1EF4A

Solution structure of the essential rna polymerase subunit rpb10 from methanobacterium thermoautotrophicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
MIPVRCLSCGKPVSAYFNEYQRRVADGEDPKDVLDDLGLKRYCCRRMLISHVETW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Zinc-bundle structure of the essential RNA polymerase subunit RPB10 from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transferase
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2000-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ef4A00
4XIDA 1FIPA 5FKNA 3OIOA 5K7HA 3ZQCA 2O8KA 1HDDC 2EZKA 3SFIA 2GBYA 2R5ZB 3QPLA 5K7FA 4IHYA 1JJ6C 4M3DA 1ETWA 1IDYA 2JN6A 2WV1A 3C2BA 1RPWA 5C4XJ 3W6VA 5M3MJ 2R93J 3HOYJ 3H3VK 4MLOA 4XK4A 4M3FA 3PM1A 4UUSB 9ANTA 2DTZA 1HF0A 4LOCA 1ZK8A 2E19A 4D5FA 1JGGA 2VI6A 1UMQA 1I6HJ 2WAQN 4C3HJ 2HOAA 2XPVA 1DU0A 3BR1A 1TWAJ 2FD5A 1H89C 4A3EJ 5F04A 1JJ8C 2CQQA 3NAUA 1SANA 5E3NA 3S1NJ 1ZKGA 4IHWA 1EF4A 2MSYA 2ZB9A 5FLMJ 4JX6A 2LTPA 4AUXA 4IHVA 2DMPA 2EZLA 2ECCA 1OCPA 2JA7J 3OOUA 1SFOJ 1E3OC 2DA1A 3RKQA 2EZIA 1ETYA 5EZGA 1ZGWA 2X48A 2RAEA 3Q0WA 5BNGA 2MGQA 3BTJA 2R92J 5EEAA 2DA3A 1TWFJ 3LSJA 1A6IA 1FIAA 5J1UA 1BW5A 1X2NA 2ME6A 1W0UA 3HOWJ 4MFEA 3FKIJ 1AHDP 4DYQA 4A69C 3G1OA 2O9LA 2DA5A 2E2IJ 1MSEC 4W97A 3CDLA 1IDZA 3PO2J 4FCYA 2KDZA 3CQZJ 2NS7A 2M0CA 1WPKA 4M6VA 5DS9A 3CMYA 3F0CA 4MFDA 2LP0A 2XB5A 4D7NA 3A01A 1B8IA 1MH4A 1B72A 3E7LA 4B1RA 2ELKA 3JRHA 2XB0X 1X2MA 1LE8A 3JRBA 4B3AA 5FKOA 1Q1VA 4D5CA 4JP0A 3G1MA 2DA4A 2K9SA 3K7AJ 4XRMA 3JRAA 2JK3A 2TRTA 2AHQA 1IV6A 2M34A 2FJ1A 4C3IJ 1GV5A 3QPSA 1HCRA 3GTQJ 3L1PA 4A3DJ 1VFCA 2HXIA 3FK7A 4DYRA 5JLWA 2Y31A 5J1YA 5EGOA 2W48A 2R5YA 4A3GJ 1UG2A 5IPAA 2LKXA 3QQAA 3JRCA 1S7EA 1JUSA 1RESA 4M3GA 2R0QC 2M9HA 5HODA 4XRSA 2LD5A 1JTXA 1WH5A 5GP9A 5FLVA 1HOMA 3HBLA 2JMWA 1H8AC 1GDTA 5IP9J 3FISA 1LFUP 1BA5A 5M5YJ 4FISA 3S14J 3A01B 1B8IB 3SDGA 2HYJA 2L7FP 2LR8A 1B72B 2XGDA 1MBKA 3TW6A 5M5WJ 4ABZA 1LE8B 1MH3A 1AKHA 1U9OA 2KT0A 3BG5A 2IAIA 1Z0XA 5EYRA 3ZOBA 2FQ4A 2E2HJ 2LK2A 5GPAA 1RR7A 1BW6A 3BQYA 3BR2A 3VPRA 4MO7A 1ZQ3P 3IH2A 3D1NI 2N8GA 3BG3A 2DMQA 5EGOB 2VKVA 2R5YB 1T33A 1IG7A 3NARA 3A02A 5FKLA 2Y9ZA 2JA5J 4HNVA 4A93J 2CUFA 2QF7A 2NS8A 1ZTRA 4C3JJ 4DZJA 2HOTA 3S16J 1U8BA 1ETOA 4B4CA 4W1UA 2DMNA 2P81A 4X6AJ 3JRDA 2K9NA 1ORKA 2XPWA 1OCTC 2IEKA 2H8RA 5EF6A 3H0GJ 1IRZA 2K9QA 3MKLA 1NK3P 1O4XA 3HOVJ 1AKHB 3TP3A 1K61A 2VUMJ 1JKPC 1WI3A 3FK6A 3G1LA 2ME0A 1UHSA 2EBIA 1CQTA 3HEFA 4AYBN 4CYCA 2NVQJ 2TCTA 4FTHA 4XICA 3WHCA 3O8GA 4FE7A 2L7ZA 1Y1WJ 3I4MJ 3HB9A 2XPUA 1FTZA 3GTOJ 2HI3A 3ZQHA 3FIWA 3JR9A 4MIMA 1APLC 2Y2ZA 5FKKA 1QRYA 2DMUA 5F1JA 1JT6A 2DA6A 1VF9A 3S1RJ 1XC5A 1OFCX 3BTCA 3GBGA 5F0FA 3B6CA 3S2DJ 3HOZJ 1JKRC 2YUSA 4DW6A 2G0EA 5IP7J 3HOXJ 4A3LJ 3GTMJ 1OJLA 2LFBA 1ETQA 5F0CA 2NOGA 1BJZA 2IBDA 2NVYJ 1YRNA 2CJJA 4I6ZA 4NDLA 4BY7J 1RKWA 4JYKA 4A3JJ 4L5EA 2QCOA 3OSFA 3BT9A 2XGEA 2DN0A 1JTYA 1JKQC 3IH3A 1LFBA 2LY9A 4CYCB 2PMZN 1JT0A 2YU9J 4I76A 2MW8A 1NK2P 1WH7A 4UUTA 2JA6J 2DMTA 1ZR4A 3M4OJ 4BY1J 1T56A 3Q3SA 4X1EA 2EQRA 2HXOA 2K40A 1DU6A 2D5VA 1BL0A 4M3BA 2XSDC 2L0KA 3A03A 3Q0VA 2OPTA 4Y52J 1HLVA 4JX5A 1GVDA 3GTLJ 2E1OA 3BR0A 4A3CJ 2DJNA 2AO9A 3IH4A 5EDNA 1WCMJ 2WB1N 3WHBA 4A3IJ 3S15J 2LVSA 3GTJJ 3OSGA 1ZR2A 1MBFA 1PUFA 3TEDA 4A3MJ 1D5YA 3DEWA 4RBOA 3RZOJ 1ENHA 5FKMA 5IYDJ 1YRNB 1AU7A 1ETXA 2COBA 1JUPA 2EH3A 2VPRA 4JX4A 2NVXJ 4AC0A 4V2FA 4EEFG 4A3FJ 2GM4A 4BXXJ 3BG9A 5IYBJ 3BTLA 1ITYA 3BR5A 4J19A 3JRFA 4QSHA 5J3LA 5E3MA 2X6OA 1GUUA 1IUFA 2JWTA 4BBSJ 3LSRA 1NTCA 2JA8J 2OF7A 1I3QJ 4IHXA 3I4NJ 1IGNA 3ZQIA 5F27A 1TWCJ 2XGCA 3LNQA 3S17J 1MBEA 2Y30A 1RKTA 2B63J 2EZHA 4V2GA 1GV2A 1Z77A 5K7ZA 4IEJA 2CUEA 3HKZN 3BQZA 1ETKA 1JUMA 5M5XJ 3ZQGA 2M8GX 2HDDA 3BTIA 1P7JA 3BR6A 3JRGA 1PUFB 3JRIA 1MBJA 4D7MA 1A5JA 1X58A 3M3YJ 5J1RA 1G2HA 4BKXA 3O8HA 3HM5A 1IJWC 2GLOA 1VNDA 2HOSA 1XG1A 4S0HB 1MBHA 3K2AA 1TWHJ 4XRSG 3TW7A 2O7OA 2JJ7A 1FTTA 2NVTJ 2X9DA 1QVUA 2L9RA 2MG4A 4DZPA 1VI0A 2HQ5A 5IYCJ 3UKGA 1TC3C 3S1MJ 3JREA 3LOCA 3S1QJ 5C3EJ 3CCYA 4DYCA 1MSFC 1R9TJ 5E3OA 1IC8A 5DTDA 1F36A 1QPIA 1I50J 4A3KJ 1MBGA 4M3EA 5EG0A 1W0TA 3DCFA 5C44J 1Y1VJ 2E2JJ 3LSGA 2DA7A 3ZQFA 3BR3A 2CU7A 4A3BJ 2ID3A 3HGYA 5IOYA 1QVTA 1GT0C 2Y0SN 5EZHA 1U78A 3Q0UA 1WGXA 3MN2A 3RQIA 3ZQLA 3HOUJ 2YS9A 3S2HJ 3LSPA 1FEXA 1P7IA 5FJ8J 4RDUA 3RZDJ 1FJLA 1U9NA 4FE4A 2R5ZA 3SJMA 3HGGA 2LLKA 5IP6A 1H88C 2FX0A 3GTKJ 5F08A 4Y7NJ 3HDDA 5JLXA 2CQXA 5E3LA 1MNMC 2Y9YA 4GFBA 1K83J 2R7ZJ 1F43A 2L7MP 5GPCA 3B6AA 3MVPA 3GTGJ 5C4JJ 2M2EA 4UUSA 1HDPA 2DA2A 3IV5A 3TP0A 1JKOC 5EG0B 2H1KA 2CRGA 1ETVA 1POGA 4BBRJ 2XRLA 4QTRA 2I10A 2VKEA 4C2MJ 1TWGJ 3GTPJ 4G12A 5M3FJ 5F0HA 2ID6A 1RETA 1XS9A 4QIWN 5IOZA 2ECBA 3PO3J
chains in the Genus database with same CATH superfamily
3G3ZA 5FKNA 4XIDA 2KZGA 1KU3A 2R5ZB 1LNWA 4IHYA 1JJ6C 2GXGA 3WE2A 2G7UA 4M3DA 4BJ6C 1SMTA 4UVCA 2QBYB 2X6XA 2AXTC 4A12A 3L2WA 4HDUA 5HDGA 3QP5A 2JN6A 1P4WA 4Q47A 4J01A 3C2BA 1RPWA 1S5LC 2VBXA 2R7TA 3LMMA 4NB5A 1YJNI 2B9SA 3HOYJ 3I58A 5JVGF 2VKDA 3SZTA 3PM1A 4N9IA 3SFZA 3BCBA 1P4AA 1MGTA 3ML6A 2F5CA 4KYWA 2L02A 3K9TA 4GO1A 1Y56A 3GUDA 1S6LA 3HSFA 4D5FA 1X1CA 3QOPA 3CLQA 3VOEA 3FXMA 2X1DA 2XPVA 4XOTA 2DTRA 3BR1A 3QODA 1S7AA 3WGHA 1YX3A 3H5AA 2VBWA 3I64A 5F04A 2JUCA 5J8FA 5DDGA 1KA8A 1L0OC 3TKYA 1R36A 2ETHA 2K3PA 4IHWA 5K1YA 2MSYA 2ZB9A 1OCCH 1HA8A 2ZJ2A 1U0JA 3GZ6A 1Y8QB 3D5LA 4AUXA 4MGRA 3L2UA 1U6GA 2ECCA 5CQGA 2ZSHB 1D0XA 3AAFA 1SFOJ 4QWQA 5LBQA 3L9FA 4NC6A 2RAEA 5BNGA 3WGIA 2MGQA 1G3WA 1L3LA 3EDPA 2P4WA 2P5VA 2XASA 3NWSA 3BWGA 4OAYA 3RPUA 4U7DA 4CHUA 2M8EA 2E5NA 2JVGA 4A69C 4N0BA 1ZARA 2CSOA 1MIJA 2DA5A 2XF7A 1T0FA 1XMKA 1IDZA 4L9TA 5ICFA 2KDZA 3DTIA 3K4MA 2QVOA 4DBRA 3L2RA 1S9HA 2DT7B 3FMRA 4M6VA 2STWA 3CP2A 1SD7A 1G3TA 4UV9A 3F0CA 3LSMA 4MFDA 3TQNA 3K4NA 4D7NA 3QYBA 5FRNA 1R1TA 2BY3A 3A01A 3A1YA 1B72A 4F55A 3MZYA 1XGSA 3QOEA 4ZJZA 2YX7A 4IX7A 1IN8A 2HVQA 1XSXA 3AG2H 3GLLA 4HV6A 4BAYA 4BHCA 4D5CA 3R60A 1T08B 4JP0A 1ZYRF 2K9SA 2NAZA 2DQRA 3JRAA 2H6CA 1QU3A 2LKSA 2JVHA 1BIBA 1T39A 2JQ7A 2BW3B 2MC3A 1HCRA 3GTQJ 1OCRH 2GOXB 2HXIA 4HLYA 5BPDA 2Y31A 5EGOA 2W48A 2R5YA 3FBNB 4A3GJ 1UG2A 1ZG3A 4P5OA 2Y0MA 2BVLA 3JRCA 5HS7A 5HODA 4XRSA 5LHGA 1E0EA 1DPRA 3OIQA 2EIJH 2KIMA 3HBLA 5KHDA 1HOMA 3FKJA 3N05A 1HW1A 5IP9J 1GDTA 3PFIA 3PNYA 4AYBA 1BA5A 2DLLA 2JSPA 3E0JB 1W7PA 3CO6C 2L9SA 1B8IB 5CVVA 3P9CA 2HYJA 2LR8A 3F72A 2DFFA 3TW6A 5HDKA 2Z3YA 2ELJA 5EJCA 2HPIA 2KT0A 2ZXJA 3MD2A 2FA5A 2KRCA 3Q9VA 1Z0XA 3ZN0A 2L54A 5D6EA 1O7FA 2XROA 1RR7A 3MMYB 4L9JA 5J4YA 3HRUA 3IH2A 3L7WA 2X4HA 2FU4A 3LAPA 3M8EA 1VQ8I 1R5HA 3BG3A 1SFXA 2DMQA 1USTA 4G7OF 3WU0A 4HF2A 2FBHA 4L0YB 1N75A 4HX8A 2LF8A 1VQNI 4HNVA 5DD8A 4A93J 2NS8A 1GVJA 1ZTRA 4RS8A 4DZJA 5LRRA 2LYCA 4G6TB 1KU9A 3AG1H 3KP5A 3S16J 4NC8A 1U3EM 3JAMZ 1U8BA 4U0WA 1ETOA 4B4CA 4ENJA 1HC8A 2Y48A 3FM5A 4HOBA 3DWLE 4KN7X 2H8RA 1ZREA 5EF6A 2K9QA 4KMFA 4N9HA 1K78A 1Z3YA 4F3QA 3QU3A 3GXOA 3DBRB 1XDSA 3MKYB 3OYBA 1J0RA 3AG4H 2DW4A 3HEFA 4YIIA 3Q9SA 4AYBN 3PFYA 2NVQJ 3T5XA 3RYPA 1SMYF 5HLIA 2QQAA 3CCMI 4XICA 1W7PD 3WHCA 2L9NA 3O8GA 4FE7A 2V9KA 3H1CA 3R61A 3W6JB 5D8KB 1LVKA 5LD2C 4CICA 3X2QH 4JK1X 2G7HA 1WJEA 5EEGA 3DF8A 5KAIC 1QRYA 3U2RA 2DA6A 3KP7A 1OMIA 3K70D 1XC5A 2VC0A 3M7GA 4HV5A 1J59A 2E35A 3LA7A 5F0FA 1ZGJA 3B6CA 2NRAC 3OOPA 4DW6A 4PGGA 4S04A 2G0EA 2K9LA 2ISYA 1Y0UA 5JFRA 1TP4A 3ULQB 2EA2A 5IT9Z 1WJ5A 1BJZA 3KEQA 2K7LA 2LBFA 2WV0A 3ZQQA 4BDYA 3W3CA 2CJJA 4NDLA 2PLYA 2CO5A 2XAUA 1RKWA 4A3JJ 2QCOA 2WADA 3OSFA 3HOTA 3AL0C 1X3ZB 2DOFA 2DN0A 1JTYA 2MABA 2O3FA 3NEUA 3IH3A 4CYCB 2LY9A 4YRVA 2VOPA 2YU9J 3WG7H 2R7OA 5LHIA 2L3DA 1WH7A 4O5VA 3BOQA 3CP8A 3LSIA 4RLQA 4UUTA 4XM3A 2FNPA 3QAHA 4WK8F 1ZR4A 1UAAA 2W24A 4BDZA 5TGTA 2FSWA 2K40A 2VPLA 3OL3A 3FXRA 3L09A 1U5TC 4RB3C 4MTDA 1VTNC 2MYSA 1JHHA 4ETSA 3RSNA 3K70C 2R7FA 3CCEI 3J80Z 2H1LA 2RNJA 2Q1ZB 5LGUA 1TTYA 4A3CJ 4ESJA 2OZUA 3IH4A 1LJ9A 1WCMJ 4NQWB 1V54H 2LVSA 3LSTA 5K5OA 2VT3A 4XR6A 4XLPF 3I53A 5HLTA 3GZ5A 2CS3A 2MLKA 3DTEA 2F4OB 3P7NA 1R00A 5IYDJ 1OPCA 1ZLJA 3JSPA 2JUGA 4OWRB 2ZXWH 3S3MA 1VQ7I 3GW2A 4XKWA 4XONA 5ILSA 2VPRA 2HU9A 1YHQI 2GM4A 4V2FA 3GF2A 5DD4A 2ZCWA 4BXXJ 5H6RA 3OWTA 3DU6A 3E6CC 5E17F 1I6XA 1ITYA 1G3SA 2V1UA 3MKZA 4J19A 5E3MA 2IS6A 4KIBA 1H9GA 2HNHA 1T6SA 2JWTA 4PFPA 4KDPA 2WAFA 2OD5A 3DU5A 1NTCA 2JA8J 2OF7A 3I4NJ 2QM3A 1IGNA 2O0YA 2VBYA 3ZQIA 2MFZA 2XGCA 3FXUA 2I8DA 1RKTA 3DXJF 3MZ8A 4A5MA 4V2GA 4LB5A 4ZZDA 4IL6C 2W4SA 2PMZA 1YE9A 2IPQX 3OYIA 2PX9A 3SEZA 2ZKZA 4B8XA 1FOXA 3OYFA 3V7RA 1Z7LA 4YEJA 5BQTA 1HXDA 2M7AA 3LAJA 1R6RA 1A5JA 2OU2A 1R1UA 3LQQA 4JBAA 4PGHA 5D6FA 3ZMSA 5HNFA 3T0YA 5ICCA 5DUIA 5J1RA 1D8JA 1G2HA 2IP2A 3O8HA 4BU2A 3PL8A 1A31A 5E1WA 1Z9CA 1DP3A 4KIFA 4RLFA 2KRFA 2LMDA 3JTHA 2FUG2 4IRIA 1VQLI 1XG1A 4ESFA 1FSEA 1YS7A 3TW7A 4OAZA 4BHPA 2O7OA 2L9RA 4ZC3A 3GCMA 4DZPA 2CV1A 3S1MJ 2XUBA 3RTRA 3L2CA 1B4AA 1R4NB 3LOCA 3REOA 4AM3A 4CA0A 2QENA 3QYEA 1KQ8A 4UVAA 2E71A 3F22A 1RR8C 1F36A 4FX0A 3TO7A 3K1PA 4HEA2 1RZ4A 4M3EA 3ERED 1FYKA 1W0TA 1BJAA 5GAEJ 1F9NA 3LFUA 4JOMA 3BR3A 2CQ7A 5KCMA 4CXFA 1EJ9A 4EGYA 1J75A 4A3BJ 1Z7UA 1OISA 1MDMA 3O6BB 1Z91A 4AVPA 3Q0UA 3MN2A 3RQIA 3C2GA 1LPQA 2M0MA 3RZDJ 2TDXA 2W7NA 1U9NA 3KP3A 2H6BA 2M5WA 1LQ1A 4BXUA 1FBUA 1RI7A 2DU9A 3SJMA 3ECHA 1Z67A 2WBMA 2LLKA 5CPRB 1XCBA 2RGVA 2FX0A 5CVUA 4U7BA 3GTKJ 1DGWY 1BI3A 2LC2A 5E3LA 1ZRCA 1R71A 1LDKB 2VE9A 3P9IA 2EJRA 3H9QA 4LIUA 4RAZA 2HS5A 2CFXA 1O57A 3MVPA 5KK1A 1FOKA 4EJTA 2M2EA 4UUSA 3A0BC 5L3BA 3LA3A 5BS6A 4M6XA 2F4IA 3K69A 1ODDA 2CRGA 4KT5C 2ZMEA 3GO5A 3SQNA 4BBRJ 4ENMA 1IV8A 2HVSA 4C2MJ 1YLFA 5CJ9A 4RM2A 2WY7Q 5M3FJ 1HW5A 5B1BH 1FPQA 5F0HA 1HW2A 2ID6A 4FASD 2L4AA 3DFGA 1X3WB 5AONA 3PO3J 3CC4I 2VLAA 2NOJB 4LK0F 4PCQA 5K7HA 3ZQCA 2E60A 3K4BA 4H4KC 3U1KA 2ZJQF 1X1BA 1SVLA 2FNAA 4LK1F 4R8HA 4B09A 2VQLA 1JGSA 3VDXA 1IDYA 2E1CA 3F8BA 1OKRA 2Y0SA 3PQJA 1WJDA 1DP7P 3ASNH 5C4XJ 3W6VA 1UELB 3WU2C 4KA4A 3DKYA 3H3VK 3W2VA 1LUJB 3CJNA 2QSFX 1F5TA 9ANTA 3B73A 1FT9A 4BH9A 2DTZA 4IOCF 2MD5A 2M87A 2MH2A 2E19A 3M8FA 1UMQA 3MWMA 1I6HJ 2HOAA 1K4TA 1TWAJ 4YELA 1PJRA 4IO9F 5D5XB 3RDIA 2LREA 2DFEA 5HOOA 2CQQA 3OY9A 5IY5H 4ZTJA 1EF4A 2CW8A 5FLMJ 2L9VA 4JX6A 3KEYA 5L3EA 4P55A 2M4KA 1NK2P 2DMPA 1O7LA 1OCPA 2DFIA 2JA6J 3KFWX 1MMNA 2GA2A 3CUQA 4G94A 1E3OC 2DA1A 4ZYHA 1NG7A 1EH7A 3CMAI 2BOLA 2EZIA 3HSRA 1ZGWA 2CWEA 2IGMA 3AKZA 2VJIA 3VYTB 3CJRB 2YU3A 4ENKA 1A6IA 3RQ4A 5B5EC 1BW5A 2OCCH 4D1QA 1W0UA 3HOWJ 4MFEA 1YIJI 4BEHA 2M3AA 1UB9A 3G1OA 4NNJA 1RRJA 3FZVA 2BV6A 2VKHA 3EUHC 3F8MA 1WVRA 1MMAA 2VE8A 5KAFC 1FP2A 3U21A 4UB6C 3CCUI 3L2QA 3TO6A 3ASOH 4BL0B 2BYVE 2V6EA 2XB5A 3VYUB 4B48A 1BOAA 1I5ZA 3KCCA 1HSJA 1BR1A 3DLAA 2ZMEC 1A04A 2B0LA 1LE8A 4BYYA 3DBHB 1QHGA 5H20A 1QO0D 2LNBA 3GEZA 4UVBA 2VQGA 1GXPA 1FSHA 3SEQA 5JVTA 1BI1A 5FLXZ 2CUZA 3HIFA 3PSFA 2FJ1A 2IS4A 1D1CA 1J09A 1X19A 1T2KA 3I5UA 3L1PA 2GA1A 4UHTA 1KQ9A 4O3MA 1B59A 3QYFA 2L7KA 1W1WE 3D0SA 1TT5B 5IPAA 4BJ5C 2HTSA 1JUSA 1RESA 1V55H 4M3GA 2VN2A 2R0QC 3KIOA 4EVIA 3ZMTA 4LG3A 1WH5A 5GP9A 3E6DA 2JMWA 3RCOA 2E1MC 2IJLA 4ZDOA 2KP6A 5HNHA 4E7LA 3BROA 2XGXA 2M30A 3CCSI 2QKMB 3A01B 4HQEA 1B72B 5LGNA 3H35A 1AKHA 4CCJA 3HHHA 5EYRA 1ZGAA 5TJJA 2LK2A 1B6AA 3TOBA 1WZ2A 2DDAA 3RI4A 5GPAA 3FXKA 4J00A 2VJ5A 3NWTA 3BPVA 3BR2A 3VPRA 2BXZA 4LB6B 2EIMH 1G6NA 2N8GA 2DT6A 1I39A 4HSRA 2LDUA 4ENNA 3DPUA 1JXSA 3VYSB 5EGOB 3SXYA 2R5YB 1PP7U 1T33A 1IG7A 4M74A 3A02A 1YIOA 1FMVA 1T8IA 4E7JA 4H0EA 4ZYEA 2JSCA 3CUQC 3K1NA 1ULYA 3VWBA 2H8WA 1BI0A 1OCZH 1FP1D 1TNSA 3BJOA 4W1UA 3K6GA 4IQJA 2W00A 4OMYA 4X6AJ 3ZPLA 1ORKA 1X1AA 2ESHA 3HC7A 4DJAA 1YI2I 1MNDA 1W7PB 3KP4A 2HQAA 3H0GJ 1IRZA 2OBPA 3HZJA 4HYEA 1YQAA 4RMNA 1T38A 1ONVA 3HOVJ 1U5TB 2Z16A 4G6QA 2UXNA 3KX2A 4PFOA 4CUGA 4EGZA 1RUOA 2RKHA 1K61A 2VUMJ 5D4SA 1JKPC 2GWRA 2ME0A 1D1AA 5L3CA 1UHSA 1CQTA 2FBKA 2Z1DA 2XF5A 5K5QA 4IZZA 2DK8A 2E7WA 2WB1A 4FTHA 1BBYA 1HKTA 3BZKA 4ZDPA 1Y1WJ 3I4MJ 3DQVC 3HB9A 2O61A 1FTZA 4I7HA 1UCRA 1KU2A 1W5TA 3FIWA 5A2QK 1LFPA 1REPC 2Y2ZA 5ERIA 4L0ZB 1MZBA 5F1JA 5K5RA 1WWXA 2KJCA 3ROUA 5LLQA 3FXJA 1TW3A 2R7QA 2X6WA 4E6KG 3F9KA 3GBGA 4BE1A 4IVNA 4Q48A 1MJBA 3HOZJ 1IAWA 4LFUA 4OOIA 3BG6A 5E8GA 3V7CA 3MKWB 4GYIA 4HQMA 3WTWC 3C3WA 1HQCA 3HRSA 2E34A 5F0CA 1QGPA 3I9V2 3I56I 2NOGA 1K78B 1Q1HA 3GFJA 4PJLA 2IA2A 2IGOA 4G7HF 4ZTFA 5FFXA 2XIGA 1N77A 1YRNA 2YSRA 2BHYA 2QQ9A 3GYHX 1P9QC 1IRGA 2K3FA 4JYKA 3MZHA 4C30A 2JT1A 3BT9A 4BACA 2HZTA 2XAJA 1LFBA 2P0WA 1SC7A 2DPUA 1D1BA 4IKFA 4WXDA 2ICWG 1J5YA 1O3TA 2VQCA 2XSJC 1DU6A 1B9NA 2D5VA 4P1WA 5J4VA 2VT2A 3IKVA 4Y17A 1BL0A 4M3BA 4PDKA 1ZAOA 2DPDA 1FMWA 3FHNA 1F4KA 2PEXA 4Y52J 2DFHA 2CQNA 2IXSA 2VXDA 3OYCA 3TGNA 2VXZA 4A3IJ 4Y13A 5EDNA 2WB1N 3S15J 3IUOA 3WTZA 4PZJA 4RAFA 4XNFA 1PUFA 4YFXF 3OYDA 1SVOA 3V4GA 3TEDA 1U5TA 2RQQA 2VASA 2LBFB 1ZRDA 5E18F 5FKMA 2KISA 3ZP5A 2HDWA 3GZNB 4BHBA 2EH3A 4UXNA 4HNTA 4YIFA 4HSTA 4RB2C 3V7SA 3ZRGA 4JX4A 4ZYAA 4BJTA 4A3FJ 2HZDA 4L5IA 1ON2A 3JRFA 1ZRFA 5J3LA 1GUUA 4IHSA 5CVRA 3WU1B 4EM2A 4LG0B 4E7SA 3J7YJ 3KETA 3LSRA 4XQFA 1GLNA 2R7VA 4HF1A 4AIJA 3S3OA 1MBEA 3OS1A 4IXAA 1XCVA 3HSEA 1K7AA 2DCEA 5DCMA 4OIQF 5K7ZA 4IEJA 5DYMA 3HKZN 1ETKA 3LL7A 5CVIA 4B47A 2V1DA 3ABMH 2IA1A 3H9GA 3BR6A 3PJRA 1OLTA 4FT8A 4D7MA 2PJRB 4GRIA 1DPUA 1VQPI 3S3NA 4Y15A 2LH9A 2XKOA 2GIZA 2V1XA 1IJWC 3VSLA 4ZDLA 3IAM2 2LOOA 2V9VA 1MBHA 4XLCA 1MJ9A 4WWCA 1TWHJ 4NBQA 1WKMA 2Y75A 5HDNA 3I71A 2W57A 3V42A 3OYLA 2DQLA 1QVUA 2MG4A 1VI0A 2HQ5A 3EPZA 5LEKA 4RGUA 5C3EJ 1QZYA 1FC3A 3PUBA 4DYCA 4II3A 1MSFC 1R9TJ 1R1VA 3T8TA 1IC8A 5DTDA 4CCLA 2EFWA 1I50J 1MBGA 1MW7A 3M9AA 4U0VA 4DIQA 1S72I 1BC8C 5EG0A 3KYCB 5C44J 2P7CB 3OR2C 2K27A 4A2UA 1OYIA 1U2WA 1TZLA 1QZEA 1SFEA 2ID3A 3HGYA 1RNLA 4F91B 3M1EA 2BY0A 2QYOA 1YG2A 2OZ6A 1YJWI 1BI2A 1GT0C 3CCQI 1STZA 3OYHA 2F5DA 2VJ4A 1U78A 1WGXA 1FNNA 3J81Z 1CGPA 2YS9A 1P6RA 1TQMA 3ABTA 4HNUA 4I99C 2AQFA 1WRJA 4HPQA 4CZZA 2CYYA 4DQ2A 4CH7A 2FOWA 1LDJA 5IP6A 1H88C 2LKPA 5F08A 2D45A 3HDDA 3CD6I 4LG0A 1R23A 1E17A 2HOEA 2WAQA 3C18A 3OYGA 4IJAA 1T98A 1WI9A 4ON0A 2ZFWA 3IHUA 3CO7C 2R7ZJ 1F43A 3IP4B 1OCOH 1WJBA 5EEHA 3GMEA 2EPFA 2HKXA 4Y33A 5HS8A 4KN4X 3D5SC 1JKOC 1VQ9I 2F5FA 5ILVA 3WG9A 1W4MA 3CCVI 3JSOA 1ETVA 3DLLF 2QEXI 1W36D 3CDIA 1HBXG 2XRLA 3H3UA 2PJRA 2VKEA 1JHFA 3Q5FA 1V5FA 4G12A 2OV7A 2KIQA 5JR3A 2BGCA 4LD5A 1MDMB 2W82A 2X1EA 3CUOA 2EIKH 3BJAA 4HX4A 5IOZA 1NHAA 3AG3H 3WTYC 2HQRA 4GCVA 3P5JA 1FY7A 3IC7A 4E7HA 2EZKA 3SFIA 2MH9A 5K7FA 1A6QA 1IN4A 5FD5A 1ETWA 2WAEA 4CCOA 2OQRA 4MEXF 3QU6A 4Z6YA 1TNTA 4BUPA 5CLSA 3CJTB 5M3MJ 2HVRA 1O3QA 2R93J 3OYJA 3HXLA 4CCKA 4MLOA 4XK4A 4CGZA 4UUSB 2ZNYA 2R7RA 2EV5A 3F6VA 5DCFA 1NH3A 1AA7A 2IW5A 2B7EA 1XB4A 2JZYA 4LOCA 2ZMEB 1ZK8A 2A6HF 4MTEA 2CG4A 2NXNB 1W36C 3F8NA 1H0MA 1JGGA 2VI6A 2DT5A 1QNTA 1BN5A 3LWFA 2WAQN 2F2EA 3W2WA 1DU0A 3B02A 3CTAA 4IQ4A 1XTAA 1EH8A 1XMXA 2FD5A 1G8XA 1H89C 2OC6A 4BNCA 4A3EJ 4D9JA 3SHFA 2IA0A 3NAUA 1IN6A 1SANA 5E3NA 4G7ZF 3S1NJ 4DOZA 4IRHA 2G9WA 2RN7A 3E6BA 5IT3A 4QPOA 2VOOA 5E1ZB 1FWZA 4IHVA 3KP6A 2BBYA 2UV1A 1XGMA 3KLOA 4L5JA 2A6TA 2CGPA 3FHZA 3RKQA 5D4RA 2X48A 3Q0WA 2PMUA 4CO8A 1J7KA 3BTJA 2R92J 2DA3A 5J1UA 3OS0A 3QRFF 1X2NA 2ME6A 4ZYGA 3UR3C 3DBLB 3FKIJ 3FXLA 1YJ9I 1LEAA 2X0LA 2Q8KA 3BCAA 4RAGA 2ZBKA 2XKPA 1MMDA 1QZZA 4W97A 1MSEC 2E2IJ 4DGWB 1LB2A 3JW4A 2ZNZA 4BQOA 4FCYA 1UHMA 3WTVC 2M0CA 2K4JA 2O03A 4Q5SF 1WPKA 2KIFA 1I1SA 3S93A 5DS9A 3CMYA 2V1NA 2WA0A 4BE2A 4XKCA 2QWWA 2A05A 2OTLI 2IS1A 1MH4A 2DBBA 5B1AH 1R7JA 1FBQA 4PJ0C 4B1RA 4KNYA 2XB0X 5CVJA 1X2MA 3FDYA 3EUHA 4B3XA 1IN5A 4B3AA 1EH6A 5FKOA 1Q1VA 4S05A 2GOMA 3G1MA 2DA4A 3K7AJ 3CUQB 4I09A 4R1HA 5FRMA 2BY1A 4XRMA 2JK3A 1R5GA 4IPAA 5KVRA 3ABUA 4BS9A 2TRTA 4G6DA 1QHHD 2AHQA 4AIHA 2DJIA 4F52A 2E7XA 3R0JA 5LFAA 2D1VA 3QPSA 4L9VA 4A3DJ 1VZ0A 1VFCA 1YS6A 3FK7A 4I2OA 5JLWA 6PAXA 5J1YA 2CW0F 4BEHB 3I59A 4ZH4F 2E1NA 2LKXA 1HSTA 3QQAA 4WXCA 3I55I 3ERMA 4M9SA 2QSGX 4R79A 2KZVA 2R7XA 1RIOH 1JTXA 4U0YA 1IXRC 2ZXHA 2NVUB 4EJVA 1E3HA 3L2VA 3F8FA 1H8AC 3FISA 2OAZA 4Y4RA 2JTVA 3S14J 2JPBA 1IRXA 3SDGA 2L7FP 2O6GE 2VONA 2KQRA 5FFZA 1FLIA 2L5QA 3J7AO 1Z3XA 5M5WJ 1LE8B 1U9OA 2LY1A 4OU0A 1H9TA 2IAIA 1V4RA 1E3PA 2L2OA 2E2HJ 2FQ4A 1PVEA 4RB1A 2EINH 5F1RA 2H27A 2Z5UA 3PNVA 3ELKA 4ANJA 3BQYA 2KFDA 4MO7A 1ZQ3P 3CC2I 2K86A 3QPTA 2HQNA 3OYNA 2BZTA 1WJCA 3K2ZA 4YG2F 2VKVA 5FKLA 1G3YA 2JA5J 2OUMA 4UB8C 2CUFA 4C3JJ 1YW7A 2HOTA 1MKMA 3JAMK 4KITB 1BR2A 2XHKA 4NC7A 3WGGA 1J9IA 3GFLA 4WF2A 4CZCA 3QWLA 1MJAA 2UUZA 2J5OA 4F93B 1K4SA 2K9NA 4EM0B 2GAUA 4XRFA 3SDBA 1OCTC 2IEKA 4AVZA 2QQ8A 3C1DA 4LLNA 3HL2A 4F7ZA 1O4XA 3BJ6A 1DUXC 4UY8I 2ACJA 1AKHB 1GHCA 3ZCOA 5FGMA 3V8LA 5LGTA 1SAUA 2JA2A 2K4BA 3VYRB 3G6EI 4KFCA 3FK6A 4AU7A 5L3GA 2EBIA 1XN7A 2HTJA 4FETA 3VEPA 2FF4A 5BMZA 2TCTA 3N4MA 3EUAA 1RUNA 3H9JA 4RA2A 2IT0A 2L7ZA 2XC7A 2XPUA 3R0AA 1WJFA 3GTOJ 4AIKA 3NRVA 2F48A 4A5NA 1QPMA 5AIQA 2V7FA 2VB6A 3R4KA 2QQBA 3KP2A 4XLEA 3P9KA 1JT6A 1BOBA 4KUMA 1OFCX 3BTCA 1D8KA 3S2DJ 1BC7C 1JKRC 2X85A 5IT9K 5IP7J 4DBQA 2EFOA 3HOXJ 1OJLA 2LFBA 2FE3A 1PDNC 3IAS2 2GXAA 4B43A 3H92A 2IBDA 3PNTA 3I4PA 4YFKF 2HR3A 2E5ZA 5AIPA 4L18B 4I6ZA 2J5PA 4BY7J 4XOPA 2DODA 4L5EA 3UNGC 5LEJA 3T1BA 2XGEA 2DO7A 4A0ZA 5DM6F 1K6YA 2GXBA 1JKQC 3O3KA 3VB2A 3G73A 5LRSA 2KRHA 2MW8A 3PIOF 4F92B 4BY1J 1T56A 3Q3SA 2Z33A 1X1DA 4MQ9F 2ZJPF 3PSIA 2HWVA 2L0KA 3ESWB 5ILUA 3J80K 1GVDA 1A36A 1UG0A 4MQVA 4OINF 2BVMA 4MNUA 2STTA 4EM1A 3WHBA 4CYDA 3GTJJ 2GIVA 3DPTA 3M07A 4FHTA 4N4OB 1Z6RA 4D0PA 4FQGA 1AWCA 4BXFA 1D5YA 1NG6A 3HPGA 1T95A 4RBOA 3RZOJ 4QLCU 1PYVA 2EFQA 5DEQA 3TL4X 3A2KA 1ENHA 2ELHA 1YRNB 2RREA 4KT6A 1AU7A 2COBA 2KHMA 5CQEA 5BOXA 4HRIA 3IRRA 3H5RA 3ONQA 5ED4A 4AWXB 3EQLF 2NVXJ 4EEFG 1ZH5A 1A35A 2P6SA 2EV6A 2DYRH 5CYVA 3T8RA 3KLNA 4IF4A 2A6EF 1OYWA 3BLYA 3DKWA 4QSHA 3PUFA 1Z1DA 2X6OA 3K1MA 1IUFA 1UFMA 1YO5C 2FMLA 1KYZA 2F5VA 4IHXA 3ISPA 5F27A 1TWCJ 1XGOA 4PUSA 2B63J 3AL0B 2EZHA 1TQIA 1GV2A 2IGNA 3E5XA 5ICGA 1Z77A 4EQQA 3CESA 2CUEA 1S3JA 2HYGD 1JUMA 3OYEA 4GYGA 3KYLA 2X51A 1LEBA 2RQPA 3BTIA 3FMQA 3JRGA 1EKEA 3JRIA 1PUFB 1FOWA 3MFKA 3ZMVA 1KONA 2EV0A 3WTTC 1D3YA 2CW7A 2HDCA 2P6TA 1X58A 3V8KA 1P4XA 1BR4A 4OIPF 2UZKA 3VFZA 4LLGF 3G4SI 1X1PA 4S0HB 2A61A 1B1BA 3HUGA 4CSWA 1YOVB 1ZG1A 2X9DA 3HJEA 3CMMA 3DTKA 3ZMZA 4XLAA 1TBXA 5IYCJ 4PJMA 3UKGA 1TC3C 1UHWA 3JREA 2OTJI 3W6KB 1UZCA 3CCYA 2NNYA 1FZPB 5E3OA 3WTSC 3KZYA 2OJED 4LITA 1QPIA 3RJPA 4AIDA 2ZJRF 4A3KJ 2JRTA 5HS9A 5DCMB 1X3UA 3DCFA 3RKYA 1Y1VJ 1SAXA 5FB2A 5FROA 2DA7A 3ZQFA 2R7SA 1PP8F 3GFMA 3GVAA 4NUBA 2CU7A 2LSOA 2FQ3A 4I02A 4IRGA 4WCGA 2F5EA 1N78A 3BY6A 2Q2EA 5E8IA 1P92A 1YYVA 5EZHA 4L9NA 2M7BA 3ZQLA 1XPXA 3MCZA 5D5WB 3S2HJ 2ISZA 2VJJA 1P7IA 1WFXA 5FJ8J 4TV7A 5L3DA 1FJLA 4IOAF 3HKZA 2GZWA 2R5ZA 3I0TA 5D5VB 1XD7A 1D5VA 2FXAA 1R5ID 2KL4A 2MA3A 4A0YA 2R7WA 1U8RA 3CLOA 2QBYA 2CQXA 1MNMC 2PBIA 2COMA 1I27A 4ITVA 2Y9YA 2IRFG 4GFBA 1K83J 2QA4I 3CDHA 1KZHA 5KNLA 1WSUA 1KU7A 5GPCA 5HLHA 3B6AA 3ABKH 2F6CA 5C4JJ 1FBSA 1W5CC 2DA2A 2FMYA 3TP0A 4E7ZA 2VIXA 3LQRA 5EG0B 4EMSA 5E20A 2H1KA 1MD0A 3WODF 1YTYA 3KZZA 1POGA 2QGUA 4XLNF 1IZ1A 3FWEA 2MC4A 4QTRA 1G59A 5BPIA 1TWGJ 3GTPJ 1MMGA 4P96A 2KLOA 2KIUA 5J47A 3G2BA 1C0WA 1FYMA 3PQKA 5JHFA 1O3RA 2CV2A 1IW7F 1XDUA 3CJQB 1KQ0A 5EEAA 5J6XA 1CF7B 1FIPA 3F23A 2OCEA 3ZMUA 3OIOA 4EV0A 5ICEA 1RC9A 2O8KA 1HDDC 2XDVA 3RPUD 2YPRA 2PI0A 3DEUA 2GBYA 3QPLA 4RAYA 4O6JA 2DAOA 3M8JA 1S29A 3DPLC 2ZSIB 2H09A 2OQGA 3J7AY 3SZGA 2WV1A 2XF6A 1ZELA 4E4HA 3DP7A 3BP8A 4C2UA 4YIRX 3COAC 4M3FA 2A68F 3R6SA 2DDBA 4LIVA 2H94A 1WJAA 1HF0A 1VQ5I 2M1BA 1G4DA 2QUFA 1IXCA 1VQ4I 3SYTA 5GAGJ 4C3HJ 4HDVA 2V9PA 5DUKA 3HTSB 4JQFA 5F64A 1JJ8C 4M6YA 5F6FA 2DYSH 1ZKGA 1XMAA 4MHGA 4BGDA 4XORA 1IN7A 3ABLH 4RM3A 2R7UA 4BQAA 2Q0OA 2LTPA 3H3ZA 4I0AA 2P7VB 2EZLA 2LY2A 5D5UB 2JA7J 1KGSA 3RKXA 2XRNA 1VQMI 1SVMA 1MNEA 1T0FC 3OOUA 4P9UA 5JHUA 2KDOA 1VQOI 2X1CA 1QA6A 1EV7A 3EUKL 1ETYA 5EZGA 4KJZA 5B66C 4N4NB 1Z6TA 4A6DA 2VQHA 1LKXA 3K4JA 4G9YA 2LRDA 2RC4A 2BW3A 2R3SA 1TWFJ 3LSJA 1FIAA 4HF0A 1VQKI 3CCRI 3K4CA 2ADUA 4BE0A 1AHDP 4DYQA 4EJOA 1OR7A 4Z2YA 3CC7I 1P2FA 3H0DA 3JCUC 2O9LA 1TL8A 3CDLA 2PFBA 2A5YB 2NS0A 3PO2J 4UV8A 3CQZJ 2NS7A 1AOYA 2XAHA 2XV4S 2R4GA 2GQQA 1CF7A 1FOYA 1IO2A 2LP0A 2PG4A 1XSVA 1FYLA 2KMUA 3E6MA 4C2TA 4HX7A 1B8IA 1JE8A 2BEOA 3E7LA 3WTUC 1R58A 2ELKA 4I98B 3JRHA 3LA2A 4OIRF 1BIAA 4WX9A 4M73A 4MEYF 2V79A 3JRBA 2P5LC 3EETA 4KISA 3RKWA 1ZG5A 5FLXK 1XX5A 4K2EA 1ZN2A 5FO5A 4E7KA 4UNOA 1IV6A 2M34A 3HOSA 4C3IJ 1GV5A 3MQ0A 4HAMA 5GADJ 5D8LB 2EFPA 4DYRA 3OYAA 1OYYA 1DGRM 2XAQA 4LMYA 4XBFA 1DDNA 2BHZA 2IS2A 4Q4ZF 1S7EA 3E1SA 3MEXA 2V26A 4KIGA 1IXSB 2M9HA 2RVCA 2A5WA 2LD5A 1SD6A 3BZCA 3KE2A 4LLLA 2KPMA 5FLVA 3OL4A 2XVCA 3HTUA 2EFNA 3LSKA 1QBJA 2CQKA 1LFUP 3E5QA 5M5YJ 4FISA 2IVMA 3FXQA 5J40A 4ZYDA 2EA4A 2RV8A 1B9MA 1MBKA 2XGDA 4ABZA 1MH3A 3GWZA 2K02A 3F6OA 3IL2A 3IWFA 3BG5A 4I01A 4U87A 1Y0NA 4DNCA 3D5RC 1XGNA 2CFOA 3ZOBA 2DK5A 2K85A 3HHGA 1Z05A 1BW6A 3BG7A 1R4MB 4FX4A 1Y39A 2BE5F 5E79C 2W84A 3OV8A 1USSA 3D1NI 2F4MB 3F3XA 4XKBA 3U9GA 5H6QA 2KKOA 3VODA 2CV0A 1Y8RB 1E2XA 5B3SH 3I59B 4BQQA 3NARA 2Y9ZA 2VC1A 4HLXA 5CKTA 2QF7A 2YR2A 4G8XA 3SZPA 2DXIA 2Z99A 1SD5A 3K4KA 4EATA 4RGSA 4KICA 4QPQA 3HRTA 5DV5A 1ON1A 3CCJI 3H5NA 4M72A 2DMNA 2P81A 2EWNA 2PJPA 2C6YA 3JRDA 4RGRA 3A4CA 2XPWA 3GLXA 3CF2A 2O5RA 3MKLA 1OR7C 4CCNA 3FBIB 1NK3P 2A69F 2FEZA 2QZ8A 4GXOA 3H36A 4CCMA 3TP3A 2EK5A 2R7DA 1VQ6I 2CUJA 3DKXA 4ZZLA 1J2XA 1WI3A 5E1XA 2E1MB 3G1LA 2M45A 3CCLI 3LSHA 2OA4A 3FX3A 4CYCA 5TRDA 3F8CA 1W5SA 2I5UA 2JPCA 2X6YA 3TMOA 3KYDB 1YW8A 2QKLB 1F1ZA 3U1DA 4XLFA 3S8PA 1HKQA 2HI3A 2W1OA 3ZQHA 1TT0A 3JR9A 4MIMA 1APLC 4XMYA 5A2QZ 5FKKA 2DMUA 4HA8A 3TO9A 1VF9A 3S1RJ 1S8NA 3FXOA 4AD9A 2MBFA 3K0LA 2PQ8A 2IGKA 3NQOA 1WQ2A 3TOAA 2YUSA 3ECOA 4NQWA 2XAFA 2ZC2A 2L01A 3JTGA 2V6CA 1R22A 4A3LJ 2HPMA 3GTMJ 1ETQA 4C9YA 1I1GA 3CF5F 4GGGA 2K5CA 4X0GA 3IRQA 4UUVA 2O8XA 4V19K 2D2WA 2NVYJ 3N97A 4PSXA 5GTIC 2ZFUA 4E70A 5TISC 4XL9A 2DOAA 2CH0A 2PN6A 3CMEI 4M9XA 1I3AA 3IKTA 2DOEA 4HG2A 2M4GA 1YW9A 2PMZN 1JT0A 4I76A 3V8JA 5L3FA 4WXHA 1ZHFA 3S32A 2DMTA 3M4OJ 4X1EA 2EQRA 2HXOA 4U88A 3TDUC 3OIPA 1GXQA 4CDGA 2XSDC 1R49A 3HRMA 2A3SA 1LDDA 2WC2A 3FMSA 3A03A 2BXYA 4HZFA 4NHJA 1K6OA 3Q0VA 2OPTA 1HLVA 4EJWA 5DM7F 1Z21A 4JX5A 2NNNA 3GTLJ 2VBZA 3BDDA 2ZO4A 2E1OA 3BR0A 3M1CA 2DJNA 2AO9A 4XSZF 2V4JC 2D1HA 1TW2A 3OSGA 4II2A 3G71I 1XSDA 1ACIA 1ZR2A 1MBFA 1D0YA 1Y6IA 2LF7A 3AFHA 3I3LA 1JI8A 5H2FC 1M1EB 1N25A 4A3MJ 3WTXC 3FM3A 3DEWA 2HEOA 2WTEA 4KMUX 3RPQA 2Z9OA 3ZQ7A 2W85A 1ETXA 2VODA 3VSKA 2BY2A 5GTHC 2NYXA 1JUPA 3EYIA 1YX5A 4XKVA 2Y69H 1YFHA 3E5UA 4AC0A 2MLGA 1X4OA 3BG9A 3KPHA 1OQYA 5IYBJ 3BTLA 4XLHA 5J8CA 3BR5A 4ASNA 3S2WA 1ERDA 3QPHA 1O3SA 1MMSA 4M71A 1SD4A 3K10A 4OMZA 2WY8Q 4BBSJ 3E3VA 4XN3A 4LGWA 1I3QJ 4BQNA 3OYKA 3LNQA 3S17J 2ZXIA 2Y30A 3MAJA 4PK4A 3DV8A 2JRMA 3IWZA 4OIOF 3BZ6A 3C7JA 3F21A 4HW0A 1ZLKA 4XSXF 3BQZA 5M5XJ 3ZQGA 2M8GX 2HDDA 4Y3OA 1FX7A 4I0BA 3TBIA 3RYRA 1P7JA 4HBLA 1MBJA 2W25A 1TQPA 3K4LA 2AS5F 2A07F 5HVQC 2AQEA 3CZ6A 3M3YJ 1SFUA 4BKXA 2UXXA 3HM5A 5HLGA 3HG9A 4YFNF 2GLOA 1VNDA 1SFKA 3OMYA 1SEUA 1BM9A 3RIRA 3OR1C 3ZXSA 2QSHX 2HOSA 2K9MA 3HPHA 4A6EA 3TDZC 3K2AA 4XRSG 4GDFA 1LVAA 3OYMA 2JJ7A 1FTTA 2NVTJ 3GX4X 3ZN1A 4XN0A 3HYIA 3LFKA 1KYWA 1S7OA 2HYFA 3S1QJ 3O2PE 2Z2SB 2QLZA 2XAGA 4E7IA 2WWYA 4RB0A 3DEEA 4EJUA 2E2JJ 1V5EA 1UJ8A 2HGCA 2RDPA 3LSGA 1TLHB 3J7ZI 1IF1A 4PJNA 4ESBA 4PJJA 2ESNA 1IRFA 2EB7A 5IOYA 1QVTA 1YITI 2Y0SN 1PUEE 3FF5A 3J81K 1WHUA 3QP6A 3HOUJ 1V3FA 3LSPA 1FEXA 2MD0A 4RDUA 3BC8A 3OS2A 3EYYA 4B44A 4FE4A 3ZMDA 2P8TA 1D0ZA 3W2AA 3HUGB 2AXLA 2UWMA 3HGGA 1EA3A 3KZIC 2CMPA 4Y7NJ 5JLXA 1DQUA 2DI3A 2HKOA 4PSWA 2E36A 2RNGA 3PIPF 3KEOA 4P9FA 4A0XA 2KJBA 2L7MP 2PMHA 4LJZF 1V5GA 3BPXA 3GTGJ 1IUYA 5LHHA 2VL8A 3GFIA 2L4MA 1HDPA 3IV5A 2EILH 2YX4A 3WE3A 3I54A 2LG4A 5FD6A 1QQIA 4RGXA 1HKSA 2FOKA 2P5KA 3ZR8X 2I10A 3A0HC 2HFHA 5GAHJ 2FRHA 4M9ZA 3ZGKA 1X4PA 5JI6A 4IHTA 3E97A 3L00A 1RETA 2FBIA 1XS9A 2Q2EB 1K79A 4QIWN 3C2HA 2ECBA
chains in the Genus database with same CATH topology
4XIDA 1FIPA 5FKNA 3OIOA 5K7HA 3ZQCA 2O8KA 1HDDC 2EZKA 3SFIA 2GBYA 2R5ZB 3QPLA 5K7FA 4IHYA 1JJ6C 4M3DA 1ETWA 1IDYA 2JN6A 2WV1A 3C2BA 1RPWA 5C4XJ 3W6VA 5M3MJ 2R93J 3HOYJ 3H3VK 4MLOA 4XK4A 4M3FA 3PM1A 4UUSB 9ANTA 2DTZA 1HF0A 4LOCA 1ZK8A 2E19A 4D5FA 1JGGA 2VI6A 1UMQA 1I6HJ 2WAQN 4C3HJ 2HOAA 2XPVA 1DU0A 3BR1A 1TWAJ 2FD5A 1H89C 4A3EJ 5F04A 1JJ8C 2CQQA 3NAUA 1SANA 5E3NA 3S1NJ 1ZKGA 4IHWA 1EF4A 2MSYA 2ZB9A 5FLMJ 4JX6A 2LTPA 4AUXA 4IHVA 2DMPA 2EZLA 2ECCA 1OCPA 2JA7J 3OOUA 1SFOJ 1E3OC 2DA1A 3RKQA 2EZIA 1ETYA 5EZGA 1ZGWA 2X48A 2RAEA 3Q0WA 5BNGA 2MGQA 3BTJA 2R92J 5EEAA 2DA3A 1TWFJ 3LSJA 1A6IA 1FIAA 5J1UA 1BW5A 1X2NA 2ME6A 1W0UA 3HOWJ 4MFEA 3FKIJ 1AHDP 4DYQA 4A69C 3G1OA 2O9LA 2DA5A 2E2IJ 1MSEC 4W97A 3CDLA 1IDZA 3PO2J 4FCYA 2KDZA 3CQZJ 2NS7A 2M0CA 1WPKA 4M6VA 5DS9A 3CMYA 3F0CA 4MFDA 2LP0A 2XB5A 4D7NA 3A01A 1B8IA 1MH4A 1B72A 3E7LA 4B1RA 2ELKA 3JRHA 2XB0X 1X2MA 1LE8A 3JRBA 4B3AA 5FKOA 1Q1VA 4D5CA 4JP0A 3G1MA 2DA4A 2K9SA 3K7AJ 4XRMA 3JRAA 2JK3A 2TRTA 2AHQA 1IV6A 2M34A 2FJ1A 4C3IJ 1GV5A 3QPSA 1HCRA 3GTQJ 3L1PA 4A3DJ 1VFCA 2HXIA 3FK7A 4DYRA 5JLWA 2Y31A 5J1YA 5EGOA 2W48A 2R5YA 4A3GJ 1UG2A 5IPAA 2LKXA 3QQAA 3JRCA 1S7EA 1JUSA 1RESA 4M3GA 2R0QC 2M9HA 5HODA 4XRSA 2LD5A 1JTXA 1WH5A 5GP9A 5FLVA 1HOMA 3HBLA 2JMWA 1H8AC 1GDTA 5IP9J 3FISA 1LFUP 1BA5A 5M5YJ 4FISA 3S14J 3A01B 1B8IB 3SDGA 2HYJA 2L7FP 2LR8A 1B72B 2XGDA 1MBKA 3TW6A 5M5WJ 4ABZA 1LE8B 1MH3A 1AKHA 1U9OA 2KT0A 3BG5A 2IAIA 1Z0XA 5EYRA 3ZOBA 2FQ4A 2E2HJ 2LK2A 5GPAA 1RR7A 1BW6A 3BQYA 3BR2A 3VPRA 4MO7A 1ZQ3P 3IH2A 3D1NI 2N8GA 3BG3A 2DMQA 5EGOB 2VKVA 2R5YB 1T33A 1IG7A 3NARA 3A02A 5FKLA 2Y9ZA 2JA5J 4HNVA 4A93J 2CUFA 2QF7A 2NS8A 1ZTRA 4C3JJ 4DZJA 2HOTA 3S16J 1U8BA 1ETOA 4B4CA 4W1UA 2DMNA 2P81A 4X6AJ 3JRDA 2K9NA 1ORKA 2XPWA 1OCTC 2IEKA 2H8RA 5EF6A 3H0GJ 1IRZA 2K9QA 3MKLA 1NK3P 1O4XA 3HOVJ 1AKHB 3TP3A 1K61A 2VUMJ 1JKPC 1WI3A 3FK6A 3G1LA 2ME0A 1UHSA 2EBIA 1CQTA 3HEFA 4AYBN 4CYCA 2NVQJ 2TCTA 4FTHA 4XICA 3WHCA 3O8GA 4FE7A 2L7ZA 1Y1WJ 3I4MJ 3HB9A 2XPUA 1FTZA 3GTOJ 2HI3A 3ZQHA 3FIWA 3JR9A 4MIMA 1APLC 2Y2ZA 5FKKA 1QRYA 2DMUA 5F1JA 1JT6A 2DA6A 1VF9A 3S1RJ 1XC5A 1OFCX 3BTCA 3GBGA 5F0FA 3B6CA 3S2DJ 3HOZJ 1JKRC 2YUSA 4DW6A 2G0EA 5IP7J 3HOXJ 4A3LJ 3GTMJ 1OJLA 2LFBA 1ETQA 5F0CA 2NOGA 1BJZA 2IBDA 2NVYJ 1YRNA 2CJJA 4I6ZA 4NDLA 4BY7J 1RKWA 4JYKA 4A3JJ 4L5EA 2QCOA 3OSFA 3BT9A 2XGEA 2DN0A 1JTYA 1JKQC 3IH3A 1LFBA 2LY9A 4CYCB 2PMZN 1JT0A 2YU9J 4I76A 2MW8A 1NK2P 1WH7A 4UUTA 2JA6J 2DMTA 1ZR4A 3M4OJ 4BY1J 1T56A 3Q3SA 4X1EA 2EQRA 2HXOA 2K40A 1DU6A 2D5VA 1BL0A 4M3BA 2XSDC 2L0KA 3A03A 3Q0VA 2OPTA 4Y52J 1HLVA 4JX5A 1GVDA 3GTLJ 2E1OA 3BR0A 4A3CJ 2DJNA 2AO9A 3IH4A 5EDNA 1WCMJ 2WB1N 3WHBA 4A3IJ 3S15J 2LVSA 3GTJJ 3OSGA 1ZR2A 1MBFA 1PUFA 3TEDA 4A3MJ 1D5YA 3DEWA 4RBOA 3RZOJ 1ENHA 5FKMA 5IYDJ 1YRNB 1AU7A 1ETXA 2COBA 1JUPA 2EH3A 2VPRA 4JX4A 2NVXJ 4AC0A 4V2FA 4EEFG 4A3FJ 2GM4A 4BXXJ 3BG9A 5IYBJ 3BTLA 1ITYA 3BR5A 4J19A 3JRFA 4QSHA 5J3LA 5E3MA 2X6OA 1GUUA 1IUFA 2JWTA 4BBSJ 3LSRA 1NTCA 2JA8J 2OF7A 1I3QJ 4IHXA 3I4NJ 1IGNA 3ZQIA 5F27A 1TWCJ 2XGCA 3LNQA 3S17J 1MBEA 2Y30A 1RKTA 2B63J 2EZHA 4V2GA 1GV2A 1Z77A 5K7ZA 4IEJA 2CUEA 3HKZN 3BQZA 1ETKA 1JUMA 5M5XJ 3ZQGA 2M8GX 2HDDA 3BTIA 1P7JA 3BR6A 3JRGA 1PUFB 3JRIA 1MBJA 4D7MA 1A5JA 1X58A 3M3YJ 5J1RA 1G2HA 4BKXA 3O8HA 3HM5A 1IJWC 2GLOA 1VNDA 2HOSA 1XG1A 4S0HB 1MBHA 3K2AA 1TWHJ 4XRSG 3TW7A 2O7OA 2JJ7A 1FTTA 2NVTJ 2X9DA 1QVUA 2L9RA 2MG4A 4DZPA 1VI0A 2HQ5A 5IYCJ 3UKGA 1TC3C 3S1MJ 3JREA 3LOCA 3S1QJ 5C3EJ 3CCYA 4DYCA 1MSFC 1R9TJ 5E3OA 1IC8A 5DTDA 1F36A 1QPIA 1I50J 4A3KJ 1MBGA 4M3EA 5EG0A 1W0TA 3DCFA 5C44J 1Y1VJ 2E2JJ 3LSGA 2DA7A 3ZQFA 3BR3A 2CU7A 4A3BJ 2ID3A 3HGYA 5IOYA 1QVTA 1GT0C 2Y0SN 5EZHA 1U78A 3Q0UA 1WGXA 3MN2A 3RQIA 3ZQLA 3HOUJ 2YS9A 3S2HJ 3LSPA 1FEXA 1P7IA 5FJ8J 4RDUA 3RZDJ 1FJLA 1U9NA 4FE4A 2R5ZA 3SJMA 3HGGA 2LLKA 5IP6A 1H88C 2FX0A 3GTKJ 5F08A 4Y7NJ 3HDDA 5JLXA 2CQXA 5E3LA 1MNMC 2Y9YA 4GFBA 1K83J 2R7ZJ 1F43A 2L7MP 5GPCA 3B6AA 3MVPA 3GTGJ 5C4JJ 2M2EA 4UUSA 1HDPA 2DA2A 3IV5A 3TP0A 1JKOC 5EG0B 2H1KA 2CRGA 1ETVA 1POGA 4BBRJ 2XRLA 4QTRA 2I10A 2VKEA 4C2MJ 1TWGJ 3GTPJ 4G12A 5M3FJ 5F0HA 2ID6A 1RETA 1XS9A 4QIWN 5IOZA 2ECBA 3PO3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XID A;  1FIP A;  5FKN A;  3OIO A;  5K7H A;  3ZQC A;  2O8K A;  1HDD C;  2EZK A;  3SFI A;  2GBY A;  2R5Z B;  3QPL A;  5K7F A;  4IHY A;  1JJ6 C;  4M3D A;  1ETW A;  1IDY A;  2JN6 A;  2WV1 A;  3C2B A;  1RPW A;  5C4X J;  3W6V A;  5M3M J;  2R93 J;  3HOY J;  3H3V K;  4MLO A;  4XK4 A;  4M3F A;  3PM1 A;  4UUS B;  9ANT A;  2DTZ A;  1HF0 A;  4LOC A;  1ZK8 A;  2E19 A;  4D5F A;  1JGG A;  2VI6 A;  1UMQ A;  1I6H J;  2WAQ N;  4C3H J;  2HOA A;  2XPV A;  1DU0 A;  3BR1 A;  1TWA J;  2FD5 A;  1H89 C;  4A3E J;  5F04 A;  1JJ8 C;  2CQQ A;  3NAU A;  1SAN A;  5E3N A;  3S1N J;  1ZKG A;  4IHW A;  1EF4 A;  2MSY A;  2ZB9 A;  5FLM J;  4JX6 A;  2LTP A;  4AUX A;  4IHV A;  2DMP A;  2EZL A;  2ECC A;  1OCP A;  2JA7 J;  3OOU A;  1SFO J;  1E3O C;  2DA1 A;  3RKQ A;  2EZI A;  1ETY A;  5EZG A;  1ZGW A;  2X48 A;  2RAE A;  3Q0W A;  5BNG A;  2MGQ A;  3BTJ A;  2R92 J;  5EEA A;  2DA3 A;  1TWF J;  3LSJ A;  1A6I A;  1FIA A;  5J1U A;  1BW5 A;  1X2N A;  2ME6 A;  1W0U A;  3HOW J;  4MFE A;  3FKI J;  1AHD P;  4DYQ A;  4A69 C;  3G1O A;  2O9L A;  2DA5 A;  2E2I J;  1MSE C;  4W97 A;  3CDL A;  1IDZ A;  3PO2 J;  4FCY A;  2KDZ A;  3CQZ J;  2NS7 A;  2M0C A;  1WPK A;  4M6V A;  5DS9 A;  3CMY A;  3F0C A;  4MFD A;  2LP0 A;  2XB5 A;  4D7N A;  3A01 A;  1B8I A;  1MH4 A;  1B72 A;  3E7L A;  4B1R A;  2ELK A;  3JRH A;  2XB0 X;  1X2M A;  1LE8 A;  3JRB A;  4B3A A;  5FKO A;  1Q1V A;  4D5C A;  4JP0 A;  3G1M A;  2DA4 A;  2K9S A;  3K7A J;  4XRM A;  3JRA A;  2JK3 A;  2TRT A;  2AHQ A;  1IV6 A;  2M34 A;  2FJ1 A;  4C3I J;  1GV5 A;  3QPS A;  1HCR A;  3GTQ J;  3L1P A;  4A3D J;  1VFC A;  2HXI A;  3FK7 A;  4DYR A;  5JLW A;  2Y31 A;  5J1Y A;  5EGO A;  2W48 A;  2R5Y A;  4A3G J;  1UG2 A;  5IPA A;  2LKX A;  3QQA A;  3JRC A;  1S7E A;  1JUS A;  1RES A;  4M3G A;  2R0Q C;  2M9H A;  5HOD A;  4XRS A;  2LD5 A;  1JTX A;  1WH5 A;  5GP9 A;  5FLV A;  1HOM A;  3HBL A;  2JMW A;  1H8A C;  1GDT A;  5IP9 J;  3FIS A;  1LFU P;  1BA5 A;  5M5Y J;  4FIS A;  3S14 J;  3A01 B;  1B8I B;  3SDG A;  2HYJ A;  2L7F P;  2LR8 A;  1B72 B;  2XGD A;  1MBK A;  3TW6 A;  5M5W J;  4ABZ A;  1LE8 B;  1MH3 A;  1AKH A;  1U9O A;  2KT0 A;  3BG5 A;  2IAI A;  1Z0X A;  5EYR A;  3ZOB A;  2FQ4 A;  2E2H J;  2LK2 A;  5GPA A;  1RR7 A;  1BW6 A;  3BQY A;  3BR2 A;  3VPR A;  4MO7 A;  1ZQ3 P;  3IH2 A;  3D1N I;  2N8G A;  3BG3 A;  2DMQ A;  5EGO B;  2VKV A;  2R5Y B;  1T33 A;  1IG7 A;  3NAR A;  3A02 A;  5FKL A;  2Y9Z A;  2JA5 J;  4HNV A;  4A93 J;  2CUF A;  2QF7 A;  2NS8 A;  1ZTR A;  4C3J J;  4DZJ A;  2HOT A;  3S16 J;  1U8B A;  1ETO A;  4B4C A;  4W1U A;  2DMN A;  2P81 A;  4X6A J;  3JRD A;  2K9N A;  1ORK A;  2XPW A;  1OCT C;  2IEK A;  2H8R A;  5EF6 A;  3H0G J;  1IRZ A;  2K9Q A;  3MKL A;  1NK3 P;  1O4X A;  3HOV J;  1AKH B;  3TP3 A;  1K61 A;  2VUM J;  1JKP C;  1WI3 A;  3FK6 A;  3G1L A;  2ME0 A;  1UHS A;  2EBI A;  1CQT A;  3HEF A;  4AYB N;  4CYC A;  2NVQ J;  2TCT A;  4FTH A;  4XIC A;  3WHC A;  3O8G A;  4FE7 A;  2L7Z A;  1Y1W J;  3I4M J;  3HB9 A;  2XPU A;  1FTZ A;  3GTO J;  2HI3 A;  3ZQH A;  3FIW A;  3JR9 A;  4MIM A;  1APL C;  2Y2Z A;  5FKK A;  1QRY A;  2DMU A;  5F1J A;  1JT6 A;  2DA6 A;  1VF9 A;  3S1R J;  1XC5 A;  1OFC X;  3BTC A;  3GBG A;  5F0F A;  3B6C A;  3S2D J;  3HOZ J;  1JKR C;  2YUS A;  4DW6 A;  2G0E A;  5IP7 J;  3HOX J;  4A3L J;  3GTM J;  1OJL A;  2LFB A;  1ETQ A;  5F0C A;  2NOG A;  1BJZ A;  2IBD A;  2NVY J;  1YRN A;  2CJJ A;  4I6Z A;  4NDL A;  4BY7 J;  1RKW A;  4JYK A;  4A3J J;  4L5E A;  2QCO A;  3OSF A;  3BT9 A;  2XGE A;  2DN0 A;  1JTY A;  1JKQ C;  3IH3 A;  1LFB A;  2LY9 A;  4CYC B;  2PMZ N;  1JT0 A;  2YU9 J;  4I76 A;  2MW8 A;  1NK2 P;  1WH7 A;  4UUT A;  2JA6 J;  2DMT A;  1ZR4 A;  3M4O J;  4BY1 J;  1T56 A;  3Q3S A;  4X1E A;  2EQR A;  2HXO A;  2K40 A;  1DU6 A;  2D5V A;  1BL0 A;  4M3B A;  2XSD C;  2L0K A;  3A03 A;  3Q0V A;  2OPT A;  4Y52 J;  1HLV A;  4JX5 A;  1GVD A;  3GTL J;  2E1O A;  3BR0 A;  4A3C J;  2DJN A;  2AO9 A;  3IH4 A;  5EDN A;  1WCM J;  2WB1 N;  3WHB A;  4A3I J;  3S15 J;  2LVS A;  3GTJ J;  3OSG A;  1ZR2 A;  1MBF A;  1PUF A;  3TED A;  4A3M J;  1D5Y A;  3DEW A;  4RBO A;  3RZO J;  1ENH A;  5FKM A;  5IYD J;  1YRN B;  1AU7 A;  1ETX A;  2COB A;  1JUP A;  2EH3 A;  2VPR A;  4JX4 A;  2NVX J;  4AC0 A;  4V2F A;  4EEF G;  4A3F J;  2GM4 A;  4BXX J;  3BG9 A;  5IYB J;  3BTL A;  1ITY A;  3BR5 A;  4J19 A;  3JRF A;  4QSH A;  5J3L A;  5E3M A;  2X6O A;  1GUU A;  1IUF A;  2JWT A;  4BBS J;  3LSR A;  1NTC A;  2JA8 J;  2OF7 A;  1I3Q J;  4IHX A;  3I4N J;  1IGN A;  3ZQI A;  5F27 A;  1TWC J;  2XGC A;  3LNQ A;  3S17 J;  1MBE A;  2Y30 A;  1RKT A;  2B63 J;  2EZH A;  4V2G A;  1GV2 A;  1Z77 A;  5K7Z A;  4IEJ A;  2CUE A;  3HKZ N;  3BQZ A;  1ETK A;  1JUM A;  5M5X J;  3ZQG A;  2M8G X;  2HDD A;  3BTI A;  1P7J A;  3BR6 A;  3JRG A;  1PUF B;  3JRI A;  1MBJ A;  4D7M A;  1A5J A;  1X58 A;  3M3Y J;  5J1R A;  1G2H A;  4BKX A;  3O8H A;  3HM5 A;  1IJW C;  2GLO A;  1VND A;  2HOS A;  1XG1 A;  4S0H B;  1MBH A;  3K2A A;  1TWH J;  4XRS G;  3TW7 A;  2O7O A;  2JJ7 A;  1FTT A;  2NVT J;  2X9D A;  1QVU A;  2L9R A;  2MG4 A;  4DZP A;  1VI0 A;  2HQ5 A;  5IYC J;  3UKG A;  1TC3 C;  3S1M J;  3JRE A;  3LOC A;  3S1Q J;  5C3E J;  3CCY A;  4DYC A;  1MSF C;  1R9T J;  5E3O A;  1IC8 A;  5DTD A;  1F36 A;  1QPI A;  1I50 J;  4A3K J;  1MBG A;  4M3E A;  5EG0 A;  1W0T A;  3DCF A;  5C44 J;  1Y1V J;  2E2J J;  3LSG A;  2DA7 A;  3ZQF A;  3BR3 A;  2CU7 A;  4A3B J;  2ID3 A;  3HGY A;  5IOY A;  1QVT A;  1GT0 C;  2Y0S N;  5EZH A;  1U78 A;  3Q0U A;  1WGX A;  3MN2 A;  3RQI A;  3ZQL A;  3HOU J;  2YS9 A;  3S2H J;  3LSP A;  1FEX A;  1P7I A;  5FJ8 J;  4RDU A;  3RZD J;  1FJL A;  1U9N A;  4FE4 A;  2R5Z A;  3SJM A;  3HGG A;  2LLK A;  5IP6 A;  1H88 C;  2FX0 A;  3GTK J;  5F08 A;  4Y7N J;  3HDD A;  5JLX A;  2CQX A;  5E3L A;  1MNM C;  2Y9Y A;  4GFB A;  1K83 J;  2R7Z J;  1F43 A;  2L7M P;  5GPC A;  3B6A A;  3MVP A;  3GTG J;  5C4J J;  2M2E A;  4UUS A;  1HDP A;  2DA2 A;  3IV5 A;  3TP0 A;  1JKO C;  5EG0 B;  2H1K A;  2CRG A;  1ETV A;  1POG A;  4BBR J;  2XRL A;  4QTR A;  2I10 A;  2VKE A;  4C2M J;  1TWG J;  3GTP J;  4G12 A;  5M3F J;  5F0H A;  2ID6 A;  1RET A;  1XS9 A;  4QIW N;  5IOZ A;  2ECB A;  3PO3 J; 
#chains in the Genus database with same CATH topology
 3G3Z A;  5FKN A;  4XID A;  2KZG A;  1KU3 A;  2R5Z B;  1LNW A;  4IHY A;  1JJ6 C;  2GXG A;  3WE2 A;  2G7U A;  4M3D A;  4BJ6 C;  1SMT A;  4UVC A;  2QBY B;  2X6X A;  2AXT C;  4A12 A;  3L2W A;  4HDU A;  5HDG A;  3QP5 A;  2JN6 A;  1P4W A;  4Q47 A;  4J01 A;  3C2B A;  1RPW A;  1S5L C;  2VBX A;  2R7T A;  3LMM A;  4NB5 A;  1YJN I;  2B9S A;  3HOY J;  3I58 A;  5JVG F;  2VKD A;  3SZT A;  3PM1 A;  4N9I A;  3SFZ A;  3BCB A;  1P4A A;  1MGT A;  3ML6 A;  2F5C A;  4KYW A;  2L02 A;  3K9T A;  4GO1 A;  1Y56 A;  3GUD A;  1S6L A;  3HSF A;  4D5F A;  1X1C A;  3QOP A;  3CLQ A;  3VOE A;  3FXM A;  2X1D A;  2XPV A;  4XOT A;  2DTR A;  3BR1 A;  3QOD A;  1S7A A;  3WGH A;  1YX3 A;  3H5A A;  2VBW A;  3I64 A;  5F04 A;  2JUC A;  5J8F A;  5DDG A;  1KA8 A;  1L0O C;  3TKY A;  1R36 A;  2ETH A;  2K3P A;  4IHW A;  5K1Y A;  2MSY A;  2ZB9 A;  1OCC H;  1HA8 A;  2ZJ2 A;  1U0J A;  3GZ6 A;  1Y8Q B;  3D5L A;  4AUX A;  4MGR A;  3L2U A;  1U6G A;  2ECC A;  5CQG A;  2ZSH B;  1D0X A;  3AAF A;  1SFO J;  4QWQ A;  5LBQ A;  3L9F A;  4NC6 A;  2RAE A;  5BNG A;  3WGI A;  2MGQ A;  1G3W A;  1L3L A;  3EDP A;  2P4W A;  2P5V A;  2XAS A;  3NWS A;  3BWG A;  4OAY A;  3RPU A;  4U7D A;  4CHU A;  2M8E A;  2E5N A;  2JVG A;  4A69 C;  4N0B A;  1ZAR A;  2CSO A;  1MIJ A;  2DA5 A;  2XF7 A;  1T0F A;  1XMK A;  1IDZ A;  4L9T A;  5ICF A;  2KDZ A;  3DTI A;  3K4M A;  2QVO A;  4DBR A;  3L2R A;  1S9H A;  2DT7 B;  3FMR A;  4M6V A;  2STW A;  3CP2 A;  1SD7 A;  1G3T A;  4UV9 A;  3F0C A;  3LSM A;  4MFD A;  3TQN A;  3K4N A;  4D7N A;  3QYB A;  5FRN A;  1R1T A;  2BY3 A;  3A01 A;  3A1Y A;  1B72 A;  4F55 A;  3MZY A;  1XGS A;  3QOE A;  4ZJZ A;  2YX7 A;  4IX7 A;  1IN8 A;  2HVQ A;  1XSX A;  3AG2 H;  3GLL A;  4HV6 A;  4BAY A;  4BHC A;  4D5C A;  3R60 A;  1T08 B;  4JP0 A;  1ZYR F;  2K9S A;  2NAZ A;  2DQR A;  3JRA A;  2H6C A;  1QU3 A;  2LKS A;  2JVH A;  1BIB A;  1T39 A;  2JQ7 A;  2BW3 B;  2MC3 A;  1HCR A;  3GTQ J;  1OCR H;  2GOX B;  2HXI A;  4HLY A;  5BPD A;  2Y31 A;  5EGO A;  2W48 A;  2R5Y A;  3FBN B;  4A3G J;  1UG2 A;  1ZG3 A;  4P5O A;  2Y0M A;  2BVL A;  3JRC A;  5HS7 A;  5HOD A;  4XRS A;  5LHG A;  1E0E A;  1DPR A;  3OIQ A;  2EIJ H;  2KIM A;  3HBL A;  5KHD A;  1HOM A;  3FKJ A;  3N05 A;  1HW1 A;  5IP9 J;  1GDT A;  3PFI A;  3PNY A;  4AYB A;  1BA5 A;  2DLL A;  2JSP A;  3E0J B;  1W7P A;  3CO6 C;  2L9S A;  1B8I B;  5CVV A;  3P9C A;  2HYJ A;  2LR8 A;  3F72 A;  2DFF A;  3TW6 A;  5HDK A;  2Z3Y A;  2ELJ A;  5EJC A;  2HPI A;  2KT0 A;  2ZXJ A;  3MD2 A;  2FA5 A;  2KRC A;  3Q9V A;  1Z0X A;  3ZN0 A;  2L54 A;  5D6E A;  1O7F A;  2XRO A;  1RR7 A;  3MMY B;  4L9J A;  5J4Y A;  3HRU A;  3IH2 A;  3L7W A;  2X4H A;  2FU4 A;  3LAP A;  3M8E A;  1VQ8 I;  1R5H A;  3BG3 A;  1SFX A;  2DMQ A;  1UST A;  4G7O F;  3WU0 A;  4HF2 A;  2FBH A;  4L0Y B;  1N75 A;  4HX8 A;  2LF8 A;  1VQN I;  4HNV A;  5DD8 A;  4A93 J;  2NS8 A;  1GVJ A;  1ZTR A;  4RS8 A;  4DZJ A;  5LRR A;  2LYC A;  4G6T B;  1KU9 A;  3AG1 H;  3KP5 A;  3S16 J;  4NC8 A;  1U3E M;  3JAM Z;  1U8B A;  4U0W A;  1ETO A;  4B4C A;  4ENJ A;  1HC8 A;  2Y48 A;  3FM5 A;  4HOB A;  3DWL E;  4KN7 X;  2H8R A;  1ZRE A;  5EF6 A;  2K9Q A;  4KMF A;  4N9H A;  1K78 A;  1Z3Y A;  4F3Q A;  3QU3 A;  3GXO A;  3DBR B;  1XDS A;  3MKY B;  3OYB A;  1J0R A;  3AG4 H;  2DW4 A;  3HEF A;  4YII A;  3Q9S A;  4AYB N;  3PFY A;  2NVQ J;  3T5X A;  3RYP A;  1SMY F;  5HLI A;  2QQA A;  3CCM I;  4XIC A;  1W7P D;  3WHC A;  2L9N A;  3O8G A;  4FE7 A;  2V9K A;  3H1C A;  3R61 A;  3W6J B;  5D8K B;  1LVK A;  5LD2 C;  4CIC A;  3X2Q H;  4JK1 X;  2G7H A;  1WJE A;  5EEG A;  3DF8 A;  5KAI C;  1QRY A;  3U2R A;  2DA6 A;  3KP7 A;  1OMI A;  3K70 D;  1XC5 A;  2VC0 A;  3M7G A;  4HV5 A;  1J59 A;  2E35 A;  3LA7 A;  5F0F A;  1ZGJ A;  3B6C A;  2NRA C;  3OOP A;  4DW6 A;  4PGG A;  4S04 A;  2G0E A;  2K9L A;  2ISY A;  1Y0U A;  5JFR A;  1TP4 A;  3ULQ B;  2EA2 A;  5IT9 Z;  1WJ5 A;  1BJZ A;  3KEQ A;  2K7L A;  2LBF A;  2WV0 A;  3ZQQ A;  4BDY A;  3W3C A;  2CJJ A;  4NDL A;  2PLY A;  2CO5 A;  2XAU A;  1RKW A;  4A3J J;  2QCO A;  2WAD A;  3OSF A;  3HOT A;  3AL0 C;  1X3Z B;  2DOF A;  2DN0 A;  1JTY A;  2MAB A;  2O3F A;  3NEU A;  3IH3 A;  4CYC B;  2LY9 A;  4YRV A;  2VOP A;  2YU9 J;  3WG7 H;  2R7O A;  5LHI A;  2L3D A;  1WH7 A;  4O5V A;  3BOQ A;  3CP8 A;  3LSI A;  4RLQ A;  4UUT A;  4XM3 A;  2FNP A;  3QAH A;  4WK8 F;  1ZR4 A;  1UAA A;  2W24 A;  4BDZ A;  5TGT A;  2FSW A;  2K40 A;  2VPL A;  3OL3 A;  3FXR A;  3L09 A;  1U5T C;  4RB3 C;  4MTD A;  1VTN C;  2MYS A;  1JHH A;  4ETS A;  3RSN A;  3K70 C;  2R7F A;  3CCE I;  3J80 Z;  2H1L A;  2RNJ A;  2Q1Z B;  5LGU A;  1TTY A;  4A3C J;  4ESJ A;  2OZU A;  3IH4 A;  1LJ9 A;  1WCM J;  4NQW B;  1V54 H;  2LVS A;  3LST A;  5K5O A;  2VT3 A;  4XR6 A;  4XLP F;  3I53 A;  5HLT A;  3GZ5 A;  2CS3 A;  2MLK A;  3DTE A;  2F4O B;  3P7N A;  1R00 A;  5IYD J;  1OPC A;  1ZLJ A;  3JSP A;  2JUG A;  4OWR B;  2ZXW H;  3S3M A;  1VQ7 I;  3GW2 A;  4XKW A;  4XON A;  5ILS A;  2VPR A;  2HU9 A;  1YHQ I;  2GM4 A;  4V2F A;  3GF2 A;  5DD4 A;  2ZCW A;  4BXX J;  5H6R A;  3OWT A;  3DU6 A;  3E6C C;  5E17 F;  1I6X A;  1ITY A;  1G3S A;  2V1U A;  3MKZ A;  4J19 A;  5E3M A;  2IS6 A;  4KIB A;  1H9G A;  2HNH A;  1T6S A;  2JWT A;  4PFP A;  4KDP A;  2WAF A;  2OD5 A;  3DU5 A;  1NTC A;  2JA8 J;  2OF7 A;  3I4N J;  2QM3 A;  1IGN A;  2O0Y A;  2VBY A;  3ZQI A;  2MFZ A;  2XGC A;  3FXU A;  2I8D A;  1RKT A;  3DXJ F;  3MZ8 A;  4A5M A;  4V2G A;  4LB5 A;  4ZZD A;  4IL6 C;  2W4S A;  2PMZ A;  1YE9 A;  2IPQ X;  3OYI A;  2PX9 A;  3SEZ A;  2ZKZ A;  4B8X A;  1FOX A;  3OYF A;  3V7R A;  1Z7L A;  4YEJ A;  5BQT A;  1HXD A;  2M7A A;  3LAJ A;  1R6R A;  1A5J A;  2OU2 A;  1R1U A;  3LQQ A;  4JBA A;  4PGH A;  5D6F A;  3ZMS A;  5HNF A;  3T0Y A;  5ICC A;  5DUI A;  5J1R A;  1D8J A;  1G2H A;  2IP2 A;  3O8H A;  4BU2 A;  3PL8 A;  1A31 A;  5E1W A;  1Z9C A;  1DP3 A;  4KIF A;  4RLF A;  2KRF A;  2LMD A;  3JTH A;  2FUG 2;  4IRI A;  1VQL I;  1XG1 A;  4ESF A;  1FSE A;  1YS7 A;  3TW7 A;  4OAZ A;  4BHP A;  2O7O A;  2L9R A;  4ZC3 A;  3GCM A;  4DZP A;  2CV1 A;  3S1M J;  2XUB A;  3RTR A;  3L2C A;  1B4A A;  1R4N B;  3LOC A;  3REO A;  4AM3 A;  4CA0 A;  2QEN A;  3QYE A;  1KQ8 A;  4UVA A;  2E71 A;  3F22 A;  1RR8 C;  1F36 A;  4FX0 A;  3TO7 A;  3K1P A;  4HEA 2;  1RZ4 A;  4M3E A;  3ERE D;  1FYK A;  1W0T A;  1BJA A;  5GAE J;  1F9N A;  3LFU A;  4JOM A;  3BR3 A;  2CQ7 A;  5KCM A;  4CXF A;  1EJ9 A;  4EGY A;  1J75 A;  4A3B J;  1Z7U A;  1OIS A;  1MDM A;  3O6B B;  1Z91 A;  4AVP A;  3Q0U A;  3MN2 A;  3RQI A;  3C2G A;  1LPQ A;  2M0M A;  3RZD J;  2TDX A;  2W7N A;  1U9N A;  3KP3 A;  2H6B A;  2M5W A;  1LQ1 A;  4BXU A;  1FBU A;  1RI7 A;  2DU9 A;  3SJM A;  3ECH A;  1Z67 A;  2WBM A;  2LLK A;  5CPR B;  1XCB A;  2RGV A;  2FX0 A;  5CVU A;  4U7B A;  3GTK J;  1DGW Y;  1BI3 A;  2LC2 A;  5E3L A;  1ZRC A;  1R71 A;  1LDK B;  2VE9 A;  3P9I A;  2EJR A;  3H9Q A;  4LIU A;  4RAZ A;  2HS5 A;  2CFX A;  1O57 A;  3MVP A;  5KK1 A;  1FOK A;  4EJT A;  2M2E A;  4UUS A;  3A0B C;  5L3B A;  3LA3 A;  5BS6 A;  4M6X A;  2F4I A;  3K69 A;  1ODD A;  2CRG A;  4KT5 C;  2ZME A;  3GO5 A;  3SQN A;  4BBR J;  4ENM A;  1IV8 A;  2HVS A;  4C2M J;  1YLF A;  5CJ9 A;  4RM2 A;  2WY7 Q;  5M3F J;  1HW5 A;  5B1B H;  1FPQ A;  5F0H A;  1HW2 A;  2ID6 A;  4FAS D;  2L4A A;  3DFG A;  1X3W B;  5AON A;  3PO3 J;  3CC4 I;  2VLA A;  2NOJ B;  4LK0 F;  4PCQ A;  5K7H A;  3ZQC A;  2E60 A;  3K4B A;  4H4K C;  3U1K A;  2ZJQ F;  1X1B A;  1SVL A;  2FNA A;  4LK1 F;  4R8H A;  4B09 A;  2VQL A;  1JGS A;  3VDX A;  1IDY A;  2E1C A;  3F8B A;  1OKR A;  2Y0S A;  3PQJ A;  1WJD A;  1DP7 P;  3ASN H;  5C4X J;  3W6V A;  1UEL B;  3WU2 C;  4KA4 A;  3DKY A;  3H3V K;  3W2V A;  1LUJ B;  3CJN A;  2QSF X;  1F5T A;  9ANT A;  3B73 A;  1FT9 A;  4BH9 A;  2DTZ A;  4IOC F;  2MD5 A;  2M87 A;  2MH2 A;  2E19 A;  3M8F A;  1UMQ A;  3MWM A;  1I6H J;  2HOA A;  1K4T A;  1TWA J;  4YEL A;  1PJR A;  4IO9 F;  5D5X B;  3RDI A;  2LRE A;  2DFE A;  5HOO A;  2CQQ A;  3OY9 A;  5IY5 H;  4ZTJ A;  1EF4 A;  2CW8 A;  5FLM J;  2L9V A;  4JX6 A;  3KEY A;  5L3E A;  4P55 A;  2M4K A;  1NK2 P;  2DMP A;  1O7L A;  1OCP A;  2DFI A;  2JA6 J;  3KFW X;  1MMN A;  2GA2 A;  3CUQ A;  4G94 A;  1E3O C;  2DA1 A;  4ZYH A;  1NG7 A;  1EH7 A;  3CMA I;  2BOL A;  2EZI A;  3HSR A;  1ZGW A;  2CWE A;  2IGM A;  3AKZ A;  2VJI A;  3VYT B;  3CJR B;  2YU3 A;  4ENK A;  1A6I A;  3RQ4 A;  5B5E C;  1BW5 A;  2OCC H;  4D1Q A;  1W0U A;  3HOW J;  4MFE A;  1YIJ I;  4BEH A;  2M3A A;  1UB9 A;  3G1O A;  4NNJ A;  1RRJ A;  3FZV A;  2BV6 A;  2VKH A;  3EUH C;  3F8M A;  1WVR A;  1MMA A;  2VE8 A;  5KAF C;  1FP2 A;  3U21 A;  4UB6 C;  3CCU I;  3L2Q A;  3TO6 A;  3ASO H;  4BL0 B;  2BYV E;  2V6E A;  2XB5 A;  3VYU B;  4B48 A;  1BOA A;  1I5Z A;  3KCC A;  1HSJ A;  1BR1 A;  3DLA A;  2ZME C;  1A04 A;  2B0L A;  1LE8 A;  4BYY A;  3DBH B;  1QHG A;  5H20 A;  1QO0 D;  2LNB A;  3GEZ A;  4UVB A;  2VQG A;  1GXP A;  1FSH A;  3SEQ A;  5JVT A;  1BI1 A;  5FLX Z;  2CUZ A;  3HIF A;  3PSF A;  2FJ1 A;  2IS4 A;  1D1C A;  1J09 A;  1X19 A;  1T2K A;  3I5U A;  3L1P A;  2GA1 A;  4UHT A;  1KQ9 A;  4O3M A;  1B59 A;  3QYF A;  2L7K A;  1W1W E;  3D0S A;  1TT5 B;  5IPA A;  4BJ5 C;  2HTS A;  1JUS A;  1RES A;  1V55 H;  4M3G A;  2VN2 A;  2R0Q C;  3KIO A;  4EVI A;  3ZMT A;  4LG3 A;  1WH5 A;  5GP9 A;  3E6D A;  2JMW A;  3RCO A;  2E1M C;  2IJL A;  4ZDO A;  2KP6 A;  5HNH A;  4E7L A;  3BRO A;  2XGX A;  2M30 A;  3CCS I;  2QKM B;  3A01 B;  4HQE A;  1B72 B;  5LGN A;  3H35 A;  1AKH A;  4CCJ A;  3HHH A;  5EYR A;  1ZGA A;  5TJJ A;  2LK2 A;  1B6A A;  3TOB A;  1WZ2 A;  2DDA A;  3RI4 A;  5GPA A;  3FXK A;  4J00 A;  2VJ5 A;  3NWT A;  3BPV A;  3BR2 A;  3VPR A;  2BXZ A;  4LB6 B;  2EIM H;  1G6N A;  2N8G A;  2DT6 A;  1I39 A;  4HSR A;  2LDU A;  4ENN A;  3DPU A;  1JXS A;  3VYS B;  5EGO B;  3SXY A;  2R5Y B;  1PP7 U;  1T33 A;  1IG7 A;  4M74 A;  3A02 A;  1YIO A;  1FMV A;  1T8I A;  4E7J A;  4H0E A;  4ZYE A;  2JSC A;  3CUQ C;  3K1N A;  1ULY A;  3VWB A;  2H8W A;  1BI0 A;  1OCZ H;  1FP1 D;  1TNS A;  3BJO A;  4W1U A;  3K6G A;  4IQJ A;  2W00 A;  4OMY A;  4X6A J;  3ZPL A;  1ORK A;  1X1A A;  2ESH A;  3HC7 A;  4DJA A;  1YI2 I;  1MND A;  1W7P B;  3KP4 A;  2HQA A;  3H0G J;  1IRZ A;  2OBP A;  3HZJ A;  4HYE A;  1YQA A;  4RMN A;  1T38 A;  1ONV A;  3HOV J;  1U5T B;  2Z16 A;  4G6Q A;  2UXN A;  3KX2 A;  4PFO A;  4CUG A;  4EGZ A;  1RUO A;  2RKH A;  1K61 A;  2VUM J;  5D4S A;  1JKP C;  2GWR A;  2ME0 A;  1D1A A;  5L3C A;  1UHS A;  1CQT A;  2FBK A;  2Z1D A;  2XF5 A;  5K5Q A;  4IZZ A;  2DK8 A;  2E7W A;  2WB1 A;  4FTH A;  1BBY A;  1HKT A;  3BZK A;  4ZDP A;  1Y1W J;  3I4M J;  3DQV C;  3HB9 A;  2O61 A;  1FTZ A;  4I7H A;  1UCR A;  1KU2 A;  1W5T A;  3FIW A;  5A2Q K;  1LFP A;  1REP C;  2Y2Z A;  5ERI A;  4L0Z B;  1MZB A;  5F1J A;  5K5R A;  1WWX A;  2KJC A;  3ROU A;  5LLQ A;  3FXJ A;  1TW3 A;  2R7Q A;  2X6W A;  4E6K G;  3F9K A;  3GBG A;  4BE1 A;  4IVN A;  4Q48 A;  1MJB A;  3HOZ J;  1IAW A;  4LFU A;  4OOI A;  3BG6 A;  5E8G A;  3V7C A;  3MKW B;  4GYI A;  4HQM A;  3WTW C;  3C3W A;  1HQC A;  3HRS A;  2E34 A;  5F0C A;  1QGP A;  3I9V 2;  3I56 I;  2NOG A;  1K78 B;  1Q1H A;  3GFJ A;  4PJL A;  2IA2 A;  2IGO A;  4G7H F;  4ZTF A;  5FFX A;  2XIG A;  1N77 A;  1YRN A;  2YSR A;  2BHY A;  2QQ9 A;  3GYH X;  1P9Q C;  1IRG A;  2K3F A;  4JYK A;  3MZH A;  4C30 A;  2JT1 A;  3BT9 A;  4BAC A;  2HZT A;  2XAJ A;  1LFB A;  2P0W A;  1SC7 A;  2DPU A;  1D1B A;  4IKF A;  4WXD A;  2ICW G;  1J5Y A;  1O3T A;  2VQC A;  2XSJ C;  1DU6 A;  1B9N A;  2D5V A;  4P1W A;  5J4V A;  2VT2 A;  3IKV A;  4Y17 A;  1BL0 A;  4M3B A;  4PDK A;  1ZAO A;  2DPD A;  1FMW A;  3FHN A;  1F4K A;  2PEX A;  4Y52 J;  2DFH A;  2CQN A;  2IXS A;  2VXD A;  3OYC A;  3TGN A;  2VXZ A;  4A3I J;  4Y13 A;  5EDN A;  2WB1 N;  3S15 J;  3IUO A;  3WTZ A;  4PZJ A;  4RAF A;  4XNF A;  1PUF A;  4YFX F;  3OYD A;  1SVO A;  3V4G A;  3TED A;  1U5T A;  2RQQ A;  2VAS A;  2LBF B;  1ZRD A;  5E18 F;  5FKM A;  2KIS A;  3ZP5 A;  2HDW A;  3GZN B;  4BHB A;  2EH3 A;  4UXN A;  4HNT A;  4YIF A;  4HST A;  4RB2 C;  3V7S A;  3ZRG A;  4JX4 A;  4ZYA A;  4BJT A;  4A3F J;  2HZD A;  4L5I A;  1ON2 A;  3JRF A;  1ZRF A;  5J3L A;  1GUU A;  4IHS A;  5CVR A;  3WU1 B;  4EM2 A;  4LG0 B;  4E7S A;  3J7Y J;  3KET A;  3LSR A;  4XQF A;  1GLN A;  2R7V A;  4HF1 A;  4AIJ A;  3S3O A;  1MBE A;  3OS1 A;  4IXA A;  1XCV A;  3HSE A;  1K7A A;  2DCE A;  5DCM A;  4OIQ F;  5K7Z A;  4IEJ A;  5DYM A;  3HKZ N;  1ETK A;  3LL7 A;  5CVI A;  4B47 A;  2V1D A;  3ABM H;  2IA1 A;  3H9G A;  3BR6 A;  3PJR A;  1OLT A;  4FT8 A;  4D7M A;  2PJR B;  4GRI A;  1DPU A;  1VQP I;  3S3N A;  4Y15 A;  2LH9 A;  2XKO A;  2GIZ A;  2V1X A;  1IJW C;  3VSL A;  4ZDL A;  3IAM 2;  2LOO A;  2V9V A;  1MBH A;  4XLC A;  1MJ9 A;  4WWC A;  1TWH J;  4NBQ A;  1WKM A;  2Y75 A;  5HDN A;  3I71 A;  2W57 A;  3V42 A;  3OYL A;  2DQL A;  1QVU A;  2MG4 A;  1VI0 A;  2HQ5 A;  3EPZ A;  5LEK A;  4RGU A;  5C3E J;  1QZY A;  1FC3 A;  3PUB A;  4DYC A;  4II3 A;  1MSF C;  1R9T J;  1R1V A;  3T8T A;  1IC8 A;  5DTD A;  4CCL A;  2EFW A;  1I50 J;  1MBG A;  1MW7 A;  3M9A A;  4U0V A;  4DIQ A;  1S72 I;  1BC8 C;  5EG0 A;  3KYC B;  5C44 J;  2P7C B;  3OR2 C;  2K27 A;  4A2U A;  1OYI A;  1U2W A;  1TZL A;  1QZE A;  1SFE A;  2ID3 A;  3HGY A;  1RNL A;  4F91 B;  3M1E A;  2BY0 A;  2QYO A;  1YG2 A;  2OZ6 A;  1YJW I;  1BI2 A;  1GT0 C;  3CCQ I;  1STZ A;  3OYH A;  2F5D A;  2VJ4 A;  1U78 A;  1WGX A;  1FNN A;  3J81 Z;  1CGP A;  2YS9 A;  1P6R A;  1TQM A;  3ABT A;  4HNU A;  4I99 C;  2AQF A;  1WRJ A;  4HPQ A;  4CZZ A;  2CYY A;  4DQ2 A;  4CH7 A;  2FOW A;  1LDJ A;  5IP6 A;  1H88 C;  2LKP A;  5F08 A;  2D45 A;  3HDD A;  3CD6 I;  4LG0 A;  1R23 A;  1E17 A;  2HOE A;  2WAQ A;  3C18 A;  3OYG A;  4IJA A;  1T98 A;  1WI9 A;  4ON0 A;  2ZFW A;  3IHU A;  3CO7 C;  2R7Z J;  1F43 A;  3IP4 B;  1OCO H;  1WJB A;  5EEH A;  3GME A;  2EPF A;  2HKX A;  4Y33 A;  5HS8 A;  4KN4 X;  3D5S C;  1JKO C;  1VQ9 I;  2F5F A;  5ILV A;  3WG9 A;  1W4M A;  3CCV I;  3JSO A;  1ETV A;  3DLL F;  2QEX I;  1W36 D;  3CDI A;  1HBX G;  2XRL A;  3H3U A;  2PJR A;  2VKE A;  1JHF A;  3Q5F A;  1V5F A;  4G12 A;  2OV7 A;  2KIQ A;  5JR3 A;  2BGC A;  4LD5 A;  1MDM B;  2W82 A;  2X1E A;  3CUO A;  2EIK H;  3BJA A;  4HX4 A;  5IOZ A;  1NHA A;  3AG3 H;  3WTY C;  2HQR A;  4GCV A;  3P5J A;  1FY7 A;  3IC7 A;  4E7H A;  2EZK A;  3SFI A;  2MH9 A;  5K7F A;  1A6Q A;  1IN4 A;  5FD5 A;  1ETW A;  2WAE A;  4CCO A;  2OQR A;  4MEX F;  3QU6 A;  4Z6Y A;  1TNT A;  4BUP A;  5CLS A;  3CJT B;  5M3M J;  2HVR A;  1O3Q A;  2R93 J;  3OYJ A;  3HXL A;  4CCK A;  4MLO A;  4XK4 A;  4CGZ A;  4UUS B;  2ZNY A;  2R7R A;  2EV5 A;  3F6V A;  5DCF A;  1NH3 A;  1AA7 A;  2IW5 A;  2B7E A;  1XB4 A;  2JZY A;  4LOC A;  2ZME B;  1ZK8 A;  2A6H F;  4MTE A;  2CG4 A;  2NXN B;  1W36 C;  3F8N A;  1H0M A;  1JGG A;  2VI6 A;  2DT5 A;  1QNT A;  1BN5 A;  3LWF A;  2WAQ N;  2F2E A;  3W2W A;  1DU0 A;  3B02 A;  3CTA A;  4IQ4 A;  1XTA A;  1EH8 A;  1XMX A;  2FD5 A;  1G8X A;  1H89 C;  2OC6 A;  4BNC A;  4A3E J;  4D9J A;  3SHF A;  2IA0 A;  3NAU A;  1IN6 A;  1SAN A;  5E3N A;  4G7Z F;  3S1N J;  4DOZ A;  4IRH A;  2G9W A;  2RN7 A;  3E6B A;  5IT3 A;  4QPO A;  2VOO A;  5E1Z B;  1FWZ A;  4IHV A;  3KP6 A;  2BBY A;  2UV1 A;  1XGM A;  3KLO A;  4L5J A;  2A6T A;  2CGP A;  3FHZ A;  3RKQ A;  5D4R A;  2X48 A;  3Q0W A;  2PMU A;  4CO8 A;  1J7K A;  3BTJ A;  2R92 J;  2DA3 A;  5J1U A;  3OS0 A;  3QRF F;  1X2N A;  2ME6 A;  4ZYG A;  3UR3 C;  3DBL B;  3FKI J;  3FXL A;  1YJ9 I;  1LEA A;  2X0L A;  2Q8K A;  3BCA A;  4RAG A;  2ZBK A;  2XKP A;  1MMD A;  1QZZ A;  4W97 A;  1MSE C;  2E2I J;  4DGW B;  1LB2 A;  3JW4 A;  2ZNZ A;  4BQO A;  4FCY A;  1UHM A;  3WTV C;  2M0C A;  2K4J A;  2O03 A;  4Q5S F;  1WPK A;  2KIF A;  1I1S A;  3S93 A;  5DS9 A;  3CMY A;  2V1N A;  2WA0 A;  4BE2 A;  4XKC A;  2QWW A;  2A05 A;  2OTL I;  2IS1 A;  1MH4 A;  2DBB A;  5B1A H;  1R7J A;  1FBQ A;  4PJ0 C;  4B1R A;  4KNY A;  2XB0 X;  5CVJ A;  1X2M A;  3FDY A;  3EUH A;  4B3X A;  1IN5 A;  4B3A A;  1EH6 A;  5FKO A;  1Q1V A;  4S05 A;  2GOM A;  3G1M A;  2DA4 A;  3K7A J;  3CUQ B;  4I09 A;  4R1H A;  5FRM A;  2BY1 A;  4XRM A;  2JK3 A;  1R5G A;  4IPA A;  5KVR A;  3ABU A;  4BS9 A;  2TRT A;  4G6D A;  1QHH D;  2AHQ A;  4AIH A;  2DJI A;  4F52 A;  2E7X A;  3R0J A;  5LFA A;  2D1V A;  3QPS A;  4L9V A;  4A3D J;  1VZ0 A;  1VFC A;  1YS6 A;  3FK7 A;  4I2O A;  5JLW A;  6PAX A;  5J1Y A;  2CW0 F;  4BEH B;  3I59 A;  4ZH4 F;  2E1N A;  2LKX A;  1HST A;  3QQA A;  4WXC A;  3I55 I;  3ERM A;  4M9S A;  2QSG X;  4R79 A;  2KZV A;  2R7X A;  1RIO H;  1JTX A;  4U0Y A;  1IXR C;  2ZXH A;  2NVU B;  4EJV A;  1E3H A;  3L2V A;  3F8F A;  1H8A C;  3FIS A;  2OAZ A;  4Y4R A;  2JTV A;  3S14 J;  2JPB A;  1IRX A;  3SDG A;  2L7F P;  2O6G E;  2VON A;  2KQR A;  5FFZ A;  1FLI A;  2L5Q A;  3J7A O;  1Z3X A;  5M5W J;  1LE8 B;  1U9O A;  2LY1 A;  4OU0 A;  1H9T A;  2IAI A;  1V4R A;  1E3P A;  2L2O A;  2E2H J;  2FQ4 A;  1PVE A;  4RB1 A;  2EIN H;  5F1R A;  2H27 A;  2Z5U A;  3PNV A;  3ELK A;  4ANJ A;  3BQY A;  2KFD A;  4MO7 A;  1ZQ3 P;  3CC2 I;  2K86 A;  3QPT A;  2HQN A;  3OYN A;  2BZT A;  1WJC A;  3K2Z A;  4YG2 F;  2VKV A;  5FKL A;  1G3Y A;  2JA5 J;  2OUM A;  4UB8 C;  2CUF A;  4C3J J;  1YW7 A;  2HOT A;  1MKM A;  3JAM K;  4KIT B;  1BR2 A;  2XHK A;  4NC7 A;  3WGG A;  1J9I A;  3GFL A;  4WF2 A;  4CZC A;  3QWL A;  1MJA A;  2UUZ A;  2J5O A;  4F93 B;  1K4S A;  2K9N A;  4EM0 B;  2GAU A;  4XRF A;  3SDB A;  1OCT C;  2IEK A;  4AVZ A;  2QQ8 A;  3C1D A;  4LLN A;  3HL2 A;  4F7Z A;  1O4X A;  3BJ6 A;  1DUX C;  4UY8 I;  2ACJ A;  1AKH B;  1GHC A;  3ZCO A;  5FGM A;  3V8L A;  5LGT A;  1SAU A;  2JA2 A;  2K4B A;  3VYR B;  3G6E I;  4KFC A;  3FK6 A;  4AU7 A;  5L3G A;  2EBI A;  1XN7 A;  2HTJ A;  4FET A;  3VEP A;  2FF4 A;  5BMZ A;  2TCT A;  3N4M A;  3EUA A;  1RUN A;  3H9J A;  4RA2 A;  2IT0 A;  2L7Z A;  2XC7 A;  2XPU A;  3R0A A;  1WJF A;  3GTO J;  4AIK A;  3NRV A;  2F48 A;  4A5N A;  1QPM A;  5AIQ A;  2V7F A;  2VB6 A;  3R4K A;  2QQB A;  3KP2 A;  4XLE A;  3P9K A;  1JT6 A;  1BOB A;  4KUM A;  1OFC X;  3BTC A;  1D8K A;  3S2D J;  1BC7 C;  1JKR C;  2X85 A;  5IT9 K;  5IP7 J;  4DBQ A;  2EFO A;  3HOX J;  1OJL A;  2LFB A;  2FE3 A;  1PDN C;  3IAS 2;  2GXA A;  4B43 A;  3H92 A;  2IBD A;  3PNT A;  3I4P A;  4YFK F;  2HR3 A;  2E5Z A;  5AIP A;  4L18 B;  4I6Z A;  2J5P A;  4BY7 J;  4XOP A;  2DOD A;  4L5E A;  3UNG C;  5LEJ A;  3T1B A;  2XGE A;  2DO7 A;  4A0Z A;  5DM6 F;  1K6Y A;  2GXB A;  1JKQ C;  3O3K A;  3VB2 A;  3G73 A;  5LRS A;  2KRH A;  2MW8 A;  3PIO F;  4F92 B;  4BY1 J;  1T56 A;  3Q3S A;  2Z33 A;  1X1D A;  4MQ9 F;  2ZJP F;  3PSI A;  2HWV A;  2L0K A;  3ESW B;  5ILU A;  3J80 K;  1GVD A;  1A36 A;  1UG0 A;  4MQV A;  4OIN F;  2BVM A;  4MNU A;  2STT A;  4EM1 A;  3WHB A;  4CYD A;  3GTJ J;  2GIV A;  3DPT A;  3M07 A;  4FHT A;  4N4O B;  1Z6R A;  4D0P A;  4FQG A;  1AWC A;  4BXF A;  1D5Y A;  1NG6 A;  3HPG A;  1T95 A;  4RBO A;  3RZO J;  4QLC U;  1PYV A;  2EFQ A;  5DEQ A;  3TL4 X;  3A2K A;  1ENH A;  2ELH A;  1YRN B;  2RRE A;  4KT6 A;  1AU7 A;  2COB A;  2KHM A;  5CQE A;  5BOX A;  4HRI A;  3IRR A;  3H5R A;  3ONQ A;  5ED4 A;  4AWX B;  3EQL F;  2NVX J;  4EEF G;  1ZH5 A;  1A35 A;  2P6S A;  2EV6 A;  2DYR H;  5CYV A;  3T8R A;  3KLN A;  4IF4 A;  2A6E F;  1OYW A;  3BLY A;  3DKW A;  4QSH A;  3PUF A;  1Z1D A;  2X6O A;  3K1M A;  1IUF A;  1UFM A;  1YO5 C;  2FML A;  1KYZ A;  2F5V A;  4IHX A;  3ISP A;  5F27 A;  1TWC J;  1XGO A;  4PUS A;  2B63 J;  3AL0 B;  2EZH A;  1TQI A;  1GV2 A;  2IGN A;  3E5X A;  5ICG A;  1Z77 A;  4EQQ A;  3CES A;  2CUE A;  1S3J A;  2HYG D;  1JUM A;  3OYE A;  4GYG A;  3KYL A;  2X51 A;  1LEB A;  2RQP A;  3BTI A;  3FMQ A;  3JRG A;  1EKE A;  3JRI A;  1PUF B;  1FOW A;  3MFK A;  3ZMV A;  1KON A;  2EV0 A;  3WTT C;  1D3Y A;  2CW7 A;  2HDC A;  2P6T A;  1X58 A;  3V8K A;  1P4X A;  1BR4 A;  4OIP F;  2UZK A;  3VFZ A;  4LLG F;  3G4S I;  1X1P A;  4S0H B;  2A61 A;  1B1B A;  3HUG A;  4CSW A;  1YOV B;  1ZG1 A;  2X9D A;  3HJE A;  3CMM A;  3DTK A;  3ZMZ A;  4XLA A;  1TBX A;  5IYC J;  4PJM A;  3UKG A;  1TC3 C;  1UHW A;  3JRE A;  2OTJ I;  3W6K B;  1UZC A;  3CCY A;  2NNY A;  1FZP B;  5E3O A;  3WTS C;  3KZY A;  2OJE D;  4LIT A;  1QPI A;  3RJP A;  4AID A;  2ZJR F;  4A3K J;  2JRT A;  5HS9 A;  5DCM B;  1X3U A;  3DCF A;  3RKY A;  1Y1V J;  1SAX A;  5FB2 A;  5FRO A;  2DA7 A;  3ZQF A;  2R7S A;  1PP8 F;  3GFM A;  3GVA A;  4NUB A;  2CU7 A;  2LSO A;  2FQ3 A;  4I02 A;  4IRG A;  4WCG A;  2F5E A;  1N78 A;  3BY6 A;  2Q2E A;  5E8I A;  1P92 A;  1YYV A;  5EZH A;  4L9N A;  2M7B A;  3ZQL A;  1XPX A;  3MCZ A;  5D5W B;  3S2H J;  2ISZ A;  2VJJ A;  1P7I A;  1WFX A;  5FJ8 J;  4TV7 A;  5L3D A;  1FJL A;  4IOA F;  3HKZ A;  2GZW A;  2R5Z A;  3I0T A;  5D5V B;  1XD7 A;  1D5V A;  2FXA A;  1R5I D;  2KL4 A;  2MA3 A;  4A0Y A;  2R7W A;  1U8R A;  3CLO A;  2QBY A;  2CQX A;  1MNM C;  2PBI A;  2COM A;  1I27 A;  4ITV A;  2Y9Y A;  2IRF G;  4GFB A;  1K83 J;  2QA4 I;  3CDH A;  1KZH A;  5KNL A;  1WSU A;  1KU7 A;  5GPC A;  5HLH A;  3B6A A;  3ABK H;  2F6C A;  5C4J J;  1FBS A;  1W5C C;  2DA2 A;  2FMY A;  3TP0 A;  4E7Z A;  2VIX A;  3LQR A;  5EG0 B;  4EMS A;  5E20 A;  2H1K A;  1MD0 A;  3WOD F;  1YTY A;  3KZZ A;  1POG A;  2QGU A;  4XLN F;  1IZ1 A;  3FWE A;  2MC4 A;  4QTR A;  1G59 A;  5BPI A;  1TWG J;  3GTP J;  1MMG A;  4P96 A;  2KLO A;  2KIU A;  5J47 A;  3G2B A;  1C0W A;  1FYM A;  3PQK A;  5JHF A;  1O3R A;  2CV2 A;  1IW7 F;  1XDU A;  3CJQ B;  1KQ0 A;  5EEA A;  5J6X A;  1CF7 B;  1FIP A;  3F23 A;  2OCE A;  3ZMU A;  3OIO A;  4EV0 A;  5ICE A;  1RC9 A;  2O8K A;  1HDD C;  2XDV A;  3RPU D;  2YPR A;  2PI0 A;  3DEU A;  2GBY A;  3QPL A;  4RAY A;  4O6J A;  2DAO A;  3M8J A;  1S29 A;  3DPL C;  2ZSI B;  2H09 A;  2OQG A;  3J7A Y;  3SZG A;  2WV1 A;  2XF6 A;  1ZEL A;  4E4H A;  3DP7 A;  3BP8 A;  4C2U A;  4YIR X;  3COA C;  4M3F A;  2A68 F;  3R6S A;  2DDB A;  4LIV A;  2H94 A;  1WJA A;  1HF0 A;  1VQ5 I;  2M1B A;  1G4D A;  2QUF A;  1IXC A;  1VQ4 I;  3SYT A;  5GAG J;  4C3H J;  4HDV A;  2V9P A;  5DUK A;  3HTS B;  4JQF A;  5F64 A;  1JJ8 C;  4M6Y A;  5F6F A;  2DYS H;  1ZKG A;  1XMA A;  4MHG A;  4BGD A;  4XOR A;  1IN7 A;  3ABL H;  4RM3 A;  2R7U A;  4BQA A;  2Q0O A;  2LTP A;  3H3Z A;  4I0A A;  2P7V B;  2EZL A;  2LY2 A;  5D5U B;  2JA7 J;  1KGS A;  3RKX A;  2XRN A;  1VQM I;  1SVM A;  1MNE A;  1T0F C;  3OOU A;  4P9U A;  5JHU A;  2KDO A;  1VQO I;  2X1C A;  1QA6 A;  1EV7 A;  3EUK L;  1ETY A;  5EZG A;  4KJZ A;  5B66 C;  4N4N B;  1Z6T A;  4A6D A;  2VQH A;  1LKX A;  3K4J A;  4G9Y A;  2LRD A;  2RC4 A;  2BW3 A;  2R3S A;  1TWF J;  3LSJ A;  1FIA A;  4HF0 A;  1VQK I;  3CCR I;  3K4C A;  2ADU A;  4BE0 A;  1AHD P;  4DYQ A;  4EJO A;  1OR7 A;  4Z2Y A;  3CC7 I;  1P2F A;  3H0D A;  3JCU C;  2O9L A;  1TL8 A;  3CDL A;  2PFB A;  2A5Y B;  2NS0 A;  3PO2 J;  4UV8 A;  3CQZ J;  2NS7 A;  1AOY A;  2XAH A;  2XV4 S;  2R4G A;  2GQQ A;  1CF7 A;  1FOY A;  1IO2 A;  2LP0 A;  2PG4 A;  1XSV A;  1FYL A;  2KMU A;  3E6M A;  4C2T A;  4HX7 A;  1B8I A;  1JE8 A;  2BEO A;  3E7L A;  3WTU C;  1R58 A;  2ELK A;  4I98 B;  3JRH A;  3LA2 A;  4OIR F;  1BIA A;  4WX9 A;  4M73 A;  4MEY F;  2V79 A;  3JRB A;  2P5L C;  3EET A;  4KIS A;  3RKW A;  1ZG5 A;  5FLX K;  1XX5 A;  4K2E A;  1ZN2 A;  5FO5 A;  4E7K A;  4UNO A;  1IV6 A;  2M34 A;  3HOS A;  4C3I J;  1GV5 A;  3MQ0 A;  4HAM A;  5GAD J;  5D8L B;  2EFP A;  4DYR A;  3OYA A;  1OYY A;  1DGR M;  2XAQ A;  4LMY A;  4XBF A;  1DDN A;  2BHZ A;  2IS2 A;  4Q4Z F;  1S7E A;  3E1S A;  3MEX A;  2V26 A;  4KIG A;  1IXS B;  2M9H A;  2RVC A;  2A5W A;  2LD5 A;  1SD6 A;  3BZC A;  3KE2 A;  4LLL A;  2KPM A;  5FLV A;  3OL4 A;  2XVC A;  3HTU A;  2EFN A;  3LSK A;  1QBJ A;  2CQK A;  1LFU P;  3E5Q A;  5M5Y J;  4FIS A;  2IVM A;  3FXQ A;  5J40 A;  4ZYD A;  2EA4 A;  2RV8 A;  1B9M A;  1MBK A;  2XGD A;  4ABZ A;  1MH3 A;  3GWZ A;  2K02 A;  3F6O A;  3IL2 A;  3IWF A;  3BG5 A;  4I01 A;  4U87 A;  1Y0N A;  4DNC A;  3D5R C;  1XGN A;  2CFO A;  3ZOB A;  2DK5 A;  2K85 A;  3HHG A;  1Z05 A;  1BW6 A;  3BG7 A;  1R4M B;  4FX4 A;  1Y39 A;  2BE5 F;  5E79 C;  2W84 A;  3OV8 A;  1USS A;  3D1N I;  2F4M B;  3F3X A;  4XKB A;  3U9G A;  5H6Q A;  2KKO A;  3VOD A;  2CV0 A;  1Y8R B;  1E2X A;  5B3S H;  3I59 B;  4BQQ A;  3NAR A;  2Y9Z A;  2VC1 A;  4HLX A;  5CKT A;  2QF7 A;  2YR2 A;  4G8X A;  3SZP A;  2DXI A;  2Z99 A;  1SD5 A;  3K4K A;  4EAT A;  4RGS A;  4KIC A;  4QPQ A;  3HRT A;  5DV5 A;  1ON1 A;  3CCJ I;  3H5N A;  4M72 A;  2DMN A;  2P81 A;  2EWN A;  2PJP A;  2C6Y A;  3JRD A;  4RGR A;  3A4C A;  2XPW A;  3GLX A;  3CF2 A;  2O5R A;  3MKL A;  1OR7 C;  4CCN A;  3FBI B;  1NK3 P;  2A69 F;  2FEZ A;  2QZ8 A;  4GXO A;  3H36 A;  4CCM A;  3TP3 A;  2EK5 A;  2R7D A;  1VQ6 I;  2CUJ A;  3DKX A;  4ZZL A;  1J2X A;  1WI3 A;  5E1X A;  2E1M B;  3G1L A;  2M45 A;  3CCL I;  3LSH A;  2OA4 A;  3FX3 A;  4CYC A;  5TRD A;  3F8C A;  1W5S A;  2I5U A;  2JPC A;  2X6Y A;  3TMO A;  3KYD B;  1YW8 A;  2QKL B;  1F1Z A;  3U1D A;  4XLF A;  3S8P A;  1HKQ A;  2HI3 A;  2W1O A;  3ZQH A;  1TT0 A;  3JR9 A;  4MIM A;  1APL C;  4XMY A;  5A2Q Z;  5FKK A;  2DMU A;  4HA8 A;  3TO9 A;  1VF9 A;  3S1R J;  1S8N A;  3FXO A;  4AD9 A;  2MBF A;  3K0L A;  2PQ8 A;  2IGK A;  3NQO A;  1WQ2 A;  3TOA A;  2YUS A;  3ECO A;  4NQW A;  2XAF A;  2ZC2 A;  2L01 A;  3JTG A;  2V6C A;  1R22 A;  4A3L J;  2HPM A;  3GTM J;  1ETQ A;  4C9Y A;  1I1G A;  3CF5 F;  4GGG A;  2K5C A;  4X0G A;  3IRQ A;  4UUV A;  2O8X A;  4V19 K;  2D2W A;  2NVY J;  3N97 A;  4PSX A;  5GTI C;  2ZFU A;  4E70 A;  5TIS C;  4XL9 A;  2DOA A;  2CH0 A;  2PN6 A;  3CME I;  4M9X A;  1I3A A;  3IKT A;  2DOE A;  4HG2 A;  2M4G A;  1YW9 A;  2PMZ N;  1JT0 A;  4I76 A;  3V8J A;  5L3F A;  4WXH A;  1ZHF A;  3S32 A;  2DMT A;  3M4O J;  4X1E A;  2EQR A;  2HXO A;  4U88 A;  3TDU C;  3OIP A;  1GXQ A;  4CDG A;  2XSD C;  1R49 A;  3HRM A;  2A3S A;  1LDD A;  2WC2 A;  3FMS A;  3A03 A;  2BXY A;  4HZF A;  4NHJ A;  1K6O A;  3Q0V A;  2OPT A;  1HLV A;  4EJW A;  5DM7 F;  1Z21 A;  4JX5 A;  2NNN A;  3GTL J;  2VBZ A;  3BDD A;  2ZO4 A;  2E1O A;  3BR0 A;  3M1C A;  2DJN A;  2AO9 A;  4XSZ F;  2V4J C;  2D1H A;  1TW2 A;  3OSG A;  4II2 A;  3G71 I;  1XSD A;  1ACI A;  1ZR2 A;  1MBF A;  1D0Y A;  1Y6I A;  2LF7 A;  3AFH A;  3I3L A;  1JI8 A;  5H2F C;  1M1E B;  1N25 A;  4A3M J;  3WTX C;  3FM3 A;  3DEW A;  2HEO A;  2WTE A;  4KMU X;  3RPQ A;  2Z9O A;  3ZQ7 A;  2W85 A;  1ETX A;  2VOD A;  3VSK A;  2BY2 A;  5GTH C;  2NYX A;  1JUP A;  3EYI A;  1YX5 A;  4XKV A;  2Y69 H;  1YFH A;  3E5U A;  4AC0 A;  2MLG A;  1X4O A;  3BG9 A;  3KPH A;  1OQY A;  5IYB J;  3BTL A;  4XLH A;  5J8C A;  3BR5 A;  4ASN A;  3S2W A;  1ERD A;  3QPH A;  1O3S A;  1MMS A;  4M71 A;  1SD4 A;  3K10 A;  4OMZ A;  2WY8 Q;  4BBS J;  3E3V A;  4XN3 A;  4LGW A;  1I3Q J;  4BQN A;  3OYK A;  3LNQ A;  3S17 J;  2ZXI A;  2Y30 A;  3MAJ A;  4PK4 A;  3DV8 A;  2JRM A;  3IWZ A;  4OIO F;  3BZ6 A;  3C7J A;  3F21 A;  4HW0 A;  1ZLK A;  4XSX F;  3BQZ A;  5M5X J;  3ZQG A;  2M8G X;  2HDD A;  4Y3O A;  1FX7 A;  4I0B A;  3TBI A;  3RYR A;  1P7J A;  4HBL A;  1MBJ A;  2W25 A;  1TQP A;  3K4L A;  2AS5 F;  2A07 F;  5HVQ C;  2AQE A;  3CZ6 A;  3M3Y J;  1SFU A;  4BKX A;  2UXX A;  3HM5 A;  5HLG A;  3HG9 A;  4YFN F;  2GLO A;  1VND A;  1SFK A;  3OMY A;  1SEU A;  1BM9 A;  3RIR A;  3OR1 C;  3ZXS A;  2QSH X;  2HOS A;  2K9M A;  3HPH A;  4A6E A;  3TDZ C;  3K2A A;  4XRS G;  4GDF A;  1LVA A;  3OYM A;  2JJ7 A;  1FTT A;  2NVT J;  3GX4 X;  3ZN1 A;  4XN0 A;  3HYI A;  3LFK A;  1KYW A;  1S7O A;  2HYF A;  3S1Q J;  3O2P E;  2Z2S B;  2QLZ A;  2XAG A;  4E7I A;  2WWY A;  4RB0 A;  3DEE A;  4EJU A;  2E2J J;  1V5E A;  1UJ8 A;  2HGC A;  2RDP A;  3LSG A;  1TLH B;  3J7Z I;  1IF1 A;  4PJN A;  4ESB A;  4PJJ A;  2ESN A;  1IRF A;  2EB7 A;  5IOY A;  1QVT A;  1YIT I;  2Y0S N;  1PUE E;  3FF5 A;  3J81 K;  1WHU A;  3QP6 A;  3HOU J;  1V3F A;  3LSP A;  1FEX A;  2MD0 A;  4RDU A;  3BC8 A;  3OS2 A;  3EYY A;  4B44 A;  4FE4 A;  3ZMD A;  2P8T A;  1D0Z A;  3W2A A;  3HUG B;  2AXL A;  2UWM A;  3HGG A;  1EA3 A;  3KZI C;  2CMP A;  4Y7N J;  5JLX A;  1DQU A;  2DI3 A;  2HKO A;  4PSW A;  2E36 A;  2RNG A;  3PIP F;  3KEO A;  4P9F A;  4A0X A;  2KJB A;  2L7M P;  2PMH A;  4LJZ F;  1V5G A;  3BPX A;  3GTG J;  1IUY A;  5LHH A;  2VL8 A;  3GFI A;  2L4M A;  1HDP A;  3IV5 A;  2EIL H;  2YX4 A;  3WE3 A;  3I54 A;  2LG4 A;  5FD6 A;  1QQI A;  4RGX A;  1HKS A;  2FOK A;  2P5K A;  3ZR8 X;  2I10 A;  3A0H C;  2HFH A;  5GAH J;  2FRH A;  4M9Z A;  3ZGK A;  1X4P A;  5JI6 A;  4IHT A;  3E97 A;  3L00 A;  1RET A;  2FBI A;  1XS9 A;  2Q2E B;  1K79 A;  4QIW N;  3C2H A;  2ECB A; 
#chains in the Genus database with same CATH homology
 4XID A;  1FIP A;  5FKN A;  3OIO A;  5K7H A;  3ZQC A;  2O8K A;  1HDD C;  2EZK A;  3SFI A;  2GBY A;  2R5Z B;  3QPL A;  5K7F A;  4IHY A;  1JJ6 C;  4M3D A;  1ETW A;  1IDY A;  2JN6 A;  2WV1 A;  3C2B A;  1RPW A;  5C4X J;  3W6V A;  5M3M J;  2R93 J;  3HOY J;  3H3V K;  4MLO A;  4XK4 A;  4M3F A;  3PM1 A;  4UUS B;  9ANT A;  2DTZ A;  1HF0 A;  4LOC A;  1ZK8 A;  2E19 A;  4D5F A;  1JGG A;  2VI6 A;  1UMQ A;  1I6H J;  2WAQ N;  4C3H J;  2HOA A;  2XPV A;  1DU0 A;  3BR1 A;  1TWA J;  2FD5 A;  1H89 C;  4A3E J;  5F04 A;  1JJ8 C;  2CQQ A;  3NAU A;  1SAN A;  5E3N A;  3S1N J;  1ZKG A;  4IHW A;  1EF4 A;  2MSY A;  2ZB9 A;  5FLM J;  4JX6 A;  2LTP A;  4AUX A;  4IHV A;  2DMP A;  2EZL A;  2ECC A;  1OCP A;  2JA7 J;  3OOU A;  1SFO J;  1E3O C;  2DA1 A;  3RKQ A;  2EZI A;  1ETY A;  5EZG A;  1ZGW A;  2X48 A;  2RAE A;  3Q0W A;  5BNG A;  2MGQ A;  3BTJ A;  2R92 J;  5EEA A;  2DA3 A;  1TWF J;  3LSJ A;  1A6I A;  1FIA A;  5J1U A;  1BW5 A;  1X2N A;  2ME6 A;  1W0U A;  3HOW J;  4MFE A;  3FKI J;  1AHD P;  4DYQ A;  4A69 C;  3G1O A;  2O9L A;  2DA5 A;  2E2I J;  1MSE C;  4W97 A;  3CDL A;  1IDZ A;  3PO2 J;  4FCY A;  2KDZ A;  3CQZ J;  2NS7 A;  2M0C A;  1WPK A;  4M6V A;  5DS9 A;  3CMY A;  3F0C A;  4MFD A;  2LP0 A;  2XB5 A;  4D7N A;  3A01 A;  1B8I A;  1MH4 A;  1B72 A;  3E7L A;  4B1R A;  2ELK A;  3JRH A;  2XB0 X;  1X2M A;  1LE8 A;  3JRB A;  4B3A A;  5FKO A;  1Q1V A;  4D5C A;  4JP0 A;  3G1M A;  2DA4 A;  2K9S A;  3K7A J;  4XRM A;  3JRA A;  2JK3 A;  2TRT A;  2AHQ A;  1IV6 A;  2M34 A;  2FJ1 A;  4C3I J;  1GV5 A;  3QPS A;  1HCR A;  3GTQ J;  3L1P A;  4A3D J;  1VFC A;  2HXI A;  3FK7 A;  4DYR A;  5JLW A;  2Y31 A;  5J1Y A;  5EGO A;  2W48 A;  2R5Y A;  4A3G J;  1UG2 A;  5IPA A;  2LKX A;  3QQA A;  3JRC A;  1S7E A;  1JUS A;  1RES A;  4M3G A;  2R0Q C;  2M9H A;  5HOD A;  4XRS A;  2LD5 A;  1JTX A;  1WH5 A;  5GP9 A;  5FLV A;  1HOM A;  3HBL A;  2JMW A;  1H8A C;  1GDT A;  5IP9 J;  3FIS A;  1LFU P;  1BA5 A;  5M5Y J;  4FIS A;  3S14 J;  3A01 B;  1B8I B;  3SDG A;  2HYJ A;  2L7F P;  2LR8 A;  1B72 B;  2XGD A;  1MBK A;  3TW6 A;  5M5W J;  4ABZ A;  1LE8 B;  1MH3 A;  1AKH A;  1U9O A;  2KT0 A;  3BG5 A;  2IAI A;  1Z0X A;  5EYR A;  3ZOB A;  2FQ4 A;  2E2H J;  2LK2 A;  5GPA A;  1RR7 A;  1BW6 A;  3BQY A;  3BR2 A;  3VPR A;  4MO7 A;  1ZQ3 P;  3IH2 A;  3D1N I;  2N8G A;  3BG3 A;  2DMQ A;  5EGO B;  2VKV A;  2R5Y B;  1T33 A;  1IG7 A;  3NAR A;  3A02 A;  5FKL A;  2Y9Z A;  2JA5 J;  4HNV A;  4A93 J;  2CUF A;  2QF7 A;  2NS8 A;  1ZTR A;  4C3J J;  4DZJ A;  2HOT A;  3S16 J;  1U8B A;  1ETO A;  4B4C A;  4W1U A;  2DMN A;  2P81 A;  4X6A J;  3JRD A;  2K9N A;  1ORK A;  2XPW A;  1OCT C;  2IEK A;  2H8R A;  5EF6 A;  3H0G J;  1IRZ A;  2K9Q A;  3MKL A;  1NK3 P;  1O4X A;  3HOV J;  1AKH B;  3TP3 A;  1K61 A;  2VUM J;  1JKP C;  1WI3 A;  3FK6 A;  3G1L A;  2ME0 A;  1UHS A;  2EBI A;  1CQT A;  3HEF A;  4AYB N;  4CYC A;  2NVQ J;  2TCT A;  4FTH A;  4XIC A;  3WHC A;  3O8G A;  4FE7 A;  2L7Z A;  1Y1W J;  3I4M J;  3HB9 A;  2XPU A;  1FTZ A;  3GTO J;  2HI3 A;  3ZQH A;  3FIW A;  3JR9 A;  4MIM A;  1APL C;  2Y2Z A;  5FKK A;  1QRY A;  2DMU A;  5F1J A;  1JT6 A;  2DA6 A;  1VF9 A;  3S1R J;  1XC5 A;  1OFC X;  3BTC A;  3GBG A;  5F0F A;  3B6C A;  3S2D J;  3HOZ J;  1JKR C;  2YUS A;  4DW6 A;  2G0E A;  5IP7 J;  3HOX J;  4A3L J;  3GTM J;  1OJL A;  2LFB A;  1ETQ A;  5F0C A;  2NOG A;  1BJZ A;  2IBD A;  2NVY J;  1YRN A;  2CJJ A;  4I6Z A;  4NDL A;  4BY7 J;  1RKW A;  4JYK A;  4A3J J;  4L5E A;  2QCO A;  3OSF A;  3BT9 A;  2XGE A;  2DN0 A;  1JTY A;  1JKQ C;  3IH3 A;  1LFB A;  2LY9 A;  4CYC B;  2PMZ N;  1JT0 A;  2YU9 J;  4I76 A;  2MW8 A;  1NK2 P;  1WH7 A;  4UUT A;  2JA6 J;  2DMT A;  1ZR4 A;  3M4O J;  4BY1 J;  1T56 A;  3Q3S A;  4X1E A;  2EQR A;  2HXO A;  2K40 A;  1DU6 A;  2D5V A;  1BL0 A;  4M3B A;  2XSD C;  2L0K A;  3A03 A;  3Q0V A;  2OPT A;  4Y52 J;  1HLV A;  4JX5 A;  1GVD A;  3GTL J;  2E1O A;  3BR0 A;  4A3C J;  2DJN A;  2AO9 A;  3IH4 A;  5EDN A;  1WCM J;  2WB1 N;  3WHB A;  4A3I J;  3S15 J;  2LVS A;  3GTJ J;  3OSG A;  1ZR2 A;  1MBF A;  1PUF A;  3TED A;  4A3M J;  1D5Y A;  3DEW A;  4RBO A;  3RZO J;  1ENH A;  5FKM A;  5IYD J;  1YRN B;  1AU7 A;  1ETX A;  2COB A;  1JUP A;  2EH3 A;  2VPR A;  4JX4 A;  2NVX J;  4AC0 A;  4V2F A;  4EEF G;  4A3F J;  2GM4 A;  4BXX J;  3BG9 A;  5IYB J;  3BTL A;  1ITY A;  3BR5 A;  4J19 A;  3JRF A;  4QSH A;  5J3L A;  5E3M A;  2X6O A;  1GUU A;  1IUF A;  2JWT A;  4BBS J;  3LSR A;  1NTC A;  2JA8 J;  2OF7 A;  1I3Q J;  4IHX A;  3I4N J;  1IGN A;  3ZQI A;  5F27 A;  1TWC J;  2XGC A;  3LNQ A;  3S17 J;  1MBE A;  2Y30 A;  1RKT A;  2B63 J;  2EZH A;  4V2G A;  1GV2 A;  1Z77 A;  5K7Z A;  4IEJ A;  2CUE A;  3HKZ N;  3BQZ A;  1ETK A;  1JUM A;  5M5X J;  3ZQG A;  2M8G X;  2HDD A;  3BTI A;  1P7J A;  3BR6 A;  3JRG A;  1PUF B;  3JRI A;  1MBJ A;  4D7M A;  1A5J A;  1X58 A;  3M3Y J;  5J1R A;  1G2H A;  4BKX A;  3O8H A;  3HM5 A;  1IJW C;  2GLO A;  1VND A;  2HOS A;  1XG1 A;  4S0H B;  1MBH A;  3K2A A;  1TWH J;  4XRS G;  3TW7 A;  2O7O A;  2JJ7 A;  1FTT A;  2NVT J;  2X9D A;  1QVU A;  2L9R A;  2MG4 A;  4DZP A;  1VI0 A;  2HQ5 A;  5IYC J;  3UKG A;  1TC3 C;  3S1M J;  3JRE A;  3LOC A;  3S1Q J;  5C3E J;  3CCY A;  4DYC A;  1MSF C;  1R9T J;  5E3O A;  1IC8 A;  5DTD A;  1F36 A;  1QPI A;  1I50 J;  4A3K J;  1MBG A;  4M3E A;  5EG0 A;  1W0T A;  3DCF A;  5C44 J;  1Y1V J;  2E2J J;  3LSG A;  2DA7 A;  3ZQF A;  3BR3 A;  2CU7 A;  4A3B J;  2ID3 A;  3HGY A;  5IOY A;  1QVT A;  1GT0 C;  2Y0S N;  5EZH A;  1U78 A;  3Q0U A;  1WGX A;  3MN2 A;  3RQI A;  3ZQL A;  3HOU J;  2YS9 A;  3S2H J;  3LSP A;  1FEX A;  1P7I A;  5FJ8 J;  4RDU A;  3RZD J;  1FJL A;  1U9N A;  4FE4 A;  2R5Z A;  3SJM A;  3HGG A;  2LLK A;  5IP6 A;  1H88 C;  2FX0 A;  3GTK J;  5F08 A;  4Y7N J;  3HDD A;  5JLX A;  2CQX A;  5E3L A;  1MNM C;  2Y9Y A;  4GFB A;  1K83 J;  2R7Z J;  1F43 A;  2L7M P;  5GPC A;  3B6A A;  3MVP A;  3GTG J;  5C4J J;  2M2E A;  4UUS A;  1HDP A;  2DA2 A;  3IV5 A;  3TP0 A;  1JKO C;  5EG0 B;  2H1K A;  2CRG A;  1ETV A;  1POG A;  4BBR J;  2XRL A;  4QTR A;  2I10 A;  2VKE A;  4C2M J;  1TWG J;  3GTP J;  4G12 A;  5M3F J;  5F0H A;  2ID6 A;  1RET A;  1XS9 A;  4QIW N;  5IOZ A;  2ECB A;  3PO3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...