5H20A

X-ray structure of padr-like transcription factor from bacteroid fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
DNVKSQMRKGMLEYCIMLLLHKEPAYASDIIQKLKEARLIVVEGTLYPLLTRLKNDDLLSYEWVESTQGPPRKYYKLTGKGESFLGELEASWKELNETVNHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of BF2549, a PadR-like transcription factor from Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transcription regulator
molecule keywords Putative PadR-family transcriptional regulatory protein
total genus 32
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5h20A00
4A6EA 3DFGA 4MQVA 2ADUA 2COMA 2DFIA 3BWGA 3CUQA 1HSJA 1XSDA 1MJAA 4UV8A 2LF7A 2P5KA 3H92A 4MHGA 1T2KA 4KA4A 4IXAA 1HW1A 1YW7A 2P8TA 4BHCA 3MWMA 1R1UA 3HRMA 4FX4A 4A0ZA 3KCCA 2GXBA 2QM3A 1X3UA 1ZN2A 3WTXC 3E6CC 2BGCA 3HOTA 1J5YA 1MD0A 1W7PD 1S6LA 1Z1DA 4MGRA 5L3EA 3R6SA 2K7LA 1BC7C 1I5ZA 1LDJA 2M45A 1XMKA 5ERIA 3V7CA 3SZPA 5E20A 3BJ6A 2W85A 2LF8A 3KP5A 4L9NA 3KZYA 4ZYHA 3TOAA 4U7DA 1O7LA 4G8XA 4U7BA 2DK8A 3KP7A 4YG2F 2VOOA 4IVNA 1S8NA 2FA5A 4ENNA 2ZBKA 3G3ZA 6PAXA 1KYZA 2OD5A 3BZ6A 4I01A 2W84A 1JE8A 1XD7A 2HKOA 4JBAA 5L3CA 3I53A 2P4WA 5FLXZ 3LFKA 3IHUA 2MLGA 3ZN0A 3GZ6A 1YTYA 2CSOA 4EJVA 4I0BA 3SXYA 1NHAA 4RGXA 4L9TA 3NEUA 1DDNA 4S05A 1KQ0A 2FMYA 1W5TA 5HS9A 3ZN1A 1YFHA 4M9ZA 2O61A 2K02A 1FWZA 5FD5A 4A0XA 3Q5FA 1FYMA 2VN2A 3GUDA 4GXOA 3V7RA 5FGMA 3RI4A 2HR3A 5FLXK 4UUVA 4AIHA 5DUKA 2IPQX 4RGRA 2GAUA 4U0VA 1WSUA 3RKYA 1D8JA 2PJPA 1SMYF 1ZRCA 1YO5C 2HS5A 3HHGA 1CF7A 4NQWA 1U5TA 4LG0B 3F23A 4A5MA 1C0WA 1XN7A 4D0PA 1DUXC 3LQQA 3R61A 5CVJA 1UCRA 3LA2A 1TNTA 1PP7U 4A0YA 2ZMEA 3KETA 3G73A 1XCVA 3QP6A 2IP2A 3FXQA 5K5RA 1BBYA 4KICA 1P4XA 5D5UB 2KKOA 1WRJA 3W6KB 4HX8A 2PLYA 1OKRA 4LB5A 1IF1A 2M8EA 5H20A 1JGSA 4HX4A 2OA4A 1HQCA 4ESJA 3J80Z 2STWA 3V4GA 3NQOA 1D3YA 4ASNA 1R1TA 4G6DA 4NB5A 2V6CA 1FC3A 3WGGA 2ZCWA 4I09A 1IN8A 2ZNZA 1IXSB 2QQ9A 3B02A 3F3XA 2NNYA 1V3FA 4Q47A 2PG4A 4AIKA 3DV8A 3F8FA 2X4HA 2O0YA 4M72A 4LJZF 3DKWA 3DPLC 2DU9A 4HW0A 3ZMTA 1S3JA 5TJJA 4Q4ZF 4ESBA 5A2QK 3WGIA 4P9UA 5F1RA 5HOOA 1UHWA 1T38A 1IN6A 3RPQA 2AS5F 3LAJA 3HHHA 4CYDA 1S7OA 2L54A 3K1PA 3HRSA 2RDPA 2DK5A 2XAQA 5K1YA 3IWFA 3JTHA 4HAMA 3E3VA 4RB3C 2OBPA 1J2XA 1SAXA 4UXNA 4XRFA 1R00A 4YFKF 2HKXA 2LSOA 1LJ9A 1O3RA 2FBIA 4L18B 1BM9A 1Z7UA 1IRFA 3HRUA 2VC0A 3WE3A 3TDZC 5BMZA 4KT5C 1GXPA 1FOKA 4KDPA 4K2EA 3K9TA 5KVRA 5E1WA 4OOIA 4WF2A 1ZREA 1BJAA 2G7UA 3BJAA 1KQ8A 2JZYA 4N9IA 4O5VA 1YQAA 3GFJA 5E1ZB 3MEXA 2LDUA 2R7FA 5HLIA 2FNAA 1F4KA 2XROA 4RB0A 5E18F 5J6XA 1HKTA 2DO7A 3FMRA 4UNOA 2F5FA 2QZ8A 5A2QZ 5L3BA 3RKWA 4CGZA 2AXLA 4XLPF 5F64A 4KFCA 4PGGA 2XRNA 4UVBA 2ZXJA 3CJNA 3OOPA 4UVCA 5L3FA 5CVUA 3TO9A 4OU0A 1R5HA 5CVVA 4LD5A 5FD6A 2LNBA 1BOAA 4XBFA 2VODA 3CTAA 2WC2A 3CO7C 3RYRA 1LVAA 4AIJA 3BOQA 4EMSA 1ZYRF 3RPUA 2CWEA 2A69F 2A6HF 1HBXG 2V1XA 4JQFA 1I1SA 5L3GA 5HLHA 2JPBA 2XUBA 2A5YB 5BQTA 4L9VA 3ZMVA 3I59A 3GZ5A 1ZGJA 1S7AA 2CGPA 2EK5A 5D8LB 3J7AO 3TOBA 1XGSA 3TGNA 5BS6A 3FWEA 3JAMK 1QGPA 1H9GA 1YW9A 2CYYA 3WU1B 1I27A 2XKOA 3K2ZA 5H6RA 3P7NA 3WGHA 3O6BB 5ICCA 2O3FA 4E70A 2G7HA 2ZO4A 3GXOA 2VBZA 4RS8A 3SFZA 2J5OA 5HDKA 2JRTA 1BIAA 4EJUA 4PCQA 4P55A 2ESHA 2F5EA 1LDKB 3E5QA 3ROUA 1P4WA 1IXRC 4LK1F 5DD4A 1TW3A 5IT3A 2A3SA 2FRHA 3ML6A 4LGWA 4OMZA 4ENKA 2DQRA 2IA0A 3AAFA 4A5NA 3CDHA 2ZFWA 1I1GA 2G9WA 2Z33A 2FQ3A 4F7ZA 5H6QA 5AONA 4MTEA 5LGTA 2R7DA 3CUQC 4L0YB 2XIGA 1D8KA 4HDVA 4RGUA 1OR7A 3QOPA 2GIVA 3I58A 5E17F 3HSEA 3S2WA 3GEZA 2Z9OA 1B1BA 3TQNA 2ZJ2A 4UVAA 4WCGA 4GO1A 4S04A 2RGVA 3QU6A 4AD9A 2QUFA 5ILSA 3GLXA 5D6EA 1P2FA 1HKSA 1WKMA 1UB9A 2OAZA 2DT5A 2IW5A 4RAYA 1G3TA 1FP1D 3JAMZ 1L0OC 4LMYA 3MZYA 3V7SA 3LSTA 3L00A 4MTDA 2GXGA 2OQGA 3QP5A 1J0RA 2V79A 2YX7A 2EJRA 3DEUA 2XV4S 3IKVA 4BHPA 5LRRA 2L01A 1HW2A 1K6OA 3JSOA 4HBLA 2BBYA 3D5LA 1P92A 1T39A 2QVOA 2IA1A 5D8KB 3I71A 1BI2A 1LB2A 1IZ1A 1USTA 1MDMA 2Q8KA 5HS7A 3F6VA 2DBBA 3CUOA 1CGPA 2UWMA 2MA3A 1K79A 2CG4A 3QU3A 1O7FA 2QYOA 1G3YA 3ABTA 2BYVE 2EFQA 1OPCA 5E8GA 3EYIA 1DPUA 2ZMEB 5E1XA 3QPHA 1B9MA 4CO8A 1H0MA 1J9IA 1E17A 4RGSA 2EB7A 1ON2A 4IHTA 4IRHA 3KZZA 2CO5A 2OQRA 4ZYGA 5K5QA 2FE3A 2BE5F 3E6DA 1GHCA 5LGUA 2F5DA 2NYXA 1OMIA 1RIOH 1YG2A 1PDNC 3GVAA 1LQ1A 2F5CA 3K69A 1Z05A 2BV6A 2XVCA 3B73A 2KIFA 1O3SA 2PQ8A 1ZLJA 4P9FA 4R8HA 2M30A 3ECOA 2VONA 3LA3A 2H09A 3QRFF 1SD5A 5LRSA 1TTYA 3GFLA 5CVRA 2UXNA 1REPC 1R22A 4IF4A 2A6EF 2V9VA 3FXUA 3GX4X 4CZZA 3FMSA 2EFOA 1MJBA 4BH9A 1DP7P 3F22A 4CHUA 3MZHA 4DQ2A 2W24A 3I0TA 4IRIA 2YPRA 5DCMB 1U78A 1XSVA 2DW4A 2Z99A 4WX9A 1WQ2A 3F72A 1B9NA 4HV6A 2W25A 4BAYA 5CYVA 5LEJA 4ZZLA 1W5SA 2QQBA 2EV0A 4H0EA 3ABUA 1QO0D 4EV0A 1FLIA 2NNNA 2QLZA 3T1BA 4HF1A 3WTVC 2O03A 3IC7A 4GYGA 3VB2A 5L3DA 3I54A 5D5XB 3WTSC 2D45A 4LFUA 1KU7A 5D5VB 4M9SA 1CF7B 5F6FA 2H6BA 4N0BA 1RZ4A 3K0LA 5DD8A 3KP2A 3HTUA 1WWXA 3F8BA 4O6JA 3GF2A 3T5XA 4CDGA 2NS0A 4XSXF 2K86A 4Z2YA 1AOYA 1FP2A 3I5UA 3MFKA 3P9CA 1FYKA 4KIBA 1QBJA 2HQNA 4OIRF 2E7WA 3ECHA 1ZGAA 1I6XA 1YIOA 1F9NA 1HSTA 1FY7A 3E5UA 3LWFA 4HLXA 3PFIA 2MBFA 1EH6A 2VE9A 2D2WA 3R0JA 1U8RA 2D1HA 5D5WB 1XSXA 2Y48A 4WXDA 1FX7A 1A04A 1G6NA 3IKTA 4R79A 2RNJA 4JK1X 4YIFA 4I7HA 1VTNC 2C6YA 5HVQC 1KU2A 3MQ0A 1ZRDA 3GO5A 2L4AA 2K4BA 3KP3A 2PMHA 1B6AA 3GFMA 2WV0A 4B8XA 2EV5A 1BN5A 2QQAA 1UFMA 3NRVA 5DYMA 2W57A 1IN7A 2ISYA 1ZAOA 2PEXA 4YFNF 3K1MA 1U5TC 4FHTA 4HF0A 1ZHFA 3ZPLA 4G7ZF 3HSRA 3FF5A 4HZFA 3M9AA 3HOSA 5JVTA 2EFNA 2HEOA 4RAZA 1RI7A 3N97A 3KE2A 3L2CA 4I98B 3RIRA 2NRAC 4B09A 1T0FA 2H94A 2RV8A 2A61A 3WTUC 5DCFA 2F2EA 2V1DA 4L9JA 3SZTA 5DDGA 1BI0A 3HYIA 4WK8F 4LB6B 2ETHA 3ZP5A 4IRGA 3RYPA 2P5LC 3ZMSA 1XMAA 4UHTA 3IRQA 2P6SA 3BPXA 2HFHA 2QBYB 1KU3A 1DPRA 4ENMA 5ILVA 4XLNF 2YX4A 3TKYA 2RVCA 3T8RA 5JR3A 4BQAA 2VOPA 2K4JA 3GW2A 4EM1A 3LQRA 3BJOA 4A12A 4P96A 2JPCA 1IXCA 3N4MA 3JTGA 1U6GA 3E6MA 5EEHA 1ULYA 1PUEE 3EYYA 1TW2A 1XDSA 2R3SA 2FXAA 4EGZA 4EJTA 4KUMA 2Z5UA 3VFZA 4M6YA 1XGMA 1UHMA 1YLFA 4GCVA 2H27A 5D4SA 1TQMA 5FB2A 2L3DA 1B4AA 3FXRA 2OZUA 2DPDA 4M6XA 3C3WA 1JHHA 1ZRFA 3CUQB 3L7WA 3CO6C 2P7CB 1R1VA 3PQKA 2K27A 2A68F 1KGSA 2FBHA 5FFXA 1QQIA 4PZJA 3WODF 1QNTA 1SFEA 4WXCA 5LBQA 2BEOA 2EA2A 3ISPA 1ON1A 3JSPA 2VC1A 4EQQA 4MEYF 3P9IA 2TDXA 3WTWC 3ULQB 5ED4A 4G7OF 5HDNA 4XSZF 4EGYA 2X0LA 3H3ZA 4I02A 3U1DA 3J81Z 1K78B 1MDMB 2DPUA 1TNSA 2UZKA 5D4RA 4HX7A 2VT2A 1Z6RA 1U2WA 3T0YA 1WI9A 3GFIA 3SQNA 4EJWA 4OIQF 5IT9Z 3Q9SA 1XCBA 5DUIA 1XB4A 3RKXA 1SD7A 2ELHA 1TQIA 2LKPA 1JXSA 3KLNA 5DCMA 4U88A 2KIMA 1FBQA 4G94A 4KMUX 1LNWA 2Q2EA 4A2UA 3R4KA 1G3WA 4ESFA 1QZZA 4HV5A 2CFXA 5BOXA 2YR2A 3BDDA 2RKHA 5LLQA 1HW5A 2RC4A 4KYWA 3COAC 5HLGA 5CJ9A 2OU2A 2M5WA 4R1HA 2GWRA 3DPTA 5LEKA 4EJOA 2PBIA 1ODDA 4OIPF 1LEBA 1ZG5A 2FEZA 3QAHA 3VOEA 2FMLA 1R58A 3EETA 1K78A 1GXQA 4EM0B 3WG9A 3KP4A 3C1DA 1FBSA 1Q1HA 2P7VB 1TLHB 4L5JA 3VEPA 2O8XA 3M8EA 1BIBA 1FT9A 1T6SA 2EFPA 5CVIA 2ACJA 3BP8A 1Z91A 2JSCA 5JI6A 3TO7A 1E2XA 4M9XA 2VXZA 3U2RA 5LGNA 5KK1A 1LDDA 1LEAA 2HWVA 3LAPA 1W7PB 1T98A 1J7KA 3GWZA 3EQLF 3Q9VA 2GA2A 1IAWA 4ENJA 4LK0F 5K5OA 3IL2A 4IPAA 2DQLA 1XGNA 1USSA 4EM2A 2EV6A 2EA4A 2D1VA 1FPQA 1ZG1A 4M73A 2JTVA 3TDUC 4LLLA 3BROA 3ZQ7A 2VBXA 2P6TA 2Y75A 5BPDA 3RTRA 2DI3A 3PQJA 3ELKA 2ZNYA 2EWNA 2XAFA 3FM5A 1R5GA 2JT1A 2KJCA 4U0WA 4BXUA 1ZH5A 1EH8A 2QBYA 5ILUA 1RUOA 1Y0UA 4KIFA 2IVMA 2WWYA 1MJ9A 2M87A 4OMYA 1BC8C 2HYFA 4RB1A 1BI1A 3JW4A 1K7AA 4NHJA 3MAJA 4LLGF 2OZ6A 4MEXF 1O57A 1JHFA 2HYGD 3BPVA 3HIFA 2XHKA 2XAHA 1O3QA 4BYYA 1O3TA 3F6OA 2VBWA 2RQPA 3FX3A 4IJAA 4I2OA 3F8NA 3TO6A 3FHZA 2ISZA 3V8JA 3WTTC 1ZG3A 4BNCA 1U5TB 1YS6A 5J8FA 2YU3A 2XAJA 4YIIA 2A07F 2VT3A 1OYYA 2QENA 2IRFG 1D5VA 2MC3A 1TQPA 3F21A 4KIGA 1FZPB 2IJLA 1R36A 2CQKA 2XAGA 3DQVC 2GA1A 3MCZA 5EEGA 3HTSB 5TRDA 4FX0A 5DEQA 4HLYA 4ZYDA 1YYVA 4HQMA 2NAZA 2P5VA 3BY6A 2EFWA 2DAOA 4CXFA 5DV5A 2H6CA 3FMQA 3FM3A 2MH2A 2XASA 1YS7A 1KU9A 4OINF 1P6RA 4HF2A 2FOKA 1IUYA 3E97A 1STZA 1GVJA 4U0YA 3CLOA 4ZH4F 1EH7A 2RN7A 2HTJA 4OIOF 4MNUA 5CLSA 3DF8A 4AVPA 3U9GA 1MZBA 2PN6A 1OYWA 3ZMZA 4AWXB 3E6BA 1SFXA 1W4MA 3KEQA 3D0SA 3C18A 3J80K 4UV9A 2VBYA 3V8KA 3HSFA 3I64A 1KA8A 5ICEA 1ZLKA 2PFBA 3WU0A 3C7JA 4KN7X 2FNPA 1IRGA 4Y15A 1G3SA 2HTSA 1V4RA 3FZVA 2PMUA 4DNCA 4ZZDA 2GZWA 2CW0F 2MLKA 1HKQA 5AIPA 3OV8A 2KIUA 4GGGA 3F8MA 1YW8A 5FFZA 5D6FA 4I0AA 4M74A 4HQEA 5JFRA 3IRRA 3KFWX 4HA8A 2XGXA 1IW7F 4KMFA 2E1CA 3E5XA 5JHUA 4KN4X 4CICA 2E1NA 3H3UA 4LG0A 5LHIA 4MQ9F 2MH9A 1S29A 3K1NA 1FBUA 4KNYA 1FNNA 5FO5A 4L0ZB 1SD4A 1IN4A 3P9KA 3W6JB 2Q0OA 4QWQA 1SMTA 3M1EA 1OYIA 1TBXA 3R60A 1H9TA 1SD6A 2PI0A 3V8LA 4A6DA 4TV7A 4WWCA 2HGCA 3REOA 3EUHA 1EV7A 2HZTA 3WTZA 3IWZA 2HDCA 4ZYEA 3ZMUA 5J8CA 2DTRA 2ESNA 4P5OA 2L4MA 1QPMA 1G4DA 4N9HA 2MD5A 5LHHA 1KQ9A 2STTA 3F8CA 2E7XA 3T8TA 4ETSA 3KP6A 3I59B 4G7HF 1Z6TA 2B0LA 2J5PA 2O6GE 1ZARA 4LLNA 3QPTA 5E8IA 2FBKA 2IA2A 4BHBA 1SFUA 3HRTA 3KEOA 3I4PA 3J81K 2GQQA 2Z3YA 2FF4A 2FSWA 3O2PE 3RDIA 3HUGA 1F5TA 5HDGA 1Z9CA 1L3LA 3M8FA 4RB2C 1IN5A 5IT9K 1RNLA 4EVIA 2UXXA 1J75A 3DXJF 4WXHA 4HDUA 4M71A 1J59A 4ON0A 1R23A 4Y17A 2VE8A 1B59A 4G9YA 1PP8F 2V1UA 4QLCU 1R7JA 1XGOA 4Q48A 5ICFA 3KLOA 3M7GA 4PDKA 3ZMDA 3SHFA 3L9FA 2IT0A 2YSRA 1F1ZA 2M1BA 3EDPA 4L5IA 4FT8A 1KYWA 3L09A 4IHSA 3ERED 3VODA 4HYEA 2KJBA 1XDUA 1FYLA 1W7PA 1U3EM 1QZYA 2FU4A 3LA7A 2XKPA 1P4AA 4PGHA 1RUNA 4GYIA 5BPIA 4O3MA 5LHGA 1AWCA 1FSHA 1FSEA 4Q5SF 3RJPA 5AIQA 2KRFA 2ZKZA 1MGTA 2Y0MA 2HQRA 4YFXF 2L02A 1ONVA 4G6QA 3O3KA 5HS8A 4Y13A 2HOEA 4HOBA 3R0AA 1BI3A 3WTYC 2WTEA 1HXDA 3DP7A 3GYHX 2DLLA 3WE2A 5ICGA 2QWWA 1MKMA
chains in the Genus database with same CATH superfamily
4A6EA 3DFGA 3QYEA 4MQVA 5F0CA 2OV7A 2L7KA 4B3XA 1FMWA 2VJ5A 4G12A 2ADUA 2A6TA 2COMA 4RLQA 5C3EJ 2IXSA 4UY8I 4I99C 3HOWJ 2DFIA 3BWGA 3CUQA 4OWRB 4XKCA 2LVSA 2P0WA 3HJEA 1HSJA 3LSIA 2WAQA 3IAM2 4BACA 1XSDA 1MJAA 2WY8Q 3OYGA 4UV8A 4D1QA 1ERDA 1NK2P 2LF7A 2P5KA 3H92A 4MHGA 1T2KA 4KA4A 4IXAA 1HW1A 5KHDA 4M3DA 3IH3A 2I5UA 1VI0A 1YW7A 2P8TA 2VKVA 4BHCA 2LMDA 3MWMA 2LKXA 4PJMA 2EZLA 1R1UA 2RNGA 3HRMA 2DMUA 4FX4A 3PNVA 5FLMJ 2DT7B 4A0ZA 2XB0X 2ID6A 2LH9A 1GV2A 2DDAA 3KCCA 3FISA 3GLLA 1MH3A 1MSEC 2GXBA 3HKZN 1OFCX 2QM3A 5IP6A 1X3UA 2L7ZA 2BY3A 3OIOA 1W1WE 4A3EJ 1ZN2A 1VQ8I 2M7BA 3WTXC 3O8GA 5CQGA 3E6CC 2BGCA 2BHYA 3HOTA 1J5YA 3KYCB 4XRSA 1MD0A 1W7PD 1X3ZB 2QSFX 3FDYA 1S6LA 3PNYA 1Z1DA 2MG4A 4MGRA 5L3EA 1BR1A 3R6SA 2K7LA 1BC7C 1I5ZA 1WJAA 3GBGA 1LDJA 2M45A 3H9QA 2AHQA 1XMKA 5ERIA 5M5XJ 4RLFA 3V7CA 3SZPA 5E20A 4AIDA 2IS2A 4CUGA 5DM6F 2QCOA 3BTJA 2W00A 3BJ6A 2W85A 4AYBA 2LF8A 3KP5A 4L9NA 3KZYA 4ZYHA 3F0CA 3GTLJ 4ZTFA 2OCCH 3TOAA 4U7DA 1Y1VJ 2WADA 1O7LA 4G8XA 4XKBA 1U0JA 1SFOJ 3DU5A 4U7BA 1VQ4I 2DK8A 1YOVB 2FQ4A 3MMYB 3KP7A 4YG2F 3PSIA 2VOOA 2DFFA 5K7HA 3BR3A 4IVNA 4XRSG 3GMEA 1I3QJ 3CCEI 1G8XA 1S8NA 1U9OA 4X6AJ 2FA5A 4XR6A 5B1AH 2JWTA 2NOGA 3G2BA 4ENNA 4MFDA 2E34A 2WA0A 2ZBKA 1WJEA 3G3ZA 6PAXA 1KYZA 2OD5A 3BZ6A 4I01A 3OYHA 2BZTA 4S0HB 2W84A 3S8PA 1JE8A 2HPIA 1XD7A 2HKOA 4JBAA 2A05A 2DA3A 5L3CA 3I53A 4C3HJ 4QPQA 2JSPA 2P4WA 5FLXZ 3LFKA 3IHUA 1QHGA 2L2OA 2MLGA 1ZELA 3ZN0A 3VWBA 1RRJA 3GZ6A 2F6CA 1YTYA 2CSOA 1LFBA 3OYEA 4EJVA 4I0BA 4NDLA 3DLLF 1JKRC 3SXYA 3PM1A 5CQEA 1IRXA 2NVXJ 2VUMJ 3OS1A 1NHAA 4RGXA 1AA7A 3OL3A 1MBJA 4V19K 4L9TA 3NEUA 3BZCA 1DDNA 4B44A 3KIOA 3ZQQA 2GOXB 4S05A 3CCLI 1KQ0A 2FMYA 1OJLA 1W5TA 5DTDA 1TWCJ 4FE7A 5HS9A 3U1KA 2QSGX 2KHMA 3M8JA 3M3YJ 3ZN1A 4DZPA 2DA4A 1QPIA 2V7FA 1YFHA 1JTXA 2HU9A 2X9DA 4M9ZA 2M7AA 2X1EA 3M4OJ 2O61A 3HPHA 2K02A 1FWZA 5FD5A 3FHNA 4A0XA 3Q5FA 1FYMA 2VN2A 3K4MA 3GUDA 1BR2A 3H3VK 4GXOA 3V7RA 4B3AA 2BY0A 3Q0WA 4M3FA 3BR2A 5FGMA 3RI4A 2HR3A 5FLXK 4UUVA 4AIHA 3TEDA 5DUKA 2IPQX 4RGRA 4A3LJ 4LITA 2GAUA 2QKMB 4YRVA 4U0VA 1X1BA 1SFKA 2LY9A 2LYCA 5JVGF 1WSUA 3RKYA 2CUEA 1D8JA 2PJPA 1SMYF 1ZRCA 4DYCA 1YO5C 2DMNA 1PUFB 1P9QC 2HS5A 3OOUA 3OSGA 4JX6A 2CFOA 3HHGA 4PFPA 4LOCA 2FX0A 4NQWA 3CMMA 3BZKA 1CF7A 1U5TA 4DBRA 3SYTA 3CC4I 3F23A 4LG0B 4XLFA 2GBYA 4A5MA 4IO9F 2VL8A 5IP9J 5E3MA 1SVMA 3L2RA 1C0WA 2PJRB 1JUPA 1XN7A 3WHCA 4D0PA 1DUXC 3LQQA 3R61A 1XPXA 2BHZA 5CVJA 1UCRA 3LA2A 2E2HJ 1TNTA 1PP7U 1UG2A 5GAHJ 4A0YA 4P1WA 2ZMEA 3H5AA 4YEJA 1A5JA 3KETA 3G73A 1YRNA 1XCVA 3QP6A 2VQHA 4BQNA 2R0QC 2MD0A 2IP2A 2TRTA 4NBQA 3FXQA 4XIDA 2JA8J 1HA8A 5K5RA 1BBYA 4KICA 3I3LA 4XQFA 1SAUA 2R7WA 1P4XA 1UZCA 5D5UB 2KKOA 3CJTB 4ZJZA 4BGDA 2KRCA 2BVMA 1WRJA 3W6KB 3QPLA 4HX8A 2I10A 2PLYA 2JRMA 1OKRA 3JRIA 2V9PA 1T0FC 4JX5A 1YIJI 4LB5A 1IF1A 1JKQC 2M8EA 3SEQA 1QRYA 1JKOC 4D9JA 5H20A 4F92B 1JGSA 2M2EA 1WJDA 4HX4A 2OA4A 2CH0A 1R9TJ 1HQCA 3SZGA 2Y69H 4ESJA 4NC7A 4PSWA 2R4GA 1UG0A 3MKYB 2LD5A 3J80Z 2STWA 2E5NA 1I6HJ 3V4GA 3NQOA 4CCOA 3JR9A 1QVTA 1D3YA 4ASNA 3ZQHA 2Z2SB 2X1DA 1R1TA 4G6DA 4NB5A 2V6CA 2X85A 4XMYA 2M8GX 1FC3A 2G0EA 1EKEA 3WGGA 1M1EB 2ZCWA 4I09A 2DA7A 1IN8A 4NC6A 2ZNZA 5F0HA 1HC8A 1IXSB 3JRFA 2QQ9A 3B02A 3F3XA 5EEAA 2NNYA 4DBQA 1V3FA 2HI3A 4Q47A 5F27A 2PG4A 5J1UA 4AIKA 2NXNB 3DV8A 4G6TB 3F8FA 1I3AA 2HQ5A 2X4HA 3HUGB 4CCNA 2O0YA 3LSMA 4M72A 1GT0C 4LJZF 3DKWA 3DPLC 2DU9A 4HW0A 3ZMTA 4J00A 4PUSA 1S3JA 3HOUJ 3LOCA 1PYVA 5TJJA 4Q4ZF 4ESBA 1K6YA 5A2QK 2CUFA 3WGIA 3K70C 4P9UA 2GIZA 5F1RA 5HOOA 1UHWA 1XG1A 1T38A 1HF0A 1IN6A 4DJAA 3RPQA 2AS5F 5KNLA 4MLOA 3LAJA 3HHHA 4Y4RA 4CYDA 1S7OA 2L54A 3H0DA 3K1PA 3AG4H 5FKLA 3HRSA 2RDPA 1Z21A 2DK5A 2XAQA 5K1YA 3BTLA 2DA1A 3IWFA 3U21A 3JTHA 2PX9A 1JKPC 2JVGA 4HAMA 2QKLB 4XRMA 3E3VA 4RB3C 2OBPA 3VYTB 1J2XA 1SAXA 4UXNA 2X6YA 4XRFA 1FEXA 3BR0A 1R00A 3OR1C 2NVYJ 4YFKF 2HKXA 2LSOA 2CRGA 2EZHA 4RM3A 1LJ9A 3H5RA 1V54H 1O3RA 2FBIA 4QIWN 4L18B 1BM9A 1JJ8C 1Z7UA 1IRFA 2F4OB 3HRUA 1NG7A 2VC0A 3WE3A 3TDZC 3P5JA 5BMZA 4KT5C 2HVSA 1GXPA 1FOKA 3FBNB 2CUZA 2EZKA 4C2UA 4KDPA 4K2EA 5GPCA 4A3BJ 3VYUB 2BXZA 3K9TA 2ZMEC 4XOTA 2LC2A 5KVRA 5E1WA 4OOIA 5FRMA 4W1UA 4WF2A 2D5VA 4A3CJ 4BKXA 1ZREA 1BJAA 3BJAA 2G7UA 2VKEA 1KQ8A 1ORKA 2JZYA 4N9IA 2R5ZA 4O5VA 1YQAA 3GFJA 5E1ZB 3MEXA 2LDUA 2R7FA 5HLIA 2FNAA 5HLTA 2WAFA 1F4KA 2XROA 3CCYA 5J47A 1SANA 3CCRI 3Q0UA 4RB0A 5E18F 5J6XA 1HKTA 2DO7A 3HBLA 4CH7A 3CLQA 3FMRA 4UNOA 4BE1A 3TBIA 2F5FA 2QZ8A 2V9KA 5A2QZ 4ITVA 4HSRA 5L3BA 3CD6I 3A03A 3RKWA 4CGZA 2OTJI 2XSJC 3MKWB 2W4SA 2AXLA 3CCQI 4ZC3A 4XLPF 5F64A 4M3GA 4KFCA 3ABMH 4PGGA 4XLCA 1H88C 1YRNB 1R71A 5H2FC 2GM4A 2XRNA 4AUXA 4UVBA 2ZXJA 3CJNA 1TC3C 2WAEA 1FMVA 1T95A 4BXFA 9ANTA 2CQXA 3OOPA 3QOEA 3IAS2 4UVCA 1ETWA 5L3FA 5CVUA 4HSTA 3TO9A 4OU0A 5IOYA 2DODA 1R5HA 2EZIA 2L9SA 5CVVA 3DLAA 4LD5A 5FD6A 3A4CA 2LNBA 1BOAA 1DGWY 3E0JB 4XBFA 2E71A 5BNGA 4AC0A 2BXYA 2WC2A 3CTAA 2VODA 4FETA 4OAZA 3CO7C 3LSPA 3RYRA 2VQLA 4E7IA 1LVAA 4AIJA 1N25A 3BOQA 4EMSA 1ZYRF 2E36A 5EYRA 3RPUA 2R93J 2CWEA 4FE4A 2O8KA 2A69F 1WHUA 2A6HF 3LL7A 1HBXG 1IO2A 4XLEA 5EG0A 2V1XA 4JQFA 4BJTA 1I1SA 5L3GA 5HLHA 3ZXSA 2JPBA 3TW7A 1LKXA 2XUBA 1OCCH 2A5YB 5DM7F 5BQTA 4L9VA 3DEWA 3ZMVA 3I59A 3GZ5A 1ZGJA 1S7AA 2LG4A 5HNFA 2CGPA 1MMNA 2EK5A 5D8LB 3OL4A 3J7AO 1XC5A 1XGSA 3TGNA 3TOBA 5BS6A 3GTOJ 2Z16A 3FWEA 1T08B 5EZGA 3JAMK 1QGPA 5FKNA 4IHVA 3VSLA 5DS9A 1H9GA 1WJ5A 1YW9A 3BQZA 2CYYA 3WU1B 1I27A 3QYFA 2XKOA 1NG6A 3K2ZA 1LFUP 1JJ6C 3KPHA 2O9LA 5H6RA 1RPWA 3KEYA 3P7NA 1JUSA 1YX3A 2XF6A 3WGHA 3O6BB 3S14J 5ICCA 2WY7Q 4E6KG 1Y8QB 2O3FA 4E70A 2G7HA 2ZO4A 3GXOA 2VBZA 4XN3A 4PJNA 3K70D 4RS8A 1ZGWA 3SFZA 3Q0VA 5LD2C 3HGGA 2J5OA 4CSWA 3FXJA 2DDBA 5HDKA 2JRTA 1BIAA 3D5SC 2PJRA 3OIPA 4EJUA 2RQQA 2NS7A 4PCQA 2K40A 2JQ7A 4P55A 3E1SA 2ESHA 2XPUA 2F5EA 3MZ8A 3PIOF 1LDKB 3E5QA 3ROUA 4IEJA 1P4WA 1IXRC 1MMGA 1MMAA 3GTKJ 1VNDA 4LK1F 2AQFA 2VPRA 2YUSA 3BR5A 5DD4A 3OMYA 3UR3C 1TW3A 3S2DJ 3OYMA 1DU6A 5IT3A 4A3IJ 1AKHB 3CCSI 3GTQJ 2A3SA 2FRHA 3ML6A 1UMQA 4LGWA 2XGEA 4OMZA 4ENKA 2ID3A 3PJRA 2DQRA 2IA0A 3OYLA 1HDDC 1IRZA 2K9LA 3AAFA 4A5NA 2OTLI 3CDHA 2ZFWA 1I1GA 2G9WA 3CDLA 5EJCA 2Z33A 2FQ3A 1Y6IA 4F7ZA 3OYBA 1WJBA 4HPQA 3DKYA 5AONA 5H6QA 4MTEA 2R7DA 3CUQC 5LGTA 4L0YB 1WZ2A 2NVUB 3BCAA 4UB8C 2XIGA 1D8KA 4C3JJ 2WBMA 4HDVA 4RGUA 2GLOA 1OR7A 3QOPA 2GIVA 2Y0SN 3I58A 5GADJ 1R4MB 5E17F 3HSEA 3S2WA 1P7JA 3GZNB 3FBIB 3GEZA 3MKLA 4DIQA 2Z9OA 2LLKA 1BR4A 1EJ9A 1B1BA 1FIPA 4JP0A 3TQNA 4E7ZA 1X4OA 2ZJ2A 4UVAA 4WCGA 4GO1A 4S04A 3CF2A 5E3LA 3V42A 2RGVA 1X2MA 1A35A 3QU6A 2L0KA 2VQGA 4BS9A 5C4JJ 2X51A 3NARA 4AD9A 4BL0B 2KFDA 2MYSA 2QUFA 2IGMA 5ILSA 5J40A 3GLXA 5D6EA 5FLVA 2K3FA 1P2FA 2Y0SA 1HKSA 1WKMA 4H4KC 1UB9A 2OAZA 2DT5A 2IW5A 4RAYA 1G3TA 2PMZA 3DKXA 1FP1D 3JAMZ 3OS2A 4CZCA 1L0OC 5CPRB 4LMYA 3MZYA 2HPMA 1W36D 2XB5A 3A1YA 4RM2A 3DCFA 1BL0A 3EUKL 2TCTA 3V7SA 2XRLA 3AL0C 3OY9A 4PJLA 3LSTA 4D5CA 3AKZA 3L00A 1LUJB 1R4NB 2KZGA 4MTDA 2GXGA 2OUMA 4XONA 2OQGA 1E3PA 3QP5A 3LSGA 1J0RA 1ZR2A 1J09A 1V5FA 3I4MJ 2V79A 2YX7A 2JVHA 2EJRA 3DEUA 5LFAA 2ZXHA 2QSHX 3HEFA 4BXXJ 2XV4S 3IKVA 4X1EA 4RDUA 2ZJPF 4BHPA 1SVOA 5LRRA 2L01A 3QYBA 2PMZN 3CMAI 1HW2A 1K6OA 2IS6A 3JSOA 4BBRJ 1UELB 2HVRA 3IH2A 1B8IA 4HBLA 4BEHB 2BBYA 3D5LA 2KRHA 1P92A 2HYJA 2QA4I 2AXTC 1T39A 2QVOA 2IA1A 3ZCOA 5D8KB 1N77A 5IOZA 2VASA 3I71A 4A93J 1BI2A 1LB2A 3HM5A 2XPWA 2DOFA 1IZ1A 1B8IB 1USTA 1MDMA 2Q8KA 5HS7A 2V6EA 3F6VA 2DBBA 3LMMA 3CUOA 1CGPA 2H1KA 2UWMA 2MA3A 1K79A 3JRAA 1MNEA 1IGNA 2CG4A 3QU3A 1O7FA 1PJRA 2IAIA 2QYOA 1G3YA 4MIMA 4V2GA 2EIKH 3ABTA 3G71I 1UJ8A 2CV0A 3TP0A 2BYVE 4FQGA 2LK2A 1MBFA 2F4MB 2EFQA 1OPCA 4CYCB 5E8GA 3EYIA 3S3NA 2ZC2A 2E1OA 1MMDA 1DPUA 2ZMEB 5E1XA 3QPHA 4BE0A 1B9MA 3PUFA 4CO8A 1H0MA 1QU3A 1J9IA 1E17A 1YJWI 1IV6A 4RGSA 1ETQA 2EB7A 3S16J 1T33A 3CESA 3DEEA 1VFCA 4ZYAA 1ON2A 1XMXA 4IHTA 4X0GA 4IRHA 3KZZA 2CO5A 2OQRA 2V4JC 3GCMA 4ZYGA 5K5QA 2FE3A 1DGRM 1NTCA 2BE5F 3E6DA 3H9GA 1GHCA 3K4LA 5LGUA 3BG6A 2F5DA 2NYXA 1OMIA 1RIOH 1YG2A 1PDNC 2EIJH 2DOEA 3CQZJ 3PFYA 3GVAA 1LQ1A 2F5CA 3K69A 1Z05A 2E1MC 4XM3A 3M07A 2R7VA 2V26A 2BV6A 2JA2A 1R6RA 2XVCA 3B73A 2KIFA 1O3SA 2PQ8A 1ZLJA 4P9FA 2JA6J 2JUCA 4R8HA 2NVQJ 4DYRA 2M30A 2ZXWH 3BC8A 2M9HA 5EDNA 3ECOA 2VONA 3VYSB 3LA3A 2H09A 5IYCJ 2H8RA 1SD5A 5LRSA 3QRFF 1TTYA 2MGQA 3GFLA 4F52A 3HC7A 5IYBJ 2L9NA 5CVRA 2UXNA 1REPC 5F1JA 1VQKI 1R22A 3HKZA 4IF4A 2A6EF 2V9VA 3FXUA 4HG2A 3GX4X 3S2HJ 4CZZA 3OSFA 3FMSA 2CUJA 1ETXA 2EFOA 2EPFA 1MJBA 1CQTA 4BH9A 3UNGC 2P81A 4JX4A 1DP7P 3F22A 1XX5A 4CHUA 3Q3SA 3MZHA 3KYDB 3CP2A 4DQ2A 2W24A 3DBRB 3I0TA 3A01A 4IRIA 2YPRA 2R7UA 5DCMB 1U78A 2DYRH 1XSVA 1I39A 3RQIA 1TWHJ 2DW4A 2Z99A 3BG3A 1WQ2A 3F72A 4WX9A 1B9NA 4HV6A 2VB6A 4HEA2 3SDGA 4AYBN 2CV1A 1Z3YA 2W25A 2X6OA 4N4NB 2ME6A 2VQCA 1MBHA 4XL9A 3TP3A 4BAYA 4DYQA 5CYVA 4BQOA 3SFIA 3D1NI 5LEJA 4ZZLA 4F91B 1W5SA 3CMEI 3ZQIA 2QQBA 2EV0A 1SVLA 4H0EA 3ABUA 1QO0D 4EV0A 1FLIA 1D1BA 1XS9A 4HNVA 4YELA 3MVPA 1VQMI 3B6CA 1E3OC 2NNNA 2M0MA 2QLZA 3T1BA 4ZDPA 4HF1A 3WTVC 3G4SI 2O03A 2VJJA 1Z77A 3BG9A 4GRIA 3IC7A 4GYGA 2KMUA 1WI3A 2B9SA 3VB2A 2VPLA 2R5ZB 3K4CA 5L3DA 3I54A 5D5XB 3WTSC 1Y1WJ 1W0TA 2D45A 1AKHA 4LFUA 1KU7A 5D5VB 2A5WA 4M9SA 4FASD 1CF7B 2ELKA 5F6FA 2H6BA 4N0BA 2K3PA 1YE9A 1RZ4A 3K0LA 5DD8A 2ZJQF 2QQ8A 3KP2A 3HTUA 3W2VA 1WWXA 1E3HA 1ZKGA 3F8BA 3GF2A 4O6JA 3T5XA 4CDGA 2NS0A 4XSXF 3S3MA 1GDTA 2K86A 1FOWA 2IGOA 4Z2YA 1AOYA 3QPSA 1FP2A 2DA6A 3I5UA 3MFKA 5E3NA 2OC6A 4BDYA 4CCJA 3CDIA 1FOXA 2VXDA 3P9CA 4D5FA 3JRGA 1FYKA 1ETOA 4KIBA 1QBJA 2HQNA 4OIRF 2E7WA 5HNHA 1Y39A 3ECHA 1TWAJ 1I6XA 1ZGAA 1D0ZA 2WV1A 1YIOA 1KZHA 1D0XA 1RESA 2DJIA 4E7HA 1F9NA 1HSTA 1FY7A 3E5UA 5KCMA 1R49A 1VZ0A 3LWFA 2ECCA 4HLXA 2I8DA 3CP8A 2GXAA 2HZDA 3X2QH 2AO9A 1D1CA 2EQRA 2DA2A 3JRCA 4N4OB 4FISA 4C2MJ 1LE8B 1T8IA 3PFIA 3PO3J 4XNFA 2NS8A 3FXKA 2MBFA 1SC7A 4MFEA 3DBHB 1EH6A 2VE9A 3OYAA 2D2WA 3R0JA 2Y31A 4RBOA 1U8RA 2CW7A 2D1HA 3L2WA 5D5WB 1XSXA 2Y48A 2X48A 4WXDA 1FX7A 1A04A 1G6NA 1BOBA 3IKTA 4HNTA 3NAUA 3CCJI 4R79A 2RNJA 2EILH 4JK1X 4YIFA 2E60A 4I7HA 1VTNC 2C6YA 5HVQC 1KU2A 3MQ0A 1ZRDA 3GO5A 2DN0A 5TGTA 3BR1A 3DTIA 3BLYA 2ZSHB 2L4AA 5F0FA 2Y9ZA 1TL8A 2K4BA 3KP3A 4QPOA 1ETYA 4NQWB 3S1MJ 2PMHA 1ETVA 1B6AA 1OLTA 3GFMA 2WV0A 4B8XA 3UKGA 2DMPA 2EV5A 1BN5A 2QQAA 2JN6A 1UFMA 3NRVA 3K6GA 3CF5F 4W97A 5M5WJ 5DYMA 2W57A 4PK4A 3HB9A 1IN7A 2Z1DA 2ISYA 3G1LA 1ZAOA 2EIMH 2PEXA 4YFNF 3K1MA 5KAFC 1U5TC 1BW6A 4J19A 2O5RA 4FHTA 4HF0A 4C2TA 1ZHFA 2XF7A 4U87A 4B43A 3ZPLA 4G7ZF 3HSRA 3FF5A 4QSHA 3CMYA 4HZFA 1QVUA 3M9AA 3HOSA 5JVTA 1UAAA 2EFNA 2HEOA 2DMQA 4RAZA 4Z6YA 4IQJA 1RI7A 1YJ9I 1VQOI 3N97A 3KE2A 3L2CA 1HDPA 2QEXI 4I98B 3RIRA 2NRAC 1DU0A 3ZOBA 4B09A 1T0FA 1A6IA 2H94A 2RV8A 2LY1A 4UUSA 1F36A 2A61A 3OWTA 3WTUC 5DCFA 2F2EA 4V2FA 1HLVA 4DOZA 4D7MA 2V1DA 4L9JA 3SZTA 1OISA 3H0GJ 5DDGA 1BI0A 3HYIA 2K9QA 4WK8F 2KDOA 4LB6B 3TW6A 3RKQA 2ETHA 2W48A 3ZP5A 4IRGA 3RYPA 2P5LC 3ZMSA 2L7MP 1XMAA 4UHTA 1W0UA 3IRQA 3HXLA 2P6SA 1VQLI 1PVEA 3BPXA 1RKTA 3LSRA 2HFHA 2QBYB 1KU3A 1DPRA 4ENMA 5ILVA 4XLNF 3L2UA 2HOAA 2YX4A 3TKYA 4L5EA 2RVCA 3H1CA 3T8RA 5JR3A 1K4TA 3W2WA 5F04A 3IV5A 2B63J 2JA7J 4BQAA 3K2AA 2VOPA 5J1YA 2K4JA 3GW2A 3JCUC 4EM1A 5EGOA 4II3A 4LG3A 3LQRA 3BJOA 4B4CA 2Y2ZA 2X1CA 3ZRGA 4A12A 4P96A 2JPCA 1IXCA 3N05A 3N4MA 3JTGA 1N78A 1U6GA 2K9SA 3E6MA 5EEHA 1ULYA 4ABZA 4D7NA 3RZDJ 1PUEE 3EYYA 1TW2A 1XDSA 2R3SA 5TISC 4PJ0C 3LSKA 2FXAA 3L2VA 1GVDA 1VQNI 4EGZA 4EJTA 3KYLA 4KUMA 1V5GA 3MD2A 1JTYA 2Z5UA 3ZQGA 2JJ7A 3VFZA 4M6YA 1XGMA 1UHMA 4F93B 1EF4A 1YLFA 2XPVA 4GCVA 1WH5A 2H27A 5D4SA 1TQMA 2B7EA 5FB2A 3EUHC 1DQUA 2L3DA 4M6VA 1B4AA 2ICWG 3FXRA 1IUFA 2OZUA 5IP7J 2DPDA 4M6XA 1T56A 4XOPA 4BE2A 3IH4A 3C2GA 5JHFA 2L5QA 2XC7A 3C3WA 1JHHA 3BTCA 1ZRFA 3CUQB 3L7WA 1D5YA 3CO6C 3ZR8X 2P7CB 4OAYA 1K61A 5EZHA 4E4HA 1A36A 1R1VA 3PQKA 2K27A 2E2JJ 2A68F 2LY2A 4NUBA 2KL4A 1VQ5I 1KGSA 2FBHA 1B72A 5FFXA 1QQIA 4PZJA 3J7ZI 1ACIA 1YITI 3WODF 1QNTA 1SFEA 2Y30A 2YS9A 4WXCA 3OYNA 2CS3A 5LBQA 3S1QJ 2LBFA 2BEOA 3HL2A 4XK4A 2EA2A 1UHSA 3ISPA 3HPGA 1ON1A 3JSPA 1VQ7I 4A3GJ 1QZEA 4DZJA 2HDWA 3LNQA 2JUGA 4DW6A 2VC1A 4EQQA 2XAUA 1TT0A 3BCBA 3P9IA 2MC4A 4MEYF 2LREA 2TDXA 3WTWC 3ULQB 3K4NA 5ED4A 1GLNA 4G7OF 1IDZA 5HDNA 4XSZF 3FIWA 4A69C 2UUZA 3S1RJ 4A3MJ 3HOVJ 2K5CA 2HXOA 3PIPF 2X0LA 4EGYA 3H3ZA 4I02A 3L2QA 4MO7A 3U1DA 5B66C 3PSFA 5J4YA 3J81Z 1K78B 1MDMB 2HNHA 1AHDP 2DPUA 1TNSA 2UZKA 1S72I 5D4RA 4HX7A 3ERMA 3NWSA 1Z3XA 1LPQA 3AL0B 2VT2A 1Z6RA 5GP9A 1U2WA 3DPUA 3H35A 1FJLA 3W6VA 3MKZA 3T0YA 1WI9A 1MBKA 3GFIA 1JI8A 3SQNA 3EUAA 4EJWA 3ASNH 4OIQF 4CYCA 5IT9Z 3Q9SA 1XCBA 5DUIA 1XB4A 1W5CC 3RKXA 2DMTA 2ELJA 1SD7A 3OYKA 2ELHA 1RR8C 1IV8A 1TQIA 2LKPA 1JXSA 1I50J 3KLNA 1ZK8A 3H9JA 3DWLE 1A31A 5DCMA 2XDVA 3S3OA 3QODA 4U88A 1TP4A 1U9NA 2LKSA 5HODA 3WHBA 2KIMA 1FBQA 4G94A 4KMUX 1LNWA 2Q2EA 4A2UA 2IS4A 3DBLB 3R4KA 1HOMA 1G3WA 2LBFB 4ESFA 1QZZA 1E0EA 4BEHA 3F9KA 2DTZA 2OF7A 2CFXA 4HV5A 3CCVI 1FIAA 1FTZA 5BOXA 4EEFG 1JGGA 2YR2A 2UV1A 3BDDA 1PUFA 2RKHA 5FKMA 5LLQA 1HW5A 3ZGKA 4IOCF 2RC4A 4KYWA 3COAC 2ZJRF 5CKTA 5CJ9A 5HLGA 4LIVA 2OU2A 5FJ8J 3CZ6A 1RETA 2IBDA 2M5WA 2CW8A 1YHQI 4R1HA 1K83J 2GWRA 3DPTA 3SJMA 5LEKA 2LP0A 2LOOA 1JT0A 4EJOA 2PBIA 1ODDA 1Y56A 1YJNI 3ZQLA 1JT6A 2MSYA 4ANJA 4OIPF 1LEBA 1ZG5A 2FEZA 2W7NA 3QAHA 3VOEA 2FMLA 3EETA 1R58A 1ZTRA 3SEZA 1K78A 1GXQA 4EM0B 3WG9A 1OR7C 3KP4A 1W36C 2ME0A 3C1DA 1FBSA 4C9YA 1Q1HA 2P7VB 3BTIA 1IG7A 4A3DJ 1TLHB 4L5JA 3VEPA 2O8XA 4I6ZA 1Z67A 3RSNA 3M8EA 1BIBA 3GTGJ 1FT9A 2K9MA 1T6SA 2V1NA 2EFPA 5CVIA 2ACJA 3BP8A 5B3SH 3RCOA 1Z91A 2JSCA 2L7FP 5JI6A 3TO7A 1H8AC 2DCEA 1E2XA 3RZOJ 2W82A 2KT0A 4F55A 1GV5A 4M9XA 3RQ4A 5K7ZA 2VXZA 3U2RA 2H1LA 3S15J 4IHYA 3S17J 2EBIA 5LGNA 3CC7I 5KK1A 1LDDA 3G1MA 4IL6C 1LEAA 2HWVA 3LAPA 1W7PB 1T98A 1P7IA 2R7ZJ 2KDZA 2BW3B 2CJJA 1IJWC 1BW5A 3GTMJ 1J7KA 1LFPA 1TZLA 1O4XA 3GWZA 3EQLF 3W2AA 2E35A 3Q9VA 5B1BH 2GA2A 3OYJA 1IAWA 4ZDOA 5FKKA 1QHHD 3HG9A 4I76A 4XLHA 3JRBA 4ENJA 1X1DA 4LK0F 4RAFA 4E7LA 1VQ9I 5K5OA 2VJ4A 3IL2A 4IPAA 2DQLA 4C30A 3ONQA 1XGNA 3L1PA 1USSA 4EM2A 2M4KA 4RMNA 5EG0B 5EGOB 4BJ5C 2EV6A 1G2HA 4CCKA 1X58A 2EA4A 2D1VA 1FPQA 2KPMA 4M73A 1ZG1A 1MH4A 2JTVA 3TDUC 4LLLA 2JMWA 3BROA 3ZQ7A 3BQYA 3OIQA 2XGDA 2VBXA 2P6TA 1R5ID 4CCMA 1D0YA 2Y75A 5BPDA 3A01B 3RTRA 2VKHA 1HCRA 2DI3A 3PQJA 3OS0A 3ELKA 5FKOA 2YU9J 2ZNYA 4B1RA 1WGXA 3TMOA 2EWNA 2XAFA 3FM5A 2L9VA 3ABKH 1R5GA 1EA3A 4IOAF 2HQAA 2JT1A 2KJCA 1OCZH 2DYSH 4U0WA 4BXUA 1EH8A 2KISA 1ZH5A 2QBYA 5ILUA 2ZSIB 2FD5A 1OCPA 1RUOA 1Y0UA 4KIFA 4BJ6C 2IVMA 2MW8A 4KT6A 1MJ9A 2LR8A 4B47A 2M87A 2WWYA 4OMYA 1BC8C 2HYFA 4RB1A 1BI1A 4DGWB 2E2IJ 3JW4A 2KQRA 1K7AA 4NHJA 1NH3A 3MAJA 3FXMA 4LLGF 4Y7NJ 5JLWA 2OZ6A 4MEXF 3G6EI 1O57A 2IS1A 2K9NA 1JHFA 2HYGD 4BUPA 3BPVA 4GFBA 3HIFA 5IYDJ 1MNDA 3HDDA 4F3QA 2XHKA 2VJIA 2XAHA 3HOYJ 1O3QA 3G1OA 3C2BA 2H8WA 4BYYA 1O3TA 3F6OA 2DXIA 2VBWA 2OJED 2RQPA 3FX3A 4IJAA 4I2OA 3CCMI 3F8NA 3W3CA 3TO6A 3FHZA 2ISZA 3FKJA 3V8JA 3VSKA 3WTTC 1ZG3A 3A0HC 3IP4B 4UB6C 1N75A 4IZZA 3WG7H 4BNCA 1U5TB 2KLOA 1YS6A 5J8FA 2YU3A 2XAJA 4YIIA 2VT3A 1X4PA 2A07F 2R7SA 1V55H 3AG2H 4ZDLA 1OYYA 1Z7LA 4BDZA 2QENA 4E7JA 2IRFG 4M3EA 3I56I 1D5VA 2MC3A 3J7YJ 3JRDA 1TQPA 3F21A 2BOLA 5E3OA 4KIGA 1FZPB 1S9HA 2IJLA 1R36A 2CQKA 2EINH 3FK6A 2XAGA 3S32A 3DQVC 2GA1A 3MCZA 4NNJA 2ECBA 5EEGA 1ENHA 3HTSB 2MFZA 4IQ4A 4FX0A 5TRDA 2HOSA 2R7TA 3ASOH 2CU7A 5DEQA 1NK3P 2FUG2 4IX7A 1XTAA 4HLYA 4ZYDA 1D1AA 1YYVA 3SDBA 5J3LA 4HQMA 3HZJA 4HNUA 2NAZA 2P5VA 3BY6A 3B6AA 3RPUD 2EFWA 2DAOA 3OYCA 4CXFA 4HRIA 5DV5A 1VF9A 2H6CA 3FMQA 3DU6A 5IY5H 4PJJA 1K4SA 3FM3A 2Y9YA 2MH2A 2XASA 1ZQ3P 1YS7A 1Q1VA 1KU9A 4OINF 4XLAA 1OCTC 2M3AA 1P6RA 2L9RA 4HF2A 2FOKA 1S5LC 3E97A 4UUTA 3FXOA 1STZA 2HXIA 1IUYA 1POGA 1GVJA 3KZIC 4U0YA 3QWLA 1G59A 3CLOA 4ZH4F 1EH7A 3OYDA 2RN7A 2HTJA 2E19A 1IC8A 2Q1ZB 3FK7A 4OIOF 2VKDA 4MNUA 5CLSA 1F43A 4RAGA 1WCMJ 3DF8A 4AVPA 3U9GA 1AU7A 2ZB9A 2F48A 2DFEA 1MZBA 2PN6A 1OYWA 3ZMZA 4AWXB 3HOZJ 5GAEJ 3E6BA 3IUOA 1SFXA 3I9V2 3NWTA 2XSDC 1W4MA 3KEQA 3D0SA 2QF7A 3C18A 4NC8A 3WU2C 3M1CA 2JK3A 3CJQB 3J80K 4AM3A 2VIXA 3K10A 4IHWA 4UV9A 2VBYA 2KZVA 3V8KA 3HSFA 2CMPA 2KIQA 3I64A 1KA8A 5E79C 4BY1J 5ICEA 3OYFA 1ZLKA 2PFBA 3WU0A 3C7JA 4KN7X 2FNPA 4XICA 5GTHC 1IRGA 3HGYA 1H89C 3BG5A 1VQPI 4Y15A 3A2KA 1OQYA 1G3SA 2HTSA 2NVTJ 3S1NJ 2E5ZA 1V4RA 3K4JA 3FZVA 4XKWA 2PMUA 2NOJB 2R5YA 2M4GA 1VQ6I 4DNCA 4ZZDA 2GZWA 3ZQCA 2CW0F 2MLKA 1RC9A 1HKQA 5AIPA 3OV8A 2DFHA 2HOTA 2KIUA 1WVRA 1X1AA 2F5VA 2QGUA 3J7AY 4GGGA 2COBA 2LTPA 2CV2A 3F8MA 1YW8A 5FFZA 4IHXA 2K85A 4XN0A 3C2HA 1MSFC 5D6FA 3DTEA 4I0AA 4M74A 1OCOH 2R7RA 5M3FJ 4HQEA 4KJZA 5JFRA 3IRRA 1LVKA 3KFWX 4HA8A 2XGXA 1IW7F 5GAGJ 3S93A 2Q2EB 2E1CA 3E5XA 4KMFA 3LSHA 5JHUA 4Y3OA 1LE8A 2VI6A 4BQQA 3QQAA 1Y0NA 4KN4X 3A0BC 3MN2A 4CICA 4XKVA 1RR7A 4E7SA 2E1NA 3H3UA 5JLXA 1WJFA 4AU7A 4LG0A 3H5NA 3FKIJ 1WFXA 5LHIA 1SEUA 2IGKA 4MQ9F 2IGNA 2MH9A 3JREA 1MBGA 1S29A 3K1NA 1FBUA 4KNYA 2HVQA 1FNNA 2XGCA 2ZXIA 5F08A 5FO5A 4L0ZB 1SD4A 1IN4A 5J1RA 3H36A 3P9KA 3W6JB 2Q0OA 4QWQA 1SMTA 4M3BA 1TWFJ 4II2A 4BY7J 3M1EA 1OYIA 1TBXA 3R60A 1H9TA 1SD6A 3BG7A 1ETKA 2PI0A 2W1OA 3V8LA 4A6DA 1FOYA 4TV7A 4BBSJ 2N8GA 4WWCA 2HGCA 3REOA 1MW7A 3EUHA 1EV7A 1X19A 2HZTA 3WTZA 3K4BA 4CCLA 3VYRB 2BY2A 3IWZA 2HDCA 4ZYEA 2DT6A 2WB1A 1YX5A 3ZMUA 5J8CA 3HOXJ 2DTRA 2BY1A 2ESNA 2MABA 4P5OA 2L4MA 2LRDA 1QPMA 3DTKA 1G4DA 2CQ7A 3OR2C 4N9HA 2MD5A 5LHHA 1KQ9A 4BU2A 3K7AJ 2STTA 1TWGJ 3F8CA 2E7XA 2CQQA 1GUUA 4A3FJ 3T8TA 4EATA 1ITYA 3ESWB 4ETSA 4IKFA 2BW3A 3KP6A 3I59B 1FTTA 3LFUA 4G7HF 1Z6TA 2OPTA 4CA0A 4YIRX 2B0LA 2J5PA 3LSJA 2DOAA 4JYKA 2WB1N 2O6GE 1MIJA 5FRNA 3JRHA 2R7QA 1ZARA 4LLNA 5K7FA 3QPTA 5E8IA 2FBKA 2DJNA 2IA2A 4BHBA 4GDFA 1SFUA 5KAIC 3HRTA 2FOWA 2FJ1A 3KEOA 1MBEA 3I4PA 3J81K 2OCEA 3E7LA 2GQQA 5IPAA 2Z3YA 2FF4A 1DP3A 3CC2I 1OCRH 2FSWA 3O2PE 2R7XA 2F4IA 1Z0XA 3RDIA 3A02A 3HUGA 3PUBA 4E7KA 1F5TA 2DA5A 5HDGA 2M34A 5GTIC 1B72B 1Z9CA 1L3LA 3M8FA 4RB2C 1IDYA 1IN5A 4C3IJ 5IT9K 1RNLA 4EVIA 4FTHA 2UXXA 1J75A 3DXJF 1APLC 5GPAA 4WXHA 4HDUA 4M71A 1J59A 4LIUA 3VPRA 4UUSB 2X6XA 2JA5J 3CCUI 4J01A 2EH3A 2LFBA 1JUMA 4ON0A 1V5EA 1R23A 2RREA 2IEKA 3I4NJ 4Y17A 4JOMA 2X6WA 3BT9A 2VE8A 1B59A 4G9YA 1KONA 2RAEA 3ABLH 5M5YJ 3I55I 1PP8F 1Y8RB 3PO2J 2V1UA 4QLCU 1R7JA 1XGOA 1WPKA 1X1PA 4Q48A 5ICFA 3KLOA 3M7GA 3AG3H 4PDKA 3ZMDA 3SHFA 3L9FA 5C4XJ 3O8HA 2R5YB 2IT0A 2YSRA 1WJCA 3OYIA 1F1ZA 2M1BA 3EDPA 4PSXA 3AG1H 4L5IA 4FT8A 1KYWA 1QA6A 3L09A 5FROA 4IHSA 3ERED 1MMSA 3EPZA 2M0CA 1BJZA 5C44J 4QTRA 2O7OA 3VODA 1RKWA 2KP6A 4HYEA 1X2NA 2KJBA 5EF6A 1XDUA 1ZR4A 1W7PA 4AVZA 1U3EM 1FYLA 1QZYA 4Y52J 2FU4A 3KX2A 1YI2I 3LA7A 2CQNA 2HDDA 3D5RC 2XKPA 1P4AA 5J4VA 4PGHA 5B5EC 1RUNA 3PNTA 4GYIA 3FXLA 1X3WB 3CJRB 5BPIA 2ZFUA 4O3MA 2GOMA 2R7OA 5LHGA 5M3MJ 4B48A 1AWCA 1U8BA 1FSHA 1FSEA 2AQEA 4Q5SF 3RJPA 4Y33A 4A3KJ 5AIQA 2KRFA 2ZKZA 3TL4X 4KITB 1MGTA 2Y0MA 1MNMC 2HQRA 4YFXF 1WH7A 4XORA 1A6QA 2L02A 3AFHA 1ONVA 4G6QA 3O3KA 3BR6A 5HS8A 4RA2A 3PL8A 4ZTJA 4Y13A 3GTJJ 4FCYA 3VDXA 2HOEA 4HOBA 3R0AA 1BI3A 3WTYC 2WTEA 1HXDA 1BA5A 2VLAA 2WAQN 3DP7A 4A3JJ 3GYHX 2DLLA 2R92J 1TT5B 3WE2A 3ZQFA 2XF5A 1S7EA 5ICGA 3GTPJ 2E1MB 4PFOA 3K4KA 4KISA 1X1CA 2BVLA 2QWWA 1MKMA
chains in the Genus database with same CATH topology
4A6EA 3DFGA 4MQVA 2ADUA 2COMA 2DFIA 3BWGA 3CUQA 1HSJA 1XSDA 1MJAA 4UV8A 2LF7A 2P5KA 3H92A 4MHGA 1T2KA 4KA4A 4IXAA 1HW1A 1YW7A 2P8TA 4BHCA 3MWMA 1R1UA 3HRMA 4FX4A 4A0ZA 3KCCA 2GXBA 2QM3A 1X3UA 1ZN2A 3WTXC 3E6CC 2BGCA 3HOTA 1J5YA 1MD0A 1W7PD 1S6LA 1Z1DA 4MGRA 5L3EA 3R6SA 2K7LA 1BC7C 1I5ZA 1LDJA 2M45A 1XMKA 5ERIA 3V7CA 3SZPA 5E20A 3BJ6A 2W85A 2LF8A 3KP5A 4L9NA 3KZYA 4ZYHA 3TOAA 4U7DA 1O7LA 4G8XA 4U7BA 2DK8A 3KP7A 4YG2F 2VOOA 4IVNA 1S8NA 2FA5A 4ENNA 2ZBKA 3G3ZA 6PAXA 1KYZA 2OD5A 3BZ6A 4I01A 2W84A 1JE8A 1XD7A 2HKOA 4JBAA 5L3CA 3I53A 2P4WA 5FLXZ 3LFKA 3IHUA 2MLGA 3ZN0A 3GZ6A 1YTYA 2CSOA 4EJVA 4I0BA 3SXYA 1NHAA 4RGXA 4L9TA 3NEUA 1DDNA 4S05A 1KQ0A 2FMYA 1W5TA 5HS9A 3ZN1A 1YFHA 4M9ZA 2O61A 2K02A 1FWZA 5FD5A 4A0XA 3Q5FA 1FYMA 2VN2A 3GUDA 4GXOA 3V7RA 5FGMA 3RI4A 2HR3A 5FLXK 4UUVA 4AIHA 5DUKA 2IPQX 4RGRA 2GAUA 4U0VA 1WSUA 3RKYA 1D8JA 2PJPA 1SMYF 1ZRCA 1YO5C 2HS5A 3HHGA 1CF7A 4NQWA 1U5TA 4LG0B 3F23A 4A5MA 1C0WA 1XN7A 4D0PA 1DUXC 3LQQA 3R61A 5CVJA 1UCRA 3LA2A 1TNTA 1PP7U 4A0YA 2ZMEA 3KETA 3G73A 1XCVA 3QP6A 2IP2A 3FXQA 5K5RA 1BBYA 4KICA 1P4XA 5D5UB 2KKOA 1WRJA 3W6KB 4HX8A 2PLYA 1OKRA 4LB5A 1IF1A 2M8EA 5H20A 1JGSA 4HX4A 2OA4A 1HQCA 4ESJA 3J80Z 2STWA 3V4GA 3NQOA 1D3YA 4ASNA 1R1TA 4G6DA 4NB5A 2V6CA 1FC3A 3WGGA 2ZCWA 4I09A 1IN8A 2ZNZA 1IXSB 2QQ9A 3B02A 3F3XA 2NNYA 1V3FA 4Q47A 2PG4A 4AIKA 3DV8A 3F8FA 2X4HA 2O0YA 4M72A 4LJZF 3DKWA 3DPLC 2DU9A 4HW0A 3ZMTA 1S3JA 5TJJA 4Q4ZF 4ESBA 5A2QK 3WGIA 4P9UA 5F1RA 5HOOA 1UHWA 1T38A 1IN6A 3RPQA 2AS5F 3LAJA 3HHHA 4CYDA 1S7OA 2L54A 3K1PA 3HRSA 2RDPA 2DK5A 2XAQA 5K1YA 3IWFA 3JTHA 4HAMA 3E3VA 4RB3C 2OBPA 1J2XA 1SAXA 4UXNA 4XRFA 1R00A 4YFKF 2HKXA 2LSOA 1LJ9A 1O3RA 2FBIA 4L18B 1BM9A 1Z7UA 1IRFA 3HRUA 2VC0A 3WE3A 3TDZC 5BMZA 4KT5C 1GXPA 1FOKA 4KDPA 4K2EA 3K9TA 5KVRA 5E1WA 4OOIA 4WF2A 1ZREA 1BJAA 2G7UA 3BJAA 1KQ8A 2JZYA 4N9IA 4O5VA 1YQAA 3GFJA 5E1ZB 3MEXA 2LDUA 2R7FA 5HLIA 2FNAA 1F4KA 2XROA 4RB0A 5E18F 5J6XA 1HKTA 2DO7A 3FMRA 4UNOA 2F5FA 2QZ8A 5A2QZ 5L3BA 3RKWA 4CGZA 2AXLA 4XLPF 5F64A 4KFCA 4PGGA 2XRNA 4UVBA 2ZXJA 3CJNA 3OOPA 4UVCA 5L3FA 5CVUA 3TO9A 4OU0A 1R5HA 5CVVA 4LD5A 5FD6A 2LNBA 1BOAA 4XBFA 2VODA 3CTAA 2WC2A 3CO7C 3RYRA 1LVAA 4AIJA 3BOQA 4EMSA 1ZYRF 3RPUA 2CWEA 2A69F 2A6HF 1HBXG 2V1XA 4JQFA 1I1SA 5L3GA 5HLHA 2JPBA 2XUBA 2A5YB 5BQTA 4L9VA 3ZMVA 3I59A 3GZ5A 1ZGJA 1S7AA 2CGPA 2EK5A 5D8LB 3J7AO 3TOBA 1XGSA 3TGNA 5BS6A 3FWEA 3JAMK 1QGPA 1H9GA 1YW9A 2CYYA 3WU1B 1I27A 2XKOA 3K2ZA 5H6RA 3P7NA 3WGHA 3O6BB 5ICCA 2O3FA 4E70A 2G7HA 2ZO4A 3GXOA 2VBZA 4RS8A 3SFZA 2J5OA 5HDKA 2JRTA 1BIAA 4EJUA 4PCQA 4P55A 2ESHA 2F5EA 1LDKB 3E5QA 3ROUA 1P4WA 1IXRC 4LK1F 5DD4A 1TW3A 5IT3A 2A3SA 2FRHA 3ML6A 4LGWA 4OMZA 4ENKA 2DQRA 2IA0A 3AAFA 4A5NA 3CDHA 2ZFWA 1I1GA 2G9WA 2Z33A 2FQ3A 4F7ZA 5H6QA 5AONA 4MTEA 5LGTA 2R7DA 3CUQC 4L0YB 2XIGA 1D8KA 4HDVA 4RGUA 1OR7A 3QOPA 2GIVA 3I58A 5E17F 3HSEA 3S2WA 3GEZA 2Z9OA 1B1BA 3TQNA 2ZJ2A 4UVAA 4WCGA 4GO1A 4S04A 2RGVA 3QU6A 4AD9A 2QUFA 5ILSA 3GLXA 5D6EA 1P2FA 1HKSA 1WKMA 1UB9A 2OAZA 2DT5A 2IW5A 4RAYA 1G3TA 1FP1D 3JAMZ 1L0OC 4LMYA 3MZYA 3V7SA 3LSTA 3L00A 4MTDA 2GXGA 2OQGA 3QP5A 1J0RA 2V79A 2YX7A 2EJRA 3DEUA 2XV4S 3IKVA 4BHPA 5LRRA 2L01A 1HW2A 1K6OA 3JSOA 4HBLA 2BBYA 3D5LA 1P92A 1T39A 2QVOA 2IA1A 5D8KB 3I71A 1BI2A 1LB2A 1IZ1A 1USTA 1MDMA 2Q8KA 5HS7A 3F6VA 2DBBA 3CUOA 1CGPA 2UWMA 2MA3A 1K79A 2CG4A 3QU3A 1O7FA 2QYOA 1G3YA 3ABTA 2BYVE 2EFQA 1OPCA 5E8GA 3EYIA 1DPUA 2ZMEB 5E1XA 3QPHA 1B9MA 4CO8A 1H0MA 1J9IA 1E17A 4RGSA 2EB7A 1ON2A 4IHTA 4IRHA 3KZZA 2CO5A 2OQRA 4ZYGA 5K5QA 2FE3A 2BE5F 3E6DA 1GHCA 5LGUA 2F5DA 2NYXA 1OMIA 1RIOH 1YG2A 1PDNC 3GVAA 1LQ1A 2F5CA 3K69A 1Z05A 2BV6A 2XVCA 3B73A 2KIFA 1O3SA 2PQ8A 1ZLJA 4P9FA 4R8HA 2M30A 3ECOA 2VONA 3LA3A 2H09A 3QRFF 1SD5A 5LRSA 1TTYA 3GFLA 5CVRA 2UXNA 1REPC 1R22A 4IF4A 2A6EF 2V9VA 3FXUA 3GX4X 4CZZA 3FMSA 2EFOA 1MJBA 4BH9A 1DP7P 3F22A 4CHUA 3MZHA 4DQ2A 2W24A 3I0TA 4IRIA 2YPRA 5DCMB 1U78A 1XSVA 2DW4A 2Z99A 4WX9A 1WQ2A 3F72A 1B9NA 4HV6A 2W25A 4BAYA 5CYVA 5LEJA 4ZZLA 1W5SA 2QQBA 2EV0A 4H0EA 3ABUA 1QO0D 4EV0A 1FLIA 2NNNA 2QLZA 3T1BA 4HF1A 3WTVC 2O03A 3IC7A 4GYGA 3VB2A 5L3DA 3I54A 5D5XB 3WTSC 2D45A 4LFUA 1KU7A 5D5VB 4M9SA 1CF7B 5F6FA 2H6BA 4N0BA 1RZ4A 3K0LA 5DD8A 3KP2A 3HTUA 1WWXA 3F8BA 4O6JA 3GF2A 3T5XA 4CDGA 2NS0A 4XSXF 2K86A 4Z2YA 1AOYA 1FP2A 3I5UA 3MFKA 3P9CA 1FYKA 4KIBA 1QBJA 2HQNA 4OIRF 2E7WA 3ECHA 1ZGAA 1I6XA 1YIOA 1F9NA 1HSTA 1FY7A 3E5UA 3LWFA 4HLXA 3PFIA 2MBFA 1EH6A 2VE9A 2D2WA 3R0JA 1U8RA 2D1HA 5D5WB 1XSXA 2Y48A 4WXDA 1FX7A 1A04A 1G6NA 3IKTA 4R79A 2RNJA 4JK1X 4YIFA 4I7HA 1VTNC 2C6YA 5HVQC 1KU2A 3MQ0A 1ZRDA 3GO5A 2L4AA 2K4BA 3KP3A 2PMHA 1B6AA 3GFMA 2WV0A 4B8XA 2EV5A 1BN5A 2QQAA 1UFMA 3NRVA 5DYMA 2W57A 1IN7A 2ISYA 1ZAOA 2PEXA 4YFNF 3K1MA 1U5TC 4FHTA 4HF0A 1ZHFA 3ZPLA 4G7ZF 3HSRA 3FF5A 4HZFA 3M9AA 3HOSA 5JVTA 2EFNA 2HEOA 4RAZA 1RI7A 3N97A 3KE2A 3L2CA 4I98B 3RIRA 2NRAC 4B09A 1T0FA 2H94A 2RV8A 2A61A 3WTUC 5DCFA 2F2EA 2V1DA 4L9JA 3SZTA 5DDGA 1BI0A 3HYIA 4WK8F 4LB6B 2ETHA 3ZP5A 4IRGA 3RYPA 2P5LC 3ZMSA 1XMAA 4UHTA 3IRQA 2P6SA 3BPXA 2HFHA 2QBYB 1KU3A 1DPRA 4ENMA 5ILVA 4XLNF 2YX4A 3TKYA 2RVCA 3T8RA 5JR3A 4BQAA 2VOPA 2K4JA 3GW2A 4EM1A 3LQRA 3BJOA 4A12A 4P96A 2JPCA 1IXCA 3N4MA 3JTGA 1U6GA 3E6MA 5EEHA 1ULYA 1PUEE 3EYYA 1TW2A 1XDSA 2R3SA 2FXAA 4EGZA 4EJTA 4KUMA 2Z5UA 3VFZA 4M6YA 1XGMA 1UHMA 1YLFA 4GCVA 2H27A 5D4SA 1TQMA 5FB2A 2L3DA 1B4AA 3FXRA 2OZUA 2DPDA 4M6XA 3C3WA 1JHHA 1ZRFA 3CUQB 3L7WA 3CO6C 2P7CB 1R1VA 3PQKA 2K27A 2A68F 1KGSA 2FBHA 5FFXA 1QQIA 4PZJA 3WODF 1QNTA 1SFEA 4WXCA 5LBQA 2BEOA 2EA2A 3ISPA 1ON1A 3JSPA 2VC1A 4EQQA 4MEYF 3P9IA 2TDXA 3WTWC 3ULQB 5ED4A 4G7OF 5HDNA 4XSZF 4EGYA 2X0LA 3H3ZA 4I02A 3U1DA 3J81Z 1K78B 1MDMB 2DPUA 1TNSA 2UZKA 5D4RA 4HX7A 2VT2A 1Z6RA 1U2WA 3T0YA 1WI9A 3GFIA 3SQNA 4EJWA 4OIQF 5IT9Z 3Q9SA 1XCBA 5DUIA 1XB4A 3RKXA 1SD7A 2ELHA 1TQIA 2LKPA 1JXSA 3KLNA 5DCMA 4U88A 2KIMA 1FBQA 4G94A 4KMUX 1LNWA 2Q2EA 4A2UA 3R4KA 1G3WA 4ESFA 1QZZA 4HV5A 2CFXA 5BOXA 2YR2A 3BDDA 2RKHA 5LLQA 1HW5A 2RC4A 4KYWA 3COAC 5HLGA 5CJ9A 2OU2A 2M5WA 4R1HA 2GWRA 3DPTA 5LEKA 4EJOA 2PBIA 1ODDA 4OIPF 1LEBA 1ZG5A 2FEZA 3QAHA 3VOEA 2FMLA 1R58A 3EETA 1K78A 1GXQA 4EM0B 3WG9A 3KP4A 3C1DA 1FBSA 1Q1HA 2P7VB 1TLHB 4L5JA 3VEPA 2O8XA 3M8EA 1BIBA 1FT9A 1T6SA 2EFPA 5CVIA 2ACJA 3BP8A 1Z91A 2JSCA 5JI6A 3TO7A 1E2XA 4M9XA 2VXZA 3U2RA 5LGNA 5KK1A 1LDDA 1LEAA 2HWVA 3LAPA 1W7PB 1T98A 1J7KA 3GWZA 3EQLF 3Q9VA 2GA2A 1IAWA 4ENJA 4LK0F 5K5OA 3IL2A 4IPAA 2DQLA 1XGNA 1USSA 4EM2A 2EV6A 2EA4A 2D1VA 1FPQA 1ZG1A 4M73A 2JTVA 3TDUC 4LLLA 3BROA 3ZQ7A 2VBXA 2P6TA 2Y75A 5BPDA 3RTRA 2DI3A 3PQJA 3ELKA 2ZNYA 2EWNA 2XAFA 3FM5A 1R5GA 2JT1A 2KJCA 4U0WA 4BXUA 1ZH5A 1EH8A 2QBYA 5ILUA 1RUOA 1Y0UA 4KIFA 2IVMA 2WWYA 1MJ9A 2M87A 4OMYA 1BC8C 2HYFA 4RB1A 1BI1A 3JW4A 1K7AA 4NHJA 3MAJA 4LLGF 2OZ6A 4MEXF 1O57A 1JHFA 2HYGD 3BPVA 3HIFA 2XHKA 2XAHA 1O3QA 4BYYA 1O3TA 3F6OA 2VBWA 2RQPA 3FX3A 4IJAA 4I2OA 3F8NA 3TO6A 3FHZA 2ISZA 3V8JA 3WTTC 1ZG3A 4BNCA 1U5TB 1YS6A 5J8FA 2YU3A 2XAJA 4YIIA 2A07F 2VT3A 1OYYA 2QENA 2IRFG 1D5VA 2MC3A 1TQPA 3F21A 4KIGA 1FZPB 2IJLA 1R36A 2CQKA 2XAGA 3DQVC 2GA1A 3MCZA 5EEGA 3HTSB 5TRDA 4FX0A 5DEQA 4HLYA 4ZYDA 1YYVA 4HQMA 2NAZA 2P5VA 3BY6A 2EFWA 2DAOA 4CXFA 5DV5A 2H6CA 3FMQA 3FM3A 2MH2A 2XASA 1YS7A 1KU9A 4OINF 1P6RA 4HF2A 2FOKA 1IUYA 3E97A 1STZA 1GVJA 4U0YA 3CLOA 4ZH4F 1EH7A 2RN7A 2HTJA 4OIOF 4MNUA 5CLSA 3DF8A 4AVPA 3U9GA 1MZBA 2PN6A 1OYWA 3ZMZA 4AWXB 3E6BA 1SFXA 1W4MA 3KEQA 3D0SA 3C18A 3J80K 4UV9A 2VBYA 3V8KA 3HSFA 3I64A 1KA8A 5ICEA 1ZLKA 2PFBA 3WU0A 3C7JA 4KN7X 2FNPA 1IRGA 4Y15A 1G3SA 2HTSA 1V4RA 3FZVA 2PMUA 4DNCA 4ZZDA 2GZWA 2CW0F 2MLKA 1HKQA 5AIPA 3OV8A 2KIUA 4GGGA 3F8MA 1YW8A 5FFZA 5D6FA 4I0AA 4M74A 4HQEA 5JFRA 3IRRA 3KFWX 4HA8A 2XGXA 1IW7F 4KMFA 2E1CA 3E5XA 5JHUA 4KN4X 4CICA 2E1NA 3H3UA 4LG0A 5LHIA 4MQ9F 2MH9A 1S29A 3K1NA 1FBUA 4KNYA 1FNNA 5FO5A 4L0ZB 1SD4A 1IN4A 3P9KA 3W6JB 2Q0OA 4QWQA 1SMTA 3M1EA 1OYIA 1TBXA 3R60A 1H9TA 1SD6A 2PI0A 3V8LA 4A6DA 4TV7A 4WWCA 2HGCA 3REOA 3EUHA 1EV7A 2HZTA 3WTZA 3IWZA 2HDCA 4ZYEA 3ZMUA 5J8CA 2DTRA 2ESNA 4P5OA 2L4MA 1QPMA 1G4DA 4N9HA 2MD5A 5LHHA 1KQ9A 2STTA 3F8CA 2E7XA 3T8TA 4ETSA 3KP6A 3I59B 4G7HF 1Z6TA 2B0LA 2J5PA 2O6GE 1ZARA 4LLNA 3QPTA 5E8IA 2FBKA 2IA2A 4BHBA 1SFUA 3HRTA 3KEOA 3I4PA 3J81K 2GQQA 2Z3YA 2FF4A 2FSWA 3O2PE 3RDIA 3HUGA 1F5TA 5HDGA 1Z9CA 1L3LA 3M8FA 4RB2C 1IN5A 5IT9K 1RNLA 4EVIA 2UXXA 1J75A 3DXJF 4WXHA 4HDUA 4M71A 1J59A 4ON0A 1R23A 4Y17A 2VE8A 1B59A 4G9YA 1PP8F 2V1UA 4QLCU 1R7JA 1XGOA 4Q48A 5ICFA 3KLOA 3M7GA 4PDKA 3ZMDA 3SHFA 3L9FA 2IT0A 2YSRA 1F1ZA 2M1BA 3EDPA 4L5IA 4FT8A 1KYWA 3L09A 4IHSA 3ERED 3VODA 4HYEA 2KJBA 1XDUA 1FYLA 1W7PA 1U3EM 1QZYA 2FU4A 3LA7A 2XKPA 1P4AA 4PGHA 1RUNA 4GYIA 5BPIA 4O3MA 5LHGA 1AWCA 1FSHA 1FSEA 4Q5SF 3RJPA 5AIQA 2KRFA 2ZKZA 1MGTA 2Y0MA 2HQRA 4YFXF 2L02A 1ONVA 4G6QA 3O3KA 5HS8A 4Y13A 2HOEA 4HOBA 3R0AA 1BI3A 3WTYC 2WTEA 1HXDA 3DP7A 3GYHX 2DLLA 3WE2A 5ICGA 2QWWA 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6E A;  3DFG A;  4MQV A;  2ADU A;  2COM A;  2DFI A;  3BWG A;  3CUQ A;  1HSJ A;  1XSD A;  1MJA A;  4UV8 A;  2LF7 A;  2P5K A;  3H92 A;  4MHG A;  1T2K A;  4KA4 A;  4IXA A;  1HW1 A;  1YW7 A;  2P8T A;  4BHC A;  3MWM A;  1R1U A;  3HRM A;  4FX4 A;  4A0Z A;  3KCC A;  2GXB A;  2QM3 A;  1X3U A;  1ZN2 A;  3WTX C;  3E6C C;  2BGC A;  3HOT A;  1J5Y A;  1MD0 A;  1W7P D;  1S6L A;  1Z1D A;  4MGR A;  5L3E A;  3R6S A;  2K7L A;  1BC7 C;  1I5Z A;  1LDJ A;  2M45 A;  1XMK A;  5ERI A;  3V7C A;  3SZP A;  5E20 A;  3BJ6 A;  2W85 A;  2LF8 A;  3KP5 A;  4L9N A;  3KZY A;  4ZYH A;  3TOA A;  4U7D A;  1O7L A;  4G8X A;  4U7B A;  2DK8 A;  3KP7 A;  4YG2 F;  2VOO A;  4IVN A;  1S8N A;  2FA5 A;  4ENN A;  2ZBK A;  3G3Z A;  6PAX A;  1KYZ A;  2OD5 A;  3BZ6 A;  4I01 A;  2W84 A;  1JE8 A;  1XD7 A;  2HKO A;  4JBA A;  5L3C A;  3I53 A;  2P4W A;  5FLX Z;  3LFK A;  3IHU A;  2MLG A;  3ZN0 A;  3GZ6 A;  1YTY A;  2CSO A;  4EJV A;  4I0B A;  3SXY A;  1NHA A;  4RGX A;  4L9T A;  3NEU A;  1DDN A;  4S05 A;  1KQ0 A;  2FMY A;  1W5T A;  5HS9 A;  3ZN1 A;  1YFH A;  4M9Z A;  2O61 A;  2K02 A;  1FWZ A;  5FD5 A;  4A0X A;  3Q5F A;  1FYM A;  2VN2 A;  3GUD A;  4GXO A;  3V7R A;  5FGM A;  3RI4 A;  2HR3 A;  5FLX K;  4UUV A;  4AIH A;  5DUK A;  2IPQ X;  4RGR A;  2GAU A;  4U0V A;  1WSU A;  3RKY A;  1D8J A;  2PJP A;  1SMY F;  1ZRC A;  1YO5 C;  2HS5 A;  3HHG A;  1CF7 A;  4NQW A;  1U5T A;  4LG0 B;  3F23 A;  4A5M A;  1C0W A;  1XN7 A;  4D0P A;  1DUX C;  3LQQ A;  3R61 A;  5CVJ A;  1UCR A;  3LA2 A;  1TNT A;  1PP7 U;  4A0Y A;  2ZME A;  3KET A;  3G73 A;  1XCV A;  3QP6 A;  2IP2 A;  3FXQ A;  5K5R A;  1BBY A;  4KIC A;  1P4X A;  5D5U B;  2KKO A;  1WRJ A;  3W6K B;  4HX8 A;  2PLY A;  1OKR A;  4LB5 A;  1IF1 A;  2M8E A;  5H20 A;  1JGS A;  4HX4 A;  2OA4 A;  1HQC A;  4ESJ A;  3J80 Z;  2STW A;  3V4G A;  3NQO A;  1D3Y A;  4ASN A;  1R1T A;  4G6D A;  4NB5 A;  2V6C A;  1FC3 A;  3WGG A;  2ZCW A;  4I09 A;  1IN8 A;  2ZNZ A;  1IXS B;  2QQ9 A;  3B02 A;  3F3X A;  2NNY A;  1V3F A;  4Q47 A;  2PG4 A;  4AIK A;  3DV8 A;  3F8F A;  2X4H A;  2O0Y A;  4M72 A;  4LJZ F;  3DKW A;  3DPL C;  2DU9 A;  4HW0 A;  3ZMT A;  1S3J A;  5TJJ A;  4Q4Z F;  4ESB A;  5A2Q K;  3WGI A;  4P9U A;  5F1R A;  5HOO A;  1UHW A;  1T38 A;  1IN6 A;  3RPQ A;  2AS5 F;  3LAJ A;  3HHH A;  4CYD A;  1S7O A;  2L54 A;  3K1P A;  3HRS A;  2RDP A;  2DK5 A;  2XAQ A;  5K1Y A;  3IWF A;  3JTH A;  4HAM A;  3E3V A;  4RB3 C;  2OBP A;  1J2X A;  1SAX A;  4UXN A;  4XRF A;  1R00 A;  4YFK F;  2HKX A;  2LSO A;  1LJ9 A;  1O3R A;  2FBI A;  4L18 B;  1BM9 A;  1Z7U A;  1IRF A;  3HRU A;  2VC0 A;  3WE3 A;  3TDZ C;  5BMZ A;  4KT5 C;  1GXP A;  1FOK A;  4KDP A;  4K2E A;  3K9T A;  5KVR A;  5E1W A;  4OOI A;  4WF2 A;  1ZRE A;  1BJA A;  2G7U A;  3BJA A;  1KQ8 A;  2JZY A;  4N9I A;  4O5V A;  1YQA A;  3GFJ A;  5E1Z B;  3MEX A;  2LDU A;  2R7F A;  5HLI A;  2FNA A;  1F4K A;  2XRO A;  4RB0 A;  5E18 F;  5J6X A;  1HKT A;  2DO7 A;  3FMR A;  4UNO A;  2F5F A;  2QZ8 A;  5A2Q Z;  5L3B A;  3RKW A;  4CGZ A;  2AXL A;  4XLP F;  5F64 A;  4KFC A;  4PGG A;  2XRN A;  4UVB A;  2ZXJ A;  3CJN A;  3OOP A;  4UVC A;  5L3F A;  5CVU A;  3TO9 A;  4OU0 A;  1R5H A;  5CVV A;  4LD5 A;  5FD6 A;  2LNB A;  1BOA A;  4XBF A;  2VOD A;  3CTA A;  2WC2 A;  3CO7 C;  3RYR A;  1LVA A;  4AIJ A;  3BOQ A;  4EMS A;  1ZYR F;  3RPU A;  2CWE A;  2A69 F;  2A6H F;  1HBX G;  2V1X A;  4JQF A;  1I1S A;  5L3G A;  5HLH A;  2JPB A;  2XUB A;  2A5Y B;  5BQT A;  4L9V A;  3ZMV A;  3I59 A;  3GZ5 A;  1ZGJ A;  1S7A A;  2CGP A;  2EK5 A;  5D8L B;  3J7A O;  3TOB A;  1XGS A;  3TGN A;  5BS6 A;  3FWE A;  3JAM K;  1QGP A;  1H9G A;  1YW9 A;  2CYY A;  3WU1 B;  1I27 A;  2XKO A;  3K2Z A;  5H6R A;  3P7N A;  3WGH A;  3O6B B;  5ICC A;  2O3F A;  4E70 A;  2G7H A;  2ZO4 A;  3GXO A;  2VBZ A;  4RS8 A;  3SFZ A;  2J5O A;  5HDK A;  2JRT A;  1BIA A;  4EJU A;  4PCQ A;  4P55 A;  2ESH A;  2F5E A;  1LDK B;  3E5Q A;  3ROU A;  1P4W A;  1IXR C;  4LK1 F;  5DD4 A;  1TW3 A;  5IT3 A;  2A3S A;  2FRH A;  3ML6 A;  4LGW A;  4OMZ A;  4ENK A;  2DQR A;  2IA0 A;  3AAF A;  4A5N A;  3CDH A;  2ZFW A;  1I1G A;  2G9W A;  2Z33 A;  2FQ3 A;  4F7Z A;  5H6Q A;  5AON A;  4MTE A;  5LGT A;  2R7D A;  3CUQ C;  4L0Y B;  2XIG A;  1D8K A;  4HDV A;  4RGU A;  1OR7 A;  3QOP A;  2GIV A;  3I58 A;  5E17 F;  3HSE A;  3S2W A;  3GEZ A;  2Z9O A;  1B1B A;  3TQN A;  2ZJ2 A;  4UVA A;  4WCG A;  4GO1 A;  4S04 A;  2RGV A;  3QU6 A;  4AD9 A;  2QUF A;  5ILS A;  3GLX A;  5D6E A;  1P2F A;  1HKS A;  1WKM A;  1UB9 A;  2OAZ A;  2DT5 A;  2IW5 A;  4RAY A;  1G3T A;  1FP1 D;  3JAM Z;  1L0O C;  4LMY A;  3MZY A;  3V7S A;  3LST A;  3L00 A;  4MTD A;  2GXG A;  2OQG A;  3QP5 A;  1J0R A;  2V79 A;  2YX7 A;  2EJR A;  3DEU A;  2XV4 S;  3IKV A;  4BHP A;  5LRR A;  2L01 A;  1HW2 A;  1K6O A;  3JSO A;  4HBL A;  2BBY A;  3D5L A;  1P92 A;  1T39 A;  2QVO A;  2IA1 A;  5D8K B;  3I71 A;  1BI2 A;  1LB2 A;  1IZ1 A;  1UST A;  1MDM A;  2Q8K A;  5HS7 A;  3F6V A;  2DBB A;  3CUO A;  1CGP A;  2UWM A;  2MA3 A;  1K79 A;  2CG4 A;  3QU3 A;  1O7F A;  2QYO A;  1G3Y A;  3ABT A;  2BYV E;  2EFQ A;  1OPC A;  5E8G A;  3EYI A;  1DPU A;  2ZME B;  5E1X A;  3QPH A;  1B9M A;  4CO8 A;  1H0M A;  1J9I A;  1E17 A;  4RGS A;  2EB7 A;  1ON2 A;  4IHT A;  4IRH A;  3KZZ A;  2CO5 A;  2OQR A;  4ZYG A;  5K5Q A;  2FE3 A;  2BE5 F;  3E6D A;  1GHC A;  5LGU A;  2F5D A;  2NYX A;  1OMI A;  1RIO H;  1YG2 A;  1PDN C;  3GVA A;  1LQ1 A;  2F5C A;  3K69 A;  1Z05 A;  2BV6 A;  2XVC A;  3B73 A;  2KIF A;  1O3S A;  2PQ8 A;  1ZLJ A;  4P9F A;  4R8H A;  2M30 A;  3ECO A;  2VON A;  3LA3 A;  2H09 A;  3QRF F;  1SD5 A;  5LRS A;  1TTY A;  3GFL A;  5CVR A;  2UXN A;  1REP C;  1R22 A;  4IF4 A;  2A6E F;  2V9V A;  3FXU A;  3GX4 X;  4CZZ A;  3FMS A;  2EFO A;  1MJB A;  4BH9 A;  1DP7 P;  3F22 A;  4CHU A;  3MZH A;  4DQ2 A;  2W24 A;  3I0T A;  4IRI A;  2YPR A;  5DCM B;  1U78 A;  1XSV A;  2DW4 A;  2Z99 A;  4WX9 A;  1WQ2 A;  3F72 A;  1B9N A;  4HV6 A;  2W25 A;  4BAY A;  5CYV A;  5LEJ A;  4ZZL A;  1W5S A;  2QQB A;  2EV0 A;  4H0E A;  3ABU A;  1QO0 D;  4EV0 A;  1FLI A;  2NNN A;  2QLZ A;  3T1B A;  4HF1 A;  3WTV C;  2O03 A;  3IC7 A;  4GYG A;  3VB2 A;  5L3D A;  3I54 A;  5D5X B;  3WTS C;  2D45 A;  4LFU A;  1KU7 A;  5D5V B;  4M9S A;  1CF7 B;  5F6F A;  2H6B A;  4N0B A;  1RZ4 A;  3K0L A;  5DD8 A;  3KP2 A;  3HTU A;  1WWX A;  3F8B A;  4O6J A;  3GF2 A;  3T5X A;  4CDG A;  2NS0 A;  4XSX F;  2K86 A;  4Z2Y A;  1AOY A;  1FP2 A;  3I5U A;  3MFK A;  3P9C A;  1FYK A;  4KIB A;  1QBJ A;  2HQN A;  4OIR F;  2E7W A;  3ECH A;  1ZGA A;  1I6X A;  1YIO A;  1F9N A;  1HST A;  1FY7 A;  3E5U A;  3LWF A;  4HLX A;  3PFI A;  2MBF A;  1EH6 A;  2VE9 A;  2D2W A;  3R0J A;  1U8R A;  2D1H A;  5D5W B;  1XSX A;  2Y48 A;  4WXD A;  1FX7 A;  1A04 A;  1G6N A;  3IKT A;  4R79 A;  2RNJ A;  4JK1 X;  4YIF A;  4I7H A;  1VTN C;  2C6Y A;  5HVQ C;  1KU2 A;  3MQ0 A;  1ZRD A;  3GO5 A;  2L4A A;  2K4B A;  3KP3 A;  2PMH A;  1B6A A;  3GFM A;  2WV0 A;  4B8X A;  2EV5 A;  1BN5 A;  2QQA A;  1UFM A;  3NRV A;  5DYM A;  2W57 A;  1IN7 A;  2ISY A;  1ZAO A;  2PEX A;  4YFN F;  3K1M A;  1U5T C;  4FHT A;  4HF0 A;  1ZHF A;  3ZPL A;  4G7Z F;  3HSR A;  3FF5 A;  4HZF A;  3M9A A;  3HOS A;  5JVT A;  2EFN A;  2HEO A;  4RAZ A;  1RI7 A;  3N97 A;  3KE2 A;  3L2C A;  4I98 B;  3RIR A;  2NRA C;  4B09 A;  1T0F A;  2H94 A;  2RV8 A;  2A61 A;  3WTU C;  5DCF A;  2F2E A;  2V1D A;  4L9J A;  3SZT A;  5DDG A;  1BI0 A;  3HYI A;  4WK8 F;  4LB6 B;  2ETH A;  3ZP5 A;  4IRG A;  3RYP A;  2P5L C;  3ZMS A;  1XMA A;  4UHT A;  3IRQ A;  2P6S A;  3BPX A;  2HFH A;  2QBY B;  1KU3 A;  1DPR A;  4ENM A;  5ILV A;  4XLN F;  2YX4 A;  3TKY A;  2RVC A;  3T8R A;  5JR3 A;  4BQA A;  2VOP A;  2K4J A;  3GW2 A;  4EM1 A;  3LQR A;  3BJO A;  4A12 A;  4P96 A;  2JPC A;  1IXC A;  3N4M A;  3JTG A;  1U6G A;  3E6M A;  5EEH A;  1ULY A;  1PUE E;  3EYY A;  1TW2 A;  1XDS A;  2R3S A;  2FXA A;  4EGZ A;  4EJT A;  4KUM A;  2Z5U A;  3VFZ A;  4M6Y A;  1XGM A;  1UHM A;  1YLF A;  4GCV A;  2H27 A;  5D4S A;  1TQM A;  5FB2 A;  2L3D A;  1B4A A;  3FXR A;  2OZU A;  2DPD A;  4M6X A;  3C3W A;  1JHH A;  1ZRF A;  3CUQ B;  3L7W A;  3CO6 C;  2P7C B;  1R1V A;  3PQK A;  2K27 A;  2A68 F;  1KGS A;  2FBH A;  5FFX A;  1QQI A;  4PZJ A;  3WOD F;  1QNT A;  1SFE A;  4WXC A;  5LBQ A;  2BEO A;  2EA2 A;  3ISP A;  1ON1 A;  3JSP A;  2VC1 A;  4EQQ A;  4MEY F;  3P9I A;  2TDX A;  3WTW C;  3ULQ B;  5ED4 A;  4G7O F;  5HDN A;  4XSZ F;  4EGY A;  2X0L A;  3H3Z A;  4I02 A;  3U1D A;  3J81 Z;  1K78 B;  1MDM B;  2DPU A;  1TNS A;  2UZK A;  5D4R A;  4HX7 A;  2VT2 A;  1Z6R A;  1U2W A;  3T0Y A;  1WI9 A;  3GFI A;  3SQN A;  4EJW A;  4OIQ F;  5IT9 Z;  3Q9S A;  1XCB A;  5DUI A;  1XB4 A;  3RKX A;  1SD7 A;  2ELH A;  1TQI A;  2LKP A;  1JXS A;  3KLN A;  5DCM A;  4U88 A;  2KIM A;  1FBQ A;  4G94 A;  4KMU X;  1LNW A;  2Q2E A;  4A2U A;  3R4K A;  1G3W A;  4ESF A;  1QZZ A;  4HV5 A;  2CFX A;  5BOX A;  2YR2 A;  3BDD A;  2RKH A;  5LLQ A;  1HW5 A;  2RC4 A;  4KYW A;  3COA C;  5HLG A;  5CJ9 A;  2OU2 A;  2M5W A;  4R1H A;  2GWR A;  3DPT A;  5LEK A;  4EJO A;  2PBI A;  1ODD A;  4OIP F;  1LEB A;  1ZG5 A;  2FEZ A;  3QAH A;  3VOE A;  2FML A;  1R58 A;  3EET A;  1K78 A;  1GXQ A;  4EM0 B;  3WG9 A;  3KP4 A;  3C1D A;  1FBS A;  1Q1H A;  2P7V B;  1TLH B;  4L5J A;  3VEP A;  2O8X A;  3M8E A;  1BIB A;  1FT9 A;  1T6S A;  2EFP A;  5CVI A;  2ACJ A;  3BP8 A;  1Z91 A;  2JSC A;  5JI6 A;  3TO7 A;  1E2X A;  4M9X A;  2VXZ A;  3U2R A;  5LGN A;  5KK1 A;  1LDD A;  1LEA A;  2HWV A;  3LAP A;  1W7P B;  1T98 A;  1J7K A;  3GWZ A;  3EQL F;  3Q9V A;  2GA2 A;  1IAW A;  4ENJ A;  4LK0 F;  5K5O A;  3IL2 A;  4IPA A;  2DQL A;  1XGN A;  1USS A;  4EM2 A;  2EV6 A;  2EA4 A;  2D1V A;  1FPQ A;  1ZG1 A;  4M73 A;  2JTV A;  3TDU C;  4LLL A;  3BRO A;  3ZQ7 A;  2VBX A;  2P6T A;  2Y75 A;  5BPD A;  3RTR A;  2DI3 A;  3PQJ A;  3ELK A;  2ZNY A;  2EWN A;  2XAF A;  3FM5 A;  1R5G A;  2JT1 A;  2KJC A;  4U0W A;  4BXU A;  1ZH5 A;  1EH8 A;  2QBY A;  5ILU A;  1RUO A;  1Y0U A;  4KIF A;  2IVM A;  2WWY A;  1MJ9 A;  2M87 A;  4OMY A;  1BC8 C;  2HYF A;  4RB1 A;  1BI1 A;  3JW4 A;  1K7A A;  4NHJ A;  3MAJ A;  4LLG F;  2OZ6 A;  4MEX F;  1O57 A;  1JHF A;  2HYG D;  3BPV A;  3HIF A;  2XHK A;  2XAH A;  1O3Q A;  4BYY A;  1O3T A;  3F6O A;  2VBW A;  2RQP A;  3FX3 A;  4IJA A;  4I2O A;  3F8N A;  3TO6 A;  3FHZ A;  2ISZ A;  3V8J A;  3WTT C;  1ZG3 A;  4BNC A;  1U5T B;  1YS6 A;  5J8F A;  2YU3 A;  2XAJ A;  4YII A;  2A07 F;  2VT3 A;  1OYY A;  2QEN A;  2IRF G;  1D5V A;  2MC3 A;  1TQP A;  3F21 A;  4KIG A;  1FZP B;  2IJL A;  1R36 A;  2CQK A;  2XAG A;  3DQV C;  2GA1 A;  3MCZ A;  5EEG A;  3HTS B;  5TRD A;  4FX0 A;  5DEQ A;  4HLY A;  4ZYD A;  1YYV A;  4HQM A;  2NAZ A;  2P5V A;  3BY6 A;  2EFW A;  2DAO A;  4CXF A;  5DV5 A;  2H6C A;  3FMQ A;  3FM3 A;  2MH2 A;  2XAS A;  1YS7 A;  1KU9 A;  4OIN F;  1P6R A;  4HF2 A;  2FOK A;  1IUY A;  3E97 A;  1STZ A;  1GVJ A;  4U0Y A;  3CLO A;  4ZH4 F;  1EH7 A;  2RN7 A;  2HTJ A;  4OIO F;  4MNU A;  5CLS A;  3DF8 A;  4AVP A;  3U9G A;  1MZB A;  2PN6 A;  1OYW A;  3ZMZ A;  4AWX B;  3E6B A;  1SFX A;  1W4M A;  3KEQ A;  3D0S A;  3C18 A;  3J80 K;  4UV9 A;  2VBY A;  3V8K A;  3HSF A;  3I64 A;  1KA8 A;  5ICE A;  1ZLK A;  2PFB A;  3WU0 A;  3C7J A;  4KN7 X;  2FNP A;  1IRG A;  4Y15 A;  1G3S A;  2HTS A;  1V4R A;  3FZV A;  2PMU A;  4DNC A;  4ZZD A;  2GZW A;  2CW0 F;  2MLK A;  1HKQ A;  5AIP A;  3OV8 A;  2KIU A;  4GGG A;  3F8M A;  1YW8 A;  5FFZ A;  5D6F A;  4I0A A;  4M74 A;  4HQE A;  5JFR A;  3IRR A;  3KFW X;  4HA8 A;  2XGX A;  1IW7 F;  4KMF A;  2E1C A;  3E5X A;  5JHU A;  4KN4 X;  4CIC A;  2E1N A;  3H3U A;  4LG0 A;  5LHI A;  4MQ9 F;  2MH9 A;  1S29 A;  3K1N A;  1FBU A;  4KNY A;  1FNN A;  5FO5 A;  4L0Z B;  1SD4 A;  1IN4 A;  3P9K A;  3W6J B;  2Q0O A;  4QWQ A;  1SMT A;  3M1E A;  1OYI A;  1TBX A;  3R60 A;  1H9T A;  1SD6 A;  2PI0 A;  3V8L A;  4A6D A;  4TV7 A;  4WWC A;  2HGC A;  3REO A;  3EUH A;  1EV7 A;  2HZT A;  3WTZ A;  3IWZ A;  2HDC A;  4ZYE A;  3ZMU A;  5J8C A;  2DTR A;  2ESN A;  4P5O A;  2L4M A;  1QPM A;  1G4D A;  4N9H A;  2MD5 A;  5LHH A;  1KQ9 A;  2STT A;  3F8C A;  2E7X A;  3T8T A;  4ETS A;  3KP6 A;  3I59 B;  4G7H F;  1Z6T A;  2B0L A;  2J5P A;  2O6G E;  1ZAR A;  4LLN A;  3QPT A;  5E8I A;  2FBK A;  2IA2 A;  4BHB A;  1SFU A;  3HRT A;  3KEO A;  3I4P A;  3J81 K;  2GQQ A;  2Z3Y A;  2FF4 A;  2FSW A;  3O2P E;  3RDI A;  3HUG A;  1F5T A;  5HDG A;  1Z9C A;  1L3L A;  3M8F A;  4RB2 C;  1IN5 A;  5IT9 K;  1RNL A;  4EVI A;  2UXX A;  1J75 A;  3DXJ F;  4WXH A;  4HDU A;  4M71 A;  1J59 A;  4ON0 A;  1R23 A;  4Y17 A;  2VE8 A;  1B59 A;  4G9Y A;  1PP8 F;  2V1U A;  4QLC U;  1R7J A;  1XGO A;  4Q48 A;  5ICF A;  3KLO A;  3M7G A;  4PDK A;  3ZMD A;  3SHF A;  3L9F A;  2IT0 A;  2YSR A;  1F1Z A;  2M1B A;  3EDP A;  4L5I A;  4FT8 A;  1KYW A;  3L09 A;  4IHS A;  3ERE D;  3VOD A;  4HYE A;  2KJB A;  1XDU A;  1FYL A;  1W7P A;  1U3E M;  1QZY A;  2FU4 A;  3LA7 A;  2XKP A;  1P4A A;  4PGH A;  1RUN A;  4GYI A;  5BPI A;  4O3M A;  5LHG A;  1AWC A;  1FSH A;  1FSE A;  4Q5S F;  3RJP A;  5AIQ A;  2KRF A;  2ZKZ A;  1MGT A;  2Y0M A;  2HQR A;  4YFX F;  2L02 A;  1ONV A;  4G6Q A;  3O3K A;  5HS8 A;  4Y13 A;  2HOE A;  4HOB A;  3R0A A;  1BI3 A;  3WTY C;  2WTE A;  1HXD A;  3DP7 A;  3GYH X;  2DLL A;  3WE2 A;  5ICG A;  2QWW A;  1MKM A; 
#chains in the Genus database with same CATH topology
 4A6E A;  3DFG A;  3QYE A;  4MQV A;  5F0C A;  2OV7 A;  2L7K A;  4B3X A;  1FMW A;  2VJ5 A;  4G12 A;  2ADU A;  2A6T A;  2COM A;  4RLQ A;  5C3E J;  2IXS A;  4UY8 I;  4I99 C;  3HOW J;  2DFI A;  3BWG A;  3CUQ A;  4OWR B;  4XKC A;  2LVS A;  2P0W A;  3HJE A;  1HSJ A;  3LSI A;  2WAQ A;  3IAM 2;  4BAC A;  1XSD A;  1MJA A;  2WY8 Q;  3OYG A;  4UV8 A;  4D1Q A;  1ERD A;  1NK2 P;  2LF7 A;  2P5K A;  3H92 A;  4MHG A;  1T2K A;  4KA4 A;  4IXA A;  1HW1 A;  5KHD A;  4M3D A;  3IH3 A;  2I5U A;  1VI0 A;  1YW7 A;  2P8T A;  2VKV A;  4BHC A;  2LMD A;  3MWM A;  2LKX A;  4PJM A;  2EZL A;  1R1U A;  2RNG A;  3HRM A;  2DMU A;  4FX4 A;  3PNV A;  5FLM J;  2DT7 B;  4A0Z A;  2XB0 X;  2ID6 A;  2LH9 A;  1GV2 A;  2DDA A;  3KCC A;  3FIS A;  3GLL A;  1MH3 A;  1MSE C;  2GXB A;  3HKZ N;  1OFC X;  2QM3 A;  5IP6 A;  1X3U A;  2L7Z A;  2BY3 A;  3OIO A;  1W1W E;  4A3E J;  1ZN2 A;  1VQ8 I;  2M7B A;  3WTX C;  3O8G A;  5CQG A;  3E6C C;  2BGC A;  2BHY A;  3HOT A;  1J5Y A;  3KYC B;  4XRS A;  1MD0 A;  1W7P D;  1X3Z B;  2QSF X;  3FDY A;  1S6L A;  3PNY A;  1Z1D A;  2MG4 A;  4MGR A;  5L3E A;  1BR1 A;  3R6S A;  2K7L A;  1BC7 C;  1I5Z A;  1WJA A;  3GBG A;  1LDJ A;  2M45 A;  3H9Q A;  2AHQ A;  1XMK A;  5ERI A;  5M5X J;  4RLF A;  3V7C A;  3SZP A;  5E20 A;  4AID A;  2IS2 A;  4CUG A;  5DM6 F;  2QCO A;  3BTJ A;  2W00 A;  3BJ6 A;  2W85 A;  4AYB A;  2LF8 A;  3KP5 A;  4L9N A;  3KZY A;  4ZYH A;  3F0C A;  3GTL J;  4ZTF A;  2OCC H;  3TOA A;  4U7D A;  1Y1V J;  2WAD A;  1O7L A;  4G8X A;  4XKB A;  1U0J A;  1SFO J;  3DU5 A;  4U7B A;  1VQ4 I;  2DK8 A;  1YOV B;  2FQ4 A;  3MMY B;  3KP7 A;  4YG2 F;  3PSI A;  2VOO A;  2DFF A;  5K7H A;  3BR3 A;  4IVN A;  4XRS G;  3GME A;  1I3Q J;  3CCE I;  1G8X A;  1S8N A;  1U9O A;  4X6A J;  2FA5 A;  4XR6 A;  5B1A H;  2JWT A;  2NOG A;  3G2B A;  4ENN A;  4MFD A;  2E34 A;  2WA0 A;  2ZBK A;  1WJE A;  3G3Z A;  6PAX A;  1KYZ A;  2OD5 A;  3BZ6 A;  4I01 A;  3OYH A;  2BZT A;  4S0H B;  2W84 A;  3S8P A;  1JE8 A;  2HPI A;  1XD7 A;  2HKO A;  4JBA A;  2A05 A;  2DA3 A;  5L3C A;  3I53 A;  4C3H J;  4QPQ A;  2JSP A;  2P4W A;  5FLX Z;  3LFK A;  3IHU A;  1QHG A;  2L2O A;  2MLG A;  1ZEL A;  3ZN0 A;  3VWB A;  1RRJ A;  3GZ6 A;  2F6C A;  1YTY A;  2CSO A;  1LFB A;  3OYE A;  4EJV A;  4I0B A;  4NDL A;  3DLL F;  1JKR C;  3SXY A;  3PM1 A;  5CQE A;  1IRX A;  2NVX J;  2VUM J;  3OS1 A;  1NHA A;  4RGX A;  1AA7 A;  3OL3 A;  1MBJ A;  4V19 K;  4L9T A;  3NEU A;  3BZC A;  1DDN A;  4B44 A;  3KIO A;  3ZQQ A;  2GOX B;  4S05 A;  3CCL I;  1KQ0 A;  2FMY A;  1OJL A;  1W5T A;  5DTD A;  1TWC J;  4FE7 A;  5HS9 A;  3U1K A;  2QSG X;  2KHM A;  3M8J A;  3M3Y J;  3ZN1 A;  4DZP A;  2DA4 A;  1QPI A;  2V7F A;  1YFH A;  1JTX A;  2HU9 A;  2X9D A;  4M9Z A;  2M7A A;  2X1E A;  3M4O J;  2O61 A;  3HPH A;  2K02 A;  1FWZ A;  5FD5 A;  3FHN A;  4A0X A;  3Q5F A;  1FYM A;  2VN2 A;  3K4M A;  3GUD A;  1BR2 A;  3H3V K;  4GXO A;  3V7R A;  4B3A A;  2BY0 A;  3Q0W A;  4M3F A;  3BR2 A;  5FGM A;  3RI4 A;  2HR3 A;  5FLX K;  4UUV A;  4AIH A;  3TED A;  5DUK A;  2IPQ X;  4RGR A;  4A3L J;  4LIT A;  2GAU A;  2QKM B;  4YRV A;  4U0V A;  1X1B A;  1SFK A;  2LY9 A;  2LYC A;  5JVG F;  1WSU A;  3RKY A;  2CUE A;  1D8J A;  2PJP A;  1SMY F;  1ZRC A;  4DYC A;  1YO5 C;  2DMN A;  1PUF B;  1P9Q C;  2HS5 A;  3OOU A;  3OSG A;  4JX6 A;  2CFO A;  3HHG A;  4PFP A;  4LOC A;  2FX0 A;  4NQW A;  3CMM A;  3BZK A;  1CF7 A;  1U5T A;  4DBR A;  3SYT A;  3CC4 I;  3F23 A;  4LG0 B;  4XLF A;  2GBY A;  4A5M A;  4IO9 F;  2VL8 A;  5IP9 J;  5E3M A;  1SVM A;  3L2R A;  1C0W A;  2PJR B;  1JUP A;  1XN7 A;  3WHC A;  4D0P A;  1DUX C;  3LQQ A;  3R61 A;  1XPX A;  2BHZ A;  5CVJ A;  1UCR A;  3LA2 A;  2E2H J;  1TNT A;  1PP7 U;  1UG2 A;  5GAH J;  4A0Y A;  4P1W A;  2ZME A;  3H5A A;  4YEJ A;  1A5J A;  3KET A;  3G73 A;  1YRN A;  1XCV A;  3QP6 A;  2VQH A;  4BQN A;  2R0Q C;  2MD0 A;  2IP2 A;  2TRT A;  4NBQ A;  3FXQ A;  4XID A;  2JA8 J;  1HA8 A;  5K5R A;  1BBY A;  4KIC A;  3I3L A;  4XQF A;  1SAU A;  2R7W A;  1P4X A;  1UZC A;  5D5U B;  2KKO A;  3CJT B;  4ZJZ A;  4BGD A;  2KRC A;  2BVM A;  1WRJ A;  3W6K B;  3QPL A;  4HX8 A;  2I10 A;  2PLY A;  2JRM A;  1OKR A;  3JRI A;  2V9P A;  1T0F C;  4JX5 A;  1YIJ I;  4LB5 A;  1IF1 A;  1JKQ C;  2M8E A;  3SEQ A;  1QRY A;  1JKO C;  4D9J A;  5H20 A;  4F92 B;  1JGS A;  2M2E A;  1WJD A;  4HX4 A;  2OA4 A;  2CH0 A;  1R9T J;  1HQC A;  3SZG A;  2Y69 H;  4ESJ A;  4NC7 A;  4PSW A;  2R4G A;  1UG0 A;  3MKY B;  2LD5 A;  3J80 Z;  2STW A;  2E5N A;  1I6H J;  3V4G A;  3NQO A;  4CCO A;  3JR9 A;  1QVT A;  1D3Y A;  4ASN A;  3ZQH A;  2Z2S B;  2X1D A;  1R1T A;  4G6D A;  4NB5 A;  2V6C A;  2X85 A;  4XMY A;  2M8G X;  1FC3 A;  2G0E A;  1EKE A;  3WGG A;  1M1E B;  2ZCW A;  4I09 A;  2DA7 A;  1IN8 A;  4NC6 A;  2ZNZ A;  5F0H A;  1HC8 A;  1IXS B;  3JRF A;  2QQ9 A;  3B02 A;  3F3X A;  5EEA A;  2NNY A;  4DBQ A;  1V3F A;  2HI3 A;  4Q47 A;  5F27 A;  2PG4 A;  5J1U A;  4AIK A;  2NXN B;  3DV8 A;  4G6T B;  3F8F A;  1I3A A;  2HQ5 A;  2X4H A;  3HUG B;  4CCN A;  2O0Y A;  3LSM A;  4M72 A;  1GT0 C;  4LJZ F;  3DKW A;  3DPL C;  2DU9 A;  4HW0 A;  3ZMT A;  4J00 A;  4PUS A;  1S3J A;  3HOU J;  3LOC A;  1PYV A;  5TJJ A;  4Q4Z F;  4ESB A;  1K6Y A;  5A2Q K;  2CUF A;  3WGI A;  3K70 C;  4P9U A;  2GIZ A;  5F1R A;  5HOO A;  1UHW A;  1XG1 A;  1T38 A;  1HF0 A;  1IN6 A;  4DJA A;  3RPQ A;  2AS5 F;  5KNL A;  4MLO A;  3LAJ A;  3HHH A;  4Y4R A;  4CYD A;  1S7O A;  2L54 A;  3H0D A;  3K1P A;  3AG4 H;  5FKL A;  3HRS A;  2RDP A;  1Z21 A;  2DK5 A;  2XAQ A;  5K1Y A;  3BTL A;  2DA1 A;  3IWF A;  3U21 A;  3JTH A;  2PX9 A;  1JKP C;  2JVG A;  4HAM A;  2QKL B;  4XRM A;  3E3V A;  4RB3 C;  2OBP A;  3VYT B;  1J2X A;  1SAX A;  4UXN A;  2X6Y A;  4XRF A;  1FEX A;  3BR0 A;  1R00 A;  3OR1 C;  2NVY J;  4YFK F;  2HKX A;  2LSO A;  2CRG A;  2EZH A;  4RM3 A;  1LJ9 A;  3H5R A;  1V54 H;  1O3R A;  2FBI A;  4QIW N;  4L18 B;  1BM9 A;  1JJ8 C;  1Z7U A;  1IRF A;  2F4O B;  3HRU A;  1NG7 A;  2VC0 A;  3WE3 A;  3TDZ C;  3P5J A;  5BMZ A;  4KT5 C;  2HVS A;  1GXP A;  1FOK A;  3FBN B;  2CUZ A;  2EZK A;  4C2U A;  4KDP A;  4K2E A;  5GPC A;  4A3B J;  3VYU B;  2BXZ A;  3K9T A;  2ZME C;  4XOT A;  2LC2 A;  5KVR A;  5E1W A;  4OOI A;  5FRM A;  4W1U A;  4WF2 A;  2D5V A;  4A3C J;  4BKX A;  1ZRE A;  1BJA A;  3BJA A;  2G7U A;  2VKE A;  1KQ8 A;  1ORK A;  2JZY A;  4N9I A;  2R5Z A;  4O5V A;  1YQA A;  3GFJ A;  5E1Z B;  3MEX A;  2LDU A;  2R7F A;  5HLI A;  2FNA A;  5HLT A;  2WAF A;  1F4K A;  2XRO A;  3CCY A;  5J47 A;  1SAN A;  3CCR I;  3Q0U A;  4RB0 A;  5E18 F;  5J6X A;  1HKT A;  2DO7 A;  3HBL A;  4CH7 A;  3CLQ A;  3FMR A;  4UNO A;  4BE1 A;  3TBI A;  2F5F A;  2QZ8 A;  2V9K A;  5A2Q Z;  4ITV A;  4HSR A;  5L3B A;  3CD6 I;  3A03 A;  3RKW A;  4CGZ A;  2OTJ I;  2XSJ C;  3MKW B;  2W4S A;  2AXL A;  3CCQ I;  4ZC3 A;  4XLP F;  5F64 A;  4M3G A;  4KFC A;  3ABM H;  4PGG A;  4XLC A;  1H88 C;  1YRN B;  1R71 A;  5H2F C;  2GM4 A;  2XRN A;  4AUX A;  4UVB A;  2ZXJ A;  3CJN A;  1TC3 C;  2WAE A;  1FMV A;  1T95 A;  4BXF A;  9ANT A;  2CQX A;  3OOP A;  3QOE A;  3IAS 2;  4UVC A;  1ETW A;  5L3F A;  5CVU A;  4HST A;  3TO9 A;  4OU0 A;  5IOY A;  2DOD A;  1R5H A;  2EZI A;  2L9S A;  5CVV A;  3DLA A;  4LD5 A;  5FD6 A;  3A4C A;  2LNB A;  1BOA A;  1DGW Y;  3E0J B;  4XBF A;  2E71 A;  5BNG A;  4AC0 A;  2BXY A;  2WC2 A;  3CTA A;  2VOD A;  4FET A;  4OAZ A;  3CO7 C;  3LSP A;  3RYR A;  2VQL A;  4E7I A;  1LVA A;  4AIJ A;  1N25 A;  3BOQ A;  4EMS A;  1ZYR F;  2E36 A;  5EYR A;  3RPU A;  2R93 J;  2CWE A;  4FE4 A;  2O8K A;  2A69 F;  1WHU A;  2A6H F;  3LL7 A;  1HBX G;  1IO2 A;  4XLE A;  5EG0 A;  2V1X A;  4JQF A;  4BJT A;  1I1S A;  5L3G A;  5HLH A;  3ZXS A;  2JPB A;  3TW7 A;  1LKX A;  2XUB A;  1OCC H;  2A5Y B;  5DM7 F;  5BQT A;  4L9V A;  3DEW A;  3ZMV A;  3I59 A;  3GZ5 A;  1ZGJ A;  1S7A A;  2LG4 A;  5HNF A;  2CGP A;  1MMN A;  2EK5 A;  5D8L B;  3OL4 A;  3J7A O;  1XC5 A;  1XGS A;  3TGN A;  3TOB A;  5BS6 A;  3GTO J;  2Z16 A;  3FWE A;  1T08 B;  5EZG A;  3JAM K;  1QGP A;  5FKN A;  4IHV A;  3VSL A;  5DS9 A;  1H9G A;  1WJ5 A;  1YW9 A;  3BQZ A;  2CYY A;  3WU1 B;  1I27 A;  3QYF A;  2XKO A;  1NG6 A;  3K2Z A;  1LFU P;  1JJ6 C;  3KPH A;  2O9L A;  5H6R A;  1RPW A;  3KEY A;  3P7N A;  1JUS A;  1YX3 A;  2XF6 A;  3WGH A;  3O6B B;  3S14 J;  5ICC A;  2WY7 Q;  4E6K G;  1Y8Q B;  2O3F A;  4E70 A;  2G7H A;  2ZO4 A;  3GXO A;  2VBZ A;  4XN3 A;  4PJN A;  3K70 D;  4RS8 A;  1ZGW A;  3SFZ A;  3Q0V A;  5LD2 C;  3HGG A;  2J5O A;  4CSW A;  3FXJ A;  2DDB A;  5HDK A;  2JRT A;  1BIA A;  3D5S C;  2PJR A;  3OIP A;  4EJU A;  2RQQ A;  2NS7 A;  4PCQ A;  2K40 A;  2JQ7 A;  4P55 A;  3E1S A;  2ESH A;  2XPU A;  2F5E A;  3MZ8 A;  3PIO F;  1LDK B;  3E5Q A;  3ROU A;  4IEJ A;  1P4W A;  1IXR C;  1MMG A;  1MMA A;  3GTK J;  1VND A;  4LK1 F;  2AQF A;  2VPR A;  2YUS A;  3BR5 A;  5DD4 A;  3OMY A;  3UR3 C;  1TW3 A;  3S2D J;  3OYM A;  1DU6 A;  5IT3 A;  4A3I J;  1AKH B;  3CCS I;  3GTQ J;  2A3S A;  2FRH A;  3ML6 A;  1UMQ A;  4LGW A;  2XGE A;  4OMZ A;  4ENK A;  2ID3 A;  3PJR A;  2DQR A;  2IA0 A;  3OYL A;  1HDD C;  1IRZ A;  2K9L A;  3AAF A;  4A5N A;  2OTL I;  3CDH A;  2ZFW A;  1I1G A;  2G9W A;  3CDL A;  5EJC A;  2Z33 A;  2FQ3 A;  1Y6I A;  4F7Z A;  3OYB A;  1WJB A;  4HPQ A;  3DKY A;  5AON A;  5H6Q A;  4MTE A;  2R7D A;  3CUQ C;  5LGT A;  4L0Y B;  1WZ2 A;  2NVU B;  3BCA A;  4UB8 C;  2XIG A;  1D8K A;  4C3J J;  2WBM A;  4HDV A;  4RGU A;  2GLO A;  1OR7 A;  3QOP A;  2GIV A;  2Y0S N;  3I58 A;  5GAD J;  1R4M B;  5E17 F;  3HSE A;  3S2W A;  1P7J A;  3GZN B;  3FBI B;  3GEZ A;  3MKL A;  4DIQ A;  2Z9O A;  2LLK A;  1BR4 A;  1EJ9 A;  1B1B A;  1FIP A;  4JP0 A;  3TQN A;  4E7Z A;  1X4O A;  2ZJ2 A;  4UVA A;  4WCG A;  4GO1 A;  4S04 A;  3CF2 A;  5E3L A;  3V42 A;  2RGV A;  1X2M A;  1A35 A;  3QU6 A;  2L0K A;  2VQG A;  4BS9 A;  5C4J J;  2X51 A;  3NAR A;  4AD9 A;  4BL0 B;  2KFD A;  2MYS A;  2QUF A;  2IGM A;  5ILS A;  5J40 A;  3GLX A;  5D6E A;  5FLV A;  2K3F A;  1P2F A;  2Y0S A;  1HKS A;  1WKM A;  4H4K C;  1UB9 A;  2OAZ A;  2DT5 A;  2IW5 A;  4RAY A;  1G3T A;  2PMZ A;  3DKX A;  1FP1 D;  3JAM Z;  3OS2 A;  4CZC A;  1L0O C;  5CPR B;  4LMY A;  3MZY A;  2HPM A;  1W36 D;  2XB5 A;  3A1Y A;  4RM2 A;  3DCF A;  1BL0 A;  3EUK L;  2TCT A;  3V7S A;  2XRL A;  3AL0 C;  3OY9 A;  4PJL A;  3LST A;  4D5C A;  3AKZ A;  3L00 A;  1LUJ B;  1R4N B;  2KZG A;  4MTD A;  2GXG A;  2OUM A;  4XON A;  2OQG A;  1E3P A;  3QP5 A;  3LSG A;  1J0R A;  1ZR2 A;  1J09 A;  1V5F A;  3I4M J;  2V79 A;  2YX7 A;  2JVH A;  2EJR A;  3DEU A;  5LFA A;  2ZXH A;  2QSH X;  3HEF A;  4BXX J;  2XV4 S;  3IKV A;  4X1E A;  4RDU A;  2ZJP F;  4BHP A;  1SVO A;  5LRR A;  2L01 A;  3QYB A;  2PMZ N;  3CMA I;  1HW2 A;  1K6O A;  2IS6 A;  3JSO A;  4BBR J;  1UEL B;  2HVR A;  3IH2 A;  1B8I A;  4HBL A;  4BEH B;  2BBY A;  3D5L A;  2KRH A;  1P92 A;  2HYJ A;  2QA4 I;  2AXT C;  1T39 A;  2QVO A;  2IA1 A;  3ZCO A;  5D8K B;  1N77 A;  5IOZ A;  2VAS A;  3I71 A;  4A93 J;  1BI2 A;  1LB2 A;  3HM5 A;  2XPW A;  2DOF A;  1IZ1 A;  1B8I B;  1UST A;  1MDM A;  2Q8K A;  5HS7 A;  2V6E A;  3F6V A;  2DBB A;  3LMM A;  3CUO A;  1CGP A;  2H1K A;  2UWM A;  2MA3 A;  1K79 A;  3JRA A;  1MNE A;  1IGN A;  2CG4 A;  3QU3 A;  1O7F A;  1PJR A;  2IAI A;  2QYO A;  1G3Y A;  4MIM A;  4V2G A;  2EIK H;  3ABT A;  3G71 I;  1UJ8 A;  2CV0 A;  3TP0 A;  2BYV E;  4FQG A;  2LK2 A;  1MBF A;  2F4M B;  2EFQ A;  1OPC A;  4CYC B;  5E8G A;  3EYI A;  3S3N A;  2ZC2 A;  2E1O A;  1MMD A;  1DPU A;  2ZME B;  5E1X A;  3QPH A;  4BE0 A;  1B9M A;  3PUF A;  4CO8 A;  1H0M A;  1QU3 A;  1J9I A;  1E17 A;  1YJW I;  1IV6 A;  4RGS A;  1ETQ A;  2EB7 A;  3S16 J;  1T33 A;  3CES A;  3DEE A;  1VFC A;  4ZYA A;  1ON2 A;  1XMX A;  4IHT A;  4X0G A;  4IRH A;  3KZZ A;  2CO5 A;  2OQR A;  2V4J C;  3GCM A;  4ZYG A;  5K5Q A;  2FE3 A;  1DGR M;  1NTC A;  2BE5 F;  3E6D A;  3H9G A;  1GHC A;  3K4L A;  5LGU A;  3BG6 A;  2F5D A;  2NYX A;  1OMI A;  1RIO H;  1YG2 A;  1PDN C;  2EIJ H;  2DOE A;  3CQZ J;  3PFY A;  3GVA A;  1LQ1 A;  2F5C A;  3K69 A;  1Z05 A;  2E1M C;  4XM3 A;  3M07 A;  2R7V A;  2V26 A;  2BV6 A;  2JA2 A;  1R6R A;  2XVC A;  3B73 A;  2KIF A;  1O3S A;  2PQ8 A;  1ZLJ A;  4P9F A;  2JA6 J;  2JUC A;  4R8H A;  2NVQ J;  4DYR A;  2M30 A;  2ZXW H;  3BC8 A;  2M9H A;  5EDN A;  3ECO A;  2VON A;  3VYS B;  3LA3 A;  2H09 A;  5IYC J;  2H8R A;  1SD5 A;  5LRS A;  3QRF F;  1TTY A;  2MGQ A;  3GFL A;  4F52 A;  3HC7 A;  5IYB J;  2L9N A;  5CVR A;  2UXN A;  1REP C;  5F1J A;  1VQK I;  1R22 A;  3HKZ A;  4IF4 A;  2A6E F;  2V9V A;  3FXU A;  4HG2 A;  3GX4 X;  3S2H J;  4CZZ A;  3OSF A;  3FMS A;  2CUJ A;  1ETX A;  2EFO A;  2EPF A;  1MJB A;  1CQT A;  4BH9 A;  3UNG C;  2P81 A;  4JX4 A;  1DP7 P;  3F22 A;  1XX5 A;  4CHU A;  3Q3S A;  3MZH A;  3KYD B;  3CP2 A;  4DQ2 A;  2W24 A;  3DBR B;  3I0T A;  3A01 A;  4IRI A;  2YPR A;  2R7U A;  5DCM B;  1U78 A;  2DYR H;  1XSV A;  1I39 A;  3RQI A;  1TWH J;  2DW4 A;  2Z99 A;  3BG3 A;  1WQ2 A;  3F72 A;  4WX9 A;  1B9N A;  4HV6 A;  2VB6 A;  4HEA 2;  3SDG A;  4AYB N;  2CV1 A;  1Z3Y A;  2W25 A;  2X6O A;  4N4N B;  2ME6 A;  2VQC A;  1MBH A;  4XL9 A;  3TP3 A;  4BAY A;  4DYQ A;  5CYV A;  4BQO A;  3SFI A;  3D1N I;  5LEJ A;  4ZZL A;  4F91 B;  1W5S A;  3CME I;  3ZQI A;  2QQB A;  2EV0 A;  1SVL A;  4H0E A;  3ABU A;  1QO0 D;  4EV0 A;  1FLI A;  1D1B A;  1XS9 A;  4HNV A;  4YEL A;  3MVP A;  1VQM I;  3B6C A;  1E3O C;  2NNN A;  2M0M A;  2QLZ A;  3T1B A;  4ZDP A;  4HF1 A;  3WTV C;  3G4S I;  2O03 A;  2VJJ A;  1Z77 A;  3BG9 A;  4GRI A;  3IC7 A;  4GYG A;  2KMU A;  1WI3 A;  2B9S A;  3VB2 A;  2VPL A;  2R5Z B;  3K4C A;  5L3D A;  3I54 A;  5D5X B;  3WTS C;  1Y1W J;  1W0T A;  2D45 A;  1AKH A;  4LFU A;  1KU7 A;  5D5V B;  2A5W A;  4M9S A;  4FAS D;  1CF7 B;  2ELK A;  5F6F A;  2H6B A;  4N0B A;  2K3P A;  1YE9 A;  1RZ4 A;  3K0L A;  5DD8 A;  2ZJQ F;  2QQ8 A;  3KP2 A;  3HTU A;  3W2V A;  1WWX A;  1E3H A;  1ZKG A;  3F8B A;  3GF2 A;  4O6J A;  3T5X A;  4CDG A;  2NS0 A;  4XSX F;  3S3M A;  1GDT A;  2K86 A;  1FOW A;  2IGO A;  4Z2Y A;  1AOY A;  3QPS A;  1FP2 A;  2DA6 A;  3I5U A;  3MFK A;  5E3N A;  2OC6 A;  4BDY A;  4CCJ A;  3CDI A;  1FOX A;  2VXD A;  3P9C A;  4D5F A;  3JRG A;  1FYK A;  1ETO A;  4KIB A;  1QBJ A;  2HQN A;  4OIR F;  2E7W A;  5HNH A;  1Y39 A;  3ECH A;  1TWA J;  1I6X A;  1ZGA A;  1D0Z A;  2WV1 A;  1YIO A;  1KZH A;  1D0X A;  1RES A;  2DJI A;  4E7H A;  1F9N A;  1HST A;  1FY7 A;  3E5U A;  5KCM A;  1R49 A;  1VZ0 A;  3LWF A;  2ECC A;  4HLX A;  2I8D A;  3CP8 A;  2GXA A;  2HZD A;  3X2Q H;  2AO9 A;  1D1C A;  2EQR A;  2DA2 A;  3JRC A;  4N4O B;  4FIS A;  4C2M J;  1LE8 B;  1T8I A;  3PFI A;  3PO3 J;  4XNF A;  2NS8 A;  3FXK A;  2MBF A;  1SC7 A;  4MFE A;  3DBH B;  1EH6 A;  2VE9 A;  3OYA A;  2D2W A;  3R0J A;  2Y31 A;  4RBO A;  1U8R A;  2CW7 A;  2D1H A;  3L2W A;  5D5W B;  1XSX A;  2Y48 A;  2X48 A;  4WXD A;  1FX7 A;  1A04 A;  1G6N A;  1BOB A;  3IKT A;  4HNT A;  3NAU A;  3CCJ I;  4R79 A;  2RNJ A;  2EIL H;  4JK1 X;  4YIF A;  2E60 A;  4I7H A;  1VTN C;  2C6Y A;  5HVQ C;  1KU2 A;  3MQ0 A;  1ZRD A;  3GO5 A;  2DN0 A;  5TGT A;  3BR1 A;  3DTI A;  3BLY A;  2ZSH B;  2L4A A;  5F0F A;  2Y9Z A;  1TL8 A;  2K4B A;  3KP3 A;  4QPO A;  1ETY A;  4NQW B;  3S1M J;  2PMH A;  1ETV A;  1B6A A;  1OLT A;  3GFM A;  2WV0 A;  4B8X A;  3UKG A;  2DMP A;  2EV5 A;  1BN5 A;  2QQA A;  2JN6 A;  1UFM A;  3NRV A;  3K6G A;  3CF5 F;  4W97 A;  5M5W J;  5DYM A;  2W57 A;  4PK4 A;  3HB9 A;  1IN7 A;  2Z1D A;  2ISY A;  3G1L A;  1ZAO A;  2EIM H;  2PEX A;  4YFN F;  3K1M A;  5KAF C;  1U5T C;  1BW6 A;  4J19 A;  2O5R A;  4FHT A;  4HF0 A;  4C2T A;  1ZHF A;  2XF7 A;  4U87 A;  4B43 A;  3ZPL A;  4G7Z F;  3HSR A;  3FF5 A;  4QSH A;  3CMY A;  4HZF A;  1QVU A;  3M9A A;  3HOS A;  5JVT A;  1UAA A;  2EFN A;  2HEO A;  2DMQ A;  4RAZ A;  4Z6Y A;  4IQJ A;  1RI7 A;  1YJ9 I;  1VQO I;  3N97 A;  3KE2 A;  3L2C A;  1HDP A;  2QEX I;  4I98 B;  3RIR A;  2NRA C;  1DU0 A;  3ZOB A;  4B09 A;  1T0F A;  1A6I A;  2H94 A;  2RV8 A;  2LY1 A;  4UUS A;  1F36 A;  2A61 A;  3OWT A;  3WTU C;  5DCF A;  2F2E A;  4V2F A;  1HLV A;  4DOZ A;  4D7M A;  2V1D A;  4L9J A;  3SZT A;  1OIS A;  3H0G J;  5DDG A;  1BI0 A;  3HYI A;  2K9Q A;  4WK8 F;  2KDO A;  4LB6 B;  3TW6 A;  3RKQ A;  2ETH A;  2W48 A;  3ZP5 A;  4IRG A;  3RYP A;  2P5L C;  3ZMS A;  2L7M P;  1XMA A;  4UHT A;  1W0U A;  3IRQ A;  3HXL A;  2P6S A;  1VQL I;  1PVE A;  3BPX A;  1RKT A;  3LSR A;  2HFH A;  2QBY B;  1KU3 A;  1DPR A;  4ENM A;  5ILV A;  4XLN F;  3L2U A;  2HOA A;  2YX4 A;  3TKY A;  4L5E A;  2RVC A;  3H1C A;  3T8R A;  5JR3 A;  1K4T A;  3W2W A;  5F04 A;  3IV5 A;  2B63 J;  2JA7 J;  4BQA A;  3K2A A;  2VOP A;  5J1Y A;  2K4J A;  3GW2 A;  3JCU C;  4EM1 A;  5EGO A;  4II3 A;  4LG3 A;  3LQR A;  3BJO A;  4B4C A;  2Y2Z A;  2X1C A;  3ZRG A;  4A12 A;  4P96 A;  2JPC A;  1IXC A;  3N05 A;  3N4M A;  3JTG A;  1N78 A;  1U6G A;  2K9S A;  3E6M A;  5EEH A;  1ULY A;  4ABZ A;  4D7N A;  3RZD J;  1PUE E;  3EYY A;  1TW2 A;  1XDS A;  2R3S A;  5TIS C;  4PJ0 C;  3LSK A;  2FXA A;  3L2V A;  1GVD A;  1VQN I;  4EGZ A;  4EJT A;  3KYL A;  4KUM A;  1V5G A;  3MD2 A;  1JTY A;  2Z5U A;  3ZQG A;  2JJ7 A;  3VFZ A;  4M6Y A;  1XGM A;  1UHM A;  4F93 B;  1EF4 A;  1YLF A;  2XPV A;  4GCV A;  1WH5 A;  2H27 A;  5D4S A;  1TQM A;  2B7E A;  5FB2 A;  3EUH C;  1DQU A;  2L3D A;  4M6V A;  1B4A A;  2ICW G;  3FXR A;  1IUF A;  2OZU A;  5IP7 J;  2DPD A;  4M6X A;  1T56 A;  4XOP A;  4BE2 A;  3IH4 A;  3C2G A;  5JHF A;  2L5Q A;  2XC7 A;  3C3W A;  1JHH A;  3BTC A;  1ZRF A;  3CUQ B;  3L7W A;  1D5Y A;  3CO6 C;  3ZR8 X;  2P7C B;  4OAY A;  1K61 A;  5EZH A;  4E4H A;  1A36 A;  1R1V A;  3PQK A;  2K27 A;  2E2J J;  2A68 F;  2LY2 A;  4NUB A;  2KL4 A;  1VQ5 I;  1KGS A;  2FBH A;  1B72 A;  5FFX A;  1QQI A;  4PZJ A;  3J7Z I;  1ACI A;  1YIT I;  3WOD F;  1QNT A;  1SFE A;  2Y30 A;  2YS9 A;  4WXC A;  3OYN A;  2CS3 A;  5LBQ A;  3S1Q J;  2LBF A;  2BEO A;  3HL2 A;  4XK4 A;  2EA2 A;  1UHS A;  3ISP A;  3HPG A;  1ON1 A;  3JSP A;  1VQ7 I;  4A3G J;  1QZE A;  4DZJ A;  2HDW A;  3LNQ A;  2JUG A;  4DW6 A;  2VC1 A;  4EQQ A;  2XAU A;  1TT0 A;  3BCB A;  3P9I A;  2MC4 A;  4MEY F;  2LRE A;  2TDX A;  3WTW C;  3ULQ B;  3K4N A;  5ED4 A;  1GLN A;  4G7O F;  1IDZ A;  5HDN A;  4XSZ F;  3FIW A;  4A69 C;  2UUZ A;  3S1R J;  4A3M J;  3HOV J;  2K5C A;  2HXO A;  3PIP F;  2X0L A;  4EGY A;  3H3Z A;  4I02 A;  3L2Q A;  4MO7 A;  3U1D A;  5B66 C;  3PSF A;  5J4Y A;  3J81 Z;  1K78 B;  1MDM B;  2HNH A;  1AHD P;  2DPU A;  1TNS A;  2UZK A;  1S72 I;  5D4R A;  4HX7 A;  3ERM A;  3NWS A;  1Z3X A;  1LPQ A;  3AL0 B;  2VT2 A;  1Z6R A;  5GP9 A;  1U2W A;  3DPU A;  3H35 A;  1FJL A;  3W6V A;  3MKZ A;  3T0Y A;  1WI9 A;  1MBK A;  3GFI A;  1JI8 A;  3SQN A;  3EUA A;  4EJW A;  3ASN H;  4OIQ F;  4CYC A;  5IT9 Z;  3Q9S A;  1XCB A;  5DUI A;  1XB4 A;  1W5C C;  3RKX A;  2DMT A;  2ELJ A;  1SD7 A;  3OYK A;  2ELH A;  1RR8 C;  1IV8 A;  1TQI A;  2LKP A;  1JXS A;  1I50 J;  3KLN A;  1ZK8 A;  3H9J A;  3DWL E;  1A31 A;  5DCM A;  2XDV A;  3S3O A;  3QOD A;  4U88 A;  1TP4 A;  1U9N A;  2LKS A;  5HOD A;  3WHB A;  2KIM A;  1FBQ A;  4G94 A;  4KMU X;  1LNW A;  2Q2E A;  4A2U A;  2IS4 A;  3DBL B;  3R4K A;  1HOM A;  1G3W A;  2LBF B;  4ESF A;  1QZZ A;  1E0E A;  4BEH A;  3F9K A;  2DTZ A;  2OF7 A;  2CFX A;  4HV5 A;  3CCV I;  1FIA A;  1FTZ A;  5BOX A;  4EEF G;  1JGG A;  2YR2 A;  2UV1 A;  3BDD A;  1PUF A;  2RKH A;  5FKM A;  5LLQ A;  1HW5 A;  3ZGK A;  4IOC F;  2RC4 A;  4KYW A;  3COA C;  2ZJR F;  5CKT A;  5CJ9 A;  5HLG A;  4LIV A;  2OU2 A;  5FJ8 J;  3CZ6 A;  1RET A;  2IBD A;  2M5W A;  2CW8 A;  1YHQ I;  4R1H A;  1K83 J;  2GWR A;  3DPT A;  3SJM A;  5LEK A;  2LP0 A;  2LOO A;  1JT0 A;  4EJO A;  2PBI A;  1ODD A;  1Y56 A;  1YJN I;  3ZQL A;  1JT6 A;  2MSY A;  4ANJ A;  4OIP F;  1LEB A;  1ZG5 A;  2FEZ A;  2W7N A;  3QAH A;  3VOE A;  2FML A;  3EET A;  1R58 A;  1ZTR A;  3SEZ A;  1K78 A;  1GXQ A;  4EM0 B;  3WG9 A;  1OR7 C;  3KP4 A;  1W36 C;  2ME0 A;  3C1D A;  1FBS A;  4C9Y A;  1Q1H A;  2P7V B;  3BTI A;  1IG7 A;  4A3D J;  1TLH B;  4L5J A;  3VEP A;  2O8X A;  4I6Z A;  1Z67 A;  3RSN A;  3M8E A;  1BIB A;  3GTG J;  1FT9 A;  2K9M A;  1T6S A;  2V1N A;  2EFP A;  5CVI A;  2ACJ A;  3BP8 A;  5B3S H;  3RCO A;  1Z91 A;  2JSC A;  2L7F P;  5JI6 A;  3TO7 A;  1H8A C;  2DCE A;  1E2X A;  3RZO J;  2W82 A;  2KT0 A;  4F55 A;  1GV5 A;  4M9X A;  3RQ4 A;  5K7Z A;  2VXZ A;  3U2R A;  2H1L A;  3S15 J;  4IHY A;  3S17 J;  2EBI A;  5LGN A;  3CC7 I;  5KK1 A;  1LDD A;  3G1M A;  4IL6 C;  1LEA A;  2HWV A;  3LAP A;  1W7P B;  1T98 A;  1P7I A;  2R7Z J;  2KDZ A;  2BW3 B;  2CJJ A;  1IJW C;  1BW5 A;  3GTM J;  1J7K A;  1LFP A;  1TZL A;  1O4X A;  3GWZ A;  3EQL F;  3W2A A;  2E35 A;  3Q9V A;  5B1B H;  2GA2 A;  3OYJ A;  1IAW A;  4ZDO A;  5FKK A;  1QHH D;  3HG9 A;  4I76 A;  4XLH A;  3JRB A;  4ENJ A;  1X1D A;  4LK0 F;  4RAF A;  4E7L A;  1VQ9 I;  5K5O A;  2VJ4 A;  3IL2 A;  4IPA A;  2DQL A;  4C30 A;  3ONQ A;  1XGN A;  3L1P A;  1USS A;  4EM2 A;  2M4K A;  4RMN A;  5EG0 B;  5EGO B;  4BJ5 C;  2EV6 A;  1G2H A;  4CCK A;  1X58 A;  2EA4 A;  2D1V A;  1FPQ A;  2KPM A;  4M73 A;  1ZG1 A;  1MH4 A;  2JTV A;  3TDU C;  4LLL A;  2JMW A;  3BRO A;  3ZQ7 A;  3BQY A;  3OIQ A;  2XGD A;  2VBX A;  2P6T A;  1R5I D;  4CCM A;  1D0Y A;  2Y75 A;  5BPD A;  3A01 B;  3RTR A;  2VKH A;  1HCR A;  2DI3 A;  3PQJ A;  3OS0 A;  3ELK A;  5FKO A;  2YU9 J;  2ZNY A;  4B1R A;  1WGX A;  3TMO A;  2EWN A;  2XAF A;  3FM5 A;  2L9V A;  3ABK H;  1R5G A;  1EA3 A;  4IOA F;  2HQA A;  2JT1 A;  2KJC A;  1OCZ H;  2DYS H;  4U0W A;  4BXU A;  1EH8 A;  2KIS A;  1ZH5 A;  2QBY A;  5ILU A;  2ZSI B;  2FD5 A;  1OCP A;  1RUO A;  1Y0U A;  4KIF A;  4BJ6 C;  2IVM A;  2MW8 A;  4KT6 A;  1MJ9 A;  2LR8 A;  4B47 A;  2M87 A;  2WWY A;  4OMY A;  1BC8 C;  2HYF A;  4RB1 A;  1BI1 A;  4DGW B;  2E2I J;  3JW4 A;  2KQR A;  1K7A A;  4NHJ A;  1NH3 A;  3MAJ A;  3FXM A;  4LLG F;  4Y7N J;  5JLW A;  2OZ6 A;  4MEX F;  3G6E I;  1O57 A;  2IS1 A;  2K9N A;  1JHF A;  2HYG D;  4BUP A;  3BPV A;  4GFB A;  3HIF A;  5IYD J;  1MND A;  3HDD A;  4F3Q A;  2XHK A;  2VJI A;  2XAH A;  3HOY J;  1O3Q A;  3G1O A;  3C2B A;  2H8W A;  4BYY A;  1O3T A;  3F6O A;  2DXI A;  2VBW A;  2OJE D;  2RQP A;  3FX3 A;  4IJA A;  4I2O A;  3CCM I;  3F8N A;  3W3C A;  3TO6 A;  3FHZ A;  2ISZ A;  3FKJ A;  3V8J A;  3VSK A;  3WTT C;  1ZG3 A;  3A0H C;  3IP4 B;  4UB6 C;  1N75 A;  4IZZ A;  3WG7 H;  4BNC A;  1U5T B;  2KLO A;  1YS6 A;  5J8F A;  2YU3 A;  2XAJ A;  4YII A;  2VT3 A;  1X4P A;  2A07 F;  2R7S A;  1V55 H;  3AG2 H;  4ZDL A;  1OYY A;  1Z7L A;  4BDZ A;  2QEN A;  4E7J A;  2IRF G;  4M3E A;  3I56 I;  1D5V A;  2MC3 A;  3J7Y J;  3JRD A;  1TQP A;  3F21 A;  2BOL A;  5E3O A;  4KIG A;  1FZP B;  1S9H A;  2IJL A;  1R36 A;  2CQK A;  2EIN H;  3FK6 A;  2XAG A;  3S32 A;  3DQV C;  2GA1 A;  3MCZ A;  4NNJ A;  2ECB A;  5EEG A;  1ENH A;  3HTS B;  2MFZ A;  4IQ4 A;  4FX0 A;  5TRD A;  2HOS A;  2R7T A;  3ASO H;  2CU7 A;  5DEQ A;  1NK3 P;  2FUG 2;  4IX7 A;  1XTA A;  4HLY A;  4ZYD A;  1D1A A;  1YYV A;  3SDB A;  5J3L A;  4HQM A;  3HZJ A;  4HNU A;  2NAZ A;  2P5V A;  3BY6 A;  3B6A A;  3RPU D;  2EFW A;  2DAO A;  3OYC A;  4CXF A;  4HRI A;  5DV5 A;  1VF9 A;  2H6C A;  3FMQ A;  3DU6 A;  5IY5 H;  4PJJ A;  1K4S A;  3FM3 A;  2Y9Y A;  2MH2 A;  2XAS A;  1ZQ3 P;  1YS7 A;  1Q1V A;  1KU9 A;  4OIN F;  4XLA A;  1OCT C;  2M3A A;  1P6R A;  2L9R A;  4HF2 A;  2FOK A;  1S5L C;  3E97 A;  4UUT A;  3FXO A;  1STZ A;  2HXI A;  1IUY A;  1POG A;  1GVJ A;  3KZI C;  4U0Y A;  3QWL A;  1G59 A;  3CLO A;  4ZH4 F;  1EH7 A;  3OYD A;  2RN7 A;  2HTJ A;  2E19 A;  1IC8 A;  2Q1Z B;  3FK7 A;  4OIO F;  2VKD A;  4MNU A;  5CLS A;  1F43 A;  4RAG A;  1WCM J;  3DF8 A;  4AVP A;  3U9G A;  1AU7 A;  2ZB9 A;  2F48 A;  2DFE A;  1MZB A;  2PN6 A;  1OYW A;  3ZMZ A;  4AWX B;  3HOZ J;  5GAE J;  3E6B A;  3IUO A;  1SFX A;  3I9V 2;  3NWT A;  2XSD C;  1W4M A;  3KEQ A;  3D0S A;  2QF7 A;  3C18 A;  4NC8 A;  3WU2 C;  3M1C A;  2JK3 A;  3CJQ B;  3J80 K;  4AM3 A;  2VIX A;  3K10 A;  4IHW A;  4UV9 A;  2VBY A;  2KZV A;  3V8K A;  3HSF A;  2CMP A;  2KIQ A;  3I64 A;  1KA8 A;  5E79 C;  4BY1 J;  5ICE A;  3OYF A;  1ZLK A;  2PFB A;  3WU0 A;  3C7J A;  4KN7 X;  2FNP A;  4XIC A;  5GTH C;  1IRG A;  3HGY A;  1H89 C;  3BG5 A;  1VQP I;  4Y15 A;  3A2K A;  1OQY A;  1G3S A;  2HTS A;  2NVT J;  3S1N J;  2E5Z A;  1V4R A;  3K4J A;  3FZV A;  4XKW A;  2PMU A;  2NOJ B;  2R5Y A;  2M4G A;  1VQ6 I;  4DNC A;  4ZZD A;  2GZW A;  3ZQC A;  2CW0 F;  2MLK A;  1RC9 A;  1HKQ A;  5AIP A;  3OV8 A;  2DFH A;  2HOT A;  2KIU A;  1WVR A;  1X1A A;  2F5V A;  2QGU A;  3J7A Y;  4GGG A;  2COB A;  2LTP A;  2CV2 A;  3F8M A;  1YW8 A;  5FFZ A;  4IHX A;  2K85 A;  4XN0 A;  3C2H A;  1MSF C;  5D6F A;  3DTE A;  4I0A A;  4M74 A;  1OCO H;  2R7R A;  5M3F J;  4HQE A;  4KJZ A;  5JFR A;  3IRR A;  1LVK A;  3KFW X;  4HA8 A;  2XGX A;  1IW7 F;  5GAG J;  3S93 A;  2Q2E B;  2E1C A;  3E5X A;  4KMF A;  3LSH A;  5JHU A;  4Y3O A;  1LE8 A;  2VI6 A;  4BQQ A;  3QQA A;  1Y0N A;  4KN4 X;  3A0B C;  3MN2 A;  4CIC A;  4XKV A;  1RR7 A;  4E7S A;  2E1N A;  3H3U A;  5JLX A;  1WJF A;  4AU7 A;  4LG0 A;  3H5N A;  3FKI J;  1WFX A;  5LHI A;  1SEU A;  2IGK A;  4MQ9 F;  2IGN A;  2MH9 A;  3JRE A;  1MBG A;  1S29 A;  3K1N A;  1FBU A;  4KNY A;  2HVQ A;  1FNN A;  2XGC A;  2ZXI A;  5F08 A;  5FO5 A;  4L0Z B;  1SD4 A;  1IN4 A;  5J1R A;  3H36 A;  3P9K A;  3W6J B;  2Q0O A;  4QWQ A;  1SMT A;  4M3B A;  1TWF J;  4II2 A;  4BY7 J;  3M1E A;  1OYI A;  1TBX A;  3R60 A;  1H9T A;  1SD6 A;  3BG7 A;  1ETK A;  2PI0 A;  2W1O A;  3V8L A;  4A6D A;  1FOY A;  4TV7 A;  4BBS J;  2N8G A;  4WWC A;  2HGC A;  3REO A;  1MW7 A;  3EUH A;  1EV7 A;  1X19 A;  2HZT A;  3WTZ A;  3K4B A;  4CCL A;  3VYR B;  2BY2 A;  3IWZ A;  2HDC A;  4ZYE A;  2DT6 A;  2WB1 A;  1YX5 A;  3ZMU A;  5J8C A;  3HOX J;  2DTR A;  2BY1 A;  2ESN A;  2MAB A;  4P5O A;  2L4M A;  2LRD A;  1QPM A;  3DTK A;  1G4D A;  2CQ7 A;  3OR2 C;  4N9H A;  2MD5 A;  5LHH A;  1KQ9 A;  4BU2 A;  3K7A J;  2STT A;  1TWG J;  3F8C A;  2E7X A;  2CQQ A;  1GUU A;  4A3F J;  3T8T A;  4EAT A;  1ITY A;  3ESW B;  4ETS A;  4IKF A;  2BW3 A;  3KP6 A;  3I59 B;  1FTT A;  3LFU A;  4G7H F;  1Z6T A;  2OPT A;  4CA0 A;  4YIR X;  2B0L A;  2J5P A;  3LSJ A;  2DOA A;  4JYK A;  2WB1 N;  2O6G E;  1MIJ A;  5FRN A;  3JRH A;  2R7Q A;  1ZAR A;  4LLN A;  5K7F A;  3QPT A;  5E8I A;  2FBK A;  2DJN A;  2IA2 A;  4BHB A;  4GDF A;  1SFU A;  5KAI C;  3HRT A;  2FOW A;  2FJ1 A;  3KEO A;  1MBE A;  3I4P A;  3J81 K;  2OCE A;  3E7L A;  2GQQ A;  5IPA A;  2Z3Y A;  2FF4 A;  1DP3 A;  3CC2 I;  1OCR H;  2FSW A;  3O2P E;  2R7X A;  2F4I A;  1Z0X A;  3RDI A;  3A02 A;  3HUG A;  3PUB A;  4E7K A;  1F5T A;  2DA5 A;  5HDG A;  2M34 A;  5GTI C;  1B72 B;  1Z9C A;  1L3L A;  3M8F A;  4RB2 C;  1IDY A;  1IN5 A;  4C3I J;  5IT9 K;  1RNL A;  4EVI A;  4FTH A;  2UXX A;  1J75 A;  3DXJ F;  1APL C;  5GPA A;  4WXH A;  4HDU A;  4M71 A;  1J59 A;  4LIU A;  3VPR A;  4UUS B;  2X6X A;  2JA5 J;  3CCU I;  4J01 A;  2EH3 A;  2LFB A;  1JUM A;  4ON0 A;  1V5E A;  1R23 A;  2RRE A;  2IEK A;  3I4N J;  4Y17 A;  4JOM A;  2X6W A;  3BT9 A;  2VE8 A;  1B59 A;  4G9Y A;  1KON A;  2RAE A;  3ABL H;  5M5Y J;  3I55 I;  1PP8 F;  1Y8R B;  3PO2 J;  2V1U A;  4QLC U;  1R7J A;  1XGO A;  1WPK A;  1X1P A;  4Q48 A;  5ICF A;  3KLO A;  3M7G A;  3AG3 H;  4PDK A;  3ZMD A;  3SHF A;  3L9F A;  5C4X J;  3O8H A;  2R5Y B;  2IT0 A;  2YSR A;  1WJC A;  3OYI A;  1F1Z A;  2M1B A;  3EDP A;  4PSX A;  3AG1 H;  4L5I A;  4FT8 A;  1KYW A;  1QA6 A;  3L09 A;  5FRO A;  4IHS A;  3ERE D;  1MMS A;  3EPZ A;  2M0C A;  1BJZ A;  5C44 J;  4QTR A;  2O7O A;  3VOD A;  1RKW A;  2KP6 A;  4HYE A;  1X2N A;  2KJB A;  5EF6 A;  1XDU A;  1ZR4 A;  1W7P A;  4AVZ A;  1U3E M;  1FYL A;  1QZY A;  4Y52 J;  2FU4 A;  3KX2 A;  1YI2 I;  3LA7 A;  2CQN A;  2HDD A;  3D5R C;  2XKP A;  1P4A A;  5J4V A;  4PGH A;  5B5E C;  1RUN A;  3PNT A;  4GYI A;  3FXL A;  1X3W B;  3CJR B;  5BPI A;  2ZFU A;  4O3M A;  2GOM A;  2R7O A;  5LHG A;  5M3M J;  4B48 A;  1AWC A;  1U8B A;  1FSH A;  1FSE A;  2AQE A;  4Q5S F;  3RJP A;  4Y33 A;  4A3K J;  5AIQ A;  2KRF A;  2ZKZ A;  3TL4 X;  4KIT B;  1MGT A;  2Y0M A;  1MNM C;  2HQR A;  4YFX F;  1WH7 A;  4XOR A;  1A6Q A;  2L02 A;  3AFH A;  1ONV A;  4G6Q A;  3O3K A;  3BR6 A;  5HS8 A;  4RA2 A;  3PL8 A;  4ZTJ A;  4Y13 A;  3GTJ J;  4FCY A;  3VDX A;  2HOE A;  4HOB A;  3R0A A;  1BI3 A;  3WTY C;  2WTE A;  1HXD A;  1BA5 A;  2VLA A;  2WAQ N;  3DP7 A;  4A3J J;  3GYH X;  2DLL A;  2R92 J;  1TT5 B;  3WE2 A;  3ZQF A;  2XF5 A;  1S7E A;  5ICG A;  3GTP J;  2E1M B;  4PFO A;  3K4K A;  4KIS A;  1X1C A;  2BVL A;  2QWW A;  1MKM A; 
#chains in the Genus database with same CATH homology
 4A6E A;  3DFG A;  4MQV A;  2ADU A;  2COM A;  2DFI A;  3BWG A;  3CUQ A;  1HSJ A;  1XSD A;  1MJA A;  4UV8 A;  2LF7 A;  2P5K A;  3H92 A;  4MHG A;  1T2K A;  4KA4 A;  4IXA A;  1HW1 A;  1YW7 A;  2P8T A;  4BHC A;  3MWM A;  1R1U A;  3HRM A;  4FX4 A;  4A0Z A;  3KCC A;  2GXB A;  2QM3 A;  1X3U A;  1ZN2 A;  3WTX C;  3E6C C;  2BGC A;  3HOT A;  1J5Y A;  1MD0 A;  1W7P D;  1S6L A;  1Z1D A;  4MGR A;  5L3E A;  3R6S A;  2K7L A;  1BC7 C;  1I5Z A;  1LDJ A;  2M45 A;  1XMK A;  5ERI A;  3V7C A;  3SZP A;  5E20 A;  3BJ6 A;  2W85 A;  2LF8 A;  3KP5 A;  4L9N A;  3KZY A;  4ZYH A;  3TOA A;  4U7D A;  1O7L A;  4G8X A;  4U7B A;  2DK8 A;  3KP7 A;  4YG2 F;  2VOO A;  4IVN A;  1S8N A;  2FA5 A;  4ENN A;  2ZBK A;  3G3Z A;  6PAX A;  1KYZ A;  2OD5 A;  3BZ6 A;  4I01 A;  2W84 A;  1JE8 A;  1XD7 A;  2HKO A;  4JBA A;  5L3C A;  3I53 A;  2P4W A;  5FLX Z;  3LFK A;  3IHU A;  2MLG A;  3ZN0 A;  3GZ6 A;  1YTY A;  2CSO A;  4EJV A;  4I0B A;  3SXY A;  1NHA A;  4RGX A;  4L9T A;  3NEU A;  1DDN A;  4S05 A;  1KQ0 A;  2FMY A;  1W5T A;  5HS9 A;  3ZN1 A;  1YFH A;  4M9Z A;  2O61 A;  2K02 A;  1FWZ A;  5FD5 A;  4A0X A;  3Q5F A;  1FYM A;  2VN2 A;  3GUD A;  4GXO A;  3V7R A;  5FGM A;  3RI4 A;  2HR3 A;  5FLX K;  4UUV A;  4AIH A;  5DUK A;  2IPQ X;  4RGR A;  2GAU A;  4U0V A;  1WSU A;  3RKY A;  1D8J A;  2PJP A;  1SMY F;  1ZRC A;  1YO5 C;  2HS5 A;  3HHG A;  1CF7 A;  4NQW A;  1U5T A;  4LG0 B;  3F23 A;  4A5M A;  1C0W A;  1XN7 A;  4D0P A;  1DUX C;  3LQQ A;  3R61 A;  5CVJ A;  1UCR A;  3LA2 A;  1TNT A;  1PP7 U;  4A0Y A;  2ZME A;  3KET A;  3G73 A;  1XCV A;  3QP6 A;  2IP2 A;  3FXQ A;  5K5R A;  1BBY A;  4KIC A;  1P4X A;  5D5U B;  2KKO A;  1WRJ A;  3W6K B;  4HX8 A;  2PLY A;  1OKR A;  4LB5 A;  1IF1 A;  2M8E A;  5H20 A;  1JGS A;  4HX4 A;  2OA4 A;  1HQC A;  4ESJ A;  3J80 Z;  2STW A;  3V4G A;  3NQO A;  1D3Y A;  4ASN A;  1R1T A;  4G6D A;  4NB5 A;  2V6C A;  1FC3 A;  3WGG A;  2ZCW A;  4I09 A;  1IN8 A;  2ZNZ A;  1IXS B;  2QQ9 A;  3B02 A;  3F3X A;  2NNY A;  1V3F A;  4Q47 A;  2PG4 A;  4AIK A;  3DV8 A;  3F8F A;  2X4H A;  2O0Y A;  4M72 A;  4LJZ F;  3DKW A;  3DPL C;  2DU9 A;  4HW0 A;  3ZMT A;  1S3J A;  5TJJ A;  4Q4Z F;  4ESB A;  5A2Q K;  3WGI A;  4P9U A;  5F1R A;  5HOO A;  1UHW A;  1T38 A;  1IN6 A;  3RPQ A;  2AS5 F;  3LAJ A;  3HHH A;  4CYD A;  1S7O A;  2L54 A;  3K1P A;  3HRS A;  2RDP A;  2DK5 A;  2XAQ A;  5K1Y A;  3IWF A;  3JTH A;  4HAM A;  3E3V A;  4RB3 C;  2OBP A;  1J2X A;  1SAX A;  4UXN A;  4XRF A;  1R00 A;  4YFK F;  2HKX A;  2LSO A;  1LJ9 A;  1O3R A;  2FBI A;  4L18 B;  1BM9 A;  1Z7U A;  1IRF A;  3HRU A;  2VC0 A;  3WE3 A;  3TDZ C;  5BMZ A;  4KT5 C;  1GXP A;  1FOK A;  4KDP A;  4K2E A;  3K9T A;  5KVR A;  5E1W A;  4OOI A;  4WF2 A;  1ZRE A;  1BJA A;  2G7U A;  3BJA A;  1KQ8 A;  2JZY A;  4N9I A;  4O5V A;  1YQA A;  3GFJ A;  5E1Z B;  3MEX A;  2LDU A;  2R7F A;  5HLI A;  2FNA A;  1F4K A;  2XRO A;  4RB0 A;  5E18 F;  5J6X A;  1HKT A;  2DO7 A;  3FMR A;  4UNO A;  2F5F A;  2QZ8 A;  5A2Q Z;  5L3B A;  3RKW A;  4CGZ A;  2AXL A;  4XLP F;  5F64 A;  4KFC A;  4PGG A;  2XRN A;  4UVB A;  2ZXJ A;  3CJN A;  3OOP A;  4UVC A;  5L3F A;  5CVU A;  3TO9 A;  4OU0 A;  1R5H A;  5CVV A;  4LD5 A;  5FD6 A;  2LNB A;  1BOA A;  4XBF A;  2VOD A;  3CTA A;  2WC2 A;  3CO7 C;  3RYR A;  1LVA A;  4AIJ A;  3BOQ A;  4EMS A;  1ZYR F;  3RPU A;  2CWE A;  2A69 F;  2A6H F;  1HBX G;  2V1X A;  4JQF A;  1I1S A;  5L3G A;  5HLH A;  2JPB A;  2XUB A;  2A5Y B;  5BQT A;  4L9V A;  3ZMV A;  3I59 A;  3GZ5 A;  1ZGJ A;  1S7A A;  2CGP A;  2EK5 A;  5D8L B;  3J7A O;  3TOB A;  1XGS A;  3TGN A;  5BS6 A;  3FWE A;  3JAM K;  1QGP A;  1H9G A;  1YW9 A;  2CYY A;  3WU1 B;  1I27 A;  2XKO A;  3K2Z A;  5H6R A;  3P7N A;  3WGH A;  3O6B B;  5ICC A;  2O3F A;  4E70 A;  2G7H A;  2ZO4 A;  3GXO A;  2VBZ A;  4RS8 A;  3SFZ A;  2J5O A;  5HDK A;  2JRT A;  1BIA A;  4EJU A;  4PCQ A;  4P55 A;  2ESH A;  2F5E A;  1LDK B;  3E5Q A;  3ROU A;  1P4W A;  1IXR C;  4LK1 F;  5DD4 A;  1TW3 A;  5IT3 A;  2A3S A;  2FRH A;  3ML6 A;  4LGW A;  4OMZ A;  4ENK A;  2DQR A;  2IA0 A;  3AAF A;  4A5N A;  3CDH A;  2ZFW A;  1I1G A;  2G9W A;  2Z33 A;  2FQ3 A;  4F7Z A;  5H6Q A;  5AON A;  4MTE A;  5LGT A;  2R7D A;  3CUQ C;  4L0Y B;  2XIG A;  1D8K A;  4HDV A;  4RGU A;  1OR7 A;  3QOP A;  2GIV A;  3I58 A;  5E17 F;  3HSE A;  3S2W A;  3GEZ A;  2Z9O A;  1B1B A;  3TQN A;  2ZJ2 A;  4UVA A;  4WCG A;  4GO1 A;  4S04 A;  2RGV A;  3QU6 A;  4AD9 A;  2QUF A;  5ILS A;  3GLX A;  5D6E A;  1P2F A;  1HKS A;  1WKM A;  1UB9 A;  2OAZ A;  2DT5 A;  2IW5 A;  4RAY A;  1G3T A;  1FP1 D;  3JAM Z;  1L0O C;  4LMY A;  3MZY A;  3V7S A;  3LST A;  3L00 A;  4MTD A;  2GXG A;  2OQG A;  3QP5 A;  1J0R A;  2V79 A;  2YX7 A;  2EJR A;  3DEU A;  2XV4 S;  3IKV A;  4BHP A;  5LRR A;  2L01 A;  1HW2 A;  1K6O A;  3JSO A;  4HBL A;  2BBY A;  3D5L A;  1P92 A;  1T39 A;  2QVO A;  2IA1 A;  5D8K B;  3I71 A;  1BI2 A;  1LB2 A;  1IZ1 A;  1UST A;  1MDM A;  2Q8K A;  5HS7 A;  3F6V A;  2DBB A;  3CUO A;  1CGP A;  2UWM A;  2MA3 A;  1K79 A;  2CG4 A;  3QU3 A;  1O7F A;  2QYO A;  1G3Y A;  3ABT A;  2BYV E;  2EFQ A;  1OPC A;  5E8G A;  3EYI A;  1DPU A;  2ZME B;  5E1X A;  3QPH A;  1B9M A;  4CO8 A;  1H0M A;  1J9I A;  1E17 A;  4RGS A;  2EB7 A;  1ON2 A;  4IHT A;  4IRH A;  3KZZ A;  2CO5 A;  2OQR A;  4ZYG A;  5K5Q A;  2FE3 A;  2BE5 F;  3E6D A;  1GHC A;  5LGU A;  2F5D A;  2NYX A;  1OMI A;  1RIO H;  1YG2 A;  1PDN C;  3GVA A;  1LQ1 A;  2F5C A;  3K69 A;  1Z05 A;  2BV6 A;  2XVC A;  3B73 A;  2KIF A;  1O3S A;  2PQ8 A;  1ZLJ A;  4P9F A;  4R8H A;  2M30 A;  3ECO A;  2VON A;  3LA3 A;  2H09 A;  3QRF F;  1SD5 A;  5LRS A;  1TTY A;  3GFL A;  5CVR A;  2UXN A;  1REP C;  1R22 A;  4IF4 A;  2A6E F;  2V9V A;  3FXU A;  3GX4 X;  4CZZ A;  3FMS A;  2EFO A;  1MJB A;  4BH9 A;  1DP7 P;  3F22 A;  4CHU A;  3MZH A;  4DQ2 A;  2W24 A;  3I0T A;  4IRI A;  2YPR A;  5DCM B;  1U78 A;  1XSV A;  2DW4 A;  2Z99 A;  4WX9 A;  1WQ2 A;  3F72 A;  1B9N A;  4HV6 A;  2W25 A;  4BAY A;  5CYV A;  5LEJ A;  4ZZL A;  1W5S A;  2QQB A;  2EV0 A;  4H0E A;  3ABU A;  1QO0 D;  4EV0 A;  1FLI A;  2NNN A;  2QLZ A;  3T1B A;  4HF1 A;  3WTV C;  2O03 A;  3IC7 A;  4GYG A;  3VB2 A;  5L3D A;  3I54 A;  5D5X B;  3WTS C;  2D45 A;  4LFU A;  1KU7 A;  5D5V B;  4M9S A;  1CF7 B;  5F6F A;  2H6B A;  4N0B A;  1RZ4 A;  3K0L A;  5DD8 A;  3KP2 A;  3HTU A;  1WWX A;  3F8B A;  4O6J A;  3GF2 A;  3T5X A;  4CDG A;  2NS0 A;  4XSX F;  2K86 A;  4Z2Y A;  1AOY A;  1FP2 A;  3I5U A;  3MFK A;  3P9C A;  1FYK A;  4KIB A;  1QBJ A;  2HQN A;  4OIR F;  2E7W A;  3ECH A;  1ZGA A;  1I6X A;  1YIO A;  1F9N A;  1HST A;  1FY7 A;  3E5U A;  3LWF A;  4HLX A;  3PFI A;  2MBF A;  1EH6 A;  2VE9 A;  2D2W A;  3R0J A;  1U8R A;  2D1H A;  5D5W B;  1XSX A;  2Y48 A;  4WXD A;  1FX7 A;  1A04 A;  1G6N A;  3IKT A;  4R79 A;  2RNJ A;  4JK1 X;  4YIF A;  4I7H A;  1VTN C;  2C6Y A;  5HVQ C;  1KU2 A;  3MQ0 A;  1ZRD A;  3GO5 A;  2L4A A;  2K4B A;  3KP3 A;  2PMH A;  1B6A A;  3GFM A;  2WV0 A;  4B8X A;  2EV5 A;  1BN5 A;  2QQA A;  1UFM A;  3NRV A;  5DYM A;  2W57 A;  1IN7 A;  2ISY A;  1ZAO A;  2PEX A;  4YFN F;  3K1M A;  1U5T C;  4FHT A;  4HF0 A;  1ZHF A;  3ZPL A;  4G7Z F;  3HSR A;  3FF5 A;  4HZF A;  3M9A A;  3HOS A;  5JVT A;  2EFN A;  2HEO A;  4RAZ A;  1RI7 A;  3N97 A;  3KE2 A;  3L2C A;  4I98 B;  3RIR A;  2NRA C;  4B09 A;  1T0F A;  2H94 A;  2RV8 A;  2A61 A;  3WTU C;  5DCF A;  2F2E A;  2V1D A;  4L9J A;  3SZT A;  5DDG A;  1BI0 A;  3HYI A;  4WK8 F;  4LB6 B;  2ETH A;  3ZP5 A;  4IRG A;  3RYP A;  2P5L C;  3ZMS A;  1XMA A;  4UHT A;  3IRQ A;  2P6S A;  3BPX A;  2HFH A;  2QBY B;  1KU3 A;  1DPR A;  4ENM A;  5ILV A;  4XLN F;  2YX4 A;  3TKY A;  2RVC A;  3T8R A;  5JR3 A;  4BQA A;  2VOP A;  2K4J A;  3GW2 A;  4EM1 A;  3LQR A;  3BJO A;  4A12 A;  4P96 A;  2JPC A;  1IXC A;  3N4M A;  3JTG A;  1U6G A;  3E6M A;  5EEH A;  1ULY A;  1PUE E;  3EYY A;  1TW2 A;  1XDS A;  2R3S A;  2FXA A;  4EGZ A;  4EJT A;  4KUM A;  2Z5U A;  3VFZ A;  4M6Y A;  1XGM A;  1UHM A;  1YLF A;  4GCV A;  2H27 A;  5D4S A;  1TQM A;  5FB2 A;  2L3D A;  1B4A A;  3FXR A;  2OZU A;  2DPD A;  4M6X A;  3C3W A;  1JHH A;  1ZRF A;  3CUQ B;  3L7W A;  3CO6 C;  2P7C B;  1R1V A;  3PQK A;  2K27 A;  2A68 F;  1KGS A;  2FBH A;  5FFX A;  1QQI A;  4PZJ A;  3WOD F;  1QNT A;  1SFE A;  4WXC A;  5LBQ A;  2BEO A;  2EA2 A;  3ISP A;  1ON1 A;  3JSP A;  2VC1 A;  4EQQ A;  4MEY F;  3P9I A;  2TDX A;  3WTW C;  3ULQ B;  5ED4 A;  4G7O F;  5HDN A;  4XSZ F;  4EGY A;  2X0L A;  3H3Z A;  4I02 A;  3U1D A;  3J81 Z;  1K78 B;  1MDM B;  2DPU A;  1TNS A;  2UZK A;  5D4R A;  4HX7 A;  2VT2 A;  1Z6R A;  1U2W A;  3T0Y A;  1WI9 A;  3GFI A;  3SQN A;  4EJW A;  4OIQ F;  5IT9 Z;  3Q9S A;  1XCB A;  5DUI A;  1XB4 A;  3RKX A;  1SD7 A;  2ELH A;  1TQI A;  2LKP A;  1JXS A;  3KLN A;  5DCM A;  4U88 A;  2KIM A;  1FBQ A;  4G94 A;  4KMU X;  1LNW A;  2Q2E A;  4A2U A;  3R4K A;  1G3W A;  4ESF A;  1QZZ A;  4HV5 A;  2CFX A;  5BOX A;  2YR2 A;  3BDD A;  2RKH A;  5LLQ A;  1HW5 A;  2RC4 A;  4KYW A;  3COA C;  5HLG A;  5CJ9 A;  2OU2 A;  2M5W A;  4R1H A;  2GWR A;  3DPT A;  5LEK A;  4EJO A;  2PBI A;  1ODD A;  4OIP F;  1LEB A;  1ZG5 A;  2FEZ A;  3QAH A;  3VOE A;  2FML A;  1R58 A;  3EET A;  1K78 A;  1GXQ A;  4EM0 B;  3WG9 A;  3KP4 A;  3C1D A;  1FBS A;  1Q1H A;  2P7V B;  1TLH B;  4L5J A;  3VEP A;  2O8X A;  3M8E A;  1BIB A;  1FT9 A;  1T6S A;  2EFP A;  5CVI A;  2ACJ A;  3BP8 A;  1Z91 A;  2JSC A;  5JI6 A;  3TO7 A;  1E2X A;  4M9X A;  2VXZ A;  3U2R A;  5LGN A;  5KK1 A;  1LDD A;  1LEA A;  2HWV A;  3LAP A;  1W7P B;  1T98 A;  1J7K A;  3GWZ A;  3EQL F;  3Q9V A;  2GA2 A;  1IAW A;  4ENJ A;  4LK0 F;  5K5O A;  3IL2 A;  4IPA A;  2DQL A;  1XGN A;  1USS A;  4EM2 A;  2EV6 A;  2EA4 A;  2D1V A;  1FPQ A;  1ZG1 A;  4M73 A;  2JTV A;  3TDU C;  4LLL A;  3BRO A;  3ZQ7 A;  2VBX A;  2P6T A;  2Y75 A;  5BPD A;  3RTR A;  2DI3 A;  3PQJ A;  3ELK A;  2ZNY A;  2EWN A;  2XAF A;  3FM5 A;  1R5G A;  2JT1 A;  2KJC A;  4U0W A;  4BXU A;  1ZH5 A;  1EH8 A;  2QBY A;  5ILU A;  1RUO A;  1Y0U A;  4KIF A;  2IVM A;  2WWY A;  1MJ9 A;  2M87 A;  4OMY A;  1BC8 C;  2HYF A;  4RB1 A;  1BI1 A;  3JW4 A;  1K7A A;  4NHJ A;  3MAJ A;  4LLG F;  2OZ6 A;  4MEX F;  1O57 A;  1JHF A;  2HYG D;  3BPV A;  3HIF A;  2XHK A;  2XAH A;  1O3Q A;  4BYY A;  1O3T A;  3F6O A;  2VBW A;  2RQP A;  3FX3 A;  4IJA A;  4I2O A;  3F8N A;  3TO6 A;  3FHZ A;  2ISZ A;  3V8J A;  3WTT C;  1ZG3 A;  4BNC A;  1U5T B;  1YS6 A;  5J8F A;  2YU3 A;  2XAJ A;  4YII A;  2A07 F;  2VT3 A;  1OYY A;  2QEN A;  2IRF G;  1D5V A;  2MC3 A;  1TQP A;  3F21 A;  4KIG A;  1FZP B;  2IJL A;  1R36 A;  2CQK A;  2XAG A;  3DQV C;  2GA1 A;  3MCZ A;  5EEG A;  3HTS B;  5TRD A;  4FX0 A;  5DEQ A;  4HLY A;  4ZYD A;  1YYV A;  4HQM A;  2NAZ A;  2P5V A;  3BY6 A;  2EFW A;  2DAO A;  4CXF A;  5DV5 A;  2H6C A;  3FMQ A;  3FM3 A;  2MH2 A;  2XAS A;  1YS7 A;  1KU9 A;  4OIN F;  1P6R A;  4HF2 A;  2FOK A;  1IUY A;  3E97 A;  1STZ A;  1GVJ A;  4U0Y A;  3CLO A;  4ZH4 F;  1EH7 A;  2RN7 A;  2HTJ A;  4OIO F;  4MNU A;  5CLS A;  3DF8 A;  4AVP A;  3U9G A;  1MZB A;  2PN6 A;  1OYW A;  3ZMZ A;  4AWX B;  3E6B A;  1SFX A;  1W4M A;  3KEQ A;  3D0S A;  3C18 A;  3J80 K;  4UV9 A;  2VBY A;  3V8K A;  3HSF A;  3I64 A;  1KA8 A;  5ICE A;  1ZLK A;  2PFB A;  3WU0 A;  3C7J A;  4KN7 X;  2FNP A;  1IRG A;  4Y15 A;  1G3S A;  2HTS A;  1V4R A;  3FZV A;  2PMU A;  4DNC A;  4ZZD A;  2GZW A;  2CW0 F;  2MLK A;  1HKQ A;  5AIP A;  3OV8 A;  2KIU A;  4GGG A;  3F8M A;  1YW8 A;  5FFZ A;  5D6F A;  4I0A A;  4M74 A;  4HQE A;  5JFR A;  3IRR A;  3KFW X;  4HA8 A;  2XGX A;  1IW7 F;  4KMF A;  2E1C A;  3E5X A;  5JHU A;  4KN4 X;  4CIC A;  2E1N A;  3H3U A;  4LG0 A;  5LHI A;  4MQ9 F;  2MH9 A;  1S29 A;  3K1N A;  1FBU A;  4KNY A;  1FNN A;  5FO5 A;  4L0Z B;  1SD4 A;  1IN4 A;  3P9K A;  3W6J B;  2Q0O A;  4QWQ A;  1SMT A;  3M1E A;  1OYI A;  1TBX A;  3R60 A;  1H9T A;  1SD6 A;  2PI0 A;  3V8L A;  4A6D A;  4TV7 A;  4WWC A;  2HGC A;  3REO A;  3EUH A;  1EV7 A;  2HZT A;  3WTZ A;  3IWZ A;  2HDC A;  4ZYE A;  3ZMU A;  5J8C A;  2DTR A;  2ESN A;  4P5O A;  2L4M A;  1QPM A;  1G4D A;  4N9H A;  2MD5 A;  5LHH A;  1KQ9 A;  2STT A;  3F8C A;  2E7X A;  3T8T A;  4ETS A;  3KP6 A;  3I59 B;  4G7H F;  1Z6T A;  2B0L A;  2J5P A;  2O6G E;  1ZAR A;  4LLN A;  3QPT A;  5E8I A;  2FBK A;  2IA2 A;  4BHB A;  1SFU A;  3HRT A;  3KEO A;  3I4P A;  3J81 K;  2GQQ A;  2Z3Y A;  2FF4 A;  2FSW A;  3O2P E;  3RDI A;  3HUG A;  1F5T A;  5HDG A;  1Z9C A;  1L3L A;  3M8F A;  4RB2 C;  1IN5 A;  5IT9 K;  1RNL A;  4EVI A;  2UXX A;  1J75 A;  3DXJ F;  4WXH A;  4HDU A;  4M71 A;  1J59 A;  4ON0 A;  1R23 A;  4Y17 A;  2VE8 A;  1B59 A;  4G9Y A;  1PP8 F;  2V1U A;  4QLC U;  1R7J A;  1XGO A;  4Q48 A;  5ICF A;  3KLO A;  3M7G A;  4PDK A;  3ZMD A;  3SHF A;  3L9F A;  2IT0 A;  2YSR A;  1F1Z A;  2M1B A;  3EDP A;  4L5I A;  4FT8 A;  1KYW A;  3L09 A;  4IHS A;  3ERE D;  3VOD A;  4HYE A;  2KJB A;  1XDU A;  1FYL A;  1W7P A;  1U3E M;  1QZY A;  2FU4 A;  3LA7 A;  2XKP A;  1P4A A;  4PGH A;  1RUN A;  4GYI A;  5BPI A;  4O3M A;  5LHG A;  1AWC A;  1FSH A;  1FSE A;  4Q5S F;  3RJP A;  5AIQ A;  2KRF A;  2ZKZ A;  1MGT A;  2Y0M A;  2HQR A;  4YFX F;  2L02 A;  1ONV A;  4G6Q A;  3O3K A;  5HS8 A;  4Y13 A;  2HOE A;  4HOB A;  3R0A A;  1BI3 A;  3WTY C;  2WTE A;  1HXD A;  3DP7 A;  3GYH X;  2DLL A;  3WE2 A;  5ICG A;  2QWW A;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...