1EF4A

Solution structure of the essential rna polymerase subunit rpb10 from methanobacterium thermoautotrophicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
MIPVRCLSCGKPVSAYFNEYQRRVADGEDPKDVLDDLGLKRYCCRRMLISHVETW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Zinc-bundle structure of the essential RNA polymerase subunit RPB10 from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2000-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ef4A00
1FIPA 3TW6A 2H1KA 2JJ7A 2N8GA 1BL0A 5F0HA 1GV2A 3Q0VA 1IG7A 3A01B 4DZJA 4W97A 2L7FP 3JRDA 1H88C 1TWCJ 1RETA 5EEAA 4MFEA 4C2MJ 1U9NA 2WB1N 3PO3J 2XB0X 5IOZA 3HOUJ 4JX5A 4IHXA 2B63J 1IUFA 2RAEA 4M3FA 5IP9J 1RPWA 3H0GJ 1F36A 2Y30A 3WHBA 4FE7A 2MG4A 2FX0A 3HKZN 3MKLA 4C3JJ 3S15J 1F43A 1TC3C 4AYBN 3OOUA 2M0CA 3S1RJ 1LFUP 3E7LA 2DA2A 3K2AA 2JN6A 1ETQA 2K9SA 2NVQJ 4UUSB 3HOVJ 1YRNA 5FKMA 3M4OJ 3JREA 2L7ZA 5C3EJ 2OF7A 1AHDP 3IH3A 4X6AJ 4V2FA 4JX4A 2TRTA 9ANTA 1RESA 4JP0A 3LNQA 3Q3SA 3OSGA 2XGDA 2E2HJ 5M3FJ 4BBSJ 4FTHA 2K40A 3BR3A 4MIMA 3BR5A 1GVDA 5EYRA 3L1PA 3GBGA 3OSFA 2EH3A 2R5ZA 1IDZA 2LP0A 2E2IJ 3BG9A 5GP9A 2EBIA 3B6AA 3A02A 2L0KA 2LLKA 5DTDA 4QIWN 3RQIA 1APLC 1HDPA 1D5YA 1Y1VJ 3BT9A 1XG1A 3FISA 4ABZA 3TP0A 1YRNB 4A3GJ 2IEKA 4UUTA 5F0FA 1FJLA 2L7MP 1SFOJ 1VI0A 4G12A 1MBHA 3TEDA 2VKVA 2JA7J 3LSPA 5IYDJ 1B8IA 3HOYJ 2R92J 2LTPA 5DS9A 5IP6A 2IAIA 2R5ZB 1XS9A 1ETOA 4A3FJ 1H89C 4MLOA 2XRLA 2X48A 4XK4A 1S7EA 3BQZA 3JRCA 2WAQN 2MSYA 4BBRJ 1JT0A 2DA3A 3RZOJ 2HQ5A 3O8HA 1Z77A 5IYBJ 1JT6A 3OIOA 1I6HJ 1ZK8A 5F27A 2JK3A 3NARA 5FKKA 5K7HA 5EG0A 2EZIA 2LK2A 1MH3A 3BG3A 2DMTA 2EZKA 2DJNA 2XB5A 1G2HA 1JTXA 3RKQA 1B8IB 3HDDA 4L5EA 4D5CA 3UKGA 4I6ZA 2X9DA 4D7MA 1UHSA 1H8AC 4C3HJ 3D1NI 2P81A 4HNVA 2DA1A 1FTZA 2HXOA 1WGXA 3GTLJ 3ZQCA 2ID3A 2Y0SN 3CCYA 2HOAA 3FIWA 3JRBA 1GUUA 1ETVA 1TWAJ 3HEFA 1DU0A 1HF0A 3BTCA 3H3VK 2IBDA 4W1UA 2W48A 1JUSA 5JLWA 2ELKA 3BR6A 1MSFC 3I4NJ 2CUEA 4XIDA 5EG0B 2NOGA 4RDUA 2CQXA 4Y52J 4XRMA 1ETWA 1E3OC 1MH4A 1ETXA 1ITYA 3LSGA 4IHVA 1ZGWA 1ETYA 1JKRC 2DMQA 2G0EA 3A03A 1X2MA 2QCOA 4CYCA 1OJLA 5IOYA 1QVTA 2COBA 5EGOA 3Q0WA 2VKEA 2X6OA 3PM1A 2Y31A 2VPRA 2CQQA 3IH2A 1I50J 3QPSA 2LD5A 2AHQA 2EQRA 4BY1J 2HI3A 1POGA 1IDYA 3CQZJ 1IV6A 2E2JJ 4I76A 4M3DA 1VFCA 1U78A 4X1EA 2HYJA 3HOZJ 3CDLA 1JUMA 4A3IJ 3S1QJ 5IPAA 1JTYA 3LSRA 1RKWA 1P7IA 1HDDC 4M3GA 3ZQFA 4A3LJ 4MFDA 3VPRA 4J19A 1I3QJ 4B1RA 3CMYA 4CYCB 2O8KA 2AO9A 2NS7A 5BNGA 5E3NA 5EGOB 1ENHA 1MSEC 5F1JA 5FKLA 1ZTRA 2JA8J 2R7ZJ 5F04A 2GM4A 1P7JA 4A3BJ 3FK7A 2LY9A 2JWTA 1TWGJ 2D5VA 1U8BA 5E3LA 3BTJA 3TP3A 4DW6A 3S1NJ 3PO2J 1ZQ3P 3RZDJ 1JJ8C 1WPKA 3SDGA 2ECBA 1OCPA 1O4XA 2MGQA 3TW7A 2NVXJ 3LOCA 2CUFA 2O9LA 5FLVA 3ZQGA 2XPWA 4D7NA 1K61A 4IHWA 4M3BA 1UG2A 4FE4A 3S17J 1A6IA 2R93J 1X2NA 3IH4A 2K9NA 1GT0C 3O8GA 1BJZA 1HOMA 1X58A 4LOCA 5J1RA 2DA6A 2KT0A 3W6VA 4A3CJ 2DMPA 3JRIA 1Q1VA 2ME6A 2HXIA 1EF4A 2VI6A 4DZPA 1WCMJ 2YS9A 1ORKA 3S14J 1MBKA 2DA5A 2JA6J 2WV1A 1MBGA 1BW5A 2ECCA 4NDLA 2ME0A 1BW6A 2YUSA 1CQTA 3M3YJ 4IHYA 4A3JJ 2XGCA 1NTCA 3Q0UA 4XRSG 4XRSA 3GTKJ 5IP7J 3JRHA 5M5YJ 4S0HB 3HGYA 5E3OA 1RKTA 2M9HA 5GPCA 3I4MJ 1ETKA 1MNMC 2E19A 4B3AA 2NS8A 5M3MJ 5GPAA 4AUXA 5IYCJ 2M8GX 1K83J 4A3EJ 3BTIA 1WI3A 3HBLA 2K9QA 1IRZA 5M5XJ 3JRGA 1UMQA 3BTLA 4QTRA 1WH7A 3JRFA 2PMZN 5F0CA 1AU7A 2EZHA 1JKPC 3F0CA 4BKXA 2R5YA 2VUMJ 1RR7A 2JMWA 3ZQLA 5K7FA 3B6CA 1JGGA 3DEWA 4BXXJ 2FQ4A 1A5JA 2DA7A 1AKHA 2MW8A 1LE8A 5C4JJ 4FCYA 3K7AJ 4A3DJ 3GTPJ 4JYKA 5J1UA 4M6VA 1U9OA 2CU7A 2LR8A 5EZGA 3S2DJ 1HLVA 3QPLA 2XGEA 4FISA 4DYCA 3DCFA 3JR9A 2ID6A 2ZB9A 2LKXA 4DYRA 2NVYJ 3IV5A 1ZR4A 5E3MA 1IGNA 5C4XJ 1QRYA 3G1MA 4AC0A 3BR2A 2O7OA 3SJMA 5JLXA 2M2EA 2I10A 2L9RA 5FKNA 1JJ6C 3MN2A 1FIAA 4MO7A 2Y9ZA 2CRGA 5K7ZA 4IEJA 2H8RA 4GFBA 4QSHA 3GTMJ 3HB9A 4Y7NJ 3GTJJ 2R5YB 1VNDA 1W0UA 3ZOBA 3JRAA 2DA4A 1NK2P 2LVSA 5EZHA 3QQAA 3S2HJ 1AKHB 1LE8B 2OPTA 5F08A 1B72A 4RBOA 1MBFA 4A3KJ 3GTOJ 3GTGJ 1LFBA 1R9TJ 4A69C 3G1LA 2LFBA 2YU9J 1HCRA 2DTZA 1W0TA 1QPIA 1VF9A 1MBJA 3FKIJ 1Z0XA 2CJJA 4D5FA 5FKOA 3C2BA 2FJ1A 1T56A 3S16J 2XPUA 5EDNA 4M3EA 4B4CA 1DU6A 5HODA 2R0QC 4A93J 3WHCA 3HOXJ 2QF7A 4A3MJ 3ZQIA 1XC5A 2XSDC 3LSJA 3BG5A 4DYQA 1JKOC 3FK6A 4BY7J 1OFCX 2DMNA 1SANA 2M34A 1TWFJ 5J3LA 3SFIA 2GLOA 5FJ8J 1B72B 1BA5A 1IC8A 1PUFA 2DMUA 2EZLA 3MVPA 2JA5J 3BR1A 1WH5A 1QVUA 1NK3P 2HDDA 3ZQHA 2Y9YA 1ZR2A 3G1OA 1TWHJ 2Y2ZA 1GV5A 5M5WJ 1FEXA 2TCTA 2XPVA 4V2GA 2HOTA 1JUPA 2NVTJ 3GTQJ 2FD5A 1IJWC 5FLMJ 1GDTA 4XICA 5EF6A 3A01A 3HOWJ 1MBEA 3S1MJ 5J1YA 3BQYA 1Y1WJ 3HGGA 4C3IJ 3BR0A 5C44J 1PUFB 2GBYA 1JKQC 2DN0A 3HM5A 3NAUA 1ZKGA 1T33A 1OCTC 2KDZA 2E1OA 1FTTA 4EEFG 4UUSA 4JX6A 2HOSA
chains in the Genus database with same CATH superfamily
2DK5A 3SHFA 3QP5A 3TW6A 2JJ7A 4PGHA 2CH0A 4LK1F 2L9SA 1GV2A 4DZJA 1BBYA 2L7FP 1TWCJ 1RETA 1LEBA 4MFEA 1T08B 2BV6A 3I59B 1FOKA 2DT6A 4LLNA 3HOUJ 2ZMEA 4IHXA 2STWA 4BJTA 1FNNA 2DFHA 4XBFA 1X1AA 1RPWA 4NQWA 3VSLA 5K5RA 2FX0A 3S15J 3BG6A 2PG4A 2EV5A 4Y4RA 3H3UA 2FMLA 4AYBN 1ZHFA 2CO5A 4BDYA 3E7LA 5DCFA 2DA2A 5AIQA 2JN6A 3A4CA 2ICWG 5BMZA 1Z7LA 3PL8A 3T8RA 4B8XA 1Y6IA 3DLLF 4L9NA 2IS2A 3GFMA 3HOVJ 3M4OJ 2XVCA 2E7XA 2OF7A 4X6AJ 2OJED 3RSNA 2CV2A 4BUPA 4OIRF 3OYJA 3MKZA 3OV8A 4BBSJ 2ZMEB 4MIMA 3D5RC 3DEUA 1HW2A 2VBXA 1GVDA 1QNTA 1FSHA 4NQWB 2MFZA 4HQMA 2P5LC 2R5ZA 3DBRB 1HKQA 1JE8A 3HKZA 3KP2A 1SD4A 1CF7A 3A02A 5KK1A 4KNYA 2K86A 1Z3YA 2BY0A 1HDPA 4AIDA 4Z2YA 2OV7A 1XPXA 2MABA 1D5YA 2HPIA 1RIOH 4ABZA 4IOCF 4ZH4F 1W7PA 3E6DA 2NNNA 4LD5A 2HOEA 4XLCA 1IAWA 1QZYA 1L0OC 2YR2A 3KZYA 4UUTA 3IC7A 4PJLA 1C0WA 2KJCA 3DXJF 2FSWA 4HDVA 2BYVE 3K1MA 3IHUA 3AG2H 3LSPA 2J5OA 1B8IA 1T98A 1TLHB 3W3CA 2LTPA 2IAIA 2R5ZB 1ETOA 4PUSA 1OYWA 2HYGD 2KLOA 4XLFA 2X48A 3H9GA 3R61A 4XK4A 1CF7B 1D8KA 4BYYA 2EJRA 1SVOA 1N77A 2WAQN 2MSYA 2V79A 1IN7A 1JT0A 2IS1A 4I0AA 4A5MA 3KZZA 1Z77A 4NC7A 4ZZDA 4F3QA 5IYBJ 4CHUA 2XF5A 5CLSA 5D5VB 5F27A 1W7PB 4CZCA 2QENA 1ZG5A 5ICGA 2W24A 3TQNA 3JAMZ 3F8FA 3OYLA 1YFHA 5DCMA 4XR6A 2EZKA 4S05A 2CW8A 2FBIA 1KYZA 1JTXA 1B8IB 3BG7A 4L5EA 4LLLA 2IW5A 1E3HA 4R1HA 2DQLA 4I6ZA 2M4GA 1BIAA 4R8HA 4CA0A 1UHSA 2VJJA 3RI4A 3FXJA 2HXOA 2XASA 2XKOA 2ID3A 3CCYA 1GUUA 1TWAJ 5B1AH 2BGCA 3V8LA 4NNJA 2YSRA 4EGYA 3PUFA 1JI8A 1JUSA 2A05A 3BR6A 2QSFX 3K9TA 3G71I 1W1WE 1OLTA 2NOGA 1HA8A 1FSEA 2VQLA 4WXDA 5DCMB 1E3OC 1R71A 3CJRB 3LSGA 2FOKA 3QODA 4YEJA 4A6DA 3M1EA 2HWVA 2MC3A 3ZN1A 2DMQA 2QKLB 2QCOA 4YFXF 3M9AA 4UB6C 5KAIC 2EFWA 1Y8RB 4EJTA 3Q0WA 3PM1A 4XORA 2VODA 2VPRA 5CPRB 3E0JB 3D5SC 3QPSA 2LSOA 2QEXI 1P4AA 2EQRA 2Y0SA 4YIIA 1POGA 1IDYA 3CQZJ 1IV6A 1F1ZA 4KMUX 2E2JJ 2CQKA 4A0XA 1ONVA 2LY1A 1R5ID 2NS0A 4U7BA 1SEUA 1FLIA 2E36A 3NEUA 4AD9A 3PNTA 1HBXG 3VYRB 3HOZJ 3CDLA 4M9SA 4OAYA 4XSXF 2V9VA 4PCQA 1RKWA 3SXYA 3N97A 3VSKA 5HOOA 3ZQFA 5DUIA 3KETA 2F5EA 4Q5SF 3HZJA 1YJWI 1SD7A 3DP7A 4P55A 2X6WA 1ZN2A 5BNGA 3DKXA 3BJ6A 1MSEC 2W57A 3CUOA 4EM2A 3CESA 1SAXA 4KYWA 1SD6A 5JI6A 2XC7A 2M8EA 2DPUA 3NWTA 4GRIA 4BE1A 3WU2C 1SFKA 2R7FA 5CQEA 3OOPA 4ZDLA 2OQRA 3H92A 2D5VA 1U8BA 4HW0A 3WU1B 4ZYAA 1AOYA 3BJOA 4U88A 3K1NA 1YIOA 3RZDJ 1QO0D 3SDGA 4YFNF 2ECBA 2VJ5A 1P4XA 1A04A 4GXOA 3H36A 3TW7A 3LOCA 3MZHA 2O9LA 1VQKI 1I27A 3CMEI 3CF5F 1K6OA 4D7NA 2XV4S 3L09A 1AA7A 1XX5A 3MAJA 1NHAA 4FE4A 3V8JA 2OD5A 1OCOH 3CZ6A 3S17J 1A6IA 2FU4A 2K9NA 3S3OA 2RVCA 1UG0A 3W6VA 2KT0A 2D1VA 1IN6A 3MQ0A 4M74A 1HW1A 3JRIA 1KU9A 4AIKA 2CUZA 3HG9A 1MIJA 2M5WA 3ONQA 4QWQA 4DZPA 2ZNYA 4XSZF 1FP1D 3CO6C 3S14J 4A2UA 4Y13A 1TBXA 3FXRA 1MBGA 1XCBA 1BW5A 2WV0A 4IHSA 3IWZA 5HNFA 2GAUA 1B9NA 1S8NA 2E5ZA 2L3DA 2L9NA 3GCMA 4HAMA 4XLAA 3TDZC 3ZN0A 4A3JJ 3MCZA 1B9MA 3CTAA 5IP7J 1YI2I 5M5YJ 3HHGA 2I5UA 2QM3A 3BPVA 2PMUA 4B44A 2ISYA 3DPTA 1U0JA 2M9HA 1X3WB 1R1TA 3I4MJ 3F8NA 4RB0A 3JAMK 2R7DA 2V1DA 5GPAA 3CUQA 4AUXA 1V5EA 1R1VA 3BCBA 1S9HA 5GAHJ 4BQOA 1WQ2A 3MFKA 1OR7A 2QWWA 5M5XJ 2M45A 5FB2A 2VIXA 3BTLA 4QTRA 4UHTA 1WFXA 2R7RA 3UNGC 1WRJA 3C2GA 4I0BA 4U87A 1ZLJA 5HS8A 2IS6A 2GIVA 4CCKA 4BL0B 2VB6A 1S29A 2KL4A 4EM1A 5K7FA 3BPXA 4BJ6C 3B6CA 1T39A 1QPMA 3T1BA 2RQQA 3BP8A 2FQ4A 2QQAA 4ESBA 2DA7A 4FQGA 1AKHA 1LE8A 2ZXWH 3W6KB 4JYKA 3P7NA 4M6VA 2CU7A 2LR8A 5EZGA 4ZYDA 2OA4A 1HLVA 3QPLA 2XGEA 4FISA 1G3WA 2Q0OA 2QKMB 3HSFA 4LFUA 1FX7A 3CUQB 2ZJ2A 1IZ1A 1ZR4A 4AC0A 2WAFA 1X4OA 2KJBA 4Y15A 3SJMA 5JLXA 2I10A 2L9RA 2GOXB 1FIAA 1DPUA 3JSPA 4G7HF 3QPTA 5IT9Z 3PIOF 5DDGA 2H8RA 4GO1A 3HSEA 3C7JA 3E97A 3HB9A 2F2EA 4Y7NJ 4DIQA 1LQ1A 3ZOBA 3JRAA 3LAJA 5JR3A 1PYVA 2AXLA 3TKYA 4F93B 1NK2P 2HTSA 4XLPF 4P96A 1AKHB 1LE8B 5EJCA 5F08A 2NXNB 2JVGA 4A3KJ 2ZXJA 3GTGJ 3GTOJ 2XAJA 2FQ3A 2LFBA 1MMNA 3J7AO 3WTWC 1YIJI 3C2HA 3R0JA 1Y8QB 1KU3A 3HTUA 4C9YA 1Z0XA 4D5FA 4HSTA 3RDIA 4L5IA 4I7HA 3LSHA 3A0BC 5H2FC 2PFBA 2A5YB 1RUOA 4M3EA 3OYMA 5ICCA 1VQMI 2WTEA 5HODA 3DTIA 1P4WA 3QYBA 2QF7A 2KRHA 1Q1HA 1SC7A 3E5QA 1JKOC 5LGTA 1P6RA 4L9JA 2LREA 3EETA 5J3LA 3K4BA 3MZYA 3SFIA 1AWCA 1BR1A 5FJ8J 1MMSA 1J7KA 1ULYA 2KP6A 3MD2A 5LHHA 4HF1A 1BA5A 5LHIA 1PVEA 2JA5J 4A12A 2CFXA 2PQ8A 5KCMA 2NVUB 1NK3P 3NRVA 3QYEA 5HLHA 1YITI 1IXRC 2DXIA 1IW7F 2HDDA 3LA7A 3WG9A 3KP3A 4RS8A 4XRFA 3BZ6A 4RAYA 1FZPB 4EJVA 2DBBA 1FEXA 1LDKB 3S32A 3HRTA 2B7EA 2F5CA 1IJWC 1UB9A 1Z3XA 2E1NA 3R60A 3ZRGA 1KQ9A 4RGXA 1IXSB 4G6DA 1H0MA 3U1KA 2WBMA 2OTLI 2PX9A 1J0RA 5J1YA 5DYMA 1E0EA 3K4NA 4I99C 2NAZA 1XMKA 2V1XA 3PUBA 4BDZA 4ENNA 3KP4A 3TMOA 3OYGA 3H1CA 1JXSA 1FY7A 2KIUA 2KKOA 5D5UB 3REOA 2DN0A 2OZ6A 5KHDA 3W2AA 4WX9A 3OYHA 2BVMA 4F52A 2IA0A 1BM9A 4L18B 4PFOA 2XKPA 3FMRA 3M7GA 1IV8A 1Z21A 4AU7A 4EEFG 3LFKA 4UUSA 4ESFA 3T0YA 1FIPA 2N8GA 5F0HA 4O5VA 3OL3A 1XN7A 4W97A 3JRDA 5EEAA 2IGNA 4CH7A 4C2MJ 3PO3J 4CCNA 3CMMA 2DODA 3ROUA 2YU3A 3F8MA 2O8XA 3R4KA 3BJAA 3A1YA 3H0GJ 1EH7A 1FP2A 4XN3A 3IKVA 1DGWY 2MLKA 2R7SA 3ULQB 3ZMTA 4MTDA 2VXDA 4KT5C 3DV8A 1TC3C 5EEHA 1ZAOA 3S1RJ 5J6XA 1LFUP 1O7LA 3GZ6A 1EH8A 1B6AA 3DPLC 5J40A 4UUSB 3I71A 1O3SA 5J8CA 1ZARA 4G6QA 2EILH 4XOTA 1LKXA 2V1UA 3OYFA 1AHDP 1BOBA 3IH3A 2TRTA 3TO9A 1RESA 3LNQA 9ANTA 2DPDA 1W7PD 2WB1A 4BHCA 4A6EA 3H9JA 2XGDA 1VQ9I 2E2HJ 1XMXA 3AL0C 4GCVA 1FC3A 2KRCA 4KUMA 3BR5A 4UY8I 5FRMA 3BOQA 4XONA 1I3AA 2EH3A 1IDZA 4OAZA 3M1CA 2MYSA 5GP9A 3ML6A 1ZGJA 1PUEE 2ELJA 3H9QA 2LKSA 2PJPA 2L0KA 4PDKA 5LHGA 2HZDA 2VT3A 2LLKA 3IWFA 1FBUA 4HYEA 4M9ZA 5DTDA 5IT9K 4OMZA 3P5JA 4X0GA 2IA2A 3L2WA 4IPAA 1X1PA 2C6YA 4ON0A 5LEJA 1ZG3A 1V5GA 5GTHC 3ECHA 5LEKA 4C2TA 3OS0A 3G2BA 4I98B 3TP0A 1DPRA 1SMTA 5HS7A 3JW4A 5ICFA 5BPDA 3UR3C 2MLGA 2IEKA 3QU3A 5K1YA 2KIMA 5F0FA 1USTA 2EINH 2L7MP 3F21A 1SFOJ 4OIQF 2CFOA 1VI0A 3SDBA 4KMFA 1MBHA 3LSTA 3TEDA 1LB2A 4HPQA 2M87A 3HOYJ 4AWXB 2X1EA 1Z6TA 1YG2A 1PJRA 1Z91A 4OIPF 2PJRA 4E7JA 4N9IA 2HQAA 1W4MA 1REPC 2VKDA 2VT2A 4RA2A 4UV9A 1UZCA 3JRCA 1DP3A 4BBRJ 2DA3A 5HLTA 2GQQA 3O8HA 3ZR8X 2L02A 2LDUA 1JT6A 3OIOA 2CV1A 1ZK8A 2LG4A 3MKYB 1TQPA 2X51A 3HUGA 5FKKA 4ZYGA 1DP7P 1Y39A 5K7HA 2VOOA 5J8FA 1WHUA 3CUQC 4B3XA 4H4KC 2V9KA 3WE2A 3ABKH 1FOWA 2DMTA 1OR7C 2F5VA 2DJNA 3K4LA 4PSXA 4F7ZA 2LMDA 3BC8A 3M07A 1I39A 2E35A 3IAM2 2ZSHB 2X9DA 1MMDA 3X2QH 2PJRB 3D1NI 4ANJA 2K4JA 3F9KA 4HNVA 3VFZA 1FTZA 2LY2A 2K5CA 3DF8A 1WGXA 3GTLJ 2E60A 3FIWA 2HOAA 2A07F 4M6YA 3VYTB 3J80Z 1DU0A 1HF0A 3ZMUA 5D6EA 2Q8KA 3H3VK 4BQAA 3WGGA 4G8XA 1LPQA 3FX3A 3KP6A 3I56I 3HUGB 4J00A 2B9SA 3I4PA 2F6CA 1TQMA 2VQHA 3KEOA 3AKZA 1WVRA 1YX3A 4RDUA 2ZBKA 1F9NA 3K4MA 2CQXA 4Y52J 4BHPA 1ETWA 4XRMA 1QZZA 2LNBA 1MH4A 1O57A 2BOLA 2VE8A 1ZGWA 1WJFA 2BVLA 3AG4H 4DBQA 3F23A 3A03A 4IHTA 1KGSA 4UB8C 5IOYA 5EGOA 4B48A 3TL4X 3CCMI 4OOIA 4KA4A 2JZYA 5ICEA 2LD5A 1OISA 5J47A 2HZTA 1VQ4I 2YPRA 1YS6A 1XB4A 2VQGA 1SFXA 3V4GA 3U21A 1VFCA 1FBQA 2OC6A 5F6FA 3FMSA 2QLZA 3FXKA 1U78A 3H5NA 4DQ2A 2A69F 2X6YA 3HXLA 1JUMA 4E7KA 2MA3A 2RN7A 5IPAA 3LA3A 3A2KA 1XGNA 3RPUA 2VC0A 1D1BA 3OIPA 2DJIA 1HXDA 2DDBA 1VQ6I 2HQRA 2LH9A 3P9IA 3TDUC 2VONA 2EB7A 3CD6I 3M8EA 2PLYA 1X1CA 1X3ZB 2AO9A 4RAGA 5E3NA 2WA0A 5EGOB 2DOFA 2F4MB 4HNUA 2IGOA 4WCGA 3F8CA 2D1HA 2P5VA 2R7QA 5F04A 4CSWA 1BC8C 4XQFA 4HDUA 2GM4A 2CQ7A 1K4TA 5DD8A 5J4VA 2HPMA 1FMWA 2VBWA 1NG7A 5LBQA 1SFEA 2LY9A 4PK4A 2BY2A 4HSRA 3QRFF 3CJQB 3BTJA 3VB2A 2DCEA 3S1NJ 3PO2J 4LIVA 4TV7A 3F72A 2MH2A 3MWMA 3PNVA 4LB6B 2PN6A 2JUCA 1JJ8C 3PSFA 4BH9A 3L2UA 1RI7A 1O4XA 3H5RA 4IQ4A 3WTXC 3GWZA 4GYGA 3SZPA 4U7DA 4G6TB 1FYKA 1Z1DA 4HV5A 2ZJQF 1O3QA 1K61A 4M3BA 4CO8A 1FBSA 1U3EM 1XSXA 1TNTA 4PGGA 2R93J 3ERMA 2Q1ZB 1BJZA 1D0ZA 3HSRA 1X58A 3GUDA 1MNEA 2WY8Q 1OYYA 3LSMA 3OIQA 3G6EI 4A3CJ 3KEQA 3MZ8A 1J5YA 2AXTC 2WWYA 4E7HA 1A31A 4KISA 2A6HF 1ORKA 2YS9A 2CUJA 3F8BA 4NB5A 5HDNA 3RKWA 2DA5A 2VPLA 2WV1A 3OYDA 3K0LA 3T8TA 4NDLA 4LITA 4G9YA 1P92A 5D5XB 1OCCH 1H9TA 1CQTA 1VQLI 2J5PA 4A0ZA 1KONA 4P9UA 3DWLE 1V55H 2V7FA 3DBLB 5CVVA 1ZELA 4P5OA 1ZRFA 3AG1H 3CCJI 3BZKA 5DM7F 5E3OA 1ODDA 4RGSA 4BQNA 5GPCA 3I5UA 5FGMA 3EUHA 2FUG2 3CLOA 5M3MJ 4XKBA 3CF2A 4PJMA 3HRUA 4RAFA 1K83J 4A3EJ 3HTSB 2M1BA 1R36A 2JPCA 1IRZA 2KQRA 2XUBA 3CC7I 3RTRA 4ZJZA 4HF0A 4H0EA 2MD0A 1YW9A 2EFOA 1AU7A 2EZHA 1JKPC 3F0CA 2R5YA 1WJEA 2ZXHA 1WWXA 2JMWA 2XGXA 1I6XA 2HDCA 3OWTA 4C2UA 2KDOA 3J80K 2MW8A 4G7ZF 4FCYA 1GXPA 2HVRA 3GTPJ 3ABTA 1T38A 1LVAA 3IRRA 3CC2I 4DYCA 4R79A 2WY7Q 4AVPA 3DCFA 3JR9A 1QHHD 2GWRA 2ID6A 3RKXA 4HLXA 5E3MA 1IGNA 3CMAI 2V6CA 3VODA 1MKMA 4WF2A 2M2EA 5FKNA 4MO7A 3SFZA 2P8TA 1QQIA 5K7ZA 3CCSI 1XDUA 4IEJA 3C1DA 1MZBA 2PMZA 3CCQI 2R5YB 1VNDA 3DFGA 2GXGA 3HIFA 2XROA 2FEZA 2Z2SB 4NHJA 1E2XA 2DA4A 2LVSA 3CDIA 1R5GA 2OPTA 2XF6A 1D5VA 3I53A 1MBFA 2IXSA 1R9TJ 4A69C 3G1LA 2YU9J 3N05A 1W0TA 1QPIA 5E8IA 3RJPA 3JCUC 2CJJA 3H3ZA 4DGWB 5KAFC 5JVTA 1HQCA 2DFEA 4UVAA 3PFIA 4EMSA 3WTTC 1VQ8I 2GXBA 3LQQA 2CGPA 1R00A 2EFNA 2FNPA 3RYPA 2KMUA 2M3AA 3ASOH 5B5EC 1MNDA 3P9KA 3ZMSA 3NWSA 2HR3A 1SANA 3DKWA 4I02A 4YIRX 3KYDB 2BEOA 3MVPA 1FOXA 3S93A 2DK8A 3IKTA 1UAAA 4JK1X 2K02A 3GMEA 4BU2A 3ZQHA 3HPGA 3IL2A 5ILVA 2Y2ZA 1SD5A 3EDPA 1TW3A 2TCTA 2IPQX 1XDSA 4D9JA 1EKEA 4UUVA 5FLMJ 3V42A 3GTQJ 1KQ8A 2GA1A 4BAYA 5L3EA 4ENKA 4XICA 2P6SA 4LG0A 5EF6A 1V3FA 3K69A 3A01A 3AFHA 1UHMA 4JOMA 3S1MJ 1Y1WJ 4ZC3A 3KZIC 2HKXA 4IJAA 2ZMEC 3BR0A 5EEGA 2K85A 2EIKH 1YW8A 2RNGA 1IF1A 5DEQA 5LLQA 4HLYA 3NAUA 2OBPA 2KHMA 5BPIA 2ZO4A 1R22A 2ADUA 2ZSIB 1FOYA 3V7CA 3QWLA 1SVLA 2NYXA 5HLIA 2VOPA 3QOPA 3L9FA 2KDZA 4IO9F 2BY3A 4JX6A 3C18A 4I09A 2HOSA 2RREA 3VOEA 3O6BB 2H1KA 5L3FA 3V8KA 1RC9A 1F4KA 1WJAA 1ZREA 1S3JA 4LG0B 3A01B 1H88C 4OWRB 2GXAA 3IAS2 3PFYA 2XB0X 5IOZA 4JX5A 1IUFA 1O3RA 2O61A 5IP9J 2Y30A 3OYIA 2Z1DA 3WHBA 3GFLA 3I3LA 4MNUA 3WU0A 3HKZN 4A0YA 3BDDA 4WXCA 4E6KG 4F91B 3BY6A 4RGRA 1X19A 3OOUA 4RMNA 3I0TA 1LDDA 5FFZA 3K2AA 2M7BA 1CGPA 2LKPA 3K1PA 3HL2A 1T8IA 4KIBA 2NVQJ 2JPBA 1DQUA 2VXZA 4KICA 2IA1A 5CVRA 2ZFUA 1YRNA 1GXQA 1Z67A 3JREA 1TQIA 2Y75A 5C3EJ 4GGGA 2EIMH 2P7CB 1QZEA 4FASD 3Q3SA 2R4GA 4LMYA 3OSGA 3V7SA 2DU9A 4FTHA 2K3PA 2K40A 1GHCA 2JRMA 2UV1A 1DDNA 3L1PA 4OINF 3GBGA 2LP0A 3BLYA 2E2IJ 1KU2A 4FX0A 2VL8A 3ASNH 2EBIA 4E7LA 3B6AA 2BXZA 4L9VA 1A36A 1XTAA 4BXUA 4IZZA 3M8FA 4AIHA 3F3XA 4QIWN 1E3PA 5F1RA 3RQIA 1APLC 3U1DA 3ZPLA 4CCMA 2KZVA 1Y1VJ 5KNLA 1HSJA 1XG1A 1YRNB 2M7AA 5FO5A 2L5QA 3KLNA 2BXYA 4ENMA 1T6SA 1FJLA 1X4PA 5CVJA 4G12A 4MEYF 2ZNZA 2Y48A 2VKVA 2JA7J 4IRGA 5IYDJ 1OMIA 5DM6F 2R92J 4BGDA 3FHZA 3CP2A 2R7VA 4IX7A 2ZC2A 1H89C 4MLOA 4Z6YA 2HTJA 1TTYA 2CW7A 1YHQI 3BQZA 2FOWA 2DI3A 3CCLI 2LF7A 4MQVA 3OYAA 3I55I 1I6HJ 2JA2A 2VJIA 4WXHA 2W00A 2A6EF 3KIOA 5GAEJ 2A61A 4EJWA 1K4SA 5EG0A 1E17A 2QQBA 1RRJA 1IUYA 4CCJA 1MH3A 3BG3A 3SQNA 3SZGA 3DTKA 3ZQ7A 3J81Z 4BACA 5HS9A 1G2HA 3RKQA 2NRAC 4D5CA 3A0HC 3UKGA 2HEOA 3R6SA 3EUKL 4E7IA 1JGSA 1XD7A 2O5RA 1H8AC 2W1OA 4UVBA 4KITB 2P81A 2LYCA 3W2VA 3TO6A 3JRBA 2Y0SN 2VC1A 3HEFA 1ETVA 2VASA 1G3TA 4Q4ZF 4HZFA 1IN4A 3RKYA 2IBDA 1R58A 2PI0A 1XCVA 2H8WA 2P4WA 5JLWA 1JHFA 5ILSA 1MSFC 2HS5A 1MMAA 3I4NJ 3J7AY 3H5AA 5EG0B 5HVQC 4HNTA 5CVIA 1U5TA 4HX4A 5FLXZ 3WGIA 1OKRA 1ITYA 4LJZF 1BN5A 3E5UA 2OUMA 1ETYA 2P0WA 3HOSA 2QVOA 2G0EA 4L0ZB 3GVAA 5CJ9A 3L2QA 1BR2A 2XAHA 4CYCA 3RPUD 1R4MB 3GFIA 4RLFA 1XGSA 3FM5A 2X6OA 2Y31A 3TOBA 2CQQA 3IH2A 5GADJ 1EV7A 3QOEA 1LNWA 1K78A 2IGKA 3ABUA 1R6RA 4XLNF 2AHQA 2QBYA 5J4YA 3K10A 4ITVA 2HI3A 3RIRA 5B66C 4II3A 2A5WA 4FT8A 1X1BA 2VN2A 1LFPA 4M6XA 2H6BA 4LIUA 3ESWB 3IUOA 4X1EA 2QUFA 3TO7A 1OQYA 2E1MB 4C30A 4A3IJ 5ILUA 1U5TB 3BZCA 3VYUB 2XF7A 5D4SA 2L2OA 3LSRA 1PDNC 1P7IA 1TT0A 4BEHA 1VQPI 4M3GA 1OCRH 1HDDC 3EPZA 4MFDA 2FNAA 3VPRA 4J19A 1FWZA 4B1RA 4DOZA 4IVNA 4PFPA 1LJ9A 3CMYA 2K7LA 4CYCB 1X3UA 2A68F 2MBFA 2NS7A 2UZKA 2K9MA 3K2ZA 5FKLA 2ZKZA 1K78B 1ZTRA 2R7ZJ 1KYWA 3GO5A 3FXQA 2QBYB 1P7JA 2L4MA 3CJTB 4KFCA 1S6LA 4S04A 4YRVA 2H94A 3FK7A 3U9GA 1S72I 2BHYA 2JWTA 5L3BA 2RKHA 1TWGJ 2Y69H 3C3WA 2M30A 2V9PA 5E3LA 4LK0F 1H9GA 3TP3A 3K4JA 2OQGA 1BI3A 5LFAA 1BI0A 1OPCA 2K3FA 3EQLF 3PQKA 4UVCA 3HYIA 1WPKA 1ON1A 2Z33A 4PJJA 1IO2A 2O6GE 4ESJA 4BEHB 5LD2C 2MGQA 2XAUA 2NVXJ 1XSVA 5FLVA 3ZQGA 3S2WA 4IHWA 3HC7A 4RLQA 2Y0MA 1I5ZA 4IRHA 3H35A 2UUZA 1P9QC 1UFMA 3O8GA 3I64A 1KA8A 5J1RA 1N75A 4BJ5C 2OCCH 3D0SA 4CZZA 2HXIA 2CSOA 4ZYEA 3E1SA 2H6CA 3OYBA 1GLNA 1L3LA 1QGPA 3GLXA 2GOMA 2DOEA 3RPQA 2ECCA 5E20A 4MHGA 3PIPF 3G73A 4BS9A 3R0AA 2ME0A 1BW6A 5TJJA 2YUSA 2RNJA 2EFPA 4CXFA 4IHYA 3W6JB 4ZDOA 4CDGA 1U6GA 2FF4A 4G94A 1QBJA 2VBZA 4XRSA 2R7OA 1STZA 1WKMA 4KIFA 4YG2F 2JSCA 2OZUA 1RKTA 4CICA 1MNMC 1EH6A 1JHHA 2E19A 2HQNA 4B3AA 2NS8A 4B43A 5CYVA 3FXLA 2M8GX 4BXFA 1HSTA 1YO5C 4E4HA 1WI3A 3HBLA 3J81K 1WZ2A 3JRGA 3OYCA 1X1DA 2LRDA 1KU7A 4WWCA 4B47A 5E1ZB 1O3TA 2V26A 4AM3A 5HDGA 5HNHA 3GF2A 3J7YJ 1RR7A 1ZYRF 5K5QA 3ISPA 3EYIA 1YJ9I 1YE9A 4II2A 4Q48A 5C4JJ 5D8KB 2GZWA 3K7AJ 4A3DJ 1G3SA 1S7OA 2ESHA 3OYNA 3S2DJ 2DW4A 1MJBA 3LSKA 1YX5A 5LGNA 2LKXA 1HC8A 2NVYJ 3IV5A 1N78A 5FLXK 1QRYA 3G1MA 1FYLA 2O7OA 2ETHA 3ABMH 3O2PE 4XM3A 5BQTA 4XMYA 1JJ6C 4WK8F 2JQ7A 2Y9ZA 5L3CA 2CRGA 4ZZLA 1U8RA 3MKWB 3ZMDA 4P9FA 1BI1A 1VQ7I 4RAZA 2Q2EA 1YJNI 3QPHA 2W25A 4HBLA 3PQJA 3W2WA 2P6TA 2KISA 3FBIB 5EZHA 3QQAA 3S2HJ 1MW7A 1VQOI 4Y33A 1B72A 4RBOA 2CS3A 2DYRH 1LFBA 4KN7X 1HCRA 1MDMA 2E71A 1J59A 2WADA 3FKIJ 4LGWA 2JRTA 1T56A 3L2VA 1FT9A 3S16J 3GEZA 2QYOA 5EDNA 4ZTFA 1DU6A 1TZLA 2R0QC 3HOXJ 3GW2A 3I9V2 4A3MJ 3ZQIA 5FD5A 3BG5A 4DYQA 1LVKA 2G7HA 3FK6A 2Q2EB 2X4HA 4BY7J 1OFCX 2DMNA 1TWFJ 1M1EB 4F92B 4ZTJA 2IGMA 3G3ZA 1UJ8A 1T95A 1B72B 1IC8A 1PUFA 2B0LA 2FRHA 2EZLA 2VKHA 3KYCB 3BCAA 1WI9A 2HU9A 2DAOA 1MDMB 3E3VA 1XMAA 3BR1A 1QVUA 1KZHA 5FROA 2M4KA 2Y9YA 2FMYA 2ELHA 1WJCA 3G1OA 1GV5A 5M5WJ 1WJDA 5FRNA 3WTZA 2QGUA 3DTEA 3ZMZA 2VLAA 2HOTA 4L9TA 1JUPA 4M9XA 2NVTJ 3CCEI 1BI2A 2VQCA 2EV6A 3L2CA 2STTA 2EPFA 3HPHA 2MD5A 3WGHA 2V6EA 2LBFA 2VBYA 4BQQA 1GDTA 2PBIA 4XLEA 2JT1A 3HOWJ 2HYFA 1MBEA 2FBKA 3OY9A 2E1MC 4UXNA 1QHGA 2JVHA 2RC4A 5A2QZ 1U5TC 2IP2A 2RQPA 1PUFB 1NG6A 2CW0F 3E5XA 2DTRA 1LDJA 1JKQC 1Z6RA 2RV8A 4XKWA 3HM5A 1R1UA 1ERDA 3GZ5A 3N4MA 4HOBA 1OCTC 2H1LA 4E7SA 3SZTA 3KE2A 5BOXA 1S7AA 3FDYA 3LAPA 3OR2C 2E1OA 2BZTA 1FTTA 4N9HA 3CO7C 1SAUA 2X1CA 1YTYA 4QPOA 2FA5A 3I58A 1TW2A 2LBFB 3FBNB 1BL0A 3Q0VA 1IG7A 1R7JA 1R5HA 2F48A 1IRXA 3DLAA 3DU5A 1U9NA 2WB1N 1Y0UA 5DD4A 2GA2A 2XAFA 3LA2A 1XSDA 1EJ9A 1ON2A 2B63J 4V19K 2RAEA 4M3FA 3LQRA 2KFDA 2KIQA 1F36A 4EJUA 4FE7A 5F64A 1RR8C 2MG4A 3FXUA 2E5NA 2ZFWA 3MKLA 4C3JJ 4RB1A 1IN8A 1V4RA 1F43A 2V1NA 1P2FA 2YX4A 1Z05A 2M0CA 4OMYA 2EA2A 2K9LA 1ETQA 2K9SA 3FF5A 1XGMA 2L7KA 2LC2A 5FKMA 5TRDA 5H20A 1G6NA 4E70A 4UV8A 3GX4X 2L7ZA 1WJ5A 2DDAA 1YW7A 4M72A 4V2FA 1UHWA 1T2KA 4JX4A 4JP0A 3OYEA 3ERED 5E1XA 5M3FJ 2HGCA 3BR3A 1OCZH 3GZNB 4EVIA 1Y56A 1YYVA 5EYRA 2H09A 3OSFA 2AQFA 3B73A 4FHTA 4HEA2 1I1SA 2EV0A 3BG9A 3FHNA 3LL7A 2V4JC 2Z3YA 2RGVA 4BNCA 5TGTA 2R7TA 5JHUA 3U2RA 3H0DA 1J2XA 2FBHA 2MC4A 3F6OA 1K6YA 4CYDA 3BT9A 3V7RA 4L5JA 2D45A 3FISA 3RCOA 3ZGKA 5GTIC 1VQ5I 3T5XA 3PNYA 2CQNA 5E1WA 5H6RA 2Z5UA 5JFRA 4A3GJ 1F5TA 1RUNA 2ZCWA 1ZRDA 1BJAA 2WC2A 2XAGA 1PP7U 2JUGA 3NQOA 3VWBA 2KZGA 3JSOA 2P5KA 2LF8A 2QA4I 3G4SI 2XAQA 2X1DA 3WE3A 5DS9A 5IP6A 1XS9A 4A3FJ 2W82A 2G9WA 2O03A 3TGNA 2XRLA 2EK5A 2KPMA 1D3YA 4HX8A 4YFKF 1DUXC 1S7EA 4I2OA 3FKJA 2DLLA 4KIGA 3BWGA 3RZOJ 2HQ5A 1TL8A 4XNFA 2X0LA 3IRQA 5E18F 3RQ4A 1YS7A 3WODF 1ZGAA 4CGZA 2ZXIA 4NC6A 4ENJA 4HF2A 5HDKA 3S8PA 2JK3A 2EIJH 2F5FA 1IRFA 2E7WA 3NARA 5H6QA 2H27A 2FXAA 4Y17A 5E17F 3DPUA 3SEZA 2EZIA 3CJNA 2LK2A 2GIZA 1LEAA 1R23A 3K70C 3AL0B 1K7AA 2JTVA 2XB5A 1W5TA 2OU2A 2ESNA 4IKFA 2QSHX 5DV5A 3HDDA 4CCOA 5LRRA 3OR1C 6PAXA 3PSIA 4D7MA 1SVMA 1T0FA 4EM0B 4C3HJ 2HVQA 1UELB 1V5FA 2DA1A 4O3MA 4IXAA 4HRIA 1B4AA 1GVJA 3HHHA 3ZQCA 2AQEA 3CCUI 3KLOA 1OYIA 5FD6A 3KX2A 1WSUA 3BTCA 3FM3A 4W1UA 2IS4A 2W48A 4EJOA 2CWEA 2ELKA 3QP6A 3L00A 5JHFA 3OS1A 3O3KA 2CUEA 4XIDA 5A2QK 1D0YA 3IP4B 1HW5A 3Q9SA 2HVSA 2ISZA 5IT3A 1NH3A 1G4DA 3WTYC 1ETXA 2DFIA 3RYRA 2P7VB 4IHVA 4PJNA 1ZG1A 1JKRC 4L0YB 1X2MA 4PJ0C 2IJLA 1OJLA 4XLHA 3HJEA 1QVTA 2COBA 2R3SA 2VKEA 3K6GA 1U2WA 3B02A 4N4OB 4NC8A 1I50J 4JBAA 4BY1J 2X85A 4I76A 3TOAA 2F4OB 3ZQQA 4M3DA 3F22A 2ZJRF 3SYTA 5JVGF 4HA8A 4BHBA 3S3MA 5D4RA 5AONA 2HYJA 1O7FA 2RDPA 1ACIA 4M73A 3S1QJ 3VYSB 4N4NB 3CCRI 1JTYA 2YX7A 3ZMVA 2BBYA 1DGRM 3CLQA 4A3LJ 2EA4A 1I3QJ 2R7XA 2DO7A 2COMA 4N0BA 2O8KA 5B1BH 4OIOF 1ENHA 1R4NB 4AYBA 4DNCA 5F1JA 2W4SA 1RZ4A 3HRMA 2EFQA 4RB2C 1R49A 1FYMA 2JA8J 1W5SA 3Q9VA 3KP7A 2I8DA 4A3BJ 3E6BA 4PSWA 2CV0A 4JQFA 1J75A 3COAC 4DW6A 3LSIA 4UNOA 3DKYA 1ZQ3P 4NBQA 1QU3A 5D6FA 4P1WA 4HG2A 4RB3C 3E6MA 2D2WA 4OU0A 2UWMA 1OCPA 4EV0A 2IT0A 2PEXA 4LG3A 1W36C 2DT7B 1G59A 2CUFA 3OS2A 3FMQA 3QAHA 3E6CC 2XPWA 3GXOA 1YLFA 1UG2A 4ZYHA 2X6XA 4D0PA 1BOAA 4MEXF 4B09A 3HRSA 3FXOA 1QA6A 4M71A 1J9IA 1X2NA 5CKTA 3IH4A 2W7NA 2DQRA 4O6JA 4FX4A 1GT0C 1HOMA 1WJBA 1I1GA 4LOCA 2DA6A 2IVMA 2L4AA 3EUHC 2DMPA 3CP8A 4NUBA 2EWNA 4EATA 3VDXA 2IRFG 1Q1VA 3CCVI 2E34A 2ME6A 2NOJB 1EF4A 2VI6A 1WCMJ 4IQJA 1K79A 1J09A 2UXXA 4ZDPA 1MBKA 4HV6A 1A35A 4YELA 2QQ8A 3I54A 1MMGA 2JA6J 1B1BA 2OCEA 3GFJA 3K70D 1SFUA 4CCLA 2MH9A 5E8GA 3Q5FA 3M3YJ 1YQAA 2XGCA 1NTCA 3Q0UA 4XRSG 3ABLH 4HQEA 5L3DA 2Z9OA 3GTKJ 2WAQA 3KCCA 1FPQA 3JRHA 3JTGA 4EGZA 4S0HB 1IXCA 3HGYA 2DOAA 3ZXSA 1N25A 4FETA 5IY5H 1FMVA 2L01A 4XKVA 3WTVC 5B3SH 1ZH5A 1V54H 2LOOA 4AVZA 1ETKA 1MJAA 5HLGA 4U0WA 3FXMA 4PZJA 2R7UA 3CC4I 5IYCJ 4G7OF 4IRIA 3BTIA 5GAGJ 2K9QA 1BC7C 1UMQA 1VZ0A 2KRFA 3WG7H 4DBRA 4XL9A 3LWFA 1WH7A 3KPHA 1LUJB 1TT5B 1BIBA 3JRFA 4Q47A 2XSJC 4EQQA 2PMZN 5F0CA 2DT5A 4BKXA 2VUMJ 1G3YA 5ERIA 2ZJPF 3ZQLA 2PMHA 3DEEA 1HKTA 4BE0A 3AG3H 5CVUA 4QPQA 1JGGA 3DEWA 4BXXJ 1A5JA 4LB5A 4KN4X 3LMMA 2VE9A 1Z7UA 1Z9CA 4CUGA 2R7WA 4D1QA 5J1UA 2DFFA 1U9OA 1TP4A 1BR4A 4IL6C 2XDVA 2Z99A 3ZCOA 1D0XA 4XKCA 2NNYA 2ZB9A 3OYKA 2A6TA 2W84A 4DYRA 5LGUA 4J01A 1HKSA 5C4XJ 2K27A 3BR2A 4BE2A 1D1CA 3MEXA 2HKOA 1VTNC 5LRSA 4LLGF 3MN2A 4A5NA 3HOTA 1MGTA 4MGRA 3QYFA 3K4CA 2QQ9A 3GLLA 2O0YA 3OMYA 5TISC 3BROA 4MQ9F 1D8JA 1MJ9A 3ECOA 2CYYA 4GFBA 3SEQA 4QLCU 4QSHA 3GTMJ 4ASNA 3GTJJ 2CMPA 3DBHB 3FWEA 1W0UA 4RM2A 1ZRCA 3KP5A 5BS6A 5K5OA 3PJRA 1S5LC 3F6VA 3K4KA 3MMYB 3ZP5A 2HDWA 2OAZA 2HFHA 2KIFA 2A3SA 3L2RA 5L3GA 4IOAF 2OTJI 4ETSA 3VEPA 4U0YA 2DYSH 5CQGA 4RM3A 1RNLA 3QU6A 2DTZA 2BW3A 1VF9A 2WAEA 1MBJA 2M0MA 3C2BA 2K4BA 3FZVA 4HX7A 5FKOA 2FJ1A 5ED4A 2ACJA 3S3NA 4GDFA 2XPUA 3P9CA 4B4CA 4IF4A 4A93J 4K2EA 3WHCA 3KFWX 1D1AA 4XN0A 1XC5A 2XSDC 3LSJA 2XHKA 1MD0A 4GYIA 1W36D 2TDXA 1XGOA 2W85A 2M34A 3KYLA 1Y0NA 4I01A 3WTUC 2GLOA 2L9VA 3EYYA 1YOVB 2DMUA 1A6QA 3DQVC 4F55A 1ZLKA 4KT6A 2Z16A 4MTEA 2BW3B 1WH5A 2AS5F 1IN5A 2FE3A 3JTHA 3TBIA 2F5DA 1T0FC 4XOPA 1ZR2A 2XRNA 2JSPA 1TWHJ 3WTSC 3GYHX 3KEYA 1G8XA 4AIJA 5D8LB 2XPVA 4V2GA 2E1CA 2FD5A 5D5WB 3OL4A 1B59A 2CG4A 4Y3OA 5FFXA 1W5CC 1TNSA 3ELKA 3DU6A 5DUKA 2G7UA 2HNHA 2L54A 1VQNI 4E7ZA 3BQYA 3LFUA 3I59A 2BHZA 4KJZA 1USSA 3HGGA 4C3IJ 5C44J 2BY1A 2GBYA 3J7ZI 1PP8F 1KQ0A 4KDPA 4U0VA 5E79C 2O3FA 2UXNA 5KVRA 3L7WA 4YIFA 2BE5F 1UCRA 2XIGA 1ZKGA 1T33A 1EA3A 2F4IA 3CDHA 4DJAA 2QZ8A 3M8JA 1IRGA 1SMYF 2VJ4A 3EUAA 3D5LA 4RGUA 5AIPA 3AAFA 2QSGX
chains in the Genus database with same CATH topology
1FIPA 3TW6A 2H1KA 2JJ7A 2N8GA 1BL0A 5F0HA 1GV2A 3Q0VA 1IG7A 3A01B 4DZJA 4W97A 2L7FP 3JRDA 1H88C 1TWCJ 1RETA 5EEAA 4MFEA 4C2MJ 1U9NA 2WB1N 3PO3J 2XB0X 5IOZA 3HOUJ 4JX5A 4IHXA 2B63J 1IUFA 2RAEA 4M3FA 5IP9J 1RPWA 3H0GJ 1F36A 2Y30A 3WHBA 4FE7A 2MG4A 2FX0A 3HKZN 3MKLA 4C3JJ 3S15J 1F43A 1TC3C 4AYBN 3OOUA 2M0CA 3S1RJ 1LFUP 3E7LA 2DA2A 3K2AA 2JN6A 1ETQA 2K9SA 2NVQJ 4UUSB 3HOVJ 1YRNA 5FKMA 3M4OJ 3JREA 2L7ZA 5C3EJ 2OF7A 1AHDP 3IH3A 4X6AJ 4V2FA 4JX4A 2TRTA 9ANTA 1RESA 4JP0A 3LNQA 3Q3SA 3OSGA 2XGDA 2E2HJ 5M3FJ 4BBSJ 4FTHA 2K40A 3BR3A 4MIMA 3BR5A 1GVDA 5EYRA 3L1PA 3GBGA 3OSFA 2EH3A 2R5ZA 1IDZA 2LP0A 2E2IJ 3BG9A 5GP9A 2EBIA 3B6AA 3A02A 2L0KA 2LLKA 5DTDA 4QIWN 3RQIA 1APLC 1HDPA 1D5YA 1Y1VJ 3BT9A 1XG1A 3FISA 4ABZA 3TP0A 1YRNB 4A3GJ 2IEKA 4UUTA 5F0FA 1FJLA 2L7MP 1SFOJ 1VI0A 4G12A 1MBHA 3TEDA 2VKVA 2JA7J 3LSPA 5IYDJ 1B8IA 3HOYJ 2R92J 2LTPA 5DS9A 5IP6A 2IAIA 2R5ZB 1XS9A 1ETOA 4A3FJ 1H89C 4MLOA 2XRLA 2X48A 4XK4A 1S7EA 3BQZA 3JRCA 2WAQN 2MSYA 4BBRJ 1JT0A 2DA3A 3RZOJ 2HQ5A 3O8HA 1Z77A 5IYBJ 1JT6A 3OIOA 1I6HJ 1ZK8A 5F27A 2JK3A 3NARA 5FKKA 5K7HA 5EG0A 2EZIA 2LK2A 1MH3A 3BG3A 2DMTA 2EZKA 2DJNA 2XB5A 1G2HA 1JTXA 3RKQA 1B8IB 3HDDA 4L5EA 4D5CA 3UKGA 4I6ZA 2X9DA 4D7MA 1UHSA 1H8AC 4C3HJ 3D1NI 2P81A 4HNVA 2DA1A 1FTZA 2HXOA 1WGXA 3GTLJ 3ZQCA 2ID3A 2Y0SN 3CCYA 2HOAA 3FIWA 3JRBA 1GUUA 1ETVA 1TWAJ 3HEFA 1DU0A 1HF0A 3BTCA 3H3VK 2IBDA 4W1UA 2W48A 1JUSA 5JLWA 2ELKA 3BR6A 1MSFC 3I4NJ 2CUEA 4XIDA 5EG0B 2NOGA 4RDUA 2CQXA 4Y52J 4XRMA 1ETWA 1E3OC 1MH4A 1ETXA 1ITYA 3LSGA 4IHVA 1ZGWA 1ETYA 1JKRC 2DMQA 2G0EA 3A03A 1X2MA 2QCOA 4CYCA 1OJLA 5IOYA 1QVTA 2COBA 5EGOA 3Q0WA 2VKEA 2X6OA 3PM1A 2Y31A 2VPRA 2CQQA 3IH2A 1I50J 3QPSA 2LD5A 2AHQA 2EQRA 4BY1J 2HI3A 1POGA 1IDYA 3CQZJ 1IV6A 2E2JJ 4I76A 4M3DA 1VFCA 1U78A 4X1EA 2HYJA 3HOZJ 3CDLA 1JUMA 4A3IJ 3S1QJ 5IPAA 1JTYA 3LSRA 1RKWA 1P7IA 1HDDC 4M3GA 3ZQFA 4A3LJ 4MFDA 3VPRA 4J19A 1I3QJ 4B1RA 3CMYA 4CYCB 2O8KA 2AO9A 2NS7A 5BNGA 5E3NA 5EGOB 1ENHA 1MSEC 5F1JA 5FKLA 1ZTRA 2JA8J 2R7ZJ 5F04A 2GM4A 1P7JA 4A3BJ 3FK7A 2LY9A 2JWTA 1TWGJ 2D5VA 1U8BA 5E3LA 3BTJA 3TP3A 4DW6A 3S1NJ 3PO2J 1ZQ3P 3RZDJ 1JJ8C 1WPKA 3SDGA 2ECBA 1OCPA 1O4XA 2MGQA 3TW7A 2NVXJ 3LOCA 2CUFA 2O9LA 5FLVA 3ZQGA 2XPWA 4D7NA 1K61A 4IHWA 4M3BA 1UG2A 4FE4A 3S17J 1A6IA 2R93J 1X2NA 3IH4A 2K9NA 1GT0C 3O8GA 1BJZA 1HOMA 1X58A 4LOCA 5J1RA 2DA6A 2KT0A 3W6VA 4A3CJ 2DMPA 3JRIA 1Q1VA 2ME6A 2HXIA 1EF4A 2VI6A 4DZPA 1WCMJ 2YS9A 1ORKA 3S14J 1MBKA 2DA5A 2JA6J 2WV1A 1MBGA 1BW5A 2ECCA 4NDLA 2ME0A 1BW6A 2YUSA 1CQTA 3M3YJ 4IHYA 4A3JJ 2XGCA 1NTCA 3Q0UA 4XRSG 4XRSA 3GTKJ 5IP7J 3JRHA 5M5YJ 4S0HB 3HGYA 5E3OA 1RKTA 2M9HA 5GPCA 3I4MJ 1ETKA 1MNMC 2E19A 4B3AA 2NS8A 5M3MJ 5GPAA 4AUXA 5IYCJ 2M8GX 1K83J 4A3EJ 3BTIA 1WI3A 3HBLA 2K9QA 1IRZA 5M5XJ 3JRGA 1UMQA 3BTLA 4QTRA 1WH7A 3JRFA 2PMZN 5F0CA 1AU7A 2EZHA 1JKPC 3F0CA 4BKXA 2R5YA 2VUMJ 1RR7A 2JMWA 3ZQLA 5K7FA 3B6CA 1JGGA 3DEWA 4BXXJ 2FQ4A 1A5JA 2DA7A 1AKHA 2MW8A 1LE8A 5C4JJ 4FCYA 3K7AJ 4A3DJ 3GTPJ 4JYKA 5J1UA 4M6VA 1U9OA 2CU7A 2LR8A 5EZGA 3S2DJ 1HLVA 3QPLA 2XGEA 4FISA 4DYCA 3DCFA 3JR9A 2ID6A 2ZB9A 2LKXA 4DYRA 2NVYJ 3IV5A 1ZR4A 5E3MA 1IGNA 5C4XJ 1QRYA 3G1MA 4AC0A 3BR2A 2O7OA 3SJMA 5JLXA 2M2EA 2I10A 2L9RA 5FKNA 1JJ6C 3MN2A 1FIAA 4MO7A 2Y9ZA 2CRGA 5K7ZA 4IEJA 2H8RA 4GFBA 4QSHA 3GTMJ 3HB9A 4Y7NJ 3GTJJ 2R5YB 1VNDA 1W0UA 3ZOBA 3JRAA 2DA4A 1NK2P 2LVSA 5EZHA 3QQAA 3S2HJ 1AKHB 1LE8B 2OPTA 5F08A 1B72A 4RBOA 1MBFA 4A3KJ 3GTOJ 3GTGJ 1LFBA 1R9TJ 4A69C 3G1LA 2LFBA 2YU9J 1HCRA 2DTZA 1W0TA 1QPIA 1VF9A 1MBJA 3FKIJ 1Z0XA 2CJJA 4D5FA 5FKOA 3C2BA 2FJ1A 1T56A 3S16J 2XPUA 5EDNA 4M3EA 4B4CA 1DU6A 5HODA 2R0QC 4A93J 3WHCA 3HOXJ 2QF7A 4A3MJ 3ZQIA 1XC5A 2XSDC 3LSJA 3BG5A 4DYQA 1JKOC 3FK6A 4BY7J 1OFCX 2DMNA 1SANA 2M34A 1TWFJ 5J3LA 3SFIA 2GLOA 5FJ8J 1B72B 1BA5A 1IC8A 1PUFA 2DMUA 2EZLA 3MVPA 2JA5J 3BR1A 1WH5A 1QVUA 1NK3P 2HDDA 3ZQHA 2Y9YA 1ZR2A 3G1OA 1TWHJ 2Y2ZA 1GV5A 5M5WJ 1FEXA 2TCTA 2XPVA 4V2GA 2HOTA 1JUPA 2NVTJ 3GTQJ 2FD5A 1IJWC 5FLMJ 1GDTA 4XICA 5EF6A 3A01A 3HOWJ 1MBEA 3S1MJ 5J1YA 3BQYA 1Y1WJ 3HGGA 4C3IJ 3BR0A 5C44J 1PUFB 2GBYA 1JKQC 2DN0A 3HM5A 3NAUA 1ZKGA 1T33A 1OCTC 2KDZA 2E1OA 1FTTA 4EEFG 4UUSA 4JX6A 2HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIP A;  3TW6 A;  2H1K A;  2JJ7 A;  2N8G A;  1BL0 A;  5F0H A;  1GV2 A;  3Q0V A;  1IG7 A;  3A01 B;  4DZJ A;  4W97 A;  2L7F P;  3JRD A;  1H88 C;  1TWC J;  1RET A;  5EEA A;  4MFE A;  4C2M J;  1U9N A;  2WB1 N;  3PO3 J;  2XB0 X;  5IOZ A;  3HOU J;  4JX5 A;  4IHX A;  2B63 J;  1IUF A;  2RAE A;  4M3F A;  5IP9 J;  1RPW A;  3H0G J;  1F36 A;  2Y30 A;  3WHB A;  4FE7 A;  2MG4 A;  2FX0 A;  3HKZ N;  3MKL A;  4C3J J;  3S15 J;  1F43 A;  1TC3 C;  4AYB N;  3OOU A;  2M0C A;  3S1R J;  1LFU P;  3E7L A;  2DA2 A;  3K2A A;  2JN6 A;  1ETQ A;  2K9S A;  2NVQ J;  4UUS B;  3HOV J;  1YRN A;  5FKM A;  3M4O J;  3JRE A;  2L7Z A;  5C3E J;  2OF7 A;  1AHD P;  3IH3 A;  4X6A J;  4V2F A;  4JX4 A;  2TRT A;  9ANT A;  1RES A;  4JP0 A;  3LNQ A;  3Q3S A;  3OSG A;  2XGD A;  2E2H J;  5M3F J;  4BBS J;  4FTH A;  2K40 A;  3BR3 A;  4MIM A;  3BR5 A;  1GVD A;  5EYR A;  3L1P A;  3GBG A;  3OSF A;  2EH3 A;  2R5Z A;  1IDZ A;  2LP0 A;  2E2I J;  3BG9 A;  5GP9 A;  2EBI A;  3B6A A;  3A02 A;  2L0K A;  2LLK A;  5DTD A;  4QIW N;  3RQI A;  1APL C;  1HDP A;  1D5Y A;  1Y1V J;  3BT9 A;  1XG1 A;  3FIS A;  4ABZ A;  3TP0 A;  1YRN B;  4A3G J;  2IEK A;  4UUT A;  5F0F A;  1FJL A;  2L7M P;  1SFO J;  1VI0 A;  4G12 A;  1MBH A;  3TED A;  2VKV A;  2JA7 J;  3LSP A;  5IYD J;  1B8I A;  3HOY J;  2R92 J;  2LTP A;  5DS9 A;  5IP6 A;  2IAI A;  2R5Z B;  1XS9 A;  1ETO A;  4A3F J;  1H89 C;  4MLO A;  2XRL A;  2X48 A;  4XK4 A;  1S7E A;  3BQZ A;  3JRC A;  2WAQ N;  2MSY A;  4BBR J;  1JT0 A;  2DA3 A;  3RZO J;  2HQ5 A;  3O8H A;  1Z77 A;  5IYB J;  1JT6 A;  3OIO A;  1I6H J;  1ZK8 A;  5F27 A;  2JK3 A;  3NAR A;  5FKK A;  5K7H A;  5EG0 A;  2EZI A;  2LK2 A;  1MH3 A;  3BG3 A;  2DMT A;  2EZK A;  2DJN A;  2XB5 A;  1G2H A;  1JTX A;  3RKQ A;  1B8I B;  3HDD A;  4L5E A;  4D5C A;  3UKG A;  4I6Z A;  2X9D A;  4D7M A;  1UHS A;  1H8A C;  4C3H J;  3D1N I;  2P81 A;  4HNV A;  2DA1 A;  1FTZ A;  2HXO A;  1WGX A;  3GTL J;  3ZQC A;  2ID3 A;  2Y0S N;  3CCY A;  2HOA A;  3FIW A;  3JRB A;  1GUU A;  1ETV A;  1TWA J;  3HEF A;  1DU0 A;  1HF0 A;  3BTC A;  3H3V K;  2IBD A;  4W1U A;  2W48 A;  1JUS A;  5JLW A;  2ELK A;  3BR6 A;  1MSF C;  3I4N J;  2CUE A;  4XID A;  5EG0 B;  2NOG A;  4RDU A;  2CQX A;  4Y52 J;  4XRM A;  1ETW A;  1E3O C;  1MH4 A;  1ETX A;  1ITY A;  3LSG A;  4IHV A;  1ZGW A;  1ETY A;  1JKR C;  2DMQ A;  2G0E A;  3A03 A;  1X2M A;  2QCO A;  4CYC A;  1OJL A;  5IOY A;  1QVT A;  2COB A;  5EGO A;  3Q0W A;  2VKE A;  2X6O A;  3PM1 A;  2Y31 A;  2VPR A;  2CQQ A;  3IH2 A;  1I50 J;  3QPS A;  2LD5 A;  2AHQ A;  2EQR A;  4BY1 J;  2HI3 A;  1POG A;  1IDY A;  3CQZ J;  1IV6 A;  2E2J J;  4I76 A;  4M3D A;  1VFC A;  1U78 A;  4X1E A;  2HYJ A;  3HOZ J;  3CDL A;  1JUM A;  4A3I J;  3S1Q J;  5IPA A;  1JTY A;  3LSR A;  1RKW A;  1P7I A;  1HDD C;  4M3G A;  3ZQF A;  4A3L J;  4MFD A;  3VPR A;  4J19 A;  1I3Q J;  4B1R A;  3CMY A;  4CYC B;  2O8K A;  2AO9 A;  2NS7 A;  5BNG A;  5E3N A;  5EGO B;  1ENH A;  1MSE C;  5F1J A;  5FKL A;  1ZTR A;  2JA8 J;  2R7Z J;  5F04 A;  2GM4 A;  1P7J A;  4A3B J;  3FK7 A;  2LY9 A;  2JWT A;  1TWG J;  2D5V A;  1U8B A;  5E3L A;  3BTJ A;  3TP3 A;  4DW6 A;  3S1N J;  3PO2 J;  1ZQ3 P;  3RZD J;  1JJ8 C;  1WPK A;  3SDG A;  2ECB A;  1OCP A;  1O4X A;  2MGQ A;  3TW7 A;  2NVX J;  3LOC A;  2CUF A;  2O9L A;  5FLV A;  3ZQG A;  2XPW A;  4D7N A;  1K61 A;  4IHW A;  4M3B A;  1UG2 A;  4FE4 A;  3S17 J;  1A6I A;  2R93 J;  1X2N A;  3IH4 A;  2K9N A;  1GT0 C;  3O8G A;  1BJZ A;  1HOM A;  1X58 A;  4LOC A;  5J1R A;  2DA6 A;  2KT0 A;  3W6V A;  4A3C J;  2DMP A;  3JRI A;  1Q1V A;  2ME6 A;  2HXI A;  1EF4 A;  2VI6 A;  4DZP A;  1WCM J;  2YS9 A;  1ORK A;  3S14 J;  1MBK A;  2DA5 A;  2JA6 J;  2WV1 A;  1MBG A;  1BW5 A;  2ECC A;  4NDL A;  2ME0 A;  1BW6 A;  2YUS A;  1CQT A;  3M3Y J;  4IHY A;  4A3J J;  2XGC A;  1NTC A;  3Q0U A;  4XRS G;  4XRS A;  3GTK J;  5IP7 J;  3JRH A;  5M5Y J;  4S0H B;  3HGY A;  5E3O A;  1RKT A;  2M9H A;  5GPC A;  3I4M J;  1ETK A;  1MNM C;  2E19 A;  4B3A A;  2NS8 A;  5M3M J;  5GPA A;  4AUX A;  5IYC J;  2M8G X;  1K83 J;  4A3E J;  3BTI A;  1WI3 A;  3HBL A;  2K9Q A;  1IRZ A;  5M5X J;  3JRG A;  1UMQ A;  3BTL A;  4QTR A;  1WH7 A;  3JRF A;  2PMZ N;  5F0C A;  1AU7 A;  2EZH A;  1JKP C;  3F0C A;  4BKX A;  2R5Y A;  2VUM J;  1RR7 A;  2JMW A;  3ZQL A;  5K7F A;  3B6C A;  1JGG A;  3DEW A;  4BXX J;  2FQ4 A;  1A5J A;  2DA7 A;  1AKH A;  2MW8 A;  1LE8 A;  5C4J J;  4FCY A;  3K7A J;  4A3D J;  3GTP J;  4JYK A;  5J1U A;  4M6V A;  1U9O A;  2CU7 A;  2LR8 A;  5EZG A;  3S2D J;  1HLV A;  3QPL A;  2XGE A;  4FIS A;  4DYC A;  3DCF A;  3JR9 A;  2ID6 A;  2ZB9 A;  2LKX A;  4DYR A;  2NVY J;  3IV5 A;  1ZR4 A;  5E3M A;  1IGN A;  5C4X J;  1QRY A;  3G1M A;  4AC0 A;  3BR2 A;  2O7O A;  3SJM A;  5JLX A;  2M2E A;  2I10 A;  2L9R A;  5FKN A;  1JJ6 C;  3MN2 A;  1FIA A;  4MO7 A;  2Y9Z A;  2CRG A;  5K7Z A;  4IEJ A;  2H8R A;  4GFB A;  4QSH A;  3GTM J;  3HB9 A;  4Y7N J;  3GTJ J;  2R5Y B;  1VND A;  1W0U A;  3ZOB A;  3JRA A;  2DA4 A;  1NK2 P;  2LVS A;  5EZH A;  3QQA A;  3S2H J;  1AKH B;  1LE8 B;  2OPT A;  5F08 A;  1B72 A;  4RBO A;  1MBF A;  4A3K J;  3GTO J;  3GTG J;  1LFB A;  1R9T J;  4A69 C;  3G1L A;  2LFB A;  2YU9 J;  1HCR A;  2DTZ A;  1W0T A;  1QPI A;  1VF9 A;  1MBJ A;  3FKI J;  1Z0X A;  2CJJ A;  4D5F A;  5FKO A;  3C2B A;  2FJ1 A;  1T56 A;  3S16 J;  2XPU A;  5EDN A;  4M3E A;  4B4C A;  1DU6 A;  5HOD A;  2R0Q C;  4A93 J;  3WHC A;  3HOX J;  2QF7 A;  4A3M J;  3ZQI A;  1XC5 A;  2XSD C;  3LSJ A;  3BG5 A;  4DYQ A;  1JKO C;  3FK6 A;  4BY7 J;  1OFC X;  2DMN A;  1SAN A;  2M34 A;  1TWF J;  5J3L A;  3SFI A;  2GLO A;  5FJ8 J;  1B72 B;  1BA5 A;  1IC8 A;  1PUF A;  2DMU A;  2EZL A;  3MVP A;  2JA5 J;  3BR1 A;  1WH5 A;  1QVU A;  1NK3 P;  2HDD A;  3ZQH A;  2Y9Y A;  1ZR2 A;  3G1O A;  1TWH J;  2Y2Z A;  1GV5 A;  5M5W J;  1FEX A;  2TCT A;  2XPV A;  4V2G A;  2HOT A;  1JUP A;  2NVT J;  3GTQ J;  2FD5 A;  1IJW C;  5FLM J;  1GDT A;  4XIC A;  5EF6 A;  3A01 A;  3HOW J;  1MBE A;  3S1M J;  5J1Y A;  3BQY A;  1Y1W J;  3HGG A;  4C3I J;  3BR0 A;  5C44 J;  1PUF B;  2GBY A;  1JKQ C;  2DN0 A;  3HM5 A;  3NAU A;  1ZKG A;  1T33 A;  1OCT C;  2KDZ A;  2E1O A;  1FTT A;  4EEF G;  4UUS A;  4JX6 A;  2HOS A; 
#chains in the Genus database with same CATH topology
 2DK5 A;  3SHF A;  3QP5 A;  3TW6 A;  2JJ7 A;  4PGH A;  2CH0 A;  4LK1 F;  2L9S A;  1GV2 A;  4DZJ A;  1BBY A;  2L7F P;  1TWC J;  1RET A;  1LEB A;  4MFE A;  1T08 B;  2BV6 A;  3I59 B;  1FOK A;  2DT6 A;  4LLN A;  3HOU J;  2ZME A;  4IHX A;  2STW A;  4BJT A;  1FNN A;  2DFH A;  4XBF A;  1X1A A;  1RPW A;  4NQW A;  3VSL A;  5K5R A;  2FX0 A;  3S15 J;  3BG6 A;  2PG4 A;  2EV5 A;  4Y4R A;  3H3U A;  2FML A;  4AYB N;  1ZHF A;  2CO5 A;  4BDY A;  3E7L A;  5DCF A;  2DA2 A;  5AIQ A;  2JN6 A;  3A4C A;  2ICW G;  5BMZ A;  1Z7L A;  3PL8 A;  3T8R A;  4B8X A;  1Y6I A;  3DLL F;  4L9N A;  2IS2 A;  3GFM A;  3HOV J;  3M4O J;  2XVC A;  2E7X A;  2OF7 A;  4X6A J;  2OJE D;  3RSN A;  2CV2 A;  4BUP A;  4OIR F;  3OYJ A;  3MKZ A;  3OV8 A;  4BBS J;  2ZME B;  4MIM A;  3D5R C;  3DEU A;  1HW2 A;  2VBX A;  1GVD A;  1QNT A;  1FSH A;  4NQW B;  2MFZ A;  4HQM A;  2P5L C;  2R5Z A;  3DBR B;  1HKQ A;  1JE8 A;  3HKZ A;  3KP2 A;  1SD4 A;  1CF7 A;  3A02 A;  5KK1 A;  4KNY A;  2K86 A;  1Z3Y A;  2BY0 A;  1HDP A;  4AID A;  4Z2Y A;  2OV7 A;  1XPX A;  2MAB A;  1D5Y A;  2HPI A;  1RIO H;  4ABZ A;  4IOC F;  4ZH4 F;  1W7P A;  3E6D A;  2NNN A;  4LD5 A;  2HOE A;  4XLC A;  1IAW A;  1QZY A;  1L0O C;  2YR2 A;  3KZY A;  4UUT A;  3IC7 A;  4PJL A;  1C0W A;  2KJC A;  3DXJ F;  2FSW A;  4HDV A;  2BYV E;  3K1M A;  3IHU A;  3AG2 H;  3LSP A;  2J5O A;  1B8I A;  1T98 A;  1TLH B;  3W3C A;  2LTP A;  2IAI A;  2R5Z B;  1ETO A;  4PUS A;  1OYW A;  2HYG D;  2KLO A;  4XLF A;  2X48 A;  3H9G A;  3R61 A;  4XK4 A;  1CF7 B;  1D8K A;  4BYY A;  2EJR A;  1SVO A;  1N77 A;  2WAQ N;  2MSY A;  2V79 A;  1IN7 A;  1JT0 A;  2IS1 A;  4I0A A;  4A5M A;  3KZZ A;  1Z77 A;  4NC7 A;  4ZZD A;  4F3Q A;  5IYB J;  4CHU A;  2XF5 A;  5CLS A;  5D5V B;  5F27 A;  1W7P B;  4CZC A;  2QEN A;  1ZG5 A;  5ICG A;  2W24 A;  3TQN A;  3JAM Z;  3F8F A;  3OYL A;  1YFH A;  5DCM A;  4XR6 A;  2EZK A;  4S05 A;  2CW8 A;  2FBI A;  1KYZ A;  1JTX A;  1B8I B;  3BG7 A;  4L5E A;  4LLL A;  2IW5 A;  1E3H A;  4R1H A;  2DQL A;  4I6Z A;  2M4G A;  1BIA A;  4R8H A;  4CA0 A;  1UHS A;  2VJJ A;  3RI4 A;  3FXJ A;  2HXO A;  2XAS A;  2XKO A;  2ID3 A;  3CCY A;  1GUU A;  1TWA J;  5B1A H;  2BGC A;  3V8L A;  4NNJ A;  2YSR A;  4EGY A;  3PUF A;  1JI8 A;  1JUS A;  2A05 A;  3BR6 A;  2QSF X;  3K9T A;  3G71 I;  1W1W E;  1OLT A;  2NOG A;  1HA8 A;  1FSE A;  2VQL A;  4WXD A;  5DCM B;  1E3O C;  1R71 A;  3CJR B;  3LSG A;  2FOK A;  3QOD A;  4YEJ A;  4A6D A;  3M1E A;  2HWV A;  2MC3 A;  3ZN1 A;  2DMQ A;  2QKL B;  2QCO A;  4YFX F;  3M9A A;  4UB6 C;  5KAI C;  2EFW A;  1Y8R B;  4EJT A;  3Q0W A;  3PM1 A;  4XOR A;  2VOD A;  2VPR A;  5CPR B;  3E0J B;  3D5S C;  3QPS A;  2LSO A;  2QEX I;  1P4A A;  2EQR A;  2Y0S A;  4YII A;  1POG A;  1IDY A;  3CQZ J;  1IV6 A;  1F1Z A;  4KMU X;  2E2J J;  2CQK A;  4A0X A;  1ONV A;  2LY1 A;  1R5I D;  2NS0 A;  4U7B A;  1SEU A;  1FLI A;  2E36 A;  3NEU A;  4AD9 A;  3PNT A;  1HBX G;  3VYR B;  3HOZ J;  3CDL A;  4M9S A;  4OAY A;  4XSX F;  2V9V A;  4PCQ A;  1RKW A;  3SXY A;  3N97 A;  3VSK A;  5HOO A;  3ZQF A;  5DUI A;  3KET A;  2F5E A;  4Q5S F;  3HZJ A;  1YJW I;  1SD7 A;  3DP7 A;  4P55 A;  2X6W A;  1ZN2 A;  5BNG A;  3DKX A;  3BJ6 A;  1MSE C;  2W57 A;  3CUO A;  4EM2 A;  3CES A;  1SAX A;  4KYW A;  1SD6 A;  5JI6 A;  2XC7 A;  2M8E A;  2DPU A;  3NWT A;  4GRI A;  4BE1 A;  3WU2 C;  1SFK A;  2R7F A;  5CQE A;  3OOP A;  4ZDL A;  2OQR A;  3H92 A;  2D5V A;  1U8B A;  4HW0 A;  3WU1 B;  4ZYA A;  1AOY A;  3BJO A;  4U88 A;  3K1N A;  1YIO A;  3RZD J;  1QO0 D;  3SDG A;  4YFN F;  2ECB A;  2VJ5 A;  1P4X A;  1A04 A;  4GXO A;  3H36 A;  3TW7 A;  3LOC A;  3MZH A;  2O9L A;  1VQK I;  1I27 A;  3CME I;  3CF5 F;  1K6O A;  4D7N A;  2XV4 S;  3L09 A;  1AA7 A;  1XX5 A;  3MAJ A;  1NHA A;  4FE4 A;  3V8J A;  2OD5 A;  1OCO H;  3CZ6 A;  3S17 J;  1A6I A;  2FU4 A;  2K9N A;  3S3O A;  2RVC A;  1UG0 A;  3W6V A;  2KT0 A;  2D1V A;  1IN6 A;  3MQ0 A;  4M74 A;  1HW1 A;  3JRI A;  1KU9 A;  4AIK A;  2CUZ A;  3HG9 A;  1MIJ A;  2M5W A;  3ONQ A;  4QWQ A;  4DZP A;  2ZNY A;  4XSZ F;  1FP1 D;  3CO6 C;  3S14 J;  4A2U A;  4Y13 A;  1TBX A;  3FXR A;  1MBG A;  1XCB A;  1BW5 A;  2WV0 A;  4IHS A;  3IWZ A;  5HNF A;  2GAU A;  1B9N A;  1S8N A;  2E5Z A;  2L3D A;  2L9N A;  3GCM A;  4HAM A;  4XLA A;  3TDZ C;  3ZN0 A;  4A3J J;  3MCZ A;  1B9M A;  3CTA A;  5IP7 J;  1YI2 I;  5M5Y J;  3HHG A;  2I5U A;  2QM3 A;  3BPV A;  2PMU A;  4B44 A;  2ISY A;  3DPT A;  1U0J A;  2M9H A;  1X3W B;  1R1T A;  3I4M J;  3F8N A;  4RB0 A;  3JAM K;  2R7D A;  2V1D A;  5GPA A;  3CUQ A;  4AUX A;  1V5E A;  1R1V A;  3BCB A;  1S9H A;  5GAH J;  4BQO A;  1WQ2 A;  3MFK A;  1OR7 A;  2QWW A;  5M5X J;  2M45 A;  5FB2 A;  2VIX A;  3BTL A;  4QTR A;  4UHT A;  1WFX A;  2R7R A;  3UNG C;  1WRJ A;  3C2G A;  4I0B A;  4U87 A;  1ZLJ A;  5HS8 A;  2IS6 A;  2GIV A;  4CCK A;  4BL0 B;  2VB6 A;  1S29 A;  2KL4 A;  4EM1 A;  5K7F A;  3BPX A;  4BJ6 C;  3B6C A;  1T39 A;  1QPM A;  3T1B A;  2RQQ A;  3BP8 A;  2FQ4 A;  2QQA A;  4ESB A;  2DA7 A;  4FQG A;  1AKH A;  1LE8 A;  2ZXW H;  3W6K B;  4JYK A;  3P7N A;  4M6V A;  2CU7 A;  2LR8 A;  5EZG A;  4ZYD A;  2OA4 A;  1HLV A;  3QPL A;  2XGE A;  4FIS A;  1G3W A;  2Q0O A;  2QKM B;  3HSF A;  4LFU A;  1FX7 A;  3CUQ B;  2ZJ2 A;  1IZ1 A;  1ZR4 A;  4AC0 A;  2WAF A;  1X4O A;  2KJB A;  4Y15 A;  3SJM A;  5JLX A;  2I10 A;  2L9R A;  2GOX B;  1FIA A;  1DPU A;  3JSP A;  4G7H F;  3QPT A;  5IT9 Z;  3PIO F;  5DDG A;  2H8R A;  4GO1 A;  3HSE A;  3C7J A;  3E97 A;  3HB9 A;  2F2E A;  4Y7N J;  4DIQ A;  1LQ1 A;  3ZOB A;  3JRA A;  3LAJ A;  5JR3 A;  1PYV A;  2AXL A;  3TKY A;  4F93 B;  1NK2 P;  2HTS A;  4XLP F;  4P96 A;  1AKH B;  1LE8 B;  5EJC A;  5F08 A;  2NXN B;  2JVG A;  4A3K J;  2ZXJ A;  3GTG J;  3GTO J;  2XAJ A;  2FQ3 A;  2LFB A;  1MMN A;  3J7A O;  3WTW C;  1YIJ I;  3C2H A;  3R0J A;  1Y8Q B;  1KU3 A;  3HTU A;  4C9Y A;  1Z0X A;  4D5F A;  4HST A;  3RDI A;  4L5I A;  4I7H A;  3LSH A;  3A0B C;  5H2F C;  2PFB A;  2A5Y B;  1RUO A;  4M3E A;  3OYM A;  5ICC A;  1VQM I;  2WTE A;  5HOD A;  3DTI A;  1P4W A;  3QYB A;  2QF7 A;  2KRH A;  1Q1H A;  1SC7 A;  3E5Q A;  1JKO C;  5LGT A;  1P6R A;  4L9J A;  2LRE A;  3EET A;  5J3L A;  3K4B A;  3MZY A;  3SFI A;  1AWC A;  1BR1 A;  5FJ8 J;  1MMS A;  1J7K A;  1ULY A;  2KP6 A;  3MD2 A;  5LHH A;  4HF1 A;  1BA5 A;  5LHI A;  1PVE A;  2JA5 J;  4A12 A;  2CFX A;  2PQ8 A;  5KCM A;  2NVU B;  1NK3 P;  3NRV A;  3QYE A;  5HLH A;  1YIT I;  1IXR C;  2DXI A;  1IW7 F;  2HDD A;  3LA7 A;  3WG9 A;  3KP3 A;  4RS8 A;  4XRF A;  3BZ6 A;  4RAY A;  1FZP B;  4EJV A;  2DBB A;  1FEX A;  1LDK B;  3S32 A;  3HRT A;  2B7E A;  2F5C A;  1IJW C;  1UB9 A;  1Z3X A;  2E1N A;  3R60 A;  3ZRG A;  1KQ9 A;  4RGX A;  1IXS B;  4G6D A;  1H0M A;  3U1K A;  2WBM A;  2OTL I;  2PX9 A;  1J0R A;  5J1Y A;  5DYM A;  1E0E A;  3K4N A;  4I99 C;  2NAZ A;  1XMK A;  2V1X A;  3PUB A;  4BDZ A;  4ENN A;  3KP4 A;  3TMO A;  3OYG A;  3H1C A;  1JXS A;  1FY7 A;  2KIU A;  2KKO A;  5D5U B;  3REO A;  2DN0 A;  2OZ6 A;  5KHD A;  3W2A A;  4WX9 A;  3OYH A;  2BVM A;  4F52 A;  2IA0 A;  1BM9 A;  4L18 B;  4PFO A;  2XKP A;  3FMR A;  3M7G A;  1IV8 A;  1Z21 A;  4AU7 A;  4EEF G;  3LFK A;  4UUS A;  4ESF A;  3T0Y A;  1FIP A;  2N8G A;  5F0H A;  4O5V A;  3OL3 A;  1XN7 A;  4W97 A;  3JRD A;  5EEA A;  2IGN A;  4CH7 A;  4C2M J;  3PO3 J;  4CCN A;  3CMM A;  2DOD A;  3ROU A;  2YU3 A;  3F8M A;  2O8X A;  3R4K A;  3BJA A;  3A1Y A;  3H0G J;  1EH7 A;  1FP2 A;  4XN3 A;  3IKV A;  1DGW Y;  2MLK A;  2R7S A;  3ULQ B;  3ZMT A;  4MTD A;  2VXD A;  4KT5 C;  3DV8 A;  1TC3 C;  5EEH A;  1ZAO A;  3S1R J;  5J6X A;  1LFU P;  1O7L A;  3GZ6 A;  1EH8 A;  1B6A A;  3DPL C;  5J40 A;  4UUS B;  3I71 A;  1O3S A;  5J8C A;  1ZAR A;  4G6Q A;  2EIL H;  4XOT A;  1LKX A;  2V1U A;  3OYF A;  1AHD P;  1BOB A;  3IH3 A;  2TRT A;  3TO9 A;  1RES A;  3LNQ A;  9ANT A;  2DPD A;  1W7P D;  2WB1 A;  4BHC A;  4A6E A;  3H9J A;  2XGD A;  1VQ9 I;  2E2H J;  1XMX A;  3AL0 C;  4GCV A;  1FC3 A;  2KRC A;  4KUM A;  3BR5 A;  4UY8 I;  5FRM A;  3BOQ A;  4XON A;  1I3A A;  2EH3 A;  1IDZ A;  4OAZ A;  3M1C A;  2MYS A;  5GP9 A;  3ML6 A;  1ZGJ A;  1PUE E;  2ELJ A;  3H9Q A;  2LKS A;  2PJP A;  2L0K A;  4PDK A;  5LHG A;  2HZD A;  2VT3 A;  2LLK A;  3IWF A;  1FBU A;  4HYE A;  4M9Z A;  5DTD A;  5IT9 K;  4OMZ A;  3P5J A;  4X0G A;  2IA2 A;  3L2W A;  4IPA A;  1X1P A;  2C6Y A;  4ON0 A;  5LEJ A;  1ZG3 A;  1V5G A;  5GTH C;  3ECH A;  5LEK A;  4C2T A;  3OS0 A;  3G2B A;  4I98 B;  3TP0 A;  1DPR A;  1SMT A;  5HS7 A;  3JW4 A;  5ICF A;  5BPD A;  3UR3 C;  2MLG A;  2IEK A;  3QU3 A;  5K1Y A;  2KIM A;  5F0F A;  1UST A;  2EIN H;  2L7M P;  3F21 A;  1SFO J;  4OIQ F;  2CFO A;  1VI0 A;  3SDB A;  4KMF A;  1MBH A;  3LST A;  3TED A;  1LB2 A;  4HPQ A;  2M87 A;  3HOY J;  4AWX B;  2X1E A;  1Z6T A;  1YG2 A;  1PJR A;  1Z91 A;  4OIP F;  2PJR A;  4E7J A;  4N9I A;  2HQA A;  1W4M A;  1REP C;  2VKD A;  2VT2 A;  4RA2 A;  4UV9 A;  1UZC A;  3JRC A;  1DP3 A;  4BBR J;  2DA3 A;  5HLT A;  2GQQ A;  3O8H A;  3ZR8 X;  2L02 A;  2LDU A;  1JT6 A;  3OIO A;  2CV1 A;  1ZK8 A;  2LG4 A;  3MKY B;  1TQP A;  2X51 A;  3HUG A;  5FKK A;  4ZYG A;  1DP7 P;  1Y39 A;  5K7H A;  2VOO A;  5J8F A;  1WHU A;  3CUQ C;  4B3X A;  4H4K C;  2V9K A;  3WE2 A;  3ABK H;  1FOW A;  2DMT A;  1OR7 C;  2F5V A;  2DJN A;  3K4L A;  4PSX A;  4F7Z A;  2LMD A;  3BC8 A;  3M07 A;  1I39 A;  2E35 A;  3IAM 2;  2ZSH B;  2X9D A;  1MMD A;  3X2Q H;  2PJR B;  3D1N I;  4ANJ A;  2K4J A;  3F9K A;  4HNV A;  3VFZ A;  1FTZ A;  2LY2 A;  2K5C A;  3DF8 A;  1WGX A;  3GTL J;  2E60 A;  3FIW A;  2HOA A;  2A07 F;  4M6Y A;  3VYT B;  3J80 Z;  1DU0 A;  1HF0 A;  3ZMU A;  5D6E A;  2Q8K A;  3H3V K;  4BQA A;  3WGG A;  4G8X A;  1LPQ A;  3FX3 A;  3KP6 A;  3I56 I;  3HUG B;  4J00 A;  2B9S A;  3I4P A;  2F6C A;  1TQM A;  2VQH A;  3KEO A;  3AKZ A;  1WVR A;  1YX3 A;  4RDU A;  2ZBK A;  1F9N A;  3K4M A;  2CQX A;  4Y52 J;  4BHP A;  1ETW A;  4XRM A;  1QZZ A;  2LNB A;  1MH4 A;  1O57 A;  2BOL A;  2VE8 A;  1ZGW A;  1WJF A;  2BVL A;  3AG4 H;  4DBQ A;  3F23 A;  3A03 A;  4IHT A;  1KGS A;  4UB8 C;  5IOY A;  5EGO A;  4B48 A;  3TL4 X;  3CCM I;  4OOI A;  4KA4 A;  2JZY A;  5ICE A;  2LD5 A;  1OIS A;  5J47 A;  2HZT A;  1VQ4 I;  2YPR A;  1YS6 A;  1XB4 A;  2VQG A;  1SFX A;  3V4G A;  3U21 A;  1VFC A;  1FBQ A;  2OC6 A;  5F6F A;  3FMS A;  2QLZ A;  3FXK A;  1U78 A;  3H5N A;  4DQ2 A;  2A69 F;  2X6Y A;  3HXL A;  1JUM A;  4E7K A;  2MA3 A;  2RN7 A;  5IPA A;  3LA3 A;  3A2K A;  1XGN A;  3RPU A;  2VC0 A;  1D1B A;  3OIP A;  2DJI A;  1HXD A;  2DDB A;  1VQ6 I;  2HQR A;  2LH9 A;  3P9I A;  3TDU C;  2VON A;  2EB7 A;  3CD6 I;  3M8E A;  2PLY A;  1X1C A;  1X3Z B;  2AO9 A;  4RAG A;  5E3N A;  2WA0 A;  5EGO B;  2DOF A;  2F4M B;  4HNU A;  2IGO A;  4WCG A;  3F8C A;  2D1H A;  2P5V A;  2R7Q A;  5F04 A;  4CSW A;  1BC8 C;  4XQF A;  4HDU A;  2GM4 A;  2CQ7 A;  1K4T A;  5DD8 A;  5J4V A;  2HPM A;  1FMW A;  2VBW A;  1NG7 A;  5LBQ A;  1SFE A;  2LY9 A;  4PK4 A;  2BY2 A;  4HSR A;  3QRF F;  3CJQ B;  3BTJ A;  3VB2 A;  2DCE A;  3S1N J;  3PO2 J;  4LIV A;  4TV7 A;  3F72 A;  2MH2 A;  3MWM A;  3PNV A;  4LB6 B;  2PN6 A;  2JUC A;  1JJ8 C;  3PSF A;  4BH9 A;  3L2U A;  1RI7 A;  1O4X A;  3H5R A;  4IQ4 A;  3WTX C;  3GWZ A;  4GYG A;  3SZP A;  4U7D A;  4G6T B;  1FYK A;  1Z1D A;  4HV5 A;  2ZJQ F;  1O3Q A;  1K61 A;  4M3B A;  4CO8 A;  1FBS A;  1U3E M;  1XSX A;  1TNT A;  4PGG A;  2R93 J;  3ERM A;  2Q1Z B;  1BJZ A;  1D0Z A;  3HSR A;  1X58 A;  3GUD A;  1MNE A;  2WY8 Q;  1OYY A;  3LSM A;  3OIQ A;  3G6E I;  4A3C J;  3KEQ A;  3MZ8 A;  1J5Y A;  2AXT C;  2WWY A;  4E7H A;  1A31 A;  4KIS A;  2A6H F;  1ORK A;  2YS9 A;  2CUJ A;  3F8B A;  4NB5 A;  5HDN A;  3RKW A;  2DA5 A;  2VPL A;  2WV1 A;  3OYD A;  3K0L A;  3T8T A;  4NDL A;  4LIT A;  4G9Y A;  1P92 A;  5D5X B;  1OCC H;  1H9T A;  1CQT A;  1VQL I;  2J5P A;  4A0Z A;  1KON A;  4P9U A;  3DWL E;  1V55 H;  2V7F A;  3DBL B;  5CVV A;  1ZEL A;  4P5O A;  1ZRF A;  3AG1 H;  3CCJ I;  3BZK A;  5DM7 F;  5E3O A;  1ODD A;  4RGS A;  4BQN A;  5GPC A;  3I5U A;  5FGM A;  3EUH A;  2FUG 2;  3CLO A;  5M3M J;  4XKB A;  3CF2 A;  4PJM A;  3HRU A;  4RAF A;  1K83 J;  4A3E J;  3HTS B;  2M1B A;  1R36 A;  2JPC A;  1IRZ A;  2KQR A;  2XUB A;  3CC7 I;  3RTR A;  4ZJZ A;  4HF0 A;  4H0E A;  2MD0 A;  1YW9 A;  2EFO A;  1AU7 A;  2EZH A;  1JKP C;  3F0C A;  2R5Y A;  1WJE A;  2ZXH A;  1WWX A;  2JMW A;  2XGX A;  1I6X A;  2HDC A;  3OWT A;  4C2U A;  2KDO A;  3J80 K;  2MW8 A;  4G7Z F;  4FCY A;  1GXP A;  2HVR A;  3GTP J;  3ABT A;  1T38 A;  1LVA A;  3IRR A;  3CC2 I;  4DYC A;  4R79 A;  2WY7 Q;  4AVP A;  3DCF A;  3JR9 A;  1QHH D;  2GWR A;  2ID6 A;  3RKX A;  4HLX A;  5E3M A;  1IGN A;  3CMA I;  2V6C A;  3VOD A;  1MKM A;  4WF2 A;  2M2E A;  5FKN A;  4MO7 A;  3SFZ A;  2P8T A;  1QQI A;  5K7Z A;  3CCS I;  1XDU A;  4IEJ A;  3C1D A;  1MZB A;  2PMZ A;  3CCQ I;  2R5Y B;  1VND A;  3DFG A;  2GXG A;  3HIF A;  2XRO A;  2FEZ A;  2Z2S B;  4NHJ A;  1E2X A;  2DA4 A;  2LVS A;  3CDI A;  1R5G A;  2OPT A;  2XF6 A;  1D5V A;  3I53 A;  1MBF A;  2IXS A;  1R9T J;  4A69 C;  3G1L A;  2YU9 J;  3N05 A;  1W0T A;  1QPI A;  5E8I A;  3RJP A;  3JCU C;  2CJJ A;  3H3Z A;  4DGW B;  5KAF C;  5JVT A;  1HQC A;  2DFE A;  4UVA A;  3PFI A;  4EMS A;  3WTT C;  1VQ8 I;  2GXB A;  3LQQ A;  2CGP A;  1R00 A;  2EFN A;  2FNP A;  3RYP A;  2KMU A;  2M3A A;  3ASO H;  5B5E C;  1MND A;  3P9K A;  3ZMS A;  3NWS A;  2HR3 A;  1SAN A;  3DKW A;  4I02 A;  4YIR X;  3KYD B;  2BEO A;  3MVP A;  1FOX A;  3S93 A;  2DK8 A;  3IKT A;  1UAA A;  4JK1 X;  2K02 A;  3GME A;  4BU2 A;  3ZQH A;  3HPG A;  3IL2 A;  5ILV A;  2Y2Z A;  1SD5 A;  3EDP A;  1TW3 A;  2TCT A;  2IPQ X;  1XDS A;  4D9J A;  1EKE A;  4UUV A;  5FLM J;  3V42 A;  3GTQ J;  1KQ8 A;  2GA1 A;  4BAY A;  5L3E A;  4ENK A;  4XIC A;  2P6S A;  4LG0 A;  5EF6 A;  1V3F A;  3K69 A;  3A01 A;  3AFH A;  1UHM A;  4JOM A;  3S1M J;  1Y1W J;  4ZC3 A;  3KZI C;  2HKX A;  4IJA A;  2ZME C;  3BR0 A;  5EEG A;  2K85 A;  2EIK H;  1YW8 A;  2RNG A;  1IF1 A;  5DEQ A;  5LLQ A;  4HLY A;  3NAU A;  2OBP A;  2KHM A;  5BPI A;  2ZO4 A;  1R22 A;  2ADU A;  2ZSI B;  1FOY A;  3V7C A;  3QWL A;  1SVL A;  2NYX A;  5HLI A;  2VOP A;  3QOP A;  3L9F A;  2KDZ A;  4IO9 F;  2BY3 A;  4JX6 A;  3C18 A;  4I09 A;  2HOS A;  2RRE A;  3VOE A;  3O6B B;  2H1K A;  5L3F A;  3V8K A;  1RC9 A;  1F4K A;  1WJA A;  1ZRE A;  1S3J A;  4LG0 B;  3A01 B;  1H88 C;  4OWR B;  2GXA A;  3IAS 2;  3PFY A;  2XB0 X;  5IOZ A;  4JX5 A;  1IUF A;  1O3R A;  2O61 A;  5IP9 J;  2Y30 A;  3OYI A;  2Z1D A;  3WHB A;  3GFL A;  3I3L A;  4MNU A;  3WU0 A;  3HKZ N;  4A0Y A;  3BDD A;  4WXC A;  4E6K G;  4F91 B;  3BY6 A;  4RGR A;  1X19 A;  3OOU A;  4RMN A;  3I0T A;  1LDD A;  5FFZ A;  3K2A A;  2M7B A;  1CGP A;  2LKP A;  3K1P A;  3HL2 A;  1T8I A;  4KIB A;  2NVQ J;  2JPB A;  1DQU A;  2VXZ A;  4KIC A;  2IA1 A;  5CVR A;  2ZFU A;  1YRN A;  1GXQ A;  1Z67 A;  3JRE A;  1TQI A;  2Y75 A;  5C3E J;  4GGG A;  2EIM H;  2P7C B;  1QZE A;  4FAS D;  3Q3S A;  2R4G A;  4LMY A;  3OSG A;  3V7S A;  2DU9 A;  4FTH A;  2K3P A;  2K40 A;  1GHC A;  2JRM A;  2UV1 A;  1DDN A;  3L1P A;  4OIN F;  3GBG A;  2LP0 A;  3BLY A;  2E2I J;  1KU2 A;  4FX0 A;  2VL8 A;  3ASN H;  2EBI A;  4E7L A;  3B6A A;  2BXZ A;  4L9V A;  1A36 A;  1XTA A;  4BXU A;  4IZZ A;  3M8F A;  4AIH A;  3F3X A;  4QIW N;  1E3P A;  5F1R A;  3RQI A;  1APL C;  3U1D A;  3ZPL A;  4CCM A;  2KZV A;  1Y1V J;  5KNL A;  1HSJ A;  1XG1 A;  1YRN B;  2M7A A;  5FO5 A;  2L5Q A;  3KLN A;  2BXY A;  4ENM A;  1T6S A;  1FJL A;  1X4P A;  5CVJ A;  4G12 A;  4MEY F;  2ZNZ A;  2Y48 A;  2VKV A;  2JA7 J;  4IRG A;  5IYD J;  1OMI A;  5DM6 F;  2R92 J;  4BGD A;  3FHZ A;  3CP2 A;  2R7V A;  4IX7 A;  2ZC2 A;  1H89 C;  4MLO A;  4Z6Y A;  2HTJ A;  1TTY A;  2CW7 A;  1YHQ I;  3BQZ A;  2FOW A;  2DI3 A;  3CCL I;  2LF7 A;  4MQV A;  3OYA A;  3I55 I;  1I6H J;  2JA2 A;  2VJI A;  4WXH A;  2W00 A;  2A6E F;  3KIO A;  5GAE J;  2A61 A;  4EJW A;  1K4S A;  5EG0 A;  1E17 A;  2QQB A;  1RRJ A;  1IUY A;  4CCJ A;  1MH3 A;  3BG3 A;  3SQN A;  3SZG A;  3DTK A;  3ZQ7 A;  3J81 Z;  4BAC A;  5HS9 A;  1G2H A;  3RKQ A;  2NRA C;  4D5C A;  3A0H C;  3UKG A;  2HEO A;  3R6S A;  3EUK L;  4E7I A;  1JGS A;  1XD7 A;  2O5R A;  1H8A C;  2W1O A;  4UVB A;  4KIT B;  2P81 A;  2LYC A;  3W2V A;  3TO6 A;  3JRB A;  2Y0S N;  2VC1 A;  3HEF A;  1ETV A;  2VAS A;  1G3T A;  4Q4Z F;  4HZF A;  1IN4 A;  3RKY A;  2IBD A;  1R58 A;  2PI0 A;  1XCV A;  2H8W A;  2P4W A;  5JLW A;  1JHF A;  5ILS A;  1MSF C;  2HS5 A;  1MMA A;  3I4N J;  3J7A Y;  3H5A A;  5EG0 B;  5HVQ C;  4HNT A;  5CVI A;  1U5T A;  4HX4 A;  5FLX Z;  3WGI A;  1OKR A;  1ITY A;  4LJZ F;  1BN5 A;  3E5U A;  2OUM A;  1ETY A;  2P0W A;  3HOS A;  2QVO A;  2G0E A;  4L0Z B;  3GVA A;  5CJ9 A;  3L2Q A;  1BR2 A;  2XAH A;  4CYC A;  3RPU D;  1R4M B;  3GFI A;  4RLF A;  1XGS A;  3FM5 A;  2X6O A;  2Y31 A;  3TOB A;  2CQQ A;  3IH2 A;  5GAD J;  1EV7 A;  3QOE A;  1LNW A;  1K78 A;  2IGK A;  3ABU A;  1R6R A;  4XLN F;  2AHQ A;  2QBY A;  5J4Y A;  3K10 A;  4ITV A;  2HI3 A;  3RIR A;  5B66 C;  4II3 A;  2A5W A;  4FT8 A;  1X1B A;  2VN2 A;  1LFP A;  4M6X A;  2H6B A;  4LIU A;  3ESW B;  3IUO A;  4X1E A;  2QUF A;  3TO7 A;  1OQY A;  2E1M B;  4C30 A;  4A3I J;  5ILU A;  1U5T B;  3BZC A;  3VYU B;  2XF7 A;  5D4S A;  2L2O A;  3LSR A;  1PDN C;  1P7I A;  1TT0 A;  4BEH A;  1VQP I;  4M3G A;  1OCR H;  1HDD C;  3EPZ A;  4MFD A;  2FNA A;  3VPR A;  4J19 A;  1FWZ A;  4B1R A;  4DOZ A;  4IVN A;  4PFP A;  1LJ9 A;  3CMY A;  2K7L A;  4CYC B;  1X3U A;  2A68 F;  2MBF A;  2NS7 A;  2UZK A;  2K9M A;  3K2Z A;  5FKL A;  2ZKZ A;  1K78 B;  1ZTR A;  2R7Z J;  1KYW A;  3GO5 A;  3FXQ A;  2QBY B;  1P7J A;  2L4M A;  3CJT B;  4KFC A;  1S6L A;  4S04 A;  4YRV A;  2H94 A;  3FK7 A;  3U9G A;  1S72 I;  2BHY A;  2JWT A;  5L3B A;  2RKH A;  1TWG J;  2Y69 H;  3C3W A;  2M30 A;  2V9P A;  5E3L A;  4LK0 F;  1H9G A;  3TP3 A;  3K4J A;  2OQG A;  1BI3 A;  5LFA A;  1BI0 A;  1OPC A;  2K3F A;  3EQL F;  3PQK A;  4UVC A;  3HYI A;  1WPK A;  1ON1 A;  2Z33 A;  4PJJ A;  1IO2 A;  2O6G E;  4ESJ A;  4BEH B;  5LD2 C;  2MGQ A;  2XAU A;  2NVX J;  1XSV A;  5FLV A;  3ZQG A;  3S2W A;  4IHW A;  3HC7 A;  4RLQ A;  2Y0M A;  1I5Z A;  4IRH A;  3H35 A;  2UUZ A;  1P9Q C;  1UFM A;  3O8G A;  3I64 A;  1KA8 A;  5J1R A;  1N75 A;  4BJ5 C;  2OCC H;  3D0S A;  4CZZ A;  2HXI A;  2CSO A;  4ZYE A;  3E1S A;  2H6C A;  3OYB A;  1GLN A;  1L3L A;  1QGP A;  3GLX A;  2GOM A;  2DOE A;  3RPQ A;  2ECC A;  5E20 A;  4MHG A;  3PIP F;  3G73 A;  4BS9 A;  3R0A A;  2ME0 A;  1BW6 A;  5TJJ A;  2YUS A;  2RNJ A;  2EFP A;  4CXF A;  4IHY A;  3W6J B;  4ZDO A;  4CDG A;  1U6G A;  2FF4 A;  4G94 A;  1QBJ A;  2VBZ A;  4XRS A;  2R7O A;  1STZ A;  1WKM A;  4KIF A;  4YG2 F;  2JSC A;  2OZU A;  1RKT A;  4CIC A;  1MNM C;  1EH6 A;  1JHH A;  2E19 A;  2HQN A;  4B3A A;  2NS8 A;  4B43 A;  5CYV A;  3FXL A;  2M8G X;  4BXF A;  1HST A;  1YO5 C;  4E4H A;  1WI3 A;  3HBL A;  3J81 K;  1WZ2 A;  3JRG A;  3OYC A;  1X1D A;  2LRD A;  1KU7 A;  4WWC A;  4B47 A;  5E1Z B;  1O3T A;  2V26 A;  4AM3 A;  5HDG A;  5HNH A;  3GF2 A;  3J7Y J;  1RR7 A;  1ZYR F;  5K5Q A;  3ISP A;  3EYI A;  1YJ9 I;  1YE9 A;  4II2 A;  4Q48 A;  5C4J J;  5D8K B;  2GZW A;  3K7A J;  4A3D J;  1G3S A;  1S7O A;  2ESH A;  3OYN A;  3S2D J;  2DW4 A;  1MJB A;  3LSK A;  1YX5 A;  5LGN A;  2LKX A;  1HC8 A;  2NVY J;  3IV5 A;  1N78 A;  5FLX K;  1QRY A;  3G1M A;  1FYL A;  2O7O A;  2ETH A;  3ABM H;  3O2P E;  4XM3 A;  5BQT A;  4XMY A;  1JJ6 C;  4WK8 F;  2JQ7 A;  2Y9Z A;  5L3C A;  2CRG A;  4ZZL A;  1U8R A;  3MKW B;  3ZMD A;  4P9F A;  1BI1 A;  1VQ7 I;  4RAZ A;  2Q2E A;  1YJN I;  3QPH A;  2W25 A;  4HBL A;  3PQJ A;  3W2W A;  2P6T A;  2KIS A;  3FBI B;  5EZH A;  3QQA A;  3S2H J;  1MW7 A;  1VQO I;  4Y33 A;  1B72 A;  4RBO A;  2CS3 A;  2DYR H;  1LFB A;  4KN7 X;  1HCR A;  1MDM A;  2E71 A;  1J59 A;  2WAD A;  3FKI J;  4LGW A;  2JRT A;  1T56 A;  3L2V A;  1FT9 A;  3S16 J;  3GEZ A;  2QYO A;  5EDN A;  4ZTF A;  1DU6 A;  1TZL A;  2R0Q C;  3HOX J;  3GW2 A;  3I9V 2;  4A3M J;  3ZQI A;  5FD5 A;  3BG5 A;  4DYQ A;  1LVK A;  2G7H A;  3FK6 A;  2Q2E B;  2X4H A;  4BY7 J;  1OFC X;  2DMN A;  1TWF J;  1M1E B;  4F92 B;  4ZTJ A;  2IGM A;  3G3Z A;  1UJ8 A;  1T95 A;  1B72 B;  1IC8 A;  1PUF A;  2B0L A;  2FRH A;  2EZL A;  2VKH A;  3KYC B;  3BCA A;  1WI9 A;  2HU9 A;  2DAO A;  1MDM B;  3E3V A;  1XMA A;  3BR1 A;  1QVU A;  1KZH A;  5FRO A;  2M4K A;  2Y9Y A;  2FMY A;  2ELH A;  1WJC A;  3G1O A;  1GV5 A;  5M5W J;  1WJD A;  5FRN A;  3WTZ A;  2QGU A;  3DTE A;  3ZMZ A;  2VLA A;  2HOT A;  4L9T A;  1JUP A;  4M9X A;  2NVT J;  3CCE I;  1BI2 A;  2VQC A;  2EV6 A;  3L2C A;  2STT A;  2EPF A;  3HPH A;  2MD5 A;  3WGH A;  2V6E A;  2LBF A;  2VBY A;  4BQQ A;  1GDT A;  2PBI A;  4XLE A;  2JT1 A;  3HOW J;  2HYF A;  1MBE A;  2FBK A;  3OY9 A;  2E1M C;  4UXN A;  1QHG A;  2JVH A;  2RC4 A;  5A2Q Z;  1U5T C;  2IP2 A;  2RQP A;  1PUF B;  1NG6 A;  2CW0 F;  3E5X A;  2DTR A;  1LDJ A;  1JKQ C;  1Z6R A;  2RV8 A;  4XKW A;  3HM5 A;  1R1U A;  1ERD A;  3GZ5 A;  3N4M A;  4HOB A;  1OCT C;  2H1L A;  4E7S A;  3SZT A;  3KE2 A;  5BOX A;  1S7A A;  3FDY A;  3LAP A;  3OR2 C;  2E1O A;  2BZT A;  1FTT A;  4N9H A;  3CO7 C;  1SAU A;  2X1C A;  1YTY A;  4QPO A;  2FA5 A;  3I58 A;  1TW2 A;  2LBF B;  3FBN B;  1BL0 A;  3Q0V A;  1IG7 A;  1R7J A;  1R5H A;  2F48 A;  1IRX A;  3DLA A;  3DU5 A;  1U9N A;  2WB1 N;  1Y0U A;  5DD4 A;  2GA2 A;  2XAF A;  3LA2 A;  1XSD A;  1EJ9 A;  1ON2 A;  2B63 J;  4V19 K;  2RAE A;  4M3F A;  3LQR A;  2KFD A;  2KIQ A;  1F36 A;  4EJU A;  4FE7 A;  5F64 A;  1RR8 C;  2MG4 A;  3FXU A;  2E5N A;  2ZFW A;  3MKL A;  4C3J J;  4RB1 A;  1IN8 A;  1V4R A;  1F43 A;  2V1N A;  1P2F A;  2YX4 A;  1Z05 A;  2M0C A;  4OMY A;  2EA2 A;  2K9L A;  1ETQ A;  2K9S A;  3FF5 A;  1XGM A;  2L7K A;  2LC2 A;  5FKM A;  5TRD A;  5H20 A;  1G6N A;  4E70 A;  4UV8 A;  3GX4 X;  2L7Z A;  1WJ5 A;  2DDA A;  1YW7 A;  4M72 A;  4V2F A;  1UHW A;  1T2K A;  4JX4 A;  4JP0 A;  3OYE A;  3ERE D;  5E1X A;  5M3F J;  2HGC A;  3BR3 A;  1OCZ H;  3GZN B;  4EVI A;  1Y56 A;  1YYV A;  5EYR A;  2H09 A;  3OSF A;  2AQF A;  3B73 A;  4FHT A;  4HEA 2;  1I1S A;  2EV0 A;  3BG9 A;  3FHN A;  3LL7 A;  2V4J C;  2Z3Y A;  2RGV A;  4BNC A;  5TGT A;  2R7T A;  5JHU A;  3U2R A;  3H0D A;  1J2X A;  2FBH A;  2MC4 A;  3F6O A;  1K6Y A;  4CYD A;  3BT9 A;  3V7R A;  4L5J A;  2D45 A;  3FIS A;  3RCO A;  3ZGK A;  5GTI C;  1VQ5 I;  3T5X A;  3PNY A;  2CQN A;  5E1W A;  5H6R A;  2Z5U A;  5JFR A;  4A3G J;  1F5T A;  1RUN A;  2ZCW A;  1ZRD A;  1BJA A;  2WC2 A;  2XAG A;  1PP7 U;  2JUG A;  3NQO A;  3VWB A;  2KZG A;  3JSO A;  2P5K A;  2LF8 A;  2QA4 I;  3G4S I;  2XAQ A;  2X1D A;  3WE3 A;  5DS9 A;  5IP6 A;  1XS9 A;  4A3F J;  2W82 A;  2G9W A;  2O03 A;  3TGN A;  2XRL A;  2EK5 A;  2KPM A;  1D3Y A;  4HX8 A;  4YFK F;  1DUX C;  1S7E A;  4I2O A;  3FKJ A;  2DLL A;  4KIG A;  3BWG A;  3RZO J;  2HQ5 A;  1TL8 A;  4XNF A;  2X0L A;  3IRQ A;  5E18 F;  3RQ4 A;  1YS7 A;  3WOD F;  1ZGA A;  4CGZ A;  2ZXI A;  4NC6 A;  4ENJ A;  4HF2 A;  5HDK A;  3S8P A;  2JK3 A;  2EIJ H;  2F5F A;  1IRF A;  2E7W A;  3NAR A;  5H6Q A;  2H27 A;  2FXA A;  4Y17 A;  5E17 F;  3DPU A;  3SEZ A;  2EZI A;  3CJN A;  2LK2 A;  2GIZ A;  1LEA A;  1R23 A;  3K70 C;  3AL0 B;  1K7A A;  2JTV A;  2XB5 A;  1W5T A;  2OU2 A;  2ESN A;  4IKF A;  2QSH X;  5DV5 A;  3HDD A;  4CCO A;  5LRR A;  3OR1 C;  6PAX A;  3PSI A;  4D7M A;  1SVM A;  1T0F A;  4EM0 B;  4C3H J;  2HVQ A;  1UEL B;  1V5F A;  2DA1 A;  4O3M A;  4IXA A;  4HRI A;  1B4A A;  1GVJ A;  3HHH A;  3ZQC A;  2AQE A;  3CCU I;  3KLO A;  1OYI A;  5FD6 A;  3KX2 A;  1WSU A;  3BTC A;  3FM3 A;  4W1U A;  2IS4 A;  2W48 A;  4EJO A;  2CWE A;  2ELK A;  3QP6 A;  3L00 A;  5JHF A;  3OS1 A;  3O3K A;  2CUE A;  4XID A;  5A2Q K;  1D0Y A;  3IP4 B;  1HW5 A;  3Q9S A;  2HVS A;  2ISZ A;  5IT3 A;  1NH3 A;  1G4D A;  3WTY C;  1ETX A;  2DFI A;  3RYR A;  2P7V B;  4IHV A;  4PJN A;  1ZG1 A;  1JKR C;  4L0Y B;  1X2M A;  4PJ0 C;  2IJL A;  1OJL A;  4XLH A;  3HJE A;  1QVT A;  2COB A;  2R3S A;  2VKE A;  3K6G A;  1U2W A;  3B02 A;  4N4O B;  4NC8 A;  1I50 J;  4JBA A;  4BY1 J;  2X85 A;  4I76 A;  3TOA A;  2F4O B;  3ZQQ A;  4M3D A;  3F22 A;  2ZJR F;  3SYT A;  5JVG F;  4HA8 A;  4BHB A;  3S3M A;  5D4R A;  5AON A;  2HYJ A;  1O7F A;  2RDP A;  1ACI A;  4M73 A;  3S1Q J;  3VYS B;  4N4N B;  3CCR I;  1JTY A;  2YX7 A;  3ZMV A;  2BBY A;  1DGR M;  3CLQ A;  4A3L J;  2EA4 A;  1I3Q J;  2R7X A;  2DO7 A;  2COM A;  4N0B A;  2O8K A;  5B1B H;  4OIO F;  1ENH A;  1R4N B;  4AYB A;  4DNC A;  5F1J A;  2W4S A;  1RZ4 A;  3HRM A;  2EFQ A;  4RB2 C;  1R49 A;  1FYM A;  2JA8 J;  1W5S A;  3Q9V A;  3KP7 A;  2I8D A;  4A3B J;  3E6B A;  4PSW A;  2CV0 A;  4JQF A;  1J75 A;  3COA C;  4DW6 A;  3LSI A;  4UNO A;  3DKY A;  1ZQ3 P;  4NBQ A;  1QU3 A;  5D6F A;  4P1W A;  4HG2 A;  4RB3 C;  3E6M A;  2D2W A;  4OU0 A;  2UWM A;  1OCP A;  4EV0 A;  2IT0 A;  2PEX A;  4LG3 A;  1W36 C;  2DT7 B;  1G59 A;  2CUF A;  3OS2 A;  3FMQ A;  3QAH A;  3E6C C;  2XPW A;  3GXO A;  1YLF A;  1UG2 A;  4ZYH A;  2X6X A;  4D0P A;  1BOA A;  4MEX F;  4B09 A;  3HRS A;  3FXO A;  1QA6 A;  4M71 A;  1J9I A;  1X2N A;  5CKT A;  3IH4 A;  2W7N A;  2DQR A;  4O6J A;  4FX4 A;  1GT0 C;  1HOM A;  1WJB A;  1I1G A;  4LOC A;  2DA6 A;  2IVM A;  2L4A A;  3EUH C;  2DMP A;  3CP8 A;  4NUB A;  2EWN A;  4EAT A;  3VDX A;  2IRF G;  1Q1V A;  3CCV I;  2E34 A;  2ME6 A;  2NOJ B;  1EF4 A;  2VI6 A;  1WCM J;  4IQJ A;  1K79 A;  1J09 A;  2UXX A;  4ZDP A;  1MBK A;  4HV6 A;  1A35 A;  4YEL A;  2QQ8 A;  3I54 A;  1MMG A;  2JA6 J;  1B1B A;  2OCE A;  3GFJ A;  3K70 D;  1SFU A;  4CCL A;  2MH9 A;  5E8G A;  3Q5F A;  3M3Y J;  1YQA A;  2XGC A;  1NTC A;  3Q0U A;  4XRS G;  3ABL H;  4HQE A;  5L3D A;  2Z9O A;  3GTK J;  2WAQ A;  3KCC A;  1FPQ A;  3JRH A;  3JTG A;  4EGZ A;  4S0H B;  1IXC A;  3HGY A;  2DOA A;  3ZXS A;  1N25 A;  4FET A;  5IY5 H;  1FMV A;  2L01 A;  4XKV A;  3WTV C;  5B3S H;  1ZH5 A;  1V54 H;  2LOO A;  4AVZ A;  1ETK A;  1MJA A;  5HLG A;  4U0W A;  3FXM A;  4PZJ A;  2R7U A;  3CC4 I;  5IYC J;  4G7O F;  4IRI A;  3BTI A;  5GAG J;  2K9Q A;  1BC7 C;  1UMQ A;  1VZ0 A;  2KRF A;  3WG7 H;  4DBR A;  4XL9 A;  3LWF A;  1WH7 A;  3KPH A;  1LUJ B;  1TT5 B;  1BIB A;  3JRF A;  4Q47 A;  2XSJ C;  4EQQ A;  2PMZ N;  5F0C A;  2DT5 A;  4BKX A;  2VUM J;  1G3Y A;  5ERI A;  2ZJP F;  3ZQL A;  2PMH A;  3DEE A;  1HKT A;  4BE0 A;  3AG3 H;  5CVU A;  4QPQ A;  1JGG A;  3DEW A;  4BXX J;  1A5J A;  4LB5 A;  4KN4 X;  3LMM A;  2VE9 A;  1Z7U A;  1Z9C A;  4CUG A;  2R7W A;  4D1Q A;  5J1U A;  2DFF A;  1U9O A;  1TP4 A;  1BR4 A;  4IL6 C;  2XDV A;  2Z99 A;  3ZCO A;  1D0X A;  4XKC A;  2NNY A;  2ZB9 A;  3OYK A;  2A6T A;  2W84 A;  4DYR A;  5LGU A;  4J01 A;  1HKS A;  5C4X J;  2K27 A;  3BR2 A;  4BE2 A;  1D1C A;  3MEX A;  2HKO A;  1VTN C;  5LRS A;  4LLG F;  3MN2 A;  4A5N A;  3HOT A;  1MGT A;  4MGR A;  3QYF A;  3K4C A;  2QQ9 A;  3GLL A;  2O0Y A;  3OMY A;  5TIS C;  3BRO A;  4MQ9 F;  1D8J A;  1MJ9 A;  3ECO A;  2CYY A;  4GFB A;  3SEQ A;  4QLC U;  4QSH A;  3GTM J;  4ASN A;  3GTJ J;  2CMP A;  3DBH B;  3FWE A;  1W0U A;  4RM2 A;  1ZRC A;  3KP5 A;  5BS6 A;  5K5O A;  3PJR A;  1S5L C;  3F6V A;  3K4K A;  3MMY B;  3ZP5 A;  2HDW A;  2OAZ A;  2HFH A;  2KIF A;  2A3S A;  3L2R A;  5L3G A;  4IOA F;  2OTJ I;  4ETS A;  3VEP A;  4U0Y A;  2DYS H;  5CQG A;  4RM3 A;  1RNL A;  3QU6 A;  2DTZ A;  2BW3 A;  1VF9 A;  2WAE A;  1MBJ A;  2M0M A;  3C2B A;  2K4B A;  3FZV A;  4HX7 A;  5FKO A;  2FJ1 A;  5ED4 A;  2ACJ A;  3S3N A;  4GDF A;  2XPU A;  3P9C A;  4B4C A;  4IF4 A;  4A93 J;  4K2E A;  3WHC A;  3KFW X;  1D1A A;  4XN0 A;  1XC5 A;  2XSD C;  3LSJ A;  2XHK A;  1MD0 A;  4GYI A;  1W36 D;  2TDX A;  1XGO A;  2W85 A;  2M34 A;  3KYL A;  1Y0N A;  4I01 A;  3WTU C;  2GLO A;  2L9V A;  3EYY A;  1YOV B;  2DMU A;  1A6Q A;  3DQV C;  4F55 A;  1ZLK A;  4KT6 A;  2Z16 A;  4MTE A;  2BW3 B;  1WH5 A;  2AS5 F;  1IN5 A;  2FE3 A;  3JTH A;  3TBI A;  2F5D A;  1T0F C;  4XOP A;  1ZR2 A;  2XRN A;  2JSP A;  1TWH J;  3WTS C;  3GYH X;  3KEY A;  1G8X A;  4AIJ A;  5D8L B;  2XPV A;  4V2G A;  2E1C A;  2FD5 A;  5D5W B;  3OL4 A;  1B59 A;  2CG4 A;  4Y3O A;  5FFX A;  1W5C C;  1TNS A;  3ELK A;  3DU6 A;  5DUK A;  2G7U A;  2HNH A;  2L54 A;  1VQN I;  4E7Z A;  3BQY A;  3LFU A;  3I59 A;  2BHZ A;  4KJZ A;  1USS A;  3HGG A;  4C3I J;  5C44 J;  2BY1 A;  2GBY A;  3J7Z I;  1PP8 F;  1KQ0 A;  4KDP A;  4U0V A;  5E79 C;  2O3F A;  2UXN A;  5KVR A;  3L7W A;  4YIF A;  2BE5 F;  1UCR A;  2XIG A;  1ZKG A;  1T33 A;  1EA3 A;  2F4I A;  3CDH A;  4DJA A;  2QZ8 A;  3M8J A;  1IRG A;  1SMY F;  2VJ4 A;  3EUA A;  3D5L A;  4RGU A;  5AIP A;  3AAF A;  2QSG X; 
#chains in the Genus database with same CATH homology
 1FIP A;  3TW6 A;  2H1K A;  2JJ7 A;  2N8G A;  1BL0 A;  5F0H A;  1GV2 A;  3Q0V A;  1IG7 A;  3A01 B;  4DZJ A;  4W97 A;  2L7F P;  3JRD A;  1H88 C;  1TWC J;  1RET A;  5EEA A;  4MFE A;  4C2M J;  1U9N A;  2WB1 N;  3PO3 J;  2XB0 X;  5IOZ A;  3HOU J;  4JX5 A;  4IHX A;  2B63 J;  1IUF A;  2RAE A;  4M3F A;  5IP9 J;  1RPW A;  3H0G J;  1F36 A;  2Y30 A;  3WHB A;  4FE7 A;  2MG4 A;  2FX0 A;  3HKZ N;  3MKL A;  4C3J J;  3S15 J;  1F43 A;  1TC3 C;  4AYB N;  3OOU A;  2M0C A;  3S1R J;  1LFU P;  3E7L A;  2DA2 A;  3K2A A;  2JN6 A;  1ETQ A;  2K9S A;  2NVQ J;  4UUS B;  3HOV J;  1YRN A;  5FKM A;  3M4O J;  3JRE A;  2L7Z A;  5C3E J;  2OF7 A;  1AHD P;  3IH3 A;  4X6A J;  4V2F A;  4JX4 A;  2TRT A;  9ANT A;  1RES A;  4JP0 A;  3LNQ A;  3Q3S A;  3OSG A;  2XGD A;  2E2H J;  5M3F J;  4BBS J;  4FTH A;  2K40 A;  3BR3 A;  4MIM A;  3BR5 A;  1GVD A;  5EYR A;  3L1P A;  3GBG A;  3OSF A;  2EH3 A;  2R5Z A;  1IDZ A;  2LP0 A;  2E2I J;  3BG9 A;  5GP9 A;  2EBI A;  3B6A A;  3A02 A;  2L0K A;  2LLK A;  5DTD A;  4QIW N;  3RQI A;  1APL C;  1HDP A;  1D5Y A;  1Y1V J;  3BT9 A;  1XG1 A;  3FIS A;  4ABZ A;  3TP0 A;  1YRN B;  4A3G J;  2IEK A;  4UUT A;  5F0F A;  1FJL A;  2L7M P;  1SFO J;  1VI0 A;  4G12 A;  1MBH A;  3TED A;  2VKV A;  2JA7 J;  3LSP A;  5IYD J;  1B8I A;  3HOY J;  2R92 J;  2LTP A;  5DS9 A;  5IP6 A;  2IAI A;  2R5Z B;  1XS9 A;  1ETO A;  4A3F J;  1H89 C;  4MLO A;  2XRL A;  2X48 A;  4XK4 A;  1S7E A;  3BQZ A;  3JRC A;  2WAQ N;  2MSY A;  4BBR J;  1JT0 A;  2DA3 A;  3RZO J;  2HQ5 A;  3O8H A;  1Z77 A;  5IYB J;  1JT6 A;  3OIO A;  1I6H J;  1ZK8 A;  5F27 A;  2JK3 A;  3NAR A;  5FKK A;  5K7H A;  5EG0 A;  2EZI A;  2LK2 A;  1MH3 A;  3BG3 A;  2DMT A;  2EZK A;  2DJN A;  2XB5 A;  1G2H A;  1JTX A;  3RKQ A;  1B8I B;  3HDD A;  4L5E A;  4D5C A;  3UKG A;  4I6Z A;  2X9D A;  4D7M A;  1UHS A;  1H8A C;  4C3H J;  3D1N I;  2P81 A;  4HNV A;  2DA1 A;  1FTZ A;  2HXO A;  1WGX A;  3GTL J;  3ZQC A;  2ID3 A;  2Y0S N;  3CCY A;  2HOA A;  3FIW A;  3JRB A;  1GUU A;  1ETV A;  1TWA J;  3HEF A;  1DU0 A;  1HF0 A;  3BTC A;  3H3V K;  2IBD A;  4W1U A;  2W48 A;  1JUS A;  5JLW A;  2ELK A;  3BR6 A;  1MSF C;  3I4N J;  2CUE A;  4XID A;  5EG0 B;  2NOG A;  4RDU A;  2CQX A;  4Y52 J;  4XRM A;  1ETW A;  1E3O C;  1MH4 A;  1ETX A;  1ITY A;  3LSG A;  4IHV A;  1ZGW A;  1ETY A;  1JKR C;  2DMQ A;  2G0E A;  3A03 A;  1X2M A;  2QCO A;  4CYC A;  1OJL A;  5IOY A;  1QVT A;  2COB A;  5EGO A;  3Q0W A;  2VKE A;  2X6O A;  3PM1 A;  2Y31 A;  2VPR A;  2CQQ A;  3IH2 A;  1I50 J;  3QPS A;  2LD5 A;  2AHQ A;  2EQR A;  4BY1 J;  2HI3 A;  1POG A;  1IDY A;  3CQZ J;  1IV6 A;  2E2J J;  4I76 A;  4M3D A;  1VFC A;  1U78 A;  4X1E A;  2HYJ A;  3HOZ J;  3CDL A;  1JUM A;  4A3I J;  3S1Q J;  5IPA A;  1JTY A;  3LSR A;  1RKW A;  1P7I A;  1HDD C;  4M3G A;  3ZQF A;  4A3L J;  4MFD A;  3VPR A;  4J19 A;  1I3Q J;  4B1R A;  3CMY A;  4CYC B;  2O8K A;  2AO9 A;  2NS7 A;  5BNG A;  5E3N A;  5EGO B;  1ENH A;  1MSE C;  5F1J A;  5FKL A;  1ZTR A;  2JA8 J;  2R7Z J;  5F04 A;  2GM4 A;  1P7J A;  4A3B J;  3FK7 A;  2LY9 A;  2JWT A;  1TWG J;  2D5V A;  1U8B A;  5E3L A;  3BTJ A;  3TP3 A;  4DW6 A;  3S1N J;  3PO2 J;  1ZQ3 P;  3RZD J;  1JJ8 C;  1WPK A;  3SDG A;  2ECB A;  1OCP A;  1O4X A;  2MGQ A;  3TW7 A;  2NVX J;  3LOC A;  2CUF A;  2O9L A;  5FLV A;  3ZQG A;  2XPW A;  4D7N A;  1K61 A;  4IHW A;  4M3B A;  1UG2 A;  4FE4 A;  3S17 J;  1A6I A;  2R93 J;  1X2N A;  3IH4 A;  2K9N A;  1GT0 C;  3O8G A;  1BJZ A;  1HOM A;  1X58 A;  4LOC A;  5J1R A;  2DA6 A;  2KT0 A;  3W6V A;  4A3C J;  2DMP A;  3JRI A;  1Q1V A;  2ME6 A;  2HXI A;  1EF4 A;  2VI6 A;  4DZP A;  1WCM J;  2YS9 A;  1ORK A;  3S14 J;  1MBK A;  2DA5 A;  2JA6 J;  2WV1 A;  1MBG A;  1BW5 A;  2ECC A;  4NDL A;  2ME0 A;  1BW6 A;  2YUS A;  1CQT A;  3M3Y J;  4IHY A;  4A3J J;  2XGC A;  1NTC A;  3Q0U A;  4XRS G;  4XRS A;  3GTK J;  5IP7 J;  3JRH A;  5M5Y J;  4S0H B;  3HGY A;  5E3O A;  1RKT A;  2M9H A;  5GPC A;  3I4M J;  1ETK A;  1MNM C;  2E19 A;  4B3A A;  2NS8 A;  5M3M J;  5GPA A;  4AUX A;  5IYC J;  2M8G X;  1K83 J;  4A3E J;  3BTI A;  1WI3 A;  3HBL A;  2K9Q A;  1IRZ A;  5M5X J;  3JRG A;  1UMQ A;  3BTL A;  4QTR A;  1WH7 A;  3JRF A;  2PMZ N;  5F0C A;  1AU7 A;  2EZH A;  1JKP C;  3F0C A;  4BKX A;  2R5Y A;  2VUM J;  1RR7 A;  2JMW A;  3ZQL A;  5K7F A;  3B6C A;  1JGG A;  3DEW A;  4BXX J;  2FQ4 A;  1A5J A;  2DA7 A;  1AKH A;  2MW8 A;  1LE8 A;  5C4J J;  4FCY A;  3K7A J;  4A3D J;  3GTP J;  4JYK A;  5J1U A;  4M6V A;  1U9O A;  2CU7 A;  2LR8 A;  5EZG A;  3S2D J;  1HLV A;  3QPL A;  2XGE A;  4FIS A;  4DYC A;  3DCF A;  3JR9 A;  2ID6 A;  2ZB9 A;  2LKX A;  4DYR A;  2NVY J;  3IV5 A;  1ZR4 A;  5E3M A;  1IGN A;  5C4X J;  1QRY A;  3G1M A;  4AC0 A;  3BR2 A;  2O7O A;  3SJM A;  5JLX A;  2M2E A;  2I10 A;  2L9R A;  5FKN A;  1JJ6 C;  3MN2 A;  1FIA A;  4MO7 A;  2Y9Z A;  2CRG A;  5K7Z A;  4IEJ A;  2H8R A;  4GFB A;  4QSH A;  3GTM J;  3HB9 A;  4Y7N J;  3GTJ J;  2R5Y B;  1VND A;  1W0U A;  3ZOB A;  3JRA A;  2DA4 A;  1NK2 P;  2LVS A;  5EZH A;  3QQA A;  3S2H J;  1AKH B;  1LE8 B;  2OPT A;  5F08 A;  1B72 A;  4RBO A;  1MBF A;  4A3K J;  3GTO J;  3GTG J;  1LFB A;  1R9T J;  4A69 C;  3G1L A;  2LFB A;  2YU9 J;  1HCR A;  2DTZ A;  1W0T A;  1QPI A;  1VF9 A;  1MBJ A;  3FKI J;  1Z0X A;  2CJJ A;  4D5F A;  5FKO A;  3C2B A;  2FJ1 A;  1T56 A;  3S16 J;  2XPU A;  5EDN A;  4M3E A;  4B4C A;  1DU6 A;  5HOD A;  2R0Q C;  4A93 J;  3WHC A;  3HOX J;  2QF7 A;  4A3M J;  3ZQI A;  1XC5 A;  2XSD C;  3LSJ A;  3BG5 A;  4DYQ A;  1JKO C;  3FK6 A;  4BY7 J;  1OFC X;  2DMN A;  1SAN A;  2M34 A;  1TWF J;  5J3L A;  3SFI A;  2GLO A;  5FJ8 J;  1B72 B;  1BA5 A;  1IC8 A;  1PUF A;  2DMU A;  2EZL A;  3MVP A;  2JA5 J;  3BR1 A;  1WH5 A;  1QVU A;  1NK3 P;  2HDD A;  3ZQH A;  2Y9Y A;  1ZR2 A;  3G1O A;  1TWH J;  2Y2Z A;  1GV5 A;  5M5W J;  1FEX A;  2TCT A;  2XPV A;  4V2G A;  2HOT A;  1JUP A;  2NVT J;  3GTQ J;  2FD5 A;  1IJW C;  5FLM J;  1GDT A;  4XIC A;  5EF6 A;  3A01 A;  3HOW J;  1MBE A;  3S1M J;  5J1Y A;  3BQY A;  1Y1W J;  3HGG A;  4C3I J;  3BR0 A;  5C44 J;  1PUF B;  2GBY A;  1JKQ C;  2DN0 A;  3HM5 A;  3NAU A;  1ZKG A;  1T33 A;  1OCT C;  2KDZ A;  2E1O A;  1FTT A;  4EEF G;  4UUS A;  4JX6 A;  2HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...