 A;  2HKO A;  3GFM A;  5DDG A;  3L9F A;  1F4K A;  3CUQ C;  1ZG1 A;  1WQ2 A;  5L3C A;  4ASN A;  1LJ9 A;  4U88 A;  4RB3 C;  4A2U A;  3I54 A;  4N9I A;  3I5U A;  4ENJ A;  3DKW A;  4UV8 A;  4ZZL A;  1NHA A;  1KA8 A;  1F5T A;  1YO5 C;  3EUH A;  5LBQ A;  2QBY A;  4HQM A;  2RVC A;  3F8B A;  3FM5 A;  3WTT C;  5K1Y A;  3RIR A;  1C0W A;  3EYY A;  4HDU A;  3MCZ A;  3F6O A;  1Z9C A;  2TDX A;  1R1V A;  2HR3 A;  1O3T A;  4HAM A;  4B09 A;  3C1D A;  2XAS A;  3BZ6 A;  2NRA C;  5E17 F;  5FFX A;  3HYI A;  4RGS A;  1SD6 A;  3JSO A;  3MZY A;  1FP2 A;  1S7O A;  1D3Y A;  1PP8 F;  2A6E F;  1CF7 A;  1UST A;  1Z1D A;  3VFZ A;  3F8N A;  1ONV A;  1HW1 A;  5HVQ C;  4F7Z A;  1YW9 A;  4LLG F;  5L3B A;  4M9X A;  4M74 A;  5L3G A;  4EM0 B;  2LF7 A;  3CUQ A;  4BYY A;  4O5V A;  4CHU A;  1ZRF A;  2P5L C;  1TNS A;  4I0A A;  2XIG A;  1IN6 A;  3L7W A;  3MFK A;  3AAF A;  1YLF A;  5ICC A;  4GYI A;  1S8N A;  2OQR A;  1FT9 A;  3MEX A;  1SFE A;  5DV5 A;  3WU1 B;  4XBF A;  1LDK B;  5L3D A;  2FE3 A;  2NNN A;  2EFQ A;  1SMY F;  3IHU A;  3EET A;  1TBX A;  5J6X A;  4ESF A;  2E1C A;  2BGC A;  3FF5 A;  3E5U A;  3PFI A;  3IKV A;  4ZYD A;  3MQ0 A;  3WE3 A;  1YFH A;  4M9S A;  1XSV A;  2PEX A;  1OR7 A;  1BC8 C;  3TO6 A;  1ZAO A;  4IHS A;  1FBQ A;  4OMY A;  1IRG A;  5IT3 A;  5AIQ A;  2ZME A;  4LB5 A;  1U6G A;  1XGO A;  1S6L A;  2RQP A;  1OPC A;  3RPQ A;  3K0L A;  3I0T A;  1STZ A;  4LK0 F;  2GXB A;  4AD9 A;  4L18 B;  2MA3 A;  3BOQ A;  4L9T A;  5JR3 A;  2QQB A;  1MDM A;  2GAU A;  5H20 A;  2DK8 A;  3ZMU A;  5E1W A;  2CQK A;  5AIP A;  3JAM Z;  4L0Z B;  3ZMT A;  5BS6 A;  2FBK A;  1J75 A;  4JBA A;  3BP8 A;  3GF2 A;  1K79 A;  3HSE A;  3M8E A;  2K86 A;  1XN7 A;  2A69 F;  1RIO H;  2V1D A;  2HGC A;  3QP5 A;  1U78 A;  3RTR A;  2HTS A;  3C3W A;  3BPX A;  2O61 A;  4K2E A;  2NAZ A;  2VBW A;  2GIV A;  2QZ8 A;  3ZMV A;  2M5W A;  3GO5 A;  3HTS B;  2BE5 F;  3K69 A;  3L09 A;  4TV7 A;  1Z6T A;  5LEK A;  3U1D A;  1YS6 A;  2KIF A;  2GA2 A;  3F72 A;  4MNU A;  5JVT A;  3F8M A;  3I58 A;  1FNN A;  4XLP F;  2JPB A;  1B1B A;  2NNY A;  2OZU A;  4AIJ A;  5ICE A;  2XAQ A;  4RS8 A;  1DUX C;  4YFK F;  4RB1 A;  5D8K B;  4UV9 A;  2DQR A;  4GGG A;  4BHP A;  2JSC A;  1P4X A;  3ABU A;  3M9A A;  3ZQ7 A;  2FML A;  2ZBK A;  4FX0 A;  5F1R A;  1ON1 A;  2A61 A;  2ZKZ A;  4XSX F;  4EMS A;  1I5Z A;  4NHJ A;  2QWW A;  4WXD A;  3RKY A;  2YSR A;  1SD7 A;  4CO8 A;  3I59 B;  4P5O A;  2XKP A;  4G7H F;  2D45 A;  4Z2Y A;  3IWZ A;  1IXR C;  1DP7 P;  3CLO A;  5LGN A;  2ISZ A;  4ETS A;  5FLX K;  3VOE A;  5DYM A;  4LB6 B;  3I53 A;  3IL2 A;  4KN4 X;  3F8C A;  1UHW A;  4KYW A;  3BWG A;  4YG2 F;  4RB2 C;  2C6Y A;  1JGS A;  3OOP A;  4BQA A;  1B9N A;  3ZN0 A;  2DU9 A;  2Z9O A;  3CTA A;  2Q8K A;  5J8C A;  5D4R A;  3ZMZ A;  1KU3 A;  3B02 A;  2CFX A;  3DFG A;  2STW A;  3KFW X;  2FEZ A;  3E5Q A;  1SFU A;  1XSX A;  1XCB A;  1BI3 A;  2E7W A;  3T0Y A;  2JT1 A;  2RKH A;  4IF4 A;  1A04 A;  4ZYH A;  1QO0 D;  3TDU C;  2QQA A;  2E1N A;  2MC3 A;  4OIQ F;  3FM3 A;  4PGG A;  3R61 A;  3GZ5 A;  3TQN A;  1KU9 A;  1O57 A;  1S29 A;  4I02 A;  5BQT A;  4EGZ A;  2OBP A;  5K5O A;  2F5D A;  5D6E A;  4EGY A;  3CUO A;  3D5L A;  4ESB A;  1W5S A;  1QBJ A;  1MJB A;  4RGU A;  3E97 A;  4MEY F;  4ZH4 F;  5FFZ A;  4YFN F;  3FXQ A;  2BYV E;  5EEG A;  4WXC A;  3VB2 A;  4L9N A;  1MZB A;  1EH7 A;  3KP4 A;  2HOE A;  1YW8 A;  3DPT A;  3WGH A;  1BIB A;  3BY6 A;  3WG9 A;  3J80 Z;  1XSD A;  4HF0 A;  1ZH5 A;  1DPU A;  2FOK A;  2P7C B;  4Q47 A;  4U0V A;  2UWM A;  5D4S A;  2GZW A;  3WTV C;  1RZ4 A;  4MEX F;  2A6H F;  4Y13 A;  1EH8 A;  3HRU A;  3FWE A;  2COM A;  4O3M A;  3GW2 A;  1YW7 A;  4KIB A;  3E5X A;  4IRI A;  4R1H A;  2IP2 A;  3PQK A;  2YPR A;  3BRO A;  3V7R A;  1D8J A;  2J5O A;  5KVR A;  2XRO A;  3F22 A;  4ENM A;  4ON0 A;  3I64 A;  3KP3 A;  1LDD A;  1P2F A;  2X4H A;  3FMR A;  2YR2 A;  3JTG A;  2STT A;  5L3F A;  1BN5 A;  1XDU A;  5HS8 A;  1IF1 A;  4OU0 A;  3NQO A;  3ZPL A;  1KQ0 A;  3Q9V A;  2ZNZ A;  4EJO A;  2L4A A;  3CO6 C;  1R1T A;  2P6T A;  2RNJ A;  2FA5 A;  2KIM A;  1PP7 U;  3E6C C;  3LWF A;  3M7G A;  1AWC A;  4GCV A;  2ETH A;  3F21 A;  1WRJ A;  2RGV A;  3FZV A;  4G7Z F;  2FMY A;  1YTY A;  1USS A;  4AVP A;  2DAO A;  1S3J A;  2IT0 A;  3EQL F;  4PDK A;  3H3Z A;  3K1M A;  3I59 A;  2P5V A;  2VBX A;  1LEB A;  1OYI A;  3QPH A;  3REO A;  2HQR A;  4UXN A;  3GEZ A;  3GVA A;  2FBI A;  3HUG A;  4BH9 A;  1SMT A;  5CYV A;  1U5T B;  2A07 F;  3D0S A;  4MGR A;  3TGN A;  3F3X A;  5CLS A;  2P6S A;  1R23 A;  2XV4 S;  1JHH A;  1KQ8 A;  3LQR A;  1B59 A;  2QVO A;  4HF2 A;  3HIF A;  1FOK A;  4A0Y A;  3T8T A;  1J2X A;  3ERE D;  2DK5 A;  3SFZ A;  4BNC A;  3RPU A;  3NRV A;  2L4M A;  1T0F A;  2FXA A;  2EWN A;  1PUE E;  3KET A;  3VEP A;  1AOY A;  1ZYR F;  3TKY A; 
#chains in the Genus database with same CATH topology
 1HW5 A;  1YS7 A;  5E1X A;  4UY8 I;  5CVR A;  4A69 C;  5FLV A;  3CO7 C;  4UUS A;  5DM6 F;  2QUF A;  3CF2 A;  2E2J J;  9ANT A;  3V7C A;  3RPU D;  4AYB N;  3HDD A;  4JP0 A;  3FX3 A;  2EZH A;  2VXD A;  2DTR A;  1BJA A;  2RAE A;  3BQZ A;  1UCR A;  1GT0 C;  2RRE A;  4XK4 A;  2DA4 A;  1XPX A;  1SFK A;  5K5Q A;  3S2H J;  1Y56 A;  2HI3 A;  2L2O A;  1FX7 A;  1EF4 A;  4F52 A;  2FQ3 A;  4B4C A;  4B8X A;  4UB8 C;  1O7L A;  3BPV A;  4LGW A;  1IN5 A;  4RAZ A;  1SD4 A;  1YX3 A;  4YIR X;  1KYW A;  2XHK A;  3VPR A;  4U7D A;  4QLC U;  1R49 A;  2IPQ X;  3RKW A;  3FIW A;  5KHD A;  2ACJ A;  1BI1 A;  1WJB A;  1J5Y A;  5HS7 A;  5GPA A;  1V5G A;  3EYI A;  2R7U A;  3GWZ A;  4LD5 A;  4DOZ A;  3BZK A;  3SHF A;  1ZGW A;  3QYF A;  5BMZ A;  2K7L A;  5HDN A;  1AHD P;  1V5F A;  1TQM A;  2L54 A;  4FX4 A;  4ZDO A;  2VOP A;  1WI9 A;  2VE8 A;  2E19 A;  3ZMD A;  1JJ6 C;  3DBR B;  1G3S A;  2BBY A;  3RKX A;  3Q0V A;  3COA C;  3RSN A;  4FE4 A;  1JGG A;  3WTW C;  3ZOB A;  3LSI A;  1BOB A;  4G7O F;  2MAB A;  2R7R A;  2V1X A;  5TJJ A;  2EV6 A;  4FIS A;  4A6E A;  3IKT A;  5TRD A;  4Q5S F;  2XAJ A;  1D5V A;  3H1C A;  4KIT B;  3HOS A;  1UB9 A;  2XAG A;  5H2F C;  5IYD J;  1BL0 A;  2HXO A;  2X6W A;  3T1B A;  1B4A A;  4JX5 A;  2R0Q C;  3OYF A;  3KEQ A;  4B44 A;  5LHH A;  5IT9 K;  1VI0 A;  1JKR C;  1WWX A;  1Y6I A;  2OU2 A;  3OWT A;  4M9Z A;  5HS9 A;  3DTK A;  3HGY A;  3VOD A;  3DXJ F;  5GTI C;  2HZT A;  3BR2 A;  5DD8 A;  2IS6 A;  2QQ9 A;  2OPT A;  3FK7 A;  3LQQ A;  3NAR A;  1H0M A;  2E60 A;  4IKF A;  4DYR A;  4A0X A;  3DP7 A;  1HST A;  1U5T C;  2NYX A;  1XCV A;  1G6N A;  3F6V A;  2DBB A;  5CVU A;  4XN3 A;  2FNP A;  3J81 K;  3JRB A;  1ZQ3 P;  4PGH A;  1FY7 A;  5HDG A;  1F9N A;  1S9H A;  3S3N A;  1VQO I;  1SEU A;  2DXI A;  2JA6 J;  1XD7 A;  3AKZ A;  2ADU A;  2FU4 A;  1W36 D;  1FZP B;  3W6V A;  2F4O B;  2IJL A;  1T98 A;  2R7F A;  2VN2 A;  4MQ9 F;  3L2R A;  3IC7 A;  3FMS A;  4PCQ A;  5CVI A;  4BHC A;  1L3L A;  4M3B A;  3KCC A;  4Y17 A;  4CYD A;  5J1U A;  1FBU A;  2D1H A;  3CME I;  3RYP A;  1ETW A;  3WTZ A;  3PO2 J;  1WI3 A;  5CVJ A;  1FC3 A;  4ITV A;  3S93 A;  1S7A A;  2LK2 A;  4R8H A;  5K5R A;  1ZRD A;  2LKP A;  3AL0 C;  2G7U A;  3U2R A;  3LOC A;  3V7S A;  2XVC A;  3MAJ A;  1LDJ A;  2KDO A;  4IPA A;  3TP0 A;  2L9V A;  3QAH A;  4WWC A;  1HA8 A;  1PUF A;  3H0G J;  3ISP A;  3FMQ A;  1OCP A;  2FUG 2;  3TOB A;  5DCM B;  3KP2 A;  3TO9 A;  1H9G A;  4ZZD A;  2PI0 A;  2NVQ J;  2M1B A;  1F1Z A;  4OMZ A;  3R4K A;  5A2Q K;  3S1N J;  4HG2 A;  1I27 A;  2COB A;  1X58 A;  1B72 B;  5LGU A;  2FSW A;  3OYH A;  1IGN A;  4LG0 B;  4NB5 A;  2Z33 A;  4RMN A;  1XMK A;  2IA1 A;  4IJA A;  3A0H C;  1L0O C;  1JE8 A;  1JHF A;  4BXU A;  1JXS A;  2EIL H;  1T56 A;  4L9J A;  5DEQ A;  2W1O A;  2PBI A;  3BLY A;  2VB6 A;  2X85 A;  1BA5 A;  5HLT A;  1TW3 A;  1OKR A;  4HBL A;  5D5V B;  1UEL B;  5F08 A;  4A0Z A;  5JHU A;  2ZFW A;  4UVA A;  2VC1 A;  1JKQ C;  2M34 A;  5C4X J;  4HQE A;  4A3L J;  4N0B A;  2ELH A;  3FXJ A;  4LG3 A;  2EZK A;  1ENH A;  5BOX A;  3ZQG A;  3KP6 A;  1HXD A;  4IQ4 A;  1I3Q J;  4IQJ A;  3JCU C;  2F4I A;  2EV5 A;  2WWY A;  4XRF A;  4PJJ A;  5JLX A;  4D1Q A;  3E1S A;  3ZQC A;  4EV0 A;  1GVJ A;  4GO1 A;  1LQ1 A;  1X2N A;  4G6Q A;  1R7J A;  3KP5 A;  3GBG A;  4UB6 C;  4I99 C;  3DEE A;  1DQU A;  2K9S A;  4EVI A;  3I56 I;  2V1N A;  1D0Z A;  2M0C A;  3S1Q J;  4KMU X;  4I76 A;  3HTU A;  5BNG A;  4ZYE A;  1D1C A;  3HC7 A;  1LE8 B;  1EV7 A;  2JN6 A;  1U5T A;  3TL4 X;  3ECH A;  4HX8 A;  3I9V 2;  5E18 F;  4MTE A;  4CUG A;  5DS9 A;  4JX4 A;  2PN6 A;  1EH6 A;  2XGC A;  3SZP A;  4E7I A;  3CJN A;  5CQG A;  3A01 A;  3B73 A;  1T6S A;  2WV0 A;  4NBQ A;  1U9N A;  5J47 A;  4G94 A;  3WTX C;  2DLL A;  3FXU A;  3QP6 A;  2M9H A;  1HKS A;  2WAF A;  3HRS A;  4G9Y A;  5BPI A;  4BE1 A;  4E7S A;  2HDC A;  1VFC A;  3KEO A;  1ETO A;  2MBF A;  4BXX J;  2DW4 A;  2HEO A;  1DPR A;  1WH5 A;  1TZL A;  2LY2 A;  4KIF A;  4YII A;  1Z6R A;  2OD5 A;  2WBM A;  5B66 C;  3IAM 2;  2RC4 A;  4BL0 B;  4LFU A;  1U2W A;  3P9K A;  3M1C A;  5J1Y A;  5DD4 A;  4J00 A;  1G4D A;  4DQ2 A;  3RZO J;  2CUZ A;  1YYV A;  4LIU A;  3C18 A;  3OR1 C;  3SXY A;  3CC7 I;  2VT3 A;  1FLI A;  4I09 A;  1UHM A;  2PMZ N;  5M5X J;  3GTL J;  1ZAR A;  5HNF A;  4EM1 A;  2ZCW A;  2A5Y B;  3L2U A;  3J7A O;  3KE2 A;  3DF8 A;  5LGT A;  2DFI A;  3QPS A;  1W7P B;  5LEJ A;  2XB5 A;  3TW7 A;  1JUS A;  2XGX A;  4I7H A;  1B6A A;  3HRT A;  4DYC A;  4X0G A;  4MQV A;  2EIN H;  5AON A;  2ZJQ F;  2LF8 A;  4IOA F;  2FF4 A;  2W4S A;  2PJR B;  2OF7 A;  4RM3 A;  1MMN A;  4Q48 A;  1TT5 B;  1R5H A;  1T08 B;  3MZH A;  1ZHF A;  3RZD J;  5GTH C;  2DFF A;  1IUY A;  2CMP A;  3JSP A;  1W0U A;  2DOF A;  1RUO A;  1X2M A;  3VSK A;  1O3Q A;  1G3Y A;  3HB9 A;  4HA8 A;  4ESJ A;  3PUF A;  3WGI A;  3KEY A;  2DPU A;  1DDN A;  3SZG A;  3B6A A;  2HOA A;  3DTE A;  1N75 A;  3ZR8 X;  3C2B A;  5J8F A;  2KJC A;  3M07 A;  2EH3 A;  4EJU A;  2LOO A;  1ZG3 A;  3DPU A;  1YIT I;  1RES A;  4IXA A;  5D5X B;  1AA7 A;  1KU2 A;  5FD5 A;  1KU7 A;  1FOW A;  1A6Q A;  1V3F A;  3DV8 A;  3K4N A;  3KLN A;  4AVZ A;  3FHN A;  2ESN A;  1ETK A;  2E71 A;  2YU9 J;  2W7N A;  2O7O A;  1OMI A;  1P92 A;  1OQY A;  1R22 A;  1E17 A;  3DCF A;  1HC8 A;  3L00 A;  4Z6Y A;  2OZ6 A;  2CUE A;  2BY3 A;  4QTR A;  1K7A A;  3ULQ B;  3CCE I;  3GTQ J;  2LG4 A;  2D2W A;  4AWX B;  1ACI A;  2X6X A;  2K27 A;  4LMY A;  5K7H A;  2CSO A;  1FBS A;  3OL3 A;  3BDD A;  4G6D A;  2IS4 A;  3QOD A;  1IV8 A;  2LMD A;  5E79 C;  2F5F A;  3LST A;  5E1Z B;  4B43 A;  3ASN H;  3GFI A;  1DP3 A;  5FRO A;  2CQX A;  2VC0 A;  3BJA A;  2QEN A;  4XOR A;  1U8B A;  5LHG A;  4BE2 A;  2VKH A;  2JUC A;  3MKL A;  3O2P E;  4PJL A;  3EUK L;  1HSJ A;  1TLH B;  1V54 H;  2PLY A;  1D1B A;  3CDI A;  2R5Z B;  4KA4 A;  2JA7 J;  2WY7 Q;  4A6D A;  1A31 A;  1JKO C;  2V9V A;  3F23 A;  4ABZ A;  3TDZ C;  1X3W B;  3QOE A;  4CCO A;  1J59 A;  1MD0 A;  2EZI A;  4KIG A;  2K4J A;  1ZRE A;  4UHT A;  1YE9 A;  1I39 A;  4NUB A;  2R93 J;  2M8E A;  4M6Y A;  3HOT A;  2LP0 A;  3ERM A;  3DQV C;  1KZH A;  4UVC A;  3FXL A;  2WAD A;  2Y0S N;  5TGT A;  2V7F A;  4LJZ F;  4P96 A;  5M3F J;  3S1M J;  5IYC J;  1WSU A;  2M30 A;  4UUT A;  3I71 A;  3TBI A;  3CMA I;  2VQH A;  3F8F A;  3HOU J;  1TP4 A;  2H09 A;  5ICF A;  4BQN A;  4CA0 A;  1MSF C;  4P9F A;  2K4B A;  2EA4 A;  4NC8 A;  4MIM A;  5FKL A;  1XB4 A;  4YIF A;  2L3D A;  2OCE A;  3EDP A;  3W6J B;  2CV1 A;  1IXC A;  3T8R A;  5DCM A;  3WHC A;  2K02 A;  2H94 A;  4ANJ A;  1JT0 A;  5M5Y J;  3G73 A;  1BI0 A;  2E7X A;  4H4K C;  1N77 A;  4KDP A;  2IA2 A;  5JVG F;  3C2H A;  2QGU A;  2I10 A;  1OCO H;  1Y8Q B;  2Z3Y A;  3E6M A;  2L9S A;  2Q2E B;  3G6E I;  3CCL I;  5ILU A;  2ME0 A;  5D6F A;  1F36 A;  3FIS A;  3JRG A;  4A3B J;  4EJV A;  2HYG D;  1IXS B;  3WU0 A;  3E3V A;  1B72 A;  3EUA A;  5HLG A;  4LG0 A;  1ZG5 A;  4M6V A;  2P8T A;  1YJN I;  2DT7 B;  2V1U A;  2NOG A;  2F6C A;  1IRF A;  3A03 A;  4Q4Z F;  2BV6 A;  1QZY A;  4RAY A;  4HOB A;  1OLT A;  2IGM A;  4E6K G;  4QIW N;  1Y39 A;  2E36 A;  4B3X A;  4P9U A;  2VPL A;  4RGX A;  4FT8 A;  4DBQ A;  3MN2 A;  2D1V A;  2L01 A;  1KQ9 A;  2DA7 A;  2PQ8 A;  5A2Q Z;  2HDD A;  4GFB A;  3K1N A;  1X4P A;  3U9G A;  4EM2 A;  1LFB A;  2HS5 A;  2A68 F;  2RQQ A;  2GXA A;  3LMM A;  3JRC A;  2V79 A;  1J0R A;  2WC2 A;  4Y15 A;  1ETV A;  1QPM A;  4L5J A;  1IN8 A;  3ECO A;  5CJ9 A;  3SQN A;  3OYK A;  4RDU A;  2OUM A;  4WXH A;  3L2W A;  4Y4R A;  1R5G A;  5IP7 J;  1APL C;  5FB2 A;  1ZGJ A;  2GWR A;  4CIC A;  3ABK H;  2AQE A;  2IW5 A;  4AYB A;  5J4Y A;  3FXO A;  3CQZ J;  3OYE A;  4E7L A;  4PFP A;  4LLN A;  2F2E A;  1SAU A;  2CS3 A;  3K10 A;  2P7V B;  4GYG A;  3FBI B;  1LFP A;  1Y0U A;  4E7H A;  1FYM A;  5F0C A;  1MH3 A;  3AFH A;  2ZSI B;  1UFM A;  1D0Y A;  2R3S A;  2WV1 A;  1IW7 F;  3LL7 A;  1LE8 A;  3R60 A;  5FD6 A;  1BC7 C;  1Z05 A;  2Y69 H;  4BAY A;  1RI7 A;  5D5W B;  2P5K A;  1TWG J;  3WTS C;  4XKV A;  2NVU B;  2E5Z A;  1KYZ A;  4NDL A;  3LSJ A;  2DDA A;  4OWR B;  2QKL B;  4WCG A;  3GLX A;  3C7J A;  1QQI A;  3PJR A;  4A5N A;  4IHY A;  2HVS A;  3QPL A;  2ZNY A;  4P1W A;  5HLH A;  4G8X A;  3GYH X;  3H36 A;  4DZP A;  4FAS D;  1U9O A;  2M7A A;  4HF1 A;  2DJN A;  3P7N A;  4ZYG A;  1OCZ H;  4QPQ A;  1U8R A;  3K9T A;  3GUD A;  2A3S A;  2IGK A;  2LD5 A;  2JTV A;  1IN7 A;  4BY1 J;  4JOM A;  4BJT A;  3A2K A;  1I1G A;  1YQA A;  2X0L A;  2FNA A;  4IHV A;  3M8J A;  2ICW G;  1TW2 A;  2O8X A;  1X1B A;  5FKN A;  4AU7 A;  1XDS A;  2NXN B;  4U7B A;  3HOV J;  5E20 A;  2JQ7 A;  4L0Y B;  1SAN A;  3G1L A;  2X6Y A;  2PJP A;  2VXZ A;  4E7J A;  2WTE A;  5CVV A;  2DDB A;  2J5P A;  1EKE A;  1G59 A;  1W7P A;  1OCC H;  4LLL A;  2CGP A;  1SFX A;  2HQA A;  3CJT B;  3WGG A;  2H27 A;  5KAF C;  1MMD A;  3SEZ A;  6PAX A;  3H9Q A;  3FBN B;  4HPQ A;  4XSZ F;  4BDY A;  1MJ9 A;  4PJM A;  5E8G A;  3HOX J;  3IAS 2;  5F04 A;  1I6H J;  2MC4 A;  5EEH A;  4HX4 A;  4M6X A;  2HNH A;  3DEU A;  3LFK A;  1VZ0 A;  2FOW A;  1W7P D;  4OIN F;  1B8I B;  5F6F A;  2EFO A;  2W57 A;  3WOD F;  2VI6 A;  3UR3 C;  3RCO A;  4C3J J;  3JR9 A;  2M0M A;  3GZ6 A;  2YX4 A;  1CQT A;  1TWC J;  1YRN A;  3FXR A;  3LA3 A;  1R58 A;  4HV5 A;  4HEA 2;  1K83 J;  1Z7U A;  3KLO A;  4WF2 A;  2L02 A;  2RN7 A;  3CJR B;  2OA4 A;  3DBH B;  4A3K J;  1PVE A;  1MSE C;  4AIH A;  5FLX Z;  3V8L A;  2HXI A;  3BTC A;  1YIO A;  3CMM A;  2W25 A;  4YEL A;  1W36 C;  5ICG A;  2EIM H;  4AUX A;  3FKJ A;  3HGG A;  3HSR A;  3PSI A;  3ZQH A;  2XAH A;  5LFA A;  3S2W A;  3LAJ A;  4CZZ A;  1FP1 D;  4DGW B;  2ZJ2 A;  2PG4 A;  1B9M A;  1S5L C;  3Q0W A;  1IZ1 A;  4D9J A;  3WE2 A;  2WAE A;  5H6R A;  4XON A;  1NG7 A;  2FBH A;  1OYY A;  2O5R A;  3OIQ A;  2VE9 A;  2QLZ A;  3QQA A;  1QZE A;  3BG9 A;  3CCM I;  1R71 A;  1ZRC A;  1IN4 A;  3L2C A;  3DBL B;  2X1E A;  3Q3S A;  1W4M A;  1MH4 A;  3BJ6 A;  3ML6 A;  3D5R C;  4BAC A;  4A3J J;  3DWL E;  3TO7 A;  4HV6 A;  4RB0 A;  3KIO A;  3QOP A;  3CDH A;  5C3E J;  2V9K A;  2Y48 A;  1W5T A;  3J7A Y;  4PZJ A;  1MBE A;  1GLN A;  1QNT A;  5ILS A;  5JFR A;  1NK3 P;  2X1C A;  2X1D A;  2ECB A;  2EZL A;  1S7E A;  4MHG A;  2OQG A;  3M3Y J;  1REP C;  4BGD A;  2G7H A;  4BKX A;  2IS2 A;  1W5C C;  2DA5 A;  2Q1Z B;  2OV7 A;  2EPF A;  4C2T A;  4IRG A;  3OV8 A;  4OIR F;  3LA7 A;  4S05 A;  4FCY A;  2DT5 A;  2G0E A;  2R5Z A;  2K9M A;  2KIU A;  2AXL A;  1XMA A;  4HYE A;  2XRN A;  2L7K A;  1O7F A;  2E1M B;  2FJ1 A;  2QYO A;  3NWS A;  1X1P A;  4FHT A;  2ZJR F;  3ABL H;  4RA2 A;  3ZGK A;  2Z2S B;  3H3U A;  3FHZ A;  4IZZ A;  2JZY A;  2DPD A;  4XKB A;  2KDZ A;  1KON A;  2RV8 A;  4HW0 A;  4YFX F;  2JVH A;  3QPT A;  3HOW J;  3LA2 A;  1H9T A;  4S04 A;  3H3V K;  2EJR A;  4KNY A;  2IAI A;  3O8H A;  5CKT A;  1QZZ A;  1QGP A;  2DA3 A;  3H9J A;  3RQ4 A;  3SZT A;  2G9W A;  4KN7 X;  4ENN A;  1P7J A;  1GVD A;  1FYK A;  2IA0 A;  4RGR A;  4P55 A;  2BVL A;  1FSE A;  1Z7L A;  1FMW A;  2LKX A;  3BQY A;  2Z5U A;  1YI2 I;  1Q1H A;  3BG5 A;  4RAG A;  3HOY J;  4A3D J;  3L1P A;  3DEW A;  2M45 A;  3G1M A;  4A12 A;  2DA6 A;  3PNV A;  3RJP A;  4BU2 A;  4XIC A;  4Y52 J;  4NQW B;  2FX0 A;  2LNB A;  2ME6 A;  2X51 A;  1LB2 A;  4C2U A;  4IOC F;  2X9D A;  5M3M J;  4BHB A;  2F5E A;  4HX7 A;  4J19 A;  1R00 A;  4EJT A;  1MGT A;  5D5U B;  3CD6 I;  1ZKG A;  4QWQ A;  2Q2E A;  4IL6 C;  3P9C A;  5HDK A;  1ZR2 A;  4HNT A;  4XM3 A;  4ENK A;  3BCA A;  4CYC B;  2KFD A;  4WK8 F;  4UVB A;  3WTU C;  1HDP A;  2W24 A;  2VKD A;  2L5Q A;  3K7A J;  1Y8R B;  1DU6 A;  1SAX A;  1O3S A;  2EBI A;  1VTN C;  2LTP A;  2MH2 A;  1R36 A;  3OSG A;  1ETQ A;  4LK1 F;  2BHZ A;  2JMW A;  4B3A A;  3QU3 A;  2CRG A;  1ODD A;  3BR6 A;  4ZC3 A;  2HOS A;  1YJW I;  2XAF A;  4KT5 C;  4HNU A;  4AM3 A;  1O3R A;  2AHQ A;  3I4P A;  3W2V A;  3HBL A;  1WGX A;  2PMZ A;  1DGW Y;  2DMU A;  1V5E A;  2B7E A;  3H92 A;  5IP6 A;  4CXF A;  3ZQF A;  3B6C A;  2CQQ A;  3O8G A;  3TOA A;  3OYJ A;  3UNG C;  2KZG A;  1ZK8 A;  2OC6 A;  3A4C A;  2CU7 A;  3J80 K;  1G3W A;  4BE0 A;  4NNJ A;  2VKE A;  5L3E A;  3OYN A;  1T2K A;  2EFN A;  2VBZ A;  1BW6 A;  3PO3 J;  3O3K A;  4BQQ A;  2Q0O A;  2L7M P;  1ZR4 A;  1X3U A;  3JTH A;  3NEU A;  1GXP A;  4FE7 A;  3PQJ A;  1D5Y A;  3BTI A;  2HKX A;  1FMV A;  1I50 J;  4OAY A;  1MW7 A;  4XR6 A;  2V26 A;  4DNC A;  1WCM J;  4MLO A;  4L9V A;  1VQ9 I;  4JK1 X;  1Z77 A;  2CO5 A;  2E2H J;  2UZK A;  1JUP A;  1T39 A;  1VQ4 I;  4CCK A;  4HLX A;  2CG4 A;  4II2 A;  1XS9 A;  3DKX A;  2N8G A;  2CWE A;  3IH3 A;  2E2I J;  5IOY A;  3IRR A;  3HPG A;  1IRX A;  1AKH B;  3KP7 A;  5BPD A;  1QHG A;  1UZC A;  1GDT A;  5GAE J;  4DJA A;  2B9S A;  2O0Y A;  5LLQ A;  2Y31 A;  4AID A;  4A3E J;  1BW5 A;  2XSJ C;  2LY1 A;  5DCF A;  3ZMS A;  3SJM A;  3ROU A;  1MIJ A;  1U0J A;  1X1C A;  2E1M C;  2FRH A;  2ZFU A;  4A5M A;  1XMX A;  1RKT A;  4CCJ A;  1I6X A;  3IWF A;  5HLI A;  3PIP F;  3H5N A;  5K7Z A;  4M3D A;  3H5A A;  3HHH A;  3WTY C;  4MFE A;  3HZJ A;  5IY5 H;  4M73 A;  4HDV A;  3S15 J;  1VQ6 I;  3FXK A;  1PDN C;  4RBO A;  2P0W A;  1CGP A;  1GHC A;  3LNQ A;  3K1P A;  2W84 A;  3KYD B;  2HYF A;  2CYY A;  5ED4 A;  1QA6 A;  3S17 J;  2ESH A;  3M1E A;  2ZXJ A;  2DI3 A;  4KT6 A;  3OSF A;  1FYL A;  1DGR M;  4XOT A;  3K70 C;  1JJ8 C;  2AS5 F;  2W82 A;  1G8X A;  2O03 A;  1J09 A;  4E7Z A;  2ZB9 A;  1B8I A;  3FXM A;  3ZP5 A;  1HQC A;  3JW4 A;  3V4G A;  3ZQL A;  2EA2 A;  2QKM B;  2K85 A;  2QM3 A;  1SC7 A;  3JRH A;  1TQI A;  2W00 A;  2EFW A;  1H8A C;  2UXX A;  5CPR B;  2GLO A;  3P9I A;  4II3 A;  1WHU A;  4IRH A;  4UUV A;  2O6G E;  2VJ4 A;  3K4M A;  2LFB A;  1HCR A;  4CZC A;  1K78 B;  3R6S A;  3MWM A;  5ERI A;  2OAZ A;  5E3O A;  3CMY A;  3OYM A;  2JA5 J;  2RDP A;  2V9P A;  2KKO A;  2KRC A;  5TIS C;  5F64 A;  2Y0S A;  4BEH A;  1KGS A;  1D1A A;  2H6B A;  2R5Y B;  1LPQ A;  1VQP I;  3H5R A;  2LSO A;  4I98 B;  3Q0U A;  3I3L A;  2PX9 A;  4LIT A;  5FLM J;  4EJW A;  2QA4 I;  5DUK A;  2KJB A;  3PSF A;  2TRT A;  2GXG A;  2LVS A;  5LRS A;  2R92 J;  3OL4 A;  3H35 A;  3HKZ N;  4OIP F;  4EQQ A;  4XRS A;  2O8K A;  4XOP A;  1BI2 A;  1LNW A;  4KFC A;  3V8J A;  2QBY B;  1J7K A;  3F9K A;  1S72 I;  3G3Z A;  3FK6 A;  3OMY A;  2B63 J;  2CUF A;  2H8R A;  1TWH J;  5IYB J;  4B47 A;  1OYW A;  4BJ5 C;  4YRV A;  3N05 A;  1WH7 A;  1R5I D;  2V4J C;  2YU3 A;  1FSH A;  2OTJ I;  3KZY A;  3F0C A;  1YRN B;  1OFC X;  3GFL A;  1G3T A;  2ZXI A;  2MLK A;  2RNG A;  2XKO A;  2EK5 A;  1FOY A;  5CQE A;  3IV5 A;  2ZXW H;  3OYC A;  1HW2 A;  3DLL F;  2XGE A;  2DT6 A;  4XLE A;  3K2Z A;  1LFU P;  3CP2 A;  1R1U A;  2VQG A;  5EEA A;  1FWZ A;  2KMU A;  1TNT A;  2XF6 A;  2H6C A;  1ZLK A;  2KLO A;  3CJQ B;  3K4L A;  2JRM A;  3CCQ I;  2BVM A;  2KL4 A;  5E8I A;  3BJO A;  2XPW A;  3SDB A;  5LHI A;  2F5C A;  2P4W A;  4FTH A;  3W2W A;  1HBX G;  2UUZ A;  2NVY J;  4D0P A;  3BZC A;  4M71 A;  4M3E A;  1GXQ A;  2NS0 A;  3PNT A;  5FO5 A;  2CW0 F;  1HF0 A;  2BZT A;  5K7F A;  3BTL A;  2R7D A;  1FEX A;  1CF7 B;  4OIO F;  1BM9 A;  4XL9 A;  3BTJ A;  2NS8 A;  1D8K A;  1U3E M;  1MKM A;  4ZYA A;  2IRF G;  3ZN1 A;  1A36 A;  1WJA A;  2K9Q A;  2JPC A;  3GXO A;  4IVN A;  5GAH J;  5EDN A;  1FTT A;  2HVR A;  4NQW A;  2KHM A;  1V4R A;  1Z67 A;  2VON A;  4F55 A;  2ZC2 A;  3N97 A;  3GTG J;  2UXN A;  3K70 D;  1ULY A;  4XLA A;  1BOA A;  3PIO F;  2IBD A;  2DQL A;  2HWV A;  2EB7 A;  2CJJ A;  3AG1 H;  1MBG A;  3JRI A;  3JRA A;  1TT0 A;  4H0E A;  3E6D A;  1J9I A;  3S3M A;  3RYR A;  1I1S A;  1TWA J;  3CUQ B;  3WU2 C;  1ON2 A;  3DPL C;  1RUN A;  4CYC A;  3RKQ A;  1WPK A;  3C2G A;  3RI4 A;  3IRQ A;  1JTY A;  2W85 A;  1LEA A;  3QYB A;  2IVM A;  2GM4 A;  1SD5 A;  5KAI C;  5IT9 Z;  1MJA A;  2MLG A;  2R7V A;  2VBY A;  1LVA A;  3GCM A;  2Z99 A;  2Y75 A;  1BR4 A;  2PMH A;  4CH7 A;  4OOI A;  1WZ2 A;  1YG2 A;  3ZCO A;  4KMF A;  3NAU A;  4XLF A;  2R4G A;  2HFH A;  2EV0 A;  2HTJ A;  3QU6 A;  4U0Y A;  3OS2 A;  4U0W A;  3W6K B;  2ZSH B;  1H89 C;  3ABM H;  1SVL A;  4IHT A;  1ZGA A;  4Y7N J;  2V6E A;  3ELK A;  2BEO A;  4L5I A;  5JI6 A;  4I2O A;  3HSF A;  3P5J A;  3J81 Z;  1UAA A;  1ZLJ A;  4E7K A;  4V19 K;  3V8K A;  4DW6 A;  4CDG A;  3RDI A;  3VYS B;  2BXZ A;  3Q5F A;  1P6R A;  2FQ4 A;  2MG4 A;  4I0B A;  5GAG J;  4PSX A;  1P4A A;  4BY7 J;  3LAP A;  3MD2 A;  2VOO A;  1NG6 A;  3T5X A;  1YHQ I;  2HQN A;  5D8L B;  4XLN F;  2LRE A;  3E6B A;  4I01 A;  1WKM A;  1XGM A;  3HRM A;  2KIQ A;  5LRR A;  2HOT A;  5FGM A;  1BBY A;  2EFP A;  1E2X A;  4CGZ A;  4CCL A;  1H88 C;  4BBR J;  1A6I A;  1XGN A;  2GA1 A;  3R0J A;  2ISY A;  3EUH C;  3KPH A;  2YX7 A;  4HLY A;  3M8F A;  1MND A;  3BG3 A;  3G1O A;  2DO7 A;  3KZZ A;  1IAW A;  1ZN2 A;  1TTY A;  5J3L A;  2NOJ B;  2M87 A;  2GOX B;  2PMU A;  4JQF A;  4F91 B;  2Y0M A;  2ZME B;  5GPC A;  3ABT A;  2JSP A;  2VT2 A;  1AKH A;  2KRF A;  2IGO A;  4BQO A;  1T33 A;  3Q9S A;  2LDU A;  3A1Y A;  1HLV A;  1Z91 A;  3FKI J;  1SVO A;  2BOL A;  4MTD A;  4M72 A;  3GX4 X;  2JK3 A;  2V6C A;  2LKS A;  4X1E A;  2EQR A;  2DCE A;  4AIK A;  3S1R J;  2B0L A;  3TP3 A;  3JAM K;  2KZV A;  1HKT A;  1P4W A;  1ERD A;  1WVR A;  3HHG A;  3JRF A;  4N9H A;  2JRT A;  1VQK I;  1VQ5 I;  2R7X A;  4R79 A;  2QSH X;  1K6O A;  4KIC A;  4WX9 A;  4KUM A;  1MDM B;  2VUM J;  5DUI A;  2MD5 A;  5HOO A;  2O3F A;  5F0F A;  4JX6 A;  3O6B B;  1BR1 A;  4M3F A;  4XLH A;  4N4N B;  4UNO A;  4E70 A;  2DOA A;  1BIA A;  1XGS A;  2PFB A;  2ZO4 A;  2MH9 A;  3ESW B;  3GTK J;  1WJ5 A;  2BY1 A;  2Z16 A;  4PJ0 C;  4D5F A;  3OYA A;  1T38 A;  4GXO A;  5H6Q A;  3GFJ A;  3R0A A;  3WG7 H;  1HKQ A;  1OCT C;  2GQQ A;  4X6A J;  1X1D A;  1TQP A;  1K6Y A;  4G12 A;  4CCM A;  5KK1 A;  4O6J A;  2DMN A;  2KP6 A;  3DU5 A;  4F3Q A;  2DMQ A;  3QRF F;  3N4M A;  3GTO J;  1RNL A;  2VOD A;  2BY0 A;  1FPQ A;  2YS9 A;  4FQG A;  2XUB A;  4XKW A;  2EIJ H;  1T8I A;  5ILV A;  3L2V A;  4HZF A;  1K78 A;  1N78 A;  2HKO A;  3GFM A;  5DDG A;  3L9F A;  1ETY A;  1F4K A;  3CUQ C;  1Y0N A;  1ZG1 A;  2E5N A;  1WQ2 A;  2JWT A;  5L3C A;  4ASN A;  2R5Y A;  1LJ9 A;  3GTP J;  2BW3 B;  4U88 A;  2ELJ A;  3DLA A;  4RB3 C;  3D1N I;  2BHY A;  4BXF A;  4A2U A;  3I54 A;  1NH3 A;  3SEQ A;  5C4J J;  1XC5 A;  4N9I A;  2I8D A;  1IO2 A;  3I5U A;  2L0K A;  4ENJ A;  3DKW A;  3M4O J;  4UV8 A;  1OIS A;  4ZZL A;  3V42 A;  1NHA A;  3BR3 A;  2Y9Z A;  1KA8 A;  1RC9 A;  3LSG A;  2M8G X;  1F5T A;  1YO5 C;  3EUH A;  2BXY A;  1NK2 P;  5LBQ A;  2OJE D;  2QBY A;  1Q1V A;  1IV6 A;  4HQM A;  2RVC A;  2AQF A;  3F8B A;  3BT9 A;  3FM5 A;  3WTT C;  5K1Y A;  1TL8 A;  2M4K A;  3RIR A;  1C0W A;  5LD2 C;  3SDG A;  3EYY A;  3MKW B;  5C44 J;  3CP8 A;  1RET A;  4HDU A;  3MCZ A;  3LSP A;  2JA8 J;  2MSY A;  3OS0 A;  3F6O A;  1XG1 A;  1Z9C A;  2A05 A;  2TDX A;  3IH2 A;  4CCN A;  2DMT A;  1A5J A;  1R1V A;  5FKK A;  2HR3 A;  2L7F P;  1O3T A;  3S32 A;  4HAM A;  2M7B A;  2Y2Z A;  3PFY A;  4B09 A;  3CCJ I;  1E3O C;  1Z3Y A;  2VIX A;  3C1D A;  4BEH B;  4V2G A;  1OR7 C;  4DZJ A;  2P81 A;  2XAS A;  1SVM A;  3BZ6 A;  3PL8 A;  2TCT A;  1K4T A;  1YIJ I;  2NRA C;  3A0B C;  5E17 F;  1X19 A;  5FFX A;  3HYI A;  4RGS A;  1SD6 A;  4C3H J;  2ZME C;  3JSO A;  1GV5 A;  3MZY A;  1MNM C;  3K4J A;  1FP2 A;  1S7O A;  1SFO J;  1D3Y A;  2DMP A;  1PP8 F;  2A6E F;  1CF7 A;  1UST A;  1Z1D A;  3VFZ A;  3F8N A;  1ONV A;  3DTI A;  1HW1 A;  5HVQ C;  4F7Z A;  2HVQ A;  5FKO A;  4E4H A;  3J7Z I;  4PUS A;  1YW9 A;  4LLG F;  3JRD A;  2ZJP F;  2CFO A;  5L3B A;  4M9X A;  3VDX A;  3S2D J;  4M74 A;  3H0D A;  2HQ5 A;  1RRJ A;  5L3G A;  4EM0 B;  1IC8 A;  1FIP A;  1EJ9 A;  3HL2 A;  1FIA A;  3HPH A;  3VYT B;  2LF7 A;  3OYI A;  3CUQ A;  4BYY A;  4FET A;  4O5V A;  4CHU A;  1ZRF A;  5F1J A;  4PJN A;  3BR5 A;  2P5L C;  4W1U A;  5IPA A;  4BDZ A;  1TNS A;  4I0A A;  2JA2 A;  4IHW A;  2XIG A;  2Y9Y A;  3ZQI A;  1IN6 A;  2NVX J;  3SYT A;  1UJ8 A;  4XMY A;  3L7W A;  1E0E A;  3MFK A;  3AAF A;  1YLF A;  5ICC A;  2L7Z A;  4GYI A;  1RR8 C;  1S8N A;  3W3C A;  2OQR A;  4W97 A;  1FT9 A;  3MEX A;  1SFE A;  5DV5 A;  4C3I J;  3WU1 B;  2KIS A;  2ID3 A;  2CW8 A;  4XBF A;  1YX5 A;  2VJJ A;  1LDK B;  2XDV A;  2FE3 A;  2NNN A;  5L3D A;  2EFQ A;  3IUO A;  3OYB A;  4IEJ A;  5EJC A;  1SMY F;  3TED A;  1N25 A;  3IHU A;  5J4V A;  3EET A;  2DA1 A;  1F43 A;  1TBX A;  5J6X A;  4ESF A;  4IO9 F;  5EF6 A;  2F4M B;  2E1C A;  3LFU A;  2BGC A;  4NC7 A;  3FF5 A;  2K3P A;  3E5U A;  5JLW A;  3PFI A;  4XRM A;  3IKV A;  4BBS J;  3S14 J;  4Y3O A;  2KRH A;  3S3O A;  3CF5 F;  1WJD A;  4ZYD A;  5IP9 J;  4XKC A;  2R7T A;  3MQ0 A;  3WE3 A;  1YFH A;  4M9S A;  1XSV A;  2PEX A;  2VQL A;  1OR7 A;  3GTM J;  1BC8 C;  3TO6 A;  3I55 I;  3H9G A;  1ZAO A;  4IHS A;  1FBQ A;  4OMY A;  2R7W A;  1IRG A;  2HPI A;  3KYC B;  3OYD A;  1K4S A;  5IT3 A;  5AIQ A;  3KYL A;  4V2F A;  2ZME A;  4LB5 A;  1U6G A;  1EA3 A;  5EGO B;  1UG2 A;  3PUB A;  1XGO A;  1UHS A;  1MBF A;  1S6L A;  2RQP A;  1OPC A;  2CQN A;  2VLA A;  2NVT J;  3RPQ A;  1JT6 A;  2X6O A;  3I0T A;  3K0L A;  2XGD A;  2KT0 A;  1STZ A;  2WAQ N;  4XNF A;  3LSH A;  4LK0 F;  1OJL A;  2XF7 A;  4ZDL A;  4ZJZ A;  3K4C A;  5JHF A;  2GXB A;  4AD9 A;  4L18 B;  1HDD C;  1VQN I;  3HKZ A;  2MA3 A;  1RPW A;  2DYR H;  3BOQ A;  2CQ7 A;  1I3A A;  1P9Q C;  3MKY B;  1MNE A;  5EZG A;  4L9T A;  5JR3 A;  3CLQ A;  1G2H A;  1IDY A;  2LYC A;  2QQB A;  2QSG X;  1TC3 C;  1MDM A;  2IXS A;  2WB1 N;  2GAU A;  5H20 A;  1R6R A;  2AXT C;  3OIP A;  2DK8 A;  1IG7 A;  3ZMU A;  5E1W A;  2OCC H;  4AC0 A;  5FRN A;  2CQK A;  5AIP A;  3JAM Z;  4L0Z B;  1ZTR A;  4HRI A;  1M1E B;  3ZMT A;  3K2A A;  5BS6 A;  1MMS A;  2FBK A;  1J75 A;  1T95 A;  4JBA A;  3BP8 A;  3GF2 A;  3I4M J;  2DTZ A;  1LKX A;  2HDW A;  2LRD A;  1K79 A;  3CES A;  3HSE A;  2XB0 X;  2HU9 A;  3M8E A;  2KPM A;  4GRI A;  2K86 A;  4MO7 A;  2D5V A;  2OTL I;  1E3P A;  2F5V A;  5EG0 B;  3OR2 C;  2O9L A;  5J1R A;  1Y1W J;  5KNL A;  1XN7 A;  2A69 F;  1RIO H;  2V1D A;  2HGC A;  3QP5 A;  4CSW A;  4A3I J;  1U78 A;  3RTR A;  2VKV A;  3E0J B;  2BW3 A;  2HTS A;  1MBK A;  3C3W A;  2IS1 A;  3BPX A;  2O61 A;  1Z0X A;  4K2E A;  3QWL A;  2NAZ A;  3ZQQ A;  1JI8 A;  2VBW A;  2GIV A;  3E7L A;  1QVT A;  1BJZ A;  3K4K A;  2QZ8 A;  3QYE A;  3ZMV A;  2JUG A;  3ZXS A;  2CV2 A;  2M5W A;  3GO5 A;  2VQC A;  4HST A;  2GBY A;  2Z1D A;  2QEX I;  4C30 A;  2VJI A;  2GOM A;  3GLL A;  2WA0 A;  3HTS B;  2VAS A;  2BE5 F;  3D5S C;  3K69 A;  3L09 A;  4OAZ A;  2HZD A;  4TV7 A;  1Z6T A;  3AG3 H;  1UMQ A;  5LEK A;  3PM1 A;  3U1D A;  2I5U A;  1IDZ A;  1R9T J;  1YS6 A;  2KIF A;  3G2B A;  2Y30 A;  2GA2 A;  1TWF J;  1X4O A;  4D5C A;  2FD5 A;  3F72 A;  4MNU A;  5JVT A;  3F8M A;  3I58 A;  1FNN A;  4XLP F;  1P7I A;  2JPB A;  1B1B A;  2NNY A;  3U1K A;  1W0T A;  2OZU A;  1WFX A;  4AIJ A;  2W48 A;  1VND A;  2R7Z J;  5ICE A;  1FOX A;  2EIK H;  4BJ6 C;  2XAQ A;  2VPR A;  2LC2 A;  5GP9 A;  4RS8 A;  1A35 A;  1ORK A;  1DUX C;  3KZI C;  4YFK F;  4RB1 A;  3LSR A;  5D8K B;  4U87 A;  4UV9 A;  3W2A A;  2DQR A;  4GGG A;  4BHP A;  4XID A;  1IUF A;  2DJI A;  2JSC A;  2K3F A;  1P4X A;  3ABU A;  3M9A A;  3ZQ7 A;  2FML A;  2ZBK A;  4FX0 A;  5F1R A;  1ON1 A;  4GDF A;  2A61 A;  2ZKZ A;  3OS1 A;  1V55 H;  1RR7 A;  4XSX F;  1UG0 A;  3MVP A;  3ZRG A;  5EZH A;  4EMS A;  4S0H B;  1I5Z A;  4MFD A;  5HNH A;  4NHJ A;  4I6Z A;  3ONQ A;  3TW6 A;  5GAD J;  1YOV B;  1GV2 A;  2K9N A;  3CCR I;  2E1O A;  4RLQ A;  2QWW A;  4WXD A;  1JKP C;  3RKY A;  4F93 B;  2YSR A;  2VL8 A;  5J40 A;  1SD7 A;  4CO8 A;  3KX2 A;  3I59 B;  4P5O A;  4G6T B;  5DTD A;  3CC2 I;  2XKP A;  4B1R A;  1MMA A;  1R4N B;  4G7H F;  2D45 A;  4Z2Y A;  3IWZ A;  3HUG B;  1IXR C;  4Y33 A;  1DP7 P;  3CLO A;  1XX5 A;  3CZ6 A;  5LGN A;  2ISZ A;  1QPI A;  2KQR A;  4ETS A;  5FLX K;  3VOE A;  4A3F J;  5DYM A;  4LB6 B;  2M4G A;  3VSL A;  3I53 A;  4A3C J;  3I4N J;  3IL2 A;  4KN4 X;  3F8C A;  1UHW A;  4KYW A;  1WJF A;  3BWG A;  3J7Y J;  2L9N A;  2DA2 A;  5IOZ A;  4J01 A;  4YG2 F;  4RB2 C;  2CUJ A;  5E3L A;  1JGS A;  3G4S I;  2C6Y A;  3OOP A;  3MZ8 A;  4BQA A;  4A93 J;  1PJR A;  1B9N A;  1ZEL A;  3ZN0 A;  1LVK A;  2DU9 A;  1Z21 A;  3CTA A;  4LIV A;  2Q8K A;  4A3M J;  2Z9O A;  2XF5 A;  5FRM A;  3OOU A;  5J8C A;  2XAU A;  5D4R A;  3ZMZ A;  1OCR H;  2LBF B;  1O4X A;  1KU3 A;  3B02 A;  3K6G A;  5M5W J;  3PNY A;  2CFX A;  3DFG A;  2STW A;  3KFW X;  2FEZ A;  3GME A;  3E5Q A;  1QU3 A;  1SFU A;  1FJL A;  1XSX A;  2DYS H;  3BG6 A;  1XCB A;  3EPZ A;  4UUS B;  3LSK A;  1Y1V J;  2UV1 A;  2H1K A;  1BI3 A;  2E7W A;  3T0Y A;  2JT1 A;  2RKH A;  4IF4 A;  1A04 A;  3RQI A;  4ZYH A;  1QO0 D;  3TDU C;  2QQA A;  3MMY B;  4HSR A;  2E1N A;  2MC3 A;  3K4B A;  2CV0 A;  4OIQ F;  2LY9 A;  3FM3 A;  3S8P A;  2VJ5 A;  4PGG A;  3AG2 H;  1WJC A;  2CH0 A;  3GZ5 A;  3R61 A;  3TQN A;  4EAT A;  3OYL A;  3AG4 H;  4L5E A;  1KU9 A;  1O57 A;  1S29 A;  1MBJ A;  2ZXH A;  1HOM A;  4I02 A;  5EGO A;  5BQT A;  2XC7 A;  4EGZ A;  2OBP A;  2A6T A;  4N4O B;  1X3Z B;  4IHX A;  4XRS G;  5K5O A;  1VF9 A;  2F5D A;  5F27 A;  4NC6 A;  4YEJ A;  5D6E A;  1VQ7 I;  4KJZ A;  3S16 J;  4EGY A;  2YUS A;  3CUO A;  3D5L A;  4ESB A;  3BR1 A;  1W5S A;  4C9Y A;  3NWT A;  1MJB A;  1QBJ A;  1QRY A;  2DOD A;  3LSM A;  4RGU A;  5E3N A;  2M3A A;  4A3G J;  3E97 A;  4RLF A;  1W1W E;  1VQL I;  2E34 A;  4MEY F;  4ZH4 F;  1X1A A;  5FFZ A;  4YFN F;  3FXQ A;  2BYV E;  5EEG A;  2JJ7 A;  4WXC A;  3VB2 A;  4L9N A;  1MZB A;  1EH7 A;  3KP4 A;  5E3M A;  3MKZ A;  2HOE A;  1YW8 A;  2K9L A;  3HG9 A;  1NTC A;  3IP4 B;  3DPT A;  3GZN B;  1BR2 A;  3WGH A;  2QSF X;  1XTA A;  1BIB A;  3BY6 A;  1DU0 A;  3WG9 A;  3J80 Z;  3GTJ J;  1XSD A;  3OY9 A;  5KCM A;  4HF0 A;  1ZH5 A;  4XQF A;  1DPU A;  3IH4 A;  2FOK A;  4ZTJ A;  2P7C B;  5EG0 A;  4Q47 A;  1POG A;  4U0V A;  2LH9 A;  3HXL A;  2UWM A;  1PYV A;  4XN0 A;  5D4S A;  2GZW A;  2LLK A;  3WTV C;  1RZ4 A;  4MEX F;  3U21 A;  2A6H F;  2NS7 A;  4Y13 A;  1LUJ B;  1EH8 A;  2JVG A;  3HRU A;  3FWE A;  2COM A;  1K61 A;  2DOE A;  4O3M A;  3GW2 A;  4DIQ A;  1MBH A;  1YW7 A;  2MGQ A;  4KIB A;  3E5X A;  4IRI A;  4R1H A;  4RAF A;  4LOC A;  3FDY A;  2H8W A;  2QF7 A;  2IP2 A;  3TMO A;  3PQK A;  3X2Q H;  4DBR A;  2YPR A;  4PFO A;  2DFH A;  3BRO A;  5DM7 F;  3V7R A;  1D8J A;  3ASO H;  1FTZ A;  5FJ8 J;  2F48 A;  2WY8 Q;  2XPU A;  3HOZ J;  2J5O A;  5KVR A;  3HEF A;  2XRO A;  5B1B H;  2HPM A;  3F22 A;  3OIO A;  4ENM A;  4D7M A;  4ON0 A;  3I64 A;  3KP3 A;  2ID6 A;  1PUF B;  2GIZ A;  1LDD A;  1T0F C;  1P2F A;  3CCY A;  2X4H A;  3FMR A;  2YR2 A;  4PSW A;  3JTG A;  2STT A;  1IRZ A;  5L3F A;  5B1A H;  1BN5 A;  5B3S H;  1YJ9 I;  1XDU A;  5HS8 A;  2IEK A;  1IF1 A;  3DU6 A;  4OU0 A;  3HJE A;  3NQO A;  4JYK A;  4F92 B;  3CCV I;  3ZPL A;  2X48 A;  1JUM A;  1KQ0 A;  5HOD A;  1VQM I;  2MW8 A;  3Q9V A;  4BUP A;  2ZNZ A;  4EJO A;  2L4A A;  2E35 A;  3CO6 C;  1IJW C;  1R1T A;  3VYR B;  2P6T A;  4XLC A;  2RNJ A;  2FA5 A;  2KIM A;  2H1L A;  1PP7 U;  3E6C C;  2K5C A;  4B48 A;  2MYS A;  3LWF A;  3M7G A;  1AWC A;  3OYG A;  1Z3X A;  4GCV A;  2ETH A;  2QCO A;  3F21 A;  1WRJ A;  2RGV A;  3FZV A;  3CDL A;  2FMY A;  4G7Z F;  1YTY A;  1ITY A;  1USS A;  4AVP A;  2DAO A;  3BG7 A;  1S3J A;  1MMG A;  3CCS I;  2ECC A;  2IT0 A;  3EQL F;  2L9R A;  4PDK A;  1WJE A;  2R7O A;  3H3Z A;  3WHB A;  3K1M A;  3I59 A;  1AU7 A;  2P5V A;  1RKW A;  2VBX A;  1LEB A;  1OYI A;  5B5E C;  3QPH A;  4EEF G;  3REO A;  2XPV A;  2HQR A;  3BCB A;  4QPO A;  3JRE A;  3CCU I;  4UXN A;  3GEZ A;  3GVA A;  2FBI A;  3HUG A;  4RM2 A;  3VYU B;  4C2M J;  1JTX A;  3BR0 A;  1D0X A;  4HNV A;  3L2Q A;  4BH9 A;  1SMT A;  3DKY A;  5CYV A;  1U5T B;  2PJR A;  2A07 F;  2HYJ A;  3D0S A;  4MGR A;  3TGN A;  3F3X A;  2BY2 A;  2A5W A;  2MD0 A;  5CLS A;  3SFI A;  3A01 B;  1E3H A;  2IGN A;  2P6S A;  1ETX A;  2MFZ A;  2XRL A;  2DN0 A;  1R23 A;  2XV4 S;  1JHH A;  2M2E A;  3LQR A;  1KQ8 A;  1B59 A;  4BS9 A;  2WAQ A;  3A02 A;  5FKM A;  1GUU A;  2QVO A;  3G71 I;  4HF2 A;  5EYR A;  2LR8 A;  2DFE A;  3HIF A;  1FOK A;  1QHH D;  3AL0 B;  4DYQ A;  2AO9 A;  4A0Y A;  3T8T A;  4PK4 A;  4ZDP A;  1J2X A;  5F0H A;  3ERE D;  4ZTF A;  3VWB A;  3BC8 A;  2DK5 A;  2ELK A;  3SFZ A;  4BNC A;  2K40 A;  3RPU A;  3NRV A;  2LBF A;  1QVU A;  3UKG A;  2L4M A;  4QSH A;  1T0F A;  4KIS A;  2FXA A;  3HM5 A;  2CW7 A;  2WB1 A;  4D7N A;  2R7S A;  2XSD C;  4M3G A;  2EWN A;  3CC4 I;  2QQ8 A;  1R4M B;  3KET A;  3VEP A;  4IX7 A;  1PUE E;  1AOY A;  1ZYR F;  1VQ8 I;  2R7Q A;  3TKY A; 
#chains in the Genus database with same CATH homology
 1HW5 A;  1YS7 A;  5E1X A;  5CVR A;  3CO7 C;  2QUF A;  3V7C A;  3FX3 A;  2DTR A;  1BJA A;  1UCR A;  5K5Q A;  1FX7 A;  2FQ3 A;  4B8X A;  1O7L A;  3BPV A;  4LGW A;  1IN5 A;  4RAZ A;  1SD4 A;  1KYW A;  2XHK A;  4U7D A;  4QLC U;  2IPQ X;  3RKW A;  2ACJ A;  1BI1 A;  1J5Y A;  5HS7 A;  3EYI A;  3GWZ A;  4LD5 A;  3SHF A;  5BMZ A;  2K7L A;  5HDN A;  1TQM A;  2L54 A;  4FX4 A;  2VOP A;  1WI9 A;  2VE8 A;  3ZMD A;  1G3S A;  2BBY A;  3RKX A;  3COA C;  3WTW C;  4G7O F;  2V1X A;  5TJJ A;  2EV6 A;  4A6E A;  3IKT A;  5TRD A;  4Q5S F;  2XAJ A;  1D5V A;  3HOS A;  1UB9 A;  2XAG A;  3T1B A;  1B4A A;  3KEQ A;  5LHH A;  5IT9 K;  1WWX A;  2OU2 A;  4M9Z A;  5HS9 A;  3VOD A;  3DXJ F;  2HZT A;  5DD8 A;  2QQ9 A;  3LQQ A;  1H0M A;  4A0X A;  3DP7 A;  1HST A;  1U5T C;  2NYX A;  1XCV A;  1G6N A;  3F6V A;  2DBB A;  5CVU A;  2FNP A;  3J81 K;  4PGH A;  1FY7 A;  5HDG A;  1F9N A;  1XD7 A;  2ADU A;  2FU4 A;  1FZP B;  2IJL A;  1T98 A;  2R7F A;  2VN2 A;  4MQ9 F;  3IC7 A;  3FMS A;  4PCQ A;  5CVI A;  4BHC A;  1L3L A;  3KCC A;  4Y17 A;  4CYD A;  1FBU A;  2D1H A;  3RYP A;  3WTZ A;  5CVJ A;  1FC3 A;  1S7A A;  1ZRD A;  4R8H A;  5K5R A;  2LKP A;  2G7U A;  3U2R A;  3V7S A;  2XVC A;  3MAJ A;  1LDJ A;  4IPA A;  3QAH A;  4WWC A;  3ISP A;  3FMQ A;  3TOB A;  5DCM B;  3KP2 A;  3TO9 A;  1H9G A;  4ZZD A;  2PI0 A;  2M1B A;  1F1Z A;  4OMZ A;  3R4K A;  5A2Q K;  1I27 A;  5LGU A;  2FSW A;  4LG0 B;  4NB5 A;  2Z33 A;  1XMK A;  2IA1 A;  4IJA A;  1L0O C;  1JE8 A;  1JHF A;  4BXU A;  1JXS A;  4L9J A;  5DEQ A;  2PBI A;  1TW3 A;  1OKR A;  4HBL A;  5D5V B;  4A0Z A;  5JHU A;  2ZFW A;  4UVA A;  2VC1 A;  4HQE A;  4N0B A;  2ELH A;  5BOX A;  3KP6 A;  1HXD A;  2EV5 A;  2WWY A;  4XRF A;  4EV0 A;  1GVJ A;  4GO1 A;  1LQ1 A;  4G6Q A;  1R7J A;  3KP5 A;  4EVI A;  4KMU X;  3HTU A;  4ZYE A;  1EV7 A;  1U5T A;  3ECH A;  4HX8 A;  5E18 F;  4MTE A;  2PN6 A;  1EH6 A;  3SZP A;  3CJN A;  3B73 A;  1T6S A;  2WV0 A;  3WTX C;  4G94 A;  2DLL A;  3FXU A;  3QP6 A;  1HKS A;  3HRS A;  4G9Y A;  5BPI A;  2HDC A;  3KEO A;  2MBF A;  2DW4 A;  2HEO A;  1DPR A;  4KIF A;  4YII A;  1Z6R A;  2OD5 A;  2RC4 A;  4LFU A;  1U2W A;  3P9K A;  5DD4 A;  1G4D A;  4DQ2 A;  1YYV A;  3C18 A;  3SXY A;  2VT3 A;  1FLI A;  4I09 A;  1UHM A;  1ZAR A;  4EM1 A;  2ZCW A;  2A5Y B;  3J7A O;  3KE2 A;  3DF8 A;  5LGT A;  2DFI A;  1W7P B;  5LEJ A;  2XGX A;  4I7H A;  1B6A A;  3HRT A;  4MQV A;  5AON A;  2LF8 A;  2FF4 A;  4Q48 A;  1R5H A;  3MZH A;  1ZHF A;  1IUY A;  3JSP A;  1RUO A;  1O3Q A;  1G3Y A;  4HA8 A;  4ESJ A;  3WGI A;  2DPU A;  1DDN A;  5J8F A;  2KJC A;  4EJU A;  1ZG3 A;  4IXA A;  5D5X B;  1KU2 A;  5FD5 A;  1KU7 A;  1V3F A;  3DV8 A;  3KLN A;  2ESN A;  1OMI A;  1P92 A;  1R22 A;  1E17 A;  3L00 A;  2OZ6 A;  1K7A A;  3ULQ B;  2D2W A;  4AWX B;  2K27 A;  4LMY A;  2CSO A;  1FBS A;  3BDD A;  4G6D A;  2F5F A;  3LST A;  5E1Z B;  3GFI A;  2VC0 A;  3BJA A;  2QEN A;  5LHG A;  3O2P E;  1HSJ A;  1TLH B;  2PLY A;  4KA4 A;  4A6D A;  2V9V A;  3F23 A;  3TDZ C;  1J59 A;  1MD0 A;  4KIG A;  2K4J A;  1ZRE A;  4UHT A;  2M8E A;  4M6Y A;  3HOT A;  3DQV C;  4UVC A;  4LJZ F;  4P96 A;  1WSU A;  2M30 A;  3I71 A;  3F8F A;  2H09 A;  5ICF A;  4P9F A;  2K4B A;  2EA4 A;  1XB4 A;  4YIF A;  2L3D A;  3EDP A;  3W6J B;  1IXC A;  3T8R A;  5DCM A;  2K02 A;  2H94 A;  3G73 A;  1BI0 A;  2E7X A;  4KDP A;  2IA2 A;  2Z3Y A;  3E6M A;  5ILU A;  5D6F A;  4EJV A;  2HYG D;  1IXS B;  3WU0 A;  3E3V A;  5HLG A;  4LG0 A;  1ZG5 A;  2P8T A;  2V1U A;  1IRF A;  4Q4Z F;  2BV6 A;  1QZY A;  4RAY A;  4HOB A;  4P9U A;  4RGX A;  4FT8 A;  2D1V A;  2L01 A;  5A2Q Z;  1KQ9 A;  2PQ8 A;  3K1N A;  3U9G A;  4EM2 A;  2HS5 A;  2A68 F;  2V79 A;  1J0R A;  2WC2 A;  4Y15 A;  1QPM A;  4L5J A;  1IN8 A;  3ECO A;  5CJ9 A;  3SQN A;  4WXH A;  1R5G A;  5FB2 A;  1ZGJ A;  2GWR A;  4CIC A;  2IW5 A;  4LLN A;  2F2E A;  2P7V B;  4GYG A;  1Y0U A;  1FYM A;  1UFM A;  2R3S A;  1IW7 F;  3R60 A;  5FD6 A;  1BC7 C;  1Z05 A;  5D5W B;  4BAY A;  1RI7 A;  2P5K A;  3WTS C;  1KYZ A;  4WCG A;  3GLX A;  3C7J A;  1QQI A;  4A5N A;  2ZNY A;  5HLH A;  4G8X A;  3GYH X;  4HF1 A;  3P7N A;  4ZYG A;  1U8R A;  3K9T A;  3GUD A;  2A3S A;  2JTV A;  1IN7 A;  1I1G A;  1YQA A;  2X0L A;  2FNA A;  1TW2 A;  2O8X A;  1XDS A;  4U7B A;  5E20 A;  4L0Y B;  2PJP A;  2VXZ A;  2WTE A;  5CVV A;  2J5P A;  1W7P A;  4LLL A;  2CGP A;  1SFX A;  3WGG A;  2H27 A;  6PAX A;  4XSZ F;  1MJ9 A;  5E8G A;  5EEH A;  4HX4 A;  4M6X A;  3DEU A;  3LFK A;  1W7P D;  4OIN F;  5F6F A;  2EFO A;  2W57 A;  3WOD F;  3GZ6 A;  2YX4 A;  3FXR A;  3LA3 A;  1R58 A;  4HV5 A;  1Z7U A;  3KLO A;  4WF2 A;  2L02 A;  2RN7 A;  2OA4 A;  4AIH A;  5FLX Z;  3V8L A;  1YIO A;  2W25 A;  5ICG A;  3HSR A;  2XAH A;  3S2W A;  3LAJ A;  4CZZ A;  1FP1 D;  2ZJ2 A;  2PG4 A;  1B9M A;  1IZ1 A;  3WE2 A;  5H6R A;  2FBH A;  2VE9 A;  1OYY A;  2QLZ A;  1ZRC A;  1IN4 A;  3L2C A;  1W4M A;  3BJ6 A;  3ML6 A;  3TO7 A;  4HV6 A;  4RB0 A;  3QOP A;  3CDH A;  2Y48 A;  1W5T A;  4PZJ A;  5ILS A;  5JFR A;  1QNT A;  4MHG A;  2OQG A;  1REP C;  2G7H A;  4IRG A;  3OV8 A;  4OIR F;  4S05 A;  3LA7 A;  2DT5 A;  2KIU A;  2AXL A;  1XMA A;  4HYE A;  2XRN A;  1O7F A;  2QYO A;  4FHT A;  3H3U A;  3FHZ A;  2DPD A;  2JZY A;  4YFX F;  2RV8 A;  4HW0 A;  3QPT A;  3LA2 A;  1H9T A;  4S04 A;  2EJR A;  4KNY A;  1QZZ A;  1QGP A;  3SZT A;  2G9W A;  4KN7 X;  4ENN A;  1FYK A;  2IA0 A;  4RGR A;  4P55 A;  1FSE A;  2Z5U A;  1Q1H A;  2M45 A;  4A12 A;  3RJP A;  1LB2 A;  2LNB A;  4BHB A;  2F5E A;  4HX7 A;  1R00 A;  4EJT A;  1MGT A;  5D5U B;  4QWQ A;  2Q2E A;  5HDK A;  3P9C A;  4ENK A;  4WK8 F;  4UVB A;  3WTU C;  2W24 A;  1SAX A;  1O3S A;  1VTN C;  2MH2 A;  1R36 A;  4LK1 F;  3QU3 A;  1ODD A;  2XAF A;  4KT5 C;  1O3R A;  3I4P A;  3H92 A;  4CXF A;  3TOA A;  3J80 K;  1G3W A;  5L3E A;  1T2K A;  2EFN A;  2VBZ A;  3O3K A;  2Q0O A;  1X3U A;  3JTH A;  3NEU A;  1GXP A;  3PQJ A;  2HKX A;  4DNC A;  4L9V A;  4JK1 X;  2CO5 A;  2UZK A;  1T39 A;  4HLX A;  2CG4 A;  2CWE A;  3IRR A;  3KP7 A;  5BPD A;  2O0Y A;  5LLQ A;  5DCF A;  3ZMS A;  3ROU A;  2FRH A;  4A5M A;  1I6X A;  3IWF A;  5HLI A;  3HHH A;  3WTY C;  4M73 A;  4HDV A;  1PDN C;  1CGP A;  1GHC A;  3K1P A;  2W84 A;  2HYF A;  2CYY A;  5ED4 A;  2ESH A;  3M1E A;  2ZXJ A;  2DI3 A;  1FYL A;  2AS5 F;  2O03 A;  3ZP5 A;  1HQC A;  3JW4 A;  3V4G A;  2EA2 A;  2QM3 A;  1TQI A;  2EFW A;  2UXX A;  3P9I A;  4IRH A;  4UUV A;  2O6G E;  1K78 B;  3R6S A;  3MWM A;  5ERI A;  2OAZ A;  2RDP A;  2KKO A;  5F64 A;  1KGS A;  2H6B A;  2LSO A;  4I98 B;  4EJW A;  5DUK A;  2KJB A;  2GXG A;  5LRS A;  4OIP F;  4EQQ A;  1BI2 A;  1LNW A;  4KFC A;  3V8J A;  2QBY B;  1J7K A;  3G3Z A;  1OYW A;  2YU3 A;  1FSH A;  3KZY A;  3GFL A;  1G3T A;  2MLK A;  2XKO A;  2EK5 A;  1HW2 A;  3K2Z A;  1R1U A;  1FWZ A;  1TNT A;  2H6C A;  1ZLK A;  5E8I A;  3BJO A;  5LHI A;  2F5C A;  2P4W A;  1HBX G;  4D0P A;  4M71 A;  1GXQ A;  2NS0 A;  5FO5 A;  2CW0 F;  2R7D A;  1CF7 B;  4OIO F;  1BM9 A;  1D8K A;  1U3E M;  1MKM A;  2IRF G;  3ZN1 A;  2JPC A;  3GXO A;  4IVN A;  4NQW A;  1V4R A;  2VON A;  3N97 A;  2UXN A;  1ULY A;  1BOA A;  2DQL A;  2HWV A;  2EB7 A;  4H0E A;  3E6D A;  1J9I A;  3RYR A;  1I1S A;  3CUQ B;  1ON2 A;  3DPL C;  1RUN A;  3RI4 A;  3IRQ A;  2W85 A;  1LEA A;  2IVM A;  1SD5 A;  5IT9 Z;  1MJA A;  2MLG A;  2VBY A;  1LVA A;  2Z99 A;  2Y75 A;  2PMH A;  4OOI A;  1YG2 A;  4KMF A;  2HFH A;  2EV0 A;  2HTJ A;  3QU6 A;  4U0Y A;  4U0W A;  3W6K B;  4IHT A;  1ZGA A;  3ELK A;  2BEO A;  4L5I A;  5JI6 A;  4I2O A;  3HSF A;  3J81 Z;  1ZLJ A;  3V8K A;  4CDG A;  3RDI A;  3Q5F A;  1P6R A;  4I0B A;  1P4A A;  3LAP A;  2VOO A;  3T5X A;  2HQN A;  5D8L B;  4XLN F;  3E6B A;  4I01 A;  1WKM A;  1XGM A;  3HRM A;  5LRR A;  5FGM A;  1BBY A;  2EFP A;  1E2X A;  4CGZ A;  1XGN A;  2GA1 A;  3R0J A;  2ISY A;  2YX7 A;  4HLY A;  3M8F A;  2DO7 A;  3KZZ A;  1IAW A;  1ZN2 A;  1TTY A;  2M87 A;  2PMU A;  4JQF A;  2Y0M A;  2ZME B;  3ABT A;  2VT2 A;  2KRF A;  3Q9S A;  2LDU A;  1Z91 A;  4MTD A;  4M72 A;  3GX4 X;  2V6C A;  4AIK A;  2B0L A;  3JAM K;  1HKT A;  1P4W A;  3HHG A;  4N9H A;  2JRT A;  4R79 A;  1K6O A;  4KIC A;  4WX9 A;  4KUM A;  1MDM B;  5DUI A;  2MD5 A;  5HOO A;  2O3F A;  3O6B B;  4UNO A;  4E70 A;  1BIA A;  1XGS A;  2PFB A;  2ZO4 A;  2MH9 A;  1T38 A;  4GXO A;  5H6Q A;  3GFJ A;  3R0A A;  1HKQ A;  2GQQ A;  1TQP A;  5KK1 A;  4O6J A;  3QRF F;  3N4M A;  1RNL A;  2VOD A;  1FPQ A;  2XUB A;  5ILV A;  4HZF A;  1K78 A;  2HKO A;  3GFM A;  5DDG A;  3L9F A;  1F4K A;  3CUQ C;  1ZG1 A;  1WQ2 A;  5L3C A;  4ASN A;  1LJ9 A;  4U88 A;  4RB3 C;  4A2U A;  3I54 A;  4N9I A;  3I5U A;  4ENJ A;  3DKW A;  4UV8 A;  4ZZL A;  1NHA A;  1KA8 A;  1F5T A;  1YO5 C;  3EUH A;  5LBQ A;  2QBY A;  4HQM A;  2RVC A;  3F8B A;  3FM5 A;  3WTT C;  5K1Y A;  3RIR A;  1C0W A;  3EYY A;  4HDU A;  3MCZ A;  3F6O A;  1Z9C A;  2TDX A;  1R1V A;  2HR3 A;  1O3T A;  4HAM A;  4B09 A;  3C1D A;  2XAS A;  3BZ6 A;  2NRA C;  5E17 F;  5FFX A;  3HYI A;  4RGS A;  1SD6 A;  3JSO A;  3MZY A;  1FP2 A;  1S7O A;  1D3Y A;  1PP8 F;  2A6E F;  1CF7 A;  1UST A;  1Z1D A;  3VFZ A;  3F8N A;  1ONV A;  1HW1 A;  5HVQ C;  4F7Z A;  1YW9 A;  4LLG F;  5L3B A;  4M9X A;  4M74 A;  5L3G A;  4EM0 B;  2LF7 A;  3CUQ A;  4BYY A;  4O5V A;  4CHU A;  1ZRF A;  2P5L C;  1TNS A;  4I0A A;  2XIG A;  1IN6 A;  3L7W A;  3MFK A;  3AAF A;  1YLF A;  5ICC A;  4GYI A;  1S8N A;  2OQR A;  1FT9 A;  3MEX A;  1SFE A;  5DV5 A;  3WU1 B;  4XBF A;  1LDK B;  5L3D A;  2FE3 A;  2NNN A;  2EFQ A;  1SMY F;  3IHU A;  3EET A;  1TBX A;  5J6X A;  4ESF A;  2E1C A;  2BGC A;  3FF5 A;  3E5U A;  3PFI A;  3IKV A;  4ZYD A;  3MQ0 A;  3WE3 A;  1YFH A;  4M9S A;  1XSV A;  2PEX A;  1OR7 A;  1BC8 C;  3TO6 A;  1ZAO A;  4IHS A;  1FBQ A;  4OMY A;  1IRG A;  5IT3 A;  5AIQ A;  2ZME A;  4LB5 A;  1U6G A;  1XGO A;  1S6L A;  2RQP A;  1OPC A;  3RPQ A;  3K0L A;  3I0T A;  1STZ A;  4LK0 F;  2GXB A;  4AD9 A;  4L18 B;  2MA3 A;  3BOQ A;  4L9T A;  5JR3 A;  2QQB A;  1MDM A;  2GAU A;  5H20 A;  2DK8 A;  3ZMU A;  5E1W A;  2CQK A;  5AIP A;  3JAM Z;  4L0Z B;  3ZMT A;  5BS6 A;  2FBK A;  1J75 A;  4JBA A;  3BP8 A;  3GF2 A;  1K79 A;  3HSE A;  3M8E A;  2K86 A;  1XN7 A;  2A69 F;  1RIO H;  2V1D A;  2HGC A;  3QP5 A;  1U78 A;  3RTR A;  2HTS A;  3C3W A;  3BPX A;  2O61 A;  4K2E A;  2NAZ A;  2VBW A;  2GIV A;  2QZ8 A;  3ZMV A;  2M5W A;  3GO5 A;  3HTS B;  2BE5 F;  3K69 A;  3L09 A;  4TV7 A;  1Z6T A;  5LEK A;  3U1D A;  1YS6 A;  2KIF A;  2GA2 A;  3F72 A;  4MNU A;  5JVT A;  3F8M A;  3I58 A;  1FNN A;  4XLP F;  2JPB A;  1B1B A;  2NNY A;  2OZU A;  4AIJ A;  5ICE A;  2XAQ A;  4RS8 A;  1DUX C;  4YFK F;  4RB1 A;  5D8K B;  4UV9 A;  2DQR A;  4GGG A;  4BHP A;  2JSC A;  1P4X A;  3ABU A;  3M9A A;  3ZQ7 A;  2FML A;  2ZBK A;  4FX0 A;  5F1R A;  1ON1 A;  2A61 A;  2ZKZ A;  4XSX F;  4EMS A;  1I5Z A;  4NHJ A;  2QWW A;  4WXD A;  3RKY A;  2YSR A;  1SD7 A;  4CO8 A;  3I59 B;  4P5O A;  2XKP A;  4G7H F;  2D45 A;  4Z2Y A;  3IWZ A;  1IXR C;  1DP7 P;  3CLO A;  5LGN A;  2ISZ A;  4ETS A;  5FLX K;  3VOE A;  5DYM A;  4LB6 B;  3I53 A;  3IL2 A;  4KN4 X;  3F8C A;  1UHW A;  4KYW A;  3BWG A;  4YG2 F;  4RB2 C;  2C6Y A;  1JGS A;  3OOP A;  4BQA A;  1B9N A;  3ZN0 A;  2DU9 A;  2Z9O A;  3CTA A;  2Q8K A;  5J8C A;  5D4R A;  3ZMZ A;  1KU3 A;  3B02 A;  2CFX A;  3DFG A;  2STW A;  3KFW X;  2FEZ A;  3E5Q A;  1SFU A;  1XSX A;  1XCB A;  1BI3 A;  2E7W A;  3T0Y A;  2JT1 A;  2RKH A;  4IF4 A;  1A04 A;  4ZYH A;  1QO0 D;  3TDU C;  2QQA A;  2E1N A;  2MC3 A;  4OIQ F;  3FM3 A;  4PGG A;  3R61 A;  3GZ5 A;  3TQN A;  1KU9 A;  1O57 A;  1S29 A;  4I02 A;  5BQT A;  4EGZ A;  2OBP A;  5K5O A;  2F5D A;  5D6E A;  4EGY A;  3CUO A;  3D5L A;  4ESB A;  1W5S A;  1QBJ A;  1MJB A;  4RGU A;  3E97 A;  4MEY F;  4ZH4 F;  5FFZ A;  4YFN F;  3FXQ A;  2BYV E;  5EEG A;  4WXC A;  3VB2 A;  4L9N A;  1MZB A;  1EH7 A;  3KP4 A;  2HOE A;  1YW8 A;  3DPT A;  3WGH A;  1BIB A;  3BY6 A;  3WG9 A;  3J80 Z;  1XSD A;  4HF0 A;  1ZH5 A;  1DPU A;  2FOK A;  2P7C B;  4Q47 A;  4U0V A;  2UWM A;  5D4S A;  2GZW A;  3WTV C;  1RZ4 A;  4MEX F;  2A6H F;  4Y13 A;  1EH8 A;  3HRU A;  3FWE A;  2COM A;  4O3M A;  3GW2 A;  1YW7 A;  4KIB A;  3E5X A;  4IRI A;  4R1H A;  2IP2 A;  3PQK A;  2YPR A;  3BRO A;  3V7R A;  1D8J A;  2J5O A;  5KVR A;  2XRO A;  3F22 A;  4ENM A;  4ON0 A;  3I64 A;  3KP3 A;  1LDD A;  1P2F A;  2X4H A;  3FMR A;  2YR2 A;  3JTG A;  2STT A;  5L3F A;  1BN5 A;  1XDU A;  5HS8 A;  1IF1 A;  4OU0 A;  3NQO A;  3ZPL A;  1KQ0 A;  3Q9V A;  2ZNZ A;  4EJO A;  2L4A A;  3CO6 C;  1R1T A;  2P6T A;  2RNJ A;  2FA5 A;  2KIM A;  1PP7 U;  3E6C C;  3LWF A;  3M7G A;  1AWC A;  4GCV A;  2ETH A;  3F21 A;  1WRJ A;  2RGV A;  3FZV A;  4G7Z F;  2FMY A;  1YTY A;  1USS A;  4AVP A;  2DAO A;  1S3J A;  2IT0 A;  3EQL F;  4PDK A;  3H3Z A;  3K1M A;  3I59 A;  2P5V A;  2VBX A;  1LEB A;  1OYI A;  3QPH A;  3REO A;  2HQR A;  4UXN A;  3GEZ A;  3GVA A;  2FBI A;  3HUG A;  4BH9 A;  1SMT A;  5CYV A;  1U5T B;  2A07 F;  3D0S A;  4MGR A;  3TGN A;  3F3X A;  5CLS A;  2P6S A;  1R23 A;  2XV4 S;  1JHH A;  1KQ8 A;  3LQR A;  1B59 A;  2QVO A;  4HF2 A;  3HIF A;  1FOK A;  4A0Y A;  3T8T A;  1J2X A;  3ERE D;  2DK5 A;  3SFZ A;  4BNC A;  3RPU A;  3NRV A;  2L4M A;  1T0F A;  2FXA A;  2EWN A;  1PUE E;  3KET A;  3VEP A;  1AOY A;  1ZYR F;  3TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...