5H20A

X-ray structure of padr-like transcription factor from bacteroid fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
DNVKSQMRKGMLEYCIMLLLHKEPAYASDIIQKLKEARLIVVEGTLYPLLTRLKNDDLLSYEWVESTQGPPRKYYKLTGKGESFLGELEASWKELNETVNHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative PadR-family transcriptional regulatory protein
publication title Structural and functional analysis of BF2549, a PadR-like transcription factor from Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transcription regulator
total genus 32
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5h20A00
2ESHA 2DW4A 2DI3A 2EFPA 3G3ZA 2IT0A 1P2FA 4EGZA 3IRRA 1QPMA 4ZYHA 5K1YA 2L3DA 4AVPA 2XAQA 4WXCA 3SFZA 4KYWA 1FPQA 3RDIA 4IJAA 5LBQA 3TO9A 1LDDA 2PG4A 2HTSA 2FNAA 4EV0A 3DPTA 5BQTA 1HQCA 2OQRA 1LB2A 5HDGA 1TQIA 1FT9A 3M9AA 3Q9VA 5FGMA 3T8RA 2K4JA 3JAMZ 4LMYA 4HQEA 4Q47A 2HQRA 5HDKA 2XAGA 2NRAC 1UB9A 3SZTA 1X3UA 3KZZA 1WSUA 1XGSA 3GUDA 5DDGA 3KEQA 5FLXZ 5FD5A 3ECHA 4ZYGA 3IC7A 4ETSA 5FO5A 1ZREA 3HOSA 5DUKA 2OA4A 5TJJA 1T38A 5J8CA 3REOA 4OIRF 3IKVA 4UVCA 5JFRA 1D5VA 1KYWA 4L9VA 3WTVC 4JBAA 4HX7A 1FLIA 2DT5A 3HTUA 4A0YA 2CG4A 3P9CA 3WG9A 5E8IA 1EH7A 2G7HA 2JTVA 3LWFA 1DUXC 4F7ZA 2GXGA 3KLOA 4KIBA 1FX7A 2FA5A 2IA1A 4UV8A 2O6GE 1FP1D 3PQKA 2HKOA 2CFXA 2P5VA 5CVRA 1R23A 1HKTA 2JT1A 4G7HF 4HF0A 3RPUA 2IA2A 4HF2A 1ULYA 3W6JB 4I2OA 1O7LA 3JTGA 3BWGA 4EMSA 1Z91A 1YLFA 2Q0OA 3HOTA 5FFZA 2JPCA 1LQ1A 1ZLKA 1R1VA 3I4PA 4JQFA 2YU3A 4ENNA 2L54A 4KICA 4QLCU 1R00A 1P6RA 2Y75A 2MH2A 3ABUA 2E7XA 3J7AO 1F1ZA 1ZGAA 1B1BA 2QUFA 5D5WB 2VXZA 1R7JA 2QVOA 1FWZA 1FP2A 3BROA 4RS8A 1BN5A 3DPLC 1BM9A 2HOEA 4I01A 4B09A 1G3TA 1F4KA 1FYMA 4ESJA 2UWMA 5H20A 5ILVA 1IN7A 2Z5UA 4RGSA 5CVUA 3V7CA 3VEPA 2Z3YA 1IN6A 5CVIA 4LJZF 1HSJA 4YFXF 1PDNC 1KU3A 3LSTA 4R1HA 4B8XA 4LLGF 4ZZDA 4G6QA 1E2XA 2VC0A 1F5TA 4ENMA 1OYIA 3CUQC 1J2XA 1J0RA 5EEGA 4IPAA 4LG0A 1HKQA 4YFKF 3ZMSA 1IXRC 1ZHFA 5ILSA 3WTUC 3F8BA 2DU9A 2ZO4A 5JI6A 3CUOA 3GXOA 4GXOA 1OR7A 1OYWA 2PEXA 4Z2YA 2BBYA 1KU2A 4KNYA 2DPDA 3HRSA 4LK1F 4IRGA 4KN7X 5BMZA 2EFWA 2FQ3A 2IW5A 3DXJF 2Z99A 1FYKA 3WTYC 2Q2EA 2RDPA 4EQQA 2P6TA 3L00A 4QWQA 4OU0A 2J5PA 1WKMA 1JE8A 2MA3A 2XAJA 2RKHA 1F9NA 3QAHA 1B4AA 3EYIA 1Q1HA 2XVCA 1ODDA 2GIVA 5ICFA 1KQ9A 3EETA 2WTEA 3ZPLA 2GQQA 2F5DA 5D8LB 1B59A 2DFIA 2YX7A 3BJOA 4U0YA 1KU9A 2DK5A 5HLGA 1FZPB 4MQ9F 1IN8A 3L9FA 4A0ZA 3BPXA 5DEQA 1XSDA 2COMA 3TO6A 1GXQA 2EA4A 3BOQA 1MJAA 2CSOA 5LGNA 2M8EA 2MBFA 2F5FA 3ELKA 2P7VB 3FMSA 2PBIA 1D8KA 2BV6A 3C7JA 2W84A 3ZN1A 4XLPF 4HF1A 3E5QA 1UCRA 3T5XA 2VOOA 1U5TC 2PFBA 1U6GA 3J81Z 3WGIA 1DDNA 3D0SA 1ZG5A 4G94A 3QU6A 1I6XA 2K02A 4KIGA 3KP4A 1QBJA 4EVIA 2Y48A 3DEUA 1TBXA 2UXNA 4KMUX 2ESNA 3SZPA 2QQBA 1P4AA 1A04A 1JXSA 5F64A 5AONA 5FB2A 4RGRA 2ACJA 2E1NA 3F21A 1HW2A 3DP7A 3V8LA 4AIHA 1U5TA 4PGGA 3E6DA 2STTA 1JHHA 3K69A 2E7WA 2G7UA 4FT8A 3QPTA 1G3YA 5DCMB 1S3JA 4LB5A 2F2EA 2CGPA 2VE9A 1K79A 2A68F 3M1EA 2IPQX 2AXLA 1MKMA 3M8FA 3WTTC 2QWWA 5K5OA 1OYYA 3E5UA 4CHUA 5LHGA 2ZNZA 4MGRA 1FBQA 3ZMTA 4LLLA 4M9XA 3HRUA 4P96A 3FZVA 2PMHA 2XKOA 3JTHA 1JHFA 1KQ0A 3F22A 1BI3A 5BOXA 5LLQA 2DLLA 1W7PB 4AIJA 2DAOA 1OKRA 4ON0A 3KP3A 1K7AA 2FMYA 1FOKA 1IF1A 3WU0A 3U9GA 4I02A 5A2QK 5FFXA 5LHHA 2ZXJA 4FX4A 2YSRA 2A6EF 2H6CA 3JW4A 4WXDA 2RV8A 1TNSA 3EYYA 1LEAA 1XSXA 2QYOA 1W5TA 3E6MA 4RB2C 4MTEA 1AOYA 4HW0A 3HUGA 3I59A 4P9UA 4M74A 5IT9K 1SFUA 3B02A 2KIMA 3LFKA 3FM3A 3HYIA 4UVAA 4HX4A 1O3TA 5F1RA 4A0XA 5TRDA 1YQAA 3GX4X 2L4AA 4CXFA 2VODA 4BXUA 3KP7A 3ISPA 4U0VA 2A69F 1HXDA 4DNCA 3KETA 4NHJA 3I59B 2HGCA 1H0MA 3OV8A 2CYYA 3U2RA 5LHIA 3RKXA 1YG2A 2GZWA 2X0LA 2M1BA 1UHWA 3L09A 3V7RA 2E1CA 1Z9CA 1HSTA 1IAWA 1BOAA 4LLNA 3WTXC 1KYZA 1XCVA 2XV4S 1QO0D 4EM1A 3KP5A 4XLNF 1BIAA 4ESFA 1J7KA 1V4RA 1SMTA 2FMLA 1RUNA 2M87A 1D8JA 1R36A 4NQWA 4U0WA 5HOOA 4ENJA 3GLXA 1FY7A 3G73A 2JRTA 3QP5A 2CW0F 2WV0A 1G3SA 2BE5F 3TOBA 1XB4A 2RNJA 3KZYA 4L5JA 2P8TA 2ZFWA 1LJ9A 2HDCA 2YR2A 1BBYA 4L9NA 4BHPA 4L9TA 5DD8A 1ZH5A 1K6OA 3TO7A 4PDKA 3WGHA 4M72A 1XDUA 2O03A 4RB0A 2ZCWA 4HZFA 2IP2A 2P5KA 5K5RA 2MD5A 3MCZA 4RAYA 5DYMA 4O6JA 5E17F 2LKPA 1K78A 1ZAOA 4ZYDA 4EM0B 1SD5A 2QLZA 3RKWA 4UUVA 4AIKA 2EA2A 5D6EA 3TQNA 2P6SA 3K1PA 4XRFA 5D5XB 5D4RA 3DF8A 3KLNA 1MGTA 1MJBA 5E20A 1HBXG 5J6XA 1S8NA 1J9IA 3I64A 5F6FA 5L3BA 1KGSA 3KEOA 1SD7A 2DTRA 2LDUA 4WXHA 3KCCA 1FNNA 2A3SA 1W5SA 1YYVA 4FX0A 3GYHX 4ENKA 1LEBA 2ADUA 1SAXA 2L02A 3F8NA 1B6AA 2ZNYA 3J80K 2A07F 4HDVA 3KFWX 2GA1A 2KKOA 1ZARA 1UHMA 2A6HF 3TOAA 2ETHA 4YG2F 4M6YA 3ERED 1T39A 4A2UA 4UNOA 2UZKA 2W85A 4LK0F 2LF7A 3C3WA 3F23A 3BJAA 1MDMA 3QRFF 2P4WA 4L18B 3VB2A 4KMFA 3R61A 4HYEA 1G3WA 1P4XA 2W24A 4HBLA 3E97A 2BEOA 2ISZA 5LRSA 1TTYA 3GWZA 2MLGA 3BDDA 2ELHA 2LNBA 4A6DA 2NYXA 1IXCA 4Y15A 3JSOA 3GEZA 3NEUA 2HFHA 3FXUA 2OAZA 3LAPA 1XMKA 1PP7U 1QZZA 3GW2A 4EJTA 4CGZA 1AWCA 3CTAA 5ILUA 3T0YA 1S6LA 3FM5A 2XHKA 1WI9A 2GXBA 3WTWC 4KN4X 5KK1A 5JHUA 2VE8A 2HEOA 2JPBA 4LG0B 3ECOA 4M6XA 2H27A 3ROUA 3CUQA 5HS9A 1IN4A 3TKYA 3N97A 2P7CB 3E6BA 5CLSA 2J5OA 1YIOA 1I1GA 1ZRFA 3ULQB 1SD6A 5HS8A 6PAXA 1EH8A 4YIIA 5HS7A 2A61A 3R0AA 4OOIA 3CUQB 3WU1B 1EH6A 3GF2A 5E8GA 1W7PD 3C18A 1CF7A 2XGXA 4N0BA 5E1WA 1L3LA 5E1XA 4ZH4F 2HQNA 4I0AA 1R5GA 4WX9A 4NB5A 2XKPA 3QP6A 4JK1X 2NS0A 4YFNF 2Q8KA 1Z05A 3P7NA 3S2WA 1B9MA 4M9SA 3HIFA 2HS5A 1CF7B 1LNWA 2K7LA 3HSRA 3WE2A 1IRFA 4KUMA 5HDNA 1R1TA 4N9HA 2O61A 1ONVA 4BHCA 4XSXF 3R0JA 3I71A 3FMRA 1L0OC 3O6BB 5E18F 3DKWA 5LEKA 2C6YA 2FE3A 1ZGJA 1RNLA 2FF4A 5JR3A 4P55A 4RAZA 1QQIA 1T2KA 3COAC 2HKXA 1MZBA 4HOBA 4EJUA 1Z6RA 2KJBA 1H9TA 4BNCA 5K5QA 1RUOA 3T8TA 1I27A 4U7DA 3KP2A 2CO5A 3Q5FA 2XRNA 2Z33A 1ZN2A 4MHGA 2K86A 4L0ZB 1TW3A 2EK5A 4HLYA 1G4DA 1BIBA 3MAJA 4U88A 5LGTA 5CYVA 1O3RA 1TW2A 4PZJA 1T98A 2QBYA 5LRRA 1S7OA 5LEJA 4UV9A 1O3QA 4K2EA 4D0PA 1HKSA 4PGHA 4MNUA 3R6SA 3L7WA 3JAMK 4I7HA 3I54A 5HLHA 5ICGA 2EJRA 3GZ6A 5HLIA 3RYPA 2V79A 1U5TB 4OIOF 2K27A 2ISYA 4E70A 2OZUA 3I5UA 4BAYA 3WGGA 4M73A 2FSWA 5FLXK 3B73A 3T1BA 3FX3A 3I0TA 3K0LA 2RGVA 2DQLA 5ERIA 4UVBA 3WTSC 4M9ZA 4ESBA 1WRJA 2FEZA 2WWYA 1GVJA 4R8HA 1FYLA 3K2ZA 5ICCA 2XIGA 5DV5A 1I1SA 1T6SA 2VBYA 3HSEA 2R3SA 1C0WA 3V8KA 1XD7A 3ZMVA 3HSFA 2GWRA 2MLKA 3DFGA 5BPDA 1J59A 2XAHA 4ZYEA 2QZ8A 3O3KA 2HWVA 1FBSA 4MTDA 1BI2A 3RKYA 3OOPA 4HV6A 3IWFA 1STZA 5L3DA 5DUIA 4EGYA 2YPRA 2DPUA 5DCFA 1USTA 1XDSA 2DBBA 2V1XA 5AIPA 1QGPA 4G9YA 4I98B 1V3FA 4CZZA 2IRFG 4ZZLA 3ZMDA 4UXNA 4CO8A 2HZTA 1LDKB 4L0YB 1YW9A 2L01A 4MEXF 1IXSB 3F3XA 1TLHB 1TQMA 2H09A 2QM3A 3M8EA 2FRHA 3C1DA 4IRIA 3MEXA 5J8FA 4EJOA 1ON1A 1RI7A 4Y17A 1FBUA 3N4MA 2EFOA 2VN2A 4EJVA 5LGUA 3RTRA 2EV5A 1YW7A 2VBWA 2FNPA 4RGXA 4HAMA 2QENA 2STWA 1XN7A 3F72A 4L5IA 2RVCA 2B0LA 1ZRCA 3KE2A 4LB6B 5FD6A 3MWMA 2PN6A 3CDHA 1REPC 2F5EA 2W57A 3HHGA 3RIRA 3PQJA 1MJ9A 1BI0A 2OU2A 1R1UA 5BPIA 3IL2A 2OQGA 3GFJA 4P5OA 3NRVA 1G6NA 4WF2A 3BJ6A 3ZQ7A 1YS7A 1Y0UA 4KIFA 1XSVA 4UHTA 4OIPF 5CJ9A 3WTZA 4OIQF 3H3ZA 3O2PE 3V8JA 3QU3A 4S04A 4OINF 1YFHA 5EEHA 2ZBKA 4H0EA 3LQRA 4WCGA 1WWXA 2V6CA 4IHSA 2RN7A 3I53A 3R4KA 4Q4ZF 3MZYA 4IXAA 3HRTA 3H3UA 2VBXA 3K9TA 1OPCA 2VC1A 1SFXA 2D45A 5A2QZ 1Z1DA 3P9KA 1O3SA 2QQAA 1P92A 4L9JA 2JSCA 1GXPA 3LA7A 5D5UB 2FBIA 1GHCA 1IN5A 1J75A 2H6BA 2JZYA 5L3GA 3HHHA 2D2WA 5L3FA 2QQ9A 4EJWA 5ICEA 1HW5A 3MZHA 1BI1A 3E3VA 2UXXA 2FXAA 2PLYA 1TNTA 3F8FA 3IWZA 4TV7A 1R5HA 4HDUA 4HX8A 5L3CA 2HYFA 1TQPA 5AIQA 2R7FA 4BYYA 5IT9Z 1ZLJA 1K78B 4Q48A 3GFLA 4KA4A 4RB1A 1ZRDA 1LDJA 3U1DA 4BHBA 2Z9OA 3R60A 2RQPA 4EM2A 4WK8F 3ZN0A 3ABTA 1YS6A 1U2WA 1SMYF 3FHZA 2D1VA 4AWXB 2KRFA 3F6OA 3AAFA 4OMYA 2F5CA 3EDPA 5D8KB 1D3YA 4U7BA 1FSHA 1U8RA 3E6CC 3F6VA 2V9VA 2V1DA 3LA2A 2X4HA 3W6KB 2NAZA 4YIFA 4G7ZF 1XMAA 1BJAA 2GAUA 2O0YA 2W25A 1O7FA 2KIUA 3MFKA 1IW7F 4IVNA 2CWEA 4LFUA 2FBHA 4MQVA 1Z7UA 1S7AA 2EB7A 1HW1A 3K1MA 1ZYRF 3J81K 2A5YB 1MDMB 2EFQA 3DV8A 3BPVA 2KIFA 1E17A 3F8MA 2RC4A 3LQQA 2HR3A 4I0BA 2BYVE 3SHFA 2K4BA 4HA8A 2PQ8A 3ZMZA 5D5VB 2WC2A 5ED4A 3LA3A 2MH9A 3GZ5A 4PCQA 3D5LA 3NQOA 2BGCA 4GCVA 4LGWA 4XBFA 3IKTA 2P5LC 2LF8A 1I5ZA 2EV0A 4I09A 1YW8A 2DQRA 3BZ6A 1O57A 5IT3A 3FXQA 4HV5A 4O3MA 1MD0A 4P9FA 3MQ0A 5H6QA 1J5YA 5E1ZB 4A12A 2AS5F 2M45A 1IUYA 2EWNA 5JVTA 2O3FA 2VOPA 3LAJA 1R58A 1UFMA 3PFIA 3ZMUA 1FC3A 2IA0A 3VOEA 3HTSB 1RZ4A 1XGNA 3RJPA 4IF4A 3FXRA 3J80Z 1LVAA 4OMZA 3RPQA 4A5MA 1QZYA 2PJPA 5D4SA 3DQVC 1U3EM 3TDUC 1SD4A 2HYGD 2ZMEA 3GVAA 4KT5C 3CLOA 1EV7A 3WODF 2LSOA 1WQ2A 3VODA 2ZJ2A 4CYDA 1BC8C 4Q5SF 4CICA 3H92A 4IRHA 3BY6A 3GFMA 3IRQA 1YTYA 1PP8F 1NHAA 2M30A 3FF5A 3K1NA 5DD4A 4M71A 2O8XA 3CO6C 4KFCA 3FMQA 1KA8A 3KP6A 2CQKA 2FU4A 2ZMEB 4ASNA 2H94A 3CO7C 5H6RA 4O5VA 3TGNA 4G8XA 2M5WA 4A5NA 3SXYA 2XAFA 3L2CA 3RI4A 1RIOH 2FBKA 1R22A 3V4GA 2NNYA 3RYRA 2IJLA 5KVRA 1Z6TA 1CGPA 1T0FA 3BP8A 4MEYF 2MC3A 5DCMA 2GA2A 2YX4A 4HLXA 2DK8A 4A6EA 1B9NA 2R7DA 3F8CA 3WE3A 1JGSA 5CVVA 5BS6A 1H9GA 3V7SA 4KDPA 2PI0A 2ZKZA 2VBZA 4LD5A 5CVJA 3E5XA 4GYIA 3IHUA 2EFNA 3JSPA 4AD9A 4IHTA 1XGOA 2VT3A 3I58A 2QBYB 3QPHA 4N9IA 2FOKA 1XCBA 2IVMA 2V1UA 2XUBA 2OBPA 1DPRA 1SFEA 3VFZA 1W7PA 2EV6A 4BH9A 2XASA 1KU7A 4XSZF 2OZ6A 2VT2A 3HRMA 1PUEE 4GYGA 1OMIA 1USSA 3ML6A 4RB3C 4CDGA 3GFIA 1DPUA 4G6DA 2VONA 2L4MA 1P4WA 3M7GA 3P9IA 4GGGA 1U78A 4FHTA 4GO1A 2OD5A 4HQMA 2G9WA 4R79A 2KJCA 5D6FA 3GO5A 3EUHA 4RGUA 1KQ8A 3TDZC 1QNTA 2TDXA 3SQNA 1W4MA 1VTNC 4S05A 4Y13A 3EQLF 2XROA 2HTJA 2DO7A 5HVQC 1ON2A 4DQ2A 2PMUA 1XGMA 2Y0MA 1IRGA 3ZP5A 4WWCA 3Q9SA 1YO5C 4G7OF 2NNNA 2D1HA 1IZ1A 3FWEA 1BC7C 5L3EA 1DP7P 1ZG3A 3QOPA 1FSEA 1S29A 4BQAA 3CJNA 1ZG1A
chains in the Genus database with same CATH superfamily
3CMEI 2ESHA 2DW4A 1FOWA 2DI3A 2DTZA 5E3OA 2EFPA 2BW3B 3A03A 3G3ZA 2IT0A 1P2FA 4EGZA 3IRRA 1QPMA 1X4OA 1VQ6I 4ZYHA 5K1YA 2L3DA 4AVPA 4XM3A 3D5SC 3H0DA 3E1SA 3K2AA 2XAQA 4WXCA 3SFZA 4KYWA 1FPQA 3RDIA 4IJAA 3CCRI 5LBQA 2JUGA 4C30A 2WADA 3TO9A 3GMEA 1LDDA 2AQEA 2PG4A 2HTSA 3HOYJ 4KT6A 3LFUA 3QPSA 3CCLI 2FNAA 4EV0A 1HOMA 5J1UA 3DPTA 5BQTA 3HOUJ 2BXYA 4DBRA 1XC5A 3AG2H 1HQCA 1R4MB 2OQRA 1LB2A 4B47A 5HDGA 1TQIA 3HJEA 1FT9A 3M9AA 4CH7A 5B66C 2L2OA 3OYMA 3Q9VA 2IS4A 3KYLA 3BQZA 5FGMA 3T8RA 2K4JA 2DMPA 3JAMZ 4LMYA 5K7FA 2DOFA 2ZB9A 4HQEA 2X51A 3ASNH 4Q47A 5DS9A 2HXOA 2VXDA 3K4NA 2HQRA 5HDKA 2XAGA 2NRAC 1UB9A 5K7HA 2NVTJ 4NNJA 3SZTA 1X3UA 3MKYB 2OJED 3KZZA 2GLOA 3J7ZI 1WSUA 1XGSA 3GUDA 5IP7J 1LE8A 3ZQIA 4XKWA 5DDGA 3CC4I 1M1EB 2DN0A 2ZFUA 3KEQA 1JTYA 1HC8A 5FLXZ 5FD5A 4KITB 1I6HJ 3ECHA 4ZYGA 3I56I 3IC7A 4ETSA 2A05A 1Y1WJ 4X6AJ 4IEJA 4CSWA 1LVKA 5FO5A 1ZREA 4CYCA 3HOSA 5DUKA 1ETWA 3FIWA 3QYEA 1MMNA 4CZCA 5HNFA 2OA4A 5TJJA 1T38A 2XC7A 3FK7A 5J8CA 3REOA 4OIRF 4J01A 3IKVA 2KQRA 4UVCA 3HOVJ 5JFRA 1GV5A 1OCOH 3NARA 1KYWA 4L9VA 1W0TA 2H8WA 3WTVC 1D5VA 4Y4RA 1I3QJ 4JBAA 4BQNA 4HX7A 1FLIA 2Y9ZA 1LE8B 3VYRB 2DT5A 2XGDA 3HTUA 1MSFC 2MW8A 1W36D 4A0YA 2CG4A 1N75A 2E36A 3P9CA 3WG9A 5E8IA 1WH5A 1EH7A 2G7HA 2JK3A 2JTVA 3LWFA 4NC7A 3S3MA 4RAGA 1DUXC 4F7ZA 5B3SH 5CKTA 2Y31A 4PJJA 2GXGA 1YITI 4C2TA 3BR5A 5J4VA 3KLOA 4KIBA 1FX7A 2FA5A 2IA1A 4CYCB 4UV8A 4E6KG 2O6GE 1FP1D 3PQKA 2X85A 2HKOA 4IOCF 1VQ5I 2CFXA 4F92B 5F0FA 2BY0A 2P5VA 2V6EA 5CVRA 1R23A 2X1DA 2XSJC 1HKTA 4PSWA 3MKWB 2R7ZJ 2E35A 2JT1A 2R7XA 4G7HF 4HF0A 3RPUA 1YRNA 2K9MA 4PJ0C 2IA2A 4HF2A 4F91B 1Y39A 1K61A 1ULYA 3W6JB 4I2OA 1O7LA 3JTGA 3BWGA 3NAUA 4V19K 4EMSA 3A1YA 4XMYA 1Z91A 4NDLA 1YLFA 2Q0OA 3HOTA 3CJQB 3JRAA 5FFZA 2JPCA 1LQ1A 1MMGA 1ZLKA 1R1VA 1V54H 3I4PA 1H89C 4JQFA 3IUOA 2YU3A 4ENNA 2L54A 4KICA 2XDVA 4QLCU 1R00A 1P6RA 2Y75A 1PJRA 4MIMA 3BZKA 1S72I 2ZJRF 2ID6A 1GDTA 3K7AJ 4A3CJ 2MH2A 3ABUA 2E7XA 3J7AO 3PUFA 2NVQJ 1F1ZA 1ZGAA 3ZQFA 5FJ8J 1B1BA 1Z67A 4XNFA 2EIKH 2QUFA 5D5WB 2VXZA 2IEKA 2DOAA 1P7JA 4DIQA 3G71I 5EG0A 2VJIA 2VJ4A 3A01A 4AIDA 3GTJJ 2TRTA 3L2UA 1R7JA 2QVOA 1VQ7I 1FWZA 2B63J 2CQQA 4IHWA 1FP2A 3BROA 4RS8A 1VF9A 1BN5A 3DPLC 3Q0VA 3G4SI 1BM9A 2HOEA 3FBNB 4I01A 1AU7A 2V9PA 1ZELA 4B09A 3OYEA 1G3TA 1F4KA 1FYMA 2JQ7A 4ESJA 2DXIA 1D0YA 5H20A 3CF5F 2UWMA 5ILVA 1IN7A 2Z5UA 4RGSA 5CVUA 4XICA 5EG0B 3V7CA 3VEPA 2Z3YA 2DA4A 1IN6A 5CVIA 1N77A 4LJZF 2XPVA 2CFOA 3PSIA 1HSJA 1I50J 3W6VA 4YFXF 4HSTA 1PDNC 1BR1A 1KU3A 1OR7C 3LSTA 2Q1ZB 4R1HA 2HPMA 2B9SA 4B8XA 4XK4A 2XB5A 3W2WA 3JREA 4LLGF 2EZLA 4ZZDA 1XS9A 4G6QA 1E2XA 2DFFA 2ZJQF 2LR8A 2VC0A 1F5TA 2W48A 5FKOA 2M0MA 1MBJA 1OYIA 4ENMA 3CLQA 2O5RA 2R7QA 1I39A 3CUQC 3AG4H 1OQYA 3GCMA 1J2XA 1J0RA 5EEGA 4IPAA 4LG0A 4PJMA 3B6AA 4B43A 1VQLI 1MH3A 1RC9A 1HKQA 2LMDA 3BR6A 4YFKF 2BVMA 3ZMSA 2XF5A 3IP4B 1IXRC 1X4PA 1ZHFA 5ILSA 3WTUC 3F8BA 2DU9A 1KZHA 4XKBA 2ZO4A 5C3EJ 1TZLA 3AG3H 3QYFA 5CPRB 1X1CA 3ABLH 5JI6A 2R92J 3CUOA 3DKYA 3GXOA 1XPXA 5DM7F 4GXOA 3LSHA 2IGKA 3ZQHA 1OR7A 4DZPA 1OYWA 2PEXA 4Z2YA 2BBYA 1KU2A 4KNYA 2BOLA 3HRSA 2DPDA 4LK1F 4IRGA 4KN7X 5BMZA 2EFWA 2FQ3A 2IW5A 3OIQA 3DXJF 3QWLA 3PO2J 2Z99A 1FYKA 3WTYC 2Q2EA 2RDPA 3DTKA 2P6TA 4IQ4A 3L00A 4YELA 4EQQA 5J1YA 4QWQA 1MBEA 3CQZJ 4OU0A 2NVUB 3KX2A 2HU9A 4CCLA 2J5PA 1WKMA 1EF4A 1JE8A 2MA3A 2XAJA 2RKHA 1F9NA 1QVUA 3QAHA 4D1QA 1B4AA 3EYIA 5E3MA 1B8IA 4D5FA 2L5QA 5F08A 3H35A 4CUGA 1Q1HA 3GTKJ 2XVCA 3K70D 1ODDA 1Y8RB 3ESWB 2GIVA 5ICFA 1KQ9A 5GPCA 1UJ8A 3EETA 3ERMA 2WTEA 3S2DJ 3ZPLA 2GQQA 2F5DA 1GV2A 5D8LB 2KIQA 1B59A 1A35A 2LG4A 3FDYA 2DFIA 4JX6A 1JKRC 3MKLA 2WAQA 4PUSA 2YX7A 4BQOA 2Q2EB 4ZTJA 3FISA 1VQNI 4G6TB 2CV1A 1ETKA 3BJOA 2NVYJ 4U0YA 1KU9A 2DK5A 1K4TA 3J7AY 5HLGA 1FZPB 1VQ8I 1SEUA 1PVEA 1MBFA 2BZTA 1IDZA 4MQ9F 3CDIA 4PK4A 2IGMA 1IN8A 3L9FA 4A0ZA 2CV2A 1ETYA 3BPXA 5J1RA 2W1OA 1B8IB 1AKHA 4BDZA 1WHUA 4X0GA 5EGOA 2CMPA 5DEQA 1XSDA 2COMA 3JRDA 3TO6A 1GXQA 2EA4A 3CP2A 3BOQA 3HPHA 5FKKA 1MJAA 2CSOA 5LGNA 2M8EA 2M4KA 2MBFA 4IOAF 2F5FA 4E7IA 3S15J 3S1RJ 3ELKA 4BACA 2P7VB 3FMSA 2PBIA 5E3LA 1D8KA 1HA8A 2BV6A 3C7JA 2W84A 2X6WA 2YUSA 3ZN1A 4XLPF 3QQAA 4HF1A 4P1WA 2CRGA 2R7OA 1R4NB 3E5QA 5C4JJ 2W7NA 1UCRA 1WFXA 1VQ9I 1F36A 3S14J 4A3FJ 3T5XA 1AKHB 2VOOA 2F6CA 4M3BA 1U5TC 2VKVA 2PFBA 1U6GA 3G2BA 5DM6F 2WY8Q 3J81Z 2AO9A 3WGIA 2AHQA 2HQAA 4AUXA 1TC3C 1DDNA 2KDZA 4I6ZA 3CF2A 4BJ6C 3D0SA 1NH3A 3OMYA 1D1CA 1ZG5A 3PSFA 4GRIA 3HEFA 3DLAA 4G94A 3QU6A 1I6XA 2K02A 1AA7A 2KZGA 3KP4A 4KIGA 4EVIA 2Y48A 1R71A 1QBJA 3DEUA 3SEQA 4DYQA 1KONA 1TBXA 2UXNA 3M8JA 1QHGA 3O8HA 4KMUX 2ESNA 3SZPA 1K6YA 2QQBA 1P4AA 5HODA 1A04A 2A6TA 1FOYA 4A93J 1JXSA 5F64A 4C2MJ 5AONA 2M9HA 5FB2A 2VPRA 2V9KA 2MSYA 4RGRA 2ACJA 2E1NA 1EA3A 2DMUA 5GP9A 3F21A 3CCSI 4A3MJ 1JKOC 1IV6A 2UV1A 1RRJA 2DT6A 1HW2A 3DP7A 3TEDA 3FXOA 3V8LA 5C4XJ 2OPTA 2LP0A 4IX7A 3HXLA 1GLNA 3KIOA 1YX5A 4AIHA 1U5TA 4C3HJ 1WGXA 4PGGA 3E6DA 2STTA 1Z0XA 1JHHA 4DW6A 3K69A 1TT5B 1YI2I 2E7WA 2G7UA 3L1PA 5EZGA 2DA1A 4FT8A 3SEZA 3QPTA 1G3YA 5DCMB 4BXFA 5B1AH 1S3JA 4LB5A 2F2EA 2CGPA 2VE9A 1K79A 2A68F 2OCCH 3M1EA 2IPQX 1ZGWA 3OSGA 1FIAA 1UZCA 2DA6A 2K40A 2DA7A 2AXLA 3Q3SA 1DU0A 2JA5J 4XKVA 1MKMA 2FJ1A 2XPWA 3M8FA 3WTTC 2QWWA 4JYKA 5K5OA 1OYYA 5B5EC 3E5UA 5J40A 2IGNA 4CHUA 5LHGA 4HSRA 1LUJB 1HDPA 1JT0A 2WA0A 3FHNA 3BR1A 3DKXA 2ZNZA 4IHXA 4MGRA 1FBQA 3ZMTA 4LLLA 4M9XA 3S1QJ 4BU2A 3Q0WA 3HRUA 4P96A 3FZVA 2PMHA 4BE0A 2XKOA 3JTHA 1MMAA 2BVLA 3DLLF 1MSEC 1JHFA 3AG1H 1KQ0A 4DGWB 3F22A 1BI3A 2XB0X 5BOXA 1NK2P 4FASD 5LLQA 4XLCA 2DLLA 1W7PB 2DMNA 4AIJA 4UUSB 1RESA 1IRZA 2DAOA 3GLLA 1OKRA 2K85A 4ON0A 3KP3A 1K7AA 2FMYA 1FOKA 2WB1N 1V5GA 3S93A 1IF1A 4D5CA 4Y7NJ 3BLYA 3WU0A 1R6RA 3EUAA 3U9GA 2HZDA 3ZRGA 4KISA 4CCKA 4EATA 4I02A 2O9LA 5A2QK 4II3A 5FFXA 3GTGJ 1FMWA 5LHHA 1A5JA 2ZXJA 4FX4A 1Z3YA 3WG7H 2YSRA 1BJZA 2A6EF 2H6CA 3JW4A 2LH9A 4WXDA 4RLQA 2L7ZA 2L7MP 2RV8A 3HL2A 1TNSA 2M0CA 3EYYA 1LEAA 1ETQA 1XSXA 5IYCJ 2QYOA 1W5TA 3E6MA 3HGGA 4RB2C 4MTEA 1AOYA 1UG2A 3G1MA 3RPUD 4HW0A 3HUGA 3VYTB 4RLFA 1RKWA 2R4GA 3I59A 1WJCA 4P9UA 4M74A 2TCTA 2LBFA 5IT9K 1SFUA 3B02A 2KIMA 4DBQA 3LFKA 2FOWA 2VJ5A 3FXJA 3VWBA 1LKXA 3BR2A 3FM3A 3HYIA 3BR3A 2E2HJ 3OYDA 4UVAA 2EQRA 4HX4A 1O3TA 2LC2A 5F1RA 1X1DA 2L0KA 4MFEA 3G1LA 2N8GA 4A0XA 3BR0A 5TRDA 4M3GA 3LSJA 1WJBA 1YQAA 2QSGX 3GX4X 2L4AA 4UUTA 1SC7A 1MBGA 5JLWA 4CXFA 1WJFA 2VODA 4BXUA 1JGGA 3KP7A 3ISPA 1RETA 2EIJH 4U0VA 1MMDA 2A69F 1HXDA 3HUGB 4DNCA 3KETA 4NHJA 2DJIA 2F48A 3I59B 2QQ8A 1BR4A 2HGCA 1H0MA 3OV8A 1ETOA 2CYYA 3U2RA 5LHIA 4FTHA 2LBFB 3RKXA 1YG2A 1OLTA 2QF7A 5M3MJ 2GZWA 2X0LA 1IC8A 3H36A 2M1BA 1UHWA 3L09A 1OJLA 2OCEA 3V7RA 2E1CA 5CQGA 1Z9CA 2M8GX 1HSTA 1IAWA 1BOAA 5M5YJ 4LLNA 1OCZH 2JMWA 2NS7A 2YU9J 5FKMA 3WTXC 3GTLJ 1KYZA 3MMYB 1XCVA 2HOAA 2XV4S 1QO0D 4EM1A 2IS2A 2BHZA 3KP5A 4XLNF 4BJTA 3H5RA 1BIAA 2L7KA 3A2KA 3HKZN 4ESFA 1J7KA 1V4RA 1SMTA 2FMLA 1RUNA 3GTOJ 4F3QA 2Y0SN 2M87A 1ORKA 3DEEA 4BGDA 1D8JA 1B72A 4BUPA 1R36A 4NQWA 4U0WA 3LSKA 3OS2A 5HOOA 5IYDJ 4ENJA 3HB9A 1A6QA 4BDYA 1V5FA 3GLXA 5KNLA 2F4IA 1FY7A 4ZDLA 1TWGJ 2I10A 2JRTA 2LTPA 3G73A 2VKDA 1JT6A 3QP5A 2CW0F 4F52A 1MMSA 2WV0A 2R7UA 1YE9A 2WB1A 2VQCA 1G3SA 2R93J 2BE5F 3TOBA 2FD5A 3M3YJ 4Y52J 1XB4A 2RNJA 2LOOA 3KZYA 4L5JA 2XF6A 1UHSA 2P8TA 2ZFWA 2W82A 2E1MC 3KZIC 1LJ9A 1BW6A 2HDCA 1R9TJ 2YR2A 1BBYA 1BA5A 3H5AA 4L9NA 4L9TA 2M34A 5DD8A 4BHPA 1ZH5A 1K6OA 1B72B 4NQWB 3ZQCA 3TO7A 2WV1A 4PDKA 3WGHA 2L9SA 4M72A 3MD2A 1XDUA 2O03A 4RB0A 2ZCWA 1R5ID 4HZFA 2IP2A 2R7TA 2P5KA 5K5RA 4OAZA 3PIOF 3NWTA 2MD5A 1YOVB 2E71A 1WJDA 3MCZA 4RDUA 4OAYA 5LFAA 3X2QH 4RAYA 3I55I 2LKXA 5EJCA 5DYMA 3EPZA 3OR1C 4O6JA 5E17F 2LKPA 1K78A 2K5CA 1ZAOA 1UG0A 2I8DA 3OIOA 4ZYDA 1MBHA 4EM0B 3I4NJ 1SD5A 4ZDPA 2QLZA 2ELKA 3RKWA 2VQHA 4UUVA 3MVPA 4AIKA 2EA2A 3VSLA 1QZEA 5D6EA 3TQNA 3TBIA 2KHMA 2P6SA 3K1PA 3PNYA 4QIWN 2R7SA 4XRFA 5D5XB 4J00A 5D4RA 1QVTA 2JVHA 3DF8A 3KLNA 1MGTA 2QA4I 1SFOJ 1MJBA 5E20A 3K4LA 4E7SA 1HBXG 5J6XA 2E5NA 1S8NA 1J9IA 3I64A 5F6FA 5L3BA 2H1KA 3K4MA 1KGSA 3CDLA 3KEOA 1SD7A 2DTRA 2LDUA 3OYFA 5JLXA 4FE7A 4WXHA 4W97A 3KCCA 1FNNA 1YRNB 2ZJPF 4BS9A 2A3SA 1W5SA 1YYVA 3DBRB 3EUKL 4FX0A 4JX4A 3D5RC 3GYHX 4YRVA 4ENKA 1WPKA 4DYRA 1LEBA 4JOMA 2R0QC 2ADUA 1T56A 2NVXJ 1D1AA 4RAFA 1SAXA 1T95A 2WY7Q 3H9JA 4AC0A 1HF0A 1PUFA 2L02A 1JKQC 1VQ4I 3F8NA 2E1MB 1DP3A 2VLAA 1B6AA 2ZNYA 4BXXJ 2LY9A 5FLVA 3J80K 1FTZA 2A07F 2QGUA 4HDVA 2IGOA 3KFWX 2ZC2A 2GA1A 2KKOA 1ZARA 1UHMA 4Z6YA 1D1BA 2A6HF 3TW6A 3TOAA 2X1EA 3ZCOA 2ETHA 3RCOA 4B4CA 4YG2F 3PIPF 1W36C 2EPFA 4M6YA 3ERED 3SDGA 1ACIA 3BTJA 1T39A 4A2UA 3DTIA 4UNOA 1QRYA 1DGRM 3F0CA 3HKZA 2UZKA 4LITA 2W85A 1ITYA 1FJLA 4LK0F 4H4KC 2LF7A 3A01B 2CUEA 3C3WA 2ME6A 3F23A 4BE2A 3BJAA 1BW5A 2DA2A 1MDMA 1Z7LA 3QRFF 1APLC 2P4WA 4L18B 4HG2A 3VB2A 4GFBA 3DU5A 1QA6A 4KMFA 4XRMA 3R61A 4V2GA 4HYEA 5F04A 1G3WA 1HCRA 1P4XA 2W24A 4HBLA 9ANTA 3E97A 2BEOA 3OYLA 2ISZA 1MH4A 1Z77A 5LRSA 3VYSB 1TTYA 1YX3A 1YJ9I 3GWZA 2MLGA 3UR3C 3HOZJ 4A3IJ 3I4MJ 3BDDA 2ELHA 2LNBA 4A6DA 2NYXA 4XOPA 1IXCA 4Y15A 5FRNA 2QKLB 3MZ8A 3JSOA 1S9HA 5TISC 3GEZA 3NEUA 1Y1VJ 3CMYA 3CC7I 2HFHA 2AQFA 2OAZA 3FXUA 2DDAA 2Z1DA 2W00A 3LAPA 4C3JJ 1SVLA 3M1CA 1XMKA 1TT0A 1PP7U 1QZZA 3GW2A 5F27A 3G1OA 4EJTA 2PJRA 4CGZA 1AWCA 3E7LA 5IP9J 3CTAA 3I9V2 5ILUA 3T0YA 4QPQA 1S6LA 3FM5A 3JRIA 2XHKA 1WI9A 4CCJA 2CUJA 4B1RA 3CCEI 2GXBA 1OCTC 3WTWC 4KN4X 2VE8A 5KK1A 5JHUA 2HEOA 2JPBA 1LPQA 4LG0B 4Y33A 4FETA 3ECOA 4CA0A 4M6XA 2H27A 2LK2A 2F4MB 3ROUA 4GDFA 3H1CA 1JJ6C 4BE1A 3CUQA 3OYIA 5JVGF 2DODA 5HS9A 1QPIA 1DU6A 4DOZA 1IN4A 3TKYA 3N97A 2P7CB 2PJRB 3PM1A 3E6BA 3OY9A 3GTQJ 2KRCA 5CLSA 2J5OA 1YIOA 1I1GA 1XX5A 3K4KA 1ZRFA 1TWHJ 3ULQB 1SD6A 4RM2A 5HS8A 6PAXA 1IDYA 2CU7A 4Y3OA 3OL3A 1EH8A 4FE4A 5IP6A 2X9DA 4YIIA 2V7FA 3PFYA 5HS7A 1FIPA 4E7JA 2DT7B 3HM5A 5BNGA 1Z21A 3DWLE 2A61A 1Y56A 3R0AA 5EDNA 4OOIA 2XRLA 2LD5A 2JA2A 4AYBN 3CUQB 3NWSA 3WU1B 1EH6A 3CJTB 3GF2A 5E8GA 2K9LA 3PL8A 1W7PD 3C18A 1CF7A 2XGXA 3Q0UA 4N0BA 4NC6A 5E1WA 1FEXA 1ETVA 1L3LA 5E1XA 2ECCA 2HQNA 4ZH4F 2VASA 3O8GA 4I0AA 2FQ4A 2HDDA 1R5GA 3PJRA 2R7VA 4WX9A 1O4XA 4NB5A 2XKPA 3KEYA 4M3DA 3OIPA 3RZOJ 3S3OA 2KISA 4UB8C 3QP6A 1GUUA 2JWTA 1ZK8A 4JK1X 3M07A 3DBHB 4B3XA 3S1MJ 2NS0A 4YFNF 2Q8KA 1Z05A 3P7NA 2KDOA 3ZQGA 3S2WA 1B9MA 4M9SA 4E7KA 3HIFA 2A5WA 5E3NA 2VPLA 2HS5A 1CF7B 2MABA 2L9VA 1YIJI 2K9SA 1LNWA 2Y2ZA 3IH2A 1TWCJ 2K7LA 3HSRA 3WE2A 4A69C 1IRFA 4KUMA 2VI6A 2GBYA 3DCFA 5HDNA 5GAHJ 3IAS2 1R1TA 2LLKA 4XLFA 3JRCA 4N9HA 3HDDA 1NG7A 2Y9YA 2O61A 1ONVA 5EGOB 4BHCA 1X1BA 4XSXF 2E2JJ 3L2RA 3R0JA 4CCOA 3I71A 2CUZA 3FMRA 2I5UA 1L0OC 3O6BB 4QPOA 1Y6IA 5E18F 3DKWA 5LEKA 2C6YA 2FE3A 1ZGJA 3QODA 1RNLA 2FF4A 5JR3A 4ZTFA 4P55A 2Y30A 1QQIA 4RAZA 1T2KA 3S1NJ 2IS6A 2CS3A 1TP4A 3COAC 2HKXA 1MZBA 2B7EA 4HOBA 1Z6RA 4EJUA 2CW7A 2KJBA 3V42A 1H9TA 1G59A 3CCMI 4BNCA 3CZ6A 5K5QA 1RUOA 4I76A 3T8TA 1K4SA 1I27A 4U7DA 4LIUA 3A4CA 3KP2A 2CO5A 2CV0A 2KLOA 3Q5FA 2XRNA 3K70C 2Z33A 1ZN2A 4MHGA 5IY5H 2JVGA 2KFDA 1X3ZB 2K86A 4L0ZB 1TW3A 3CCVI 2P0WA 2EK5A 3HZJA 5GPAA 1VZ0A 3FXMA 4HLYA 5IYBJ 1G4DA 1BIBA 3MAJA 4U88A 5LGTA 3SDBA 5DTDA 5CYVA 1O3RA 3W2AA 1TW2A 4PZJA 3BG3A 4B44A 4XONA 1T98A 1VQMI 1OCPA 2QBYA 2MGQA 5LRRA 1S7OA 5LEJA 3IH4A 4UV9A 4XN0A 4BKXA 2ME0A 4K2EA 1O3QA 3AL0C 4RM3A 4S0HB 2K3FA 1V5EA 3VPRA 1WCMJ 4D0PA 3OS0A 4XL9A 3L2QA 1FMVA 1HKSA 4A3GJ 3LMMA 1Q1VA 2LFBA 4B3AA 4PGHA 4MNUA 3R6SA 2NS8A 3L7WA 3JAMK 3OYAA 2XGCA 2DMTA 3BCBA 4I7HA 3I54A 5HLHA 5ICGA 2EJRA 3OYHA 3GZ6A 4FCYA 5HLIA 1T08B 3RYPA 4L5EA 2V79A 1U5TB 4OIOF 2G0EA 2K27A 2K9QA 2F4OB 2JN6A 1TL8A 2ISYA 4E70A 2OZUA 3CESA 1X2NA 4ZJZA 3SJMA 3I5UA 1H88C 2LRDA 4BAYA 4JX5A 1JJ8C 3A0HC 3WGGA 2QSHX 4M73A 2FSWA 3ABKH 5FLXK 2WAFA 3B73A 3LSGA 4QSHA 3T1BA 2RAEA 3FX3A 4F55A 3UNGC 3FXKA 2XPUA 3BG6A 3I0TA 1T8IA 3F9KA 2VIXA 3K0LA 3PNTA 3OWTA 4PSXA 2RGVA 2DQLA 5K7ZA 5ERIA 4AU7A 1VQKI 5M3FJ 4UVBA 1Y0NA 4M9ZA 2OF7A 3C2BA 3WTSC 4ESBA 1SANA 1WRJA 5FROA 2FEZA 2WWYA 5F0HA 1GVJA 4R8HA 1JKPC 1F43A 2M7AA 1FYLA 3BTLA 1POGA 4LIVA 2M3AA 1IGNA 1N25A 2X6YA 2XSDC 3K2ZA 5ICCA 2XIGA 5DV5A 1I1SA 1T6SA 1G8XA 2VBYA 3HSEA 5GADJ 2R3SA 3PNVA 2CQXA 2DJNA 1C0WA 1IG7A 3V8KA 1XD7A 3HC7A 3ZMVA 4E4HA 3HSFA 2GWRA 2MLKA 1XMXA 3DFGA 3PO3J 5BPDA 1J59A 2M4GA 2IS1A 2XAHA 4ZYEA 1WVRA 2QZ8A 3O3KA 2KP6A 2HWVA 1GVDA 1FBSA 4MTDA 1DGWY 1SAUA 1BI2A 3RKYA 3AL0B 1FOXA 3OOPA 4HV6A 4NBQA 3IWFA 5TGTA 1STZA 5L3DA 5DUIA 4EGYA 4HRIA 2YPRA 2DPUA 5DCFA 3OYCA 1USTA 2VJJA 2IXSA 1XDSA 2DBBA 2V1XA 4BBSJ 5AIPA 2RREA 4XOTA 1QGPA 3KYCB 3UKGA 4G9YA 4I98B 1V3FA 4CZZA 2IRFG 4ZZLA 3ZMDA 4M3EA 4UXNA 3JR9A 2IBDA 4CO8A 3QYBA 1IJWC 1P9QC 2HZTA 1LDKB 4HEA2 4L0YB 1YW9A 2L01A 4MEXF 5J3LA 2CQNA 1IXSB 3F3XA 3LL7A 2HI3A 1TLHB 1WJEA 1VQOI 1SVOA 1TQMA 2H09A 2ID3A 2QM3A 3M8EA 3K4BA 2FRHA 4RMNA 3C1DA 5IOZA 3FKIJ 4IRIA 3MEXA 5J8FA 2X1CA 2UUZA 4EJOA 4ANJA 3D1NI 1ON1A 4UY8I 1RI7A 4EEFG 4Y17A 3SFIA 1FBUA 3QOEA 3N4MA 2EFOA 1R49A 3H0GJ 2D5VA 1J09A 2VN2A 4EJVA 1A31A 5LGUA 2Z2SB 3RTRA 2EV5A 1VI0A 2VL8A 1YW7A 2V4JC 2VBWA 2FNPA 4RGXA 1EKEA 5EZHA 2CW8A 2EZIA 4HAMA 3S32A 2NOGA 2PX9A 2QENA 3VYUB 3CMAI 1TWFJ 1XN7A 2STWA 3ZR8X 5IOYA 1JUSA 5LD2C 3F72A 4L5IA 2RVCA 1NTCA 2B0LA 1ZRCA 3KE2A 4LB6B 5FD6A 3MWMA 2PN6A 3CP8A 1E3PA 1Z3XA 2WBMA 4BY1J 3CDHA 1REPC 2F5EA 2W57A 3HHGA 4N4OB 2Z16A 2V1NA 3RIRA 1G2HA 3PQJA 1N78A 1MJ9A 1D5YA 4DZJA 1BI0A 2OU2A 2JA6J 3K6GA 1R1UA 5BPIA 3IL2A 4C2UA 1CQTA 2OQGA 3GFJA 4P5OA 1U8BA 3NRVA 3OOUA 4V2FA 1EJ9A 1G6NA 4M6VA 4WF2A 2R5YA 3JRHA 1DQUA 3BJ6A 3ZQ7A 2JA8J 2E19A 2XGEA 3OYBA 2L9NA 1WZ2A 1MNDA 1YS7A 1P7IA 2CH0A 3ONQA 4YEJA 1Y0UA 1ZKGA 4KIFA 4IO9F 1XSVA 4UHTA 2QEXI 4OIPF 5CJ9A 3WTZA 5FLMJ 2BY1A 4OIQF 3H3ZA 3O2PE 3AKZA 3V8JA 2FX0A 3QU3A 2HPIA 4S04A 4OINF 1YFHA 1T33A 3LSMA 5EEHA 4IZZA 2ZBKA 4H0EA 1U9OA 1NG6A 3LQRA 4WCGA 1WWXA 2X6XA 2V6CA 3ZQLA 4IHSA 2DFEA 5M5XJ 2R5YB 2RN7A 2VUMJ 2DYRH 3JCUC 3S17J 4DJAA 1UAAA 3I53A 3R4KA 4Q4ZF 2L7FP 4G12A 3MZYA 2ZXIA 4IXAA 3H9QA 2VKHA 3HRTA 3H3UA 1IRXA 2VBXA 3K9TA 5B1BH 4ZYAA 1VQPI 1OPCA 2VC1A 1SFXA 4NC8A 2D45A 5A2QZ 1Z1DA 3P9KA 2P81A 2QSFX 2ECBA 2O8KA 2ZSHB 1O3SA 2MYSA 2EBIA 2QQAA 3W2VA 3HOWJ 1P92A 3DBLB 4L9JA 2JSCA 1W5CC 2PMZN 1GXPA 3LA7A 3KYDB 5D5UB 2FBIA 1GHCA 1IN5A 2X6OA 1J75A 2H6BA 2DCEA 2JZYA 3HGYA 5L3GA 1ZR2A 3HHHA 2D2WA 4J19A 5L3FA 2QQ9A 4EJWA 4ZDOA 3RQIA 5ICEA 1HW5A 4B48A 3MZHA 1BI1A 4BBRJ 2E34A 2HOSA 2CQ7A 4D7NA 4E7LA 3E3VA 2UXXA 3FKJA 2HVSA 2FXAA 2PLYA 1TNTA 3F8FA 3IV5A 3IWZA 2ZXWH 4TV7A 1R5HA 4NUBA 4HX8A 4HDUA 5L3CA 2HYFA 2LY1A 1TQPA 5AIQA 4BY7J 1X1AA 2R7FA 1IO2A 4BYYA 5IT9Z 1ZLJA 2LREA 1K78B 1OISA 3OL4A 3GFLA 4Q48A 4KA4A 3BG5A 4XR6A 2JRMA 4MFDA 4HNUA 4RB1A 1ZRDA 3MKZA 2RQQA 1LDJA 3B6CA 4KJZA 3U1DA 4BHBA 2HOTA 2Z9OA 2M7BA 3WU2C 3VSKA 3S3NA 3R60A 2RQPA 4EM2A 4WK8F 3DU6A 3U21A 3ZN0A 3ABTA 1MNMC 2K3PA 1YS6A 1S5LC 2K9NA 1U2WA 1WJAA 3ZOBA 4YIRX 4BQQA 3FXLA 1SMYF 1WI3A 3FHZA 3MN2A 2LY2A 2D1VA 4AWXB 2KRFA 3CJRB 2IAIA 3F6OA 3CCQI 3AAFA 4XORA 3K4JA 2E60A 4OMYA 2F5CA 2H8RA 3EDPA 5D8KB 4C9YA 2WAQN 1D3YA 4U7BA 2XAUA 1FSHA 2CUFA 1U8RA 3E6CC 2Y0SA 3F6VA 1X1PA 2V9VA 2V1DA 5FKLA 3LA2A 2X4HA 4X1EA 1PUFB 2FUG2 2GM4A 2GIZA 2W4SA 3W6KB 2NAZA 4ITVA 4YIFA 4G7ZF 3ZQQA 2KZVA 1JTXA 1XMAA 4MLOA 1BJAA 4XLEA 2GAUA 2O0YA 1OCRH 2W25A 1O7FA 2HXIA 3ZXSA 2KIUA 1MIJA 3MFKA 2DA3A 3FK6A 3L2WA 1ZQ3P 1IW7F 3BT9A 2EIMH 4IVNA 2CWEA 3CMMA 4LFUA 2FBHA 4MQVA 2EZKA 1Z7UA 2GOXB 1S7AA 2QKMB 2JSPA 2EB7A 1HW1A 2R7WA 1TWAJ 5EEAA 3K1MA 1QHHD 1ZYRF 3HG9A 2A5YB 3J81K 4LG3A 1MDMB 2EFQA 2OC6A 3BG9A 3BCAA 3DV8A 4XQFA 3BPVA 2KIFA 5GAEJ 3LOCA 4HPQA 1E17A 3F8MA 2XF7A 2RC4A 1JI8A 3LQQA 2HR3A 1AHDP 2JA7J 4E7ZA 4I0BA 2HVQA 2BYVE 3C2GA 2OV7A 3BC8A 3SHFA 2K4BA 3FBIB 4A3LJ 3H9GA 4HA8A 4W1UA 2PQ8A 2YS9A 3ZMZA 2KT0A 4DYCA 3U1KA 2COBA 5D5VB 2WC2A 4AM3A 2PMZA 5FKNA 2OUMA 4BL0B 5ED4A 4C3IJ 3W3CA 1BL0A 4RBOA 2MD0A 3RKQA 1FTTA 3LA3A 2MH9A 1A36A 3GZ5A 4PCQA 3D5LA 3I3LA 1V55H 3NQOA 1RR7A 2BGCA 4GCVA 4LGWA 2EH3A 3JRBA 3SZGA 4XBFA 4LOCA 3IKTA 4HNTA 2P5LC 4E7HA 1XG1A 1JUPA 1S7EA 2LF8A 3C2HA 4IL6C 1I5ZA 5J47A 2EV0A 5H2FC 4U87A 4I09A 1YW8A 2DQRA 3BZ6A 4CCMA 5FRMA 1O57A 5IT3A 4CCNA 3DEWA 4PFOA 3RQ4A 5HNHA 3FXQA 2EINH 4HV5A 3OYGA 3WHBA 2ZMEC 1X58A 1GT0C 4XKCA 3BQYA 2KPMA 1BOBA 1MD0A 4O3MA 4A3KJ 2HDWA 3MQ0A 2LVSA 2EZHA 4P9FA 5H6QA 1J5YA 5E1ZB 1ERDA 2ICWG 4A12A 2AS5F 2DFHA 2M45A 3HOXJ 1H8AC 1IUYA 2EWNA 5JVTA 1BR2A 3DTEA 2O3FA 3K4CA 1JUMA 2VOPA 3LAJA 1QU3A 4D9JA 2KMUA 1R58A 1UFMA 3A0BC 1OFCX 3PFIA 2ZSIB 3ZMUA 4PJNA 1FC3A 2O7OA 3IAM2 3CD6I 2IA0A 3VOEA 3HTSB 4UB6C 1RZ4A 1XGNA 4I99C 3RJPA 2NXNB 3ZGKA 1MBKA 4IF4A 3FXRA 1IV8A 3TL4X 1RR8C 3J80Z 2R7RA 3BZCA 3LSPA 1LVAA 4OMZA 3RPQA 3WHCA 4A5MA 1QZYA 2BY3A 2PJPA 5D4SA 3DQVC 2HVRA 1U3EM 2MC4A 3HPGA 3JRFA 3TDUC 3AFHA 1SD4A 2HYGD 2ZMEA 3GVAA 3QPLA 4KT5C 3CLOA 1EV7A 2KRHA 1U9NA 3WODF 3KPHA 1PYVA 2LSOA 1WQ2A 3VODA 3RZDJ 5M5WJ 2ZJ2A 3OSFA 3CCJI 4CYDA 1BC8C 3OS1A 4Q5SF 4CICA 3H92A 1VNDA 4IRHA 3BY6A 3GFMA 3IRQA 3LSRA 1T0FC 4IHVA 1YTYA 4HNVA 1PP8F 1NHAA 2M30A 3FF5A 1VFCA 3K1NA 5DD4A 1E3OC 1SVMA 3TP0A 4A3EJ 4M71A 2X48A 1E3HA 2O8XA 3CO6C 5KHDA 4KFCA 3FMQA 1KA8A 3KP6A 4ABZA 2CQKA 4JP0A 2R5ZA 2FU4A 2ZMEB 4ASNA 2H94A 3CO7C 5H6RA 4II2A 4O5VA 5KCMA 3TGNA 1Y8QB 1ETXA 3S16J 4G8XA 2M5WA 4A5NA 3OYJA 3SXYA 1UMQA 2VQGA 1W1WE 2E5ZA 2ELJA 2XAFA 5F1JA 3L2CA 2L9RA 3RI4A 4PFPA 3J7YJ 1D0ZA 1RIOH 3OR2C 2EILH 4BJ5C 5HLTA 2E2IJ 2FBKA 3A02A 1R22A 3V4GA 2NNYA 3RYRA 1X2MA 5KAFC 1XTAA 1HDDC 2IJLA 5KVRA 2WAEA 4IKFA 1Z6TA 2R5ZB 5J4YA 1CGPA 1T0FA 3BP8A 4XRSG 4MEYF 1WH7A 3CCYA 3SYTA 3K10A 2LKSA 2GOMA 3GTPJ 3CC2I 2Y69H 2MC3A 1OCCH 3S2HJ 5DCMA 2NOJB 2GA2A 2JUCA 2YX4A 5GTHC 4HLXA 2DK8A 4A6EA 5GTIC 1B9NA 2JJ7A 2BXZA 2R7DA 2V26A 4MO7A 4N4NB 1HLVA 3F8CA 3WE3A 1JGSA 5CVVA 5BS6A 2ZXHA 4A3BJ 1H9GA 4A3DJ 3OYKA 4XN3A 3GZNB 3V7SA 2DMQA 4KDPA 1ENHA 2PI0A 1YJWI 2ZKZA 2VBZA 4LD5A 3L2VA 5GAGJ 1MNEA 5EYRA 1E0EA 5CVJA 3E5XA 2QCOA 3OYNA 4GYIA 3IHUA 2EFNA 3TW7A 3JSPA 3EUHC 4AD9A 4QTRA 4OWRB 4IHTA 4AYBA 1XGOA 3G6EI 2VT3A 3I58A 2M2EA 2QBYB 3QPHA 4N9IA 2FOKA 1XCBA 5EF6A 5F0CA 2IVMA 2V1UA 1ZTRA 3P5JA 2XUBA 2OBPA 3TMOA 1DPRA 1SFEA 3CCUI 4M3FA 3VFZA 1W7PA 2EV6A 4BH9A 4UUSA 4XLAA 2DOEA 2XASA 1YHQI 3H3VK 1KU7A 2MG4A 4A3JJ 1A6IA 4XSZF 2OZ6A 2VT2A 3BG7A 4RA2A 3HRMA 5CQEA 1IUFA 1PUEE 4GYGA 2DA5A 1OMIA 3S8PA 3JRGA 4FISA 1USSA 3ML6A 5KAIC 4RB3C 2E1OA 4CDGA 3GFIA 2OTLI 1DPUA 4ZC3A 1NK3P 4G6DA 5IPAA 2VONA 2CJJA 1WJ5A 3HBLA 2L4MA 1P4WA 2BY2A 3M7GA 3P9IA 4GGGA 4PJLA 4BEHA 4FHTA 4F93B 4XRSA 1U78A 3DPUA 3BTIA 4GO1A 2OD5A 2LYCA 1MW7A 4HQMA 2G9WA 4R79A 2KJCA 1U0JA 3M4OJ 5D6FA 3GO5A 4IQJA 2KL4A 2HNHA 3EUHA 4RGUA 3TP3A 1KQ8A 3TDZC 1QNTA 2TDXA 3SQNA 1W4MA 1VTNC 4S05A 2H1LA 4Y13A 4IHYA 2VB6A 1RKTA 3EQLF 2XROA 2HTJA 3GBGA 2GXAA 1LFBA 2BHYA 2DO7A 1D0XA 5HVQC 1ON2A 4DQ2A 4XLHA 2PMUA 4FQGA 3LNQA 2BW3A 1X19A 2DYSH 3IH3A 1XGMA 2AXTC 2F5VA 3LSIA 1LFPA 2HQ5A 2Y0MA 1IRGA 3E0JB 1LFUP 4BEHB 4D7MA 1SFKA 2VQLA 1UELB 3ZP5A 4AVZA 2DDBA 2OTJI 4WWCA 3Q9SA 3N05A 1YO5C 4G7OF 2MFZA 2NNNA 5C44J 2VKEA 1YJNI 2D1HA 3ABMH 1IZ1A 4XIDA 1K83J 2HYJA 2RNGA 3FWEA 1BC7C 3VDXA 1ZR4A 1I3AA 3BTCA 5L3EA 1DP7P 3ASOH 3GTMJ 3PUBA 1RPWA 1ZG3A 3QOPA 3H5NA 5JHFA 1FSEA 1S29A 4BQAA 1W0UA 3CJNA 5E79C 1X3WB 1ZG1A 3RSNA
chains in the Genus database with same CATH topology
2ESHA 2DW4A 2DI3A 2EFPA 3G3ZA 2IT0A 1P2FA 4EGZA 3IRRA 1QPMA 4ZYHA 5K1YA 2L3DA 4AVPA 2XAQA 4WXCA 3SFZA 4KYWA 1FPQA 3RDIA 4IJAA 5LBQA 3TO9A 1LDDA 2PG4A 2HTSA 2FNAA 4EV0A 3DPTA 5BQTA 1HQCA 2OQRA 1LB2A 5HDGA 1TQIA 1FT9A 3M9AA 3Q9VA 5FGMA 3T8RA 2K4JA 3JAMZ 4LMYA 4HQEA 4Q47A 2HQRA 5HDKA 2XAGA 2NRAC 1UB9A 3SZTA 1X3UA 3KZZA 1WSUA 1XGSA 3GUDA 5DDGA 3KEQA 5FLXZ 5FD5A 3ECHA 4ZYGA 3IC7A 4ETSA 5FO5A 1ZREA 3HOSA 5DUKA 2OA4A 5TJJA 1T38A 5J8CA 3REOA 4OIRF 3IKVA 4UVCA 5JFRA 1D5VA 1KYWA 4L9VA 3WTVC 4JBAA 4HX7A 1FLIA 2DT5A 3HTUA 4A0YA 2CG4A 3P9CA 3WG9A 5E8IA 1EH7A 2G7HA 2JTVA 3LWFA 1DUXC 4F7ZA 2GXGA 3KLOA 4KIBA 1FX7A 2FA5A 2IA1A 4UV8A 2O6GE 1FP1D 3PQKA 2HKOA 2CFXA 2P5VA 5CVRA 1R23A 1HKTA 2JT1A 4G7HF 4HF0A 3RPUA 2IA2A 4HF2A 1ULYA 3W6JB 4I2OA 1O7LA 3JTGA 3BWGA 4EMSA 1Z91A 1YLFA 2Q0OA 3HOTA 5FFZA 2JPCA 1LQ1A 1ZLKA 1R1VA 3I4PA 4JQFA 2YU3A 4ENNA 2L54A 4KICA 4QLCU 1R00A 1P6RA 2Y75A 2MH2A 3ABUA 2E7XA 3J7AO 1F1ZA 1ZGAA 1B1BA 2QUFA 5D5WB 2VXZA 1R7JA 2QVOA 1FWZA 1FP2A 3BROA 4RS8A 1BN5A 3DPLC 1BM9A 2HOEA 4I01A 4B09A 1G3TA 1F4KA 1FYMA 4ESJA 2UWMA 5H20A 5ILVA 1IN7A 2Z5UA 4RGSA 5CVUA 3V7CA 3VEPA 2Z3YA 1IN6A 5CVIA 4LJZF 1HSJA 4YFXF 1PDNC 1KU3A 3LSTA 4R1HA 4B8XA 4LLGF 4ZZDA 4G6QA 1E2XA 2VC0A 1F5TA 4ENMA 1OYIA 3CUQC 1J2XA 1J0RA 5EEGA 4IPAA 4LG0A 1HKQA 4YFKF 3ZMSA 1IXRC 1ZHFA 5ILSA 3WTUC 3F8BA 2DU9A 2ZO4A 5JI6A 3CUOA 3GXOA 4GXOA 1OR7A 1OYWA 2PEXA 4Z2YA 2BBYA 1KU2A 4KNYA 2DPDA 3HRSA 4LK1F 4IRGA 4KN7X 5BMZA 2EFWA 2FQ3A 2IW5A 3DXJF 2Z99A 1FYKA 3WTYC 2Q2EA 2RDPA 4EQQA 2P6TA 3L00A 4QWQA 4OU0A 2J5PA 1WKMA 1JE8A 2MA3A 2XAJA 2RKHA 1F9NA 3QAHA 1B4AA 3EYIA 1Q1HA 2XVCA 1ODDA 2GIVA 5ICFA 1KQ9A 3EETA 2WTEA 3ZPLA 2GQQA 2F5DA 5D8LB 1B59A 2DFIA 2YX7A 3BJOA 4U0YA 1KU9A 2DK5A 5HLGA 1FZPB 4MQ9F 1IN8A 3L9FA 4A0ZA 3BPXA 5DEQA 1XSDA 2COMA 3TO6A 1GXQA 2EA4A 3BOQA 1MJAA 2CSOA 5LGNA 2M8EA 2MBFA 2F5FA 3ELKA 2P7VB 3FMSA 2PBIA 1D8KA 2BV6A 3C7JA 2W84A 3ZN1A 4XLPF 4HF1A 3E5QA 1UCRA 3T5XA 2VOOA 1U5TC 2PFBA 1U6GA 3J81Z 3WGIA 1DDNA 3D0SA 1ZG5A 4G94A 3QU6A 1I6XA 2K02A 4KIGA 3KP4A 1QBJA 4EVIA 2Y48A 3DEUA 1TBXA 2UXNA 4KMUX 2ESNA 3SZPA 2QQBA 1P4AA 1A04A 1JXSA 5F64A 5AONA 5FB2A 4RGRA 2ACJA 2E1NA 3F21A 1HW2A 3DP7A 3V8LA 4AIHA 1U5TA 4PGGA 3E6DA 2STTA 1JHHA 3K69A 2E7WA 2G7UA 4FT8A 3QPTA 1G3YA 5DCMB 1S3JA 4LB5A 2F2EA 2CGPA 2VE9A 1K79A 2A68F 3M1EA 2IPQX 2AXLA 1MKMA 3M8FA 3WTTC 2QWWA 5K5OA 1OYYA 3E5UA 4CHUA 5LHGA 2ZNZA 4MGRA 1FBQA 3ZMTA 4LLLA 4M9XA 3HRUA 4P96A 3FZVA 2PMHA 2XKOA 3JTHA 1JHFA 1KQ0A 3F22A 1BI3A 5BOXA 5LLQA 2DLLA 1W7PB 4AIJA 2DAOA 1OKRA 4ON0A 3KP3A 1K7AA 2FMYA 1FOKA 1IF1A 3WU0A 3U9GA 4I02A 5A2QK 5FFXA 5LHHA 2ZXJA 4FX4A 2YSRA 2A6EF 2H6CA 3JW4A 4WXDA 2RV8A 1TNSA 3EYYA 1LEAA 1XSXA 2QYOA 1W5TA 3E6MA 4RB2C 4MTEA 1AOYA 4HW0A 3HUGA 3I59A 4P9UA 4M74A 5IT9K 1SFUA 3B02A 2KIMA 3LFKA 3FM3A 3HYIA 4UVAA 4HX4A 1O3TA 5F1RA 4A0XA 5TRDA 1YQAA 3GX4X 2L4AA 4CXFA 2VODA 4BXUA 3KP7A 3ISPA 4U0VA 2A69F 1HXDA 4DNCA 3KETA 4NHJA 3I59B 2HGCA 1H0MA 3OV8A 2CYYA 3U2RA 5LHIA 3RKXA 1YG2A 2GZWA 2X0LA 2M1BA 1UHWA 3L09A 3V7RA 2E1CA 1Z9CA 1HSTA 1IAWA 1BOAA 4LLNA 3WTXC 1KYZA 1XCVA 2XV4S 1QO0D 4EM1A 3KP5A 4XLNF 1BIAA 4ESFA 1J7KA 1V4RA 1SMTA 2FMLA 1RUNA 2M87A 1D8JA 1R36A 4NQWA 4U0WA 5HOOA 4ENJA 3GLXA 1FY7A 3G73A 2JRTA 3QP5A 2CW0F 2WV0A 1G3SA 2BE5F 3TOBA 1XB4A 2RNJA 3KZYA 4L5JA 2P8TA 2ZFWA 1LJ9A 2HDCA 2YR2A 1BBYA 4L9NA 4BHPA 4L9TA 5DD8A 1ZH5A 1K6OA 3TO7A 4PDKA 3WGHA 4M72A 1XDUA 2O03A 4RB0A 2ZCWA 4HZFA 2IP2A 2P5KA 5K5RA 2MD5A 3MCZA 4RAYA 5DYMA 4O6JA 5E17F 2LKPA 1K78A 1ZAOA 4ZYDA 4EM0B 1SD5A 2QLZA 3RKWA 4UUVA 4AIKA 2EA2A 5D6EA 3TQNA 2P6SA 3K1PA 4XRFA 5D5XB 5D4RA 3DF8A 3KLNA 1MGTA 1MJBA 5E20A 1HBXG 5J6XA 1S8NA 1J9IA 3I64A 5F6FA 5L3BA 1KGSA 3KEOA 1SD7A 2DTRA 2LDUA 4WXHA 3KCCA 1FNNA 2A3SA 1W5SA 1YYVA 4FX0A 3GYHX 4ENKA 1LEBA 2ADUA 1SAXA 2L02A 3F8NA 1B6AA 2ZNYA 3J80K 2A07F 4HDVA 3KFWX 2GA1A 2KKOA 1ZARA 1UHMA 2A6HF 3TOAA 2ETHA 4YG2F 4M6YA 3ERED 1T39A 4A2UA 4UNOA 2UZKA 2W85A 4LK0F 2LF7A 3C3WA 3F23A 3BJAA 1MDMA 3QRFF 2P4WA 4L18B 3VB2A 4KMFA 3R61A 4HYEA 1G3WA 1P4XA 2W24A 4HBLA 3E97A 2BEOA 2ISZA 5LRSA 1TTYA 3GWZA 2MLGA 3BDDA 2ELHA 2LNBA 4A6DA 2NYXA 1IXCA 4Y15A 3JSOA 3GEZA 3NEUA 2HFHA 3FXUA 2OAZA 3LAPA 1XMKA 1PP7U 1QZZA 3GW2A 4EJTA 4CGZA 1AWCA 3CTAA 5ILUA 3T0YA 1S6LA 3FM5A 2XHKA 1WI9A 2GXBA 3WTWC 4KN4X 5KK1A 5JHUA 2VE8A 2HEOA 2JPBA 4LG0B 3ECOA 4M6XA 2H27A 3ROUA 3CUQA 5HS9A 1IN4A 3TKYA 3N97A 2P7CB 3E6BA 5CLSA 2J5OA 1YIOA 1I1GA 1ZRFA 3ULQB 1SD6A 5HS8A 6PAXA 1EH8A 4YIIA 5HS7A 2A61A 3R0AA 4OOIA 3CUQB 3WU1B 1EH6A 3GF2A 5E8GA 1W7PD 3C18A 1CF7A 2XGXA 4N0BA 5E1WA 1L3LA 5E1XA 4ZH4F 2HQNA 4I0AA 1R5GA 4WX9A 4NB5A 2XKPA 3QP6A 4JK1X 2NS0A 4YFNF 2Q8KA 1Z05A 3P7NA 3S2WA 1B9MA 4M9SA 3HIFA 2HS5A 1CF7B 1LNWA 2K7LA 3HSRA 3WE2A 1IRFA 4KUMA 5HDNA 1R1TA 4N9HA 2O61A 1ONVA 4BHCA 4XSXF 3R0JA 3I71A 3FMRA 1L0OC 3O6BB 5E18F 3DKWA 5LEKA 2C6YA 2FE3A 1ZGJA 1RNLA 2FF4A 5JR3A 4P55A 4RAZA 1QQIA 1T2KA 3COAC 2HKXA 1MZBA 4HOBA 4EJUA 1Z6RA 2KJBA 1H9TA 4BNCA 5K5QA 1RUOA 3T8TA 1I27A 4U7DA 3KP2A 2CO5A 3Q5FA 2XRNA 2Z33A 1ZN2A 4MHGA 2K86A 4L0ZB 1TW3A 2EK5A 4HLYA 1G4DA 1BIBA 3MAJA 4U88A 5LGTA 5CYVA 1O3RA 1TW2A 4PZJA 1T98A 2QBYA 5LRRA 1S7OA 5LEJA 4UV9A 1O3QA 4K2EA 4D0PA 1HKSA 4PGHA 4MNUA 3R6SA 3L7WA 3JAMK 4I7HA 3I54A 5HLHA 5ICGA 2EJRA 3GZ6A 5HLIA 3RYPA 2V79A 1U5TB 4OIOF 2K27A 2ISYA 4E70A 2OZUA 3I5UA 4BAYA 3WGGA 4M73A 2FSWA 5FLXK 3B73A 3T1BA 3FX3A 3I0TA 3K0LA 2RGVA 2DQLA 5ERIA 4UVBA 3WTSC 4M9ZA 4ESBA 1WRJA 2FEZA 2WWYA 1GVJA 4R8HA 1FYLA 3K2ZA 5ICCA 2XIGA 5DV5A 1I1SA 1T6SA 2VBYA 3HSEA 2R3SA 1C0WA 3V8KA 1XD7A 3ZMVA 3HSFA 2GWRA 2MLKA 3DFGA 5BPDA 1J59A 2XAHA 4ZYEA 2QZ8A 3O3KA 2HWVA 1FBSA 4MTDA 1BI2A 3RKYA 3OOPA 4HV6A 3IWFA 1STZA 5L3DA 5DUIA 4EGYA 2YPRA 2DPUA 5DCFA 1USTA 1XDSA 2DBBA 2V1XA 5AIPA 1QGPA 4G9YA 4I98B 1V3FA 4CZZA 2IRFG 4ZZLA 3ZMDA 4UXNA 4CO8A 2HZTA 1LDKB 4L0YB 1YW9A 2L01A 4MEXF 1IXSB 3F3XA 1TLHB 1TQMA 2H09A 2QM3A 3M8EA 2FRHA 3C1DA 4IRIA 3MEXA 5J8FA 4EJOA 1ON1A 1RI7A 4Y17A 1FBUA 3N4MA 2EFOA 2VN2A 4EJVA 5LGUA 3RTRA 2EV5A 1YW7A 2VBWA 2FNPA 4RGXA 4HAMA 2QENA 2STWA 1XN7A 3F72A 4L5IA 2RVCA 2B0LA 1ZRCA 3KE2A 4LB6B 5FD6A 3MWMA 2PN6A 3CDHA 1REPC 2F5EA 2W57A 3HHGA 3RIRA 3PQJA 1MJ9A 1BI0A 2OU2A 1R1UA 5BPIA 3IL2A 2OQGA 3GFJA 4P5OA 3NRVA 1G6NA 4WF2A 3BJ6A 3ZQ7A 1YS7A 1Y0UA 4KIFA 1XSVA 4UHTA 4OIPF 5CJ9A 3WTZA 4OIQF 3H3ZA 3O2PE 3V8JA 3QU3A 4S04A 4OINF 1YFHA 5EEHA 2ZBKA 4H0EA 3LQRA 4WCGA 1WWXA 2V6CA 4IHSA 2RN7A 3I53A 3R4KA 4Q4ZF 3MZYA 4IXAA 3HRTA 3H3UA 2VBXA 3K9TA 1OPCA 2VC1A 1SFXA 2D45A 5A2QZ 1Z1DA 3P9KA 1O3SA 2QQAA 1P92A 4L9JA 2JSCA 1GXPA 3LA7A 5D5UB 2FBIA 1GHCA 1IN5A 1J75A 2H6BA 2JZYA 5L3GA 3HHHA 2D2WA 5L3FA 2QQ9A 4EJWA 5ICEA 1HW5A 3MZHA 1BI1A 3E3VA 2UXXA 2FXAA 2PLYA 1TNTA 3F8FA 3IWZA 4TV7A 1R5HA 4HDUA 4HX8A 5L3CA 2HYFA 1TQPA 5AIQA 2R7FA 4BYYA 5IT9Z 1ZLJA 1K78B 4Q48A 3GFLA 4KA4A 4RB1A 1ZRDA 1LDJA 3U1DA 4BHBA 2Z9OA 3R60A 2RQPA 4EM2A 4WK8F 3ZN0A 3ABTA 1YS6A 1U2WA 1SMYF 3FHZA 2D1VA 4AWXB 2KRFA 3F6OA 3AAFA 4OMYA 2F5CA 3EDPA 5D8KB 1D3YA 4U7BA 1FSHA 1U8RA 3E6CC 3F6VA 2V9VA 2V1DA 3LA2A 2X4HA 3W6KB 2NAZA 4YIFA 4G7ZF 1XMAA 1BJAA 2GAUA 2O0YA 2W25A 1O7FA 2KIUA 3MFKA 1IW7F 4IVNA 2CWEA 4LFUA 2FBHA 4MQVA 1Z7UA 1S7AA 2EB7A 1HW1A 3K1MA 1ZYRF 3J81K 2A5YB 1MDMB 2EFQA 3DV8A 3BPVA 2KIFA 1E17A 3F8MA 2RC4A 3LQQA 2HR3A 4I0BA 2BYVE 3SHFA 2K4BA 4HA8A 2PQ8A 3ZMZA 5D5VB 2WC2A 5ED4A 3LA3A 2MH9A 3GZ5A 4PCQA 3D5LA 3NQOA 2BGCA 4GCVA 4LGWA 4XBFA 3IKTA 2P5LC 2LF8A 1I5ZA 2EV0A 4I09A 1YW8A 2DQRA 3BZ6A 1O57A 5IT3A 3FXQA 4HV5A 4O3MA 1MD0A 4P9FA 3MQ0A 5H6QA 1J5YA 5E1ZB 4A12A 2AS5F 2M45A 1IUYA 2EWNA 5JVTA 2O3FA 2VOPA 3LAJA 1R58A 1UFMA 3PFIA 3ZMUA 1FC3A 2IA0A 3VOEA 3HTSB 1RZ4A 1XGNA 3RJPA 4IF4A 3FXRA 3J80Z 1LVAA 4OMZA 3RPQA 4A5MA 1QZYA 2PJPA 5D4SA 3DQVC 1U3EM 3TDUC 1SD4A 2HYGD 2ZMEA 3GVAA 4KT5C 3CLOA 1EV7A 3WODF 2LSOA 1WQ2A 3VODA 2ZJ2A 4CYDA 1BC8C 4Q5SF 4CICA 3H92A 4IRHA 3BY6A 3GFMA 3IRQA 1YTYA 1PP8F 1NHAA 2M30A 3FF5A 3K1NA 5DD4A 4M71A 2O8XA 3CO6C 4KFCA 3FMQA 1KA8A 3KP6A 2CQKA 2FU4A 2ZMEB 4ASNA 2H94A 3CO7C 5H6RA 4O5VA 3TGNA 4G8XA 2M5WA 4A5NA 3SXYA 2XAFA 3L2CA 3RI4A 1RIOH 2FBKA 1R22A 3V4GA 2NNYA 3RYRA 2IJLA 5KVRA 1Z6TA 1CGPA 1T0FA 3BP8A 4MEYF 2MC3A 5DCMA 2GA2A 2YX4A 4HLXA 2DK8A 4A6EA 1B9NA 2R7DA 3F8CA 3WE3A 1JGSA 5CVVA 5BS6A 1H9GA 3V7SA 4KDPA 2PI0A 2ZKZA 2VBZA 4LD5A 5CVJA 3E5XA 4GYIA 3IHUA 2EFNA 3JSPA 4AD9A 4IHTA 1XGOA 2VT3A 3I58A 2QBYB 3QPHA 4N9IA 2FOKA 1XCBA 2IVMA 2V1UA 2XUBA 2OBPA 1DPRA 1SFEA 3VFZA 1W7PA 2EV6A 4BH9A 2XASA 1KU7A 4XSZF 2OZ6A 2VT2A 3HRMA 1PUEE 4GYGA 1OMIA 1USSA 3ML6A 4RB3C 4CDGA 3GFIA 1DPUA 4G6DA 2VONA 2L4MA 1P4WA 3M7GA 3P9IA 4GGGA 1U78A 4FHTA 4GO1A 2OD5A 4HQMA 2G9WA 4R79A 2KJCA 5D6FA 3GO5A 3EUHA 4RGUA 1KQ8A 3TDZC 1QNTA 2TDXA 3SQNA 1W4MA 1VTNC 4S05A 4Y13A 3EQLF 2XROA 2HTJA 2DO7A 5HVQC 1ON2A 4DQ2A 2PMUA 1XGMA 2Y0MA 1IRGA 3ZP5A 4WWCA 3Q9SA 1YO5C 4G7OF 2NNNA 2D1HA 1IZ1A 3FWEA 1BC7C 5L3EA 1DP7P 1ZG3A 3QOPA 1FSEA 1S29A 4BQAA 3CJNA 1ZG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESH A;  2DW4 A;  2DI3 A;  2EFP A;  3G3Z A;  2IT0 A;  1P2F A;  4EGZ A;  3IRR A;  1QPM A;  4ZYH A;  5K1Y A;  2L3D A;  4AVP A;  2XAQ A;  4WXC A;  3SFZ A;  4KYW A;  1FPQ A;  3RDI A;  4IJA A;  5LBQ A;  3TO9 A;  1LDD A;  2PG4 A;  2HTS A;  2FNA A;  4EV0 A;  3DPT A;  5BQT A;  1HQC A;  2OQR A;  1LB2 A;  5HDG A;  1TQI A;  1FT9 A;  3M9A A;  3Q9V A;  5FGM A;  3T8R A;  2K4J A;  3JAM Z;  4LMY A;  4HQE A;  4Q47 A;  2HQR A;  5HDK A;  2XAG A;  2NRA C;  1UB9 A;  3SZT A;  1X3U A;  3KZZ A;  1WSU A;  1XGS A;  3GUD A;  5DDG A;  3KEQ A;  5FLX Z;  5FD5 A;  3ECH A;  4ZYG A;  3IC7 A;  4ETS A;  5FO5 A;  1ZRE A;  3HOS A;  5DUK A;  2OA4 A;  5TJJ A;  1T38 A;  5J8C A;  3REO A;  4OIR F;  3IKV A;  4UVC A;  5JFR A;  1D5V A;  1KYW A;  4L9V A;  3WTV C;  4JBA A;  4HX7 A;  1FLI A;  2DT5 A;  3HTU A;  4A0Y A;  2CG4 A;  3P9C A;  3WG9 A;  5E8I A;  1EH7 A;  2G7H A;  2JTV A;  3LWF A;  1DUX C;  4F7Z A;  2GXG A;  3KLO A;  4KIB A;  1FX7 A;  2FA5 A;  2IA1 A;  4UV8 A;  2O6G E;  1FP1 D;  3PQK A;  2HKO A;  2CFX A;  2P5V A;  5CVR A;  1R23 A;  1HKT A;  2JT1 A;  4G7H F;  4HF0 A;  3RPU A;  2IA2 A;  4HF2 A;  1ULY A;  3W6J B;  4I2O A;  1O7L A;  3JTG A;  3BWG A;  4EMS A;  1Z91 A;  1YLF A;  2Q0O A;  3HOT A;  5FFZ A;  2JPC A;  1LQ1 A;  1ZLK A;  1R1V A;  3I4P A;  4JQF A;  2YU3 A;  4ENN A;  2L54 A;  4KIC A;  4QLC U;  1R00 A;  1P6R A;  2Y75 A;  2MH2 A;  3ABU A;  2E7X A;  3J7A O;  1F1Z A;  1ZGA A;  1B1B A;  2QUF A;  5D5W B;  2VXZ A;  1R7J A;  2QVO A;  1FWZ A;  1FP2 A;  3BRO A;  4RS8 A;  1BN5 A;  3DPL C;  1BM9 A;  2HOE A;  4I01 A;  4B09 A;  1G3T A;  1F4K A;  1FYM A;  4ESJ A;  2UWM A;  5H20 A;  5ILV A;  1IN7 A;  2Z5U A;  4RGS A;  5CVU A;  3V7C A;  3VEP A;  2Z3Y A;  1IN6 A;  5CVI A;  4LJZ F;  1HSJ A;  4YFX F;  1PDN C;  1KU3 A;  3LST A;  4R1H A;  4B8X A;  4LLG F;  4ZZD A;  4G6Q A;  1E2X A;  2VC0 A;  1F5T A;  4ENM A;  1OYI A;  3CUQ C;  1J2X A;  1J0R A;  5EEG A;  4IPA A;  4LG0 A;  1HKQ A;  4YFK F;  3ZMS A;  1IXR C;  1ZHF A;  5ILS A;  3WTU C;  3F8B A;  2DU9 A;  2ZO4 A;  5JI6 A;  3CUO A;  3GXO A;  4GXO A;  1OR7 A;  1OYW A;  2PEX A;  4Z2Y A;  2BBY A;  1KU2 A;  4KNY A;  2DPD A;  3HRS A;  4LK1 F;  4IRG A;  4KN7 X;  5BMZ A;  2EFW A;  2FQ3 A;  2IW5 A;  3DXJ F;  2Z99 A;  1FYK A;  3WTY C;  2Q2E A;  2RDP A;  4EQQ A;  2P6T A;  3L00 A;  4QWQ A;  4OU0 A;  2J5P A;  1WKM A;  1JE8 A;  2MA3 A;  2XAJ A;  2RKH A;  1F9N A;  3QAH A;  1B4A A;  3EYI A;  1Q1H A;  2XVC A;  1ODD A;  2GIV A;  5ICF A;  1KQ9 A;  3EET A;  2WTE A;  3ZPL A;  2GQQ A;  2F5D A;  5D8L B;  1B59 A;  2DFI A;  2YX7 A;  3BJO A;  4U0Y A;  1KU9 A;  2DK5 A;  5HLG A;  1FZP B;  4MQ9 F;  1IN8 A;  3L9F A;  4A0Z A;  3BPX A;  5DEQ A;  1XSD A;  2COM A;  3TO6 A;  1GXQ A;  2EA4 A;  3BOQ A;  1MJA A;  2CSO A;  5LGN A;  2M8E A;  2MBF A;  2F5F A;  3ELK A;  2P7V B;  3FMS A;  2PBI A;  1D8K A;  2BV6 A;  3C7J A;  2W84 A;  3ZN1 A;  4XLP F;  4HF1 A;  3E5Q A;  1UCR A;  3T5X A;  2VOO A;  1U5T C;  2PFB A;  1U6G A;  3J81 Z;  3WGI A;  1DDN A;  3D0S A;  1ZG5 A;  4G94 A;  3QU6 A;  1I6X A;  2K02 A;  4KIG A;  3KP4 A;  1QBJ A;  4EVI A;  2Y48 A;  3DEU A;  1TBX A;  2UXN A;  4KMU X;  2ESN A;  3SZP A;  2QQB A;  1P4A A;  1A04 A;  1JXS A;  5F64 A;  5AON A;  5FB2 A;  4RGR A;  2ACJ A;  2E1N A;  3F21 A;  1HW2 A;  3DP7 A;  3V8L A;  4AIH A;  1U5T A;  4PGG A;  3E6D A;  2STT A;  1JHH A;  3K69 A;  2E7W A;  2G7U A;  4FT8 A;  3QPT A;  1G3Y A;  5DCM B;  1S3J A;  4LB5 A;  2F2E A;  2CGP A;  2VE9 A;  1K79 A;  2A68 F;  3M1E A;  2IPQ X;  2AXL A;  1MKM A;  3M8F A;  3WTT C;  2QWW A;  5K5O A;  1OYY A;  3E5U A;  4CHU A;  5LHG A;  2ZNZ A;  4MGR A;  1FBQ A;  3ZMT A;  4LLL A;  4M9X A;  3HRU A;  4P96 A;  3FZV A;  2PMH A;  2XKO A;  3JTH A;  1JHF A;  1KQ0 A;  3F22 A;  1BI3 A;  5BOX A;  5LLQ A;  2DLL A;  1W7P B;  4AIJ A;  2DAO A;  1OKR A;  4ON0 A;  3KP3 A;  1K7A A;  2FMY A;  1FOK A;  1IF1 A;  3WU0 A;  3U9G A;  4I02 A;  5A2Q K;  5FFX A;  5LHH A;  2ZXJ A;  4FX4 A;  2YSR A;  2A6E F;  2H6C A;  3JW4 A;  4WXD A;  2RV8 A;  1TNS A;  3EYY A;  1LEA A;  1XSX A;  2QYO A;  1W5T A;  3E6M A;  4RB2 C;  4MTE A;  1AOY A;  4HW0 A;  3HUG A;  3I59 A;  4P9U A;  4M74 A;  5IT9 K;  1SFU A;  3B02 A;  2KIM A;  3LFK A;  3FM3 A;  3HYI A;  4UVA A;  4HX4 A;  1O3T A;  5F1R A;  4A0X A;  5TRD A;  1YQA A;  3GX4 X;  2L4A A;  4CXF A;  2VOD A;  4BXU A;  3KP7 A;  3ISP A;  4U0V A;  2A69 F;  1HXD A;  4DNC A;  3KET A;  4NHJ A;  3I59 B;  2HGC A;  1H0M A;  3OV8 A;  2CYY A;  3U2R A;  5LHI A;  3RKX A;  1YG2 A;  2GZW A;  2X0L A;  2M1B A;  1UHW A;  3L09 A;  3V7R A;  2E1C A;  1Z9C A;  1HST A;  1IAW A;  1BOA A;  4LLN A;  3WTX C;  1KYZ A;  1XCV A;  2XV4 S;  1QO0 D;  4EM1 A;  3KP5 A;  4XLN F;  1BIA A;  4ESF A;  1J7K A;  1V4R A;  1SMT A;  2FML A;  1RUN A;  2M87 A;  1D8J A;  1R36 A;  4NQW A;  4U0W A;  5HOO A;  4ENJ A;  3GLX A;  1FY7 A;  3G73 A;  2JRT A;  3QP5 A;  2CW0 F;  2WV0 A;  1G3S A;  2BE5 F;  3TOB A;  1XB4 A;  2RNJ A;  3KZY A;  4L5J A;  2P8T A;  2ZFW A;  1LJ9 A;  2HDC A;  2YR2 A;  1BBY A;  4L9N A;  4BHP A;  4L9T A;  5DD8 A;  1ZH5 A;  1K6O A;  3TO7 A;  4PDK A;  3WGH A;  4M72 A;  1XDU A;  2O03 A;  4RB0 A;  2ZCW A;  4HZF A;  2IP2 A;  2P5K A;  5K5R A;  2MD5 A;  3MCZ A;  4RAY A;  5DYM A;  4O6J A;  5E17 F;  2LKP A;  1K78 A;  1ZAO A;  4ZYD A;  4EM0 B;  1SD5 A;  2QLZ A;  3RKW A;  4UUV A;  4AIK A;  2EA2 A;  5D6E A;  3TQN A;  2P6S A;  3K1P A;  4XRF A;  5D5X B;  5D4R A;  3DF8 A;  3KLN A;  1MGT A;  1MJB A;  5E20 A;  1HBX G;  5J6X A;  1S8N A;  1J9I A;  3I64 A;  5F6F A;  5L3B A;  1KGS A;  3KEO A;  1SD7 A;  2DTR A;  2LDU A;  4WXH A;  3KCC A;  1FNN A;  2A3S A;  1W5S A;  1YYV A;  4FX0 A;  3GYH X;  4ENK A;  1LEB A;  2ADU A;  1SAX A;  2L02 A;  3F8N A;  1B6A A;  2ZNY A;  3J80 K;  2A07 F;  4HDV A;  3KFW X;  2GA1 A;  2KKO A;  1ZAR A;  1UHM A;  2A6H F;  3TOA A;  2ETH A;  4YG2 F;  4M6Y A;  3ERE D;  1T39 A;  4A2U A;  4UNO A;  2UZK A;  2W85 A;  4LK0 F;  2LF7 A;  3C3W A;  3F23 A;  3BJA A;  1MDM A;  3QRF F;  2P4W A;  4L18 B;  3VB2 A;  4KMF A;  3R61 A;  4HYE A;  1G3W A;  1P4X A;  2W24 A;  4HBL A;  3E97 A;  2BEO A;  2ISZ A;  5LRS A;  1TTY A;  3GWZ A;  2MLG A;  3BDD A;  2ELH A;  2LNB A;  4A6D A;  2NYX A;  1IXC A;  4Y15 A;  3JSO A;  3GEZ A;  3NEU A;  2HFH A;  3FXU A;  2OAZ A;  3LAP A;  1XMK A;  1PP7 U;  1QZZ A;  3GW2 A;  4EJT A;  4CGZ A;  1AWC A;  3CTA A;  5ILU A;  3T0Y A;  1S6L A;  3FM5 A;  2XHK A;  1WI9 A;  2GXB A;  3WTW C;  4KN4 X;  5KK1 A;  5JHU A;  2VE8 A;  2HEO A;  2JPB A;  4LG0 B;  3ECO A;  4M6X A;  2H27 A;  3ROU A;  3CUQ A;  5HS9 A;  1IN4 A;  3TKY A;  3N97 A;  2P7C B;  3E6B A;  5CLS A;  2J5O A;  1YIO A;  1I1G A;  1ZRF A;  3ULQ B;  1SD6 A;  5HS8 A;  6PAX A;  1EH8 A;  4YII A;  5HS7 A;  2A61 A;  3R0A A;  4OOI A;  3CUQ B;  3WU1 B;  1EH6 A;  3GF2 A;  5E8G A;  1W7P D;  3C18 A;  1CF7 A;  2XGX A;  4N0B A;  5E1W A;  1L3L A;  5E1X A;  4ZH4 F;  2HQN A;  4I0A A;  1R5G A;  4WX9 A;  4NB5 A;  2XKP A;  3QP6 A;  4JK1 X;  2NS0 A;  4YFN F;  2Q8K A;  1Z05 A;  3P7N A;  3S2W A;  1B9M A;  4M9S A;  3HIF A;  2HS5 A;  1CF7 B;  1LNW A;  2K7L A;  3HSR A;  3WE2 A;  1IRF A;  4KUM A;  5HDN A;  1R1T A;  4N9H A;  2O61 A;  1ONV A;  4BHC A;  4XSX F;  3R0J A;  3I71 A;  3FMR A;  1L0O C;  3O6B B;  5E18 F;  3DKW A;  5LEK A;  2C6Y A;  2FE3 A;  1ZGJ A;  1RNL A;  2FF4 A;  5JR3 A;  4P55 A;  4RAZ A;  1QQI A;  1T2K A;  3COA C;  2HKX A;  1MZB A;  4HOB A;  4EJU A;  1Z6R A;  2KJB A;  1H9T A;  4BNC A;  5K5Q A;  1RUO A;  3T8T A;  1I27 A;  4U7D A;  3KP2 A;  2CO5 A;  3Q5F A;  2XRN A;  2Z33 A;  1ZN2 A;  4MHG A;  2K86 A;  4L0Z B;  1TW3 A;  2EK5 A;  4HLY A;  1G4D A;  1BIB A;  3MAJ A;  4U88 A;  5LGT A;  5CYV A;  1O3R A;  1TW2 A;  4PZJ A;  1T98 A;  2QBY A;  5LRR A;  1S7O A;  5LEJ A;  4UV9 A;  1O3Q A;  4K2E A;  4D0P A;  1HKS A;  4PGH A;  4MNU A;  3R6S A;  3L7W A;  3JAM K;  4I7H A;  3I54 A;  5HLH A;  5ICG A;  2EJR A;  3GZ6 A;  5HLI A;  3RYP A;  2V79 A;  1U5T B;  4OIO F;  2K27 A;  2ISY A;  4E70 A;  2OZU A;  3I5U A;  4BAY A;  3WGG A;  4M73 A;  2FSW A;  5FLX K;  3B73 A;  3T1B A;  3FX3 A;  3I0T A;  3K0L A;  2RGV A;  2DQL A;  5ERI A;  4UVB A;  3WTS C;  4M9Z A;  4ESB A;  1WRJ A;  2FEZ A;  2WWY A;  1GVJ A;  4R8H A;  1FYL A;  3K2Z A;  5ICC A;  2XIG A;  5DV5 A;  1I1S A;  1T6S A;  2VBY A;  3HSE A;  2R3S A;  1C0W A;  3V8K A;  1XD7 A;  3ZMV A;  3HSF A;  2GWR A;  2MLK A;  3DFG A;  5BPD A;  1J59 A;  2XAH A;  4ZYE A;  2QZ8 A;  3O3K A;  2HWV A;  1FBS A;  4MTD A;  1BI2 A;  3RKY A;  3OOP A;  4HV6 A;  3IWF A;  1STZ A;  5L3D A;  5DUI A;  4EGY A;  2YPR A;  2DPU A;  5DCF A;  1UST A;  1XDS A;  2DBB A;  2V1X A;  5AIP A;  1QGP A;  4G9Y A;  4I98 B;  1V3F A;  4CZZ A;  2IRF G;  4ZZL A;  3ZMD A;  4UXN A;  4CO8 A;  2HZT A;  1LDK B;  4L0Y B;  1YW9 A;  2L01 A;  4MEX F;  1IXS B;  3F3X A;  1TLH B;  1TQM A;  2H09 A;  2QM3 A;  3M8E A;  2FRH A;  3C1D A;  4IRI A;  3MEX A;  5J8F A;  4EJO A;  1ON1 A;  1RI7 A;  4Y17 A;  1FBU A;  3N4M A;  2EFO A;  2VN2 A;  4EJV A;  5LGU A;  3RTR A;  2EV5 A;  1YW7 A;  2VBW A;  2FNP A;  4RGX A;  4HAM A;  2QEN A;  2STW A;  1XN7 A;  3F72 A;  4L5I A;  2RVC A;  2B0L A;  1ZRC A;  3KE2 A;  4LB6 B;  5FD6 A;  3MWM A;  2PN6 A;  3CDH A;  1REP C;  2F5E A;  2W57 A;  3HHG A;  3RIR A;  3PQJ A;  1MJ9 A;  1BI0 A;  2OU2 A;  1R1U A;  5BPI A;  3IL2 A;  2OQG A;  3GFJ A;  4P5O A;  3NRV A;  1G6N A;  4WF2 A;  3BJ6 A;  3ZQ7 A;  1YS7 A;  1Y0U A;  4KIF A;  1XSV A;  4UHT A;  4OIP F;  5CJ9 A;  3WTZ A;  4OIQ F;  3H3Z A;  3O2P E;  3V8J A;  3QU3 A;  4S04 A;  4OIN F;  1YFH A;  5EEH A;  2ZBK A;  4H0E A;  3LQR A;  4WCG A;  1WWX A;  2V6C A;  4IHS A;  2RN7 A;  3I53 A;  3R4K A;  4Q4Z F;  3MZY A;  4IXA A;  3HRT A;  3H3U A;  2VBX A;  3K9T A;  1OPC A;  2VC1 A;  1SFX A;  2D45 A;  5A2Q Z;  1Z1D A;  3P9K A;  1O3S A;  2QQA A;  1P92 A;  4L9J A;  2JSC A;  1GXP A;  3LA7 A;  5D5U B;  2FBI A;  1GHC A;  1IN5 A;  1J75 A;  2H6B A;  2JZY A;  5L3G A;  3HHH A;  2D2W A;  5L3F A;  2QQ9 A;  4EJW A;  5ICE A;  1HW5 A;  3MZH A;  1BI1 A;  3E3V A;  2UXX A;  2FXA A;  2PLY A;  1TNT A;  3F8F A;  3IWZ A;  4TV7 A;  1R5H A;  4HDU A;  4HX8 A;  5L3C A;  2HYF A;  1TQP A;  5AIQ A;  2R7F A;  4BYY A;  5IT9 Z;  1ZLJ A;  1K78 B;  4Q48 A;  3GFL A;  4KA4 A;  4RB1 A;  1ZRD A;  1LDJ A;  3U1D A;  4BHB A;  2Z9O A;  3R60 A;  2RQP A;  4EM2 A;  4WK8 F;  3ZN0 A;  3ABT A;  1YS6 A;  1U2W A;  1SMY F;  3FHZ A;  2D1V A;  4AWX B;  2KRF A;  3F6O A;  3AAF A;  4OMY A;  2F5C A;  3EDP A;  5D8K B;  1D3Y A;  4U7B A;  1FSH A;  1U8R A;  3E6C C;  3F6V A;  2V9V A;  2V1D A;  3LA2 A;  2X4H A;  3W6K B;  2NAZ A;  4YIF A;  4G7Z F;  1XMA A;  1BJA A;  2GAU A;  2O0Y A;  2W25 A;  1O7F A;  2KIU A;  3MFK A;  1IW7 F;  4IVN A;  2CWE A;  4LFU A;  2FBH A;  4MQV A;  1Z7U A;  1S7A A;  2EB7 A;  1HW1 A;  3K1M A;  1ZYR F;  3J81 K;  2A5Y B;  1MDM B;  2EFQ A;  3DV8 A;  3BPV A;  2KIF A;  1E17 A;  3F8M A;  2RC4 A;  3LQQ A;  2HR3 A;  4I0B A;  2BYV E;  3SHF A;  2K4B A;  4HA8 A;  2PQ8 A;  3ZMZ A;  5D5V B;  2WC2 A;  5ED4 A;  3LA3 A;  2MH9 A;  3GZ5 A;  4PCQ A;  3D5L A;  3NQO A;  2BGC A;  4GCV A;  4LGW A;  4XBF A;  3IKT A;  2P5L C;  2LF8 A;  1I5Z A;  2EV0 A;  4I09 A;  1YW8 A;  2DQR A;  3BZ6 A;  1O57 A;  5IT3 A;  3FXQ A;  4HV5 A;  4O3M A;  1MD0 A;  4P9F A;  3MQ0 A;  5H6Q A;  1J5Y A;  5E1Z B;  4A12 A;  2AS5 F;  2M45 A;  1IUY A;  2EWN A;  5JVT A;  2O3F A;  2VOP A;  3LAJ A;  1R58 A;  1UFM A;  3PFI A;  3ZMU A;  1FC3 A;  2IA0 A;  3VOE A;  3HTS B;  1RZ4 A;  1XGN A;  3RJP A;  4IF4 A;  3FXR A;  3J80 Z;  1LVA A;  4OMZ A;  3RPQ A;  4A5M A;  1QZY A;  2PJP A;  5D4S A;  3DQV C;  1U3E M;  3TDU C;  1SD4 A;  2HYG D;  2ZME A;  3GVA A;  4KT5 C;  3CLO A;  1EV7 A;  3WOD F;  2LSO A;  1WQ2 A;  3VOD A;  2ZJ2 A;  4CYD A;  1BC8 C;  4Q5S F;  4CIC A;  3H92 A;  4IRH A;  3BY6 A;  3GFM A;  3IRQ A;  1YTY A;  1PP8 F;  1NHA A;  2M30 A;  3FF5 A;  3K1N A;  5DD4 A;  4M71 A;  2O8X A;  3CO6 C;  4KFC A;  3FMQ A;  1KA8 A;  3KP6 A;  2CQK A;  2FU4 A;  2ZME B;  4ASN A;  2H94 A;  3CO7 C;  5H6R A;  4O5V A;  3TGN A;  4G8X A;  2M5W A;  4A5N A;  3SXY A;  2XAF A;  3L2C A;  3RI4 A;  1RIO H;  2FBK A;  1R22 A;  3V4G A;  2NNY A;  3RYR A;  2IJL A;  5KVR A;  1Z6T A;  1CGP A;  1T0F A;  3BP8 A;  4MEY F;  2MC3 A;  5DCM A;  2GA2 A;  2YX4 A;  4HLX A;  2DK8 A;  4A6E A;  1B9N A;  2R7D A;  3F8C A;  3WE3 A;  1JGS A;  5CVV A;  5BS6 A;  1H9G A;  3V7S A;  4KDP A;  2PI0 A;  2ZKZ A;  2VBZ A;  4LD5 A;  5CVJ A;  3E5X A;  4GYI A;  3IHU A;  2EFN A;  3JSP A;  4AD9 A;  4IHT A;  1XGO A;  2VT3 A;  3I58 A;  2QBY B;  3QPH A;  4N9I A;  2FOK A;  1XCB A;  2IVM A;  2V1U A;  2XUB A;  2OBP A;  1DPR A;  1SFE A;  3VFZ A;  1W7P A;  2EV6 A;  4BH9 A;  2XAS A;  1KU7 A;  4XSZ F;  2OZ6 A;  2VT2 A;  3HRM A;  1PUE E;  4GYG A;  1OMI A;  1USS A;  3ML6 A;  4RB3 C;  4CDG A;  3GFI A;  1DPU A;  4G6D A;  2VON A;  2L4M A;  1P4W A;  3M7G A;  3P9I A;  4GGG A;  1U78 A;  4FHT A;  4GO1 A;  2OD5 A;  4HQM A;  2G9W A;  4R79 A;  2KJC A;  5D6F A;  3GO5 A;  3EUH A;  4RGU A;  1KQ8 A;  3TDZ C;  1QNT A;  2TDX A;  3SQN A;  1W4M A;  1VTN C;  4S05 A;  4Y13 A;  3EQL F;  2XRO A;  2HTJ A;  2DO7 A;  5HVQ C;  1ON2 A;  4DQ2 A;  2PMU A;  1XGM A;  2Y0M A;  1IRG A;  3ZP5 A;  4WWC A;  3Q9S A;  1YO5 C;  4G7O F;  2NNN A;  2D1H A;  1IZ1 A;  3FWE A;  1BC7 C;  5L3E A;  1DP7 P;  1ZG3 A;  3QOP A;  1FSE A;  1S29 A;  4BQA A;  3CJN A;  1ZG1 A; 
#chains in the Genus database with same CATH topology
 3CME I;  2ESH A;  2DW4 A;  1FOW A;  2DI3 A;  2DTZ A;  5E3O A;  2EFP A;  2BW3 B;  3A03 A;  3G3Z A;  2IT0 A;  1P2F A;  4EGZ A;  3IRR A;  1QPM A;  1X4O A;  1VQ6 I;  4ZYH A;  5K1Y A;  2L3D A;  4AVP A;  4XM3 A;  3D5S C;  3H0D A;  3E1S A;  3K2A A;  2XAQ A;  4WXC A;  3SFZ A;  4KYW A;  1FPQ A;  3RDI A;  4IJA A;  3CCR I;  5LBQ A;  2JUG A;  4C30 A;  2WAD A;  3TO9 A;  3GME A;  1LDD A;  2AQE A;  2PG4 A;  2HTS A;  3HOY J;  4KT6 A;  3LFU A;  3QPS A;  3CCL I;  2FNA A;  4EV0 A;  1HOM A;  5J1U A;  3DPT A;  5BQT A;  3HOU J;  2BXY A;  4DBR A;  1XC5 A;  3AG2 H;  1HQC A;  1R4M B;  2OQR A;  1LB2 A;  4B47 A;  5HDG A;  1TQI A;  3HJE A;  1FT9 A;  3M9A A;  4CH7 A;  5B66 C;  2L2O A;  3OYM A;  3Q9V A;  2IS4 A;  3KYL A;  3BQZ A;  5FGM A;  3T8R A;  2K4J A;  2DMP A;  3JAM Z;  4LMY A;  5K7F A;  2DOF A;  2ZB9 A;  4HQE A;  2X51 A;  3ASN H;  4Q47 A;  5DS9 A;  2HXO A;  2VXD A;  3K4N A;  2HQR A;  5HDK A;  2XAG A;  2NRA C;  1UB9 A;  5K7H A;  2NVT J;  4NNJ A;  3SZT A;  1X3U A;  3MKY B;  2OJE D;  3KZZ A;  2GLO A;  3J7Z I;  1WSU A;  1XGS A;  3GUD A;  5IP7 J;  1LE8 A;  3ZQI A;  4XKW A;  5DDG A;  3CC4 I;  1M1E B;  2DN0 A;  2ZFU A;  3KEQ A;  1JTY A;  1HC8 A;  5FLX Z;  5FD5 A;  4KIT B;  1I6H J;  3ECH A;  4ZYG A;  3I56 I;  3IC7 A;  4ETS A;  2A05 A;  1Y1W J;  4X6A J;  4IEJ A;  4CSW A;  1LVK A;  5FO5 A;  1ZRE A;  4CYC A;  3HOS A;  5DUK A;  1ETW A;  3FIW A;  3QYE A;  1MMN A;  4CZC A;  5HNF A;  2OA4 A;  5TJJ A;  1T38 A;  2XC7 A;  3FK7 A;  5J8C A;  3REO A;  4OIR F;  4J01 A;  3IKV A;  2KQR A;  4UVC A;  3HOV J;  5JFR A;  1GV5 A;  1OCO H;  3NAR A;  1KYW A;  4L9V A;  1W0T A;  2H8W A;  3WTV C;  1D5V A;  4Y4R A;  1I3Q J;  4JBA A;  4BQN A;  4HX7 A;  1FLI A;  2Y9Z A;  1LE8 B;  3VYR B;  2DT5 A;  2XGD A;  3HTU A;  1MSF C;  2MW8 A;  1W36 D;  4A0Y A;  2CG4 A;  1N75 A;  2E36 A;  3P9C A;  3WG9 A;  5E8I A;  1WH5 A;  1EH7 A;  2G7H A;  2JK3 A;  2JTV A;  3LWF A;  4NC7 A;  3S3M A;  4RAG A;  1DUX C;  4F7Z A;  5B3S H;  5CKT A;  2Y31 A;  4PJJ A;  2GXG A;  1YIT I;  4C2T A;  3BR5 A;  5J4V A;  3KLO A;  4KIB A;  1FX7 A;  2FA5 A;  2IA1 A;  4CYC B;  4UV8 A;  4E6K G;  2O6G E;  1FP1 D;  3PQK A;  2X85 A;  2HKO A;  4IOC F;  1VQ5 I;  2CFX A;  4F92 B;  5F0F A;  2BY0 A;  2P5V A;  2V6E A;  5CVR A;  1R23 A;  2X1D A;  2XSJ C;  1HKT A;  4PSW A;  3MKW B;  2R7Z J;  2E35 A;  2JT1 A;  2R7X A;  4G7H F;  4HF0 A;  3RPU A;  1YRN A;  2K9M A;  4PJ0 C;  2IA2 A;  4HF2 A;  4F91 B;  1Y39 A;  1K61 A;  1ULY A;  3W6J B;  4I2O A;  1O7L A;  3JTG A;  3BWG A;  3NAU A;  4V19 K;  4EMS A;  3A1Y A;  4XMY A;  1Z91 A;  4NDL A;  1YLF A;  2Q0O A;  3HOT A;  3CJQ B;  3JRA A;  5FFZ A;  2JPC A;  1LQ1 A;  1MMG A;  1ZLK A;  1R1V A;  1V54 H;  3I4P A;  1H89 C;  4JQF A;  3IUO A;  2YU3 A;  4ENN A;  2L54 A;  4KIC A;  2XDV A;  4QLC U;  1R00 A;  1P6R A;  2Y75 A;  1PJR A;  4MIM A;  3BZK A;  1S72 I;  2ZJR F;  2ID6 A;  1GDT A;  3K7A J;  4A3C J;  2MH2 A;  3ABU A;  2E7X A;  3J7A O;  3PUF A;  2NVQ J;  1F1Z A;  1ZGA A;  3ZQF A;  5FJ8 J;  1B1B A;  1Z67 A;  4XNF A;  2EIK H;  2QUF A;  5D5W B;  2VXZ A;  2IEK A;  2DOA A;  1P7J A;  4DIQ A;  3G71 I;  5EG0 A;  2VJI A;  2VJ4 A;  3A01 A;  4AID A;  3GTJ J;  2TRT A;  3L2U A;  1R7J A;  2QVO A;  1VQ7 I;  1FWZ A;  2B63 J;  2CQQ A;  4IHW A;  1FP2 A;  3BRO A;  4RS8 A;  1VF9 A;  1BN5 A;  3DPL C;  3Q0V A;  3G4S I;  1BM9 A;  2HOE A;  3FBN B;  4I01 A;  1AU7 A;  2V9P A;  1ZEL A;  4B09 A;  3OYE A;  1G3T A;  1F4K A;  1FYM A;  2JQ7 A;  4ESJ A;  2DXI A;  1D0Y A;  5H20 A;  3CF5 F;  2UWM A;  5ILV A;  1IN7 A;  2Z5U A;  4RGS A;  5CVU A;  4XIC A;  5EG0 B;  3V7C A;  3VEP A;  2Z3Y A;  2DA4 A;  1IN6 A;  5CVI A;  1N77 A;  4LJZ F;  2XPV A;  2CFO A;  3PSI A;  1HSJ A;  1I50 J;  3W6V A;  4YFX F;  4HST A;  1PDN C;  1BR1 A;  1KU3 A;  1OR7 C;  3LST A;  2Q1Z B;  4R1H A;  2HPM A;  2B9S A;  4B8X A;  4XK4 A;  2XB5 A;  3W2W A;  3JRE A;  4LLG F;  2EZL A;  4ZZD A;  1XS9 A;  4G6Q A;  1E2X A;  2DFF A;  2ZJQ F;  2LR8 A;  2VC0 A;  1F5T A;  2W48 A;  5FKO A;  2M0M A;  1MBJ A;  1OYI A;  4ENM A;  3CLQ A;  2O5R A;  2R7Q A;  1I39 A;  3CUQ C;  3AG4 H;  1OQY A;  3GCM A;  1J2X A;  1J0R A;  5EEG A;  4IPA A;  4LG0 A;  4PJM A;  3B6A A;  4B43 A;  1VQL I;  1MH3 A;  1RC9 A;  1HKQ A;  2LMD A;  3BR6 A;  4YFK F;  2BVM A;  3ZMS A;  2XF5 A;  3IP4 B;  1IXR C;  1X4P A;  1ZHF A;  5ILS A;  3WTU C;  3F8B A;  2DU9 A;  1KZH A;  4XKB A;  2ZO4 A;  5C3E J;  1TZL A;  3AG3 H;  3QYF A;  5CPR B;  1X1C A;  3ABL H;  5JI6 A;  2R92 J;  3CUO A;  3DKY A;  3GXO A;  1XPX A;  5DM7 F;  4GXO A;  3LSH A;  2IGK A;  3ZQH A;  1OR7 A;  4DZP A;  1OYW A;  2PEX A;  4Z2Y A;  2BBY A;  1KU2 A;  4KNY A;  2BOL A;  3HRS A;  2DPD A;  4LK1 F;  4IRG A;  4KN7 X;  5BMZ A;  2EFW A;  2FQ3 A;  2IW5 A;  3OIQ A;  3DXJ F;  3QWL A;  3PO2 J;  2Z99 A;  1FYK A;  3WTY C;  2Q2E A;  2RDP A;  3DTK A;  2P6T A;  4IQ4 A;  3L00 A;  4YEL A;  4EQQ A;  5J1Y A;  4QWQ A;  1MBE A;  3CQZ J;  4OU0 A;  2NVU B;  3KX2 A;  2HU9 A;  4CCL A;  2J5P A;  1WKM A;  1EF4 A;  1JE8 A;  2MA3 A;  2XAJ A;  2RKH A;  1F9N A;  1QVU A;  3QAH A;  4D1Q A;  1B4A A;  3EYI A;  5E3M A;  1B8I A;  4D5F A;  2L5Q A;  5F08 A;  3H35 A;  4CUG A;  1Q1H A;  3GTK J;  2XVC A;  3K70 D;  1ODD A;  1Y8R B;  3ESW B;  2GIV A;  5ICF A;  1KQ9 A;  5GPC A;  1UJ8 A;  3EET A;  3ERM A;  2WTE A;  3S2D J;  3ZPL A;  2GQQ A;  2F5D A;  1GV2 A;  5D8L B;  2KIQ A;  1B59 A;  1A35 A;  2LG4 A;  3FDY A;  2DFI A;  4JX6 A;  1JKR C;  3MKL A;  2WAQ A;  4PUS A;  2YX7 A;  4BQO A;  2Q2E B;  4ZTJ A;  3FIS A;  1VQN I;  4G6T B;  2CV1 A;  1ETK A;  3BJO A;  2NVY J;  4U0Y A;  1KU9 A;  2DK5 A;  1K4T A;  3J7A Y;  5HLG A;  1FZP B;  1VQ8 I;  1SEU A;  1PVE A;  1MBF A;  2BZT A;  1IDZ A;  4MQ9 F;  3CDI A;  4PK4 A;  2IGM A;  1IN8 A;  3L9F A;  4A0Z A;  2CV2 A;  1ETY A;  3BPX A;  5J1R A;  2W1O A;  1B8I B;  1AKH A;  4BDZ A;  1WHU A;  4X0G A;  5EGO A;  2CMP A;  5DEQ A;  1XSD A;  2COM A;  3JRD A;  3TO6 A;  1GXQ A;  2EA4 A;  3CP2 A;  3BOQ A;  3HPH A;  5FKK A;  1MJA A;  2CSO A;  5LGN A;  2M8E A;  2M4K A;  2MBF A;  4IOA F;  2F5F A;  4E7I A;  3S15 J;  3S1R J;  3ELK A;  4BAC A;  2P7V B;  3FMS A;  2PBI A;  5E3L A;  1D8K A;  1HA8 A;  2BV6 A;  3C7J A;  2W84 A;  2X6W A;  2YUS A;  3ZN1 A;  4XLP F;  3QQA A;  4HF1 A;  4P1W A;  2CRG A;  2R7O A;  1R4N B;  3E5Q A;  5C4J J;  2W7N A;  1UCR A;  1WFX A;  1VQ9 I;  1F36 A;  3S14 J;  4A3F J;  3T5X A;  1AKH B;  2VOO A;  2F6C A;  4M3B A;  1U5T C;  2VKV A;  2PFB A;  1U6G A;  3G2B A;  5DM6 F;  2WY8 Q;  3J81 Z;  2AO9 A;  3WGI A;  2AHQ A;  2HQA A;  4AUX A;  1TC3 C;  1DDN A;  2KDZ A;  4I6Z A;  3CF2 A;  4BJ6 C;  3D0S A;  1NH3 A;  3OMY A;  1D1C A;  1ZG5 A;  3PSF A;  4GRI A;  3HEF A;  3DLA A;  4G94 A;  3QU6 A;  1I6X A;  2K02 A;  1AA7 A;  2KZG A;  3KP4 A;  4KIG A;  4EVI A;  2Y48 A;  1R71 A;  1QBJ A;  3DEU A;  3SEQ A;  4DYQ A;  1KON A;  1TBX A;  2UXN A;  3M8J A;  1QHG A;  3O8H A;  4KMU X;  2ESN A;  3SZP A;  1K6Y A;  2QQB A;  1P4A A;  5HOD A;  1A04 A;  2A6T A;  1FOY A;  4A93 J;  1JXS A;  5F64 A;  4C2M J;  5AON A;  2M9H A;  5FB2 A;  2VPR A;  2V9K A;  2MSY A;  4RGR A;  2ACJ A;  2E1N A;  1EA3 A;  2DMU A;  5GP9 A;  3F21 A;  3CCS I;  4A3M J;  1JKO C;  1IV6 A;  2UV1 A;  1RRJ A;  2DT6 A;  1HW2 A;  3DP7 A;  3TED A;  3FXO A;  3V8L A;  5C4X J;  2OPT A;  2LP0 A;  4IX7 A;  3HXL A;  1GLN A;  3KIO A;  1YX5 A;  4AIH A;  1U5T A;  4C3H J;  1WGX A;  4PGG A;  3E6D A;  2STT A;  1Z0X A;  1JHH A;  4DW6 A;  3K69 A;  1TT5 B;  1YI2 I;  2E7W A;  2G7U A;  3L1P A;  5EZG A;  2DA1 A;  4FT8 A;  3SEZ A;  3QPT A;  1G3Y A;  5DCM B;  4BXF A;  5B1A H;  1S3J A;  4LB5 A;  2F2E A;  2CGP A;  2VE9 A;  1K79 A;  2A68 F;  2OCC H;  3M1E A;  2IPQ X;  1ZGW A;  3OSG A;  1FIA A;  1UZC A;  2DA6 A;  2K40 A;  2DA7 A;  2AXL A;  3Q3S A;  1DU0 A;  2JA5 J;  4XKV A;  1MKM A;  2FJ1 A;  2XPW A;  3M8F A;  3WTT C;  2QWW A;  4JYK A;  5K5O A;  1OYY A;  5B5E C;  3E5U A;  5J40 A;  2IGN A;  4CHU A;  5LHG A;  4HSR A;  1LUJ B;  1HDP A;  1JT0 A;  2WA0 A;  3FHN A;  3BR1 A;  3DKX A;  2ZNZ A;  4IHX A;  4MGR A;  1FBQ A;  3ZMT A;  4LLL A;  4M9X A;  3S1Q J;  4BU2 A;  3Q0W A;  3HRU A;  4P96 A;  3FZV A;  2PMH A;  4BE0 A;  2XKO A;  3JTH A;  1MMA A;  2BVL A;  3DLL F;  1MSE C;  1JHF A;  3AG1 H;  1KQ0 A;  4DGW B;  3F22 A;  1BI3 A;  2XB0 X;  5BOX A;  1NK2 P;  4FAS D;  5LLQ A;  4XLC A;  2DLL A;  1W7P B;  2DMN A;  4AIJ A;  4UUS B;  1RES A;  1IRZ A;  2DAO A;  3GLL A;  1OKR A;  2K85 A;  4ON0 A;  3KP3 A;  1K7A A;  2FMY A;  1FOK A;  2WB1 N;  1V5G A;  3S93 A;  1IF1 A;  4D5C A;  4Y7N J;  3BLY A;  3WU0 A;  1R6R A;  3EUA A;  3U9G A;  2HZD A;  3ZRG A;  4KIS A;  4CCK A;  4EAT A;  4I02 A;  2O9L A;  5A2Q K;  4II3 A;  5FFX A;  3GTG J;  1FMW A;  5LHH A;  1A5J A;  2ZXJ A;  4FX4 A;  1Z3Y A;  3WG7 H;  2YSR A;  1BJZ A;  2A6E F;  2H6C A;  3JW4 A;  2LH9 A;  4WXD A;  4RLQ A;  2L7Z A;  2L7M P;  2RV8 A;  3HL2 A;  1TNS A;  2M0C A;  3EYY A;  1LEA A;  1ETQ A;  1XSX A;  5IYC J;  2QYO A;  1W5T A;  3E6M A;  3HGG A;  4RB2 C;  4MTE A;  1AOY A;  1UG2 A;  3G1M A;  3RPU D;  4HW0 A;  3HUG A;  3VYT B;  4RLF A;  1RKW A;  2R4G A;  3I59 A;  1WJC A;  4P9U A;  4M74 A;  2TCT A;  2LBF A;  5IT9 K;  1SFU A;  3B02 A;  2KIM A;  4DBQ A;  3LFK A;  2FOW A;  2VJ5 A;  3FXJ A;  3VWB A;  1LKX A;  3BR2 A;  3FM3 A;  3HYI A;  3BR3 A;  2E2H J;  3OYD A;  4UVA A;  2EQR A;  4HX4 A;  1O3T A;  2LC2 A;  5F1R A;  1X1D A;  2L0K A;  4MFE A;  3G1L A;  2N8G A;  4A0X A;  3BR0 A;  5TRD A;  4M3G A;  3LSJ A;  1WJB A;  1YQA A;  2QSG X;  3GX4 X;  2L4A A;  4UUT A;  1SC7 A;  1MBG A;  5JLW A;  4CXF A;  1WJF A;  2VOD A;  4BXU A;  1JGG A;  3KP7 A;  3ISP A;  1RET A;  2EIJ H;  4U0V A;  1MMD A;  2A69 F;  1HXD A;  3HUG B;  4DNC A;  3KET A;  4NHJ A;  2DJI A;  2F48 A;  3I59 B;  2QQ8 A;  1BR4 A;  2HGC A;  1H0M A;  3OV8 A;  1ETO A;  2CYY A;  3U2R A;  5LHI A;  4FTH A;  2LBF B;  3RKX A;  1YG2 A;  1OLT A;  2QF7 A;  5M3M J;  2GZW A;  2X0L A;  1IC8 A;  3H36 A;  2M1B A;  1UHW A;  3L09 A;  1OJL A;  2OCE A;  3V7R A;  2E1C A;  5CQG A;  1Z9C A;  2M8G X;  1HST A;  1IAW A;  1BOA A;  5M5Y J;  4LLN A;  1OCZ H;  2JMW A;  2NS7 A;  2YU9 J;  5FKM A;  3WTX C;  3GTL J;  1KYZ A;  3MMY B;  1XCV A;  2HOA A;  2XV4 S;  1QO0 D;  4EM1 A;  2IS2 A;  2BHZ A;  3KP5 A;  4XLN F;  4BJT A;  3H5R A;  1BIA A;  2L7K A;  3A2K A;  3HKZ N;  4ESF A;  1J7K A;  1V4R A;  1SMT A;  2FML A;  1RUN A;  3GTO J;  4F3Q A;  2Y0S N;  2M87 A;  1ORK A;  3DEE A;  4BGD A;  1D8J A;  1B72 A;  4BUP A;  1R36 A;  4NQW A;  4U0W A;  3LSK A;  3OS2 A;  5HOO A;  5IYD J;  4ENJ A;  3HB9 A;  1A6Q A;  4BDY A;  1V5F A;  3GLX A;  5KNL A;  2F4I A;  1FY7 A;  4ZDL A;  1TWG J;  2I10 A;  2JRT A;  2LTP A;  3G73 A;  2VKD A;  1JT6 A;  3QP5 A;  2CW0 F;  4F52 A;  1MMS A;  2WV0 A;  2R7U A;  1YE9 A;  2WB1 A;  2VQC A;  1G3S A;  2R93 J;  2BE5 F;  3TOB A;  2FD5 A;  3M3Y J;  4Y52 J;  1XB4 A;  2RNJ A;  2LOO A;  3KZY A;  4L5J A;  2XF6 A;  1UHS A;  2P8T A;  2ZFW A;  2W82 A;  2E1M C;  3KZI C;  1LJ9 A;  1BW6 A;  2HDC A;  1R9T J;  2YR2 A;  1BBY A;  1BA5 A;  3H5A A;  4L9N A;  4L9T A;  2M34 A;  5DD8 A;  4BHP A;  1ZH5 A;  1K6O A;  1B72 B;  4NQW B;  3ZQC A;  3TO7 A;  2WV1 A;  4PDK A;  3WGH A;  2L9S A;  4M72 A;  3MD2 A;  1XDU A;  2O03 A;  4RB0 A;  2ZCW A;  1R5I D;  4HZF A;  2IP2 A;  2R7T A;  2P5K A;  5K5R A;  4OAZ A;  3PIO F;  3NWT A;  2MD5 A;  1YOV B;  2E71 A;  1WJD A;  3MCZ A;  4RDU A;  4OAY A;  5LFA A;  3X2Q H;  4RAY A;  3I55 I;  2LKX A;  5EJC A;  5DYM A;  3EPZ A;  3OR1 C;  4O6J A;  5E17 F;  2LKP A;  1K78 A;  2K5C A;  1ZAO A;  1UG0 A;  2I8D A;  3OIO A;  4ZYD A;  1MBH A;  4EM0 B;  3I4N J;  1SD5 A;  4ZDP A;  2QLZ A;  2ELK A;  3RKW A;  2VQH A;  4UUV A;  3MVP A;  4AIK A;  2EA2 A;  3VSL A;  1QZE A;  5D6E A;  3TQN A;  3TBI A;  2KHM A;  2P6S A;  3K1P A;  3PNY A;  4QIW N;  2R7S A;  4XRF A;  5D5X B;  4J00 A;  5D4R A;  1QVT A;  2JVH A;  3DF8 A;  3KLN A;  1MGT A;  2QA4 I;  1SFO J;  1MJB A;  5E20 A;  3K4L A;  4E7S A;  1HBX G;  5J6X A;  2E5N A;  1S8N A;  1J9I A;  3I64 A;  5F6F A;  5L3B A;  2H1K A;  3K4M A;  1KGS A;  3CDL A;  3KEO A;  1SD7 A;  2DTR A;  2LDU A;  3OYF A;  5JLX A;  4FE7 A;  4WXH A;  4W97 A;  3KCC A;  1FNN A;  1YRN B;  2ZJP F;  4BS9 A;  2A3S A;  1W5S A;  1YYV A;  3DBR B;  3EUK L;  4FX0 A;  4JX4 A;  3D5R C;  3GYH X;  4YRV A;  4ENK A;  1WPK A;  4DYR A;  1LEB A;  4JOM A;  2R0Q C;  2ADU A;  1T56 A;  2NVX J;  1D1A A;  4RAF A;  1SAX A;  1T95 A;  2WY7 Q;  3H9J A;  4AC0 A;  1HF0 A;  1PUF A;  2L02 A;  1JKQ C;  1VQ4 I;  3F8N A;  2E1M B;  1DP3 A;  2VLA A;  1B6A A;  2ZNY A;  4BXX J;  2LY9 A;  5FLV A;  3J80 K;  1FTZ A;  2A07 F;  2QGU A;  4HDV A;  2IGO A;  3KFW X;  2ZC2 A;  2GA1 A;  2KKO A;  1ZAR A;  1UHM A;  4Z6Y A;  1D1B A;  2A6H F;  3TW6 A;  3TOA A;  2X1E A;  3ZCO A;  2ETH A;  3RCO A;  4B4C A;  4YG2 F;  3PIP F;  1W36 C;  2EPF A;  4M6Y A;  3ERE D;  3SDG A;  1ACI A;  3BTJ A;  1T39 A;  4A2U A;  3DTI A;  4UNO A;  1QRY A;  1DGR M;  3F0C A;  3HKZ A;  2UZK A;  4LIT A;  2W85 A;  1ITY A;  1FJL A;  4LK0 F;  4H4K C;  2LF7 A;  3A01 B;  2CUE A;  3C3W A;  2ME6 A;  3F23 A;  4BE2 A;  3BJA A;  1BW5 A;  2DA2 A;  1MDM A;  1Z7L A;  3QRF F;  1APL C;  2P4W A;  4L18 B;  4HG2 A;  3VB2 A;  4GFB A;  3DU5 A;  1QA6 A;  4KMF A;  4XRM A;  3R61 A;  4V2G A;  4HYE A;  5F04 A;  1G3W A;  1HCR A;  1P4X A;  2W24 A;  4HBL A;  9ANT A;  3E97 A;  2BEO A;  3OYL A;  2ISZ A;  1MH4 A;  1Z77 A;  5LRS A;  3VYS B;  1TTY A;  1YX3 A;  1YJ9 I;  3GWZ A;  2MLG A;  3UR3 C;  3HOZ J;  4A3I J;  3I4M J;  3BDD A;  2ELH A;  2LNB A;  4A6D A;  2NYX A;  4XOP A;  1IXC A;  4Y15 A;  5FRN A;  2QKL B;  3MZ8 A;  3JSO A;  1S9H A;  5TIS C;  3GEZ A;  3NEU A;  1Y1V J;  3CMY A;  3CC7 I;  2HFH A;  2AQF A;  2OAZ A;  3FXU A;  2DDA A;  2Z1D A;  2W00 A;  3LAP A;  4C3J J;  1SVL A;  3M1C A;  1XMK A;  1TT0 A;  1PP7 U;  1QZZ A;  3GW2 A;  5F27 A;  3G1O A;  4EJT A;  2PJR A;  4CGZ A;  1AWC A;  3E7L A;  5IP9 J;  3CTA A;  3I9V 2;  5ILU A;  3T0Y A;  4QPQ A;  1S6L A;  3FM5 A;  3JRI A;  2XHK A;  1WI9 A;  4CCJ A;  2CUJ A;  4B1R A;  3CCE I;  2GXB A;  1OCT C;  3WTW C;  4KN4 X;  2VE8 A;  5KK1 A;  5JHU A;  2HEO A;  2JPB A;  1LPQ A;  4LG0 B;  4Y33 A;  4FET A;  3ECO A;  4CA0 A;  4M6X A;  2H27 A;  2LK2 A;  2F4M B;  3ROU A;  4GDF A;  3H1C A;  1JJ6 C;  4BE1 A;  3CUQ A;  3OYI A;  5JVG F;  2DOD A;  5HS9 A;  1QPI A;  1DU6 A;  4DOZ A;  1IN4 A;  3TKY A;  3N97 A;  2P7C B;  2PJR B;  3PM1 A;  3E6B A;  3OY9 A;  3GTQ J;  2KRC A;  5CLS A;  2J5O A;  1YIO A;  1I1G A;  1XX5 A;  3K4K A;  1ZRF A;  1TWH J;  3ULQ B;  1SD6 A;  4RM2 A;  5HS8 A;  6PAX A;  1IDY A;  2CU7 A;  4Y3O A;  3OL3 A;  1EH8 A;  4FE4 A;  5IP6 A;  2X9D A;  4YII A;  2V7F A;  3PFY A;  5HS7 A;  1FIP A;  4E7J A;  2DT7 B;  3HM5 A;  5BNG A;  1Z21 A;  3DWL E;  2A61 A;  1Y56 A;  3R0A A;  5EDN A;  4OOI A;  2XRL A;  2LD5 A;  2JA2 A;  4AYB N;  3CUQ B;  3NWS A;  3WU1 B;  1EH6 A;  3CJT B;  3GF2 A;  5E8G A;  2K9L A;  3PL8 A;  1W7P D;  3C18 A;  1CF7 A;  2XGX A;  3Q0U A;  4N0B A;  4NC6 A;  5E1W A;  1FEX A;  1ETV A;  1L3L A;  5E1X A;  2ECC A;  2HQN A;  4ZH4 F;  2VAS A;  3O8G A;  4I0A A;  2FQ4 A;  2HDD A;  1R5G A;  3PJR A;  2R7V A;  4WX9 A;  1O4X A;  4NB5 A;  2XKP A;  3KEY A;  4M3D A;  3OIP A;  3RZO J;  3S3O A;  2KIS A;  4UB8 C;  3QP6 A;  1GUU A;  2JWT A;  1ZK8 A;  4JK1 X;  3M07 A;  3DBH B;  4B3X A;  3S1M J;  2NS0 A;  4YFN F;  2Q8K A;  1Z05 A;  3P7N A;  2KDO A;  3ZQG A;  3S2W A;  1B9M A;  4M9S A;  4E7K A;  3HIF A;  2A5W A;  5E3N A;  2VPL A;  2HS5 A;  1CF7 B;  2MAB A;  2L9V A;  1YIJ I;  2K9S A;  1LNW A;  2Y2Z A;  3IH2 A;  1TWC J;  2K7L A;  3HSR A;  3WE2 A;  4A69 C;  1IRF A;  4KUM A;  2VI6 A;  2GBY A;  3DCF A;  5HDN A;  5GAH J;  3IAS 2;  1R1T A;  2LLK A;  4XLF A;  3JRC A;  4N9H A;  3HDD A;  1NG7 A;  2Y9Y A;  2O61 A;  1ONV A;  5EGO B;  4BHC A;  1X1B A;  4XSX F;  2E2J J;  3L2R A;  3R0J A;  4CCO A;  3I71 A;  2CUZ A;  3FMR A;  2I5U A;  1L0O C;  3O6B B;  4QPO A;  1Y6I A;  5E18 F;  3DKW A;  5LEK A;  2C6Y A;  2FE3 A;  1ZGJ A;  3QOD A;  1RNL A;  2FF4 A;  5JR3 A;  4ZTF A;  4P55 A;  2Y30 A;  1QQI A;  4RAZ A;  1T2K A;  3S1N J;  2IS6 A;  2CS3 A;  1TP4 A;  3COA C;  2HKX A;  1MZB A;  2B7E A;  4HOB A;  1Z6R A;  4EJU A;  2CW7 A;  2KJB A;  3V42 A;  1H9T A;  1G59 A;  3CCM I;  4BNC A;  3CZ6 A;  5K5Q A;  1RUO A;  4I76 A;  3T8T A;  1K4S A;  1I27 A;  4U7D A;  4LIU A;  3A4C A;  3KP2 A;  2CO5 A;  2CV0 A;  2KLO A;  3Q5F A;  2XRN A;  3K70 C;  2Z33 A;  1ZN2 A;  4MHG A;  5IY5 H;  2JVG A;  2KFD A;  1X3Z B;  2K86 A;  4L0Z B;  1TW3 A;  3CCV I;  2P0W A;  2EK5 A;  3HZJ A;  5GPA A;  1VZ0 A;  3FXM A;  4HLY A;  5IYB J;  1G4D A;  1BIB A;  3MAJ A;  4U88 A;  5LGT A;  3SDB A;  5DTD A;  5CYV A;  1O3R A;  3W2A A;  1TW2 A;  4PZJ A;  3BG3 A;  4B44 A;  4XON A;  1T98 A;  1VQM I;  1OCP A;  2QBY A;  2MGQ A;  5LRR A;  1S7O A;  5LEJ A;  3IH4 A;  4UV9 A;  4XN0 A;  4BKX A;  2ME0 A;  4K2E A;  1O3Q A;  3AL0 C;  4RM3 A;  4S0H B;  2K3F A;  1V5E A;  3VPR A;  1WCM J;  4D0P A;  3OS0 A;  4XL9 A;  3L2Q A;  1FMV A;  1HKS A;  4A3G J;  3LMM A;  1Q1V A;  2LFB A;  4B3A A;  4PGH A;  4MNU A;  3R6S A;  2NS8 A;  3L7W A;  3JAM K;  3OYA A;  2XGC A;  2DMT A;  3BCB A;  4I7H A;  3I54 A;  5HLH A;  5ICG A;  2EJR A;  3OYH A;  3GZ6 A;  4FCY A;  5HLI A;  1T08 B;  3RYP A;  4L5E A;  2V79 A;  1U5T B;  4OIO F;  2G0E A;  2K27 A;  2K9Q A;  2F4O B;  2JN6 A;  1TL8 A;  2ISY A;  4E70 A;  2OZU A;  3CES A;  1X2N A;  4ZJZ A;  3SJM A;  3I5U A;  1H88 C;  2LRD A;  4BAY A;  4JX5 A;  1JJ8 C;  3A0H C;  3WGG A;  2QSH X;  4M73 A;  2FSW A;  3ABK H;  5FLX K;  2WAF A;  3B73 A;  3LSG A;  4QSH A;  3T1B A;  2RAE A;  3FX3 A;  4F55 A;  3UNG C;  3FXK A;  2XPU A;  3BG6 A;  3I0T A;  1T8I A;  3F9K A;  2VIX A;  3K0L A;  3PNT A;  3OWT A;  4PSX A;  2RGV A;  2DQL A;  5K7Z A;  5ERI A;  4AU7 A;  1VQK I;  5M3F J;  4UVB A;  1Y0N A;  4M9Z A;  2OF7 A;  3C2B A;  3WTS C;  4ESB A;  1SAN A;  1WRJ A;  5FRO A;  2FEZ A;  2WWY A;  5F0H A;  1GVJ A;  4R8H A;  1JKP C;  1F43 A;  2M7A A;  1FYL A;  3BTL A;  1POG A;  4LIV A;  2M3A A;  1IGN A;  1N25 A;  2X6Y A;  2XSD C;  3K2Z A;  5ICC A;  2XIG A;  5DV5 A;  1I1S A;  1T6S A;  1G8X A;  2VBY A;  3HSE A;  5GAD J;  2R3S A;  3PNV A;  2CQX A;  2DJN A;  1C0W A;  1IG7 A;  3V8K A;  1XD7 A;  3HC7 A;  3ZMV A;  4E4H A;  3HSF A;  2GWR A;  2MLK A;  1XMX A;  3DFG A;  3PO3 J;  5BPD A;  1J59 A;  2M4G A;  2IS1 A;  2XAH A;  4ZYE A;  1WVR A;  2QZ8 A;  3O3K A;  2KP6 A;  2HWV A;  1GVD A;  1FBS A;  4MTD A;  1DGW Y;  1SAU A;  1BI2 A;  3RKY A;  3AL0 B;  1FOX A;  3OOP A;  4HV6 A;  4NBQ A;  3IWF A;  5TGT A;  1STZ A;  5L3D A;  5DUI A;  4EGY A;  4HRI A;  2YPR A;  2DPU A;  5DCF A;  3OYC A;  1UST A;  2VJJ A;  2IXS A;  1XDS A;  2DBB A;  2V1X A;  4BBS J;  5AIP A;  2RRE A;  4XOT A;  1QGP A;  3KYC B;  3UKG A;  4G9Y A;  4I98 B;  1V3F A;  4CZZ A;  2IRF G;  4ZZL A;  3ZMD A;  4M3E A;  4UXN A;  3JR9 A;  2IBD A;  4CO8 A;  3QYB A;  1IJW C;  1P9Q C;  2HZT A;  1LDK B;  4HEA 2;  4L0Y B;  1YW9 A;  2L01 A;  4MEX F;  5J3L A;  2CQN A;  1IXS B;  3F3X A;  3LL7 A;  2HI3 A;  1TLH B;  1WJE A;  1VQO I;  1SVO A;  1TQM A;  2H09 A;  2ID3 A;  2QM3 A;  3M8E A;  3K4B A;  2FRH A;  4RMN A;  3C1D A;  5IOZ A;  3FKI J;  4IRI A;  3MEX A;  5J8F A;  2X1C A;  2UUZ A;  4EJO A;  4ANJ A;  3D1N I;  1ON1 A;  4UY8 I;  1RI7 A;  4EEF G;  4Y17 A;  3SFI A;  1FBU A;  3QOE A;  3N4M A;  2EFO A;  1R49 A;  3H0G J;  2D5V A;  1J09 A;  2VN2 A;  4EJV A;  1A31 A;  5LGU A;  2Z2S B;  3RTR A;  2EV5 A;  1VI0 A;  2VL8 A;  1YW7 A;  2V4J C;  2VBW A;  2FNP A;  4RGX A;  1EKE A;  5EZH A;  2CW8 A;  2EZI A;  4HAM A;  3S32 A;  2NOG A;  2PX9 A;  2QEN A;  3VYU B;  3CMA I;  1TWF J;  1XN7 A;  2STW A;  3ZR8 X;  5IOY A;  1JUS A;  5LD2 C;  3F72 A;  4L5I A;  2RVC A;  1NTC A;  2B0L A;  1ZRC A;  3KE2 A;  4LB6 B;  5FD6 A;  3MWM A;  2PN6 A;  3CP8 A;  1E3P A;  1Z3X A;  2WBM A;  4BY1 J;  3CDH A;  1REP C;  2F5E A;  2W57 A;  3HHG A;  4N4O B;  2Z16 A;  2V1N A;  3RIR A;  1G2H A;  3PQJ A;  1N78 A;  1MJ9 A;  1D5Y A;  4DZJ A;  1BI0 A;  2OU2 A;  2JA6 J;  3K6G A;  1R1U A;  5BPI A;  3IL2 A;  4C2U A;  1CQT A;  2OQG A;  3GFJ A;  4P5O A;  1U8B A;  3NRV A;  3OOU A;  4V2F A;  1EJ9 A;  1G6N A;  4M6V A;  4WF2 A;  2R5Y A;  3JRH A;  1DQU A;  3BJ6 A;  3ZQ7 A;  2JA8 J;  2E19 A;  2XGE A;  3OYB A;  2L9N A;  1WZ2 A;  1MND A;  1YS7 A;  1P7I A;  2CH0 A;  3ONQ A;  4YEJ A;  1Y0U A;  1ZKG A;  4KIF A;  4IO9 F;  1XSV A;  4UHT A;  2QEX I;  4OIP F;  5CJ9 A;  3WTZ A;  5FLM J;  2BY1 A;  4OIQ F;  3H3Z A;  3O2P E;  3AKZ A;  3V8J A;  2FX0 A;  3QU3 A;  2HPI A;  4S04 A;  4OIN F;  1YFH A;  1T33 A;  3LSM A;  5EEH A;  4IZZ A;  2ZBK A;  4H0E A;  1U9O A;  1NG6 A;  3LQR A;  4WCG A;  1WWX A;  2X6X A;  2V6C A;  3ZQL A;  4IHS A;  2DFE A;  5M5X J;  2R5Y B;  2RN7 A;  2VUM J;  2DYR H;  3JCU C;  3S17 J;  4DJA A;  1UAA A;  3I53 A;  3R4K A;  4Q4Z F;  2L7F P;  4G12 A;  3MZY A;  2ZXI A;  4IXA A;  3H9Q A;  2VKH A;  3HRT A;  3H3U A;  1IRX A;  2VBX A;  3K9T A;  5B1B H;  4ZYA A;  1VQP I;  1OPC A;  2VC1 A;  1SFX A;  4NC8 A;  2D45 A;  5A2Q Z;  1Z1D A;  3P9K A;  2P81 A;  2QSF X;  2ECB A;  2O8K A;  2ZSH B;  1O3S A;  2MYS A;  2EBI A;  2QQA A;  3W2V A;  3HOW J;  1P92 A;  3DBL B;  4L9J A;  2JSC A;  1W5C C;  2PMZ N;  1GXP A;  3LA7 A;  3KYD B;  5D5U B;  2FBI A;  1GHC A;  1IN5 A;  2X6O A;  1J75 A;  2H6B A;  2DCE A;  2JZY A;  3HGY A;  5L3G A;  1ZR2 A;  3HHH A;  2D2W A;  4J19 A;  5L3F A;  2QQ9 A;  4EJW A;  4ZDO A;  3RQI A;  5ICE A;  1HW5 A;  4B48 A;  3MZH A;  1BI1 A;  4BBR J;  2E34 A;  2HOS A;  2CQ7 A;  4D7N A;  4E7L A;  3E3V A;  2UXX A;  3FKJ A;  2HVS A;  2FXA A;  2PLY A;  1TNT A;  3F8F A;  3IV5 A;  3IWZ A;  2ZXW H;  4TV7 A;  1R5H A;  4NUB A;  4HX8 A;  4HDU A;  5L3C A;  2HYF A;  2LY1 A;  1TQP A;  5AIQ A;  4BY7 J;  1X1A A;  2R7F A;  1IO2 A;  4BYY A;  5IT9 Z;  1ZLJ A;  2LRE A;  1K78 B;  1OIS A;  3OL4 A;  3GFL A;  4Q48 A;  4KA4 A;  3BG5 A;  4XR6 A;  2JRM A;  4MFD A;  4HNU A;  4RB1 A;  1ZRD A;  3MKZ A;  2RQQ A;  1LDJ A;  3B6C A;  4KJZ A;  3U1D A;  4BHB A;  2HOT A;  2Z9O A;  2M7B A;  3WU2 C;  3VSK A;  3S3N A;  3R60 A;  2RQP A;  4EM2 A;  4WK8 F;  3DU6 A;  3U21 A;  3ZN0 A;  3ABT A;  1MNM C;  2K3P A;  1YS6 A;  1S5L C;  2K9N A;  1U2W A;  1WJA A;  3ZOB A;  4YIR X;  4BQQ A;  3FXL A;  1SMY F;  1WI3 A;  3FHZ A;  3MN2 A;  2LY2 A;  2D1V A;  4AWX B;  2KRF A;  3CJR B;  2IAI A;  3F6O A;  3CCQ I;  3AAF A;  4XOR A;  3K4J A;  2E60 A;  4OMY A;  2F5C A;  2H8R A;  3EDP A;  5D8K B;  4C9Y A;  2WAQ N;  1D3Y A;  4U7B A;  2XAU A;  1FSH A;  2CUF A;  1U8R A;  3E6C C;  2Y0S A;  3F6V A;  1X1P A;  2V9V A;  2V1D A;  5FKL A;  3LA2 A;  2X4H A;  4X1E A;  1PUF B;  2FUG 2;  2GM4 A;  2GIZ A;  2W4S A;  3W6K B;  2NAZ A;  4ITV A;  4YIF A;  4G7Z F;  3ZQQ A;  2KZV A;  1JTX A;  1XMA A;  4MLO A;  1BJA A;  4XLE A;  2GAU A;  2O0Y A;  1OCR H;  2W25 A;  1O7F A;  2HXI A;  3ZXS A;  2KIU A;  1MIJ A;  3MFK A;  2DA3 A;  3FK6 A;  3L2W A;  1ZQ3 P;  1IW7 F;  3BT9 A;  2EIM H;  4IVN A;  2CWE A;  3CMM A;  4LFU A;  2FBH A;  4MQV A;  2EZK A;  1Z7U A;  2GOX B;  1S7A A;  2QKM B;  2JSP A;  2EB7 A;  1HW1 A;  2R7W A;  1TWA J;  5EEA A;  3K1M A;  1QHH D;  1ZYR F;  3HG9 A;  2A5Y B;  3J81 K;  4LG3 A;  1MDM B;  2EFQ A;  2OC6 A;  3BG9 A;  3BCA A;  3DV8 A;  4XQF A;  3BPV A;  2KIF A;  5GAE J;  3LOC A;  4HPQ A;  1E17 A;  3F8M A;  2XF7 A;  2RC4 A;  1JI8 A;  3LQQ A;  2HR3 A;  1AHD P;  2JA7 J;  4E7Z A;  4I0B A;  2HVQ A;  2BYV E;  3C2G A;  2OV7 A;  3BC8 A;  3SHF A;  2K4B A;  3FBI B;  4A3L J;  3H9G A;  4HA8 A;  4W1U A;  2PQ8 A;  2YS9 A;  3ZMZ A;  2KT0 A;  4DYC A;  3U1K A;  2COB A;  5D5V B;  2WC2 A;  4AM3 A;  2PMZ A;  5FKN A;  2OUM A;  4BL0 B;  5ED4 A;  4C3I J;  3W3C A;  1BL0 A;  4RBO A;  2MD0 A;  3RKQ A;  1FTT A;  3LA3 A;  2MH9 A;  1A36 A;  3GZ5 A;  4PCQ A;  3D5L A;  3I3L A;  1V55 H;  3NQO A;  1RR7 A;  2BGC A;  4GCV A;  4LGW A;  2EH3 A;  3JRB A;  3SZG A;  4XBF A;  4LOC A;  3IKT A;  4HNT A;  2P5L C;  4E7H A;  1XG1 A;  1JUP A;  1S7E A;  2LF8 A;  3C2H A;  4IL6 C;  1I5Z A;  5J47 A;  2EV0 A;  5H2F C;  4U87 A;  4I09 A;  1YW8 A;  2DQR A;  3BZ6 A;  4CCM A;  5FRM A;  1O57 A;  5IT3 A;  4CCN A;  3DEW A;  4PFO A;  3RQ4 A;  5HNH A;  3FXQ A;  2EIN H;  4HV5 A;  3OYG A;  3WHB A;  2ZME C;  1X58 A;  1GT0 C;  4XKC A;  3BQY A;  2KPM A;  1BOB A;  1MD0 A;  4O3M A;  4A3K J;  2HDW A;  3MQ0 A;  2LVS A;  2EZH A;  4P9F A;  5H6Q A;  1J5Y A;  5E1Z B;  1ERD A;  2ICW G;  4A12 A;  2AS5 F;  2DFH A;  2M45 A;  3HOX J;  1H8A C;  1IUY A;  2EWN A;  5JVT A;  1BR2 A;  3DTE A;  2O3F A;  3K4C A;  1JUM A;  2VOP A;  3LAJ A;  1QU3 A;  4D9J A;  2KMU A;  1R58 A;  1UFM A;  3A0B C;  1OFC X;  3PFI A;  2ZSI B;  3ZMU A;  4PJN A;  1FC3 A;  2O7O A;  3IAM 2;  3CD6 I;  2IA0 A;  3VOE A;  3HTS B;  4UB6 C;  1RZ4 A;  1XGN A;  4I99 C;  3RJP A;  2NXN B;  3ZGK A;  1MBK A;  4IF4 A;  3FXR A;  1IV8 A;  3TL4 X;  1RR8 C;  3J80 Z;  2R7R A;  3BZC A;  3LSP A;  1LVA A;  4OMZ A;  3RPQ A;  3WHC A;  4A5M A;  1QZY A;  2BY3 A;  2PJP A;  5D4S A;  3DQV C;  2HVR A;  1U3E M;  2MC4 A;  3HPG A;  3JRF A;  3TDU C;  3AFH A;  1SD4 A;  2HYG D;  2ZME A;  3GVA A;  3QPL A;  4KT5 C;  3CLO A;  1EV7 A;  2KRH A;  1U9N A;  3WOD F;  3KPH A;  1PYV A;  2LSO A;  1WQ2 A;  3VOD A;  3RZD J;  5M5W J;  2ZJ2 A;  3OSF A;  3CCJ I;  4CYD A;  1BC8 C;  3OS1 A;  4Q5S F;  4CIC A;  3H92 A;  1VND A;  4IRH A;  3BY6 A;  3GFM A;  3IRQ A;  3LSR A;  1T0F C;  4IHV A;  1YTY A;  4HNV A;  1PP8 F;  1NHA A;  2M30 A;  3FF5 A;  1VFC A;  3K1N A;  5DD4 A;  1E3O C;  1SVM A;  3TP0 A;  4A3E J;  4M71 A;  2X48 A;  1E3H A;  2O8X A;  3CO6 C;  5KHD A;  4KFC A;  3FMQ A;  1KA8 A;  3KP6 A;  4ABZ A;  2CQK A;  4JP0 A;  2R5Z A;  2FU4 A;  2ZME B;  4ASN A;  2H94 A;  3CO7 C;  5H6R A;  4II2 A;  4O5V A;  5KCM A;  3TGN A;  1Y8Q B;  1ETX A;  3S16 J;  4G8X A;  2M5W A;  4A5N A;  3OYJ A;  3SXY A;  1UMQ A;  2VQG A;  1W1W E;  2E5Z A;  2ELJ A;  2XAF A;  5F1J A;  3L2C A;  2L9R A;  3RI4 A;  4PFP A;  3J7Y J;  1D0Z A;  1RIO H;  3OR2 C;  2EIL H;  4BJ5 C;  5HLT A;  2E2I J;  2FBK A;  3A02 A;  1R22 A;  3V4G A;  2NNY A;  3RYR A;  1X2M A;  5KAF C;  1XTA A;  1HDD C;  2IJL A;  5KVR A;  2WAE A;  4IKF A;  1Z6T A;  2R5Z B;  5J4Y A;  1CGP A;  1T0F A;  3BP8 A;  4XRS G;  4MEY F;  1WH7 A;  3CCY A;  3SYT A;  3K10 A;  2LKS A;  2GOM A;  3GTP J;  3CC2 I;  2Y69 H;  2MC3 A;  1OCC H;  3S2H J;  5DCM A;  2NOJ B;  2GA2 A;  2JUC A;  2YX4 A;  5GTH C;  4HLX A;  2DK8 A;  4A6E A;  5GTI C;  1B9N A;  2JJ7 A;  2BXZ A;  2R7D A;  2V26 A;  4MO7 A;  4N4N B;  1HLV A;  3F8C A;  3WE3 A;  1JGS A;  5CVV A;  5BS6 A;  2ZXH A;  4A3B J;  1H9G A;  4A3D J;  3OYK A;  4XN3 A;  3GZN B;  3V7S A;  2DMQ A;  4KDP A;  1ENH A;  2PI0 A;  1YJW I;  2ZKZ A;  2VBZ A;  4LD5 A;  3L2V A;  5GAG J;  1MNE A;  5EYR A;  1E0E A;  5CVJ A;  3E5X A;  2QCO A;  3OYN A;  4GYI A;  3IHU A;  2EFN A;  3TW7 A;  3JSP A;  3EUH C;  4AD9 A;  4QTR A;  4OWR B;  4IHT A;  4AYB A;  1XGO A;  3G6E I;  2VT3 A;  3I58 A;  2M2E A;  2QBY B;  3QPH A;  4N9I A;  2FOK A;  1XCB A;  5EF6 A;  5F0C A;  2IVM A;  2V1U A;  1ZTR A;  3P5J A;  2XUB A;  2OBP A;  3TMO A;  1DPR A;  1SFE A;  3CCU I;  4M3F A;  3VFZ A;  1W7P A;  2EV6 A;  4BH9 A;  4UUS A;  4XLA A;  2DOE A;  2XAS A;  1YHQ I;  3H3V K;  1KU7 A;  2MG4 A;  4A3J J;  1A6I A;  4XSZ F;  2OZ6 A;  2VT2 A;  3BG7 A;  4RA2 A;  3HRM A;  5CQE A;  1IUF A;  1PUE E;  4GYG A;  2DA5 A;  1OMI A;  3S8P A;  3JRG A;  4FIS A;  1USS A;  3ML6 A;  5KAI C;  4RB3 C;  2E1O A;  4CDG A;  3GFI A;  2OTL I;  1DPU A;  4ZC3 A;  1NK3 P;  4G6D A;  5IPA A;  2VON A;  2CJJ A;  1WJ5 A;  3HBL A;  2L4M A;  1P4W A;  2BY2 A;  3M7G A;  3P9I A;  4GGG A;  4PJL A;  4BEH A;  4FHT A;  4F93 B;  4XRS A;  1U78 A;  3DPU A;  3BTI A;  4GO1 A;  2OD5 A;  2LYC A;  1MW7 A;  4HQM A;  2G9W A;  4R79 A;  2KJC A;  1U0J A;  3M4O J;  5D6F A;  3GO5 A;  4IQJ A;  2KL4 A;  2HNH A;  3EUH A;  4RGU A;  3TP3 A;  1KQ8 A;  3TDZ C;  1QNT A;  2TDX A;  3SQN A;  1W4M A;  1VTN C;  4S05 A;  2H1L A;  4Y13 A;  4IHY A;  2VB6 A;  1RKT A;  3EQL F;  2XRO A;  2HTJ A;  3GBG A;  2GXA A;  1LFB A;  2BHY A;  2DO7 A;  1D0X A;  5HVQ C;  1ON2 A;  4DQ2 A;  4XLH A;  2PMU A;  4FQG A;  3LNQ A;  2BW3 A;  1X19 A;  2DYS H;  3IH3 A;  1XGM A;  2AXT C;  2F5V A;  3LSI A;  1LFP A;  2HQ5 A;  2Y0M A;  1IRG A;  3E0J B;  1LFU P;  4BEH B;  4D7M A;  1SFK A;  2VQL A;  1UEL B;  3ZP5 A;  4AVZ A;  2DDB A;  2OTJ I;  4WWC A;  3Q9S A;  3N05 A;  1YO5 C;  4G7O F;  2MFZ A;  2NNN A;  5C44 J;  2VKE A;  1YJN I;  2D1H A;  3ABM H;  1IZ1 A;  4XID A;  1K83 J;  2HYJ A;  2RNG A;  3FWE A;  1BC7 C;  3VDX A;  1ZR4 A;  1I3A A;  3BTC A;  5L3E A;  1DP7 P;  3ASO H;  3GTM J;  3PUB A;  1RPW A;  1ZG3 A;  3QOP A;  3H5N A;  5JHF A;  1FSE A;  1S29 A;  4BQA A;  1W0U A;  3CJN A;  5E79 C;  1X3W B;  1ZG1 A;  3RSN A; 
#chains in the Genus database with same CATH homology
 2ESH A;  2DW4 A;  2DI3 A;  2EFP A;  3G3Z A;  2IT0 A;  1P2F A;  4EGZ A;  3IRR A;  1QPM A;  4ZYH A;  5K1Y A;  2L3D A;  4AVP A;  2XAQ A;  4WXC A;  3SFZ A;  4KYW A;  1FPQ A;  3RDI A;  4IJA A;  5LBQ A;  3TO9 A;  1LDD A;  2PG4 A;  2HTS A;  2FNA A;  4EV0 A;  3DPT A;  5BQT A;  1HQC A;  2OQR A;  1LB2 A;  5HDG A;  1TQI A;  1FT9 A;  3M9A A;  3Q9V A;  5FGM A;  3T8R A;  2K4J A;  3JAM Z;  4LMY A;  4HQE A;  4Q47 A;  2HQR A;  5HDK A;  2XAG A;  2NRA C;  1UB9 A;  3SZT A;  1X3U A;  3KZZ A;  1WSU A;  1XGS A;  3GUD A;  5DDG A;  3KEQ A;  5FLX Z;  5FD5 A;  3ECH A;  4ZYG A;  3IC7 A;  4ETS A;  5FO5 A;  1ZRE A;  3HOS A;  5DUK A;  2OA4 A;  5TJJ A;  1T38 A;  5J8C A;  3REO A;  4OIR F;  3IKV A;  4UVC A;  5JFR A;  1D5V A;  1KYW A;  4L9V A;  3WTV C;  4JBA A;  4HX7 A;  1FLI A;  2DT5 A;  3HTU A;  4A0Y A;  2CG4 A;  3P9C A;  3WG9 A;  5E8I A;  1EH7 A;  2G7H A;  2JTV A;  3LWF A;  1DUX C;  4F7Z A;  2GXG A;  3KLO A;  4KIB A;  1FX7 A;  2FA5 A;  2IA1 A;  4UV8 A;  2O6G E;  1FP1 D;  3PQK A;  2HKO A;  2CFX A;  2P5V A;  5CVR A;  1R23 A;  1HKT A;  2JT1 A;  4G7H F;  4HF0 A;  3RPU A;  2IA2 A;  4HF2 A;  1ULY A;  3W6J B;  4I2O A;  1O7L A;  3JTG A;  3BWG A;  4EMS A;  1Z91 A;  1YLF A;  2Q0O A;  3HOT A;  5FFZ A;  2JPC A;  1LQ1 A;  1ZLK A;  1R1V A;  3I4P A;  4JQF A;  2YU3 A;  4ENN A;  2L54 A;  4KIC A;  4QLC U;  1R00 A;  1P6R A;  2Y75 A;  2MH2 A;  3ABU A;  2E7X A;  3J7A O;  1F1Z A;  1ZGA A;  1B1B A;  2QUF A;  5D5W B;  2VXZ A;  1R7J A;  2QVO A;  1FWZ A;  1FP2 A;  3BRO A;  4RS8 A;  1BN5 A;  3DPL C;  1BM9 A;  2HOE A;  4I01 A;  4B09 A;  1G3T A;  1F4K A;  1FYM A;  4ESJ A;  2UWM A;  5H20 A;  5ILV A;  1IN7 A;  2Z5U A;  4RGS A;  5CVU A;  3V7C A;  3VEP A;  2Z3Y A;  1IN6 A;  5CVI A;  4LJZ F;  1HSJ A;  4YFX F;  1PDN C;  1KU3 A;  3LST A;  4R1H A;  4B8X A;  4LLG F;  4ZZD A;  4G6Q A;  1E2X A;  2VC0 A;  1F5T A;  4ENM A;  1OYI A;  3CUQ C;  1J2X A;  1J0R A;  5EEG A;  4IPA A;  4LG0 A;  1HKQ A;  4YFK F;  3ZMS A;  1IXR C;  1ZHF A;  5ILS A;  3WTU C;  3F8B A;  2DU9 A;  2ZO4 A;  5JI6 A;  3CUO A;  3GXO A;  4GXO A;  1OR7 A;  1OYW A;  2PEX A;  4Z2Y A;  2BBY A;  1KU2 A;  4KNY A;  2DPD A;  3HRS A;  4LK1 F;  4IRG A;  4KN7 X;  5BMZ A;  2EFW A;  2FQ3 A;  2IW5 A;  3DXJ F;  2Z99 A;  1FYK A;  3WTY C;  2Q2E A;  2RDP A;  4EQQ A;  2P6T A;  3L00 A;  4QWQ A;  4OU0 A;  2J5P A;  1WKM A;  1JE8 A;  2MA3 A;  2XAJ A;  2RKH A;  1F9N A;  3QAH A;  1B4A A;  3EYI A;  1Q1H A;  2XVC A;  1ODD A;  2GIV A;  5ICF A;  1KQ9 A;  3EET A;  2WTE A;  3ZPL A;  2GQQ A;  2F5D A;  5D8L B;  1B59 A;  2DFI A;  2YX7 A;  3BJO A;  4U0Y A;  1KU9 A;  2DK5 A;  5HLG A;  1FZP B;  4MQ9 F;  1IN8 A;  3L9F A;  4A0Z A;  3BPX A;  5DEQ A;  1XSD A;  2COM A;  3TO6 A;  1GXQ A;  2EA4 A;  3BOQ A;  1MJA A;  2CSO A;  5LGN A;  2M8E A;  2MBF A;  2F5F A;  3ELK A;  2P7V B;  3FMS A;  2PBI A;  1D8K A;  2BV6 A;  3C7J A;  2W84 A;  3ZN1 A;  4XLP F;  4HF1 A;  3E5Q A;  1UCR A;  3T5X A;  2VOO A;  1U5T C;  2PFB A;  1U6G A;  3J81 Z;  3WGI A;  1DDN A;  3D0S A;  1ZG5 A;  4G94 A;  3QU6 A;  1I6X A;  2K02 A;  4KIG A;  3KP4 A;  1QBJ A;  4EVI A;  2Y48 A;  3DEU A;  1TBX A;  2UXN A;  4KMU X;  2ESN A;  3SZP A;  2QQB A;  1P4A A;  1A04 A;  1JXS A;  5F64 A;  5AON A;  5FB2 A;  4RGR A;  2ACJ A;  2E1N A;  3F21 A;  1HW2 A;  3DP7 A;  3V8L A;  4AIH A;  1U5T A;  4PGG A;  3E6D A;  2STT A;  1JHH A;  3K69 A;  2E7W A;  2G7U A;  4FT8 A;  3QPT A;  1G3Y A;  5DCM B;  1S3J A;  4LB5 A;  2F2E A;  2CGP A;  2VE9 A;  1K79 A;  2A68 F;  3M1E A;  2IPQ X;  2AXL A;  1MKM A;  3M8F A;  3WTT C;  2QWW A;  5K5O A;  1OYY A;  3E5U A;  4CHU A;  5LHG A;  2ZNZ A;  4MGR A;  1FBQ A;  3ZMT A;  4LLL A;  4M9X A;  3HRU A;  4P96 A;  3FZV A;  2PMH A;  2XKO A;  3JTH A;  1JHF A;  1KQ0 A;  3F22 A;  1BI3 A;  5BOX A;  5LLQ A;  2DLL A;  1W7P B;  4AIJ A;  2DAO A;  1OKR A;  4ON0 A;  3KP3 A;  1K7A A;  2FMY A;  1FOK A;  1IF1 A;  3WU0 A;  3U9G A;  4I02 A;  5A2Q K;  5FFX A;  5LHH A;  2ZXJ A;  4FX4 A;  2YSR A;  2A6E F;  2H6C A;  3JW4 A;  4WXD A;  2RV8 A;  1TNS A;  3EYY A;  1LEA A;  1XSX A;  2QYO A;  1W5T A;  3E6M A;  4RB2 C;  4MTE A;  1AOY A;  4HW0 A;  3HUG A;  3I59 A;  4P9U A;  4M74 A;  5IT9 K;  1SFU A;  3B02 A;  2KIM A;  3LFK A;  3FM3 A;  3HYI A;  4UVA A;  4HX4 A;  1O3T A;  5F1R A;  4A0X A;  5TRD A;  1YQA A;  3GX4 X;  2L4A A;  4CXF A;  2VOD A;  4BXU A;  3KP7 A;  3ISP A;  4U0V A;  2A69 F;  1HXD A;  4DNC A;  3KET A;  4NHJ A;  3I59 B;  2HGC A;  1H0M A;  3OV8 A;  2CYY A;  3U2R A;  5LHI A;  3RKX A;  1YG2 A;  2GZW A;  2X0L A;  2M1B A;  1UHW A;  3L09 A;  3V7R A;  2E1C A;  1Z9C A;  1HST A;  1IAW A;  1BOA A;  4LLN A;  3WTX C;  1KYZ A;  1XCV A;  2XV4 S;  1QO0 D;  4EM1 A;  3KP5 A;  4XLN F;  1BIA A;  4ESF A;  1J7K A;  1V4R A;  1SMT A;  2FML A;  1RUN A;  2M87 A;  1D8J A;  1R36 A;  4NQW A;  4U0W A;  5HOO A;  4ENJ A;  3GLX A;  1FY7 A;  3G73 A;  2JRT A;  3QP5 A;  2CW0 F;  2WV0 A;  1G3S A;  2BE5 F;  3TOB A;  1XB4 A;  2RNJ A;  3KZY A;  4L5J A;  2P8T A;  2ZFW A;  1LJ9 A;  2HDC A;  2YR2 A;  1BBY A;  4L9N A;  4BHP A;  4L9T A;  5DD8 A;  1ZH5 A;  1K6O A;  3TO7 A;  4PDK A;  3WGH A;  4M72 A;  1XDU A;  2O03 A;  4RB0 A;  2ZCW A;  4HZF A;  2IP2 A;  2P5K A;  5K5R A;  2MD5 A;  3MCZ A;  4RAY A;  5DYM A;  4O6J A;  5E17 F;  2LKP A;  1K78 A;  1ZAO A;  4ZYD A;  4EM0 B;  1SD5 A;  2QLZ A;  3RKW A;  4UUV A;  4AIK A;  2EA2 A;  5D6E A;  3TQN A;  2P6S A;  3K1P A;  4XRF A;  5D5X B;  5D4R A;  3DF8 A;  3KLN A;  1MGT A;  1MJB A;  5E20 A;  1HBX G;  5J6X A;  1S8N A;  1J9I A;  3I64 A;  5F6F A;  5L3B A;  1KGS A;  3KEO A;  1SD7 A;  2DTR A;  2LDU A;  4WXH A;  3KCC A;  1FNN A;  2A3S A;  1W5S A;  1YYV A;  4FX0 A;  3GYH X;  4ENK A;  1LEB A;  2ADU A;  1SAX A;  2L02 A;  3F8N A;  1B6A A;  2ZNY A;  3J80 K;  2A07 F;  4HDV A;  3KFW X;  2GA1 A;  2KKO A;  1ZAR A;  1UHM A;  2A6H F;  3TOA A;  2ETH A;  4YG2 F;  4M6Y A;  3ERE D;  1T39 A;  4A2U A;  4UNO A;  2UZK A;  2W85 A;  4LK0 F;  2LF7 A;  3C3W A;  3F23 A;  3BJA A;  1MDM A;  3QRF F;  2P4W A;  4L18 B;  3VB2 A;  4KMF A;  3R61 A;  4HYE A;  1G3W A;  1P4X A;  2W24 A;  4HBL A;  3E97 A;  2BEO A;  2ISZ A;  5LRS A;  1TTY A;  3GWZ A;  2MLG A;  3BDD A;  2ELH A;  2LNB A;  4A6D A;  2NYX A;  1IXC A;  4Y15 A;  3JSO A;  3GEZ A;  3NEU A;  2HFH A;  3FXU A;  2OAZ A;  3LAP A;  1XMK A;  1PP7 U;  1QZZ A;  3GW2 A;  4EJT A;  4CGZ A;  1AWC A;  3CTA A;  5ILU A;  3T0Y A;  1S6L A;  3FM5 A;  2XHK A;  1WI9 A;  2GXB A;  3WTW C;  4KN4 X;  5KK1 A;  5JHU A;  2VE8 A;  2HEO A;  2JPB A;  4LG0 B;  3ECO A;  4M6X A;  2H27 A;  3ROU A;  3CUQ A;  5HS9 A;  1IN4 A;  3TKY A;  3N97 A;  2P7C B;  3E6B A;  5CLS A;  2J5O A;  1YIO A;  1I1G A;  1ZRF A;  3ULQ B;  1SD6 A;  5HS8 A;  6PAX A;  1EH8 A;  4YII A;  5HS7 A;  2A61 A;  3R0A A;  4OOI A;  3CUQ B;  3WU1 B;  1EH6 A;  3GF2 A;  5E8G A;  1W7P D;  3C18 A;  1CF7 A;  2XGX A;  4N0B A;  5E1W A;  1L3L A;  5E1X A;  4ZH4 F;  2HQN A;  4I0A A;  1R5G A;  4WX9 A;  4NB5 A;  2XKP A;  3QP6 A;  4JK1 X;  2NS0 A;  4YFN F;  2Q8K A;  1Z05 A;  3P7N A;  3S2W A;  1B9M A;  4M9S A;  3HIF A;  2HS5 A;  1CF7 B;  1LNW A;  2K7L A;  3HSR A;  3WE2 A;  1IRF A;  4KUM A;  5HDN A;  1R1T A;  4N9H A;  2O61 A;  1ONV A;  4BHC A;  4XSX F;  3R0J A;  3I71 A;  3FMR A;  1L0O C;  3O6B B;  5E18 F;  3DKW A;  5LEK A;  2C6Y A;  2FE3 A;  1ZGJ A;  1RNL A;  2FF4 A;  5JR3 A;  4P55 A;  4RAZ A;  1QQI A;  1T2K A;  3COA C;  2HKX A;  1MZB A;  4HOB A;  4EJU A;  1Z6R A;  2KJB A;  1H9T A;  4BNC A;  5K5Q A;  1RUO A;  3T8T A;  1I27 A;  4U7D A;  3KP2 A;  2CO5 A;  3Q5F A;  2XRN A;  2Z33 A;  1ZN2 A;  4MHG A;  2K86 A;  4L0Z B;  1TW3 A;  2EK5 A;  4HLY A;  1G4D A;  1BIB A;  3MAJ A;  4U88 A;  5LGT A;  5CYV A;  1O3R A;  1TW2 A;  4PZJ A;  1T98 A;  2QBY A;  5LRR A;  1S7O A;  5LEJ A;  4UV9 A;  1O3Q A;  4K2E A;  4D0P A;  1HKS A;  4PGH A;  4MNU A;  3R6S A;  3L7W A;  3JAM K;  4I7H A;  3I54 A;  5HLH A;  5ICG A;  2EJR A;  3GZ6 A;  5HLI A;  3RYP A;  2V79 A;  1U5T B;  4OIO F;  2K27 A;  2ISY A;  4E70 A;  2OZU A;  3I5U A;  4BAY A;  3WGG A;  4M73 A;  2FSW A;  5FLX K;  3B73 A;  3T1B A;  3FX3 A;  3I0T A;  3K0L A;  2RGV A;  2DQL A;  5ERI A;  4UVB A;  3WTS C;  4M9Z A;  4ESB A;  1WRJ A;  2FEZ A;  2WWY A;  1GVJ A;  4R8H A;  1FYL A;  3K2Z A;  5ICC A;  2XIG A;  5DV5 A;  1I1S A;  1T6S A;  2VBY A;  3HSE A;  2R3S A;  1C0W A;  3V8K A;  1XD7 A;  3ZMV A;  3HSF A;  2GWR A;  2MLK A;  3DFG A;  5BPD A;  1J59 A;  2XAH A;  4ZYE A;  2QZ8 A;  3O3K A;  2HWV A;  1FBS A;  4MTD A;  1BI2 A;  3RKY A;  3OOP A;  4HV6 A;  3IWF A;  1STZ A;  5L3D A;  5DUI A;  4EGY A;  2YPR A;  2DPU A;  5DCF A;  1UST A;  1XDS A;  2DBB A;  2V1X A;  5AIP A;  1QGP A;  4G9Y A;  4I98 B;  1V3F A;  4CZZ A;  2IRF G;  4ZZL A;  3ZMD A;  4UXN A;  4CO8 A;  2HZT A;  1LDK B;  4L0Y B;  1YW9 A;  2L01 A;  4MEX F;  1IXS B;  3F3X A;  1TLH B;  1TQM A;  2H09 A;  2QM3 A;  3M8E A;  2FRH A;  3C1D A;  4IRI A;  3MEX A;  5J8F A;  4EJO A;  1ON1 A;  1RI7 A;  4Y17 A;  1FBU A;  3N4M A;  2EFO A;  2VN2 A;  4EJV A;  5LGU A;  3RTR A;  2EV5 A;  1YW7 A;  2VBW A;  2FNP A;  4RGX A;  4HAM A;  2QEN A;  2STW A;  1XN7 A;  3F72 A;  4L5I A;  2RVC A;  2B0L A;  1ZRC A;  3KE2 A;  4LB6 B;  5FD6 A;  3MWM A;  2PN6 A;  3CDH A;  1REP C;  2F5E A;  2W57 A;  3HHG A;  3RIR A;  3PQJ A;  1MJ9 A;  1BI0 A;  2OU2 A;  1R1U A;  5BPI A;  3IL2 A;  2OQG A;  3GFJ A;  4P5O A;  3NRV A;  1G6N A;  4WF2 A;  3BJ6 A;  3ZQ7 A;  1YS7 A;  1Y0U A;  4KIF A;  1XSV A;  4UHT A;  4OIP F;  5CJ9 A;  3WTZ A;  4OIQ F;  3H3Z A;  3O2P E;  3V8J A;  3QU3 A;  4S04 A;  4OIN F;  1YFH A;  5EEH A;  2ZBK A;  4H0E A;  3LQR A;  4WCG A;  1WWX A;  2V6C A;  4IHS A;  2RN7 A;  3I53 A;  3R4K A;  4Q4Z F;  3MZY A;  4IXA A;  3HRT A;  3H3U A;  2VBX A;  3K9T A;  1OPC A;  2VC1 A;  1SFX A;  2D45 A;  5A2Q Z;  1Z1D A;  3P9K A;  1O3S A;  2QQA A;  1P92 A;  4L9J A;  2JSC A;  1GXP A;  3LA7 A;  5D5U B;  2FBI A;  1GHC A;  1IN5 A;  1J75 A;  2H6B A;  2JZY A;  5L3G A;  3HHH A;  2D2W A;  5L3F A;  2QQ9 A;  4EJW A;  5ICE A;  1HW5 A;  3MZH A;  1BI1 A;  3E3V A;  2UXX A;  2FXA A;  2PLY A;  1TNT A;  3F8F A;  3IWZ A;  4TV7 A;  1R5H A;  4HDU A;  4HX8 A;  5L3C A;  2HYF A;  1TQP A;  5AIQ A;  2R7F A;  4BYY A;  5IT9 Z;  1ZLJ A;  1K78 B;  4Q48 A;  3GFL A;  4KA4 A;  4RB1 A;  1ZRD A;  1LDJ A;  3U1D A;  4BHB A;  2Z9O A;  3R60 A;  2RQP A;  4EM2 A;  4WK8 F;  3ZN0 A;  3ABT A;  1YS6 A;  1U2W A;  1SMY F;  3FHZ A;  2D1V A;  4AWX B;  2KRF A;  3F6O A;  3AAF A;  4OMY A;  2F5C A;  3EDP A;  5D8K B;  1D3Y A;  4U7B A;  1FSH A;  1U8R A;  3E6C C;  3F6V A;  2V9V A;  2V1D A;  3LA2 A;  2X4H A;  3W6K B;  2NAZ A;  4YIF A;  4G7Z F;  1XMA A;  1BJA A;  2GAU A;  2O0Y A;  2W25 A;  1O7F A;  2KIU A;  3MFK A;  1IW7 F;  4IVN A;  2CWE A;  4LFU A;  2FBH A;  4MQV A;  1Z7U A;  1S7A A;  2EB7 A;  1HW1 A;  3K1M A;  1ZYR F;  3J81 K;  2A5Y B;  1MDM B;  2EFQ A;  3DV8 A;  3BPV A;  2KIF A;  1E17 A;  3F8M A;  2RC4 A;  3LQQ A;  2HR3 A;  4I0B A;  2BYV E;  3SHF A;  2K4B A;  4HA8 A;  2PQ8 A;  3ZMZ A;  5D5V B;  2WC2 A;  5ED4 A;  3LA3 A;  2MH9 A;  3GZ5 A;  4PCQ A;  3D5L A;  3NQO A;  2BGC A;  4GCV A;  4LGW A;  4XBF A;  3IKT A;  2P5L C;  2LF8 A;  1I5Z A;  2EV0 A;  4I09 A;  1YW8 A;  2DQR A;  3BZ6 A;  1O57 A;  5IT3 A;  3FXQ A;  4HV5 A;  4O3M A;  1MD0 A;  4P9F A;  3MQ0 A;  5H6Q A;  1J5Y A;  5E1Z B;  4A12 A;  2AS5 F;  2M45 A;  1IUY A;  2EWN A;  5JVT A;  2O3F A;  2VOP A;  3LAJ A;  1R58 A;  1UFM A;  3PFI A;  3ZMU A;  1FC3 A;  2IA0 A;  3VOE A;  3HTS B;  1RZ4 A;  1XGN A;  3RJP A;  4IF4 A;  3FXR A;  3J80 Z;  1LVA A;  4OMZ A;  3RPQ A;  4A5M A;  1QZY A;  2PJP A;  5D4S A;  3DQV C;  1U3E M;  3TDU C;  1SD4 A;  2HYG D;  2ZME A;  3GVA A;  4KT5 C;  3CLO A;  1EV7 A;  3WOD F;  2LSO A;  1WQ2 A;  3VOD A;  2ZJ2 A;  4CYD A;  1BC8 C;  4Q5S F;  4CIC A;  3H92 A;  4IRH A;  3BY6 A;  3GFM A;  3IRQ A;  1YTY A;  1PP8 F;  1NHA A;  2M30 A;  3FF5 A;  3K1N A;  5DD4 A;  4M71 A;  2O8X A;  3CO6 C;  4KFC A;  3FMQ A;  1KA8 A;  3KP6 A;  2CQK A;  2FU4 A;  2ZME B;  4ASN A;  2H94 A;  3CO7 C;  5H6R A;  4O5V A;  3TGN A;  4G8X A;  2M5W A;  4A5N A;  3SXY A;  2XAF A;  3L2C A;  3RI4 A;  1RIO H;  2FBK A;  1R22 A;  3V4G A;  2NNY A;  3RYR A;  2IJL A;  5KVR A;  1Z6T A;  1CGP A;  1T0F A;  3BP8 A;  4MEY F;  2MC3 A;  5DCM A;  2GA2 A;  2YX4 A;  4HLX A;  2DK8 A;  4A6E A;  1B9N A;  2R7D A;  3F8C A;  3WE3 A;  1JGS A;  5CVV A;  5BS6 A;  1H9G A;  3V7S A;  4KDP A;  2PI0 A;  2ZKZ A;  2VBZ A;  4LD5 A;  5CVJ A;  3E5X A;  4GYI A;  3IHU A;  2EFN A;  3JSP A;  4AD9 A;  4IHT A;  1XGO A;  2VT3 A;  3I58 A;  2QBY B;  3QPH A;  4N9I A;  2FOK A;  1XCB A;  2IVM A;  2V1U A;  2XUB A;  2OBP A;  1DPR A;  1SFE A;  3VFZ A;  1W7P A;  2EV6 A;  4BH9 A;  2XAS A;  1KU7 A;  4XSZ F;  2OZ6 A;  2VT2 A;  3HRM A;  1PUE E;  4GYG A;  1OMI A;  1USS A;  3ML6 A;  4RB3 C;  4CDG A;  3GFI A;  1DPU A;  4G6D A;  2VON A;  2L4M A;  1P4W A;  3M7G A;  3P9I A;  4GGG A;  1U78 A;  4FHT A;  4GO1 A;  2OD5 A;  4HQM A;  2G9W A;  4R79 A;  2KJC A;  5D6F A;  3GO5 A;  3EUH A;  4RGU A;  1KQ8 A;  3TDZ C;  1QNT A;  2TDX A;  3SQN A;  1W4M A;  1VTN C;  4S05 A;  4Y13 A;  3EQL F;  2XRO A;  2HTJ A;  2DO7 A;  5HVQ C;  1ON2 A;  4DQ2 A;  2PMU A;  1XGM A;  2Y0M A;  1IRG A;  3ZP5 A;  4WWC A;  3Q9S A;  1YO5 C;  4G7O F;  2NNN A;  2D1H A;  1IZ1 A;  3FWE A;  1BC7 C;  5L3E A;  1DP7 P;  1ZG3 A;  3QOP A;  1FSE A;  1S29 A;  4BQA A;  3CJN A;  1ZG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...