3ZGKA

Nmr solution structure of the rxlr effector avr3a11 from phytophthora capsici
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
GPGLTDLFKTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVR3A11
publication title NMR Solution Structure of the Avr3A11 from Phytophthora Capsi
rcsb
source organism Phytophthora capsici
molecule tags Protein binding
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zgkA00
3ZGKA 3ZR8X 2LC2A
chains in the Genus database with same CATH superfamily
3V7SA 3KLNA 5LHGA 2KIFA 2YS9A 2X1EA 2ZJ2A 5KK1A 1MSEC 3CCYA 1HBXG 3M9AA 3RIRA 4M73A 2DK5A 3IL2A 1DUXC 1GHCA 5HS8A 1B72B 3C2HA 5LGTA 2R93J 2MW8A 3OR2C 3CC4I 1G2HA 5ICGA 5CVJA 1K4TA 4NB5A 2IGNA 4EATA 2STTA 2KHMA 3AG2H 3H3VK 1B6AA 2R7FA 5TISC 3KIOA 3HOTA 2GXBA 3FK7A 3WTYC 2ACJA 3HUGA 3CLOA 4BXUA 4OIPF 2XAJA 3EUAA 2CW7A 1E3HA 3JRCA 3MWMA 4IQ4A 2EFPA 3ISPA 5BQTA 3J7ZI 1RKTA 1Z3YA 3SZPA 1EH8A 1RI7A 2DQRA 1MH4A 4U7BA 3KP7A 2DTRA 3W2VA 5ILVA 4KIGA 2R7UA 2WC2A 4C30A 3OSFA 5KAFC 3IWZA 3I54A 2VIXA 3WU0A 3WGIA 4U87A 3A4CA 3MKWB 1KQ9A 4M3DA 4RLQA 1LPQA 5J6XA 2HQ5A 1CF7A 2K9LA 4BHCA 5M5XJ 4BNCA 2RC4A 1P4AA 2KZGA 1AHDP 2A5WA 3RPUA 4M6XA 3A02A 3SFIA 1JKQC 2P5LC 1R58A 3FDYA 4XOPA 1W0TA 2P7CB 1I1GA 2BW3A 2QKMB 3N4MA 3GUDA 1FBQA 2NYXA 4XONA 5IT9K 4LB6B 4XLAA 1JTXA 1R22A 1P6RA 1X3WB 3F0CA 3CC2I 2BYVE 1XMAA 1N77A 2R92J 2B9SA 4DW6A 3AKZA 4MTEA 3HSRA 3EUHC 3HSEA 3Q5FA 2MC3A 4PGGA 1ENHA 3ASOH 3S2HJ 3CJNA 2XSJC 2DA3A 2COMA 3L2VA 5LFAA 4QPOA 4E7IA 2LKXA 3BWGA 3A03A 4ASNA 2VJJA 3L2QA 2OZ6A 1FMWA 1RKWA 1QHGA 1QNTA 2M3AA 1V55H 3M8JA 1MNMC 1HSTA 3ZOBA 5HODA 2HYJA 1Y8RB 1JUPA 3OOUA 2VI6A 4E7KA 2LY2A 4XKCA 3EQLF 2VXDA 4KMUX 4X0GA 4C3HJ 4A6DA 2O03A 1YX5A 2M2EA 3L2RA 4A3KJ 1C0WA 3GTPJ 3LSKA 4HYEA 4CSWA 2W82A 3FXMA 4UNOA 2V6CA 2QSGX 5E3LA 5LHHA 3RCOA 1TZLA 4G8XA 1X1BA 2CV0A 3M7GA 3RSNA 2QWWA 3OS2A 4N0BA 3WE3A 3IH2A 3TQNA 5CVUA 2KDZA 1K78A 4Y52J 3TP3A 4XMYA 1BL0A 2A3SA 3DPTA 1MJBA 4BBRJ 2R7ZJ 2HWVA 2CQQA 4ESFA 2HR3A 2V9VA 4HOBA 4O6JA 1IGNA 1K6YA 4MIMA 3KP2A 1E3PA 3K4BA 4OINF 3G71I 1R5HA 5DS9A 4M9XA 3PSIA 3LFKA 2J5PA 3IAM2 2V6EA 1YJNI 3K4JA 5GAHJ 3KETA 3J7AO 3T0YA 3V8LA 2BY0A 3JRIA 2Z9OA 4WX9A 4OMYA 3S15J 1T0FA 5FGMA 5J1YA 4XM3A 4XK4A 5KCMA 3B6CA 5BPDA 5FJ8J 1W1WE 1YRNB 5JLXA 1LEBA 3U2RA 3GTOJ 2W1OA 1RPWA 4LIVA 3FBIB 4JQFA 4FETA 2O7OA 2W25A 4IL6C 4MNUA 3BZ6A 2HZDA 3FXJA 1IXRC 4E4HA 3JW4A 2ZKZA 4NC8A 5HDGA 4QWQA 1KU2A 4PSWA 3K2ZA 3K69A 2LREA 3O2PE 5DCFA 5L3EA 1LJ9A 5EZHA 1U2WA 1SAXA 2DA7A 2LDUA 1GXQA 2QBYA 2IGMA 2VASA 4M6VA 2HKXA 3O3KA 5BNGA 4UVAA 2JJ7A 3CTAA 5HLIA 1RC9A 3JTHA 1YFHA 1ITYA 1MMDA 2QGUA 5DCMA 1W36C 2ICWG 2PEXA 2G7HA 1FLIA 3F6OA 2VL8A 3K2AA 4U88A 3ZQHA 2DFHA 4S04A 1WI3A 2VKVA 3KPHA 4DBRA 4LOCA 3S1NJ 4EGYA 1LNWA 2HEOA 3BR3A 1GVJA 2EA2A 3TOBA 1SFUA 3WU2C 2FX0A 2OAZA 1QVTA 5GTIC 4MFEA 3GMEA 1SFKA 1WJBA 4JX5A 3ZQGA 4WK8F 2EB7A 1AU7A 4JK1X 4BY7J 2CWEA 3ZMTA 1SD5A 4RAYA 1P92A 2BEOA 1MNDA 5JFRA 2DPUA 3RZOJ 2B0LA 4NNJA 4YELA 1WJ5A 4XNFA 5DM7F 2RQQA 2ZXIA 3BG6A 5E1WA 4GDFA 2QKLB 2DLLA 2GQQA 2K40A 5JHUA 5DD4A 1TL8A 2KQRA 4CYCA 3FMSA 1V5GA 4AIHA 1V5FA 2A6HF 1TWCJ 1FTZA 1ON2A 4W1UA 4RB3C 5K7FA 3E0JB 4XSXF 3ML6A 2CUJA 2W7NA 4EV0A 3BJOA 2MABA 2RV8A 3I59B 1Y0UA 4IHXA 4EM1A 4XLEA 1S6LA 2CUEA 1KU9A 2E34A 3CUQB 2EK5A 5D5UB 1NK2P 5GPAA 4FHTA 2KRFA 2E1MB 3WG7H 4A2UA 2RQPA 3LQRA 2DJNA 3H5NA 1B4AA 3I0TA 2ESHA 4A3GJ 2P6SA 1ZREA 1ZN2A 1JHHA 1X3ZB 1MJAA 2F2EA 2V7FA 1TQMA 2DT6A 3V7RA 1I3QJ 1BOBA 3ECOA 1I3AA 2PG4A 1JGSA 4L9TA 1NH3A 1FOYA 4RGSA 2KP6A 3KYCB 2X85A 1F43A 3H3UA 3C1DA 1O7FA 4DIQA 1YJWI 4OU0A 1LFBA 2QM3A 1W5TA 4PZJA 4BHBA 2KRCA 1DPUA 2EFWA 1ZAOA 3QPTA 2XHKA 4DZPA 2HVQA 1R7JA 1YE9A 3TOAA 2KDOA 1RNLA 3W2WA 1BR1A 2QUFA 1HW1A 3DBRB 2O9LA 4CCNA 3E5QA 4BGDA 4UB6C 5LBQA 1B9NA 3ABTA 5IP7J 2ZCWA 4A0ZA 2CFOA 4DBQA 2TCTA 2FOKA 3MZYA 1S29A 2LF7A 3R4KA 5TRDA 5L3BA 3EETA 1OCZH 4U7DA 2A69F 5B1AH 2NVQJ 1J0RA 2CSOA 5A2QK 3V42A 4HV5A 3F9KA 4CDGA 3G4SI 3FXLA 2DI3A 4HDVA 1T08B 3FIWA 4PFPA 1G3SA 2DBBA 4RS8A 1W0UA 2GAUA 2ZSIB 3WTWC 2JWTA 4TV7A 3A01B 2DFFA 3EUHA 4W97A 3NARA 3R61A 5F0HA 2EV0A 1L0OC 4C3JJ 2VKDA 3WTVC 4HLXA 2H94A 5D8KB 3OYAA 3HOYJ 3CQZJ 2EPFA 2WV0A 3DXJF 3TO9A 1O3SA 3VEPA 3DLAA 2E35A 4S05A 4M6YA 2K9QA 3CO7C 2XAGA 5CKTA 3EDPA 4DYCA 3DLLF 1A04A 4RM3A 4G7OF 5DEQA 2X6XA 4PJMA 2O0YA 2KIUA 4F3QA 3AG4H 4A6EA 1T39A 2XC7A 2ELHA 5LEKA 1OMIA 2LC2A 2XROA 1I27A 2DAOA 3MCZA 1T8IA 3ZQIA 2DXIA 1ZG1A 1H8AC 3B6AA 2VQLA 2ZMEB 1WKMA 4FX4A 3KE2A 3NRVA 1LB2A 3J7AY 1PUEE 1K7AA 4XBFA 5IT9Z 3SEQA 3WE2A 3BROA 4O5VA 3GZ6A 2OTJI 4AVZA 3LAJA 5F08A 1OCTC 3OYIA 4HX7A 1H0MA 1ETVA 2VBXA 2WY7Q 4IRGA 4BQOA 1SVOA 5L3FA 2HVSA 2PN6A 4DZJA 2Y0MA 1MD0A 4D7MA 1JKRC 3LSRA 2JUCA 3SZGA 2HPMA 1F5TA 4P1WA 4Q47A 3TP0A 3F21A 4UUSB 4ENNA 2OBPA 1MSFC 3H92A 3H9JA 1IUYA 3TO6A 2GZWA 2ZNYA 1O3TA 2QQ8A 3I4MJ 2IS4A 1YS7A 3NEUA 1T38A 5EEHA 1YJ9I 2GA1A 1SFXA 4BUPA 3CCRI 1ZH5A 2CU7A 1IXSB 4XICA 4FE4A 1EF4A 3X2QH 2O6GE 3PUFA 1FOWA 1IO2A 5M5WJ 1KQ0A 1UFMA 4B3AA 1MBHA 2H1KA 3P7NA 2EIMH 2R7OA 5H6QA 3QPLA 5K7ZA 1X1PA 3TKYA 4B8XA 4B3XA 3QRFF 3TDUC 1BJZA 4L9JA 1BI1A 4M71A 4MFDA 4MTDA 4U0WA 2HOTA 2NVUB 5IYCJ 1F1ZA 2OQRA 1OLTA 2FQ3A 4Y15A 1K4SA 5FRMA 3VOEA 1RRJA 2ZJQF 3ZQCA 4IQJA 1G6NA 3K4NA 4LFUA 1X1AA 4NC6A 4AD9A 3H9QA 3LAPA 1I50J 2JA8J 4BJTA 2E5ZA 2Q8KA 2DMTA 2R5YA 1TW2A 4RB0A 1T98A 2W48A 1RUOA 2XF5A 3KLOA 4ITVA 1Z6TA 3K70C 3CCVI 2CGPA 3BPVA 3PL8A 5C4JJ 2FBIA 1BW5A 3I64A 4BACA 1YHQI 2PJPA 2HDCA 2V1UA 2Y0SA 2P0WA 3ZN0A 4HQEA 2XAUA 5TJJA 6PAXA 5J1RA 3FISA 4A3MJ 4F92B 3FHZA 4MEXF 3HPGA 5K5OA 3G73A 1XB4A 3OS0A 1Z05A 2F5CA 2DA6A 3ZN1A 3GZ5A 4ZTFA 5E3NA 3HTUA 2D1VA 3CUOA 1VQPI 4KIFA 1DP7P 1MKMA 3SEZA 2OD5A 2E36A 5IYDJ 1W5SA 3MKLA 1S7AA 1LFUP 1FSEA 3KYLA 2LR8A 4M74A 4KNYA 2E7XA 3ELKA 2YX7A 3BP8A 3IP4B 5LD2C 3SHFA 1LKXA 2RAEA 4E7HA 5ERIA 2IA2A 1P4WA 3O8HA 2M34A 2Z3YA 2WA0A 5DDGA 1W7PD 3FF5A 2OPTA 3GFMA 1MGTA 4YG2F 1HKQA 2JVHA 2JN6A 2FOWA 1W7PB 2YU9J 4OMZA 1S5LC 4G9YA 3L2UA 4CUGA 4PJNA 3OSGA 3BCBA 3MEXA 5E18F 3QPHA 1A5JA 2PBIA 2Y69H 4CCOA 3L7WA 4EJTA 1J7KA 1ZRDA 3WTTC 2H8RA 1XD7A 1YS6A 1ZLKA 3CMYA 1YTYA 3K4KA 3CCUI 4AU7A 1VQMI 1WGXA 1RETA 2UXXA 1VQ6I 1MMAA 4LG0B 3DBHB 2WAQA 1D0ZA 4Z2YA 4GFBA 3CCMI 1R36A 3SZTA 4EM2A 3PO2J 2HDWA 3BY6A 3VSKA 5EYRA 2QQBA 3F8NA 4UVCA 3KZIC 1MMNA 4LLGF 2NOGA 2L5QA 2K85A 2GA2A 2V79A 2VT3A 4ZDPA 3MFKA 5HDKA 4KFCA 2D5VA 4UHTA 5EDNA 2HS5A 3JTGA 2MBFA 3V8KA 2HPIA 3K6GA 2DO7A 3DEUA 2WB1A 5F64A 2GOXB 1J59A 4QPQA 3LQQA 3H36A 1KU7A 4H4KC 3W3CA 3BR0A 2LBFB 2Y9ZA 3HPHA 1HF0A 1FIAA 1IRGA 5FFZA 4XLPF 3ZCOA 2RKHA 3U9GA 1V5EA 3VYTB 2Y9YA 4Q5SF 3E6DA 4HAMA 3S1RJ 5BOXA 1BJAA 2GBYA 4P9UA 5IYBJ 2X6YA 2MSYA 4OWRB 4HX8A 4AUXA 1SEUA 2FNAA 1Z1DA 3FZVA 4H0EA 1U3EM 5E3OA 1BI3A 4M9ZA 3J80K 1Y1VJ 2K02A 4CO8A 2BXYA 2A5YB 4RB1A 1GXPA 3BQYA 2JK3A 3S8PA 4I09A 4IOCF 1REPC 4G6DA 3HRMA 2NVYJ 3FMQA 1FC3A 3EPZA 3SDBA 2EFOA 1TQIA 1FT9A 1O3QA 3S32A 4KT5C 3ZQ7A 2CFXA 1U9OA 2MH2A 2Y48A 2FEZA 2CW0F 2EJRA 5K1YA 1J09A 2DT7B 2ELJA 2ZFWA 3OYDA 1J9IA 4EJWA 2ZJPF 2JVGA 4RDUA 3HBLA 2E5NA 3FXOA 2M5WA 2MA3A 2OZUA 4IHWA 1ORKA 4NQWA 3VYRB 3LNQA 1SD6A 5FLVA 4J19A 1PJRA 1O4XA 2H27A 1Q1VA 2JPCA 3RKQA 1BN5A 1X4OA 4MQVA 3PQJA 4NDLA 3OYCA 4BQQA 1DDNA 1HDDC 1HCRA 4G7ZF 2IS1A 2K5CA 3WU1B 3O8GA 3SDGA 5IP9J 5A2QZ 3KYDB 2JSCA 3HG9A 3JRFA 3ZMVA 4HNVA 5HDNA 2RGVA 2BZTA 2EFNA 4RGRA 5LLQA 4XQFA 4BYYA 2VE9A 3WTZA 2BY2A 5IOYA 1V4RA 4UY8I 4PJ0C 2CO5A 1ZKGA 2GOMA 2LSOA 3HRTA 3MQ0A 1DU6A 2F5VA 2Z1DA 5HNFA 1L3LA 3LSHA 2X1CA 3B02A 4LB5A 4I99C 2VQHA 3K0LA 2A6TA 3OWTA 3ZMZA 1X1CA 4IEJA 3IC7A 3P9KA 1S7EA 5D5VB 3F3XA 2BOLA 1UAAA 2MLGA 4BDYA 4HF1A 3W6VA 1B8IA 2FF4A 1BOAA 3BOQA 4ZTJA 1FTTA 5CQGA 2HI3A 3LA2A 3L00A 5EGOB 1NK3P 4E7LA 4DGWB 3DEEA 1TLHB 4R79A 3HDDA 3VYSB 2ZXHA 1TTYA 3GFLA 4I76A 1IJWC 1FMVA 1VTNC 1X2NA 2ZB9A 1D1AA 1YLFA 2K4BA 3RJPA 5F27A 4XN0A 2K4JA 5B5EC 2VT2A 1UG0A 1YW9A 2JMWA 4M3GA 4HSRA 4IOAF 1NHAA 3S3OA 4BY1J 1LE8A 1LEAA 1PUFB 2DDAA 1SFOJ 3H3ZA 5D5WB 1IN7A 1IC8A 3GW2A 2OCCH 3QU6A 5EF6A 1DGWY 3S1QJ 4QTRA 1WSUA 1SMYF 3ERED 2PJRA 3FK6A 1U5TC 2HGCA 3CJQB 3U1KA 4RAZA 2XPUA 3KZYA 4FE7A 2PMZA 4F55A 1IDZA 2CRGA 5K7HA 2DTZA 3LMMA 2YU3A 2LMDA 2HOEA 2RDPA 4HQMA 2DOFA 2R5ZA 1H88C 3DKXA 3V8JA 2UWMA 2JQ7A 1TQPA 4CCMA 4XKWA 1IG7A 2O8XA 1YW8A 2VQGA 1Q1HA 4JX4A 1TNTA 2AQFA 2CYYA 1ETKA 1SVMA 3K9TA 3GVAA 1ZK8A 1SVLA 5L3DA 2IVMA 4C2MJ 2KIMA 5D6FA 1WZ2A 4WXCA 5L3GA 2EV6A 3BDDA 1V3FA 2OCEA 3KFWX 2E1CA 4XLNF 1J5YA 4ESJA 2UXNA 2WAQN 3BJAA 2X4HA 2QVOA 4Y17A 1S3JA 2IS6A 4N9IA 1NTCA 2XGDA 5E8IA 2DFIA 1OCOH 4LD5A 2M7AA 3EYYA 1PP8F 2OV7A 1RR7A 3KZZA 1IDYA 4IHYA 2JPBA 2MYSA 1FPQA 2LYCA 2BY3A 3QOEA 3M1CA 2L2OA 1X1DA 3F6VA 3RI4A 2OU2A 4BEHA 1D8JA 3BG5A 4XOTA 2IA1A 2CQ7A 2WB1N 4L9NA 4ESBA 4KN7X 1OCRH 3E5UA 1ZGJA 2XVCA 1MW7A 2A6EF 1F9NA 2DU9A 3JRHA 5H20A 1X19A 2CUZA 3HOZJ 2LK2A 2XF6A 2FMYA 2R0QC 3GTGJ 4KMFA 2HOAA 3R60A 4FQGA 5F1RA 3JAMZ 4FISA 2IT0A 4ZYHA 3ABLH 3I4NJ 4BJ6C 3RKYA 3DF8A 1FX7A 2DDBA 3MKYB 4CHUA 1Y8QB 4HG2A 2G7UA 2R7SA 2XDVA 3KP4A 1UZCA 1TW3A 4EGZA 1OYYA 1AWCA 1HC8A 4JYKA 3ESWB 2R4GA 1JJ6C 1P2FA 3OYGA 2HTJA 1VQ4I 5HS9A 5GADJ 3GCMA 4PDKA 1QA6A 3R0JA 3REOA 4S0HB 3H0GJ 1JT6A 1LDDA 4DYRA 3F23A 2WBMA 1HKSA 4E6KG 2UV1A 2STWA 5BPIA 1TNSA 1WJEA 3HUGB 2ZO4A 1BI2A 3ZR8X 3KEQA 3Q0WA 2M7BA 5EG0A 3GLLA 1QO0D 2EBIA 3FM3A 2FQ4A 2GIVA 4AIDA 3HRUA 1VQLI 3HHHA 2A61A 3BR1A 4LITA 4Y3OA 1T6SA 3HGGA 1QPIA 3FWEA 4ZC3A 2WADA 3F22A 4IPAA 2EZKA 2W00A 3OYNA 1AKHA 5H2FC 3U21A 4E70A 1QVUA 1FWZA 3JRAA 4V2FA 1WH5A 1HA8A 3RPUD 3H9GA 3FBNB 1CF7B 4HZFA 1D5VA 4HEA2 4B48A 2RNJA 2L7MP 2CQKA 4HX4A 3GBGA 2YPRA 2VOPA 4A12A 5JLWA 1DU0A 3E6CC 2G9WA 4M3BA 2BW3B 2ECBA 3D0SA 1XGMA 5JHFA 3MZ8A 2HQNA 4I2OA 4IRHA 4L5EA 3DV8A 1A31A 2V1NA 1SANA 3HOSA 2NNNA 4PJJA 4JP0A 3K10A 4GXOA 2OTLI 3HTSB 3GTLJ 2EV5A 3HZJA 2I8DA 3RQ4A 3F8BA 1D8KA 1XGOA 1D5YA 3JRGA 4UXNA 3I53A 3QPSA 5GP9A 4M3EA 2CS3A 2DA4A 4LJZF 4MLOA 1KQ8A 2Q2EA 2HTSA 1HW2A 4YEJA 3J80Z 1XCVA 1R1VA 1KYWA 1ZTRA 1JT0A 1HSJA 2AS5F 5FKOA 5JVGF 3OOPA 4ENKA 2Z33A 2XSDC 1IUFA 1JXSA 4MGRA 4MO7A 1BA5A 2WTEA 3E97A 4UUVA 2O5RA 2F4OB 4ABZA 1LDKB 5B66C 1QPMA 2K3PA 3DEWA 1JUMA 2L54A 4BXXJ 5LEJA 4V2GA 1OJLA 3MD2A 1XX5A 2D1HA 5GAEJ 5F0FA 3FMRA 2KKOA 3E3VA 3H35A 4I6ZA 1DQUA 1ZG3A 2GXGA 2K9MA 2JA5J 2E19A 3FM5A 2IJLA 4E7SA 1ON1A 3NWTA 2E60A 1KA8A 2M9HA 3PJRA 1K61A 3HKZA 3C2BA 2J5OA 5DV5A 2L4MA 4A0XA 1G3YA 1FYKA 3BQZA 5JI6A 5HOOA 2L01A 3BG7A 2OQGA 4GO1A 2K9SA 1IF1A 5F04A 1G3WA 3BG9A 3BTIA 3IAS2 2EFQA 5J4VA 2KIQA 2Y31A 3IKVA 1WRJA 2EQRA 2ID3A 2MD0A 4Q4ZF 3C2GA 1W5CC 2Z5UA 3C3WA 4I7HA 1AA7A 5H6RA 3H5RA 3N97A 2LNBA 3J7YJ 3C7JA 5AONA 1R4MB 4P9FA 3DU5A 1LFPA 4BBSJ 5HNHA 3VDXA 1GV2A 4B4CA 1RR8C 2E2JJ 2AXTC 3F8CA 4IO9F 1EH7A 3ZRGA 4M72A 2M1BA 1MMGA 2WAEA 2OA4A 1FIPA 3FXUA 4C9YA 3QAHA 2VODA 3CCQI 1QZYA 2B7EA 4LLNA 3DP7A 1X4PA 1RESA 2HQAA 2VOOA 3KP6A 2NS7A 2Z99A 3I71A 4AIJA 5HLGA 3GX4X 2E2IJ 3LSJA 3RPQA 1J75A 4RB2C 1JJ8C 3G1LA 3S3NA 1P4XA 4AYBA 4PFOA 4XORA 2GXAA 2AQEA 2XF7A 1EKEA 1FY7A 1Y1WJ 1LVAA 2ZSHB 3LFUA 2HXIA 1IZ1A 2OC6A 3IWFA 1U5TA 3GYHX 1SC7A 2Z16A 1D1CA 4A3IJ 4HV6A 1ETWA 3MKZA 4L0ZB 1Z7LA 2FJ1A 3QOPA 1MDMA 2QBYB 4OAZA 3QP5A 3G3ZA 5FD5A 4HSTA 3TGNA 3M3YJ 4ZDOA 5CJ9A 4CCJA 3PIOF 4E7JA 2DQLA 2D45A 1SD4A 2YX4A 3G6EI 5CQEA 1VQ5I 5KNLA 1T95A 2V9PA 4HW0A 1XDSA 2NNYA 2XKOA 2V4JC 1KGSA 5DCMB 3GEZA 4AVPA 2I5UA 1BIAA 2NVXJ 1POGA 2W84A 1Z91A 4HPQA 4BKXA 1LVKA 4IX7A 4AIKA 3LSTA 2O3FA 3GTMJ 2XAFA 1FEXA 4RGXA 3WTXC 4ZH4F 1MJ9A 2BVLA 2LKSA 3EYIA 1UHMA 1WVRA 1G8XA 2DFEA 4EJOA 1VQ9I 2M8EA 4KICA 3CCLI 4BDZA 2H1LA 3V7CA 1U78A 1V54H 1HW5A 3CF2A 1R23A 4X1EA 1YI2I 2ISZA 2DK8A 2ME6A 1E0EA 4UVBA 4GRIA 2UZKA 3CUQC 1B72A 3ABKH 3FXRA 2E1MC 5LGNA 2XB0X 3RYRA 1YW7A 4KN4X 1U6GA 4A3LJ 4HNUA 4EJVA 4CYCB 4BE2A 3HOVJ 2KRHA 3AL0B 4WWCA 3E6MA 1TBXA 3DKYA 3ZMSA 4B1RA 4D5CA 1ZHFA 1I6XA 2FE3A 3S3MA 3DWLE 2W57A 2RVCA 1MZBA 4KT6A 3CDLA 4N4NB 3GXOA 3CESA 3VWBA 2QQ9A 3RQIA 3E7LA 2JSPA 2DMQA 3MMYB 4II2A 5E8GA 4A5NA 2YUSA 2E1OA 4F52A 2XASA 4BE0A 4B47A 1IRZA 5D4SA 5LRSA 1S9HA 2R7TA 4KIBA 1TT0A 1WJAA 4GYGA 1MBKA 1CGPA 2L3DA 3ZQFA 3SXYA 2ZJRF 4CXFA 3CJTB 1MMSA 3VFZA 1YITI 2F4IA 4UB8C 3JAMK 3H1CA 3D5SC 2WAFA 3FX3A 3PNYA 2JUGA 4OIOF 3CC7I 5FRNA 4FT8A 4B44A 2LP0A 4RAGA 5F0CA 3S17J 1FJLA 3CDIA 1XS9A 3BC8A 2TDXA 3TO7A 2EILH 4B09A 1WHUA 3T8TA 5HVQC 1GDTA 4IKFA 3RKWA 5D4RA 1HDPA 2X51A 3TMOA 3W6JB 1QHHD 4CH7A 4D1QA 4CCKA 5J40A 1Z9CA 2V1XA 4ZYDA 3PQKA 3E5XA 2DPDA 1GUUA 2VN2A 2X6WA 3MN2A 1H9TA 1R00A 3PSFA 3A0BC 5D5XB 3KP3A 3DQVC 2IEKA 3QYBA 1FYMA 3WTUC 4MQ9F 1B9MA 1OQYA 2K27A 1H9GA 1TP4A 1O57A 4YFXF 2A68F 5M5YJ 3L2CA 1VQ7I 2ZMEC 5J1UA 5J4YA 2DOEA 2CV1A 3V4GA 1XMKA 4F93B 1QU3A 3CCSI 1BBYA 2R7VA 4HF2A 3HKZN 2LD5A 1ZELA 4KDPA 1ERDA 1F36A 1KONA 2MLKA 5EEAA 4KA4A 3WTSC 4GYIA 2I10A 2KMUA 4P96A 2ZFUA 1JUSA 1XG1A 3NWSA 4YFKF 2GLOA 2XRLA 3BLYA 2ZC2A 4GCVA 5F1JA 4A3DJ 3HXLA 1UELB 1SD7A 3KCCA 4IVNA 2NXNB 3MAJA 4FASD 5EEGA 1IN6A 3LWFA 4OOIA 4D5FA 1ZRFA 1U8BA 1YX3A 3JCUC 2KJBA 4BHPA 3HSFA 2WWYA 4I98B 4YIFA 3HOXJ 3OV8A 3HEFA 3QYEA 4HDUA 3Q3SA 1YRNA 2IPQX 2TRTA 5J3LA 5K5QA 5LRRA 1TC3C 4L5IA 3M4OJ 3BR2A 5BS6A 4A3FJ 3BTLA 2DN0A 3A0HC 3TW7A 1AOYA 2RN7A 4EJUA 1VFCA 3BZCA 4G6TB 3I58A 3ONQA 1K79A 1R5GA 1OYWA 4DOZA 4IXAA 2MC4A 3PNVA 1VI0A 1A35A 4MHGA 1Y6IA 2KISA 1XTAA 4G7HF 2M4KA 3WHBA 1T33A 2K7LA 4BS9A 3NQOA 3M1EA 4I01A 1WJCA 2PMHA 3VPRA 1VF9A 2G0EA 4K2EA 1ZLJA 2AO9A 3D1NI 2M45A 2XIGA 4C2TA 2F48A 3QU3A 4IJAA 3LSIA 2KZVA 4XIDA 2GIZA 1JHFA 2V1DA 2O8KA 3S2DJ 4NBQA 5B1BH 2E71A 3VODA 4HF0A 5FO5A 1U0JA 4XLFA 3FXKA 2X9DA 5FROA 4XR6A 5KAIC 2X0LA 5IPAA 1ETOA 5FLXZ 5FKNA 3CCJI 1P7JA 2P6TA 4DQ2A 3BG3A 1FOKA 4XRSA 4Y4RA 4A0YA 5KVRA 2R3SA 1ETXA 3BTJA 4HBLA 4PUSA 5CVVA 4BH9A 2F5FA 1OR7A 5ICCA 1W36D 3TEDA 2Y30A 2R5YB 2XAHA 3R6SA 4LGWA 4N4OB 2ETHA 2VC0A 1FP2A 4M3FA 5ILSA 1BIBA 3LSGA 5J8FA 1D0YA 2LG4A 2XPWA 1N78A 2VJIA 3SQNA 2HXOA 1I1SA 2CQNA 2F4MB 1XGNA 2P5KA 4QIWN 1KU3A 1X2MA 3ZQLA 1JKPC 1HQCA 2COBA 5J47A 1A36A 3SJMA 2ELKA 2F5DA 2MFZA 4XKVA 3GWZA 1E3OC 3HGYA 1VQKI 1ZYRF 4XKBA 1Z6RA 3EUKL 3I59A 2Y2ZA 1YIJI 3O6BB 2X48A 2LLKA 2ID6A 2PMUA 1A6QA 1VZ0A 2E1NA 2LFBA 2VQCA 4Z6YA 3AAFA 4XN3A 2CH0A 4YFNF 4ZZDA 1I6HJ 3CUQA 3J81Z 2LY1A 3F8MA 3IV5A 2CUFA 4NUBA 2Y0SN 2PI0A 1HLVA 4ZYEA 3PUBA 1ETQA 5J8CA 4A69C 3BT9A 2FBKA 1DGRM 5D6EA 1K83J 2IGKA 1GLNA 1IRFA 4R1HA 3T1BA 2LTPA 4O3MA 2X6OA 3P9CA 1XCBA 1QZEA 4I02A 3K4CA 1EV7A 3HC7A 2LKPA 3OY9A 2IW5A 3E6BA 2FBHA 1ODDA 4WXDA 3ZP5A 2LY9A 2NS0A 3BCAA 4I0BA 2L7FP 2E2HJ 2IBDA 3COAC 4CCLA 5HLHA 5IP6A 4KISA 1QRYA 1O3RA 3BJ6A 3TBIA 3AG1H 2L0KA 3SFZA 2LF8A 3ZMDA 3I4PA 2GWRA 3K7AJ 4UUTA 2KJCA 2VE8A 3RZDJ 3A1YA 3ZPLA 2QQAA 2XPVA 1CQTA 2DJIA 3OS1A 1ZR2A 3ABUA 3HHGA 2CV2A 1FSHA 1JTYA 4G12A 1G4DA 3F8FA 4YIRX 2BY1A 2VBYA 2QCOA 2XB5A 4ETSA 3KEOA 3OL3A 1Z3XA 4IHVA 2PX9A 3LA7A 3PNTA 5LHIA 2FA5A 3QQAA 2PQ8A 2NVTJ 2EIJH 1R71A 2JTVA 3DPUA 2OF7A 2A05A 2EIKH 2DMUA 4D0PA 3HL2A 1K6OA 2B63J 4LK1F 2R7DA 4UV8A 3QYFA 2F5EA 2VBWA 3A01A 4CICA 3S14J 2OUMA 2IP2A 1USTA 1IAWA 2H6BA 4WXHA 4JX6A 3Q9VA 3T8RA 5BMZA 1WFXA 2XRNA 5IOZA 2W24A 4G6QA 3K4MA 4IRIA 2H6CA 4NHJA 2HU9A 1SAUA 1WPKA 5DYMA 3FHNA 3K1MA 3I3LA 2EINH 1FZPB 1R49A 3GTKJ 2CG4A 4Y33A 1FOXA 4B43A 1NG7A 1QBJA 5DUKA 4BQAA 1PDNC 1MBGA 4RBOA 1FBUA 3OIQA 2IXSA 1IN5A 2HNHA 4C2UA 4CZCA 4BJ5C 2X1DA 2Q0OA 2FD5A 1MNEA 3BR6A 2DA2A 2KT0A 3HJEA 2VKEA 5EZGA 2ZMEA 1Y56A 3FKIJ 3ECHA 2JA2A 2DA1A 3OMYA 1RZ4A 1KZHA 1UMQA 4CZZA 5E1ZB 3OIOA 4A93J 5HLTA 3ZQQA 3R0AA 3I56I 4KYWA 3W2AA 1Z7UA 3HIFA 1O7LA 1R4NB 1IRXA 5IT3A 4HA8A 1D3YA 5CPRB 3H5AA 2M8GX 1OFCX 4DYQA 5ILUA 5C44J 2R7XA 4EEFG 3PIPF 4D7NA 2DYRH 2HYFA 3OYLA 3S16J 4UUSA 3WG9A 1P9QC 2EWNA 3CZ6A 4NQWB 5B3SH 3ULQB 4HLYA 3RYPA 3FKJA 2JRMA 5JR3A 1PP7U 1ONVA 5EJCA 3M8FA 3A2KA 2HFHA 2DMNA 4YRVA 4NC7A 3I9V2 1JI8A 2CJJA 3W6KB 4CGZA 2MH9A 4LLLA 2O61A 5GAGJ 3OYMA 1R1TA 4ZYGA 4AWXB 2M30A 1XPXA 4RLFA 2DW4A 4I0AA 4DNCA 4D9JA 1OKRA 1WI9A 2QF7A 1N75A 2LH9A 2NOJB 1ZQ3P 3UNGC 3IKTA 2YSRA 4CA0A 1MBEA 1U8RA 4XRFA 4RGUA 1JGGA 4F7ZA 1HKTA 2QZ8A 4OIRF 4BU2A 1UHSA 1ZARA 3QWLA 2KLOA 3AG3H 3IRQA 2HOSA 3ZMUA 4A5MA 2M87A 3OYBA 2DOAA 2JRTA 3WGHA 4EVIA 2HDDA 2C6YA 4G94A 1USSA 1I39A 2ISYA 5FD6A 2XUBA 3JSPA 1BC7C 5CVRA 2F6CA 1B8IB 2LOOA 1FP1D 1B59A 3VSLA 2M4GA 4PJLA 2QEXI 4V19K 5L3CA 2IS2A 3H0DA 1EA3A 4AC0A 2D2WA 1Y39A 4P55A 4RAFA 3CMEI 3OYEA 4L5JA 3VB2A 2NAZA 1QQIA 3ZGKA 3K70D 1IW7F 3IH4A 5LGUA 4ZYAA 5E3MA 4RMNA 2DT5A 1SFEA 5JVTA 4XSZF 4BAYA 1LE8B 2L9RA 2Y75A 4WCGA 2R7RA 1MIJA 4UV9A 1YG2A 2W4SA 1BM9A 4LK0F 1X58A 5ICFA 5C4XJ 4C3IJ 1RUNA 1N25A 2VJ4A 5FLXK 1K78B 1W7PA 3RTRA 2KFDA 2EZHA 3LA3A 2PJRB 1XSDA 3DCFA 3PFIA 2L02A 2FU4A 1JE8A 1HXDA 2P8TA 5DD8A 3L9FA 2HVRA 3BTCA 2H09A 9ANTA 2V26A 2R5ZB 5M3FJ 4QLCU 1BW6A 3JR9A 4J01A 5GTHC 1LDJA 3LL7A 1T2KA 2NS8A 4EMSA 2JA6J 2L9VA 2AXLA 1OYIA 2ME0A 4AM3A 3ROUA 2RREA 3DFGA 1ULYA 3P5JA 1OCPA 4LG0A 3OL4A 3IHUA 3OIPA 1VQOI 3SYTA 2MD5A 3KP5A 2BHYA 3GFJA 3RKXA 5IY5H 2HYGD 2PMZN 1QZZA 3Q9SA 2BGCA 4EM0B 2QSFX 3CO6C 2EZIA 4HRIA 2AHQA 2VONA 3DPLC 5FFXA 3P9IA 4CYDA 3OYHA 2PFBA 3WHCA 2VUMJ 4X6AJ 4KITB 3GLXA 3OYFA 3U1DA 3PM1A 3S1MJ 4LG3A 3J81K 3DU6A 2K9NA 4GGGA 4MEYF 1Z21A 2LBFA 4BEHB 2P81A 2NRAC 2BXZA 2VKHA 4WF2A 5AIPA 4KUMA 5FKLA 4ENJA 3CJRB 3OYJA 2XGCA 1WJDA 2XGXA 3GFIA 2EH3A 1OR7C 1GVDA 1R1UA 3ERMA 3K1PA 3HYIA 5GPCA 1XN7A 3Q0UA 2MGQA 3DTKA 3HOUJ 4OAYA 5K5RA 4LIUA 3D5RC 1I5ZA 2Z2SB 5ED4A 2CMPA 1ZRCA 2L7KA 4FX0A 1XMXA 2R7QA 3ZXSA 2L7ZA 3GZNB 2ZXJA 5AIQA 1R9TJ 2FSWA 3JRBA 1UG2A 3WGGA 2BE5F 2DODA 1YOVB 3S93A 2XAQA 1FNNA 1D1BA 1WH7A 1Z0XA 3JRDA 3S2WA 1H89C 1R6RA 1IV8A 5CVIA 1G3TA 2EA4A 4U0VA 1SMTA 2MG4A 5M3MJ 3TL4X 1PVEA 4PSXA 3WODF 1RIOH 1UHWA 1WCMJ 4YIIA 3ABMH 2FRHA 1P7IA 2LVSA 2VB6A 5EG0B 1IN4A 1FBSA 3GTJJ 2L9SA 1TWGJ 1UJ8A 4DJAA 2V9KA 5E20A 2ESNA 3DBLB 3TW6A 4ZJZA 1J2XA 2QENA 3OYKA 4FTHA 1G59A 3KEYA 1VNDA 5FKKA 1LQ1A 4A3CJ 2HQRA 2IRFG 1AKHB 4IF4A 1STZA 4PCQA 4L0YB 4J00A 1LUJB 3F72A 3ASNH 2VXZA 2QLZA 3CCEI 3DKWA 1TT5B 2ZXWH 5DM6F 1IXCA 4Y13A 2VPRA 4XRMA 3MZHA 3FXQA 1GV5A 3GO5A 5FKMA 3CLQA 5DTDA 1R5ID 3HB9A 3IUOA 1OISA 2L4AA 1XSVA 4II3A 1XGSA 1MH3A 2BHZA 2CW8A 1TWFJ 2VJ5A 3BPXA 1MBJA 3DTEA 2K86A 4Y7NJ 2ADUA 1EH6A 3QODA 1NG6A 3L2WA 2IGOA 4XL9A 1YYVA 2QSHX 1ETYA 3HOWJ 1MBFA 1TWAJ 3CMMA 2L9NA 4BL0B 3G1MA 5E17F 1M1EB 3K1NA 1EJ9A 2WY8Q 3BZKA 2BVMA 2QYOA 4A3BJ 3LSMA 5ICEA 3IH3A 2JZYA 3TDZC 3C18A 3CMAI 4ZDLA 2QA4I 2Q2EB 4E7ZA 4ON0A 2OJED 5CLSA 1VQNI 1T56A 2P4WA 1PYVA 4PGHA 3LOCA 4Q48A 2FNPA 4N9HA 1A6IA 2EZLA 2M0MA 4L18B 5E1XA 3QP6A 1ZR4A 4R8HA 2BV6A 1QGPA 5EGOA 3CD6I 4EQQA 1VQ8I 1DP3A 1OPCA 1FYLA 1ZG5A 1HOMA 3PO3J 1YQAA 2K3FA 4F91B 1B1BA 3OR1C 3G1OA 4IHTA 3IRRA 2R7WA 4KJZA 1KYZA 4LMYA 4BE1A 2FXAA 4ENMA 1IN8A 2ECCA 2VLAA 1ZGWA 1T0FC 2DMPA 2Q1ZB 3JREA 2PLYA 3K4LA 4JBAA 4QSHA 4OIQF 1JKOC 3D5LA 2IA0A 1PUFA 1XDUA 4RM2A 1X3UA 3I55I 1ACIA 5HS7A 4IZZA 1Y0NA 1APLC 2HZTA 5F6FA 1WWXA 4XLHA 1W4MA 1XC5A 3M8EA 1E2XA 5D8LB 3Q0VA 2XKPA 3N05A 5DUIA 2DYSH 1UB9A 3KX2A 2W85A 1TWHJ 1WQ2A 2XV4S 3I5UA 2VBZA 4RA2A 2N8GA 5E79C 5FLMJ 1YO5C 1IV6A 3CF5F 3GF2A 2P5VA 1BC8C 2XGEA 2M0CA 3T5XA 2BBYA 1YIOA 1OCCH 3GTQJ 5KHDA 2GM4A 3JSOA 1D0XA 2ZBKA 2H8WA 1BR2A 4ANJA 3G2BA 2P7VB 1S72I 4FCYA 2WV1A 5CYVA 3HRSA 3E1SA 1UCRA 5C3EJ 5TGTA 3MVPA 4XLCA 2LRDA 4P5OA 2DCEA 2UUZA 3CP2A 4L9VA 3DTIA 1ZGAA 2JT1A 3HM5A 1F4KA 1DPRA 3L09A 3RDIA 1E17A 2E7WA 2VC1A 3PFYA 4PK4A 2ZNZA 3CDHA 1U5TB 1U9NA 1Z67A 3M07A 4A3EJ 2KPMA 4IHSA 3L1PA 4U0YA 2FMLA 2RNGA 1BR4A 4BQNA 1MDMB 1S7OA 3VYUB 2VPLA 2FUG2 3CP8A 4AYBN 3NAUA 2JA7J 2A07F 4A3JJ 1GT0C 4HNTA 3LSPA 3AL0C 4JOMA 2KL4A 1S8NA 2YR2A 2DA5A 4M9SA 3B73A 5FB2A 3UR3C 4XRSG 3BR5A 3AFHA 4ZZLA 3UKGA 2CQXA 1Z77A 2IAIA 1WJFA 1XSXA 1BI0A 4BXFA 2HKOA
chains in the Genus database with same CATH topology
4ITVA 3MD2A 3K70C 2HU9A 3PL8A 1SAUA 3FHNA 3I3LA 2X1EA 3H35A 4BACA 1DQUA 4Y33A 4B43A 2K9MA 1NG7A 2Y0SA 2P0WA 4E7SA 3NWTA 2E60A 3C2HA 3PJRA 2XAUA 3HKZA 3OR2C 3OIQA 2IXSA 4F92B 2HNHA 3HPGA 4CZCA 4C2UA 3OS0A 2IGNA 4ZTFA 4BJ5C 4EATA 2X1DA 3BG7A 2KHMA 5HOOA 3HOTA 3IAS2 1MNEA 3SEZA 2MD0A 3C2GA 3EUAA 2CW7A 1AA7A 1Y56A 3H5RA 4IQ4A 3OMYA 2JA2A 3KYLA 1Z3YA 3DU5A 1LFPA 4U7BA 5HNHA 3IP4B 3VDXA 5LD2C 1LKXA 5HLTA 3ZQQA 4E7HA 3W2AA 3W2VA 3ZRGA 2WA0A 1IRXA 1MMGA 2WAEA 2R7UA 4C30A 4C9YA 5CPRB 3H5AA 2VIXA 4U87A 2JVHA 1X4PA 3A4CA 3MKWB 2R7XA 4RLQA 2HQAA 2K9LA 3L2UA 4CUGA 4PJNA 3OYLA 3BCBA 1P9QC 2A5WA 3CZ6A 4NQWB 4CCOA 3FDYA 3S3NA 3FKJA 4XOPA 4PFOA 4XORA 4AYBA 2AQEA 2XF7A 2BW3A 3K4KA 2QKMB 2ZSHB 4AU7A 3A2KA 3LFUA 4XONA 2OC6A 4YRVA 4NC7A 3I9V2 1JI8A 1MMAA 2Z16A 1D1CA 4XLAA 3MKZA 3OYMA 2WAQA 1D0ZA 1Z7LA 1N77A 4RLFA 3AKZA 4OAZA 4HSTA 2HDWA 3VSKA 4D9JA 4ZDOA 3EUHC 4CCJA 4E7JA 1N75A 5CQEA 1MMNA 2LH9A 1T95A 2NOJB 5KNLA 3UNGC 2XSJC 2L5QA 4CA0A 3L2VA 5LFAA 4QPOA 2V4JC 4ZDPA 4E7IA 2VJJA 3L2QA 2HPIA 1FMWA 1QHGA 2M3AA 3K6GA 3M8JA 1LVKA 2WB1A 4HPQA 4IX7A 2GOXB 4BU2A 4QPQA 2KLOA 3OOUA 4H4KC 3W3CA 2LBFB 4E7KA 2LY2A 3HPHA 4XKCA 2BVLA 3OYBA 2VXDA 2DOAA 1G8XA 3ZCOA 4X0GA 1V5EA 3VYTB 1YX5A 3L2RA 4BDZA 3LSKA 2F6CA 3CF2A 2W82A 4CSWA 4GRIA 2X6YA 3RCOA 1TZLA 4OWRB 1X1BA 2LOOA 2CV0A 3RSNA 2E1MC 3OS2A 3VSLA 2M4GA 4PJLA 2IS2A 4HNUA 3H0DA 1EA3A 4XMYA 4BE2A 3DPTA 2KRHA 3AL0B 3OYEA 3DKYA 3S8PA 1K6YA 3ZGKA 3K70D 3K4BA 3S3MA 3DWLE 4ZYAA 3SDBA 3EPZA 3PSIA 4RMNA 3IAM2 2V6EA 4KT6A 3S32A 3K4JA 2R7RA 4N4NB 3CESA 2W4SA 1J09A 3VWBA 2DT7B 2ELJA 2JSPA 3MMYB 4II2A 3OYDA 4F52A 4BE0A 4B47A 2VJ4A 4XM3A 1S9HA 2JVGA 2R7TA 1TT0A 1WJAA 5KCMA 2E5NA 3RTRA 2PJRB 2HVRA 3VYRB 2W1OA 4LIVA 1PJRA 2V26A 3FBIB 4JQFA 4FETA 4J01A 2F4IA 1X4OA 3OYCA 2HZDA 4BQQA 3LL7A 2IS1A 2K5CA 4E4HA 3D5SC 2WAFA 4NC8A 3PNYA 2JUGA 4PSWA 2LREA 5FRNA 2RREA 3HG9A 4B44A 3OL4A 3OIPA 3SYTA 2IGMA 2VASA 4XQFA 3BC8A 2GOMA 1MMDA 5HVQC 4HRIA 2F5VA 4IKFA 2Z1DA 5HNFA 1W36C 3DPLC 2X51A 3LSHA 3TMOA 2X1CA 3OYHA 1QHHD 2VL8A 4CH7A 4KITB 4D1QA 4CCKA 2VQHA 3OYFA 4LG3A 2A6TA 3DU6A 3OWTA 4DBRA 1Z21A 1X1CA 2LBFA 2X6WA 3PSFA 4BEHB 2VKHA 3DQVC 3QYBA 3CJRB 3OYJA 1SFKA 1WJBA 1WJDA 2BOLA 1UAAA 4BDYA 1OR7C 1MNDA 4ZTJA 4NNJA 4YELA 5CQGA 1WJ5A 2CV1A 4XNFA 2RQQA 2ZXIA 3BG6A 4F93B 2QKLB 1QU3A 3DTKA 4OAYA 4LIUA 2KQRA 4E7LA 3D5RC 4DGWB 3DEEA 2R7VA 2Z2SB 4R79A 3VYSB 2CMPA 2ZXHA 2L7KA 1V5GA 1FMVA 1ZELA 2R7QA 1V5FA 3ZXSA 1KONA 1ERDA 1D1AA 4XN0A 2KMUA 3E0JB 2ZFUA 1UG0A 3NWSA 3S93A 3BLYA 4HSRA 3S3OA 1D1BA 2CUJA 2W7NA 1R6RA 3HXLA 2MABA 1UELB 4FASD 4XLEA 3TL4X 1YX3A 1DGWY 4PSXA 2VB6A 2E1MB 2PJRA 3QYEA 2L9SA 3H5NA 3CJQB 4DJAA 2V9KA 2PMZA 4F55A 1E0EA 4ZJZA 3OYKA 3LMMA 1G59A 3KEYA 2V7FA 3DKXA 2DT6A 2UWMA 1BOBA 4CCMA 4XKWA 4G6TB 4J00A 3ONQA 2KP6A 2VQGA 2VXZA 4DOZA 2X85A 2AQFA 2MC4A 3PNVA 4DIQA 1Y6IA 2M4KA 3IUOA 4BS9A 2KRCA 4II3A 1WJCA 2CW8A 2VJ5A 2HVQA 3DTEA 2IS6A 1YE9A 4C2TA 2KDOA 3W2WA 1BR1A 3QODA 3LSIA 1NG6A 3L2WA 2KZVA 2IGOA 2M7AA 4XL9A 4CCNA 4BL0B 3CMMA 2L9NA 2OV7A 4BGDA 2WY8Q 2CFOA 4DBQA 2MYSA 2LYCA 1U0JA 4XLFA 2BVMA 3QOEA 3M1CA 2L2OA 1X1DA 3LSMA 5FROA 4XR6A 4BEHA 4XOTA 4ZDLA 3V42A 2Q2EB 4E7ZA 3F9KA 1MW7A 4Y4RA 1PYVA 4PUSA 4PFPA 1X19A 2CUZA 2ZSIB 2XF6A 1W36D 2M0MA 4N4OB 1DP3A 3LSGA 2VKDA 4F91B 1D0YA 2LG4A 3OR1C 4BJ6C 3OYAA 1N78A 3MKYB 2VJIA 4HG2A 2R7WA 2R7SA 2XDVA 4KJZA 3DLAA 4BE1A 2VLAA 1T0FC 2Q1ZB 2R4GA 5CKTA 2MFZA 3K4LA 4XKVA 3OYGA 4RM3A 2X6XA 4PJMA 4XKBA 3D5LA 3EUKL 4F3QA 4RM2A 2XC7A 4IZZA 2WBMA 2LC2A 2UV1A 4E6KG 1VZ0A 1WJEA 2VQCA 4XLHA 4XN3A 2CH0A 3HUGB 2DXIA 2LY1A 3ZR8X 2VQLA 2M7BA 4NUBA 3N05A 3J7AY 3PUBA 3SEQA 3KX2A 1DGRM 2IGKA 1GLNA 4AVZA 4LITA 4Y3OA 4ZC3A 2WADA 3OYIA 3K4CA 2W00A 3HC7A 3OY9A 3OYNA 2WY7Q 4BQOA 2HVSA 3U21A 5KHDA 3BCAA 1D0XA 1HA8A 3RPUD 3H9GA 1BR2A 3FBNB 3G2BA 4ANJA 4CCLA 2HPMA 3SZGA 4P1WA 4HEA2 3E1SA 4KISA 4B48A 3H9JA 5TGTA 3TBIA 4XLCA 2LRDA 4P5OA 3GBGA 2IS4A 2DCEA 2UUZA 3CP2A 4BUPA 3DTIA 2BW3B 3A1YA 3PFYA 4PK4A 5JHFA 2DJIA 3OS1A 2V1NA 2CV2A 2KPMA 2R7OA 3HOSA 4PJJA 2RNGA 3K10A 1BR4A 4BQNA 3VYUB 4B3XA 2I8DA 2VPLA 3RQ4A 3OL3A 1Z3XA 2FUG2 3CP8A 3PNTA 2CS3A 4MLOA 1OLTA 4HNTA 4YEJA 3AL0C 5FRMA 4IQJA 4JOMA 3DPUA 3K4NA 3HL2A 2KL4A 1X1AA 3H9QA 4BJTA 3QYFA 3UR3C 2E5ZA 3AFHA 2OUMA 2O5RA 1LDKB 1WJFA 4BXFA 2K3PA 1WFXA 2XF5A 3K4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZGK A;  3ZR8 X;  2LC2 A; 
#chains in the Genus database with same CATH topology
 3V7S A;  3KLN A;  5LHG A;  2KIF A;  2YS9 A;  2X1E A;  2ZJ2 A;  5KK1 A;  1MSE C;  3CCY A;  1HBX G;  3M9A A;  3RIR A;  4M73 A;  2DK5 A;  3IL2 A;  1DUX C;  1GHC A;  5HS8 A;  1B72 B;  3C2H A;  5LGT A;  2R93 J;  2MW8 A;  3OR2 C;  3CC4 I;  1G2H A;  5ICG A;  5CVJ A;  1K4T A;  4NB5 A;  2IGN A;  4EAT A;  2STT A;  2KHM A;  3AG2 H;  3H3V K;  1B6A A;  2R7F A;  5TIS C;  3KIO A;  3HOT A;  2GXB A;  3FK7 A;  3WTY C;  2ACJ A;  3HUG A;  3CLO A;  4BXU A;  4OIP F;  2XAJ A;  3EUA A;  2CW7 A;  1E3H A;  3JRC A;  3MWM A;  4IQ4 A;  2EFP A;  3ISP A;  5BQT A;  3J7Z I;  1RKT A;  1Z3Y A;  3SZP A;  1EH8 A;  1RI7 A;  2DQR A;  1MH4 A;  4U7B A;  3KP7 A;  2DTR A;  3W2V A;  5ILV A;  4KIG A;  2R7U A;  2WC2 A;  4C30 A;  3OSF A;  5KAF C;  3IWZ A;  3I54 A;  2VIX A;  3WU0 A;  3WGI A;  4U87 A;  3A4C A;  3MKW B;  1KQ9 A;  4M3D A;  4RLQ A;  1LPQ A;  5J6X A;  2HQ5 A;  1CF7 A;  2K9L A;  4BHC A;  5M5X J;  4BNC A;  2RC4 A;  1P4A A;  2KZG A;  1AHD P;  2A5W A;  3RPU A;  4M6X A;  3A02 A;  3SFI A;  1JKQ C;  2P5L C;  1R58 A;  3FDY A;  4XOP A;  1W0T A;  2P7C B;  1I1G A;  2BW3 A;  2QKM B;  3N4M A;  3GUD A;  1FBQ A;  2NYX A;  4XON A;  5IT9 K;  4LB6 B;  4XLA A;  1JTX A;  1R22 A;  1P6R A;  1X3W B;  3F0C A;  3CC2 I;  2BYV E;  1XMA A;  1N77 A;  2R92 J;  2B9S A;  4DW6 A;  3AKZ A;  4MTE A;  3HSR A;  3EUH C;  3HSE A;  3Q5F A;  2MC3 A;  4PGG A;  1ENH A;  3ASO H;  3S2H J;  3CJN A;  2XSJ C;  2DA3 A;  2COM A;  3L2V A;  5LFA A;  4QPO A;  4E7I A;  2LKX A;  3BWG A;  3A03 A;  4ASN A;  2VJJ A;  3L2Q A;  2OZ6 A;  1FMW A;  1RKW A;  1QHG A;  1QNT A;  2M3A A;  1V55 H;  3M8J A;  1MNM C;  1HST A;  3ZOB A;  5HOD A;  2HYJ A;  1Y8R B;  1JUP A;  3OOU A;  2VI6 A;  4E7K A;  2LY2 A;  4XKC A;  3EQL F;  2VXD A;  4KMU X;  4X0G A;  4C3H J;  4A6D A;  2O03 A;  1YX5 A;  2M2E A;  3L2R A;  4A3K J;  1C0W A;  3GTP J;  3LSK A;  4HYE A;  4CSW A;  2W82 A;  3FXM A;  4UNO A;  2V6C A;  2QSG X;  5E3L A;  5LHH A;  3RCO A;  1TZL A;  4G8X A;  1X1B A;  2CV0 A;  3M7G A;  3RSN A;  2QWW A;  3OS2 A;  4N0B A;  3WE3 A;  3IH2 A;  3TQN A;  5CVU A;  2KDZ A;  1K78 A;  4Y52 J;  3TP3 A;  4XMY A;  1BL0 A;  2A3S A;  3DPT A;  1MJB A;  4BBR J;  2R7Z J;  2HWV A;  2CQQ A;  4ESF A;  2HR3 A;  2V9V A;  4HOB A;  4O6J A;  1IGN A;  1K6Y A;  4MIM A;  3KP2 A;  1E3P A;  3K4B A;  4OIN F;  3G71 I;  1R5H A;  5DS9 A;  4M9X A;  3PSI A;  3LFK A;  2J5P A;  3IAM 2;  2V6E A;  1YJN I;  3K4J A;  5GAH J;  3KET A;  3J7A O;  3T0Y A;  3V8L A;  2BY0 A;  3JRI A;  2Z9O A;  4WX9 A;  4OMY A;  3S15 J;  1T0F A;  5FGM A;  5J1Y A;  4XM3 A;  4XK4 A;  5KCM A;  3B6C A;  5BPD A;  5FJ8 J;  1W1W E;  1YRN B;  5JLX A;  1LEB A;  3U2R A;  3GTO J;  2W1O A;  1RPW A;  4LIV A;  3FBI B;  4JQF A;  4FET A;  2O7O A;  2W25 A;  4IL6 C;  4MNU A;  3BZ6 A;  2HZD A;  3FXJ A;  1IXR C;  4E4H A;  3JW4 A;  2ZKZ A;  4NC8 A;  5HDG A;  4QWQ A;  1KU2 A;  4PSW A;  3K2Z A;  3K69 A;  2LRE A;  3O2P E;  5DCF A;  5L3E A;  1LJ9 A;  5EZH A;  1U2W A;  1SAX A;  2DA7 A;  2LDU A;  1GXQ A;  2QBY A;  2IGM A;  2VAS A;  4M6V A;  2HKX A;  3O3K A;  5BNG A;  4UVA A;  2JJ7 A;  3CTA A;  5HLI A;  1RC9 A;  3JTH A;  1YFH A;  1ITY A;  1MMD A;  2QGU A;  5DCM A;  1W36 C;  2ICW G;  2PEX A;  2G7H A;  1FLI A;  3F6O A;  2VL8 A;  3K2A A;  4U88 A;  3ZQH A;  2DFH A;  4S04 A;  1WI3 A;  2VKV A;  3KPH A;  4DBR A;  4LOC A;  3S1N J;  4EGY A;  1LNW A;  2HEO A;  3BR3 A;  1GVJ A;  2EA2 A;  3TOB A;  1SFU A;  3WU2 C;  2FX0 A;  2OAZ A;  1QVT A;  5GTI C;  4MFE A;  3GME A;  1SFK A;  1WJB A;  4JX5 A;  3ZQG A;  4WK8 F;  2EB7 A;  1AU7 A;  4JK1 X;  4BY7 J;  2CWE A;  3ZMT A;  1SD5 A;  4RAY A;  1P92 A;  2BEO A;  1MND A;  5JFR A;  2DPU A;  3RZO J;  2B0L A;  4NNJ A;  4YEL A;  1WJ5 A;  4XNF A;  5DM7 F;  2RQQ A;  2ZXI A;  3BG6 A;  5E1W A;  4GDF A;  2QKL B;  2DLL A;  2GQQ A;  2K40 A;  5JHU A;  5DD4 A;  1TL8 A;  2KQR A;  4CYC A;  3FMS A;  1V5G A;  4AIH A;  1V5F A;  2A6H F;  1TWC J;  1FTZ A;  1ON2 A;  4W1U A;  4RB3 C;  5K7F A;  3E0J B;  4XSX F;  3ML6 A;  2CUJ A;  2W7N A;  4EV0 A;  3BJO A;  2MAB A;  2RV8 A;  3I59 B;  1Y0U A;  4IHX A;  4EM1 A;  4XLE A;  1S6L A;  2CUE A;  1KU9 A;  2E34 A;  3CUQ B;  2EK5 A;  5D5U B;  1NK2 P;  5GPA A;  4FHT A;  2KRF A;  2E1M B;  3WG7 H;  4A2U A;  2RQP A;  3LQR A;  2DJN A;  3H5N A;  1B4A A;  3I0T A;  2ESH A;  4A3G J;  2P6S A;  1ZRE A;  1ZN2 A;  1JHH A;  1X3Z B;  1MJA A;  2F2E A;  2V7F A;  1TQM A;  2DT6 A;  3V7R A;  1I3Q J;  1BOB A;  3ECO A;  1I3A A;  2PG4 A;  1JGS A;  4L9T A;  1NH3 A;  1FOY A;  4RGS A;  2KP6 A;  3KYC B;  2X85 A;  1F43 A;  3H3U A;  3C1D A;  1O7F A;  4DIQ A;  1YJW I;  4OU0 A;  1LFB A;  2QM3 A;  1W5T A;  4PZJ A;  4BHB A;  2KRC A;  1DPU A;  2EFW A;  1ZAO A;  3QPT A;  2XHK A;  4DZP A;  2HVQ A;  1R7J A;  1YE9 A;  3TOA A;  2KDO A;  1RNL A;  3W2W A;  1BR1 A;  2QUF A;  1HW1 A;  3DBR B;  2O9L A;  4CCN A;  3E5Q A;  4BGD A;  4UB6 C;  5LBQ A;  1B9N A;  3ABT A;  5IP7 J;  2ZCW A;  4A0Z A;  2CFO A;  4DBQ A;  2TCT A;  2FOK A;  3MZY A;  1S29 A;  2LF7 A;  3R4K A;  5TRD A;  5L3B A;  3EET A;  1OCZ H;  4U7D A;  2A69 F;  5B1A H;  2NVQ J;  1J0R A;  2CSO A;  5A2Q K;  3V42 A;  4HV5 A;  3F9K A;  4CDG A;  3G4S I;  3FXL A;  2DI3 A;  4HDV A;  1T08 B;  3FIW A;  4PFP A;  1G3S A;  2DBB A;  4RS8 A;  1W0U A;  2GAU A;  2ZSI B;  3WTW C;  2JWT A;  4TV7 A;  3A01 B;  2DFF A;  3EUH A;  4W97 A;  3NAR A;  3R61 A;  5F0H A;  2EV0 A;  1L0O C;  4C3J J;  2VKD A;  3WTV C;  4HLX A;  2H94 A;  5D8K B;  3OYA A;  3HOY J;  3CQZ J;  2EPF A;  2WV0 A;  3DXJ F;  3TO9 A;  1O3S A;  3VEP A;  3DLA A;  2E35 A;  4S05 A;  4M6Y A;  2K9Q A;  3CO7 C;  2XAG A;  5CKT A;  3EDP A;  4DYC A;  3DLL F;  1A04 A;  4RM3 A;  4G7O F;  5DEQ A;  2X6X A;  4PJM A;  2O0Y A;  2KIU A;  4F3Q A;  3AG4 H;  4A6E A;  1T39 A;  2XC7 A;  2ELH A;  5LEK A;  1OMI A;  2LC2 A;  2XRO A;  1I27 A;  2DAO A;  3MCZ A;  1T8I A;  3ZQI A;  2DXI A;  1ZG1 A;  1H8A C;  3B6A A;  2VQL A;  2ZME B;  1WKM A;  4FX4 A;  3KE2 A;  3NRV A;  1LB2 A;  3J7A Y;  1PUE E;  1K7A A;  4XBF A;  5IT9 Z;  3SEQ A;  3WE2 A;  3BRO A;  4O5V A;  3GZ6 A;  2OTJ I;  4AVZ A;  3LAJ A;  5F08 A;  1OCT C;  3OYI A;  4HX7 A;  1H0M A;  1ETV A;  2VBX A;  2WY7 Q;  4IRG A;  4BQO A;  1SVO A;  5L3F A;  2HVS A;  2PN6 A;  4DZJ A;  2Y0M A;  1MD0 A;  4D7M A;  1JKR C;  3LSR A;  2JUC A;  3SZG A;  2HPM A;  1F5T A;  4P1W A;  4Q47 A;  3TP0 A;  3F21 A;  4UUS B;  4ENN A;  2OBP A;  1MSF C;  3H92 A;  3H9J A;  1IUY A;  3TO6 A;  2GZW A;  2ZNY A;  1O3T A;  2QQ8 A;  3I4M J;  2IS4 A;  1YS7 A;  3NEU A;  1T38 A;  5EEH A;  1YJ9 I;  2GA1 A;  1SFX A;  4BUP A;  3CCR I;  1ZH5 A;  2CU7 A;  1IXS B;  4XIC A;  4FE4 A;  1EF4 A;  3X2Q H;  2O6G E;  3PUF A;  1FOW A;  1IO2 A;  5M5W J;  1KQ0 A;  1UFM A;  4B3A A;  1MBH A;  2H1K A;  3P7N A;  2EIM H;  2R7O A;  5H6Q A;  3QPL A;  5K7Z A;  1X1P A;  3TKY A;  4B8X A;  4B3X A;  3QRF F;  3TDU C;  1BJZ A;  4L9J A;  1BI1 A;  4M71 A;  4MFD A;  4MTD A;  4U0W A;  2HOT A;  2NVU B;  5IYC J;  1F1Z A;  2OQR A;  1OLT A;  2FQ3 A;  4Y15 A;  1K4S A;  5FRM A;  3VOE A;  1RRJ A;  2ZJQ F;  3ZQC A;  4IQJ A;  1G6N A;  3K4N A;  4LFU A;  1X1A A;  4NC6 A;  4AD9 A;  3H9Q A;  3LAP A;  1I50 J;  2JA8 J;  4BJT A;  2E5Z A;  2Q8K A;  2DMT A;  2R5Y A;  1TW2 A;  4RB0 A;  1T98 A;  2W48 A;  1RUO A;  2XF5 A;  3KLO A;  4ITV A;  1Z6T A;  3K70 C;  3CCV I;  2CGP A;  3BPV A;  3PL8 A;  5C4J J;  2FBI A;  1BW5 A;  3I64 A;  4BAC A;  1YHQ I;  2PJP A;  2HDC A;  2V1U A;  2Y0S A;  2P0W A;  3ZN0 A;  4HQE A;  2XAU A;  5TJJ A;  6PAX A;  5J1R A;  3FIS A;  4A3M J;  4F92 B;  3FHZ A;  4MEX F;  3HPG A;  5K5O A;  3G73 A;  1XB4 A;  3OS0 A;  1Z05 A;  2F5C A;  2DA6 A;  3ZN1 A;  3GZ5 A;  4ZTF A;  5E3N A;  3HTU A;  2D1V A;  3CUO A;  1VQP I;  4KIF A;  1DP7 P;  1MKM A;  3SEZ A;  2OD5 A;  2E36 A;  5IYD J;  1W5S A;  3MKL A;  1S7A A;  1LFU P;  1FSE A;  3KYL A;  2LR8 A;  4M74 A;  4KNY A;  2E7X A;  3ELK A;  2YX7 A;  3BP8 A;  3IP4 B;  5LD2 C;  3SHF A;  1LKX A;  2RAE A;  4E7H A;  5ERI A;  2IA2 A;  1P4W A;  3O8H A;  2M34 A;  2Z3Y A;  2WA0 A;  5DDG A;  1W7P D;  3FF5 A;  2OPT A;  3GFM A;  1MGT A;  4YG2 F;  1HKQ A;  2JVH A;  2JN6 A;  2FOW A;  1W7P B;  2YU9 J;  4OMZ A;  1S5L C;  4G9Y A;  3L2U A;  4CUG A;  4PJN A;  3OSG A;  3BCB A;  3MEX A;  5E18 F;  3QPH A;  1A5J A;  2PBI A;  2Y69 H;  4CCO A;  3L7W A;  4EJT A;  1J7K A;  1ZRD A;  3WTT C;  2H8R A;  1XD7 A;  1YS6 A;  1ZLK A;  3CMY A;  1YTY A;  3K4K A;  3CCU I;  4AU7 A;  1VQM I;  1WGX A;  1RET A;  2UXX A;  1VQ6 I;  1MMA A;  4LG0 B;  3DBH B;  2WAQ A;  1D0Z A;  4Z2Y A;  4GFB A;  3CCM I;  1R36 A;  3SZT A;  4EM2 A;  3PO2 J;  2HDW A;  3BY6 A;  3VSK A;  5EYR A;  2QQB A;  3F8N A;  4UVC A;  3KZI C;  1MMN A;  4LLG F;  2NOG A;  2L5Q A;  2K85 A;  2GA2 A;  2V79 A;  2VT3 A;  4ZDP A;  3MFK A;  5HDK A;  4KFC A;  2D5V A;  4UHT A;  5EDN A;  2HS5 A;  3JTG A;  2MBF A;  3V8K A;  2HPI A;  3K6G A;  2DO7 A;  3DEU A;  2WB1 A;  5F64 A;  2GOX B;  1J59 A;  4QPQ A;  3LQQ A;  3H36 A;  1KU7 A;  4H4K C;  3W3C A;  3BR0 A;  2LBF B;  2Y9Z A;  3HPH A;  1HF0 A;  1FIA A;  1IRG A;  5FFZ A;  4XLP F;  3ZCO A;  2RKH A;  3U9G A;  1V5E A;  3VYT B;  2Y9Y A;  4Q5S F;  3E6D A;  4HAM A;  3S1R J;  5BOX A;  1BJA A;  2GBY A;  4P9U A;  5IYB J;  2X6Y A;  2MSY A;  4OWR B;  4HX8 A;  4AUX A;  1SEU A;  2FNA A;  1Z1D A;  3FZV A;  4H0E A;  1U3E M;  5E3O A;  1BI3 A;  4M9Z A;  3J80 K;  1Y1V J;  2K02 A;  4CO8 A;  2BXY A;  2A5Y B;  4RB1 A;  1GXP A;  3BQY A;  2JK3 A;  3S8P A;  4I09 A;  4IOC F;  1REP C;  4G6D A;  3HRM A;  2NVY J;  3FMQ A;  1FC3 A;  3EPZ A;  3SDB A;  2EFO A;  1TQI A;  1FT9 A;  1O3Q A;  3S32 A;  4KT5 C;  3ZQ7 A;  2CFX A;  1U9O A;  2MH2 A;  2Y48 A;  2FEZ A;  2CW0 F;  2EJR A;  5K1Y A;  1J09 A;  2DT7 B;  2ELJ A;  2ZFW A;  3OYD A;  1J9I A;  4EJW A;  2ZJP F;  2JVG A;  4RDU A;  3HBL A;  2E5N A;  3FXO A;  2M5W A;  2MA3 A;  2OZU A;  4IHW A;  1ORK A;  4NQW A;  3VYR B;  3LNQ A;  1SD6 A;  5FLV A;  4J19 A;  1PJR A;  1O4X A;  2H27 A;  1Q1V A;  2JPC A;  3RKQ A;  1BN5 A;  1X4O A;  4MQV A;  3PQJ A;  4NDL A;  3OYC A;  4BQQ A;  1DDN A;  1HDD C;  1HCR A;  4G7Z F;  2IS1 A;  2K5C A;  3WU1 B;  3O8G A;  3SDG A;  5IP9 J;  5A2Q Z;  3KYD B;  2JSC A;  3HG9 A;  3JRF A;  3ZMV A;  4HNV A;  5HDN A;  2RGV A;  2BZT A;  2EFN A;  4RGR A;  5LLQ A;  4XQF A;  4BYY A;  2VE9 A;  3WTZ A;  2BY2 A;  5IOY A;  1V4R A;  4UY8 I;  4PJ0 C;  2CO5 A;  1ZKG A;  2GOM A;  2LSO A;  3HRT A;  3MQ0 A;  1DU6 A;  2F5V A;  2Z1D A;  5HNF A;  1L3L A;  3LSH A;  2X1C A;  3B02 A;  4LB5 A;  4I99 C;  2VQH A;  3K0L A;  2A6T A;  3OWT A;  3ZMZ A;  1X1C A;  4IEJ A;  3IC7 A;  3P9K A;  1S7E A;  5D5V B;  3F3X A;  2BOL A;  1UAA A;  2MLG A;  4BDY A;  4HF1 A;  3W6V A;  1B8I A;  2FF4 A;  1BOA A;  3BOQ A;  4ZTJ A;  1FTT A;  5CQG A;  2HI3 A;  3LA2 A;  3L00 A;  5EGO B;  1NK3 P;  4E7L A;  4DGW B;  3DEE A;  1TLH B;  4R79 A;  3HDD A;  3VYS B;  2ZXH A;  1TTY A;  3GFL A;  4I76 A;  1IJW C;  1FMV A;  1VTN C;  1X2N A;  2ZB9 A;  1D1A A;  1YLF A;  2K4B A;  3RJP A;  5F27 A;  4XN0 A;  2K4J A;  5B5E C;  2VT2 A;  1UG0 A;  1YW9 A;  2JMW A;  4M3G A;  4HSR A;  4IOA F;  1NHA A;  3S3O A;  4BY1 J;  1LE8 A;  1LEA A;  1PUF B;  2DDA A;  1SFO J;  3H3Z A;  5D5W B;  1IN7 A;  1IC8 A;  3GW2 A;  2OCC H;  3QU6 A;  5EF6 A;  1DGW Y;  3S1Q J;  4QTR A;  1WSU A;  1SMY F;  3ERE D;  2PJR A;  3FK6 A;  1U5T C;  2HGC A;  3CJQ B;  3U1K A;  4RAZ A;  2XPU A;  3KZY A;  4FE7 A;  2PMZ A;  4F55 A;  1IDZ A;  2CRG A;  5K7H A;  2DTZ A;  3LMM A;  2YU3 A;  2LMD A;  2HOE A;  2RDP A;  4HQM A;  2DOF A;  2R5Z A;  1H88 C;  3DKX A;  3V8J A;  2UWM A;  2JQ7 A;  1TQP A;  4CCM A;  4XKW A;  1IG7 A;  2O8X A;  1YW8 A;  2VQG A;  1Q1H A;  4JX4 A;  1TNT A;  2AQF A;  2CYY A;  1ETK A;  1SVM A;  3K9T A;  3GVA A;  1ZK8 A;  1SVL A;  5L3D A;  2IVM A;  4C2M J;  2KIM A;  5D6F A;  1WZ2 A;  4WXC A;  5L3G A;  2EV6 A;  3BDD A;  1V3F A;  2OCE A;  3KFW X;  2E1C A;  4XLN F;  1J5Y A;  4ESJ A;  2UXN A;  2WAQ N;  3BJA A;  2X4H A;  2QVO A;  4Y17 A;  1S3J A;  2IS6 A;  4N9I A;  1NTC A;  2XGD A;  5E8I A;  2DFI A;  1OCO H;  4LD5 A;  2M7A A;  3EYY A;  1PP8 F;  2OV7 A;  1RR7 A;  3KZZ A;  1IDY A;  4IHY A;  2JPB A;  2MYS A;  1FPQ A;  2LYC A;  2BY3 A;  3QOE A;  3M1C A;  2L2O A;  1X1D A;  3F6V A;  3RI4 A;  2OU2 A;  4BEH A;  1D8J A;  3BG5 A;  4XOT A;  2IA1 A;  2CQ7 A;  2WB1 N;  4L9N A;  4ESB A;  4KN7 X;  1OCR H;  3E5U A;  1ZGJ A;  2XVC A;  1MW7 A;  2A6E F;  1F9N A;  2DU9 A;  3JRH A;  5H20 A;  1X19 A;  2CUZ A;  3HOZ J;  2LK2 A;  2XF6 A;  2FMY A;  2R0Q C;  3GTG J;  4KMF A;  2HOA A;  3R60 A;  4FQG A;  5F1R A;  3JAM Z;  4FIS A;  2IT0 A;  4ZYH A;  3ABL H;  3I4N J;  4BJ6 C;  3RKY A;  3DF8 A;  1FX7 A;  2DDB A;  3MKY B;  4CHU A;  1Y8Q B;  4HG2 A;  2G7U A;  2R7S A;  2XDV A;  3KP4 A;  1UZC A;  1TW3 A;  4EGZ A;  1OYY A;  1AWC A;  1HC8 A;  4JYK A;  3ESW B;  2R4G A;  1JJ6 C;  1P2F A;  3OYG A;  2HTJ A;  1VQ4 I;  5HS9 A;  5GAD J;  3GCM A;  4PDK A;  1QA6 A;  3R0J A;  3REO A;  4S0H B;  3H0G J;  1JT6 A;  1LDD A;  4DYR A;  3F23 A;  2WBM A;  1HKS A;  4E6K G;  2UV1 A;  2STW A;  5BPI A;  1TNS A;  1WJE A;  3HUG B;  2ZO4 A;  1BI2 A;  3ZR8 X;  3KEQ A;  3Q0W A;  2M7B A;  5EG0 A;  3GLL A;  1QO0 D;  2EBI A;  3FM3 A;  2FQ4 A;  2GIV A;  4AID A;  3HRU A;  1VQL I;  3HHH A;  2A61 A;  3BR1 A;  4LIT A;  4Y3O A;  1T6S A;  3HGG A;  1QPI A;  3FWE A;  4ZC3 A;  2WAD A;  3F22 A;  4IPA A;  2EZK A;  2W00 A;  3OYN A;  1AKH A;  5H2F C;  3U21 A;  4E70 A;  1QVU A;  1FWZ A;  3JRA A;  4V2F A;  1WH5 A;  1HA8 A;  3RPU D;  3H9G A;  3FBN B;  1CF7 B;  4HZF A;  1D5V A;  4HEA 2;  4B48 A;  2RNJ A;  2L7M P;  2CQK A;  4HX4 A;  3GBG A;  2YPR A;  2VOP A;  4A12 A;  5JLW A;  1DU0 A;  3E6C C;  2G9W A;  4M3B A;  2BW3 B;  2ECB A;  3D0S A;  1XGM A;  5JHF A;  3MZ8 A;  2HQN A;  4I2O A;  4IRH A;  4L5E A;  3DV8 A;  1A31 A;  2V1N A;  1SAN A;  3HOS A;  2NNN A;  4PJJ A;  4JP0 A;  3K10 A;  4GXO A;  2OTL I;  3HTS B;  3GTL J;  2EV5 A;  3HZJ A;  2I8D A;  3RQ4 A;  3F8B A;  1D8K A;  1XGO A;  1D5Y A;  3JRG A;  4UXN A;  3I53 A;  3QPS A;  5GP9 A;  4M3E A;  2CS3 A;  2DA4 A;  4LJZ F;  4MLO A;  1KQ8 A;  2Q2E A;  2HTS A;  1HW2 A;  4YEJ A;  3J80 Z;  1XCV A;  1R1V A;  1KYW A;  1ZTR A;  1JT0 A;  1HSJ A;  2AS5 F;  5FKO A;  5JVG F;  3OOP A;  4ENK A;  2Z33 A;  2XSD C;  1IUF A;  1JXS A;  4MGR A;  4MO7 A;  1BA5 A;  2WTE A;  3E97 A;  4UUV A;  2O5R A;  2F4O B;  4ABZ A;  1LDK B;  5B66 C;  1QPM A;  2K3P A;  3DEW A;  1JUM A;  2L54 A;  4BXX J;  5LEJ A;  4V2G A;  1OJL A;  3MD2 A;  1XX5 A;  2D1H A;  5GAE J;  5F0F A;  3FMR A;  2KKO A;  3E3V A;  3H35 A;  4I6Z A;  1DQU A;  1ZG3 A;  2GXG A;  2K9M A;  2JA5 J;  2E19 A;  3FM5 A;  2IJL A;  4E7S A;  1ON1 A;  3NWT A;  2E60 A;  1KA8 A;  2M9H A;  3PJR A;  1K61 A;  3HKZ A;  3C2B A;  2J5O A;  5DV5 A;  2L4M A;  4A0X A;  1G3Y A;  1FYK A;  3BQZ A;  5JI6 A;  5HOO A;  2L01 A;  3BG7 A;  2OQG A;  4GO1 A;  2K9S A;  1IF1 A;  5F04 A;  1G3W A;  3BG9 A;  3BTI A;  3IAS 2;  2EFQ A;  5J4V A;  2KIQ A;  2Y31 A;  3IKV A;  1WRJ A;  2EQR A;  2ID3 A;  2MD0 A;  4Q4Z F;  3C2G A;  1W5C C;  2Z5U A;  3C3W A;  4I7H A;  1AA7 A;  5H6R A;  3H5R A;  3N97 A;  2LNB A;  3J7Y J;  3C7J A;  5AON A;  1R4M B;  4P9F A;  3DU5 A;  1LFP A;  4BBS J;  5HNH A;  3VDX A;  1GV2 A;  4B4C A;  1RR8 C;  2E2J J;  2AXT C;  3F8C A;  4IO9 F;  1EH7 A;  3ZRG A;  4M72 A;  2M1B A;  1MMG A;  2WAE A;  2OA4 A;  1FIP A;  3FXU A;  4C9Y A;  3QAH A;  2VOD A;  3CCQ I;  1QZY A;  2B7E A;  4LLN A;  3DP7 A;  1X4P A;  1RES A;  2HQA A;  2VOO A;  3KP6 A;  2NS7 A;  2Z99 A;  3I71 A;  4AIJ A;  5HLG A;  3GX4 X;  2E2I J;  3LSJ A;  3RPQ A;  1J75 A;  4RB2 C;  1JJ8 C;  3G1L A;  3S3N A;  1P4X A;  4AYB A;  4PFO A;  4XOR A;  2GXA A;  2AQE A;  2XF7 A;  1EKE A;  1FY7 A;  1Y1W J;  1LVA A;  2ZSH B;  3LFU A;  2HXI A;  1IZ1 A;  2OC6 A;  3IWF A;  1U5T A;  3GYH X;  1SC7 A;  2Z16 A;  1D1C A;  4A3I J;  4HV6 A;  1ETW A;  3MKZ A;  4L0Z B;  1Z7L A;  2FJ1 A;  3QOP A;  1MDM A;  2QBY B;  4OAZ A;  3QP5 A;  3G3Z A;  5FD5 A;  4HST A;  3TGN A;  3M3Y J;  4ZDO A;  5CJ9 A;  4CCJ A;  3PIO F;  4E7J A;  2DQL A;  2D45 A;  1SD4 A;  2YX4 A;  3G6E I;  5CQE A;  1VQ5 I;  5KNL A;  1T95 A;  2V9P A;  4HW0 A;  1XDS A;  2NNY A;  2XKO A;  2V4J C;  1KGS A;  5DCM B;  3GEZ A;  4AVP A;  2I5U A;  1BIA A;  2NVX J;  1POG A;  2W84 A;  1Z91 A;  4HPQ A;  4BKX A;  1LVK A;  4IX7 A;  4AIK A;  3LST A;  2O3F A;  3GTM J;  2XAF A;  1FEX A;  4RGX A;  3WTX C;  4ZH4 F;  1MJ9 A;  2BVL A;  2LKS A;  3EYI A;  1UHM A;  1WVR A;  1G8X A;  2DFE A;  4EJO A;  1VQ9 I;  2M8E A;  4KIC A;  3CCL I;  4BDZ A;  2H1L A;  3V7C A;  1U78 A;  1V54 H;  1HW5 A;  3CF2 A;  1R23 A;  4X1E A;  1YI2 I;  2ISZ A;  2DK8 A;  2ME6 A;  1E0E A;  4UVB A;  4GRI A;  2UZK A;  3CUQ C;  1B72 A;  3ABK H;  3FXR A;  2E1M C;  5LGN A;  2XB0 X;  3RYR A;  1YW7 A;  4KN4 X;  1U6G A;  4A3L J;  4HNU A;  4EJV A;  4CYC B;  4BE2 A;  3HOV J;  2KRH A;  3AL0 B;  4WWC A;  3E6M A;  1TBX A;  3DKY A;  3ZMS A;  4B1R A;  4D5C A;  1ZHF A;  1I6X A;  2FE3 A;  3S3M A;  3DWL E;  2W57 A;  2RVC A;  1MZB A;  4KT6 A;  3CDL A;  4N4N B;  3GXO A;  3CES A;  3VWB A;  2QQ9 A;  3RQI A;  3E7L A;  2JSP A;  2DMQ A;  3MMY B;  4II2 A;  5E8G A;  4A5N A;  2YUS A;  2E1O A;  4F52 A;  2XAS A;  4BE0 A;  4B47 A;  1IRZ A;  5D4S A;  5LRS A;  1S9H A;  2R7T A;  4KIB A;  1TT0 A;  1WJA A;  4GYG A;  1MBK A;  1CGP A;  2L3D A;  3ZQF A;  3SXY A;  2ZJR F;  4CXF A;  3CJT B;  1MMS A;  3VFZ A;  1YIT I;  2F4I A;  4UB8 C;  3JAM K;  3H1C A;  3D5S C;  2WAF A;  3FX3 A;  3PNY A;  2JUG A;  4OIO F;  3CC7 I;  5FRN A;  4FT8 A;  4B44 A;  2LP0 A;  4RAG A;  5F0C A;  3S17 J;  1FJL A;  3CDI A;  1XS9 A;  3BC8 A;  2TDX A;  3TO7 A;  2EIL H;  4B09 A;  1WHU A;  3T8T A;  5HVQ C;  1GDT A;  4IKF A;  3RKW A;  5D4R A;  1HDP A;  2X51 A;  3TMO A;  3W6J B;  1QHH D;  4CH7 A;  4D1Q A;  4CCK A;  5J40 A;  1Z9C A;  2V1X A;  4ZYD A;  3PQK A;  3E5X A;  2DPD A;  1GUU A;  2VN2 A;  2X6W A;  3MN2 A;  1H9T A;  1R00 A;  3PSF A;  3A0B C;  5D5X B;  3KP3 A;  3DQV C;  2IEK A;  3QYB A;  1FYM A;  3WTU C;  4MQ9 F;  1B9M A;  1OQY A;  2K27 A;  1H9G A;  1TP4 A;  1O57 A;  4YFX F;  2A68 F;  5M5Y J;  3L2C A;  1VQ7 I;  2ZME C;  5J1U A;  5J4Y A;  2DOE A;  2CV1 A;  3V4G A;  1XMK A;  4F93 B;  1QU3 A;  3CCS I;  1BBY A;  2R7V A;  4HF2 A;  3HKZ N;  2LD5 A;  1ZEL A;  4KDP A;  1ERD A;  1F36 A;  1KON A;  2MLK A;  5EEA A;  4KA4 A;  3WTS C;  4GYI A;  2I10 A;  2KMU A;  4P96 A;  2ZFU A;  1JUS A;  1XG1 A;  3NWS A;  4YFK F;  2GLO A;  2XRL A;  3BLY A;  2ZC2 A;  4GCV A;  5F1J A;  4A3D J;  3HXL A;  1UEL B;  1SD7 A;  3KCC A;  4IVN A;  2NXN B;  3MAJ A;  4FAS D;  5EEG A;  1IN6 A;  3LWF A;  4OOI A;  4D5F A;  1ZRF A;  1U8B A;  1YX3 A;  3JCU C;  2KJB A;  4BHP A;  3HSF A;  2WWY A;  4I98 B;  4YIF A;  3HOX J;  3OV8 A;  3HEF A;  3QYE A;  4HDU A;  3Q3S A;  1YRN A;  2IPQ X;  2TRT A;  5J3L A;  5K5Q A;  5LRR A;  1TC3 C;  4L5I A;  3M4O J;  3BR2 A;  5BS6 A;  4A3F J;  3BTL A;  2DN0 A;  3A0H C;  3TW7 A;  1AOY A;  2RN7 A;  4EJU A;  1VFC A;  3BZC A;  4G6T B;  3I58 A;  3ONQ A;  1K79 A;  1R5G A;  1OYW A;  4DOZ A;  4IXA A;  2MC4 A;  3PNV A;  1VI0 A;  1A35 A;  4MHG A;  1Y6I A;  2KIS A;  1XTA A;  4G7H F;  2M4K A;  3WHB A;  1T33 A;  2K7L A;  4BS9 A;  3NQO A;  3M1E A;  4I01 A;  1WJC A;  2PMH A;  3VPR A;  1VF9 A;  2G0E A;  4K2E A;  1ZLJ A;  2AO9 A;  3D1N I;  2M45 A;  2XIG A;  4C2T A;  2F48 A;  3QU3 A;  4IJA A;  3LSI A;  2KZV A;  4XID A;  2GIZ A;  1JHF A;  2V1D A;  2O8K A;  3S2D J;  4NBQ A;  5B1B H;  2E71 A;  3VOD A;  4HF0 A;  5FO5 A;  1U0J A;  4XLF A;  3FXK A;  2X9D A;  5FRO A;  4XR6 A;  5KAI C;  2X0L A;  5IPA A;  1ETO A;  5FLX Z;  5FKN A;  3CCJ I;  1P7J A;  2P6T A;  4DQ2 A;  3BG3 A;  1FOK A;  4XRS A;  4Y4R A;  4A0Y A;  5KVR A;  2R3S A;  1ETX A;  3BTJ A;  4HBL A;  4PUS A;  5CVV A;  4BH9 A;  2F5F A;  1OR7 A;  5ICC A;  1W36 D;  3TED A;  2Y30 A;  2R5Y B;  2XAH A;  3R6S A;  4LGW A;  4N4O B;  2ETH A;  2VC0 A;  1FP2 A;  4M3F A;  5ILS A;  1BIB A;  3LSG A;  5J8F A;  1D0Y A;  2LG4 A;  2XPW A;  1N78 A;  2VJI A;  3SQN A;  2HXO A;  1I1S A;  2CQN A;  2F4M B;  1XGN A;  2P5K A;  4QIW N;  1KU3 A;  1X2M A;  3ZQL A;  1JKP C;  1HQC A;  2COB A;  5J47 A;  1A36 A;  3SJM A;  2ELK A;  2F5D A;  2MFZ A;  4XKV A;  3GWZ A;  1E3O C;  3HGY A;  1VQK I;  1ZYR F;  4XKB A;  1Z6R A;  3EUK L;  3I59 A;  2Y2Z A;  1YIJ I;  3O6B B;  2X48 A;  2LLK A;  2ID6 A;  2PMU A;  1A6Q A;  1VZ0 A;  2E1N A;  2LFB A;  2VQC A;  4Z6Y A;  3AAF A;  4XN3 A;  2CH0 A;  4YFN F;  4ZZD A;  1I6H J;  3CUQ A;  3J81 Z;  2LY1 A;  3F8M A;  3IV5 A;  2CUF A;  4NUB A;  2Y0S N;  2PI0 A;  1HLV A;  4ZYE A;  3PUB A;  1ETQ A;  5J8C A;  4A69 C;  3BT9 A;  2FBK A;  1DGR M;  5D6E A;  1K83 J;  2IGK A;  1GLN A;  1IRF A;  4R1H A;  3T1B A;  2LTP A;  4O3M A;  2X6O A;  3P9C A;  1XCB A;  1QZE A;  4I02 A;  3K4C A;  1EV7 A;  3HC7 A;  2LKP A;  3OY9 A;  2IW5 A;  3E6B A;  2FBH A;  1ODD A;  4WXD A;  3ZP5 A;  2LY9 A;  2NS0 A;  3BCA A;  4I0B A;  2L7F P;  2E2H J;  2IBD A;  3COA C;  4CCL A;  5HLH A;  5IP6 A;  4KIS A;  1QRY A;  1O3R A;  3BJ6 A;  3TBI A;  3AG1 H;  2L0K A;  3SFZ A;  2LF8 A;  3ZMD A;  3I4P A;  2GWR A;  3K7A J;  4UUT A;  2KJC A;  2VE8 A;  3RZD J;  3A1Y A;  3ZPL A;  2QQA A;  2XPV A;  1CQT A;  2DJI A;  3OS1 A;  1ZR2 A;  3ABU A;  3HHG A;  2CV2 A;  1FSH A;  1JTY A;  4G12 A;  1G4D A;  3F8F A;  4YIR X;  2BY1 A;  2VBY A;  2QCO A;  2XB5 A;  4ETS A;  3KEO A;  3OL3 A;  1Z3X A;  4IHV A;  2PX9 A;  3LA7 A;  3PNT A;  5LHI A;  2FA5 A;  3QQA A;  2PQ8 A;  2NVT J;  2EIJ H;  1R71 A;  2JTV A;  3DPU A;  2OF7 A;  2A05 A;  2EIK H;  2DMU A;  4D0P A;  3HL2 A;  1K6O A;  2B63 J;  4LK1 F;  2R7D A;  4UV8 A;  3QYF A;  2F5E A;  2VBW A;  3A01 A;  4CIC A;  3S14 J;  2OUM A;  2IP2 A;  1UST A;  1IAW A;  2H6B A;  4WXH A;  4JX6 A;  3Q9V A;  3T8R A;  5BMZ A;  1WFX A;  2XRN A;  5IOZ A;  2W24 A;  4G6Q A;  3K4M A;  4IRI A;  2H6C A;  4NHJ A;  2HU9 A;  1SAU A;  1WPK A;  5DYM A;  3FHN A;  3K1M A;  3I3L A;  2EIN H;  1FZP B;  1R49 A;  3GTK J;  2CG4 A;  4Y33 A;  1FOX A;  4B43 A;  1NG7 A;  1QBJ A;  5DUK A;  4BQA A;  1PDN C;  1MBG A;  4RBO A;  1FBU A;  3OIQ A;  2IXS A;  1IN5 A;  2HNH A;  4C2U A;  4CZC A;  4BJ5 C;  2X1D A;  2Q0O A;  2FD5 A;  1MNE A;  3BR6 A;  2DA2 A;  2KT0 A;  3HJE A;  2VKE A;  5EZG A;  2ZME A;  1Y56 A;  3FKI J;  3ECH A;  2JA2 A;  2DA1 A;  3OMY A;  1RZ4 A;  1KZH A;  1UMQ A;  4CZZ A;  5E1Z B;  3OIO A;  4A93 J;  5HLT A;  3ZQQ A;  3R0A A;  3I56 I;  4KYW A;  3W2A A;  1Z7U A;  3HIF A;  1O7L A;  1R4N B;  1IRX A;  5IT3 A;  4HA8 A;  1D3Y A;  5CPR B;  3H5A A;  2M8G X;  1OFC X;  4DYQ A;  5ILU A;  5C44 J;  2R7X A;  4EEF G;  3PIP F;  4D7N A;  2DYR H;  2HYF A;  3OYL A;  3S16 J;  4UUS A;  3WG9 A;  1P9Q C;  2EWN A;  3CZ6 A;  4NQW B;  5B3S H;  3ULQ B;  4HLY A;  3RYP A;  3FKJ A;  2JRM A;  5JR3 A;  1PP7 U;  1ONV A;  5EJC A;  3M8F A;  3A2K A;  2HFH A;  2DMN A;  4YRV A;  4NC7 A;  3I9V 2;  1JI8 A;  2CJJ A;  3W6K B;  4CGZ A;  2MH9 A;  4LLL A;  2O61 A;  5GAG J;  3OYM A;  1R1T A;  4ZYG A;  4AWX B;  2M30 A;  1XPX A;  4RLF A;  2DW4 A;  4I0A A;  4DNC A;  4D9J A;  1OKR A;  1WI9 A;  2QF7 A;  1N75 A;  2LH9 A;  2NOJ B;  1ZQ3 P;  3UNG C;  3IKT A;  2YSR A;  4CA0 A;  1MBE A;  1U8R A;  4XRF A;  4RGU A;  1JGG A;  4F7Z A;  1HKT A;  2QZ8 A;  4OIR F;  4BU2 A;  1UHS A;  1ZAR A;  3QWL A;  2KLO A;  3AG3 H;  3IRQ A;  2HOS A;  3ZMU A;  4A5M A;  2M87 A;  3OYB A;  2DOA A;  2JRT A;  3WGH A;  4EVI A;  2HDD A;  2C6Y A;  4G94 A;  1USS A;  1I39 A;  2ISY A;  5FD6 A;  2XUB A;  3JSP A;  1BC7 C;  5CVR A;  2F6C A;  1B8I B;  2LOO A;  1FP1 D;  1B59 A;  3VSL A;  2M4G A;  4PJL A;  2QEX I;  4V19 K;  5L3C A;  2IS2 A;  3H0D A;  1EA3 A;  4AC0 A;  2D2W A;  1Y39 A;  4P55 A;  4RAF A;  3CME I;  3OYE A;  4L5J A;  3VB2 A;  2NAZ A;  1QQI A;  3ZGK A;  3K70 D;  1IW7 F;  3IH4 A;  5LGU A;  4ZYA A;  5E3M A;  4RMN A;  2DT5 A;  1SFE A;  5JVT A;  4XSZ F;  4BAY A;  1LE8 B;  2L9R A;  2Y75 A;  4WCG A;  2R7R A;  1MIJ A;  4UV9 A;  1YG2 A;  2W4S A;  1BM9 A;  4LK0 F;  1X58 A;  5ICF A;  5C4X J;  4C3I J;  1RUN A;  1N25 A;  2VJ4 A;  5FLX K;  1K78 B;  1W7P A;  3RTR A;  2KFD A;  2EZH A;  3LA3 A;  2PJR B;  1XSD A;  3DCF A;  3PFI A;  2L02 A;  2FU4 A;  1JE8 A;  1HXD A;  2P8T A;  5DD8 A;  3L9F A;  2HVR A;  3BTC A;  2H09 A;  9ANT A;  2V26 A;  2R5Z B;  5M3F J;  4QLC U;  1BW6 A;  3JR9 A;  4J01 A;  5GTH C;  1LDJ A;  3LL7 A;  1T2K A;  2NS8 A;  4EMS A;  2JA6 J;  2L9V A;  2AXL A;  1OYI A;  2ME0 A;  4AM3 A;  3ROU A;  2RRE A;  3DFG A;  1ULY A;  3P5J A;  1OCP A;  4LG0 A;  3OL4 A;  3IHU A;  3OIP A;  1VQO I;  3SYT A;  2MD5 A;  3KP5 A;  2BHY A;  3GFJ A;  3RKX A;  5IY5 H;  2HYG D;  2PMZ N;  1QZZ A;  3Q9S A;  2BGC A;  4EM0 B;  2QSF X;  3CO6 C;  2EZI A;  4HRI A;  2AHQ A;  2VON A;  3DPL C;  5FFX A;  3P9I A;  4CYD A;  3OYH A;  2PFB A;  3WHC A;  2VUM J;  4X6A J;  4KIT B;  3GLX A;  3OYF A;  3U1D A;  3PM1 A;  3S1M J;  4LG3 A;  3J81 K;  3DU6 A;  2K9N A;  4GGG A;  4MEY F;  1Z21 A;  2LBF A;  4BEH B;  2P81 A;  2NRA C;  2BXZ A;  2VKH A;  4WF2 A;  5AIP A;  4KUM A;  5FKL A;  4ENJ A;  3CJR B;  3OYJ A;  2XGC A;  1WJD A;  2XGX A;  3GFI A;  2EH3 A;  1OR7 C;  1GVD A;  1R1U A;  3ERM A;  3K1P A;  3HYI A;  5GPC A;  1XN7 A;  3Q0U A;  2MGQ A;  3DTK A;  3HOU J;  4OAY A;  5K5R A;  4LIU A;  3D5R C;  1I5Z A;  2Z2S B;  5ED4 A;  2CMP A;  1ZRC A;  2L7K A;  4FX0 A;  1XMX A;  2R7Q A;  3ZXS A;  2L7Z A;  3GZN B;  2ZXJ A;  5AIQ A;  1R9T J;  2FSW A;  3JRB A;  1UG2 A;  3WGG A;  2BE5 F;  2DOD A;  1YOV B;  3S93 A;  2XAQ A;  1FNN A;  1D1B A;  1WH7 A;  1Z0X A;  3JRD A;  3S2W A;  1H89 C;  1R6R A;  1IV8 A;  5CVI A;  1G3T A;  2EA4 A;  4U0V A;  1SMT A;  2MG4 A;  5M3M J;  3TL4 X;  1PVE A;  4PSX A;  3WOD F;  1RIO H;  1UHW A;  1WCM J;  4YII A;  3ABM H;  2FRH A;  1P7I A;  2LVS A;  2VB6 A;  5EG0 B;  1IN4 A;  1FBS A;  3GTJ J;  2L9S A;  1TWG J;  1UJ8 A;  4DJA A;  2V9K A;  5E20 A;  2ESN A;  3DBL B;  3TW6 A;  4ZJZ A;  1J2X A;  2QEN A;  3OYK A;  4FTH A;  1G59 A;  3KEY A;  1VND A;  5FKK A;  1LQ1 A;  4A3C J;  2HQR A;  2IRF G;  1AKH B;  4IF4 A;  1STZ A;  4PCQ A;  4L0Y B;  4J00 A;  1LUJ B;  3F72 A;  3ASN H;  2VXZ A;  2QLZ A;  3CCE I;  3DKW A;  1TT5 B;  2ZXW H;  5DM6 F;  1IXC A;  4Y13 A;  2VPR A;  4XRM A;  3MZH A;  3FXQ A;  1GV5 A;  3GO5 A;  5FKM A;  3CLQ A;  5DTD A;  1R5I D;  3HB9 A;  3IUO A;  1OIS A;  2L4A A;  1XSV A;  4II3 A;  1XGS A;  1MH3 A;  2BHZ A;  2CW8 A;  1TWF J;  2VJ5 A;  3BPX A;  1MBJ A;  3DTE A;  2K86 A;  4Y7N J;  2ADU A;  1EH6 A;  3QOD A;  1NG6 A;  3L2W A;  2IGO A;  4XL9 A;  1YYV A;  2QSH X;  1ETY A;  3HOW J;  1MBF A;  1TWA J;  3CMM A;  2L9N A;  4BL0 B;  3G1M A;  5E17 F;  1M1E B;  3K1N A;  1EJ9 A;  2WY8 Q;  3BZK A;  2BVM A;  2QYO A;  4A3B J;  3LSM A;  5ICE A;  3IH3 A;  2JZY A;  3TDZ C;  3C18 A;  3CMA I;  4ZDL A;  2QA4 I;  2Q2E B;  4E7Z A;  4ON0 A;  2OJE D;  5CLS A;  1VQN I;  1T56 A;  2P4W A;  1PYV A;  4PGH A;  3LOC A;  4Q48 A;  2FNP A;  4N9H A;  1A6I A;  2EZL A;  2M0M A;  4L18 B;  5E1X A;  3QP6 A;  1ZR4 A;  4R8H A;  2BV6 A;  1QGP A;  5EGO A;  3CD6 I;  4EQQ A;  1VQ8 I;  1DP3 A;  1OPC A;  1FYL A;  1ZG5 A;  1HOM A;  3PO3 J;  1YQA A;  2K3F A;  4F91 B;  1B1B A;  3OR1 C;  3G1O A;  4IHT A;  3IRR A;  2R7W A;  4KJZ A;  1KYZ A;  4LMY A;  4BE1 A;  2FXA A;  4ENM A;  1IN8 A;  2ECC A;  2VLA A;  1ZGW A;  1T0F C;  2DMP A;  2Q1Z B;  3JRE A;  2PLY A;  3K4L A;  4JBA A;  4QSH A;  4OIQ F;  1JKO C;  3D5L A;  2IA0 A;  1PUF A;  1XDU A;  4RM2 A;  1X3U A;  3I55 I;  1ACI A;  5HS7 A;  4IZZ A;  1Y0N A;  1APL C;  2HZT A;  5F6F A;  1WWX A;  4XLH A;  1W4M A;  1XC5 A;  3M8E A;  1E2X A;  5D8L B;  3Q0V A;  2XKP A;  3N05 A;  5DUI A;  2DYS H;  1UB9 A;  3KX2 A;  2W85 A;  1TWH J;  1WQ2 A;  2XV4 S;  3I5U A;  2VBZ A;  4RA2 A;  2N8G A;  5E79 C;  5FLM J;  1YO5 C;  1IV6 A;  3CF5 F;  3GF2 A;  2P5V A;  1BC8 C;  2XGE A;  2M0C A;  3T5X A;  2BBY A;  1YIO A;  1OCC H;  3GTQ J;  5KHD A;  2GM4 A;  3JSO A;  1D0X A;  2ZBK A;  2H8W A;  1BR2 A;  4ANJ A;  3G2B A;  2P7V B;  1S72 I;  4FCY A;  2WV1 A;  5CYV A;  3HRS A;  3E1S A;  1UCR A;  5C3E J;  5TGT A;  3MVP A;  4XLC A;  2LRD A;  4P5O A;  2DCE A;  2UUZ A;  3CP2 A;  4L9V A;  3DTI A;  1ZGA A;  2JT1 A;  3HM5 A;  1F4K A;  1DPR A;  3L09 A;  3RDI A;  1E17 A;  2E7W A;  2VC1 A;  3PFY A;  4PK4 A;  2ZNZ A;  3CDH A;  1U5T B;  1U9N A;  1Z67 A;  3M07 A;  4A3E J;  2KPM A;  4IHS A;  3L1P A;  4U0Y A;  2FML A;  2RNG A;  1BR4 A;  4BQN A;  1MDM B;  1S7O A;  3VYU B;  2VPL A;  2FUG 2;  3CP8 A;  4AYB N;  3NAU A;  2JA7 J;  2A07 F;  4A3J J;  1GT0 C;  4HNT A;  3LSP A;  3AL0 C;  4JOM A;  2KL4 A;  1S8N A;  2YR2 A;  2DA5 A;  4M9S A;  3B73 A;  5FB2 A;  3UR3 C;  4XRS G;  3BR5 A;  3AFH A;  4ZZL A;  3UKG A;  2CQX A;  1Z77 A;  2IAI A;  1WJF A;  1XSX A;  1BI0 A;  4BXF A;  2HKO A; 
#chains in the Genus database with same CATH homology
 4ITV A;  3MD2 A;  3K70 C;  2HU9 A;  3PL8 A;  1SAU A;  3FHN A;  3I3L A;  2X1E A;  3H35 A;  4BAC A;  1DQU A;  4Y33 A;  4B43 A;  2K9M A;  1NG7 A;  2Y0S A;  2P0W A;  4E7S A;  3NWT A;  2E60 A;  3C2H A;  3PJR A;  2XAU A;  3HKZ A;  3OR2 C;  3OIQ A;  2IXS A;  4F92 B;  2HNH A;  3HPG A;  4CZC A;  4C2U A;  3OS0 A;  2IGN A;  4ZTF A;  4BJ5 C;  4EAT A;  2X1D A;  3BG7 A;  2KHM A;  5HOO A;  3HOT A;  3IAS 2;  1MNE A;  3SEZ A;  2MD0 A;  3C2G A;  3EUA A;  2CW7 A;  1AA7 A;  1Y56 A;  3H5R A;  4IQ4 A;  3OMY A;  2JA2 A;  3KYL A;  1Z3Y A;  3DU5 A;  1LFP A;  4U7B A;  5HNH A;  3IP4 B;  3VDX A;  5LD2 C;  1LKX A;  5HLT A;  3ZQQ A;  4E7H A;  3W2A A;  3W2V A;  3ZRG A;  2WA0 A;  1IRX A;  1MMG A;  2WAE A;  2R7U A;  4C30 A;  4C9Y A;  5CPR B;  3H5A A;  2VIX A;  4U87 A;  2JVH A;  1X4P A;  3A4C A;  3MKW B;  2R7X A;  4RLQ A;  2HQA A;  2K9L A;  3L2U A;  4CUG A;  4PJN A;  3OYL A;  3BCB A;  1P9Q C;  2A5W A;  3CZ6 A;  4NQW B;  4CCO A;  3FDY A;  3S3N A;  3FKJ A;  4XOP A;  4PFO A;  4XOR A;  4AYB A;  2AQE A;  2XF7 A;  2BW3 A;  3K4K A;  2QKM B;  2ZSH B;  4AU7 A;  3A2K A;  3LFU A;  4XON A;  2OC6 A;  4YRV A;  4NC7 A;  3I9V 2;  1JI8 A;  1MMA A;  2Z16 A;  1D1C A;  4XLA A;  3MKZ A;  3OYM A;  2WAQ A;  1D0Z A;  1Z7L A;  1N77 A;  4RLF A;  3AKZ A;  4OAZ A;  4HST A;  2HDW A;  3VSK A;  4D9J A;  4ZDO A;  3EUH C;  4CCJ A;  4E7J A;  1N75 A;  5CQE A;  1MMN A;  2LH9 A;  1T95 A;  2NOJ B;  5KNL A;  3UNG C;  2XSJ C;  2L5Q A;  4CA0 A;  3L2V A;  5LFA A;  4QPO A;  2V4J C;  4ZDP A;  4E7I A;  2VJJ A;  3L2Q A;  2HPI A;  1FMW A;  1QHG A;  2M3A A;  3K6G A;  3M8J A;  1LVK A;  2WB1 A;  4HPQ A;  4IX7 A;  2GOX B;  4BU2 A;  4QPQ A;  2KLO A;  3OOU A;  4H4K C;  3W3C A;  2LBF B;  4E7K A;  2LY2 A;  3HPH A;  4XKC A;  2BVL A;  3OYB A;  2VXD A;  2DOA A;  1G8X A;  3ZCO A;  4X0G A;  1V5E A;  3VYT B;  1YX5 A;  3L2R A;  4BDZ A;  3LSK A;  2F6C A;  3CF2 A;  2W82 A;  4CSW A;  4GRI A;  2X6Y A;  3RCO A;  1TZL A;  4OWR B;  1X1B A;  2LOO A;  2CV0 A;  3RSN A;  2E1M C;  3OS2 A;  3VSL A;  2M4G A;  4PJL A;  2IS2 A;  4HNU A;  3H0D A;  1EA3 A;  4XMY A;  4BE2 A;  3DPT A;  2KRH A;  3AL0 B;  3OYE A;  3DKY A;  3S8P A;  1K6Y A;  3ZGK A;  3K70 D;  3K4B A;  3S3M A;  3DWL E;  4ZYA A;  3SDB A;  3EPZ A;  3PSI A;  4RMN A;  3IAM 2;  2V6E A;  4KT6 A;  3S32 A;  3K4J A;  2R7R A;  4N4N B;  3CES A;  2W4S A;  1J09 A;  3VWB A;  2DT7 B;  2ELJ A;  2JSP A;  3MMY B;  4II2 A;  3OYD A;  4F52 A;  4BE0 A;  4B47 A;  2VJ4 A;  4XM3 A;  1S9H A;  2JVG A;  2R7T A;  1TT0 A;  1WJA A;  5KCM A;  2E5N A;  3RTR A;  2PJR B;  2HVR A;  3VYR B;  2W1O A;  4LIV A;  1PJR A;  2V26 A;  3FBI B;  4JQF A;  4FET A;  4J01 A;  2F4I A;  1X4O A;  3OYC A;  2HZD A;  4BQQ A;  3LL7 A;  2IS1 A;  2K5C A;  4E4H A;  3D5S C;  2WAF A;  4NC8 A;  3PNY A;  2JUG A;  4PSW A;  2LRE A;  5FRN A;  2RRE A;  3HG9 A;  4B44 A;  3OL4 A;  3OIP A;  3SYT A;  2IGM A;  2VAS A;  4XQF A;  3BC8 A;  2GOM A;  1MMD A;  5HVQ C;  4HRI A;  2F5V A;  4IKF A;  2Z1D A;  5HNF A;  1W36 C;  3DPL C;  2X51 A;  3LSH A;  3TMO A;  2X1C A;  3OYH A;  1QHH D;  2VL8 A;  4CH7 A;  4KIT B;  4D1Q A;  4CCK A;  2VQH A;  3OYF A;  4LG3 A;  2A6T A;  3DU6 A;  3OWT A;  4DBR A;  1Z21 A;  1X1C A;  2LBF A;  2X6W A;  3PSF A;  4BEH B;  2VKH A;  3DQV C;  3QYB A;  3CJR B;  3OYJ A;  1SFK A;  1WJB A;  1WJD A;  2BOL A;  1UAA A;  4BDY A;  1OR7 C;  1MND A;  4ZTJ A;  4NNJ A;  4YEL A;  5CQG A;  1WJ5 A;  2CV1 A;  4XNF A;  2RQQ A;  2ZXI A;  3BG6 A;  4F93 B;  2QKL B;  1QU3 A;  3DTK A;  4OAY A;  4LIU A;  2KQR A;  4E7L A;  3D5R C;  4DGW B;  3DEE A;  2R7V A;  2Z2S B;  4R79 A;  3VYS B;  2CMP A;  2ZXH A;  2L7K A;  1V5G A;  1FMV A;  1ZEL A;  2R7Q A;  1V5F A;  3ZXS A;  1KON A;  1ERD A;  1D1A A;  4XN0 A;  2KMU A;  3E0J B;  2ZFU A;  1UG0 A;  3NWS A;  3S93 A;  3BLY A;  4HSR A;  3S3O A;  1D1B A;  2CUJ A;  2W7N A;  1R6R A;  3HXL A;  2MAB A;  1UEL B;  4FAS D;  4XLE A;  3TL4 X;  1YX3 A;  1DGW Y;  4PSX A;  2VB6 A;  2E1M B;  2PJR A;  3QYE A;  2L9S A;  3H5N A;  3CJQ B;  4DJA A;  2V9K A;  2PMZ A;  4F55 A;  1E0E A;  4ZJZ A;  3OYK A;  3LMM A;  1G59 A;  3KEY A;  2V7F A;  3DKX A;  2DT6 A;  2UWM A;  1BOB A;  4CCM A;  4XKW A;  4G6T B;  4J00 A;  3ONQ A;  2KP6 A;  2VQG A;  2VXZ A;  4DOZ A;  2X85 A;  2AQF A;  2MC4 A;  3PNV A;  4DIQ A;  1Y6I A;  2M4K A;  3IUO A;  4BS9 A;  2KRC A;  4II3 A;  1WJC A;  2CW8 A;  2VJ5 A;  2HVQ A;  3DTE A;  2IS6 A;  1YE9 A;  4C2T A;  2KDO A;  3W2W A;  1BR1 A;  3QOD A;  3LSI A;  1NG6 A;  3L2W A;  2KZV A;  2IGO A;  2M7A A;  4XL9 A;  4CCN A;  4BL0 B;  3CMM A;  2L9N A;  2OV7 A;  4BGD A;  2WY8 Q;  2CFO A;  4DBQ A;  2MYS A;  2LYC A;  1U0J A;  4XLF A;  2BVM A;  3QOE A;  3M1C A;  2L2O A;  1X1D A;  3LSM A;  5FRO A;  4XR6 A;  4BEH A;  4XOT A;  4ZDL A;  3V42 A;  2Q2E B;  4E7Z A;  3F9K A;  1MW7 A;  4Y4R A;  1PYV A;  4PUS A;  4PFP A;  1X19 A;  2CUZ A;  2ZSI B;  2XF6 A;  1W36 D;  2M0M A;  4N4O B;  1DP3 A;  3LSG A;  2VKD A;  4F91 B;  1D0Y A;  2LG4 A;  3OR1 C;  4BJ6 C;  3OYA A;  1N78 A;  3MKY B;  2VJI A;  4HG2 A;  2R7W A;  2R7S A;  2XDV A;  4KJZ A;  3DLA A;  4BE1 A;  2VLA A;  1T0F C;  2Q1Z B;  2R4G A;  5CKT A;  2MFZ A;  3K4L A;  4XKV A;  3OYG A;  4RM3 A;  2X6X A;  4PJM A;  4XKB A;  3D5L A;  3EUK L;  4F3Q A;  4RM2 A;  2XC7 A;  4IZZ A;  2WBM A;  2LC2 A;  2UV1 A;  4E6K G;  1VZ0 A;  1WJE A;  2VQC A;  4XLH A;  4XN3 A;  2CH0 A;  3HUG B;  2DXI A;  2LY1 A;  3ZR8 X;  2VQL A;  2M7B A;  4NUB A;  3N05 A;  3J7A Y;  3PUB A;  3SEQ A;  3KX2 A;  1DGR M;  2IGK A;  1GLN A;  4AVZ A;  4LIT A;  4Y3O A;  4ZC3 A;  2WAD A;  3OYI A;  3K4C A;  2W00 A;  3HC7 A;  3OY9 A;  3OYN A;  2WY7 Q;  4BQO A;  2HVS A;  3U21 A;  5KHD A;  3BCA A;  1D0X A;  1HA8 A;  3RPU D;  3H9G A;  1BR2 A;  3FBN B;  3G2B A;  4ANJ A;  4CCL A;  2HPM A;  3SZG A;  4P1W A;  4HEA 2;  3E1S A;  4KIS A;  4B48 A;  3H9J A;  5TGT A;  3TBI A;  4XLC A;  2LRD A;  4P5O A;  3GBG A;  2IS4 A;  2DCE A;  2UUZ A;  3CP2 A;  4BUP A;  3DTI A;  2BW3 B;  3A1Y A;  3PFY A;  4PK4 A;  5JHF A;  2DJI A;  3OS1 A;  2V1N A;  2CV2 A;  2KPM A;  2R7O A;  3HOS A;  4PJJ A;  2RNG A;  3K10 A;  1BR4 A;  4BQN A;  3VYU B;  4B3X A;  2I8D A;  2VPL A;  3RQ4 A;  3OL3 A;  1Z3X A;  2FUG 2;  3CP8 A;  3PNT A;  2CS3 A;  4MLO A;  1OLT A;  4HNT A;  4YEJ A;  3AL0 C;  5FRM A;  4IQJ A;  4JOM A;  3DPU A;  3K4N A;  3HL2 A;  2KL4 A;  1X1A A;  3H9Q A;  4BJT A;  3QYF A;  3UR3 C;  2E5Z A;  3AFH A;  2OUM A;  2O5R A;  1LDK B;  1WJF A;  4BXF A;  2K3P A;  1WFX A;  2XF5 A;  3K4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...