5H20A

X-ray structure of padr-like transcription factor from bacteroid fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
DNVKSQMRKGMLEYCIMLLLHKEPAYASDIIQKLKEARLIVVEGTLYPLLTRLKNDDLLSYEWVESTQGPPRKYYKLTGKGESFLGELEASWKELNETVNHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of BF2549, a PadR-like transcription factor from Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transcription regulator
molecule keywords Putative PadR-family transcriptional regulatory protein
total genus 32
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5h20A00
5HS8A 4A0YA 2EV0A 1KA8A 3FM5A 2BYVE 1KQ8A 3V4GA 1K79A 2R3SA 2LF8A 5A2QZ 5JR3A 3ROUA 3ZMTA 4G7HF 1X3UA 2K7LA 3E6CC 1QPMA 2RGVA 3BDDA 3Q9VA 3IHUA 1LVAA 1R5HA 1ON1A 2QBYB 3KEOA 4L5JA 3KZZA 1G6NA 4OMYA 3QAHA 4PCQA 3IKTA 1XGSA 3MWMA 3DP7A 3IKVA 2GIVA 1UCRA 2IA1A 4HW0A 2XASA 2P6SA 2YPRA 1SFEA 2QVOA 2K4JA 4L0YB 1MZBA 4KUMA 1T98A 2BGCA 4AIHA 4LD5A 1DDNA 3HHHA 4A5NA 1BBYA 4L9TA 2COMA 4Z2YA 3LWFA 4BAYA 3CDHA 1PP8F 4TV7A 4ZH4F 3WTXC 1XGNA 4EJOA 4HBLA 4ETSA 4HAMA 4KMFA 3VB2A 4D0PA 3V7SA 4KN7X 4JK1X 1IXRC 2PFBA 5FO5A 3MAJA 1WRJA 1T6SA 1RUNA 2A61A 1U78A 3QP5A 3GEZA 4I98B 4KDPA 1H0MA 1L3LA 2GQQA 1IUYA 3U2RA 1MJAA 3VODA 2Z99A 3GLXA 2FBIA 3ECHA 3K1PA 5FFZA 2WV0A 1YQAA 3H3UA 4HQEA 4ENJA 5ICEA 1ULYA 2XAQA 3R4KA 4UVBA 5LLQA 2L01A 1B6AA 4MGRA 5LRRA 1BJAA 3FXUA 3GYHX 3FZVA 1HSJA 4LGWA 3I4PA 3I59B 1G3TA 3TO6A 2FOKA 1GXPA 1FBQA 3EYYA 3CLOA 1EH8A 1OMIA 1LDJA 2HR3A 5L3DA 2FBKA 4IRHA 2L02A 1YLFA 3MEXA 5CYVA 3E6MA 4ZZDA 3C18A 4N9HA 5FGMA 2VBZA 4P55A 5KK1A 1J59A 4A0XA 3CO6C 1E2XA 3ERED 2OD5A 1BN5A 1XMKA 4B8XA 1P92A 4U0VA 3FHZA 2MBFA 2O0YA 2V6CA 3V7CA 5FD6A 1TQMA 1AOYA 2ACJA 1FBSA 3T8RA 2ESNA 4OIQF 1K6OA 1YW9A 3DFGA 1KU9A 1FX7A 2VONA 2M8EA 5FB2A 1P4WA 4RB0A 3PFIA 1HW5A 4P9UA 2QWWA 1STZA 2UXXA 1ON2A 3CUQC 2FE3A 1BIBA 4A2UA 2O61A 1R00A 3LQQA 3HOTA 3DPTA 1ZGJA 3RYPA 5IT9K 3KLOA 4WXHA 2MA3A 1PDNC 5H6RA 3LAPA 2L4AA 3KP7A 5LEKA 2IRFG 5CJ9A 1YO5C 3QPHA 4I2OA 2GA1A 4I0BA 2ESHA 2HKXA 5J8CA 4UVCA 1LEBA 2G7UA 2K27A 2XGXA 2QYOA 1G4DA 1QGPA 4EGZA 1EV7A 3K0LA 5JFRA 3OV8A 1REPC 1JXSA 2GZWA 3SFZA 4XBFA 4MEYF 2TDXA 2AS5F 3U9GA 4U88A 2KKOA 4P5OA 4KN4X 2UZKA 5HDNA 2OU2A 1B4AA 3GF2A 2BE5F 2XKPA 4HF0A 5F6FA 5AIQA 3E97A 5FD5A 3D5LA 2J5PA 4GCVA 3F23A 3H3ZA 3MZYA 1D8JA 2O6GE 3I71A 1U3EM 2LSOA 5CVVA 3MFKA 2VODA 4FT8A 4Y15A 4IF4A 3QP6A 4CZZA 2PQ8A 3R60A 3J81K 5D5WB 3WU0A 1I5ZA 2DLLA 3H92A 3NRVA 2NRAC 2VBXA 4L9VA 2HZTA 4MHGA 1U5TB 4G9YA 1H9TA 4RGUA 2HWVA 4KIBA 4EGYA 1ZYRF 4BYYA 4LK0F 1J75A 4A6EA 1I1SA 2Y48A 4G6DA 1BI2A 4OOIA 1SD4A 3W6KB 4CGZA 5DUIA 1MGTA 1W7PA 3C3WA 5HS9A 2MLKA 1DP7P 3NEUA 2XVCA 3R6SA 4AD9A 3V7RA 3E6BA 3KP5A 2IW5A 2VBYA 5DEQA 4IJAA 4UNOA 3M8FA 2F5DA 5HLGA 3BROA 1P6RA 1J9IA 4WF2A 1TQIA 4M9SA 4MNUA 4WXDA 2EK5A 2XV4S 3ZMSA 1XGOA 1LDKB 1RZ4A 2A3SA 4M9ZA 1Z6TA 2KJBA 4MQVA 1XSXA 2Z33A 2XROA 3TOAA 1SMTA 3CUQB 1ZHFA 3WU1B 3ECOA 3FM3A 1DPRA 3IL2A 1HW2A 4YFXF 1R1UA 1L0OC 1FLIA 2O3FA 2K86A 5H20A 5DCMA 2QBYA 2DBBA 2CWEA 2ZJ2A 2CW0F 2E7WA 3HTSB 1IN7A 1TNTA 5D5UB 1SFUA 4BHBA 4OIPF 4O6JA 3PQKA 2FEZA 1TTYA 5E8IA 5JI6A 4DNCA 2W57A 2D45A 1TQPA 5D5XB 4RB3C 1S6LA 2Z9OA 2ZKZA 1UB9A 4EM0B 2XUBA 5AONA 3EYIA 5KVRA 4L9NA 3KP6A 2HKOA 2FF4A 2VN2A 2FNAA 2WTEA 5HDKA 2G7HA 5L3BA 2PI0A 3SXYA 2JSCA 4FX0A 1FP2A 2DQRA 1D5VA 2KRFA 2FBHA 4WK8F 4HX4A 3G73A 5ED4A 2E7XA 1XMAA 3P7NA 1IAWA 2BEOA 5K5QA 2EFWA 3JSPA 5D6FA 4WWCA 4NHJA 4EJTA 3J81Z 2B0LA 2P4WA 2VC1A 1R22A 4G6QA 2MD5A 5LHIA 1YFHA 1GVJA 3B02A 1XCBA 5LGNA 4F7ZA 3FXQA 2VE8A 3BOQA 5D4RA 1KU2A 3HTUA 1LJ9A 1J5YA 5FLXZ 1BOAA 1ZLKA 5JVTA 1R5GA 1ZREA 3BY6A 4AIJA 4Q48A 1TNSA 2P7VB 1ZG1A 1FPQA 2KJCA 2L54A 1Q1HA 1H9GA 1P4AA 1Z7UA 4HLXA 4N0BA 1JHFA 5BOXA 2CG4A 2M1BA 5LGTA 2G9WA 5BMZA 3GFLA 1JGSA 2RC4A 1O57A 3KEQA 3CUOA 1SFXA 1MD0A 1QQIA 5L3CA 3GUDA 2EB7A 2GXGA 2QZ8A 2O8XA 5L3EA 1D8KA 1MDMB 1ZH5A 2DAOA 2X0LA 5E8GA 2EFPA 2KIFA 4UUVA 1R23A 4A12A 5CVRA 1G3YA 2YU3A 2J5OA 4Y13A 4ENNA 2QQ9A 4U0WA 1FYKA 5AIPA 2NAZA 4LLNA 2V1XA 3WTTC 1I1GA 1SMYF 1W5TA 2HQNA 4CDGA 1DUXC 2DK8A 2FA5A 1R36A 3JSOA 2F5FA 4M6YA 2EWNA 3I58A 4EM2A 1K78B 5J8FA 1RIOH 4YFNF 1OKRA 2EV5A 4EJWA 3N97A 1QNTA 1RI7A 2CYYA 1IRFA 3I5UA 2YX4A 3R0JA 1O3RA 5ICGA 3DQVC 2IP2A 1ZARA 2EA4A 2DW4A 2QENA 3ZPLA 2ZNYA 2IJLA 3FX3A 5LEJA 3RI4A 2IA2A 1BI3A 1BM9A 4WCGA 2K02A 4GYIA 3ULQB 3IRRA 5HDGA 4UXNA 2LKPA 2GAUA 5CVIA 6PAXA 3FXRA 5ILUA 2ISYA 3LAJA 1RUOA 2F5EA 1YYVA 3RIRA 3SZTA 1P2FA 2OQRA 1EH7A 4P9FA 3WE2A 4ON0A 1Z9CA 2DQLA 1YW7A 2ETHA 4BNCA 2IT0A 1LEAA 2OZ6A 4G7OF 4EJUA 1PP7U 4LG0A 5BPDA 5FFXA 4Y17A 2UXNA 4UHTA 4ZYDA 2Q2EA 1YS7A 2K4BA 3KE2A 3GVAA 3HSFA 2DPDA 1LNWA 4CHUA 4KFCA 1G3SA 2JRTA 5A2QK 1IRGA 4H0EA 4WX9A 3TO7A 4IRIA 3RKYA 1HKQA 1T0FA 3T5XA 1S7OA 2XAFA 1O3TA 4FHTA 5DD4A 3RKXA 3ML6A 4KT5C 1P4XA 1ZLJA 1EH6A 2VE9A 2R7FA 4HX8A 5CVJA 3MZHA 3GFIA 1IZ1A 3ZN0A 2E1CA 5D5VB 3GW2A 5E17F 1S3JA 1V4RA 4WXCA 4LG0B 5FLXK 2V1DA 3L2CA 3P9KA 2ZO4A 1E17A 4YIFA 3KP2A 1NHAA 4JQFA 2Q8KA 4MEXF 3HRTA 3DKWA 1U5TC 3F21A 4GGGA 4PDKA 1Z05A 4FX4A 4UVAA 2XAHA 2C6YA 2FXAA 2VOOA 4I0AA 2EFNA 1BC8C 3BWGA 5J6XA 3RKWA 2MLGA 4U0YA 1W7PD 4K2EA 1YW8A 3RDIA 3WG9A 2QQAA 3I54A 4HLYA 1IF1A 4I02A 3BJ6A 2MC3A 2DI3A 1ODDA 4ESJA 4G8XA 1HKTA 3HUGA 3F22A 1ONVA 3EQLF 1B1BA 5LRSA 3FF5A 2NNNA 4MTDA 4ASNA 3BPVA 1HQCA 3V8JA 1CF7A 1D3YA 3F6VA 2V9VA 3ZMDA 3WGIA 2RVCA 4QLCU 1FYMA 3GX4X 2JZYA 3KCCA 4HOBA 4YFKF 3T1BA 3M1EA 2QLZA 1U6GA 2A6HF 4ESFA 5DV5A 1LB2A 3SZPA 2A69F 3F8FA 2H6BA 1MJ9A 1Z1DA 1BC7C 1YTYA 3C7JA 4M6XA 3GWZA 2ISZA 3TGNA 3WGGA 4KIGA 5BQTA 5LHHA 1VTNC 3F8NA 3KLNA 1K78A 2EFOA 2W25A 2DT5A 2QUFA 2H09A 3KZYA 1IN6A 2CSOA 1OPCA 1J0RA 3TOBA 2F5CA 1HBXG 1QZYA 3KFWX 3SQNA 2P7CB 3K1NA 3HRMA 1LDDA 3MCZA 1HKSA 3F3XA 5ICCA 5DDGA 4PGHA 4RS8A 2HYFA 2ZMEB 1ZRDA 2FMYA 3E5XA 4IPAA 4AVPA 1SAXA 3EETA 4HF1A 5HS7A 1DPUA 1FYLA 5HLIA 4RGXA 3WTZA 1OYIA 1ZG3A 3WTWC 5JHUA 1FY7A 2FQ3A 2HGCA 1FBUA 4XSZF 3KP4A 1BI0A 4RGSA 2PMUA 4Q47A 2AXLA 3CO7C 4OINF 3L9FA 4XLPF 1I6XA 1JHHA 3IWFA 3EUHA 1O3SA 1KYZA 3FMSA 2OBPA 2YR2A 2CO5A 4HV6A 1IXSB 5LBQA 1ZRCA 4GYGA 1K7AA 4N9IA 2M87A 4HDVA 3F8CA 4BQAA 4QWQA 4ZYHA 3D0SA 5EEGA 5D8LB 1Y0UA 1T39A 1ZAOA 4R1HA 4AIKA 1R1TA 5HLHA 4A0ZA 1IW7F 1OR7A 4B09A 2P5LC 3GZ6A 3BZ6A 1IN8A 3WTYC 1HW1A 2FNPA 3RTRA 5E1XA 3JTGA 2PN6A 3BJOA 1AWCA 2PBIA 1UFMA 3IC7A 4RB1A 3WTSC 2STWA 2Z5UA 1W7PB 4EMSA 3K1MA 5E18F 1V3FA 1T2KA 2LNBA 4S05A 2NS0A 2M45A 3KETA 2VXZA 5K5RA 1XDUA 2OA4A 1WWXA 3V8LA 1ZGAA 2DU9A 3DEUA 1IXCA 2LF7A 1SD5A 1JE8A 5LHGA 2HS5A 2OZUA 2MH2A 1YIOA 3KP3A 5DD8A 5DYMA 3J80K 3JW4A 3B73A 2JPCA 4LFUA 4IRGA 2P8TA 1KU7A 3TKYA 2H27A 4KYWA 2ELHA 3VFZA 2L4MA 3JTHA 4LMYA 2W24A 3F8BA 2EV6A 3GO5A 4R79A 2XAJA 2JT1A 2A07F 3WTVC 5IT9Z 3DV8A 2X4HA 4Q4ZF 4LK1F 4NB5A 5CLSA 3JAMZ 2M30A 2RNJA 4I09A 1IN4A 2DTRA 3L7WA 4PGGA 2ZNZA 3DF8A 5DCFA 4EM1A 3ELKA 1WQ2A 3I64A 1F1ZA 3LA3A 4L5IA 2V1UA 2ZCWA 2DK5A 1B9NA 3HOSA 4M9XA 3FMQA 1Z91A 2RQPA 1I27A 2HOEA 2BV6A 1O7FA 3HYIA 1XCVA 1MKMA 2A5YB 2RKHA 4EQQA 1UHMA 1LQ1A 1J7KA 2IVMA 1FNNA 4RB2C 3WE3A 1U5TA 2V79A 4M74A 2HEOA 2P5VA 1FSHA 5HVQC 1FP1D 2FRHA 4IHTA 2YX7A 2E1NA 2QQBA 4AWXB 1MJBA 3RJPA 1KYWA 2W85A 3G3ZA 4ZYEA 1RNLA 3CJNA 3L00A 3I59A 2STTA 4CYDA 2P6TA 1G3WA 5D4SA 2JPBA 4OU0A 2HQRA 3Q5FA 3HIFA 4R8HA 2D1HA 3ZQ7A 1S8NA 4ENMA 5BPIA 1S7AA 3I0TA 3F72A 3E3VA 5E20A 4HDUA 1WKMA 5ILVA 4LLGF 4KNYA 4NQWA 3GXOA 3ZP5A 1QZZA 3SHFA 2PLYA 3I53A 3RPQA 2QM3A 1TBXA 4DQ2A 3WODF 1OYYA 2Y75A 3QU6A 4I7HA 2VOPA 4L18B 3OOPA 1F9NA 5CVUA 1FC3A 3ZMVA 1XN7A 1SD7A 2RV8A 5F64A 3T8TA 3IWZA 2XKOA 3Q9SA 1KGSA 4L0ZB 4U7BA 2XAGA 2DFIA 2RN7A 3HSRA 1ZRFA 3QOPA 4LLLA 1WSUA 1TLHB 2CFXA 3E5UA 1T38A 4LB6B 4MQ9F 5D8KB 2FSWA 4G94A 1GHCA 3HRSA 1ZN2A 3FMRA 2GXBA 4GXOA 2EJRA 1QBJA 1MDMA 1TW2A 4JBAA 5LGUA 2YSRA 2D2WA 3LA2A 1FWZA 3GFJA 2FMLA 3O2PE 4S04A 3N4MA 1BI1A 2FU4A 4RAYA 1OYWA 1KQ9A 2P5KA 2OAZA 2IPQX 3TO9A 2DPUA 4A5MA 4LB5A 4ZYGA 4KMUX 1A04A 4XRFA 3VOEA 4IHSA 1SD6A 2KIMA 3HSEA 3REOA 2HDCA 2BBYA 1CF7B 2HYGD 2UWMA 3E5QA 1U8RA 2OQGA 4HYEA 3QPTA 1PUEE 4MTEA 5ILSA 2H6CA 1CGPA 3M8EA 5ICFA 3W6JB 4Q5SF 1R1VA 1XSVA 5E1WA 4L9JA 1O7LA 2PMHA 3LA7A 4GO1A 4BXUA 3VEPA 3CTAA 4YIIA 2O03A 4IVNA 1HSTA 4U7DA 2MH9A 2H94A 4BHCA 4OIOF 1XD7A 3LSTA 4G7ZF 3HRUA 3T0YA 4CO8A 3E6DA 1XDSA 4EVIA 5ERIA 1F4KA 1R7JA 1O3QA 3QU3A 2DO7A 4IXAA 2VT3A 1KQ0A 4UV8A 2CGPA 5E1ZB 1WI9A 5HOOA 3O3KA 4E70A 2EFQA 1W4MA 3U1DA 2Y0MA 2Z3YA 3ABUA 1R58A 1HXDA 4CXFA 1BIAA 1XSDA 5L3FA 4HQMA 2R7DA 3WGHA 4ESBA 3JAMK 2XHKA 4HZFA 1QO0D 3IRQA 3MQ0A 3HHGA 3EDPA 1FT9A 3FWEA 2XRNA 3ISPA 2ZBKA 5L3GA 1FOKA 5EEHA 2KIUA 3BP8A 3O6BB 3QRFF 3F6OA 3J80Z 4HX7A 3M7GA 3COAC 2VT2A 2WC2A 4HF2A 4P96A 2WWYA 5D6EA 2A68F 3ZMZA 2VBWA 2RDPA 5H6QA 4M72A 3R0AA 4I01A 4CICA 3R61A 1XGMA 2ZMEA 3GZ5A 2W84A 1UHWA 3P9IA 5DUKA 4BHPA 4KICA 3WTUC 1S29A 2NYXA 4M71A 1U2WA 4XSXF 3ZMUA 5K5OA 2HTSA 3K9TA 5IT3A 5BS6A 3J7AO 2XIGA 5TJJA 2GWRA 4PZJA 3C1DA 1IN5A 3BJAA 1B9MA 3BPXA 3L09A 3P9CA 1USSA 2PJPA 2PG4A 3NQOA 2ADUA 3DXJF 4KA4A 4OIRF 4A6DA 3K69A 4ZZLA 1ZG5A 2ZXJA 2M5WA 2A6EF 3TDUC 2GA2A 1F5TA 3RPUA 5K1YA 3F8MA 4RAZA 2IA0A 4XLNF 3CUQA 1USTA 2Q0OA 3GFMA 3M9AA 2HFHA 2D1VA 3TQNA 3S2WA 4YG2F 5TRDA 1GXQA 1KU3A 1Z6RA 4HV5A 2PEXA 5F1RA 1YS6A 3ZN1A 4LJZF 2ZFWA 2NNYA 4EV0A 1B59A 2VC0A 1FSEA 4EJVA 1FZPB 2HTJA 2JTVA 4RGRA 3K2ZA 3RYRA 1J2XA 3V8KA 3AAFA 2CQKA 1XB4A 4O5VA 1TW3A 4UV9A 3PQJA 1C0WA 2LDUA 4OMZA 4O3MA 4HA8A 1YG2A 3TDZC 2EA2A 2L3DA 3LQRA 3ABTA 3DPLC 1W5SA 4M73A 4ENKA 4BH9A 2F2EA 4KIFA 3LFKA 5DCMB
chains in the Genus database with same CATH superfamily
4ZDPA 3HOWJ 1EA3A 5HS8A 2W00A 1XPXA 1OFCX 2CJJA 1MBHA 4NC7A 4A0YA 2Q1ZB 2VQGA 2EV0A 1KA8A 2R4GA 3FM5A 3FXMA 2X6YA 2BYVE 1VQOI 3IH2A 2VUMJ 1KQ8A 1VQ4I 3RZOJ 3IUOA 3V4GA 1K79A 3I3LA 3HOZJ 2R3SA 1VQ9I 2LF8A 5A2QZ 5JR3A 3ROUA 3SYTA 2F4MB 3A0BC 1OLTA 1X1BA 3ZMTA 4G7HF 2Y30A 1I50J 1X3UA 4C3IJ 2K7LA 3E6CC 1QPMA 3BTCA 2E2IJ 4LIUA 1ZR2A 2MG4A 2RGVA 3BDDA 3Q9VA 3IHUA 1LVAA 4EEFG 1D0XA 1R5HA 2MC4A 1QPIA 2EINH 1ON1A 4RA2A 2QBYB 3KEOA 4L5JA 3KZZA 2CW7A 3CC4I 1G6NA 2LKSA 4OMYA 3OWTA 3HC7A 3QAHA 3QWLA 4PCQA 4DZPA 3MWMA 1XGSA 2NXNB 3IKTA 3DP7A 3IKVA 3C2GA 3DBLB 1P7JA 2GIVA 1T8IA 1UCRA 1V5GA 2IA1A 4HW0A 2XASA 2W4SA 2P6SA 2NS7A 2YPRA 1SFEA 2QVOA 2K4JA 4L0YB 2TRTA 3PL8A 4PJJA 1U0JA 1MZBA 4KUMA 2HDDA 2QSHX 1S5LC 1T98A 1U9NA 5H2FC 3RQ4A 3OYJA 3KIOA 2BGCA 2FUG2 1R6RA 2K3PA 5FKLA 2EIKH 1JKPC 3I9V2 3AFHA 4BQQA 4AIHA 4LD5A 2WAEA 2X48A 1DDNA 2BVMA 4ZTFA 2R92J 3A0HC 1TT5B 2DMPA 3HHHA 4A5NA 3M1CA 1BBYA 2RAEA 5EJCA 1OQYA 2VPRA 2COMA 2MW8A 4L9TA 1BL0A 4Z2YA 3LWFA 2VKEA 1RKTA 4BAYA 1IJWC 4E7SA 3UNGC 3CDHA 2I10A 1PP8F 4TV7A 1YJ9I 4ZH4F 4ZDOA 4XLHA 3WTXC 5IP9J 1XGNA 4EJOA 4HBLA 4ETSA 4HAMA 4XKCA 2JSPA 2X1EA 1V5FA 1J09A 4M3EA 4KMFA 2B63J 1AHDP 5EF6A 2E5NA 3OIPA 3VB2A 4D0PA 3HM5A 3V7SA 4KN7X 3F9KA 1FOYA 4JK1X 1IXRC 2PFBA 5FO5A 3MAJA 1WRJA 5E79C 1T6SA 2M4KA 4F92B 1RUNA 2A61A 1U78A 3S93A 3QYFA 1LE8A 4BBSJ 2ME0A 3GEZA 3QP5A 4I98B 4NNJA 5B3SH 2GM4A 1WGXA 1JJ8C 2DYSH 3H5RA 3H9JA 1H89C 4KDPA 3HPGA 3VWBA 1H0MA 1L3LA 2V26A 2VASA 2GQQA 3HG9A 2FQ4A 1IUYA 3U2RA 3CCQI 1MJAA 4I6ZA 3VODA 1Y56A 1WJCA 2Z99A 3GLXA 2FBIA 3ECHA 1SVLA 2ZSIB 3E7LA 1BR4A 3K1PA 3FKIJ 3PSIA 5FFZA 2WV0A 5GAGJ 3E0JB 1YQAA 3H3UA 4P1WA 4IOAF 4HQEA 4ENJA 2NVYJ 5ICEA 1ULYA 2HOTA 3A01B 2XAQA 3S14J 2CQQA 3R4KA 3IV5A 2LREA 3HB9A 2E1MC 4UVBA 5LLQA 4II2A 2L01A 2R7RA 1AA7A 1B6AA 4MGRA 5LRRA 4X1EA 1BJAA 4FE7A 3FXUA 5KHDA 3I4MJ 1ITYA 4G6TB 3GYHX 3FZVA 5F0HA 1HSJA 1HA8A 3HXLA 1GV2A 4D7NA 4LGWA 4RLQA 3I4PA 3I59B 1G3TA 4AYBA 3BTIA 3TO6A 1WJAA 3MD2A 1TL8A 3VYRB 2FOKA 2MABA 2IS6A 3K6GA 4CUGA 1FBQA 4JOMA 1GXPA 4BL0B 2R7UA 3EYYA 3CLOA 4YRVA 2K9QA 3PO2J 1EH8A 1OMIA 2D5VA 1LDJA 1HDPA 3DTKA 3OYKA 2HDWA 2HR3A 5L3DA 2FBKA 2LY9A 4IRHA 3OIQA 3K70C 2L02A 4RMNA 1MMGA 4OWRB 4YELA 1YLFA 3MEXA 3ABMH 5CYVA 3E6MA 4ZZDA 5J1RA 3C18A 5GP9A 4N9HA 2KIQA 5FGMA 2VBZA 4P55A 3PNVA 5KK1A 1J59A 4A0XA 3CO6C 1E2XA 3ERED 1HDDC 3PUFA 2OD5A 1BN5A 1XMKA 3PFYA 4B8XA 4JX6A 3OSGA 1P92A 4U0VA 3FHZA 2M2EA 3OYDA 3AL0B 2MBFA 2O0YA 2V6CA 3V7CA 3V42A 3JCUC 5FD6A 1TQMA 2AO9A 1AOYA 2ACJA 1FBSA 2CH0A 3T8RA 5GPCA 2ESNA 4OIQF 2XF6A 2LYCA 2L9VA 3DFGA 1YW9A 1ZTRA 1K6OA 3M4OJ 4XMYA 1JKOC 1KU9A 1FX7A 3FHNA 4AC0A 2VONA 1JUPA 1SANA 5EGOB 3OYEA 2M8EA 5FB2A 1P4WA 3AG2H 2WA0A 3J7YJ 4RB0A 3PFIA 2M9HA 3L2QA 1HW5A 4P9UA 2QWWA 2ECCA 4F55A 1STZA 4QIWN 2UXXA 2GXAA 1IC8A 1ON2A 3CUQC 2FE3A 1BIBA 1VNDA 2QKMB 3PJRA 4A2UA 2PJRA 2COBA 2DOFA 2HPMA 5M3MJ 2BY1A 3OS1A 2O61A 1R00A 3LQQA 3HOTA 1JGGA 3S15J 3DPTA 2HOAA 2VIXA 1ZGJA 3ZOBA 3BZCA 2VQCA 3RYPA 5IT9K 1I3AA 3KLOA 4WXHA 1K4TA 2MA3A 1PDNC 5H6RA 3LAPA 2L4AA 4F91B 3JRBA 1WZ2A 3KP7A 5LEKA 2IRFG 5CJ9A 5EEAA 1YO5C 2K9LA 1UMQA 2LTPA 3QPHA 3JRHA 2L9NA 3ZCOA 4I2OA 2GA1A 4I0BA 4XR6A 1ENHA 2ESHA 2HKXA 5J8CA 4UVCA 4BKXA 2DDAA 2G7UA 1LEBA 2K27A 4XK4A 5JVGF 2V1NA 2XGXA 2DYRH 2QYOA 1G4DA 1QGPA 4EGZA 3LOCA 1EV7A 1LE8B 3BLYA 1POGA 2LK2A 4MFEA 1OCCH 2ME6A 3K0LA 1GVDA 2ZMEC 3OV8A 3QQAA 4YEJA 5JFRA 1G2HA 2P81A 1REPC 1JXSA 1X1DA 3AG3H 5GAEJ 2GZWA 5IPAA 3SFZA 1V54H 4CCNA 4HNTA 4XBFA 4MEYF 2TDXA 3Q0VA 1HOMA 2AS5F 2KP6A 3HPHA 3U9GA 4U88A 3A01A 2KKOA 4P5OA 1MBEA 4KN4X 2UZKA 2NVQJ 5HLTA 2DT7B 5HDNA 5FLMJ 1R49A 2OU2A 1PUFA 3W6VA 2VB6A 5CKTA 3MKYB 1B4AA 3GF2A 4CCMA 3SEQA 4BACA 2A05A 2BE5F 2XKPA 4HF0A 5F6FA 3N05A 1ZKGA 5AIQA 3E97A 2LOOA 3FBIB 5FD5A 3LSHA 1DQUA 1A6IA 3D5LA 1ZQ3P 1IV6A 2J5PA 4PSXA 4GCVA 3F23A 2XPVA 3H1CA 3H3ZA 3MZYA 3K4LA 4XNFA 1D8JA 2O6GE 2QSFX 3I71A 5J47A 2EQRA 4B44A 2LSOA 1U3EM 5CVVA 2NVXJ 3A4CA 1VQ7I 3MFKA 9ANTA 2VODA 2H1LA 4FT8A 4Y15A 4IF4A 3QP6A 4CZZA 2E2JJ 2PQ8A 3R60A 3J81K 2KMUA 4E7LA 2XC7A 2HOSA 4XIDA 3ONQA 4Y33A 5D5WB 3S1QJ 5E3OA 4C3HJ 3WU0A 5M3FJ 2R0QC 1I5ZA 2DLLA 3BR6A 3M3YJ 3H92A 1K6YA 5FJ8J 1Y8RB 1K61A 3NRVA 2NRAC 2EZLA 2VBXA 4L9VA 2HZTA 4MHGA 1U5TB 2XPUA 3U21A 4M3GA 3PIOF 1E3OC 5IYBJ 4G9YA 2E36A 2JMWA 5F04A 4RGUA 1H9TA 5F08A 3OYMA 3DEEA 3RPUD 2KISA 3H5AA 2HWVA 4KIBA 4EGYA 1ZYRF 3HGYA 4BYYA 4LK0F 4PUSA 1J75A 4A6EA 4UUSB 1I1SA 4BBRJ 2Y48A 4G6DA 4ANJA 1BI2A 4OAZA 4OOIA 1SD4A 3W6KB 5J1YA 1E3HA 4CGZA 4MIMA 5DUIA 5IYCJ 4E7KA 5JLWA 2L2OA 1MGTA 2DOAA 2M34A 1W7PA 3C3WA 5HS9A 2MLKA 1DP7P 3D1NI 3NEUA 2XVCA 3R6SA 3CCRI 4AD9A 5GADJ 3V7RA 1YX3A 3E6BA 3KP5A 2IW5A 2LG4A 1TWGJ 2VBYA 5DEQA 5J4VA 3K70D 4JX4A 1RETA 5KAIC 1MIJA 1QVTA 4IJAA 4N4OB 2R7SA 4C3JJ 2JUCA 4UNOA 3OIOA 3M8FA 1JJ6C 1KZHA 2F5DA 5HLGA 2LRDA 2CQ7A 1YRNB 3BROA 1MBFA 1P6RA 1J9IA 4WF2A 3BQZA 3CMYA 4BS9A 3GTJJ 1TQIA 4HG2A 4M9SA 2EZIA 5KAFC 1OJLA 2MD0A 1LFPA 3K10A 4MNUA 4WXDA 3LSPA 2EK5A 4IHVA 3FKJA 1HLVA 1VZ0A 2XV4S 4DYQA 3ZMSA 2WY7Q 1D1CA 1TZLA 2CS3A 1F43A 1XGOA 1BR2A 2YS9A 4N4NB 1LDKB 1RZ4A 2A3SA 4M9ZA 2BVLA 2VKDA 1Z6TA 2KJBA 4BGDA 4MQVA 2HVRA 1XSXA 4ZC3A 2Z33A 2XROA 3TOAA 2GOMA 2DJNA 1TWHJ 1H88C 1SMTA 2LMDA 1N77A 3CUQB 1S9HA 4XRSA 1ZHFA 3WU1B 3A2KA 3VYUB 3ECOA 3FM3A 3ZQHA 1DPRA 3Q0WA 4B48A 4XRMA 1HF0A 4E7HA 3MKZA 1BOBA 3IL2A 1HW2A 4YFXF 1QHGA 1R1UA 3KYDB 1L0OC 1FLIA 2O3FA 2K86A 5H20A 5DCMA 2QBYA 3J7ZI 2DBBA 3OYBA 1NK2P 2CWEA 2ZJ2A 4CA0A 2MSYA 2QA4I 2CW0F 2HXIA 2E7WA 3HTSB 1IN7A 1TNTA 5D5UB 1SFUA 4BHBA 3BG3A 3QYBA 3S8PA 4XLCA 4OIPF 4O6JA 3ZRGA 3PQKA 4RDUA 2FEZA 1U8BA 2X85A 2EZHA 1TTYA 1ETVA 5E8IA 5JI6A 4DNCA 2W57A 1ZGWA 2D45A 2HZDA 1TQPA 2QQ8A 5D5XB 4RB3C 1S6LA 4A3MJ 4DJAA 4YIRX 2Z9OA 2ZKZA 1XG1A 2JVHA 1UB9A 4EM0B 4BY7J 2XUBA 3PNYA 5AONA 4A69C 3EYIA 2DN0A 2ID3A 1SFOJ 5KVRA 3ZQFA 4FASD 4L9NA 1K83J 3KP6A 1D5YA 2HKOA 2OTLI 2FF4A 3SDBA 1WH7A 3KPHA 4Y7NJ 2K9NA 2VN2A 2FNAA 2WTEA 4C30A 5HDKA 2G7HA 2R7VA 2JA8J 4RM3A 5L3BA 2PI0A 3SXYA 2JSCA 5IY5H 4FX0A 2CQNA 4B3XA 1FP2A 1EKEA 2DQRA 1ZR4A 1D5VA 2KRFA 2FBHA 3GMEA 1UZCA 2XGDA 4HX4A 4WK8F 5ED4A 3G73A 2JQ7A 2ICWG 4M3BA 4XORA 4IQ4A 4OAYA 2VJJA 2E7XA 1XMAA 2X51A 3P7NA 2BEOA 5K5QA 2Y31A 3FK7A 1IAWA 2RQQA 2EFWA 5CPRB 3JSPA 5D6FA 4WWCA 3KZIC 4NHJA 4EJTA 2DODA 3J81Z 2B0LA 2P4WA 5JLXA 4CYCB 4IO9F 1QU3A 1T56A 2VC1A 1R22A 4G6QA 4FISA 1YI2I 3OS2A 1X4PA 2MD5A 5LHIA 2L5QA 2Z1DA 5K7FA 4QTRA 1YFHA 1GVJA 3B02A 3LSRA 3H36A 1APLC 4M3DA 4A3CJ 2HI3A 1I3QJ 2WB1A 5J40A 1IUFA 2RREA 4A3DJ 2DT6A 1XCBA 4D9JA 5LGNA 3JREA 3ASNH 4F7ZA 2E19A 4XM3A 3FXQA 2DFHA 5CQEA 3OYIA 2VE8A 3OS0A 1VQMI 2X6WA 4A3FJ 3BOQA 5D4RA 1KU2A 3HTUA 1PUFB 1LJ9A 1J5YA 5FLXZ 1MBJA 1BOAA 1MH4A 2L7MP 1ZLKA 1MNDA 3BR2A 1F36A 2XDVA 5JVTA 1R5GA 1ZREA 3BY6A 2LD5A 2Y2ZA 4AIJA 2LP0A 4Q48A 1DP3A 2BY0A 1TNSA 2P7VB 3DCFA 3BR1A 1ZG1A 1FPQA 3GBGA 2BW3A 4J00A 2KJCA 2L54A 1Q1HA 1H9GA 1W1WE 3A03A 1P4AA 1Z7UA 4HLXA 4CCKA 4N0BA 1V5EA 1LPQA 1GDTA 1JHFA 3MVPA 1W0TA 2K3FA 1LUJB 4DYCA 2CG4A 2M1BA 3UR3C 5LGTA 3CMEI 5BOXA 2G9WA 5BMZA 2X1CA 3GFLA 4A3EJ 4V2GA 1JGSA 1NTCA 2RC4A 1WFXA 1Y1VJ 2XGCA 3FBNB 1O57A 3KEQA 3LNQA 2K85A 1B72B 3CUOA 1SFXA 2R5ZA 1MD0A 1QQIA 2M7BA 5L3CA 2OCEA 2CUJA 4BQOA 3GUDA 5B1BH 3ERMA 1TP4A 5HNFA 2EB7A 1ETXA 2GXGA 2L0KA 2QEXI 1PJRA 2QZ8A 2O8XA 3QOEA 5L3EA 5DM7F 3K4BA 3CCUI 1D8KA 1T08B 1X1AA 3OYFA 2DTZA 2F4OB 4X6AJ 2DA7A 1MDMB 1ZH5A 2DAOA 4RLFA 4ZYAA 2XF7A 1OISA 2KDZA 4I76A 5FKMA 2KHMA 4AYBN 2X0LA 3KX2A 5E8GA 2EFPA 2KIFA 4UUVA 1R23A 3KYCB 1YE9A 4A12A 5F0CA 4I99C 3HOUJ 3LMMA 2OJED 3U1KA 5CVRA 4XLAA 5J1UA 1G3YA 4ABZA 2B9SA 2YU3A 1Y8QB 3GCMA 3K4NA 2DA4A 2ELJA 1YJNI 4QSHA 1DU0A 4KISA 2J5OA 1LFBA 2L7FP 4Y13A 4ENNA 2QQ9A 4U0WA 4D5CA 3OR2C 1FYKA 5AIPA 5IOZA 2NAZA 5DM6F 4NDLA 1TC3C 3C2BA 4LLNA 2V1XA 3HJEA 1E3PA 3WTTC 2IGMA 3CP8A 2FJ1A 1I1GA 2VQHA 1IGNA 4ITVA 1SMYF 1W5TA 3BG9A 2HQNA 4CCJA 4CDGA 1DUXC 2DK8A 2FA5A 1Y1WJ 3CF2A 1R36A 3EUAA 3JSOA 2F5FA 3MKWB 4M6YA 2K40A 2EWNA 3I58A 4EM2A 1K78B 3I55I 5J8FA 1RIOH 4YFNF 1OKRA 1R5ID 2EV5A 4EJWA 3N97A 1MBKA 1QNTA 1MNMC 1RI7A 3CCLI 3CJQB 2CYYA 1IRFA 2GBYA 2YX4A 3I5UA 4IHXA 3R0JA 1O3RA 5LD2C 5ICGA 3DQVC 1BW6A 1LKXA 2IP2A 2E1MB 2QKLB 3C2HA 3GTPJ 1B8IA 4HNVA 1ZARA 1BA5A 5J4YA 2EA4A 2DW4A 1ORKA 3OSFA 1W0UA 2K9MA 4MLOA 2QENA 3ZPLA 1NH3A 1X1PA 3O8GA 2ZNYA 3FDYA 1BJZA 2IJLA 4XICA 3FX3A 5LEJA 3RI4A 2IA2A 3TP0A 3HKZA 1BI3A 1BM9A 2WB1N 3LFUA 4WCGA 3ABKH 2K02A 1X58A 5EG0A 4GYIA 1RPWA 1R4MB 2DCEA 3OMYA 3JRFA 3ULQB 4AVZA 2WY8Q 2KDOA 2K9SA 3IRRA 2IS4A 2ECBA 5HDGA 1WJEA 4UXNA 3GTKJ 3TBIA 2LKPA 2GAUA 5CVIA 2KZVA 3FXRA 6PAXA 5ILUA 2ID6A 2ISYA 1BW5A 3LAJA 1RUOA 4BJ5C 2F5EA 1YYVA 3RIRA 4NC8A 3PUBA 1P2FA 3SZTA 1SC7A 1AKHA 4HNUA 2OQRA 1EH7A 4P9FA 3WE2A 1Z7LA 2Z16A 1N25A 2QGUA 4BUPA 2HPIA 4ON0A 1Z9CA 2L9SA 2DQLA 1YW7A 2ETHA 4ZJZA 4BNCA 2IT0A 1JT0A 1LEAA 5IP7J 5C44J 2OZ6A 4G7OF 1OCOH 3RSNA 4EJUA 1PP7U 4LG0A 5BPDA 5FFXA 4QPQA 2CV1A 4Y17A 2UXNA 4UHTA 4ZYDA 2Q2EA 1QA6A 1YS7A 2K4BA 5FKNA 3KE2A 3GVAA 2CQXA 3HSFA 2DPDA 1LNWA 4CHUA 1FTTA 2ZJRF 4KFCA 2FX0A 2XF5A 3LSKA 1G3SA 5GTIC 1A6QA 3EUHC 5TGTA 2E2HJ 4BQNA 4BE2A 2JRTA 1RC9A 2R7ZJ 2X9DA 5A2QK 1IRGA 2BHZA 4AUXA 4WX9A 4H0EA 1Y39A 2H8RA 3TO7A 4IRIA 1X2NA 3RKYA 1HKQA 1T0FA 2H8WA 3T5XA 4D7MA 1VQ5I 2IXSA 3K4CA 4F52A 1S7OA 2ZSHB 4BDYA 1OCZH 3D5SC 2XAFA 4LITA 3HOXJ 2JA5J 1O3TA 4FHTA 5DD4A 2X6XA 3RKXA 3ML6A 4KT5C 1P4XA 1ZLJA 2F48A 1EH6A 2VE9A 2ELKA 2R7FA 2VI6A 4HX8A 5CVJA 2Y69H 3CCVI 3MZHA 2GOXB 3FISA 1X1CA 4PFPA 1TWFJ 3GFIA 4BXFA 4MO7A 2LY2A 1IZ1A 3ZN0A 1VQ6I 2E1CA 5D5VB 2K5CA 5EG0B 3GW2A 4RAGA 5E17F 1S3JA 1V4RA 2CUZA 4WXCA 4UUTA 4LG0B 1LVKA 5FLXK 2V1DA 3L2CA 1XC5A 1JKRC 4NQWB 3W2AA 1MMDA 3P9KA 2ZO4A 2ZJQF 1E17A 4YIFA 1Q1VA 3BQYA 5BNGA 3KP2A 1NHAA 4JQFA 1WJBA 2Q8KA 2DFEA 4MEXF 3HRTA 3X2QH 2CV0A 3OYHA 1Z3XA 3DKWA 1U5TC 3F21A 4GGGA 2VPLA 4PDKA 3VPRA 1X4OA 1Z05A 1LFUP 4FX4A 4UVAA 3CF5F 4C9YA 2W7NA 5E3MA 1FIPA 2HXOA 4XLFA 1DGRM 2XAHA 1OCRH 1UELB 3K4JA 2FXAA 2C6YA 2VOOA 1WH5A 4I0AA 1RRJA 2EFNA 1BC8C 1OCPA 3BWGA 5J6XA 1A5JA 3CP2A 3RKWA 3HKZN 2MLGA 4U0YA 2R5YA 1V55H 1W7PD 3DPUA 3ZQLA 4K2EA 2JVGA 5TISC 1ETKA 1YW8A 1Z3YA 3RDIA 1Z67A 4XN3A 3WG9A 2QQAA 3I54A 2L7KA 4HLYA 1IF1A 4I02A 2E5ZA 1Y6IA 3BJ6A 2MC3A 2LC2A 2BXZA 3CMAI 4CZCA 2DI3A 1ODDA 3JR9A 3S17J 2LY1A 4G8XA 4ESJA 1HKTA 2VQLA 2LKXA 2CUEA 3HUGA 3F22A 3TMOA 3ESWB 1WJFA 4A3GJ 1ONVA 1MSEC 3EQLF 1MMAA 1B1BA 5LRSA 3FF5A 3QPSA 2NNNA 3A1YA 5J3LA 3SFIA 1T33A 4MTDA 1WJDA 4ASNA 3BR0A 3BPVA 1HQCA 1Z21A 3V8JA 1CF7A 1D3YA 3QODA 4EATA 2XB0X 3F6VA 2V9VA 3ZMDA 3WGIA 4KJZA 4C2UA 1XS9A 1IDZA 4HEA2 2RVCA 2N8GA 4QLCU 1FYMA 3GX4X 3S16J 2JZYA 2XGEA 3G1OA 3KCCA 4HOBA 3ZR8X 4YFKF 2F5VA 3MZ8A 3T1BA 3M1EA 2E60A 2ZXHA 2QLZA 4DYRA 1U6GA 2A6HF 1QHHD 4ESFA 5DV5A 1LB2A 3SZPA 4A93J 2A69F 1ETQA 3F8FA 3CQZJ 2VLAA 3CESA 3ZQIA 2H6BA 2EIJH 1MJ9A 1Z1DA 3CJTB 4B4CA 1S72I 1BC7C 2GLOA 1YTYA 1ERDA 3C7JA 3I4NJ 2Y0SN 2PJRB 4M6XA 3GWZA 2ISZA 4ZDLA 3CLQA 1YIJI 1IV8A 5C4JJ 3TGNA 3WGGA 4BY1J 2BXYA 4Z6YA 2NVTJ 4KIGA 3GZNB 5K7HA 2EIMH 3TP3A 1M1EB 4LG3A 5BQTA 2R7QA 5LHHA 1VTNC 3S2DJ 3JRDA 3F8NA 3KLNA 3Q3SA 4AIDA 3LSJA 1K78A 2EFOA 2W25A 3OYLA 2DT5A 2QUFA 3G1MA 1WHUA 2H09A 1FOXA 1YRNA 3KZYA 1I6HJ 1IN6A 2CSOA 2I5UA 1OPCA 1J0RA 3TOBA 2Z2SB 2BOLA 2Y9YA 4Y3OA 2F5CA 1GT0C 4FETA 3DLAA 1HBXG 1QZYA 3HOVJ 1X2MA 2JA2A 3KFWX 3NWSA 5EZGA 3SQNA 5DS9A 2P7CB 3IH3A 3K1NA 1VFCA 3HRMA 1LDDA 3MCZA 1HKSA 4UY8I 1MMSA 1W36D 3F3XA 5ICCA 5DDGA 4PGHA 3S2HJ 4IZZA 3OL3A 5B5EC 1SVOA 4XN0A 4RS8A 1OR7C 2HYFA 2ZMEB 3S32A 2FMYA 1ZRDA 2CW8A 3E5XA 3DWLE 3FXOA 3HL2A 4IPAA 4AVPA 4J01A 1SAXA 3EETA 4HF1A 5HS7A 2O5RA 4V2FA 1FMVA 1FYLA 1DPUA 2M3AA 2KL4A 5HLIA 4RGXA 4XLEA 3WTZA 3ZQGA 1OYIA 2WAQA 1ZG3A 3WTWC 5JHFA 5JHUA 4A3JJ 1FY7A 2FQ3A 2HGCA 2CMPA 3JRAA 5FLVA 1FBUA 3GTOJ 4XSZF 3KP4A 1T0FC 2CU7A 2M0MA 1BI0A 4RGSA 1FMWA 1U9OA 2PMUA 4Q47A 2AXLA 1RESA 3CO7C 3BG6A 5C4XJ 3TW7A 3CCEI 3CC7I 4OINF 1MH3A 3GTQJ 3L9FA 4XLPF 1I6XA 1JHHA 2JN6A 3IWFA 3EUHA 1UG2A 1VQKI 3OYAA 1O3SA 1KYZA 3FMSA 5K7ZA 3JRCA 2OBPA 2ZB9A 3S3OA 4RM2A 3FIWA 4C2MJ 2YR2A 2CO5A 4HV6A 1IXSB 3W2WA 2KQRA 4HPQA 3DTIA 3K7AJ 5LBQA 1ZRCA 2DMQA 5HODA 1MSFC 4GYGA 1K7AA 4N9IA 2M87A 4HDVA 3F8CA 4BQAA 3P5JA 3WHCA 4QWQA 3L2RA 1MNEA 3CCJI 3BG7A 2VL8A 4ZYHA 3LSMA 1JKQC 3BTLA 3D0SA 4BE0A 5EEGA 3FXKA 4D1QA 5D8LB 1Y0UA 1YX5A 1T39A 1ZAOA 4R1HA 4AIKA 1TWCJ 4V19K 3AKZA 1R1TA 2BW3B 5HLHA 4A0ZA 1IW7F 1OR7A 4B09A 1DGWY 2P5LC 2KRCA 3BZ6A 3GZ6A 1IN8A 3WTYC 1HW1A 2FNPA 2Q2EB 3RTRA 5E1XA 3JTGA 2PN6A 3BJOA 2OC6A 2IS1A 4JP0A 3DU5A 3CCSI 2LBFB 1AWCA 3CCMI 2PBIA 1CQTA 1JUMA 1UFMA 3IC7A 2IBDA 1QRYA 1XMXA 3ZGKA 4RB1A 3WTSC 2Z5UA 2STWA 1W7PB 4JX5A 3S3MA 4DW6A 1IDYA 1JTYA 4EMSA 3K1MA 5E18F 1V3FA 2HVSA 1SFKA 4XOTA 1T2KA 4FCYA 2LNBA 4QPOA 4S05A 2NS0A 2WAFA 4UB8C 1MBGA 2M45A 3CJRB 3KETA 3WHBA 3ZXSA 3H9GA 2VXZA 5K5RA 2DA3A 1XDUA 2OA4A 1WWXA 3V8LA 1ZGAA 2DU9A 3DEUA 4RAFA 1IXCA 2LF7A 3G6EI 4E7IA 1SD5A 5EZHA 1JE8A 5LHGA 4UUSA 3VYTB 2HS5A 2JK3A 2OZUA 2R93J 2DMTA 2AHQA 1YIOA 2MH2A 3KP3A 4CCOA 2JWTA 5DD8A 5DYMA 3K4KA 3J80K 3JW4A 4IL6C 3H0GJ 3B73A 2HU9A 2JPCA 4LFUA 1FJLA 4IRGA 3RQIA 4BE1A 2E1OA 2P8TA 2R5YB 1KU7A 3TKYA 2H27A 4KYWA 1WPKA 2ELHA 3VFZA 2L4MA 4PJNA 1FOWA 4W1UA 3JTHA 3WU2C 4LMYA 2W24A 3F8BA 3M8JA 2H1KA 2EV6A 3GO5A 4R79A 3BT9A 3AL0C 2XAJA 2R5ZB 2JT1A 1Z77A 3QYEA 2EBIA 3ASOH 3WTVC 2A07F 5IT9Z 3DV8A 1WJ5A 2X4HA 3OOUA 4Q4ZF 3OL4A 4LK1F 3FK6A 3SDGA 1HC8A 4NB5A 3AG1H 2UV1A 5CLSA 2Y0SA 3JAMZ 2M30A 2QSGX 2RNJA 5IP6A 4IOCF 1MMNA 3G1LA 4I09A 1GLNA 1IN4A 2DTRA 1ETWA 3L7WA 1X19A 4PGGA 1BR1A 4S0HB 2O8KA 2YUSA 2ZNZA 3DF8A 5F1JA 3DKYA 1IRXA 5DCFA 1P9QC 4EM1A 3ELKA 4BEHB 1WQ2A 1K4SA 4DZJA 1D0YA 3HEFA 3I64A 1F1ZA 3LA3A 2IAIA 1JT6A 4IEJA 4L5IA 2KLOA 5C3EJ 2V1UA 1WCMJ 2ZCWA 2ZC2A 2DK5A 1B9NA 5E3NA 3HOSA 4M9XA 3FMQA 1Z91A 2RQPA 1I27A 1JTXA 2HOEA 1GUUA 1NG6A 4F93B 2BV6A 1O7FA 3HYIA 4GFBA 3EUKL 1XCVA 2E71A 4B43A 1XX5A 1E0EA 2M7AA 5F27A 5IOYA 1MKMA 3RZDJ 1WVRA 2A5YB 5FROA 2V9PA 2RKHA 3D5RC 3KYLA 4EQQA 1R71A 1UHMA 3BC8A 3M07A 1LQ1A 1G8XA 1J7KA 2IVMA 1FNNA 1R4NB 4RB2C 2BY3A 3WE3A 1U5TA 2V79A 2XSJC 4M74A 4PSWA 2HEOA 2P5VA 1FSHA 4LIVA 5HVQC 4F3QA 1FP1D 4XKWA 3L2VA 2FRHA 2XPWA 2XSDC 3DLLF 1I39A 4IHTA 2YX7A 2E1NA 1SEUA 2QQBA 4AWXB 1JI8A 3W3CA 2M8GX 3L2WA 1MJBA 3RJPA 1N78A 1N75A 1KYWA 2V9KA 2W85A 3G3ZA 4ZYEA 1RNLA 3CJNA 2MYSA 2QCOA 3RCOA 1OCTC 3L00A 3GTGJ 3I59A 2STTA 3FXLA 2HQ5A 4CYDA 2DFFA 2P6TA 1G3WA 1D1BA 1ETOA 1VQNI 5D4SA 3BR3A 2JPBA 4OU0A 2HQRA 3MN2A 3L2UA 3Q5FA 2V4JC 3HDDA 3S1NJ 3HIFA 4DOZA 4R8HA 2D1HA 3ZQ7A 3H35A 1S8NA 2EPFA 4ENMA 1S7AA 5BPIA 3I0TA 3F72A 3TL4X 3E3VA 5E20A 4HDUA 1WKMA 5ILVA 4LLGF 1IO2A 4KNYA 3BCAA 4NQWA 2KRHA 2TCTA 3GXOA 3ZP5A 2HNHA 1QZZA 3SHFA 2PLYA 2VJIA 3E1SA 3I53A 3Q0UA 4PJMA 3RPQA 2YU9J 2QM3A 1TBXA 4DQ2A 3WODF 1OYYA 3H9QA 1UG0A 1R9TJ 1EF4A 2Y75A 3QU6A 4I7HA 3H0DA 2VOPA 4L18B 3CCYA 3OOPA 1F9NA 5CVUA 4BEHA 1YITI 1A35A 3B6AA 1FC3A 2IEKA 1X3WB 3ZMVA 1XN7A 1SD7A 2RV8A 5F64A 3T8TA 2LH9A 1RR7A 3IWZA 4CYCA 2VKVA 3UKGA 2XKOA 2MFZA 2W82A 3Q9SA 2DJIA 1KGSA 3OYGA 2AQEA 2F4IA 2PMZN 4DBQA 4U7BA 2XAGA 4L0ZB 3OY9A 2DFIA 2RN7A 4GDFA 3CD6I 3HSRA 1ZRFA 4UB6C 1TT0A 3QOPA 2JA6J 4LLLA 2LR8A 1WSUA 4ZTJA 1TLHB 3JRIA 2CFXA 3E5UA 4PK4A 2A6TA 2JJ7A 4X0GA 1T38A 2I8DA 4LB6B 4BJ6C 3FXJA 3NAUA 2ZJPF 4MQ9F 2IGKA 3LSIA 5D8KB 3SJMA 2FSWA 4G94A 1DU6A 4A3LJ 4U87A 1GHCA 2O7OA 2L9RA 2VJ5A 3HRSA 4XKBA 5GPAA 1ZN2A 1ACIA 3FMRA 4BDZA 2GXBA 5M5YJ 2KT0A 1O4XA 4GXOA 2EJRA 1QBJA 1MDMA 1TW2A 4JBAA 4H4KC 2WV1A 5LGUA 2YSRA 2D2WA 4RBOA 2XAUA 1FWZA 3LA2A 3VDXA 1QVUA 3GFJA 2CFOA 1JUSA 1PVEA 2FMLA 4AM3A 2M0CA 1A36A 4C2TA 3O2PE 4S04A 3N4MA 1BI1A 2FU4A 2BY2A 4RAYA 1FIAA 1OYWA 2R7WA 3S1MJ 1KQ9A 3VSLA 4XONA 3DU6A 5FRMA 2P5KA 3IH4A 2OAZA 2WADA 1NK3P 2IPQX 2LVSA 4FQGA 3TO9A 4A5MA 5M5WJ 2DPUA 4ZYGA 4KMUX 4LB5A 3DKXA 2OF7A 3MMYB 1A04A 2E35A 4XRFA 3VOEA 4B1RA 4IHSA 2X1DA 3BG5A 1SD6A 2KIMA 2DDBA 3HSEA 3IAS2 3REOA 2DA1A 2HDCA 3PM1A 1YJWI 2DMUA 2BBYA 1CF7B 2HYGD 2UWMA 3E5QA 1U8RA 2OQGA 4HYEA 3QPTA 2PX9A 1VQPI 1PUEE 4MTEA 3NARA 3JRGA 4E7JA 5B66C 2JUGA 3CDIA 4Y4RA 2ZXWH 5ILSA 4IHYA 3DTEA 2H6CA 1CGPA 4D5FA 2KFDA 2EILH 2FOWA 3M8EA 5FKOA 5ICFA 3W6JB 3DEWA 3PSFA 2LBFA 1H8AC 4Q5SF 1R1VA 1XSVA 1T95A 2NOJB 5E1WA 1D0ZA 2EZKA 2VXDA 4L9JA 1O7LA 2PMHA 3OYCA 1UHSA 1ZK8A 3LA7A 4KT6A 3LL7A 2BHYA 2DOEA 3CZ6A 4GO1A 4BXUA 3VEPA 3CTAA 4YIIA 2A5WA 2O03A 1A31A 4PJ0C 4IVNA 1HSTA 4NUBA 4U7DA 2LLKA 2MH9A 4GRIA 2H94A 3K2AA 5IYDJ 4E7ZA 4DBRA 1IRZA 4PJLA 3BZKA 1PYVA 4XOPA 4BHCA 1GV5A 4FTHA 4OIOF 2DA6A 1XD7A 3LSTA 4G7ZF 2OTJI 1RR8C 3HRUA 5LFAA 2EH3A 2F6CA 2HQAA 3T0YA 4CO8A 3BTJA 3E6DA 1XDSA 1QZEA 4EVIA 1HCRA 5ERIA 1D1AA 2AQFA 2MGQA 2ZFUA 3ZQQA 4E4HA 1F4KA 2LFBA 1R7JA 1O3QA 4XKVA 2P0WA 3QU3A 4NC6A 3G71I 2DO7A 4NBQA 5HNHA 1ETYA 1SVMA 2VT3A 2G0EA 4IXAA 1KQ0A 4HSRA 4UV8A 2CGPA 5E1ZB 1WI9A 2ZXIA 5HOOA 1AU7A 2DMNA 1X3ZB 2FD5A 2JA7J 3O3KA 3DBHB 3SEZA 4E70A 2EFQA 3DBRB 1W4MA 3U1DA 3QPLA 1MW7A 3TEDA 2Y0MA 2W48A 2Z3YA 3ABUA 1R58A 5DTDA 1UAAA 1HXDA 4CXFA 2R7XA 3A02A 2PMZA 1BIAA 1ZELA 3H5NA 2OUMA 5B1AH 1B72A 2L7ZA 1RKWA 1XSDA 2VJ4A 2NOGA 5CQGA 5L3FA 2RNGA 4XL9A 3B6CA 4HQMA 3VSKA 2CUFA 2R7DA 3WGHA 4E6KG 3MKLA 1P7IA 3S1RJ 3ABLH 4ESBA 3JAMK 2XHKA 4HZFA 1VQLI 1QO0D 2UUZA 3IRQA 3HZJA 3MQ0A 2V7FA 3HHGA 3EDPA 1FT9A 3FWEA 2XRNA 3LSGA 1VI0A 3ISPA 4CSWA 2ZBKA 2IS2A 3EPZA 4II3A 5L3GA 4L5EA 1FOKA 5EEHA 2KIUA 3GTMJ 3BP8A 3O6BB 4XQFA 5E3LA 3AG4H 3QRFF 3F6OA 3J80Z 2V6EA 4HX7A 1NG7A 3M7GA 1Y0NA 3COAC 1B8IB 2VT2A 2WC2A 4HF2A 4P96A 2WWYA 4J19A 5D6EA 2A68F 3CMMA 3ZMZA 4IHWA 2VBWA 2RDPA 5H6QA 2IGOA 4M72A 3R0AA 4I01A 4HSTA 4CICA 3R61A 4FE4A 4M6VA 1XGMA 2BZTA 2ZMEA 3GZ5A 2VKHA 1VF9A 2AXTC 3GTLJ 2W84A 1UHWA 3P9IA 3CDLA 5DUKA 3ZQCA 1YHQI 4BHPA 1VQ8I 4KICA 3WTUC 1S29A 5F0FA 4AU7A 2NYXA 4M71A 4Y52J 2GIZA 4G12A 1U2WA 4XSXF 3HBLA 3ZMUA 3VYSB 4A3IJ 3G2BA 2HTSA 3K9TA 5K5OA 5IT3A 5BS6A 3J7AO 2CRGA 2XIGA 5TJJA 3W2VA 2GWRA 4PZJA 5GTHC 3PIPF 1W36C 3C1DA 2DA5A 1IN5A 3BJAA 1B9MA 3BPXA 3L09A 3P9CA 3RKQA 4IQJA 1USSA 2PJPA 3O8HA 2PG4A 3F0CA 3NQOA 3L1PA 2ADUA 3DXJF 4KA4A 3J7AY 4DGWB 4OIRF 4A6DA 2DA2A 3K69A 4ZZLA 1ZG5A 2KZGA 4HRIA 5EYRA 2ZXJA 2M5WA 4W97A 2Y9ZA 2W1OA 2A6EF 2NS8A 2GA2A 3TDUC 1FTZA 1TWAJ 1F5TA 3RPUA 5K1YA 5EGOA 3TW6A 3F8MA 4RAZA 2IA0A 4PFOA 1WI3A 4BU2A 3HUGB 3GLLA 2X6OA 3CUQA 3PNTA 4XLNF 3SZGA 1USTA 4IX7A 2Q0OA 3GFMA 4IKFA 3M9AA 3K4MA 2HFHA 2D1VA 4XRSG 4A3BJ 3TQNA 3S2WA 1UJ8A 4YG2F 5TRDA 3IAM2 1GXQA 3IP4B 2WAQN 4M3FA 4LOCA 1FEXA 1KU3A 1Z6RA 2HYJA 1G59A 1SAUA 4HV5A 4CH7A 2PEXA 3BCBA 5F1RA 2CV2A 1AKHB 2WBMA 3WG7H 4KITB 3HGGA 5FRNA 1YS6A 3ZN1A 4LJZF 2ZFWA 2NNYA 3NWTA 4EV0A 5FKKA 1YOVB 4B47A 2KPMA 3BR5A 1B59A 2VC0A 2XRLA 2O9LA 3CC2I 3HOYJ 2NVUB 3OR1C 1FSEA 4EJVA 1FZPB 2HTJA 4BXXJ 2HVQA 5KNLA 2B7EA 2JTVA 2OV7A 1XTAA 4RGRA 4CCLA 3K2ZA 3PO3J 3RYRA 1J2XA 3V8KA 3AAFA 2CQKA 1XB4A 4O5VA 1TW3A 4UV9A 5KCMA 5EDNA 3PQJA 2QF7A 2LDUA 4OMZA 1C0WA 4JYKA 4O3MA 2DXIA 2R7OA 4HA8A 2JRMA 1YG2A 3I56I 3TDZC 2EA2A 1KONA 4DIQA 2L3DA 2R7TA 3LQRA 2XB5A 3ABTA 2IGNA 3DPLC 3S3NA 3H3VK 1W5SA 4M73A 5M5XJ 4ENKA 4BH9A 2F2EA 2E34A 1S7EA 4BJTA 2OCCH 3LFKA 4KIFA 4B3AA 3KEYA 1W5CC 1Z0XA 3OYNA 1IG7A 2OPTA 2M4GA 1EJ9A 4MFDA 3G4SI 5DCMB 5GAHJ 4A3KJ
chains in the Genus database with same CATH topology
5HS8A 4A0YA 2EV0A 1KA8A 3FM5A 2BYVE 1KQ8A 3V4GA 1K79A 2R3SA 2LF8A 5A2QZ 5JR3A 3ROUA 3ZMTA 4G7HF 1X3UA 2K7LA 3E6CC 1QPMA 2RGVA 3BDDA 3Q9VA 3IHUA 1LVAA 1R5HA 1ON1A 2QBYB 3KEOA 4L5JA 3KZZA 1G6NA 4OMYA 3QAHA 4PCQA 3IKTA 1XGSA 3MWMA 3DP7A 3IKVA 2GIVA 1UCRA 2IA1A 4HW0A 2XASA 2P6SA 2YPRA 1SFEA 2QVOA 2K4JA 4L0YB 1MZBA 4KUMA 1T98A 2BGCA 4AIHA 4LD5A 1DDNA 3HHHA 4A5NA 1BBYA 4L9TA 2COMA 4Z2YA 3LWFA 4BAYA 3CDHA 1PP8F 4TV7A 4ZH4F 3WTXC 1XGNA 4EJOA 4HBLA 4ETSA 4HAMA 4KMFA 3VB2A 4D0PA 3V7SA 4KN7X 4JK1X 1IXRC 2PFBA 5FO5A 3MAJA 1WRJA 1T6SA 1RUNA 2A61A 1U78A 3QP5A 3GEZA 4I98B 4KDPA 1H0MA 1L3LA 2GQQA 1IUYA 3U2RA 1MJAA 3VODA 2Z99A 3GLXA 2FBIA 3ECHA 3K1PA 5FFZA 2WV0A 1YQAA 3H3UA 4HQEA 4ENJA 5ICEA 1ULYA 2XAQA 3R4KA 4UVBA 5LLQA 2L01A 1B6AA 4MGRA 5LRRA 1BJAA 3FXUA 3GYHX 3FZVA 1HSJA 4LGWA 3I4PA 3I59B 1G3TA 3TO6A 2FOKA 1GXPA 1FBQA 3EYYA 3CLOA 1EH8A 1OMIA 1LDJA 2HR3A 5L3DA 2FBKA 4IRHA 2L02A 1YLFA 3MEXA 5CYVA 3E6MA 4ZZDA 3C18A 4N9HA 5FGMA 2VBZA 4P55A 5KK1A 1J59A 4A0XA 3CO6C 1E2XA 3ERED 2OD5A 1BN5A 1XMKA 4B8XA 1P92A 4U0VA 3FHZA 2MBFA 2O0YA 2V6CA 3V7CA 5FD6A 1TQMA 1AOYA 2ACJA 1FBSA 3T8RA 2ESNA 4OIQF 1K6OA 1YW9A 3DFGA 1KU9A 1FX7A 2VONA 2M8EA 5FB2A 1P4WA 4RB0A 3PFIA 1HW5A 4P9UA 2QWWA 1STZA 2UXXA 1ON2A 3CUQC 2FE3A 1BIBA 4A2UA 2O61A 1R00A 3LQQA 3HOTA 3DPTA 1ZGJA 3RYPA 5IT9K 3KLOA 4WXHA 2MA3A 1PDNC 5H6RA 3LAPA 2L4AA 3KP7A 5LEKA 2IRFG 5CJ9A 1YO5C 3QPHA 4I2OA 2GA1A 4I0BA 2ESHA 2HKXA 5J8CA 4UVCA 1LEBA 2G7UA 2K27A 2XGXA 2QYOA 1G4DA 1QGPA 4EGZA 1EV7A 3K0LA 5JFRA 3OV8A 1REPC 1JXSA 2GZWA 3SFZA 4XBFA 4MEYF 2TDXA 2AS5F 3U9GA 4U88A 2KKOA 4P5OA 4KN4X 2UZKA 5HDNA 2OU2A 1B4AA 3GF2A 2BE5F 2XKPA 4HF0A 5F6FA 5AIQA 3E97A 5FD5A 3D5LA 2J5PA 4GCVA 3F23A 3H3ZA 3MZYA 1D8JA 2O6GE 3I71A 1U3EM 2LSOA 5CVVA 3MFKA 2VODA 4FT8A 4Y15A 4IF4A 3QP6A 4CZZA 2PQ8A 3R60A 3J81K 5D5WB 3WU0A 1I5ZA 2DLLA 3H92A 3NRVA 2NRAC 2VBXA 4L9VA 2HZTA 4MHGA 1U5TB 4G9YA 1H9TA 4RGUA 2HWVA 4KIBA 4EGYA 1ZYRF 4BYYA 4LK0F 1J75A 4A6EA 1I1SA 2Y48A 4G6DA 1BI2A 4OOIA 1SD4A 3W6KB 4CGZA 5DUIA 1MGTA 1W7PA 3C3WA 5HS9A 2MLKA 1DP7P 3NEUA 2XVCA 3R6SA 4AD9A 3V7RA 3E6BA 3KP5A 2IW5A 2VBYA 5DEQA 4IJAA 4UNOA 3M8FA 2F5DA 5HLGA 3BROA 1P6RA 1J9IA 4WF2A 1TQIA 4M9SA 4MNUA 4WXDA 2EK5A 2XV4S 3ZMSA 1XGOA 1LDKB 1RZ4A 2A3SA 4M9ZA 1Z6TA 2KJBA 4MQVA 1XSXA 2Z33A 2XROA 3TOAA 1SMTA 3CUQB 1ZHFA 3WU1B 3ECOA 3FM3A 1DPRA 3IL2A 1HW2A 4YFXF 1R1UA 1L0OC 1FLIA 2O3FA 2K86A 5H20A 5DCMA 2QBYA 2DBBA 2CWEA 2ZJ2A 2CW0F 2E7WA 3HTSB 1IN7A 1TNTA 5D5UB 1SFUA 4BHBA 4OIPF 4O6JA 3PQKA 2FEZA 1TTYA 5E8IA 5JI6A 4DNCA 2W57A 2D45A 1TQPA 5D5XB 4RB3C 1S6LA 2Z9OA 2ZKZA 1UB9A 4EM0B 2XUBA 5AONA 3EYIA 5KVRA 4L9NA 3KP6A 2HKOA 2FF4A 2VN2A 2FNAA 2WTEA 5HDKA 2G7HA 5L3BA 2PI0A 3SXYA 2JSCA 4FX0A 1FP2A 2DQRA 1D5VA 2KRFA 2FBHA 4WK8F 4HX4A 3G73A 5ED4A 2E7XA 1XMAA 3P7NA 1IAWA 2BEOA 5K5QA 2EFWA 3JSPA 5D6FA 4WWCA 4NHJA 4EJTA 3J81Z 2B0LA 2P4WA 2VC1A 1R22A 4G6QA 2MD5A 5LHIA 1YFHA 1GVJA 3B02A 1XCBA 5LGNA 4F7ZA 3FXQA 2VE8A 3BOQA 5D4RA 1KU2A 3HTUA 1LJ9A 1J5YA 5FLXZ 1BOAA 1ZLKA 5JVTA 1R5GA 1ZREA 3BY6A 4AIJA 4Q48A 1TNSA 2P7VB 1ZG1A 1FPQA 2KJCA 2L54A 1Q1HA 1H9GA 1P4AA 1Z7UA 4HLXA 4N0BA 1JHFA 5BOXA 2CG4A 2M1BA 5LGTA 2G9WA 5BMZA 3GFLA 1JGSA 2RC4A 1O57A 3KEQA 3CUOA 1SFXA 1MD0A 1QQIA 5L3CA 3GUDA 2EB7A 2GXGA 2QZ8A 2O8XA 5L3EA 1D8KA 1MDMB 1ZH5A 2DAOA 2X0LA 5E8GA 2EFPA 2KIFA 4UUVA 1R23A 4A12A 5CVRA 1G3YA 2YU3A 2J5OA 4Y13A 4ENNA 2QQ9A 4U0WA 1FYKA 5AIPA 2NAZA 4LLNA 2V1XA 3WTTC 1I1GA 1SMYF 1W5TA 2HQNA 4CDGA 1DUXC 2DK8A 2FA5A 1R36A 3JSOA 2F5FA 4M6YA 2EWNA 3I58A 4EM2A 1K78B 5J8FA 1RIOH 4YFNF 1OKRA 2EV5A 4EJWA 3N97A 1QNTA 1RI7A 2CYYA 1IRFA 3I5UA 2YX4A 3R0JA 1O3RA 5ICGA 3DQVC 2IP2A 1ZARA 2EA4A 2DW4A 2QENA 3ZPLA 2ZNYA 2IJLA 3FX3A 5LEJA 3RI4A 2IA2A 1BI3A 1BM9A 4WCGA 2K02A 4GYIA 3ULQB 3IRRA 5HDGA 4UXNA 2LKPA 2GAUA 5CVIA 6PAXA 3FXRA 5ILUA 2ISYA 3LAJA 1RUOA 2F5EA 1YYVA 3RIRA 3SZTA 1P2FA 2OQRA 1EH7A 4P9FA 3WE2A 4ON0A 1Z9CA 2DQLA 1YW7A 2ETHA 4BNCA 2IT0A 1LEAA 2OZ6A 4G7OF 4EJUA 1PP7U 4LG0A 5BPDA 5FFXA 4Y17A 2UXNA 4UHTA 4ZYDA 2Q2EA 1YS7A 2K4BA 3KE2A 3GVAA 3HSFA 2DPDA 1LNWA 4CHUA 4KFCA 1G3SA 2JRTA 5A2QK 1IRGA 4H0EA 4WX9A 3TO7A 4IRIA 3RKYA 1HKQA 1T0FA 3T5XA 1S7OA 2XAFA 1O3TA 4FHTA 5DD4A 3RKXA 3ML6A 4KT5C 1P4XA 1ZLJA 1EH6A 2VE9A 2R7FA 4HX8A 5CVJA 3MZHA 3GFIA 1IZ1A 3ZN0A 2E1CA 5D5VB 3GW2A 5E17F 1S3JA 1V4RA 4WXCA 4LG0B 5FLXK 2V1DA 3L2CA 3P9KA 2ZO4A 1E17A 4YIFA 3KP2A 1NHAA 4JQFA 2Q8KA 4MEXF 3HRTA 3DKWA 1U5TC 3F21A 4GGGA 4PDKA 1Z05A 4FX4A 4UVAA 2XAHA 2C6YA 2FXAA 2VOOA 4I0AA 2EFNA 1BC8C 3BWGA 5J6XA 3RKWA 2MLGA 4U0YA 1W7PD 4K2EA 1YW8A 3RDIA 3WG9A 2QQAA 3I54A 4HLYA 1IF1A 4I02A 3BJ6A 2MC3A 2DI3A 1ODDA 4ESJA 4G8XA 1HKTA 3HUGA 3F22A 1ONVA 3EQLF 1B1BA 5LRSA 3FF5A 2NNNA 4MTDA 4ASNA 3BPVA 1HQCA 3V8JA 1CF7A 1D3YA 3F6VA 2V9VA 3ZMDA 3WGIA 2RVCA 4QLCU 1FYMA 3GX4X 2JZYA 3KCCA 4HOBA 4YFKF 3T1BA 3M1EA 2QLZA 1U6GA 2A6HF 4ESFA 5DV5A 1LB2A 3SZPA 2A69F 3F8FA 2H6BA 1MJ9A 1Z1DA 1BC7C 1YTYA 3C7JA 4M6XA 3GWZA 2ISZA 3TGNA 3WGGA 4KIGA 5BQTA 5LHHA 1VTNC 3F8NA 3KLNA 1K78A 2EFOA 2W25A 2DT5A 2QUFA 2H09A 3KZYA 1IN6A 2CSOA 1OPCA 1J0RA 3TOBA 2F5CA 1HBXG 1QZYA 3KFWX 3SQNA 2P7CB 3K1NA 3HRMA 1LDDA 3MCZA 1HKSA 3F3XA 5ICCA 5DDGA 4PGHA 4RS8A 2HYFA 2ZMEB 1ZRDA 2FMYA 3E5XA 4IPAA 4AVPA 1SAXA 3EETA 4HF1A 5HS7A 1DPUA 1FYLA 5HLIA 4RGXA 3WTZA 1OYIA 1ZG3A 3WTWC 5JHUA 1FY7A 2FQ3A 2HGCA 1FBUA 4XSZF 3KP4A 1BI0A 4RGSA 2PMUA 4Q47A 2AXLA 3CO7C 4OINF 3L9FA 4XLPF 1I6XA 1JHHA 3IWFA 3EUHA 1O3SA 1KYZA 3FMSA 2OBPA 2YR2A 2CO5A 4HV6A 1IXSB 5LBQA 1ZRCA 4GYGA 1K7AA 4N9IA 2M87A 4HDVA 3F8CA 4BQAA 4QWQA 4ZYHA 3D0SA 5EEGA 5D8LB 1Y0UA 1T39A 1ZAOA 4R1HA 4AIKA 1R1TA 5HLHA 4A0ZA 1IW7F 1OR7A 4B09A 2P5LC 3GZ6A 3BZ6A 1IN8A 3WTYC 1HW1A 2FNPA 3RTRA 5E1XA 3JTGA 2PN6A 3BJOA 1AWCA 2PBIA 1UFMA 3IC7A 4RB1A 3WTSC 2STWA 2Z5UA 1W7PB 4EMSA 3K1MA 5E18F 1V3FA 1T2KA 2LNBA 4S05A 2NS0A 2M45A 3KETA 2VXZA 5K5RA 1XDUA 2OA4A 1WWXA 3V8LA 1ZGAA 2DU9A 3DEUA 1IXCA 2LF7A 1SD5A 1JE8A 5LHGA 2HS5A 2OZUA 2MH2A 1YIOA 3KP3A 5DD8A 5DYMA 3J80K 3JW4A 3B73A 2JPCA 4LFUA 4IRGA 2P8TA 1KU7A 3TKYA 2H27A 4KYWA 2ELHA 3VFZA 2L4MA 3JTHA 4LMYA 2W24A 3F8BA 2EV6A 3GO5A 4R79A 2XAJA 2JT1A 2A07F 3WTVC 5IT9Z 3DV8A 2X4HA 4Q4ZF 4LK1F 4NB5A 5CLSA 3JAMZ 2M30A 2RNJA 4I09A 1IN4A 2DTRA 3L7WA 4PGGA 2ZNZA 3DF8A 5DCFA 4EM1A 3ELKA 1WQ2A 3I64A 1F1ZA 3LA3A 4L5IA 2V1UA 2ZCWA 2DK5A 1B9NA 3HOSA 4M9XA 3FMQA 1Z91A 2RQPA 1I27A 2HOEA 2BV6A 1O7FA 3HYIA 1XCVA 1MKMA 2A5YB 2RKHA 4EQQA 1UHMA 1LQ1A 1J7KA 2IVMA 1FNNA 4RB2C 3WE3A 1U5TA 2V79A 4M74A 2HEOA 2P5VA 1FSHA 5HVQC 1FP1D 2FRHA 4IHTA 2YX7A 2E1NA 2QQBA 4AWXB 1MJBA 3RJPA 1KYWA 2W85A 3G3ZA 4ZYEA 1RNLA 3CJNA 3L00A 3I59A 2STTA 4CYDA 2P6TA 1G3WA 5D4SA 2JPBA 4OU0A 2HQRA 3Q5FA 3HIFA 4R8HA 2D1HA 3ZQ7A 1S8NA 4ENMA 5BPIA 1S7AA 3I0TA 3F72A 3E3VA 5E20A 4HDUA 1WKMA 5ILVA 4LLGF 4KNYA 4NQWA 3GXOA 3ZP5A 1QZZA 3SHFA 2PLYA 3I53A 3RPQA 2QM3A 1TBXA 4DQ2A 3WODF 1OYYA 2Y75A 3QU6A 4I7HA 2VOPA 4L18B 3OOPA 1F9NA 5CVUA 1FC3A 3ZMVA 1XN7A 1SD7A 2RV8A 5F64A 3T8TA 3IWZA 2XKOA 3Q9SA 1KGSA 4L0ZB 4U7BA 2XAGA 2DFIA 2RN7A 3HSRA 1ZRFA 3QOPA 4LLLA 1WSUA 1TLHB 2CFXA 3E5UA 1T38A 4LB6B 4MQ9F 5D8KB 2FSWA 4G94A 1GHCA 3HRSA 1ZN2A 3FMRA 2GXBA 4GXOA 2EJRA 1QBJA 1MDMA 1TW2A 4JBAA 5LGUA 2YSRA 2D2WA 3LA2A 1FWZA 3GFJA 2FMLA 3O2PE 4S04A 3N4MA 1BI1A 2FU4A 4RAYA 1OYWA 1KQ9A 2P5KA 2OAZA 2IPQX 3TO9A 2DPUA 4A5MA 4LB5A 4ZYGA 4KMUX 1A04A 4XRFA 3VOEA 4IHSA 1SD6A 2KIMA 3HSEA 3REOA 2HDCA 2BBYA 1CF7B 2HYGD 2UWMA 3E5QA 1U8RA 2OQGA 4HYEA 3QPTA 1PUEE 4MTEA 5ILSA 2H6CA 1CGPA 3M8EA 5ICFA 3W6JB 4Q5SF 1R1VA 1XSVA 5E1WA 4L9JA 1O7LA 2PMHA 3LA7A 4GO1A 4BXUA 3VEPA 3CTAA 4YIIA 2O03A 4IVNA 1HSTA 4U7DA 2MH9A 2H94A 4BHCA 4OIOF 1XD7A 3LSTA 4G7ZF 3HRUA 3T0YA 4CO8A 3E6DA 1XDSA 4EVIA 5ERIA 1F4KA 1R7JA 1O3QA 3QU3A 2DO7A 4IXAA 2VT3A 1KQ0A 4UV8A 2CGPA 5E1ZB 1WI9A 5HOOA 3O3KA 4E70A 2EFQA 1W4MA 3U1DA 2Y0MA 2Z3YA 3ABUA 1R58A 1HXDA 4CXFA 1BIAA 1XSDA 5L3FA 4HQMA 2R7DA 3WGHA 4ESBA 3JAMK 2XHKA 4HZFA 1QO0D 3IRQA 3MQ0A 3HHGA 3EDPA 1FT9A 3FWEA 2XRNA 3ISPA 2ZBKA 5L3GA 1FOKA 5EEHA 2KIUA 3BP8A 3O6BB 3QRFF 3F6OA 3J80Z 4HX7A 3M7GA 3COAC 2VT2A 2WC2A 4HF2A 4P96A 2WWYA 5D6EA 2A68F 3ZMZA 2VBWA 2RDPA 5H6QA 4M72A 3R0AA 4I01A 4CICA 3R61A 1XGMA 2ZMEA 3GZ5A 2W84A 1UHWA 3P9IA 5DUKA 4BHPA 4KICA 3WTUC 1S29A 2NYXA 4M71A 1U2WA 4XSXF 3ZMUA 5K5OA 2HTSA 3K9TA 5IT3A 5BS6A 3J7AO 2XIGA 5TJJA 2GWRA 4PZJA 3C1DA 1IN5A 3BJAA 1B9MA 3BPXA 3L09A 3P9CA 1USSA 2PJPA 2PG4A 3NQOA 2ADUA 3DXJF 4KA4A 4OIRF 4A6DA 3K69A 4ZZLA 1ZG5A 2ZXJA 2M5WA 2A6EF 3TDUC 2GA2A 1F5TA 3RPUA 5K1YA 3F8MA 4RAZA 2IA0A 4XLNF 3CUQA 1USTA 2Q0OA 3GFMA 3M9AA 2HFHA 2D1VA 3TQNA 3S2WA 4YG2F 5TRDA 1GXQA 1KU3A 1Z6RA 4HV5A 2PEXA 5F1RA 1YS6A 3ZN1A 4LJZF 2ZFWA 2NNYA 4EV0A 1B59A 2VC0A 1FSEA 4EJVA 1FZPB 2HTJA 2JTVA 4RGRA 3K2ZA 3RYRA 1J2XA 3V8KA 3AAFA 2CQKA 1XB4A 4O5VA 1TW3A 4UV9A 3PQJA 1C0WA 2LDUA 4OMZA 4O3MA 4HA8A 1YG2A 3TDZC 2EA2A 2L3DA 3LQRA 3ABTA 3DPLC 1W5SA 4M73A 4ENKA 4BH9A 2F2EA 4KIFA 3LFKA 5DCMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS8 A;  4A0Y A;  2EV0 A;  1KA8 A;  3FM5 A;  2BYV E;  1KQ8 A;  3V4G A;  1K79 A;  2R3S A;  2LF8 A;  5A2Q Z;  5JR3 A;  3ROU A;  3ZMT A;  4G7H F;  1X3U A;  2K7L A;  3E6C C;  1QPM A;  2RGV A;  3BDD A;  3Q9V A;  3IHU A;  1LVA A;  1R5H A;  1ON1 A;  2QBY B;  3KEO A;  4L5J A;  3KZZ A;  1G6N A;  4OMY A;  3QAH A;  4PCQ A;  3IKT A;  1XGS A;  3MWM A;  3DP7 A;  3IKV A;  2GIV A;  1UCR A;  2IA1 A;  4HW0 A;  2XAS A;  2P6S A;  2YPR A;  1SFE A;  2QVO A;  2K4J A;  4L0Y B;  1MZB A;  4KUM A;  1T98 A;  2BGC A;  4AIH A;  4LD5 A;  1DDN A;  3HHH A;  4A5N A;  1BBY A;  4L9T A;  2COM A;  4Z2Y A;  3LWF A;  4BAY A;  3CDH A;  1PP8 F;  4TV7 A;  4ZH4 F;  3WTX C;  1XGN A;  4EJO A;  4HBL A;  4ETS A;  4HAM A;  4KMF A;  3VB2 A;  4D0P A;  3V7S A;  4KN7 X;  4JK1 X;  1IXR C;  2PFB A;  5FO5 A;  3MAJ A;  1WRJ A;  1T6S A;  1RUN A;  2A61 A;  1U78 A;  3QP5 A;  3GEZ A;  4I98 B;  4KDP A;  1H0M A;  1L3L A;  2GQQ A;  1IUY A;  3U2R A;  1MJA A;  3VOD A;  2Z99 A;  3GLX A;  2FBI A;  3ECH A;  3K1P A;  5FFZ A;  2WV0 A;  1YQA A;  3H3U A;  4HQE A;  4ENJ A;  5ICE A;  1ULY A;  2XAQ A;  3R4K A;  4UVB A;  5LLQ A;  2L01 A;  1B6A A;  4MGR A;  5LRR A;  1BJA A;  3FXU A;  3GYH X;  3FZV A;  1HSJ A;  4LGW A;  3I4P A;  3I59 B;  1G3T A;  3TO6 A;  2FOK A;  1GXP A;  1FBQ A;  3EYY A;  3CLO A;  1EH8 A;  1OMI A;  1LDJ A;  2HR3 A;  5L3D A;  2FBK A;  4IRH A;  2L02 A;  1YLF A;  3MEX A;  5CYV A;  3E6M A;  4ZZD A;  3C18 A;  4N9H A;  5FGM A;  2VBZ A;  4P55 A;  5KK1 A;  1J59 A;  4A0X A;  3CO6 C;  1E2X A;  3ERE D;  2OD5 A;  1BN5 A;  1XMK A;  4B8X A;  1P92 A;  4U0V A;  3FHZ A;  2MBF A;  2O0Y A;  2V6C A;  3V7C A;  5FD6 A;  1TQM A;  1AOY A;  2ACJ A;  1FBS A;  3T8R A;  2ESN A;  4OIQ F;  1K6O A;  1YW9 A;  3DFG A;  1KU9 A;  1FX7 A;  2VON A;  2M8E A;  5FB2 A;  1P4W A;  4RB0 A;  3PFI A;  1HW5 A;  4P9U A;  2QWW A;  1STZ A;  2UXX A;  1ON2 A;  3CUQ C;  2FE3 A;  1BIB A;  4A2U A;  2O61 A;  1R00 A;  3LQQ A;  3HOT A;  3DPT A;  1ZGJ A;  3RYP A;  5IT9 K;  3KLO A;  4WXH A;  2MA3 A;  1PDN C;  5H6R A;  3LAP A;  2L4A A;  3KP7 A;  5LEK A;  2IRF G;  5CJ9 A;  1YO5 C;  3QPH A;  4I2O A;  2GA1 A;  4I0B A;  2ESH A;  2HKX A;  5J8C A;  4UVC A;  1LEB A;  2G7U A;  2K27 A;  2XGX A;  2QYO A;  1G4D A;  1QGP A;  4EGZ A;  1EV7 A;  3K0L A;  5JFR A;  3OV8 A;  1REP C;  1JXS A;  2GZW A;  3SFZ A;  4XBF A;  4MEY F;  2TDX A;  2AS5 F;  3U9G A;  4U88 A;  2KKO A;  4P5O A;  4KN4 X;  2UZK A;  5HDN A;  2OU2 A;  1B4A A;  3GF2 A;  2BE5 F;  2XKP A;  4HF0 A;  5F6F A;  5AIQ A;  3E97 A;  5FD5 A;  3D5L A;  2J5P A;  4GCV A;  3F23 A;  3H3Z A;  3MZY A;  1D8J A;  2O6G E;  3I71 A;  1U3E M;  2LSO A;  5CVV A;  3MFK A;  2VOD A;  4FT8 A;  4Y15 A;  4IF4 A;  3QP6 A;  4CZZ A;  2PQ8 A;  3R60 A;  3J81 K;  5D5W B;  3WU0 A;  1I5Z A;  2DLL A;  3H92 A;  3NRV A;  2NRA C;  2VBX A;  4L9V A;  2HZT A;  4MHG A;  1U5T B;  4G9Y A;  1H9T A;  4RGU A;  2HWV A;  4KIB A;  4EGY A;  1ZYR F;  4BYY A;  4LK0 F;  1J75 A;  4A6E A;  1I1S A;  2Y48 A;  4G6D A;  1BI2 A;  4OOI A;  1SD4 A;  3W6K B;  4CGZ A;  5DUI A;  1MGT A;  1W7P A;  3C3W A;  5HS9 A;  2MLK A;  1DP7 P;  3NEU A;  2XVC A;  3R6S A;  4AD9 A;  3V7R A;  3E6B A;  3KP5 A;  2IW5 A;  2VBY A;  5DEQ A;  4IJA A;  4UNO A;  3M8F A;  2F5D A;  5HLG A;  3BRO A;  1P6R A;  1J9I A;  4WF2 A;  1TQI A;  4M9S A;  4MNU A;  4WXD A;  2EK5 A;  2XV4 S;  3ZMS A;  1XGO A;  1LDK B;  1RZ4 A;  2A3S A;  4M9Z A;  1Z6T A;  2KJB A;  4MQV A;  1XSX A;  2Z33 A;  2XRO A;  3TOA A;  1SMT A;  3CUQ B;  1ZHF A;  3WU1 B;  3ECO A;  3FM3 A;  1DPR A;  3IL2 A;  1HW2 A;  4YFX F;  1R1U A;  1L0O C;  1FLI A;  2O3F A;  2K86 A;  5H20 A;  5DCM A;  2QBY A;  2DBB A;  2CWE A;  2ZJ2 A;  2CW0 F;  2E7W A;  3HTS B;  1IN7 A;  1TNT A;  5D5U B;  1SFU A;  4BHB A;  4OIP F;  4O6J A;  3PQK A;  2FEZ A;  1TTY A;  5E8I A;  5JI6 A;  4DNC A;  2W57 A;  2D45 A;  1TQP A;  5D5X B;  4RB3 C;  1S6L A;  2Z9O A;  2ZKZ A;  1UB9 A;  4EM0 B;  2XUB A;  5AON A;  3EYI A;  5KVR A;  4L9N A;  3KP6 A;  2HKO A;  2FF4 A;  2VN2 A;  2FNA A;  2WTE A;  5HDK A;  2G7H A;  5L3B A;  2PI0 A;  3SXY A;  2JSC A;  4FX0 A;  1FP2 A;  2DQR A;  1D5V A;  2KRF A;  2FBH A;  4WK8 F;  4HX4 A;  3G73 A;  5ED4 A;  2E7X A;  1XMA A;  3P7N A;  1IAW A;  2BEO A;  5K5Q A;  2EFW A;  3JSP A;  5D6F A;  4WWC A;  4NHJ A;  4EJT A;  3J81 Z;  2B0L A;  2P4W A;  2VC1 A;  1R22 A;  4G6Q A;  2MD5 A;  5LHI A;  1YFH A;  1GVJ A;  3B02 A;  1XCB A;  5LGN A;  4F7Z A;  3FXQ A;  2VE8 A;  3BOQ A;  5D4R A;  1KU2 A;  3HTU A;  1LJ9 A;  1J5Y A;  5FLX Z;  1BOA A;  1ZLK A;  5JVT A;  1R5G A;  1ZRE A;  3BY6 A;  4AIJ A;  4Q48 A;  1TNS A;  2P7V B;  1ZG1 A;  1FPQ A;  2KJC A;  2L54 A;  1Q1H A;  1H9G A;  1P4A A;  1Z7U A;  4HLX A;  4N0B A;  1JHF A;  5BOX A;  2CG4 A;  2M1B A;  5LGT A;  2G9W A;  5BMZ A;  3GFL A;  1JGS A;  2RC4 A;  1O57 A;  3KEQ A;  3CUO A;  1SFX A;  1MD0 A;  1QQI A;  5L3C A;  3GUD A;  2EB7 A;  2GXG A;  2QZ8 A;  2O8X A;  5L3E A;  1D8K A;  1MDM B;  1ZH5 A;  2DAO A;  2X0L A;  5E8G A;  2EFP A;  2KIF A;  4UUV A;  1R23 A;  4A12 A;  5CVR A;  1G3Y A;  2YU3 A;  2J5O A;  4Y13 A;  4ENN A;  2QQ9 A;  4U0W A;  1FYK A;  5AIP A;  2NAZ A;  4LLN A;  2V1X A;  3WTT C;  1I1G A;  1SMY F;  1W5T A;  2HQN A;  4CDG A;  1DUX C;  2DK8 A;  2FA5 A;  1R36 A;  3JSO A;  2F5F A;  4M6Y A;  2EWN A;  3I58 A;  4EM2 A;  1K78 B;  5J8F A;  1RIO H;  4YFN F;  1OKR A;  2EV5 A;  4EJW A;  3N97 A;  1QNT A;  1RI7 A;  2CYY A;  1IRF A;  3I5U A;  2YX4 A;  3R0J A;  1O3R A;  5ICG A;  3DQV C;  2IP2 A;  1ZAR A;  2EA4 A;  2DW4 A;  2QEN A;  3ZPL A;  2ZNY A;  2IJL A;  3FX3 A;  5LEJ A;  3RI4 A;  2IA2 A;  1BI3 A;  1BM9 A;  4WCG A;  2K02 A;  4GYI A;  3ULQ B;  3IRR A;  5HDG A;  4UXN A;  2LKP A;  2GAU A;  5CVI A;  6PAX A;  3FXR A;  5ILU A;  2ISY A;  3LAJ A;  1RUO A;  2F5E A;  1YYV A;  3RIR A;  3SZT A;  1P2F A;  2OQR A;  1EH7 A;  4P9F A;  3WE2 A;  4ON0 A;  1Z9C A;  2DQL A;  1YW7 A;  2ETH A;  4BNC A;  2IT0 A;  1LEA A;  2OZ6 A;  4G7O F;  4EJU A;  1PP7 U;  4LG0 A;  5BPD A;  5FFX A;  4Y17 A;  2UXN A;  4UHT A;  4ZYD A;  2Q2E A;  1YS7 A;  2K4B A;  3KE2 A;  3GVA A;  3HSF A;  2DPD A;  1LNW A;  4CHU A;  4KFC A;  1G3S A;  2JRT A;  5A2Q K;  1IRG A;  4H0E A;  4WX9 A;  3TO7 A;  4IRI A;  3RKY A;  1HKQ A;  1T0F A;  3T5X A;  1S7O A;  2XAF A;  1O3T A;  4FHT A;  5DD4 A;  3RKX A;  3ML6 A;  4KT5 C;  1P4X A;  1ZLJ A;  1EH6 A;  2VE9 A;  2R7F A;  4HX8 A;  5CVJ A;  3MZH A;  3GFI A;  1IZ1 A;  3ZN0 A;  2E1C A;  5D5V B;  3GW2 A;  5E17 F;  1S3J A;  1V4R A;  4WXC A;  4LG0 B;  5FLX K;  2V1D A;  3L2C A;  3P9K A;  2ZO4 A;  1E17 A;  4YIF A;  3KP2 A;  1NHA A;  4JQF A;  2Q8K A;  4MEX F;  3HRT A;  3DKW A;  1U5T C;  3F21 A;  4GGG A;  4PDK A;  1Z05 A;  4FX4 A;  4UVA A;  2XAH A;  2C6Y A;  2FXA A;  2VOO A;  4I0A A;  2EFN A;  1BC8 C;  3BWG A;  5J6X A;  3RKW A;  2MLG A;  4U0Y A;  1W7P D;  4K2E A;  1YW8 A;  3RDI A;  3WG9 A;  2QQA A;  3I54 A;  4HLY A;  1IF1 A;  4I02 A;  3BJ6 A;  2MC3 A;  2DI3 A;  1ODD A;  4ESJ A;  4G8X A;  1HKT A;  3HUG A;  3F22 A;  1ONV A;  3EQL F;  1B1B A;  5LRS A;  3FF5 A;  2NNN A;  4MTD A;  4ASN A;  3BPV A;  1HQC A;  3V8J A;  1CF7 A;  1D3Y A;  3F6V A;  2V9V A;  3ZMD A;  3WGI A;  2RVC A;  4QLC U;  1FYM A;  3GX4 X;  2JZY A;  3KCC A;  4HOB A;  4YFK F;  3T1B A;  3M1E A;  2QLZ A;  1U6G A;  2A6H F;  4ESF A;  5DV5 A;  1LB2 A;  3SZP A;  2A69 F;  3F8F A;  2H6B A;  1MJ9 A;  1Z1D A;  1BC7 C;  1YTY A;  3C7J A;  4M6X A;  3GWZ A;  2ISZ A;  3TGN A;  3WGG A;  4KIG A;  5BQT A;  5LHH A;  1VTN C;  3F8N A;  3KLN A;  1K78 A;  2EFO A;  2W25 A;  2DT5 A;  2QUF A;  2H09 A;  3KZY A;  1IN6 A;  2CSO A;  1OPC A;  1J0R A;  3TOB A;  2F5C A;  1HBX G;  1QZY A;  3KFW X;  3SQN A;  2P7C B;  3K1N A;  3HRM A;  1LDD A;  3MCZ A;  1HKS A;  3F3X A;  5ICC A;  5DDG A;  4PGH A;  4RS8 A;  2HYF A;  2ZME B;  1ZRD A;  2FMY A;  3E5X A;  4IPA A;  4AVP A;  1SAX A;  3EET A;  4HF1 A;  5HS7 A;  1DPU A;  1FYL A;  5HLI A;  4RGX A;  3WTZ A;  1OYI A;  1ZG3 A;  3WTW C;  5JHU A;  1FY7 A;  2FQ3 A;  2HGC A;  1FBU A;  4XSZ F;  3KP4 A;  1BI0 A;  4RGS A;  2PMU A;  4Q47 A;  2AXL A;  3CO7 C;  4OIN F;  3L9F A;  4XLP F;  1I6X A;  1JHH A;  3IWF A;  3EUH A;  1O3S A;  1KYZ A;  3FMS A;  2OBP A;  2YR2 A;  2CO5 A;  4HV6 A;  1IXS B;  5LBQ A;  1ZRC A;  4GYG A;  1K7A A;  4N9I A;  2M87 A;  4HDV A;  3F8C A;  4BQA A;  4QWQ A;  4ZYH A;  3D0S A;  5EEG A;  5D8L B;  1Y0U A;  1T39 A;  1ZAO A;  4R1H A;  4AIK A;  1R1T A;  5HLH A;  4A0Z A;  1IW7 F;  1OR7 A;  4B09 A;  2P5L C;  3GZ6 A;  3BZ6 A;  1IN8 A;  3WTY C;  1HW1 A;  2FNP A;  3RTR A;  5E1X A;  3JTG A;  2PN6 A;  3BJO A;  1AWC A;  2PBI A;  1UFM A;  3IC7 A;  4RB1 A;  3WTS C;  2STW A;  2Z5U A;  1W7P B;  4EMS A;  3K1M A;  5E18 F;  1V3F A;  1T2K A;  2LNB A;  4S05 A;  2NS0 A;  2M45 A;  3KET A;  2VXZ A;  5K5R A;  1XDU A;  2OA4 A;  1WWX A;  3V8L A;  1ZGA A;  2DU9 A;  3DEU A;  1IXC A;  2LF7 A;  1SD5 A;  1JE8 A;  5LHG A;  2HS5 A;  2OZU A;  2MH2 A;  1YIO A;  3KP3 A;  5DD8 A;  5DYM A;  3J80 K;  3JW4 A;  3B73 A;  2JPC A;  4LFU A;  4IRG A;  2P8T A;  1KU7 A;  3TKY A;  2H27 A;  4KYW A;  2ELH A;  3VFZ A;  2L4M A;  3JTH A;  4LMY A;  2W24 A;  3F8B A;  2EV6 A;  3GO5 A;  4R79 A;  2XAJ A;  2JT1 A;  2A07 F;  3WTV C;  5IT9 Z;  3DV8 A;  2X4H A;  4Q4Z F;  4LK1 F;  4NB5 A;  5CLS A;  3JAM Z;  2M30 A;  2RNJ A;  4I09 A;  1IN4 A;  2DTR A;  3L7W A;  4PGG A;  2ZNZ A;  3DF8 A;  5DCF A;  4EM1 A;  3ELK A;  1WQ2 A;  3I64 A;  1F1Z A;  3LA3 A;  4L5I A;  2V1U A;  2ZCW A;  2DK5 A;  1B9N A;  3HOS A;  4M9X A;  3FMQ A;  1Z91 A;  2RQP A;  1I27 A;  2HOE A;  2BV6 A;  1O7F A;  3HYI A;  1XCV A;  1MKM A;  2A5Y B;  2RKH A;  4EQQ A;  1UHM A;  1LQ1 A;  1J7K A;  2IVM A;  1FNN A;  4RB2 C;  3WE3 A;  1U5T A;  2V79 A;  4M74 A;  2HEO A;  2P5V A;  1FSH A;  5HVQ C;  1FP1 D;  2FRH A;  4IHT A;  2YX7 A;  2E1N A;  2QQB A;  4AWX B;  1MJB A;  3RJP A;  1KYW A;  2W85 A;  3G3Z A;  4ZYE A;  1RNL A;  3CJN A;  3L00 A;  3I59 A;  2STT A;  4CYD A;  2P6T A;  1G3W A;  5D4S A;  2JPB A;  4OU0 A;  2HQR A;  3Q5F A;  3HIF A;  4R8H A;  2D1H A;  3ZQ7 A;  1S8N A;  4ENM A;  5BPI A;  1S7A A;  3I0T A;  3F72 A;  3E3V A;  5E20 A;  4HDU A;  1WKM A;  5ILV A;  4LLG F;  4KNY A;  4NQW A;  3GXO A;  3ZP5 A;  1QZZ A;  3SHF A;  2PLY A;  3I53 A;  3RPQ A;  2QM3 A;  1TBX A;  4DQ2 A;  3WOD F;  1OYY A;  2Y75 A;  3QU6 A;  4I7H A;  2VOP A;  4L18 B;  3OOP A;  1F9N A;  5CVU A;  1FC3 A;  3ZMV A;  1XN7 A;  1SD7 A;  2RV8 A;  5F64 A;  3T8T A;  3IWZ A;  2XKO A;  3Q9S A;  1KGS A;  4L0Z B;  4U7B A;  2XAG A;  2DFI A;  2RN7 A;  3HSR A;  1ZRF A;  3QOP A;  4LLL A;  1WSU A;  1TLH B;  2CFX A;  3E5U A;  1T38 A;  4LB6 B;  4MQ9 F;  5D8K B;  2FSW A;  4G94 A;  1GHC A;  3HRS A;  1ZN2 A;  3FMR A;  2GXB A;  4GXO A;  2EJR A;  1QBJ A;  1MDM A;  1TW2 A;  4JBA A;  5LGU A;  2YSR A;  2D2W A;  3LA2 A;  1FWZ A;  3GFJ A;  2FML A;  3O2P E;  4S04 A;  3N4M A;  1BI1 A;  2FU4 A;  4RAY A;  1OYW A;  1KQ9 A;  2P5K A;  2OAZ A;  2IPQ X;  3TO9 A;  2DPU A;  4A5M A;  4LB5 A;  4ZYG A;  4KMU X;  1A04 A;  4XRF A;  3VOE A;  4IHS A;  1SD6 A;  2KIM A;  3HSE A;  3REO A;  2HDC A;  2BBY A;  1CF7 B;  2HYG D;  2UWM A;  3E5Q A;  1U8R A;  2OQG A;  4HYE A;  3QPT A;  1PUE E;  4MTE A;  5ILS A;  2H6C A;  1CGP A;  3M8E A;  5ICF A;  3W6J B;  4Q5S F;  1R1V A;  1XSV A;  5E1W A;  4L9J A;  1O7L A;  2PMH A;  3LA7 A;  4GO1 A;  4BXU A;  3VEP A;  3CTA A;  4YII A;  2O03 A;  4IVN A;  1HST A;  4U7D A;  2MH9 A;  2H94 A;  4BHC A;  4OIO F;  1XD7 A;  3LST A;  4G7Z F;  3HRU A;  3T0Y A;  4CO8 A;  3E6D A;  1XDS A;  4EVI A;  5ERI A;  1F4K A;  1R7J A;  1O3Q A;  3QU3 A;  2DO7 A;  4IXA A;  2VT3 A;  1KQ0 A;  4UV8 A;  2CGP A;  5E1Z B;  1WI9 A;  5HOO A;  3O3K A;  4E70 A;  2EFQ A;  1W4M A;  3U1D A;  2Y0M A;  2Z3Y A;  3ABU A;  1R58 A;  1HXD A;  4CXF A;  1BIA A;  1XSD A;  5L3F A;  4HQM A;  2R7D A;  3WGH A;  4ESB A;  3JAM K;  2XHK A;  4HZF A;  1QO0 D;  3IRQ A;  3MQ0 A;  3HHG A;  3EDP A;  1FT9 A;  3FWE A;  2XRN A;  3ISP A;  2ZBK A;  5L3G A;  1FOK A;  5EEH A;  2KIU A;  3BP8 A;  3O6B B;  3QRF F;  3F6O A;  3J80 Z;  4HX7 A;  3M7G A;  3COA C;  2VT2 A;  2WC2 A;  4HF2 A;  4P96 A;  2WWY A;  5D6E A;  2A68 F;  3ZMZ A;  2VBW A;  2RDP A;  5H6Q A;  4M72 A;  3R0A A;  4I01 A;  4CIC A;  3R61 A;  1XGM A;  2ZME A;  3GZ5 A;  2W84 A;  1UHW A;  3P9I A;  5DUK A;  4BHP A;  4KIC A;  3WTU C;  1S29 A;  2NYX A;  4M71 A;  1U2W A;  4XSX F;  3ZMU A;  5K5O A;  2HTS A;  3K9T A;  5IT3 A;  5BS6 A;  3J7A O;  2XIG A;  5TJJ A;  2GWR A;  4PZJ A;  3C1D A;  1IN5 A;  3BJA A;  1B9M A;  3BPX A;  3L09 A;  3P9C A;  1USS A;  2PJP A;  2PG4 A;  3NQO A;  2ADU A;  3DXJ F;  4KA4 A;  4OIR F;  4A6D A;  3K69 A;  4ZZL A;  1ZG5 A;  2ZXJ A;  2M5W A;  2A6E F;  3TDU C;  2GA2 A;  1F5T A;  3RPU A;  5K1Y A;  3F8M A;  4RAZ A;  2IA0 A;  4XLN F;  3CUQ A;  1UST A;  2Q0O A;  3GFM A;  3M9A A;  2HFH A;  2D1V A;  3TQN A;  3S2W A;  4YG2 F;  5TRD A;  1GXQ A;  1KU3 A;  1Z6R A;  4HV5 A;  2PEX A;  5F1R A;  1YS6 A;  3ZN1 A;  4LJZ F;  2ZFW A;  2NNY A;  4EV0 A;  1B59 A;  2VC0 A;  1FSE A;  4EJV A;  1FZP B;  2HTJ A;  2JTV A;  4RGR A;  3K2Z A;  3RYR A;  1J2X A;  3V8K A;  3AAF A;  2CQK A;  1XB4 A;  4O5V A;  1TW3 A;  4UV9 A;  3PQJ A;  1C0W A;  2LDU A;  4OMZ A;  4O3M A;  4HA8 A;  1YG2 A;  3TDZ C;  2EA2 A;  2L3D A;  3LQR A;  3ABT A;  3DPL C;  1W5S A;  4M73 A;  4ENK A;  4BH9 A;  2F2E A;  4KIF A;  3LFK A;  5DCM B; 
#chains in the Genus database with same CATH topology
 4ZDP A;  3HOW J;  1EA3 A;  5HS8 A;  2W00 A;  1XPX A;  1OFC X;  2CJJ A;  1MBH A;  4NC7 A;  4A0Y A;  2Q1Z B;  2VQG A;  2EV0 A;  1KA8 A;  2R4G A;  3FM5 A;  3FXM A;  2X6Y A;  2BYV E;  1VQO I;  3IH2 A;  2VUM J;  1KQ8 A;  1VQ4 I;  3RZO J;  3IUO A;  3V4G A;  1K79 A;  3I3L A;  3HOZ J;  2R3S A;  1VQ9 I;  2LF8 A;  5A2Q Z;  5JR3 A;  3ROU A;  3SYT A;  2F4M B;  3A0B C;  1OLT A;  1X1B A;  3ZMT A;  4G7H F;  2Y30 A;  1I50 J;  1X3U A;  4C3I J;  2K7L A;  3E6C C;  1QPM A;  3BTC A;  2E2I J;  4LIU A;  1ZR2 A;  2MG4 A;  2RGV A;  3BDD A;  3Q9V A;  3IHU A;  1LVA A;  4EEF G;  1D0X A;  1R5H A;  2MC4 A;  1QPI A;  2EIN H;  1ON1 A;  4RA2 A;  2QBY B;  3KEO A;  4L5J A;  3KZZ A;  2CW7 A;  3CC4 I;  1G6N A;  2LKS A;  4OMY A;  3OWT A;  3HC7 A;  3QAH A;  3QWL A;  4PCQ A;  4DZP A;  3MWM A;  1XGS A;  2NXN B;  3IKT A;  3DP7 A;  3IKV A;  3C2G A;  3DBL B;  1P7J A;  2GIV A;  1T8I A;  1UCR A;  1V5G A;  2IA1 A;  4HW0 A;  2XAS A;  2W4S A;  2P6S A;  2NS7 A;  2YPR A;  1SFE A;  2QVO A;  2K4J A;  4L0Y B;  2TRT A;  3PL8 A;  4PJJ A;  1U0J A;  1MZB A;  4KUM A;  2HDD A;  2QSH X;  1S5L C;  1T98 A;  1U9N A;  5H2F C;  3RQ4 A;  3OYJ A;  3KIO A;  2BGC A;  2FUG 2;  1R6R A;  2K3P A;  5FKL A;  2EIK H;  1JKP C;  3I9V 2;  3AFH A;  4BQQ A;  4AIH A;  4LD5 A;  2WAE A;  2X48 A;  1DDN A;  2BVM A;  4ZTF A;  2R92 J;  3A0H C;  1TT5 B;  2DMP A;  3HHH A;  4A5N A;  3M1C A;  1BBY A;  2RAE A;  5EJC A;  1OQY A;  2VPR A;  2COM A;  2MW8 A;  4L9T A;  1BL0 A;  4Z2Y A;  3LWF A;  2VKE A;  1RKT A;  4BAY A;  1IJW C;  4E7S A;  3UNG C;  3CDH A;  2I10 A;  1PP8 F;  4TV7 A;  1YJ9 I;  4ZH4 F;  4ZDO A;  4XLH A;  3WTX C;  5IP9 J;  1XGN A;  4EJO A;  4HBL A;  4ETS A;  4HAM A;  4XKC A;  2JSP A;  2X1E A;  1V5F A;  1J09 A;  4M3E A;  4KMF A;  2B63 J;  1AHD P;  5EF6 A;  2E5N A;  3OIP A;  3VB2 A;  4D0P A;  3HM5 A;  3V7S A;  4KN7 X;  3F9K A;  1FOY A;  4JK1 X;  1IXR C;  2PFB A;  5FO5 A;  3MAJ A;  1WRJ A;  5E79 C;  1T6S A;  2M4K A;  4F92 B;  1RUN A;  2A61 A;  1U78 A;  3S93 A;  3QYF A;  1LE8 A;  4BBS J;  2ME0 A;  3GEZ A;  3QP5 A;  4I98 B;  4NNJ A;  5B3S H;  2GM4 A;  1WGX A;  1JJ8 C;  2DYS H;  3H5R A;  3H9J A;  1H89 C;  4KDP A;  3HPG A;  3VWB A;  1H0M A;  1L3L A;  2V26 A;  2VAS A;  2GQQ A;  3HG9 A;  2FQ4 A;  1IUY A;  3U2R A;  3CCQ I;  1MJA A;  4I6Z A;  3VOD A;  1Y56 A;  1WJC A;  2Z99 A;  3GLX A;  2FBI A;  3ECH A;  1SVL A;  2ZSI B;  3E7L A;  1BR4 A;  3K1P A;  3FKI J;  3PSI A;  5FFZ A;  2WV0 A;  5GAG J;  3E0J B;  1YQA A;  3H3U A;  4P1W A;  4IOA F;  4HQE A;  4ENJ A;  2NVY J;  5ICE A;  1ULY A;  2HOT A;  3A01 B;  2XAQ A;  3S14 J;  2CQQ A;  3R4K A;  3IV5 A;  2LRE A;  3HB9 A;  2E1M C;  4UVB A;  5LLQ A;  4II2 A;  2L01 A;  2R7R A;  1AA7 A;  1B6A A;  4MGR A;  5LRR A;  4X1E A;  1BJA A;  4FE7 A;  3FXU A;  5KHD A;  3I4M J;  1ITY A;  4G6T B;  3GYH X;  3FZV A;  5F0H A;  1HSJ A;  1HA8 A;  3HXL A;  1GV2 A;  4D7N A;  4LGW A;  4RLQ A;  3I4P A;  3I59 B;  1G3T A;  4AYB A;  3BTI A;  3TO6 A;  1WJA A;  3MD2 A;  1TL8 A;  3VYR B;  2FOK A;  2MAB A;  2IS6 A;  3K6G A;  4CUG A;  1FBQ A;  4JOM A;  1GXP A;  4BL0 B;  2R7U A;  3EYY A;  3CLO A;  4YRV A;  2K9Q A;  3PO2 J;  1EH8 A;  1OMI A;  2D5V A;  1LDJ A;  1HDP A;  3DTK A;  3OYK A;  2HDW A;  2HR3 A;  5L3D A;  2FBK A;  2LY9 A;  4IRH A;  3OIQ A;  3K70 C;  2L02 A;  4RMN A;  1MMG A;  4OWR B;  4YEL A;  1YLF A;  3MEX A;  3ABM H;  5CYV A;  3E6M A;  4ZZD A;  5J1R A;  3C18 A;  5GP9 A;  4N9H A;  2KIQ A;  5FGM A;  2VBZ A;  4P55 A;  3PNV A;  5KK1 A;  1J59 A;  4A0X A;  3CO6 C;  1E2X A;  3ERE D;  1HDD C;  3PUF A;  2OD5 A;  1BN5 A;  1XMK A;  3PFY A;  4B8X A;  4JX6 A;  3OSG A;  1P92 A;  4U0V A;  3FHZ A;  2M2E A;  3OYD A;  3AL0 B;  2MBF A;  2O0Y A;  2V6C A;  3V7C A;  3V42 A;  3JCU C;  5FD6 A;  1TQM A;  2AO9 A;  1AOY A;  2ACJ A;  1FBS A;  2CH0 A;  3T8R A;  5GPC A;  2ESN A;  4OIQ F;  2XF6 A;  2LYC A;  2L9V A;  3DFG A;  1YW9 A;  1ZTR A;  1K6O A;  3M4O J;  4XMY A;  1JKO C;  1KU9 A;  1FX7 A;  3FHN A;  4AC0 A;  2VON A;  1JUP A;  1SAN A;  5EGO B;  3OYE A;  2M8E A;  5FB2 A;  1P4W A;  3AG2 H;  2WA0 A;  3J7Y J;  4RB0 A;  3PFI A;  2M9H A;  3L2Q A;  1HW5 A;  4P9U A;  2QWW A;  2ECC A;  4F55 A;  1STZ A;  4QIW N;  2UXX A;  2GXA A;  1IC8 A;  1ON2 A;  3CUQ C;  2FE3 A;  1BIB A;  1VND A;  2QKM B;  3PJR A;  4A2U A;  2PJR A;  2COB A;  2DOF A;  2HPM A;  5M3M J;  2BY1 A;  3OS1 A;  2O61 A;  1R00 A;  3LQQ A;  3HOT A;  1JGG A;  3S15 J;  3DPT A;  2HOA A;  2VIX A;  1ZGJ A;  3ZOB A;  3BZC A;  2VQC A;  3RYP A;  5IT9 K;  1I3A A;  3KLO A;  4WXH A;  1K4T A;  2MA3 A;  1PDN C;  5H6R A;  3LAP A;  2L4A A;  4F91 B;  3JRB A;  1WZ2 A;  3KP7 A;  5LEK A;  2IRF G;  5CJ9 A;  5EEA A;  1YO5 C;  2K9L A;  1UMQ A;  2LTP A;  3QPH A;  3JRH A;  2L9N A;  3ZCO A;  4I2O A;  2GA1 A;  4I0B A;  4XR6 A;  1ENH A;  2ESH A;  2HKX A;  5J8C A;  4UVC A;  4BKX A;  2DDA A;  2G7U A;  1LEB A;  2K27 A;  4XK4 A;  5JVG F;  2V1N A;  2XGX A;  2DYR H;  2QYO A;  1G4D A;  1QGP A;  4EGZ A;  3LOC A;  1EV7 A;  1LE8 B;  3BLY A;  1POG A;  2LK2 A;  4MFE A;  1OCC H;  2ME6 A;  3K0L A;  1GVD A;  2ZME C;  3OV8 A;  3QQA A;  4YEJ A;  5JFR A;  1G2H A;  2P81 A;  1REP C;  1JXS A;  1X1D A;  3AG3 H;  5GAE J;  2GZW A;  5IPA A;  3SFZ A;  1V54 H;  4CCN A;  4HNT A;  4XBF A;  4MEY F;  2TDX A;  3Q0V A;  1HOM A;  2AS5 F;  2KP6 A;  3HPH A;  3U9G A;  4U88 A;  3A01 A;  2KKO A;  4P5O A;  1MBE A;  4KN4 X;  2UZK A;  2NVQ J;  5HLT A;  2DT7 B;  5HDN A;  5FLM J;  1R49 A;  2OU2 A;  1PUF A;  3W6V A;  2VB6 A;  5CKT A;  3MKY B;  1B4A A;  3GF2 A;  4CCM A;  3SEQ A;  4BAC A;  2A05 A;  2BE5 F;  2XKP A;  4HF0 A;  5F6F A;  3N05 A;  1ZKG A;  5AIQ A;  3E97 A;  2LOO A;  3FBI B;  5FD5 A;  3LSH A;  1DQU A;  1A6I A;  3D5L A;  1ZQ3 P;  1IV6 A;  2J5P A;  4PSX A;  4GCV A;  3F23 A;  2XPV A;  3H1C A;  3H3Z A;  3MZY A;  3K4L A;  4XNF A;  1D8J A;  2O6G E;  2QSF X;  3I71 A;  5J47 A;  2EQR A;  4B44 A;  2LSO A;  1U3E M;  5CVV A;  2NVX J;  3A4C A;  1VQ7 I;  3MFK A;  9ANT A;  2VOD A;  2H1L A;  4FT8 A;  4Y15 A;  4IF4 A;  3QP6 A;  4CZZ A;  2E2J J;  2PQ8 A;  3R60 A;  3J81 K;  2KMU A;  4E7L A;  2XC7 A;  2HOS A;  4XID A;  3ONQ A;  4Y33 A;  5D5W B;  3S1Q J;  5E3O A;  4C3H J;  3WU0 A;  5M3F J;  2R0Q C;  1I5Z A;  2DLL A;  3BR6 A;  3M3Y J;  3H92 A;  1K6Y A;  5FJ8 J;  1Y8R B;  1K61 A;  3NRV A;  2NRA C;  2EZL A;  2VBX A;  4L9V A;  2HZT A;  4MHG A;  1U5T B;  2XPU A;  3U21 A;  4M3G A;  3PIO F;  1E3O C;  5IYB J;  4G9Y A;  2E36 A;  2JMW A;  5F04 A;  4RGU A;  1H9T A;  5F08 A;  3OYM A;  3DEE A;  3RPU D;  2KIS A;  3H5A A;  2HWV A;  4KIB A;  4EGY A;  1ZYR F;  3HGY A;  4BYY A;  4LK0 F;  4PUS A;  1J75 A;  4A6E A;  4UUS B;  1I1S A;  4BBR J;  2Y48 A;  4G6D A;  4ANJ A;  1BI2 A;  4OAZ A;  4OOI A;  1SD4 A;  3W6K B;  5J1Y A;  1E3H A;  4CGZ A;  4MIM A;  5DUI A;  5IYC J;  4E7K A;  5JLW A;  2L2O A;  1MGT A;  2DOA A;  2M34 A;  1W7P A;  3C3W A;  5HS9 A;  2MLK A;  1DP7 P;  3D1N I;  3NEU A;  2XVC A;  3R6S A;  3CCR I;  4AD9 A;  5GAD J;  3V7R A;  1YX3 A;  3E6B A;  3KP5 A;  2IW5 A;  2LG4 A;  1TWG J;  2VBY A;  5DEQ A;  5J4V A;  3K70 D;  4JX4 A;  1RET A;  5KAI C;  1MIJ A;  1QVT A;  4IJA A;  4N4O B;  2R7S A;  4C3J J;  2JUC A;  4UNO A;  3OIO A;  3M8F A;  1JJ6 C;  1KZH A;  2F5D A;  5HLG A;  2LRD A;  2CQ7 A;  1YRN B;  3BRO A;  1MBF A;  1P6R A;  1J9I A;  4WF2 A;  3BQZ A;  3CMY A;  4BS9 A;  3GTJ J;  1TQI A;  4HG2 A;  4M9S A;  2EZI A;  5KAF C;  1OJL A;  2MD0 A;  1LFP A;  3K10 A;  4MNU A;  4WXD A;  3LSP A;  2EK5 A;  4IHV A;  3FKJ A;  1HLV A;  1VZ0 A;  2XV4 S;  4DYQ A;  3ZMS A;  2WY7 Q;  1D1C A;  1TZL A;  2CS3 A;  1F43 A;  1XGO A;  1BR2 A;  2YS9 A;  4N4N B;  1LDK B;  1RZ4 A;  2A3S A;  4M9Z A;  2BVL A;  2VKD A;  1Z6T A;  2KJB A;  4BGD A;  4MQV A;  2HVR A;  1XSX A;  4ZC3 A;  2Z33 A;  2XRO A;  3TOA A;  2GOM A;  2DJN A;  1TWH J;  1H88 C;  1SMT A;  2LMD A;  1N77 A;  3CUQ B;  1S9H A;  4XRS A;  1ZHF A;  3WU1 B;  3A2K A;  3VYU B;  3ECO A;  3FM3 A;  3ZQH A;  1DPR A;  3Q0W A;  4B48 A;  4XRM A;  1HF0 A;  4E7H A;  3MKZ A;  1BOB A;  3IL2 A;  1HW2 A;  4YFX F;  1QHG A;  1R1U A;  3KYD B;  1L0O C;  1FLI A;  2O3F A;  2K86 A;  5H20 A;  5DCM A;  2QBY A;  3J7Z I;  2DBB A;  3OYB A;  1NK2 P;  2CWE A;  2ZJ2 A;  4CA0 A;  2MSY A;  2QA4 I;  2CW0 F;  2HXI A;  2E7W A;  3HTS B;  1IN7 A;  1TNT A;  5D5U B;  1SFU A;  4BHB A;  3BG3 A;  3QYB A;  3S8P A;  4XLC A;  4OIP F;  4O6J A;  3ZRG A;  3PQK A;  4RDU A;  2FEZ A;  1U8B A;  2X85 A;  2EZH A;  1TTY A;  1ETV A;  5E8I A;  5JI6 A;  4DNC A;  2W57 A;  1ZGW A;  2D45 A;  2HZD A;  1TQP A;  2QQ8 A;  5D5X B;  4RB3 C;  1S6L A;  4A3M J;  4DJA A;  4YIR X;  2Z9O A;  2ZKZ A;  1XG1 A;  2JVH A;  1UB9 A;  4EM0 B;  4BY7 J;  2XUB A;  3PNY A;  5AON A;  4A69 C;  3EYI A;  2DN0 A;  2ID3 A;  1SFO J;  5KVR A;  3ZQF A;  4FAS D;  4L9N A;  1K83 J;  3KP6 A;  1D5Y A;  2HKO A;  2OTL I;  2FF4 A;  3SDB A;  1WH7 A;  3KPH A;  4Y7N J;  2K9N A;  2VN2 A;  2FNA A;  2WTE A;  4C30 A;  5HDK A;  2G7H A;  2R7V A;  2JA8 J;  4RM3 A;  5L3B A;  2PI0 A;  3SXY A;  2JSC A;  5IY5 H;  4FX0 A;  2CQN A;  4B3X A;  1FP2 A;  1EKE A;  2DQR A;  1ZR4 A;  1D5V A;  2KRF A;  2FBH A;  3GME A;  1UZC A;  2XGD A;  4HX4 A;  4WK8 F;  5ED4 A;  3G73 A;  2JQ7 A;  2ICW G;  4M3B A;  4XOR A;  4IQ4 A;  4OAY A;  2VJJ A;  2E7X A;  1XMA A;  2X51 A;  3P7N A;  2BEO A;  5K5Q A;  2Y31 A;  3FK7 A;  1IAW A;  2RQQ A;  2EFW A;  5CPR B;  3JSP A;  5D6F A;  4WWC A;  3KZI C;  4NHJ A;  4EJT A;  2DOD A;  3J81 Z;  2B0L A;  2P4W A;  5JLX A;  4CYC B;  4IO9 F;  1QU3 A;  1T56 A;  2VC1 A;  1R22 A;  4G6Q A;  4FIS A;  1YI2 I;  3OS2 A;  1X4P A;  2MD5 A;  5LHI A;  2L5Q A;  2Z1D A;  5K7F A;  4QTR A;  1YFH A;  1GVJ A;  3B02 A;  3LSR A;  3H36 A;  1APL C;  4M3D A;  4A3C J;  2HI3 A;  1I3Q J;  2WB1 A;  5J40 A;  1IUF A;  2RRE A;  4A3D J;  2DT6 A;  1XCB A;  4D9J A;  5LGN A;  3JRE A;  3ASN H;  4F7Z A;  2E19 A;  4XM3 A;  3FXQ A;  2DFH A;  5CQE A;  3OYI A;  2VE8 A;  3OS0 A;  1VQM I;  2X6W A;  4A3F J;  3BOQ A;  5D4R A;  1KU2 A;  3HTU A;  1PUF B;  1LJ9 A;  1J5Y A;  5FLX Z;  1MBJ A;  1BOA A;  1MH4 A;  2L7M P;  1ZLK A;  1MND A;  3BR2 A;  1F36 A;  2XDV A;  5JVT A;  1R5G A;  1ZRE A;  3BY6 A;  2LD5 A;  2Y2Z A;  4AIJ A;  2LP0 A;  4Q48 A;  1DP3 A;  2BY0 A;  1TNS A;  2P7V B;  3DCF A;  3BR1 A;  1ZG1 A;  1FPQ A;  3GBG A;  2BW3 A;  4J00 A;  2KJC A;  2L54 A;  1Q1H A;  1H9G A;  1W1W E;  3A03 A;  1P4A A;  1Z7U A;  4HLX A;  4CCK A;  4N0B A;  1V5E A;  1LPQ A;  1GDT A;  1JHF A;  3MVP A;  1W0T A;  2K3F A;  1LUJ B;  4DYC A;  2CG4 A;  2M1B A;  3UR3 C;  5LGT A;  3CME I;  5BOX A;  2G9W A;  5BMZ A;  2X1C A;  3GFL A;  4A3E J;  4V2G A;  1JGS A;  1NTC A;  2RC4 A;  1WFX A;  1Y1V J;  2XGC A;  3FBN B;  1O57 A;  3KEQ A;  3LNQ A;  2K85 A;  1B72 B;  3CUO A;  1SFX A;  2R5Z A;  1MD0 A;  1QQI A;  2M7B A;  5L3C A;  2OCE A;  2CUJ A;  4BQO A;  3GUD A;  5B1B H;  3ERM A;  1TP4 A;  5HNF A;  2EB7 A;  1ETX A;  2GXG A;  2L0K A;  2QEX I;  1PJR A;  2QZ8 A;  2O8X A;  3QOE A;  5L3E A;  5DM7 F;  3K4B A;  3CCU I;  1D8K A;  1T08 B;  1X1A A;  3OYF A;  2DTZ A;  2F4O B;  4X6A J;  2DA7 A;  1MDM B;  1ZH5 A;  2DAO A;  4RLF A;  4ZYA A;  2XF7 A;  1OIS A;  2KDZ A;  4I76 A;  5FKM A;  2KHM A;  4AYB N;  2X0L A;  3KX2 A;  5E8G A;  2EFP A;  2KIF A;  4UUV A;  1R23 A;  3KYC B;  1YE9 A;  4A12 A;  5F0C A;  4I99 C;  3HOU J;  3LMM A;  2OJE D;  3U1K A;  5CVR A;  4XLA A;  5J1U A;  1G3Y A;  4ABZ A;  2B9S A;  2YU3 A;  1Y8Q B;  3GCM A;  3K4N A;  2DA4 A;  2ELJ A;  1YJN I;  4QSH A;  1DU0 A;  4KIS A;  2J5O A;  1LFB A;  2L7F P;  4Y13 A;  4ENN A;  2QQ9 A;  4U0W A;  4D5C A;  3OR2 C;  1FYK A;  5AIP A;  5IOZ A;  2NAZ A;  5DM6 F;  4NDL A;  1TC3 C;  3C2B A;  4LLN A;  2V1X A;  3HJE A;  1E3P A;  3WTT C;  2IGM A;  3CP8 A;  2FJ1 A;  1I1G A;  2VQH A;  1IGN A;  4ITV A;  1SMY F;  1W5T A;  3BG9 A;  2HQN A;  4CCJ A;  4CDG A;  1DUX C;  2DK8 A;  2FA5 A;  1Y1W J;  3CF2 A;  1R36 A;  3EUA A;  3JSO A;  2F5F A;  3MKW B;  4M6Y A;  2K40 A;  2EWN A;  3I58 A;  4EM2 A;  1K78 B;  3I55 I;  5J8F A;  1RIO H;  4YFN F;  1OKR A;  1R5I D;  2EV5 A;  4EJW A;  3N97 A;  1MBK A;  1QNT A;  1MNM C;  1RI7 A;  3CCL I;  3CJQ B;  2CYY A;  1IRF A;  2GBY A;  2YX4 A;  3I5U A;  4IHX A;  3R0J A;  1O3R A;  5LD2 C;  5ICG A;  3DQV C;  1BW6 A;  1LKX A;  2IP2 A;  2E1M B;  2QKL B;  3C2H A;  3GTP J;  1B8I A;  4HNV A;  1ZAR A;  1BA5 A;  5J4Y A;  2EA4 A;  2DW4 A;  1ORK A;  3OSF A;  1W0U A;  2K9M A;  4MLO A;  2QEN A;  3ZPL A;  1NH3 A;  1X1P A;  3O8G A;  2ZNY A;  3FDY A;  1BJZ A;  2IJL A;  4XIC A;  3FX3 A;  5LEJ A;  3RI4 A;  2IA2 A;  3TP0 A;  3HKZ A;  1BI3 A;  1BM9 A;  2WB1 N;  3LFU A;  4WCG A;  3ABK H;  2K02 A;  1X58 A;  5EG0 A;  4GYI A;  1RPW A;  1R4M B;  2DCE A;  3OMY A;  3JRF A;  3ULQ B;  4AVZ A;  2WY8 Q;  2KDO A;  2K9S A;  3IRR A;  2IS4 A;  2ECB A;  5HDG A;  1WJE A;  4UXN A;  3GTK J;  3TBI A;  2LKP A;  2GAU A;  5CVI A;  2KZV A;  3FXR A;  6PAX A;  5ILU A;  2ID6 A;  2ISY A;  1BW5 A;  3LAJ A;  1RUO A;  4BJ5 C;  2F5E A;  1YYV A;  3RIR A;  4NC8 A;  3PUB A;  1P2F A;  3SZT A;  1SC7 A;  1AKH A;  4HNU A;  2OQR A;  1EH7 A;  4P9F A;  3WE2 A;  1Z7L A;  2Z16 A;  1N25 A;  2QGU A;  4BUP A;  2HPI A;  4ON0 A;  1Z9C A;  2L9S A;  2DQL A;  1YW7 A;  2ETH A;  4ZJZ A;  4BNC A;  2IT0 A;  1JT0 A;  1LEA A;  5IP7 J;  5C44 J;  2OZ6 A;  4G7O F;  1OCO H;  3RSN A;  4EJU A;  1PP7 U;  4LG0 A;  5BPD A;  5FFX A;  4QPQ A;  2CV1 A;  4Y17 A;  2UXN A;  4UHT A;  4ZYD A;  2Q2E A;  1QA6 A;  1YS7 A;  2K4B A;  5FKN A;  3KE2 A;  3GVA A;  2CQX A;  3HSF A;  2DPD A;  1LNW A;  4CHU A;  1FTT A;  2ZJR F;  4KFC A;  2FX0 A;  2XF5 A;  3LSK A;  1G3S A;  5GTI C;  1A6Q A;  3EUH C;  5TGT A;  2E2H J;  4BQN A;  4BE2 A;  2JRT A;  1RC9 A;  2R7Z J;  2X9D A;  5A2Q K;  1IRG A;  2BHZ A;  4AUX A;  4WX9 A;  4H0E A;  1Y39 A;  2H8R A;  3TO7 A;  4IRI A;  1X2N A;  3RKY A;  1HKQ A;  1T0F A;  2H8W A;  3T5X A;  4D7M A;  1VQ5 I;  2IXS A;  3K4C A;  4F52 A;  1S7O A;  2ZSH B;  4BDY A;  1OCZ H;  3D5S C;  2XAF A;  4LIT A;  3HOX J;  2JA5 J;  1O3T A;  4FHT A;  5DD4 A;  2X6X A;  3RKX A;  3ML6 A;  4KT5 C;  1P4X A;  1ZLJ A;  2F48 A;  1EH6 A;  2VE9 A;  2ELK A;  2R7F A;  2VI6 A;  4HX8 A;  5CVJ A;  2Y69 H;  3CCV I;  3MZH A;  2GOX B;  3FIS A;  1X1C A;  4PFP A;  1TWF J;  3GFI A;  4BXF A;  4MO7 A;  2LY2 A;  1IZ1 A;  3ZN0 A;  1VQ6 I;  2E1C A;  5D5V B;  2K5C A;  5EG0 B;  3GW2 A;  4RAG A;  5E17 F;  1S3J A;  1V4R A;  2CUZ A;  4WXC A;  4UUT A;  4LG0 B;  1LVK A;  5FLX K;  2V1D A;  3L2C A;  1XC5 A;  1JKR C;  4NQW B;  3W2A A;  1MMD A;  3P9K A;  2ZO4 A;  2ZJQ F;  1E17 A;  4YIF A;  1Q1V A;  3BQY A;  5BNG A;  3KP2 A;  1NHA A;  4JQF A;  1WJB A;  2Q8K A;  2DFE A;  4MEX F;  3HRT A;  3X2Q H;  2CV0 A;  3OYH A;  1Z3X A;  3DKW A;  1U5T C;  3F21 A;  4GGG A;  2VPL A;  4PDK A;  3VPR A;  1X4O A;  1Z05 A;  1LFU P;  4FX4 A;  4UVA A;  3CF5 F;  4C9Y A;  2W7N A;  5E3M A;  1FIP A;  2HXO A;  4XLF A;  1DGR M;  2XAH A;  1OCR H;  1UEL B;  3K4J A;  2FXA A;  2C6Y A;  2VOO A;  1WH5 A;  4I0A A;  1RRJ A;  2EFN A;  1BC8 C;  1OCP A;  3BWG A;  5J6X A;  1A5J A;  3CP2 A;  3RKW A;  3HKZ N;  2MLG A;  4U0Y A;  2R5Y A;  1V55 H;  1W7P D;  3DPU A;  3ZQL A;  4K2E A;  2JVG A;  5TIS C;  1ETK A;  1YW8 A;  1Z3Y A;  3RDI A;  1Z67 A;  4XN3 A;  3WG9 A;  2QQA A;  3I54 A;  2L7K A;  4HLY A;  1IF1 A;  4I02 A;  2E5Z A;  1Y6I A;  3BJ6 A;  2MC3 A;  2LC2 A;  2BXZ A;  3CMA I;  4CZC A;  2DI3 A;  1ODD A;  3JR9 A;  3S17 J;  2LY1 A;  4G8X A;  4ESJ A;  1HKT A;  2VQL A;  2LKX A;  2CUE A;  3HUG A;  3F22 A;  3TMO A;  3ESW B;  1WJF A;  4A3G J;  1ONV A;  1MSE C;  3EQL F;  1MMA A;  1B1B A;  5LRS A;  3FF5 A;  3QPS A;  2NNN A;  3A1Y A;  5J3L A;  3SFI A;  1T33 A;  4MTD A;  1WJD A;  4ASN A;  3BR0 A;  3BPV A;  1HQC A;  1Z21 A;  3V8J A;  1CF7 A;  1D3Y A;  3QOD A;  4EAT A;  2XB0 X;  3F6V A;  2V9V A;  3ZMD A;  3WGI A;  4KJZ A;  4C2U A;  1XS9 A;  1IDZ A;  4HEA 2;  2RVC A;  2N8G A;  4QLC U;  1FYM A;  3GX4 X;  3S16 J;  2JZY A;  2XGE A;  3G1O A;  3KCC A;  4HOB A;  3ZR8 X;  4YFK F;  2F5V A;  3MZ8 A;  3T1B A;  3M1E A;  2E60 A;  2ZXH A;  2QLZ A;  4DYR A;  1U6G A;  2A6H F;  1QHH D;  4ESF A;  5DV5 A;  1LB2 A;  3SZP A;  4A93 J;  2A69 F;  1ETQ A;  3F8F A;  3CQZ J;  2VLA A;  3CES A;  3ZQI A;  2H6B A;  2EIJ H;  1MJ9 A;  1Z1D A;  3CJT B;  4B4C A;  1S72 I;  1BC7 C;  2GLO A;  1YTY A;  1ERD A;  3C7J A;  3I4N J;  2Y0S N;  2PJR B;  4M6X A;  3GWZ A;  2ISZ A;  4ZDL A;  3CLQ A;  1YIJ I;  1IV8 A;  5C4J J;  3TGN A;  3WGG A;  4BY1 J;  2BXY A;  4Z6Y A;  2NVT J;  4KIG A;  3GZN B;  5K7H A;  2EIM H;  3TP3 A;  1M1E B;  4LG3 A;  5BQT A;  2R7Q A;  5LHH A;  1VTN C;  3S2D J;  3JRD A;  3F8N A;  3KLN A;  3Q3S A;  4AID A;  3LSJ A;  1K78 A;  2EFO A;  2W25 A;  3OYL A;  2DT5 A;  2QUF A;  3G1M A;  1WHU A;  2H09 A;  1FOX A;  1YRN A;  3KZY A;  1I6H J;  1IN6 A;  2CSO A;  2I5U A;  1OPC A;  1J0R A;  3TOB A;  2Z2S B;  2BOL A;  2Y9Y A;  4Y3O A;  2F5C A;  1GT0 C;  4FET A;  3DLA A;  1HBX G;  1QZY A;  3HOV J;  1X2M A;  2JA2 A;  3KFW X;  3NWS A;  5EZG A;  3SQN A;  5DS9 A;  2P7C B;  3IH3 A;  3K1N A;  1VFC A;  3HRM A;  1LDD A;  3MCZ A;  1HKS A;  4UY8 I;  1MMS A;  1W36 D;  3F3X A;  5ICC A;  5DDG A;  4PGH A;  3S2H J;  4IZZ A;  3OL3 A;  5B5E C;  1SVO A;  4XN0 A;  4RS8 A;  1OR7 C;  2HYF A;  2ZME B;  3S32 A;  2FMY A;  1ZRD A;  2CW8 A;  3E5X A;  3DWL E;  3FXO A;  3HL2 A;  4IPA A;  4AVP A;  4J01 A;  1SAX A;  3EET A;  4HF1 A;  5HS7 A;  2O5R A;  4V2F A;  1FMV A;  1FYL A;  1DPU A;  2M3A A;  2KL4 A;  5HLI A;  4RGX A;  4XLE A;  3WTZ A;  3ZQG A;  1OYI A;  2WAQ A;  1ZG3 A;  3WTW C;  5JHF A;  5JHU A;  4A3J J;  1FY7 A;  2FQ3 A;  2HGC A;  2CMP A;  3JRA A;  5FLV A;  1FBU A;  3GTO J;  4XSZ F;  3KP4 A;  1T0F C;  2CU7 A;  2M0M A;  1BI0 A;  4RGS A;  1FMW A;  1U9O A;  2PMU A;  4Q47 A;  2AXL A;  1RES A;  3CO7 C;  3BG6 A;  5C4X J;  3TW7 A;  3CCE I;  3CC7 I;  4OIN F;  1MH3 A;  3GTQ J;  3L9F A;  4XLP F;  1I6X A;  1JHH A;  2JN6 A;  3IWF A;  3EUH A;  1UG2 A;  1VQK I;  3OYA A;  1O3S A;  1KYZ A;  3FMS A;  5K7Z A;  3JRC A;  2OBP A;  2ZB9 A;  3S3O A;  4RM2 A;  3FIW A;  4C2M J;  2YR2 A;  2CO5 A;  4HV6 A;  1IXS B;  3W2W A;  2KQR A;  4HPQ A;  3DTI A;  3K7A J;  5LBQ A;  1ZRC A;  2DMQ A;  5HOD A;  1MSF C;  4GYG A;  1K7A A;  4N9I A;  2M87 A;  4HDV A;  3F8C A;  4BQA A;  3P5J A;  3WHC A;  4QWQ A;  3L2R A;  1MNE A;  3CCJ I;  3BG7 A;  2VL8 A;  4ZYH A;  3LSM A;  1JKQ C;  3BTL A;  3D0S A;  4BE0 A;  5EEG A;  3FXK A;  4D1Q A;  5D8L B;  1Y0U A;  1YX5 A;  1T39 A;  1ZAO A;  4R1H A;  4AIK A;  1TWC J;  4V19 K;  3AKZ A;  1R1T A;  2BW3 B;  5HLH A;  4A0Z A;  1IW7 F;  1OR7 A;  4B09 A;  1DGW Y;  2P5L C;  2KRC A;  3BZ6 A;  3GZ6 A;  1IN8 A;  3WTY C;  1HW1 A;  2FNP A;  2Q2E B;  3RTR A;  5E1X A;  3JTG A;  2PN6 A;  3BJO A;  2OC6 A;  2IS1 A;  4JP0 A;  3DU5 A;  3CCS I;  2LBF B;  1AWC A;  3CCM I;  2PBI A;  1CQT A;  1JUM A;  1UFM A;  3IC7 A;  2IBD A;  1QRY A;  1XMX A;  3ZGK A;  4RB1 A;  3WTS C;  2Z5U A;  2STW A;  1W7P B;  4JX5 A;  3S3M A;  4DW6 A;  1IDY A;  1JTY A;  4EMS A;  3K1M A;  5E18 F;  1V3F A;  2HVS A;  1SFK A;  4XOT A;  1T2K A;  4FCY A;  2LNB A;  4QPO A;  4S05 A;  2NS0 A;  2WAF A;  4UB8 C;  1MBG A;  2M45 A;  3CJR B;  3KET A;  3WHB A;  3ZXS A;  3H9G A;  2VXZ A;  5K5R A;  2DA3 A;  1XDU A;  2OA4 A;  1WWX A;  3V8L A;  1ZGA A;  2DU9 A;  3DEU A;  4RAF A;  1IXC A;  2LF7 A;  3G6E I;  4E7I A;  1SD5 A;  5EZH A;  1JE8 A;  5LHG A;  4UUS A;  3VYT B;  2HS5 A;  2JK3 A;  2OZU A;  2R93 J;  2DMT A;  2AHQ A;  1YIO A;  2MH2 A;  3KP3 A;  4CCO A;  2JWT A;  5DD8 A;  5DYM A;  3K4K A;  3J80 K;  3JW4 A;  4IL6 C;  3H0G J;  3B73 A;  2HU9 A;  2JPC A;  4LFU A;  1FJL A;  4IRG A;  3RQI A;  4BE1 A;  2E1O A;  2P8T A;  2R5Y B;  1KU7 A;  3TKY A;  2H27 A;  4KYW A;  1WPK A;  2ELH A;  3VFZ A;  2L4M A;  4PJN A;  1FOW A;  4W1U A;  3JTH A;  3WU2 C;  4LMY A;  2W24 A;  3F8B A;  3M8J A;  2H1K A;  2EV6 A;  3GO5 A;  4R79 A;  3BT9 A;  3AL0 C;  2XAJ A;  2R5Z B;  2JT1 A;  1Z77 A;  3QYE A;  2EBI A;  3ASO H;  3WTV C;  2A07 F;  5IT9 Z;  3DV8 A;  1WJ5 A;  2X4H A;  3OOU A;  4Q4Z F;  3OL4 A;  4LK1 F;  3FK6 A;  3SDG A;  1HC8 A;  4NB5 A;  3AG1 H;  2UV1 A;  5CLS A;  2Y0S A;  3JAM Z;  2M30 A;  2QSG X;  2RNJ A;  5IP6 A;  4IOC F;  1MMN A;  3G1L A;  4I09 A;  1GLN A;  1IN4 A;  2DTR A;  1ETW A;  3L7W A;  1X19 A;  4PGG A;  1BR1 A;  4S0H B;  2O8K A;  2YUS A;  2ZNZ A;  3DF8 A;  5F1J A;  3DKY A;  1IRX A;  5DCF A;  1P9Q C;  4EM1 A;  3ELK A;  4BEH B;  1WQ2 A;  1K4S A;  4DZJ A;  1D0Y A;  3HEF A;  3I64 A;  1F1Z A;  3LA3 A;  2IAI A;  1JT6 A;  4IEJ A;  4L5I A;  2KLO A;  5C3E J;  2V1U A;  1WCM J;  2ZCW A;  2ZC2 A;  2DK5 A;  1B9N A;  5E3N A;  3HOS A;  4M9X A;  3FMQ A;  1Z91 A;  2RQP A;  1I27 A;  1JTX A;  2HOE A;  1GUU A;  1NG6 A;  4F93 B;  2BV6 A;  1O7F A;  3HYI A;  4GFB A;  3EUK L;  1XCV A;  2E71 A;  4B43 A;  1XX5 A;  1E0E A;  2M7A A;  5F27 A;  5IOY A;  1MKM A;  3RZD J;  1WVR A;  2A5Y B;  5FRO A;  2V9P A;  2RKH A;  3D5R C;  3KYL A;  4EQQ A;  1R71 A;  1UHM A;  3BC8 A;  3M07 A;  1LQ1 A;  1G8X A;  1J7K A;  2IVM A;  1FNN A;  1R4N B;  4RB2 C;  2BY3 A;  3WE3 A;  1U5T A;  2V79 A;  2XSJ C;  4M74 A;  4PSW A;  2HEO A;  2P5V A;  1FSH A;  4LIV A;  5HVQ C;  4F3Q A;  1FP1 D;  4XKW A;  3L2V A;  2FRH A;  2XPW A;  2XSD C;  3DLL F;  1I39 A;  4IHT A;  2YX7 A;  2E1N A;  1SEU A;  2QQB A;  4AWX B;  1JI8 A;  3W3C A;  2M8G X;  3L2W A;  1MJB A;  3RJP A;  1N78 A;  1N75 A;  1KYW A;  2V9K A;  2W85 A;  3G3Z A;  4ZYE A;  1RNL A;  3CJN A;  2MYS A;  2QCO A;  3RCO A;  1OCT C;  3L00 A;  3GTG J;  3I59 A;  2STT A;  3FXL A;  2HQ5 A;  4CYD A;  2DFF A;  2P6T A;  1G3W A;  1D1B A;  1ETO A;  1VQN I;  5D4S A;  3BR3 A;  2JPB A;  4OU0 A;  2HQR A;  3MN2 A;  3L2U A;  3Q5F A;  2V4J C;  3HDD A;  3S1N J;  3HIF A;  4DOZ A;  4R8H A;  2D1H A;  3ZQ7 A;  3H35 A;  1S8N A;  2EPF A;  4ENM A;  1S7A A;  5BPI A;  3I0T A;  3F72 A;  3TL4 X;  3E3V A;  5E20 A;  4HDU A;  1WKM A;  5ILV A;  4LLG F;  1IO2 A;  4KNY A;  3BCA A;  4NQW A;  2KRH A;  2TCT A;  3GXO A;  3ZP5 A;  2HNH A;  1QZZ A;  3SHF A;  2PLY A;  2VJI A;  3E1S A;  3I53 A;  3Q0U A;  4PJM A;  3RPQ A;  2YU9 J;  2QM3 A;  1TBX A;  4DQ2 A;  3WOD F;  1OYY A;  3H9Q A;  1UG0 A;  1R9T J;  1EF4 A;  2Y75 A;  3QU6 A;  4I7H A;  3H0D A;  2VOP A;  4L18 B;  3CCY A;  3OOP A;  1F9N A;  5CVU A;  4BEH A;  1YIT I;  1A35 A;  3B6A A;  1FC3 A;  2IEK A;  1X3W B;  3ZMV A;  1XN7 A;  1SD7 A;  2RV8 A;  5F64 A;  3T8T A;  2LH9 A;  1RR7 A;  3IWZ A;  4CYC A;  2VKV A;  3UKG A;  2XKO A;  2MFZ A;  2W82 A;  3Q9S A;  2DJI A;  1KGS A;  3OYG A;  2AQE A;  2F4I A;  2PMZ N;  4DBQ A;  4U7B A;  2XAG A;  4L0Z B;  3OY9 A;  2DFI A;  2RN7 A;  4GDF A;  3CD6 I;  3HSR A;  1ZRF A;  4UB6 C;  1TT0 A;  3QOP A;  2JA6 J;  4LLL A;  2LR8 A;  1WSU A;  4ZTJ A;  1TLH B;  3JRI A;  2CFX A;  3E5U A;  4PK4 A;  2A6T A;  2JJ7 A;  4X0G A;  1T38 A;  2I8D A;  4LB6 B;  4BJ6 C;  3FXJ A;  3NAU A;  2ZJP F;  4MQ9 F;  2IGK A;  3LSI A;  5D8K B;  3SJM A;  2FSW A;  4G94 A;  1DU6 A;  4A3L J;  4U87 A;  1GHC A;  2O7O A;  2L9R A;  2VJ5 A;  3HRS A;  4XKB A;  5GPA A;  1ZN2 A;  1ACI A;  3FMR A;  4BDZ A;  2GXB A;  5M5Y J;  2KT0 A;  1O4X A;  4GXO A;  2EJR A;  1QBJ A;  1MDM A;  1TW2 A;  4JBA A;  4H4K C;  2WV1 A;  5LGU A;  2YSR A;  2D2W A;  4RBO A;  2XAU A;  1FWZ A;  3LA2 A;  3VDX A;  1QVU A;  3GFJ A;  2CFO A;  1JUS A;  1PVE A;  2FML A;  4AM3 A;  2M0C A;  1A36 A;  4C2T A;  3O2P E;  4S04 A;  3N4M A;  1BI1 A;  2FU4 A;  2BY2 A;  4RAY A;  1FIA A;  1OYW A;  2R7W A;  3S1M J;  1KQ9 A;  3VSL A;  4XON A;  3DU6 A;  5FRM A;  2P5K A;  3IH4 A;  2OAZ A;  2WAD A;  1NK3 P;  2IPQ X;  2LVS A;  4FQG A;  3TO9 A;  4A5M A;  5M5W J;  2DPU A;  4ZYG A;  4KMU X;  4LB5 A;  3DKX A;  2OF7 A;  3MMY B;  1A04 A;  2E35 A;  4XRF A;  3VOE A;  4B1R A;  4IHS A;  2X1D A;  3BG5 A;  1SD6 A;  2KIM A;  2DDB A;  3HSE A;  3IAS 2;  3REO A;  2DA1 A;  2HDC A;  3PM1 A;  1YJW I;  2DMU A;  2BBY A;  1CF7 B;  2HYG D;  2UWM A;  3E5Q A;  1U8R A;  2OQG A;  4HYE A;  3QPT A;  2PX9 A;  1VQP I;  1PUE E;  4MTE A;  3NAR A;  3JRG A;  4E7J A;  5B66 C;  2JUG A;  3CDI A;  4Y4R A;  2ZXW H;  5ILS A;  4IHY A;  3DTE A;  2H6C A;  1CGP A;  4D5F A;  2KFD A;  2EIL H;  2FOW A;  3M8E A;  5FKO A;  5ICF A;  3W6J B;  3DEW A;  3PSF A;  2LBF A;  1H8A C;  4Q5S F;  1R1V A;  1XSV A;  1T95 A;  2NOJ B;  5E1W A;  1D0Z A;  2EZK A;  2VXD A;  4L9J A;  1O7L A;  2PMH A;  3OYC A;  1UHS A;  1ZK8 A;  3LA7 A;  4KT6 A;  3LL7 A;  2BHY A;  2DOE A;  3CZ6 A;  4GO1 A;  4BXU A;  3VEP A;  3CTA A;  4YII A;  2A5W A;  2O03 A;  1A31 A;  4PJ0 C;  4IVN A;  1HST A;  4NUB A;  4U7D A;  2LLK A;  2MH9 A;  4GRI A;  2H94 A;  3K2A A;  5IYD J;  4E7Z A;  4DBR A;  1IRZ A;  4PJL A;  3BZK A;  1PYV A;  4XOP A;  4BHC A;  1GV5 A;  4FTH A;  4OIO F;  2DA6 A;  1XD7 A;  3LST A;  4G7Z F;  2OTJ I;  1RR8 C;  3HRU A;  5LFA A;  2EH3 A;  2F6C A;  2HQA A;  3T0Y A;  4CO8 A;  3BTJ A;  3E6D A;  1XDS A;  1QZE A;  4EVI A;  1HCR A;  5ERI A;  1D1A A;  2AQF A;  2MGQ A;  2ZFU A;  3ZQQ A;  4E4H A;  1F4K A;  2LFB A;  1R7J A;  1O3Q A;  4XKV A;  2P0W A;  3QU3 A;  4NC6 A;  3G71 I;  2DO7 A;  4NBQ A;  5HNH A;  1ETY A;  1SVM A;  2VT3 A;  2G0E A;  4IXA A;  1KQ0 A;  4HSR A;  4UV8 A;  2CGP A;  5E1Z B;  1WI9 A;  2ZXI A;  5HOO A;  1AU7 A;  2DMN A;  1X3Z B;  2FD5 A;  2JA7 J;  3O3K A;  3DBH B;  3SEZ A;  4E70 A;  2EFQ A;  3DBR B;  1W4M A;  3U1D A;  3QPL A;  1MW7 A;  3TED A;  2Y0M A;  2W48 A;  2Z3Y A;  3ABU A;  1R58 A;  5DTD A;  1UAA A;  1HXD A;  4CXF A;  2R7X A;  3A02 A;  2PMZ A;  1BIA A;  1ZEL A;  3H5N A;  2OUM A;  5B1A H;  1B72 A;  2L7Z A;  1RKW A;  1XSD A;  2VJ4 A;  2NOG A;  5CQG A;  5L3F A;  2RNG A;  4XL9 A;  3B6C A;  4HQM A;  3VSK A;  2CUF A;  2R7D A;  3WGH A;  4E6K G;  3MKL A;  1P7I A;  3S1R J;  3ABL H;  4ESB A;  3JAM K;  2XHK A;  4HZF A;  1VQL I;  1QO0 D;  2UUZ A;  3IRQ A;  3HZJ A;  3MQ0 A;  2V7F A;  3HHG A;  3EDP A;  1FT9 A;  3FWE A;  2XRN A;  3LSG A;  1VI0 A;  3ISP A;  4CSW A;  2ZBK A;  2IS2 A;  3EPZ A;  4II3 A;  5L3G A;  4L5E A;  1FOK A;  5EEH A;  2KIU A;  3GTM J;  3BP8 A;  3O6B B;  4XQF A;  5E3L A;  3AG4 H;  3QRF F;  3F6O A;  3J80 Z;  2V6E A;  4HX7 A;  1NG7 A;  3M7G A;  1Y0N A;  3COA C;  1B8I B;  2VT2 A;  2WC2 A;  4HF2 A;  4P96 A;  2WWY A;  4J19 A;  5D6E A;  2A68 F;  3CMM A;  3ZMZ A;  4IHW A;  2VBW A;  2RDP A;  5H6Q A;  2IGO A;  4M72 A;  3R0A A;  4I01 A;  4HST A;  4CIC A;  3R61 A;  4FE4 A;  4M6V A;  1XGM A;  2BZT A;  2ZME A;  3GZ5 A;  2VKH A;  1VF9 A;  2AXT C;  3GTL J;  2W84 A;  1UHW A;  3P9I A;  3CDL A;  5DUK A;  3ZQC A;  1YHQ I;  4BHP A;  1VQ8 I;  4KIC A;  3WTU C;  1S29 A;  5F0F A;  4AU7 A;  2NYX A;  4M71 A;  4Y52 J;  2GIZ A;  4G12 A;  1U2W A;  4XSX F;  3HBL A;  3ZMU A;  3VYS B;  4A3I J;  3G2B A;  2HTS A;  3K9T A;  5K5O A;  5IT3 A;  5BS6 A;  3J7A O;  2CRG A;  2XIG A;  5TJJ A;  3W2V A;  2GWR A;  4PZJ A;  5GTH C;  3PIP F;  1W36 C;  3C1D A;  2DA5 A;  1IN5 A;  3BJA A;  1B9M A;  3BPX A;  3L09 A;  3P9C A;  3RKQ A;  4IQJ A;  1USS A;  2PJP A;  3O8H A;  2PG4 A;  3F0C A;  3NQO A;  3L1P A;  2ADU A;  3DXJ F;  4KA4 A;  3J7A Y;  4DGW B;  4OIR F;  4A6D A;  2DA2 A;  3K69 A;  4ZZL A;  1ZG5 A;  2KZG A;  4HRI A;  5EYR A;  2ZXJ A;  2M5W A;  4W97 A;  2Y9Z A;  2W1O A;  2A6E F;  2NS8 A;  2GA2 A;  3TDU C;  1FTZ A;  1TWA J;  1F5T A;  3RPU A;  5K1Y A;  5EGO A;  3TW6 A;  3F8M A;  4RAZ A;  2IA0 A;  4PFO A;  1WI3 A;  4BU2 A;  3HUG B;  3GLL A;  2X6O A;  3CUQ A;  3PNT A;  4XLN F;  3SZG A;  1UST A;  4IX7 A;  2Q0O A;  3GFM A;  4IKF A;  3M9A A;  3K4M A;  2HFH A;  2D1V A;  4XRS G;  4A3B J;  3TQN A;  3S2W A;  1UJ8 A;  4YG2 F;  5TRD A;  3IAM 2;  1GXQ A;  3IP4 B;  2WAQ N;  4M3F A;  4LOC A;  1FEX A;  1KU3 A;  1Z6R A;  2HYJ A;  1G59 A;  1SAU A;  4HV5 A;  4CH7 A;  2PEX A;  3BCB A;  5F1R A;  2CV2 A;  1AKH B;  2WBM A;  3WG7 H;  4KIT B;  3HGG A;  5FRN A;  1YS6 A;  3ZN1 A;  4LJZ F;  2ZFW A;  2NNY A;  3NWT A;  4EV0 A;  5FKK A;  1YOV B;  4B47 A;  2KPM A;  3BR5 A;  1B59 A;  2VC0 A;  2XRL A;  2O9L A;  3CC2 I;  3HOY J;  2NVU B;  3OR1 C;  1FSE A;  4EJV A;  1FZP B;  2HTJ A;  4BXX J;  2HVQ A;  5KNL A;  2B7E A;  2JTV A;  2OV7 A;  1XTA A;  4RGR A;  4CCL A;  3K2Z A;  3PO3 J;  3RYR A;  1J2X A;  3V8K A;  3AAF A;  2CQK A;  1XB4 A;  4O5V A;  1TW3 A;  4UV9 A;  5KCM A;  5EDN A;  3PQJ A;  2QF7 A;  2LDU A;  4OMZ A;  1C0W A;  4JYK A;  4O3M A;  2DXI A;  2R7O A;  4HA8 A;  2JRM A;  1YG2 A;  3I56 I;  3TDZ C;  2EA2 A;  1KON A;  4DIQ A;  2L3D A;  2R7T A;  3LQR A;  2XB5 A;  3ABT A;  2IGN A;  3DPL C;  3S3N A;  3H3V K;  1W5S A;  4M73 A;  5M5X J;  4ENK A;  4BH9 A;  2F2E A;  2E34 A;  1S7E A;  4BJT A;  2OCC H;  3LFK A;  4KIF A;  4B3A A;  3KEY A;  1W5C C;  1Z0X A;  3OYN A;  1IG7 A;  2OPT A;  2M4G A;  1EJ9 A;  4MFD A;  3G4S I;  5DCM B;  5GAH J;  4A3K J; 
#chains in the Genus database with same CATH homology
 5HS8 A;  4A0Y A;  2EV0 A;  1KA8 A;  3FM5 A;  2BYV E;  1KQ8 A;  3V4G A;  1K79 A;  2R3S A;  2LF8 A;  5A2Q Z;  5JR3 A;  3ROU A;  3ZMT A;  4G7H F;  1X3U A;  2K7L A;  3E6C C;  1QPM A;  2RGV A;  3BDD A;  3Q9V A;  3IHU A;  1LVA A;  1R5H A;  1ON1 A;  2QBY B;  3KEO A;  4L5J A;  3KZZ A;  1G6N A;  4OMY A;  3QAH A;  4PCQ A;  3IKT A;  1XGS A;  3MWM A;  3DP7 A;  3IKV A;  2GIV A;  1UCR A;  2IA1 A;  4HW0 A;  2XAS A;  2P6S A;  2YPR A;  1SFE A;  2QVO A;  2K4J A;  4L0Y B;  1MZB A;  4KUM A;  1T98 A;  2BGC A;  4AIH A;  4LD5 A;  1DDN A;  3HHH A;  4A5N A;  1BBY A;  4L9T A;  2COM A;  4Z2Y A;  3LWF A;  4BAY A;  3CDH A;  1PP8 F;  4TV7 A;  4ZH4 F;  3WTX C;  1XGN A;  4EJO A;  4HBL A;  4ETS A;  4HAM A;  4KMF A;  3VB2 A;  4D0P A;  3V7S A;  4KN7 X;  4JK1 X;  1IXR C;  2PFB A;  5FO5 A;  3MAJ A;  1WRJ A;  1T6S A;  1RUN A;  2A61 A;  1U78 A;  3QP5 A;  3GEZ A;  4I98 B;  4KDP A;  1H0M A;  1L3L A;  2GQQ A;  1IUY A;  3U2R A;  1MJA A;  3VOD A;  2Z99 A;  3GLX A;  2FBI A;  3ECH A;  3K1P A;  5FFZ A;  2WV0 A;  1YQA A;  3H3U A;  4HQE A;  4ENJ A;  5ICE A;  1ULY A;  2XAQ A;  3R4K A;  4UVB A;  5LLQ A;  2L01 A;  1B6A A;  4MGR A;  5LRR A;  1BJA A;  3FXU A;  3GYH X;  3FZV A;  1HSJ A;  4LGW A;  3I4P A;  3I59 B;  1G3T A;  3TO6 A;  2FOK A;  1GXP A;  1FBQ A;  3EYY A;  3CLO A;  1EH8 A;  1OMI A;  1LDJ A;  2HR3 A;  5L3D A;  2FBK A;  4IRH A;  2L02 A;  1YLF A;  3MEX A;  5CYV A;  3E6M A;  4ZZD A;  3C18 A;  4N9H A;  5FGM A;  2VBZ A;  4P55 A;  5KK1 A;  1J59 A;  4A0X A;  3CO6 C;  1E2X A;  3ERE D;  2OD5 A;  1BN5 A;  1XMK A;  4B8X A;  1P92 A;  4U0V A;  3FHZ A;  2MBF A;  2O0Y A;  2V6C A;  3V7C A;  5FD6 A;  1TQM A;  1AOY A;  2ACJ A;  1FBS A;  3T8R A;  2ESN A;  4OIQ F;  1K6O A;  1YW9 A;  3DFG A;  1KU9 A;  1FX7 A;  2VON A;  2M8E A;  5FB2 A;  1P4W A;  4RB0 A;  3PFI A;  1HW5 A;  4P9U A;  2QWW A;  1STZ A;  2UXX A;  1ON2 A;  3CUQ C;  2FE3 A;  1BIB A;  4A2U A;  2O61 A;  1R00 A;  3LQQ A;  3HOT A;  3DPT A;  1ZGJ A;  3RYP A;  5IT9 K;  3KLO A;  4WXH A;  2MA3 A;  1PDN C;  5H6R A;  3LAP A;  2L4A A;  3KP7 A;  5LEK A;  2IRF G;  5CJ9 A;  1YO5 C;  3QPH A;  4I2O A;  2GA1 A;  4I0B A;  2ESH A;  2HKX A;  5J8C A;  4UVC A;  1LEB A;  2G7U A;  2K27 A;  2XGX A;  2QYO A;  1G4D A;  1QGP A;  4EGZ A;  1EV7 A;  3K0L A;  5JFR A;  3OV8 A;  1REP C;  1JXS A;  2GZW A;  3SFZ A;  4XBF A;  4MEY F;  2TDX A;  2AS5 F;  3U9G A;  4U88 A;  2KKO A;  4P5O A;  4KN4 X;  2UZK A;  5HDN A;  2OU2 A;  1B4A A;  3GF2 A;  2BE5 F;  2XKP A;  4HF0 A;  5F6F A;  5AIQ A;  3E97 A;  5FD5 A;  3D5L A;  2J5P A;  4GCV A;  3F23 A;  3H3Z A;  3MZY A;  1D8J A;  2O6G E;  3I71 A;  1U3E M;  2LSO A;  5CVV A;  3MFK A;  2VOD A;  4FT8 A;  4Y15 A;  4IF4 A;  3QP6 A;  4CZZ A;  2PQ8 A;  3R60 A;  3J81 K;  5D5W B;  3WU0 A;  1I5Z A;  2DLL A;  3H92 A;  3NRV A;  2NRA C;  2VBX A;  4L9V A;  2HZT A;  4MHG A;  1U5T B;  4G9Y A;  1H9T A;  4RGU A;  2HWV A;  4KIB A;  4EGY A;  1ZYR F;  4BYY A;  4LK0 F;  1J75 A;  4A6E A;  1I1S A;  2Y48 A;  4G6D A;  1BI2 A;  4OOI A;  1SD4 A;  3W6K B;  4CGZ A;  5DUI A;  1MGT A;  1W7P A;  3C3W A;  5HS9 A;  2MLK A;  1DP7 P;  3NEU A;  2XVC A;  3R6S A;  4AD9 A;  3V7R A;  3E6B A;  3KP5 A;  2IW5 A;  2VBY A;  5DEQ A;  4IJA A;  4UNO A;  3M8F A;  2F5D A;  5HLG A;  3BRO A;  1P6R A;  1J9I A;  4WF2 A;  1TQI A;  4M9S A;  4MNU A;  4WXD A;  2EK5 A;  2XV4 S;  3ZMS A;  1XGO A;  1LDK B;  1RZ4 A;  2A3S A;  4M9Z A;  1Z6T A;  2KJB A;  4MQV A;  1XSX A;  2Z33 A;  2XRO A;  3TOA A;  1SMT A;  3CUQ B;  1ZHF A;  3WU1 B;  3ECO A;  3FM3 A;  1DPR A;  3IL2 A;  1HW2 A;  4YFX F;  1R1U A;  1L0O C;  1FLI A;  2O3F A;  2K86 A;  5H20 A;  5DCM A;  2QBY A;  2DBB A;  2CWE A;  2ZJ2 A;  2CW0 F;  2E7W A;  3HTS B;  1IN7 A;  1TNT A;  5D5U B;  1SFU A;  4BHB A;  4OIP F;  4O6J A;  3PQK A;  2FEZ A;  1TTY A;  5E8I A;  5JI6 A;  4DNC A;  2W57 A;  2D45 A;  1TQP A;  5D5X B;  4RB3 C;  1S6L A;  2Z9O A;  2ZKZ A;  1UB9 A;  4EM0 B;  2XUB A;  5AON A;  3EYI A;  5KVR A;  4L9N A;  3KP6 A;  2HKO A;  2FF4 A;  2VN2 A;  2FNA A;  2WTE A;  5HDK A;  2G7H A;  5L3B A;  2PI0 A;  3SXY A;  2JSC A;  4FX0 A;  1FP2 A;  2DQR A;  1D5V A;  2KRF A;  2FBH A;  4WK8 F;  4HX4 A;  3G73 A;  5ED4 A;  2E7X A;  1XMA A;  3P7N A;  1IAW A;  2BEO A;  5K5Q A;  2EFW A;  3JSP A;  5D6F A;  4WWC A;  4NHJ A;  4EJT A;  3J81 Z;  2B0L A;  2P4W A;  2VC1 A;  1R22 A;  4G6Q A;  2MD5 A;  5LHI A;  1YFH A;  1GVJ A;  3B02 A;  1XCB A;  5LGN A;  4F7Z A;  3FXQ A;  2VE8 A;  3BOQ A;  5D4R A;  1KU2 A;  3HTU A;  1LJ9 A;  1J5Y A;  5FLX Z;  1BOA A;  1ZLK A;  5JVT A;  1R5G A;  1ZRE A;  3BY6 A;  4AIJ A;  4Q48 A;  1TNS A;  2P7V B;  1ZG1 A;  1FPQ A;  2KJC A;  2L54 A;  1Q1H A;  1H9G A;  1P4A A;  1Z7U A;  4HLX A;  4N0B A;  1JHF A;  5BOX A;  2CG4 A;  2M1B A;  5LGT A;  2G9W A;  5BMZ A;  3GFL A;  1JGS A;  2RC4 A;  1O57 A;  3KEQ A;  3CUO A;  1SFX A;  1MD0 A;  1QQI A;  5L3C A;  3GUD A;  2EB7 A;  2GXG A;  2QZ8 A;  2O8X A;  5L3E A;  1D8K A;  1MDM B;  1ZH5 A;  2DAO A;  2X0L A;  5E8G A;  2EFP A;  2KIF A;  4UUV A;  1R23 A;  4A12 A;  5CVR A;  1G3Y A;  2YU3 A;  2J5O A;  4Y13 A;  4ENN A;  2QQ9 A;  4U0W A;  1FYK A;  5AIP A;  2NAZ A;  4LLN A;  2V1X A;  3WTT C;  1I1G A;  1SMY F;  1W5T A;  2HQN A;  4CDG A;  1DUX C;  2DK8 A;  2FA5 A;  1R36 A;  3JSO A;  2F5F A;  4M6Y A;  2EWN A;  3I58 A;  4EM2 A;  1K78 B;  5J8F A;  1RIO H;  4YFN F;  1OKR A;  2EV5 A;  4EJW A;  3N97 A;  1QNT A;  1RI7 A;  2CYY A;  1IRF A;  3I5U A;  2YX4 A;  3R0J A;  1O3R A;  5ICG A;  3DQV C;  2IP2 A;  1ZAR A;  2EA4 A;  2DW4 A;  2QEN A;  3ZPL A;  2ZNY A;  2IJL A;  3FX3 A;  5LEJ A;  3RI4 A;  2IA2 A;  1BI3 A;  1BM9 A;  4WCG A;  2K02 A;  4GYI A;  3ULQ B;  3IRR A;  5HDG A;  4UXN A;  2LKP A;  2GAU A;  5CVI A;  6PAX A;  3FXR A;  5ILU A;  2ISY A;  3LAJ A;  1RUO A;  2F5E A;  1YYV A;  3RIR A;  3SZT A;  1P2F A;  2OQR A;  1EH7 A;  4P9F A;  3WE2 A;  4ON0 A;  1Z9C A;  2DQL A;  1YW7 A;  2ETH A;  4BNC A;  2IT0 A;  1LEA A;  2OZ6 A;  4G7O F;  4EJU A;  1PP7 U;  4LG0 A;  5BPD A;  5FFX A;  4Y17 A;  2UXN A;  4UHT A;  4ZYD A;  2Q2E A;  1YS7 A;  2K4B A;  3KE2 A;  3GVA A;  3HSF A;  2DPD A;  1LNW A;  4CHU A;  4KFC A;  1G3S A;  2JRT A;  5A2Q K;  1IRG A;  4H0E A;  4WX9 A;  3TO7 A;  4IRI A;  3RKY A;  1HKQ A;  1T0F A;  3T5X A;  1S7O A;  2XAF A;  1O3T A;  4FHT A;  5DD4 A;  3RKX A;  3ML6 A;  4KT5 C;  1P4X A;  1ZLJ A;  1EH6 A;  2VE9 A;  2R7F A;  4HX8 A;  5CVJ A;  3MZH A;  3GFI A;  1IZ1 A;  3ZN0 A;  2E1C A;  5D5V B;  3GW2 A;  5E17 F;  1S3J A;  1V4R A;  4WXC A;  4LG0 B;  5FLX K;  2V1D A;  3L2C A;  3P9K A;  2ZO4 A;  1E17 A;  4YIF A;  3KP2 A;  1NHA A;  4JQF A;  2Q8K A;  4MEX F;  3HRT A;  3DKW A;  1U5T C;  3F21 A;  4GGG A;  4PDK A;  1Z05 A;  4FX4 A;  4UVA A;  2XAH A;  2C6Y A;  2FXA A;  2VOO A;  4I0A A;  2EFN A;  1BC8 C;  3BWG A;  5J6X A;  3RKW A;  2MLG A;  4U0Y A;  1W7P D;  4K2E A;  1YW8 A;  3RDI A;  3WG9 A;  2QQA A;  3I54 A;  4HLY A;  1IF1 A;  4I02 A;  3BJ6 A;  2MC3 A;  2DI3 A;  1ODD A;  4ESJ A;  4G8X A;  1HKT A;  3HUG A;  3F22 A;  1ONV A;  3EQL F;  1B1B A;  5LRS A;  3FF5 A;  2NNN A;  4MTD A;  4ASN A;  3BPV A;  1HQC A;  3V8J A;  1CF7 A;  1D3Y A;  3F6V A;  2V9V A;  3ZMD A;  3WGI A;  2RVC A;  4QLC U;  1FYM A;  3GX4 X;  2JZY A;  3KCC A;  4HOB A;  4YFK F;  3T1B A;  3M1E A;  2QLZ A;  1U6G A;  2A6H F;  4ESF A;  5DV5 A;  1LB2 A;  3SZP A;  2A69 F;  3F8F A;  2H6B A;  1MJ9 A;  1Z1D A;  1BC7 C;  1YTY A;  3C7J A;  4M6X A;  3GWZ A;  2ISZ A;  3TGN A;  3WGG A;  4KIG A;  5BQT A;  5LHH A;  1VTN C;  3F8N A;  3KLN A;  1K78 A;  2EFO A;  2W25 A;  2DT5 A;  2QUF A;  2H09 A;  3KZY A;  1IN6 A;  2CSO A;  1OPC A;  1J0R A;  3TOB A;  2F5C A;  1HBX G;  1QZY A;  3KFW X;  3SQN A;  2P7C B;  3K1N A;  3HRM A;  1LDD A;  3MCZ A;  1HKS A;  3F3X A;  5ICC A;  5DDG A;  4PGH A;  4RS8 A;  2HYF A;  2ZME B;  1ZRD A;  2FMY A;  3E5X A;  4IPA A;  4AVP A;  1SAX A;  3EET A;  4HF1 A;  5HS7 A;  1DPU A;  1FYL A;  5HLI A;  4RGX A;  3WTZ A;  1OYI A;  1ZG3 A;  3WTW C;  5JHU A;  1FY7 A;  2FQ3 A;  2HGC A;  1FBU A;  4XSZ F;  3KP4 A;  1BI0 A;  4RGS A;  2PMU A;  4Q47 A;  2AXL A;  3CO7 C;  4OIN F;  3L9F A;  4XLP F;  1I6X A;  1JHH A;  3IWF A;  3EUH A;  1O3S A;  1KYZ A;  3FMS A;  2OBP A;  2YR2 A;  2CO5 A;  4HV6 A;  1IXS B;  5LBQ A;  1ZRC A;  4GYG A;  1K7A A;  4N9I A;  2M87 A;  4HDV A;  3F8C A;  4BQA A;  4QWQ A;  4ZYH A;  3D0S A;  5EEG A;  5D8L B;  1Y0U A;  1T39 A;  1ZAO A;  4R1H A;  4AIK A;  1R1T A;  5HLH A;  4A0Z A;  1IW7 F;  1OR7 A;  4B09 A;  2P5L C;  3GZ6 A;  3BZ6 A;  1IN8 A;  3WTY C;  1HW1 A;  2FNP A;  3RTR A;  5E1X A;  3JTG A;  2PN6 A;  3BJO A;  1AWC A;  2PBI A;  1UFM A;  3IC7 A;  4RB1 A;  3WTS C;  2STW A;  2Z5U A;  1W7P B;  4EMS A;  3K1M A;  5E18 F;  1V3F A;  1T2K A;  2LNB A;  4S05 A;  2NS0 A;  2M45 A;  3KET A;  2VXZ A;  5K5R A;  1XDU A;  2OA4 A;  1WWX A;  3V8L A;  1ZGA A;  2DU9 A;  3DEU A;  1IXC A;  2LF7 A;  1SD5 A;  1JE8 A;  5LHG A;  2HS5 A;  2OZU A;  2MH2 A;  1YIO A;  3KP3 A;  5DD8 A;  5DYM A;  3J80 K;  3JW4 A;  3B73 A;  2JPC A;  4LFU A;  4IRG A;  2P8T A;  1KU7 A;  3TKY A;  2H27 A;  4KYW A;  2ELH A;  3VFZ A;  2L4M A;  3JTH A;  4LMY A;  2W24 A;  3F8B A;  2EV6 A;  3GO5 A;  4R79 A;  2XAJ A;  2JT1 A;  2A07 F;  3WTV C;  5IT9 Z;  3DV8 A;  2X4H A;  4Q4Z F;  4LK1 F;  4NB5 A;  5CLS A;  3JAM Z;  2M30 A;  2RNJ A;  4I09 A;  1IN4 A;  2DTR A;  3L7W A;  4PGG A;  2ZNZ A;  3DF8 A;  5DCF A;  4EM1 A;  3ELK A;  1WQ2 A;  3I64 A;  1F1Z A;  3LA3 A;  4L5I A;  2V1U A;  2ZCW A;  2DK5 A;  1B9N A;  3HOS A;  4M9X A;  3FMQ A;  1Z91 A;  2RQP A;  1I27 A;  2HOE A;  2BV6 A;  1O7F A;  3HYI A;  1XCV A;  1MKM A;  2A5Y B;  2RKH A;  4EQQ A;  1UHM A;  1LQ1 A;  1J7K A;  2IVM A;  1FNN A;  4RB2 C;  3WE3 A;  1U5T A;  2V79 A;  4M74 A;  2HEO A;  2P5V A;  1FSH A;  5HVQ C;  1FP1 D;  2FRH A;  4IHT A;  2YX7 A;  2E1N A;  2QQB A;  4AWX B;  1MJB A;  3RJP A;  1KYW A;  2W85 A;  3G3Z A;  4ZYE A;  1RNL A;  3CJN A;  3L00 A;  3I59 A;  2STT A;  4CYD A;  2P6T A;  1G3W A;  5D4S A;  2JPB A;  4OU0 A;  2HQR A;  3Q5F A;  3HIF A;  4R8H A;  2D1H A;  3ZQ7 A;  1S8N A;  4ENM A;  5BPI A;  1S7A A;  3I0T A;  3F72 A;  3E3V A;  5E20 A;  4HDU A;  1WKM A;  5ILV A;  4LLG F;  4KNY A;  4NQW A;  3GXO A;  3ZP5 A;  1QZZ A;  3SHF A;  2PLY A;  3I53 A;  3RPQ A;  2QM3 A;  1TBX A;  4DQ2 A;  3WOD F;  1OYY A;  2Y75 A;  3QU6 A;  4I7H A;  2VOP A;  4L18 B;  3OOP A;  1F9N A;  5CVU A;  1FC3 A;  3ZMV A;  1XN7 A;  1SD7 A;  2RV8 A;  5F64 A;  3T8T A;  3IWZ A;  2XKO A;  3Q9S A;  1KGS A;  4L0Z B;  4U7B A;  2XAG A;  2DFI A;  2RN7 A;  3HSR A;  1ZRF A;  3QOP A;  4LLL A;  1WSU A;  1TLH B;  2CFX A;  3E5U A;  1T38 A;  4LB6 B;  4MQ9 F;  5D8K B;  2FSW A;  4G94 A;  1GHC A;  3HRS A;  1ZN2 A;  3FMR A;  2GXB A;  4GXO A;  2EJR A;  1QBJ A;  1MDM A;  1TW2 A;  4JBA A;  5LGU A;  2YSR A;  2D2W A;  3LA2 A;  1FWZ A;  3GFJ A;  2FML A;  3O2P E;  4S04 A;  3N4M A;  1BI1 A;  2FU4 A;  4RAY A;  1OYW A;  1KQ9 A;  2P5K A;  2OAZ A;  2IPQ X;  3TO9 A;  2DPU A;  4A5M A;  4LB5 A;  4ZYG A;  4KMU X;  1A04 A;  4XRF A;  3VOE A;  4IHS A;  1SD6 A;  2KIM A;  3HSE A;  3REO A;  2HDC A;  2BBY A;  1CF7 B;  2HYG D;  2UWM A;  3E5Q A;  1U8R A;  2OQG A;  4HYE A;  3QPT A;  1PUE E;  4MTE A;  5ILS A;  2H6C A;  1CGP A;  3M8E A;  5ICF A;  3W6J B;  4Q5S F;  1R1V A;  1XSV A;  5E1W A;  4L9J A;  1O7L A;  2PMH A;  3LA7 A;  4GO1 A;  4BXU A;  3VEP A;  3CTA A;  4YII A;  2O03 A;  4IVN A;  1HST A;  4U7D A;  2MH9 A;  2H94 A;  4BHC A;  4OIO F;  1XD7 A;  3LST A;  4G7Z F;  3HRU A;  3T0Y A;  4CO8 A;  3E6D A;  1XDS A;  4EVI A;  5ERI A;  1F4K A;  1R7J A;  1O3Q A;  3QU3 A;  2DO7 A;  4IXA A;  2VT3 A;  1KQ0 A;  4UV8 A;  2CGP A;  5E1Z B;  1WI9 A;  5HOO A;  3O3K A;  4E70 A;  2EFQ A;  1W4M A;  3U1D A;  2Y0M A;  2Z3Y A;  3ABU A;  1R58 A;  1HXD A;  4CXF A;  1BIA A;  1XSD A;  5L3F A;  4HQM A;  2R7D A;  3WGH A;  4ESB A;  3JAM K;  2XHK A;  4HZF A;  1QO0 D;  3IRQ A;  3MQ0 A;  3HHG A;  3EDP A;  1FT9 A;  3FWE A;  2XRN A;  3ISP A;  2ZBK A;  5L3G A;  1FOK A;  5EEH A;  2KIU A;  3BP8 A;  3O6B B;  3QRF F;  3F6O A;  3J80 Z;  4HX7 A;  3M7G A;  3COA C;  2VT2 A;  2WC2 A;  4HF2 A;  4P96 A;  2WWY A;  5D6E A;  2A68 F;  3ZMZ A;  2VBW A;  2RDP A;  5H6Q A;  4M72 A;  3R0A A;  4I01 A;  4CIC A;  3R61 A;  1XGM A;  2ZME A;  3GZ5 A;  2W84 A;  1UHW A;  3P9I A;  5DUK A;  4BHP A;  4KIC A;  3WTU C;  1S29 A;  2NYX A;  4M71 A;  1U2W A;  4XSX F;  3ZMU A;  5K5O A;  2HTS A;  3K9T A;  5IT3 A;  5BS6 A;  3J7A O;  2XIG A;  5TJJ A;  2GWR A;  4PZJ A;  3C1D A;  1IN5 A;  3BJA A;  1B9M A;  3BPX A;  3L09 A;  3P9C A;  1USS A;  2PJP A;  2PG4 A;  3NQO A;  2ADU A;  3DXJ F;  4KA4 A;  4OIR F;  4A6D A;  3K69 A;  4ZZL A;  1ZG5 A;  2ZXJ A;  2M5W A;  2A6E F;  3TDU C;  2GA2 A;  1F5T A;  3RPU A;  5K1Y A;  3F8M A;  4RAZ A;  2IA0 A;  4XLN F;  3CUQ A;  1UST A;  2Q0O A;  3GFM A;  3M9A A;  2HFH A;  2D1V A;  3TQN A;  3S2W A;  4YG2 F;  5TRD A;  1GXQ A;  1KU3 A;  1Z6R A;  4HV5 A;  2PEX A;  5F1R A;  1YS6 A;  3ZN1 A;  4LJZ F;  2ZFW A;  2NNY A;  4EV0 A;  1B59 A;  2VC0 A;  1FSE A;  4EJV A;  1FZP B;  2HTJ A;  2JTV A;  4RGR A;  3K2Z A;  3RYR A;  1J2X A;  3V8K A;  3AAF A;  2CQK A;  1XB4 A;  4O5V A;  1TW3 A;  4UV9 A;  3PQJ A;  1C0W A;  2LDU A;  4OMZ A;  4O3M A;  4HA8 A;  1YG2 A;  3TDZ C;  2EA2 A;  2L3D A;  3LQR A;  3ABT A;  3DPL C;  1W5S A;  4M73 A;  4ENK A;  4BH9 A;  2F2E A;  4KIF A;  3LFK A;  5DCM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...