3ZGKA

Nmr solution structure of the rxlr effector avr3a11 from phytophthora capsici
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
GPGLTDLFKTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords AVR3A11
publication title NMR Solution Structure of the Avr3A11 from Phytophthora Capsi
rcsb
source organism Phytophthora capsici
total genus 24
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2012-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zgkA00
3ZR8X 2LC2A 3ZGKA
chains in the Genus database with same CATH superfamily
2OF7A 3TQNA 1HW5A 2HDDA 3PUBA 3DLLF 4IKFA 2DQLA 1VF9A 5LFAA 5FRNA 1SFOJ 2LMDA 4DGWB 1AKHA 2Q8KA 2HQNA 1B9NA 5E1XA 2FEZA 2X1EA 1EKEA 2EV0A 3BY6A 4KUMA 5IOZA 1OCTC 4IHVA 2ETHA 2YU9J 2ESNA 4A3IJ 3KE2A 4B3XA 4DOZA 1E3PA 4IHTA 3OSGA 4CO8A 1XDSA 3QYBA 3BC8A 1OFCX 3SDGA 3BR5A 1RNLA 3H3ZA 2CV2A 1Y8QB 3PFYA 1JTYA 4LMYA 3I3LA 2W57A 2ZO4A 5E8IA 1CQTA 2ZFUA 4XRFA 1LJ9A 4XMYA 2UUZA 5EEAA 3WTSC 4A3GJ 4JP0A 2FXAA 2JA7J 4UUVA 2MABA 5J8FA 4W1UA 4U88A 3GTGJ 3CCSI 1MDMA 2GXGA 4ZTFA 2HOSA 3HOYJ 5LGNA 3MFKA 1GVDA 3U2RA 1O7LA 1WPKA 5DCMA 4E7KA 3N97A 1BI1A 3IKVA 5GTHC 4C2TA 4YFNF 1Y0UA 2X4HA 2F5DA 3GEZA 1UFMA 3PQKA 3IWZA 3ECHA 4I76A 5FLXZ 4YEJA 3RSNA 3RYPA 4BGDA 2EJRA 3RKXA 3FBIB 2H94A 3DEWA 1EV7A 2VE9A 1HW1A 3VSKA 1JKOC 4XOTA 4DYCA 2KDZA 1T98A 2MH2A 4GDFA 4LG0B 5K7HA 2JPCA 4I0BA 4S04A 4B1RA 3LQRA 2H1LA 1QVUA 1ZKGA 5KCMA 1BW6A 2PJRA 4HSRA 2K86A 4RAYA 4IHSA 5CYVA 1WQ2A 1TQMA 3GZ5A 3T8TA 3A01A 1BA5A 2H6BA 5DD8A 3QYFA 1TZLA 1POGA 4M9SA 3M7GA 1OCCH 3DPTA 3HEFA 3OYKA 3BG9A 4A5NA 5FKMA 3S2DJ 1JGSA 3F3XA 2KLOA 5BQTA 2LY1A 1BM9A 4UXNA 2RN7A 2K9QA 3J7ZI 2OA4A 1K6YA 2R7WA 2CJJA 3KZYA 1T0FC 4IQ4A 2P6SA 1HKSA 3KLOA 2YSRA 3A02A 4LJZF 4FISA 5DD4A 4E7ZA 5E20A 1O3TA 1MMSA 2RQPA 4L5JA 4EQQA 4RDUA 5ILSA 2F5VA 1FIAA 4GFBA 4BHPA 3WTWC 4KNYA 2CQKA 4RB0A 4ENJA 3IHUA 3BG3A 2WAFA 4CYCA 1QVTA 4M3EA 5FD5A 3HOUJ 4BYYA 2MLKA 3AL0C 2WV1A 4ASNA 3JW4A 3WE2A 3CMEI 2VE8A 2LH9A 3LSRA 2BE5F 4XRSG 2XV4S 5BNGA 3RKQA 4F52A 2QLZA 2HOTA 3ZXSA 1Y6IA 3IP4B 2IS4A 2L02A 2UV1A 2ZXHA 2LYCA 4XLAA 3KFWX 4BQAA 3PIPF 1TTYA 1PUFB 2ME0A 2ZSIB 2UXXA 4L5IA 1QRYA 2MC4A 4D7MA 3BP8A 4M3FA 3VSLA 1W0TA 4V19K 2NAZA 2DODA 1Y39A 4BXFA 2W24A 5HDKA 5EGOB 3ZQCA 3EETA 3T8RA 2OQRA 3CZ6A 3LFKA 1W7PB 2OPTA 4K2EA 5D6FA 2VODA 1LQ1A 2P81A 4LIVA 1RPWA 3COAC 3WHBA 4F7ZA 2K5CA 1X1AA 3R6SA 4DBRA 2ME6A 3HPHA 1WGXA 2LKPA 2H27A 3CJRB 2L54A 4OIRF 2KIMA 2VJ5A 4PK4A 4D5CA 4WXDA 2XAGA 1MGTA 1F1ZA 4LK1F 2E36A 1UCRA 1W0UA 3OY9A 2QSHX 4OINF 1ZHFA 1FTZA 3ASOH 3CTAA 3U1KA 2O61A 3OMYA 4CZZA 2DCEA 2V9PA 1PP7U 4XKWA 1XCBA 2IAIA 5E1WA 3PO2J 4KJZA 4UNOA 3MZYA 1T2KA 2F48A 2W00A 2H8RA 1HQCA 3SYTA 1I3QJ 2VQHA 1KYWA 4KICA 3CQZJ 3F9KA 2CUFA 3C1DA 1R49A 3I71A 3GMEA 1BOBA 4I99C 4CCMA 1ODDA 4UUSB 2DAOA 1XMAA 1Y8RB 3ZN1A 4NBQA 4N9IA 4HQEA 1BJZA 2P5KA 4DJAA 3MQ0A 3K69A 1B8IA 4RGUA 4MFEA 3AG3H 4BDZA 5KK1A 2I5UA 1K78A 2QVOA 3GVAA 1I1SA 1NK2P 1OR7C 4A3DJ 3S93A 3V7RA 1KU3A 4E7IA 2E1CA 1OCRH 4A2UA 1MH4A 4CDGA 2ACJA 2UZKA 1ONVA 2JRTA 3B6CA 1JHHA 3L2VA 2ELJA 2QQAA 3HC7A 2NVUB 1VNDA 1G3WA 3VODA 1X4OA 2XVCA 2VT3A 4PSWA 3HTUA 4M3BA 5JI6A 2FBHA 4LITA 5EDNA 4XL9A 1ZR4A 2CH0A 2IEKA 3OYFA 1FMVA 2H6CA 2Z2SB 1W4MA 1GV5A 3JR9A 1GHCA 4BQQA 3CCRI 3E5QA 1ENHA 4XLNF 3B73A 1Y1WJ 3FMQA 2EPFA 4P96A 2MYSA 2M2EA 3ZQQA 5HDNA 3DLAA 5CQGA 1J7KA 1YS7A 2LRDA 3WE3A 3CJNA 1T08B 2L9SA 3OS0A 3CCMI 4LLNA 2EIKH 2CV1A 4Z6YA 1B59A 4I0AA 4D5FA 4RB2C 2E7WA 2H1KA 4Q5SF 1PVEA 2PX9A 4EJTA 2Q1ZB 4OWRB 2UXNA 2DYRH 1GLNA 3BCBA 2CQ7A 5B5EC 5ICCA 2ADUA 1LNWA 3DFGA 2IS1A 1GXPA 3DP7A 2FRHA 3W6VA 1Q1VA 4HG2A 4C30A 2W85A 4QIWN 2IVMA 1WJ5A 2M7BA 1NTCA 2ISYA 4F55A 2QBYB 3GTKJ 2XC7A 2E1MC 2LDUA 2GBYA 3IKTA 3LQQA 4YIRX 2FBIA 4BE2A 2XGDA 3TGNA 1K83J 1QO0D 3MKWB 1ITYA 3DF8A 1I1GA 1TW2A 1Q1HA 2Z5UA 3CP2A 1UHSA 2PI0A 1DU6A 2CQXA 3GX4X 1O4XA 1DPUA 3KP5A 2CQQA 1P6RA 2WB1N 3E0JB 3IAM2 5CVIA 1CF7B 3D5SC 1SAUA 1SD4A 3L09A 5DCFA 3L1PA 3E6MA 1MW7A 4M6VA 5CKTA 4NHJA 2R7QA 5D5UB 2EB7A 1J9IA 1XGOA 1EH8A 4HDVA 2DK5A 3K7AJ 2HZTA 2Q0OA 1XMKA 3J81Z 1F5TA 2KIFA 2B63J 5F1RA 5K5OA 3LOCA 5A2QK 5HODA 4HF2A 1S9HA 1SVOA 2UWMA 2GQQA 2HDCA 2V9VA 2WAEA 4J19A 1MDMB 5IP6A 3I4NJ 5JLXA 3HHGA 1Y1VJ 1XN7A 3FXQA 5J6XA 2DQRA 2AO9A 4A6EA 5DCMB 4PZJA 4OIOF 5HS8A 1R1TA 1XSXA 5H2FC 2B7EA 1RESA 1ZQ3P 1YW8A 3RI4A 3EUKL 1VQ5I 3FZVA 5ILVA 1J75A 4KMUX 3M07A 2O5RA 4QLCU 2WC2A 1VTNC 1R5ID 1UMQA 1YTYA 4O5VA 4I01A 2QENA 3KP7A 3KCCA 1J0RA 4LG0A 3PNTA 1D5YA 2EIMH 4A0ZA 2G7HA 1UHWA 2RVCA 4B44A 3G4SI 2LY9A 2XPVA 3TP3A 2Z33A 3K1NA 5K1YA 3E97A 1W36D 5D6EA 3GTMJ 2FNAA 2W25A 3EQLF 3HZJA 4XRMA 4RB3C 2Z16A 4FHTA 4XKVA 3LA3A 2JK3A 1VQ6I 3OS2A 2WY7Q 4PFPA 5M3MJ 5D5WB 2NVXJ 1QPMA 4G9YA 3IAS2 3RKWA 4XKBA 2LD5A 2NVQJ 1T8IA 3DU5A 4EJUA 3D5LA 3CLOA 2ID6A 4EM2A 4E7SA 3DKWA 3BWGA 2X6OA 1YX5A 2IW5A 4UB6C 1B4AA 4LG3A 4DQ2A 4XOPA 2VOPA 2DT7B 3BZCA 4CYDA 4A12A 1R4MB 3OYBA 1YFHA 1BI3A 1ETKA 5FD6A 3J80K 3HOWJ 2EBIA 4MEYF 2DA1A 1ON1A 4M72A 3QRFF 4GCVA 1R4NB 1S5LC 1H9TA 4KIGA 4BH9A 1D5VA 4BDYA 2CW8A 1ACIA 2R5ZB 5JHFA 5FKLA 4CYCB 1UZCA 2QF7A 2QSFX 3GZNB 2GIZA 4DW6A 3I58A 3OYCA 2L2OA 2BY1A 3FM5A 4A93J 5IT9K 2CUJA 1AA7A 3H35A 3VEPA 3S1RJ 1BI2A 1OJLA 2LVSA 4YELA 2B9SA 2IXSA 4OOIA 2FQ4A 2HEOA 4IHWA 1TWHJ 2E2IJ 1D1CA 1XTAA 2M4GA 2BBYA 1PUFA 3LA7A 2A5WA 2HGCA 2IP2A 2TDXA 4LB6B 1GUUA 4M74A 5GAGJ 1YJNI 1SEUA 1E3HA 1VQNI 3HOTA 4X0GA 4KFCA 2BXZA 4NC7A 2XHKA 1D8JA 2OAZA 5KAIC 5EGOA 1UELB 1IV6A 2V7FA 2DXIA 4XN0A 2DTRA 1UJ8A 2L9NA 3SFIA 1X2NA 1RETA 1RR7A 4RM3A 1W7PA 5H6QA 3DBRB 1VI0A 3KZZA 2K9MA 2GA1A 2K3PA 1BC7C 3BJ6A 2E35A 5HLGA 4JX5A 1XD7A 2KZVA 1Z05A 3QPTA 5GP9A 1P92A 3JRHA 3F6OA 3Q0WA 1GXQA 3LSPA 1X58A 3DWLE 1T56A 3CCLI 1S7OA 1TNSA 2FUG2 3QP6A 3SZGA 1V54H 5HVQC 3L2UA 1P4AA 1H0MA 1S8NA 1K4SA 1I5ZA 2BV6A 3F8BA 1A31A 3FHNA 1VQ7I 3FX3A 5ICEA 4A3LJ 1JI8A 1OCOH 1X3ZB 2F6CA 2W48A 3CMAI 1QHGA 2E5NA 3GUDA 5B3SH 3FXUA 2O8KA 5TISC 4B43A 2CV0A 3NEUA 3BR3A 5FLVA 2MFZA 1Z0XA 4IL6C 2NNYA 2WAQN 4XONA 4A69C 1ZLJA 3H9QA 4UUSA 2X48A 3C2BA 2R7OA 2G0EA 4II2A 2HQ5A 5F04A 1R1UA 2ZXIA 1OYYA 3RCOA 1VQ4I 5L3DA 3P9KA 3R0AA 1WSUA 4XM3A 3M1EA 1J5YA 2M5WA 4RGRA 1CGPA 3G1MA 5F1JA 2VKHA 2MD0A 2KRFA 4L9JA 1F9NA 3M8JA 2R7SA 2OZ6A 2HXOA 1YG2A 3A1YA 3BROA 1X1PA 2GZWA 1IJWC 1W36C 2EINH 5H6RA 2QEXI 3S17J 4HX4A 1MMDA 1Z7LA 2IS6A 3GCMA 4HNVA 4QSHA 4DIQA 2FX0A 2R4GA 1ORKA 1HKQA 2KISA 3ISPA 1U5TB 2KDOA 2XKOA 2C6YA 4ETSA 1L0OC 2ZMEB 1ZLKA 2JRMA 3UR3C 1BR4A 3GLXA 2P6TA 3EYYA 1H89C 5BS6A 1FTTA 4R1HA 3CCVI 2EK5A 5D5VB 4XICA 2AQFA 1PUEE 1YQAA 3CP8A 4MQ9F 3JRGA 3A4CA 3CD6I 1OISA 2R3SA 2DMTA 2M8EA 3HKZA 2LNBA 3K1PA 3X2QH 3GYHX 5FFZA 1KZHA 5IYDJ 4RA2A 4ANJA 1SANA 1V4RA 5J3LA 1ZREA 1VQKI 4BL0B 1WHUA 4S0HB 4KT6A 2ELKA 3LSTA 4MIMA 1A5JA 3HM5A 1N77A 1R6RA 4CA0A 3OYLA 3TO7A 2WTEA 4ZDLA 3DEEA 3K4MA 3FXOA 3KPHA 3G6EI 2IGMA 4RAGA 1NG7A 2BXYA 2DOFA 2VXZA 2W4SA 3H9GA 2KKOA 2Y75A 4C2MJ 4FASD 1MZBA 2V1NA 1IN7A 4EMSA 2KRHA 3JAMK 2XF6A 4YFXF 1VZ0A 1BC8C 2QBYA 2ECBA 2X9DA 1W7PD 2F5FA 3GFJA 3M9AA 4E70A 2QUFA 5E18F 4FCYA 3M3YJ 1XGMA 2FMYA 5AIPA 3ELKA 4RLFA 3CF5F 4ZDOA 5IP9J 3ZGKA 1QNTA 4BE1A 4BS9A 4C3IJ 3HYIA 1BOAA 3DV8A 4G6QA 4CGZA 3PNVA 1FOXA 5GPCA 3J81K 5M5WJ 2OC6A 1X3WB 3QQAA 4X1EA 2V79A 3D0SA 1LFUP 3KZIC 1CF7A 3Q0VA 3H3VK 1FOYA 2XF5A 2QYOA 3W6JB 4YIIA 3ZQLA 1S6LA 2D45A 4NNJA 5J4VA 3KP2A 1QA6A 3NARA 2VIXA 3HB9A 4XR6A 2KQRA 1REPC 1I50J 2GXBA 1YS6A 2PLYA 4KMFA 2HR3A 2Y30A 5GAEJ 1BR2A 1IG7A 4ZZLA 4RGXA 5ERIA 5H20A 4IHXA 2DA5A 4G94A 3ZQFA 4Y4RA 2R7DA 3RPUA 1TBXA 3OIQA 4XQFA 1U8BA 4V2GA 1B1BA 1FSEA 3ABLH 3FMSA 3PO3J 2JZYA 3CMMA 4NQWB 3S3MA 5M5YJ 1HDDC 3MMYB 2XAHA 1ETYA 1MNMC 1FIPA 1V3FA 4F93B 1WWXA 2EZHA 4MEXF 4DZPA 2GWRA 5A2QZ 4WF2A 1I6HJ 3Q3SA 2QCOA 2DO7A 3I55I 2XB0X 3DEUA 2LLKA 3MWMA 2NXNB 1MJBA 5E3LA 4IO9F 1ETVA 1X2MA 2M30A 4ZYDA 1A36A 3S16J 1NHAA 2E7XA 1ZRDA 4X6AJ 1IN8A 1V55H 1WI3A 3OWTA 4V2FA 2E2JJ 2RAEA 3F8FA 4EGYA 3HXLA 1X3UA 4HLYA 3ZCOA 3BTIA 4KIFA 3K4JA 1BR1A 2FMLA 2IGOA 3JTGA 1FEXA 4KDPA 1HCRA 3K1MA 2RKHA 3L2WA 2STTA 2FBKA 2QQ9A 2X6XA 1TWFJ 1JHFA 4MTDA 5DYMA 2ZKZA 2EFWA 5JVTA 5B1AH 2CU7A 3I4MJ 4XK4A 3W2WA 2TRTA 3TDZC 4CCLA 1APLC 4BUPA 1S7EA 3LSHA 2ZNZA 2JN6A 5DUKA 3TW7A 3FK7A 3KYCB 4I2OA 2RV8A 4NC6A 1B6AA 4FT8A 3L2CA 4HRIA 2PJPA 2GIVA 2VUMJ 4IF4A 3BJOA 1BIBA 1P7IA 1Y0NA 1U9OA 2VQCA 1R5HA 4NB5A 4D7NA 3LL7A 2VKEA 1IXRC 3PFIA 1USTA 4MHGA 1AOYA 3OIOA 3HGGA 4HYEA 4J01A 2R5ZA 2FOKA 2EZIA 1FZPB 1MJ9A 3K4LA 2KJCA 2ZFWA 2L7FP 1EA3A 1ZELA 3DPLC 3EUAA 1X1CA 3J80Z 4IOAF 1OYIA 1G59A 2CW0F 2HPMA 4PJNA 3B02A 1ETWA 4QWQA 2V6CA 1IN4A 5LHIA 2JPBA 1XGSA 2OQGA 2DJNA 3I4PA 3O2PE 5LGTA 3HRMA 2IS2A 2EA2A 2OUMA 3ZPLA 4HX8A 2HYGD 5D8LB 5E3NA 1OPCA 2LK2A 2LY2A 4A3BJ 3FKJA 2OU2A 2D1HA 4YFKF 4L9NA 4PDKA 3WTTC 1ZGWA 1V5FA 5DDGA 5IT9Z 2V1XA 4G6TB 4XORA 3SEZA 3VB2A 2DK8A 5E1ZB 5K5RA 1Z3YA 1LPQA 3SZPA 1W5TA 2AXTC 4HF0A 2LFBA 2CYYA 2KP6A 4HBLA 3ZQHA 3QOPA 4PJ0C 2XUBA 3E6DA 2STWA 5B1BH 1ZH5A 5LRRA 1OCZH 2FD5A 2P8TA 3I64A 2JA5J 1SFUA 2QKLB 4OIPF 3LSJA 4CXFA 3CCUI 3HIFA 1S72I 2HPIA 2DMPA 4JX4A 1G3TA 1MD0A 1N75A 5DV5A 3OYAA 5CVRA 1IXCA 3CCEI 1FYKA 1IO2A 3K2ZA 3HHHA 2YX4A 2HXIA 4U0WA 2VC1A 3M8EA 1JT0A 3VYRB 5HNFA 1HOMA 3RPUD 1USSA 2EZKA 4UV8A 1YITI 3CDIA 4LFUA 4OMYA 2L4MA 4KA4A 2NS8A 5IP7J 2J5PA 1WJEA 3I9V2 5JLWA 3LNQA 2EH3A 2O7OA 5DM6F 5LD2C 2HI3A 1RIOH 1W5SA 4MQVA 3JTHA 3OOPA 3SQNA 4C3JJ 1XX5A 3JSOA 1WH7A 4EM1A 3CUQB 4PSXA 3V42A 4S05A 5FGMA 2OD5A 3F23A 4Y15A 3FXRA 5M3FJ 3PL8A 3ZQGA 3TDUC 2E5ZA 2DDAA 4CCKA 5DUIA 3RTRA 5F27A 3IH2A 1KU7A 1IRZA 1TWCJ 4XLHA 1BW5A 1RI7A 4YRVA 3ESWB 3BTCA 2XAQA 3DTKA 3QAHA 4HEA2 3QODA 2VOOA 4LIUA 2YU3A 4LGWA 2EZLA 3ZR8X 5C44J 1J59A 2DFIA 1GDTA 3W2AA 3RIRA 4EJVA 4BBSJ 9ANTA 2B0LA 2XRLA 1WH5A 1U5TA 4IOCF 1X19A 2R7FA 4A3MJ 5J1RA 4XRSA 1YIOA 2ZMEA 4HOBA 2DMQA 1XS9A 1GVJA 2DA3A 4BKXA 2GOXB 4G12A 4C3HJ 1A04A 1WVRA 5E79C 4XN3A 4P9FA 4PGGA 5EG0B 2RC4A 4KISA 2A6EF 2PBIA 2L7KA 3JCUC 1HLVA 1XGNA 3G1LA 3JREA 5FO5A 1SFKA 1XCVA 2H09A 1JKPC 3S2HJ 1F43A 2R0QC 3E6BA 3K4KA 1FYLA 1T39A 2CGPA 3S8PA 1JT6A 1SD7A 2HU9A 3VWBA 1FBQA 3HOVJ 3IH4A 5CVVA 4A0YA 4KITB 4UUTA 4OAZA 1RRJA 4BY1J 3WGIA 4G7ZF 5JR3A 4R79A 1YI2I 4ZZDA 5LRSA 4U0VA 2E19A 1P2FA 1WKMA 2CG4A 2VBZA 5GPAA 1S3JA 2M1BA 4PGHA 2HQRA 2XASA 2XSDC 4IVNA 3KP6A 3A0HC 1ZGAA 3WTXC 4BEHB 2PQ8A 3K4NA 1LFBA 2HKXA 4JX6A 1WZ2A 3O8GA 5LEJA 2W7NA 2LR8A 2DFFA 1R9TJ 3NWSA 5IYCJ 2PMZN 4DBQA 5CVJA 5FKNA 4E6KG 3HRTA 4FTHA 1ZG5A 1RR8C 2PEXA 1F4KA 2ZJQF 2IGNA 2JUCA 2X6WA 3JAMZ 1K7AA 1ZYRF 3CDLA 3CC2I 2OJED 5L3EA 3I54A 1YYVA 1SVLA 4A3KJ 3HDDA 4M6XA 3HSEA 4BU2A 2XRNA 3H9JA 1D0ZA 1BIAA 4KN7X 2FE3A 2O0YA 2K9SA 3HOSA 3OYEA 2BVMA 2ZXJA 4E7LA 3HG9A 4AIDA 1OQYA 2DLLA 3J7AO 2Z1DA 3W6KB 3HTSB 3ZMSA 2M34A 2XGCA 2BW3B 2L7ZA 3OYDA 1E2XA 1KQ9A 4ZJZA 2GM4A 1IUYA 4N0BA 2XF7A 1HSJA 1MNDA 5HLTA 1TWGJ 3ABTA 3T5XA 2ECCA 4BBRJ 2CUEA 1SAXA 2IJLA 3AG1H 1OKRA 4G7HF 1D1AA 2DN0A 3RZDJ 3QP5A 2RNJA 2PMZA 3JSPA 3FXKA 2FU4A 4NQWA 1JUMA 4AVPA 1GT0C 2X6YA 3OS1A 2A69F 2XPUA 1BL0A 2GOMA 1E3OC 3PJRA 1FBSA 1MJAA 2GLOA 4PFOA 2TCTA 2XAJA 3OOUA 4BAYA 3GO5A 2WB1A 4ON0A 3LMMA 1IN5A 2ZXWH 1LDJA 2ZJRF 5M5XJ 3VPRA 3IC7A 1L3LA 1IRGA 4XSZF 1U6GA 4LK0F 1QBJA 4Y3OA 3ECOA 1MH3A 2E71A 3R60A 5D5XB 5FKKA 2BHZA 5HLHA 3L2RA 4MO7A 2A61A 2HS5A 2O6GE 3PUFA 3AG2H 3ROUA 2IPQX 3M1CA 1RUNA 1R00A 3HUGB 4Y17A 3TKYA 3TO6A 4ENKA 3Q9SA 4B8XA 4AYBN 4ZYEA 1QPIA 3EYIA 3F6VA 5J4YA 1Z77A 1XSDA 1DP3A 2RGVA 2VBYA 2Y0SN 4UHTA 3GZ6A 3HL2A 1J09A 2XIGA 1DUXC 1RZ4A 2XPWA 2NS0A 3OL3A 1TW3A 3H0DA 3KIOA 2L4AA 4U7DA 4IX7A 1N78A 1YIJI 2M8GX 5L3GA 3RQ4A 2R5YB 1WJDA 1FSHA 1UB9A 1MBEA 2HWVA 4Q4ZF 3T1BA 5DTDA 4JQFA 5J47A 2DW4A 5FKOA 4EJWA 1MMAA 2F4OB 3G3ZA 3PIOF 4UB8C 1HF0A 2DI3A 2ZBKA 4OIQF 4HLXA 1SFEA 3GTOJ 1LKXA 2KIQA 2DU9A 4OMZA 1QU3A 3BR2A 3M8FA 3MAJA 1XSVA 5FLMJ 5EEGA 4FETA 2VQGA 1J2XA 3G71I 4EVIA 4LLLA 3TEDA 3OIPA 1IGNA 5LBQA 5C4JJ 3OL4A 1DGWY 2QA4I 5BOXA 3L7WA 5KHDA 2L9VA 4ESBA 3DPUA 2Y0SA 4L9VA 4F92B 4AD9A 2V1UA 2HTJA 4E4HA 4OAYA 1ZR2A 5F0FA 2IRFG 3DQVC 1E17A 3OYIA 4F91B 4XLPF 1WRJA 4Q48A 3DKXA 2D1VA 3FF5A 3BTLA 3A2KA 1RKWA 4RM2A 1PP8F 1R71A 4EJOA 4Z2YA 3HBLA 5AIQA 3EPZA 4AM3A 2KRCA 2XDVA 4GYGA 4O6JA 2BHYA 2JA2A 2EILH 2DTZA 3WTZA 4M71A 1XG1A 4E7JA 3E3VA 2ICWG 3IL2A 3WU1B 4HW0A 3R0JA 1UG2A 3PSIA 3AFHA 3ZRGA 3WG9A 2VBXA 1HXDA 2F2EA 3E7LA 3KP4A 1UAAA 3CC7I 1KU2A 2JTVA 4HQMA 4W97A 3FXJA 2ISZA 3FM3A 1FC3A 4B4CA 1YJ9I 3I0TA 3ERMA 2O03A 4FE4A 4P9UA 1UHMA 3CJTB 3FISA 4M3DA 1LE8B 2IGKA 2MA3A 2LKSA 1I3AA 2XROA 1U8RA 2FSWA 3F21A 1IN6A 3IH3A 4ITVA 3MEXA 1JGGA 1Z9CA 3FXLA 3QPHA 4G7OF 4EATA 3ZMTA 1C0WA 2DMUA 1JTXA 4IQJA 2PMUA 3OYJA 4RB1A 3CUQA 3MKLA 4HSTA 1T33A 1KONA 3KYLA 3EDPA 5FFXA 4ZC3A 1G2HA 3BCAA 2M87A 3Q9VA 3WU2C 5E17F 1K4TA 3W3CA 4MLOA 2DOAA 3MKYB 3H3UA 3V8LA 4LOCA 2MGQA 2CO5A 3K70D 1IF1A 2E1OA 1Z91A 1D0YA 3E5XA 3VFZA 2L7MP 4Y7NJ 1Z67A 3S15J 4QPOA 1IC8A 5CVUA 1DDNA 1U5TC 4RLQA 4UV9A 1R1VA 3CCQI 2ZMEC 3HSRA 5J1YA 1PJRA 1O3QA 4ZYAA 1S29A 2V4JC 3LSIA 3WTUC 4BQOA 5IPAA 4XIDA 5ED4A 3V4GA 4R8HA 3GLLA 3ONQA 3FK6A 4BHCA 1R22A 3BR6A 5L3BA 1YO5C 3C3WA 4IEJA 4L0ZB 3EUHA 3VYSB 2A3SA 2WBMA 5EG0A 3KETA 3IRRA 3E1SA 2WAQA 1LEBA 2IA0A 4NDLA 1R58A 2HOEA 2OCCH 4ZYGA 1XPXA 3DTEA 2KMUA 2P7VB 4AVZA 2I10A 3S3OA 4D0PA 5HLIA 4QPQA 2E2HJ 2QSGX 3JRCA 4N4OB 2DA4A 3T0YA 2HTSA 3BJAA 1QHHD 4A3CJ 3F72A 1XDUA 4FX0A 1U9NA 3H5RA 1TNTA 5EEHA 1RC9A 1A35A 3DKYA 4BEHA 3BT9A 3BTJA 2HZDA 5K7FA 3TBIA 3S1QJ 2J5OA 3L9FA 2KPMA 3NWTA 1TC3C 5GAHJ 1HA8A 3KX2A 2JWTA 3ZQIA 1DGRM 3TO9A 5HS7A 5JHUA 3WTVC 2QZ8A 2XAFA 1XMXA 1H88C 2DPDA 2K02A 2L5QA 3OYGA 2VI6A 3K6GA 4PCQA 2EFOA 4XLFA 3ZOBA 5F0HA 4I98B 2VJ4A 1KA8A 3GXOA 4KYWA 2Z99A 3WU0A 3OV8A 3WODF 1FNNA 2LC2A 1JKQC 2VC0A 2Y9YA 1SFXA 3GFMA 4JYKA 1K6OA 4PUSA 4P55A 2CRGA 1SD6A 2JQ7A 2BW3A 2ID3A 4B48A 3MZ8A 4MNUA 2K40A 4HV5A 3ZQ7A 1G6NA 4PJLA 3CCJI 2P4WA 3LAPA 2DBBA 3GTPJ 2IT0A 1QQIA 3A03A 1EF4A 2N8GA 2ZNYA 3MN2A 4XKCA 3MZHA 1NG6A 2CFOA 5IYBJ 3J7AY 1HW2A 1B9MA 4EGZA 3C2GA 4IJAA 5JVGF 1HBXG 1R7JA 2OV7A 4M3GA 5J8CA 4ZYHA 5AONA 5L3CA 3QOEA 5EYRA 4HAMA 3H5NA 3FBNB 3SJMA 1MIJA 1VFCA 2DPUA 6PAXA 2LP0A 3LWFA 3U9GA 1N25A 5F08A 2NS7A 2LG4A 2CMPA 2FOWA 2P7CB 3WTYC 1S7AA 2M45A 3ABKH 3KYDB 2PN6A 2MSYA 1SVMA 2Y0MA 3VOEA 3K70C 5J1UA 1LEAA 2Q2EB 4P1WA 5EJCA 4QTRA 4ESFA 4XLCA 2JSCA 2Y31A 3E5UA 3TL4X 2R93J 3LSKA 3JRFA 2NVTJ 3HUGA 2W1OA 3GWZA 2VXDA 2VPRA 4U87A 3FWEA 4J00A 1MSFC 2O9LA 2EFQA 1FBUA 3DXJF 4CCOA 2ESHA 2LKXA 3BPVA 3OSFA 2MBFA 3FHZA 3M4OJ 2R7UA 3HRSA 4ESJA 1XC5A 3H5AA 2R7VA 1VQLI 2R5YA 3I53A 4AUXA 3CO6C 3LAJA 3HOXJ 2YR2A 1MBFA 1FWZA 1I39A 1KYZA 1TWAJ 1X1DA 1H8AC 4FE7A 3FMRA 5LGUA 4UVCA 2HFHA 1ZG3A 2KHMA 2EWNA 2Z9OA 3V7CA 3NQOA 1IZ1A 3LSGA 3ERED 3I56I 4RS8A 1ERDA 3H0GJ 3S32A 2DFHA 1VQPI 3A0BC 1T38A 4BHBA 1WI9A 4YG2F 2R92J 2KIUA 3ML6A 3K9TA 2X0LA 2XAUA 2NNNA 2BVLA 2RREA 2ZJ2A 5CLSA 3TOBA 3U1DA 1VQ8I 1ON2A 4L18B 3B6AA 5GTIC 1P9QC 1G3YA 4HA8A 4P5OA 3K2AA 1MMGA 2XKPA 3CLQA 1MSEC 2ZJPF 2VONA 2DA6A 3P5JA 2D5VA 2GXAA 4U0YA 4JOMA 3VYUB 2IA2A 4A0XA 4BJ6C 5BPDA 2R7TA 1FLIA 2DJIA 3S14J 2HVSA 3O3KA 2PMHA 1O3SA 1IUFA 2PFBA 5EZHA 3KEQA 3RYRA 3AL0B 2RQQA 1GV2A 2EV6A 4CCNA 2IBDA 3HGYA 5LHHA 1ZARA 3U21A 2CSOA 4N9HA 1G4DA 1DQUA 1VQ9I 4RAFA 3E6CC 4RGSA 3G2BA 1G8XA 4EEFG 3DU6A 1BI0A 4OU0A 4G6DA 3DBLB 2M0MA 2Y9ZA 4B09A 3TMOA 3VYTB 1MBGA 4Q47A 3S1NJ 3AAFA 2LSOA 3BZKA 4CHUA 1YLFA 3WG7H 2NRAC 2V26A 2K9NA 3JRBA 1U2WA 1LE8A 3TP0A 3BDDA 3K4CA 4I02A 1QZEA 5DS9A 5DEQA 4IRIA 3CUQC 5FROA 2BZTA 2R7ZJ 2HOAA 2OCEA 2P0WA 2KFDA 4BJTA 3S3NA 3DCFA 2BEOA 5ICGA 3P7NA 2A68F 2VKDA 1YRNA 1ZRCA 5B66C 3I59B 2FA5A 3G73A 2COMA 3L2QA 2VT2A 2HYFA 3RDIA 4L9TA 1FPQA 1XB4A 5F64A 2RNGA 2WA0A 2DA7A 2A05A 4B47A 4H0EA 1ZGJA 3BOQA 3I5UA 5HDGA 1YJWI 3IV5A 3UNGC 2K4JA 1P4WA 1YW9A 1FMWA 3GF2A 4RAZA 2DFEA 2M9HA 4DZJA 2M3AA 1NH3A 2JJ7A 1JUPA 2VL8A 1OLTA 3HOZJ 1SMTA 2Y2ZA 1ZRFA 4FQGA 1WJFA 2COBA 2JVGA 2JA8J 3QWLA 4FX4A 2CS3A 5C3EJ 2X51A 3ZP5A 3QYEA 2BOLA 5CJ9A 5LHGA 4CICA 3F0CA 1LUJB 1ZTRA 1YX3A 1D8KA 3EUHC 1YOVB 1R5GA 5FRMA 4XBFA 2L01A 4IXAA 1OCPA 2QWWA 1IW7F 2GA2A 1MBKA 2A6HF 2X1CA 1LB2A 5HNHA 3BZ6A 4Y52J 2XSJC 2EV5A 3R4KA 2KT0A 1LVKA 2HVRA 4CCJA 4WXCA 2X85A 5D4RA 1ZG1A 1JUSA 4AC0A 2K7LA 1A6IA 5J40A 1FY7A 3CF2A 3HJEA 4A3EJ 1AHDP 2NOJB 2EFPA 4KIBA 4ENNA 4UY8I 1B72B 4D1QA 1E0EA 2Y48A 4L0YB 2D2WA 3ABMH 1R36A 1TQIA 1YE9A 4M9ZA 2MLGA 3V8JA 1TT0A 3K10A 5GADJ 3PQJA 2O3FA 2BGCA 2VQLA 2OZUA 4MGRA 4Y33A 2DYSH 4YIFA 1Z21A 5TRDA 3CDHA 5JFRA 2W84A 2OTJI 3MKZA 3V8KA 1T95A 4U7BA 2K3FA 1PYVA 4ABZA 3GTQJ 2YS9A 2F5EA 2FF4A 1LDDA 1X1BA 1IAWA 2G9WA 2K4BA 1F36A 2CUZA 3LSMA 1P7JA 2M0CA 3BPXA 4KN4X 5LEKA 2F4IA 4IRGA 5IY5H 1FP1D 2XGEA 2M4KA 2JVHA 1ETOA 3GFLA 4HZFA 2LREA 1FOKA 3L00A 4A3FJ 5E3MA 3ABUA 5TGTA 1D3YA 4JBAA 2MC3A 2LF8A 2LBFB 1G3SA 1TQPA 5FB2A 4IPAA 1I27A 3G1OA 1Z7UA 1K61A 1X4PA 5K5QA 3K4BA 2FQ3A 2LTPA 5TJJA 4I09A 1OYWA 2NOGA 3HRUA 1H9GA 4HV6A 3ASNH 2E1MB 2P5LC 4EV0A 4XLEA 3CCYA 4B3AA 2WY8Q 3OR1C 3AKZA 1AKHB 1ZAOA 2V1DA 2ZC2A 1HKTA 4N4NB 4CH7A 1UG0A 4BY7J 3JRIA 1M1EB 2VJJA 1QZZA 1ETQA 1RKTA 4II3A 4HF1A 5IOYA 3F8NA 2WV0A 1AWCA 1KGSA 1TL8A 4BXUA 2YUSA 2YX7A 1FX7A 4G8XA 1MNEA 3O6BB 3BLYA 2F5CA 2H8WA 4C9YA 3TW6A 4AIJA 2LF7A 4H4KC 2OBPA 2CWEA 2V9KA 5FLXK 1JKRC 1FOWA 2ELHA 3FXMA 1WJBA 4CSWA 5KAFC 2I8DA 1VQOI 5F6FA 5E3OA 2HVQA 3SZTA 4A6DA 2K27A 2VKVA 2X1DA 2MD5A 2EQRA 2P5VA 3FDYA 4BE0A 3RQIA 1JXSA 2Q2EA 2L9RA 4HPQA 4HDUA 1EJ9A 2OTLI 3CMYA 2HKOA 3S1MJ 5CPRB 1Z3XA 4AWXB 2KZGA 2JUGA 4E7HA 4C2UA 2L3DA 3RKYA 1IDZA 3F22A 2E34A 4MFDA 1JE8A 4BNCA 4O3MA 1MMNA 2WADA 3AG4H 3C7JA 2CQNA 1IRXA 3BQYA 4HNTA 3SXYA 3WGGA 1OMIA 2EFNA 1WFXA 2MH9A 2PJRB 1U78A 3CESA 4WXHA 3MCZA 1BN5A 3ZMZA 3A01B 3H36A 1W1WE 3NRVA 4XSXF 5IT3A 1TT5B 3RZOJ 3KLNA 3ZMVA 2AXLA 2W82A 5D4SA 2VBWA 2Y69H 1D1BA 3D5RC 2IA1A 3MD2A 4KT5C 1Y56A 1YHQI 4BACA 2DT6A 5D8KB 2CFXA 4AIKA 1HC8A 2YPRA 3SEQA 2FJ1A 2JSPA 5KNLA 1V5EA 1IDYA 3J7YJ 1FP2A 5LLQA 1QZYA 3FKIJ 3QU3A 4EM0B 3P9IA 1T0FA 2DOEA 2QQ8A 4AYBA 2XGXA 3C2HA 2CW7A 1EH7A 4GYIA 1JJ6C 3QPLA 1O7FA 3KEOA 3K0LA 4LD5A 4BXXJ 4I6ZA 4PJJA 1W5CC 2GAUA 2BY3A 1WJCA 4HNUA 2JA6J 4XNFA 1PDNC 2MW8A 4ZTJA 3GTLJ 3CC4I 2K9LA 3LA2A 3REOA 3DTIA 3SDBA 3PNYA 1MBJA 1AU7A 2HQAA 1SD5A 2QGUA 3TOAA 4M73A 3F8CA 4GRIA 1IV8A 3HPGA 3OYNA 3CJQB 3BR0A 2HNHA 2WWYA 3GFIA 1SMYF 2AHQA 3GW2A 3QPSA 3OYMA 1DU0A 3JRDA 3BQZA 3CO7C 2M7AA 4WX9A 1DP7P 3OR2C 4RMNA 2EA4A 3H1CA 1P4XA 1A6QA 2JT1A 2PG4A 3IRQA 3FIWA 2V6EA 2BY0A 3DBHB 1VQMI 3PSFA 2VASA 4HX7A 1ZK8A 4F3QA 1I6XA 2HYJA 4I7HA 3BG6A 3ZN0A 3I59A 4LB5A 1MBHA 4M6YA 1YRNB 3SHFA 5ILUA 1LVAA 2ZSHB 3H92A 1Z6TA 4DYRA 4WK8F 3CUOA 4Y13A 2JMWA 1WJAA 1V5GA 3R61A 3JRAA 1U3EM 3OYHA 1SC7A 5ICFA 3VDXA 2Z3YA 3MVPA 2AQEA 3N4MA 5BPIA 3F8MA 5DM7F 4GGGA 5HS9A 4PJMA 4IHYA 2ZB9A 3SFZA 2A6TA 3LFUA 2RDPA 4WWCA 2K85A 3BR1A 2AS5F 1HDPA 1FT9A 1KU9A 4UVBA 2R7RA 1O57A 2NYXA 3GTJJ 1K79A 3HKZN 4TV7A 2QM3A 2BYVE 2E1NA 4GO1A 3GBGA 1BJAA 2O8XA 3N05A 1B8IB 4NC8A 1RUOA 4NUBA 4DNCA 4M9XA 2NVYJ 1Z6RA 3Q5FA 2XB5A 1K78B 2F4MB 2MG4A 3HSFA 2L0KA 3BG5A 3RPQA 3PM1A 5K7ZA 3KEYA 1IRFA 1D0XA 2DT5A 1KQ8A 3P9CA 4RBOA 3C18A 1HSTA 4ZH4F 4BJ5C 1OR7A 1KQ0A 2KL4A 2BY2A 4BQNA 1ULYA 1B72A 3S2WA 3ULQB 2R7XA 2HDWA 1IXSB 2VN2A 1DPRA 3WGHA 5EF6A 1LDKB 1ZN2A 1TP4A 2VLAA 2E60A 5E8GA 2G7UA 5C4XJ 1MKMA 4DYQA 4UVAA 5EZGA 2A07F 1FYMA 3Q0UA 5HOOA 3IWFA 1O3RA 4A5MA 2DA2A 4IRHA 4A3JJ 3KP3A 1Z1DA 4ZDPA 1ETXA 2A5YB 3RJPA 1LFPA 1TLHB 2EIJH 4GXOA 2QKMB 4MTEA 2VJIA 1EH6A 4AIHA 2ZCWA 4CUGA 2DDBA 4CZCA 1NK3P 1YW7A 2QQBA 2DMNA 1JJ8C 3O8HA 2VB6A 3IUOA 4JK1X 4ENMA 2FNPA 3ZMDA 1T6SA 1FJLA 1QGPA 4L5EA 3NAUA 1U0JA 2KJBA 3WHCA 2LOOA 1STZA 1WCMJ 4D9JA 5BMZA 2LBFA 5F0CA 5KVRA 5CQEA 4LLGF 1R23A 3QU6A 5FJ8J 3UKGA 1BBYA 4AU7A 3ZMUA 3W2VA 4IZZA 4WCGA 3D1NI 2VPLA 3V7SA 5L3FA 3BG7A
chains in the Genus database with same CATH topology
2K3PA 3H9JA 1D0ZA 3DU6A 4IKFA 3PUBA 3HOSA 5FRNA 5LFAA 2KZVA 2BVMA 3OYEA 2M0MA 3TMOA 3VYTB 4DGWB 4E7LA 3HG9A 2X1EA 2Z1DA 3DWLE 2V26A 2FUG2 3SZGA 2BW3B 3K4CA 4B3XA 4DOZA 5HVQC 3OYDA 3L2UA 4ZJZA 2XF7A 1MNDA 3BC8A 3QYBA 5FROA 5HLTA 2CV2A 3FHNA 2P0WA 3PFYA 4BJTA 4BU2A 3S3NA 3I3LA 1JI8A 2ZFUA 2F6CA 1D1AA 2VKDA 1QHGA 2E5NA 2UUZA 4XMYA 2PMZA 2MABA 2X6YA 3OS1A 3L2QA 3PJRA 2GOMA 4B43A 2CV0A 4ZTFA 2RNGA 2WA0A 2MFZA 4PFOA 4B47A 3OOUA 4E7KA 2WB1A 4XONA 3LMMA 3H9QA 3UNGC 4C2TA 1FMWA 2R7OA 2M3AA 2VL8A 1OLTA 4II2A 1WJFA 2ZXIA 4Y3OA 4YEJA 3RCOA 2JVGA 3RSNA 4XM3A 2CS3A 2X51A 4BGDA 3QYEA 3L2RA 3FBIB 2BOLA 2VKHA 2MD0A 3VSKA 4XOTA 3M8JA 2R7SA 1YX3A 3M1CA 3A1YA 3EUHC 3HUGB 5FRMA 1W36C 5KCMA 2PJRA 4HSRA 1MMDA 1Z7LA 2X1CA 2IS6A 5HNHA 3QYFA 1DP3A 4DIQA 1TZLA 2XSJC 2R4GA 3HL2A 1J09A 2KDOA 3DPTA 3OYKA 1LVKA 2HVRA 4CCJA 3OL3A 3H0DA 2X85A 3UR3C 4IX7A 2KLOA 1N78A 2LY1A 3CF2A 3RQ4A 1WJDA 1BR4A 2NOJB 1E0EA 4D1QA 1K6YA 2R7WA 2AQFA 4JQFA 1YE9A 3CP8A 1MMAA 3A4CA 1T0FC 4IQ4A 1TT0A 3K10A 3HKZA 2VQLA 1LKXA 4E7ZA 4ANJA 1QU3A 4Y33A 4BL0B 1Z21A 4KT6A 2F5VA 1N77A 3MKZA 1R6RA 4CA0A 3OYLA 4FETA 2WAFA 4ZDLA 2VQGA 3DEEA 3K4MA 1T95A 2IGMA 4U7BA 3OIPA 1NG7A 1PYVA 2VXZA 2W4SA 3H9GA 3OL4A 3AL0C 1DGWY 4FASD 2LH9A 2V1NA 5KHDA 1X1BA 2CUZA 3DPUA 3LSMA 4F52A 2KRHA 2Y0SA 3ZXSA 2XF6A 4F92B 1VZ0A 1Y6IA 3IP4B 4OAYA 4E4HA 2IS4A 2UV1A 2F4IA 2ZXHA 2LYCA 3DQVC 4XLAA 4F91B 3OYIA 2M4KA 3DKXA 2JVHA 2LREA 2ZSIB 3A2KA 4RLFA 2MC4A 4RM2A 4ZDOA 5TGTA 3VSLA 2LBFB 3EPZA 3ZGKA 4BE1A 2KRCA 2XDVA 4BXFA 4BS9A 2JA2A 1X4PA 3K4BA 3PNVA 3CZ6A 2OC6A 4E7JA 4LIVA 2XF5A 3PSIA 2K5CA 2E1MB 1X1AA 3AFHA 4DBRA 4XLEA 3HPHA 3ZRGA 1UAAA 2WY8Q 3CJRB 3OR1C 3AKZA 4NNJA 2VJ5A 4PK4A 4N4NB 2VIXA 4CH7A 4XR6A 1UG0A 2KQRA 2IGKA 2VJJA 3OY9A 1BR2A 4II3A 4ITVA 3OMYA 4Y4RA 2DCEA 4XKWA 3OIQA 4EATA 1MNEA 4XQFA 3BLYA 4IQJA 3OYJA 4HSTA 4KJZA 4C9YA 1KONA 3KYLA 3CMMA 2W00A 4NQWB 4ZC3A 3S3MA 4H4KC 3BCAA 3MMYB 2V9KA 3SYTA 2VQHA 4F93B 3F9KA 1WJBA 4CSWA 2I8DA 3W3CA 4MLOA 2HVQA 1BOBA 2DOAA 3MKYB 2X1DA 4CCMA 3FDYA 4BE0A 4HPQA 3K70D 4DJAA 1D0YA 5CPRB 1Z3XA 3OWTA 4QPOA 4BDZA 4RLQA 3HXLA 2JUGA 4E7HA 4C2UA 1PJRA 3ZCOA 4ZYAA 2V4JC 3LSIA 1MMNA 1OR7C 2WADA 4BQOA 1IRXA 3K4JA 3S93A 1BR1A 2IGOA 4HNTA 4E7IA 3ONQA 3L2WA 2X6XA 1WFXA 2PJRB 3CESA 3L2VA 2ELJA 3HC7A 3VYSB 1X4OA 4PSWA 2WBMA 3W2WA 4CCLA 3E1SA 2WAQA 4BUPA 2W82A 3LSHA 4LITA 4XL9A 2CH0A 1D1BA 1FMVA 2Z2SB 3OYFA 3D5RC 4HRIA 3DTEA 2KMUA 3MD2A 4AVZA 1Y56A 4BQQA 2VQCA 3S3OA 3LL7A 4QPQA 4BACA 2DT6A 4J01A 2MYSA 3SEQA 2JSPA 3ZQQA 5KNLA 1V5EA 3DLAA 5CQGA 2LRDA 4N4OB 2L9SA 3OS0A 3K4LA 1QHHD 2CV1A 3EUAA 3DPLC 1EA3A 1ZELA 1X1CA 4AYBA 3H5RA 1G59A 1G8XA 2HPMA 3C2HA 4PJNA 2CW7A 2Q1ZB 4OWRB 3DKYA 4BEHA 2HZDA 2IS2A 3TBIA 2OUMA 1GLNA 3BCBA 2KPMA 3NWTA 2LY2A 2IS1A 3FKJA 1HA8A 4PJJA 4HG2A 4C30A 1WJCA 3KX2A 4HNUA 1V5FA 1DGRM 1WJ5A 2M7BA 4G6TB 4XORA 3SEZA 4XNFA 4ZTJA 4F55A 2K9LA 1Z3YA 2XC7A 2E1MC 2L5QA 3SDBA 3DTIA 3PNYA 2KP6A 3OYGA 2HQAA 3K6GA 4BE2A 4GRIA 4XLFA 3HPGA 3MKWB 2QKLB 3OYNA 2VJ4A 3CJQB 2HNHA 3CP2A 2HPIA 2LC2A 1N75A 3OYAA 3OYMA 3E0JB 3IAM2 4PUSA 3D5SC 1SAUA 2BW3A 2M7AA 4B48A 3OR2C 4RMNA 1MW7A 4PJLA 5CKTA 2R7QA 3VYRB 5HNFA 2V6EA 3RPUD 3PSFA 2VASA 4XKCA 4F3QA 1NG6A 3BG6A 2CFOA 3J7AY 1S9HA 2ZSHB 2UWMA 3C2GA 1WJEA 3I9V2 2WAEA 2OV7A 5LD2C 1WJAA 1V5GA 3QOEA 3H5NA 3OYHA 3FBNB 3V42A 4PSXA 3VDXA 2AQEA 3PL8A 2LG4A 2CMPA 4PJMA 3EUKL 2A6TA 2E5ZA 4CCKA 3LFUA 2O5RA 3RTRA 4XLHA 3K70C 4YRVA 2R7RA 2Q2EB 3PNTA 4P1WA 3DTKA 4XLCA 3TL4X 4HEA2 3QODA 3LSKA 4B44A 3GBGA 2W1OA 4LIUA 2VXDA 3N05A 4NC8A 4U87A 4NUBA 3ZR8X 4J00A 1W36D 4CCOA 3W2AA 2Z16A 4XKVA 1X19A 3OS2A 3KEYA 2WY7Q 4PFPA 2R7UA 1D0XA 3H5AA 3IAS2 4XKBA 2R7VA 4BJ5C 3DU5A 2GOXB 2KL4A 3D5LA 4BQNA 1X1DA 2R7XA 4XN3A 4E7SA 2HDWA 4KISA 1YX5A 2L7KA 4LG3A 4XOPA 1LDKB 2KHMA 2DT7B 3OYBA 3LSGA 1SFKA 1ERDA 2VLAA 2E60A 3S32A 3K4KA 3S8PA 2HU9A 3VWBA 5HOOA 2XAUA 2BVLA 2RREA 4BDYA 2CW8A 4KITB 5JHFA 4OAZA 4ZDPA 1P9QC 1LFPA 3OYCA 2L2OA 4P5OA 4R79A 2QKMB 2CUJA 1AA7A 2VJIA 3H35A 1MMGA 4YELA 4CUGA 2IXSA 4CZCA 4JOMA 3VYUB 4BJ6C 4BEHB 2VB6A 2R7TA 3K4NA 1D1CA 3IUOA 2M4GA 2W7NA 2A5WA 2DJIA 2HVSA 1U0JA 3NWSA 2LOOA 3HOTA 4D9JA 4X0GA 2LBFA 4DBQA 4E6KG 4NC7A 5CQEA 3AL0B 1UELB 2V7FA 2DXIA 2RQQA 4XN0A 4CCNA 4AU7A 2IGNA 2X6WA 2L9NA 3W2VA 4IZZA 4RM3A 3U21A 1DQUA 2VPLA 2K9MA 3G2BA 3BG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR8 X;  2LC2 A;  3ZGK A; 
#chains in the Genus database with same CATH topology
 2OF7 A;  3TQN A;  1HW5 A;  2HDD A;  3PUB A;  3DLL F;  4IKF A;  2DQL A;  1VF9 A;  5LFA A;  5FRN A;  1SFO J;  2LMD A;  4DGW B;  1AKH A;  2Q8K A;  2HQN A;  1B9N A;  5E1X A;  2FEZ A;  2X1E A;  1EKE A;  2EV0 A;  3BY6 A;  4KUM A;  5IOZ A;  1OCT C;  4IHV A;  2ETH A;  2YU9 J;  2ESN A;  4A3I J;  3KE2 A;  4B3X A;  4DOZ A;  1E3P A;  4IHT A;  3OSG A;  4CO8 A;  1XDS A;  3QYB A;  3BC8 A;  1OFC X;  3SDG A;  3BR5 A;  1RNL A;  3H3Z A;  2CV2 A;  1Y8Q B;  3PFY A;  1JTY A;  4LMY A;  3I3L A;  2W57 A;  2ZO4 A;  5E8I A;  1CQT A;  2ZFU A;  4XRF A;  1LJ9 A;  4XMY A;  2UUZ A;  5EEA A;  3WTS C;  4A3G J;  4JP0 A;  2FXA A;  2JA7 J;  4UUV A;  2MAB A;  5J8F A;  4W1U A;  4U88 A;  3GTG J;  3CCS I;  1MDM A;  2GXG A;  4ZTF A;  2HOS A;  3HOY J;  5LGN A;  3MFK A;  1GVD A;  3U2R A;  1O7L A;  1WPK A;  5DCM A;  4E7K A;  3N97 A;  1BI1 A;  3IKV A;  5GTH C;  4C2T A;  4YFN F;  1Y0U A;  2X4H A;  2F5D A;  3GEZ A;  1UFM A;  3PQK A;  3IWZ A;  3ECH A;  4I76 A;  5FLX Z;  4YEJ A;  3RSN A;  3RYP A;  4BGD A;  2EJR A;  3RKX A;  3FBI B;  2H94 A;  3DEW A;  1EV7 A;  2VE9 A;  1HW1 A;  3VSK A;  1JKO C;  4XOT A;  4DYC A;  2KDZ A;  1T98 A;  2MH2 A;  4GDF A;  4LG0 B;  5K7H A;  2JPC A;  4I0B A;  4S04 A;  4B1R A;  3LQR A;  2H1L A;  1QVU A;  1ZKG A;  5KCM A;  1BW6 A;  2PJR A;  4HSR A;  2K86 A;  4RAY A;  4IHS A;  5CYV A;  1WQ2 A;  1TQM A;  3GZ5 A;  3T8T A;  3A01 A;  1BA5 A;  2H6B A;  5DD8 A;  3QYF A;  1TZL A;  1POG A;  4M9S A;  3M7G A;  1OCC H;  3DPT A;  3HEF A;  3OYK A;  3BG9 A;  4A5N A;  5FKM A;  3S2D J;  1JGS A;  3F3X A;  2KLO A;  5BQT A;  2LY1 A;  1BM9 A;  4UXN A;  2RN7 A;  2K9Q A;  3J7Z I;  2OA4 A;  1K6Y A;  2R7W A;  2CJJ A;  3KZY A;  1T0F C;  4IQ4 A;  2P6S A;  1HKS A;  3KLO A;  2YSR A;  3A02 A;  4LJZ F;  4FIS A;  5DD4 A;  4E7Z A;  5E20 A;  1O3T A;  1MMS A;  2RQP A;  4L5J A;  4EQQ A;  4RDU A;  5ILS A;  2F5V A;  1FIA A;  4GFB A;  4BHP A;  3WTW C;  4KNY A;  2CQK A;  4RB0 A;  4ENJ A;  3IHU A;  3BG3 A;  2WAF A;  4CYC A;  1QVT A;  4M3E A;  5FD5 A;  3HOU J;  4BYY A;  2MLK A;  3AL0 C;  2WV1 A;  4ASN A;  3JW4 A;  3WE2 A;  3CME I;  2VE8 A;  2LH9 A;  3LSR A;  2BE5 F;  4XRS G;  2XV4 S;  5BNG A;  3RKQ A;  4F52 A;  2QLZ A;  2HOT A;  3ZXS A;  1Y6I A;  3IP4 B;  2IS4 A;  2L02 A;  2UV1 A;  2ZXH A;  2LYC A;  4XLA A;  3KFW X;  4BQA A;  3PIP F;  1TTY A;  1PUF B;  2ME0 A;  2ZSI B;  2UXX A;  4L5I A;  1QRY A;  2MC4 A;  4D7M A;  3BP8 A;  4M3F A;  3VSL A;  1W0T A;  4V19 K;  2NAZ A;  2DOD A;  1Y39 A;  4BXF A;  2W24 A;  5HDK A;  5EGO B;  3ZQC A;  3EET A;  3T8R A;  2OQR A;  3CZ6 A;  3LFK A;  1W7P B;  2OPT A;  4K2E A;  5D6F A;  2VOD A;  1LQ1 A;  2P81 A;  4LIV A;  1RPW A;  3COA C;  3WHB A;  4F7Z A;  2K5C A;  1X1A A;  3R6S A;  4DBR A;  2ME6 A;  3HPH A;  1WGX A;  2LKP A;  2H27 A;  3CJR B;  2L54 A;  4OIR F;  2KIM A;  2VJ5 A;  4PK4 A;  4D5C A;  4WXD A;  2XAG A;  1MGT A;  1F1Z A;  4LK1 F;  2E36 A;  1UCR A;  1W0U A;  3OY9 A;  2QSH X;  4OIN F;  1ZHF A;  1FTZ A;  3ASO H;  3CTA A;  3U1K A;  2O61 A;  3OMY A;  4CZZ A;  2DCE A;  2V9P A;  1PP7 U;  4XKW A;  1XCB A;  2IAI A;  5E1W A;  3PO2 J;  4KJZ A;  4UNO A;  3MZY A;  1T2K A;  2F48 A;  2W00 A;  2H8R A;  1HQC A;  3SYT A;  1I3Q J;  2VQH A;  1KYW A;  4KIC A;  3CQZ J;  3F9K A;  2CUF A;  3C1D A;  1R49 A;  3I71 A;  3GME A;  1BOB A;  4I99 C;  4CCM A;  1ODD A;  4UUS B;  2DAO A;  1XMA A;  1Y8R B;  3ZN1 A;  4NBQ A;  4N9I A;  4HQE A;  1BJZ A;  2P5K A;  4DJA A;  3MQ0 A;  3K69 A;  1B8I A;  4RGU A;  4MFE A;  3AG3 H;  4BDZ A;  5KK1 A;  2I5U A;  1K78 A;  2QVO A;  3GVA A;  1I1S A;  1NK2 P;  1OR7 C;  4A3D J;  3S93 A;  3V7R A;  1KU3 A;  4E7I A;  2E1C A;  1OCR H;  4A2U A;  1MH4 A;  4CDG A;  2ACJ A;  2UZK A;  1ONV A;  2JRT A;  3B6C A;  1JHH A;  3L2V A;  2ELJ A;  2QQA A;  3HC7 A;  2NVU B;  1VND A;  1G3W A;  3VOD A;  1X4O A;  2XVC A;  2VT3 A;  4PSW A;  3HTU A;  4M3B A;  5JI6 A;  2FBH A;  4LIT A;  5EDN A;  4XL9 A;  1ZR4 A;  2CH0 A;  2IEK A;  3OYF A;  1FMV A;  2H6C A;  2Z2S B;  1W4M A;  1GV5 A;  3JR9 A;  1GHC A;  4BQQ A;  3CCR I;  3E5Q A;  1ENH A;  4XLN F;  3B73 A;  1Y1W J;  3FMQ A;  2EPF A;  4P96 A;  2MYS A;  2M2E A;  3ZQQ A;  5HDN A;  3DLA A;  5CQG A;  1J7K A;  1YS7 A;  2LRD A;  3WE3 A;  3CJN A;  1T08 B;  2L9S A;  3OS0 A;  3CCM I;  4LLN A;  2EIK H;  2CV1 A;  4Z6Y A;  1B59 A;  4I0A A;  4D5F A;  4RB2 C;  2E7W A;  2H1K A;  4Q5S F;  1PVE A;  2PX9 A;  4EJT A;  2Q1Z B;  4OWR B;  2UXN A;  2DYR H;  1GLN A;  3BCB A;  2CQ7 A;  5B5E C;  5ICC A;  2ADU A;  1LNW A;  3DFG A;  2IS1 A;  1GXP A;  3DP7 A;  2FRH A;  3W6V A;  1Q1V A;  4HG2 A;  4C30 A;  2W85 A;  4QIW N;  2IVM A;  1WJ5 A;  2M7B A;  1NTC A;  2ISY A;  4F55 A;  2QBY B;  3GTK J;  2XC7 A;  2E1M C;  2LDU A;  2GBY A;  3IKT A;  3LQQ A;  4YIR X;  2FBI A;  4BE2 A;  2XGD A;  3TGN A;  1K83 J;  1QO0 D;  3MKW B;  1ITY A;  3DF8 A;  1I1G A;  1TW2 A;  1Q1H A;  2Z5U A;  3CP2 A;  1UHS A;  2PI0 A;  1DU6 A;  2CQX A;  3GX4 X;  1O4X A;  1DPU A;  3KP5 A;  2CQQ A;  1P6R A;  2WB1 N;  3E0J B;  3IAM 2;  5CVI A;  1CF7 B;  3D5S C;  1SAU A;  1SD4 A;  3L09 A;  5DCF A;  3L1P A;  3E6M A;  1MW7 A;  4M6V A;  5CKT A;  4NHJ A;  2R7Q A;  5D5U B;  2EB7 A;  1J9I A;  1XGO A;  1EH8 A;  4HDV A;  2DK5 A;  3K7A J;  2HZT A;  2Q0O A;  1XMK A;  3J81 Z;  1F5T A;  2KIF A;  2B63 J;  5F1R A;  5K5O A;  3LOC A;  5A2Q K;  5HOD A;  4HF2 A;  1S9H A;  1SVO A;  2UWM A;  2GQQ A;  2HDC A;  2V9V A;  2WAE A;  4J19 A;  1MDM B;  5IP6 A;  3I4N J;  5JLX A;  3HHG A;  1Y1V J;  1XN7 A;  3FXQ A;  5J6X A;  2DQR A;  2AO9 A;  4A6E A;  5DCM B;  4PZJ A;  4OIO F;  5HS8 A;  1R1T A;  1XSX A;  5H2F C;  2B7E A;  1RES A;  1ZQ3 P;  1YW8 A;  3RI4 A;  3EUK L;  1VQ5 I;  3FZV A;  5ILV A;  1J75 A;  4KMU X;  3M07 A;  2O5R A;  4QLC U;  2WC2 A;  1VTN C;  1R5I D;  1UMQ A;  1YTY A;  4O5V A;  4I01 A;  2QEN A;  3KP7 A;  3KCC A;  1J0R A;  4LG0 A;  3PNT A;  1D5Y A;  2EIM H;  4A0Z A;  2G7H A;  1UHW A;  2RVC A;  4B44 A;  3G4S I;  2LY9 A;  2XPV A;  3TP3 A;  2Z33 A;  3K1N A;  5K1Y A;  3E97 A;  1W36 D;  5D6E A;  3GTM J;  2FNA A;  2W25 A;  3EQL F;  3HZJ A;  4XRM A;  4RB3 C;  2Z16 A;  4FHT A;  4XKV A;  3LA3 A;  2JK3 A;  1VQ6 I;  3OS2 A;  2WY7 Q;  4PFP A;  5M3M J;  5D5W B;  2NVX J;  1QPM A;  4G9Y A;  3IAS 2;  3RKW A;  4XKB A;  2LD5 A;  2NVQ J;  1T8I A;  3DU5 A;  4EJU A;  3D5L A;  3CLO A;  2ID6 A;  4EM2 A;  4E7S A;  3DKW A;  3BWG A;  2X6O A;  1YX5 A;  2IW5 A;  4UB6 C;  1B4A A;  4LG3 A;  4DQ2 A;  4XOP A;  2VOP A;  2DT7 B;  3BZC A;  4CYD A;  4A12 A;  1R4M B;  3OYB A;  1YFH A;  1BI3 A;  1ETK A;  5FD6 A;  3J80 K;  3HOW J;  2EBI A;  4MEY F;  2DA1 A;  1ON1 A;  4M72 A;  3QRF F;  4GCV A;  1R4N B;  1S5L C;  1H9T A;  4KIG A;  4BH9 A;  1D5V A;  4BDY A;  2CW8 A;  1ACI A;  2R5Z B;  5JHF A;  5FKL A;  4CYC B;  1UZC A;  2QF7 A;  2QSF X;  3GZN B;  2GIZ A;  4DW6 A;  3I58 A;  3OYC A;  2L2O A;  2BY1 A;  3FM5 A;  4A93 J;  5IT9 K;  2CUJ A;  1AA7 A;  3H35 A;  3VEP A;  3S1R J;  1BI2 A;  1OJL A;  2LVS A;  4YEL A;  2B9S A;  2IXS A;  4OOI A;  2FQ4 A;  2HEO A;  4IHW A;  1TWH J;  2E2I J;  1D1C A;  1XTA A;  2M4G A;  2BBY A;  1PUF A;  3LA7 A;  2A5W A;  2HGC A;  2IP2 A;  2TDX A;  4LB6 B;  1GUU A;  4M74 A;  5GAG J;  1YJN I;  1SEU A;  1E3H A;  1VQN I;  3HOT A;  4X0G A;  4KFC A;  2BXZ A;  4NC7 A;  2XHK A;  1D8J A;  2OAZ A;  5KAI C;  5EGO A;  1UEL B;  1IV6 A;  2V7F A;  2DXI A;  4XN0 A;  2DTR A;  1UJ8 A;  2L9N A;  3SFI A;  1X2N A;  1RET A;  1RR7 A;  4RM3 A;  1W7P A;  5H6Q A;  3DBR B;  1VI0 A;  3KZZ A;  2K9M A;  2GA1 A;  2K3P A;  1BC7 C;  3BJ6 A;  2E35 A;  5HLG A;  4JX5 A;  1XD7 A;  2KZV A;  1Z05 A;  3QPT A;  5GP9 A;  1P92 A;  3JRH A;  3F6O A;  3Q0W A;  1GXQ A;  3LSP A;  1X58 A;  3DWL E;  1T56 A;  3CCL I;  1S7O A;  1TNS A;  2FUG 2;  3QP6 A;  3SZG A;  1V54 H;  5HVQ C;  3L2U A;  1P4A A;  1H0M A;  1S8N A;  1K4S A;  1I5Z A;  2BV6 A;  3F8B A;  1A31 A;  3FHN A;  1VQ7 I;  3FX3 A;  5ICE A;  4A3L J;  1JI8 A;  1OCO H;  1X3Z B;  2F6C A;  2W48 A;  3CMA I;  1QHG A;  2E5N A;  3GUD A;  5B3S H;  3FXU A;  2O8K A;  5TIS C;  4B43 A;  2CV0 A;  3NEU A;  3BR3 A;  5FLV A;  2MFZ A;  1Z0X A;  4IL6 C;  2NNY A;  2WAQ N;  4XON A;  4A69 C;  1ZLJ A;  3H9Q A;  4UUS A;  2X48 A;  3C2B A;  2R7O A;  2G0E A;  4II2 A;  2HQ5 A;  5F04 A;  1R1U A;  2ZXI A;  1OYY A;  3RCO A;  1VQ4 I;  5L3D A;  3P9K A;  3R0A A;  1WSU A;  4XM3 A;  3M1E A;  1J5Y A;  2M5W A;  4RGR A;  1CGP A;  3G1M A;  5F1J A;  2VKH A;  2MD0 A;  2KRF A;  4L9J A;  1F9N A;  3M8J A;  2R7S A;  2OZ6 A;  2HXO A;  1YG2 A;  3A1Y A;  3BRO A;  1X1P A;  2GZW A;  1IJW C;  1W36 C;  2EIN H;  5H6R A;  2QEX I;  3S17 J;  4HX4 A;  1MMD A;  1Z7L A;  2IS6 A;  3GCM A;  4HNV A;  4QSH A;  4DIQ A;  2FX0 A;  2R4G A;  1ORK A;  1HKQ A;  2KIS A;  3ISP A;  1U5T B;  2KDO A;  2XKO A;  2C6Y A;  4ETS A;  1L0O C;  2ZME B;  1ZLK A;  2JRM A;  3UR3 C;  1BR4 A;  3GLX A;  2P6T A;  3EYY A;  1H89 C;  5BS6 A;  1FTT A;  4R1H A;  3CCV I;  2EK5 A;  5D5V B;  4XIC A;  2AQF A;  1PUE E;  1YQA A;  3CP8 A;  4MQ9 F;  3JRG A;  3A4C A;  3CD6 I;  1OIS A;  2R3S A;  2DMT A;  2M8E A;  3HKZ A;  2LNB A;  3K1P A;  3X2Q H;  3GYH X;  5FFZ A;  1KZH A;  5IYD J;  4RA2 A;  4ANJ A;  1SAN A;  1V4R A;  5J3L A;  1ZRE A;  1VQK I;  4BL0 B;  1WHU A;  4S0H B;  4KT6 A;  2ELK A;  3LST A;  4MIM A;  1A5J A;  3HM5 A;  1N77 A;  1R6R A;  4CA0 A;  3OYL A;  3TO7 A;  2WTE A;  4ZDL A;  3DEE A;  3K4M A;  3FXO A;  3KPH A;  3G6E I;  2IGM A;  4RAG A;  1NG7 A;  2BXY A;  2DOF A;  2VXZ A;  2W4S A;  3H9G A;  2KKO A;  2Y75 A;  4C2M J;  4FAS D;  1MZB A;  2V1N A;  1IN7 A;  4EMS A;  2KRH A;  3JAM K;  2XF6 A;  4YFX F;  1VZ0 A;  1BC8 C;  2QBY A;  2ECB A;  2X9D A;  1W7P D;  2F5F A;  3GFJ A;  3M9A A;  4E70 A;  2QUF A;  5E18 F;  4FCY A;  3M3Y J;  1XGM A;  2FMY A;  5AIP A;  3ELK A;  4RLF A;  3CF5 F;  4ZDO A;  5IP9 J;  3ZGK A;  1QNT A;  4BE1 A;  4BS9 A;  4C3I J;  3HYI A;  1BOA A;  3DV8 A;  4G6Q A;  4CGZ A;  3PNV A;  1FOX A;  5GPC A;  3J81 K;  5M5W J;  2OC6 A;  1X3W B;  3QQA A;  4X1E A;  2V79 A;  3D0S A;  1LFU P;  3KZI C;  1CF7 A;  3Q0V A;  3H3V K;  1FOY A;  2XF5 A;  2QYO A;  3W6J B;  4YII A;  3ZQL A;  1S6L A;  2D45 A;  4NNJ A;  5J4V A;  3KP2 A;  1QA6 A;  3NAR A;  2VIX A;  3HB9 A;  4XR6 A;  2KQR A;  1REP C;  1I50 J;  2GXB A;  1YS6 A;  2PLY A;  4KMF A;  2HR3 A;  2Y30 A;  5GAE J;  1BR2 A;  1IG7 A;  4ZZL A;  4RGX A;  5ERI A;  5H20 A;  4IHX A;  2DA5 A;  4G94 A;  3ZQF A;  4Y4R A;  2R7D A;  3RPU A;  1TBX A;  3OIQ A;  4XQF A;  1U8B A;  4V2G A;  1B1B A;  1FSE A;  3ABL H;  3FMS A;  3PO3 J;  2JZY A;  3CMM A;  4NQW B;  3S3M A;  5M5Y J;  1HDD C;  3MMY B;  2XAH A;  1ETY A;  1MNM C;  1FIP A;  1V3F A;  4F93 B;  1WWX A;  2EZH A;  4MEX F;  4DZP A;  2GWR A;  5A2Q Z;  4WF2 A;  1I6H J;  3Q3S A;  2QCO A;  2DO7 A;  3I55 I;  2XB0 X;  3DEU A;  2LLK A;  3MWM A;  2NXN B;  1MJB A;  5E3L A;  4IO9 F;  1ETV A;  1X2M A;  2M30 A;  4ZYD A;  1A36 A;  3S16 J;  1NHA A;  2E7X A;  1ZRD A;  4X6A J;  1IN8 A;  1V55 H;  1WI3 A;  3OWT A;  4V2F A;  2E2J J;  2RAE A;  3F8F A;  4EGY A;  3HXL A;  1X3U A;  4HLY A;  3ZCO A;  3BTI A;  4KIF A;  3K4J A;  1BR1 A;  2FML A;  2IGO A;  3JTG A;  1FEX A;  4KDP A;  1HCR A;  3K1M A;  2RKH A;  3L2W A;  2STT A;  2FBK A;  2QQ9 A;  2X6X A;  1TWF J;  1JHF A;  4MTD A;  5DYM A;  2ZKZ A;  2EFW A;  5JVT A;  5B1A H;  2CU7 A;  3I4M J;  4XK4 A;  3W2W A;  2TRT A;  3TDZ C;  4CCL A;  1APL C;  4BUP A;  1S7E A;  3LSH A;  2ZNZ A;  2JN6 A;  5DUK A;  3TW7 A;  3FK7 A;  3KYC B;  4I2O A;  2RV8 A;  4NC6 A;  1B6A A;  4FT8 A;  3L2C A;  4HRI A;  2PJP A;  2GIV A;  2VUM J;  4IF4 A;  3BJO A;  1BIB A;  1P7I A;  1Y0N A;  1U9O A;  2VQC A;  1R5H A;  4NB5 A;  4D7N A;  3LL7 A;  2VKE A;  1IXR C;  3PFI A;  1UST A;  4MHG A;  1AOY A;  3OIO A;  3HGG A;  4HYE A;  4J01 A;  2R5Z A;  2FOK A;  2EZI A;  1FZP B;  1MJ9 A;  3K4L A;  2KJC A;  2ZFW A;  2L7F P;  1EA3 A;  1ZEL A;  3DPL C;  3EUA A;  1X1C A;  3J80 Z;  4IOA F;  1OYI A;  1G59 A;  2CW0 F;  2HPM A;  4PJN A;  3B02 A;  1ETW A;  4QWQ A;  2V6C A;  1IN4 A;  5LHI A;  2JPB A;  1XGS A;  2OQG A;  2DJN A;  3I4P A;  3O2P E;  5LGT A;  3HRM A;  2IS2 A;  2EA2 A;  2OUM A;  3ZPL A;  4HX8 A;  2HYG D;  5D8L B;  5E3N A;  1OPC A;  2LK2 A;  2LY2 A;  4A3B J;  3FKJ A;  2OU2 A;  2D1H A;  4YFK F;  4L9N A;  4PDK A;  3WTT C;  1ZGW A;  1V5F A;  5DDG A;  5IT9 Z;  2V1X A;  4G6T B;  4XOR A;  3SEZ A;  3VB2 A;  2DK8 A;  5E1Z B;  5K5R A;  1Z3Y A;  1LPQ A;  3SZP A;  1W5T A;  2AXT C;  4HF0 A;  2LFB A;  2CYY A;  2KP6 A;  4HBL A;  3ZQH A;  3QOP A;  4PJ0 C;  2XUB A;  3E6D A;  2STW A;  5B1B H;  1ZH5 A;  5LRR A;  1OCZ H;  2FD5 A;  2P8T A;  3I64 A;  2JA5 J;  1SFU A;  2QKL B;  4OIP F;  3LSJ A;  4CXF A;  3CCU I;  3HIF A;  1S72 I;  2HPI A;  2DMP A;  4JX4 A;  1G3T A;  1MD0 A;  1N75 A;  5DV5 A;  3OYA A;  5CVR A;  1IXC A;  3CCE I;  1FYK A;  1IO2 A;  3K2Z A;  3HHH A;  2YX4 A;  2HXI A;  4U0W A;  2VC1 A;  3M8E A;  1JT0 A;  3VYR B;  5HNF A;  1HOM A;  3RPU D;  1USS A;  2EZK A;  4UV8 A;  1YIT I;  3CDI A;  4LFU A;  4OMY A;  2L4M A;  4KA4 A;  2NS8 A;  5IP7 J;  2J5P A;  1WJE A;  3I9V 2;  5JLW A;  3LNQ A;  2EH3 A;  2O7O A;  5DM6 F;  5LD2 C;  2HI3 A;  1RIO H;  1W5S A;  4MQV A;  3JTH A;  3OOP A;  3SQN A;  4C3J J;  1XX5 A;  3JSO A;  1WH7 A;  4EM1 A;  3CUQ B;  4PSX A;  3V42 A;  4S05 A;  5FGM A;  2OD5 A;  3F23 A;  4Y15 A;  3FXR A;  5M3F J;  3PL8 A;  3ZQG A;  3TDU C;  2E5Z A;  2DDA A;  4CCK A;  5DUI A;  3RTR A;  5F27 A;  3IH2 A;  1KU7 A;  1IRZ A;  1TWC J;  4XLH A;  1BW5 A;  1RI7 A;  4YRV A;  3ESW B;  3BTC A;  2XAQ A;  3DTK A;  3QAH A;  4HEA 2;  3QOD A;  2VOO A;  4LIU A;  2YU3 A;  4LGW A;  2EZL A;  3ZR8 X;  5C44 J;  1J59 A;  2DFI A;  1GDT A;  3W2A A;  3RIR A;  4EJV A;  4BBS J;  9ANT A;  2B0L A;  2XRL A;  1WH5 A;  1U5T A;  4IOC F;  1X19 A;  2R7F A;  4A3M J;  5J1R A;  4XRS A;  1YIO A;  2ZME A;  4HOB A;  2DMQ A;  1XS9 A;  1GVJ A;  2DA3 A;  4BKX A;  2GOX B;  4G12 A;  4C3H J;  1A04 A;  1WVR A;  5E79 C;  4XN3 A;  4P9F A;  4PGG A;  5EG0 B;  2RC4 A;  4KIS A;  2A6E F;  2PBI A;  2L7K A;  3JCU C;  1HLV A;  1XGN A;  3G1L A;  3JRE A;  5FO5 A;  1SFK A;  1XCV A;  2H09 A;  1JKP C;  3S2H J;  1F43 A;  2R0Q C;  3E6B A;  3K4K A;  1FYL A;  1T39 A;  2CGP A;  3S8P A;  1JT6 A;  1SD7 A;  2HU9 A;  3VWB A;  1FBQ A;  3HOV J;  3IH4 A;  5CVV A;  4A0Y A;  4KIT B;  4UUT A;  4OAZ A;  1RRJ A;  4BY1 J;  3WGI A;  4G7Z F;  5JR3 A;  4R79 A;  1YI2 I;  4ZZD A;  5LRS A;  4U0V A;  2E19 A;  1P2F A;  1WKM A;  2CG4 A;  2VBZ A;  5GPA A;  1S3J A;  2M1B A;  4PGH A;  2HQR A;  2XAS A;  2XSD C;  4IVN A;  3KP6 A;  3A0H C;  1ZGA A;  3WTX C;  4BEH B;  2PQ8 A;  3K4N A;  1LFB A;  2HKX A;  4JX6 A;  1WZ2 A;  3O8G A;  5LEJ A;  2W7N A;  2LR8 A;  2DFF A;  1R9T J;  3NWS A;  5IYC J;  2PMZ N;  4DBQ A;  5CVJ A;  5FKN A;  4E6K G;  3HRT A;  4FTH A;  1ZG5 A;  1RR8 C;  2PEX A;  1F4K A;  2ZJQ F;  2IGN A;  2JUC A;  2X6W A;  3JAM Z;  1K7A A;  1ZYR F;  3CDL A;  3CC2 I;  2OJE D;  5L3E A;  3I54 A;  1YYV A;  1SVL A;  4A3K J;  3HDD A;  4M6X A;  3HSE A;  4BU2 A;  2XRN A;  3H9J A;  1D0Z A;  1BIA A;  4KN7 X;  2FE3 A;  2O0Y A;  2K9S A;  3HOS A;  3OYE A;  2BVM A;  2ZXJ A;  4E7L A;  3HG9 A;  4AID A;  1OQY A;  2DLL A;  3J7A O;  2Z1D A;  3W6K B;  3HTS B;  3ZMS A;  2M34 A;  2XGC A;  2BW3 B;  2L7Z A;  3OYD A;  1E2X A;  1KQ9 A;  4ZJZ A;  2GM4 A;  1IUY A;  4N0B A;  2XF7 A;  1HSJ A;  1MND A;  5HLT A;  1TWG J;  3ABT A;  3T5X A;  2ECC A;  4BBR J;  2CUE A;  1SAX A;  2IJL A;  3AG1 H;  1OKR A;  4G7H F;  1D1A A;  2DN0 A;  3RZD J;  3QP5 A;  2RNJ A;  2PMZ A;  3JSP A;  3FXK A;  2FU4 A;  4NQW A;  1JUM A;  4AVP A;  1GT0 C;  2X6Y A;  3OS1 A;  2A69 F;  2XPU A;  1BL0 A;  2GOM A;  1E3O C;  3PJR A;  1FBS A;  1MJA A;  2GLO A;  4PFO A;  2TCT A;  2XAJ A;  3OOU A;  4BAY A;  3GO5 A;  2WB1 A;  4ON0 A;  3LMM A;  1IN5 A;  2ZXW H;  1LDJ A;  2ZJR F;  5M5X J;  3VPR A;  3IC7 A;  1L3L A;  1IRG A;  4XSZ F;  1U6G A;  4LK0 F;  1QBJ A;  4Y3O A;  3ECO A;  1MH3 A;  2E71 A;  3R60 A;  5D5X B;  5FKK A;  2BHZ A;  5HLH A;  3L2R A;  4MO7 A;  2A61 A;  2HS5 A;  2O6G E;  3PUF A;  3AG2 H;  3ROU A;  2IPQ X;  3M1C A;  1RUN A;  1R00 A;  3HUG B;  4Y17 A;  3TKY A;  3TO6 A;  4ENK A;  3Q9S A;  4B8X A;  4AYB N;  4ZYE A;  1QPI A;  3EYI A;  3F6V A;  5J4Y A;  1Z77 A;  1XSD A;  1DP3 A;  2RGV A;  2VBY A;  2Y0S N;  4UHT A;  3GZ6 A;  3HL2 A;  1J09 A;  2XIG A;  1DUX C;  1RZ4 A;  2XPW A;  2NS0 A;  3OL3 A;  1TW3 A;  3H0D A;  3KIO A;  2L4A A;  4U7D A;  4IX7 A;  1N78 A;  1YIJ I;  2M8G X;  5L3G A;  3RQ4 A;  2R5Y B;  1WJD A;  1FSH A;  1UB9 A;  1MBE A;  2HWV A;  4Q4Z F;  3T1B A;  5DTD A;  4JQF A;  5J47 A;  2DW4 A;  5FKO A;  4EJW A;  1MMA A;  2F4O B;  3G3Z A;  3PIO F;  4UB8 C;  1HF0 A;  2DI3 A;  2ZBK A;  4OIQ F;  4HLX A;  1SFE A;  3GTO J;  1LKX A;  2KIQ A;  2DU9 A;  4OMZ A;  1QU3 A;  3BR2 A;  3M8F A;  3MAJ A;  1XSV A;  5FLM J;  5EEG A;  4FET A;  2VQG A;  1J2X A;  3G71 I;  4EVI A;  4LLL A;  3TED A;  3OIP A;  1IGN A;  5LBQ A;  5C4J J;  3OL4 A;  1DGW Y;  2QA4 I;  5BOX A;  3L7W A;  5KHD A;  2L9V A;  4ESB A;  3DPU A;  2Y0S A;  4L9V A;  4F92 B;  4AD9 A;  2V1U A;  2HTJ A;  4E4H A;  4OAY A;  1ZR2 A;  5F0F A;  2IRF G;  3DQV C;  1E17 A;  3OYI A;  4F91 B;  4XLP F;  1WRJ A;  4Q48 A;  3DKX A;  2D1V A;  3FF5 A;  3BTL A;  3A2K A;  1RKW A;  4RM2 A;  1PP8 F;  1R71 A;  4EJO A;  4Z2Y A;  3HBL A;  5AIQ A;  3EPZ A;  4AM3 A;  2KRC A;  2XDV A;  4GYG A;  4O6J A;  2BHY A;  2JA2 A;  2EIL H;  2DTZ A;  3WTZ A;  4M71 A;  1XG1 A;  4E7J A;  3E3V A;  2ICW G;  3IL2 A;  3WU1 B;  4HW0 A;  3R0J A;  1UG2 A;  3PSI A;  3AFH A;  3ZRG A;  3WG9 A;  2VBX A;  1HXD A;  2F2E A;  3E7L A;  3KP4 A;  1UAA A;  3CC7 I;  1KU2 A;  2JTV A;  4HQM A;  4W97 A;  3FXJ A;  2ISZ A;  3FM3 A;  1FC3 A;  4B4C A;  1YJ9 I;  3I0T A;  3ERM A;  2O03 A;  4FE4 A;  4P9U A;  1UHM A;  3CJT B;  3FIS A;  4M3D A;  1LE8 B;  2IGK A;  2MA3 A;  2LKS A;  1I3A A;  2XRO A;  1U8R A;  2FSW A;  3F21 A;  1IN6 A;  3IH3 A;  4ITV A;  3MEX A;  1JGG A;  1Z9C A;  3FXL A;  3QPH A;  4G7O F;  4EAT A;  3ZMT A;  1C0W A;  2DMU A;  1JTX A;  4IQJ A;  2PMU A;  3OYJ A;  4RB1 A;  3CUQ A;  3MKL A;  4HST A;  1T33 A;  1KON A;  3KYL A;  3EDP A;  5FFX A;  4ZC3 A;  1G2H A;  3BCA A;  2M87 A;  3Q9V A;  3WU2 C;  5E17 F;  1K4T A;  3W3C A;  4MLO A;  2DOA A;  3MKY B;  3H3U A;  3V8L A;  4LOC A;  2MGQ A;  2CO5 A;  3K70 D;  1IF1 A;  2E1O A;  1Z91 A;  1D0Y A;  3E5X A;  3VFZ A;  2L7M P;  4Y7N J;  1Z67 A;  3S15 J;  4QPO A;  1IC8 A;  5CVU A;  1DDN A;  1U5T C;  4RLQ A;  4UV9 A;  1R1V A;  3CCQ I;  2ZME C;  3HSR A;  5J1Y A;  1PJR A;  1O3Q A;  4ZYA A;  1S29 A;  2V4J C;  3LSI A;  3WTU C;  4BQO A;  5IPA A;  4XID A;  5ED4 A;  3V4G A;  4R8H A;  3GLL A;  3ONQ A;  3FK6 A;  4BHC A;  1R22 A;  3BR6 A;  5L3B A;  1YO5 C;  3C3W A;  4IEJ A;  4L0Z B;  3EUH A;  3VYS B;  2A3S A;  2WBM A;  5EG0 A;  3KET A;  3IRR A;  3E1S A;  2WAQ A;  1LEB A;  2IA0 A;  4NDL A;  1R58 A;  2HOE A;  2OCC H;  4ZYG A;  1XPX A;  3DTE A;  2KMU A;  2P7V B;  4AVZ A;  2I10 A;  3S3O A;  4D0P A;  5HLI A;  4QPQ A;  2E2H J;  2QSG X;  3JRC A;  4N4O B;  2DA4 A;  3T0Y A;  2HTS A;  3BJA A;  1QHH D;  4A3C J;  3F72 A;  1XDU A;  4FX0 A;  1U9N A;  3H5R A;  1TNT A;  5EEH A;  1RC9 A;  1A35 A;  3DKY A;  4BEH A;  3BT9 A;  3BTJ A;  2HZD A;  5K7F A;  3TBI A;  3S1Q J;  2J5O A;  3L9F A;  2KPM A;  3NWT A;  1TC3 C;  5GAH J;  1HA8 A;  3KX2 A;  2JWT A;  3ZQI A;  1DGR M;  3TO9 A;  5HS7 A;  5JHU A;  3WTV C;  2QZ8 A;  2XAF A;  1XMX A;  1H88 C;  2DPD A;  2K02 A;  2L5Q A;  3OYG A;  2VI6 A;  3K6G A;  4PCQ A;  2EFO A;  4XLF A;  3ZOB A;  5F0H A;  4I98 B;  2VJ4 A;  1KA8 A;  3GXO A;  4KYW A;  2Z99 A;  3WU0 A;  3OV8 A;  3WOD F;  1FNN A;  2LC2 A;  1JKQ C;  2VC0 A;  2Y9Y A;  1SFX A;  3GFM A;  4JYK A;  1K6O A;  4PUS A;  4P55 A;  2CRG A;  1SD6 A;  2JQ7 A;  2BW3 A;  2ID3 A;  4B48 A;  3MZ8 A;  4MNU A;  2K40 A;  4HV5 A;  3ZQ7 A;  1G6N A;  4PJL A;  3CCJ I;  2P4W A;  3LAP A;  2DBB A;  3GTP J;  2IT0 A;  1QQI A;  3A03 A;  1EF4 A;  2N8G A;  2ZNY A;  3MN2 A;  4XKC A;  3MZH A;  1NG6 A;  2CFO A;  5IYB J;  3J7A Y;  1HW2 A;  1B9M A;  4EGZ A;  3C2G A;  4IJA A;  5JVG F;  1HBX G;  1R7J A;  2OV7 A;  4M3G A;  5J8C A;  4ZYH A;  5AON A;  5L3C A;  3QOE A;  5EYR A;  4HAM A;  3H5N A;  3FBN B;  3SJM A;  1MIJ A;  1VFC A;  2DPU A;  6PAX A;  2LP0 A;  3LWF A;  3U9G A;  1N25 A;  5F08 A;  2NS7 A;  2LG4 A;  2CMP A;  2FOW A;  2P7C B;  3WTY C;  1S7A A;  2M45 A;  3ABK H;  3KYD B;  2PN6 A;  2MSY A;  1SVM A;  2Y0M A;  3VOE A;  3K70 C;  5J1U A;  1LEA A;  2Q2E B;  4P1W A;  5EJC A;  4QTR A;  4ESF A;  4XLC A;  2JSC A;  2Y31 A;  3E5U A;  3TL4 X;  2R93 J;  3LSK A;  3JRF A;  2NVT J;  3HUG A;  2W1O A;  3GWZ A;  2VXD A;  2VPR A;  4U87 A;  3FWE A;  4J00 A;  1MSF C;  2O9L A;  2EFQ A;  1FBU A;  3DXJ F;  4CCO A;  2ESH A;  2LKX A;  3BPV A;  3OSF A;  2MBF A;  3FHZ A;  3M4O J;  2R7U A;  3HRS A;  4ESJ A;  1XC5 A;  3H5A A;  2R7V A;  1VQL I;  2R5Y A;  3I53 A;  4AUX A;  3CO6 C;  3LAJ A;  3HOX J;  2YR2 A;  1MBF A;  1FWZ A;  1I39 A;  1KYZ A;  1TWA J;  1X1D A;  1H8A C;  4FE7 A;  3FMR A;  5LGU A;  4UVC A;  2HFH A;  1ZG3 A;  2KHM A;  2EWN A;  2Z9O A;  3V7C A;  3NQO A;  1IZ1 A;  3LSG A;  3ERE D;  3I56 I;  4RS8 A;  1ERD A;  3H0G J;  3S32 A;  2DFH A;  1VQP I;  3A0B C;  1T38 A;  4BHB A;  1WI9 A;  4YG2 F;  2R92 J;  2KIU A;  3ML6 A;  3K9T A;  2X0L A;  2XAU A;  2NNN A;  2BVL A;  2RRE A;  2ZJ2 A;  5CLS A;  3TOB A;  3U1D A;  1VQ8 I;  1ON2 A;  4L18 B;  3B6A A;  5GTI C;  1P9Q C;  1G3Y A;  4HA8 A;  4P5O A;  3K2A A;  1MMG A;  2XKP A;  3CLQ A;  1MSE C;  2ZJP F;  2VON A;  2DA6 A;  3P5J A;  2D5V A;  2GXA A;  4U0Y A;  4JOM A;  3VYU B;  2IA2 A;  4A0X A;  4BJ6 C;  5BPD A;  2R7T A;  1FLI A;  2DJI A;  3S14 J;  2HVS A;  3O3K A;  2PMH A;  1O3S A;  1IUF A;  2PFB A;  5EZH A;  3KEQ A;  3RYR A;  3AL0 B;  2RQQ A;  1GV2 A;  2EV6 A;  4CCN A;  2IBD A;  3HGY A;  5LHH A;  1ZAR A;  3U21 A;  2CSO A;  4N9H A;  1G4D A;  1DQU A;  1VQ9 I;  4RAF A;  3E6C C;  4RGS A;  3G2B A;  1G8X A;  4EEF G;  3DU6 A;  1BI0 A;  4OU0 A;  4G6D A;  3DBL B;  2M0M A;  2Y9Z A;  4B09 A;  3TMO A;  3VYT B;  1MBG A;  4Q47 A;  3S1N J;  3AAF A;  2LSO A;  3BZK A;  4CHU A;  1YLF A;  3WG7 H;  2NRA C;  2V26 A;  2K9N A;  3JRB A;  1U2W A;  1LE8 A;  3TP0 A;  3BDD A;  3K4C A;  4I02 A;  1QZE A;  5DS9 A;  5DEQ A;  4IRI A;  3CUQ C;  5FRO A;  2BZT A;  2R7Z J;  2HOA A;  2OCE A;  2P0W A;  2KFD A;  4BJT A;  3S3N A;  3DCF A;  2BEO A;  5ICG A;  3P7N A;  2A68 F;  2VKD A;  1YRN A;  1ZRC A;  5B66 C;  3I59 B;  2FA5 A;  3G73 A;  2COM A;  3L2Q A;  2VT2 A;  2HYF A;  3RDI A;  4L9T A;  1FPQ A;  1XB4 A;  5F64 A;  2RNG A;  2WA0 A;  2DA7 A;  2A05 A;  4B47 A;  4H0E A;  1ZGJ A;  3BOQ A;  3I5U A;  5HDG A;  1YJW I;  3IV5 A;  3UNG C;  2K4J A;  1P4W A;  1YW9 A;  1FMW A;  3GF2 A;  4RAZ A;  2DFE A;  2M9H A;  4DZJ A;  2M3A A;  1NH3 A;  2JJ7 A;  1JUP A;  2VL8 A;  1OLT A;  3HOZ J;  1SMT A;  2Y2Z A;  1ZRF A;  4FQG A;  1WJF A;  2COB A;  2JVG A;  2JA8 J;  3QWL A;  4FX4 A;  2CS3 A;  5C3E J;  2X51 A;  3ZP5 A;  3QYE A;  2BOL A;  5CJ9 A;  5LHG A;  4CIC A;  3F0C A;  1LUJ B;  1ZTR A;  1YX3 A;  1D8K A;  3EUH C;  1YOV B;  1R5G A;  5FRM A;  4XBF A;  2L01 A;  4IXA A;  1OCP A;  2QWW A;  1IW7 F;  2GA2 A;  1MBK A;  2A6H F;  2X1C A;  1LB2 A;  5HNH A;  3BZ6 A;  4Y52 J;  2XSJ C;  2EV5 A;  3R4K A;  2KT0 A;  1LVK A;  2HVR A;  4CCJ A;  4WXC A;  2X85 A;  5D4R A;  1ZG1 A;  1JUS A;  4AC0 A;  2K7L A;  1A6I A;  5J40 A;  1FY7 A;  3CF2 A;  3HJE A;  4A3E J;  1AHD P;  2NOJ B;  2EFP A;  4KIB A;  4ENN A;  4UY8 I;  1B72 B;  4D1Q A;  1E0E A;  2Y48 A;  4L0Y B;  2D2W A;  3ABM H;  1R36 A;  1TQI A;  1YE9 A;  4M9Z A;  2MLG A;  3V8J A;  1TT0 A;  3K10 A;  5GAD J;  3PQJ A;  2O3F A;  2BGC A;  2VQL A;  2OZU A;  4MGR A;  4Y33 A;  2DYS H;  4YIF A;  1Z21 A;  5TRD A;  3CDH A;  5JFR A;  2W84 A;  2OTJ I;  3MKZ A;  3V8K A;  1T95 A;  4U7B A;  2K3F A;  1PYV A;  4ABZ A;  3GTQ J;  2YS9 A;  2F5E A;  2FF4 A;  1LDD A;  1X1B A;  1IAW A;  2G9W A;  2K4B A;  1F36 A;  2CUZ A;  3LSM A;  1P7J A;  2M0C A;  3BPX A;  4KN4 X;  5LEK A;  2F4I A;  4IRG A;  5IY5 H;  1FP1 D;  2XGE A;  2M4K A;  2JVH A;  1ETO A;  3GFL A;  4HZF A;  2LRE A;  1FOK A;  3L00 A;  4A3F J;  5E3M A;  3ABU A;  5TGT A;  1D3Y A;  4JBA A;  2MC3 A;  2LF8 A;  2LBF B;  1G3S A;  1TQP A;  5FB2 A;  4IPA A;  1I27 A;  3G1O A;  1Z7U A;  1K61 A;  1X4P A;  5K5Q A;  3K4B A;  2FQ3 A;  2LTP A;  5TJJ A;  4I09 A;  1OYW A;  2NOG A;  3HRU A;  1H9G A;  4HV6 A;  3ASN H;  2E1M B;  2P5L C;  4EV0 A;  4XLE A;  3CCY A;  4B3A A;  2WY8 Q;  3OR1 C;  3AKZ A;  1AKH B;  1ZAO A;  2V1D A;  2ZC2 A;  1HKT A;  4N4N B;  4CH7 A;  1UG0 A;  4BY7 J;  3JRI A;  1M1E B;  2VJJ A;  1QZZ A;  1ETQ A;  1RKT A;  4II3 A;  4HF1 A;  5IOY A;  3F8N A;  2WV0 A;  1AWC A;  1KGS A;  1TL8 A;  4BXU A;  2YUS A;  2YX7 A;  1FX7 A;  4G8X A;  1MNE A;  3O6B B;  3BLY A;  2F5C A;  2H8W A;  4C9Y A;  3TW6 A;  4AIJ A;  2LF7 A;  4H4K C;  2OBP A;  2CWE A;  2V9K A;  5FLX K;  1JKR C;  1FOW A;  2ELH A;  3FXM A;  1WJB A;  4CSW A;  5KAF C;  2I8D A;  1VQO I;  5F6F A;  5E3O A;  2HVQ A;  3SZT A;  4A6D A;  2K27 A;  2VKV A;  2X1D A;  2MD5 A;  2EQR A;  2P5V A;  3FDY A;  4BE0 A;  3RQI A;  1JXS A;  2Q2E A;  2L9R A;  4HPQ A;  4HDU A;  1EJ9 A;  2OTL I;  3CMY A;  2HKO A;  3S1M J;  5CPR B;  1Z3X A;  4AWX B;  2KZG A;  2JUG A;  4E7H A;  4C2U A;  2L3D A;  3RKY A;  1IDZ A;  3F22 A;  2E34 A;  4MFD A;  1JE8 A;  4BNC A;  4O3M A;  1MMN A;  2WAD A;  3AG4 H;  3C7J A;  2CQN A;  1IRX A;  3BQY A;  4HNT A;  3SXY A;  3WGG A;  1OMI A;  2EFN A;  1WFX A;  2MH9 A;  2PJR B;  1U78 A;  3CES A;  4WXH A;  3MCZ A;  1BN5 A;  3ZMZ A;  3A01 B;  3H36 A;  1W1W E;  3NRV A;  4XSX F;  5IT3 A;  1TT5 B;  3RZO J;  3KLN A;  3ZMV A;  2AXL A;  2W82 A;  5D4S A;  2VBW A;  2Y69 H;  1D1B A;  3D5R C;  2IA1 A;  3MD2 A;  4KT5 C;  1Y56 A;  1YHQ I;  4BAC A;  2DT6 A;  5D8K B;  2CFX A;  4AIK A;  1HC8 A;  2YPR A;  3SEQ A;  2FJ1 A;  2JSP A;  5KNL A;  1V5E A;  1IDY A;  3J7Y J;  1FP2 A;  5LLQ A;  1QZY A;  3FKI J;  3QU3 A;  4EM0 B;  3P9I A;  1T0F A;  2DOE A;  2QQ8 A;  4AYB A;  2XGX A;  3C2H A;  2CW7 A;  1EH7 A;  4GYI A;  1JJ6 C;  3QPL A;  1O7F A;  3KEO A;  3K0L A;  4LD5 A;  4BXX J;  4I6Z A;  4PJJ A;  1W5C C;  2GAU A;  2BY3 A;  1WJC A;  4HNU A;  2JA6 J;  4XNF A;  1PDN C;  2MW8 A;  4ZTJ A;  3GTL J;  3CC4 I;  2K9L A;  3LA2 A;  3REO A;  3DTI A;  3SDB A;  3PNY A;  1MBJ A;  1AU7 A;  2HQA A;  1SD5 A;  2QGU A;  3TOA A;  4M73 A;  3F8C A;  4GRI A;  1IV8 A;  3HPG A;  3OYN A;  3CJQ B;  3BR0 A;  2HNH A;  2WWY A;  3GFI A;  1SMY F;  2AHQ A;  3GW2 A;  3QPS A;  3OYM A;  1DU0 A;  3JRD A;  3BQZ A;  3CO7 C;  2M7A A;  4WX9 A;  1DP7 P;  3OR2 C;  4RMN A;  2EA4 A;  3H1C A;  1P4X A;  1A6Q A;  2JT1 A;  2PG4 A;  3IRQ A;  3FIW A;  2V6E A;  2BY0 A;  3DBH B;  1VQM I;  3PSF A;  2VAS A;  4HX7 A;  1ZK8 A;  4F3Q A;  1I6X A;  2HYJ A;  4I7H A;  3BG6 A;  3ZN0 A;  3I59 A;  4LB5 A;  1MBH A;  4M6Y A;  1YRN B;  3SHF A;  5ILU A;  1LVA A;  2ZSH B;  3H92 A;  1Z6T A;  4DYR A;  4WK8 F;  3CUO A;  4Y13 A;  2JMW A;  1WJA A;  1V5G A;  3R61 A;  3JRA A;  1U3E M;  3OYH A;  1SC7 A;  5ICF A;  3VDX A;  2Z3Y A;  3MVP A;  2AQE A;  3N4M A;  5BPI A;  3F8M A;  5DM7 F;  4GGG A;  5HS9 A;  4PJM A;  4IHY A;  2ZB9 A;  3SFZ A;  2A6T A;  3LFU A;  2RDP A;  4WWC A;  2K85 A;  3BR1 A;  2AS5 F;  1HDP A;  1FT9 A;  1KU9 A;  4UVB A;  2R7R A;  1O57 A;  2NYX A;  3GTJ J;  1K79 A;  3HKZ N;  4TV7 A;  2QM3 A;  2BYV E;  2E1N A;  4GO1 A;  3GBG A;  1BJA A;  2O8X A;  3N05 A;  1B8I B;  4NC8 A;  1RUO A;  4NUB A;  4DNC A;  4M9X A;  2NVY J;  1Z6R A;  3Q5F A;  2XB5 A;  1K78 B;  2F4M B;  2MG4 A;  3HSF A;  2L0K A;  3BG5 A;  3RPQ A;  3PM1 A;  5K7Z A;  3KEY A;  1IRF A;  1D0X A;  2DT5 A;  1KQ8 A;  3P9C A;  4RBO A;  3C18 A;  1HST A;  4ZH4 F;  4BJ5 C;  1OR7 A;  1KQ0 A;  2KL4 A;  2BY2 A;  4BQN A;  1ULY A;  1B72 A;  3S2W A;  3ULQ B;  2R7X A;  2HDW A;  1IXS B;  2VN2 A;  1DPR A;  3WGH A;  5EF6 A;  1LDK B;  1ZN2 A;  1TP4 A;  2VLA A;  2E60 A;  5E8G A;  2G7U A;  5C4X J;  1MKM A;  4DYQ A;  4UVA A;  5EZG A;  2A07 F;  1FYM A;  3Q0U A;  5HOO A;  3IWF A;  1O3R A;  4A5M A;  2DA2 A;  4IRH A;  4A3J J;  3KP3 A;  1Z1D A;  4ZDP A;  1ETX A;  2A5Y B;  3RJP A;  1LFP A;  1TLH B;  2EIJ H;  4GXO A;  2QKM B;  4MTE A;  2VJI A;  1EH6 A;  4AIH A;  2ZCW A;  4CUG A;  2DDB A;  4CZC A;  1NK3 P;  1YW7 A;  2QQB A;  2DMN A;  1JJ8 C;  3O8H A;  2VB6 A;  3IUO A;  4JK1 X;  4ENM A;  2FNP A;  3ZMD A;  1T6S A;  1FJL A;  1QGP A;  4L5E A;  3NAU A;  1U0J A;  2KJB A;  3WHC A;  2LOO A;  1STZ A;  1WCM J;  4D9J A;  5BMZ A;  2LBF A;  5F0C A;  5KVR A;  5CQE A;  4LLG F;  1R23 A;  3QU6 A;  5FJ8 J;  3UKG A;  1BBY A;  4AU7 A;  3ZMU A;  3W2V A;  4IZZ A;  4WCG A;  3D1N I;  2VPL A;  3V7S A;  5L3F A;  3BG7 A; 
#chains in the Genus database with same CATH homology
 2K3P A;  3H9J A;  1D0Z A;  3DU6 A;  4IKF A;  3PUB A;  3HOS A;  5FRN A;  5LFA A;  2KZV A;  2BVM A;  3OYE A;  2M0M A;  3TMO A;  3VYT B;  4DGW B;  4E7L A;  3HG9 A;  2X1E A;  2Z1D A;  3DWL E;  2V26 A;  2FUG 2;  3SZG A;  2BW3 B;  3K4C A;  4B3X A;  4DOZ A;  5HVQ C;  3OYD A;  3L2U A;  4ZJZ A;  2XF7 A;  1MND A;  3BC8 A;  3QYB A;  5FRO A;  5HLT A;  2CV2 A;  3FHN A;  2P0W A;  3PFY A;  4BJT A;  4BU2 A;  3S3N A;  3I3L A;  1JI8 A;  2ZFU A;  2F6C A;  1D1A A;  2VKD A;  1QHG A;  2E5N A;  2UUZ A;  4XMY A;  2PMZ A;  2MAB A;  2X6Y A;  3OS1 A;  3L2Q A;  3PJR A;  2GOM A;  4B43 A;  2CV0 A;  4ZTF A;  2RNG A;  2WA0 A;  2MFZ A;  4PFO A;  4B47 A;  3OOU A;  4E7K A;  2WB1 A;  4XON A;  3LMM A;  3H9Q A;  3UNG C;  4C2T A;  1FMW A;  2R7O A;  2M3A A;  2VL8 A;  1OLT A;  4II2 A;  1WJF A;  2ZXI A;  4Y3O A;  4YEJ A;  3RCO A;  2JVG A;  3RSN A;  4XM3 A;  2CS3 A;  2X51 A;  4BGD A;  3QYE A;  3L2R A;  3FBI B;  2BOL A;  2VKH A;  2MD0 A;  3VSK A;  4XOT A;  3M8J A;  2R7S A;  1YX3 A;  3M1C A;  3A1Y A;  3EUH C;  3HUG B;  5FRM A;  1W36 C;  5KCM A;  2PJR A;  4HSR A;  1MMD A;  1Z7L A;  2X1C A;  2IS6 A;  5HNH A;  3QYF A;  1DP3 A;  4DIQ A;  1TZL A;  2XSJ C;  2R4G A;  3HL2 A;  1J09 A;  2KDO A;  3DPT A;  3OYK A;  1LVK A;  2HVR A;  4CCJ A;  3OL3 A;  3H0D A;  2X85 A;  3UR3 C;  4IX7 A;  2KLO A;  1N78 A;  2LY1 A;  3CF2 A;  3RQ4 A;  1WJD A;  1BR4 A;  2NOJ B;  1E0E A;  4D1Q A;  1K6Y A;  2R7W A;  2AQF A;  4JQF A;  1YE9 A;  3CP8 A;  1MMA A;  3A4C A;  1T0F C;  4IQ4 A;  1TT0 A;  3K10 A;  3HKZ A;  2VQL A;  1LKX A;  4E7Z A;  4ANJ A;  1QU3 A;  4Y33 A;  4BL0 B;  1Z21 A;  4KT6 A;  2F5V A;  1N77 A;  3MKZ A;  1R6R A;  4CA0 A;  3OYL A;  4FET A;  2WAF A;  4ZDL A;  2VQG A;  3DEE A;  3K4M A;  1T95 A;  2IGM A;  4U7B A;  3OIP A;  1NG7 A;  1PYV A;  2VXZ A;  2W4S A;  3H9G A;  3OL4 A;  3AL0 C;  1DGW Y;  4FAS D;  2LH9 A;  2V1N A;  5KHD A;  1X1B A;  2CUZ A;  3DPU A;  3LSM A;  4F52 A;  2KRH A;  2Y0S A;  3ZXS A;  2XF6 A;  4F92 B;  1VZ0 A;  1Y6I A;  3IP4 B;  4OAY A;  4E4H A;  2IS4 A;  2UV1 A;  2F4I A;  2ZXH A;  2LYC A;  3DQV C;  4XLA A;  4F91 B;  3OYI A;  2M4K A;  3DKX A;  2JVH A;  2LRE A;  2ZSI B;  3A2K A;  4RLF A;  2MC4 A;  4RM2 A;  4ZDO A;  5TGT A;  3VSL A;  2LBF B;  3EPZ A;  3ZGK A;  4BE1 A;  2KRC A;  2XDV A;  4BXF A;  4BS9 A;  2JA2 A;  1X4P A;  3K4B A;  3PNV A;  3CZ6 A;  2OC6 A;  4E7J A;  4LIV A;  2XF5 A;  3PSI A;  2K5C A;  2E1M B;  1X1A A;  3AFH A;  4DBR A;  4XLE A;  3HPH A;  3ZRG A;  1UAA A;  2WY8 Q;  3CJR B;  3OR1 C;  3AKZ A;  4NNJ A;  2VJ5 A;  4PK4 A;  4N4N B;  2VIX A;  4CH7 A;  4XR6 A;  1UG0 A;  2KQR A;  2IGK A;  2VJJ A;  3OY9 A;  1BR2 A;  4II3 A;  4ITV A;  3OMY A;  4Y4R A;  2DCE A;  4XKW A;  3OIQ A;  4EAT A;  1MNE A;  4XQF A;  3BLY A;  4IQJ A;  3OYJ A;  4HST A;  4KJZ A;  4C9Y A;  1KON A;  3KYL A;  3CMM A;  2W00 A;  4NQW B;  4ZC3 A;  3S3M A;  4H4K C;  3BCA A;  3MMY B;  2V9K A;  3SYT A;  2VQH A;  4F93 B;  3F9K A;  1WJB A;  4CSW A;  2I8D A;  3W3C A;  4MLO A;  2HVQ A;  1BOB A;  2DOA A;  3MKY B;  2X1D A;  4CCM A;  3FDY A;  4BE0 A;  4HPQ A;  3K70 D;  4DJA A;  1D0Y A;  5CPR B;  1Z3X A;  3OWT A;  4QPO A;  4BDZ A;  4RLQ A;  3HXL A;  2JUG A;  4E7H A;  4C2U A;  1PJR A;  3ZCO A;  4ZYA A;  2V4J C;  3LSI A;  1MMN A;  1OR7 C;  2WAD A;  4BQO A;  1IRX A;  3K4J A;  3S93 A;  1BR1 A;  2IGO A;  4HNT A;  4E7I A;  3ONQ A;  3L2W A;  2X6X A;  1WFX A;  2PJR B;  3CES A;  3L2V A;  2ELJ A;  3HC7 A;  3VYS B;  1X4O A;  4PSW A;  2WBM A;  3W2W A;  4CCL A;  3E1S A;  2WAQ A;  4BUP A;  2W82 A;  3LSH A;  4LIT A;  4XL9 A;  2CH0 A;  1D1B A;  1FMV A;  2Z2S B;  3OYF A;  3D5R C;  4HRI A;  3DTE A;  2KMU A;  3MD2 A;  4AVZ A;  1Y56 A;  4BQQ A;  2VQC A;  3S3O A;  3LL7 A;  4QPQ A;  4BAC A;  2DT6 A;  4J01 A;  2MYS A;  3SEQ A;  2JSP A;  3ZQQ A;  5KNL A;  1V5E A;  3DLA A;  5CQG A;  2LRD A;  4N4O B;  2L9S A;  3OS0 A;  3K4L A;  1QHH D;  2CV1 A;  3EUA A;  3DPL C;  1EA3 A;  1ZEL A;  1X1C A;  4AYB A;  3H5R A;  1G59 A;  1G8X A;  2HPM A;  3C2H A;  4PJN A;  2CW7 A;  2Q1Z B;  4OWR B;  3DKY A;  4BEH A;  2HZD A;  2IS2 A;  3TBI A;  2OUM A;  1GLN A;  3BCB A;  2KPM A;  3NWT A;  2LY2 A;  2IS1 A;  3FKJ A;  1HA8 A;  4PJJ A;  4HG2 A;  4C30 A;  1WJC A;  3KX2 A;  4HNU A;  1V5F A;  1DGR M;  1WJ5 A;  2M7B A;  4G6T B;  4XOR A;  3SEZ A;  4XNF A;  4ZTJ A;  4F55 A;  2K9L A;  1Z3Y A;  2XC7 A;  2E1M C;  2L5Q A;  3SDB A;  3DTI A;  3PNY A;  2KP6 A;  3OYG A;  2HQA A;  3K6G A;  4BE2 A;  4GRI A;  4XLF A;  3HPG A;  3MKW B;  2QKL B;  3OYN A;  2VJ4 A;  3CJQ B;  2HNH A;  3CP2 A;  2HPI A;  2LC2 A;  1N75 A;  3OYA A;  3OYM A;  3E0J B;  3IAM 2;  4PUS A;  3D5S C;  1SAU A;  2BW3 A;  2M7A A;  4B48 A;  3OR2 C;  4RMN A;  1MW7 A;  4PJL A;  5CKT A;  2R7Q A;  3VYR B;  5HNF A;  2V6E A;  3RPU D;  3PSF A;  2VAS A;  4XKC A;  4F3Q A;  1NG6 A;  3BG6 A;  2CFO A;  3J7A Y;  1S9H A;  2ZSH B;  2UWM A;  3C2G A;  1WJE A;  3I9V 2;  2WAE A;  2OV7 A;  5LD2 C;  1WJA A;  1V5G A;  3QOE A;  3H5N A;  3OYH A;  3FBN B;  3V42 A;  4PSX A;  3VDX A;  2AQE A;  3PL8 A;  2LG4 A;  2CMP A;  4PJM A;  3EUK L;  2A6T A;  2E5Z A;  4CCK A;  3LFU A;  2O5R A;  3RTR A;  4XLH A;  3K70 C;  4YRV A;  2R7R A;  2Q2E B;  3PNT A;  4P1W A;  3DTK A;  4XLC A;  3TL4 X;  4HEA 2;  3QOD A;  3LSK A;  4B44 A;  3GBG A;  2W1O A;  4LIU A;  2VXD A;  3N05 A;  4NC8 A;  4U87 A;  4NUB A;  3ZR8 X;  4J00 A;  1W36 D;  4CCO A;  3W2A A;  2Z16 A;  4XKV A;  1X19 A;  3OS2 A;  3KEY A;  2WY7 Q;  4PFP A;  2R7U A;  1D0X A;  3H5A A;  3IAS 2;  4XKB A;  2R7V A;  4BJ5 C;  3DU5 A;  2GOX B;  2KL4 A;  3D5L A;  4BQN A;  1X1D A;  2R7X A;  4XN3 A;  4E7S A;  2HDW A;  4KIS A;  1YX5 A;  2L7K A;  4LG3 A;  4XOP A;  1LDK B;  2KHM A;  2DT7 B;  3OYB A;  3LSG A;  1SFK A;  1ERD A;  2VLA A;  2E60 A;  3S32 A;  3K4K A;  3S8P A;  2HU9 A;  3VWB A;  5HOO A;  2XAU A;  2BVL A;  2RRE A;  4BDY A;  2CW8 A;  4KIT B;  5JHF A;  4OAZ A;  4ZDP A;  1P9Q C;  1LFP A;  3OYC A;  2L2O A;  4P5O A;  4R79 A;  2QKM B;  2CUJ A;  1AA7 A;  2VJI A;  3H35 A;  1MMG A;  4YEL A;  4CUG A;  2IXS A;  4CZC A;  4JOM A;  3VYU B;  4BJ6 C;  4BEH B;  2VB6 A;  2R7T A;  3K4N A;  1D1C A;  3IUO A;  2M4G A;  2W7N A;  2A5W A;  2DJI A;  2HVS A;  1U0J A;  3NWS A;  2LOO A;  3HOT A;  4D9J A;  4X0G A;  2LBF A;  4DBQ A;  4E6K G;  4NC7 A;  5CQE A;  3AL0 B;  1UEL B;  2V7F A;  2DXI A;  2RQQ A;  4XN0 A;  4CCN A;  4AU7 A;  2IGN A;  2X6W A;  2L9N A;  3W2V A;  4IZZ A;  4RM3 A;  3U21 A;  1DQU A;  2VPL A;  2K9M A;  3G2B A;  3BG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...