5H20A

X-ray structure of padr-like transcription factor from bacteroid fragilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
DNVKSQMRKGMLEYCIMLLLHKEPAYASDIIQKLKEARLIVVEGTLYPLLTRLKNDDLLSYEWVESTQGPPRKYYKLTGKGESFLGELEASWKELNETVNHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative PadR-family transcriptional regulatory protein
publication title Structural and functional analysis of BF2549, a PadR-like transcription factor from Bacteroides fragilis.
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 32
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5h20A00
2PFBA 2GZWA 5K5RA 1YYVA 2ZMEB 2M8EA 2V1XA 4CZZA 2ZCWA 4XLPF 2IA0A 2UXXA 3ZMUA 3WTXC 3P9KA 1MKMA 3EETA 1HW1A 3G3ZA 1OMIA 2DU9A 1I6XA 2QUFA 3KP6A 4EJUA 3LA2A 1RNLA 2FU4A 2M45A 4AIKA 3GFLA 3N4MA 3HIFA 1H0MA 3F8FA 2ADUA 3ELKA 3RKXA 1ZRDA 3HOTA 3DXJF 4YFKF 2EB7A 3CLOA 2R7FA 1RI7A 1WWXA 2HZTA 2P7VB 2XKPA 1PP8F 4LMYA 3WGIA 4MEXF 1BOAA 2L4MA 2OQGA 1IRGA 2ESHA 3FHZA 1D5VA 2VXZA 4PCQA 4Q48A 2K02A 3GX4X 3TO6A 5DV5A 1YFHA 3F6VA 3KLOA 3E5XA 2PI0A 1IN4A 4KIFA 5DYMA 1I1SA 4BYYA 3IL2A 1G4DA 1BM9A 1DPUA 2W24A 5LBQA 3V8LA 5FFZA 4WK8F 4ASNA 1RUOA 3GFIA 3I4PA 5F64A 1JGSA 4FX0A 3SHFA 5BQTA 1LNWA 3R6SA 5ED4A 3O3KA 3S2WA 5EEGA 2B0LA 3K1MA 5LRRA 3EQLF 4EGYA 3LQRA 4ZH4F 1EH7A 2VBYA 1B9MA 1KQ8A 3DF8A 1J2XA 3Q9VA 2HTJA 3IKVA 3W6KB 1FBUA 2L4AA 1JHHA 4AD9A 1EH6A 2DBBA 3MWMA 1G3YA 3CTAA 1IXSB 3FF5A 3NEUA 2QQ9A 3SZPA 1YQAA 3KP2A 4JK1X 2MH2A 2KJCA 2M30A 1HXDA 5CVRA 3CO7C 3FZVA 5DUKA 1BBYA 3V4GA 4KMFA 4FX4A 2QYOA 2OZ6A 5CVUA 4HF0A 2ISZA 2FMLA 3HRMA 4LLNA 3IRRA 4A0YA 3MFKA 3T8RA 3QAHA 5CLSA 2EV6A 1BI0A 5BPIA 4LK0F 2H27A 3QU6A 2ISYA 4A12A 2JPBA 1PDNC 2VC1A 1IW7F 3QU3A 3T0YA 3HTUA 3SZTA 2V1UA 2FE3A 1ZGAA 2RGVA 3BZ6A 4WXCA 4R8HA 2V1DA 3Q9SA 5ICFA 3RYRA 1BI2A 2RQPA 1K6OA 5HS8A 4RAYA 4EJWA 4WF2A 1IZ1A 3U2RA 4L9VA 3RIRA 2HKOA 2CFXA 4ZZLA 4U0WA 3ABUA 1G6NA 3TO9A 4U0YA 1STZA 4I2OA 2E1NA 4RGRA 4A2UA 4RB1A 1BJAA 2FNAA 1CGPA 5FGMA 4KDPA 1W7PA 1LDJA 3DFGA 4Y13A 4KIGA 2HQNA 1ZG3A 2XV4S 2DAOA 1YO5C 2JTVA 3GFJA 3KP3A 1A04A 1G3SA 1SMTA 4I01A 3CJNA 1O3RA 5ICGA 3DKWA 5HS9A 2PMUA 5ERIA 3M8FA 4XSZF 1FY7A 2Y75A 1W5SA 2HTSA 3DPLC 3QP6A 2A3SA 2Z99A 2LKPA 3K9TA 3V7SA 3I64A 5JFRA 4OIOF 4L5IA 2ELHA 4WCGA 4N9IA 1S7OA 4CICA 3QOPA 5LEKA 1PP7U 2F5DA 2CSOA 3BPVA 3WTSC 1HW5A 2JSCA 1QNTA 2EWNA 1SAXA 5JVTA 5DD4A 1XDUA 1Z05A 3BJ6A 2DPUA 4S05A 1IN7A 4IRGA 4EMSA 2YPRA 4RAZA 1U5TC 2L01A 1V3FA 3T5XA 4I02A 3J80Z 3KETA 3JTGA 3DP7A 2XAJA 1KA8A 2V6CA 4KA4A 3VFZA 1R23A 2NAZA 4BH9A 4IHSA 1G3TA 1L0OC 1WKMA 4P9FA 1HKTA 3R4KA 4MNUA 1QO0D 2Z5UA 3R61A 4UHTA 3L2CA 1LDDA 1U8RA 2F5CA 1XCVA 1IXRC 3HRSA 3PQKA 4HV6A 1KQ9A 2ZXJA 5D4RA 4I09A 4BAYA 1XCBA 1Z91A 2IJLA 4OIRF 4HLXA 3OV8A 4BNCA 2M5WA 3L00A 3NRVA 1KU7A 2RVCA 3ULQB 1KYZA 5LHIA 1R1UA 1T39A 2ACJA 3U9GA 4L9NA 1FX7A 2X0LA 1C0WA 2XAHA 5H6QA 2STTA 4GYGA 2HEOA 1H9GA 3GEZA 5HOOA 5FD5A 3KZZA 3GXOA 4UXNA 5LHHA 4LK1F 4KT5C 4EGZA 2IA1A 4BHPA 1W7PB 5DUIA 4MQVA 4NHJA 1OR7A 2Q2EA 2Q8KA 1GXPA 3F8NA 4HV5A 3E6MA 2KJBA 1EH8A 1O57A 2V79A 2ZFWA 4O6JA 3O2PE 5LEJA 3EYIA 2A69F 1FSEA 2M87A 2LF8A 5KVRA 4EJOA 3I53A 1X3UA 2VBZA 3QPTA 3M8EA 1ZARA 2DT5A 4HQEA 4R1HA 2IA2A 1XD7A 1Z6RA 1P4WA 1YW7A 2ZNZA 4XSXF 1ON2A 4B8XA 1S3JA 2Z33A 3BPXA 1U6GA 3HTSB 2P4WA 2YSRA 4GCVA 3EYYA 4HX7A 3WTZA 3WTVC 1IN5A 3RPQA 1F5TA 3HUGA 5CYVA 3T1BA 2MH9A 3F72A 1OKRA 4OOIA 2A07F 3LAJA 3DV8A 3QPHA 1IAWA 2Q0OA 2RNJA 2P5KA 4UVAA 1YW9A 4A5NA 2HR3A 4IRIA 1R7JA 5ILVA 4ZYGA 2MBFA 1U5TA 1GVJA 2W57A 1XSDA 5ICEA 3EDPA 2JT1A 3K0LA 4I98B 3LWFA 5TRDA 4EM2A 3IWFA 1QPMA 1WRJA 1RUNA 4LLGF 2Y0MA 3GF2A 1IXCA 4HBLA 1UHMA 5D5XB 1FBQA 5IT9Z 4MHGA 1H9TA 2HFHA 1ZAOA 5HDGA 4RB3C 4HOBA 2Z3YA 1NHAA 3WGHA 2EA2A 5E20A 5L3GA 3ZMDA 2G7UA 3L7WA 1D3YA 3Q5FA 5ILSA 1OPCA 5HLHA 3ZN0A 2WV0A 3IWZA 3MCZA 1XDSA 5K5OA 1ZLKA 2QBYA 1O3TA 1WSUA 1IN8A 3BJOA 3EUHA 2BGCA 2PLYA 1SFXA 2CW0F 2D1VA 2R7DA 3HSRA 4O5VA 5F1RA 1P2FA 2IPQX 4TV7A 1ZHFA 3PQJA 1FYMA 1YIOA 3MEXA 1K7AA 2W85A 5A2QZ 1WI9A 3K1PA 3DEUA 4I7HA 2A5YB 1XGOA 2FF4A 1SMYF 4A0ZA 2KRFA 2XRNA 2L3DA 2O6GE 3CDHA 2GA1A 1J75A 4AIHA 4OMYA 2P5VA 4M9XA 1MJ9A 2XGXA 5HS7A 2DQLA 3ROUA 1FZPB 1ZREA 2EFNA 2GQQA 3ABTA 4ZYDA 4PGHA 5DCMA 2XAFA 4BQAA 3P9CA 1YW8A 3HHHA 3C7JA 2BBYA 4RB0A 2DW4A 3IC7A 1Z7UA 3MAJA 5J8CA 1SD6A 3RJPA 1HKQA 3H3UA 3GO5A 1GXQA 1DUXC 3JAMZ 1YS7A 3KP7A 3P9IA 5J8FA 1U2WA 2ESNA 5HLGA 4LJZF 3I5UA 1U5TB 1OYWA 4UVBA 4YFNF 3H3ZA 4IPAA 2P8TA 4KMUX 2BYVE 2PEXA 4K2EA 3E5QA 4XBFA 4P55A 4A6DA 2HYGD 4O3MA 3BOQA 1B9NA 4RS8A 5TJJA 1FOKA 1P92A 5D5UB 1O7FA 3SQNA 2RN7A 1TQIA 2J5PA 1REPC 3K2ZA 2IP2A 1P4XA 2GXGA 2FOKA 1XGNA 3JTHA 2OBPA 4BHBA 4OINF 2OAZA 4LGWA 3L9FA 5F6FA 1W5TA 4AVPA 4ESBA 4PGGA 2FXAA 2DK8A 2K27A 4HF1A 5AIQA 4P96A 1J5YA 2QBYB 4CHUA 3I71A 1TNSA 1T6SA 4G6DA 5E1ZB 5A2QK 1R5GA 4A6EA 1O3SA 1OYIA 2O8XA 3M1EA 3LFKA 3F3XA 3FXRA 3ZMTA 2VONA 2FQ3A 1UFMA 3KFWX 2IW5A 1BI1A 2O3FA 2R3SA 3IHUA 3KCCA 2VE9A 1LVAA 1MJAA 3T8TA 5ICCA 2MC3A 2DO7A 2UXNA 4DQ2A 1B6AA 1BI3A 4JBAA 1TTYA 5JHUA 2COMA 1W4MA 2DFIA 3BWGA 5E18F 2PBIA 5HDKA 3E97A 2CWEA 2FMYA 2NYXA 4G7ZF 5CVJA 1R5HA 4ESJA 2QM3A 3JAMK 5DCMB 4OIPF 1R36A 2E7XA 4ON0A 1F9NA 2ZBKA 2K4JA 1JXSA 4MGRA 2OZUA 3FM5A 4HAMA 3BDDA 5DDGA 2OQRA 3FX3A 1QGPA 1KU2A 1Z6TA 1T2KA 3LA7A 1ZG1A 2BV6A 2E1CA 4RGXA 3E3VA 2L54A 1RIOH 3RDIA 3WODF 3WU0A 1T98A 2KIMA 1BIAA 2STWA 4HF2A 1TBXA 5CVIA 4GYIA 2LNBA 2DLLA 4CGZA 4QWQA 3RI4A 3P7NA 2FBKA 5LGTA 1DDNA 3BP8A 3I58A 2K4BA 3CUQC 4FHTA 4EJVA 1G3WA 3TQNA 1R22A 4I0AA 2QLZA 1V4RA 1FWZA 1KU3A 4R79A 1Z9CA 2VBWA 3K1NA 5J6XA 2HQRA 1LB2A 2M1BA 4ENMA 4ETSA 1JE8A 1KYWA 3F8MA 3V7RA 2ZKZA 3N97A 3F23A 3J81Z 5L3CA 3NQOA 2EJRA 2LSOA 3GZ5A 4HDVA 1ZGJA 5E8GA 2RDPA 3KLNA 3ZMVA 2PJPA 1FC3A 3FMSA 4WX9A 4YG2F 4D0PA 2NS0A 3RYPA 3H92A 2FRHA 2BE5F 2UZKA 4EM0B 1XGSA 1SD7A 2VT3A 2WWYA 3RKYA 3TKYA 2C6YA 1AWCA 1MD0A 1R1TA 2VC0A 2PN6A 4HDUA 1UCRA 3ECOA 1FP2A 5E8IA 2BEOA 1Y0UA 2GXBA 1QZZA 4P9UA 3JSOA 3V8JA 3LA3A 3REOA 2RV8A 2WTEA 4M6XA 2NNYA 3GLXA 1HQCA 1RZ4A 1Z1DA 2JRTA 4HLYA 3WTUC 2IRFG 1IRFA 3G73A 4EVIA 2P6TA 2NNNA 4M9SA 4L0YB 3WTYC 1MJBA 1OYYA 2L02A 3IRQA 1B1BA 3M9AA 2XAQA 2HKXA 5LGUA 4LB5A 4MTDA 4IJAA 2HDCA 1I1GA 4PZJA 3WG9A 2KKOA 4M73A 3BROA 3I0TA 1U3EM 2EFPA 5L3EA 1FBSA 4G8XA 2A6HF 3AAFA 1XSVA 4GO1A 5CJ9A 1HKSA 2EV0A 3E5UA 4CO8A 4ZZDA 1ZYRF 2CGPA 2GAUA 2NRAC 3LSTA 1FLIA 3J81K 1KU9A 2E7WA 1TLHB 2QZ8A 3CUQA 4M72A 5K1YA 2MLGA 5E1WA 2O61A 1BN5A 2YR2A 3JSPA 2A68F 3J80K 1S29A 4M74A 5JI6A 2CO5A 1DPRA 4A5MA 3C1DA 1S6LA 1CF7A 1E17A 4FT8A 2F5FA 3TGNA 4H0EA 2QWWA 3KP4A 2OA4A 2WC2A 1R00A 5H20A 2VODA 4ZYHA 1MGTA 2OD5A 4M9ZA 1ODDA 2P6SA 4KFCA 4G94A 2RC4A 3F22A 4G7OF 1DP7P 3V8KA 1FPQA 4HQMA 3ZPLA 5D4SA 3GWZA 4PDKA 5AIPA 1FYKA 1QZYA 3HHGA 1IUYA 4JQFA 1LJ9A 1I5ZA 1EV7A 4DNCA 4IF4A 2ZJ2A 1K79A 3B02A 2EFWA 4I0BA 2VE8A 3V7CA 4EM1A 2K7LA 2VBXA 4L0ZB 4MQ9F 2Y48A 1L3LA 4A0XA 4EJTA 4BHCA 3FXUA 2IT0A 3L09A 4U0VA 5BMZA 3I54A 1MDMB 4KN4X 4ENJA 5D6EA 2EV5A 1F4KA 4ESFA 5HDNA 2PMHA 3U1DA 3GVAA 2MA3A 1XGMA 3HYIA 3CUOA 4Y17A 3FMRA 3WE2A 2XROA 1J9IA 5FLXZ 4M71A 1HBXG 5DEQA 2D1HA 2A6EF 1FP1D 1PUEE 2GWRA 3GYHX 4N0BA 4QLCU 4KICA 1XMAA 3R60A 1WQ2A 4L5JA 2KIUA 2VOOA 4CDGA 4CYDA 2FA5A 3OOPA 3DPTA 3CUQB 5D5VB 2JPCA 3SXYA 2DI3A 1SFUA 4HA8A 1XN7A 4U7BA 1S8NA 2O0YA 2MLKA 5HLIA 1ZLJA 1SD5A 1I27A 4E70A 4Q5SF 1CF7B 1ONVA 1J0RA 5IT9K 2W84A 2PG4A 3BY6A 4U7DA 2HGCA 3F6OA 2ETHA 4AWXB 4HZFA 4YFXF 4LLLA 2DPDA 2TDXA 5BS6A 2H6CA 2GIVA 4N9HA 4LFUA 3GUDA 4RGSA 1QBJA 1LDKB 4LG0A 3TOAA 2CQKA 1T38A 2XKOA 3DQVC 1ZRCA 5FO5A 5FFXA 5H6RA 3E6CC 3MQ0A 2HWVA 5D6FA 5K5QA 3RTRA 2FBHA 1B59A 1P4AA 1MZBA 4RGUA 3WU1B 2YX4A 3K69A 1LEBA 1USSA 2VT2A 2FEZA 1P6RA 1VTNC 1T0FA 5LHGA 4HW0A 3CO6C 1ON1A 4MEYF 5AONA 1BIBA 1TQPA 1BC8C 6PAXA 1XSXA 3GFMA 4F7ZA 2QQAA 3WTTC 2D2WA 2YU3A 5FLXK 2XHKA 2ZNYA 1QQIA 5L3FA 3TOBA 2GA2A 2IVMA 3F21A 2XASA 2P5LC 1J59A 4NQWA 1FSHA 3ERED 3C3WA 1S7AA 2W25A 3MZYA 5KK1A 3E6DA 2AXLA 1W7PD 3GW2A 1ZG5A 2QENA 3R0JA 5E17F 3WTWC 3HRTA 1R1VA 4UNOA 3ISPA 3TDUC 2VOPA 1U78A 3I59A 4HX4A 4KIBA 4HYEA 1FNNA 1IN6A 4KYWA 1D8KA 1ULYA 1K78A 2UWMA 2LDUA 1O7LA 2D45A 4GGGA 1D8JA 1BC7C 5LLQA 2O03A 4IHTA 4GXOA 2DQRA 3IKTA 3W6JB 2A61A 4G7HF 3VEPA 1YTYA 1AOYA 5CVVA 2G7HA 4EQQA 4B09A 3HSEA 5LGNA 3JW4A 4ZYEA 4M6YA 3F8CA 1SD4A 4XRFA 3J7AO 5DD8A 4LG0B 3ZMSA 4MTEA 4OMZA 4RB2C 1TQMA 3FM3A 3ZQ7A 4UVCA 4EV0A 1B4AA 2AS5F 4NB5A 3M7GA 4OIQF 1HSTA 2K86A 2EA4A 2LF7A 4WWCA 3QRFF 1ZH5A 3LQQA 2MD5A 2H09A 2HOEA 2FBIA 4LB6B 4L9TA 2EK5A 4XLNF 1ZRFA 1Q1HA 1R58A 3QP5A 1UB9A 1O3QA 1FYLA 2CG4A 2HYFA 1YG2A 5BOXA 2ZO4A 2XIGA 3F8BA 1HW2A 4OU0A 4WXHA 1J7KA 3ML6A 2ZMEA 4BXUA 1USTA 3R0AA 3HRUA 2X4HA 3WE3A 3WGGA 2F5EA 5EEHA 3D5LA 5L3DA 2FNPA 5D5WB 1LQ1A 2Z9OA 4L9JA 2F2EA 4YIIA 5LRSA 3GZ6A 1IF1A 1SFEA 3ZMZA 3TDZC 4AIJA 3KP5A 3COAC 3B73A 3VODA 3BJAA 2G9WA 4IXAA 4HX8A 5FD6A 2YX7A 3KEOA 4Q4ZF 4KNYA 2XUBA 2QQBA 5IT3A 1F1ZA 3FMQA 3MZHA 3KE2A 1XB4A 3HOSA 4P5OA 4UV9A 3ZN1A 3KEQA 1MDMA 4WXDA 5BPDA 5D8KB 3I59B 3VB2A 2V9VA 3RPUA 5JR3A 3ZP5A 2RKHA 2XAGA 3FXQA 1LEAA 2FSWA 1K78B 2PQ8A 2KIFA 1ZN2A 1YS6A 2XVCA 2EFOA 4G6QA 4KUMA 3VOEA 5DCFA 1JHFA 2QVOA 4ENKA 3D0SA 3PFIA 5HVQC 4Y15A 4Q47A 5L3BA 2J5OA 3ECHA 2H6BA 4YIFA 3TO7A 4U88A 4CXFA 2HS5A 3HSFA 4IVNA 4G9YA 3C18A 5FB2A 5D8LB 2JZYA 1YLFA 5ILUA 3FWEA 1XMKA 4S04A 4KN7X 1E2XA 3RKWA 1TW2A 1KQ0A 1TNTA 3KZYA 2EFQA 2H94A 2DTRA 1UHWA 3E6BA 4L18B 3LAPA 1FT9A 4IRHA 1GHCA 2P7CB 5E1XA 2OU2A 3SFZA 1HSJA 4Z2YA 4ENNA 1KGSA 2DK5A 4UUVA 4LD5A 3O6BB 4UV8A 1TW3A 2CYYA 2VN2A
chains in the Genus database with same CATH superfamily
3TP3A 2PFBA 2GZWA 2HXIA 3BR0A 4C3HJ 2KLOA 1IDZA 4I99C 5K5RA 1YYVA 2ZMEB 2M8EA 1Z7LA 2V1XA 2WY8Q 4CZZA 3OR1C 2ZCWA 3KYDB 2FOWA 2K9QA 1T95A 4XLPF 2IA0A 2UXXA 3ZMUA 3D1NI 2NVYJ 3WTXC 2L9VA 3P9KA 1WPKA 1MKMA 3EETA 1HW1A 3G3ZA 3HGYA 3ZQFA 4X0GA 1OMIA 2DA4A 2DU9A 1I6XA 2PX9A 2KRCA 3KPHA 2QUFA 3KP6A 1YJWI 4EJUA 2BY3A 2Y9YA 3GTGJ 3LA2A 4I76A 3BZKA 2IBDA 2XB5A 1RNLA 1LE8A 2FU4A 5CKTA 4BQOA 3H9JA 2F5VA 2M45A 5FRNA 3CCVI 4AIKA 2M2EA 3GFLA 4RM3A 5HODA 3N4MA 3HIFA 1H0MA 3F8FA 5M5WJ 2ADUA 3ELKA 1YITI 1BR4A 3RKXA 3SDGA 1PUFB 2PMZN 4BE1A 4I6ZA 4PJ0C 1KZHA 1ZRDA 4J00A 3HOTA 5EEAA 3DXJF 4YFKF 2EB7A 1B72B 2XPUA 5LD2C 2LH9A 3ERMA 4A93J 3CLOA 3ONQA 3ZQIA 4DZJA 1OFCX 1BR2A 2R7FA 3SEZA 1RI7A 1RR8C 1WWXA 2HZTA 2P7VB 2XKPA 5J40A 1PP8F 4LMYA 4CCLA 3MKZA 3WGIA 4MEXF 1BOAA 2L4MA 2B63J 2OQGA 1IRGA 3S3OA 2ESHA 3ABLH 5E3MA 2JUCA 4XORA 3FHZA 2VJ5A 1D5VA 4B3AA 2E5NA 2VXZA 3JRCA 4A69C 4QIWN 3CDIA 4PCQA 4Q48A 2OTLI 2X51A 2LKXA 2DMNA 2K02A 4A3GJ 3HOWJ 3GX4X 3TO6A 3MZ8A 4IOCF 4E7HA 5DV5A 3QQAA 2ECCA 1WH7A 1ZKGA 2DDBA 1YFHA 3F6VA 2KIQA 3KLOA 3E5XA 2PI0A 1IN4A 3K4KA 4KIFA 1VQMI 4B4CA 4IHXA 1OJLA 1Z0XA 5DYMA 1I1SA 2IAIA 3CJRB 4BYYA 3IL2A 1G4DA 2X1CA 2LOOA 1IC8A 1BM9A 3BG6A 3M1CA 1DPUA 2W24A 4DYCA 5LBQA 2DA6A 5JLXA 4CH7A 3GTJJ 3V8LA 3D5SC 4BBSJ 5FFZA 3FXLA 4WK8F 4ASNA 1RUOA 3M3YJ 3GFIA 3BR6A 3I4PA 3DTKA 3O8HA 5F64A 1DGRM 1PVEA 3NAUA 1JGSA 1R71A 4FX0A 3SHFA 5BQTA 1LNWA 3R6SA 5ED4A 4RBOA 2L9RA 3S1RJ 3DBHB 1UG0A 2E60A 3HUGB 1GV5A 2LREA 3O3KA 4E7KA 3S2WA 3LSRA 3OIPA 5EEGA 2B0LA 1MMSA 5K7HA 3K1MA 3HXLA 1FOXA 4YIRX 4Y7NJ 5LRRA 3EQLF 4EGYA 2ELKA 4BGDA 3KEYA 1LFBA 1IV6A 1WZ2A 1D0XA 3QODA 4N4NB 3LQRA 4ZH4F 1EH7A 2VBYA 4IHYA 1B9MA 3CLQA 4BE0A 4G6TB 3ZGKA 2BY2A 2MG4A 1MBJA 2VL8A 3G2BA 3HOXJ 1KQ8A 3DF8A 1MNEA 3GTMJ 1J2XA 2CJJA 2ICWG 3Q9VA 2HTJA 3HEFA 4PFOA 3I56I 2R5YB 3K7AJ 1S72I 1POGA 3IKVA 2BW3A 3W6KB 1FBUA 2L4AA 1JHHA 3BCBA 3G6EI 4AD9A 2CUJA 2M7BA 3FHNA 1EH6A 2VOOA 2DBBA 1FMVA 1G3YA 3MWMA 2RQQA 3Q0VA 3OYMA 3CTAA 1IXSB 3FF5A 2IS1A 3OYAA 5M5XJ 3NEUA 1K4TA 2QQ9A 3SZPA 1YQAA 2VJIA 3KP2A 2Y2ZA 2BZTA 2HNHA 4IKFA 4JK1X 1I3QJ 2JSPA 2MH2A 2LY9A 2WAEA 1GDTA 2DA5A 4A3IJ 3JRAA 1R49A 3HOVJ 2KJCA 2M30A 1HXDA 5CVRA 3CO7C 3FZVA 5DUKA 2R7ZJ 4HRIA 4AM3A 1BBYA 1VZ0A 1LE8B 3V4GA 4KMFA 4FX4A 5FRMA 2QYOA 2OZ6A 2EZLA 2V9PA 4HF0A 2FMLA 4NC7A 5CVUA 2ISZA 1X4PA 1GV2A 3OOUA 3HRMA 2MABA 4LLNA 2FX0A 2YS9A 3IRRA 3CMYA 4A0YA 3GTKJ 3MFKA 1MNMC 2Y69H 2BVLA 3PNVA 3T8RA 2NOGA 3QAHA 5CLSA 4DBQA 2H1KA 2EV6A 1BI0A 1JT6A 3IH2A 2DMUA 2RNGA 5BPIA 2ID6A 1ERDA 4LK0F 4C2MJ 2H27A 3QU6A 1OCPA 1RETA 3F9KA 2ISYA 4A12A 4II3A 3BT9A 3AG4H 2JPBA 3ABMH 1PDNC 4B3XA 2VC1A 1IW7F 3QU3A 4UUSA 3T0YA 3HTUA 1H88C 3BC8A 5GADJ 3SZTA 2V1UA 1V5EA 4Y4RA 4IHWA 1WCMJ 2FE3A 1ZGAA 2XSJC 5GAHJ 4BKXA 3CF5F 2RGVA 3CC2I 1S5LC 2F4IA 4BJ5C 3BZ6A 4WXCA 3DU5A 2ELJA 4OAZA 2L9NA 4XNFA 4R8HA 4DW6A 1VQ7I 2V1DA 1N78A 1RESA 3Q9SA 4EEFG 5ICFA 3RYRA 1BI2A 2RQPA 3BQYA 1JKOC 3S3NA 5TGTA 1K6OA 5HS8A 4RAYA 4BDZA 4EJWA 4WF2A 1IZ1A 2XPVA 4ZYAA 3U2RA 3B6AA 4L9VA 3RIRA 4B48A 2XB0X 3B6CA 2HKOA 2CFXA 4ZZLA 2CMPA 3K4MA 4U0WA 2K5CA 2R7WA 3ABUA 3ZQHA 2IEKA 1MBHA 1UHSA 4GFBA 1G2HA 2KDOA 1G6NA 3TO9A 4U0YA 2JVGA 1STZA 2DA2A 1TC3C 4I2OA 2E1NA 3ZQGA 4RGRA 4A2UA 4RB1A 1BJAA 2FNAA 3KIOA 1CGPA 2ZFUA 5FGMA 4KDPA 1MMAA 3EUKL 1W7PA 1WH5A 2IXSA 1LDJA 3DFGA 4Y13A 4KIGA 1BOBA 3I9V2 4Z6YA 2HQNA 1OR7C 4PJMA 2XV4S 1R6RA 1ZG3A 1D0YA 2DAOA 3FDYA 2W1OA 2JTVA 3GFJA 4JYKA 4NC6A 3LSHA 3CCMI 3KP3A 1D1BA 1A04A 2EIMH 1G3SA 1JI8A 1SMTA 2BVMA 4I01A 3CJNA 1O3RA 1TT5B 5ICGA 2LTPA 3DKWA 5HS9A 2PMUA 5ERIA 4QPQA 3FIWA 4RM2A 3M8FA 3DLAA 3CCJI 1JTXA 4XSZF 3ZQLA 1MSEC 2IGMA 1FY7A 3H9GA 3OYLA 2Y75A 1W5SA 2HTSA 3DPLC 3QP6A 4XLHA 4XLEA 3HGGA 2A3SA 1WJFA 2Z99A 1N75A 2LKPA 3K9TA 3V7SA 4AUXA 3I64A 5JFRA 3J7ZI 4E7JA 4OIOF 2DMPA 3S1NJ 4L5IA 2IS4A 2ELHA 4WCGA 2V6EA 4N9IA 1S7OA 4CICA 1AA7A 3CCLI 3QOPA 1TWGJ 2JA8J 3DBRB 5LEKA 1PP7U 2F5DA 2CSOA 3TBIA 4M3EA 2XSDC 4NC8A 5TISC 1K83J 1WVRA 1MH3A 2OV7A 4HNVA 4CCNA 2H8RA 2ID3A 1Z21A 1HW5A 2JSCA 1QNTA 3BPVA 3WTSC 2EWNA 3S3MA 1SAXA 2VQLA 4GDFA 5JVTA 5DD4A 1XDUA 1Z05A 3CCQI 1JUSA 3G1LA 3BJ6A 4XKCA 2DPUA 2L2OA 2R0QC 4S05A 1X3ZB 1IN7A 4YEJA 4IRGA 3ZQQA 3L1PA 2PJRA 4EMSA 2M3AA 2YPRA 4RAZA 1U5TC 2ZXWH 2L01A 1JKQC 1V3FA 4BQNA 3T5XA 1PJRA 3BTJA 4I02A 3J80Z 3PO2J 3MKLA 3KETA 3JTGA 1YRNA 3DP7A 2XAJA 1KA8A 2V6CA 4KA4A 3VFZA 4NBQA 1R23A 2NAZA 4BH9A 4IHSA 4M3FA 1G3TA 3FXKA 1L0OC 1WKMA 4P9FA 1HKTA 3R4KA 4DIQA 4MNUA 1LUJB 1QO0D 2Z5UA 4D5CA 1U8BA 3ZQCA 3R61A 4UHTA 3L2CA 3DTEA 2JA7J 3H0GJ 2DODA 1LDDA 1U8RA 2F5CA 2X6WA 1XCVA 1IXRC 3HRSA 3PQKA 4HV6A 1KQ9A 2ZXJA 5D4RA 3E1SA 4I09A 4UUSB 4BAYA 1XCBA 4HG2A 2XGDA 1Z91A 2IJLA 4OIRF 4HLXA 3OV8A 2AXTC 3ZCOA 2R7VA 4BNCA 2M5WA 3L00A 1TWHJ 2LY2A 3CZ6A 4AU7A 3NRVA 1KU7A 2RVCA 3ULQB 1KYZA 5LHIA 3HG9A 3HPGA 1R1UA 1F36A 1T39A 2ACJA 1RR7A 3U9GA 1PUFA 4L9NA 3LFUA 1FX7A 2X0LA 3VYTB 1C0WA 1N25A 2XAHA 2LKSA 3CMEI 2VQGA 1ZQ3P 1H89C 5H6QA 4PSWA 2STTA 3H35A 5GAGJ 3F0CA 1JUPA 2L7FP 1WGXA 3JRIA 1HOMA 4GYGA 1TWCJ 2HEOA 1TP4A 1H9GA 3VDXA 3GEZA 1MIJA 5HOOA 4A3MJ 5FD5A 2E35A 3KZZA 4ANJA 3GXOA 1ETQA 2K85A 3HC7A 4UXNA 5LHHA 4LK1F 1BJZA 4KT5C 4EGZA 2IA1A 4P1WA 2OC6A 2L7MP 4FQGA 5CQGA 3OY9A 2E1MB 2HYJA 4BHPA 1W7PB 5DUIA 3K6GA 3Q0UA 4MQVA 3U21A 4NHJA 1E3PA 1NTCA 1OR7A 3CMMA 3LSKA 2Q2EA 2Q8KA 1GXPA 3F8NA 2EH3A 4HV5A 3E6MA 1K4SA 2KJBA 1EH8A 5LFAA 1O57A 4DYQA 2O8KA 2V79A 2ZFWA 1OCRH 3O2PE 4O6JA 3MMYB 2KQRA 5EZGA 4A3LJ 2DYSH 5LEJA 3MKWB 3EYIA 2A69F 5M3FJ 2G0EA 1FSEA 2M87A 2LF8A 4PJLA 5KVRA 4EJOA 3A0BC 5IYBJ 2ME0A 3I53A 4RAGA 1X3UA 3AL0B 2VBZA 3LSJA 3QPTA 3M8EA 1ZARA 2DT5A 5F04A 4HQEA 4R1HA 2AHQA 2IA2A 3Q3SA 4XOTA 1XD7A 1D5YA 1A31A 1Z3YA 1Z6RA 3FXMA 1P4WA 1YW7A 2WAFA 5B66C 2ZNZA 1IDYA 4XSXF 1ON2A 5FKLA 3JRDA 4B8XA 1S3JA 4B43A 2Z33A 3BPXA 4HSRA 2M0MA 1U6GA 3HTSB 2P4WA 2YSRA 4GCVA 3W2AA 3EYYA 4HX7A 2L5QA 3WTZA 3WTVC 4II2A 1IN5A 3RPQA 1F5TA 2CUFA 3HUGA 5CYVA 3VSLA 2HPMA 3T1BA 2MH9A 2DTZA 1OKRA 1MNDA 3F72A 3O8GA 5KAFC 1N77A 4OOIA 1XMXA 4QPOA 2A07F 3LAJA 5C4XJ 3DV8A 3QPHA 3ZXSA 3TW7A 1IAWA 2Q0OA 2RNJA 4F52A 1LFUP 4NUBA 2CQQA 2P5KA 4B1RA 4UVAA 2LY1A 4QTRA 4IZZA 1YW9A 4XN3A 4A5NA 2HR3A 2E2IJ 1R7JA 5ILVA 4ZYGA 4IRIA 3OYGA 2MBFA 1U5TA 1GVJA 2LG4A 2W57A 2PJRB 1XSDA 5ICEA 2I5UA 3NARA 3EDPA 2JT1A 3H5AA 2QSGX 3K0LA 4I98B 3DKXA 3LWFA 3K2AA 2FJ1A 4CUGA 2XDVA 1R4NB 1JJ6C 4AIDA 5TRDA 2WB1N 2K9MA 4EM2A 2R5YA 3IWFA 1QPMA 1WRJA 1RUNA 4LLGF 1YRNB 2Y0MA 5C44J 2ME6A 3GF2A 2DOAA 1ZGWA 1IXCA 2FUG2 3QYEA 3CC7I 3S15J 4HBLA 1UHMA 5D5XB 4RLQA 1DU0A 1FBQA 5IT9Z 4MHGA 2DT6A 1H9TA 2HFHA 3VYRB 1ZAOA 5HDGA 2VKVA 2KT0A 2Y31A 3DBLB 4UUTA 4RB3C 4HOBA 3EUAA 2Z3YA 1TWFJ 1QZEA 1NHAA 3WGHA 2EA2A 5E20A 5L3GA 3ZMDA 3H0DA 2G7UA 3L7WA 2GM4A 1D3YA 2ZB9A 4KT6A 3Q5FA 5ILSA 3ASNH 1OPCA 5HLHA 3OYDA 2WV0A 3ZN0A 3QPSA 3IWZA 3MCZA 3FKJA 3JREA 1XDSA 5J47A 5K5OA 1ZLKA 2QBYA 4A3CJ 3DU6A 4M3DA 5IY5H 2A6TA 1O3TA 1WSUA 3S2DJ 1IN8A 3BJOA 3EPZA 3EUHA 2BGCA 2PLYA 5BNGA 2R7OA 1SFXA 2CW0F 2D1VA 2R7DA 3QPLA 3HSRA 4AYBN 4O5VA 5F1RA 1P2FA 2IPQX 4TV7A 2W48A 1ZHFA 5DM7F 5EG0A 3PQJA 3KYLA 1Z77A 4Y3OA 3OYKA 1FYMA 1YIOA 2TCTA 5E79C 3MEXA 3K4BA 1E3HA 4CYCB 1W36D 3DKYA 2LYCA 1K7AA 2W85A 3LNQA 3C2GA 4DZPA 5A2QZ 1OCOH 1WI9A 3K1PA 2LFBA 3DEUA 1EF4A 3V42A 2QCOA 4I7HA 1KONA 2A5YB 1YOVB 1XGOA 4CZCA 2FF4A 1ZR2A 1SMYF 4A0ZA 1BW6A 2KRFA 2XRNA 2Q2EB 4DBRA 3G71I 2L3DA 2O6GE 3RZOJ 3C2BA 3CDHA 1V55H 2GA1A 3ZOBA 3BR5A 2RAEA 1J75A 3CCEI 4AIHA 2HDDA 4OMYA 2P5VA 5C4JJ 4M9XA 1MJ9A 2VI6A 2XGXA 5HS7A 3AKZA 1HA8A 2B7EA 5FLVA 2L0KA 2DQLA 2L7ZA 3ROUA 3OYIA 4IX7A 1FZPB 1YX3A 2EPFA 2EZHA 1ZREA 2EFNA 2GQQA 3K4CA 3ABTA 4ZYDA 4PGHA 5DCMA 2CQNA 2HOSA 3L2QA 2KL4A 1T08B 2F4MB 2QQ8A 4FETA 2XAFA 1X19A 1Q1VA 4RDUA 4BQAA 2VASA 2P81A 3K10A 3P9CA 1YW8A 3HHHA 1A36A 4FASD 2W4SA 3BR1A 2E1MC 3C7JA 5IYDJ 1WJCA 2BBYA 1FMWA 2IGNA 4RB0A 2DW4A 3IC7A 1Z7UA 4MO7A 3MAJA 5J8CA 1SD6A 3N05A 3RJPA 1HKQA 1G8XA 3VSKA 3H3UA 4L5EA 2HOTA 3GO5A 1GXQA 1DUXC 3JAMZ 2JMWA 2M9HA 1YS7A 2QSHX 3KP7A 1VFCA 2VIXA 4BQQA 1YIJI 3P9IA 3W2VA 5FKOA 3PFYA 1UMQA 5J8FA 2KZGA 1Y6IA 4JX4A 1U2WA 2ESNA 3GLLA 3AL0C 3S17J 5HLGA 1FOWA 2JA6J 4LJZF 3W6VA 3I5UA 1U5TB 2DFHA 1OYWA 1ETWA 3H5RA 1ETXA 4UVBA 4YFNF 2E2JJ 3H3ZA 2H1LA 4IPAA 3PO3J 2P8TA 3BG3A 3W3CA 1H8AC 4KMUX 5DTDA 5EF6A 2KPMA 5FKMA 2BYVE 3UKGA 3AFHA 2QEXI 3CD6I 2PEXA 2LBFA 4BY7J 4K2EA 3H5NA 3E5QA 1VQ8I 4XBFA 4DGWB 3NWSA 4P55A 4A6DA 3JRFA 2HYGD 4O3MA 3BOQA 1B9NA 4RS8A 5TJJA 3ESWB 1P92A 5D5UB 1FOKA 1O7FA 2ZJPF 4ZTFA 5FLMJ 3SQNA 2RN7A 1TQIA 2J5PA 4FE4A 3PUFA 3S32A 3SJMA 1REPC 3K2ZA 1VQ6I 2IP2A 1P4XA 5KNLA 2CS3A 3HOYJ 2GXGA 2FOKA 1FEXA 1XGNA 3JTHA 2OBPA 4BHBA 5B1AH 4OINF 2OAZA 4LGWA 3L9FA 3TMOA 1BW5A 5F6FA 1W5TA 4AVPA 4ESBA 4PGGA 1JTYA 2MSYA 3GZNB 2VPLA 2FXAA 4LIUA 2DK8A 2K27A 4HF1A 5AIQA 4P96A 1J5YA 4XN0A 1OISA 2EZKA 2JK3A 5FKKA 2QBYB 3HKZN 3SYTA 4CHUA 2CUEA 4JP0A 3I71A 1VQLI 1TNSA 3UNGC 1HCRA 2F4OB 2CV1A 1T6SA 1RC9A 4S0HB 4G6DA 5F08A 5E1ZB 3QWLA 3L2RA 3WU2C 1R5GA 4A6EA 5A2QK 1O3SA 1OYIA 3RQIA 2O8XA 2Q1ZB 3JCUC 3CP2A 1WFXA 3QOEA 3M1EA 3LFKA 2VKHA 3F3XA 3FXRA 5EG0B 2ZSHB 3ZMTA 1ITYA 2VONA 1ZELA 4D9JA 4M3BA 2FQ3A 1S7EA 1UFMA 2K9NA 2IW5A 3KFWX 5HLTA 1BI1A 2OTJI 4BUPA 2O3FA 5E3LA 2R3SA 5M3MJ 4C2TA 3IHUA 3KCCA 2VE9A 2NS8A 1LVAA 5F0FA 1MJAA 4HEA2 4FCYA 3T8TA 2HXOA 1FIAA 2DFEA 4X1EA 5M5YJ 5ICCA 1GVDA 2KISA 2VQCA 1UELB 2MC3A 2DO7A 4IQJA 2UXNA 4DQ2A 1B6AA 4KITB 3J7AY 1BI3A 2OCEA 2ZXIA 1TTYA 4JBAA 5JHUA 2COMA 2CU7A 1QRYA 1W4MA 2QGUA 2DFIA 4F93B 3BWGA 3OMYA 5IOYA 4UB6C 1W1WE 5E18F 2PBIA 2D5VA 5HDKA 3E97A 3LSPA 4E7LA 2CWEA 3SDBA 2DT7B 2FMYA 2NYXA 3BTCA 3CJQB 4G7ZF 4A3DJ 1Y56A 2CFOA 2E19A 1R5HA 5CVJA 4ESJA 1Y8RB 1FJLA 4V2FA 2QM3A 3JAMK 2X48A 4ABZA 5DCMB 2VXDA 2XPWA 4OIPF 1R36A 5GTIC 2R5ZA 4BEHA 4A3EJ 2E7XA 1RKTA 4ON0A 4BJ6C 1F9NA 2JWTA 2ZBKA 1Y1VJ 2EILH 2K4JA 1JXSA 4Y52J 2YUSA 4MGRA 2OZUA 3FM5A 5GP9A 4HAMA 3BDDA 5DDGA 2R7XA 4F92B 4GRIA 2OQRA 3FX3A 1QGPA 1KU2A 1ORKA 2WV1A 1Z6TA 2Y0SN 3FKIJ 1T2KA 4BXXJ 3LA7A 1ZG1A 1ZR4A 5H2FC 1R9TJ 4A3BJ 2BV6A 2E1CA 3IP4B 2DMTA 4RGXA 3E3VA 1A35A 2L54A 2DA7A 1RIOH 3RDIA 2KP6A 2LVSA 1Y0NA 1EKEA 3WODF 2AO9A 1MW7A 3PSFA 3WU0A 1T33A 1T98A 2KIMA 4IHVA 4PSXA 1BIAA 2EIJH 4D1QA 1YO5C 2STWA 4HF2A 4G12A 4HSTA 1TBXA 5CVIA 4GYIA 3L2WA 1YHQI 2LNBA 1ETOA 2DLLA 4CGZA 4QWQA 4XR6A 3PM1A 4M3GA 3RI4A 4LOCA 3P7NA 2FBKA 4E4HA 5LGTA 1DDNA 3BP8A 1HC8A 3I58A 2K4BA 3CUQC 1MSFC 4FHTA 4EJVA 2LBFB 5IOZA 1G3WA 2DJIA 3TQNA 1R22A 3I4NJ 3A4CA 2QLZA 4I0AA 3RCOA 1V4RA 2O5RA 2WADA 1AU7A 1FWZA 1KU3A 4R79A 3IH4A 1Z9CA 3S16J 5FKNA 2VBWA 3K1NA 5J6XA 2NVQJ 2HQRA 1LB2A 2M1BA 1IV8A 3RZDJ 4ENMA 4ETSA 1JE8A 4PJNA 3JRHA 1KYWA 1UZCA 3F8MA 3V7RA 2XAUA 2ZKZA 3TEDA 3N97A 5EGOB 3F23A 3J81Z 3H36A 5L3CA 2HVSA 3MN2A 3NQOA 1JT0A 2EJRA 2LSOA 2UUZA 3G4SI 1UG2A 3GZ5A 2GBYA 4HDVA 3PL8A 1ZGJA 5EJCA 5E8GA 2RDPA 3KLNA 3ZMVA 2PJPA 3BTLA 1W5CC 1X1BA 4PUSA 1FC3A 3FMSA 3BZCA 4F3QA 2NVXJ 3VYSB 4WX9A 3OSFA 1IRXA 4YG2F 4D0PA 2NS0A 3RYPA 4MFEA 3H92A 2FRHA 2BE5F 3H3VK 2WB1A 2UZKA 4CCKA 4EM0B 5F1JA 1XGSA 1SD7A 2I8DA 2VT3A 3PNTA 2WWYA 2GOMA 3RKYA 1QA6A 4FTHA 3TKYA 2I10A 2C6YA 1VF9A 1AWCA 1MD0A 1R1TA 4DJAA 2VC0A 2PN6A 4HDUA 3FBIB 1UCRA 2CW8A 3ECOA 1XPXA 2LRDA 1FP2A 5E8IA 2BEOA 1X58A 5GPCA 1Y0UA 2GXBA 3ZRGA 3FBNB 1QZZA 1QVTA 1SEUA 4IQ4A 4P9UA 2M7AA 3M8JA 3JSOA 5K7ZA 3V8JA 3HM5A 1IG7A 3S1QJ 3HL2A 3LA3A 1VQOI 4NQWB 3REOA 3BG5A 2RV8A 2WTEA 3LOCA 2L7KA 2X85A 4FISA 4M6XA 2NNYA 1OCZH 2NVUB 4JX5A 3EUHC 4F91B 3GLXA 3K4JA 5IP7J 1HQCA 1RZ4A 1Z1DA 2JRTA 2PMZA 4HLYA 2GIZA 5F0HA 2V26A 3WTUC 2IRFG 1IRFA 3AG2H 3G73A 5GPAA 2KFDA 3E0JB 3IH3A 1YX5A 4EVIA 2M4KA 3SZGA 4ZDPA 3OSGA 2P6TA 2NNNA 4M9SA 1X1CA 4L0YB 3WTYC 4E7IA 5CPRB 3OYBA 1MJBA 1OYYA 2L02A 3IRQA 2R7SA 1TT0A 1U9OA 1B1BA 3HPHA 4CYCA 3S1MJ 3M9AA 2XAQA 1RKWA 2R5ZB 4BEHB 3BLYA 2DDAA 2F48A 3AG3H 2HKXA 3CDLA 1SC7A 3Q0WA 2KDZA 5LGUA 1AHDP 4LB5A 4XLFA 4MTDA 4IJAA 4D7NA 2HDCA 5EZHA 1I1GA 4PZJA 3WG9A 2KKOA 2HVQA 2M4GA 3A1YA 1UJ8A 4M73A 3BROA 5IYCJ 1T56A 3I0TA 1U3EM 1S9HA 2EIKH 2UV1A 1I50J 2EFPA 5L3EA 1FBSA 2WA0A 2W82A 4G8XA 2A6HF 3HDDA 3M4OJ 3AAFA 1XSVA 3LSGA 2CW7A 3A03A 1GLNA 3KZIC 1DGWY 4GO1A 2CV2A 5J4VA 5CJ9A 2DOFA 1HKSA 2EV0A 3E5UA 4LITA 5IP9J 4CO8A 1SFOJ 4ZZDA 5JVGF 2NOJB 1ZYRF 2WAQN 3OYCA 3A0HC 3A02A 3FK6A 2JVHA 2AQFA 2CGPA 2GAUA 3OL3A 2VJJA 2NRAC 3DEEA 1QVUA 3LSTA 1FLIA 5CQEA 1NG6A 1Y8QB 5EYRA 3J81K 1KU9A 2E7WA 1YJ9I 1TLHB 2CH0A 1W36C 2QZ8A 3CUQA 2V7FA 4M72A 5K1YA 2MLGA 5E1WA 1GT0C 2O61A 2RREA 1BN5A 4A3FJ 2YR2A 3JSPA 2A68F 2KHMA 3J80K 1S29A 2FD5A 4M74A 5JI6A 2QKLB 2CO5A 3BCAA 3TP0A 1DPRA 4A5MA 3C1DA 2E36A 3PSIA 2JUGA 1S6LA 2XF6A 3LMMA 2V1NA 1SANA 1CF7A 4KJZA 4FT8A 4UY8I 1E17A 2F5FA 5C3EJ 1JGGA 2MGQA 2JRMA 4DYRA 2MD0A 3TGNA 4H0EA 4XLCA 2JN6A 2QWWA 2BXYA 3OS0A 3KP4A 2OA4A 2WC2A 1R00A 3OYFA 2K40A 4BBRJ 2E34A 5H20A 2VODA 1X2MA 4ZYHA 4HPQA 2OCCH 4XRMA 1MGTA 2OD5A 4V2GA 1I39A 4M9ZA 2XRLA 1ODDA 2P6SA 2A05A 4KFCA 1ETKA 4G94A 2KZVA 2RC4A 4RA2A 4F55A 2ZJQF 3F22A 4G7OF 4QSHA 1DP7P 1QU3A 1V54H 3V8KA 3PNYA 5KCMA 1FPQA 1FTTA 3IUOA 4HQMA 3ZPLA 4RLFA 4AC0A 5D4SA 2DN0A 3K4LA 3GWZA 2X1EA 4PDKA 2DYRH 5B3SH 3K4NA 5AIPA 2R92J 2KRHA 1JJ8C 4ZDOA 2X6YA 4XKVA 2DA1A 5HNFA 1FYKA 2DMQA 1NK2P 1MBFA 1PYVA 2DJNA 3HOZJ 4BJTA 1QZYA 1NK3P 3HHGA 1IUYA 3PIOF 4JQFA 1LJ9A 1I6HJ 1I5ZA 1TZLA 4IEJA 5J3LA 1EV7A 3U1KA 4DNCA 4IF4A 2ECBA 2ZJ2A 2VQHA 1K79A 3CCRI 3B02A 4A3KJ 3HOUJ 2LK2A 1MMNA 1X1PA 2EFWA 4I0BA 2VE8A 3V7CA 1IUFA 4EM1A 1T0FC 3CCUI 2JA5J 3CMAI 4X6AJ 2K7LA 2VBXA 3HKZA 4L0ZB 3FK7A 2VKDA 4MQ9F 2Y48A 1L3LA 4A0XA 4EJTA 1SVOA 4BHCA 1O4XA 1JKPC 3QYBA 3FXUA 2IT0A 3C2HA 2EINH 3L09A 5K7FA 1B8IB 3CESA 4U0VA 5BMZA 5E3NA 3I54A 2BHZA 1ZTRA 1MDMB 4KN4X 4ENJA 5D6EA 1VQ9I 1NG7A 3A2KA 2CUZA 2EV5A 1F4KA 3CQZJ 4ESFA 2BY0A 1FIPA 5HDNA 2PMHA 1MMDA 3U1DA 3GVAA 2MA3A 2EZIA 4BS9A 1XGMA 2ZSIB 3HYIA 3CUOA 4Y17A 5JHFA 3FMRA 3WE2A 2XROA 1J9IA 5FLXZ 1U9NA 4M71A 1HBXG 2K9LA 5DEQA 2D1HA 1HDPA 2A6EF 1FP1D 1P9QC 2GWRA 1PUEE 1D0ZA 1VQ5I 3TW6A 3GYHX 4N0BA 1D1CA 2IGKA 4QLCU 4KICA 3BTIA 1XMAA 2TRTA 2EBIA 2O7OA 3R60A 1WQ2A 1XX5A 4L5JA 1WHUA 4AVZA 1SVLA 3RQ4A 1WI3A 2Y9ZA 2Z2SB 3LL7A 4XL9A 3CCYA 2KIUA 2LR8A 3E7LA 3BG7A 4PK4A 4CDGA 1V5FA 2CRGA 4CYDA 2FA5A 3OOPA 1OCTC 3DPTA 4CCJA 3CUQB 5D5VB 2JPCA 1HF0A 1M1EB 4XIDA 3SXYA 2X1DA 3G1MA 4CCMA 2DI3A 1SFUA 2HQAA 4HA8A 1XN7A 2HI3A 3WHBA 2OJED 4U7BA 1S8NA 2O0YA 2MLKA 3WHCA 5HLIA 2HVRA 2Y0SA 2IS6A 1ZLJA 4BE2A 1SD5A 1I27A 1SFKA 4E70A 2HDWA 2BOLA 4Q5SF 3W2WA 1CF7B 4LIVA 1ONVA 1J0RA 3IV5A 2YU9J 5IT9K 2MW8A 1Y39A 3GTOJ 2W84A 2PG4A 4V19K 3BY6A 4XKWA 4U7DA 3X2QH 2HGCA 2NXNB 3F6OA 2ETHA 1APLC 2VKEA 2OUMA 4AWXB 4HZFA 2VPRA 4YFXF 2BY1A 4LLLA 2DPDA 2TDXA 5BS6A 2VUMJ 1IO2A 1ETVA 2H6CA 1R4MB 3OS2A 2MFZA 2GIVA 4N9HA 3BQZA 4LFUA 3GUDA 4RGSA 1QBJA 1LDKB 4LG0A 3BR2A 3TOAA 2CQKA 1T38A 2VB6A 2XKOA 1WJBA 3DQVC 4XM3A 2MYSA 1ZK8A 1ZRCA 5GAEJ 4XMYA 5FO5A 5FFXA 5H6RA 2R7RA 5EGOA 1QHHD 3E6CC 2IS2A 2Z1DA 2X6XA 2NS7A 3MQ0A 4XK4A 3P5JA 2HWVA 5D6FA 4B47A 3MKYB 3DEWA 5K5QA 3RTRA 1TL8A 2XF7A 2FBHA 2HU9A 3DWLE 1B59A 2O9LA 1P4AA 2K3FA 1P7JA 1MZBA 4RGUA 4EATA 3WU1B 1JUMA 3CCSI 2DFFA 2YX4A 3LSIA 3K69A 3OYNA 1LEBA 3A01A 4BU2A 3K70C 1USSA 2N8GA 2VT2A 4ZJZA 2FEZA 1P6RA 1VTNC 1T0FA 5LHGA 4HW0A 4IOAF 3CO6C 9ANTA 4W97A 1ON1A 4MEYF 5AONA 2X9DA 4D7MA 1BIBA 1TQPA 1BC8C 6PAXA 1XSXA 3GFMA 4F7ZA 2QQAA 5EDNA 3WTTC 2ZMEC 2D2WA 1F43A 2YU3A 3OR2C 5FLXK 1VNDA 2XHKA 4CA0A 2ZNYA 1QQIA 3FXOA 3CP8A 5L3FA 1BL0A 2KMUA 3TOBA 2GA2A 4MLOA 1W0TA 2IVMA 3F21A 1X2NA 1WJEA 4DOZA 1DP3A 3JR9A 2XASA 2P5LC 1P7IA 1YE9A 1MBEA 5J4YA 1J59A 2XGCA 4U87A 4NQWA 1FSHA 3ERED 4A3JJ 3C3WA 2Z16A 3ABKH 3CF2A 2HQ5A 1S7AA 3GBGA 2W25A 3MZYA 5KK1A 1VI0A 3I55I 2QA4I 3E6DA 2LP0A 4XQFA 4FE7A 2A5WA 2AXLA 4ITVA 4E7SA 1W7PD 3GW2A 1Y1WJ 1ZG5A 2QENA 3RKQA 3R0JA 5E17F 1VQNI 2R7TA 3WTWC 1X1AA 3HRTA 5E3OA 1R1VA 4XRSA 4UNOA 4BDYA 3ISPA 3TDUC 3S14J 2VOPA 5J1UA 2V9KA 1Z3XA 5IPAA 3G1OA 1U78A 2COBA 3I59A 4HX4A 4KIBA 1VQPI 2QF7A 5FROA 1YI2I 4HYEA 3HBLA 3OS1A 1FNNA 1IN6A 3OYHA 4KYWA 2ZC2A 5J1RA 2JA2A 1D8KA 2F6CA 1XG1A 5FJ8J 1ULYA 1K78A 3OL4A 2UWMA 4XLAA 2LDUA 4C30A 1O7LA 2CQXA 2D45A 4GGGA 1D8JA 1OQYA 3RSNA 1BC7C 5KAIC 5LLQA 1U0JA 2O03A 2JQ7A 1BA5A 2OF7A 4IHTA 3KX2A 4GXOA 2DQRA 3BG9A 4J19A 1VQKI 4J01A 3IKTA 3W6JB 4KISA 2W7NA 2E1OA 2JJ7A 3FISA 1AKHA 2A61A 2HOAA 2WY7Q 3OIOA 4G7HF 1FTZA 2ZXHA 2V4JC 5HNHA 1OLTA 3GMEA 3VEPA 1YTYA 1YJNI 3K70D 1MMGA 1AOYA 5CVVA 2G7HA 5JLWA 1ETYA 4CCOA 1BR1A 2VJ4A 2WAQA 1RRJA 1K6YA 3HJEA 4EQQA 1EA3A 4OAYA 3HSEA 4B09A 5LGNA 1ACIA 3JW4A 4ZYEA 4M6YA 3F8CA 1SD4A 4XRFA 4ZDLA 3J7AO 5DD8A 3CJTB 1X3WB 4LG0B 3ZMSA 4IL6C 5GTHC 4MTEA 4OMZA 4ZTJA 1MBGA 2W00A 4RB2C 1TQMA 3BR3A 3FM3A 1XTAA 3ZQ7A 1SVMA 4UVCA 4EV0A 1B4AA 2E5ZA 2AS5F 4NB5A 3M7GA 4OIQF 3GTQJ 1HSTA 2K86A 4Y33A 1A5JA 2EA4A 2LF7A 4WWCA 3L2VA 3QRFF 3LQQA 2MD5A 5J1YA 4YRVA 1ZH5A 2BW3B 2H09A 1J09A 2HOEA 2OPTA 3TL4X 2FBIA 4LB6B 1WJ5A 3LSMA 2DOEA 3I3LA 4L9TA 2EK5A 1VQ4I 1W0UA 4XLNF 5B5EC 3OYEA 1ZRFA 1Q1HA 1R58A 3QP5A 1UB9A 2K9SA 2QSFX 1O3QA 2AQEA 2Y30A 1FYLA 2CG4A 2R93J 3ASOH 4XONA 2HYFA 3A01B 3HZJA 4D5FA 1YG2A 3J7YJ 5BOXA 1XS9A 2ZO4A 5F0CA 4RMNA 3UR3C 2XIGA 4B44A 3F8BA 4BACA 1X4OA 3DTIA 1HW2A 4OU0A 4WXHA 1J7KA 3ML6A 2ZMEA 4BXUA 3GTPJ 1FOYA 5F27A 1E3OC 1USTA 3R0AA 4XOPA 3HRUA 2X4HA 3H9QA 3WE3A 2R7UA 1E0EA 3WGGA 3AG1H 3L2UA 1MBKA 2F5EA 3IAS2 5EEHA 1UAAA 1A6QA 3D5LA 2E2HJ 5L3DA 3RPUD 2FNPA 1LFPA 5D5WB 1LQ1A 2Z9OA 2M8GX 3NWTA 4L9JA 2VLAA 2F2EA 4YIIA 1DQUA 4XRSG 5LRSA 1SAUA 3GZ6A 2BHYA 1IF1A 4C9YA 1SFEA 1WJAA 4JX6A 2EQRA 2ZJRF 3ZMZA 3TDZC 4AIJA 3KP5A 4LG3A 3B73A 4XICA 3COAC 4N4OB 3VODA 2CV0A 3BJAA 2G9WA 4IXAA 1LPQA 4HX8A 4M6VA 5B1BH 4NNJA 1HDDC 2XF5A 2GXAA 5FD6A 3S2HJ 2YX7A 3KEOA 4Q4ZF 1QPIA 4KNYA 2XUBA 2QQBA 5IT3A 3GTLJ 1F1ZA 1WJDA 3DCFA 2DCEA 2R4GA 3FMQA 3MZHA 3KE2A 4JOMA 5DM6F 1XB4A 3S8PA 3HOSA 4P5OA 4PJJA 4UV9A 2XGEA 1B8IA 3ZN1A 2BXZA 2M34A 4UB8C 3KEQA 1MDMA 4AYBA 2QKMB 1XC5A 1ENHA 1Z67A 3D5RC 2GOXB 3MD2A 4WXDA 3OIQA 1RPWA 5BPDA 5D8KB 4HNTA 1OCCH 2L9SA 2HPIA 3I59B 3VB2A 4MFDA 2V9VA 3RPUA 1T8IA 1NH3A 1B72A 5JR3A 4MIMA 4H4KC 3DPUA 3ZP5A 2RKHA 1CQTA 2XAGA 3PIPF 2K3PA 3FXQA 1LEAA 2CQ7A 3DLLF 4YELA 2FSWA 1K78B 2PQ8A 2KIFA 1IGNA 4NDLA 1ZN2A 1YS6A 5DS9A 2XVCA 2P0WA 3MVPA 2EFOA 4G6QA 4KUMA 3VOEA 5DCFA 1JHFA 2QVOA 4ENKA 3D0SA 3PFIA 4C3JJ 3OWTA 1LKXA 2WBMA 5HVQC 1DU6A 5KHDA 4BY1J 4Y15A 2X6OA 1MH4A 4Q47A 4BL0B 5L3BA 3VPRA 1D1AA 4C3IJ 2J5OA 3WG7H 4OWRB 4E6KG 3ZR8X 1IRZA 3ECHA 3SEQA 2H6BA 2HZDA 1AKHB 1IJWC 4YIFA 3TO7A 2E71A 4RAFA 5IP6A 1K61A 4U88A 4CXFA 3QYFA 2HS5A 1I3AA 3HSFA 4IVNA 4G9YA 1V5GA 3C18A 3PUBA 2B9SA 4PFPA 5FB2A 3H1CA 4CSWA 5D8LB 2MC4A 2DA3A 3SFIA 4C2UA 2JZYA 2LC2A 1YLFA 5ILUA 3JRBA 3FWEA 4E7ZA 2H8WA 1XMKA 4S04A 2IGOA 4IO9F 4ZC3A 2NVTJ 2LMDA 3CC4I 4KN7X 1E2XA 1HLVA 2XC7A 3VWBA 4BXFA 1LVKA 3RKWA 1TWAJ 1TW2A 1KQ0A 1TNTA 3KZYA 1R5ID 2M0CA 3OYJA 2EFQA 3VYUB 2R7QA 1A6IA 2H94A 3IAM2 2DTRA 2GLOA 2LD5A 1UHWA 2DXIA 1G59A 4HNUA 3E6BA 3PJRA 1X1DA 3FXJA 4XKBA 4L18B 3LAPA 1FT9A 3M07A 4IRHA 1GHCA 2P7CB 5E1XA 2OU2A 3SFZA 1HSJA 1QHGA 4W1UA 3JRGA 2FQ4A 4Z2YA 4ENNA 3S93A 1KGSA 2DK5A 3KYCB 4UUVA 4LD5A 3I4MJ 3O6BB 2LLKA 1EJ9A 4UV8A 1TW3A 2CYYA 1JKRC 1GUUA 3GCMA 2VN2A 3HB9A
chains in the Genus database with same CATH topology
2PFBA 2GZWA 5K5RA 1YYVA 2ZMEB 2M8EA 2V1XA 4CZZA 2ZCWA 4XLPF 2IA0A 2UXXA 3ZMUA 3WTXC 3P9KA 1MKMA 3EETA 1HW1A 3G3ZA 1OMIA 2DU9A 1I6XA 2QUFA 3KP6A 4EJUA 3LA2A 1RNLA 2FU4A 2M45A 4AIKA 3GFLA 3N4MA 3HIFA 1H0MA 3F8FA 2ADUA 3ELKA 3RKXA 1ZRDA 3HOTA 3DXJF 4YFKF 2EB7A 3CLOA 2R7FA 1RI7A 1WWXA 2HZTA 2P7VB 2XKPA 1PP8F 4LMYA 3WGIA 4MEXF 1BOAA 2L4MA 2OQGA 1IRGA 2ESHA 3FHZA 1D5VA 2VXZA 4PCQA 4Q48A 2K02A 3GX4X 3TO6A 5DV5A 1YFHA 3F6VA 3KLOA 3E5XA 2PI0A 1IN4A 4KIFA 5DYMA 1I1SA 4BYYA 3IL2A 1G4DA 1BM9A 1DPUA 2W24A 5LBQA 3V8LA 5FFZA 4WK8F 4ASNA 1RUOA 3GFIA 3I4PA 5F64A 1JGSA 4FX0A 3SHFA 5BQTA 1LNWA 3R6SA 5ED4A 3O3KA 3S2WA 5EEGA 2B0LA 3K1MA 5LRRA 3EQLF 4EGYA 3LQRA 4ZH4F 1EH7A 2VBYA 1B9MA 1KQ8A 3DF8A 1J2XA 3Q9VA 2HTJA 3IKVA 3W6KB 1FBUA 2L4AA 1JHHA 4AD9A 1EH6A 2DBBA 3MWMA 1G3YA 3CTAA 1IXSB 3FF5A 3NEUA 2QQ9A 3SZPA 1YQAA 3KP2A 4JK1X 2MH2A 2KJCA 2M30A 1HXDA 5CVRA 3CO7C 3FZVA 5DUKA 1BBYA 3V4GA 4KMFA 4FX4A 2QYOA 2OZ6A 5CVUA 4HF0A 2ISZA 2FMLA 3HRMA 4LLNA 3IRRA 4A0YA 3MFKA 3T8RA 3QAHA 5CLSA 2EV6A 1BI0A 5BPIA 4LK0F 2H27A 3QU6A 2ISYA 4A12A 2JPBA 1PDNC 2VC1A 1IW7F 3QU3A 3T0YA 3HTUA 3SZTA 2V1UA 2FE3A 1ZGAA 2RGVA 3BZ6A 4WXCA 4R8HA 2V1DA 3Q9SA 5ICFA 3RYRA 1BI2A 2RQPA 1K6OA 5HS8A 4RAYA 4EJWA 4WF2A 1IZ1A 3U2RA 4L9VA 3RIRA 2HKOA 2CFXA 4ZZLA 4U0WA 3ABUA 1G6NA 3TO9A 4U0YA 1STZA 4I2OA 2E1NA 4RGRA 4A2UA 4RB1A 1BJAA 2FNAA 1CGPA 5FGMA 4KDPA 1W7PA 1LDJA 3DFGA 4Y13A 4KIGA 2HQNA 1ZG3A 2XV4S 2DAOA 1YO5C 2JTVA 3GFJA 3KP3A 1A04A 1G3SA 1SMTA 4I01A 3CJNA 1O3RA 5ICGA 3DKWA 5HS9A 2PMUA 5ERIA 3M8FA 4XSZF 1FY7A 2Y75A 1W5SA 2HTSA 3DPLC 3QP6A 2A3SA 2Z99A 2LKPA 3K9TA 3V7SA 3I64A 5JFRA 4OIOF 4L5IA 2ELHA 4WCGA 4N9IA 1S7OA 4CICA 3QOPA 5LEKA 1PP7U 2F5DA 2CSOA 3BPVA 3WTSC 1HW5A 2JSCA 1QNTA 2EWNA 1SAXA 5JVTA 5DD4A 1XDUA 1Z05A 3BJ6A 2DPUA 4S05A 1IN7A 4IRGA 4EMSA 2YPRA 4RAZA 1U5TC 2L01A 1V3FA 3T5XA 4I02A 3J80Z 3KETA 3JTGA 3DP7A 2XAJA 1KA8A 2V6CA 4KA4A 3VFZA 1R23A 2NAZA 4BH9A 4IHSA 1G3TA 1L0OC 1WKMA 4P9FA 1HKTA 3R4KA 4MNUA 1QO0D 2Z5UA 3R61A 4UHTA 3L2CA 1LDDA 1U8RA 2F5CA 1XCVA 1IXRC 3HRSA 3PQKA 4HV6A 1KQ9A 2ZXJA 5D4RA 4I09A 4BAYA 1XCBA 1Z91A 2IJLA 4OIRF 4HLXA 3OV8A 4BNCA 2M5WA 3L00A 3NRVA 1KU7A 2RVCA 3ULQB 1KYZA 5LHIA 1R1UA 1T39A 2ACJA 3U9GA 4L9NA 1FX7A 2X0LA 1C0WA 2XAHA 5H6QA 2STTA 4GYGA 2HEOA 1H9GA 3GEZA 5HOOA 5FD5A 3KZZA 3GXOA 4UXNA 5LHHA 4LK1F 4KT5C 4EGZA 2IA1A 4BHPA 1W7PB 5DUIA 4MQVA 4NHJA 1OR7A 2Q2EA 2Q8KA 1GXPA 3F8NA 4HV5A 3E6MA 2KJBA 1EH8A 1O57A 2V79A 2ZFWA 4O6JA 3O2PE 5LEJA 3EYIA 2A69F 1FSEA 2M87A 2LF8A 5KVRA 4EJOA 3I53A 1X3UA 2VBZA 3QPTA 3M8EA 1ZARA 2DT5A 4HQEA 4R1HA 2IA2A 1XD7A 1Z6RA 1P4WA 1YW7A 2ZNZA 4XSXF 1ON2A 4B8XA 1S3JA 2Z33A 3BPXA 1U6GA 3HTSB 2P4WA 2YSRA 4GCVA 3EYYA 4HX7A 3WTZA 3WTVC 1IN5A 3RPQA 1F5TA 3HUGA 5CYVA 3T1BA 2MH9A 3F72A 1OKRA 4OOIA 2A07F 3LAJA 3DV8A 3QPHA 1IAWA 2Q0OA 2RNJA 2P5KA 4UVAA 1YW9A 4A5NA 2HR3A 4IRIA 1R7JA 5ILVA 4ZYGA 2MBFA 1U5TA 1GVJA 2W57A 1XSDA 5ICEA 3EDPA 2JT1A 3K0LA 4I98B 3LWFA 5TRDA 4EM2A 3IWFA 1QPMA 1WRJA 1RUNA 4LLGF 2Y0MA 3GF2A 1IXCA 4HBLA 1UHMA 5D5XB 1FBQA 5IT9Z 4MHGA 1H9TA 2HFHA 1ZAOA 5HDGA 4RB3C 4HOBA 2Z3YA 1NHAA 3WGHA 2EA2A 5E20A 5L3GA 3ZMDA 2G7UA 3L7WA 1D3YA 3Q5FA 5ILSA 1OPCA 5HLHA 3ZN0A 2WV0A 3IWZA 3MCZA 1XDSA 5K5OA 1ZLKA 2QBYA 1O3TA 1WSUA 1IN8A 3BJOA 3EUHA 2BGCA 2PLYA 1SFXA 2CW0F 2D1VA 2R7DA 3HSRA 4O5VA 5F1RA 1P2FA 2IPQX 4TV7A 1ZHFA 3PQJA 1FYMA 1YIOA 3MEXA 1K7AA 2W85A 5A2QZ 1WI9A 3K1PA 3DEUA 4I7HA 2A5YB 1XGOA 2FF4A 1SMYF 4A0ZA 2KRFA 2XRNA 2L3DA 2O6GE 3CDHA 2GA1A 1J75A 4AIHA 4OMYA 2P5VA 4M9XA 1MJ9A 2XGXA 5HS7A 2DQLA 3ROUA 1FZPB 1ZREA 2EFNA 2GQQA 3ABTA 4ZYDA 4PGHA 5DCMA 2XAFA 4BQAA 3P9CA 1YW8A 3HHHA 3C7JA 2BBYA 4RB0A 2DW4A 3IC7A 1Z7UA 3MAJA 5J8CA 1SD6A 3RJPA 1HKQA 3H3UA 3GO5A 1GXQA 1DUXC 3JAMZ 1YS7A 3KP7A 3P9IA 5J8FA 1U2WA 2ESNA 5HLGA 4LJZF 3I5UA 1U5TB 1OYWA 4UVBA 4YFNF 3H3ZA 4IPAA 2P8TA 4KMUX 2BYVE 2PEXA 4K2EA 3E5QA 4XBFA 4P55A 4A6DA 2HYGD 4O3MA 3BOQA 1B9NA 4RS8A 5TJJA 1FOKA 1P92A 5D5UB 1O7FA 3SQNA 2RN7A 1TQIA 2J5PA 1REPC 3K2ZA 2IP2A 1P4XA 2GXGA 2FOKA 1XGNA 3JTHA 2OBPA 4BHBA 4OINF 2OAZA 4LGWA 3L9FA 5F6FA 1W5TA 4AVPA 4ESBA 4PGGA 2FXAA 2DK8A 2K27A 4HF1A 5AIQA 4P96A 1J5YA 2QBYB 4CHUA 3I71A 1TNSA 1T6SA 4G6DA 5E1ZB 5A2QK 1R5GA 4A6EA 1O3SA 1OYIA 2O8XA 3M1EA 3LFKA 3F3XA 3FXRA 3ZMTA 2VONA 2FQ3A 1UFMA 3KFWX 2IW5A 1BI1A 2O3FA 2R3SA 3IHUA 3KCCA 2VE9A 1LVAA 1MJAA 3T8TA 5ICCA 2MC3A 2DO7A 2UXNA 4DQ2A 1B6AA 1BI3A 4JBAA 1TTYA 5JHUA 2COMA 1W4MA 2DFIA 3BWGA 5E18F 2PBIA 5HDKA 3E97A 2CWEA 2FMYA 2NYXA 4G7ZF 5CVJA 1R5HA 4ESJA 2QM3A 3JAMK 5DCMB 4OIPF 1R36A 2E7XA 4ON0A 1F9NA 2ZBKA 2K4JA 1JXSA 4MGRA 2OZUA 3FM5A 4HAMA 3BDDA 5DDGA 2OQRA 3FX3A 1QGPA 1KU2A 1Z6TA 1T2KA 3LA7A 1ZG1A 2BV6A 2E1CA 4RGXA 3E3VA 2L54A 1RIOH 3RDIA 3WODF 3WU0A 1T98A 2KIMA 1BIAA 2STWA 4HF2A 1TBXA 5CVIA 4GYIA 2LNBA 2DLLA 4CGZA 4QWQA 3RI4A 3P7NA 2FBKA 5LGTA 1DDNA 3BP8A 3I58A 2K4BA 3CUQC 4FHTA 4EJVA 1G3WA 3TQNA 1R22A 4I0AA 2QLZA 1V4RA 1FWZA 1KU3A 4R79A 1Z9CA 2VBWA 3K1NA 5J6XA 2HQRA 1LB2A 2M1BA 4ENMA 4ETSA 1JE8A 1KYWA 3F8MA 3V7RA 2ZKZA 3N97A 3F23A 3J81Z 5L3CA 3NQOA 2EJRA 2LSOA 3GZ5A 4HDVA 1ZGJA 5E8GA 2RDPA 3KLNA 3ZMVA 2PJPA 1FC3A 3FMSA 4WX9A 4YG2F 4D0PA 2NS0A 3RYPA 3H92A 2FRHA 2BE5F 2UZKA 4EM0B 1XGSA 1SD7A 2VT3A 2WWYA 3RKYA 3TKYA 2C6YA 1AWCA 1MD0A 1R1TA 2VC0A 2PN6A 4HDUA 1UCRA 3ECOA 1FP2A 5E8IA 2BEOA 1Y0UA 2GXBA 1QZZA 4P9UA 3JSOA 3V8JA 3LA3A 3REOA 2RV8A 2WTEA 4M6XA 2NNYA 3GLXA 1HQCA 1RZ4A 1Z1DA 2JRTA 4HLYA 3WTUC 2IRFG 1IRFA 3G73A 4EVIA 2P6TA 2NNNA 4M9SA 4L0YB 3WTYC 1MJBA 1OYYA 2L02A 3IRQA 1B1BA 3M9AA 2XAQA 2HKXA 5LGUA 4LB5A 4MTDA 4IJAA 2HDCA 1I1GA 4PZJA 3WG9A 2KKOA 4M73A 3BROA 3I0TA 1U3EM 2EFPA 5L3EA 1FBSA 4G8XA 2A6HF 3AAFA 1XSVA 4GO1A 5CJ9A 1HKSA 2EV0A 3E5UA 4CO8A 4ZZDA 1ZYRF 2CGPA 2GAUA 2NRAC 3LSTA 1FLIA 3J81K 1KU9A 2E7WA 1TLHB 2QZ8A 3CUQA 4M72A 5K1YA 2MLGA 5E1WA 2O61A 1BN5A 2YR2A 3JSPA 2A68F 3J80K 1S29A 4M74A 5JI6A 2CO5A 1DPRA 4A5MA 3C1DA 1S6LA 1CF7A 1E17A 4FT8A 2F5FA 3TGNA 4H0EA 2QWWA 3KP4A 2OA4A 2WC2A 1R00A 5H20A 2VODA 4ZYHA 1MGTA 2OD5A 4M9ZA 1ODDA 2P6SA 4KFCA 4G94A 2RC4A 3F22A 4G7OF 1DP7P 3V8KA 1FPQA 4HQMA 3ZPLA 5D4SA 3GWZA 4PDKA 5AIPA 1FYKA 1QZYA 3HHGA 1IUYA 4JQFA 1LJ9A 1I5ZA 1EV7A 4DNCA 4IF4A 2ZJ2A 1K79A 3B02A 2EFWA 4I0BA 2VE8A 3V7CA 4EM1A 2K7LA 2VBXA 4L0ZB 4MQ9F 2Y48A 1L3LA 4A0XA 4EJTA 4BHCA 3FXUA 2IT0A 3L09A 4U0VA 5BMZA 3I54A 1MDMB 4KN4X 4ENJA 5D6EA 2EV5A 1F4KA 4ESFA 5HDNA 2PMHA 3U1DA 3GVAA 2MA3A 1XGMA 3HYIA 3CUOA 4Y17A 3FMRA 3WE2A 2XROA 1J9IA 5FLXZ 4M71A 1HBXG 5DEQA 2D1HA 2A6EF 1FP1D 1PUEE 2GWRA 3GYHX 4N0BA 4QLCU 4KICA 1XMAA 3R60A 1WQ2A 4L5JA 2KIUA 2VOOA 4CDGA 4CYDA 2FA5A 3OOPA 3DPTA 3CUQB 5D5VB 2JPCA 3SXYA 2DI3A 1SFUA 4HA8A 1XN7A 4U7BA 1S8NA 2O0YA 2MLKA 5HLIA 1ZLJA 1SD5A 1I27A 4E70A 4Q5SF 1CF7B 1ONVA 1J0RA 5IT9K 2W84A 2PG4A 3BY6A 4U7DA 2HGCA 3F6OA 2ETHA 4AWXB 4HZFA 4YFXF 4LLLA 2DPDA 2TDXA 5BS6A 2H6CA 2GIVA 4N9HA 4LFUA 3GUDA 4RGSA 1QBJA 1LDKB 4LG0A 3TOAA 2CQKA 1T38A 2XKOA 3DQVC 1ZRCA 5FO5A 5FFXA 5H6RA 3E6CC 3MQ0A 2HWVA 5D6FA 5K5QA 3RTRA 2FBHA 1B59A 1P4AA 1MZBA 4RGUA 3WU1B 2YX4A 3K69A 1LEBA 1USSA 2VT2A 2FEZA 1P6RA 1VTNC 1T0FA 5LHGA 4HW0A 3CO6C 1ON1A 4MEYF 5AONA 1BIBA 1TQPA 1BC8C 6PAXA 1XSXA 3GFMA 4F7ZA 2QQAA 3WTTC 2D2WA 2YU3A 5FLXK 2XHKA 2ZNYA 1QQIA 5L3FA 3TOBA 2GA2A 2IVMA 3F21A 2XASA 2P5LC 1J59A 4NQWA 1FSHA 3ERED 3C3WA 1S7AA 2W25A 3MZYA 5KK1A 3E6DA 2AXLA 1W7PD 3GW2A 1ZG5A 2QENA 3R0JA 5E17F 3WTWC 3HRTA 1R1VA 4UNOA 3ISPA 3TDUC 2VOPA 1U78A 3I59A 4HX4A 4KIBA 4HYEA 1FNNA 1IN6A 4KYWA 1D8KA 1ULYA 1K78A 2UWMA 2LDUA 1O7LA 2D45A 4GGGA 1D8JA 1BC7C 5LLQA 2O03A 4IHTA 4GXOA 2DQRA 3IKTA 3W6JB 2A61A 4G7HF 3VEPA 1YTYA 1AOYA 5CVVA 2G7HA 4EQQA 4B09A 3HSEA 5LGNA 3JW4A 4ZYEA 4M6YA 3F8CA 1SD4A 4XRFA 3J7AO 5DD8A 4LG0B 3ZMSA 4MTEA 4OMZA 4RB2C 1TQMA 3FM3A 3ZQ7A 4UVCA 4EV0A 1B4AA 2AS5F 4NB5A 3M7GA 4OIQF 1HSTA 2K86A 2EA4A 2LF7A 4WWCA 3QRFF 1ZH5A 3LQQA 2MD5A 2H09A 2HOEA 2FBIA 4LB6B 4L9TA 2EK5A 4XLNF 1ZRFA 1Q1HA 1R58A 3QP5A 1UB9A 1O3QA 1FYLA 2CG4A 2HYFA 1YG2A 5BOXA 2ZO4A 2XIGA 3F8BA 1HW2A 4OU0A 4WXHA 1J7KA 3ML6A 2ZMEA 4BXUA 1USTA 3R0AA 3HRUA 2X4HA 3WE3A 3WGGA 2F5EA 5EEHA 3D5LA 5L3DA 2FNPA 5D5WB 1LQ1A 2Z9OA 4L9JA 2F2EA 4YIIA 5LRSA 3GZ6A 1IF1A 1SFEA 3ZMZA 3TDZC 4AIJA 3KP5A 3COAC 3B73A 3VODA 3BJAA 2G9WA 4IXAA 4HX8A 5FD6A 2YX7A 3KEOA 4Q4ZF 4KNYA 2XUBA 2QQBA 5IT3A 1F1ZA 3FMQA 3MZHA 3KE2A 1XB4A 3HOSA 4P5OA 4UV9A 3ZN1A 3KEQA 1MDMA 4WXDA 5BPDA 5D8KB 3I59B 3VB2A 2V9VA 3RPUA 5JR3A 3ZP5A 2RKHA 2XAGA 3FXQA 1LEAA 2FSWA 1K78B 2PQ8A 2KIFA 1ZN2A 1YS6A 2XVCA 2EFOA 4G6QA 4KUMA 3VOEA 5DCFA 1JHFA 2QVOA 4ENKA 3D0SA 3PFIA 5HVQC 4Y15A 4Q47A 5L3BA 2J5OA 3ECHA 2H6BA 4YIFA 3TO7A 4U88A 4CXFA 2HS5A 3HSFA 4IVNA 4G9YA 3C18A 5FB2A 5D8LB 2JZYA 1YLFA 5ILUA 3FWEA 1XMKA 4S04A 4KN7X 1E2XA 3RKWA 1TW2A 1KQ0A 1TNTA 3KZYA 2EFQA 2H94A 2DTRA 1UHWA 3E6BA 4L18B 3LAPA 1FT9A 4IRHA 1GHCA 2P7CB 5E1XA 2OU2A 3SFZA 1HSJA 4Z2YA 4ENNA 1KGSA 2DK5A 4UUVA 4LD5A 3O6BB 4UV8A 1TW3A 2CYYA 2VN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFB A;  2GZW A;  5K5R A;  1YYV A;  2ZME B;  2M8E A;  2V1X A;  4CZZ A;  2ZCW A;  4XLP F;  2IA0 A;  2UXX A;  3ZMU A;  3WTX C;  3P9K A;  1MKM A;  3EET A;  1HW1 A;  3G3Z A;  1OMI A;  2DU9 A;  1I6X A;  2QUF A;  3KP6 A;  4EJU A;  3LA2 A;  1RNL A;  2FU4 A;  2M45 A;  4AIK A;  3GFL A;  3N4M A;  3HIF A;  1H0M A;  3F8F A;  2ADU A;  3ELK A;  3RKX A;  1ZRD A;  3HOT A;  3DXJ F;  4YFK F;  2EB7 A;  3CLO A;  2R7F A;  1RI7 A;  1WWX A;  2HZT A;  2P7V B;  2XKP A;  1PP8 F;  4LMY A;  3WGI A;  4MEX F;  1BOA A;  2L4M A;  2OQG A;  1IRG A;  2ESH A;  3FHZ A;  1D5V A;  2VXZ A;  4PCQ A;  4Q48 A;  2K02 A;  3GX4 X;  3TO6 A;  5DV5 A;  1YFH A;  3F6V A;  3KLO A;  3E5X A;  2PI0 A;  1IN4 A;  4KIF A;  5DYM A;  1I1S A;  4BYY A;  3IL2 A;  1G4D A;  1BM9 A;  1DPU A;  2W24 A;  5LBQ A;  3V8L A;  5FFZ A;  4WK8 F;  4ASN A;  1RUO A;  3GFI A;  3I4P A;  5F64 A;  1JGS A;  4FX0 A;  3SHF A;  5BQT A;  1LNW A;  3R6S A;  5ED4 A;  3O3K A;  3S2W A;  5EEG A;  2B0L A;  3K1M A;  5LRR A;  3EQL F;  4EGY A;  3LQR A;  4ZH4 F;  1EH7 A;  2VBY A;  1B9M A;  1KQ8 A;  3DF8 A;  1J2X A;  3Q9V A;  2HTJ A;  3IKV A;  3W6K B;  1FBU A;  2L4A A;  1JHH A;  4AD9 A;  1EH6 A;  2DBB A;  3MWM A;  1G3Y A;  3CTA A;  1IXS B;  3FF5 A;  3NEU A;  2QQ9 A;  3SZP A;  1YQA A;  3KP2 A;  4JK1 X;  2MH2 A;  2KJC A;  2M30 A;  1HXD A;  5CVR A;  3CO7 C;  3FZV A;  5DUK A;  1BBY A;  3V4G A;  4KMF A;  4FX4 A;  2QYO A;  2OZ6 A;  5CVU A;  4HF0 A;  2ISZ A;  2FML A;  3HRM A;  4LLN A;  3IRR A;  4A0Y A;  3MFK A;  3T8R A;  3QAH A;  5CLS A;  2EV6 A;  1BI0 A;  5BPI A;  4LK0 F;  2H27 A;  3QU6 A;  2ISY A;  4A12 A;  2JPB A;  1PDN C;  2VC1 A;  1IW7 F;  3QU3 A;  3T0Y A;  3HTU A;  3SZT A;  2V1U A;  2FE3 A;  1ZGA A;  2RGV A;  3BZ6 A;  4WXC A;  4R8H A;  2V1D A;  3Q9S A;  5ICF A;  3RYR A;  1BI2 A;  2RQP A;  1K6O A;  5HS8 A;  4RAY A;  4EJW A;  4WF2 A;  1IZ1 A;  3U2R A;  4L9V A;  3RIR A;  2HKO A;  2CFX A;  4ZZL A;  4U0W A;  3ABU A;  1G6N A;  3TO9 A;  4U0Y A;  1STZ A;  4I2O A;  2E1N A;  4RGR A;  4A2U A;  4RB1 A;  1BJA A;  2FNA A;  1CGP A;  5FGM A;  4KDP A;  1W7P A;  1LDJ A;  3DFG A;  4Y13 A;  4KIG A;  2HQN A;  1ZG3 A;  2XV4 S;  2DAO A;  1YO5 C;  2JTV A;  3GFJ A;  3KP3 A;  1A04 A;  1G3S A;  1SMT A;  4I01 A;  3CJN A;  1O3R A;  5ICG A;  3DKW A;  5HS9 A;  2PMU A;  5ERI A;  3M8F A;  4XSZ F;  1FY7 A;  2Y75 A;  1W5S A;  2HTS A;  3DPL C;  3QP6 A;  2A3S A;  2Z99 A;  2LKP A;  3K9T A;  3V7S A;  3I64 A;  5JFR A;  4OIO F;  4L5I A;  2ELH A;  4WCG A;  4N9I A;  1S7O A;  4CIC A;  3QOP A;  5LEK A;  1PP7 U;  2F5D A;  2CSO A;  3BPV A;  3WTS C;  1HW5 A;  2JSC A;  1QNT A;  2EWN A;  1SAX A;  5JVT A;  5DD4 A;  1XDU A;  1Z05 A;  3BJ6 A;  2DPU A;  4S05 A;  1IN7 A;  4IRG A;  4EMS A;  2YPR A;  4RAZ A;  1U5T C;  2L01 A;  1V3F A;  3T5X A;  4I02 A;  3J80 Z;  3KET A;  3JTG A;  3DP7 A;  2XAJ A;  1KA8 A;  2V6C A;  4KA4 A;  3VFZ A;  1R23 A;  2NAZ A;  4BH9 A;  4IHS A;  1G3T A;  1L0O C;  1WKM A;  4P9F A;  1HKT A;  3R4K A;  4MNU A;  1QO0 D;  2Z5U A;  3R61 A;  4UHT A;  3L2C A;  1LDD A;  1U8R A;  2F5C A;  1XCV A;  1IXR C;  3HRS A;  3PQK A;  4HV6 A;  1KQ9 A;  2ZXJ A;  5D4R A;  4I09 A;  4BAY A;  1XCB A;  1Z91 A;  2IJL A;  4OIR F;  4HLX A;  3OV8 A;  4BNC A;  2M5W A;  3L00 A;  3NRV A;  1KU7 A;  2RVC A;  3ULQ B;  1KYZ A;  5LHI A;  1R1U A;  1T39 A;  2ACJ A;  3U9G A;  4L9N A;  1FX7 A;  2X0L A;  1C0W A;  2XAH A;  5H6Q A;  2STT A;  4GYG A;  2HEO A;  1H9G A;  3GEZ A;  5HOO A;  5FD5 A;  3KZZ A;  3GXO A;  4UXN A;  5LHH A;  4LK1 F;  4KT5 C;  4EGZ A;  2IA1 A;  4BHP A;  1W7P B;  5DUI A;  4MQV A;  4NHJ A;  1OR7 A;  2Q2E A;  2Q8K A;  1GXP A;  3F8N A;  4HV5 A;  3E6M A;  2KJB A;  1EH8 A;  1O57 A;  2V79 A;  2ZFW A;  4O6J A;  3O2P E;  5LEJ A;  3EYI A;  2A69 F;  1FSE A;  2M87 A;  2LF8 A;  5KVR A;  4EJO A;  3I53 A;  1X3U A;  2VBZ A;  3QPT A;  3M8E A;  1ZAR A;  2DT5 A;  4HQE A;  4R1H A;  2IA2 A;  1XD7 A;  1Z6R A;  1P4W A;  1YW7 A;  2ZNZ A;  4XSX F;  1ON2 A;  4B8X A;  1S3J A;  2Z33 A;  3BPX A;  1U6G A;  3HTS B;  2P4W A;  2YSR A;  4GCV A;  3EYY A;  4HX7 A;  3WTZ A;  3WTV C;  1IN5 A;  3RPQ A;  1F5T A;  3HUG A;  5CYV A;  3T1B A;  2MH9 A;  3F72 A;  1OKR A;  4OOI A;  2A07 F;  3LAJ A;  3DV8 A;  3QPH A;  1IAW A;  2Q0O A;  2RNJ A;  2P5K A;  4UVA A;  1YW9 A;  4A5N A;  2HR3 A;  4IRI A;  1R7J A;  5ILV A;  4ZYG A;  2MBF A;  1U5T A;  1GVJ A;  2W57 A;  1XSD A;  5ICE A;  3EDP A;  2JT1 A;  3K0L A;  4I98 B;  3LWF A;  5TRD A;  4EM2 A;  3IWF A;  1QPM A;  1WRJ A;  1RUN A;  4LLG F;  2Y0M A;  3GF2 A;  1IXC A;  4HBL A;  1UHM A;  5D5X B;  1FBQ A;  5IT9 Z;  4MHG A;  1H9T A;  2HFH A;  1ZAO A;  5HDG A;  4RB3 C;  4HOB A;  2Z3Y A;  1NHA A;  3WGH A;  2EA2 A;  5E20 A;  5L3G A;  3ZMD A;  2G7U A;  3L7W A;  1D3Y A;  3Q5F A;  5ILS A;  1OPC A;  5HLH A;  3ZN0 A;  2WV0 A;  3IWZ A;  3MCZ A;  1XDS A;  5K5O A;  1ZLK A;  2QBY A;  1O3T A;  1WSU A;  1IN8 A;  3BJO A;  3EUH A;  2BGC A;  2PLY A;  1SFX A;  2CW0 F;  2D1V A;  2R7D A;  3HSR A;  4O5V A;  5F1R A;  1P2F A;  2IPQ X;  4TV7 A;  1ZHF A;  3PQJ A;  1FYM A;  1YIO A;  3MEX A;  1K7A A;  2W85 A;  5A2Q Z;  1WI9 A;  3K1P A;  3DEU A;  4I7H A;  2A5Y B;  1XGO A;  2FF4 A;  1SMY F;  4A0Z A;  2KRF A;  2XRN A;  2L3D A;  2O6G E;  3CDH A;  2GA1 A;  1J75 A;  4AIH A;  4OMY A;  2P5V A;  4M9X A;  1MJ9 A;  2XGX A;  5HS7 A;  2DQL A;  3ROU A;  1FZP B;  1ZRE A;  2EFN A;  2GQQ A;  3ABT A;  4ZYD A;  4PGH A;  5DCM A;  2XAF A;  4BQA A;  3P9C A;  1YW8 A;  3HHH A;  3C7J A;  2BBY A;  4RB0 A;  2DW4 A;  3IC7 A;  1Z7U A;  3MAJ A;  5J8C A;  1SD6 A;  3RJP A;  1HKQ A;  3H3U A;  3GO5 A;  1GXQ A;  1DUX C;  3JAM Z;  1YS7 A;  3KP7 A;  3P9I A;  5J8F A;  1U2W A;  2ESN A;  5HLG A;  4LJZ F;  3I5U A;  1U5T B;  1OYW A;  4UVB A;  4YFN F;  3H3Z A;  4IPA A;  2P8T A;  4KMU X;  2BYV E;  2PEX A;  4K2E A;  3E5Q A;  4XBF A;  4P55 A;  4A6D A;  2HYG D;  4O3M A;  3BOQ A;  1B9N A;  4RS8 A;  5TJJ A;  1FOK A;  1P92 A;  5D5U B;  1O7F A;  3SQN A;  2RN7 A;  1TQI A;  2J5P A;  1REP C;  3K2Z A;  2IP2 A;  1P4X A;  2GXG A;  2FOK A;  1XGN A;  3JTH A;  2OBP A;  4BHB A;  4OIN F;  2OAZ A;  4LGW A;  3L9F A;  5F6F A;  1W5T A;  4AVP A;  4ESB A;  4PGG A;  2FXA A;  2DK8 A;  2K27 A;  4HF1 A;  5AIQ A;  4P96 A;  1J5Y A;  2QBY B;  4CHU A;  3I71 A;  1TNS A;  1T6S A;  4G6D A;  5E1Z B;  5A2Q K;  1R5G A;  4A6E A;  1O3S A;  1OYI A;  2O8X A;  3M1E A;  3LFK A;  3F3X A;  3FXR A;  3ZMT A;  2VON A;  2FQ3 A;  1UFM A;  3KFW X;  2IW5 A;  1BI1 A;  2O3F A;  2R3S A;  3IHU A;  3KCC A;  2VE9 A;  1LVA A;  1MJA A;  3T8T A;  5ICC A;  2MC3 A;  2DO7 A;  2UXN A;  4DQ2 A;  1B6A A;  1BI3 A;  4JBA A;  1TTY A;  5JHU A;  2COM A;  1W4M A;  2DFI A;  3BWG A;  5E18 F;  2PBI A;  5HDK A;  3E97 A;  2CWE A;  2FMY A;  2NYX A;  4G7Z F;  5CVJ A;  1R5H A;  4ESJ A;  2QM3 A;  3JAM K;  5DCM B;  4OIP F;  1R36 A;  2E7X A;  4ON0 A;  1F9N A;  2ZBK A;  2K4J A;  1JXS A;  4MGR A;  2OZU A;  3FM5 A;  4HAM A;  3BDD A;  5DDG A;  2OQR A;  3FX3 A;  1QGP A;  1KU2 A;  1Z6T A;  1T2K A;  3LA7 A;  1ZG1 A;  2BV6 A;  2E1C A;  4RGX A;  3E3V A;  2L54 A;  1RIO H;  3RDI A;  3WOD F;  3WU0 A;  1T98 A;  2KIM A;  1BIA A;  2STW A;  4HF2 A;  1TBX A;  5CVI A;  4GYI A;  2LNB A;  2DLL A;  4CGZ A;  4QWQ A;  3RI4 A;  3P7N A;  2FBK A;  5LGT A;  1DDN A;  3BP8 A;  3I58 A;  2K4B A;  3CUQ C;  4FHT A;  4EJV A;  1G3W A;  3TQN A;  1R22 A;  4I0A A;  2QLZ A;  1V4R A;  1FWZ A;  1KU3 A;  4R79 A;  1Z9C A;  2VBW A;  3K1N A;  5J6X A;  2HQR A;  1LB2 A;  2M1B A;  4ENM A;  4ETS A;  1JE8 A;  1KYW A;  3F8M A;  3V7R A;  2ZKZ A;  3N97 A;  3F23 A;  3J81 Z;  5L3C A;  3NQO A;  2EJR A;  2LSO A;  3GZ5 A;  4HDV A;  1ZGJ A;  5E8G A;  2RDP A;  3KLN A;  3ZMV A;  2PJP A;  1FC3 A;  3FMS A;  4WX9 A;  4YG2 F;  4D0P A;  2NS0 A;  3RYP A;  3H92 A;  2FRH A;  2BE5 F;  2UZK A;  4EM0 B;  1XGS A;  1SD7 A;  2VT3 A;  2WWY A;  3RKY A;  3TKY A;  2C6Y A;  1AWC A;  1MD0 A;  1R1T A;  2VC0 A;  2PN6 A;  4HDU A;  1UCR A;  3ECO A;  1FP2 A;  5E8I A;  2BEO A;  1Y0U A;  2GXB A;  1QZZ A;  4P9U A;  3JSO A;  3V8J A;  3LA3 A;  3REO A;  2RV8 A;  2WTE A;  4M6X A;  2NNY A;  3GLX A;  1HQC A;  1RZ4 A;  1Z1D A;  2JRT A;  4HLY A;  3WTU C;  2IRF G;  1IRF A;  3G73 A;  4EVI A;  2P6T A;  2NNN A;  4M9S A;  4L0Y B;  3WTY C;  1MJB A;  1OYY A;  2L02 A;  3IRQ A;  1B1B A;  3M9A A;  2XAQ A;  2HKX A;  5LGU A;  4LB5 A;  4MTD A;  4IJA A;  2HDC A;  1I1G A;  4PZJ A;  3WG9 A;  2KKO A;  4M73 A;  3BRO A;  3I0T A;  1U3E M;  2EFP A;  5L3E A;  1FBS A;  4G8X A;  2A6H F;  3AAF A;  1XSV A;  4GO1 A;  5CJ9 A;  1HKS A;  2EV0 A;  3E5U A;  4CO8 A;  4ZZD A;  1ZYR F;  2CGP A;  2GAU A;  2NRA C;  3LST A;  1FLI A;  3J81 K;  1KU9 A;  2E7W A;  1TLH B;  2QZ8 A;  3CUQ A;  4M72 A;  5K1Y A;  2MLG A;  5E1W A;  2O61 A;  1BN5 A;  2YR2 A;  3JSP A;  2A68 F;  3J80 K;  1S29 A;  4M74 A;  5JI6 A;  2CO5 A;  1DPR A;  4A5M A;  3C1D A;  1S6L A;  1CF7 A;  1E17 A;  4FT8 A;  2F5F A;  3TGN A;  4H0E A;  2QWW A;  3KP4 A;  2OA4 A;  2WC2 A;  1R00 A;  5H20 A;  2VOD A;  4ZYH A;  1MGT A;  2OD5 A;  4M9Z A;  1ODD A;  2P6S A;  4KFC A;  4G94 A;  2RC4 A;  3F22 A;  4G7O F;  1DP7 P;  3V8K A;  1FPQ A;  4HQM A;  3ZPL A;  5D4S A;  3GWZ A;  4PDK A;  5AIP A;  1FYK A;  1QZY A;  3HHG A;  1IUY A;  4JQF A;  1LJ9 A;  1I5Z A;  1EV7 A;  4DNC A;  4IF4 A;  2ZJ2 A;  1K79 A;  3B02 A;  2EFW A;  4I0B A;  2VE8 A;  3V7C A;  4EM1 A;  2K7L A;  2VBX A;  4L0Z B;  4MQ9 F;  2Y48 A;  1L3L A;  4A0X A;  4EJT A;  4BHC A;  3FXU A;  2IT0 A;  3L09 A;  4U0V A;  5BMZ A;  3I54 A;  1MDM B;  4KN4 X;  4ENJ A;  5D6E A;  2EV5 A;  1F4K A;  4ESF A;  5HDN A;  2PMH A;  3U1D A;  3GVA A;  2MA3 A;  1XGM A;  3HYI A;  3CUO A;  4Y17 A;  3FMR A;  3WE2 A;  2XRO A;  1J9I A;  5FLX Z;  4M71 A;  1HBX G;  5DEQ A;  2D1H A;  2A6E F;  1FP1 D;  1PUE E;  2GWR A;  3GYH X;  4N0B A;  4QLC U;  4KIC A;  1XMA A;  3R60 A;  1WQ2 A;  4L5J A;  2KIU A;  2VOO A;  4CDG A;  4CYD A;  2FA5 A;  3OOP A;  3DPT A;  3CUQ B;  5D5V B;  2JPC A;  3SXY A;  2DI3 A;  1SFU A;  4HA8 A;  1XN7 A;  4U7B A;  1S8N A;  2O0Y A;  2MLK A;  5HLI A;  1ZLJ A;  1SD5 A;  1I27 A;  4E70 A;  4Q5S F;  1CF7 B;  1ONV A;  1J0R A;  5IT9 K;  2W84 A;  2PG4 A;  3BY6 A;  4U7D A;  2HGC A;  3F6O A;  2ETH A;  4AWX B;  4HZF A;  4YFX F;  4LLL A;  2DPD A;  2TDX A;  5BS6 A;  2H6C A;  2GIV A;  4N9H A;  4LFU A;  3GUD A;  4RGS A;  1QBJ A;  1LDK B;  4LG0 A;  3TOA A;  2CQK A;  1T38 A;  2XKO A;  3DQV C;  1ZRC A;  5FO5 A;  5FFX A;  5H6R A;  3E6C C;  3MQ0 A;  2HWV A;  5D6F A;  5K5Q A;  3RTR A;  2FBH A;  1B59 A;  1P4A A;  1MZB A;  4RGU A;  3WU1 B;  2YX4 A;  3K69 A;  1LEB A;  1USS A;  2VT2 A;  2FEZ A;  1P6R A;  1VTN C;  1T0F A;  5LHG A;  4HW0 A;  3CO6 C;  1ON1 A;  4MEY F;  5AON A;  1BIB A;  1TQP A;  1BC8 C;  6PAX A;  1XSX A;  3GFM A;  4F7Z A;  2QQA A;  3WTT C;  2D2W A;  2YU3 A;  5FLX K;  2XHK A;  2ZNY A;  1QQI A;  5L3F A;  3TOB A;  2GA2 A;  2IVM A;  3F21 A;  2XAS A;  2P5L C;  1J59 A;  4NQW A;  1FSH A;  3ERE D;  3C3W A;  1S7A A;  2W25 A;  3MZY A;  5KK1 A;  3E6D A;  2AXL A;  1W7P D;  3GW2 A;  1ZG5 A;  2QEN A;  3R0J A;  5E17 F;  3WTW C;  3HRT A;  1R1V A;  4UNO A;  3ISP A;  3TDU C;  2VOP A;  1U78 A;  3I59 A;  4HX4 A;  4KIB A;  4HYE A;  1FNN A;  1IN6 A;  4KYW A;  1D8K A;  1ULY A;  1K78 A;  2UWM A;  2LDU A;  1O7L A;  2D45 A;  4GGG A;  1D8J A;  1BC7 C;  5LLQ A;  2O03 A;  4IHT A;  4GXO A;  2DQR A;  3IKT A;  3W6J B;  2A61 A;  4G7H F;  3VEP A;  1YTY A;  1AOY A;  5CVV A;  2G7H A;  4EQQ A;  4B09 A;  3HSE A;  5LGN A;  3JW4 A;  4ZYE A;  4M6Y A;  3F8C A;  1SD4 A;  4XRF A;  3J7A O;  5DD8 A;  4LG0 B;  3ZMS A;  4MTE A;  4OMZ A;  4RB2 C;  1TQM A;  3FM3 A;  3ZQ7 A;  4UVC A;  4EV0 A;  1B4A A;  2AS5 F;  4NB5 A;  3M7G A;  4OIQ F;  1HST A;  2K86 A;  2EA4 A;  2LF7 A;  4WWC A;  3QRF F;  1ZH5 A;  3LQQ A;  2MD5 A;  2H09 A;  2HOE A;  2FBI A;  4LB6 B;  4L9T A;  2EK5 A;  4XLN F;  1ZRF A;  1Q1H A;  1R58 A;  3QP5 A;  1UB9 A;  1O3Q A;  1FYL A;  2CG4 A;  2HYF A;  1YG2 A;  5BOX A;  2ZO4 A;  2XIG A;  3F8B A;  1HW2 A;  4OU0 A;  4WXH A;  1J7K A;  3ML6 A;  2ZME A;  4BXU A;  1UST A;  3R0A A;  3HRU A;  2X4H A;  3WE3 A;  3WGG A;  2F5E A;  5EEH A;  3D5L A;  5L3D A;  2FNP A;  5D5W B;  1LQ1 A;  2Z9O A;  4L9J A;  2F2E A;  4YII A;  5LRS A;  3GZ6 A;  1IF1 A;  1SFE A;  3ZMZ A;  3TDZ C;  4AIJ A;  3KP5 A;  3COA C;  3B73 A;  3VOD A;  3BJA A;  2G9W A;  4IXA A;  4HX8 A;  5FD6 A;  2YX7 A;  3KEO A;  4Q4Z F;  4KNY A;  2XUB A;  2QQB A;  5IT3 A;  1F1Z A;  3FMQ A;  3MZH A;  3KE2 A;  1XB4 A;  3HOS A;  4P5O A;  4UV9 A;  3ZN1 A;  3KEQ A;  1MDM A;  4WXD A;  5BPD A;  5D8K B;  3I59 B;  3VB2 A;  2V9V A;  3RPU A;  5JR3 A;  3ZP5 A;  2RKH A;  2XAG A;  3FXQ A;  1LEA A;  2FSW A;  1K78 B;  2PQ8 A;  2KIF A;  1ZN2 A;  1YS6 A;  2XVC A;  2EFO A;  4G6Q A;  4KUM A;  3VOE A;  5DCF A;  1JHF A;  2QVO A;  4ENK A;  3D0S A;  3PFI A;  5HVQ C;  4Y15 A;  4Q47 A;  5L3B A;  2J5O A;  3ECH A;  2H6B A;  4YIF A;  3TO7 A;  4U88 A;  4CXF A;  2HS5 A;  3HSF A;  4IVN A;  4G9Y A;  3C18 A;  5FB2 A;  5D8L B;  2JZY A;  1YLF A;  5ILU A;  3FWE A;  1XMK A;  4S04 A;  4KN7 X;  1E2X A;  3RKW A;  1TW2 A;  1KQ0 A;  1TNT A;  3KZY A;  2EFQ A;  2H94 A;  2DTR A;  1UHW A;  3E6B A;  4L18 B;  3LAP A;  1FT9 A;  4IRH A;  1GHC A;  2P7C B;  5E1X A;  2OU2 A;  3SFZ A;  1HSJ A;  4Z2Y A;  4ENN A;  1KGS A;  2DK5 A;  4UUV A;  4LD5 A;  3O6B B;  4UV8 A;  1TW3 A;  2CYY A;  2VN2 A; 
#chains in the Genus database with same CATH topology
 3TP3 A;  2PFB A;  2GZW A;  2HXI A;  3BR0 A;  4C3H J;  2KLO A;  1IDZ A;  4I99 C;  5K5R A;  1YYV A;  2ZME B;  2M8E A;  1Z7L A;  2V1X A;  2WY8 Q;  4CZZ A;  3OR1 C;  2ZCW A;  3KYD B;  2FOW A;  2K9Q A;  1T95 A;  4XLP F;  2IA0 A;  2UXX A;  3ZMU A;  3D1N I;  2NVY J;  3WTX C;  2L9V A;  3P9K A;  1WPK A;  1MKM A;  3EET A;  1HW1 A;  3G3Z A;  3HGY A;  3ZQF A;  4X0G A;  1OMI A;  2DA4 A;  2DU9 A;  1I6X A;  2PX9 A;  2KRC A;  3KPH A;  2QUF A;  3KP6 A;  1YJW I;  4EJU A;  2BY3 A;  2Y9Y A;  3GTG J;  3LA2 A;  4I76 A;  3BZK A;  2IBD A;  2XB5 A;  1RNL A;  1LE8 A;  2FU4 A;  5CKT A;  4BQO A;  3H9J A;  2F5V A;  2M45 A;  5FRN A;  3CCV I;  4AIK A;  2M2E A;  3GFL A;  4RM3 A;  5HOD A;  3N4M A;  3HIF A;  1H0M A;  3F8F A;  5M5W J;  2ADU A;  3ELK A;  1YIT I;  1BR4 A;  3RKX A;  3SDG A;  1PUF B;  2PMZ N;  4BE1 A;  4I6Z A;  4PJ0 C;  1KZH A;  1ZRD A;  4J00 A;  3HOT A;  5EEA A;  3DXJ F;  4YFK F;  2EB7 A;  1B72 B;  2XPU A;  5LD2 C;  2LH9 A;  3ERM A;  4A93 J;  3CLO A;  3ONQ A;  3ZQI A;  4DZJ A;  1OFC X;  1BR2 A;  2R7F A;  3SEZ A;  1RI7 A;  1RR8 C;  1WWX A;  2HZT A;  2P7V B;  2XKP A;  5J40 A;  1PP8 F;  4LMY A;  4CCL A;  3MKZ A;  3WGI A;  4MEX F;  1BOA A;  2L4M A;  2B63 J;  2OQG A;  1IRG A;  3S3O A;  2ESH A;  3ABL H;  5E3M A;  2JUC A;  4XOR A;  3FHZ A;  2VJ5 A;  1D5V A;  4B3A A;  2E5N A;  2VXZ A;  3JRC A;  4A69 C;  4QIW N;  3CDI A;  4PCQ A;  4Q48 A;  2OTL I;  2X51 A;  2LKX A;  2DMN A;  2K02 A;  4A3G J;  3HOW J;  3GX4 X;  3TO6 A;  3MZ8 A;  4IOC F;  4E7H A;  5DV5 A;  3QQA A;  2ECC A;  1WH7 A;  1ZKG A;  2DDB A;  1YFH A;  3F6V A;  2KIQ A;  3KLO A;  3E5X A;  2PI0 A;  1IN4 A;  3K4K A;  4KIF A;  1VQM I;  4B4C A;  4IHX A;  1OJL A;  1Z0X A;  5DYM A;  1I1S A;  2IAI A;  3CJR B;  4BYY A;  3IL2 A;  1G4D A;  2X1C A;  2LOO A;  1IC8 A;  1BM9 A;  3BG6 A;  3M1C A;  1DPU A;  2W24 A;  4DYC A;  5LBQ A;  2DA6 A;  5JLX A;  4CH7 A;  3GTJ J;  3V8L A;  3D5S C;  4BBS J;  5FFZ A;  3FXL A;  4WK8 F;  4ASN A;  1RUO A;  3M3Y J;  3GFI A;  3BR6 A;  3I4P A;  3DTK A;  3O8H A;  5F64 A;  1DGR M;  1PVE A;  3NAU A;  1JGS A;  1R71 A;  4FX0 A;  3SHF A;  5BQT A;  1LNW A;  3R6S A;  5ED4 A;  4RBO A;  2L9R A;  3S1R J;  3DBH B;  1UG0 A;  2E60 A;  3HUG B;  1GV5 A;  2LRE A;  3O3K A;  4E7K A;  3S2W A;  3LSR A;  3OIP A;  5EEG A;  2B0L A;  1MMS A;  5K7H A;  3K1M A;  3HXL A;  1FOX A;  4YIR X;  4Y7N J;  5LRR A;  3EQL F;  4EGY A;  2ELK A;  4BGD A;  3KEY A;  1LFB A;  1IV6 A;  1WZ2 A;  1D0X A;  3QOD A;  4N4N B;  3LQR A;  4ZH4 F;  1EH7 A;  2VBY A;  4IHY A;  1B9M A;  3CLQ A;  4BE0 A;  4G6T B;  3ZGK A;  2BY2 A;  2MG4 A;  1MBJ A;  2VL8 A;  3G2B A;  3HOX J;  1KQ8 A;  3DF8 A;  1MNE A;  3GTM J;  1J2X A;  2CJJ A;  2ICW G;  3Q9V A;  2HTJ A;  3HEF A;  4PFO A;  3I56 I;  2R5Y B;  3K7A J;  1S72 I;  1POG A;  3IKV A;  2BW3 A;  3W6K B;  1FBU A;  2L4A A;  1JHH A;  3BCB A;  3G6E I;  4AD9 A;  2CUJ A;  2M7B A;  3FHN A;  1EH6 A;  2VOO A;  2DBB A;  1FMV A;  1G3Y A;  3MWM A;  2RQQ A;  3Q0V A;  3OYM A;  3CTA A;  1IXS B;  3FF5 A;  2IS1 A;  3OYA A;  5M5X J;  3NEU A;  1K4T A;  2QQ9 A;  3SZP A;  1YQA A;  2VJI A;  3KP2 A;  2Y2Z A;  2BZT A;  2HNH A;  4IKF A;  4JK1 X;  1I3Q J;  2JSP A;  2MH2 A;  2LY9 A;  2WAE A;  1GDT A;  2DA5 A;  4A3I J;  3JRA A;  1R49 A;  3HOV J;  2KJC A;  2M30 A;  1HXD A;  5CVR A;  3CO7 C;  3FZV A;  5DUK A;  2R7Z J;  4HRI A;  4AM3 A;  1BBY A;  1VZ0 A;  1LE8 B;  3V4G A;  4KMF A;  4FX4 A;  5FRM A;  2QYO A;  2OZ6 A;  2EZL A;  2V9P A;  4HF0 A;  2FML A;  4NC7 A;  5CVU A;  2ISZ A;  1X4P A;  1GV2 A;  3OOU A;  3HRM A;  2MAB A;  4LLN A;  2FX0 A;  2YS9 A;  3IRR A;  3CMY A;  4A0Y A;  3GTK J;  3MFK A;  1MNM C;  2Y69 H;  2BVL A;  3PNV A;  3T8R A;  2NOG A;  3QAH A;  5CLS A;  4DBQ A;  2H1K A;  2EV6 A;  1BI0 A;  1JT6 A;  3IH2 A;  2DMU A;  2RNG A;  5BPI A;  2ID6 A;  1ERD A;  4LK0 F;  4C2M J;  2H27 A;  3QU6 A;  1OCP A;  1RET A;  3F9K A;  2ISY A;  4A12 A;  4II3 A;  3BT9 A;  3AG4 H;  2JPB A;  3ABM H;  1PDN C;  4B3X A;  2VC1 A;  1IW7 F;  3QU3 A;  4UUS A;  3T0Y A;  3HTU A;  1H88 C;  3BC8 A;  5GAD J;  3SZT A;  2V1U A;  1V5E A;  4Y4R A;  4IHW A;  1WCM J;  2FE3 A;  1ZGA A;  2XSJ C;  5GAH J;  4BKX A;  3CF5 F;  2RGV A;  3CC2 I;  1S5L C;  2F4I A;  4BJ5 C;  3BZ6 A;  4WXC A;  3DU5 A;  2ELJ A;  4OAZ A;  2L9N A;  4XNF A;  4R8H A;  4DW6 A;  1VQ7 I;  2V1D A;  1N78 A;  1RES A;  3Q9S A;  4EEF G;  5ICF A;  3RYR A;  1BI2 A;  2RQP A;  3BQY A;  1JKO C;  3S3N A;  5TGT A;  1K6O A;  5HS8 A;  4RAY A;  4BDZ A;  4EJW A;  4WF2 A;  1IZ1 A;  2XPV A;  4ZYA A;  3U2R A;  3B6A A;  4L9V A;  3RIR A;  4B48 A;  2XB0 X;  3B6C A;  2HKO A;  2CFX A;  4ZZL A;  2CMP A;  3K4M A;  4U0W A;  2K5C A;  2R7W A;  3ABU A;  3ZQH A;  2IEK A;  1MBH A;  1UHS A;  4GFB A;  1G2H A;  2KDO A;  1G6N A;  3TO9 A;  4U0Y A;  2JVG A;  1STZ A;  2DA2 A;  1TC3 C;  4I2O A;  2E1N A;  3ZQG A;  4RGR A;  4A2U A;  4RB1 A;  1BJA A;  2FNA A;  3KIO A;  1CGP A;  2ZFU A;  5FGM A;  4KDP A;  1MMA A;  3EUK L;  1W7P A;  1WH5 A;  2IXS A;  1LDJ A;  3DFG A;  4Y13 A;  4KIG A;  1BOB A;  3I9V 2;  4Z6Y A;  2HQN A;  1OR7 C;  4PJM A;  2XV4 S;  1R6R A;  1ZG3 A;  1D0Y A;  2DAO A;  3FDY A;  2W1O A;  2JTV A;  3GFJ A;  4JYK A;  4NC6 A;  3LSH A;  3CCM I;  3KP3 A;  1D1B A;  1A04 A;  2EIM H;  1G3S A;  1JI8 A;  1SMT A;  2BVM A;  4I01 A;  3CJN A;  1O3R A;  1TT5 B;  5ICG A;  2LTP A;  3DKW A;  5HS9 A;  2PMU A;  5ERI A;  4QPQ A;  3FIW A;  4RM2 A;  3M8F A;  3DLA A;  3CCJ I;  1JTX A;  4XSZ F;  3ZQL A;  1MSE C;  2IGM A;  1FY7 A;  3H9G A;  3OYL A;  2Y75 A;  1W5S A;  2HTS A;  3DPL C;  3QP6 A;  4XLH A;  4XLE A;  3HGG A;  2A3S A;  1WJF A;  2Z99 A;  1N75 A;  2LKP A;  3K9T A;  3V7S A;  4AUX A;  3I64 A;  5JFR A;  3J7Z I;  4E7J A;  4OIO F;  2DMP A;  3S1N J;  4L5I A;  2IS4 A;  2ELH A;  4WCG A;  2V6E A;  4N9I A;  1S7O A;  4CIC A;  1AA7 A;  3CCL I;  3QOP A;  1TWG J;  2JA8 J;  3DBR B;  5LEK A;  1PP7 U;  2F5D A;  2CSO A;  3TBI A;  4M3E A;  2XSD C;  4NC8 A;  5TIS C;  1K83 J;  1WVR A;  1MH3 A;  2OV7 A;  4HNV A;  4CCN A;  2H8R A;  2ID3 A;  1Z21 A;  1HW5 A;  2JSC A;  1QNT A;  3BPV A;  3WTS C;  2EWN A;  3S3M A;  1SAX A;  2VQL A;  4GDF A;  5JVT A;  5DD4 A;  1XDU A;  1Z05 A;  3CCQ I;  1JUS A;  3G1L A;  3BJ6 A;  4XKC A;  2DPU A;  2L2O A;  2R0Q C;  4S05 A;  1X3Z B;  1IN7 A;  4YEJ A;  4IRG A;  3ZQQ A;  3L1P A;  2PJR A;  4EMS A;  2M3A A;  2YPR A;  4RAZ A;  1U5T C;  2ZXW H;  2L01 A;  1JKQ C;  1V3F A;  4BQN A;  3T5X A;  1PJR A;  3BTJ A;  4I02 A;  3J80 Z;  3PO2 J;  3MKL A;  3KET A;  3JTG A;  1YRN A;  3DP7 A;  2XAJ A;  1KA8 A;  2V6C A;  4KA4 A;  3VFZ A;  4NBQ A;  1R23 A;  2NAZ A;  4BH9 A;  4IHS A;  4M3F A;  1G3T A;  3FXK A;  1L0O C;  1WKM A;  4P9F A;  1HKT A;  3R4K A;  4DIQ A;  4MNU A;  1LUJ B;  1QO0 D;  2Z5U A;  4D5C A;  1U8B A;  3ZQC A;  3R61 A;  4UHT A;  3L2C A;  3DTE A;  2JA7 J;  3H0G J;  2DOD A;  1LDD A;  1U8R A;  2F5C A;  2X6W A;  1XCV A;  1IXR C;  3HRS A;  3PQK A;  4HV6 A;  1KQ9 A;  2ZXJ A;  5D4R A;  3E1S A;  4I09 A;  4UUS B;  4BAY A;  1XCB A;  4HG2 A;  2XGD A;  1Z91 A;  2IJL A;  4OIR F;  4HLX A;  3OV8 A;  2AXT C;  3ZCO A;  2R7V A;  4BNC A;  2M5W A;  3L00 A;  1TWH J;  2LY2 A;  3CZ6 A;  4AU7 A;  3NRV A;  1KU7 A;  2RVC A;  3ULQ B;  1KYZ A;  5LHI A;  3HG9 A;  3HPG A;  1R1U A;  1F36 A;  1T39 A;  2ACJ A;  1RR7 A;  3U9G A;  1PUF A;  4L9N A;  3LFU A;  1FX7 A;  2X0L A;  3VYT B;  1C0W A;  1N25 A;  2XAH A;  2LKS A;  3CME I;  2VQG A;  1ZQ3 P;  1H89 C;  5H6Q A;  4PSW A;  2STT A;  3H35 A;  5GAG J;  3F0C A;  1JUP A;  2L7F P;  1WGX A;  3JRI A;  1HOM A;  4GYG A;  1TWC J;  2HEO A;  1TP4 A;  1H9G A;  3VDX A;  3GEZ A;  1MIJ A;  5HOO A;  4A3M J;  5FD5 A;  2E35 A;  3KZZ A;  4ANJ A;  3GXO A;  1ETQ A;  2K85 A;  3HC7 A;  4UXN A;  5LHH A;  4LK1 F;  1BJZ A;  4KT5 C;  4EGZ A;  2IA1 A;  4P1W A;  2OC6 A;  2L7M P;  4FQG A;  5CQG A;  3OY9 A;  2E1M B;  2HYJ A;  4BHP A;  1W7P B;  5DUI A;  3K6G A;  3Q0U A;  4MQV A;  3U21 A;  4NHJ A;  1E3P A;  1NTC A;  1OR7 A;  3CMM A;  3LSK A;  2Q2E A;  2Q8K A;  1GXP A;  3F8N A;  2EH3 A;  4HV5 A;  3E6M A;  1K4S A;  2KJB A;  1EH8 A;  5LFA A;  1O57 A;  4DYQ A;  2O8K A;  2V79 A;  2ZFW A;  1OCR H;  3O2P E;  4O6J A;  3MMY B;  2KQR A;  5EZG A;  4A3L J;  2DYS H;  5LEJ A;  3MKW B;  3EYI A;  2A69 F;  5M3F J;  2G0E A;  1FSE A;  2M87 A;  2LF8 A;  4PJL A;  5KVR A;  4EJO A;  3A0B C;  5IYB J;  2ME0 A;  3I53 A;  4RAG A;  1X3U A;  3AL0 B;  2VBZ A;  3LSJ A;  3QPT A;  3M8E A;  1ZAR A;  2DT5 A;  5F04 A;  4HQE A;  4R1H A;  2AHQ A;  2IA2 A;  3Q3S A;  4XOT A;  1XD7 A;  1D5Y A;  1A31 A;  1Z3Y A;  1Z6R A;  3FXM A;  1P4W A;  1YW7 A;  2WAF A;  5B66 C;  2ZNZ A;  1IDY A;  4XSX F;  1ON2 A;  5FKL A;  3JRD A;  4B8X A;  1S3J A;  4B43 A;  2Z33 A;  3BPX A;  4HSR A;  2M0M A;  1U6G A;  3HTS B;  2P4W A;  2YSR A;  4GCV A;  3W2A A;  3EYY A;  4HX7 A;  2L5Q A;  3WTZ A;  3WTV C;  4II2 A;  1IN5 A;  3RPQ A;  1F5T A;  2CUF A;  3HUG A;  5CYV A;  3VSL A;  2HPM A;  3T1B A;  2MH9 A;  2DTZ A;  1OKR A;  1MND A;  3F72 A;  3O8G A;  5KAF C;  1N77 A;  4OOI A;  1XMX A;  4QPO A;  2A07 F;  3LAJ A;  5C4X J;  3DV8 A;  3QPH A;  3ZXS A;  3TW7 A;  1IAW A;  2Q0O A;  2RNJ A;  4F52 A;  1LFU P;  4NUB A;  2CQQ A;  2P5K A;  4B1R A;  4UVA A;  2LY1 A;  4QTR A;  4IZZ A;  1YW9 A;  4XN3 A;  4A5N A;  2HR3 A;  2E2I J;  1R7J A;  5ILV A;  4ZYG A;  4IRI A;  3OYG A;  2MBF A;  1U5T A;  1GVJ A;  2LG4 A;  2W57 A;  2PJR B;  1XSD A;  5ICE A;  2I5U A;  3NAR A;  3EDP A;  2JT1 A;  3H5A A;  2QSG X;  3K0L A;  4I98 B;  3DKX A;  3LWF A;  3K2A A;  2FJ1 A;  4CUG A;  2XDV A;  1R4N B;  1JJ6 C;  4AID A;  5TRD A;  2WB1 N;  2K9M A;  4EM2 A;  2R5Y A;  3IWF A;  1QPM A;  1WRJ A;  1RUN A;  4LLG F;  1YRN B;  2Y0M A;  5C44 J;  2ME6 A;  3GF2 A;  2DOA A;  1ZGW A;  1IXC A;  2FUG 2;  3QYE A;  3CC7 I;  3S15 J;  4HBL A;  1UHM A;  5D5X B;  4RLQ A;  1DU0 A;  1FBQ A;  5IT9 Z;  4MHG A;  2DT6 A;  1H9T A;  2HFH A;  3VYR B;  1ZAO A;  5HDG A;  2VKV A;  2KT0 A;  2Y31 A;  3DBL B;  4UUT A;  4RB3 C;  4HOB A;  3EUA A;  2Z3Y A;  1TWF J;  1QZE A;  1NHA A;  3WGH A;  2EA2 A;  5E20 A;  5L3G A;  3ZMD A;  3H0D A;  2G7U A;  3L7W A;  2GM4 A;  1D3Y A;  2ZB9 A;  4KT6 A;  3Q5F A;  5ILS A;  3ASN H;  1OPC A;  5HLH A;  3OYD A;  2WV0 A;  3ZN0 A;  3QPS A;  3IWZ A;  3MCZ A;  3FKJ A;  3JRE A;  1XDS A;  5J47 A;  5K5O A;  1ZLK A;  2QBY A;  4A3C J;  3DU6 A;  4M3D A;  5IY5 H;  2A6T A;  1O3T A;  1WSU A;  3S2D J;  1IN8 A;  3BJO A;  3EPZ A;  3EUH A;  2BGC A;  2PLY A;  5BNG A;  2R7O A;  1SFX A;  2CW0 F;  2D1V A;  2R7D A;  3QPL A;  3HSR A;  4AYB N;  4O5V A;  5F1R A;  1P2F A;  2IPQ X;  4TV7 A;  2W48 A;  1ZHF A;  5DM7 F;  5EG0 A;  3PQJ A;  3KYL A;  1Z77 A;  4Y3O A;  3OYK A;  1FYM A;  1YIO A;  2TCT A;  5E79 C;  3MEX A;  3K4B A;  1E3H A;  4CYC B;  1W36 D;  3DKY A;  2LYC A;  1K7A A;  2W85 A;  3LNQ A;  3C2G A;  4DZP A;  5A2Q Z;  1OCO H;  1WI9 A;  3K1P A;  2LFB A;  3DEU A;  1EF4 A;  3V42 A;  2QCO A;  4I7H A;  1KON A;  2A5Y B;  1YOV B;  1XGO A;  4CZC A;  2FF4 A;  1ZR2 A;  1SMY F;  4A0Z A;  1BW6 A;  2KRF A;  2XRN A;  2Q2E B;  4DBR A;  3G71 I;  2L3D A;  2O6G E;  3RZO J;  3C2B A;  3CDH A;  1V55 H;  2GA1 A;  3ZOB A;  3BR5 A;  2RAE A;  1J75 A;  3CCE I;  4AIH A;  2HDD A;  4OMY A;  2P5V A;  5C4J J;  4M9X A;  1MJ9 A;  2VI6 A;  2XGX A;  5HS7 A;  3AKZ A;  1HA8 A;  2B7E A;  5FLV A;  2L0K A;  2DQL A;  2L7Z A;  3ROU A;  3OYI A;  4IX7 A;  1FZP B;  1YX3 A;  2EPF A;  2EZH A;  1ZRE A;  2EFN A;  2GQQ A;  3K4C A;  3ABT A;  4ZYD A;  4PGH A;  5DCM A;  2CQN A;  2HOS A;  3L2Q A;  2KL4 A;  1T08 B;  2F4M B;  2QQ8 A;  4FET A;  2XAF A;  1X19 A;  1Q1V A;  4RDU A;  4BQA A;  2VAS A;  2P81 A;  3K10 A;  3P9C A;  1YW8 A;  3HHH A;  1A36 A;  4FAS D;  2W4S A;  3BR1 A;  2E1M C;  3C7J A;  5IYD J;  1WJC A;  2BBY A;  1FMW A;  2IGN A;  4RB0 A;  2DW4 A;  3IC7 A;  1Z7U A;  4MO7 A;  3MAJ A;  5J8C A;  1SD6 A;  3N05 A;  3RJP A;  1HKQ A;  1G8X A;  3VSK A;  3H3U A;  4L5E A;  2HOT A;  3GO5 A;  1GXQ A;  1DUX C;  3JAM Z;  2JMW A;  2M9H A;  1YS7 A;  2QSH X;  3KP7 A;  1VFC A;  2VIX A;  4BQQ A;  1YIJ I;  3P9I A;  3W2V A;  5FKO A;  3PFY A;  1UMQ A;  5J8F A;  2KZG A;  1Y6I A;  4JX4 A;  1U2W A;  2ESN A;  3GLL A;  3AL0 C;  3S17 J;  5HLG A;  1FOW A;  2JA6 J;  4LJZ F;  3W6V A;  3I5U A;  1U5T B;  2DFH A;  1OYW A;  1ETW A;  3H5R A;  1ETX A;  4UVB A;  4YFN F;  2E2J J;  3H3Z A;  2H1L A;  4IPA A;  3PO3 J;  2P8T A;  3BG3 A;  3W3C A;  1H8A C;  4KMU X;  5DTD A;  5EF6 A;  2KPM A;  5FKM A;  2BYV E;  3UKG A;  3AFH A;  2QEX I;  3CD6 I;  2PEX A;  2LBF A;  4BY7 J;  4K2E A;  3H5N A;  3E5Q A;  1VQ8 I;  4XBF A;  4DGW B;  3NWS A;  4P55 A;  4A6D A;  3JRF A;  2HYG D;  4O3M A;  3BOQ A;  1B9N A;  4RS8 A;  5TJJ A;  3ESW B;  1P92 A;  5D5U B;  1FOK A;  1O7F A;  2ZJP F;  4ZTF A;  5FLM J;  3SQN A;  2RN7 A;  1TQI A;  2J5P A;  4FE4 A;  3PUF A;  3S32 A;  3SJM A;  1REP C;  3K2Z A;  1VQ6 I;  2IP2 A;  1P4X A;  5KNL A;  2CS3 A;  3HOY J;  2GXG A;  2FOK A;  1FEX A;  1XGN A;  3JTH A;  2OBP A;  4BHB A;  5B1A H;  4OIN F;  2OAZ A;  4LGW A;  3L9F A;  3TMO A;  1BW5 A;  5F6F A;  1W5T A;  4AVP A;  4ESB A;  4PGG A;  1JTY A;  2MSY A;  3GZN B;  2VPL A;  2FXA A;  4LIU A;  2DK8 A;  2K27 A;  4HF1 A;  5AIQ A;  4P96 A;  1J5Y A;  4XN0 A;  1OIS A;  2EZK A;  2JK3 A;  5FKK A;  2QBY B;  3HKZ N;  3SYT A;  4CHU A;  2CUE A;  4JP0 A;  3I71 A;  1VQL I;  1TNS A;  3UNG C;  1HCR A;  2F4O B;  2CV1 A;  1T6S A;  1RC9 A;  4S0H B;  4G6D A;  5F08 A;  5E1Z B;  3QWL A;  3L2R A;  3WU2 C;  1R5G A;  4A6E A;  5A2Q K;  1O3S A;  1OYI A;  3RQI A;  2O8X A;  2Q1Z B;  3JCU C;  3CP2 A;  1WFX A;  3QOE A;  3M1E A;  3LFK A;  2VKH A;  3F3X A;  3FXR A;  5EG0 B;  2ZSH B;  3ZMT A;  1ITY A;  2VON A;  1ZEL A;  4D9J A;  4M3B A;  2FQ3 A;  1S7E A;  1UFM A;  2K9N A;  2IW5 A;  3KFW X;  5HLT A;  1BI1 A;  2OTJ I;  4BUP A;  2O3F A;  5E3L A;  2R3S A;  5M3M J;  4C2T A;  3IHU A;  3KCC A;  2VE9 A;  2NS8 A;  1LVA A;  5F0F A;  1MJA A;  4HEA 2;  4FCY A;  3T8T A;  2HXO A;  1FIA A;  2DFE A;  4X1E A;  5M5Y J;  5ICC A;  1GVD A;  2KIS A;  2VQC A;  1UEL B;  2MC3 A;  2DO7 A;  4IQJ A;  2UXN A;  4DQ2 A;  1B6A A;  4KIT B;  3J7A Y;  1BI3 A;  2OCE A;  2ZXI A;  1TTY A;  4JBA A;  5JHU A;  2COM A;  2CU7 A;  1QRY A;  1W4M A;  2QGU A;  2DFI A;  4F93 B;  3BWG A;  3OMY A;  5IOY A;  4UB6 C;  1W1W E;  5E18 F;  2PBI A;  2D5V A;  5HDK A;  3E97 A;  3LSP A;  4E7L A;  2CWE A;  3SDB A;  2DT7 B;  2FMY A;  2NYX A;  3BTC A;  3CJQ B;  4G7Z F;  4A3D J;  1Y56 A;  2CFO A;  2E19 A;  1R5H A;  5CVJ A;  4ESJ A;  1Y8R B;  1FJL A;  4V2F A;  2QM3 A;  3JAM K;  2X48 A;  4ABZ A;  5DCM B;  2VXD A;  2XPW A;  4OIP F;  1R36 A;  5GTI C;  2R5Z A;  4BEH A;  4A3E J;  2E7X A;  1RKT A;  4ON0 A;  4BJ6 C;  1F9N A;  2JWT A;  2ZBK A;  1Y1V J;  2EIL H;  2K4J A;  1JXS A;  4Y52 J;  2YUS A;  4MGR A;  2OZU A;  3FM5 A;  5GP9 A;  4HAM A;  3BDD A;  5DDG A;  2R7X A;  4F92 B;  4GRI A;  2OQR A;  3FX3 A;  1QGP A;  1KU2 A;  1ORK A;  2WV1 A;  1Z6T A;  2Y0S N;  3FKI J;  1T2K A;  4BXX J;  3LA7 A;  1ZG1 A;  1ZR4 A;  5H2F C;  1R9T J;  4A3B J;  2BV6 A;  2E1C A;  3IP4 B;  2DMT A;  4RGX A;  3E3V A;  1A35 A;  2L54 A;  2DA7 A;  1RIO H;  3RDI A;  2KP6 A;  2LVS A;  1Y0N A;  1EKE A;  3WOD F;  2AO9 A;  1MW7 A;  3PSF A;  3WU0 A;  1T33 A;  1T98 A;  2KIM A;  4IHV A;  4PSX A;  1BIA A;  2EIJ H;  4D1Q A;  1YO5 C;  2STW A;  4HF2 A;  4G12 A;  4HST A;  1TBX A;  5CVI A;  4GYI A;  3L2W A;  1YHQ I;  2LNB A;  1ETO A;  2DLL A;  4CGZ A;  4QWQ A;  4XR6 A;  3PM1 A;  4M3G A;  3RI4 A;  4LOC A;  3P7N A;  2FBK A;  4E4H A;  5LGT A;  1DDN A;  3BP8 A;  1HC8 A;  3I58 A;  2K4B A;  3CUQ C;  1MSF C;  4FHT A;  4EJV A;  2LBF B;  5IOZ A;  1G3W A;  2DJI A;  3TQN A;  1R22 A;  3I4N J;  3A4C A;  2QLZ A;  4I0A A;  3RCO A;  1V4R A;  2O5R A;  2WAD A;  1AU7 A;  1FWZ A;  1KU3 A;  4R79 A;  3IH4 A;  1Z9C A;  3S16 J;  5FKN A;  2VBW A;  3K1N A;  5J6X A;  2NVQ J;  2HQR A;  1LB2 A;  2M1B A;  1IV8 A;  3RZD J;  4ENM A;  4ETS A;  1JE8 A;  4PJN A;  3JRH A;  1KYW A;  1UZC A;  3F8M A;  3V7R A;  2XAU A;  2ZKZ A;  3TED A;  3N97 A;  5EGO B;  3F23 A;  3J81 Z;  3H36 A;  5L3C A;  2HVS A;  3MN2 A;  3NQO A;  1JT0 A;  2EJR A;  2LSO A;  2UUZ A;  3G4S I;  1UG2 A;  3GZ5 A;  2GBY A;  4HDV A;  3PL8 A;  1ZGJ A;  5EJC A;  5E8G A;  2RDP A;  3KLN A;  3ZMV A;  2PJP A;  3BTL A;  1W5C C;  1X1B A;  4PUS A;  1FC3 A;  3FMS A;  3BZC A;  4F3Q A;  2NVX J;  3VYS B;  4WX9 A;  3OSF A;  1IRX A;  4YG2 F;  4D0P A;  2NS0 A;  3RYP A;  4MFE A;  3H92 A;  2FRH A;  2BE5 F;  3H3V K;  2WB1 A;  2UZK A;  4CCK A;  4EM0 B;  5F1J A;  1XGS A;  1SD7 A;  2I8D A;  2VT3 A;  3PNT A;  2WWY A;  2GOM A;  3RKY A;  1QA6 A;  4FTH A;  3TKY A;  2I10 A;  2C6Y A;  1VF9 A;  1AWC A;  1MD0 A;  1R1T A;  4DJA A;  2VC0 A;  2PN6 A;  4HDU A;  3FBI B;  1UCR A;  2CW8 A;  3ECO A;  1XPX A;  2LRD A;  1FP2 A;  5E8I A;  2BEO A;  1X58 A;  5GPC A;  1Y0U A;  2GXB A;  3ZRG A;  3FBN B;  1QZZ A;  1QVT A;  1SEU A;  4IQ4 A;  4P9U A;  2M7A A;  3M8J A;  3JSO A;  5K7Z A;  3V8J A;  3HM5 A;  1IG7 A;  3S1Q J;  3HL2 A;  3LA3 A;  1VQO I;  4NQW B;  3REO A;  3BG5 A;  2RV8 A;  2WTE A;  3LOC A;  2L7K A;  2X85 A;  4FIS A;  4M6X A;  2NNY A;  1OCZ H;  2NVU B;  4JX5 A;  3EUH C;  4F91 B;  3GLX A;  3K4J A;  5IP7 J;  1HQC A;  1RZ4 A;  1Z1D A;  2JRT A;  2PMZ A;  4HLY A;  2GIZ A;  5F0H A;  2V26 A;  3WTU C;  2IRF G;  1IRF A;  3AG2 H;  3G73 A;  5GPA A;  2KFD A;  3E0J B;  3IH3 A;  1YX5 A;  4EVI A;  2M4K A;  3SZG A;  4ZDP A;  3OSG A;  2P6T A;  2NNN A;  4M9S A;  1X1C A;  4L0Y B;  3WTY C;  4E7I A;  5CPR B;  3OYB A;  1MJB A;  1OYY A;  2L02 A;  3IRQ A;  2R7S A;  1TT0 A;  1U9O A;  1B1B A;  3HPH A;  4CYC A;  3S1M J;  3M9A A;  2XAQ A;  1RKW A;  2R5Z B;  4BEH B;  3BLY A;  2DDA A;  2F48 A;  3AG3 H;  2HKX A;  3CDL A;  1SC7 A;  3Q0W A;  2KDZ A;  5LGU A;  1AHD P;  4LB5 A;  4XLF A;  4MTD A;  4IJA A;  4D7N A;  2HDC A;  5EZH A;  1I1G A;  4PZJ A;  3WG9 A;  2KKO A;  2HVQ A;  2M4G A;  3A1Y A;  1UJ8 A;  4M73 A;  3BRO A;  5IYC J;  1T56 A;  3I0T A;  1U3E M;  1S9H A;  2EIK H;  2UV1 A;  1I50 J;  2EFP A;  5L3E A;  1FBS A;  2WA0 A;  2W82 A;  4G8X A;  2A6H F;  3HDD A;  3M4O J;  3AAF A;  1XSV A;  3LSG A;  2CW7 A;  3A03 A;  1GLN A;  3KZI C;  1DGW Y;  4GO1 A;  2CV2 A;  5J4V A;  5CJ9 A;  2DOF A;  1HKS A;  2EV0 A;  3E5U A;  4LIT A;  5IP9 J;  4CO8 A;  1SFO J;  4ZZD A;  5JVG F;  2NOJ B;  1ZYR F;  2WAQ N;  3OYC A;  3A0H C;  3A02 A;  3FK6 A;  2JVH A;  2AQF A;  2CGP A;  2GAU A;  3OL3 A;  2VJJ A;  2NRA C;  3DEE A;  1QVU A;  3LST A;  1FLI A;  5CQE A;  1NG6 A;  1Y8Q B;  5EYR A;  3J81 K;  1KU9 A;  2E7W A;  1YJ9 I;  1TLH B;  2CH0 A;  1W36 C;  2QZ8 A;  3CUQ A;  2V7F A;  4M72 A;  5K1Y A;  2MLG A;  5E1W A;  1GT0 C;  2O61 A;  2RRE A;  1BN5 A;  4A3F J;  2YR2 A;  3JSP A;  2A68 F;  2KHM A;  3J80 K;  1S29 A;  2FD5 A;  4M74 A;  5JI6 A;  2QKL B;  2CO5 A;  3BCA A;  3TP0 A;  1DPR A;  4A5M A;  3C1D A;  2E36 A;  3PSI A;  2JUG A;  1S6L A;  2XF6 A;  3LMM A;  2V1N A;  1SAN A;  1CF7 A;  4KJZ A;  4FT8 A;  4UY8 I;  1E17 A;  2F5F A;  5C3E J;  1JGG A;  2MGQ A;  2JRM A;  4DYR A;  2MD0 A;  3TGN A;  4H0E A;  4XLC A;  2JN6 A;  2QWW A;  2BXY A;  3OS0 A;  3KP4 A;  2OA4 A;  2WC2 A;  1R00 A;  3OYF A;  2K40 A;  4BBR J;  2E34 A;  5H20 A;  2VOD A;  1X2M A;  4ZYH A;  4HPQ A;  2OCC H;  4XRM A;  1MGT A;  2OD5 A;  4V2G A;  1I39 A;  4M9Z A;  2XRL A;  1ODD A;  2P6S A;  2A05 A;  4KFC A;  1ETK A;  4G94 A;  2KZV A;  2RC4 A;  4RA2 A;  4F55 A;  2ZJQ F;  3F22 A;  4G7O F;  4QSH A;  1DP7 P;  1QU3 A;  1V54 H;  3V8K A;  3PNY A;  5KCM A;  1FPQ A;  1FTT A;  3IUO A;  4HQM A;  3ZPL A;  4RLF A;  4AC0 A;  5D4S A;  2DN0 A;  3K4L A;  3GWZ A;  2X1E A;  4PDK A;  2DYR H;  5B3S H;  3K4N A;  5AIP A;  2R92 J;  2KRH A;  1JJ8 C;  4ZDO A;  2X6Y A;  4XKV A;  2DA1 A;  5HNF A;  1FYK A;  2DMQ A;  1NK2 P;  1MBF A;  1PYV A;  2DJN A;  3HOZ J;  4BJT A;  1QZY A;  1NK3 P;  3HHG A;  1IUY A;  3PIO F;  4JQF A;  1LJ9 A;  1I6H J;  1I5Z A;  1TZL A;  4IEJ A;  5J3L A;  1EV7 A;  3U1K A;  4DNC A;  4IF4 A;  2ECB A;  2ZJ2 A;  2VQH A;  1K79 A;  3CCR I;  3B02 A;  4A3K J;  3HOU J;  2LK2 A;  1MMN A;  1X1P A;  2EFW A;  4I0B A;  2VE8 A;  3V7C A;  1IUF A;  4EM1 A;  1T0F C;  3CCU I;  2JA5 J;  3CMA I;  4X6A J;  2K7L A;  2VBX A;  3HKZ A;  4L0Z B;  3FK7 A;  2VKD A;  4MQ9 F;  2Y48 A;  1L3L A;  4A0X A;  4EJT A;  1SVO A;  4BHC A;  1O4X A;  1JKP C;  3QYB A;  3FXU A;  2IT0 A;  3C2H A;  2EIN H;  3L09 A;  5K7F A;  1B8I B;  3CES A;  4U0V A;  5BMZ A;  5E3N A;  3I54 A;  2BHZ A;  1ZTR A;  1MDM B;  4KN4 X;  4ENJ A;  5D6E A;  1VQ9 I;  1NG7 A;  3A2K A;  2CUZ A;  2EV5 A;  1F4K A;  3CQZ J;  4ESF A;  2BY0 A;  1FIP A;  5HDN A;  2PMH A;  1MMD A;  3U1D A;  3GVA A;  2MA3 A;  2EZI A;  4BS9 A;  1XGM A;  2ZSI B;  3HYI A;  3CUO A;  4Y17 A;  5JHF A;  3FMR A;  3WE2 A;  2XRO A;  1J9I A;  5FLX Z;  1U9N A;  4M71 A;  1HBX G;  2K9L A;  5DEQ A;  2D1H A;  1HDP A;  2A6E F;  1FP1 D;  1P9Q C;  2GWR A;  1PUE E;  1D0Z A;  1VQ5 I;  3TW6 A;  3GYH X;  4N0B A;  1D1C A;  2IGK A;  4QLC U;  4KIC A;  3BTI A;  1XMA A;  2TRT A;  2EBI A;  2O7O A;  3R60 A;  1WQ2 A;  1XX5 A;  4L5J A;  1WHU A;  4AVZ A;  1SVL A;  3RQ4 A;  1WI3 A;  2Y9Z A;  2Z2S B;  3LL7 A;  4XL9 A;  3CCY A;  2KIU A;  2LR8 A;  3E7L A;  3BG7 A;  4PK4 A;  4CDG A;  1V5F A;  2CRG A;  4CYD A;  2FA5 A;  3OOP A;  1OCT C;  3DPT A;  4CCJ A;  3CUQ B;  5D5V B;  2JPC A;  1HF0 A;  1M1E B;  4XID A;  3SXY A;  2X1D A;  3G1M A;  4CCM A;  2DI3 A;  1SFU A;  2HQA A;  4HA8 A;  1XN7 A;  2HI3 A;  3WHB A;  2OJE D;  4U7B A;  1S8N A;  2O0Y A;  2MLK A;  3WHC A;  5HLI A;  2HVR A;  2Y0S A;  2IS6 A;  1ZLJ A;  4BE2 A;  1SD5 A;  1I27 A;  1SFK A;  4E70 A;  2HDW A;  2BOL A;  4Q5S F;  3W2W A;  1CF7 B;  4LIV A;  1ONV A;  1J0R A;  3IV5 A;  2YU9 J;  5IT9 K;  2MW8 A;  1Y39 A;  3GTO J;  2W84 A;  2PG4 A;  4V19 K;  3BY6 A;  4XKW A;  4U7D A;  3X2Q H;  2HGC A;  2NXN B;  3F6O A;  2ETH A;  1APL C;  2VKE A;  2OUM A;  4AWX B;  4HZF A;  2VPR A;  4YFX F;  2BY1 A;  4LLL A;  2DPD A;  2TDX A;  5BS6 A;  2VUM J;  1IO2 A;  1ETV A;  2H6C A;  1R4M B;  3OS2 A;  2MFZ A;  2GIV A;  4N9H A;  3BQZ A;  4LFU A;  3GUD A;  4RGS A;  1QBJ A;  1LDK B;  4LG0 A;  3BR2 A;  3TOA A;  2CQK A;  1T38 A;  2VB6 A;  2XKO A;  1WJB A;  3DQV C;  4XM3 A;  2MYS A;  1ZK8 A;  1ZRC A;  5GAE J;  4XMY A;  5FO5 A;  5FFX A;  5H6R A;  2R7R A;  5EGO A;  1QHH D;  3E6C C;  2IS2 A;  2Z1D A;  2X6X A;  2NS7 A;  3MQ0 A;  4XK4 A;  3P5J A;  2HWV A;  5D6F A;  4B47 A;  3MKY B;  3DEW A;  5K5Q A;  3RTR A;  1TL8 A;  2XF7 A;  2FBH A;  2HU9 A;  3DWL E;  1B59 A;  2O9L A;  1P4A A;  2K3F A;  1P7J A;  1MZB A;  4RGU A;  4EAT A;  3WU1 B;  1JUM A;  3CCS I;  2DFF A;  2YX4 A;  3LSI A;  3K69 A;  3OYN A;  1LEB A;  3A01 A;  4BU2 A;  3K70 C;  1USS A;  2N8G A;  2VT2 A;  4ZJZ A;  2FEZ A;  1P6R A;  1VTN C;  1T0F A;  5LHG A;  4HW0 A;  4IOA F;  3CO6 C;  9ANT A;  4W97 A;  1ON1 A;  4MEY F;  5AON A;  2X9D A;  4D7M A;  1BIB A;  1TQP A;  1BC8 C;  6PAX A;  1XSX A;  3GFM A;  4F7Z A;  2QQA A;  5EDN A;  3WTT C;  2ZME C;  2D2W A;  1F43 A;  2YU3 A;  3OR2 C;  5FLX K;  1VND A;  2XHK A;  4CA0 A;  2ZNY A;  1QQI A;  3FXO A;  3CP8 A;  5L3F A;  1BL0 A;  2KMU A;  3TOB A;  2GA2 A;  4MLO A;  1W0T A;  2IVM A;  3F21 A;  1X2N A;  1WJE A;  4DOZ A;  1DP3 A;  3JR9 A;  2XAS A;  2P5L C;  1P7I A;  1YE9 A;  1MBE A;  5J4Y A;  1J59 A;  2XGC A;  4U87 A;  4NQW A;  1FSH A;  3ERE D;  4A3J J;  3C3W A;  2Z16 A;  3ABK H;  3CF2 A;  2HQ5 A;  1S7A A;  3GBG A;  2W25 A;  3MZY A;  5KK1 A;  1VI0 A;  3I55 I;  2QA4 I;  3E6D A;  2LP0 A;  4XQF A;  4FE7 A;  2A5W A;  2AXL A;  4ITV A;  4E7S A;  1W7P D;  3GW2 A;  1Y1W J;  1ZG5 A;  2QEN A;  3RKQ A;  3R0J A;  5E17 F;  1VQN I;  2R7T A;  3WTW C;  1X1A A;  3HRT A;  5E3O A;  1R1V A;  4XRS A;  4UNO A;  4BDY A;  3ISP A;  3TDU C;  3S14 J;  2VOP A;  5J1U A;  2V9K A;  1Z3X A;  5IPA A;  3G1O A;  1U78 A;  2COB A;  3I59 A;  4HX4 A;  4KIB A;  1VQP I;  2QF7 A;  5FRO A;  1YI2 I;  4HYE A;  3HBL A;  3OS1 A;  1FNN A;  1IN6 A;  3OYH A;  4KYW A;  2ZC2 A;  5J1R A;  2JA2 A;  1D8K A;  2F6C A;  1XG1 A;  5FJ8 J;  1ULY A;  1K78 A;  3OL4 A;  2UWM A;  4XLA A;  2LDU A;  4C30 A;  1O7L A;  2CQX A;  2D45 A;  4GGG A;  1D8J A;  1OQY A;  3RSN A;  1BC7 C;  5KAI C;  5LLQ A;  1U0J A;  2O03 A;  2JQ7 A;  1BA5 A;  2OF7 A;  4IHT A;  3KX2 A;  4GXO A;  2DQR A;  3BG9 A;  4J19 A;  1VQK I;  4J01 A;  3IKT A;  3W6J B;  4KIS A;  2W7N A;  2E1O A;  2JJ7 A;  3FIS A;  1AKH A;  2A61 A;  2HOA A;  2WY7 Q;  3OIO A;  4G7H F;  1FTZ A;  2ZXH A;  2V4J C;  5HNH A;  1OLT A;  3GME A;  3VEP A;  1YTY A;  1YJN I;  3K70 D;  1MMG A;  1AOY A;  5CVV A;  2G7H A;  5JLW A;  1ETY A;  4CCO A;  1BR1 A;  2VJ4 A;  2WAQ A;  1RRJ A;  1K6Y A;  3HJE A;  4EQQ A;  1EA3 A;  4OAY A;  3HSE A;  4B09 A;  5LGN A;  1ACI A;  3JW4 A;  4ZYE A;  4M6Y A;  3F8C A;  1SD4 A;  4XRF A;  4ZDL A;  3J7A O;  5DD8 A;  3CJT B;  1X3W B;  4LG0 B;  3ZMS A;  4IL6 C;  5GTH C;  4MTE A;  4OMZ A;  4ZTJ A;  1MBG A;  2W00 A;  4RB2 C;  1TQM A;  3BR3 A;  3FM3 A;  1XTA A;  3ZQ7 A;  1SVM A;  4UVC A;  4EV0 A;  1B4A A;  2E5Z A;  2AS5 F;  4NB5 A;  3M7G A;  4OIQ F;  3GTQ J;  1HST A;  2K86 A;  4Y33 A;  1A5J A;  2EA4 A;  2LF7 A;  4WWC A;  3L2V A;  3QRF F;  3LQQ A;  2MD5 A;  5J1Y A;  4YRV A;  1ZH5 A;  2BW3 B;  2H09 A;  1J09 A;  2HOE A;  2OPT A;  3TL4 X;  2FBI A;  4LB6 B;  1WJ5 A;  3LSM A;  2DOE A;  3I3L A;  4L9T A;  2EK5 A;  1VQ4 I;  1W0U A;  4XLN F;  5B5E C;  3OYE A;  1ZRF A;  1Q1H A;  1R58 A;  3QP5 A;  1UB9 A;  2K9S A;  2QSF X;  1O3Q A;  2AQE A;  2Y30 A;  1FYL A;  2CG4 A;  2R93 J;  3ASO H;  4XON A;  2HYF A;  3A01 B;  3HZJ A;  4D5F A;  1YG2 A;  3J7Y J;  5BOX A;  1XS9 A;  2ZO4 A;  5F0C A;  4RMN A;  3UR3 C;  2XIG A;  4B44 A;  3F8B A;  4BAC A;  1X4O A;  3DTI A;  1HW2 A;  4OU0 A;  4WXH A;  1J7K A;  3ML6 A;  2ZME A;  4BXU A;  3GTP J;  1FOY A;  5F27 A;  1E3O C;  1UST A;  3R0A A;  4XOP A;  3HRU A;  2X4H A;  3H9Q A;  3WE3 A;  2R7U A;  1E0E A;  3WGG A;  3AG1 H;  3L2U A;  1MBK A;  2F5E A;  3IAS 2;  5EEH A;  1UAA A;  1A6Q A;  3D5L A;  2E2H J;  5L3D A;  3RPU D;  2FNP A;  1LFP A;  5D5W B;  1LQ1 A;  2Z9O A;  2M8G X;  3NWT A;  4L9J A;  2VLA A;  2F2E A;  4YII A;  1DQU A;  4XRS G;  5LRS A;  1SAU A;  3GZ6 A;  2BHY A;  1IF1 A;  4C9Y A;  1SFE A;  1WJA A;  4JX6 A;  2EQR A;  2ZJR F;  3ZMZ A;  3TDZ C;  4AIJ A;  3KP5 A;  4LG3 A;  3B73 A;  4XIC A;  3COA C;  4N4O B;  3VOD A;  2CV0 A;  3BJA A;  2G9W A;  4IXA A;  1LPQ A;  4HX8 A;  4M6V A;  5B1B H;  4NNJ A;  1HDD C;  2XF5 A;  2GXA A;  5FD6 A;  3S2H J;  2YX7 A;  3KEO A;  4Q4Z F;  1QPI A;  4KNY A;  2XUB A;  2QQB A;  5IT3 A;  3GTL J;  1F1Z A;  1WJD A;  3DCF A;  2DCE A;  2R4G A;  3FMQ A;  3MZH A;  3KE2 A;  4JOM A;  5DM6 F;  1XB4 A;  3S8P A;  3HOS A;  4P5O A;  4PJJ A;  4UV9 A;  2XGE A;  1B8I A;  3ZN1 A;  2BXZ A;  2M34 A;  4UB8 C;  3KEQ A;  1MDM A;  4AYB A;  2QKM B;  1XC5 A;  1ENH A;  1Z67 A;  3D5R C;  2GOX B;  3MD2 A;  4WXD A;  3OIQ A;  1RPW A;  5BPD A;  5D8K B;  4HNT A;  1OCC H;  2L9S A;  2HPI A;  3I59 B;  3VB2 A;  4MFD A;  2V9V A;  3RPU A;  1T8I A;  1NH3 A;  1B72 A;  5JR3 A;  4MIM A;  4H4K C;  3DPU A;  3ZP5 A;  2RKH A;  1CQT A;  2XAG A;  3PIP F;  2K3P A;  3FXQ A;  1LEA A;  2CQ7 A;  3DLL F;  4YEL A;  2FSW A;  1K78 B;  2PQ8 A;  2KIF A;  1IGN A;  4NDL A;  1ZN2 A;  1YS6 A;  5DS9 A;  2XVC A;  2P0W A;  3MVP A;  2EFO A;  4G6Q A;  4KUM A;  3VOE A;  5DCF A;  1JHF A;  2QVO A;  4ENK A;  3D0S A;  3PFI A;  4C3J J;  3OWT A;  1LKX A;  2WBM A;  5HVQ C;  1DU6 A;  5KHD A;  4BY1 J;  4Y15 A;  2X6O A;  1MH4 A;  4Q47 A;  4BL0 B;  5L3B A;  3VPR A;  1D1A A;  4C3I J;  2J5O A;  3WG7 H;  4OWR B;  4E6K G;  3ZR8 X;  1IRZ A;  3ECH A;  3SEQ A;  2H6B A;  2HZD A;  1AKH B;  1IJW C;  4YIF A;  3TO7 A;  2E71 A;  4RAF A;  5IP6 A;  1K61 A;  4U88 A;  4CXF A;  3QYF A;  2HS5 A;  1I3A A;  3HSF A;  4IVN A;  4G9Y A;  1V5G A;  3C18 A;  3PUB A;  2B9S A;  4PFP A;  5FB2 A;  3H1C A;  4CSW A;  5D8L B;  2MC4 A;  2DA3 A;  3SFI A;  4C2U A;  2JZY A;  2LC2 A;  1YLF A;  5ILU A;  3JRB A;  3FWE A;  4E7Z A;  2H8W A;  1XMK A;  4S04 A;  2IGO A;  4IO9 F;  4ZC3 A;  2NVT J;  2LMD A;  3CC4 I;  4KN7 X;  1E2X A;  1HLV A;  2XC7 A;  3VWB A;  4BXF A;  1LVK A;  3RKW A;  1TWA J;  1TW2 A;  1KQ0 A;  1TNT A;  3KZY A;  1R5I D;  2M0C A;  3OYJ A;  2EFQ A;  3VYU B;  2R7Q A;  1A6I A;  2H94 A;  3IAM 2;  2DTR A;  2GLO A;  2LD5 A;  1UHW A;  2DXI A;  1G59 A;  4HNU A;  3E6B A;  3PJR A;  1X1D A;  3FXJ A;  4XKB A;  4L18 B;  3LAP A;  1FT9 A;  3M07 A;  4IRH A;  1GHC A;  2P7C B;  5E1X A;  2OU2 A;  3SFZ A;  1HSJ A;  1QHG A;  4W1U A;  3JRG A;  2FQ4 A;  4Z2Y A;  4ENN A;  3S93 A;  1KGS A;  2DK5 A;  3KYC B;  4UUV A;  4LD5 A;  3I4M J;  3O6B B;  2LLK A;  1EJ9 A;  4UV8 A;  1TW3 A;  2CYY A;  1JKR C;  1GUU A;  3GCM A;  2VN2 A;  3HB9 A; 
#chains in the Genus database with same CATH homology
 2PFB A;  2GZW A;  5K5R A;  1YYV A;  2ZME B;  2M8E A;  2V1X A;  4CZZ A;  2ZCW A;  4XLP F;  2IA0 A;  2UXX A;  3ZMU A;  3WTX C;  3P9K A;  1MKM A;  3EET A;  1HW1 A;  3G3Z A;  1OMI A;  2DU9 A;  1I6X A;  2QUF A;  3KP6 A;  4EJU A;  3LA2 A;  1RNL A;  2FU4 A;  2M45 A;  4AIK A;  3GFL A;  3N4M A;  3HIF A;  1H0M A;  3F8F A;  2ADU A;  3ELK A;  3RKX A;  1ZRD A;  3HOT A;  3DXJ F;  4YFK F;  2EB7 A;  3CLO A;  2R7F A;  1RI7 A;  1WWX A;  2HZT A;  2P7V B;  2XKP A;  1PP8 F;  4LMY A;  3WGI A;  4MEX F;  1BOA A;  2L4M A;  2OQG A;  1IRG A;  2ESH A;  3FHZ A;  1D5V A;  2VXZ A;  4PCQ A;  4Q48 A;  2K02 A;  3GX4 X;  3TO6 A;  5DV5 A;  1YFH A;  3F6V A;  3KLO A;  3E5X A;  2PI0 A;  1IN4 A;  4KIF A;  5DYM A;  1I1S A;  4BYY A;  3IL2 A;  1G4D A;  1BM9 A;  1DPU A;  2W24 A;  5LBQ A;  3V8L A;  5FFZ A;  4WK8 F;  4ASN A;  1RUO A;  3GFI A;  3I4P A;  5F64 A;  1JGS A;  4FX0 A;  3SHF A;  5BQT A;  1LNW A;  3R6S A;  5ED4 A;  3O3K A;  3S2W A;  5EEG A;  2B0L A;  3K1M A;  5LRR A;  3EQL F;  4EGY A;  3LQR A;  4ZH4 F;  1EH7 A;  2VBY A;  1B9M A;  1KQ8 A;  3DF8 A;  1J2X A;  3Q9V A;  2HTJ A;  3IKV A;  3W6K B;  1FBU A;  2L4A A;  1JHH A;  4AD9 A;  1EH6 A;  2DBB A;  3MWM A;  1G3Y A;  3CTA A;  1IXS B;  3FF5 A;  3NEU A;  2QQ9 A;  3SZP A;  1YQA A;  3KP2 A;  4JK1 X;  2MH2 A;  2KJC A;  2M30 A;  1HXD A;  5CVR A;  3CO7 C;  3FZV A;  5DUK A;  1BBY A;  3V4G A;  4KMF A;  4FX4 A;  2QYO A;  2OZ6 A;  5CVU A;  4HF0 A;  2ISZ A;  2FML A;  3HRM A;  4LLN A;  3IRR A;  4A0Y A;  3MFK A;  3T8R A;  3QAH A;  5CLS A;  2EV6 A;  1BI0 A;  5BPI A;  4LK0 F;  2H27 A;  3QU6 A;  2ISY A;  4A12 A;  2JPB A;  1PDN C;  2VC1 A;  1IW7 F;  3QU3 A;  3T0Y A;  3HTU A;  3SZT A;  2V1U A;  2FE3 A;  1ZGA A;  2RGV A;  3BZ6 A;  4WXC A;  4R8H A;  2V1D A;  3Q9S A;  5ICF A;  3RYR A;  1BI2 A;  2RQP A;  1K6O A;  5HS8 A;  4RAY A;  4EJW A;  4WF2 A;  1IZ1 A;  3U2R A;  4L9V A;  3RIR A;  2HKO A;  2CFX A;  4ZZL A;  4U0W A;  3ABU A;  1G6N A;  3TO9 A;  4U0Y A;  1STZ A;  4I2O A;  2E1N A;  4RGR A;  4A2U A;  4RB1 A;  1BJA A;  2FNA A;  1CGP A;  5FGM A;  4KDP A;  1W7P A;  1LDJ A;  3DFG A;  4Y13 A;  4KIG A;  2HQN A;  1ZG3 A;  2XV4 S;  2DAO A;  1YO5 C;  2JTV A;  3GFJ A;  3KP3 A;  1A04 A;  1G3S A;  1SMT A;  4I01 A;  3CJN A;  1O3R A;  5ICG A;  3DKW A;  5HS9 A;  2PMU A;  5ERI A;  3M8F A;  4XSZ F;  1FY7 A;  2Y75 A;  1W5S A;  2HTS A;  3DPL C;  3QP6 A;  2A3S A;  2Z99 A;  2LKP A;  3K9T A;  3V7S A;  3I64 A;  5JFR A;  4OIO F;  4L5I A;  2ELH A;  4WCG A;  4N9I A;  1S7O A;  4CIC A;  3QOP A;  5LEK A;  1PP7 U;  2F5D A;  2CSO A;  3BPV A;  3WTS C;  1HW5 A;  2JSC A;  1QNT A;  2EWN A;  1SAX A;  5JVT A;  5DD4 A;  1XDU A;  1Z05 A;  3BJ6 A;  2DPU A;  4S05 A;  1IN7 A;  4IRG A;  4EMS A;  2YPR A;  4RAZ A;  1U5T C;  2L01 A;  1V3F A;  3T5X A;  4I02 A;  3J80 Z;  3KET A;  3JTG A;  3DP7 A;  2XAJ A;  1KA8 A;  2V6C A;  4KA4 A;  3VFZ A;  1R23 A;  2NAZ A;  4BH9 A;  4IHS A;  1G3T A;  1L0O C;  1WKM A;  4P9F A;  1HKT A;  3R4K A;  4MNU A;  1QO0 D;  2Z5U A;  3R61 A;  4UHT A;  3L2C A;  1LDD A;  1U8R A;  2F5C A;  1XCV A;  1IXR C;  3HRS A;  3PQK A;  4HV6 A;  1KQ9 A;  2ZXJ A;  5D4R A;  4I09 A;  4BAY A;  1XCB A;  1Z91 A;  2IJL A;  4OIR F;  4HLX A;  3OV8 A;  4BNC A;  2M5W A;  3L00 A;  3NRV A;  1KU7 A;  2RVC A;  3ULQ B;  1KYZ A;  5LHI A;  1R1U A;  1T39 A;  2ACJ A;  3U9G A;  4L9N A;  1FX7 A;  2X0L A;  1C0W A;  2XAH A;  5H6Q A;  2STT A;  4GYG A;  2HEO A;  1H9G A;  3GEZ A;  5HOO A;  5FD5 A;  3KZZ A;  3GXO A;  4UXN A;  5LHH A;  4LK1 F;  4KT5 C;  4EGZ A;  2IA1 A;  4BHP A;  1W7P B;  5DUI A;  4MQV A;  4NHJ A;  1OR7 A;  2Q2E A;  2Q8K A;  1GXP A;  3F8N A;  4HV5 A;  3E6M A;  2KJB A;  1EH8 A;  1O57 A;  2V79 A;  2ZFW A;  4O6J A;  3O2P E;  5LEJ A;  3EYI A;  2A69 F;  1FSE A;  2M87 A;  2LF8 A;  5KVR A;  4EJO A;  3I53 A;  1X3U A;  2VBZ A;  3QPT A;  3M8E A;  1ZAR A;  2DT5 A;  4HQE A;  4R1H A;  2IA2 A;  1XD7 A;  1Z6R A;  1P4W A;  1YW7 A;  2ZNZ A;  4XSX F;  1ON2 A;  4B8X A;  1S3J A;  2Z33 A;  3BPX A;  1U6G A;  3HTS B;  2P4W A;  2YSR A;  4GCV A;  3EYY A;  4HX7 A;  3WTZ A;  3WTV C;  1IN5 A;  3RPQ A;  1F5T A;  3HUG A;  5CYV A;  3T1B A;  2MH9 A;  3F72 A;  1OKR A;  4OOI A;  2A07 F;  3LAJ A;  3DV8 A;  3QPH A;  1IAW A;  2Q0O A;  2RNJ A;  2P5K A;  4UVA A;  1YW9 A;  4A5N A;  2HR3 A;  4IRI A;  1R7J A;  5ILV A;  4ZYG A;  2MBF A;  1U5T A;  1GVJ A;  2W57 A;  1XSD A;  5ICE A;  3EDP A;  2JT1 A;  3K0L A;  4I98 B;  3LWF A;  5TRD A;  4EM2 A;  3IWF A;  1QPM A;  1WRJ A;  1RUN A;  4LLG F;  2Y0M A;  3GF2 A;  1IXC A;  4HBL A;  1UHM A;  5D5X B;  1FBQ A;  5IT9 Z;  4MHG A;  1H9T A;  2HFH A;  1ZAO A;  5HDG A;  4RB3 C;  4HOB A;  2Z3Y A;  1NHA A;  3WGH A;  2EA2 A;  5E20 A;  5L3G A;  3ZMD A;  2G7U A;  3L7W A;  1D3Y A;  3Q5F A;  5ILS A;  1OPC A;  5HLH A;  3ZN0 A;  2WV0 A;  3IWZ A;  3MCZ A;  1XDS A;  5K5O A;  1ZLK A;  2QBY A;  1O3T A;  1WSU A;  1IN8 A;  3BJO A;  3EUH A;  2BGC A;  2PLY A;  1SFX A;  2CW0 F;  2D1V A;  2R7D A;  3HSR A;  4O5V A;  5F1R A;  1P2F A;  2IPQ X;  4TV7 A;  1ZHF A;  3PQJ A;  1FYM A;  1YIO A;  3MEX A;  1K7A A;  2W85 A;  5A2Q Z;  1WI9 A;  3K1P A;  3DEU A;  4I7H A;  2A5Y B;  1XGO A;  2FF4 A;  1SMY F;  4A0Z A;  2KRF A;  2XRN A;  2L3D A;  2O6G E;  3CDH A;  2GA1 A;  1J75 A;  4AIH A;  4OMY A;  2P5V A;  4M9X A;  1MJ9 A;  2XGX A;  5HS7 A;  2DQL A;  3ROU A;  1FZP B;  1ZRE A;  2EFN A;  2GQQ A;  3ABT A;  4ZYD A;  4PGH A;  5DCM A;  2XAF A;  4BQA A;  3P9C A;  1YW8 A;  3HHH A;  3C7J A;  2BBY A;  4RB0 A;  2DW4 A;  3IC7 A;  1Z7U A;  3MAJ A;  5J8C A;  1SD6 A;  3RJP A;  1HKQ A;  3H3U A;  3GO5 A;  1GXQ A;  1DUX C;  3JAM Z;  1YS7 A;  3KP7 A;  3P9I A;  5J8F A;  1U2W A;  2ESN A;  5HLG A;  4LJZ F;  3I5U A;  1U5T B;  1OYW A;  4UVB A;  4YFN F;  3H3Z A;  4IPA A;  2P8T A;  4KMU X;  2BYV E;  2PEX A;  4K2E A;  3E5Q A;  4XBF A;  4P55 A;  4A6D A;  2HYG D;  4O3M A;  3BOQ A;  1B9N A;  4RS8 A;  5TJJ A;  1FOK A;  1P92 A;  5D5U B;  1O7F A;  3SQN A;  2RN7 A;  1TQI A;  2J5P A;  1REP C;  3K2Z A;  2IP2 A;  1P4X A;  2GXG A;  2FOK A;  1XGN A;  3JTH A;  2OBP A;  4BHB A;  4OIN F;  2OAZ A;  4LGW A;  3L9F A;  5F6F A;  1W5T A;  4AVP A;  4ESB A;  4PGG A;  2FXA A;  2DK8 A;  2K27 A;  4HF1 A;  5AIQ A;  4P96 A;  1J5Y A;  2QBY B;  4CHU A;  3I71 A;  1TNS A;  1T6S A;  4G6D A;  5E1Z B;  5A2Q K;  1R5G A;  4A6E A;  1O3S A;  1OYI A;  2O8X A;  3M1E A;  3LFK A;  3F3X A;  3FXR A;  3ZMT A;  2VON A;  2FQ3 A;  1UFM A;  3KFW X;  2IW5 A;  1BI1 A;  2O3F A;  2R3S A;  3IHU A;  3KCC A;  2VE9 A;  1LVA A;  1MJA A;  3T8T A;  5ICC A;  2MC3 A;  2DO7 A;  2UXN A;  4DQ2 A;  1B6A A;  1BI3 A;  4JBA A;  1TTY A;  5JHU A;  2COM A;  1W4M A;  2DFI A;  3BWG A;  5E18 F;  2PBI A;  5HDK A;  3E97 A;  2CWE A;  2FMY A;  2NYX A;  4G7Z F;  5CVJ A;  1R5H A;  4ESJ A;  2QM3 A;  3JAM K;  5DCM B;  4OIP F;  1R36 A;  2E7X A;  4ON0 A;  1F9N A;  2ZBK A;  2K4J A;  1JXS A;  4MGR A;  2OZU A;  3FM5 A;  4HAM A;  3BDD A;  5DDG A;  2OQR A;  3FX3 A;  1QGP A;  1KU2 A;  1Z6T A;  1T2K A;  3LA7 A;  1ZG1 A;  2BV6 A;  2E1C A;  4RGX A;  3E3V A;  2L54 A;  1RIO H;  3RDI A;  3WOD F;  3WU0 A;  1T98 A;  2KIM A;  1BIA A;  2STW A;  4HF2 A;  1TBX A;  5CVI A;  4GYI A;  2LNB A;  2DLL A;  4CGZ A;  4QWQ A;  3RI4 A;  3P7N A;  2FBK A;  5LGT A;  1DDN A;  3BP8 A;  3I58 A;  2K4B A;  3CUQ C;  4FHT A;  4EJV A;  1G3W A;  3TQN A;  1R22 A;  4I0A A;  2QLZ A;  1V4R A;  1FWZ A;  1KU3 A;  4R79 A;  1Z9C A;  2VBW A;  3K1N A;  5J6X A;  2HQR A;  1LB2 A;  2M1B A;  4ENM A;  4ETS A;  1JE8 A;  1KYW A;  3F8M A;  3V7R A;  2ZKZ A;  3N97 A;  3F23 A;  3J81 Z;  5L3C A;  3NQO A;  2EJR A;  2LSO A;  3GZ5 A;  4HDV A;  1ZGJ A;  5E8G A;  2RDP A;  3KLN A;  3ZMV A;  2PJP A;  1FC3 A;  3FMS A;  4WX9 A;  4YG2 F;  4D0P A;  2NS0 A;  3RYP A;  3H92 A;  2FRH A;  2BE5 F;  2UZK A;  4EM0 B;  1XGS A;  1SD7 A;  2VT3 A;  2WWY A;  3RKY A;  3TKY A;  2C6Y A;  1AWC A;  1MD0 A;  1R1T A;  2VC0 A;  2PN6 A;  4HDU A;  1UCR A;  3ECO A;  1FP2 A;  5E8I A;  2BEO A;  1Y0U A;  2GXB A;  1QZZ A;  4P9U A;  3JSO A;  3V8J A;  3LA3 A;  3REO A;  2RV8 A;  2WTE A;  4M6X A;  2NNY A;  3GLX A;  1HQC A;  1RZ4 A;  1Z1D A;  2JRT A;  4HLY A;  3WTU C;  2IRF G;  1IRF A;  3G73 A;  4EVI A;  2P6T A;  2NNN A;  4M9S A;  4L0Y B;  3WTY C;  1MJB A;  1OYY A;  2L02 A;  3IRQ A;  1B1B A;  3M9A A;  2XAQ A;  2HKX A;  5LGU A;  4LB5 A;  4MTD A;  4IJA A;  2HDC A;  1I1G A;  4PZJ A;  3WG9 A;  2KKO A;  4M73 A;  3BRO A;  3I0T A;  1U3E M;  2EFP A;  5L3E A;  1FBS A;  4G8X A;  2A6H F;  3AAF A;  1XSV A;  4GO1 A;  5CJ9 A;  1HKS A;  2EV0 A;  3E5U A;  4CO8 A;  4ZZD A;  1ZYR F;  2CGP A;  2GAU A;  2NRA C;  3LST A;  1FLI A;  3J81 K;  1KU9 A;  2E7W A;  1TLH B;  2QZ8 A;  3CUQ A;  4M72 A;  5K1Y A;  2MLG A;  5E1W A;  2O61 A;  1BN5 A;  2YR2 A;  3JSP A;  2A68 F;  3J80 K;  1S29 A;  4M74 A;  5JI6 A;  2CO5 A;  1DPR A;  4A5M A;  3C1D A;  1S6L A;  1CF7 A;  1E17 A;  4FT8 A;  2F5F A;  3TGN A;  4H0E A;  2QWW A;  3KP4 A;  2OA4 A;  2WC2 A;  1R00 A;  5H20 A;  2VOD A;  4ZYH A;  1MGT A;  2OD5 A;  4M9Z A;  1ODD A;  2P6S A;  4KFC A;  4G94 A;  2RC4 A;  3F22 A;  4G7O F;  1DP7 P;  3V8K A;  1FPQ A;  4HQM A;  3ZPL A;  5D4S A;  3GWZ A;  4PDK A;  5AIP A;  1FYK A;  1QZY A;  3HHG A;  1IUY A;  4JQF A;  1LJ9 A;  1I5Z A;  1EV7 A;  4DNC A;  4IF4 A;  2ZJ2 A;  1K79 A;  3B02 A;  2EFW A;  4I0B A;  2VE8 A;  3V7C A;  4EM1 A;  2K7L A;  2VBX A;  4L0Z B;  4MQ9 F;  2Y48 A;  1L3L A;  4A0X A;  4EJT A;  4BHC A;  3FXU A;  2IT0 A;  3L09 A;  4U0V A;  5BMZ A;  3I54 A;  1MDM B;  4KN4 X;  4ENJ A;  5D6E A;  2EV5 A;  1F4K A;  4ESF A;  5HDN A;  2PMH A;  3U1D A;  3GVA A;  2MA3 A;  1XGM A;  3HYI A;  3CUO A;  4Y17 A;  3FMR A;  3WE2 A;  2XRO A;  1J9I A;  5FLX Z;  4M71 A;  1HBX G;  5DEQ A;  2D1H A;  2A6E F;  1FP1 D;  1PUE E;  2GWR A;  3GYH X;  4N0B A;  4QLC U;  4KIC A;  1XMA A;  3R60 A;  1WQ2 A;  4L5J A;  2KIU A;  2VOO A;  4CDG A;  4CYD A;  2FA5 A;  3OOP A;  3DPT A;  3CUQ B;  5D5V B;  2JPC A;  3SXY A;  2DI3 A;  1SFU A;  4HA8 A;  1XN7 A;  4U7B A;  1S8N A;  2O0Y A;  2MLK A;  5HLI A;  1ZLJ A;  1SD5 A;  1I27 A;  4E70 A;  4Q5S F;  1CF7 B;  1ONV A;  1J0R A;  5IT9 K;  2W84 A;  2PG4 A;  3BY6 A;  4U7D A;  2HGC A;  3F6O A;  2ETH A;  4AWX B;  4HZF A;  4YFX F;  4LLL A;  2DPD A;  2TDX A;  5BS6 A;  2H6C A;  2GIV A;  4N9H A;  4LFU A;  3GUD A;  4RGS A;  1QBJ A;  1LDK B;  4LG0 A;  3TOA A;  2CQK A;  1T38 A;  2XKO A;  3DQV C;  1ZRC A;  5FO5 A;  5FFX A;  5H6R A;  3E6C C;  3MQ0 A;  2HWV A;  5D6F A;  5K5Q A;  3RTR A;  2FBH A;  1B59 A;  1P4A A;  1MZB A;  4RGU A;  3WU1 B;  2YX4 A;  3K69 A;  1LEB A;  1USS A;  2VT2 A;  2FEZ A;  1P6R A;  1VTN C;  1T0F A;  5LHG A;  4HW0 A;  3CO6 C;  1ON1 A;  4MEY F;  5AON A;  1BIB A;  1TQP A;  1BC8 C;  6PAX A;  1XSX A;  3GFM A;  4F7Z A;  2QQA A;  3WTT C;  2D2W A;  2YU3 A;  5FLX K;  2XHK A;  2ZNY A;  1QQI A;  5L3F A;  3TOB A;  2GA2 A;  2IVM A;  3F21 A;  2XAS A;  2P5L C;  1J59 A;  4NQW A;  1FSH A;  3ERE D;  3C3W A;  1S7A A;  2W25 A;  3MZY A;  5KK1 A;  3E6D A;  2AXL A;  1W7P D;  3GW2 A;  1ZG5 A;  2QEN A;  3R0J A;  5E17 F;  3WTW C;  3HRT A;  1R1V A;  4UNO A;  3ISP A;  3TDU C;  2VOP A;  1U78 A;  3I59 A;  4HX4 A;  4KIB A;  4HYE A;  1FNN A;  1IN6 A;  4KYW A;  1D8K A;  1ULY A;  1K78 A;  2UWM A;  2LDU A;  1O7L A;  2D45 A;  4GGG A;  1D8J A;  1BC7 C;  5LLQ A;  2O03 A;  4IHT A;  4GXO A;  2DQR A;  3IKT A;  3W6J B;  2A61 A;  4G7H F;  3VEP A;  1YTY A;  1AOY A;  5CVV A;  2G7H A;  4EQQ A;  4B09 A;  3HSE A;  5LGN A;  3JW4 A;  4ZYE A;  4M6Y A;  3F8C A;  1SD4 A;  4XRF A;  3J7A O;  5DD8 A;  4LG0 B;  3ZMS A;  4MTE A;  4OMZ A;  4RB2 C;  1TQM A;  3FM3 A;  3ZQ7 A;  4UVC A;  4EV0 A;  1B4A A;  2AS5 F;  4NB5 A;  3M7G A;  4OIQ F;  1HST A;  2K86 A;  2EA4 A;  2LF7 A;  4WWC A;  3QRF F;  1ZH5 A;  3LQQ A;  2MD5 A;  2H09 A;  2HOE A;  2FBI A;  4LB6 B;  4L9T A;  2EK5 A;  4XLN F;  1ZRF A;  1Q1H A;  1R58 A;  3QP5 A;  1UB9 A;  1O3Q A;  1FYL A;  2CG4 A;  2HYF A;  1YG2 A;  5BOX A;  2ZO4 A;  2XIG A;  3F8B A;  1HW2 A;  4OU0 A;  4WXH A;  1J7K A;  3ML6 A;  2ZME A;  4BXU A;  1UST A;  3R0A A;  3HRU A;  2X4H A;  3WE3 A;  3WGG A;  2F5E A;  5EEH A;  3D5L A;  5L3D A;  2FNP A;  5D5W B;  1LQ1 A;  2Z9O A;  4L9J A;  2F2E A;  4YII A;  5LRS A;  3GZ6 A;  1IF1 A;  1SFE A;  3ZMZ A;  3TDZ C;  4AIJ A;  3KP5 A;  3COA C;  3B73 A;  3VOD A;  3BJA A;  2G9W A;  4IXA A;  4HX8 A;  5FD6 A;  2YX7 A;  3KEO A;  4Q4Z F;  4KNY A;  2XUB A;  2QQB A;  5IT3 A;  1F1Z A;  3FMQ A;  3MZH A;  3KE2 A;  1XB4 A;  3HOS A;  4P5O A;  4UV9 A;  3ZN1 A;  3KEQ A;  1MDM A;  4WXD A;  5BPD A;  5D8K B;  3I59 B;  3VB2 A;  2V9V A;  3RPU A;  5JR3 A;  3ZP5 A;  2RKH A;  2XAG A;  3FXQ A;  1LEA A;  2FSW A;  1K78 B;  2PQ8 A;  2KIF A;  1ZN2 A;  1YS6 A;  2XVC A;  2EFO A;  4G6Q A;  4KUM A;  3VOE A;  5DCF A;  1JHF A;  2QVO A;  4ENK A;  3D0S A;  3PFI A;  5HVQ C;  4Y15 A;  4Q47 A;  5L3B A;  2J5O A;  3ECH A;  2H6B A;  4YIF A;  3TO7 A;  4U88 A;  4CXF A;  2HS5 A;  3HSF A;  4IVN A;  4G9Y A;  3C18 A;  5FB2 A;  5D8L B;  2JZY A;  1YLF A;  5ILU A;  3FWE A;  1XMK A;  4S04 A;  4KN7 X;  1E2X A;  3RKW A;  1TW2 A;  1KQ0 A;  1TNT A;  3KZY A;  2EFQ A;  2H94 A;  2DTR A;  1UHW A;  3E6B A;  4L18 B;  3LAP A;  1FT9 A;  4IRH A;  1GHC A;  2P7C B;  5E1X A;  2OU2 A;  3SFZ A;  1HSJ A;  4Z2Y A;  4ENN A;  1KGS A;  2DK5 A;  4UUV A;  4LD5 A;  3O6B B;  4UV8 A;  1TW3 A;  2CYY A;  2VN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...