3OL3A

Crystal structure of a putative uncharacterized protein from mycobacterium smegamtis, an ortholog of rv0543c, iodide phased
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Unknown function
total genus 31
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol3A02
3OL3A 3OL4A
chains in the Genus database with same CATH superfamily
2L9VA 4BJTA 3K69A 3BWGA 5HS8A 1VQ5I 1FSEA 5HLTA 3MZYA 4E70A 2HNHA 3FXQA 4ITVA 3WTZA 4AVZA 2R7RA 2W85A 3K10A 3I55I 2KZVA 3EUHA 1E3OC 2KP6A 1SVMA 5GPAA 2E2HJ 3DEUA 4LIVA 2IGOA 1HW1A 3V7SA 4A69C 2STTA 3NAUA 1A6QA 2F4OB 2DW4A 4JX6A 2XROA 1RNLA 2M30A 1OCPA 3GWZA 1I50J 2HKXA 3IC7A 1VQ8I 1FPQA 4C2MJ 4BDZA 2O0YA 3F21A 1HDDC 2L9NA 4LG0B 1VQ6I 1Y56A 2YUSA 3DKWA 2Z1DA 4NDLA 5E1XA 1TNSA 1YI2I 3CUOA 3SHFA 1NG7A 1LFBA 2M9HA 2YSRA 3HOSA 1E0EA 1BR4A 3LSTA 3K6GA 2A61A 4HLXA 2JA6J 1HC8A 5FKOA 2P6SA 4JYKA 5D8KB 2HYGD 4L5EA 5FGMA 4KNYA 3PO2J 5C4JJ 4U0VA 3TP3A 4DIQA 2HDCA 1IN6A 4UB6C 1SAXA 1OYYA 5ICFA 3JRHA 2VXZA 1G3SA 4XKVA 1TLHB 1GXQA 3B73A 3BR5A 4LJZF 2ZNZA 2VE9A 3WTUC 1B9NA 1OPCA 1TWFJ 4R8HA 1OISA 3RJPA 5GP9A 2ZSHB 2WY8Q 1YX5A 1D1AA 1I27A 1H88C 4XSZF 1UG0A 3EUKL 3TDZC 4ZDOA 4A3GJ 1JJ8C 3C7JA 3MKYB 2WAFA 2DT7B 4IEJA 1AKHB 3I71A 3CJRB 5LRSA 1QPMA 3IRQA 1R5HA 2XC7A 4L9VA 2O03A 2GOXB 2DOFA 3SZGA 3DTKA 4ZZDA 4A3EJ 2EILH 4I01A 2ESHA 1A36A 3BR0A 2B63J 1UJ8A 4IQ4A 1XC5A 3QPLA 3TO6A 4B4CA 4IHYA 4PK4A 1ZGJA 1BI0A 2K9NA 1MD0A 2DFFA 3MVPA 2E7XA 2MSYA 1XSVA 2CQ7A 3U21A 3HGYA 4ZZLA 3IRRA 2XB5A 2KDZA 3KYDB 1OCTC 3ISPA 2ECBA 5IP7J 2GBYA 3JAMK 4IVNA 2LP0A 2EJRA 2PMHA 4YFKF 4HOBA 4RDUA 1UHWA 3OYLA 3OYNA 5EJCA 3F9KA 1YO5C 5DYMA 2B7EA 4HX8A 3LA7A 1IV6A 4YFNF 4RB2C 4ESBA 1YW9A 4BDYA 1BJZA 4U7BA 5BPIA 2B0LA 5J8FA 3VODA 3P7NA 4CZCA 2Y0SN 3IP4B 1T08B 4UUSB 1X3ZB 1V5EA 2I5UA 3M3YJ 3L2VA 1UHMA 2DA4A 1C0WA 4AD9A 1EH7A 3CP2A 2XGXA 3GTKJ 1H0MA 3LA2A 4E7KA 1MBJA 2ME6A 5M3MJ 3LSRA 3S8PA 2NAZA 4BY7J 2ZFUA 1QU3A 1WJDA 1K6YA 3VDXA 4HQEA 3JREA 2YX4A 1FP1D 2WAEA 1HBXG 4N9HA 1WCMJ 2JPBA 2JK3A 2E1NA 2V79A 5TJJA 4AVPA 1VZ0A 3WE3A 4M3EA 3I0TA 4RBOA 1SC7A 3GLXA 1G3WA 2GA1A 1YOVB 5FFZA 4HLYA 2DFEA 3TOAA 1F4KA 3ABMH 4Y13A 1HXDA 3R4KA 3PIOF 1DPUA 3HSRA 1J7KA 3LSKA 3AFHA 4G6DA 3EYIA 2IS2A 3S3NA 3SZTA 1KU7A 1DU0A 5GTIC 3HYIA 2VE8A 2WAQN 2EH3A 2M5WA 3IH2A 3SYTA 4F52A 3OYDA 1P92A 1SD7A 4L5JA 1H9GA 4CCLA 2WBMA 2KIUA 4HX4A 4XN3A 3S3OA 3KZZA 3REOA 4YIRX 5HODA 2F5VA 3DFGA 2QSFX 3E0JB 3LSMA 3H92A 3GW2A 2C6YA 4I0BA 5EZGA 4G8XA 1VQMI 5LBQA 4HF2A 3FXLA 1ZARA 2JQ7A 2A5WA 4FCYA 1IJWC 1IF1A 3VPRA 1W36C 1WH5A 2AHQA 3QPTA 4RB0A 5E17F 5D4SA 4MTEA 4OOIA 4DBRA 3ZCOA 1YTYA 4M9XA 2RAEA 1BI2A 2V1XA 4RGXA 1NG6A 1SD6A 2IGMA 4QPOA 4YG2F 4RAFA 3RYRA 2WAQA 1SEUA 2X9DA 3HZJA 2GM4A 3ZQHA 1JE8A 4LMYA 2XPWA 2O61A 5M3FJ 4I2OA 2DA6A 1REPC 2Y69H 4M6VA 5F0CA 3GF2A 5JR3A 4A3IJ 2V9PA 4XQFA 3GTOJ 2BEOA 2VQHA 3KP6A 4HNVA 2F5CA 2E60A 3H3UA 4Q48A 4GRIA 3M8FA 2VBWA 1X1DA 2G9WA 3FXOA 1X3UA 2FU4A 2LH9A 5IT9K 2VBYA 2HDWA 2EQRA 5A2QZ 3V7RA 1BOAA 3ZQIA 2FQ3A 1RIOH 2EV6A 2CU7A 3D0SA 3ZQGA 5HDNA 2VC1A 1ZH5A 4MTDA 4G7HF 4LLNA 2TRTA 5HNFA 1U9NA 1P7IA 4G9YA 4B8XA 2B9SA 1PP7U 3FXKA 2ZCWA 1WQ2A 4EJOA 5GAEJ 2ICWG 3ESWB 1DDNA 4A3JJ 3EUAA 4L9TA 3W6KB 1O3TA 1MJ9A 1U0JA 3SFIA 5BPDA 2X1CA 1VQOI 4XKWA 4HNTA 2O9LA 4G7ZF 2M1BA 2CGPA 5E3OA 2M45A 3HUGA 2A6TA 1UAAA 3GCMA 2LKPA 4HPQA 2VPLA 3CCYA 1ZELA 2CW7A 2HI3A 1ZLKA 4DGWB 3H5AA 2JSPA 1ETOA 2OPTA 4RAZA 3SEZA 1HDPA 2ZXIA 1D0YA 2CJJA 2W25A 3I5UA 1HSJA 2K27A 2E34A 2HPIA 2F4IA 1O7LA 1IAWA 3E7LA 2X0LA 3I9V2 3PL8A 4MO7A 3FXMA 2XAGA 1OYWA 4XLFA 1ZR4A 3K2ZA 2XKPA 3AG1H 3DPTA 4DBQA 4ESJA 3J81K 1MDMB 1IN7A 4W1UA 4PJJA 1O3QA 4BJ6C 4M6XA 2WADA 5EEAA 3LA3A 3AAFA 4G94A 3ZXSA 4ZYGA 1HOMA 1GT0C 5JFRA 3DKYA 3ZQCA 2EK5A 2I8DA 1NK3P 2L02A 2AQFA 1BBYA 2BW3B 5IY5H 3H9GA 4KMFA 4ANJA 2D1VA 3KYLA 3JCUC 3A0BC 2QQ9A 2WY7Q 3TEDA 2DMUA 1FOYA 3DPLC 3CCLI 2I10A 3HM5A 3VYUB 3H0DA 1Q1HA 1B4AA 3PQKA 4NB5A 3RZOJ 5D6FA 1FNNA 2V1DA 4BQQA 2HQRA 3K0LA 1TQIA 4D7NA 3MAJA 5ED4A 3K1PA 2EFOA 3JRDA 2QSGX 2KHMA 3T8RA 4UUTA 2HS5A 5E3MA 1MMSA 2XAJA 2JVHA 5KHDA 2VLAA 3UR3C 4ZYEA 1IZ1A 3AL0C 1EF4A 3HOTA 2DT6A 1AKHA 1IN5A 1LKXA 4Q47A 4PSWA 1IV8A 1R1VA 5F08A 2VKHA 2HU9A 2CV2A 2L7ZA 3ZPLA 1G6NA 3P9IA 1LVAA 5JLWA 5IT3A 1P6RA 4OMZA 1W5SA 3WU1B 3FK7A 5D5WB 2EZLA 2WV1A 3CF2A 2CQNA 4FE4A 3LNQA 4CGZA 3IV5A 1D1CA 2FJ1A 1S8NA 2D2WA 1QVUA 3DLAA 3HPGA 4A93J 1VNDA 2HEOA 1JXSA 1PUEE 4KMUX 1WH7A 2L54A 2NRAC 2NVTJ 1MSEC 1PUFB 5ILSA 1DUXC 4C2UA 1JUPA 1R5GA 5DM6F 4A3MJ 2O8XA 2UV1A 2QQBA 4A0XA 4HSTA 4BHCA 1K78B 1O7FA 1VQ7I 2CSOA 3ZMVA 2XAHA 1FLIA 2E35A 1XX5A 1PJRA 1X58A 3BY6A 3IH4A 4C2TA 1QO0D 3QPSA 2RNJA 2FF4A 3I56I 1Y8QB 4OIPF 4BY1J 5H6RA 3L2UA 4Y17A 3MZHA 1BI3A 3DEWA 4UUSA 4MFEA 2PMZA 2F48A 1TNTA 1IXRC 3ERED 2ZNYA 5FROA 5DUIA 3GYHX 1BW5A 2W48A 2VJJA 4ENMA 3S2WA 3QPHA 2M7AA 4BYYA 2QCOA 3G3ZA 2NYXA 4E7SA 2XAUA 1ZGAA 3DBRB 3CP8A 2X48A 2ZXHA 2DYSH 1BJAA 2ZXJA 3CCUI 3DBLB 3GFMA 5ERIA 1YG2A 2YU9J 2O3FA 1TZLA 4FHTA 2IA0A 1LFPA 3S93A 4KFCA 2QVOA 3IKTA 2VPRA 3PIPF 3S1MJ 4LD5A 5LLQA 1ULYA 5KAIC 2ETHA 1K6OA 1T56A 1DGRM 1BC8C 3OSFA 2R5YB 2KIFA 1WZ2A 1MMAA 2HPMA 1GDTA 1WI3A 2E5ZA 1W7PD 2XHKA 4HV6A 5F6FA 3QAHA 4LGWA 2Z33A 3HOYJ 1OKRA 4JP0A 1XSDA 2IPQX 3VWBA 1J2XA 3FHZA 4IZZA 1LDKB 3QODA 2OZUA 4AYBN 3CDIA 4I02A 1B72B 1MKMA 2GAUA 4BE0A 4GO1A 2MC4A 4GYIA 2LKXA 4LB6B 2R7QA 4DQ2A 2CV1A 1WPKA 3CMYA 5EDNA 3W6VA 3BPVA 5LGUA 3HKZN 2OD5A 1V5FA 1P9QC 1FT9A 3GMEA 4C9YA 3WTWC 2AO9A 4NC8A 2W1OA 1KYZA 2JUCA 2HOTA 3PNTA 1P4XA 3E3VA 3E1SA 2LLKA 1HSTA 3VYRB 5FKKA 2Y30A 3JRIA 3GTQJ 2DMNA 2RV8A 4V2GA 1OCZH 2A6EF 1S5LC 3M1EA 4XKBA 1PP8F 3WODF 2VL8A 2ADUA 3KYCB 2ZMEB 2JVGA 3OIPA 4OAYA 1V3FA 1Y39A 1SFXA 4LOCA 3GZ5A 3T0YA 4J19A 1RR8C 3P9KA 3LMMA 1X2MA 4RAYA 5CJ9A 2CYYA 3OIQA 4Y7NJ 1MMDA 1Y8RB 5FO5A 5DCFA 1B8IB 4KICA 3GZ6A 2VT2A 3J7YJ 3HC7A 4GYGA 3F23A 3EQLF 2OCEA 3KEYA 1BA5A 1TT5B 1UMQA 3H5RA 5EZHA 2V6EA 4IQJA 4WWCA 5CKTA 3BG6A 1TQPA 3OV8A 5D6EA 1XGNA 5L3CA 1CF7B 1U9OA 4AM3A 2CH0A 3DPUA 4EJWA 3N4MA 1AHDP 4W97A 1FC3A 2IS6A 4B3XA 3S3MA 1JKRC 4NNJA 3HEFA 2CRGA 1Y1WJ 1YIJI 1Z91A 1ONVA 1FBUA 2LY2A 2YR2A 2HXOA 2NXNB 1J5YA 3OL3A 1AWCA 2VI6A 3CMMA 2QF7A 3RKYA 4O6JA 4ZDPA 3J7AY 2HZTA 3WHBA 4YELA 3FBIB 3GX4X 3ZP5A 4CHUA 2BXZA 2Q1ZB 2FX0A 2R3SA 3BOQA 2A6HF 2QENA 5HVQC 1UB9A 1KGSA 4OIRF 1EH6A 2DK5A 1LPQA 1QHHD 1Z77A 3Q9SA 4IX7A 2XUBA 2W4SA 4PDKA 3PM1A 1EKEA 9ANTA 5E79C 3K4MA 5FKLA 3OOUA 2DI3A 4NBQA 2M0CA 1GLNA 3G1LA 2Z3YA 4U0WA 3QOPA 4GCVA 5EGOA 3R60A 5E18F 2HYFA 3C2BA 2GXAA 1Z05A 5J40A 1WJAA 2MH2A 2Z9OA 2ZB9A 2D45A 1SFUA 3QWLA 1W7PB 2D5VA 3GTGJ 1IRGA 3LWFA 4UXNA 1OJLA 3RKQA 2L01A 4WXHA 1KZHA 3BR2A 2D1HA 3BTCA 4AWXB 4O3MA 2HZDA 3KZYA 4D5CA 1OCRH 2H6BA 4BKXA 3L2QA 1JT6A 1LVKA 3PO3J 1JTYA 3KLNA 5JVGF 3GTLJ 1TWCJ 2MGQA 1FBSA 5BOXA 4EVIA 2Y9YA 3Q0VA 4JBAA 5F04A 1RR7A 3FKJA 1HQCA 2XSJC 4X1EA 1EA3A 4KJZA 4UVBA 4M3DA 2JA8J 2EFQA 1HKQA 3FMQA 2O6GE 4WK8F 1I6XA 4H4KC 2EBIA 1UZCA 2HR3A 4I09A 1FJLA 2G7HA 2KFDA 4U0YA 2MD0A 3FK6A 3M9AA 1IRXA 2Q0OA 5FFXA 3K1MA 3F8CA 2W24A 1OYIA 3DU6A 3J80Z 3BPXA 3I53A 3L09A 3R0JA 3I59A 4S04A 1G3YA 2DXIA 5FLXZ 2X1DA 3A01B 4G6TB 4M3FA 3A02A 3ROUA 3TKYA 2E71A 1RKTA 4AC0A 2H94A 3BZKA 4IL6C 2BE5F 2COBA 4ETSA 2R7OA 1S72I 2EPFA 2STWA 3JRGA 1R6RA 1ETQA 3PFYA 5DCMA 3LSIA 4N9IA 1W4MA 4BE2A 4PFOA 1P2FA 1PVEA 3F8BA 3FXRA 3RQ4A 2DTZA 4G6QA 3PJRA 5FD6A 2QUFA 3IWZA 1K83J 4I7HA 2DAOA 4Y15A 5LEKA 2RN7A 3S15J 1U8BA 1Z7UA 4BEHB 2IA2A 2CFOA 3ML6A 3ZMUA 1QZZA 3FF5A 3GZNB 3SXYA 1SVOA 2PJRB 3I3LA 3F6OA 3CF5F 1IN4A 2V1UA 2QEXI 4CCKA 2PEXA 2K86A 2CQKA 5B3SH 2L4MA 4B43A 3S1QJ 1KQ9A 1X1BA 3S14J 1KU3A 4A5NA 2ID6A 3OYEA 1RZ4A 5EG0A 1YS7A 4MFDA 3BJAA 2LBFB 4CYCA 3BJOA 2R5ZA 3AG2H 1U2WA 2K85A 1LDJA 2ME0A 2E1MC 3K7AJ 4OIOF 1ZG5A 1HLVA 5EYRA 3SEQA 1MBGA 4BUPA 4CH7A 4RB3C 4BQAA 3RSNA 4XM3A 1ZRDA 3B02A 3I64A 1TW3A 2DCEA 2BY0A 1BW6A 5J8CA 3ZR8X 3K1NA 2F4MB 4PFPA 2E2IJ 4KYWA 1TWAJ 2BHZA 4EGZA 2ELKA 5IOZA 4Z6YA 3CCVI 2LNBA 2KT0A 2K3PA 1AA7A 2Y31A 1V4RA 3QRFF 1T95A 2LKSA 2EV5A 3NQOA 2WWYA 3ASOH 1W5CC 4X6AJ 4IPAA 4JK1X 1YIOA 2DA2A 3BTJA 1FYKA 3CMEI 1WJCA 4KN7X 4IHSA 2GQQA 3OS2A 2FE3A 4MHGA 2IGNA 2Y0SA 2GWRA 4ASNA 3L2WA 5KCMA 3MD2A 2DBBA 3M4OJ 4BJ5C 2VKVA 4YFXF 3U1KA 2VBZA 2ZC2A 3OYCA 2DTRA 1U5TB 2X6OA 3HRSA 4L0YB 3CDHA 4B3AA 3CJNA 1MMNA 3HOVJ 3CUQB 4YIFA 3F8MA 4NQWA 2P0WA 2CUEA 3OR2C 5IYDJ 4I76A 2QBYA 3BG5A 5GAGJ 4X0GA 2ZJ2A 1D5VA 2LY9A 5F27A 1T2KA 2R7TA 4FX4A 2RDPA 4CCJA 4UVCA 3HRUA 3CO6C 3RIRA 5L3EA 2KLOA 2DPDA 3DEEA 5EF6A 2HQ5A 1O3RA 5CVIA 5J4YA 1E2XA 2Q2EA 3O8HA 1FX7A 3C18A 1WVRA 2VQGA 4UVAA 1R4MB 2A68F 2XAFA 2OV7A 2L0KA 4HW0A 1FMVA 1YW7A 2WB1N 3C2HA 4IKFA 2MA3A 2EB7A 2HQNA 1I5ZA 1R5ID 2X51A 3H36A 4RGSA 1LE8A 3BQZA 3HPHA 4Y3OA 3BTLA 1E3HA 5KAFC 2NS8A 2VOPA 1RC9A 1SFEA 1W0UA 1JHHA 2VBXA 2JA2A 3WGHA 4QSHA 1MH3A 2W82A 1SVLA 2ZBKA 2XGDA 2VJ5A 5ICCA 5J47A 2HVQA 3CC7I 1FOKA 4MQ9F 1T8IA 2LF8A 2HVSA 3BR1A 2DT5A 1R36A 2FEZA 3PSIA 1T38A 3VYTB 2M3AA 2L4AA 4IJAA 4UV8A 2EIMH 3KETA 3CD6I 2CW8A 2KMUA 4M3GA 3RTRA 5M5YJ 4FQGA 2UXXA 5FB2A 4M6YA 5AONA 3QP5A 3KP3A 1R1TA 1ZRCA 4HV5A 4RLFA 3E6CC 1IN8A 3VSLA 3Q9VA 4KITB 2H1KA 2WB1A 4HAMA 3M1CA 1KYWA 3WU2C 1OR7C 2MFZA 2LDUA 3RZDJ 1VFCA 1R22A 4FE7A 1JKOC 1D5YA 3D5RC 2WA0A 2A69F 3JSOA 1UG2A 4KT6A 2IVMA 3FMRA 2Y2ZA 5B5EC 4ZYDA 2LF7A 2XIGA 2DLLA 2X6XA 5ICGA 4ZTJA 2RGVA 2H09A 3DTEA 4ZTFA 1WI9A 3TGNA 1EH8A 3RDIA 4KDPA 2RKHA 3TW6A 3C1DA 1YRNB 2XV4S 2F6CA 2FBHA 3W3CA 4B47A 1RETA 4BXXJ 2MH9A 4LG3A 4XRSG 1ZK8A 2P7VB 3SFZA 4AUXA 2GLOA 4PUSA 3I4MJ 2BXYA 1W7PA 3DXJF 1RKWA 3V8KA 1QQIA 2XF5A 5DUKA 2CUZA 2DMTA 2OA4A 2P6TA 4C3IJ 4U7DA 2ISZA 4JOMA 3CCSI 2L7KA 2FBIA 5HDGA 2MW8A 2ID3A 4P9FA 3ULQB 1HW5A 1XN7A 4UNOA 2M8GX 5HLIA 5E3NA 4LG0A 2Z5UA 4WXDA 5HNHA 2JMWA 1IXSB 2QQ8A 2COMA 2EIJH 3OR1C 2VT3A 4JX4A 3ZOBA 4AIKA 2FOWA 2XB0X 3G71I 1XDUA 3CCEI 5EEHA 1MBKA 1JUMA 3DWLE 2XF7A 3ZQQA 1IRFA 4MGRA 1BL0A 2MC3A 2F2EA 1VQLI 2ZJPF 1IGNA 2QGUA 3OYGA 2ZFWA 2BV6A 3GO5A 2HQAA 4DYRA 1QRYA 2EA4A 3H3VK 1BI1A 4ON0A 1GVJA 4RGUA 1W1WE 4N4OB 2UZKA 3OS0A 3RPQA 3TW7A 2JRTA 4XLNF 4EV0A 2FNAA 1FP2A 3N05A 3VEPA 4HNUA 4E7LA 3OYJA 1OMIA 4QTRA 2QSHX 4IRGA 3WE2A 3LOCA 4M74A 4WXCA 3TMOA 4Z2YA 1AOYA 2NVUB 1ORKA 4XSXF 1FIAA 2O7OA 4JQFA 3K4NA 5TGTA 1IC8A 4F7ZA 5KK1A 3QYEA 3OY9A 2K4BA 3TO9A 3B6AA 4HQMA 2ACJA 2LVSA 4J01A 1BR1A 1YYVA 4BACA 4L0ZB 5D5XB 5KVRA 1XD7A 2MG4A 4BHPA 3FM3A 1ERDA 3KEOA 3M8EA 1QHGA 4CZZA 4XKCA 4DZPA 2HOEA 3MCZA 2NVYJ 3QYFA 1AU7A 3DQVC 4EJUA 4UV9A 4RAGA 2DMPA 3P5JA 4M71A 4M9SA 3CMAI 2DJNA 4RM3A 1L0OC 2V9VA 4A3LJ 2Y48A 2JUGA 2DA5A 3EETA 3QP6A 3LAJA 2R7ZJ 3WU0A 5LGNA 2DDAA 1O4XA 1BOBA 1PYVA 2QQAA 3FMSA 2RQPA 1IXCA 1ETWA 4C3HJ 4XICA 2KDOA 3HB9A 1U8RA 4PJMA 1RUOA 4XOPA 4D9JA 1X19A 2IS1A 1K61A 4OAZA 3IUOA 4YEJA 3SZPA 1IW7F 1DGWY 5FRNA 3GXOA 4UHTA 2XSDC 3GTMJ 3MZ8A 4BGDA 3UKGA 2QWWA 2OBPA 3W6JB 1F43A 4HDUA 4WX9A 5HS9A 1YJNI 2KRHA 3OYIA 4ZDLA 2E1OA 5CQEA 2M4KA 1RUNA 3WTSC 2MABA 4IHVA 4PJLA 5BS6A 2H27A 2OC6A 1JGSA 3S17J 4EJTA 3OYFA 4EM0B 4FT8A 5J4VA 2RQQA 4LB5A 1WFXA 2M0MA 1IDYA 1W5TA 5E8GA 1H89C 4FX0A 5F64A 3JAMZ 2MYSA 2DYRH 4LK1F 1JUSA 3HTSB 2X6WA 3RI4A 2DK8A 1FYMA 2DODA 1U6GA 3ASNH 3B6CA 2IEKA 2H8RA 3GLLA 4BNCA 2KPMA 1KQ0A 2YS9A 3RPUD 1JT0A 1JKPC 4CCMA 5J6XA 3M8JA 2ELHA 2H1LA 5LGTA 4MIMA 2OU2A 2ZMEC 2R7VA 3KE2A 3QU3A 4A3CJ 2DA7A 2PMUA 3R6SA 3BT9A 3H35A 3L1PA 1CGPA 4PCQA 1GUUA 1ZTRA 2BY1A 5JHFA 3IAM2 2R7XA 3R0AA 4DOZA 1MJBA 2P5LC 2VUMJ 3I58A 3HOUJ 1ZKGA 2FMYA 2R7FA 2V6CA 4HBLA 3CUQA 3IL2A 1K4SA 4XRMA 1FOWA 1N77A 4HRIA 2AXTC 1XCVA 2HOSA 4PZJA 5DM7F 2CFXA 3RQIA 5CVRA 5J3LA 3QYBA 2PBIA 3G6EI 3TP0A 1I6HJ 3HDDA 3KZIC 1ZN2A 2VASA 1T0FA 2CUJA 3AG3H 3FKIJ 4ZC3A 1Z7LA 1ITYA 3PQJA 3U9GA 2PG4A 2DMQA 2UXNA 1FWZA 2V7FA 4XIDA 1RRJA 4XONA 5F0FA 3IHUA 3T1BA 2DPUA 3MWMA 4F92B 4F55A 4A6EA 1WGXA 2NS7A 3DV8A 1PDNC 4AYBA 2K40A 2IT0A 3BG9A 3ZN1A 1QNTA 2MD5A 4KIBA 2PI0A 2VN2A 1DP7P 1F5TA 2XRLA 4RMNA 2NNNA 3FDYA 3BQYA 4NHJA 3T8TA 4IOCF 2VKEA 2P5KA 1MBHA 3L00A 3ABTA 3W2WA 4ENKA 3FXUA 3HKZA 3BTIA 4ABZA 1FTZA 1WRJA 4IRHA 5GAHJ 3D5SC 2KL4A 2E1CA 1FOXA 3OYMA 2RNGA 3E97A 4LITA 1APLC 3QQAA 2IGKA 2YU3A 2EV0A 3K4JA 4XOTA 2ECCA 3CQZJ 5JLXA 1TW2A 4GXOA 5KNLA 2FQ4A 3ZMZA 2XASA 2LYCA 4XNFA 2NVQJ 4NC7A 3K4BA 4F3QA 2EZKA 2MLGA 1UFMA 5A2QK 2IP2A 3DLLF 2MLKA 1G2HA 1R58A 1TL8A 3HHHA 4RB1A 3ZMSA 1VTNC 2GZWA 3UNGC 6PAXA 5C4XJ 3BZ6A 4BH9A 1H9TA 3GEZA 5F0HA 3X2QH 2OF7A 5IYCJ 2HTJA 3MFKA 2CS3A 2X4HA 2TDXA 3MKLA 2BVMA 5B1AH 3A03A 1LEBA 1MW7A 1MIJA 3HSFA 5K5QA 1ETXA 1A6IA 2HDDA 1IO2A 4L5IA 3V42A 4EJVA 1YRNA 5JVTA 5GTHC 4OMYA 1H8AC 2VC0A 5LHHA 3DF8A 1XB4A 1B59A 2VJIA 3K4LA 2GIVA 3JSPA 1YFHA 5E1WA 1TWHJ 3BDDA 3WHCA 1A5JA 2A05A 4WCGA 2LTPA 1SFOJ 4L18B 1GV2A 2KKOA 5IT9Z 1D8KA 1WJBA 2KIQA 3O2PE 4K2EA 3F22A 3ZQLA 2XGEA 1QA6A 2BOLA 2UWMA 4Y4RA 2JRMA 4OIQF 5LFAA 1A31A 4M73A 1VQ4I 3ERMA 1F1ZA 1FIPA 2K9SA 3AKZA 3BROA 1MDMA 1JJ6C 1V55H 3Q0UA 4XRFA 3CJQB 4QLCU 3MMYB 1MNMC 2HOAA 4N4NB 3PNVA 4XK4A 2DA3A 3JRCA 5FLVA 3HHGA 4ESFA 5H20A 1Z3YA 2ZKZA 2ZSIB 2K7LA 4A3DJ 5L3FA 2Y75A 1TC3C 2IW5A 5D8LB 2E36A 4IXAA 1U78A 1OR7A 5D5UB 1JKQC 2Q8KA 2EZHA 2CMPA 4HX7A 4XL9A 2BW3A 4V2FA 1IDZA 2W84A 3HUGB 1M1EB 1USSA 2RVCA 4P9UA 3IH3A 2VB6A 3ECOA 1X4PA 1IUFA 2L9RA 3O8GA 1Z0XA 3CO7C 2BYVE 4OINF 2GXBA 1XMAA 2KZGA 2CUFA 3FBNB 3H3ZA 3IWFA 3R61A 3OYKA 4P5OA 4ZH4F 3GTPJ 1X4OA 2JSCA 3DCFA 3LSJA 2DFHA 2K3FA 5ILVA 2TCTA 1QBJA 3FXJA 2R7UA 3GUDA 2XDVA 3MKZA 5DTDA 2XKOA 4KT5C 3PSFA 5B1BH 3J81Z 3GVAA 3S1NJ 5K7HA 5H2FC 4QPQA 3OYHA 2EA2A 5GPCA 2HYJA 2QLZA 1Z67A 4IHTA 4DZJA 1WJ5A 2F5EA 4BXUA 1SD5A 3LSPA 1XPXA 3H9QA 2V1NA 3LQQA 1QVTA 4CA0A 4E7ZA 4XLHA 3O6BB 4KIFA 2ZJQF 1OCCH 4D7MA 2DDBA 1POGA 3ABKH 2AS5F 2KJBA 1G8XA 4OWRB 1U3EM 2BZTA 2L7FP 3TOBA 2AQEA 2M34A 3OYAA 3LL7A 4U87A 1X3WB 5D4RA 1V54H 2LK2A 3S16J 3LFKA 3KPHA 2R7DA 2XGCA 3ELKA 3HOXJ 2P5VA 1PUFA 3IKVA 3CCJI 3CCRI 1K78A 3HXLA 5CQGA 1J59A 2L3DA 1R23A 5HDKA 1ON2A 3E5XA 3PUBA 2FNPA 4XN0A 2BHYA 4R79A 1WSUA 1LDDA 1O3SA 2R92J 2CG4A 4A3KJ 1VQNI 5LRRA 1B6AA 3BCAA 3KP4A 1D1BA 3KCCA 3KP5A 3L2CA 3JRAA 2BVLA 4A3BJ 4I6ZA 3KLOA 4MEXF 3I4PA 1MZBA 2CQQA 4B1RA 3KP2A 5FD5A 1MBEA 2DJIA 2VONA 2K4JA 3KIOA 3K9TA 2J5OA 2JT1A 4BHBA 1XDSA 1GV5A 3CDLA 5FLMJ 1E17A 2VOOA 3A0HC 4A2UA 3OIOA 3KX2A 1S6LA 2GIZA 4A0ZA 4AU7A 1R71A 1U5TC 2DFIA 1KU9A 5LEJA 5CYVA 4BS9A 2JTVA 3V4GA 2P8TA 1YLFA 3CUQC 1W36D 1ZREA 1ETKA 3DTIA 4N0BA 4PSXA 4BE1A 4F93B 1XS9A 1WJEA 2K9QA 2R5YA 2OTJI 4D1QA 2W00A 2F5DA 3VOEA 2G7UA 5AIQA 3E6BA 4YIIA 4BAYA 3N97A 2XVCA 2NOJB 5J1RA 2M87A 3Q0WA 2VKDA 1T0FC 4J00A 2DA1A 3ZMDA 5K7FA 2HFHA 3TDUC 2LSOA 2CV0A 5IYBJ 3BCBA 1B72A 3FISA 2FUG2 2LRDA 4HSRA 2OQGA 2FXAA 2X1EA 3FM5A 2QA4I 1Z6TA 1D0ZA 2DQLA 4F91B 1LEAA 2LY1A 4M72A 1Z1DA 3V7CA 1IUYA 3M07A 3S2DJ 1FSHA 2EWNA 3D5LA 3FWEA 1HA8A 1MSFC 2ZJRF 3BR6A 4IHXA 2DO7A 2XRNA 4XLPF 3DKXA 1XG1A 1S7EA 2LR8A 3U1DA 4M3BA 1I39A 4G7OF 4KUMA 1Y0UA 2R7WA 3Q5FA 4XRSA 4DYCA 4EGYA 5CVUA 2NNYA 3CCQI 1IRZA 3ZMTA 2KRCA 4YRVA 4RM2A 1LFUP 3A4CA 3Q3SA 1DQUA 1WJFA 3HOZJ 2KQRA 2VQCA 3NWSA 1XGMA 2KISA 3OL4A 4LIUA 1Z9CA 1P4WA 1ACIA 5JI6A 1Z3XA 1QPIA 2O5RA 2K9MA 3HOWJ 4NUBA 1SMYF 4M9ZA 2ZMEA 4LLLA 2E1MB 2VIXA 4E4HA 1LQ1A 5F1JA 5HLHA 1Z21A 3OYBA 4CSWA 4D0PA 2X85A 5FKNA 3PUFA 1S7AA 5K5OA 3GTJJ 1HKTA 2K9LA 1NK2P 1RESA 1FEXA 3WTTC 1O57A 1B8IA 3JRBA 4HG2A 1WWXA 2G0EA 2BY3A 1GXPA 3BZCA 2ESNA 1HF0A 2L7MP 4PGHA 3W2VA 4FETA 3CZ6A 3V8JA 1I3AA 1BIBA 3EPZA 2BY2A 2P4WA 5L3DA 3E6DA 4EEFG 3G4SI 2FBKA 2ZXWH 3ABLH 3WGIA 2PN6A 1R9TJ 2K5CA 3WTYC 2W7NA 1CF7A 2LFBA 4I0AA 3RKWA 1W0TA 1N78A 1JTXA 2HTSA 3BC8A 5BMZA 2N8GA 2Z99A 5C3EJ 3RCOA 4OU0A 3HBLA 1FYLA 4WF2A 1ETVA 1K4TA 1BN5A 3JTHA 4EMSA 4I98B 4QIWN 2L5QA 4EATA 4CXFA 1ZQ3P 2OAZA 3CTAA 1ZRFA 2R93J 2H6CA 2JWTA 2EINH 2OZ6A 2CW0F 1QZYA 4AIHA 1VQKI 1ON1A 1X1PA 3QU6A 5DEQA 5ICEA 1ZG1A 2WC2A 5M5XJ 1VI0A 3EUHC 2XF6A 3JW4A 2EIKH 2AXLA 1Y6IA 2M8EA 3OOPA 4CICA 1VQPI 4DYQA 1FZPB 1ZLJA 4EQQA 4UUVA 2HWVA 1MNDA 3K70D 1I1GA 2K02A 5E8IA 3JRFA 4P55A 2QM3A 5IP6A 3GFLA 3RPUA 1N25A 5GADJ 3IAS2 4B09A 2Y9ZA 3EDPA 4C30A 3V8LA 1EV7A 1SFKA 3HL2A 3CC2I 3HG9A 2EZIA 3HSEA 2VJ4A 3K4CA 3GFIA 2HVRA 1NTCA 2JA7J 2LG4A 1STZA 4II3A 4HF0A 1MH4A 2HGCA 1E3PA 3J7ZI 4C3JJ 2PLYA 2VODA 1MBFA 1ZYRF 2FMLA 5K5RA 2FD5A 2JPCA 1KA8A 3KFWX 4G12A 2VQLA 4S0HB 5F1RA 1JI8A 2ISYA 4GDFA 1I3QJ 2WTEA 3E5UA 5E1ZB 2YX7A 2P81A 4E6KG 5IP9J 4E7IA 2XAQA 3FX3A 2FRHA 3S2HJ 5C44J 4A0YA 3HTUA 3NARA 4BQOA 1X1AA 2LREA 1L3LA 2L2OA 3M7GA 1MGTA 1EJ9A 1SMTA 1YQAA 4HDVA 3SQNA 3FIWA 2NVXJ 2LOOA 1UHSA 2E19A 2W57A 3S32A 3ONQA 3TL4X 2IAIA 4IOAF 2J5PA 2ZO4A 4IO9F 3KEQA 5EGOB 1GHCA 4BL0B 4CCNA 2PFBA 3A2KA 3HRTA 1D3YA 5B66C 1OLTA 3F8FA 5CVJA 2Z2SB 3H9JA 2IA1A 3OSGA 4DW6A 1MNEA 1F36A 2BGCA 3NWTA 1TP4A 2OTLI 3MQ0A 4XLAA 1R7JA 1V5GA 1NH3A 4HEA2 1TWGJ 1WHUA 1G3TA 4BXFA 3FZVA 1J75A 3J80K 1KU2A 3LAPA 3HGGA 1FBQA 1K7AA 2E5NA 5LHIA 4DNCA 4DJAA 2KRFA 3WTVC 5FLXK 2FA5A 3LSGA 3A01A 1X1CA 2GA2A 4BBRJ 4XORA 4A6DA 5ILUA 3BJ6A 2ELJA 1S9HA 1JHFA 2R7SA 4MNUA 1LJ9A 1ZAOA 5L3GA 4QWQA 2DN0A 2LD5A 2VXDA 3CESA 5LD2C 4ZJZA 2HKOA 1A04A 3CLQA 3ZQ7A 4XMYA 1HW2A 4CDGA 4RA2A 1YX3A 3DP7A 2IJLA 3WTXC 3O3KA 1YJWI 4IHWA 2Z16A 2FOKA 2MBFA 2LC2A 2CWEA 1QGPA 3WGGA 2FSWA 2BBYA 3QOEA 4LFUA 2WV0A 3G1MA 1S29A 1D0XA 3TO7A 3WG7H 1OQYA 2JA5J 5DD8A 3K70C 1FTTA 3L7WA 3F72A 1VF9A 5JHUA 4BEHA 3CC4I 3HRMA 5TRDA 3GFJA 4P96A 1S7OA 1XMXA 1I1SA 2PQ8A 3RKXA 4II2A 2PJRA 3OS1A 2OCCH 1SD4A 2PMZN 2PX9A 3SDBA 1BIAA 3HIFA 2JZYA 3I59B 3E6MA 1N75A 3TBIA 4E7HA 5HOOA 1LUJB 5D5VB 1GVDA 2M4GA 4CCOA 4MEYF 1VQ9I 2LBFA 5E3LA 3JR9A 1F9NA 3AG4H 2JN6A 4LK0F 3MKWB 3OWTA 3ZN0A 1KQ8A 5TISC 1S3JA 1G59A 4EM2A 1BM9A 4IF4A 3EYYA 1IG7A 4IRIA 2LMDA 1FMWA 4XBFA 1Z6RA 1YE9A 1G4DA 2QKLB 3BG7A 4HA8A 4CO8A 5DCMB 3F3XA 1BC7C 2NS0A 3GBGA 3VSKA 2M2EA 4JX5A 5H6QA 4O5VA 3BP8A 4Q5SF 3COAC 4U88A 1DP3A 4XLCA 5M5WJ 4RGRA 4GFBA 4PJ0C 3AL0B 3F0CA 3H0GJ 1HCRA 4RLQA 4I99C 1TQMA 3K4KA 4PJNA 4AIJA 1RI7A 4TV7A 5LHGA 3K2AA 3WG9A 4D5FA 2IBDA 3C3WA 3I54A 1CQTA 5EG0B 1J09A 4L9JA 4CYCB 2YPRA 3PNYA 4ZYHA 4ENNA 2R5ZB 3A1YA 2GXGA 4MLOA 5E20A 1BR2A 1SANA 2CQXA 3HJEA 5J1YA 3CLOA 1T39A 5HLGA 1T33A 2OJED 5FJ8J 1R00A 5L3BA 3CJTB 5HS7A 3BR3A 1LNWA 1U5TA 1MJAA 2EFWA 5DV5A 2R0QC 1DPRA 2M7BA 1TBXA 5AIPA 2OQRA 3ECHA 2KIMA 3DU5A 4R1HA 5BNGA 4L9NA 4BBSJ 2EFNA 4FTHA 4A12A 2EFPA 1YJ9I 1QZEA 4P1WA 4PGGA 2RREA 3PFIA 4AIDA 1J9IA 2X6YA 1XCBA 1B1BA 5K7ZA 3JTGA 1ZHFA 4KA4A 3VFZA 4B48A 1D8JA 2QKMB 3SJMA 2R4GA 4KISA 2A3SA 2A07F 1B9MA 2PJPA 3BG3A 4Y33A 1SAUA 4Y52J 2F5FA 3W2AA 5DD4A 3VB2A 3C2GA 2V4JC 2IXSA 3I4NJ 4UB8C 1P7JA 2XPVA 1TT0A 1UELB 5J1UA 1J0RA 5DDGA 2A5YB 5FRMA 5DS9A 3ZQFA 4A3FJ 1Y1VJ 2RC4A 4V19K 2CO5A 4GGGA 4BU2A 1K79A 1ZR2A 2HXIA 4MQVA 3TQNA 3P9CA 2OUMA 1NHAA 3NEUA 3NRVA 4HYEA 3MN2A 1ZGWA 1LB2A 3CCMI 1XGSA 2V26A 2XPUA 4NQWB 3ZGKA 1TTYA 3VYSB 2QBYB 5FKMA 1YHQI 4ENJA 2QYOA 1P4AA 2IRFG 3RYPA 5CVVA 1OCOH 3H5NA 1T98A 4FASD 1XTAA 4NC6A 4S05A 1ETYA 1YW8A 1RPWA 2Y0MA 5EEGA 1R4NB 2Q2EB 1XGOA 4KIGA 4XLEA 3J7AO 4HF1A 3ABUA 3OMYA 1X2NA 5CLSA 4CUGA 4UY8I 1YS6A 2L9SA 3G2BA 1ENHA 1OFCX 2E7WA 5BQTA 1LE8B 1DU6A 1Q1VA 2P7CB 4KN4X 4RS8A 1Y0NA 4HZFA 3LFUA 4Q4ZF 3KP7A 3L2RA 3F6VA 4LLGF 3T5XA 1WKMA 4BQNA 4E7JA 1HKSA 4XR6A 2DQRA 1MMGA 1USTA 2NOGA 2V9KA 1YITI 2KJCA 1A35A 1R1UA 3LSHA 2QZ8A 1UCRA 2DOAA 2O8KA 1XSXA 2UUZA 1R49A 3BLYA 4FISA 2GOMA 1JGGA 2H8WA 1T6SA 4B44A 3G73A 1ODDA 1XMKA 4A5MA 3ZRGA 2E2JJ 1KONA 1FY7A 3L9FA 3LQRA 4ZYAA 3H1CA 5IPAA 4EM1A 3FHNA 3SDGA 1ZG3A 3U2RA 3DBHB 3F8NA 3S1RJ 5CPRB 3G1OA 3MEXA 3E5QA 3D1NI 4CYDA 5K1YA 2IS4A 2JJ7A 2DU9A 2DOEA 4H0EA 5IOYA
chains in the Genus database with same CATH topology
3BCBA 2FUG2 2LRDA 2XF5A 2X1EA 2CUZA 4HSRA 4BJTA 5HLTA 2HNHA 1D0ZA 4ITVA 4AVZA 2R7RA 4F91B 3K10A 2LY1A 4JOMA 1DGRM 2KZVA 1MMAA 2L7KA 2HPMA 3D5LA 2KP6A 2E5ZA 1HA8A 4LIVA 3VWBA 2IGOA 4IZZA 5HNHA 1LDKB 3QODA 3DKXA 3OR1C 4BE0A 3ZQQA 3DWLE 2XF7A 2R7WA 2MC4A 2R7QA 2CV1A 2KRCA 3OYGA 4BDZA 4YRVA 4RM2A 2HQAA 3A4CA 2L9NA 1DQUA 1WJFA 2KQRA 2VQCA 1Y56A 1V5FA 3NWSA 3OL4A 1P9QC 4LIUA 2Z1DA 1Z3XA 4N4OB 4C9YA 3OS0A 2O5RA 2K9MA 4NC8A 4NUBA 2W1OA 1NG7A 1E0EA 3HOSA 1BR4A 3N05A 2E1MB 2VIXA 3K6GA 3PNTA 4E4HA 4HNUA 3OYJA 4E7LA 3E1SA 1Z21A 3OYBA 3TMOA 4CSWA 3VYRB 2X85A 2K9LA 4JQFA 3K4NA 5TGTA 3QYEA 3OY9A 4HG2A 4XKBA 4DIQA 2VL8A 4J01A 1BR1A 4BACA 2VXZA 4XKVA 3W2VA 4FETA 2JVGA 1ERDA 3OIPA 4OAYA 3CZ6A 1QHGA 4XKCA 3EPZA 3QYFA 3DQVC 2ZSHB 2K5CA 2WY8Q 1YX5A 1D1AA 3LMMA 2W7NA 1UG0A 3EUKL 4ZDOA 1N78A 3OIQA 3MKYB 2WAFA 3BC8A 1MMDA 2DT7B 4RM3A 3RCOA 2JUGA 3CJRB 3HC7A 2XC7A 3KEYA 2GOXB 3H5RA 3SZGA 1BOBA 1PYVA 2V6EA 4IQJA 3DTKA 5CKTA 3BG6A 2KDOA 2L5QA 4EATA 4IQ4A 4PK4A 4PJMA 2CH0A 3DPUA 4XOPA 2IS6A 4D9JA 4B3XA 1X19A 2IS1A 3S3MA 4OAZA 4NNJA 3IUOA 4YEJA 3U21A 1DGWY 5FRNA 3EUHC 2XF6A 4BGDA 2LY2A 3OL3A 1Y6IA 3OYLA 2KRHA 3OYNA 3OYIA 3F9KA 3CMMA 4ZDLA 5CQEA 2M4KA 4ZDPA 3J7AY 2MABA 4YELA 3FBIB 4PJLA 2OC6A 1MNDA 3K70D 3OYFA 4BDYA 4U7BA 2RQQA 1WFXA 2M0MA 2Q1ZB 4CZCA 3IP4B 3IAS2 5HVQC 1V5EA 4C30A 2MYSA 1QHHD 1SFKA 3HL2A 4IX7A 3HG9A 2X6WA 2VJ4A 2W4SA 3K4CA 3L2VA 2HVRA 3CP2A 2LG4A 3K4MA 3OOUA 4II3A 2KPMA 3RPUD 1GLNA 4E7KA 4CCMA 3S8PA 3M8JA 1JI8A 1WJAA 2VQLA 2ZFUA 1QU3A 1WJDA 2R7VA 4E6KG 4E7IA 1K6YA 3VDXA 4BQOA 1X1AA 2LREA 2WAEA 3H35A 2L2OA 5JHFA 3IAM2 2R7XA 4DOZA 1VZ0A 2LOOA 3S32A 3ONQA 2HZDA 3TL4X 1N77A 4HRIA 4BL0B 4CCNA 3A2KA 3L2QA 1LVKA 1OLTA 2Z2SB 3H9JA 3LSKA 3AFHA 3QYBA 1MNEA 2IS2A 3S3NA 3NWTA 2VASA 2CUJA 4ZC3A 1Z7LA 4XLAA 1V5GA 3FKJA 2XSJC 4HEA2 1EA3A 4BXFA 3SYTA 4F52A 4KJZA 3OYDA 2V7FA 4CCLA 2WBMA 4XONA 4XN3A 2E5NA 3S3OA 4F92B 4F55A 4H4KC 4DJAA 3LSGA 2F5VA 4AYBA 1X1CA 3E0JB 3LSMA 4XORA 2ELJA 1S9HA 2R7SA 2MD0A 4RMNA 2VXDA 3CESA 1IRXA 3FDYA 5LD2C 4ZJZA 4XMYA 1YX3A 3DU6A 2A5WA 2Z16A 3W2WA 1W36C 3HKZA 2LC2A 2DXIA 3D5SC 2KL4A 2X1DA 3OYMA 2RNGA 3QOEA 4G6TB 4DBRA 3ZCOA 4LITA 1D0XA 2IGKA 3K70C 3K4JA 4XOTA 1NG6A 4BEHA 2IGMA 4QPOA 5KNLA 2WAQA 2R7OA 2LYCA 4XNFA 4II2A 2PJRA 3OS1A 4NC7A 3K4BA 4F3QA 1R6RA 3SDBA 3PFYA 3LSIA 1N75A 3TBIA 4XQFA 5HOOA 4PFOA 3UNGC 4BE2A 4E7HA 3RQ4A 2VQHA 2M4GA 4CCOA 3PJRA 2LBFA 2E60A 4GRIA 1X1DA 4BEHB 2CS3A 3MKWB 3OWTA 2CFOA 2BVMA 2LH9A 1G59A 2HDWA 1MW7A 2PJRB 1FMWA 3I3LA 4CCKA 1YE9A 2QKLB 3BG7A 3V42A 4B43A 3GBGA 1X1BA 3VSKA 5HNFA 2VJIA 3K4LA 3OYEA 2LBFB 1DP3A 4XLCA 1WJBA 3EUAA 2E1MC 3AL0B 2UWMA 1U0JA 2BOLA 3SEQA 4Y4RA 2X1CA 5LFAA 4RLQA 4XKWA 4HNTA 3K4KA 4BUPA 4PJNA 4CH7A 2A6TA 1UAAA 3AKZA 3RSNA 4HPQA 2VPLA 4XM3A 3CJQB 1ZELA 2CW7A 3MMYB 4N4NB 4DGWB 2DCEA 3H5AA 3PNVA 1J09A 2JSPA 3ZR8X 3SEZA 1Z3YA 3PNYA 2ZXIA 1D0YA 2ZSIB 3A1YA 4PFPA 4MLOA 2HPIA 1BR2A 2F4IA 3I9V2 3PL8A 2CMPA 2K3PA 1AA7A 4XL9A 2BW3A 4XLFA 3HUGB 1T95A 3DPTA 2VB6A 4DBQA 1X4PA 2M7BA 3DU5A 4PJJA 4BJ6C 3FBNB 1WJCA 2WADA 3OYKA 4P5OA 3OS2A 2IGNA 2Y0SA 3L2WA 5KCMA 4P1WA 3ZXSA 3MD2A 1X4OA 2RREA 3DKYA 2X6YA 4BJ5C 2I8DA 2R7UA 4B48A 2AQFA 3OYCA 2XDVA 2QKMB 3MKZA 2BW3B 2R4GA 4KISA 3PSFA 3H9GA 4Y33A 4ANJA 1SAUA 1MMNA 4QPQA 3OYHA 3W2AA 3KYLA 3C2GA 2P0WA 2V4JC 3OR2C 2IXSA 1WJ5A 2WY7Q 4X0GA 3DPLC 3H9QA 1TT0A 1UELB 2V1NA 3VYUB 3H0DA 5FRMA 2R7TA 4CCJA 4CA0A 4BQQA 4E7ZA 4XLHA 4BU2A 2KLOA 3DEEA 2KHMA 2OUMA 2JVHA 1G8XA 4OWRB 5KHDA 4NQWB 2V26A 2VQGA 3UR3C 3ZGKA 2VLAA 2AQEA 3OYAA 3VYSB 3LL7A 2OV7A 3AL0C 1FMVA 3HOTA 4U87A 3C2HA 4IKFA 2DT6A 2X51A 1LKXA 3HPHA 4Y3OA 4PSWA 2VKHA 3H5NA 2HU9A 4FASD 2CV2A 2JA2A 2W82A 3HXLA 4XLEA 2Q2EB 2VJ5A 5CQGA 2HVQA 3OMYA 4CUGA 2HVSA 2L9SA 3CF2A 3G2BA 3PUBA 1D1CA 4XN0A 4R79A 3DLAA 3HPGA 3PSIA 3BCAA 2M3AA 3VYTB 3LFUA 2CW8A 2KMUA 3L2RA 4C2UA 3RTRA 1D1BA 2BVLA 2UV1A 4BQNA 4HSTA 4E7JA 4XR6A 4RLFA 1MMGA 3VSLA 4KITB 2V9KA 2WB1A 2DJIA 1PJRA 3M1CA 3LSHA 1OR7C 2MFZA 2DOAA 4C2TA 3D5RC 2WA0A 3KX2A 2UUZA 4KT6A 4AU7A 3L2UA 3BLYA 2GOMA 2X6XA 4B44A 2PMZA 4BS9A 4ZTJA 5FROA 3DTEA 3ZRGA 4ZTFA 2VJJA 1W36D 1KONA 3DTIA 4PSXA 4BE1A 2M7AA 4F93B 4ZYAA 1WJEA 2F6CA 3W3CA 4B47A 4D1QA 2W00A 3FHNA 4E7SA 2XAUA 4LG3A 3CP8A 2ZXHA 2NOJB 5CPRB 2VKDA 1T0FC 4J00A 2IS4A 1TZLA 4PUSA 2CV0A 1LFPA 3S93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL3 A;  3OL4 A; 
#chains in the Genus database with same CATH topology
 2L9V A;  4BJT A;  3K69 A;  3BWG A;  5HS8 A;  1VQ5 I;  1FSE A;  5HLT A;  3MZY A;  4E70 A;  2HNH A;  3FXQ A;  4ITV A;  3WTZ A;  4AVZ A;  2R7R A;  2W85 A;  3K10 A;  3I55 I;  2KZV A;  3EUH A;  1E3O C;  2KP6 A;  1SVM A;  5GPA A;  2E2H J;  3DEU A;  4LIV A;  2IGO A;  1HW1 A;  3V7S A;  4A69 C;  2STT A;  3NAU A;  1A6Q A;  2F4O B;  2DW4 A;  4JX6 A;  2XRO A;  1RNL A;  2M30 A;  1OCP A;  3GWZ A;  1I50 J;  2HKX A;  3IC7 A;  1VQ8 I;  1FPQ A;  4C2M J;  4BDZ A;  2O0Y A;  3F21 A;  1HDD C;  2L9N A;  4LG0 B;  1VQ6 I;  1Y56 A;  2YUS A;  3DKW A;  2Z1D A;  4NDL A;  5E1X A;  1TNS A;  1YI2 I;  3CUO A;  3SHF A;  1NG7 A;  1LFB A;  2M9H A;  2YSR A;  3HOS A;  1E0E A;  1BR4 A;  3LST A;  3K6G A;  2A61 A;  4HLX A;  2JA6 J;  1HC8 A;  5FKO A;  2P6S A;  4JYK A;  5D8K B;  2HYG D;  4L5E A;  5FGM A;  4KNY A;  3PO2 J;  5C4J J;  4U0V A;  3TP3 A;  4DIQ A;  2HDC A;  1IN6 A;  4UB6 C;  1SAX A;  1OYY A;  5ICF A;  3JRH A;  2VXZ A;  1G3S A;  4XKV A;  1TLH B;  1GXQ A;  3B73 A;  3BR5 A;  4LJZ F;  2ZNZ A;  2VE9 A;  3WTU C;  1B9N A;  1OPC A;  1TWF J;  4R8H A;  1OIS A;  3RJP A;  5GP9 A;  2ZSH B;  2WY8 Q;  1YX5 A;  1D1A A;  1I27 A;  1H88 C;  4XSZ F;  1UG0 A;  3EUK L;  3TDZ C;  4ZDO A;  4A3G J;  1JJ8 C;  3C7J A;  3MKY B;  2WAF A;  2DT7 B;  4IEJ A;  1AKH B;  3I71 A;  3CJR B;  5LRS A;  1QPM A;  3IRQ A;  1R5H A;  2XC7 A;  4L9V A;  2O03 A;  2GOX B;  2DOF A;  3SZG A;  3DTK A;  4ZZD A;  4A3E J;  2EIL H;  4I01 A;  2ESH A;  1A36 A;  3BR0 A;  2B63 J;  1UJ8 A;  4IQ4 A;  1XC5 A;  3QPL A;  3TO6 A;  4B4C A;  4IHY A;  4PK4 A;  1ZGJ A;  1BI0 A;  2K9N A;  1MD0 A;  2DFF A;  3MVP A;  2E7X A;  2MSY A;  1XSV A;  2CQ7 A;  3U21 A;  3HGY A;  4ZZL A;  3IRR A;  2XB5 A;  2KDZ A;  3KYD B;  1OCT C;  3ISP A;  2ECB A;  5IP7 J;  2GBY A;  3JAM K;  4IVN A;  2LP0 A;  2EJR A;  2PMH A;  4YFK F;  4HOB A;  4RDU A;  1UHW A;  3OYL A;  3OYN A;  5EJC A;  3F9K A;  1YO5 C;  5DYM A;  2B7E A;  4HX8 A;  3LA7 A;  1IV6 A;  4YFN F;  4RB2 C;  4ESB A;  1YW9 A;  4BDY A;  1BJZ A;  4U7B A;  5BPI A;  2B0L A;  5J8F A;  3VOD A;  3P7N A;  4CZC A;  2Y0S N;  3IP4 B;  1T08 B;  4UUS B;  1X3Z B;  1V5E A;  2I5U A;  3M3Y J;  3L2V A;  1UHM A;  2DA4 A;  1C0W A;  4AD9 A;  1EH7 A;  3CP2 A;  2XGX A;  3GTK J;  1H0M A;  3LA2 A;  4E7K A;  1MBJ A;  2ME6 A;  5M3M J;  3LSR A;  3S8P A;  2NAZ A;  4BY7 J;  2ZFU A;  1QU3 A;  1WJD A;  1K6Y A;  3VDX A;  4HQE A;  3JRE A;  2YX4 A;  1FP1 D;  2WAE A;  1HBX G;  4N9H A;  1WCM J;  2JPB A;  2JK3 A;  2E1N A;  2V79 A;  5TJJ A;  4AVP A;  1VZ0 A;  3WE3 A;  4M3E A;  3I0T A;  4RBO A;  1SC7 A;  3GLX A;  1G3W A;  2GA1 A;  1YOV B;  5FFZ A;  4HLY A;  2DFE A;  3TOA A;  1F4K A;  3ABM H;  4Y13 A;  1HXD A;  3R4K A;  3PIO F;  1DPU A;  3HSR A;  1J7K A;  3LSK A;  3AFH A;  4G6D A;  3EYI A;  2IS2 A;  3S3N A;  3SZT A;  1KU7 A;  1DU0 A;  5GTI C;  3HYI A;  2VE8 A;  2WAQ N;  2EH3 A;  2M5W A;  3IH2 A;  3SYT A;  4F52 A;  3OYD A;  1P92 A;  1SD7 A;  4L5J A;  1H9G A;  4CCL A;  2WBM A;  2KIU A;  4HX4 A;  4XN3 A;  3S3O A;  3KZZ A;  3REO A;  4YIR X;  5HOD A;  2F5V A;  3DFG A;  2QSF X;  3E0J B;  3LSM A;  3H92 A;  3GW2 A;  2C6Y A;  4I0B A;  5EZG A;  4G8X A;  1VQM I;  5LBQ A;  4HF2 A;  3FXL A;  1ZAR A;  2JQ7 A;  2A5W A;  4FCY A;  1IJW C;  1IF1 A;  3VPR A;  1W36 C;  1WH5 A;  2AHQ A;  3QPT A;  4RB0 A;  5E17 F;  5D4S A;  4MTE A;  4OOI A;  4DBR A;  3ZCO A;  1YTY A;  4M9X A;  2RAE A;  1BI2 A;  2V1X A;  4RGX A;  1NG6 A;  1SD6 A;  2IGM A;  4QPO A;  4YG2 F;  4RAF A;  3RYR A;  2WAQ A;  1SEU A;  2X9D A;  3HZJ A;  2GM4 A;  3ZQH A;  1JE8 A;  4LMY A;  2XPW A;  2O61 A;  5M3F J;  4I2O A;  2DA6 A;  1REP C;  2Y69 H;  4M6V A;  5F0C A;  3GF2 A;  5JR3 A;  4A3I J;  2V9P A;  4XQF A;  3GTO J;  2BEO A;  2VQH A;  3KP6 A;  4HNV A;  2F5C A;  2E60 A;  3H3U A;  4Q48 A;  4GRI A;  3M8F A;  2VBW A;  1X1D A;  2G9W A;  3FXO A;  1X3U A;  2FU4 A;  2LH9 A;  5IT9 K;  2VBY A;  2HDW A;  2EQR A;  5A2Q Z;  3V7R A;  1BOA A;  3ZQI A;  2FQ3 A;  1RIO H;  2EV6 A;  2CU7 A;  3D0S A;  3ZQG A;  5HDN A;  2VC1 A;  1ZH5 A;  4MTD A;  4G7H F;  4LLN A;  2TRT A;  5HNF A;  1U9N A;  1P7I A;  4G9Y A;  4B8X A;  2B9S A;  1PP7 U;  3FXK A;  2ZCW A;  1WQ2 A;  4EJO A;  5GAE J;  2ICW G;  3ESW B;  1DDN A;  4A3J J;  3EUA A;  4L9T A;  3W6K B;  1O3T A;  1MJ9 A;  1U0J A;  3SFI A;  5BPD A;  2X1C A;  1VQO I;  4XKW A;  4HNT A;  2O9L A;  4G7Z F;  2M1B A;  2CGP A;  5E3O A;  2M45 A;  3HUG A;  2A6T A;  1UAA A;  3GCM A;  2LKP A;  4HPQ A;  2VPL A;  3CCY A;  1ZEL A;  2CW7 A;  2HI3 A;  1ZLK A;  4DGW B;  3H5A A;  2JSP A;  1ETO A;  2OPT A;  4RAZ A;  3SEZ A;  1HDP A;  2ZXI A;  1D0Y A;  2CJJ A;  2W25 A;  3I5U A;  1HSJ A;  2K27 A;  2E34 A;  2HPI A;  2F4I A;  1O7L A;  1IAW A;  3E7L A;  2X0L A;  3I9V 2;  3PL8 A;  4MO7 A;  3FXM A;  2XAG A;  1OYW A;  4XLF A;  1ZR4 A;  3K2Z A;  2XKP A;  3AG1 H;  3DPT A;  4DBQ A;  4ESJ A;  3J81 K;  1MDM B;  1IN7 A;  4W1U A;  4PJJ A;  1O3Q A;  4BJ6 C;  4M6X A;  2WAD A;  5EEA A;  3LA3 A;  3AAF A;  4G94 A;  3ZXS A;  4ZYG A;  1HOM A;  1GT0 C;  5JFR A;  3DKY A;  3ZQC A;  2EK5 A;  2I8D A;  1NK3 P;  2L02 A;  2AQF A;  1BBY A;  2BW3 B;  5IY5 H;  3H9G A;  4KMF A;  4ANJ A;  2D1V A;  3KYL A;  3JCU C;  3A0B C;  2QQ9 A;  2WY7 Q;  3TED A;  2DMU A;  1FOY A;  3DPL C;  3CCL I;  2I10 A;  3HM5 A;  3VYU B;  3H0D A;  1Q1H A;  1B4A A;  3PQK A;  4NB5 A;  3RZO J;  5D6F A;  1FNN A;  2V1D A;  4BQQ A;  2HQR A;  3K0L A;  1TQI A;  4D7N A;  3MAJ A;  5ED4 A;  3K1P A;  2EFO A;  3JRD A;  2QSG X;  2KHM A;  3T8R A;  4UUT A;  2HS5 A;  5E3M A;  1MMS A;  2XAJ A;  2JVH A;  5KHD A;  2VLA A;  3UR3 C;  4ZYE A;  1IZ1 A;  3AL0 C;  1EF4 A;  3HOT A;  2DT6 A;  1AKH A;  1IN5 A;  1LKX A;  4Q47 A;  4PSW A;  1IV8 A;  1R1V A;  5F08 A;  2VKH A;  2HU9 A;  2CV2 A;  2L7Z A;  3ZPL A;  1G6N A;  3P9I A;  1LVA A;  5JLW A;  5IT3 A;  1P6R A;  4OMZ A;  1W5S A;  3WU1 B;  3FK7 A;  5D5W B;  2EZL A;  2WV1 A;  3CF2 A;  2CQN A;  4FE4 A;  3LNQ A;  4CGZ A;  3IV5 A;  1D1C A;  2FJ1 A;  1S8N A;  2D2W A;  1QVU A;  3DLA A;  3HPG A;  4A93 J;  1VND A;  2HEO A;  1JXS A;  1PUE E;  4KMU X;  1WH7 A;  2L54 A;  2NRA C;  2NVT J;  1MSE C;  1PUF B;  5ILS A;  1DUX C;  4C2U A;  1JUP A;  1R5G A;  5DM6 F;  4A3M J;  2O8X A;  2UV1 A;  2QQB A;  4A0X A;  4HST A;  4BHC A;  1K78 B;  1O7F A;  1VQ7 I;  2CSO A;  3ZMV A;  2XAH A;  1FLI A;  2E35 A;  1XX5 A;  1PJR A;  1X58 A;  3BY6 A;  3IH4 A;  4C2T A;  1QO0 D;  3QPS A;  2RNJ A;  2FF4 A;  3I56 I;  1Y8Q B;  4OIP F;  4BY1 J;  5H6R A;  3L2U A;  4Y17 A;  3MZH A;  1BI3 A;  3DEW A;  4UUS A;  4MFE A;  2PMZ A;  2F48 A;  1TNT A;  1IXR C;  3ERE D;  2ZNY A;  5FRO A;  5DUI A;  3GYH X;  1BW5 A;  2W48 A;  2VJJ A;  4ENM A;  3S2W A;  3QPH A;  2M7A A;  4BYY A;  2QCO A;  3G3Z A;  2NYX A;  4E7S A;  2XAU A;  1ZGA A;  3DBR B;  3CP8 A;  2X48 A;  2ZXH A;  2DYS H;  1BJA A;  2ZXJ A;  3CCU I;  3DBL B;  3GFM A;  5ERI A;  1YG2 A;  2YU9 J;  2O3F A;  1TZL A;  4FHT A;  2IA0 A;  1LFP A;  3S93 A;  4KFC A;  2QVO A;  3IKT A;  2VPR A;  3PIP F;  3S1M J;  4LD5 A;  5LLQ A;  1ULY A;  5KAI C;  2ETH A;  1K6O A;  1T56 A;  1DGR M;  1BC8 C;  3OSF A;  2R5Y B;  2KIF A;  1WZ2 A;  1MMA A;  2HPM A;  1GDT A;  1WI3 A;  2E5Z A;  1W7P D;  2XHK A;  4HV6 A;  5F6F A;  3QAH A;  4LGW A;  2Z33 A;  3HOY J;  1OKR A;  4JP0 A;  1XSD A;  2IPQ X;  3VWB A;  1J2X A;  3FHZ A;  4IZZ A;  1LDK B;  3QOD A;  2OZU A;  4AYB N;  3CDI A;  4I02 A;  1B72 B;  1MKM A;  2GAU A;  4BE0 A;  4GO1 A;  2MC4 A;  4GYI A;  2LKX A;  4LB6 B;  2R7Q A;  4DQ2 A;  2CV1 A;  1WPK A;  3CMY A;  5EDN A;  3W6V A;  3BPV A;  5LGU A;  3HKZ N;  2OD5 A;  1V5F A;  1P9Q C;  1FT9 A;  3GME A;  4C9Y A;  3WTW C;  2AO9 A;  4NC8 A;  2W1O A;  1KYZ A;  2JUC A;  2HOT A;  3PNT A;  1P4X A;  3E3V A;  3E1S A;  2LLK A;  1HST A;  3VYR B;  5FKK A;  2Y30 A;  3JRI A;  3GTQ J;  2DMN A;  2RV8 A;  4V2G A;  1OCZ H;  2A6E F;  1S5L C;  3M1E A;  4XKB A;  1PP8 F;  3WOD F;  2VL8 A;  2ADU A;  3KYC B;  2ZME B;  2JVG A;  3OIP A;  4OAY A;  1V3F A;  1Y39 A;  1SFX A;  4LOC A;  3GZ5 A;  3T0Y A;  4J19 A;  1RR8 C;  3P9K A;  3LMM A;  1X2M A;  4RAY A;  5CJ9 A;  2CYY A;  3OIQ A;  4Y7N J;  1MMD A;  1Y8R B;  5FO5 A;  5DCF A;  1B8I B;  4KIC A;  3GZ6 A;  2VT2 A;  3J7Y J;  3HC7 A;  4GYG A;  3F23 A;  3EQL F;  2OCE A;  3KEY A;  1BA5 A;  1TT5 B;  1UMQ A;  3H5R A;  5EZH A;  2V6E A;  4IQJ A;  4WWC A;  5CKT A;  3BG6 A;  1TQP A;  3OV8 A;  5D6E A;  1XGN A;  5L3C A;  1CF7 B;  1U9O A;  4AM3 A;  2CH0 A;  3DPU A;  4EJW A;  3N4M A;  1AHD P;  4W97 A;  1FC3 A;  2IS6 A;  4B3X A;  3S3M A;  1JKR C;  4NNJ A;  3HEF A;  2CRG A;  1Y1W J;  1YIJ I;  1Z91 A;  1ONV A;  1FBU A;  2LY2 A;  2YR2 A;  2HXO A;  2NXN B;  1J5Y A;  3OL3 A;  1AWC A;  2VI6 A;  3CMM A;  2QF7 A;  3RKY A;  4O6J A;  4ZDP A;  3J7A Y;  2HZT A;  3WHB A;  4YEL A;  3FBI B;  3GX4 X;  3ZP5 A;  4CHU A;  2BXZ A;  2Q1Z B;  2FX0 A;  2R3S A;  3BOQ A;  2A6H F;  2QEN A;  5HVQ C;  1UB9 A;  1KGS A;  4OIR F;  1EH6 A;  2DK5 A;  1LPQ A;  1QHH D;  1Z77 A;  3Q9S A;  4IX7 A;  2XUB A;  2W4S A;  4PDK A;  3PM1 A;  1EKE A;  9ANT A;  5E79 C;  3K4M A;  5FKL A;  3OOU A;  2DI3 A;  4NBQ A;  2M0C A;  1GLN A;  3G1L A;  2Z3Y A;  4U0W A;  3QOP A;  4GCV A;  5EGO A;  3R60 A;  5E18 F;  2HYF A;  3C2B A;  2GXA A;  1Z05 A;  5J40 A;  1WJA A;  2MH2 A;  2Z9O A;  2ZB9 A;  2D45 A;  1SFU A;  3QWL A;  1W7P B;  2D5V A;  3GTG J;  1IRG A;  3LWF A;  4UXN A;  1OJL A;  3RKQ A;  2L01 A;  4WXH A;  1KZH A;  3BR2 A;  2D1H A;  3BTC A;  4AWX B;  4O3M A;  2HZD A;  3KZY A;  4D5C A;  1OCR H;  2H6B A;  4BKX A;  3L2Q A;  1JT6 A;  1LVK A;  3PO3 J;  1JTY A;  3KLN A;  5JVG F;  3GTL J;  1TWC J;  2MGQ A;  1FBS A;  5BOX A;  4EVI A;  2Y9Y A;  3Q0V A;  4JBA A;  5F04 A;  1RR7 A;  3FKJ A;  1HQC A;  2XSJ C;  4X1E A;  1EA3 A;  4KJZ A;  4UVB A;  4M3D A;  2JA8 J;  2EFQ A;  1HKQ A;  3FMQ A;  2O6G E;  4WK8 F;  1I6X A;  4H4K C;  2EBI A;  1UZC A;  2HR3 A;  4I09 A;  1FJL A;  2G7H A;  2KFD A;  4U0Y A;  2MD0 A;  3FK6 A;  3M9A A;  1IRX A;  2Q0O A;  5FFX A;  3K1M A;  3F8C A;  2W24 A;  1OYI A;  3DU6 A;  3J80 Z;  3BPX A;  3I53 A;  3L09 A;  3R0J A;  3I59 A;  4S04 A;  1G3Y A;  2DXI A;  5FLX Z;  2X1D A;  3A01 B;  4G6T B;  4M3F A;  3A02 A;  3ROU A;  3TKY A;  2E71 A;  1RKT A;  4AC0 A;  2H94 A;  3BZK A;  4IL6 C;  2BE5 F;  2COB A;  4ETS A;  2R7O A;  1S72 I;  2EPF A;  2STW A;  3JRG A;  1R6R A;  1ETQ A;  3PFY A;  5DCM A;  3LSI A;  4N9I A;  1W4M A;  4BE2 A;  4PFO A;  1P2F A;  1PVE A;  3F8B A;  3FXR A;  3RQ4 A;  2DTZ A;  4G6Q A;  3PJR A;  5FD6 A;  2QUF A;  3IWZ A;  1K83 J;  4I7H A;  2DAO A;  4Y15 A;  5LEK A;  2RN7 A;  3S15 J;  1U8B A;  1Z7U A;  4BEH B;  2IA2 A;  2CFO A;  3ML6 A;  3ZMU A;  1QZZ A;  3FF5 A;  3GZN B;  3SXY A;  1SVO A;  2PJR B;  3I3L A;  3F6O A;  3CF5 F;  1IN4 A;  2V1U A;  2QEX I;  4CCK A;  2PEX A;  2K86 A;  2CQK A;  5B3S H;  2L4M A;  4B43 A;  3S1Q J;  1KQ9 A;  1X1B A;  3S14 J;  1KU3 A;  4A5N A;  2ID6 A;  3OYE A;  1RZ4 A;  5EG0 A;  1YS7 A;  4MFD A;  3BJA A;  2LBF B;  4CYC A;  3BJO A;  2R5Z A;  3AG2 H;  1U2W A;  2K85 A;  1LDJ A;  2ME0 A;  2E1M C;  3K7A J;  4OIO F;  1ZG5 A;  1HLV A;  5EYR A;  3SEQ A;  1MBG A;  4BUP A;  4CH7 A;  4RB3 C;  4BQA A;  3RSN A;  4XM3 A;  1ZRD A;  3B02 A;  3I64 A;  1TW3 A;  2DCE A;  2BY0 A;  1BW6 A;  5J8C A;  3ZR8 X;  3K1N A;  2F4M B;  4PFP A;  2E2I J;  4KYW A;  1TWA J;  2BHZ A;  4EGZ A;  2ELK A;  5IOZ A;  4Z6Y A;  3CCV I;  2LNB A;  2KT0 A;  2K3P A;  1AA7 A;  2Y31 A;  1V4R A;  3QRF F;  1T95 A;  2LKS A;  2EV5 A;  3NQO A;  2WWY A;  3ASO H;  1W5C C;  4X6A J;  4IPA A;  4JK1 X;  1YIO A;  2DA2 A;  3BTJ A;  1FYK A;  3CME I;  1WJC A;  4KN7 X;  4IHS A;  2GQQ A;  3OS2 A;  2FE3 A;  4MHG A;  2IGN A;  2Y0S A;  2GWR A;  4ASN A;  3L2W A;  5KCM A;  3MD2 A;  2DBB A;  3M4O J;  4BJ5 C;  2VKV A;  4YFX F;  3U1K A;  2VBZ A;  2ZC2 A;  3OYC A;  2DTR A;  1U5T B;  2X6O A;  3HRS A;  4L0Y B;  3CDH A;  4B3A A;  3CJN A;  1MMN A;  3HOV J;  3CUQ B;  4YIF A;  3F8M A;  4NQW A;  2P0W A;  2CUE A;  3OR2 C;  5IYD J;  4I76 A;  2QBY A;  3BG5 A;  5GAG J;  4X0G A;  2ZJ2 A;  1D5V A;  2LY9 A;  5F27 A;  1T2K A;  2R7T A;  4FX4 A;  2RDP A;  4CCJ A;  4UVC A;  3HRU A;  3CO6 C;  3RIR A;  5L3E A;  2KLO A;  2DPD A;  3DEE A;  5EF6 A;  2HQ5 A;  1O3R A;  5CVI A;  5J4Y A;  1E2X A;  2Q2E A;  3O8H A;  1FX7 A;  3C18 A;  1WVR A;  2VQG A;  4UVA A;  1R4M B;  2A68 F;  2XAF A;  2OV7 A;  2L0K A;  4HW0 A;  1FMV A;  1YW7 A;  2WB1 N;  3C2H A;  4IKF A;  2MA3 A;  2EB7 A;  2HQN A;  1I5Z A;  1R5I D;  2X51 A;  3H36 A;  4RGS A;  1LE8 A;  3BQZ A;  3HPH A;  4Y3O A;  3BTL A;  1E3H A;  5KAF C;  2NS8 A;  2VOP A;  1RC9 A;  1SFE A;  1W0U A;  1JHH A;  2VBX A;  2JA2 A;  3WGH A;  4QSH A;  1MH3 A;  2W82 A;  1SVL A;  2ZBK A;  2XGD A;  2VJ5 A;  5ICC A;  5J47 A;  2HVQ A;  3CC7 I;  1FOK A;  4MQ9 F;  1T8I A;  2LF8 A;  2HVS A;  3BR1 A;  2DT5 A;  1R36 A;  2FEZ A;  3PSI A;  1T38 A;  3VYT B;  2M3A A;  2L4A A;  4IJA A;  4UV8 A;  2EIM H;  3KET A;  3CD6 I;  2CW8 A;  2KMU A;  4M3G A;  3RTR A;  5M5Y J;  4FQG A;  2UXX A;  5FB2 A;  4M6Y A;  5AON A;  3QP5 A;  3KP3 A;  1R1T A;  1ZRC A;  4HV5 A;  4RLF A;  3E6C C;  1IN8 A;  3VSL A;  3Q9V A;  4KIT B;  2H1K A;  2WB1 A;  4HAM A;  3M1C A;  1KYW A;  3WU2 C;  1OR7 C;  2MFZ A;  2LDU A;  3RZD J;  1VFC A;  1R22 A;  4FE7 A;  1JKO C;  1D5Y A;  3D5R C;  2WA0 A;  2A69 F;  3JSO A;  1UG2 A;  4KT6 A;  2IVM A;  3FMR A;  2Y2Z A;  5B5E C;  4ZYD A;  2LF7 A;  2XIG A;  2DLL A;  2X6X A;  5ICG A;  4ZTJ A;  2RGV A;  2H09 A;  3DTE A;  4ZTF A;  1WI9 A;  3TGN A;  1EH8 A;  3RDI A;  4KDP A;  2RKH A;  3TW6 A;  3C1D A;  1YRN B;  2XV4 S;  2F6C A;  2FBH A;  3W3C A;  4B47 A;  1RET A;  4BXX J;  2MH9 A;  4LG3 A;  4XRS G;  1ZK8 A;  2P7V B;  3SFZ A;  4AUX A;  2GLO A;  4PUS A;  3I4M J;  2BXY A;  1W7P A;  3DXJ F;  1RKW A;  3V8K A;  1QQI A;  2XF5 A;  5DUK A;  2CUZ A;  2DMT A;  2OA4 A;  2P6T A;  4C3I J;  4U7D A;  2ISZ A;  4JOM A;  3CCS I;  2L7K A;  2FBI A;  5HDG A;  2MW8 A;  2ID3 A;  4P9F A;  3ULQ B;  1HW5 A;  1XN7 A;  4UNO A;  2M8G X;  5HLI A;  5E3N A;  4LG0 A;  2Z5U A;  4WXD A;  5HNH A;  2JMW A;  1IXS B;  2QQ8 A;  2COM A;  2EIJ H;  3OR1 C;  2VT3 A;  4JX4 A;  3ZOB A;  4AIK A;  2FOW A;  2XB0 X;  3G71 I;  1XDU A;  3CCE I;  5EEH A;  1MBK A;  1JUM A;  3DWL E;  2XF7 A;  3ZQQ A;  1IRF A;  4MGR A;  1BL0 A;  2MC3 A;  2F2E A;  1VQL I;  2ZJP F;  1IGN A;  2QGU A;  3OYG A;  2ZFW A;  2BV6 A;  3GO5 A;  2HQA A;  4DYR A;  1QRY A;  2EA4 A;  3H3V K;  1BI1 A;  4ON0 A;  1GVJ A;  4RGU A;  1W1W E;  4N4O B;  2UZK A;  3OS0 A;  3RPQ A;  3TW7 A;  2JRT A;  4XLN F;  4EV0 A;  2FNA A;  1FP2 A;  3N05 A;  3VEP A;  4HNU A;  4E7L A;  3OYJ A;  1OMI A;  4QTR A;  2QSH X;  4IRG A;  3WE2 A;  3LOC A;  4M74 A;  4WXC A;  3TMO A;  4Z2Y A;  1AOY A;  2NVU B;  1ORK A;  4XSX F;  1FIA A;  2O7O A;  4JQF A;  3K4N A;  5TGT A;  1IC8 A;  4F7Z A;  5KK1 A;  3QYE A;  3OY9 A;  2K4B A;  3TO9 A;  3B6A A;  4HQM A;  2ACJ A;  2LVS A;  4J01 A;  1BR1 A;  1YYV A;  4BAC A;  4L0Z B;  5D5X B;  5KVR A;  1XD7 A;  2MG4 A;  4BHP A;  3FM3 A;  1ERD A;  3KEO A;  3M8E A;  1QHG A;  4CZZ A;  4XKC A;  4DZP A;  2HOE A;  3MCZ A;  2NVY J;  3QYF A;  1AU7 A;  3DQV C;  4EJU A;  4UV9 A;  4RAG A;  2DMP A;  3P5J A;  4M71 A;  4M9S A;  3CMA I;  2DJN A;  4RM3 A;  1L0O C;  2V9V A;  4A3L J;  2Y48 A;  2JUG A;  2DA5 A;  3EET A;  3QP6 A;  3LAJ A;  2R7Z J;  3WU0 A;  5LGN A;  2DDA A;  1O4X A;  1BOB A;  1PYV A;  2QQA A;  3FMS A;  2RQP A;  1IXC A;  1ETW A;  4C3H J;  4XIC A;  2KDO A;  3HB9 A;  1U8R A;  4PJM A;  1RUO A;  4XOP A;  4D9J A;  1X19 A;  2IS1 A;  1K61 A;  4OAZ A;  3IUO A;  4YEJ A;  3SZP A;  1IW7 F;  1DGW Y;  5FRN A;  3GXO A;  4UHT A;  2XSD C;  3GTM J;  3MZ8 A;  4BGD A;  3UKG A;  2QWW A;  2OBP A;  3W6J B;  1F43 A;  4HDU A;  4WX9 A;  5HS9 A;  1YJN I;  2KRH A;  3OYI A;  4ZDL A;  2E1O A;  5CQE A;  2M4K A;  1RUN A;  3WTS C;  2MAB A;  4IHV A;  4PJL A;  5BS6 A;  2H27 A;  2OC6 A;  1JGS A;  3S17 J;  4EJT A;  3OYF A;  4EM0 B;  4FT8 A;  5J4V A;  2RQQ A;  4LB5 A;  1WFX A;  2M0M A;  1IDY A;  1W5T A;  5E8G A;  1H89 C;  4FX0 A;  5F64 A;  3JAM Z;  2MYS A;  2DYR H;  4LK1 F;  1JUS A;  3HTS B;  2X6W A;  3RI4 A;  2DK8 A;  1FYM A;  2DOD A;  1U6G A;  3ASN H;  3B6C A;  2IEK A;  2H8R A;  3GLL A;  4BNC A;  2KPM A;  1KQ0 A;  2YS9 A;  3RPU D;  1JT0 A;  1JKP C;  4CCM A;  5J6X A;  3M8J A;  2ELH A;  2H1L A;  5LGT A;  4MIM A;  2OU2 A;  2ZME C;  2R7V A;  3KE2 A;  3QU3 A;  4A3C J;  2DA7 A;  2PMU A;  3R6S A;  3BT9 A;  3H35 A;  3L1P A;  1CGP A;  4PCQ A;  1GUU A;  1ZTR A;  2BY1 A;  5JHF A;  3IAM 2;  2R7X A;  3R0A A;  4DOZ A;  1MJB A;  2P5L C;  2VUM J;  3I58 A;  3HOU J;  1ZKG A;  2FMY A;  2R7F A;  2V6C A;  4HBL A;  3CUQ A;  3IL2 A;  1K4S A;  4XRM A;  1FOW A;  1N77 A;  4HRI A;  2AXT C;  1XCV A;  2HOS A;  4PZJ A;  5DM7 F;  2CFX A;  3RQI A;  5CVR A;  5J3L A;  3QYB A;  2PBI A;  3G6E I;  3TP0 A;  1I6H J;  3HDD A;  3KZI C;  1ZN2 A;  2VAS A;  1T0F A;  2CUJ A;  3AG3 H;  3FKI J;  4ZC3 A;  1Z7L A;  1ITY A;  3PQJ A;  3U9G A;  2PG4 A;  2DMQ A;  2UXN A;  1FWZ A;  2V7F A;  4XID A;  1RRJ A;  4XON A;  5F0F A;  3IHU A;  3T1B A;  2DPU A;  3MWM A;  4F92 B;  4F55 A;  4A6E A;  1WGX A;  2NS7 A;  3DV8 A;  1PDN C;  4AYB A;  2K40 A;  2IT0 A;  3BG9 A;  3ZN1 A;  1QNT A;  2MD5 A;  4KIB A;  2PI0 A;  2VN2 A;  1DP7 P;  1F5T A;  2XRL A;  4RMN A;  2NNN A;  3FDY A;  3BQY A;  4NHJ A;  3T8T A;  4IOC F;  2VKE A;  2P5K A;  1MBH A;  3L00 A;  3ABT A;  3W2W A;  4ENK A;  3FXU A;  3HKZ A;  3BTI A;  4ABZ A;  1FTZ A;  1WRJ A;  4IRH A;  5GAH J;  3D5S C;  2KL4 A;  2E1C A;  1FOX A;  3OYM A;  2RNG A;  3E97 A;  4LIT A;  1APL C;  3QQA A;  2IGK A;  2YU3 A;  2EV0 A;  3K4J A;  4XOT A;  2ECC A;  3CQZ J;  5JLX A;  1TW2 A;  4GXO A;  5KNL A;  2FQ4 A;  3ZMZ A;  2XAS A;  2LYC A;  4XNF A;  2NVQ J;  4NC7 A;  3K4B A;  4F3Q A;  2EZK A;  2MLG A;  1UFM A;  5A2Q K;  2IP2 A;  3DLL F;  2MLK A;  1G2H A;  1R58 A;  1TL8 A;  3HHH A;  4RB1 A;  3ZMS A;  1VTN C;  2GZW A;  3UNG C;  6PAX A;  5C4X J;  3BZ6 A;  4BH9 A;  1H9T A;  3GEZ A;  5F0H A;  3X2Q H;  2OF7 A;  5IYC J;  2HTJ A;  3MFK A;  2CS3 A;  2X4H A;  2TDX A;  3MKL A;  2BVM A;  5B1A H;  3A03 A;  1LEB A;  1MW7 A;  1MIJ A;  3HSF A;  5K5Q A;  1ETX A;  1A6I A;  2HDD A;  1IO2 A;  4L5I A;  3V42 A;  4EJV A;  1YRN A;  5JVT A;  5GTH C;  4OMY A;  1H8A C;  2VC0 A;  5LHH A;  3DF8 A;  1XB4 A;  1B59 A;  2VJI A;  3K4L A;  2GIV A;  3JSP A;  1YFH A;  5E1W A;  1TWH J;  3BDD A;  3WHC A;  1A5J A;  2A05 A;  4WCG A;  2LTP A;  1SFO J;  4L18 B;  1GV2 A;  2KKO A;  5IT9 Z;  1D8K A;  1WJB A;  2KIQ A;  3O2P E;  4K2E A;  3F22 A;  3ZQL A;  2XGE A;  1QA6 A;  2BOL A;  2UWM A;  4Y4R A;  2JRM A;  4OIQ F;  5LFA A;  1A31 A;  4M73 A;  1VQ4 I;  3ERM A;  1F1Z A;  1FIP A;  2K9S A;  3AKZ A;  3BRO A;  1MDM A;  1JJ6 C;  1V55 H;  3Q0U A;  4XRF A;  3CJQ B;  4QLC U;  3MMY B;  1MNM C;  2HOA A;  4N4N B;  3PNV A;  4XK4 A;  2DA3 A;  3JRC A;  5FLV A;  3HHG A;  4ESF A;  5H20 A;  1Z3Y A;  2ZKZ A;  2ZSI B;  2K7L A;  4A3D J;  5L3F A;  2Y75 A;  1TC3 C;  2IW5 A;  5D8L B;  2E36 A;  4IXA A;  1U78 A;  1OR7 A;  5D5U B;  1JKQ C;  2Q8K A;  2EZH A;  2CMP A;  4HX7 A;  4XL9 A;  2BW3 A;  4V2F A;  1IDZ A;  2W84 A;  3HUG B;  1M1E B;  1USS A;  2RVC A;  4P9U A;  3IH3 A;  2VB6 A;  3ECO A;  1X4P A;  1IUF A;  2L9R A;  3O8G A;  1Z0X A;  3CO7 C;  2BYV E;  4OIN F;  2GXB A;  1XMA A;  2KZG A;  2CUF A;  3FBN B;  3H3Z A;  3IWF A;  3R61 A;  3OYK A;  4P5O A;  4ZH4 F;  3GTP J;  1X4O A;  2JSC A;  3DCF A;  3LSJ A;  2DFH A;  2K3F A;  5ILV A;  2TCT A;  1QBJ A;  3FXJ A;  2R7U A;  3GUD A;  2XDV A;  3MKZ A;  5DTD A;  2XKO A;  4KT5 C;  3PSF A;  5B1B H;  3J81 Z;  3GVA A;  3S1N J;  5K7H A;  5H2F C;  4QPQ A;  3OYH A;  2EA2 A;  5GPC A;  2HYJ A;  2QLZ A;  1Z67 A;  4IHT A;  4DZJ A;  1WJ5 A;  2F5E A;  4BXU A;  1SD5 A;  3LSP A;  1XPX A;  3H9Q A;  2V1N A;  3LQQ A;  1QVT A;  4CA0 A;  4E7Z A;  4XLH A;  3O6B B;  4KIF A;  2ZJQ F;  1OCC H;  4D7M A;  2DDB A;  1POG A;  3ABK H;  2AS5 F;  2KJB A;  1G8X A;  4OWR B;  1U3E M;  2BZT A;  2L7F P;  3TOB A;  2AQE A;  2M34 A;  3OYA A;  3LL7 A;  4U87 A;  1X3W B;  5D4R A;  1V54 H;  2LK2 A;  3S16 J;  3LFK A;  3KPH A;  2R7D A;  2XGC A;  3ELK A;  3HOX J;  2P5V A;  1PUF A;  3IKV A;  3CCJ I;  3CCR I;  1K78 A;  3HXL A;  5CQG A;  1J59 A;  2L3D A;  1R23 A;  5HDK A;  1ON2 A;  3E5X A;  3PUB A;  2FNP A;  4XN0 A;  2BHY A;  4R79 A;  1WSU A;  1LDD A;  1O3S A;  2R92 J;  2CG4 A;  4A3K J;  1VQN I;  5LRR A;  1B6A A;  3BCA A;  3KP4 A;  1D1B A;  3KCC A;  3KP5 A;  3L2C A;  3JRA A;  2BVL A;  4A3B J;  4I6Z A;  3KLO A;  4MEX F;  3I4P A;  1MZB A;  2CQQ A;  4B1R A;  3KP2 A;  5FD5 A;  1MBE A;  2DJI A;  2VON A;  2K4J A;  3KIO A;  3K9T A;  2J5O A;  2JT1 A;  4BHB A;  1XDS A;  1GV5 A;  3CDL A;  5FLM J;  1E17 A;  2VOO A;  3A0H C;  4A2U A;  3OIO A;  3KX2 A;  1S6L A;  2GIZ A;  4A0Z A;  4AU7 A;  1R71 A;  1U5T C;  2DFI A;  1KU9 A;  5LEJ A;  5CYV A;  4BS9 A;  2JTV A;  3V4G A;  2P8T A;  1YLF A;  3CUQ C;  1W36 D;  1ZRE A;  1ETK A;  3DTI A;  4N0B A;  4PSX A;  4BE1 A;  4F93 B;  1XS9 A;  1WJE A;  2K9Q A;  2R5Y A;  2OTJ I;  4D1Q A;  2W00 A;  2F5D A;  3VOE A;  2G7U A;  5AIQ A;  3E6B A;  4YII A;  4BAY A;  3N97 A;  2XVC A;  2NOJ B;  5J1R A;  2M87 A;  3Q0W A;  2VKD A;  1T0F C;  4J00 A;  2DA1 A;  3ZMD A;  5K7F A;  2HFH A;  3TDU C;  2LSO A;  2CV0 A;  5IYB J;  3BCB A;  1B72 A;  3FIS A;  2FUG 2;  2LRD A;  4HSR A;  2OQG A;  2FXA A;  2X1E A;  3FM5 A;  2QA4 I;  1Z6T A;  1D0Z A;  2DQL A;  4F91 B;  1LEA A;  2LY1 A;  4M72 A;  1Z1D A;  3V7C A;  1IUY A;  3M07 A;  3S2D J;  1FSH A;  2EWN A;  3D5L A;  3FWE A;  1HA8 A;  1MSF C;  2ZJR F;  3BR6 A;  4IHX A;  2DO7 A;  2XRN A;  4XLP F;  3DKX A;  1XG1 A;  1S7E A;  2LR8 A;  3U1D A;  4M3B A;  1I39 A;  4G7O F;  4KUM A;  1Y0U A;  2R7W A;  3Q5F A;  4XRS A;  4DYC A;  4EGY A;  5CVU A;  2NNY A;  3CCQ I;  1IRZ A;  3ZMT A;  2KRC A;  4YRV A;  4RM2 A;  1LFU P;  3A4C A;  3Q3S A;  1DQU A;  1WJF A;  3HOZ J;  2KQR A;  2VQC A;  3NWS A;  1XGM A;  2KIS A;  3OL4 A;  4LIU A;  1Z9C A;  1P4W A;  1ACI A;  5JI6 A;  1Z3X A;  1QPI A;  2O5R A;  2K9M A;  3HOW J;  4NUB A;  1SMY F;  4M9Z A;  2ZME A;  4LLL A;  2E1M B;  2VIX A;  4E4H A;  1LQ1 A;  5F1J A;  5HLH A;  1Z21 A;  3OYB A;  4CSW A;  4D0P A;  2X85 A;  5FKN A;  3PUF A;  1S7A A;  5K5O A;  3GTJ J;  1HKT A;  2K9L A;  1NK2 P;  1RES A;  1FEX A;  3WTT C;  1O57 A;  1B8I A;  3JRB A;  4HG2 A;  1WWX A;  2G0E A;  2BY3 A;  1GXP A;  3BZC A;  2ESN A;  1HF0 A;  2L7M P;  4PGH A;  3W2V A;  4FET A;  3CZ6 A;  3V8J A;  1I3A A;  1BIB A;  3EPZ A;  2BY2 A;  2P4W A;  5L3D A;  3E6D A;  4EEF G;  3G4S I;  2FBK A;  2ZXW H;  3ABL H;  3WGI A;  2PN6 A;  1R9T J;  2K5C A;  3WTY C;  2W7N A;  1CF7 A;  2LFB A;  4I0A A;  3RKW A;  1W0T A;  1N78 A;  1JTX A;  2HTS A;  3BC8 A;  5BMZ A;  2N8G A;  2Z99 A;  5C3E J;  3RCO A;  4OU0 A;  3HBL A;  1FYL A;  4WF2 A;  1ETV A;  1K4T A;  1BN5 A;  3JTH A;  4EMS A;  4I98 B;  4QIW N;  2L5Q A;  4EAT A;  4CXF A;  1ZQ3 P;  2OAZ A;  3CTA A;  1ZRF A;  2R93 J;  2H6C A;  2JWT A;  2EIN H;  2OZ6 A;  2CW0 F;  1QZY A;  4AIH A;  1VQK I;  1ON1 A;  1X1P A;  3QU6 A;  5DEQ A;  5ICE A;  1ZG1 A;  2WC2 A;  5M5X J;  1VI0 A;  3EUH C;  2XF6 A;  3JW4 A;  2EIK H;  2AXL A;  1Y6I A;  2M8E A;  3OOP A;  4CIC A;  1VQP I;  4DYQ A;  1FZP B;  1ZLJ A;  4EQQ A;  4UUV A;  2HWV A;  1MND A;  3K70 D;  1I1G A;  2K02 A;  5E8I A;  3JRF A;  4P55 A;  2QM3 A;  5IP6 A;  3GFL A;  3RPU A;  1N25 A;  5GAD J;  3IAS 2;  4B09 A;  2Y9Z A;  3EDP A;  4C30 A;  3V8L A;  1EV7 A;  1SFK A;  3HL2 A;  3CC2 I;  3HG9 A;  2EZI A;  3HSE A;  2VJ4 A;  3K4C A;  3GFI A;  2HVR A;  1NTC A;  2JA7 J;  2LG4 A;  1STZ A;  4II3 A;  4HF0 A;  1MH4 A;  2HGC A;  1E3P A;  3J7Z I;  4C3J J;  2PLY A;  2VOD A;  1MBF A;  1ZYR F;  2FML A;  5K5R A;  2FD5 A;  2JPC A;  1KA8 A;  3KFW X;  4G12 A;  2VQL A;  4S0H B;  5F1R A;  1JI8 A;  2ISY A;  4GDF A;  1I3Q J;  2WTE A;  3E5U A;  5E1Z B;  2YX7 A;  2P81 A;  4E6K G;  5IP9 J;  4E7I A;  2XAQ A;  3FX3 A;  2FRH A;  3S2H J;  5C44 J;  4A0Y A;  3HTU A;  3NAR A;  4BQO A;  1X1A A;  2LRE A;  1L3L A;  2L2O A;  3M7G A;  1MGT A;  1EJ9 A;  1SMT A;  1YQA A;  4HDV A;  3SQN A;  3FIW A;  2NVX J;  2LOO A;  1UHS A;  2E19 A;  2W57 A;  3S32 A;  3ONQ A;  3TL4 X;  2IAI A;  4IOA F;  2J5P A;  2ZO4 A;  4IO9 F;  3KEQ A;  5EGO B;  1GHC A;  4BL0 B;  4CCN A;  2PFB A;  3A2K A;  3HRT A;  1D3Y A;  5B66 C;  1OLT A;  3F8F A;  5CVJ A;  2Z2S B;  3H9J A;  2IA1 A;  3OSG A;  4DW6 A;  1MNE A;  1F36 A;  2BGC A;  3NWT A;  1TP4 A;  2OTL I;  3MQ0 A;  4XLA A;  1R7J A;  1V5G A;  1NH3 A;  4HEA 2;  1TWG J;  1WHU A;  1G3T A;  4BXF A;  3FZV A;  1J75 A;  3J80 K;  1KU2 A;  3LAP A;  3HGG A;  1FBQ A;  1K7A A;  2E5N A;  5LHI A;  4DNC A;  4DJA A;  2KRF A;  3WTV C;  5FLX K;  2FA5 A;  3LSG A;  3A01 A;  1X1C A;  2GA2 A;  4BBR J;  4XOR A;  4A6D A;  5ILU A;  3BJ6 A;  2ELJ A;  1S9H A;  1JHF A;  2R7S A;  4MNU A;  1LJ9 A;  1ZAO A;  5L3G A;  4QWQ A;  2DN0 A;  2LD5 A;  2VXD A;  3CES A;  5LD2 C;  4ZJZ A;  2HKO A;  1A04 A;  3CLQ A;  3ZQ7 A;  4XMY A;  1HW2 A;  4CDG A;  4RA2 A;  1YX3 A;  3DP7 A;  2IJL A;  3WTX C;  3O3K A;  1YJW I;  4IHW A;  2Z16 A;  2FOK A;  2MBF A;  2LC2 A;  2CWE A;  1QGP A;  3WGG A;  2FSW A;  2BBY A;  3QOE A;  4LFU A;  2WV0 A;  3G1M A;  1S29 A;  1D0X A;  3TO7 A;  3WG7 H;  1OQY A;  2JA5 J;  5DD8 A;  3K70 C;  1FTT A;  3L7W A;  3F72 A;  1VF9 A;  5JHU A;  4BEH A;  3CC4 I;  3HRM A;  5TRD A;  3GFJ A;  4P96 A;  1S7O A;  1XMX A;  1I1S A;  2PQ8 A;  3RKX A;  4II2 A;  2PJR A;  3OS1 A;  2OCC H;  1SD4 A;  2PMZ N;  2PX9 A;  3SDB A;  1BIA A;  3HIF A;  2JZY A;  3I59 B;  3E6M A;  1N75 A;  3TBI A;  4E7H A;  5HOO A;  1LUJ B;  5D5V B;  1GVD A;  2M4G A;  4CCO A;  4MEY F;  1VQ9 I;  2LBF A;  5E3L A;  3JR9 A;  1F9N A;  3AG4 H;  2JN6 A;  4LK0 F;  3MKW B;  3OWT A;  3ZN0 A;  1KQ8 A;  5TIS C;  1S3J A;  1G59 A;  4EM2 A;  1BM9 A;  4IF4 A;  3EYY A;  1IG7 A;  4IRI A;  2LMD A;  1FMW A;  4XBF A;  1Z6R A;  1YE9 A;  1G4D A;  2QKL B;  3BG7 A;  4HA8 A;  4CO8 A;  5DCM B;  3F3X A;  1BC7 C;  2NS0 A;  3GBG A;  3VSK A;  2M2E A;  4JX5 A;  5H6Q A;  4O5V A;  3BP8 A;  4Q5S F;  3COA C;  4U88 A;  1DP3 A;  4XLC A;  5M5W J;  4RGR A;  4GFB A;  4PJ0 C;  3AL0 B;  3F0C A;  3H0G J;  1HCR A;  4RLQ A;  4I99 C;  1TQM A;  3K4K A;  4PJN A;  4AIJ A;  1RI7 A;  4TV7 A;  5LHG A;  3K2A A;  3WG9 A;  4D5F A;  2IBD A;  3C3W A;  3I54 A;  1CQT A;  5EG0 B;  1J09 A;  4L9J A;  4CYC B;  2YPR A;  3PNY A;  4ZYH A;  4ENN A;  2R5Z B;  3A1Y A;  2GXG A;  4MLO A;  5E20 A;  1BR2 A;  1SAN A;  2CQX A;  3HJE A;  5J1Y A;  3CLO A;  1T39 A;  5HLG A;  1T33 A;  2OJE D;  5FJ8 J;  1R00 A;  5L3B A;  3CJT B;  5HS7 A;  3BR3 A;  1LNW A;  1U5T A;  1MJA A;  2EFW A;  5DV5 A;  2R0Q C;  1DPR A;  2M7B A;  1TBX A;  5AIP A;  2OQR A;  3ECH A;  2KIM A;  3DU5 A;  4R1H A;  5BNG A;  4L9N A;  4BBS J;  2EFN A;  4FTH A;  4A12 A;  2EFP A;  1YJ9 I;  1QZE A;  4P1W A;  4PGG A;  2RRE A;  3PFI A;  4AID A;  1J9I A;  2X6Y A;  1XCB A;  1B1B A;  5K7Z A;  3JTG A;  1ZHF A;  4KA4 A;  3VFZ A;  4B48 A;  1D8J A;  2QKM B;  3SJM A;  2R4G A;  4KIS A;  2A3S A;  2A07 F;  1B9M A;  2PJP A;  3BG3 A;  4Y33 A;  1SAU A;  4Y52 J;  2F5F A;  3W2A A;  5DD4 A;  3VB2 A;  3C2G A;  2V4J C;  2IXS A;  3I4N J;  4UB8 C;  1P7J A;  2XPV A;  1TT0 A;  1UEL B;  5J1U A;  1J0R A;  5DDG A;  2A5Y B;  5FRM A;  5DS9 A;  3ZQF A;  4A3F J;  1Y1V J;  2RC4 A;  4V19 K;  2CO5 A;  4GGG A;  4BU2 A;  1K79 A;  1ZR2 A;  2HXI A;  4MQV A;  3TQN A;  3P9C A;  2OUM A;  1NHA A;  3NEU A;  3NRV A;  4HYE A;  3MN2 A;  1ZGW A;  1LB2 A;  3CCM I;  1XGS A;  2V26 A;  2XPU A;  4NQW B;  3ZGK A;  1TTY A;  3VYS B;  2QBY B;  5FKM A;  1YHQ I;  4ENJ A;  2QYO A;  1P4A A;  2IRF G;  3RYP A;  5CVV A;  1OCO H;  3H5N A;  1T98 A;  4FAS D;  1XTA A;  4NC6 A;  4S05 A;  1ETY A;  1YW8 A;  1RPW A;  2Y0M A;  5EEG A;  1R4N B;  2Q2E B;  1XGO A;  4KIG A;  4XLE A;  3J7A O;  4HF1 A;  3ABU A;  3OMY A;  1X2N A;  5CLS A;  4CUG A;  4UY8 I;  1YS6 A;  2L9S A;  3G2B A;  1ENH A;  1OFC X;  2E7W A;  5BQT A;  1LE8 B;  1DU6 A;  1Q1V A;  2P7C B;  4KN4 X;  4RS8 A;  1Y0N A;  4HZF A;  3LFU A;  4Q4Z F;  3KP7 A;  3L2R A;  3F6V A;  4LLG F;  3T5X A;  1WKM A;  4BQN A;  4E7J A;  1HKS A;  4XR6 A;  2DQR A;  1MMG A;  1UST A;  2NOG A;  2V9K A;  1YIT I;  2KJC A;  1A35 A;  1R1U A;  3LSH A;  2QZ8 A;  1UCR A;  2DOA A;  2O8K A;  1XSX A;  2UUZ A;  1R49 A;  3BLY A;  4FIS A;  2GOM A;  1JGG A;  2H8W A;  1T6S A;  4B44 A;  3G73 A;  1ODD A;  1XMK A;  4A5M A;  3ZRG A;  2E2J J;  1KON A;  1FY7 A;  3L9F A;  3LQR A;  4ZYA A;  3H1C A;  5IPA A;  4EM1 A;  3FHN A;  3SDG A;  1ZG3 A;  3U2R A;  3DBH B;  3F8N A;  3S1R J;  5CPR B;  3G1O A;  3MEX A;  3E5Q A;  3D1N I;  4CYD A;  5K1Y A;  2IS4 A;  2JJ7 A;  2DU9 A;  2DOE A;  4H0E A;  5IOY A; 
#chains in the Genus database with same CATH homology
 3BCB A;  2FUG 2;  2LRD A;  2XF5 A;  2X1E A;  2CUZ A;  4HSR A;  4BJT A;  5HLT A;  2HNH A;  1D0Z A;  4ITV A;  4AVZ A;  2R7R A;  4F91 B;  3K10 A;  2LY1 A;  4JOM A;  1DGR M;  2KZV A;  1MMA A;  2L7K A;  2HPM A;  3D5L A;  2KP6 A;  2E5Z A;  1HA8 A;  4LIV A;  3VWB A;  2IGO A;  4IZZ A;  5HNH A;  1LDK B;  3QOD A;  3DKX A;  3OR1 C;  4BE0 A;  3ZQQ A;  3DWL E;  2XF7 A;  2R7W A;  2MC4 A;  2R7Q A;  2CV1 A;  2KRC A;  3OYG A;  4BDZ A;  4YRV A;  4RM2 A;  2HQA A;  3A4C A;  2L9N A;  1DQU A;  1WJF A;  2KQR A;  2VQC A;  1Y56 A;  1V5F A;  3NWS A;  3OL4 A;  1P9Q C;  4LIU A;  2Z1D A;  1Z3X A;  4N4O B;  4C9Y A;  3OS0 A;  2O5R A;  2K9M A;  4NC8 A;  4NUB A;  2W1O A;  1NG7 A;  1E0E A;  3HOS A;  1BR4 A;  3N05 A;  2E1M B;  2VIX A;  3K6G A;  3PNT A;  4E4H A;  4HNU A;  3OYJ A;  4E7L A;  3E1S A;  1Z21 A;  3OYB A;  3TMO A;  4CSW A;  3VYR B;  2X85 A;  2K9L A;  4JQF A;  3K4N A;  5TGT A;  3QYE A;  3OY9 A;  4HG2 A;  4XKB A;  4DIQ A;  2VL8 A;  4J01 A;  1BR1 A;  4BAC A;  2VXZ A;  4XKV A;  3W2V A;  4FET A;  2JVG A;  1ERD A;  3OIP A;  4OAY A;  3CZ6 A;  1QHG A;  4XKC A;  3EPZ A;  3QYF A;  3DQV C;  2ZSH B;  2K5C A;  2WY8 Q;  1YX5 A;  1D1A A;  3LMM A;  2W7N A;  1UG0 A;  3EUK L;  4ZDO A;  1N78 A;  3OIQ A;  3MKY B;  2WAF A;  3BC8 A;  1MMD A;  2DT7 B;  4RM3 A;  3RCO A;  2JUG A;  3CJR B;  3HC7 A;  2XC7 A;  3KEY A;  2GOX B;  3H5R A;  3SZG A;  1BOB A;  1PYV A;  2V6E A;  4IQJ A;  3DTK A;  5CKT A;  3BG6 A;  2KDO A;  2L5Q A;  4EAT A;  4IQ4 A;  4PK4 A;  4PJM A;  2CH0 A;  3DPU A;  4XOP A;  2IS6 A;  4D9J A;  4B3X A;  1X19 A;  2IS1 A;  3S3M A;  4OAZ A;  4NNJ A;  3IUO A;  4YEJ A;  3U21 A;  1DGW Y;  5FRN A;  3EUH C;  2XF6 A;  4BGD A;  2LY2 A;  3OL3 A;  1Y6I A;  3OYL A;  2KRH A;  3OYN A;  3OYI A;  3F9K A;  3CMM A;  4ZDL A;  5CQE A;  2M4K A;  4ZDP A;  3J7A Y;  2MAB A;  4YEL A;  3FBI B;  4PJL A;  2OC6 A;  1MND A;  3K70 D;  3OYF A;  4BDY A;  4U7B A;  2RQQ A;  1WFX A;  2M0M A;  2Q1Z B;  4CZC A;  3IP4 B;  3IAS 2;  5HVQ C;  1V5E A;  4C30 A;  2MYS A;  1QHH D;  1SFK A;  3HL2 A;  4IX7 A;  3HG9 A;  2X6W A;  2VJ4 A;  2W4S A;  3K4C A;  3L2V A;  2HVR A;  3CP2 A;  2LG4 A;  3K4M A;  3OOU A;  4II3 A;  2KPM A;  3RPU D;  1GLN A;  4E7K A;  4CCM A;  3S8P A;  3M8J A;  1JI8 A;  1WJA A;  2VQL A;  2ZFU A;  1QU3 A;  1WJD A;  2R7V A;  4E6K G;  4E7I A;  1K6Y A;  3VDX A;  4BQO A;  1X1A A;  2LRE A;  2WAE A;  3H35 A;  2L2O A;  5JHF A;  3IAM 2;  2R7X A;  4DOZ A;  1VZ0 A;  2LOO A;  3S32 A;  3ONQ A;  2HZD A;  3TL4 X;  1N77 A;  4HRI A;  4BL0 B;  4CCN A;  3A2K A;  3L2Q A;  1LVK A;  1OLT A;  2Z2S B;  3H9J A;  3LSK A;  3AFH A;  3QYB A;  1MNE A;  2IS2 A;  3S3N A;  3NWT A;  2VAS A;  2CUJ A;  4ZC3 A;  1Z7L A;  4XLA A;  1V5G A;  3FKJ A;  2XSJ C;  4HEA 2;  1EA3 A;  4BXF A;  3SYT A;  4F52 A;  4KJZ A;  3OYD A;  2V7F A;  4CCL A;  2WBM A;  4XON A;  4XN3 A;  2E5N A;  3S3O A;  4F92 B;  4F55 A;  4H4K C;  4DJA A;  3LSG A;  2F5V A;  4AYB A;  1X1C A;  3E0J B;  3LSM A;  4XOR A;  2ELJ A;  1S9H A;  2R7S A;  2MD0 A;  4RMN A;  2VXD A;  3CES A;  1IRX A;  3FDY A;  5LD2 C;  4ZJZ A;  4XMY A;  1YX3 A;  3DU6 A;  2A5W A;  2Z16 A;  3W2W A;  1W36 C;  3HKZ A;  2LC2 A;  2DXI A;  3D5S C;  2KL4 A;  2X1D A;  3OYM A;  2RNG A;  3QOE A;  4G6T B;  4DBR A;  3ZCO A;  4LIT A;  1D0X A;  2IGK A;  3K70 C;  3K4J A;  4XOT A;  1NG6 A;  4BEH A;  2IGM A;  4QPO A;  5KNL A;  2WAQ A;  2R7O A;  2LYC A;  4XNF A;  4II2 A;  2PJR A;  3OS1 A;  4NC7 A;  3K4B A;  4F3Q A;  1R6R A;  3SDB A;  3PFY A;  3LSI A;  1N75 A;  3TBI A;  4XQF A;  5HOO A;  4PFO A;  3UNG C;  4BE2 A;  4E7H A;  3RQ4 A;  2VQH A;  2M4G A;  4CCO A;  3PJR A;  2LBF A;  2E60 A;  4GRI A;  1X1D A;  4BEH B;  2CS3 A;  3MKW B;  3OWT A;  2CFO A;  2BVM A;  2LH9 A;  1G59 A;  2HDW A;  1MW7 A;  2PJR B;  1FMW A;  3I3L A;  4CCK A;  1YE9 A;  2QKL B;  3BG7 A;  3V42 A;  4B43 A;  3GBG A;  1X1B A;  3VSK A;  5HNF A;  2VJI A;  3K4L A;  3OYE A;  2LBF B;  1DP3 A;  4XLC A;  1WJB A;  3EUA A;  2E1M C;  3AL0 B;  2UWM A;  1U0J A;  2BOL A;  3SEQ A;  4Y4R A;  2X1C A;  5LFA A;  4RLQ A;  4XKW A;  4HNT A;  3K4K A;  4BUP A;  4PJN A;  4CH7 A;  2A6T A;  1UAA A;  3AKZ A;  3RSN A;  4HPQ A;  2VPL A;  4XM3 A;  3CJQ B;  1ZEL A;  2CW7 A;  3MMY B;  4N4N B;  4DGW B;  2DCE A;  3H5A A;  3PNV A;  1J09 A;  2JSP A;  3ZR8 X;  3SEZ A;  1Z3Y A;  3PNY A;  2ZXI A;  1D0Y A;  2ZSI B;  3A1Y A;  4PFP A;  4MLO A;  2HPI A;  1BR2 A;  2F4I A;  3I9V 2;  3PL8 A;  2CMP A;  2K3P A;  1AA7 A;  4XL9 A;  2BW3 A;  4XLF A;  3HUG B;  1T95 A;  3DPT A;  2VB6 A;  4DBQ A;  1X4P A;  2M7B A;  3DU5 A;  4PJJ A;  4BJ6 C;  3FBN B;  1WJC A;  2WAD A;  3OYK A;  4P5O A;  3OS2 A;  2IGN A;  2Y0S A;  3L2W A;  5KCM A;  4P1W A;  3ZXS A;  3MD2 A;  1X4O A;  2RRE A;  3DKY A;  2X6Y A;  4BJ5 C;  2I8D A;  2R7U A;  4B48 A;  2AQF A;  3OYC A;  2XDV A;  2QKM B;  3MKZ A;  2BW3 B;  2R4G A;  4KIS A;  3PSF A;  3H9G A;  4Y33 A;  4ANJ A;  1SAU A;  1MMN A;  4QPQ A;  3OYH A;  3W2A A;  3KYL A;  3C2G A;  2P0W A;  2V4J C;  3OR2 C;  2IXS A;  1WJ5 A;  2WY7 Q;  4X0G A;  3DPL C;  3H9Q A;  1TT0 A;  1UEL B;  2V1N A;  3VYU B;  3H0D A;  5FRM A;  2R7T A;  4CCJ A;  4CA0 A;  4BQQ A;  4E7Z A;  4XLH A;  4BU2 A;  2KLO A;  3DEE A;  2KHM A;  2OUM A;  2JVH A;  1G8X A;  4OWR B;  5KHD A;  4NQW B;  2V26 A;  2VQG A;  3UR3 C;  3ZGK A;  2VLA A;  2AQE A;  3OYA A;  3VYS B;  3LL7 A;  2OV7 A;  3AL0 C;  1FMV A;  3HOT A;  4U87 A;  3C2H A;  4IKF A;  2DT6 A;  2X51 A;  1LKX A;  3HPH A;  4Y3O A;  4PSW A;  2VKH A;  3H5N A;  2HU9 A;  4FAS D;  2CV2 A;  2JA2 A;  2W82 A;  3HXL A;  4XLE A;  2Q2E B;  2VJ5 A;  5CQG A;  2HVQ A;  3OMY A;  4CUG A;  2HVS A;  2L9S A;  3CF2 A;  3G2B A;  3PUB A;  1D1C A;  4XN0 A;  4R79 A;  3DLA A;  3HPG A;  3PSI A;  3BCA A;  2M3A A;  3VYT B;  3LFU A;  2CW8 A;  2KMU A;  3L2R A;  4C2U A;  3RTR A;  1D1B A;  2BVL A;  2UV1 A;  4BQN A;  4HST A;  4E7J A;  4XR6 A;  4RLF A;  1MMG A;  3VSL A;  4KIT B;  2V9K A;  2WB1 A;  2DJI A;  1PJR A;  3M1C A;  3LSH A;  1OR7 C;  2MFZ A;  2DOA A;  4C2T A;  3D5R C;  2WA0 A;  3KX2 A;  2UUZ A;  4KT6 A;  4AU7 A;  3L2U A;  3BLY A;  2GOM A;  2X6X A;  4B44 A;  2PMZ A;  4BS9 A;  4ZTJ A;  5FRO A;  3DTE A;  3ZRG A;  4ZTF A;  2VJJ A;  1W36 D;  1KON A;  3DTI A;  4PSX A;  4BE1 A;  2M7A A;  4F93 B;  4ZYA A;  1WJE A;  2F6C A;  3W3C A;  4B47 A;  4D1Q A;  2W00 A;  3FHN A;  4E7S A;  2XAU A;  4LG3 A;  3CP8 A;  2ZXH A;  2NOJ B;  5CPR B;  2VKD A;  1T0F C;  4J00 A;  2IS4 A;  1TZL A;  4PUS A;  2CV0 A;  1LFP A;  3S93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...