4HDVA

Crystal structure of s. pombe atl1 in complex with damaged dna containing 2,6-diaminopurine
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyltransferase-like protein 1
publication title Alkyltransferase-like protein (Atl1) distinguishes alkylated guanines for DNA repair using cation-{pi} interactions.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hdvA00
2MLGA 1R58A 2QENA 3M8FA 2PEXA 2EK5A 4LG0A 3F6OA 5JI6A 2CO5A 1LVAA 2FA5A 4KMFA 4I01A 2VODA 4NQWA 3EETA 4ENJA 1FBSA 4CICA 1E17A 2AS5F 1ON1A 1HW2A 1TQMA 4WWCA 2V79A 2MA3A 2PQ8A 2BGCA 3EUHA 5D5UB 5LBQA 1UFMA 4L9VA 1TQPA 1QZZA 4ESBA 1HBXG 4LK0F 4KIBA 5J6XA 4GO1A 4ZZLA 1FYLA 4MNUA 5HDKA 1JHFA 4U7BA 3TDZC 4EJOA 2A5YB 4G7HF 5CJ9A 3FM5A 2J5PA 2PJPA 3BY6A 4M72A 4A5NA 3ROUA 4ENMA 4HYEA 4O5VA 5HS7A 4KUMA 2A69F 5CLSA 4AIKA 4I7HA 1J75A 1JXSA 1FBQA 1RIOH 4IHSA 1MKMA 2IA1A 1BI1A 4DQ2A 3E5UA 3WGHA 3WGIA 1E2XA 1SFUA 3WTXC 2XAHA 3LA7A 2HYFA 3JW4A 5E1ZB 4LGWA 2STTA 2QQAA 1O3SA 1R5HA 3TO6A 2EJRA 4M9ZA 1KYWA 3JTGA 1EV7A 1HKSA 5CVRA 5EEGA 4M73A 3HUGA 4MQ9F 2W84A 5D5XB 5ILVA 3GFJA 1F9NA 4ETSA 2ESNA 4EGZA 5E1XA 1I5ZA 5LRRA 1Z6RA 5LLQA 2G7UA 1REPC 2Z33A 4L9JA 3P7NA 1QQIA 2A68F 2VC0A 3GVAA 1ZRDA 4ZZDA 1HW1A 3K1PA 2HWVA 3GXOA 3ZMTA 1BI0A 3I0TA 3ULQB 3TO7A 1W5SA 2PMHA 1YW9A 3FM3A 3U2RA 4M6YA 1W4MA 2DI3A 4CXFA 3SFZA 1HKQA 1SFXA 4HX7A 4U88A 1G3SA 2PBIA 5LGTA 4AIHA 3IHUA 2VT3A 3EYIA 5L3CA 4E70A 4MHGA 1Z9CA 4S05A 2O3FA 2Q0OA 4RB3C 1QBJA 2P5LC 4L0YB 1TLHB 2F5CA 3ZP5A 3WE3A 1B59A 2XAGA 3VFZA 5EEHA 1LQ1A 4R8HA 3E5QA 3IWZA 4G94A 4HF1A 4WXCA 1XB4A 4Q47A 3GO5A 4OOIA 3E6CC 2VBYA 4IJAA 5K5OA 1XMKA 2K4JA 3MFKA 2GXGA 2VONA 3HIFA 4KICA 5DEQA 1IAWA 3HRMA 3ZN0A 2EWNA 2P7VB 2DBBA 2QM3A 1J2XA 1MJ9A 1AWCA 1B6AA 1A04A 2BYVE 1S3JA 5E8IA 1T2KA 1XGOA 1V3FA 2BV6A 1USTA 1OPCA 1TBXA 3MCZA 2QVOA 2P7CB 1FYMA 1LEAA 1IN5A 2HDCA 2HS5A 5JR3A 5BS6A 3ABUA 4IF4A 1TNSA 1SD5A 2JT1A 2HZTA 1T98A 2A61A 2DLLA 3D0SA 2ZMEA 2DO7A 1J0RA 2VBXA 4Q4ZF 2ZCWA 1I6XA 3B73A 1ZRFA 1O7LA 5JFRA 2HQRA 4ZH4F 4FX0A 3W6JB 5DD4A 3HHHA 3QRFF 5LHHA 2P6SA 3TKYA 1T38A 4P96A 1MJBA 3L00A 3T5XA 2OU2A 2ISZA 4YFKF 2EFQA 4CHUA 3P9CA 4HX4A 4XRFA 3WE2A 3QU3A 3QPHA 2FBHA 3D5LA 4A5MA 1V4RA 1CF7A 1FP1D 2UZKA 5DCFA 2XKPA 1FX7A 4U0WA 3VODA 4HDVA 5H6RA 3CUQB 2CWEA 4XLPF 4OINF 3M8EA 1B4AA 3FHZA 2V1XA 2D1VA 3HTUA 2NNNA 3FZVA 2ZO4A 4IHTA 3HYIA 1P4AA 2D2WA 3IKTA 5DD8A 1VTNC 2Z9OA 3TO9A 3HRTA 2K7LA 1P92A 3M1EA 4F7ZA 3WTVC 3F8BA 3S2WA 4A6DA 1Q1HA 3GUDA 3R0JA 2XVCA 3O3KA 4EM0B 2EB7A 3R0AA 5BPDA 2UXNA 5FGMA 2W57A 3IRQA 2LNBA 3KP3A 2GA1A 3HRUA 1GXQA 4EJVA 1HW5A 1BIAA 3KP4A 4M9SA 1PUEE 3HOTA 1IW7F 1X3UA 3LAPA 1KA8A 3GF2A 4UHTA 3HOSA 2XUBA 2DAOA 1TW2A 2RC4A 2TDXA 2QQ9A 5FO5A 2M45A 2LSOA 4LD5A 3I71A 4RB1A 2G9WA 3ERED 5F1RA 1G4DA 4DNCA 2L3DA 2ZMEB 2YU3A 2KIMA 3EYYA 1TTYA 1RNLA 2P5VA 5D8KB 5TJJA 4UV9A 1S7OA 3V8KA 3LSTA 4KYWA 4G9YA 5DCMB 2XAFA 4AVPA 3LQQA 2AXLA 4HQMA 2H94A 4I98B 2RQPA 1P4XA 4JQFA 3RJPA 4R1HA 5FLXZ 3BDDA 4M71A 1K7AA 2K86A 4RAYA 1KU9A 4CYDA 3ZMZA 2LDUA 2PG4A 2Y48A 1YW8A 3T1BA 1CF7B 4UVCA 2IVMA 2EA2A 3R61A 1R5GA 1W7PB 3R6SA 1ZG5A 2Y75A 1KU7A 3GZ5A 4KFCA 4AD9A 3B02A 3ISPA 2VE9A 1ON2A 3C18A 2HOEA 3ZMDA 3L2CA 3MZHA 1KQ9A 5E18F 1D8JA 3SXYA 1FNNA 2K27A 1DPRA 1OKRA 2CSOA 3EQLF 3DKWA 1GXPA 3ML6A 2FOKA 2X4HA 1R1VA 1B9NA 3H3ZA 1BI2A 2JPBA 5LEKA 2NAZA 2KRFA 3DF8A 3HSEA 4GXOA 4U0YA 3LA2A 3F8FA 2FXAA 4IRHA 1LB2A 1RZ4A 2GAUA 1UCRA 1BM9A 3MEXA 1FSEA 1XSXA 2OA4A 3F22A 4YG2F 2JTVA 2ESHA 2YR2A 5K5QA 2ISYA 5LGNA 1IUYA 3DEUA 3KE2A 2IRFG 2UWMA 3F8NA 3U9GA 3SHFA 4YIFA 4ZYHA 3KLNA 5FB2A 3FX3A 4H0EA 5DUIA 3KFWX 4O6JA 3Q9SA 4N9IA 3E97A 2NRAC 4I2OA 4EJTA 3DV8A 4IXAA 1SMTA 2E1NA 4U7DA 2L4AA 2FSWA 2LKPA 3K69A 1J59A 2XV4S 3VOEA 4BH9A 4BQAA 4LMYA 5CVVA 4HOBA 1YYVA 4JK1X 5CVUA 1Z6TA 3RYRA 1KQ8A 3FWEA 2BBYA 4IRGA 1FLIA 4XLNF 2CW0F 1XMAA 1WKMA 5HVQC 2EV6A 5L3BA 3BP8A 3E6MA 2FE3A 4RGUA 3BJ6A 2EA4A 1H0MA 3V7RA 3FXQA 1OMIA 2RKHA 2F2EA 2PFBA 1S6LA 4KT5C 4LLNA 4QWQA 3H92A 1OYYA 1GHCA 3L09A 4ON0A 3DXJF 2DT5A 1IZ1A 4CZZA 2ZJ2A 4N9HA 1LDKB 2YX4A 3AAFA 1YG2A 5D6EA 4L9NA 4M9XA 3V8JA 4WF2A 3RKWA 2MH9A 1O57A 1O3QA 2Q2EA 4MTEA 4OMZA 2HKXA 1IN8A 5BOXA 3RPUA 2QBYB 5IT3A 2EFOA 2BE5F 2O6GE 3I5UA 4A6EA 3K9TA 2FU4A 1YLFA 1BBYA 2RVCA 3VB2A 2FNAA 2F5DA 3OV8A 2KJCA 1DUXC 4RB0A 3CUQA 4R79A 4CGZA 4GYGA 4JBAA 4FHTA 1IN6A 4MGRA 1J7KA 4NHJA 4PGGA 1YIOA 1ZN2A 5BMZA 2D1HA 4N0BA 1TNTA 1JGSA 5H6QA 5FFXA 2YSRA 4AIJA 2OD5A 4HF0A 3J7AO 1T6SA 3CDHA 3HHGA 1STZA 5D5VB 2ACJA 3HSFA 4EMSA 2Y0MA 3GFIA 2IJLA 1OYWA 1ZGJA 2A3SA 3WTTC 1RI7A 2IA2A 2A6HF 3K0LA 2XASA 4G7OF 2A07F 2OZUA 2ZXJA 4HLXA 1OR7A 4ZYEA 1XCVA 3BPXA 2FQ3A 2MD5A 1L3LA 2K02A 1KU3A 1J9IA 4Y13A 2YPRA 3K1MA 5AIPA 2WC2A 3PFIA 3JAMZ 4HW0A 3KP5A 2HR3A 4EGYA 1EH6A 3F8CA 4AWXB 1EH7A 4GCVA 1FPQA 3F8MA 3FMSA 3FXRA 2RNJA 1WI9A 4A2UA 2GIVA 4IVNA 2ZNZA 5DCMA 3I4PA 5KVRA 1IXSB 2KJBA 3MQ0A 1F5TA 3SZPA 3Q5FA 4I02A 3V4GA 3F6VA 5J8FA 2DFIA 4BHPA 1U8RA 4IRIA 2DQLA 3GW2A 5JVTA 3OOPA 1BIBA 2V1UA 4RGRA 1FBUA 1LDJA 2ELHA 2FBKA 1IRGA 2P6TA 2JPCA 4EJWA 4O3MA 1U5TB 3F23A 2ZBKA 2QQBA 1Z1DA 3FMQA 1W7PA 2IA0A 5FLXK 1IXRC 3R60A 5LRSA 4RGXA 3JSPA 2OQGA 2HGCA 3F3XA 1XGSA 2WV0A 5IT9K 1R7JA 2KIUA 3COAC 4ESFA 3I58A 1JHHA 4RAZA 5ICFA 3WTZA 5ICEA 4KN7X 4LK1F 5E20A 3CUQC 2R3SA 1YTYA 1IXCA 2DK5A 1DP7P 3GWZA 2QYOA 5TRDA 4KIFA 4LB6B 1WQ2A 4B09A 3ZMSA 4TV7A 1RUOA 1QNTA 4WCGA 3LAJA 5HS8A 4Y15A 2JZYA 3BJAA 4I0BA 5DV5A 3WODF 1Z7UA 3T0YA 4L5JA 4ZYGA 1SD6A 5D4RA 3LQRA 5D6FA 2KIFA 1XDSA 2PI0A 5HLIA 5DYMA 2OBPA 3F72A 4I0AA 1F1ZA 2CFXA 4U0VA 1MDMB 4M74A 3DP7A 3QU6A 2IW5A 2R7DA 3KCCA 4KMUX 1R00A 2DU9A 1U78A 1S8NA 4PGHA 1TQIA 1P2FA 3WG9A 3IKVA 4UVAA 3RPQA 3R4KA 5D4SA 2K4BA 1ZG1A 1J5YA 2H6CA 5K1YA 4WXDA 4LLLA 3T8TA 5L3EA 2BEOA 1S29A 3WTWC 3GZ6A 2FMLA 1FY7A 1G3YA 1R36A 1XGMA 1WSUA 4UUVA 3I53A 4KN4X 1FC3A 1ZLKA 2DQRA 3DFGA 4HX8A 3TOAA 4BHCA 4Q5SF 2WWYA 2HKOA 4CO8A 2FMYA 1K78B 3SZTA 1QGPA 3QOPA 5IT9Z 4OU0A 1KYZA 2NS0A 1XGNA 1Z91A 1ZREA 3HTSB 4P5OA 5LEJA 3FMRA 1D5VA 3MZYA 5HLGA 4YFXF 2V9VA 4EM1A 4LJZF 4RS8A 3NRVA 3HSRA 5AIQA 3KP6A 3I64A 1T0FA 3JSOA 1XSDA 4MTDA 4P55A 2L02A 1ODDA 2P8TA 3M9AA 1L0OC 1ULYA 3QPTA 3TGNA 3JTHA 5D8LB 1Y0UA 1O3TA 5KK1A 5FD5A 2V6CA 3WTSC 4BYYA 1UHMA 2VOPA 1PP8F 3ZMUA 3GFMA 4XSXF 1PP7U 2QZ8A 2QBYA 2VN2A 1T39A 5BPIA 2L54A 1WRJA 2IP2A 4PCQA 3ZPLA 2Z99A 1HXDA 4BXUA 3FF5A 2HEOA 3K1NA 4FT8A 2STWA 1F4KA 3ABTA 3WTYC 2V1DA 2OAZA 4A0XA 1YS6A 3P9KA 1W5TA 3BROA 1ZAOA 2FRHA 4LFUA 2EV5A 1NHAA 2YX7A 2G7HA 4OIPF 1RUNA 1IRFA 2JRTA 2ETHA 3FXUA 2EV0A 3E3VA 4L0ZB 2PMUA 3LA3A 1KQ0A 1QZYA 1P4WA 3BZ6A 2VBZA 2HTJA 2RN7A 3IRRA 5K5RA 2A6EF 4ENKA 5J8CA 1HSTA 3I54A 3RDIA 2H09A 4BNCA 1BI3A 1FZPB 1KGSA 2M8EA 1BJAA 4EQQA 4XBFA 2OZ6A 1I1SA 3E5XA 1USSA 2W24A 4GYIA 1BOAA 4UVBA 3PQJA 5BQTA 4EV0A 4HV5A 3C1DA 3E6DA 1DDNA 3EDPA 1G3TA 3KP7A 1ZG3A 2KKOA 1BC8C 5FD6A 2J5OA 1B9MA 1YW7A 5AONA 3KZZA 4WK8F 1P6RA 5ICGA 1EH8A 4P9FA 5HLHA 3QAHA 2O03A 3J80Z 1XN7A 2MBFA 4GGGA 4L9TA 4EJUA 3ELKA 4LB5A 4PZJA 4HA8A 2P4WA 2EFNA 2C6YA 1FP2A 1W7PD 3JAMK 1R1TA 3Q9VA 2W25A 3CO6C 3O6BB 4YIIA 3GLXA 2R7FA 3RKYA 1K6OA 1FOKA 3LFKA 2MC3A 1H9TA 2F5EA 2P5KA 4YFNF 2VOOA 4BAYA 3GEZA 3QP6A 1G3WA 5E8GA 3ECHA 3ZQ7A 1O7FA 3LWFA 3G73A 1H9GA 3IWFA 3RI4A 5L3DA 4OIRF 4LG0B 1XCBA 5LHIA 2XHKA 1U5TA 1IN4A 1YS7A 1HQCA 4EVIA 4G6DA 2E7WA 4P9UA 1FSHA 2RV8A 2HQNA 3V7CA 3T8RA 2CYYA 4NB5A 3J81K 3RKXA 5F64A 1YO5C 3CJNA 1HKTA 1BN5A 1AOYA 2VBWA 1HSJA 3DPLC 4D0PA 4G6QA 4I09A 4L18B 3IL2A 2JSCA 1ZH5A 2COMA 3M7GA 3QP5A 2LF8A 4IPAA 1U3EM 2PN6A 2ZNYA 4UXNA 1ZHFA 3KP2A 3CO7C 5L3GA 3BPVA 2XGXA 5CYVA 3V8LA 4KDPA 1XSVA 1FYKA 1ZARA 2QWWA 4HBLA 3MAJA 3P9IA 2ZKZA 4HAMA 4HQEA 1TW3A 5E1WA 1LDDA 2H27A 2X0LA 5F6FA 3BOQA 1D8KA 2UXXA 3TQNA 4B8XA 2B0LA 2L01A 4ASNA 2O61A 5D5WB 2FBIA 3V7SA 1SD7A 4L5IA 4MEXF 5A2QK 2M87A 3GX4X 1MDMA 4QLCU 3MWMA 1R22A 2VXZA 3KETA 3WU0A 1ZGAA 4M6XA 3N97A 1IN7A 5H20A 1D3YA 2VE8A 2VT2A 1PDNC 4RB2C 3I59A 2ADUA 2DPDA 5L3FA 5ERIA 2M30A 3SQNA 3E6BA 3F21A 5HS9A 2E1CA 2GQQA 1KU2A 5E17F 2XAJA 1YFHA 1U6GA 4G8XA 3DQVC 3J81Z 1OYIA 5ED4A 2XAQA 2CGPA 1I27A 1K78A 4WX9A 3TOBA 1SMYF 4Z2YA 2GZWA 3KZYA 5ICCA 3W6KB 1G6NA 5HOOA 1MZBA 3C7JA 4A0YA 4ESJA 3CTAA 1B1BA 1S7AA 3KLOA 4Q48A 4BHBA 3NEUA 1U5TC 1LEBA 4KA4A 4UNOA 1DPUA 2GXBA 4UV8A 2DK8A 2O0YA 1WWXA 5DUKA 2D45A 2RDPA 2VC1A 3PQKA 1CGPA 2CG4A 3REOA 1IF1A 3GFLA 4CDGA 1ZYRF 2ZFWA 2IPQX 1LNWA 2WTEA 2MLKA 4XSZF 2Q8KA 4EM2A 2O8XA 2GWRA 1FT9A 3IC7A 5A2QZ 5DDGA 4KIGA 3RIRA 3C3WA 5LHGA 4MQVA 1R1UA 3TDUC 2QLZA 3U1DA 2EFWA 3RTRA 1R23A 2H6BA 3N4MA 3KEQA 4HDUA 4PDKA 4WXHA 3GYHX 3WU1B 1C0WA 1SFEA 2HFHA 1MJAA 2EFPA 2OQRA 2HTSA 4OIQF 3ZN1A 1SD4A 4HLYA 5LGUA 3BWGA 5HDGA 4OIOF 1Z05A 3BJOA 4FX4A 1U2WA 1ZLJA 2E7XA 4A0ZA 2F5FA 3VEPA 2CQKA 1LJ9A 2FEZA 3HRSA 4KNYA 2PLYA 1UB9A 3I59B 2M5WA 4G7ZF 5CVIA 4A12A 1JE8A 1MGTA 2W85A 2FNPA 3G3ZA 3O2PE 2MH2A 3NQOA 1UHWA 1MD0A 1QO0D 4HZFA 4Y17A 4HF2A 5ILUA 2DW4A 5CVJA 6PAXA 1FWZA 5FFZA 2XIGA 1GVJA 3WGGA 4LLGF 2XROA 2RGVA 4OMYA 4HV6A 1BC7C 1XD7A 1K79A 3CLOA 1SAXA 1ZRCA 1QPMA 4MEYF 4K2EA 3L9FA 3KEOA 2L4MA 5JHUA 3L7WA 1O3RA 4ZYDA 2XKOA 2M1BA 5ILSA 2IT0A 2Z5UA 3WTUC 2GA2A 2NNYA 3ECOA 2LF7A 1XDUA 3ZMVA 3K2ZA 2NYXA 2FF4A 2XRNA 2Z3YA 4RGSA 3CUOA 4ENNA 3DPTA 3J80K 2HYGD 5HDNA 2DPUA 1YQAA 2QUFA 3H3UA 3RYPA 4S04A 2DTRA 1ONVA 1I1GA
chains in the Genus database with same CATH superfamily
4AC0A 2MLGA 3DLLF 1R58A 4V19K 2NOJB 5K7FA 1W36D 2QENA 2CUFA 3M8FA 2PEXA 2LP0A 2EK5A 4LG0A 5M3MJ 3F6OA 4IQ4A 3FISA 2H1KA 5JI6A 3OYEA 3OYFA 4RA2A 2CO5A 3LMMA 2CU7A 1LVAA 4P1WA 2FA5A 4KMFA 4I01A 2VODA 4NQWA 3EETA 4ENJA 3RCOA 5F27A 1FBSA 4CICA 1E17A 4IHYA 4N4NB 1HC8A 2AS5F 1ON1A 1MMSA 1HW2A 3ZQGA 1MSFC 5FROA 1TQMA 4WWCA 2V79A 2MA3A 2XPWA 3BTIA 2HXOA 3TL4X 2PQ8A 1D1BA 1FMWA 1OCPA 2BGCA 1FIPA 2KT0A 3EUHA 5D5UB 3HKZA 5KNLA 4PUSA 5LBQA 3CCSI 1UFMA 3ZGKA 1X4OA 5F1JA 3HOUJ 3CCYA 3S32A 5JLXA 2JVHA 4L9VA 2B7EA 1SANA 3M4OJ 1TQPA 1QZZA 3RKQA 1Y39A 1IV6A 4ESBA 1HBXG 4DJAA 2X6XA 4LK0F 4KIBA 5GTHC 5CPRB 5J6XA 4BXXJ 5FKOA 4RM2A 3QPSA 2E34A 4GO1A 4ZZLA 2FJ1A 4E7ZA 1FYLA 4IQJA 1ERDA 4MNUA 3HM5A 5HDKA 4YRVA 1JHFA 3MVPA 5B66C 2I10A 4U7BA 1A31A 2LY2A 4FE4A 3TDZC 4EJOA 2A5YB 2B9SA 4G7HF 4G6TB 4FETA 5CJ9A 3WG7H 3CCMI 3FM5A 2J5PA 2PJPA 3C2GA 3BY6A 2K9NA 4M72A 4M3BA 4MFEA 3RSNA 2KZVA 2H8RA 4A5NA 1QVTA 3ROUA 4ENMA 5C4XJ 4HYEA 4O5VA 5HS7A 4KUMA 2A69F 5CLSA 4AIKA 4I7HA 1J75A 4U87A 1JXSA 1FBQA 1RIOH 4IHSA 2FQ4A 1MKMA 1S5LC 2IS2A 2IA1A 3CJTB 1BI1A 3DBLB 4DQ2A 2Y0SA 3E5UA 1V5FA 3WGHA 3WGIA 4IEJA 1K4TA 5EG0A 1E2XA 3CMEI 1SFUA 3CMMA 1PUFB 3WTXC 5J3LA 2XAHA 1X1CA 2CV1A 3S17J 3LA7A 2HYFA 3JW4A 5E1ZB 1Y56A 4LGWA 2STTA 2AHQA 3QODA 2QQAA 3AL0B 1O3SA 2WAEA 2W82A 3AG4H 4HNVA 2IS1A 2COBA 1R5HA 3VPRA 3AG1H 3U21A 1MMDA 5B3SH 3TO6A 2EJRA 3W2VA 4M9ZA 4DBRA 2IBDA 3L2RA 2R5ZA 2ELJA 3GLLA 3W2WA 5J40A 1KYWA 4E7SA 3JTGA 2L7MP 3C2BA 1EV7A 1IDZA 5E79C 1HKSA 5CVRA 2Y9ZA 2CJJA 5EEGA 4M73A 4II2A 3HOZJ 3HUGA 3CF2A 4MQ9F 2W84A 1ZR2A 4AYBN 2R7TA 1LVKA 3HL2A 1RRJA 5D5XB 5ILVA 3GFJA 1F9NA 3FIWA 4ETSA 2ESNA 4EGZA 4CSWA 4E6KG 1BW5A 5E1XA 1I5ZA 5LRRA 1Z6RA 3LSMA 2G7UA 5LLQA 1REPC 2HDDA 2JK3A 2Z33A 3BG6A 4L9JA 3P7NA 5B1AH 4C9YA 3ASNH 4ITVA 1QQIA 4DIQA 2A68F 2VC0A 3GVAA 1ZRDA 2HPIA 4ZZDA 3EUAA 3VSKA 4F92B 1HW1A 3FXOA 2QQ8A 1DP3A 2OPTA 3K1PA 2WY8Q 3PSIA 2HWVA 2HOTA 1BL0A 3GXOA 3QPLA 3ZMTA 1BI0A 3I0TA 1TWHJ 3K10A 1JUPA 3TO7A 3ULQB 4MLOA 2ECCA 1W5SA 2PMHA 1MW7A 1YW9A 3FM3A 4XICA 3U2RA 3OYCA 1ETOA 1WJAA 2X51A 2ZC2A 4M6YA 4M3EA 1VQ4I 4M3DA 3RZDJ 2K40A 2K9MA 1W4MA 3ABLH 2DI3A 2VKDA 3BR3A 4Y33A 4CXFA 1Z7LA 2BY3A 1HKQA 3SFZA 4KISA 1SFXA 1OCTC 2K5CA 4HX7A 4U88A 1G3SA 2PBIA 5LGTA 4AIHA 2MFZA 3IHUA 2VT3A 3EYIA 5L3CA 1K83J 1FIAA 4E70A 4MHGA 2EIJH 4CCJA 1Z9CA 2I5UA 3WU2C 4G12A 4S05A 4NC7A 2O3FA 2Q0OA 3OSGA 3S1RJ 4RB3C 1QBJA 2HVSA 3GCMA 4Z6YA 3I56I 4XORA 4BQNA 2P5LC 4L0YB 1TLHB 2F5CA 3K4KA 3ZP5A 4BDZA 3WE3A 1B59A 2XAGA 3VFZA 3H0DA 5EEHA 1LQ1A 4R8HA 4MIMA 3EUHC 2LYCA 3E5QA 3IWZA 3JRIA 3ZRGA 2OJED 4G94A 2ELKA 4HF1A 4WXCA 2YUSA 4W1UA 1XB4A 1T33A 3BZKA 1VQ5I 4Q47A 2XB0X 3K4JA 3GO5A 4OOIA 1VQOI 2ZJRF 3E6CC 2VBYA 4IJAA 4II3A 4Y7NJ 5K5OA 1XMKA 2K4JA 3MFKA 2GXGA 2HNHA 2VONA 1IV8A 3CZ6A 3HIFA 4KICA 3OYMA 5DEQA 2X6WA 4NC6A 1X19A 1IAWA 3HRMA 3H5NA 3ZN0A 2EWNA 2P7VB 1QZEA 1JUMA 3G2BA 3M07A 2XAUA 3K6GA 3F0CA 4IL6C 2DBBA 2QM3A 2V9PA 2KLOA 3LNQA 1J2XA 3VSLA 2M7BA 3HEFA 2QSFX 3HGGA 2HVRA 2EZHA 1Y1VJ 1MJ9A 1AWCA 1B6AA 2WAQA 2DYRH 1A04A 2BYVE 4A3EJ 1S3JA 1YJNI 5E8IA 1T2KA 1XGOA 3Q0WA 1V3FA 2BV6A 1USTA 2ZJPF 1OPCA 1TBXA 3MCZA 4IO9F 3ZQCA 2QVOA 2P7CB 3FK7A 1QRYA 3N05A 1FYMA 1LEAA 3A0HC 5C44J 4RDUA 1IN5A 4A3BJ 4B44A 2HDCA 2HS5A 3Q0UA 5JR3A 5FJ8J 5BS6A 3ABUA 4IF4A 4QIWN 1TNSA 2L7ZA 1SD5A 2JT1A 5F0HA 1I3AA 2HZTA 1VF9A 3W3CA 3OSFA 1TT0A 1TWGJ 1T98A 2A61A 3LSPA 4XRSA 2DLLA 3D0SA 2ZMEA 3VYUB 2DO7A 1J0RA 1OCRH 2VXDA 2JVGA 2VBXA 2KRCA 4CCKA 4B1RA 4Q4ZF 2R7SA 2ZCWA 1I6XA 1DGWY 3B73A 4DOZA 4YIRX 1ZRFA 3VWBA 1O7LA 5JFRA 2DODA 1OISA 1XPXA 2Z16A 4C3HJ 2HQRA 3OL3A 4ZH4F 2OUMA 4FX0A 4RAGA 4HSRA 3W6JB 4M3FA 4DYRA 5DD4A 1S7EA 3HHHA 2R7RA 4XONA 4HSTA 3QRFF 5LHHA 3DLAA 2P6SA 3TKYA 1T38A 4P96A 1MJBA 3L00A 3T5XA 1X2NA 2OU2A 1KZHA 2ISZA 2M2EA 4YFKF 2EFQA 3LSGA 4CHUA 3JRCA 2OTLI 3P9CA 4HX4A 4XRFA 3WE2A 1V5GA 1OCCH 3QU3A 3WHBA 4BU2A 1W0TA 3QPHA 2VUMJ 2FBHA 1LPQA 1YOVB 3JCUC 3D5LA 3DEEA 4A5MA 5E3NA 1IDYA 1V4RA 1R71A 2DA2A 1D1CA 1V55H 1CF7A 2W48A 1FP1D 1FOYA 3E7LA 4E7LA 2E19A 1HLVA 2CUZA 2UZKA 1QVUA 1V5EA 4ZYAA 5DCFA 2QKLB 2XKPA 4A3MJ 2MYSA 5FRMA 1FX7A 4U0WA 3VODA 4HDVA 5H6RA 3CUQB 2CV0A 4A69C 2CWEA 3MKLA 2R7QA 4XLPF 4OINF 3V42A 3M8EA 1B4AA 4BE0A 3PNYA 2E36A 2MSYA 2PMZN 2Y31A 3FHZA 1NG6A 1P7IA 3OR1C 2V1XA 2D1VA 3ZR8X 3HTUA 2P81A 3O8HA 2NNNA 3FZVA 2ZO4A 4IHTA 3HYIA 4B48A 1P4AA 1WH7A 3GTPJ 4FASD 1W36C 2D2WA 2NOGA 3H1CA 1NG7A 2GOXB 3IKTA 3RQIA 5DD8A 1VTNC 2Z9OA 3TO9A 3HRTA 2K7LA 1P92A 3OIQA 3HXLA 3M1EA 4LOCA 4F7ZA 3WTVC 2QGUA 3F8BA 3CDLA 1MBGA 2WBMA 3S2WA 4A6DA 1Q1HA 4B3AA 3BCAA 3GUDA 1NH3A 2EILH 3R0JA 2XVCA 4XQFA 4XN3A 3O3KA 4EM0B 5HLTA 3FXKA 2ECBA 2EB7A 3R0AA 2F48A 4XOPA 2UXNA 5FGMA 5BPDA 2W57A 4C30A 2LNBA 2MGQA 3IRQA 2O9LA 3KP3A 2FX0A 2GA1A 3HRUA 4OAZA 1X1AA 1E0EA 1GXQA 3H5RA 4PJMA 2IXSA 4EJVA 1HW5A 1BIAA 3KP4A 2VASA 1ZR4A 3S3OA 4M9SA 2OTJI 2LFBA 1PUEE 3HOTA 1SEUA 1IW7F 1JTXA 1IG7A 4IOAF 1X3UA 3LAPA 1KA8A 3GF2A 2AQEA 1EJ9A 3A4CA 2DMUA 4UHTA 3HOSA 3UKGA 2GIZA 2XUBA 5KAFC 9ANTA 2DAOA 1TW2A 2RC4A 2TDXA 2QQ9A 2R93J 5FO5A 1JTYA 3SZGA 1R6RA 2KPMA 2HDWA 2M45A 2EPFA 4CCOA 2LSOA 4LD5A 2E5ZA 3I71A 1X3WB 5IOYA 4BEHB 1WCMJ 4RB1A 2G9WA 3ERED 5F1RA 1G4DA 2CQXA 2ZB9A 4DNCA 5JVGF 4ZJZA 2L3DA 2ZMEB 1WVRA 2YU3A 2KIMA 3EYYA 1TTYA 2D5VA 4A3LJ 1TWAJ 1RNLA 1MMGA 2QF7A 4Y52J 3CCQI 2P5VA 2YU9J 2AQFA 2CQNA 5D8KB 5TJJA 2E1MB 4UV9A 1S7OA 3V8KA 3LSTA 2R7ZJ 3NARA 4KYWA 4G9YA 5DCMB 1PUFA 2XAFA 4AVPA 2BOLA 2E5NA 1OCZH 3LQQA 1WJEA 1WJDA 2JA8J 2AXLA 4HQMA 2R92J 5E3MA 2LOOA 3J7AY 2H94A 2VPLA 4I98B 2RQPA 1A36A 1P4XA 4JQFA 3RJPA 5EEAA 4R1HA 5FLXZ 1XTAA 4BACA 3CP8A 2EZLA 3BDDA 4M71A 3K2AA 1R49A 3VDXA 3K70D 4XLHA 1K7AA 2K86A 5E3OA 3PIOF 3BT9A 2LKXA 1U9OA 1LFBA 2LH9A 4RAYA 1KU9A 4CYDA 3ZMZA 2EINH 3ZQLA 2LDUA 5HODA 2PG4A 2Y48A 3UR3C 1S9HA 2JA7J 1YW8A 3T1BA 1CF7B 4UVCA 2IVMA 1JKPC 1ETKA 1E3OC 3MD2A 2EA2A 1YX3A 4XMYA 2O8KA 2DMNA 3R61A 1R5GA 2BZTA 1W7PB 3R6SA 1ZG5A 2Y75A 1U0JA 1KU7A 5HNFA 1X1DA 3GZ5A 4KFCA 2JA6J 5M5YJ 3EUKL 5FRNA 1VI0A 4AD9A 3B02A 3ISPA 1Y6IA 5F0CA 2ZSIB 2VE9A 1ON2A 4YEJA 1MNDA 2IGKA 3C18A 4XKVA 2HOEA 2LG4A 3S93A 3ZMDA 4J00A 4A3IJ 3L2CA 2QEXI 3ZQFA 3MZHA 4HG2A 5JLWA 1KQ9A 5E18F 3L2QA 4A3FJ 1D8JA 3SXYA 1FNNA 2Z2SB 1Y0NA 2M4GA 2K27A 1UG0A 5J4VA 2LKSA 1DPRA 1R4MB 1H8AC 3AG2H 1OKRA 2CSOA 2Y69H 3EQLF 2HOAA 3DKWA 3TBIA 1APLC 2XRLA 1GXPA 4IHXA 3ML6A 2FOKA 3BR5A 1LKXA 2X4HA 1R1VA 1B9NA 3H3ZA 1BI2A 2R7XA 3CCRI 4HNTA 3I4MJ 2JPBA 2V6EA 5LEKA 2NAZA 3BG5A 3DTKA 2KRFA 3DF8A 2TRTA 3HSEA 4GXOA 2M34A 4U0YA 2PJRB 3LA2A 2DMTA 4BQQA 1SVOA 3AFHA 4X1EA 3F8FA 2FXAA 4IRHA 1LB2A 4RMNA 2WY7Q 2LVSA 1RZ4A 4CYCA 3S8PA 3PUBA 2GAUA 1UCRA 3IH3A 2GM4A 3ZOBA 3CC2I 1BM9A 3MEXA 1JKRC 1FSEA 1XSXA 5IPAA 2OA4A 2VJIA 3F22A 4YG2F 2EBIA 2ZXHA 1UMQA 2BXYA 1FTTA 2JTVA 4XLEA 2ESHA 2YR2A 2IGOA 3CJQB 1DU6A 5K5QA 2ISYA 4C2TA 2Y30A 1XMXA 2ID3A 5LGNA 2DT6A 3QQAA 2KHMA 1IUYA 3DEUA 1U9NA 3KE2A 3OWTA 2IRFG 2UWMA 2XB5A 3FHNA 3F8NA 2NVXJ 3U9GA 1N25A 1AHDP 5KAIC 3SHFA 4YIFA 1K61A 3CP2A 4ZYHA 3CCJI 3KLNA 5FB2A 3OYKA 3A01B 1J09A 3FX3A 4H0EA 4PFPA 2BHZA 5DUIA 3KFWX 4O6JA 3Q9SA 4N9IA 4XLFA 2DOAA 3K7AJ 3E97A 2NRAC 4I2OA 3ZQHA 4EJTA 3DV8A 1Z77A 4IXAA 1SMTA 2E1NA 4U7DA 4A3DJ 2L4AA 2FSWA 2LKPA 4IKFA 3M8JA 4UUSB 2IGNA 1GV2A 3K69A 1J59A 2XV4S 1ZKGA 4I76A 4QSHA 3S3NA 3HDDA 3VOEA 4BH9A 4BQAA 4LMYA 5CVVA 3BG9A 4HOBA 1YYVA 3KYLA 4JK1X 5CVUA 1Z6TA 5C3EJ 3RYRA 1KQ8A 3PL8A 2RAEA 3FWEA 2DT7B 3NAUA 4CZCA 2BBYA 2NVYJ 3CC7I 4IRGA 5J1YA 1FLIA 4XLNF 2BVMA 2CW0F 4RLQA 3AL0C 1XMAA 1WKMA 3JR9A 3U1KA 5HVQC 2EV6A 5L3BA 3BP8A 3D5RC 5H2FC 3E6MA 4E4HA 2FE3A 3PO3J 4RGUA 1F43A 3BJ6A 3CF5F 3GTKJ 3BCBA 3HGYA 2EA4A 4AIDA 1LFPA 2RNGA 4IHVA 5IP6A 1H0MA 5FLMJ 1BW6A 1FOXA 3H36A 3V7RA 3CCLI 1D0YA 1OMIA 2Z1DA 3FXQA 2RKHA 2F2EA 3OIPA 3IAS2 3HPHA 2PFBA 1S6LA 1O4XA 4KT5C 4LLNA 4QWQA 3H92A 1OYYA 1GHCA 3L09A 1TL8A 5IOZA 4ON0A 3DXJF 1UHSA 1IZ1A 2DT5A 5EYRA 4CZZA 2ZJ2A 3SJMA 3FXMA 1YX5A 4N9HA 3K4CA 1LDKB 2YX4A 1YG2A 3AAFA 4PJJA 4PJNA 5D6EA 4E7KA 4L9NA 2M0MA 2VI6A 4M9XA 3V8JA 4WF2A 2JSPA 3RKWA 3OYGA 4BQOA 2MH9A 3GTGJ 1O57A 4A3KJ 1DQUA 1O3QA 2Q2EA 2XSJC 4MTEA 2F5VA 1QU3A 4OMZA 2HKXA 3SEQA 1NK2P 1IN8A 1LFUP 3L1PA 3IH2A 5BOXA 3RPUA 2QBYB 4FISA 5IT3A 3CCUI 2HYJA 2EFOA 2KQRA 1ETWA 2A5WA 2BE5F 4J01A 2O6GE 3I5UA 3PNTA 4A6EA 3K9TA 3OYBA 3JRHA 3S3MA 1FOWA 4KITB 3BC8A 2DXIA 2FU4A 4J19A 2GLOA 1YLFA 4GDFA 1BBYA 1N75A 2RVCA 3VB2A 2KDZA 2FNAA 1WGXA 2F5DA 4V2FA 4CYCB 3OV8A 2KJCA 3GZNB 1Z21A 3HKZN 5BNGA 4X0GA 4BBSJ 1DUXC 1UELB 4RB0A 3CUQA 2R4GA 5GPAA 4R79A 4CGZA 1YIJI 2WV1A 2NVQJ 3IAM2 3MKZA 3HPGA 3S1NJ 2X9DA 1PJRA 2EZKA 2F4IA 2K85A 2DDBA 4GYGA 4JBAA 3OR2C 2HQAA 4FHTA 3SFIA 4BKXA 1IN6A 4MGRA 2KL4A 2GXAA 3G4SI 1J7KA 4NHJA 1MBHA 4PGGA 3AKZA 2X6OA 1YIOA 2IS4A 1ZN2A 2N8GA 5BMZA 2D1HA 2ZJQF 4N0BA 2R7VA 3ZCOA 4XR6A 1TNTA 1JGSA 1WI3A 2VKEA 3K4MA 1FTZA 2VKHA 1EA3A 5H6QA 3BR2A 5FFXA 2YSRA 4JYKA 4ABZA 3PO2J 4AIJA 2OD5A 1MSEC 4HF0A 2CS3A 3J7AO 3KZIC 4UB6C 1T6SA 3CDHA 4E7HA 3HHGA 1STZA 5D5VB 1D0ZA 3RZOJ 4XM3A 4XLCA 5J1RA 1X1BA 2DFHA 2ACJA 1ZELA 2OF7A 2R5YB 2DMPA 3F9KA 3HSFA 2Y0SN 2Y0MA 5FKKA 4EMSA 3GFIA 3WHCA 5EGOB 2IJLA 1Y1WJ 1OYWA 4B47A 1ZGJA 2A3SA 2BY0A 3WTTC 1RI7A 1SAUA 2IA2A 2A6HF 1X3ZB 2XASA 3BQZA 2DTZA 3FBIB 3K0LA 4BJTA 4UB8C 4RBOA 1JKQC 4G7OF 4XKWA 2A07F 1RKWA 2XDVA 2OZUA 1R9TJ 2VLAA 1MNMC 2ZXJA 3FBNB 4HLXA 1OR7A 4LG3A 4ZYEA 1XCVA 4RM3A 3BPXA 2FQ3A 2MD5A 1L3LA 1MNEA 2JN6A 2K02A 1MIJA 4DW6A 1KU3A 3KYCB 1Z3XA 3H0GJ 1J9IA 2KFDA 4Y13A 1WH5A 2YPRA 2R7WA 3K1MA 2YS9A 2WC2A 5AIPA 3PFIA 3JAMZ 4HW0A 3KP5A 2HR3A 3G1OA 1ETQA 4BEHA 5DS9A 1JKOC 3CESA 4EGYA 1EH6A 3F8CA 1P9QC 4BL0B 2X85A 2DOEA 4AWXB 1EH7A 1PVEA 3ERMA 1YITI 2WAFA 4GCVA 1FPQA 3F8MA 2L9VA 5J47A 3S14J 1VQ8I 3HOXJ 3FMSA 3FXRA 2RNJA 1WI9A 3HOYJ 2NVTJ 4A2UA 2GIVA 4IVNA 2ZNZA 3OYDA 5DCMA 3FXLA 1ENHA 3BR1A 5EF6A 3I4PA 2TCTA 4FCYA 5KVRA 1IXSB 1GV5A 2KJBA 3MQ0A 1F5TA 3CQZJ 3LSHA 2V4JC 3SZPA 3Q5FA 4I02A 3V4GA 2O7OA 3F6VA 4BY1J 2JUGA 3TEDA 1GT0C 3SDGA 5J8FA 3B6CA 4Y3OA 3DTIA 3CMYA 2LK2A 2DFIA 4ZDPA 2Q2EB 4BHPA 2X6YA 4BUPA 1U8RA 4N4OB 1YE9A 3ESWB 4IRIA 2DQLA 3GW2A 5JVTA 3OOPA 1POGA 1BIBA 2V1UA 4RGRA 4XL9A 3K70C 2WB1A 1E3PA 1FBUA 1JGGA 1LDJA 2X48A 2ELHA 2RREA 2FBKA 2V7FA 2VQGA 2LY9A 3PSFA 1IRGA 5IY5H 5FKNA 2P6TA 2JPCA 3J7YJ 2DCEA 4EJWA 4O3MA 1U5TB 3F23A 2ZBKA 3BTCA 2M8GX 2QQBA 1I6HJ 3GTOJ 3OYHA 1Z1DA 3A1YA 3FMQA 1W7PA 2IA0A 2XPUA 5FLXK 2EZIA 1IXRC 1FJLA 2F4MB 3R60A 5LRSA 1YHQI 4RGXA 3JSPA 2OQGA 2HGCA 2V1NA 4A93J 1BA5A 3F3XA 1XGSA 1UJ8A 4BDYA 2IGMA 4EEFG 2WV0A 5IT9K 1R7JA 2DJIA 2KIUA 1RR7A 3COAC 4ESFA 3I58A 1G8XA 4F93B 1JHHA 4RAZA 2VQCA 5GAGJ 5ICFA 3WTZA 5ICEA 4KN7X 4LK1F 3MKWB 5E20A 3SDBA 3CUQC 3OOUA 1V54H 1BJZA 3O8GA 3DPUA 3TMOA 3VYRB 2R3SA 2CH0A 4ZTFA 1IXCA 1YTYA 2DK5A 1DP7P 2DA1A 3GWZA 4HRIA 2UUZA 3OMYA 2BY1A 2QYOA 5TRDA 4GFBA 1YI2I 4KIFA 4LB6B 3CDIA 1WQ2A 3BTLA 4B09A 2EIKH 3ZMSA 4TV7A 1RUOA 1QNTA 4WCGA 2PJRA 3AG3H 3HBLA 3LAJA 3QYEA 2ZXWH 5HS8A 4Y15A 1RR8C 3QYBA 2JZYA 3BJAA 4I0BA 2WAQN 4KT6A 5DV5A 3WODF 3I55I 3GTQJ 1ETYA 5GP9A 1Z7UA 3T0YA 3G1LA 4L5JA 4ZC3A 2R7OA 2QSHX 4ZYGA 1BR2A 5FLVA 1SD6A 5CQGA 5D4RA 3LQRA 2A6TA 5IYCJ 5D6FA 5E3LA 1UAAA 1GDTA 2HVQA 2KIFA 2LD5A 1TT5B 5F08A 3A2KA 1XDSA 4BJ5C 2PI0A 3DCFA 3ZQQA 5HLIA 5DYMA 5K7ZA 2OBPA 1OR7C 5EDNA 3F72A 4I0AA 1F1ZA 2CFXA 1RESA 4U0VA 1MDMB 4M74A 4RAFA 1TWFJ 2JA5J 2CFOA 3DP7A 3QU6A 2IW5A 2R7DA 3KCCA 4D1QA 2ICWG 2MW8A 3ZQIA 3NWTA 4KMUX 2DA6A 3A01A 1R00A 2DU9A 2PX9A 5B1BH 1U78A 1S8NA 4PGHA 1TQIA 3DEWA 1P2FA 1GLNA 2XF5A 3IKVA 4UVAA 3RPQA 3WG9A 3MKYB 3R4KA 4F91B 4NDLA 5D4SA 2DMQA 2K4BA 2W1OA 1MBJA 2JMWA 1ZG1A 1IRZA 1JI8A 1J5YA 2H6CA 5K1YA 4WXDA 4LLLA 2DA3A 3T8TA 2ZMEC 4B4CA 5L3EA 4FQGA 4UUSA 1VQPI 2BEOA 1S29A 3H9JA 3WTWC 2FUG2 4XK4A 3GZ6A 1WHUA 2FMLA 1FY7A 1G3YA 1R36A 1XGMA 2DA7A 1WSUA 2L9SA 4UUVA 1QPIA 1HF0A 1R4NB 3I53A 2UV1A 3GTMJ 1VQ6I 4KN4X 1BR1A 4D5CA 2E1MC 5F04A 1FC3A 1ZLKA 1N78A 2DQRA 3DFGA 3K4BA 4HX8A 2VJJA 2OCEA 3TOAA 5IP9J 1N77A 4BHCA 4Q5SF 2WWYA 3DTEA 4LIUA 1SVMA 2HKOA 4CO8A 2FMYA 1K6YA 2IEKA 2BY2A 5GAHJ 5EZGA 3G6EI 3DBRB 1K78B 5J1UA 3KPHA 3SZTA 1QGPA 1VQ9I 5LD2C 2OV7A 3QOPA 5IT9Z 4OU0A 5CKTA 1KYZA 4DYQA 5EJCA 3S2DJ 2NS0A 5DTDA 3J7ZI 1XGNA 2BW3A 4F55A 1Z91A 1M1EB 4ANJA 1SFOJ 1ZREA 3HTSB 4JX5A 4P5OA 3RPUD 5LEJA 3NWSA 3FMRA 1D5VA 3MZYA 3LSRA 3GBGA 5HLGA 3LL7A 2HZDA 4YFXF 3OY9A 2V9VA 4M3GA 4FTHA 4EM1A 4LJZF 1T95A 4RS8A 3NRVA 4AYBA 3HSRA 5AIQA 1Y8RB 3KP6A 4AM3A 2LC2A 3I64A 2I8DA 3OL4A 1T0FA 3JSOA 1XSDA 4M6VA 4MTDA 1IUFA 1WJBA 1X58A 4P55A 3BG7A 4XRSG 2L02A 3TP0A 1ODDA 2P8TA 3M9AA 2F6CA 1L0OC 1ULYA 3QPTA 3TGNA 1B8IA 3JTHA 1Z67A 4L5EA 5D8LB 1Y0UA 1O3TA 5KK1A 5FD5A 4XN0A 2QA4I 2V6CA 3WTSC 4BYYA 3PFYA 5TISC 1UHMA 3ONQA 1JUSA 3GTJJ 1XX5A 2VOPA 1PP8F 3ZMUA 2G0EA 2LY1A 3GFMA 3Q0VA 4E7IA 4XSXF 4DYCA 2XPVA 2MG4A 4XIDA 1PP7U 2QZ8A 1ETXA 3OS2A 2VQHA 2HPMA 2QBYA 2VN2A 2B63J 1T39A 4XOTA 1P7JA 5BPIA 2L54A 3PM1A 4A3JJ 2LLKA 1Y8QB 1WRJA 3ABKH 2IP2A 4C3JJ 1K4SA 1VQMI 2VQLA 2EQRA 4PCQA 1JJ6C 2Z99A 1NK3P 5B5EC 3ZPLA 1HXDA 4BXUA 1HDPA 3FF5A 2HEOA 4IOCF 2K9LA 1B72B 1A6IA 3K1NA 4FT8A 2STWA 4UUTA 1F4KA 3ABTA 3PIPF 2JUCA 3WTYC 2XC7A 5M5XJ 2V1DA 2OAZA 4A0XA 2E71A 3KEYA 1YS6A 3MMYB 3P9KA 1W5TA 3BROA 5GTIC 1ZAOA 2FRHA 3C2HA 3TP3A 4AUXA 4LFUA 2EV5A 1NHAA 2YX7A 2DFFA 2G7HA 1W5CC 4OIPF 1RUNA 4XKCA 2DA4A 4KJZA 1IRFA 2JRTA 4BS9A 2ETHA 3FXUA 2EV0A 3FXJA 3E3VA 3KIOA 4NBQA 5F0FA 4L0ZB 3KX2A 2PMUA 1VQKI 3LA3A 2P0WA 1KQ0A 1QZYA 1P4WA 3BZ6A 2VBZA 3SEZA 2HTJA 5IYBJ 2RN7A 4HPQA 4DZPA 3IRRA 5K5RA 2OC6A 2A6EF 4ENKA 5J8CA 1HSTA 3I54A 2VJ4A 2LBFB 3RDIA 4BJ6C 2H09A 2HI3A 3L2UA 4BNCA 2ME6A 1MH4A 2VL8A 5J4YA 2DYSH 4QPOA 1SFKA 3JRGA 2XSDC 1BI3A 2NVUB 2R5YA 1FZPB 1KGSA 2M8EA 1BJAA 3CC4I 2E60A 3HJEA 3ABMH 4EQQA 1OQYA 5EGOA 2MABA 4XBFA 2OZ6A 1IC8A 1I1SA 4MFDA 2NS7A 2ZSHB 3E5XA 1ETVA 1VQLI 1U8BA 1X4PA 2IAIA 1Z3YA 1USSA 3L2WA 1JT0A 2V9KA 2W24A 4HNUA 4I6ZA 4GYIA 2ZFUA 2Q1ZB 1BOAA 4UVBA 5EZHA 3PQJA 1RC9A 1BR4A 5BQTA 1RPWA 4EV0A 2GOMA 3H3VK 4CA0A 4HV5A 3C1DA 3E6DA 3IH4A 1DDNA 3EDPA 5FKMA 4NUBA 1G3TA 3KP7A 1ZG3A 1MBFA 3ASOH 2KKOA 3HZJA 2M4KA 1BC8C 5FD6A 4DGWB 2J5OA 1B9MA 3ZXSA 1YW7A 5AONA 2DA5A 1WJ5A 3JRFA 1HA8A 3KZZA 2H1LA 2L7KA 4WK8F 2XF6A 3S1MJ 1P6RA 3LSKA 5ICGA 1EH8A 3HG9A 2BW3B 3EPZA 3OYAA 2E2HJ 4P9FA 5HLHA 3QAHA 2BXZA 3L2VA 1D5YA 2O03A 1VNDA 3J80Z 1XN7A 2MBFA 3BR6A 4GGGA 4L9TA 4EJUA 3ELKA 2DDAA 4LB5A 4PZJA 2K3FA 2XGEA 4MO7A 2NS8A 4HA8A 2L5QA 4PSXA 1XG1A 3I3LA 3BQYA 2P4WA 2EFNA 1VQ7I 2FD5A 3BR0A 3VYTB 5FKLA 3GTLJ 1LE8B 5IYDJ 2C6YA 1FP2A 1AKHB 3LSIA 1W7PD 1W1WE 3JAMK 1R1TA 2L7FP 4C3IJ 2CQQA 3G1MA 1KONA 3Q9VA 1OFCX 2W25A 1B8IB 3CO6C 3O6BB 4YIIA 3TW7A 3GLXA 2R7FA 3PNVA 3QWLA 3RKYA 2W4SA 1K6OA 1FOKA 1T0FC 2CW7A 2MC3A 2CUEA 3LFKA 1H9TA 3BLYA 2IS6A 2F5EA 2P5KA 2EIMH 4YFNF 2VOOA 2L0KA 4BAYA 3FKJA 3GEZA 4AU7A 3QP6A 1UG2A 2JA2A 1G3WA 2JWTA 1CQTA 1YJWI 5E8GA 1RETA 3ECHA 3ZQ7A 1O7FA 3LWFA 3G73A 1H9GA 3IWFA 3RI4A 1ACIA 5L3DA 4OIRF 4LG0B 1XCBA 5LHIA 1WPKA 2XHKA 1U5TA 1IN4A 1MBEA 3IP4B 1YS7A 4BBRJ 1HQCA 4C2MJ 4EVIA 3OYNA 3BZCA 4G6DA 2E2JJ 2EH3A 2E2IJ 5GAEJ 2E7WA 2VIXA 1WJFA 4P9UA 1FSHA 4JX4A 1IRXA 2RV8A 4NQWB 2HQNA 3V7CA 3S2HJ 3T8RA 4IZZA 4XLAA 2CYYA 2QCOA 3RQ4A 4NB5A 1OLTA 3A03A 5KCMA 4CUGA 3J81K 3RKXA 3CMAI 5F64A 3B6AA 1YO5C 3OS1A 3CJNA 1HKTA 4S0HB 1BN5A 2XGDA 3H9GA 2VBWA 1AOYA 1HSJA 4QTRA 3DPLC 1DU0A 4D0PA 5GADJ 4G6QA 4I09A 3LSJA 4L18B 3IL2A 2JSCA 1ZH5A 4YELA 1X2MA 2COMA 3FK6A 3S15J 3K4NA 3M7GA 1W0UA 3QP5A 2LF8A 1HCRA 1LUJB 4IPAA 3HOWJ 2JJ7A 1U3EM 3VYSB 4RLFA 2PN6A 2XGCA 3BG3A 3JRAA 2PMZA 2ZNYA 4UXNA 4ZDLA 3JREA 1ZHFA 2KMUA 3KP2A 3CO7C 2M0CA 5L3GA 1XC5A 3A02A 3BPVA 2XGXA 5CYVA 4FE7A 3DBHB 3V8LA 4KDPA 1XSVA 1FYKA 1ZARA 2QWWA 1Z0XA 4HBLA 2VJ5A 3CCEI 5CQEA 3MAJA 3P9IA 2ZKZA 1MBKA 4HAMA 4HQEA 2R7UA 1A6QA 2KRHA 1JJ8C 1TW3A 5E1WA 1LDDA 1ITYA 1WZ2A 3JRBA 1MH3A 2H27A 2X0LA 5F6FA 3BOQA 1VQNI 2BVLA 1D8KA 4XNFA 3M3YJ 2UXXA 3E0JB 3TQNA 4B8XA 2B0LA 5EG0B 2L9NA 4CCMA 2L01A 2MD0A 4ZTJA 3W2AA 1H88C 3CD6I 3P5JA 4ASNA 2O61A 1F36A 5D5WB 2FBIA 3V7SA 3PUFA 1SD7A 2CUJA 4L5IA 4MEXF 5A2QK 2QKMB 2M87A 1HDDC 2R5ZB 3GX4X 3OYJA 1MDMA 4QLCU 3MWMA 1I39A 1R22A 2VXZA 3MZ8A 1OCOH 4LIVA 3KETA 3WU0A 1ZGAA 1EKEA 5DM6F 1T08B 4M6XA 3N97A 1IN7A 3IV5A 3DWLE 5H20A 2RQQA 2QSGX 3HUGB 1FEXA 2W7NA 1D3YA 1X1PA 2VE8A 2VT2A 1QA6A 1WJCA 4A3GJ 4CH7A 1PDNC 3PJRA 4RB2C 3I59A 2ADUA 2DPDA 2OCCH 5L3FA 3IUOA 4HEA2 5ERIA 2CW8A 2M30A 3SQNA 3E6BA 3F21A 1JT6A 4OWRB 5HS9A 2E1CA 4CCNA 2GQQA 2K9QA 1UZCA 1KU2A 3CLQA 5E17F 4BE2A 2XAJA 1YFHA 1U6GA 4D9JA 2HXIA 4G8XA 3DQVC 4XRMA 4XKBA 3J81Z 3SYTA 2H8WA 1OYIA 1Q1VA 2DJNA 3MN2A 5ED4A 2XAQA 2CGPA 2VKVA 3G71I 1I27A 1K78A 4LITA 4WX9A 1AU7A 3TOBA 1SMYF 4X6AJ 1MMNA 3I9V2 3HB9A 1OJLA 3CJRB 4Z2YA 4CCLA 1YRNA 2GZWA 3OYLA 3KZYA 1D0XA 3X2QH 5ICCA 3W6KB 1IO2A 1G6NA 1FMVA 5HOOA 1MZBA 1SC7A 1VZ0A 2ME0A 1MMAA 3C7JA 3I4NJ 1QHHD 2JQ7A 2CV2A 4A0YA 1R5ID 4F52A 4OAYA 2ID6A 4ESJA 2X1CA 5M3FJ 3CTAA 1B1BA 1S7AA 3KLOA 2AO9A 4Q48A 5HNHA 4BHBA 3NEUA 1S72I 3H9QA 1IJWC 2M3AA 3HOVJ 4ZDOA 4PSWA 1U5TC 4BY7J 1ZQ3P 1LEBA 4D7NA 4KA4A 4UNOA 1DPUA 2GXBA 4UV8A 1G2HA 2DK8A 2O0YA 1TZLA 5KHDA 1WWXA 2WA0A 5DUKA 4PJLA 2D45A 2RDPA 4D7MA 2VC1A 2KIQA 3PQKA 5K7HA 1CGPA 1DGRM 1SVLA 2CG4A 2W00A 3K4LA 2DN0A 4H4KC 2HOSA 2HQ5A 3REOA 1EF4A 1IF1A 3GFLA 4F3QA 4CDGA 1ZYRF 2LRDA 2ZFWA 3LFUA 3OYIA 1ORKA 2M9HA 1QHGA 2IPQX 2L2OA 1LNWA 5GPCA 2WTEA 2MLKA 2JRMA 4XSZF 3BTJA 2Q8KA 2M7AA 4UY8I 4EM2A 2O8XA 2O5RA 2GWRA 1FT9A 4PJ0C 2VPRA 3IC7A 3M1CA 5A2QZ 1B72A 5DDGA 4KIGA 3QYFA 3RIRA 3C3WA 2K3PA 4W97A 5LHGA 4IHWA 3UNGC 2L9RA 4MQVA 1R1UA 4BGDA 3TDUC 3E1SA 2X1DA 2QLZA 4B3XA 3DU6A 3U1DA 2EFWA 3RTRA 3HC7A 4JOMA 1R23A 2H6BA 3D5SC 3N4MA 2KP6A 3KEQA 4HDUA 1IGNA 4PDKA 4WXHA 3GYHX 1RKTA 2Y9YA 1A35A 3WU1B 1C0WA 1SFEA 2HFHA 4Y4RA 1MJAA 2EFPA 2OQRA 1T56A 2HTSA 1NTCA 1I50J 4OIQF 2X1EA 3JRDA 3ZN1A 1SD4A 3S1QJ 4HLYA 5LGUA 3BWGA 5HDGA 4C2UA 4OIOF 1Z05A 3BJOA 4FX4A 1PYVA 4NC8A 1U2WA 1ZLJA 2E7XA 2LBFA 4A0ZA 2F5FA 1VFCA 5TGTA 3VEPA 2CQKA 2ZXIA 5DM7F 1LJ9A 2FEZA 3HRSA 4KNYA 2PLYA 1UB9A 3W6VA 5JHFA 2K9SA 3I59B 2M5WA 2XF7A 3H35A 4JX6A 5CVIA 4A12A 1MGTA 4G7ZF 1JE8A 2W85A 4QPQA 2LMDA 1TP4A 2FNPA 3G3ZA 3O2PE 4DBQA 2MH2A 3KYDB 3NQOA 2F4OB 2GBYA 1UHWA 4GRIA 1MD0A 1QO0D 1G59A 2DFEA 2KISA 2CRGA 4HZFA 3CCVI 2MC4A 2R0QC 4A3CJ 1ZGWA 3OS0A 4Y17A 4HF2A 4NNJA 2CQ7A 5ILUA 2DW4A 5CVJA 3S16J 6PAXA 2E1OA 4V2GA 4I99C 1TC3C 1FWZA 1TWCJ 2WB1N 5FFZA 1GUUA 3FKIJ 2FOWA 1I3QJ 2XIGA 1GVJA 3WGGA 4LLGF 2VB6A 4PK4A 4BE1A 2LR8A 2XROA 2RGVA 2AXTC 3QOEA 5M5WJ 3FDYA 2CMPA 3H5AA 2NXNB 3LOCA 1YRNB 3GMEA 4OMYA 1HOMA 1YJ9I 2DOFA 1A5JA 2Y2ZA 4HV6A 1H89C 1BC7C 1XD7A 2LTPA 1GVDA 4BXFA 1K79A 3CLOA 1SAXA 1ZRCA 3TW6A 5LFAA 4PFOA 1QPMA 4MEYF 2BHYA 1D1AA 4K2EA 3L9FA 3OIOA 3KEOA 2L4MA 5JHUA 3L7WA 1O3RA 1ZK8A 3DKYA 4ZYDA 3DU5A 3Q3SA 2A05A 5C4JJ 2KZGA 2XKOA 2M1BA 5ILSA 1LE8A 2IT0A 2Z5UA 3WTUC 1AKHA 2GA2A 4B43A 2NNYA 3ECOA 5IP7J 2LF7A 1XDUA 1T8IA 3ZMVA 1XS9A 1BOBA 3K2ZA 4D5FA 2NYXA 2E35A 4AVZA 2FF4A 2XRNA 4IX7A 2Z3YA 2V26A 4DZJA 1E3HA 1AA7A 4RGSA 2KDOA 3CUOA 4ENNA 3DPTA 1WFXA 2HU9A 4EATA 3J80K 2HYGD 5HDNA 2DPUA 2LREA 3A0BC 1YQAA 2QUFA 3H3UA 3RYPA 4S04A 3DKXA 4JP0A 4E7JA 2WADA 3D1NI 2DTRA 1ONVA 1ZTRA 1I1GA
chains in the Genus database with same CATH topology
2MLGA 1R58A 2QENA 3M8FA 2PEXA 2EK5A 4LG0A 3F6OA 5JI6A 2CO5A 1LVAA 2FA5A 4KMFA 4I01A 2VODA 4NQWA 3EETA 4ENJA 1FBSA 4CICA 1E17A 2AS5F 1ON1A 1HW2A 1TQMA 4WWCA 2V79A 2MA3A 2PQ8A 2BGCA 3EUHA 5D5UB 5LBQA 1UFMA 4L9VA 1TQPA 1QZZA 4ESBA 1HBXG 4LK0F 4KIBA 5J6XA 4GO1A 4ZZLA 1FYLA 4MNUA 5HDKA 1JHFA 4U7BA 3TDZC 4EJOA 2A5YB 4G7HF 5CJ9A 3FM5A 2J5PA 2PJPA 3BY6A 4M72A 4A5NA 3ROUA 4ENMA 4HYEA 4O5VA 5HS7A 4KUMA 2A69F 5CLSA 4AIKA 4I7HA 1J75A 1JXSA 1FBQA 1RIOH 4IHSA 1MKMA 2IA1A 1BI1A 4DQ2A 3E5UA 3WGHA 3WGIA 1E2XA 1SFUA 3WTXC 2XAHA 3LA7A 2HYFA 3JW4A 5E1ZB 4LGWA 2STTA 2QQAA 1O3SA 1R5HA 3TO6A 2EJRA 4M9ZA 1KYWA 3JTGA 1EV7A 1HKSA 5CVRA 5EEGA 4M73A 3HUGA 4MQ9F 2W84A 5D5XB 5ILVA 3GFJA 1F9NA 4ETSA 2ESNA 4EGZA 5E1XA 1I5ZA 5LRRA 1Z6RA 5LLQA 2G7UA 1REPC 2Z33A 4L9JA 3P7NA 1QQIA 2A68F 2VC0A 3GVAA 1ZRDA 4ZZDA 1HW1A 3K1PA 2HWVA 3GXOA 3ZMTA 1BI0A 3I0TA 3ULQB 3TO7A 1W5SA 2PMHA 1YW9A 3FM3A 3U2RA 4M6YA 1W4MA 2DI3A 4CXFA 3SFZA 1HKQA 1SFXA 4HX7A 4U88A 1G3SA 2PBIA 5LGTA 4AIHA 3IHUA 2VT3A 3EYIA 5L3CA 4E70A 4MHGA 1Z9CA 4S05A 2O3FA 2Q0OA 4RB3C 1QBJA 2P5LC 4L0YB 1TLHB 2F5CA 3ZP5A 3WE3A 1B59A 2XAGA 3VFZA 5EEHA 1LQ1A 4R8HA 3E5QA 3IWZA 4G94A 4HF1A 4WXCA 1XB4A 4Q47A 3GO5A 4OOIA 3E6CC 2VBYA 4IJAA 5K5OA 1XMKA 2K4JA 3MFKA 2GXGA 2VONA 3HIFA 4KICA 5DEQA 1IAWA 3HRMA 3ZN0A 2EWNA 2P7VB 2DBBA 2QM3A 1J2XA 1MJ9A 1AWCA 1B6AA 1A04A 2BYVE 1S3JA 5E8IA 1T2KA 1XGOA 1V3FA 2BV6A 1USTA 1OPCA 1TBXA 3MCZA 2QVOA 2P7CB 1FYMA 1LEAA 1IN5A 2HDCA 2HS5A 5JR3A 5BS6A 3ABUA 4IF4A 1TNSA 1SD5A 2JT1A 2HZTA 1T98A 2A61A 2DLLA 3D0SA 2ZMEA 2DO7A 1J0RA 2VBXA 4Q4ZF 2ZCWA 1I6XA 3B73A 1ZRFA 1O7LA 5JFRA 2HQRA 4ZH4F 4FX0A 3W6JB 5DD4A 3HHHA 3QRFF 5LHHA 2P6SA 3TKYA 1T38A 4P96A 1MJBA 3L00A 3T5XA 2OU2A 2ISZA 4YFKF 2EFQA 4CHUA 3P9CA 4HX4A 4XRFA 3WE2A 3QU3A 3QPHA 2FBHA 3D5LA 4A5MA 1V4RA 1CF7A 1FP1D 2UZKA 5DCFA 2XKPA 1FX7A 4U0WA 3VODA 4HDVA 5H6RA 3CUQB 2CWEA 4XLPF 4OINF 3M8EA 1B4AA 3FHZA 2V1XA 2D1VA 3HTUA 2NNNA 3FZVA 2ZO4A 4IHTA 3HYIA 1P4AA 2D2WA 3IKTA 5DD8A 1VTNC 2Z9OA 3TO9A 3HRTA 2K7LA 1P92A 3M1EA 4F7ZA 3WTVC 3F8BA 3S2WA 4A6DA 1Q1HA 3GUDA 3R0JA 2XVCA 3O3KA 4EM0B 2EB7A 3R0AA 5BPDA 2UXNA 5FGMA 2W57A 3IRQA 2LNBA 3KP3A 2GA1A 3HRUA 1GXQA 4EJVA 1HW5A 1BIAA 3KP4A 4M9SA 1PUEE 3HOTA 1IW7F 1X3UA 3LAPA 1KA8A 3GF2A 4UHTA 3HOSA 2XUBA 2DAOA 1TW2A 2RC4A 2TDXA 2QQ9A 5FO5A 2M45A 2LSOA 4LD5A 3I71A 4RB1A 2G9WA 3ERED 5F1RA 1G4DA 4DNCA 2L3DA 2ZMEB 2YU3A 2KIMA 3EYYA 1TTYA 1RNLA 2P5VA 5D8KB 5TJJA 4UV9A 1S7OA 3V8KA 3LSTA 4KYWA 4G9YA 5DCMB 2XAFA 4AVPA 3LQQA 2AXLA 4HQMA 2H94A 4I98B 2RQPA 1P4XA 4JQFA 3RJPA 4R1HA 5FLXZ 3BDDA 4M71A 1K7AA 2K86A 4RAYA 1KU9A 4CYDA 3ZMZA 2LDUA 2PG4A 2Y48A 1YW8A 3T1BA 1CF7B 4UVCA 2IVMA 2EA2A 3R61A 1R5GA 1W7PB 3R6SA 1ZG5A 2Y75A 1KU7A 3GZ5A 4KFCA 4AD9A 3B02A 3ISPA 2VE9A 1ON2A 3C18A 2HOEA 3ZMDA 3L2CA 3MZHA 1KQ9A 5E18F 1D8JA 3SXYA 1FNNA 2K27A 1DPRA 1OKRA 2CSOA 3EQLF 3DKWA 1GXPA 3ML6A 2FOKA 2X4HA 1R1VA 1B9NA 3H3ZA 1BI2A 2JPBA 5LEKA 2NAZA 2KRFA 3DF8A 3HSEA 4GXOA 4U0YA 3LA2A 3F8FA 2FXAA 4IRHA 1LB2A 1RZ4A 2GAUA 1UCRA 1BM9A 3MEXA 1FSEA 1XSXA 2OA4A 3F22A 4YG2F 2JTVA 2ESHA 2YR2A 5K5QA 2ISYA 5LGNA 1IUYA 3DEUA 3KE2A 2IRFG 2UWMA 3F8NA 3U9GA 3SHFA 4YIFA 4ZYHA 3KLNA 5FB2A 3FX3A 4H0EA 5DUIA 3KFWX 4O6JA 3Q9SA 4N9IA 3E97A 2NRAC 4I2OA 4EJTA 3DV8A 4IXAA 1SMTA 2E1NA 4U7DA 2L4AA 2FSWA 2LKPA 3K69A 1J59A 2XV4S 3VOEA 4BH9A 4BQAA 4LMYA 5CVVA 4HOBA 1YYVA 4JK1X 5CVUA 1Z6TA 3RYRA 1KQ8A 3FWEA 2BBYA 4IRGA 1FLIA 4XLNF 2CW0F 1XMAA 1WKMA 5HVQC 2EV6A 5L3BA 3BP8A 3E6MA 2FE3A 4RGUA 3BJ6A 2EA4A 1H0MA 3V7RA 3FXQA 1OMIA 2RKHA 2F2EA 2PFBA 1S6LA 4KT5C 4LLNA 4QWQA 3H92A 1OYYA 1GHCA 3L09A 4ON0A 3DXJF 2DT5A 1IZ1A 4CZZA 2ZJ2A 4N9HA 1LDKB 2YX4A 3AAFA 1YG2A 5D6EA 4L9NA 4M9XA 3V8JA 4WF2A 3RKWA 2MH9A 1O57A 1O3QA 2Q2EA 4MTEA 4OMZA 2HKXA 1IN8A 5BOXA 3RPUA 2QBYB 5IT3A 2EFOA 2BE5F 2O6GE 3I5UA 4A6EA 3K9TA 2FU4A 1YLFA 1BBYA 2RVCA 3VB2A 2FNAA 2F5DA 3OV8A 2KJCA 1DUXC 4RB0A 3CUQA 4R79A 4CGZA 4GYGA 4JBAA 4FHTA 1IN6A 4MGRA 1J7KA 4NHJA 4PGGA 1YIOA 1ZN2A 5BMZA 2D1HA 4N0BA 1TNTA 1JGSA 5H6QA 5FFXA 2YSRA 4AIJA 2OD5A 4HF0A 3J7AO 1T6SA 3CDHA 3HHGA 1STZA 5D5VB 2ACJA 3HSFA 4EMSA 2Y0MA 3GFIA 2IJLA 1OYWA 1ZGJA 2A3SA 3WTTC 1RI7A 2IA2A 2A6HF 3K0LA 2XASA 4G7OF 2A07F 2OZUA 2ZXJA 4HLXA 1OR7A 4ZYEA 1XCVA 3BPXA 2FQ3A 2MD5A 1L3LA 2K02A 1KU3A 1J9IA 4Y13A 2YPRA 3K1MA 5AIPA 2WC2A 3PFIA 3JAMZ 4HW0A 3KP5A 2HR3A 4EGYA 1EH6A 3F8CA 4AWXB 1EH7A 4GCVA 1FPQA 3F8MA 3FMSA 3FXRA 2RNJA 1WI9A 4A2UA 2GIVA 4IVNA 2ZNZA 5DCMA 3I4PA 5KVRA 1IXSB 2KJBA 3MQ0A 1F5TA 3SZPA 3Q5FA 4I02A 3V4GA 3F6VA 5J8FA 2DFIA 4BHPA 1U8RA 4IRIA 2DQLA 3GW2A 5JVTA 3OOPA 1BIBA 2V1UA 4RGRA 1FBUA 1LDJA 2ELHA 2FBKA 1IRGA 2P6TA 2JPCA 4EJWA 4O3MA 1U5TB 3F23A 2ZBKA 2QQBA 1Z1DA 3FMQA 1W7PA 2IA0A 5FLXK 1IXRC 3R60A 5LRSA 4RGXA 3JSPA 2OQGA 2HGCA 3F3XA 1XGSA 2WV0A 5IT9K 1R7JA 2KIUA 3COAC 4ESFA 3I58A 1JHHA 4RAZA 5ICFA 3WTZA 5ICEA 4KN7X 4LK1F 5E20A 3CUQC 2R3SA 1YTYA 1IXCA 2DK5A 1DP7P 3GWZA 2QYOA 5TRDA 4KIFA 4LB6B 1WQ2A 4B09A 3ZMSA 4TV7A 1RUOA 1QNTA 4WCGA 3LAJA 5HS8A 4Y15A 2JZYA 3BJAA 4I0BA 5DV5A 3WODF 1Z7UA 3T0YA 4L5JA 4ZYGA 1SD6A 5D4RA 3LQRA 5D6FA 2KIFA 1XDSA 2PI0A 5HLIA 5DYMA 2OBPA 3F72A 4I0AA 1F1ZA 2CFXA 4U0VA 1MDMB 4M74A 3DP7A 3QU6A 2IW5A 2R7DA 3KCCA 4KMUX 1R00A 2DU9A 1U78A 1S8NA 4PGHA 1TQIA 1P2FA 3WG9A 3IKVA 4UVAA 3RPQA 3R4KA 5D4SA 2K4BA 1ZG1A 1J5YA 2H6CA 5K1YA 4WXDA 4LLLA 3T8TA 5L3EA 2BEOA 1S29A 3WTWC 3GZ6A 2FMLA 1FY7A 1G3YA 1R36A 1XGMA 1WSUA 4UUVA 3I53A 4KN4X 1FC3A 1ZLKA 2DQRA 3DFGA 4HX8A 3TOAA 4BHCA 4Q5SF 2WWYA 2HKOA 4CO8A 2FMYA 1K78B 3SZTA 1QGPA 3QOPA 5IT9Z 4OU0A 1KYZA 2NS0A 1XGNA 1Z91A 1ZREA 3HTSB 4P5OA 5LEJA 3FMRA 1D5VA 3MZYA 5HLGA 4YFXF 2V9VA 4EM1A 4LJZF 4RS8A 3NRVA 3HSRA 5AIQA 3KP6A 3I64A 1T0FA 3JSOA 1XSDA 4MTDA 4P55A 2L02A 1ODDA 2P8TA 3M9AA 1L0OC 1ULYA 3QPTA 3TGNA 3JTHA 5D8LB 1Y0UA 1O3TA 5KK1A 5FD5A 2V6CA 3WTSC 4BYYA 1UHMA 2VOPA 1PP8F 3ZMUA 3GFMA 4XSXF 1PP7U 2QZ8A 2QBYA 2VN2A 1T39A 5BPIA 2L54A 1WRJA 2IP2A 4PCQA 3ZPLA 2Z99A 1HXDA 4BXUA 3FF5A 2HEOA 3K1NA 4FT8A 2STWA 1F4KA 3ABTA 3WTYC 2V1DA 2OAZA 4A0XA 1YS6A 3P9KA 1W5TA 3BROA 1ZAOA 2FRHA 4LFUA 2EV5A 1NHAA 2YX7A 2G7HA 4OIPF 1RUNA 1IRFA 2JRTA 2ETHA 3FXUA 2EV0A 3E3VA 4L0ZB 2PMUA 3LA3A 1KQ0A 1QZYA 1P4WA 3BZ6A 2VBZA 2HTJA 2RN7A 3IRRA 5K5RA 2A6EF 4ENKA 5J8CA 1HSTA 3I54A 3RDIA 2H09A 4BNCA 1BI3A 1FZPB 1KGSA 2M8EA 1BJAA 4EQQA 4XBFA 2OZ6A 1I1SA 3E5XA 1USSA 2W24A 4GYIA 1BOAA 4UVBA 3PQJA 5BQTA 4EV0A 4HV5A 3C1DA 3E6DA 1DDNA 3EDPA 1G3TA 3KP7A 1ZG3A 2KKOA 1BC8C 5FD6A 2J5OA 1B9MA 1YW7A 5AONA 3KZZA 4WK8F 1P6RA 5ICGA 1EH8A 4P9FA 5HLHA 3QAHA 2O03A 3J80Z 1XN7A 2MBFA 4GGGA 4L9TA 4EJUA 3ELKA 4LB5A 4PZJA 4HA8A 2P4WA 2EFNA 2C6YA 1FP2A 1W7PD 3JAMK 1R1TA 3Q9VA 2W25A 3CO6C 3O6BB 4YIIA 3GLXA 2R7FA 3RKYA 1K6OA 1FOKA 3LFKA 2MC3A 1H9TA 2F5EA 2P5KA 4YFNF 2VOOA 4BAYA 3GEZA 3QP6A 1G3WA 5E8GA 3ECHA 3ZQ7A 1O7FA 3LWFA 3G73A 1H9GA 3IWFA 3RI4A 5L3DA 4OIRF 4LG0B 1XCBA 5LHIA 2XHKA 1U5TA 1IN4A 1YS7A 1HQCA 4EVIA 4G6DA 2E7WA 4P9UA 1FSHA 2RV8A 2HQNA 3V7CA 3T8RA 2CYYA 4NB5A 3J81K 3RKXA 5F64A 1YO5C 3CJNA 1HKTA 1BN5A 1AOYA 2VBWA 1HSJA 3DPLC 4D0PA 4G6QA 4I09A 4L18B 3IL2A 2JSCA 1ZH5A 2COMA 3M7GA 3QP5A 2LF8A 4IPAA 1U3EM 2PN6A 2ZNYA 4UXNA 1ZHFA 3KP2A 3CO7C 5L3GA 3BPVA 2XGXA 5CYVA 3V8LA 4KDPA 1XSVA 1FYKA 1ZARA 2QWWA 4HBLA 3MAJA 3P9IA 2ZKZA 4HAMA 4HQEA 1TW3A 5E1WA 1LDDA 2H27A 2X0LA 5F6FA 3BOQA 1D8KA 2UXXA 3TQNA 4B8XA 2B0LA 2L01A 4ASNA 2O61A 5D5WB 2FBIA 3V7SA 1SD7A 4L5IA 4MEXF 5A2QK 2M87A 3GX4X 1MDMA 4QLCU 3MWMA 1R22A 2VXZA 3KETA 3WU0A 1ZGAA 4M6XA 3N97A 1IN7A 5H20A 1D3YA 2VE8A 2VT2A 1PDNC 4RB2C 3I59A 2ADUA 2DPDA 5L3FA 5ERIA 2M30A 3SQNA 3E6BA 3F21A 5HS9A 2E1CA 2GQQA 1KU2A 5E17F 2XAJA 1YFHA 1U6GA 4G8XA 3DQVC 3J81Z 1OYIA 5ED4A 2XAQA 2CGPA 1I27A 1K78A 4WX9A 3TOBA 1SMYF 4Z2YA 2GZWA 3KZYA 5ICCA 3W6KB 1G6NA 5HOOA 1MZBA 3C7JA 4A0YA 4ESJA 3CTAA 1B1BA 1S7AA 3KLOA 4Q48A 4BHBA 3NEUA 1U5TC 1LEBA 4KA4A 4UNOA 1DPUA 2GXBA 4UV8A 2DK8A 2O0YA 1WWXA 5DUKA 2D45A 2RDPA 2VC1A 3PQKA 1CGPA 2CG4A 3REOA 1IF1A 3GFLA 4CDGA 1ZYRF 2ZFWA 2IPQX 1LNWA 2WTEA 2MLKA 4XSZF 2Q8KA 4EM2A 2O8XA 2GWRA 1FT9A 3IC7A 5A2QZ 5DDGA 4KIGA 3RIRA 3C3WA 5LHGA 4MQVA 1R1UA 3TDUC 2QLZA 3U1DA 2EFWA 3RTRA 1R23A 2H6BA 3N4MA 3KEQA 4HDUA 4PDKA 4WXHA 3GYHX 3WU1B 1C0WA 1SFEA 2HFHA 1MJAA 2EFPA 2OQRA 2HTSA 4OIQF 3ZN1A 1SD4A 4HLYA 5LGUA 3BWGA 5HDGA 4OIOF 1Z05A 3BJOA 4FX4A 1U2WA 1ZLJA 2E7XA 4A0ZA 2F5FA 3VEPA 2CQKA 1LJ9A 2FEZA 3HRSA 4KNYA 2PLYA 1UB9A 3I59B 2M5WA 4G7ZF 5CVIA 4A12A 1JE8A 1MGTA 2W85A 2FNPA 3G3ZA 3O2PE 2MH2A 3NQOA 1UHWA 1MD0A 1QO0D 4HZFA 4Y17A 4HF2A 5ILUA 2DW4A 5CVJA 6PAXA 1FWZA 5FFZA 2XIGA 1GVJA 3WGGA 4LLGF 2XROA 2RGVA 4OMYA 4HV6A 1BC7C 1XD7A 1K79A 3CLOA 1SAXA 1ZRCA 1QPMA 4MEYF 4K2EA 3L9FA 3KEOA 2L4MA 5JHUA 3L7WA 1O3RA 4ZYDA 2XKOA 2M1BA 5ILSA 2IT0A 2Z5UA 3WTUC 2GA2A 2NNYA 3ECOA 2LF7A 1XDUA 3ZMVA 3K2ZA 2NYXA 2FF4A 2XRNA 2Z3YA 4RGSA 3CUOA 4ENNA 3DPTA 3J80K 2HYGD 5HDNA 2DPUA 1YQAA 2QUFA 3H3UA 3RYPA 4S04A 2DTRA 1ONVA 1I1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLG A;  1R58 A;  2QEN A;  3M8F A;  2PEX A;  2EK5 A;  4LG0 A;  3F6O A;  5JI6 A;  2CO5 A;  1LVA A;  2FA5 A;  4KMF A;  4I01 A;  2VOD A;  4NQW A;  3EET A;  4ENJ A;  1FBS A;  4CIC A;  1E17 A;  2AS5 F;  1ON1 A;  1HW2 A;  1TQM A;  4WWC A;  2V79 A;  2MA3 A;  2PQ8 A;  2BGC A;  3EUH A;  5D5U B;  5LBQ A;  1UFM A;  4L9V A;  1TQP A;  1QZZ A;  4ESB A;  1HBX G;  4LK0 F;  4KIB A;  5J6X A;  4GO1 A;  4ZZL A;  1FYL A;  4MNU A;  5HDK A;  1JHF A;  4U7B A;  3TDZ C;  4EJO A;  2A5Y B;  4G7H F;  5CJ9 A;  3FM5 A;  2J5P A;  2PJP A;  3BY6 A;  4M72 A;  4A5N A;  3ROU A;  4ENM A;  4HYE A;  4O5V A;  5HS7 A;  4KUM A;  2A69 F;  5CLS A;  4AIK A;  4I7H A;  1J75 A;  1JXS A;  1FBQ A;  1RIO H;  4IHS A;  1MKM A;  2IA1 A;  1BI1 A;  4DQ2 A;  3E5U A;  3WGH A;  3WGI A;  1E2X A;  1SFU A;  3WTX C;  2XAH A;  3LA7 A;  2HYF A;  3JW4 A;  5E1Z B;  4LGW A;  2STT A;  2QQA A;  1O3S A;  1R5H A;  3TO6 A;  2EJR A;  4M9Z A;  1KYW A;  3JTG A;  1EV7 A;  1HKS A;  5CVR A;  5EEG A;  4M73 A;  3HUG A;  4MQ9 F;  2W84 A;  5D5X B;  5ILV A;  3GFJ A;  1F9N A;  4ETS A;  2ESN A;  4EGZ A;  5E1X A;  1I5Z A;  5LRR A;  1Z6R A;  5LLQ A;  2G7U A;  1REP C;  2Z33 A;  4L9J A;  3P7N A;  1QQI A;  2A68 F;  2VC0 A;  3GVA A;  1ZRD A;  4ZZD A;  1HW1 A;  3K1P A;  2HWV A;  3GXO A;  3ZMT A;  1BI0 A;  3I0T A;  3ULQ B;  3TO7 A;  1W5S A;  2PMH A;  1YW9 A;  3FM3 A;  3U2R A;  4M6Y A;  1W4M A;  2DI3 A;  4CXF A;  3SFZ A;  1HKQ A;  1SFX A;  4HX7 A;  4U88 A;  1G3S A;  2PBI A;  5LGT A;  4AIH A;  3IHU A;  2VT3 A;  3EYI A;  5L3C A;  4E70 A;  4MHG A;  1Z9C A;  4S05 A;  2O3F A;  2Q0O A;  4RB3 C;  1QBJ A;  2P5L C;  4L0Y B;  1TLH B;  2F5C A;  3ZP5 A;  3WE3 A;  1B59 A;  2XAG A;  3VFZ A;  5EEH A;  1LQ1 A;  4R8H A;  3E5Q A;  3IWZ A;  4G94 A;  4HF1 A;  4WXC A;  1XB4 A;  4Q47 A;  3GO5 A;  4OOI A;  3E6C C;  2VBY A;  4IJA A;  5K5O A;  1XMK A;  2K4J A;  3MFK A;  2GXG A;  2VON A;  3HIF A;  4KIC A;  5DEQ A;  1IAW A;  3HRM A;  3ZN0 A;  2EWN A;  2P7V B;  2DBB A;  2QM3 A;  1J2X A;  1MJ9 A;  1AWC A;  1B6A A;  1A04 A;  2BYV E;  1S3J A;  5E8I A;  1T2K A;  1XGO A;  1V3F A;  2BV6 A;  1UST A;  1OPC A;  1TBX A;  3MCZ A;  2QVO A;  2P7C B;  1FYM A;  1LEA A;  1IN5 A;  2HDC A;  2HS5 A;  5JR3 A;  5BS6 A;  3ABU A;  4IF4 A;  1TNS A;  1SD5 A;  2JT1 A;  2HZT A;  1T98 A;  2A61 A;  2DLL A;  3D0S A;  2ZME A;  2DO7 A;  1J0R A;  2VBX A;  4Q4Z F;  2ZCW A;  1I6X A;  3B73 A;  1ZRF A;  1O7L A;  5JFR A;  2HQR A;  4ZH4 F;  4FX0 A;  3W6J B;  5DD4 A;  3HHH A;  3QRF F;  5LHH A;  2P6S A;  3TKY A;  1T38 A;  4P96 A;  1MJB A;  3L00 A;  3T5X A;  2OU2 A;  2ISZ A;  4YFK F;  2EFQ A;  4CHU A;  3P9C A;  4HX4 A;  4XRF A;  3WE2 A;  3QU3 A;  3QPH A;  2FBH A;  3D5L A;  4A5M A;  1V4R A;  1CF7 A;  1FP1 D;  2UZK A;  5DCF A;  2XKP A;  1FX7 A;  4U0W A;  3VOD A;  4HDV A;  5H6R A;  3CUQ B;  2CWE A;  4XLP F;  4OIN F;  3M8E A;  1B4A A;  3FHZ A;  2V1X A;  2D1V A;  3HTU A;  2NNN A;  3FZV A;  2ZO4 A;  4IHT A;  3HYI A;  1P4A A;  2D2W A;  3IKT A;  5DD8 A;  1VTN C;  2Z9O A;  3TO9 A;  3HRT A;  2K7L A;  1P92 A;  3M1E A;  4F7Z A;  3WTV C;  3F8B A;  3S2W A;  4A6D A;  1Q1H A;  3GUD A;  3R0J A;  2XVC A;  3O3K A;  4EM0 B;  2EB7 A;  3R0A A;  5BPD A;  2UXN A;  5FGM A;  2W57 A;  3IRQ A;  2LNB A;  3KP3 A;  2GA1 A;  3HRU A;  1GXQ A;  4EJV A;  1HW5 A;  1BIA A;  3KP4 A;  4M9S A;  1PUE E;  3HOT A;  1IW7 F;  1X3U A;  3LAP A;  1KA8 A;  3GF2 A;  4UHT A;  3HOS A;  2XUB A;  2DAO A;  1TW2 A;  2RC4 A;  2TDX A;  2QQ9 A;  5FO5 A;  2M45 A;  2LSO A;  4LD5 A;  3I71 A;  4RB1 A;  2G9W A;  3ERE D;  5F1R A;  1G4D A;  4DNC A;  2L3D A;  2ZME B;  2YU3 A;  2KIM A;  3EYY A;  1TTY A;  1RNL A;  2P5V A;  5D8K B;  5TJJ A;  4UV9 A;  1S7O A;  3V8K A;  3LST A;  4KYW A;  4G9Y A;  5DCM B;  2XAF A;  4AVP A;  3LQQ A;  2AXL A;  4HQM A;  2H94 A;  4I98 B;  2RQP A;  1P4X A;  4JQF A;  3RJP A;  4R1H A;  5FLX Z;  3BDD A;  4M71 A;  1K7A A;  2K86 A;  4RAY A;  1KU9 A;  4CYD A;  3ZMZ A;  2LDU A;  2PG4 A;  2Y48 A;  1YW8 A;  3T1B A;  1CF7 B;  4UVC A;  2IVM A;  2EA2 A;  3R61 A;  1R5G A;  1W7P B;  3R6S A;  1ZG5 A;  2Y75 A;  1KU7 A;  3GZ5 A;  4KFC A;  4AD9 A;  3B02 A;  3ISP A;  2VE9 A;  1ON2 A;  3C18 A;  2HOE A;  3ZMD A;  3L2C A;  3MZH A;  1KQ9 A;  5E18 F;  1D8J A;  3SXY A;  1FNN A;  2K27 A;  1DPR A;  1OKR A;  2CSO A;  3EQL F;  3DKW A;  1GXP A;  3ML6 A;  2FOK A;  2X4H A;  1R1V A;  1B9N A;  3H3Z A;  1BI2 A;  2JPB A;  5LEK A;  2NAZ A;  2KRF A;  3DF8 A;  3HSE A;  4GXO A;  4U0Y A;  3LA2 A;  3F8F A;  2FXA A;  4IRH A;  1LB2 A;  1RZ4 A;  2GAU A;  1UCR A;  1BM9 A;  3MEX A;  1FSE A;  1XSX A;  2OA4 A;  3F22 A;  4YG2 F;  2JTV A;  2ESH A;  2YR2 A;  5K5Q A;  2ISY A;  5LGN A;  1IUY A;  3DEU A;  3KE2 A;  2IRF G;  2UWM A;  3F8N A;  3U9G A;  3SHF A;  4YIF A;  4ZYH A;  3KLN A;  5FB2 A;  3FX3 A;  4H0E A;  5DUI A;  3KFW X;  4O6J A;  3Q9S A;  4N9I A;  3E97 A;  2NRA C;  4I2O A;  4EJT A;  3DV8 A;  4IXA A;  1SMT A;  2E1N A;  4U7D A;  2L4A A;  2FSW A;  2LKP A;  3K69 A;  1J59 A;  2XV4 S;  3VOE A;  4BH9 A;  4BQA A;  4LMY A;  5CVV A;  4HOB A;  1YYV A;  4JK1 X;  5CVU A;  1Z6T A;  3RYR A;  1KQ8 A;  3FWE A;  2BBY A;  4IRG A;  1FLI A;  4XLN F;  2CW0 F;  1XMA A;  1WKM A;  5HVQ C;  2EV6 A;  5L3B A;  3BP8 A;  3E6M A;  2FE3 A;  4RGU A;  3BJ6 A;  2EA4 A;  1H0M A;  3V7R A;  3FXQ A;  1OMI A;  2RKH A;  2F2E A;  2PFB A;  1S6L A;  4KT5 C;  4LLN A;  4QWQ A;  3H92 A;  1OYY A;  1GHC A;  3L09 A;  4ON0 A;  3DXJ F;  2DT5 A;  1IZ1 A;  4CZZ A;  2ZJ2 A;  4N9H A;  1LDK B;  2YX4 A;  3AAF A;  1YG2 A;  5D6E A;  4L9N A;  4M9X A;  3V8J A;  4WF2 A;  3RKW A;  2MH9 A;  1O57 A;  1O3Q A;  2Q2E A;  4MTE A;  4OMZ A;  2HKX A;  1IN8 A;  5BOX A;  3RPU A;  2QBY B;  5IT3 A;  2EFO A;  2BE5 F;  2O6G E;  3I5U A;  4A6E A;  3K9T A;  2FU4 A;  1YLF A;  1BBY A;  2RVC A;  3VB2 A;  2FNA A;  2F5D A;  3OV8 A;  2KJC A;  1DUX C;  4RB0 A;  3CUQ A;  4R79 A;  4CGZ A;  4GYG A;  4JBA A;  4FHT A;  1IN6 A;  4MGR A;  1J7K A;  4NHJ A;  4PGG A;  1YIO A;  1ZN2 A;  5BMZ A;  2D1H A;  4N0B A;  1TNT A;  1JGS A;  5H6Q A;  5FFX A;  2YSR A;  4AIJ A;  2OD5 A;  4HF0 A;  3J7A O;  1T6S A;  3CDH A;  3HHG A;  1STZ A;  5D5V B;  2ACJ A;  3HSF A;  4EMS A;  2Y0M A;  3GFI A;  2IJL A;  1OYW A;  1ZGJ A;  2A3S A;  3WTT C;  1RI7 A;  2IA2 A;  2A6H F;  3K0L A;  2XAS A;  4G7O F;  2A07 F;  2OZU A;  2ZXJ A;  4HLX A;  1OR7 A;  4ZYE A;  1XCV A;  3BPX A;  2FQ3 A;  2MD5 A;  1L3L A;  2K02 A;  1KU3 A;  1J9I A;  4Y13 A;  2YPR A;  3K1M A;  5AIP A;  2WC2 A;  3PFI A;  3JAM Z;  4HW0 A;  3KP5 A;  2HR3 A;  4EGY A;  1EH6 A;  3F8C A;  4AWX B;  1EH7 A;  4GCV A;  1FPQ A;  3F8M A;  3FMS A;  3FXR A;  2RNJ A;  1WI9 A;  4A2U A;  2GIV A;  4IVN A;  2ZNZ A;  5DCM A;  3I4P A;  5KVR A;  1IXS B;  2KJB A;  3MQ0 A;  1F5T A;  3SZP A;  3Q5F A;  4I02 A;  3V4G A;  3F6V A;  5J8F A;  2DFI A;  4BHP A;  1U8R A;  4IRI A;  2DQL A;  3GW2 A;  5JVT A;  3OOP A;  1BIB A;  2V1U A;  4RGR A;  1FBU A;  1LDJ A;  2ELH A;  2FBK A;  1IRG A;  2P6T A;  2JPC A;  4EJW A;  4O3M A;  1U5T B;  3F23 A;  2ZBK A;  2QQB A;  1Z1D A;  3FMQ A;  1W7P A;  2IA0 A;  5FLX K;  1IXR C;  3R60 A;  5LRS A;  4RGX A;  3JSP A;  2OQG A;  2HGC A;  3F3X A;  1XGS A;  2WV0 A;  5IT9 K;  1R7J A;  2KIU A;  3COA C;  4ESF A;  3I58 A;  1JHH A;  4RAZ A;  5ICF A;  3WTZ A;  5ICE A;  4KN7 X;  4LK1 F;  5E20 A;  3CUQ C;  2R3S A;  1YTY A;  1IXC A;  2DK5 A;  1DP7 P;  3GWZ A;  2QYO A;  5TRD A;  4KIF A;  4LB6 B;  1WQ2 A;  4B09 A;  3ZMS A;  4TV7 A;  1RUO A;  1QNT A;  4WCG A;  3LAJ A;  5HS8 A;  4Y15 A;  2JZY A;  3BJA A;  4I0B A;  5DV5 A;  3WOD F;  1Z7U A;  3T0Y A;  4L5J A;  4ZYG A;  1SD6 A;  5D4R A;  3LQR A;  5D6F A;  2KIF A;  1XDS A;  2PI0 A;  5HLI A;  5DYM A;  2OBP A;  3F72 A;  4I0A A;  1F1Z A;  2CFX A;  4U0V A;  1MDM B;  4M74 A;  3DP7 A;  3QU6 A;  2IW5 A;  2R7D A;  3KCC A;  4KMU X;  1R00 A;  2DU9 A;  1U78 A;  1S8N A;  4PGH A;  1TQI A;  1P2F A;  3WG9 A;  3IKV A;  4UVA A;  3RPQ A;  3R4K A;  5D4S A;  2K4B A;  1ZG1 A;  1J5Y A;  2H6C A;  5K1Y A;  4WXD A;  4LLL A;  3T8T A;  5L3E A;  2BEO A;  1S29 A;  3WTW C;  3GZ6 A;  2FML A;  1FY7 A;  1G3Y A;  1R36 A;  1XGM A;  1WSU A;  4UUV A;  3I53 A;  4KN4 X;  1FC3 A;  1ZLK A;  2DQR A;  3DFG A;  4HX8 A;  3TOA A;  4BHC A;  4Q5S F;  2WWY A;  2HKO A;  4CO8 A;  2FMY A;  1K78 B;  3SZT A;  1QGP A;  3QOP A;  5IT9 Z;  4OU0 A;  1KYZ A;  2NS0 A;  1XGN A;  1Z91 A;  1ZRE A;  3HTS B;  4P5O A;  5LEJ A;  3FMR A;  1D5V A;  3MZY A;  5HLG A;  4YFX F;  2V9V A;  4EM1 A;  4LJZ F;  4RS8 A;  3NRV A;  3HSR A;  5AIQ A;  3KP6 A;  3I64 A;  1T0F A;  3JSO A;  1XSD A;  4MTD A;  4P55 A;  2L02 A;  1ODD A;  2P8T A;  3M9A A;  1L0O C;  1ULY A;  3QPT A;  3TGN A;  3JTH A;  5D8L B;  1Y0U A;  1O3T A;  5KK1 A;  5FD5 A;  2V6C A;  3WTS C;  4BYY A;  1UHM A;  2VOP A;  1PP8 F;  3ZMU A;  3GFM A;  4XSX F;  1PP7 U;  2QZ8 A;  2QBY A;  2VN2 A;  1T39 A;  5BPI A;  2L54 A;  1WRJ A;  2IP2 A;  4PCQ A;  3ZPL A;  2Z99 A;  1HXD A;  4BXU A;  3FF5 A;  2HEO A;  3K1N A;  4FT8 A;  2STW A;  1F4K A;  3ABT A;  3WTY C;  2V1D A;  2OAZ A;  4A0X A;  1YS6 A;  3P9K A;  1W5T A;  3BRO A;  1ZAO A;  2FRH A;  4LFU A;  2EV5 A;  1NHA A;  2YX7 A;  2G7H A;  4OIP F;  1RUN A;  1IRF A;  2JRT A;  2ETH A;  3FXU A;  2EV0 A;  3E3V A;  4L0Z B;  2PMU A;  3LA3 A;  1KQ0 A;  1QZY A;  1P4W A;  3BZ6 A;  2VBZ A;  2HTJ A;  2RN7 A;  3IRR A;  5K5R A;  2A6E F;  4ENK A;  5J8C A;  1HST A;  3I54 A;  3RDI A;  2H09 A;  4BNC A;  1BI3 A;  1FZP B;  1KGS A;  2M8E A;  1BJA A;  4EQQ A;  4XBF A;  2OZ6 A;  1I1S A;  3E5X A;  1USS A;  2W24 A;  4GYI A;  1BOA A;  4UVB A;  3PQJ A;  5BQT A;  4EV0 A;  4HV5 A;  3C1D A;  3E6D A;  1DDN A;  3EDP A;  1G3T A;  3KP7 A;  1ZG3 A;  2KKO A;  1BC8 C;  5FD6 A;  2J5O A;  1B9M A;  1YW7 A;  5AON A;  3KZZ A;  4WK8 F;  1P6R A;  5ICG A;  1EH8 A;  4P9F A;  5HLH A;  3QAH A;  2O03 A;  3J80 Z;  1XN7 A;  2MBF A;  4GGG A;  4L9T A;  4EJU A;  3ELK A;  4LB5 A;  4PZJ A;  4HA8 A;  2P4W A;  2EFN A;  2C6Y A;  1FP2 A;  1W7P D;  3JAM K;  1R1T A;  3Q9V A;  2W25 A;  3CO6 C;  3O6B B;  4YII A;  3GLX A;  2R7F A;  3RKY A;  1K6O A;  1FOK A;  3LFK A;  2MC3 A;  1H9T A;  2F5E A;  2P5K A;  4YFN F;  2VOO A;  4BAY A;  3GEZ A;  3QP6 A;  1G3W A;  5E8G A;  3ECH A;  3ZQ7 A;  1O7F A;  3LWF A;  3G73 A;  1H9G A;  3IWF A;  3RI4 A;  5L3D A;  4OIR F;  4LG0 B;  1XCB A;  5LHI A;  2XHK A;  1U5T A;  1IN4 A;  1YS7 A;  1HQC A;  4EVI A;  4G6D A;  2E7W A;  4P9U A;  1FSH A;  2RV8 A;  2HQN A;  3V7C A;  3T8R A;  2CYY A;  4NB5 A;  3J81 K;  3RKX A;  5F64 A;  1YO5 C;  3CJN A;  1HKT A;  1BN5 A;  1AOY A;  2VBW A;  1HSJ A;  3DPL C;  4D0P A;  4G6Q A;  4I09 A;  4L18 B;  3IL2 A;  2JSC A;  1ZH5 A;  2COM A;  3M7G A;  3QP5 A;  2LF8 A;  4IPA A;  1U3E M;  2PN6 A;  2ZNY A;  4UXN A;  1ZHF A;  3KP2 A;  3CO7 C;  5L3G A;  3BPV A;  2XGX A;  5CYV A;  3V8L A;  4KDP A;  1XSV A;  1FYK A;  1ZAR A;  2QWW A;  4HBL A;  3MAJ A;  3P9I A;  2ZKZ A;  4HAM A;  4HQE A;  1TW3 A;  5E1W A;  1LDD A;  2H27 A;  2X0L A;  5F6F A;  3BOQ A;  1D8K A;  2UXX A;  3TQN A;  4B8X A;  2B0L A;  2L01 A;  4ASN A;  2O61 A;  5D5W B;  2FBI A;  3V7S A;  1SD7 A;  4L5I A;  4MEX F;  5A2Q K;  2M87 A;  3GX4 X;  1MDM A;  4QLC U;  3MWM A;  1R22 A;  2VXZ A;  3KET A;  3WU0 A;  1ZGA A;  4M6X A;  3N97 A;  1IN7 A;  5H20 A;  1D3Y A;  2VE8 A;  2VT2 A;  1PDN C;  4RB2 C;  3I59 A;  2ADU A;  2DPD A;  5L3F A;  5ERI A;  2M30 A;  3SQN A;  3E6B A;  3F21 A;  5HS9 A;  2E1C A;  2GQQ A;  1KU2 A;  5E17 F;  2XAJ A;  1YFH A;  1U6G A;  4G8X A;  3DQV C;  3J81 Z;  1OYI A;  5ED4 A;  2XAQ A;  2CGP A;  1I27 A;  1K78 A;  4WX9 A;  3TOB A;  1SMY F;  4Z2Y A;  2GZW A;  3KZY A;  5ICC A;  3W6K B;  1G6N A;  5HOO A;  1MZB A;  3C7J A;  4A0Y A;  4ESJ A;  3CTA A;  1B1B A;  1S7A A;  3KLO A;  4Q48 A;  4BHB A;  3NEU A;  1U5T C;  1LEB A;  4KA4 A;  4UNO A;  1DPU A;  2GXB A;  4UV8 A;  2DK8 A;  2O0Y A;  1WWX A;  5DUK A;  2D45 A;  2RDP A;  2VC1 A;  3PQK A;  1CGP A;  2CG4 A;  3REO A;  1IF1 A;  3GFL A;  4CDG A;  1ZYR F;  2ZFW A;  2IPQ X;  1LNW A;  2WTE A;  2MLK A;  4XSZ F;  2Q8K A;  4EM2 A;  2O8X A;  2GWR A;  1FT9 A;  3IC7 A;  5A2Q Z;  5DDG A;  4KIG A;  3RIR A;  3C3W A;  5LHG A;  4MQV A;  1R1U A;  3TDU C;  2QLZ A;  3U1D A;  2EFW A;  3RTR A;  1R23 A;  2H6B A;  3N4M A;  3KEQ A;  4HDU A;  4PDK A;  4WXH A;  3GYH X;  3WU1 B;  1C0W A;  1SFE A;  2HFH A;  1MJA A;  2EFP A;  2OQR A;  2HTS A;  4OIQ F;  3ZN1 A;  1SD4 A;  4HLY A;  5LGU A;  3BWG A;  5HDG A;  4OIO F;  1Z05 A;  3BJO A;  4FX4 A;  1U2W A;  1ZLJ A;  2E7X A;  4A0Z A;  2F5F A;  3VEP A;  2CQK A;  1LJ9 A;  2FEZ A;  3HRS A;  4KNY A;  2PLY A;  1UB9 A;  3I59 B;  2M5W A;  4G7Z F;  5CVI A;  4A12 A;  1JE8 A;  1MGT A;  2W85 A;  2FNP A;  3G3Z A;  3O2P E;  2MH2 A;  3NQO A;  1UHW A;  1MD0 A;  1QO0 D;  4HZF A;  4Y17 A;  4HF2 A;  5ILU A;  2DW4 A;  5CVJ A;  6PAX A;  1FWZ A;  5FFZ A;  2XIG A;  1GVJ A;  3WGG A;  4LLG F;  2XRO A;  2RGV A;  4OMY A;  4HV6 A;  1BC7 C;  1XD7 A;  1K79 A;  3CLO A;  1SAX A;  1ZRC A;  1QPM A;  4MEY F;  4K2E A;  3L9F A;  3KEO A;  2L4M A;  5JHU A;  3L7W A;  1O3R A;  4ZYD A;  2XKO A;  2M1B A;  5ILS A;  2IT0 A;  2Z5U A;  3WTU C;  2GA2 A;  2NNY A;  3ECO A;  2LF7 A;  1XDU A;  3ZMV A;  3K2Z A;  2NYX A;  2FF4 A;  2XRN A;  2Z3Y A;  4RGS A;  3CUO A;  4ENN A;  3DPT A;  3J80 K;  2HYG D;  5HDN A;  2DPU A;  1YQA A;  2QUF A;  3H3U A;  3RYP A;  4S04 A;  2DTR A;  1ONV A;  1I1G A; 
#chains in the Genus database with same CATH topology
 4AC0 A;  2MLG A;  3DLL F;  1R58 A;  4V19 K;  2NOJ B;  5K7F A;  1W36 D;  2QEN A;  2CUF A;  3M8F A;  2PEX A;  2LP0 A;  2EK5 A;  4LG0 A;  5M3M J;  3F6O A;  4IQ4 A;  3FIS A;  2H1K A;  5JI6 A;  3OYE A;  3OYF A;  4RA2 A;  2CO5 A;  3LMM A;  2CU7 A;  1LVA A;  4P1W A;  2FA5 A;  4KMF A;  4I01 A;  2VOD A;  4NQW A;  3EET A;  4ENJ A;  3RCO A;  5F27 A;  1FBS A;  4CIC A;  1E17 A;  4IHY A;  4N4N B;  1HC8 A;  2AS5 F;  1ON1 A;  1MMS A;  1HW2 A;  3ZQG A;  1MSF C;  5FRO A;  1TQM A;  4WWC A;  2V79 A;  2MA3 A;  2XPW A;  3BTI A;  2HXO A;  3TL4 X;  2PQ8 A;  1D1B A;  1FMW A;  1OCP A;  2BGC A;  1FIP A;  2KT0 A;  3EUH A;  5D5U B;  3HKZ A;  5KNL A;  4PUS A;  5LBQ A;  3CCS I;  1UFM A;  3ZGK A;  1X4O A;  5F1J A;  3HOU J;  3CCY A;  3S32 A;  5JLX A;  2JVH A;  4L9V A;  2B7E A;  1SAN A;  3M4O J;  1TQP A;  1QZZ A;  3RKQ A;  1Y39 A;  1IV6 A;  4ESB A;  1HBX G;  4DJA A;  2X6X A;  4LK0 F;  4KIB A;  5GTH C;  5CPR B;  5J6X A;  4BXX J;  5FKO A;  4RM2 A;  3QPS A;  2E34 A;  4GO1 A;  4ZZL A;  2FJ1 A;  4E7Z A;  1FYL A;  4IQJ A;  1ERD A;  4MNU A;  3HM5 A;  5HDK A;  4YRV A;  1JHF A;  3MVP A;  5B66 C;  2I10 A;  4U7B A;  1A31 A;  2LY2 A;  4FE4 A;  3TDZ C;  4EJO A;  2A5Y B;  2B9S A;  4G7H F;  4G6T B;  4FET A;  5CJ9 A;  3WG7 H;  3CCM I;  3FM5 A;  2J5P A;  2PJP A;  3C2G A;  3BY6 A;  2K9N A;  4M72 A;  4M3B A;  4MFE A;  3RSN A;  2KZV A;  2H8R A;  4A5N A;  1QVT A;  3ROU A;  4ENM A;  5C4X J;  4HYE A;  4O5V A;  5HS7 A;  4KUM A;  2A69 F;  5CLS A;  4AIK A;  4I7H A;  1J75 A;  4U87 A;  1JXS A;  1FBQ A;  1RIO H;  4IHS A;  2FQ4 A;  1MKM A;  1S5L C;  2IS2 A;  2IA1 A;  3CJT B;  1BI1 A;  3DBL B;  4DQ2 A;  2Y0S A;  3E5U A;  1V5F A;  3WGH A;  3WGI A;  4IEJ A;  1K4T A;  5EG0 A;  1E2X A;  3CME I;  1SFU A;  3CMM A;  1PUF B;  3WTX C;  5J3L A;  2XAH A;  1X1C A;  2CV1 A;  3S17 J;  3LA7 A;  2HYF A;  3JW4 A;  5E1Z B;  1Y56 A;  4LGW A;  2STT A;  2AHQ A;  3QOD A;  2QQA A;  3AL0 B;  1O3S A;  2WAE A;  2W82 A;  3AG4 H;  4HNV A;  2IS1 A;  2COB A;  1R5H A;  3VPR A;  3AG1 H;  3U21 A;  1MMD A;  5B3S H;  3TO6 A;  2EJR A;  3W2V A;  4M9Z A;  4DBR A;  2IBD A;  3L2R A;  2R5Z A;  2ELJ A;  3GLL A;  3W2W A;  5J40 A;  1KYW A;  4E7S A;  3JTG A;  2L7M P;  3C2B A;  1EV7 A;  1IDZ A;  5E79 C;  1HKS A;  5CVR A;  2Y9Z A;  2CJJ A;  5EEG A;  4M73 A;  4II2 A;  3HOZ J;  3HUG A;  3CF2 A;  4MQ9 F;  2W84 A;  1ZR2 A;  4AYB N;  2R7T A;  1LVK A;  3HL2 A;  1RRJ A;  5D5X B;  5ILV A;  3GFJ A;  1F9N A;  3FIW A;  4ETS A;  2ESN A;  4EGZ A;  4CSW A;  4E6K G;  1BW5 A;  5E1X A;  1I5Z A;  5LRR A;  1Z6R A;  3LSM A;  2G7U A;  5LLQ A;  1REP C;  2HDD A;  2JK3 A;  2Z33 A;  3BG6 A;  4L9J A;  3P7N A;  5B1A H;  4C9Y A;  3ASN H;  4ITV A;  1QQI A;  4DIQ A;  2A68 F;  2VC0 A;  3GVA A;  1ZRD A;  2HPI A;  4ZZD A;  3EUA A;  3VSK A;  4F92 B;  1HW1 A;  3FXO A;  2QQ8 A;  1DP3 A;  2OPT A;  3K1P A;  2WY8 Q;  3PSI A;  2HWV A;  2HOT A;  1BL0 A;  3GXO A;  3QPL A;  3ZMT A;  1BI0 A;  3I0T A;  1TWH J;  3K10 A;  1JUP A;  3TO7 A;  3ULQ B;  4MLO A;  2ECC A;  1W5S A;  2PMH A;  1MW7 A;  1YW9 A;  3FM3 A;  4XIC A;  3U2R A;  3OYC A;  1ETO A;  1WJA A;  2X51 A;  2ZC2 A;  4M6Y A;  4M3E A;  1VQ4 I;  4M3D A;  3RZD J;  2K40 A;  2K9M A;  1W4M A;  3ABL H;  2DI3 A;  2VKD A;  3BR3 A;  4Y33 A;  4CXF A;  1Z7L A;  2BY3 A;  1HKQ A;  3SFZ A;  4KIS A;  1SFX A;  1OCT C;  2K5C A;  4HX7 A;  4U88 A;  1G3S A;  2PBI A;  5LGT A;  4AIH A;  2MFZ A;  3IHU A;  2VT3 A;  3EYI A;  5L3C A;  1K83 J;  1FIA A;  4E70 A;  4MHG A;  2EIJ H;  4CCJ A;  1Z9C A;  2I5U A;  3WU2 C;  4G12 A;  4S05 A;  4NC7 A;  2O3F A;  2Q0O A;  3OSG A;  3S1R J;  4RB3 C;  1QBJ A;  2HVS A;  3GCM A;  4Z6Y A;  3I56 I;  4XOR A;  4BQN A;  2P5L C;  4L0Y B;  1TLH B;  2F5C A;  3K4K A;  3ZP5 A;  4BDZ A;  3WE3 A;  1B59 A;  2XAG A;  3VFZ A;  3H0D A;  5EEH A;  1LQ1 A;  4R8H A;  4MIM A;  3EUH C;  2LYC A;  3E5Q A;  3IWZ A;  3JRI A;  3ZRG A;  2OJE D;  4G94 A;  2ELK A;  4HF1 A;  4WXC A;  2YUS A;  4W1U A;  1XB4 A;  1T33 A;  3BZK A;  1VQ5 I;  4Q47 A;  2XB0 X;  3K4J A;  3GO5 A;  4OOI A;  1VQO I;  2ZJR F;  3E6C C;  2VBY A;  4IJA A;  4II3 A;  4Y7N J;  5K5O A;  1XMK A;  2K4J A;  3MFK A;  2GXG A;  2HNH A;  2VON A;  1IV8 A;  3CZ6 A;  3HIF A;  4KIC A;  3OYM A;  5DEQ A;  2X6W A;  4NC6 A;  1X19 A;  1IAW A;  3HRM A;  3H5N A;  3ZN0 A;  2EWN A;  2P7V B;  1QZE A;  1JUM A;  3G2B A;  3M07 A;  2XAU A;  3K6G A;  3F0C A;  4IL6 C;  2DBB A;  2QM3 A;  2V9P A;  2KLO A;  3LNQ A;  1J2X A;  3VSL A;  2M7B A;  3HEF A;  2QSF X;  3HGG A;  2HVR A;  2EZH A;  1Y1V J;  1MJ9 A;  1AWC A;  1B6A A;  2WAQ A;  2DYR H;  1A04 A;  2BYV E;  4A3E J;  1S3J A;  1YJN I;  5E8I A;  1T2K A;  1XGO A;  3Q0W A;  1V3F A;  2BV6 A;  1UST A;  2ZJP F;  1OPC A;  1TBX A;  3MCZ A;  4IO9 F;  3ZQC A;  2QVO A;  2P7C B;  3FK7 A;  1QRY A;  3N05 A;  1FYM A;  1LEA A;  3A0H C;  5C44 J;  4RDU A;  1IN5 A;  4A3B J;  4B44 A;  2HDC A;  2HS5 A;  3Q0U A;  5JR3 A;  5FJ8 J;  5BS6 A;  3ABU A;  4IF4 A;  4QIW N;  1TNS A;  2L7Z A;  1SD5 A;  2JT1 A;  5F0H A;  1I3A A;  2HZT A;  1VF9 A;  3W3C A;  3OSF A;  1TT0 A;  1TWG J;  1T98 A;  2A61 A;  3LSP A;  4XRS A;  2DLL A;  3D0S A;  2ZME A;  3VYU B;  2DO7 A;  1J0R A;  1OCR H;  2VXD A;  2JVG A;  2VBX A;  2KRC A;  4CCK A;  4B1R A;  4Q4Z F;  2R7S A;  2ZCW A;  1I6X A;  1DGW Y;  3B73 A;  4DOZ A;  4YIR X;  1ZRF A;  3VWB A;  1O7L A;  5JFR A;  2DOD A;  1OIS A;  1XPX A;  2Z16 A;  4C3H J;  2HQR A;  3OL3 A;  4ZH4 F;  2OUM A;  4FX0 A;  4RAG A;  4HSR A;  3W6J B;  4M3F A;  4DYR A;  5DD4 A;  1S7E A;  3HHH A;  2R7R A;  4XON A;  4HST A;  3QRF F;  5LHH A;  3DLA A;  2P6S A;  3TKY A;  1T38 A;  4P96 A;  1MJB A;  3L00 A;  3T5X A;  1X2N A;  2OU2 A;  1KZH A;  2ISZ A;  2M2E A;  4YFK F;  2EFQ A;  3LSG A;  4CHU A;  3JRC A;  2OTL I;  3P9C A;  4HX4 A;  4XRF A;  3WE2 A;  1V5G A;  1OCC H;  3QU3 A;  3WHB A;  4BU2 A;  1W0T A;  3QPH A;  2VUM J;  2FBH A;  1LPQ A;  1YOV B;  3JCU C;  3D5L A;  3DEE A;  4A5M A;  5E3N A;  1IDY A;  1V4R A;  1R71 A;  2DA2 A;  1D1C A;  1V55 H;  1CF7 A;  2W48 A;  1FP1 D;  1FOY A;  3E7L A;  4E7L A;  2E19 A;  1HLV A;  2CUZ A;  2UZK A;  1QVU A;  1V5E A;  4ZYA A;  5DCF A;  2QKL B;  2XKP A;  4A3M J;  2MYS A;  5FRM A;  1FX7 A;  4U0W A;  3VOD A;  4HDV A;  5H6R A;  3CUQ B;  2CV0 A;  4A69 C;  2CWE A;  3MKL A;  2R7Q A;  4XLP F;  4OIN F;  3V42 A;  3M8E A;  1B4A A;  4BE0 A;  3PNY A;  2E36 A;  2MSY A;  2PMZ N;  2Y31 A;  3FHZ A;  1NG6 A;  1P7I A;  3OR1 C;  2V1X A;  2D1V A;  3ZR8 X;  3HTU A;  2P81 A;  3O8H A;  2NNN A;  3FZV A;  2ZO4 A;  4IHT A;  3HYI A;  4B48 A;  1P4A A;  1WH7 A;  3GTP J;  4FAS D;  1W36 C;  2D2W A;  2NOG A;  3H1C A;  1NG7 A;  2GOX B;  3IKT A;  3RQI A;  5DD8 A;  1VTN C;  2Z9O A;  3TO9 A;  3HRT A;  2K7L A;  1P92 A;  3OIQ A;  3HXL A;  3M1E A;  4LOC A;  4F7Z A;  3WTV C;  2QGU A;  3F8B A;  3CDL A;  1MBG A;  2WBM A;  3S2W A;  4A6D A;  1Q1H A;  4B3A A;  3BCA A;  3GUD A;  1NH3 A;  2EIL H;  3R0J A;  2XVC A;  4XQF A;  4XN3 A;  3O3K A;  4EM0 B;  5HLT A;  3FXK A;  2ECB A;  2EB7 A;  3R0A A;  2F48 A;  4XOP A;  2UXN A;  5FGM A;  5BPD A;  2W57 A;  4C30 A;  2LNB A;  2MGQ A;  3IRQ A;  2O9L A;  3KP3 A;  2FX0 A;  2GA1 A;  3HRU A;  4OAZ A;  1X1A A;  1E0E A;  1GXQ A;  3H5R A;  4PJM A;  2IXS A;  4EJV A;  1HW5 A;  1BIA A;  3KP4 A;  2VAS A;  1ZR4 A;  3S3O A;  4M9S A;  2OTJ I;  2LFB A;  1PUE E;  3HOT A;  1SEU A;  1IW7 F;  1JTX A;  1IG7 A;  4IOA F;  1X3U A;  3LAP A;  1KA8 A;  3GF2 A;  2AQE A;  1EJ9 A;  3A4C A;  2DMU A;  4UHT A;  3HOS A;  3UKG A;  2GIZ A;  2XUB A;  5KAF C;  9ANT A;  2DAO A;  1TW2 A;  2RC4 A;  2TDX A;  2QQ9 A;  2R93 J;  5FO5 A;  1JTY A;  3SZG A;  1R6R A;  2KPM A;  2HDW A;  2M45 A;  2EPF A;  4CCO A;  2LSO A;  4LD5 A;  2E5Z A;  3I71 A;  1X3W B;  5IOY A;  4BEH B;  1WCM J;  4RB1 A;  2G9W A;  3ERE D;  5F1R A;  1G4D A;  2CQX A;  2ZB9 A;  4DNC A;  5JVG F;  4ZJZ A;  2L3D A;  2ZME B;  1WVR A;  2YU3 A;  2KIM A;  3EYY A;  1TTY A;  2D5V A;  4A3L J;  1TWA J;  1RNL A;  1MMG A;  2QF7 A;  4Y52 J;  3CCQ I;  2P5V A;  2YU9 J;  2AQF A;  2CQN A;  5D8K B;  5TJJ A;  2E1M B;  4UV9 A;  1S7O A;  3V8K A;  3LST A;  2R7Z J;  3NAR A;  4KYW A;  4G9Y A;  5DCM B;  1PUF A;  2XAF A;  4AVP A;  2BOL A;  2E5N A;  1OCZ H;  3LQQ A;  1WJE A;  1WJD A;  2JA8 J;  2AXL A;  4HQM A;  2R92 J;  5E3M A;  2LOO A;  3J7A Y;  2H94 A;  2VPL A;  4I98 B;  2RQP A;  1A36 A;  1P4X A;  4JQF A;  3RJP A;  5EEA A;  4R1H A;  5FLX Z;  1XTA A;  4BAC A;  3CP8 A;  2EZL A;  3BDD A;  4M71 A;  3K2A A;  1R49 A;  3VDX A;  3K70 D;  4XLH A;  1K7A A;  2K86 A;  5E3O A;  3PIO F;  3BT9 A;  2LKX A;  1U9O A;  1LFB A;  2LH9 A;  4RAY A;  1KU9 A;  4CYD A;  3ZMZ A;  2EIN H;  3ZQL A;  2LDU A;  5HOD A;  2PG4 A;  2Y48 A;  3UR3 C;  1S9H A;  2JA7 J;  1YW8 A;  3T1B A;  1CF7 B;  4UVC A;  2IVM A;  1JKP C;  1ETK A;  1E3O C;  3MD2 A;  2EA2 A;  1YX3 A;  4XMY A;  2O8K A;  2DMN A;  3R61 A;  1R5G A;  2BZT A;  1W7P B;  3R6S A;  1ZG5 A;  2Y75 A;  1U0J A;  1KU7 A;  5HNF A;  1X1D A;  3GZ5 A;  4KFC A;  2JA6 J;  5M5Y J;  3EUK L;  5FRN A;  1VI0 A;  4AD9 A;  3B02 A;  3ISP A;  1Y6I A;  5F0C A;  2ZSI B;  2VE9 A;  1ON2 A;  4YEJ A;  1MND A;  2IGK A;  3C18 A;  4XKV A;  2HOE A;  2LG4 A;  3S93 A;  3ZMD A;  4J00 A;  4A3I J;  3L2C A;  2QEX I;  3ZQF A;  3MZH A;  4HG2 A;  5JLW A;  1KQ9 A;  5E18 F;  3L2Q A;  4A3F J;  1D8J A;  3SXY A;  1FNN A;  2Z2S B;  1Y0N A;  2M4G A;  2K27 A;  1UG0 A;  5J4V A;  2LKS A;  1DPR A;  1R4M B;  1H8A C;  3AG2 H;  1OKR A;  2CSO A;  2Y69 H;  3EQL F;  2HOA A;  3DKW A;  3TBI A;  1APL C;  2XRL A;  1GXP A;  4IHX A;  3ML6 A;  2FOK A;  3BR5 A;  1LKX A;  2X4H A;  1R1V A;  1B9N A;  3H3Z A;  1BI2 A;  2R7X A;  3CCR I;  4HNT A;  3I4M J;  2JPB A;  2V6E A;  5LEK A;  2NAZ A;  3BG5 A;  3DTK A;  2KRF A;  3DF8 A;  2TRT A;  3HSE A;  4GXO A;  2M34 A;  4U0Y A;  2PJR B;  3LA2 A;  2DMT A;  4BQQ A;  1SVO A;  3AFH A;  4X1E A;  3F8F A;  2FXA A;  4IRH A;  1LB2 A;  4RMN A;  2WY7 Q;  2LVS A;  1RZ4 A;  4CYC A;  3S8P A;  3PUB A;  2GAU A;  1UCR A;  3IH3 A;  2GM4 A;  3ZOB A;  3CC2 I;  1BM9 A;  3MEX A;  1JKR C;  1FSE A;  1XSX A;  5IPA A;  2OA4 A;  2VJI A;  3F22 A;  4YG2 F;  2EBI A;  2ZXH A;  1UMQ A;  2BXY A;  1FTT A;  2JTV A;  4XLE A;  2ESH A;  2YR2 A;  2IGO A;  3CJQ B;  1DU6 A;  5K5Q A;  2ISY A;  4C2T A;  2Y30 A;  1XMX A;  2ID3 A;  5LGN A;  2DT6 A;  3QQA A;  2KHM A;  1IUY A;  3DEU A;  1U9N A;  3KE2 A;  3OWT A;  2IRF G;  2UWM A;  2XB5 A;  3FHN A;  3F8N A;  2NVX J;  3U9G A;  1N25 A;  1AHD P;  5KAI C;  3SHF A;  4YIF A;  1K61 A;  3CP2 A;  4ZYH A;  3CCJ I;  3KLN A;  5FB2 A;  3OYK A;  3A01 B;  1J09 A;  3FX3 A;  4H0E A;  4PFP A;  2BHZ A;  5DUI A;  3KFW X;  4O6J A;  3Q9S A;  4N9I A;  4XLF A;  2DOA A;  3K7A J;  3E97 A;  2NRA C;  4I2O A;  3ZQH A;  4EJT A;  3DV8 A;  1Z77 A;  4IXA A;  1SMT A;  2E1N A;  4U7D A;  4A3D J;  2L4A A;  2FSW A;  2LKP A;  4IKF A;  3M8J A;  4UUS B;  2IGN A;  1GV2 A;  3K69 A;  1J59 A;  2XV4 S;  1ZKG A;  4I76 A;  4QSH A;  3S3N A;  3HDD A;  3VOE A;  4BH9 A;  4BQA A;  4LMY A;  5CVV A;  3BG9 A;  4HOB A;  1YYV A;  3KYL A;  4JK1 X;  5CVU A;  1Z6T A;  5C3E J;  3RYR A;  1KQ8 A;  3PL8 A;  2RAE A;  3FWE A;  2DT7 B;  3NAU A;  4CZC A;  2BBY A;  2NVY J;  3CC7 I;  4IRG A;  5J1Y A;  1FLI A;  4XLN F;  2BVM A;  2CW0 F;  4RLQ A;  3AL0 C;  1XMA A;  1WKM A;  3JR9 A;  3U1K A;  5HVQ C;  2EV6 A;  5L3B A;  3BP8 A;  3D5R C;  5H2F C;  3E6M A;  4E4H A;  2FE3 A;  3PO3 J;  4RGU A;  1F43 A;  3BJ6 A;  3CF5 F;  3GTK J;  3BCB A;  3HGY A;  2EA4 A;  4AID A;  1LFP A;  2RNG A;  4IHV A;  5IP6 A;  1H0M A;  5FLM J;  1BW6 A;  1FOX A;  3H36 A;  3V7R A;  3CCL I;  1D0Y A;  1OMI A;  2Z1D A;  3FXQ A;  2RKH A;  2F2E A;  3OIP A;  3IAS 2;  3HPH A;  2PFB A;  1S6L A;  1O4X A;  4KT5 C;  4LLN A;  4QWQ A;  3H92 A;  1OYY A;  1GHC A;  3L09 A;  1TL8 A;  5IOZ A;  4ON0 A;  3DXJ F;  1UHS A;  1IZ1 A;  2DT5 A;  5EYR A;  4CZZ A;  2ZJ2 A;  3SJM A;  3FXM A;  1YX5 A;  4N9H A;  3K4C A;  1LDK B;  2YX4 A;  1YG2 A;  3AAF A;  4PJJ A;  4PJN A;  5D6E A;  4E7K A;  4L9N A;  2M0M A;  2VI6 A;  4M9X A;  3V8J A;  4WF2 A;  2JSP A;  3RKW A;  3OYG A;  4BQO A;  2MH9 A;  3GTG J;  1O57 A;  4A3K J;  1DQU A;  1O3Q A;  2Q2E A;  2XSJ C;  4MTE A;  2F5V A;  1QU3 A;  4OMZ A;  2HKX A;  3SEQ A;  1NK2 P;  1IN8 A;  1LFU P;  3L1P A;  3IH2 A;  5BOX A;  3RPU A;  2QBY B;  4FIS A;  5IT3 A;  3CCU I;  2HYJ A;  2EFO A;  2KQR A;  1ETW A;  2A5W A;  2BE5 F;  4J01 A;  2O6G E;  3I5U A;  3PNT A;  4A6E A;  3K9T A;  3OYB A;  3JRH A;  3S3M A;  1FOW A;  4KIT B;  3BC8 A;  2DXI A;  2FU4 A;  4J19 A;  2GLO A;  1YLF A;  4GDF A;  1BBY A;  1N75 A;  2RVC A;  3VB2 A;  2KDZ A;  2FNA A;  1WGX A;  2F5D A;  4V2F A;  4CYC B;  3OV8 A;  2KJC A;  3GZN B;  1Z21 A;  3HKZ N;  5BNG A;  4X0G A;  4BBS J;  1DUX C;  1UEL B;  4RB0 A;  3CUQ A;  2R4G A;  5GPA A;  4R79 A;  4CGZ A;  1YIJ I;  2WV1 A;  2NVQ J;  3IAM 2;  3MKZ A;  3HPG A;  3S1N J;  2X9D A;  1PJR A;  2EZK A;  2F4I A;  2K85 A;  2DDB A;  4GYG A;  4JBA A;  3OR2 C;  2HQA A;  4FHT A;  3SFI A;  4BKX A;  1IN6 A;  4MGR A;  2KL4 A;  2GXA A;  3G4S I;  1J7K A;  4NHJ A;  1MBH A;  4PGG A;  3AKZ A;  2X6O A;  1YIO A;  2IS4 A;  1ZN2 A;  2N8G A;  5BMZ A;  2D1H A;  2ZJQ F;  4N0B A;  2R7V A;  3ZCO A;  4XR6 A;  1TNT A;  1JGS A;  1WI3 A;  2VKE A;  3K4M A;  1FTZ A;  2VKH A;  1EA3 A;  5H6Q A;  3BR2 A;  5FFX A;  2YSR A;  4JYK A;  4ABZ A;  3PO2 J;  4AIJ A;  2OD5 A;  1MSE C;  4HF0 A;  2CS3 A;  3J7A O;  3KZI C;  4UB6 C;  1T6S A;  3CDH A;  4E7H A;  3HHG A;  1STZ A;  5D5V B;  1D0Z A;  3RZO J;  4XM3 A;  4XLC A;  5J1R A;  1X1B A;  2DFH A;  2ACJ A;  1ZEL A;  2OF7 A;  2R5Y B;  2DMP A;  3F9K A;  3HSF A;  2Y0S N;  2Y0M A;  5FKK A;  4EMS A;  3GFI A;  3WHC A;  5EGO B;  2IJL A;  1Y1W J;  1OYW A;  4B47 A;  1ZGJ A;  2A3S A;  2BY0 A;  3WTT C;  1RI7 A;  1SAU A;  2IA2 A;  2A6H F;  1X3Z B;  2XAS A;  3BQZ A;  2DTZ A;  3FBI B;  3K0L A;  4BJT A;  4UB8 C;  4RBO A;  1JKQ C;  4G7O F;  4XKW A;  2A07 F;  1RKW A;  2XDV A;  2OZU A;  1R9T J;  2VLA A;  1MNM C;  2ZXJ A;  3FBN B;  4HLX A;  1OR7 A;  4LG3 A;  4ZYE A;  1XCV A;  4RM3 A;  3BPX A;  2FQ3 A;  2MD5 A;  1L3L A;  1MNE A;  2JN6 A;  2K02 A;  1MIJ A;  4DW6 A;  1KU3 A;  3KYC B;  1Z3X A;  3H0G J;  1J9I A;  2KFD A;  4Y13 A;  1WH5 A;  2YPR A;  2R7W A;  3K1M A;  2YS9 A;  2WC2 A;  5AIP A;  3PFI A;  3JAM Z;  4HW0 A;  3KP5 A;  2HR3 A;  3G1O A;  1ETQ A;  4BEH A;  5DS9 A;  1JKO C;  3CES A;  4EGY A;  1EH6 A;  3F8C A;  1P9Q C;  4BL0 B;  2X85 A;  2DOE A;  4AWX B;  1EH7 A;  1PVE A;  3ERM A;  1YIT I;  2WAF A;  4GCV A;  1FPQ A;  3F8M A;  2L9V A;  5J47 A;  3S14 J;  1VQ8 I;  3HOX J;  3FMS A;  3FXR A;  2RNJ A;  1WI9 A;  3HOY J;  2NVT J;  4A2U A;  2GIV A;  4IVN A;  2ZNZ A;  3OYD A;  5DCM A;  3FXL A;  1ENH A;  3BR1 A;  5EF6 A;  3I4P A;  2TCT A;  4FCY A;  5KVR A;  1IXS B;  1GV5 A;  2KJB A;  3MQ0 A;  1F5T A;  3CQZ J;  3LSH A;  2V4J C;  3SZP A;  3Q5F A;  4I02 A;  3V4G A;  2O7O A;  3F6V A;  4BY1 J;  2JUG A;  3TED A;  1GT0 C;  3SDG A;  5J8F A;  3B6C A;  4Y3O A;  3DTI A;  3CMY A;  2LK2 A;  2DFI A;  4ZDP A;  2Q2E B;  4BHP A;  2X6Y A;  4BUP A;  1U8R A;  4N4O B;  1YE9 A;  3ESW B;  4IRI A;  2DQL A;  3GW2 A;  5JVT A;  3OOP A;  1POG A;  1BIB A;  2V1U A;  4RGR A;  4XL9 A;  3K70 C;  2WB1 A;  1E3P A;  1FBU A;  1JGG A;  1LDJ A;  2X48 A;  2ELH A;  2RRE A;  2FBK A;  2V7F A;  2VQG A;  2LY9 A;  3PSF A;  1IRG A;  5IY5 H;  5FKN A;  2P6T A;  2JPC A;  3J7Y J;  2DCE A;  4EJW A;  4O3M A;  1U5T B;  3F23 A;  2ZBK A;  3BTC A;  2M8G X;  2QQB A;  1I6H J;  3GTO J;  3OYH A;  1Z1D A;  3A1Y A;  3FMQ A;  1W7P A;  2IA0 A;  2XPU A;  5FLX K;  2EZI A;  1IXR C;  1FJL A;  2F4M B;  3R60 A;  5LRS A;  1YHQ I;  4RGX A;  3JSP A;  2OQG A;  2HGC A;  2V1N A;  4A93 J;  1BA5 A;  3F3X A;  1XGS A;  1UJ8 A;  4BDY A;  2IGM A;  4EEF G;  2WV0 A;  5IT9 K;  1R7J A;  2DJI A;  2KIU A;  1RR7 A;  3COA C;  4ESF A;  3I58 A;  1G8X A;  4F93 B;  1JHH A;  4RAZ A;  2VQC A;  5GAG J;  5ICF A;  3WTZ A;  5ICE A;  4KN7 X;  4LK1 F;  3MKW B;  5E20 A;  3SDB A;  3CUQ C;  3OOU A;  1V54 H;  1BJZ A;  3O8G A;  3DPU A;  3TMO A;  3VYR B;  2R3S A;  2CH0 A;  4ZTF A;  1IXC A;  1YTY A;  2DK5 A;  1DP7 P;  2DA1 A;  3GWZ A;  4HRI A;  2UUZ A;  3OMY A;  2BY1 A;  2QYO A;  5TRD A;  4GFB A;  1YI2 I;  4KIF A;  4LB6 B;  3CDI A;  1WQ2 A;  3BTL A;  4B09 A;  2EIK H;  3ZMS A;  4TV7 A;  1RUO A;  1QNT A;  4WCG A;  2PJR A;  3AG3 H;  3HBL A;  3LAJ A;  3QYE A;  2ZXW H;  5HS8 A;  4Y15 A;  1RR8 C;  3QYB A;  2JZY A;  3BJA A;  4I0B A;  2WAQ N;  4KT6 A;  5DV5 A;  3WOD F;  3I55 I;  3GTQ J;  1ETY A;  5GP9 A;  1Z7U A;  3T0Y A;  3G1L A;  4L5J A;  4ZC3 A;  2R7O A;  2QSH X;  4ZYG A;  1BR2 A;  5FLV A;  1SD6 A;  5CQG A;  5D4R A;  3LQR A;  2A6T A;  5IYC J;  5D6F A;  5E3L A;  1UAA A;  1GDT A;  2HVQ A;  2KIF A;  2LD5 A;  1TT5 B;  5F08 A;  3A2K A;  1XDS A;  4BJ5 C;  2PI0 A;  3DCF A;  3ZQQ A;  5HLI A;  5DYM A;  5K7Z A;  2OBP A;  1OR7 C;  5EDN A;  3F72 A;  4I0A A;  1F1Z A;  2CFX A;  1RES A;  4U0V A;  1MDM B;  4M74 A;  4RAF A;  1TWF J;  2JA5 J;  2CFO A;  3DP7 A;  3QU6 A;  2IW5 A;  2R7D A;  3KCC A;  4D1Q A;  2ICW G;  2MW8 A;  3ZQI A;  3NWT A;  4KMU X;  2DA6 A;  3A01 A;  1R00 A;  2DU9 A;  2PX9 A;  5B1B H;  1U78 A;  1S8N A;  4PGH A;  1TQI A;  3DEW A;  1P2F A;  1GLN A;  2XF5 A;  3IKV A;  4UVA A;  3RPQ A;  3WG9 A;  3MKY B;  3R4K A;  4F91 B;  4NDL A;  5D4S A;  2DMQ A;  2K4B A;  2W1O A;  1MBJ A;  2JMW A;  1ZG1 A;  1IRZ A;  1JI8 A;  1J5Y A;  2H6C A;  5K1Y A;  4WXD A;  4LLL A;  2DA3 A;  3T8T A;  2ZME C;  4B4C A;  5L3E A;  4FQG A;  4UUS A;  1VQP I;  2BEO A;  1S29 A;  3H9J A;  3WTW C;  2FUG 2;  4XK4 A;  3GZ6 A;  1WHU A;  2FML A;  1FY7 A;  1G3Y A;  1R36 A;  1XGM A;  2DA7 A;  1WSU A;  2L9S A;  4UUV A;  1QPI A;  1HF0 A;  1R4N B;  3I53 A;  2UV1 A;  3GTM J;  1VQ6 I;  4KN4 X;  1BR1 A;  4D5C A;  2E1M C;  5F04 A;  1FC3 A;  1ZLK A;  1N78 A;  2DQR A;  3DFG A;  3K4B A;  4HX8 A;  2VJJ A;  2OCE A;  3TOA A;  5IP9 J;  1N77 A;  4BHC A;  4Q5S F;  2WWY A;  3DTE A;  4LIU A;  1SVM A;  2HKO A;  4CO8 A;  2FMY A;  1K6Y A;  2IEK A;  2BY2 A;  5GAH J;  5EZG A;  3G6E I;  3DBR B;  1K78 B;  5J1U A;  3KPH A;  3SZT A;  1QGP A;  1VQ9 I;  5LD2 C;  2OV7 A;  3QOP A;  5IT9 Z;  4OU0 A;  5CKT A;  1KYZ A;  4DYQ A;  5EJC A;  3S2D J;  2NS0 A;  5DTD A;  3J7Z I;  1XGN A;  2BW3 A;  4F55 A;  1Z91 A;  1M1E B;  4ANJ A;  1SFO J;  1ZRE A;  3HTS B;  4JX5 A;  4P5O A;  3RPU D;  5LEJ A;  3NWS A;  3FMR A;  1D5V A;  3MZY A;  3LSR A;  3GBG A;  5HLG A;  3LL7 A;  2HZD A;  4YFX F;  3OY9 A;  2V9V A;  4M3G A;  4FTH A;  4EM1 A;  4LJZ F;  1T95 A;  4RS8 A;  3NRV A;  4AYB A;  3HSR A;  5AIQ A;  1Y8R B;  3KP6 A;  4AM3 A;  2LC2 A;  3I64 A;  2I8D A;  3OL4 A;  1T0F A;  3JSO A;  1XSD A;  4M6V A;  4MTD A;  1IUF A;  1WJB A;  1X58 A;  4P55 A;  3BG7 A;  4XRS G;  2L02 A;  3TP0 A;  1ODD A;  2P8T A;  3M9A A;  2F6C A;  1L0O C;  1ULY A;  3QPT A;  3TGN A;  1B8I A;  3JTH A;  1Z67 A;  4L5E A;  5D8L B;  1Y0U A;  1O3T A;  5KK1 A;  5FD5 A;  4XN0 A;  2QA4 I;  2V6C A;  3WTS C;  4BYY A;  3PFY A;  5TIS C;  1UHM A;  3ONQ A;  1JUS A;  3GTJ J;  1XX5 A;  2VOP A;  1PP8 F;  3ZMU A;  2G0E A;  2LY1 A;  3GFM A;  3Q0V A;  4E7I A;  4XSX F;  4DYC A;  2XPV A;  2MG4 A;  4XID A;  1PP7 U;  2QZ8 A;  1ETX A;  3OS2 A;  2VQH A;  2HPM A;  2QBY A;  2VN2 A;  2B63 J;  1T39 A;  4XOT A;  1P7J A;  5BPI A;  2L54 A;  3PM1 A;  4A3J J;  2LLK A;  1Y8Q B;  1WRJ A;  3ABK H;  2IP2 A;  4C3J J;  1K4S A;  1VQM I;  2VQL A;  2EQR A;  4PCQ A;  1JJ6 C;  2Z99 A;  1NK3 P;  5B5E C;  3ZPL A;  1HXD A;  4BXU A;  1HDP A;  3FF5 A;  2HEO A;  4IOC F;  2K9L A;  1B72 B;  1A6I A;  3K1N A;  4FT8 A;  2STW A;  4UUT A;  1F4K A;  3ABT A;  3PIP F;  2JUC A;  3WTY C;  2XC7 A;  5M5X J;  2V1D A;  2OAZ A;  4A0X A;  2E71 A;  3KEY A;  1YS6 A;  3MMY B;  3P9K A;  1W5T A;  3BRO A;  5GTI C;  1ZAO A;  2FRH A;  3C2H A;  3TP3 A;  4AUX A;  4LFU A;  2EV5 A;  1NHA A;  2YX7 A;  2DFF A;  2G7H A;  1W5C C;  4OIP F;  1RUN A;  4XKC A;  2DA4 A;  4KJZ A;  1IRF A;  2JRT A;  4BS9 A;  2ETH A;  3FXU A;  2EV0 A;  3FXJ A;  3E3V A;  3KIO A;  4NBQ A;  5F0F A;  4L0Z B;  3KX2 A;  2PMU A;  1VQK I;  3LA3 A;  2P0W A;  1KQ0 A;  1QZY A;  1P4W A;  3BZ6 A;  2VBZ A;  3SEZ A;  2HTJ A;  5IYB J;  2RN7 A;  4HPQ A;  4DZP A;  3IRR A;  5K5R A;  2OC6 A;  2A6E F;  4ENK A;  5J8C A;  1HST A;  3I54 A;  2VJ4 A;  2LBF B;  3RDI A;  4BJ6 C;  2H09 A;  2HI3 A;  3L2U A;  4BNC A;  2ME6 A;  1MH4 A;  2VL8 A;  5J4Y A;  2DYS H;  4QPO A;  1SFK A;  3JRG A;  2XSD C;  1BI3 A;  2NVU B;  2R5Y A;  1FZP B;  1KGS A;  2M8E A;  1BJA A;  3CC4 I;  2E60 A;  3HJE A;  3ABM H;  4EQQ A;  1OQY A;  5EGO A;  2MAB A;  4XBF A;  2OZ6 A;  1IC8 A;  1I1S A;  4MFD A;  2NS7 A;  2ZSH B;  3E5X A;  1ETV A;  1VQL I;  1U8B A;  1X4P A;  2IAI A;  1Z3Y A;  1USS A;  3L2W A;  1JT0 A;  2V9K A;  2W24 A;  4HNU A;  4I6Z A;  4GYI A;  2ZFU A;  2Q1Z B;  1BOA A;  4UVB A;  5EZH A;  3PQJ A;  1RC9 A;  1BR4 A;  5BQT A;  1RPW A;  4EV0 A;  2GOM A;  3H3V K;  4CA0 A;  4HV5 A;  3C1D A;  3E6D A;  3IH4 A;  1DDN A;  3EDP A;  5FKM A;  4NUB A;  1G3T A;  3KP7 A;  1ZG3 A;  1MBF A;  3ASO H;  2KKO A;  3HZJ A;  2M4K A;  1BC8 C;  5FD6 A;  4DGW B;  2J5O A;  1B9M A;  3ZXS A;  1YW7 A;  5AON A;  2DA5 A;  1WJ5 A;  3JRF A;  1HA8 A;  3KZZ A;  2H1L A;  2L7K A;  4WK8 F;  2XF6 A;  3S1M J;  1P6R A;  3LSK A;  5ICG A;  1EH8 A;  3HG9 A;  2BW3 B;  3EPZ A;  3OYA A;  2E2H J;  4P9F A;  5HLH A;  3QAH A;  2BXZ A;  3L2V A;  1D5Y A;  2O03 A;  1VND A;  3J80 Z;  1XN7 A;  2MBF A;  3BR6 A;  4GGG A;  4L9T A;  4EJU A;  3ELK A;  2DDA A;  4LB5 A;  4PZJ A;  2K3F A;  2XGE A;  4MO7 A;  2NS8 A;  4HA8 A;  2L5Q A;  4PSX A;  1XG1 A;  3I3L A;  3BQY A;  2P4W A;  2EFN A;  1VQ7 I;  2FD5 A;  3BR0 A;  3VYT B;  5FKL A;  3GTL J;  1LE8 B;  5IYD J;  2C6Y A;  1FP2 A;  1AKH B;  3LSI A;  1W7P D;  1W1W E;  3JAM K;  1R1T A;  2L7F P;  4C3I J;  2CQQ A;  3G1M A;  1KON A;  3Q9V A;  1OFC X;  2W25 A;  1B8I B;  3CO6 C;  3O6B B;  4YII A;  3TW7 A;  3GLX A;  2R7F A;  3PNV A;  3QWL A;  3RKY A;  2W4S A;  1K6O A;  1FOK A;  1T0F C;  2CW7 A;  2MC3 A;  2CUE A;  3LFK A;  1H9T A;  3BLY A;  2IS6 A;  2F5E A;  2P5K A;  2EIM H;  4YFN F;  2VOO A;  2L0K A;  4BAY A;  3FKJ A;  3GEZ A;  4AU7 A;  3QP6 A;  1UG2 A;  2JA2 A;  1G3W A;  2JWT A;  1CQT A;  1YJW I;  5E8G A;  1RET A;  3ECH A;  3ZQ7 A;  1O7F A;  3LWF A;  3G73 A;  1H9G A;  3IWF A;  3RI4 A;  1ACI A;  5L3D A;  4OIR F;  4LG0 B;  1XCB A;  5LHI A;  1WPK A;  2XHK A;  1U5T A;  1IN4 A;  1MBE A;  3IP4 B;  1YS7 A;  4BBR J;  1HQC A;  4C2M J;  4EVI A;  3OYN A;  3BZC A;  4G6D A;  2E2J J;  2EH3 A;  2E2I J;  5GAE J;  2E7W A;  2VIX A;  1WJF A;  4P9U A;  1FSH A;  4JX4 A;  1IRX A;  2RV8 A;  4NQW B;  2HQN A;  3V7C A;  3S2H J;  3T8R A;  4IZZ A;  4XLA A;  2CYY A;  2QCO A;  3RQ4 A;  4NB5 A;  1OLT A;  3A03 A;  5KCM A;  4CUG A;  3J81 K;  3RKX A;  3CMA I;  5F64 A;  3B6A A;  1YO5 C;  3OS1 A;  3CJN A;  1HKT A;  4S0H B;  1BN5 A;  2XGD A;  3H9G A;  2VBW A;  1AOY A;  1HSJ A;  4QTR A;  3DPL C;  1DU0 A;  4D0P A;  5GAD J;  4G6Q A;  4I09 A;  3LSJ A;  4L18 B;  3IL2 A;  2JSC A;  1ZH5 A;  4YEL A;  1X2M A;  2COM A;  3FK6 A;  3S15 J;  3K4N A;  3M7G A;  1W0U A;  3QP5 A;  2LF8 A;  1HCR A;  1LUJ B;  4IPA A;  3HOW J;  2JJ7 A;  1U3E M;  3VYS B;  4RLF A;  2PN6 A;  2XGC A;  3BG3 A;  3JRA A;  2PMZ A;  2ZNY A;  4UXN A;  4ZDL A;  3JRE A;  1ZHF A;  2KMU A;  3KP2 A;  3CO7 C;  2M0C A;  5L3G A;  1XC5 A;  3A02 A;  3BPV A;  2XGX A;  5CYV A;  4FE7 A;  3DBH B;  3V8L A;  4KDP A;  1XSV A;  1FYK A;  1ZAR A;  2QWW A;  1Z0X A;  4HBL A;  2VJ5 A;  3CCE I;  5CQE A;  3MAJ A;  3P9I A;  2ZKZ A;  1MBK A;  4HAM A;  4HQE A;  2R7U A;  1A6Q A;  2KRH A;  1JJ8 C;  1TW3 A;  5E1W A;  1LDD A;  1ITY A;  1WZ2 A;  3JRB A;  1MH3 A;  2H27 A;  2X0L A;  5F6F A;  3BOQ A;  1VQN I;  2BVL A;  1D8K A;  4XNF A;  3M3Y J;  2UXX A;  3E0J B;  3TQN A;  4B8X A;  2B0L A;  5EG0 B;  2L9N A;  4CCM A;  2L01 A;  2MD0 A;  4ZTJ A;  3W2A A;  1H88 C;  3CD6 I;  3P5J A;  4ASN A;  2O61 A;  1F36 A;  5D5W B;  2FBI A;  3V7S A;  3PUF A;  1SD7 A;  2CUJ A;  4L5I A;  4MEX F;  5A2Q K;  2QKM B;  2M87 A;  1HDD C;  2R5Z B;  3GX4 X;  3OYJ A;  1MDM A;  4QLC U;  3MWM A;  1I39 A;  1R22 A;  2VXZ A;  3MZ8 A;  1OCO H;  4LIV A;  3KET A;  3WU0 A;  1ZGA A;  1EKE A;  5DM6 F;  1T08 B;  4M6X A;  3N97 A;  1IN7 A;  3IV5 A;  3DWL E;  5H20 A;  2RQQ A;  2QSG X;  3HUG B;  1FEX A;  2W7N A;  1D3Y A;  1X1P A;  2VE8 A;  2VT2 A;  1QA6 A;  1WJC A;  4A3G J;  4CH7 A;  1PDN C;  3PJR A;  4RB2 C;  3I59 A;  2ADU A;  2DPD A;  2OCC H;  5L3F A;  3IUO A;  4HEA 2;  5ERI A;  2CW8 A;  2M30 A;  3SQN A;  3E6B A;  3F21 A;  1JT6 A;  4OWR B;  5HS9 A;  2E1C A;  4CCN A;  2GQQ A;  2K9Q A;  1UZC A;  1KU2 A;  3CLQ A;  5E17 F;  4BE2 A;  2XAJ A;  1YFH A;  1U6G A;  4D9J A;  2HXI A;  4G8X A;  3DQV C;  4XRM A;  4XKB A;  3J81 Z;  3SYT A;  2H8W A;  1OYI A;  1Q1V A;  2DJN A;  3MN2 A;  5ED4 A;  2XAQ A;  2CGP A;  2VKV A;  3G71 I;  1I27 A;  1K78 A;  4LIT A;  4WX9 A;  1AU7 A;  3TOB A;  1SMY F;  4X6A J;  1MMN A;  3I9V 2;  3HB9 A;  1OJL A;  3CJR B;  4Z2Y A;  4CCL A;  1YRN A;  2GZW A;  3OYL A;  3KZY A;  1D0X A;  3X2Q H;  5ICC A;  3W6K B;  1IO2 A;  1G6N A;  1FMV A;  5HOO A;  1MZB A;  1SC7 A;  1VZ0 A;  2ME0 A;  1MMA A;  3C7J A;  3I4N J;  1QHH D;  2JQ7 A;  2CV2 A;  4A0Y A;  1R5I D;  4F52 A;  4OAY A;  2ID6 A;  4ESJ A;  2X1C A;  5M3F J;  3CTA A;  1B1B A;  1S7A A;  3KLO A;  2AO9 A;  4Q48 A;  5HNH A;  4BHB A;  3NEU A;  1S72 I;  3H9Q A;  1IJW C;  2M3A A;  3HOV J;  4ZDO A;  4PSW A;  1U5T C;  4BY7 J;  1ZQ3 P;  1LEB A;  4D7N A;  4KA4 A;  4UNO A;  1DPU A;  2GXB A;  4UV8 A;  1G2H A;  2DK8 A;  2O0Y A;  1TZL A;  5KHD A;  1WWX A;  2WA0 A;  5DUK A;  4PJL A;  2D45 A;  2RDP A;  4D7M A;  2VC1 A;  2KIQ A;  3PQK A;  5K7H A;  1CGP A;  1DGR M;  1SVL A;  2CG4 A;  2W00 A;  3K4L A;  2DN0 A;  4H4K C;  2HOS A;  2HQ5 A;  3REO A;  1EF4 A;  1IF1 A;  3GFL A;  4F3Q A;  4CDG A;  1ZYR F;  2LRD A;  2ZFW A;  3LFU A;  3OYI A;  1ORK A;  2M9H A;  1QHG A;  2IPQ X;  2L2O A;  1LNW A;  5GPC A;  2WTE A;  2MLK A;  2JRM A;  4XSZ F;  3BTJ A;  2Q8K A;  2M7A A;  4UY8 I;  4EM2 A;  2O8X A;  2O5R A;  2GWR A;  1FT9 A;  4PJ0 C;  2VPR A;  3IC7 A;  3M1C A;  5A2Q Z;  1B72 A;  5DDG A;  4KIG A;  3QYF A;  3RIR A;  3C3W A;  2K3P A;  4W97 A;  5LHG A;  4IHW A;  3UNG C;  2L9R A;  4MQV A;  1R1U A;  4BGD A;  3TDU C;  3E1S A;  2X1D A;  2QLZ A;  4B3X A;  3DU6 A;  3U1D A;  2EFW A;  3RTR A;  3HC7 A;  4JOM A;  1R23 A;  2H6B A;  3D5S C;  3N4M A;  2KP6 A;  3KEQ A;  4HDU A;  1IGN A;  4PDK A;  4WXH A;  3GYH X;  1RKT A;  2Y9Y A;  1A35 A;  3WU1 B;  1C0W A;  1SFE A;  2HFH A;  4Y4R A;  1MJA A;  2EFP A;  2OQR A;  1T56 A;  2HTS A;  1NTC A;  1I50 J;  4OIQ F;  2X1E A;  3JRD A;  3ZN1 A;  1SD4 A;  3S1Q J;  4HLY A;  5LGU A;  3BWG A;  5HDG A;  4C2U A;  4OIO F;  1Z05 A;  3BJO A;  4FX4 A;  1PYV A;  4NC8 A;  1U2W A;  1ZLJ A;  2E7X A;  2LBF A;  4A0Z A;  2F5F A;  1VFC A;  5TGT A;  3VEP A;  2CQK A;  2ZXI A;  5DM7 F;  1LJ9 A;  2FEZ A;  3HRS A;  4KNY A;  2PLY A;  1UB9 A;  3W6V A;  5JHF A;  2K9S A;  3I59 B;  2M5W A;  2XF7 A;  3H35 A;  4JX6 A;  5CVI A;  4A12 A;  1MGT A;  4G7Z F;  1JE8 A;  2W85 A;  4QPQ A;  2LMD A;  1TP4 A;  2FNP A;  3G3Z A;  3O2P E;  4DBQ A;  2MH2 A;  3KYD B;  3NQO A;  2F4O B;  2GBY A;  1UHW A;  4GRI A;  1MD0 A;  1QO0 D;  1G59 A;  2DFE A;  2KIS A;  2CRG A;  4HZF A;  3CCV I;  2MC4 A;  2R0Q C;  4A3C J;  1ZGW A;  3OS0 A;  4Y17 A;  4HF2 A;  4NNJ A;  2CQ7 A;  5ILU A;  2DW4 A;  5CVJ A;  3S16 J;  6PAX A;  2E1O A;  4V2G A;  4I99 C;  1TC3 C;  1FWZ A;  1TWC J;  2WB1 N;  5FFZ A;  1GUU A;  3FKI J;  2FOW A;  1I3Q J;  2XIG A;  1GVJ A;  3WGG A;  4LLG F;  2VB6 A;  4PK4 A;  4BE1 A;  2LR8 A;  2XRO A;  2RGV A;  2AXT C;  3QOE A;  5M5W J;  3FDY A;  2CMP A;  3H5A A;  2NXN B;  3LOC A;  1YRN B;  3GME A;  4OMY A;  1HOM A;  1YJ9 I;  2DOF A;  1A5J A;  2Y2Z A;  4HV6 A;  1H89 C;  1BC7 C;  1XD7 A;  2LTP A;  1GVD A;  4BXF A;  1K79 A;  3CLO A;  1SAX A;  1ZRC A;  3TW6 A;  5LFA A;  4PFO A;  1QPM A;  4MEY F;  2BHY A;  1D1A A;  4K2E A;  3L9F A;  3OIO A;  3KEO A;  2L4M A;  5JHU A;  3L7W A;  1O3R A;  1ZK8 A;  3DKY A;  4ZYD A;  3DU5 A;  3Q3S A;  2A05 A;  5C4J J;  2KZG A;  2XKO A;  2M1B A;  5ILS A;  1LE8 A;  2IT0 A;  2Z5U A;  3WTU C;  1AKH A;  2GA2 A;  4B43 A;  2NNY A;  3ECO A;  5IP7 J;  2LF7 A;  1XDU A;  1T8I A;  3ZMV A;  1XS9 A;  1BOB A;  3K2Z A;  4D5F A;  2NYX A;  2E35 A;  4AVZ A;  2FF4 A;  2XRN A;  4IX7 A;  2Z3Y A;  2V26 A;  4DZJ A;  1E3H A;  1AA7 A;  4RGS A;  2KDO A;  3CUO A;  4ENN A;  3DPT A;  1WFX A;  2HU9 A;  4EAT A;  3J80 K;  2HYG D;  5HDN A;  2DPU A;  2LRE A;  3A0B C;  1YQA A;  2QUF A;  3H3U A;  3RYP A;  4S04 A;  3DKX A;  4JP0 A;  4E7J A;  2WAD A;  3D1N I;  2DTR A;  1ONV A;  1ZTR A;  1I1G A; 
#chains in the Genus database with same CATH homology
 2MLG A;  1R58 A;  2QEN A;  3M8F A;  2PEX A;  2EK5 A;  4LG0 A;  3F6O A;  5JI6 A;  2CO5 A;  1LVA A;  2FA5 A;  4KMF A;  4I01 A;  2VOD A;  4NQW A;  3EET A;  4ENJ A;  1FBS A;  4CIC A;  1E17 A;  2AS5 F;  1ON1 A;  1HW2 A;  1TQM A;  4WWC A;  2V79 A;  2MA3 A;  2PQ8 A;  2BGC A;  3EUH A;  5D5U B;  5LBQ A;  1UFM A;  4L9V A;  1TQP A;  1QZZ A;  4ESB A;  1HBX G;  4LK0 F;  4KIB A;  5J6X A;  4GO1 A;  4ZZL A;  1FYL A;  4MNU A;  5HDK A;  1JHF A;  4U7B A;  3TDZ C;  4EJO A;  2A5Y B;  4G7H F;  5CJ9 A;  3FM5 A;  2J5P A;  2PJP A;  3BY6 A;  4M72 A;  4A5N A;  3ROU A;  4ENM A;  4HYE A;  4O5V A;  5HS7 A;  4KUM A;  2A69 F;  5CLS A;  4AIK A;  4I7H A;  1J75 A;  1JXS A;  1FBQ A;  1RIO H;  4IHS A;  1MKM A;  2IA1 A;  1BI1 A;  4DQ2 A;  3E5U A;  3WGH A;  3WGI A;  1E2X A;  1SFU A;  3WTX C;  2XAH A;  3LA7 A;  2HYF A;  3JW4 A;  5E1Z B;  4LGW A;  2STT A;  2QQA A;  1O3S A;  1R5H A;  3TO6 A;  2EJR A;  4M9Z A;  1KYW A;  3JTG A;  1EV7 A;  1HKS A;  5CVR A;  5EEG A;  4M73 A;  3HUG A;  4MQ9 F;  2W84 A;  5D5X B;  5ILV A;  3GFJ A;  1F9N A;  4ETS A;  2ESN A;  4EGZ A;  5E1X A;  1I5Z A;  5LRR A;  1Z6R A;  5LLQ A;  2G7U A;  1REP C;  2Z33 A;  4L9J A;  3P7N A;  1QQI A;  2A68 F;  2VC0 A;  3GVA A;  1ZRD A;  4ZZD A;  1HW1 A;  3K1P A;  2HWV A;  3GXO A;  3ZMT A;  1BI0 A;  3I0T A;  3ULQ B;  3TO7 A;  1W5S A;  2PMH A;  1YW9 A;  3FM3 A;  3U2R A;  4M6Y A;  1W4M A;  2DI3 A;  4CXF A;  3SFZ A;  1HKQ A;  1SFX A;  4HX7 A;  4U88 A;  1G3S A;  2PBI A;  5LGT A;  4AIH A;  3IHU A;  2VT3 A;  3EYI A;  5L3C A;  4E70 A;  4MHG A;  1Z9C A;  4S05 A;  2O3F A;  2Q0O A;  4RB3 C;  1QBJ A;  2P5L C;  4L0Y B;  1TLH B;  2F5C A;  3ZP5 A;  3WE3 A;  1B59 A;  2XAG A;  3VFZ A;  5EEH A;  1LQ1 A;  4R8H A;  3E5Q A;  3IWZ A;  4G94 A;  4HF1 A;  4WXC A;  1XB4 A;  4Q47 A;  3GO5 A;  4OOI A;  3E6C C;  2VBY A;  4IJA A;  5K5O A;  1XMK A;  2K4J A;  3MFK A;  2GXG A;  2VON A;  3HIF A;  4KIC A;  5DEQ A;  1IAW A;  3HRM A;  3ZN0 A;  2EWN A;  2P7V B;  2DBB A;  2QM3 A;  1J2X A;  1MJ9 A;  1AWC A;  1B6A A;  1A04 A;  2BYV E;  1S3J A;  5E8I A;  1T2K A;  1XGO A;  1V3F A;  2BV6 A;  1UST A;  1OPC A;  1TBX A;  3MCZ A;  2QVO A;  2P7C B;  1FYM A;  1LEA A;  1IN5 A;  2HDC A;  2HS5 A;  5JR3 A;  5BS6 A;  3ABU A;  4IF4 A;  1TNS A;  1SD5 A;  2JT1 A;  2HZT A;  1T98 A;  2A61 A;  2DLL A;  3D0S A;  2ZME A;  2DO7 A;  1J0R A;  2VBX A;  4Q4Z F;  2ZCW A;  1I6X A;  3B73 A;  1ZRF A;  1O7L A;  5JFR A;  2HQR A;  4ZH4 F;  4FX0 A;  3W6J B;  5DD4 A;  3HHH A;  3QRF F;  5LHH A;  2P6S A;  3TKY A;  1T38 A;  4P96 A;  1MJB A;  3L00 A;  3T5X A;  2OU2 A;  2ISZ A;  4YFK F;  2EFQ A;  4CHU A;  3P9C A;  4HX4 A;  4XRF A;  3WE2 A;  3QU3 A;  3QPH A;  2FBH A;  3D5L A;  4A5M A;  1V4R A;  1CF7 A;  1FP1 D;  2UZK A;  5DCF A;  2XKP A;  1FX7 A;  4U0W A;  3VOD A;  4HDV A;  5H6R A;  3CUQ B;  2CWE A;  4XLP F;  4OIN F;  3M8E A;  1B4A A;  3FHZ A;  2V1X A;  2D1V A;  3HTU A;  2NNN A;  3FZV A;  2ZO4 A;  4IHT A;  3HYI A;  1P4A A;  2D2W A;  3IKT A;  5DD8 A;  1VTN C;  2Z9O A;  3TO9 A;  3HRT A;  2K7L A;  1P92 A;  3M1E A;  4F7Z A;  3WTV C;  3F8B A;  3S2W A;  4A6D A;  1Q1H A;  3GUD A;  3R0J A;  2XVC A;  3O3K A;  4EM0 B;  2EB7 A;  3R0A A;  5BPD A;  2UXN A;  5FGM A;  2W57 A;  3IRQ A;  2LNB A;  3KP3 A;  2GA1 A;  3HRU A;  1GXQ A;  4EJV A;  1HW5 A;  1BIA A;  3KP4 A;  4M9S A;  1PUE E;  3HOT A;  1IW7 F;  1X3U A;  3LAP A;  1KA8 A;  3GF2 A;  4UHT A;  3HOS A;  2XUB A;  2DAO A;  1TW2 A;  2RC4 A;  2TDX A;  2QQ9 A;  5FO5 A;  2M45 A;  2LSO A;  4LD5 A;  3I71 A;  4RB1 A;  2G9W A;  3ERE D;  5F1R A;  1G4D A;  4DNC A;  2L3D A;  2ZME B;  2YU3 A;  2KIM A;  3EYY A;  1TTY A;  1RNL A;  2P5V A;  5D8K B;  5TJJ A;  4UV9 A;  1S7O A;  3V8K A;  3LST A;  4KYW A;  4G9Y A;  5DCM B;  2XAF A;  4AVP A;  3LQQ A;  2AXL A;  4HQM A;  2H94 A;  4I98 B;  2RQP A;  1P4X A;  4JQF A;  3RJP A;  4R1H A;  5FLX Z;  3BDD A;  4M71 A;  1K7A A;  2K86 A;  4RAY A;  1KU9 A;  4CYD A;  3ZMZ A;  2LDU A;  2PG4 A;  2Y48 A;  1YW8 A;  3T1B A;  1CF7 B;  4UVC A;  2IVM A;  2EA2 A;  3R61 A;  1R5G A;  1W7P B;  3R6S A;  1ZG5 A;  2Y75 A;  1KU7 A;  3GZ5 A;  4KFC A;  4AD9 A;  3B02 A;  3ISP A;  2VE9 A;  1ON2 A;  3C18 A;  2HOE A;  3ZMD A;  3L2C A;  3MZH A;  1KQ9 A;  5E18 F;  1D8J A;  3SXY A;  1FNN A;  2K27 A;  1DPR A;  1OKR A;  2CSO A;  3EQL F;  3DKW A;  1GXP A;  3ML6 A;  2FOK A;  2X4H A;  1R1V A;  1B9N A;  3H3Z A;  1BI2 A;  2JPB A;  5LEK A;  2NAZ A;  2KRF A;  3DF8 A;  3HSE A;  4GXO A;  4U0Y A;  3LA2 A;  3F8F A;  2FXA A;  4IRH A;  1LB2 A;  1RZ4 A;  2GAU A;  1UCR A;  1BM9 A;  3MEX A;  1FSE A;  1XSX A;  2OA4 A;  3F22 A;  4YG2 F;  2JTV A;  2ESH A;  2YR2 A;  5K5Q A;  2ISY A;  5LGN A;  1IUY A;  3DEU A;  3KE2 A;  2IRF G;  2UWM A;  3F8N A;  3U9G A;  3SHF A;  4YIF A;  4ZYH A;  3KLN A;  5FB2 A;  3FX3 A;  4H0E A;  5DUI A;  3KFW X;  4O6J A;  3Q9S A;  4N9I A;  3E97 A;  2NRA C;  4I2O A;  4EJT A;  3DV8 A;  4IXA A;  1SMT A;  2E1N A;  4U7D A;  2L4A A;  2FSW A;  2LKP A;  3K69 A;  1J59 A;  2XV4 S;  3VOE A;  4BH9 A;  4BQA A;  4LMY A;  5CVV A;  4HOB A;  1YYV A;  4JK1 X;  5CVU A;  1Z6T A;  3RYR A;  1KQ8 A;  3FWE A;  2BBY A;  4IRG A;  1FLI A;  4XLN F;  2CW0 F;  1XMA A;  1WKM A;  5HVQ C;  2EV6 A;  5L3B A;  3BP8 A;  3E6M A;  2FE3 A;  4RGU A;  3BJ6 A;  2EA4 A;  1H0M A;  3V7R A;  3FXQ A;  1OMI A;  2RKH A;  2F2E A;  2PFB A;  1S6L A;  4KT5 C;  4LLN A;  4QWQ A;  3H92 A;  1OYY A;  1GHC A;  3L09 A;  4ON0 A;  3DXJ F;  2DT5 A;  1IZ1 A;  4CZZ A;  2ZJ2 A;  4N9H A;  1LDK B;  2YX4 A;  3AAF A;  1YG2 A;  5D6E A;  4L9N A;  4M9X A;  3V8J A;  4WF2 A;  3RKW A;  2MH9 A;  1O57 A;  1O3Q A;  2Q2E A;  4MTE A;  4OMZ A;  2HKX A;  1IN8 A;  5BOX A;  3RPU A;  2QBY B;  5IT3 A;  2EFO A;  2BE5 F;  2O6G E;  3I5U A;  4A6E A;  3K9T A;  2FU4 A;  1YLF A;  1BBY A;  2RVC A;  3VB2 A;  2FNA A;  2F5D A;  3OV8 A;  2KJC A;  1DUX C;  4RB0 A;  3CUQ A;  4R79 A;  4CGZ A;  4GYG A;  4JBA A;  4FHT A;  1IN6 A;  4MGR A;  1J7K A;  4NHJ A;  4PGG A;  1YIO A;  1ZN2 A;  5BMZ A;  2D1H A;  4N0B A;  1TNT A;  1JGS A;  5H6Q A;  5FFX A;  2YSR A;  4AIJ A;  2OD5 A;  4HF0 A;  3J7A O;  1T6S A;  3CDH A;  3HHG A;  1STZ A;  5D5V B;  2ACJ A;  3HSF A;  4EMS A;  2Y0M A;  3GFI A;  2IJL A;  1OYW A;  1ZGJ A;  2A3S A;  3WTT C;  1RI7 A;  2IA2 A;  2A6H F;  3K0L A;  2XAS A;  4G7O F;  2A07 F;  2OZU A;  2ZXJ A;  4HLX A;  1OR7 A;  4ZYE A;  1XCV A;  3BPX A;  2FQ3 A;  2MD5 A;  1L3L A;  2K02 A;  1KU3 A;  1J9I A;  4Y13 A;  2YPR A;  3K1M A;  5AIP A;  2WC2 A;  3PFI A;  3JAM Z;  4HW0 A;  3KP5 A;  2HR3 A;  4EGY A;  1EH6 A;  3F8C A;  4AWX B;  1EH7 A;  4GCV A;  1FPQ A;  3F8M A;  3FMS A;  3FXR A;  2RNJ A;  1WI9 A;  4A2U A;  2GIV A;  4IVN A;  2ZNZ A;  5DCM A;  3I4P A;  5KVR A;  1IXS B;  2KJB A;  3MQ0 A;  1F5T A;  3SZP A;  3Q5F A;  4I02 A;  3V4G A;  3F6V A;  5J8F A;  2DFI A;  4BHP A;  1U8R A;  4IRI A;  2DQL A;  3GW2 A;  5JVT A;  3OOP A;  1BIB A;  2V1U A;  4RGR A;  1FBU A;  1LDJ A;  2ELH A;  2FBK A;  1IRG A;  2P6T A;  2JPC A;  4EJW A;  4O3M A;  1U5T B;  3F23 A;  2ZBK A;  2QQB A;  1Z1D A;  3FMQ A;  1W7P A;  2IA0 A;  5FLX K;  1IXR C;  3R60 A;  5LRS A;  4RGX A;  3JSP A;  2OQG A;  2HGC A;  3F3X A;  1XGS A;  2WV0 A;  5IT9 K;  1R7J A;  2KIU A;  3COA C;  4ESF A;  3I58 A;  1JHH A;  4RAZ A;  5ICF A;  3WTZ A;  5ICE A;  4KN7 X;  4LK1 F;  5E20 A;  3CUQ C;  2R3S A;  1YTY A;  1IXC A;  2DK5 A;  1DP7 P;  3GWZ A;  2QYO A;  5TRD A;  4KIF A;  4LB6 B;  1WQ2 A;  4B09 A;  3ZMS A;  4TV7 A;  1RUO A;  1QNT A;  4WCG A;  3LAJ A;  5HS8 A;  4Y15 A;  2JZY A;  3BJA A;  4I0B A;  5DV5 A;  3WOD F;  1Z7U A;  3T0Y A;  4L5J A;  4ZYG A;  1SD6 A;  5D4R A;  3LQR A;  5D6F A;  2KIF A;  1XDS A;  2PI0 A;  5HLI A;  5DYM A;  2OBP A;  3F72 A;  4I0A A;  1F1Z A;  2CFX A;  4U0V A;  1MDM B;  4M74 A;  3DP7 A;  3QU6 A;  2IW5 A;  2R7D A;  3KCC A;  4KMU X;  1R00 A;  2DU9 A;  1U78 A;  1S8N A;  4PGH A;  1TQI A;  1P2F A;  3WG9 A;  3IKV A;  4UVA A;  3RPQ A;  3R4K A;  5D4S A;  2K4B A;  1ZG1 A;  1J5Y A;  2H6C A;  5K1Y A;  4WXD A;  4LLL A;  3T8T A;  5L3E A;  2BEO A;  1S29 A;  3WTW C;  3GZ6 A;  2FML A;  1FY7 A;  1G3Y A;  1R36 A;  1XGM A;  1WSU A;  4UUV A;  3I53 A;  4KN4 X;  1FC3 A;  1ZLK A;  2DQR A;  3DFG A;  4HX8 A;  3TOA A;  4BHC A;  4Q5S F;  2WWY A;  2HKO A;  4CO8 A;  2FMY A;  1K78 B;  3SZT A;  1QGP A;  3QOP A;  5IT9 Z;  4OU0 A;  1KYZ A;  2NS0 A;  1XGN A;  1Z91 A;  1ZRE A;  3HTS B;  4P5O A;  5LEJ A;  3FMR A;  1D5V A;  3MZY A;  5HLG A;  4YFX F;  2V9V A;  4EM1 A;  4LJZ F;  4RS8 A;  3NRV A;  3HSR A;  5AIQ A;  3KP6 A;  3I64 A;  1T0F A;  3JSO A;  1XSD A;  4MTD A;  4P55 A;  2L02 A;  1ODD A;  2P8T A;  3M9A A;  1L0O C;  1ULY A;  3QPT A;  3TGN A;  3JTH A;  5D8L B;  1Y0U A;  1O3T A;  5KK1 A;  5FD5 A;  2V6C A;  3WTS C;  4BYY A;  1UHM A;  2VOP A;  1PP8 F;  3ZMU A;  3GFM A;  4XSX F;  1PP7 U;  2QZ8 A;  2QBY A;  2VN2 A;  1T39 A;  5BPI A;  2L54 A;  1WRJ A;  2IP2 A;  4PCQ A;  3ZPL A;  2Z99 A;  1HXD A;  4BXU A;  3FF5 A;  2HEO A;  3K1N A;  4FT8 A;  2STW A;  1F4K A;  3ABT A;  3WTY C;  2V1D A;  2OAZ A;  4A0X A;  1YS6 A;  3P9K A;  1W5T A;  3BRO A;  1ZAO A;  2FRH A;  4LFU A;  2EV5 A;  1NHA A;  2YX7 A;  2G7H A;  4OIP F;  1RUN A;  1IRF A;  2JRT A;  2ETH A;  3FXU A;  2EV0 A;  3E3V A;  4L0Z B;  2PMU A;  3LA3 A;  1KQ0 A;  1QZY A;  1P4W A;  3BZ6 A;  2VBZ A;  2HTJ A;  2RN7 A;  3IRR A;  5K5R A;  2A6E F;  4ENK A;  5J8C A;  1HST A;  3I54 A;  3RDI A;  2H09 A;  4BNC A;  1BI3 A;  1FZP B;  1KGS A;  2M8E A;  1BJA A;  4EQQ A;  4XBF A;  2OZ6 A;  1I1S A;  3E5X A;  1USS A;  2W24 A;  4GYI A;  1BOA A;  4UVB A;  3PQJ A;  5BQT A;  4EV0 A;  4HV5 A;  3C1D A;  3E6D A;  1DDN A;  3EDP A;  1G3T A;  3KP7 A;  1ZG3 A;  2KKO A;  1BC8 C;  5FD6 A;  2J5O A;  1B9M A;  1YW7 A;  5AON A;  3KZZ A;  4WK8 F;  1P6R A;  5ICG A;  1EH8 A;  4P9F A;  5HLH A;  3QAH A;  2O03 A;  3J80 Z;  1XN7 A;  2MBF A;  4GGG A;  4L9T A;  4EJU A;  3ELK A;  4LB5 A;  4PZJ A;  4HA8 A;  2P4W A;  2EFN A;  2C6Y A;  1FP2 A;  1W7P D;  3JAM K;  1R1T A;  3Q9V A;  2W25 A;  3CO6 C;  3O6B B;  4YII A;  3GLX A;  2R7F A;  3RKY A;  1K6O A;  1FOK A;  3LFK A;  2MC3 A;  1H9T A;  2F5E A;  2P5K A;  4YFN F;  2VOO A;  4BAY A;  3GEZ A;  3QP6 A;  1G3W A;  5E8G A;  3ECH A;  3ZQ7 A;  1O7F A;  3LWF A;  3G73 A;  1H9G A;  3IWF A;  3RI4 A;  5L3D A;  4OIR F;  4LG0 B;  1XCB A;  5LHI A;  2XHK A;  1U5T A;  1IN4 A;  1YS7 A;  1HQC A;  4EVI A;  4G6D A;  2E7W A;  4P9U A;  1FSH A;  2RV8 A;  2HQN A;  3V7C A;  3T8R A;  2CYY A;  4NB5 A;  3J81 K;  3RKX A;  5F64 A;  1YO5 C;  3CJN A;  1HKT A;  1BN5 A;  1AOY A;  2VBW A;  1HSJ A;  3DPL C;  4D0P A;  4G6Q A;  4I09 A;  4L18 B;  3IL2 A;  2JSC A;  1ZH5 A;  2COM A;  3M7G A;  3QP5 A;  2LF8 A;  4IPA A;  1U3E M;  2PN6 A;  2ZNY A;  4UXN A;  1ZHF A;  3KP2 A;  3CO7 C;  5L3G A;  3BPV A;  2XGX A;  5CYV A;  3V8L A;  4KDP A;  1XSV A;  1FYK A;  1ZAR A;  2QWW A;  4HBL A;  3MAJ A;  3P9I A;  2ZKZ A;  4HAM A;  4HQE A;  1TW3 A;  5E1W A;  1LDD A;  2H27 A;  2X0L A;  5F6F A;  3BOQ A;  1D8K A;  2UXX A;  3TQN A;  4B8X A;  2B0L A;  2L01 A;  4ASN A;  2O61 A;  5D5W B;  2FBI A;  3V7S A;  1SD7 A;  4L5I A;  4MEX F;  5A2Q K;  2M87 A;  3GX4 X;  1MDM A;  4QLC U;  3MWM A;  1R22 A;  2VXZ A;  3KET A;  3WU0 A;  1ZGA A;  4M6X A;  3N97 A;  1IN7 A;  5H20 A;  1D3Y A;  2VE8 A;  2VT2 A;  1PDN C;  4RB2 C;  3I59 A;  2ADU A;  2DPD A;  5L3F A;  5ERI A;  2M30 A;  3SQN A;  3E6B A;  3F21 A;  5HS9 A;  2E1C A;  2GQQ A;  1KU2 A;  5E17 F;  2XAJ A;  1YFH A;  1U6G A;  4G8X A;  3DQV C;  3J81 Z;  1OYI A;  5ED4 A;  2XAQ A;  2CGP A;  1I27 A;  1K78 A;  4WX9 A;  3TOB A;  1SMY F;  4Z2Y A;  2GZW A;  3KZY A;  5ICC A;  3W6K B;  1G6N A;  5HOO A;  1MZB A;  3C7J A;  4A0Y A;  4ESJ A;  3CTA A;  1B1B A;  1S7A A;  3KLO A;  4Q48 A;  4BHB A;  3NEU A;  1U5T C;  1LEB A;  4KA4 A;  4UNO A;  1DPU A;  2GXB A;  4UV8 A;  2DK8 A;  2O0Y A;  1WWX A;  5DUK A;  2D45 A;  2RDP A;  2VC1 A;  3PQK A;  1CGP A;  2CG4 A;  3REO A;  1IF1 A;  3GFL A;  4CDG A;  1ZYR F;  2ZFW A;  2IPQ X;  1LNW A;  2WTE A;  2MLK A;  4XSZ F;  2Q8K A;  4EM2 A;  2O8X A;  2GWR A;  1FT9 A;  3IC7 A;  5A2Q Z;  5DDG A;  4KIG A;  3RIR A;  3C3W A;  5LHG A;  4MQV A;  1R1U A;  3TDU C;  2QLZ A;  3U1D A;  2EFW A;  3RTR A;  1R23 A;  2H6B A;  3N4M A;  3KEQ A;  4HDU A;  4PDK A;  4WXH A;  3GYH X;  3WU1 B;  1C0W A;  1SFE A;  2HFH A;  1MJA A;  2EFP A;  2OQR A;  2HTS A;  4OIQ F;  3ZN1 A;  1SD4 A;  4HLY A;  5LGU A;  3BWG A;  5HDG A;  4OIO F;  1Z05 A;  3BJO A;  4FX4 A;  1U2W A;  1ZLJ A;  2E7X A;  4A0Z A;  2F5F A;  3VEP A;  2CQK A;  1LJ9 A;  2FEZ A;  3HRS A;  4KNY A;  2PLY A;  1UB9 A;  3I59 B;  2M5W A;  4G7Z F;  5CVI A;  4A12 A;  1JE8 A;  1MGT A;  2W85 A;  2FNP A;  3G3Z A;  3O2P E;  2MH2 A;  3NQO A;  1UHW A;  1MD0 A;  1QO0 D;  4HZF A;  4Y17 A;  4HF2 A;  5ILU A;  2DW4 A;  5CVJ A;  6PAX A;  1FWZ A;  5FFZ A;  2XIG A;  1GVJ A;  3WGG A;  4LLG F;  2XRO A;  2RGV A;  4OMY A;  4HV6 A;  1BC7 C;  1XD7 A;  1K79 A;  3CLO A;  1SAX A;  1ZRC A;  1QPM A;  4MEY F;  4K2E A;  3L9F A;  3KEO A;  2L4M A;  5JHU A;  3L7W A;  1O3R A;  4ZYD A;  2XKO A;  2M1B A;  5ILS A;  2IT0 A;  2Z5U A;  3WTU C;  2GA2 A;  2NNY A;  3ECO A;  2LF7 A;  1XDU A;  3ZMV A;  3K2Z A;  2NYX A;  2FF4 A;  2XRN A;  2Z3Y A;  4RGS A;  3CUO A;  4ENN A;  3DPT A;  3J80 K;  2HYG D;  5HDN A;  2DPU A;  1YQA A;  2QUF A;  3H3U A;  3RYP A;  4S04 A;  2DTR A;  1ONV A;  1I1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...