3DLLF

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
KTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3dllF00
1VQPI 1HC8A 1YJNI 5DM7F 3CF5F 1VQ9I 2QEXI 1YIJI 3CCQI 3I55I 3CCUI 1YHQI 1YJWI 1VQOI 1MMSA 3CMEI 2H8WA 2ZJPF 3PIOF 3CC7I 3CMAI 5GAGJ 1S72I 3CC2I 1FOWA 2NXNB 3CD6I 1VQNI 5DM6F 1YI2I 2ZJQF 3CCRI 1FOXA 3DLLF 3CCEI 3I56I 3G71I 1VQKI 2E35A 2FOWA 1VQ4I 3CJTB 3CCSI 5JVGF 5GADJ 3J7YJ 4IOCF 4UY8I 3CCMI 1QA6A 4IO9F 3CCJI 2JQ7A 2K3FA 3G4SI 2E34A 2OTJI 1FOYA 4V19K 1ACIA 3J7ZI 2QA4I 3CCVI 1VQ5I 3G6EI 1VQMI 5GAHJ 3CCLI 2OTLI 1VQ6I 3PIPF 1Y39A 1VQLI 1YJ9I 5GAEJ 2ZJRF 1YITI 4IOAF 2E36A 1VQ7I 3CC4I 1VQ8I
chains in the Genus database with same CATH superfamily
1VQPI 4Q4ZF 2GXBA 4N0BA 1YJNI 1I50J 2E2IJ 1GT0C 4F52A 1HDDC 2ADUA 2OZ6A 4CCOA 4PZJA 5FFZA 3SZTA 1UHWA 3FHZA 1ZGAA 1YG2A 5HOOA 3RPUA 2L4MA 1FX7A 2LKXA 2L7ZA 4XRFA 3FMQA 1H0MA 5FLMJ 3BZ6A 3O2PE 2EB7A 1TQMA 2BV6A 3CJNA 2FE3A 4DW6A 3T8TA 1JUMA 3A1YA 3TQNA 4XM3A 1PP7U 4EGZA 3CC7I 3S15J 2V26A 3CUQB 4AD9A 2XGEA 3E6MA 2UZKA 5GAGJ 2DQRA 3DEWA 5H2FC 3I4PA 3V4GA 1YQAA 2CG4A 3TW7A 1JHHA 2VKDA 1OYYA 2BEOA 3LSIA 3ECOA 2BVMA 1USSA 1V54H 5CQEA 2AQFA 2DI3A 3FXKA 5CVVA 3A03A 5IOYA 1XMAA 2M9HA 3QYFA 3FXJA 3ECHA 1K4TA 2X1DA 1X4PA 2DJNA 2F4OB 1OR7C 3W2AA 1LFPA 1GLNA 3DCFA 1JTXA 2JT1A 3CF2A 1KZHA 3CCSI 3SQNA 5L3EA 3HBLA 4ZYAA 4XKWA 1WSUA 2BXYA 5FRMA 1B72B 1K78B 1PP8F 1IGNA 1DU6A 5KVRA 1AU7A 2OAZA 2L0KA 2W4SA 3ZQQA 2VBYA 2BE5F 4LIUA 1MJAA 3BR3A 4AIDA 2DA6A 3JRCA 2XSJC 1ACIA 4G6DA 4IRIA 4PSXA 4L0ZB 1R4MB 5E1ZB 3CCVI 2P5LC 4A2UA 4C3IJ 1IV8A 1KQ9A 1MDMB 4CCJA 3DTIA 4YEJA 2B7EA 5BS6A 3GXOA 5GAHJ 1B59A 2L02A 2CQXA 2EV5A 3F8NA 3I0TA 1IC8A 3JTHA 2M0MA 3CCLI 4WX9A 2PMHA 3CO6C 4LB6B 1JT6A 2I8DA 1SMYF 2OZUA 2QWWA 3DKWA 3AG2H 4BS9A 2EILH 4C30A 3WG7H 2DO7A 4BBRJ 3VFZA 5CVJA 3D0SA 4IQJA 4LG3A 3BC8A 2M7BA 1YIOA 1X1PA 1PUFA 2W48A 4KN7X 3O6BB 4HQEA 4KMFA 2CUFA 1D0XA 2CYYA 4PJLA 5ILUA 1J59A 5AONA 4NHJA 2M2EA 4ZJZA 3CJRB 4LGWA 3GTPJ 1KQ8A 5CYVA 1X1AA 4F55A 1EA3A 3MZ8A 4I98B 4B3XA 2ZNZA 2NOGA 2HQAA 1AKHB 1WWXA 4U7BA 4KDPA 3LSTA 5ICEA 1AA7A 3HKZN 3CCUI 2ZXJA 4NQWB 5FFXA 4PCQA 2K9QA 3D5LA 2DOEA 3V42A 2XF6A 2C6YA 1FMWA 2O61A 2D1HA 2IRFG 3TDUC 2ID6A 3ZMDA 1UAAA 2RV8A 2R92J 3H5AA 1X3UA 4BNCA 4D5CA 1Z6TA 1OMIA 2X85A 3QQAA 1Z3YA 2XDVA 5HLGA 3GZ6A 1E2XA 3T5XA 2LY1A 4HA8A 2L54A 4RM2A 1S72I 3JRIA 3J7AO 3M8FA 5EG0B 1WZ2A 5JLXA 3EPZA 3KEYA 1X19A 1R58A 1FP1D 1DP7P 1QZZA 5K7FA 4U0VA 2NVUB 3I4MJ 2DFEA 3KZZA 1JTYA 2E7WA 4EM1A 4V2FA 4G9YA 4AWXB 3BTJA 3WODF 2H6CA 2UXXA 2BY1A 1I6HJ 2E1MB 1DGRM 2CJJA 2KFDA 3L2VA 5A2QZ 4OIOF 1GVJA 1JGGA 3MN2A 1SVOA 3OR1C 3E6BA 2HYFA 2KZVA 5D5VB 1BR2A 5KAFC 3DF8A 4E7SA 3LA2A 1MNEA 4DOZA 4ZYDA 1YO5C 1S9HA 2KLOA 2K3FA 2EA2A 5CPRB 3GTKJ 2OPTA 2F6CA 1T98A 2JA2A 2HOAA 2LMDA 3K0LA 3L2CA 5EEHA 4LB5A 1P2FA 3WHCA 3FISA 1ITYA 2A61A 3WG9A 4WWCA 2JN6A 2KIQA 1YS7A 2CH0A 2PMZA 3LA3A 5JR3A 3J81K 3TBIA 3M1CA 5D5XB 3BQYA 2ELHA 3LQQA 3UR3C 2R7QA 3KP7A 3WU0A 1RIOH 4OIPF 1FIAA 3S14J 5AIPA 2DT7B 3KLOA 3K1MA 3GFJA 1SFEA 3OV8A 1QGPA 2A6HF 5HDKA 4EJWA 2IVMA 1E17A 1S5LC 4UV9A 1NK3P 5GP9A 4YIIA 2W84A 4IOAF 1P7IA 2WB1N 1IUFA 2LVSA 1A35A 1MJBA 2IBDA 2FOKA 3D5RC 2O9LA 4YIFA 1O3QA 3HTSB 4YFNF 2EA4A 1H9GA 3K2ZA 3RJPA 2BOLA 3NQOA 3VOEA 2H27A 1P6RA 3TW6A 5F1JA 1UHSA 3HDDA 2W57A 2DT6A 2QVOA 3R0JA 2IS6A 5IP9J 3DEUA 3QU6A 5M5WJ 3GTLJ 4RGXA 3E6DA 2L7FP 3ERMA 1R5GA 1QHHD 1P4XA 1U2WA 2IGMA 3QPSA 3W2WA 1VTNC 2ZFUA 4NC7A 2D5VA 4YFXF 1V4RA 4NBQA 1WHUA 5L3CA 4E7KA 3RI4A 2IGKA 2Z33A 2IAIA 2W25A 2HTSA 5HDGA 2M4GA 3LSRA 2RC4A 1ZELA 3ZRGA 2XB5A 3FK7A 2VQGA 2WWYA 2YSRA 4ABZA 3GTJJ 1TTYA 3OY9A 1MIJA 2H94A 3BY6A 5F04A 4I2OA 2CQ7A 5HLIA 1ENHA 3FMSA 4DZJA 3KFWX 1JUPA 2E1CA 4M74A 4ZDPA 3MWMA 2DPDA 4R8HA 4I76A 3WHBA 4D0PA 1KU7A 1GV5A 2FD5A 2EIKH 1B8IB 3MMYB 3GZ5A 5HLTA 1FZPB 1U9NA 1SFXA 3C2HA 4A6EA 5LRSA 3EQLF 3QOPA 4HSRA 2LP0A 2HVSA 2K85A 4S0HB 1UB9A 4BBSJ 2OTJI 1HA8A 5EDNA 3K1PA 1XGSA 3FM3A 4RB2C 3LSPA 2O6GE 3E0JB 1LKXA 4FCYA 1QBJA 2V9VA 1CF7B 4BDZA 3EETA 3DEEA 4GRIA 2P5KA 1IXSB 1IXRC 2L2OA 2K3PA 5HNFA 1IN8A 1X1DA 1Z77A 2CSOA 2BVLA 4BY1J 1IRFA 2DMUA 2O03A 5J4VA 3WE3A 3C18A 3K6GA 4NNJA 3HRSA 3J80K 1C0WA 3WTSC 1XCVA 1IDYA 2MLGA 3ML6A 2XC7A 3H3ZA 1YITI 3SDBA 2HPMA 1MD0A 1JUSA 3O8HA 1VQ7I 4Q47A 5KAIC 2ZXIA 2IA1A 1A36A 3H35A 4BAYA 4EMSA 5J40A 3EUHC 2LY9A 4F91B 3Q9VA 1Z0XA 2QEXI 5F6FA 3CP2A 2HNHA 1BW6A 3PSFA 4HX4A 3RKQA 2V1NA 2LTPA 4LJZF 5LLQA 3VWBA 1X3ZB 2P6SA 2M8EA 4CCLA 5J8CA 3HSEA 2X48A 2YS9A 4JX5A 5DUIA 2ICWG 3A0BC 1XB4A 3EUKL 1R36A 4A0YA 1ZK8A 4M3GA 3BROA 1T08B 2ZBKA 3BG6A 2NNNA 5HODA 2MLKA 1LE8B 1EJ9A 1AWCA 2CUEA 2MD5A 3DQVC 4QWQA 2L3DA 1FSHA 1WKMA 1YRNB 2H09A 3WTTC 1ZGWA 2HQRA 3E5UA 2CMPA 1MSEC 3OYMA 3I54A 1H8AC 1W0UA 2X6WA 4PGHA 5C4JJ 3H3UA 3KX2A 2PN6A 4YIRX 2L9NA 1JT0A 2ACJA 1DU0A 3BR6A 5HNHA 2M45A 2F2EA 1T2KA 3K4CA 4M6YA 1DDNA 3DU5A 3CCJI 3TGNA 5CLSA 1JKPC 3ZMZA 2K86A 3L00A 1ZR4A 3KE2A 2JQ7A 2COMA 2F5CA 5F0CA 2DXIA 3Q9SA 1FY7A 1FOYA 4O5VA 1TWCJ 4CZZA 5FB2A 2A6TA 3IAS2 1Y1WJ 5EZGA 3KYLA 3WTVC 3V8JA 1D5YA 2ID3A 2A05A 3D5SC 3GW2A 2CFXA 1SD6A 1ETYA 5TRDA 2ZMEB 3K69A 1XSDA 1VQ6I 1WJDA 1MNDA 5HDNA 4N4OB 5FGMA 4YRVA 3JCUC 1T0FC 1FC3A 1WI9A 3S2DJ 1JJ8C 2KIMA 3Q3SA 5K5RA 1LVAA 4E7HA 4A3IJ 1L3LA 3PO3J 3BJOA 2HXOA 1WJEA 2E5NA 3CLOA 4DBQA 1ULYA 3F8BA 2NS7A 2ZC2A 3EUHA 5L3BA 1LEAA 1LNWA 2XRLA 5IYCJ 3RYPA 5D8KB 3D1NI 3CCQI 1W1WE 4UUSB 2J5PA 2MW8A 1B4AA 1ETWA 1A6QA 3TO6A 4ZZLA 1D0ZA 2IA0A 5FROA 2J5OA 1CGPA 4OIQF 4UXNA 1FYKA 4BL0B 3HRTA 3M4OJ 1QQIA 3O8GA 4RLQA 2IS2A 1X1CA 2A5YB 3JTGA 3LSHA 2PJRA 1VFCA 2IS1A 3MFKA 2DAOA 2G7HA 3LSMA 1IW7F 1I5ZA 4RAYA 3TOBA 4O3MA 4U87A 3IH2A 4X0GA 4XSZF 4CA0A 5ICCA 2DMQA 2GOXB 3I53A 1Z7LA 3SEZA 3K9TA 2R7ZJ 3F6OA 1R6RA 2M1BA 2X0LA 2XKOA 1R9TJ 4GO1A 5LGTA 5FKOA 1I3AA 3SZGA 2LY2A 4X6AJ 3FXQA 2V1XA 4MGRA 4Y4RA 3AG3H 5JHUA 3FXMA 2YUSA 1T38A 1PDNC 2TDXA 1MH3A 2CS3A 3E3VA 1P9QC 5BPIA 2W24A 2GQQA 1JXSA 3CMMA 3NWSA 4RB0A 4EV0A 1MMAA 1YTYA 1FNNA 2ZFWA 2DA3A 3S3MA 2AHQA 2CO5A 3L7WA 3KLNA 5J6XA 4ENKA 2JPBA 2ELKA 2JA7J 4UB6C 2ISYA 2JRMA 4RM3A 1MZBA 3CUOA 4DIQA 1S7EA 3ZQHA 5FD6A 3ZQGA 4G7HF 4DGWB 2ZSIB 3V7CA 2QSGX 2O5RA 1X3WB 3DTEA 3K70C 1OKRA 5JVTA 2VPLA 2E5ZA 5IT9Z 1ON1A 3VYSB 4HDUA 4YG2F 4A3KJ 5AIQA 2GXGA 1UFMA 1U0JA 2RAEA 1IJWC 4RAZA 1JKOC 1BA5A 1YE9A 1BW5A 5FO5A 4RBOA 3AKZA 5B1AH 3PM1A 2ELJA 2E2HJ 2EINH 2PI0A 5E3LA 1ZLKA 2YX7A 5IP6A 2FJ1A 3R0AA 3PQKA 3SEQA 5LD2C 5IP7J 1ZHFA 1HC8A 4RS8A 2Y2ZA 2JUGA 2HTJA 1G59A 3LQRA 3RCOA 3RQ4A 1FLIA 3M3YJ 5E20A 2FUG2 1VQOI 5ILSA 1FMVA 1ZARA 1KYZA 2X6YA 3HG9A 1RR8C 2HU9A 3CMYA 4HF0A 2QBYB 1Z21A 3BR2A 3QWLA 5GTIC 4PJNA 1B9NA 1FOKA 4M6VA 2CWEA 4IL6C 4MO7A 3L1PA 3PIOF 3S93A 4GCVA 1X2NA 3TDZC 2VBWA 2WTEA 1F1ZA 1O3TA 3H92A 3GFLA 1I6XA 2CQNA 4B44A 5EGOA 2FF4A 2NYXA 1LFBA 2VQCA 5HLHA 2FQ4A 2FNPA 2F5EA 1SD5A 5LBQA 3JSPA 3CDHA 1RKWA 1Z67A 2E60A 2WAFA 1LDJA 3JRAA 4GDFA 2QSFX 2QCOA 3TOAA 2EFQA 2H1LA 2MG4A 2CW7A 4AU7A 3CLQA 4M3DA 3R4KA 3JRDA 3PO2J 2XF7A 3I56I 2XGCA 5EYRA 1JE8A 2LBFA 1TNTA 5E1WA 5DS9A 2K9NA 4UUVA 2NVTJ 1TT5B 3HL2A 2GM4A 1D8KA 4BXUA 2ZXHA 2QQBA 1G2HA 3BLYA 2BY2A 3NWTA 2PG4A 2QSHX 5FKNA 3RKXA 3SXYA 3SDGA 1R1TA 4E6KG 3UKGA 4K2EA 4XLAA 1XDSA 2E1OA 4RGRA 4WK8F 4XRMA 4IHSA 1PUFB 5B3SH 2FBIA 2GBYA 4HW0A 1FT9A 1PUEE 3QOEA 1T95A 3MD2A 4A6DA 1XDUA 1Z7UA 1IN4A 4P96A 4AUXA 3WGIA 2O8XA 2QBYA 3B6AA 1ZKGA 1FPQA 3BG5A 4AIHA 2QA4I 1MBHA 4XSXF 2HKXA 2WY7Q 5TJJA 4CSWA 1FBUA 4ANJA 4F93B 1HOMA 4AM3A 4KICA 3Q0WA 5F64A 4CCMA 4LK0F 2Q8KA 3U9GA 2R7SA 3GCMA 5EF6A 1VF9A 4R1HA 1RZ4A 2UV1A 3OIPA 2EV6A 3ERED 3QYBA 1YJ9I 4C3JJ 2ISZA 2JA6J 1ETQA 5H6QA 1JHFA 1T33A 2R4GA 3QAHA 5CKTA 1W4MA 1D0YA 3OMYA 1OCZH 3H9JA 3VSKA 5CVIA 5E3MA 3G2BA 1S6LA 1S8NA 4OAYA 3CO7C 3B02A 3CC4I 4A3DJ 1W36C 5LHGA 3PQJA 4MEXF 1YW8A 1U8BA 1N25A 3GBGA 4E7ZA 5DYMA 4LD5A 1ZG3A 1QNTA 5ICFA 2JSCA 2GXAA 1HDPA 5CQGA 4DBRA 1R71A 2V1UA 2JMWA 2LF7A 2MH9A 1IRXA 2DK8A 2WAQA 4QLCU 2KL4A 3WGHA 1YJWI 1KONA 3DPTA 3H36A 4I02A 5IOZA 3CMEI 5FD5A 3RSNA 3DTKA 3RPUD 3ZCOA 3RYRA 2TRTA 1UZCA 2Z2SB 2R5YB 1NHAA 4I09A 4HOBA 2K5CA 1ZRCA 1D8JA 2FBKA 2X9DA 1XSXA 3I58A 3MKYB 1BOBA 3HOTA 1KGSA 3CP8A 1G3TA 1R7JA 1EH8A 4ZC3A 2VJJA 2R5ZA 5DM6F 1Z9CA 1Y56A 1J9IA 1YX5A 3BG9A 3OOUA 4BJ5C 3IC7A 2YU3A 3SFZA 3LNQA 4IRHA 2GOMA 4A3BJ 1ODDA 1AHDP 4HF2A 5F0FA 4IPAA 1YI2I 1EKEA 2YU9J 3RPQA 2O3FA 5E1XA 3AAFA 3N97A 1YW9A 2XAUA 1BI2A 2FOWA 2P7VB 2DN0A 3VYRB 2ZKZA 4HX8A 9ANTA 3CZ6A 1OCRH 2HXIA 4LLNA 3LFUA 3E5QA 5A2QK 3GFMA 3WU1B 4UY8I 3CCYA 1Y8QB 5J1RA 5ED4A 2M34A 3ONQA 1Y1VJ 4KA4A 4DYCA 4XKVA 2WV1A 5J8FA 2IXSA 2EJRA 5D4RA 3F6VA 4H0EA 5IYBJ 1HW1A 3F9KA 3ZQ7A 1X1BA 1B1BA 4Y33A 3BR0A 2R5YA 3KP4A 1LQ1A 1I1SA 3DBRB 2XF5A 1W5CC 2DA4A 3A0HC 1S7AA 2VC1A 4H4KC 4N9IA 1OCCH 3S2HJ 3H5NA 1MNMC 3FX3A 5C4XJ 2HDWA 3H0GJ 3WTXC 4ESJA 3TP3A 2JA5J 2FSWA 3ELKA 1Y8RB 3F22A 1R1UA 2LKPA 3RZOJ 1ZRFA 4RB3C 1IXCA 1XD7A 4ESBA 2XIGA 3RIRA 4BQQA 1T6SA 2XSDC 4UVBA 2IGOA 1Z91A 1GVDA 3CF5F 2PMZN 2MYSA 3Q0UA 4M6XA 3CDLA 3X2QH 3GEZA 3WTWC 3I64A 2EV0A 2KRHA 1KU9A 2OF7A 4NUBA 2NNYA 1E3OC 2Q0OA 2CV1A 4B47A 4FX0A 1UELB 4D7NA 2XAJA 4AIKA 3IH3A 2IA2A 1X58A 2VJ4A 3TMOA 3S1NJ 2JUCA 5ILVA 2K40A 4OOIA 1R4NB 1XCBA 2OQRA 4L5EA 2FX0A 2H8WA 5BOXA 1W0TA 3JAMK 1MMNA 4ZTFA 2EIJH 1STZA 3EDPA 3SHFA 2RN7A 2DFIA 2DYSH 3C1DA 4G7OF 3TO7A 5DD4A 2KRFA 1OCOH 4IX7A 2X51A 3L9FA 2VKEA 3PL8A 2VLAA 4BGDA 2XAHA 2LC2A 4B4CA 3HYIA 5CVUA 2M7AA 1NG6A 2VN2A 2G7UA 1MBKA 4IHWA 4BJTA 5DUKA 3HXLA 3OYFA 2F5FA 3EUAA 4XNFA 5LEJA 2GWRA 1U5TC 2VXZA 2JJ7A 3OOPA 2HVRA 3AL0C 3S32A 5B1BH 2KPMA 3MKWB 2PMUA 3L2QA 2K02A 2R7RA 1SAXA 1MBGA 1TLHB 3HEFA 4FQGA 4IOCF 4J01A 2HDDA 1IO2A 2DMTA 2VXDA 3ZMUA 4EATA 3CCMI 4IVNA 3QRFF 4UNOA 3FWEA 3ABMH 4KYWA 5FJ8J 2A07F 3TL4X 4KNYA 1ZYRF 1A6IA 4G94A 3TP0A 4Y15A 2OJED 1Z1DA 2Z5UA 2K7LA 3SJMA 2DDAA 3MQ0A 1WJAA 1K6OA 3W6KB 4FISA 2VODA 3DPLC 2EZIA 4OU0A 2VI6A 3J7ZI 5FKMA 4M9SA 3PUBA 1DUXC 1E3HA 4AC0A 2FBHA 3C2GA 3GX4X 1YLFA 2UUZA 1XSVA 3MVPA 4L9VA 4LITA 3ABTA 2IP2A 3I59A 3I5UA 1XGMA 1WH7A 3R6SA 4BUPA 5HS7A 4A93J 4PSWA 4XLHA 1VQMI 4JX4A 3KZIC 2CQKA 2UXNA 4RGUA 4B09A 3BZCA 2M4KA 2LNBA 4P55A 3B73A 4ENMA 3AL0B 2ZJRF 2HZTA 2R3SA 1S29A 3K4LA 3R60A 2E36A 2NS8A 1K7AA 5IPAA 1TQPA 4CZCA 1ON2A 4I01A 1IN5A 2XRNA 3CTAA 2EIMH 3FK6A 1OYWA 3HPHA 4KJZA 3ASOH 1R1VA 3I55I 1HQCA 3V7RA 1AOYA 4B48A 4L18B 2V1DA 3HOXJ 2WV0A 3U1KA 2NOJB 1UG2A 3KP2A 1RR7A 2P6TA 2HI3A 2X1CA 1XS9A 3S1MJ 2DPUA 2JVGA 2MGQA 3OYLA 3OYCA 1HKTA 5BNGA 1IN7A 4WF2A 1WRJA 1OFCX 3K4KA 1BR4A 3LFKA 3FKJA 4IRGA 3A01A 3GWZA 4DYQA 4HDVA 3CC2I 2F4IA 4RMNA 2HYJA 4A3GJ 1XGOA 4HQMA 2XKPA 4L9JA 4ZYEA 1V5GA 1HXDA 5D6EA 3F72A 3HSFA 3L2RA 3IRQA 2I5UA 5EEAA 3BTLA 4CCKA 2V9KA 3T0YA 3M1EA 5E79C 4XL9A 1U5TA 5GTHC 5E18F 2NVXJ 1W7PA 1I1GA 4L9TA 4HLYA 2VJ5A 3ABUA 3Q5FA 1VQ4I 1XG1A 3CJTB 2L7MP 2P0WA 1QVUA 2IW5A 2O8KA 2FU4A 4P5OA 3S2WA 3RQIA 3M7GA 4XONA 2NVQJ 2AQEA 2DW4A 3GTQJ 2R7WA 1SD7A 3BTIA 1R23A 1XMKA 2PEXA 4MHGA 4Y3OA 1W5SA 2LFBA 3ROUA 4PJMA 4MFDA 3VPRA 1WJBA 3AG1H 3PNYA 1LB2A 3BPXA 4UUTA 2E7XA 2W1OA 3HTUA 4II3A 3DV8A 4FE4A 3C2BA 1F5TA 3ZR8X 4OMZA 3P5JA 1UCRA 2W00A 6PAXA 1FWZA 1P4WA 3V7SA 4MQ9F 4L5JA 2EFPA 4S05A 1NH3A 1F43A 3HSRA 4ZZDA 2LH9A 2R7OA 3GYHX 4CO8A 2XGDA 1U6GA 1ZRDA 1RI7A 2F4MB 4GYIA 3HGYA 2F5DA 4EJTA 3AFHA 3LSJA 4IJAA 4RDUA 4LG0A 2PJRB 4P9UA 4D1QA 3FBIB 3ZPLA 2ZNYA 1YIJI 2JA8J 1G3SA 2YX4A 4OMYA 2V7FA 3QP5A 3ZXSA 2M5WA 2ZJ2A 2VASA 3F8CA 2EPFA 2AO9A 2KRCA 2O7OA 4J00A 4A3MJ 3LWFA 3ZMSA 2IT0A 5EEGA 4IHVA 4BQNA 5C3EJ 4G6QA 1WVRA 2DODA 4M9ZA 2OU2A 3WTYC 4WXHA 4XLFA 3WE2A 3AG4H 1YX3A 3HOUJ 1IRZA 3GUDA 3QU3A 4HPQA 1PVEA 2DMPA 2BY0A 3M07A 3ZMTA 1JKRC 2KZGA 2XPUA 3VYUB 2DOFA 2VB6A 1YW7A 2ME0A 1GHCA 3CD6I 4M71A 3S1RJ 2CW0F 1XTAA 2LRDA 2VKVA 2XPVA 4EM2A 4EVIA 4O6JA 4B1RA 2D45A 2G9WA 3IUOA 4Q48A 2UWMA 2V79A 2XPWA 3BPVA 3BCAA 2JRTA 3IKTA 3CCRI 4BHPA 4IHXA 2FQ3A 2PFBA 2ZSHB 1QRYA 3PFYA 2E35A 1HF0A 2QYOA 2M30A 1P4AA 2HOTA 4XRSA 4UHTA 2K4BA 4ESFA 5KK1A 5GADJ 2HQ5A 4BJ6C 2DK5A 2K27A 2IPQX 3J7YJ 3S3NA 1TT0A 4ITVA 2YPRA 3HRUA 5J3LA 4CYCA 1BR1A 3BJAA 4XBFA 1XN7A 2OQGA 5KCMA 2F5VA 1ZH5A 2LF8A 3PNTA 3JSOA 2Y0MA 2DJIA 1F4KA 4QSHA 4OWRB 3ZMVA 2EQRA 4AVZA 1WJFA 1MJ9A 2RNJA 1OCTC 4NB5A 4ZDLA 4IEJA 2R0QC 3QYEA 4ZTJA 3GLLA 2FNAA 2OTLI 5IT9K 2VT3A 4MIMA 1VQLI 4A3FJ 2P7CB 4PFOA 2BBYA 1N75A 5DTDA 1HLVA 2LSOA 1EH7A 2DA2A 3MCZA 1UG0A 2QM3A 1T56A 4V2GA 4II2A 4GYGA 4HX7A 1DGWY 2JSPA 1SAUA 5FLXZ 5EGOB 1YS6A 2CGPA 1WCMJ 2HVQA 4GXOA 1B9MA 3G1OA 3K1NA 5HVQC 4UVCA 3OL3A 2JZYA 3N4MA 2WBMA 1DPUA 4KUMA 3LMMA 1ZN2A 1MMSA 2R7XA 1TWGJ 3E1SA 1ETXA 2E19A 3FM5A 2DOAA 5DCMA 2V6CA 1R49A 1BIAA 2BYVE 5J4YA 4OIRF 4P1WA 2LBFB 3KEOA 1N77A 2E2JJ 2GZWA 5M3MJ 1BJZA 2X6OA 2Y9ZA 5JFRA 3F8MA 3RDIA 2P81A 1BIBA 1OJLA 1H9TA 3DWLE 4IXAA 1RETA 3B6CA 1U9OA 1FOWA 3A2KA 1MW7A 1D5VA 3OL4A 3ZOBA 2GA2A 1S3JA 1Q1HA 1U3EM 1D1AA 2LG4A 1YFHA 3U1DA 1REPC 1GXQA 3GO5A 3KIOA 1VZ0A 1WJ5A 4CUGA 3OYIA 4CH7A 2CU7A 2MSYA 3KYDB 4BYYA 2KDOA 5TGTA 2EFOA 3IAM2 4W97A 3GZNB 3HB9A 4XN0A 3OS1A 4CGZA 4I0AA 3JRHA 3G71I 1R00A 3KCCA 3COAC 3WTZA 2OC6A 3KEQA 3ZP5A 2HEOA 1V5EA 1W5TA 2XHKA 3OWTA 5GPAA 4BH9A 4WCGA 3OYAA 4C2UA 1IG7A 1LEBA 4M9XA 3HZJA 2HOSA 4RLFA 1OQYA 3W6VA 3NAUA 2GAUA 1BM9A 2HKOA 2R7VA 1TNSA 3FXLA 1SEUA 2K9MA 1D3YA 2MC3A 4NC8A 3H1CA 1ONVA 2BW3A 3KETA 1BBYA 3FBNB 4EJOA 1A5JA 1Z3XA 5F08A 4XOTA 2H1KA 3L09A 5FLVA 4AYBA 2KKOA 3BG3A 4E7LA 1V55H 2EWNA 5C44J 4F7ZA 1R5HA 1WI3A 2DA1A 2QQAA 3V8LA 3U2RA 1J75A 1HW5A 3GMEA 1RUNA 1GXPA 2XAGA 2M8GX 1HKQA 1MBJA 4I6ZA 1VI0A 4LMYA 4PK4A 2KP6A 3LSGA 2DT5A 2Y69H 3OYNA 4CICA 1F9NA 3QPHA 4EJVA 4G8XA 2L4AA 4Z6YA 1LFUP 1R22A 2DMNA 4E7IA 1FSEA 2LYCA 4MLOA 1ZAOA 2OCEA 3H9GA 4MFEA 2VIXA 4PUSA 2VONA 5L3GA 4IHYA 1ETOA 2L5QA 5LRRA 2R5ZB 5DD8A 2W85A 3LA7A 1SANA 1BI1A 1FBSA 1XGNA 2EK5A 3F21A 3W2VA 1I39A 3R61A 4LIVA 1QVTA 5D5WB 2P5VA 2XAFA 2Y0SN 2Y0SA 4XLCA 4KIBA 4HF1A 3I9V2 2VT2A 1O7FA 2BHZA 3LAPA 4JX6A 2ZJPF 2VE9A 4JP0A 1ZTRA 1H89C 1U78A 1IZ1A 5DDGA 1HBXG 3J7AY 1JJ6C 3QODA 2CV2A 3ABLH 3IKVA 4E70A 2NAZA 1O3RA 2KJBA 2CFOA 1Y6IA 3BCBA 1K61A 3KPHA 2Y75A 3GTOJ 2BGCA 2CQQA 3SYTA 2N8GA 2WAQN 1IUYA 4BQAA 2EBIA 1JGSA 4XN3A 2MBFA 3BP8A 2WADA 4CCNA 2HWVA 2BXZA 2ZJQF 1F36A 1IDZA 1RESA 2KDZA 2ECCA 4LFUA 2GA1A 1TQIA 3P9CA 1W36D 4HG2A 4BHCA 1J0RA 2CV0A 2EFWA 4NDLA 3MKLA 4ENJA 1BI0A 1O3SA 3W6JB 2BZTA 4RA2A 2RKHA 1A31A 3F0CA 3CUQA 3DBHB 4UV8A 1QA6A 4IO9F 1RRJA 4QPQA 4BU2A 3DKYA 4UB8C 3ZQIA 4I0BA 3GLXA 3E6CC 4XLPF 1SFOJ 2GLOA 1O4XA 1DQUA 1TWAJ 2P4WA 1NG7A 1WJCA 2MD0A 5D6FA 3DBLB 3HUGB 1QPIA 1YYVA 3W3CA 1X4OA 3OSFA 4HLXA 2QQ8A 2KIUA 3HGGA 3LOCA 2Y48A 2HYGD 2DA5A 5LFAA 2JPCA 4HNUA 1MBFA 2E1MC 1QHGA 1WQ2A 2RQQA 5E17F 3MEXA 1KU2A 4HSTA 3ZN0A 3HKZA 2KT0A 3IP4B 4I7HA 4ZYHA 5LHHA 4HEA2 3K70D 2VE8A 4KT5C 1B72A 1K78A 4L0YB 3ABKH 5DV5A 2KISA 2X4HA 1OPCA 3LSKA 5GAEJ 4WXDA 5K5QA 4IKFA 2TCTA 3BG7A 3HOWJ 1JKQC 2DYRH 2FA5A 2BY3A 1MH4A 1KQ0A 3A4CA 1M1EB 2A69F 4XLEA 5D4SA 2H8RA 1VQ8I 3QP6A 1EF4A 2WA0A 1K6YA 4ON0A 2PLYA 2XVCA 2PQ8A 2FMLA 4XIDA 2LDUA 4XQFA 4I99C 1OLTA 1USTA 3ESWB 4EM0B 5JHFA 5KHDA 1MDMA 4DNCA 1VQ9I 1SD4A 4G7ZF 3S16J 3DP7A 4D9JA 1FJLA 3PJRA 2QUFA 2X1EA 1A04A 2Z9OA 2RVCA 5LGNA 1OCPA 4U0WA 3M8JA 1MBEA 1Z05A 5IT3A 1FP2A 2R7DA 2A5WA 2QGUA 1TWFJ 1Q1VA 1O57A 2X6XA 4M3EA 4BQOA 1OR7A 4C2MJ 3HUGA 3CMAI 4BEHB 3JREA 4Y52J 2JWTA 4DZPA 1G3WA 1GV2A 1TW3A 3BWGA 2D2WA 2IS4A 1NTCA 1X2MA 2WC2A 1SFUA 3BQZA 1Y0UA 3K4MA 3HOYJ 5CVRA 3OYJA 1AKHA 1HKSA 2OUMA 3PUFA 4TV7A 2B63J 5BMZA 4BDYA 1U8RA 4KISA 4PGGA 4DJAA 3OYEA 4NQWA 1RNLA 4XLNF 3N05A 2BHYA 3SFIA 3VB2A 1DPRA 1QPMA 1J7KA 3I59B 3QPTA 2L01A 2RDPA 2VQHA 1TC3C 1UMQA 4D7MA 3JRBA 1FEXA 3M8EA 3K2AA 3BDDA 2V9PA 2E71A 4NC6A 2DFHA 4XOPA 3OS0A 2RREA 2VOPA 1KA8A 1E3PA 3K4NA 5EJCA 3GTMJ 2YR2A 2CUZA 2LR8A 3BT9A 5EG0A 3T8RA 5BPDA 1VNDA 1WH5A 3C7JA 3WTUC 2HR3A 3JRGA 2VL8A 2VJIA 1FTZA 3F8FA 1FYLA 3SZPA 1GDTA 3P9KA 1RC9A 4ZH4F 1ORKA 4V19K 3OYBA 3RKWA 4PJJA 3DLAA 2XGXA 4PDKA 2MH2A 3IHUA 2H6BA 2EZKA 2WB1A 1ETKA 4R79A 5K1YA 1BC7C 3RZDJ 1LDDA 4HZFA 4M72A 3S1QJ 2DDBA 1FYMA 3VSLA 4IZZA 1UHMA 3J81Z 3ZGKA 4A5MA 3FHNA 3HHHA 5EZHA 1P92A 1POGA 2RQPA 2VKHA 2STWA 4X1EA 2EH3A 2Z99A 4KIFA 4BEHA 1H88C 5E8IA 3VDXA 3CESA 4MTDA 1I27A 5F0HA 3JRFA 2XUBA 4Z2YA 5IYDJ 3ZQCA 3IL2A 3H9QA 3A02A 3DU6A 4W1UA 5K5OA 1TL8A 1RPWA 3E97A 3JAMZ 1XPXA 1SFKA 3VODA 4AVPA 4F3QA 1QU3A 5K7HA 2EFNA 3ZQFA 1MMGA 3MZHA 4BXFA 3A01B 3FDYA 1T8IA 3KP6A 4XMYA 3BR1A 1HSTA 2XV4S 3E7LA 3I3LA 1WFXA 2VPRA 4XK4A 2AXTC 2V6EA 1PYVA 1R5ID 2JVHA 3UNGC 4ASNA 1DP3A 3REOA 4HYEA 3FF5A 2COBA 1WPKA 2G0EA 3IRRA 3Q0VA 5H20A 2PBIA 3K10A 1IAWA 2D1VA 4C2TA 2ME6A 1S7OA 2VBZA 4LOCA 4UVAA 4DYRA 1U5TB 1W7PB 1NK2P 3FKIJ 4D5FA 5LHIA 5HS9A 1LPQA 3O3KA 3BJ6A 3HC7A 3QPLA 3DKXA 3HRMA 3OYHA 3FZVA 1TP4A 2Y31A 4G6TB 5FKKA 3PSIA 4MNUA 4BE2A 4CHUA 3G3ZA 2KHMA 5TISC 4IQ4A 1BL0A 3FIWA 2KQRA 2XAQA 2LREA 1ZG1A 2A68F 3MAJA 4BE0A 4CYDA 1SVLA 4BHBA 2R7FA 1APLC 3OYKA 2Z1DA 1TBXA 1TW2A 1EH6A 1GUUA 2NRAC 2QZ8A 3DLLF 1KU3A 4HNVA 4ZYGA 4JYKA 5D8LB 4U88A 5M5YJ 1OISA 1G3YA 1V5FA 4XKBA 4HBLA 2R93J 4FHTA 1HCRA 2M0CA 1J2XA 4FX4A 4WXCA 3H3VK 5FRNA 2DCEA 4L5IA 3PNVA 2Y30A 4FETA 4Y7NJ 2VOOA 1XX5A 2ZO4A 3T1BA 1L0OC 2K4JA 3EYYA 2HOEA 2CRGA 3HPGA 5L3FA 2HGCA 3S8PA 3TKYA 4HV6A 2E34A 3HHGA 3NRVA 4L9NA 4KFCA 2R7UA 2K9LA 2QLZA 3V8KA 3VEPA 5M3FJ 1K79A 4LG0B 1CQTA 2W7NA 1JI8A 1N78A 3RKYA 1VQ5I 1ZLJA 2HPIA 4ETSA 5B66C 1V3FA 1FTTA 2F48A 2B0LA 1IF1A 2CW8A 2RGVA 3H5RA 2VC0A 3GFIA 3IH4A 2A3SA 3BTCA 4DQ2A 1K4SA 4KN4X 4FASD 2NS0A 1B8IA 3KP3A 2AXLA 3ZQLA 3TEDA 3P9IA 4M73A 4S04A 4GFBA 2DQLA 3I71A 1LJ9A 3J80Z 2XROA 1G6NA 3C3WA 1ERDA 4RAFA 2OBPA 4QIWN 4ZDOA 5ERIA 4Y13A 4YELA 2Z3YA 4BXXJ 3L2UA 2FEZA 2PX9A 4MEYF 2LOOA 1K83J 1CF7A 2DFFA 2LLKA 5J1YA 4JK1X 1BOAA 2WAEA 2L9VA 2KMUA 2MC4A 2ZMEC 3K4BA 4JQFA 3H0DA 3DXJF 3LL7A 3GTGJ 1MKMA 3OIOA 4QPOA 2KJCA 1RKTA 1ZG5A 2W82A 4C9YA 3PFIA 3S3OA 3KP5A 2HZDA 2HDCA 2FXAA 3FXUA 3BOQA 2JTVA 3M9AA 1KYWA 4OAZA 4CYCB 1XMXA 1FIPA 4B8XA 1BJAA 3CJQB 2Y9YA 3OSGA 3CDIA 1VQNI 3DFGA 4XRSG 1O7LA 4HNTA 4XKCA 2OD5A 4A0ZA 5ICGA 4XORA 1LUJB 3E5XA 5BQTA 3HOZJ 2XB0X 3OYGA 3HIFA 5KNLA 4A3JJ 2Q2EB 1FOXA 3CCEI 4BKXA 1FBQA 1W7PD 3KZYA 4HV5A 5JI6A 2O0YA 5F1RA 3G1MA 2E1NA 3IWZA 1LE8A 3RTRA 1J09A 3HM5A 2ESHA 2M3AA 1QZYA 1BN5A 2LK2A 4AIJA 5IY5H 2IGNA 3G73A 2IJLA 3ASNH 2HFHA 2L7KA 1YRNA 3HOSA 2DBBA 2ZXWH 4KIGA 3EYIA 3P7NA 4J19A 1J5YA 5LGUA 4IF4A 2FMYA 2VUMJ 1TWHJ 4OINF 2GIVA 3GVAA 3I4NJ 5JLWA 3OR2C 1SVMA 1EV7A 2K9SA 4RGSA 1T39A 4HAMA 2LD5A 2B9SA 5CJ9A 5J1UA 3PIPF 4EEFG 4A3LJ 1Y39A 2XASA 2V4JC 4EQQA 1RUOA 4RB1A 4Q5SF 5DCMB 2CUJA 4F92B 2QQ9A 3GF2A 5E3OA 2M87A 4LK1F 3F23A 1P7JA 2FRHA 1Z6RA 1ZGJA 3OIQA 5HS8A 5FKLA 3MKZA 3BZKA 5GPCA 2MFZA 2MA3A 2NVYJ 1MGTA 4YFKF 1LDKB 2MABA 3FXOA 4XICA 2OV7A 2Q2EA 3FMRA 4CDGA 1G4DA 1E0EA 2PJPA 5DM7F 5FLXK 4IHTA 2RNGA 1D1CA 3DPUA 5D5UB 1ETVA 4RAGA 4A5NA 1YHQI 2VQLA 4EJUA 2ZMEA 4MQVA 2GIZA 2KIFA 3KYCB 3MZYA 4PJ0C 3JW4A 2Z16A 1YOVB 3VYTB 4G12A 2ETHA 3F3XA 3U21A 4A0XA 3OYDA 2AS5F 3ZN1A 2OCCH 1D1BA 1IRGA 3IWFA 4FE7A 2P8TA 4KT6A 4BE1A 1SMTA 1QO0D 1ZQ3P 3NARA 4A12A 2DA7A 4FT8A 4Y17A 1ZREA 2NXNB 3G1LA 1B6AA 2A6EF 4KMUX 4BY7J 2DTRA 2QKLB 3K7AJ 2BW3B 5LEKA 1XC5A 1MSFC 2ESNA 2WY8Q 4HRIA 4PFPA 5E8GA 4B43A 4UUSA 1BC8C 4GGGA 1HW2A 2ZCWA 2L9SA 1MMDA 1G8XA 5B5EC 1BI3A 4E7JA 2QENA 2DTZA 3ISPA 4M3BA 4P9FA 5F27A 3TO9A 1VQKI 1LVKA 2L9RA 4QTRA 4U7DA 4EGYA 2DU9A 2JK3A 5K7ZA 5JVGF 3CQZJ 5DEQA 3L2WA 3HJEA 1IN6A 3FXRA 3S17J 5L3DA 1I3QJ 1PJRA 2LKSA 4C3HJ 4FTHA 1T0FA 4M3FA 4A3CJ 4JOMA 2HQNA 3NEUA 4MTEA 4N4NB 3ULQB 2DLLA 5J47A 2QF7A 1WGXA 3G4SI 4XR6A 2ECBA 1Y0NA 4N9HA 4BACA 2R7TA 4A69C 4U0YA 3WGGA 3OS2A 3G6EI 3LAJA 3WU2C 4E4HA 3CUQC 1ZR2A 1IV6A 3K4JA 3HOVJ 4A3EJ 2EZLA 4LLLA 4ENNA 1TZLA 1OYIA 2HS5A 3BR5A 1SC7A 5H6RA 4B3AA 3IV5A 2ZB9A 5E3NA 2QKMB 1HSJA 2VBXA 2IEKA 2STTA 1UJ8A 4CXFA 3JR9A 2EZHA 2Q1ZB 2OA4A 1QZEA 5DCFA 4KITB 4LLGF 5M5XJ 4JBAA 2I10A 4AYBN
chains in the Genus database with same CATH topology
1VQPI 1HC8A 1YJNI 5DM7F 3CF5F 1VQ9I 2QEXI 1YIJI 3CCQI 3I55I 3CCUI 1YHQI 1YJWI 1VQOI 1MMSA 3CMEI 2H8WA 2ZJPF 3PIOF 3CC7I 3CMAI 5GAGJ 1S72I 3CC2I 1FOWA 2NXNB 3CD6I 1VQNI 5DM6F 1YI2I 2ZJQF 3CCRI 1FOXA 3DLLF 3CCEI 3I56I 3G71I 1VQKI 2E35A 2FOWA 1VQ4I 3CJTB 3CCSI 5JVGF 5GADJ 3J7YJ 4IOCF 4UY8I 3CCMI 1QA6A 4IO9F 3CCJI 2JQ7A 2K3FA 3G4SI 2E34A 2OTJI 1FOYA 4V19K 1ACIA 3J7ZI 2QA4I 3CCVI 1VQ5I 3G6EI 1VQMI 5GAHJ 3CCLI 2OTLI 1VQ6I 3PIPF 1Y39A 1VQLI 1YJ9I 5GAEJ 2ZJRF 1YITI 4IOAF 2E36A 1VQ7I 3CC4I 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP I;  1HC8 A;  1YJN I;  5DM7 F;  3CF5 F;  1VQ9 I;  2QEX I;  1YIJ I;  3CCQ I;  3I55 I;  3CCU I;  1YHQ I;  1YJW I;  1VQO I;  1MMS A;  3CME I;  2H8W A;  2ZJP F;  3PIO F;  3CC7 I;  3CMA I;  5GAG J;  1S72 I;  3CC2 I;  1FOW A;  2NXN B;  3CD6 I;  1VQN I;  5DM6 F;  1YI2 I;  2ZJQ F;  3CCR I;  1FOX A;  3DLL F;  3CCE I;  3I56 I;  3G71 I;  1VQK I;  2E35 A;  2FOW A;  1VQ4 I;  3CJT B;  3CCS I;  5JVG F;  5GAD J;  3J7Y J;  4IOC F;  4UY8 I;  3CCM I;  1QA6 A;  4IO9 F;  3CCJ I;  2JQ7 A;  2K3F A;  3G4S I;  2E34 A;  2OTJ I;  1FOY A;  4V19 K;  1ACI A;  3J7Z I;  2QA4 I;  3CCV I;  1VQ5 I;  3G6E I;  1VQM I;  5GAH J;  3CCL I;  2OTL I;  1VQ6 I;  3PIP F;  1Y39 A;  1VQL I;  1YJ9 I;  5GAE J;  2ZJR F;  1YIT I;  4IOA F;  2E36 A;  1VQ7 I;  3CC4 I;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 1VQP I;  4Q4Z F;  2GXB A;  4N0B A;  1YJN I;  1I50 J;  2E2I J;  1GT0 C;  4F52 A;  1HDD C;  2ADU A;  2OZ6 A;  4CCO A;  4PZJ A;  5FFZ A;  3SZT A;  1UHW A;  3FHZ A;  1ZGA A;  1YG2 A;  5HOO A;  3RPU A;  2L4M A;  1FX7 A;  2LKX A;  2L7Z A;  4XRF A;  3FMQ A;  1H0M A;  5FLM J;  3BZ6 A;  3O2P E;  2EB7 A;  1TQM A;  2BV6 A;  3CJN A;  2FE3 A;  4DW6 A;  3T8T A;  1JUM A;  3A1Y A;  3TQN A;  4XM3 A;  1PP7 U;  4EGZ A;  3CC7 I;  3S15 J;  2V26 A;  3CUQ B;  4AD9 A;  2XGE A;  3E6M A;  2UZK A;  5GAG J;  2DQR A;  3DEW A;  5H2F C;  3I4P A;  3V4G A;  1YQA A;  2CG4 A;  3TW7 A;  1JHH A;  2VKD A;  1OYY A;  2BEO A;  3LSI A;  3ECO A;  2BVM A;  1USS A;  1V54 H;  5CQE A;  2AQF A;  2DI3 A;  3FXK A;  5CVV A;  3A03 A;  5IOY A;  1XMA A;  2M9H A;  3QYF A;  3FXJ A;  3ECH A;  1K4T A;  2X1D A;  1X4P A;  2DJN A;  2F4O B;  1OR7 C;  3W2A A;  1LFP A;  1GLN A;  3DCF A;  1JTX A;  2JT1 A;  3CF2 A;  1KZH A;  3CCS I;  3SQN A;  5L3E A;  3HBL A;  4ZYA A;  4XKW A;  1WSU A;  2BXY A;  5FRM A;  1B72 B;  1K78 B;  1PP8 F;  1IGN A;  1DU6 A;  5KVR A;  1AU7 A;  2OAZ A;  2L0K A;  2W4S A;  3ZQQ A;  2VBY A;  2BE5 F;  4LIU A;  1MJA A;  3BR3 A;  4AID A;  2DA6 A;  3JRC A;  2XSJ C;  1ACI A;  4G6D A;  4IRI A;  4PSX A;  4L0Z B;  1R4M B;  5E1Z B;  3CCV I;  2P5L C;  4A2U A;  4C3I J;  1IV8 A;  1KQ9 A;  1MDM B;  4CCJ A;  3DTI A;  4YEJ A;  2B7E A;  5BS6 A;  3GXO A;  5GAH J;  1B59 A;  2L02 A;  2CQX A;  2EV5 A;  3F8N A;  3I0T A;  1IC8 A;  3JTH A;  2M0M A;  3CCL I;  4WX9 A;  2PMH A;  3CO6 C;  4LB6 B;  1JT6 A;  2I8D A;  1SMY F;  2OZU A;  2QWW A;  3DKW A;  3AG2 H;  4BS9 A;  2EIL H;  4C30 A;  3WG7 H;  2DO7 A;  4BBR J;  3VFZ A;  5CVJ A;  3D0S A;  4IQJ A;  4LG3 A;  3BC8 A;  2M7B A;  1YIO A;  1X1P A;  1PUF A;  2W48 A;  4KN7 X;  3O6B B;  4HQE A;  4KMF A;  2CUF A;  1D0X A;  2CYY A;  4PJL A;  5ILU A;  1J59 A;  5AON A;  4NHJ A;  2M2E A;  4ZJZ A;  3CJR B;  4LGW A;  3GTP J;  1KQ8 A;  5CYV A;  1X1A A;  4F55 A;  1EA3 A;  3MZ8 A;  4I98 B;  4B3X A;  2ZNZ A;  2NOG A;  2HQA A;  1AKH B;  1WWX A;  4U7B A;  4KDP A;  3LST A;  5ICE A;  1AA7 A;  3HKZ N;  3CCU I;  2ZXJ A;  4NQW B;  5FFX A;  4PCQ A;  2K9Q A;  3D5L A;  2DOE A;  3V42 A;  2XF6 A;  2C6Y A;  1FMW A;  2O61 A;  2D1H A;  2IRF G;  3TDU C;  2ID6 A;  3ZMD A;  1UAA A;  2RV8 A;  2R92 J;  3H5A A;  1X3U A;  4BNC A;  4D5C A;  1Z6T A;  1OMI A;  2X85 A;  3QQA A;  1Z3Y A;  2XDV A;  5HLG A;  3GZ6 A;  1E2X A;  3T5X A;  2LY1 A;  4HA8 A;  2L54 A;  4RM2 A;  1S72 I;  3JRI A;  3J7A O;  3M8F A;  5EG0 B;  1WZ2 A;  5JLX A;  3EPZ A;  3KEY A;  1X19 A;  1R58 A;  1FP1 D;  1DP7 P;  1QZZ A;  5K7F A;  4U0V A;  2NVU B;  3I4M J;  2DFE A;  3KZZ A;  1JTY A;  2E7W A;  4EM1 A;  4V2F A;  4G9Y A;  4AWX B;  3BTJ A;  3WOD F;  2H6C A;  2UXX A;  2BY1 A;  1I6H J;  2E1M B;  1DGR M;  2CJJ A;  2KFD A;  3L2V A;  5A2Q Z;  4OIO F;  1GVJ A;  1JGG A;  3MN2 A;  1SVO A;  3OR1 C;  3E6B A;  2HYF A;  2KZV A;  5D5V B;  1BR2 A;  5KAF C;  3DF8 A;  4E7S A;  3LA2 A;  1MNE A;  4DOZ A;  4ZYD A;  1YO5 C;  1S9H A;  2KLO A;  2K3F A;  2EA2 A;  5CPR B;  3GTK J;  2OPT A;  2F6C A;  1T98 A;  2JA2 A;  2HOA A;  2LMD A;  3K0L A;  3L2C A;  5EEH A;  4LB5 A;  1P2F A;  3WHC A;  3FIS A;  1ITY A;  2A61 A;  3WG9 A;  4WWC A;  2JN6 A;  2KIQ A;  1YS7 A;  2CH0 A;  2PMZ A;  3LA3 A;  5JR3 A;  3J81 K;  3TBI A;  3M1C A;  5D5X B;  3BQY A;  2ELH A;  3LQQ A;  3UR3 C;  2R7Q A;  3KP7 A;  3WU0 A;  1RIO H;  4OIP F;  1FIA A;  3S14 J;  5AIP A;  2DT7 B;  3KLO A;  3K1M A;  3GFJ A;  1SFE A;  3OV8 A;  1QGP A;  2A6H F;  5HDK A;  4EJW A;  2IVM A;  1E17 A;  1S5L C;  4UV9 A;  1NK3 P;  5GP9 A;  4YII A;  2W84 A;  4IOA F;  1P7I A;  2WB1 N;  1IUF A;  2LVS A;  1A35 A;  1MJB A;  2IBD A;  2FOK A;  3D5R C;  2O9L A;  4YIF A;  1O3Q A;  3HTS B;  4YFN F;  2EA4 A;  1H9G A;  3K2Z A;  3RJP A;  2BOL A;  3NQO A;  3VOE A;  2H27 A;  1P6R A;  3TW6 A;  5F1J A;  1UHS A;  3HDD A;  2W57 A;  2DT6 A;  2QVO A;  3R0J A;  2IS6 A;  5IP9 J;  3DEU A;  3QU6 A;  5M5W J;  3GTL J;  4RGX A;  3E6D A;  2L7F P;  3ERM A;  1R5G A;  1QHH D;  1P4X A;  1U2W A;  2IGM A;  3QPS A;  3W2W A;  1VTN C;  2ZFU A;  4NC7 A;  2D5V A;  4YFX F;  1V4R A;  4NBQ A;  1WHU A;  5L3C A;  4E7K A;  3RI4 A;  2IGK A;  2Z33 A;  2IAI A;  2W25 A;  2HTS A;  5HDG A;  2M4G A;  3LSR A;  2RC4 A;  1ZEL A;  3ZRG A;  2XB5 A;  3FK7 A;  2VQG A;  2WWY A;  2YSR A;  4ABZ A;  3GTJ J;  1TTY A;  3OY9 A;  1MIJ A;  2H94 A;  3BY6 A;  5F04 A;  4I2O A;  2CQ7 A;  5HLI A;  1ENH A;  3FMS A;  4DZJ A;  3KFW X;  1JUP A;  2E1C A;  4M74 A;  4ZDP A;  3MWM A;  2DPD A;  4R8H A;  4I76 A;  3WHB A;  4D0P A;  1KU7 A;  1GV5 A;  2FD5 A;  2EIK H;  1B8I B;  3MMY B;  3GZ5 A;  5HLT A;  1FZP B;  1U9N A;  1SFX A;  3C2H A;  4A6E A;  5LRS A;  3EQL F;  3QOP A;  4HSR A;  2LP0 A;  2HVS A;  2K85 A;  4S0H B;  1UB9 A;  4BBS J;  2OTJ I;  1HA8 A;  5EDN A;  3K1P A;  1XGS A;  3FM3 A;  4RB2 C;  3LSP A;  2O6G E;  3E0J B;  1LKX A;  4FCY A;  1QBJ A;  2V9V A;  1CF7 B;  4BDZ A;  3EET A;  3DEE A;  4GRI A;  2P5K A;  1IXS B;  1IXR C;  2L2O A;  2K3P A;  5HNF A;  1IN8 A;  1X1D A;  1Z77 A;  2CSO A;  2BVL A;  4BY1 J;  1IRF A;  2DMU A;  2O03 A;  5J4V A;  3WE3 A;  3C18 A;  3K6G A;  4NNJ A;  3HRS A;  3J80 K;  1C0W A;  3WTS C;  1XCV A;  1IDY A;  2MLG A;  3ML6 A;  2XC7 A;  3H3Z A;  1YIT I;  3SDB A;  2HPM A;  1MD0 A;  1JUS A;  3O8H A;  1VQ7 I;  4Q47 A;  5KAI C;  2ZXI A;  2IA1 A;  1A36 A;  3H35 A;  4BAY A;  4EMS A;  5J40 A;  3EUH C;  2LY9 A;  4F91 B;  3Q9V A;  1Z0X A;  2QEX I;  5F6F A;  3CP2 A;  2HNH A;  1BW6 A;  3PSF A;  4HX4 A;  3RKQ A;  2V1N A;  2LTP A;  4LJZ F;  5LLQ A;  3VWB A;  1X3Z B;  2P6S A;  2M8E A;  4CCL A;  5J8C A;  3HSE A;  2X48 A;  2YS9 A;  4JX5 A;  5DUI A;  2ICW G;  3A0B C;  1XB4 A;  3EUK L;  1R36 A;  4A0Y A;  1ZK8 A;  4M3G A;  3BRO A;  1T08 B;  2ZBK A;  3BG6 A;  2NNN A;  5HOD A;  2MLK A;  1LE8 B;  1EJ9 A;  1AWC A;  2CUE A;  2MD5 A;  3DQV C;  4QWQ A;  2L3D A;  1FSH A;  1WKM A;  1YRN B;  2H09 A;  3WTT C;  1ZGW A;  2HQR A;  3E5U A;  2CMP A;  1MSE C;  3OYM A;  3I54 A;  1H8A C;  1W0U A;  2X6W A;  4PGH A;  5C4J J;  3H3U A;  3KX2 A;  2PN6 A;  4YIR X;  2L9N A;  1JT0 A;  2ACJ A;  1DU0 A;  3BR6 A;  5HNH A;  2M45 A;  2F2E A;  1T2K A;  3K4C A;  4M6Y A;  1DDN A;  3DU5 A;  3CCJ I;  3TGN A;  5CLS A;  1JKP C;  3ZMZ A;  2K86 A;  3L00 A;  1ZR4 A;  3KE2 A;  2JQ7 A;  2COM A;  2F5C A;  5F0C A;  2DXI A;  3Q9S A;  1FY7 A;  1FOY A;  4O5V A;  1TWC J;  4CZZ A;  5FB2 A;  2A6T A;  3IAS 2;  1Y1W J;  5EZG A;  3KYL A;  3WTV C;  3V8J A;  1D5Y A;  2ID3 A;  2A05 A;  3D5S C;  3GW2 A;  2CFX A;  1SD6 A;  1ETY A;  5TRD A;  2ZME B;  3K69 A;  1XSD A;  1VQ6 I;  1WJD A;  1MND A;  5HDN A;  4N4O B;  5FGM A;  4YRV A;  3JCU C;  1T0F C;  1FC3 A;  1WI9 A;  3S2D J;  1JJ8 C;  2KIM A;  3Q3S A;  5K5R A;  1LVA A;  4E7H A;  4A3I J;  1L3L A;  3PO3 J;  3BJO A;  2HXO A;  1WJE A;  2E5N A;  3CLO A;  4DBQ A;  1ULY A;  3F8B A;  2NS7 A;  2ZC2 A;  3EUH A;  5L3B A;  1LEA A;  1LNW A;  2XRL A;  5IYC J;  3RYP A;  5D8K B;  3D1N I;  3CCQ I;  1W1W E;  4UUS B;  2J5P A;  2MW8 A;  1B4A A;  1ETW A;  1A6Q A;  3TO6 A;  4ZZL A;  1D0Z A;  2IA0 A;  5FRO A;  2J5O A;  1CGP A;  4OIQ F;  4UXN A;  1FYK A;  4BL0 B;  3HRT A;  3M4O J;  1QQI A;  3O8G A;  4RLQ A;  2IS2 A;  1X1C A;  2A5Y B;  3JTG A;  3LSH A;  2PJR A;  1VFC A;  2IS1 A;  3MFK A;  2DAO A;  2G7H A;  3LSM A;  1IW7 F;  1I5Z A;  4RAY A;  3TOB A;  4O3M A;  4U87 A;  3IH2 A;  4X0G A;  4XSZ F;  4CA0 A;  5ICC A;  2DMQ A;  2GOX B;  3I53 A;  1Z7L A;  3SEZ A;  3K9T A;  2R7Z J;  3F6O A;  1R6R A;  2M1B A;  2X0L A;  2XKO A;  1R9T J;  4GO1 A;  5LGT A;  5FKO A;  1I3A A;  3SZG A;  2LY2 A;  4X6A J;  3FXQ A;  2V1X A;  4MGR A;  4Y4R A;  3AG3 H;  5JHU A;  3FXM A;  2YUS A;  1T38 A;  1PDN C;  2TDX A;  1MH3 A;  2CS3 A;  3E3V A;  1P9Q C;  5BPI A;  2W24 A;  2GQQ A;  1JXS A;  3CMM A;  3NWS A;  4RB0 A;  4EV0 A;  1MMA A;  1YTY A;  1FNN A;  2ZFW A;  2DA3 A;  3S3M A;  2AHQ A;  2CO5 A;  3L7W A;  3KLN A;  5J6X A;  4ENK A;  2JPB A;  2ELK A;  2JA7 J;  4UB6 C;  2ISY A;  2JRM A;  4RM3 A;  1MZB A;  3CUO A;  4DIQ A;  1S7E A;  3ZQH A;  5FD6 A;  3ZQG A;  4G7H F;  4DGW B;  2ZSI B;  3V7C A;  2QSG X;  2O5R A;  1X3W B;  3DTE A;  3K70 C;  1OKR A;  5JVT A;  2VPL A;  2E5Z A;  5IT9 Z;  1ON1 A;  3VYS B;  4HDU A;  4YG2 F;  4A3K J;  5AIQ A;  2GXG A;  1UFM A;  1U0J A;  2RAE A;  1IJW C;  4RAZ A;  1JKO C;  1BA5 A;  1YE9 A;  1BW5 A;  5FO5 A;  4RBO A;  3AKZ A;  5B1A H;  3PM1 A;  2ELJ A;  2E2H J;  2EIN H;  2PI0 A;  5E3L A;  1ZLK A;  2YX7 A;  5IP6 A;  2FJ1 A;  3R0A A;  3PQK A;  3SEQ A;  5LD2 C;  5IP7 J;  1ZHF A;  1HC8 A;  4RS8 A;  2Y2Z A;  2JUG A;  2HTJ A;  1G59 A;  3LQR A;  3RCO A;  3RQ4 A;  1FLI A;  3M3Y J;  5E20 A;  2FUG 2;  1VQO I;  5ILS A;  1FMV A;  1ZAR A;  1KYZ A;  2X6Y A;  3HG9 A;  1RR8 C;  2HU9 A;  3CMY A;  4HF0 A;  2QBY B;  1Z21 A;  3BR2 A;  3QWL A;  5GTI C;  4PJN A;  1B9N A;  1FOK A;  4M6V A;  2CWE A;  4IL6 C;  4MO7 A;  3L1P A;  3PIO F;  3S93 A;  4GCV A;  1X2N A;  3TDZ C;  2VBW A;  2WTE A;  1F1Z A;  1O3T A;  3H92 A;  3GFL A;  1I6X A;  2CQN A;  4B44 A;  5EGO A;  2FF4 A;  2NYX A;  1LFB A;  2VQC A;  5HLH A;  2FQ4 A;  2FNP A;  2F5E A;  1SD5 A;  5LBQ A;  3JSP A;  3CDH A;  1RKW A;  1Z67 A;  2E60 A;  2WAF A;  1LDJ A;  3JRA A;  4GDF A;  2QSF X;  2QCO A;  3TOA A;  2EFQ A;  2H1L A;  2MG4 A;  2CW7 A;  4AU7 A;  3CLQ A;  4M3D A;  3R4K A;  3JRD A;  3PO2 J;  2XF7 A;  3I56 I;  2XGC A;  5EYR A;  1JE8 A;  2LBF A;  1TNT A;  5E1W A;  5DS9 A;  2K9N A;  4UUV A;  2NVT J;  1TT5 B;  3HL2 A;  2GM4 A;  1D8K A;  4BXU A;  2ZXH A;  2QQB A;  1G2H A;  3BLY A;  2BY2 A;  3NWT A;  2PG4 A;  2QSH X;  5FKN A;  3RKX A;  3SXY A;  3SDG A;  1R1T A;  4E6K G;  3UKG A;  4K2E A;  4XLA A;  1XDS A;  2E1O A;  4RGR A;  4WK8 F;  4XRM A;  4IHS A;  1PUF B;  5B3S H;  2FBI A;  2GBY A;  4HW0 A;  1FT9 A;  1PUE E;  3QOE A;  1T95 A;  3MD2 A;  4A6D A;  1XDU A;  1Z7U A;  1IN4 A;  4P96 A;  4AUX A;  3WGI A;  2O8X A;  2QBY A;  3B6A A;  1ZKG A;  1FPQ A;  3BG5 A;  4AIH A;  2QA4 I;  1MBH A;  4XSX F;  2HKX A;  2WY7 Q;  5TJJ A;  4CSW A;  1FBU A;  4ANJ A;  4F93 B;  1HOM A;  4AM3 A;  4KIC A;  3Q0W A;  5F64 A;  4CCM A;  4LK0 F;  2Q8K A;  3U9G A;  2R7S A;  3GCM A;  5EF6 A;  1VF9 A;  4R1H A;  1RZ4 A;  2UV1 A;  3OIP A;  2EV6 A;  3ERE D;  3QYB A;  1YJ9 I;  4C3J J;  2ISZ A;  2JA6 J;  1ETQ A;  5H6Q A;  1JHF A;  1T33 A;  2R4G A;  3QAH A;  5CKT A;  1W4M A;  1D0Y A;  3OMY A;  1OCZ H;  3H9J A;  3VSK A;  5CVI A;  5E3M A;  3G2B A;  1S6L A;  1S8N A;  4OAY A;  3CO7 C;  3B02 A;  3CC4 I;  4A3D J;  1W36 C;  5LHG A;  3PQJ A;  4MEX F;  1YW8 A;  1U8B A;  1N25 A;  3GBG A;  4E7Z A;  5DYM A;  4LD5 A;  1ZG3 A;  1QNT A;  5ICF A;  2JSC A;  2GXA A;  1HDP A;  5CQG A;  4DBR A;  1R71 A;  2V1U A;  2JMW A;  2LF7 A;  2MH9 A;  1IRX A;  2DK8 A;  2WAQ A;  4QLC U;  2KL4 A;  3WGH A;  1YJW I;  1KON A;  3DPT A;  3H36 A;  4I02 A;  5IOZ A;  3CME I;  5FD5 A;  3RSN A;  3DTK A;  3RPU D;  3ZCO A;  3RYR A;  2TRT A;  1UZC A;  2Z2S B;  2R5Y B;  1NHA A;  4I09 A;  4HOB A;  2K5C A;  1ZRC A;  1D8J A;  2FBK A;  2X9D A;  1XSX A;  3I58 A;  3MKY B;  1BOB A;  3HOT A;  1KGS A;  3CP8 A;  1G3T A;  1R7J A;  1EH8 A;  4ZC3 A;  2VJJ A;  2R5Z A;  5DM6 F;  1Z9C A;  1Y56 A;  1J9I A;  1YX5 A;  3BG9 A;  3OOU A;  4BJ5 C;  3IC7 A;  2YU3 A;  3SFZ A;  3LNQ A;  4IRH A;  2GOM A;  4A3B J;  1ODD A;  1AHD P;  4HF2 A;  5F0F A;  4IPA A;  1YI2 I;  1EKE A;  2YU9 J;  3RPQ A;  2O3F A;  5E1X A;  3AAF A;  3N97 A;  1YW9 A;  2XAU A;  1BI2 A;  2FOW A;  2P7V B;  2DN0 A;  3VYR B;  2ZKZ A;  4HX8 A;  9ANT A;  3CZ6 A;  1OCR H;  2HXI A;  4LLN A;  3LFU A;  3E5Q A;  5A2Q K;  3GFM A;  3WU1 B;  4UY8 I;  3CCY A;  1Y8Q B;  5J1R A;  5ED4 A;  2M34 A;  3ONQ A;  1Y1V J;  4KA4 A;  4DYC A;  4XKV A;  2WV1 A;  5J8F A;  2IXS A;  2EJR A;  5D4R A;  3F6V A;  4H0E A;  5IYB J;  1HW1 A;  3F9K A;  3ZQ7 A;  1X1B A;  1B1B A;  4Y33 A;  3BR0 A;  2R5Y A;  3KP4 A;  1LQ1 A;  1I1S A;  3DBR B;  2XF5 A;  1W5C C;  2DA4 A;  3A0H C;  1S7A A;  2VC1 A;  4H4K C;  4N9I A;  1OCC H;  3S2H J;  3H5N A;  1MNM C;  3FX3 A;  5C4X J;  2HDW A;  3H0G J;  3WTX C;  4ESJ A;  3TP3 A;  2JA5 J;  2FSW A;  3ELK A;  1Y8R B;  3F22 A;  1R1U A;  2LKP A;  3RZO J;  1ZRF A;  4RB3 C;  1IXC A;  1XD7 A;  4ESB A;  2XIG A;  3RIR A;  4BQQ A;  1T6S A;  2XSD C;  4UVB A;  2IGO A;  1Z91 A;  1GVD A;  3CF5 F;  2PMZ N;  2MYS A;  3Q0U A;  4M6X A;  3CDL A;  3X2Q H;  3GEZ A;  3WTW C;  3I64 A;  2EV0 A;  2KRH A;  1KU9 A;  2OF7 A;  4NUB A;  2NNY A;  1E3O C;  2Q0O A;  2CV1 A;  4B47 A;  4FX0 A;  1UEL B;  4D7N A;  2XAJ A;  4AIK A;  3IH3 A;  2IA2 A;  1X58 A;  2VJ4 A;  3TMO A;  3S1N J;  2JUC A;  5ILV A;  2K40 A;  4OOI A;  1R4N B;  1XCB A;  2OQR A;  4L5E A;  2FX0 A;  2H8W A;  5BOX A;  1W0T A;  3JAM K;  1MMN A;  4ZTF A;  2EIJ H;  1STZ A;  3EDP A;  3SHF A;  2RN7 A;  2DFI A;  2DYS H;  3C1D A;  4G7O F;  3TO7 A;  5DD4 A;  2KRF A;  1OCO H;  4IX7 A;  2X51 A;  3L9F A;  2VKE A;  3PL8 A;  2VLA A;  4BGD A;  2XAH A;  2LC2 A;  4B4C A;  3HYI A;  5CVU A;  2M7A A;  1NG6 A;  2VN2 A;  2G7U A;  1MBK A;  4IHW A;  4BJT A;  5DUK A;  3HXL A;  3OYF A;  2F5F A;  3EUA A;  4XNF A;  5LEJ A;  2GWR A;  1U5T C;  2VXZ A;  2JJ7 A;  3OOP A;  2HVR A;  3AL0 C;  3S32 A;  5B1B H;  2KPM A;  3MKW B;  2PMU A;  3L2Q A;  2K02 A;  2R7R A;  1SAX A;  1MBG A;  1TLH B;  3HEF A;  4FQG A;  4IOC F;  4J01 A;  2HDD A;  1IO2 A;  2DMT A;  2VXD A;  3ZMU A;  4EAT A;  3CCM I;  4IVN A;  3QRF F;  4UNO A;  3FWE A;  3ABM H;  4KYW A;  5FJ8 J;  2A07 F;  3TL4 X;  4KNY A;  1ZYR F;  1A6I A;  4G94 A;  3TP0 A;  4Y15 A;  2OJE D;  1Z1D A;  2Z5U A;  2K7L A;  3SJM A;  2DDA A;  3MQ0 A;  1WJA A;  1K6O A;  3W6K B;  4FIS A;  2VOD A;  3DPL C;  2EZI A;  4OU0 A;  2VI6 A;  3J7Z I;  5FKM A;  4M9S A;  3PUB A;  1DUX C;  1E3H A;  4AC0 A;  2FBH A;  3C2G A;  3GX4 X;  1YLF A;  2UUZ A;  1XSV A;  3MVP A;  4L9V A;  4LIT A;  3ABT A;  2IP2 A;  3I59 A;  3I5U A;  1XGM A;  1WH7 A;  3R6S A;  4BUP A;  5HS7 A;  4A93 J;  4PSW A;  4XLH A;  1VQM I;  4JX4 A;  3KZI C;  2CQK A;  2UXN A;  4RGU A;  4B09 A;  3BZC A;  2M4K A;  2LNB A;  4P55 A;  3B73 A;  4ENM A;  3AL0 B;  2ZJR F;  2HZT A;  2R3S A;  1S29 A;  3K4L A;  3R60 A;  2E36 A;  2NS8 A;  1K7A A;  5IPA A;  1TQP A;  4CZC A;  1ON2 A;  4I01 A;  1IN5 A;  2XRN A;  3CTA A;  2EIM H;  3FK6 A;  1OYW A;  3HPH A;  4KJZ A;  3ASO H;  1R1V A;  3I55 I;  1HQC A;  3V7R A;  1AOY A;  4B48 A;  4L18 B;  2V1D A;  3HOX J;  2WV0 A;  3U1K A;  2NOJ B;  1UG2 A;  3KP2 A;  1RR7 A;  2P6T A;  2HI3 A;  2X1C A;  1XS9 A;  3S1M J;  2DPU A;  2JVG A;  2MGQ A;  3OYL A;  3OYC A;  1HKT A;  5BNG A;  1IN7 A;  4WF2 A;  1WRJ A;  1OFC X;  3K4K A;  1BR4 A;  3LFK A;  3FKJ A;  4IRG A;  3A01 A;  3GWZ A;  4DYQ A;  4HDV A;  3CC2 I;  2F4I A;  4RMN A;  2HYJ A;  4A3G J;  1XGO A;  4HQM A;  2XKP A;  4L9J A;  4ZYE A;  1V5G A;  1HXD A;  5D6E A;  3F72 A;  3HSF A;  3L2R A;  3IRQ A;  2I5U A;  5EEA A;  3BTL A;  4CCK A;  2V9K A;  3T0Y A;  3M1E A;  5E79 C;  4XL9 A;  1U5T A;  5GTH C;  5E18 F;  2NVX J;  1W7P A;  1I1G A;  4L9T A;  4HLY A;  2VJ5 A;  3ABU A;  3Q5F A;  1VQ4 I;  1XG1 A;  3CJT B;  2L7M P;  2P0W A;  1QVU A;  2IW5 A;  2O8K A;  2FU4 A;  4P5O A;  3S2W A;  3RQI A;  3M7G A;  4XON A;  2NVQ J;  2AQE A;  2DW4 A;  3GTQ J;  2R7W A;  1SD7 A;  3BTI A;  1R23 A;  1XMK A;  2PEX A;  4MHG A;  4Y3O A;  1W5S A;  2LFB A;  3ROU A;  4PJM A;  4MFD A;  3VPR A;  1WJB A;  3AG1 H;  3PNY A;  1LB2 A;  3BPX A;  4UUT A;  2E7X A;  2W1O A;  3HTU A;  4II3 A;  3DV8 A;  4FE4 A;  3C2B A;  1F5T A;  3ZR8 X;  4OMZ A;  3P5J A;  1UCR A;  2W00 A;  6PAX A;  1FWZ A;  1P4W A;  3V7S A;  4MQ9 F;  4L5J A;  2EFP A;  4S05 A;  1NH3 A;  1F43 A;  3HSR A;  4ZZD A;  2LH9 A;  2R7O A;  3GYH X;  4CO8 A;  2XGD A;  1U6G A;  1ZRD A;  1RI7 A;  2F4M B;  4GYI A;  3HGY A;  2F5D A;  4EJT A;  3AFH A;  3LSJ A;  4IJA A;  4RDU A;  4LG0 A;  2PJR B;  4P9U A;  4D1Q A;  3FBI B;  3ZPL A;  2ZNY A;  1YIJ I;  2JA8 J;  1G3S A;  2YX4 A;  4OMY A;  2V7F A;  3QP5 A;  3ZXS A;  2M5W A;  2ZJ2 A;  2VAS A;  3F8C A;  2EPF A;  2AO9 A;  2KRC A;  2O7O A;  4J00 A;  4A3M J;  3LWF A;  3ZMS A;  2IT0 A;  5EEG A;  4IHV A;  4BQN A;  5C3E J;  4G6Q A;  1WVR A;  2DOD A;  4M9Z A;  2OU2 A;  3WTY C;  4WXH A;  4XLF A;  3WE2 A;  3AG4 H;  1YX3 A;  3HOU J;  1IRZ A;  3GUD A;  3QU3 A;  4HPQ A;  1PVE A;  2DMP A;  2BY0 A;  3M07 A;  3ZMT A;  1JKR C;  2KZG A;  2XPU A;  3VYU B;  2DOF A;  2VB6 A;  1YW7 A;  2ME0 A;  1GHC A;  3CD6 I;  4M71 A;  3S1R J;  2CW0 F;  1XTA A;  2LRD A;  2VKV A;  2XPV A;  4EM2 A;  4EVI A;  4O6J A;  4B1R A;  2D45 A;  2G9W A;  3IUO A;  4Q48 A;  2UWM A;  2V79 A;  2XPW A;  3BPV A;  3BCA A;  2JRT A;  3IKT A;  3CCR I;  4BHP A;  4IHX A;  2FQ3 A;  2PFB A;  2ZSH B;  1QRY A;  3PFY A;  2E35 A;  1HF0 A;  2QYO A;  2M30 A;  1P4A A;  2HOT A;  4XRS A;  4UHT A;  2K4B A;  4ESF A;  5KK1 A;  5GAD J;  2HQ5 A;  4BJ6 C;  2DK5 A;  2K27 A;  2IPQ X;  3J7Y J;  3S3N A;  1TT0 A;  4ITV A;  2YPR A;  3HRU A;  5J3L A;  4CYC A;  1BR1 A;  3BJA A;  4XBF A;  1XN7 A;  2OQG A;  5KCM A;  2F5V A;  1ZH5 A;  2LF8 A;  3PNT A;  3JSO A;  2Y0M A;  2DJI A;  1F4K A;  4QSH A;  4OWR B;  3ZMV A;  2EQR A;  4AVZ A;  1WJF A;  1MJ9 A;  2RNJ A;  1OCT C;  4NB5 A;  4ZDL A;  4IEJ A;  2R0Q C;  3QYE A;  4ZTJ A;  3GLL A;  2FNA A;  2OTL I;  5IT9 K;  2VT3 A;  4MIM A;  1VQL I;  4A3F J;  2P7C B;  4PFO A;  2BBY A;  1N75 A;  5DTD A;  1HLV A;  2LSO A;  1EH7 A;  2DA2 A;  3MCZ A;  1UG0 A;  2QM3 A;  1T56 A;  4V2G A;  4II2 A;  4GYG A;  4HX7 A;  1DGW Y;  2JSP A;  1SAU A;  5FLX Z;  5EGO B;  1YS6 A;  2CGP A;  1WCM J;  2HVQ A;  4GXO A;  1B9M A;  3G1O A;  3K1N A;  5HVQ C;  4UVC A;  3OL3 A;  2JZY A;  3N4M A;  2WBM A;  1DPU A;  4KUM A;  3LMM A;  1ZN2 A;  1MMS A;  2R7X A;  1TWG J;  3E1S A;  1ETX A;  2E19 A;  3FM5 A;  2DOA A;  5DCM A;  2V6C A;  1R49 A;  1BIA A;  2BYV E;  5J4Y A;  4OIR F;  4P1W A;  2LBF B;  3KEO A;  1N77 A;  2E2J J;  2GZW A;  5M3M J;  1BJZ A;  2X6O A;  2Y9Z A;  5JFR A;  3F8M A;  3RDI A;  2P81 A;  1BIB A;  1OJL A;  1H9T A;  3DWL E;  4IXA A;  1RET A;  3B6C A;  1U9O A;  1FOW A;  3A2K A;  1MW7 A;  1D5V A;  3OL4 A;  3ZOB A;  2GA2 A;  1S3J A;  1Q1H A;  1U3E M;  1D1A A;  2LG4 A;  1YFH A;  3U1D A;  1REP C;  1GXQ A;  3GO5 A;  3KIO A;  1VZ0 A;  1WJ5 A;  4CUG A;  3OYI A;  4CH7 A;  2CU7 A;  2MSY A;  3KYD B;  4BYY A;  2KDO A;  5TGT A;  2EFO A;  3IAM 2;  4W97 A;  3GZN B;  3HB9 A;  4XN0 A;  3OS1 A;  4CGZ A;  4I0A A;  3JRH A;  3G71 I;  1R00 A;  3KCC A;  3COA C;  3WTZ A;  2OC6 A;  3KEQ A;  3ZP5 A;  2HEO A;  1V5E A;  1W5T A;  2XHK A;  3OWT A;  5GPA A;  4BH9 A;  4WCG A;  3OYA A;  4C2U A;  1IG7 A;  1LEB A;  4M9X A;  3HZJ A;  2HOS A;  4RLF A;  1OQY A;  3W6V A;  3NAU A;  2GAU A;  1BM9 A;  2HKO A;  2R7V A;  1TNS A;  3FXL A;  1SEU A;  2K9M A;  1D3Y A;  2MC3 A;  4NC8 A;  3H1C A;  1ONV A;  2BW3 A;  3KET A;  1BBY A;  3FBN B;  4EJO A;  1A5J A;  1Z3X A;  5F08 A;  4XOT A;  2H1K A;  3L09 A;  5FLV A;  4AYB A;  2KKO A;  3BG3 A;  4E7L A;  1V55 H;  2EWN A;  5C44 J;  4F7Z A;  1R5H A;  1WI3 A;  2DA1 A;  2QQA A;  3V8L A;  3U2R A;  1J75 A;  1HW5 A;  3GME A;  1RUN A;  1GXP A;  2XAG A;  2M8G X;  1HKQ A;  1MBJ A;  4I6Z A;  1VI0 A;  4LMY A;  4PK4 A;  2KP6 A;  3LSG A;  2DT5 A;  2Y69 H;  3OYN A;  4CIC A;  1F9N A;  3QPH A;  4EJV A;  4G8X A;  2L4A A;  4Z6Y A;  1LFU P;  1R22 A;  2DMN A;  4E7I A;  1FSE A;  2LYC A;  4MLO A;  1ZAO A;  2OCE A;  3H9G A;  4MFE A;  2VIX A;  4PUS A;  2VON A;  5L3G A;  4IHY A;  1ETO A;  2L5Q A;  5LRR A;  2R5Z B;  5DD8 A;  2W85 A;  3LA7 A;  1SAN A;  1BI1 A;  1FBS A;  1XGN A;  2EK5 A;  3F21 A;  3W2V A;  1I39 A;  3R61 A;  4LIV A;  1QVT A;  5D5W B;  2P5V A;  2XAF A;  2Y0S N;  2Y0S A;  4XLC A;  4KIB A;  4HF1 A;  3I9V 2;  2VT2 A;  1O7F A;  2BHZ A;  3LAP A;  4JX6 A;  2ZJP F;  2VE9 A;  4JP0 A;  1ZTR A;  1H89 C;  1U78 A;  1IZ1 A;  5DDG A;  1HBX G;  3J7A Y;  1JJ6 C;  3QOD A;  2CV2 A;  3ABL H;  3IKV A;  4E70 A;  2NAZ A;  1O3R A;  2KJB A;  2CFO A;  1Y6I A;  3BCB A;  1K61 A;  3KPH A;  2Y75 A;  3GTO J;  2BGC A;  2CQQ A;  3SYT A;  2N8G A;  2WAQ N;  1IUY A;  4BQA A;  2EBI A;  1JGS A;  4XN3 A;  2MBF A;  3BP8 A;  2WAD A;  4CCN A;  2HWV A;  2BXZ A;  2ZJQ F;  1F36 A;  1IDZ A;  1RES A;  2KDZ A;  2ECC A;  4LFU A;  2GA1 A;  1TQI A;  3P9C A;  1W36 D;  4HG2 A;  4BHC A;  1J0R A;  2CV0 A;  2EFW A;  4NDL A;  3MKL A;  4ENJ A;  1BI0 A;  1O3S A;  3W6J B;  2BZT A;  4RA2 A;  2RKH A;  1A31 A;  3F0C A;  3CUQ A;  3DBH B;  4UV8 A;  1QA6 A;  4IO9 F;  1RRJ A;  4QPQ A;  4BU2 A;  3DKY A;  4UB8 C;  3ZQI A;  4I0B A;  3GLX A;  3E6C C;  4XLP F;  1SFO J;  2GLO A;  1O4X A;  1DQU A;  1TWA J;  2P4W A;  1NG7 A;  1WJC A;  2MD0 A;  5D6F A;  3DBL B;  3HUG B;  1QPI A;  1YYV A;  3W3C A;  1X4O A;  3OSF A;  4HLX A;  2QQ8 A;  2KIU A;  3HGG A;  3LOC A;  2Y48 A;  2HYG D;  2DA5 A;  5LFA A;  2JPC A;  4HNU A;  1MBF A;  2E1M C;  1QHG A;  1WQ2 A;  2RQQ A;  5E17 F;  3MEX A;  1KU2 A;  4HST A;  3ZN0 A;  3HKZ A;  2KT0 A;  3IP4 B;  4I7H A;  4ZYH A;  5LHH A;  4HEA 2;  3K70 D;  2VE8 A;  4KT5 C;  1B72 A;  1K78 A;  4L0Y B;  3ABK H;  5DV5 A;  2KIS A;  2X4H A;  1OPC A;  3LSK A;  5GAE J;  4WXD A;  5K5Q A;  4IKF A;  2TCT A;  3BG7 A;  3HOW J;  1JKQ C;  2DYR H;  2FA5 A;  2BY3 A;  1MH4 A;  1KQ0 A;  3A4C A;  1M1E B;  2A69 F;  4XLE A;  5D4S A;  2H8R A;  1VQ8 I;  3QP6 A;  1EF4 A;  2WA0 A;  1K6Y A;  4ON0 A;  2PLY A;  2XVC A;  2PQ8 A;  2FML A;  4XID A;  2LDU A;  4XQF A;  4I99 C;  1OLT A;  1UST A;  3ESW B;  4EM0 B;  5JHF A;  5KHD A;  1MDM A;  4DNC A;  1VQ9 I;  1SD4 A;  4G7Z F;  3S16 J;  3DP7 A;  4D9J A;  1FJL A;  3PJR A;  2QUF A;  2X1E A;  1A04 A;  2Z9O A;  2RVC A;  5LGN A;  1OCP A;  4U0W A;  3M8J A;  1MBE A;  1Z05 A;  5IT3 A;  1FP2 A;  2R7D A;  2A5W A;  2QGU A;  1TWF J;  1Q1V A;  1O57 A;  2X6X A;  4M3E A;  4BQO A;  1OR7 A;  4C2M J;  3HUG A;  3CMA I;  4BEH B;  3JRE A;  4Y52 J;  2JWT A;  4DZP A;  1G3W A;  1GV2 A;  1TW3 A;  3BWG A;  2D2W A;  2IS4 A;  1NTC A;  1X2M A;  2WC2 A;  1SFU A;  3BQZ A;  1Y0U A;  3K4M A;  3HOY J;  5CVR A;  3OYJ A;  1AKH A;  1HKS A;  2OUM A;  3PUF A;  4TV7 A;  2B63 J;  5BMZ A;  4BDY A;  1U8R A;  4KIS A;  4PGG A;  4DJA A;  3OYE A;  4NQW A;  1RNL A;  4XLN F;  3N05 A;  2BHY A;  3SFI A;  3VB2 A;  1DPR A;  1QPM A;  1J7K A;  3I59 B;  3QPT A;  2L01 A;  2RDP A;  2VQH A;  1TC3 C;  1UMQ A;  4D7M A;  3JRB A;  1FEX A;  3M8E A;  3K2A A;  3BDD A;  2V9P A;  2E71 A;  4NC6 A;  2DFH A;  4XOP A;  3OS0 A;  2RRE A;  2VOP A;  1KA8 A;  1E3P A;  3K4N A;  5EJC A;  3GTM J;  2YR2 A;  2CUZ A;  2LR8 A;  3BT9 A;  5EG0 A;  3T8R A;  5BPD A;  1VND A;  1WH5 A;  3C7J A;  3WTU C;  2HR3 A;  3JRG A;  2VL8 A;  2VJI A;  1FTZ A;  3F8F A;  1FYL A;  3SZP A;  1GDT A;  3P9K A;  1RC9 A;  4ZH4 F;  1ORK A;  4V19 K;  3OYB A;  3RKW A;  4PJJ A;  3DLA A;  2XGX A;  4PDK A;  2MH2 A;  3IHU A;  2H6B A;  2EZK A;  2WB1 A;  1ETK A;  4R79 A;  5K1Y A;  1BC7 C;  3RZD J;  1LDD A;  4HZF A;  4M72 A;  3S1Q J;  2DDB A;  1FYM A;  3VSL A;  4IZZ A;  1UHM A;  3J81 Z;  3ZGK A;  4A5M A;  3FHN A;  3HHH A;  5EZH A;  1P92 A;  1POG A;  2RQP A;  2VKH A;  2STW A;  4X1E A;  2EH3 A;  2Z99 A;  4KIF A;  4BEH A;  1H88 C;  5E8I A;  3VDX A;  3CES A;  4MTD A;  1I27 A;  5F0H A;  3JRF A;  2XUB A;  4Z2Y A;  5IYD J;  3ZQC A;  3IL2 A;  3H9Q A;  3A02 A;  3DU6 A;  4W1U A;  5K5O A;  1TL8 A;  1RPW A;  3E97 A;  3JAM Z;  1XPX A;  1SFK A;  3VOD A;  4AVP A;  4F3Q A;  1QU3 A;  5K7H A;  2EFN A;  3ZQF A;  1MMG A;  3MZH A;  4BXF A;  3A01 B;  3FDY A;  1T8I A;  3KP6 A;  4XMY A;  3BR1 A;  1HST A;  2XV4 S;  3E7L A;  3I3L A;  1WFX A;  2VPR A;  4XK4 A;  2AXT C;  2V6E A;  1PYV A;  1R5I D;  2JVH A;  3UNG C;  4ASN A;  1DP3 A;  3REO A;  4HYE A;  3FF5 A;  2COB A;  1WPK A;  2G0E A;  3IRR A;  3Q0V A;  5H20 A;  2PBI A;  3K10 A;  1IAW A;  2D1V A;  4C2T A;  2ME6 A;  1S7O A;  2VBZ A;  4LOC A;  4UVA A;  4DYR A;  1U5T B;  1W7P B;  1NK2 P;  3FKI J;  4D5F A;  5LHI A;  5HS9 A;  1LPQ A;  3O3K A;  3BJ6 A;  3HC7 A;  3QPL A;  3DKX A;  3HRM A;  3OYH A;  3FZV A;  1TP4 A;  2Y31 A;  4G6T B;  5FKK A;  3PSI A;  4MNU A;  4BE2 A;  4CHU A;  3G3Z A;  2KHM A;  5TIS C;  4IQ4 A;  1BL0 A;  3FIW A;  2KQR A;  2XAQ A;  2LRE A;  1ZG1 A;  2A68 F;  3MAJ A;  4BE0 A;  4CYD A;  1SVL A;  4BHB A;  2R7F A;  1APL C;  3OYK A;  2Z1D A;  1TBX A;  1TW2 A;  1EH6 A;  1GUU A;  2NRA C;  2QZ8 A;  3DLL F;  1KU3 A;  4HNV A;  4ZYG A;  4JYK A;  5D8L B;  4U88 A;  5M5Y J;  1OIS A;  1G3Y A;  1V5F A;  4XKB A;  4HBL A;  2R93 J;  4FHT A;  1HCR A;  2M0C A;  1J2X A;  4FX4 A;  4WXC A;  3H3V K;  5FRN A;  2DCE A;  4L5I A;  3PNV A;  2Y30 A;  4FET A;  4Y7N J;  2VOO A;  1XX5 A;  2ZO4 A;  3T1B A;  1L0O C;  2K4J A;  3EYY A;  2HOE A;  2CRG A;  3HPG A;  5L3F A;  2HGC A;  3S8P A;  3TKY A;  4HV6 A;  2E34 A;  3HHG A;  3NRV A;  4L9N A;  4KFC A;  2R7U A;  2K9L A;  2QLZ A;  3V8K A;  3VEP A;  5M3F J;  1K79 A;  4LG0 B;  1CQT A;  2W7N A;  1JI8 A;  1N78 A;  3RKY A;  1VQ5 I;  1ZLJ A;  2HPI A;  4ETS A;  5B66 C;  1V3F A;  1FTT A;  2F48 A;  2B0L A;  1IF1 A;  2CW8 A;  2RGV A;  3H5R A;  2VC0 A;  3GFI A;  3IH4 A;  2A3S A;  3BTC A;  4DQ2 A;  1K4S A;  4KN4 X;  4FAS D;  2NS0 A;  1B8I A;  3KP3 A;  2AXL A;  3ZQL A;  3TED A;  3P9I A;  4M73 A;  4S04 A;  4GFB A;  2DQL A;  3I71 A;  1LJ9 A;  3J80 Z;  2XRO A;  1G6N A;  3C3W A;  1ERD A;  4RAF A;  2OBP A;  4QIW N;  4ZDO A;  5ERI A;  4Y13 A;  4YEL A;  2Z3Y A;  4BXX J;  3L2U A;  2FEZ A;  2PX9 A;  4MEY F;  2LOO A;  1K83 J;  1CF7 A;  2DFF A;  2LLK A;  5J1Y A;  4JK1 X;  1BOA A;  2WAE A;  2L9V A;  2KMU A;  2MC4 A;  2ZME C;  3K4B A;  4JQF A;  3H0D A;  3DXJ F;  3LL7 A;  3GTG J;  1MKM A;  3OIO A;  4QPO A;  2KJC A;  1RKT A;  1ZG5 A;  2W82 A;  4C9Y A;  3PFI A;  3S3O A;  3KP5 A;  2HZD A;  2HDC A;  2FXA A;  3FXU A;  3BOQ A;  2JTV A;  3M9A A;  1KYW A;  4OAZ A;  4CYC B;  1XMX A;  1FIP A;  4B8X A;  1BJA A;  3CJQ B;  2Y9Y A;  3OSG A;  3CDI A;  1VQN I;  3DFG A;  4XRS G;  1O7L A;  4HNT A;  4XKC A;  2OD5 A;  4A0Z A;  5ICG A;  4XOR A;  1LUJ B;  3E5X A;  5BQT A;  3HOZ J;  2XB0 X;  3OYG A;  3HIF A;  5KNL A;  4A3J J;  2Q2E B;  1FOX A;  3CCE I;  4BKX A;  1FBQ A;  1W7P D;  3KZY A;  4HV5 A;  5JI6 A;  2O0Y A;  5F1R A;  3G1M A;  2E1N A;  3IWZ A;  1LE8 A;  3RTR A;  1J09 A;  3HM5 A;  2ESH A;  2M3A A;  1QZY A;  1BN5 A;  2LK2 A;  4AIJ A;  5IY5 H;  2IGN A;  3G73 A;  2IJL A;  3ASN H;  2HFH A;  2L7K A;  1YRN A;  3HOS A;  2DBB A;  2ZXW H;  4KIG A;  3EYI A;  3P7N A;  4J19 A;  1J5Y A;  5LGU A;  4IF4 A;  2FMY A;  2VUM J;  1TWH J;  4OIN F;  2GIV A;  3GVA A;  3I4N J;  5JLW A;  3OR2 C;  1SVM A;  1EV7 A;  2K9S A;  4RGS A;  1T39 A;  4HAM A;  2LD5 A;  2B9S A;  5CJ9 A;  5J1U A;  3PIP F;  4EEF G;  4A3L J;  1Y39 A;  2XAS A;  2V4J C;  4EQQ A;  1RUO A;  4RB1 A;  4Q5S F;  5DCM B;  2CUJ A;  4F92 B;  2QQ9 A;  3GF2 A;  5E3O A;  2M87 A;  4LK1 F;  3F23 A;  1P7J A;  2FRH A;  1Z6R A;  1ZGJ A;  3OIQ A;  5HS8 A;  5FKL A;  3MKZ A;  3BZK A;  5GPC A;  2MFZ A;  2MA3 A;  2NVY J;  1MGT A;  4YFK F;  1LDK B;  2MAB A;  3FXO A;  4XIC A;  2OV7 A;  2Q2E A;  3FMR A;  4CDG A;  1G4D A;  1E0E A;  2PJP A;  5DM7 F;  5FLX K;  4IHT A;  2RNG A;  1D1C A;  3DPU A;  5D5U B;  1ETV A;  4RAG A;  4A5N A;  1YHQ I;  2VQL A;  4EJU A;  2ZME A;  4MQV A;  2GIZ A;  2KIF A;  3KYC B;  3MZY A;  4PJ0 C;  3JW4 A;  2Z16 A;  1YOV B;  3VYT B;  4G12 A;  2ETH A;  3F3X A;  3U21 A;  4A0X A;  3OYD A;  2AS5 F;  3ZN1 A;  2OCC H;  1D1B A;  1IRG A;  3IWF A;  4FE7 A;  2P8T A;  4KT6 A;  4BE1 A;  1SMT A;  1QO0 D;  1ZQ3 P;  3NAR A;  4A12 A;  2DA7 A;  4FT8 A;  4Y17 A;  1ZRE A;  2NXN B;  3G1L A;  1B6A A;  2A6E F;  4KMU X;  4BY7 J;  2DTR A;  2QKL B;  3K7A J;  2BW3 B;  5LEK A;  1XC5 A;  1MSF C;  2ESN A;  2WY8 Q;  4HRI A;  4PFP A;  5E8G A;  4B43 A;  4UUS A;  1BC8 C;  4GGG A;  1HW2 A;  2ZCW A;  2L9S A;  1MMD A;  1G8X A;  5B5E C;  1BI3 A;  4E7J A;  2QEN A;  2DTZ A;  3ISP A;  4M3B A;  4P9F A;  5F27 A;  3TO9 A;  1VQK I;  1LVK A;  2L9R A;  4QTR A;  4U7D A;  4EGY A;  2DU9 A;  2JK3 A;  5K7Z A;  5JVG F;  3CQZ J;  5DEQ A;  3L2W A;  3HJE A;  1IN6 A;  3FXR A;  3S17 J;  5L3D A;  1I3Q J;  1PJR A;  2LKS A;  4C3H J;  4FTH A;  1T0F A;  4M3F A;  4A3C J;  4JOM A;  2HQN A;  3NEU A;  4MTE A;  4N4N B;  3ULQ B;  2DLL A;  5J47 A;  2QF7 A;  1WGX A;  3G4S I;  4XR6 A;  2ECB A;  1Y0N A;  4N9H A;  4BAC A;  2R7T A;  4A69 C;  4U0Y A;  3WGG A;  3OS2 A;  3G6E I;  3LAJ A;  3WU2 C;  4E4H A;  3CUQ C;  1ZR2 A;  1IV6 A;  3K4J A;  3HOV J;  4A3E J;  2EZL A;  4LLL A;  4ENN A;  1TZL A;  1OYI A;  2HS5 A;  3BR5 A;  1SC7 A;  5H6R A;  4B3A A;  3IV5 A;  2ZB9 A;  5E3N A;  2QKM B;  1HSJ A;  2VBX A;  2IEK A;  2STT A;  1UJ8 A;  4CXF A;  3JR9 A;  2EZH A;  2Q1Z B;  2OA4 A;  1QZE A;  5DCF A;  4KIT B;  4LLG F;  5M5X J;  4JBA A;  2I10 A;  4AYB N; 
#chains in the Genus database with same CATH homology
 1VQP I;  1HC8 A;  1YJN I;  5DM7 F;  3CF5 F;  1VQ9 I;  2QEX I;  1YIJ I;  3CCQ I;  3I55 I;  3CCU I;  1YHQ I;  1YJW I;  1VQO I;  1MMS A;  3CME I;  2H8W A;  2ZJP F;  3PIO F;  3CC7 I;  3CMA I;  5GAG J;  1S72 I;  3CC2 I;  1FOW A;  2NXN B;  3CD6 I;  1VQN I;  5DM6 F;  1YI2 I;  2ZJQ F;  3CCR I;  1FOX A;  3DLL F;  3CCE I;  3I56 I;  3G71 I;  1VQK I;  2E35 A;  2FOW A;  1VQ4 I;  3CJT B;  3CCS I;  5JVG F;  5GAD J;  3J7Y J;  4IOC F;  4UY8 I;  3CCM I;  1QA6 A;  4IO9 F;  3CCJ I;  2JQ7 A;  2K3F A;  3G4S I;  2E34 A;  2OTJ I;  1FOY A;  4V19 K;  1ACI A;  3J7Z I;  2QA4 I;  3CCV I;  1VQ5 I;  3G6E I;  1VQM I;  5GAH J;  3CCL I;  2OTL I;  1VQ6 I;  3PIP F;  1Y39 A;  1VQL I;  1YJ9 I;  5GAE J;  2ZJR F;  1YIT I;  4IOA F;  2E36 A;  1VQ7 I;  3CC4 I;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...