1XSVA

X-ray crystal structure of conserved hypothetical upf0122 protein sav1236 from staphylococcus aureus subsp. aureus mu50
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
106
Chain Sequence
DLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0122 protein SAV1236
publication title 1.7 Angstrom Crystal Structure of Conserved Hypothetical UPF0122 Protein SAV1236 From Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 40
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xsvA00
4NHJA 2H09A 2EJRA 2DU9A 4I0BA 3V4GA 1KQ8A 2EFWA 4BNCA 2XIGA 3TDUC 4MTDA 3BP8A 2MH2A 2F5FA 3GWZA 3ISPA 2BBYA 2M87A 1DP7P 3K1NA 3EYIA 3RPQA 2BV6A 3Q9SA 1Z9CA 3R0AA 2PJPA 5CVVA 3M8EA 5D5XB 3HRUA 3ROUA 2VT3A 2H27A 1B6AA 5AIPA 2K4BA 4CYDA 1QNTA 3NQOA 2RKHA 1O7LA 2DLLA 3BOQA 3RYPA 2Y75A 1ZRFA 5ICEA 2HS5A 4TV7A 4M9XA 1S7OA 2GZWA 3QPHA 2FXAA 5FLXZ 2D1HA 4XBFA 3ZP5A 5D6FA 3KZYA 1YYVA 2E1CA 1K78B 5HVQC 4KN7X 4HX8A 5J6XA 3GLXA 4OMYA 1MJBA 2LF7A 3QU6A 2O0YA 1KU9A 2NAZA 1R1TA 1JGSA 1IN8A 1IAWA 4R79A 2XROA 4ENNA 5BMZA 1QO0D 3QOPA 2Z99A 1EH6A 1ZYRF 1W5TA 1JE8A 4U0VA 1FT9A 4EJWA 3WTYC 4HBLA 4ESJA 2O6GE 2X4HA 1FX7A 3L9FA 2EA4A 1T38A 4ZH4F 3DPTA 2DI3A 2HOEA 3ZMZA 5L3CA 1I27A 1B9MA 3HHHA 1MDMA 4M6XA 3V7SA 3O3KA 4OIOF 4EM2A 4KUMA 1UHWA 4U7DA 3Q5FA 3BJ6A 3KCCA 4OOIA 3HYIA 3N97A 3W6KB 2EV5A 3CJNA 4LLNA 3E5XA 1YIOA 1FWZA 2PQ8A 3DPLC 1ZG5A 1IXRC 3V8LA 3N4MA 2P4WA 1R5GA 3GO5A 5CVUA 4EM1A 1FSHA 4MEXF 1KU2A 2DW4A 2G9WA 4XLNF 5D8LB 5LEKA 3Q9VA 4UHTA 3IRRA 4OIQF 1MD0A 3F8BA 4ZYGA 5FD5A 4IRGA 1RUNA 1Y0UA 5CLSA 3HOTA 3BPXA 2W85A 3E6BA 6PAXA 4KYWA 4JK1X 4LB6B 2UWMA 4IHSA 3MZHA 2DFIA 4M74A 5D4RA 1S3JA 2JTVA 1WKMA 4U88A 1FP1D 2MC3A 2DAOA 3H3ZA 3E6CC 3IWZA 2LKPA 5L3GA 5K1YA 3V7RA 2PLYA 4ZZDA 4LK1F 2D45A 1OYYA 1E17A 1H9GA 2QLZA 3G73A 3PQKA 4I7HA 4RB0A 5ILSA 2P5VA 3TO9A 5DUIA 2HGCA 4HA8A 5L3EA 4AIJA 3COAC 2VONA 3MQ0A 3GFJA 1BC7C 3HRTA 1Z6RA 2IA2A 3BY6A 2P5KA 2KRFA 4RB3C 5A2QK 5JVTA 1TQPA 3K69A 2VBZA 3FMQA 2L02A 4LMYA 2VBXA 5F1RA 5E1XA 4RGRA 2FBIA 2Y0MA 1FBSA 3CO6C 1WRJA 3AAFA 1G3YA 1S8NA 3CDHA 3ZMSA 1LB2A 1HW2A 1P2FA 2V1DA 4E70A 3WGGA 3DXJF 3FM3A 1B59A 2ZBKA 2EK5A 3CTAA 3R6SA 2ESNA 2EV6A 4HX4A 3R4KA 1KYWA 4L18B 4ENMA 3TO6A 2F5CA 3U9GA 3OOPA 4UVBA 3E5QA 2YPRA 1IZ1A 3E3VA 3F6OA 1ZLKA 2FSWA 5JFRA 2M8EA 1A04A 4RB2C 2XVCA 2HTJA 4P96A 4JQFA 1FBQA 1FBUA 1CF7A 2OQGA 5ED4A 2OZ6A 3I4PA 2IP2A 1V3FA 3QU3A 4YFKF 2A07F 2P6TA 2XAFA 5E8GA 5BS6A 2RDPA 3JSPA 2DTRA 1RI7A 2CG4A 2PFBA 4DQ2A 5LGUA 1RUOA 2FRHA 3L7WA 1G6NA 1XGMA 2HKOA 4F7ZA 2H6CA 1YW9A 4MQ9F 2GWRA 5BPDA 2PMHA 3M8FA 3RJPA 3VOEA 1XGSA 1UCRA 4AIKA 4M6YA 4MTEA 3KETA 3R60A 1P6RA 5LGTA 2KIMA 1T0FA 1VTNC 2KIUA 2IVMA 2F5DA 2LF8A 2A6HF 2EV0A 4KMUX 5IT9K 1BI3A 4L9NA 2MLKA 5HS9A 4RGSA 2FMYA 4L5JA 1Q1HA 3I59A 3BWGA 2GXGA 1U5TA 1OMIA 2CO5A 4I98B 2MA3A 1O7FA 4MGRA 4WXHA 1I5ZA 5LRSA 2XAHA 1PP7U 4K2EA 3IHUA 4IXAA 1LEAA 1LNWA 2MH9A 5FB2A 2XAQA 3GZ5A 3DFGA 1U8RA 3LA7A 2BE5F 1ZGJA 3IRQA 2E1NA 1DPRA 5HS7A 5E8IA 4XSXF 4RGXA 2FEZA 4ASNA 2VOOA 2YSRA 3WTSC 4BAYA 5DD8A 5ICGA 4XLPF 2VT2A 2XRNA 1T39A 1SFUA 3RYRA 4HLYA 3TOBA 4EM0B 5TJJA 4MHGA 1MJ9A 2F2EA 4ON0A 1IN6A 5AIQA 3FXRA 1K79A 4KN4X 1O57A 2L01A 4P55A 2C6YA 1B4AA 3BROA 3KLNA 3T0YA 1HKTA 4A6EA 2W57A 2CYYA 1X3UA 3FWEA 1L3LA 1KU3A 1XN7A 5L3FA 2P7VB 1R1UA 2J5OA 2NS0A 4A6DA 2QBYB 2CW0F 3LA2A 3C3WA 3SZPA 4KIBA 2CQKA 1YG2A 2PN6A 3ZMTA 1RIOH 4IRHA 3HTUA 5LRRA 3F3XA 1YW7A 1U6GA 3GYHX 5CYVA 2J5PA 3FM5A 1IRGA 3DV8A 4A5MA 3ZQ7A 4U0YA 4LGWA 2HZTA 1W7PB 1G4DA 2P8TA 1R00A 5ERIA 2ETHA 3WGHA 5J8CA 1EH8A 3GFMA 1W7PD 1K78A 3JW4A 5HDKA 3WG9A 1ZGAA 3B73A 3FXQA 4BXUA 4PDKA 4EQQA 3I58A 4H0EA 2ZO4A 2VE8A 2UXNA 2LDUA 3C7JA 3TOAA 5DCMB 2JT1A 2ZJ2A 2R3SA 4RAZA 2V1XA 2NNYA 5FFXA 2NYXA 5H6QA 3FXUA 2K02A 4A12A 1KQ0A 3KLOA 3HTSB 4KDPA 4PZJA 1QZZA 5A2QZ 4BQAA 2DO7A 1J0RA 5EEHA 2O3FA 2O8XA 4CO8A 2IT0A 2E7XA 2HWVA 2NRAC 4BHPA 2D2WA 3EDPA 5EEGA 2CSOA 2QQ9A 1XGNA 1YS6A 3GVAA 5ICCA 4UXNA 1ZG1A 4L9JA 4U0WA 5H6RA 1HW5A 2XKOA 3PFIA 4QLCU 3QAHA 4KNYA 4IF4A 5E20A 2DK8A 2CFXA 1BJAA 2ESHA 3J80K 2E7WA 4IRIA 3LA3A 2JSCA 2Q2EA 3GEZA 3KP4A 4IHTA 4EVIA 1D8JA 2XKPA 2Q8KA 4PGHA 3GX4X 1REPC 3JSOA 5D6EA 4ZYHA 2ZCWA 3U2RA 3JAMK 3T8TA 1R58A 2RV8A 1RNLA 1IRFA 1LEBA 3T5XA 2ADUA 3VEPA 2HTSA 3NEUA 3PQJA 1P4AA 1ZG3A 2DQLA 1ONVA 4WK8F 3F6VA 2IA0A 3F8FA 3GF2A 2R7DA 5LGNA 3LAJA 4AWXB 4Q4ZF 5LHHA 1F4KA 1B9NA 1U3EM 4FT8A 3WTZA 1BBYA 5FD6A 1TNSA 1XGOA 2V6CA 2AXLA 2ELHA 5H20A 1T2KA 2HR3A 2RVCA 2ZXJA 2RQPA 4KICA 3WU0A 1YO5C 2VOPA 3WU1B 3JTHA 1WI9A 3HOSA 4KIFA 3KP3A 1ZRDA 3F23A 1FP2A 4EJVA 1STZA 3R0JA 2QYOA 2LSOA 2W84A 5BPIA 4A0ZA 2ZNYA 2HYFA 2STWA 2K4JA 5FFZA 2VXZA 2A5YB 2PG4A 1L0OC 3KP6A 1GXPA 3QPTA 3HIFA 3KP2A 2WV0A 1YQAA 3ZPLA 4OU0A 2ACJA 2DPUA 1JHFA 4DNCA 5CVIA 4JBAA 4EGYA 4L5IA 2W25A 4FX0A 5BOXA 4QWQA 3BDDA 4U7BA 1BM9A 5CJ9A 4Y15A 2NNNA 1USTA 2RNJA 3GZ6A 5JI6A 2V9VA 2OA4A 2UZKA 5DV5A 3V8KA 4LLLA 2Z33A 2FNPA 4UNOA 4BH9A 3SHFA 2GXBA 5FO5A 5FLXK 2A61A 1FYMA 3RKXA 3CO7C 4Q5SF 3ULQB 4GYIA 1EV7A 4N0BA 4RAYA 5DEQA 4G7HF 4HZFA 3F22A 4CDGA 5D5VB 2HQNA 1O3RA 1U78A 4HDVA 1O3SA 1XD7A 3K9TA 2CGPA 3KFWX 4EJTA 4OIRF 3SXYA 1J2XA 4WF2A 4M9ZA 4HAMA 1XMKA 1P4WA 1TW2A 2EB7A 1K6OA 3FHZA 4UVAA 3VB2A 1LQ1A 2XGXA 3C1DA 5F64A 4S04A 4ZYDA 4GCVA 3H92A 1FZPB 2A6EF 1QGPA 1JHHA 3EQLF 4GGGA 3E6DA 1FNNA 1J5YA 3HSFA 4BYYA 3MEXA 3WE2A 3IKTA 4HYEA 3TQNA 5DD4A 1K7AA 4CHUA 2QQBA 2L4MA 4EV0A 3CUQC 5JHUA 5ICFA 3EETA 2IRFG 1S6LA 3D5LA 4RS8A 1XCVA 4YFNF 3ERED 1F9NA 1R1VA 2G7HA 1SD6A 3K0LA 4ZYEA 2M1BA 5DDGA 3GW2A 4G7ZF 1J9IA 1V4RA 1SMTA 4PGGA 1QZYA 2FA5A 1O3QA 2WTEA 4FHTA 1ZN2A 2HFHA 2DBBA 1BI0A 2QWWA 1OYWA 1DUXC 1BOAA 1IN5A 3OV8A 3RDIA 3R61A 2V1UA 4ETSA 2ZMEB 2VE9A 3CUQB 1T98A 3TGNA 2EFNA 4EJUA 3TKYA 3M7GA 2UXXA 4BHBA 2XAJA 2VC0A 5L3BA 1U5TC 4LG0B 4IJAA 4RGUA 2RN7A 1I1SA 2OQRA 1MJAA 2OD5A 2FE3A 2GA1A 2QBYA 2VBYA 3V8JA 4BHCA 5FGMA 5D8KB 1HKQA 1BIAA 1R23A 3J80Z 5D5UB 2XASA 3KEOA 1J7KA 4G8XA 4O5VA 1BC8C 3ELKA 4L9VA 1WQ2A 1KQ9A 2IJLA 2ISZA 1WSUA 1E2XA 1Z91A 1W7PA 3HSEA 4ENKA 3LFKA 2A3SA 1NHAA 1XSXA 1S7AA 1TBXA 1AWCA 1IN7A 2OAZA 3M9AA 2STTA 4HX7A 5K5OA 2AS5F 3P9KA 3QP6A 1BI2A 3LQRA 3IL2A 1FPQA 2XUBA 5K5RA 5DCMA 3E97A 1I1GA 1F5TA 1BIBA 1ZHFA 2PBIA 2DPDA 3WTUC 2O03A 2KJCA 3HUGA 2VBWA 3P9IA 5LEJA 3IC7A 2K27A 5AONA 2FQ3A 1IUYA 1T6SA 3J81K 3E6MA 1H0MA 3MCZA 3I64A 2JPCA 4I09A 4D0PA 2PMUA 4KA4A 1TQIA 2GIVA 5JR3A 1C0WA 3DP7A 1R36A 1TNTA 3GFIA 3O2PE 2LNBA 3EUHA 5LHGA 4HW0A 1UB9A 3B02A 1GXQA 2TDXA 1Z05A 3I54A 2QZ8A 4AD9A 1P4XA 3ZN1A 4AIHA 2FBHA 1WWXA 1OPCA 3D0SA 4G94A 4CGZA 3TDZC 4MNUA 3FMSA 1FOKA 2D1VA 3L09A 2R7FA 2DQRA 5E18F 5TRDA 1XDUA 2Z3YA 4HOBA 4I02A 4LD5A 1KU7A 1CGPA 1B1BA 2HQRA 2QQAA 5E1ZB 1IXSB 3WTXC 1Z1DA 4I2OA 1AOYA 3V7CA 4Y17A 2OU2A 5HLGA 4OMZA 4HDUA 3HRMA 1IF1A 3LSTA 3L00A 4XRFA 2Z9OA 2MBFA 4A5NA 4G9YA 4KIGA 1IW7F 4MEYF 3RI4A 3MWMA 1QQIA 3GUDA 1JXSA 3KP5A 4A0XA 1OYIA 1TLHB 1ULYA 2IA1A 4WX9A 4M71A 5E1WA 3WE3A 1HW1A 2L54A 5LBQA 1IXCA 5D4SA 4HF0A 3RPUA 4GYGA 1D8KA 1G3WA 4HV6A 4CICA 5HDGA 4Q48A 2KJBA 4S05A 2H6BA 4G6QA 1ZARA 2QVOA 1RZ4A 2L3DA 1ON2A 5CVRA 5HLHA 4XSZF 2GA2A 2YX4A 2OBPA 3ZMVA 2EWNA 3NRVA 2HEOA 2GQQA 4A2UA 2HKXA 3VODA 3L2CA 4OIPF 4ZZLA 2YU3A 3MAJA 3REOA 4B8XA 3C18A 1O3TA 1D5VA 4R8HA 3EYYA 3DEUA 3VFZA 2A68F 2P5LC 3SQNA 3BPVA 2DK5A 4HF2A 4IPAA 1KGSA 4G7OF 3K2ZA 2A69F 3ABUA 1LDDA 4LB5A 3J7AO 1J75A 3ABTA 2MLGA 4LLGF 3H3UA 2GAUA 2JPBA 1MZBA 2M30A 2MD5A 4EGZA 4HQMA 1SD7A 2YR2A 1YW8A 5DUKA 5IT9Z 2KKOA 3ZMUA 1XSVA 3SZTA 3LWFA 1GVJA 5F6FA 4AVPA 1MDMB 5IT3A 3BJOA 3FMRA 4O6JA 2PI0A 1PUEE 3GXOA 2P6SA 2G7UA 4WXDA 5L3DA 4MQVA 3F21A 1FY7A 3WODF 4FX4A 2CWEA 3K1MA 2DT5A 2PEXA 4ENJA 1DDNA 1ODDA 3BJAA 1TQMA 1U2WA 3I0TA 4HLXA 2RGVA 5HOOA 1QBJA 2QENA 1PDNC 2VODA 1G3SA 4I0AA 2F5EA 4UVCA 2EFPA 2IW5A 2FOKA 2EFQA 4YFXF 2VN2A 4WCGA 1XDSA 3DKWA 4L9TA 4OINF 1ZLJA 2IPQX 2JZYA 5BQTA 3BZ6A 3P9CA 3KEQA 4HV5A 4Y13A 1D3YA 2W24A 1FSEA 1G3TA 4PCQA 2FMLA 3MZYA 1YTYA 1HBXG 3M1EA 4NB5A 1UFMA 4P5OA 1FC3A 3WGIA 1XCBA 2Z5UA 3RIRA 4L0ZB 4KT5C 2BYVE 2ZFWA 3ML6A 3IKVA 3S2WA 3FX3A 2JRTA 3WTWC 2EA2A 1S29A 5E17F 2K86A 3CLOA 1SFXA 3HSRA 2WC2A 3WTVC 4R1HA 5HS8A 2O61A 5J8FA 3LQQA 1SMYF 1HSJA 4YG2F 2FNAA 4WWCA 1SAXA 4HF1A 4YIFA 2M5WA 2M45A 4M73A 1MKMA 3IWFA 2EFOA 2K7LA 3ZMDA 2HDCA 1DPUA 1UHMA 1FYKA 1KA8A 1MGTA 1FLIA 4B09A 3J81Z 1XSDA 2FU4A 4Z2YA 1LDKB 1TTYA 3ECHA 1J59A 5D5WB 1SD4A 5DCFA 2ZMEA 1R22A 3CUQA 4IVNA 5LHIA 3RKYA 4EJOA 1FYLA 3QP5A 4LG0A 2B0LA 1P92A 5CVJA 3WTTC 1I6XA 3ECOA 3T1BA 4UUVA 4O3MA 5HDNA 4LJZF 2Y48A 1TW3A 3CUOA 3MFKA 1Z7UA 4N9IA 4LFUA 3SFZA 4RB1A 1BN5A 5KVRA 1ZREA 4HQEA 2FBKA 3O6BB 5HLIA 1H9TA 4A0YA 1CF7B 5ILUA 3LAPA 2HYGD 4LK0F 2QM3A 1SFEA 3FF5A 3FZVA 1GHCA 4CZZA 1ZAOA 2Q0OA 1HXDA 1USSA 1SD5A 1BI1A 1F1ZA 2X0LA 4G6DA 1R5HA 3KZZA 4ESFA 4KFCA 4GXOA 3W6JB 1R7JA 2ISYA 4UV9A 1OKRA 1HQCA 1PP8F 1IN4A 1QPMA 1OR7A 5DYMA 2ZNZA 3P7NA 4P9FA 2BEOA 1XB4A 1ZRCA 1W4MA 3G3ZA 3HRSA 3ZN0A 3JAMZ 3RTRA 3I53A 4EMSA 3K1PA 4M9SA 2OZUA 2KIFA 3RKWA 2BGCA 5K5QA 2ZKZA 1HKSA 1ZH5A 3F72A 3F8NA 3KE2A 4N9HA 5KK1A 2FF4A 3T8RA 3I59B 4YIIA 2WWYA 1LDJA 1U5TB 1EH7A 2YX7A 4UV8A 2COMA 2XV4S 1LJ9A 2L4AA 4L0YB 1ON1A 4NQWA 5LLQA 2QUFA 2XAGA 1YLFA 2VC1A 1YFHA 2H94A 4P9UA 5ILVA 1LVAA 2XHKA 4M72A 3E5UA 4ESBA 4KMFA 4Q47A 4GO1A 3I71A 2P7CB 3I5UA 3KP7A 2RC4A 1W5SA 1HSTA 3JTGA 3F8CA 4I01A 4WXCA 3DF8A 2V79A 3GFLA 3F8MA 3DQVC 1KYZA 3TO7A 3HHGA 1Z6TA 3QRFF 3U1DA 1XMAA 4CXFA 1YS7A
chains in the Genus database with same CATH superfamily
1W0TA 4NHJA 2H09A 2EJRA 4XLFA 2DU9A 4I0BA 2OTJI 3NARA 1RETA 3V4GA 1KQ8A 2EFWA 4BNCA 1VNDA 2XIGA 3DEWA 4H4KC 3TDUC 3BP8A 4MTDA 3BQZA 3CDLA 3BTIA 2MH2A 2F5FA 3FKJA 3GWZA 3ISPA 4LIUA 3ZGKA 2BBYA 2ME6A 3CMAI 4NNJA 1JGGA 2DXIA 2M87A 3OOUA 1DP7P 3K1NA 3EYIA 3OYLA 3RPQA 4GDFA 2BV6A 2L7FP 3Q9SA 2CUFA 1Z9CA 2A5WA 4XOTA 2KZVA 1BL0A 2OUMA 4E7ZA 4XLCA 2DFFA 3R0AA 2PJPA 5CVVA 3SEZA 3M8EA 5B5EC 5D5XB 2LOOA 3HXLA 3HRUA 3ROUA 2DT7B 1FOYA 1VI0A 2VT3A 5CPRB 2H27A 1B6AA 3EUHC 2CFOA 1X4PA 2DOAA 5AIPA 1B72B 2K4BA 4FE4A 1LFPA 2X6XA 3HB9A 4A3EJ 4CYDA 1QNTA 3JCUC 2RKHA 3NQOA 3ZQQA 2R92J 2LRDA 1O7LA 2DLLA 3BTLA 3BOQA 4CCOA 3QQAA 3RYPA 2Y75A 3CJQB 3H5NA 1ZRFA 5ICEA 1Z0XA 3PNVA 2R5YB 5F1JA 2HS5A 5HODA 4TV7A 4B1RA 4M9XA 1S7OA 1UELB 2GZWA 4BXFA 2DT6A 1ORKA 3QPHA 4E7SA 4JP0A 3VYRB 2FXAA 5FLXZ 3CMEI 3ZQFA 2D1HA 3MKWB 5IY5H 3CC4I 3LSPA 4XBFA 2CU7A 3ZP5A 4AIDA 4XONA 2LR8A 2ZSIB 1FMVA 2LBFB 2H1LA 3TBIA 5D6FA 4XN3A 1Y1VJ 4PSWA 1YOVB 3KZYA 1YYVA 2E1CA 3CC7I 1K78B 2VJ5A 5HVQC 2LY9A 3EUKL 3H9QA 4HX8A 3BQYA 4KN7X 5J6XA 1MW7A 3GLXA 4OMYA 5FLMJ 1MJBA 2LF7A 2Y2ZA 2Y69H 4KT6A 4M3EA 3QU6A 2M34A 3OWTA 2O0YA 1KU9A 5KNLA 2NAZA 2WV1A 3CJRB 1R1TA 1JGSA 1IN8A 4B3XA 1HA8A 3K4CA 2F5VA 1IAWA 4PJ0C 5M5WJ 5GADJ 1R4NB 4R79A 2XROA 4ENNA 3A1YA 5BMZA 1IC8A 1QO0D 2V6EA 3QOPA 2Z99A 4AYBA 1EH6A 2Z2SB 1ZYRF 1W5TA 1JE8A 2HVSA 4U0VA 1FT9A 4EJWA 3WTYC 3BR0A 4HBLA 5GAHJ 4ESJA 2O6GE 2VKDA 1A31A 2X4HA 3BZCA 1ZR4A 1FX7A 3L9FA 4MIMA 2EA4A 2JN6A 1T38A 1ZR2A 3L1PA 4ZH4F 2V1NA 1GVDA 3DPTA 4ZC3A 4BJ5C 2LH9A 2DI3A 2HOEA 2XB5A 4IEJA 2DJIA 3ZMZA 4E4HA 5L3CA 1I27A 2M4GA 3SDBA 1B9MA 1N78A 3HHHA 1MDMA 4M6XA 3LSGA 4PFOA 3O3KA 1T95A 3V7SA 2CV1A 4OIOF 4EM2A 4KUMA 2DODA 4IOAF 3H9GA 2E5ZA 1UHWA 4U7DA 3Q5FA 3BJ6A 3KCCA 4XM3A 3OYDA 4OOIA 4ZDOA 3HYIA 3N97A 1Y39A 3I55I 3W6KB 3OY9A 2EV5A 3CJNA 4V19K 4LLNA 1FTTA 3E5XA 1YIOA 1FWZA 2H1KA 3BTJA 2PQ8A 2D5VA 3DPLC 2KMUA 1ZG5A 3PJRA 1IXRC 3V8LA 3N4MA 2P4WA 1R5GA 3GO5A 5CVUA 4EM1A 1FSHA 4MEXF 4II2A 1QHGA 1KU2A 2DW4A 2G9WA 4XLNF 5D8LB 4BDYA 1E3HA 4Y4RA 4BJTA 5LEKA 2NS7A 2V26A 3Q9VA 1D0XA 4UHTA 3U21A 3IRRA 1MD0A 4OIQF 3F8BA 4ZYGA 2IGOA 4OWRB 5FD5A 3E7LA 4IRGA 2FQ4A 4Y7NJ 1RUNA 2LY2A 2KIQA 1Y0UA 5CLSA 2ZB9A 2CUEA 3HOTA 2Q2EB 3NWSA 3VSLA 3BPXA 3DBRB 2LREA 2W85A 2BXZA 3K6GA 2VPLA 3OIOA 2L7KA 1RPWA 2KISA 3E6BA 3TP3A 3QODA 1Z77A 6PAXA 4KYWA 4BEHA 4A3FJ 3CCLI 3FHNA 1DU6A 2EZKA 2WAQA 4JK1X 4LB6B 2MABA 2UWMA 4B43A 4IHSA 3MZHA 2OV7A 2JMWA 1O4XA 1ETYA 3NWTA 1HOMA 2DFIA 2QSFX 4M74A 5D4RA 1S3JA 2JTVA 3QYFA 4PUSA 5K7FA 1WKMA 4U88A 1FP1D 2MC3A 2DAOA 3PNTA 2W4SA 1HDPA 3H3ZA 3E6CC 5GTIC 2DA6A 3IWZA 2LKPA 5L3GA 3H9JA 4YELA 5K1YA 3NAUA 3V7RA 1XC5A 2PLYA 3HOXJ 3GTMJ 4ZZDA 1MSEC 2VQCA 4LK1F 2F4OB 1MBKA 2L0KA 5KHDA 2D45A 4Y33A 3KX2A 3HJEA 1OYYA 2K5CA 1E17A 1H9GA 2AQFA 2QLZA 2F6CA 2CUJA 5J40A 2GBYA 3G73A 3PQKA 4I7HA 4RB0A 5FKLA 5ILSA 4ZYAA 3GMEA 3K4JA 2P5VA 3TO9A 5DUIA 4D5CA 1T08B 3GCMA 2JWTA 1NK3P 2R0QC 3DTKA 3IH2A 2JUCA 2HGCA 1VFCA 4HA8A 5L3EA 4AIJA 3COAC 2VONA 4E7KA 3MQ0A 4DGWB 5J1RA 1K4TA 3GFJA 1BC7C 4V2GA 3IV5A 1LFBA 5K7ZA 3HRTA 2HXOA 1Z6RA 2IGNA 2IA2A 3BY6A 3MVPA 1KONA 3MN2A 1OISA 2E2JJ 2P5KA 3AL0C 2KRFA 4RB3C 3S3NA 4E7HA 5A2QK 5JVTA 1TQPA 3K69A 2VBZA 3FMQA 4P1WA 1TWHJ 2L02A 2L7MP 2QGUA 2MSYA 4XLAA 4LMYA 2L2OA 2VBXA 5F1RA 2DDBA 5E1XA 4RGRA 2FBIA 4IX7A 2F48A 2Y0MA 3BG3A 3O8HA 2X6YA 1FBSA 3CO6C 3GTKJ 1WRJA 5FLVA 3TEDA 3AAFA 1G3YA 1ZGWA 1S8NA 4CYCB 3CDHA 1VQ9I 3ZMSA 1WVRA 4KISA 4F91B 1LB2A 1HW2A 3BTCA 1P2FA 2V1DA 4E70A 3WGGA 1GV5A 3DXJF 5C44J 2EH3A 1MMDA 3FM3A 1B59A 2FX0A 2EIMH 1IV6A 4DZJA 2ZBKA 2KFDA 3DPUA 3S17J 4HNUA 5FROA 2EK5A 3CTAA 3LMMA 3R6SA 3GTGJ 2ESNA 2EV6A 4HX4A 4PJLA 3R4KA 1KYWA 2DCEA 4L18B 4ENMA 1D1AA 3TO6A 2XDVA 2F5CA 1P7IA 2CV0A 3BR5A 3DCFA 4ZTJA 4XRSG 3U9GA 2LLKA 3OOPA 1F43A 3Q0VA 1IDZA 3E1SA 1P9QC 4UVBA 3K70C 3E5QA 1AHDP 2YPRA 1IZ1A 1UG0A 3E3VA 3BG7A 3B6CA 3W2AA 3F6OA 1ZLKA 2FSWA 5JFRA 1I39A 1T8IA 2M8EA 1W36D 1A04A 4XNFA 1FEXA 1U9NA 5FKKA 2DMQA 4NDLA 4RB2C 3TMOA 3HOUJ 2XVCA 2HTJA 1B8IB 3FBIB 2K3PA 4P96A 2VKHA 4JQFA 1FBQA 3ZQCA 5EEAA 1FBUA 1T33A 1CF7A 2OQGA 5ED4A 2OZ6A 3I4PA 2IP2A 2EPFA 4PK4A 2VXDA 1V3FA 3QU3A 4YFKF 2A07F 2P6TA 1TT0A 2JVGA 2XAFA 3BR6A 3M1CA 5E8GA 3RKQA 5BS6A 2DMNA 1K61A 4IHVA 3RZOJ 2RDPA 1G59A 2FUG2 3JSPA 2DTRA 1RI7A 4AC0A 1CQTA 2CG4A 2GXAA 2PFBA 4DQ2A 5LGUA 1RUOA 2FRHA 3A01B 2VUMJ 3DEEA 2ZXWH 3JRHA 3L7WA 1G6NA 1LE8A 1I6HJ 1POGA 1XGMA 2NS8A 3L2RA 1DP3A 2HKOA 2M0MA 4F7ZA 5E3MA 2H6CA 1YW9A 4MQ9F 2GWRA 3H5RA 3ESWB 2PMHA 3M8FA 3RJPA 3VOEA 2ZMEC 1ETWA 5BPDA 2R93J 4BXXJ 1GDTA 3CESA 1XGSA 1UCRA 4AIKA 2XPUA 2K40A 1A6IA 2BW3B 1A36A 4M6YA 4MTEA 1GV2A 3KETA 3R60A 2E19A 1P6RA 2XF5A 2K9NA 5LGTA 2KIMA 1T0FA 1Z3YA 1VTNC 2KIUA 3LSMA 3PL8A 2IVMA 1OCPA 2F5DA 2LF8A 4JYKA 3HOYJ 2A6HF 4CA0A 2E5NA 2EV0A 5IP6A 4KMUX 5IT9K 1BI3A 2R7VA 4L9NA 1SEUA 2MLKA 5HS9A 1R4MB 4RGSA 1OCCH 4ITVA 2FMYA 4L5JA 1Q1HA 3I59A 3BWGA 5E3NA 2GXGA 1U5TA 1OMIA 5H2FC 3AG3H 2CO5A 4I98B 3L2UA 2RREA 3I56I 2PMZN 3FIWA 2MA3A 1O7FA 4MGRA 4XQFA 4KITB 4WXHA 1I5ZA 4PSXA 4E6KG 5LRSA 2MC4A 1TT5B 2XAHA 1PP7U 2DA5A 3OSFA 4K2EA 4JOMA 3IHUA 1QRYA 4IXAA 2DOFA 1LEAA 1D5YA 2JSPA 4BQNA 1LNWA 1JUPA 2MH9A 5FB2A 2XAQA 1SC7A 3GZ5A 3DFGA 1U8RA 3F0CA 3ERMA 3BCBA 1OQYA 3LA7A 2BE5F 1ZGJA 4FISA 3IRQA 2V4JC 2E1NA 1DPRA 5HS7A 1RR8C 2DYSH 2DTZA 5E8IA 3QYBA 4XSXF 4RGXA 2KZGA 2M2EA 4CH7A 2FEZA 3D5RC 1SVMA 1PUFA 2V9KA 4ASNA 3AKZA 2VOOA 3LFUA 1MBFA 1AA7A 2YSRA 2NVUB 2XGDA 3WTSC 4GRIA 4A3LJ 4BAYA 3A03A 4MFDA 3W3CA 5J47A 1VQNI 5DD8A 4ZTFA 1IRXA 5ICGA 4XLPF 2HDDA 2VT2A 1K6YA 2XRNA 4RBOA 1T39A 4BUPA 1SFUA 3RYRA 4HLYA 1ZQ3P 1OR7C 3K4KA 3TOBA 3CP8A 4DYRA 5TJJA 4MHGA 1MJ9A 2F2EA 4ON0A 4EM0B 1IN6A 3BG9A 3C2HA 5AIQA 2XC7A 2OF7A 5JLXA 3FXRA 3VYSB 4KN4X 1O57A 1X2NA 2WY7Q 1K79A 3CMYA 2L01A 4P55A 2C6YA 1ZK8A 1B4AA 3TW7A 3ZQGA 3BROA 1TWFJ 3KLNA 2V7FA 2ID3A 3T0YA 1YX3A 1HKTA 4BE2A 4HNTA 4A6EA 2W57A 2CYYA 1X3UA 3FWEA 4II3A 2TCTA 5IYBJ 3ZRGA 3S1NJ 4C3IJ 4A3MJ 1L3LA 2BY2A 5FJ8J 1KU3A 1XN7A 3K4NA 5L3FA 4IHXA 2P7VB 4BU2A 5J1YA 1R1UA 2J5OA 2NS0A 1LFUP 4A6DA 2QBYB 1S7EA 2CW0F 3LA2A 1YITI 1EA3A 2UUZA 2R7OA 3C3WA 1YIJI 3SZPA 4KIBA 3DLLF 2CQKA 2F4IA 2VL8A 3ONQA 1XMXA 1YG2A 2PN6A 3ZMTA 2VPRA 3H36A 5EG0B 1B72A 1RIOH 3UR3C 1WCMJ 3CCYA 3OR1C 4IRHA 3HTUA 3H3VK 5LRRA 3F3XA 1YW7A 1U6GA 3GYHX 4HG2A 4NBQA 3FXKA 4X6AJ 5CYVA 2J5PA 2HQ5A 1D1CA 3FM5A 1K4SA 1IRGA 3DV8A 2QKLB 2ECBA 2IAIA 4A5MA 1UG2A 3ZQ7A 5F0CA 3DLAA 5J1UA 1TWGJ 3PUFA 4U0YA 3ZOBA 4LGWA 4NC8A 3S16J 2ZJPF 2HZTA 2VJ4A 1Z3XA 1W7PB 4A3IJ 1G4DA 2P8TA 1R00A 5ERIA 2ETHA 1VQ5I 3WGHA 2LBFA 5J8CA 4MO7A 3WU2C 2EILH 1EH8A 3GFMA 3PSFA 1W7PD 5F08A 5DTDA 2CQXA 1SVLA 1K78A 2E34A 3JW4A 2KL4A 5HDKA 2XF6A 1Y0NA 2XAUA 2YS9A 1DGWY 1ZGAA 1ENHA 3WG9A 3K4MA 3B73A 3FXQA 3KIOA 4BXUA 4PDKA 1OFCX 2EIKH 3DBHB 3WHBA 4EQQA 1RR7A 3I58A 3BT9A 1OLTA 3W2WA 3SFIA 2ZJRF 1TP4A 4H0EA 2ZO4A 1SFOJ 2R7ZJ 2VE8A 2UXNA 2LDUA 3TL4X 3C7JA 3TOAA 3S14J 2XB0X 5DCMB 3HC7A 1U9OA 2JT1A 2ZJ2A 4C30A 4JX6A 5J4VA 1MBJA 2HYJA 2R3SA 3FXOA 4RAZA 2V1XA 5IP7J 2E1MC 4BKXA 5IYDJ 2NNYA 4PFPA 3MKLA 4DW6A 5FFXA 3RQIA 3HUGB 2NYXA 5H6QA 3FXUA 1VQPI 1R9TJ 2K02A 4A12A 3IH3A 2EZHA 4XR6A 1KQ0A 3KLOA 4B3AA 3HTSB 4KDPA 4PZJA 1QZZA 5A2QZ 5TISC 2BHZA 4BQAA 2DO7A 1J0RA 2E35A 1HC8A 5EEHA 3A0BC 2O3FA 4DIQA 2O8XA 2Z1DA 4CO8A 4DBQA 4RM3A 2IT0A 2HVRA 3OS1A 2IS4A 2E7XA 2HWVA 2NRAC 4XIDA 4BHPA 2D2WA 3EDPA 2HOAA 5HNHA 5EEGA 2CSOA 2QQ9A 1XGNA 3QWLA 2ZC2A 5GAGJ 2DYRH 4E7LA 1WHUA 2BXYA 2JA7J 1YS6A 4BDZA 2LKSA 1WPKA 3GVAA 5ICCA 3PIPF 4UXNA 1ZG1A 4XLHA 4L9JA 2VIXA 2VLAA 4U0WA 2JUGA 5H6RA 2CV2A 1HW5A 2XKOA 4XMYA 2E1OA 4XICA 3PFIA 3S32A 1G8XA 2E1MB 3QAHA 4QLCU 2N8GA 4X0GA 4KNYA 4IF4A 5E20A 1M1EB 2DK8A 5M5YJ 2NVTJ 4PJMA 2CFXA 1IV8A 1BJAA 2ESHA 3J80K 2NXNB 4J19A 3GTOJ 2E7WA 4IRIA 3LA3A 2JSCA 2Q2EA 3MKYB 3GEZA 3KP4A 3CF5F 2L5QA 4IHTA 4EVIA 1D8JA 2V9PA 1IO2A 2LK2A 2XKPA 2XSJC 1DQUA 2Q8KA 1LUJB 4PGHA 2PMZA 3OIPA 3GX4X 1REPC 3JSOA 2NVXJ 1S9HA 5D6EA 4ZYHA 2ZCWA 2XPVA 3U2RA 3Q0WA 1BR1A 3JAMK 5M3MJ 2NOJB 2B9SA 1W5CC 2GOMA 3T8TA 4UUTA 1R58A 2RV8A 1RNLA 1IRFA 1WJCA 1LEBA 2OCCH 2ADUA 3K4BA 3T5XA 2HDWA 3VEPA 1HCRA 2HTSA 1WJDA 3S93A 2XSDC 1IDYA 1A35A 3NEUA 3PQJA 1P4AA 5GAEJ 1ZG3A 2DQLA 2PJRB 1E0EA 1X3ZB 2HOTA 4DYCA 1ONVA 3VSKA 5K7HA 4WK8F 3F6VA 2IA0A 1EJ9A 3F8FA 3GF2A 2R7DA 4B44A 5LGNA 3LAJA 4AWXB 4Q4ZF 5M3FJ 1HLVA 5LHHA 1FMWA 1F4KA 1B9NA 2E71A 3H0DA 4XOPA 3OYJA 1U3EM 4FT8A 4DOZA 3WTZA 1BBYA 3OR2C 2R7RA 5FD6A 2R4GA 1Z67A 3S8PA 1TNSA 1XGOA 2HZDA 2V6CA 2AXLA 2LVSA 2ELHA 3D5SC 5H20A 4DBRA 1T2KA 5C4XJ 3HGGA 4HSRA 4XKVA 2HR3A 2RVCA 2ZXJA 2RQPA 4KICA 3WU0A 2JA6J 1YO5C 2VOPA 1BR2A 2FOWA 3WU1B 4ABZA 3OYHA 4IHWA 3S2HJ 3X2QH 3JTHA 1R5ID 1WI9A 3HOSA 4KIFA 3KP3A 2AQEA 1ZRDA 3F23A 1FP2A 4EJVA 1TWAJ 1U0JA 1IJWC 3OSGA 2CH0A 4N4NB 2NOGA 5LD2C 1STZA 4MLOA 5DS9A 3R0JA 2QYOA 2LSOA 2W84A 5BPIA 4A0ZA 2ZNYA 3DU6A 2HYFA 3KZIC 2K9QA 2STWA 2K4JA 3OYNA 2VQLA 5FFZA 5TGTA 2MG4A 4CYCA 2L9VA 2VXZA 4C2MJ 3FXMA 4XRMA 1NK2P 2A5YB 2PG4A 3I3LA 1L0OC 3KP6A 3UNGC 2VJIA 1UJ8A 2GM4A 1GXPA 3QPTA 3JRGA 3HIFA 5B3SH 3KP2A 2WV0A 1EF4A 1YQAA 3ZPLA 4OU0A 3VYUB 3JREA 2ACJA 2X51A 5FRMA 2A05A 2HNHA 2DPUA 3HKZN 2NVYJ 5EDNA 1V5FA 1JHFA 3S3OA 3CF2A 4DNCA 3CDIA 5EGOA 5CVIA 4JBAA 2DMPA 4EGYA 4QTRA 3G2BA 4BQQA 4L5IA 2W25A 2LY1A 4FX0A 3K4LA 5BOXA 4BE1A 2QKMB 4QWQA 3BDDA 4U7BA 4BBSJ 1BM9A 5CJ9A 1WJFA 2QSHX 1Y1WJ 4Y15A 2NNNA 1USTA 2RNJA 2R7TA 3GZ6A 3TP0A 5JI6A 4RAFA 2V9VA 2KDZA 4AUXA 4ANJA 2OA4A 4I6ZA 1FIPA 2UZKA 5DV5A 3V8KA 5GTHC 4LLLA 4GFBA 2Z33A 1X2MA 1B8IA 1WJ5A 2YU9J 4L5EA 4QSHA 2FNPA 4UNOA 2HPIA 3PUBA 4X1EA 4BH9A 3SHFA 2GXBA 5FO5A 5FLXK 2A61A 3OL4A 1FYMA 1D0YA 3RKXA 3CO7C 4Q5SF 3ULQB 1E3PA 4GYIA 1EV7A 4N0BA 4RAYA 3U1KA 5DEQA 3VWBA 4G7HF 4HZFA 2PX9A 3MZ8A 4HSTA 1APLC 3F22A 2DA1A 3CCSI 3H1CA 1JKPC 4XKBA 4CDGA 5E3OA 5D5VB 2HQNA 3A01A 1AU7A 2XF7A 2MD0A 1VF9A 1O3RA 3V42A 4PJJA 1U78A 4HDVA 1O3SA 3M8JA 1XD7A 3L2WA 2NVQJ 4I99C 3K9TA 1G2HA 1VQ4I 2CGPA 3KFWX 4FE7A 5KCMA 2BW3A 4EJTA 4OIRF 3ZR8X 3S15J 3SXYA 1J2XA 3AL0B 3A02A 4WF2A 4YRVA 2O5RA 4M9ZA 2BY3A 2Y31A 4HAMA 4B48A 1R71A 1UMQA 2ECCA 1XMKA 1P4WA 2FD5A 1TW2A 2EB7A 1NTCA 1K6OA 3GTJJ 3FHZA 1MMAA 4UVAA 3CZ6A 3VB2A 4FQGA 1LQ1A 3SYTA 1QA6A 2XGXA 3C1DA 2W1OA 1UAAA 5F64A 4S04A 4ZYDA 2IEKA 1X1DA 4GCVA 4CCMA 2VI6A 3DTEA 1LKXA 3H92A 1FZPB 2A6EF 2R5ZB 2LKXA 2X6OA 5C3EJ 5E79C 1BW5A 3OMYA 1QGPA 1JHHA 3EQLF 4GGGA 3E6DA 5IOZA 5EYRA 1WZ2A 1FNNA 2W48A 5GPCA 4UUSB 1J5YA 1N25A 4M6VA 4RM2A 4UB6C 3HSFA 4BYYA 3MEXA 3WE2A 2P0WA 3ABLH 3IKTA 2CW8A 4W97A 1J09A 3HEFA 4HYEA 3TQNA 5DD4A 1K7AA 4CHUA 2QQBA 2L4MA 4EV0A 3CUQC 4D5FA 5JHUA 1Y8QB 3K70D 5ICFA 3EETA 3OYBA 2IRFG 5J4YA 3RCOA 1XS9A 1S6LA 3D5LA 1V5EA 1OJLA 4RS8A 1XCVA 4YFNF 3ERED 2WADA 1D0ZA 3H5AA 1F9NA 1WH7A 1R1VA 2BOLA 2G7HA 1SD6A 2O7OA 3K0LA 4ZYEA 5GP9A 2M1BA 5DDGA 2MYSA 2XRLA 3IH4A 1RKWA 5JLWA 3GW2A 1AKHB 4G7ZF 1J9IA 1V4RA 1SMTA 2DA4A 4PGGA 1QZYA 2FA5A 3DU5A 1O3QA 2R7WA 4A69C 2IGKA 2VJJA 2WTEA 5FKOA 2IS6A 4FHTA 1ZN2A 2RQQA 2W7NA 1T0FC 2HFHA 2DBBA 2KP6A 2X48A 5FKNA 1BI0A 2X1DA 2QWWA 3H35A 1OYWA 2COBA 1DUXC 1S5LC 1BOAA 1WJBA 1OCZH 3F9KA 5CKTA 1IN5A 3OV8A 3RDIA 3R61A 2A6TA 4HPQA 3J7AY 2V1UA 4ETSA 2ZMEB 2VE9A 3CUQB 1T98A 3TGNA 2EFNA 4EJUA 1YX5A 3TKYA 3M7GA 1PYVA 2UXXA 4E7IA 3HOZJ 4BHBA 2XAJA 2VC0A 3AG2H 5L3BA 4AU7A 1U5TC 5JVGF 1MNEA 2LC2A 4LG0B 4IJAA 4RGUA 2RN7A 1I1SA 3LNQA 2OQRA 1MJAA 2OD5A 5F27A 2FE3A 2GA1A 2LP0A 4HEA2 2QBYA 2VBYA 1ETKA 2ZJQF 3V8JA 4C9YA 4BHCA 5FGMA 5D8KB 1HKQA 1BIAA 1YE9A 1R23A 3J80Z 5EG0A 2EINH 3GZNB 5D5UB 2XASA 3KEOA 3OL3A 3PIOF 1ITYA 4QPQA 2HPMA 1BA5A 3M4OJ 1J7KA 1MIJA 2ELKA 3OYIA 4G8XA 4DZPA 3OS2A 3G1LA 4O5VA 1BC8C 1JJ6C 2F4MB 3ELKA 4L9VA 3VPRA 1EKEA 1WQ2A 1KQ9A 4LITA 2IJLA 2ISZA 1X58A 3HKZA 2VQGA 3A0HC 4XKWA 1WSUA 1E2XA 1Z91A 2MW8A 1W7PA 3HSEA 2E60A 4XLEA 2WB1N 4QIWN 2DMTA 4ENKA 3BLYA 3LFKA 2A3SA 1TC3C 2HOSA 1NHAA 2ID6A 1XSXA 1S7AA 1TBXA 2LTPA 1AWCA 3PNYA 2G0EA 3IP4B 2JA8J 1IN7A 1BW6A 2BY0A 2OAZA 3G1OA 1Y6IA 1MBHA 2M7AA 4CCKA 3M9AA 1D1BA 2STTA 4HX7A 1R6RA 3ASNH 1X4OA 5K5OA 2BVMA 2AS5F 3P9KA 3QP6A 1BI2A 3LQRA 3IL2A 1FPQA 3OYKA 1JUMA 3DTIA 2XUBA 1YI2I 4IL6C 1ZTRA 5K5RA 5DCMA 5CQGA 2JA5J 3CC2I 3E97A 1I1GA 3PO2J 2IBDA 1F5TA 2DDAA 1BIBA 2R7UA 4J00A 1ZHFA 1GUUA 2PBIA 2VKEA 2DPDA 1NG7A 3WTUC 2O03A 2KJCA 1K83J 2M8GX 2VBWA 1WFXA 3HUGA 3IC7A 3P9IA 2K27A 4RA2A 5LEJA 2R5YA 4BE0A 2E2IJ 1S72I 5AONA 2FQ3A 2O9LA 2WAFA 1BOBA 1IUYA 2QQ8A 3QYEA 1VQKI 1T6SA 3J81K 3L2VA 2KLOA 1X1CA 3E6MA 1BJZA 1H0MA 4NC6A 2OC6A 1V54H 2B7EA 1XG1A 5FKMA 3MCZA 1VZ0A 2K9SA 4AVZA 5C4JJ 4M3BA 3I64A 2JPCA 4I09A 5HLTA 3Q3SA 2UV1A 4D0PA 4M3DA 1VQMI 2LFBA 2PMUA 4M3GA 4KA4A 1TQIA 1WGXA 2GIVA 5JR3A 1C0WA 1YJWI 3DP7A 1R36A 1TNTA 3GFIA 3MD2A 3QOEA 3O2PE 1TL8A 2LNBA 2M0CA 3EUHA 5LHGA 4HW0A 5F04A 1UB9A 2HI3A 2HU9A 4NQWB 5JHFA 3JRDA 3B02A 1GXQA 2TDXA 1Z05A 3I54A 4A3KJ 2QZ8A 4AD9A 1YRNB 1P4XA 3ZN1A 4AIHA 2VASA 2FBHA 1N77A 1WWXA 1OPCA 3D0SA 2QA4I 4G94A 4CGZA 2ICWG 1OCOH 1FOXA 3TDZC 1JTYA 4MNUA 3FMSA 1FOKA 2D1VA 3ZXSA 2CQQA 2IGMA 3L09A 3KEYA 2R7FA 2DQRA 1OCTC 5E18F 4CCLA 5TRDA 2IXSA 1XDUA 2Z3YA 4HOBA 4XK4A 4I02A 3DWLE 4LD5A 1KU7A 1U8BA 1CGPA 2LMDA 1B1BA 2HQRA 2QQAA 5E1ZB 3CCUI 1IXSB 3GTLJ 3BG6A 1Q1VA 1Y8RB 3WTXC 2X85A 1Z1DA 4I2OA 5EZHA 5B66C 1W0UA 3V7CA 1AOYA 4Y17A 2OU2A 4OMZA 5HLGA 2WY8Q 4HDUA 3HRMA 1IF1A 1MH3A 3LSTA 2PJRA 3L00A 4BGDA 5HNFA 4OAYA 2LD5A 4XRFA 2Z9OA 2MBFA 4A5NA 4G9YA 2HQAA 4M3FA 1SVOA 3BCAA 4KIGA 4W1UA 1IW7F 2P81A 1N75A 4MEYF 3D1NI 2ZXHA 3RI4A 3MWMA 4YEJA 1JT6A 1QQIA 3GUDA 4G12A 2JJ7A 2KRHA 1JXSA 2CQ7A 1Z7LA 3FKIJ 4FETA 1TWCJ 4RMNA 3KP5A 3CCMI 3BZKA 3OYMA 4A0XA 1OYIA 1TLHB 1ULYA 2IA1A 1YJNI 4WX9A 4M71A 2L9RA 5E1WA 1IRZA 3WE3A 1HW1A 2L54A 3BG5A 5LBQA 3OYCA 1IXCA 5D4SA 1XPXA 3S2DJ 4HF0A 3RPUA 4GYGA 1D8KA 4BACA 2IS2A 1G3WA 4HV6A 1MNMC 2ELJA 1H89C 4CICA 5HDGA 4Q48A 4D7MA 2KJBA 1VQLI 4S05A 4A3DJ 2H6BA 4G6QA 1ZARA 4BBRJ 2YUSA 2QVOA 3E0JB 1RZ4A 2L3DA 2M9HA 1ON2A 5CVRA 5HLHA 1QPIA 3KYCB 4XSZF 2GA2A 3K7AJ 4EATA 3BR3A 2YX4A 3MMYB 3DKXA 3P5JA 1HF0A 2OBPA 3ZMVA 2EWNA 3NRVA 2HEOA 2GQQA 4CUGA 1MBEA 4A2UA 4F3QA 2HKXA 2ZFUA 5KAIC 4XN0A 3VODA 1FTZA 4D7NA 2KPMA 3L2CA 4BQOA 3W6VA 4OIPF 3HOWJ 4ZZLA 2CW7A 2YU3A 2XPWA 2WAEA 4XORA 4CZCA 3MAJA 4U87A 1F36A 1QVTA 3REOA 2I8DA 4B8XA 1E3OC 2RAEA 3FDYA 3C18A 4IO9F 1O3TA 1D5VA 2XGEA 1RESA 3KPHA 4JX5A 4R8HA 3EYYA 3DEUA 1Y56A 5DM7F 3VFZA 2A68F 3HBLA 2P5LC 3SQNA 3RZDJ 3BPVA 2DK5A 4HF2A 1QU3A 1T56A 2EBIA 3LSJA 3O8GA 4IPAA 1KGSA 5B1AH 4G7OF 2CQNA 2DOEA 3K2ZA 3PSIA 2A69F 2CUZA 2X1CA 3ABUA 4C3JJ 2DMUA 5EJCA 1LDDA 3G4SI 1PJRA 4LB5A 3J7AO 5CQEA 3ABTA 1J75A 3RPUD 2R7SA 1LVKA 2MLGA 4LLGF 1VQ7I 2M3AA 3RSNA 3H3UA 2GAUA 3FISA 2WB1A 2JPBA 2ZSHB 1MZBA 4PJNA 1LPQA 2M30A 2Y30A 4CCJA 2BZTA 1MMSA 2KHMA 3I9V2 2MD5A 1PUFB 4A93J 4BL0B 4EGZA 3AG1H 4HQMA 1SD7A 2YR2A 1YW8A 5DUKA 5IT9Z 2KKOA 3ZMUA 4MFEA 1XSVA 2VQHA 3SZTA 3LWFA 1GVJA 1X1PA 3OYAA 5F6FA 3CCRI 4AVPA 1MDMB 5IT3A 1RKTA 3BJOA 3FMRA 3WHCA 1ETXA 3DBLB 4O6JA 1WJAA 3IUOA 2ME0A 2PI0A 2FJ1A 1PUEE 3GXOA 2P6SA 2G7UA 4WXDA 5L3DA 4MQVA 3F21A 1FY7A 1SANA 3WODF 4FX4A 2CWEA 1JKRC 2DFHA 3S1QJ 3K1MA 1KZHA 2OCEA 4G6TB 2DT5A 2JRMA 2PEXA 2K85A 2K9LA 4ENJA 1DDNA 2M4KA 1RRJA 1FIAA 1ODDA 3BJAA 1TQMA 2DA7A 4V2FA 1U2WA 3I0TA 4HLXA 2RGVA 5HOOA 2Y9ZA 3ZQIA 2L7ZA 3CCQI 1QBJA 2KT0A 2QENA 1PDNC 4IQJA 1JUSA 1ETOA 2GIZA 3LOCA 4FTHA 2VODA 4XL9A 1G3SA 1V5GA 2JQ7A 4C2UA 4I0AA 2RNGA 2F5EA 3AG4H 4UVCA 2EFPA 3OYEA 2QEXI 4IKFA 2IW5A 4F93B 2FOKA 4C2TA 2L9SA 2EFQA 4YFXF 4ZDPA 2VN2A 4WCGA 1XDSA 1VQ8I 3DKWA 1DU0A 1JJ8C 1ERDA 4L9TA 5GPAA 4OINF 1ZLJA 2IPQX 2JZYA 3A4CA 4ZDLA 3ZQHA 5BQTA 3HPHA 1WJEA 1ACIA 3BZ6A 3P9CA 2AO9A 5M5XJ 3KEQA 3HDDA 3K10A 3K2AA 4HV5A 4BEHB 1YHQI 4Y13A 1D3YA 2GOXB 2W24A 3SEQA 1FJLA 4BJ6C 4Y52J 3I4MJ 1FSEA 2MGQA 1G3TA 4OAZA 1I3AA 4F92B 4FASD 2R5ZA 1W36C 4PCQA 3CQZJ 4B4CA 2FMLA 3MZYA 1YTYA 1HBXG 3CMMA 1NG6A 3ABMH 3M1EA 2HVQA 4NB5A 1UFMA 4P5OA 3J7YJ 2Y0SN 1FC3A 4UUSA 4YIRX 1UZCA 4BY7J 4BS9A 3WGIA 1XCBA 1XTAA 2Z5UA 3RIRA 4L0ZB 4KT5C 2OPTA 3G71I 2LYCA 1GLNA 2BYVE 2ZFWA 3ML6A 3IKVA 2QF7A 3S2WA 3OS0A 3FX3A 3SZGA 1QZEA 3G6EI 2JRTA 3WTWC 4JX4A 2EA2A 2VB6A 1S29A 1UHSA 3BR1A 5IYCJ 2K86A 3CLOA 5E17F 1SFXA 3GTPJ 3HSRA 2WC2A 1X19A 2BVLA 3EPZA 3WTVC 4R1HA 5HS8A 2O61A 1IUFA 5J8FA 5DM6F 3LQQA 1SMYF 2M7BA 5F0FA 3RQ4A 1V55H 2CS3A 2R7XA 1HSJA 2EZIA 5EGOB 4YG2F 2FNAA 4WWCA 1SAXA 3JRCA 4HF1A 3G1MA 2M5WA 4YIFA 3FK7A 2H8WA 2M45A 1A6QA 4A3GJ 4M73A 3S1MJ 1MKMA 4N4OB 1FOWA 3IWFA 2EFOA 1OCRH 3SJMA 1PVEA 3HZJA 1AKHA 2K7LA 3ZMDA 2HDCA 1XX5A 2AXTC 1DPUA 2MFZA 1UHMA 3HGYA 4RDUA 1FYKA 2XGCA 1KA8A 1MGTA 1QHHD 1FLIA 1GT0C 3ZQLA 1WI3A 4B09A 3J81Z 9ANTA 1XSDA 2FU4A 4RLQA 4Z2YA 2Z16A 1LDKB 5FRNA 1X3WB 1TTYA 1ETQA 3ECHA 1HDDC 1H8AC 1J59A 4B47A 5D5WB 5B1BH 1SD4A 1DGRM 5DCFA 5EF6A 2QSGX 1X1AA 2LG4A 2ZMEA 1R22A 3CUQA 4IVNA 5BNGA 5KAFC 5LHIA 3VDXA 2WA0A 4XKCA 2DJNA 3DKYA 4A3BJ 3RKYA 3OYFA 4EJOA 1FYLA 3JRAA 2CJJA 4EEFG 3QP5A 1MBGA 4I76A 2I5UA 3CP2A 4LG0A 4DJAA 2B0LA 1P92A 3HOVJ 2EIJH 5CVJA 4NC7A 2KDOA 2QCOA 2L9NA 3WTTC 1I6XA 2Y9YA 3ECOA 3FXLA 3T1BA 2X9DA 4UUVA 1MMNA 3M3YJ 4O3MA 5HDNA 2EQRA 4AM3A 3H0GJ 3LSKA 4LJZF 2Y48A 4LOCA 1TW3A 1I3QJ 3CUOA 3HPGA 1W1WE 3MFKA 1Z7UA 3A2KA 1SFKA 4N9IA 4LFUA 3SFZA 4RB1A 4F52A 2JK3A 3QPSA 1BN5A 1QVUA 2O8KA 3C2GA 1VQOI 3UKGA 2JA2A 5KVRA 3OIQA 2EZLA 3CJTB 1ZREA 4HQEA 4UY8I 2FBKA 3O6BB 5HLIA 1H9TA 4A0YA 4IQ4A 4AYBN 3J7ZI 1CF7B 3TW6A 4RAGA 5ILUA 3LAPA 3PM1A 3GBGA 2HYGD 4XRSA 4LK0F 2QM3A 1SFEA 2AHQA 3ASOH 4F55A 3FF5A 3M07A 3FZVA 4KJZA 3BR2A 2KRCA 1GHCA 4CZZA 4CCNA 1ZAOA 2E2HJ 4FCYA 2Q0OA 1HXDA 1SAUA 4HRIA 1USSA 1SD5A 4C3HJ 3JRBA 1BI1A 1F1ZA 2X0LA 5IPAA 4G6DA 1IG7A 1R5HA 2DA2A 3CD6I 3SDGA 3CCVI 1LE8B 2WBMA 2DFEA 4Z6YA 2X6WA 1RC9A 3IAM2 5F0HA 3KZZA 4ESFA 2OJED 4KFCA 1JI8A 4GXOA 4IZZA 2K3FA 3N05A 3W6JB 4D9JA 2TRTA 3ABKH 1R7JA 4LG3A 3L2QA 2HXIA 1YJ9I 1MNDA 2ISYA 2BY1A 2X1EA 4UV9A 1OKRA 3S1RJ 1HQCA 2VKVA 1PP8F 1IN4A 3LSIA 2OTLI 2ZXIA 1R49A 1QPMA 3JRFA 3VYTB 3ZCOA 3LSRA 1OR7A 5DYMA 1A5JA 2ZNZA 3P7NA 4P9FA 4HNVA 3FXJA 4LIVA 2BEOA 3Q0UA 1XB4A 2IS1A 1ZRCA 4D1QA 1MMGA 1JKOC 1W4MA 3G3ZA 3HRSA 3ZN0A 3CCEI 4IHYA 4S0HB 3JAMZ 3RTRA 3I53A 1ETVA 3HM5A 3IAS2 4EMSA 5IOYA 4BY1J 3K1PA 5J3LA 4NUBA 4M9SA 3JR9A 2OZUA 2KIFA 3RKWA 2BGCA 5K5QA 5E3LA 2ZKZA 2I10A 1HKSA 4DYQA 1ZH5A 3F72A 3AFHA 3F8NA 3KE2A 4QPOA 1I50J 4N9HA 2E36A 5KK1A 2FF4A 3T8RA 4CSWA 3I59B 4YIIA 2WWYA 1TZLA 3EUAA 1LDJA 4UB8C 3GTQJ 2Q1ZB 1U5TB 4ZJZA 1EH7A 2DA3A 2GLOA 3I4NJ 2YX7A 4UV8A 3CLQA 3CCJI 3KYLA 2W00A 3JRIA 3FBNB 2COMA 1WH5A 1BR4A 2XV4S 1LJ9A 3W2VA 4Y3OA 2CRGA 1JT0A 3MKZA 2L4AA 5IP9J 4L0YB 5LFAA 2W82A 2WAQN 1JKQC 1P7JA 1ON1A 3BC8A 4NQWA 5LLQA 1H88C 2KQRA 4J01A 1MH4A 1ZKGA 2QUFA 2XAGA 1MSFC 2B63J 1YLFA 1YRNA 2VC1A 1YFHA 2H94A 2DN0A 4P9UA 4A3CJ 5ILVA 1LVAA 2XHKA 4M72A 3E5UA 4ESBA 2K9MA 1JTXA 3OYGA 4E7JA 4A3JJ 4KMFA 4Q47A 3LSHA 2BHYA 4GO1A 4IOCF 3KYDB 1X1BA 3I71A 2JVHA 2P7CB 3I5UA 3PO3J 3B6AA 1VQ6I 2CMPA 3KP7A 3QPLA 5EZGA 1IGNA 2RC4A 1W5SA 1ZELA 2R7QA 3LL7A 2Y0SA 4RLFA 1HSTA 3JTGA 3F8CA 2H8RA 3HL2A 1Z21A 4I01A 4WXCA 3DF8A 2V79A 3GFLA 3C2BA 3F8MA 3DQVC 1KYZA 3HG9A 3TO7A 3S3MA 3HHGA 1NH3A 3FK6A 1Z6TA 3GLLA 3PFYA 3QRFF 3U1DA 3WG7H 1XMAA 4CXFA 1YS7A
chains in the Genus database with same CATH topology
4NHJA 2H09A 2EJRA 2DU9A 4I0BA 3V4GA 1KQ8A 2EFWA 4BNCA 2XIGA 3TDUC 4MTDA 3BP8A 2MH2A 2F5FA 3GWZA 3ISPA 2BBYA 2M87A 1DP7P 3K1NA 3EYIA 3RPQA 2BV6A 3Q9SA 1Z9CA 3R0AA 2PJPA 5CVVA 3M8EA 5D5XB 3HRUA 3ROUA 2VT3A 2H27A 1B6AA 5AIPA 2K4BA 4CYDA 1QNTA 3NQOA 2RKHA 1O7LA 2DLLA 3BOQA 3RYPA 2Y75A 1ZRFA 5ICEA 2HS5A 4TV7A 4M9XA 1S7OA 2GZWA 3QPHA 2FXAA 5FLXZ 2D1HA 4XBFA 3ZP5A 5D6FA 3KZYA 1YYVA 2E1CA 1K78B 5HVQC 4KN7X 4HX8A 5J6XA 3GLXA 4OMYA 1MJBA 2LF7A 3QU6A 2O0YA 1KU9A 2NAZA 1R1TA 1JGSA 1IN8A 1IAWA 4R79A 2XROA 4ENNA 5BMZA 1QO0D 3QOPA 2Z99A 1EH6A 1ZYRF 1W5TA 1JE8A 4U0VA 1FT9A 4EJWA 3WTYC 4HBLA 4ESJA 2O6GE 2X4HA 1FX7A 3L9FA 2EA4A 1T38A 4ZH4F 3DPTA 2DI3A 2HOEA 3ZMZA 5L3CA 1I27A 1B9MA 3HHHA 1MDMA 4M6XA 3V7SA 3O3KA 4OIOF 4EM2A 4KUMA 1UHWA 4U7DA 3Q5FA 3BJ6A 3KCCA 4OOIA 3HYIA 3N97A 3W6KB 2EV5A 3CJNA 4LLNA 3E5XA 1YIOA 1FWZA 2PQ8A 3DPLC 1ZG5A 1IXRC 3V8LA 3N4MA 2P4WA 1R5GA 3GO5A 5CVUA 4EM1A 1FSHA 4MEXF 1KU2A 2DW4A 2G9WA 4XLNF 5D8LB 5LEKA 3Q9VA 4UHTA 3IRRA 4OIQF 1MD0A 3F8BA 4ZYGA 5FD5A 4IRGA 1RUNA 1Y0UA 5CLSA 3HOTA 3BPXA 2W85A 3E6BA 6PAXA 4KYWA 4JK1X 4LB6B 2UWMA 4IHSA 3MZHA 2DFIA 4M74A 5D4RA 1S3JA 2JTVA 1WKMA 4U88A 1FP1D 2MC3A 2DAOA 3H3ZA 3E6CC 3IWZA 2LKPA 5L3GA 5K1YA 3V7RA 2PLYA 4ZZDA 4LK1F 2D45A 1OYYA 1E17A 1H9GA 2QLZA 3G73A 3PQKA 4I7HA 4RB0A 5ILSA 2P5VA 3TO9A 5DUIA 2HGCA 4HA8A 5L3EA 4AIJA 3COAC 2VONA 3MQ0A 3GFJA 1BC7C 3HRTA 1Z6RA 2IA2A 3BY6A 2P5KA 2KRFA 4RB3C 5A2QK 5JVTA 1TQPA 3K69A 2VBZA 3FMQA 2L02A 4LMYA 2VBXA 5F1RA 5E1XA 4RGRA 2FBIA 2Y0MA 1FBSA 3CO6C 1WRJA 3AAFA 1G3YA 1S8NA 3CDHA 3ZMSA 1LB2A 1HW2A 1P2FA 2V1DA 4E70A 3WGGA 3DXJF 3FM3A 1B59A 2ZBKA 2EK5A 3CTAA 3R6SA 2ESNA 2EV6A 4HX4A 3R4KA 1KYWA 4L18B 4ENMA 3TO6A 2F5CA 3U9GA 3OOPA 4UVBA 3E5QA 2YPRA 1IZ1A 3E3VA 3F6OA 1ZLKA 2FSWA 5JFRA 2M8EA 1A04A 4RB2C 2XVCA 2HTJA 4P96A 4JQFA 1FBQA 1FBUA 1CF7A 2OQGA 5ED4A 2OZ6A 3I4PA 2IP2A 1V3FA 3QU3A 4YFKF 2A07F 2P6TA 2XAFA 5E8GA 5BS6A 2RDPA 3JSPA 2DTRA 1RI7A 2CG4A 2PFBA 4DQ2A 5LGUA 1RUOA 2FRHA 3L7WA 1G6NA 1XGMA 2HKOA 4F7ZA 2H6CA 1YW9A 4MQ9F 2GWRA 5BPDA 2PMHA 3M8FA 3RJPA 3VOEA 1XGSA 1UCRA 4AIKA 4M6YA 4MTEA 3KETA 3R60A 1P6RA 5LGTA 2KIMA 1T0FA 1VTNC 2KIUA 2IVMA 2F5DA 2LF8A 2A6HF 2EV0A 4KMUX 5IT9K 1BI3A 4L9NA 2MLKA 5HS9A 4RGSA 2FMYA 4L5JA 1Q1HA 3I59A 3BWGA 2GXGA 1U5TA 1OMIA 2CO5A 4I98B 2MA3A 1O7FA 4MGRA 4WXHA 1I5ZA 5LRSA 2XAHA 1PP7U 4K2EA 3IHUA 4IXAA 1LEAA 1LNWA 2MH9A 5FB2A 2XAQA 3GZ5A 3DFGA 1U8RA 3LA7A 2BE5F 1ZGJA 3IRQA 2E1NA 1DPRA 5HS7A 5E8IA 4XSXF 4RGXA 2FEZA 4ASNA 2VOOA 2YSRA 3WTSC 4BAYA 5DD8A 5ICGA 4XLPF 2VT2A 2XRNA 1T39A 1SFUA 3RYRA 4HLYA 3TOBA 4EM0B 5TJJA 4MHGA 1MJ9A 2F2EA 4ON0A 1IN6A 5AIQA 3FXRA 1K79A 4KN4X 1O57A 2L01A 4P55A 2C6YA 1B4AA 3BROA 3KLNA 3T0YA 1HKTA 4A6EA 2W57A 2CYYA 1X3UA 3FWEA 1L3LA 1KU3A 1XN7A 5L3FA 2P7VB 1R1UA 2J5OA 2NS0A 4A6DA 2QBYB 2CW0F 3LA2A 3C3WA 3SZPA 4KIBA 2CQKA 1YG2A 2PN6A 3ZMTA 1RIOH 4IRHA 3HTUA 5LRRA 3F3XA 1YW7A 1U6GA 3GYHX 5CYVA 2J5PA 3FM5A 1IRGA 3DV8A 4A5MA 3ZQ7A 4U0YA 4LGWA 2HZTA 1W7PB 1G4DA 2P8TA 1R00A 5ERIA 2ETHA 3WGHA 5J8CA 1EH8A 3GFMA 1W7PD 1K78A 3JW4A 5HDKA 3WG9A 1ZGAA 3B73A 3FXQA 4BXUA 4PDKA 4EQQA 3I58A 4H0EA 2ZO4A 2VE8A 2UXNA 2LDUA 3C7JA 3TOAA 5DCMB 2JT1A 2ZJ2A 2R3SA 4RAZA 2V1XA 2NNYA 5FFXA 2NYXA 5H6QA 3FXUA 2K02A 4A12A 1KQ0A 3KLOA 3HTSB 4KDPA 4PZJA 1QZZA 5A2QZ 4BQAA 2DO7A 1J0RA 5EEHA 2O3FA 2O8XA 4CO8A 2IT0A 2E7XA 2HWVA 2NRAC 4BHPA 2D2WA 3EDPA 5EEGA 2CSOA 2QQ9A 1XGNA 1YS6A 3GVAA 5ICCA 4UXNA 1ZG1A 4L9JA 4U0WA 5H6RA 1HW5A 2XKOA 3PFIA 4QLCU 3QAHA 4KNYA 4IF4A 5E20A 2DK8A 2CFXA 1BJAA 2ESHA 3J80K 2E7WA 4IRIA 3LA3A 2JSCA 2Q2EA 3GEZA 3KP4A 4IHTA 4EVIA 1D8JA 2XKPA 2Q8KA 4PGHA 3GX4X 1REPC 3JSOA 5D6EA 4ZYHA 2ZCWA 3U2RA 3JAMK 3T8TA 1R58A 2RV8A 1RNLA 1IRFA 1LEBA 3T5XA 2ADUA 3VEPA 2HTSA 3NEUA 3PQJA 1P4AA 1ZG3A 2DQLA 1ONVA 4WK8F 3F6VA 2IA0A 3F8FA 3GF2A 2R7DA 5LGNA 3LAJA 4AWXB 4Q4ZF 5LHHA 1F4KA 1B9NA 1U3EM 4FT8A 3WTZA 1BBYA 5FD6A 1TNSA 1XGOA 2V6CA 2AXLA 2ELHA 5H20A 1T2KA 2HR3A 2RVCA 2ZXJA 2RQPA 4KICA 3WU0A 1YO5C 2VOPA 3WU1B 3JTHA 1WI9A 3HOSA 4KIFA 3KP3A 1ZRDA 3F23A 1FP2A 4EJVA 1STZA 3R0JA 2QYOA 2LSOA 2W84A 5BPIA 4A0ZA 2ZNYA 2HYFA 2STWA 2K4JA 5FFZA 2VXZA 2A5YB 2PG4A 1L0OC 3KP6A 1GXPA 3QPTA 3HIFA 3KP2A 2WV0A 1YQAA 3ZPLA 4OU0A 2ACJA 2DPUA 1JHFA 4DNCA 5CVIA 4JBAA 4EGYA 4L5IA 2W25A 4FX0A 5BOXA 4QWQA 3BDDA 4U7BA 1BM9A 5CJ9A 4Y15A 2NNNA 1USTA 2RNJA 3GZ6A 5JI6A 2V9VA 2OA4A 2UZKA 5DV5A 3V8KA 4LLLA 2Z33A 2FNPA 4UNOA 4BH9A 3SHFA 2GXBA 5FO5A 5FLXK 2A61A 1FYMA 3RKXA 3CO7C 4Q5SF 3ULQB 4GYIA 1EV7A 4N0BA 4RAYA 5DEQA 4G7HF 4HZFA 3F22A 4CDGA 5D5VB 2HQNA 1O3RA 1U78A 4HDVA 1O3SA 1XD7A 3K9TA 2CGPA 3KFWX 4EJTA 4OIRF 3SXYA 1J2XA 4WF2A 4M9ZA 4HAMA 1XMKA 1P4WA 1TW2A 2EB7A 1K6OA 3FHZA 4UVAA 3VB2A 1LQ1A 2XGXA 3C1DA 5F64A 4S04A 4ZYDA 4GCVA 3H92A 1FZPB 2A6EF 1QGPA 1JHHA 3EQLF 4GGGA 3E6DA 1FNNA 1J5YA 3HSFA 4BYYA 3MEXA 3WE2A 3IKTA 4HYEA 3TQNA 5DD4A 1K7AA 4CHUA 2QQBA 2L4MA 4EV0A 3CUQC 5JHUA 5ICFA 3EETA 2IRFG 1S6LA 3D5LA 4RS8A 1XCVA 4YFNF 3ERED 1F9NA 1R1VA 2G7HA 1SD6A 3K0LA 4ZYEA 2M1BA 5DDGA 3GW2A 4G7ZF 1J9IA 1V4RA 1SMTA 4PGGA 1QZYA 2FA5A 1O3QA 2WTEA 4FHTA 1ZN2A 2HFHA 2DBBA 1BI0A 2QWWA 1OYWA 1DUXC 1BOAA 1IN5A 3OV8A 3RDIA 3R61A 2V1UA 4ETSA 2ZMEB 2VE9A 3CUQB 1T98A 3TGNA 2EFNA 4EJUA 3TKYA 3M7GA 2UXXA 4BHBA 2XAJA 2VC0A 5L3BA 1U5TC 4LG0B 4IJAA 4RGUA 2RN7A 1I1SA 2OQRA 1MJAA 2OD5A 2FE3A 2GA1A 2QBYA 2VBYA 3V8JA 4BHCA 5FGMA 5D8KB 1HKQA 1BIAA 1R23A 3J80Z 5D5UB 2XASA 3KEOA 1J7KA 4G8XA 4O5VA 1BC8C 3ELKA 4L9VA 1WQ2A 1KQ9A 2IJLA 2ISZA 1WSUA 1E2XA 1Z91A 1W7PA 3HSEA 4ENKA 3LFKA 2A3SA 1NHAA 1XSXA 1S7AA 1TBXA 1AWCA 1IN7A 2OAZA 3M9AA 2STTA 4HX7A 5K5OA 2AS5F 3P9KA 3QP6A 1BI2A 3LQRA 3IL2A 1FPQA 2XUBA 5K5RA 5DCMA 3E97A 1I1GA 1F5TA 1BIBA 1ZHFA 2PBIA 2DPDA 3WTUC 2O03A 2KJCA 3HUGA 2VBWA 3P9IA 5LEJA 3IC7A 2K27A 5AONA 2FQ3A 1IUYA 1T6SA 3J81K 3E6MA 1H0MA 3MCZA 3I64A 2JPCA 4I09A 4D0PA 2PMUA 4KA4A 1TQIA 2GIVA 5JR3A 1C0WA 3DP7A 1R36A 1TNTA 3GFIA 3O2PE 2LNBA 3EUHA 5LHGA 4HW0A 1UB9A 3B02A 1GXQA 2TDXA 1Z05A 3I54A 2QZ8A 4AD9A 1P4XA 3ZN1A 4AIHA 2FBHA 1WWXA 1OPCA 3D0SA 4G94A 4CGZA 3TDZC 4MNUA 3FMSA 1FOKA 2D1VA 3L09A 2R7FA 2DQRA 5E18F 5TRDA 1XDUA 2Z3YA 4HOBA 4I02A 4LD5A 1KU7A 1CGPA 1B1BA 2HQRA 2QQAA 5E1ZB 1IXSB 3WTXC 1Z1DA 4I2OA 1AOYA 3V7CA 4Y17A 2OU2A 5HLGA 4OMZA 4HDUA 3HRMA 1IF1A 3LSTA 3L00A 4XRFA 2Z9OA 2MBFA 4A5NA 4G9YA 4KIGA 1IW7F 4MEYF 3RI4A 3MWMA 1QQIA 3GUDA 1JXSA 3KP5A 4A0XA 1OYIA 1TLHB 1ULYA 2IA1A 4WX9A 4M71A 5E1WA 3WE3A 1HW1A 2L54A 5LBQA 1IXCA 5D4SA 4HF0A 3RPUA 4GYGA 1D8KA 1G3WA 4HV6A 4CICA 5HDGA 4Q48A 2KJBA 4S05A 2H6BA 4G6QA 1ZARA 2QVOA 1RZ4A 2L3DA 1ON2A 5CVRA 5HLHA 4XSZF 2GA2A 2YX4A 2OBPA 3ZMVA 2EWNA 3NRVA 2HEOA 2GQQA 4A2UA 2HKXA 3VODA 3L2CA 4OIPF 4ZZLA 2YU3A 3MAJA 3REOA 4B8XA 3C18A 1O3TA 1D5VA 4R8HA 3EYYA 3DEUA 3VFZA 2A68F 2P5LC 3SQNA 3BPVA 2DK5A 4HF2A 4IPAA 1KGSA 4G7OF 3K2ZA 2A69F 3ABUA 1LDDA 4LB5A 3J7AO 1J75A 3ABTA 2MLGA 4LLGF 3H3UA 2GAUA 2JPBA 1MZBA 2M30A 2MD5A 4EGZA 4HQMA 1SD7A 2YR2A 1YW8A 5DUKA 5IT9Z 2KKOA 3ZMUA 1XSVA 3SZTA 3LWFA 1GVJA 5F6FA 4AVPA 1MDMB 5IT3A 3BJOA 3FMRA 4O6JA 2PI0A 1PUEE 3GXOA 2P6SA 2G7UA 4WXDA 5L3DA 4MQVA 3F21A 1FY7A 3WODF 4FX4A 2CWEA 3K1MA 2DT5A 2PEXA 4ENJA 1DDNA 1ODDA 3BJAA 1TQMA 1U2WA 3I0TA 4HLXA 2RGVA 5HOOA 1QBJA 2QENA 1PDNC 2VODA 1G3SA 4I0AA 2F5EA 4UVCA 2EFPA 2IW5A 2FOKA 2EFQA 4YFXF 2VN2A 4WCGA 1XDSA 3DKWA 4L9TA 4OINF 1ZLJA 2IPQX 2JZYA 5BQTA 3BZ6A 3P9CA 3KEQA 4HV5A 4Y13A 1D3YA 2W24A 1FSEA 1G3TA 4PCQA 2FMLA 3MZYA 1YTYA 1HBXG 3M1EA 4NB5A 1UFMA 4P5OA 1FC3A 3WGIA 1XCBA 2Z5UA 3RIRA 4L0ZB 4KT5C 2BYVE 2ZFWA 3ML6A 3IKVA 3S2WA 3FX3A 2JRTA 3WTWC 2EA2A 1S29A 5E17F 2K86A 3CLOA 1SFXA 3HSRA 2WC2A 3WTVC 4R1HA 5HS8A 2O61A 5J8FA 3LQQA 1SMYF 1HSJA 4YG2F 2FNAA 4WWCA 1SAXA 4HF1A 4YIFA 2M5WA 2M45A 4M73A 1MKMA 3IWFA 2EFOA 2K7LA 3ZMDA 2HDCA 1DPUA 1UHMA 1FYKA 1KA8A 1MGTA 1FLIA 4B09A 3J81Z 1XSDA 2FU4A 4Z2YA 1LDKB 1TTYA 3ECHA 1J59A 5D5WB 1SD4A 5DCFA 2ZMEA 1R22A 3CUQA 4IVNA 5LHIA 3RKYA 4EJOA 1FYLA 3QP5A 4LG0A 2B0LA 1P92A 5CVJA 3WTTC 1I6XA 3ECOA 3T1BA 4UUVA 4O3MA 5HDNA 4LJZF 2Y48A 1TW3A 3CUOA 3MFKA 1Z7UA 4N9IA 4LFUA 3SFZA 4RB1A 1BN5A 5KVRA 1ZREA 4HQEA 2FBKA 3O6BB 5HLIA 1H9TA 4A0YA 1CF7B 5ILUA 3LAPA 2HYGD 4LK0F 2QM3A 1SFEA 3FF5A 3FZVA 1GHCA 4CZZA 1ZAOA 2Q0OA 1HXDA 1USSA 1SD5A 1BI1A 1F1ZA 2X0LA 4G6DA 1R5HA 3KZZA 4ESFA 4KFCA 4GXOA 3W6JB 1R7JA 2ISYA 4UV9A 1OKRA 1HQCA 1PP8F 1IN4A 1QPMA 1OR7A 5DYMA 2ZNZA 3P7NA 4P9FA 2BEOA 1XB4A 1ZRCA 1W4MA 3G3ZA 3HRSA 3ZN0A 3JAMZ 3RTRA 3I53A 4EMSA 3K1PA 4M9SA 2OZUA 2KIFA 3RKWA 2BGCA 5K5QA 2ZKZA 1HKSA 1ZH5A 3F72A 3F8NA 3KE2A 4N9HA 5KK1A 2FF4A 3T8RA 3I59B 4YIIA 2WWYA 1LDJA 1U5TB 1EH7A 2YX7A 4UV8A 2COMA 2XV4S 1LJ9A 2L4AA 4L0YB 1ON1A 4NQWA 5LLQA 2QUFA 2XAGA 1YLFA 2VC1A 1YFHA 2H94A 4P9UA 5ILVA 1LVAA 2XHKA 4M72A 3E5UA 4ESBA 4KMFA 4Q47A 4GO1A 3I71A 2P7CB 3I5UA 3KP7A 2RC4A 1W5SA 1HSTA 3JTGA 3F8CA 4I01A 4WXCA 3DF8A 2V79A 3GFLA 3F8MA 3DQVC 1KYZA 3TO7A 3HHGA 1Z6TA 3QRFF 3U1DA 1XMAA 4CXFA 1YS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHJ A;  2H09 A;  2EJR A;  2DU9 A;  4I0B A;  3V4G A;  1KQ8 A;  2EFW A;  4BNC A;  2XIG A;  3TDU C;  4MTD A;  3BP8 A;  2MH2 A;  2F5F A;  3GWZ A;  3ISP A;  2BBY A;  2M87 A;  1DP7 P;  3K1N A;  3EYI A;  3RPQ A;  2BV6 A;  3Q9S A;  1Z9C A;  3R0A A;  2PJP A;  5CVV A;  3M8E A;  5D5X B;  3HRU A;  3ROU A;  2VT3 A;  2H27 A;  1B6A A;  5AIP A;  2K4B A;  4CYD A;  1QNT A;  3NQO A;  2RKH A;  1O7L A;  2DLL A;  3BOQ A;  3RYP A;  2Y75 A;  1ZRF A;  5ICE A;  2HS5 A;  4TV7 A;  4M9X A;  1S7O A;  2GZW A;  3QPH A;  2FXA A;  5FLX Z;  2D1H A;  4XBF A;  3ZP5 A;  5D6F A;  3KZY A;  1YYV A;  2E1C A;  1K78 B;  5HVQ C;  4KN7 X;  4HX8 A;  5J6X A;  3GLX A;  4OMY A;  1MJB A;  2LF7 A;  3QU6 A;  2O0Y A;  1KU9 A;  2NAZ A;  1R1T A;  1JGS A;  1IN8 A;  1IAW A;  4R79 A;  2XRO A;  4ENN A;  5BMZ A;  1QO0 D;  3QOP A;  2Z99 A;  1EH6 A;  1ZYR F;  1W5T A;  1JE8 A;  4U0V A;  1FT9 A;  4EJW A;  3WTY C;  4HBL A;  4ESJ A;  2O6G E;  2X4H A;  1FX7 A;  3L9F A;  2EA4 A;  1T38 A;  4ZH4 F;  3DPT A;  2DI3 A;  2HOE A;  3ZMZ A;  5L3C A;  1I27 A;  1B9M A;  3HHH A;  1MDM A;  4M6X A;  3V7S A;  3O3K A;  4OIO F;  4EM2 A;  4KUM A;  1UHW A;  4U7D A;  3Q5F A;  3BJ6 A;  3KCC A;  4OOI A;  3HYI A;  3N97 A;  3W6K B;  2EV5 A;  3CJN A;  4LLN A;  3E5X A;  1YIO A;  1FWZ A;  2PQ8 A;  3DPL C;  1ZG5 A;  1IXR C;  3V8L A;  3N4M A;  2P4W A;  1R5G A;  3GO5 A;  5CVU A;  4EM1 A;  1FSH A;  4MEX F;  1KU2 A;  2DW4 A;  2G9W A;  4XLN F;  5D8L B;  5LEK A;  3Q9V A;  4UHT A;  3IRR A;  4OIQ F;  1MD0 A;  3F8B A;  4ZYG A;  5FD5 A;  4IRG A;  1RUN A;  1Y0U A;  5CLS A;  3HOT A;  3BPX A;  2W85 A;  3E6B A;  6PAX A;  4KYW A;  4JK1 X;  4LB6 B;  2UWM A;  4IHS A;  3MZH A;  2DFI A;  4M74 A;  5D4R A;  1S3J A;  2JTV A;  1WKM A;  4U88 A;  1FP1 D;  2MC3 A;  2DAO A;  3H3Z A;  3E6C C;  3IWZ A;  2LKP A;  5L3G A;  5K1Y A;  3V7R A;  2PLY A;  4ZZD A;  4LK1 F;  2D45 A;  1OYY A;  1E17 A;  1H9G A;  2QLZ A;  3G73 A;  3PQK A;  4I7H A;  4RB0 A;  5ILS A;  2P5V A;  3TO9 A;  5DUI A;  2HGC A;  4HA8 A;  5L3E A;  4AIJ A;  3COA C;  2VON A;  3MQ0 A;  3GFJ A;  1BC7 C;  3HRT A;  1Z6R A;  2IA2 A;  3BY6 A;  2P5K A;  2KRF A;  4RB3 C;  5A2Q K;  5JVT A;  1TQP A;  3K69 A;  2VBZ A;  3FMQ A;  2L02 A;  4LMY A;  2VBX A;  5F1R A;  5E1X A;  4RGR A;  2FBI A;  2Y0M A;  1FBS A;  3CO6 C;  1WRJ A;  3AAF A;  1G3Y A;  1S8N A;  3CDH A;  3ZMS A;  1LB2 A;  1HW2 A;  1P2F A;  2V1D A;  4E70 A;  3WGG A;  3DXJ F;  3FM3 A;  1B59 A;  2ZBK A;  2EK5 A;  3CTA A;  3R6S A;  2ESN A;  2EV6 A;  4HX4 A;  3R4K A;  1KYW A;  4L18 B;  4ENM A;  3TO6 A;  2F5C A;  3U9G A;  3OOP A;  4UVB A;  3E5Q A;  2YPR A;  1IZ1 A;  3E3V A;  3F6O A;  1ZLK A;  2FSW A;  5JFR A;  2M8E A;  1A04 A;  4RB2 C;  2XVC A;  2HTJ A;  4P96 A;  4JQF A;  1FBQ A;  1FBU A;  1CF7 A;  2OQG A;  5ED4 A;  2OZ6 A;  3I4P A;  2IP2 A;  1V3F A;  3QU3 A;  4YFK F;  2A07 F;  2P6T A;  2XAF A;  5E8G A;  5BS6 A;  2RDP A;  3JSP A;  2DTR A;  1RI7 A;  2CG4 A;  2PFB A;  4DQ2 A;  5LGU A;  1RUO A;  2FRH A;  3L7W A;  1G6N A;  1XGM A;  2HKO A;  4F7Z A;  2H6C A;  1YW9 A;  4MQ9 F;  2GWR A;  5BPD A;  2PMH A;  3M8F A;  3RJP A;  3VOE A;  1XGS A;  1UCR A;  4AIK A;  4M6Y A;  4MTE A;  3KET A;  3R60 A;  1P6R A;  5LGT A;  2KIM A;  1T0F A;  1VTN C;  2KIU A;  2IVM A;  2F5D A;  2LF8 A;  2A6H F;  2EV0 A;  4KMU X;  5IT9 K;  1BI3 A;  4L9N A;  2MLK A;  5HS9 A;  4RGS A;  2FMY A;  4L5J A;  1Q1H A;  3I59 A;  3BWG A;  2GXG A;  1U5T A;  1OMI A;  2CO5 A;  4I98 B;  2MA3 A;  1O7F A;  4MGR A;  4WXH A;  1I5Z A;  5LRS A;  2XAH A;  1PP7 U;  4K2E A;  3IHU A;  4IXA A;  1LEA A;  1LNW A;  2MH9 A;  5FB2 A;  2XAQ A;  3GZ5 A;  3DFG A;  1U8R A;  3LA7 A;  2BE5 F;  1ZGJ A;  3IRQ A;  2E1N A;  1DPR A;  5HS7 A;  5E8I A;  4XSX F;  4RGX A;  2FEZ A;  4ASN A;  2VOO A;  2YSR A;  3WTS C;  4BAY A;  5DD8 A;  5ICG A;  4XLP F;  2VT2 A;  2XRN A;  1T39 A;  1SFU A;  3RYR A;  4HLY A;  3TOB A;  4EM0 B;  5TJJ A;  4MHG A;  1MJ9 A;  2F2E A;  4ON0 A;  1IN6 A;  5AIQ A;  3FXR A;  1K79 A;  4KN4 X;  1O57 A;  2L01 A;  4P55 A;  2C6Y A;  1B4A A;  3BRO A;  3KLN A;  3T0Y A;  1HKT A;  4A6E A;  2W57 A;  2CYY A;  1X3U A;  3FWE A;  1L3L A;  1KU3 A;  1XN7 A;  5L3F A;  2P7V B;  1R1U A;  2J5O A;  2NS0 A;  4A6D A;  2QBY B;  2CW0 F;  3LA2 A;  3C3W A;  3SZP A;  4KIB A;  2CQK A;  1YG2 A;  2PN6 A;  3ZMT A;  1RIO H;  4IRH A;  3HTU A;  5LRR A;  3F3X A;  1YW7 A;  1U6G A;  3GYH X;  5CYV A;  2J5P A;  3FM5 A;  1IRG A;  3DV8 A;  4A5M A;  3ZQ7 A;  4U0Y A;  4LGW A;  2HZT A;  1W7P B;  1G4D A;  2P8T A;  1R00 A;  5ERI A;  2ETH A;  3WGH A;  5J8C A;  1EH8 A;  3GFM A;  1W7P D;  1K78 A;  3JW4 A;  5HDK A;  3WG9 A;  1ZGA A;  3B73 A;  3FXQ A;  4BXU A;  4PDK A;  4EQQ A;  3I58 A;  4H0E A;  2ZO4 A;  2VE8 A;  2UXN A;  2LDU A;  3C7J A;  3TOA A;  5DCM B;  2JT1 A;  2ZJ2 A;  2R3S A;  4RAZ A;  2V1X A;  2NNY A;  5FFX A;  2NYX A;  5H6Q A;  3FXU A;  2K02 A;  4A12 A;  1KQ0 A;  3KLO A;  3HTS B;  4KDP A;  4PZJ A;  1QZZ A;  5A2Q Z;  4BQA A;  2DO7 A;  1J0R A;  5EEH A;  2O3F A;  2O8X A;  4CO8 A;  2IT0 A;  2E7X A;  2HWV A;  2NRA C;  4BHP A;  2D2W A;  3EDP A;  5EEG A;  2CSO A;  2QQ9 A;  1XGN A;  1YS6 A;  3GVA A;  5ICC A;  4UXN A;  1ZG1 A;  4L9J A;  4U0W A;  5H6R A;  1HW5 A;  2XKO A;  3PFI A;  4QLC U;  3QAH A;  4KNY A;  4IF4 A;  5E20 A;  2DK8 A;  2CFX A;  1BJA A;  2ESH A;  3J80 K;  2E7W A;  4IRI A;  3LA3 A;  2JSC A;  2Q2E A;  3GEZ A;  3KP4 A;  4IHT A;  4EVI A;  1D8J A;  2XKP A;  2Q8K A;  4PGH A;  3GX4 X;  1REP C;  3JSO A;  5D6E A;  4ZYH A;  2ZCW A;  3U2R A;  3JAM K;  3T8T A;  1R58 A;  2RV8 A;  1RNL A;  1IRF A;  1LEB A;  3T5X A;  2ADU A;  3VEP A;  2HTS A;  3NEU A;  3PQJ A;  1P4A A;  1ZG3 A;  2DQL A;  1ONV A;  4WK8 F;  3F6V A;  2IA0 A;  3F8F A;  3GF2 A;  2R7D A;  5LGN A;  3LAJ A;  4AWX B;  4Q4Z F;  5LHH A;  1F4K A;  1B9N A;  1U3E M;  4FT8 A;  3WTZ A;  1BBY A;  5FD6 A;  1TNS A;  1XGO A;  2V6C A;  2AXL A;  2ELH A;  5H20 A;  1T2K A;  2HR3 A;  2RVC A;  2ZXJ A;  2RQP A;  4KIC A;  3WU0 A;  1YO5 C;  2VOP A;  3WU1 B;  3JTH A;  1WI9 A;  3HOS A;  4KIF A;  3KP3 A;  1ZRD A;  3F23 A;  1FP2 A;  4EJV A;  1STZ A;  3R0J A;  2QYO A;  2LSO A;  2W84 A;  5BPI A;  4A0Z A;  2ZNY A;  2HYF A;  2STW A;  2K4J A;  5FFZ A;  2VXZ A;  2A5Y B;  2PG4 A;  1L0O C;  3KP6 A;  1GXP A;  3QPT A;  3HIF A;  3KP2 A;  2WV0 A;  1YQA A;  3ZPL A;  4OU0 A;  2ACJ A;  2DPU A;  1JHF A;  4DNC A;  5CVI A;  4JBA A;  4EGY A;  4L5I A;  2W25 A;  4FX0 A;  5BOX A;  4QWQ A;  3BDD A;  4U7B A;  1BM9 A;  5CJ9 A;  4Y15 A;  2NNN A;  1UST A;  2RNJ A;  3GZ6 A;  5JI6 A;  2V9V A;  2OA4 A;  2UZK A;  5DV5 A;  3V8K A;  4LLL A;  2Z33 A;  2FNP A;  4UNO A;  4BH9 A;  3SHF A;  2GXB A;  5FO5 A;  5FLX K;  2A61 A;  1FYM A;  3RKX A;  3CO7 C;  4Q5S F;  3ULQ B;  4GYI A;  1EV7 A;  4N0B A;  4RAY A;  5DEQ A;  4G7H F;  4HZF A;  3F22 A;  4CDG A;  5D5V B;  2HQN A;  1O3R A;  1U78 A;  4HDV A;  1O3S A;  1XD7 A;  3K9T A;  2CGP A;  3KFW X;  4EJT A;  4OIR F;  3SXY A;  1J2X A;  4WF2 A;  4M9Z A;  4HAM A;  1XMK A;  1P4W A;  1TW2 A;  2EB7 A;  1K6O A;  3FHZ A;  4UVA A;  3VB2 A;  1LQ1 A;  2XGX A;  3C1D A;  5F64 A;  4S04 A;  4ZYD A;  4GCV A;  3H92 A;  1FZP B;  2A6E F;  1QGP A;  1JHH A;  3EQL F;  4GGG A;  3E6D A;  1FNN A;  1J5Y A;  3HSF A;  4BYY A;  3MEX A;  3WE2 A;  3IKT A;  4HYE A;  3TQN A;  5DD4 A;  1K7A A;  4CHU A;  2QQB A;  2L4M A;  4EV0 A;  3CUQ C;  5JHU A;  5ICF A;  3EET A;  2IRF G;  1S6L A;  3D5L A;  4RS8 A;  1XCV A;  4YFN F;  3ERE D;  1F9N A;  1R1V A;  2G7H A;  1SD6 A;  3K0L A;  4ZYE A;  2M1B A;  5DDG A;  3GW2 A;  4G7Z F;  1J9I A;  1V4R A;  1SMT A;  4PGG A;  1QZY A;  2FA5 A;  1O3Q A;  2WTE A;  4FHT A;  1ZN2 A;  2HFH A;  2DBB A;  1BI0 A;  2QWW A;  1OYW A;  1DUX C;  1BOA A;  1IN5 A;  3OV8 A;  3RDI A;  3R61 A;  2V1U A;  4ETS A;  2ZME B;  2VE9 A;  3CUQ B;  1T98 A;  3TGN A;  2EFN A;  4EJU A;  3TKY A;  3M7G A;  2UXX A;  4BHB A;  2XAJ A;  2VC0 A;  5L3B A;  1U5T C;  4LG0 B;  4IJA A;  4RGU A;  2RN7 A;  1I1S A;  2OQR A;  1MJA A;  2OD5 A;  2FE3 A;  2GA1 A;  2QBY A;  2VBY A;  3V8J A;  4BHC A;  5FGM A;  5D8K B;  1HKQ A;  1BIA A;  1R23 A;  3J80 Z;  5D5U B;  2XAS A;  3KEO A;  1J7K A;  4G8X A;  4O5V A;  1BC8 C;  3ELK A;  4L9V A;  1WQ2 A;  1KQ9 A;  2IJL A;  2ISZ A;  1WSU A;  1E2X A;  1Z91 A;  1W7P A;  3HSE A;  4ENK A;  3LFK A;  2A3S A;  1NHA A;  1XSX A;  1S7A A;  1TBX A;  1AWC A;  1IN7 A;  2OAZ A;  3M9A A;  2STT A;  4HX7 A;  5K5O A;  2AS5 F;  3P9K A;  3QP6 A;  1BI2 A;  3LQR A;  3IL2 A;  1FPQ A;  2XUB A;  5K5R A;  5DCM A;  3E97 A;  1I1G A;  1F5T A;  1BIB A;  1ZHF A;  2PBI A;  2DPD A;  3WTU C;  2O03 A;  2KJC A;  3HUG A;  2VBW A;  3P9I A;  5LEJ A;  3IC7 A;  2K27 A;  5AON A;  2FQ3 A;  1IUY A;  1T6S A;  3J81 K;  3E6M A;  1H0M A;  3MCZ A;  3I64 A;  2JPC A;  4I09 A;  4D0P A;  2PMU A;  4KA4 A;  1TQI A;  2GIV A;  5JR3 A;  1C0W A;  3DP7 A;  1R36 A;  1TNT A;  3GFI A;  3O2P E;  2LNB A;  3EUH A;  5LHG A;  4HW0 A;  1UB9 A;  3B02 A;  1GXQ A;  2TDX A;  1Z05 A;  3I54 A;  2QZ8 A;  4AD9 A;  1P4X A;  3ZN1 A;  4AIH A;  2FBH A;  1WWX A;  1OPC A;  3D0S A;  4G94 A;  4CGZ A;  3TDZ C;  4MNU A;  3FMS A;  1FOK A;  2D1V A;  3L09 A;  2R7F A;  2DQR A;  5E18 F;  5TRD A;  1XDU A;  2Z3Y A;  4HOB A;  4I02 A;  4LD5 A;  1KU7 A;  1CGP A;  1B1B A;  2HQR A;  2QQA A;  5E1Z B;  1IXS B;  3WTX C;  1Z1D A;  4I2O A;  1AOY A;  3V7C A;  4Y17 A;  2OU2 A;  5HLG A;  4OMZ A;  4HDU A;  3HRM A;  1IF1 A;  3LST A;  3L00 A;  4XRF A;  2Z9O A;  2MBF A;  4A5N A;  4G9Y A;  4KIG A;  1IW7 F;  4MEY F;  3RI4 A;  3MWM A;  1QQI A;  3GUD A;  1JXS A;  3KP5 A;  4A0X A;  1OYI A;  1TLH B;  1ULY A;  2IA1 A;  4WX9 A;  4M71 A;  5E1W A;  3WE3 A;  1HW1 A;  2L54 A;  5LBQ A;  1IXC A;  5D4S A;  4HF0 A;  3RPU A;  4GYG A;  1D8K A;  1G3W A;  4HV6 A;  4CIC A;  5HDG A;  4Q48 A;  2KJB A;  4S05 A;  2H6B A;  4G6Q A;  1ZAR A;  2QVO A;  1RZ4 A;  2L3D A;  1ON2 A;  5CVR A;  5HLH A;  4XSZ F;  2GA2 A;  2YX4 A;  2OBP A;  3ZMV A;  2EWN A;  3NRV A;  2HEO A;  2GQQ A;  4A2U A;  2HKX A;  3VOD A;  3L2C A;  4OIP F;  4ZZL A;  2YU3 A;  3MAJ A;  3REO A;  4B8X A;  3C18 A;  1O3T A;  1D5V A;  4R8H A;  3EYY A;  3DEU A;  3VFZ A;  2A68 F;  2P5L C;  3SQN A;  3BPV A;  2DK5 A;  4HF2 A;  4IPA A;  1KGS A;  4G7O F;  3K2Z A;  2A69 F;  3ABU A;  1LDD A;  4LB5 A;  3J7A O;  1J75 A;  3ABT A;  2MLG A;  4LLG F;  3H3U A;  2GAU A;  2JPB A;  1MZB A;  2M30 A;  2MD5 A;  4EGZ A;  4HQM A;  1SD7 A;  2YR2 A;  1YW8 A;  5DUK A;  5IT9 Z;  2KKO A;  3ZMU A;  1XSV A;  3SZT A;  3LWF A;  1GVJ A;  5F6F A;  4AVP A;  1MDM B;  5IT3 A;  3BJO A;  3FMR A;  4O6J A;  2PI0 A;  1PUE E;  3GXO A;  2P6S A;  2G7U A;  4WXD A;  5L3D A;  4MQV A;  3F21 A;  1FY7 A;  3WOD F;  4FX4 A;  2CWE A;  3K1M A;  2DT5 A;  2PEX A;  4ENJ A;  1DDN A;  1ODD A;  3BJA A;  1TQM A;  1U2W A;  3I0T A;  4HLX A;  2RGV A;  5HOO A;  1QBJ A;  2QEN A;  1PDN C;  2VOD A;  1G3S A;  4I0A A;  2F5E A;  4UVC A;  2EFP A;  2IW5 A;  2FOK A;  2EFQ A;  4YFX F;  2VN2 A;  4WCG A;  1XDS A;  3DKW A;  4L9T A;  4OIN F;  1ZLJ A;  2IPQ X;  2JZY A;  5BQT A;  3BZ6 A;  3P9C A;  3KEQ A;  4HV5 A;  4Y13 A;  1D3Y A;  2W24 A;  1FSE A;  1G3T A;  4PCQ A;  2FML A;  3MZY A;  1YTY A;  1HBX G;  3M1E A;  4NB5 A;  1UFM A;  4P5O A;  1FC3 A;  3WGI A;  1XCB A;  2Z5U A;  3RIR A;  4L0Z B;  4KT5 C;  2BYV E;  2ZFW A;  3ML6 A;  3IKV A;  3S2W A;  3FX3 A;  2JRT A;  3WTW C;  2EA2 A;  1S29 A;  5E17 F;  2K86 A;  3CLO A;  1SFX A;  3HSR A;  2WC2 A;  3WTV C;  4R1H A;  5HS8 A;  2O61 A;  5J8F A;  3LQQ A;  1SMY F;  1HSJ A;  4YG2 F;  2FNA A;  4WWC A;  1SAX A;  4HF1 A;  4YIF A;  2M5W A;  2M45 A;  4M73 A;  1MKM A;  3IWF A;  2EFO A;  2K7L A;  3ZMD A;  2HDC A;  1DPU A;  1UHM A;  1FYK A;  1KA8 A;  1MGT A;  1FLI A;  4B09 A;  3J81 Z;  1XSD A;  2FU4 A;  4Z2Y A;  1LDK B;  1TTY A;  3ECH A;  1J59 A;  5D5W B;  1SD4 A;  5DCF A;  2ZME A;  1R22 A;  3CUQ A;  4IVN A;  5LHI A;  3RKY A;  4EJO A;  1FYL A;  3QP5 A;  4LG0 A;  2B0L A;  1P92 A;  5CVJ A;  3WTT C;  1I6X A;  3ECO A;  3T1B A;  4UUV A;  4O3M A;  5HDN A;  4LJZ F;  2Y48 A;  1TW3 A;  3CUO A;  3MFK A;  1Z7U A;  4N9I A;  4LFU A;  3SFZ A;  4RB1 A;  1BN5 A;  5KVR A;  1ZRE A;  4HQE A;  2FBK A;  3O6B B;  5HLI A;  1H9T A;  4A0Y A;  1CF7 B;  5ILU A;  3LAP A;  2HYG D;  4LK0 F;  2QM3 A;  1SFE A;  3FF5 A;  3FZV A;  1GHC A;  4CZZ A;  1ZAO A;  2Q0O A;  1HXD A;  1USS A;  1SD5 A;  1BI1 A;  1F1Z A;  2X0L A;  4G6D A;  1R5H A;  3KZZ A;  4ESF A;  4KFC A;  4GXO A;  3W6J B;  1R7J A;  2ISY A;  4UV9 A;  1OKR A;  1HQC A;  1PP8 F;  1IN4 A;  1QPM A;  1OR7 A;  5DYM A;  2ZNZ A;  3P7N A;  4P9F A;  2BEO A;  1XB4 A;  1ZRC A;  1W4M A;  3G3Z A;  3HRS A;  3ZN0 A;  3JAM Z;  3RTR A;  3I53 A;  4EMS A;  3K1P A;  4M9S A;  2OZU A;  2KIF A;  3RKW A;  2BGC A;  5K5Q A;  2ZKZ A;  1HKS A;  1ZH5 A;  3F72 A;  3F8N A;  3KE2 A;  4N9H A;  5KK1 A;  2FF4 A;  3T8R A;  3I59 B;  4YII A;  2WWY A;  1LDJ A;  1U5T B;  1EH7 A;  2YX7 A;  4UV8 A;  2COM A;  2XV4 S;  1LJ9 A;  2L4A A;  4L0Y B;  1ON1 A;  4NQW A;  5LLQ A;  2QUF A;  2XAG A;  1YLF A;  2VC1 A;  1YFH A;  2H94 A;  4P9U A;  5ILV A;  1LVA A;  2XHK A;  4M72 A;  3E5U A;  4ESB A;  4KMF A;  4Q47 A;  4GO1 A;  3I71 A;  2P7C B;  3I5U A;  3KP7 A;  2RC4 A;  1W5S A;  1HST A;  3JTG A;  3F8C A;  4I01 A;  4WXC A;  3DF8 A;  2V79 A;  3GFL A;  3F8M A;  3DQV C;  1KYZ A;  3TO7 A;  3HHG A;  1Z6T A;  3QRF F;  3U1D A;  1XMA A;  4CXF A;  1YS7 A; 
#chains in the Genus database with same CATH topology
 1W0T A;  4NHJ A;  2H09 A;  2EJR A;  4XLF A;  2DU9 A;  4I0B A;  2OTJ I;  3NAR A;  1RET A;  3V4G A;  1KQ8 A;  2EFW A;  4BNC A;  1VND A;  2XIG A;  3DEW A;  4H4K C;  3TDU C;  3BP8 A;  4MTD A;  3BQZ A;  3CDL A;  3BTI A;  2MH2 A;  2F5F A;  3FKJ A;  3GWZ A;  3ISP A;  4LIU A;  3ZGK A;  2BBY A;  2ME6 A;  3CMA I;  4NNJ A;  1JGG A;  2DXI A;  2M87 A;  3OOU A;  1DP7 P;  3K1N A;  3EYI A;  3OYL A;  3RPQ A;  4GDF A;  2BV6 A;  2L7F P;  3Q9S A;  2CUF A;  1Z9C A;  2A5W A;  4XOT A;  2KZV A;  1BL0 A;  2OUM A;  4E7Z A;  4XLC A;  2DFF A;  3R0A A;  2PJP A;  5CVV A;  3SEZ A;  3M8E A;  5B5E C;  5D5X B;  2LOO A;  3HXL A;  3HRU A;  3ROU A;  2DT7 B;  1FOY A;  1VI0 A;  2VT3 A;  5CPR B;  2H27 A;  1B6A A;  3EUH C;  2CFO A;  1X4P A;  2DOA A;  5AIP A;  1B72 B;  2K4B A;  4FE4 A;  1LFP A;  2X6X A;  3HB9 A;  4A3E J;  4CYD A;  1QNT A;  3JCU C;  2RKH A;  3NQO A;  3ZQQ A;  2R92 J;  2LRD A;  1O7L A;  2DLL A;  3BTL A;  3BOQ A;  4CCO A;  3QQA A;  3RYP A;  2Y75 A;  3CJQ B;  3H5N A;  1ZRF A;  5ICE A;  1Z0X A;  3PNV A;  2R5Y B;  5F1J A;  2HS5 A;  5HOD A;  4TV7 A;  4B1R A;  4M9X A;  1S7O A;  1UEL B;  2GZW A;  4BXF A;  2DT6 A;  1ORK A;  3QPH A;  4E7S A;  4JP0 A;  3VYR B;  2FXA A;  5FLX Z;  3CME I;  3ZQF A;  2D1H A;  3MKW B;  5IY5 H;  3CC4 I;  3LSP A;  4XBF A;  2CU7 A;  3ZP5 A;  4AID A;  4XON A;  2LR8 A;  2ZSI B;  1FMV A;  2LBF B;  2H1L A;  3TBI A;  5D6F A;  4XN3 A;  1Y1V J;  4PSW A;  1YOV B;  3KZY A;  1YYV A;  2E1C A;  3CC7 I;  1K78 B;  2VJ5 A;  5HVQ C;  2LY9 A;  3EUK L;  3H9Q A;  4HX8 A;  3BQY A;  4KN7 X;  5J6X A;  1MW7 A;  3GLX A;  4OMY A;  5FLM J;  1MJB A;  2LF7 A;  2Y2Z A;  2Y69 H;  4KT6 A;  4M3E A;  3QU6 A;  2M34 A;  3OWT A;  2O0Y A;  1KU9 A;  5KNL A;  2NAZ A;  2WV1 A;  3CJR B;  1R1T A;  1JGS A;  1IN8 A;  4B3X A;  1HA8 A;  3K4C A;  2F5V A;  1IAW A;  4PJ0 C;  5M5W J;  5GAD J;  1R4N B;  4R79 A;  2XRO A;  4ENN A;  3A1Y A;  5BMZ A;  1IC8 A;  1QO0 D;  2V6E A;  3QOP A;  2Z99 A;  4AYB A;  1EH6 A;  2Z2S B;  1ZYR F;  1W5T A;  1JE8 A;  2HVS A;  4U0V A;  1FT9 A;  4EJW A;  3WTY C;  3BR0 A;  4HBL A;  5GAH J;  4ESJ A;  2O6G E;  2VKD A;  1A31 A;  2X4H A;  3BZC A;  1ZR4 A;  1FX7 A;  3L9F A;  4MIM A;  2EA4 A;  2JN6 A;  1T38 A;  1ZR2 A;  3L1P A;  4ZH4 F;  2V1N A;  1GVD A;  3DPT A;  4ZC3 A;  4BJ5 C;  2LH9 A;  2DI3 A;  2HOE A;  2XB5 A;  4IEJ A;  2DJI A;  3ZMZ A;  4E4H A;  5L3C A;  1I27 A;  2M4G A;  3SDB A;  1B9M A;  1N78 A;  3HHH A;  1MDM A;  4M6X A;  3LSG A;  4PFO A;  3O3K A;  1T95 A;  3V7S A;  2CV1 A;  4OIO F;  4EM2 A;  4KUM A;  2DOD A;  4IOA F;  3H9G A;  2E5Z A;  1UHW A;  4U7D A;  3Q5F A;  3BJ6 A;  3KCC A;  4XM3 A;  3OYD A;  4OOI A;  4ZDO A;  3HYI A;  3N97 A;  1Y39 A;  3I55 I;  3W6K B;  3OY9 A;  2EV5 A;  3CJN A;  4V19 K;  4LLN A;  1FTT A;  3E5X A;  1YIO A;  1FWZ A;  2H1K A;  3BTJ A;  2PQ8 A;  2D5V A;  3DPL C;  2KMU A;  1ZG5 A;  3PJR A;  1IXR C;  3V8L A;  3N4M A;  2P4W A;  1R5G A;  3GO5 A;  5CVU A;  4EM1 A;  1FSH A;  4MEX F;  4II2 A;  1QHG A;  1KU2 A;  2DW4 A;  2G9W A;  4XLN F;  5D8L B;  4BDY A;  1E3H A;  4Y4R A;  4BJT A;  5LEK A;  2NS7 A;  2V26 A;  3Q9V A;  1D0X A;  4UHT A;  3U21 A;  3IRR A;  1MD0 A;  4OIQ F;  3F8B A;  4ZYG A;  2IGO A;  4OWR B;  5FD5 A;  3E7L A;  4IRG A;  2FQ4 A;  4Y7N J;  1RUN A;  2LY2 A;  2KIQ A;  1Y0U A;  5CLS A;  2ZB9 A;  2CUE A;  3HOT A;  2Q2E B;  3NWS A;  3VSL A;  3BPX A;  3DBR B;  2LRE A;  2W85 A;  2BXZ A;  3K6G A;  2VPL A;  3OIO A;  2L7K A;  1RPW A;  2KIS A;  3E6B A;  3TP3 A;  3QOD A;  1Z77 A;  6PAX A;  4KYW A;  4BEH A;  4A3F J;  3CCL I;  3FHN A;  1DU6 A;  2EZK A;  2WAQ A;  4JK1 X;  4LB6 B;  2MAB A;  2UWM A;  4B43 A;  4IHS A;  3MZH A;  2OV7 A;  2JMW A;  1O4X A;  1ETY A;  3NWT A;  1HOM A;  2DFI A;  2QSF X;  4M74 A;  5D4R A;  1S3J A;  2JTV A;  3QYF A;  4PUS A;  5K7F A;  1WKM A;  4U88 A;  1FP1 D;  2MC3 A;  2DAO A;  3PNT A;  2W4S A;  1HDP A;  3H3Z A;  3E6C C;  5GTI C;  2DA6 A;  3IWZ A;  2LKP A;  5L3G A;  3H9J A;  4YEL A;  5K1Y A;  3NAU A;  3V7R A;  1XC5 A;  2PLY A;  3HOX J;  3GTM J;  4ZZD A;  1MSE C;  2VQC A;  4LK1 F;  2F4O B;  1MBK A;  2L0K A;  5KHD A;  2D45 A;  4Y33 A;  3KX2 A;  3HJE A;  1OYY A;  2K5C A;  1E17 A;  1H9G A;  2AQF A;  2QLZ A;  2F6C A;  2CUJ A;  5J40 A;  2GBY A;  3G73 A;  3PQK A;  4I7H A;  4RB0 A;  5FKL A;  5ILS A;  4ZYA A;  3GME A;  3K4J A;  2P5V A;  3TO9 A;  5DUI A;  4D5C A;  1T08 B;  3GCM A;  2JWT A;  1NK3 P;  2R0Q C;  3DTK A;  3IH2 A;  2JUC A;  2HGC A;  1VFC A;  4HA8 A;  5L3E A;  4AIJ A;  3COA C;  2VON A;  4E7K A;  3MQ0 A;  4DGW B;  5J1R A;  1K4T A;  3GFJ A;  1BC7 C;  4V2G A;  3IV5 A;  1LFB A;  5K7Z A;  3HRT A;  2HXO A;  1Z6R A;  2IGN A;  2IA2 A;  3BY6 A;  3MVP A;  1KON A;  3MN2 A;  1OIS A;  2E2J J;  2P5K A;  3AL0 C;  2KRF A;  4RB3 C;  3S3N A;  4E7H A;  5A2Q K;  5JVT A;  1TQP A;  3K69 A;  2VBZ A;  3FMQ A;  4P1W A;  1TWH J;  2L02 A;  2L7M P;  2QGU A;  2MSY A;  4XLA A;  4LMY A;  2L2O A;  2VBX A;  5F1R A;  2DDB A;  5E1X A;  4RGR A;  2FBI A;  4IX7 A;  2F48 A;  2Y0M A;  3BG3 A;  3O8H A;  2X6Y A;  1FBS A;  3CO6 C;  3GTK J;  1WRJ A;  5FLV A;  3TED A;  3AAF A;  1G3Y A;  1ZGW A;  1S8N A;  4CYC B;  3CDH A;  1VQ9 I;  3ZMS A;  1WVR A;  4KIS A;  4F91 B;  1LB2 A;  1HW2 A;  3BTC A;  1P2F A;  2V1D A;  4E70 A;  3WGG A;  1GV5 A;  3DXJ F;  5C44 J;  2EH3 A;  1MMD A;  3FM3 A;  1B59 A;  2FX0 A;  2EIM H;  1IV6 A;  4DZJ A;  2ZBK A;  2KFD A;  3DPU A;  3S17 J;  4HNU A;  5FRO A;  2EK5 A;  3CTA A;  3LMM A;  3R6S A;  3GTG J;  2ESN A;  2EV6 A;  4HX4 A;  4PJL A;  3R4K A;  1KYW A;  2DCE A;  4L18 B;  4ENM A;  1D1A A;  3TO6 A;  2XDV A;  2F5C A;  1P7I A;  2CV0 A;  3BR5 A;  3DCF A;  4ZTJ A;  4XRS G;  3U9G A;  2LLK A;  3OOP A;  1F43 A;  3Q0V A;  1IDZ A;  3E1S A;  1P9Q C;  4UVB A;  3K70 C;  3E5Q A;  1AHD P;  2YPR A;  1IZ1 A;  1UG0 A;  3E3V A;  3BG7 A;  3B6C A;  3W2A A;  3F6O A;  1ZLK A;  2FSW A;  5JFR A;  1I39 A;  1T8I A;  2M8E A;  1W36 D;  1A04 A;  4XNF A;  1FEX A;  1U9N A;  5FKK A;  2DMQ A;  4NDL A;  4RB2 C;  3TMO A;  3HOU J;  2XVC A;  2HTJ A;  1B8I B;  3FBI B;  2K3P A;  4P96 A;  2VKH A;  4JQF A;  1FBQ A;  3ZQC A;  5EEA A;  1FBU A;  1T33 A;  1CF7 A;  2OQG A;  5ED4 A;  2OZ6 A;  3I4P A;  2IP2 A;  2EPF A;  4PK4 A;  2VXD A;  1V3F A;  3QU3 A;  4YFK F;  2A07 F;  2P6T A;  1TT0 A;  2JVG A;  2XAF A;  3BR6 A;  3M1C A;  5E8G A;  3RKQ A;  5BS6 A;  2DMN A;  1K61 A;  4IHV A;  3RZO J;  2RDP A;  1G59 A;  2FUG 2;  3JSP A;  2DTR A;  1RI7 A;  4AC0 A;  1CQT A;  2CG4 A;  2GXA A;  2PFB A;  4DQ2 A;  5LGU A;  1RUO A;  2FRH A;  3A01 B;  2VUM J;  3DEE A;  2ZXW H;  3JRH A;  3L7W A;  1G6N A;  1LE8 A;  1I6H J;  1POG A;  1XGM A;  2NS8 A;  3L2R A;  1DP3 A;  2HKO A;  2M0M A;  4F7Z A;  5E3M A;  2H6C A;  1YW9 A;  4MQ9 F;  2GWR A;  3H5R A;  3ESW B;  2PMH A;  3M8F A;  3RJP A;  3VOE A;  2ZME C;  1ETW A;  5BPD A;  2R93 J;  4BXX J;  1GDT A;  3CES A;  1XGS A;  1UCR A;  4AIK A;  2XPU A;  2K40 A;  1A6I A;  2BW3 B;  1A36 A;  4M6Y A;  4MTE A;  1GV2 A;  3KET A;  3R60 A;  2E19 A;  1P6R A;  2XF5 A;  2K9N A;  5LGT A;  2KIM A;  1T0F A;  1Z3Y A;  1VTN C;  2KIU A;  3LSM A;  3PL8 A;  2IVM A;  1OCP A;  2F5D A;  2LF8 A;  4JYK A;  3HOY J;  2A6H F;  4CA0 A;  2E5N A;  2EV0 A;  5IP6 A;  4KMU X;  5IT9 K;  1BI3 A;  2R7V A;  4L9N A;  1SEU A;  2MLK A;  5HS9 A;  1R4M B;  4RGS A;  1OCC H;  4ITV A;  2FMY A;  4L5J A;  1Q1H A;  3I59 A;  3BWG A;  5E3N A;  2GXG A;  1U5T A;  1OMI A;  5H2F C;  3AG3 H;  2CO5 A;  4I98 B;  3L2U A;  2RRE A;  3I56 I;  2PMZ N;  3FIW A;  2MA3 A;  1O7F A;  4MGR A;  4XQF A;  4KIT B;  4WXH A;  1I5Z A;  4PSX A;  4E6K G;  5LRS A;  2MC4 A;  1TT5 B;  2XAH A;  1PP7 U;  2DA5 A;  3OSF A;  4K2E A;  4JOM A;  3IHU A;  1QRY A;  4IXA A;  2DOF A;  1LEA A;  1D5Y A;  2JSP A;  4BQN A;  1LNW A;  1JUP A;  2MH9 A;  5FB2 A;  2XAQ A;  1SC7 A;  3GZ5 A;  3DFG A;  1U8R A;  3F0C A;  3ERM A;  3BCB A;  1OQY A;  3LA7 A;  2BE5 F;  1ZGJ A;  4FIS A;  3IRQ A;  2V4J C;  2E1N A;  1DPR A;  5HS7 A;  1RR8 C;  2DYS H;  2DTZ A;  5E8I A;  3QYB A;  4XSX F;  4RGX A;  2KZG A;  2M2E A;  4CH7 A;  2FEZ A;  3D5R C;  1SVM A;  1PUF A;  2V9K A;  4ASN A;  3AKZ A;  2VOO A;  3LFU A;  1MBF A;  1AA7 A;  2YSR A;  2NVU B;  2XGD A;  3WTS C;  4GRI A;  4A3L J;  4BAY A;  3A03 A;  4MFD A;  3W3C A;  5J47 A;  1VQN I;  5DD8 A;  4ZTF A;  1IRX A;  5ICG A;  4XLP F;  2HDD A;  2VT2 A;  1K6Y A;  2XRN A;  4RBO A;  1T39 A;  4BUP A;  1SFU A;  3RYR A;  4HLY A;  1ZQ3 P;  1OR7 C;  3K4K A;  3TOB A;  3CP8 A;  4DYR A;  5TJJ A;  4MHG A;  1MJ9 A;  2F2E A;  4ON0 A;  4EM0 B;  1IN6 A;  3BG9 A;  3C2H A;  5AIQ A;  2XC7 A;  2OF7 A;  5JLX A;  3FXR A;  3VYS B;  4KN4 X;  1O57 A;  1X2N A;  2WY7 Q;  1K79 A;  3CMY A;  2L01 A;  4P55 A;  2C6Y A;  1ZK8 A;  1B4A A;  3TW7 A;  3ZQG A;  3BRO A;  1TWF J;  3KLN A;  2V7F A;  2ID3 A;  3T0Y A;  1YX3 A;  1HKT A;  4BE2 A;  4HNT A;  4A6E A;  2W57 A;  2CYY A;  1X3U A;  3FWE A;  4II3 A;  2TCT A;  5IYB J;  3ZRG A;  3S1N J;  4C3I J;  4A3M J;  1L3L A;  2BY2 A;  5FJ8 J;  1KU3 A;  1XN7 A;  3K4N A;  5L3F A;  4IHX A;  2P7V B;  4BU2 A;  5J1Y A;  1R1U A;  2J5O A;  2NS0 A;  1LFU P;  4A6D A;  2QBY B;  1S7E A;  2CW0 F;  3LA2 A;  1YIT I;  1EA3 A;  2UUZ A;  2R7O A;  3C3W A;  1YIJ I;  3SZP A;  4KIB A;  3DLL F;  2CQK A;  2F4I A;  2VL8 A;  3ONQ A;  1XMX A;  1YG2 A;  2PN6 A;  3ZMT A;  2VPR A;  3H36 A;  5EG0 B;  1B72 A;  1RIO H;  3UR3 C;  1WCM J;  3CCY A;  3OR1 C;  4IRH A;  3HTU A;  3H3V K;  5LRR A;  3F3X A;  1YW7 A;  1U6G A;  3GYH X;  4HG2 A;  4NBQ A;  3FXK A;  4X6A J;  5CYV A;  2J5P A;  2HQ5 A;  1D1C A;  3FM5 A;  1K4S A;  1IRG A;  3DV8 A;  2QKL B;  2ECB A;  2IAI A;  4A5M A;  1UG2 A;  3ZQ7 A;  5F0C A;  3DLA A;  5J1U A;  1TWG J;  3PUF A;  4U0Y A;  3ZOB A;  4LGW A;  4NC8 A;  3S16 J;  2ZJP F;  2HZT A;  2VJ4 A;  1Z3X A;  1W7P B;  4A3I J;  1G4D A;  2P8T A;  1R00 A;  5ERI A;  2ETH A;  1VQ5 I;  3WGH A;  2LBF A;  5J8C A;  4MO7 A;  3WU2 C;  2EIL H;  1EH8 A;  3GFM A;  3PSF A;  1W7P D;  5F08 A;  5DTD A;  2CQX A;  1SVL A;  1K78 A;  2E34 A;  3JW4 A;  2KL4 A;  5HDK A;  2XF6 A;  1Y0N A;  2XAU A;  2YS9 A;  1DGW Y;  1ZGA A;  1ENH A;  3WG9 A;  3K4M A;  3B73 A;  3FXQ A;  3KIO A;  4BXU A;  4PDK A;  1OFC X;  2EIK H;  3DBH B;  3WHB A;  4EQQ A;  1RR7 A;  3I58 A;  3BT9 A;  1OLT A;  3W2W A;  3SFI A;  2ZJR F;  1TP4 A;  4H0E A;  2ZO4 A;  1SFO J;  2R7Z J;  2VE8 A;  2UXN A;  2LDU A;  3TL4 X;  3C7J A;  3TOA A;  3S14 J;  2XB0 X;  5DCM B;  3HC7 A;  1U9O A;  2JT1 A;  2ZJ2 A;  4C30 A;  4JX6 A;  5J4V A;  1MBJ A;  2HYJ A;  2R3S A;  3FXO A;  4RAZ A;  2V1X A;  5IP7 J;  2E1M C;  4BKX A;  5IYD J;  2NNY A;  4PFP A;  3MKL A;  4DW6 A;  5FFX A;  3RQI A;  3HUG B;  2NYX A;  5H6Q A;  3FXU A;  1VQP I;  1R9T J;  2K02 A;  4A12 A;  3IH3 A;  2EZH A;  4XR6 A;  1KQ0 A;  3KLO A;  4B3A A;  3HTS B;  4KDP A;  4PZJ A;  1QZZ A;  5A2Q Z;  5TIS C;  2BHZ A;  4BQA A;  2DO7 A;  1J0R A;  2E35 A;  1HC8 A;  5EEH A;  3A0B C;  2O3F A;  4DIQ A;  2O8X A;  2Z1D A;  4CO8 A;  4DBQ A;  4RM3 A;  2IT0 A;  2HVR A;  3OS1 A;  2IS4 A;  2E7X A;  2HWV A;  2NRA C;  4XID A;  4BHP A;  2D2W A;  3EDP A;  2HOA A;  5HNH A;  5EEG A;  2CSO A;  2QQ9 A;  1XGN A;  3QWL A;  2ZC2 A;  5GAG J;  2DYR H;  4E7L A;  1WHU A;  2BXY A;  2JA7 J;  1YS6 A;  4BDZ A;  2LKS A;  1WPK A;  3GVA A;  5ICC A;  3PIP F;  4UXN A;  1ZG1 A;  4XLH A;  4L9J A;  2VIX A;  2VLA A;  4U0W A;  2JUG A;  5H6R A;  2CV2 A;  1HW5 A;  2XKO A;  4XMY A;  2E1O A;  4XIC A;  3PFI A;  3S32 A;  1G8X A;  2E1M B;  3QAH A;  4QLC U;  2N8G A;  4X0G A;  4KNY A;  4IF4 A;  5E20 A;  1M1E B;  2DK8 A;  5M5Y J;  2NVT J;  4PJM A;  2CFX A;  1IV8 A;  1BJA A;  2ESH A;  3J80 K;  2NXN B;  4J19 A;  3GTO J;  2E7W A;  4IRI A;  3LA3 A;  2JSC A;  2Q2E A;  3MKY B;  3GEZ A;  3KP4 A;  3CF5 F;  2L5Q A;  4IHT A;  4EVI A;  1D8J A;  2V9P A;  1IO2 A;  2LK2 A;  2XKP A;  2XSJ C;  1DQU A;  2Q8K A;  1LUJ B;  4PGH A;  2PMZ A;  3OIP A;  3GX4 X;  1REP C;  3JSO A;  2NVX J;  1S9H A;  5D6E A;  4ZYH A;  2ZCW A;  2XPV A;  3U2R A;  3Q0W A;  1BR1 A;  3JAM K;  5M3M J;  2NOJ B;  2B9S A;  1W5C C;  2GOM A;  3T8T A;  4UUT A;  1R58 A;  2RV8 A;  1RNL A;  1IRF A;  1WJC A;  1LEB A;  2OCC H;  2ADU A;  3K4B A;  3T5X A;  2HDW A;  3VEP A;  1HCR A;  2HTS A;  1WJD A;  3S93 A;  2XSD C;  1IDY A;  1A35 A;  3NEU A;  3PQJ A;  1P4A A;  5GAE J;  1ZG3 A;  2DQL A;  2PJR B;  1E0E A;  1X3Z B;  2HOT A;  4DYC A;  1ONV A;  3VSK A;  5K7H A;  4WK8 F;  3F6V A;  2IA0 A;  1EJ9 A;  3F8F A;  3GF2 A;  2R7D A;  4B44 A;  5LGN A;  3LAJ A;  4AWX B;  4Q4Z F;  5M3F J;  1HLV A;  5LHH A;  1FMW A;  1F4K A;  1B9N A;  2E71 A;  3H0D A;  4XOP A;  3OYJ A;  1U3E M;  4FT8 A;  4DOZ A;  3WTZ A;  1BBY A;  3OR2 C;  2R7R A;  5FD6 A;  2R4G A;  1Z67 A;  3S8P A;  1TNS A;  1XGO A;  2HZD A;  2V6C A;  2AXL A;  2LVS A;  2ELH A;  3D5S C;  5H20 A;  4DBR A;  1T2K A;  5C4X J;  3HGG A;  4HSR A;  4XKV A;  2HR3 A;  2RVC A;  2ZXJ A;  2RQP A;  4KIC A;  3WU0 A;  2JA6 J;  1YO5 C;  2VOP A;  1BR2 A;  2FOW A;  3WU1 B;  4ABZ A;  3OYH A;  4IHW A;  3S2H J;  3X2Q H;  3JTH A;  1R5I D;  1WI9 A;  3HOS A;  4KIF A;  3KP3 A;  2AQE A;  1ZRD A;  3F23 A;  1FP2 A;  4EJV A;  1TWA J;  1U0J A;  1IJW C;  3OSG A;  2CH0 A;  4N4N B;  2NOG A;  5LD2 C;  1STZ A;  4MLO A;  5DS9 A;  3R0J A;  2QYO A;  2LSO A;  2W84 A;  5BPI A;  4A0Z A;  2ZNY A;  3DU6 A;  2HYF A;  3KZI C;  2K9Q A;  2STW A;  2K4J A;  3OYN A;  2VQL A;  5FFZ A;  5TGT A;  2MG4 A;  4CYC A;  2L9V A;  2VXZ A;  4C2M J;  3FXM A;  4XRM A;  1NK2 P;  2A5Y B;  2PG4 A;  3I3L A;  1L0O C;  3KP6 A;  3UNG C;  2VJI A;  1UJ8 A;  2GM4 A;  1GXP A;  3QPT A;  3JRG A;  3HIF A;  5B3S H;  3KP2 A;  2WV0 A;  1EF4 A;  1YQA A;  3ZPL A;  4OU0 A;  3VYU B;  3JRE A;  2ACJ A;  2X51 A;  5FRM A;  2A05 A;  2HNH A;  2DPU A;  3HKZ N;  2NVY J;  5EDN A;  1V5F A;  1JHF A;  3S3O A;  3CF2 A;  4DNC A;  3CDI A;  5EGO A;  5CVI A;  4JBA A;  2DMP A;  4EGY A;  4QTR A;  3G2B A;  4BQQ A;  4L5I A;  2W25 A;  2LY1 A;  4FX0 A;  3K4L A;  5BOX A;  4BE1 A;  2QKM B;  4QWQ A;  3BDD A;  4U7B A;  4BBS J;  1BM9 A;  5CJ9 A;  1WJF A;  2QSH X;  1Y1W J;  4Y15 A;  2NNN A;  1UST A;  2RNJ A;  2R7T A;  3GZ6 A;  3TP0 A;  5JI6 A;  4RAF A;  2V9V A;  2KDZ A;  4AUX A;  4ANJ A;  2OA4 A;  4I6Z A;  1FIP A;  2UZK A;  5DV5 A;  3V8K A;  5GTH C;  4LLL A;  4GFB A;  2Z33 A;  1X2M A;  1B8I A;  1WJ5 A;  2YU9 J;  4L5E A;  4QSH A;  2FNP A;  4UNO A;  2HPI A;  3PUB A;  4X1E A;  4BH9 A;  3SHF A;  2GXB A;  5FO5 A;  5FLX K;  2A61 A;  3OL4 A;  1FYM A;  1D0Y A;  3RKX A;  3CO7 C;  4Q5S F;  3ULQ B;  1E3P A;  4GYI A;  1EV7 A;  4N0B A;  4RAY A;  3U1K A;  5DEQ A;  3VWB A;  4G7H F;  4HZF A;  2PX9 A;  3MZ8 A;  4HST A;  1APL C;  3F22 A;  2DA1 A;  3CCS I;  3H1C A;  1JKP C;  4XKB A;  4CDG A;  5E3O A;  5D5V B;  2HQN A;  3A01 A;  1AU7 A;  2XF7 A;  2MD0 A;  1VF9 A;  1O3R A;  3V42 A;  4PJJ A;  1U78 A;  4HDV A;  1O3S A;  3M8J A;  1XD7 A;  3L2W A;  2NVQ J;  4I99 C;  3K9T A;  1G2H A;  1VQ4 I;  2CGP A;  3KFW X;  4FE7 A;  5KCM A;  2BW3 A;  4EJT A;  4OIR F;  3ZR8 X;  3S15 J;  3SXY A;  1J2X A;  3AL0 B;  3A02 A;  4WF2 A;  4YRV A;  2O5R A;  4M9Z A;  2BY3 A;  2Y31 A;  4HAM A;  4B48 A;  1R71 A;  1UMQ A;  2ECC A;  1XMK A;  1P4W A;  2FD5 A;  1TW2 A;  2EB7 A;  1NTC A;  1K6O A;  3GTJ J;  3FHZ A;  1MMA A;  4UVA A;  3CZ6 A;  3VB2 A;  4FQG A;  1LQ1 A;  3SYT A;  1QA6 A;  2XGX A;  3C1D A;  2W1O A;  1UAA A;  5F64 A;  4S04 A;  4ZYD A;  2IEK A;  1X1D A;  4GCV A;  4CCM A;  2VI6 A;  3DTE A;  1LKX A;  3H92 A;  1FZP B;  2A6E F;  2R5Z B;  2LKX A;  2X6O A;  5C3E J;  5E79 C;  1BW5 A;  3OMY A;  1QGP A;  1JHH A;  3EQL F;  4GGG A;  3E6D A;  5IOZ A;  5EYR A;  1WZ2 A;  1FNN A;  2W48 A;  5GPC A;  4UUS B;  1J5Y A;  1N25 A;  4M6V A;  4RM2 A;  4UB6 C;  3HSF A;  4BYY A;  3MEX A;  3WE2 A;  2P0W A;  3ABL H;  3IKT A;  2CW8 A;  4W97 A;  1J09 A;  3HEF A;  4HYE A;  3TQN A;  5DD4 A;  1K7A A;  4CHU A;  2QQB A;  2L4M A;  4EV0 A;  3CUQ C;  4D5F A;  5JHU A;  1Y8Q B;  3K70 D;  5ICF A;  3EET A;  3OYB A;  2IRF G;  5J4Y A;  3RCO A;  1XS9 A;  1S6L A;  3D5L A;  1V5E A;  1OJL A;  4RS8 A;  1XCV A;  4YFN F;  3ERE D;  2WAD A;  1D0Z A;  3H5A A;  1F9N A;  1WH7 A;  1R1V A;  2BOL A;  2G7H A;  1SD6 A;  2O7O A;  3K0L A;  4ZYE A;  5GP9 A;  2M1B A;  5DDG A;  2MYS A;  2XRL A;  3IH4 A;  1RKW A;  5JLW A;  3GW2 A;  1AKH B;  4G7Z F;  1J9I A;  1V4R A;  1SMT A;  2DA4 A;  4PGG A;  1QZY A;  2FA5 A;  3DU5 A;  1O3Q A;  2R7W A;  4A69 C;  2IGK A;  2VJJ A;  2WTE A;  5FKO A;  2IS6 A;  4FHT A;  1ZN2 A;  2RQQ A;  2W7N A;  1T0F C;  2HFH A;  2DBB A;  2KP6 A;  2X48 A;  5FKN A;  1BI0 A;  2X1D A;  2QWW A;  3H35 A;  1OYW A;  2COB A;  1DUX C;  1S5L C;  1BOA A;  1WJB A;  1OCZ H;  3F9K A;  5CKT A;  1IN5 A;  3OV8 A;  3RDI A;  3R61 A;  2A6T A;  4HPQ A;  3J7A Y;  2V1U A;  4ETS A;  2ZME B;  2VE9 A;  3CUQ B;  1T98 A;  3TGN A;  2EFN A;  4EJU A;  1YX5 A;  3TKY A;  3M7G A;  1PYV A;  2UXX A;  4E7I A;  3HOZ J;  4BHB A;  2XAJ A;  2VC0 A;  3AG2 H;  5L3B A;  4AU7 A;  1U5T C;  5JVG F;  1MNE A;  2LC2 A;  4LG0 B;  4IJA A;  4RGU A;  2RN7 A;  1I1S A;  3LNQ A;  2OQR A;  1MJA A;  2OD5 A;  5F27 A;  2FE3 A;  2GA1 A;  2LP0 A;  4HEA 2;  2QBY A;  2VBY A;  1ETK A;  2ZJQ F;  3V8J A;  4C9Y A;  4BHC A;  5FGM A;  5D8K B;  1HKQ A;  1BIA A;  1YE9 A;  1R23 A;  3J80 Z;  5EG0 A;  2EIN H;  3GZN B;  5D5U B;  2XAS A;  3KEO A;  3OL3 A;  3PIO F;  1ITY A;  4QPQ A;  2HPM A;  1BA5 A;  3M4O J;  1J7K A;  1MIJ A;  2ELK A;  3OYI A;  4G8X A;  4DZP A;  3OS2 A;  3G1L A;  4O5V A;  1BC8 C;  1JJ6 C;  2F4M B;  3ELK A;  4L9V A;  3VPR A;  1EKE A;  1WQ2 A;  1KQ9 A;  4LIT A;  2IJL A;  2ISZ A;  1X58 A;  3HKZ A;  2VQG A;  3A0H C;  4XKW A;  1WSU A;  1E2X A;  1Z91 A;  2MW8 A;  1W7P A;  3HSE A;  2E60 A;  4XLE A;  2WB1 N;  4QIW N;  2DMT A;  4ENK A;  3BLY A;  3LFK A;  2A3S A;  1TC3 C;  2HOS A;  1NHA A;  2ID6 A;  1XSX A;  1S7A A;  1TBX A;  2LTP A;  1AWC A;  3PNY A;  2G0E A;  3IP4 B;  2JA8 J;  1IN7 A;  1BW6 A;  2BY0 A;  2OAZ A;  3G1O A;  1Y6I A;  1MBH A;  2M7A A;  4CCK A;  3M9A A;  1D1B A;  2STT A;  4HX7 A;  1R6R A;  3ASN H;  1X4O A;  5K5O A;  2BVM A;  2AS5 F;  3P9K A;  3QP6 A;  1BI2 A;  3LQR A;  3IL2 A;  1FPQ A;  3OYK A;  1JUM A;  3DTI A;  2XUB A;  1YI2 I;  4IL6 C;  1ZTR A;  5K5R A;  5DCM A;  5CQG A;  2JA5 J;  3CC2 I;  3E97 A;  1I1G A;  3PO2 J;  2IBD A;  1F5T A;  2DDA A;  1BIB A;  2R7U A;  4J00 A;  1ZHF A;  1GUU A;  2PBI A;  2VKE A;  2DPD A;  1NG7 A;  3WTU C;  2O03 A;  2KJC A;  1K83 J;  2M8G X;  2VBW A;  1WFX A;  3HUG A;  3IC7 A;  3P9I A;  2K27 A;  4RA2 A;  5LEJ A;  2R5Y A;  4BE0 A;  2E2I J;  1S72 I;  5AON A;  2FQ3 A;  2O9L A;  2WAF A;  1BOB A;  1IUY A;  2QQ8 A;  3QYE A;  1VQK I;  1T6S A;  3J81 K;  3L2V A;  2KLO A;  1X1C A;  3E6M A;  1BJZ A;  1H0M A;  4NC6 A;  2OC6 A;  1V54 H;  2B7E A;  1XG1 A;  5FKM A;  3MCZ A;  1VZ0 A;  2K9S A;  4AVZ A;  5C4J J;  4M3B A;  3I64 A;  2JPC A;  4I09 A;  5HLT A;  3Q3S A;  2UV1 A;  4D0P A;  4M3D A;  1VQM I;  2LFB A;  2PMU A;  4M3G A;  4KA4 A;  1TQI A;  1WGX A;  2GIV A;  5JR3 A;  1C0W A;  1YJW I;  3DP7 A;  1R36 A;  1TNT A;  3GFI A;  3MD2 A;  3QOE A;  3O2P E;  1TL8 A;  2LNB A;  2M0C A;  3EUH A;  5LHG A;  4HW0 A;  5F04 A;  1UB9 A;  2HI3 A;  2HU9 A;  4NQW B;  5JHF A;  3JRD A;  3B02 A;  1GXQ A;  2TDX A;  1Z05 A;  3I54 A;  4A3K J;  2QZ8 A;  4AD9 A;  1YRN B;  1P4X A;  3ZN1 A;  4AIH A;  2VAS A;  2FBH A;  1N77 A;  1WWX A;  1OPC A;  3D0S A;  2QA4 I;  4G94 A;  4CGZ A;  2ICW G;  1OCO H;  1FOX A;  3TDZ C;  1JTY A;  4MNU A;  3FMS A;  1FOK A;  2D1V A;  3ZXS A;  2CQQ A;  2IGM A;  3L09 A;  3KEY A;  2R7F A;  2DQR A;  1OCT C;  5E18 F;  4CCL A;  5TRD A;  2IXS A;  1XDU A;  2Z3Y A;  4HOB A;  4XK4 A;  4I02 A;  3DWL E;  4LD5 A;  1KU7 A;  1U8B A;  1CGP A;  2LMD A;  1B1B A;  2HQR A;  2QQA A;  5E1Z B;  3CCU I;  1IXS B;  3GTL J;  3BG6 A;  1Q1V A;  1Y8R B;  3WTX C;  2X85 A;  1Z1D A;  4I2O A;  5EZH A;  5B66 C;  1W0U A;  3V7C A;  1AOY A;  4Y17 A;  2OU2 A;  4OMZ A;  5HLG A;  2WY8 Q;  4HDU A;  3HRM A;  1IF1 A;  1MH3 A;  3LST A;  2PJR A;  3L00 A;  4BGD A;  5HNF A;  4OAY A;  2LD5 A;  4XRF A;  2Z9O A;  2MBF A;  4A5N A;  4G9Y A;  2HQA A;  4M3F A;  1SVO A;  3BCA A;  4KIG A;  4W1U A;  1IW7 F;  2P81 A;  1N75 A;  4MEY F;  3D1N I;  2ZXH A;  3RI4 A;  3MWM A;  4YEJ A;  1JT6 A;  1QQI A;  3GUD A;  4G12 A;  2JJ7 A;  2KRH A;  1JXS A;  2CQ7 A;  1Z7L A;  3FKI J;  4FET A;  1TWC J;  4RMN A;  3KP5 A;  3CCM I;  3BZK A;  3OYM A;  4A0X A;  1OYI A;  1TLH B;  1ULY A;  2IA1 A;  1YJN I;  4WX9 A;  4M71 A;  2L9R A;  5E1W A;  1IRZ A;  3WE3 A;  1HW1 A;  2L54 A;  3BG5 A;  5LBQ A;  3OYC A;  1IXC A;  5D4S A;  1XPX A;  3S2D J;  4HF0 A;  3RPU A;  4GYG A;  1D8K A;  4BAC A;  2IS2 A;  1G3W A;  4HV6 A;  1MNM C;  2ELJ A;  1H89 C;  4CIC A;  5HDG A;  4Q48 A;  4D7M A;  2KJB A;  1VQL I;  4S05 A;  4A3D J;  2H6B A;  4G6Q A;  1ZAR A;  4BBR J;  2YUS A;  2QVO A;  3E0J B;  1RZ4 A;  2L3D A;  2M9H A;  1ON2 A;  5CVR A;  5HLH A;  1QPI A;  3KYC B;  4XSZ F;  2GA2 A;  3K7A J;  4EAT A;  3BR3 A;  2YX4 A;  3MMY B;  3DKX A;  3P5J A;  1HF0 A;  2OBP A;  3ZMV A;  2EWN A;  3NRV A;  2HEO A;  2GQQ A;  4CUG A;  1MBE A;  4A2U A;  4F3Q A;  2HKX A;  2ZFU A;  5KAI C;  4XN0 A;  3VOD A;  1FTZ A;  4D7N A;  2KPM A;  3L2C A;  4BQO A;  3W6V A;  4OIP F;  3HOW J;  4ZZL A;  2CW7 A;  2YU3 A;  2XPW A;  2WAE A;  4XOR A;  4CZC A;  3MAJ A;  4U87 A;  1F36 A;  1QVT A;  3REO A;  2I8D A;  4B8X A;  1E3O C;  2RAE A;  3FDY A;  3C18 A;  4IO9 F;  1O3T A;  1D5V A;  2XGE A;  1RES A;  3KPH A;  4JX5 A;  4R8H A;  3EYY A;  3DEU A;  1Y56 A;  5DM7 F;  3VFZ A;  2A68 F;  3HBL A;  2P5L C;  3SQN A;  3RZD J;  3BPV A;  2DK5 A;  4HF2 A;  1QU3 A;  1T56 A;  2EBI A;  3LSJ A;  3O8G A;  4IPA A;  1KGS A;  5B1A H;  4G7O F;  2CQN A;  2DOE A;  3K2Z A;  3PSI A;  2A69 F;  2CUZ A;  2X1C A;  3ABU A;  4C3J J;  2DMU A;  5EJC A;  1LDD A;  3G4S I;  1PJR A;  4LB5 A;  3J7A O;  5CQE A;  3ABT A;  1J75 A;  3RPU D;  2R7S A;  1LVK A;  2MLG A;  4LLG F;  1VQ7 I;  2M3A A;  3RSN A;  3H3U A;  2GAU A;  3FIS A;  2WB1 A;  2JPB A;  2ZSH B;  1MZB A;  4PJN A;  1LPQ A;  2M30 A;  2Y30 A;  4CCJ A;  2BZT A;  1MMS A;  2KHM A;  3I9V 2;  2MD5 A;  1PUF B;  4A93 J;  4BL0 B;  4EGZ A;  3AG1 H;  4HQM A;  1SD7 A;  2YR2 A;  1YW8 A;  5DUK A;  5IT9 Z;  2KKO A;  3ZMU A;  4MFE A;  1XSV A;  2VQH A;  3SZT A;  3LWF A;  1GVJ A;  1X1P A;  3OYA A;  5F6F A;  3CCR I;  4AVP A;  1MDM B;  5IT3 A;  1RKT A;  3BJO A;  3FMR A;  3WHC A;  1ETX A;  3DBL B;  4O6J A;  1WJA A;  3IUO A;  2ME0 A;  2PI0 A;  2FJ1 A;  1PUE E;  3GXO A;  2P6S A;  2G7U A;  4WXD A;  5L3D A;  4MQV A;  3F21 A;  1FY7 A;  1SAN A;  3WOD F;  4FX4 A;  2CWE A;  1JKR C;  2DFH A;  3S1Q J;  3K1M A;  1KZH A;  2OCE A;  4G6T B;  2DT5 A;  2JRM A;  2PEX A;  2K85 A;  2K9L A;  4ENJ A;  1DDN A;  2M4K A;  1RRJ A;  1FIA A;  1ODD A;  3BJA A;  1TQM A;  2DA7 A;  4V2F A;  1U2W A;  3I0T A;  4HLX A;  2RGV A;  5HOO A;  2Y9Z A;  3ZQI A;  2L7Z A;  3CCQ I;  1QBJ A;  2KT0 A;  2QEN A;  1PDN C;  4IQJ A;  1JUS A;  1ETO A;  2GIZ A;  3LOC A;  4FTH A;  2VOD A;  4XL9 A;  1G3S A;  1V5G A;  2JQ7 A;  4C2U A;  4I0A A;  2RNG A;  2F5E A;  3AG4 H;  4UVC A;  2EFP A;  3OYE A;  2QEX I;  4IKF A;  2IW5 A;  4F93 B;  2FOK A;  4C2T A;  2L9S A;  2EFQ A;  4YFX F;  4ZDP A;  2VN2 A;  4WCG A;  1XDS A;  1VQ8 I;  3DKW A;  1DU0 A;  1JJ8 C;  1ERD A;  4L9T A;  5GPA A;  4OIN F;  1ZLJ A;  2IPQ X;  2JZY A;  3A4C A;  4ZDL A;  3ZQH A;  5BQT A;  3HPH A;  1WJE A;  1ACI A;  3BZ6 A;  3P9C A;  2AO9 A;  5M5X J;  3KEQ A;  3HDD A;  3K10 A;  3K2A A;  4HV5 A;  4BEH B;  1YHQ I;  4Y13 A;  1D3Y A;  2GOX B;  2W24 A;  3SEQ A;  1FJL A;  4BJ6 C;  4Y52 J;  3I4M J;  1FSE A;  2MGQ A;  1G3T A;  4OAZ A;  1I3A A;  4F92 B;  4FAS D;  2R5Z A;  1W36 C;  4PCQ A;  3CQZ J;  4B4C A;  2FML A;  3MZY A;  1YTY A;  1HBX G;  3CMM A;  1NG6 A;  3ABM H;  3M1E A;  2HVQ A;  4NB5 A;  1UFM A;  4P5O A;  3J7Y J;  2Y0S N;  1FC3 A;  4UUS A;  4YIR X;  1UZC A;  4BY7 J;  4BS9 A;  3WGI A;  1XCB A;  1XTA A;  2Z5U A;  3RIR A;  4L0Z B;  4KT5 C;  2OPT A;  3G71 I;  2LYC A;  1GLN A;  2BYV E;  2ZFW A;  3ML6 A;  3IKV A;  2QF7 A;  3S2W A;  3OS0 A;  3FX3 A;  3SZG A;  1QZE A;  3G6E I;  2JRT A;  3WTW C;  4JX4 A;  2EA2 A;  2VB6 A;  1S29 A;  1UHS A;  3BR1 A;  5IYC J;  2K86 A;  3CLO A;  5E17 F;  1SFX A;  3GTP J;  3HSR A;  2WC2 A;  1X19 A;  2BVL A;  3EPZ A;  3WTV C;  4R1H A;  5HS8 A;  2O61 A;  1IUF A;  5J8F A;  5DM6 F;  3LQQ A;  1SMY F;  2M7B A;  5F0F A;  3RQ4 A;  1V55 H;  2CS3 A;  2R7X A;  1HSJ A;  2EZI A;  5EGO B;  4YG2 F;  2FNA A;  4WWC A;  1SAX A;  3JRC A;  4HF1 A;  3G1M A;  2M5W A;  4YIF A;  3FK7 A;  2H8W A;  2M45 A;  1A6Q A;  4A3G J;  4M73 A;  3S1M J;  1MKM A;  4N4O B;  1FOW A;  3IWF A;  2EFO A;  1OCR H;  3SJM A;  1PVE A;  3HZJ A;  1AKH A;  2K7L A;  3ZMD A;  2HDC A;  1XX5 A;  2AXT C;  1DPU A;  2MFZ A;  1UHM A;  3HGY A;  4RDU A;  1FYK A;  2XGC A;  1KA8 A;  1MGT A;  1QHH D;  1FLI A;  1GT0 C;  3ZQL A;  1WI3 A;  4B09 A;  3J81 Z;  9ANT A;  1XSD A;  2FU4 A;  4RLQ A;  4Z2Y A;  2Z16 A;  1LDK B;  5FRN A;  1X3W B;  1TTY A;  1ETQ A;  3ECH A;  1HDD C;  1H8A C;  1J59 A;  4B47 A;  5D5W B;  5B1B H;  1SD4 A;  1DGR M;  5DCF A;  5EF6 A;  2QSG X;  1X1A A;  2LG4 A;  2ZME A;  1R22 A;  3CUQ A;  4IVN A;  5BNG A;  5KAF C;  5LHI A;  3VDX A;  2WA0 A;  4XKC A;  2DJN A;  3DKY A;  4A3B J;  3RKY A;  3OYF A;  4EJO A;  1FYL A;  3JRA A;  2CJJ A;  4EEF G;  3QP5 A;  1MBG A;  4I76 A;  2I5U A;  3CP2 A;  4LG0 A;  4DJA A;  2B0L A;  1P92 A;  3HOV J;  2EIJ H;  5CVJ A;  4NC7 A;  2KDO A;  2QCO A;  2L9N A;  3WTT C;  1I6X A;  2Y9Y A;  3ECO A;  3FXL A;  3T1B A;  2X9D A;  4UUV A;  1MMN A;  3M3Y J;  4O3M A;  5HDN A;  2EQR A;  4AM3 A;  3H0G J;  3LSK A;  4LJZ F;  2Y48 A;  4LOC A;  1TW3 A;  1I3Q J;  3CUO A;  3HPG A;  1W1W E;  3MFK A;  1Z7U A;  3A2K A;  1SFK A;  4N9I A;  4LFU A;  3SFZ A;  4RB1 A;  4F52 A;  2JK3 A;  3QPS A;  1BN5 A;  1QVU A;  2O8K A;  3C2G A;  1VQO I;  3UKG A;  2JA2 A;  5KVR A;  3OIQ A;  2EZL A;  3CJT B;  1ZRE A;  4HQE A;  4UY8 I;  2FBK A;  3O6B B;  5HLI A;  1H9T A;  4A0Y A;  4IQ4 A;  4AYB N;  3J7Z I;  1CF7 B;  3TW6 A;  4RAG A;  5ILU A;  3LAP A;  3PM1 A;  3GBG A;  2HYG D;  4XRS A;  4LK0 F;  2QM3 A;  1SFE A;  2AHQ A;  3ASO H;  4F55 A;  3FF5 A;  3M07 A;  3FZV A;  4KJZ A;  3BR2 A;  2KRC A;  1GHC A;  4CZZ A;  4CCN A;  1ZAO A;  2E2H J;  4FCY A;  2Q0O A;  1HXD A;  1SAU A;  4HRI A;  1USS A;  1SD5 A;  4C3H J;  3JRB A;  1BI1 A;  1F1Z A;  2X0L A;  5IPA A;  4G6D A;  1IG7 A;  1R5H A;  2DA2 A;  3CD6 I;  3SDG A;  3CCV I;  1LE8 B;  2WBM A;  2DFE A;  4Z6Y A;  2X6W A;  1RC9 A;  3IAM 2;  5F0H A;  3KZZ A;  4ESF A;  2OJE D;  4KFC A;  1JI8 A;  4GXO A;  4IZZ A;  2K3F A;  3N05 A;  3W6J B;  4D9J A;  2TRT A;  3ABK H;  1R7J A;  4LG3 A;  3L2Q A;  2HXI A;  1YJ9 I;  1MND A;  2ISY A;  2BY1 A;  2X1E A;  4UV9 A;  1OKR A;  3S1R J;  1HQC A;  2VKV A;  1PP8 F;  1IN4 A;  3LSI A;  2OTL I;  2ZXI A;  1R49 A;  1QPM A;  3JRF A;  3VYT B;  3ZCO A;  3LSR A;  1OR7 A;  5DYM A;  1A5J A;  2ZNZ A;  3P7N A;  4P9F A;  4HNV A;  3FXJ A;  4LIV A;  2BEO A;  3Q0U A;  1XB4 A;  2IS1 A;  1ZRC A;  4D1Q A;  1MMG A;  1JKO C;  1W4M A;  3G3Z A;  3HRS A;  3ZN0 A;  3CCE I;  4IHY A;  4S0H B;  3JAM Z;  3RTR A;  3I53 A;  1ETV A;  3HM5 A;  3IAS 2;  4EMS A;  5IOY A;  4BY1 J;  3K1P A;  5J3L A;  4NUB A;  4M9S A;  3JR9 A;  2OZU A;  2KIF A;  3RKW A;  2BGC A;  5K5Q A;  5E3L A;  2ZKZ A;  2I10 A;  1HKS A;  4DYQ A;  1ZH5 A;  3F72 A;  3AFH A;  3F8N A;  3KE2 A;  4QPO A;  1I50 J;  4N9H A;  2E36 A;  5KK1 A;  2FF4 A;  3T8R A;  4CSW A;  3I59 B;  4YII A;  2WWY A;  1TZL A;  3EUA A;  1LDJ A;  4UB8 C;  3GTQ J;  2Q1Z B;  1U5T B;  4ZJZ A;  1EH7 A;  2DA3 A;  2GLO A;  3I4N J;  2YX7 A;  4UV8 A;  3CLQ A;  3CCJ I;  3KYL A;  2W00 A;  3JRI A;  3FBN B;  2COM A;  1WH5 A;  1BR4 A;  2XV4 S;  1LJ9 A;  3W2V A;  4Y3O A;  2CRG A;  1JT0 A;  3MKZ A;  2L4A A;  5IP9 J;  4L0Y B;  5LFA A;  2W82 A;  2WAQ N;  1JKQ C;  1P7J A;  1ON1 A;  3BC8 A;  4NQW A;  5LLQ A;  1H88 C;  2KQR A;  4J01 A;  1MH4 A;  1ZKG A;  2QUF A;  2XAG A;  1MSF C;  2B63 J;  1YLF A;  1YRN A;  2VC1 A;  1YFH A;  2H94 A;  2DN0 A;  4P9U A;  4A3C J;  5ILV A;  1LVA A;  2XHK A;  4M72 A;  3E5U A;  4ESB A;  2K9M A;  1JTX A;  3OYG A;  4E7J A;  4A3J J;  4KMF A;  4Q47 A;  3LSH A;  2BHY A;  4GO1 A;  4IOC F;  3KYD B;  1X1B A;  3I71 A;  2JVH A;  2P7C B;  3I5U A;  3PO3 J;  3B6A A;  1VQ6 I;  2CMP A;  3KP7 A;  3QPL A;  5EZG A;  1IGN A;  2RC4 A;  1W5S A;  1ZEL A;  2R7Q A;  3LL7 A;  2Y0S A;  4RLF A;  1HST A;  3JTG A;  3F8C A;  2H8R A;  3HL2 A;  1Z21 A;  4I01 A;  4WXC A;  3DF8 A;  2V79 A;  3GFL A;  3C2B A;  3F8M A;  3DQV C;  1KYZ A;  3HG9 A;  3TO7 A;  3S3M A;  3HHG A;  1NH3 A;  3FK6 A;  1Z6T A;  3GLL A;  3PFY A;  3QRF F;  3U1D A;  3WG7 H;  1XMA A;  4CXF A;  1YS7 A; 
#chains in the Genus database with same CATH homology
 4NHJ A;  2H09 A;  2EJR A;  2DU9 A;  4I0B A;  3V4G A;  1KQ8 A;  2EFW A;  4BNC A;  2XIG A;  3TDU C;  4MTD A;  3BP8 A;  2MH2 A;  2F5F A;  3GWZ A;  3ISP A;  2BBY A;  2M87 A;  1DP7 P;  3K1N A;  3EYI A;  3RPQ A;  2BV6 A;  3Q9S A;  1Z9C A;  3R0A A;  2PJP A;  5CVV A;  3M8E A;  5D5X B;  3HRU A;  3ROU A;  2VT3 A;  2H27 A;  1B6A A;  5AIP A;  2K4B A;  4CYD A;  1QNT A;  3NQO A;  2RKH A;  1O7L A;  2DLL A;  3BOQ A;  3RYP A;  2Y75 A;  1ZRF A;  5ICE A;  2HS5 A;  4TV7 A;  4M9X A;  1S7O A;  2GZW A;  3QPH A;  2FXA A;  5FLX Z;  2D1H A;  4XBF A;  3ZP5 A;  5D6F A;  3KZY A;  1YYV A;  2E1C A;  1K78 B;  5HVQ C;  4KN7 X;  4HX8 A;  5J6X A;  3GLX A;  4OMY A;  1MJB A;  2LF7 A;  3QU6 A;  2O0Y A;  1KU9 A;  2NAZ A;  1R1T A;  1JGS A;  1IN8 A;  1IAW A;  4R79 A;  2XRO A;  4ENN A;  5BMZ A;  1QO0 D;  3QOP A;  2Z99 A;  1EH6 A;  1ZYR F;  1W5T A;  1JE8 A;  4U0V A;  1FT9 A;  4EJW A;  3WTY C;  4HBL A;  4ESJ A;  2O6G E;  2X4H A;  1FX7 A;  3L9F A;  2EA4 A;  1T38 A;  4ZH4 F;  3DPT A;  2DI3 A;  2HOE A;  3ZMZ A;  5L3C A;  1I27 A;  1B9M A;  3HHH A;  1MDM A;  4M6X A;  3V7S A;  3O3K A;  4OIO F;  4EM2 A;  4KUM A;  1UHW A;  4U7D A;  3Q5F A;  3BJ6 A;  3KCC A;  4OOI A;  3HYI A;  3N97 A;  3W6K B;  2EV5 A;  3CJN A;  4LLN A;  3E5X A;  1YIO A;  1FWZ A;  2PQ8 A;  3DPL C;  1ZG5 A;  1IXR C;  3V8L A;  3N4M A;  2P4W A;  1R5G A;  3GO5 A;  5CVU A;  4EM1 A;  1FSH A;  4MEX F;  1KU2 A;  2DW4 A;  2G9W A;  4XLN F;  5D8L B;  5LEK A;  3Q9V A;  4UHT A;  3IRR A;  4OIQ F;  1MD0 A;  3F8B A;  4ZYG A;  5FD5 A;  4IRG A;  1RUN A;  1Y0U A;  5CLS A;  3HOT A;  3BPX A;  2W85 A;  3E6B A;  6PAX A;  4KYW A;  4JK1 X;  4LB6 B;  2UWM A;  4IHS A;  3MZH A;  2DFI A;  4M74 A;  5D4R A;  1S3J A;  2JTV A;  1WKM A;  4U88 A;  1FP1 D;  2MC3 A;  2DAO A;  3H3Z A;  3E6C C;  3IWZ A;  2LKP A;  5L3G A;  5K1Y A;  3V7R A;  2PLY A;  4ZZD A;  4LK1 F;  2D45 A;  1OYY A;  1E17 A;  1H9G A;  2QLZ A;  3G73 A;  3PQK A;  4I7H A;  4RB0 A;  5ILS A;  2P5V A;  3TO9 A;  5DUI A;  2HGC A;  4HA8 A;  5L3E A;  4AIJ A;  3COA C;  2VON A;  3MQ0 A;  3GFJ A;  1BC7 C;  3HRT A;  1Z6R A;  2IA2 A;  3BY6 A;  2P5K A;  2KRF A;  4RB3 C;  5A2Q K;  5JVT A;  1TQP A;  3K69 A;  2VBZ A;  3FMQ A;  2L02 A;  4LMY A;  2VBX A;  5F1R A;  5E1X A;  4RGR A;  2FBI A;  2Y0M A;  1FBS A;  3CO6 C;  1WRJ A;  3AAF A;  1G3Y A;  1S8N A;  3CDH A;  3ZMS A;  1LB2 A;  1HW2 A;  1P2F A;  2V1D A;  4E70 A;  3WGG A;  3DXJ F;  3FM3 A;  1B59 A;  2ZBK A;  2EK5 A;  3CTA A;  3R6S A;  2ESN A;  2EV6 A;  4HX4 A;  3R4K A;  1KYW A;  4L18 B;  4ENM A;  3TO6 A;  2F5C A;  3U9G A;  3OOP A;  4UVB A;  3E5Q A;  2YPR A;  1IZ1 A;  3E3V A;  3F6O A;  1ZLK A;  2FSW A;  5JFR A;  2M8E A;  1A04 A;  4RB2 C;  2XVC A;  2HTJ A;  4P96 A;  4JQF A;  1FBQ A;  1FBU A;  1CF7 A;  2OQG A;  5ED4 A;  2OZ6 A;  3I4P A;  2IP2 A;  1V3F A;  3QU3 A;  4YFK F;  2A07 F;  2P6T A;  2XAF A;  5E8G A;  5BS6 A;  2RDP A;  3JSP A;  2DTR A;  1RI7 A;  2CG4 A;  2PFB A;  4DQ2 A;  5LGU A;  1RUO A;  2FRH A;  3L7W A;  1G6N A;  1XGM A;  2HKO A;  4F7Z A;  2H6C A;  1YW9 A;  4MQ9 F;  2GWR A;  5BPD A;  2PMH A;  3M8F A;  3RJP A;  3VOE A;  1XGS A;  1UCR A;  4AIK A;  4M6Y A;  4MTE A;  3KET A;  3R60 A;  1P6R A;  5LGT A;  2KIM A;  1T0F A;  1VTN C;  2KIU A;  2IVM A;  2F5D A;  2LF8 A;  2A6H F;  2EV0 A;  4KMU X;  5IT9 K;  1BI3 A;  4L9N A;  2MLK A;  5HS9 A;  4RGS A;  2FMY A;  4L5J A;  1Q1H A;  3I59 A;  3BWG A;  2GXG A;  1U5T A;  1OMI A;  2CO5 A;  4I98 B;  2MA3 A;  1O7F A;  4MGR A;  4WXH A;  1I5Z A;  5LRS A;  2XAH A;  1PP7 U;  4K2E A;  3IHU A;  4IXA A;  1LEA A;  1LNW A;  2MH9 A;  5FB2 A;  2XAQ A;  3GZ5 A;  3DFG A;  1U8R A;  3LA7 A;  2BE5 F;  1ZGJ A;  3IRQ A;  2E1N A;  1DPR A;  5HS7 A;  5E8I A;  4XSX F;  4RGX A;  2FEZ A;  4ASN A;  2VOO A;  2YSR A;  3WTS C;  4BAY A;  5DD8 A;  5ICG A;  4XLP F;  2VT2 A;  2XRN A;  1T39 A;  1SFU A;  3RYR A;  4HLY A;  3TOB A;  4EM0 B;  5TJJ A;  4MHG A;  1MJ9 A;  2F2E A;  4ON0 A;  1IN6 A;  5AIQ A;  3FXR A;  1K79 A;  4KN4 X;  1O57 A;  2L01 A;  4P55 A;  2C6Y A;  1B4A A;  3BRO A;  3KLN A;  3T0Y A;  1HKT A;  4A6E A;  2W57 A;  2CYY A;  1X3U A;  3FWE A;  1L3L A;  1KU3 A;  1XN7 A;  5L3F A;  2P7V B;  1R1U A;  2J5O A;  2NS0 A;  4A6D A;  2QBY B;  2CW0 F;  3LA2 A;  3C3W A;  3SZP A;  4KIB A;  2CQK A;  1YG2 A;  2PN6 A;  3ZMT A;  1RIO H;  4IRH A;  3HTU A;  5LRR A;  3F3X A;  1YW7 A;  1U6G A;  3GYH X;  5CYV A;  2J5P A;  3FM5 A;  1IRG A;  3DV8 A;  4A5M A;  3ZQ7 A;  4U0Y A;  4LGW A;  2HZT A;  1W7P B;  1G4D A;  2P8T A;  1R00 A;  5ERI A;  2ETH A;  3WGH A;  5J8C A;  1EH8 A;  3GFM A;  1W7P D;  1K78 A;  3JW4 A;  5HDK A;  3WG9 A;  1ZGA A;  3B73 A;  3FXQ A;  4BXU A;  4PDK A;  4EQQ A;  3I58 A;  4H0E A;  2ZO4 A;  2VE8 A;  2UXN A;  2LDU A;  3C7J A;  3TOA A;  5DCM B;  2JT1 A;  2ZJ2 A;  2R3S A;  4RAZ A;  2V1X A;  2NNY A;  5FFX A;  2NYX A;  5H6Q A;  3FXU A;  2K02 A;  4A12 A;  1KQ0 A;  3KLO A;  3HTS B;  4KDP A;  4PZJ A;  1QZZ A;  5A2Q Z;  4BQA A;  2DO7 A;  1J0R A;  5EEH A;  2O3F A;  2O8X A;  4CO8 A;  2IT0 A;  2E7X A;  2HWV A;  2NRA C;  4BHP A;  2D2W A;  3EDP A;  5EEG A;  2CSO A;  2QQ9 A;  1XGN A;  1YS6 A;  3GVA A;  5ICC A;  4UXN A;  1ZG1 A;  4L9J A;  4U0W A;  5H6R A;  1HW5 A;  2XKO A;  3PFI A;  4QLC U;  3QAH A;  4KNY A;  4IF4 A;  5E20 A;  2DK8 A;  2CFX A;  1BJA A;  2ESH A;  3J80 K;  2E7W A;  4IRI A;  3LA3 A;  2JSC A;  2Q2E A;  3GEZ A;  3KP4 A;  4IHT A;  4EVI A;  1D8J A;  2XKP A;  2Q8K A;  4PGH A;  3GX4 X;  1REP C;  3JSO A;  5D6E A;  4ZYH A;  2ZCW A;  3U2R A;  3JAM K;  3T8T A;  1R58 A;  2RV8 A;  1RNL A;  1IRF A;  1LEB A;  3T5X A;  2ADU A;  3VEP A;  2HTS A;  3NEU A;  3PQJ A;  1P4A A;  1ZG3 A;  2DQL A;  1ONV A;  4WK8 F;  3F6V A;  2IA0 A;  3F8F A;  3GF2 A;  2R7D A;  5LGN A;  3LAJ A;  4AWX B;  4Q4Z F;  5LHH A;  1F4K A;  1B9N A;  1U3E M;  4FT8 A;  3WTZ A;  1BBY A;  5FD6 A;  1TNS A;  1XGO A;  2V6C A;  2AXL A;  2ELH A;  5H20 A;  1T2K A;  2HR3 A;  2RVC A;  2ZXJ A;  2RQP A;  4KIC A;  3WU0 A;  1YO5 C;  2VOP A;  3WU1 B;  3JTH A;  1WI9 A;  3HOS A;  4KIF A;  3KP3 A;  1ZRD A;  3F23 A;  1FP2 A;  4EJV A;  1STZ A;  3R0J A;  2QYO A;  2LSO A;  2W84 A;  5BPI A;  4A0Z A;  2ZNY A;  2HYF A;  2STW A;  2K4J A;  5FFZ A;  2VXZ A;  2A5Y B;  2PG4 A;  1L0O C;  3KP6 A;  1GXP A;  3QPT A;  3HIF A;  3KP2 A;  2WV0 A;  1YQA A;  3ZPL A;  4OU0 A;  2ACJ A;  2DPU A;  1JHF A;  4DNC A;  5CVI A;  4JBA A;  4EGY A;  4L5I A;  2W25 A;  4FX0 A;  5BOX A;  4QWQ A;  3BDD A;  4U7B A;  1BM9 A;  5CJ9 A;  4Y15 A;  2NNN A;  1UST A;  2RNJ A;  3GZ6 A;  5JI6 A;  2V9V A;  2OA4 A;  2UZK A;  5DV5 A;  3V8K A;  4LLL A;  2Z33 A;  2FNP A;  4UNO A;  4BH9 A;  3SHF A;  2GXB A;  5FO5 A;  5FLX K;  2A61 A;  1FYM A;  3RKX A;  3CO7 C;  4Q5S F;  3ULQ B;  4GYI A;  1EV7 A;  4N0B A;  4RAY A;  5DEQ A;  4G7H F;  4HZF A;  3F22 A;  4CDG A;  5D5V B;  2HQN A;  1O3R A;  1U78 A;  4HDV A;  1O3S A;  1XD7 A;  3K9T A;  2CGP A;  3KFW X;  4EJT A;  4OIR F;  3SXY A;  1J2X A;  4WF2 A;  4M9Z A;  4HAM A;  1XMK A;  1P4W A;  1TW2 A;  2EB7 A;  1K6O A;  3FHZ A;  4UVA A;  3VB2 A;  1LQ1 A;  2XGX A;  3C1D A;  5F64 A;  4S04 A;  4ZYD A;  4GCV A;  3H92 A;  1FZP B;  2A6E F;  1QGP A;  1JHH A;  3EQL F;  4GGG A;  3E6D A;  1FNN A;  1J5Y A;  3HSF A;  4BYY A;  3MEX A;  3WE2 A;  3IKT A;  4HYE A;  3TQN A;  5DD4 A;  1K7A A;  4CHU A;  2QQB A;  2L4M A;  4EV0 A;  3CUQ C;  5JHU A;  5ICF A;  3EET A;  2IRF G;  1S6L A;  3D5L A;  4RS8 A;  1XCV A;  4YFN F;  3ERE D;  1F9N A;  1R1V A;  2G7H A;  1SD6 A;  3K0L A;  4ZYE A;  2M1B A;  5DDG A;  3GW2 A;  4G7Z F;  1J9I A;  1V4R A;  1SMT A;  4PGG A;  1QZY A;  2FA5 A;  1O3Q A;  2WTE A;  4FHT A;  1ZN2 A;  2HFH A;  2DBB A;  1BI0 A;  2QWW A;  1OYW A;  1DUX C;  1BOA A;  1IN5 A;  3OV8 A;  3RDI A;  3R61 A;  2V1U A;  4ETS A;  2ZME B;  2VE9 A;  3CUQ B;  1T98 A;  3TGN A;  2EFN A;  4EJU A;  3TKY A;  3M7G A;  2UXX A;  4BHB A;  2XAJ A;  2VC0 A;  5L3B A;  1U5T C;  4LG0 B;  4IJA A;  4RGU A;  2RN7 A;  1I1S A;  2OQR A;  1MJA A;  2OD5 A;  2FE3 A;  2GA1 A;  2QBY A;  2VBY A;  3V8J A;  4BHC A;  5FGM A;  5D8K B;  1HKQ A;  1BIA A;  1R23 A;  3J80 Z;  5D5U B;  2XAS A;  3KEO A;  1J7K A;  4G8X A;  4O5V A;  1BC8 C;  3ELK A;  4L9V A;  1WQ2 A;  1KQ9 A;  2IJL A;  2ISZ A;  1WSU A;  1E2X A;  1Z91 A;  1W7P A;  3HSE A;  4ENK A;  3LFK A;  2A3S A;  1NHA A;  1XSX A;  1S7A A;  1TBX A;  1AWC A;  1IN7 A;  2OAZ A;  3M9A A;  2STT A;  4HX7 A;  5K5O A;  2AS5 F;  3P9K A;  3QP6 A;  1BI2 A;  3LQR A;  3IL2 A;  1FPQ A;  2XUB A;  5K5R A;  5DCM A;  3E97 A;  1I1G A;  1F5T A;  1BIB A;  1ZHF A;  2PBI A;  2DPD A;  3WTU C;  2O03 A;  2KJC A;  3HUG A;  2VBW A;  3P9I A;  5LEJ A;  3IC7 A;  2K27 A;  5AON A;  2FQ3 A;  1IUY A;  1T6S A;  3J81 K;  3E6M A;  1H0M A;  3MCZ A;  3I64 A;  2JPC A;  4I09 A;  4D0P A;  2PMU A;  4KA4 A;  1TQI A;  2GIV A;  5JR3 A;  1C0W A;  3DP7 A;  1R36 A;  1TNT A;  3GFI A;  3O2P E;  2LNB A;  3EUH A;  5LHG A;  4HW0 A;  1UB9 A;  3B02 A;  1GXQ A;  2TDX A;  1Z05 A;  3I54 A;  2QZ8 A;  4AD9 A;  1P4X A;  3ZN1 A;  4AIH A;  2FBH A;  1WWX A;  1OPC A;  3D0S A;  4G94 A;  4CGZ A;  3TDZ C;  4MNU A;  3FMS A;  1FOK A;  2D1V A;  3L09 A;  2R7F A;  2DQR A;  5E18 F;  5TRD A;  1XDU A;  2Z3Y A;  4HOB A;  4I02 A;  4LD5 A;  1KU7 A;  1CGP A;  1B1B A;  2HQR A;  2QQA A;  5E1Z B;  1IXS B;  3WTX C;  1Z1D A;  4I2O A;  1AOY A;  3V7C A;  4Y17 A;  2OU2 A;  5HLG A;  4OMZ A;  4HDU A;  3HRM A;  1IF1 A;  3LST A;  3L00 A;  4XRF A;  2Z9O A;  2MBF A;  4A5N A;  4G9Y A;  4KIG A;  1IW7 F;  4MEY F;  3RI4 A;  3MWM A;  1QQI A;  3GUD A;  1JXS A;  3KP5 A;  4A0X A;  1OYI A;  1TLH B;  1ULY A;  2IA1 A;  4WX9 A;  4M71 A;  5E1W A;  3WE3 A;  1HW1 A;  2L54 A;  5LBQ A;  1IXC A;  5D4S A;  4HF0 A;  3RPU A;  4GYG A;  1D8K A;  1G3W A;  4HV6 A;  4CIC A;  5HDG A;  4Q48 A;  2KJB A;  4S05 A;  2H6B A;  4G6Q A;  1ZAR A;  2QVO A;  1RZ4 A;  2L3D A;  1ON2 A;  5CVR A;  5HLH A;  4XSZ F;  2GA2 A;  2YX4 A;  2OBP A;  3ZMV A;  2EWN A;  3NRV A;  2HEO A;  2GQQ A;  4A2U A;  2HKX A;  3VOD A;  3L2C A;  4OIP F;  4ZZL A;  2YU3 A;  3MAJ A;  3REO A;  4B8X A;  3C18 A;  1O3T A;  1D5V A;  4R8H A;  3EYY A;  3DEU A;  3VFZ A;  2A68 F;  2P5L C;  3SQN A;  3BPV A;  2DK5 A;  4HF2 A;  4IPA A;  1KGS A;  4G7O F;  3K2Z A;  2A69 F;  3ABU A;  1LDD A;  4LB5 A;  3J7A O;  1J75 A;  3ABT A;  2MLG A;  4LLG F;  3H3U A;  2GAU A;  2JPB A;  1MZB A;  2M30 A;  2MD5 A;  4EGZ A;  4HQM A;  1SD7 A;  2YR2 A;  1YW8 A;  5DUK A;  5IT9 Z;  2KKO A;  3ZMU A;  1XSV A;  3SZT A;  3LWF A;  1GVJ A;  5F6F A;  4AVP A;  1MDM B;  5IT3 A;  3BJO A;  3FMR A;  4O6J A;  2PI0 A;  1PUE E;  3GXO A;  2P6S A;  2G7U A;  4WXD A;  5L3D A;  4MQV A;  3F21 A;  1FY7 A;  3WOD F;  4FX4 A;  2CWE A;  3K1M A;  2DT5 A;  2PEX A;  4ENJ A;  1DDN A;  1ODD A;  3BJA A;  1TQM A;  1U2W A;  3I0T A;  4HLX A;  2RGV A;  5HOO A;  1QBJ A;  2QEN A;  1PDN C;  2VOD A;  1G3S A;  4I0A A;  2F5E A;  4UVC A;  2EFP A;  2IW5 A;  2FOK A;  2EFQ A;  4YFX F;  2VN2 A;  4WCG A;  1XDS A;  3DKW A;  4L9T A;  4OIN F;  1ZLJ A;  2IPQ X;  2JZY A;  5BQT A;  3BZ6 A;  3P9C A;  3KEQ A;  4HV5 A;  4Y13 A;  1D3Y A;  2W24 A;  1FSE A;  1G3T A;  4PCQ A;  2FML A;  3MZY A;  1YTY A;  1HBX G;  3M1E A;  4NB5 A;  1UFM A;  4P5O A;  1FC3 A;  3WGI A;  1XCB A;  2Z5U A;  3RIR A;  4L0Z B;  4KT5 C;  2BYV E;  2ZFW A;  3ML6 A;  3IKV A;  3S2W A;  3FX3 A;  2JRT A;  3WTW C;  2EA2 A;  1S29 A;  5E17 F;  2K86 A;  3CLO A;  1SFX A;  3HSR A;  2WC2 A;  3WTV C;  4R1H A;  5HS8 A;  2O61 A;  5J8F A;  3LQQ A;  1SMY F;  1HSJ A;  4YG2 F;  2FNA A;  4WWC A;  1SAX A;  4HF1 A;  4YIF A;  2M5W A;  2M45 A;  4M73 A;  1MKM A;  3IWF A;  2EFO A;  2K7L A;  3ZMD A;  2HDC A;  1DPU A;  1UHM A;  1FYK A;  1KA8 A;  1MGT A;  1FLI A;  4B09 A;  3J81 Z;  1XSD A;  2FU4 A;  4Z2Y A;  1LDK B;  1TTY A;  3ECH A;  1J59 A;  5D5W B;  1SD4 A;  5DCF A;  2ZME A;  1R22 A;  3CUQ A;  4IVN A;  5LHI A;  3RKY A;  4EJO A;  1FYL A;  3QP5 A;  4LG0 A;  2B0L A;  1P92 A;  5CVJ A;  3WTT C;  1I6X A;  3ECO A;  3T1B A;  4UUV A;  4O3M A;  5HDN A;  4LJZ F;  2Y48 A;  1TW3 A;  3CUO A;  3MFK A;  1Z7U A;  4N9I A;  4LFU A;  3SFZ A;  4RB1 A;  1BN5 A;  5KVR A;  1ZRE A;  4HQE A;  2FBK A;  3O6B B;  5HLI A;  1H9T A;  4A0Y A;  1CF7 B;  5ILU A;  3LAP A;  2HYG D;  4LK0 F;  2QM3 A;  1SFE A;  3FF5 A;  3FZV A;  1GHC A;  4CZZ A;  1ZAO A;  2Q0O A;  1HXD A;  1USS A;  1SD5 A;  1BI1 A;  1F1Z A;  2X0L A;  4G6D A;  1R5H A;  3KZZ A;  4ESF A;  4KFC A;  4GXO A;  3W6J B;  1R7J A;  2ISY A;  4UV9 A;  1OKR A;  1HQC A;  1PP8 F;  1IN4 A;  1QPM A;  1OR7 A;  5DYM A;  2ZNZ A;  3P7N A;  4P9F A;  2BEO A;  1XB4 A;  1ZRC A;  1W4M A;  3G3Z A;  3HRS A;  3ZN0 A;  3JAM Z;  3RTR A;  3I53 A;  4EMS A;  3K1P A;  4M9S A;  2OZU A;  2KIF A;  3RKW A;  2BGC A;  5K5Q A;  2ZKZ A;  1HKS A;  1ZH5 A;  3F72 A;  3F8N A;  3KE2 A;  4N9H A;  5KK1 A;  2FF4 A;  3T8R A;  3I59 B;  4YII A;  2WWY A;  1LDJ A;  1U5T B;  1EH7 A;  2YX7 A;  4UV8 A;  2COM A;  2XV4 S;  1LJ9 A;  2L4A A;  4L0Y B;  1ON1 A;  4NQW A;  5LLQ A;  2QUF A;  2XAG A;  1YLF A;  2VC1 A;  1YFH A;  2H94 A;  4P9U A;  5ILV A;  1LVA A;  2XHK A;  4M72 A;  3E5U A;  4ESB A;  4KMF A;  4Q47 A;  4GO1 A;  3I71 A;  2P7C B;  3I5U A;  3KP7 A;  2RC4 A;  1W5S A;  1HST A;  3JTG A;  3F8C A;  4I01 A;  4WXC A;  3DF8 A;  2V79 A;  3GFL A;  3F8M A;  3DQV C;  1KYZ A;  3TO7 A;  3HHG A;  1Z6T A;  3QRF F;  3U1D A;  1XMA A;  4CXF A;  1YS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...