1XSVA

X-ray crystal structure of conserved hypothetical upf0122 protein sav1236 from staphylococcus aureus subsp. aureus mu50
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
DLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical UPF0122 protein SAV1236
publication title 1.7 Angstrom Crystal Structure of Conserved Hypothetical UPF0122 Protein SAV1236 From Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 40
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsvA00
4KIBA 4Q47A 1TBXA 2J5OA 3KP7A 4AIJA 4R8HA 3RYRA 2ZFWA 1QZZA 3WGHA 5HS8A 1BC7C 4WF2A 1S3JA 4KIGA 3WE3A 3GLXA 1JHHA 4P9UA 2F2EA 3FHZA 3SFZA 5K5QA 4JBAA 2DBBA 1ZGJA 3O6BB 2EWNA 1IRFA 3S2WA 1HQCA 1BI1A 4UV8A 2G9WA 4EGYA 3BPVA 2P5VA 5L3BA 1QPMA 4MEYF 1TW3A 3M8EA 2GIVA 3HSFA 1U6GA 3HRTA 3HRUA 2RNJA 3QP6A 4HQEA 5E1XA 4P5OA 3KP6A 3M7GA 4UHTA 1Z9CA 2M8EA 4A12A 5CVVA 2XV4S 5ILUA 4U88A 3T0YA 4BQAA 3CUQB 5D6FA 3MQ0A 4M71A 2LSOA 2K86A 3GFIA 2QBYB 5D4SA 4Y15A 3IRQA 2NRAC 5BPDA 2DK5A 4S05A 2D45A 3BROA 2ISZA 1ULYA 1MD0A 3L9FA 3F6VA 2HZTA 1FSHA 3K0LA 5CVIA 3DQVC 3CJNA 3QOPA 4IF4A 1FOKA 3ERED 3FWEA 2VBYA 4M9XA 3WODF 4MNUA 2BEOA 3L7WA 3WGIA 2COMA 3RIRA 3KLNA 4RB0A 1R22A 1B59A 1O7FA 1YYVA 1ZRDA 4WCGA 4HF1A 3HYIA 3KFWX 2IA0A 4QLCU 4U0YA 5TJJA 2HYFA 2MD5A 4WXHA 1YW8A 4AIKA 1PDNC 4KN4X 3HHHA 3H92A 1BJAA 3CO7C 5CVRA 3E3VA 2Z33A 2ZJ2A 2VOOA 3NQOA 5DEQA 2FOKA 3KP5A 3N97A 3HOSA 5HLIA 4EM1A 2V9VA 4IRGA 2EFNA 4GO1A 5J8FA 5JVTA 3KLOA 1XSXA 5DDGA 1UHWA 3QAHA 3MCZA 3QRFF 1IAWA 4U7BA 2FNPA 3LA2A 3DPTA 3I5UA 4XSZF 1P6RA 2YPRA 5ICCA 1KQ9A 3KCCA 1HKSA 3F8NA 3G73A 4LB6B 2STTA 3IKVA 3LWFA 2FNAA 2VT2A 2GWRA 3OV8A 3GWZA 2UWMA 2HDCA 2ESHA 5KK1A 3J7AO 2VONA 3JTGA 1J59A 1QBJA 2NAZA 2NNNA 1KU3A 1ZRFA 4Q4ZF 4A0XA 3PFIA 2P6SA 2VE9A 1LEAA 1LVAA 3HOTA 2FBIA 1W7PD 1GXPA 2LDUA 3F23A 4O5VA 3E6MA 4MEXF 5EEHA 4ESBA 4Z2YA 2OBPA 3MZHA 3I71A 5BS6A 1IN5A 3BOQA 2VC0A 3ZN1A 2HR3A 1HBXG 2CQKA 4YFKF 2P8TA 3J81Z 3HRMA 4RB1A 2WWYA 1XDUA 5BMZA 4L18B 2A6HF 3F6OA 4L9VA 2P7VB 2P5LC 2H94A 3CUOA 3GW2A 4MQVA 3C18A 2OU2A 4Y17A 1PP8F 2RV8A 2Y0MA 2QQAA 1I5ZA 1P4AA 5EEGA 4HDVA 3RTRA 2QYOA 3ZPLA 4LK0F 3IWFA 5LGNA 4OINF 2A68F 4MGRA 3GVAA 1K78A 2WTEA 2HTSA 3IL2A 1USSA 4RGRA 2AS5F 3SXYA 1WI9A 4IVNA 3FZVA 3BJOA 5D6EA 4PDKA 5ILSA 4IRHA 3I54A 4A0ZA 1S7OA 2PFBA 1XCVA 3P9KA 3F22A 2EFOA 3TOAA 1E17A 2HOEA 4N9HA 1ZG3A 1GHCA 5L3FA 4GCVA 4FX0A 4AIHA 4LB5A 1ZHFA 1LDDA 3VB2A 1MDMB 5E17F 2LF8A 2FMLA 1L0OC 1S6LA 4F7ZA 2R3SA 3U1DA 1RIOH 2JPBA 3TGNA 3LAJA 3ECHA 3F8BA 3KZZA 2H6BA 4KN7X 3V7CA 3K1NA 2XHKA 4G8XA 2VBZA 3F8FA 3J81K 3KEQA 3BJ6A 3GUDA 3M9AA 1O3QA 3F21A 3QPHA 2FF4A 2EA2A 3EYIA 3MZYA 1U2WA 5LHGA 2ZCWA 1IXSB 3I4PA 5F6FA 1HW1A 3RYPA 4OIPF 3W6KB 2OAZA 3L09A 1AWCA 2PQ8A 1ZREA 2H6CA 2BE5F 2CGPA 1J0RA 1B9NA 3HSEA 4Q48A 2P7CB 4WXCA 1ZYRF 1LEBA 1WRJA 4YIIA 4HZFA 1G3WA 3HHGA 1G4DA 3G3ZA 4KMUX 4P96A 4EJWA 1LJ9A 4KA4A 4I02A 1FP1D 3DEUA 4DQ2A 2Y48A 5LGTA 3ISPA 1I6XA 3TDUC 1G3SA 2G7HA 2XIGA 2NYXA 2HS5A 1TQIA 2DTRA 4LG0B 1FPQA 4HDUA 4LJZF 5H6QA 3O2PE 3F8CA 4B09A 2KIFA 5AONA 1KA8A 1Z6RA 3WTXC 3WTTC 3GYHX 4WX9A 2O3FA 4U0WA 2EFPA 2PEXA 4KDPA 4NQWA 4EM0B 5LEKA 2V79A 4ZYHA 3DPLC 4LFUA 1LDJA 4ZZDA 2KKOA 5D5VB 3M1EA 2KIMA 4YFNF 4PCQA 3EQLF 3KP4A 4EQQA 4ETSA 4I2OA 2FSWA 3V8JA 4ENKA 2A69F 2PMHA 1T98A 2QQBA 4GYGA 3I59A 2H27A 4EVIA 4BHBA 3E97A 2D2WA 4I01A 2MH9A 2ESNA 4WK8F 2EV5A 1XB4A 4CHUA 3F8MA 1HSTA 3WGGA 4ZH4F 2PG4A 2M30A 4HV6A 2W84A 1WQ2A 4LGWA 2GAUA 3I53A 1BIAA 4LMYA 2LF7A 2DI3A 2IT0A 1IZ1A 2Q8KA 3WTUC 3ABTA 4ZZLA 2WC2A 5JFRA 3WTVC 4ENNA 2XASA 4PGHA 2ZKZA 1UCRA 4L0ZB 2EFWA 2HWVA 1Z91A 3LAPA 3K9TA 3H3UA 1U8RA 4JK1X 1K78B 3N4MA 5K5RA 3KP3A 1DP7P 2DPUA 4EJUA 1ON1A 2DQRA 5JI6A 2CFXA 2DK8A 3C7JA 4FHTA 4EMSA 2ADUA 1R23A 5AIPA 2ZNZA 3GO5A 1W5SA 2JSCA 1IN8A 3RDIA 2FBHA 2MH2A 4MQ9F 4GXOA 4OIQF 4L9NA 1QGPA 3V4GA 1BI3A 4MTDA 2VXZA 2HYGD 4G7OF 1MKMA 3U9GA 4ZYEA 4RB2C 3SZTA 1DUXC 2DW4A 1BI0A 5LBQA 1YLFA 1EV7A 4XBFA 1QNTA 2DQLA 4I09A 1CF7A 3P9IA 5IT3A 4I98B 3HTSB 1ZGAA 4A0YA 1U5TC 3VODA 1AOYA 2W24A 2VOPA 4N0BA 1R1TA 4G9YA 4RGXA 3ULQB 2X0LA 2MA3A 2FA5A 3VOEA 2RQPA 1J5YA 1LNWA 1D8JA 2ETHA 2A61A 1WKMA 4HLYA 2L02A 4XRFA 5D8KB 2PLYA 1MGTA 3HUGA 4LLNA 5CVUA 3F3XA 3WTZA 3RJPA 4IHSA 2A3SA 4I0AA 4ENJA 3TO6A 3GFMA 1IN6A 1F5TA 1P4WA 2RGVA 4L5JA 1IN7A 1R58A 3ZMTA 3BPXA 3C1DA 3FF5A 2LNBA 2A07F 2EB7A 4CICA 2PI0A 2W25A 5L3DA 2UZKA 2D1HA 3LQRA 1QO0D 4NB5A 1YFHA 4ZYDA 1G3YA 3B02A 1FP2A 4O6JA 3IRRA 6PAXA 2IJLA 2VE8A 1D5VA 2XAHA 3Q9VA 1U5TA 3FXRA 1YIOA 3J80Z 1IN4A 2VBWA 2DPDA 5DUIA 1Z05A 1J2XA 4R79A 3ABUA 3ZP5A 3RKXA 2P6TA 3C3WA 1T38A 3GFLA 3K69A 2YX7A 5HOOA 4KUMA 2L01A 3NEUA 3FX3A 3T5XA 1XCBA 2HKXA 2IA1A 2STWA 5E8IA 4HX4A 1ZARA 3TO7A 2V1UA 2YU3A 4UUVA 2CG4A 2JRTA 4BHCA 2MLKA 2QM3A 3V8LA 1SMYF 3V8KA 1H0MA 1MZBA 5JHUA 5HDGA 2Q2EA 4HQMA 2RVCA 1EH8A 1FBSA 1SD5A 2FQ3A 1STZA 1PUEE 3I59B 4IJAA 2CSOA 2OQGA 1DPRA 3ZMSA 2PJPA 3SZPA 2WV0A 3TQNA 2EA4A 4HBLA 5DCFA 4IPAA 4BHPA 1RUOA 2XGXA 5CLSA 2E7WA 1FYKA 2QZ8A 3B73A 3KP2A 4M9ZA 1REPC 3I58A 1O3RA 5ILVA 1KGSA 2NNYA 4AD9A 1OYIA 1LDKB 4HV5A 1UB9A 4R1HA 3J80K 3D5LA 3V7RA 1BBYA 3FM3A 4UVCA 1D3YA 1K6OA 4EJOA 2EK5A 4RAYA 2ACJA 1XGMA 2RC4A 4GYIA 2OZ6A 3NRVA 3RI4A 3K1MA 1EH7A 1U78A 4N9IA 5A2QK 3QU3A 1SD6A 2O6GE 1FY7A 2IVMA 3T1BA 5ED4A 4IXAA 4WWCA 4EM2A 1FBUA 1TQMA 1IXRC 3JW4A 1XGNA 2QENA 1E2XA 1YS7A 3JTHA 5HS7A 1SD4A 4BNCA 2BV6A 1B6AA 1GVJA 5HDKA 4AVPA 1CGPA 1GXQA 1YTYA 2HGCA 1USTA 2ZMEA 4YFXF 2QLZA 3ZN0A 4EV0A 4FT8A 5FD6A 2Z3YA 2EJRA 5E18F 5E20A 1MJBA 5FGMA 5LHHA 1SFEA 1MJAA 5FB2A 1Z1DA 1ZN2A 4HX7A 4A2UA 1LB2A 2M5WA 1TTYA 4M72A 4CGZA 1W7PA 3E6DA 1I1GA 2L3DA 3L2CA 3R60A 2E1CA 1SD7A 1K7AA 1FNNA 3R61A 2ISYA 3WU0A 1XGOA 4L9TA 2Z9OA 4U0VA 2D1VA 4O3MA 1ZAOA 3CTAA 1XGSA 5LEJA 3R0AA 4A6DA 4ESJA 2GA1A 3ML6A 2V6CA 5F64A 4M73A 4TV7A 1O7LA 2O0YA 1H9TA 2VODA 2VT3A 1OR7A 2DO7A 5JR3A 1XDSA 1RUNA 1U3EM 1U5TB 2HQRA 4H0EA 3HSRA 3PQJA 3CUQA 4OIOF 3E5XA 1S7AA 1R00A 1BC8C 3DP7A 4M74A 4LD5A 3RPQA 1YW7A 2YSRA 5J8CA 2K27A 3GZ6A 3QPTA 5H6RA 5DCMA 4Y13A 1F1ZA 2V1XA 4I0BA 3ZMUA 1R7JA 3WTSC 1TNSA 1T6SA 1P92A 5ICFA 1IW7F 4HOBA 5LRRA 3JSOA 1YG2A 3VFZA 3KEOA 4D0PA 3GX4X 4EGZA 4HF0A 3LQQA 1KU7A 1OYYA 4L9JA 2RDPA 3ZMDA 4KT5C 5ERIA 3TDZC 5FFZA 2OA4A 3MAJA 2K7LA 2BBYA 3WU1B 5L3GA 1RZ4A 1A04A 2F5EA 2DFIA 2GXGA 4LLLA 3MFKA 2B0LA 2F5DA 3ROUA 3Q9SA 1FYMA 4RGSA 2O61A 2RKHA 2GA2A 3GXOA 1TW2A 1ON2A 2A5YB 1TNTA 4OIRF 2XAQA 1O3TA 4HYEA 1F9NA 2FE3A 1KYZA 1BIBA 4GGGA 1S8NA 2BYVE 3DV8A 4G94A 1IUYA 4ENMA 1V3FA 1QZYA 4HAMA 5HDNA 5E1ZB 4XLPF 5LLQA 3FMRA 2GZWA 3CLOA 3FXQA 1JE8A 4G6DA 1ZG1A 2KJCA 4YG2F 5TRDA 1JXSA 4KIFA 4CYDA 3CO6C 1Y0UA 3E5UA 2XAJA 4P55A 2JPCA 2RN7A 1B9MA 4B8XA 1J9IA 2IW5A 4G6QA 3L00A 4G7HF 2L4MA 4S04A 1MJ9A 3LA3A 3BJAA 2ZMEB 3K1PA 2QWWA 2UXNA 1HW5A 2ZBKA 5DYMA 5ICEA 1QQIA 1XSVA 1TQPA 1O3SA 1SFXA 2CO5A 3U2RA 2H09A 3E5QA 4OU0A 3DXJF 1K79A 1W7PB 2FXAA 1XN7A 4P9FA 2LKPA 2UXXA 5D5WB 3EDPA 4LLGF 1UHMA 1IXCA 2HTJA 4UV9A 4YIFA 1YW9A 2G7UA 2IRFG 4KNYA 2DT5A 1T39A 4BH9A 2HEOA 5IT9K 3FM5A 3W6JB 1F4KA 1FT9A 5E1WA 5DD4A 3FXUA 1YS6A 1ZLKA 5LGUA 3RKYA 4RB3C 3O3KA 3R6SA 2JTVA 2FBKA 1I1SA 3HRSA 3R4KA 4KICA 3T8RA 1MDMA 2E1NA 5D5UB 1T0FA 1XMKA 2DLLA 4OOIA 3LSTA 1KYWA 4EJTA 4M6YA 3WE2A 1HW2A 2F5FA 5DCMB 2X4HA 3GEZA 2XAFA 5J6XA 5D8LB 2IP2A 1Z7UA 2VBXA 4HA8A 3GFJA 2OZUA 3K2ZA 1BOAA 4M9SA 2FRHA 2ZO4A 4UVAA 3V7SA 2K4JA 3BWGA 1EH6A 1R36A 3R0JA 1JGSA 3ZMZA 2P5KA 1Z6TA 3TO9A 5DV5A 5L3EA 2C6YA 3FMQA 1BI2A 4PZJA 4RGUA 5A2QZ 4UVBA 4RAZA 3JAMZ 2K4BA 3ELKA 2XAGA 1YO5C 1TLHB 3VEPA 5HLGA 2PN6A 3KE2A 5CVJA 4I7HA 4CO8A 5FO5A 4UNOA 3IC7A 1JHFA 3P7NA 5D5XB 2GXBA 1WWXA 3JSPA 4A5NA 4EJVA 3I0TA 2GQQA 3DKWA 4OMZA 4L0YB 4HLXA 1FSEA 3RKWA 2ZXJA 3ZQ7A 2XKOA 3EUHA 5E8GA 4LG0A 1UFMA 2W85A 1O57A 3LFKA 2E7XA 2JT1A 4CDGA 2OD5A 2R7FA 4A6EA 1FX7A 1P2FA 4LK1F 1S29A 5DUKA 1PP7U 1OPCA 2VC1A 3OOPA 3WTWC 5KVRA 3F72A 1SMTA 3I64A 1DPUA 2V1DA 4IHTA 5CJ9A 3TKYA 4KFCA 3H3ZA 3COAC 4XSXF 4PGGA 4WXDA 4BYYA 5ICGA 5HVQC 2CWEA 2F5CA 4BXUA 5FFXA 3JAMK 1L3LA 3PQKA 1D8KA 1BM9A 2O03A 1HKQA 2HFHA 4A5MA 2HKOA 2PMUA 1P4XA 4RS8A 2KRFA 3GF2A 4MHGA 1WSUA 2FMYA 5HLHA 1W5TA 5LHIA 1OMIA 1IF1A 2AXLA 3SQNA 5AIQA 2XRNA 3M8FA 5FLXZ 3AAFA 3IHUA 2TDXA 2W57A 1CF7B 1B4AA 4CXFA 4ESFA 1XD7A 5FD5A 4M6XA 4UXNA 3REOA 4E70A 3WTYC 1HXDA 2EV0A 3CUQC 4ZYGA 1R1VA 2ZNYA 2FEZA 4HX8A 2OQRA 2EFQA 2CYYA 3IWZA 2MBFA 1IRGA 4ASNA 2JZYA 5CYVA 3E6BA 1OKRA 2IPQX 4HF2A 3DF8A 2DU9A 2Z99A 2VN2A 3QP5A 5F1RA 4IRIA 1G3TA 1B1BA 1HSJA 4Q5SF 1KQ0A 2O8XA 2PBIA 5DD8A 2K02A 2NS0A 3P9CA 2L4AA 1I27A 1RNLA 1FC3A 3SHFA 2Z5UA 1R1UA 4U7DA 5D4RA 1ZH5A 2M45A 5H20A 1ZG5A 2QBYA 5FLXK 2L54A 2BGCA 1C0WA 2M87A 3KZYA 4FX4A 2QQ9A 2QVOA 1YQAA 1ZLJA 4KMFA 2IA2A 3KETA 1DDNA 3MEXA 3E6CC 2MLGA 2J5PA 3ZMVA 3D0SA 3T8TA 4ON0A 4DNCA 3HIFA 4QWQA 5BPIA 3DFGA 3ECOA 3EYYA 1H9GA 3EETA 5LRSA 3BDDA 1VTNC 1XSDA 3LA7A 2ELHA 4G7ZF 1SAXA 1X3UA 1FYLA 2MC3A 3FMSA 5BQTA 3GZ5A 2XKPA 4XLNF 2KJBA 1R5GA 1J7KA 1OYWA 3BP8A 1NHAA 5L3CA 1FWZA 1KU2A 1BN5A 4MTEA 3BZ6A 1RI7A 3HTUA 2CW0F 4AWXB 2XUBA 2HQNA 3QU6A 1ZRCA 1KU9A 1XMAA 1LQ1A 3WG9A 1Q1HA 1FLIA 1R5HA 1T2KA 2EV6A 2KIUA 1SFUA 3CDHA 1G6NA 3RPUA 5K1YA 2DAOA 1FZPB 3TOBA 1J75A 2FU4A 1W4MA 1KQ8A 4JQFA 4L5IA 2Q0OA 4HW0A 3MWMA 4NHJA 2R7DA 2XVCA 4CZZA 5HS9A 1ODDA 4BAYA 5IT9Z 1HKTA 3Q5FA 5BOXA 2Y75A 2YR2A 2XROA 2YX4A 1FBQA 2P4WA 2M1BA 5K5OA 4KYWA 3BY6A 1V4RA 2A6EF 1ONVA 4K2EA 3IKTA 4OMYA 2QUFA
chains in the Genus database with same CATH superfamily
1VFCA 3I4NJ 2W7NA 2XSDC 4KIBA 2AQFA 1TZLA 2OCEA 2P81A 4LOCA 2R7WA 4C3IJ 3W6VA 4YIRX 5E3OA 4Q47A 2NS8A 1TBXA 3BTIA 2GOMA 2J5OA 4N4NB 3KP7A 2EZKA 2M4KA 4AIJA 4HSRA 1Y6IA 2XGCA 4R8HA 3RYRA 1MH3A 2ZFWA 1QZZA 2E2JJ 3DKXA 2VJIA 2XC7A 2HOAA 3WGHA 5HS8A 1BC7C 4WF2A 4IX7A 1T0FC 1S3JA 1NH3A 4KIGA 3WE3A 2JVHA 2E60A 2WAFA 4RM3A 3GLXA 1YJNI 1JHHA 2BY3A 4P9UA 2F2EA 3FHZA 2V9PA 3SFZA 5K5QA 2HI3A 2IGMA 3DTEA 4JBAA 4AUXA 2DBBA 1Y0NA 2DT6A 2R7VA 1ZGJA 2WAEA 3O6BB 2EWNA 1IRFA 3S2WA 1HQCA 1MW7A 2CUEA 1BI1A 3C2GA 2HZDA 4UV8A 2G9WA 4EGYA 3BPVA 2P5VA 3DCFA 1QVTA 5L3BA 3G4SI 1QPMA 4XLCA 1T95A 1MMNA 4MEYF 1TW3A 2ZJQF 3M8EA 4QIWN 1MBGA 3RQIA 5F04A 3HPHA 2GIVA 3HSFA 1EA3A 2PMZA 2ZXIA 1U6GA 2NXNB 3GZNB 3HRTA 3HRUA 4XN3A 2RNJA 2HDDA 3LOCA 4CCLA 3QP6A 4HQEA 5E1XA 4A93J 4P5OA 1JJ6C 2ZB9A 3KP6A 3UNGC 3M7GA 4UHTA 3H3VK 2K9LA 2KL4A 2XGEA 4BJ6C 1Z9CA 3D1NI 2NVUB 2JN6A 2M8EA 1XX5A 3S16J 2L0KA 2X48A 1A6IA 4E7JA 4A12A 4N4OB 5CVVA 2XV4S 5ILUA 1O4XA 4U88A 3M1CA 3T0YA 4BQAA 3CUQB 5D6FA 3NARA 3MQ0A 4M71A 1GV5A 2LSOA 5J40A 3MKWB 2K86A 3GFIA 4Y52J 3H5NA 2QBYB 2R7XA 5D4SA 4Y15A 1MNMC 3IRQA 2NRAC 5BPDA 2DK5A 4S05A 2D45A 3UR3C 3BROA 2ISZA 4L5EA 3CQZJ 1ULYA 1PUFA 1OCCH 1MD0A 3L9FA 3F6VA 2HZTA 2VJ4A 1W36D 3K0LA 1FSHA 2XF6A 5CVIA 3SEZA 3DQVC 3G71I 3PM1A 4CCOA 3S3OA 4CUGA 2LY9A 3CLQA 1DGWY 5C4JJ 3CJNA 3QOPA 4IF4A 1FOKA 3MD2A 3ERED 3CCVI 3FWEA 2O7OA 2VBYA 3NWSA 4M9XA 3WODF 4MNUA 3L2WA 2BEOA 3BR2A 3L7WA 3GTLJ 1R5ID 4BEHB 3EUHC 3WGIA 5FKOA 2COMA 2ECCA 3RIRA 1EKEA 1X1BA 4AC0A 3KLNA 4RB0A 1R22A 1B59A 1RR8C 1O7FA 1YYVA 4UUTA 2F5VA 4IQJA 1ZRDA 4WCGA 2HVSA 4AVZA 2A5WA 4GFBA 2CMPA 4HF1A 3TW7A 2E5NA 2M4GA 3ERMA 3HYIA 3KFWX 2IA0A 4QLCU 4U0YA 5TJJA 3ZRGA 2LMDA 4W1UA 2HYFA 2MD5A 3HOWJ 3U21A 4WXHA 2N8GA 3AKZA 1YW8A 2XGDA 2KIQA 4AIKA 4HPQA 4KN4X 1PDNC 3HHHA 3H92A 1BJAA 3CO7C 4ZYAA 2R0QC 5CVRA 3E3VA 3HEFA 2Z33A 2ZJ2A 2VOOA 3KX2A 3NQOA 3G1LA 5DEQA 2KQRA 2FOKA 2K3FA 3KP5A 4ZTFA 4XQFA 4XRSG 3N97A 3HOSA 5HLIA 4EM1A 2V1NA 4IL6C 4AM3A 2V9VA 2L7FP 4IRGA 2EFNA 5E3NA 2F6CA 3OYJA 4E7SA 4GO1A 2HVRA 5J8FA 2JA5J 5JVTA 5GAEJ 1GLNA 3KLOA 1XSXA 5DDGA 2FJ1A 1UHWA 3QAHA 3MCZA 1NTCA 3QRFF 2CUFA 1FOWA 4FE7A 1IAWA 4U7BA 1XMXA 1HDDC 3W2VA 3TEDA 2FNPA 3PJRA 3LA2A 2R7QA 2LBFB 3DPTA 3I5UA 4XSZF 3AG4H 1P6RA 2YPRA 5ICCA 5F0HA 1KQ9A 3MN2A 2W48A 3KCCA 2LRDA 2QF7A 1HKSA 2OC6A 2X1CA 3F8NA 3S1MJ 2L9VA 3BG6A 3BTCA 3G73A 3FIWA 4LB6B 5BNGA 2STTA 3IKVA 3LWFA 2FUG2 2FNAA 2VT2A 4F93B 1AKHB 3HXLA 3OYFA 2GWRA 1MMAA 5E79C 3K4LA 2GLOA 3OV8A 3GWZA 4P1WA 2UWMA 2HDCA 2JMWA 2ZXWH 2CS3A 2ESHA 4NBQA 5KK1A 5EG0A 2OTJI 5GAHJ 3J7AO 2VONA 3JTGA 1J59A 3W2WA 1JUMA 1QBJA 2NAZA 2NNNA 1KU3A 1ZRFA 2E1MB 3A02A 4Q4ZF 4A0XA 3PFIA 3LSIA 3FXOA 2P6SA 3DBRB 1X4PA 3CESA 1ETOA 2VE9A 2R5ZA 1LEAA 1LVAA 3HOTA 2FBIA 1W7PD 1GXPA 2NVYJ 1VQ9I 2LDUA 1SVMA 2DN0A 1R4NB 3F23A 3GMEA 4O5VA 2W4SA 4XMYA 1TP4A 2IEKA 3E6MA 4XOTA 2LVSA 4D7MA 4MEXF 2JA2A 1LFUP 1GDTA 1IDYA 5EEHA 3VSLA 2M0CA 2VIXA 3U1KA 4ESBA 4BE0A 4Z2YA 4XRMA 4LIUA 2OBPA 2OPTA 2L9NA 2ZSHB 3MZHA 2GXAA 4C2UA 3I71A 5BS6A 3OYLA 3BOQA 1IN5A 2PMZN 2DA3A 2LG4A 4B3AA 2VC0A 3ZN1A 2HR3A 2R7ZJ 2F4OB 5EYRA 1HBXG 2CQKA 2IBDA 4G12A 4E7ZA 4YFKF 2BY1A 3FISA 3AL0C 1YJWI 3ASOH 2P8TA 1N25A 5KHDA 3CJTB 1MMDA 4CCNA 3J81Z 3I55I 3EUAA 3HRMA 4A3FJ 5J1YA 1TWHJ 2R7UA 4RB1A 2WWYA 2HQ5A 1XDUA 5BMZA 2BHZA 4L18B 2A6HF 3F6OA 4L9VA 4HNUA 2P7VB 4CYCB 2P5LC 2H94A 3CUOA 3GW2A 4MQVA 4ZDLA 3ZQGA 3JR9A 3C18A 1X1PA 2OU2A 4Y17A 2I5UA 1PP8F 2RV8A 1K4TA 2Y0MA 1QPIA 2QQAA 3HM5A 1I5ZA 1P4AA 5EEGA 4RMNA 4HDVA 5H2FC 3RTRA 2QYOA 3ZPLA 3ZQHA 4LK0F 3IWFA 5EZGA 5LGNA 1JI8A 4OINF 2A68F 2DDAA 4MGRA 3GVAA 1K78A 2WTEA 4AYBN 2QQ8A 3H5RA 1FEXA 2HTSA 2E34A 3IL2A 1J09A 1USSA 4RGRA 2AS5F 4A3BJ 3SXYA 1Z3YA 1WI9A 4IVNA 2DFFA 2HXIA 5CKTA 2OJED 3FZVA 3BJOA 5D6EA 4PDKA 5ILSA 3CCRI 4IRHA 1VQLI 1LVKA 3I54A 4A0ZA 1S7OA 2PFBA 5F27A 1XCVA 3P9KA 5B1BH 4MFEA 2KFDA 4HEA2 3J7YJ 3OYAA 2VQHA 4E7HA 1OCZH 3F22A 2IGNA 3L2UA 1XTAA 1SANA 2R93J 2EFOA 3TOAA 3WHBA 4IOCF 1E17A 2HOEA 5J4VA 4N9HA 2CV2A 1ZG3A 3ZGKA 3DEEA 5M5YJ 1GHCA 5L3FA 4JX4A 3S8PA 1Y1WJ 4GCVA 4FX0A 3D5SC 4AIHA 1ZHFA 1OCPA 4LB5A 1LDDA 3VB2A 3K4CA 1MDMB 5E17F 2LF8A 2BZTA 2FMLA 1L0OC 3JCUC 1S6LA 4KT6A 4F7ZA 2R3SA 1UHSA 3U1DA 1RIOH 2JPBA 2EBIA 2V6EA 3TGNA 3LAJA 1PUFB 3ECHA 4FISA 1WH5A 3F8BA 3KZZA 2LTPA 3LSHA 2H6BA 2ZFUA 4KN7X 3GTJJ 3V7CA 3DWLE 1F43A 3K1NA 2XHKA 4BY7J 4C2MJ 4G8XA 2VBZA 2IGOA 3F8FA 3OL3A 3OYCA 3J81K 3KEQA 3BJ6A 1K61A 3GUDA 1ZGWA 2PX9A 3M9AA 1O3QA 1SEUA 2Q1ZB 3F21A 2LR8A 3FDYA 3QPHA 2FF4A 2LC2A 2EA2A 4XKCA 3EYIA 4DYRA 3MZYA 4BJTA 4IKFA 1U2WA 5LHGA 2ZCWA 1IXSB 3I4PA 5F6FA 3OOUA 2MD0A 1HW1A 3GTMJ 3RYPA 3DBHB 5F0FA 4OIPF 3W6KB 2OAZA 3L09A 1AWCA 3TP0A 3GTGJ 2PQ8A 1ZREA 1SAUA 1YOVB 2H6CA 3F0CA 1I3AA 2AQEA 3RQ4A 2LYCA 2BE5F 1LB2A 2CGPA 2VUMJ 1J0RA 4CCMA 1ACIA 1VQPI 3QYFA 1B9NA 3K7AJ 4XKWA 3HSEA 4Q48A 2P7CB 4WXCA 1ZYRF 2L2OA 1LEBA 1VI0A 1WRJA 4YIIA 4HZFA 2JUGA 1G3WA 2Y31A 3HHGA 1G4DA 3G3ZA 2L5QA 4KMUX 3OYMA 2EPFA 2WB1N 4PJJA 1QVUA 2DJIA 4P96A 4EJWA 3G1MA 1LJ9A 3CF5F 5B1AH 1V55H 4KA4A 4I02A 1FP1D 3DEUA 2L7KA 4B44A 4DQ2A 2Y48A 5LGTA 3ISPA 1I6XA 3TDUC 2CRGA 1X1AA 3A2KA 1G3SA 2G7HA 4C3HJ 3PUBA 2XIGA 2JA7J 1D0XA 2NYXA 3DKYA 2M34A 5GAGJ 1BW5A 2HS5A 5IOZA 3BTLA 4OWRB 1TQIA 4IHVA 2DTRA 3BCAA 2ZJPF 2JSPA 3QYBA 4LG0B 3PNVA 4LIVA 1R6RA 3OYNA 3GTPJ 1FPQA 4HDUA 2MABA 3SEQA 4LJZF 3I56I 3ZQFA 1ORKA 2KZGA 5H6QA 3O2PE 2X6OA 3GCMA 3F8CA 4B09A 3H9JA 2KIFA 5AONA 4CZCA 1KA8A 1TT5B 5EG0B 2LFBA 1Z6RA 4M3DA 3WTXC 3M4OJ 3WTTC 3GYHX 5M5XJ 4ZTJA 1X19A 4WX9A 2M2EA 2O3FA 4XL9A 3PIPF 1IC8A 4U0WA 3ZR8X 2EFPA 2LY2A 2PEXA 4KDPA 4XR6A 2COBA 4NQWA 4EM0B 5LEKA 2QSHX 2V79A 3LSKA 4ZYHA 3TL4X 3DPLC 3DLAA 4LFUA 2P0WA 5FRMA 1LDJA 4ZZDA 2KKOA 5D5VB 2VI6A 3M1EA 2KIMA 4YFNF 4PCQA 3CCMI 1N77A 5GP9A 3EQLF 3KP4A 4EQQA 2KMUA 3CJRB 1B72A 4ETSA 4I2OA 2O8KA 3H5AA 2FSWA 2OUMA 5DM7F 3V8JA 4ENKA 4E7IA 2A69F 2PMHA 2ID3A 1T98A 2QQBA 2AHQA 4GYGA 1V5EA 4RLFA 3I59A 1XS9A 4M3EA 2H27A 3CJQB 2IS1A 4EVIA 4BHBA 3E97A 1WGXA 2D2WA 2DA4A 4I01A 2MH9A 3BR6A 1P7IA 1B8IB 2ESNA 4WK8F 2Y9YA 2JUCA 2JA6J 2EV5A 1XB4A 2XB0X 2K3PA 4CHUA 3F8MA 1HSTA 3WGGA 3A01B 4ZH4F 1T56A 3ONQA 2Z2SB 2PG4A 2M30A 4HV6A 2W84A 2M8GX 1WQ2A 1FMWA 4LGWA 3BG7A 2GAUA 1HC8A 3I53A 3BR0A 3PNYA 1BIAA 4LMYA 2LF7A 2DI3A 2LLKA 4Z6YA 2IT0A 3CP2A 1IZ1A 2IAIA 2OF7A 2Q8KA 3WTUC 1IO2A 3ABTA 1Z7LA 2V26A 3OYDA 2CU7A 3IH2A 4ZZLA 2WC2A 5JFRA 3WTVC 2BVMA 4ENNA 2XASA 4B1RA 4Y4RA 2EIKH 3PL8A 3BCBA 5C4XJ 4J01A 2CV1A 2LKXA 4PGHA 3CCQI 2ZKZA 1UCRA 2O5RA 4L0ZB 2EFWA 2XF7A 2HWVA 2V4JC 1Z91A 4D5FA 3LAPA 3K9TA 2CQXA 2H8WA 3H3UA 1U8RA 3B6AA 4JK1X 1K78B 2DA5A 3N4MA 5K5RA 2QKLB 3KP3A 3Q3SA 5IPAA 1DP7P 3HGGA 4PUSA 2DPUA 2VQLA 3DTKA 4EJUA 1ON1A 2DQRA 5JI6A 2CFXA 3WU2C 5JLXA 2DK8A 3C7JA 4FHTA 4EMSA 1JTXA 9ANTA 4B4CA 1PJRA 1WPKA 1HA8A 5DS9A 2K9NA 2ADUA 1R23A 5AIPA 4LG3A 2ZNZA 3GO5A 1W5SA 4H4KC 2JSCA 3AL0B 1X1CA 1IN8A 3CC2I 3RDIA 2FBHA 2DT7B 2MH2A 4MQ9F 5J3LA 4GXOA 4OIQF 4L9NA 1IDZA 4PJLA 4GDFA 1QGPA 3V4GA 1BI3A 4MTDA 2CUZA 2VXZA 4D9JA 4M3BA 4BXFA 2HYGD 3S1RJ 4G7OF 1MKMA 3U9GA 1UJ8A 3BR3A 4ZYEA 1Z77A 4RB2C 5F08A 3A0HC 4UUSA 3SZTA 1ZTRA 1DUXC 2DW4A 1BI0A 5LBQA 1WH7A 1YLFA 1WHUA 1U8BA 2HOSA 4II3A 1EV7A 2EINH 4XBFA 2DMPA 4A3EJ 2F4IA 4BU2A 1QNTA 1D0YA 2DQLA 4I09A 4IEJA 4KITB 1CF7A 3CC4I 3P9IA 1Z21A 1MBHA 3OWTA 5IT3A 2WY8Q 1BR2A 1ETVA 2CQQA 2QA4I 4M6VA 4I98B 3HTSB 2DMUA 1ZGAA 5HNFA 3JRIA 2LOOA 4A0YA 1U5TC 3DTIA 2BOLA 3VODA 1AOYA 1WJ5A 2E2IJ 2W24A 1Y8QB 2VOPA 4N0BA 1M1EB 5FKNA 3A1YA 2FX0A 1R1TA 5TGTA 3BTJA 3FXLA 4G9YA 4ABZA 4RGXA 3ULQB 2X0LA 5HLTA 2MA3A 2FA5A 3VOEA 4X1EA 3CMYA 3CCLI 5IYCJ 2RQPA 1J5YA 1LNWA 1KZHA 1D8JA 2ETHA 2A61A 3S1QJ 1AHDP 1WKMA 4HLYA 2L02A 4XRFA 5D8KB 2PLYA 1MGTA 3HUGA 4LLNA 5CVUA 4BBSJ 3F3XA 3WTZA 3OS2A 3RJPA 2CV0A 2MW8A 4DW6A 1G2HA 1RRJA 4IHSA 2A3SA 4FTHA 4I0AA 4F3QA 4ENJA 3HL2A 2M9HA 3TO6A 3GFMA 1IN6A 4F52A 1F5TA 1IRZA 1P4WA 4BY1J 5HNHA 1NG7A 2VKHA 2RGVA 4L5JA 1IN7A 1R58A 3ZMTA 2R92J 3BPXA 3C1DA 3FF5A 2WAQA 2LNBA 2A07F 2R7SA 5B5EC 2EB7A 1A35A 2KISA 4JX5A 4CICA 2LK2A 5B66C 2PI0A 2W25A 1UZCA 1MBEA 5IP6A 5L3DA 2UZKA 2D1HA 4DOZA 1WCMJ 3IH4A 3PSIA 3NWTA 3LQRA 1QO0D 4NB5A 1YFHA 4ZYDA 1G3YA 3B02A 1FP2A 4O6JA 3IRRA 6PAXA 5EZHA 1E0EA 3CMAI 2IJLA 2VE8A 4FASD 3IV5A 1D5VA 2XAHA 3Q9VA 3QQAA 1U5TA 3FXRA 1YIOA 4AU7A 3LSMA 3J80Z 2R7RA 4ZDOA 2WBMA 1R71A 1IN4A 1LUJB 3MKZA 2OV7A 4YEJA 2VBWA 2DPDA 5DUIA 2LKSA 1Z05A 1J2XA 4BQQA 1KONA 3ABUA 4R79A 3ZP5A 3RKXA 2QSFX 2P6TA 3C3WA 1GUUA 1T38A 3GFLA 4RDUA 3CCYA 3K69A 2YX7A 1QRYA 5HOOA 3IAS2 4KUMA 2L01A 3NEUA 3FX3A 3T5XA 3CZ6A 1XCBA 2HKXA 2F48A 1ZK8A 2IA1A 3H1CA 2STWA 5E8IA 3M3YJ 2GIZA 4HX4A 1ZARA 4CSWA 3TO7A 3OSGA 1JKRC 2V1UA 4NQWB 4XM3A 5DTDA 1IJWC 2YU3A 4UUVA 2CG4A 3K4KA 2HYJA 2JRTA 2L9SA 4BHCA 2RQQA 2MLKA 1DU0A 2QM3A 3V8LA 5EF6A 1SMYF 3V8KA 1H0MA 3H35A 1MZBA 5JHUA 4BL0B 2I10A 1B72B 5HDGA 1UAAA 1WJEA 2Q2EA 2XDVA 2Z1DA 4HQMA 2RVCA 2M0MA 1TL8A 4KISA 1EH8A 3Q0WA 1FBSA 1SD5A 5FKMA 2FQ3A 1STZA 2VXDA 1PUEE 3I59B 1WJCA 3TP3A 4IJAA 3BG9A 1NK3P 1HF0A 2CSOA 4DYCA 1VZ0A 2OQGA 1DPRA 4XNFA 3QOEA 3ZMSA 1JTYA 3SZPA 2PJPA 4NUBA 2WV0A 3TQNA 2EA4A 3N05A 2L7ZA 3AG3H 1G8XA 4HBLA 5DCFA 1NK2P 1I39A 4IPAA 4BHPA 4C30A 3ABMH 1RUOA 2XGXA 4IHYA 5CLSA 2CQ7A 2E7WA 1FYKA 2QZ8A 3B73A 3ZQQA 4RLQA 2YU9J 3KP2A 4M9ZA 1E3OC 2JWTA 2TRTA 1SFKA 1REPC 3I58A 1O3RA 5ILVA 3BQYA 1MSEC 2KP6A 2MG4A 5HODA 1KGSA 2NNYA 2BY2A 4AD9A 3VYRB 5EGOA 1OYIA 2K85A 3MZ8A 4BDZA 1LPQA 1LDKB 4HV5A 3HOUJ 1UB9A 1YI2I 1X1DA 4R1HA 2X9DA 3J80K 3D5LA 2X1DA 3V7RA 1OCOH 1BBYA 4I99C 3JRDA 2DMQA 3FM3A 1QU3A 4UVCA 1D3YA 2QGUA 2HOTA 1K6OA 4EJOA 2M3AA 2EK5A 4RAYA 2ACJA 4RA2A 1MBFA 3JREA 1RR7A 1JUSA 1XGMA 2RC4A 4Y3OA 5IOYA 3OYBA 4GYIA 1VQ5I 4KJZA 2OZ6A 2E36A 3NRVA 3RI4A 1YRNA 1R9TJ 1SVLA 3K1MA 1EH7A 3S1NJ 4RAFA 1U78A 3S93A 4N9IA 3G1OA 5A2QK 3VWBA 3ZXSA 3QU3A 1SD6A 2O6GE 3G2BA 4X6AJ 1D5YA 1FY7A 2IVMA 3T1BA 5ED4A 4IXAA 4WWCA 4EM2A 4HNTA 1FBUA 2H1LA 1QA6A 3C2BA 2K9MA 3S2HJ 3S2DJ 1MNDA 1TQMA 4YRVA 1IXRC 1FOXA 3JW4A 3BR1A 1XGNA 2QENA 1E2XA 2R5YA 1ZELA 4CA0A 4CCJA 1YS7A 3HOVJ 4A3IJ 1S72I 2X6WA 3JTHA 3NAUA 4NC6A 2ICWG 2L7MP 1SD4A 5HS7A 5B3SH 1YITI 4BNCA 4DYQA 2BV6A 5M5WJ 2XSJC 1B6AA 3QYEA 4A3GJ 1GVJA 3V42A 4UUSB 5HDKA 4AVPA 1FTTA 5K7ZA 4A3MJ 3JRFA 2PJRA 1CGPA 1IUFA 1GXQA 1YTYA 4HRIA 4BQNA 4UB8C 2W00A 2HGCA 2DXIA 1USTA 3MMYB 2ZMEA 1D1AA 2XB5A 5LFAA 1APLC 4QTRA 1WZ2A 2DFHA 4YFXF 2QLZA 3ZN0A 1X3ZB 4PJMA 1PVEA 2H8RA 4EV0A 3H0DA 3A4CA 4FT8A 5FD6A 2Z3YA 3HOYJ 1POGA 2EJRA 5E18F 5E20A 4XN0A 1MJBA 5FGMA 5FKLA 5LHHA 1SFEA 1MJAA 5FB2A 2UV1A 1Z1DA 1ETKA 1ZN2A 1Q1VA 3D5RC 4HX7A 4A2UA 4HSTA 2M5WA 3JRGA 2DOAA 1TTYA 1WI3A 2WV1A 4I76A 4M72A 4PSXA 1OLTA 2Y30A 4CGZA 3OSFA 2XF5A 3K70C 5CPRB 1W7PA 3PUFA 2XPVA 3E6DA 1I1GA 2L3DA 3IUOA 3L2CA 3R60A 2E1CA 1SD7A 1K7AA 3HUGB 1FNNA 3K4NA 3R61A 1OCTC 4FETA 1MBKA 2ISYA 3OIPA 3WU0A 4J19A 1XGOA 4L9TA 1TWCJ 2Z9OA 4U0VA 4XLFA 2D1VA 3X2QH 2JA8J 2GBYA 3OL4A 5CQGA 1MNEA 4NC7A 4O3MA 3CCSI 1ZAOA 3CTAA 1XGSA 2XRLA 2D5VA 5LEJA 2RREA 4DGWB 1XC5A 3FK7A 4BKXA 4XOPA 3R0AA 4GRIA 4XLAA 4A6DA 4ESJA 3J7AY 1XPXA 2GA1A 1QZEA 3ML6A 1WJAA 2V6CA 5F64A 3F9KA 4DBRA 1FTZA 3BG5A 5M3MJ 4M73A 4TV7A 1O7LA 2O0YA 2EZHA 3RPUD 3LSGA 2VQGA 2LD5A 1H9TA 2VODA 2E1OA 3C2HA 2R4GA 2VT3A 1OR7A 2DO7A 5JR3A 1XDSA 1RUNA 1U3EM 1U5TB 2HQRA 4PK4A 4H0EA 3HSRA 5EDNA 2KZVA 3PQJA 3CUQA 5FJ8J 1T8IA 1IV6A 3WHCA 4OIOF 3ZOBA 3TMOA 3E5XA 1S7AA 1R00A 4Y33A 4A3DJ 1BC8C 3DP7A 4M74A 4LD5A 3RPQA 1YW7A 2YSRA 5J8CA 2K27A 3GZ6A 1IGNA 3QPTA 2MC4A 3OMYA 4BACA 3P5JA 2ID6A 5KCMA 2M7AA 5H6RA 5DCMA 4Y13A 1F1ZA 1I6HJ 3SZGA 2V1XA 4I0BA 3ZMUA 1R7JA 3E1SA 1TNSA 1GV2A 3WTSC 1WFXA 4UY8I 1T6SA 1WJDA 1P92A 5ICFA 1IW7F 2EILH 3E7LA 4HOBA 2BW3A 1W5CC 5LRRA 3DU5A 2W1OA 3JSOA 1Y8RB 4XIDA 2E2HJ 1YG2A 3I4MJ 4BBRJ 3VFZA 4DIQA 3VPRA 3KEOA 3SJMA 1GVDA 4D0PA 3GX4X 4EGZA 4HF0A 3VYSB 3LQQA 3W3CA 2JRMA 2Q2EB 3K4MA 4IO9F 4XK4A 1KU7A 1V54H 3BR5A 1OYYA 3DEWA 4LITA 4L9JA 2RDPA 3ZMDA 2VJ5A 4KT5C 5ERIA 3BG3A 3TDZC 2HPMA 5FFZA 1VQ6I 2OA4A 2K9SA 3MAJA 2KRHA 2DA2A 4XRSA 2DA1A 2K7LA 4JP0A 2BBYA 3WU1B 5L3GA 1R49A 1RZ4A 1A04A 5JLWA 1OFCX 2F5EA 2DFIA 2KHMA 2GXGA 2ZJRF 4OAYA 4LLLA 3MFKA 3EUKL 4U87A 1ETWA 3CMMA 3FHNA 2R5ZB 2B0LA 2F5DA 3H36A 4MIMA 2YS9A 3ROUA 3Q9SA 4G6TB 4RGSA 1FYMA 5TISC 5E3LA 3CDLA 2O61A 3RKQA 2RKHA 3CC7I 2GA2A 1Z67A 4QSHA 3GXOA 3HKZA 1TW2A 5EGOB 4XKVA 3S14J 3VDXA 4PJ0C 2KRCA 1ON2A 4D5CA 2EZLA 5F0CA 3OYKA 3BZKA 2A5YB 3SDGA 2CW7A 1TNTA 3JRAA 2KDZA 4OIRF 2LREA 2XAQA 1O3TA 4HYEA 1F9NA 2IS4A 2FE3A 1KYZA 3H0GJ 1BIBA 4GGGA 1S8NA 2B63J 4PFPA 3KYLA 1H8AC 2BYVE 3DV8A 4G94A 1IUYA 3S3MA 1DP3A 4ENMA 3HZJA 2CH0A 3Q0UA 3W2AA 1V3FA 1QHGA 1QZYA 4HAMA 5HDNA 5E1ZB 2XAUA 1U9NA 4XLPF 1BW6A 1QHHD 1YRNB 2K5CA 3PFYA 5LLQA 3FMRA 2GZWA 1TWGJ 3CLOA 3FXQA 5J1UA 1JE8A 4G6DA 1ZG1A 4Y7NJ 2KJCA 4YG2F 2JVGA 3IH3A 1VQMI 5TRDA 3PIOF 1JXSA 3ABKH 1A6QA 4KIFA 4JOMA 3ZQIA 4CYDA 1ITYA 4XORA 3CO6C 4E6KG 1S9HA 1Y0UA 3ABLH 3E5UA 2XAJA 3MKLA 4P55A 2RAEA 4C2TA 2JPCA 2ECBA 1OCRH 2R5YB 1FMVA 1TWAJ 2XPWA 1VQ4I 1FOYA 2RN7A 1B9MA 1DU6A 4IHXA 2X85A 3FKIJ 4B8XA 2O9LA 3DLLF 3OY9A 1J9IA 2IW5A 1E3PA 4G6QA 4CH7A 1HOMA 3L00A 4G7HF 2X6YA 1YX5A 1MH4A 2HNHA 2L4MA 3VSKA 4S04A 2PJRB 3DBLB 4IHWA 1BJZA 1MJ9A 4HNVA 2R7OA 3LA3A 2VKEA 3BJAA 1S5LC 3OS0A 1YE9A 2QKMB 3OYHA 2ZMEB 3PNTA 2HPIA 2ZSIB 4B48A 4RAGA 2YUSA 4NDLA 3GLLA 3K1PA 1ETQA 2QWWA 2AO9A 2UXNA 3FKJA 2BXZA 2MFZA 1HW5A 1V5FA 2IGKA 4XICA 2ZBKA 5DYMA 5ICEA 3RZOJ 1QQIA 5EEAA 3GTKJ 1XSVA 3S3NA 1TQPA 3OS1A 1O3SA 1SFXA 3CDIA 2CO5A 3U2RA 2H09A 3E5QA 1YX3A 4CYCA 1G59A 4XONA 2VASA 4OU0A 3DXJF 1K79A 1W7PB 2FXAA 1XN7A 2IXSA 4P9FA 2LKPA 2UXXA 5D5WB 3EDPA 2HXOA 4LLGF 2DYRH 1UHMA 3S17J 1IXCA 4C9YA 2F4MB 5KNLA 2HTJA 4UV9A 4YIFA 4JYKA 2DJNA 1HLVA 1YW9A 2X1EA 2G7UA 2BY0A 3KZIC 4JX6A 2IRFG 5IY5H 4RBOA 4KNYA 2DT5A 1T39A 1F36A 4BH9A 2VPRA 2HEOA 2ZC2A 3S32A 3ZCOA 2KPMA 2VQCA 5IT9K 2JK3A 1YIJI 3FM5A 3K6GA 3W6JB 5JHFA 2MYSA 2DODA 1F4KA 2R7TA 1FT9A 5E1WA 5DD4A 3FXUA 4DBQA 5J4YA 1YS6A 1K83J 3L1PA 1ZLKA 3FXKA 5LGUA 1N75A 2Z16A 1HDPA 3RKYA 3CMEI 4RB3C 3O3KA 1JT0A 3R6SA 5FLMJ 2JTVA 2FBKA 3QODA 1I1SA 3HRSA 2UUZA 3R4KA 1Y39A 1W1WE 5J47A 4KICA 1AU7A 3T8RA 1VF9A 1MDMA 4IOAF 5GTIC 2E1NA 1LE8A 4BUPA 1T0FA 5D5UB 1XMKA 2DMNA 2DLLA 1SFOJ 4OOIA 4EEFG 3LSTA 3LSJA 4S0HB 1KYWA 1ZR2A 4A3JJ 4EJTA 5C44J 4M6YA 1MBJA 3CP8A 5KAFC 3WE2A 1P9QC 1HW2A 4AYBA 2F5FA 3CCJI 1UG0A 5DCMB 2X4HA 4F91B 4BE2A 4V2GA 5GPCA 3QPSA 3GEZA 2XAFA 3HKZN 3BT9A 3K2AA 5J6XA 5D8LB 3UKGA 2IP2A 1Z7UA 2VBXA 2LH9A 4HA8A 5EJCA 5LD2C 3HPGA 3GFJA 2OZUA 4W97A 4EATA 2BW3B 1FIPA 4MLOA 5K7HA 3LNQA 3K2ZA 4RM2A 1BOAA 4M9SA 3A0BC 5GTHC 2FRHA 2ZO4A 1JGGA 5FRNA 4UVAA 1ZKGA 4OAZA 3V7SA 2K4JA 1MMGA 5J1RA 3BWGA 4E7LA 4A3LJ 1EH6A 1R36A 1W36C 3R0JA 1JGSA 3ZMZA 2P5KA 1Z6TA 2DA6A 2NVQJ 4FCYA 3TO9A 2HQAA 2EIMH 3OIQA 5DV5A 5L3EA 2C6YA 2Y0SA 3FMQA 2MSYA 1BI2A 2B7EA 5JVGF 1T08B 4PZJA 4RGUA 5A2QZ 4UVBA 2CUJA 4RAZA 3JAMZ 2K4BA 3ELKA 2XAGA 1YO5C 1H88C 2CJJA 4AIDA 1TLHB 3VEPA 3LFUA 2ME0A 5HLGA 2PN6A 3KE2A 3KYDB 4I7HA 5CVJA 1VQKI 4CO8A 1T33A 5FO5A 4UNOA 4A3KJ 4DZPA 3FK6A 2X6XA 3RCOA 5F1JA 3IC7A 1JHFA 2HDWA 3OYIA 4DZJA 3P7NA 5D5XB 2GXBA 1WWXA 2JQ7A 3JSPA 1GT0C 3PO3J 3RZDJ 1RPWA 2DA7A 2DFEA 4A5NA 4EJVA 1EJ9A 1OQYA 3I0TA 5IYBJ 1EF4A 1JT6A 3BC8A 2GQQA 4B43A 3DKWA 4OMZA 4L0YB 4HLXA 4XKBA 4E7KA 1FSEA 3RKWA 3IP4B 3A03A 4XLHA 1AA7A 5IP7J 4M3GA 2E71A 3JRBA 2ZXJA 2K9QA 3ZQ7A 1A5JA 2XKOA 3EUHA 5E8GA 3KYCB 3LL7A 4LG0A 1UFMA 2Y9ZA 2W85A 1O57A 2NOJB 4A69C 2FOWA 3LFKA 3RSNA 3CCEI 2H1KA 2E7XA 2JT1A 2E19A 2QCOA 4BS9A 1BR1A 1X3WB 3IAM2 4CDGA 2OD5A 4CCKA 2R7FA 3HB9A 2OCCH 2V7FA 4A6EA 1FX7A 4YELA 1P2FA 2DOEA 3PSFA 4LK1F 1S29A 2W82A 5DUKA 1PP7U 1OPCA 2VC1A 2VPLA 3OOPA 3K4BA 3FBNB 3WTWC 3E0JB 1MMSA 1IG7A 5KVRA 1JJ8C 3F72A 1SMTA 2HU9A 4F92B 2WB1A 2ZMEC 3I64A 2NOGA 3ASNH 1DPUA 2ME6A 2V1DA 3HGYA 4IHTA 5CJ9A 3TKYA 4F55A 4KFCA 3H3ZA 1WVRA 2CFOA 4II2A 4XSXF 4PGGA 4XLEA 3COAC 1JKPC 2BHYA 4WXDA 3CCUI 4BYYA 5ICGA 2FQ4A 1Y1VJ 5HVQC 1K6YA 3AG1H 2DYSH 1D1BA 3O8HA 4QPOA 4ANJA 2NS7A 2CWEA 2F5CA 3MVPA 1RETA 3BLYA 5E3MA 2ELKA 2Y69H 1K4SA 1SVOA 2VL8A 4BXUA 4E4HA 3L2RA 5FFXA 3JAMK 1L3LA 1B8IA 2GOXB 3AFHA 3PQKA 3GTQJ 2RNGA 4FE4A 3L2VA 1D8KA 5FROA 1BM9A 2VKDA 3Q0VA 3QPLA 2E35A 2O03A 3A01A 1HKQA 2HFHA 4A5MA 1A31A 1DQUA 2FD5A 2HKOA 3GTOJ 2PMUA 2VKVA 1P4XA 4RS8A 2KRFA 3GF2A 4MHGA 4X0GA 1V5GA 1YJ9I 1WSUA 2IS2A 3L2QA 2FMYA 5HLHA 5DM6F 3ZQLA 1W5TA 2ELJA 5LHIA 3FXJA 2K40A 1OMIA 2XPUA 1VQOI 1LFPA 4QPQA 2Y2ZA 4FQGA 1IF1A 5IP9J 2AXLA 3SQNA 1BR4A 5AIQA 1MSFC 1W0UA 5FLVA 2XRNA 3FXMA 3M8FA 5FLXZ 3AAFA 3IHUA 2TDXA 2KT0A 3KEYA 2EIJH 4IQ4A 3KPHA 1X4OA 2WAQN 3K70D 3JRCA 2W57A 3M07A 2L9RA 1XG1A 1CF7B 1B4AA 4CXFA 1VQ7I 4ESFA 1XD7A 5FD5A 1BL0A 4M6XA 4I6ZA 1D0ZA 1OR7C 3OYEA 4UXNA 3REOA 4E70A 4BGDA 1Z3XA 5GADJ 3WTYC 3J7ZI 1BA5A 1HXDA 2EV0A 3CUQC 1JUPA 4ZYGA 1U9OA 1R1VA 2LP0A 2FEZA 2ZNYA 4HX8A 1ETXA 2KDOA 2OQRA 2EQRA 3HDDA 1RESA 2EFQA 1YHQI 3CD6I 2CYYA 3IWZA 2BVLA 1DGRM 2MBFA 1IRGA 1WJFA 3OYGA 4ASNA 2B9SA 2JZYA 5CYVA 1ZQ3P 3E6BA 3PO2J 1OKRA 2IPQX 4HG2A 1JKQC 1D1CA 4HF2A 1ERDA 3DF8A 2Y0SN 2DU9A 4ZC3A 4MFDA 3TBIA 3VYTB 4DJAA 2Z99A 1LE8B 2CW8A 2VN2A 3QP5A 5F1RA 4IRIA 3I3LA 1G3TA 1B1BA 1HSJA 2BXYA 4Q5SF 3DU6A 1KQ0A 3HOXJ 1UG2A 3ZQCA 1W0TA 2MGQA 1FJLA 2JJ7A 3B6CA 3SFIA 2DDBA 1RKTA 2DMTA 2O8XA 1VQ8I 2PBIA 5DD8A 4J00A 4C3JJ 1PYVA 2K02A 2NS0A 3P9CA 2WY7Q 2GM4A 2L4AA 3HC7A 1H89C 2TCTA 3AG2H 3HJEA 3LSPA 4BXXJ 3LMMA 3OR2C 1I27A 3DPUA 3O8GA 1RNLA 3K4JA 1FC3A 3QWLA 3SHFA 2Z5UA 1R1UA 4U7DA 1A36A 2QSGX 2HVQA 5D4RA 1ZH5A 1P7JA 3SDBA 2M45A 2AXTC 5H20A 1OISA 2EH3A 4NNJA 1ZG5A 2QBYA 4A3CJ 4M3FA 5FLXK 2KLOA 2L54A 1Z0XA 2BGCA 2CQNA 1LKXA 1C0WA 2M87A 5KAIC 2NVXJ 3KZYA 2DOFA 1JKOC 4FX4A 2VB6A 2QQ9A 2QVOA 3WG7H 1ZR4A 1YQAA 2A05A 1ZLJA 2M7BA 4PFOA 4KMFA 2IA2A 3CF2A 3KETA 1DDNA 1ENHA 3MEXA 3E6CC 1TWFJ 2IS6A 1NG6A 1N78A 2MLGA 2J5PA 3ZMVA 3D0SA 1Y56A 3T8TA 4ON0A 2VLAA 4DNCA 3HIFA 1IV8A 4QWQA 5BPIA 3DFGA 3G6EI 2DTZA 1U0JA 5K7FA 3ECOA 3EYYA 4BEHA 5IYDJ 1H9GA 4ITVA 3EETA 1TC3C 5LRSA 3OIOA 1X58A 3BDDA 1VTNC 3BQZA 4D1QA 1XSDA 3LA7A 1E3HA 1LFBA 2ELHA 4G7ZF 1SAXA 1X3UA 1FYLA 2NVTJ 2MC3A 3FMSA 2WA0A 5BQTA 3GZ5A 4NC8A 2XKPA 1VQNI 3EPZA 4BJ5C 3JRHA 2E1MC 4XLNF 4IZZA 4D7NA 2KJBA 1R5GA 1VNDA 1J7KA 1OYWA 3BP8A 1NHAA 5L3CA 4PJNA 1FWZA 1KU2A 1BN5A 2V9KA 1X2MA 3BZ6A 1RI7A 4MTEA 3HTUA 3GBGA 2QEXI 2CW0F 4AWXB 2XUBA 2HQNA 1HCRA 3QU6A 4PSWA 1ZRCA 2I8DA 1S7EA 3TW6A 4ZDPA 1KU9A 3M8JA 1UELB 2WADA 1XMAA 3H9QA 1BOBA 2A6TA 1LQ1A 3WG9A 1Q1HA 4B3XA 1FLIA 1MIJA 1R5HA 5CQEA 4BE1A 1WJBA 3KIOA 1ETYA 3HOZJ 2LBFA 1T2KA 2EV6A 3S15J 2KIUA 1SFUA 3CDHA 1X2NA 1G6NA 3RPUA 1OJLA 3ESWB 4BQOA 1RKWA 5K1YA 2DAOA 5GPAA 1IRXA 1I50J 1AKHA 3TOBA 1FZPB 1J75A 3HG9A 2FU4A 1W4MA 1KQ8A 4JQFA 4L5IA 2Q0OA 4HW0A 3MWMA 4NHJA 4ZJZA 5M3FJ 2OTLI 2R7DA 2XVCA 4CZZA 5HS9A 2E5ZA 1ODDA 3SYTA 1CQTA 4B47A 4BAYA 5IT9Z 3Q5FA 1HKTA 2G0EA 3BZCA 5BOXA 2EZIA 2LY1A 2Y75A 2YR2A 2YX4A 5FKKA 2XROA 3MKYB 1FBQA 2VJJA 2P4WA 2M1BA 5K5OA 4BDYA 2ZXHA 4KYWA 3BY6A 3HBLA 3I9V2 1I3QJ 2DCEA 4MO7A 1FIAA 1V4RA 4UB6C 1TT0A 3FBIB 3VYUB 1UMQA 2A6EF 1ONVA 3LSRA 4K2EA 1RC9A 3IKTA 5C3EJ 2X51A 3K10A 1R4MB 3OR1C 4OMYA 1SC7A 3H9GA 4V2FA 2QUFA 4V19K
chains in the Genus database with same CATH topology
4KIBA 4Q47A 1TBXA 2J5OA 3KP7A 4AIJA 4R8HA 3RYRA 2ZFWA 1QZZA 3WGHA 5HS8A 1BC7C 4WF2A 1S3JA 4KIGA 3WE3A 3GLXA 1JHHA 4P9UA 2F2EA 3FHZA 3SFZA 5K5QA 4JBAA 2DBBA 1ZGJA 3O6BB 2EWNA 1IRFA 3S2WA 1HQCA 1BI1A 4UV8A 2G9WA 4EGYA 3BPVA 2P5VA 5L3BA 1QPMA 4MEYF 1TW3A 3M8EA 2GIVA 3HSFA 1U6GA 3HRTA 3HRUA 2RNJA 3QP6A 4HQEA 5E1XA 4P5OA 3KP6A 3M7GA 4UHTA 1Z9CA 2M8EA 4A12A 5CVVA 2XV4S 5ILUA 4U88A 3T0YA 4BQAA 3CUQB 5D6FA 3MQ0A 4M71A 2LSOA 2K86A 3GFIA 2QBYB 5D4SA 4Y15A 3IRQA 2NRAC 5BPDA 2DK5A 4S05A 2D45A 3BROA 2ISZA 1ULYA 1MD0A 3L9FA 3F6VA 2HZTA 1FSHA 3K0LA 5CVIA 3DQVC 3CJNA 3QOPA 4IF4A 1FOKA 3ERED 3FWEA 2VBYA 4M9XA 3WODF 4MNUA 2BEOA 3L7WA 3WGIA 2COMA 3RIRA 3KLNA 4RB0A 1R22A 1B59A 1O7FA 1YYVA 1ZRDA 4WCGA 4HF1A 3HYIA 3KFWX 2IA0A 4QLCU 4U0YA 5TJJA 2HYFA 2MD5A 4WXHA 1YW8A 4AIKA 1PDNC 4KN4X 3HHHA 3H92A 1BJAA 3CO7C 5CVRA 3E3VA 2Z33A 2ZJ2A 2VOOA 3NQOA 5DEQA 2FOKA 3KP5A 3N97A 3HOSA 5HLIA 4EM1A 2V9VA 4IRGA 2EFNA 4GO1A 5J8FA 5JVTA 3KLOA 1XSXA 5DDGA 1UHWA 3QAHA 3MCZA 3QRFF 1IAWA 4U7BA 2FNPA 3LA2A 3DPTA 3I5UA 4XSZF 1P6RA 2YPRA 5ICCA 1KQ9A 3KCCA 1HKSA 3F8NA 3G73A 4LB6B 2STTA 3IKVA 3LWFA 2FNAA 2VT2A 2GWRA 3OV8A 3GWZA 2UWMA 2HDCA 2ESHA 5KK1A 3J7AO 2VONA 3JTGA 1J59A 1QBJA 2NAZA 2NNNA 1KU3A 1ZRFA 4Q4ZF 4A0XA 3PFIA 2P6SA 2VE9A 1LEAA 1LVAA 3HOTA 2FBIA 1W7PD 1GXPA 2LDUA 3F23A 4O5VA 3E6MA 4MEXF 5EEHA 4ESBA 4Z2YA 2OBPA 3MZHA 3I71A 5BS6A 1IN5A 3BOQA 2VC0A 3ZN1A 2HR3A 1HBXG 2CQKA 4YFKF 2P8TA 3J81Z 3HRMA 4RB1A 2WWYA 1XDUA 5BMZA 4L18B 2A6HF 3F6OA 4L9VA 2P7VB 2P5LC 2H94A 3CUOA 3GW2A 4MQVA 3C18A 2OU2A 4Y17A 1PP8F 2RV8A 2Y0MA 2QQAA 1I5ZA 1P4AA 5EEGA 4HDVA 3RTRA 2QYOA 3ZPLA 4LK0F 3IWFA 5LGNA 4OINF 2A68F 4MGRA 3GVAA 1K78A 2WTEA 2HTSA 3IL2A 1USSA 4RGRA 2AS5F 3SXYA 1WI9A 4IVNA 3FZVA 3BJOA 5D6EA 4PDKA 5ILSA 4IRHA 3I54A 4A0ZA 1S7OA 2PFBA 1XCVA 3P9KA 3F22A 2EFOA 3TOAA 1E17A 2HOEA 4N9HA 1ZG3A 1GHCA 5L3FA 4GCVA 4FX0A 4AIHA 4LB5A 1ZHFA 1LDDA 3VB2A 1MDMB 5E17F 2LF8A 2FMLA 1L0OC 1S6LA 4F7ZA 2R3SA 3U1DA 1RIOH 2JPBA 3TGNA 3LAJA 3ECHA 3F8BA 3KZZA 2H6BA 4KN7X 3V7CA 3K1NA 2XHKA 4G8XA 2VBZA 3F8FA 3J81K 3KEQA 3BJ6A 3GUDA 3M9AA 1O3QA 3F21A 3QPHA 2FF4A 2EA2A 3EYIA 3MZYA 1U2WA 5LHGA 2ZCWA 1IXSB 3I4PA 5F6FA 1HW1A 3RYPA 4OIPF 3W6KB 2OAZA 3L09A 1AWCA 2PQ8A 1ZREA 2H6CA 2BE5F 2CGPA 1J0RA 1B9NA 3HSEA 4Q48A 2P7CB 4WXCA 1ZYRF 1LEBA 1WRJA 4YIIA 4HZFA 1G3WA 3HHGA 1G4DA 3G3ZA 4KMUX 4P96A 4EJWA 1LJ9A 4KA4A 4I02A 1FP1D 3DEUA 4DQ2A 2Y48A 5LGTA 3ISPA 1I6XA 3TDUC 1G3SA 2G7HA 2XIGA 2NYXA 2HS5A 1TQIA 2DTRA 4LG0B 1FPQA 4HDUA 4LJZF 5H6QA 3O2PE 3F8CA 4B09A 2KIFA 5AONA 1KA8A 1Z6RA 3WTXC 3WTTC 3GYHX 4WX9A 2O3FA 4U0WA 2EFPA 2PEXA 4KDPA 4NQWA 4EM0B 5LEKA 2V79A 4ZYHA 3DPLC 4LFUA 1LDJA 4ZZDA 2KKOA 5D5VB 3M1EA 2KIMA 4YFNF 4PCQA 3EQLF 3KP4A 4EQQA 4ETSA 4I2OA 2FSWA 3V8JA 4ENKA 2A69F 2PMHA 1T98A 2QQBA 4GYGA 3I59A 2H27A 4EVIA 4BHBA 3E97A 2D2WA 4I01A 2MH9A 2ESNA 4WK8F 2EV5A 1XB4A 4CHUA 3F8MA 1HSTA 3WGGA 4ZH4F 2PG4A 2M30A 4HV6A 2W84A 1WQ2A 4LGWA 2GAUA 3I53A 1BIAA 4LMYA 2LF7A 2DI3A 2IT0A 1IZ1A 2Q8KA 3WTUC 3ABTA 4ZZLA 2WC2A 5JFRA 3WTVC 4ENNA 2XASA 4PGHA 2ZKZA 1UCRA 4L0ZB 2EFWA 2HWVA 1Z91A 3LAPA 3K9TA 3H3UA 1U8RA 4JK1X 1K78B 3N4MA 5K5RA 3KP3A 1DP7P 2DPUA 4EJUA 1ON1A 2DQRA 5JI6A 2CFXA 2DK8A 3C7JA 4FHTA 4EMSA 2ADUA 1R23A 5AIPA 2ZNZA 3GO5A 1W5SA 2JSCA 1IN8A 3RDIA 2FBHA 2MH2A 4MQ9F 4GXOA 4OIQF 4L9NA 1QGPA 3V4GA 1BI3A 4MTDA 2VXZA 2HYGD 4G7OF 1MKMA 3U9GA 4ZYEA 4RB2C 3SZTA 1DUXC 2DW4A 1BI0A 5LBQA 1YLFA 1EV7A 4XBFA 1QNTA 2DQLA 4I09A 1CF7A 3P9IA 5IT3A 4I98B 3HTSB 1ZGAA 4A0YA 1U5TC 3VODA 1AOYA 2W24A 2VOPA 4N0BA 1R1TA 4G9YA 4RGXA 3ULQB 2X0LA 2MA3A 2FA5A 3VOEA 2RQPA 1J5YA 1LNWA 1D8JA 2ETHA 2A61A 1WKMA 4HLYA 2L02A 4XRFA 5D8KB 2PLYA 1MGTA 3HUGA 4LLNA 5CVUA 3F3XA 3WTZA 3RJPA 4IHSA 2A3SA 4I0AA 4ENJA 3TO6A 3GFMA 1IN6A 1F5TA 1P4WA 2RGVA 4L5JA 1IN7A 1R58A 3ZMTA 3BPXA 3C1DA 3FF5A 2LNBA 2A07F 2EB7A 4CICA 2PI0A 2W25A 5L3DA 2UZKA 2D1HA 3LQRA 1QO0D 4NB5A 1YFHA 4ZYDA 1G3YA 3B02A 1FP2A 4O6JA 3IRRA 6PAXA 2IJLA 2VE8A 1D5VA 2XAHA 3Q9VA 1U5TA 3FXRA 1YIOA 3J80Z 1IN4A 2VBWA 2DPDA 5DUIA 1Z05A 1J2XA 4R79A 3ABUA 3ZP5A 3RKXA 2P6TA 3C3WA 1T38A 3GFLA 3K69A 2YX7A 5HOOA 4KUMA 2L01A 3NEUA 3FX3A 3T5XA 1XCBA 2HKXA 2IA1A 2STWA 5E8IA 4HX4A 1ZARA 3TO7A 2V1UA 2YU3A 4UUVA 2CG4A 2JRTA 4BHCA 2MLKA 2QM3A 3V8LA 1SMYF 3V8KA 1H0MA 1MZBA 5JHUA 5HDGA 2Q2EA 4HQMA 2RVCA 1EH8A 1FBSA 1SD5A 2FQ3A 1STZA 1PUEE 3I59B 4IJAA 2CSOA 2OQGA 1DPRA 3ZMSA 2PJPA 3SZPA 2WV0A 3TQNA 2EA4A 4HBLA 5DCFA 4IPAA 4BHPA 1RUOA 2XGXA 5CLSA 2E7WA 1FYKA 2QZ8A 3B73A 3KP2A 4M9ZA 1REPC 3I58A 1O3RA 5ILVA 1KGSA 2NNYA 4AD9A 1OYIA 1LDKB 4HV5A 1UB9A 4R1HA 3J80K 3D5LA 3V7RA 1BBYA 3FM3A 4UVCA 1D3YA 1K6OA 4EJOA 2EK5A 4RAYA 2ACJA 1XGMA 2RC4A 4GYIA 2OZ6A 3NRVA 3RI4A 3K1MA 1EH7A 1U78A 4N9IA 5A2QK 3QU3A 1SD6A 2O6GE 1FY7A 2IVMA 3T1BA 5ED4A 4IXAA 4WWCA 4EM2A 1FBUA 1TQMA 1IXRC 3JW4A 1XGNA 2QENA 1E2XA 1YS7A 3JTHA 5HS7A 1SD4A 4BNCA 2BV6A 1B6AA 1GVJA 5HDKA 4AVPA 1CGPA 1GXQA 1YTYA 2HGCA 1USTA 2ZMEA 4YFXF 2QLZA 3ZN0A 4EV0A 4FT8A 5FD6A 2Z3YA 2EJRA 5E18F 5E20A 1MJBA 5FGMA 5LHHA 1SFEA 1MJAA 5FB2A 1Z1DA 1ZN2A 4HX7A 4A2UA 1LB2A 2M5WA 1TTYA 4M72A 4CGZA 1W7PA 3E6DA 1I1GA 2L3DA 3L2CA 3R60A 2E1CA 1SD7A 1K7AA 1FNNA 3R61A 2ISYA 3WU0A 1XGOA 4L9TA 2Z9OA 4U0VA 2D1VA 4O3MA 1ZAOA 3CTAA 1XGSA 5LEJA 3R0AA 4A6DA 4ESJA 2GA1A 3ML6A 2V6CA 5F64A 4M73A 4TV7A 1O7LA 2O0YA 1H9TA 2VODA 2VT3A 1OR7A 2DO7A 5JR3A 1XDSA 1RUNA 1U3EM 1U5TB 2HQRA 4H0EA 3HSRA 3PQJA 3CUQA 4OIOF 3E5XA 1S7AA 1R00A 1BC8C 3DP7A 4M74A 4LD5A 3RPQA 1YW7A 2YSRA 5J8CA 2K27A 3GZ6A 3QPTA 5H6RA 5DCMA 4Y13A 1F1ZA 2V1XA 4I0BA 3ZMUA 1R7JA 3WTSC 1TNSA 1T6SA 1P92A 5ICFA 1IW7F 4HOBA 5LRRA 3JSOA 1YG2A 3VFZA 3KEOA 4D0PA 3GX4X 4EGZA 4HF0A 3LQQA 1KU7A 1OYYA 4L9JA 2RDPA 3ZMDA 4KT5C 5ERIA 3TDZC 5FFZA 2OA4A 3MAJA 2K7LA 2BBYA 3WU1B 5L3GA 1RZ4A 1A04A 2F5EA 2DFIA 2GXGA 4LLLA 3MFKA 2B0LA 2F5DA 3ROUA 3Q9SA 1FYMA 4RGSA 2O61A 2RKHA 2GA2A 3GXOA 1TW2A 1ON2A 2A5YB 1TNTA 4OIRF 2XAQA 1O3TA 4HYEA 1F9NA 2FE3A 1KYZA 1BIBA 4GGGA 1S8NA 2BYVE 3DV8A 4G94A 1IUYA 4ENMA 1V3FA 1QZYA 4HAMA 5HDNA 5E1ZB 4XLPF 5LLQA 3FMRA 2GZWA 3CLOA 3FXQA 1JE8A 4G6DA 1ZG1A 2KJCA 4YG2F 5TRDA 1JXSA 4KIFA 4CYDA 3CO6C 1Y0UA 3E5UA 2XAJA 4P55A 2JPCA 2RN7A 1B9MA 4B8XA 1J9IA 2IW5A 4G6QA 3L00A 4G7HF 2L4MA 4S04A 1MJ9A 3LA3A 3BJAA 2ZMEB 3K1PA 2QWWA 2UXNA 1HW5A 2ZBKA 5DYMA 5ICEA 1QQIA 1XSVA 1TQPA 1O3SA 1SFXA 2CO5A 3U2RA 2H09A 3E5QA 4OU0A 3DXJF 1K79A 1W7PB 2FXAA 1XN7A 4P9FA 2LKPA 2UXXA 5D5WB 3EDPA 4LLGF 1UHMA 1IXCA 2HTJA 4UV9A 4YIFA 1YW9A 2G7UA 2IRFG 4KNYA 2DT5A 1T39A 4BH9A 2HEOA 5IT9K 3FM5A 3W6JB 1F4KA 1FT9A 5E1WA 5DD4A 3FXUA 1YS6A 1ZLKA 5LGUA 3RKYA 4RB3C 3O3KA 3R6SA 2JTVA 2FBKA 1I1SA 3HRSA 3R4KA 4KICA 3T8RA 1MDMA 2E1NA 5D5UB 1T0FA 1XMKA 2DLLA 4OOIA 3LSTA 1KYWA 4EJTA 4M6YA 3WE2A 1HW2A 2F5FA 5DCMB 2X4HA 3GEZA 2XAFA 5J6XA 5D8LB 2IP2A 1Z7UA 2VBXA 4HA8A 3GFJA 2OZUA 3K2ZA 1BOAA 4M9SA 2FRHA 2ZO4A 4UVAA 3V7SA 2K4JA 3BWGA 1EH6A 1R36A 3R0JA 1JGSA 3ZMZA 2P5KA 1Z6TA 3TO9A 5DV5A 5L3EA 2C6YA 3FMQA 1BI2A 4PZJA 4RGUA 5A2QZ 4UVBA 4RAZA 3JAMZ 2K4BA 3ELKA 2XAGA 1YO5C 1TLHB 3VEPA 5HLGA 2PN6A 3KE2A 5CVJA 4I7HA 4CO8A 5FO5A 4UNOA 3IC7A 1JHFA 3P7NA 5D5XB 2GXBA 1WWXA 3JSPA 4A5NA 4EJVA 3I0TA 2GQQA 3DKWA 4OMZA 4L0YB 4HLXA 1FSEA 3RKWA 2ZXJA 3ZQ7A 2XKOA 3EUHA 5E8GA 4LG0A 1UFMA 2W85A 1O57A 3LFKA 2E7XA 2JT1A 4CDGA 2OD5A 2R7FA 4A6EA 1FX7A 1P2FA 4LK1F 1S29A 5DUKA 1PP7U 1OPCA 2VC1A 3OOPA 3WTWC 5KVRA 3F72A 1SMTA 3I64A 1DPUA 2V1DA 4IHTA 5CJ9A 3TKYA 4KFCA 3H3ZA 3COAC 4XSXF 4PGGA 4WXDA 4BYYA 5ICGA 5HVQC 2CWEA 2F5CA 4BXUA 5FFXA 3JAMK 1L3LA 3PQKA 1D8KA 1BM9A 2O03A 1HKQA 2HFHA 4A5MA 2HKOA 2PMUA 1P4XA 4RS8A 2KRFA 3GF2A 4MHGA 1WSUA 2FMYA 5HLHA 1W5TA 5LHIA 1OMIA 1IF1A 2AXLA 3SQNA 5AIQA 2XRNA 3M8FA 5FLXZ 3AAFA 3IHUA 2TDXA 2W57A 1CF7B 1B4AA 4CXFA 4ESFA 1XD7A 5FD5A 4M6XA 4UXNA 3REOA 4E70A 3WTYC 1HXDA 2EV0A 3CUQC 4ZYGA 1R1VA 2ZNYA 2FEZA 4HX8A 2OQRA 2EFQA 2CYYA 3IWZA 2MBFA 1IRGA 4ASNA 2JZYA 5CYVA 3E6BA 1OKRA 2IPQX 4HF2A 3DF8A 2DU9A 2Z99A 2VN2A 3QP5A 5F1RA 4IRIA 1G3TA 1B1BA 1HSJA 4Q5SF 1KQ0A 2O8XA 2PBIA 5DD8A 2K02A 2NS0A 3P9CA 2L4AA 1I27A 1RNLA 1FC3A 3SHFA 2Z5UA 1R1UA 4U7DA 5D4RA 1ZH5A 2M45A 5H20A 1ZG5A 2QBYA 5FLXK 2L54A 2BGCA 1C0WA 2M87A 3KZYA 4FX4A 2QQ9A 2QVOA 1YQAA 1ZLJA 4KMFA 2IA2A 3KETA 1DDNA 3MEXA 3E6CC 2MLGA 2J5PA 3ZMVA 3D0SA 3T8TA 4ON0A 4DNCA 3HIFA 4QWQA 5BPIA 3DFGA 3ECOA 3EYYA 1H9GA 3EETA 5LRSA 3BDDA 1VTNC 1XSDA 3LA7A 2ELHA 4G7ZF 1SAXA 1X3UA 1FYLA 2MC3A 3FMSA 5BQTA 3GZ5A 2XKPA 4XLNF 2KJBA 1R5GA 1J7KA 1OYWA 3BP8A 1NHAA 5L3CA 1FWZA 1KU2A 1BN5A 4MTEA 3BZ6A 1RI7A 3HTUA 2CW0F 4AWXB 2XUBA 2HQNA 3QU6A 1ZRCA 1KU9A 1XMAA 1LQ1A 3WG9A 1Q1HA 1FLIA 1R5HA 1T2KA 2EV6A 2KIUA 1SFUA 3CDHA 1G6NA 3RPUA 5K1YA 2DAOA 1FZPB 3TOBA 1J75A 2FU4A 1W4MA 1KQ8A 4JQFA 4L5IA 2Q0OA 4HW0A 3MWMA 4NHJA 2R7DA 2XVCA 4CZZA 5HS9A 1ODDA 4BAYA 5IT9Z 1HKTA 3Q5FA 5BOXA 2Y75A 2YR2A 2XROA 2YX4A 1FBQA 2P4WA 2M1BA 5K5OA 4KYWA 3BY6A 1V4RA 2A6EF 1ONVA 4K2EA 3IKTA 4OMYA 2QUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIB A;  4Q47 A;  1TBX A;  2J5O A;  3KP7 A;  4AIJ A;  4R8H A;  3RYR A;  2ZFW A;  1QZZ A;  3WGH A;  5HS8 A;  1BC7 C;  4WF2 A;  1S3J A;  4KIG A;  3WE3 A;  3GLX A;  1JHH A;  4P9U A;  2F2E A;  3FHZ A;  3SFZ A;  5K5Q A;  4JBA A;  2DBB A;  1ZGJ A;  3O6B B;  2EWN A;  1IRF A;  3S2W A;  1HQC A;  1BI1 A;  4UV8 A;  2G9W A;  4EGY A;  3BPV A;  2P5V A;  5L3B A;  1QPM A;  4MEY F;  1TW3 A;  3M8E A;  2GIV A;  3HSF A;  1U6G A;  3HRT A;  3HRU A;  2RNJ A;  3QP6 A;  4HQE A;  5E1X A;  4P5O A;  3KP6 A;  3M7G A;  4UHT A;  1Z9C A;  2M8E A;  4A12 A;  5CVV A;  2XV4 S;  5ILU A;  4U88 A;  3T0Y A;  4BQA A;  3CUQ B;  5D6F A;  3MQ0 A;  4M71 A;  2LSO A;  2K86 A;  3GFI A;  2QBY B;  5D4S A;  4Y15 A;  3IRQ A;  2NRA C;  5BPD A;  2DK5 A;  4S05 A;  2D45 A;  3BRO A;  2ISZ A;  1ULY A;  1MD0 A;  3L9F A;  3F6V A;  2HZT A;  1FSH A;  3K0L A;  5CVI A;  3DQV C;  3CJN A;  3QOP A;  4IF4 A;  1FOK A;  3ERE D;  3FWE A;  2VBY A;  4M9X A;  3WOD F;  4MNU A;  2BEO A;  3L7W A;  3WGI A;  2COM A;  3RIR A;  3KLN A;  4RB0 A;  1R22 A;  1B59 A;  1O7F A;  1YYV A;  1ZRD A;  4WCG A;  4HF1 A;  3HYI A;  3KFW X;  2IA0 A;  4QLC U;  4U0Y A;  5TJJ A;  2HYF A;  2MD5 A;  4WXH A;  1YW8 A;  4AIK A;  1PDN C;  4KN4 X;  3HHH A;  3H92 A;  1BJA A;  3CO7 C;  5CVR A;  3E3V A;  2Z33 A;  2ZJ2 A;  2VOO A;  3NQO A;  5DEQ A;  2FOK A;  3KP5 A;  3N97 A;  3HOS A;  5HLI A;  4EM1 A;  2V9V A;  4IRG A;  2EFN A;  4GO1 A;  5J8F A;  5JVT A;  3KLO A;  1XSX A;  5DDG A;  1UHW A;  3QAH A;  3MCZ A;  3QRF F;  1IAW A;  4U7B A;  2FNP A;  3LA2 A;  3DPT A;  3I5U A;  4XSZ F;  1P6R A;  2YPR A;  5ICC A;  1KQ9 A;  3KCC A;  1HKS A;  3F8N A;  3G73 A;  4LB6 B;  2STT A;  3IKV A;  3LWF A;  2FNA A;  2VT2 A;  2GWR A;  3OV8 A;  3GWZ A;  2UWM A;  2HDC A;  2ESH A;  5KK1 A;  3J7A O;  2VON A;  3JTG A;  1J59 A;  1QBJ A;  2NAZ A;  2NNN A;  1KU3 A;  1ZRF A;  4Q4Z F;  4A0X A;  3PFI A;  2P6S A;  2VE9 A;  1LEA A;  1LVA A;  3HOT A;  2FBI A;  1W7P D;  1GXP A;  2LDU A;  3F23 A;  4O5V A;  3E6M A;  4MEX F;  5EEH A;  4ESB A;  4Z2Y A;  2OBP A;  3MZH A;  3I71 A;  5BS6 A;  1IN5 A;  3BOQ A;  2VC0 A;  3ZN1 A;  2HR3 A;  1HBX G;  2CQK A;  4YFK F;  2P8T A;  3J81 Z;  3HRM A;  4RB1 A;  2WWY A;  1XDU A;  5BMZ A;  4L18 B;  2A6H F;  3F6O A;  4L9V A;  2P7V B;  2P5L C;  2H94 A;  3CUO A;  3GW2 A;  4MQV A;  3C18 A;  2OU2 A;  4Y17 A;  1PP8 F;  2RV8 A;  2Y0M A;  2QQA A;  1I5Z A;  1P4A A;  5EEG A;  4HDV A;  3RTR A;  2QYO A;  3ZPL A;  4LK0 F;  3IWF A;  5LGN A;  4OIN F;  2A68 F;  4MGR A;  3GVA A;  1K78 A;  2WTE A;  2HTS A;  3IL2 A;  1USS A;  4RGR A;  2AS5 F;  3SXY A;  1WI9 A;  4IVN A;  3FZV A;  3BJO A;  5D6E A;  4PDK A;  5ILS A;  4IRH A;  3I54 A;  4A0Z A;  1S7O A;  2PFB A;  1XCV A;  3P9K A;  3F22 A;  2EFO A;  3TOA A;  1E17 A;  2HOE A;  4N9H A;  1ZG3 A;  1GHC A;  5L3F A;  4GCV A;  4FX0 A;  4AIH A;  4LB5 A;  1ZHF A;  1LDD A;  3VB2 A;  1MDM B;  5E17 F;  2LF8 A;  2FML A;  1L0O C;  1S6L A;  4F7Z A;  2R3S A;  3U1D A;  1RIO H;  2JPB A;  3TGN A;  3LAJ A;  3ECH A;  3F8B A;  3KZZ A;  2H6B A;  4KN7 X;  3V7C A;  3K1N A;  2XHK A;  4G8X A;  2VBZ A;  3F8F A;  3J81 K;  3KEQ A;  3BJ6 A;  3GUD A;  3M9A A;  1O3Q A;  3F21 A;  3QPH A;  2FF4 A;  2EA2 A;  3EYI A;  3MZY A;  1U2W A;  5LHG A;  2ZCW A;  1IXS B;  3I4P A;  5F6F A;  1HW1 A;  3RYP A;  4OIP F;  3W6K B;  2OAZ A;  3L09 A;  1AWC A;  2PQ8 A;  1ZRE A;  2H6C A;  2BE5 F;  2CGP A;  1J0R A;  1B9N A;  3HSE A;  4Q48 A;  2P7C B;  4WXC A;  1ZYR F;  1LEB A;  1WRJ A;  4YII A;  4HZF A;  1G3W A;  3HHG A;  1G4D A;  3G3Z A;  4KMU X;  4P96 A;  4EJW A;  1LJ9 A;  4KA4 A;  4I02 A;  1FP1 D;  3DEU A;  4DQ2 A;  2Y48 A;  5LGT A;  3ISP A;  1I6X A;  3TDU C;  1G3S A;  2G7H A;  2XIG A;  2NYX A;  2HS5 A;  1TQI A;  2DTR A;  4LG0 B;  1FPQ A;  4HDU A;  4LJZ F;  5H6Q A;  3O2P E;  3F8C A;  4B09 A;  2KIF A;  5AON A;  1KA8 A;  1Z6R A;  3WTX C;  3WTT C;  3GYH X;  4WX9 A;  2O3F A;  4U0W A;  2EFP A;  2PEX A;  4KDP A;  4NQW A;  4EM0 B;  5LEK A;  2V79 A;  4ZYH A;  3DPL C;  4LFU A;  1LDJ A;  4ZZD A;  2KKO A;  5D5V B;  3M1E A;  2KIM A;  4YFN F;  4PCQ A;  3EQL F;  3KP4 A;  4EQQ A;  4ETS A;  4I2O A;  2FSW A;  3V8J A;  4ENK A;  2A69 F;  2PMH A;  1T98 A;  2QQB A;  4GYG A;  3I59 A;  2H27 A;  4EVI A;  4BHB A;  3E97 A;  2D2W A;  4I01 A;  2MH9 A;  2ESN A;  4WK8 F;  2EV5 A;  1XB4 A;  4CHU A;  3F8M A;  1HST A;  3WGG A;  4ZH4 F;  2PG4 A;  2M30 A;  4HV6 A;  2W84 A;  1WQ2 A;  4LGW A;  2GAU A;  3I53 A;  1BIA A;  4LMY A;  2LF7 A;  2DI3 A;  2IT0 A;  1IZ1 A;  2Q8K A;  3WTU C;  3ABT A;  4ZZL A;  2WC2 A;  5JFR A;  3WTV C;  4ENN A;  2XAS A;  4PGH A;  2ZKZ A;  1UCR A;  4L0Z B;  2EFW A;  2HWV A;  1Z91 A;  3LAP A;  3K9T A;  3H3U A;  1U8R A;  4JK1 X;  1K78 B;  3N4M A;  5K5R A;  3KP3 A;  1DP7 P;  2DPU A;  4EJU A;  1ON1 A;  2DQR A;  5JI6 A;  2CFX A;  2DK8 A;  3C7J A;  4FHT A;  4EMS A;  2ADU A;  1R23 A;  5AIP A;  2ZNZ A;  3GO5 A;  1W5S A;  2JSC A;  1IN8 A;  3RDI A;  2FBH A;  2MH2 A;  4MQ9 F;  4GXO A;  4OIQ F;  4L9N A;  1QGP A;  3V4G A;  1BI3 A;  4MTD A;  2VXZ A;  2HYG D;  4G7O F;  1MKM A;  3U9G A;  4ZYE A;  4RB2 C;  3SZT A;  1DUX C;  2DW4 A;  1BI0 A;  5LBQ A;  1YLF A;  1EV7 A;  4XBF A;  1QNT A;  2DQL A;  4I09 A;  1CF7 A;  3P9I A;  5IT3 A;  4I98 B;  3HTS B;  1ZGA A;  4A0Y A;  1U5T C;  3VOD A;  1AOY A;  2W24 A;  2VOP A;  4N0B A;  1R1T A;  4G9Y A;  4RGX A;  3ULQ B;  2X0L A;  2MA3 A;  2FA5 A;  3VOE A;  2RQP A;  1J5Y A;  1LNW A;  1D8J A;  2ETH A;  2A61 A;  1WKM A;  4HLY A;  2L02 A;  4XRF A;  5D8K B;  2PLY A;  1MGT A;  3HUG A;  4LLN A;  5CVU A;  3F3X A;  3WTZ A;  3RJP A;  4IHS A;  2A3S A;  4I0A A;  4ENJ A;  3TO6 A;  3GFM A;  1IN6 A;  1F5T A;  1P4W A;  2RGV A;  4L5J A;  1IN7 A;  1R58 A;  3ZMT A;  3BPX A;  3C1D A;  3FF5 A;  2LNB A;  2A07 F;  2EB7 A;  4CIC A;  2PI0 A;  2W25 A;  5L3D A;  2UZK A;  2D1H A;  3LQR A;  1QO0 D;  4NB5 A;  1YFH A;  4ZYD A;  1G3Y A;  3B02 A;  1FP2 A;  4O6J A;  3IRR A;  6PAX A;  2IJL A;  2VE8 A;  1D5V A;  2XAH A;  3Q9V A;  1U5T A;  3FXR A;  1YIO A;  3J80 Z;  1IN4 A;  2VBW A;  2DPD A;  5DUI A;  1Z05 A;  1J2X A;  4R79 A;  3ABU A;  3ZP5 A;  3RKX A;  2P6T A;  3C3W A;  1T38 A;  3GFL A;  3K69 A;  2YX7 A;  5HOO A;  4KUM A;  2L01 A;  3NEU A;  3FX3 A;  3T5X A;  1XCB A;  2HKX A;  2IA1 A;  2STW A;  5E8I A;  4HX4 A;  1ZAR A;  3TO7 A;  2V1U A;  2YU3 A;  4UUV A;  2CG4 A;  2JRT A;  4BHC A;  2MLK A;  2QM3 A;  3V8L A;  1SMY F;  3V8K A;  1H0M A;  1MZB A;  5JHU A;  5HDG A;  2Q2E A;  4HQM A;  2RVC A;  1EH8 A;  1FBS A;  1SD5 A;  2FQ3 A;  1STZ A;  1PUE E;  3I59 B;  4IJA A;  2CSO A;  2OQG A;  1DPR A;  3ZMS A;  2PJP A;  3SZP A;  2WV0 A;  3TQN A;  2EA4 A;  4HBL A;  5DCF A;  4IPA A;  4BHP A;  1RUO A;  2XGX A;  5CLS A;  2E7W A;  1FYK A;  2QZ8 A;  3B73 A;  3KP2 A;  4M9Z A;  1REP C;  3I58 A;  1O3R A;  5ILV A;  1KGS A;  2NNY A;  4AD9 A;  1OYI A;  1LDK B;  4HV5 A;  1UB9 A;  4R1H A;  3J80 K;  3D5L A;  3V7R A;  1BBY A;  3FM3 A;  4UVC A;  1D3Y A;  1K6O A;  4EJO A;  2EK5 A;  4RAY A;  2ACJ A;  1XGM A;  2RC4 A;  4GYI A;  2OZ6 A;  3NRV A;  3RI4 A;  3K1M A;  1EH7 A;  1U78 A;  4N9I A;  5A2Q K;  3QU3 A;  1SD6 A;  2O6G E;  1FY7 A;  2IVM A;  3T1B A;  5ED4 A;  4IXA A;  4WWC A;  4EM2 A;  1FBU A;  1TQM A;  1IXR C;  3JW4 A;  1XGN A;  2QEN A;  1E2X A;  1YS7 A;  3JTH A;  5HS7 A;  1SD4 A;  4BNC A;  2BV6 A;  1B6A A;  1GVJ A;  5HDK A;  4AVP A;  1CGP A;  1GXQ A;  1YTY A;  2HGC A;  1UST A;  2ZME A;  4YFX F;  2QLZ A;  3ZN0 A;  4EV0 A;  4FT8 A;  5FD6 A;  2Z3Y A;  2EJR A;  5E18 F;  5E20 A;  1MJB A;  5FGM A;  5LHH A;  1SFE A;  1MJA A;  5FB2 A;  1Z1D A;  1ZN2 A;  4HX7 A;  4A2U A;  1LB2 A;  2M5W A;  1TTY A;  4M72 A;  4CGZ A;  1W7P A;  3E6D A;  1I1G A;  2L3D A;  3L2C A;  3R60 A;  2E1C A;  1SD7 A;  1K7A A;  1FNN A;  3R61 A;  2ISY A;  3WU0 A;  1XGO A;  4L9T A;  2Z9O A;  4U0V A;  2D1V A;  4O3M A;  1ZAO A;  3CTA A;  1XGS A;  5LEJ A;  3R0A A;  4A6D A;  4ESJ A;  2GA1 A;  3ML6 A;  2V6C A;  5F64 A;  4M73 A;  4TV7 A;  1O7L A;  2O0Y A;  1H9T A;  2VOD A;  2VT3 A;  1OR7 A;  2DO7 A;  5JR3 A;  1XDS A;  1RUN A;  1U3E M;  1U5T B;  2HQR A;  4H0E A;  3HSR A;  3PQJ A;  3CUQ A;  4OIO F;  3E5X A;  1S7A A;  1R00 A;  1BC8 C;  3DP7 A;  4M74 A;  4LD5 A;  3RPQ A;  1YW7 A;  2YSR A;  5J8C A;  2K27 A;  3GZ6 A;  3QPT A;  5H6R A;  5DCM A;  4Y13 A;  1F1Z A;  2V1X A;  4I0B A;  3ZMU A;  1R7J A;  3WTS C;  1TNS A;  1T6S A;  1P92 A;  5ICF A;  1IW7 F;  4HOB A;  5LRR A;  3JSO A;  1YG2 A;  3VFZ A;  3KEO A;  4D0P A;  3GX4 X;  4EGZ A;  4HF0 A;  3LQQ A;  1KU7 A;  1OYY A;  4L9J A;  2RDP A;  3ZMD A;  4KT5 C;  5ERI A;  3TDZ C;  5FFZ A;  2OA4 A;  3MAJ A;  2K7L A;  2BBY A;  3WU1 B;  5L3G A;  1RZ4 A;  1A04 A;  2F5E A;  2DFI A;  2GXG A;  4LLL A;  3MFK A;  2B0L A;  2F5D A;  3ROU A;  3Q9S A;  1FYM A;  4RGS A;  2O61 A;  2RKH A;  2GA2 A;  3GXO A;  1TW2 A;  1ON2 A;  2A5Y B;  1TNT A;  4OIR F;  2XAQ A;  1O3T A;  4HYE A;  1F9N A;  2FE3 A;  1KYZ A;  1BIB A;  4GGG A;  1S8N A;  2BYV E;  3DV8 A;  4G94 A;  1IUY A;  4ENM A;  1V3F A;  1QZY A;  4HAM A;  5HDN A;  5E1Z B;  4XLP F;  5LLQ A;  3FMR A;  2GZW A;  3CLO A;  3FXQ A;  1JE8 A;  4G6D A;  1ZG1 A;  2KJC A;  4YG2 F;  5TRD A;  1JXS A;  4KIF A;  4CYD A;  3CO6 C;  1Y0U A;  3E5U A;  2XAJ A;  4P55 A;  2JPC A;  2RN7 A;  1B9M A;  4B8X A;  1J9I A;  2IW5 A;  4G6Q A;  3L00 A;  4G7H F;  2L4M A;  4S04 A;  1MJ9 A;  3LA3 A;  3BJA A;  2ZME B;  3K1P A;  2QWW A;  2UXN A;  1HW5 A;  2ZBK A;  5DYM A;  5ICE A;  1QQI A;  1XSV A;  1TQP A;  1O3S A;  1SFX A;  2CO5 A;  3U2R A;  2H09 A;  3E5Q A;  4OU0 A;  3DXJ F;  1K79 A;  1W7P B;  2FXA A;  1XN7 A;  4P9F A;  2LKP A;  2UXX A;  5D5W B;  3EDP A;  4LLG F;  1UHM A;  1IXC A;  2HTJ A;  4UV9 A;  4YIF A;  1YW9 A;  2G7U A;  2IRF G;  4KNY A;  2DT5 A;  1T39 A;  4BH9 A;  2HEO A;  5IT9 K;  3FM5 A;  3W6J B;  1F4K A;  1FT9 A;  5E1W A;  5DD4 A;  3FXU A;  1YS6 A;  1ZLK A;  5LGU A;  3RKY A;  4RB3 C;  3O3K A;  3R6S A;  2JTV A;  2FBK A;  1I1S A;  3HRS A;  3R4K A;  4KIC A;  3T8R A;  1MDM A;  2E1N A;  5D5U B;  1T0F A;  1XMK A;  2DLL A;  4OOI A;  3LST A;  1KYW A;  4EJT A;  4M6Y A;  3WE2 A;  1HW2 A;  2F5F A;  5DCM B;  2X4H A;  3GEZ A;  2XAF A;  5J6X A;  5D8L B;  2IP2 A;  1Z7U A;  2VBX A;  4HA8 A;  3GFJ A;  2OZU A;  3K2Z A;  1BOA A;  4M9S A;  2FRH A;  2ZO4 A;  4UVA A;  3V7S A;  2K4J A;  3BWG A;  1EH6 A;  1R36 A;  3R0J A;  1JGS A;  3ZMZ A;  2P5K A;  1Z6T A;  3TO9 A;  5DV5 A;  5L3E A;  2C6Y A;  3FMQ A;  1BI2 A;  4PZJ A;  4RGU A;  5A2Q Z;  4UVB A;  4RAZ A;  3JAM Z;  2K4B A;  3ELK A;  2XAG A;  1YO5 C;  1TLH B;  3VEP A;  5HLG A;  2PN6 A;  3KE2 A;  5CVJ A;  4I7H A;  4CO8 A;  5FO5 A;  4UNO A;  3IC7 A;  1JHF A;  3P7N A;  5D5X B;  2GXB A;  1WWX A;  3JSP A;  4A5N A;  4EJV A;  3I0T A;  2GQQ A;  3DKW A;  4OMZ A;  4L0Y B;  4HLX A;  1FSE A;  3RKW A;  2ZXJ A;  3ZQ7 A;  2XKO A;  3EUH A;  5E8G A;  4LG0 A;  1UFM A;  2W85 A;  1O57 A;  3LFK A;  2E7X A;  2JT1 A;  4CDG A;  2OD5 A;  2R7F A;  4A6E A;  1FX7 A;  1P2F A;  4LK1 F;  1S29 A;  5DUK A;  1PP7 U;  1OPC A;  2VC1 A;  3OOP A;  3WTW C;  5KVR A;  3F72 A;  1SMT A;  3I64 A;  1DPU A;  2V1D A;  4IHT A;  5CJ9 A;  3TKY A;  4KFC A;  3H3Z A;  3COA C;  4XSX F;  4PGG A;  4WXD A;  4BYY A;  5ICG A;  5HVQ C;  2CWE A;  2F5C A;  4BXU A;  5FFX A;  3JAM K;  1L3L A;  3PQK A;  1D8K A;  1BM9 A;  2O03 A;  1HKQ A;  2HFH A;  4A5M A;  2HKO A;  2PMU A;  1P4X A;  4RS8 A;  2KRF A;  3GF2 A;  4MHG A;  1WSU A;  2FMY A;  5HLH A;  1W5T A;  5LHI A;  1OMI A;  1IF1 A;  2AXL A;  3SQN A;  5AIQ A;  2XRN A;  3M8F A;  5FLX Z;  3AAF A;  3IHU A;  2TDX A;  2W57 A;  1CF7 B;  1B4A A;  4CXF A;  4ESF A;  1XD7 A;  5FD5 A;  4M6X A;  4UXN A;  3REO A;  4E70 A;  3WTY C;  1HXD A;  2EV0 A;  3CUQ C;  4ZYG A;  1R1V A;  2ZNY A;  2FEZ A;  4HX8 A;  2OQR A;  2EFQ A;  2CYY A;  3IWZ A;  2MBF A;  1IRG A;  4ASN A;  2JZY A;  5CYV A;  3E6B A;  1OKR A;  2IPQ X;  4HF2 A;  3DF8 A;  2DU9 A;  2Z99 A;  2VN2 A;  3QP5 A;  5F1R A;  4IRI A;  1G3T A;  1B1B A;  1HSJ A;  4Q5S F;  1KQ0 A;  2O8X A;  2PBI A;  5DD8 A;  2K02 A;  2NS0 A;  3P9C A;  2L4A A;  1I27 A;  1RNL A;  1FC3 A;  3SHF A;  2Z5U A;  1R1U A;  4U7D A;  5D4R A;  1ZH5 A;  2M45 A;  5H20 A;  1ZG5 A;  2QBY A;  5FLX K;  2L54 A;  2BGC A;  1C0W A;  2M87 A;  3KZY A;  4FX4 A;  2QQ9 A;  2QVO A;  1YQA A;  1ZLJ A;  4KMF A;  2IA2 A;  3KET A;  1DDN A;  3MEX A;  3E6C C;  2MLG A;  2J5P A;  3ZMV A;  3D0S A;  3T8T A;  4ON0 A;  4DNC A;  3HIF A;  4QWQ A;  5BPI A;  3DFG A;  3ECO A;  3EYY A;  1H9G A;  3EET A;  5LRS A;  3BDD A;  1VTN C;  1XSD A;  3LA7 A;  2ELH A;  4G7Z F;  1SAX A;  1X3U A;  1FYL A;  2MC3 A;  3FMS A;  5BQT A;  3GZ5 A;  2XKP A;  4XLN F;  2KJB A;  1R5G A;  1J7K A;  1OYW A;  3BP8 A;  1NHA A;  5L3C A;  1FWZ A;  1KU2 A;  1BN5 A;  4MTE A;  3BZ6 A;  1RI7 A;  3HTU A;  2CW0 F;  4AWX B;  2XUB A;  2HQN A;  3QU6 A;  1ZRC A;  1KU9 A;  1XMA A;  1LQ1 A;  3WG9 A;  1Q1H A;  1FLI A;  1R5H A;  1T2K A;  2EV6 A;  2KIU A;  1SFU A;  3CDH A;  1G6N A;  3RPU A;  5K1Y A;  2DAO A;  1FZP B;  3TOB A;  1J75 A;  2FU4 A;  1W4M A;  1KQ8 A;  4JQF A;  4L5I A;  2Q0O A;  4HW0 A;  3MWM A;  4NHJ A;  2R7D A;  2XVC A;  4CZZ A;  5HS9 A;  1ODD A;  4BAY A;  5IT9 Z;  1HKT A;  3Q5F A;  5BOX A;  2Y75 A;  2YR2 A;  2XRO A;  2YX4 A;  1FBQ A;  2P4W A;  2M1B A;  5K5O A;  4KYW A;  3BY6 A;  1V4R A;  2A6E F;  1ONV A;  4K2E A;  3IKT A;  4OMY A;  2QUF A; 
#chains in the Genus database with same CATH topology
 1VFC A;  3I4N J;  2W7N A;  2XSD C;  4KIB A;  2AQF A;  1TZL A;  2OCE A;  2P81 A;  4LOC A;  2R7W A;  4C3I J;  3W6V A;  4YIR X;  5E3O A;  4Q47 A;  2NS8 A;  1TBX A;  3BTI A;  2GOM A;  2J5O A;  4N4N B;  3KP7 A;  2EZK A;  2M4K A;  4AIJ A;  4HSR A;  1Y6I A;  2XGC A;  4R8H A;  3RYR A;  1MH3 A;  2ZFW A;  1QZZ A;  2E2J J;  3DKX A;  2VJI A;  2XC7 A;  2HOA A;  3WGH A;  5HS8 A;  1BC7 C;  4WF2 A;  4IX7 A;  1T0F C;  1S3J A;  1NH3 A;  4KIG A;  3WE3 A;  2JVH A;  2E60 A;  2WAF A;  4RM3 A;  3GLX A;  1YJN I;  1JHH A;  2BY3 A;  4P9U A;  2F2E A;  3FHZ A;  2V9P A;  3SFZ A;  5K5Q A;  2HI3 A;  2IGM A;  3DTE A;  4JBA A;  4AUX A;  2DBB A;  1Y0N A;  2DT6 A;  2R7V A;  1ZGJ A;  2WAE A;  3O6B B;  2EWN A;  1IRF A;  3S2W A;  1HQC A;  1MW7 A;  2CUE A;  1BI1 A;  3C2G A;  2HZD A;  4UV8 A;  2G9W A;  4EGY A;  3BPV A;  2P5V A;  3DCF A;  1QVT A;  5L3B A;  3G4S I;  1QPM A;  4XLC A;  1T95 A;  1MMN A;  4MEY F;  1TW3 A;  2ZJQ F;  3M8E A;  4QIW N;  1MBG A;  3RQI A;  5F04 A;  3HPH A;  2GIV A;  3HSF A;  1EA3 A;  2PMZ A;  2ZXI A;  1U6G A;  2NXN B;  3GZN B;  3HRT A;  3HRU A;  4XN3 A;  2RNJ A;  2HDD A;  3LOC A;  4CCL A;  3QP6 A;  4HQE A;  5E1X A;  4A93 J;  4P5O A;  1JJ6 C;  2ZB9 A;  3KP6 A;  3UNG C;  3M7G A;  4UHT A;  3H3V K;  2K9L A;  2KL4 A;  2XGE A;  4BJ6 C;  1Z9C A;  3D1N I;  2NVU B;  2JN6 A;  2M8E A;  1XX5 A;  3S16 J;  2L0K A;  2X48 A;  1A6I A;  4E7J A;  4A12 A;  4N4O B;  5CVV A;  2XV4 S;  5ILU A;  1O4X A;  4U88 A;  3M1C A;  3T0Y A;  4BQA A;  3CUQ B;  5D6F A;  3NAR A;  3MQ0 A;  4M71 A;  1GV5 A;  2LSO A;  5J40 A;  3MKW B;  2K86 A;  3GFI A;  4Y52 J;  3H5N A;  2QBY B;  2R7X A;  5D4S A;  4Y15 A;  1MNM C;  3IRQ A;  2NRA C;  5BPD A;  2DK5 A;  4S05 A;  2D45 A;  3UR3 C;  3BRO A;  2ISZ A;  4L5E A;  3CQZ J;  1ULY A;  1PUF A;  1OCC H;  1MD0 A;  3L9F A;  3F6V A;  2HZT A;  2VJ4 A;  1W36 D;  3K0L A;  1FSH A;  2XF6 A;  5CVI A;  3SEZ A;  3DQV C;  3G71 I;  3PM1 A;  4CCO A;  3S3O A;  4CUG A;  2LY9 A;  3CLQ A;  1DGW Y;  5C4J J;  3CJN A;  3QOP A;  4IF4 A;  1FOK A;  3MD2 A;  3ERE D;  3CCV I;  3FWE A;  2O7O A;  2VBY A;  3NWS A;  4M9X A;  3WOD F;  4MNU A;  3L2W A;  2BEO A;  3BR2 A;  3L7W A;  3GTL J;  1R5I D;  4BEH B;  3EUH C;  3WGI A;  5FKO A;  2COM A;  2ECC A;  3RIR A;  1EKE A;  1X1B A;  4AC0 A;  3KLN A;  4RB0 A;  1R22 A;  1B59 A;  1RR8 C;  1O7F A;  1YYV A;  4UUT A;  2F5V A;  4IQJ A;  1ZRD A;  4WCG A;  2HVS A;  4AVZ A;  2A5W A;  4GFB A;  2CMP A;  4HF1 A;  3TW7 A;  2E5N A;  2M4G A;  3ERM A;  3HYI A;  3KFW X;  2IA0 A;  4QLC U;  4U0Y A;  5TJJ A;  3ZRG A;  2LMD A;  4W1U A;  2HYF A;  2MD5 A;  3HOW J;  3U21 A;  4WXH A;  2N8G A;  3AKZ A;  1YW8 A;  2XGD A;  2KIQ A;  4AIK A;  4HPQ A;  4KN4 X;  1PDN C;  3HHH A;  3H92 A;  1BJA A;  3CO7 C;  4ZYA A;  2R0Q C;  5CVR A;  3E3V A;  3HEF A;  2Z33 A;  2ZJ2 A;  2VOO A;  3KX2 A;  3NQO A;  3G1L A;  5DEQ A;  2KQR A;  2FOK A;  2K3F A;  3KP5 A;  4ZTF A;  4XQF A;  4XRS G;  3N97 A;  3HOS A;  5HLI A;  4EM1 A;  2V1N A;  4IL6 C;  4AM3 A;  2V9V A;  2L7F P;  4IRG A;  2EFN A;  5E3N A;  2F6C A;  3OYJ A;  4E7S A;  4GO1 A;  2HVR A;  5J8F A;  2JA5 J;  5JVT A;  5GAE J;  1GLN A;  3KLO A;  1XSX A;  5DDG A;  2FJ1 A;  1UHW A;  3QAH A;  3MCZ A;  1NTC A;  3QRF F;  2CUF A;  1FOW A;  4FE7 A;  1IAW A;  4U7B A;  1XMX A;  1HDD C;  3W2V A;  3TED A;  2FNP A;  3PJR A;  3LA2 A;  2R7Q A;  2LBF B;  3DPT A;  3I5U A;  4XSZ F;  3AG4 H;  1P6R A;  2YPR A;  5ICC A;  5F0H A;  1KQ9 A;  3MN2 A;  2W48 A;  3KCC A;  2LRD A;  2QF7 A;  1HKS A;  2OC6 A;  2X1C A;  3F8N A;  3S1M J;  2L9V A;  3BG6 A;  3BTC A;  3G73 A;  3FIW A;  4LB6 B;  5BNG A;  2STT A;  3IKV A;  3LWF A;  2FUG 2;  2FNA A;  2VT2 A;  4F93 B;  1AKH B;  3HXL A;  3OYF A;  2GWR A;  1MMA A;  5E79 C;  3K4L A;  2GLO A;  3OV8 A;  3GWZ A;  4P1W A;  2UWM A;  2HDC A;  2JMW A;  2ZXW H;  2CS3 A;  2ESH A;  4NBQ A;  5KK1 A;  5EG0 A;  2OTJ I;  5GAH J;  3J7A O;  2VON A;  3JTG A;  1J59 A;  3W2W A;  1JUM A;  1QBJ A;  2NAZ A;  2NNN A;  1KU3 A;  1ZRF A;  2E1M B;  3A02 A;  4Q4Z F;  4A0X A;  3PFI A;  3LSI A;  3FXO A;  2P6S A;  3DBR B;  1X4P A;  3CES A;  1ETO A;  2VE9 A;  2R5Z A;  1LEA A;  1LVA A;  3HOT A;  2FBI A;  1W7P D;  1GXP A;  2NVY J;  1VQ9 I;  2LDU A;  1SVM A;  2DN0 A;  1R4N B;  3F23 A;  3GME A;  4O5V A;  2W4S A;  4XMY A;  1TP4 A;  2IEK A;  3E6M A;  4XOT A;  2LVS A;  4D7M A;  4MEX F;  2JA2 A;  1LFU P;  1GDT A;  1IDY A;  5EEH A;  3VSL A;  2M0C A;  2VIX A;  3U1K A;  4ESB A;  4BE0 A;  4Z2Y A;  4XRM A;  4LIU A;  2OBP A;  2OPT A;  2L9N A;  2ZSH B;  3MZH A;  2GXA A;  4C2U A;  3I71 A;  5BS6 A;  3OYL A;  3BOQ A;  1IN5 A;  2PMZ N;  2DA3 A;  2LG4 A;  4B3A A;  2VC0 A;  3ZN1 A;  2HR3 A;  2R7Z J;  2F4O B;  5EYR A;  1HBX G;  2CQK A;  2IBD A;  4G12 A;  4E7Z A;  4YFK F;  2BY1 A;  3FIS A;  3AL0 C;  1YJW I;  3ASO H;  2P8T A;  1N25 A;  5KHD A;  3CJT B;  1MMD A;  4CCN A;  3J81 Z;  3I55 I;  3EUA A;  3HRM A;  4A3F J;  5J1Y A;  1TWH J;  2R7U A;  4RB1 A;  2WWY A;  2HQ5 A;  1XDU A;  5BMZ A;  2BHZ A;  4L18 B;  2A6H F;  3F6O A;  4L9V A;  4HNU A;  2P7V B;  4CYC B;  2P5L C;  2H94 A;  3CUO A;  3GW2 A;  4MQV A;  4ZDL A;  3ZQG A;  3JR9 A;  3C18 A;  1X1P A;  2OU2 A;  4Y17 A;  2I5U A;  1PP8 F;  2RV8 A;  1K4T A;  2Y0M A;  1QPI A;  2QQA A;  3HM5 A;  1I5Z A;  1P4A A;  5EEG A;  4RMN A;  4HDV A;  5H2F C;  3RTR A;  2QYO A;  3ZPL A;  3ZQH A;  4LK0 F;  3IWF A;  5EZG A;  5LGN A;  1JI8 A;  4OIN F;  2A68 F;  2DDA A;  4MGR A;  3GVA A;  1K78 A;  2WTE A;  4AYB N;  2QQ8 A;  3H5R A;  1FEX A;  2HTS A;  2E34 A;  3IL2 A;  1J09 A;  1USS A;  4RGR A;  2AS5 F;  4A3B J;  3SXY A;  1Z3Y A;  1WI9 A;  4IVN A;  2DFF A;  2HXI A;  5CKT A;  2OJE D;  3FZV A;  3BJO A;  5D6E A;  4PDK A;  5ILS A;  3CCR I;  4IRH A;  1VQL I;  1LVK A;  3I54 A;  4A0Z A;  1S7O A;  2PFB A;  5F27 A;  1XCV A;  3P9K A;  5B1B H;  4MFE A;  2KFD A;  4HEA 2;  3J7Y J;  3OYA A;  2VQH A;  4E7H A;  1OCZ H;  3F22 A;  2IGN A;  3L2U A;  1XTA A;  1SAN A;  2R93 J;  2EFO A;  3TOA A;  3WHB A;  4IOC F;  1E17 A;  2HOE A;  5J4V A;  4N9H A;  2CV2 A;  1ZG3 A;  3ZGK A;  3DEE A;  5M5Y J;  1GHC A;  5L3F A;  4JX4 A;  3S8P A;  1Y1W J;  4GCV A;  4FX0 A;  3D5S C;  4AIH A;  1ZHF A;  1OCP A;  4LB5 A;  1LDD A;  3VB2 A;  3K4C A;  1MDM B;  5E17 F;  2LF8 A;  2BZT A;  2FML A;  1L0O C;  3JCU C;  1S6L A;  4KT6 A;  4F7Z A;  2R3S A;  1UHS A;  3U1D A;  1RIO H;  2JPB A;  2EBI A;  2V6E A;  3TGN A;  3LAJ A;  1PUF B;  3ECH A;  4FIS A;  1WH5 A;  3F8B A;  3KZZ A;  2LTP A;  3LSH A;  2H6B A;  2ZFU A;  4KN7 X;  3GTJ J;  3V7C A;  3DWL E;  1F43 A;  3K1N A;  2XHK A;  4BY7 J;  4C2M J;  4G8X A;  2VBZ A;  2IGO A;  3F8F A;  3OL3 A;  3OYC A;  3J81 K;  3KEQ A;  3BJ6 A;  1K61 A;  3GUD A;  1ZGW A;  2PX9 A;  3M9A A;  1O3Q A;  1SEU A;  2Q1Z B;  3F21 A;  2LR8 A;  3FDY A;  3QPH A;  2FF4 A;  2LC2 A;  2EA2 A;  4XKC A;  3EYI A;  4DYR A;  3MZY A;  4BJT A;  4IKF A;  1U2W A;  5LHG A;  2ZCW A;  1IXS B;  3I4P A;  5F6F A;  3OOU A;  2MD0 A;  1HW1 A;  3GTM J;  3RYP A;  3DBH B;  5F0F A;  4OIP F;  3W6K B;  2OAZ A;  3L09 A;  1AWC A;  3TP0 A;  3GTG J;  2PQ8 A;  1ZRE A;  1SAU A;  1YOV B;  2H6C A;  3F0C A;  1I3A A;  2AQE A;  3RQ4 A;  2LYC A;  2BE5 F;  1LB2 A;  2CGP A;  2VUM J;  1J0R A;  4CCM A;  1ACI A;  1VQP I;  3QYF A;  1B9N A;  3K7A J;  4XKW A;  3HSE A;  4Q48 A;  2P7C B;  4WXC A;  1ZYR F;  2L2O A;  1LEB A;  1VI0 A;  1WRJ A;  4YII A;  4HZF A;  2JUG A;  1G3W A;  2Y31 A;  3HHG A;  1G4D A;  3G3Z A;  2L5Q A;  4KMU X;  3OYM A;  2EPF A;  2WB1 N;  4PJJ A;  1QVU A;  2DJI A;  4P96 A;  4EJW A;  3G1M A;  1LJ9 A;  3CF5 F;  5B1A H;  1V55 H;  4KA4 A;  4I02 A;  1FP1 D;  3DEU A;  2L7K A;  4B44 A;  4DQ2 A;  2Y48 A;  5LGT A;  3ISP A;  1I6X A;  3TDU C;  2CRG A;  1X1A A;  3A2K A;  1G3S A;  2G7H A;  4C3H J;  3PUB A;  2XIG A;  2JA7 J;  1D0X A;  2NYX A;  3DKY A;  2M34 A;  5GAG J;  1BW5 A;  2HS5 A;  5IOZ A;  3BTL A;  4OWR B;  1TQI A;  4IHV A;  2DTR A;  3BCA A;  2ZJP F;  2JSP A;  3QYB A;  4LG0 B;  3PNV A;  4LIV A;  1R6R A;  3OYN A;  3GTP J;  1FPQ A;  4HDU A;  2MAB A;  3SEQ A;  4LJZ F;  3I56 I;  3ZQF A;  1ORK A;  2KZG A;  5H6Q A;  3O2P E;  2X6O A;  3GCM A;  3F8C A;  4B09 A;  3H9J A;  2KIF A;  5AON A;  4CZC A;  1KA8 A;  1TT5 B;  5EG0 B;  2LFB A;  1Z6R A;  4M3D A;  3WTX C;  3M4O J;  3WTT C;  3GYH X;  5M5X J;  4ZTJ A;  1X19 A;  4WX9 A;  2M2E A;  2O3F A;  4XL9 A;  3PIP F;  1IC8 A;  4U0W A;  3ZR8 X;  2EFP A;  2LY2 A;  2PEX A;  4KDP A;  4XR6 A;  2COB A;  4NQW A;  4EM0 B;  5LEK A;  2QSH X;  2V79 A;  3LSK A;  4ZYH A;  3TL4 X;  3DPL C;  3DLA A;  4LFU A;  2P0W A;  5FRM A;  1LDJ A;  4ZZD A;  2KKO A;  5D5V B;  2VI6 A;  3M1E A;  2KIM A;  4YFN F;  4PCQ A;  3CCM I;  1N77 A;  5GP9 A;  3EQL F;  3KP4 A;  4EQQ A;  2KMU A;  3CJR B;  1B72 A;  4ETS A;  4I2O A;  2O8K A;  3H5A A;  2FSW A;  2OUM A;  5DM7 F;  3V8J A;  4ENK A;  4E7I A;  2A69 F;  2PMH A;  2ID3 A;  1T98 A;  2QQB A;  2AHQ A;  4GYG A;  1V5E A;  4RLF A;  3I59 A;  1XS9 A;  4M3E A;  2H27 A;  3CJQ B;  2IS1 A;  4EVI A;  4BHB A;  3E97 A;  1WGX A;  2D2W A;  2DA4 A;  4I01 A;  2MH9 A;  3BR6 A;  1P7I A;  1B8I B;  2ESN A;  4WK8 F;  2Y9Y A;  2JUC A;  2JA6 J;  2EV5 A;  1XB4 A;  2XB0 X;  2K3P A;  4CHU A;  3F8M A;  1HST A;  3WGG A;  3A01 B;  4ZH4 F;  1T56 A;  3ONQ A;  2Z2S B;  2PG4 A;  2M30 A;  4HV6 A;  2W84 A;  2M8G X;  1WQ2 A;  1FMW A;  4LGW A;  3BG7 A;  2GAU A;  1HC8 A;  3I53 A;  3BR0 A;  3PNY A;  1BIA A;  4LMY A;  2LF7 A;  2DI3 A;  2LLK A;  4Z6Y A;  2IT0 A;  3CP2 A;  1IZ1 A;  2IAI A;  2OF7 A;  2Q8K A;  3WTU C;  1IO2 A;  3ABT A;  1Z7L A;  2V26 A;  3OYD A;  2CU7 A;  3IH2 A;  4ZZL A;  2WC2 A;  5JFR A;  3WTV C;  2BVM A;  4ENN A;  2XAS A;  4B1R A;  4Y4R A;  2EIK H;  3PL8 A;  3BCB A;  5C4X J;  4J01 A;  2CV1 A;  2LKX A;  4PGH A;  3CCQ I;  2ZKZ A;  1UCR A;  2O5R A;  4L0Z B;  2EFW A;  2XF7 A;  2HWV A;  2V4J C;  1Z91 A;  4D5F A;  3LAP A;  3K9T A;  2CQX A;  2H8W A;  3H3U A;  1U8R A;  3B6A A;  4JK1 X;  1K78 B;  2DA5 A;  3N4M A;  5K5R A;  2QKL B;  3KP3 A;  3Q3S A;  5IPA A;  1DP7 P;  3HGG A;  4PUS A;  2DPU A;  2VQL A;  3DTK A;  4EJU A;  1ON1 A;  2DQR A;  5JI6 A;  2CFX A;  3WU2 C;  5JLX A;  2DK8 A;  3C7J A;  4FHT A;  4EMS A;  1JTX A;  9ANT A;  4B4C A;  1PJR A;  1WPK A;  1HA8 A;  5DS9 A;  2K9N A;  2ADU A;  1R23 A;  5AIP A;  4LG3 A;  2ZNZ A;  3GO5 A;  1W5S A;  4H4K C;  2JSC A;  3AL0 B;  1X1C A;  1IN8 A;  3CC2 I;  3RDI A;  2FBH A;  2DT7 B;  2MH2 A;  4MQ9 F;  5J3L A;  4GXO A;  4OIQ F;  4L9N A;  1IDZ A;  4PJL A;  4GDF A;  1QGP A;  3V4G A;  1BI3 A;  4MTD A;  2CUZ A;  2VXZ A;  4D9J A;  4M3B A;  4BXF A;  2HYG D;  3S1R J;  4G7O F;  1MKM A;  3U9G A;  1UJ8 A;  3BR3 A;  4ZYE A;  1Z77 A;  4RB2 C;  5F08 A;  3A0H C;  4UUS A;  3SZT A;  1ZTR A;  1DUX C;  2DW4 A;  1BI0 A;  5LBQ A;  1WH7 A;  1YLF A;  1WHU A;  1U8B A;  2HOS A;  4II3 A;  1EV7 A;  2EIN H;  4XBF A;  2DMP A;  4A3E J;  2F4I A;  4BU2 A;  1QNT A;  1D0Y A;  2DQL A;  4I09 A;  4IEJ A;  4KIT B;  1CF7 A;  3CC4 I;  3P9I A;  1Z21 A;  1MBH A;  3OWT A;  5IT3 A;  2WY8 Q;  1BR2 A;  1ETV A;  2CQQ A;  2QA4 I;  4M6V A;  4I98 B;  3HTS B;  2DMU A;  1ZGA A;  5HNF A;  3JRI A;  2LOO A;  4A0Y A;  1U5T C;  3DTI A;  2BOL A;  3VOD A;  1AOY A;  1WJ5 A;  2E2I J;  2W24 A;  1Y8Q B;  2VOP A;  4N0B A;  1M1E B;  5FKN A;  3A1Y A;  2FX0 A;  1R1T A;  5TGT A;  3BTJ A;  3FXL A;  4G9Y A;  4ABZ A;  4RGX A;  3ULQ B;  2X0L A;  5HLT A;  2MA3 A;  2FA5 A;  3VOE A;  4X1E A;  3CMY A;  3CCL I;  5IYC J;  2RQP A;  1J5Y A;  1LNW A;  1KZH A;  1D8J A;  2ETH A;  2A61 A;  3S1Q J;  1AHD P;  1WKM A;  4HLY A;  2L02 A;  4XRF A;  5D8K B;  2PLY A;  1MGT A;  3HUG A;  4LLN A;  5CVU A;  4BBS J;  3F3X A;  3WTZ A;  3OS2 A;  3RJP A;  2CV0 A;  2MW8 A;  4DW6 A;  1G2H A;  1RRJ A;  4IHS A;  2A3S A;  4FTH A;  4I0A A;  4F3Q A;  4ENJ A;  3HL2 A;  2M9H A;  3TO6 A;  3GFM A;  1IN6 A;  4F52 A;  1F5T A;  1IRZ A;  1P4W A;  4BY1 J;  5HNH A;  1NG7 A;  2VKH A;  2RGV A;  4L5J A;  1IN7 A;  1R58 A;  3ZMT A;  2R92 J;  3BPX A;  3C1D A;  3FF5 A;  2WAQ A;  2LNB A;  2A07 F;  2R7S A;  5B5E C;  2EB7 A;  1A35 A;  2KIS A;  4JX5 A;  4CIC A;  2LK2 A;  5B66 C;  2PI0 A;  2W25 A;  1UZC A;  1MBE A;  5IP6 A;  5L3D A;  2UZK A;  2D1H A;  4DOZ A;  1WCM J;  3IH4 A;  3PSI A;  3NWT A;  3LQR A;  1QO0 D;  4NB5 A;  1YFH A;  4ZYD A;  1G3Y A;  3B02 A;  1FP2 A;  4O6J A;  3IRR A;  6PAX A;  5EZH A;  1E0E A;  3CMA I;  2IJL A;  2VE8 A;  4FAS D;  3IV5 A;  1D5V A;  2XAH A;  3Q9V A;  3QQA A;  1U5T A;  3FXR A;  1YIO A;  4AU7 A;  3LSM A;  3J80 Z;  2R7R A;  4ZDO A;  2WBM A;  1R71 A;  1IN4 A;  1LUJ B;  3MKZ A;  2OV7 A;  4YEJ A;  2VBW A;  2DPD A;  5DUI A;  2LKS A;  1Z05 A;  1J2X A;  4BQQ A;  1KON A;  3ABU A;  4R79 A;  3ZP5 A;  3RKX A;  2QSF X;  2P6T A;  3C3W A;  1GUU A;  1T38 A;  3GFL A;  4RDU A;  3CCY A;  3K69 A;  2YX7 A;  1QRY A;  5HOO A;  3IAS 2;  4KUM A;  2L01 A;  3NEU A;  3FX3 A;  3T5X A;  3CZ6 A;  1XCB A;  2HKX A;  2F48 A;  1ZK8 A;  2IA1 A;  3H1C A;  2STW A;  5E8I A;  3M3Y J;  2GIZ A;  4HX4 A;  1ZAR A;  4CSW A;  3TO7 A;  3OSG A;  1JKR C;  2V1U A;  4NQW B;  4XM3 A;  5DTD A;  1IJW C;  2YU3 A;  4UUV A;  2CG4 A;  3K4K A;  2HYJ A;  2JRT A;  2L9S A;  4BHC A;  2RQQ A;  2MLK A;  1DU0 A;  2QM3 A;  3V8L A;  5EF6 A;  1SMY F;  3V8K A;  1H0M A;  3H35 A;  1MZB A;  5JHU A;  4BL0 B;  2I10 A;  1B72 B;  5HDG A;  1UAA A;  1WJE A;  2Q2E A;  2XDV A;  2Z1D A;  4HQM A;  2RVC A;  2M0M A;  1TL8 A;  4KIS A;  1EH8 A;  3Q0W A;  1FBS A;  1SD5 A;  5FKM A;  2FQ3 A;  1STZ A;  2VXD A;  1PUE E;  3I59 B;  1WJC A;  3TP3 A;  4IJA A;  3BG9 A;  1NK3 P;  1HF0 A;  2CSO A;  4DYC A;  1VZ0 A;  2OQG A;  1DPR A;  4XNF A;  3QOE A;  3ZMS A;  1JTY A;  3SZP A;  2PJP A;  4NUB A;  2WV0 A;  3TQN A;  2EA4 A;  3N05 A;  2L7Z A;  3AG3 H;  1G8X A;  4HBL A;  5DCF A;  1NK2 P;  1I39 A;  4IPA A;  4BHP A;  4C30 A;  3ABM H;  1RUO A;  2XGX A;  4IHY A;  5CLS A;  2CQ7 A;  2E7W A;  1FYK A;  2QZ8 A;  3B73 A;  3ZQQ A;  4RLQ A;  2YU9 J;  3KP2 A;  4M9Z A;  1E3O C;  2JWT A;  2TRT A;  1SFK A;  1REP C;  3I58 A;  1O3R A;  5ILV A;  3BQY A;  1MSE C;  2KP6 A;  2MG4 A;  5HOD A;  1KGS A;  2NNY A;  2BY2 A;  4AD9 A;  3VYR B;  5EGO A;  1OYI A;  2K85 A;  3MZ8 A;  4BDZ A;  1LPQ A;  1LDK B;  4HV5 A;  3HOU J;  1UB9 A;  1YI2 I;  1X1D A;  4R1H A;  2X9D A;  3J80 K;  3D5L A;  2X1D A;  3V7R A;  1OCO H;  1BBY A;  4I99 C;  3JRD A;  2DMQ A;  3FM3 A;  1QU3 A;  4UVC A;  1D3Y A;  2QGU A;  2HOT A;  1K6O A;  4EJO A;  2M3A A;  2EK5 A;  4RAY A;  2ACJ A;  4RA2 A;  1MBF A;  3JRE A;  1RR7 A;  1JUS A;  1XGM A;  2RC4 A;  4Y3O A;  5IOY A;  3OYB A;  4GYI A;  1VQ5 I;  4KJZ A;  2OZ6 A;  2E36 A;  3NRV A;  3RI4 A;  1YRN A;  1R9T J;  1SVL A;  3K1M A;  1EH7 A;  3S1N J;  4RAF A;  1U78 A;  3S93 A;  4N9I A;  3G1O A;  5A2Q K;  3VWB A;  3ZXS A;  3QU3 A;  1SD6 A;  2O6G E;  3G2B A;  4X6A J;  1D5Y A;  1FY7 A;  2IVM A;  3T1B A;  5ED4 A;  4IXA A;  4WWC A;  4EM2 A;  4HNT A;  1FBU A;  2H1L A;  1QA6 A;  3C2B A;  2K9M A;  3S2H J;  3S2D J;  1MND A;  1TQM A;  4YRV A;  1IXR C;  1FOX A;  3JW4 A;  3BR1 A;  1XGN A;  2QEN A;  1E2X A;  2R5Y A;  1ZEL A;  4CA0 A;  4CCJ A;  1YS7 A;  3HOV J;  4A3I J;  1S72 I;  2X6W A;  3JTH A;  3NAU A;  4NC6 A;  2ICW G;  2L7M P;  1SD4 A;  5HS7 A;  5B3S H;  1YIT I;  4BNC A;  4DYQ A;  2BV6 A;  5M5W J;  2XSJ C;  1B6A A;  3QYE A;  4A3G J;  1GVJ A;  3V42 A;  4UUS B;  5HDK A;  4AVP A;  1FTT A;  5K7Z A;  4A3M J;  3JRF A;  2PJR A;  1CGP A;  1IUF A;  1GXQ A;  1YTY A;  4HRI A;  4BQN A;  4UB8 C;  2W00 A;  2HGC A;  2DXI A;  1UST A;  3MMY B;  2ZME A;  1D1A A;  2XB5 A;  5LFA A;  1APL C;  4QTR A;  1WZ2 A;  2DFH A;  4YFX F;  2QLZ A;  3ZN0 A;  1X3Z B;  4PJM A;  1PVE A;  2H8R A;  4EV0 A;  3H0D A;  3A4C A;  4FT8 A;  5FD6 A;  2Z3Y A;  3HOY J;  1POG A;  2EJR A;  5E18 F;  5E20 A;  4XN0 A;  1MJB A;  5FGM A;  5FKL A;  5LHH A;  1SFE A;  1MJA A;  5FB2 A;  2UV1 A;  1Z1D A;  1ETK A;  1ZN2 A;  1Q1V A;  3D5R C;  4HX7 A;  4A2U A;  4HST A;  2M5W A;  3JRG A;  2DOA A;  1TTY A;  1WI3 A;  2WV1 A;  4I76 A;  4M72 A;  4PSX A;  1OLT A;  2Y30 A;  4CGZ A;  3OSF A;  2XF5 A;  3K70 C;  5CPR B;  1W7P A;  3PUF A;  2XPV A;  3E6D A;  1I1G A;  2L3D A;  3IUO A;  3L2C A;  3R60 A;  2E1C A;  1SD7 A;  1K7A A;  3HUG B;  1FNN A;  3K4N A;  3R61 A;  1OCT C;  4FET A;  1MBK A;  2ISY A;  3OIP A;  3WU0 A;  4J19 A;  1XGO A;  4L9T A;  1TWC J;  2Z9O A;  4U0V A;  4XLF A;  2D1V A;  3X2Q H;  2JA8 J;  2GBY A;  3OL4 A;  5CQG A;  1MNE A;  4NC7 A;  4O3M A;  3CCS I;  1ZAO A;  3CTA A;  1XGS A;  2XRL A;  2D5V A;  5LEJ A;  2RRE A;  4DGW B;  1XC5 A;  3FK7 A;  4BKX A;  4XOP A;  3R0A A;  4GRI A;  4XLA A;  4A6D A;  4ESJ A;  3J7A Y;  1XPX A;  2GA1 A;  1QZE A;  3ML6 A;  1WJA A;  2V6C A;  5F64 A;  3F9K A;  4DBR A;  1FTZ A;  3BG5 A;  5M3M J;  4M73 A;  4TV7 A;  1O7L A;  2O0Y A;  2EZH A;  3RPU D;  3LSG A;  2VQG A;  2LD5 A;  1H9T A;  2VOD A;  2E1O A;  3C2H A;  2R4G A;  2VT3 A;  1OR7 A;  2DO7 A;  5JR3 A;  1XDS A;  1RUN A;  1U3E M;  1U5T B;  2HQR A;  4PK4 A;  4H0E A;  3HSR A;  5EDN A;  2KZV A;  3PQJ A;  3CUQ A;  5FJ8 J;  1T8I A;  1IV6 A;  3WHC A;  4OIO F;  3ZOB A;  3TMO A;  3E5X A;  1S7A A;  1R00 A;  4Y33 A;  4A3D J;  1BC8 C;  3DP7 A;  4M74 A;  4LD5 A;  3RPQ A;  1YW7 A;  2YSR A;  5J8C A;  2K27 A;  3GZ6 A;  1IGN A;  3QPT A;  2MC4 A;  3OMY A;  4BAC A;  3P5J A;  2ID6 A;  5KCM A;  2M7A A;  5H6R A;  5DCM A;  4Y13 A;  1F1Z A;  1I6H J;  3SZG A;  2V1X A;  4I0B A;  3ZMU A;  1R7J A;  3E1S A;  1TNS A;  1GV2 A;  3WTS C;  1WFX A;  4UY8 I;  1T6S A;  1WJD A;  1P92 A;  5ICF A;  1IW7 F;  2EIL H;  3E7L A;  4HOB A;  2BW3 A;  1W5C C;  5LRR A;  3DU5 A;  2W1O A;  3JSO A;  1Y8R B;  4XID A;  2E2H J;  1YG2 A;  3I4M J;  4BBR J;  3VFZ A;  4DIQ A;  3VPR A;  3KEO A;  3SJM A;  1GVD A;  4D0P A;  3GX4 X;  4EGZ A;  4HF0 A;  3VYS B;  3LQQ A;  3W3C A;  2JRM A;  2Q2E B;  3K4M A;  4IO9 F;  4XK4 A;  1KU7 A;  1V54 H;  3BR5 A;  1OYY A;  3DEW A;  4LIT A;  4L9J A;  2RDP A;  3ZMD A;  2VJ5 A;  4KT5 C;  5ERI A;  3BG3 A;  3TDZ C;  2HPM A;  5FFZ A;  1VQ6 I;  2OA4 A;  2K9S A;  3MAJ A;  2KRH A;  2DA2 A;  4XRS A;  2DA1 A;  2K7L A;  4JP0 A;  2BBY A;  3WU1 B;  5L3G A;  1R49 A;  1RZ4 A;  1A04 A;  5JLW A;  1OFC X;  2F5E A;  2DFI A;  2KHM A;  2GXG A;  2ZJR F;  4OAY A;  4LLL A;  3MFK A;  3EUK L;  4U87 A;  1ETW A;  3CMM A;  3FHN A;  2R5Z B;  2B0L A;  2F5D A;  3H36 A;  4MIM A;  2YS9 A;  3ROU A;  3Q9S A;  4G6T B;  4RGS A;  1FYM A;  5TIS C;  5E3L A;  3CDL A;  2O61 A;  3RKQ A;  2RKH A;  3CC7 I;  2GA2 A;  1Z67 A;  4QSH A;  3GXO A;  3HKZ A;  1TW2 A;  5EGO B;  4XKV A;  3S14 J;  3VDX A;  4PJ0 C;  2KRC A;  1ON2 A;  4D5C A;  2EZL A;  5F0C A;  3OYK A;  3BZK A;  2A5Y B;  3SDG A;  2CW7 A;  1TNT A;  3JRA A;  2KDZ A;  4OIR F;  2LRE A;  2XAQ A;  1O3T A;  4HYE A;  1F9N A;  2IS4 A;  2FE3 A;  1KYZ A;  3H0G J;  1BIB A;  4GGG A;  1S8N A;  2B63 J;  4PFP A;  3KYL A;  1H8A C;  2BYV E;  3DV8 A;  4G94 A;  1IUY A;  3S3M A;  1DP3 A;  4ENM A;  3HZJ A;  2CH0 A;  3Q0U A;  3W2A A;  1V3F A;  1QHG A;  1QZY A;  4HAM A;  5HDN A;  5E1Z B;  2XAU A;  1U9N A;  4XLP F;  1BW6 A;  1QHH D;  1YRN B;  2K5C A;  3PFY A;  5LLQ A;  3FMR A;  2GZW A;  1TWG J;  3CLO A;  3FXQ A;  5J1U A;  1JE8 A;  4G6D A;  1ZG1 A;  4Y7N J;  2KJC A;  4YG2 F;  2JVG A;  3IH3 A;  1VQM I;  5TRD A;  3PIO F;  1JXS A;  3ABK H;  1A6Q A;  4KIF A;  4JOM A;  3ZQI A;  4CYD A;  1ITY A;  4XOR A;  3CO6 C;  4E6K G;  1S9H A;  1Y0U A;  3ABL H;  3E5U A;  2XAJ A;  3MKL A;  4P55 A;  2RAE A;  4C2T A;  2JPC A;  2ECB A;  1OCR H;  2R5Y B;  1FMV A;  1TWA J;  2XPW A;  1VQ4 I;  1FOY A;  2RN7 A;  1B9M A;  1DU6 A;  4IHX A;  2X85 A;  3FKI J;  4B8X A;  2O9L A;  3DLL F;  3OY9 A;  1J9I A;  2IW5 A;  1E3P A;  4G6Q A;  4CH7 A;  1HOM A;  3L00 A;  4G7H F;  2X6Y A;  1YX5 A;  1MH4 A;  2HNH A;  2L4M A;  3VSK A;  4S04 A;  2PJR B;  3DBL B;  4IHW A;  1BJZ A;  1MJ9 A;  4HNV A;  2R7O A;  3LA3 A;  2VKE A;  3BJA A;  1S5L C;  3OS0 A;  1YE9 A;  2QKM B;  3OYH A;  2ZME B;  3PNT A;  2HPI A;  2ZSI B;  4B48 A;  4RAG A;  2YUS A;  4NDL A;  3GLL A;  3K1P A;  1ETQ A;  2QWW A;  2AO9 A;  2UXN A;  3FKJ A;  2BXZ A;  2MFZ A;  1HW5 A;  1V5F A;  2IGK A;  4XIC A;  2ZBK A;  5DYM A;  5ICE A;  3RZO J;  1QQI A;  5EEA A;  3GTK J;  1XSV A;  3S3N A;  1TQP A;  3OS1 A;  1O3S A;  1SFX A;  3CDI A;  2CO5 A;  3U2R A;  2H09 A;  3E5Q A;  1YX3 A;  4CYC A;  1G59 A;  4XON A;  2VAS A;  4OU0 A;  3DXJ F;  1K79 A;  1W7P B;  2FXA A;  1XN7 A;  2IXS A;  4P9F A;  2LKP A;  2UXX A;  5D5W B;  3EDP A;  2HXO A;  4LLG F;  2DYR H;  1UHM A;  3S17 J;  1IXC A;  4C9Y A;  2F4M B;  5KNL A;  2HTJ A;  4UV9 A;  4YIF A;  4JYK A;  2DJN A;  1HLV A;  1YW9 A;  2X1E A;  2G7U A;  2BY0 A;  3KZI C;  4JX6 A;  2IRF G;  5IY5 H;  4RBO A;  4KNY A;  2DT5 A;  1T39 A;  1F36 A;  4BH9 A;  2VPR A;  2HEO A;  2ZC2 A;  3S32 A;  3ZCO A;  2KPM A;  2VQC A;  5IT9 K;  2JK3 A;  1YIJ I;  3FM5 A;  3K6G A;  3W6J B;  5JHF A;  2MYS A;  2DOD A;  1F4K A;  2R7T A;  1FT9 A;  5E1W A;  5DD4 A;  3FXU A;  4DBQ A;  5J4Y A;  1YS6 A;  1K83 J;  3L1P A;  1ZLK A;  3FXK A;  5LGU A;  1N75 A;  2Z16 A;  1HDP A;  3RKY A;  3CME I;  4RB3 C;  3O3K A;  1JT0 A;  3R6S A;  5FLM J;  2JTV A;  2FBK A;  3QOD A;  1I1S A;  3HRS A;  2UUZ A;  3R4K A;  1Y39 A;  1W1W E;  5J47 A;  4KIC A;  1AU7 A;  3T8R A;  1VF9 A;  1MDM A;  4IOA F;  5GTI C;  2E1N A;  1LE8 A;  4BUP A;  1T0F A;  5D5U B;  1XMK A;  2DMN A;  2DLL A;  1SFO J;  4OOI A;  4EEF G;  3LST A;  3LSJ A;  4S0H B;  1KYW A;  1ZR2 A;  4A3J J;  4EJT A;  5C44 J;  4M6Y A;  1MBJ A;  3CP8 A;  5KAF C;  3WE2 A;  1P9Q C;  1HW2 A;  4AYB A;  2F5F A;  3CCJ I;  1UG0 A;  5DCM B;  2X4H A;  4F91 B;  4BE2 A;  4V2G A;  5GPC A;  3QPS A;  3GEZ A;  2XAF A;  3HKZ N;  3BT9 A;  3K2A A;  5J6X A;  5D8L B;  3UKG A;  2IP2 A;  1Z7U A;  2VBX A;  2LH9 A;  4HA8 A;  5EJC A;  5LD2 C;  3HPG A;  3GFJ A;  2OZU A;  4W97 A;  4EAT A;  2BW3 B;  1FIP A;  4MLO A;  5K7H A;  3LNQ A;  3K2Z A;  4RM2 A;  1BOA A;  4M9S A;  3A0B C;  5GTH C;  2FRH A;  2ZO4 A;  1JGG A;  5FRN A;  4UVA A;  1ZKG A;  4OAZ A;  3V7S A;  2K4J A;  1MMG A;  5J1R A;  3BWG A;  4E7L A;  4A3L J;  1EH6 A;  1R36 A;  1W36 C;  3R0J A;  1JGS A;  3ZMZ A;  2P5K A;  1Z6T A;  2DA6 A;  2NVQ J;  4FCY A;  3TO9 A;  2HQA A;  2EIM H;  3OIQ A;  5DV5 A;  5L3E A;  2C6Y A;  2Y0S A;  3FMQ A;  2MSY A;  1BI2 A;  2B7E A;  5JVG F;  1T08 B;  4PZJ A;  4RGU A;  5A2Q Z;  4UVB A;  2CUJ A;  4RAZ A;  3JAM Z;  2K4B A;  3ELK A;  2XAG A;  1YO5 C;  1H88 C;  2CJJ A;  4AID A;  1TLH B;  3VEP A;  3LFU A;  2ME0 A;  5HLG A;  2PN6 A;  3KE2 A;  3KYD B;  4I7H A;  5CVJ A;  1VQK I;  4CO8 A;  1T33 A;  5FO5 A;  4UNO A;  4A3K J;  4DZP A;  3FK6 A;  2X6X A;  3RCO A;  5F1J A;  3IC7 A;  1JHF A;  2HDW A;  3OYI A;  4DZJ A;  3P7N A;  5D5X B;  2GXB A;  1WWX A;  2JQ7 A;  3JSP A;  1GT0 C;  3PO3 J;  3RZD J;  1RPW A;  2DA7 A;  2DFE A;  4A5N A;  4EJV A;  1EJ9 A;  1OQY A;  3I0T A;  5IYB J;  1EF4 A;  1JT6 A;  3BC8 A;  2GQQ A;  4B43 A;  3DKW A;  4OMZ A;  4L0Y B;  4HLX A;  4XKB A;  4E7K A;  1FSE A;  3RKW A;  3IP4 B;  3A03 A;  4XLH A;  1AA7 A;  5IP7 J;  4M3G A;  2E71 A;  3JRB A;  2ZXJ A;  2K9Q A;  3ZQ7 A;  1A5J A;  2XKO A;  3EUH A;  5E8G A;  3KYC B;  3LL7 A;  4LG0 A;  1UFM A;  2Y9Z A;  2W85 A;  1O57 A;  2NOJ B;  4A69 C;  2FOW A;  3LFK A;  3RSN A;  3CCE I;  2H1K A;  2E7X A;  2JT1 A;  2E19 A;  2QCO A;  4BS9 A;  1BR1 A;  1X3W B;  3IAM 2;  4CDG A;  2OD5 A;  4CCK A;  2R7F A;  3HB9 A;  2OCC H;  2V7F A;  4A6E A;  1FX7 A;  4YEL A;  1P2F A;  2DOE A;  3PSF A;  4LK1 F;  1S29 A;  2W82 A;  5DUK A;  1PP7 U;  1OPC A;  2VC1 A;  2VPL A;  3OOP A;  3K4B A;  3FBN B;  3WTW C;  3E0J B;  1MMS A;  1IG7 A;  5KVR A;  1JJ8 C;  3F72 A;  1SMT A;  2HU9 A;  4F92 B;  2WB1 A;  2ZME C;  3I64 A;  2NOG A;  3ASN H;  1DPU A;  2ME6 A;  2V1D A;  3HGY A;  4IHT A;  5CJ9 A;  3TKY A;  4F55 A;  4KFC A;  3H3Z A;  1WVR A;  2CFO A;  4II2 A;  4XSX F;  4PGG A;  4XLE A;  3COA C;  1JKP C;  2BHY A;  4WXD A;  3CCU I;  4BYY A;  5ICG A;  2FQ4 A;  1Y1V J;  5HVQ C;  1K6Y A;  3AG1 H;  2DYS H;  1D1B A;  3O8H A;  4QPO A;  4ANJ A;  2NS7 A;  2CWE A;  2F5C A;  3MVP A;  1RET A;  3BLY A;  5E3M A;  2ELK A;  2Y69 H;  1K4S A;  1SVO A;  2VL8 A;  4BXU A;  4E4H A;  3L2R A;  5FFX A;  3JAM K;  1L3L A;  1B8I A;  2GOX B;  3AFH A;  3PQK A;  3GTQ J;  2RNG A;  4FE4 A;  3L2V A;  1D8K A;  5FRO A;  1BM9 A;  2VKD A;  3Q0V A;  3QPL A;  2E35 A;  2O03 A;  3A01 A;  1HKQ A;  2HFH A;  4A5M A;  1A31 A;  1DQU A;  2FD5 A;  2HKO A;  3GTO J;  2PMU A;  2VKV A;  1P4X A;  4RS8 A;  2KRF A;  3GF2 A;  4MHG A;  4X0G A;  1V5G A;  1YJ9 I;  1WSU A;  2IS2 A;  3L2Q A;  2FMY A;  5HLH A;  5DM6 F;  3ZQL A;  1W5T A;  2ELJ A;  5LHI A;  3FXJ A;  2K40 A;  1OMI A;  2XPU A;  1VQO I;  1LFP A;  4QPQ A;  2Y2Z A;  4FQG A;  1IF1 A;  5IP9 J;  2AXL A;  3SQN A;  1BR4 A;  5AIQ A;  1MSF C;  1W0U A;  5FLV A;  2XRN A;  3FXM A;  3M8F A;  5FLX Z;  3AAF A;  3IHU A;  2TDX A;  2KT0 A;  3KEY A;  2EIJ H;  4IQ4 A;  3KPH A;  1X4O A;  2WAQ N;  3K70 D;  3JRC A;  2W57 A;  3M07 A;  2L9R A;  1XG1 A;  1CF7 B;  1B4A A;  4CXF A;  1VQ7 I;  4ESF A;  1XD7 A;  5FD5 A;  1BL0 A;  4M6X A;  4I6Z A;  1D0Z A;  1OR7 C;  3OYE A;  4UXN A;  3REO A;  4E70 A;  4BGD A;  1Z3X A;  5GAD J;  3WTY C;  3J7Z I;  1BA5 A;  1HXD A;  2EV0 A;  3CUQ C;  1JUP A;  4ZYG A;  1U9O A;  1R1V A;  2LP0 A;  2FEZ A;  2ZNY A;  4HX8 A;  1ETX A;  2KDO A;  2OQR A;  2EQR A;  3HDD A;  1RES A;  2EFQ A;  1YHQ I;  3CD6 I;  2CYY A;  3IWZ A;  2BVL A;  1DGR M;  2MBF A;  1IRG A;  1WJF A;  3OYG A;  4ASN A;  2B9S A;  2JZY A;  5CYV A;  1ZQ3 P;  3E6B A;  3PO2 J;  1OKR A;  2IPQ X;  4HG2 A;  1JKQ C;  1D1C A;  4HF2 A;  1ERD A;  3DF8 A;  2Y0S N;  2DU9 A;  4ZC3 A;  4MFD A;  3TBI A;  3VYT B;  4DJA A;  2Z99 A;  1LE8 B;  2CW8 A;  2VN2 A;  3QP5 A;  5F1R A;  4IRI A;  3I3L A;  1G3T A;  1B1B A;  1HSJ A;  2BXY A;  4Q5S F;  3DU6 A;  1KQ0 A;  3HOX J;  1UG2 A;  3ZQC A;  1W0T A;  2MGQ A;  1FJL A;  2JJ7 A;  3B6C A;  3SFI A;  2DDB A;  1RKT A;  2DMT A;  2O8X A;  1VQ8 I;  2PBI A;  5DD8 A;  4J00 A;  4C3J J;  1PYV A;  2K02 A;  2NS0 A;  3P9C A;  2WY7 Q;  2GM4 A;  2L4A A;  3HC7 A;  1H89 C;  2TCT A;  3AG2 H;  3HJE A;  3LSP A;  4BXX J;  3LMM A;  3OR2 C;  1I27 A;  3DPU A;  3O8G A;  1RNL A;  3K4J A;  1FC3 A;  3QWL A;  3SHF A;  2Z5U A;  1R1U A;  4U7D A;  1A36 A;  2QSG X;  2HVQ A;  5D4R A;  1ZH5 A;  1P7J A;  3SDB A;  2M45 A;  2AXT C;  5H20 A;  1OIS A;  2EH3 A;  4NNJ A;  1ZG5 A;  2QBY A;  4A3C J;  4M3F A;  5FLX K;  2KLO A;  2L54 A;  1Z0X A;  2BGC A;  2CQN A;  1LKX A;  1C0W A;  2M87 A;  5KAI C;  2NVX J;  3KZY A;  2DOF A;  1JKO C;  4FX4 A;  2VB6 A;  2QQ9 A;  2QVO A;  3WG7 H;  1ZR4 A;  1YQA A;  2A05 A;  1ZLJ A;  2M7B A;  4PFO A;  4KMF A;  2IA2 A;  3CF2 A;  3KET A;  1DDN A;  1ENH A;  3MEX A;  3E6C C;  1TWF J;  2IS6 A;  1NG6 A;  1N78 A;  2MLG A;  2J5P A;  3ZMV A;  3D0S A;  1Y56 A;  3T8T A;  4ON0 A;  2VLA A;  4DNC A;  3HIF A;  1IV8 A;  4QWQ A;  5BPI A;  3DFG A;  3G6E I;  2DTZ A;  1U0J A;  5K7F A;  3ECO A;  3EYY A;  4BEH A;  5IYD J;  1H9G A;  4ITV A;  3EET A;  1TC3 C;  5LRS A;  3OIO A;  1X58 A;  3BDD A;  1VTN C;  3BQZ A;  4D1Q A;  1XSD A;  3LA7 A;  1E3H A;  1LFB A;  2ELH A;  4G7Z F;  1SAX A;  1X3U A;  1FYL A;  2NVT J;  2MC3 A;  3FMS A;  2WA0 A;  5BQT A;  3GZ5 A;  4NC8 A;  2XKP A;  1VQN I;  3EPZ A;  4BJ5 C;  3JRH A;  2E1M C;  4XLN F;  4IZZ A;  4D7N A;  2KJB A;  1R5G A;  1VND A;  1J7K A;  1OYW A;  3BP8 A;  1NHA A;  5L3C A;  4PJN A;  1FWZ A;  1KU2 A;  1BN5 A;  2V9K A;  1X2M A;  3BZ6 A;  1RI7 A;  4MTE A;  3HTU A;  3GBG A;  2QEX I;  2CW0 F;  4AWX B;  2XUB A;  2HQN A;  1HCR A;  3QU6 A;  4PSW A;  1ZRC A;  2I8D A;  1S7E A;  3TW6 A;  4ZDP A;  1KU9 A;  3M8J A;  1UEL B;  2WAD A;  1XMA A;  3H9Q A;  1BOB A;  2A6T A;  1LQ1 A;  3WG9 A;  1Q1H A;  4B3X A;  1FLI A;  1MIJ A;  1R5H A;  5CQE A;  4BE1 A;  1WJB A;  3KIO A;  1ETY A;  3HOZ J;  2LBF A;  1T2K A;  2EV6 A;  3S15 J;  2KIU A;  1SFU A;  3CDH A;  1X2N A;  1G6N A;  3RPU A;  1OJL A;  3ESW B;  4BQO A;  1RKW A;  5K1Y A;  2DAO A;  5GPA A;  1IRX A;  1I50 J;  1AKH A;  3TOB A;  1FZP B;  1J75 A;  3HG9 A;  2FU4 A;  1W4M A;  1KQ8 A;  4JQF A;  4L5I A;  2Q0O A;  4HW0 A;  3MWM A;  4NHJ A;  4ZJZ A;  5M3F J;  2OTL I;  2R7D A;  2XVC A;  4CZZ A;  5HS9 A;  2E5Z A;  1ODD A;  3SYT A;  1CQT A;  4B47 A;  4BAY A;  5IT9 Z;  3Q5F A;  1HKT A;  2G0E A;  3BZC A;  5BOX A;  2EZI A;  2LY1 A;  2Y75 A;  2YR2 A;  2YX4 A;  5FKK A;  2XRO A;  3MKY B;  1FBQ A;  2VJJ A;  2P4W A;  2M1B A;  5K5O A;  4BDY A;  2ZXH A;  4KYW A;  3BY6 A;  3HBL A;  3I9V 2;  1I3Q J;  2DCE A;  4MO7 A;  1FIA A;  1V4R A;  4UB6 C;  1TT0 A;  3FBI B;  3VYU B;  1UMQ A;  2A6E F;  1ONV A;  3LSR A;  4K2E A;  1RC9 A;  3IKT A;  5C3E J;  2X51 A;  3K10 A;  1R4M B;  3OR1 C;  4OMY A;  1SC7 A;  3H9G A;  4V2F A;  2QUF A;  4V19 K; 
#chains in the Genus database with same CATH homology
 4KIB A;  4Q47 A;  1TBX A;  2J5O A;  3KP7 A;  4AIJ A;  4R8H A;  3RYR A;  2ZFW A;  1QZZ A;  3WGH A;  5HS8 A;  1BC7 C;  4WF2 A;  1S3J A;  4KIG A;  3WE3 A;  3GLX A;  1JHH A;  4P9U A;  2F2E A;  3FHZ A;  3SFZ A;  5K5Q A;  4JBA A;  2DBB A;  1ZGJ A;  3O6B B;  2EWN A;  1IRF A;  3S2W A;  1HQC A;  1BI1 A;  4UV8 A;  2G9W A;  4EGY A;  3BPV A;  2P5V A;  5L3B A;  1QPM A;  4MEY F;  1TW3 A;  3M8E A;  2GIV A;  3HSF A;  1U6G A;  3HRT A;  3HRU A;  2RNJ A;  3QP6 A;  4HQE A;  5E1X A;  4P5O A;  3KP6 A;  3M7G A;  4UHT A;  1Z9C A;  2M8E A;  4A12 A;  5CVV A;  2XV4 S;  5ILU A;  4U88 A;  3T0Y A;  4BQA A;  3CUQ B;  5D6F A;  3MQ0 A;  4M71 A;  2LSO A;  2K86 A;  3GFI A;  2QBY B;  5D4S A;  4Y15 A;  3IRQ A;  2NRA C;  5BPD A;  2DK5 A;  4S05 A;  2D45 A;  3BRO A;  2ISZ A;  1ULY A;  1MD0 A;  3L9F A;  3F6V A;  2HZT A;  1FSH A;  3K0L A;  5CVI A;  3DQV C;  3CJN A;  3QOP A;  4IF4 A;  1FOK A;  3ERE D;  3FWE A;  2VBY A;  4M9X A;  3WOD F;  4MNU A;  2BEO A;  3L7W A;  3WGI A;  2COM A;  3RIR A;  3KLN A;  4RB0 A;  1R22 A;  1B59 A;  1O7F A;  1YYV A;  1ZRD A;  4WCG A;  4HF1 A;  3HYI A;  3KFW X;  2IA0 A;  4QLC U;  4U0Y A;  5TJJ A;  2HYF A;  2MD5 A;  4WXH A;  1YW8 A;  4AIK A;  1PDN C;  4KN4 X;  3HHH A;  3H92 A;  1BJA A;  3CO7 C;  5CVR A;  3E3V A;  2Z33 A;  2ZJ2 A;  2VOO A;  3NQO A;  5DEQ A;  2FOK A;  3KP5 A;  3N97 A;  3HOS A;  5HLI A;  4EM1 A;  2V9V A;  4IRG A;  2EFN A;  4GO1 A;  5J8F A;  5JVT A;  3KLO A;  1XSX A;  5DDG A;  1UHW A;  3QAH A;  3MCZ A;  3QRF F;  1IAW A;  4U7B A;  2FNP A;  3LA2 A;  3DPT A;  3I5U A;  4XSZ F;  1P6R A;  2YPR A;  5ICC A;  1KQ9 A;  3KCC A;  1HKS A;  3F8N A;  3G73 A;  4LB6 B;  2STT A;  3IKV A;  3LWF A;  2FNA A;  2VT2 A;  2GWR A;  3OV8 A;  3GWZ A;  2UWM A;  2HDC A;  2ESH A;  5KK1 A;  3J7A O;  2VON A;  3JTG A;  1J59 A;  1QBJ A;  2NAZ A;  2NNN A;  1KU3 A;  1ZRF A;  4Q4Z F;  4A0X A;  3PFI A;  2P6S A;  2VE9 A;  1LEA A;  1LVA A;  3HOT A;  2FBI A;  1W7P D;  1GXP A;  2LDU A;  3F23 A;  4O5V A;  3E6M A;  4MEX F;  5EEH A;  4ESB A;  4Z2Y A;  2OBP A;  3MZH A;  3I71 A;  5BS6 A;  1IN5 A;  3BOQ A;  2VC0 A;  3ZN1 A;  2HR3 A;  1HBX G;  2CQK A;  4YFK F;  2P8T A;  3J81 Z;  3HRM A;  4RB1 A;  2WWY A;  1XDU A;  5BMZ A;  4L18 B;  2A6H F;  3F6O A;  4L9V A;  2P7V B;  2P5L C;  2H94 A;  3CUO A;  3GW2 A;  4MQV A;  3C18 A;  2OU2 A;  4Y17 A;  1PP8 F;  2RV8 A;  2Y0M A;  2QQA A;  1I5Z A;  1P4A A;  5EEG A;  4HDV A;  3RTR A;  2QYO A;  3ZPL A;  4LK0 F;  3IWF A;  5LGN A;  4OIN F;  2A68 F;  4MGR A;  3GVA A;  1K78 A;  2WTE A;  2HTS A;  3IL2 A;  1USS A;  4RGR A;  2AS5 F;  3SXY A;  1WI9 A;  4IVN A;  3FZV A;  3BJO A;  5D6E A;  4PDK A;  5ILS A;  4IRH A;  3I54 A;  4A0Z A;  1S7O A;  2PFB A;  1XCV A;  3P9K A;  3F22 A;  2EFO A;  3TOA A;  1E17 A;  2HOE A;  4N9H A;  1ZG3 A;  1GHC A;  5L3F A;  4GCV A;  4FX0 A;  4AIH A;  4LB5 A;  1ZHF A;  1LDD A;  3VB2 A;  1MDM B;  5E17 F;  2LF8 A;  2FML A;  1L0O C;  1S6L A;  4F7Z A;  2R3S A;  3U1D A;  1RIO H;  2JPB A;  3TGN A;  3LAJ A;  3ECH A;  3F8B A;  3KZZ A;  2H6B A;  4KN7 X;  3V7C A;  3K1N A;  2XHK A;  4G8X A;  2VBZ A;  3F8F A;  3J81 K;  3KEQ A;  3BJ6 A;  3GUD A;  3M9A A;  1O3Q A;  3F21 A;  3QPH A;  2FF4 A;  2EA2 A;  3EYI A;  3MZY A;  1U2W A;  5LHG A;  2ZCW A;  1IXS B;  3I4P A;  5F6F A;  1HW1 A;  3RYP A;  4OIP F;  3W6K B;  2OAZ A;  3L09 A;  1AWC A;  2PQ8 A;  1ZRE A;  2H6C A;  2BE5 F;  2CGP A;  1J0R A;  1B9N A;  3HSE A;  4Q48 A;  2P7C B;  4WXC A;  1ZYR F;  1LEB A;  1WRJ A;  4YII A;  4HZF A;  1G3W A;  3HHG A;  1G4D A;  3G3Z A;  4KMU X;  4P96 A;  4EJW A;  1LJ9 A;  4KA4 A;  4I02 A;  1FP1 D;  3DEU A;  4DQ2 A;  2Y48 A;  5LGT A;  3ISP A;  1I6X A;  3TDU C;  1G3S A;  2G7H A;  2XIG A;  2NYX A;  2HS5 A;  1TQI A;  2DTR A;  4LG0 B;  1FPQ A;  4HDU A;  4LJZ F;  5H6Q A;  3O2P E;  3F8C A;  4B09 A;  2KIF A;  5AON A;  1KA8 A;  1Z6R A;  3WTX C;  3WTT C;  3GYH X;  4WX9 A;  2O3F A;  4U0W A;  2EFP A;  2PEX A;  4KDP A;  4NQW A;  4EM0 B;  5LEK A;  2V79 A;  4ZYH A;  3DPL C;  4LFU A;  1LDJ A;  4ZZD A;  2KKO A;  5D5V B;  3M1E A;  2KIM A;  4YFN F;  4PCQ A;  3EQL F;  3KP4 A;  4EQQ A;  4ETS A;  4I2O A;  2FSW A;  3V8J A;  4ENK A;  2A69 F;  2PMH A;  1T98 A;  2QQB A;  4GYG A;  3I59 A;  2H27 A;  4EVI A;  4BHB A;  3E97 A;  2D2W A;  4I01 A;  2MH9 A;  2ESN A;  4WK8 F;  2EV5 A;  1XB4 A;  4CHU A;  3F8M A;  1HST A;  3WGG A;  4ZH4 F;  2PG4 A;  2M30 A;  4HV6 A;  2W84 A;  1WQ2 A;  4LGW A;  2GAU A;  3I53 A;  1BIA A;  4LMY A;  2LF7 A;  2DI3 A;  2IT0 A;  1IZ1 A;  2Q8K A;  3WTU C;  3ABT A;  4ZZL A;  2WC2 A;  5JFR A;  3WTV C;  4ENN A;  2XAS A;  4PGH A;  2ZKZ A;  1UCR A;  4L0Z B;  2EFW A;  2HWV A;  1Z91 A;  3LAP A;  3K9T A;  3H3U A;  1U8R A;  4JK1 X;  1K78 B;  3N4M A;  5K5R A;  3KP3 A;  1DP7 P;  2DPU A;  4EJU A;  1ON1 A;  2DQR A;  5JI6 A;  2CFX A;  2DK8 A;  3C7J A;  4FHT A;  4EMS A;  2ADU A;  1R23 A;  5AIP A;  2ZNZ A;  3GO5 A;  1W5S A;  2JSC A;  1IN8 A;  3RDI A;  2FBH A;  2MH2 A;  4MQ9 F;  4GXO A;  4OIQ F;  4L9N A;  1QGP A;  3V4G A;  1BI3 A;  4MTD A;  2VXZ A;  2HYG D;  4G7O F;  1MKM A;  3U9G A;  4ZYE A;  4RB2 C;  3SZT A;  1DUX C;  2DW4 A;  1BI0 A;  5LBQ A;  1YLF A;  1EV7 A;  4XBF A;  1QNT A;  2DQL A;  4I09 A;  1CF7 A;  3P9I A;  5IT3 A;  4I98 B;  3HTS B;  1ZGA A;  4A0Y A;  1U5T C;  3VOD A;  1AOY A;  2W24 A;  2VOP A;  4N0B A;  1R1T A;  4G9Y A;  4RGX A;  3ULQ B;  2X0L A;  2MA3 A;  2FA5 A;  3VOE A;  2RQP A;  1J5Y A;  1LNW A;  1D8J A;  2ETH A;  2A61 A;  1WKM A;  4HLY A;  2L02 A;  4XRF A;  5D8K B;  2PLY A;  1MGT A;  3HUG A;  4LLN A;  5CVU A;  3F3X A;  3WTZ A;  3RJP A;  4IHS A;  2A3S A;  4I0A A;  4ENJ A;  3TO6 A;  3GFM A;  1IN6 A;  1F5T A;  1P4W A;  2RGV A;  4L5J A;  1IN7 A;  1R58 A;  3ZMT A;  3BPX A;  3C1D A;  3FF5 A;  2LNB A;  2A07 F;  2EB7 A;  4CIC A;  2PI0 A;  2W25 A;  5L3D A;  2UZK A;  2D1H A;  3LQR A;  1QO0 D;  4NB5 A;  1YFH A;  4ZYD A;  1G3Y A;  3B02 A;  1FP2 A;  4O6J A;  3IRR A;  6PAX A;  2IJL A;  2VE8 A;  1D5V A;  2XAH A;  3Q9V A;  1U5T A;  3FXR A;  1YIO A;  3J80 Z;  1IN4 A;  2VBW A;  2DPD A;  5DUI A;  1Z05 A;  1J2X A;  4R79 A;  3ABU A;  3ZP5 A;  3RKX A;  2P6T A;  3C3W A;  1T38 A;  3GFL A;  3K69 A;  2YX7 A;  5HOO A;  4KUM A;  2L01 A;  3NEU A;  3FX3 A;  3T5X A;  1XCB A;  2HKX A;  2IA1 A;  2STW A;  5E8I A;  4HX4 A;  1ZAR A;  3TO7 A;  2V1U A;  2YU3 A;  4UUV A;  2CG4 A;  2JRT A;  4BHC A;  2MLK A;  2QM3 A;  3V8L A;  1SMY F;  3V8K A;  1H0M A;  1MZB A;  5JHU A;  5HDG A;  2Q2E A;  4HQM A;  2RVC A;  1EH8 A;  1FBS A;  1SD5 A;  2FQ3 A;  1STZ A;  1PUE E;  3I59 B;  4IJA A;  2CSO A;  2OQG A;  1DPR A;  3ZMS A;  2PJP A;  3SZP A;  2WV0 A;  3TQN A;  2EA4 A;  4HBL A;  5DCF A;  4IPA A;  4BHP A;  1RUO A;  2XGX A;  5CLS A;  2E7W A;  1FYK A;  2QZ8 A;  3B73 A;  3KP2 A;  4M9Z A;  1REP C;  3I58 A;  1O3R A;  5ILV A;  1KGS A;  2NNY A;  4AD9 A;  1OYI A;  1LDK B;  4HV5 A;  1UB9 A;  4R1H A;  3J80 K;  3D5L A;  3V7R A;  1BBY A;  3FM3 A;  4UVC A;  1D3Y A;  1K6O A;  4EJO A;  2EK5 A;  4RAY A;  2ACJ A;  1XGM A;  2RC4 A;  4GYI A;  2OZ6 A;  3NRV A;  3RI4 A;  3K1M A;  1EH7 A;  1U78 A;  4N9I A;  5A2Q K;  3QU3 A;  1SD6 A;  2O6G E;  1FY7 A;  2IVM A;  3T1B A;  5ED4 A;  4IXA A;  4WWC A;  4EM2 A;  1FBU A;  1TQM A;  1IXR C;  3JW4 A;  1XGN A;  2QEN A;  1E2X A;  1YS7 A;  3JTH A;  5HS7 A;  1SD4 A;  4BNC A;  2BV6 A;  1B6A A;  1GVJ A;  5HDK A;  4AVP A;  1CGP A;  1GXQ A;  1YTY A;  2HGC A;  1UST A;  2ZME A;  4YFX F;  2QLZ A;  3ZN0 A;  4EV0 A;  4FT8 A;  5FD6 A;  2Z3Y A;  2EJR A;  5E18 F;  5E20 A;  1MJB A;  5FGM A;  5LHH A;  1SFE A;  1MJA A;  5FB2 A;  1Z1D A;  1ZN2 A;  4HX7 A;  4A2U A;  1LB2 A;  2M5W A;  1TTY A;  4M72 A;  4CGZ A;  1W7P A;  3E6D A;  1I1G A;  2L3D A;  3L2C A;  3R60 A;  2E1C A;  1SD7 A;  1K7A A;  1FNN A;  3R61 A;  2ISY A;  3WU0 A;  1XGO A;  4L9T A;  2Z9O A;  4U0V A;  2D1V A;  4O3M A;  1ZAO A;  3CTA A;  1XGS A;  5LEJ A;  3R0A A;  4A6D A;  4ESJ A;  2GA1 A;  3ML6 A;  2V6C A;  5F64 A;  4M73 A;  4TV7 A;  1O7L A;  2O0Y A;  1H9T A;  2VOD A;  2VT3 A;  1OR7 A;  2DO7 A;  5JR3 A;  1XDS A;  1RUN A;  1U3E M;  1U5T B;  2HQR A;  4H0E A;  3HSR A;  3PQJ A;  3CUQ A;  4OIO F;  3E5X A;  1S7A A;  1R00 A;  1BC8 C;  3DP7 A;  4M74 A;  4LD5 A;  3RPQ A;  1YW7 A;  2YSR A;  5J8C A;  2K27 A;  3GZ6 A;  3QPT A;  5H6R A;  5DCM A;  4Y13 A;  1F1Z A;  2V1X A;  4I0B A;  3ZMU A;  1R7J A;  3WTS C;  1TNS A;  1T6S A;  1P92 A;  5ICF A;  1IW7 F;  4HOB A;  5LRR A;  3JSO A;  1YG2 A;  3VFZ A;  3KEO A;  4D0P A;  3GX4 X;  4EGZ A;  4HF0 A;  3LQQ A;  1KU7 A;  1OYY A;  4L9J A;  2RDP A;  3ZMD A;  4KT5 C;  5ERI A;  3TDZ C;  5FFZ A;  2OA4 A;  3MAJ A;  2K7L A;  2BBY A;  3WU1 B;  5L3G A;  1RZ4 A;  1A04 A;  2F5E A;  2DFI A;  2GXG A;  4LLL A;  3MFK A;  2B0L A;  2F5D A;  3ROU A;  3Q9S A;  1FYM A;  4RGS A;  2O61 A;  2RKH A;  2GA2 A;  3GXO A;  1TW2 A;  1ON2 A;  2A5Y B;  1TNT A;  4OIR F;  2XAQ A;  1O3T A;  4HYE A;  1F9N A;  2FE3 A;  1KYZ A;  1BIB A;  4GGG A;  1S8N A;  2BYV E;  3DV8 A;  4G94 A;  1IUY A;  4ENM A;  1V3F A;  1QZY A;  4HAM A;  5HDN A;  5E1Z B;  4XLP F;  5LLQ A;  3FMR A;  2GZW A;  3CLO A;  3FXQ A;  1JE8 A;  4G6D A;  1ZG1 A;  2KJC A;  4YG2 F;  5TRD A;  1JXS A;  4KIF A;  4CYD A;  3CO6 C;  1Y0U A;  3E5U A;  2XAJ A;  4P55 A;  2JPC A;  2RN7 A;  1B9M A;  4B8X A;  1J9I A;  2IW5 A;  4G6Q A;  3L00 A;  4G7H F;  2L4M A;  4S04 A;  1MJ9 A;  3LA3 A;  3BJA A;  2ZME B;  3K1P A;  2QWW A;  2UXN A;  1HW5 A;  2ZBK A;  5DYM A;  5ICE A;  1QQI A;  1XSV A;  1TQP A;  1O3S A;  1SFX A;  2CO5 A;  3U2R A;  2H09 A;  3E5Q A;  4OU0 A;  3DXJ F;  1K79 A;  1W7P B;  2FXA A;  1XN7 A;  4P9F A;  2LKP A;  2UXX A;  5D5W B;  3EDP A;  4LLG F;  1UHM A;  1IXC A;  2HTJ A;  4UV9 A;  4YIF A;  1YW9 A;  2G7U A;  2IRF G;  4KNY A;  2DT5 A;  1T39 A;  4BH9 A;  2HEO A;  5IT9 K;  3FM5 A;  3W6J B;  1F4K A;  1FT9 A;  5E1W A;  5DD4 A;  3FXU A;  1YS6 A;  1ZLK A;  5LGU A;  3RKY A;  4RB3 C;  3O3K A;  3R6S A;  2JTV A;  2FBK A;  1I1S A;  3HRS A;  3R4K A;  4KIC A;  3T8R A;  1MDM A;  2E1N A;  5D5U B;  1T0F A;  1XMK A;  2DLL A;  4OOI A;  3LST A;  1KYW A;  4EJT A;  4M6Y A;  3WE2 A;  1HW2 A;  2F5F A;  5DCM B;  2X4H A;  3GEZ A;  2XAF A;  5J6X A;  5D8L B;  2IP2 A;  1Z7U A;  2VBX A;  4HA8 A;  3GFJ A;  2OZU A;  3K2Z A;  1BOA A;  4M9S A;  2FRH A;  2ZO4 A;  4UVA A;  3V7S A;  2K4J A;  3BWG A;  1EH6 A;  1R36 A;  3R0J A;  1JGS A;  3ZMZ A;  2P5K A;  1Z6T A;  3TO9 A;  5DV5 A;  5L3E A;  2C6Y A;  3FMQ A;  1BI2 A;  4PZJ A;  4RGU A;  5A2Q Z;  4UVB A;  4RAZ A;  3JAM Z;  2K4B A;  3ELK A;  2XAG A;  1YO5 C;  1TLH B;  3VEP A;  5HLG A;  2PN6 A;  3KE2 A;  5CVJ A;  4I7H A;  4CO8 A;  5FO5 A;  4UNO A;  3IC7 A;  1JHF A;  3P7N A;  5D5X B;  2GXB A;  1WWX A;  3JSP A;  4A5N A;  4EJV A;  3I0T A;  2GQQ A;  3DKW A;  4OMZ A;  4L0Y B;  4HLX A;  1FSE A;  3RKW A;  2ZXJ A;  3ZQ7 A;  2XKO A;  3EUH A;  5E8G A;  4LG0 A;  1UFM A;  2W85 A;  1O57 A;  3LFK A;  2E7X A;  2JT1 A;  4CDG A;  2OD5 A;  2R7F A;  4A6E A;  1FX7 A;  1P2F A;  4LK1 F;  1S29 A;  5DUK A;  1PP7 U;  1OPC A;  2VC1 A;  3OOP A;  3WTW C;  5KVR A;  3F72 A;  1SMT A;  3I64 A;  1DPU A;  2V1D A;  4IHT A;  5CJ9 A;  3TKY A;  4KFC A;  3H3Z A;  3COA C;  4XSX F;  4PGG A;  4WXD A;  4BYY A;  5ICG A;  5HVQ C;  2CWE A;  2F5C A;  4BXU A;  5FFX A;  3JAM K;  1L3L A;  3PQK A;  1D8K A;  1BM9 A;  2O03 A;  1HKQ A;  2HFH A;  4A5M A;  2HKO A;  2PMU A;  1P4X A;  4RS8 A;  2KRF A;  3GF2 A;  4MHG A;  1WSU A;  2FMY A;  5HLH A;  1W5T A;  5LHI A;  1OMI A;  1IF1 A;  2AXL A;  3SQN A;  5AIQ A;  2XRN A;  3M8F A;  5FLX Z;  3AAF A;  3IHU A;  2TDX A;  2W57 A;  1CF7 B;  1B4A A;  4CXF A;  4ESF A;  1XD7 A;  5FD5 A;  4M6X A;  4UXN A;  3REO A;  4E70 A;  3WTY C;  1HXD A;  2EV0 A;  3CUQ C;  4ZYG A;  1R1V A;  2ZNY A;  2FEZ A;  4HX8 A;  2OQR A;  2EFQ A;  2CYY A;  3IWZ A;  2MBF A;  1IRG A;  4ASN A;  2JZY A;  5CYV A;  3E6B A;  1OKR A;  2IPQ X;  4HF2 A;  3DF8 A;  2DU9 A;  2Z99 A;  2VN2 A;  3QP5 A;  5F1R A;  4IRI A;  1G3T A;  1B1B A;  1HSJ A;  4Q5S F;  1KQ0 A;  2O8X A;  2PBI A;  5DD8 A;  2K02 A;  2NS0 A;  3P9C A;  2L4A A;  1I27 A;  1RNL A;  1FC3 A;  3SHF A;  2Z5U A;  1R1U A;  4U7D A;  5D4R A;  1ZH5 A;  2M45 A;  5H20 A;  1ZG5 A;  2QBY A;  5FLX K;  2L54 A;  2BGC A;  1C0W A;  2M87 A;  3KZY A;  4FX4 A;  2QQ9 A;  2QVO A;  1YQA A;  1ZLJ A;  4KMF A;  2IA2 A;  3KET A;  1DDN A;  3MEX A;  3E6C C;  2MLG A;  2J5P A;  3ZMV A;  3D0S A;  3T8T A;  4ON0 A;  4DNC A;  3HIF A;  4QWQ A;  5BPI A;  3DFG A;  3ECO A;  3EYY A;  1H9G A;  3EET A;  5LRS A;  3BDD A;  1VTN C;  1XSD A;  3LA7 A;  2ELH A;  4G7Z F;  1SAX A;  1X3U A;  1FYL A;  2MC3 A;  3FMS A;  5BQT A;  3GZ5 A;  2XKP A;  4XLN F;  2KJB A;  1R5G A;  1J7K A;  1OYW A;  3BP8 A;  1NHA A;  5L3C A;  1FWZ A;  1KU2 A;  1BN5 A;  4MTE A;  3BZ6 A;  1RI7 A;  3HTU A;  2CW0 F;  4AWX B;  2XUB A;  2HQN A;  3QU6 A;  1ZRC A;  1KU9 A;  1XMA A;  1LQ1 A;  3WG9 A;  1Q1H A;  1FLI A;  1R5H A;  1T2K A;  2EV6 A;  2KIU A;  1SFU A;  3CDH A;  1G6N A;  3RPU A;  5K1Y A;  2DAO A;  1FZP B;  3TOB A;  1J75 A;  2FU4 A;  1W4M A;  1KQ8 A;  4JQF A;  4L5I A;  2Q0O A;  4HW0 A;  3MWM A;  4NHJ A;  2R7D A;  2XVC A;  4CZZ A;  5HS9 A;  1ODD A;  4BAY A;  5IT9 Z;  1HKT A;  3Q5F A;  5BOX A;  2Y75 A;  2YR2 A;  2XRO A;  2YX4 A;  1FBQ A;  2P4W A;  2M1B A;  5K5O A;  4KYW A;  3BY6 A;  1V4R A;  2A6E F;  1ONV A;  4K2E A;  3IKT A;  4OMY A;  2QUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...