3OL3A

Crystal structure of a putative uncharacterized protein from mycobacterium smegamtis, an ortholog of rv0543c, iodide phased
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 31
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol3A02
3OL4A 3OL3A
chains in the Genus database with same CATH superfamily
4DYRA 2L54A 4U7BA 2VXDA 4JX4A 1X3ZB 5EGOA 1WFXA 2HU9A 2BHYA 4M3DA 1KQ9A 2G9WA 4F7ZA 2M45A 3ZQLA 2R7SA 1G2HA 2QA4I 1XSDA 1ZGAA 4HBLA 3HXLA 2M3AA 5DS9A 1XN7A 3QYEA 1LNWA 2IBDA 2R5YB 1BBYA 3BDDA 3E6BA 4E4HA 2IEKA 2YSRA 4LG3A 1T95A 5IPAA 3G1MA 3G73A 5FO5A 1TW2A 2DPDA 1S72I 4ZYAA 4F55A 3IC7A 4B3AA 1UJ8A 4KITB 3J7ZI 4RAGA 1PUEE 1QZZA 1STZA 1FBUA 1ETWA 3KEOA 4LG0A 4PZJA 2FRHA 2VJ4A 4I0AA 2EJRA 3L2CA 3F6VA 4B43A 4BHBA 1AKHA 3H9QA 3HOWJ 3WE2A 3BZKA 2JA8J 5F1RA 2CMPA 1YW7A 3F8FA 4I98B 1I6XA 4X6AJ 3BTLA 3H9JA 3JCUC 1BJAA 5E1WA 3A0BC 3BJAA 1K78B 4D5FA 3OOPA 1D5VA 4M6VA 3H3ZA 5J4VA 3JRBA 4XK4A 3ZMZA 4EMSA 2UZKA 3R61A 3F8CA 1E17A 3FXMA 2UXXA 2MABA 1RUOA 2MH9A 3E5QA 2LF8A 2ELKA 3MAJA 2L9SA 2X1CA 2PX9A 4U88A 2MLGA 1A31A 3ZCOA 3R0AA 2BE5F 2KIFA 4CA0A 1TNTA 2KQRA 5JHUA 2HZTA 1GLNA 4GGGA 5BQTA 4ZC3A 5ILUA 4MQ9F 4PDKA 2PJRB 4AM3A 3I55I 1XGSA 4HYEA 2XC7A 4WX9A 1R23A 4UV8A 4A0YA 1N77A 1XMKA 3CC4I 3CCMI 3ERMA 3LA7A 3TO7A 3X2QH 4PJ0C 3H1CA 2KRCA 1W7PA 4ABZA 2DAOA 1ETQA 4RGRA 4C3IJ 4RAZA 2EBIA 3HUGA 2MSYA 4F52A 2XF7A 4P5OA 1UZCA 2DFFA 4R79A 2M7AA 4JOMA 1XPXA 1PJRA 5C44J 3SFZA 4ETSA 1YIJI 1K7AA 1HXDA 2G7UA 2LBFB 1B4AA 2IS1A 3E7LA 3BC8A 4QTRA 1R6RA 4S05A 1U5TB 3EETA 2K9QA 2F4OB 4M72A 4I6ZA 1LEBA 4IO9F 2VPLA 1ZR2A 4OOIA 3QPHA 2BGCA 2NVUB 2E35A 1BR4A 1I27A 3RYPA 1JT0A 1CF7A 3BR2A 2IS6A 2X0LA 1OJLA 2A3SA 4EVIA 1D8KA 4PGGA 4G6QA 4KMUX 1LB2A 2FSWA 1IJWC 4L9VA 2QGUA 1J9IA 1XC5A 2C6YA 2LVSA 2P5VA 1OCPA 2CG4A 4G12A 2W57A 3QPSA 2E1NA 3WU1B 4BBRJ 4M6XA 5JVGF 3CC2I 5HS9A 1ETKA 2TDXA 1VQ4I 4D0PA 1MZBA 5EF6A 3BY6A 3PIOF 2IGNA 4HX7A 1LE8A 3K4CA 2V7FA 5IT3A 4E7KA 2DODA 1T33A 3IKTA 4P96A 1MKMA 1FOWA 4RLFA 2ZO4A 5DDGA 1ETVA 3LAJA 3FZVA 3W6VA 3F3XA 3ZGKA 2X51A 3IHUA 3TP0A 3HM5A 4BAYA 2EV6A 2CO5A 1R36A 4N4NB 2IGMA 2DA7A 3HKZA 1FZPB 4KISA 2OUMA 3AG1H 1FC3A 5A2QK 2EZKA 2CW0F 3OYHA 4DBRA 3S1MJ 2DA1A 4FTHA 4O6JA 1U2WA 1W36C 1SANA 1CF7B 1DPUA 1P92A 4PK4A 2VBXA 2QWWA 4L9JA 1W5TA 4ZDOA 2GXGA 6PAXA 1NK3P 1EH6A 2LTPA 3RIRA 3U1KA 2DPUA 3H5NA 3K6GA 2HOSA 1VI0A 2QUFA 2GQQA 4ZDLA 2MYSA 4HRIA 2DA5A 1ONVA 2O61A 3QQAA 4F93B 2BW3B 4G6TB 3AG3H 1PP8F 2E60A 4IVNA 3CTAA 5BOXA 3FXQA 5CVRA 2MC4A 2IJLA 5HS7A 5BPIA 3JRDA 2HZDA 5FFXA 3GO5A 5BMZA 4ZYEA 4XORA 1F36A 2PMUA 4LK1F 2FNAA 3VSKA 1IC8A 3I64A 2Y9ZA 2VJ5A 1NTCA 2RVCA 3BR5A 1PUFA 2HYGD 2EZHA 2HGCA 4B4CA 5KAIC 1BM9A 1MD0A 3M4OJ 3DEUA 1DP3A 1SEUA 3LSHA 3ERED 5HOOA 3H3VK 3A0HC 3D0SA 4EGYA 1Z3XA 2GIVA 2VASA 1TWFJ 1MMDA 1YS6A 5E20A 4CCJA 4HNTA 2HTSA 3E5UA 1W4MA 1BI3A 2NOGA 3BR1A 2KIQA 1P7IA 3BJOA 3IWFA 3QYFA 2IS2A 2ZKZA 1MSFC 5C3EJ 5IY5H 4FQGA 1IGNA 1MNEA 1QGPA 1R7JA 1V3FA 1ZN2A 5F27A 3EDPA 5DUKA 3OYLA 2XRNA 1FBSA 3MD2A 4OIQF 2L02A 2FXAA 3EUAA 4CZCA 3P9IA 3WHBA 2VI6A 3BTCA 3Q0WA 3OS2A 1T56A 2LKSA 4CO8A 1RPWA 1QVTA 4I09A 2Q8KA 3CJNA 3TO6A 2DJNA 3ZRGA 1OCOH 3OS0A 4BXXJ 3TO9A 2NYXA 2PG4A 5GAGJ 2KMUA 3E1SA 3FISA 3J80Z 2KT0A 5ICEA 1Z6RA 2R7DA 1TQIA 2OZUA 2XAFA 3PNTA 4CSWA 4GYIA 4ENMA 5D5VB 5GADJ 1WZ2A 4B09A 2V1DA 2HVRA 3GFLA 1YITI 3MZYA 4LG0B 2WADA 3DPTA 3J81Z 3WTSC 1S6LA 2WWYA 2HVQA 1MH3A 1YIOA 3HB9A 4Q48A 5FFZA 1OR7C 2HOEA 1P6RA 5EEGA 1OYYA 1UHWA 5CVJA 1ZHFA 1IUFA 5JFRA 2ID6A 2BBYA 3DEEA 1HSTA 2E2HJ 1P9QC 1WQ2A 3FWEA 4QWQA 1NG7A 1R22A 3M8JA 3KP7A 2TCTA 3MKLA 3J80K 1E3PA 1YG2A 3Q3SA 3QP5A 2HXIA 4Q5SF 2JA5J 1OYWA 4Z6YA 3HEFA 5D8KB 1T39A 1O4XA 1OMIA 3S1QJ 2A5WA 1TC3C 2A05A 2QQBA 4UVBA 4BQQA 2JQ7A 3HKZN 3F22A 4IPAA 2H6BA 2K85A 1RRJA 2FX0A 1GVJA 4CYDA 2VONA 4HG2A 4CHUA 2HEOA 1HDDC 2K9LA 2DMTA 1ON1A 4EQQA 1MSEC 3R6SA 4A3LJ 4NC6A 3QRFF 3TL4X 3I4MJ 2ZBKA 3DV8A 2ESNA 4EJOA 1K79A 5H2FC 5FGMA 5M3FJ 2P4WA 1FX7A 1U9OA 1F9NA 3FXKA 3V7RA 1AWCA 2EIKH 4Y17A 4C3JJ 3GYHX 3KLOA 1K78A 5LGTA 2JA2A 5J3LA 3LSRA 2E7WA 1WJDA 2YS9A 3P7NA 1S7OA 4MTEA 5GPAA 1DUXC 9ANTA 1A5JA 2PJPA 2XB0X 1Y1WJ 3QYBA 4W97A 4X1EA 2WY8Q 3WTVC 1RNLA 2IW5A 5E8IA 4EM2A 3LL7A 4HQEA 2VBWA 3K4NA 4AWXB 1WI3A 1U8BA 4AYBN 2M2EA 2QQAA 2K9MA 3DEWA 4N4OB 3VEPA 3Q9VA 4KDPA 1U0JA 2MBFA 1D5YA 4M6YA 3JTGA 1WJ5A 3KZZA 4C9YA 2BV6A 3CCYA 3IH3A 1F43A 1O3TA 1H0MA 1Z21A 2GXAA 2Z99A 4RB3C 4IOAF 2W84A 2V1UA 3GLXA 1P7JA 4UV9A 3GFJA 5FJ8J 3HOXJ 3K70D 4EJWA 2QZ8A 2ZMEA 5J8CA 4I02A 2CUJA 2HVSA 2R7ZJ 2L2OA 1XCVA 3DBRB 4BDZA 3H5AA 1IN8A 2V6EA 2M0CA 3BWGA 2Z2SB 4K2EA 5D8LB 1J7KA 2DOFA 1J59A 4A93J 4FISA 1WKMA 1F1ZA 1JKRC 3HRSA 4A0ZA 2L01A 3M8EA 1YRNB 2M87A 3GUDA 4XKVA 2BZTA 1U8RA 3FM3A 4PSXA 3ZMUA 4AVZA 3RZDJ 1TW3A 3HRTA 1I3AA 1NG6A 3G1OA 5LHGA 4IHVA 1N25A 2OV7A 3CO6C 3LFKA 5J1RA 2UV1A 3BP8A 4HLYA 2VKHA 1WSUA 4LB5A 3TW6A 2IA1A 2GOXB 1EH8A 3PQJA 2QKMB 5B1AH 2IRFG 1XS9A 3K9TA 2DN0A 4UUSA 2EIMH 4AUXA 3SZGA 3P5JA 3CMYA 2JT1A 2CUZA 3DQVC 5LD2C 2LKXA 3C2BA 1BW5A 3SEQA 4DBQA 3S32A 4HDUA 4UB6C 2NAZA 1DU6A 1YO5C 3PUBA 2I10A 3EUHA 1WHUA 1GHCA 2JA6J 5CVUA 4H0EA 1IF1A 3CCQI 1YQAA 4XLNF 1BI0A 3RYRA 3JTHA 1JE8A 3K4MA 4RGUA 3T0YA 3HG9A 3KIOA 4CYCA 3IRRA 4N9HA 2ECCA 4S0HB 2B7EA 3A02A 2O03A 3M1EA 3LSJA 2D5VA 3F8NA 4R1HA 1Z77A 3HUGB 2CU7A 5ERIA 2X1EA 4FE7A 1TT0A 4EATA 1VQNI 4XR6A 3K4BA 3KE2A 5DV5A 1D3YA 1QVUA 2LBFA 1H88C 4LOCA 3PNVA 1FTTA 1W7PB 3OYEA 1YYVA 2K4JA 1DP7P 2P7CB 4CCKA 2NS8A 2BW3A 4CXFA 3TOAA 3WGGA 3HIFA 2KHMA 3TGNA 2COMA 3ABTA 3GFIA 2Y69H 5IP9J 5EDNA 3ZOBA 4BHPA 4Y15A 2YPRA 3RPUA 2EWNA 5HLIA 2ME6A 5LEJA 3HSEA 3UNGC 4IQ4A 3OYGA 5EZHA 3G71I 4RDUA 2DFIA 4PJMA 2BHZA 1HA8A 3A2KA 5L3EA 4ZZLA 1K4SA 4NBQA 2Z1DA 1MNMC 3EQLF 3WHCA 2O0YA 1MNDA 2WAEA 5K5QA 3OYNA 4RS8A 4NQWA 3L1PA 2UXNA 2OQRA 2GOMA 3C1DA 4IHSA 4ESFA 1EH7A 1L3LA 2VKVA 2Y0MA 1T98A 2ID3A 4XLEA 1GXPA 3HC7A 1MBJA 3OIOA 4ENKA 4HZFA 5FB2A 3ECOA 4NC7A 4J19A 1TWHJ 2F5VA 3FMSA 4L5JA 2O8XA 1FYMA 4I2OA 2HQAA 3IAS2 1WJFA 2F5DA 1RUNA 1REPC 2QQ9A 3K2ZA 1I39A 3HGGA 3AL0B 4JP0A 2I5UA 3CP2A 1G3TA 3H5RA 2Q2EB 2Y2ZA 2LSOA 3JRGA 1WWXA 2DA6A 2EB7A 4CCMA 5F0FA 4ZYGA 2MG4A 3KP6A 1YRNA 2JA7J 2H1LA 3SJMA 2CV2A 1X1CA 4AU7A 4BJ5C 4EM0B 2V1XA 5E1ZB 1VQOI 5J6XA 1B1BA 5ICFA 5E3OA 4BUPA 1NH3A 2R7XA 1KU3A 2FF4A 2R7RA 3U21A 4DZJA 4Y4RA 1ZH5A 1FPQA 1YI2I 2MLKA 2ZMEB 3ZQQA 2IT0A 4P9FA 3EUHC 2EFPA 3WODF 1UFMA 2MD5A 4PCQA 1X19A 3FXOA 3S93A 3HOYJ 2DT7B 4A5NA 2IGOA 1ZGJA 3UKGA 2P7VB 1P4WA 3WTUC 3KPHA 4XN3A 4NDLA 4G7ZF 2M8GX 4L5EA 1XDUA 3CZ6A 2BY2A 4RGSA 1SC7A 5ILSA 3HGYA 1O7LA 2FNPA 2HS5A 2F48A 4JX6A 3OS1A 3J7AO 2QSFX 2WAQN 3S15J 1LPQA 3PJRA 5JI6A 2KJBA 1JHFA 3K4LA 2K02A 5D5WB 4B47A 5LGNA 1G3SA 3KX2A 1AHDP 3DU6A 1USSA 3JW4A 3N05A 4U7DA 1BN5A 3GZNB 4HDVA 2KDOA 1U3EM 1VQ5I 4ZDPA 4CYCB 1J0RA 3WU2C 3PNYA 5DCFA 1T38A 2W7NA 1SAXA 1DDNA 2A5YB 4HX4A 2FUG2 2W24A 3CJQB 4GXOA 2A68F 2XGEA 2E1MC 3ZMDA 1UELB 1E2XA 2DJIA 2M5WA 4XM3A 4BJ6C 4CCOA 2LD5A 2VBZA 3E6CC 4HV5A 2JRMA 2WC2A 3HDDA 4A3CJ 5HNHA 1PUFB 4XQFA 3AG4H 4IL6C 2K7LA 2VIXA 4MQVA 2JSCA 1B8IA 5E1XA 1U9NA 2RKHA 1JKPC 1JTYA 1IN5A 3HSRA 1FYKA 3QP6A 1ORKA 1BIBA 1IN6A 1OFCX 2L3DA 2RNJA 4WF2A 4AC0A 2HDCA 3HOZJ 4OWRB 1KU7A 2BY1A 4UUSB 4IJAA 2M8EA 2QVOA 4U87A 5FLVA 1ZQ3P 2EFOA 3ZXSA 3K4JA 1RR7A 3BQYA 5BS6A 4DGWB 3CF5F 3ZMVA 2F6CA 1Y6IA 5EG0B 2DTRA 1LE8B 1R71A 4RB0A 3VYTB 2P6TA 3L2WA 5KNLA 2RQPA 3ASNH 4YIRX 2E5ZA 1MMAA 3M7GA 3CUQB 2DW4A 2IXSA 4OIOF 4DYCA 1ERDA 1A6IA 3BG7A 2V26A 4HA8A 5IOYA 2K5CA 3CJRB 4BYYA 1H89C 2ESHA 5HDNA 4EJTA 1H9GA 4G7HF 3IWZA 3QWLA 3RKQA 1FSHA 2ICWG 4WXHA 2HTJA 2EPFA 4U0YA 1JJ6C 3BCBA 2QF7A 3OIQA 3COAC 4C2UA 1APLC 2R7TA 1Y8RB 3TBIA 4IHTA 5FRNA 2ME0A 5J1UA 2D1VA 5H20A 1W0UA 3OR2C 2Q2EA 1OCCH 2JZYA 2FBHA 2AXTC 1R4NB 4V2GA 2XAGA 1R1TA 1OCZH 4BDYA 1HQCA 2EA2A 4MFDA 3WU0A 2VOOA 1FLIA 1LUJB 4XIDA 4OIRF 2GZWA 1PDNC 3VDXA 3K70C 3RKWA 4Y52J 5FLMJ 2HWVA 5B3SH 3MVPA 5GPCA 2JMWA 3FMRA 4Q47A 3CCSI 1YS7A 3TW7A 3E5XA 5L3DA 4ZZDA 1IN4A 3OSGA 1UMQA 4MIMA 1HKQA 4G7OF 4O3MA 3R0JA 4IRGA 2X6YA 2DDAA 4HF0A 3GTPJ 4DIQA 2XAQA 3KYDB 2WAQA 1USTA 4KIGA 4ZTJA 4RBOA 2LOOA 5CLSA 2R7VA 3U9GA 4BEHB 3DWLE 4C2MJ 5LHIA 2DMUA 2CSOA 2E1OA 5ED4A 2KJCA 4DNCA 2VQLA 3V4GA 3HTUA 5F0CA 1CGPA 3Q0UA 3ABMH 2LH9A 1GXQA 4M73A 3CUQC 3FKJA 1LDJA 1G59A 3F8MA 3DCFA 3EYIA 4A3EJ 2E1CA 3DKYA 5FD6A 1D1CA 4BQAA 2DK5A 5CPRB 2NXNB 3SDBA 3TKYA 2Q0OA 1HW2A 1I3QJ 1XMAA 2CJJA 3CCEI 3C2GA 1ON2A 1MBFA 1SVLA 2XGDA 4YG2F 2CUFA 1QZYA 4DOZA 2L9NA 2GA1A 3KZIC 3TMOA 2VODA 3M1CA 1SFXA 4KT5C 2XAHA 1S3JA 1YJWI 2G7HA 3BG3A 2XVCA 2NVQJ 1YE9A 1N78A 5D4SA 1N75A 3D5SC 1W1WE 1HF0A 3CD6I 3I3LA 4JQFA 1K61A 2VQCA 2H6CA 2VC0A 1TWCJ 1QPIA 5DEQA 2DMPA 4W1UA 4IHWA 4DZPA 2LP0A 1RIOH 1EF4A 3L2RA 2HQ5A 1IUYA 2M0MA 4M3FA 5LFAA 5E3MA 1S7AA 3ROUA 2JPCA 4KIBA 5ICCA 3OYBA 4GRIA 4OMZA 3N97A 3ABLH 1KONA 4BKXA 1BI2A 3V8LA 4R8HA 4FCYA 1RC9A 2K86A 3JAMZ 2MA3A 4IZZA 5FLXK 5D5XB 2VT2A 2WB1N 2W82A 3GTLJ 4ENNA 1FMVA 3OYMA 3JRHA 3TQNA 4RAFA 2LYCA 3BOQA 3ML6A 4XSZF 2PEXA 3C18A 4KUMA 3T8TA 3S8PA 2DDBA 3WTTC 1MBEA 3LNQA 3B6AA 3DLAA 3ABKH 4M71A 1D0XA 4KN7X 2XB5A 5HLHA 4RLQA 3E6MA 1I5ZA 4BXFA 3NARA 3PSIA 1T0FC 2QQ8A 3GCMA 2MC3A 1W7PD 1UCRA 2QSGX 1YX3A 1WH5A 3HHHA 2WV0A 2E71A 4NUBA 4UVAA 3BTJA 1SD4A 3I4PA 4NQWB 2B9SA 3PQKA 1TNSA 1Z0XA 5BPDA 1FY7A 1BW6A 1MW7A 3DTEA 3J81K 4OINF 3MEXA 2BXYA 1OR7A 2JTVA 4S04A 4KIFA 3KETA 3I56I 3PM1A 4LJZF 2MH2A 1W0TA 1J09A 2JUGA 3KP4A 4IEJA 4U0WA 5EZGA 4MNUA 4MO7A 5HDGA 2VLAA 4E7LA 4F91B 2QEXI 2HDWA 4XSXF 3LMMA 2R92J 3HSFA 2XF5A 5FLXZ 1BA5A 1FTZA 3FF5A 2A61A 4GFBA 2DOEA 2FU4A 4KT6A 2HOTA 1V5FA 2F5CA 4Y3OA 1BIAA 4BXUA 2H1KA 3ASOH 5J47A 3K2AA 1XCBA 5BNGA 1H8AC 3A1YA 4KICA 1X2MA 2IPQX 3LSGA 3GLLA 2ZCWA 3DU5A 3KP3A 4A3KJ 1O3RA 2R7WA 1R5GA 2JRTA 2FQ3A 4EJUA 1YJNI 1LQ1A 1SD5A 2BEOA 1OPCA 2WA0A 1Z9CA 4I01A 4U0VA 2ZFWA 4L5IA 4PFOA 1G3WA 2DT5A 1IN7A 3MN2A 1RESA 4P1WA 1TT5B 2NOJB 1FT9A 3GMEA 3BG6A 4BEHA 4KJZA 1ZGWA 1V4RA 4OAYA 2HPMA 1Y0NA 5J4YA 2DCEA 5LGUA 1XG1A 3OY9A 5AONA 2V79A 1HKTA 2BY3A 1FNNA 1G3YA 5L3FA 2AQEA 4YFNF 3HL2A 4FT8A 3S3MA 5J40A 2M34A 1TLHB 3CQZJ 4DJAA 1LDKB 5LRRA 3LFUA 2M1BA 2DMNA 3UR3C 1R1UA 3LA2A 1W36D 2GM4A 1V5EA 3BLYA 2XF6A 2ZJ2A 4B44A 1UHSA 1Y56A 1YLFA 2HQRA 1X1BA 2FBIA 1IDZA 2CQQA 3ZQ7A 4KMFA 3FXLA 1AA7A 2UUZA 2Y31A 4UB8C 5H6QA 1D0ZA 3CO7C 3SYTA 4XOTA 4G6DA 3PSFA 3HOTA 4UUVA 2OZ6A 1BC7C 5AIQA 3BR0A 1JGSA 3GTGJ 3RZOJ 2JN6A 1D0YA 1A04A 2JK3A 4AYBA 4PGHA 3LSTA 3GZ6A 4E70A 3DPLC 1A6QA 1X4OA 1DGWY 3K1MA 3RPUD 2P8TA 3MMYB 1Z7LA 2LFBA 3LSMA 2GIZA 2O5RA 5D6EA 2X9DA 4NB5A 3L9FA 1EA3A 1Y39A 3GTQJ 3R60A 2XSJC 5FKKA 2PBIA 3CP8A 3I59B 1R49A 3J7YJ 2V6CA 1HBXG 2E2JJ 1WI9A 4A6DA 4XKBA 5GTHC 1HW1A 1ODDA 2LRDA 4KFCA 3VYUB 3BR6A 4M74A 3CUQA 2KZGA 3KLNA 3OR1C 1Z91A 1WJEA 5KAFC 3S2WA 1RKWA 4YELA 5F08A 1JGGA 3S3NA 3HTSB 4MEXF 3WE3A 2K27A 3NAUA 2EINH 2N8GA 5JVTA 3ZMTA 3K10A 3MFKA 1VQ6I 1ZYRF 2J5OA 2EV5A 1YHQI 3JRFA 3O3KA 3AFHA 3IKVA 4WWCA 3E3VA 2XPUA 1FP2A 3ZR8X 1ZG1A 1I1SA 2HXOA 2OBPA 1ZRFA 2L7MP 4MGRA 2Y30A 3NRVA 1SVOA 3O8HA 4MLOA 3S1NJ 2HFHA 4N9IA 4A12A 2PMZA 4M3EA 5FKNA 2RC4A 2EK5A 3MKYB 4BACA 3W2VA 2FEZA 2DYSH 1QO0D 4A69C 1KGSA 4OU0A 5B1BH 4LLNA 4A3DJ 3QOEA 1Y8QB 1GDTA 2V9PA 2PMHA 1FYLA 1B72A 1P4AA 1B8IB 5J8FA 1SD6A 1K83J 4XN0A 1TP4A 4BJTA 1XX5A 4CCLA 1XGOA 1IAWA 2MW8A 4E7ZA 2VQHA 5CVVA 4A0XA 5EJCA 4L0YB 3ESWB 2L4AA 1T2KA 1C0WA 2ZNZA 3GEZA 4L9TA 5HS8A 5E18F 1POGA 1XB4A 3CC7I 2CW7A 2KISA 2K40A 3SEZA 3CCRI 1U5TC 2KRFA 2QKLB 1U78A 2STWA 3HOSA 2B63J 1L0OC 4B3XA 1T0FA 3I5UA 2ETHA 3OV8A 2ZJRF 1SD7A 1MIJA 3OMYA 2IS4A 3PIPF 4UY8I 4OIPF 4HSTA 4A3BJ 4XLCA 1F4KA 1BOAA 2VQGA 2ELHA 4DW6A 2WAFA 2XAJA 3G2BA 5E8GA 5F0HA 4CICA 4I7HA 1A36A 2Y0SN 3KYLA 3LSIA 1ZRDA 4LLGF 1MJAA 5M3MJ 1LDDA 2DA2A 2X85A 3CDLA 2I8DA 5GTIC 2VJJA 2GBYA 1KU9A 4LLLA 2A69F 4HEA2 5IYBJ 1X1AA 3GW2A 1ZREA 2XASA 2Z5UA 3QPLA 3VFZA 2W1OA 3NWSA 4IRIA 4IHYA 4LGWA 5DYMA 2CGPA 1KU2A 4BQOA 1FEXA 3OOUA 3VPRA 5FROA 2FOKA 3KYCB 3ZQHA 2W00A 4AIJA 1NHAA 5L3CA 3M9AA 3VB2A 1YW8A 3BZCA 4X0GA 1XDSA 5CQEA 2X6XA 3HOVJ 1GUUA 1JT6A 2OCCH 5FKLA 2CQKA 1BJZA 2VOPA 4HNVA 4LFUA 2W25A 4O5VA 3GTKJ 2E7XA 1IRFA 3IH2A 1WRJA 2HKXA 3F72A 3FHNA 1JKOC 2OJED 2OU2A 4GO1A 3V42A 1H9TA 2OPTA 5CVIA 3K1NA 4PJJA 3SZTA 2VXZA 4XLFA 1QPMA 5L3BA 1JI8A 2FMLA 2ZNYA 2E2IJ 3AG2H 2DA4A 1O57A 3W6KB 4D9JA 2J5PA 1F5TA 3KFWX 2O8KA 1B72B 2QBYA 3RQIA 1RZ4A 3M8FA 3IRQA 3WTXC 3RI4A 2VE9A 2DT6A 4IRHA 1QHHD 2XHKA 4G9YA 3Q0VA 2JJ7A 1YTYA 1BC8C 2NVTJ 1ITYA 1LKXA 2RQQA 3D5LA 2A6EF 3HHGA 2LF7A 3FBNB 1E3HA 3K4KA 3QPTA 1R00A 2HNHA 1S9HA 1LVKA 1FWZA 3VODA 1UG2A 4JYKA 1M1EB 2EIJH 3VOEA 4G8XA 1V54H 2P81A 3HJEA 1OISA 4XLPF 3IV5A 3HRMA 5IP7J 4QIWN 3CUOA 4D7NA 1QBJA 1TBXA 2EZIA 3JSPA 1VQ9I 2LLKA 2CV1A 1E3OC 2DO7A 5FKOA 4A3JJ 2YU3A 2PJRA 3JR9A 2DFEA 2M4KA 2RREA 5FRMA 2O3FA 2DYRH 2MGQA 2KIUA 1P4XA 4II3A 3ZQIA 2DBBA 5LHHA 3GXOA 5F64A 2PMZN 3RTRA 3Q9SA 2UWMA 3ZQFA 2ZB9A 4L9NA 4A6EA 4KNYA 1KQ8A 4HOBA 1SVMA 1J75A 3DLLF 4AVPA 2R4GA 3OL4A 4Y7NJ 3OYJA 2BOLA 3D5RC 3BPVA 1A35A 3L09A 2ISYA 4E7SA 3KEQA 4PUSA 3CMMA 3DKWA 4OMYA 1X4PA 2R0QC 2IAIA 3TOBA 3WTZA 4M9ZA 1AU7A 2K3PA 4DYQA 1HCRA 2EQRA 3OWTA 1MMGA 1VQ7I 5DD4A 4A3IJ 2CV0A 3SFIA 3F0CA 1IXSB 2Z9OA 2LMDA 3CCJI 1Z3YA 2OC6A 2LKPA 4P9UA 3BROA 1XSXA 3OYCA 1KZHA 4ON0A 2GXBA 4QPQA 2X48A 1HDPA 1CQTA 3ZN1A 2DFHA 2KKOA 2RNGA 3JSOA 4V19K 1S29A 2LR8A 4P55A 1B9MA 1XGMA 4IQJA 3O2PE 3GF2A 3PO2J 4ITVA 5EEHA 2H8RA 1FOXA 3QAHA 1KA8A 2OAZA 2JWTA 4D7MA 1WPKA 2OA4A 2KDZA 1MH4A 3U1DA 5E3NA 3JRCA 1WH7A 2ZFUA 1EKEA 3OYFA 4EJVA 4ESJA 3FX3A 5GP9A 1OYIA 3KP2A 3CCLI 2LY2A 2HQNA 4NC8A 5K7ZA 3MZ8A 1KYZA 2V9VA 3BQZA 3V8KA 4LIUA 2B0LA 2DA3A 3FXRA 4A5MA 4E7IA 4PSWA 2DQLA 3DTIA 5JHFA 1B6AA 5DM6F 2JUCA 5F1JA 2XSDC 2WB1A 4GYGA 2IVMA 4MEYF 1TWAJ 2DI3A 5KHDA 3SXYA 5B66C 1HW5A 4EV0A 3GTJJ 1BR1A 3DXJF 4IX7A 3DKXA 5HLGA 2HYJA 2NVYJ 1TTYA 1ZELA 5TGTA 3AAFA 4WXCA 1LEAA 3F9KA 1I6HJ 3W2WA 1IXCA 1XMXA 2XKOA 4E6KG 3OYAA 3CMEI 3GVAA 1RI7A 1VZ0A 4B48A 1ACIA 5EG0A 2A07F 1P2FA 1K6YA 1YW9A 2D1HA 2RV8A 3K1PA 3K7AJ 4UUTA 4FE4A 2HI3A 1PVEA 1JXSA 3QU3A 5M5YJ 2R93J 1I1GA 2L4MA 2CFOA 4N0BA 5KK1A 2EILH 2ZXJA 3H9GA 1HKSA 2W4SA 3GZ5A 3H35A 3QODA 2MD0A 2KRHA 3F6OA 2WY7Q 3PO3J 5LLQA 4IF4A 1R4MB 4ZH4F 1V5GA 3HBLA 4HV6A 3VSLA 4CH7A 2O7OA 3CLQA 2CRGA 2VJIA 1BL0A 1SFUA 3A01B 2Y75A 3DTKA 1X3WB 2EFWA 3RKYA 3IH4A 3EYYA 2XDVA 3RDIA 2LNBA 1QZEA 4YFKF 2F5EA 1FBQA 1Q1HA 4XNFA 5LEKA 1MDMB 2Q1ZB 3OYDA 4BHCA 1DPRA 3H36A 4LIVA 4ENJA 3ECHA 4F92B 3I0TA 1D8JA 1ZTRA 3I71A 2BXZA 3VWBA 4CUGA 2H8WA 1SMTA 4Y33A 3V7SA 4YRVA 2ACJA 5CKTA 2M7BA 1Y1VJ 4ANJA 4BQNA 1ZG5A 4C2TA 1NK2P 2VKEA 4XLAA 5AIPA 2FBKA 5K7HA 5L3GA 4EM1A 2DXIA 3GTOJ 1ETOA 5K1YA 1JTXA 2EA4A 2D45A 5GAHJ 3RPQA 2OTLI 4MFEA 4J01A 1JKQC 4ZTFA 2KPMA 4BE0A 2STTA 3CDIA 3LAPA 2AO9A 5JLXA 3BT9A 2RAEA 2AS5F 2XIGA 2FD5A 3S2HJ 3ZQCA 2AXLA 1O3SA 4HSRA 1K4TA 2FA5A 5E17F 3L00A 1MGTA 5LBQA 2IP2A 2COBA 1T6SA 4I0BA 2KIMA 2VC1A 2JVGA 1J5YA 1XGNA 1BR2A 4CCNA 2LY1A 2YX4A 4XLHA 5TRDA 2X4HA 1VTNC 3JRIA 4JK1X 1ZR4A 3KP5A 2R7UA 2E19A 3HPHA 3REOA 3F8BA 2IGKA 4RB2C 2XUBA 2DMQA 2KLOA 4FETA 3I59A 5CYVA 4F3QA 1YJ9I 1GVDA 2EFNA 3NWTA 3I54A 4RGXA 1IG7A 3T5XA 2L9VA 1D1BA 1WJBA 1VF9A 2LDUA 2H94A 1KYWA 2PFBA 3C7JA 1XSVA 4HNUA 1IRXA 2CH0A 3MZHA 3HOUJ 2XGCA 3P9KA 5DCMA 4M9SA 4RM3A 3BG5A 4KYWA 3GFMA 1R5HA 3JRAA 2K9NA 1O3QA 4LITA 5IT9K 2R5ZB 3IAM2 1MMNA 1G8XA 3W2AA 1PP7U 4M3GA 3ULQB 3GBGA 4YFXF 2NRAC 2HR3A 2P6SA 2R7FA 5EYRA 1OQYA 2XAUA 3HPGA 4OAZA 2Y48A 1D1AA 4RAYA 4BL0B 4BU2A 2LY9A 1QA6A 3MWMA 1O7FA 1WVRA 2Z16A 4C30A 2FMYA 3BTIA 4QSHA 4E7HA 3PFYA 3ZMSA 2PN6A 4XKCA 3E6DA 1EJ9A 3NQOA 4HQMA 3L2QA 2GWRA 2HKOA 5IOZA 3RSNA 2HDDA 1G6NA 2JVHA 3LSKA 3FBIB 2KFDA 1TQMA 2PLYA 1VQMI 4XRSA 4HLXA 4BNCA 2NNNA 4UHTA 3F21A 2VPRA 4XL9A 2MFZA 3ISPA 3LQQA 3G4SI 3WTYC 1XD7A 4H4KC 4KN4X 1G4DA 2DOAA 4PJNA 3LA3A 1R9TJ 2BVLA 4RA2A 4XOPA 1RKTA 2XPWA 3LSPA 3IL2A 3RCOA 4UNOA 3DF8A 1W5SA 1GV2A 3ZQGA 2RDPA 3ZN0A 4HX8A 5F04A 3N4MA 2F4IA 3L7WA 3SDGA 3T8RA 1MDMA 5ICGA 5M5XJ 3BZ6A 1S7EA 2VE8A 3NEUA 2FJ1A 1J2XA 4BS9A 5GAEJ 3OYIA 3EPZA 1ZLJA 4TV7A 2ZC2A 4XRFA 1RETA 2PI0A 5K7FA 3Q5FA 3PL8A 1SFOJ 1WJAA 3LWFA 2HOAA 1RR8C 4L18B 2RN7A 3HZJA 2Y9YA 2IA2A 1FMWA 4MHGA 2LREA 2E1MB 1GV5A 3SQNA 4CZZA 1ZAOA 3K0LA 4HF2A 5B5EC 1UB9A 2E36A 1IO2A 3V8JA 5LRSA 2FOWA 3D1NI 4IXAA 5J1YA 5DD8A 3A4CA 1OLTA 5IP6A 2HPIA 1ZARA 4WXDA 1VQLI 2ZJQF 2VB6A 3AL0C 4XMYA 3CESA 3B6CA 1VNDA 4UXNA 1BOBA 1X58A 1FIAA 3K69A 2P5LC 4IHXA 3S16J 2L9RA 2Y0SA 3OIPA 1LVAA 3GX4X 5HODA 2A6TA 2HYFA 1QNTA 5IYCJ 5E3LA 3RQ4A 3FHZA 4D5CA 5DM7F 5D5UB 2A6HF 5KCMA 3ELKA 3S1RJ 5IYDJ 1ZK8A 3I4NJ 4M3BA 2EV0A 2QM3A 3RJPA 4I99C 2F5FA 5TJJA 3FDYA 2QCOA 1FP1D 1B9NA 2FQ4A 2X6OA 2XRLA 3M3YJ 2WBMA 3FKIJ 2V1NA 2H27A 1MMSA 2Z3YA 2R5YA 1R58A 1TL8A 2ADUA 1ENHA 4RM2A 3FXUA 1FIPA 3IUOA 1IZ1A 5TISC 3BPXA 3G6EI 1FJLA 5HNFA 4BBSJ 4ASNA 3CDHA 4YIFA 3MKZA 2E5NA 3R4KA 3I58A 3WGHA 1Z05A 2TRTA 3VYSB 1Y0UA 3GWZA 4A3FJ 5EGOB 2X6WA 4ZYHA 2YU9J 3DP7A 3FMQA 4AIDA 1Z67A 1X1DA 5DTDA 2ZSIB 4WCGA 4IOCF 3BR3A 3CJTB 4FASD 3QOPA 5ILVA 2GLOA 1PYVA 2ZXIA 4A3GJ 4MTDA 1TZLA 1ZLKA 5A2QZ 2QYOA 2BY0A 4EGZA 3DFGA 2KZVA 3OYKA 3PFIA 3HRUA 3G1LA 1OKRA 2R7OA 5E79C 1JJ8C 1R1VA 1X2NA 3BCAA 4GCVA 2AQFA 1LFUP 3OL3A 1VFCA 2EZLA 3ZPLA 3G3ZA 2BVMA 2LK2A 1V55H 2CS3A 2RGVA 4A2UA 3QU6A 2CYYA 1DU0A 1X3UA 1UG0A 3CMAI 3V7CA 1U5TA 2R7QA 3WGIA 1W5CC 2CQ7A 4LB6B 2E34A 2ZJPF 3EUKL 1JUPA 2LG4A 1GT0C 3C2HA 2DU9A 4C3HJ 1K6OA 5F6FA 5C4XJ 4FHTA 4FX4A 3S3OA 3RKXA 1AOYA 4ESBA 2K9SA 1LFPA 2L7ZA 3FK7A 5K5OA 2F4MB 2DQRA 3BJ6A 3S17J 2QENA 2NS0A 3DBHB 3BG9A 1S5LC 2IA0A 2M30A 1IRGA 2BYVE 3MCZA 1VQPI 1EV7A 2XGXA 3CCVI 3M07A 5CJ9A 4BY1J 1MBHA 2ISZA 4HPQA 1QRYA 4HW0A 3W6JB 4BE2A 1OCTC 1T8IA 1JHHA 1BI1A 2D2WA 3SHFA 1FSEA 2P5KA 4II2A 5FKMA 3FM5A 3VYRB 1UAAA 1SFKA 2FE3A 1QHGA 2X1DA 2VN2A 2L7FP 4NHJA 2NS7A 3F23A 3B73A 2O6GE 3WG7H 4KA4A 1AKHB 1HSJA 2M9HA 4AIKA 3MKWB 3PUFA 2VL8A 2L7KA 1DGRM 3L2VA 2XV4S 2CQXA 3CF2A 3HYIA 1MJ9A 1DQUA 4D1QA 5HLTA 4YEJA 3IP4B 3H3UA 3MQ0A 3ZP5A 1Q1VA 5H6RA 3FXJA 1ULYA 3SZPA 2DTZA 2P0WA 4XBFA 4XRMA 3H0DA 1T08B 5D4RA 2EH3A 4QPOA 3WTWC 5DUIA 5K5RA 2M4GA 2NVXJ 4LMYA 5D6FA 4RMNA 1SFEA 4EEFG 2VBYA 2K3FA 3E0JB 3WG9A 3CCUI 3S14J 4JX5A 2AHQA 2L0KA 5DCMB 4ZJZA 3A03A 1YX5A 3TP3A 5JR3A 4GDFA 4Y13A 1IRZA 4CDGA 1UHMA 1IXRC 1JUSA 2VUMJ 3ONQA 3I53A 4J00A 1Z6TA 1ZKGA 2KL4A 2LC2A 1Z7UA 4AIHA 3U2RA 2YR2A 4E7JA 2GA2A 2W48A 4XONA 2OF7A 4BH9A 2ZMEC 3L2UA 2G0EA 5CQGA 1KQ0A 2ELJA 5HVQC 5IT9Z 3O8GA 2CQNA 2DLLA 3W3CA 2NNYA 1IV6A 1IW7F 5EEAA 1FOKA 3O6BB 1OCRH 4V2FA 2L5QA 3KZYA 4G94A 3LQRA 1SAUA 2XROA 4JBAA 4YIIA 4BE1A 4BGDA 4L0ZB 4PJLA 2QLZA 4RB1A 1YFHA 2F2EA 2ZXWH 1IV8A 5HDKA 3KCCA 4DQ2A 2K4BA 1U6GA 2W85A 3H92A 1FOYA 2ZXHA 2WTEA 1LFBA 3B02A 3P9CA 3AKZA 3TDZC 1ZRCA 3S2DJ 4NNJA 2YX7A 2EFQA 1WJCA 3J7AY 3LOCA 1ETXA 2ECBA 4IKFA 4XRSG 4M9XA 1MBKA 1HC8A 1ZG3A 2CUEA 3C3WA 2JSPA 2Z33A 4HAMA 4A3MJ 4HF1A 2XKPA 1IDYA 3A01A 4CGZA 2QBYB 3TDUC 2VKDA 3OSFA 1VQ8I 3DPUA 1TWGJ 2PQ8A 1X1PA 5KVRA 4Z2YA 2O9LA 1MBGA 2VT3A 2YUSA 4LD5A 2R3SA 1VQKI 4PFPA 4B8XA 2V9KA 3E97A 4LK0F 4AD9A 2WV1A 4WK8F 2H09A 1S8NA 2R5ZA 3H0GJ 1QQIA 3I9V2 5JLWA 2DK8A 1E0EA 2XPVA 1HLVA 1YOVB 1Z1DA 4QLCU 3TEDA 1HOMA 5FD5A 3JAMK 4ZYDA 1B59A 2JPBA 4UVCA 2V4JC 1TQPA 2OQGA 1WCMJ 1XTAA 3DBLB 2KP6A 2QSHX 3ABUA 1QU3A 1R5ID 5M5WJ 1JUMA 3GTMJ 1I50J 1WGXA 5C4JJ 2CFXA 2OD5A 3JREA 4B1RA 3FK6A 1LJ9A 1MJBA 2CW8A 4I76A 4Q4ZF 3FIWA 1ETYA 3KEYA 4BY7J 2GAUA 4FX0A 3T1BA 1SMYF 4XICA 4XKWA 2ZSHB 2CWEA 2OCEA 2OTJI 3CLOA
chains in the Genus database with same CATH topology
4Y33A 4DBQA 4YRVA 5CKTA 3S32A 2M7BA 4U7BA 2VXDA 4ANJA 4KT6A 4BQNA 1WFXA 2HU9A 3PUBA 1V5FA 4C2TA 4Y3OA 4XLAA 2DXIA 2R7SA 3HXLA 3A1YA 3LSGA 2M3AA 3DU5A 2R7WA 3K4MA 4J01A 3HG9A 3QYEA 4ZTFA 2KPMA 4BE0A 4E4HA 2WA0A 4PFOA 4LG3A 1T95A 4P1WA 2NOJB 4HSRA 4BEHA 3BG6A 4KJZA 3HUGB 4OAYA 4ZYAA 4F55A 2HPMA 4KITB 2DCEA 3OY9A 2X1EA 4EATA 1TT0A 2AQEA 4XR6A 3HL2A 3K4BA 2JVGA 2VJ4A 3S3MA 1BR2A 2LBFA 4DJAA 1LDKB 2LY1A 3PNVA 4XLHA 3LFUA 4CCNA 3OYEA 4B43A 4CCKA 3UR3C 3HPHA 2R7UA 2BW3A 2IGKA 3H9QA 1W36D 1V5EA 3BLYA 2KLOA 2XF6A 4FETA 4B44A 1Y56A 4F3QA 1X1BA 2KHMA 2CMPA 3NWTA 3H9JA 1AA7A 2UUZA 1D1BA 1WJBA 1D0ZA 4HNUA 1IRXA 2CH0A 4XOTA 3SYTA 3UNGC 4IQ4A 3PSFA 3OYGA 3HOTA 4RM3A 4PJMA 1D0YA 1HA8A 4LITA 4AYBA 3A2KA 3IAM2 1MMNA 1G8XA 3W2AA 3DPLC 2MABA 1X4OA 1DGWY 3GBGA 2Z1DA 3RPUD 2XAUA 3MMYB 1Z7LA 3HPGA 3LSMA 2L9SA 2O5RA 4OAZA 1MNDA 2WAEA 1D1AA 2X1CA 4BL0B 4BU2A 3OYNA 3ZCOA 1EA3A 2GOMA 2XSJC 2Z16A 4C30A 3CP8A 4E7HA 4CA0A 3PFYA 2KQRA 4XKCA 4XKBA 1GLNA 4XLEA 4ZC3A 3L2QA 3HC7A 2LRDA 2PJRB 3VYUB 2XC7A 1N77A 3RSNA 2JVHA 3LSKA 3OR1C 3FBIB 4NC7A 1WJEA 2KRCA 2F5VA 4YELA 3S3NA 2HQAA 3IAS2 1WJFA 4XL9A 2MFZA 4F52A 2XF7A 4P5OA 4H4KC 3AL0B 2DOAA 4R79A 2M7AA 3K10A 4JOMA 4PJNA 3CP2A 1PJRA 2BVLA 3H5RA 2Q2EB 4XOPA 2LBFB 2IS1A 3BC8A 3RCOA 4CCMA 1R6RA 3AFHA 2F4IA 2VPLA 3ZR8X 1BR4A 4BS9A 3OYIA 1X1CA 2CV2A 3EPZA 2IS6A 4AU7A 4BJ5C 4MLOA 3PL8A 1WJAA 4BUPA 2PMZA 2R7XA 4BACA 3MKYB 2R7RA 3W2VA 3U21A 4Y4RA 1FMWA 2LREA 2E1MB 3ZQQA 3EUHC 3QOEA 1X19A 3S93A 4XN0A 2DT7B 4BJTA 2IGOA 4CCLA 2IGNA 3A4CA 1OLTA 3K4CA 2V7FA 4XN3A 2HPIA 2VQHA 4E7ZA 4E7KA 2VB6A 3AL0C 4XMYA 3CESA 3CZ6A 1BOBA 3OS1A 2Y0SA 3OIPA 3PJRA 4RLFA 2A6TA 3ZGKA 2X51A 3RQ4A 3K4LA 4B47A 2CW7A 3SEZA 5KCMA 3KX2A 4N4NB 2QKLB 2IGMA 3DU6A 3N05A 3HOSA 3HKZA 4B3XA 4KISA 2OUMA 3OYHA 4DBRA 3OMYA 3FDYA 2KDOA 2IS4A 1W36C 2WBMA 2V1NA 4HSTA 4ZDPA 4XLCA 4PK4A 3PNYA 4RM2A 2W7NA 4ZDOA 3IUOA 2FUG2 2VQGA 5HNFA 3CJQB 2WAFA 3G2BA 2E1MC 3MKZA 1UELB 2DJIA 4XM3A 2E5NA 3H5NA 3LSIA 4BJ6C 4CCOA 3KYLA 3K6GA 3VYSB 5HNHA 4XQFA 4ZDLA 2MYSA 2X85A 2I8DA 4HRIA 2VJJA 2X6WA 4F93B 2BW3B 4G6TB 2VIXA 4HEA2 1X1DA 1X1AA 2E60A 2ZSIB 4FASD 1PYVA 2MC4A 2ZXIA 2W1OA 3NWSA 2HZDA 1TZLA 4OWRB 4XORA 4BQOA 4U87A 2KZVA 3OYKA 3VSKA 3OOUA 3ZXSA 2R7OA 5FROA 2VJ5A 2W00A 3BCAA 3K4JA 2AQFA 4X0GA 5CQEA 3OL3A 2X6XA 4DGWB 2F6CA 1Y6IA 2BVMA 2CS3A 1DP3A 3LSHA 3VYTB 3L2WA 5HOOA 5KNLA 1UG0A 2R7QA 1Z3XA 2VASA 2E5ZA 1MMDA 3FHNA 1MMAA 4CCJA 4HNTA 2IXSA 1ERDA 3EUKL 2IS2A 3V42A 2LG4A 3QYFA 3C2HA 3BG7A 2V26A 4PJJA 1MNEA 3S3OA 2K5CA 2VXZA 4XLFA 1JI8A 3CJRB 3OYLA 3MD2A 1LFPA 4D9JA 3EUAA 4CZCA 3OS2A 2DT6A 1QHHD 3BCBA 3OIQA 3ZRGA 3OS0A 4C2UA 2R7TA 1LKXA 2KMUA 2RQQA 3D5LA 3E1SA 3TBIA 4HPQA 3FBNB 3K4KA 5FRNA 3PNTA 3OR2C 4CSWA 4BE2A 2HNHA 1S9HA 1LVKA 2HVRA 4BDYA 4II2A 2WADA 3DPTA 3VYRB 1UAAA 1SFKA 1QHGA 2X1DA 2HVQA 3VDXA 3K70C 1OR7C 2CV1A 3MKWB 2VL8A 2PJRA 2L7KA 1DGRM 3L2VA 2M4KA 2RREA 5FRMA 3CF2A 3DEEA 1DQUA 1P9QC 4D1QA 5HLTA 4YEJA 4II3A 3IP4B 1NG7A 3M8JA 2X6YA 3RTRA 2UWMA 2P0WA 4DIQA 2WAQA 3H0DA 2R4GA 3OL4A 4QPOA 2BOLA 3D5RC 3OYJA 4ZTJA 2LOOA 2R7VA 4BEHB 3DWLE 4E7SA 2M4GA 4PUSA 2A5WA 3CMMA 4RMNA 3E0JB 1X4PA 2VQLA 4ZJZA 4BQQA 1YX5A 2LH9A 3FKJA 2K3PA 3OWTA 1MMGA 1G59A 2CV0A 3ONQA 4J00A 4HG2A 2KL4A 3DKYA 2LC2A 1D1CA 2K9LA 4E7JA 5CPRB 4XONA 3SDBA 1Z3YA 2OC6A 3TL4X 3C2GA 4DOZA 2L9NA 3L2UA 5CQGA 3TMOA 3OYCA 3M1CA 2ELJA 5HVQC 4QPQA 3W3CA 2JA2A 2RNGA 1YE9A 1N78A 1WJDA 2L5QA 1N75A 3D5SC 4IQJA 3I3LA 4JQFA 1SAUA 4BE1A 2VQCA 4ITVA 4BGDA 3QYBA 4PJLA 2WY8Q 2ZFUA 3OYFA 3LL7A 3L2RA 3K4NA 2M0MA 2ZXHA 5LFAA 2LY2A 4NC8A 3OYBA 3AKZA 4LIUA 4GRIA 2K9MA 4NNJA 4N4OB 4E7IA 4PSWA 5JHFA 3DTIA 1KONA 1WJCA 3J7AY 1U0JA 4IKFA 1WJ5A 2WB1A 4C9YA 4IZZA 5KHDA 2JSPA 1BR1A 2W82A 1Z21A 1FMVA 3OYMA 4IX7A 3DKXA 2LYCA 1ZELA 5TGTA 3S8PA 3F9KA 2VKDA 3K70D 3W2WA 3DPUA 3DLAA 4E6KG 1D0XA 2CUJA 2HVSA 3OYAA 2L2OA 1VZ0A 4RLQA 4B48A 4BDZA 3H5AA 4BXFA 2V6EA 4PFPA 2Z2SB 3PSIA 1T0FC 1K6YA 2V9KA 1E0EA 3I9V2 1YX3A 2CFOA 4XKVA 3H9GA 2W4SA 4NUBA 4PSXA 3H35A 3QODA 4AVZA 2MD0A 2KRHA 2V4JC 2WY7Q 1NG6A 4NQWB 1V5GA 2KP6A 3VSLA 4CH7A 1QU3A 2VJIA 2OV7A 3DTKA 1MW7A 3DTEA 2UV1A 2XDVA 2VKHA 1J09A 2JUGA 2GOXB 4E7LA 2VLAA 2CW8A 4XNFA 2QKMB 4F91B 3KEYA 2Q1ZB 3OYDA 4LIVA 2HDWA 4F92B 3LMMA 3SZGA 4XKWA 2ZSHB 2CUZA 3DQVC 5LD2C 2XF5A 3VWBA 4CUGA 3SEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL4 A;  3OL3 A; 
#chains in the Genus database with same CATH topology
 4DYR A;  2L54 A;  4U7B A;  2VXD A;  4JX4 A;  1X3Z B;  5EGO A;  1WFX A;  2HU9 A;  2BHY A;  4M3D A;  1KQ9 A;  2G9W A;  4F7Z A;  2M45 A;  3ZQL A;  2R7S A;  1G2H A;  2QA4 I;  1XSD A;  1ZGA A;  4HBL A;  3HXL A;  2M3A A;  5DS9 A;  1XN7 A;  3QYE A;  1LNW A;  2IBD A;  2R5Y B;  1BBY A;  3BDD A;  3E6B A;  4E4H A;  2IEK A;  2YSR A;  4LG3 A;  1T95 A;  5IPA A;  3G1M A;  3G73 A;  5FO5 A;  1TW2 A;  2DPD A;  1S72 I;  4ZYA A;  4F55 A;  3IC7 A;  4B3A A;  1UJ8 A;  4KIT B;  3J7Z I;  4RAG A;  1PUE E;  1QZZ A;  1STZ A;  1FBU A;  1ETW A;  3KEO A;  4LG0 A;  4PZJ A;  2FRH A;  2VJ4 A;  4I0A A;  2EJR A;  3L2C A;  3F6V A;  4B43 A;  4BHB A;  1AKH A;  3H9Q A;  3HOW J;  3WE2 A;  3BZK A;  2JA8 J;  5F1R A;  2CMP A;  1YW7 A;  3F8F A;  4I98 B;  1I6X A;  4X6A J;  3BTL A;  3H9J A;  3JCU C;  1BJA A;  5E1W A;  3A0B C;  3BJA A;  1K78 B;  4D5F A;  3OOP A;  1D5V A;  4M6V A;  3H3Z A;  5J4V A;  3JRB A;  4XK4 A;  3ZMZ A;  4EMS A;  2UZK A;  3R61 A;  3F8C A;  1E17 A;  3FXM A;  2UXX A;  2MAB A;  1RUO A;  2MH9 A;  3E5Q A;  2LF8 A;  2ELK A;  3MAJ A;  2L9S A;  2X1C A;  2PX9 A;  4U88 A;  2MLG A;  1A31 A;  3ZCO A;  3R0A A;  2BE5 F;  2KIF A;  4CA0 A;  1TNT A;  2KQR A;  5JHU A;  2HZT A;  1GLN A;  4GGG A;  5BQT A;  4ZC3 A;  5ILU A;  4MQ9 F;  4PDK A;  2PJR B;  4AM3 A;  3I55 I;  1XGS A;  4HYE A;  2XC7 A;  4WX9 A;  1R23 A;  4UV8 A;  4A0Y A;  1N77 A;  1XMK A;  3CC4 I;  3CCM I;  3ERM A;  3LA7 A;  3TO7 A;  3X2Q H;  4PJ0 C;  3H1C A;  2KRC A;  1W7P A;  4ABZ A;  2DAO A;  1ETQ A;  4RGR A;  4C3I J;  4RAZ A;  2EBI A;  3HUG A;  2MSY A;  4F52 A;  2XF7 A;  4P5O A;  1UZC A;  2DFF A;  4R79 A;  2M7A A;  4JOM A;  1XPX A;  1PJR A;  5C44 J;  3SFZ A;  4ETS A;  1YIJ I;  1K7A A;  1HXD A;  2G7U A;  2LBF B;  1B4A A;  2IS1 A;  3E7L A;  3BC8 A;  4QTR A;  1R6R A;  4S05 A;  1U5T B;  3EET A;  2K9Q A;  2F4O B;  4M72 A;  4I6Z A;  1LEB A;  4IO9 F;  2VPL A;  1ZR2 A;  4OOI A;  3QPH A;  2BGC A;  2NVU B;  2E35 A;  1BR4 A;  1I27 A;  3RYP A;  1JT0 A;  1CF7 A;  3BR2 A;  2IS6 A;  2X0L A;  1OJL A;  2A3S A;  4EVI A;  1D8K A;  4PGG A;  4G6Q A;  4KMU X;  1LB2 A;  2FSW A;  1IJW C;  4L9V A;  2QGU A;  1J9I A;  1XC5 A;  2C6Y A;  2LVS A;  2P5V A;  1OCP A;  2CG4 A;  4G12 A;  2W57 A;  3QPS A;  2E1N A;  3WU1 B;  4BBR J;  4M6X A;  5JVG F;  3CC2 I;  5HS9 A;  1ETK A;  2TDX A;  1VQ4 I;  4D0P A;  1MZB A;  5EF6 A;  3BY6 A;  3PIO F;  2IGN A;  4HX7 A;  1LE8 A;  3K4C A;  2V7F A;  5IT3 A;  4E7K A;  2DOD A;  1T33 A;  3IKT A;  4P96 A;  1MKM A;  1FOW A;  4RLF A;  2ZO4 A;  5DDG A;  1ETV A;  3LAJ A;  3FZV A;  3W6V A;  3F3X A;  3ZGK A;  2X51 A;  3IHU A;  3TP0 A;  3HM5 A;  4BAY A;  2EV6 A;  2CO5 A;  1R36 A;  4N4N B;  2IGM A;  2DA7 A;  3HKZ A;  1FZP B;  4KIS A;  2OUM A;  3AG1 H;  1FC3 A;  5A2Q K;  2EZK A;  2CW0 F;  3OYH A;  4DBR A;  3S1M J;  2DA1 A;  4FTH A;  4O6J A;  1U2W A;  1W36 C;  1SAN A;  1CF7 B;  1DPU A;  1P92 A;  4PK4 A;  2VBX A;  2QWW A;  4L9J A;  1W5T A;  4ZDO A;  2GXG A;  6PAX A;  1NK3 P;  1EH6 A;  2LTP A;  3RIR A;  3U1K A;  2DPU A;  3H5N A;  3K6G A;  2HOS A;  1VI0 A;  2QUF A;  2GQQ A;  4ZDL A;  2MYS A;  4HRI A;  2DA5 A;  1ONV A;  2O61 A;  3QQA A;  4F93 B;  2BW3 B;  4G6T B;  3AG3 H;  1PP8 F;  2E60 A;  4IVN A;  3CTA A;  5BOX A;  3FXQ A;  5CVR A;  2MC4 A;  2IJL A;  5HS7 A;  5BPI A;  3JRD A;  2HZD A;  5FFX A;  3GO5 A;  5BMZ A;  4ZYE A;  4XOR A;  1F36 A;  2PMU A;  4LK1 F;  2FNA A;  3VSK A;  1IC8 A;  3I64 A;  2Y9Z A;  2VJ5 A;  1NTC A;  2RVC A;  3BR5 A;  1PUF A;  2HYG D;  2EZH A;  2HGC A;  4B4C A;  5KAI C;  1BM9 A;  1MD0 A;  3M4O J;  3DEU A;  1DP3 A;  1SEU A;  3LSH A;  3ERE D;  5HOO A;  3H3V K;  3A0H C;  3D0S A;  4EGY A;  1Z3X A;  2GIV A;  2VAS A;  1TWF J;  1MMD A;  1YS6 A;  5E20 A;  4CCJ A;  4HNT A;  2HTS A;  3E5U A;  1W4M A;  1BI3 A;  2NOG A;  3BR1 A;  2KIQ A;  1P7I A;  3BJO A;  3IWF A;  3QYF A;  2IS2 A;  2ZKZ A;  1MSF C;  5C3E J;  5IY5 H;  4FQG A;  1IGN A;  1MNE A;  1QGP A;  1R7J A;  1V3F A;  1ZN2 A;  5F27 A;  3EDP A;  5DUK A;  3OYL A;  2XRN A;  1FBS A;  3MD2 A;  4OIQ F;  2L02 A;  2FXA A;  3EUA A;  4CZC A;  3P9I A;  3WHB A;  2VI6 A;  3BTC A;  3Q0W A;  3OS2 A;  1T56 A;  2LKS A;  4CO8 A;  1RPW A;  1QVT A;  4I09 A;  2Q8K A;  3CJN A;  3TO6 A;  2DJN A;  3ZRG A;  1OCO H;  3OS0 A;  4BXX J;  3TO9 A;  2NYX A;  2PG4 A;  5GAG J;  2KMU A;  3E1S A;  3FIS A;  3J80 Z;  2KT0 A;  5ICE A;  1Z6R A;  2R7D A;  1TQI A;  2OZU A;  2XAF A;  3PNT A;  4CSW A;  4GYI A;  4ENM A;  5D5V B;  5GAD J;  1WZ2 A;  4B09 A;  2V1D A;  2HVR A;  3GFL A;  1YIT I;  3MZY A;  4LG0 B;  2WAD A;  3DPT A;  3J81 Z;  3WTS C;  1S6L A;  2WWY A;  2HVQ A;  1MH3 A;  1YIO A;  3HB9 A;  4Q48 A;  5FFZ A;  1OR7 C;  2HOE A;  1P6R A;  5EEG A;  1OYY A;  1UHW A;  5CVJ A;  1ZHF A;  1IUF A;  5JFR A;  2ID6 A;  2BBY A;  3DEE A;  1HST A;  2E2H J;  1P9Q C;  1WQ2 A;  3FWE A;  4QWQ A;  1NG7 A;  1R22 A;  3M8J A;  3KP7 A;  2TCT A;  3MKL A;  3J80 K;  1E3P A;  1YG2 A;  3Q3S A;  3QP5 A;  2HXI A;  4Q5S F;  2JA5 J;  1OYW A;  4Z6Y A;  3HEF A;  5D8K B;  1T39 A;  1O4X A;  1OMI A;  3S1Q J;  2A5W A;  1TC3 C;  2A05 A;  2QQB A;  4UVB A;  4BQQ A;  2JQ7 A;  3HKZ N;  3F22 A;  4IPA A;  2H6B A;  2K85 A;  1RRJ A;  2FX0 A;  1GVJ A;  4CYD A;  2VON A;  4HG2 A;  4CHU A;  2HEO A;  1HDD C;  2K9L A;  2DMT A;  1ON1 A;  4EQQ A;  1MSE C;  3R6S A;  4A3L J;  4NC6 A;  3QRF F;  3TL4 X;  3I4M J;  2ZBK A;  3DV8 A;  2ESN A;  4EJO A;  1K79 A;  5H2F C;  5FGM A;  5M3F J;  2P4W A;  1FX7 A;  1U9O A;  1F9N A;  3FXK A;  3V7R A;  1AWC A;  2EIK H;  4Y17 A;  4C3J J;  3GYH X;  3KLO A;  1K78 A;  5LGT A;  2JA2 A;  5J3L A;  3LSR A;  2E7W A;  1WJD A;  2YS9 A;  3P7N A;  1S7O A;  4MTE A;  5GPA A;  1DUX C;  9ANT A;  1A5J A;  2PJP A;  2XB0 X;  1Y1W J;  3QYB A;  4W97 A;  4X1E A;  2WY8 Q;  3WTV C;  1RNL A;  2IW5 A;  5E8I A;  4EM2 A;  3LL7 A;  4HQE A;  2VBW A;  3K4N A;  4AWX B;  1WI3 A;  1U8B A;  4AYB N;  2M2E A;  2QQA A;  2K9M A;  3DEW A;  4N4O B;  3VEP A;  3Q9V A;  4KDP A;  1U0J A;  2MBF A;  1D5Y A;  4M6Y A;  3JTG A;  1WJ5 A;  3KZZ A;  4C9Y A;  2BV6 A;  3CCY A;  3IH3 A;  1F43 A;  1O3T A;  1H0M A;  1Z21 A;  2GXA A;  2Z99 A;  4RB3 C;  4IOA F;  2W84 A;  2V1U A;  3GLX A;  1P7J A;  4UV9 A;  3GFJ A;  5FJ8 J;  3HOX J;  3K70 D;  4EJW A;  2QZ8 A;  2ZME A;  5J8C A;  4I02 A;  2CUJ A;  2HVS A;  2R7Z J;  2L2O A;  1XCV A;  3DBR B;  4BDZ A;  3H5A A;  1IN8 A;  2V6E A;  2M0C A;  3BWG A;  2Z2S B;  4K2E A;  5D8L B;  1J7K A;  2DOF A;  1J59 A;  4A93 J;  4FIS A;  1WKM A;  1F1Z A;  1JKR C;  3HRS A;  4A0Z A;  2L01 A;  3M8E A;  1YRN B;  2M87 A;  3GUD A;  4XKV A;  2BZT A;  1U8R A;  3FM3 A;  4PSX A;  3ZMU A;  4AVZ A;  3RZD J;  1TW3 A;  3HRT A;  1I3A A;  1NG6 A;  3G1O A;  5LHG A;  4IHV A;  1N25 A;  2OV7 A;  3CO6 C;  3LFK A;  5J1R A;  2UV1 A;  3BP8 A;  4HLY A;  2VKH A;  1WSU A;  4LB5 A;  3TW6 A;  2IA1 A;  2GOX B;  1EH8 A;  3PQJ A;  2QKM B;  5B1A H;  2IRF G;  1XS9 A;  3K9T A;  2DN0 A;  4UUS A;  2EIM H;  4AUX A;  3SZG A;  3P5J A;  3CMY A;  2JT1 A;  2CUZ A;  3DQV C;  5LD2 C;  2LKX A;  3C2B A;  1BW5 A;  3SEQ A;  4DBQ A;  3S32 A;  4HDU A;  4UB6 C;  2NAZ A;  1DU6 A;  1YO5 C;  3PUB A;  2I10 A;  3EUH A;  1WHU A;  1GHC A;  2JA6 J;  5CVU A;  4H0E A;  1IF1 A;  3CCQ I;  1YQA A;  4XLN F;  1BI0 A;  3RYR A;  3JTH A;  1JE8 A;  3K4M A;  4RGU A;  3T0Y A;  3HG9 A;  3KIO A;  4CYC A;  3IRR A;  4N9H A;  2ECC A;  4S0H B;  2B7E A;  3A02 A;  2O03 A;  3M1E A;  3LSJ A;  2D5V A;  3F8N A;  4R1H A;  1Z77 A;  3HUG B;  2CU7 A;  5ERI A;  2X1E A;  4FE7 A;  1TT0 A;  4EAT A;  1VQN I;  4XR6 A;  3K4B A;  3KE2 A;  5DV5 A;  1D3Y A;  1QVU A;  2LBF A;  1H88 C;  4LOC A;  3PNV A;  1FTT A;  1W7P B;  3OYE A;  1YYV A;  2K4J A;  1DP7 P;  2P7C B;  4CCK A;  2NS8 A;  2BW3 A;  4CXF A;  3TOA A;  3WGG A;  3HIF A;  2KHM A;  3TGN A;  2COM A;  3ABT A;  3GFI A;  2Y69 H;  5IP9 J;  5EDN A;  3ZOB A;  4BHP A;  4Y15 A;  2YPR A;  3RPU A;  2EWN A;  5HLI A;  2ME6 A;  5LEJ A;  3HSE A;  3UNG C;  4IQ4 A;  3OYG A;  5EZH A;  3G71 I;  4RDU A;  2DFI A;  4PJM A;  2BHZ A;  1HA8 A;  3A2K A;  5L3E A;  4ZZL A;  1K4S A;  4NBQ A;  2Z1D A;  1MNM C;  3EQL F;  3WHC A;  2O0Y A;  1MND A;  2WAE A;  5K5Q A;  3OYN A;  4RS8 A;  4NQW A;  3L1P A;  2UXN A;  2OQR A;  2GOM A;  3C1D A;  4IHS A;  4ESF A;  1EH7 A;  1L3L A;  2VKV A;  2Y0M A;  1T98 A;  2ID3 A;  4XLE A;  1GXP A;  3HC7 A;  1MBJ A;  3OIO A;  4ENK A;  4HZF A;  5FB2 A;  3ECO A;  4NC7 A;  4J19 A;  1TWH J;  2F5V A;  3FMS A;  4L5J A;  2O8X A;  1FYM A;  4I2O A;  2HQA A;  3IAS 2;  1WJF A;  2F5D A;  1RUN A;  1REP C;  2QQ9 A;  3K2Z A;  1I39 A;  3HGG A;  3AL0 B;  4JP0 A;  2I5U A;  3CP2 A;  1G3T A;  3H5R A;  2Q2E B;  2Y2Z A;  2LSO A;  3JRG A;  1WWX A;  2DA6 A;  2EB7 A;  4CCM A;  5F0F A;  4ZYG A;  2MG4 A;  3KP6 A;  1YRN A;  2JA7 J;  2H1L A;  3SJM A;  2CV2 A;  1X1C A;  4AU7 A;  4BJ5 C;  4EM0 B;  2V1X A;  5E1Z B;  1VQO I;  5J6X A;  1B1B A;  5ICF A;  5E3O A;  4BUP A;  1NH3 A;  2R7X A;  1KU3 A;  2FF4 A;  2R7R A;  3U21 A;  4DZJ A;  4Y4R A;  1ZH5 A;  1FPQ A;  1YI2 I;  2MLK A;  2ZME B;  3ZQQ A;  2IT0 A;  4P9F A;  3EUH C;  2EFP A;  3WOD F;  1UFM A;  2MD5 A;  4PCQ A;  1X19 A;  3FXO A;  3S93 A;  3HOY J;  2DT7 B;  4A5N A;  2IGO A;  1ZGJ A;  3UKG A;  2P7V B;  1P4W A;  3WTU C;  3KPH A;  4XN3 A;  4NDL A;  4G7Z F;  2M8G X;  4L5E A;  1XDU A;  3CZ6 A;  2BY2 A;  4RGS A;  1SC7 A;  5ILS A;  3HGY A;  1O7L A;  2FNP A;  2HS5 A;  2F48 A;  4JX6 A;  3OS1 A;  3J7A O;  2QSF X;  2WAQ N;  3S15 J;  1LPQ A;  3PJR A;  5JI6 A;  2KJB A;  1JHF A;  3K4L A;  2K02 A;  5D5W B;  4B47 A;  5LGN A;  1G3S A;  3KX2 A;  1AHD P;  3DU6 A;  1USS A;  3JW4 A;  3N05 A;  4U7D A;  1BN5 A;  3GZN B;  4HDV A;  2KDO A;  1U3E M;  1VQ5 I;  4ZDP A;  4CYC B;  1J0R A;  3WU2 C;  3PNY A;  5DCF A;  1T38 A;  2W7N A;  1SAX A;  1DDN A;  2A5Y B;  4HX4 A;  2FUG 2;  2W24 A;  3CJQ B;  4GXO A;  2A68 F;  2XGE A;  2E1M C;  3ZMD A;  1UEL B;  1E2X A;  2DJI A;  2M5W A;  4XM3 A;  4BJ6 C;  4CCO A;  2LD5 A;  2VBZ A;  3E6C C;  4HV5 A;  2JRM A;  2WC2 A;  3HDD A;  4A3C J;  5HNH A;  1PUF B;  4XQF A;  3AG4 H;  4IL6 C;  2K7L A;  2VIX A;  4MQV A;  2JSC A;  1B8I A;  5E1X A;  1U9N A;  2RKH A;  1JKP C;  1JTY A;  1IN5 A;  3HSR A;  1FYK A;  3QP6 A;  1ORK A;  1BIB A;  1IN6 A;  1OFC X;  2L3D A;  2RNJ A;  4WF2 A;  4AC0 A;  2HDC A;  3HOZ J;  4OWR B;  1KU7 A;  2BY1 A;  4UUS B;  4IJA A;  2M8E A;  2QVO A;  4U87 A;  5FLV A;  1ZQ3 P;  2EFO A;  3ZXS A;  3K4J A;  1RR7 A;  3BQY A;  5BS6 A;  4DGW B;  3CF5 F;  3ZMV A;  2F6C A;  1Y6I A;  5EG0 B;  2DTR A;  1LE8 B;  1R71 A;  4RB0 A;  3VYT B;  2P6T A;  3L2W A;  5KNL A;  2RQP A;  3ASN H;  4YIR X;  2E5Z A;  1MMA A;  3M7G A;  3CUQ B;  2DW4 A;  2IXS A;  4OIO F;  4DYC A;  1ERD A;  1A6I A;  3BG7 A;  2V26 A;  4HA8 A;  5IOY A;  2K5C A;  3CJR B;  4BYY A;  1H89 C;  2ESH A;  5HDN A;  4EJT A;  1H9G A;  4G7H F;  3IWZ A;  3QWL A;  3RKQ A;  1FSH A;  2ICW G;  4WXH A;  2HTJ A;  2EPF A;  4U0Y A;  1JJ6 C;  3BCB A;  2QF7 A;  3OIQ A;  3COA C;  4C2U A;  1APL C;  2R7T A;  1Y8R B;  3TBI A;  4IHT A;  5FRN A;  2ME0 A;  5J1U A;  2D1V A;  5H20 A;  1W0U A;  3OR2 C;  2Q2E A;  1OCC H;  2JZY A;  2FBH A;  2AXT C;  1R4N B;  4V2G A;  2XAG A;  1R1T A;  1OCZ H;  4BDY A;  1HQC A;  2EA2 A;  4MFD A;  3WU0 A;  2VOO A;  1FLI A;  1LUJ B;  4XID A;  4OIR F;  2GZW A;  1PDN C;  3VDX A;  3K70 C;  3RKW A;  4Y52 J;  5FLM J;  2HWV A;  5B3S H;  3MVP A;  5GPC A;  2JMW A;  3FMR A;  4Q47 A;  3CCS I;  1YS7 A;  3TW7 A;  3E5X A;  5L3D A;  4ZZD A;  1IN4 A;  3OSG A;  1UMQ A;  4MIM A;  1HKQ A;  4G7O F;  4O3M A;  3R0J A;  4IRG A;  2X6Y A;  2DDA A;  4HF0 A;  3GTP J;  4DIQ A;  2XAQ A;  3KYD B;  2WAQ A;  1UST A;  4KIG A;  4ZTJ A;  4RBO A;  2LOO A;  5CLS A;  2R7V A;  3U9G A;  4BEH B;  3DWL E;  4C2M J;  5LHI A;  2DMU A;  2CSO A;  2E1O A;  5ED4 A;  2KJC A;  4DNC A;  2VQL A;  3V4G A;  3HTU A;  5F0C A;  1CGP A;  3Q0U A;  3ABM H;  2LH9 A;  1GXQ A;  4M73 A;  3CUQ C;  3FKJ A;  1LDJ A;  1G59 A;  3F8M A;  3DCF A;  3EYI A;  4A3E J;  2E1C A;  3DKY A;  5FD6 A;  1D1C A;  4BQA A;  2DK5 A;  5CPR B;  2NXN B;  3SDB A;  3TKY A;  2Q0O A;  1HW2 A;  1I3Q J;  1XMA A;  2CJJ A;  3CCE I;  3C2G A;  1ON2 A;  1MBF A;  1SVL A;  2XGD A;  4YG2 F;  2CUF A;  1QZY A;  4DOZ A;  2L9N A;  2GA1 A;  3KZI C;  3TMO A;  2VOD A;  3M1C A;  1SFX A;  4KT5 C;  2XAH A;  1S3J A;  1YJW I;  2G7H A;  3BG3 A;  2XVC A;  2NVQ J;  1YE9 A;  1N78 A;  5D4S A;  1N75 A;  3D5S C;  1W1W E;  1HF0 A;  3CD6 I;  3I3L A;  4JQF A;  1K61 A;  2VQC A;  2H6C A;  2VC0 A;  1TWC J;  1QPI A;  5DEQ A;  2DMP A;  4W1U A;  4IHW A;  4DZP A;  2LP0 A;  1RIO H;  1EF4 A;  3L2R A;  2HQ5 A;  1IUY A;  2M0M A;  4M3F A;  5LFA A;  5E3M A;  1S7A A;  3ROU A;  2JPC A;  4KIB A;  5ICC A;  3OYB A;  4GRI A;  4OMZ A;  3N97 A;  3ABL H;  1KON A;  4BKX A;  1BI2 A;  3V8L A;  4R8H A;  4FCY A;  1RC9 A;  2K86 A;  3JAM Z;  2MA3 A;  4IZZ A;  5FLX K;  5D5X B;  2VT2 A;  2WB1 N;  2W82 A;  3GTL J;  4ENN A;  1FMV A;  3OYM A;  3JRH A;  3TQN A;  4RAF A;  2LYC A;  3BOQ A;  3ML6 A;  4XSZ F;  2PEX A;  3C18 A;  4KUM A;  3T8T A;  3S8P A;  2DDB A;  3WTT C;  1MBE A;  3LNQ A;  3B6A A;  3DLA A;  3ABK H;  4M71 A;  1D0X A;  4KN7 X;  2XB5 A;  5HLH A;  4RLQ A;  3E6M A;  1I5Z A;  4BXF A;  3NAR A;  3PSI A;  1T0F C;  2QQ8 A;  3GCM A;  2MC3 A;  1W7P D;  1UCR A;  2QSG X;  1YX3 A;  1WH5 A;  3HHH A;  2WV0 A;  2E71 A;  4NUB A;  4UVA A;  3BTJ A;  1SD4 A;  3I4P A;  4NQW B;  2B9S A;  3PQK A;  1TNS A;  1Z0X A;  5BPD A;  1FY7 A;  1BW6 A;  1MW7 A;  3DTE A;  3J81 K;  4OIN F;  3MEX A;  2BXY A;  1OR7 A;  2JTV A;  4S04 A;  4KIF A;  3KET A;  3I56 I;  3PM1 A;  4LJZ F;  2MH2 A;  1W0T A;  1J09 A;  2JUG A;  3KP4 A;  4IEJ A;  4U0W A;  5EZG A;  4MNU A;  4MO7 A;  5HDG A;  2VLA A;  4E7L A;  4F91 B;  2QEX I;  2HDW A;  4XSX F;  3LMM A;  2R92 J;  3HSF A;  2XF5 A;  5FLX Z;  1BA5 A;  1FTZ A;  3FF5 A;  2A61 A;  4GFB A;  2DOE A;  2FU4 A;  4KT6 A;  2HOT A;  1V5F A;  2F5C A;  4Y3O A;  1BIA A;  4BXU A;  2H1K A;  3ASO H;  5J47 A;  3K2A A;  1XCB A;  5BNG A;  1H8A C;  3A1Y A;  4KIC A;  1X2M A;  2IPQ X;  3LSG A;  3GLL A;  2ZCW A;  3DU5 A;  3KP3 A;  4A3K J;  1O3R A;  2R7W A;  1R5G A;  2JRT A;  2FQ3 A;  4EJU A;  1YJN I;  1LQ1 A;  1SD5 A;  2BEO A;  1OPC A;  2WA0 A;  1Z9C A;  4I01 A;  4U0V A;  2ZFW A;  4L5I A;  4PFO A;  1G3W A;  2DT5 A;  1IN7 A;  3MN2 A;  1RES A;  4P1W A;  1TT5 B;  2NOJ B;  1FT9 A;  3GME A;  3BG6 A;  4BEH A;  4KJZ A;  1ZGW A;  1V4R A;  4OAY A;  2HPM A;  1Y0N A;  5J4Y A;  2DCE A;  5LGU A;  1XG1 A;  3OY9 A;  5AON A;  2V79 A;  1HKT A;  2BY3 A;  1FNN A;  1G3Y A;  5L3F A;  2AQE A;  4YFN F;  3HL2 A;  4FT8 A;  3S3M A;  5J40 A;  2M34 A;  1TLH B;  3CQZ J;  4DJA A;  1LDK B;  5LRR A;  3LFU A;  2M1B A;  2DMN A;  3UR3 C;  1R1U A;  3LA2 A;  1W36 D;  2GM4 A;  1V5E A;  3BLY A;  2XF6 A;  2ZJ2 A;  4B44 A;  1UHS A;  1Y56 A;  1YLF A;  2HQR A;  1X1B A;  2FBI A;  1IDZ A;  2CQQ A;  3ZQ7 A;  4KMF A;  3FXL A;  1AA7 A;  2UUZ A;  2Y31 A;  4UB8 C;  5H6Q A;  1D0Z A;  3CO7 C;  3SYT A;  4XOT A;  4G6D A;  3PSF A;  3HOT A;  4UUV A;  2OZ6 A;  1BC7 C;  5AIQ A;  3BR0 A;  1JGS A;  3GTG J;  3RZO J;  2JN6 A;  1D0Y A;  1A04 A;  2JK3 A;  4AYB A;  4PGH A;  3LST A;  3GZ6 A;  4E70 A;  3DPL C;  1A6Q A;  1X4O A;  1DGW Y;  3K1M A;  3RPU D;  2P8T A;  3MMY B;  1Z7L A;  2LFB A;  3LSM A;  2GIZ A;  2O5R A;  5D6E A;  2X9D A;  4NB5 A;  3L9F A;  1EA3 A;  1Y39 A;  3GTQ J;  3R60 A;  2XSJ C;  5FKK A;  2PBI A;  3CP8 A;  3I59 B;  1R49 A;  3J7Y J;  2V6C A;  1HBX G;  2E2J J;  1WI9 A;  4A6D A;  4XKB A;  5GTH C;  1HW1 A;  1ODD A;  2LRD A;  4KFC A;  3VYU B;  3BR6 A;  4M74 A;  3CUQ A;  2KZG A;  3KLN A;  3OR1 C;  1Z91 A;  1WJE A;  5KAF C;  3S2W A;  1RKW A;  4YEL A;  5F08 A;  1JGG A;  3S3N A;  3HTS B;  4MEX F;  3WE3 A;  2K27 A;  3NAU A;  2EIN H;  2N8G A;  5JVT A;  3ZMT A;  3K10 A;  3MFK A;  1VQ6 I;  1ZYR F;  2J5O A;  2EV5 A;  1YHQ I;  3JRF A;  3O3K A;  3AFH A;  3IKV A;  4WWC A;  3E3V A;  2XPU A;  1FP2 A;  3ZR8 X;  1ZG1 A;  1I1S A;  2HXO A;  2OBP A;  1ZRF A;  2L7M P;  4MGR A;  2Y30 A;  3NRV A;  1SVO A;  3O8H A;  4MLO A;  3S1N J;  2HFH A;  4N9I A;  4A12 A;  2PMZ A;  4M3E A;  5FKN A;  2RC4 A;  2EK5 A;  3MKY B;  4BAC A;  3W2V A;  2FEZ A;  2DYS H;  1QO0 D;  4A69 C;  1KGS A;  4OU0 A;  5B1B H;  4LLN A;  4A3D J;  3QOE A;  1Y8Q B;  1GDT A;  2V9P A;  2PMH A;  1FYL A;  1B72 A;  1P4A A;  1B8I B;  5J8F A;  1SD6 A;  1K83 J;  4XN0 A;  1TP4 A;  4BJT A;  1XX5 A;  4CCL A;  1XGO A;  1IAW A;  2MW8 A;  4E7Z A;  2VQH A;  5CVV A;  4A0X A;  5EJC A;  4L0Y B;  3ESW B;  2L4A A;  1T2K A;  1C0W A;  2ZNZ A;  3GEZ A;  4L9T A;  5HS8 A;  5E18 F;  1POG A;  1XB4 A;  3CC7 I;  2CW7 A;  2KIS A;  2K40 A;  3SEZ A;  3CCR I;  1U5T C;  2KRF A;  2QKL B;  1U78 A;  2STW A;  3HOS A;  2B63 J;  1L0O C;  4B3X A;  1T0F A;  3I5U A;  2ETH A;  3OV8 A;  2ZJR F;  1SD7 A;  1MIJ A;  3OMY A;  2IS4 A;  3PIP F;  4UY8 I;  4OIP F;  4HST A;  4A3B J;  4XLC A;  1F4K A;  1BOA A;  2VQG A;  2ELH A;  4DW6 A;  2WAF A;  2XAJ A;  3G2B A;  5E8G A;  5F0H A;  4CIC A;  4I7H A;  1A36 A;  2Y0S N;  3KYL A;  3LSI A;  1ZRD A;  4LLG F;  1MJA A;  5M3M J;  1LDD A;  2DA2 A;  2X85 A;  3CDL A;  2I8D A;  5GTI C;  2VJJ A;  2GBY A;  1KU9 A;  4LLL A;  2A69 F;  4HEA 2;  5IYB J;  1X1A A;  3GW2 A;  1ZRE A;  2XAS A;  2Z5U A;  3QPL A;  3VFZ A;  2W1O A;  3NWS A;  4IRI A;  4IHY A;  4LGW A;  5DYM A;  2CGP A;  1KU2 A;  4BQO A;  1FEX A;  3OOU A;  3VPR A;  5FRO A;  2FOK A;  3KYC B;  3ZQH A;  2W00 A;  4AIJ A;  1NHA A;  5L3C A;  3M9A A;  3VB2 A;  1YW8 A;  3BZC A;  4X0G A;  1XDS A;  5CQE A;  2X6X A;  3HOV J;  1GUU A;  1JT6 A;  2OCC H;  5FKL A;  2CQK A;  1BJZ A;  2VOP A;  4HNV A;  4LFU A;  2W25 A;  4O5V A;  3GTK J;  2E7X A;  1IRF A;  3IH2 A;  1WRJ A;  2HKX A;  3F72 A;  3FHN A;  1JKO C;  2OJE D;  2OU2 A;  4GO1 A;  3V42 A;  1H9T A;  2OPT A;  5CVI A;  3K1N A;  4PJJ A;  3SZT A;  2VXZ A;  4XLF A;  1QPM A;  5L3B A;  1JI8 A;  2FML A;  2ZNY A;  2E2I J;  3AG2 H;  2DA4 A;  1O57 A;  3W6K B;  4D9J A;  2J5P A;  1F5T A;  3KFW X;  2O8K A;  1B72 B;  2QBY A;  3RQI A;  1RZ4 A;  3M8F A;  3IRQ A;  3WTX C;  3RI4 A;  2VE9 A;  2DT6 A;  4IRH A;  1QHH D;  2XHK A;  4G9Y A;  3Q0V A;  2JJ7 A;  1YTY A;  1BC8 C;  2NVT J;  1ITY A;  1LKX A;  2RQQ A;  3D5L A;  2A6E F;  3HHG A;  2LF7 A;  3FBN B;  1E3H A;  3K4K A;  3QPT A;  1R00 A;  2HNH A;  1S9H A;  1LVK A;  1FWZ A;  3VOD A;  1UG2 A;  4JYK A;  1M1E B;  2EIJ H;  3VOE A;  4G8X A;  1V54 H;  2P81 A;  3HJE A;  1OIS A;  4XLP F;  3IV5 A;  3HRM A;  5IP7 J;  4QIW N;  3CUO A;  4D7N A;  1QBJ A;  1TBX A;  2EZI A;  3JSP A;  1VQ9 I;  2LLK A;  2CV1 A;  1E3O C;  2DO7 A;  5FKO A;  4A3J J;  2YU3 A;  2PJR A;  3JR9 A;  2DFE A;  2M4K A;  2RRE A;  5FRM A;  2O3F A;  2DYR H;  2MGQ A;  2KIU A;  1P4X A;  4II3 A;  3ZQI A;  2DBB A;  5LHH A;  3GXO A;  5F64 A;  2PMZ N;  3RTR A;  3Q9S A;  2UWM A;  3ZQF A;  2ZB9 A;  4L9N A;  4A6E A;  4KNY A;  1KQ8 A;  4HOB A;  1SVM A;  1J75 A;  3DLL F;  4AVP A;  2R4G A;  3OL4 A;  4Y7N J;  3OYJ A;  2BOL A;  3D5R C;  3BPV A;  1A35 A;  3L09 A;  2ISY A;  4E7S A;  3KEQ A;  4PUS A;  3CMM A;  3DKW A;  4OMY A;  1X4P A;  2R0Q C;  2IAI A;  3TOB A;  3WTZ A;  4M9Z A;  1AU7 A;  2K3P A;  4DYQ A;  1HCR A;  2EQR A;  3OWT A;  1MMG A;  1VQ7 I;  5DD4 A;  4A3I J;  2CV0 A;  3SFI A;  3F0C A;  1IXS B;  2Z9O A;  2LMD A;  3CCJ I;  1Z3Y A;  2OC6 A;  2LKP A;  4P9U A;  3BRO A;  1XSX A;  3OYC A;  1KZH A;  4ON0 A;  2GXB A;  4QPQ A;  2X48 A;  1HDP A;  1CQT A;  3ZN1 A;  2DFH A;  2KKO A;  2RNG A;  3JSO A;  4V19 K;  1S29 A;  2LR8 A;  4P55 A;  1B9M A;  1XGM A;  4IQJ A;  3O2P E;  3GF2 A;  3PO2 J;  4ITV A;  5EEH A;  2H8R A;  1FOX A;  3QAH A;  1KA8 A;  2OAZ A;  2JWT A;  4D7M A;  1WPK A;  2OA4 A;  2KDZ A;  1MH4 A;  3U1D A;  5E3N A;  3JRC A;  1WH7 A;  2ZFU A;  1EKE A;  3OYF A;  4EJV A;  4ESJ A;  3FX3 A;  5GP9 A;  1OYI A;  3KP2 A;  3CCL I;  2LY2 A;  2HQN A;  4NC8 A;  5K7Z A;  3MZ8 A;  1KYZ A;  2V9V A;  3BQZ A;  3V8K A;  4LIU A;  2B0L A;  2DA3 A;  3FXR A;  4A5M A;  4E7I A;  4PSW A;  2DQL A;  3DTI A;  5JHF A;  1B6A A;  5DM6 F;  2JUC A;  5F1J A;  2XSD C;  2WB1 A;  4GYG A;  2IVM A;  4MEY F;  1TWA J;  2DI3 A;  5KHD A;  3SXY A;  5B66 C;  1HW5 A;  4EV0 A;  3GTJ J;  1BR1 A;  3DXJ F;  4IX7 A;  3DKX A;  5HLG A;  2HYJ A;  2NVY J;  1TTY A;  1ZEL A;  5TGT A;  3AAF A;  4WXC A;  1LEA A;  3F9K A;  1I6H J;  3W2W A;  1IXC A;  1XMX A;  2XKO A;  4E6K G;  3OYA A;  3CME I;  3GVA A;  1RI7 A;  1VZ0 A;  4B48 A;  1ACI A;  5EG0 A;  2A07 F;  1P2F A;  1K6Y A;  1YW9 A;  2D1H A;  2RV8 A;  3K1P A;  3K7A J;  4UUT A;  4FE4 A;  2HI3 A;  1PVE A;  1JXS A;  3QU3 A;  5M5Y J;  2R93 J;  1I1G A;  2L4M A;  2CFO A;  4N0B A;  5KK1 A;  2EIL H;  2ZXJ A;  3H9G A;  1HKS A;  2W4S A;  3GZ5 A;  3H35 A;  3QOD A;  2MD0 A;  2KRH A;  3F6O A;  2WY7 Q;  3PO3 J;  5LLQ A;  4IF4 A;  1R4M B;  4ZH4 F;  1V5G A;  3HBL A;  4HV6 A;  3VSL A;  4CH7 A;  2O7O A;  3CLQ A;  2CRG A;  2VJI A;  1BL0 A;  1SFU A;  3A01 B;  2Y75 A;  3DTK A;  1X3W B;  2EFW A;  3RKY A;  3IH4 A;  3EYY A;  2XDV A;  3RDI A;  2LNB A;  1QZE A;  4YFK F;  2F5E A;  1FBQ A;  1Q1H A;  4XNF A;  5LEK A;  1MDM B;  2Q1Z B;  3OYD A;  4BHC A;  1DPR A;  3H36 A;  4LIV A;  4ENJ A;  3ECH A;  4F92 B;  3I0T A;  1D8J A;  1ZTR A;  3I71 A;  2BXZ A;  3VWB A;  4CUG A;  2H8W A;  1SMT A;  4Y33 A;  3V7S A;  4YRV A;  2ACJ A;  5CKT A;  2M7B A;  1Y1V J;  4ANJ A;  4BQN A;  1ZG5 A;  4C2T A;  1NK2 P;  2VKE A;  4XLA A;  5AIP A;  2FBK A;  5K7H A;  5L3G A;  4EM1 A;  2DXI A;  3GTO J;  1ETO A;  5K1Y A;  1JTX A;  2EA4 A;  2D45 A;  5GAH J;  3RPQ A;  2OTL I;  4MFE A;  4J01 A;  1JKQ C;  4ZTF A;  2KPM A;  4BE0 A;  2STT A;  3CDI A;  3LAP A;  2AO9 A;  5JLX A;  3BT9 A;  2RAE A;  2AS5 F;  2XIG A;  2FD5 A;  3S2H J;  3ZQC A;  2AXL A;  1O3S A;  4HSR A;  1K4T A;  2FA5 A;  5E17 F;  3L00 A;  1MGT A;  5LBQ A;  2IP2 A;  2COB A;  1T6S A;  4I0B A;  2KIM A;  2VC1 A;  2JVG A;  1J5Y A;  1XGN A;  1BR2 A;  4CCN A;  2LY1 A;  2YX4 A;  4XLH A;  5TRD A;  2X4H A;  1VTN C;  3JRI A;  4JK1 X;  1ZR4 A;  3KP5 A;  2R7U A;  2E19 A;  3HPH A;  3REO A;  3F8B A;  2IGK A;  4RB2 C;  2XUB A;  2DMQ A;  2KLO A;  4FET A;  3I59 A;  5CYV A;  4F3Q A;  1YJ9 I;  1GVD A;  2EFN A;  3NWT A;  3I54 A;  4RGX A;  1IG7 A;  3T5X A;  2L9V A;  1D1B A;  1WJB A;  1VF9 A;  2LDU A;  2H94 A;  1KYW A;  2PFB A;  3C7J A;  1XSV A;  4HNU A;  1IRX A;  2CH0 A;  3MZH A;  3HOU J;  2XGC A;  3P9K A;  5DCM A;  4M9S A;  4RM3 A;  3BG5 A;  4KYW A;  3GFM A;  1R5H A;  3JRA A;  2K9N A;  1O3Q A;  4LIT A;  5IT9 K;  2R5Z B;  3IAM 2;  1MMN A;  1G8X A;  3W2A A;  1PP7 U;  4M3G A;  3ULQ B;  3GBG A;  4YFX F;  2NRA C;  2HR3 A;  2P6S A;  2R7F A;  5EYR A;  1OQY A;  2XAU A;  3HPG A;  4OAZ A;  2Y48 A;  1D1A A;  4RAY A;  4BL0 B;  4BU2 A;  2LY9 A;  1QA6 A;  3MWM A;  1O7F A;  1WVR A;  2Z16 A;  4C30 A;  2FMY A;  3BTI A;  4QSH A;  4E7H A;  3PFY A;  3ZMS A;  2PN6 A;  4XKC A;  3E6D A;  1EJ9 A;  3NQO A;  4HQM A;  3L2Q A;  2GWR A;  2HKO A;  5IOZ A;  3RSN A;  2HDD A;  1G6N A;  2JVH A;  3LSK A;  3FBI B;  2KFD A;  1TQM A;  2PLY A;  1VQM I;  4XRS A;  4HLX A;  4BNC A;  2NNN A;  4UHT A;  3F21 A;  2VPR A;  4XL9 A;  2MFZ A;  3ISP A;  3LQQ A;  3G4S I;  3WTY C;  1XD7 A;  4H4K C;  4KN4 X;  1G4D A;  2DOA A;  4PJN A;  3LA3 A;  1R9T J;  2BVL A;  4RA2 A;  4XOP A;  1RKT A;  2XPW A;  3LSP A;  3IL2 A;  3RCO A;  4UNO A;  3DF8 A;  1W5S A;  1GV2 A;  3ZQG A;  2RDP A;  3ZN0 A;  4HX8 A;  5F04 A;  3N4M A;  2F4I A;  3L7W A;  3SDG A;  3T8R A;  1MDM A;  5ICG A;  5M5X J;  3BZ6 A;  1S7E A;  2VE8 A;  3NEU A;  2FJ1 A;  1J2X A;  4BS9 A;  5GAE J;  3OYI A;  3EPZ A;  1ZLJ A;  4TV7 A;  2ZC2 A;  4XRF A;  1RET A;  2PI0 A;  5K7F A;  3Q5F A;  3PL8 A;  1SFO J;  1WJA A;  3LWF A;  2HOA A;  1RR8 C;  4L18 B;  2RN7 A;  3HZJ A;  2Y9Y A;  2IA2 A;  1FMW A;  4MHG A;  2LRE A;  2E1M B;  1GV5 A;  3SQN A;  4CZZ A;  1ZAO A;  3K0L A;  4HF2 A;  5B5E C;  1UB9 A;  2E36 A;  1IO2 A;  3V8J A;  5LRS A;  2FOW A;  3D1N I;  4IXA A;  5J1Y A;  5DD8 A;  3A4C A;  1OLT A;  5IP6 A;  2HPI A;  1ZAR A;  4WXD A;  1VQL I;  2ZJQ F;  2VB6 A;  3AL0 C;  4XMY A;  3CES A;  3B6C A;  1VND A;  4UXN A;  1BOB A;  1X58 A;  1FIA A;  3K69 A;  2P5L C;  4IHX A;  3S16 J;  2L9R A;  2Y0S A;  3OIP A;  1LVA A;  3GX4 X;  5HOD A;  2A6T A;  2HYF A;  1QNT A;  5IYC J;  5E3L A;  3RQ4 A;  3FHZ A;  4D5C A;  5DM7 F;  5D5U B;  2A6H F;  5KCM A;  3ELK A;  3S1R J;  5IYD J;  1ZK8 A;  3I4N J;  4M3B A;  2EV0 A;  2QM3 A;  3RJP A;  4I99 C;  2F5F A;  5TJJ A;  3FDY A;  2QCO A;  1FP1 D;  1B9N A;  2FQ4 A;  2X6O A;  2XRL A;  3M3Y J;  2WBM A;  3FKI J;  2V1N A;  2H27 A;  1MMS A;  2Z3Y A;  2R5Y A;  1R58 A;  1TL8 A;  2ADU A;  1ENH A;  4RM2 A;  3FXU A;  1FIP A;  3IUO A;  1IZ1 A;  5TIS C;  3BPX A;  3G6E I;  1FJL A;  5HNF A;  4BBS J;  4ASN A;  3CDH A;  4YIF A;  3MKZ A;  2E5N A;  3R4K A;  3I58 A;  3WGH A;  1Z05 A;  2TRT A;  3VYS B;  1Y0U A;  3GWZ A;  4A3F J;  5EGO B;  2X6W A;  4ZYH A;  2YU9 J;  3DP7 A;  3FMQ A;  4AID A;  1Z67 A;  1X1D A;  5DTD A;  2ZSI B;  4WCG A;  4IOC F;  3BR3 A;  3CJT B;  4FAS D;  3QOP A;  5ILV A;  2GLO A;  1PYV A;  2ZXI A;  4A3G J;  4MTD A;  1TZL A;  1ZLK A;  5A2Q Z;  2QYO A;  2BY0 A;  4EGZ A;  3DFG A;  2KZV A;  3OYK A;  3PFI A;  3HRU A;  3G1L A;  1OKR A;  2R7O A;  5E79 C;  1JJ8 C;  1R1V A;  1X2N A;  3BCA A;  4GCV A;  2AQF A;  1LFU P;  3OL3 A;  1VFC A;  2EZL A;  3ZPL A;  3G3Z A;  2BVM A;  2LK2 A;  1V55 H;  2CS3 A;  2RGV A;  4A2U A;  3QU6 A;  2CYY A;  1DU0 A;  1X3U A;  1UG0 A;  3CMA I;  3V7C A;  1U5T A;  2R7Q A;  3WGI A;  1W5C C;  2CQ7 A;  4LB6 B;  2E34 A;  2ZJP F;  3EUK L;  1JUP A;  2LG4 A;  1GT0 C;  3C2H A;  2DU9 A;  4C3H J;  1K6O A;  5F6F A;  5C4X J;  4FHT A;  4FX4 A;  3S3O A;  3RKX A;  1AOY A;  4ESB A;  2K9S A;  1LFP A;  2L7Z A;  3FK7 A;  5K5O A;  2F4M B;  2DQR A;  3BJ6 A;  3S17 J;  2QEN A;  2NS0 A;  3DBH B;  3BG9 A;  1S5L C;  2IA0 A;  2M30 A;  1IRG A;  2BYV E;  3MCZ A;  1VQP I;  1EV7 A;  2XGX A;  3CCV I;  3M07 A;  5CJ9 A;  4BY1 J;  1MBH A;  2ISZ A;  4HPQ A;  1QRY A;  4HW0 A;  3W6J B;  4BE2 A;  1OCT C;  1T8I A;  1JHH A;  1BI1 A;  2D2W A;  3SHF A;  1FSE A;  2P5K A;  4II2 A;  5FKM A;  3FM5 A;  3VYR B;  1UAA A;  1SFK A;  2FE3 A;  1QHG A;  2X1D A;  2VN2 A;  2L7F P;  4NHJ A;  2NS7 A;  3F23 A;  3B73 A;  2O6G E;  3WG7 H;  4KA4 A;  1AKH B;  1HSJ A;  2M9H A;  4AIK A;  3MKW B;  3PUF A;  2VL8 A;  2L7K A;  1DGR M;  3L2V A;  2XV4 S;  2CQX A;  3CF2 A;  3HYI A;  1MJ9 A;  1DQU A;  4D1Q A;  5HLT A;  4YEJ A;  3IP4 B;  3H3U A;  3MQ0 A;  3ZP5 A;  1Q1V A;  5H6R A;  3FXJ A;  1ULY A;  3SZP A;  2DTZ A;  2P0W A;  4XBF A;  4XRM A;  3H0D A;  1T08 B;  5D4R A;  2EH3 A;  4QPO A;  3WTW C;  5DUI A;  5K5R A;  2M4G A;  2NVX J;  4LMY A;  5D6F A;  4RMN A;  1SFE A;  4EEF G;  2VBY A;  2K3F A;  3E0J B;  3WG9 A;  3CCU I;  3S14 J;  4JX5 A;  2AHQ A;  2L0K A;  5DCM B;  4ZJZ A;  3A03 A;  1YX5 A;  3TP3 A;  5JR3 A;  4GDF A;  4Y13 A;  1IRZ A;  4CDG A;  1UHM A;  1IXR C;  1JUS A;  2VUM J;  3ONQ A;  3I53 A;  4J00 A;  1Z6T A;  1ZKG A;  2KL4 A;  2LC2 A;  1Z7U A;  4AIH A;  3U2R A;  2YR2 A;  4E7J A;  2GA2 A;  2W48 A;  4XON A;  2OF7 A;  4BH9 A;  2ZME C;  3L2U A;  2G0E A;  5CQG A;  1KQ0 A;  2ELJ A;  5HVQ C;  5IT9 Z;  3O8G A;  2CQN A;  2DLL A;  3W3C A;  2NNY A;  1IV6 A;  1IW7 F;  5EEA A;  1FOK A;  3O6B B;  1OCR H;  4V2F A;  2L5Q A;  3KZY A;  4G94 A;  3LQR A;  1SAU A;  2XRO A;  4JBA A;  4YII A;  4BE1 A;  4BGD A;  4L0Z B;  4PJL A;  2QLZ A;  4RB1 A;  1YFH A;  2F2E A;  2ZXW H;  1IV8 A;  5HDK A;  3KCC A;  4DQ2 A;  2K4B A;  1U6G A;  2W85 A;  3H92 A;  1FOY A;  2ZXH A;  2WTE A;  1LFB A;  3B02 A;  3P9C A;  3AKZ A;  3TDZ C;  1ZRC A;  3S2D J;  4NNJ A;  2YX7 A;  2EFQ A;  1WJC A;  3J7A Y;  3LOC A;  1ETX A;  2ECB A;  4IKF A;  4XRS G;  4M9X A;  1MBK A;  1HC8 A;  1ZG3 A;  2CUE A;  3C3W A;  2JSP A;  2Z33 A;  4HAM A;  4A3M J;  4HF1 A;  2XKP A;  1IDY A;  3A01 A;  4CGZ A;  2QBY B;  3TDU C;  2VKD A;  3OSF A;  1VQ8 I;  3DPU A;  1TWG J;  2PQ8 A;  1X1P A;  5KVR A;  4Z2Y A;  2O9L A;  1MBG A;  2VT3 A;  2YUS A;  4LD5 A;  2R3S A;  1VQK I;  4PFP A;  4B8X A;  2V9K A;  3E97 A;  4LK0 F;  4AD9 A;  2WV1 A;  4WK8 F;  2H09 A;  1S8N A;  2R5Z A;  3H0G J;  1QQI A;  3I9V 2;  5JLW A;  2DK8 A;  1E0E A;  2XPV A;  1HLV A;  1YOV B;  1Z1D A;  4QLC U;  3TED A;  1HOM A;  5FD5 A;  3JAM K;  4ZYD A;  1B59 A;  2JPB A;  4UVC A;  2V4J C;  1TQP A;  2OQG A;  1WCM J;  1XTA A;  3DBL B;  2KP6 A;  2QSH X;  3ABU A;  1QU3 A;  1R5I D;  5M5W J;  1JUM A;  3GTM J;  1I50 J;  1WGX A;  5C4J J;  2CFX A;  2OD5 A;  3JRE A;  4B1R A;  3FK6 A;  1LJ9 A;  1MJB A;  2CW8 A;  4I76 A;  4Q4Z F;  3FIW A;  1ETY A;  3KEY A;  4BY7 J;  2GAU A;  4FX0 A;  3T1B A;  1SMY F;  4XIC A;  4XKW A;  2ZSH B;  2CWE A;  2OCE A;  2OTJ I;  3CLO A; 
#chains in the Genus database with same CATH homology
 4Y33 A;  4DBQ A;  4YRV A;  5CKT A;  3S32 A;  2M7B A;  4U7B A;  2VXD A;  4ANJ A;  4KT6 A;  4BQN A;  1WFX A;  2HU9 A;  3PUB A;  1V5F A;  4C2T A;  4Y3O A;  4XLA A;  2DXI A;  2R7S A;  3HXL A;  3A1Y A;  3LSG A;  2M3A A;  3DU5 A;  2R7W A;  3K4M A;  4J01 A;  3HG9 A;  3QYE A;  4ZTF A;  2KPM A;  4BE0 A;  4E4H A;  2WA0 A;  4PFO A;  4LG3 A;  1T95 A;  4P1W A;  2NOJ B;  4HSR A;  4BEH A;  3BG6 A;  4KJZ A;  3HUG B;  4OAY A;  4ZYA A;  4F55 A;  2HPM A;  4KIT B;  2DCE A;  3OY9 A;  2X1E A;  4EAT A;  1TT0 A;  2AQE A;  4XR6 A;  3HL2 A;  3K4B A;  2JVG A;  2VJ4 A;  3S3M A;  1BR2 A;  2LBF A;  4DJA A;  1LDK B;  2LY1 A;  3PNV A;  4XLH A;  3LFU A;  4CCN A;  3OYE A;  4B43 A;  4CCK A;  3UR3 C;  3HPH A;  2R7U A;  2BW3 A;  2IGK A;  3H9Q A;  1W36 D;  1V5E A;  3BLY A;  2KLO A;  2XF6 A;  4FET A;  4B44 A;  1Y56 A;  4F3Q A;  1X1B A;  2KHM A;  2CMP A;  3NWT A;  3H9J A;  1AA7 A;  2UUZ A;  1D1B A;  1WJB A;  1D0Z A;  4HNU A;  1IRX A;  2CH0 A;  4XOT A;  3SYT A;  3UNG C;  4IQ4 A;  3PSF A;  3OYG A;  3HOT A;  4RM3 A;  4PJM A;  1D0Y A;  1HA8 A;  4LIT A;  4AYB A;  3A2K A;  3IAM 2;  1MMN A;  1G8X A;  3W2A A;  3DPL C;  2MAB A;  1X4O A;  1DGW Y;  3GBG A;  2Z1D A;  3RPU D;  2XAU A;  3MMY B;  1Z7L A;  3HPG A;  3LSM A;  2L9S A;  2O5R A;  4OAZ A;  1MND A;  2WAE A;  1D1A A;  2X1C A;  4BL0 B;  4BU2 A;  3OYN A;  3ZCO A;  1EA3 A;  2GOM A;  2XSJ C;  2Z16 A;  4C30 A;  3CP8 A;  4E7H A;  4CA0 A;  3PFY A;  2KQR A;  4XKC A;  4XKB A;  1GLN A;  4XLE A;  4ZC3 A;  3L2Q A;  3HC7 A;  2LRD A;  2PJR B;  3VYU B;  2XC7 A;  1N77 A;  3RSN A;  2JVH A;  3LSK A;  3OR1 C;  3FBI B;  4NC7 A;  1WJE A;  2KRC A;  2F5V A;  4YEL A;  3S3N A;  2HQA A;  3IAS 2;  1WJF A;  4XL9 A;  2MFZ A;  4F52 A;  2XF7 A;  4P5O A;  4H4K C;  3AL0 B;  2DOA A;  4R79 A;  2M7A A;  3K10 A;  4JOM A;  4PJN A;  3CP2 A;  1PJR A;  2BVL A;  3H5R A;  2Q2E B;  4XOP A;  2LBF B;  2IS1 A;  3BC8 A;  3RCO A;  4CCM A;  1R6R A;  3AFH A;  2F4I A;  2VPL A;  3ZR8 X;  1BR4 A;  4BS9 A;  3OYI A;  1X1C A;  2CV2 A;  3EPZ A;  2IS6 A;  4AU7 A;  4BJ5 C;  4MLO A;  3PL8 A;  1WJA A;  4BUP A;  2PMZ A;  2R7X A;  4BAC A;  3MKY B;  2R7R A;  3W2V A;  3U21 A;  4Y4R A;  1FMW A;  2LRE A;  2E1M B;  3ZQQ A;  3EUH C;  3QOE A;  1X19 A;  3S93 A;  4XN0 A;  2DT7 B;  4BJT A;  2IGO A;  4CCL A;  2IGN A;  3A4C A;  1OLT A;  3K4C A;  2V7F A;  4XN3 A;  2HPI A;  2VQH A;  4E7Z A;  4E7K A;  2VB6 A;  3AL0 C;  4XMY A;  3CES A;  3CZ6 A;  1BOB A;  3OS1 A;  2Y0S A;  3OIP A;  3PJR A;  4RLF A;  2A6T A;  3ZGK A;  2X51 A;  3RQ4 A;  3K4L A;  4B47 A;  2CW7 A;  3SEZ A;  5KCM A;  3KX2 A;  4N4N B;  2QKL B;  2IGM A;  3DU6 A;  3N05 A;  3HOS A;  3HKZ A;  4B3X A;  4KIS A;  2OUM A;  3OYH A;  4DBR A;  3OMY A;  3FDY A;  2KDO A;  2IS4 A;  1W36 C;  2WBM A;  2V1N A;  4HST A;  4ZDP A;  4XLC A;  4PK4 A;  3PNY A;  4RM2 A;  2W7N A;  4ZDO A;  3IUO A;  2FUG 2;  2VQG A;  5HNF A;  3CJQ B;  2WAF A;  3G2B A;  2E1M C;  3MKZ A;  1UEL B;  2DJI A;  4XM3 A;  2E5N A;  3H5N A;  3LSI A;  4BJ6 C;  4CCO A;  3KYL A;  3K6G A;  3VYS B;  5HNH A;  4XQF A;  4ZDL A;  2MYS A;  2X85 A;  2I8D A;  4HRI A;  2VJJ A;  2X6W A;  4F93 B;  2BW3 B;  4G6T B;  2VIX A;  4HEA 2;  1X1D A;  1X1A A;  2E60 A;  2ZSI B;  4FAS D;  1PYV A;  2MC4 A;  2ZXI A;  2W1O A;  3NWS A;  2HZD A;  1TZL A;  4OWR B;  4XOR A;  4BQO A;  4U87 A;  2KZV A;  3OYK A;  3VSK A;  3OOU A;  3ZXS A;  2R7O A;  5FRO A;  2VJ5 A;  2W00 A;  3BCA A;  3K4J A;  2AQF A;  4X0G A;  5CQE A;  3OL3 A;  2X6X A;  4DGW B;  2F6C A;  1Y6I A;  2BVM A;  2CS3 A;  1DP3 A;  3LSH A;  3VYT B;  3L2W A;  5HOO A;  5KNL A;  1UG0 A;  2R7Q A;  1Z3X A;  2VAS A;  2E5Z A;  1MMD A;  3FHN A;  1MMA A;  4CCJ A;  4HNT A;  2IXS A;  1ERD A;  3EUK L;  2IS2 A;  3V42 A;  2LG4 A;  3QYF A;  3C2H A;  3BG7 A;  2V26 A;  4PJJ A;  1MNE A;  3S3O A;  2K5C A;  2VXZ A;  4XLF A;  1JI8 A;  3CJR B;  3OYL A;  3MD2 A;  1LFP A;  4D9J A;  3EUA A;  4CZC A;  3OS2 A;  2DT6 A;  1QHH D;  3BCB A;  3OIQ A;  3ZRG A;  3OS0 A;  4C2U A;  2R7T A;  1LKX A;  2KMU A;  2RQQ A;  3D5L A;  3E1S A;  3TBI A;  4HPQ A;  3FBN B;  3K4K A;  5FRN A;  3PNT A;  3OR2 C;  4CSW A;  4BE2 A;  2HNH A;  1S9H A;  1LVK A;  2HVR A;  4BDY A;  4II2 A;  2WAD A;  3DPT A;  3VYR B;  1UAA A;  1SFK A;  1QHG A;  2X1D A;  2HVQ A;  3VDX A;  3K70 C;  1OR7 C;  2CV1 A;  3MKW B;  2VL8 A;  2PJR A;  2L7K A;  1DGR M;  3L2V A;  2M4K A;  2RRE A;  5FRM A;  3CF2 A;  3DEE A;  1DQU A;  1P9Q C;  4D1Q A;  5HLT A;  4YEJ A;  4II3 A;  3IP4 B;  1NG7 A;  3M8J A;  2X6Y A;  3RTR A;  2UWM A;  2P0W A;  4DIQ A;  2WAQ A;  3H0D A;  2R4G A;  3OL4 A;  4QPO A;  2BOL A;  3D5R C;  3OYJ A;  4ZTJ A;  2LOO A;  2R7V A;  4BEH B;  3DWL E;  4E7S A;  2M4G A;  4PUS A;  2A5W A;  3CMM A;  4RMN A;  3E0J B;  1X4P A;  2VQL A;  4ZJZ A;  4BQQ A;  1YX5 A;  2LH9 A;  3FKJ A;  2K3P A;  3OWT A;  1MMG A;  1G59 A;  2CV0 A;  3ONQ A;  4J00 A;  4HG2 A;  2KL4 A;  3DKY A;  2LC2 A;  1D1C A;  2K9L A;  4E7J A;  5CPR B;  4XON A;  3SDB A;  1Z3Y A;  2OC6 A;  3TL4 X;  3C2G A;  4DOZ A;  2L9N A;  3L2U A;  5CQG A;  3TMO A;  3OYC A;  3M1C A;  2ELJ A;  5HVQ C;  4QPQ A;  3W3C A;  2JA2 A;  2RNG A;  1YE9 A;  1N78 A;  1WJD A;  2L5Q A;  1N75 A;  3D5S C;  4IQJ A;  3I3L A;  4JQF A;  1SAU A;  4BE1 A;  2VQC A;  4ITV A;  4BGD A;  3QYB A;  4PJL A;  2WY8 Q;  2ZFU A;  3OYF A;  3LL7 A;  3L2R A;  3K4N A;  2M0M A;  2ZXH A;  5LFA A;  2LY2 A;  4NC8 A;  3OYB A;  3AKZ A;  4LIU A;  4GRI A;  2K9M A;  4NNJ A;  4N4O B;  4E7I A;  4PSW A;  5JHF A;  3DTI A;  1KON A;  1WJC A;  3J7A Y;  1U0J A;  4IKF A;  1WJ5 A;  2WB1 A;  4C9Y A;  4IZZ A;  5KHD A;  2JSP A;  1BR1 A;  2W82 A;  1Z21 A;  1FMV A;  3OYM A;  4IX7 A;  3DKX A;  2LYC A;  1ZEL A;  5TGT A;  3S8P A;  3F9K A;  2VKD A;  3K70 D;  3W2W A;  3DPU A;  3DLA A;  4E6K G;  1D0X A;  2CUJ A;  2HVS A;  3OYA A;  2L2O A;  1VZ0 A;  4RLQ A;  4B48 A;  4BDZ A;  3H5A A;  4BXF A;  2V6E A;  4PFP A;  2Z2S B;  3PSI A;  1T0F C;  1K6Y A;  2V9K A;  1E0E A;  3I9V 2;  1YX3 A;  2CFO A;  4XKV A;  3H9G A;  2W4S A;  4NUB A;  4PSX A;  3H35 A;  3QOD A;  4AVZ A;  2MD0 A;  2KRH A;  2V4J C;  2WY7 Q;  1NG6 A;  4NQW B;  1V5G A;  2KP6 A;  3VSL A;  4CH7 A;  1QU3 A;  2VJI A;  2OV7 A;  3DTK A;  1MW7 A;  3DTE A;  2UV1 A;  2XDV A;  2VKH A;  1J09 A;  2JUG A;  2GOX B;  4E7L A;  2VLA A;  2CW8 A;  4XNF A;  2QKM B;  4F91 B;  3KEY A;  2Q1Z B;  3OYD A;  4LIV A;  2HDW A;  4F92 B;  3LMM A;  3SZG A;  4XKW A;  2ZSH B;  2CUZ A;  3DQV C;  5LD2 C;  2XF5 A;  3VWB A;  4CUG A;  3SEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...