3OL3A

Crystal structure of a putative uncharacterized protein from mycobacterium smegamtis, an ortholog of rv0543c, iodide phased
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
b'TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Unknown function
total genus 31
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol3A02
3OL3A 3OL4A
chains in the Genus database with same CATH superfamily
1SD4A 1AA7A 2LOOA 4C30A 5D4SA 4C3IJ 1EJ9A 3QPSA 3J7ZI 2X1EA 1J09A 1U5TA 3MVPA 3VYRB 1FMVA 4WK8F 2QYOA 3TBIA 4HSTA 5JHUA 4LGWA 4NC8A 4QLCU 3QODA 1V5FA 2AQEA 1F43A 3MN2A 2FBIA 3IV5A 1YHQI 3K6GA 4ZTJA 3BPXA 4IVNA 1HKTA 5F0HA 1MSEC 3FWEA 3HOTA 3W6JB 3IUOA 1WWXA 4KIGA 1LKXA 2F6CA 3T5XA 3SYTA 5GTHC 1IGNA 4OMYA 4D7NA 1KU7A 2R7XA 1GV2A 3OYCA 3OIPA 3FXQA 2OTLI 2NVTJ 2BE5F 3BC8A 2XKPA 4RGXA 2V9PA 2MW8A 1UG2A 4X1EA 4BEHB 1C0WA 2CV1A 1LNWA 3AG2H 2M30A 5EEHA 2LSOA 1W7PA 2EZIA 2QZ8A 4I0AA 3NAUA 3TO7A 2E34A 1K61A 1IXSB 1FC3A 3AFHA 2E7XA 3HTUA 4L5EA 2MBFA 1G4DA 1RKTA 1KU3A 4CZZA 3C2HA 4PJNA 5IPAA 4RB1A 3DBHB 4ABZA 4YG2F 2E36A 2DA5A 4E7IA 2DN0A 4AIJA 2CQXA 5D5WB 4FCYA 3K1PA 1MJ9A 1JJ6C 1VQNI 3CLOA 2DCEA 3GBGA 3H0DA 4OU0A 5K7HA 2HVRA 3CUQA 3I55I 1ETQA 2VBZA 5TGTA 2JN6A 3VSKA 3CCYA 2XRNA 2VUMJ 2L7MP 4NQWA 1KQ9A 2E1MB 3OYEA 2HYFA 3V8KA 2R5YA 3CDIA 1E3PA 4PUSA 2ESNA 2LDUA 3OR2C 3OYHA 4RDUA 3E6MA 2K4BA 1IF1A 4CCJA 3OYIA 3TMOA 3CP2A 1TZLA 4A5MA 1X3ZB 1YTYA 4RA2A 4J01A 1GVJA 3ZOBA 2K85A 3PJRA 4CCNA 2DTZA 5CYVA 3O6BB 4EM1A 4F92B 4BBRJ 1PUFA 1YO5C 2DMNA 3K70D 4IZZA 1X58A 1RESA 3I71A 1F5TA 2O5RA 5M5YJ 1G3YA 4LG0A 1W36D 2DOEA 1Z91A 5H6RA 5HDNA 3VSLA 5EDNA 3CCSI 2UXNA 3FXOA 5DCMA 2KIUA 3KETA 5C44J 1DP3A 3MFKA 1J9IA 4XQFA 2CWEA 2HTSA 2BYVE 2EZKA 3CJRB 4ESFA 4S05A 3HDDA 3G6EI 1I3AA 4DIQA 1YG2A 2Q0OA 2M8EA 3M4OJ 3CCQI 5HLGA 4HX4A 1R6RA 5CQGA 2COMA 2RC4A 1VQ4I 4KYWA 1ZN2A 4M3FA 4V2FA 2IS1A 2JK3A 2O8XA 1G3WA 4P1WA 3ABLH 1AU7A 3GX4X 2KFDA 1I27A 2W25A 2M4GA 3T0YA 1GV5A 2DXIA 2HOEA 5B1BH 2CQ7A 5K5OA 5FJ8J 6PAXA 1XG1A 2VLAA 4IRHA 1R00A 1ZR2A 3EYIA 1GUUA 2AQFA 5FRMA 4U0WA 4CCKA 3B6AA 3S14J 2R7ZJ 2STTA 2EA2A 1K78A 3BR0A 3C1DA 1WJFA 1KA8A 2MD0A 1R22A 3BZCA 2WB1N 4I99C 1NTCA 4HF2A 1OQYA 2CRGA 2ISYA 2I5UA 2DLLA 1E3HA 2AXTC 2Q2EB 3CDLA 3U2RA 4E7ZA 4CH7A 4D5CA 5E8GA 4HLYA 4OAYA 1PDNC 5JI6A 2E1MC 2JA6J 1LVAA 2WY8Q 4LB5A 1F4KA 3I54A 2FD5A 1IZ1A 3CMMA 3OS1A 3M1CA 3ABKH 2HZTA 1KQ8A 3UKGA 4NC6A 3L7WA 1HDDC 3VYSB 4XN0A 2KIQA 4C2UA 2DA7A 2OZUA 2X6WA 2DT6A 4PSWA 1A31A 4M6YA 4A0YA 4KDPA 1MJAA 3JSOA 2HWVA 2LK2A 4Z2YA 4BBSJ 2GAUA 2VQGA 3S2WA 1IXRC 4A6EA 5EGOA 1W7PD 1P92A 4CICA 1XPXA 3HOYJ 3HPHA 2CW7A 4BXUA 2K9QA 3ELKA 3L2UA 1MBJA 5F0FA 4HG2A 4XLAA 3TW6A 1KZHA 3OYFA 1W5SA 1Y1WJ 2CYYA 3J81K 3HRSA 2BXZA 2ZKZA 4FASD 4FTHA 2RDPA 1ENHA 5F1JA 5E3OA 1VQPI 4CYCB 1GT0C 5CVUA 2E2HJ 3GZNB 3ZN1A 1R4MB 2HVSA 2A6EF 3K2ZA 2F4OB 1JKRC 3DP7A 4PFOA 2HOAA 3H36A 3D0SA 2FBKA 2V9KA 1JGGA 2BVMA 2NNYA 3I4PA 3Q0WA 1X1AA 3DTEA 3BPVA 3MKLA 3ZMSA 3E1SA 2HKOA 4EATA 3G73A 2OBPA 3BTCA 2NS8A 2KIFA 4XRFA 2EV5A 3WTWC 4RB2C 4HDVA 4U88A 2CW8A 1CQTA 1D1AA 1W1WE 2MH2A 3RDIA 3WODF 3ZP5A 2H8WA 3QQAA 1OLTA 1GXPA 3W2AA 4IQ4A 2F5FA 3K4JA 5GADJ 2STWA 2OJED 3EDPA 3GCMA 3CO7C 5C4JJ 3AKZA 3MAJA 4CHUA 1GDTA 2RNJA 2X1DA 4YELA 2D45A 1RC9A 4UV9A 3JW4A 1P4AA 1BC7C 3LSIA 1RNLA 2DPUA 2RV8A 4I6ZA 1LPQA 4OIQF 3WGGA 3R61A 4JK1X 2A5YB 1MW7A 2KRCA 4KMUX 4KITB 1U0JA 2MC4A 3OYMA 3KEOA 4QTRA 3JTGA 2NNNA 2L9NA 1XGNA 4EGYA 3S16J 2E5ZA 1I39A 1WH5A 2O61A 5GP9A 2HU9A 3ZXSA 1YIJI 2XPVA 1P2FA 2Y69H 3GTMJ 3ABTA 3KEQA 4GGGA 3OSFA 1OCOH 1S29A 4M3BA 1GXQA 3OY9A 2IS6A 2K9LA 4A3MJ 2EA4A 2R7QA 1LEAA 2R5ZB 2CGPA 2W00A 1UELB 2F2EA 2LH9A 2VXDA 2VOPA 3O3KA 2W84A 3TOAA 2K9SA 3ONQA 3L2CA 4P5OA 2F4IA 4AWXB 3H1CA 1FJLA 3P7NA 3H92A 3N05A 3WTSC 3F23A 3DFGA 3LAPA 4MQVA 3F8FA 3H35A 5LHIA 3L2VA 4I2OA 2FMLA 2IEKA 3BJAA 1QPMA 2NYXA 2WBMA 3C7JA 1FY7A 2RKHA 4GYIA 5FFZA 1RRJA 3LAJA 3SHFA 4DYCA 4ITVA 3DTIA 1XGSA 2HXIA 5L3GA 4D1QA 1OCCH 4XN3A 1DPUA 2LBFB 3WU0A 3JRIA 4M73A 4ZTFA 1YYVA 3L1PA 1IXCA 1IDYA 1KONA 3B6CA 3FK7A 3PQJA 5FRNA 5BPIA 1YITI 3FBNB 4Y17A 1HQCA 4HZFA 2PX9A 3VEPA 3BR1A 2QUFA 3C2BA 2HS5A 4BU2A 2UZKA 3ZQ7A 2M87A 2UWMA 1P9QC 2QSHX 4C3HJ 1D5VA 2XUBA 3LA2A 1ZGAA 1R1VA 1I6XA 1XGMA 5BMZA 1T6SA 3OOPA 5E1WA 1ERDA 3PO3J 1T0FC 4M6XA 1BI3A 3WHBA 2V7FA 1K7AA 3FX3A 5KVRA 4C2TA 1JKQC 1LDDA 4IHTA 2LC2A 2KISA 5IYBJ 1R58A 2GOMA 4EVIA 4HX7A 3Q0UA 4M9XA 2KQRA 2R7UA 3EUKL 3R60A 2DFFA 4U87A 4ZZLA 2QLZA 2Y2ZA 2P81A 3I4NJ 2RN7A 3RQIA 2DA6A 5M5XJ 3D1NI 2Y30A 4OAZA 5CVIA 2DJNA 2FQ3A 2V79A 4B8XA 2CV0A 2JVHA 2L54A 3S3MA 2KP6A 1S8NA 1FMWA 1UAAA 2Z33A 3BTJA 5J47A 4JBAA 4A3JJ 1JT0A 5LEKA 2WC2A 2KT0A 2EB7A 2K3PA 2VODA 4RAZA 4XONA 4XLPF 2RREA 2EILH 3S2DJ 2X6XA 1Y56A 4E7SA 5IP6A 1LQ1A 5F6FA 1S7EA 3M7GA 5IT3A 1XGOA 3CCMI 3LNQA 2DJIA 2XVCA 4U7BA 3U9GA 4NC7A 1RIOH 4DYRA 2FJ1A 2Z5UA 5TJJA 2NVXJ 1QZZA 4QIWN 4RLFA 2LNBA 1IN7A 4IHSA 5EZGA 4MLOA 1YX3A 3B73A 5IT9Z 2E7WA 2FNAA 4UVBA 2HOTA 2QA4I 3AL0B 2Z16A 3G1LA 4D0PA 1ODDA 5F08A 2LRDA 3M8JA 3I59B 4FE7A 1YX5A 4UB8C 1JUMA 3TP3A 3NQOA 1Z1DA 1XDUA 1HC8A 4CCOA 3K69A 1X2NA 3LOCA 4D7MA 1FTTA 1BW6A 1U9OA 4N4OB 4NNJA 3BZ6A 4XLFA 1B8IA 1B72A 1ZH5A 4M9ZA 4Q47A 2M3AA 2DA1A 2IJLA 2VC0A 3Q3SA 3ZR8X 3A4CA 1TNTA 3KFWX 1YLFA 5HOOA 2CUFA 5FKLA 3K9TA 3DLAA 4M71A 1TBXA 3ECHA 1JUPA 2MYSA 3V7SA 4RAGA 3FMQA 4EJVA 2V1NA 1QZEA 4X0GA 3F3XA 2KRFA 2E19A 1XS9A 3JR9A 2ZFWA 1FYKA 3R0JA 5CQEA 3S93A 1FYLA 2L3DA 5FD5A 5EF6A 4JYKA 4F3QA 3A03A 1Y8QB 3FIWA 3VB2A 4B3AA 2G9WA 4P55A 4OIOF 1R36A 3I0TA 3ZQGA 2DMTA 2KJBA 3CMEI 4A2UA 1JGSA 1A6IA 2B63J 2BY2A 1TWCJ 3S1NJ 1MIJA 3OYKA 2XV4S 4JX5A 4BHPA 2BY0A 4BHCA 4HW0A 3OYDA 2NS0A 2FMYA 3A1YA 5E17F 4S0HB 1OYWA 1T39A 2LYCA 1LEBA 3QOPA 1YIOA 2ZMEB 2FEZA 1MH4A 2HPIA 4PK4A 4BE1A 4YEJA 1IJWC 1CF7A 4HPQA 4IXAA 4BJ6C 1LE8A 3BCAA 3BR3A 2VBWA 3ZMDA 4YIRX 4D5FA 1XMKA 4XRSA 1IC8A 1ZRFA 4IF4A 4J00A 1SMTA 4FISA 1WJEA 4L5IA 3SEZA 3CD6I 3VPRA 2BXYA 4L18B 4DQ2A 4BE2A 2HVQA 3WHCA 2IGOA 1E3OC 3S3NA 4U0YA 3HOWJ 3BG6A 4B48A 3MMYB 2A69F 2WA0A 1JHFA 4BXXJ 1N25A 1ZARA 2QQBA 4V2GA 1ZK8A 2XIGA 4WF2A 3H3UA 1QHGA 4A3KJ 2MC3A 3A01A 1Y0UA 2Q1ZB 1AWCA 5J8CA 3KPHA 4P9UA 1OR7A 2OV7A 3DCFA 1J59A 1TT5B 3JRGA 4N9HA 2I8DA 3QYFA 2M7BA 5BNGA 5LFAA 4HX8A 5IT9K 4ZYEA 4I7HA 1VQOI 1EH8A 3ZMTA 3LFKA 1NHAA 2IPQX 3ZGKA 2VI6A 1TLHB 1W5TA 3QYEA 3TO9A 4A0ZA 1HW2A 2M34A 3BJ6A 1FOXA 5IYDJ 2FA5A 4LG3A 2WWYA 1YRNA 4A3BJ 2Z99A 4ZH4F 3F8MA 4BQOA 4LK0F 2Y75A 1ZG3A 2TCTA 3RZDJ 4KNYA 2FUG2 2B7EA 4LLLA 1G3TA 2K3FA 2CW0F 4ZDLA 1X1DA 3VWBA 1PP8F 1AHDP 5H20A 5B66C 3H9QA 4A12A 4B44A 1AKHA 1BBYA 2LY9A 3WE2A 4G9YA 2PBIA 5M3FJ 2WTEA 4H4KC 4PFPA 3G71I 2JVGA 4FT8A 4RLQA 5E20A 2VXZA 2V1DA 1R5GA 4DNCA 3J7AO 1FX7A 2ZMEC 3K1MA 3LQRA 3K70C 5J1RA 3OL3A 1HKQA 1MSFC 1VQ5I 1ZAOA 3SDGA 5KHDA 4XKWA 5HNFA 2O03A 4LIUA 3DBRB 2LREA 1W36C 2DT7B 3DU5A 2HOSA 2E2IJ 2DFIA 3H5RA 3PQKA 4ZDOA 5L3CA 1TTYA 1ETXA 1LFPA 9ANTA 2VL8A 4XK4A 1GHCA 2YX4A 1YFHA 5BPDA 4IHYA 5ICCA 4M72A 2XGEA 4GXOA 3OWTA 3IWZA 3WU1B 4HF1A 1TWHJ 3BT9A 1P7IA 1P4XA 1R7JA 2LR8A 4M9SA 4ZJZA 3OYNA 1T33A 4Y52J 4C2MJ 3DKYA 3S15J 1UFMA 2FQ4A 4AVPA 2W4SA 1W0TA 5E8IA 2ZC2A 5GAHJ 3HOZJ 4HQMA 2W85A 1TWGJ 3I58A 5H6QA 4XOPA 5EZHA 2K27A 2L9VA 2RNGA 1XC5A 3RKYA 1UMQA 3V42A 1VQ8I 1PJRA 3H3VK 3I9V2 2HZDA 1QBJA 2DA2A 3BG3A 1BR1A 5DM7F 3M9AA 1TQMA 1SC7A 1MDMB 5D8LB 2P8TA 4L9VA 2O9LA 3CJTB 2EIKH 5EG0B 1M1EB 2XASA 2DDBA 4LIVA 4QWQA 3EYYA 1X4PA 2F5DA 3AAFA 4Z6YA 2CFXA 1X4OA 4XORA 3SFZA 5FLMJ 1K6OA 1HBXG 5ILUA 2H1KA 3BCBA 1U5TC 5J4VA 4LG0B 1SEUA 1WSUA 3J7YJ 2JZYA 1DQUA 3GTOJ 1V4RA 1FSEA 4HF0A 1MBEA 3GTJJ 4ZYGA 1DP7P 2PJRB 1FLIA 2L4MA 2ESHA 5F27A 3UNGC 4Y15A 2WAQA 2VQHA 1HF0A 2OAZA 3S32A 4YFKF 1K79A 3LQQA 2DDAA 2L7ZA 1U9NA 5GAGJ 2Z9OA 1UHSA 1N75A 1ZG5A 3A0HC 1J5YA 3PNTA 2DK8A 3GLXA 2IAIA 3HUGB 5F04A 2QSGX 5CLSA 4ZYAA 2DFEA 1QZYA 1DUXC 4DYQA 2K4JA 5LGNA 1IN8A 2N8GA 4BQQA 1OCRH 1WVRA 3MEXA 3ZQCA 2HQ5A 3K4KA 2IBDA 2VKHA 1YI2I 4M74A 4OIPF 3PNVA 3BG7A 2ELJA 3DKXA 1MZBA 4E7JA 4F55A 3I3LA 5D5UB 3ZQIA 3HOVJ 3DEEA 2JRMA 4GYGA 3TO6A 4NDLA 1N77A 5D5XB 2FOKA 5JVGF 2DOFA 4MEYF 4BQNA 1T38A 3HB9A 2KDOA 2RQQA 4ASNA 1FT9A 2BGCA 4WXDA 3CUQC 2EIJH 3QU3A 3TP0A 1IRZA 4MTEA 1DDNA 2FRHA 1OISA 2D1HA 2VJIA 2DBBA 3KX2A 2G0EA 3KP5A 4CCLA 1CGPA 2HDCA 3DPLC 4XL9A 3E97A 4WCGA 2GM4A 3F22A 1R1UA 2HNHA 4RMNA 1OMIA 1SVMA 3OYJA 3CCRI 3HRMA 1Y39A 3OYLA 3ZMVA 4WXHA 2XSJC 2TRTA 5HNHA 3QU6A 5JHFA 2R7TA 4LB6B 3SEQA 2HYGD 3DEWA 2LY1A 2VE9A 2LP0A 3FZVA 3Q5FA 4V19K 1NG7A 4IEJA 1VNDA 2VJ5A 3DBLB 3HRUA 1VTNC 1QHHD 1WJAA 5EGOB 2DMUA 2KIMA 1Y1VJ 5E79C 1G3SA 4OIRF 4HAMA 2P5LC 2KDZA 4EM2A 2K40A 2GZWA 4FHTA 4G6QA 2HPMA 2Q2EA 2QKLB 4Y33A 4DBQA 2M4KA 3Q9VA 1X1PA 3HRTA 4BAYA 2H09A 1ZYRF 2VC1A 2CMPA 4RM2A 2IP2A 4KT6A 2YX7A 2IT0A 5M3MJ 4BY1J 3RPUA 4AIDA 3QP5A 4WWCA 4N9IA 1BC8C 3ZPLA 3SZGA 4BYYA 1QVTA 1VZ0A 3CCUI 3F21A 1RR7A 2VQCA 1S9HA 2ELKA 4XKVA 3CCLI 4X6AJ 1MNDA 1BR2A 4QPOA 4XSZF 4LITA 4BACA 4ENKA 3QRFF 3ISPA 1QO0D 4ON0A 3ZMZA 3IKTA 2PMHA 1WI3A 2MFZA 1APLC 1I50J 2E1CA 1S7OA 3L09A 2JQ7A 2P0WA 5J1YA 3AG1H 1A35A 3W3CA 2DQRA 2HEOA 2ZXHA 2GXAA 3WTXC 1I1SA 3KP6A 3EUHC 3KP2A 5F1RA 2D1VA 1WGXA 1Y8RB 3O8HA 1DU6A 3JRFA 1DPRA 1HLVA 4MFEA 1YW7A 5LRRA 3L2WA 2VJ4A 2CFOA 4PJ0C 2EZLA 4BH9A 2Y9ZA 2PFBA 2V6EA 4UNOA 1VQ6I 4RBOA 5FROA 4CYCA 1N78A 2OQGA 3E3VA 2V4JC 3COAC 3ESWB 2LKXA 2JWTA 2XGCA 3OR1C 1PYVA 5LLQA 1WI9A 3FF5A 3QPTA 4PJJA 2X51A 3GWZA 1KU9A 5B1AH 2LLKA 1R9TJ 1ONVA 2VBXA 3PUBA 4Q48A 2JA8J 3GMEA 3RQ4A 1K4SA 4LD5A 4A3LJ 2OC6A 2W82A 3T1BA 1GLNA 2TDXA 2RVCA 3SZPA 5C3EJ 2UV1A 4B47A 4XLHA 2R7FA 3TGNA 1ZRDA 1L3LA 1XSVA 3T8RA 2W7NA 1QA6A 1IV6A 3I5UA 2EV0A 3LSRA 4O3MA 3GXOA 1I1GA 2EIMH 2WB1A 3D5RC 4JQFA 2PQ8A 4I98B 1XSXA 4RAYA 1IDZA 2BW3A 4KJZA 1S3JA 3PL8A 5E3NA 4JOMA 4RB0A 5KK1A 4PCQA 4IPAA 3CLQA 3WGIA 4HOBA 4MFDA 2RGVA 3F9KA 2PI0A 4UUSB 2ZJPF 1OJLA 1U78A 4KN4X 1VQMI 4RGRA 3DWLE 2W48A 5BOXA 4MHGA 1J0RA 2OU2A 4XICA 1QU3A 4MQ9F 4OOIA 3P9KA 2A05A 2P5VA 4M6VA 4Y4RA 2E5NA 3GYHX 4EJWA 4B43A 2MD5A 3MWMA 2VBYA 2LF7A 4EEFG 1TQIA 3LSGA 4MGRA 5HLHA 3LA3A 1JTXA 1SVOA 1H88C 1LDKB 4I0BA 3PFYA 4XSXF 1BOBA 5D8KB 1O7LA 4HSRA 2V6CA 2QBYA 2FU4A 3V8JA 3NEUA 1F9NA 3CUOA 2R5ZA 3REOA 3OOUA 3JRCA 4L0YB 1LDJA 2P5KA 5CVVA 2HDDA 2WAFA 1FNNA 2EQRA 4O6JA 1MKMA 2PLYA 2NOJB 2H27A 3MZHA 4XLNF 1RPWA 2R4GA 2QKMB 5ED4A 3KLNA 1MBHA 2ETHA 3I53A 5B3SH 1WJCA 1FBUA 1T8IA 3TDUC 5EEGA 3G1OA 1JXSA 3P5JA 1KYWA 5E3LA 5LRSA 1STZA 1X3UA 5DUKA 2GXGA 1U8RA 1D0YA 2VOOA 1MD0A 5EEAA 5LBQA 3HM5A 2ZXIA 2YUSA 3L2QA 4IHVA 3FISA 2P7VB 2XPWA 3RPUD 4H0EA 3F0CA 3LSMA 2F48A 4PJLA 3GUDA 3M8FA 2ME6A 4HNTA 2E1OA 3VODA 4KFCA 1TWAJ 2HXOA 1YE9A 1O7FA 2OCCH 3PO2J 1D5YA 2QF7A 5HDKA 1E17A 2EFQA 3WTVC 1QVUA 4WX9A 2Y48A 1IRFA 3CP8A 3GTKJ 3H0GJ 1ZTRA 4OINF 3P9IA 3S17J 4AD9A 1P6RA 1MMAA 1OPCA 3QYBA 4BJTA 1TQPA 1VFCA 3OS2A 3QOEA 2OUMA 2A68F 2F5VA 3OIOA 2MH9A 2COBA 3B02A 4UY8I 1JT6A 2O0YA 3FBIB 2X48A 4K2EA 2LMDA 4BUPA 2R7SA 2XSDC 4ZC3A 1EA3A 2PN6A 3CF2A 4G8XA 1WJBA 1OFCX 3WE3A 1FOYA 3WTUC 5ERIA 3DU6A 1V55H 1XMAA 4PSXA 4UB6C 1HXDA 1XD7A 2IA2A 3IWFA 4U0VA 3A2KA 4BS9A 1ETYA 2IXSA 1T95A 4M3GA 1JI8A 1FBQA 2I10A 5CJ9A 4ESBA 3FHNA 3QP6A 2R7OA 3SFIA 4OWRB 1JKPC 2QEXI 3S1QJ 1YS7A 3S1RJ 1P7JA 1OYYA 3HBLA 2M9HA 3RKQA 4ZZDA 1H0MA 3MCZA 2ZNYA 1FPQA 3BROA 4MEXF 3OL4A 1B59A 5K5QA 1JTYA 2L4AA 3RIRA 2PEXA 2BV6A 2KZGA 3FXLA 1EH6A 1JKOC 2PG4A 2DFHA 2VPRA 3K4LA 3CDHA 2V1XA 4YRVA 4II3A 2X4HA 3ZQHA 1ETKA 2M8GX 2IRFG 2A6HF 2NS7A 3KZYA 5K7FA 2XGDA 1FOWA 5DEQA 1Z77A 2ZFUA 1FP1D 2DK5A 3IH3A 1R71A 4LK1F 4ETSA 1VQ7I 3I56I 1SD7A 3MKWB 2MLKA 2Y9YA 3I59A 3W2WA 1Z3YA 1OCPA 2XC7A 3F72A 3GEZA 1NK3P 3K10A 1FWZA 4EGZA 2ZSIB 1IUFA 2QCOA 1ZLKA 1R1TA 3FM3A 2Y0MA 3BOQA 3GVAA 1SVLA 3ERED 1TP4A 2P6TA 4DOZA 3RKXA 3CMAI 1K4TA 3A0BC 1X2MA 1XTAA 1JHHA 2K9MA 3W6VA 1G2HA 3GW2A 2BHZA 2GA2A 1WKMA 3SZTA 4P96A 4AIHA 4RAFA 2WV0A 5H2FC 4FQGA 1LVKA 2CU7A 2HDWA 5LGTA 5JR3A 3FHZA 4MNUA 1LE8B 2M7AA 1O4XA 4YFXF 4HEA2 3CC2I 2Y0SN 3IL2A 4FE4A 1KYZA 3M8EA 3H9JA 5E1ZB 5B5EC 4AC0A 4EV0A 3HOSA 4JX4A 3CQZJ 3ZN0A 4GCVA 3K2AA 2QSFX 3IH2A 1WCMJ 4BXFA 3KP3A 2R7WA 1TC3C 2VN2A 1WRJA 4C3JJ 3C18A 1B9MA 1XMXA 3RPQA 1I6HJ 2DTRA 2G7HA 3CZ6A 4HLXA 2EK5A 1Z9CA 5JLXA 1YJ9I 3FXRA 3G1MA 1T08B 1MNMC 3W2VA 2JT1A 2BHYA 4AUXA 3W6KB 2EV6A 3NARA 5M5WJ 2CQNA 1FZPB 2EFNA 2B0LA 2DU9A 4GO1A 2A6TA 4R1HA 3A01B 3F8CA 3JRHA 2P6SA 2EFOA 1XB4A 1ON2A 1ITYA 2FE3A 2ZMEA 5FGMA 2XF5A 1ETWA 2LG4A 1YJWI 1RUOA 3BR6A 3VFZA 1U8BA 2A5WA 3WGHA 2M0MA 4N0BA 2NVYJ 2DYRH 2O8KA 1BR4A 3JAMZ 3BDDA 1Z7UA 1JUSA 2QQ8A 2VT3A 2XHKA 3HJEA 2VE8A 1HKSA 1MJBA 4N4NB 1Z6RA 2XF7A 2XAQA 4XKBA 1VQ9I 3IRRA 2PMZN 2OTJI 5HS9A 5HVQC 1ON1A 2E2JJ 3ZQLA 4LJZF 2FNPA 4O5VA 4AYBN 1ZQ3P 3HHHA 3P9CA 3JTHA 3CMYA 4IL6C 1Y0NA 5FLXZ 2JSPA 3K1NA 2NXNB 2XAUA 2HQNA 3IH4A 2ZBKA 4FX4A 5HODA 1FOKA 1D8KA 5A2QZ 1U5TB 2GA1A 3D5SC 3K4NA 3OIQA 3KZIC 5C4XJ 4PZJA 3RZOJ 3HTSB 3MKYB 1TT0A 2EINH 3U1KA 2CUJA 5L3EA 2IVMA 2K02A 1ZGWA 2KKOA 2R93J 4FETA 1TW3A 1J2XA 1ETOA 3SQNA 4XNFA 4CSWA 1NK2P 3LL7A 4IJAA 5LEJA 1KQ0A 1BOAA 2XAGA 1YW8A 1NH3A 4BY7J 3S3OA 4RB3C 1I3QJ 3CCJI 2CV2A 3GTPJ 2LY2A 2VKDA 1FSHA 2A3SA 3RYPA 1DGWY 1J75A 3ULQB 4E4HA 4II2A 3RKWA 1SMYF 2E1NA 2JPBA 1UJ8A 4A3IJ 2IGNA 2X85A 5K5RA 1W7PB 5E1XA 3OSGA 4IQJA 1MMGA 4EM0B 4RGSA 4L0ZB 1V5EA 1PUEE 1V5GA 2UXXA 2VT2A 5DYMA 3I64A 1A6QA 2JA7J 1FIPA 1USTA 1UHMA 3LFUA 3X2QH 2HTJA 4JX6A 1EKEA 3LSKA 3DLLF 1A04A 3T8TA 2IS4A 1SAUA 5K7ZA 2XGXA 2YR2A 2HQRA 1RZ4A 1R5HA 4XOTA 3D5LA 3HSEA 5D6EA 3HXLA 2Y0SA 2O7OA 4UVAA 1A5JA 3ASNH 2X0LA 1ZREA 3CUQB 4CO8A 4HV5A 2NVQJ 4LFUA 1XX5A 5L3DA 3GO5A 3HPGA 1OR7C 3NWSA 1FBSA 4NQWB 2IA0A 2X6YA 4AIKA 3C2GA 2R5YB 3PFIA 3IP4B 3CCEI 4A93J 2JRTA 1HSJA 2L0KA 2W24A 4I02A 5KNLA 1VI0A 2L7FP 4TV7A 4BEHA 4BKXA 4QSHA 4ZYDA 3FDYA 4CDGA 1WHUA 3OYBA 3RSNA 3I4MJ 1WJDA 2NAZA 2R0QC 1FYMA 2DO7A 4A3GJ 2DYSH 3VYUB 4F7ZA 1BM9A 3OS0A 3WG9A 2CG4A 2KJCA 3KP7A 5FLVA 3E6CC 5J8FA 3CJNA 1ZGJA 1Y6IA 1PUFB 4NBQA 4M3EA 4LOCA 4CZCA 2XB5A 3G3ZA 4W97A 5GPAA 1B9NA 2XB0X 3J80Z 1PP7U 3JAMK 2R7VA 2C6YA 4XLCA 4KT5C 2NVUB 3FXJA 3PSFA 2Z1DA 2CSOA 5DCMB 4MTDA 2H94A 3AG3H 1X1BA 4XBFA 2PMZA 1YOVB 5D6FA 3OYGA 4G7OF 1FP2A 2XF6A 1Z0XA 1VQKI 2ID6A 4EJUA 4AYBA 3V7CA 2CQQA 2ZJQF 1MDMA 1UG0A 3GZ5A 5FLXK 3K0LA 3J81Z 2ZO4A 2Z2SB 5EG0A 2LTPA 3ERMA 3RYRA 4BJ5C 3CESA 2VPLA 3KLOA 4HYEA 3LMMA 1NG6A 2E71A 5A2QK 2FXAA 4PDKA 2YS9A 3LA7A 4XRMA 2LKSA 4HDUA 1BI0A 4B09A 2JJ7A 3O8GA 2ELHA 3ML6A 3WU2C 2V1UA 2CO5A 2D5VA 3M07A 2R7RA 3DPUA 1REPC 2PJRA 4BQAA 2XRLA 1UCRA 4NB5A 2M45A 3JCUC 3KIOA 4L9NA 5EJCA 2H8RA 4EJTA 2ID3A 2XAFA 5GTIC 1K78B 4KMFA 1FTZA 4A0XA 1TW2A 3PM1A 3HUGA 3BLYA 5ICEA 1XCVA 4PGGA 2OQRA 4S04A 3GZ6A 4UUVA 1H89C 4L5JA 4IO9F 3E5QA 3G2BA 4F93B 1RUNA 1Z21A 2JA2A 3KZZA 3HL2A 4L9TA 1SFKA 5ICGA 1HA8A 3PIPF 1Q1VA 1W4MA 2QVOA 3HIFA 1U3EM 1IN5A 2CQKA 2AHQA 4KICA 3WTYC 2DMPA 3VYTB 1BA5A 4DGWB 4ENNA 2ADUA 3V8LA 1RETA 2H6BA 1SFUA 3Q0VA 4PJMA 4J19A 2KHMA 2J5OA 4CXFA 3EUHA 4A3FJ 2YU9J 1QQIA 3L00A 3BG9A 5KCMA 4QPQA 2RAEA 4A69C 3OYAA 2D2WA 1ZLJA 3LSPA 3TL4X 3SXYA 5ICFA 5J1UA 2XDVA 3HKZN 2KMUA 3DTKA 3HC7A 2DW4A 1LFBA 3RTRA 1XSDA 2DOAA 1B1BA 1BJZA 3N97A 1ZR4A 3CF5F 4BHBA 4HBLA 1ZELA 5FFXA 4DJAA 1LB2A 4MIMA 2EBIA 2BY1A 2E60A 1SD6A 4I01A 5KAIC 2KPMA 2KLOA 2JPCA 5KAFC 3TKYA 3IRQA 5IY5H 2JSCA 4G6TB 5L3FA 5F0CA 3DXJF 2DA4A 3ROUA 3J80K 3F6OA 3GTGJ 2ZSHB 3LWFA 2KRHA 2X9DA 4BDYA 4IX7A 3CO6C 5FB2A 2FSWA 2ME0A 1V3FA 3FK6A 2EJRA 2ZXJA 3GFIA 2HYJA 2OA4A 4BE0A 2AO9A 3C3WA 3TOBA 1WQ2A 5CVRA 3R4KA 4B1RA 1H9TA 5J4YA 1D0ZA 3AG4H 5DD4A 1G8XA 4EJOA 5JLWA 1YS6A 2JTVA 1LUJB 2L02A 2LVSA 3GTLJ 2HKXA 3FM5A 1IW7F 5CVJA 2K5CA 3SDBA 4E7LA 5HS8A 3IKVA 4BNCA 3R0AA 3KP4A 3JRDA 3IAM2 1X19A 1F36A 4KISA 1T98A 1W5CC 1BIAA 3H5AA 2YU3A 1JJ8C 4XLEA 3F8BA 1SAXA 1POGA 2UUZA 3TW7A 1SFOJ 2BVLA 1A36A 1SFEA 2LF8A 2VIXA 2QGUA 1K83J 1WPKA 1D0XA 2GOXB 4BL0B 1H8AC 2OCEA 5DV5A 5IOYA 2JUCA 4Q4ZF 4YFNF 1HCRA 1XN7A 2BBYA 2IW5A 1BI2A 4G7HF 1TWFJ 3S2HJ 3ZQQA 2W1OA 1S6LA 1UZCA 2MLGA 3RCOA 3KE2A 1ZG1A 2LKPA 1O3QA 2L2OA 1I5ZA 2G7UA 1G6NA 4FX0A 4LLNA 1O57A 3Q9SA 2BW3B 3FMSA 1D1CA 3VOEA 4DZPA 4M3DA 3M3YJ 3VDXA 1MBGA 5AONA 5GAEJ 1ORKA 4BDZA 3GFMA 5LD2C 3KYCB 2JUGA 5E18F 1ULYA 5J6XA 1ZKGA 3JRBA 3JREA 2R92J 2R7DA 2GQQA 5F64A 1E2XA 3MQ0A 3HOXJ 3ZCOA 1T0FA 2CS3A 5HLTA 2M1BA 5DD8A 4L9JA 3MD2A 1LFUP 1WZ2A 4Q5SF 2AS5F 3BTIA 1IUYA 3UR3C 2F4MB 1MMSA 3HHGA 4AVZA 2QM3A 1VF9A 4ANJA 4ZDPA 4ENJA 5BS6A 2RQPA 3N4MA 3HOUJ 2OD5A 3F6VA 3IHUA 4UXNA 4WXCA 3E0JB 3FXKA 2QWWA 4IOCF 2O6GE 3H9GA 2FX0A 2H1LA 3SJMA 5GPCA 4E7HA 4AU7A 3HGYA 2JA5J 2QBYB 3CC7I 2NOGA 1S72I 5IP7J 4RM3A 3HKZA 2GXBA 3KEYA 2HFHA 4PGHA 4DBRA 4JP0A 4CYDA 2MSYA 1Z6TA 2XAHA 3BR5A 3QAHA 2Z3YA 2VKEA 1Z3XA 2M5WA 4XIDA 1T2KA 3HZJA 5FO5A 4DZJA 1MNEA 2GLOA 2J5PA 1HDPA 1OCZH 2E35A 3GLLA 4UUSA 5LHGA 4XMYA 3JSPA 3FKIJ 2FOWA 5LHHA 4ZYHA 3PNYA 3FMRA 5JFRA 1OKRA 3K4BA 4B4CA 1IV8A 4R8HA 4CCMA 4XM3A 3HEFA 3ABUA 4G7ZF 4I76A 4IOAF 1GVDA 1WFXA 2MGQA 1RI7A 5E3MA 1Q1HA 3PUFA 2DMQA 5HS7A 4E70A 2XKOA 4I09A 3GFLA 2JMWA 5FKOA 3HG9A 1BJAA 3WTZA 5IOZA 4LLGF 1MMNA 3A02A 2LBFA 3ECOA 3BTLA 5L3BA 1D8JA 2PMUA 4B3XA 4IRIA 2DA3A 5CPRB 5LGUA 1IAWA 2BOLA 4G12A 4KA4A 5TISC 4E6KG 3PIOF 4BGDA 1IN4A 2WY7Q 4HV6A 1YJNI 1AOYA 3HSFA 3BY6A 1UB9A 2X6OA 4RS8A 3HGGA 4D9JA 1R4NB 3WTTC 2P7CB 1BIBA 5D4RA 3DQVC 4HNVA 1EH7A 5ILSA 4OMZA 3V7RA 2KZVA 5DTDA 2CUZA 2QQ9A 4YIIA 3U1DA 4EMSA 2MABA 1R23A 3K7AJ 2VB6A 4KIFA 5ILVA 2ACJA 1O3SA 2K7LA 2DPDA 2X1CA 2L5QA 4R79A 3ZMUA 2P4WA 3TEDA 1IN6A 2CJJA 3K4MA 1G59A 1T56A 4UVCA 1OYIA 5EYRA 5HDGA 3E6BA 3CTAA 3OMYA 4YIFA 2EFPA 5FKKA 4GDFA 1SFXA 2YSRA 2OZ6A 1XCBA 4IRGA 1TL8A 4ENMA 1KGSA 1U2WA 2IA1A 2DODA 1IRGA 2DI3A 2L7KA 2CUEA 4P9FA 4C9YA 1R49A 2A61A 1SANA 3FKJA 1ZRCA 2GBYA 1W0UA 3MZYA 5D5VB 1Z05A 1HW5A 2WV1A 3E7LA 3F8NA 3K4CA 3EUAA 4Y13A 2L9SA 3OV8A 2B9SA 1B8IB 3DV8A 3IAS2 1B72B 1BW5A 3QPLA 1DU0A 3BWGA 2ECCA 4F52A 2A07F 1BN5A 4XKCA 5IYCJ 3BR2A 3ZQFA 5DCFA 2DQLA 4W1UA 1IRXA 4A3DJ 2ICWG 3KCCA 2HGCA 4UUTA 1X3WB 3LSHA 5BQTA 4LMYA 3BP8A 3O2PE 1BL0A 3KYLA 1S7AA 3DPTA 3PSIA 3ZRGA 3H5NA 3FXMA 4KIBA 3S1MJ 2YPRA 3CC4I 1ACIA 1XDSA 2IGKA 4HA8A 3GTQJ 2NRAC 4GFBA 1D3YA 5CKTA 2HR3A 3CCVI 5DM6F 1ZHFA 1HW1A 4Y3OA 3LSTA 3GF2A 2WADA 2CH0A 4G6DA 1ETVA 4A6DA 1IO2A 4XR6A 1TNSA 2K86A 2QQAA 1X1CA 1O3RA 2WAEA 2F5CA 2BZTA 2M2EA 1U6GA 1JE8A 2ISZA 2Y31A 3MKZA 4A3CJ 2XPUA 1OCTC 1MBFA 2XROA 3S8PA 2HQAA 1HSTA 4UV8A 1L0OC 2DT5A 4KN7X 2BEOA 3BG5A 3TQNA 2IS2A 1E0EA 1CF7B 3BQYA 5K1YA 1MBKA 1P4WA 2BY3A 2EWNA 1K6YA 2K9NA 3LSJA 3U21A 5DDGA 2FF4A 3BJOA 5AIQA 5AIPA 2R3SA 3RI4A 2VQLA 2EH3A 5J3LA 3V4GA 4U7DA 5JVTA 4UHTA 1J7KA 1F1ZA 5FD6A 4G94A 1B4AA 3HYIA 4RGUA 2PJPA 3E6DA 3WG7H 4HQEA 4MO7A 1V54H 3DKWA 3EPZA 4IHWA 2ZNZA 3KYDB 4A3EJ 1PVEA 2L9RA 2XAJA 4AM3A 2GIVA 2ZB9A 2F5EA 2ZCWA 3JRAA 3BQZA 1MGTA 4CA0A 4DW6A 2LD5A 3G4SI 3QPHA 1QGPA 1R5ID 2HI3A 2GWRA 4XRSG 4IHXA 3NWTA 1FEXA 3H3ZA 2LFBA 2V9VA 2O3FA 2GIZA 3FXUA 4HRIA 3MZ8A 2OF7A 4NHJA 2ZJ2A 3L2RA 1DGRM 1KU2A 1USSA 1D1BA 4A5NA 1FIAA 3EETA 1LJ9A 3HSRA 3DF8A 3ASOH 5FKNA 2EFWA 2ECBA 1RKWA 3BZKA 4GRIA 3J7AY 2AXLA 3NRVA 3ABMH 1EF4A 3AL0C 2OPTA 2EPFA 5IP9J 2VKVA 1YRNB 2Q8KA 3EQLF 1O3TA 5TRDA 3QWLA 4ESJA 2VJJA 1QRYA 3E5UA 3GFJA 1MH3A 2L01A 3IC7A 3RJPA 1EV7A 1UHWA 1HOMA 4IKFA 5HLIA 3TDZC 3R6SA 2EZHA 4EQQA 1Z67A 1YW9A 2WAQN 2H6CA 1AKHB 1QPIA 3L9FA 4CGZA 5J40A 1WH7A 2IGMA 4CUGA 2W57A 4F91B 2QENA 1VQLI 2VASA 2DAOA 3M1EA 3E5XA 4HNUA 1BI1A 5DUIA 1IG7A 2MA3A 1QNTA 1MMDA 1S5LC 1Z7LA 3CJQB 2V26A 2M0CA 4KUMA 2ZJRF 4Y7NJ 1RR8C 2MG4A 1YQAA 4NUBA 2FBHA 5FKMA 2VONA 5DS9A 3DEUA 1B6AA 4E7KA 2KL4A 1SD5A 1WJ5A 1H9GA 2ZXWH
chains in the Genus database with same CATH topology
1AA7A 1YX5A 2LOOA 4C30A 1Z21A 2JA2A 3HL2A 1SFKA 2X1EA 3F9KA 1HA8A 1J09A 3VYRB 1FMVA 4CCOA 3TBIA 4HSTA 3DWLE 3VYTB 4NNJA 4N4OB 4XLFA 4NC8A 4DGWB 3QODA 1V5FA 2AQEA 2M3AA 3ZR8X 1QU3A 3A4CA 4PJMA 2KHMA 5HOOA 3K6GA 4Y4RA 4ZTJA 2E5NA 4B43A 3DLAA 3HOTA 3OYAA 5KCMA 4QPQA 3IUOA 3LSGA 2MYSA 1LKXA 2F6CA 3SYTA 2R7XA 3TL4X 1LDKB 2V1NA 3PFYA 3OYCA 2XDVA 1BOBA 3OIPA 4HSRA 4X0GA 2KMUA 3DTKA 3HC7A 3BC8A 4F93B 5CQEA 3RTRA 3S93A 4BEHB 2DOAA 3OOUA 4F3QA 2CV1A 2WAFA 4DJAA 1ZELA 2NOJB 2E60A 3AFHA 2R4GA 2KPMA 2QKMB 2KLOA 3OYKA 1WJCA 4G6TB 3OYDA 3A1YA 3C2HA 2ZSHB 4PJNA 2KRHA 2LYCA 4BDYA 4IX7A 4E7IA 3M8JA 1D0YA 2HPIA 4BE1A 4YEJA 2DCEA 3GBGA 2ZXIA 4HPQA 3H0DA 4BE0A 2HVRA 4BJ6C 3L2QA 3BCAA 5TGTA 3VSKA 3RPUD 3LSMA 1D0ZA 4PJLA 2E1MB 3OYEA 1G8XA 4J00A 4HNTA 1WJEA 3SEZA 4PUSA 3OR2C 3OYHA 1YE9A 4CCJA 3OYIA 4BE2A 3TMOA 3CP2A 1TZLA 3SDBA 2HVQA 4E7LA 2K5CA 4J01A 2IGOA 3S3NA 4CCNA 3PJRA 3BG6A 1X19A 3CP8A 3IAM2 4B48A 3MMYB 4KISA 3H5AA 2WA0A 4F92B 4XLEA 1MMAA 2UUZA 3K70D 4IZZA 3QYBA 4BJTA 2BVLA 3OS2A 3QOEA 2OUMA 2O5RA 2VIXA 1QHGA 2F5VA 1D0XA 2GOXB 4BL0B 1W36D 2Q1ZB 3FBIB 3VSLA 4BUPA 2R7SA 4ZC3A 1EA3A 2OV7A 3ZQQA 2W1OA 1DP3A 3CF2A 3RCOA 1WJBA 2I8DA 3QYFA 2L2OA 2M7BA 3DU6A 4XQFA 5LFAA 4PSXA 3CJRB 3A2KA 4BS9A 2BW3B 2IXSA 1D1CA 4DIQA 1T95A 1JI8A 3ZGKA 3FHNA 3VDXA 2R7OA 3QYEA 4OWRB 4BDZA 5LD2C 2JUGA 4LG3A 1R6RA 5CQGA 4BQOA 2IS1A 3OL4A 4P1WA 3ZCOA 2FUG2 2CS3A 5HLTA 4ZDLA 3MD2A 1X1DA 3VWBA 2M4GA 3UR3C 3H9QA 2DXIA 4B44A 4AVZA 4ANJA 4ZDPA 2VLAA 3K4LA 4YRVA 2AQFA 4II3A 3E0JB 4CCKA 5FRMA 4H4KC 4PFPA 2JVGA 3H9GA 4RLQA 2VXZA 4AU7A 4E7HA 1WJFA 2MD0A 2ZFUA 4RM3A 3HKZA 3K70C 3KEYA 4DBRA 3OL3A 5KHDA 4XKWA 2Q2EB 5HNFA 3MKWB 1Z3XA 4LIUA 4CH7A 4E7ZA 2LREA 1W36C 3W2WA 1Z3YA 2XC7A 2DT7B 3DU5A 4OAYA 1MNEA 3K10A 2ZSIB 2E1MC 3H5RA 4XMYA 4ZDOA 2WY8Q 1LFPA 3PNYA 2VL8A 4DOZA 3PL8A 3CMMA 3OS1A 3OWTA 3M1CA 3K4BA 2K9MA 4CCMA 4XM3A 3VYSB 4XN0A 4C2UA 2X6WA 2DT6A 4PSWA 1WFXA 4ZJZA 3OYNA 3DKYA 1LVKA 2HDWA 2M7AA 2W4SA 4HEA2 3HG9A 2VQGA 1MMNA 3H9JA 3HPHA 2LBFA 2CW7A 4XOPA 2RNGA 3HOSA 3V42A 3L2UA 4B3XA 5CPRB 1PJRA 3I9V2 2HZDA 2BOLA 4HG2A 4XLAA 4BXFA 2R7WA 4E6KG 1BR1A 3OYFA 4BGDA 2WY7Q 3CZ6A 4FASD 4D9JA 4LIVA 1X4PA 3DQVC 3W2VA 1X4OA 2HVSA 4XORA 2KZVA 2CUZA 2MABA 2A6TA 3BCBA 4PFOA 2V9KA 2VB6A 1DQUA 2BVMA 2X1CA 1X1AA 2LG4A 2XF5A 2L5QA 3DTEA 2PJRB 4R79A 3E1SA 2A5WA 3UNGC 2M0MA 2WAQA 2VQHA 4EATA 3S32A 1BR4A 3K4MA 1G59A 4PK4A 4N4NB 2XF7A 2CW8A 3OMYA 4XKBA 1D1AA 1N75A 1OLTA 3W2AA 4IQ4A 5HVQC 3PNTA 3K4JA 3HUGB 4ZYAA 3AKZA 2L7KA 4C9YA 2JSPA 4BQQA 2XAUA 3FKJA 2X1DA 4YELA 3K4KA 3D5SC 3K4NA 2VKHA 3OIQA 3K4CA 3EUAA 3LSIA 1TT0A 3MKYB 2L9SA 3PNVA 3BG7A 2CUJA 3IAS2 2ELJA 3DKXA 4E7JA 4F55A 4FETA 3I3LA 1MW7A 2KRCA 4KITB 1U0JA 2MC4A 3OYMA 3DEEA 4F52A 2L9NA 4XKCA 1N77A 1IRXA 2E5ZA 4XNFA 4CSWA 4BQNA 3LL7A 2HU9A 3ZXSA 3LSHA 2KDOA 2RQQA 3S3OA 2CV2A 2LY2A 2VKDA 3KYLA 3PSIA 3DPTA 3ZRGA 1DGWY 3OY9A 2IS6A 3H5NA 2VJIA 4E4HA 2K9LA 3KX2A 4II2A 4CCLA 2IGKA 3DPLC 2R7QA 4XL9A 5CKTA 2W00A 1UELB 2HNHA 4RMNA 2LH9A 2VXDA 2IGNA 2X85A 3OYJA 4Y3OA 3OYLA 3ONQA 2WADA 2CH0A 4IQJA 4P5OA 1MMGA 2XSJC 2F4IA 4XR6A 1V5EA 1V5GA 5HNHA 1X1CA 5JHFA 2WAEA 3N05A 2R7TA 3LFUA 3SEQA 3MKZA 2LY1A 3LSKA 3H35A 3L2VA 1NG7A 2IS4A 1SAUA 3S8PA 2HQAA 2WBMA 2VJ5A 4XOTA 3D5LA 1QHHD 1WJAA 3DTIA 3HXLA 2Y0SA 4ITVA 2IS2A 4D1QA 1E0EA 4XN3A 2LBFB 1K6YA 3U21A 4ZTFA 3HPGA 1KONA 1OR7C 2VQLA 3NWSA 2HPMA 4NQWB 2X6YA 2QKLB 3C2GA 4Y33A 5FRNA 4DBQA 3IP4B 2M4KA 3FBNB 2CMPA 4RM2A 5KNLA 4KT6A 4BEHA 3FDYA 4BU2A 3OYBA 3RSNA 1WJDA 3EPZA 2UWMA 1P9QC 3SZGA 3VYUB 1VZ0A 3OS0A 2VQCA 1Y6IA 1S9HA 4XKVA 4CZCA 1MNDA 1BR2A 4QPOA 1ERDA 4LITA 4CA0A 4BACA 1T0FC 2V7FA 2R7VA 4XLCA 4C2TA 3NWTA 2MFZA 2LC2A 2Z1DA 3PSFA 1X1BA 2GOMA 2P0WA 2PMZA 3OYGA 4HRIA 2KQRA 2R7UA 3W3CA 2XF6A 3EUKL 2ZXHA 3L2RA 1DGRM 3EUHC 4U87A 1D1BA 4AYBA 1UG0A 3L2WA 2VJ4A 2Z2SB 3J7AY 4GRIA 2CFOA 4BJ5C 2VPLA 3CESA 3LMMA 1NG6A 3AL0C 4OAZA 1N78A 2V6EA 2CV0A 5FROA 2JVHA 3S3MA 2KP6A 1UAAA 1FMWA 2V4JC 3OR1C 1PYVA 2VJJA 4PJJA 2K3PA 2X51A 4XONA 4IKFA 2RREA 3PUBA 2X6XA 1Y56A 3DPUA 4E7SA 2R7RA 2PJRA 3RQ4A 2OC6A 2IGMA 4CUGA 4F91B 2W82A 2DJIA 1GLNA 4U7BA 2VASA 4NC7A 4HNUA 2UV1A 4B47A 4XLHA 4RLFA 1MMDA 2W7NA 1Z7LA 3CJQB 2V26A 4MLOA 2WB1A 3D5RC 4JQFA 1YX3A 4NUBA 3BLYA 2BW3A 3AL0B 2Z16A 4KJZA 4E7KA 2KL4A 1WJ5A 2LRDA 3G2BA 4JOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL3 A;  3OL4 A; 
#chains in the Genus database with same CATH topology
 1SD4 A;  1AA7 A;  2LOO A;  4C30 A;  5D4S A;  4C3I J;  1EJ9 A;  3QPS A;  3J7Z I;  2X1E A;  1J09 A;  1U5T A;  3MVP A;  3VYR B;  1FMV A;  4WK8 F;  2QYO A;  3TBI A;  4HST A;  5JHU A;  4LGW A;  4NC8 A;  4QLC U;  3QOD A;  1V5F A;  2AQE A;  1F43 A;  3MN2 A;  2FBI A;  3IV5 A;  1YHQ I;  3K6G A;  4ZTJ A;  3BPX A;  4IVN A;  1HKT A;  5F0H A;  1MSE C;  3FWE A;  3HOT A;  3W6J B;  3IUO A;  1WWX A;  4KIG A;  1LKX A;  2F6C A;  3T5X A;  3SYT A;  5GTH C;  1IGN A;  4OMY A;  4D7N A;  1KU7 A;  2R7X A;  1GV2 A;  3OYC A;  3OIP A;  3FXQ A;  2OTL I;  2NVT J;  2BE5 F;  3BC8 A;  2XKP A;  4RGX A;  2V9P A;  2MW8 A;  1UG2 A;  4X1E A;  4BEH B;  1C0W A;  2CV1 A;  1LNW A;  3AG2 H;  2M30 A;  5EEH A;  2LSO A;  1W7P A;  2EZI A;  2QZ8 A;  4I0A A;  3NAU A;  3TO7 A;  2E34 A;  1K61 A;  1IXS B;  1FC3 A;  3AFH A;  2E7X A;  3HTU A;  4L5E A;  2MBF A;  1G4D A;  1RKT A;  1KU3 A;  4CZZ A;  3C2H A;  4PJN A;  5IPA A;  4RB1 A;  3DBH B;  4ABZ A;  4YG2 F;  2E36 A;  2DA5 A;  4E7I A;  2DN0 A;  4AIJ A;  2CQX A;  5D5W B;  4FCY A;  3K1P A;  1MJ9 A;  1JJ6 C;  1VQN I;  3CLO A;  2DCE A;  3GBG A;  3H0D A;  4OU0 A;  5K7H A;  2HVR A;  3CUQ A;  3I55 I;  1ETQ A;  2VBZ A;  5TGT A;  2JN6 A;  3VSK A;  3CCY A;  2XRN A;  2VUM J;  2L7M P;  4NQW A;  1KQ9 A;  2E1M B;  3OYE A;  2HYF A;  3V8K A;  2R5Y A;  3CDI A;  1E3P A;  4PUS A;  2ESN A;  2LDU A;  3OR2 C;  3OYH A;  4RDU A;  3E6M A;  2K4B A;  1IF1 A;  4CCJ A;  3OYI A;  3TMO A;  3CP2 A;  1TZL A;  4A5M A;  1X3Z B;  1YTY A;  4RA2 A;  4J01 A;  1GVJ A;  3ZOB A;  2K85 A;  3PJR A;  4CCN A;  2DTZ A;  5CYV A;  3O6B B;  4EM1 A;  4F92 B;  4BBR J;  1PUF A;  1YO5 C;  2DMN A;  3K70 D;  4IZZ A;  1X58 A;  1RES A;  3I71 A;  1F5T A;  2O5R A;  5M5Y J;  1G3Y A;  4LG0 A;  1W36 D;  2DOE A;  1Z91 A;  5H6R A;  5HDN A;  3VSL A;  5EDN A;  3CCS I;  2UXN A;  3FXO A;  5DCM A;  2KIU A;  3KET A;  5C44 J;  1DP3 A;  3MFK A;  1J9I A;  4XQF A;  2CWE A;  2HTS A;  2BYV E;  2EZK A;  3CJR B;  4ESF A;  4S05 A;  3HDD A;  3G6E I;  1I3A A;  4DIQ A;  1YG2 A;  2Q0O A;  2M8E A;  3M4O J;  3CCQ I;  5HLG A;  4HX4 A;  1R6R A;  5CQG A;  2COM A;  2RC4 A;  1VQ4 I;  4KYW A;  1ZN2 A;  4M3F A;  4V2F A;  2IS1 A;  2JK3 A;  2O8X A;  1G3W A;  4P1W A;  3ABL H;  1AU7 A;  3GX4 X;  2KFD A;  1I27 A;  2W25 A;  2M4G A;  3T0Y A;  1GV5 A;  2DXI A;  2HOE A;  5B1B H;  2CQ7 A;  5K5O A;  5FJ8 J;  6PAX A;  1XG1 A;  2VLA A;  4IRH A;  1R00 A;  1ZR2 A;  3EYI A;  1GUU A;  2AQF A;  5FRM A;  4U0W A;  4CCK A;  3B6A A;  3S14 J;  2R7Z J;  2STT A;  2EA2 A;  1K78 A;  3BR0 A;  3C1D A;  1WJF A;  1KA8 A;  2MD0 A;  1R22 A;  3BZC A;  2WB1 N;  4I99 C;  1NTC A;  4HF2 A;  1OQY A;  2CRG A;  2ISY A;  2I5U A;  2DLL A;  1E3H A;  2AXT C;  2Q2E B;  3CDL A;  3U2R A;  4E7Z A;  4CH7 A;  4D5C A;  5E8G A;  4HLY A;  4OAY A;  1PDN C;  5JI6 A;  2E1M C;  2JA6 J;  1LVA A;  2WY8 Q;  4LB5 A;  1F4K A;  3I54 A;  2FD5 A;  1IZ1 A;  3CMM A;  3OS1 A;  3M1C A;  3ABK H;  2HZT A;  1KQ8 A;  3UKG A;  4NC6 A;  3L7W A;  1HDD C;  3VYS B;  4XN0 A;  2KIQ A;  4C2U A;  2DA7 A;  2OZU A;  2X6W A;  2DT6 A;  4PSW A;  1A31 A;  4M6Y A;  4A0Y A;  4KDP A;  1MJA A;  3JSO A;  2HWV A;  2LK2 A;  4Z2Y A;  4BBS J;  2GAU A;  2VQG A;  3S2W A;  1IXR C;  4A6E A;  5EGO A;  1W7P D;  1P92 A;  4CIC A;  1XPX A;  3HOY J;  3HPH A;  2CW7 A;  4BXU A;  2K9Q A;  3ELK A;  3L2U A;  1MBJ A;  5F0F A;  4HG2 A;  4XLA A;  3TW6 A;  1KZH A;  3OYF A;  1W5S A;  1Y1W J;  2CYY A;  3J81 K;  3HRS A;  2BXZ A;  2ZKZ A;  4FAS D;  4FTH A;  2RDP A;  1ENH A;  5F1J A;  5E3O A;  1VQP I;  4CYC B;  1GT0 C;  5CVU A;  2E2H J;  3GZN B;  3ZN1 A;  1R4M B;  2HVS A;  2A6E F;  3K2Z A;  2F4O B;  1JKR C;  3DP7 A;  4PFO A;  2HOA A;  3H36 A;  3D0S A;  2FBK A;  2V9K A;  1JGG A;  2BVM A;  2NNY A;  3I4P A;  3Q0W A;  1X1A A;  3DTE A;  3BPV A;  3MKL A;  3ZMS A;  3E1S A;  2HKO A;  4EAT A;  3G73 A;  2OBP A;  3BTC A;  2NS8 A;  2KIF A;  4XRF A;  2EV5 A;  3WTW C;  4RB2 C;  4HDV A;  4U88 A;  2CW8 A;  1CQT A;  1D1A A;  1W1W E;  2MH2 A;  3RDI A;  3WOD F;  3ZP5 A;  2H8W A;  3QQA A;  1OLT A;  1GXP A;  3W2A A;  4IQ4 A;  2F5F A;  3K4J A;  5GAD J;  2STW A;  2OJE D;  3EDP A;  3GCM A;  3CO7 C;  5C4J J;  3AKZ A;  3MAJ A;  4CHU A;  1GDT A;  2RNJ A;  2X1D A;  4YEL A;  2D45 A;  1RC9 A;  4UV9 A;  3JW4 A;  1P4A A;  1BC7 C;  3LSI A;  1RNL A;  2DPU A;  2RV8 A;  4I6Z A;  1LPQ A;  4OIQ F;  3WGG A;  3R61 A;  4JK1 X;  2A5Y B;  1MW7 A;  2KRC A;  4KMU X;  4KIT B;  1U0J A;  2MC4 A;  3OYM A;  3KEO A;  4QTR A;  3JTG A;  2NNN A;  2L9N A;  1XGN A;  4EGY A;  3S16 J;  2E5Z A;  1I39 A;  1WH5 A;  2O61 A;  5GP9 A;  2HU9 A;  3ZXS A;  1YIJ I;  2XPV A;  1P2F A;  2Y69 H;  3GTM J;  3ABT A;  3KEQ A;  4GGG A;  3OSF A;  1OCO H;  1S29 A;  4M3B A;  1GXQ A;  3OY9 A;  2IS6 A;  2K9L A;  4A3M J;  2EA4 A;  2R7Q A;  1LEA A;  2R5Z B;  2CGP A;  2W00 A;  1UEL B;  2F2E A;  2LH9 A;  2VXD A;  2VOP A;  3O3K A;  2W84 A;  3TOA A;  2K9S A;  3ONQ A;  3L2C A;  4P5O A;  2F4I A;  4AWX B;  3H1C A;  1FJL A;  3P7N A;  3H92 A;  3N05 A;  3WTS C;  3F23 A;  3DFG A;  3LAP A;  4MQV A;  3F8F A;  3H35 A;  5LHI A;  3L2V A;  4I2O A;  2FML A;  2IEK A;  3BJA A;  1QPM A;  2NYX A;  2WBM A;  3C7J A;  1FY7 A;  2RKH A;  4GYI A;  5FFZ A;  1RRJ A;  3LAJ A;  3SHF A;  4DYC A;  4ITV A;  3DTI A;  1XGS A;  2HXI A;  5L3G A;  4D1Q A;  1OCC H;  4XN3 A;  1DPU A;  2LBF B;  3WU0 A;  3JRI A;  4M73 A;  4ZTF A;  1YYV A;  3L1P A;  1IXC A;  1IDY A;  1KON A;  3B6C A;  3FK7 A;  3PQJ A;  5FRN A;  5BPI A;  1YIT I;  3FBN B;  4Y17 A;  1HQC A;  4HZF A;  2PX9 A;  3VEP A;  3BR1 A;  2QUF A;  3C2B A;  2HS5 A;  4BU2 A;  2UZK A;  3ZQ7 A;  2M87 A;  2UWM A;  1P9Q C;  2QSH X;  4C3H J;  1D5V A;  2XUB A;  3LA2 A;  1ZGA A;  1R1V A;  1I6X A;  1XGM A;  5BMZ A;  1T6S A;  3OOP A;  5E1W A;  1ERD A;  3PO3 J;  1T0F C;  4M6X A;  1BI3 A;  3WHB A;  2V7F A;  1K7A A;  3FX3 A;  5KVR A;  4C2T A;  1JKQ C;  1LDD A;  4IHT A;  2LC2 A;  2KIS A;  5IYB J;  1R58 A;  2GOM A;  4EVI A;  4HX7 A;  3Q0U A;  4M9X A;  2KQR A;  2R7U A;  3EUK L;  3R60 A;  2DFF A;  4U87 A;  4ZZL A;  2QLZ A;  2Y2Z A;  2P81 A;  3I4N J;  2RN7 A;  3RQI A;  2DA6 A;  5M5X J;  3D1N I;  2Y30 A;  4OAZ A;  5CVI A;  2DJN A;  2FQ3 A;  2V79 A;  4B8X A;  2CV0 A;  2JVH A;  2L54 A;  3S3M A;  2KP6 A;  1S8N A;  1FMW A;  1UAA A;  2Z33 A;  3BTJ A;  5J47 A;  4JBA A;  4A3J J;  1JT0 A;  5LEK A;  2WC2 A;  2KT0 A;  2EB7 A;  2K3P A;  2VOD A;  4RAZ A;  4XON A;  4XLP F;  2RRE A;  2EIL H;  3S2D J;  2X6X A;  1Y56 A;  4E7S A;  5IP6 A;  1LQ1 A;  5F6F A;  1S7E A;  3M7G A;  5IT3 A;  1XGO A;  3CCM I;  3LNQ A;  2DJI A;  2XVC A;  4U7B A;  3U9G A;  4NC7 A;  1RIO H;  4DYR A;  2FJ1 A;  2Z5U A;  5TJJ A;  2NVX J;  1QZZ A;  4QIW N;  4RLF A;  2LNB A;  1IN7 A;  4IHS A;  5EZG A;  4MLO A;  1YX3 A;  3B73 A;  5IT9 Z;  2E7W A;  2FNA A;  4UVB A;  2HOT A;  2QA4 I;  3AL0 B;  2Z16 A;  3G1L A;  4D0P A;  1ODD A;  5F08 A;  2LRD A;  3M8J A;  3I59 B;  4FE7 A;  1YX5 A;  4UB8 C;  1JUM A;  3TP3 A;  3NQO A;  1Z1D A;  1XDU A;  1HC8 A;  4CCO A;  3K69 A;  1X2N A;  3LOC A;  4D7M A;  1FTT A;  1BW6 A;  1U9O A;  4N4O B;  4NNJ A;  3BZ6 A;  4XLF A;  1B8I A;  1B72 A;  1ZH5 A;  4M9Z A;  4Q47 A;  2M3A A;  2DA1 A;  2IJL A;  2VC0 A;  3Q3S A;  3ZR8 X;  3A4C A;  1TNT A;  3KFW X;  1YLF A;  5HOO A;  2CUF A;  5FKL A;  3K9T A;  3DLA A;  4M71 A;  1TBX A;  3ECH A;  1JUP A;  2MYS A;  3V7S A;  4RAG A;  3FMQ A;  4EJV A;  2V1N A;  1QZE A;  4X0G A;  3F3X A;  2KRF A;  2E19 A;  1XS9 A;  3JR9 A;  2ZFW A;  1FYK A;  3R0J A;  5CQE A;  3S93 A;  1FYL A;  2L3D A;  5FD5 A;  5EF6 A;  4JYK A;  4F3Q A;  3A03 A;  1Y8Q B;  3FIW A;  3VB2 A;  4B3A A;  2G9W A;  4P55 A;  4OIO F;  1R36 A;  3I0T A;  3ZQG A;  2DMT A;  2KJB A;  3CME I;  4A2U A;  1JGS A;  1A6I A;  2B63 J;  2BY2 A;  1TWC J;  3S1N J;  1MIJ A;  3OYK A;  2XV4 S;  4JX5 A;  4BHP A;  2BY0 A;  4BHC A;  4HW0 A;  3OYD A;  2NS0 A;  2FMY A;  3A1Y A;  5E17 F;  4S0H B;  1OYW A;  1T39 A;  2LYC A;  1LEB A;  3QOP A;  1YIO A;  2ZME B;  2FEZ A;  1MH4 A;  2HPI A;  4PK4 A;  4BE1 A;  4YEJ A;  1IJW C;  1CF7 A;  4HPQ A;  4IXA A;  4BJ6 C;  1LE8 A;  3BCA A;  3BR3 A;  2VBW A;  3ZMD A;  4YIR X;  4D5F A;  1XMK A;  4XRS A;  1IC8 A;  1ZRF A;  4IF4 A;  4J00 A;  1SMT A;  4FIS A;  1WJE A;  4L5I A;  3SEZ A;  3CD6 I;  3VPR A;  2BXY A;  4L18 B;  4DQ2 A;  4BE2 A;  2HVQ A;  3WHC A;  2IGO A;  1E3O C;  3S3N A;  4U0Y A;  3HOW J;  3BG6 A;  4B48 A;  3MMY B;  2A69 F;  2WA0 A;  1JHF A;  4BXX J;  1N25 A;  1ZAR A;  2QQB A;  4V2G A;  1ZK8 A;  2XIG A;  4WF2 A;  3H3U A;  1QHG A;  4A3K J;  2MC3 A;  3A01 A;  1Y0U A;  2Q1Z B;  1AWC A;  5J8C A;  3KPH A;  4P9U A;  1OR7 A;  2OV7 A;  3DCF A;  1J59 A;  1TT5 B;  3JRG A;  4N9H A;  2I8D A;  3QYF A;  2M7B A;  5BNG A;  5LFA A;  4HX8 A;  5IT9 K;  4ZYE A;  4I7H A;  1VQO I;  1EH8 A;  3ZMT A;  3LFK A;  1NHA A;  2IPQ X;  3ZGK A;  2VI6 A;  1TLH B;  1W5T A;  3QYE A;  3TO9 A;  4A0Z A;  1HW2 A;  2M34 A;  3BJ6 A;  1FOX A;  5IYD J;  2FA5 A;  4LG3 A;  2WWY A;  1YRN A;  4A3B J;  2Z99 A;  4ZH4 F;  3F8M A;  4BQO A;  4LK0 F;  2Y75 A;  1ZG3 A;  2TCT A;  3RZD J;  4KNY A;  2FUG 2;  2B7E A;  4LLL A;  1G3T A;  2K3F A;  2CW0 F;  4ZDL A;  1X1D A;  3VWB A;  1PP8 F;  1AHD P;  5H20 A;  5B66 C;  3H9Q A;  4A12 A;  4B44 A;  1AKH A;  1BBY A;  2LY9 A;  3WE2 A;  4G9Y A;  2PBI A;  5M3F J;  2WTE A;  4H4K C;  4PFP A;  3G71 I;  2JVG A;  4FT8 A;  4RLQ A;  5E20 A;  2VXZ A;  2V1D A;  1R5G A;  4DNC A;  3J7A O;  1FX7 A;  2ZME C;  3K1M A;  3LQR A;  3K70 C;  5J1R A;  3OL3 A;  1HKQ A;  1MSF C;  1VQ5 I;  1ZAO A;  3SDG A;  5KHD A;  4XKW A;  5HNF A;  2O03 A;  4LIU A;  3DBR B;  2LRE A;  1W36 C;  2DT7 B;  3DU5 A;  2HOS A;  2E2I J;  2DFI A;  3H5R A;  3PQK A;  4ZDO A;  5L3C A;  1TTY A;  1ETX A;  1LFP A;  9ANT A;  2VL8 A;  4XK4 A;  1GHC A;  2YX4 A;  1YFH A;  5BPD A;  4IHY A;  5ICC A;  4M72 A;  2XGE A;  4GXO A;  3OWT A;  3IWZ A;  3WU1 B;  4HF1 A;  1TWH J;  3BT9 A;  1P7I A;  1P4X A;  1R7J A;  2LR8 A;  4M9S A;  4ZJZ A;  3OYN A;  1T33 A;  4Y52 J;  4C2M J;  3DKY A;  3S15 J;  1UFM A;  2FQ4 A;  4AVP A;  2W4S A;  1W0T A;  5E8I A;  2ZC2 A;  5GAH J;  3HOZ J;  4HQM A;  2W85 A;  1TWG J;  3I58 A;  5H6Q A;  4XOP A;  5EZH A;  2K27 A;  2L9V A;  2RNG A;  1XC5 A;  3RKY A;  1UMQ A;  3V42 A;  1VQ8 I;  1PJR A;  3H3V K;  3I9V 2;  2HZD A;  1QBJ A;  2DA2 A;  3BG3 A;  1BR1 A;  5DM7 F;  3M9A A;  1TQM A;  1SC7 A;  1MDM B;  5D8L B;  2P8T A;  4L9V A;  2O9L A;  3CJT B;  2EIK H;  5EG0 B;  1M1E B;  2XAS A;  2DDB A;  4LIV A;  4QWQ A;  3EYY A;  1X4P A;  2F5D A;  3AAF A;  4Z6Y A;  2CFX A;  1X4O A;  4XOR A;  3SFZ A;  5FLM J;  1K6O A;  1HBX G;  5ILU A;  2H1K A;  3BCB A;  1U5T C;  5J4V A;  4LG0 B;  1SEU A;  1WSU A;  3J7Y J;  2JZY A;  1DQU A;  3GTO J;  1V4R A;  1FSE A;  4HF0 A;  1MBE A;  3GTJ J;  4ZYG A;  1DP7 P;  2PJR B;  1FLI A;  2L4M A;  2ESH A;  5F27 A;  3UNG C;  4Y15 A;  2WAQ A;  2VQH A;  1HF0 A;  2OAZ A;  3S32 A;  4YFK F;  1K79 A;  3LQQ A;  2DDA A;  2L7Z A;  1U9N A;  5GAG J;  2Z9O A;  1UHS A;  1N75 A;  1ZG5 A;  3A0H C;  1J5Y A;  3PNT A;  2DK8 A;  3GLX A;  2IAI A;  3HUG B;  5F04 A;  2QSG X;  5CLS A;  4ZYA A;  2DFE A;  1QZY A;  1DUX C;  4DYQ A;  2K4J A;  5LGN A;  1IN8 A;  2N8G A;  4BQQ A;  1OCR H;  1WVR A;  3MEX A;  3ZQC A;  2HQ5 A;  3K4K A;  2IBD A;  2VKH A;  1YI2 I;  4M74 A;  4OIP F;  3PNV A;  3BG7 A;  2ELJ A;  3DKX A;  1MZB A;  4E7J A;  4F55 A;  3I3L A;  5D5U B;  3ZQI A;  3HOV J;  3DEE A;  2JRM A;  4GYG A;  3TO6 A;  4NDL A;  1N77 A;  5D5X B;  2FOK A;  5JVG F;  2DOF A;  4MEY F;  4BQN A;  1T38 A;  3HB9 A;  2KDO A;  2RQQ A;  4ASN A;  1FT9 A;  2BGC A;  4WXD A;  3CUQ C;  2EIJ H;  3QU3 A;  3TP0 A;  1IRZ A;  4MTE A;  1DDN A;  2FRH A;  1OIS A;  2D1H A;  2VJI A;  2DBB A;  3KX2 A;  2G0E A;  3KP5 A;  4CCL A;  1CGP A;  2HDC A;  3DPL C;  4XL9 A;  3E97 A;  4WCG A;  2GM4 A;  3F22 A;  1R1U A;  2HNH A;  4RMN A;  1OMI A;  1SVM A;  3OYJ A;  3CCR I;  3HRM A;  1Y39 A;  3OYL A;  3ZMV A;  4WXH A;  2XSJ C;  2TRT A;  5HNH A;  3QU6 A;  5JHF A;  2R7T A;  4LB6 B;  3SEQ A;  2HYG D;  3DEW A;  2LY1 A;  2VE9 A;  2LP0 A;  3FZV A;  3Q5F A;  4V19 K;  1NG7 A;  4IEJ A;  1VND A;  2VJ5 A;  3DBL B;  3HRU A;  1VTN C;  1QHH D;  1WJA A;  5EGO B;  2DMU A;  2KIM A;  1Y1V J;  5E79 C;  1G3S A;  4OIR F;  4HAM A;  2P5L C;  2KDZ A;  4EM2 A;  2K40 A;  2GZW A;  4FHT A;  4G6Q A;  2HPM A;  2Q2E A;  2QKL B;  4Y33 A;  4DBQ A;  2M4K A;  3Q9V A;  1X1P A;  3HRT A;  4BAY A;  2H09 A;  1ZYR F;  2VC1 A;  2CMP A;  4RM2 A;  2IP2 A;  4KT6 A;  2YX7 A;  2IT0 A;  5M3M J;  4BY1 J;  3RPU A;  4AID A;  3QP5 A;  4WWC A;  4N9I A;  1BC8 C;  3ZPL A;  3SZG A;  4BYY A;  1QVT A;  1VZ0 A;  3CCU I;  3F21 A;  1RR7 A;  2VQC A;  1S9H A;  2ELK A;  4XKV A;  3CCL I;  4X6A J;  1MND A;  1BR2 A;  4QPO A;  4XSZ F;  4LIT A;  4BAC A;  4ENK A;  3QRF F;  3ISP A;  1QO0 D;  4ON0 A;  3ZMZ A;  3IKT A;  2PMH A;  1WI3 A;  2MFZ A;  1APL C;  1I50 J;  2E1C A;  1S7O A;  3L09 A;  2JQ7 A;  2P0W A;  5J1Y A;  3AG1 H;  1A35 A;  3W3C A;  2DQR A;  2HEO A;  2ZXH A;  2GXA A;  3WTX C;  1I1S A;  3KP6 A;  3EUH C;  3KP2 A;  5F1R A;  2D1V A;  1WGX A;  1Y8R B;  3O8H A;  1DU6 A;  3JRF A;  1DPR A;  1HLV A;  4MFE A;  1YW7 A;  5LRR A;  3L2W A;  2VJ4 A;  2CFO A;  4PJ0 C;  2EZL A;  4BH9 A;  2Y9Z A;  2PFB A;  2V6E A;  4UNO A;  1VQ6 I;  4RBO A;  5FRO A;  4CYC A;  1N78 A;  2OQG A;  3E3V A;  2V4J C;  3COA C;  3ESW B;  2LKX A;  2JWT A;  2XGC A;  3OR1 C;  1PYV A;  5LLQ A;  1WI9 A;  3FF5 A;  3QPT A;  4PJJ A;  2X51 A;  3GWZ A;  1KU9 A;  5B1A H;  2LLK A;  1R9T J;  1ONV A;  2VBX A;  3PUB A;  4Q48 A;  2JA8 J;  3GME A;  3RQ4 A;  1K4S A;  4LD5 A;  4A3L J;  2OC6 A;  2W82 A;  3T1B A;  1GLN A;  2TDX A;  2RVC A;  3SZP A;  5C3E J;  2UV1 A;  4B47 A;  4XLH A;  2R7F A;  3TGN A;  1ZRD A;  1L3L A;  1XSV A;  3T8R A;  2W7N A;  1QA6 A;  1IV6 A;  3I5U A;  2EV0 A;  3LSR A;  4O3M A;  3GXO A;  1I1G A;  2EIM H;  2WB1 A;  3D5R C;  4JQF A;  2PQ8 A;  4I98 B;  1XSX A;  4RAY A;  1IDZ A;  2BW3 A;  4KJZ A;  1S3J A;  3PL8 A;  5E3N A;  4JOM A;  4RB0 A;  5KK1 A;  4PCQ A;  4IPA A;  3CLQ A;  3WGI A;  4HOB A;  4MFD A;  2RGV A;  3F9K A;  2PI0 A;  4UUS B;  2ZJP F;  1OJL A;  1U78 A;  4KN4 X;  1VQM I;  4RGR A;  3DWL E;  2W48 A;  5BOX A;  4MHG A;  1J0R A;  2OU2 A;  4XIC A;  1QU3 A;  4MQ9 F;  4OOI A;  3P9K A;  2A05 A;  2P5V A;  4M6V A;  4Y4R A;  2E5N A;  3GYH X;  4EJW A;  4B43 A;  2MD5 A;  3MWM A;  2VBY A;  2LF7 A;  4EEF G;  1TQI A;  3LSG A;  4MGR A;  5HLH A;  3LA3 A;  1JTX A;  1SVO A;  1H88 C;  1LDK B;  4I0B A;  3PFY A;  4XSX F;  1BOB A;  5D8K B;  1O7L A;  4HSR A;  2V6C A;  2QBY A;  2FU4 A;  3V8J A;  3NEU A;  1F9N A;  3CUO A;  2R5Z A;  3REO A;  3OOU A;  3JRC A;  4L0Y B;  1LDJ A;  2P5K A;  5CVV A;  2HDD A;  2WAF A;  1FNN A;  2EQR A;  4O6J A;  1MKM A;  2PLY A;  2NOJ B;  2H27 A;  3MZH A;  4XLN F;  1RPW A;  2R4G A;  2QKM B;  5ED4 A;  3KLN A;  1MBH A;  2ETH A;  3I53 A;  5B3S H;  1WJC A;  1FBU A;  1T8I A;  3TDU C;  5EEG A;  3G1O A;  1JXS A;  3P5J A;  1KYW A;  5E3L A;  5LRS A;  1STZ A;  1X3U A;  5DUK A;  2GXG A;  1U8R A;  1D0Y A;  2VOO A;  1MD0 A;  5EEA A;  5LBQ A;  3HM5 A;  2ZXI A;  2YUS A;  3L2Q A;  4IHV A;  3FIS A;  2P7V B;  2XPW A;  3RPU D;  4H0E A;  3F0C A;  3LSM A;  2F48 A;  4PJL A;  3GUD A;  3M8F A;  2ME6 A;  4HNT A;  2E1O A;  3VOD A;  4KFC A;  1TWA J;  2HXO A;  1YE9 A;  1O7F A;  2OCC H;  3PO2 J;  1D5Y A;  2QF7 A;  5HDK A;  1E17 A;  2EFQ A;  3WTV C;  1QVU A;  4WX9 A;  2Y48 A;  1IRF A;  3CP8 A;  3GTK J;  3H0G J;  1ZTR A;  4OIN F;  3P9I A;  3S17 J;  4AD9 A;  1P6R A;  1MMA A;  1OPC A;  3QYB A;  4BJT A;  1TQP A;  1VFC A;  3OS2 A;  3QOE A;  2OUM A;  2A68 F;  2F5V A;  3OIO A;  2MH9 A;  2COB A;  3B02 A;  4UY8 I;  1JT6 A;  2O0Y A;  3FBI B;  2X48 A;  4K2E A;  2LMD A;  4BUP A;  2R7S A;  2XSD C;  4ZC3 A;  1EA3 A;  2PN6 A;  3CF2 A;  4G8X A;  1WJB A;  1OFC X;  3WE3 A;  1FOY A;  3WTU C;  5ERI A;  3DU6 A;  1V55 H;  1XMA A;  4PSX A;  4UB6 C;  1HXD A;  1XD7 A;  2IA2 A;  3IWF A;  4U0V A;  3A2K A;  4BS9 A;  1ETY A;  2IXS A;  1T95 A;  4M3G A;  1JI8 A;  1FBQ A;  2I10 A;  5CJ9 A;  4ESB A;  3FHN A;  3QP6 A;  2R7O A;  3SFI A;  4OWR B;  1JKP C;  2QEX I;  3S1Q J;  1YS7 A;  3S1R J;  1P7J A;  1OYY A;  3HBL A;  2M9H A;  3RKQ A;  4ZZD A;  1H0M A;  3MCZ A;  2ZNY A;  1FPQ A;  3BRO A;  4MEX F;  3OL4 A;  1B59 A;  5K5Q A;  1JTY A;  2L4A A;  3RIR A;  2PEX A;  2BV6 A;  2KZG A;  3FXL A;  1EH6 A;  1JKO C;  2PG4 A;  2DFH A;  2VPR A;  3K4L A;  3CDH A;  2V1X A;  4YRV A;  4II3 A;  2X4H A;  3ZQH A;  1ETK A;  2M8G X;  2IRF G;  2A6H F;  2NS7 A;  3KZY A;  5K7F A;  2XGD A;  1FOW A;  5DEQ A;  1Z77 A;  2ZFU A;  1FP1 D;  2DK5 A;  3IH3 A;  1R71 A;  4LK1 F;  4ETS A;  1VQ7 I;  3I56 I;  1SD7 A;  3MKW B;  2MLK A;  2Y9Y A;  3I59 A;  3W2W A;  1Z3Y A;  1OCP A;  2XC7 A;  3F72 A;  3GEZ A;  1NK3 P;  3K10 A;  1FWZ A;  4EGZ A;  2ZSI B;  1IUF A;  2QCO A;  1ZLK A;  1R1T A;  3FM3 A;  2Y0M A;  3BOQ A;  3GVA A;  1SVL A;  3ERE D;  1TP4 A;  2P6T A;  4DOZ A;  3RKX A;  3CMA I;  1K4T A;  3A0B C;  1X2M A;  1XTA A;  1JHH A;  2K9M A;  3W6V A;  1G2H A;  3GW2 A;  2BHZ A;  2GA2 A;  1WKM A;  3SZT A;  4P96 A;  4AIH A;  4RAF A;  2WV0 A;  5H2F C;  4FQG A;  1LVK A;  2CU7 A;  2HDW A;  5LGT A;  5JR3 A;  3FHZ A;  4MNU A;  1LE8 B;  2M7A A;  1O4X A;  4YFX F;  4HEA 2;  3CC2 I;  2Y0S N;  3IL2 A;  4FE4 A;  1KYZ A;  3M8E A;  3H9J A;  5E1Z B;  5B5E C;  4AC0 A;  4EV0 A;  3HOS A;  4JX4 A;  3CQZ J;  3ZN0 A;  4GCV A;  3K2A A;  2QSF X;  3IH2 A;  1WCM J;  4BXF A;  3KP3 A;  2R7W A;  1TC3 C;  2VN2 A;  1WRJ A;  4C3J J;  3C18 A;  1B9M A;  1XMX A;  3RPQ A;  1I6H J;  2DTR A;  2G7H A;  3CZ6 A;  4HLX A;  2EK5 A;  1Z9C A;  5JLX A;  1YJ9 I;  3FXR A;  3G1M A;  1T08 B;  1MNM C;  3W2V A;  2JT1 A;  2BHY A;  4AUX A;  3W6K B;  2EV6 A;  3NAR A;  5M5W J;  2CQN A;  1FZP B;  2EFN A;  2B0L A;  2DU9 A;  4GO1 A;  2A6T A;  4R1H A;  3A01 B;  3F8C A;  3JRH A;  2P6S A;  2EFO A;  1XB4 A;  1ON2 A;  1ITY A;  2FE3 A;  2ZME A;  5FGM A;  2XF5 A;  1ETW A;  2LG4 A;  1YJW I;  1RUO A;  3BR6 A;  3VFZ A;  1U8B A;  2A5W A;  3WGH A;  2M0M A;  4N0B A;  2NVY J;  2DYR H;  2O8K A;  1BR4 A;  3JAM Z;  3BDD A;  1Z7U A;  1JUS A;  2QQ8 A;  2VT3 A;  2XHK A;  3HJE A;  2VE8 A;  1HKS A;  1MJB A;  4N4N B;  1Z6R A;  2XF7 A;  2XAQ A;  4XKB A;  1VQ9 I;  3IRR A;  2PMZ N;  2OTJ I;  5HS9 A;  5HVQ C;  1ON1 A;  2E2J J;  3ZQL A;  4LJZ F;  2FNP A;  4O5V A;  4AYB N;  1ZQ3 P;  3HHH A;  3P9C A;  3JTH A;  3CMY A;  4IL6 C;  1Y0N A;  5FLX Z;  2JSP A;  3K1N A;  2NXN B;  2XAU A;  2HQN A;  3IH4 A;  2ZBK A;  4FX4 A;  5HOD A;  1FOK A;  1D8K A;  5A2Q Z;  1U5T B;  2GA1 A;  3D5S C;  3K4N A;  3OIQ A;  3KZI C;  5C4X J;  4PZJ A;  3RZO J;  3HTS B;  3MKY B;  1TT0 A;  2EIN H;  3U1K A;  2CUJ A;  5L3E A;  2IVM A;  2K02 A;  1ZGW A;  2KKO A;  2R93 J;  4FET A;  1TW3 A;  1J2X A;  1ETO A;  3SQN A;  4XNF A;  4CSW A;  1NK2 P;  3LL7 A;  4IJA A;  5LEJ A;  1KQ0 A;  1BOA A;  2XAG A;  1YW8 A;  1NH3 A;  4BY7 J;  3S3O A;  4RB3 C;  1I3Q J;  3CCJ I;  2CV2 A;  3GTP J;  2LY2 A;  2VKD A;  1FSH A;  2A3S A;  3RYP A;  1DGW Y;  1J75 A;  3ULQ B;  4E4H A;  4II2 A;  3RKW A;  1SMY F;  2E1N A;  2JPB A;  1UJ8 A;  4A3I J;  2IGN A;  2X85 A;  5K5R A;  1W7P B;  5E1X A;  3OSG A;  4IQJ A;  1MMG A;  4EM0 B;  4RGS A;  4L0Z B;  1V5E A;  1PUE E;  1V5G A;  2UXX A;  2VT2 A;  5DYM A;  3I64 A;  1A6Q A;  2JA7 J;  1FIP A;  1UST A;  1UHM A;  3LFU A;  3X2Q H;  2HTJ A;  4JX6 A;  1EKE A;  3LSK A;  3DLL F;  1A04 A;  3T8T A;  2IS4 A;  1SAU A;  5K7Z A;  2XGX A;  2YR2 A;  2HQR A;  1RZ4 A;  1R5H A;  4XOT A;  3D5L A;  3HSE A;  5D6E A;  3HXL A;  2Y0S A;  2O7O A;  4UVA A;  1A5J A;  3ASN H;  2X0L A;  1ZRE A;  3CUQ B;  4CO8 A;  4HV5 A;  2NVQ J;  4LFU A;  1XX5 A;  5L3D A;  3GO5 A;  3HPG A;  1OR7 C;  3NWS A;  1FBS A;  4NQW B;  2IA0 A;  2X6Y A;  4AIK A;  3C2G A;  2R5Y B;  3PFI A;  3IP4 B;  3CCE I;  4A93 J;  2JRT A;  1HSJ A;  2L0K A;  2W24 A;  4I02 A;  5KNL A;  1VI0 A;  2L7F P;  4TV7 A;  4BEH A;  4BKX A;  4QSH A;  4ZYD A;  3FDY A;  4CDG A;  1WHU A;  3OYB A;  3RSN A;  3I4M J;  1WJD A;  2NAZ A;  2R0Q C;  1FYM A;  2DO7 A;  4A3G J;  2DYS H;  3VYU B;  4F7Z A;  1BM9 A;  3OS0 A;  3WG9 A;  2CG4 A;  2KJC A;  3KP7 A;  5FLV A;  3E6C C;  5J8F A;  3CJN A;  1ZGJ A;  1Y6I A;  1PUF B;  4NBQ A;  4M3E A;  4LOC A;  4CZC A;  2XB5 A;  3G3Z A;  4W97 A;  5GPA A;  1B9N A;  2XB0 X;  3J80 Z;  1PP7 U;  3JAM K;  2R7V A;  2C6Y A;  4XLC A;  4KT5 C;  2NVU B;  3FXJ A;  3PSF A;  2Z1D A;  2CSO A;  5DCM B;  4MTD A;  2H94 A;  3AG3 H;  1X1B A;  4XBF A;  2PMZ A;  1YOV B;  5D6F A;  3OYG A;  4G7O F;  1FP2 A;  2XF6 A;  1Z0X A;  1VQK I;  2ID6 A;  4EJU A;  4AYB A;  3V7C A;  2CQQ A;  2ZJQ F;  1MDM A;  1UG0 A;  3GZ5 A;  5FLX K;  3K0L A;  3J81 Z;  2ZO4 A;  2Z2S B;  5EG0 A;  2LTP A;  3ERM A;  3RYR A;  4BJ5 C;  3CES A;  2VPL A;  3KLO A;  4HYE A;  3LMM A;  1NG6 A;  2E71 A;  5A2Q K;  2FXA A;  4PDK A;  2YS9 A;  3LA7 A;  4XRM A;  2LKS A;  4HDU A;  1BI0 A;  4B09 A;  2JJ7 A;  3O8G A;  2ELH A;  3ML6 A;  3WU2 C;  2V1U A;  2CO5 A;  2D5V A;  3M07 A;  2R7R A;  3DPU A;  1REP C;  2PJR A;  4BQA A;  2XRL A;  1UCR A;  4NB5 A;  2M45 A;  3JCU C;  3KIO A;  4L9N A;  5EJC A;  2H8R A;  4EJT A;  2ID3 A;  2XAF A;  5GTI C;  1K78 B;  4KMF A;  1FTZ A;  4A0X A;  1TW2 A;  3PM1 A;  3HUG A;  3BLY A;  5ICE A;  1XCV A;  4PGG A;  2OQR A;  4S04 A;  3GZ6 A;  4UUV A;  1H89 C;  4L5J A;  4IO9 F;  3E5Q A;  3G2B A;  4F93 B;  1RUN A;  1Z21 A;  2JA2 A;  3KZZ A;  3HL2 A;  4L9T A;  1SFK A;  5ICG A;  1HA8 A;  3PIP F;  1Q1V A;  1W4M A;  2QVO A;  3HIF A;  1U3E M;  1IN5 A;  2CQK A;  2AHQ A;  4KIC A;  3WTY C;  2DMP A;  3VYT B;  1BA5 A;  4DGW B;  4ENN A;  2ADU A;  3V8L A;  1RET A;  2H6B A;  1SFU A;  3Q0V A;  4PJM A;  4J19 A;  2KHM A;  2J5O A;  4CXF A;  3EUH A;  4A3F J;  2YU9 J;  1QQI A;  3L00 A;  3BG9 A;  5KCM A;  4QPQ A;  2RAE A;  4A69 C;  3OYA A;  2D2W A;  1ZLJ A;  3LSP A;  3TL4 X;  3SXY A;  5ICF A;  5J1U A;  2XDV A;  3HKZ N;  2KMU A;  3DTK A;  3HC7 A;  2DW4 A;  1LFB A;  3RTR A;  1XSD A;  2DOA A;  1B1B A;  1BJZ A;  3N97 A;  1ZR4 A;  3CF5 F;  4BHB A;  4HBL A;  1ZEL A;  5FFX A;  4DJA A;  1LB2 A;  4MIM A;  2EBI A;  2BY1 A;  2E60 A;  1SD6 A;  4I01 A;  5KAI C;  2KPM A;  2KLO A;  2JPC A;  5KAF C;  3TKY A;  3IRQ A;  5IY5 H;  2JSC A;  4G6T B;  5L3F A;  5F0C A;  3DXJ F;  2DA4 A;  3ROU A;  3J80 K;  3F6O A;  3GTG J;  2ZSH B;  3LWF A;  2KRH A;  2X9D A;  4BDY A;  4IX7 A;  3CO6 C;  5FB2 A;  2FSW A;  2ME0 A;  1V3F A;  3FK6 A;  2EJR A;  2ZXJ A;  3GFI A;  2HYJ A;  2OA4 A;  4BE0 A;  2AO9 A;  3C3W A;  3TOB A;  1WQ2 A;  5CVR A;  3R4K A;  4B1R A;  1H9T A;  5J4Y A;  1D0Z A;  3AG4 H;  5DD4 A;  1G8X A;  4EJO A;  5JLW A;  1YS6 A;  2JTV A;  1LUJ B;  2L02 A;  2LVS A;  3GTL J;  2HKX A;  3FM5 A;  1IW7 F;  5CVJ A;  2K5C A;  3SDB A;  4E7L A;  5HS8 A;  3IKV A;  4BNC A;  3R0A A;  3KP4 A;  3JRD A;  3IAM 2;  1X19 A;  1F36 A;  4KIS A;  1T98 A;  1W5C C;  1BIA A;  3H5A A;  2YU3 A;  1JJ8 C;  4XLE A;  3F8B A;  1SAX A;  1POG A;  2UUZ A;  3TW7 A;  1SFO J;  2BVL A;  1A36 A;  1SFE A;  2LF8 A;  2VIX A;  2QGU A;  1K83 J;  1WPK A;  1D0X A;  2GOX B;  4BL0 B;  1H8A C;  2OCE A;  5DV5 A;  5IOY A;  2JUC A;  4Q4Z F;  4YFN F;  1HCR A;  1XN7 A;  2BBY A;  2IW5 A;  1BI2 A;  4G7H F;  1TWF J;  3S2H J;  3ZQQ A;  2W1O A;  1S6L A;  1UZC A;  2MLG A;  3RCO A;  3KE2 A;  1ZG1 A;  2LKP A;  1O3Q A;  2L2O A;  1I5Z A;  2G7U A;  1G6N A;  4FX0 A;  4LLN A;  1O57 A;  3Q9S A;  2BW3 B;  3FMS A;  1D1C A;  3VOE A;  4DZP A;  4M3D A;  3M3Y J;  3VDX A;  1MBG A;  5AON A;  5GAE J;  1ORK A;  4BDZ A;  3GFM A;  5LD2 C;  3KYC B;  2JUG A;  5E18 F;  1ULY A;  5J6X A;  1ZKG A;  3JRB A;  3JRE A;  2R92 J;  2R7D A;  2GQQ A;  5F64 A;  1E2X A;  3MQ0 A;  3HOX J;  3ZCO A;  1T0F A;  2CS3 A;  5HLT A;  2M1B A;  5DD8 A;  4L9J A;  3MD2 A;  1LFU P;  1WZ2 A;  4Q5S F;  2AS5 F;  3BTI A;  1IUY A;  3UR3 C;  2F4M B;  1MMS A;  3HHG A;  4AVZ A;  2QM3 A;  1VF9 A;  4ANJ A;  4ZDP A;  4ENJ A;  5BS6 A;  2RQP A;  3N4M A;  3HOU J;  2OD5 A;  3F6V A;  3IHU A;  4UXN A;  4WXC A;  3E0J B;  3FXK A;  2QWW A;  4IOC F;  2O6G E;  3H9G A;  2FX0 A;  2H1L A;  3SJM A;  5GPC A;  4E7H A;  4AU7 A;  3HGY A;  2JA5 J;  2QBY B;  3CC7 I;  2NOG A;  1S72 I;  5IP7 J;  4RM3 A;  3HKZ A;  2GXB A;  3KEY A;  2HFH A;  4PGH A;  4DBR A;  4JP0 A;  4CYD A;  2MSY A;  1Z6T A;  2XAH A;  3BR5 A;  3QAH A;  2Z3Y A;  2VKE A;  1Z3X A;  2M5W A;  4XID A;  1T2K A;  3HZJ A;  5FO5 A;  4DZJ A;  1MNE A;  2GLO A;  2J5P A;  1HDP A;  1OCZ H;  2E35 A;  3GLL A;  4UUS A;  5LHG A;  4XMY A;  3JSP A;  3FKI J;  2FOW A;  5LHH A;  4ZYH A;  3PNY A;  3FMR A;  5JFR A;  1OKR A;  3K4B A;  4B4C A;  1IV8 A;  4R8H A;  4CCM A;  4XM3 A;  3HEF A;  3ABU A;  4G7Z F;  4I76 A;  4IOA F;  1GVD A;  1WFX A;  2MGQ A;  1RI7 A;  5E3M A;  1Q1H A;  3PUF A;  2DMQ A;  5HS7 A;  4E70 A;  2XKO A;  4I09 A;  3GFL A;  2JMW A;  5FKO A;  3HG9 A;  1BJA A;  3WTZ A;  5IOZ A;  4LLG F;  1MMN A;  3A02 A;  2LBF A;  3ECO A;  3BTL A;  5L3B A;  1D8J A;  2PMU A;  4B3X A;  4IRI A;  2DA3 A;  5CPR B;  5LGU A;  1IAW A;  2BOL A;  4G12 A;  4KA4 A;  5TIS C;  4E6K G;  3PIO F;  4BGD A;  1IN4 A;  2WY7 Q;  4HV6 A;  1YJN I;  1AOY A;  3HSF A;  3BY6 A;  1UB9 A;  2X6O A;  4RS8 A;  3HGG A;  4D9J A;  1R4N B;  3WTT C;  2P7C B;  1BIB A;  5D4R A;  3DQV C;  4HNV A;  1EH7 A;  5ILS A;  4OMZ A;  3V7R A;  2KZV A;  5DTD A;  2CUZ A;  2QQ9 A;  4YII A;  3U1D A;  4EMS A;  2MAB A;  1R23 A;  3K7A J;  2VB6 A;  4KIF A;  5ILV A;  2ACJ A;  1O3S A;  2K7L A;  2DPD A;  2X1C A;  2L5Q A;  4R79 A;  3ZMU A;  2P4W A;  3TED A;  1IN6 A;  2CJJ A;  3K4M A;  1G59 A;  1T56 A;  4UVC A;  1OYI A;  5EYR A;  5HDG A;  3E6B A;  3CTA A;  3OMY A;  4YIF A;  2EFP A;  5FKK A;  4GDF A;  1SFX A;  2YSR A;  2OZ6 A;  1XCB A;  4IRG A;  1TL8 A;  4ENM A;  1KGS A;  1U2W A;  2IA1 A;  2DOD A;  1IRG A;  2DI3 A;  2L7K A;  2CUE A;  4P9F A;  4C9Y A;  1R49 A;  2A61 A;  1SAN A;  3FKJ A;  1ZRC A;  2GBY A;  1W0U A;  3MZY A;  5D5V B;  1Z05 A;  1HW5 A;  2WV1 A;  3E7L A;  3F8N A;  3K4C A;  3EUA A;  4Y13 A;  2L9S A;  3OV8 A;  2B9S A;  1B8I B;  3DV8 A;  3IAS 2;  1B72 B;  1BW5 A;  3QPL A;  1DU0 A;  3BWG A;  2ECC A;  4F52 A;  2A07 F;  1BN5 A;  4XKC A;  5IYC J;  3BR2 A;  3ZQF A;  5DCF A;  2DQL A;  4W1U A;  1IRX A;  4A3D J;  2ICW G;  3KCC A;  2HGC A;  4UUT A;  1X3W B;  3LSH A;  5BQT A;  4LMY A;  3BP8 A;  3O2P E;  1BL0 A;  3KYL A;  1S7A A;  3DPT A;  3PSI A;  3ZRG A;  3H5N A;  3FXM A;  4KIB A;  3S1M J;  2YPR A;  3CC4 I;  1ACI A;  1XDS A;  2IGK A;  4HA8 A;  3GTQ J;  2NRA C;  4GFB A;  1D3Y A;  5CKT A;  2HR3 A;  3CCV I;  5DM6 F;  1ZHF A;  1HW1 A;  4Y3O A;  3LST A;  3GF2 A;  2WAD A;  2CH0 A;  4G6D A;  1ETV A;  4A6D A;  1IO2 A;  4XR6 A;  1TNS A;  2K86 A;  2QQA A;  1X1C A;  1O3R A;  2WAE A;  2F5C A;  2BZT A;  2M2E A;  1U6G A;  1JE8 A;  2ISZ A;  2Y31 A;  3MKZ A;  4A3C J;  2XPU A;  1OCT C;  1MBF A;  2XRO A;  3S8P A;  2HQA A;  1HST A;  4UV8 A;  1L0O C;  2DT5 A;  4KN7 X;  2BEO A;  3BG5 A;  3TQN A;  2IS2 A;  1E0E A;  1CF7 B;  3BQY A;  5K1Y A;  1MBK A;  1P4W A;  2BY3 A;  2EWN A;  1K6Y A;  2K9N A;  3LSJ A;  3U21 A;  5DDG A;  2FF4 A;  3BJO A;  5AIQ A;  5AIP A;  2R3S A;  3RI4 A;  2VQL A;  2EH3 A;  5J3L A;  3V4G A;  4U7D A;  5JVT A;  4UHT A;  1J7K A;  1F1Z A;  5FD6 A;  4G94 A;  1B4A A;  3HYI A;  4RGU A;  2PJP A;  3E6D A;  3WG7 H;  4HQE A;  4MO7 A;  1V54 H;  3DKW A;  3EPZ A;  4IHW A;  2ZNZ A;  3KYD B;  4A3E J;  1PVE A;  2L9R A;  2XAJ A;  4AM3 A;  2GIV A;  2ZB9 A;  2F5E A;  2ZCW A;  3JRA A;  3BQZ A;  1MGT A;  4CA0 A;  4DW6 A;  2LD5 A;  3G4S I;  3QPH A;  1QGP A;  1R5I D;  2HI3 A;  2GWR A;  4XRS G;  4IHX A;  3NWT A;  1FEX A;  3H3Z A;  2LFB A;  2V9V A;  2O3F A;  2GIZ A;  3FXU A;  4HRI A;  3MZ8 A;  2OF7 A;  4NHJ A;  2ZJ2 A;  3L2R A;  1DGR M;  1KU2 A;  1USS A;  1D1B A;  4A5N A;  1FIA A;  3EET A;  1LJ9 A;  3HSR A;  3DF8 A;  3ASO H;  5FKN A;  2EFW A;  2ECB A;  1RKW A;  3BZK A;  4GRI A;  3J7A Y;  2AXL A;  3NRV A;  3ABM H;  1EF4 A;  3AL0 C;  2OPT A;  2EPF A;  5IP9 J;  2VKV A;  1YRN B;  2Q8K A;  3EQL F;  1O3T A;  5TRD A;  3QWL A;  4ESJ A;  2VJJ A;  1QRY A;  3E5U A;  3GFJ A;  1MH3 A;  2L01 A;  3IC7 A;  3RJP A;  1EV7 A;  1UHW A;  1HOM A;  4IKF A;  5HLI A;  3TDZ C;  3R6S A;  2EZH A;  4EQQ A;  1Z67 A;  1YW9 A;  2WAQ N;  2H6C A;  1AKH B;  1QPI A;  3L9F A;  4CGZ A;  5J40 A;  1WH7 A;  2IGM A;  4CUG A;  2W57 A;  4F91 B;  2QEN A;  1VQL I;  2VAS A;  2DAO A;  3M1E A;  3E5X A;  4HNU A;  1BI1 A;  5DUI A;  1IG7 A;  2MA3 A;  1QNT A;  1MMD A;  1S5L C;  1Z7L A;  3CJQ B;  2V26 A;  2M0C A;  4KUM A;  2ZJR F;  4Y7N J;  1RR8 C;  2MG4 A;  1YQA A;  4NUB A;  2FBH A;  5FKM A;  2VON A;  5DS9 A;  3DEU A;  1B6A A;  4E7K A;  2KL4 A;  1SD5 A;  1WJ5 A;  1H9G A;  2ZXW H; 
#chains in the Genus database with same CATH homology
 1AA7 A;  1YX5 A;  2LOO A;  4C30 A;  1Z21 A;  2JA2 A;  3HL2 A;  1SFK A;  2X1E A;  3F9K A;  1HA8 A;  1J09 A;  3VYR B;  1FMV A;  4CCO A;  3TBI A;  4HST A;  3DWL E;  3VYT B;  4NNJ A;  4N4O B;  4XLF A;  4NC8 A;  4DGW B;  3QOD A;  1V5F A;  2AQE A;  2M3A A;  3ZR8 X;  1QU3 A;  3A4C A;  4PJM A;  2KHM A;  5HOO A;  3K6G A;  4Y4R A;  4ZTJ A;  2E5N A;  4B43 A;  3DLA A;  3HOT A;  3OYA A;  5KCM A;  4QPQ A;  3IUO A;  3LSG A;  2MYS A;  1LKX A;  2F6C A;  3SYT A;  2R7X A;  3TL4 X;  1LDK B;  2V1N A;  3PFY A;  3OYC A;  2XDV A;  1BOB A;  3OIP A;  4HSR A;  4X0G A;  2KMU A;  3DTK A;  3HC7 A;  3BC8 A;  4F93 B;  5CQE A;  3RTR A;  3S93 A;  4BEH B;  2DOA A;  3OOU A;  4F3Q A;  2CV1 A;  2WAF A;  4DJA A;  1ZEL A;  2NOJ B;  2E60 A;  3AFH A;  2R4G A;  2KPM A;  2QKM B;  2KLO A;  3OYK A;  1WJC A;  4G6T B;  3OYD A;  3A1Y A;  3C2H A;  2ZSH B;  4PJN A;  2KRH A;  2LYC A;  4BDY A;  4IX7 A;  4E7I A;  3M8J A;  1D0Y A;  2HPI A;  4BE1 A;  4YEJ A;  2DCE A;  3GBG A;  2ZXI A;  4HPQ A;  3H0D A;  4BE0 A;  2HVR A;  4BJ6 C;  3L2Q A;  3BCA A;  5TGT A;  3VSK A;  3RPU D;  3LSM A;  1D0Z A;  4PJL A;  2E1M B;  3OYE A;  1G8X A;  4J00 A;  4HNT A;  1WJE A;  3SEZ A;  4PUS A;  3OR2 C;  3OYH A;  1YE9 A;  4CCJ A;  3OYI A;  4BE2 A;  3TMO A;  3CP2 A;  1TZL A;  3SDB A;  2HVQ A;  4E7L A;  2K5C A;  4J01 A;  2IGO A;  3S3N A;  4CCN A;  3PJR A;  3BG6 A;  1X19 A;  3CP8 A;  3IAM 2;  4B48 A;  3MMY B;  4KIS A;  3H5A A;  2WA0 A;  4F92 B;  4XLE A;  1MMA A;  2UUZ A;  3K70 D;  4IZZ A;  3QYB A;  4BJT A;  2BVL A;  3OS2 A;  3QOE A;  2OUM A;  2O5R A;  2VIX A;  1QHG A;  2F5V A;  1D0X A;  2GOX B;  4BL0 B;  1W36 D;  2Q1Z B;  3FBI B;  3VSL A;  4BUP A;  2R7S A;  4ZC3 A;  1EA3 A;  2OV7 A;  3ZQQ A;  2W1O A;  1DP3 A;  3CF2 A;  3RCO A;  1WJB A;  2I8D A;  3QYF A;  2L2O A;  2M7B A;  3DU6 A;  4XQF A;  5LFA A;  4PSX A;  3CJR B;  3A2K A;  4BS9 A;  2BW3 B;  2IXS A;  1D1C A;  4DIQ A;  1T95 A;  1JI8 A;  3ZGK A;  3FHN A;  3VDX A;  2R7O A;  3QYE A;  4OWR B;  4BDZ A;  5LD2 C;  2JUG A;  4LG3 A;  1R6R A;  5CQG A;  4BQO A;  2IS1 A;  3OL4 A;  4P1W A;  3ZCO A;  2FUG 2;  2CS3 A;  5HLT A;  4ZDL A;  3MD2 A;  1X1D A;  3VWB A;  2M4G A;  3UR3 C;  3H9Q A;  2DXI A;  4B44 A;  4AVZ A;  4ANJ A;  4ZDP A;  2VLA A;  3K4L A;  4YRV A;  2AQF A;  4II3 A;  3E0J B;  4CCK A;  5FRM A;  4H4K C;  4PFP A;  2JVG A;  3H9G A;  4RLQ A;  2VXZ A;  4AU7 A;  4E7H A;  1WJF A;  2MD0 A;  2ZFU A;  4RM3 A;  3HKZ A;  3K70 C;  3KEY A;  4DBR A;  3OL3 A;  5KHD A;  4XKW A;  2Q2E B;  5HNF A;  3MKW B;  1Z3X A;  4LIU A;  4CH7 A;  4E7Z A;  2LRE A;  1W36 C;  3W2W A;  1Z3Y A;  2XC7 A;  2DT7 B;  3DU5 A;  4OAY A;  1MNE A;  3K10 A;  2ZSI B;  2E1M C;  3H5R A;  4XMY A;  4ZDO A;  2WY8 Q;  1LFP A;  3PNY A;  2VL8 A;  4DOZ A;  3PL8 A;  3CMM A;  3OS1 A;  3OWT A;  3M1C A;  3K4B A;  2K9M A;  4CCM A;  4XM3 A;  3VYS B;  4XN0 A;  4C2U A;  2X6W A;  2DT6 A;  4PSW A;  1WFX A;  4ZJZ A;  3OYN A;  3DKY A;  1LVK A;  2HDW A;  2M7A A;  2W4S A;  4HEA 2;  3HG9 A;  2VQG A;  1MMN A;  3H9J A;  3HPH A;  2LBF A;  2CW7 A;  4XOP A;  2RNG A;  3HOS A;  3V42 A;  3L2U A;  4B3X A;  5CPR B;  1PJR A;  3I9V 2;  2HZD A;  2BOL A;  4HG2 A;  4XLA A;  4BXF A;  2R7W A;  4E6K G;  1BR1 A;  3OYF A;  4BGD A;  2WY7 Q;  3CZ6 A;  4FAS D;  4D9J A;  4LIV A;  1X4P A;  3DQV C;  3W2V A;  1X4O A;  2HVS A;  4XOR A;  2KZV A;  2CUZ A;  2MAB A;  2A6T A;  3BCB A;  4PFO A;  2V9K A;  2VB6 A;  1DQU A;  2BVM A;  2X1C A;  1X1A A;  2LG4 A;  2XF5 A;  2L5Q A;  3DTE A;  2PJR B;  4R79 A;  3E1S A;  2A5W A;  3UNG C;  2M0M A;  2WAQ A;  2VQH A;  4EAT A;  3S32 A;  1BR4 A;  3K4M A;  1G59 A;  4PK4 A;  4N4N B;  2XF7 A;  2CW8 A;  3OMY A;  4XKB A;  1D1A A;  1N75 A;  1OLT A;  3W2A A;  4IQ4 A;  5HVQ C;  3PNT A;  3K4J A;  3HUG B;  4ZYA A;  3AKZ A;  2L7K A;  4C9Y A;  2JSP A;  4BQQ A;  2XAU A;  3FKJ A;  2X1D A;  4YEL A;  3K4K A;  3D5S C;  3K4N A;  2VKH A;  3OIQ A;  3K4C A;  3EUA A;  3LSI A;  1TT0 A;  3MKY B;  2L9S A;  3PNV A;  3BG7 A;  2CUJ A;  3IAS 2;  2ELJ A;  3DKX A;  4E7J A;  4F55 A;  4FET A;  3I3L A;  1MW7 A;  2KRC A;  4KIT B;  1U0J A;  2MC4 A;  3OYM A;  3DEE A;  4F52 A;  2L9N A;  4XKC A;  1N77 A;  1IRX A;  2E5Z A;  4XNF A;  4CSW A;  4BQN A;  3LL7 A;  2HU9 A;  3ZXS A;  3LSH A;  2KDO A;  2RQQ A;  3S3O A;  2CV2 A;  2LY2 A;  2VKD A;  3KYL A;  3PSI A;  3DPT A;  3ZRG A;  1DGW Y;  3OY9 A;  2IS6 A;  3H5N A;  2VJI A;  4E4H A;  2K9L A;  3KX2 A;  4II2 A;  4CCL A;  2IGK A;  3DPL C;  2R7Q A;  4XL9 A;  5CKT A;  2W00 A;  1UEL B;  2HNH A;  4RMN A;  2LH9 A;  2VXD A;  2IGN A;  2X85 A;  3OYJ A;  4Y3O A;  3OYL A;  3ONQ A;  2WAD A;  2CH0 A;  4IQJ A;  4P5O A;  1MMG A;  2XSJ C;  2F4I A;  4XR6 A;  1V5E A;  1V5G A;  5HNH A;  1X1C A;  5JHF A;  2WAE A;  3N05 A;  2R7T A;  3LFU A;  3SEQ A;  3MKZ A;  2LY1 A;  3LSK A;  3H35 A;  3L2V A;  1NG7 A;  2IS4 A;  1SAU A;  3S8P A;  2HQA A;  2WBM A;  2VJ5 A;  4XOT A;  3D5L A;  1QHH D;  1WJA A;  3DTI A;  3HXL A;  2Y0S A;  4ITV A;  2IS2 A;  4D1Q A;  1E0E A;  4XN3 A;  2LBF B;  1K6Y A;  3U21 A;  4ZTF A;  3HPG A;  1KON A;  1OR7 C;  2VQL A;  3NWS A;  2HPM A;  4NQW B;  2X6Y A;  2QKL B;  3C2G A;  4Y33 A;  5FRN A;  4DBQ A;  3IP4 B;  2M4K A;  3FBN B;  2CMP A;  4RM2 A;  5KNL A;  4KT6 A;  4BEH A;  3FDY A;  4BU2 A;  3OYB A;  3RSN A;  1WJD A;  3EPZ A;  2UWM A;  1P9Q C;  3SZG A;  3VYU B;  1VZ0 A;  3OS0 A;  2VQC A;  1Y6I A;  1S9H A;  4XKV A;  4CZC A;  1MND A;  1BR2 A;  4QPO A;  1ERD A;  4LIT A;  4CA0 A;  4BAC A;  1T0F C;  2V7F A;  2R7V A;  4XLC A;  4C2T A;  3NWT A;  2MFZ A;  2LC2 A;  2Z1D A;  3PSF A;  1X1B A;  2GOM A;  2P0W A;  2PMZ A;  3OYG A;  4HRI A;  2KQR A;  2R7U A;  3W3C A;  2XF6 A;  3EUK L;  2ZXH A;  3L2R A;  1DGR M;  3EUH C;  4U87 A;  1D1B A;  4AYB A;  1UG0 A;  3L2W A;  2VJ4 A;  2Z2S B;  3J7A Y;  4GRI A;  2CFO A;  4BJ5 C;  2VPL A;  3CES A;  3LMM A;  1NG6 A;  3AL0 C;  4OAZ A;  1N78 A;  2V6E A;  2CV0 A;  5FRO A;  2JVH A;  3S3M A;  2KP6 A;  1UAA A;  1FMW A;  2V4J C;  3OR1 C;  1PYV A;  2VJJ A;  4PJJ A;  2K3P A;  2X51 A;  4XON A;  4IKF A;  2RRE A;  3PUB A;  2X6X A;  1Y56 A;  3DPU A;  4E7S A;  2R7R A;  2PJR A;  3RQ4 A;  2OC6 A;  2IGM A;  4CUG A;  4F91 B;  2W82 A;  2DJI A;  1GLN A;  4U7B A;  2VAS A;  4NC7 A;  4HNU A;  2UV1 A;  4B47 A;  4XLH A;  4RLF A;  1MMD A;  2W7N A;  1Z7L A;  3CJQ B;  2V26 A;  4MLO A;  2WB1 A;  3D5R C;  4JQF A;  1YX3 A;  4NUB A;  3BLY A;  2BW3 A;  3AL0 B;  2Z16 A;  4KJZ A;  4E7K A;  2KL4 A;  1WJ5 A;  2LRD A;  3G2B A;  4JOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...