2DT6A

Solution structure of the first surp domain of human splicing factor sf3a120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
GEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor 3 subunit 1
publication title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2dt6A01
4DGWB 2E60A 1UG0A 2DT7B 2E5ZA 2DT6A 1X4PA 1X4OA
chains in the Genus database with same CATH superfamily
1RKWA 3CCUI 3J7AO 4UY8I 3QOEA 2RNGA 1BA5A 4CA0A 4HAMA 3QYBA 2K40A 2BYVE 3CLQA 4A3JJ 2XUBA 2JK3A 4M73A 1SC7A 1D3YA 1P9QC 2OUMA 2JN6A 1J0RA 1HW2A 1FC3A 3BLYA 3VSKA 4DBRA 1LFUP 3I59A 3E6CC 2ZCWA 1YW9A 4BS9A 1LVAA 4RM3A 1XC5A 3HRTA 4XIDA 5EDNA 1EH6A 5E79C 3SFIA 2DK8A 2VKHA 2DOAA 5DDGA 5GADJ 1P92A 1P7JA 4II3A 2ZBKA 4DIQA 1DUXC 3CMYA 2A61A 3WU0A 2KKOA 2M0MA 4UUVA 4RS8A 3ABMH 1R4NB 1MBJA 1S3JA 1E0EA 2XB5A 2OV7A 2VIXA 3G1LA 5J3LA 1Q1HA 1VF9A 3VYTB 3IV5A 3OIQA 3ZR8X 4IZZA 4PK4A 4N0BA 2QM3A 1BI2A 3WODF 1X19A 3CJQB 2P5KA 2IGNA 1Z3XA 3MD2A 5ED4A 4A3EJ 2HGCA 3DPUA 1ZGWA 3HOXJ 1S7EA 1RKTA 5KAFC 2A07F 3T8RA 2DBBA 2KT0A 5KCMA 1GUUA 1XMAA 4XQFA 2FSWA 1U78A 4FX0A 1OKRA 2MGQA 4K2EA 3Q0WA 3CCVI 4G8XA 3S93A 2QF7A 1EV7A 4BNCA 1YX3A 2M4KA 1SFUA 2F2EA 5CVIA 2LF8A 5TGTA 4AIKA 3BTIA 1NG7A 1G8XA 4LMYA 2ID6A 3BG6A 2FNPA 3F6VA 2B0LA 2DJIA 1ZK8A 3QWLA 3I4NJ 1MMSA 5HLTA 2UWMA 1SD6A 2KP6A 1QRYA 1MH3A 3BP8A 4PJJA 3LSJA 4PJMA 2NVQJ 1BW5A 3I58A 3EPZA 1TT5B 1KYWA 5K7HA 2JT1A 2DJNA 2M9HA 2E1MC 1B1BA 3T1BA 3FM5A 2ZMEB 4L9TA 4OMZA 4PJNA 3F21A 4OINF 2VT3A 5ICCA 5HS8A 2JVGA 4XR6A 2X51A 4FQGA 2RQPA 1BC8C 1FZPB 5CYVA 3VYSB 4XKWA 1F5TA 2K7LA 4GCVA 4BH9A 1VQPI 2X0LA 5DTDA 4PJLA 2J5PA 1R9TJ 2R5ZA 1WVRA 3EUAA 4CHUA 2HVRA 4BY7J 3JRFA 3BTJA 1EKEA 1H9GA 3I55I 2HQRA 1DPUA 1GDTA 2XB0X 2W85A 1BL0A 1YITI 1G3SA 4ZZLA 1Y0UA 3ABLH 4NC6A 2HXOA 3CC7I 3GFIA 1W36D 5EEHA 3VDXA 2Z16A 1POGA 2OCEA 4BQOA 2V6EA 3ML6A 5FKKA 4AC0A 4IHVA 2OAZA 2F5CA 3QP5A 2E2HJ 5AONA 2E7WA 1MMGA 3K4MA 4KA4A 4J19A 1TQPA 2FOWA 4U87A 1R58A 3FWEA 4ETSA 4JX5A 2ZJRF 3BDDA 5AIPA 1SFOJ 3CJNA 1G6NA 1QVUA 6PAXA 3LSKA 2JQ7A 2A69F 1F9NA 2PBIA 4U7BA 4O6JA 5CQEA 3PNTA 1LEAA 2EZIA 3ASNH 4LIVA 5H2FC 2GXGA 4QPOA 1APLC 2ELHA 1FIPA 2FBHA 4NBQA 3I0TA 2DK5A 2JSCA 2P6TA 4ENMA 1FPQA 3AG2H 1ZLJA 4HDUA 3MEXA 1WJAA 4BJ6C 2IXSA 2JUCA 3E5UA 3RZDJ 4RAFA 2RN7A 1W7PB 4I2OA 1QO0D 3VSLA 1E17A 2V6CA 3E7LA 3K4CA 3CD6I 2LSOA 2HKXA 1TW3A 2NXNB 2WB1A 4B3AA 3EUKL 3TGNA 2QSHX 4OIOF 2NNYA 3I53A 1ETOA 2XRNA 3V42A 4EJOA 3OL4A 4E7IA 1RRJA 3COAC 4M3EA 4QTRA 5FLXK 4KIGA 5LRSA 4QIWN 1D0ZA 3AG1H 1Z05A 4PSWA 4BHBA 1K79A 3K4BA 3RKWA 1NK3P 1XGOA 4B3XA 2MFZA 1ONVA 5E1WA 3Q0VA 4UB6C 3GYHX 4WX9A 1LB2A 1ZREA 1LNWA 1A6IA 4PFPA 3CUQA 2WAEA 3K69A 3CC4I 1I50J 1HKTA 5L3FA 1OYYA 4LD5A 5E17F 1N25A 1RI7A 3TO7A 4KMUX 3TEDA 4U7DA 1JUSA 1HF0A 3C2HA 3EUHA 2OC6A 1XGMA 3GW2A 1G59A 1WH5A 2I5UA 2LKPA 2R7QA 3H0GJ 3PFIA 5FD5A 2X4HA 2VXDA 1J75A 4NNJA 1S6LA 4M71A 3GZNB 3J80Z 1USSA 2CH0A 2H1LA 3VYUB 2RV8A 4D5CA 4UUSB 2ZXHA 4FX4A 1T8IA 4O3MA 1U9OA 4A5MA 1SD4A 1MBHA 4NDLA 3OOUA 1FIAA 4Z6YA 1YW8A 3KZIC 1LE8A 1R4MB 3I3LA 1FWZA 4L5JA 2XPVA 2VN2A 4V19K 4E7JA 5J4VA 2Y0SA 1FMVA 5LGUA 3MVPA 3CCLI 3IHUA 3A02A 2ESNA 4P9FA 2NS7A 4JX4A 3QPTA 2JUGA 2ZFUA 1S72I 3LSMA 2K27A 3FXKA 3W2VA 3WHCA 3X2QH 2VJ5A 5HVQC 3GTKJ 5GAGJ 4CCOA 2K4BA 4XN3A 2W4SA 4OIQF 1DU6A 3EUHC 5FFXA 2L0KA 4KNYA 1PP8F 3I5UA 1K78B 3OYEA 3ERED 1Y56A 2LY9A 2RC4A 2W25A 2H94A 1Z0XA 3PIOF 4U0VA 1E3HA 2HDDA 3ZN0A 1ITYA 1X1DA 5LEKA 1W7PD 4HYEA 1VQ4I 5DCMB 3L1PA 1MBGA 2R7ZJ 2LRDA 4PJ0C 2WY7Q 4W1UA 3HL2A 1TL8A 2VC1A 3PM1A 4L0ZB 2A3SA 2LY1A 3GTJJ 2DTRA 3S1NJ 1V5FA 1OFCX 1OCPA 2MH9A 3HJEA 5J1UA 3K70D 3U21A 2CS3A 4A3IJ 4AWXB 1JJ8C 4BXUA 1MNDA 1R7JA 3E97A 3SHFA 2CGPA 3HKZN 3E6MA 2BOLA 4YRVA 5EG0A 2NNNA 1W0UA 1B4AA 3HB9A 2HS5A 2P4WA 3FXUA 1JT6A 1LFBA 5F04A 1PUFA 3LA3A 3GLLA 4A6DA 5CPRB 4XN0A 3LL7A 1S8NA 3RQIA 1MBKA 4EMSA 4XLCA 3OSGA 2DU9A 1ZLKA 4CYDA 2PX9A 5D4SA 4CZCA 5HDGA 1XG1A 4OU0A 1J5YA 2B63J 2XPUA 2FUG2 4KJZA 5ILUA 1QBJA 1YHQI 2L9RA 1UHMA 3AAFA 2R7DA 4N9IA 1JKQC 5FKMA 4DQ2A 1HDDC 3S8PA 1DGWY 2VODA 5DCFA 2KJBA 2XAGA 1FJLA 3W2WA 1D8KA 1OR7A 2JA8J 1MMAA 3K2ZA 4MIMA 4KYWA 2F4IA 2W00A 4I6ZA 4EJVA 3V8KA 2VXZA 5J8CA 4L18B 4CSWA 3CF5F 5GP9A 2DMPA 2L4AA 3GMEA 3BR0A 4I76A 2WTEA 3FXQA 1VQMI 3CC2I 3PL8A 4RAZA 2XIGA 2EFWA 2GAUA 4PUSA 5IPAA 2ID3A 3B02A 3CP2A 3D5SC 2RGVA 4NQWB 1PYVA 2QUFA 4DBQA 2XROA 3GFJA 2PI0A 2VJJA 4IHWA 4LG0B 2Z5UA 5C4JJ 1R5HA 2BVMA 5KAIC 4GRIA 1V4RA 3DBRB 1IN4A 2D1VA 4J01A 4P96A 4BL0B 2KMUA 2Z3YA 1UJ8A 4E6KG 1YIJI 3BOQA 3J7ZI 3N4MA 2NOGA 1HOMA 2Y75A 3ZCOA 3GO5A 1OR7C 5DD4A 4Y7NJ 3RPQA 2TDXA 1VQ6I 3E3VA 4XLAA 1Z6TA 2A6HF 5LGTA 1LFPA 1XCBA 1IO2A 4L9VA 2IP2A 1R23A 5LGNA 5FKNA 1YFHA 4RAYA 2JA7J 1I6HJ 2QYOA 4JQFA 2BY0A 2LKXA 1RIOH 5K7FA 4LLGF 1WSUA 1OYWA 3F22A 1XN7A 4IF4A 1VQKI 3ZQQA 1DP7P 3FX3A 3TO6A 1NHAA 1UELB 4UUTA 1WJBA 3CP8A 2HVQA 3IUOA 3SYTA 5DUKA 3KYLA 3FDYA 3V4GA 4CXFA 4A3MJ 3LNQA 4M9ZA 2YX4A 2ZXIA 4EEFG 3PQJA 2KRFA 2ZSIB 3DEEA 2GLOA 3W2AA 2LVSA 2E60A 3ERMA 4HV5A 4A2UA 3K1PA 4CZZA 3G71I 2UV1A 4IVNA 4ZJZA 1W36C 2P6SA 2ZXWH 3V7SA 1RUOA 1R49A 1U2WA 2HKOA 2EQRA 1VQOI 3KEQA 4I98B 1WHUA 3BR3A 1RZ4A 2WWYA 4OIRF 4EM2A 4BBRJ 4I0AA 2V9PA 2L7ZA 3MN2A 1MMNA 2LBFA 3WTSC 2QKMB 3E0JB 2L2OA 1ZQ3P 5D8KB 2QKLB 4KT6A 1TLHB 4Q48A 1X1BA 4MFEA 2M0CA 5F6FA 3CCSI 1J7KA 2KHMA 4WXDA 4ZDOA 2BHZA 2GOXB 2ZJQF 1FBSA 1BOBA 1OJLA 1D1CA 5CVJA 1XTAA 3ASOH 4F92B 4UNOA 3LA2A 2O0YA 1KYZA 3SZGA 1BOAA 2K86A 3DP7A 4JX6A 5HS7A 4DNCA 2JJ7A 3HPHA 5BOXA 3GTOJ 2DMTA 4HNVA 3ELKA 3NEUA 3D5LA 4WWCA 3ABUA 3SEQA 3S1MJ 4WK8F 4AIHA 2WAFA 4XORA 3GWZA 5CVVA 1T08B 3RPUD 1RUNA 2IRFG 4XLPF 2OPTA 3SZTA 1VQ9I 4M72A 2VQGA 1FP1D 1UHSA 3K2AA 5B5EC 2CV1A 1SVLA 1IW7F 3F9KA 1R22A 1ZAOA 1H9TA 4EV0A 2ZMEC 1A36A 2IA2A 4V2FA 5HNFA 3OS1A 3BWGA 1FX7A 4R8HA 2FOKA 2VKEA 4F91B 2Z9OA 2OD5A 4PDKA 1NG6A 4O5VA 3TMOA 4R1HA 4C3JJ 4A69C 1HSJA 4BAYA 2EB7A 1OPCA 2FEZA 1WFXA 4EGYA 2EIMH 2OBPA 2LLKA 3GTPJ 4DGWB 2RNJA 3B6AA 5C4XJ 2VBYA 2Q8KA 2XAUA 2Q2EB 2DMUA 4FISA 2Q0OA 3MMYB 2STWA 1XD7A 1IDZA 1QZZA 5CQGA 2IGMA 3H0DA 3QAHA 1XX5A 3DF8A 4LB5A 1REPC 3P9KA 3S1RJ 4XOPA 2WB1N 1BR2A 3KIOA 4LGWA 5EGOB 2O8XA 2HWVA 2Y69H 5KNLA 1HLVA 4G9YA 1EH8A 2CQKA 1KU9A 2XHKA 3TP0A 1X4OA 3BPVA 1OCZH 3GXOA 3JRHA 4A3CJ 4U0WA 5D6FA 2MH2A 1MSFC 4A6EA 1Y8QB 3V7CA 4KFCA 3F23A 2DMNA 2XGEA 1Z7LA 1QA6A 3OOPA 3HUGA 3K9TA 4LLLA 2LY2A 4AIJA 1IV6A 1ZTRA 2DFHA 3OYGA 4Y4RA 2ISYA 2G7HA 3CQZJ 3I4MJ 2XGDA 4XK4A 4C30A 3SDGA 3KZYA 4MFDA 2PMUA 2P7VB 2EJRA 3AFHA 1YS7A 2PG4A 1JUPA 1XDSA 5JVTA 3L2RA 2DA4A 4E7LA 3W6VA 4XL9A 3JTHA 2GZWA 2W24A 3I71A 5FRMA 3IWZA 2IAIA 2CQNA 2VBWA 2D2WA 4G6TB 4X1EA 3Q9SA 5EZGA 1CF7A 1TP4A 1TWFJ 2M5WA 4LOCA 4G94A 1AKHB 2VJIA 1TTYA 3GFLA 3PSIA 1B8IB 2L54A 1Z3YA 3K70C 2QENA 4A3KJ 4C2TA 3HGYA 2OQGA 3OIOA 1MDMB 2H8WA 3DTEA 5IOYA 3ZMDA 1F36A 2HPIA 2Y0SN 5JR3A 1X58A 4BY1J 4JP0A 4KN4X 2YPRA 3RDIA 2CV0A 2DDBA 5EZHA 1SVOA 3V8LA 3ZMSA 2TCTA 2XKPA 2HOTA 3J81Z 1O7FA 3F8BA 3ROUA 3WG9A 4HNUA 1U9NA 1T56A 3MZHA 3ZQHA 3LFKA 5E8IA 1P4WA 2HXIA 2CV2A 3WG7H 2R7VA 3CUOA 1H8AC 2X1DA 5D6EA 3DKWA 4D0PA 3DXJF 5IT9Z 1E3OC 2GIVA 1Y8RB 2MABA 2H09A 1WZ2A 2GQQA 1YW7A 2EV0A 3ZQLA 1SFXA 1IUFA 3DWLE 2JA5J 2V4JC 4P1WA 5M3FJ 2DI3A 3ZQ7A 2O3FA 4E4HA 4E70A 2HTJA 2COBA 3IKVA 2VB6A 3OYBA 3CTAA 2DODA 3KFWX 4LB6B 2R5YB 4BQAA 2E1NA 2R3SA 2JMWA 4JYKA 3HHHA 3LSPA 3WGGA 3H9QA 2XAHA 4XMYA 2L3DA 4Y52J 2XASA 3AL0B 2CG4A 5EJCA 1LJ9A 3BZCA 3M9AA 3GVAA 3BR6A 4BYYA 1TWHJ 1IRZA 3Q0UA 2FU4A 2WY8Q 3QPLA 2ETHA 5HLIA 2HQNA 4FE7A 5CVUA 1YLFA 1FEXA 3E6DA 1YJ9I 1TC3C 4RGXA 5DEQA 3WTYC 1XMXA 3DTKA 4F93B 2HZDA 4YIIA 2DTZA 2DLLA 3IAS2 4AUXA 3C1DA 2BHYA 5FO5A 3K6GA 3F8NA 3I4PA 4R79A 3SEZA 2NVTJ 3BTCA 4LK1F 1NTCA 4FE4A 4AIDA 3A01B 3F8FA 3DCFA 3CDIA 2A6EF 1XPXA 1AHDP 2MSYA 3HEFA 3Q3SA 3IH2A 2ME0A 1F1ZA 5LHIA 1J9IA 2BGCA 3S3MA 3TQNA 4YFNF 3OSFA 4LIUA 2QGUA 1ZR4A 1E2XA 3FHNA 3P9IA 1ZGAA 2IPQX 4PGGA 3KYCB 4ZDPA 3IKTA 1ZG1A 1P4XA 2VI6A 1MSEC 1USTA 5F0HA 2CYYA 3BG9A 1DPRA 1RPWA 2X85A 3RKQA 4M3BA 3TOBA 4A93J 2K5CA 5IYDJ 1TNSA 1HKQA 3LAPA 1JKOC 4Q4ZF 3J7AY 3ZMZA 4MEYF 2JZYA 2QBYA 2ZNZA 1AA7A 1OCCH 1VQNI 1GHCA 3BTLA 1D1BA 5FGMA 2XGCA 3DLAA 3FISA 4UV8A 4C3IJ 2ACJA 2DW4A 3CESA 3BR2A 1YJWI 3C7JA 4ITVA 3S16J 3BROA 2QVOA 3BG7A 2K3FA 2A5YB 2BY2A 4XRSA 4DZPA 1P2FA 1Y39A 1T6SA 4MTEA 3KLOA 2R7FA 3IL2A 4C2UA 1P6RA 3WTTC 1ORKA 2DA3A 2NVUB 3JRDA 2E1OA 5E8GA 4RMNA 3HYIA 4RA2A 5FD6A 3ESWB 1B6AA 1XGSA 2CQ7A 2P7CB 3O6BB 1W5CC 3ZQFA 4G6QA 1KONA 4M6VA 4UXNA 3FXJA 2R7RA 4BEHA 2CU7A 3HZJA 1ZGJA 1LVKA 3RQ4A 2P0WA 4Y33A 4XRMA 4KICA 1LKXA 1OLTA 2OZ6A 5K5RA 3L2WA 1MJ9A 1HBXG 4YIFA 3E1SA 1EH7A 4XLFA 3VOEA 3QYEA 5LRRA 2V79A 1BJZA 2DT5A 3H5NA 3GCMA 5LBQA 4OAZA 2ZO4A 3JRCA 2E5NA 3OMYA 1EJ9A 3SDBA 4PSXA 4IHXA 2CW0F 5GPCA 3ZMVA 4FTHA 1YO5C 1OCOH 1R1UA 2MLKA 2X9DA 3HOYJ 3HSFA 3A03A 3FHZA 1HC8A 2PQ8A 2DDAA 3VODA 3K10A 2ZSHB 5FLVA 4QSHA 1V5GA 4IXAA 2ISZA 2BW3B 3ISPA 3IP4B 1A35A 2ZXJA 1DP3A 4GYGA 2M4GA 3QU6A 5M5YJ 1SFEA 2FQ4A 3LSIA 3W6KB 4C9YA 3L2CA 3K4JA 1PJRA 4M3DA 1BBYA 4Y3OA 2PJPA 1G3YA 1YYVA 3I9V2 4ZZDA 1FOXA 3K1NA 2EIKH 1ETKA 3BT9A 1FNNA 1P4AA 3H36A 2V1DA 5ILSA 1Z6RA 2ESHA 1DDNA 1G3WA 2KZVA 4L5IA 3IRRA 1VTNC 5IOZA 1HCRA 1ETQA 1ETXA 1YE9A 3F8MA 2IJLA 5GAEJ 4ZYEA 2VKVA 3CO6C 2VT2A 4HV6A 3HOUJ 2DOFA 3HTUA 4RB0A 1A5JA 4RGSA 2JTVA 1SAXA 2M34A 2VOOA 1QZYA 3NRVA 5TJJA 2EILH 1YX5A 2F5DA 3I54A 5LD2C 1WQ2A 1I6XA 3LSRA 3G73A 5L3GA 5E3OA 4BQQA 1ZRCA 2AQFA 1AOYA 4HOBA 2J5OA 3C2GA 1XCVA 2E1CA 1J59A 3M8FA 4YG2F 4HSRA 1V5EA 1FY7A 2DXIA 2FA5A 3HG9A 3NAUA 1YIOA 3JAMZ 2LP0A 4G12A 3S2WA 3HSRA 4I7HA 4EATA 2IA1A 1ZKGA 1U5TA 5DS9A 2CFXA 1Z67A 3I59B 2PJRA 2VQHA 2CUEA 2KRHA 1KQ8A 5K1YA 2K02A 2XF5A 1B9NA 3BR5A 5IP9J 2EPFA 1V54H 1QVTA 4EJWA 2FNAA 1I27A 2M2EA 4BJTA 1JE8A 1IXRC 2LTPA 1QGPA 4MGRA 1U8BA 1UFMA 2P5VA 2VE9A 4IJAA 4GXOA 4XRFA 2I8DA 4OWRB 2VL8A 1ON2A 2E5ZA 1K7AA 1YRNA 2KLOA 1K4TA 1T98A 3FBNB 3GF2A 2CFOA 2KZGA 2K3PA 2KDOA 5HDNA 2OZUA 3J80K 4IHYA 1IC8A 2R93J 4KITB 3QOPA 2M87A 2OU2A 4BE2A 4M6XA 2FD5A 1D0XA 2K4JA 2ELJA 2GA2A 1IGNA 4B4CA 1L3LA 3L2UA 1U5TC 1Q1VA 2OF7A 5D5UB 4X6AJ 1UAAA 3JW4A 2M1BA 3FKJA 3HBLA 4A0XA 1JXSA 4HF2A 1SANA 5DM6F 2OQRA 2HR3A 4PCQA 4XLNF 1IZ1A 1WJEA 2FF4A 3EYYA 3QPHA 2QSGX 2LF7A 3QYFA 2XGXA 1HSTA 3TBIA 1JGGA 1G3TA 4WXHA 1S7OA 1TZLA 1WKMA 4D7MA 1RR7A 2WA0A 1UB9A 4P5OA 1ZG3A 3DPTA 3EETA 3L9FA 3S15J 5EEAA 1WJFA 4C2MJ 1JHFA 1FYKA 1WJCA 4NC8A 3TL4X 2LR8A 2R7OA 3HOTA 1FTZA 4ANJA 4KT5C 3ZQIA 1MGTA 3FXRA 2HFHA 3NWTA 4RBOA 4RGRA 3RKYA 3HTSB 1Y6IA 1E3PA 3R4KA 4RGUA 3UR3C 2V1XA 4BU2A 2Y31A 4HQEA 3MCZA 5M5WJ 1R6RA 3ABKH 1Y0NA 3C2BA 4Y17A 1MD0A 4S0HB 4L0YB 2R5ZB 2VLAA 1OMIA 1X3UA 4U88A 4MTDA 3MQ0A 1Z7UA 1T0FC 4JK1X 4EQQA 2M3AA 2DA5A 2TRTA 4H0EA 1N78A 1MKMA 3QPSA 1V55H 1X4PA 2M7BA 3NWSA 2K9NA 5F27A 2KIUA 2QSFX 4LJZF 2O7OA 1O3QA 2DCEA 2D1HA 1NH3A 3K4LA 1UZCA 1ZRDA 2CQXA 1X3ZB 1R00A 5IY5H 5E3NA 2R7XA 4QLCU 5HNHA 2PMHA 2E19A 4Y15A 4CCLA 2E71A 5GTIC 2GOMA 4TV7A 1GXQA 1BN5A 4I0BA 5M5XJ 3H1CA 1I3AA 2COMA 3HRUA 2KL4A 3PFYA 2CSOA 2V26A 3FM3A 4RB1A 3JRBA 3LSHA 3SXYA 2ELKA 1ENHA 2EZLA 2CUFA 2NS8A 4IX7A 4HEA2 3PSFA 1MBEA 2VQLA 2C6YA 3GFMA 4BQNA 5JLWA 3CCJI 3T5XA 4NUBA 3G1OA 3BCBA 3VB2A 1TQIA 4ENJA 3OL3A 3B73A 2IA0A 4KMFA 5D5VB 1I1SA 3AG4H 3BG5A 4I09A 2HVSA 4IOCF 2BVLA 1JUMA 2O03A 3S2HJ 5FKLA 1WH7A 5DYMA 2FBIA 2YR2A 4BEHB 4LFUA 4D1QA 3TP3A 3CCYA 3CMMA 3FMSA 2K85A 1IN5A 2IGKA 3DKYA 1R5GA 1UCRA 5CKTA 2K9LA 2KIQA 2JPBA 1XS9A 2Y9ZA 4BBSJ 1WRJA 3I56I 1H88C 2F48A 5F0CA 2STTA 4E7SA 2X1EA 5BPIA 3RKXA 2MBFA 3DTIA 5E1XA 3KYDB 5K5OA 2DAOA 5H20A 1KQ0A 2AXLA 2XRLA 5LHHA 1ZYRF 2EA2A 2ZMEA 3HM5A 3BR1A 2X48A 2OTLI 2CW7A 5CVRA 1A6QA 5KHDA 3A0BC 3M8JA 3IH3A 4F52A 5F64A 3CUQB 2DQRA 3PO3J 1HKSA 4II2A 4CDGA 4B47A 1LDJA 2O8KA 2MC4A 3SZPA 1RC9A 4N4OB 1HDPA 2YSRA 5L3DA 3J7YJ 4UVAA 1N75A 4G6DA 4AYBA 1QU3A 2Q1ZB 3R60A 2F4MB 4A0YA 3KCCA 3ZMUA 1BI1A 2L4MA 5F1JA 2GWRA 4BHPA 3FBIB 4RLFA 2VJ4A 2V7FA 1Z91A 3K4KA 2MC3A 2OCCH 2DT7B 3SQNA 3DKXA 3OR1C 1OYIA 2GXBA 5K5QA 1LE8B 2IS2A 1YI2I 1NK2P 1TW2A 5FFZA 4ESBA 1UMQA 2DO7A 2QQAA 3VPRA 4ZYAA 1J2XA 3PO2J 4OAYA 1T38A 3HOZJ 3WE3A 2F6CA 3SJMA 3ECHA 5JI6A 4RM2A 4FETA 1MH4A 3DEWA 2WBMA 2E34A 2CQQA 4M74A 3U9GA 3CCMI 3K1MA 1D8JA 1IN6A 4CH7A 5M3MJ 3CLOA 2R7SA 4D7NA 1B72A 1QPIA 2BZTA 1MNEA 1YG2A 5A2QZ 4G7OF 3LQQA 1G4DA 3BY6A 2NOJB 4CICA 1IRGA 3ZGKA 3BJAA 1Z9CA 2P8TA 5JVGF 3G2BA 3PJRA 4UB8C 4I01A 1W7PA 4B8XA 2CRGA 4F55A 1H89C 2KJCA 2MD0A 5TRDA 1QHGA 5C44J 3REOA 1BJAA 3U1DA 2X6XA 5LHGA 2MLGA 3A4CA 3KX2A 3DU5A 3F0CA 1VQ8I 4HF0A 2UUZA 1B9MA 1IDYA 2UXXA 4ZYDA 5GAHJ 1I39A 4A3DJ 3ZN1A 1GLNA 3S14J 2FX0A 4DYQA 4F7ZA 4B48A 3S17J 4HQMA 4XSZF 4XRSG 2CWEA 5HODA 5EG0B 5D5WB 4P9UA 3WE2A 3CMEI 1WI3A 1QPMA 3HXLA 1IUYA 4BE0A 3K4NA 4BDYA 1PUFB 5FROA 3SFZA 2JPCA 4G7HF 1ON1A 2F5FA 3RCOA 1KA8A 2Y2ZA 5FJ8J 4HPQA 3HPGA 3P9CA 2B7EA 1R71A 2BEOA 4YFKF 3TDUC 1B59A 5B3SH 1EF4A 2A6TA 3OWTA 2EZHA 2LH9A 5F1RA 1CQTA 3I64A 4HLXA 1ACIA 2MYSA 2IEKA 2NVYJ 2Y30A 1Z77A 2XAQA 1WI9A 2LMDA 3NARA 4UUSA 2V1UA 1P7IA 2L9VA 4P55A 3RYPA 1KU3A 2F5VA 1VNDA 3VFZA 1GXPA 1F4KA 1FYLA 3CDHA 2LK2A 4XBFA 1H0MA 3M07A 5J1RA 3H5RA 3K7AJ 5D5XB 1MIJA 3OYAA 1FSHA 2EK5A 5FRNA 1SFKA 1Z21A 2DA2A 4BDZA 3H5AA 3DBHB 3AKZA 3N05A 1DQUA 2LC2A 1DU0A 2FMLA 4JBAA 3A2KA 4YFXF 3S2DJ 3TW7A 5LLQA 2W48A 2YU9J 2R4GA 4HSTA 2JSPA 5H6RA 5B1AH 4IOAF 3PUBA 3FK7A 3K0LA 1K78A 3OYHA 2AS5F 1LDDA 1ZARA 2VQCA 1HQCA 3NQOA 2Z33A 3FK6A 2FMYA 2JRMA 2L7MP 4Q5SF 2PFBA 4X0GA 3FXLA 2EWNA 4HA8A 5L3BA 3IRQA 1W0TA 1PP7U 5DCMA 2LREA 2K9SA 1O57A 2WC2A 4AU7A 2HDCA 2D5VA 1YQAA 2L9NA 4FCYA 3OYDA 5BPDA 2ECCA 3RI4A 1RETA 1MBFA 5HS9A 3W6JB 1T95A 2B9SA 3BCAA 3OYJA 3RTRA 4CCJA 1SVMA 2N8GA 5E3MA 2CUZA 2E2IJ 2R92J 2HZTA 4KIFA 4DZJA 3ZQGA 1IXCA 1BR1A 2JWTA 4D5FA 4XLEA 4J00A 3QP6A 2L7FP 4HF1A 5E20A 4LITA 3LQRA 2O61A 4KISA 3A0HC 4CGZA 2GA1A 3WU1B 1R5ID 4A5NA 2O9LA 3L09A 3R6SA 2WAQA 2RKHA 4M9XA 5ICGA 3GZ6A 1BI3A 3HIFA 1ZN2A 4RB3C 5TISC 1BC7C 3HC7A 1HW1A 2VPRA 2HPMA 3J81K 3O8GA 3GLXA 2AO9A 1PDNC 1FSEA 1XMKA 3DLLF 1K6YA 3VWBA 2OJED 2LD5A 2NRAC 2WV1A 3JSOA 2DFEA 3EYIA 1WGXA 5E3LA 5HLHA 3CCEI 2OA4A 1D5YA 5IT9K 1SD7A 1TBXA 2IGOA 3JCUC 3MKLA 5BQTA 2FXAA 1HXDA 3OYCA 2V9VA 2KPMA 4CYCA 2LBFB 4HX7A 3LOCA 2XAJA 1O3RA 3HGGA 3WTZA 3TO9A 4GGGA 3L2QA 5C3EJ 2DOEA 2HOAA 1UHWA 2V9KA 3LSGA 2XF6A 4L5EA 1UG2A 3F8CA 3OYIA 4LLNA 1MZBA 2M7AA 3BG3A 2V1NA 2DPDA 2JRTA 3ZMTA 2QA4I 4MQ9F 1ZG5A 5E18F 5KK1A 3S3OA 2UXNA 2YX7A 3DBLB 5IYCJ 3JTGA 2OTJI 3GUDA 3MKZA 5L3CA 4ESFA 2PEXA 4E7KA 2QZ8A 1FOWA 4IQJA 2BV6A 1X2MA 4JOMA 1SEUA 2RDPA 2YS9A 4NQWA 4ZYHA 2R0QC 3ECOA 3E6BA 4HNTA 4N4NB 4LG0A 5FLXZ 3JRIA 4IO9F 4ENNA 3HDDA 3CDLA 3MKYB 3LMMA 2CMPA 4XM3A 1BW6A 1MJAA 3KP2A 5J47A 2PLYA 4XNFA 3RPUA 5B66C 5DV5A 3GX4X 3H3ZA 2FQ3A 3L7WA 2QQ9A 3OS2A 2E7XA 2VKDA 2UZKA 3FMQA 4CUGA 1FBQA 2BY1A 1N77A 4Z2YA 2H6CA 2LDUA 2DPUA 4I99C 4A3BJ 1IV8A 3HHGA 3F6OA 4QWQA 2A68F 4H4KC 2MG4A 2R7TA 1XSDA 1VFCA 2KIFA 1GT0C 3ZPLA 2MA3A 2KQRA 3E5QA 3KEOA 5FLMJ 3ZRGA 2ZJPF 3AG3H 5L3EA 4ESJA 2JA6J 2VBXA 1B72B 3QQAA 3QODA 4PGHA 1IN7A 1W5SA 1JGSA 3KP7A 4L9JA 3O2PE 4FT8A 4RAGA 2E36A 4MQVA 4B44A 2XAFA 3ULQB 2DYSH 1HA8A 2NYXA 1MJBA 2NVXJ 1AU7A 2EFQA 4N9HA 3L00A 2E35A 1FYMA 3TW6A 2GXAA 4NHJA 4ZC3A 3IAM2 3T0YA 2QWWA 3DQVC 2O5RA 2A05A 2LNBA 4DJAA 3JSPA 1I3QJ 1X1PA 3OS0A 2HTSA 3U2RA 2RAEA 2VPLA 3A1YA 1M1EB 2X1CA 4WCGA 4MO7A 3T8TA 3GTMJ 1ETVA 2W84A 3HUGB 1D0YA 3TDZC 3BQZA 3IC7A 1EA3A 2R7WA 4HLYA 3V8JA 2PMZA 2MD5A 1F43A 1VI0A 3PNYA 1X3WB 3O3KA 1JTYA 5F08A 1LDKB 3MWMA 1K61A 2M30A 3G6EI 2DA7A 2F4OB 2K9QA 1C0WA 1ETWA 1FP2A 3VYRB 1T39A 4AYBN 2FJ1A 2EFPA 3ZP5A 2GBYA 4XONA 2EINH 2Z99A 3JRGA 3OYMA 1XSXA 2ADUA 5AIQA 3DV8A 1CF7B 3FXOA 2IW5A 3DPLC 4IPAA 4S04A 4E7ZA 3HOWJ 1QNTA 3BJ6A 2EA4A 4I02A 2M8EA 3FIWA 3Q9VA 3GBGA 2AXTC 4IRHA 3H3VK 4IKFA 1XSVA 2L02A 3F3XA 4A0ZA 3PIPF 1K6OA 2F5EA 3OV8A 1A04A 5J4YA 1KQ9A 1FMWA 1BM9A 2X6OA 5F0FA 3UNGC 4G7ZF 4ENKA 2IT0A 3CUQC 4QPQA 1OISA 2VC0A 1GVJA 2EFNA 2IS1A 4EM1A 1SMTA 1SD5A 2P5LC 2VASA 3WGIA 1R36A 2Y0MA 5E1ZB 3WGHA 2RREA 3H92A 3CJRB 3R61A 5HLGA 4S05A 3BC8A 2Q2EA 3FF5A 4NB5A 2GIZA 2WV0A 2CW8A 2E1MB 2M8GX 5EF6A 5BMZA 2DFIA 1X1AA 2LYCA 2VE8A 3M8EA 4E7HA 2JVHA 4DYCA 2D45A 4A3GJ 2HEOA 1WJ5A 3FXMA 5EGOA 2BXYA 1OCTC 3G3ZA 3GZ5A 2XC7A 3GTQJ 4ASNA 4HBLA 1ODDA 2BBYA 1W1WE 2IBDA 1T0FA 4MHGA 2EIJH 1BIBA 3JAMK 5JLXA 1IF1A 5DUIA 4IHSA 1T33A 3DEUA 4Y13A 1IRXA 1Y1WJ 3M7GA 3HRMA 2EV6A 2KRCA 1S29A 2I10A 4UV9A 1WJDA 2BY3A 3H9GA 3RSNA 1JKRC 4OMYA 3LA7A 3HOSA 4ZH4F 5IYBJ 4XKCA 3IH4A 3CJTB 1ZHFA 1STZA 2AHQA 1TWCJ 2CJJA 4KUMA 1GV2A 4HG2A 4IL6C 1SAUA 4ZDLA 4EGZA 1VQ7I 2KFDA 2ZC2A 3W3CA 1OCRH 3M1CA 4PFOA 4DW6A 1MW7A 5ILVA 3D5RC 3QU3A 9ANTA 1AKHA 1OQYA 1TQMA 2DA1A 3ABTA 2VBZA 2X6YA 3WU2C 4ZTFA 1KGSA 1B8IA 1TT0A 3KPHA 2PN6A 4UVCA 5B1BH 4HW0A 3WTUC 3HOVJ 4CYCB 3TKYA 2IS4A 2AQEA 1I5ZA 2E2JJ 2QCOA 2R7UA 1L0OC 1MDMA 5J6XA 3LWFA 1QZEA 4MLOA 1JKPC 3C3WA 2IS6A 5ICFA 4HX4A 4XSXF 5JHUA 1ZR2A 4BKXA 3BZKA 4OOIA 2EBIA 3MFKA 3BZ6A 5EEGA 3HSEA 3GTLJ 1V3FA 2JA2A 3GEZA 4M3FA 2L9SA 1WPKA 3GTGJ 3KEYA 1VQLI 1W5TA 1U3EM 2FBKA 2Z2SB 1O3TA 2LG4A 3LSTA 4IHTA 4RDUA 1FTTA 2QBYB 1YS6A 1XGNA 3F72A 4AVZA 4BJ5C 5ERIA 4GYIA 3H35A 5BNGA 1ETYA 2HOEA 3B6CA 3OYNA 2H27A 3C18A 3G4SI 4KIBA 3UKGA 4IQ4A 3KP6A 4HRIA 1FT9A 3MKWB 1S9HA 1AWCA 1BIAA 2W82A 3BJOA 4AD9A 1U6GA 4XKVA 2DMQA 1ERDA 3CCRI 1LQ1A 2HYFA 4EM0B 2L01A 4MNUA 2L5QA 4NC7A 3PQKA 3BQYA 4FHTA 4XKBA 5CJ9A 3U1KA 1JI8A 5K7ZA 2R5YA 1JT0A 1QQIA 1W4MA 5DM7F 2MW8A 3IWFA 3S32A 2XDVA 3WTWC 1LUJB 3D1NI 2NS0A 4ABZA 4EJTA 3LFUA 1ULYA 2ME6A 2CUJA 2KIMA 4XICA 1RR8C 1O7LA 1U0JA 1R1VA 3OIPA 3HRSA 4EVIA 5IP6A 4UHTA 5FKOA 2GM4A 3OYFA 2VOPA 4L9NA 4LK0F 4YEJA 1IG7A 4DYRA 4A3LJ 2HOSA 4XLHA 3O8HA 3G1MA 2WAQN 5GPAA 2XV4S 4CO8A 1FBUA 2DFFA 3MZ8A 1WCMJ 4PZJA 2ICWG 3EDPA 4RLQA 3KE2A 1HW5A 5IP7J 3KETA 2A5WA 2BE5F 2XVCA 2HNHA 2X6WA 1KZHA 5BS6A 5D4RA 2G9WA 2HQAA 2XSJC 3CF2A 2YUSA 3H3UA 1FOYA 2P81A 4HX8A 4B1RA 3A01A 4ZTJA 1Y1VJ 4LG3A 3E5XA 1YJNI 3FZVA 4GO1A 4D9JA 3ONQA 4V2GA 4C3HJ 3KP4A 3AL0C 1IRFA 5HDKA 3D0SA 4IRGA 1O3SA 3L2VA 1G2HA 2DN0A 3M1EA 3N97A 1BR4A 2ZJ2A 3M4OJ 2BXZA 1IXSB 2ECBA 4BUPA 4BE1A 1GVDA 4OIPF 3OYKA 2W1OA 1ZRFA 2G7UA 2CO5A 2H6BA 4AVPA 2EV5A 2IVMA 4ON0A 1GV5A 5IT3A 5JFRA 3CMAI 2VONA 2DYRH 3PNVA 3DFGA 4DOZA 1JHHA 4GFBA 1I1GA 4A12A 4HDVA 1KU2A 3KZZA 5J8FA 4GDFA 3FKIJ 1TWAJ 2RQQA 4WF2A 5LFAA 3CO7C 4IRIA 3JR9A 1T2KA 5D8LB 5JHFA 1JTXA 1IN8A 1DGRM 4BXFA 1U5TB 4BGDA 3M3YJ 5CLSA 3KLNA 2EH3A 2YU3A 5EYRA 1U8RA 1Z1DA 2PJRB 2KISA 1S7AA 4CCMA 4CCKA 5J40A 5ICEA 1VZ0A 1YOVB 4BHCA 2HU9A 2ZB9A 1QHHD 3BPXA 1FOKA 3MAJA 4ZYGA 2Y48A 2Z1DA 1R1TA 1K83J 1S5LC 1TWGJ 3QRFF 4IEJA 2EFOA 2KDZA 1RNLA 1YTYA 2QQBA 2ZKZA 3R0AA 2NAZA 3S3NA 1IJWC 1WWXA 2LKSA 1CGPA 1D1AA 2ZNYA 2HYGD 3MZYA 4YIRX 4MEXF 1YRNB 2DQLA 3P5JA 1A31A 2DT6A 1XDUA 2L7KA 3EQLF 3ZOBA 2W7NA 2H8RA 4KN7X 5J1YA 1D5VA 4CCNA 3KP3A 3ZXSA 2DA6A 4M3GA 2XPWA 2Y9YA 4A3FJ 2EZKA 4U0YA 5H6QA 3DU6A 2W57A 2QEXI 1VQ5I 1FLIA 2LOOA 3HKZA 1ZH5A 4W97A 2LFBA 3LAJA 1LEBA 1X2NA 2BW3A 1O4XA 2ZFWA 1RESA 3H9JA 3CZ6A 3WTXC 1K4SA 1LPQA 5GTHC 3ZQCA 2HDWA 4RB2C 3KP5A 3PUFA 3OYLA 5KVRA 2WADA 4UVBA 1X1CA 3RYRA 2VUMJ 3P7NA 1UG0A 2HQ5A 2K9MA 3OR2C 2H1KA 4B43A 3JRAA 4B09A 3WTVC 1ZELA 2RVCA 1KU7A 2XKOA 3CCQI 3RIRA 2QLZA 1MMDA 1SMYF 1JJ6C 5FB2A 5LEJA 1IAWA 4M9SA 4FASD 2XSDC 3RJPA 4KDPA 3FMRA 4BXXJ 4XOTA 1J09A 4BACA 3WHBA 2G0EA 5HOOA 1BI0A 4AM3A 2HYJA 3JREA 5A2QK 4Q47A 3R0JA 3V7RA 4WXCA 2PMZN 3Q5FA 2XF7A 1PVEA 1PUEE 2O6GE 3RZOJ 3VEPA 4F3QA 2QQ8A 2HI3A 4EJUA 4M6YA 1MNMC 3S1QJ 1XB4A 4HZFA 4YELA 2M45A 5DD8A 1TNTA 2FRHA 3TOAA 2FE3A 3OY9A
chains in the Genus database with same CATH topology
1MMNA 2LBFA 2QKMB 4CUGA 3QOEA 2RNGA 3L2UA 4CA0A 3E0JB 2L2OA 3QYBA 1N77A 2QKLB 4KT6A 1X1BA 1UAAA 3FKJA 1P9QC 2OUMA 2KHMA 3BLYA 3VSKA 4ZDOA 4DBRA 4H4KC 2GOXB 2R7TA 4BS9A 4RM3A 1BOBA 1WJEA 2KQRA 1D1CA 4F92B 3ZRGA 3SZGA 3QYFA 2VKHA 2DOAA 3TBIA 4II3A 1TZLA 3HPHA 4DIQA 3QODA 2WA0A 4P5OA 3D5LA 3SEQA 2M0MA 3DPTA 2WAFA 4XORA 1E0EA 2OV7A 1WJFA 2VIXA 3VYTB 3OIQA 3RPUD 3ZR8X 1WJCA 4NC8A 3TL4X 4IZZA 4PK4A 4B44A 1X19A 3CJQB 2R7OA 3HOTA 2VQGA 1HA8A 4ANJA 2IGNA 1Z3XA 3MD2A 3DPUA 2CV1A 3NWTA 1Y6IA 3F9KA 5KCMA 3UR3C 4BU2A 4ZC3A 3IAM2 4XQFA 1R6RA 3DQVC 2O5RA 5HNFA 3OS1A 4DJAA 4F91B 3S93A 3OS0A 2VLAA 1YX3A 1NG6A 2M4KA 1T0FC 3A1YA 3TMOA 2VPLA 2M3AA 2X1CA 1N78A 1X4PA 2M7BA 3NWSA 5TGTA 2R7WA 3HUGB 1D0YA 1WFXA 2DCEA 1NG7A 1EA3A 2PMZA 3K4LA 1G8XA 4DGWB 3PNYA 3BG6A 1LDKB 2DJIA 2XAUA 2Q2EB 2R7XA 5HNHA 3MMYB 5HLTA 2UWMA 4CCLA 3VYRB 5CQGA 2KP6A 4PJJA 4PJMA 2GOMA 2IGMA 3EPZA 3H0DA 4XONA 3PFYA 2KL4A 2V26A 3OYMA 3LSHA 2E1MC 4XOPA 4IX7A 3DPLC 4HEA2 3PSFA 1BR2A 2VQLA 4PJNA 4E7ZA 4BQNA 2JVGA 4XR6A 2X51A 5KNLA 3GBGA 3VYSB 1X4OA 4XKWA 4NUBA 3BCBA 4IKFA 3OL3A 4PJLA 3EUAA 2HVRA 2HVSA 1FMWA 3UNGC 2BVLA 4QPQA 2IS1A 1Z7LA 4BEHB 2LY2A 2VASA 3OYGA 4Y4RA 4D1QA 2RREA 3CMMA 3CJRB 1W36D 2IGKA 3BC8A 3DKYA 4C30A 3VDXA 2Z16A 5CKTA 2K9LA 3AFHA 4BQOA 2V6EA 2CW8A 3L2RA 2E1MB 4E7LA 4E7SA 2X1EA 4XL9A 1MMGA 1X1AA 2LYCA 3DTIA 3K4MA 5FRMA 4E7HA 4G6TB 2JVHA 4U87A 1WJ5A 2VJIA 3PSIA 2XC7A 3LSKA 2CW7A 1Z3YA 4U7BA 3K70C 5CQEA 3PNTA 4LIVA 4C2TA 5KHDA 3M8JA 4F52A 3DTEA 4QPOA 4II2A 2HPIA 4B47A 2CV0A 1IRXA 2MC4A 2KRCA 1WJAA 4N4OB 2IXSA 4BJ6C 4HNUA 1WJDA 1N75A 3H9GA 3RSNA 4AYBA 2CV2A 1QU3A 2Q1ZB 2R7VA 3HOSA 2X1DA 3VSLA 4XKCA 3K4CA 2MABA 3FBIB 4RLFA 2VJ4A 2V7FA 2WB1A 3K4KA 4HG2A 3EUKL 2DT7B 3DWLE 1SAUA 4ZDLA 3DKXA 2V4JC 3OR1C 4P1WA 3V42A 3W3CA 3M1CA 3OL4A 4E7IA 4PFOA 4E4HA 2IS2A 1MW7A 1D0ZA 2VB6A 3D5RC 4PSWA 3OYBA 4ZYAA 3K4BA 2X6YA 4OAYA 4ZTFA 4B3XA 1TT0A 2F6CA 2MFZA 2IS4A 4RM2A 2AQEA 3H9QA 4FETA 2R7UA 4PFPA 4XMYA 4MLOA 2WAEA 2WBMA 2IS6A 3AL0B 4CH7A 2R7SA 2JA2A 2L9SA 3C2HA 2OC6A 1MNEA 3KEYA 2WY8Q 1G59A 2R7QA 2Z2SB 2LG4A 2NOJB 3ZGKA 2VXDA 3G2BA 4AVZA 4NNJA 3PJRA 4BJ5C 4F55A 3DTKA 3H35A 4F93B 2CH0A 2HZDA 3VYUB 3OYNA 2MD0A 1QHGA 2ZXHA 3IAS2 4IQ4A 4HRIA 3OOUA 3MKWB 3K6GA 2X6XA 1S9HA 2W82A 3A4CA 3KX2A 4R79A 3I3LA 4XKVA 3SEZA 1ERDA 3DU5A 2UUZA 4E7JA 1GLNA 2L5QA 4NC7A 2Y0SA 1FMVA 4XKBA 1JI8A 4B48A 3S3MA 2JUGA 2ZFUA 4LIUA 3FHNA 3S32A 3LSMA 3W2VA 3HXLA 2XDVA 5HVQC 2VJ5A 4ZDPA 4BE0A 3K4NA 4CCOA 4BDYA 3LFUA 5FROA 4XN3A 2W4SA 2CUJA 3EUHC 2X85A 3RCOA 3OYEA 1U0JA 1Y56A 2K5CA 3HPGA 3OIPA 4HPQA 3OYFA 3J7AY 2A6TA 4YEJA 1X1DA 1AA7A 3OWTA 4XLHA 2LH9A 2LRDA 1D1BA 3DLAA 2MYSA 2WY7Q 3HL2A 3CESA 4RLQA 2A5WA 4ITVA 2LY1A 3BG7A 1V5FA 2F5VA 2HNHA 2X6WA 2HQAA 2XSJC 3CF2A 4C2UA 3K70D 3U21A 2CS3A 3H5RA 3OYAA 4ZTJA 4LG3A 4RMNA 1MNDA 5FRNA 1SFKA 1Z21A 4BDZA 3H5AA 2BOLA 4YRVA 3AKZA 3N05A 4D9JA 3ONQA 1DQUA 2LC2A 3A2KA 3AL0C 1KONA 2R4GA 4HSTA 2R7RA 2JSPA 3L2VA 4BEHA 3RQ4A 1LVKA 3PUBA 5CPRB 2P0WA 4Y33A 1BR4A 4XN0A 1LKXA 1OLTA 3LL7A 3OYHA 2VQCA 3L2WA 4XLCA 4BUPA 4BE1A 3E1SA 4XLFA 3OYKA 2W1OA 3QYEA 3H5NA 4CZCA 4X0GA 4OAZA 2LREA 2E5NA 3OMYA 2FUG2 4KJZA 4PSXA 3PNVA 3SDBA 4DOZA 4AU7A 2L9NA 3OYDA 3S8PA 1DGWY 3K10A 2ZSHB 3W2WA 2RQQA 1V5GA 5LFAA 1T95A 2BW3B 3IP4B 3BCAA 1MMAA 3OYJA 5JHFA 3RTRA 1DP3A 2M4GA 4CCJA 2F4IA 2W00A 3LSIA 2CUZA 4C9YA 1DGRM 2VXZA 3K4JA 4BXFA 1PJRA 4CSWA 4BGDA 4Y3OA 1BR1A 3I9V2 4XLEA 4J00A 2PJRB 4LITA 4KISA 4CCMA 4CCKA 3PL8A 1VZ0A 2HU9A 4PUSA 1QHHD 2KZVA 2Z1DA 2WAQA 1YE9A 3CP2A 3D5SC 4NQWB 1PYVA 4DBQA 3S3NA 3HC7A 1D1AA 2HPMA 2VJJA 2BVMA 4GRIA 1YX5A 2DT6A 2L7KA 4J01A 1K6YA 2W7NA 4BL0B 2KMUA 5LD2C 3VWBA 4E6KG 4CCNA 3ZXSA 4BQQA 2AQFA 3C2GA 3ZCOA 3DU6A 1OR7C 2LOOA 3HKZA 4HSRA 1V5EA 2IGOA 3OYCA 2DXIA 2BW3A 2KPMA 2LBFB 3HG9A 4XLAA 3H9JA 3CZ6A 1LFPA 2HDWA 4EATA 3L2QA 3OYLA 2V9KA 2WADA 3LSGA 4JQFA 2XF6A 1X1CA 3OYIA 2M7AA 2V1NA 1UG0A 2K9MA 2VQHA 2PJRA 2KRHA 3OR2C 4B43A 3S3OA 2XF5A 3ZQQA 1ZELA 1UELB 3MKZA 1WJBA 3CP8A 2HVQA 3IUOA 3SYTA 4E7KA 1MMDA 4IQJA 4JOMA 4FASD 3FDYA 3KYLA 4BJTA 2ZXIA 4XOTA 2ZSIB 3DEEA 3W2AA 1J09A 4BACA 2I8DA 4HNTA 4N4NB 2E60A 5HOOA 4OWRB 2VL8A 2E5ZA 1W36C 2UV1A 2KLOA 3LMMA 4ZJZA 2CMPA 4XM3A 2XF7A 3FBNB 3MKYB 2CFOA 4XNFA 2K3PA 2KDOA 4F3QA 4KITB 4YELA 3OS2A 4BE2A 1D0XA 3OY9A 2ELJA 2VKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGW B;  2E60 A;  1UG0 A;  2DT7 B;  2E5Z A;  2DT6 A;  1X4P A;  1X4O A; 
#chains in the Genus database with same CATH topology
 1RKW A;  3CCU I;  3J7A O;  4UY8 I;  3QOE A;  2RNG A;  1BA5 A;  4CA0 A;  4HAM A;  3QYB A;  2K40 A;  2BYV E;  3CLQ A;  4A3J J;  2XUB A;  2JK3 A;  4M73 A;  1SC7 A;  1D3Y A;  1P9Q C;  2OUM A;  2JN6 A;  1J0R A;  1HW2 A;  1FC3 A;  3BLY A;  3VSK A;  4DBR A;  1LFU P;  3I59 A;  3E6C C;  2ZCW A;  1YW9 A;  4BS9 A;  1LVA A;  4RM3 A;  1XC5 A;  3HRT A;  4XID A;  5EDN A;  1EH6 A;  5E79 C;  3SFI A;  2DK8 A;  2VKH A;  2DOA A;  5DDG A;  5GAD J;  1P92 A;  1P7J A;  4II3 A;  2ZBK A;  4DIQ A;  1DUX C;  3CMY A;  2A61 A;  3WU0 A;  2KKO A;  2M0M A;  4UUV A;  4RS8 A;  3ABM H;  1R4N B;  1MBJ A;  1S3J A;  1E0E A;  2XB5 A;  2OV7 A;  2VIX A;  3G1L A;  5J3L A;  1Q1H A;  1VF9 A;  3VYT B;  3IV5 A;  3OIQ A;  3ZR8 X;  4IZZ A;  4PK4 A;  4N0B A;  2QM3 A;  1BI2 A;  3WOD F;  1X19 A;  3CJQ B;  2P5K A;  2IGN A;  1Z3X A;  3MD2 A;  5ED4 A;  4A3E J;  2HGC A;  3DPU A;  1ZGW A;  3HOX J;  1S7E A;  1RKT A;  5KAF C;  2A07 F;  3T8R A;  2DBB A;  2KT0 A;  5KCM A;  1GUU A;  1XMA A;  4XQF A;  2FSW A;  1U78 A;  4FX0 A;  1OKR A;  2MGQ A;  4K2E A;  3Q0W A;  3CCV I;  4G8X A;  3S93 A;  2QF7 A;  1EV7 A;  4BNC A;  1YX3 A;  2M4K A;  1SFU A;  2F2E A;  5CVI A;  2LF8 A;  5TGT A;  4AIK A;  3BTI A;  1NG7 A;  1G8X A;  4LMY A;  2ID6 A;  3BG6 A;  2FNP A;  3F6V A;  2B0L A;  2DJI A;  1ZK8 A;  3QWL A;  3I4N J;  1MMS A;  5HLT A;  2UWM A;  1SD6 A;  2KP6 A;  1QRY A;  1MH3 A;  3BP8 A;  4PJJ A;  3LSJ A;  4PJM A;  2NVQ J;  1BW5 A;  3I58 A;  3EPZ A;  1TT5 B;  1KYW A;  5K7H A;  2JT1 A;  2DJN A;  2M9H A;  2E1M C;  1B1B A;  3T1B A;  3FM5 A;  2ZME B;  4L9T A;  4OMZ A;  4PJN A;  3F21 A;  4OIN F;  2VT3 A;  5ICC A;  5HS8 A;  2JVG A;  4XR6 A;  2X51 A;  4FQG A;  2RQP A;  1BC8 C;  1FZP B;  5CYV A;  3VYS B;  4XKW A;  1F5T A;  2K7L A;  4GCV A;  4BH9 A;  1VQP I;  2X0L A;  5DTD A;  4PJL A;  2J5P A;  1R9T J;  2R5Z A;  1WVR A;  3EUA A;  4CHU A;  2HVR A;  4BY7 J;  3JRF A;  3BTJ A;  1EKE A;  1H9G A;  3I55 I;  2HQR A;  1DPU A;  1GDT A;  2XB0 X;  2W85 A;  1BL0 A;  1YIT I;  1G3S A;  4ZZL A;  1Y0U A;  3ABL H;  4NC6 A;  2HXO A;  3CC7 I;  3GFI A;  1W36 D;  5EEH A;  3VDX A;  2Z16 A;  1POG A;  2OCE A;  4BQO A;  2V6E A;  3ML6 A;  5FKK A;  4AC0 A;  4IHV A;  2OAZ A;  2F5C A;  3QP5 A;  2E2H J;  5AON A;  2E7W A;  1MMG A;  3K4M A;  4KA4 A;  4J19 A;  1TQP A;  2FOW A;  4U87 A;  1R58 A;  3FWE A;  4ETS A;  4JX5 A;  2ZJR F;  3BDD A;  5AIP A;  1SFO J;  3CJN A;  1G6N A;  1QVU A;  6PAX A;  3LSK A;  2JQ7 A;  2A69 F;  1F9N A;  2PBI A;  4U7B A;  4O6J A;  5CQE A;  3PNT A;  1LEA A;  2EZI A;  3ASN H;  4LIV A;  5H2F C;  2GXG A;  4QPO A;  1APL C;  2ELH A;  1FIP A;  2FBH A;  4NBQ A;  3I0T A;  2DK5 A;  2JSC A;  2P6T A;  4ENM A;  1FPQ A;  3AG2 H;  1ZLJ A;  4HDU A;  3MEX A;  1WJA A;  4BJ6 C;  2IXS A;  2JUC A;  3E5U A;  3RZD J;  4RAF A;  2RN7 A;  1W7P B;  4I2O A;  1QO0 D;  3VSL A;  1E17 A;  2V6C A;  3E7L A;  3K4C A;  3CD6 I;  2LSO A;  2HKX A;  1TW3 A;  2NXN B;  2WB1 A;  4B3A A;  3EUK L;  3TGN A;  2QSH X;  4OIO F;  2NNY A;  3I53 A;  1ETO A;  2XRN A;  3V42 A;  4EJO A;  3OL4 A;  4E7I A;  1RRJ A;  3COA C;  4M3E A;  4QTR A;  5FLX K;  4KIG A;  5LRS A;  4QIW N;  1D0Z A;  3AG1 H;  1Z05 A;  4PSW A;  4BHB A;  1K79 A;  3K4B A;  3RKW A;  1NK3 P;  1XGO A;  4B3X A;  2MFZ A;  1ONV A;  5E1W A;  3Q0V A;  4UB6 C;  3GYH X;  4WX9 A;  1LB2 A;  1ZRE A;  1LNW A;  1A6I A;  4PFP A;  3CUQ A;  2WAE A;  3K69 A;  3CC4 I;  1I50 J;  1HKT A;  5L3F A;  1OYY A;  4LD5 A;  5E17 F;  1N25 A;  1RI7 A;  3TO7 A;  4KMU X;  3TED A;  4U7D A;  1JUS A;  1HF0 A;  3C2H A;  3EUH A;  2OC6 A;  1XGM A;  3GW2 A;  1G59 A;  1WH5 A;  2I5U A;  2LKP A;  2R7Q A;  3H0G J;  3PFI A;  5FD5 A;  2X4H A;  2VXD A;  1J75 A;  4NNJ A;  1S6L A;  4M71 A;  3GZN B;  3J80 Z;  1USS A;  2CH0 A;  2H1L A;  3VYU B;  2RV8 A;  4D5C A;  4UUS B;  2ZXH A;  4FX4 A;  1T8I A;  4O3M A;  1U9O A;  4A5M A;  1SD4 A;  1MBH A;  4NDL A;  3OOU A;  1FIA A;  4Z6Y A;  1YW8 A;  3KZI C;  1LE8 A;  1R4M B;  3I3L A;  1FWZ A;  4L5J A;  2XPV A;  2VN2 A;  4V19 K;  4E7J A;  5J4V A;  2Y0S A;  1FMV A;  5LGU A;  3MVP A;  3CCL I;  3IHU A;  3A02 A;  2ESN A;  4P9F A;  2NS7 A;  4JX4 A;  3QPT A;  2JUG A;  2ZFU A;  1S72 I;  3LSM A;  2K27 A;  3FXK A;  3W2V A;  3WHC A;  3X2Q H;  2VJ5 A;  5HVQ C;  3GTK J;  5GAG J;  4CCO A;  2K4B A;  4XN3 A;  2W4S A;  4OIQ F;  1DU6 A;  3EUH C;  5FFX A;  2L0K A;  4KNY A;  1PP8 F;  3I5U A;  1K78 B;  3OYE A;  3ERE D;  1Y56 A;  2LY9 A;  2RC4 A;  2W25 A;  2H94 A;  1Z0X A;  3PIO F;  4U0V A;  1E3H A;  2HDD A;  3ZN0 A;  1ITY A;  1X1D A;  5LEK A;  1W7P D;  4HYE A;  1VQ4 I;  5DCM B;  3L1P A;  1MBG A;  2R7Z J;  2LRD A;  4PJ0 C;  2WY7 Q;  4W1U A;  3HL2 A;  1TL8 A;  2VC1 A;  3PM1 A;  4L0Z B;  2A3S A;  2LY1 A;  3GTJ J;  2DTR A;  3S1N J;  1V5F A;  1OFC X;  1OCP A;  2MH9 A;  3HJE A;  5J1U A;  3K70 D;  3U21 A;  2CS3 A;  4A3I J;  4AWX B;  1JJ8 C;  4BXU A;  1MND A;  1R7J A;  3E97 A;  3SHF A;  2CGP A;  3HKZ N;  3E6M A;  2BOL A;  4YRV A;  5EG0 A;  2NNN A;  1W0U A;  1B4A A;  3HB9 A;  2HS5 A;  2P4W A;  3FXU A;  1JT6 A;  1LFB A;  5F04 A;  1PUF A;  3LA3 A;  3GLL A;  4A6D A;  5CPR B;  4XN0 A;  3LL7 A;  1S8N A;  3RQI A;  1MBK A;  4EMS A;  4XLC A;  3OSG A;  2DU9 A;  1ZLK A;  4CYD A;  2PX9 A;  5D4S A;  4CZC A;  5HDG A;  1XG1 A;  4OU0 A;  1J5Y A;  2B63 J;  2XPU A;  2FUG 2;  4KJZ A;  5ILU A;  1QBJ A;  1YHQ I;  2L9R A;  1UHM A;  3AAF A;  2R7D A;  4N9I A;  1JKQ C;  5FKM A;  4DQ2 A;  1HDD C;  3S8P A;  1DGW Y;  2VOD A;  5DCF A;  2KJB A;  2XAG A;  1FJL A;  3W2W A;  1D8K A;  1OR7 A;  2JA8 J;  1MMA A;  3K2Z A;  4MIM A;  4KYW A;  2F4I A;  2W00 A;  4I6Z A;  4EJV A;  3V8K A;  2VXZ A;  5J8C A;  4L18 B;  4CSW A;  3CF5 F;  5GP9 A;  2DMP A;  2L4A A;  3GME A;  3BR0 A;  4I76 A;  2WTE A;  3FXQ A;  1VQM I;  3CC2 I;  3PL8 A;  4RAZ A;  2XIG A;  2EFW A;  2GAU A;  4PUS A;  5IPA A;  2ID3 A;  3B02 A;  3CP2 A;  3D5S C;  2RGV A;  4NQW B;  1PYV A;  2QUF A;  4DBQ A;  2XRO A;  3GFJ A;  2PI0 A;  2VJJ A;  4IHW A;  4LG0 B;  2Z5U A;  5C4J J;  1R5H A;  2BVM A;  5KAI C;  4GRI A;  1V4R A;  3DBR B;  1IN4 A;  2D1V A;  4J01 A;  4P96 A;  4BL0 B;  2KMU A;  2Z3Y A;  1UJ8 A;  4E6K G;  1YIJ I;  3BOQ A;  3J7Z I;  3N4M A;  2NOG A;  1HOM A;  2Y75 A;  3ZCO A;  3GO5 A;  1OR7 C;  5DD4 A;  4Y7N J;  3RPQ A;  2TDX A;  1VQ6 I;  3E3V A;  4XLA A;  1Z6T A;  2A6H F;  5LGT A;  1LFP A;  1XCB A;  1IO2 A;  4L9V A;  2IP2 A;  1R23 A;  5LGN A;  5FKN A;  1YFH A;  4RAY A;  2JA7 J;  1I6H J;  2QYO A;  4JQF A;  2BY0 A;  2LKX A;  1RIO H;  5K7F A;  4LLG F;  1WSU A;  1OYW A;  3F22 A;  1XN7 A;  4IF4 A;  1VQK I;  3ZQQ A;  1DP7 P;  3FX3 A;  3TO6 A;  1NHA A;  1UEL B;  4UUT A;  1WJB A;  3CP8 A;  2HVQ A;  3IUO A;  3SYT A;  5DUK A;  3KYL A;  3FDY A;  3V4G A;  4CXF A;  4A3M J;  3LNQ A;  4M9Z A;  2YX4 A;  2ZXI A;  4EEF G;  3PQJ A;  2KRF A;  2ZSI B;  3DEE A;  2GLO A;  3W2A A;  2LVS A;  2E60 A;  3ERM A;  4HV5 A;  4A2U A;  3K1P A;  4CZZ A;  3G71 I;  2UV1 A;  4IVN A;  4ZJZ A;  1W36 C;  2P6S A;  2ZXW H;  3V7S A;  1RUO A;  1R49 A;  1U2W A;  2HKO A;  2EQR A;  1VQO I;  3KEQ A;  4I98 B;  1WHU A;  3BR3 A;  1RZ4 A;  2WWY A;  4OIR F;  4EM2 A;  4BBR J;  4I0A A;  2V9P A;  2L7Z A;  3MN2 A;  1MMN A;  2LBF A;  3WTS C;  2QKM B;  3E0J B;  2L2O A;  1ZQ3 P;  5D8K B;  2QKL B;  4KT6 A;  1TLH B;  4Q48 A;  1X1B A;  4MFE A;  2M0C A;  5F6F A;  3CCS I;  1J7K A;  2KHM A;  4WXD A;  4ZDO A;  2BHZ A;  2GOX B;  2ZJQ F;  1FBS A;  1BOB A;  1OJL A;  1D1C A;  5CVJ A;  1XTA A;  3ASO H;  4F92 B;  4UNO A;  3LA2 A;  2O0Y A;  1KYZ A;  3SZG A;  1BOA A;  2K86 A;  3DP7 A;  4JX6 A;  5HS7 A;  4DNC A;  2JJ7 A;  3HPH A;  5BOX A;  3GTO J;  2DMT A;  4HNV A;  3ELK A;  3NEU A;  3D5L A;  4WWC A;  3ABU A;  3SEQ A;  3S1M J;  4WK8 F;  4AIH A;  2WAF A;  4XOR A;  3GWZ A;  5CVV A;  1T08 B;  3RPU D;  1RUN A;  2IRF G;  4XLP F;  2OPT A;  3SZT A;  1VQ9 I;  4M72 A;  2VQG A;  1FP1 D;  1UHS A;  3K2A A;  5B5E C;  2CV1 A;  1SVL A;  1IW7 F;  3F9K A;  1R22 A;  1ZAO A;  1H9T A;  4EV0 A;  2ZME C;  1A36 A;  2IA2 A;  4V2F A;  5HNF A;  3OS1 A;  3BWG A;  1FX7 A;  4R8H A;  2FOK A;  2VKE A;  4F91 B;  2Z9O A;  2OD5 A;  4PDK A;  1NG6 A;  4O5V A;  3TMO A;  4R1H A;  4C3J J;  4A69 C;  1HSJ A;  4BAY A;  2EB7 A;  1OPC A;  2FEZ A;  1WFX A;  4EGY A;  2EIM H;  2OBP A;  2LLK A;  3GTP J;  4DGW B;  2RNJ A;  3B6A A;  5C4X J;  2VBY A;  2Q8K A;  2XAU A;  2Q2E B;  2DMU A;  4FIS A;  2Q0O A;  3MMY B;  2STW A;  1XD7 A;  1IDZ A;  1QZZ A;  5CQG A;  2IGM A;  3H0D A;  3QAH A;  1XX5 A;  3DF8 A;  4LB5 A;  1REP C;  3P9K A;  3S1R J;  4XOP A;  2WB1 N;  1BR2 A;  3KIO A;  4LGW A;  5EGO B;  2O8X A;  2HWV A;  2Y69 H;  5KNL A;  1HLV A;  4G9Y A;  1EH8 A;  2CQK A;  1KU9 A;  2XHK A;  3TP0 A;  1X4O A;  3BPV A;  1OCZ H;  3GXO A;  3JRH A;  4A3C J;  4U0W A;  5D6F A;  2MH2 A;  1MSF C;  4A6E A;  1Y8Q B;  3V7C A;  4KFC A;  3F23 A;  2DMN A;  2XGE A;  1Z7L A;  1QA6 A;  3OOP A;  3HUG A;  3K9T A;  4LLL A;  2LY2 A;  4AIJ A;  1IV6 A;  1ZTR A;  2DFH A;  3OYG A;  4Y4R A;  2ISY A;  2G7H A;  3CQZ J;  3I4M J;  2XGD A;  4XK4 A;  4C30 A;  3SDG A;  3KZY A;  4MFD A;  2PMU A;  2P7V B;  2EJR A;  3AFH A;  1YS7 A;  2PG4 A;  1JUP A;  1XDS A;  5JVT A;  3L2R A;  2DA4 A;  4E7L A;  3W6V A;  4XL9 A;  3JTH A;  2GZW A;  2W24 A;  3I71 A;  5FRM A;  3IWZ A;  2IAI A;  2CQN A;  2VBW A;  2D2W A;  4G6T B;  4X1E A;  3Q9S A;  5EZG A;  1CF7 A;  1TP4 A;  1TWF J;  2M5W A;  4LOC A;  4G94 A;  1AKH B;  2VJI A;  1TTY A;  3GFL A;  3PSI A;  1B8I B;  2L54 A;  1Z3Y A;  3K70 C;  2QEN A;  4A3K J;  4C2T A;  3HGY A;  2OQG A;  3OIO A;  1MDM B;  2H8W A;  3DTE A;  5IOY A;  3ZMD A;  1F36 A;  2HPI A;  2Y0S N;  5JR3 A;  1X58 A;  4BY1 J;  4JP0 A;  4KN4 X;  2YPR A;  3RDI A;  2CV0 A;  2DDB A;  5EZH A;  1SVO A;  3V8L A;  3ZMS A;  2TCT A;  2XKP A;  2HOT A;  3J81 Z;  1O7F A;  3F8B A;  3ROU A;  3WG9 A;  4HNU A;  1U9N A;  1T56 A;  3MZH A;  3ZQH A;  3LFK A;  5E8I A;  1P4W A;  2HXI A;  2CV2 A;  3WG7 H;  2R7V A;  3CUO A;  1H8A C;  2X1D A;  5D6E A;  3DKW A;  4D0P A;  3DXJ F;  5IT9 Z;  1E3O C;  2GIV A;  1Y8R B;  2MAB A;  2H09 A;  1WZ2 A;  2GQQ A;  1YW7 A;  2EV0 A;  3ZQL A;  1SFX A;  1IUF A;  3DWL E;  2JA5 J;  2V4J C;  4P1W A;  5M3F J;  2DI3 A;  3ZQ7 A;  2O3F A;  4E4H A;  4E70 A;  2HTJ A;  2COB A;  3IKV A;  2VB6 A;  3OYB A;  3CTA A;  2DOD A;  3KFW X;  4LB6 B;  2R5Y B;  4BQA A;  2E1N A;  2R3S A;  2JMW A;  4JYK A;  3HHH A;  3LSP A;  3WGG A;  3H9Q A;  2XAH A;  4XMY A;  2L3D A;  4Y52 J;  2XAS A;  3AL0 B;  2CG4 A;  5EJC A;  1LJ9 A;  3BZC A;  3M9A A;  3GVA A;  3BR6 A;  4BYY A;  1TWH J;  1IRZ A;  3Q0U A;  2FU4 A;  2WY8 Q;  3QPL A;  2ETH A;  5HLI A;  2HQN A;  4FE7 A;  5CVU A;  1YLF A;  1FEX A;  3E6D A;  1YJ9 I;  1TC3 C;  4RGX A;  5DEQ A;  3WTY C;  1XMX A;  3DTK A;  4F93 B;  2HZD A;  4YII A;  2DTZ A;  2DLL A;  3IAS 2;  4AUX A;  3C1D A;  2BHY A;  5FO5 A;  3K6G A;  3F8N A;  3I4P A;  4R79 A;  3SEZ A;  2NVT J;  3BTC A;  4LK1 F;  1NTC A;  4FE4 A;  4AID A;  3A01 B;  3F8F A;  3DCF A;  3CDI A;  2A6E F;  1XPX A;  1AHD P;  2MSY A;  3HEF A;  3Q3S A;  3IH2 A;  2ME0 A;  1F1Z A;  5LHI A;  1J9I A;  2BGC A;  3S3M A;  3TQN A;  4YFN F;  3OSF A;  4LIU A;  2QGU A;  1ZR4 A;  1E2X A;  3FHN A;  3P9I A;  1ZGA A;  2IPQ X;  4PGG A;  3KYC B;  4ZDP A;  3IKT A;  1ZG1 A;  1P4X A;  2VI6 A;  1MSE C;  1UST A;  5F0H A;  2CYY A;  3BG9 A;  1DPR A;  1RPW A;  2X85 A;  3RKQ A;  4M3B A;  3TOB A;  4A93 J;  2K5C A;  5IYD J;  1TNS A;  1HKQ A;  3LAP A;  1JKO C;  4Q4Z F;  3J7A Y;  3ZMZ A;  4MEY F;  2JZY A;  2QBY A;  2ZNZ A;  1AA7 A;  1OCC H;  1VQN I;  1GHC A;  3BTL A;  1D1B A;  5FGM A;  2XGC A;  3DLA A;  3FIS A;  4UV8 A;  4C3I J;  2ACJ A;  2DW4 A;  3CES A;  3BR2 A;  1YJW I;  3C7J A;  4ITV A;  3S16 J;  3BRO A;  2QVO A;  3BG7 A;  2K3F A;  2A5Y B;  2BY2 A;  4XRS A;  4DZP A;  1P2F A;  1Y39 A;  1T6S A;  4MTE A;  3KLO A;  2R7F A;  3IL2 A;  4C2U A;  1P6R A;  3WTT C;  1ORK A;  2DA3 A;  2NVU B;  3JRD A;  2E1O A;  5E8G A;  4RMN A;  3HYI A;  4RA2 A;  5FD6 A;  3ESW B;  1B6A A;  1XGS A;  2CQ7 A;  2P7C B;  3O6B B;  1W5C C;  3ZQF A;  4G6Q A;  1KON A;  4M6V A;  4UXN A;  3FXJ A;  2R7R A;  4BEH A;  2CU7 A;  3HZJ A;  1ZGJ A;  1LVK A;  3RQ4 A;  2P0W A;  4Y33 A;  4XRM A;  4KIC A;  1LKX A;  1OLT A;  2OZ6 A;  5K5R A;  3L2W A;  1MJ9 A;  1HBX G;  4YIF A;  3E1S A;  1EH7 A;  4XLF A;  3VOE A;  3QYE A;  5LRR A;  2V79 A;  1BJZ A;  2DT5 A;  3H5N A;  3GCM A;  5LBQ A;  4OAZ A;  2ZO4 A;  3JRC A;  2E5N A;  3OMY A;  1EJ9 A;  3SDB A;  4PSX A;  4IHX A;  2CW0 F;  5GPC A;  3ZMV A;  4FTH A;  1YO5 C;  1OCO H;  1R1U A;  2MLK A;  2X9D A;  3HOY J;  3HSF A;  3A03 A;  3FHZ A;  1HC8 A;  2PQ8 A;  2DDA A;  3VOD A;  3K10 A;  2ZSH B;  5FLV A;  4QSH A;  1V5G A;  4IXA A;  2ISZ A;  2BW3 B;  3ISP A;  3IP4 B;  1A35 A;  2ZXJ A;  1DP3 A;  4GYG A;  2M4G A;  3QU6 A;  5M5Y J;  1SFE A;  2FQ4 A;  3LSI A;  3W6K B;  4C9Y A;  3L2C A;  3K4J A;  1PJR A;  4M3D A;  1BBY A;  4Y3O A;  2PJP A;  1G3Y A;  1YYV A;  3I9V 2;  4ZZD A;  1FOX A;  3K1N A;  2EIK H;  1ETK A;  3BT9 A;  1FNN A;  1P4A A;  3H36 A;  2V1D A;  5ILS A;  1Z6R A;  2ESH A;  1DDN A;  1G3W A;  2KZV A;  4L5I A;  3IRR A;  1VTN C;  5IOZ A;  1HCR A;  1ETQ A;  1ETX A;  1YE9 A;  3F8M A;  2IJL A;  5GAE J;  4ZYE A;  2VKV A;  3CO6 C;  2VT2 A;  4HV6 A;  3HOU J;  2DOF A;  3HTU A;  4RB0 A;  1A5J A;  4RGS A;  2JTV A;  1SAX A;  2M34 A;  2VOO A;  1QZY A;  3NRV A;  5TJJ A;  2EIL H;  1YX5 A;  2F5D A;  3I54 A;  5LD2 C;  1WQ2 A;  1I6X A;  3LSR A;  3G73 A;  5L3G A;  5E3O A;  4BQQ A;  1ZRC A;  2AQF A;  1AOY A;  4HOB A;  2J5O A;  3C2G A;  1XCV A;  2E1C A;  1J59 A;  3M8F A;  4YG2 F;  4HSR A;  1V5E A;  1FY7 A;  2DXI A;  2FA5 A;  3HG9 A;  3NAU A;  1YIO A;  3JAM Z;  2LP0 A;  4G12 A;  3S2W A;  3HSR A;  4I7H A;  4EAT A;  2IA1 A;  1ZKG A;  1U5T A;  5DS9 A;  2CFX A;  1Z67 A;  3I59 B;  2PJR A;  2VQH A;  2CUE A;  2KRH A;  1KQ8 A;  5K1Y A;  2K02 A;  2XF5 A;  1B9N A;  3BR5 A;  5IP9 J;  2EPF A;  1V54 H;  1QVT A;  4EJW A;  2FNA A;  1I27 A;  2M2E A;  4BJT A;  1JE8 A;  1IXR C;  2LTP A;  1QGP A;  4MGR A;  1U8B A;  1UFM A;  2P5V A;  2VE9 A;  4IJA A;  4GXO A;  4XRF A;  2I8D A;  4OWR B;  2VL8 A;  1ON2 A;  2E5Z A;  1K7A A;  1YRN A;  2KLO A;  1K4T A;  1T98 A;  3FBN B;  3GF2 A;  2CFO A;  2KZG A;  2K3P A;  2KDO A;  5HDN A;  2OZU A;  3J80 K;  4IHY A;  1IC8 A;  2R93 J;  4KIT B;  3QOP A;  2M87 A;  2OU2 A;  4BE2 A;  4M6X A;  2FD5 A;  1D0X A;  2K4J A;  2ELJ A;  2GA2 A;  1IGN A;  4B4C A;  1L3L A;  3L2U A;  1U5T C;  1Q1V A;  2OF7 A;  5D5U B;  4X6A J;  1UAA A;  3JW4 A;  2M1B A;  3FKJ A;  3HBL A;  4A0X A;  1JXS A;  4HF2 A;  1SAN A;  5DM6 F;  2OQR A;  2HR3 A;  4PCQ A;  4XLN F;  1IZ1 A;  1WJE A;  2FF4 A;  3EYY A;  3QPH A;  2QSG X;  2LF7 A;  3QYF A;  2XGX A;  1HST A;  3TBI A;  1JGG A;  1G3T A;  4WXH A;  1S7O A;  1TZL A;  1WKM A;  4D7M A;  1RR7 A;  2WA0 A;  1UB9 A;  4P5O A;  1ZG3 A;  3DPT A;  3EET A;  3L9F A;  3S15 J;  5EEA A;  1WJF A;  4C2M J;  1JHF A;  1FYK A;  1WJC A;  4NC8 A;  3TL4 X;  2LR8 A;  2R7O A;  3HOT A;  1FTZ A;  4ANJ A;  4KT5 C;  3ZQI A;  1MGT A;  3FXR A;  2HFH A;  3NWT A;  4RBO A;  4RGR A;  3RKY A;  3HTS B;  1Y6I A;  1E3P A;  3R4K A;  4RGU A;  3UR3 C;  2V1X A;  4BU2 A;  2Y31 A;  4HQE A;  3MCZ A;  5M5W J;  1R6R A;  3ABK H;  1Y0N A;  3C2B A;  4Y17 A;  1MD0 A;  4S0H B;  4L0Y B;  2R5Z B;  2VLA A;  1OMI A;  1X3U A;  4U88 A;  4MTD A;  3MQ0 A;  1Z7U A;  1T0F C;  4JK1 X;  4EQQ A;  2M3A A;  2DA5 A;  2TRT A;  4H0E A;  1N78 A;  1MKM A;  3QPS A;  1V55 H;  1X4P A;  2M7B A;  3NWS A;  2K9N A;  5F27 A;  2KIU A;  2QSF X;  4LJZ F;  2O7O A;  1O3Q A;  2DCE A;  2D1H A;  1NH3 A;  3K4L A;  1UZC A;  1ZRD A;  2CQX A;  1X3Z B;  1R00 A;  5IY5 H;  5E3N A;  2R7X A;  4QLC U;  5HNH A;  2PMH A;  2E19 A;  4Y15 A;  4CCL A;  2E71 A;  5GTI C;  2GOM A;  4TV7 A;  1GXQ A;  1BN5 A;  4I0B A;  5M5X J;  3H1C A;  1I3A A;  2COM A;  3HRU A;  2KL4 A;  3PFY A;  2CSO A;  2V26 A;  3FM3 A;  4RB1 A;  3JRB A;  3LSH A;  3SXY A;  2ELK A;  1ENH A;  2EZL A;  2CUF A;  2NS8 A;  4IX7 A;  4HEA 2;  3PSF A;  1MBE A;  2VQL A;  2C6Y A;  3GFM A;  4BQN A;  5JLW A;  3CCJ I;  3T5X A;  4NUB A;  3G1O A;  3BCB A;  3VB2 A;  1TQI A;  4ENJ A;  3OL3 A;  3B73 A;  2IA0 A;  4KMF A;  5D5V B;  1I1S A;  3AG4 H;  3BG5 A;  4I09 A;  2HVS A;  4IOC F;  2BVL A;  1JUM A;  2O03 A;  3S2H J;  5FKL A;  1WH7 A;  5DYM A;  2FBI A;  2YR2 A;  4BEH B;  4LFU A;  4D1Q A;  3TP3 A;  3CCY A;  3CMM A;  3FMS A;  2K85 A;  1IN5 A;  2IGK A;  3DKY A;  1R5G A;  1UCR A;  5CKT A;  2K9L A;  2KIQ A;  2JPB A;  1XS9 A;  2Y9Z A;  4BBS J;  1WRJ A;  3I56 I;  1H88 C;  2F48 A;  5F0C A;  2STT A;  4E7S A;  2X1E A;  5BPI A;  3RKX A;  2MBF A;  3DTI A;  5E1X A;  3KYD B;  5K5O A;  2DAO A;  5H20 A;  1KQ0 A;  2AXL A;  2XRL A;  5LHH A;  1ZYR F;  2EA2 A;  2ZME A;  3HM5 A;  3BR1 A;  2X48 A;  2OTL I;  2CW7 A;  5CVR A;  1A6Q A;  5KHD A;  3A0B C;  3M8J A;  3IH3 A;  4F52 A;  5F64 A;  3CUQ B;  2DQR A;  3PO3 J;  1HKS A;  4II2 A;  4CDG A;  4B47 A;  1LDJ A;  2O8K A;  2MC4 A;  3SZP A;  1RC9 A;  4N4O B;  1HDP A;  2YSR A;  5L3D A;  3J7Y J;  4UVA A;  1N75 A;  4G6D A;  4AYB A;  1QU3 A;  2Q1Z B;  3R60 A;  2F4M B;  4A0Y A;  3KCC A;  3ZMU A;  1BI1 A;  2L4M A;  5F1J A;  2GWR A;  4BHP A;  3FBI B;  4RLF A;  2VJ4 A;  2V7F A;  1Z91 A;  3K4K A;  2MC3 A;  2OCC H;  2DT7 B;  3SQN A;  3DKX A;  3OR1 C;  1OYI A;  2GXB A;  5K5Q A;  1LE8 B;  2IS2 A;  1YI2 I;  1NK2 P;  1TW2 A;  5FFZ A;  4ESB A;  1UMQ A;  2DO7 A;  2QQA A;  3VPR A;  4ZYA A;  1J2X A;  3PO2 J;  4OAY A;  1T38 A;  3HOZ J;  3WE3 A;  2F6C A;  3SJM A;  3ECH A;  5JI6 A;  4RM2 A;  4FET A;  1MH4 A;  3DEW A;  2WBM A;  2E34 A;  2CQQ A;  4M74 A;  3U9G A;  3CCM I;  3K1M A;  1D8J A;  1IN6 A;  4CH7 A;  5M3M J;  3CLO A;  2R7S A;  4D7N A;  1B72 A;  1QPI A;  2BZT A;  1MNE A;  1YG2 A;  5A2Q Z;  4G7O F;  3LQQ A;  1G4D A;  3BY6 A;  2NOJ B;  4CIC A;  1IRG A;  3ZGK A;  3BJA A;  1Z9C A;  2P8T A;  5JVG F;  3G2B A;  3PJR A;  4UB8 C;  4I01 A;  1W7P A;  4B8X A;  2CRG A;  4F55 A;  1H89 C;  2KJC A;  2MD0 A;  5TRD A;  1QHG A;  5C44 J;  3REO A;  1BJA A;  3U1D A;  2X6X A;  5LHG A;  2MLG A;  3A4C A;  3KX2 A;  3DU5 A;  3F0C A;  1VQ8 I;  4HF0 A;  2UUZ A;  1B9M A;  1IDY A;  2UXX A;  4ZYD A;  5GAH J;  1I39 A;  4A3D J;  3ZN1 A;  1GLN A;  3S14 J;  2FX0 A;  4DYQ A;  4F7Z A;  4B48 A;  3S17 J;  4HQM A;  4XSZ F;  4XRS G;  2CWE A;  5HOD A;  5EG0 B;  5D5W B;  4P9U A;  3WE2 A;  3CME I;  1WI3 A;  1QPM A;  3HXL A;  1IUY A;  4BE0 A;  3K4N A;  4BDY A;  1PUF B;  5FRO A;  3SFZ A;  2JPC A;  4G7H F;  1ON1 A;  2F5F A;  3RCO A;  1KA8 A;  2Y2Z A;  5FJ8 J;  4HPQ A;  3HPG A;  3P9C A;  2B7E A;  1R71 A;  2BEO A;  4YFK F;  3TDU C;  1B59 A;  5B3S H;  1EF4 A;  2A6T A;  3OWT A;  2EZH A;  2LH9 A;  5F1R A;  1CQT A;  3I64 A;  4HLX A;  1ACI A;  2MYS A;  2IEK A;  2NVY J;  2Y30 A;  1Z77 A;  2XAQ A;  1WI9 A;  2LMD A;  3NAR A;  4UUS A;  2V1U A;  1P7I A;  2L9V A;  4P55 A;  3RYP A;  1KU3 A;  2F5V A;  1VND A;  3VFZ A;  1GXP A;  1F4K A;  1FYL A;  3CDH A;  2LK2 A;  4XBF A;  1H0M A;  3M07 A;  5J1R A;  3H5R A;  3K7A J;  5D5X B;  1MIJ A;  3OYA A;  1FSH A;  2EK5 A;  5FRN A;  1SFK A;  1Z21 A;  2DA2 A;  4BDZ A;  3H5A A;  3DBH B;  3AKZ A;  3N05 A;  1DQU A;  2LC2 A;  1DU0 A;  2FML A;  4JBA A;  3A2K A;  4YFX F;  3S2D J;  3TW7 A;  5LLQ A;  2W48 A;  2YU9 J;  2R4G A;  4HST A;  2JSP A;  5H6R A;  5B1A H;  4IOA F;  3PUB A;  3FK7 A;  3K0L A;  1K78 A;  3OYH A;  2AS5 F;  1LDD A;  1ZAR A;  2VQC A;  1HQC A;  3NQO A;  2Z33 A;  3FK6 A;  2FMY A;  2JRM A;  2L7M P;  4Q5S F;  2PFB A;  4X0G A;  3FXL A;  2EWN A;  4HA8 A;  5L3B A;  3IRQ A;  1W0T A;  1PP7 U;  5DCM A;  2LRE A;  2K9S A;  1O57 A;  2WC2 A;  4AU7 A;  2HDC A;  2D5V A;  1YQA A;  2L9N A;  4FCY A;  3OYD A;  5BPD A;  2ECC A;  3RI4 A;  1RET A;  1MBF A;  5HS9 A;  3W6J B;  1T95 A;  2B9S A;  3BCA A;  3OYJ A;  3RTR A;  4CCJ A;  1SVM A;  2N8G A;  5E3M A;  2CUZ A;  2E2I J;  2R92 J;  2HZT A;  4KIF A;  4DZJ A;  3ZQG A;  1IXC A;  1BR1 A;  2JWT A;  4D5F A;  4XLE A;  4J00 A;  3QP6 A;  2L7F P;  4HF1 A;  5E20 A;  4LIT A;  3LQR A;  2O61 A;  4KIS A;  3A0H C;  4CGZ A;  2GA1 A;  3WU1 B;  1R5I D;  4A5N A;  2O9L A;  3L09 A;  3R6S A;  2WAQ A;  2RKH A;  4M9X A;  5ICG A;  3GZ6 A;  1BI3 A;  3HIF A;  1ZN2 A;  4RB3 C;  5TIS C;  1BC7 C;  3HC7 A;  1HW1 A;  2VPR A;  2HPM A;  3J81 K;  3O8G A;  3GLX A;  2AO9 A;  1PDN C;  1FSE A;  1XMK A;  3DLL F;  1K6Y A;  3VWB A;  2OJE D;  2LD5 A;  2NRA C;  2WV1 A;  3JSO A;  2DFE A;  3EYI A;  1WGX A;  5E3L A;  5HLH A;  3CCE I;  2OA4 A;  1D5Y A;  5IT9 K;  1SD7 A;  1TBX A;  2IGO A;  3JCU C;  3MKL A;  5BQT A;  2FXA A;  1HXD A;  3OYC A;  2V9V A;  2KPM A;  4CYC A;  2LBF B;  4HX7 A;  3LOC A;  2XAJ A;  1O3R A;  3HGG A;  3WTZ A;  3TO9 A;  4GGG A;  3L2Q A;  5C3E J;  2DOE A;  2HOA A;  1UHW A;  2V9K A;  3LSG A;  2XF6 A;  4L5E A;  1UG2 A;  3F8C A;  3OYI A;  4LLN A;  1MZB A;  2M7A A;  3BG3 A;  2V1N A;  2DPD A;  2JRT A;  3ZMT A;  2QA4 I;  4MQ9 F;  1ZG5 A;  5E18 F;  5KK1 A;  3S3O A;  2UXN A;  2YX7 A;  3DBL B;  5IYC J;  3JTG A;  2OTJ I;  3GUD A;  3MKZ A;  5L3C A;  4ESF A;  2PEX A;  4E7K A;  2QZ8 A;  1FOW A;  4IQJ A;  2BV6 A;  1X2M A;  4JOM A;  1SEU A;  2RDP A;  2YS9 A;  4NQW A;  4ZYH A;  2R0Q C;  3ECO A;  3E6B A;  4HNT A;  4N4N B;  4LG0 A;  5FLX Z;  3JRI A;  4IO9 F;  4ENN A;  3HDD A;  3CDL A;  3MKY B;  3LMM A;  2CMP A;  4XM3 A;  1BW6 A;  1MJA A;  3KP2 A;  5J47 A;  2PLY A;  4XNF A;  3RPU A;  5B66 C;  5DV5 A;  3GX4 X;  3H3Z A;  2FQ3 A;  3L7W A;  2QQ9 A;  3OS2 A;  2E7X A;  2VKD A;  2UZK A;  3FMQ A;  4CUG A;  1FBQ A;  2BY1 A;  1N77 A;  4Z2Y A;  2H6C A;  2LDU A;  2DPU A;  4I99 C;  4A3B J;  1IV8 A;  3HHG A;  3F6O A;  4QWQ A;  2A68 F;  4H4K C;  2MG4 A;  2R7T A;  1XSD A;  1VFC A;  2KIF A;  1GT0 C;  3ZPL A;  2MA3 A;  2KQR A;  3E5Q A;  3KEO A;  5FLM J;  3ZRG A;  2ZJP F;  3AG3 H;  5L3E A;  4ESJ A;  2JA6 J;  2VBX A;  1B72 B;  3QQA A;  3QOD A;  4PGH A;  1IN7 A;  1W5S A;  1JGS A;  3KP7 A;  4L9J A;  3O2P E;  4FT8 A;  4RAG A;  2E36 A;  4MQV A;  4B44 A;  2XAF A;  3ULQ B;  2DYS H;  1HA8 A;  2NYX A;  1MJB A;  2NVX J;  1AU7 A;  2EFQ A;  4N9H A;  3L00 A;  2E35 A;  1FYM A;  3TW6 A;  2GXA A;  4NHJ A;  4ZC3 A;  3IAM 2;  3T0Y A;  2QWW A;  3DQV C;  2O5R A;  2A05 A;  2LNB A;  4DJA A;  3JSP A;  1I3Q J;  1X1P A;  3OS0 A;  2HTS A;  3U2R A;  2RAE A;  2VPL A;  3A1Y A;  1M1E B;  2X1C A;  4WCG A;  4MO7 A;  3T8T A;  3GTM J;  1ETV A;  2W84 A;  3HUG B;  1D0Y A;  3TDZ C;  3BQZ A;  3IC7 A;  1EA3 A;  2R7W A;  4HLY A;  3V8J A;  2PMZ A;  2MD5 A;  1F43 A;  1VI0 A;  3PNY A;  1X3W B;  3O3K A;  1JTY A;  5F08 A;  1LDK B;  3MWM A;  1K61 A;  2M30 A;  3G6E I;  2DA7 A;  2F4O B;  2K9Q A;  1C0W A;  1ETW A;  1FP2 A;  3VYR B;  1T39 A;  4AYB N;  2FJ1 A;  2EFP A;  3ZP5 A;  2GBY A;  4XON A;  2EIN H;  2Z99 A;  3JRG A;  3OYM A;  1XSX A;  2ADU A;  5AIQ A;  3DV8 A;  1CF7 B;  3FXO A;  2IW5 A;  3DPL C;  4IPA A;  4S04 A;  4E7Z A;  3HOW J;  1QNT A;  3BJ6 A;  2EA4 A;  4I02 A;  2M8E A;  3FIW A;  3Q9V A;  3GBG A;  2AXT C;  4IRH A;  3H3V K;  4IKF A;  1XSV A;  2L02 A;  3F3X A;  4A0Z A;  3PIP F;  1K6O A;  2F5E A;  3OV8 A;  1A04 A;  5J4Y A;  1KQ9 A;  1FMW A;  1BM9 A;  2X6O A;  5F0F A;  3UNG C;  4G7Z F;  4ENK A;  2IT0 A;  3CUQ C;  4QPQ A;  1OIS A;  2VC0 A;  1GVJ A;  2EFN A;  2IS1 A;  4EM1 A;  1SMT A;  1SD5 A;  2P5L C;  2VAS A;  3WGI A;  1R36 A;  2Y0M A;  5E1Z B;  3WGH A;  2RRE A;  3H92 A;  3CJR B;  3R61 A;  5HLG A;  4S05 A;  3BC8 A;  2Q2E A;  3FF5 A;  4NB5 A;  2GIZ A;  2WV0 A;  2CW8 A;  2E1M B;  2M8G X;  5EF6 A;  5BMZ A;  2DFI A;  1X1A A;  2LYC A;  2VE8 A;  3M8E A;  4E7H A;  2JVH A;  4DYC A;  2D45 A;  4A3G J;  2HEO A;  1WJ5 A;  3FXM A;  5EGO A;  2BXY A;  1OCT C;  3G3Z A;  3GZ5 A;  2XC7 A;  3GTQ J;  4ASN A;  4HBL A;  1ODD A;  2BBY A;  1W1W E;  2IBD A;  1T0F A;  4MHG A;  2EIJ H;  1BIB A;  3JAM K;  5JLX A;  1IF1 A;  5DUI A;  4IHS A;  1T33 A;  3DEU A;  4Y13 A;  1IRX A;  1Y1W J;  3M7G A;  3HRM A;  2EV6 A;  2KRC A;  1S29 A;  2I10 A;  4UV9 A;  1WJD A;  2BY3 A;  3H9G A;  3RSN A;  1JKR C;  4OMY A;  3LA7 A;  3HOS A;  4ZH4 F;  5IYB J;  4XKC A;  3IH4 A;  3CJT B;  1ZHF A;  1STZ A;  2AHQ A;  1TWC J;  2CJJ A;  4KUM A;  1GV2 A;  4HG2 A;  4IL6 C;  1SAU A;  4ZDL A;  4EGZ A;  1VQ7 I;  2KFD A;  2ZC2 A;  3W3C A;  1OCR H;  3M1C A;  4PFO A;  4DW6 A;  1MW7 A;  5ILV A;  3D5R C;  3QU3 A;  9ANT A;  1AKH A;  1OQY A;  1TQM A;  2DA1 A;  3ABT A;  2VBZ A;  2X6Y A;  3WU2 C;  4ZTF A;  1KGS A;  1B8I A;  1TT0 A;  3KPH A;  2PN6 A;  4UVC A;  5B1B H;  4HW0 A;  3WTU C;  3HOV J;  4CYC B;  3TKY A;  2IS4 A;  2AQE A;  1I5Z A;  2E2J J;  2QCO A;  2R7U A;  1L0O C;  1MDM A;  5J6X A;  3LWF A;  1QZE A;  4MLO A;  1JKP C;  3C3W A;  2IS6 A;  5ICF A;  4HX4 A;  4XSX F;  5JHU A;  1ZR2 A;  4BKX A;  3BZK A;  4OOI A;  2EBI A;  3MFK A;  3BZ6 A;  5EEG A;  3HSE A;  3GTL J;  1V3F A;  2JA2 A;  3GEZ A;  4M3F A;  2L9S A;  1WPK A;  3GTG J;  3KEY A;  1VQL I;  1W5T A;  1U3E M;  2FBK A;  2Z2S B;  1O3T A;  2LG4 A;  3LST A;  4IHT A;  4RDU A;  1FTT A;  2QBY B;  1YS6 A;  1XGN A;  3F72 A;  4AVZ A;  4BJ5 C;  5ERI A;  4GYI A;  3H35 A;  5BNG A;  1ETY A;  2HOE A;  3B6C A;  3OYN A;  2H27 A;  3C18 A;  3G4S I;  4KIB A;  3UKG A;  4IQ4 A;  3KP6 A;  4HRI A;  1FT9 A;  3MKW B;  1S9H A;  1AWC A;  1BIA A;  2W82 A;  3BJO A;  4AD9 A;  1U6G A;  4XKV A;  2DMQ A;  1ERD A;  3CCR I;  1LQ1 A;  2HYF A;  4EM0 B;  2L01 A;  4MNU A;  2L5Q A;  4NC7 A;  3PQK A;  3BQY A;  4FHT A;  4XKB A;  5CJ9 A;  3U1K A;  1JI8 A;  5K7Z A;  2R5Y A;  1JT0 A;  1QQI A;  1W4M A;  5DM7 F;  2MW8 A;  3IWF A;  3S32 A;  2XDV A;  3WTW C;  1LUJ B;  3D1N I;  2NS0 A;  4ABZ A;  4EJT A;  3LFU A;  1ULY A;  2ME6 A;  2CUJ A;  2KIM A;  4XIC A;  1RR8 C;  1O7L A;  1U0J A;  1R1V A;  3OIP A;  3HRS A;  4EVI A;  5IP6 A;  4UHT A;  5FKO A;  2GM4 A;  3OYF A;  2VOP A;  4L9N A;  4LK0 F;  4YEJ A;  1IG7 A;  4DYR A;  4A3L J;  2HOS A;  4XLH A;  3O8H A;  3G1M A;  2WAQ N;  5GPA A;  2XV4 S;  4CO8 A;  1FBU A;  2DFF A;  3MZ8 A;  1WCM J;  4PZJ A;  2ICW G;  3EDP A;  4RLQ A;  3KE2 A;  1HW5 A;  5IP7 J;  3KET A;  2A5W A;  2BE5 F;  2XVC A;  2HNH A;  2X6W A;  1KZH A;  5BS6 A;  5D4R A;  2G9W A;  2HQA A;  2XSJ C;  3CF2 A;  2YUS A;  3H3U A;  1FOY A;  2P81 A;  4HX8 A;  4B1R A;  3A01 A;  4ZTJ A;  1Y1V J;  4LG3 A;  3E5X A;  1YJN I;  3FZV A;  4GO1 A;  4D9J A;  3ONQ A;  4V2G A;  4C3H J;  3KP4 A;  3AL0 C;  1IRF A;  5HDK A;  3D0S A;  4IRG A;  1O3S A;  3L2V A;  1G2H A;  2DN0 A;  3M1E A;  3N97 A;  1BR4 A;  2ZJ2 A;  3M4O J;  2BXZ A;  1IXS B;  2ECB A;  4BUP A;  4BE1 A;  1GVD A;  4OIP F;  3OYK A;  2W1O A;  1ZRF A;  2G7U A;  2CO5 A;  2H6B A;  4AVP A;  2EV5 A;  2IVM A;  4ON0 A;  1GV5 A;  5IT3 A;  5JFR A;  3CMA I;  2VON A;  2DYR H;  3PNV A;  3DFG A;  4DOZ A;  1JHH A;  4GFB A;  1I1G A;  4A12 A;  4HDV A;  1KU2 A;  3KZZ A;  5J8F A;  4GDF A;  3FKI J;  1TWA J;  2RQQ A;  4WF2 A;  5LFA A;  3CO7 C;  4IRI A;  3JR9 A;  1T2K A;  5D8L B;  5JHF A;  1JTX A;  1IN8 A;  1DGR M;  4BXF A;  1U5T B;  4BGD A;  3M3Y J;  5CLS A;  3KLN A;  2EH3 A;  2YU3 A;  5EYR A;  1U8R A;  1Z1D A;  2PJR B;  2KIS A;  1S7A A;  4CCM A;  4CCK A;  5J40 A;  5ICE A;  1VZ0 A;  1YOV B;  4BHC A;  2HU9 A;  2ZB9 A;  1QHH D;  3BPX A;  1FOK A;  3MAJ A;  4ZYG A;  2Y48 A;  2Z1D A;  1R1T A;  1K83 J;  1S5L C;  1TWG J;  3QRF F;  4IEJ A;  2EFO A;  2KDZ A;  1RNL A;  1YTY A;  2QQB A;  2ZKZ A;  3R0A A;  2NAZ A;  3S3N A;  1IJW C;  1WWX A;  2LKS A;  1CGP A;  1D1A A;  2ZNY A;  2HYG D;  3MZY A;  4YIR X;  4MEX F;  1YRN B;  2DQL A;  3P5J A;  1A31 A;  2DT6 A;  1XDU A;  2L7K A;  3EQL F;  3ZOB A;  2W7N A;  2H8R A;  4KN7 X;  5J1Y A;  1D5V A;  4CCN A;  3KP3 A;  3ZXS A;  2DA6 A;  4M3G A;  2XPW A;  2Y9Y A;  4A3F J;  2EZK A;  4U0Y A;  5H6Q A;  3DU6 A;  2W57 A;  2QEX I;  1VQ5 I;  1FLI A;  2LOO A;  3HKZ A;  1ZH5 A;  4W97 A;  2LFB A;  3LAJ A;  1LEB A;  1X2N A;  2BW3 A;  1O4X A;  2ZFW A;  1RES A;  3H9J A;  3CZ6 A;  3WTX C;  1K4S A;  1LPQ A;  5GTH C;  3ZQC A;  2HDW A;  4RB2 C;  3KP5 A;  3PUF A;  3OYL A;  5KVR A;  2WAD A;  4UVB A;  1X1C A;  3RYR A;  2VUM J;  3P7N A;  1UG0 A;  2HQ5 A;  2K9M A;  3OR2 C;  2H1K A;  4B43 A;  3JRA A;  4B09 A;  3WTV C;  1ZEL A;  2RVC A;  1KU7 A;  2XKO A;  3CCQ I;  3RIR A;  2QLZ A;  1MMD A;  1SMY F;  1JJ6 C;  5FB2 A;  5LEJ A;  1IAW A;  4M9S A;  4FAS D;  2XSD C;  3RJP A;  4KDP A;  3FMR A;  4BXX J;  4XOT A;  1J09 A;  4BAC A;  3WHB A;  2G0E A;  5HOO A;  1BI0 A;  4AM3 A;  2HYJ A;  3JRE A;  5A2Q K;  4Q47 A;  3R0J A;  3V7R A;  4WXC A;  2PMZ N;  3Q5F A;  2XF7 A;  1PVE A;  1PUE E;  2O6G E;  3RZO J;  3VEP A;  4F3Q A;  2QQ8 A;  2HI3 A;  4EJU A;  4M6Y A;  1MNM C;  3S1Q J;  1XB4 A;  4HZF A;  4YEL A;  2M45 A;  5DD8 A;  1TNT A;  2FRH A;  3TOA A;  2FE3 A;  3OY9 A; 
#chains in the Genus database with same CATH homology
 1MMN A;  2LBF A;  2QKM B;  4CUG A;  3QOE A;  2RNG A;  3L2U A;  4CA0 A;  3E0J B;  2L2O A;  3QYB A;  1N77 A;  2QKL B;  4KT6 A;  1X1B A;  1UAA A;  3FKJ A;  1P9Q C;  2OUM A;  2KHM A;  3BLY A;  3VSK A;  4ZDO A;  4DBR A;  4H4K C;  2GOX B;  2R7T A;  4BS9 A;  4RM3 A;  1BOB A;  1WJE A;  2KQR A;  1D1C A;  4F92 B;  3ZRG A;  3SZG A;  3QYF A;  2VKH A;  2DOA A;  3TBI A;  4II3 A;  1TZL A;  3HPH A;  4DIQ A;  3QOD A;  2WA0 A;  4P5O A;  3D5L A;  3SEQ A;  2M0M A;  3DPT A;  2WAF A;  4XOR A;  1E0E A;  2OV7 A;  1WJF A;  2VIX A;  3VYT B;  3OIQ A;  3RPU D;  3ZR8 X;  1WJC A;  4NC8 A;  3TL4 X;  4IZZ A;  4PK4 A;  4B44 A;  1X19 A;  3CJQ B;  2R7O A;  3HOT A;  2VQG A;  1HA8 A;  4ANJ A;  2IGN A;  1Z3X A;  3MD2 A;  3DPU A;  2CV1 A;  3NWT A;  1Y6I A;  3F9K A;  5KCM A;  3UR3 C;  4BU2 A;  4ZC3 A;  3IAM 2;  4XQF A;  1R6R A;  3DQV C;  2O5R A;  5HNF A;  3OS1 A;  4DJA A;  4F91 B;  3S93 A;  3OS0 A;  2VLA A;  1YX3 A;  1NG6 A;  2M4K A;  1T0F C;  3A1Y A;  3TMO A;  2VPL A;  2M3A A;  2X1C A;  1N78 A;  1X4P A;  2M7B A;  3NWS A;  5TGT A;  2R7W A;  3HUG B;  1D0Y A;  1WFX A;  2DCE A;  1NG7 A;  1EA3 A;  2PMZ A;  3K4L A;  1G8X A;  4DGW B;  3PNY A;  3BG6 A;  1LDK B;  2DJI A;  2XAU A;  2Q2E B;  2R7X A;  5HNH A;  3MMY B;  5HLT A;  2UWM A;  4CCL A;  3VYR B;  5CQG A;  2KP6 A;  4PJJ A;  4PJM A;  2GOM A;  2IGM A;  3EPZ A;  3H0D A;  4XON A;  3PFY A;  2KL4 A;  2V26 A;  3OYM A;  3LSH A;  2E1M C;  4XOP A;  4IX7 A;  3DPL C;  4HEA 2;  3PSF A;  1BR2 A;  2VQL A;  4PJN A;  4E7Z A;  4BQN A;  2JVG A;  4XR6 A;  2X51 A;  5KNL A;  3GBG A;  3VYS B;  1X4O A;  4XKW A;  4NUB A;  3BCB A;  4IKF A;  3OL3 A;  4PJL A;  3EUA A;  2HVR A;  2HVS A;  1FMW A;  3UNG C;  2BVL A;  4QPQ A;  2IS1 A;  1Z7L A;  4BEH B;  2LY2 A;  2VAS A;  3OYG A;  4Y4R A;  4D1Q A;  2RRE A;  3CMM A;  3CJR B;  1W36 D;  2IGK A;  3BC8 A;  3DKY A;  4C30 A;  3VDX A;  2Z16 A;  5CKT A;  2K9L A;  3AFH A;  4BQO A;  2V6E A;  2CW8 A;  3L2R A;  2E1M B;  4E7L A;  4E7S A;  2X1E A;  4XL9 A;  1MMG A;  1X1A A;  2LYC A;  3DTI A;  3K4M A;  5FRM A;  4E7H A;  4G6T B;  2JVH A;  4U87 A;  1WJ5 A;  2VJI A;  3PSI A;  2XC7 A;  3LSK A;  2CW7 A;  1Z3Y A;  4U7B A;  3K70 C;  5CQE A;  3PNT A;  4LIV A;  4C2T A;  5KHD A;  3M8J A;  4F52 A;  3DTE A;  4QPO A;  4II2 A;  2HPI A;  4B47 A;  2CV0 A;  1IRX A;  2MC4 A;  2KRC A;  1WJA A;  4N4O B;  2IXS A;  4BJ6 C;  4HNU A;  1WJD A;  1N75 A;  3H9G A;  3RSN A;  4AYB A;  2CV2 A;  1QU3 A;  2Q1Z B;  2R7V A;  3HOS A;  2X1D A;  3VSL A;  4XKC A;  3K4C A;  2MAB A;  3FBI B;  4RLF A;  2VJ4 A;  2V7F A;  2WB1 A;  3K4K A;  4HG2 A;  3EUK L;  2DT7 B;  3DWL E;  1SAU A;  4ZDL A;  3DKX A;  2V4J C;  3OR1 C;  4P1W A;  3V42 A;  3W3C A;  3M1C A;  3OL4 A;  4E7I A;  4PFO A;  4E4H A;  2IS2 A;  1MW7 A;  1D0Z A;  2VB6 A;  3D5R C;  4PSW A;  3OYB A;  4ZYA A;  3K4B A;  2X6Y A;  4OAY A;  4ZTF A;  4B3X A;  1TT0 A;  2F6C A;  2MFZ A;  2IS4 A;  4RM2 A;  2AQE A;  3H9Q A;  4FET A;  2R7U A;  4PFP A;  4XMY A;  4MLO A;  2WAE A;  2WBM A;  2IS6 A;  3AL0 B;  4CH7 A;  2R7S A;  2JA2 A;  2L9S A;  3C2H A;  2OC6 A;  1MNE A;  3KEY A;  2WY8 Q;  1G59 A;  2R7Q A;  2Z2S B;  2LG4 A;  2NOJ B;  3ZGK A;  2VXD A;  3G2B A;  4AVZ A;  4NNJ A;  3PJR A;  4BJ5 C;  4F55 A;  3DTK A;  3H35 A;  4F93 B;  2CH0 A;  2HZD A;  3VYU B;  3OYN A;  2MD0 A;  1QHG A;  2ZXH A;  3IAS 2;  4IQ4 A;  4HRI A;  3OOU A;  3MKW B;  3K6G A;  2X6X A;  1S9H A;  2W82 A;  3A4C A;  3KX2 A;  4R79 A;  3I3L A;  4XKV A;  3SEZ A;  1ERD A;  3DU5 A;  2UUZ A;  4E7J A;  1GLN A;  2L5Q A;  4NC7 A;  2Y0S A;  1FMV A;  4XKB A;  1JI8 A;  4B48 A;  3S3M A;  2JUG A;  2ZFU A;  4LIU A;  3FHN A;  3S32 A;  3LSM A;  3W2V A;  3HXL A;  2XDV A;  5HVQ C;  2VJ5 A;  4ZDP A;  4BE0 A;  3K4N A;  4CCO A;  4BDY A;  3LFU A;  5FRO A;  4XN3 A;  2W4S A;  2CUJ A;  3EUH C;  2X85 A;  3RCO A;  3OYE A;  1U0J A;  1Y56 A;  2K5C A;  3HPG A;  3OIP A;  4HPQ A;  3OYF A;  3J7A Y;  2A6T A;  4YEJ A;  1X1D A;  1AA7 A;  3OWT A;  4XLH A;  2LH9 A;  2LRD A;  1D1B A;  3DLA A;  2MYS A;  2WY7 Q;  3HL2 A;  3CES A;  4RLQ A;  2A5W A;  4ITV A;  2LY1 A;  3BG7 A;  1V5F A;  2F5V A;  2HNH A;  2X6W A;  2HQA A;  2XSJ C;  3CF2 A;  4C2U A;  3K70 D;  3U21 A;  2CS3 A;  3H5R A;  3OYA A;  4ZTJ A;  4LG3 A;  4RMN A;  1MND A;  5FRN A;  1SFK A;  1Z21 A;  4BDZ A;  3H5A A;  2BOL A;  4YRV A;  3AKZ A;  3N05 A;  4D9J A;  3ONQ A;  1DQU A;  2LC2 A;  3A2K A;  3AL0 C;  1KON A;  2R4G A;  4HST A;  2R7R A;  2JSP A;  3L2V A;  4BEH A;  3RQ4 A;  1LVK A;  3PUB A;  5CPR B;  2P0W A;  4Y33 A;  1BR4 A;  4XN0 A;  1LKX A;  1OLT A;  3LL7 A;  3OYH A;  2VQC A;  3L2W A;  4XLC A;  4BUP A;  4BE1 A;  3E1S A;  4XLF A;  3OYK A;  2W1O A;  3QYE A;  3H5N A;  4CZC A;  4X0G A;  4OAZ A;  2LRE A;  2E5N A;  3OMY A;  2FUG 2;  4KJZ A;  4PSX A;  3PNV A;  3SDB A;  4DOZ A;  4AU7 A;  2L9N A;  3OYD A;  3S8P A;  1DGW Y;  3K10 A;  2ZSH B;  3W2W A;  2RQQ A;  1V5G A;  5LFA A;  1T95 A;  2BW3 B;  3IP4 B;  3BCA A;  1MMA A;  3OYJ A;  5JHF A;  3RTR A;  1DP3 A;  2M4G A;  4CCJ A;  2F4I A;  2W00 A;  3LSI A;  2CUZ A;  4C9Y A;  1DGR M;  2VXZ A;  3K4J A;  4BXF A;  1PJR A;  4CSW A;  4BGD A;  4Y3O A;  1BR1 A;  3I9V 2;  4XLE A;  4J00 A;  2PJR B;  4LIT A;  4KIS A;  4CCM A;  4CCK A;  3PL8 A;  1VZ0 A;  2HU9 A;  4PUS A;  1QHH D;  2KZV A;  2Z1D A;  2WAQ A;  1YE9 A;  3CP2 A;  3D5S C;  4NQW B;  1PYV A;  4DBQ A;  3S3N A;  3HC7 A;  1D1A A;  2HPM A;  2VJJ A;  2BVM A;  4GRI A;  1YX5 A;  2DT6 A;  2L7K A;  4J01 A;  1K6Y A;  2W7N A;  4BL0 B;  2KMU A;  5LD2 C;  3VWB A;  4E6K G;  4CCN A;  3ZXS A;  4BQQ A;  2AQF A;  3C2G A;  3ZCO A;  3DU6 A;  1OR7 C;  2LOO A;  3HKZ A;  4HSR A;  1V5E A;  2IGO A;  3OYC A;  2DXI A;  2BW3 A;  2KPM A;  2LBF B;  3HG9 A;  4XLA A;  3H9J A;  3CZ6 A;  1LFP A;  2HDW A;  4EAT A;  3L2Q A;  3OYL A;  2V9K A;  2WAD A;  3LSG A;  4JQF A;  2XF6 A;  1X1C A;  3OYI A;  2M7A A;  2V1N A;  1UG0 A;  2K9M A;  2VQH A;  2PJR A;  2KRH A;  3OR2 C;  4B43 A;  3S3O A;  2XF5 A;  3ZQQ A;  1ZEL A;  1UEL B;  3MKZ A;  1WJB A;  3CP8 A;  2HVQ A;  3IUO A;  3SYT A;  4E7K A;  1MMD A;  4IQJ A;  4JOM A;  4FAS D;  3FDY A;  3KYL A;  4BJT A;  2ZXI A;  4XOT A;  2ZSI B;  3DEE A;  3W2A A;  1J09 A;  4BAC A;  2I8D A;  4HNT A;  4N4N B;  2E60 A;  5HOO A;  4OWR B;  2VL8 A;  2E5Z A;  1W36 C;  2UV1 A;  2KLO A;  3LMM A;  4ZJZ A;  2CMP A;  4XM3 A;  2XF7 A;  3FBN B;  3MKY B;  2CFO A;  4XNF A;  2K3P A;  2KDO A;  4F3Q A;  4KIT B;  4YEL A;  3OS2 A;  4BE2 A;  1D0X A;  3OY9 A;  2ELJ A;  2VKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...