3OL3A

Crystal structure of a putative uncharacterized protein from mycobacterium smegamtis, an ortholog of rv0543c, iodide phased
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 31
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol3A02
3OL3A 3OL4A
chains in the Genus database with same CATH superfamily
1B1BA 1LVKA 5JHFA 4N9IA 4BH9A 4XBFA 1MMNA 3DKWA 4RB2C 1C0WA 3FKJA 3OIOA 4DGWB 5LRSA 3T0YA 1BJZA 4M9SA 2AXLA 1KU7A 3BQZA 1HKQA 3HL2A 2E1OA 2X4HA 2O03A 4AIDA 4YIFA 3WE3A 4M73A 4IXAA 1LFUP 1P7JA 2WB1N 4F52A 2FEZA 4L9JA 5AIPA 1LDDA 3F3XA 3QPSA 5K7ZA 3OS0A 3P9IA 2HQNA 4ZZLA 2YUSA 3AAFA 2O0YA 4HW0A 3WU0A 3CCUI 1U9OA 4A6EA 4PGHA 1V5FA 2L02A 2HYGD 3MN2A 1UHMA 3DLLF 4Y33A 3S14J 2X6XA 3BP8A 2ECBA 2D1VA 3V8KA 4BKXA 5LEJA 4PJLA 3O6BB 2KIMA 3HYIA 4CCNA 1P7IA 4WXCA 3CCLI 4C9YA 3T8RA 1ETVA 4PJJA 2N8GA 5GPAA 3ASOH 2DA1A 1OR7A 1USTA 5FD6A 1T6SA 3GTPJ 1FZPB 4AU7A 2HXIA 3CCJI 2YPRA 3KP5A 1ZH5A 3SJMA 3I5UA 4P1WA 3Q5FA 2LYCA 2Q0OA 3Q0UA 1YW8A 3DBRB 1HKTA 3DKYA 2WAQN 2JPCA 2RC4A 2NYXA 1TQPA 4BHBA 4WXHA 3DTEA 5FKMA 3RCOA 3CF2A 5L3EA 2JUCA 1N77A 4CHUA 2V7FA 1VQ7I 2OV7A 2DT5A 4ESFA 3GX4X 1IN7A 2K4BA 1HKSA 4B4CA 3HSFA 4UB8C 1QGPA 4WWCA 3GTMJ 1Z91A 2HR3A 1P9QC 1WFXA 4X6AJ 5IPAA 4R8HA 5L3DA 3K4BA 1YJNI 4DOZA 2YU3A 4OWRB 4DIQA 1IN4A 1X3ZB 5CVIA 3V42A 1JE8A 1LB2A 1ZHFA 2ZSHB 5M3FJ 3B6CA 1OLTA 2EZIA 5B3SH 2EFNA 4P9FA 4BQOA 1VQOI 4IHSA 1AA7A 4HPQA 4LLNA 2R7ZJ 2DK5A 5IT9K 1RPWA 4RAYA 3BWGA 2OCCH 1WH7A 2KRHA 2V1DA 2DMPA 4N4OB 1YS6A 1QPIA 1OCZH 5IYDJ 1S72I 5FROA 1B6AA 3G6EI 4HF1A 2KL4A 5FGMA 3S93A 2PMUA 2ZXIA 1FTTA 2G9WA 1J2XA 1FJLA 3MAJA 1FY7A 1LE8B 1H9TA 5J1UA 5DUIA 1PUEE 4ESJA 5J1YA 1TWCJ 2ZFWA 2Z1DA 2P5KA 2DPDA 1CGPA 2P0WA 3ZCOA 1ZAOA 3D5LA 1D5YA 3OOPA 4EM2A 3KP7A 3S15J 5B1AH 4YG2F 3BR3A 2E2JJ 3I9V2 4QWQA 1FMWA 2QQBA 1MMDA 3BZ6A 2CUFA 2E19A 3SZGA 2E1MB 2KIQA 3BZCA 1YHQI 4LG0B 2M1BA 4BUPA 3G4SI 3CMEI 3OR1C 5D4SA 3WGGA 4AVPA 1T08B 2CV1A 1ZR4A 3BTJA 1IW7F 3ZMVA 5M5YJ 2KQRA 2BYVE 3L9FA 1XDUA 4KA4A 2A61A 4I02A 2STWA 1G3SA 4A5NA 3A01A 1K4TA 2CV0A 3ZGKA 4J19A 3K6GA 1GDTA 2XB0X 3EUHC 3K4NA 2CQXA 1FMVA 5FLVA 3SEQA 4LITA 2HXOA 2XHKA 4GRIA 1MMAA 3AG1H 3GFLA 4RLFA 2QSGX 1GV2A 3UR3C 3MKYB 4EEFG 2Q2EA 2OCEA 5IP9J 3SYTA 5LHGA 3QRFF 3Q3SA 2VT2A 1OJLA 4E7SA 3OSGA 1TT5B 5CQGA 3VYRB 1W0UA 4XR6A 2P7VB 4B44A 1ZREA 4C30A 1S7AA 4XLNF 2ID6A 2HQ5A 4XSZF 2E2HJ 2GXGA 3KCCA 1D8JA 1VQMI 2GM4A 3HHHA 2R0QC 4XKBA 2BY1A 4RGSA 2Y48A 2CWEA 1WZ2A 4BJ6C 1FYMA 3LMMA 2DMTA 3MZHA 3VB2A 4HG2A 4RAGA 2ESNA 3ZXSA 3FBNB 2XPUA 3H35A 3SHFA 3R6SA 3PM1A 3I54A 5LGTA 2IXSA 4V19K 3BTLA 1S6LA 3HTSB 1HOMA 3RKYA 3S8PA 1UG0A 4LK1F 2DFHA 1XN7A 4M72A 5J8FA 1T38A 1LEAA 2Y69H 2FBIA 2WWYA 1HA8A 3C18A 2JA8J 2KLOA 3C3WA 5IY5H 2E7XA 1ULYA 5EF6A 1IG7A 1ZK8A 4BY1J 1Z6TA 4N0BA 2DFIA 3MMYB 4MIMA 3RZDJ 1XC5A 4Z2YA 4WF2A 4EJUA 3TMOA 3H5AA 2BBYA 4Y15A 2BY0A 3ABMH 4RAZA 1XSDA 1SFXA 3GTKJ 3C2GA 1ENHA 5E1WA 2M30A 2PG4A 4LLGF 2LY1A 2QSHX 3PFIA 1YI2I 1KU3A 1MH3A 5E1ZB 2EIJH 5GAEJ 4GO1A 3F8CA 2V1NA 4I01A 1LUJB 1GVJA 4F91B 1ZARA 1T2KA 3D1NI 1Y0NA 3WE2A 2K9LA 2QENA 3CJRB 3LSTA 2E5ZA 4RM3A 2QUFA 5K5RA 2FRHA 4OMZA 2FXAA 3GZ6A 2ZBKA 1ZLKA 1E3PA 2B7EA 1MH4A 3CDIA 1SD4A 5F27A 5F6FA 4F93B 2AQFA 1QZEA 4O6JA 3I71A 1Y8QB 2MH2A 2DI3A 2FU4A 4CO8A 1D8KA 2ICWG 3L2WA 4JK1X 2DAOA 5E1XA 4I09A 2O6GE 1AKHA 2RQPA 3DP7A 2XB5A 5CVJA 1BA5A 1XDSA 2GIZA 3FXOA 1RNLA 4KDPA 5KHDA 2ETHA 1BC7C 5CVVA 2K4JA 3SXYA 2ZC2A 1MSEC 3HSRA 1E3HA 1TQMA 1SD6A 4YFKF 1TNSA 3U1KA 2XROA 3VWBA 1PVEA 2EV6A 4C3IJ 1D1CA 1BI3A 1LQ1A 4A3GJ 1DP3A 1DP7P 1QA6A 2DOEA 1WHUA 2P6TA 1IDZA 5ED4A 2VQLA 4II3A 5ERIA 3VYSB 5DM7F 2M7AA 4W1UA 1N78A 1MGTA 3F8FA 3K4CA 4IZZA 1NTCA 4ZYEA 2KJBA 3JRHA 2VPLA 4M3BA 3FXUA 1LKXA 1WJAA 5TJJA 1YITI 1QVUA 3PO3J 2JRTA 4I0BA 3OL3A 4D0PA 1E17A 1XX5A 4MTEA 2R5ZB 1XSVA 2D5VA 1ZTRA 1X2MA 2ZJ2A 5FFZA 2ZXJA 5HLTA 3E5UA 5F08A 2I8DA 2IJLA 1U8BA 2AS5F 5BPDA 4XRSG 2HKOA 4P5OA 1ZGWA 2EIMH 3V7CA 3G3ZA 1GVDA 4GDFA 3HEFA 2WTEA 2HDCA 1FIAA 2A5WA 3WTUC 2MFZA 2VE9A 5M3MJ 4I6ZA 2JN6A 5F04A 2JJ7A 2X48A 2PJRB 2FF4A 1YRNB 1X1CA 2X9DA 3BPVA 2LH9A 3WTTC 3IWZA 3G2BA 3ELKA 3FZVA 5K1YA 2R7WA 4CH7A 4B3XA 1JXSA 3E6DA 1IRXA 3AG3H 5HLHA 2ZJRF 4IHYA 1R22A 1TWAJ 4NBQA 3ERMA 1F1ZA 2YS9A 5E20A 2DA6A 4BXFA 3H9QA 2VI6A 4IJAA 1UZCA 2MC4A 5EJCA 5L3GA 4BHPA 1WQ2A 1Z9CA 2K5CA 4CGZA 1EA3A 2ZKZA 3HB9A 2VBZA 1NG7A 4I99C 1P92A 3LAPA 4EV0A 1KYWA 2D2WA 2X1CA 2F5EA 1UMQA 1BR1A 2ISYA 5E3MA 4PCQA 3BLYA 2VJJA 3I59B 2CV2A 2VC0A 1J0RA 3O3KA 3FIWA 2QQ9A 1XGMA 1HDDC 3H36A 4NB5A 4F7ZA 4FTHA 4ZYHA 2AO9A 2NOGA 2X6YA 2G7HA 3CC7I 1OCPA 4L18B 3DTIA 4ZDPA 3WTWC 4UV9A 2CGPA 5FKOA 1ETQA 5KAFC 1TQIA 1VQ9I 4A3KJ 3KP3A 1FNNA 2H09A 1BM9A 2IGOA 1NK2P 2LLKA 5L3FA 1SANA 2FBKA 2R7SA 4EQQA 3S32A 3IV5A 2HOSA 3QU3A 3QYBA 1A6IA 3C2BA 3M8JA 4A93J 1B4AA 5D5UB 2FBHA 1Y6IA 1RI7A 3MD2A 3K70C 1U5TC 2W4SA 4YEJA 3RPQA 1KGSA 3MCZA 3G1OA 4BHCA 4BJTA 3CUQC 3DEWA 2OAZA 3WODF 1HW2A 4IOAF 2VKVA 3FXKA 4LGWA 2MD0A 3V4GA 3BR2A 2VLAA 2LD5A 3A4CA 2A69F 3T1BA 3JAMZ 1H8AC 2E5NA 1TL8A 1DGRM 2NVTJ 4ZH4F 3O8HA 2DMQA 3F23A 2MGQA 2K3FA 3H0DA 3QPLA 2ZXHA 4S04A 2YSRA 2O8KA 3E0JB 3TO9A 4BAYA 3K0LA 4IRIA 4DJAA 1TLHB 2R7QA 4HOBA 2M0CA 3BG5A 4D5FA 5BS6A 3OYIA 3R60A 2BVMA 2M4GA 4G8XA 2DBBA 4NNJA 4BXUA 2UXNA 2M87A 3HRUA 2LMDA 5IYCJ 5D8LB 4EATA 4LB5A 5ILVA 5IP6A 2DODA 1FYLA 2OTJI 3FHZA 5DCFA 1UB9A 2M2EA 4HV5A 1SVLA 2L0KA 3IH3A 5DCMA 1WCMJ 5H6RA 1KQ9A 2V4JC 2VXZA 2DFEA 2VPRA 1TZLA 2ME6A 4CUGA 2P81A 1W5CC 2P7CB 4HYEA 1R4NB 1FYKA 3VFZA 4YIRX 3LFUA 4ZYGA 1KA8A 4BEHB 2W85A 2HVSA 3BR1A 2PMZA 4HA8A 4N9HA 2H1KA 5LEKA 3VEPA 3RSNA 5FD5A 4BQAA 1F5TA 2HTSA 5EEGA 5ICGA 2RV8A 3MKLA 2CQKA 1IXRC 1WH5A 4CCKA 2A68F 3I56I 3FM5A 5FLXZ 3RIRA 1ETWA 3H3UA 4ASNA 2A05A 3HJEA 3I4MJ 1XGNA 4AWXB 1P4AA 1IF1A 2KFDA 2Z9OA 5KCMA 1APLC 1VQKI 4Y7NJ 4BDZA 2KJCA 2BXYA 3F22A 4Q48A 1AU7A 1OCOH 4UUVA 4KJZA 1W1WE 1XMXA 1B72A 1O4XA 4PFOA 2W24A 2O3FA 1OCTC 3HXLA 2LVSA 1VNDA 4E7KA 2ESHA 2ZNZA 1IJWC 2DTZA 3D0SA 3HUGB 2E35A 4KICA 4G7OF 2AXTC 2JK3A 3ZQ7A 5D6EA 5E8GA 4LOCA 3IRQA 5ICCA 3J80Z 2O61A 2KKOA 4HNTA 5EZGA 3NRVA 5C4XJ 1FIPA 2G0EA 2QBYA 4MEYF 2UUZA 2E36A 3M07A 4UB6C 2FNPA 5GAGJ 4XIDA 5EG0B 3WTXC 1RC9A 1USSA 3A0BC 3V8JA 2FMYA 2MABA 1OYIA 2DA7A 1XG1A 2DU9A 1FT9A 1FOXA 3DPLC 2LC2A 4KIBA 2X6OA 4XONA 2VASA 1U5TA 1REPC 4LB6B 3KIOA 3H5NA 2DT7B 3CUQA 3LWFA 4R1HA 1PUFA 4IVNA 4ESBA 2H8WA 2LP0A 2IA1A 3M7GA 4MQ9F 3ZPLA 2W57A 2X85A 1O7FA 2M45A 3AG4H 4M6XA 5AIQA 5LBQA 3R61A 3K10A 1ZRDA 1G3YA 1JHFA 3RKWA 3BTCA 4L9NA 1Z1DA 2CQNA 4G6TB 2X6WA 3K2ZA 2KZVA 5HDKA 2R3SA 4W97A 4A3IJ 1AOYA 2V9VA 2E60A 2M8EA 1D1AA 2BGCA 4CZCA 4FCYA 3CF5F 1WJEA 1Z0XA 1LFPA 2TCTA 3PUBA 5DV5A 1O3SA 2HTJA 3W6KB 3AL0B 4DYCA 2V1UA 1YW7A 4NUBA 3CO6C 1PP7U 1A5JA 1Y8RB 4ON0A 5F0HA 3R0AA 3P7NA 1QHGA 1BR4A 3G71I 1I50J 1W7PA 1EF4A 1SVMA 3QYFA 3R4KA 2JUGA 2GIVA 3BROA 4PSWA 4AD9A 1QVTA 3V7SA 4DW6A 2XPVA 2VN2A 3JTHA 1RUNA 1IUYA 3F8BA 5A2QZ 1ODDA 2HPMA 4HX8A 1IZ1A 5FLXK 3W2VA 1UCRA 2BVLA 2Y30A 1OCCH 1CF7B 2RREA 4DYQA 3U1DA 1Z3XA 4AC0A 2KPMA 4PZJA 3H92A 1G4DA 3WTSC 2H27A 2LFBA 1ERDA 1YJ9I 2X0LA 2D1HA 3FK7A 4BQQA 2Z33A 1ZR2A 4HQEA 1XSXA 3ISPA 4YRVA 4UUSA 1P2FA 2IS2A 4LK0F 1MZBA 2HVQA 3B02A 2K86A 2RN7A 3KYCB 4Y52J 4UVBA 2UV1A 4M6VA 3M4OJ 5LD2C 3OYNA 4HDVA 3LNQA 3O2PE 2MD5A 2NNNA 1QHHD 4FQGA 1X1PA 3TP3A 3JRIA 2CJJA 2R5YB 2Z3YA 2NS0A 1I39A 2BE5F 4BQNA 3JRGA 2DJNA 1QU3A 1DPRA 4CCLA 2ZB9A 3CO7C 4IKFA 1EH8A 3F9KA 2HZTA 3U9GA 2LF8A 2PBIA 1FX7A 3HC7A 3MZ8A 4ETSA 3H9JA 4UUTA 4IHTA 2X1DA 3OYMA 2F5DA 3TDZC 1JTXA 1RR8C 4CDGA 2Z5UA 2DOAA 3EUKL 3ZN1A 5DDGA 1YFHA 3SZPA 4HNVA 1JT6A 1MDMB 5B5EC 1EV7A 3BPXA 3K1MA 2FNAA 2HOAA 5M5WJ 5TISC 2LY9A 4XQFA 4GFBA 1G8XA 5M5XJ 4QLCU 4HRIA 3CD6I 3S2WA 1EKEA 4L5EA 2RQQA 3HRMA 3HOUJ 3IL2A 4RA2A 1KU2A 2H94A 4XRSA 1KQ8A 1ZGAA 5LRRA 2XVCA 3ASNH 2DA3A 2M3AA 3BTIA 2LBFB 3T8TA 2R7RA 4M3EA 4RGXA 3GLLA 4HLYA 2IP2A 3WHBA 2PJPA 3K70D 2L7ZA 3H3VK 1L0OC 1LPQA 1S7EA 5DTDA 1B59A 2Q8KA 2L7FP 5F1RA 2VONA 2KIUA 3N05A 2NAZA 2TRTA 1YG2A 2DW4A 3W2WA 3DF8A 5DD8A 2WA0A 3X2QH 3WTVC 4HBLA 2XV4S 2VJ4A 2K85A 5IOYA 2CW8A 3VOEA 2F5FA 1L3LA 2K7LA 1VQ8I 3Q0WA 2XC7A 3KZZA 4Y4RA 2CFOA 2D45A 1R4MB 2LF7A 4P96A 5JVGF 2XASA 2M9HA 1O3QA 4XLEA 4ZC3A 3FM3A 3KEOA 2EB7A 3TGNA 3ZMDA 2DOFA 4A0YA 1Y0UA 1Y1WJ 1TW3A 4LG3A 1P6RA 2Q2EB 3CLQA 2ZJQF 1BW5A 2HOTA 3G1MA 2GZWA 1SD7A 4EJVA 2PX9A 4BL0B 3PL8A 5CYVA 1H0MA 4IRGA 1TTYA 2O8XA 2UZKA 2P8TA 4XOPA 1RUOA 5HDGA 1MKMA 2HOEA 3JW4A 2WBMA 1DDNA 3OMYA 2DA2A 3WTZA 2L5QA 5JFRA 3ZQQA 3JRCA 3I3LA 1W5SA 3BY6A 4XKCA 2FE3A 1M1EB 2XSDC 3ONQA 4HX4A 4RGUA 4OMYA 3REOA 3A2KA 2EZLA 1SEUA 1UAAA 2QSFX 3DPTA 1YJWI 4AVZA 3KLOA 1GXPA 4FHTA 1SD5A 1LE8A 3K4MA 2QLZA 3CMAI 1WJCA 4C2MJ 3GTJJ 2KT0A 4B47A 4ITVA 1FBUA 5AONA 4B43A 1T39A 1CQTA 3KP4A 1WPKA 3V7RA 4OU0A 4RS8A 2FX0A 3V8LA 2HWVA 2JA2A 1JGSA 1ON2A 1YYVA 4E6KG 1X2NA 2L2OA 1ACIA 4ZJZA 3OYCA 2M5WA 1W36D 1IRZA 3L2CA 4ZYDA 1LNWA 1JKRC 1DUXC 2DDBA 2A6EF 5JR3A 3RKXA 4OIPF 3VSKA 1ZELA 3GMEA 2A3SA 3OYDA 5IOZA 5BOXA 1POGA 1MNEA 3KFWX 1R9TJ 1ZGJA 3KX2A 2CH0A 3C2HA 3ZMTA 2KMUA 4C2TA 3AG2H 3OSFA 4G6QA 4U87A 2E71A 3RKQA 1HC8A 4HDUA 1JUPA 3IH4A 3CCSI 4R79A 3DFGA 3A0HC 3EUAA 2VIXA 2IT0A 3J7YJ 5LLQA 3HTUA 5LHHA 4XORA 3S3MA 4RLQA 3LSMA 1SAXA 4KN4X 1BN5A 1S8NA 3GCMA 4KIGA 5B66C 3RI4A 3ZQLA 3CC4I 3QAHA 2W1OA 3RYRA 1UELB 2Y2ZA 3SDBA 3TL4X 3LA3A 3S1QJ 3QOEA 2EIKH 4OINF 1XS9A 4CZZA 3CESA 2GXBA 3RDIA 4D1QA 3HPGA 2IA0A 1R5ID 1SAUA 5JHUA 4A2UA 1A36A 3B73A 1VTNC 1W5TA 1YE9A 2RNGA 3F8MA 2CSOA 2BHZA 3HM5A 1VQ5I 3NARA 1AKHB 1I1GA 3H3ZA 5GTHC 2GLOA 1U2WA 3CZ6A 4ZDOA 3OR2C 3KEQA 4J01A 3DKXA 3H0GJ 4HSRA 3R0JA 1XB4A 5J8CA 4RB1A 1GHCA 2ID3A 2A6HF 2EPFA 4AYBA 4S05A 1NHAA 3CUOA 1Z3YA 1WI9A 3IHUA 1E0EA 1FTZA 2GOMA 3A02A 3HPHA 1I6XA 3LSHA 3VDXA 3GLXA 5H2FC 3W2AA 2Q1ZB 2Z2SB 3RZOJ 1LDKB 2BV6A 4H0EA 1FP2A 5FJ8J 4C2UA 4JX6A 5CPRB 4OOIA 3I55I 2NNYA 3CCYA 5JI6A 1YS7A 3MZYA 2ADUA 2VQCA 4IOCF 1MJ9A 1OMIA 2CUZA 2FA5A 2OZ6A 2QQ8A 1YIOA 5J47A 3GYHX 4G6DA 2WAEA 3D5RC 5KVRA 4L9VA 4PSXA 4KNYA 2COBA 2L9SA 4DBRA 1IN5A 1ZG5A 2LY2A 1FWZA 1YQAA 2VBXA 3S1NJ 5DUKA 3TO7A 6PAXA 1RZ4A 3EUHA 4QPQA 5KK1A 3KYDB 2XGEA 2C6YA 3ZR8X 2KIFA 2ELKA 3FK6A 4Q4ZF 1U0JA 3SQNA 3WGHA 1RIOH 4PFPA 4IF4A 5C4JJ 3FHNA 1G3TA 3K4KA 4UY8I 1IN8A 4CSWA 2HS5A 2IAIA 5CKTA 9ANTA 1F36A 1HDPA 3BJ6A 1J59A 3NEUA 3L00A 3HZJA 5DEQA 2HYFA 3ROUA 3BCAA 4E7LA 4UNOA 3OV8A 3J7AY 3EDPA 2RKHA 5EGOB 4CICA 4LIVA 4BE1A 4ENNA 2NVYJ 1HF0A 1WSUA 4BACA 1HW5A 1PYVA 1A6QA 4A0ZA 2E34A 4IX7A 2YR2A 3FMRA 4QSHA 2FD5A 1IXCA 2L9RA 3J81Z 2XF5A 5B1BH 1Z7LA 2ZO4A 4V2GA 4U88A 4LD5A 4IHVA 2JA6J 1ETOA 3IAM2 4A3CJ 4I76A 4M71A 5FRNA 1QZZA 1JKOC 3CDLA 3Q0VA 1JKPC 4E4HA 2DO7A 2MG4A 3ZMZA 1R1UA 3RPUA 1WJBA 2LDUA 1WRJA 2R7OA 4KIFA 2P5LC 1BW6A 1R36A 5ILSA 1U78A 2E7WA 2HZDA 4MTDA 1K79A 1MBGA 3BJOA 3OWTA 3BJAA 3BCBA 3KZYA 4U0YA 2VJ5A 3HKZA 3FXRA 1NG6A 3OYGA 2FQ3A 1YX3A 2OQRA 3SFIA 4A3DJ 4Y17A 1IDYA 4UXNA 2LKPA 4FX0A 1MMSA 4FASD 4YFNF 3PO2J 1FSHA 2JSCA 2FSWA 1DQUA 4LIUA 4A3BJ 2L4AA 3SEZA 3KPHA 4MFDA 1BI1A 3DQVC 3DU6A 5HDNA 5K5QA 1R58A 2CO5A 1R6RA 4BBSJ 1V5EA 4AIKA 2K9NA 4Q47A 5IYBJ 3RTRA 1ZQ3P 2ZNYA 2JVGA 4XSXF 3M8EA 1WGXA 3RQIA 5BPIA 2OTLI 2JPBA 1K78B 2FOWA 3HKZN 1FLIA 3K7AJ 4UHTA 2OZUA 3EQLF 3MFKA 1A04A 2XAGA 4EM0B 1RR7A 2OQGA 2JA7J 1FSEA 3WU2C 2ZMEB 3DU5A 2L4MA 5C3EJ 4E7HA 1YTYA 3TKYA 1PDNC 2QYOA 5GP9A 5FKLA 2MBFA 4O5VA 2WADA 1B8IA 2KP6A 3F6VA 4OIOF 4G7HF 4L0ZB 1ZLJA 4HX7A 1Z05A 3LA2A 2NVXJ 4O3MA 3PNYA 1MNDA 3BG7A 2MSYA 3G73A 4QTRA 3ECHA 3LSGA 1Z6RA 5DCMB 4U7BA 2LRDA 1QZYA 2R4GA 3DLAA 3ESWB 1MBJA 3H1CA 4DZPA 3LSJA 5L3BA 1EH6A 3K1PA 2V9PA 2M0MA 1RKTA 2QWWA 5E17F 1Z77A 3OYKA 2Y31A 4C3JJ 2BW3B 2HI3A 2J5OA 3VPRA 3GZNB 4ABZA 2DMNA 2F5CA 2HDDA 4M3FA 5FLMJ 1K4SA 1U3EM 1IV8A 2L7KA 5KAIC 4JP0A 4WK8F 5E3NA 4FX4A 1MNMC 4XM3A 4ANJA 1MIJA 1GXQA 3DPUA 1ON1A 5HS9A 1FBQA 3CMYA 1FOYA 2LOOA 1YX5A 1VQ6I 1K6OA 1XMAA 3M3YJ 3E6MA 4M3DA 1V4RA 2CW0F 3IUOA 1BOBA 3P9CA 3S2HJ 4L5JA 4A3EJ 1U8RA 4A12A 1D1BA 1QQIA 1OPCA 2EA4A 1OQYA 2FQ4A 3CP8A 5FFXA 2ZJPF 1T8IA 1R00A 1T33A 2LNBA 3HIFA 2YX7A 3AL0C 1XGSA 5HS8A 5HLIA 1ETYA 4RMNA 1X3WB 2V26A 2L9NA 4NQWB 1OKRA 2QBYB 1R7JA 2YX4A 3KLNA 1SMYF 3BDDA 4CYCB 4IQ4A 4DZJA 4HQMA 1OCRH 5E3LA 2GWRA 1FPQA 3M1CA 1EH7A 2V9KA 2PMZN 3CP2A 3N4MA 2F4MB 3IC7A 2L9VA 4ZDLA 3E6CC 2EFWA 2F48A 3T5XA 4M9XA 2XAHA 4EJWA 4UVAA 1PUFB 1V5GA 1VZ0A 2DT6A 2XSJC 3FDYA 5BNGA 1S5LC 1LEBA 2VT3A 1I3QJ 2IGKA 2XAFA 3JAMK 2VBWA 2JRMA 1ETXA 4F92B 5FKKA 1JHHA 3ZP5A 3CCVI 1BBYA 1B9NA 3PSFA 3GFIA 1YOVB 1HSTA 1RESA 1BC8C 1V55H 4JYKA 5F64A 2PMHA 1MBHA 2NOJB 3HOYJ 2YU9J 5E79C 2K40A 3LFKA 4U0WA 2EINH 5F1JA 3F8NA 3K1NA 2QEXI 1ITYA 1W7PB 3C1DA 3I0TA 4LMYA 4IO9F 2K9MA 1WI3A 5C44J 3K4LA 2EWNA 5J4YA 4CYDA 4RM2A 4BGDA 3IKTA 2NRAC 1W4MA 2VOPA 3DTKA 2VB6A 2OPTA 3GTGJ 4BNCA 3JTGA 1JT0A 2DA5A 1IRGA 2L3DA 1VQPI 5GAHJ 4YFXF 3WU1B 1TBXA 3JCUC 4KITB 2E1CA 3ABKH 1JJ8C 1U6GA 2WAFA 1ZG1A 2B63J 5DM6F 3ML6A 2V79A 5EG0A 4E7IA 4UUSB 3RYPA 2CFXA 2HGCA 3HGGA 1N25A 3FXMA 4XN0A 4ENKA 3F72A 4QIWN 1A35A 2DLLA 2IS1A 1RKWA 3TOBA 5IT9Z 2GXAA 2GOXB 1V54H 2E1NA 3ABTA 2PQ8A 3HRTA 2KRCA 2ZXWH 3LSPA 5CQEA 1O7LA 4AIJA 2EFQA 3P9KA 2PFBA 4EMSA 3ZQCA 3UKGA 2HU9A 2VOOA 2HKXA 2WY8Q 4D7MA 1Y1VJ 3ZMSA 1S9HA 1XGOA 4IQJA 3NWTA 1JGGA 1I1SA 3GWZA 2JWTA 2Z16A 4XKVA 2NXNB 3S3OA 4EJTA 2RAEA 2CQ7A 1F9NA 1MD0A 2K3PA 2ELJA 2LTPA 2OU2A 4PJNA 1G3WA 2WAQA 1XCBA 3CCQI 1HW1A 2E1MC 4XLPF 3J80K 4FE4A 4IRHA 5GADJ 4Q5SF 1XTAA 1KU9A 1IXSB 3CJQB 1Y56A 3FKIJ 3KP6A 4RAFA 3CMMA 1IGNA 3L2UA 1VQLI 3JREA 1TWGJ 3FISA 3M9AA 2DMUA 3LSIA 3PIPF 1Y39A 2HPIA 2DXIA 2VC1A 5EEAA 5CVRA 2QA4I 3FMSA 2BEOA 3KYLA 2Y9YA 3OYHA 3O8GA 1MJAA 5TGTA 3CTAA 2H6BA 1I6HJ 5DD4A 3WG7H 5LFAA 1D3YA 5KNLA 2ISZA 1CF7A 4KMFA 2OBPA 1HQCA 2AQEA 4LFUA 1H89C 2R7DA 5LGNA 3PJRA 2EK5A 3BOQA 3ZQIA 3SFZA 1J09A 4GCVA 3PNTA 5EEHA 2XRNA 5F0FA 2EJRA 4CXFA 2RDPA 1VQ4I 2DTRA 4BY7J 4G7ZF 3GO5A 4KMUX 1FOWA 3BG3A 3BR5A 4B3AA 4BJ5C 3QYEA 3RQ4A 2LREA 4CCOA 2XAQA 3GVAA 4IPAA 2O9LA 3S1MJ 2IGNA 3VSLA 3S16J 2R5YA 1FEXA 2CW7A 3DWLE 2CMPA 4BBRJ 1ZYRF 2HEOA 3P5JA 4G12A 2HVRA 3JSOA 4M6YA 1BOAA 1D0YA 3L7WA 1Q1VA 3GF2A 3HOXJ 2VKDA 4GGGA 1K61A 4KISA 1VI0A 4FE7A 1WJ5A 1AWCA 2JTVA 1PP8F 1O57A 2ECCA 1SC7A 5J4VA 4A5MA 1MDMA 3A01B 3ZMUA 4D5CA 4CA0A 3FX3A 5A2QK 2HNHA 3BZKA 4FT8A 3SZTA 2O7OA 3LAJA 2CS3A 5CVUA 4MGRA 2VXDA 2KDOA 3I4NJ 5E3OA 5L3CA 3L1PA 1MBFA 1W7PD 2QKMB 3L2VA 4BS9A 2EZHA 2CUEA 1UJ8A 2LBFA 2IEKA 1LDJA 1O3RA 3EYIA 2OC6A 2WV1A 3TO6A 4BU2A 1BIBA 2TDXA 3JRBA 2XAUA 2ZSIB 2DQLA 2QF7A 2JZYA 2M34A 5FRMA 3QQAA 2H8RA 1E3OC 1YW9A 2K02A 5GTIC 5CJ9A 2K9QA 3HOTA 2LKXA 4C3HJ 4CCJA 1I5ZA 4DYRA 3CCEI 4BE2A 1VFCA 4B1RA 4RDUA 5JVTA 3AKZA 3ABLH 4F55A 3IP4B 3TDUC 5CLSA 2B9SA 2Y0SA 1J7KA 1K6YA 2MW8A 2EV0A 1GLNA 5ILUA 1YO5C 4DQ2A 5E18F 1R49A 4NC6A 1KQ0A 2QCOA 3WG9A 4XRFA 4I0AA 3C7JA 3OYAA 1T98A 4L0YB 4EVIA 4I98B 1R1TA 2IRFG 4JX5A 1H88C 5D8KB 2IVMA 2QVOA 2R93J 3QPHA 2GA2A 4NC7A 4L9TA 3FBIB 1T56A 3U21A 4LG0A 4BYYA 5BQTA 4KN7X 4WCGA 1MJBA 4XK4A 2R92J 5J6XA 4QPOA 4XN3A 2FOKA 1F43A 1HCRA 4XLCA 4PGGA 1T95A 3I64A 3GXOA 2GQQA 2Y0SN 4A6DA 4EM1A 3OIPA 3FF5A 3QWLA 4P9UA 4M3GA 4PJ0C 1J75A 5LHIA 1FP1D 2NS8A 1X4OA 3E6BA 3K4JA 1XCVA 1NH3A 2WY7Q 2R7XA 3DBLB 3GW2A 2XAJA 2B0LA 1TC3C 2PI0A 3HOVJ 2L7MP 2KHMA 4A3LJ 4MQVA 4P55A 2JSPA 3SDGA 2I10A 1J5YA 2O5RA 4E7ZA 4D9JA 3ERED 1LVAA 2DDAA 1E2XA 3K69A 4AIHA 2VE8A 4EGZA 1TT0A 4LJZF 3HOWJ 1R5GA 2DYSH 2LSOA 4XICA 2UXXA 4OAYA 2QM3A 3E1SA 2RNJA 4S0HB 1FOKA 4HEA2 4OAZA 3EYYA 3ZQGA 4I2OA 3BR0A 3DEUA 1OFCX 3NAUA 2P6SA 1LFBA 3E3VA 2XF6A 1KZHA 2VJIA 2A07F 3J7AO 2GBYA 3HBLA 4UV8A 3RJPA 1K83J 3HOSA 2R7FA 5ICFA 1K7AA 3PFYA 2P4WA 4XMYA 3DXJF 3JRAA 1JI8A 1MW7A 2L01A 4MHGA 4X1EA 3I58A 4XL9A 4HF0A 2VQGA 3ULQB 1WVRA 1WJDA 3I4PA 2CUJA 4KT5C 4J00A 1BJAA 1QNTA 2OD5A 2HFHA 1FC3A 2I5UA 1I27A 2RGVA 2CG4A 2W00A 2VODA 2FUG2 1LJ9A 1XD7A 1R1VA 2VKHA 1IN6A 3GFJA 4PUSA 3HDDA 1UHSA 4A69C 1Z67A 2F4IA 4IHXA 1MBKA 1IV6A 4HSTA 3MEXA 2BY3A 4HV6A 4AYBN 1VQNI 4G9YA 4XLFA 2COMA 1B9MA 1X1DA 1HLVA 3TBIA 2IPQX 2X1EA 1JKQC 1TNTA 2XGCA 2ZFUA 4MO7A 3WGIA 1X58A 5J1RA 5HS7A 3F21A 2ZCWA 4CCMA 4OIQF 4F3QA 3ZRGA 3E7LA 2OJED 3QU6A 5TRDA 2HQAA 1DU0A 1WJFA 4X0GA 3HGYA 2XKPA 3FMQA 3GZ5A 4WXDA 2W25A 4L5IA 3D5SC 3HG9A 5D5WB 2M8GX 2JVHA 3KE2A 3B6AA 1ZG3A 2CQQA 2ZMEC 5JLXA 3W3CA 3ZN0A 1ZRCA 3LSKA 4M9ZA 5DYMA 1VF9A 1D0XA 5D5VB 3IAS2 3LQQA 3S1RJ 3FXQA 3U2RA 2BY2A 2XGDA 2MH9A 2EA2A 1YIJI 1P4XA 2DYRH 3BT9A 2F4OB 3MQ0A 3IKVA 1WWXA 2MA3A 3W6JB 1JUMA 1TWHJ 3CCMI 1X19A 4NDLA 2KDZA 3EPZA 4JQFA 1S3JA 4A3JJ 1IC8A 3JSPA 4YIIA 2GA1A 3JRFA 1ZN2A 3OS1A 2NVUB 2WC2A 2V6CA 1STZA 4TV7A 4Y13A 1JTYA 2OA4A 1P4WA 3G1LA 3GTQJ 2XDVA 2DN0A 1G59A 1X1BA 3DV8A 2A6TA 3PUFA 5HODA 1GV5A 5HNFA 4G94A 4N4NB 4B8XA 2QZ8A 2H6CA 3PIOF 2VQHA 4KFCA 3FXJA 1ETKA 1X4PA 3NQOA 4GYIA 3TP0A 3OIQA 2R5ZA 1TWFJ 5FKNA 3KZIC 1X3UA 4V2FA 1BI2A 3ZQHA 4JBAA 1KYZA 4XRMA 1SFUA 4JX4A 2NVQJ 5EGOA 1O3TA 1V3FA 4E7JA 4XNFA 2QQAA 3M1EA 2QKLB 2W82A 1Z7UA 1A31A 3PQJA 1KONA 3H9GA 3A03A 5LGUA 5FB2A 3PQKA 1YRNA 2PJRA 1B8IB 2GAUA 1NK3P 4PJMA 4Y3OA 2JMWA 3I53A 3LSRA 2VL8A 1Q1HA 3GUDA 3OY9A 2F5VA 1DGWY 1R5HA 5K5OA 3CC2I 2JA5J 1UHWA 2W84A 1MBEA 4XLAA 1T0FC 2HDWA 2PLYA 2LR8A 1IUFA 2X51A 2OF7A 3ZOBA 2DA4A 1MSFC 3GFMA 4HF2A 2EILH 2ACJA 5FO5A 4UVCA 1RRJA 1JJ6C 2DJIA 5IT3A 2BZTA 4LLLA 3GTOJ 4M74A 3W6VA 3ABUA 2QGUA 4RGRA 1X1AA 2MC3A 1QRYA 1OYYA 5J3LA 1UFMA 5HOOA 3I59A 2L54A 3IRRA 1S29A 2EBIA 2EQRA 3F6OA 2IA2A 2ME0A 2CRGA 3UNGC 3TQNA 2Y9ZA 1U9NA 3S2DJ 1GT0C 4A0XA 4II2A 1FBSA 2Y0MA 2EFPA 3OOUA 2W48A 1ZRFA 4OIRF 1TP4A 2EV5A 4BXXJ 3IWFA 4I7HA 4Z6YA 3MKZA 3BR6A 4U0VA 4D7NA 2JQ7A 4MFEA 2E2IJ 3TW7A 2DK8A 4K2EA 4DBQA 3HSEA 5J40A 1PJRA 4RB3C 3J81K 3OYEA 3N97A 1IAWA 4HAMA 2XGXA 2MLKA 4MNUA 3CLOA 1XPXA 3E5XA 5EYRA 4GYGA 4IEJA 4KYWA 1K78A 2BXZA 4NHJA 2IS4A 4A3FJ 4DNCA 4PK4A 3PSIA 5F0CA 1JUSA 4B48A 1BR2A 2PEXA 3H5RA 2ZMEA 3KETA 3FWEA 5HVQC 2IW5A 3L09A 2XRLA 4IL6C 3BC8A 3L2RA 4JOMA 4ZYAA 4ZTJA 1HBXG 1B72B 5D5XB 2WV0A 1HXDA 2Y75A 2DFFA 3CJNA 3OYFA 1G6NA 2F2EA 3VYTB 4RB0A 3FXLA 2RVCA 3QP5A 2A5YB 3RPUD 4H4KC 4YELA 1RETA 1IRFA 1BIAA 5D6FA 2XKOA 1H9GA 3BG9A 3OYBA 5K7HA 2H1LA 4FISA 2R7VA 2FJ1A 2V6EA 4KUMA 2HQRA 1S7OA 2MYSA 3BQYA 2MLGA 1SMTA 1OYWA 2IBDA 2KISA 1ZKGA 3VYUB 4ENMA 3S3NA 3HRSA 3F0CA 3CQZJ 3Q9VA 3CCRI 2XF7A 2STTA 1D5VA 3LA7A 2PN6A 4MEXF 1HSJA 2CYYA 1DPUA 2VKEA 3MKWB 3AFHA 2DCEA 1UG2A 1R71A 2BW3A 3GBGA 1AHDP 1W0TA 3OYLA 4GXOA 4ZZDA 1OR7C 5H6QA 3LOCA 1WKMA 2V1XA 5EZHA 2R7TA 3BG6A 2J5PA 3WTYC 1SFOJ 4ZTFA 2DQRA 1F4KA 1W36C 3VODA 4AUXA 5GPCA 2R7UA 1SFEA 2VUMJ 1U5TB 2G7UA 5H20A 5E8IA 4U7DA 3GTLJ 2JT1A 2KRFA 4ENJA 3CUQB 5K7FA 2BHYA 3LL7A 3Q9SA 4HNUA 4BEHA 2M7BA 3JRDA 2NS7A 2LK2A 3OYJA 4PDKA 3DEEA 4IHWA 1J9IA 4AM3A 4HLXA 2DPUA 3KEYA 3GEZA 2CU7A 2EZKA 2K27A 2LKSA 2XPWA 3J7ZI 3COAC 4EGYA 5EDNA 3L2QA 1R23A 2EH3A 2EFOA 1OISA 2IS6A 1IO2A 3K2AA 3K9TA 3ZQFA 5DS9A 4XOTA 3KP2A 3M8FA 1T0FA 2Z99A 5IP7J 4E70A 1GUUA 4HZFA 4NQWA 2BOLA 1BI0A 2XUBA 2P5VA 1YLFA 4CYCA 2LG4A 4XLHA 1ONVA 3E5QA 4WX9A 5HLGA 1SFKA 1I3AA 2VBYA 2XIGA 3IH2A 1EJ9A 3QOPA 3WHCA 2OUMA 1DU6A 4BDYA 3QODA 2ELHA 5JLWA 3HUGA 1N75A 1SVOA 3OS2A 1QBJA 3HOZJ 3E97A 3PNVA 2AHQA 2UWMA 3LQRA 2W7NA 1XMKA 1ORKA 1G2HA 5D4RA 2FMLA 4NC8A 3JR9A 3MWMA 4B09A 3EETA 3ECOA 3S17J 3TW6A 2HYJA 5ICEA 4MLOA 4BE0A 3TEDA 1QO0D 2K9SA 2KZGA 1MMGA 4EJOA 2WB1A 3QP6A 3HHGA 4XKWA 3TOAA 4FETA 5HNHA 4A3MJ 3A1YA 3CDHA 3DCFA 4RBOA 2M4KA 2F6CA 3OL4A 1BL0A 3CJTB 3DBHB 1Z21A 4KT6A 1QPMA 5BMZA 1TW2A 2IGMA 3QPTA 1D0ZA 3MVPA 3NWSA
chains in the Genus database with same CATH topology
4CCJA 5JHFA 1LVKA 4BE2A 4DJAA 2R7QA 3ZR8X 1MMNA 3OYIA 4NNJA 2BVMA 2M4GA 3AKZA 4F55A 3IP4B 1U0JA 3FKJA 4DGWB 4PFPA 2Y0SA 3FHNA 1K6YA 3K4KA 4CSWA 1GLNA 4EATA 5CKTA 3HL2A 3OYAA 3BCAA 4E7LA 3J7AY 4F52A 2V4JC 2VXZA 4LIVA 4BE1A 3OS0A 4BACA 4NC7A 1TZLA 1PYVA 3FBIB 4CUGA 3U21A 4IX7A 3LFUA 4BEHB 2HVSA 1V5FA 2PMZA 2XF5A 4Y33A 1Z7LA 2X6XA 4QPOA 4XN3A 3RSNA 3IAM2 4PJLA 4XLCA 4CCNA 1T95A 4C9YA 4CCKA 4PJJA 5FRNA 3OIPA 4AU7A 4E4HA 1X4OA 3K4JA 1WJBA 2WY7Q 2R7XA 4P1WA 2LYCA 2R7OA 5KCMA 3DKYA 2KHMA 2HZDA 4BDZA 3RCOA 3DTEA 3OWTA 4KJZA 2JSPA 3BCBA 3CF2A 2VJ5A 3HKZA 4PFOA 1NG6A 3OYGA 1N77A 2O5RA 1YX3A 4E7ZA 2V7FA 2OV7A 3HXLA 4D9JA 4E7KA 3HUGB 1TT0A 4FASD 4OAYA 1DQUA 4LIUA 3E1SA 1P9QC 1WFXA 4HEA2 4HNTA 4OAZA 3K4BA 3SEZA 4DOZA 4OWRB 4DIQA 3DQVC 3V42A 3DU6A 2ZSHB 1R6RA 1V5EA 2UUZA 1OLTA 3RTRA 2XF6A 2JVGA 2VJIA 4BQOA 1AA7A 3HOSA 4HPQA 2MABA 3PFYA 4XMYA 2KRHA 4N4OB 3DPLC 2LC2A 1JI8A 1MW7A 4XONA 2VASA 5FROA 4XL9A 2KL4A 3H5NA 2DT7B 3DU5A 2VQGA 3S93A 1WJDA 2ZXIA 2CUJA 4E7HA 4J00A 2W00A 2X85A 2FUG2 2WADA 2KP6A 2VKHA 2Z1DA 3K10A 4PUSA 2P0WA 3ZCOA 3PNYA 1MNDA 3BG7A 3D5LA 2F4IA 4G6TB 3LSGA 2X6WA 2KZVA 4HSTA 4U7BA 2LRDA 3I9V2 1FMWA 4XLFA 1MMDA 2E60A 2R4GA 1D1AA 3DLAA 1X1DA 3TBIA 2X1EA 4CZCA 3SZGA 2E1MB 1WJEA 3PUBA 1LFPA 2ZFUA 3AL0B 4BUPA 4NUBA 3OR1C 4CCMA 1QHGA 1BR4A 2M0MA 4F3QA 2CV1A 2KQRA 3ZRGA 3QYFA 2JUGA 3OYKA 4PSWA 2HQAA 1WJFA 2BW3B 4X0GA 2CV0A 3D5SC 3HG9A 3ZGKA 3K6GA 2HPMA 2JVHA 3EUHC 3K4NA 3W2VA 2BVLA 1FMVA 3W3CA 3SEQA 2RREA 3LSKA 4LITA 4GRIA 2L7KA 1MMAA 1Z3XA 4RLFA 1D0XA 3IAS2 2KPMA 3UR3C 3MKYB 4XM3A 3SYTA 4ANJA 1ERDA 3DPUA 4BQQA 4E7SA 4YRVA 5CQGA 2IS2A 2LOOA 1YX5A 2HVQA 3VYRB 4XR6A 1X19A 3IUOA 4B44A 1BOBA 2UV1A 3EPZA 4C30A 4JQFA 5LD2C 3OYNA 1D1BA 3OS1A 4XKBA 1QHHD 3CP8A 4BJ6C 3AL0C 3LMMA 4BQNA 1QU3A 4HG2A 2XDVA 4RMNA 4CCLA 1X1BA 2V26A 1G59A 4IKFA 2L9NA 3F9KA 2A6TA 3FBNB 3H35A 4NQWB 3ZXSA 5HNFA 2IXSA 4N4NB 3HC7A 3H9JA 4IQ4A 2VQHA 2X1DA 3OYMA 1X4PA 3M1CA 3OIQA 2DOAA 1UG0A 3EUKL 2V9KA 3S8PA 3CP2A 4ZDLA 1HA8A 4E7JA 4XNFA 4XQFA 1G8XA 2KLOA 2QKLB 2W82A 4HRIA 1V5GA 2RQQA 1VZ0A 1KONA 2DT6A 3H9GA 2XSJC 3FDYA 2PJRA 2M3AA 2LBFB 3MMYB 2IGKA 4PJMA 4Y3OA 2R7RA 2VL8A 3TMOA 3OY9A 2F5VA 3H5AA 4F92B 1DGWY 3K70D 3PSFA 3C2GA 4XLAA 2LY1A 1T0FC 2HDWA 2X51A 2V1NA 3N05A 2NOJB 4F91B 3W2WA 2WA0A 2DJIA 2K9LA 3CJRB 4RM3A 2E5ZA 2VJ4A 2CW8A 2K9MA 1X1AA 4F93B 2AQFA 5HOOA 2XC7A 3K4LA 4Y4RA 4RM2A 4BGDA 2CFOA 3UNGC 3L2WA 3DTKA 4II2A 2VB6A 4XLEA 4ZC3A 3OOUA 4LG3A 5KHDA 2Q2EB 4KITB 3MKZA 2WAFA 4BL0B 3PL8A 3VWBA 4E7IA 4DBQA 3OYEA 1PJRA 1D1CA 4XOPA 2WBMA 3OMYA 4XN0A 1DP3A 2IS1A 2L5QA 3ZQQA 2GOXB 3I3LA 2IS4A 2KRCA 4XKCA 5CQEA 4PK4A 2VQLA 3PSIA 4B48A 4II3A 1BR2A 3ONQA 3VYSB 3A2KA 3H5RA 2M7AA 1UAAA 5HVQC 1N78A 3DPTA 2HU9A 3K4CA 4IZZA 4AVZA 3BC8A 2WY8Q 3K4MA 2VPLA 1WJCA 3L2RA 1S9HA 1LKXA 1WJAA 3NWTA 4ITVA 4B47A 4IQJA 4JOMA 4ZYAA 4ZTJA 2Z16A 4B43A 4XKVA 3S3OA 3OL3A 3OYFA 3VYTB 2JA2A 5HLTA 4E6KG 2K3PA 2L2OA 2I8DA 4H4KC 3RPUD 4ZJZA 3OYCA 4YELA 1W36D 2ELJA 4PJNA 2WAQA 4P5OA 2E1MC 3VSKA 1ZELA 3OYBA 3OYDA 2R7VA 2V6EA 1MNEA 2A5WA 1Y56A 2MYSA 3CJQB 3CMMA 2MFZA 3S3NA 3VYUB 3KX2A 3L2UA 2CH0A 3C2HA 2XF7A 2PJRB 2KMUA 4C2TA 1X1CA 4U87A 2LH9A 3MKWB 3AFHA 2DCEA 3LSIA 2BW3A 2HPIA 3GBGA 3G2BA 2DXIA 3OYLA 2R7WA 4CH7A 4B3XA 4R79A 1OR7C 3KYLA 3OYHA 3EUAA 1IRXA 2VIXA 5TGTA 2R7TA 3BG6A 5LFAA 5KNLA 4XORA 3S3MA 4ZTFA 4RLQA 1W36C 3LSMA 4BXFA 3H9QA 2R7UA 2AQEA 2MC4A 3PJRA 2K5CA 1EA3A 3LL7A 4HNUA 1J09A 1NG7A 2W1OA 2M7BA 3PNTA 4BEHA 1UELB 3SDBA 3TL4X 3QOEA 3OYJA 3DEEA 2X1CA 3CESA 4D1QA 1BR1A 3KEYA 3HPGA 3BLYA 1SAUA 2VJJA 2CV2A 4BJ5C 3QYEA 3L2QA 3RQ4A 2LREA 4CCOA 1YE9A 2RNGA 2IS6A 2IGNA 3VSLA 4XOTA 2X6YA 2CW7A 3DWLE 2CMPA 3DTIA 4ZDPA 3CZ6A 4ZDOA 2HVRA 3OR2C 4J01A 1D0YA 2BOLA 3DKXA 2IGOA 4HSRA 2VKDA 2LG4A 4XLHA 4KISA 1SFKA 1WJ5A 2R7SA 4AYBA 3S32A 2OUMA 3QYBA 4BDYA 3QODA 3M8JA 1Z3YA 1E0EA 1N75A 2GOMA 3HPHA 1Y6IA 3LSHA 3MD2A 3VDXA 4CA0A 3OS2A 3K70C 3PNVA 2W4SA 4YEJA 2HNHA 2Q1ZB 2Z2SB 3W2AA 1LDKB 2UWMA 4BJTA 2W7NA 2CS3A 2VXDA 2KDOA 4C2UA 2QKMB 4NC8A 5CPRB 2MD0A 3L2VA 4BS9A 2VLAA 3A4CA 2LBFA 4BE0A 4MLOA 2OC6A 4BU2A 2E5NA 1MMGA 2VQCA 1DGRM 2CUZA 2WB1A 2XAUA 2ZSIB 4XKWA 4FETA 5HNHA 2WAEA 3A1YA 3D5RC 5FRMA 4PSXA 2M4KA 2F6CA 3OL4A 2L9SA 4DBRA 2LY2A 1Z21A 4KT6A 3H0DA 2ZXHA 2IGMA 1D0ZA 3HOTA 3E0JB 4QPQA 3NWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL3 A;  3OL4 A; 
#chains in the Genus database with same CATH topology
 1B1B A;  1LVK A;  5JHF A;  4N9I A;  4BH9 A;  4XBF A;  1MMN A;  3DKW A;  4RB2 C;  1C0W A;  3FKJ A;  3OIO A;  4DGW B;  5LRS A;  3T0Y A;  1BJZ A;  4M9S A;  2AXL A;  1KU7 A;  3BQZ A;  1HKQ A;  3HL2 A;  2E1O A;  2X4H A;  2O03 A;  4AID A;  4YIF A;  3WE3 A;  4M73 A;  4IXA A;  1LFU P;  1P7J A;  2WB1 N;  4F52 A;  2FEZ A;  4L9J A;  5AIP A;  1LDD A;  3F3X A;  3QPS A;  5K7Z A;  3OS0 A;  3P9I A;  2HQN A;  4ZZL A;  2YUS A;  3AAF A;  2O0Y A;  4HW0 A;  3WU0 A;  3CCU I;  1U9O A;  4A6E A;  4PGH A;  1V5F A;  2L02 A;  2HYG D;  3MN2 A;  1UHM A;  3DLL F;  4Y33 A;  3S14 J;  2X6X A;  3BP8 A;  2ECB A;  2D1V A;  3V8K A;  4BKX A;  5LEJ A;  4PJL A;  3O6B B;  2KIM A;  3HYI A;  4CCN A;  1P7I A;  4WXC A;  3CCL I;  4C9Y A;  3T8R A;  1ETV A;  4PJJ A;  2N8G A;  5GPA A;  3ASO H;  2DA1 A;  1OR7 A;  1UST A;  5FD6 A;  1T6S A;  3GTP J;  1FZP B;  4AU7 A;  2HXI A;  3CCJ I;  2YPR A;  3KP5 A;  1ZH5 A;  3SJM A;  3I5U A;  4P1W A;  3Q5F A;  2LYC A;  2Q0O A;  3Q0U A;  1YW8 A;  3DBR B;  1HKT A;  3DKY A;  2WAQ N;  2JPC A;  2RC4 A;  2NYX A;  1TQP A;  4BHB A;  4WXH A;  3DTE A;  5FKM A;  3RCO A;  3CF2 A;  5L3E A;  2JUC A;  1N77 A;  4CHU A;  2V7F A;  1VQ7 I;  2OV7 A;  2DT5 A;  4ESF A;  3GX4 X;  1IN7 A;  2K4B A;  1HKS A;  4B4C A;  3HSF A;  4UB8 C;  1QGP A;  4WWC A;  3GTM J;  1Z91 A;  2HR3 A;  1P9Q C;  1WFX A;  4X6A J;  5IPA A;  4R8H A;  5L3D A;  3K4B A;  1YJN I;  4DOZ A;  2YU3 A;  4OWR B;  4DIQ A;  1IN4 A;  1X3Z B;  5CVI A;  3V42 A;  1JE8 A;  1LB2 A;  1ZHF A;  2ZSH B;  5M3F J;  3B6C A;  1OLT A;  2EZI A;  5B3S H;  2EFN A;  4P9F A;  4BQO A;  1VQO I;  4IHS A;  1AA7 A;  4HPQ A;  4LLN A;  2R7Z J;  2DK5 A;  5IT9 K;  1RPW A;  4RAY A;  3BWG A;  2OCC H;  1WH7 A;  2KRH A;  2V1D A;  2DMP A;  4N4O B;  1YS6 A;  1QPI A;  1OCZ H;  5IYD J;  1S72 I;  5FRO A;  1B6A A;  3G6E I;  4HF1 A;  2KL4 A;  5FGM A;  3S93 A;  2PMU A;  2ZXI A;  1FTT A;  2G9W A;  1J2X A;  1FJL A;  3MAJ A;  1FY7 A;  1LE8 B;  1H9T A;  5J1U A;  5DUI A;  1PUE E;  4ESJ A;  5J1Y A;  1TWC J;  2ZFW A;  2Z1D A;  2P5K A;  2DPD A;  1CGP A;  2P0W A;  3ZCO A;  1ZAO A;  3D5L A;  1D5Y A;  3OOP A;  4EM2 A;  3KP7 A;  3S15 J;  5B1A H;  4YG2 F;  3BR3 A;  2E2J J;  3I9V 2;  4QWQ A;  1FMW A;  2QQB A;  1MMD A;  3BZ6 A;  2CUF A;  2E19 A;  3SZG A;  2E1M B;  2KIQ A;  3BZC A;  1YHQ I;  4LG0 B;  2M1B A;  4BUP A;  3G4S I;  3CME I;  3OR1 C;  5D4S A;  3WGG A;  4AVP A;  1T08 B;  2CV1 A;  1ZR4 A;  3BTJ A;  1IW7 F;  3ZMV A;  5M5Y J;  2KQR A;  2BYV E;  3L9F A;  1XDU A;  4KA4 A;  2A61 A;  4I02 A;  2STW A;  1G3S A;  4A5N A;  3A01 A;  1K4T A;  2CV0 A;  3ZGK A;  4J19 A;  3K6G A;  1GDT A;  2XB0 X;  3EUH C;  3K4N A;  2CQX A;  1FMV A;  5FLV A;  3SEQ A;  4LIT A;  2HXO A;  2XHK A;  4GRI A;  1MMA A;  3AG1 H;  3GFL A;  4RLF A;  2QSG X;  1GV2 A;  3UR3 C;  3MKY B;  4EEF G;  2Q2E A;  2OCE A;  5IP9 J;  3SYT A;  5LHG A;  3QRF F;  3Q3S A;  2VT2 A;  1OJL A;  4E7S A;  3OSG A;  1TT5 B;  5CQG A;  3VYR B;  1W0U A;  4XR6 A;  2P7V B;  4B44 A;  1ZRE A;  4C30 A;  1S7A A;  4XLN F;  2ID6 A;  2HQ5 A;  4XSZ F;  2E2H J;  2GXG A;  3KCC A;  1D8J A;  1VQM I;  2GM4 A;  3HHH A;  2R0Q C;  4XKB A;  2BY1 A;  4RGS A;  2Y48 A;  2CWE A;  1WZ2 A;  4BJ6 C;  1FYM A;  3LMM A;  2DMT A;  3MZH A;  3VB2 A;  4HG2 A;  4RAG A;  2ESN A;  3ZXS A;  3FBN B;  2XPU A;  3H35 A;  3SHF A;  3R6S A;  3PM1 A;  3I54 A;  5LGT A;  2IXS A;  4V19 K;  3BTL A;  1S6L A;  3HTS B;  1HOM A;  3RKY A;  3S8P A;  1UG0 A;  4LK1 F;  2DFH A;  1XN7 A;  4M72 A;  5J8F A;  1T38 A;  1LEA A;  2Y69 H;  2FBI A;  2WWY A;  1HA8 A;  3C18 A;  2JA8 J;  2KLO A;  3C3W A;  5IY5 H;  2E7X A;  1ULY A;  5EF6 A;  1IG7 A;  1ZK8 A;  4BY1 J;  1Z6T A;  4N0B A;  2DFI A;  3MMY B;  4MIM A;  3RZD J;  1XC5 A;  4Z2Y A;  4WF2 A;  4EJU A;  3TMO A;  3H5A A;  2BBY A;  4Y15 A;  2BY0 A;  3ABM H;  4RAZ A;  1XSD A;  1SFX A;  3GTK J;  3C2G A;  1ENH A;  5E1W A;  2M30 A;  2PG4 A;  4LLG F;  2LY1 A;  2QSH X;  3PFI A;  1YI2 I;  1KU3 A;  1MH3 A;  5E1Z B;  2EIJ H;  5GAE J;  4GO1 A;  3F8C A;  2V1N A;  4I01 A;  1LUJ B;  1GVJ A;  4F91 B;  1ZAR A;  1T2K A;  3D1N I;  1Y0N A;  3WE2 A;  2K9L A;  2QEN A;  3CJR B;  3LST A;  2E5Z A;  4RM3 A;  2QUF A;  5K5R A;  2FRH A;  4OMZ A;  2FXA A;  3GZ6 A;  2ZBK A;  1ZLK A;  1E3P A;  2B7E A;  1MH4 A;  3CDI A;  1SD4 A;  5F27 A;  5F6F A;  4F93 B;  2AQF A;  1QZE A;  4O6J A;  3I71 A;  1Y8Q B;  2MH2 A;  2DI3 A;  2FU4 A;  4CO8 A;  1D8K A;  2ICW G;  3L2W A;  4JK1 X;  2DAO A;  5E1X A;  4I09 A;  2O6G E;  1AKH A;  2RQP A;  3DP7 A;  2XB5 A;  5CVJ A;  1BA5 A;  1XDS A;  2GIZ A;  3FXO A;  1RNL A;  4KDP A;  5KHD A;  2ETH A;  1BC7 C;  5CVV A;  2K4J A;  3SXY A;  2ZC2 A;  1MSE C;  3HSR A;  1E3H A;  1TQM A;  1SD6 A;  4YFK F;  1TNS A;  3U1K A;  2XRO A;  3VWB A;  1PVE A;  2EV6 A;  4C3I J;  1D1C A;  1BI3 A;  1LQ1 A;  4A3G J;  1DP3 A;  1DP7 P;  1QA6 A;  2DOE A;  1WHU A;  2P6T A;  1IDZ A;  5ED4 A;  2VQL A;  4II3 A;  5ERI A;  3VYS B;  5DM7 F;  2M7A A;  4W1U A;  1N78 A;  1MGT A;  3F8F A;  3K4C A;  4IZZ A;  1NTC A;  4ZYE A;  2KJB A;  3JRH A;  2VPL A;  4M3B A;  3FXU A;  1LKX A;  1WJA A;  5TJJ A;  1YIT I;  1QVU A;  3PO3 J;  2JRT A;  4I0B A;  3OL3 A;  4D0P A;  1E17 A;  1XX5 A;  4MTE A;  2R5Z B;  1XSV A;  2D5V A;  1ZTR A;  1X2M A;  2ZJ2 A;  5FFZ A;  2ZXJ A;  5HLT A;  3E5U A;  5F08 A;  2I8D A;  2IJL A;  1U8B A;  2AS5 F;  5BPD A;  4XRS G;  2HKO A;  4P5O A;  1ZGW A;  2EIM H;  3V7C A;  3G3Z A;  1GVD A;  4GDF A;  3HEF A;  2WTE A;  2HDC A;  1FIA A;  2A5W A;  3WTU C;  2MFZ A;  2VE9 A;  5M3M J;  4I6Z A;  2JN6 A;  5F04 A;  2JJ7 A;  2X48 A;  2PJR B;  2FF4 A;  1YRN B;  1X1C A;  2X9D A;  3BPV A;  2LH9 A;  3WTT C;  3IWZ A;  3G2B A;  3ELK A;  3FZV A;  5K1Y A;  2R7W A;  4CH7 A;  4B3X A;  1JXS A;  3E6D A;  1IRX A;  3AG3 H;  5HLH A;  2ZJR F;  4IHY A;  1R22 A;  1TWA J;  4NBQ A;  3ERM A;  1F1Z A;  2YS9 A;  5E20 A;  2DA6 A;  4BXF A;  3H9Q A;  2VI6 A;  4IJA A;  1UZC A;  2MC4 A;  5EJC A;  5L3G A;  4BHP A;  1WQ2 A;  1Z9C A;  2K5C A;  4CGZ A;  1EA3 A;  2ZKZ A;  3HB9 A;  2VBZ A;  1NG7 A;  4I99 C;  1P92 A;  3LAP A;  4EV0 A;  1KYW A;  2D2W A;  2X1C A;  2F5E A;  1UMQ A;  1BR1 A;  2ISY A;  5E3M A;  4PCQ A;  3BLY A;  2VJJ A;  3I59 B;  2CV2 A;  2VC0 A;  1J0R A;  3O3K A;  3FIW A;  2QQ9 A;  1XGM A;  1HDD C;  3H36 A;  4NB5 A;  4F7Z A;  4FTH A;  4ZYH A;  2AO9 A;  2NOG A;  2X6Y A;  2G7H A;  3CC7 I;  1OCP A;  4L18 B;  3DTI A;  4ZDP A;  3WTW C;  4UV9 A;  2CGP A;  5FKO A;  1ETQ A;  5KAF C;  1TQI A;  1VQ9 I;  4A3K J;  3KP3 A;  1FNN A;  2H09 A;  1BM9 A;  2IGO A;  1NK2 P;  2LLK A;  5L3F A;  1SAN A;  2FBK A;  2R7S A;  4EQQ A;  3S32 A;  3IV5 A;  2HOS A;  3QU3 A;  3QYB A;  1A6I A;  3C2B A;  3M8J A;  4A93 J;  1B4A A;  5D5U B;  2FBH A;  1Y6I A;  1RI7 A;  3MD2 A;  3K70 C;  1U5T C;  2W4S A;  4YEJ A;  3RPQ A;  1KGS A;  3MCZ A;  3G1O A;  4BHC A;  4BJT A;  3CUQ C;  3DEW A;  2OAZ A;  3WOD F;  1HW2 A;  4IOA F;  2VKV A;  3FXK A;  4LGW A;  2MD0 A;  3V4G A;  3BR2 A;  2VLA A;  2LD5 A;  3A4C A;  2A69 F;  3T1B A;  3JAM Z;  1H8A C;  2E5N A;  1TL8 A;  1DGR M;  2NVT J;  4ZH4 F;  3O8H A;  2DMQ A;  3F23 A;  2MGQ A;  2K3F A;  3H0D A;  3QPL A;  2ZXH A;  4S04 A;  2YSR A;  2O8K A;  3E0J B;  3TO9 A;  4BAY A;  3K0L A;  4IRI A;  4DJA A;  1TLH B;  2R7Q A;  4HOB A;  2M0C A;  3BG5 A;  4D5F A;  5BS6 A;  3OYI A;  3R60 A;  2BVM A;  2M4G A;  4G8X A;  2DBB A;  4NNJ A;  4BXU A;  2UXN A;  2M87 A;  3HRU A;  2LMD A;  5IYC J;  5D8L B;  4EAT A;  4LB5 A;  5ILV A;  5IP6 A;  2DOD A;  1FYL A;  2OTJ I;  3FHZ A;  5DCF A;  1UB9 A;  2M2E A;  4HV5 A;  1SVL A;  2L0K A;  3IH3 A;  5DCM A;  1WCM J;  5H6R A;  1KQ9 A;  2V4J C;  2VXZ A;  2DFE A;  2VPR A;  1TZL A;  2ME6 A;  4CUG A;  2P81 A;  1W5C C;  2P7C B;  4HYE A;  1R4N B;  1FYK A;  3VFZ A;  4YIR X;  3LFU A;  4ZYG A;  1KA8 A;  4BEH B;  2W85 A;  2HVS A;  3BR1 A;  2PMZ A;  4HA8 A;  4N9H A;  2H1K A;  5LEK A;  3VEP A;  3RSN A;  5FD5 A;  4BQA A;  1F5T A;  2HTS A;  5EEG A;  5ICG A;  2RV8 A;  3MKL A;  2CQK A;  1IXR C;  1WH5 A;  4CCK A;  2A68 F;  3I56 I;  3FM5 A;  5FLX Z;  3RIR A;  1ETW A;  3H3U A;  4ASN A;  2A05 A;  3HJE A;  3I4M J;  1XGN A;  4AWX B;  1P4A A;  1IF1 A;  2KFD A;  2Z9O A;  5KCM A;  1APL C;  1VQK I;  4Y7N J;  4BDZ A;  2KJC A;  2BXY A;  3F22 A;  4Q48 A;  1AU7 A;  1OCO H;  4UUV A;  4KJZ A;  1W1W E;  1XMX A;  1B72 A;  1O4X A;  4PFO A;  2W24 A;  2O3F A;  1OCT C;  3HXL A;  2LVS A;  1VND A;  4E7K A;  2ESH A;  2ZNZ A;  1IJW C;  2DTZ A;  3D0S A;  3HUG B;  2E35 A;  4KIC A;  4G7O F;  2AXT C;  2JK3 A;  3ZQ7 A;  5D6E A;  5E8G A;  4LOC A;  3IRQ A;  5ICC A;  3J80 Z;  2O61 A;  2KKO A;  4HNT A;  5EZG A;  3NRV A;  5C4X J;  1FIP A;  2G0E A;  2QBY A;  4MEY F;  2UUZ A;  2E36 A;  3M07 A;  4UB6 C;  2FNP A;  5GAG J;  4XID A;  5EG0 B;  3WTX C;  1RC9 A;  1USS A;  3A0B C;  3V8J A;  2FMY A;  2MAB A;  1OYI A;  2DA7 A;  1XG1 A;  2DU9 A;  1FT9 A;  1FOX A;  3DPL C;  2LC2 A;  4KIB A;  2X6O A;  4XON A;  2VAS A;  1U5T A;  1REP C;  4LB6 B;  3KIO A;  3H5N A;  2DT7 B;  3CUQ A;  3LWF A;  4R1H A;  1PUF A;  4IVN A;  4ESB A;  2H8W A;  2LP0 A;  2IA1 A;  3M7G A;  4MQ9 F;  3ZPL A;  2W57 A;  2X85 A;  1O7F A;  2M45 A;  3AG4 H;  4M6X A;  5AIQ A;  5LBQ A;  3R61 A;  3K10 A;  1ZRD A;  1G3Y A;  1JHF A;  3RKW A;  3BTC A;  4L9N A;  1Z1D A;  2CQN A;  4G6T B;  2X6W A;  3K2Z A;  2KZV A;  5HDK A;  2R3S A;  4W97 A;  4A3I J;  1AOY A;  2V9V A;  2E60 A;  2M8E A;  1D1A A;  2BGC A;  4CZC A;  4FCY A;  3CF5 F;  1WJE A;  1Z0X A;  1LFP A;  2TCT A;  3PUB A;  5DV5 A;  1O3S A;  2HTJ A;  3W6K B;  3AL0 B;  4DYC A;  2V1U A;  1YW7 A;  4NUB A;  3CO6 C;  1PP7 U;  1A5J A;  1Y8R B;  4ON0 A;  5F0H A;  3R0A A;  3P7N A;  1QHG A;  1BR4 A;  3G71 I;  1I50 J;  1W7P A;  1EF4 A;  1SVM A;  3QYF A;  3R4K A;  2JUG A;  2GIV A;  3BRO A;  4PSW A;  4AD9 A;  1QVT A;  3V7S A;  4DW6 A;  2XPV A;  2VN2 A;  3JTH A;  1RUN A;  1IUY A;  3F8B A;  5A2Q Z;  1ODD A;  2HPM A;  4HX8 A;  1IZ1 A;  5FLX K;  3W2V A;  1UCR A;  2BVL A;  2Y30 A;  1OCC H;  1CF7 B;  2RRE A;  4DYQ A;  3U1D A;  1Z3X A;  4AC0 A;  2KPM A;  4PZJ A;  3H92 A;  1G4D A;  3WTS C;  2H27 A;  2LFB A;  1ERD A;  1YJ9 I;  2X0L A;  2D1H A;  3FK7 A;  4BQQ A;  2Z33 A;  1ZR2 A;  4HQE A;  1XSX A;  3ISP A;  4YRV A;  4UUS A;  1P2F A;  2IS2 A;  4LK0 F;  1MZB A;  2HVQ A;  3B02 A;  2K86 A;  2RN7 A;  3KYC B;  4Y52 J;  4UVB A;  2UV1 A;  4M6V A;  3M4O J;  5LD2 C;  3OYN A;  4HDV A;  3LNQ A;  3O2P E;  2MD5 A;  2NNN A;  1QHH D;  4FQG A;  1X1P A;  3TP3 A;  3JRI A;  2CJJ A;  2R5Y B;  2Z3Y A;  2NS0 A;  1I39 A;  2BE5 F;  4BQN A;  3JRG A;  2DJN A;  1QU3 A;  1DPR A;  4CCL A;  2ZB9 A;  3CO7 C;  4IKF A;  1EH8 A;  3F9K A;  2HZT A;  3U9G A;  2LF8 A;  2PBI A;  1FX7 A;  3HC7 A;  3MZ8 A;  4ETS A;  3H9J A;  4UUT A;  4IHT A;  2X1D A;  3OYM A;  2F5D A;  3TDZ C;  1JTX A;  1RR8 C;  4CDG A;  2Z5U A;  2DOA A;  3EUK L;  3ZN1 A;  5DDG A;  1YFH A;  3SZP A;  4HNV A;  1JT6 A;  1MDM B;  5B5E C;  1EV7 A;  3BPX A;  3K1M A;  2FNA A;  2HOA A;  5M5W J;  5TIS C;  2LY9 A;  4XQF A;  4GFB A;  1G8X A;  5M5X J;  4QLC U;  4HRI A;  3CD6 I;  3S2W A;  1EKE A;  4L5E A;  2RQQ A;  3HRM A;  3HOU J;  3IL2 A;  4RA2 A;  1KU2 A;  2H94 A;  4XRS A;  1KQ8 A;  1ZGA A;  5LRR A;  2XVC A;  3ASN H;  2DA3 A;  2M3A A;  3BTI A;  2LBF B;  3T8T A;  2R7R A;  4M3E A;  4RGX A;  3GLL A;  4HLY A;  2IP2 A;  3WHB A;  2PJP A;  3K70 D;  2L7Z A;  3H3V K;  1L0O C;  1LPQ A;  1S7E A;  5DTD A;  1B59 A;  2Q8K A;  2L7F P;  5F1R A;  2VON A;  2KIU A;  3N05 A;  2NAZ A;  2TRT A;  1YG2 A;  2DW4 A;  3W2W A;  3DF8 A;  5DD8 A;  2WA0 A;  3X2Q H;  3WTV C;  4HBL A;  2XV4 S;  2VJ4 A;  2K85 A;  5IOY A;  2CW8 A;  3VOE A;  2F5F A;  1L3L A;  2K7L A;  1VQ8 I;  3Q0W A;  2XC7 A;  3KZZ A;  4Y4R A;  2CFO A;  2D45 A;  1R4M B;  2LF7 A;  4P96 A;  5JVG F;  2XAS A;  2M9H A;  1O3Q A;  4XLE A;  4ZC3 A;  3FM3 A;  3KEO A;  2EB7 A;  3TGN A;  3ZMD A;  2DOF A;  4A0Y A;  1Y0U A;  1Y1W J;  1TW3 A;  4LG3 A;  1P6R A;  2Q2E B;  3CLQ A;  2ZJQ F;  1BW5 A;  2HOT A;  3G1M A;  2GZW A;  1SD7 A;  4EJV A;  2PX9 A;  4BL0 B;  3PL8 A;  5CYV A;  1H0M A;  4IRG A;  1TTY A;  2O8X A;  2UZK A;  2P8T A;  4XOP A;  1RUO A;  5HDG A;  1MKM A;  2HOE A;  3JW4 A;  2WBM A;  1DDN A;  3OMY A;  2DA2 A;  3WTZ A;  2L5Q A;  5JFR A;  3ZQQ A;  3JRC A;  3I3L A;  1W5S A;  3BY6 A;  4XKC A;  2FE3 A;  1M1E B;  2XSD C;  3ONQ A;  4HX4 A;  4RGU A;  4OMY A;  3REO A;  3A2K A;  2EZL A;  1SEU A;  1UAA A;  2QSF X;  3DPT A;  1YJW I;  4AVZ A;  3KLO A;  1GXP A;  4FHT A;  1SD5 A;  1LE8 A;  3K4M A;  2QLZ A;  3CMA I;  1WJC A;  4C2M J;  3GTJ J;  2KT0 A;  4B47 A;  4ITV A;  1FBU A;  5AON A;  4B43 A;  1T39 A;  1CQT A;  3KP4 A;  1WPK A;  3V7R A;  4OU0 A;  4RS8 A;  2FX0 A;  3V8L A;  2HWV A;  2JA2 A;  1JGS A;  1ON2 A;  1YYV A;  4E6K G;  1X2N A;  2L2O A;  1ACI A;  4ZJZ A;  3OYC A;  2M5W A;  1W36 D;  1IRZ A;  3L2C A;  4ZYD A;  1LNW A;  1JKR C;  1DUX C;  2DDB A;  2A6E F;  5JR3 A;  3RKX A;  4OIP F;  3VSK A;  1ZEL A;  3GME A;  2A3S A;  3OYD A;  5IOZ A;  5BOX A;  1POG A;  1MNE A;  3KFW X;  1R9T J;  1ZGJ A;  3KX2 A;  2CH0 A;  3C2H A;  3ZMT A;  2KMU A;  4C2T A;  3AG2 H;  3OSF A;  4G6Q A;  4U87 A;  2E71 A;  3RKQ A;  1HC8 A;  4HDU A;  1JUP A;  3IH4 A;  3CCS I;  4R79 A;  3DFG A;  3A0H C;  3EUA A;  2VIX A;  2IT0 A;  3J7Y J;  5LLQ A;  3HTU A;  5LHH A;  4XOR A;  3S3M A;  4RLQ A;  3LSM A;  1SAX A;  4KN4 X;  1BN5 A;  1S8N A;  3GCM A;  4KIG A;  5B66 C;  3RI4 A;  3ZQL A;  3CC4 I;  3QAH A;  2W1O A;  3RYR A;  1UEL B;  2Y2Z A;  3SDB A;  3TL4 X;  3LA3 A;  3S1Q J;  3QOE A;  2EIK H;  4OIN F;  1XS9 A;  4CZZ A;  3CES A;  2GXB A;  3RDI A;  4D1Q A;  3HPG A;  2IA0 A;  1R5I D;  1SAU A;  5JHU A;  4A2U A;  1A36 A;  3B73 A;  1VTN C;  1W5T A;  1YE9 A;  2RNG A;  3F8M A;  2CSO A;  2BHZ A;  3HM5 A;  1VQ5 I;  3NAR A;  1AKH B;  1I1G A;  3H3Z A;  5GTH C;  2GLO A;  1U2W A;  3CZ6 A;  4ZDO A;  3OR2 C;  3KEQ A;  4J01 A;  3DKX A;  3H0G J;  4HSR A;  3R0J A;  1XB4 A;  5J8C A;  4RB1 A;  1GHC A;  2ID3 A;  2A6H F;  2EPF A;  4AYB A;  4S05 A;  1NHA A;  3CUO A;  1Z3Y A;  1WI9 A;  3IHU A;  1E0E A;  1FTZ A;  2GOM A;  3A02 A;  3HPH A;  1I6X A;  3LSH A;  3VDX A;  3GLX A;  5H2F C;  3W2A A;  2Q1Z B;  2Z2S B;  3RZO J;  1LDK B;  2BV6 A;  4H0E A;  1FP2 A;  5FJ8 J;  4C2U A;  4JX6 A;  5CPR B;  4OOI A;  3I55 I;  2NNY A;  3CCY A;  5JI6 A;  1YS7 A;  3MZY A;  2ADU A;  2VQC A;  4IOC F;  1MJ9 A;  1OMI A;  2CUZ A;  2FA5 A;  2OZ6 A;  2QQ8 A;  1YIO A;  5J47 A;  3GYH X;  4G6D A;  2WAE A;  3D5R C;  5KVR A;  4L9V A;  4PSX A;  4KNY A;  2COB A;  2L9S A;  4DBR A;  1IN5 A;  1ZG5 A;  2LY2 A;  1FWZ A;  1YQA A;  2VBX A;  3S1N J;  5DUK A;  3TO7 A;  6PAX A;  1RZ4 A;  3EUH A;  4QPQ A;  5KK1 A;  3KYD B;  2XGE A;  2C6Y A;  3ZR8 X;  2KIF A;  2ELK A;  3FK6 A;  4Q4Z F;  1U0J A;  3SQN A;  3WGH A;  1RIO H;  4PFP A;  4IF4 A;  5C4J J;  3FHN A;  1G3T A;  3K4K A;  4UY8 I;  1IN8 A;  4CSW A;  2HS5 A;  2IAI A;  5CKT A;  9ANT A;  1F36 A;  1HDP A;  3BJ6 A;  1J59 A;  3NEU A;  3L00 A;  3HZJ A;  5DEQ A;  2HYF A;  3ROU A;  3BCA A;  4E7L A;  4UNO A;  3OV8 A;  3J7A Y;  3EDP A;  2RKH A;  5EGO B;  4CIC A;  4LIV A;  4BE1 A;  4ENN A;  2NVY J;  1HF0 A;  1WSU A;  4BAC A;  1HW5 A;  1PYV A;  1A6Q A;  4A0Z A;  2E34 A;  4IX7 A;  2YR2 A;  3FMR A;  4QSH A;  2FD5 A;  1IXC A;  2L9R A;  3J81 Z;  2XF5 A;  5B1B H;  1Z7L A;  2ZO4 A;  4V2G A;  4U88 A;  4LD5 A;  4IHV A;  2JA6 J;  1ETO A;  3IAM 2;  4A3C J;  4I76 A;  4M71 A;  5FRN A;  1QZZ A;  1JKO C;  3CDL A;  3Q0V A;  1JKP C;  4E4H A;  2DO7 A;  2MG4 A;  3ZMZ A;  1R1U A;  3RPU A;  1WJB A;  2LDU A;  1WRJ A;  2R7O A;  4KIF A;  2P5L C;  1BW6 A;  1R36 A;  5ILS A;  1U78 A;  2E7W A;  2HZD A;  4MTD A;  1K79 A;  1MBG A;  3BJO A;  3OWT A;  3BJA A;  3BCB A;  3KZY A;  4U0Y A;  2VJ5 A;  3HKZ A;  3FXR A;  1NG6 A;  3OYG A;  2FQ3 A;  1YX3 A;  2OQR A;  3SFI A;  4A3D J;  4Y17 A;  1IDY A;  4UXN A;  2LKP A;  4FX0 A;  1MMS A;  4FAS D;  4YFN F;  3PO2 J;  1FSH A;  2JSC A;  2FSW A;  1DQU A;  4LIU A;  4A3B J;  2L4A A;  3SEZ A;  3KPH A;  4MFD A;  1BI1 A;  3DQV C;  3DU6 A;  5HDN A;  5K5Q A;  1R58 A;  2CO5 A;  1R6R A;  4BBS J;  1V5E A;  4AIK A;  2K9N A;  4Q47 A;  5IYB J;  3RTR A;  1ZQ3 P;  2ZNY A;  2JVG A;  4XSX F;  3M8E A;  1WGX A;  3RQI A;  5BPI A;  2OTL I;  2JPB A;  1K78 B;  2FOW A;  3HKZ N;  1FLI A;  3K7A J;  4UHT A;  2OZU A;  3EQL F;  3MFK A;  1A04 A;  2XAG A;  4EM0 B;  1RR7 A;  2OQG A;  2JA7 J;  1FSE A;  3WU2 C;  2ZME B;  3DU5 A;  2L4M A;  5C3E J;  4E7H A;  1YTY A;  3TKY A;  1PDN C;  2QYO A;  5GP9 A;  5FKL A;  2MBF A;  4O5V A;  2WAD A;  1B8I A;  2KP6 A;  3F6V A;  4OIO F;  4G7H F;  4L0Z B;  1ZLJ A;  4HX7 A;  1Z05 A;  3LA2 A;  2NVX J;  4O3M A;  3PNY A;  1MND A;  3BG7 A;  2MSY A;  3G73 A;  4QTR A;  3ECH A;  3LSG A;  1Z6R A;  5DCM B;  4U7B A;  2LRD A;  1QZY A;  2R4G A;  3DLA A;  3ESW B;  1MBJ A;  3H1C A;  4DZP A;  3LSJ A;  5L3B A;  1EH6 A;  3K1P A;  2V9P A;  2M0M A;  1RKT A;  2QWW A;  5E17 F;  1Z77 A;  3OYK A;  2Y31 A;  4C3J J;  2BW3 B;  2HI3 A;  2J5O A;  3VPR A;  3GZN B;  4ABZ A;  2DMN A;  2F5C A;  2HDD A;  4M3F A;  5FLM J;  1K4S A;  1U3E M;  1IV8 A;  2L7K A;  5KAI C;  4JP0 A;  4WK8 F;  5E3N A;  4FX4 A;  1MNM C;  4XM3 A;  4ANJ A;  1MIJ A;  1GXQ A;  3DPU A;  1ON1 A;  5HS9 A;  1FBQ A;  3CMY A;  1FOY A;  2LOO A;  1YX5 A;  1VQ6 I;  1K6O A;  1XMA A;  3M3Y J;  3E6M A;  4M3D A;  1V4R A;  2CW0 F;  3IUO A;  1BOB A;  3P9C A;  3S2H J;  4L5J A;  4A3E J;  1U8R A;  4A12 A;  1D1B A;  1QQI A;  1OPC A;  2EA4 A;  1OQY A;  2FQ4 A;  3CP8 A;  5FFX A;  2ZJP F;  1T8I A;  1R00 A;  1T33 A;  2LNB A;  3HIF A;  2YX7 A;  3AL0 C;  1XGS A;  5HS8 A;  5HLI A;  1ETY A;  4RMN A;  1X3W B;  2V26 A;  2L9N A;  4NQW B;  1OKR A;  2QBY B;  1R7J A;  2YX4 A;  3KLN A;  1SMY F;  3BDD A;  4CYC B;  4IQ4 A;  4DZJ A;  4HQM A;  1OCR H;  5E3L A;  2GWR A;  1FPQ A;  3M1C A;  1EH7 A;  2V9K A;  2PMZ N;  3CP2 A;  3N4M A;  2F4M B;  3IC7 A;  2L9V A;  4ZDL A;  3E6C C;  2EFW A;  2F48 A;  3T5X A;  4M9X A;  2XAH A;  4EJW A;  4UVA A;  1PUF B;  1V5G A;  1VZ0 A;  2DT6 A;  2XSJ C;  3FDY A;  5BNG A;  1S5L C;  1LEB A;  2VT3 A;  1I3Q J;  2IGK A;  2XAF A;  3JAM K;  2VBW A;  2JRM A;  1ETX A;  4F92 B;  5FKK A;  1JHH A;  3ZP5 A;  3CCV I;  1BBY A;  1B9N A;  3PSF A;  3GFI A;  1YOV B;  1HST A;  1RES A;  1BC8 C;  1V55 H;  4JYK A;  5F64 A;  2PMH A;  1MBH A;  2NOJ B;  3HOY J;  2YU9 J;  5E79 C;  2K40 A;  3LFK A;  4U0W A;  2EIN H;  5F1J A;  3F8N A;  3K1N A;  2QEX I;  1ITY A;  1W7P B;  3C1D A;  3I0T A;  4LMY A;  4IO9 F;  2K9M A;  1WI3 A;  5C44 J;  3K4L A;  2EWN A;  5J4Y A;  4CYD A;  4RM2 A;  4BGD A;  3IKT A;  2NRA C;  1W4M A;  2VOP A;  3DTK A;  2VB6 A;  2OPT A;  3GTG J;  4BNC A;  3JTG A;  1JT0 A;  2DA5 A;  1IRG A;  2L3D A;  1VQP I;  5GAH J;  4YFX F;  3WU1 B;  1TBX A;  3JCU C;  4KIT B;  2E1C A;  3ABK H;  1JJ8 C;  1U6G A;  2WAF A;  1ZG1 A;  2B63 J;  5DM6 F;  3ML6 A;  2V79 A;  5EG0 A;  4E7I A;  4UUS B;  3RYP A;  2CFX A;  2HGC A;  3HGG A;  1N25 A;  3FXM A;  4XN0 A;  4ENK A;  3F72 A;  4QIW N;  1A35 A;  2DLL A;  2IS1 A;  1RKW A;  3TOB A;  5IT9 Z;  2GXA A;  2GOX B;  1V54 H;  2E1N A;  3ABT A;  2PQ8 A;  3HRT A;  2KRC A;  2ZXW H;  3LSP A;  5CQE A;  1O7L A;  4AIJ A;  2EFQ A;  3P9K A;  2PFB A;  4EMS A;  3ZQC A;  3UKG A;  2HU9 A;  2VOO A;  2HKX A;  2WY8 Q;  4D7M A;  1Y1V J;  3ZMS A;  1S9H A;  1XGO A;  4IQJ A;  3NWT A;  1JGG A;  1I1S A;  3GWZ A;  2JWT A;  2Z16 A;  4XKV A;  2NXN B;  3S3O A;  4EJT A;  2RAE A;  2CQ7 A;  1F9N A;  1MD0 A;  2K3P A;  2ELJ A;  2LTP A;  2OU2 A;  4PJN A;  1G3W A;  2WAQ A;  1XCB A;  3CCQ I;  1HW1 A;  2E1M C;  4XLP F;  3J80 K;  4FE4 A;  4IRH A;  5GAD J;  4Q5S F;  1XTA A;  1KU9 A;  1IXS B;  3CJQ B;  1Y56 A;  3FKI J;  3KP6 A;  4RAF A;  3CMM A;  1IGN A;  3L2U A;  1VQL I;  3JRE A;  1TWG J;  3FIS A;  3M9A A;  2DMU A;  3LSI A;  3PIP F;  1Y39 A;  2HPI A;  2DXI A;  2VC1 A;  5EEA A;  5CVR A;  2QA4 I;  3FMS A;  2BEO A;  3KYL A;  2Y9Y A;  3OYH A;  3O8G A;  1MJA A;  5TGT A;  3CTA A;  2H6B A;  1I6H J;  5DD4 A;  3WG7 H;  5LFA A;  1D3Y A;  5KNL A;  2ISZ A;  1CF7 A;  4KMF A;  2OBP A;  1HQC A;  2AQE A;  4LFU A;  1H89 C;  2R7D A;  5LGN A;  3PJR A;  2EK5 A;  3BOQ A;  3ZQI A;  3SFZ A;  1J09 A;  4GCV A;  3PNT A;  5EEH A;  2XRN A;  5F0F A;  2EJR A;  4CXF A;  2RDP A;  1VQ4 I;  2DTR A;  4BY7 J;  4G7Z F;  3GO5 A;  4KMU X;  1FOW A;  3BG3 A;  3BR5 A;  4B3A A;  4BJ5 C;  3QYE A;  3RQ4 A;  2LRE A;  4CCO A;  2XAQ A;  3GVA A;  4IPA A;  2O9L A;  3S1M J;  2IGN A;  3VSL A;  3S16 J;  2R5Y A;  1FEX A;  2CW7 A;  3DWL E;  2CMP A;  4BBR J;  1ZYR F;  2HEO A;  3P5J A;  4G12 A;  2HVR A;  3JSO A;  4M6Y A;  1BOA A;  1D0Y A;  3L7W A;  1Q1V A;  3GF2 A;  3HOX J;  2VKD A;  4GGG A;  1K61 A;  4KIS A;  1VI0 A;  4FE7 A;  1WJ5 A;  1AWC A;  2JTV A;  1PP8 F;  1O57 A;  2ECC A;  1SC7 A;  5J4V A;  4A5M A;  1MDM A;  3A01 B;  3ZMU A;  4D5C A;  4CA0 A;  3FX3 A;  5A2Q K;  2HNH A;  3BZK A;  4FT8 A;  3SZT A;  2O7O A;  3LAJ A;  2CS3 A;  5CVU A;  4MGR A;  2VXD A;  2KDO A;  3I4N J;  5E3O A;  5L3C A;  3L1P A;  1MBF A;  1W7P D;  2QKM B;  3L2V A;  4BS9 A;  2EZH A;  2CUE A;  1UJ8 A;  2LBF A;  2IEK A;  1LDJ A;  1O3R A;  3EYI A;  2OC6 A;  2WV1 A;  3TO6 A;  4BU2 A;  1BIB A;  2TDX A;  3JRB A;  2XAU A;  2ZSI B;  2DQL A;  2QF7 A;  2JZY A;  2M34 A;  5FRM A;  3QQA A;  2H8R A;  1E3O C;  1YW9 A;  2K02 A;  5GTI C;  5CJ9 A;  2K9Q A;  3HOT A;  2LKX A;  4C3H J;  4CCJ A;  1I5Z A;  4DYR A;  3CCE I;  4BE2 A;  1VFC A;  4B1R A;  4RDU A;  5JVT A;  3AKZ A;  3ABL H;  4F55 A;  3IP4 B;  3TDU C;  5CLS A;  2B9S A;  2Y0S A;  1J7K A;  1K6Y A;  2MW8 A;  2EV0 A;  1GLN A;  5ILU A;  1YO5 C;  4DQ2 A;  5E18 F;  1R49 A;  4NC6 A;  1KQ0 A;  2QCO A;  3WG9 A;  4XRF A;  4I0A A;  3C7J A;  3OYA A;  1T98 A;  4L0Y B;  4EVI A;  4I98 B;  1R1T A;  2IRF G;  4JX5 A;  1H88 C;  5D8K B;  2IVM A;  2QVO A;  2R93 J;  3QPH A;  2GA2 A;  4NC7 A;  4L9T A;  3FBI B;  1T56 A;  3U21 A;  4LG0 A;  4BYY A;  5BQT A;  4KN7 X;  4WCG A;  1MJB A;  4XK4 A;  2R92 J;  5J6X A;  4QPO A;  4XN3 A;  2FOK A;  1F43 A;  1HCR A;  4XLC A;  4PGG A;  1T95 A;  3I64 A;  3GXO A;  2GQQ A;  2Y0S N;  4A6D A;  4EM1 A;  3OIP A;  3FF5 A;  3QWL A;  4P9U A;  4M3G A;  4PJ0 C;  1J75 A;  5LHI A;  1FP1 D;  2NS8 A;  1X4O A;  3E6B A;  3K4J A;  1XCV A;  1NH3 A;  2WY7 Q;  2R7X A;  3DBL B;  3GW2 A;  2XAJ A;  2B0L A;  1TC3 C;  2PI0 A;  3HOV J;  2L7M P;  2KHM A;  4A3L J;  4MQV A;  4P55 A;  2JSP A;  3SDG A;  2I10 A;  1J5Y A;  2O5R A;  4E7Z A;  4D9J A;  3ERE D;  1LVA A;  2DDA A;  1E2X A;  3K69 A;  4AIH A;  2VE8 A;  4EGZ A;  1TT0 A;  4LJZ F;  3HOW J;  1R5G A;  2DYS H;  2LSO A;  4XIC A;  2UXX A;  4OAY A;  2QM3 A;  3E1S A;  2RNJ A;  4S0H B;  1FOK A;  4HEA 2;  4OAZ A;  3EYY A;  3ZQG A;  4I2O A;  3BR0 A;  3DEU A;  1OFC X;  3NAU A;  2P6S A;  1LFB A;  3E3V A;  2XF6 A;  1KZH A;  2VJI A;  2A07 F;  3J7A O;  2GBY A;  3HBL A;  4UV8 A;  3RJP A;  1K83 J;  3HOS A;  2R7F A;  5ICF A;  1K7A A;  3PFY A;  2P4W A;  4XMY A;  3DXJ F;  3JRA A;  1JI8 A;  1MW7 A;  2L01 A;  4MHG A;  4X1E A;  3I58 A;  4XL9 A;  4HF0 A;  2VQG A;  3ULQ B;  1WVR A;  1WJD A;  3I4P A;  2CUJ A;  4KT5 C;  4J00 A;  1BJA A;  1QNT A;  2OD5 A;  2HFH A;  1FC3 A;  2I5U A;  1I27 A;  2RGV A;  2CG4 A;  2W00 A;  2VOD A;  2FUG 2;  1LJ9 A;  1XD7 A;  1R1V A;  2VKH A;  1IN6 A;  3GFJ A;  4PUS A;  3HDD A;  1UHS A;  4A69 C;  1Z67 A;  2F4I A;  4IHX A;  1MBK A;  1IV6 A;  4HST A;  3MEX A;  2BY3 A;  4HV6 A;  4AYB N;  1VQN I;  4G9Y A;  4XLF A;  2COM A;  1B9M A;  1X1D A;  1HLV A;  3TBI A;  2IPQ X;  2X1E A;  1JKQ C;  1TNT A;  2XGC A;  2ZFU A;  4MO7 A;  3WGI A;  1X58 A;  5J1R A;  5HS7 A;  3F21 A;  2ZCW A;  4CCM A;  4OIQ F;  4F3Q A;  3ZRG A;  3E7L A;  2OJE D;  3QU6 A;  5TRD A;  2HQA A;  1DU0 A;  1WJF A;  4X0G A;  3HGY A;  2XKP A;  3FMQ A;  3GZ5 A;  4WXD A;  2W25 A;  4L5I A;  3D5S C;  3HG9 A;  5D5W B;  2M8G X;  2JVH A;  3KE2 A;  3B6A A;  1ZG3 A;  2CQQ A;  2ZME C;  5JLX A;  3W3C A;  3ZN0 A;  1ZRC A;  3LSK A;  4M9Z A;  5DYM A;  1VF9 A;  1D0X A;  5D5V B;  3IAS 2;  3LQQ A;  3S1R J;  3FXQ A;  3U2R A;  2BY2 A;  2XGD A;  2MH9 A;  2EA2 A;  1YIJ I;  1P4X A;  2DYR H;  3BT9 A;  2F4O B;  3MQ0 A;  3IKV A;  1WWX A;  2MA3 A;  3W6J B;  1JUM A;  1TWH J;  3CCM I;  1X19 A;  4NDL A;  2KDZ A;  3EPZ A;  4JQF A;  1S3J A;  4A3J J;  1IC8 A;  3JSP A;  4YII A;  2GA1 A;  3JRF A;  1ZN2 A;  3OS1 A;  2NVU B;  2WC2 A;  2V6C A;  1STZ A;  4TV7 A;  4Y13 A;  1JTY A;  2OA4 A;  1P4W A;  3G1L A;  3GTQ J;  2XDV A;  2DN0 A;  1G59 A;  1X1B A;  3DV8 A;  2A6T A;  3PUF A;  5HOD A;  1GV5 A;  5HNF A;  4G94 A;  4N4N B;  4B8X A;  2QZ8 A;  2H6C A;  3PIO F;  2VQH A;  4KFC A;  3FXJ A;  1ETK A;  1X4P A;  3NQO A;  4GYI A;  3TP0 A;  3OIQ A;  2R5Z A;  1TWF J;  5FKN A;  3KZI C;  1X3U A;  4V2F A;  1BI2 A;  3ZQH A;  4JBA A;  1KYZ A;  4XRM A;  1SFU A;  4JX4 A;  2NVQ J;  5EGO A;  1O3T A;  1V3F A;  4E7J A;  4XNF A;  2QQA A;  3M1E A;  2QKL B;  2W82 A;  1Z7U A;  1A31 A;  3PQJ A;  1KON A;  3H9G A;  3A03 A;  5LGU A;  5FB2 A;  3PQK A;  1YRN A;  2PJR A;  1B8I B;  2GAU A;  1NK3 P;  4PJM A;  4Y3O A;  2JMW A;  3I53 A;  3LSR A;  2VL8 A;  1Q1H A;  3GUD A;  3OY9 A;  2F5V A;  1DGW Y;  1R5H A;  5K5O A;  3CC2 I;  2JA5 J;  1UHW A;  2W84 A;  1MBE A;  4XLA A;  1T0F C;  2HDW A;  2PLY A;  2LR8 A;  1IUF A;  2X51 A;  2OF7 A;  3ZOB A;  2DA4 A;  1MSF C;  3GFM A;  4HF2 A;  2EIL H;  2ACJ A;  5FO5 A;  4UVC A;  1RRJ A;  1JJ6 C;  2DJI A;  5IT3 A;  2BZT A;  4LLL A;  3GTO J;  4M74 A;  3W6V A;  3ABU A;  2QGU A;  4RGR A;  1X1A A;  2MC3 A;  1QRY A;  1OYY A;  5J3L A;  1UFM A;  5HOO A;  3I59 A;  2L54 A;  3IRR A;  1S29 A;  2EBI A;  2EQR A;  3F6O A;  2IA2 A;  2ME0 A;  2CRG A;  3UNG C;  3TQN A;  2Y9Z A;  1U9N A;  3S2D J;  1GT0 C;  4A0X A;  4II2 A;  1FBS A;  2Y0M A;  2EFP A;  3OOU A;  2W48 A;  1ZRF A;  4OIR F;  1TP4 A;  2EV5 A;  4BXX J;  3IWF A;  4I7H A;  4Z6Y A;  3MKZ A;  3BR6 A;  4U0V A;  4D7N A;  2JQ7 A;  4MFE A;  2E2I J;  3TW7 A;  2DK8 A;  4K2E A;  4DBQ A;  3HSE A;  5J40 A;  1PJR A;  4RB3 C;  3J81 K;  3OYE A;  3N97 A;  1IAW A;  4HAM A;  2XGX A;  2MLK A;  4MNU A;  3CLO A;  1XPX A;  3E5X A;  5EYR A;  4GYG A;  4IEJ A;  4KYW A;  1K78 A;  2BXZ A;  4NHJ A;  2IS4 A;  4A3F J;  4DNC A;  4PK4 A;  3PSI A;  5F0C A;  1JUS A;  4B48 A;  1BR2 A;  2PEX A;  3H5R A;  2ZME A;  3KET A;  3FWE A;  5HVQ C;  2IW5 A;  3L09 A;  2XRL A;  4IL6 C;  3BC8 A;  3L2R A;  4JOM A;  4ZYA A;  4ZTJ A;  1HBX G;  1B72 B;  5D5X B;  2WV0 A;  1HXD A;  2Y75 A;  2DFF A;  3CJN A;  3OYF A;  1G6N A;  2F2E A;  3VYT B;  4RB0 A;  3FXL A;  2RVC A;  3QP5 A;  2A5Y B;  3RPU D;  4H4K C;  4YEL A;  1RET A;  1IRF A;  1BIA A;  5D6F A;  2XKO A;  1H9G A;  3BG9 A;  3OYB A;  5K7H A;  2H1L A;  4FIS A;  2R7V A;  2FJ1 A;  2V6E A;  4KUM A;  2HQR A;  1S7O A;  2MYS A;  3BQY A;  2MLG A;  1SMT A;  1OYW A;  2IBD A;  2KIS A;  1ZKG A;  3VYU B;  4ENM A;  3S3N A;  3HRS A;  3F0C A;  3CQZ J;  3Q9V A;  3CCR I;  2XF7 A;  2STT A;  1D5V A;  3LA7 A;  2PN6 A;  4MEX F;  1HSJ A;  2CYY A;  1DPU A;  2VKE A;  3MKW B;  3AFH A;  2DCE A;  1UG2 A;  1R71 A;  2BW3 A;  3GBG A;  1AHD P;  1W0T A;  3OYL A;  4GXO A;  4ZZD A;  1OR7 C;  5H6Q A;  3LOC A;  1WKM A;  2V1X A;  5EZH A;  2R7T A;  3BG6 A;  2J5P A;  3WTY C;  1SFO J;  4ZTF A;  2DQR A;  1F4K A;  1W36 C;  3VOD A;  4AUX A;  5GPC A;  2R7U A;  1SFE A;  2VUM J;  1U5T B;  2G7U A;  5H20 A;  5E8I A;  4U7D A;  3GTL J;  2JT1 A;  2KRF A;  4ENJ A;  3CUQ B;  5K7F A;  2BHY A;  3LL7 A;  3Q9S A;  4HNU A;  4BEH A;  2M7B A;  3JRD A;  2NS7 A;  2LK2 A;  3OYJ A;  4PDK A;  3DEE A;  4IHW A;  1J9I A;  4AM3 A;  4HLX A;  2DPU A;  3KEY A;  3GEZ A;  2CU7 A;  2EZK A;  2K27 A;  2LKS A;  2XPW A;  3J7Z I;  3COA C;  4EGY A;  5EDN A;  3L2Q A;  1R23 A;  2EH3 A;  2EFO A;  1OIS A;  2IS6 A;  1IO2 A;  3K2A A;  3K9T A;  3ZQF A;  5DS9 A;  4XOT A;  3KP2 A;  3M8F A;  1T0F A;  2Z99 A;  5IP7 J;  4E70 A;  1GUU A;  4HZF A;  4NQW A;  2BOL A;  1BI0 A;  2XUB A;  2P5V A;  1YLF A;  4CYC A;  2LG4 A;  4XLH A;  1ONV A;  3E5Q A;  4WX9 A;  5HLG A;  1SFK A;  1I3A A;  2VBY A;  2XIG A;  3IH2 A;  1EJ9 A;  3QOP A;  3WHC A;  2OUM A;  1DU6 A;  4BDY A;  3QOD A;  2ELH A;  5JLW A;  3HUG A;  1N75 A;  1SVO A;  3OS2 A;  1QBJ A;  3HOZ J;  3E97 A;  3PNV A;  2AHQ A;  2UWM A;  3LQR A;  2W7N A;  1XMK A;  1ORK A;  1G2H A;  5D4R A;  2FML A;  4NC8 A;  3JR9 A;  3MWM A;  4B09 A;  3EET A;  3ECO A;  3S17 J;  3TW6 A;  2HYJ A;  5ICE A;  4MLO A;  4BE0 A;  3TED A;  1QO0 D;  2K9S A;  2KZG A;  1MMG A;  4EJO A;  2WB1 A;  3QP6 A;  3HHG A;  4XKW A;  3TOA A;  4FET A;  5HNH A;  4A3M J;  3A1Y A;  3CDH A;  3DCF A;  4RBO A;  2M4K A;  2F6C A;  3OL4 A;  1BL0 A;  3CJT B;  3DBH B;  1Z21 A;  4KT6 A;  1QPM A;  5BMZ A;  1TW2 A;  2IGM A;  3QPT A;  1D0Z A;  3MVP A;  3NWS A; 
#chains in the Genus database with same CATH homology
 4CCJ A;  5JHF A;  1LVK A;  4BE2 A;  4DJA A;  2R7Q A;  3ZR8 X;  1MMN A;  3OYI A;  4NNJ A;  2BVM A;  2M4G A;  3AKZ A;  4F55 A;  3IP4 B;  1U0J A;  3FKJ A;  4DGW B;  4PFP A;  2Y0S A;  3FHN A;  1K6Y A;  3K4K A;  4CSW A;  1GLN A;  4EAT A;  5CKT A;  3HL2 A;  3OYA A;  3BCA A;  4E7L A;  3J7A Y;  4F52 A;  2V4J C;  2VXZ A;  4LIV A;  4BE1 A;  3OS0 A;  4BAC A;  4NC7 A;  1TZL A;  1PYV A;  3FBI B;  4CUG A;  3U21 A;  4IX7 A;  3LFU A;  4BEH B;  2HVS A;  1V5F A;  2PMZ A;  2XF5 A;  4Y33 A;  1Z7L A;  2X6X A;  4QPO A;  4XN3 A;  3RSN A;  3IAM 2;  4PJL A;  4XLC A;  4CCN A;  1T95 A;  4C9Y A;  4CCK A;  4PJJ A;  5FRN A;  3OIP A;  4AU7 A;  4E4H A;  1X4O A;  3K4J A;  1WJB A;  2WY7 Q;  2R7X A;  4P1W A;  2LYC A;  2R7O A;  5KCM A;  3DKY A;  2KHM A;  2HZD A;  4BDZ A;  3RCO A;  3DTE A;  3OWT A;  4KJZ A;  2JSP A;  3BCB A;  3CF2 A;  2VJ5 A;  3HKZ A;  4PFO A;  1NG6 A;  3OYG A;  1N77 A;  2O5R A;  1YX3 A;  4E7Z A;  2V7F A;  2OV7 A;  3HXL A;  4D9J A;  4E7K A;  3HUG B;  1TT0 A;  4FAS D;  4OAY A;  1DQU A;  4LIU A;  3E1S A;  1P9Q C;  1WFX A;  4HEA 2;  4HNT A;  4OAZ A;  3K4B A;  3SEZ A;  4DOZ A;  4OWR B;  4DIQ A;  3DQV C;  3V42 A;  3DU6 A;  2ZSH B;  1R6R A;  1V5E A;  2UUZ A;  1OLT A;  3RTR A;  2XF6 A;  2JVG A;  2VJI A;  4BQO A;  1AA7 A;  3HOS A;  4HPQ A;  2MAB A;  3PFY A;  4XMY A;  2KRH A;  4N4O B;  3DPL C;  2LC2 A;  1JI8 A;  1MW7 A;  4XON A;  2VAS A;  5FRO A;  4XL9 A;  2KL4 A;  3H5N A;  2DT7 B;  3DU5 A;  2VQG A;  3S93 A;  1WJD A;  2ZXI A;  2CUJ A;  4E7H A;  4J00 A;  2W00 A;  2X85 A;  2FUG 2;  2WAD A;  2KP6 A;  2VKH A;  2Z1D A;  3K10 A;  4PUS A;  2P0W A;  3ZCO A;  3PNY A;  1MND A;  3BG7 A;  3D5L A;  2F4I A;  4G6T B;  3LSG A;  2X6W A;  2KZV A;  4HST A;  4U7B A;  2LRD A;  3I9V 2;  1FMW A;  4XLF A;  1MMD A;  2E60 A;  2R4G A;  1D1A A;  3DLA A;  1X1D A;  3TBI A;  2X1E A;  4CZC A;  3SZG A;  2E1M B;  1WJE A;  3PUB A;  1LFP A;  2ZFU A;  3AL0 B;  4BUP A;  4NUB A;  3OR1 C;  4CCM A;  1QHG A;  1BR4 A;  2M0M A;  4F3Q A;  2CV1 A;  2KQR A;  3ZRG A;  3QYF A;  2JUG A;  3OYK A;  4PSW A;  2HQA A;  1WJF A;  2BW3 B;  4X0G A;  2CV0 A;  3D5S C;  3HG9 A;  3ZGK A;  3K6G A;  2HPM A;  2JVH A;  3EUH C;  3K4N A;  3W2V A;  2BVL A;  1FMV A;  3W3C A;  3SEQ A;  2RRE A;  3LSK A;  4LIT A;  4GRI A;  2L7K A;  1MMA A;  1Z3X A;  4RLF A;  1D0X A;  3IAS 2;  2KPM A;  3UR3 C;  3MKY B;  4XM3 A;  3SYT A;  4ANJ A;  1ERD A;  3DPU A;  4BQQ A;  4E7S A;  4YRV A;  5CQG A;  2IS2 A;  2LOO A;  1YX5 A;  2HVQ A;  3VYR B;  4XR6 A;  1X19 A;  3IUO A;  4B44 A;  1BOB A;  2UV1 A;  3EPZ A;  4C30 A;  4JQF A;  5LD2 C;  3OYN A;  1D1B A;  3OS1 A;  4XKB A;  1QHH D;  3CP8 A;  4BJ6 C;  3AL0 C;  3LMM A;  4BQN A;  1QU3 A;  4HG2 A;  2XDV A;  4RMN A;  4CCL A;  1X1B A;  2V26 A;  1G59 A;  4IKF A;  2L9N A;  3F9K A;  2A6T A;  3FBN B;  3H35 A;  4NQW B;  3ZXS A;  5HNF A;  2IXS A;  4N4N B;  3HC7 A;  3H9J A;  4IQ4 A;  2VQH A;  2X1D A;  3OYM A;  1X4P A;  3M1C A;  3OIQ A;  2DOA A;  1UG0 A;  3EUK L;  2V9K A;  3S8P A;  3CP2 A;  4ZDL A;  1HA8 A;  4E7J A;  4XNF A;  4XQF A;  1G8X A;  2KLO A;  2QKL B;  2W82 A;  4HRI A;  1V5G A;  2RQQ A;  1VZ0 A;  1KON A;  2DT6 A;  3H9G A;  2XSJ C;  3FDY A;  2PJR A;  2M3A A;  2LBF B;  3MMY B;  2IGK A;  4PJM A;  4Y3O A;  2R7R A;  2VL8 A;  3TMO A;  3OY9 A;  2F5V A;  3H5A A;  4F92 B;  1DGW Y;  3K70 D;  3PSF A;  3C2G A;  4XLA A;  2LY1 A;  1T0F C;  2HDW A;  2X51 A;  2V1N A;  3N05 A;  2NOJ B;  4F91 B;  3W2W A;  2WA0 A;  2DJI A;  2K9L A;  3CJR B;  4RM3 A;  2E5Z A;  2VJ4 A;  2CW8 A;  2K9M A;  1X1A A;  4F93 B;  2AQF A;  5HOO A;  2XC7 A;  3K4L A;  4Y4R A;  4RM2 A;  4BGD A;  2CFO A;  3UNG C;  3L2W A;  3DTK A;  4II2 A;  2VB6 A;  4XLE A;  4ZC3 A;  3OOU A;  4LG3 A;  5KHD A;  2Q2E B;  4KIT B;  3MKZ A;  2WAF A;  4BL0 B;  3PL8 A;  3VWB A;  4E7I A;  4DBQ A;  3OYE A;  1PJR A;  1D1C A;  4XOP A;  2WBM A;  3OMY A;  4XN0 A;  1DP3 A;  2IS1 A;  2L5Q A;  3ZQQ A;  2GOX B;  3I3L A;  2IS4 A;  2KRC A;  4XKC A;  5CQE A;  4PK4 A;  2VQL A;  3PSI A;  4B48 A;  4II3 A;  1BR2 A;  3ONQ A;  3VYS B;  3A2K A;  3H5R A;  2M7A A;  1UAA A;  5HVQ C;  1N78 A;  3DPT A;  2HU9 A;  3K4C A;  4IZZ A;  4AVZ A;  3BC8 A;  2WY8 Q;  3K4M A;  2VPL A;  1WJC A;  3L2R A;  1S9H A;  1LKX A;  1WJA A;  3NWT A;  4ITV A;  4B47 A;  4IQJ A;  4JOM A;  4ZYA A;  4ZTJ A;  2Z16 A;  4B43 A;  4XKV A;  3S3O A;  3OL3 A;  3OYF A;  3VYT B;  2JA2 A;  5HLT A;  4E6K G;  2K3P A;  2L2O A;  2I8D A;  4H4K C;  3RPU D;  4ZJZ A;  3OYC A;  4YEL A;  1W36 D;  2ELJ A;  4PJN A;  2WAQ A;  4P5O A;  2E1M C;  3VSK A;  1ZEL A;  3OYB A;  3OYD A;  2R7V A;  2V6E A;  1MNE A;  2A5W A;  1Y56 A;  2MYS A;  3CJQ B;  3CMM A;  2MFZ A;  3S3N A;  3VYU B;  3KX2 A;  3L2U A;  2CH0 A;  3C2H A;  2XF7 A;  2PJR B;  2KMU A;  4C2T A;  1X1C A;  4U87 A;  2LH9 A;  3MKW B;  3AFH A;  2DCE A;  3LSI A;  2BW3 A;  2HPI A;  3GBG A;  3G2B A;  2DXI A;  3OYL A;  2R7W A;  4CH7 A;  4B3X A;  4R79 A;  1OR7 C;  3KYL A;  3OYH A;  3EUA A;  1IRX A;  2VIX A;  5TGT A;  2R7T A;  3BG6 A;  5LFA A;  5KNL A;  4XOR A;  3S3M A;  4ZTF A;  4RLQ A;  1W36 C;  3LSM A;  4BXF A;  3H9Q A;  2R7U A;  2AQE A;  2MC4 A;  3PJR A;  2K5C A;  1EA3 A;  3LL7 A;  4HNU A;  1J09 A;  1NG7 A;  2W1O A;  2M7B A;  3PNT A;  4BEH A;  1UEL B;  3SDB A;  3TL4 X;  3QOE A;  3OYJ A;  3DEE A;  2X1C A;  3CES A;  4D1Q A;  1BR1 A;  3KEY A;  3HPG A;  3BLY A;  1SAU A;  2VJJ A;  2CV2 A;  4BJ5 C;  3QYE A;  3L2Q A;  3RQ4 A;  2LRE A;  4CCO A;  1YE9 A;  2RNG A;  2IS6 A;  2IGN A;  3VSL A;  4XOT A;  2X6Y A;  2CW7 A;  3DWL E;  2CMP A;  3DTI A;  4ZDP A;  3CZ6 A;  4ZDO A;  2HVR A;  3OR2 C;  4J01 A;  1D0Y A;  2BOL A;  3DKX A;  2IGO A;  4HSR A;  2VKD A;  2LG4 A;  4XLH A;  4KIS A;  1SFK A;  1WJ5 A;  2R7S A;  4AYB A;  3S32 A;  2OUM A;  3QYB A;  4BDY A;  3QOD A;  3M8J A;  1Z3Y A;  1E0E A;  1N75 A;  2GOM A;  3HPH A;  1Y6I A;  3LSH A;  3MD2 A;  3VDX A;  4CA0 A;  3OS2 A;  3K70 C;  3PNV A;  2W4S A;  4YEJ A;  2HNH A;  2Q1Z B;  2Z2S B;  3W2A A;  1LDK B;  2UWM A;  4BJT A;  2W7N A;  2CS3 A;  2VXD A;  2KDO A;  4C2U A;  2QKM B;  4NC8 A;  5CPR B;  2MD0 A;  3L2V A;  4BS9 A;  2VLA A;  3A4C A;  2LBF A;  4BE0 A;  4MLO A;  2OC6 A;  4BU2 A;  2E5N A;  1MMG A;  2VQC A;  1DGR M;  2CUZ A;  2WB1 A;  2XAU A;  2ZSI B;  4XKW A;  4FET A;  5HNH A;  2WAE A;  3A1Y A;  3D5R C;  5FRM A;  4PSX A;  2M4K A;  2F6C A;  3OL4 A;  2L9S A;  4DBR A;  2LY2 A;  1Z21 A;  4KT6 A;  3H0D A;  2ZXH A;  2IGM A;  1D0Z A;  3HOT A;  3E0J B;  4QPQ A;  3NWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...