3DLLF

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
KTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3dllF00
5GADJ 3CMAI 1ACIA 3CCMI 1VQ8I 3PIOF 2NXNB 1QA6A 3CC7I 3CMEI 3CCEI 3CC2I 1YHQI 3CD6I 1YI2I 2OTLI 1VQNI 5DM6F 4IO9F 2E34A 3CCUI 3J7YJ 5DM7F 3CC4I 3G71I 3J7ZI 1VQPI 2H8WA 1YITI 1YJNI 1VQ5I 2FOWA 1MMSA 1FOYA 4UY8I 1HC8A 3CJTB 5GAGJ 1YIJI 1VQ6I 3I56I 5GAEJ 4IOCF 1YJWI 4IOAF 3CCRI 1YJ9I 5JVGF 2E36A 2K3FA 2JQ7A 2ZJQF 2QA4I 1Y39A 3CCLI 3CCVI 1VQLI 5GAHJ 1VQ9I 1FOXA 1VQMI 3CCSI 1S72I 2ZJRF 3CF5F 1FOWA 4V19K 3DLLF 1VQ4I 1VQKI 3I55I 1VQ7I 1VQOI 2E35A 2ZJPF 3CCJI 2QEXI 3PIPF 3CCQI 2OTJI 3G4SI 3G6EI
chains in the Genus database with same CATH superfamily
1FWZA 2HNHA 2ESNA 2DQLA 3HPGA 1KYWA 1Y8RB 2F5EA 3O6BB 2O8KA 5BPDA 1JJ8C 3DXJF 1SFOJ 3W2AA 3CMEI 3CCEI 4HF1A 3L00A 3CC2I 1P2FA 4OWRB 2XC7A 1E2XA 1YG2A 2E2IJ 2GA1A 4HOBA 1YW8A 1AU7A 4DW6A 1IN6A 2ZMEA 2OTLI 4XONA 3P9KA 2HYFA 3MWMA 2XAJA 2E34A 3JSOA 2D5VA 2MW8A 4BEHB 2QYOA 1YW7A 3BTIA 2DK8A 3CC4I 2KFDA 1MBGA 5DYMA 1TQMA 2FRHA 4PCQA 2X4HA 1YQAA 1ZGAA 2KQRA 2L2OA 4AVPA 1IG7A 3F21A 3T5XA 1FBQA 3QOPA 2BYVE 2NVQJ 2W48A 4KN4X 4UUSA 3HTUA 3L2QA 2E7WA 4XQFA 5DS9A 2LVSA 4D5FA 3FKJA 2EFWA 2XHKA 3WTZA 1B8IB 3ELKA 1W4MA 4AIJA 3CZ6A 4GYGA 4P96A 2CQ7A 2QSFX 3TBIA 3SHFA 4DYQA 5E3MA 1IXSB 3QODA 4B44A 4XOPA 1OCZH 2DTRA 4D1QA 1TBXA 1FMWA 2P5VA 1IN7A 2V9VA 2R5YB 1OYYA 3FKIJ 1IAWA 2RV8A 2RQQA 4D5CA 2G0EA 2JA2A 2KMUA 2QVOA 3FM5A 1Y1VJ 3TKYA 2XSJC 1IV6A 2NOJB 2NS8A 2GWRA 1Y56A 2M45A 3AG3H 1E3OC 3I58A 3A01A 4XOTA 4U87A 2A69F 3JAMZ 2CW8A 4A0XA 1QVUA 4RA2A 5J4VA 1K7AA 2J5OA 2VKEA 5J47A 4OIQF 2H6BA 3WE3A 3F9KA 3JR9A 4ETSA 3HKZA 3P7NA 5J40A 2ACJA 4S05A 3V8JA 2R7TA 5DUKA 4XK4A 4BDZA 2MD0A 3EQLF 2KLOA 4ZH4F 1D0XA 5JHUA 2DMQA 2EB7A 4AU7A 5JLWA 2IRFG 4XM3A 4A6DA 4CDGA 1O3QA 3K0LA 2OUMA 5K7FA 4YIRX 3G6EI 3HTSB 2EH3A 3JAMK 4B48A 1SANA 3SZGA 3TDZC 1ZG3A 4RB1A 2V9KA 5K7HA 2K86A 3PIOF 3QU3A 4E7HA 2ZJ2A 2STTA 4RGUA 2X6OA 4I6ZA 4UHTA 3EYYA 5ICEA 4E7ZA 4OIRF 1XSDA 1IJWC 3F8CA 2MGQA 4UB8C 4ESBA 3CCUI 4NHJA 4IL6C 3HOUJ 5KK1A 1RPWA 4BDYA 2IS4A 5DM7F 3AL0B 1KQ9A 1WFXA 2B0LA 1QPMA 1R00A 2NNNA 1JHHA 3KE2A 4K2EA 3Q5FA 2B63J 1JUSA 3ABMH 1LDKB 2HXIA 4HZFA 1BI3A 1J0RA 1ZREA 3H0GJ 4AUXA 1MMNA 1EKEA 4BHPA 1S8NA 1U6GA 5HODA 1O3TA 2RGVA 4KFCA 3WG9A 5BPIA 4FETA 1FOYA 1FIAA 1KQ0A 4Y17A 3M9AA 3CLOA 4KMFA 3WHBA 3OYNA 1ZAOA 3OIPA 1T6SA 2EZIA 1EV7A 2O8XA 2GXBA 3HOWJ 1Z67A 5J4YA 4RM3A 4BKXA 1YRNB 2E2JJ 1K4TA 2KRHA 3TDUC 2NS0A 3JRHA 1YIJI 1G4DA 3QQAA 3GFMA 3IWFA 2FE3A 2H6CA 3ABKH 4PDKA 4BXUA 4W97A 2A6HF 4EJOA 2IS1A 4Y3OA 1NHAA 2V26A 3HOXJ 1FMVA 5ICFA 1ZRFA 2VT3A 2E36A 2MG4A 2FF4A 2UUZA 3K70D 3NRVA 1OYIA 5E3OA 4WX9A 3W6KB 1Q1HA 1SD6A 3RQ4A 3LSTA 2ESHA 3C3WA 4DYRA 1W36C 4AYBN 4AD9A 1UJ8A 1ZTRA 1GV5A 2PMZN 4A12A 4M3DA 4A3MJ 3K4CA 4F55A 3H5AA 1SMYF 4LG0B 3FXOA 1TP4A 2K40A 3LSMA 4AM3A 5K5RA 3T1BA 4J00A 3HUGA 1YW9A 3BCAA 2JUCA 1MGTA 3BC8A 1YS7A 3S1NJ 5GTHC 4LLNA 3Q0VA 2FXAA 5F64A 1H8AC 3CMMA 2VASA 4JYKA 2W57A 2F2EA 4C9YA 1T39A 1V5EA 1D1BA 2W84A 3QAHA 1JUPA 3CC7I 2EV6A 4J19A 1T95A 3R60A 1QZYA 1XMKA 1XCBA 2FNPA 2RN7A 1KU3A 1X3WB 1I1GA 3HSRA 5EEAA 2G9WA 2Y0SN 4YELA 3E7LA 2DOFA 1X1BA 4FTHA 3LOCA 2A05A 2E19A 3BOQA 1QZZA 2DA1A 3H9GA 5IY5H 1Z7UA 5J1RA 5ERIA 2M3AA 1J59A 2D2WA 3LQRA 1RNLA 5E20A 4A69C 3M8FA 1W36D 1G2HA 1BBYA 5EZHA 2IS6A 1I1SA 3ISPA 2MH2A 1ZKGA 2VJJA 3BG5A 2ETHA 3TGNA 1PUFA 2DDBA 2M7BA 2MFZA 1IO2A 1FP2A 1HKQA 3S32A 3WTVC 2FMLA 1YITI 2CQNA 1N75A 1KU9A 3EDPA 4IJAA 5M5YJ 3R0AA 2PMHA 2VOPA 3BPVA 4DNCA 3GTKJ 2BEOA 1DDNA 4CICA 4BL0B 4ENNA 3UKGA 5EEHA 2BV6A 5ILUA 3SEQA 5HLHA 3Q3SA 2LYCA 4QWQA 4BQAA 3V8KA 4XRFA 3VYUB 1O57A 1D3YA 3VB2A 1I6XA 5DV5A 2UZKA 4UUVA 2M8GX 4F92B 3ONQA 5CVRA 3E5UA 2W4SA 3DPUA 1B6AA 3BZKA 3TO6A 3HM5A 3U21A 1RKWA 1RC9A 4M3EA 1LNWA 2ZJQF 3ABUA 3FMSA 1O4XA 1Y39A 1U5TB 5L3EA 3BG9A 3GYHX 3HEFA 3BZ6A 3SZTA 1NK3P 1W0TA 4JX4A 1FOXA 4N4NB 1K78A 1G59A 1WCMJ 1YYVA 1IN8A 1VQKI 1JUMA 2VQHA 1U0JA 1VQ7I 2N8GA 3TW6A 3N97A 2PJRB 2HR3A 1B1BA 4OINF 2DJNA 5BNGA 3U1KA 1ZGWA 1H9GA 1EJ9A 4OAZA 4A3BJ 2HKXA 1W0UA 1JJ6C 3FXMA 1E3HA 3PNTA 4EVIA 2L5QA 3J7AY 1MJ9A 3CJNA 3QPTA 4I0BA 4M3BA 2H94A 2OCEA 2Q2EB 1I39A 2EZKA 5EG0B 2IVMA 1TL8A 2KT0A 1WZ2A 3OL4A 1ZLJA 3WODF 1QA6A 1P7IA 4EJTA 3FXJA 3KZIC 3RKYA 2A6EF 3M1CA 4EJWA 2QCOA 5GTIC 2ISZA 2X1DA 2KRCA 3CCYA 1IUYA 1D8KA 4MEXF 4IHWA 3OS0A 1K6OA 4LITA 5DUIA 2R5ZB 3MKWB 3E6DA 5E3LA 1V3FA 3FIWA 4WCGA 3KYCB 3KETA 3OYAA 5HS9A 1X19A 2L02A 2VBWA 3TO9A 3HHGA 3E6MA 2R3SA 4MFDA 3ZQIA 4DBQA 2ZFUA 3W3CA 2HXOA 2PFBA 1Z21A 3JRFA 4XL9A 3RZOJ 3H1CA 2LNBA 1WVRA 1HBXG 3RJPA 3HRMA 5TISC 3I3LA 2H8WA 4GRIA 4UVBA 3O8HA 5F0CA 3JRIA 4OIOF 2BXZA 1MMGA 2VBXA 2R7QA 4ZZLA 4KISA 2LTPA 1MBJA 3AFHA 1F5TA 5LHGA 2KP6A 2V6CA 4HSTA 1R36A 5A2QZ 3M4OJ 2GIVA 2X51A 4L9JA 3MAJA 1WJAA 1SFXA 1G8XA 1UFMA 4C2TA 3OYFA 1F4KA 3I56I 1FX7A 2XAGA 3LAPA 1JTYA 4XRSA 3GFIA 2WY8Q 1MH3A 4MEYF 2K3FA 2FEZA 2V1UA 4PJ0C 3SJMA 2BHYA 3H0DA 4JP0A 5GPCA 1AA7A 1U8BA 3QPSA 1R4NB 1ZRCA 5C3EJ 1SC7A 2F4MB 3D5RC 5JFRA 3CCVI 1XGSA 1WI9A 2A68F 2KHMA 5A2QK 2F4OB 4CCNA 4BJ6C 1JT6A 2DYRH 5J3LA 3K1MA 5J8FA 1V55H 4MTEA 3S1RJ 3COAC 1FTZA 4BEHA 1DGRM 1NG6A 1MKMA 4CHUA 3ZMVA 2BY0A 3JRGA 1D0ZA 4UB6C 3F6VA 5E79C 5LGUA 2K3PA 4CCKA 4RLFA 1Y8QB 2OZ6A 3HZJA 4EV0A 2EIMH 3S2WA 1A35A 3NARA 3OR2C 5KAIC 3JREA 5IT9Z 3JRAA 2E60A 3ZQGA 4ABZA 2FBHA 2VQLA 2JK3A 3F8BA 4D7MA 1Y6IA 2VJ4A 3H9JA 5LEKA 1HW2A 2BW3B 4WXCA 2MBFA 4EATA 1B8IA 2EFNA 1Y0NA 5LGNA 5HLIA 3BTCA 2MYSA 3HXLA 1YTYA 4RBOA 3V7CA 3ABLH 3LSRA 3DV8A 3ERMA 2R5YA 1TWHJ 3T0YA 4BE0A 5IT9K 1H89C 2WY7Q 3LQQA 5HDNA 4PFPA 2LY2A 2CSOA 5HS8A 5LD2C 3TQNA 3L09A 4XLEA 2CUJA 3OYHA 5FFXA 4A93J 1PYVA 4PJJA 4IQJA 1V5FA 2IJLA 3BR2A 2Y9ZA 1FTTA 2M0CA 2F5FA 1VQPI 4CCJA 1XDUA 1Z0XA 3FISA 1F43A 5HLGA 2UWMA 1CGPA 4C2UA 2IS2A 4Y52J 2EQRA 4KJZA 1ZLKA 3H5NA 2W82A 4QLCU 1XGMA 1UMQA 2Z1DA 1IXRC 1LJ9A 3AAFA 3L9FA 1LFUP 2A07F 3LFUA 4JBAA 5CJ9A 4XICA 2W25A 5C44J 5M5WJ 2XAFA 3CTAA 2EZLA 4RM2A 1QGPA 2L9RA 3PFYA 1VQ6I 3ZRGA 3DKXA 2M30A 2X9DA 4DBRA 2VXZA 3C2HA 1KA8A 5K5OA 2VT2A 1YJWI 1ZRDA 3ULQB 3WGHA 4AVZA 4EM2A 2CU7A 4F3QA 2RC4A 2MH9A 4XKVA 4BNCA 2Y9YA 2RNGA 3SYTA 4X6AJ 5F08A 1E3PA 3QP5A 1DPUA 2LP0A 2QBYB 1OQYA 1XX5A 3NEUA 4I01A 1OYWA 3BR1A 1TQPA 4B43A 2NS7A 3IP4B 4U7BA 3KCCA 4RB2C 2EA4A 1RUOA 1SVOA 3M1EA 2JZYA 1EH6A 1GLNA 2LRDA 4BUPA 2JA8J 1WJFA 3E5XA 4FCYA 1Y0UA 4N9IA 2QSGX 1USTA 2WAEA 5FGMA 3OSFA 1VTNC 1PP7U 3BPXA 3KYLA 2QEXI 4CUGA 2OTJI 4BJTA 2WWYA 1MBKA 4M9ZA 4UV8A 2WV0A 3OMYA 2BHZA 2LG4A 2QSHX 2VN2A 4XRMA 4O5VA 3S16J 1T0FA 2FD5A 1WHUA 4M3GA 2ELKA 4GGGA 4NUBA 4MNUA 2M4KA 2ZSIB 2D1VA 1WJDA 2VC1A 4HX7A 3B6AA 4IXAA 5F0FA 1Z6TA 5D5XB 3N4MA 3RDIA 2BY1A 4DJAA 2IA2A 3S3MA 4XLAA 1JXSA 3V7RA 2PX9A 2P4WA 3VYSB 3ZGKA 4WF2A 2DFFA 2PMZA 2I5UA 5D5WB 4NC7A 2GXAA 1UG2A 3G71I 3DEEA 1E0EA 2LBFB 1UELB 3FX3A 4G12A 3GTOJ 5ILSA 3PFIA 1XPXA 2GXGA 2KL4A 3C1DA 2OC6A 4HX4A 5L3FA 1SAXA 5E1XA 1ZHFA 2DMTA 3ASOH 2O0YA 1WJ5A 3E0JB 2P5LC 2VI6A 3K6GA 2L7ZA 2XPWA 3LA7A 1OISA 1TZLA 3RQIA 4BS9A 1UB9A 4BJ5C 2TCTA 3LNQA 3K4MA 4C3HJ 1TWGJ 1IN5A 4XMYA 2IGMA 2KIFA 2H09A 4ZYHA 4LG0A 2F48A 4L5EA 3WU1B 1BOAA 2H1LA 4HPQA 4F93B 2IW5A 1Y1WJ 3VWBA 1HQCA 2WC2A 1X4OA 3ZN1A 1D5YA 1S5LC 3KEQA 2O03A 1XMAA 2ZKZA 2JUGA 4HG2A 4BACA 2ZXHA 2DBBA 3MMYB 5LHIA 3CCLI 3K2ZA 2Y2ZA 2FBIA 3WU2C 1PP8F 5GAHJ 2BVLA 3ERED 2DA3A 2QQBA 1ETWA 2Z3YA 5TRDA 4RB0A 4V2FA 1G3YA 2A5WA 1OR7A 2QZ8A 3S2DJ 3DBLB 3BP8A 4BHBA 1S72I 1OCPA 1FYKA 2MC3A 5ICCA 2MA3A 2BY2A 4TV7A 1R71A 5TJJA 4CZCA 2E1OA 1S3JA 2ME0A 2VBYA 2M8EA 4OAYA 2RNJA 3K4NA 3KP5A 5DCMB 2E35A 1WWXA 3ROUA 1USSA 1FLIA 1P92A 3LWFA 2Z16A 2F5CA 4A5NA 3PO3J 1APLC 3G2BA 2LC2A 1JE8A 3BQZA 5F6FA 1LVKA 4NQWB 1JT0A 3KP4A 3PO2J 4CYCB 2X1EA 4II2A 4M9SA 3D0SA 4XLCA 5DEQA 4UV9A 3K4JA 3RPUA 1S29A 4MFEA 2DLLA 2WAQN 4I7HA 1YHQI 3GCMA 3BCBA 1XSVA 2YU9J 2V1NA 2UXXA 2ECBA 2P81A 1D5VA 2OU2A 4IHTA 1R23A 2MLGA 1FSHA 2EBIA 2DYSH 2JJ7A 5IOZA 2FSWA 4JOMA 1ITYA 1I5ZA 5B5EC 3GXOA 3C18A 1ETXA 3DBRB 5D6EA 4GO1A 3K69A 1TWFJ 2BVMA 3GFJA 1F9NA 2DODA 2HDDA 1T8IA 2QWWA 4L9VA 5J6XA 3HL2A 4CXFA 2IEKA 5C4XJ 2OJED 5AIPA 3GTMJ 1QO0D 2X6YA 1S7OA 2VJIA 2ZXIA 3FHZA 1XS9A 1HKTA 1S7EA 2D1HA 3JRDA 2CW0F 1U5TA 2K4JA 2FQ3A 1R7JA 4HX8A 1A6QA 1JGSA 3W2WA 1FP1D 1I3QJ 1MSFC 2FUG2 3DTKA 3GLXA 5LEJA 5CLSA 2XVCA 4HW0A 3S17J 3BLYA 2VOOA 2HDWA 3K70C 1X1DA 1HDPA 4KNYA 1X1CA 5M5XJ 3RIRA 2HVSA 4HLXA 1YFHA 5E3NA 1WRJA 3WTWC 3LA2A 4ZYAA 2WB1A 5IPAA 2FQ4A 1W5TA 2L01A 3K2AA 2OBPA 3F0CA 2FBKA 2CQQA 3QRFF 5D5UB 2ZB9A 2Q2EA 4XR6A 2CUZA 4DZJA 5EG0A 2X1CA 5F27A 2YR2A 4UXNA 5F1JA 3TOAA 1P6RA 1X3ZB 1NK2P 1MJAA 1G3WA 3UR3C 5E18F 1RI7A 4Q47A 1B72A 3OYMA 1VQMI 3V7SA 5KCMA 2R5ZA 1S7AA 2DDAA 1ONVA 4FT8A 3S2HJ 1QVTA 4A3LJ 1LPQA 2B9SA 2OQGA 2HVQA 3VSLA 3JW4A 2QQ9A 5LHHA 5KNLA 3IRQA 4CCOA 3HOSA 5CVVA 2G7UA 4CCLA 5CKTA 1IRGA 3SFIA 2VB6A 2WTEA 4KYWA 2DFEA 3QP6A 5HS7A 4D0PA 3CP8A 2K27A 4ZDOA 2IXSA 3HOVJ 2XKPA 4RDUA 4IHYA 2KKOA 4N9HA 1ZELA 2R7RA 4YRVA 3OV8A 1T2KA 1QNTA 1XTAA 3VYRB 2GBYA 3CDLA 4D9JA 5BQTA 5FB2A 2RREA 1FJLA 3KX2A 2L4MA 4L9NA 4E7KA 3S3NA 4BQQA 2M2EA 2Z9OA 2DW4A 2ELHA 2CO5A 2IGOA 3OSGA 2VONA 4BBSJ 1O7LA 2EPFA 5EF6A 1BI0A 2IA0A 3F8MA 3S1MJ 5B66C 2M0MA 4A3KJ 2LKXA 3MKYB 3JRBA 5EGOA 4A0ZA 2C6YA 2AXLA 3FK7A 2NVUB 2R93J 1DU6A 4IHSA 3KLOA 5CVUA 4S04A 3B6CA 2R0QC 3ZQFA 3OYJA 1KZHA 2W24A 3F8FA 4ZYGA 4Y7NJ 4UNOA 2BY3A 1MW7A 2YX7A 2QENA 1YJNI 2EK5A 2JA6J 3PM1A 1VQ5I 1IRXA 2VJ5A 2DMUA 4ESFA 2PI0A 4NNJA 1BOBA 4L5JA 2DT6A 1STZA 4BY7J 3JSPA 4YFNF 2K02A 3MN2A 3QWLA 4WWCA 1PVEA 4Y4RA 2HPMA 5B1AH 1D1AA 5EZGA 4X0GA 5JHFA 4MGRA 3H3ZA 3I53A 4M73A 5GAEJ 3LL7A 1Q1VA 3CCRI 2VC0A 3TO7A 5M3FJ 4Q5SF 3DPTA 5FKNA 5FKOA 4HQEA 2DT5A 3EUHA 5BOXA 2DMNA 4E7LA 2XKOA 4CSWA 1FIPA 2CUFA 1CQTA 4GFBA 3A02A 2EV5A 4LG3A 2Y75A 2JWTA 5HNHA 5H2FC 1FNNA 3OWTA 1TNTA 3EPZA 3PUFA 3R61A 3DLLF 3KZYA 3QU6A 1LE8B 4XORA 2DA5A 4B1RA 3VEPA 2HTSA 3H9QA 5E8IA 3TL4X 1VQOI 1FOKA 1W7PB 4OIPF 3HIFA 1YX5A 1J75A 3PIPF 3H36A 3RCOA 3E6CC 2EA2A 4BQNA 2L9SA 2XV4S 1ERDA 1IV8A 4D7NA 4QIWN 5HOOA 4FHTA 3DEUA 4B3XA 5E1ZB 4KN7X 4ZDLA 1KGSA 2FA5A 5KAFC 3CCMI 1U9NA 2FNAA 1VQ8I 4ZJZA 1N78A 3CUQA 1YI2I 3OIQA 1Z3YA 3R4KA 5CVIA 5H20A 3F22A 4A3GJ 1R4MB 1JKQC 4IO9F 1LFBA 2LH9A 3DEWA 3DPLC 3NQOA 1XB4A 3FDYA 4QSHA 5LRSA 1SVMA 3I4PA 1ZGJA 2FX0A 2ZMEC 4R1HA 3MD2A 2LR8A 4DGWB 4KUMA 3CDHA 1B9MA 3J7ZI 3VOEA 2KZGA 1XGNA 4N0BA 3SEZA 1T56A 2WA0A 4C2MJ 1ZG5A 4XKWA 4AWXB 4NDLA 3LAJA 1LDDA 2GIZA 2E5ZA 2KDOA 3B02A 4JX5A 2PQ8A 4IHVA 3TP0A 2QKMB 3PSIA 5ED4A 4A3EJ 3FXUA 3OOUA 3DBHB 3L7WA 1I27A 2EILH 2P8TA 3F6OA 4M6YA 3PJRA 1OCOH 2JPCA 4HF0A 3VYTB 2GZWA 1ETQA 2R7OA 4XLPF 1GDTA 2NAZA 2DPUA 5IYCJ 3H5RA 4IRGA 3KP7A 5HDKA 2DK5A 3H3VK 4ESJA 2F6CA 3FBIB 4L18B 3J80Z 2ZC2A 3ZMDA 3DP7A 5FO5A 2K9NA 3GO5A 2LF7A 4A0YA 2K9MA 5C4JJ 4OMYA 4RGXA 2GLOA 3H35A 2K5CA 3KLNA 3RYPA 3P9CA 4FQGA 1BW6A 1RESA 4IF4A 2YU3A 2R7WA 4ANJA 4IVNA 2V1DA 3F23A 4ENJA 2HWVA 4XLHA 2QQAA 2VKHA 1BL0A 1HDDC 4P55A 2ID3A 3FZVA 2MD5A 3MVPA 2XASA 1A6IA 2CFOA 4KT5C 1VZ0A 2L7KA 2TRTA 3L2RA 1YO5C 3S1QJ 1REPC 3EYIA 2M9HA 5E17F 3SZPA 4EJVA 1JKOC 1EA3A 3J80K 3W6VA 2JTVA 3O2PE 1JKRC 2JPBA 3ECOA 3K4BA 1N25A 4IRHA 3VODA 4B3AA 2PJPA 5IYDJ 2ZO4A 3S14J 3R0JA 1XD7A 2K9QA 4A3IJ 4II3A 4CO8A 4ENMA 2DFHA 2GAUA 2JN6A 4FE7A 3BG3A 3HHHA 3DFGA 2A5YB 2VPRA 3KYDB 3G1MA 4I2OA 1TC3C 3HSFA 5GADJ 2EJRA 3MZ8A 1NTCA 1Z6RA 4MTDA 2R7UA 3V8LA 3WTSC 4ZYDA 1BJAA 3M3YJ 2M87A 3E3VA 3BG6A 2CYYA 1SMTA 2Y30A 2JMWA 2RVCA 3SXYA 4AIHA 1LEBA 4CCMA 1R6RA 3KP2A 2UXNA 1EH8A 2CV0A 2LKSA 5J1YA 1XG1A 3GTLJ 1ENHA 4G94A 3E97A 4ON0A 1J5YA 5D4RA 1XMXA 1XC5A 2PG4A 3I59B 4U0YA 3IWZA 4ZZDA 3LSIA 1SFEA 3IUOA 3MKZA 1ZN2A 5DDGA 1IDZA 3RKXA 1RR7A 2XGDA 1UHMA 1U9OA 2ZCWA 2XF6A 4A6EA 3TOBA 3VSKA 1G3TA 2HI3A 4DOZA 2CWEA 3L2CA 2I10A 1O7FA 2L7MP 4ZDPA 5BMZA 1GXPA 2O6GE 3ASNH 1MMSA 3HJEA 5FFZA 2EWNA 4B47A 5GPAA 3IC7A 5EYRA 1FY7A 2MABA 2WADA 3BROA 3DU6A 3AG1H 1QRYA 1F36A 3LSHA 5DCMA 1FZPB 2ZXWH 4IRIA 3HRTA 1GXQA 1WH7A 2HZTA 2IP2A 2WAQA 3RI4A 1VFCA 4XLNF 4HDVA 1RIOH 3I64A 4NQWA 4QTRA 5D6FA 5H6QA 4Y15A 1FEXA 2GOXB 1ETYA 2Z5UA 4IOAF 1BI1A 2XF7A 1BC7C 1IW7F 5FJ8J 5JI6A 4BXFA 3RKWA 4BU2A 2JRMA 1KQ8A 3BJAA 2HOSA 2QKLB 3VDXA 2WV1A 4M74A 3GZ6A 3ZMZA 3DTIA 4KIGA 4C3IJ 1YLFA 3IL2A 4FX4A 1Z3XA 5E1WA 4L9TA 2JSPA 2Z33A 1UHWA 2KZVA 4U0WA 5F0HA 2RDPA 2E1CA 4LIVA 2CV2A 3RYRA 2IPQX 4UVCA 2ICWG 1EF4A 3OYEA 1I6HJ 3A0HC 1OJLA 2WAFA 2HEOA 1GVJA 2IA1A 3DWLE 3K4KA 5JLXA 1K61A 3JRCA 3WTTC 1LQ1A 4M6VA 1W5CC 1QZEA 1S9HA 2P6TA 1YX3A 4ITVA 3SDBA 3W6JB 4F91B 2A6TA 3K1NA 2BOLA 2K7LA 1ETKA 2HOAA 2IAIA 3CMAI 2HYGD 2ZBKA 1VI0A 1KONA 2GA2A 3FK6A 4KIBA 4XNFA 3NWTA 2NXNB 1RZ4A 4XRSG 2VKDA 2W85A 4C30A 3CD6I 3RTRA 5IT3A 3IH4A 3M7GA 3ZR8X 1P4XA 4U0VA 3T8RA 2L9VA 3A03A 2CGPA 2NYXA 4P1WA 4EQQA 3AG4H 2YPRA 5FKKA 2E5NA 3G73A 3IH3A 3GF2A 4ZTFA 1ZR2A 3GLLA 3GTJJ 3P5JA 2HPIA 1HLVA 2K9LA 4IHXA 4L0YB 2LD5A 1H9TA 2VQCA 1AKHB 2QLZA 2HVRA 2A61A 3FWEA 4B8XA 2KIUA 1W1WE 3SQNA 1FC3A 1XGOA 1XCVA 3WGIA 1MH4A 3FXQA 4DZPA 5B3SH 5FLXZ 1YRNA 3GUDA 3OYDA 1MNMC 3C2GA 5LLQA 4AYBA 1TNSA 2P7VB 2VQGA 3PNVA 1M1EB 4A3FJ 3QYFA 2HQRA 2P0WA 2I8DA 2IGKA 3HPHA 3QYBA 4M72A 1G3SA 4YIIA 3L1PA 1TQIA 5FROA 3LA3A 1ZG1A 2IGNA 3FXRA 2RAEA 2IBDA 1BIAA 1W5SA 3FMRA 3OYBA 3BR0A 1ZQ3P 2JQ7A 5FLXK 4RB3C 1UG0A 4PSXA 2QUFA 3CDIA 2CS3A 4H0EA 1VQLI 2Y31A 3MEXA 3ECHA 4A5MA 3MZHA 1KU7A 2E1MC 2KIMA 1TWCJ 1V5GA 2O7OA 4PGHA 1R5ID 1VQ9I 4HRIA 1PUEE 1E17A 3CCSI 2XRNA 1J7KA 2CRGA 2AQEA 2V7FA 2BXYA 2PN6A 3K10A 4KT6A 3CF5F 1BR4A 1IDYA 4OMZA 2Y0SA 1BIBA 2L9NA 4KICA 3KFWX 1RRJA 3A2KA 1XSXA 3CUQC 3TW7A 1MMDA 2LSOA 3CCJI 2PLYA 1ON2A 4UUTA 5JVTA 1T38A 1WPKA 3ZOBA 4WK8F 2VE8A 3QYEA 1WJEA 1GHCA 4A2UA 3A0BC 3TMOA 5J1UA 3K9TA 1MNEA 4AIDA 1ZARA 2KPMA 1JI8A 2V1XA 4BYYA 3RKQA 4MO7A 4BH9A 4IEJA 3Q9VA 1SFKA 3IV5A 3L2WA 3CUOA 2XRLA 2DO7A 2LLKA 1B9NA 4G7OF 1VF9A 5KVRA 4A3CJ 2YUSA 2XSDC 1PDNC 1X2NA 2DU9A 5L3DA 2JVHA 3CJRB 1HOMA 4J01A 1ETOA 4EEFG 1LUJB 2F5DA 5DM6F 2M7AA 2JA5J 2ZSHB 3F72A 1WSUA 3GFLA 5FRMA 3L2UA 4NB5A 2ADUA 2VKVA 1HXDA 3CO6C 1IZ1A 5ILVA 1MBFA 3G1OA 1R5HA 5HDGA 2BBYA 3BWGA 2NOGA 1ODDA 3RZDJ 5L3CA 5EEGA 1JGGA 1OCTC 1B59A 2DN0A 2MSYA 4Z6YA 4XN3A 2PBIA 1U78A 1DGWY 1ZYRF 2R7SA 1I3AA 1DQUA 2FOWA 1WH5A 2HQNA 5DCFA 1U8RA 5FKLA 1J9IA 2XPUA 2K9SA 1T33A 4I02A 1LE8A 3FHNA 3GEZA 5CQGA 4EGZA 1HC8A 1LFPA 3WE2A 4BE2A 2P7CB 3ZQLA 3GBGA 3HGYA 1W7PA 4R8HA 1MDMB 2DT7B 1BA5A 2W1OA 1IUFA 4XKCA 1H0MA 2E71A 4PSWA 1A5JA 1EH7A 3MQ0A 2CW7A 3ZQ7A 4ASNA 2KJBA 1L3LA 3PSFA 1I50J 2Q8KA 2XB0X 4DQ2A 4OOIA 4RGRA 3NWSA 5LRRA 2QA4I 4RLQA 3ZP5A 1T08B 3GZ5A 2B7EA 3CJQB 3HRUA 1ULYA 2QQ8A 2VIXA 1R5GA 1FBSA 1OKRA 5J8CA 2PJRA 5AIQA 2EIJH 4BHCA 4LOCA 5K5QA 4V19K 4H4KC 2JRTA 4MHGA 2OQRA 2XGEA 4Y13A 4LIUA 3BDDA 3LSGA 4F52A 1MJBA 1O3RA 3I4MJ 3G4SI 4AIKA 3ZCOA 4HV6A 2DPDA 2ME6A 2Q0OA 3EETA 1FYMA 2L7FP 2QGUA 4LFUA 1ACIA 3ESWB 4GXOA 2R7VA 2COMA 1HW1A 3WGGA 2NVXJ 1RKTA 3BY6A 4F7ZA 1ON1A 4ZYEA 5IP9J 3U2RA 1X3UA 3C7JA 3FF5A 1N77A 2J5PA 4Q4ZF 4XBFA 3CQZJ 2NRAC 4ZTJA 2O61A 2H1KA 4BY1J 1Z7LA 4E7JA 2CJJA 3Q0UA 1VQNI 3DF8A 4PJLA 4IZZA 1P4AA 3BJOA 3LMMA 4A3JJ 3DU5A 2Y69H 4PJMA 3ML6A 1GUUA 1CF7B 4LB6B 2Y0MA 4WXHA 2COBA 5B1BH 2LKPA 3GMEA 1U3EM 3E1SA 1LB2A 2X48A 3BZCA 4NC8A 5DD4A 2ISYA 3CESA 4HBLA 4I99C 4B4CA 1Z1DA 2ZNYA 3A1YA 3OYCA 2UV1A 2G7HA 3JCUC 4BE1A 3EUKL 2K85A 2FMYA 3LSJA 5CYVA 3KIOA 2XGXA 2KISA 4HYEA 3ZXSA 5L3BA 4Q48A 1LEAA 3L2VA 4BXXJ 4BBRJ 4LLGF 1K4SA 2A3SA 2M34A 4RAFA 1IC8A 1P4WA 2JVGA 1DUXC 2LK2A 3MKLA 2K4BA 3WU0A 5K7ZA 1LKXA 2DCEA 3V4GA 3ABTA 2HOTA 2F5VA 4EJUA 3UNGC 3OY9A 4M3FA 4JQFA 2X85A 3CJTB 4YEJA 2ZMEB 1DU0A 2D45A 2KRFA 2Y48A 3FXKA 3SDGA 3CF2A 4BAYA 3D5SC 1R1TA 2GQQA 2CH0A 3RSNA 3ZQQA 3OOPA 3PQKA 3ZQHA 2QF7A 2DFIA 3S93A 1ZH5A 1HW5A 2JSCA 3Q9SA 3I9V2 1YJ9I 1OLTA 2DOEA 4NC6A 3FM3A 4B09A 5D4SA 3WG7H 4M71A 6PAXA 1SVLA 2OF7A 4ZC3A 4UUSB 1V4RA 3VFZA 5JR3A 4WXDA 3FBNB 1S6LA 1X58A 2HTJA 1BM9A 2OCCH 2W00A 2Q1ZB 2EFPA 3AKZA 3NAUA 3HOYJ 2ZXJA 4X1EA 2CUEA 3KEYA 3I59A 3HOTA 3JTHA 2DOAA 4XSZF 2FOKA 3GX4X 2VXDA 2ID6A 2RKHA 3I5UA 1HSJA 1V54H 9ANTA 1WI3A 2BW3A 3VPRA 2VLAA 3J7AO 1XN7A 3CP2A 4W1UA 3AL0C 4CZZA 1YIOA 1ZR4A 1BN5A 2EV0A 2HYJA 1SAUA 4RS8A 3JTGA 1XDSA 2OAZA 2EIKH 4LMYA 1R1VA 3SFZA 1IF1A 2RQPA 3DTEA 1HF0A 3DQVC 3F3XA 2KJCA 1K79A 1NG7A 1TWAJ 3HGGA 2DAOA 2EINH 3A01B 4HF2A 3O3KA 2IT0A 2OV7A 1HCRA 1T0FC 4G9YA 2OPTA 5KHDA 2HQ5A 2VUMJ 4PGGA 3BTJA 3LSPA 1VNDA 4KDPA 3S15J 3I0TA 1LVAA 1B4AA 4FE4A 3PUBA 1IN4A 3S8PA 3DCFA 3V42A 1YE9A 2HOEA 5TGTA 1H88C 5FKMA 5FD5A 3OL3A 4PFOA 3KZZA 4PK4A 4EGYA 2QM3A 2M4GA 3IKVA 2FU4A 2L54A 3X2QH 4I0AA 2CQKA 1Z05A 2DA4A 1Z77A 2CQXA 1A36A 4CGZA 3W2VA 2OA4A 1FT9A 3C2BA 3D1NI 1MD0A 3IHUA 2XB5A 1WJCA 3HKZN 3OIOA 3I4NJ 2LY1A 3D5LA 4Y33A 1QPIA 4G6TB 3TEDA 1FSEA 4O3MA 4UY8I 3LSKA 5HVQC 1SEUA 1ZK8A 5EDNA 2KIQA 3PL8A 4I98B 3ZN0A 4DIQA 5BS6A 2MC4A 1Z9CA 4HV5A 4RAYA 2NVYJ 1DP3A 5L3GA 5FLVA 5GAGJ 3DKWA 1WJBA 3BJ6A 1POGA 5DD8A 3HC7A 2HQAA 3WTXC 3OYKA 2QBYA 4XLFA 2KDZA 2E1NA 1WQ2A 2R7ZJ 1RR8C 2H8RA 1X2MA 2X6XA 1BR2A 2GM4A 2OZUA 4HLYA 1R9TJ 4G6DA 1UAAA 2LF8A 4E4HA 2NVTJ 2WBMA 1P9QC 4MIMA 4HNUA 3HYIA 1X4PA 3U1DA 2ZJRF 4XIDA 2WB1N 3CLQA 2HFHA 4PJNA 4EM0B 3ZMSA 1QHHD 1G6NA 2XAUA 1ORKA 1OR7C 1QHGA 4PZJA 1B72B 2PMUA 4ENKA 1WGXA 4U88A 2ZJPF 1MZBA 3IRRA 1YS6A 2L4AA 1A04A 1RETA 3M07A 4AC0A 3F8NA 4E7SA 3CCQI 2DXIA 2DJIA 1UCRA 4MLOA 4HNTA 1AKHA 4NBQA 3LFKA 1TT0A 1IRFA 5HNFA 3U9GA 2DTZA 3MZYA 1JHFA 4JK1X 4HNVA 3T8TA 2DQRA 4HQMA 1GT0C 4LK1F 1O3SA 2P6SA 4RGSA 2VODA 2BE5F 2LY9A 5LFAA 2O9LA 4UVAA 3HDDA 1UZCA 3A4CA 4KIFA 2LBFA 2W7NA 2YS9A 2R7DA 3I71A 1HA8A 1SD7A 2LDUA 4V2GA 3BQYA 2LFBA 2XROA 1P7JA 2F4IA 3E5QA 2AQFA 2AXTC 3K7AJ 1J09A 2V4JC 3PNYA 3PQJA 3WTUC 3GTPJ 2CMPA 3J81Z 3HUGB 3Q0WA 2XF5A 5CVJA 5LBQA 2VL8A 2EFOA 4RAZA 4R79A 5EGOB 1KU2A 2ELJA 3WHCA 3MFKA 3S3OA 4XN0A 2NNYA 5GP9A 5DTDA 1FPQA 1DP7P 1MSEC 4GCVA 4QPOA 5CQEA 1SD4A 1MBHA 1FBUA 2DA6A 4FISA 1U5TC 4PUSA 3N05A 1OFCX 1ETVA 4E7IA 2HKOA 5IP7J 2O3FA 2BGCA 3OR1C 5D8KB 1U2WA 1OMIA 3OS2A 3J81K 3ZMTA 2HU9A 2JT1A 1GV2A 1IRZA 4RAGA 1QQIA 1OCCH 3P9IA 4HDUA 3CMYA 2EFQA 4HA8A 4IOCF 3BR3A 1A31A 3RPUD 2X0LA 4G7ZF 4DYCA 1QU3A 5FRNA 4LGWA 2XAHA 5JVGF 1BW5A 2O5RA 4BQOA 2DMPA 2AO9A 2JA7J 3ZPLA 1PUFB 2V6EA 5CPRB 1QBJA 3GZNB 3BR5A 2XPVA 3B73A 3HB9A 4L0ZB 1L0OC 1J2XA 4G7HF 3IAM2 3ZMUA 1R49A 4XKBA 3IH2A 4JX6A 3I54A 5D5VB 2X6WA 2TDXA 3WTYC 4S0HB 2Z99A 4IKFA 1W7PD 3FXLA 1F1ZA 2BZTA 3TP3A 3I55I 2H27A 5AONA 3QOEA 4CYCA 2HDCA 1BC8C 2HS5A 2DA2A 2L0KA 1C0WA 1Z91A 1BI2A 4O6JA 2L3DA 1R1UA 4KMUX 3G3ZA 2CG4A 2V9PA 2VPLA 3KP3A 3HG9A 3R6SA 2LOOA 3GTGJ 3IKTA 3G1LA 3BG7A 1X1PA 3IAS2 1BJZA 3MCZA 4P9UA 1AWCA 2ECCA 3OYLA 4HEA2 2PEXA 2E1MB 1MBEA 1SFUA 4LLLA 4U7DA 4EM1A 1D8JA 3BT9A 2V79A 3GW2A 4G6QA 1OCRH 2MLKA 4GYIA 3OYGA 4KITB 1TLHB 1TT5B 2R7XA 2VE9A 1PJRA 1SD5A 1AHDP 1D1CA 4E70A 3M8JA 1MDMA 3OS1A 5FD6A 1K83J 1R58A 1K78B 1JKPC 3CUQB 1K6YA 4M9XA 4YFXF 1R22A 3J7YJ 1GVDA 1TW2A 4M6XA 1BR1A 3HSEA 3KEOA 5E8GA 2OD5A 1KYZA 5IOYA 1HSTA 4BGDA 4YIFA 3OYIA 4I09A 3GTQJ 5D8LB 3H3UA 4L5IA 2R4GA 1AOYA 4LD5A 4P9FA 5EJCA 4CH7A 1NH3A 3FMQA 4N4OB 2FJ1A 4FASD 3CO7C 1X1AA 1WKMA 4I76A 2DA7A 3HBLA 5IYBJ 3HOZJ 2YSRA 5IP6A 3EUAA 3M8EA 4OU0A 2EZHA 2ZFWA 3H92A 2LMDA 2YX4A 2M5WA 3QPHA 2XUBA 3KPHA 3O8GA 3QPLA 4HAMA 4YFKF 4LJZF 2E2HJ 3BR6A 4IQ4A 2R92J 3DLAA 3GVAA 2XDVA 1IXCA 1LDJA 2CFXA 2E7XA 4LK0F 5H6RA 2HGCA 2R7FA 3BTLA 4G8XA 4GDFA 2CV1A 4C3JJ 4E6KG 2AHQA 3K1PA 4QPQA 1MIJA 4IPAA 5F04A 3DKYA 5ICGA 3REOA 1D0YA 1TW3A 3KP6A 2P5KA 1MNDA 1FYLA 2LREA 3K4LA 1OPCA 1YOVB 3E6BA 2XIGA 1T98A 2ZNZA 4FX0A 1HKSA 5HLTA 2AS5F 5M3MJ 3EUHC 4P5OA 3GWZA 4CYDA 1RUNA 5F1RA 1DPRA 3HRSA 1IGNA 3RPQA 4YG2F 1FOWA 2VBZA 4A3DJ 2STWA 2DI3A 3AG2H 4CA0A 3ZQCA 1VQ4I 1CF7A 1MMAA 4Z2YA 5FLMJ 1UHSA 5K1YA 2XGCA 2HZDA 5LGTA 4XSXF 1TTYA 4RMNA 2M1BA 4MQVA 4EMSA 2Z2SB 2GOMA 4MQ9F 4IX7A 1JTXA 4HSRA 4KA4A 2XAQA 4LB5A
chains in the Genus database with same CATH topology
5GADJ 3CMAI 1ACIA 3CCMI 1VQ8I 3PIOF 2NXNB 1QA6A 3CC7I 3CMEI 3CCEI 3CC2I 1YHQI 3CD6I 1YI2I 2OTLI 1VQNI 5DM6F 4IO9F 2E34A 3CCUI 3J7YJ 5DM7F 3CC4I 3G71I 3J7ZI 1VQPI 2H8WA 1YITI 1YJNI 1VQ5I 2FOWA 1MMSA 1FOYA 4UY8I 1HC8A 3CJTB 5GAGJ 1YIJI 1VQ6I 3I56I 5GAEJ 4IOCF 1YJWI 4IOAF 3CCRI 1YJ9I 5JVGF 2E36A 2K3FA 2JQ7A 2ZJQF 2QA4I 1Y39A 3CCLI 3CCVI 1VQLI 5GAHJ 1VQ9I 1FOXA 1VQMI 3CCSI 1S72I 2ZJRF 3CF5F 1FOWA 4V19K 3DLLF 1VQ4I 1VQKI 3I55I 1VQ7I 1VQOI 2E35A 2ZJPF 3CCJI 2QEXI 3PIPF 3CCQI 2OTJI 3G4SI 3G6EI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD J;  3CMA I;  1ACI A;  3CCM I;  1VQ8 I;  3PIO F;  2NXN B;  1QA6 A;  3CC7 I;  3CME I;  3CCE I;  3CC2 I;  1YHQ I;  3CD6 I;  1YI2 I;  2OTL I;  1VQN I;  5DM6 F;  4IO9 F;  2E34 A;  3CCU I;  3J7Y J;  5DM7 F;  3CC4 I;  3G71 I;  3J7Z I;  1VQP I;  2H8W A;  1YIT I;  1YJN I;  1VQ5 I;  2FOW A;  1MMS A;  1FOY A;  4UY8 I;  1HC8 A;  3CJT B;  5GAG J;  1YIJ I;  1VQ6 I;  3I56 I;  5GAE J;  4IOC F;  1YJW I;  4IOA F;  3CCR I;  1YJ9 I;  5JVG F;  2E36 A;  2K3F A;  2JQ7 A;  2ZJQ F;  2QA4 I;  1Y39 A;  3CCL I;  3CCV I;  1VQL I;  5GAH J;  1VQ9 I;  1FOX A;  1VQM I;  3CCS I;  1S72 I;  2ZJR F;  3CF5 F;  1FOW A;  4V19 K;  3DLL F;  1VQ4 I;  1VQK I;  3I55 I;  1VQ7 I;  1VQO I;  2E35 A;  2ZJP F;  3CCJ I;  2QEX I;  3PIP F;  3CCQ I;  2OTJ I;  3G4S I;  3G6E I; 
#chains in the Genus database with same CATH topology
 1FWZ A;  2HNH A;  2ESN A;  2DQL A;  3HPG A;  1KYW A;  1Y8R B;  2F5E A;  3O6B B;  2O8K A;  5BPD A;  1JJ8 C;  3DXJ F;  1SFO J;  3W2A A;  3CME I;  3CCE I;  4HF1 A;  3L00 A;  3CC2 I;  1P2F A;  4OWR B;  2XC7 A;  1E2X A;  1YG2 A;  2E2I J;  2GA1 A;  4HOB A;  1YW8 A;  1AU7 A;  4DW6 A;  1IN6 A;  2ZME A;  2OTL I;  4XON A;  3P9K A;  2HYF A;  3MWM A;  2XAJ A;  2E34 A;  3JSO A;  2D5V A;  2MW8 A;  4BEH B;  2QYO A;  1YW7 A;  3BTI A;  2DK8 A;  3CC4 I;  2KFD A;  1MBG A;  5DYM A;  1TQM A;  2FRH A;  4PCQ A;  2X4H A;  1YQA A;  1ZGA A;  2KQR A;  2L2O A;  4AVP A;  1IG7 A;  3F21 A;  3T5X A;  1FBQ A;  3QOP A;  2BYV E;  2NVQ J;  2W48 A;  4KN4 X;  4UUS A;  3HTU A;  3L2Q A;  2E7W A;  4XQF A;  5DS9 A;  2LVS A;  4D5F A;  3FKJ A;  2EFW A;  2XHK A;  3WTZ A;  1B8I B;  3ELK A;  1W4M A;  4AIJ A;  3CZ6 A;  4GYG A;  4P96 A;  2CQ7 A;  2QSF X;  3TBI A;  3SHF A;  4DYQ A;  5E3M A;  1IXS B;  3QOD A;  4B44 A;  4XOP A;  1OCZ H;  2DTR A;  4D1Q A;  1TBX A;  1FMW A;  2P5V A;  1IN7 A;  2V9V A;  2R5Y B;  1OYY A;  3FKI J;  1IAW A;  2RV8 A;  2RQQ A;  4D5C A;  2G0E A;  2JA2 A;  2KMU A;  2QVO A;  3FM5 A;  1Y1V J;  3TKY A;  2XSJ C;  1IV6 A;  2NOJ B;  2NS8 A;  2GWR A;  1Y56 A;  2M45 A;  3AG3 H;  1E3O C;  3I58 A;  3A01 A;  4XOT A;  4U87 A;  2A69 F;  3JAM Z;  2CW8 A;  4A0X A;  1QVU A;  4RA2 A;  5J4V A;  1K7A A;  2J5O A;  2VKE A;  5J47 A;  4OIQ F;  2H6B A;  3WE3 A;  3F9K A;  3JR9 A;  4ETS A;  3HKZ A;  3P7N A;  5J40 A;  2ACJ A;  4S05 A;  3V8J A;  2R7T A;  5DUK A;  4XK4 A;  4BDZ A;  2MD0 A;  3EQL F;  2KLO A;  4ZH4 F;  1D0X A;  5JHU A;  2DMQ A;  2EB7 A;  4AU7 A;  5JLW A;  2IRF G;  4XM3 A;  4A6D A;  4CDG A;  1O3Q A;  3K0L A;  2OUM A;  5K7F A;  4YIR X;  3G6E I;  3HTS B;  2EH3 A;  3JAM K;  4B48 A;  1SAN A;  3SZG A;  3TDZ C;  1ZG3 A;  4RB1 A;  2V9K A;  5K7H A;  2K86 A;  3PIO F;  3QU3 A;  4E7H A;  2ZJ2 A;  2STT A;  4RGU A;  2X6O A;  4I6Z A;  4UHT A;  3EYY A;  5ICE A;  4E7Z A;  4OIR F;  1XSD A;  1IJW C;  3F8C A;  2MGQ A;  4UB8 C;  4ESB A;  3CCU I;  4NHJ A;  4IL6 C;  3HOU J;  5KK1 A;  1RPW A;  4BDY A;  2IS4 A;  5DM7 F;  3AL0 B;  1KQ9 A;  1WFX A;  2B0L A;  1QPM A;  1R00 A;  2NNN A;  1JHH A;  3KE2 A;  4K2E A;  3Q5F A;  2B63 J;  1JUS A;  3ABM H;  1LDK B;  2HXI A;  4HZF A;  1BI3 A;  1J0R A;  1ZRE A;  3H0G J;  4AUX A;  1MMN A;  1EKE A;  4BHP A;  1S8N A;  1U6G A;  5HOD A;  1O3T A;  2RGV A;  4KFC A;  3WG9 A;  5BPI A;  4FET A;  1FOY A;  1FIA A;  1KQ0 A;  4Y17 A;  3M9A A;  3CLO A;  4KMF A;  3WHB A;  3OYN A;  1ZAO A;  3OIP A;  1T6S A;  2EZI A;  1EV7 A;  2O8X A;  2GXB A;  3HOW J;  1Z67 A;  5J4Y A;  4RM3 A;  4BKX A;  1YRN B;  2E2J J;  1K4T A;  2KRH A;  3TDU C;  2NS0 A;  3JRH A;  1YIJ I;  1G4D A;  3QQA A;  3GFM A;  3IWF A;  2FE3 A;  2H6C A;  3ABK H;  4PDK A;  4BXU A;  4W97 A;  2A6H F;  4EJO A;  2IS1 A;  4Y3O A;  1NHA A;  2V26 A;  3HOX J;  1FMV A;  5ICF A;  1ZRF A;  2VT3 A;  2E36 A;  2MG4 A;  2FF4 A;  2UUZ A;  3K70 D;  3NRV A;  1OYI A;  5E3O A;  4WX9 A;  3W6K B;  1Q1H A;  1SD6 A;  3RQ4 A;  3LST A;  2ESH A;  3C3W A;  4DYR A;  1W36 C;  4AYB N;  4AD9 A;  1UJ8 A;  1ZTR A;  1GV5 A;  2PMZ N;  4A12 A;  4M3D A;  4A3M J;  3K4C A;  4F55 A;  3H5A A;  1SMY F;  4LG0 B;  3FXO A;  1TP4 A;  2K40 A;  3LSM A;  4AM3 A;  5K5R A;  3T1B A;  4J00 A;  3HUG A;  1YW9 A;  3BCA A;  2JUC A;  1MGT A;  3BC8 A;  1YS7 A;  3S1N J;  5GTH C;  4LLN A;  3Q0V A;  2FXA A;  5F64 A;  1H8A C;  3CMM A;  2VAS A;  4JYK A;  2W57 A;  2F2E A;  4C9Y A;  1T39 A;  1V5E A;  1D1B A;  2W84 A;  3QAH A;  1JUP A;  3CC7 I;  2EV6 A;  4J19 A;  1T95 A;  3R60 A;  1QZY A;  1XMK A;  1XCB A;  2FNP A;  2RN7 A;  1KU3 A;  1X3W B;  1I1G A;  3HSR A;  5EEA A;  2G9W A;  2Y0S N;  4YEL A;  3E7L A;  2DOF A;  1X1B A;  4FTH A;  3LOC A;  2A05 A;  2E19 A;  3BOQ A;  1QZZ A;  2DA1 A;  3H9G A;  5IY5 H;  1Z7U A;  5J1R A;  5ERI A;  2M3A A;  1J59 A;  2D2W A;  3LQR A;  1RNL A;  5E20 A;  4A69 C;  3M8F A;  1W36 D;  1G2H A;  1BBY A;  5EZH A;  2IS6 A;  1I1S A;  3ISP A;  2MH2 A;  1ZKG A;  2VJJ A;  3BG5 A;  2ETH A;  3TGN A;  1PUF A;  2DDB A;  2M7B A;  2MFZ A;  1IO2 A;  1FP2 A;  1HKQ A;  3S32 A;  3WTV C;  2FML A;  1YIT I;  2CQN A;  1N75 A;  1KU9 A;  3EDP A;  4IJA A;  5M5Y J;  3R0A A;  2PMH A;  2VOP A;  3BPV A;  4DNC A;  3GTK J;  2BEO A;  1DDN A;  4CIC A;  4BL0 B;  4ENN A;  3UKG A;  5EEH A;  2BV6 A;  5ILU A;  3SEQ A;  5HLH A;  3Q3S A;  2LYC A;  4QWQ A;  4BQA A;  3V8K A;  4XRF A;  3VYU B;  1O57 A;  1D3Y A;  3VB2 A;  1I6X A;  5DV5 A;  2UZK A;  4UUV A;  2M8G X;  4F92 B;  3ONQ A;  5CVR A;  3E5U A;  2W4S A;  3DPU A;  1B6A A;  3BZK A;  3TO6 A;  3HM5 A;  3U21 A;  1RKW A;  1RC9 A;  4M3E A;  1LNW A;  2ZJQ F;  3ABU A;  3FMS A;  1O4X A;  1Y39 A;  1U5T B;  5L3E A;  3BG9 A;  3GYH X;  3HEF A;  3BZ6 A;  3SZT A;  1NK3 P;  1W0T A;  4JX4 A;  1FOX A;  4N4N B;  1K78 A;  1G59 A;  1WCM J;  1YYV A;  1IN8 A;  1VQK I;  1JUM A;  2VQH A;  1U0J A;  1VQ7 I;  2N8G A;  3TW6 A;  3N97 A;  2PJR B;  2HR3 A;  1B1B A;  4OIN F;  2DJN A;  5BNG A;  3U1K A;  1ZGW A;  1H9G A;  1EJ9 A;  4OAZ A;  4A3B J;  2HKX A;  1W0U A;  1JJ6 C;  3FXM A;  1E3H A;  3PNT A;  4EVI A;  2L5Q A;  3J7A Y;  1MJ9 A;  3CJN A;  3QPT A;  4I0B A;  4M3B A;  2H94 A;  2OCE A;  2Q2E B;  1I39 A;  2EZK A;  5EG0 B;  2IVM A;  1TL8 A;  2KT0 A;  1WZ2 A;  3OL4 A;  1ZLJ A;  3WOD F;  1QA6 A;  1P7I A;  4EJT A;  3FXJ A;  3KZI C;  3RKY A;  2A6E F;  3M1C A;  4EJW A;  2QCO A;  5GTI C;  2ISZ A;  2X1D A;  2KRC A;  3CCY A;  1IUY A;  1D8K A;  4MEX F;  4IHW A;  3OS0 A;  1K6O A;  4LIT A;  5DUI A;  2R5Z B;  3MKW B;  3E6D A;  5E3L A;  1V3F A;  3FIW A;  4WCG A;  3KYC B;  3KET A;  3OYA A;  5HS9 A;  1X19 A;  2L02 A;  2VBW A;  3TO9 A;  3HHG A;  3E6M A;  2R3S A;  4MFD A;  3ZQI A;  4DBQ A;  2ZFU A;  3W3C A;  2HXO A;  2PFB A;  1Z21 A;  3JRF A;  4XL9 A;  3RZO J;  3H1C A;  2LNB A;  1WVR A;  1HBX G;  3RJP A;  3HRM A;  5TIS C;  3I3L A;  2H8W A;  4GRI A;  4UVB A;  3O8H A;  5F0C A;  3JRI A;  4OIO F;  2BXZ A;  1MMG A;  2VBX A;  2R7Q A;  4ZZL A;  4KIS A;  2LTP A;  1MBJ A;  3AFH A;  1F5T A;  5LHG A;  2KP6 A;  2V6C A;  4HST A;  1R36 A;  5A2Q Z;  3M4O J;  2GIV A;  2X51 A;  4L9J A;  3MAJ A;  1WJA A;  1SFX A;  1G8X A;  1UFM A;  4C2T A;  3OYF A;  1F4K A;  3I56 I;  1FX7 A;  2XAG A;  3LAP A;  1JTY A;  4XRS A;  3GFI A;  2WY8 Q;  1MH3 A;  4MEY F;  2K3F A;  2FEZ A;  2V1U A;  4PJ0 C;  3SJM A;  2BHY A;  3H0D A;  4JP0 A;  5GPC A;  1AA7 A;  1U8B A;  3QPS A;  1R4N B;  1ZRC A;  5C3E J;  1SC7 A;  2F4M B;  3D5R C;  5JFR A;  3CCV I;  1XGS A;  1WI9 A;  2A68 F;  2KHM A;  5A2Q K;  2F4O B;  4CCN A;  4BJ6 C;  1JT6 A;  2DYR H;  5J3L A;  3K1M A;  5J8F A;  1V55 H;  4MTE A;  3S1R J;  3COA C;  1FTZ A;  4BEH A;  1DGR M;  1NG6 A;  1MKM A;  4CHU A;  3ZMV A;  2BY0 A;  3JRG A;  1D0Z A;  4UB6 C;  3F6V A;  5E79 C;  5LGU A;  2K3P A;  4CCK A;  4RLF A;  1Y8Q B;  2OZ6 A;  3HZJ A;  4EV0 A;  2EIM H;  3S2W A;  1A35 A;  3NAR A;  3OR2 C;  5KAI C;  3JRE A;  5IT9 Z;  3JRA A;  2E60 A;  3ZQG A;  4ABZ A;  2FBH A;  2VQL A;  2JK3 A;  3F8B A;  4D7M A;  1Y6I A;  2VJ4 A;  3H9J A;  5LEK A;  1HW2 A;  2BW3 B;  4WXC A;  2MBF A;  4EAT A;  1B8I A;  2EFN A;  1Y0N A;  5LGN A;  5HLI A;  3BTC A;  2MYS A;  3HXL A;  1YTY A;  4RBO A;  3V7C A;  3ABL H;  3LSR A;  3DV8 A;  3ERM A;  2R5Y A;  1TWH J;  3T0Y A;  4BE0 A;  5IT9 K;  1H89 C;  2WY7 Q;  3LQQ A;  5HDN A;  4PFP A;  2LY2 A;  2CSO A;  5HS8 A;  5LD2 C;  3TQN A;  3L09 A;  4XLE A;  2CUJ A;  3OYH A;  5FFX A;  4A93 J;  1PYV A;  4PJJ A;  4IQJ A;  1V5F A;  2IJL A;  3BR2 A;  2Y9Z A;  1FTT A;  2M0C A;  2F5F A;  1VQP I;  4CCJ A;  1XDU A;  1Z0X A;  3FIS A;  1F43 A;  5HLG A;  2UWM A;  1CGP A;  4C2U A;  2IS2 A;  4Y52 J;  2EQR A;  4KJZ A;  1ZLK A;  3H5N A;  2W82 A;  4QLC U;  1XGM A;  1UMQ A;  2Z1D A;  1IXR C;  1LJ9 A;  3AAF A;  3L9F A;  1LFU P;  2A07 F;  3LFU A;  4JBA A;  5CJ9 A;  4XIC A;  2W25 A;  5C44 J;  5M5W J;  2XAF A;  3CTA A;  2EZL A;  4RM2 A;  1QGP A;  2L9R A;  3PFY A;  1VQ6 I;  3ZRG A;  3DKX A;  2M30 A;  2X9D A;  4DBR A;  2VXZ A;  3C2H A;  1KA8 A;  5K5O A;  2VT2 A;  1YJW I;  1ZRD A;  3ULQ B;  3WGH A;  4AVZ A;  4EM2 A;  2CU7 A;  4F3Q A;  2RC4 A;  2MH9 A;  4XKV A;  4BNC A;  2Y9Y A;  2RNG A;  3SYT A;  4X6A J;  5F08 A;  1E3P A;  3QP5 A;  1DPU A;  2LP0 A;  2QBY B;  1OQY A;  1XX5 A;  3NEU A;  4I01 A;  1OYW A;  3BR1 A;  1TQP A;  4B43 A;  2NS7 A;  3IP4 B;  4U7B A;  3KCC A;  4RB2 C;  2EA4 A;  1RUO A;  1SVO A;  3M1E A;  2JZY A;  1EH6 A;  1GLN A;  2LRD A;  4BUP A;  2JA8 J;  1WJF A;  3E5X A;  4FCY A;  1Y0U A;  4N9I A;  2QSG X;  1UST A;  2WAE A;  5FGM A;  3OSF A;  1VTN C;  1PP7 U;  3BPX A;  3KYL A;  2QEX I;  4CUG A;  2OTJ I;  4BJT A;  2WWY A;  1MBK A;  4M9Z A;  4UV8 A;  2WV0 A;  3OMY A;  2BHZ A;  2LG4 A;  2QSH X;  2VN2 A;  4XRM A;  4O5V A;  3S16 J;  1T0F A;  2FD5 A;  1WHU A;  4M3G A;  2ELK A;  4GGG A;  4NUB A;  4MNU A;  2M4K A;  2ZSI B;  2D1V A;  1WJD A;  2VC1 A;  4HX7 A;  3B6A A;  4IXA A;  5F0F A;  1Z6T A;  5D5X B;  3N4M A;  3RDI A;  2BY1 A;  4DJA A;  2IA2 A;  3S3M A;  4XLA A;  1JXS A;  3V7R A;  2PX9 A;  2P4W A;  3VYS B;  3ZGK A;  4WF2 A;  2DFF A;  2PMZ A;  2I5U A;  5D5W B;  4NC7 A;  2GXA A;  1UG2 A;  3G71 I;  3DEE A;  1E0E A;  2LBF B;  1UEL B;  3FX3 A;  4G12 A;  3GTO J;  5ILS A;  3PFI A;  1XPX A;  2GXG A;  2KL4 A;  3C1D A;  2OC6 A;  4HX4 A;  5L3F A;  1SAX A;  5E1X A;  1ZHF A;  2DMT A;  3ASO H;  2O0Y A;  1WJ5 A;  3E0J B;  2P5L C;  2VI6 A;  3K6G A;  2L7Z A;  2XPW A;  3LA7 A;  1OIS A;  1TZL A;  3RQI A;  4BS9 A;  1UB9 A;  4BJ5 C;  2TCT A;  3LNQ A;  3K4M A;  4C3H J;  1TWG J;  1IN5 A;  4XMY A;  2IGM A;  2KIF A;  2H09 A;  4ZYH A;  4LG0 A;  2F48 A;  4L5E A;  3WU1 B;  1BOA A;  2H1L A;  4HPQ A;  4F93 B;  2IW5 A;  1Y1W J;  3VWB A;  1HQC A;  2WC2 A;  1X4O A;  3ZN1 A;  1D5Y A;  1S5L C;  3KEQ A;  2O03 A;  1XMA A;  2ZKZ A;  2JUG A;  4HG2 A;  4BAC A;  2ZXH A;  2DBB A;  3MMY B;  5LHI A;  3CCL I;  3K2Z A;  2Y2Z A;  2FBI A;  3WU2 C;  1PP8 F;  5GAH J;  2BVL A;  3ERE D;  2DA3 A;  2QQB A;  1ETW A;  2Z3Y A;  5TRD A;  4RB0 A;  4V2F A;  1G3Y A;  2A5W A;  1OR7 A;  2QZ8 A;  3S2D J;  3DBL B;  3BP8 A;  4BHB A;  1S72 I;  1OCP A;  1FYK A;  2MC3 A;  5ICC A;  2MA3 A;  2BY2 A;  4TV7 A;  1R71 A;  5TJJ A;  4CZC A;  2E1O A;  1S3J A;  2ME0 A;  2VBY A;  2M8E A;  4OAY A;  2RNJ A;  3K4N A;  3KP5 A;  5DCM B;  2E35 A;  1WWX A;  3ROU A;  1USS A;  1FLI A;  1P92 A;  3LWF A;  2Z16 A;  2F5C A;  4A5N A;  3PO3 J;  1APL C;  3G2B A;  2LC2 A;  1JE8 A;  3BQZ A;  5F6F A;  1LVK A;  4NQW B;  1JT0 A;  3KP4 A;  3PO2 J;  4CYC B;  2X1E A;  4II2 A;  4M9S A;  3D0S A;  4XLC A;  5DEQ A;  4UV9 A;  3K4J A;  3RPU A;  1S29 A;  4MFE A;  2DLL A;  2WAQ N;  4I7H A;  1YHQ I;  3GCM A;  3BCB A;  1XSV A;  2YU9 J;  2V1N A;  2UXX A;  2ECB A;  2P81 A;  1D5V A;  2OU2 A;  4IHT A;  1R23 A;  2MLG A;  1FSH A;  2EBI A;  2DYS H;  2JJ7 A;  5IOZ A;  2FSW A;  4JOM A;  1ITY A;  1I5Z A;  5B5E C;  3GXO A;  3C18 A;  1ETX A;  3DBR B;  5D6E A;  4GO1 A;  3K69 A;  1TWF J;  2BVM A;  3GFJ A;  1F9N A;  2DOD A;  2HDD A;  1T8I A;  2QWW A;  4L9V A;  5J6X A;  3HL2 A;  4CXF A;  2IEK A;  5C4X J;  2OJE D;  5AIP A;  3GTM J;  1QO0 D;  2X6Y A;  1S7O A;  2VJI A;  2ZXI A;  3FHZ A;  1XS9 A;  1HKT A;  1S7E A;  2D1H A;  3JRD A;  2CW0 F;  1U5T A;  2K4J A;  2FQ3 A;  1R7J A;  4HX8 A;  1A6Q A;  1JGS A;  3W2W A;  1FP1 D;  1I3Q J;  1MSF C;  2FUG 2;  3DTK A;  3GLX A;  5LEJ A;  5CLS A;  2XVC A;  4HW0 A;  3S17 J;  3BLY A;  2VOO A;  2HDW A;  3K70 C;  1X1D A;  1HDP A;  4KNY A;  1X1C A;  5M5X J;  3RIR A;  2HVS A;  4HLX A;  1YFH A;  5E3N A;  1WRJ A;  3WTW C;  3LA2 A;  4ZYA A;  2WB1 A;  5IPA A;  2FQ4 A;  1W5T A;  2L01 A;  3K2A A;  2OBP A;  3F0C A;  2FBK A;  2CQQ A;  3QRF F;  5D5U B;  2ZB9 A;  2Q2E A;  4XR6 A;  2CUZ A;  4DZJ A;  5EG0 A;  2X1C A;  5F27 A;  2YR2 A;  4UXN A;  5F1J A;  3TOA A;  1P6R A;  1X3Z B;  1NK2 P;  1MJA A;  1G3W A;  3UR3 C;  5E18 F;  1RI7 A;  4Q47 A;  1B72 A;  3OYM A;  1VQM I;  3V7S A;  5KCM A;  2R5Z A;  1S7A A;  2DDA A;  1ONV A;  4FT8 A;  3S2H J;  1QVT A;  4A3L J;  1LPQ A;  2B9S A;  2OQG A;  2HVQ A;  3VSL A;  3JW4 A;  2QQ9 A;  5LHH A;  5KNL A;  3IRQ A;  4CCO A;  3HOS A;  5CVV A;  2G7U A;  4CCL A;  5CKT A;  1IRG A;  3SFI A;  2VB6 A;  2WTE A;  4KYW A;  2DFE A;  3QP6 A;  5HS7 A;  4D0P A;  3CP8 A;  2K27 A;  4ZDO A;  2IXS A;  3HOV J;  2XKP A;  4RDU A;  4IHY A;  2KKO A;  4N9H A;  1ZEL A;  2R7R A;  4YRV A;  3OV8 A;  1T2K A;  1QNT A;  1XTA A;  3VYR B;  2GBY A;  3CDL A;  4D9J A;  5BQT A;  5FB2 A;  2RRE A;  1FJL A;  3KX2 A;  2L4M A;  4L9N A;  4E7K A;  3S3N A;  4BQQ A;  2M2E A;  2Z9O A;  2DW4 A;  2ELH A;  2CO5 A;  2IGO A;  3OSG A;  2VON A;  4BBS J;  1O7L A;  2EPF A;  5EF6 A;  1BI0 A;  2IA0 A;  3F8M A;  3S1M J;  5B66 C;  2M0M A;  4A3K J;  2LKX A;  3MKY B;  3JRB A;  5EGO A;  4A0Z A;  2C6Y A;  2AXL A;  3FK7 A;  2NVU B;  2R93 J;  1DU6 A;  4IHS A;  3KLO A;  5CVU A;  4S04 A;  3B6C A;  2R0Q C;  3ZQF A;  3OYJ A;  1KZH A;  2W24 A;  3F8F A;  4ZYG A;  4Y7N J;  4UNO A;  2BY3 A;  1MW7 A;  2YX7 A;  2QEN A;  1YJN I;  2EK5 A;  2JA6 J;  3PM1 A;  1VQ5 I;  1IRX A;  2VJ5 A;  2DMU A;  4ESF A;  2PI0 A;  4NNJ A;  1BOB A;  4L5J A;  2DT6 A;  1STZ A;  4BY7 J;  3JSP A;  4YFN F;  2K02 A;  3MN2 A;  3QWL A;  4WWC A;  1PVE A;  4Y4R A;  2HPM A;  5B1A H;  1D1A A;  5EZG A;  4X0G A;  5JHF A;  4MGR A;  3H3Z A;  3I53 A;  4M73 A;  5GAE J;  3LL7 A;  1Q1V A;  3CCR I;  2VC0 A;  3TO7 A;  5M3F J;  4Q5S F;  3DPT A;  5FKN A;  5FKO A;  4HQE A;  2DT5 A;  3EUH A;  5BOX A;  2DMN A;  4E7L A;  2XKO A;  4CSW A;  1FIP A;  2CUF A;  1CQT A;  4GFB A;  3A02 A;  2EV5 A;  4LG3 A;  2Y75 A;  2JWT A;  5HNH A;  5H2F C;  1FNN A;  3OWT A;  1TNT A;  3EPZ A;  3PUF A;  3R61 A;  3DLL F;  3KZY A;  3QU6 A;  1LE8 B;  4XOR A;  2DA5 A;  4B1R A;  3VEP A;  2HTS A;  3H9Q A;  5E8I A;  3TL4 X;  1VQO I;  1FOK A;  1W7P B;  4OIP F;  3HIF A;  1YX5 A;  1J75 A;  3PIP F;  3H36 A;  3RCO A;  3E6C C;  2EA2 A;  4BQN A;  2L9S A;  2XV4 S;  1ERD A;  1IV8 A;  4D7N A;  4QIW N;  5HOO A;  4FHT A;  3DEU A;  4B3X A;  5E1Z B;  4KN7 X;  4ZDL A;  1KGS A;  2FA5 A;  5KAF C;  3CCM I;  1U9N A;  2FNA A;  1VQ8 I;  4ZJZ A;  1N78 A;  3CUQ A;  1YI2 I;  3OIQ A;  1Z3Y A;  3R4K A;  5CVI A;  5H20 A;  3F22 A;  4A3G J;  1R4M B;  1JKQ C;  4IO9 F;  1LFB A;  2LH9 A;  3DEW A;  3DPL C;  3NQO A;  1XB4 A;  3FDY A;  4QSH A;  5LRS A;  1SVM A;  3I4P A;  1ZGJ A;  2FX0 A;  2ZME C;  4R1H A;  3MD2 A;  2LR8 A;  4DGW B;  4KUM A;  3CDH A;  1B9M A;  3J7Z I;  3VOE A;  2KZG A;  1XGN A;  4N0B A;  3SEZ A;  1T56 A;  2WA0 A;  4C2M J;  1ZG5 A;  4XKW A;  4AWX B;  4NDL A;  3LAJ A;  1LDD A;  2GIZ A;  2E5Z A;  2KDO A;  3B02 A;  4JX5 A;  2PQ8 A;  4IHV A;  3TP0 A;  2QKM B;  3PSI A;  5ED4 A;  4A3E J;  3FXU A;  3OOU A;  3DBH B;  3L7W A;  1I27 A;  2EIL H;  2P8T A;  3F6O A;  4M6Y A;  3PJR A;  1OCO H;  2JPC A;  4HF0 A;  3VYT B;  2GZW A;  1ETQ A;  2R7O A;  4XLP F;  1GDT A;  2NAZ A;  2DPU A;  5IYC J;  3H5R A;  4IRG A;  3KP7 A;  5HDK A;  2DK5 A;  3H3V K;  4ESJ A;  2F6C A;  3FBI B;  4L18 B;  3J80 Z;  2ZC2 A;  3ZMD A;  3DP7 A;  5FO5 A;  2K9N A;  3GO5 A;  2LF7 A;  4A0Y A;  2K9M A;  5C4J J;  4OMY A;  4RGX A;  2GLO A;  3H35 A;  2K5C A;  3KLN A;  3RYP A;  3P9C A;  4FQG A;  1BW6 A;  1RES A;  4IF4 A;  2YU3 A;  2R7W A;  4ANJ A;  4IVN A;  2V1D A;  3F23 A;  4ENJ A;  2HWV A;  4XLH A;  2QQA A;  2VKH A;  1BL0 A;  1HDD C;  4P55 A;  2ID3 A;  3FZV A;  2MD5 A;  3MVP A;  2XAS A;  1A6I A;  2CFO A;  4KT5 C;  1VZ0 A;  2L7K A;  2TRT A;  3L2R A;  1YO5 C;  3S1Q J;  1REP C;  3EYI A;  2M9H A;  5E17 F;  3SZP A;  4EJV A;  1JKO C;  1EA3 A;  3J80 K;  3W6V A;  2JTV A;  3O2P E;  1JKR C;  2JPB A;  3ECO A;  3K4B A;  1N25 A;  4IRH A;  3VOD A;  4B3A A;  2PJP A;  5IYD J;  2ZO4 A;  3S14 J;  3R0J A;  1XD7 A;  2K9Q A;  4A3I J;  4II3 A;  4CO8 A;  4ENM A;  2DFH A;  2GAU A;  2JN6 A;  4FE7 A;  3BG3 A;  3HHH A;  3DFG A;  2A5Y B;  2VPR A;  3KYD B;  3G1M A;  4I2O A;  1TC3 C;  3HSF A;  5GAD J;  2EJR A;  3MZ8 A;  1NTC A;  1Z6R A;  4MTD A;  2R7U A;  3V8L A;  3WTS C;  4ZYD A;  1BJA A;  3M3Y J;  2M87 A;  3E3V A;  3BG6 A;  2CYY A;  1SMT A;  2Y30 A;  2JMW A;  2RVC A;  3SXY A;  4AIH A;  1LEB A;  4CCM A;  1R6R A;  3KP2 A;  2UXN A;  1EH8 A;  2CV0 A;  2LKS A;  5J1Y A;  1XG1 A;  3GTL J;  1ENH A;  4G94 A;  3E97 A;  4ON0 A;  1J5Y A;  5D4R A;  1XMX A;  1XC5 A;  2PG4 A;  3I59 B;  4U0Y A;  3IWZ A;  4ZZD A;  3LSI A;  1SFE A;  3IUO A;  3MKZ A;  1ZN2 A;  5DDG A;  1IDZ A;  3RKX A;  1RR7 A;  2XGD A;  1UHM A;  1U9O A;  2ZCW A;  2XF6 A;  4A6E A;  3TOB A;  3VSK A;  1G3T A;  2HI3 A;  4DOZ A;  2CWE A;  3L2C A;  2I10 A;  1O7F A;  2L7M P;  4ZDP A;  5BMZ A;  1GXP A;  2O6G E;  3ASN H;  1MMS A;  3HJE A;  5FFZ A;  2EWN A;  4B47 A;  5GPA A;  3IC7 A;  5EYR A;  1FY7 A;  2MAB A;  2WAD A;  3BRO A;  3DU6 A;  3AG1 H;  1QRY A;  1F36 A;  3LSH A;  5DCM A;  1FZP B;  2ZXW H;  4IRI A;  3HRT A;  1GXQ A;  1WH7 A;  2HZT A;  2IP2 A;  2WAQ A;  3RI4 A;  1VFC A;  4XLN F;  4HDV A;  1RIO H;  3I64 A;  4NQW A;  4QTR A;  5D6F A;  5H6Q A;  4Y15 A;  1FEX A;  2GOX B;  1ETY A;  2Z5U A;  4IOA F;  1BI1 A;  2XF7 A;  1BC7 C;  1IW7 F;  5FJ8 J;  5JI6 A;  4BXF A;  3RKW A;  4BU2 A;  2JRM A;  1KQ8 A;  3BJA A;  2HOS A;  2QKL B;  3VDX A;  2WV1 A;  4M74 A;  3GZ6 A;  3ZMZ A;  3DTI A;  4KIG A;  4C3I J;  1YLF A;  3IL2 A;  4FX4 A;  1Z3X A;  5E1W A;  4L9T A;  2JSP A;  2Z33 A;  1UHW A;  2KZV A;  4U0W A;  5F0H A;  2RDP A;  2E1C A;  4LIV A;  2CV2 A;  3RYR A;  2IPQ X;  4UVC A;  2ICW G;  1EF4 A;  3OYE A;  1I6H J;  3A0H C;  1OJL A;  2WAF A;  2HEO A;  1GVJ A;  2IA1 A;  3DWL E;  3K4K A;  5JLX A;  1K61 A;  3JRC A;  3WTT C;  1LQ1 A;  4M6V A;  1W5C C;  1QZE A;  1S9H A;  2P6T A;  1YX3 A;  4ITV A;  3SDB A;  3W6J B;  4F91 B;  2A6T A;  3K1N A;  2BOL A;  2K7L A;  1ETK A;  2HOA A;  2IAI A;  3CMA I;  2HYG D;  2ZBK A;  1VI0 A;  1KON A;  2GA2 A;  3FK6 A;  4KIB A;  4XNF A;  3NWT A;  2NXN B;  1RZ4 A;  4XRS G;  2VKD A;  2W85 A;  4C30 A;  3CD6 I;  3RTR A;  5IT3 A;  3IH4 A;  3M7G A;  3ZR8 X;  1P4X A;  4U0V A;  3T8R A;  2L9V A;  3A03 A;  2CGP A;  2NYX A;  4P1W A;  4EQQ A;  3AG4 H;  2YPR A;  5FKK A;  2E5N A;  3G73 A;  3IH3 A;  3GF2 A;  4ZTF A;  1ZR2 A;  3GLL A;  3GTJ J;  3P5J A;  2HPI A;  1HLV A;  2K9L A;  4IHX A;  4L0Y B;  2LD5 A;  1H9T A;  2VQC A;  1AKH B;  2QLZ A;  2HVR A;  2A61 A;  3FWE A;  4B8X A;  2KIU A;  1W1W E;  3SQN A;  1FC3 A;  1XGO A;  1XCV A;  3WGI A;  1MH4 A;  3FXQ A;  4DZP A;  5B3S H;  5FLX Z;  1YRN A;  3GUD A;  3OYD A;  1MNM C;  3C2G A;  5LLQ A;  4AYB A;  1TNS A;  2P7V B;  2VQG A;  3PNV A;  1M1E B;  4A3F J;  3QYF A;  2HQR A;  2P0W A;  2I8D A;  2IGK A;  3HPH A;  3QYB A;  4M72 A;  1G3S A;  4YII A;  3L1P A;  1TQI A;  5FRO A;  3LA3 A;  1ZG1 A;  2IGN A;  3FXR A;  2RAE A;  2IBD A;  1BIA A;  1W5S A;  3FMR A;  3OYB A;  3BR0 A;  1ZQ3 P;  2JQ7 A;  5FLX K;  4RB3 C;  1UG0 A;  4PSX A;  2QUF A;  3CDI A;  2CS3 A;  4H0E A;  1VQL I;  2Y31 A;  3MEX A;  3ECH A;  4A5M A;  3MZH A;  1KU7 A;  2E1M C;  2KIM A;  1TWC J;  1V5G A;  2O7O A;  4PGH A;  1R5I D;  1VQ9 I;  4HRI A;  1PUE E;  1E17 A;  3CCS I;  2XRN A;  1J7K A;  2CRG A;  2AQE A;  2V7F A;  2BXY A;  2PN6 A;  3K10 A;  4KT6 A;  3CF5 F;  1BR4 A;  1IDY A;  4OMZ A;  2Y0S A;  1BIB A;  2L9N A;  4KIC A;  3KFW X;  1RRJ A;  3A2K A;  1XSX A;  3CUQ C;  3TW7 A;  1MMD A;  2LSO A;  3CCJ I;  2PLY A;  1ON2 A;  4UUT A;  5JVT A;  1T38 A;  1WPK A;  3ZOB A;  4WK8 F;  2VE8 A;  3QYE A;  1WJE A;  1GHC A;  4A2U A;  3A0B C;  3TMO A;  5J1U A;  3K9T A;  1MNE A;  4AID A;  1ZAR A;  2KPM A;  1JI8 A;  2V1X A;  4BYY A;  3RKQ A;  4MO7 A;  4BH9 A;  4IEJ A;  3Q9V A;  1SFK A;  3IV5 A;  3L2W A;  3CUO A;  2XRL A;  2DO7 A;  2LLK A;  1B9N A;  4G7O F;  1VF9 A;  5KVR A;  4A3C J;  2YUS A;  2XSD C;  1PDN C;  1X2N A;  2DU9 A;  5L3D A;  2JVH A;  3CJR B;  1HOM A;  4J01 A;  1ETO A;  4EEF G;  1LUJ B;  2F5D A;  5DM6 F;  2M7A A;  2JA5 J;  2ZSH B;  3F72 A;  1WSU A;  3GFL A;  5FRM A;  3L2U A;  4NB5 A;  2ADU A;  2VKV A;  1HXD A;  3CO6 C;  1IZ1 A;  5ILV A;  1MBF A;  3G1O A;  1R5H A;  5HDG A;  2BBY A;  3BWG A;  2NOG A;  1ODD A;  3RZD J;  5L3C A;  5EEG A;  1JGG A;  1OCT C;  1B59 A;  2DN0 A;  2MSY A;  4Z6Y A;  4XN3 A;  2PBI A;  1U78 A;  1DGW Y;  1ZYR F;  2R7S A;  1I3A A;  1DQU A;  2FOW A;  1WH5 A;  2HQN A;  5DCF A;  1U8R A;  5FKL A;  1J9I A;  2XPU A;  2K9S A;  1T33 A;  4I02 A;  1LE8 A;  3FHN A;  3GEZ A;  5CQG A;  4EGZ A;  1HC8 A;  1LFP A;  3WE2 A;  4BE2 A;  2P7C B;  3ZQL A;  3GBG A;  3HGY A;  1W7P A;  4R8H A;  1MDM B;  2DT7 B;  1BA5 A;  2W1O A;  1IUF A;  4XKC A;  1H0M A;  2E71 A;  4PSW A;  1A5J A;  1EH7 A;  3MQ0 A;  2CW7 A;  3ZQ7 A;  4ASN A;  2KJB A;  1L3L A;  3PSF A;  1I50 J;  2Q8K A;  2XB0 X;  4DQ2 A;  4OOI A;  4RGR A;  3NWS A;  5LRR A;  2QA4 I;  4RLQ A;  3ZP5 A;  1T08 B;  3GZ5 A;  2B7E A;  3CJQ B;  3HRU A;  1ULY A;  2QQ8 A;  2VIX A;  1R5G A;  1FBS A;  1OKR A;  5J8C A;  2PJR A;  5AIQ A;  2EIJ H;  4BHC A;  4LOC A;  5K5Q A;  4V19 K;  4H4K C;  2JRT A;  4MHG A;  2OQR A;  2XGE A;  4Y13 A;  4LIU A;  3BDD A;  3LSG A;  4F52 A;  1MJB A;  1O3R A;  3I4M J;  3G4S I;  4AIK A;  3ZCO A;  4HV6 A;  2DPD A;  2ME6 A;  2Q0O A;  3EET A;  1FYM A;  2L7F P;  2QGU A;  4LFU A;  1ACI A;  3ESW B;  4GXO A;  2R7V A;  2COM A;  1HW1 A;  3WGG A;  2NVX J;  1RKT A;  3BY6 A;  4F7Z A;  1ON1 A;  4ZYE A;  5IP9 J;  3U2R A;  1X3U A;  3C7J A;  3FF5 A;  1N77 A;  2J5P A;  4Q4Z F;  4XBF A;  3CQZ J;  2NRA C;  4ZTJ A;  2O61 A;  2H1K A;  4BY1 J;  1Z7L A;  4E7J A;  2CJJ A;  3Q0U A;  1VQN I;  3DF8 A;  4PJL A;  4IZZ A;  1P4A A;  3BJO A;  3LMM A;  4A3J J;  3DU5 A;  2Y69 H;  4PJM A;  3ML6 A;  1GUU A;  1CF7 B;  4LB6 B;  2Y0M A;  4WXH A;  2COB A;  5B1B H;  2LKP A;  3GME A;  1U3E M;  3E1S A;  1LB2 A;  2X48 A;  3BZC A;  4NC8 A;  5DD4 A;  2ISY A;  3CES A;  4HBL A;  4I99 C;  4B4C A;  1Z1D A;  2ZNY A;  3A1Y A;  3OYC A;  2UV1 A;  2G7H A;  3JCU C;  4BE1 A;  3EUK L;  2K85 A;  2FMY A;  3LSJ A;  5CYV A;  3KIO A;  2XGX A;  2KIS A;  4HYE A;  3ZXS A;  5L3B A;  4Q48 A;  1LEA A;  3L2V A;  4BXX J;  4BBR J;  4LLG F;  1K4S A;  2A3S A;  2M34 A;  4RAF A;  1IC8 A;  1P4W A;  2JVG A;  1DUX C;  2LK2 A;  3MKL A;  2K4B A;  3WU0 A;  5K7Z A;  1LKX A;  2DCE A;  3V4G A;  3ABT A;  2HOT A;  2F5V A;  4EJU A;  3UNG C;  3OY9 A;  4M3F A;  4JQF A;  2X85 A;  3CJT B;  4YEJ A;  2ZME B;  1DU0 A;  2D45 A;  2KRF A;  2Y48 A;  3FXK A;  3SDG A;  3CF2 A;  4BAY A;  3D5S C;  1R1T A;  2GQQ A;  2CH0 A;  3RSN A;  3ZQQ A;  3OOP A;  3PQK A;  3ZQH A;  2QF7 A;  2DFI A;  3S93 A;  1ZH5 A;  1HW5 A;  2JSC A;  3Q9S A;  3I9V 2;  1YJ9 I;  1OLT A;  2DOE A;  4NC6 A;  3FM3 A;  4B09 A;  5D4S A;  3WG7 H;  4M71 A;  6PAX A;  1SVL A;  2OF7 A;  4ZC3 A;  4UUS B;  1V4R A;  3VFZ A;  5JR3 A;  4WXD A;  3FBN B;  1S6L A;  1X58 A;  2HTJ A;  1BM9 A;  2OCC H;  2W00 A;  2Q1Z B;  2EFP A;  3AKZ A;  3NAU A;  3HOY J;  2ZXJ A;  4X1E A;  2CUE A;  3KEY A;  3I59 A;  3HOT A;  3JTH A;  2DOA A;  4XSZ F;  2FOK A;  3GX4 X;  2VXD A;  2ID6 A;  2RKH A;  3I5U A;  1HSJ A;  1V54 H;  9ANT A;  1WI3 A;  2BW3 A;  3VPR A;  2VLA A;  3J7A O;  1XN7 A;  3CP2 A;  4W1U A;  3AL0 C;  4CZZ A;  1YIO A;  1ZR4 A;  1BN5 A;  2EV0 A;  2HYJ A;  1SAU A;  4RS8 A;  3JTG A;  1XDS A;  2OAZ A;  2EIK H;  4LMY A;  1R1V A;  3SFZ A;  1IF1 A;  2RQP A;  3DTE A;  1HF0 A;  3DQV C;  3F3X A;  2KJC A;  1K79 A;  1NG7 A;  1TWA J;  3HGG A;  2DAO A;  2EIN H;  3A01 B;  4HF2 A;  3O3K A;  2IT0 A;  2OV7 A;  1HCR A;  1T0F C;  4G9Y A;  2OPT A;  5KHD A;  2HQ5 A;  2VUM J;  4PGG A;  3BTJ A;  3LSP A;  1VND A;  4KDP A;  3S15 J;  3I0T A;  1LVA A;  1B4A A;  4FE4 A;  3PUB A;  1IN4 A;  3S8P A;  3DCF A;  3V42 A;  1YE9 A;  2HOE A;  5TGT A;  1H88 C;  5FKM A;  5FD5 A;  3OL3 A;  4PFO A;  3KZZ A;  4PK4 A;  4EGY A;  2QM3 A;  2M4G A;  3IKV A;  2FU4 A;  2L54 A;  3X2Q H;  4I0A A;  2CQK A;  1Z05 A;  2DA4 A;  1Z77 A;  2CQX A;  1A36 A;  4CGZ A;  3W2V A;  2OA4 A;  1FT9 A;  3C2B A;  3D1N I;  1MD0 A;  3IHU A;  2XB5 A;  1WJC A;  3HKZ N;  3OIO A;  3I4N J;  2LY1 A;  3D5L A;  4Y33 A;  1QPI A;  4G6T B;  3TED A;  1FSE A;  4O3M A;  4UY8 I;  3LSK A;  5HVQ C;  1SEU A;  1ZK8 A;  5EDN A;  2KIQ A;  3PL8 A;  4I98 B;  3ZN0 A;  4DIQ A;  5BS6 A;  2MC4 A;  1Z9C A;  4HV5 A;  4RAY A;  2NVY J;  1DP3 A;  5L3G A;  5FLV A;  5GAG J;  3DKW A;  1WJB A;  3BJ6 A;  1POG A;  5DD8 A;  3HC7 A;  2HQA A;  3WTX C;  3OYK A;  2QBY A;  4XLF A;  2KDZ A;  2E1N A;  1WQ2 A;  2R7Z J;  1RR8 C;  2H8R A;  1X2M A;  2X6X A;  1BR2 A;  2GM4 A;  2OZU A;  4HLY A;  1R9T J;  4G6D A;  1UAA A;  2LF8 A;  4E4H A;  2NVT J;  2WBM A;  1P9Q C;  4MIM A;  4HNU A;  3HYI A;  1X4P A;  3U1D A;  2ZJR F;  4XID A;  2WB1 N;  3CLQ A;  2HFH A;  4PJN A;  4EM0 B;  3ZMS A;  1QHH D;  1G6N A;  2XAU A;  1ORK A;  1OR7 C;  1QHG A;  4PZJ A;  1B72 B;  2PMU A;  4ENK A;  1WGX A;  4U88 A;  2ZJP F;  1MZB A;  3IRR A;  1YS6 A;  2L4A A;  1A04 A;  1RET A;  3M07 A;  4AC0 A;  3F8N A;  4E7S A;  3CCQ I;  2DXI A;  2DJI A;  1UCR A;  4MLO A;  4HNT A;  1AKH A;  4NBQ A;  3LFK A;  1TT0 A;  1IRF A;  5HNF A;  3U9G A;  2DTZ A;  3MZY A;  1JHF A;  4JK1 X;  4HNV A;  3T8T A;  2DQR A;  4HQM A;  1GT0 C;  4LK1 F;  1O3S A;  2P6S A;  4RGS A;  2VOD A;  2BE5 F;  2LY9 A;  5LFA A;  2O9L A;  4UVA A;  3HDD A;  1UZC A;  3A4C A;  4KIF A;  2LBF A;  2W7N A;  2YS9 A;  2R7D A;  3I71 A;  1HA8 A;  1SD7 A;  2LDU A;  4V2G A;  3BQY A;  2LFB A;  2XRO A;  1P7J A;  2F4I A;  3E5Q A;  2AQF A;  2AXT C;  3K7A J;  1J09 A;  2V4J C;  3PNY A;  3PQJ A;  3WTU C;  3GTP J;  2CMP A;  3J81 Z;  3HUG B;  3Q0W A;  2XF5 A;  5CVJ A;  5LBQ A;  2VL8 A;  2EFO A;  4RAZ A;  4R79 A;  5EGO B;  1KU2 A;  2ELJ A;  3WHC A;  3MFK A;  3S3O A;  4XN0 A;  2NNY A;  5GP9 A;  5DTD A;  1FPQ A;  1DP7 P;  1MSE C;  4GCV A;  4QPO A;  5CQE A;  1SD4 A;  1MBH A;  1FBU A;  2DA6 A;  4FIS A;  1U5T C;  4PUS A;  3N05 A;  1OFC X;  1ETV A;  4E7I A;  2HKO A;  5IP7 J;  2O3F A;  2BGC A;  3OR1 C;  5D8K B;  1U2W A;  1OMI A;  3OS2 A;  3J81 K;  3ZMT A;  2HU9 A;  2JT1 A;  1GV2 A;  1IRZ A;  4RAG A;  1QQI A;  1OCC H;  3P9I A;  4HDU A;  3CMY A;  2EFQ A;  4HA8 A;  4IOC F;  3BR3 A;  1A31 A;  3RPU D;  2X0L A;  4G7Z F;  4DYC A;  1QU3 A;  5FRN A;  4LGW A;  2XAH A;  5JVG F;  1BW5 A;  2O5R A;  4BQO A;  2DMP A;  2AO9 A;  2JA7 J;  3ZPL A;  1PUF B;  2V6E A;  5CPR B;  1QBJ A;  3GZN B;  3BR5 A;  2XPV A;  3B73 A;  3HB9 A;  4L0Z B;  1L0O C;  1J2X A;  4G7H F;  3IAM 2;  3ZMU A;  1R49 A;  4XKB A;  3IH2 A;  4JX6 A;  3I54 A;  5D5V B;  2X6W A;  2TDX A;  3WTY C;  4S0H B;  2Z99 A;  4IKF A;  1W7P D;  3FXL A;  1F1Z A;  2BZT A;  3TP3 A;  3I55 I;  2H27 A;  5AON A;  3QOE A;  4CYC A;  2HDC A;  1BC8 C;  2HS5 A;  2DA2 A;  2L0K A;  1C0W A;  1Z91 A;  1BI2 A;  4O6J A;  2L3D A;  1R1U A;  4KMU X;  3G3Z A;  2CG4 A;  2V9P A;  2VPL A;  3KP3 A;  3HG9 A;  3R6S A;  2LOO A;  3GTG J;  3IKT A;  3G1L A;  3BG7 A;  1X1P A;  3IAS 2;  1BJZ A;  3MCZ A;  4P9U A;  1AWC A;  2ECC A;  3OYL A;  4HEA 2;  2PEX A;  2E1M B;  1MBE A;  1SFU A;  4LLL A;  4U7D A;  4EM1 A;  1D8J A;  3BT9 A;  2V79 A;  3GW2 A;  4G6Q A;  1OCR H;  2MLK A;  4GYI A;  3OYG A;  4KIT B;  1TLH B;  1TT5 B;  2R7X A;  2VE9 A;  1PJR A;  1SD5 A;  1AHD P;  1D1C A;  4E70 A;  3M8J A;  1MDM A;  3OS1 A;  5FD6 A;  1K83 J;  1R58 A;  1K78 B;  1JKP C;  3CUQ B;  1K6Y A;  4M9X A;  4YFX F;  1R22 A;  3J7Y J;  1GVD A;  1TW2 A;  4M6X A;  1BR1 A;  3HSE A;  3KEO A;  5E8G A;  2OD5 A;  1KYZ A;  5IOY A;  1HST A;  4BGD A;  4YIF A;  3OYI A;  4I09 A;  3GTQ J;  5D8L B;  3H3U A;  4L5I A;  2R4G A;  1AOY A;  4LD5 A;  4P9F A;  5EJC A;  4CH7 A;  1NH3 A;  3FMQ A;  4N4O B;  2FJ1 A;  4FAS D;  3CO7 C;  1X1A A;  1WKM A;  4I76 A;  2DA7 A;  3HBL A;  5IYB J;  3HOZ J;  2YSR A;  5IP6 A;  3EUA A;  3M8E A;  4OU0 A;  2EZH A;  2ZFW A;  3H92 A;  2LMD A;  2YX4 A;  2M5W A;  3QPH A;  2XUB A;  3KPH A;  3O8G A;  3QPL A;  4HAM A;  4YFK F;  4LJZ F;  2E2H J;  3BR6 A;  4IQ4 A;  2R92 J;  3DLA A;  3GVA A;  2XDV A;  1IXC A;  1LDJ A;  2CFX A;  2E7X A;  4LK0 F;  5H6R A;  2HGC A;  2R7F A;  3BTL A;  4G8X A;  4GDF A;  2CV1 A;  4C3J J;  4E6K G;  2AHQ A;  3K1P A;  4QPQ A;  1MIJ A;  4IPA A;  5F04 A;  3DKY A;  5ICG A;  3REO A;  1D0Y A;  1TW3 A;  3KP6 A;  2P5K A;  1MND A;  1FYL A;  2LRE A;  3K4L A;  1OPC A;  1YOV B;  3E6B A;  2XIG A;  1T98 A;  2ZNZ A;  4FX0 A;  1HKS A;  5HLT A;  2AS5 F;  5M3M J;  3EUH C;  4P5O A;  3GWZ A;  4CYD A;  1RUN A;  5F1R A;  1DPR A;  3HRS A;  1IGN A;  3RPQ A;  4YG2 F;  1FOW A;  2VBZ A;  4A3D J;  2STW A;  2DI3 A;  3AG2 H;  4CA0 A;  3ZQC A;  1VQ4 I;  1CF7 A;  1MMA A;  4Z2Y A;  5FLM J;  1UHS A;  5K1Y A;  2XGC A;  2HZD A;  5LGT A;  4XSX F;  1TTY A;  4RMN A;  2M1B A;  4MQV A;  4EMS A;  2Z2S B;  2GOM A;  4MQ9 F;  4IX7 A;  1JTX A;  4HSR A;  4KA4 A;  2XAQ A;  4LB5 A; 
#chains in the Genus database with same CATH homology
 5GAD J;  3CMA I;  1ACI A;  3CCM I;  1VQ8 I;  3PIO F;  2NXN B;  1QA6 A;  3CC7 I;  3CME I;  3CCE I;  3CC2 I;  1YHQ I;  3CD6 I;  1YI2 I;  2OTL I;  1VQN I;  5DM6 F;  4IO9 F;  2E34 A;  3CCU I;  3J7Y J;  5DM7 F;  3CC4 I;  3G71 I;  3J7Z I;  1VQP I;  2H8W A;  1YIT I;  1YJN I;  1VQ5 I;  2FOW A;  1MMS A;  1FOY A;  4UY8 I;  1HC8 A;  3CJT B;  5GAG J;  1YIJ I;  1VQ6 I;  3I56 I;  5GAE J;  4IOC F;  1YJW I;  4IOA F;  3CCR I;  1YJ9 I;  5JVG F;  2E36 A;  2K3F A;  2JQ7 A;  2ZJQ F;  2QA4 I;  1Y39 A;  3CCL I;  3CCV I;  1VQL I;  5GAH J;  1VQ9 I;  1FOX A;  1VQM I;  3CCS I;  1S72 I;  2ZJR F;  3CF5 F;  1FOW A;  4V19 K;  3DLL F;  1VQ4 I;  1VQK I;  3I55 I;  1VQ7 I;  1VQO I;  2E35 A;  2ZJP F;  3CCJ I;  2QEX I;  3PIP F;  3CCQ I;  2OTJ I;  3G4S I;  3G6E I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...