2DT6A

Solution structure of the first surp domain of human splicing factor sf3a120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
GEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Splicing factor 3 subunit 1
publication title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2dt6A01
2DT7B 1X4PA 2DT6A 2E5ZA 2E60A 1X4OA 1UG0A 4DGWB
chains in the Genus database with same CATH superfamily
1WJDA 3CP2A 4XLCA 1JUSA 1JKPC 2M4KA 4PDKA 5J47A 5DCMA 5E3LA 2ZXHA 2IXSA 2FXAA 3FZVA 1IGNA 1T0FC 2DOFA 1GUUA 2ZXJA 2QENA 4E7IA 4OIPF 4IHTA 3TQNA 1HDDC 3LSJA 2CMPA 2F5DA 2GZWA 4NBQA 3RYRA 3MKZA 3IKTA 1KYZA 5BNGA 4G9YA 4BDZA 4G7ZF 1HBXG 2WTEA 2VKVA 3ROUA 2V9KA 5IT9K 3HUGB 3KE2A 2GQQA 4ITVA 4D7NA 3I59B 3OYDA 2E2IJ 4UUSA 5BPIA 1FMWA 4BDYA 1O57A 1O3SA 1VFCA 2V26A 1Z7LA 2HFHA 4B3AA 1MKMA 2FBIA 2FD5A 4BH9A 4Y3OA 2H8RA 2X0LA 5A2QK 3QPLA 4DBQA 2IA2A 1JGSA 5LGTA 2QM3A 4ENMA 1ZHFA 2DMTA 1WJBA 4E7LA 3VWBA 3RPQA 2CSOA 3S15J 1FX7A 3CJTB 3D5SC 1XCVA 5HDKA 3LSKA 3ZMSA 2XPWA 5B3SH 4LG0A 3MZYA 3W6KB 1EH8A 3GTLJ 4HLYA 4N4OB 4IF4A 2DA3A 4MQ9F 4XONA 1PUFA 1R49A 2XAGA 1R5ID 1IV8A 3ZMTA 2VQCA 2NOGA 2LR8A 4QPOA 5GAHJ 2VXZA 2LVSA 3F8BA 4ENKA 4XRSA 3FMQA 4XRFA 3IL2A 1IAWA 2MH2A 4OMYA 3MWMA 3P9KA 4BAYA 1SD6A 4RLFA 2XKPA 1XC5A 1FBUA 2BW3B 4ZDOA 3GTJJ 4XRSG 2KISA 4U0VA 2P81A 3KEYA 2B63J 5F6FA 3IKVA 3OYMA 3CCEI 3S1NJ 4G94A 2E35A 4ESBA 5ILUA 4GCVA 1K4TA 1R22A 3KLNA 1QRYA 4O6JA 3ZN0A 4GXOA 2A61A 5E3NA 2HVSA 2F4MB 1CF7A 1X1AA 5TISC 4X0GA 4A12A 4IOAF 2CQQA 3OIQA 4AC0A 3JRCA 1J09A 3F23A 3KIOA 4YG2F 4KIGA 3HOWJ 3DPLC 4RGSA 5DDGA 2R7TA 3RZDJ 4LFUA 2FJ1A 5EG0A 4F52A 5EEHA 1KQ9A 1YQAA 2KRFA 2FA5A 2K4BA 3V8LA 1S7OA 5GADJ 2D1HA 1IRXA 1IZ1A 5KVRA 1PP7U 3TL4X 2R7VA 4OINF 3HOYJ 3LA7A 1UJ8A 2R7DA 5EZGA 2KJCA 3F8NA 3WHCA 1D1CA 1O7FA 3LA3A 3DLAA 3RPUD 5JR3A 3NRVA 3IAM2 3OL3A 5L3FA 1NHAA 3M3YJ 1LE8B 3CZ6A 1IW7F 4UXNA 3SZGA 1AU7A 3SFZA 1IUFA 4JBAA 2ACJA 3VEPA 2H1LA 3E1SA 2HNHA 2X6OA 1ZELA 5BPDA 2VONA 4V2GA 3OWTA 2ZMEC 2CW0F 1QVTA 2BHYA 2DO7A 3VPRA 5A2QZ 1T33A 2XSJC 4RBOA 3S8PA 2VBWA 1S3JA 2OA4A 2Y31A 5E1WA 2YR2A 3WG9A 3K4NA 5DM7F 2HDDA 5C44J 1FWZA 1U78A 4N0BA 5KHDA 4A3FJ 3FMSA 1DP3A 4D5CA 2NVXJ 1KU9A 4FE4A 2XAUA 2GM4A 2RV8A 2MA3A 3DEWA 4U7DA 5FO5A 1LVAA 2ME6A 2H6BA 4IHVA 1FBSA 2DU9A 5KNLA 5CPRB 4A0YA 2V1NA 4IKFA 4AVPA 2EFWA 1Z9CA 4RB0A 2M0MA 2K85A 1XSDA 2M87A 3FXQA 5HDGA 1W5SA 1SVLA 2DW4A 1MZBA 2K86A 3HRSA 2W57A 3L2WA 4EGZA 3I0TA 3EUHA 3ASOH 1SVOA 1MDMA 1OJLA 4HSTA 4QLCU 3O3KA 3ZRGA 3AKZA 1KZHA 3WHBA 3GZ5A 3OYIA 3CCMI 4HQEA 3KZYA 3C1DA 4K2EA 3LQRA 1JHHA 1ONVA 4LITA 4RMNA 2X6WA 1WH5A 4BBSJ 1HF0A 1WI9A 2WBMA 4UB8C 2EQRA 2ZXWH 1YTYA 4A0ZA 1HLVA 3FBNB 2UXXA 4J01A 1GXPA 3WTXC 2RC4A 4A2UA 1XGSA 3FIWA 4KA4A 1X3WB 3H36A 3QYBA 4LK0F 1F43A 1HC8A 3KCCA 4EJVA 3TO6A 1APLC 2MSYA 3FHNA 3HSRA 2K3PA 2BEOA 4LIUA 1U6GA 5EDNA 1MMNA 3HEFA 2AQFA 2L9RA 3HOXJ 3O8HA 3GVAA 3EETA 5JHUA 2GA1A 1N75A 1OQYA 1WVRA 4XLEA 3BCAA 4M6VA 2DQLA 3MEXA 5CQGA 5TRDA 1RIOH 4A3EJ 1YX3A 4CCOA 5CQEA 5L3GA 2XRLA 1SMYF 2R92J 3HTUA 3MZHA 2LMDA 4HSRA 5KK1A 2ZFUA 4IHXA 3DKXA 2Z3YA 1ACIA 1ETOA 2GAUA 4AIHA 5HOOA 2Q8KA 2M0CA 3HHGA 2H09A 3FXMA 2YS9A 2ZKZA 3TDZC 1FYLA 1B8IB 4BE0A 2V6EA 4L0ZB 2P5KA 1G3TA 2PN6A 3TO9A 4B8XA 4E7JA 1ZGWA 2R7UA 4DNCA 4BQQA 3V8KA 4Y13A 3K1MA 3HC7A 2PMUA 1I5ZA 3HRMA 2CU7A 3DBLB 3M4OJ 4ANJA 1TW2A 5M3FJ 3NEUA 1T0FA 2L9VA 4N9IA 2VPLA 3LA2A 3BC8A 2I8DA 3PNVA 3CMYA 4KUMA 4II2A 3OY9A 4IX7A 5IPAA 1LJ9A 1QPMA 3SJMA 5J1RA 1Y0UA 3WTVC 4R8HA 4I99C 4BYYA 1XDSA 4PSWA 3ERMA 1G3YA 4C2TA 3S3NA 3RKWA 2W25A 2WAQA 1IXRC 1TWCJ 1YHQI 2DDAA 1X3ZB 2E7XA 3DXJF 3M8JA 4XN3A 1ZGJA 2WV0A 4C3IJ 3N4MA 4NC7A 3FISA 5EJCA 5E1ZB 2ZJQF 4Y33A 4MTEA 3H35A 3GFIA 2EILH 3HGYA 2ZCWA 2QYOA 2E60A 3I4PA 2JA8J 2Z1DA 5J8CA 4CH7A 2B9SA 3H0DA 3F6VA 4OOIA 2DLLA 3Q3SA 5JLXA 1E3HA 1ZARA 2DA1A 2Y75A 2OC6A 2B0LA 4N9HA 5F1RA 3HSFA 5IYCJ 3HOVJ 3DEUA 1DDNA 2GBYA 2M2EA 3JRDA 2MYSA 1B1BA 5LRSA 3HKZN 2X48A 3CC7I 2D1VA 1DGWY 3L09A 2UXNA 1B59A 3MCZA 2IW5A 4H4KC 1YLFA 2O5RA 2FBKA 2VBXA 2PLYA 2QQ9A 5F1JA 3CCYA 4C9YA 4HV6A 2RKHA 1QBJA 2AQEA 2DBBA 2HWVA 1H88C 4UUVA 4LMYA 4B48A 4HW0A 2QSHX 4BJTA 1DGRM 1CQTA 3SZPA 3J7AO 1AA7A 1S5LC 1NH3A 2X1CA 4XOPA 3OIOA 2JTVA 4RAGA 1FP2A 2R5ZB 2JN6A 4GDFA 3DEEA 3TW7A 4RGRA 2Q2EA 1R4MB 2YX4A 3E6BA 2O6GE 2X6YA 3OYAA 2K40A 3WODF 1J0RA 2JSCA 3GZ6A 1G2HA 2R7RA 1LEAA 1XMXA 3DFGA 5CJ9A 3A0HC 5ED4A 2XIGA 3E6MA 2RNJA 3JRBA 4DQ2A 4DGWB 3K1NA 4M73A 2IGOA 3DPTA 4CSWA 2VKDA 1I39A 1LPQA 4E6KG 2VBYA 3OL4A 4KT6A 2NNNA 5BOXA 4Q5SF 2LFBA 3EYYA 3WE2A 1SFUA 1D5VA 5K7HA 2MD5A 2WAQN 4I7HA 4HF2A 2PI0A 1RI7A 1USSA 4J00A 5FD5A 2ZMEA 2HYJA 3HL2A 1JE8A 1I1SA 4RAYA 2X6XA 1SD4A 2KDOA 2M30A 1YS7A 3U1KA 3KX2A 1KQ8A 4NC8A 5IYBJ 1A04A 1U5TB 2DT6A 1IDYA 1BJAA 2FU4A 2V6CA 4WX9A 2E34A 3LOCA 5K1YA 5DEQA 5F04A 2DPDA 4CCLA 4N4NB 1WRJA 1FP1D 1FZPB 4DYRA 3X2QH 3FBIB 3ZQ7A 4WK8F 3H5NA 2ECBA 3ZQCA 2DXIA 1J7KA 2JZYA 3H9GA 3KP6A 1V4RA 1YE9A 2LH9A 1H89C 3S2DJ 3L2RA 3KEOA 4WXDA 4KITB 3H5RA 1J5YA 1Q1VA 2ISZA 2HDWA 4HA8A 4M9SA 2NXNB 3J81K 3ESWB 1P92A 3WTSC 4M71A 2GIVA 2LD5A 2VJ4A 3M8EA 1QA6A 1TBXA 3CESA 1T6SA 1BW6A 2HQ5A 1K78B 2KRHA 3ERED 1ENHA 2HOEA 2Y0MA 3QAHA 2PEXA 1ODDA 2F5FA 1RRJA 1P4XA 1F5TA 1SD7A 1XX5A 4GO1A 1P9QC 4ETSA 1OLTA 1P7IA 1IXSB 5FD6A 2KQRA 3O6BB 1RR8C 1OCTC 1RESA 3VYUB 3MN2A 1FNNA 1Z6TA 3A01B 3K6GA 4O3MA 1FOKA 1U2WA 4RB3C 1LVKA 1WI3A 3OYCA 2CO5A 1ZAOA 4A6EA 4CZCA 1BJZA 4XLHA 4RAFA 1I50J 1T39A 3W6VA 3DTEA 3GX4X 3JRHA 1SANA 3NWTA 4AIDA 4PUSA 2BOLA 4L18B 4AM3A 1YOVB 4BHCA 3K0LA 2VUMJ 1R1UA 2V4JC 2K9LA 4F7ZA 3GTPJ 2NAZA 3L1PA 2P6SA 4DYQA 4G7HF 2UZKA 5JI6A 2Y2ZA 3FF5A 2X4HA 5ERIA 4ON0A 2MBFA 4I98B 2QQAA 2PBIA 1MMSA 3DTKA 3L2CA 3MKLA 1YW8A 1MH4A 2NVYJ 3GW2A 3QP5A 4HYEA 2BV6A 1ZG3A 2FNAA 3NQOA 2COBA 1SAUA 5DD8A 3K2AA 3VYRB 3I71A 4NC6A 1IXCA 2DCEA 1T56A 3BTLA 1LDKB 1EA3A 1R5GA 1SFKA 1Z91A 2LP0A 3BR1A 3DV8A 3M7GA 4XL9A 1VQ6I 3ABKH 3FHZA 1T2KA 5E17F 3FXOA 4E70A 4A5NA 1H0MA 4I02A 1IC8A 5FLXZ 3NAUA 3ZQHA 4XORA 4KFCA 4I0AA 1SFXA 2HZDA 1R5HA 1ZRCA 2ELJA 1ZG1A 2ADUA 5H2FC 3K4LA 4BQOA 3LNQA 3OSFA 4MO7A 4MIMA 1TT0A 1V5EA 4CGZA 2LF8A 3C7JA 1ON2A 3D0SA 1TQPA 2FE3A 2HQAA 4AU7A 5HLTA 2R7XA 1OCPA 1JUMA 2KHMA 1BOAA 4JYKA 3GTOJ 4ZYHA 2FMYA 4JOMA 2G7HA 4BJ6C 2P5LC 4IRIA 4IVNA 4JP0A 4LB6B 2GOMA 1NG7A 5LBQA 1HOMA 1WFXA 2FUG2 3GZNB 3V4GA 1KQ0A 3QQAA 5FJ8J 2HGCA 2QGUA 4Y52J 1ZRFA 3WU2C 2JA5J 1DU0A 3PFYA 1W7PB 5F0HA 1Z05A 2DT5A 4II3A 4CO8A 3H1CA 1OCCH 2VQHA 2XAJA 3K70D 1J59A 2EIMH 2PMZN 1HKQA 4EATA 5EGOB 3IH3A 4ZZLA 4GYGA 4P55A 5HLGA 5L3BA 3TO7A 1XN7A 1YJWI 4LK1F 3BWGA 4CHUA 3RQ4A 1FSEA 1HKSA 2EZKA 1IN5A 4MTDA 3VYTB 2LKPA 1ZRDA 4E7HA 5AONA 4IHYA 4OIOF 3ZR8X 1JUPA 2RQPA 1REPC 1RC9A 2A6EF 2MFZA 4CUGA 4PSXA 5GPAA 4Q4ZF 3K4MA 3DU6A 2OQGA 3K10A 3TP3A 2DMPA 2QKLB 1D1BA 4QTRA 1XMAA 2ELKA 5C4XJ 4UB6C 1HCRA 1D1AA 3ECOA 3RPUA 2KL4A 1VQ8I 3HUGA 1JGGA 2LY9A 4XKWA 1TL8A 3E7LA 3ZQQA 3HPHA 5EF6A 1IJWC 4XKVA 3GEZA 4M3DA 2HS5A 1LB2A 3WTWC 5J8FA 3RDIA 3CUQB 4BE2A 5IT3A 1P7JA 1GV5A 2XGXA 4B43A 5HVQC 3W2WA 2BVLA 3QYFA 5CVIA 4KN7X 5CLSA 3CDHA 4O5VA 1UB9A 3QPHA 3S1MJ 1OKRA 2MGQA 1QZZA 1BC7C 4OWRB 1WJCA 2HI3A 3N05A 4P96A 1BIAA 4DBRA 1FY7A 3AFHA 1IRFA 3M1EA 5JVGF 2VKHA 2XB5A 3JRAA 1TWFJ 3MVPA 1TP4A 5CKTA 3DLLF 2EIJH 5FLVA 2EZLA 2COMA 4XLNF 2A05A 1V5GA 4XOTA 1V55H 4XKBA 1SMTA 4Z2YA 2STTA 1WJAA 1X1BA 3K4JA 4YIIA 1Y1VJ 3FXLA 4PCQA 4A69C 1TNSA 3HM5A 3IH4A 4ZJZA 2QBYA 4XSZF 1JT0A 2DI3A 2H27A 4I2OA 1FTTA 1YJNI 2M9HA 3LSMA 1L0OC 1ETQA 2V79A 3C2GA 2B7EA 1W7PD 2BW3A 3KYDB 1GDTA 4LLGF 3TW6A 1ETYA 2E19A 4ZDLA 2MD0A 1FYKA 4M3FA 3L2QA 4IZZA 1Z6RA 3IAS2 2VT2A 2R7OA 4UUSB 3FXKA 2VODA 4YFKF 1BR1A 3VDXA 4EQQA 4AIJA 2QLZA 5DCFA 1R9TJ 2L4MA 5E8GA 2PMHA 1BOBA 2W85A 3C3WA 3JSPA 1TNTA 5IOYA 2HPIA 3MFKA 2ZNZA 3CP8A 2Q0OA 3F72A 4M9ZA 2LLKA 1TLHB 1KU2A 2EIKH 1OCRH 4L9VA 2GA2A 4LG0B 4XKCA 3OYHA 4FCYA 2QUFA 2Y9YA 1J9IA 3OS1A 1PUFB 2JA2A 1X1PA 2E7WA 1ZLKA 3GTGJ 1O3RA 3P9IA 4HEA2 1R00A 3PO3J 2M7BA 2WB1A 1UHWA 1VNDA 3T8TA 3PO2J 2DTRA 4LB5A 3D5LA 1YIJI 5L3EA 5HNFA 1YG2A 1S7AA 1W1WE 2K9MA 3EDPA 4HPQA 2XC7A 3AL0B 3ECHA 2W48A 3WTZA 3CUOA 4Q48A 2EFNA 1HW5A 3OOPA 5C4JJ 5IT9Z 4BXXJ 2KIFA 3SZTA 3SQNA 3G2BA 3WTYC 4I09A 2L9NA 1BN5A 3CDLA 4IL6C 4S04A 2E1MC 1U5TC 3BCBA 1J2XA 1MJBA 3GO5A 4B3XA 2CQXA 1Z1DA 1CF7B 2CUFA 3FK6A 2VASA 3RTRA 3CMMA 2LRDA 2QKMB 2P4WA 2A5YB 3GFMA 4CCJA 1XSVA 2ETHA 2EA2A 2G9WA 3WGHA 5IYDJ 5ICEA 4YFNF 3G3ZA 2I5UA 2VL8A 4E7KA 5TGTA 2K5CA 3S2WA 1EH7A 4EEFG 3OYKA 1STZA 1J75A 2X85A 1BI0A 3Q9VA 1XPXA 4KMFA 4NB5A 3GLXA 1B9MA 5E20A 4XIDA 4HAMA 4AVZA 3D5RC 3TDUC 4HZFA 1BW5A 1UMQA 2QWWA 3OYGA 3R61A 1D0XA 1BI1A 3OYJA 3BZCA 2JUCA 5LD2C 1P4AA 3H5AA 3V7CA 4D1QA 2OZ6A 2Z16A 2YSRA 3GMEA 1JXSA 4A3CJ 4X1EA 1ZG5A 5J4YA 3GBGA 2M5WA 5E1XA 4OIQF 4EV0A 1I6HJ 2CUJA 4G8XA 5ILSA 2HPMA 2R4GA 5FKMA 4S05A 5FROA 3AG4H 1KA8A 3Q9SA 2YX7A 5D5XB 1QNTA 3BG9A 3AG1H 3H0GJ 3W3CA 2LBFB 4E7ZA 3VSLA 4UVBA 2EFQA 4MFDA 1R7JA 1A6IA 4PGGA 3ULQB 3FM5A 1D0ZA 2K9SA 4LOCA 4CYCB 2DYRH 4DJAA 5FKLA 1YITI 4G6QA 2RREA 2ZFWA 2CWEA 5M5XJ 3MAJA 1OFCX 3BPXA 1U3EM 1BR2A 2RQQA 1IRGA 2F5CA 3BR6A 2V1XA 1G6NA 2CQNA 4L5EA 4Y4RA 1PJRA 2A6TA 3HKZA 4RM3A 2WB1N 3ZGKA 1FLIA 2GLOA 4ZYEA 5FRMA 5DM6F 4JQFA 4ABZA 1B8IA 2M8GX 1WH7A 4M6YA 1VQ9I 2JA6J 1ZLJA 1YW7A 3O2PE 3F8CA 3IRRA 2Z33A 1EKEA 2Q1ZB 1HDPA 1Y0NA 1YIOA 3BT9A 1Q1HA 2DK8A 3J7AY 4RA2A 2F5EA 2X1EA 4CCMA 5HS9A 4WCGA 1QHGA 3LL7A 2LY2A 2X9DA 3DF8A 3DQVC 4AD9A 3IHUA 1RR7A 3HIFA 1LNWA 1TWHJ 2ZB9A 1OCOH 4U0YA 2VJ5A 1Z77A 2Y48A 3SDBA 3DP7A 1FOXA 3QWLA 4KISA 1I1GA 2KT0A 5HDNA 4QPQA 2BY3A 3CJRB 3LFUA 2VBZA 5E8IA 4FHTA 2VJJA 4XQFA 2KZGA 4HRIA 2O3FA 3K4BA 4NUBA 2MG4A 3LSIA 2UWMA 5FKNA 1MSEC 3ZMZA 4BHBA 4D9JA 5LHHA 4ESJA 4E7SA 2DODA 1JTXA 1U8RA 2OAZA 1JTYA 1A31A 1I3AA 2FQ3A 3HB9A 3PQKA 1MMAA 3F22A 2NVTJ 4UVCA 3BZ6A 2IAIA 2EB7A 2JJ7A 2VQGA 3WU1B 1ETVA 1K7AA 1XGNA 3U9GA 4BL0B 1SEUA 4NHJA 2HXOA 5IP9J 4FT8A 3I4MJ 3E97A 1T98A 4L0YB 2EV5A 2MW8A 2JA7J 1P2FA 1F36A 4QWQA 1W5TA 1MMDA 1RKTA 1PUEE 1IN4A 1U9NA 1V5FA 3MZ8A 1S6LA 1Z3YA 5E3MA 4IEJA 4YEJA 2OJED 2FOWA 3QOEA 3QPSA 1HA8A 1K4SA 4MHGA 1WPKA 1YJ9I 5FLMJ 1GXQA 2EZHA 2LF7A 2XVCA 2HOSA 2XAHA 3IUOA 2EA4A 3QOPA 3U1DA 4BBRJ 4F55A 4IO9F 4UV9A 2D45A 2Y69H 3O8GA 3BZKA 1KU3A 4JX5A 1UZCA 3MD2A 1SAXA 4ZTJA 2CV1A 1Y8QB 3NARA 4EJWA 5J1UA 3M9AA 1Y6IA 2QQ8A 3MMYB 5D4SA 3A2KA 5E79C 2XGCA 3KP2A 1D0YA 3OYNA 5DS9A 3RIRA 5C3EJ 2UUZA 2R5YB 1A35A 4PJJA 2XB0X 3KZIC 1N78A 2EBIA 1E3PA 2RGVA 1V3FA 3VSKA 4ZH4F 4KYWA 3SYTA 5B1BH 4ZYDA 1R4NB 4DIQA 4U0WA 3I58A 2OQRA 1VF9A 1JJ6C 4WWCA 2FSWA 4RGUA 2A68F 1SD5A 4JX6A 5LRRA 3CUQC 2M34A 3OMYA 2PG4A 1A36A 1YFHA 5FKOA 2XRNA 2IJLA 4M3GA 5HS8A 3OV8A 3R0JA 2UV1A 1RKWA 2NS0A 1PDNC 3HPGA 2WADA 5EEAA 3M07A 1A5JA 1WKMA 1DQUA 2ICWG 3BJAA 1SC7A 3BG3A 4CCKA 4BY1J 2CJJA 2JVHA 4D5FA 3H92A 1YW9A 4MGRA 2Y0SN 2GXBA 3H9JA 3K69A 2J5PA 3SEQA 2VI6A 3EUKL 2OCEA 1R71A 1IF1A 4PJ0C 2E1OA 2BY0A 5D6FA 2CV2A 1L3LA 2OZUA 2BBYA 4EM0B 2HKXA 4KMUX 4HF0A 3QP6A 3R0AA 1EJ9A 1P4WA 3RZOJ 1VQOI 4IOCF 4BHPA 2K02A 2CW8A 3PNYA 3UKGA 1T95A 2VJIA 3IC7A 3FXJA 1T8IA 1WJ5A 4BEHA 2LYCA 3KFWX 2DA7A 1U5TA 2ZO4A 3ABUA 1OR7C 2LTPA 2FRHA 2D2WA 4RDUA 2ZNYA 2VE8A 2KMUA 4F3QA 5HS7A 1X3UA 1USTA 5ILVA 3LSGA 1ITYA 3RQIA 1R1TA 2ZJRF 3BR3A 4HDUA 5J3LA 1G3SA 2ISYA 4CCNA 2XDVA 2DA2A 4Z6YA 1E3OC 2Q2EB 3MQ0A 1POGA 4RS8A 1WHUA 2BE5F 1D5YA 5IY5H 3F6OA 2HDCA 3HDDA 5GP9A 4B44A 5DTDA 3BOQA 1GV2A 2VB6A 2L7KA 1IRZA 3L2UA 1OISA 3GUDA 2M3AA 4ESFA 3G71I 1K78A 2P8TA 4IRGA 3A02A 4G6TB 4XBFA 2DFHA 3LSRA 4C2UA 2JWTA 3JAMK 2Y30A 2ZBKA 4RAZA 1YRNA 3A03A 3DBHB 4ZYAA 4YELA 4C3JJ 1N25A 4YIRX 4XRMA 1QPIA 1FMVA 5CVRA 2PQ8A 4BXUA 1B72B 2A07F 2ZMEB 3A01A 3KETA 3LSTA 5FB2A 2RN7A 2V1DA 2DFIA 3AL0C 2A69F 3FXUA 4PGHA 1C0WA 2BHZA 2MLKA 4D0PA 1X1DA 2HTSA 5EZHA 2DDBA 4W1UA 2ZJPF 4FTHA 2BY2A 2KDZA 1Y39A 3L9FA 3BG5A 4H0EA 1KU7A 2O9LA 1LDJA 4OAZA 4W97A 3BQZA 3B6AA 3OR2C 1U8BA 4BGDA 6PAXA 3PSIA 2PMZA 3HG9A 4FQGA 1E0EA 2YU9J 3KZZA 1OYYA 5IP7J 1QQIA 3W2VA 1F9NA 3Q0UA 3QU3A 1W0TA 2DN0A 1YX5A 2A3SA 5KAFC 1IN7A 2MLGA 2G0EA 2M1BA 2FOKA 2FMLA 2QVOA 4ENJA 2D5VA 5ICGA 3B02A 2JT1A 3QYEA 3J80K 2STWA 4ZDPA 2O61A 1QZEA 3E0JB 5GAGJ 4CZZA 2H6CA 2IP2A 4P5OA 3DKWA 2WWYA 3C2BA 3TP0A 4U7BA 2P5VA 3K1PA 3GTMJ 1X4PA 2PFBA 1R36A 5KAIC 4HG2A 2XF5A 1WZ2A 2W84A 3GFLA 2X51A 5FFZA 1O3TA 2W00A 3LWFA 1X1CA 2QEXI 1TC3C 2IS4A 3S16J 2K3FA 5CYVA 4NQWB 1W4MA 3ZMVA 2EWNA 3OIPA 2XROA 3LAPA 3CCLI 1I27A 1R58A 1AHDP 1MBHA 2L54A 4A3GJ 2R0QC 3T0YA 4A3KJ 1IN6A 4LJZF 1M1EB 1R23A 3W2AA 3JRGA 1GVJA 1I3QJ 3CTAA 5GTHC 3DKYA 1ZYRF 2DT7B 3ZOBA 5K7ZA 4BNCA 5ICFA 2LKSA 1JKQC 3F8MA 4Y7NJ 3CCJI 1ETWA 2HVRA 3V7RA 2PJRB 2HQRA 1RZ4A 2FEZA 3CO7C 2EV6A 1AKHB 3QPTA 3G4SI 1W7PA 3J81Z 1BA5A 2M4GA 2C6YA 9ANTA 4LG3A 1RUOA 4HV5A 3FMRA 2R7WA 3T5XA 3Q5FA 3BROA 3ZQFA 3SXYA 5EGOA 4M74A 4RLQA 5M5YJ 2LDUA 1DU6A 4WXHA 2VIXA 3JR9A 2W7NA 3DWLE 3BP8A 1MJAA 1TTYA 2OV7A 1QO0D 2CS3A 4OU0A 3G73A 2DMUA 2KPMA 3GYHX 2EZIA 4EGYA 3IWZA 4IRHA 3HYIA 2OCCH 3RCOA 3HBLA 4FX0A 1EH6A 2H8WA 2L7FP 2F6CA 2L9SA 4IHWA 2OTJI 2CRGA 2IVMA 4AWXB 3PQJA 2V7FA 3F3XA 2LNBA 3M8FA 4JX4A 1B4AA 2MC3A 2PJPA 5DD4A 3JRIA 5H6RA 5JHFA 1ETKA 2FF4A 4JK1X 2VOOA 1CGPA 4ZTFA 2O8KA 1LQ1A 4IHSA 3G6EI 2K4JA 1UG0A 3HRUA 3S3OA 4KIFA 3CUQA 2Y9ZA 3L00A 2WY8Q 2IPQX 4IQJA 2CGPA 2HKOA 1Z67A 1ZKGA 3FKJA 3K4KA 1G59A 2KFDA 1XS9A 1K83J 4YRVA 5DV5A 2OUMA 4M9XA 1X4OA 1YYVA 2DAOA 3A1YA 3BTJA 4B4CA 4D7MA 3I59A 4TV7A 3CQZJ 2JPCA 2Z99A 1X2NA 1F1ZA 1NG6A 3F0CA 3COAC 1UHSA 5F0FA 4X6AJ 3WU0A 2HYGD 4C3HJ 3HTSB 1UHMA 3PIPF 2VN2A 3G1OA 3JRFA 3P7NA 4HX4A 3WGIA 3JCUC 2P7VB 3EQLF 4OAYA 3KP7A 4C2MJ 1ZQ3P 3ELKA 5HLHA 1ZREA 2TCTA 2E2JJ 5AIQA 1VI0A 4PFPA 2TDXA 3OOUA 1GHCA 3PL8A 4I01A 3J7ZI 3CF5F 1IN8A 2ZSHB 4L9NA 2Z5UA 4A3LJ 4XK4A 2L7ZA 2M7AA 2DOAA 1OR7A 4HX7A 1Y8RB 3K9TA 1Z7UA 5DCMB 2XPUA 3I54A 3W6JB 3UR3C 1MNMC 3R60A 2GOXB 2HOAA 3CJNA 4KT5C 1R6RA 1LFUP 2W4SA 3BQYA 3CC4I 1LEBA 1DP7P 3BTCA 3VB2A 3J7YJ 4PFOA 3LAJA 1WWXA 1BL0A 2DFFA 4GRIA 3RKQA 1O4XA 1KGSA 2MABA 2P6TA 4B47A 3H3UA 3A4CA 2O0YA 4KIBA 1UELB 3S1QJ 2OBPA 1Z0XA 1XCBA 2HQNA 2HXIA 5BS6A 3S14J 2BGCA 2IGNA 3JTHA 1LDDA 3PIOF 1KYWA 2IS2A 2M45A 2VXDA 1TQMA 4PZJA 2QBYB 2L7MP 2KP6A 5L3DA 2K9QA 4V2FA 4A3DJ 3DTIA 1HKTA 1TW3A 5IP6A 2V1UA 3FXRA 2JQ7A 1MIJA 2MH9A 5D5UB 5F64A 4G6DA 3TGNA 1MW7A 4BE1A 1H9GA 1MBFA 3K7AJ 3F9KA 2O7OA 3S1RJ 2ELHA 1LE8A 2HYFA 3SFIA 5GTIC 1H9TA 3WTUC 4G7OF 3G1LA 3BG6A 3GLLA 1X58A 2PX9A 3CJQB 2RDPA 3PFIA 1NK3P 2CYYA 2E1CA 3L2VA 4KICA 3E5UA 4FETA 5HNHA 2IS1A 3OYFA 1FC3A 2P7CB 1MMGA 3PJRA 1E17A 2LK2A 2DPUA 1KONA 5J4VA 3JREA 1WSUA 3I3LA 2IBDA 4G12A 2TRTA 1S9HA 2LOOA 1HQCA 5K5QA 1N77A 1ORKA 2F5VA 2NYXA 3P9CA 2AXTC 1VZ0A 4S0HB 3U21A 1ZR2A 1IO2A 2CQ7A 4M3BA 2F48A 1FOYA 3CO6C 2HEOA 2NS7A 5CVUA 1S8NA 2ID3A 3CLOA 3B73A 4BQNA 3ONQA 2IRFG 5EG0B 4AUXA 3IV5A 5FGMA 1HW2A 2H1KA 3FKIJ 1G3WA 4RM2A 4YFXF 4LLNA 1EV7A 1G8XA 3I4NJ 3ZMUA 1BIBA 2JUGA 1Y1WJ 3HGGA 2DYSH 4MFEA 3ZMDA 2OPTA 5JLWA 5DUIA 5J40A 1O7LA 2LBFA 1BR4A 3VOEA 5D8LB 1K6OA 1WQ2A 1YS6A 4YIFA 2MC4A 3S32A 2K7LA 1W36D 3VODA 1HSJA 4CYCA 2W82A 3BG7A 1JT6A 4BS9A 3I56I 1I6XA 5D8KB 1VQNI 3K70C 3WTTC 5IOZA 1WCMJ 5JFRA 4F93B 2DOEA 2ZJ2A 4Q47A 3BJ6A 1FT9A 2A5WA 2DK5A 2N8GA 2VC1A 2QF7A 4BU2A 4MEYF 1OYWA 2FNPA 3OS2A 3V7SA 1QHHD 2YPRA 4FASD 4F92B 4GFBA 2JSPA 1D3YA 4M6XA 3GTKJ 4UUTA 5L3CA 3EYIA 3CMEI 4I0BA 1RNLA 2K9NA 2L0KA 3NWSA 4B09A 1QZYA 2R93J 3B6CA 2BXZA 1R1VA 1MDMB 2AXLA 3D1NI 3ZCOA 5B66C 2VE9A 1VQLI 3A0BC 1T38A 5K7FA 3IRQA 1OYIA 3SHFA 5M3MJ 3JW4A 3KEQA 2K27A 1VQKI 4M3EA 2DJIA 3LQQA 3P5JA 3TOAA 1MGTA 4DYCA 2QCOA 2VLAA 3TMOA 4R79A 1K61A 3U2RA 3H3ZA 3HHHA 5DUKA 3RSNA 1W0UA 2R3SA 2BVMA 2Y0SA 5CVJA 5F08A 2BZTA 5M5WJ 1OCZH 3V8JA 2QSGX 2BXYA 2L3DA 4BJ5C 4ENNA 1JJ8C 2RVCA 4MLOA 3T8RA 4PJLA 2HU9A 2J5OA 4R1HA 1K6YA 3ZP5A 3QODA 4A93J 1ERDA 2O03A 1XG1A 2EJRA 2RNGA 3I53A 1TWAJ 4DZJA 3MKWB 3AAFA 1S72I 3LSPA 3CCRI 3S3MA 1QU3A 3SEZA 3PSFA 1FYMA 5E18F 4L9JA 1MNDA 4EJOA 4BUPA 3QRFF 5EEGA 1RUNA 4NNJA 2EPFA 2L4AA 1U0JA 4P1WA 3VFZA 5ICCA 3HOZJ 1MNEA 3HOSA 3HJEA 5F27A 3ML6A 3JTGA 2ZC2A 2NNYA 2L2OA 3GTQJ 2BY1A 3GFJA 2KZVA 2E36A 5BMZA 2GXGA 2XUBA 5FFXA 1IUYA 4CICA 2A6HF 2LY1A 3HSEA 3E5QA 4Y15A 2R5YA 5LLQA 4XM3A 2NOJB 2G7UA 3Q0VA 1MBKA 3GCMA 5TJJA 3KPHA 4HNVA 1D8KA 5FKKA 5J1YA 1UCRA 3ISPA 3CCVI 1PP8F 3AG2H 2HOTA 4A3MJ 4MQVA 2IA0A 4KNYA 3PUBA 1TT5B 5GAEJ 1NTCA 1SFOJ 1ETXA 4PJMA 4IJAA 1VQ5I 1MBJA 3PUFA 1XB4A 2AO9A 2VPRA 1EF4A 4EMSA 2OU2A 1V54H 4NDLA 1ZR4A 3DU5A 2JK3A 2DMNA 2W24A 2L5QA 4OMZA 3IH2A 3M1CA 3TKYA 4BACA 4HDVA 2EV0A 3HOTA 1ZN2A 3MKYB 1OPCA 2DA6A 2F4OB 3PM1A 3Q0WA 4DOZA 5K5RA 1BM9A 3FWEA 3C2HA 2IGKA 4GYIA 4IPAA 4B1RA 5D5WB 1Z3XA 3CDIA 1ZH5A 2R5ZA 3AG3H 2X1DA 1D8JA 1VTNC 3RKXA 5LHIA 1MD0A 3G1MA 2ME0A 3CCSI 2KLOA 1P6RA 2NVQJ 2GXAA 5LGNA 3E3VA 2CV0A 1LFPA 3HXLA 5CVVA 3GXOA 2E71A 1XDUA 2ZXIA 1XGOA 4EJTA 4ZZDA 2XHKA 2KIQA 1FJLA 2IT0A 2R7SA 3OYBA 4UNOA 2GWRA 1X19A 1U9OA 2FQ4A 1BI3A 4HNTA 5LEKA 1FSHA 1FIAA 1O3QA 5H20A 1BI2A 4HQMA 4AIKA 4XN0A 2R7FA 5GPCA 4EJUA 2JPBA 3TEDA 2OTLI 5E3OA 5FRNA 3KP5A 1NK2P 2Z9OA 2DJNA 3SDGA 1ULYA 3KYCB 4CXFA 1ZK8A 3R6SA 4A0XA 1W36C 4HF1A 1FIPA 4HNUA 3S2HJ 2XGDA 3I64A 2CH0A 2JRMA 2QA4I 2M8EA 2AS5F 2XPVA 2FBHA 4BXFA 2WC2A 2IA1A 1YO5C 3HRTA 4ZC3A 3LMMA 2WV1A 5LFAA 4FX4A 4EM2A 5KCMA 2QZ8A 3REOA 4MNUA 1B72A 2ESNA 2XV4S 4BY7J 1IV6A 4I76A 3DPUA 1MSFC 2EINH 2O8XA 1IDZA 3RKYA 4BEHB 3OR1C 2E1MB 4KJZA 3IP4B 3HOUJ 4BKXA 4P9UA 4OIRF 4RB2C 3BDDA 1W5CC 1SVMA 3S17J 5BQTA 3KYLA 1TZLA 3N97A 1VQPI 3BTIA 4WF2A 2XAFA 5FLXK 2FX0A 2KJBA 2QSFX 2EFPA 3ABLH 2WAEA 2ESHA 5J6XA 4QIWN 1JI8A 2F2EA 1XD7A 3ZQLA 2ID6A 1GT0C 1RETA 1ON1A 1VQMI 1PYVA 5LGUA 5AIPA 4HLXA 4UV8A 4PJNA 3ZN1A 4Y17A 4AYBA 1XSXA 2AHQA 3EPZA 1HW1A 3QU6A 2VC0A 2VT3A 4HOBA 2VOPA 4CYDA 2F4IA 3ABMH 2GIZA 3GF2A 1QVUA 3OYLA 1A6QA 1YI2I 2E5NA 3FDYA 3ABTA 1ZTRA 2WY7Q 4KN4X 1T08B 2BYVE 3V42A 3WG7H 4A6DA 1DUXC 1FBQA 1TWGJ 2L02A 1HXDA 1YRNB 2LREA 5HLIA 3LFKA 3ZQGA 2OD5A 4PK4A 1XGMA 1H8AC 2DMQA 3FX3A 2XF7A 1MBGA 2HVQA 4UY8I 2JMWA 2NVUB 4A5MA 1LUJB 3ZPLA 5D6EA 4XICA 3BPVA 4NQWA 2OF7A 2P0WA 3BR2A 4I6ZA 2EFOA 4RB1A 2L01A 4WXCA 2JRTA 2XGEA 3HZJA 3I55I 3BLYA 2YU3A 4XMYA 4U87A 1DPRA 1AWCA 1Y56A 1BBYA 1JKOC 3RJPA 2LKXA 3I9V2 2DTZA 2E1NA 4EM1A 3CF2A 4QSHA 1G4DA 4U88A 1VQ7I 2Z2SB 5EYRA 3E6CC 4HBLA 3OSGA 1Z21A 2KKOA 2HTJA 4IQ4A 4ASNA 2EK5A 1ZGAA 2DFEA 3E5XA 5H6QA 2PJRA 4A3IJ 3WGGA 4FE7A 3RI4A 3FM3A 4J19A 3TBIA 1HSTA 2CG4A 2ZSIB 1AKHA 1SFEA 2IGMA 3BR0A 4GGGA 2E2HJ 3UNGC 2IEKA 3IWFA 3H9QA 2KRCA 3WE3A 2JVGA 4M72A 5LHGA 3I5UA 3L7WA 3JSOA 2HZTA 1B9NA 4L5JA 1B6AA 4E4HA 3JAMZ 2WA0A 3CMAI 1RPWA 2DQRA 4L9TA 3F21A 4CA0A 2VKEA 3OYEA 2H94A 1JKRC 3PNTA 4V19K 3ASNH 3C18A 2DA5A 1FPQA 1WJFA 1F4KA 3BR5A 5K5OA 4LD5A 3EUHC 2IS6A 1FOWA 4ZYGA 2R7ZJ 2R7QA 2ECCA 1LFBA 2XAQA 4KDPA 3CD6I 5D4RA 4RGXA 2DA4A 3CLQA 3RYPA 4XR6A 2KIUA 2E5ZA 1IG7A 2CW7A 3TOBA 1GLNA 2NS8A 4DW6A 2LG4A 4A3JJ 2V9PA 3K4CA 3F8FA 4C30A 5B1AH 1K79A 4BQAA 4AYBN 4P9FA 3VYSB 1UAAA 1FEXA 2XF6A 5DYMA 1S29A 5F0CA 3DBRB 1MH3A 1FTZA 1XTAA 1DPUA 1MBEA 4CDGA 1WGXA 4F91B 3DCFA 3OS0A 1UG2A 2KIMA 3FK7A 4UVAA 1LKXA 4XLFA 2EH3A 3R4KA 2V9VA 2QQBA 5D5VB 3J80Z 2LSOA 5B5EC 5JVTA 5HODA 4XNFA 4XLPF 1S7EA 3BJOA 3LSHA 1BC8C 4LLLA 1UFMA 2XSDC 3S93A 3K2ZA 2HR3A 1VQ4I 4XLAA 2XKOA 2VQLA 4EVIA 4A3BJ 1E2XA 2CQKA 3EUAA 2NRAC 1PVEA 1TQIA 4MEXF 4L5IA 2CFOA 4HX8A 3BY6A 2CUEA 4XSXF 3GWZA 4LIVA 3CCQI 2WAFA 3H3VK 2CUZA 3E6DA 2RAEA 1GVDA 3ZXSA 4DZPA 4LGWA 4UHTA 3KLOA 2CFXA 3KP4A 3ZQIA 2W1OA 4IXAA 2YUSA 1QGPA 2XASA 1AOYA 4FISA 1MJ9A 1OMIA 3T1BA 2LC2A 1WJEA 1X2MA 5LEJA 3CCUI 3CC2I 1XMKA 3KP3A 1JHFA 2I10A
chains in the Genus database with same CATH topology
1WJDA 3CP2A 4XLCA 2M4KA 1Y6IA 2LBFA 3MMYB 3VYUB 1BR4A 2ZXHA 2IXSA 3A2KA 3OYNA 1D0YA 1T0FC 2UUZA 3K6GA 4PJJA 2MC4A 3S32A 4E7IA 1W36D 1N78A 3VSKA 3OYCA 1LVKA 2CMPA 3SYTA 2W82A 3MKZA 3BG7A 4CZCA 4DIQA 4XLHA 4BS9A 4BDZA 3DTEA 2V9KA 3K70C 3NWTA 3HUGB 4ITVA 4PUSA 2BOLA 4F93B 3OYDA 3OMYA 1FMWA 2V4JC 2K9LA 4BDYA 2A5WA 2V26A 1Z7LA 2UV1A 4BU2A 3HPGA 2WADA 4Y3OA 1DQUA 3OS2A 1QHHD 4CCKA 4FASD 4F92B 2JSPA 3DTKA 4DBQA 2JVHA 1WJBA 4E7LA 3VWBA 3H9JA 3D5SC 3LSKA 1SAUA 3NWSA 3SEQA 3EUKL 3VYRB 2DCEA 1LDKB 1EA3A 4N4OB 1SFKA 4XONA 2CV2A 4XL9A 3ZCOA 2VQCA 4QPOA 2VXZA 2CW8A 3PNYA 4XORA 1T95A 2VJIA 2HZDA 2DJIA 2ELJA 1WJ5A 4BEHA 2LYCA 3K4LA 4RLFA 4BQOA 2VLAA 3TMOA 4R79A 1OR7C 2BW3B 4ZDOA 3RSNA 1TT0A 1V5EA 2BVMA 2KMUA 2Y0SA 3KEYA 4F3QA 3OYMA 2HQAA 4AU7A 5HLTA 2R7XA 3LSGA 2KHMA 4BJ5C 4JOMA 4BJ6C 4CCNA 2XDVA 2HVSA 4MLOA 1X1AA 2GOMA 1NG7A 2Q2EB 4X0GA 4PJLA 2HU9A 1WFXA 1K6YA 2FUG2 3OIQA 3QODA 1ERDA 1J09A 2RNGA 3PFYA 4B44A 3DPLC 3MKWB 2R7TA 2VB6A 2L7KA 3L2UA 3S3MA 4II3A 1QU3A 3SEZA 2VQHA 2M3AA 3PSFA 4F52A 3K70D 1MNDA 4BUPA 1IRXA 4EATA 4NNJA 4G6TB 3TL4X 2R7VA 1U0JA 4P1WA 4C2UA 1MNEA 3HOSA 1D1CA 3DLAA 3RPUD 2L2OA 4ZYAA 4YELA 3RQ4A 2KZVA 3IAM2 3OL3A 3VYTB 1FMVA 3CZ6A 4E7HA 2LY1A 3SZGA 3ZR8X 3AL0C 4XM3A 2NOJB 3E1SA 2MFZA 4CUGA 4PSXA 2HNHA 1X1DA 3K4MA 3DU6A 3K10A 1ZELA 2QKLB 1D1BA 3OWTA 4OAZA 3PUBA 1D1AA 3OR2C 2KL4A 4PJMA 4BGDA 2XSJC 3S8PA 3PSIA 2PMZA 4XKWA 3HG9A 1E0EA 3ZQQA 3HPHA 3W2VA 3K4NA 4XKVA 3DU5A 1YX5A 2L5QA 5KHDA 3M1CA 1DP3A 4BACA 4BE2A 2XAUA 3HOTA 4B43A 5HVQC 3QYEA 3W2WA 3MKYB 2BVLA 4ZDPA 3QYFA 5KNLA 5CPRB 4DOZA 2V1NA 4IKFA 3E0JB 3C2HA 2IGKA 1Z3XA 4OWRB 1WJCA 4P5OA 2M0MA 3N05A 4DBRA 2X1DA 3AFHA 2VKHA 3L2WA 4U7BA 5CKTA 1X4PA 2KLOA 4HG2A 1V5GA 2XF5A 4HSTA 4XOTA 3ZRGA 3AKZA 4XKBA 3OYIA 1WJAA 1X1BA 3K4JA 2X51A 2W00A 1X1CA 2CV0A 2IS4A 4LITA 4ZJZA 4RMNA 1LFPA 2X6WA 3HXLA 4NQWB 2WBMA 2ZXIA 3OIPA 3LSMA 3FBNB 3C2GA 2R7SA 3OYBA 4J01A 1X19A 2BW3A 3W2AA 3QYBA 3DKYA 2DT7B 4ZDLA 2MD0A 3FHNA 3L2QA 2K3PA 4LIUA 4IZZA 1MMNA 3IAS2 4HNTA 2AQFA 2R7OA 2HVRA 1BR1A 3VDXA 2PJRB 1N75A 4XN0A 4XLEA 3BCAA 5CQGA 1YX3A 4CCOA 5CQEA 1BOBA 5FRNA 2M4GA 2HPIA 4LG3A 4HSRA 3CP8A 2ZFUA 3DKXA 2R7WA 1W36C 4HNUA 5HOOA 4RLQA 2CH0A 4XKCA 4BXFA 2VIXA 3OYHA 2W7NA 3DWLE 4BE0A 4ZC3A 3LMMA 3OS1A 2V6EA 2OV7A 5LFAA 2JA2A 4E7JA 2CS3A 5KCMA 2R7UA 2KPMA 4BQQA 4HEA2 3HC7A 2M7BA 2WB1A 3RCOA 2F6CA 2L9SA 3DPUA 3D5LA 4ANJA 4BEHB 5HNFA 3OR1C 2V7FA 2K9MA 2E1MB 4KJZA 4HPQA 3IP4B 2XC7A 3AL0B 2VPLA 3BC8A 2I8DA 3PNVA 3KYLA 1TZLA 4II2A 3OY9A 5JHFA 4IX7A 3G2BA 2L9NA 4ZTFA 2E1MC 3BCBA 1UG0A 2WAEA 1JI8A 4B3XA 4PSWA 3S3OA 4C2TA 2WY8Q 3S3NA 2VASA 3RTRA 4IQJA 3CMMA 2LRDA 1PYVA 2QKMB 4CCJA 2WAQA 3FKJA 3K4KA 1G59A 4PJNA 4AYBA 4YRVA 2OUMA 3EPZA 1X4OA 3A1YA 3M8JA 2VL8A 4XN3A 4E7KA 5TGTA 2K5CA 3OYKA 1NG6A 2X85A 2F4IA 4NC7A 4Y33A 3OYLA 3H35A 2E5NA 3FDYA 4AVZA 3D5RC 2WY7Q 3V42A 2E60A 2Z1DA 3OYGA 1D0XA 2LREA 4OAYA 4CH7A 3OYJA 3H0DA 4PK4A 2XF7A 5LD2C 2HVQA 3H5AA 4D1QA 4PFPA 2OC6A 3OOUA 2P0WA 2Z16A 3PL8A 2MYSA 3BLYA 4XMYA 3GBGA 4U87A 2ZSHB 2CUJA 1DGWY 1Y56A 2HPMA 2R4GA 5FROA 3I9V2 2M7AA 2DOAA 4H4KC 3W3CA 3CF2A 2LBFB 4E7ZA 3VSLA 2Z2SB 2O5RA 1Z21A 4IQ4A 3UR3C 4C9YA 1D0ZA 2GOXB 2PJRA 1R6RA 2AQEA 2W4SA 4DJAA 3TBIA 4B48A 2ZSIB 2RREA 4BJTA 1DGRM 4PFOA 2IGMA 1AA7A 2X1CA 1BR2A 2RQQA 4XOPA 3UNGC 3H9QA 2KRCA 4GRIA 2JVGA 4Y4RA 2MABA 1PJRA 2A6TA 4B47A 3DEEA 3HKZA 4RM3A 3A4CA 1UELB 3ZGKA 4E4HA 2X6YA 2WA0A 2IGNA 3OYAA 5FRMA 4JQFA 2IS2A 4CA0A 2VXDA 3OYEA 2R7RA 3PNTA 2Q1ZB 1WJFA 4DGWB 3J7AY 2IGOA 2X1EA 2KP6A 3EUHC 4CCMA 3DPTA 2IS6A 1QHGA 2R7QA 3LL7A 4CSWA 3DTIA 2VKDA 2LY2A 3DQVC 4E6KG 1MW7A 2VJ5A 3OL4A 4KT6A 4XR6A 2E5ZA 3SDBA 4BE1A 2CW7A 4KISA 1GLNA 2LG4A 3F9KA 4QPQA 3K4CA 4C30A 3CJRB 3LFUA 4J00A 3VYSB 1UAAA 4XQFA 3HL2A 2VJJA 2XF6A 3BG6A 4HRIA 3CJQB 2X6XA 3K4BA 2KDOA 4NUBA 3LSIA 4F91B 2UWMA 3KX2A 4NC8A 4D9JA 3OS0A 4XLFA 4E7SA 1LKXA 2DT6A 3L2VA 4FETA 5HNHA 2IS1A 3OYFA 1MMGA 3PJRA 1KONA 1MMAA 3I3LA 4CCLA 4N4NB 4XNFA 1S9HA 3LSHA 2LOOA 2VQGA 3FBIB 1N77A 3H5NA 3S93A 4BL0B 2DXIA 2F5VA 4XLAA 1VZ0A 2VQLA 3H9GA 3U21A 1YE9A 2LH9A 3EUAA 3L2RA 4KITB 3H5RA 2HDWA 1MMDA 2CFOA 1V5FA 1Z3YA 4LIVA 4BQNA 3ONQA 4YEJA 2VJ4A 2WAFA 2CUZA 3QOEA 1HA8A 3CESA 4RM2A 2KRHA 3ZXSA 3IUOA 4F55A 2W1OA 1G8XA 2JUGA 3MD2A 2LC2A 1WJEA 4ZTJA 2CV1A 1P9QC 1OLTA 2KQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT7 B;  1X4P A;  2DT6 A;  2E5Z A;  2E60 A;  1X4O A;  1UG0 A;  4DGW B; 
#chains in the Genus database with same CATH topology
 1WJD A;  3CP2 A;  4XLC A;  1JUS A;  1JKP C;  2M4K A;  4PDK A;  5J47 A;  5DCM A;  5E3L A;  2ZXH A;  2IXS A;  2FXA A;  3FZV A;  1IGN A;  1T0F C;  2DOF A;  1GUU A;  2ZXJ A;  2QEN A;  4E7I A;  4OIP F;  4IHT A;  3TQN A;  1HDD C;  3LSJ A;  2CMP A;  2F5D A;  2GZW A;  4NBQ A;  3RYR A;  3MKZ A;  3IKT A;  1KYZ A;  5BNG A;  4G9Y A;  4BDZ A;  4G7Z F;  1HBX G;  2WTE A;  2VKV A;  3ROU A;  2V9K A;  5IT9 K;  3HUG B;  3KE2 A;  2GQQ A;  4ITV A;  4D7N A;  3I59 B;  3OYD A;  2E2I J;  4UUS A;  5BPI A;  1FMW A;  4BDY A;  1O57 A;  1O3S A;  1VFC A;  2V26 A;  1Z7L A;  2HFH A;  4B3A A;  1MKM A;  2FBI A;  2FD5 A;  4BH9 A;  4Y3O A;  2H8R A;  2X0L A;  5A2Q K;  3QPL A;  4DBQ A;  2IA2 A;  1JGS A;  5LGT A;  2QM3 A;  4ENM A;  1ZHF A;  2DMT A;  1WJB A;  4E7L A;  3VWB A;  3RPQ A;  2CSO A;  3S15 J;  1FX7 A;  3CJT B;  3D5S C;  1XCV A;  5HDK A;  3LSK A;  3ZMS A;  2XPW A;  5B3S H;  4LG0 A;  3MZY A;  3W6K B;  1EH8 A;  3GTL J;  4HLY A;  4N4O B;  4IF4 A;  2DA3 A;  4MQ9 F;  4XON A;  1PUF A;  1R49 A;  2XAG A;  1R5I D;  1IV8 A;  3ZMT A;  2VQC A;  2NOG A;  2LR8 A;  4QPO A;  5GAH J;  2VXZ A;  2LVS A;  3F8B A;  4ENK A;  4XRS A;  3FMQ A;  4XRF A;  3IL2 A;  1IAW A;  2MH2 A;  4OMY A;  3MWM A;  3P9K A;  4BAY A;  1SD6 A;  4RLF A;  2XKP A;  1XC5 A;  1FBU A;  2BW3 B;  4ZDO A;  3GTJ J;  4XRS G;  2KIS A;  4U0V A;  2P81 A;  3KEY A;  2B63 J;  5F6F A;  3IKV A;  3OYM A;  3CCE I;  3S1N J;  4G94 A;  2E35 A;  4ESB A;  5ILU A;  4GCV A;  1K4T A;  1R22 A;  3KLN A;  1QRY A;  4O6J A;  3ZN0 A;  4GXO A;  2A61 A;  5E3N A;  2HVS A;  2F4M B;  1CF7 A;  1X1A A;  5TIS C;  4X0G A;  4A12 A;  4IOA F;  2CQQ A;  3OIQ A;  4AC0 A;  3JRC A;  1J09 A;  3F23 A;  3KIO A;  4YG2 F;  4KIG A;  3HOW J;  3DPL C;  4RGS A;  5DDG A;  2R7T A;  3RZD J;  4LFU A;  2FJ1 A;  5EG0 A;  4F52 A;  5EEH A;  1KQ9 A;  1YQA A;  2KRF A;  2FA5 A;  2K4B A;  3V8L A;  1S7O A;  5GAD J;  2D1H A;  1IRX A;  1IZ1 A;  5KVR A;  1PP7 U;  3TL4 X;  2R7V A;  4OIN F;  3HOY J;  3LA7 A;  1UJ8 A;  2R7D A;  5EZG A;  2KJC A;  3F8N A;  3WHC A;  1D1C A;  1O7F A;  3LA3 A;  3DLA A;  3RPU D;  5JR3 A;  3NRV A;  3IAM 2;  3OL3 A;  5L3F A;  1NHA A;  3M3Y J;  1LE8 B;  3CZ6 A;  1IW7 F;  4UXN A;  3SZG A;  1AU7 A;  3SFZ A;  1IUF A;  4JBA A;  2ACJ A;  3VEP A;  2H1L A;  3E1S A;  2HNH A;  2X6O A;  1ZEL A;  5BPD A;  2VON A;  4V2G A;  3OWT A;  2ZME C;  2CW0 F;  1QVT A;  2BHY A;  2DO7 A;  3VPR A;  5A2Q Z;  1T33 A;  2XSJ C;  4RBO A;  3S8P A;  2VBW A;  1S3J A;  2OA4 A;  2Y31 A;  5E1W A;  2YR2 A;  3WG9 A;  3K4N A;  5DM7 F;  2HDD A;  5C44 J;  1FWZ A;  1U78 A;  4N0B A;  5KHD A;  4A3F J;  3FMS A;  1DP3 A;  4D5C A;  2NVX J;  1KU9 A;  4FE4 A;  2XAU A;  2GM4 A;  2RV8 A;  2MA3 A;  3DEW A;  4U7D A;  5FO5 A;  1LVA A;  2ME6 A;  2H6B A;  4IHV A;  1FBS A;  2DU9 A;  5KNL A;  5CPR B;  4A0Y A;  2V1N A;  4IKF A;  4AVP A;  2EFW A;  1Z9C A;  4RB0 A;  2M0M A;  2K85 A;  1XSD A;  2M87 A;  3FXQ A;  5HDG A;  1W5S A;  1SVL A;  2DW4 A;  1MZB A;  2K86 A;  3HRS A;  2W57 A;  3L2W A;  4EGZ A;  3I0T A;  3EUH A;  3ASO H;  1SVO A;  1MDM A;  1OJL A;  4HST A;  4QLC U;  3O3K A;  3ZRG A;  3AKZ A;  1KZH A;  3WHB A;  3GZ5 A;  3OYI A;  3CCM I;  4HQE A;  3KZY A;  3C1D A;  4K2E A;  3LQR A;  1JHH A;  1ONV A;  4LIT A;  4RMN A;  2X6W A;  1WH5 A;  4BBS J;  1HF0 A;  1WI9 A;  2WBM A;  4UB8 C;  2EQR A;  2ZXW H;  1YTY A;  4A0Z A;  1HLV A;  3FBN B;  2UXX A;  4J01 A;  1GXP A;  3WTX C;  2RC4 A;  4A2U A;  1XGS A;  3FIW A;  4KA4 A;  1X3W B;  3H36 A;  3QYB A;  4LK0 F;  1F43 A;  1HC8 A;  3KCC A;  4EJV A;  3TO6 A;  1APL C;  2MSY A;  3FHN A;  3HSR A;  2K3P A;  2BEO A;  4LIU A;  1U6G A;  5EDN A;  1MMN A;  3HEF A;  2AQF A;  2L9R A;  3HOX J;  3O8H A;  3GVA A;  3EET A;  5JHU A;  2GA1 A;  1N75 A;  1OQY A;  1WVR A;  4XLE A;  3BCA A;  4M6V A;  2DQL A;  3MEX A;  5CQG A;  5TRD A;  1RIO H;  4A3E J;  1YX3 A;  4CCO A;  5CQE A;  5L3G A;  2XRL A;  1SMY F;  2R92 J;  3HTU A;  3MZH A;  2LMD A;  4HSR A;  5KK1 A;  2ZFU A;  4IHX A;  3DKX A;  2Z3Y A;  1ACI A;  1ETO A;  2GAU A;  4AIH A;  5HOO A;  2Q8K A;  2M0C A;  3HHG A;  2H09 A;  3FXM A;  2YS9 A;  2ZKZ A;  3TDZ C;  1FYL A;  1B8I B;  4BE0 A;  2V6E A;  4L0Z B;  2P5K A;  1G3T A;  2PN6 A;  3TO9 A;  4B8X A;  4E7J A;  1ZGW A;  2R7U A;  4DNC A;  4BQQ A;  3V8K A;  4Y13 A;  3K1M A;  3HC7 A;  2PMU A;  1I5Z A;  3HRM A;  2CU7 A;  3DBL B;  3M4O J;  4ANJ A;  1TW2 A;  5M3F J;  3NEU A;  1T0F A;  2L9V A;  4N9I A;  2VPL A;  3LA2 A;  3BC8 A;  2I8D A;  3PNV A;  3CMY A;  4KUM A;  4II2 A;  3OY9 A;  4IX7 A;  5IPA A;  1LJ9 A;  1QPM A;  3SJM A;  5J1R A;  1Y0U A;  3WTV C;  4R8H A;  4I99 C;  4BYY A;  1XDS A;  4PSW A;  3ERM A;  1G3Y A;  4C2T A;  3S3N A;  3RKW A;  2W25 A;  2WAQ A;  1IXR C;  1TWC J;  1YHQ I;  2DDA A;  1X3Z B;  2E7X A;  3DXJ F;  3M8J A;  4XN3 A;  1ZGJ A;  2WV0 A;  4C3I J;  3N4M A;  4NC7 A;  3FIS A;  5EJC A;  5E1Z B;  2ZJQ F;  4Y33 A;  4MTE A;  3H35 A;  3GFI A;  2EIL H;  3HGY A;  2ZCW A;  2QYO A;  2E60 A;  3I4P A;  2JA8 J;  2Z1D A;  5J8C A;  4CH7 A;  2B9S A;  3H0D A;  3F6V A;  4OOI A;  2DLL A;  3Q3S A;  5JLX A;  1E3H A;  1ZAR A;  2DA1 A;  2Y75 A;  2OC6 A;  2B0L A;  4N9H A;  5F1R A;  3HSF A;  5IYC J;  3HOV J;  3DEU A;  1DDN A;  2GBY A;  2M2E A;  3JRD A;  2MYS A;  1B1B A;  5LRS A;  3HKZ N;  2X48 A;  3CC7 I;  2D1V A;  1DGW Y;  3L09 A;  2UXN A;  1B59 A;  3MCZ A;  2IW5 A;  4H4K C;  1YLF A;  2O5R A;  2FBK A;  2VBX A;  2PLY A;  2QQ9 A;  5F1J A;  3CCY A;  4C9Y A;  4HV6 A;  2RKH A;  1QBJ A;  2AQE A;  2DBB A;  2HWV A;  1H88 C;  4UUV A;  4LMY A;  4B48 A;  4HW0 A;  2QSH X;  4BJT A;  1DGR M;  1CQT A;  3SZP A;  3J7A O;  1AA7 A;  1S5L C;  1NH3 A;  2X1C A;  4XOP A;  3OIO A;  2JTV A;  4RAG A;  1FP2 A;  2R5Z B;  2JN6 A;  4GDF A;  3DEE A;  3TW7 A;  4RGR A;  2Q2E A;  1R4M B;  2YX4 A;  3E6B A;  2O6G E;  2X6Y A;  3OYA A;  2K40 A;  3WOD F;  1J0R A;  2JSC A;  3GZ6 A;  1G2H A;  2R7R A;  1LEA A;  1XMX A;  3DFG A;  5CJ9 A;  3A0H C;  5ED4 A;  2XIG A;  3E6M A;  2RNJ A;  3JRB A;  4DQ2 A;  4DGW B;  3K1N A;  4M73 A;  2IGO A;  3DPT A;  4CSW A;  2VKD A;  1I39 A;  1LPQ A;  4E6K G;  2VBY A;  3OL4 A;  4KT6 A;  2NNN A;  5BOX A;  4Q5S F;  2LFB A;  3EYY A;  3WE2 A;  1SFU A;  1D5V A;  5K7H A;  2MD5 A;  2WAQ N;  4I7H A;  4HF2 A;  2PI0 A;  1RI7 A;  1USS A;  4J00 A;  5FD5 A;  2ZME A;  2HYJ A;  3HL2 A;  1JE8 A;  1I1S A;  4RAY A;  2X6X A;  1SD4 A;  2KDO A;  2M30 A;  1YS7 A;  3U1K A;  3KX2 A;  1KQ8 A;  4NC8 A;  5IYB J;  1A04 A;  1U5T B;  2DT6 A;  1IDY A;  1BJA A;  2FU4 A;  2V6C A;  4WX9 A;  2E34 A;  3LOC A;  5K1Y A;  5DEQ A;  5F04 A;  2DPD A;  4CCL A;  4N4N B;  1WRJ A;  1FP1 D;  1FZP B;  4DYR A;  3X2Q H;  3FBI B;  3ZQ7 A;  4WK8 F;  3H5N A;  2ECB A;  3ZQC A;  2DXI A;  1J7K A;  2JZY A;  3H9G A;  3KP6 A;  1V4R A;  1YE9 A;  2LH9 A;  1H89 C;  3S2D J;  3L2R A;  3KEO A;  4WXD A;  4KIT B;  3H5R A;  1J5Y A;  1Q1V A;  2ISZ A;  2HDW A;  4HA8 A;  4M9S A;  2NXN B;  3J81 K;  3ESW B;  1P92 A;  3WTS C;  4M71 A;  2GIV A;  2LD5 A;  2VJ4 A;  3M8E A;  1QA6 A;  1TBX A;  3CES A;  1T6S A;  1BW6 A;  2HQ5 A;  1K78 B;  2KRH A;  3ERE D;  1ENH A;  2HOE A;  2Y0M A;  3QAH A;  2PEX A;  1ODD A;  2F5F A;  1RRJ A;  1P4X A;  1F5T A;  1SD7 A;  1XX5 A;  4GO1 A;  1P9Q C;  4ETS A;  1OLT A;  1P7I A;  1IXS B;  5FD6 A;  2KQR A;  3O6B B;  1RR8 C;  1OCT C;  1RES A;  3VYU B;  3MN2 A;  1FNN A;  1Z6T A;  3A01 B;  3K6G A;  4O3M A;  1FOK A;  1U2W A;  4RB3 C;  1LVK A;  1WI3 A;  3OYC A;  2CO5 A;  1ZAO A;  4A6E A;  4CZC A;  1BJZ A;  4XLH A;  4RAF A;  1I50 J;  1T39 A;  3W6V A;  3DTE A;  3GX4 X;  3JRH A;  1SAN A;  3NWT A;  4AID A;  4PUS A;  2BOL A;  4L18 B;  4AM3 A;  1YOV B;  4BHC A;  3K0L A;  2VUM J;  1R1U A;  2V4J C;  2K9L A;  4F7Z A;  3GTP J;  2NAZ A;  3L1P A;  2P6S A;  4DYQ A;  4G7H F;  2UZK A;  5JI6 A;  2Y2Z A;  3FF5 A;  2X4H A;  5ERI A;  4ON0 A;  2MBF A;  4I98 B;  2QQA A;  2PBI A;  1MMS A;  3DTK A;  3L2C A;  3MKL A;  1YW8 A;  1MH4 A;  2NVY J;  3GW2 A;  3QP5 A;  4HYE A;  2BV6 A;  1ZG3 A;  2FNA A;  3NQO A;  2COB A;  1SAU A;  5DD8 A;  3K2A A;  3VYR B;  3I71 A;  4NC6 A;  1IXC A;  2DCE A;  1T56 A;  3BTL A;  1LDK B;  1EA3 A;  1R5G A;  1SFK A;  1Z91 A;  2LP0 A;  3BR1 A;  3DV8 A;  3M7G A;  4XL9 A;  1VQ6 I;  3ABK H;  3FHZ A;  1T2K A;  5E17 F;  3FXO A;  4E70 A;  4A5N A;  1H0M A;  4I02 A;  1IC8 A;  5FLX Z;  3NAU A;  3ZQH A;  4XOR A;  4KFC A;  4I0A A;  1SFX A;  2HZD A;  1R5H A;  1ZRC A;  2ELJ A;  1ZG1 A;  2ADU A;  5H2F C;  3K4L A;  4BQO A;  3LNQ A;  3OSF A;  4MO7 A;  4MIM A;  1TT0 A;  1V5E A;  4CGZ A;  2LF8 A;  3C7J A;  1ON2 A;  3D0S A;  1TQP A;  2FE3 A;  2HQA A;  4AU7 A;  5HLT A;  2R7X A;  1OCP A;  1JUM A;  2KHM A;  1BOA A;  4JYK A;  3GTO J;  4ZYH A;  2FMY A;  4JOM A;  2G7H A;  4BJ6 C;  2P5L C;  4IRI A;  4IVN A;  4JP0 A;  4LB6 B;  2GOM A;  1NG7 A;  5LBQ A;  1HOM A;  1WFX A;  2FUG 2;  3GZN B;  3V4G A;  1KQ0 A;  3QQA A;  5FJ8 J;  2HGC A;  2QGU A;  4Y52 J;  1ZRF A;  3WU2 C;  2JA5 J;  1DU0 A;  3PFY A;  1W7P B;  5F0H A;  1Z05 A;  2DT5 A;  4II3 A;  4CO8 A;  3H1C A;  1OCC H;  2VQH A;  2XAJ A;  3K70 D;  1J59 A;  2EIM H;  2PMZ N;  1HKQ A;  4EAT A;  5EGO B;  3IH3 A;  4ZZL A;  4GYG A;  4P55 A;  5HLG A;  5L3B A;  3TO7 A;  1XN7 A;  1YJW I;  4LK1 F;  3BWG A;  4CHU A;  3RQ4 A;  1FSE A;  1HKS A;  2EZK A;  1IN5 A;  4MTD A;  3VYT B;  2LKP A;  1ZRD A;  4E7H A;  5AON A;  4IHY A;  4OIO F;  3ZR8 X;  1JUP A;  2RQP A;  1REP C;  1RC9 A;  2A6E F;  2MFZ A;  4CUG A;  4PSX A;  5GPA A;  4Q4Z F;  3K4M A;  3DU6 A;  2OQG A;  3K10 A;  3TP3 A;  2DMP A;  2QKL B;  1D1B A;  4QTR A;  1XMA A;  2ELK A;  5C4X J;  4UB6 C;  1HCR A;  1D1A A;  3ECO A;  3RPU A;  2KL4 A;  1VQ8 I;  3HUG A;  1JGG A;  2LY9 A;  4XKW A;  1TL8 A;  3E7L A;  3ZQQ A;  3HPH A;  5EF6 A;  1IJW C;  4XKV A;  3GEZ A;  4M3D A;  2HS5 A;  1LB2 A;  3WTW C;  5J8F A;  3RDI A;  3CUQ B;  4BE2 A;  5IT3 A;  1P7J A;  1GV5 A;  2XGX A;  4B43 A;  5HVQ C;  3W2W A;  2BVL A;  3QYF A;  5CVI A;  4KN7 X;  5CLS A;  3CDH A;  4O5V A;  1UB9 A;  3QPH A;  3S1M J;  1OKR A;  2MGQ A;  1QZZ A;  1BC7 C;  4OWR B;  1WJC A;  2HI3 A;  3N05 A;  4P96 A;  1BIA A;  4DBR A;  1FY7 A;  3AFH A;  1IRF A;  3M1E A;  5JVG F;  2VKH A;  2XB5 A;  3JRA A;  1TWF J;  3MVP A;  1TP4 A;  5CKT A;  3DLL F;  2EIJ H;  5FLV A;  2EZL A;  2COM A;  4XLN F;  2A05 A;  1V5G A;  4XOT A;  1V55 H;  4XKB A;  1SMT A;  4Z2Y A;  2STT A;  1WJA A;  1X1B A;  3K4J A;  4YII A;  1Y1V J;  3FXL A;  4PCQ A;  4A69 C;  1TNS A;  3HM5 A;  3IH4 A;  4ZJZ A;  2QBY A;  4XSZ F;  1JT0 A;  2DI3 A;  2H27 A;  4I2O A;  1FTT A;  1YJN I;  2M9H A;  3LSM A;  1L0O C;  1ETQ A;  2V79 A;  3C2G A;  2B7E A;  1W7P D;  2BW3 A;  3KYD B;  1GDT A;  4LLG F;  3TW6 A;  1ETY A;  2E19 A;  4ZDL A;  2MD0 A;  1FYK A;  4M3F A;  3L2Q A;  4IZZ A;  1Z6R A;  3IAS 2;  2VT2 A;  2R7O A;  4UUS B;  3FXK A;  2VOD A;  4YFK F;  1BR1 A;  3VDX A;  4EQQ A;  4AIJ A;  2QLZ A;  5DCF A;  1R9T J;  2L4M A;  5E8G A;  2PMH A;  1BOB A;  2W85 A;  3C3W A;  3JSP A;  1TNT A;  5IOY A;  2HPI A;  3MFK A;  2ZNZ A;  3CP8 A;  2Q0O A;  3F72 A;  4M9Z A;  2LLK A;  1TLH B;  1KU2 A;  2EIK H;  1OCR H;  4L9V A;  2GA2 A;  4LG0 B;  4XKC A;  3OYH A;  4FCY A;  2QUF A;  2Y9Y A;  1J9I A;  3OS1 A;  1PUF B;  2JA2 A;  1X1P A;  2E7W A;  1ZLK A;  3GTG J;  1O3R A;  3P9I A;  4HEA 2;  1R00 A;  3PO3 J;  2M7B A;  2WB1 A;  1UHW A;  1VND A;  3T8T A;  3PO2 J;  2DTR A;  4LB5 A;  3D5L A;  1YIJ I;  5L3E A;  5HNF A;  1YG2 A;  1S7A A;  1W1W E;  2K9M A;  3EDP A;  4HPQ A;  2XC7 A;  3AL0 B;  3ECH A;  2W48 A;  3WTZ A;  3CUO A;  4Q48 A;  2EFN A;  1HW5 A;  3OOP A;  5C4J J;  5IT9 Z;  4BXX J;  2KIF A;  3SZT A;  3SQN A;  3G2B A;  3WTY C;  4I09 A;  2L9N A;  1BN5 A;  3CDL A;  4IL6 C;  4S04 A;  2E1M C;  1U5T C;  3BCB A;  1J2X A;  1MJB A;  3GO5 A;  4B3X A;  2CQX A;  1Z1D A;  1CF7 B;  2CUF A;  3FK6 A;  2VAS A;  3RTR A;  3CMM A;  2LRD A;  2QKM B;  2P4W A;  2A5Y B;  3GFM A;  4CCJ A;  1XSV A;  2ETH A;  2EA2 A;  2G9W A;  3WGH A;  5IYD J;  5ICE A;  4YFN F;  3G3Z A;  2I5U A;  2VL8 A;  4E7K A;  5TGT A;  2K5C A;  3S2W A;  1EH7 A;  4EEF G;  3OYK A;  1STZ A;  1J75 A;  2X85 A;  1BI0 A;  3Q9V A;  1XPX A;  4KMF A;  4NB5 A;  3GLX A;  1B9M A;  5E20 A;  4XID A;  4HAM A;  4AVZ A;  3D5R C;  3TDU C;  4HZF A;  1BW5 A;  1UMQ A;  2QWW A;  3OYG A;  3R61 A;  1D0X A;  1BI1 A;  3OYJ A;  3BZC A;  2JUC A;  5LD2 C;  1P4A A;  3H5A A;  3V7C A;  4D1Q A;  2OZ6 A;  2Z16 A;  2YSR A;  3GME A;  1JXS A;  4A3C J;  4X1E A;  1ZG5 A;  5J4Y A;  3GBG A;  2M5W A;  5E1X A;  4OIQ F;  4EV0 A;  1I6H J;  2CUJ A;  4G8X A;  5ILS A;  2HPM A;  2R4G A;  5FKM A;  4S05 A;  5FRO A;  3AG4 H;  1KA8 A;  3Q9S A;  2YX7 A;  5D5X B;  1QNT A;  3BG9 A;  3AG1 H;  3H0G J;  3W3C A;  2LBF B;  4E7Z A;  3VSL A;  4UVB A;  2EFQ A;  4MFD A;  1R7J A;  1A6I A;  4PGG A;  3ULQ B;  3FM5 A;  1D0Z A;  2K9S A;  4LOC A;  4CYC B;  2DYR H;  4DJA A;  5FKL A;  1YIT I;  4G6Q A;  2RRE A;  2ZFW A;  2CWE A;  5M5X J;  3MAJ A;  1OFC X;  3BPX A;  1U3E M;  1BR2 A;  2RQQ A;  1IRG A;  2F5C A;  3BR6 A;  2V1X A;  1G6N A;  2CQN A;  4L5E A;  4Y4R A;  1PJR A;  2A6T A;  3HKZ A;  4RM3 A;  2WB1 N;  3ZGK A;  1FLI A;  2GLO A;  4ZYE A;  5FRM A;  5DM6 F;  4JQF A;  4ABZ A;  1B8I A;  2M8G X;  1WH7 A;  4M6Y A;  1VQ9 I;  2JA6 J;  1ZLJ A;  1YW7 A;  3O2P E;  3F8C A;  3IRR A;  2Z33 A;  1EKE A;  2Q1Z B;  1HDP A;  1Y0N A;  1YIO A;  3BT9 A;  1Q1H A;  2DK8 A;  3J7A Y;  4RA2 A;  2F5E A;  2X1E A;  4CCM A;  5HS9 A;  4WCG A;  1QHG A;  3LL7 A;  2LY2 A;  2X9D A;  3DF8 A;  3DQV C;  4AD9 A;  3IHU A;  1RR7 A;  3HIF A;  1LNW A;  1TWH J;  2ZB9 A;  1OCO H;  4U0Y A;  2VJ5 A;  1Z77 A;  2Y48 A;  3SDB A;  3DP7 A;  1FOX A;  3QWL A;  4KIS A;  1I1G A;  2KT0 A;  5HDN A;  4QPQ A;  2BY3 A;  3CJR B;  3LFU A;  2VBZ A;  5E8I A;  4FHT A;  2VJJ A;  4XQF A;  2KZG A;  4HRI A;  2O3F A;  3K4B A;  4NUB A;  2MG4 A;  3LSI A;  2UWM A;  5FKN A;  1MSE C;  3ZMZ A;  4BHB A;  4D9J A;  5LHH A;  4ESJ A;  4E7S A;  2DOD A;  1JTX A;  1U8R A;  2OAZ A;  1JTY A;  1A31 A;  1I3A A;  2FQ3 A;  3HB9 A;  3PQK A;  1MMA A;  3F22 A;  2NVT J;  4UVC A;  3BZ6 A;  2IAI A;  2EB7 A;  2JJ7 A;  2VQG A;  3WU1 B;  1ETV A;  1K7A A;  1XGN A;  3U9G A;  4BL0 B;  1SEU A;  4NHJ A;  2HXO A;  5IP9 J;  4FT8 A;  3I4M J;  3E97 A;  1T98 A;  4L0Y B;  2EV5 A;  2MW8 A;  2JA7 J;  1P2F A;  1F36 A;  4QWQ A;  1W5T A;  1MMD A;  1RKT A;  1PUE E;  1IN4 A;  1U9N A;  1V5F A;  3MZ8 A;  1S6L A;  1Z3Y A;  5E3M A;  4IEJ A;  4YEJ A;  2OJE D;  2FOW A;  3QOE A;  3QPS A;  1HA8 A;  1K4S A;  4MHG A;  1WPK A;  1YJ9 I;  5FLM J;  1GXQ A;  2EZH A;  2LF7 A;  2XVC A;  2HOS A;  2XAH A;  3IUO A;  2EA4 A;  3QOP A;  3U1D A;  4BBR J;  4F55 A;  4IO9 F;  4UV9 A;  2D45 A;  2Y69 H;  3O8G A;  3BZK A;  1KU3 A;  4JX5 A;  1UZC A;  3MD2 A;  1SAX A;  4ZTJ A;  2CV1 A;  1Y8Q B;  3NAR A;  4EJW A;  5J1U A;  3M9A A;  1Y6I A;  2QQ8 A;  3MMY B;  5D4S A;  3A2K A;  5E79 C;  2XGC A;  3KP2 A;  1D0Y A;  3OYN A;  5DS9 A;  3RIR A;  5C3E J;  2UUZ A;  2R5Y B;  1A35 A;  4PJJ A;  2XB0 X;  3KZI C;  1N78 A;  2EBI A;  1E3P A;  2RGV A;  1V3F A;  3VSK A;  4ZH4 F;  4KYW A;  3SYT A;  5B1B H;  4ZYD A;  1R4N B;  4DIQ A;  4U0W A;  3I58 A;  2OQR A;  1VF9 A;  1JJ6 C;  4WWC A;  2FSW A;  4RGU A;  2A68 F;  1SD5 A;  4JX6 A;  5LRR A;  3CUQ C;  2M34 A;  3OMY A;  2PG4 A;  1A36 A;  1YFH A;  5FKO A;  2XRN A;  2IJL A;  4M3G A;  5HS8 A;  3OV8 A;  3R0J A;  2UV1 A;  1RKW A;  2NS0 A;  1PDN C;  3HPG A;  2WAD A;  5EEA A;  3M07 A;  1A5J A;  1WKM A;  1DQU A;  2ICW G;  3BJA A;  1SC7 A;  3BG3 A;  4CCK A;  4BY1 J;  2CJJ A;  2JVH A;  4D5F A;  3H92 A;  1YW9 A;  4MGR A;  2Y0S N;  2GXB A;  3H9J A;  3K69 A;  2J5P A;  3SEQ A;  2VI6 A;  3EUK L;  2OCE A;  1R71 A;  1IF1 A;  4PJ0 C;  2E1O A;  2BY0 A;  5D6F A;  2CV2 A;  1L3L A;  2OZU A;  2BBY A;  4EM0 B;  2HKX A;  4KMU X;  4HF0 A;  3QP6 A;  3R0A A;  1EJ9 A;  1P4W A;  3RZO J;  1VQO I;  4IOC F;  4BHP A;  2K02 A;  2CW8 A;  3PNY A;  3UKG A;  1T95 A;  2VJI A;  3IC7 A;  3FXJ A;  1T8I A;  1WJ5 A;  4BEH A;  2LYC A;  3KFW X;  2DA7 A;  1U5T A;  2ZO4 A;  3ABU A;  1OR7 C;  2LTP A;  2FRH A;  2D2W A;  4RDU A;  2ZNY A;  2VE8 A;  2KMU A;  4F3Q A;  5HS7 A;  1X3U A;  1UST A;  5ILV A;  3LSG A;  1ITY A;  3RQI A;  1R1T A;  2ZJR F;  3BR3 A;  4HDU A;  5J3L A;  1G3S A;  2ISY A;  4CCN A;  2XDV A;  2DA2 A;  4Z6Y A;  1E3O C;  2Q2E B;  3MQ0 A;  1POG A;  4RS8 A;  1WHU A;  2BE5 F;  1D5Y A;  5IY5 H;  3F6O A;  2HDC A;  3HDD A;  5GP9 A;  4B44 A;  5DTD A;  3BOQ A;  1GV2 A;  2VB6 A;  2L7K A;  1IRZ A;  3L2U A;  1OIS A;  3GUD A;  2M3A A;  4ESF A;  3G71 I;  1K78 A;  2P8T A;  4IRG A;  3A02 A;  4G6T B;  4XBF A;  2DFH A;  3LSR A;  4C2U A;  2JWT A;  3JAM K;  2Y30 A;  2ZBK A;  4RAZ A;  1YRN A;  3A03 A;  3DBH B;  4ZYA A;  4YEL A;  4C3J J;  1N25 A;  4YIR X;  4XRM A;  1QPI A;  1FMV A;  5CVR A;  2PQ8 A;  4BXU A;  1B72 B;  2A07 F;  2ZME B;  3A01 A;  3KET A;  3LST A;  5FB2 A;  2RN7 A;  2V1D A;  2DFI A;  3AL0 C;  2A69 F;  3FXU A;  4PGH A;  1C0W A;  2BHZ A;  2MLK A;  4D0P A;  1X1D A;  2HTS A;  5EZH A;  2DDB A;  4W1U A;  2ZJP F;  4FTH A;  2BY2 A;  2KDZ A;  1Y39 A;  3L9F A;  3BG5 A;  4H0E A;  1KU7 A;  2O9L A;  1LDJ A;  4OAZ A;  4W97 A;  3BQZ A;  3B6A A;  3OR2 C;  1U8B A;  4BGD A;  6PAX A;  3PSI A;  2PMZ A;  3HG9 A;  4FQG A;  1E0E A;  2YU9 J;  3KZZ A;  1OYY A;  5IP7 J;  1QQI A;  3W2V A;  1F9N A;  3Q0U A;  3QU3 A;  1W0T A;  2DN0 A;  1YX5 A;  2A3S A;  5KAF C;  1IN7 A;  2MLG A;  2G0E A;  2M1B A;  2FOK A;  2FML A;  2QVO A;  4ENJ A;  2D5V A;  5ICG A;  3B02 A;  2JT1 A;  3QYE A;  3J80 K;  2STW A;  4ZDP A;  2O61 A;  1QZE A;  3E0J B;  5GAG J;  4CZZ A;  2H6C A;  2IP2 A;  4P5O A;  3DKW A;  2WWY A;  3C2B A;  3TP0 A;  4U7B A;  2P5V A;  3K1P A;  3GTM J;  1X4P A;  2PFB A;  1R36 A;  5KAI C;  4HG2 A;  2XF5 A;  1WZ2 A;  2W84 A;  3GFL A;  2X51 A;  5FFZ A;  1O3T A;  2W00 A;  3LWF A;  1X1C A;  2QEX I;  1TC3 C;  2IS4 A;  3S16 J;  2K3F A;  5CYV A;  4NQW B;  1W4M A;  3ZMV A;  2EWN A;  3OIP A;  2XRO A;  3LAP A;  3CCL I;  1I27 A;  1R58 A;  1AHD P;  1MBH A;  2L54 A;  4A3G J;  2R0Q C;  3T0Y A;  4A3K J;  1IN6 A;  4LJZ F;  1M1E B;  1R23 A;  3W2A A;  3JRG A;  1GVJ A;  1I3Q J;  3CTA A;  5GTH C;  3DKY A;  1ZYR F;  2DT7 B;  3ZOB A;  5K7Z A;  4BNC A;  5ICF A;  2LKS A;  1JKQ C;  3F8M A;  4Y7N J;  3CCJ I;  1ETW A;  2HVR A;  3V7R A;  2PJR B;  2HQR A;  1RZ4 A;  2FEZ A;  3CO7 C;  2EV6 A;  1AKH B;  3QPT A;  3G4S I;  1W7P A;  3J81 Z;  1BA5 A;  2M4G A;  2C6Y A;  9ANT A;  4LG3 A;  1RUO A;  4HV5 A;  3FMR A;  2R7W A;  3T5X A;  3Q5F A;  3BRO A;  3ZQF A;  3SXY A;  5EGO A;  4M74 A;  4RLQ A;  5M5Y J;  2LDU A;  1DU6 A;  4WXH A;  2VIX A;  3JR9 A;  2W7N A;  3DWL E;  3BP8 A;  1MJA A;  1TTY A;  2OV7 A;  1QO0 D;  2CS3 A;  4OU0 A;  3G73 A;  2DMU A;  2KPM A;  3GYH X;  2EZI A;  4EGY A;  3IWZ A;  4IRH A;  3HYI A;  2OCC H;  3RCO A;  3HBL A;  4FX0 A;  1EH6 A;  2H8W A;  2L7F P;  2F6C A;  2L9S A;  4IHW A;  2OTJ I;  2CRG A;  2IVM A;  4AWX B;  3PQJ A;  2V7F A;  3F3X A;  2LNB A;  3M8F A;  4JX4 A;  1B4A A;  2MC3 A;  2PJP A;  5DD4 A;  3JRI A;  5H6R A;  5JHF A;  1ETK A;  2FF4 A;  4JK1 X;  2VOO A;  1CGP A;  4ZTF A;  2O8K A;  1LQ1 A;  4IHS A;  3G6E I;  2K4J A;  1UG0 A;  3HRU A;  3S3O A;  4KIF A;  3CUQ A;  2Y9Z A;  3L00 A;  2WY8 Q;  2IPQ X;  4IQJ A;  2CGP A;  2HKO A;  1Z67 A;  1ZKG A;  3FKJ A;  3K4K A;  1G59 A;  2KFD A;  1XS9 A;  1K83 J;  4YRV A;  5DV5 A;  2OUM A;  4M9X A;  1X4O A;  1YYV A;  2DAO A;  3A1Y A;  3BTJ A;  4B4C A;  4D7M A;  3I59 A;  4TV7 A;  3CQZ J;  2JPC A;  2Z99 A;  1X2N A;  1F1Z A;  1NG6 A;  3F0C A;  3COA C;  1UHS A;  5F0F A;  4X6A J;  3WU0 A;  2HYG D;  4C3H J;  3HTS B;  1UHM A;  3PIP F;  2VN2 A;  3G1O A;  3JRF A;  3P7N A;  4HX4 A;  3WGI A;  3JCU C;  2P7V B;  3EQL F;  4OAY A;  3KP7 A;  4C2M J;  1ZQ3 P;  3ELK A;  5HLH A;  1ZRE A;  2TCT A;  2E2J J;  5AIQ A;  1VI0 A;  4PFP A;  2TDX A;  3OOU A;  1GHC A;  3PL8 A;  4I01 A;  3J7Z I;  3CF5 F;  1IN8 A;  2ZSH B;  4L9N A;  2Z5U A;  4A3L J;  4XK4 A;  2L7Z A;  2M7A A;  2DOA A;  1OR7 A;  4HX7 A;  1Y8R B;  3K9T A;  1Z7U A;  5DCM B;  2XPU A;  3I54 A;  3W6J B;  3UR3 C;  1MNM C;  3R60 A;  2GOX B;  2HOA A;  3CJN A;  4KT5 C;  1R6R A;  1LFU P;  2W4S A;  3BQY A;  3CC4 I;  1LEB A;  1DP7 P;  3BTC A;  3VB2 A;  3J7Y J;  4PFO A;  3LAJ A;  1WWX A;  1BL0 A;  2DFF A;  4GRI A;  3RKQ A;  1O4X A;  1KGS A;  2MAB A;  2P6T A;  4B47 A;  3H3U A;  3A4C A;  2O0Y A;  4KIB A;  1UEL B;  3S1Q J;  2OBP A;  1Z0X A;  1XCB A;  2HQN A;  2HXI A;  5BS6 A;  3S14 J;  2BGC A;  2IGN A;  3JTH A;  1LDD A;  3PIO F;  1KYW A;  2IS2 A;  2M45 A;  2VXD A;  1TQM A;  4PZJ A;  2QBY B;  2L7M P;  2KP6 A;  5L3D A;  2K9Q A;  4V2F A;  4A3D J;  3DTI A;  1HKT A;  1TW3 A;  5IP6 A;  2V1U A;  3FXR A;  2JQ7 A;  1MIJ A;  2MH9 A;  5D5U B;  5F64 A;  4G6D A;  3TGN A;  1MW7 A;  4BE1 A;  1H9G A;  1MBF A;  3K7A J;  3F9K A;  2O7O A;  3S1R J;  2ELH A;  1LE8 A;  2HYF A;  3SFI A;  5GTI C;  1H9T A;  3WTU C;  4G7O F;  3G1L A;  3BG6 A;  3GLL A;  1X58 A;  2PX9 A;  3CJQ B;  2RDP A;  3PFI A;  1NK3 P;  2CYY A;  2E1C A;  3L2V A;  4KIC A;  3E5U A;  4FET A;  5HNH A;  2IS1 A;  3OYF A;  1FC3 A;  2P7C B;  1MMG A;  3PJR A;  1E17 A;  2LK2 A;  2DPU A;  1KON A;  5J4V A;  3JRE A;  1WSU A;  3I3L A;  2IBD A;  4G12 A;  2TRT A;  1S9H A;  2LOO A;  1HQC A;  5K5Q A;  1N77 A;  1ORK A;  2F5V A;  2NYX A;  3P9C A;  2AXT C;  1VZ0 A;  4S0H B;  3U21 A;  1ZR2 A;  1IO2 A;  2CQ7 A;  4M3B A;  2F48 A;  1FOY A;  3CO6 C;  2HEO A;  2NS7 A;  5CVU A;  1S8N A;  2ID3 A;  3CLO A;  3B73 A;  4BQN A;  3ONQ A;  2IRF G;  5EG0 B;  4AUX A;  3IV5 A;  5FGM A;  1HW2 A;  2H1K A;  3FKI J;  1G3W A;  4RM2 A;  4YFX F;  4LLN A;  1EV7 A;  1G8X A;  3I4N J;  3ZMU A;  1BIB A;  2JUG A;  1Y1W J;  3HGG A;  2DYS H;  4MFE A;  3ZMD A;  2OPT A;  5JLW A;  5DUI A;  5J40 A;  1O7L A;  2LBF A;  1BR4 A;  3VOE A;  5D8L B;  1K6O A;  1WQ2 A;  1YS6 A;  4YIF A;  2MC4 A;  3S32 A;  2K7L A;  1W36 D;  3VOD A;  1HSJ A;  4CYC A;  2W82 A;  3BG7 A;  1JT6 A;  4BS9 A;  3I56 I;  1I6X A;  5D8K B;  1VQN I;  3K70 C;  3WTT C;  5IOZ A;  1WCM J;  5JFR A;  4F93 B;  2DOE A;  2ZJ2 A;  4Q47 A;  3BJ6 A;  1FT9 A;  2A5W A;  2DK5 A;  2N8G A;  2VC1 A;  2QF7 A;  4BU2 A;  4MEY F;  1OYW A;  2FNP A;  3OS2 A;  3V7S A;  1QHH D;  2YPR A;  4FAS D;  4F92 B;  4GFB A;  2JSP A;  1D3Y A;  4M6X A;  3GTK J;  4UUT A;  5L3C A;  3EYI A;  3CME I;  4I0B A;  1RNL A;  2K9N A;  2L0K A;  3NWS A;  4B09 A;  1QZY A;  2R93 J;  3B6C A;  2BXZ A;  1R1V A;  1MDM B;  2AXL A;  3D1N I;  3ZCO A;  5B66 C;  2VE9 A;  1VQL I;  3A0B C;  1T38 A;  5K7F A;  3IRQ A;  1OYI A;  3SHF A;  5M3M J;  3JW4 A;  3KEQ A;  2K27 A;  1VQK I;  4M3E A;  2DJI A;  3LQQ A;  3P5J A;  3TOA A;  1MGT A;  4DYC A;  2QCO A;  2VLA A;  3TMO A;  4R79 A;  1K61 A;  3U2R A;  3H3Z A;  3HHH A;  5DUK A;  3RSN A;  1W0U A;  2R3S A;  2BVM A;  2Y0S A;  5CVJ A;  5F08 A;  2BZT A;  5M5W J;  1OCZ H;  3V8J A;  2QSG X;  2BXY A;  2L3D A;  4BJ5 C;  4ENN A;  1JJ8 C;  2RVC A;  4MLO A;  3T8R A;  4PJL A;  2HU9 A;  2J5O A;  4R1H A;  1K6Y A;  3ZP5 A;  3QOD A;  4A93 J;  1ERD A;  2O03 A;  1XG1 A;  2EJR A;  2RNG A;  3I53 A;  1TWA J;  4DZJ A;  3MKW B;  3AAF A;  1S72 I;  3LSP A;  3CCR I;  3S3M A;  1QU3 A;  3SEZ A;  3PSF A;  1FYM A;  5E18 F;  4L9J A;  1MND A;  4EJO A;  4BUP A;  3QRF F;  5EEG A;  1RUN A;  4NNJ A;  2EPF A;  2L4A A;  1U0J A;  4P1W A;  3VFZ A;  5ICC A;  3HOZ J;  1MNE A;  3HOS A;  3HJE A;  5F27 A;  3ML6 A;  3JTG A;  2ZC2 A;  2NNY A;  2L2O A;  3GTQ J;  2BY1 A;  3GFJ A;  2KZV A;  2E36 A;  5BMZ A;  2GXG A;  2XUB A;  5FFX A;  1IUY A;  4CIC A;  2A6H F;  2LY1 A;  3HSE A;  3E5Q A;  4Y15 A;  2R5Y A;  5LLQ A;  4XM3 A;  2NOJ B;  2G7U A;  3Q0V A;  1MBK A;  3GCM A;  5TJJ A;  3KPH A;  4HNV A;  1D8K A;  5FKK A;  5J1Y A;  1UCR A;  3ISP A;  3CCV I;  1PP8 F;  3AG2 H;  2HOT A;  4A3M J;  4MQV A;  2IA0 A;  4KNY A;  3PUB A;  1TT5 B;  5GAE J;  1NTC A;  1SFO J;  1ETX A;  4PJM A;  4IJA A;  1VQ5 I;  1MBJ A;  3PUF A;  1XB4 A;  2AO9 A;  2VPR A;  1EF4 A;  4EMS A;  2OU2 A;  1V54 H;  4NDL A;  1ZR4 A;  3DU5 A;  2JK3 A;  2DMN A;  2W24 A;  2L5Q A;  4OMZ A;  3IH2 A;  3M1C A;  3TKY A;  4BAC A;  4HDV A;  2EV0 A;  3HOT A;  1ZN2 A;  3MKY B;  1OPC A;  2DA6 A;  2F4O B;  3PM1 A;  3Q0W A;  4DOZ A;  5K5R A;  1BM9 A;  3FWE A;  3C2H A;  2IGK A;  4GYI A;  4IPA A;  4B1R A;  5D5W B;  1Z3X A;  3CDI A;  1ZH5 A;  2R5Z A;  3AG3 H;  2X1D A;  1D8J A;  1VTN C;  3RKX A;  5LHI A;  1MD0 A;  3G1M A;  2ME0 A;  3CCS I;  2KLO A;  1P6R A;  2NVQ J;  2GXA A;  5LGN A;  3E3V A;  2CV0 A;  1LFP A;  3HXL A;  5CVV A;  3GXO A;  2E71 A;  1XDU A;  2ZXI A;  1XGO A;  4EJT A;  4ZZD A;  2XHK A;  2KIQ A;  1FJL A;  2IT0 A;  2R7S A;  3OYB A;  4UNO A;  2GWR A;  1X19 A;  1U9O A;  2FQ4 A;  1BI3 A;  4HNT A;  5LEK A;  1FSH A;  1FIA A;  1O3Q A;  5H20 A;  1BI2 A;  4HQM A;  4AIK A;  4XN0 A;  2R7F A;  5GPC A;  4EJU A;  2JPB A;  3TED A;  2OTL I;  5E3O A;  5FRN A;  3KP5 A;  1NK2 P;  2Z9O A;  2DJN A;  3SDG A;  1ULY A;  3KYC B;  4CXF A;  1ZK8 A;  3R6S A;  4A0X A;  1W36 C;  4HF1 A;  1FIP A;  4HNU A;  3S2H J;  2XGD A;  3I64 A;  2CH0 A;  2JRM A;  2QA4 I;  2M8E A;  2AS5 F;  2XPV A;  2FBH A;  4BXF A;  2WC2 A;  2IA1 A;  1YO5 C;  3HRT A;  4ZC3 A;  3LMM A;  2WV1 A;  5LFA A;  4FX4 A;  4EM2 A;  5KCM A;  2QZ8 A;  3REO A;  4MNU A;  1B72 A;  2ESN A;  2XV4 S;  4BY7 J;  1IV6 A;  4I76 A;  3DPU A;  1MSF C;  2EIN H;  2O8X A;  1IDZ A;  3RKY A;  4BEH B;  3OR1 C;  2E1M B;  4KJZ A;  3IP4 B;  3HOU J;  4BKX A;  4P9U A;  4OIR F;  4RB2 C;  3BDD A;  1W5C C;  1SVM A;  3S17 J;  5BQT A;  3KYL A;  1TZL A;  3N97 A;  1VQP I;  3BTI A;  4WF2 A;  2XAF A;  5FLX K;  2FX0 A;  2KJB A;  2QSF X;  2EFP A;  3ABL H;  2WAE A;  2ESH A;  5J6X A;  4QIW N;  1JI8 A;  2F2E A;  1XD7 A;  3ZQL A;  2ID6 A;  1GT0 C;  1RET A;  1ON1 A;  1VQM I;  1PYV A;  5LGU A;  5AIP A;  4HLX A;  4UV8 A;  4PJN A;  3ZN1 A;  4Y17 A;  4AYB A;  1XSX A;  2AHQ A;  3EPZ A;  1HW1 A;  3QU6 A;  2VC0 A;  2VT3 A;  4HOB A;  2VOP A;  4CYD A;  2F4I A;  3ABM H;  2GIZ A;  3GF2 A;  1QVU A;  3OYL A;  1A6Q A;  1YI2 I;  2E5N A;  3FDY A;  3ABT A;  1ZTR A;  2WY7 Q;  4KN4 X;  1T08 B;  2BYV E;  3V42 A;  3WG7 H;  4A6D A;  1DUX C;  1FBQ A;  1TWG J;  2L02 A;  1HXD A;  1YRN B;  2LRE A;  5HLI A;  3LFK A;  3ZQG A;  2OD5 A;  4PK4 A;  1XGM A;  1H8A C;  2DMQ A;  3FX3 A;  2XF7 A;  1MBG A;  2HVQ A;  4UY8 I;  2JMW A;  2NVU B;  4A5M A;  1LUJ B;  3ZPL A;  5D6E A;  4XIC A;  3BPV A;  4NQW A;  2OF7 A;  2P0W A;  3BR2 A;  4I6Z A;  2EFO A;  4RB1 A;  2L01 A;  4WXC A;  2JRT A;  2XGE A;  3HZJ A;  3I55 I;  3BLY A;  2YU3 A;  4XMY A;  4U87 A;  1DPR A;  1AWC A;  1Y56 A;  1BBY A;  1JKO C;  3RJP A;  2LKX A;  3I9V 2;  2DTZ A;  2E1N A;  4EM1 A;  3CF2 A;  4QSH A;  1G4D A;  4U88 A;  1VQ7 I;  2Z2S B;  5EYR A;  3E6C C;  4HBL A;  3OSG A;  1Z21 A;  2KKO A;  2HTJ A;  4IQ4 A;  4ASN A;  2EK5 A;  1ZGA A;  2DFE A;  3E5X A;  5H6Q A;  2PJR A;  4A3I J;  3WGG A;  4FE7 A;  3RI4 A;  3FM3 A;  4J19 A;  3TBI A;  1HST A;  2CG4 A;  2ZSI B;  1AKH A;  1SFE A;  2IGM A;  3BR0 A;  4GGG A;  2E2H J;  3UNG C;  2IEK A;  3IWF A;  3H9Q A;  2KRC A;  3WE3 A;  2JVG A;  4M72 A;  5LHG A;  3I5U A;  3L7W A;  3JSO A;  2HZT A;  1B9N A;  4L5J A;  1B6A A;  4E4H A;  3JAM Z;  2WA0 A;  3CMA I;  1RPW A;  2DQR A;  4L9T A;  3F21 A;  4CA0 A;  2VKE A;  3OYE A;  2H94 A;  1JKR C;  3PNT A;  4V19 K;  3ASN H;  3C18 A;  2DA5 A;  1FPQ A;  1WJF A;  1F4K A;  3BR5 A;  5K5O A;  4LD5 A;  3EUH C;  2IS6 A;  1FOW A;  4ZYG A;  2R7Z J;  2R7Q A;  2ECC A;  1LFB A;  2XAQ A;  4KDP A;  3CD6 I;  5D4R A;  4RGX A;  2DA4 A;  3CLQ A;  3RYP A;  4XR6 A;  2KIU A;  2E5Z A;  1IG7 A;  2CW7 A;  3TOB A;  1GLN A;  2NS8 A;  4DW6 A;  2LG4 A;  4A3J J;  2V9P A;  3K4C A;  3F8F A;  4C30 A;  5B1A H;  1K79 A;  4BQA A;  4AYB N;  4P9F A;  3VYS B;  1UAA A;  1FEX A;  2XF6 A;  5DYM A;  1S29 A;  5F0C A;  3DBR B;  1MH3 A;  1FTZ A;  1XTA A;  1DPU A;  1MBE A;  4CDG A;  1WGX A;  4F91 B;  3DCF A;  3OS0 A;  1UG2 A;  2KIM A;  3FK7 A;  4UVA A;  1LKX A;  4XLF A;  2EH3 A;  3R4K A;  2V9V A;  2QQB A;  5D5V B;  3J80 Z;  2LSO A;  5B5E C;  5JVT A;  5HOD A;  4XNF A;  4XLP F;  1S7E A;  3BJO A;  3LSH A;  1BC8 C;  4LLL A;  1UFM A;  2XSD C;  3S93 A;  3K2Z A;  2HR3 A;  1VQ4 I;  4XLA A;  2XKO A;  2VQL A;  4EVI A;  4A3B J;  1E2X A;  2CQK A;  3EUA A;  2NRA C;  1PVE A;  1TQI A;  4MEX F;  4L5I A;  2CFO A;  4HX8 A;  3BY6 A;  2CUE A;  4XSX F;  3GWZ A;  4LIV A;  3CCQ I;  2WAF A;  3H3V K;  2CUZ A;  3E6D A;  2RAE A;  1GVD A;  3ZXS A;  4DZP A;  4LGW A;  4UHT A;  3KLO A;  2CFX A;  3KP4 A;  3ZQI A;  2W1O A;  4IXA A;  2YUS A;  1QGP A;  2XAS A;  1AOY A;  4FIS A;  1MJ9 A;  1OMI A;  3T1B A;  2LC2 A;  1WJE A;  1X2M A;  5LEJ A;  3CCU I;  3CC2 I;  1XMK A;  3KP3 A;  1JHF A;  2I10 A; 
#chains in the Genus database with same CATH homology
 1WJD A;  3CP2 A;  4XLC A;  2M4K A;  1Y6I A;  2LBF A;  3MMY B;  3VYU B;  1BR4 A;  2ZXH A;  2IXS A;  3A2K A;  3OYN A;  1D0Y A;  1T0F C;  2UUZ A;  3K6G A;  4PJJ A;  2MC4 A;  3S32 A;  4E7I A;  1W36 D;  1N78 A;  3VSK A;  3OYC A;  1LVK A;  2CMP A;  3SYT A;  2W82 A;  3MKZ A;  3BG7 A;  4CZC A;  4DIQ A;  4XLH A;  4BS9 A;  4BDZ A;  3DTE A;  2V9K A;  3K70 C;  3NWT A;  3HUG B;  4ITV A;  4PUS A;  2BOL A;  4F93 B;  3OYD A;  3OMY A;  1FMW A;  2V4J C;  2K9L A;  4BDY A;  2A5W A;  2V26 A;  1Z7L A;  2UV1 A;  4BU2 A;  3HPG A;  2WAD A;  4Y3O A;  1DQU A;  3OS2 A;  1QHH D;  4CCK A;  4FAS D;  4F92 B;  2JSP A;  3DTK A;  4DBQ A;  2JVH A;  1WJB A;  4E7L A;  3VWB A;  3H9J A;  3D5S C;  3LSK A;  1SAU A;  3NWS A;  3SEQ A;  3EUK L;  3VYR B;  2DCE A;  1LDK B;  1EA3 A;  4N4O B;  1SFK A;  4XON A;  2CV2 A;  4XL9 A;  3ZCO A;  2VQC A;  4QPO A;  2VXZ A;  2CW8 A;  3PNY A;  4XOR A;  1T95 A;  2VJI A;  2HZD A;  2DJI A;  2ELJ A;  1WJ5 A;  4BEH A;  2LYC A;  3K4L A;  4RLF A;  4BQO A;  2VLA A;  3TMO A;  4R79 A;  1OR7 C;  2BW3 B;  4ZDO A;  3RSN A;  1TT0 A;  1V5E A;  2BVM A;  2KMU A;  2Y0S A;  3KEY A;  4F3Q A;  3OYM A;  2HQA A;  4AU7 A;  5HLT A;  2R7X A;  3LSG A;  2KHM A;  4BJ5 C;  4JOM A;  4BJ6 C;  4CCN A;  2XDV A;  2HVS A;  4MLO A;  1X1A A;  2GOM A;  1NG7 A;  2Q2E B;  4X0G A;  4PJL A;  2HU9 A;  1WFX A;  1K6Y A;  2FUG 2;  3OIQ A;  3QOD A;  1ERD A;  1J09 A;  2RNG A;  3PFY A;  4B44 A;  3DPL C;  3MKW B;  2R7T A;  2VB6 A;  2L7K A;  3L2U A;  3S3M A;  4II3 A;  1QU3 A;  3SEZ A;  2VQH A;  2M3A A;  3PSF A;  4F52 A;  3K70 D;  1MND A;  4BUP A;  1IRX A;  4EAT A;  4NNJ A;  4G6T B;  3TL4 X;  2R7V A;  1U0J A;  4P1W A;  4C2U A;  1MNE A;  3HOS A;  1D1C A;  3DLA A;  3RPU D;  2L2O A;  4ZYA A;  4YEL A;  3RQ4 A;  2KZV A;  3IAM 2;  3OL3 A;  3VYT B;  1FMV A;  3CZ6 A;  4E7H A;  2LY1 A;  3SZG A;  3ZR8 X;  3AL0 C;  4XM3 A;  2NOJ B;  3E1S A;  2MFZ A;  4CUG A;  4PSX A;  2HNH A;  1X1D A;  3K4M A;  3DU6 A;  3K10 A;  1ZEL A;  2QKL B;  1D1B A;  3OWT A;  4OAZ A;  3PUB A;  1D1A A;  3OR2 C;  2KL4 A;  4PJM A;  4BGD A;  2XSJ C;  3S8P A;  3PSI A;  2PMZ A;  4XKW A;  3HG9 A;  1E0E A;  3ZQQ A;  3HPH A;  3W2V A;  3K4N A;  4XKV A;  3DU5 A;  1YX5 A;  2L5Q A;  5KHD A;  3M1C A;  1DP3 A;  4BAC A;  4BE2 A;  2XAU A;  3HOT A;  4B43 A;  5HVQ C;  3QYE A;  3W2W A;  3MKY B;  2BVL A;  4ZDP A;  3QYF A;  5KNL A;  5CPR B;  4DOZ A;  2V1N A;  4IKF A;  3E0J B;  3C2H A;  2IGK A;  1Z3X A;  4OWR B;  1WJC A;  4P5O A;  2M0M A;  3N05 A;  4DBR A;  2X1D A;  3AFH A;  2VKH A;  3L2W A;  4U7B A;  5CKT A;  1X4P A;  2KLO A;  4HG2 A;  1V5G A;  2XF5 A;  4HST A;  4XOT A;  3ZRG A;  3AKZ A;  4XKB A;  3OYI A;  1WJA A;  1X1B A;  3K4J A;  2X51 A;  2W00 A;  1X1C A;  2CV0 A;  2IS4 A;  4LIT A;  4ZJZ A;  4RMN A;  1LFP A;  2X6W A;  3HXL A;  4NQW B;  2WBM A;  2ZXI A;  3OIP A;  3LSM A;  3FBN B;  3C2G A;  2R7S A;  3OYB A;  4J01 A;  1X19 A;  2BW3 A;  3W2A A;  3QYB A;  3DKY A;  2DT7 B;  4ZDL A;  2MD0 A;  3FHN A;  3L2Q A;  2K3P A;  4LIU A;  4IZZ A;  1MMN A;  3IAS 2;  4HNT A;  2AQF A;  2R7O A;  2HVR A;  1BR1 A;  3VDX A;  2PJR B;  1N75 A;  4XN0 A;  4XLE A;  3BCA A;  5CQG A;  1YX3 A;  4CCO A;  5CQE A;  1BOB A;  5FRN A;  2M4G A;  2HPI A;  4LG3 A;  4HSR A;  3CP8 A;  2ZFU A;  3DKX A;  2R7W A;  1W36 C;  4HNU A;  5HOO A;  4RLQ A;  2CH0 A;  4XKC A;  4BXF A;  2VIX A;  3OYH A;  2W7N A;  3DWL E;  4BE0 A;  4ZC3 A;  3LMM A;  3OS1 A;  2V6E A;  2OV7 A;  5LFA A;  2JA2 A;  4E7J A;  2CS3 A;  5KCM A;  2R7U A;  2KPM A;  4BQQ A;  4HEA 2;  3HC7 A;  2M7B A;  2WB1 A;  3RCO A;  2F6C A;  2L9S A;  3DPU A;  3D5L A;  4ANJ A;  4BEH B;  5HNF A;  3OR1 C;  2V7F A;  2K9M A;  2E1M B;  4KJZ A;  4HPQ A;  3IP4 B;  2XC7 A;  3AL0 B;  2VPL A;  3BC8 A;  2I8D A;  3PNV A;  3KYL A;  1TZL A;  4II2 A;  3OY9 A;  5JHF A;  4IX7 A;  3G2B A;  2L9N A;  4ZTF A;  2E1M C;  3BCB A;  1UG0 A;  2WAE A;  1JI8 A;  4B3X A;  4PSW A;  3S3O A;  4C2T A;  2WY8 Q;  3S3N A;  2VAS A;  3RTR A;  4IQJ A;  3CMM A;  2LRD A;  1PYV A;  2QKM B;  4CCJ A;  2WAQ A;  3FKJ A;  3K4K A;  1G59 A;  4PJN A;  4AYB A;  4YRV A;  2OUM A;  3EPZ A;  1X4O A;  3A1Y A;  3M8J A;  2VL8 A;  4XN3 A;  4E7K A;  5TGT A;  2K5C A;  3OYK A;  1NG6 A;  2X85 A;  2F4I A;  4NC7 A;  4Y33 A;  3OYL A;  3H35 A;  2E5N A;  3FDY A;  4AVZ A;  3D5R C;  2WY7 Q;  3V42 A;  2E60 A;  2Z1D A;  3OYG A;  1D0X A;  2LRE A;  4OAY A;  4CH7 A;  3OYJ A;  3H0D A;  4PK4 A;  2XF7 A;  5LD2 C;  2HVQ A;  3H5A A;  4D1Q A;  4PFP A;  2OC6 A;  3OOU A;  2P0W A;  2Z16 A;  3PL8 A;  2MYS A;  3BLY A;  4XMY A;  3GBG A;  4U87 A;  2ZSH B;  2CUJ A;  1DGW Y;  1Y56 A;  2HPM A;  2R4G A;  5FRO A;  3I9V 2;  2M7A A;  2DOA A;  4H4K C;  3W3C A;  3CF2 A;  2LBF B;  4E7Z A;  3VSL A;  2Z2S B;  2O5R A;  1Z21 A;  4IQ4 A;  3UR3 C;  4C9Y A;  1D0Z A;  2GOX B;  2PJR A;  1R6R A;  2AQE A;  2W4S A;  4DJA A;  3TBI A;  4B48 A;  2ZSI B;  2RRE A;  4BJT A;  1DGR M;  4PFO A;  2IGM A;  1AA7 A;  2X1C A;  1BR2 A;  2RQQ A;  4XOP A;  3UNG C;  3H9Q A;  2KRC A;  4GRI A;  2JVG A;  4Y4R A;  2MAB A;  1PJR A;  2A6T A;  4B47 A;  3DEE A;  3HKZ A;  4RM3 A;  3A4C A;  1UEL B;  3ZGK A;  4E4H A;  2X6Y A;  2WA0 A;  2IGN A;  3OYA A;  5FRM A;  4JQF A;  2IS2 A;  4CA0 A;  2VXD A;  3OYE A;  2R7R A;  3PNT A;  2Q1Z B;  1WJF A;  4DGW B;  3J7A Y;  2IGO A;  2X1E A;  2KP6 A;  3EUH C;  4CCM A;  3DPT A;  2IS6 A;  1QHG A;  2R7Q A;  3LL7 A;  4CSW A;  3DTI A;  2VKD A;  2LY2 A;  3DQV C;  4E6K G;  1MW7 A;  2VJ5 A;  3OL4 A;  4KT6 A;  4XR6 A;  2E5Z A;  3SDB A;  4BE1 A;  2CW7 A;  4KIS A;  1GLN A;  2LG4 A;  3F9K A;  4QPQ A;  3K4C A;  4C30 A;  3CJR B;  3LFU A;  4J00 A;  3VYS B;  1UAA A;  4XQF A;  3HL2 A;  2VJJ A;  2XF6 A;  3BG6 A;  4HRI A;  3CJQ B;  2X6X A;  3K4B A;  2KDO A;  4NUB A;  3LSI A;  4F91 B;  2UWM A;  3KX2 A;  4NC8 A;  4D9J A;  3OS0 A;  4XLF A;  4E7S A;  1LKX A;  2DT6 A;  3L2V A;  4FET A;  5HNH A;  2IS1 A;  3OYF A;  1MMG A;  3PJR A;  1KON A;  1MMA A;  3I3L A;  4CCL A;  4N4N B;  4XNF A;  1S9H A;  3LSH A;  2LOO A;  2VQG A;  3FBI B;  1N77 A;  3H5N A;  3S93 A;  4BL0 B;  2DXI A;  2F5V A;  4XLA A;  1VZ0 A;  2VQL A;  3H9G A;  3U21 A;  1YE9 A;  2LH9 A;  3EUA A;  3L2R A;  4KIT B;  3H5R A;  2HDW A;  1MMD A;  2CFO A;  1V5F A;  1Z3Y A;  4LIV A;  4BQN A;  3ONQ A;  4YEJ A;  2VJ4 A;  2WAF A;  2CUZ A;  3QOE A;  1HA8 A;  3CES A;  4RM2 A;  2KRH A;  3ZXS A;  3IUO A;  4F55 A;  2W1O A;  1G8X A;  2JUG A;  3MD2 A;  2LC2 A;  1WJE A;  4ZTJ A;  2CV1 A;  1P9Q C;  1OLT A;  2KQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...