3CUQB

Integrated structural and functional model of the human escrt-ii complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
204
Chain Sequence
KNISEAFEDLSKLMIKAKEMVELSKSIANKDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 204
sequence length 214
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqB02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqB03
5DD4A 1HKQA 4G7ZF 1ZHFA 1V4RA 4G7OF 3ZMSA 3ABUA 1IRGA 2P7VB 2HWVA 1U5TA 3E6MA 3JW4A 5D4SA 4S04A 1YW9A 1J7KA 3TO7A 3F8MA 3HRTA 2VE8A 3RKXA 4PDKA 3E5UA 4Y13A 1FLIA 4WXHA 3PFIA 2NAZA 4LLNA 4LD5A 3EUHA 4LK0F 4ZZDA 2DI3A 2HZTA 4YG2F 4L9VA 4HV6A 2JTVA 3BWGA 4M74A 2DW4A 3MZHA 1DUXC 5BS6A 2KIUA 2VBYA 2CG4A 1ZREA 3ISPA 2H27A 3L2CA 4KA4A 2DPUA 1ZGJA 2EA4A 4BHCA 5JI6A 1XCBA 3VB2A 3LA2A 1U8RA 2Q2EA 4HX4A 1MDMA 2P4WA 2Y0MA 3CO6C 3ECOA 2XVCA 3COAC 4XSXF 3VFZA 4OIPF 2XASA 3JSPA 3WTZA 5CVIA 3J81Z 5J8FA 3S2WA 1D5VA 4GYIA 4XSZF 1UB9A 1YO5C 3HHGA 4FX4A 4WXDA 5E1ZB 3T5XA 3KLOA 2OD5A 1PP8F 2GIVA 2NRAC 3ELKA 1LEBA 2EK5A 3RYPA 4ENNA 2FQ3A 5FGMA 2BEOA 4A5NA 5D6FA 3CDHA 5AONA 1A04A 4I02A 3QAHA 5HDNA 2ZNZA 3M8FA 4IRGA 1AOYA 5FD5A 3GZ6A 1XSVA 3GFLA 1TTYA 5DDGA 1HSJA 2W25A 2OBPA 1H0MA 2A61A 4KN4X 1SD5A 3FWEA 2R7FA 1USSA 2PEXA 3GFJA 3P7NA 1UHWA 1FBQA 2CWEA 3WG9A 2DBBA 4XLNF 4U0WA 4KIBA 3BY6A 2FNPA 3C7JA 3GWZA 4YIFA 2ADUA 5K5RA 4OMYA 2V1DA 3M9AA 3KP5A 1KU2A 1FYLA 2HS5A 1JXSA 3R61A 1IN5A 3JTGA 1T38A 2P7CB 4MEXF 4LB5A 3EYYA 3HSRA 5EEGA 4BXUA 1IRFA 3WODF 1L3LA 1XSDA 1XCVA 2RC4A 4E70A 5D5XB 4ESJA 2COMA 2VT2A 1K7AA 5D5VB 1KYWA 5BPIA 1S29A 2G7UA 5F1RA 4CXFA 2ZJ2A 2XRNA 4FT8A 4HLYA 4UHTA 1XDUA 2PFBA 4IPAA 1Z6RA 2LSOA 1FP2A 1KA8A 3F6VA 2KJCA 2FA5A 1Z1DA 3Q9SA 2IA0A 4ZYDA 3R0JA 2KKOA 4O6JA 2V6CA 2W57A 1HKTA 2UXXA 3LWFA 1EV7A 3P9IA 1R22A 2LKPA 1F4KA 1XD7A 3HHHA 4B8XA 2L4AA 4I0BA 4IHSA 2L54A 2XIGA 5CVVA 1F5TA 3F22A 5HS7A 2XAHA 3WE3A 2OQRA 4KIFA 3C18A 3CUQA 2P6SA 4ESBA 2YPRA 2Z99A 3ZMTA 3GFMA 2DTRA 1USTA 2A6HF 3ML6A 1MJAA 4A12A 1ONVA 1YG2A 2VODA 3RPUA 1ZRCA 3SZPA 3W6KB 4RAZA 3F3XA 1MDMB 4QLCU 1W7PD 4G7HF 3M7GA 4IRIA 2GQQA 5H6RA 2VE9A 4HBLA 5DCFA 2XROA 1B9MA 3QPHA 2FMLA 4Y15A 3R0AA 4IF4A 4FHTA 1U5TC 4U0YA 2FMYA 1T2KA 2ZO4A 4LB6B 1Q1HA 5BQTA 3RDIA 2QLZA 2A6EF 2VBWA 3WTXC 1JGSA 2E1NA 3E5QA 2HEOA 4EVIA 2QWWA 4JQFA 1I1GA 2KRFA 3K1MA 2VT3A 4N0BA 4EM2A 1XMAA 3D5LA 2W85A 3TKYA 4I0AA 2D1VA 2HTJA 4L9TA 3V8JA 2JPBA 3I59A 4PGHA 3FX3A 2DFIA 4ON0A 3BJAA 2J5PA 3BDDA 3DPTA 4GYGA 2ACJA 3IRRA 2H6CA 4YFKF 3ULQB 1KQ8A 1G3SA 2FEZA 3GXOA 4HLXA 1ZGAA 2X0LA 3KLNA 3WTVC 3ZP5A 5L3DA 4Q5SF 3E6DA 1K79A 2HKOA 3BJOA 5IT9Z 1IN6A 1BI3A 4EV0A 3HOTA 3L9FA 4OIOF 3ECHA 4HDUA 2HKXA 1WRJA 4A2UA 3KZYA 2ISZA 2LDUA 2JRTA 4Q47A 2AXLA 1R1UA 4M73A 1EH7A 1BI0A 3CO7C 4F7ZA 4PCQA 5DYMA 3DP7A 2KIMA 1BJAA 1K78A 3O6BB 1I6XA 5E1WA 1S3JA 4G8XA 4G94A 2STTA 2YX4A 5E8GA 4U0VA 3DKWA 3RPQA 3P9KA 3U9GA 1HW2A 3TO6A 3HYIA 1IN7A 2QUFA 3GVAA 2DO7A 1B1BA 1W7PA 4WXCA 5CLSA 3WE2A 1B59A 2HTSA 2VOPA 1XGNA 2EB7A 2RGVA 2P5KA 3FMRA 4S05A 1FX7A 2WWYA 1OYWA 5LHGA 5ICCA 2HQRA 1ZYRF 4HX8A 3DFGA 3FF5A 2PLYA 2OU2A 2QVOA 3JAMK 5E8IA 2GA2A 1MZBA 2FBHA 4LGWA 2RDPA 1O7LA 1WKMA 3V7RA 1FYKA 1PUEE 2P5VA 3D0SA 1H9GA 2LNBA 3CTAA 2FE3A 1TBXA 1SMTA 2EFNA 5D8LB 1LVAA 2O03A 2EFPA 4GXOA 1OR7A 3C1DA 2IJLA 3K0LA 2M87A 3FXRA 1FWZA 4MTEA 1FY7A 3QU3A 4M9ZA 1KQ9A 1JE8A 5KVRA 1IZ1A 4ETSA 3L7WA 2VBZA 3RIRA 4KFCA 3R4KA 1YQAA 3F21A 1LJ9A 1FP1D 3QOPA 3TOAA 1Z7UA 3IRQA 2MLGA 3TOBA 1P4AA 5CYVA 1R5GA 5ERIA 3GO5A 1IF1A 2ZBKA 1QPMA 2HR3A 3SHFA 1HKSA 4MQ9F 1WQ2A 1P4XA 2FRHA 1BBYA 3FM5A 1ZAOA 1W4MA 4M71A 3GZ5A 2XHKA 2HGCA 2EV6A 2ZXJA 3H3ZA 1BIBA 4M6YA 4OIQF 3GYHX 2MD5A 1Z6TA 1LNWA 1ZLJA 1TQPA 2HOEA 4PZJA 4JBAA 3WGHA 4BAYA 4ESFA 4LLGF 4I7HA 2K4BA 1OYYA 3DEUA 4BHBA 2ZMEA 4N9HA 4KMUX 4I09A 4BQAA 2L3DA 3I0TA 2E7WA 2XAGA 3VEPA 3IKVA 4L9JA 1D8JA 3I59B 2MH2A 2FSWA 2OQGA 2Q8KA 1EH8A 2ELHA 3FMSA 1G4DA 2CGPA 5FLXK 3N4MA 1O57A 3J7AO 2BBYA 3PQJA 3I58A 4DQ2A 2IA2A 3K1NA 1LDDA 2H94A 3WTSC 3HTSB 2JZYA 1YLFA 4UXNA 1SFEA 2M1BA 3JAMZ 4M9XA 3F8BA 3M1EA 5LRSA 1FBSA 1Z91A 1OPCA 1ON1A 3B73A 2O3FA 4EM1A 1ON2A 2QM3A 1TQIA 5DCMA 3DF8A 3E6CC 1O3RA 3FZVA 3RI4A 1PP7U 3I4PA 1XGMA 1T39A 2Z3YA 4EQQA 1O3SA 3EDPA 2MLKA 4HF2A 3V7CA 2P5LC 1U6GA 3CJNA 3WU1B 2KJBA 3IC7A 2YSRA 1FNNA 1K78B 2R7DA 4UVCA 1R58A 2M45A 4LMYA 2L01A 4RB3C 4GO1A 4WF2A 4EGZA 2QYOA 1SFXA 1SMYF 2QBYA 4KICA 3IKTA 2IT0A 4AWXB 5HVQC 3ZN0A 1AWCA 4ZH4F 2DU9A 2BYVE 2A68F 2ZCWA 1U3EM 2DAOA 1TW2A 2K4JA 1ZH5A 3MQ0A 4AIHA 5J8CA 2XAFA 3KP6A 4YFNF 2F2EA 2RKHA 4EGYA 2DPDA 2VN2A 4I2OA 2O0YA 3IWZA 4CHUA 3KCCA 3LA3A 4RGXA 4HAMA 4WK8F 1ZG3A 1FSEA 3GLXA 1MKMA 2G9WA 1XB4A 3HIFA 4AVPA 2C6YA 1STZA 2IW5A 3HSEA 1FOKA 1BC7C 4R1HA 3KZZA 2HQNA 4P96A 3F8NA 3EYIA 2OZ6A 3TGNA 1S6LA 3I53A 4UVBA 4UNOA 2EV0A 1CF7A 5DV5A 5HS8A 1OMIA 2XAQA 1U5TB 4RGSA 1PDNC 4OINF 3KEOA 4ZYEA 3GFIA 3KP4A 1YW7A 3ZMUA 4BHPA 4OU0A 4G9YA 3DXJF 2CQKA 2VC0A 2HYFA 4P9FA 4MHGA 1TLHB 1T0FA 2EA2A 1CGPA 1ULYA 5LBQA 2UXNA 1L0OC 3U1DA 1JHFA 3QPTA 5ILSA 2ESNA 2XKPA 4RB2C 3MEXA 3FXQA 5D6EA 4Z2YA 1T98A 1HSTA 5LHIA 4MGRA 2VXZA 1B4AA 2IPQX 3W6JB 1BM9A 1ODDA 3WTTC 4A0XA 4LJZF 1UCRA 4KUMA 2IP2A 3RYRA 3K2ZA 1SAXA 4L5JA 1BOAA 3O3KA 4OIRF 3ZMVA 4B09A 2ZMEB 4XRFA 5ICGA 3G3ZA 1SFUA 2PQ8A 1GXQA 1HBXG 2K86A 2Z9OA 3HTUA 1QO0D 3L00A 4CZZA 2XUBA 4LG0A 4JK1X 5LHHA 2GXGA 3K69A 5K5QA 5E1XA 3OV8A 5E17F 1QQIA 1YS6A 2F5FA 3ZMDA 4UUVA 4GGGA 1G6NA 1KU9A 4WCGA 3DV8A 3U2RA 5L3BA 3RKYA 2GAUA 3T0YA 2F5DA 1VTNC 1Z9CA 4RAYA 1IXCA 3KETA 3KFWX 2FXAA 5DCMB 3H3UA 1GHCA 3H92A 4HDVA 3R60A 1R00A 1RZ4A 5J6XA 2CFXA 3NQOA 1K6OA 2HYGD 5LGUA 1HQCA 1Y0UA 1Z05A 5TRDA 2XV4S 3ROUA 4OMZA 4R79A 1P92A 1SD7A 3OOPA 2EFQA 5DD8A 5H6QA 3F6OA 4CO8A 3IL2A 2L02A 2QBYB 1REPC 1V3FA 5L3FA 5CJ9A 3BROA 3MCZA 5BOXA 3ERED 4HV5A 1QZYA 2FF4A 2ISYA 1RIOH 3Q9VA 5D4RA 1IUYA 3NRVA 3FM3A 2MC3A 2NNNA 4MNUA 3F72A 6PAXA 5CVUA 5FB2A 4EMSA 1XGOA 5E20A 4K2EA 3E5XA 1YFHA 3REOA 3TO9A 5FD6A 3QU6A 3F23A 5LGTA 5CVJA 4U7BA 5HLHA 1GVJA 4EJUA 5AIPA 1J5YA 2CW0F 3ZMZA 1YTYA 1FT9A 1ZARA 2P8TA 3KEQA 4HA8A 1QGPA 2JPCA 2WC2A 1BI2A 3I64A 1UHMA 4FX0A 2Y75A 3C3WA 2F5EA 3GUDA 4KT5C 3HRSA 4L18B 2W84A 2FBIA 3BJ6A 3ZPLA 2ZFWA 2STWA 1P2FA 1LQ1A 4HF1A 3TDUC 3KP2A 2KIFA 4OOIA 2A69F 4ZYHA 3VOEA 4G6DA 1G3WA 3V8KA 1R36A 1QNTA 4KYWA 3SZTA 3FXUA 3R6SA 5A2QK 2RN7A 1I1SA 1U78A 5LLQA 3CUQB 5BMZA 1E17A 2YU3A 4HW0A 4ENJA 2M8EA 3LSTA 2PN6A 2BE5F 1IW7F 3J80K 4ASNA 4CDGA 5ILVA 1HW5A 4H0EA 5ED4A 2FU4A 5JFRA 4P55A 3BZ6A 1C0WA 4CGZA 2BGCA 5H20A 2DK5A 2XGXA 1W5SA 2WTEA 2Z33A 3P9CA 3E97A 3HUGA 2YR2A 4ZZLA 1RNLA 4IXAA 1XN7A 2A5YB 3HSFA 4L9NA 4LG0B 3MZYA 1MGTA 1TNTA 1HW1A 2V1XA 4CYDA 3I71A 3F8FA 1P6RA 3WU0A 5HDKA 2VC1A 2IA1A 3T1BA 3BPVA 3SXYA 5FO5A 2FNAA 4ENMA 3BOQA 4IHTA 3K9TA 2IRFG 3DPLC 3QP6A 2DQRA 5JVTA 4BNCA 3CUQC 1GXPA 1WI9A 2P6TA 2OA4A 4RS8A 3HOSA 1FYMA 2QZ8A 5L3GA 1ZG5A 2PMHA 1U2WA 1IXRC 1G3TA 2QENA 1BN5A 5D5UB 3IHUA 3NEUA 1F9NA 5FFXA 1NHAA 1MJBA 1J9IA 2DK8A 2GXBA 5LRRA 4O3MA 4NB5A 2EFOA 4I98B 4MEYF 4TV7A 2JSCA 3QP5A 2D2WA 1G3YA 2NYXA 4LFUA 1R7JA 3WTWC 4L0YB 2O8XA 3LQRA 4IJAA 4QWQA 5JHUA 3IWFA 1LDJA 4WWCA 1TQMA 3DQVC 4YFXF 5A2QZ 3K1PA 1W7PB 5ICEA 2K7LA 4RGRA 1KYZA 1YIOA 1R1TA 1KU3A 2AS5F 1O7FA 1X3UA 3J80Z 2V79A 1FZPB 1IN4A 3MFKA 4GCVA 1QZZA 2EWNA 4ZYGA 1F1ZA 4N9IA 1E2XA 4UV8A 1H9TA 4MQVA 3CUOA 2EV5A 3ZQ7A 3PQKA 1S7AA 3RTRA 1I5ZA 1IN8A 2QQAA 2R3SA 4L0ZB 5HDGA 3GEZA 1OKRA 2CYYA 2OZUA 2L4MA 4XBFA 1OYIA 5LEKA 2V1UA 4A0ZA 2D45A 3KE2A 4P5OA 2A07F 2Y48A 2PI0A 1SD4A 2TDXA 4EM0B 5D5WB 2D1HA 3N97A 1B9NA 5LEJA 5BPDA 3I54A 2VONA 1JHHA 4HQMA 3WTYC 3V7SA 5LGNA 4IVNA 4U7DA 1J75A 3WTUC 3MAJA 4M9SA 2XKOA 5FLXZ 4HQEA 1ZLKA 3ZN1A 4KMFA 2XAJA 5K1YA 5HLIA 4RGUA 2PMUA 5IT9K 5E18F 4RB1A 3I5UA 1I27A 4NQWA 1R23A 1R5HA 4Q48A 1TW3A 4EJVA 3JSOA 3F8CA 3HRUA 3E6BA 5L3EA 2MBFA 2QQBA 3GW2A 2BV6A 1T6SA 1ZN2A 5ILUA 3TQNA 4CICA 2CSOA 4O5VA 1D3YA 4UVAA 3HRMA 3BP8A 1SD6A 4AD9A 2ETHA 1RI7A 3GX4X 2MA3A 1KU7A 3KP3A 1B6AA 5JR3A 1S7OA 2GA1A 1O3TA 4NHJA 4R8HA 3TDZC 1R1VA 2CO5A 2H09A 4I01A 1J59A 2B0LA 4EJOA 2O61A 3T8TA 4A5MA 1RUOA 4Q4ZF 4ENKA 5EEHA 3V4GA 2K02A 2LF8A 4AIJA 3E3VA 1YS7A 3SQNA 1ZRFA 3GF2A 1QBJA 5CVRA 3G73A 3KP7A 4XLPF 2DT5A 3Q5FA 2DLLA 2VOOA 1HXDA 1W5TA 5D8KB 4G6QA 1WWXA 1DP7P 4WX9A 4IRHA 5F64A 2UZKA 2W24A 2F5CA 1BI1A 1IAWA 2Q0OA 2A3SA 2HFHA 2NS0A 2GWRA 5DUIA 1YYVA 5L3CA 3RJPA 3AAFA 1BC8C 4U88A 1WSUA 1KGSA 4RB0A 5HS9A 2EJRA 3O2PE 1KQ0A 2PBIA 4A6DA 2GZWA 2RQPA 1XGSA 4P9UA 1D8KA 2ZKZA 2VBXA 3BPXA 2G7HA 1FPQA 4KNYA 2E7XA 4EJTA 2RVCA 3SFZA 3L09A 2DQLA 4Y17A 1J2XA 2OAZA 1DPUA 3CLOA 2ZNYA 4UV9A 1BIAA 5F6FA 3LAJA 2O6GE 1FBUA 2FBKA 1S8NA 4A6EA 2UWMA 5HLGA 4HOBA 5ICFA 1MD0A 3ABTA 3RKWA 1FSHA 1XDSA 5FFZA 4L5IA 2RV8A 3VODA 4M6XA 1UFMA 3B02A 3LQQA 2V9VA 2FOKA 2ESHA 2X4HA 3LA7A 5KK1A 3LAPA 4BH9A 2H6BA 2M30A 2MH9A 4BYYA 1J0RA 1IXSB 2J5OA 5DUKA 1FC3A 3J81K 4A0YA 4M72A 4PGGA 1ZG1A 3LFKA 4EJWA 5AIQA 4KIGA 2Z5UA 5HOOA 3FHZA 1EH6A 4YIIA 1RUNA 1CF7B 2PJPA 3EETA 1MJ9A 2HDCA 1LB2A 1P4WA 1YW8A 2WV0A 4KDPA 5TJJA 1LDKB 4D0PA 2PG4A 2IVMA 1DPRA 4HZFA 4HF0A 1LEAA 4AIKA 4LK1F 3WGIA 4KN7X 1ZRDA 2M5WA 1XSXA 3QRFF 3FMQA 2E1CA 2RNJA 2JT1A 5K5OA 2QQ9A 3V8LA 4HX7A 2NNYA 3T8RA 1DDNA 3JTHA 5DEQA 5IT3A 4DNCA 4LLLA 3M8EA 3WGGA 1O3QA 1XMKA 2YX7A 2LF7A 4HYEA 2K27A 1TNSA 2EFWA 3EQLF 3MWMA 4MTDA
chains in the Genus database with same CATH superfamily
5DD4A 2VPLA 1HKQA 4GRIA 1MMDA 4G7ZF 1QPIA 1ZHFA 1V4RA 4G7OF 3ZMSA 3ABUA 2WAEA 1IRGA 2P7VB 2HWVA 1U5TA 4DZPA 3E6MA 3JRBA 1DGRM 3C2BA 3JW4A 2CUFA 5D4SA 1Y56A 4M3DA 3GTQJ 1Y1VJ 2EIJH 4S04A 3S3MA 1YW9A 3CF2A 3S32A 1J7KA 2CV1A 2HNHA 3K4JA 3TO7A 3CMEI 2FOWA 3F8MA 3HRTA 1V5EA 2VE8A 3RKXA 4PDKA 4F92B 3E5UA 4KT6A 4Y13A 1OCCH 1FLIA 4WXHA 3PFIA 2L7FP 2NAZA 2WBMA 2M7AA 3Q0WA 4LLNA 3VSKA 4LD5A 3M3YJ 2O5RA 3OYEA 3EUHA 1LFPA 4LK0F 3W2WA 4ZZDA 2DI3A 2HZTA 4YG2F 2HVSA 4L9VA 4Y4RA 4HV6A 2JTVA 2CRGA 3BWGA 2LY2A 3JRCA 4M74A 2DW4A 3MZHA 1DUXC 1UHSA 2HOAA 5BS6A 3H5AA 2KIUA 2VBYA 2CG4A 2Z16A 2R93J 1ZREA 3ISPA 4XR6A 3OYDA 2H27A 3AG2H 1SAUA 3L2CA 4KA4A 2BW3A 5CKTA 3HM5A 1ZGJA 2EA4A 3K7AJ 2DPUA 3GTLJ 4BHCA 1N25A 1MBKA 4C2UA 5JI6A 1XCBA 2L9NA 3VB2A 3LA2A 1U8RA 2Q2EA 1TWGJ 3ASNH 4HX4A 1MDMA 3D5RC 2P4WA 2Y0MA 1WJCA 3CO6C 4B47A 5B5EC 4II3A 3ECOA 4JX5A 1HOMA 2DA2A 1APLC 2XF7A 1NK3P 1F43A 3H9QA 2XVCA 3TW7A 3COAC 3S1RJ 4XSXF 3A02A 3VFZA 1VQ8I 4OIPF 2XASA 3JSPA 1JI8A 3WTZA 5CVIA 1T56A 3J81Z 3DTEA 4NBQA 2JWTA 5J8FA 3A01A 3S2WA 4B1RA 3CCSI 1MW7A 1D5VA 4GYIA 4ZDLA 4XSZF 1UAAA 1UB9A 1POGA 1YO5C 1DQUA 2HDWA 3HHGA 2HDDA 4FX4A 1IDYA 3OIPA 4WXDA 3ZXSA 5E1ZB 4PFOA 5KNLA 2DA5A 3J7AY 3T5XA 3KLOA 2NVYJ 1LE8A 3CP8A 2OD5A 1PP8F 1F36A 2IGKA 2X85A 2GIVA 2NRAC 3CC4I 3ELKA 4B48A 3GTGJ 3K2AA 1LEBA 2EK5A 3RYPA 2R7TA 4ENNA 2FQ3A 3OS0A 2R7WA 3Q0UA 1V5FA 5FGMA 2BEOA 3A2KA 4A5NA 2HU9A 5M3FJ 2Y9YA 3CCYA 5D6FA 3CDHA 3AKZA 5AONA 1A04A 1FIPA 4BQNA 2LMDA 4I02A 5E3MA 3JRDA 3QAHA 5HDNA 2R0QC 5IPAA 1V55H 2ZNZA 3M8FA 1JJ8C 4XKWA 3ZQCA 4E7KA 4IRGA 4PSWA 3WU2C 1K61A 4IHWA 1AOYA 5FD5A 1Q1VA 5J1UA 2WAQN 3GZ6A 1S72I 1DP3A 1MBHA 2EQRA 3K70D 2XAUA 4XKBA 1R6RA 1XSVA 2BHYA 3FXJA 3GFLA 1TTYA 5DDGA 1HSJA 2DT6A 2W25A 5M5XJ 2OBPA 5C44J 1H0MA 2A61A 4KN4X 2XB0X 3ABKH 1SD5A 3FWEA 2R7FA 4DOZA 1USSA 3VDXA 2PEXA 3GFJA 3GZNB 3P7NA 1UHWA 1ZKGA 1UELB 2CQ7A 2R7OA 1FBQA 2HXIA 2WV1A 2CWEA 3WG9A 3OYHA 2AQEA 3K4KA 5FRMA 2DBBA 4XLNF 4U0WA 4KIBA 3JREA 4A3BJ 5EDNA 3BY6A 2FNPA 2PJRB 5GPCA 3BCAA 3C7JA 3L2QA 3GWZA 4YIFA 2ADUA 3BT9A 2EH3A 5K5RA 4OMYA 3HG9A 4CCOA 1V5GA 2VQGA 2V1DA 3OS2A 3M9AA 3KP5A 1OCPA 1KU2A 2M3AA 5E79C 1FYLA 2R7ZJ 2HS5A 1JXSA 3R61A 2HI3A 1IN5A 1EKEA 3JTGA 1T38A 2P7CB 4MEXF 3G1MA 1SVLA 2P81A 3DEEA 3EUAA 3EUKL 2W4SA 4LB5A 4UY8I 4CZCA 2BXZA 4LIUA 3EYYA 3HSRA 3W3CA 2IS1A 2VKDA 5EEGA 5J4VA 1H8AC 1PYVA 4BXUA 1IRFA 3CJRB 4C3IJ 3WODF 1K6YA 5TISC 1L3LA 2DXIA 1XSDA 2GM4A 1XCVA 2RC4A 4E70A 5D5XB 4ESJA 2RREA 2F4OB 3KYLA 3OL3A 4FTHA 2COMA 2VT2A 2W7NA 1K7AA 4IKFA 3M4OJ 5D5VB 1KYWA 5BPIA 1TWHJ 1IG7A 1S29A 2G7UA 5F1RA 1B72B 3OYLA 2ZC2A 3G1OA 4CXFA 2ZJ2A 1JTXA 2XRNA 4FT8A 2OTLI 4HLYA 3FK6A 3H0GJ 4DIQA 2V7FA 2X1EA 2K9QA 2DFHA 4UHTA 1XDUA 3BG7A 2PFBA 4IPAA 4PK4A 4XLCA 2BOLA 2VASA 1JTYA 3OY9A 1Z6RA 3HEFA 5EZGA 2LSOA 1FP2A 1KA8A 1LUJB 1V54H 3F6VA 3GBGA 2KJCA 5FLMJ 2FA5A 1Z1DA 2FD5A 3Q9SA 4ZYAA 1VQ7I 2IA0A 4PJMA 2VJIA 4ZYDA 3R0JA 3JCUC 3D1NI 2KKOA 4O6JA 2V6CA 3OYKA 4N4OB 4FE7A 5JHFA 2W57A 4A3FJ 2UXXA 2E1OA 1IJWC 2R7VA 3LWFA 1HKTA 1EV7A 2NVUB 3CCJI 4NC8A 1TT0A 5HODA 2D5VA 3P9IA 1Z3XA 4DGWB 2WY7Q 3CCEI 1X1AA 1MSFC 1R22A 2LKPA 1F4KA 1XD7A 2LYCA 3BR0A 3HHHA 2M8GX 3SEZA 4B8XA 2E5ZA 2L4AA 4I0BA 4IHSA 3S2HJ 2L54A 2XIGA 5CVVA 3DLLF 3PFYA 1D0XA 3LMMA 1F5TA 1ETKA 4BKXA 3F22A 5HS7A 2ECBA 2XAHA 2B7EA 3WE3A 2OQRA 2K9SA 4KIFA 3C18A 3AFHA 1DGWY 3P5JA 3SFIA 4D9JA 4DZJA 3CUQA 2P6SA 4XNFA 3OYBA 4ESBA 2YPRA 2Z99A 1D1AA 1VQ5I 5CQEA 3H9JA 3ZMTA 3GLLA 3GFMA 3SYTA 3FXMA 2DTRA 1USTA 2WB1N 3RSNA 4DJAA 2A6HF 3ML6A 1MJAA 4A12A 4IEJA 3OR1C 1ONVA 2F4MB 1YG2A 3D5SC 4NUBA 2VODA 3RPUA 1U8BA 2Q2EB 1ZRCA 3SZPA 4J01A 3W6KB 3PNVA 2VJ5A 4RAZA 2V6EA 1XS9A 3F3XA 1KONA 4BDYA 1MDMB 4XN0A 4QLCU 1W7PD 4G7HF 3M7GA 4IRIA 2GQQA 5H6RA 5F27A 1TT5B 5M5YJ 1ETQA 4HBLA 2VE9A 1NK2P 3HOZJ 2JA8J 5DCFA 1N75A 1U9OA 2XROA 1B9MA 1S7EA 3QPHA 4RBOA 2I5UA 2FMLA 4XKCA 3FDYA 3BTLA 2ZB9A 4Y15A 3AG1H 3R0AA 4D7NA 4IF4A 4FHTA 1U5TC 4U0YA 1LKXA 2FMYA 3LSRA 2ZO4A 3A01B 4LB6B 1T2KA 1Q1HA 4BS9A 5BQTA 2E5NA 3IAM2 3RDIA 4YRVA 3OYMA 2QLZA 2MC4A 2A6EF 4RDUA 1AA7A 4BXXJ 1VQKI 5IOYA 2BY3A 2VBWA 3WTXC 1JGSA 2E1NA 3E5QA 4XLAA 3PUBA 1LVKA 2HEOA 4EVIA 2EZHA 2KISA 2QWWA 1XG1A 4JQFA 1I1GA 2KRFA 3K1MA 4BBRJ 2VT3A 2JK3A 4N0BA 4IHXA 4MIMA 4EM2A 1LE8B 1XMAA 4NDLA 5KCMA 3ZOBA 3JR9A 3D5LA 2DOAA 2W85A 3TKYA 2VKHA 4P1WA 4I0AA 2LVSA 3EUHC 2D1VA 2HTJA 4L9TA 3V8JA 5C4XJ 4F55A 2JPBA 3OL4A 3KZIC 2KFDA 3I59A 4PGHA 3HL2A 3FX3A 2DFIA 4ON0A 4MO7A 3BJAA 2J5PA 1VQ6I 2VKEA 3BDDA 5EG0A 4XOTA 4ZJZA 1TZLA 1P7JA 3HPGA 5FLVA 3Q0VA 1UG2A 3DPTA 4GYGA 2KT0A 3LNQA 2ACJA 3IRRA 2H6CA 3CDLA 4YFKF 1P7IA 1TWFJ 3QPSA 3ULQB 1KQ8A 1G3SA 2FEZA 2RQQA 3GXOA 3GTOJ 3QYEA 4HLXA 1ZGAA 1QVUA 3OIOA 2X0LA 3KLNA 4PJNA 5FROA 1RR8C 3WTVC 3ZP5A 4B3AA 2VKVA 2K5CA 5L3DA 4Q5SF 2EIKH 3NWTA 3BR5A 3E6DA 5GADJ 2HKOA 4E4HA 3BJOA 4QTRA 1K79A 1BW5A 4E7IA 4BE0A 5IT9Z 1IN6A 1BI3A 4EV0A 3HOTA 3U1KA 3L9FA 2HZDA 4OIOF 1YITI 3ECHA 4HDUA 2HKXA 1WRJA 1IV8A 1EF4A 4A2UA 3KZYA 2ISZA 2DYRH 2LDUA 3FISA 3LSKA 4UB8C 2VB6A 2JRTA 2COBA 4Q47A 2AXLA 1TP4A 1R1UA 2VL8A 3CCRI 4M73A 5F08A 1EH7A 1IC8A 2ME6A 2HOTA 3S15J 2ZJQF 2BVLA 1BI0A 1YI2I 1D5YA 5E3LA 3CO7C 1QHGA 2EZIA 4F7ZA 1VQLI 1E3HA 1FOXA 4PCQA 3VPRA 5DYMA 3DP7A 4ZTFA 2KIMA 1BJAA 5TGTA 2IS6A 2QF7A 1K78A 3O6BB 1I6XA 1WJBA 5E1WA 1S3JA 4G8XA 3LFUA 2IGOA 4G94A 2STTA 2YX4A 5E8GA 4U0VA 2IAIA 3DKWA 2V26A 3RPQA 4XLFA 2H8RA 3DTIA 3P9KA 2KMUA 3A03A 3U9GA 1HW2A 3TO6A 1OCZH 3HYIA 3K4BA 3L2UA 1IN7A 2QUFA 1JJ6C 1BJZA 4FASD 3GVAA 2DO7A 1B1BA 1W7PA 4WXCA 5CLSA 3WE2A 2JUGA 1B59A 2HTSA 2LY1A 2VOPA 1XGNA 2EB7A 2RGVA 1ETXA 2NVTJ 2P5KA 2JA7J 2NVXJ 3FMRA 4XKVA 1A5JA 2M7BA 4S05A 2VQHA 1FX7A 2DTZA 2WWYA 1OYWA 1IO2A 5LHGA 1MBFA 5FKMA 5ICCA 3DU5A 2HQRA 1ZYRF 1QRYA 4HX8A 3BG9A 3HKZN 3DFGA 1W36C 3FF5A 2Y0SN 2PLYA 3IV5A 2OU2A 4RMNA 2QVOA 5DTDA 3JAMK 3M07A 5E8IA 2VLAA 3E7LA 1K4TA 2GA2A 1MZBA 2FBHA 3K4MA 1FEXA 2LP0A 1MBJA 4LGWA 1WH7A 2RDPA 4ANJA 3RQIA 1O7LA 1WKMA 2KRHA 1RKWA 3V7RA 5DS9A 1FYKA 1PUEE 3DTKA 2DDAA 2P5VA 5GTHC 3KEYA 3D0SA 1H9GA 2LNBA 3CTAA 4IX7A 2FE3A 1TBXA 3KIOA 1SMTA 2EFNA 5D8LB 1LVAA 2O03A 3I9V2 1ZTRA 2M2EA 5IYBJ 3OS1A 2O8KA 2EFPA 4GXOA 1OR7A 3C1DA 1XX5A 3L1PA 2B63J 4V19K 2IJLA 3K0LA 1WHUA 2M87A 3BQYA 2BY0A 3FXRA 3FIWA 2DA7A 1FWZA 4MTEA 1FY7A 1H89C 2DMTA 2ZXIA 1WJ5A 2QCOA 3QU3A 2VQLA 3K6GA 4M9ZA 1KQ9A 3CCVI 2GOMA 1JE8A 1N78A 5KVRA 1IZ1A 4ETSA 3L7WA 1D1BA 1G8XA 2VBZA 3RIRA 4KFCA 5JLWA 3R4KA 2CQQA 1YQAA 4QIWN 3F21A 1PJRA 1LJ9A 1FP1D 2HVQA 3QOPA 2L5QA 3LOCA 3TOAA 4Y7NJ 2OJED 3N05A 1Z7UA 2L2OA 3IRQA 2MLGA 4AUXA 2NVQJ 2V9PA 3RQ4A 3TOBA 1T08B 4M3BA 1P4AA 1VI0A 1YHQI 5CYVA 3CCLI 1R5GA 4UUSA 5ERIA 3GO5A 3E1SA 2ZBKA 1IF1A 3G4SI 2DFEA 1QPMA 2HR3A 3SHFA 5GAEJ 1HKSA 1YX5A 1WQ2A 2OPTA 4MQ9F 3S1QJ 2EIMH 1P4XA 4CCLA 2FRHA 1BBYA 3CCQI 3FM5A 1ZAOA 3C2GA 4D7MA 1RPWA 1W4MA 5J1YA 3JRHA 4M71A 3GZ5A 2XHKA 5FKLA 1R9TJ 1A6IA 2EV6A 2HGCA 2ZXJA 3H3ZA 1BIBA 4M6YA 4OIQF 3GYHX 2MD5A 1Z6TA 1LNWA 1ZLJA 1TQPA 2HOEA 4PZJA 4JBAA 3SEQA 4HRIA 3WGHA 1WZ2A 2Y0SA 4BAYA 2DOEA 1NG7A 4ESFA 4OWRB 5CPRB 4ZTJA 2XGEA 4LLGF 4I7HA 2K4BA 2JVHA 2VPRA 5IYDJ 1OYYA 5C4JJ 2VJ4A 3DEUA 4BHBA 2R92J 1A36A 2ZMEA 4N9HA 3JRIA 4BQOA 4KITB 3OYIA 4IQ4A 4KMUX 3CZ6A 1HA8A 4I09A 4BQAA 2L3DA 3I0TA 1JKOC 2E7WA 2XAGA 3VEPA 3IKVA 3W6VA 4L9JA 1JUPA 1D8JA 3HPHA 3PUFA 3I59B 4S0HB 3IH2A 3K70C 3CMAI 2MH2A 2FSWA 2OQGA 3AL0B 5EG0B 2R5ZA 2Q8KA 1EH8A 2ELHA 3FMSA 4AM3A 1G4DA 2KL4A 2ZXHA 2CGPA 1DU6A 5FLXK 3N4MA 1O57A 3J7AO 2BBYA 1HDPA 2NOGA 3IP4B 3PQJA 3I58A 3HOUJ 4DQ2A 4PJLA 2IA2A 2B9SA 2OF7A 3BG5A 3K1NA 1LDDA 2H94A 2ICWG 2OCEA 5KAIC 5BNGA 1FTZA 1UMQA 2CQXA 3WTSC 3HTSB 2JZYA 1YLFA 2TCTA 4UXNA 3IH4A 1SFEA 2DT7B 2M1BA 3JAMZ 2DN0A 3F8BA 3M1EA 4M9XA 5LRSA 2GBYA 2DCEA 1FBSA 1WPKA 1Z91A 1HF0A 1OPCA 1ON1A 3B73A 2CV2A 2O3FA 4EM1A 4E7HA 1ERDA 1ON2A 2QM3A 1TQIA 5DCMA 2KQRA 3DF8A 3E6CC 1O3RA 3FZVA 3RI4A 2E34A 1FOYA 2WY8Q 1PP7U 3I4PA 4HNUA 1FTTA 2CS3A 1QVTA 1XGMA 1T39A 2IGMA 2Z3YA 3DLAA 4EQQA 1O3SA 3EDPA 4ITVA 1WI3A 1M1EB 2MLKA 1S9HA 3H35A 4HF2A 2KZVA 2MSYA 1PVEA 1EA3A 3ABLH 2ECCA 3V7CA 2A6TA 2P5LC 1U6GA 4N4NB 1UZCA 1VQ9I 3CJNA 3WU1B 3GTJJ 1X2NA 3GCMA 2KJBA 3IC7A 2YSRA 1FNNA 4BL0B 1K78B 2R7DA 4UVCA 1RESA 3FXLA 1R58A 2M45A 4PSXA 5KHDA 3BCBA 4LMYA 2VQCA 2L01A 4RB3C 2LC2A 4GO1A 3PNTA 4Y52J 2JA5J 2M9HA 2H1KA 3TEDA 2V4JC 4WF2A 2VUMJ 2R5YA 5M5WJ 3RZDJ 4EGZA 3OYCA 2QYOA 2Z2SB 1SFXA 1SMYF 3PSIA 3AL0C 3BZKA 3PNYA 2QBYA 2KRCA 2R7SA 1NTCA 4KICA 2LKSA 3IKTA 2TRTA 2IT0A 3IUOA 4HSTA 3W6JB 4AWXB 5HVQC 3ZN0A 1AWCA 2MGQA 4ZH4F 2E2IJ 1XPXA 3S1NJ 1RKTA 2DU9A 2BYVE 3H0DA 2A68F 2ZCWA 3H5RA 1U3EM 3ONQA 2DAOA 3OYFA 4M3EA 2IXSA 4EEFG 1TW2A 2K4JA 1ZH5A 2L0KA 3MQ0A 4AIHA 3HJEA 1R49A 3BLYA 4DYQA 5J8CA 5B3SH 2XAFA 3VYSB 1RETA 1VQNI 3KP6A 4YFNF 1OFCX 2F2EA 2RKHA 4EGYA 2DPDA 2R7QA 1FIAA 2VN2A 4I2OA 2O0YA 2PMZN 3EPZA 3IWZA 1A35A 4CHUA 3KCCA 4BJ5C 4IO9F 2BZTA 1WJAA 4XLEA 1ZELA 3LA3A 1JUMA 4RGXA 3H9GA 4CCJA 4HAMA 5EGOA 4WK8F 5B1AH 3PIPF 2NS8A 2W82A 1FSEA 1ZG3A 3GLXA 1MKMA 4M3FA 2L9RA 2G9WA 1XB4A 3HIFA 2XPVA 4AVPA 2C6YA 2E35A 1STZA 3HBLA 2IW5A 2LKXA 3DBHB 3HSEA 1FOKA 4MFEA 1LFBA 1WJDA 1BC7C 1WGXA 4R1HA 1MNEA 2HQNA 3KZZA 4ZC3A 3RCOA 4P96A 3F8NA 3EYIA 2OZ6A 2K9LA 3TGNA 1S6LA 1ORKA 2L9VA 3I53A 4UVBA 4HSRA 4UNOA 2EV0A 1TC3C 3K4NA 2UV1A 1CF7A 5DV5A 4DBQA 4QPQA 5HS8A 1OMIA 2XAQA 1U5TB 4RGSA 4AYBN 1PDNC 1GUUA 4OINF 1K4SA 3AG3H 1LFUP 5E3NA 2WAQA 3KEOA 4ZYEA 1GDTA 3GFIA 2DMPA 3KP4A 1YW7A 3K10A 3ZMUA 4BHPA 4OU0A 2LBFA 4G9YA 2MG4A 3DXJF 4HPQA 1CQTA 1YJ9I 2K3PA 2X1DA 4XRSG 3VYUB 1LPQA 2CQKA 2VC0A 2HYFA 4P9FA 1OCRH 1VNDA 4MHGA 4Y33A 4UUSB 1W0UA 1XTAA 1TLHB 1Y6IA 1T0FA 2W1OA 2EA2A 1CGPA 1ULYA 5LBQA 5FKOA 2UXNA 1L0OC 3U1DA 1JHFA 3BG3A 3QPTA 2K85A 5ILSA 2IGNA 1JKPC 2ESNA 1AKHA 2XKPA 2KDOA 1MBEA 4A3JJ 4B3XA 3G1LA 4RB2C 1X19A 4C9YA 3MEXA 4RAFA 1VZ0A 1TWAJ 2L7ZA 3FXQA 5D6EA 2BW3B 2X6OA 1T98A 4Z2YA 3ZGKA 1HSTA 5LHIA 3KYCB 4MGRA 3PO3J 2VXZA 2ZXWH 4A3DJ 1B4AA 1ZK8A 2IPQX 1BM9A 2AO9A 2JSPA 1ODDA 3BC8A 3F9KA 4G6TB 4A0XA 4LJZF 3WTTC 1G59A 1UCRA 4KUMA 3ZRGA 1OR7C 2IP2A 3RYRA 3K2ZA 4OAZA 4L5JA 1SAXA 4UUTA 1X58A 1W1WE 1R71A 3DU6A 5GAGJ 1BOAA 3HZJA 2Y69H 4W97A 3O3KA 4JYKA 4OIRF 3ZMVA 4B09A 3V42A 2ZMEB 4E7SA 2M4GA 4XRFA 5ICGA 3CESA 3G3ZA 1SFUA 3TL4X 3VYRB 2PQ8A 2OV7A 2ID3A 3QPLA 4F91B 1GXQA 1HBXG 2K86A 5FKKA 3RZOJ 3OYGA 2Z9OA 3ZCOA 3HTUA 3DEWA 1QO0D 2DA4A 3CJQB 1OLTA 2E36A 3L00A 4CZZA 2IBDA 2L9SA 1XC5A 2RNGA 1N77A 2XB5A 2R5ZB 2XUBA 2KIQA 4LG0A 4JK1X 4BXFA 5LHHA 2YUSA 4X0GA 2GXGA 3BR3A 4JOMA 3K69A 5K5QA 5E1XA 3OV8A 5E17F 1X3ZB 3CDIA 1QQIA 1YS6A 2F5FA 4BBSJ 3LSMA 3ZMDA 4UUVA 4GGGA 1G6NA 4AVZA 1KU9A 4WCGA 1EJ9A 3DV8A 3U2RA 3ASOH 3G71I 3NWSA 5L3BA 3B6CA 1BR2A 3HC7A 3RKYA 4HG2A 3QWLA 2BVMA 2GAUA 1SVOA 3I4NJ 3T0YA 1Z21A 2F5DA 1VTNC 1Z9CA 4RAYA 4LG3A 3MD2A 2MABA 1IXCA 4B44A 3KETA 2VI6A 4BDZA 3LSJA 2E2JJ 3KFWX 3AG4H 2FXAA 5DCMB 3H3UA 3S16J 4FISA 1GHCA 2JA2A 3H92A 3R60A 4I76A 4HDVA 3OYAA 2XRLA 1R00A 1RZ4A 2CW8A 2O9LA 5J6XA 2CFXA 3NQOA 2JUCA 1K6OA 2HYGD 3HOVJ 3ZQFA 1JKQC 1FMVA 1ETYA 5LGUA 2XSJC 1HQCA 3UR3C 2R7XA 1Y0UA 2WA0A 1YE9A 5EYRA 1Z05A 1ETOA 3B6AA 2IS4A 4NC7A 3CLQA 1SVMA 5TRDA 2MD0A 2H1LA 2XV4S 2ZMEC 2LTPA 3ROUA 3TP3A 4OMZA 1WJFA 3F0CA 2HQ5A 4XORA 1X4PA 4R79A 4YELA 2E60A 4IQJA 1P92A 1SD7A 3OOPA 3KYDB 4HNVA 2R5YB 2EFQA 5DD8A 5H6QA 3F6OA 4GDFA 2WB1A 4CO8A 4IZZA 3IL2A 4Z6YA 3OMYA 2L02A 2QBYB 2LLKA 4UB6C 1REPC 3MZ8A 2QGUA 1V3FA 4M6VA 5L3FA 5CJ9A 3BROA 3MCZA 5BOXA 1DU0A 2A5WA 4C3HJ 3ERED 1YIJI 1NH3A 2KLOA 4HV5A 1IUFA 1ZGWA 1QZYA 2LRDA 2FF4A 2ISYA 1RIOH 3VWBA 3M1CA 3Q9VA 5D4RA 3MKZA 1VFCA 1VQOI 2LOOA 4KJZA 1IUYA 1W0TA 3NRVA 2JMWA 2DMNA 3FM3A 1IGNA 5FKNA 5H2FC 2MC3A 2NNNA 4MNUA 1BW6A 3BR2A 3F72A 3JRGA 6PAXA 2FX0A 5CVUA 5FB2A 1H88C 4EMSA 1XGOA 3BR6A 1I3QJ 4U87A 5E20A 4K2EA 3W2VA 3E5XA 2F5VA 3REOA 3TO9A 2O7OA 4DYCA 1YFHA 4QSHA 5FD6A 5F04A 2R4GA 3QU6A 3OYJA 2AQFA 3F23A 5EGOB 5DM6F 5HNHA 5GTIC 5LGTA 4E7ZA 2QSHX 4FCYA 5CVJA 4U7BA 3S8PA 5HLHA 3DWLE 1GVJA 2X6WA 3HGYA 4EJUA 5AIPA 3DBRB 1J5YA 2CW0F 2OC6A 1VQMI 1ENHA 3ZMZA 1YTYA 1FT9A 1ZARA 1Z7LA 5M3MJ 2P8TA 4BE2A 2E1MB 3KEQA 4HA8A 1QGPA 2JPCA 2WC2A 1BI2A 1GLNA 1UHMA 3I64A 4FX0A 2Y75A 1E3OC 3C3WA 4AU7A 2F5EA 1TWCJ 3GUDA 4KT5C 5K7HA 4BU2A 3HRSA 4L18B 2W84A 3M8JA 2FBIA 2LK2A 1BL0A 2QEXI 3BJ6A 2F6CA 1JKRC 2ZFWA 2STWA 3ZPLA 4D1QA 1B8IA 1P2FA 1LQ1A 4A3LJ 4HF1A 1MMSA 3KP2A 3TDUC 2KIFA 4OOIA 2A69F 2CH0A 4ZYHA 2LBFB 3DKXA 1IDZA 3VOEA 4C2TA 4G6DA 1G3WA 3V8KA 4A3IJ 4MFDA 4H4KC 4C30A 2CUZA 1ITYA 4Y3OA 1E3PA 1R36A 2HYJA 1QNTA 4KYWA 3OYNA 3SZTA 1OCTC 2BY2A 3FHNA 3HOYJ 2KHMA 3BG6A 2DJIA 3FXUA 5IP7J 3R6SA 3ERMA 2RN7A 3LL7A 5A2QK 1AKHB 4II2A 3S3OA 3MKWB 1I1SA 1U78A 3PIOF 3GMEA 4JX6A 5LLQA 3CUQB 4XM3A 2IS2A 3GTPJ 3I3LA 2IEKA 3TBIA 5BMZA 1E17A 3I55I 2DODA 2YU3A 4HW0A 5E3OA 2M8EA 3LSTA 4ENJA 1ZR2A 2PN6A 2L7KA 2HPMA 1GV2A 2BE5F 1IW7F 1RRJA 3J80K 4ASNA 3CJTB 5IYCJ 4CDGA 5ILVA 1HW5A 4H0EA 5ED4A 2H8WA 4CCMA 4IL6C 1I39A 2FU4A 1W36D 1XMXA 5JFRA 4P55A 4XLHA 3HB9A 4A69C 3BZ6A 3KX2A 1C0WA 2E1MC 4CGZA 2HVRA 1PUFA 2BGCA 5H20A 2BY1A 2DK5A 2XGXA 1FJLA 2F48A 1W5SA 2WTEA 2Z33A 3P9CA 3E97A 3LSPA 5EJCA 3FKIJ 3HUGA 3FBNB 4BJTA 1MBGA 2YR2A 4ZZLA 3QOEA 1RNLA 3HGGA 1OISA 3G2BA 2JN6A 4IXAA 1XN7A 2JRMA 2A5YB 3CCMI 4RM3A 3HSFA 2YS9A 4CYCA 4L9NA 4IHYA 3NAUA 3QYFA 4LG0B 2HQAA 3HKZA 4GFBA 2XPUA 4IHVA 1S5LC 3FK7A 4E6KG 4IOAF 2YU9J 2AHQA 1HDDC 3MZYA 1MGTA 1TNTA 1HW1A 2V1XA 4CYDA 3I71A 5F1JA 1X1PA 3F8FA 1P6RA 1WCMJ 3L2RA 1OJLA 3A0BC 3WU0A 5HDKA 1Y0NA 1ACIA 2VC1A 2ME0A 1X3WB 2IA1A 3T1BA 1T0FC 2JQ7A 3BPVA 4E7JA 3H5NA 4X6AJ 3SXYA 2R7RA 5FO5A 2FNAA 2LD5A 3CMYA 4ENMA 3BOQA 4IHTA 4HEA2 3K9TA 2IRFG 4CH7A 3DPLC 3DKYA 3QP6A 3S2DJ 2EPFA 2DQRA 5JVTA 4BNCA 3G6EI 3TP0A 3CCUI 1I6HJ 4XIDA 3CUQC 1GXPA 2JJ7A 1MMAA 1U0JA 1WI9A 2P6TA 2OA4A 5GAHJ 4RS8A 3HOSA 3SJMA 1FYMA 1SFKA 4I6ZA 2HPIA 2QZ8A 5L3GA 4A3MJ 2ZSIB 4F93B 2P0WA 5IY5H 3JRAA 1ZG5A 2PMHA 1GV5A 2I10A 4AC0A 5IP6A 4IOCF 1ZQ3P 1U2WA 2QKLB 3MVPA 1IXRC 1G3TA 2LG4A 1JGGA 2QENA 3QODA 1BN5A 1JUSA 1R4NB 2CUEA 4OAYA 4BQQA 3K4CA 4B43A 3OOUA 5D5UB 1YRNA 3S1MJ 3IHUA 1SEUA 3NEUA 1NG6A 1F9NA 4F3QA 1A31A 3PSFA 5FFXA 1NHAA 1MJBA 2Z1DA 1J9IA 1Y8QB 2AXTC 2DK8A 3ABMH 5LRRA 4O3MA 4NB5A 2EFOA 2GXBA 3CP2A 1JT0A 2ELJA 1IV6A 2GOXB 2DDBA 2K9MA 2KPMA 4I98B 4MEYF 3BTIA 4TV7A 2JSCA 3QP5A 2D2WA 4XRMA 3KPHA 1G3YA 2NYXA 4LFUA 1R7JA 2CJJA 3WTWC 4L0YB 2MW8A 2O8XA 3LQRA 4IJAA 5FRNA 4QWQA 5JLXA 2E2HJ 5JHUA 1QU3A 3IWFA 1VQPI 1LDJA 4WWCA 2XGCA 1TQMA 1WJEA 3ZQLA 4RA2A 2EZLA 3E0JB 2L7MP 3DQVC 4PFPA 3LSGA 4A3KJ 2EZKA 3K4LA 2KDZA 3OR2C 1VQ4I 1IRZA 2HXOA 2I8DA 4BY7J 1D0ZA 4I99C 4YFXF 5A2QZ 4ABZA 5IOZA 1QA6A 2WAFA 3CF5F 3K1PA 1W7PB 2ZJPF 5ICEA 2K7LA 1HLVA 2R7UA 4RGRA 3S17J 1KYZA 3S93A 1YIOA 1R1TA 5EEAA 1BA5A 2FUG2 1KU3A 2LFBA 2AS5F 1O7FA 1X3UA 2ZSHB 3FXKA 3J80Z 1Y8RB 3UNGC 2V79A 1X1DA 2LY9A 4DBRA 1FZPB 4CA0A 3RPUD 1IN4A 3SZGA 1MH3A 3MFKA 3ZQGA 4GCVA 1QZZA 3RKQA 3I56I 1YJWI 5C3EJ 3BQZA 2EWNA 4ZYGA 1F1ZA 4N9IA 1E2XA 4UV8A 1G2HA 4BEHA 1H9TA 4MQVA 3CUOA 2EV5A 3ZQ7A 2Y2ZA 3JRFA 2K3FA 3H1CA 3PQKA 1S7AA 1T95A 1Z77A 1TL8A 4CCNA 3RTRA 1I5ZA 1IN8A 4X1EA 3ZR8X 3IAS2 2QQAA 2R3SA 4L0ZB 1T33A 5HDGA 3GEZA 1OKRA 2CYYA 2OZUA 4BACA 2L4MA 2M0CA 2ZJRF 4DYRA 4XBFA 1OYIA 2F4IA 5LEKA 1A6QA 2V1UA 2XPWA 1ZR4A 4A0ZA 4AIDA 2D45A 2DJNA 3KE2A 1B8IB 4P5OA 2A07F 2Y48A 2K9NA 3QQAA 3WG7H 4JP0A 2PI0A 9ANTA 4EATA 1SD4A 2TDXA 3SDBA 1MNMC 4EM0B 5D5WB 2D1HA 2OCCH 4RLQA 1YX3A 3LSHA 3N97A 1B9NA 4V2FA 5LEJA 1D0YA 4B4CA 5JVGF 5BPDA 1BOBA 3I54A 2VONA 1JHHA 4HQMA 1UG0A 3WTYC 3V7SA 2XF5A 5LGNA 5J3LA 4IVNA 4U7DA 2ZFUA 1J75A 2W48A 2BXYA 2KZGA 2CMPA 3MAJA 3WTUC 4J00A 4M9SA 2QSFX 2XKOA 5FLXZ 4HQEA 1ZLKA 3ZN1A 2Y9ZA 4KMFA 2XAJA 5K1YA 5HLIA 1SC7A 3DBLB 4RGUA 5HLTA 5F0FA 1GVDA 2PMUA 5IT9K 5E18F 3L2VA 4RB1A 3PO2J 3CD6I 3I5UA 1I27A 4F52A 3LSIA 2LREA 1WVRA 4NQWA 4YIRX 1R23A 1R5HA 2DOFA 4Q48A 4QPOA 1TW3A 4EJVA 4CUGA 1T8IA 3VYTB 3GTKJ 1WFXA 4NNJA 3JSOA 1X4OA 3F8CA 3L2WA 2LH9A 2HOSA 4M3GA 3HRUA 3E6BA 5L3EA 2FQ4A 2MBFA 4KISA 2QQBA 3GW2A 2BV6A 4PJJA 3BZCA 4XONA 1T6SA 5J40A 3WHBA 4C3JJ 1ZN2A 5ILUA 3TQNA 1PUFB 4CICA 4JX4A 2CSOA 2ELKA 3NARA 4O5VA 3O8GA 3HDDA 1D3YA 4PUSA 4MLOA 4UVAA 3PM1A 3HRMA 3HUGB 3C2HA 1O4XA 3BP8A 1E0EA 1SD6A 4AD9A 2ETHA 2DMQA 4XMYA 1RI7A 3GX4X 2MA3A 4CYCB 1KU7A 2X6XA 2JVGA 2CW7A 1VF9A 3KP3A 3W2AA 1B6AA 1X2MA 5JR3A 2WADA 5EF6A 1S7OA 2GA1A 5LFAA 5DM7F 1R4MB 1O3TA 4NHJA 5F0CA 3ESWB 3CC7I 4R8HA 3TDZC 1R1VA 2CO5A 2H09A 1Y1WJ 3FKJA 4I01A 2OUMA 1J59A 1W5CC 3A0HC 1JT6A 2B0LA 4EJOA 2O61A 3T8TA 4A5MA 1RUOA 2PMZA 4Q4ZF 4ENKA 4D5FA 5EEHA 2QA4I 3V4GA 4XOPA 2K02A 2LF8A 4AIJA 3E3VA 3HOXJ 2NOJB 1ETWA 1YS7A 3SQNA 3UKGA 1ZRFA 3GF2A 1QBJA 3OSFA 5CVRA 4ZDOA 1Z67A 4ZDPA 1MMNA 3H36A 2Y31A 1WH5A 3KP7A 3G73A 2V1NA 1IRXA 3I4MJ 3O8HA 1GT0C 3OSGA 1AU7A 4XLPF 3H3VK 2DT5A 3Q5FA 2OTJI 2DLLA 2VOOA 1HXDA 1W5TA 5D8KB 3ZQIA 4G6QA 2X1CA 1WWXA 2E19A 2V9KA 1DP7P 4WX9A 3IH3A 2DA1A 1MMGA 4IRHA 2A05A 2G0EA 5F64A 4PJ0C 2XC7A 2UZKA 1YOVB 3HXLA 3MN2A 1KZHA 2W24A 5KAFC 2F5CA 1BI1A 1IAWA 3PL8A 2Q0OA 2A3SA 2HFHA 2NS0A 4RLFA 2GWRA 5DUIA 3BR1A 3FBIB 4AYBA 1YYVA 5L3CA 4A3EJ 3RJPA 1YRNB 2DYSH 4LITA 3SDGA 3AAFA 1BR1A 1BC8C 4CSWA 5EZHA 1Z0XA 4CCKA 1X1BA 1ETVA 4L5EA 5K7FA 4U88A 1WSUA 1KGSA 4RB0A 5HS9A 2EJRA 3O2PE 4BGDA 1KQ0A 3DCFA 3DPUA 5HNFA 2EBIA 3QYBA 2MFZA 2M34A 4A3CJ 2PBIA 2N8GA 2XSDC 2EILH 4A6DA 2GZWA 2RQPA 1XGSA 4P9UA 1D8KA 2ZKZA 3ZQHA 2VBXA 3BPXA 2G7HA 1FPQA 2VIXA 2JA6J 5J4YA 4KNYA 4RM2A 1J09A 3CC2I 4FETA 2X9DA 2Y30A 2E7XA 4J19A 4EJTA 1OCOH 4A3GJ 2RVCA 3S14J 3SFZA 5CQGA 2ID6A 4RAGA 5IP9J 1QHHD 1YJNI 1FMWA 4BUPA 5B66C 3MKYB 3L09A 1I50J 2DMUA 2DQLA 4BJ6C 4Y17A 1J2XA 1D1CA 2NS7A 2OAZA 1Z3YA 4YEJA 1P9QC 1DPUA 3CLOA 2CU7A 2ZNYA 1X1CA 3CMMA 3TW6A 3FXOA 1UJ8A 4UV9A 3VSLA 1BIAA 4FQGA 2DA3A 4XN3A 5F6FA 3LAJA 2O6GE 1FBUA 4BY1J 3ZQQA 2FBKA 1S8NA 4A6EA 2UWMA 2X51A 1QZEA 5HLGA 4HOBA 2CUJA 2DA6A 5ICFA 1MD0A 2M4KA 3ABTA 3RKWA 1FSHA 1XDSA 5FFZA 4XL9A 3CQZJ 4L5IA 2RV8A 5J47A 3VODA 4FE4A 4M6XA 4XRSA 2XGDA 1UFMA 3WHCA 3B02A 3LQQA 2CFOA 2V9VA 5B1BH 2FOKA 2W00A 2ESHA 2X4HA 3BTCA 3LA7A 5KK1A 3Q3SA 4BEHB 3LAPA 4C2MJ 4BH9A 3MKLA 2H6BA 2M30A 3OWTA 1SANA 1MNDA 1OQYA 4LIVA 2MH9A 4BYYA 1FOWA 2QSGX 1J0RA 1IXSB 1HCRA 1MSEC 2J5OA 2FJ1A 4LOCA 4W1UA 5DUKA 5FJ8J 2DFFA 2M0MA 4A93J 2EINH 2NXNB 2BHZA 3OIQA 1FC3A 3J81K 3A4CA 4A0YA 2GXAA 2PJRA 3A1YA 3J7ZI 4M72A 4PGGA 5GP9A 4XICA 3X2QH 1ZG1A 3LFKA 4EJWA 2QQ8A 3HOWJ 4XQFA 2GIZA 5AIQA 2PX9A 4KIGA 4NC6A 1R5ID 2KP6A 2XDVA 2Z5UA 4G12A 5HOOA 3FHZA 1HC8A 4XK4A 2CV0A 1EH6A 4YIIA 3BTJA 1RUNA 2XF6A 1CF7B 1BR4A 2PJPA 3EETA 1MJ9A 2HDCA 4E7LA 2K40A 1I3AA 2CQNA 3S3NA 3J7YJ 1LB2A 1P4WA 1RR7A 1YW8A 1SFOJ 2WV0A 5J1RA 1MH4A 4KDPA 1K83J 2VJJA 5TJJA 1LDKB 2Q1ZB 2PG4A 4D0PA 2IVMA 1DPRA 2MYSA 1MIJA 4HZFA 4HF0A 1LEAA 4V2GA 4AIKA 4LK1F 5F0HA 3WGIA 2LR8A 4KN7X 2UUZA 4D5CA 2M5WA 2QKMB 4NQWB 1RC9A 2VXDA 1ZRDA 1XSXA 4HNTA 3QRFF 5K7ZA 3FMQA 2E1CA 2RNJA 2JT1A 5K5OA 2QQ9A 3V8LA 1AHDP 4HX7A 3PJRA 1U9NA 2NNYA 3T8RA 1DDNA 3JTHA 5DEQA 3U21A 5LD2C 1B72A 5IT3A 4DNCA 3GTMJ 2X48A 4LLLA 3M8EA 3MMYB 3TMOA 4DW6A 3WGGA 5GPAA 1Y39A 1O3QA 1XMKA 2YX7A 2GLOA 2LF7A 4HYEA 2K27A 2E71A 4BE1A 1TNSA 2X6YA 2EFWA 3EQLF 3MWMA 4MTDA 2RAEA
chains in the Genus database with same CATH topology
5DD4A 1HKQA 4G7ZF 1ZHFA 1V4RA 4G7OF 3ZMSA 3ABUA 1IRGA 2P7VB 2HWVA 1U5TA 3E6MA 3JW4A 5D4SA 4S04A 1YW9A 1J7KA 3TO7A 3F8MA 3HRTA 2VE8A 3RKXA 4PDKA 3E5UA 4Y13A 1FLIA 4WXHA 3PFIA 2NAZA 4LLNA 4LD5A 3EUHA 4LK0F 4ZZDA 2DI3A 2HZTA 4YG2F 4L9VA 4HV6A 2JTVA 3BWGA 4M74A 2DW4A 3MZHA 1DUXC 5BS6A 2KIUA 2VBYA 2CG4A 1ZREA 3ISPA 2H27A 3L2CA 4KA4A 2DPUA 1ZGJA 2EA4A 4BHCA 5JI6A 1XCBA 3VB2A 3LA2A 1U8RA 2Q2EA 4HX4A 1MDMA 2P4WA 2Y0MA 3CO6C 3ECOA 2XVCA 3COAC 4XSXF 3VFZA 4OIPF 2XASA 3JSPA 3WTZA 5CVIA 3J81Z 5J8FA 3S2WA 1D5VA 4GYIA 4XSZF 1UB9A 1YO5C 3HHGA 4FX4A 4WXDA 5E1ZB 3T5XA 3KLOA 2OD5A 1PP8F 2GIVA 2NRAC 3ELKA 1LEBA 2EK5A 3RYPA 4ENNA 2FQ3A 5FGMA 2BEOA 4A5NA 5D6FA 3CDHA 5AONA 1A04A 4I02A 3QAHA 5HDNA 2ZNZA 3M8FA 4IRGA 1AOYA 5FD5A 3GZ6A 1XSVA 3GFLA 1TTYA 5DDGA 1HSJA 2W25A 2OBPA 1H0MA 2A61A 4KN4X 1SD5A 3FWEA 2R7FA 1USSA 2PEXA 3GFJA 3P7NA 1UHWA 1FBQA 2CWEA 3WG9A 2DBBA 4XLNF 4U0WA 4KIBA 3BY6A 2FNPA 3C7JA 3GWZA 4YIFA 2ADUA 5K5RA 4OMYA 2V1DA 3M9AA 3KP5A 1KU2A 1FYLA 2HS5A 1JXSA 3R61A 1IN5A 3JTGA 1T38A 2P7CB 4MEXF 4LB5A 3EYYA 3HSRA 5EEGA 4BXUA 1IRFA 3WODF 1L3LA 1XSDA 1XCVA 2RC4A 4E70A 5D5XB 4ESJA 2COMA 2VT2A 1K7AA 5D5VB 1KYWA 5BPIA 1S29A 2G7UA 5F1RA 4CXFA 2ZJ2A 2XRNA 4FT8A 4HLYA 4UHTA 1XDUA 2PFBA 4IPAA 1Z6RA 2LSOA 1FP2A 1KA8A 3F6VA 2KJCA 2FA5A 1Z1DA 3Q9SA 2IA0A 4ZYDA 3R0JA 2KKOA 4O6JA 2V6CA 2W57A 1HKTA 2UXXA 3LWFA 1EV7A 3P9IA 1R22A 2LKPA 1F4KA 1XD7A 3HHHA 4B8XA 2L4AA 4I0BA 4IHSA 2L54A 2XIGA 5CVVA 1F5TA 3F22A 5HS7A 2XAHA 3WE3A 2OQRA 4KIFA 3C18A 3CUQA 2P6SA 4ESBA 2YPRA 2Z99A 3ZMTA 3GFMA 2DTRA 1USTA 2A6HF 3ML6A 1MJAA 4A12A 1ONVA 1YG2A 2VODA 3RPUA 1ZRCA 3SZPA 3W6KB 4RAZA 3F3XA 1MDMB 4QLCU 1W7PD 4G7HF 3M7GA 4IRIA 2GQQA 5H6RA 2VE9A 4HBLA 5DCFA 2XROA 1B9MA 3QPHA 2FMLA 4Y15A 3R0AA 4IF4A 4FHTA 1U5TC 4U0YA 2FMYA 1T2KA 2ZO4A 4LB6B 1Q1HA 5BQTA 3RDIA 2QLZA 2A6EF 2VBWA 3WTXC 1JGSA 2E1NA 3E5QA 2HEOA 4EVIA 2QWWA 4JQFA 1I1GA 2KRFA 3K1MA 2VT3A 4N0BA 4EM2A 1XMAA 3D5LA 2W85A 3TKYA 4I0AA 2D1VA 2HTJA 4L9TA 3V8JA 2JPBA 3I59A 4PGHA 3FX3A 2DFIA 4ON0A 3BJAA 2J5PA 3BDDA 3DPTA 4GYGA 2ACJA 3IRRA 2H6CA 4YFKF 3ULQB 1KQ8A 1G3SA 2FEZA 3GXOA 4HLXA 1ZGAA 2X0LA 3KLNA 3WTVC 3ZP5A 5L3DA 4Q5SF 3E6DA 1K79A 2HKOA 3BJOA 5IT9Z 1IN6A 1BI3A 4EV0A 3HOTA 3L9FA 4OIOF 3ECHA 4HDUA 2HKXA 1WRJA 4A2UA 3KZYA 2ISZA 2LDUA 2JRTA 4Q47A 2AXLA 1R1UA 4M73A 1EH7A 1BI0A 3CO7C 4F7ZA 4PCQA 5DYMA 3DP7A 2KIMA 1BJAA 1K78A 3O6BB 1I6XA 5E1WA 1S3JA 4G8XA 4G94A 2STTA 2YX4A 5E8GA 4U0VA 3DKWA 3RPQA 3P9KA 3U9GA 1HW2A 3TO6A 3HYIA 1IN7A 2QUFA 3GVAA 2DO7A 1B1BA 1W7PA 4WXCA 5CLSA 3WE2A 1B59A 2HTSA 2VOPA 1XGNA 2EB7A 2RGVA 2P5KA 3FMRA 4S05A 1FX7A 2WWYA 1OYWA 5LHGA 5ICCA 2HQRA 1ZYRF 4HX8A 3DFGA 3FF5A 2PLYA 2OU2A 2QVOA 3JAMK 5E8IA 2GA2A 1MZBA 2FBHA 4LGWA 2RDPA 1O7LA 1WKMA 3V7RA 1FYKA 1PUEE 2P5VA 3D0SA 1H9GA 2LNBA 3CTAA 2FE3A 1TBXA 1SMTA 2EFNA 5D8LB 1LVAA 2O03A 2EFPA 4GXOA 1OR7A 3C1DA 2IJLA 3K0LA 2M87A 3FXRA 1FWZA 4MTEA 1FY7A 3QU3A 4M9ZA 1KQ9A 1JE8A 5KVRA 1IZ1A 4ETSA 3L7WA 2VBZA 3RIRA 4KFCA 3R4KA 1YQAA 3F21A 1LJ9A 1FP1D 3QOPA 3TOAA 1Z7UA 3IRQA 2MLGA 3TOBA 1P4AA 5CYVA 1R5GA 5ERIA 3GO5A 1IF1A 2ZBKA 1QPMA 2HR3A 3SHFA 1HKSA 4MQ9F 1WQ2A 1P4XA 2FRHA 1BBYA 3FM5A 1ZAOA 1W4MA 4M71A 3GZ5A 2XHKA 2HGCA 2EV6A 2ZXJA 3H3ZA 1BIBA 4M6YA 4OIQF 3GYHX 2MD5A 1Z6TA 1LNWA 1ZLJA 1TQPA 2HOEA 4PZJA 4JBAA 3WGHA 4BAYA 4ESFA 4LLGF 4I7HA 2K4BA 1OYYA 3DEUA 4BHBA 2ZMEA 4N9HA 4KMUX 4I09A 4BQAA 2L3DA 3I0TA 2E7WA 2XAGA 3VEPA 3IKVA 4L9JA 1D8JA 3I59B 2MH2A 2FSWA 2OQGA 2Q8KA 1EH8A 2ELHA 3FMSA 1G4DA 2CGPA 5FLXK 3N4MA 1O57A 3J7AO 2BBYA 3PQJA 3I58A 4DQ2A 2IA2A 3K1NA 1LDDA 2H94A 3WTSC 3HTSB 2JZYA 1YLFA 4UXNA 1SFEA 2M1BA 3JAMZ 4M9XA 3F8BA 3M1EA 5LRSA 1FBSA 1Z91A 1OPCA 1ON1A 3B73A 2O3FA 4EM1A 1ON2A 2QM3A 1TQIA 5DCMA 3DF8A 3E6CC 1O3RA 3FZVA 3RI4A 1PP7U 3I4PA 1XGMA 1T39A 2Z3YA 4EQQA 1O3SA 3EDPA 2MLKA 4HF2A 3V7CA 2P5LC 1U6GA 3CJNA 3WU1B 2KJBA 3IC7A 2YSRA 1FNNA 1K78B 2R7DA 4UVCA 1R58A 2M45A 4LMYA 2L01A 4RB3C 4GO1A 4WF2A 4EGZA 2QYOA 1SFXA 1SMYF 2QBYA 4KICA 3IKTA 2IT0A 4AWXB 5HVQC 3ZN0A 1AWCA 4ZH4F 2DU9A 2BYVE 2A68F 2ZCWA 1U3EM 2DAOA 1TW2A 2K4JA 1ZH5A 3MQ0A 4AIHA 5J8CA 2XAFA 3KP6A 4YFNF 2F2EA 2RKHA 4EGYA 2DPDA 2VN2A 4I2OA 2O0YA 3IWZA 4CHUA 3KCCA 3LA3A 4RGXA 4HAMA 4WK8F 1ZG3A 1FSEA 3GLXA 1MKMA 2G9WA 1XB4A 3HIFA 4AVPA 2C6YA 1STZA 2IW5A 3HSEA 1FOKA 1BC7C 4R1HA 3KZZA 2HQNA 4P96A 3F8NA 3EYIA 2OZ6A 3TGNA 1S6LA 3I53A 4UVBA 4UNOA 2EV0A 1CF7A 5DV5A 5HS8A 1OMIA 2XAQA 1U5TB 4RGSA 1PDNC 4OINF 3KEOA 4ZYEA 3GFIA 3KP4A 1YW7A 3ZMUA 4BHPA 4OU0A 4G9YA 3DXJF 2CQKA 2VC0A 2HYFA 4P9FA 4MHGA 1TLHB 1T0FA 2EA2A 1CGPA 1ULYA 5LBQA 2UXNA 1L0OC 3U1DA 1JHFA 3QPTA 5ILSA 2ESNA 2XKPA 4RB2C 3MEXA 3FXQA 5D6EA 4Z2YA 1T98A 1HSTA 5LHIA 4MGRA 2VXZA 1B4AA 2IPQX 3W6JB 1BM9A 1ODDA 3WTTC 4A0XA 4LJZF 1UCRA 4KUMA 2IP2A 3RYRA 3K2ZA 1SAXA 4L5JA 1BOAA 3O3KA 4OIRF 3ZMVA 4B09A 2ZMEB 4XRFA 5ICGA 3G3ZA 1SFUA 2PQ8A 1GXQA 1HBXG 2K86A 2Z9OA 3HTUA 1QO0D 3L00A 4CZZA 2XUBA 4LG0A 4JK1X 5LHHA 2GXGA 3K69A 5K5QA 5E1XA 3OV8A 5E17F 1QQIA 1YS6A 2F5FA 3ZMDA 4UUVA 4GGGA 1G6NA 1KU9A 4WCGA 3DV8A 3U2RA 5L3BA 3RKYA 2GAUA 3T0YA 2F5DA 1VTNC 1Z9CA 4RAYA 1IXCA 3KETA 3KFWX 2FXAA 5DCMB 3H3UA 1GHCA 3H92A 4HDVA 3R60A 1R00A 1RZ4A 5J6XA 2CFXA 3NQOA 1K6OA 2HYGD 5LGUA 1HQCA 1Y0UA 1Z05A 5TRDA 2XV4S 3ROUA 4OMZA 4R79A 1P92A 1SD7A 3OOPA 2EFQA 5DD8A 5H6QA 3F6OA 4CO8A 3IL2A 2L02A 2QBYB 1REPC 1V3FA 5L3FA 5CJ9A 3BROA 3MCZA 5BOXA 3ERED 4HV5A 1QZYA 2FF4A 2ISYA 1RIOH 3Q9VA 5D4RA 1IUYA 3NRVA 3FM3A 2MC3A 2NNNA 4MNUA 3F72A 6PAXA 5CVUA 5FB2A 4EMSA 1XGOA 5E20A 4K2EA 3E5XA 1YFHA 3REOA 3TO9A 5FD6A 3QU6A 3F23A 5LGTA 5CVJA 4U7BA 5HLHA 1GVJA 4EJUA 5AIPA 1J5YA 2CW0F 3ZMZA 1YTYA 1FT9A 1ZARA 2P8TA 3KEQA 4HA8A 1QGPA 2JPCA 2WC2A 1BI2A 3I64A 1UHMA 4FX0A 2Y75A 3C3WA 2F5EA 3GUDA 4KT5C 3HRSA 4L18B 2W84A 2FBIA 3BJ6A 3ZPLA 2ZFWA 2STWA 1P2FA 1LQ1A 4HF1A 3TDUC 3KP2A 2KIFA 4OOIA 2A69F 4ZYHA 3VOEA 4G6DA 1G3WA 3V8KA 1R36A 1QNTA 4KYWA 3SZTA 3FXUA 3R6SA 5A2QK 2RN7A 1I1SA 1U78A 5LLQA 3CUQB 5BMZA 1E17A 2YU3A 4HW0A 4ENJA 2M8EA 3LSTA 2PN6A 2BE5F 1IW7F 3J80K 4ASNA 4CDGA 5ILVA 1HW5A 4H0EA 5ED4A 2FU4A 5JFRA 4P55A 3BZ6A 1C0WA 4CGZA 2BGCA 5H20A 2DK5A 2XGXA 1W5SA 2WTEA 2Z33A 3P9CA 3E97A 3HUGA 2YR2A 4ZZLA 1RNLA 4IXAA 1XN7A 2A5YB 3HSFA 4L9NA 4LG0B 3MZYA 1MGTA 1TNTA 1HW1A 2V1XA 4CYDA 3I71A 3F8FA 1P6RA 3WU0A 5HDKA 2VC1A 2IA1A 3T1BA 3BPVA 3SXYA 5FO5A 2FNAA 4ENMA 3BOQA 4IHTA 3K9TA 2IRFG 3DPLC 3QP6A 2DQRA 5JVTA 4BNCA 3CUQC 1GXPA 1WI9A 2P6TA 2OA4A 4RS8A 3HOSA 1FYMA 2QZ8A 5L3GA 1ZG5A 2PMHA 1U2WA 1IXRC 1G3TA 2QENA 1BN5A 5D5UB 3IHUA 3NEUA 1F9NA 5FFXA 1NHAA 1MJBA 1J9IA 2DK8A 2GXBA 5LRRA 4O3MA 4NB5A 2EFOA 4I98B 4MEYF 4TV7A 2JSCA 3QP5A 2D2WA 1G3YA 2NYXA 4LFUA 1R7JA 3WTWC 4L0YB 2O8XA 3LQRA 4IJAA 4QWQA 5JHUA 3IWFA 1LDJA 4WWCA 1TQMA 3DQVC 4YFXF 5A2QZ 3K1PA 1W7PB 5ICEA 2K7LA 4RGRA 1KYZA 1YIOA 1R1TA 1KU3A 2AS5F 1O7FA 1X3UA 3J80Z 2V79A 1FZPB 1IN4A 3MFKA 4GCVA 1QZZA 2EWNA 4ZYGA 1F1ZA 4N9IA 1E2XA 4UV8A 1H9TA 4MQVA 3CUOA 2EV5A 3ZQ7A 3PQKA 1S7AA 3RTRA 1I5ZA 1IN8A 2QQAA 2R3SA 4L0ZB 5HDGA 3GEZA 1OKRA 2CYYA 2OZUA 2L4MA 4XBFA 1OYIA 5LEKA 2V1UA 4A0ZA 2D45A 3KE2A 4P5OA 2A07F 2Y48A 2PI0A 1SD4A 2TDXA 4EM0B 5D5WB 2D1HA 3N97A 1B9NA 5LEJA 5BPDA 3I54A 2VONA 1JHHA 4HQMA 3WTYC 3V7SA 5LGNA 4IVNA 4U7DA 1J75A 3WTUC 3MAJA 4M9SA 2XKOA 5FLXZ 4HQEA 1ZLKA 3ZN1A 4KMFA 2XAJA 5K1YA 5HLIA 4RGUA 2PMUA 5IT9K 5E18F 4RB1A 3I5UA 1I27A 4NQWA 1R23A 1R5HA 4Q48A 1TW3A 4EJVA 3JSOA 3F8CA 3HRUA 3E6BA 5L3EA 2MBFA 2QQBA 3GW2A 2BV6A 1T6SA 1ZN2A 5ILUA 3TQNA 4CICA 2CSOA 4O5VA 1D3YA 4UVAA 3HRMA 3BP8A 1SD6A 4AD9A 2ETHA 1RI7A 3GX4X 2MA3A 1KU7A 3KP3A 1B6AA 5JR3A 1S7OA 2GA1A 1O3TA 4NHJA 4R8HA 3TDZC 1R1VA 2CO5A 2H09A 4I01A 1J59A 2B0LA 4EJOA 2O61A 3T8TA 4A5MA 1RUOA 4Q4ZF 4ENKA 5EEHA 3V4GA 2K02A 2LF8A 4AIJA 3E3VA 1YS7A 3SQNA 1ZRFA 3GF2A 1QBJA 5CVRA 3G73A 3KP7A 4XLPF 2DT5A 3Q5FA 2DLLA 2VOOA 1HXDA 1W5TA 5D8KB 4G6QA 1WWXA 1DP7P 4WX9A 4IRHA 5F64A 2UZKA 2W24A 2F5CA 1BI1A 1IAWA 2Q0OA 2A3SA 2HFHA 2NS0A 2GWRA 5DUIA 1YYVA 5L3CA 3RJPA 3AAFA 1BC8C 4U88A 1WSUA 1KGSA 4RB0A 5HS9A 2EJRA 3O2PE 1KQ0A 2PBIA 4A6DA 2GZWA 2RQPA 1XGSA 4P9UA 1D8KA 2ZKZA 2VBXA 3BPXA 2G7HA 1FPQA 4KNYA 2E7XA 4EJTA 2RVCA 3SFZA 3L09A 2DQLA 4Y17A 1J2XA 2OAZA 1DPUA 3CLOA 2ZNYA 4UV9A 1BIAA 5F6FA 3LAJA 2O6GE 1FBUA 2FBKA 1S8NA 4A6EA 2UWMA 5HLGA 4HOBA 5ICFA 1MD0A 3ABTA 3RKWA 1FSHA 1XDSA 5FFZA 4L5IA 2RV8A 3VODA 4M6XA 1UFMA 3B02A 3LQQA 2V9VA 2FOKA 2ESHA 2X4HA 3LA7A 5KK1A 3LAPA 4BH9A 2H6BA 2M30A 2MH9A 4BYYA 1J0RA 1IXSB 2J5OA 5DUKA 1FC3A 3J81K 4A0YA 4M72A 4PGGA 1ZG1A 3LFKA 4EJWA 5AIQA 4KIGA 2Z5UA 5HOOA 3FHZA 1EH6A 4YIIA 1RUNA 1CF7B 2PJPA 3EETA 1MJ9A 2HDCA 1LB2A 1P4WA 1YW8A 2WV0A 4KDPA 5TJJA 1LDKB 4D0PA 2PG4A 2IVMA 1DPRA 4HZFA 4HF0A 1LEAA 4AIKA 4LK1F 3WGIA 4KN7X 1ZRDA 2M5WA 1XSXA 3QRFF 3FMQA 2E1CA 2RNJA 2JT1A 5K5OA 2QQ9A 3V8LA 4HX7A 2NNYA 3T8RA 1DDNA 3JTHA 5DEQA 5IT3A 4DNCA 4LLLA 3M8EA 3WGGA 1O3QA 1XMKA 2YX7A 2LF7A 4HYEA 2K27A 1TNSA 2EFWA 3EQLF 3MWMA 4MTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DD4 A;  1HKQ A;  4G7Z F;  1ZHF A;  1V4R A;  4G7O F;  3ZMS A;  3ABU A;  1IRG A;  2P7V B;  2HWV A;  1U5T A;  3E6M A;  3JW4 A;  5D4S A;  4S04 A;  1YW9 A;  1J7K A;  3TO7 A;  3F8M A;  3HRT A;  2VE8 A;  3RKX A;  4PDK A;  3E5U A;  4Y13 A;  1FLI A;  4WXH A;  3PFI A;  2NAZ A;  4LLN A;  4LD5 A;  3EUH A;  4LK0 F;  4ZZD A;  2DI3 A;  2HZT A;  4YG2 F;  4L9V A;  4HV6 A;  2JTV A;  3BWG A;  4M74 A;  2DW4 A;  3MZH A;  1DUX C;  5BS6 A;  2KIU A;  2VBY A;  2CG4 A;  1ZRE A;  3ISP A;  2H27 A;  3L2C A;  4KA4 A;  2DPU A;  1ZGJ A;  2EA4 A;  4BHC A;  5JI6 A;  1XCB A;  3VB2 A;  3LA2 A;  1U8R A;  2Q2E A;  4HX4 A;  1MDM A;  2P4W A;  2Y0M A;  3CO6 C;  3ECO A;  2XVC A;  3COA C;  4XSX F;  3VFZ A;  4OIP F;  2XAS A;  3JSP A;  3WTZ A;  5CVI A;  3J81 Z;  5J8F A;  3S2W A;  1D5V A;  4GYI A;  4XSZ F;  1UB9 A;  1YO5 C;  3HHG A;  4FX4 A;  4WXD A;  5E1Z B;  3T5X A;  3KLO A;  2OD5 A;  1PP8 F;  2GIV A;  2NRA C;  3ELK A;  1LEB A;  2EK5 A;  3RYP A;  4ENN A;  2FQ3 A;  5FGM A;  2BEO A;  4A5N A;  5D6F A;  3CDH A;  5AON A;  1A04 A;  4I02 A;  3QAH A;  5HDN A;  2ZNZ A;  3M8F A;  4IRG A;  1AOY A;  5FD5 A;  3GZ6 A;  1XSV A;  3GFL A;  1TTY A;  5DDG A;  1HSJ A;  2W25 A;  2OBP A;  1H0M A;  2A61 A;  4KN4 X;  1SD5 A;  3FWE A;  2R7F A;  1USS A;  2PEX A;  3GFJ A;  3P7N A;  1UHW A;  1FBQ A;  2CWE A;  3WG9 A;  2DBB A;  4XLN F;  4U0W A;  4KIB A;  3BY6 A;  2FNP A;  3C7J A;  3GWZ A;  4YIF A;  2ADU A;  5K5R A;  4OMY A;  2V1D A;  3M9A A;  3KP5 A;  1KU2 A;  1FYL A;  2HS5 A;  1JXS A;  3R61 A;  1IN5 A;  3JTG A;  1T38 A;  2P7C B;  4MEX F;  4LB5 A;  3EYY A;  3HSR A;  5EEG A;  4BXU A;  1IRF A;  3WOD F;  1L3L A;  1XSD A;  1XCV A;  2RC4 A;  4E70 A;  5D5X B;  4ESJ A;  2COM A;  2VT2 A;  1K7A A;  5D5V B;  1KYW A;  5BPI A;  1S29 A;  2G7U A;  5F1R A;  4CXF A;  2ZJ2 A;  2XRN A;  4FT8 A;  4HLY A;  4UHT A;  1XDU A;  2PFB A;  4IPA A;  1Z6R A;  2LSO A;  1FP2 A;  1KA8 A;  3F6V A;  2KJC A;  2FA5 A;  1Z1D A;  3Q9S A;  2IA0 A;  4ZYD A;  3R0J A;  2KKO A;  4O6J A;  2V6C A;  2W57 A;  1HKT A;  2UXX A;  3LWF A;  1EV7 A;  3P9I A;  1R22 A;  2LKP A;  1F4K A;  1XD7 A;  3HHH A;  4B8X A;  2L4A A;  4I0B A;  4IHS A;  2L54 A;  2XIG A;  5CVV A;  1F5T A;  3F22 A;  5HS7 A;  2XAH A;  3WE3 A;  2OQR A;  4KIF A;  3C18 A;  3CUQ A;  2P6S A;  4ESB A;  2YPR A;  2Z99 A;  3ZMT A;  3GFM A;  2DTR A;  1UST A;  2A6H F;  3ML6 A;  1MJA A;  4A12 A;  1ONV A;  1YG2 A;  2VOD A;  3RPU A;  1ZRC A;  3SZP A;  3W6K B;  4RAZ A;  3F3X A;  1MDM B;  4QLC U;  1W7P D;  4G7H F;  3M7G A;  4IRI A;  2GQQ A;  5H6R A;  2VE9 A;  4HBL A;  5DCF A;  2XRO A;  1B9M A;  3QPH A;  2FML A;  4Y15 A;  3R0A A;  4IF4 A;  4FHT A;  1U5T C;  4U0Y A;  2FMY A;  1T2K A;  2ZO4 A;  4LB6 B;  1Q1H A;  5BQT A;  3RDI A;  2QLZ A;  2A6E F;  2VBW A;  3WTX C;  1JGS A;  2E1N A;  3E5Q A;  2HEO A;  4EVI A;  2QWW A;  4JQF A;  1I1G A;  2KRF A;  3K1M A;  2VT3 A;  4N0B A;  4EM2 A;  1XMA A;  3D5L A;  2W85 A;  3TKY A;  4I0A A;  2D1V A;  2HTJ A;  4L9T A;  3V8J A;  2JPB A;  3I59 A;  4PGH A;  3FX3 A;  2DFI A;  4ON0 A;  3BJA A;  2J5P A;  3BDD A;  3DPT A;  4GYG A;  2ACJ A;  3IRR A;  2H6C A;  4YFK F;  3ULQ B;  1KQ8 A;  1G3S A;  2FEZ A;  3GXO A;  4HLX A;  1ZGA A;  2X0L A;  3KLN A;  3WTV C;  3ZP5 A;  5L3D A;  4Q5S F;  3E6D A;  1K79 A;  2HKO A;  3BJO A;  5IT9 Z;  1IN6 A;  1BI3 A;  4EV0 A;  3HOT A;  3L9F A;  4OIO F;  3ECH A;  4HDU A;  2HKX A;  1WRJ A;  4A2U A;  3KZY A;  2ISZ A;  2LDU A;  2JRT A;  4Q47 A;  2AXL A;  1R1U A;  4M73 A;  1EH7 A;  1BI0 A;  3CO7 C;  4F7Z A;  4PCQ A;  5DYM A;  3DP7 A;  2KIM A;  1BJA A;  1K78 A;  3O6B B;  1I6X A;  5E1W A;  1S3J A;  4G8X A;  4G94 A;  2STT A;  2YX4 A;  5E8G A;  4U0V A;  3DKW A;  3RPQ A;  3P9K A;  3U9G A;  1HW2 A;  3TO6 A;  3HYI A;  1IN7 A;  2QUF A;  3GVA A;  2DO7 A;  1B1B A;  1W7P A;  4WXC A;  5CLS A;  3WE2 A;  1B59 A;  2HTS A;  2VOP A;  1XGN A;  2EB7 A;  2RGV A;  2P5K A;  3FMR A;  4S05 A;  1FX7 A;  2WWY A;  1OYW A;  5LHG A;  5ICC A;  2HQR A;  1ZYR F;  4HX8 A;  3DFG A;  3FF5 A;  2PLY A;  2OU2 A;  2QVO A;  3JAM K;  5E8I A;  2GA2 A;  1MZB A;  2FBH A;  4LGW A;  2RDP A;  1O7L A;  1WKM A;  3V7R A;  1FYK A;  1PUE E;  2P5V A;  3D0S A;  1H9G A;  2LNB A;  3CTA A;  2FE3 A;  1TBX A;  1SMT A;  2EFN A;  5D8L B;  1LVA A;  2O03 A;  2EFP A;  4GXO A;  1OR7 A;  3C1D A;  2IJL A;  3K0L A;  2M87 A;  3FXR A;  1FWZ A;  4MTE A;  1FY7 A;  3QU3 A;  4M9Z A;  1KQ9 A;  1JE8 A;  5KVR A;  1IZ1 A;  4ETS A;  3L7W A;  2VBZ A;  3RIR A;  4KFC A;  3R4K A;  1YQA A;  3F21 A;  1LJ9 A;  1FP1 D;  3QOP A;  3TOA A;  1Z7U A;  3IRQ A;  2MLG A;  3TOB A;  1P4A A;  5CYV A;  1R5G A;  5ERI A;  3GO5 A;  1IF1 A;  2ZBK A;  1QPM A;  2HR3 A;  3SHF A;  1HKS A;  4MQ9 F;  1WQ2 A;  1P4X A;  2FRH A;  1BBY A;  3FM5 A;  1ZAO A;  1W4M A;  4M71 A;  3GZ5 A;  2XHK A;  2HGC A;  2EV6 A;  2ZXJ A;  3H3Z A;  1BIB A;  4M6Y A;  4OIQ F;  3GYH X;  2MD5 A;  1Z6T A;  1LNW A;  1ZLJ A;  1TQP A;  2HOE A;  4PZJ A;  4JBA A;  3WGH A;  4BAY A;  4ESF A;  4LLG F;  4I7H A;  2K4B A;  1OYY A;  3DEU A;  4BHB A;  2ZME A;  4N9H A;  4KMU X;  4I09 A;  4BQA A;  2L3D A;  3I0T A;  2E7W A;  2XAG A;  3VEP A;  3IKV A;  4L9J A;  1D8J A;  3I59 B;  2MH2 A;  2FSW A;  2OQG A;  2Q8K A;  1EH8 A;  2ELH A;  3FMS A;  1G4D A;  2CGP A;  5FLX K;  3N4M A;  1O57 A;  3J7A O;  2BBY A;  3PQJ A;  3I58 A;  4DQ2 A;  2IA2 A;  3K1N A;  1LDD A;  2H94 A;  3WTS C;  3HTS B;  2JZY A;  1YLF A;  4UXN A;  1SFE A;  2M1B A;  3JAM Z;  4M9X A;  3F8B A;  3M1E A;  5LRS A;  1FBS A;  1Z91 A;  1OPC A;  1ON1 A;  3B73 A;  2O3F A;  4EM1 A;  1ON2 A;  2QM3 A;  1TQI A;  5DCM A;  3DF8 A;  3E6C C;  1O3R A;  3FZV A;  3RI4 A;  1PP7 U;  3I4P A;  1XGM A;  1T39 A;  2Z3Y A;  4EQQ A;  1O3S A;  3EDP A;  2MLK A;  4HF2 A;  3V7C A;  2P5L C;  1U6G A;  3CJN A;  3WU1 B;  2KJB A;  3IC7 A;  2YSR A;  1FNN A;  1K78 B;  2R7D A;  4UVC A;  1R58 A;  2M45 A;  4LMY A;  2L01 A;  4RB3 C;  4GO1 A;  4WF2 A;  4EGZ A;  2QYO A;  1SFX A;  1SMY F;  2QBY A;  4KIC A;  3IKT A;  2IT0 A;  4AWX B;  5HVQ C;  3ZN0 A;  1AWC A;  4ZH4 F;  2DU9 A;  2BYV E;  2A68 F;  2ZCW A;  1U3E M;  2DAO A;  1TW2 A;  2K4J A;  1ZH5 A;  3MQ0 A;  4AIH A;  5J8C A;  2XAF A;  3KP6 A;  4YFN F;  2F2E A;  2RKH A;  4EGY A;  2DPD A;  2VN2 A;  4I2O A;  2O0Y A;  3IWZ A;  4CHU A;  3KCC A;  3LA3 A;  4RGX A;  4HAM A;  4WK8 F;  1ZG3 A;  1FSE A;  3GLX A;  1MKM A;  2G9W A;  1XB4 A;  3HIF A;  4AVP A;  2C6Y A;  1STZ A;  2IW5 A;  3HSE A;  1FOK A;  1BC7 C;  4R1H A;  3KZZ A;  2HQN A;  4P96 A;  3F8N A;  3EYI A;  2OZ6 A;  3TGN A;  1S6L A;  3I53 A;  4UVB A;  4UNO A;  2EV0 A;  1CF7 A;  5DV5 A;  5HS8 A;  1OMI A;  2XAQ A;  1U5T B;  4RGS A;  1PDN C;  4OIN F;  3KEO A;  4ZYE A;  3GFI A;  3KP4 A;  1YW7 A;  3ZMU A;  4BHP A;  4OU0 A;  4G9Y A;  3DXJ F;  2CQK A;  2VC0 A;  2HYF A;  4P9F A;  4MHG A;  1TLH B;  1T0F A;  2EA2 A;  1CGP A;  1ULY A;  5LBQ A;  2UXN A;  1L0O C;  3U1D A;  1JHF A;  3QPT A;  5ILS A;  2ESN A;  2XKP A;  4RB2 C;  3MEX A;  3FXQ A;  5D6E A;  4Z2Y A;  1T98 A;  1HST A;  5LHI A;  4MGR A;  2VXZ A;  1B4A A;  2IPQ X;  3W6J B;  1BM9 A;  1ODD A;  3WTT C;  4A0X A;  4LJZ F;  1UCR A;  4KUM A;  2IP2 A;  3RYR A;  3K2Z A;  1SAX A;  4L5J A;  1BOA A;  3O3K A;  4OIR F;  3ZMV A;  4B09 A;  2ZME B;  4XRF A;  5ICG A;  3G3Z A;  1SFU A;  2PQ8 A;  1GXQ A;  1HBX G;  2K86 A;  2Z9O A;  3HTU A;  1QO0 D;  3L00 A;  4CZZ A;  2XUB A;  4LG0 A;  4JK1 X;  5LHH A;  2GXG A;  3K69 A;  5K5Q A;  5E1X A;  3OV8 A;  5E17 F;  1QQI A;  1YS6 A;  2F5F A;  3ZMD A;  4UUV A;  4GGG A;  1G6N A;  1KU9 A;  4WCG A;  3DV8 A;  3U2R A;  5L3B A;  3RKY A;  2GAU A;  3T0Y A;  2F5D A;  1VTN C;  1Z9C A;  4RAY A;  1IXC A;  3KET A;  3KFW X;  2FXA A;  5DCM B;  3H3U A;  1GHC A;  3H92 A;  4HDV A;  3R60 A;  1R00 A;  1RZ4 A;  5J6X A;  2CFX A;  3NQO A;  1K6O A;  2HYG D;  5LGU A;  1HQC A;  1Y0U A;  1Z05 A;  5TRD A;  2XV4 S;  3ROU A;  4OMZ A;  4R79 A;  1P92 A;  1SD7 A;  3OOP A;  2EFQ A;  5DD8 A;  5H6Q A;  3F6O A;  4CO8 A;  3IL2 A;  2L02 A;  2QBY B;  1REP C;  1V3F A;  5L3F A;  5CJ9 A;  3BRO A;  3MCZ A;  5BOX A;  3ERE D;  4HV5 A;  1QZY A;  2FF4 A;  2ISY A;  1RIO H;  3Q9V A;  5D4R A;  1IUY A;  3NRV A;  3FM3 A;  2MC3 A;  2NNN A;  4MNU A;  3F72 A;  6PAX A;  5CVU A;  5FB2 A;  4EMS A;  1XGO A;  5E20 A;  4K2E A;  3E5X A;  1YFH A;  3REO A;  3TO9 A;  5FD6 A;  3QU6 A;  3F23 A;  5LGT A;  5CVJ A;  4U7B A;  5HLH A;  1GVJ A;  4EJU A;  5AIP A;  1J5Y A;  2CW0 F;  3ZMZ A;  1YTY A;  1FT9 A;  1ZAR A;  2P8T A;  3KEQ A;  4HA8 A;  1QGP A;  2JPC A;  2WC2 A;  1BI2 A;  3I64 A;  1UHM A;  4FX0 A;  2Y75 A;  3C3W A;  2F5E A;  3GUD A;  4KT5 C;  3HRS A;  4L18 B;  2W84 A;  2FBI A;  3BJ6 A;  3ZPL A;  2ZFW A;  2STW A;  1P2F A;  1LQ1 A;  4HF1 A;  3TDU C;  3KP2 A;  2KIF A;  4OOI A;  2A69 F;  4ZYH A;  3VOE A;  4G6D A;  1G3W A;  3V8K A;  1R36 A;  1QNT A;  4KYW A;  3SZT A;  3FXU A;  3R6S A;  5A2Q K;  2RN7 A;  1I1S A;  1U78 A;  5LLQ A;  3CUQ B;  5BMZ A;  1E17 A;  2YU3 A;  4HW0 A;  4ENJ A;  2M8E A;  3LST A;  2PN6 A;  2BE5 F;  1IW7 F;  3J80 K;  4ASN A;  4CDG A;  5ILV A;  1HW5 A;  4H0E A;  5ED4 A;  2FU4 A;  5JFR A;  4P55 A;  3BZ6 A;  1C0W A;  4CGZ A;  2BGC A;  5H20 A;  2DK5 A;  2XGX A;  1W5S A;  2WTE A;  2Z33 A;  3P9C A;  3E97 A;  3HUG A;  2YR2 A;  4ZZL A;  1RNL A;  4IXA A;  1XN7 A;  2A5Y B;  3HSF A;  4L9N A;  4LG0 B;  3MZY A;  1MGT A;  1TNT A;  1HW1 A;  2V1X A;  4CYD A;  3I71 A;  3F8F A;  1P6R A;  3WU0 A;  5HDK A;  2VC1 A;  2IA1 A;  3T1B A;  3BPV A;  3SXY A;  5FO5 A;  2FNA A;  4ENM A;  3BOQ A;  4IHT A;  3K9T A;  2IRF G;  3DPL C;  3QP6 A;  2DQR A;  5JVT A;  4BNC A;  3CUQ C;  1GXP A;  1WI9 A;  2P6T A;  2OA4 A;  4RS8 A;  3HOS A;  1FYM A;  2QZ8 A;  5L3G A;  1ZG5 A;  2PMH A;  1U2W A;  1IXR C;  1G3T A;  2QEN A;  1BN5 A;  5D5U B;  3IHU A;  3NEU A;  1F9N A;  5FFX A;  1NHA A;  1MJB A;  1J9I A;  2DK8 A;  2GXB A;  5LRR A;  4O3M A;  4NB5 A;  2EFO A;  4I98 B;  4MEY F;  4TV7 A;  2JSC A;  3QP5 A;  2D2W A;  1G3Y A;  2NYX A;  4LFU A;  1R7J A;  3WTW C;  4L0Y B;  2O8X A;  3LQR A;  4IJA A;  4QWQ A;  5JHU A;  3IWF A;  1LDJ A;  4WWC A;  1TQM A;  3DQV C;  4YFX F;  5A2Q Z;  3K1P A;  1W7P B;  5ICE A;  2K7L A;  4RGR A;  1KYZ A;  1YIO A;  1R1T A;  1KU3 A;  2AS5 F;  1O7F A;  1X3U A;  3J80 Z;  2V79 A;  1FZP B;  1IN4 A;  3MFK A;  4GCV A;  1QZZ A;  2EWN A;  4ZYG A;  1F1Z A;  4N9I A;  1E2X A;  4UV8 A;  1H9T A;  4MQV A;  3CUO A;  2EV5 A;  3ZQ7 A;  3PQK A;  1S7A A;  3RTR A;  1I5Z A;  1IN8 A;  2QQA A;  2R3S A;  4L0Z B;  5HDG A;  3GEZ A;  1OKR A;  2CYY A;  2OZU A;  2L4M A;  4XBF A;  1OYI A;  5LEK A;  2V1U A;  4A0Z A;  2D45 A;  3KE2 A;  4P5O A;  2A07 F;  2Y48 A;  2PI0 A;  1SD4 A;  2TDX A;  4EM0 B;  5D5W B;  2D1H A;  3N97 A;  1B9N A;  5LEJ A;  5BPD A;  3I54 A;  2VON A;  1JHH A;  4HQM A;  3WTY C;  3V7S A;  5LGN A;  4IVN A;  4U7D A;  1J75 A;  3WTU C;  3MAJ A;  4M9S A;  2XKO A;  5FLX Z;  4HQE A;  1ZLK A;  3ZN1 A;  4KMF A;  2XAJ A;  5K1Y A;  5HLI A;  4RGU A;  2PMU A;  5IT9 K;  5E18 F;  4RB1 A;  3I5U A;  1I27 A;  4NQW A;  1R23 A;  1R5H A;  4Q48 A;  1TW3 A;  4EJV A;  3JSO A;  3F8C A;  3HRU A;  3E6B A;  5L3E A;  2MBF A;  2QQB A;  3GW2 A;  2BV6 A;  1T6S A;  1ZN2 A;  5ILU A;  3TQN A;  4CIC A;  2CSO A;  4O5V A;  1D3Y A;  4UVA A;  3HRM A;  3BP8 A;  1SD6 A;  4AD9 A;  2ETH A;  1RI7 A;  3GX4 X;  2MA3 A;  1KU7 A;  3KP3 A;  1B6A A;  5JR3 A;  1S7O A;  2GA1 A;  1O3T A;  4NHJ A;  4R8H A;  3TDZ C;  1R1V A;  2CO5 A;  2H09 A;  4I01 A;  1J59 A;  2B0L A;  4EJO A;  2O61 A;  3T8T A;  4A5M A;  1RUO A;  4Q4Z F;  4ENK A;  5EEH A;  3V4G A;  2K02 A;  2LF8 A;  4AIJ A;  3E3V A;  1YS7 A;  3SQN A;  1ZRF A;  3GF2 A;  1QBJ A;  5CVR A;  3G73 A;  3KP7 A;  4XLP F;  2DT5 A;  3Q5F A;  2DLL A;  2VOO A;  1HXD A;  1W5T A;  5D8K B;  4G6Q A;  1WWX A;  1DP7 P;  4WX9 A;  4IRH A;  5F64 A;  2UZK A;  2W24 A;  2F5C A;  1BI1 A;  1IAW A;  2Q0O A;  2A3S A;  2HFH A;  2NS0 A;  2GWR A;  5DUI A;  1YYV A;  5L3C A;  3RJP A;  3AAF A;  1BC8 C;  4U88 A;  1WSU A;  1KGS A;  4RB0 A;  5HS9 A;  2EJR A;  3O2P E;  1KQ0 A;  2PBI A;  4A6D A;  2GZW A;  2RQP A;  1XGS A;  4P9U A;  1D8K A;  2ZKZ A;  2VBX A;  3BPX A;  2G7H A;  1FPQ A;  4KNY A;  2E7X A;  4EJT A;  2RVC A;  3SFZ A;  3L09 A;  2DQL A;  4Y17 A;  1J2X A;  2OAZ A;  1DPU A;  3CLO A;  2ZNY A;  4UV9 A;  1BIA A;  5F6F A;  3LAJ A;  2O6G E;  1FBU A;  2FBK A;  1S8N A;  4A6E A;  2UWM A;  5HLG A;  4HOB A;  5ICF A;  1MD0 A;  3ABT A;  3RKW A;  1FSH A;  1XDS A;  5FFZ A;  4L5I A;  2RV8 A;  3VOD A;  4M6X A;  1UFM A;  3B02 A;  3LQQ A;  2V9V A;  2FOK A;  2ESH A;  2X4H A;  3LA7 A;  5KK1 A;  3LAP A;  4BH9 A;  2H6B A;  2M30 A;  2MH9 A;  4BYY A;  1J0R A;  1IXS B;  2J5O A;  5DUK A;  1FC3 A;  3J81 K;  4A0Y A;  4M72 A;  4PGG A;  1ZG1 A;  3LFK A;  4EJW A;  5AIQ A;  4KIG A;  2Z5U A;  5HOO A;  3FHZ A;  1EH6 A;  4YII A;  1RUN A;  1CF7 B;  2PJP A;  3EET A;  1MJ9 A;  2HDC A;  1LB2 A;  1P4W A;  1YW8 A;  2WV0 A;  4KDP A;  5TJJ A;  1LDK B;  4D0P A;  2PG4 A;  2IVM A;  1DPR A;  4HZF A;  4HF0 A;  1LEA A;  4AIK A;  4LK1 F;  3WGI A;  4KN7 X;  1ZRD A;  2M5W A;  1XSX A;  3QRF F;  3FMQ A;  2E1C A;  2RNJ A;  2JT1 A;  5K5O A;  2QQ9 A;  3V8L A;  4HX7 A;  2NNY A;  3T8R A;  1DDN A;  3JTH A;  5DEQ A;  5IT3 A;  4DNC A;  4LLL A;  3M8E A;  3WGG A;  1O3Q A;  1XMK A;  2YX7 A;  2LF7 A;  4HYE A;  2K27 A;  1TNS A;  2EFW A;  3EQL F;  3MWM A;  4MTD A; 
#chains in the Genus database with same CATH topology
 5DD4 A;  2VPL A;  1HKQ A;  4GRI A;  1MMD A;  4G7Z F;  1QPI A;  1ZHF A;  1V4R A;  4G7O F;  3ZMS A;  3ABU A;  2WAE A;  1IRG A;  2P7V B;  2HWV A;  1U5T A;  4DZP A;  3E6M A;  3JRB A;  1DGR M;  3C2B A;  3JW4 A;  2CUF A;  5D4S A;  1Y56 A;  4M3D A;  3GTQ J;  1Y1V J;  2EIJ H;  4S04 A;  3S3M A;  1YW9 A;  3CF2 A;  3S32 A;  1J7K A;  2CV1 A;  2HNH A;  3K4J A;  3TO7 A;  3CME I;  2FOW A;  3F8M A;  3HRT A;  1V5E A;  2VE8 A;  3RKX A;  4PDK A;  4F92 B;  3E5U A;  4KT6 A;  4Y13 A;  1OCC H;  1FLI A;  4WXH A;  3PFI A;  2L7F P;  2NAZ A;  2WBM A;  2M7A A;  3Q0W A;  4LLN A;  3VSK A;  4LD5 A;  3M3Y J;  2O5R A;  3OYE A;  3EUH A;  1LFP A;  4LK0 F;  3W2W A;  4ZZD A;  2DI3 A;  2HZT A;  4YG2 F;  2HVS A;  4L9V A;  4Y4R A;  4HV6 A;  2JTV A;  2CRG A;  3BWG A;  2LY2 A;  3JRC A;  4M74 A;  2DW4 A;  3MZH A;  1DUX C;  1UHS A;  2HOA A;  5BS6 A;  3H5A A;  2KIU A;  2VBY A;  2CG4 A;  2Z16 A;  2R93 J;  1ZRE A;  3ISP A;  4XR6 A;  3OYD A;  2H27 A;  3AG2 H;  1SAU A;  3L2C A;  4KA4 A;  2BW3 A;  5CKT A;  3HM5 A;  1ZGJ A;  2EA4 A;  3K7A J;  2DPU A;  3GTL J;  4BHC A;  1N25 A;  1MBK A;  4C2U A;  5JI6 A;  1XCB A;  2L9N A;  3VB2 A;  3LA2 A;  1U8R A;  2Q2E A;  1TWG J;  3ASN H;  4HX4 A;  1MDM A;  3D5R C;  2P4W A;  2Y0M A;  1WJC A;  3CO6 C;  4B47 A;  5B5E C;  4II3 A;  3ECO A;  4JX5 A;  1HOM A;  2DA2 A;  1APL C;  2XF7 A;  1NK3 P;  1F43 A;  3H9Q A;  2XVC A;  3TW7 A;  3COA C;  3S1R J;  4XSX F;  3A02 A;  3VFZ A;  1VQ8 I;  4OIP F;  2XAS A;  3JSP A;  1JI8 A;  3WTZ A;  5CVI A;  1T56 A;  3J81 Z;  3DTE A;  4NBQ A;  2JWT A;  5J8F A;  3A01 A;  3S2W A;  4B1R A;  3CCS I;  1MW7 A;  1D5V A;  4GYI A;  4ZDL A;  4XSZ F;  1UAA A;  1UB9 A;  1POG A;  1YO5 C;  1DQU A;  2HDW A;  3HHG A;  2HDD A;  4FX4 A;  1IDY A;  3OIP A;  4WXD A;  3ZXS A;  5E1Z B;  4PFO A;  5KNL A;  2DA5 A;  3J7A Y;  3T5X A;  3KLO A;  2NVY J;  1LE8 A;  3CP8 A;  2OD5 A;  1PP8 F;  1F36 A;  2IGK A;  2X85 A;  2GIV A;  2NRA C;  3CC4 I;  3ELK A;  4B48 A;  3GTG J;  3K2A A;  1LEB A;  2EK5 A;  3RYP A;  2R7T A;  4ENN A;  2FQ3 A;  3OS0 A;  2R7W A;  3Q0U A;  1V5F A;  5FGM A;  2BEO A;  3A2K A;  4A5N A;  2HU9 A;  5M3F J;  2Y9Y A;  3CCY A;  5D6F A;  3CDH A;  3AKZ A;  5AON A;  1A04 A;  1FIP A;  4BQN A;  2LMD A;  4I02 A;  5E3M A;  3JRD A;  3QAH A;  5HDN A;  2R0Q C;  5IPA A;  1V55 H;  2ZNZ A;  3M8F A;  1JJ8 C;  4XKW A;  3ZQC A;  4E7K A;  4IRG A;  4PSW A;  3WU2 C;  1K61 A;  4IHW A;  1AOY A;  5FD5 A;  1Q1V A;  5J1U A;  2WAQ N;  3GZ6 A;  1S72 I;  1DP3 A;  1MBH A;  2EQR A;  3K70 D;  2XAU A;  4XKB A;  1R6R A;  1XSV A;  2BHY A;  3FXJ A;  3GFL A;  1TTY A;  5DDG A;  1HSJ A;  2DT6 A;  2W25 A;  5M5X J;  2OBP A;  5C44 J;  1H0M A;  2A61 A;  4KN4 X;  2XB0 X;  3ABK H;  1SD5 A;  3FWE A;  2R7F A;  4DOZ A;  1USS A;  3VDX A;  2PEX A;  3GFJ A;  3GZN B;  3P7N A;  1UHW A;  1ZKG A;  1UEL B;  2CQ7 A;  2R7O A;  1FBQ A;  2HXI A;  2WV1 A;  2CWE A;  3WG9 A;  3OYH A;  2AQE A;  3K4K A;  5FRM A;  2DBB A;  4XLN F;  4U0W A;  4KIB A;  3JRE A;  4A3B J;  5EDN A;  3BY6 A;  2FNP A;  2PJR B;  5GPC A;  3BCA A;  3C7J A;  3L2Q A;  3GWZ A;  4YIF A;  2ADU A;  3BT9 A;  2EH3 A;  5K5R A;  4OMY A;  3HG9 A;  4CCO A;  1V5G A;  2VQG A;  2V1D A;  3OS2 A;  3M9A A;  3KP5 A;  1OCP A;  1KU2 A;  2M3A A;  5E79 C;  1FYL A;  2R7Z J;  2HS5 A;  1JXS A;  3R61 A;  2HI3 A;  1IN5 A;  1EKE A;  3JTG A;  1T38 A;  2P7C B;  4MEX F;  3G1M A;  1SVL A;  2P81 A;  3DEE A;  3EUA A;  3EUK L;  2W4S A;  4LB5 A;  4UY8 I;  4CZC A;  2BXZ A;  4LIU A;  3EYY A;  3HSR A;  3W3C A;  2IS1 A;  2VKD A;  5EEG A;  5J4V A;  1H8A C;  1PYV A;  4BXU A;  1IRF A;  3CJR B;  4C3I J;  3WOD F;  1K6Y A;  5TIS C;  1L3L A;  2DXI A;  1XSD A;  2GM4 A;  1XCV A;  2RC4 A;  4E70 A;  5D5X B;  4ESJ A;  2RRE A;  2F4O B;  3KYL A;  3OL3 A;  4FTH A;  2COM A;  2VT2 A;  2W7N A;  1K7A A;  4IKF A;  3M4O J;  5D5V B;  1KYW A;  5BPI A;  1TWH J;  1IG7 A;  1S29 A;  2G7U A;  5F1R A;  1B72 B;  3OYL A;  2ZC2 A;  3G1O A;  4CXF A;  2ZJ2 A;  1JTX A;  2XRN A;  4FT8 A;  2OTL I;  4HLY A;  3FK6 A;  3H0G J;  4DIQ A;  2V7F A;  2X1E A;  2K9Q A;  2DFH A;  4UHT A;  1XDU A;  3BG7 A;  2PFB A;  4IPA A;  4PK4 A;  4XLC A;  2BOL A;  2VAS A;  1JTY A;  3OY9 A;  1Z6R A;  3HEF A;  5EZG A;  2LSO A;  1FP2 A;  1KA8 A;  1LUJ B;  1V54 H;  3F6V A;  3GBG A;  2KJC A;  5FLM J;  2FA5 A;  1Z1D A;  2FD5 A;  3Q9S A;  4ZYA A;  1VQ7 I;  2IA0 A;  4PJM A;  2VJI A;  4ZYD A;  3R0J A;  3JCU C;  3D1N I;  2KKO A;  4O6J A;  2V6C A;  3OYK A;  4N4O B;  4FE7 A;  5JHF A;  2W57 A;  4A3F J;  2UXX A;  2E1O A;  1IJW C;  2R7V A;  3LWF A;  1HKT A;  1EV7 A;  2NVU B;  3CCJ I;  4NC8 A;  1TT0 A;  5HOD A;  2D5V A;  3P9I A;  1Z3X A;  4DGW B;  2WY7 Q;  3CCE I;  1X1A A;  1MSF C;  1R22 A;  2LKP A;  1F4K A;  1XD7 A;  2LYC A;  3BR0 A;  3HHH A;  2M8G X;  3SEZ A;  4B8X A;  2E5Z A;  2L4A A;  4I0B A;  4IHS A;  3S2H J;  2L54 A;  2XIG A;  5CVV A;  3DLL F;  3PFY A;  1D0X A;  3LMM A;  1F5T A;  1ETK A;  4BKX A;  3F22 A;  5HS7 A;  2ECB A;  2XAH A;  2B7E A;  3WE3 A;  2OQR A;  2K9S A;  4KIF A;  3C18 A;  3AFH A;  1DGW Y;  3P5J A;  3SFI A;  4D9J A;  4DZJ A;  3CUQ A;  2P6S A;  4XNF A;  3OYB A;  4ESB A;  2YPR A;  2Z99 A;  1D1A A;  1VQ5 I;  5CQE A;  3H9J A;  3ZMT A;  3GLL A;  3GFM A;  3SYT A;  3FXM A;  2DTR A;  1UST A;  2WB1 N;  3RSN A;  4DJA A;  2A6H F;  3ML6 A;  1MJA A;  4A12 A;  4IEJ A;  3OR1 C;  1ONV A;  2F4M B;  1YG2 A;  3D5S C;  4NUB A;  2VOD A;  3RPU A;  1U8B A;  2Q2E B;  1ZRC A;  3SZP A;  4J01 A;  3W6K B;  3PNV A;  2VJ5 A;  4RAZ A;  2V6E A;  1XS9 A;  3F3X A;  1KON A;  4BDY A;  1MDM B;  4XN0 A;  4QLC U;  1W7P D;  4G7H F;  3M7G A;  4IRI A;  2GQQ A;  5H6R A;  5F27 A;  1TT5 B;  5M5Y J;  1ETQ A;  4HBL A;  2VE9 A;  1NK2 P;  3HOZ J;  2JA8 J;  5DCF A;  1N75 A;  1U9O A;  2XRO A;  1B9M A;  1S7E A;  3QPH A;  4RBO A;  2I5U A;  2FML A;  4XKC A;  3FDY A;  3BTL A;  2ZB9 A;  4Y15 A;  3AG1 H;  3R0A A;  4D7N A;  4IF4 A;  4FHT A;  1U5T C;  4U0Y A;  1LKX A;  2FMY A;  3LSR A;  2ZO4 A;  3A01 B;  4LB6 B;  1T2K A;  1Q1H A;  4BS9 A;  5BQT A;  2E5N A;  3IAM 2;  3RDI A;  4YRV A;  3OYM A;  2QLZ A;  2MC4 A;  2A6E F;  4RDU A;  1AA7 A;  4BXX J;  1VQK I;  5IOY A;  2BY3 A;  2VBW A;  3WTX C;  1JGS A;  2E1N A;  3E5Q A;  4XLA A;  3PUB A;  1LVK A;  2HEO A;  4EVI A;  2EZH A;  2KIS A;  2QWW A;  1XG1 A;  4JQF A;  1I1G A;  2KRF A;  3K1M A;  4BBR J;  2VT3 A;  2JK3 A;  4N0B A;  4IHX A;  4MIM A;  4EM2 A;  1LE8 B;  1XMA A;  4NDL A;  5KCM A;  3ZOB A;  3JR9 A;  3D5L A;  2DOA A;  2W85 A;  3TKY A;  2VKH A;  4P1W A;  4I0A A;  2LVS A;  3EUH C;  2D1V A;  2HTJ A;  4L9T A;  3V8J A;  5C4X J;  4F55 A;  2JPB A;  3OL4 A;  3KZI C;  2KFD A;  3I59 A;  4PGH A;  3HL2 A;  3FX3 A;  2DFI A;  4ON0 A;  4MO7 A;  3BJA A;  2J5P A;  1VQ6 I;  2VKE A;  3BDD A;  5EG0 A;  4XOT A;  4ZJZ A;  1TZL A;  1P7J A;  3HPG A;  5FLV A;  3Q0V A;  1UG2 A;  3DPT A;  4GYG A;  2KT0 A;  3LNQ A;  2ACJ A;  3IRR A;  2H6C A;  3CDL A;  4YFK F;  1P7I A;  1TWF J;  3QPS A;  3ULQ B;  1KQ8 A;  1G3S A;  2FEZ A;  2RQQ A;  3GXO A;  3GTO J;  3QYE A;  4HLX A;  1ZGA A;  1QVU A;  3OIO A;  2X0L A;  3KLN A;  4PJN A;  5FRO A;  1RR8 C;  3WTV C;  3ZP5 A;  4B3A A;  2VKV A;  2K5C A;  5L3D A;  4Q5S F;  2EIK H;  3NWT A;  3BR5 A;  3E6D A;  5GAD J;  2HKO A;  4E4H A;  3BJO A;  4QTR A;  1K79 A;  1BW5 A;  4E7I A;  4BE0 A;  5IT9 Z;  1IN6 A;  1BI3 A;  4EV0 A;  3HOT A;  3U1K A;  3L9F A;  2HZD A;  4OIO F;  1YIT I;  3ECH A;  4HDU A;  2HKX A;  1WRJ A;  1IV8 A;  1EF4 A;  4A2U A;  3KZY A;  2ISZ A;  2DYR H;  2LDU A;  3FIS A;  3LSK A;  4UB8 C;  2VB6 A;  2JRT A;  2COB A;  4Q47 A;  2AXL A;  1TP4 A;  1R1U A;  2VL8 A;  3CCR I;  4M73 A;  5F08 A;  1EH7 A;  1IC8 A;  2ME6 A;  2HOT A;  3S15 J;  2ZJQ F;  2BVL A;  1BI0 A;  1YI2 I;  1D5Y A;  5E3L A;  3CO7 C;  1QHG A;  2EZI A;  4F7Z A;  1VQL I;  1E3H A;  1FOX A;  4PCQ A;  3VPR A;  5DYM A;  3DP7 A;  4ZTF A;  2KIM A;  1BJA A;  5TGT A;  2IS6 A;  2QF7 A;  1K78 A;  3O6B B;  1I6X A;  1WJB A;  5E1W A;  1S3J A;  4G8X A;  3LFU A;  2IGO A;  4G94 A;  2STT A;  2YX4 A;  5E8G A;  4U0V A;  2IAI A;  3DKW A;  2V26 A;  3RPQ A;  4XLF A;  2H8R A;  3DTI A;  3P9K A;  2KMU A;  3A03 A;  3U9G A;  1HW2 A;  3TO6 A;  1OCZ H;  3HYI A;  3K4B A;  3L2U A;  1IN7 A;  2QUF A;  1JJ6 C;  1BJZ A;  4FAS D;  3GVA A;  2DO7 A;  1B1B A;  1W7P A;  4WXC A;  5CLS A;  3WE2 A;  2JUG A;  1B59 A;  2HTS A;  2LY1 A;  2VOP A;  1XGN A;  2EB7 A;  2RGV A;  1ETX A;  2NVT J;  2P5K A;  2JA7 J;  2NVX J;  3FMR A;  4XKV A;  1A5J A;  2M7B A;  4S05 A;  2VQH A;  1FX7 A;  2DTZ A;  2WWY A;  1OYW A;  1IO2 A;  5LHG A;  1MBF A;  5FKM A;  5ICC A;  3DU5 A;  2HQR A;  1ZYR F;  1QRY A;  4HX8 A;  3BG9 A;  3HKZ N;  3DFG A;  1W36 C;  3FF5 A;  2Y0S N;  2PLY A;  3IV5 A;  2OU2 A;  4RMN A;  2QVO A;  5DTD A;  3JAM K;  3M07 A;  5E8I A;  2VLA A;  3E7L A;  1K4T A;  2GA2 A;  1MZB A;  2FBH A;  3K4M A;  1FEX A;  2LP0 A;  1MBJ A;  4LGW A;  1WH7 A;  2RDP A;  4ANJ A;  3RQI A;  1O7L A;  1WKM A;  2KRH A;  1RKW A;  3V7R A;  5DS9 A;  1FYK A;  1PUE E;  3DTK A;  2DDA A;  2P5V A;  5GTH C;  3KEY A;  3D0S A;  1H9G A;  2LNB A;  3CTA A;  4IX7 A;  2FE3 A;  1TBX A;  3KIO A;  1SMT A;  2EFN A;  5D8L B;  1LVA A;  2O03 A;  3I9V 2;  1ZTR A;  2M2E A;  5IYB J;  3OS1 A;  2O8K A;  2EFP A;  4GXO A;  1OR7 A;  3C1D A;  1XX5 A;  3L1P A;  2B63 J;  4V19 K;  2IJL A;  3K0L A;  1WHU A;  2M87 A;  3BQY A;  2BY0 A;  3FXR A;  3FIW A;  2DA7 A;  1FWZ A;  4MTE A;  1FY7 A;  1H89 C;  2DMT A;  2ZXI A;  1WJ5 A;  2QCO A;  3QU3 A;  2VQL A;  3K6G A;  4M9Z A;  1KQ9 A;  3CCV I;  2GOM A;  1JE8 A;  1N78 A;  5KVR A;  1IZ1 A;  4ETS A;  3L7W A;  1D1B A;  1G8X A;  2VBZ A;  3RIR A;  4KFC A;  5JLW A;  3R4K A;  2CQQ A;  1YQA A;  4QIW N;  3F21 A;  1PJR A;  1LJ9 A;  1FP1 D;  2HVQ A;  3QOP A;  2L5Q A;  3LOC A;  3TOA A;  4Y7N J;  2OJE D;  3N05 A;  1Z7U A;  2L2O A;  3IRQ A;  2MLG A;  4AUX A;  2NVQ J;  2V9P A;  3RQ4 A;  3TOB A;  1T08 B;  4M3B A;  1P4A A;  1VI0 A;  1YHQ I;  5CYV A;  3CCL I;  1R5G A;  4UUS A;  5ERI A;  3GO5 A;  3E1S A;  2ZBK A;  1IF1 A;  3G4S I;  2DFE A;  1QPM A;  2HR3 A;  3SHF A;  5GAE J;  1HKS A;  1YX5 A;  1WQ2 A;  2OPT A;  4MQ9 F;  3S1Q J;  2EIM H;  1P4X A;  4CCL A;  2FRH A;  1BBY A;  3CCQ I;  3FM5 A;  1ZAO A;  3C2G A;  4D7M A;  1RPW A;  1W4M A;  5J1Y A;  3JRH A;  4M71 A;  3GZ5 A;  2XHK A;  5FKL A;  1R9T J;  1A6I A;  2EV6 A;  2HGC A;  2ZXJ A;  3H3Z A;  1BIB A;  4M6Y A;  4OIQ F;  3GYH X;  2MD5 A;  1Z6T A;  1LNW A;  1ZLJ A;  1TQP A;  2HOE A;  4PZJ A;  4JBA A;  3SEQ A;  4HRI A;  3WGH A;  1WZ2 A;  2Y0S A;  4BAY A;  2DOE A;  1NG7 A;  4ESF A;  4OWR B;  5CPR B;  4ZTJ A;  2XGE A;  4LLG F;  4I7H A;  2K4B A;  2JVH A;  2VPR A;  5IYD J;  1OYY A;  5C4J J;  2VJ4 A;  3DEU A;  4BHB A;  2R92 J;  1A36 A;  2ZME A;  4N9H A;  3JRI A;  4BQO A;  4KIT B;  3OYI A;  4IQ4 A;  4KMU X;  3CZ6 A;  1HA8 A;  4I09 A;  4BQA A;  2L3D A;  3I0T A;  1JKO C;  2E7W A;  2XAG A;  3VEP A;  3IKV A;  3W6V A;  4L9J A;  1JUP A;  1D8J A;  3HPH A;  3PUF A;  3I59 B;  4S0H B;  3IH2 A;  3K70 C;  3CMA I;  2MH2 A;  2FSW A;  2OQG A;  3AL0 B;  5EG0 B;  2R5Z A;  2Q8K A;  1EH8 A;  2ELH A;  3FMS A;  4AM3 A;  1G4D A;  2KL4 A;  2ZXH A;  2CGP A;  1DU6 A;  5FLX K;  3N4M A;  1O57 A;  3J7A O;  2BBY A;  1HDP A;  2NOG A;  3IP4 B;  3PQJ A;  3I58 A;  3HOU J;  4DQ2 A;  4PJL A;  2IA2 A;  2B9S A;  2OF7 A;  3BG5 A;  3K1N A;  1LDD A;  2H94 A;  2ICW G;  2OCE A;  5KAI C;  5BNG A;  1FTZ A;  1UMQ A;  2CQX A;  3WTS C;  3HTS B;  2JZY A;  1YLF A;  2TCT A;  4UXN A;  3IH4 A;  1SFE A;  2DT7 B;  2M1B A;  3JAM Z;  2DN0 A;  3F8B A;  3M1E A;  4M9X A;  5LRS A;  2GBY A;  2DCE A;  1FBS A;  1WPK A;  1Z91 A;  1HF0 A;  1OPC A;  1ON1 A;  3B73 A;  2CV2 A;  2O3F A;  4EM1 A;  4E7H A;  1ERD A;  1ON2 A;  2QM3 A;  1TQI A;  5DCM A;  2KQR A;  3DF8 A;  3E6C C;  1O3R A;  3FZV A;  3RI4 A;  2E34 A;  1FOY A;  2WY8 Q;  1PP7 U;  3I4P A;  4HNU A;  1FTT A;  2CS3 A;  1QVT A;  1XGM A;  1T39 A;  2IGM A;  2Z3Y A;  3DLA A;  4EQQ A;  1O3S A;  3EDP A;  4ITV A;  1WI3 A;  1M1E B;  2MLK A;  1S9H A;  3H35 A;  4HF2 A;  2KZV A;  2MSY A;  1PVE A;  1EA3 A;  3ABL H;  2ECC A;  3V7C A;  2A6T A;  2P5L C;  1U6G A;  4N4N B;  1UZC A;  1VQ9 I;  3CJN A;  3WU1 B;  3GTJ J;  1X2N A;  3GCM A;  2KJB A;  3IC7 A;  2YSR A;  1FNN A;  4BL0 B;  1K78 B;  2R7D A;  4UVC A;  1RES A;  3FXL A;  1R58 A;  2M45 A;  4PSX A;  5KHD A;  3BCB A;  4LMY A;  2VQC A;  2L01 A;  4RB3 C;  2LC2 A;  4GO1 A;  3PNT A;  4Y52 J;  2JA5 J;  2M9H A;  2H1K A;  3TED A;  2V4J C;  4WF2 A;  2VUM J;  2R5Y A;  5M5W J;  3RZD J;  4EGZ A;  3OYC A;  2QYO A;  2Z2S B;  1SFX A;  1SMY F;  3PSI A;  3AL0 C;  3BZK A;  3PNY A;  2QBY A;  2KRC A;  2R7S A;  1NTC A;  4KIC A;  2LKS A;  3IKT A;  2TRT A;  2IT0 A;  3IUO A;  4HST A;  3W6J B;  4AWX B;  5HVQ C;  3ZN0 A;  1AWC A;  2MGQ A;  4ZH4 F;  2E2I J;  1XPX A;  3S1N J;  1RKT A;  2DU9 A;  2BYV E;  3H0D A;  2A68 F;  2ZCW A;  3H5R A;  1U3E M;  3ONQ A;  2DAO A;  3OYF A;  4M3E A;  2IXS A;  4EEF G;  1TW2 A;  2K4J A;  1ZH5 A;  2L0K A;  3MQ0 A;  4AIH A;  3HJE A;  1R49 A;  3BLY A;  4DYQ A;  5J8C A;  5B3S H;  2XAF A;  3VYS B;  1RET A;  1VQN I;  3KP6 A;  4YFN F;  1OFC X;  2F2E A;  2RKH A;  4EGY A;  2DPD A;  2R7Q A;  1FIA A;  2VN2 A;  4I2O A;  2O0Y A;  2PMZ N;  3EPZ A;  3IWZ A;  1A35 A;  4CHU A;  3KCC A;  4BJ5 C;  4IO9 F;  2BZT A;  1WJA A;  4XLE A;  1ZEL A;  3LA3 A;  1JUM A;  4RGX A;  3H9G A;  4CCJ A;  4HAM A;  5EGO A;  4WK8 F;  5B1A H;  3PIP F;  2NS8 A;  2W82 A;  1FSE A;  1ZG3 A;  3GLX A;  1MKM A;  4M3F A;  2L9R A;  2G9W A;  1XB4 A;  3HIF A;  2XPV A;  4AVP A;  2C6Y A;  2E35 A;  1STZ A;  3HBL A;  2IW5 A;  2LKX A;  3DBH B;  3HSE A;  1FOK A;  4MFE A;  1LFB A;  1WJD A;  1BC7 C;  1WGX A;  4R1H A;  1MNE A;  2HQN A;  3KZZ A;  4ZC3 A;  3RCO A;  4P96 A;  3F8N A;  3EYI A;  2OZ6 A;  2K9L A;  3TGN A;  1S6L A;  1ORK A;  2L9V A;  3I53 A;  4UVB A;  4HSR A;  4UNO A;  2EV0 A;  1TC3 C;  3K4N A;  2UV1 A;  1CF7 A;  5DV5 A;  4DBQ A;  4QPQ A;  5HS8 A;  1OMI A;  2XAQ A;  1U5T B;  4RGS A;  4AYB N;  1PDN C;  1GUU A;  4OIN F;  1K4S A;  3AG3 H;  1LFU P;  5E3N A;  2WAQ A;  3KEO A;  4ZYE A;  1GDT A;  3GFI A;  2DMP A;  3KP4 A;  1YW7 A;  3K10 A;  3ZMU A;  4BHP A;  4OU0 A;  2LBF A;  4G9Y A;  2MG4 A;  3DXJ F;  4HPQ A;  1CQT A;  1YJ9 I;  2K3P A;  2X1D A;  4XRS G;  3VYU B;  1LPQ A;  2CQK A;  2VC0 A;  2HYF A;  4P9F A;  1OCR H;  1VND A;  4MHG A;  4Y33 A;  4UUS B;  1W0U A;  1XTA A;  1TLH B;  1Y6I A;  1T0F A;  2W1O A;  2EA2 A;  1CGP A;  1ULY A;  5LBQ A;  5FKO A;  2UXN A;  1L0O C;  3U1D A;  1JHF A;  3BG3 A;  3QPT A;  2K85 A;  5ILS A;  2IGN A;  1JKP C;  2ESN A;  1AKH A;  2XKP A;  2KDO A;  1MBE A;  4A3J J;  4B3X A;  3G1L A;  4RB2 C;  1X19 A;  4C9Y A;  3MEX A;  4RAF A;  1VZ0 A;  1TWA J;  2L7Z A;  3FXQ A;  5D6E A;  2BW3 B;  2X6O A;  1T98 A;  4Z2Y A;  3ZGK A;  1HST A;  5LHI A;  3KYC B;  4MGR A;  3PO3 J;  2VXZ A;  2ZXW H;  4A3D J;  1B4A A;  1ZK8 A;  2IPQ X;  1BM9 A;  2AO9 A;  2JSP A;  1ODD A;  3BC8 A;  3F9K A;  4G6T B;  4A0X A;  4LJZ F;  3WTT C;  1G59 A;  1UCR A;  4KUM A;  3ZRG A;  1OR7 C;  2IP2 A;  3RYR A;  3K2Z A;  4OAZ A;  4L5J A;  1SAX A;  4UUT A;  1X58 A;  1W1W E;  1R71 A;  3DU6 A;  5GAG J;  1BOA A;  3HZJ A;  2Y69 H;  4W97 A;  3O3K A;  4JYK A;  4OIR F;  3ZMV A;  4B09 A;  3V42 A;  2ZME B;  4E7S A;  2M4G A;  4XRF A;  5ICG A;  3CES A;  3G3Z A;  1SFU A;  3TL4 X;  3VYR B;  2PQ8 A;  2OV7 A;  2ID3 A;  3QPL A;  4F91 B;  1GXQ A;  1HBX G;  2K86 A;  5FKK A;  3RZO J;  3OYG A;  2Z9O A;  3ZCO A;  3HTU A;  3DEW A;  1QO0 D;  2DA4 A;  3CJQ B;  1OLT A;  2E36 A;  3L00 A;  4CZZ A;  2IBD A;  2L9S A;  1XC5 A;  2RNG A;  1N77 A;  2XB5 A;  2R5Z B;  2XUB A;  2KIQ A;  4LG0 A;  4JK1 X;  4BXF A;  5LHH A;  2YUS A;  4X0G A;  2GXG A;  3BR3 A;  4JOM A;  3K69 A;  5K5Q A;  5E1X A;  3OV8 A;  5E17 F;  1X3Z B;  3CDI A;  1QQI A;  1YS6 A;  2F5F A;  4BBS J;  3LSM A;  3ZMD A;  4UUV A;  4GGG A;  1G6N A;  4AVZ A;  1KU9 A;  4WCG A;  1EJ9 A;  3DV8 A;  3U2R A;  3ASO H;  3G71 I;  3NWS A;  5L3B A;  3B6C A;  1BR2 A;  3HC7 A;  3RKY A;  4HG2 A;  3QWL A;  2BVM A;  2GAU A;  1SVO A;  3I4N J;  3T0Y A;  1Z21 A;  2F5D A;  1VTN C;  1Z9C A;  4RAY A;  4LG3 A;  3MD2 A;  2MAB A;  1IXC A;  4B44 A;  3KET A;  2VI6 A;  4BDZ A;  3LSJ A;  2E2J J;  3KFW X;  3AG4 H;  2FXA A;  5DCM B;  3H3U A;  3S16 J;  4FIS A;  1GHC A;  2JA2 A;  3H92 A;  3R60 A;  4I76 A;  4HDV A;  3OYA A;  2XRL A;  1R00 A;  1RZ4 A;  2CW8 A;  2O9L A;  5J6X A;  2CFX A;  3NQO A;  2JUC A;  1K6O A;  2HYG D;  3HOV J;  3ZQF A;  1JKQ C;  1FMV A;  1ETY A;  5LGU A;  2XSJ C;  1HQC A;  3UR3 C;  2R7X A;  1Y0U A;  2WA0 A;  1YE9 A;  5EYR A;  1Z05 A;  1ETO A;  3B6A A;  2IS4 A;  4NC7 A;  3CLQ A;  1SVM A;  5TRD A;  2MD0 A;  2H1L A;  2XV4 S;  2ZME C;  2LTP A;  3ROU A;  3TP3 A;  4OMZ A;  1WJF A;  3F0C A;  2HQ5 A;  4XOR A;  1X4P A;  4R79 A;  4YEL A;  2E60 A;  4IQJ A;  1P92 A;  1SD7 A;  3OOP A;  3KYD B;  4HNV A;  2R5Y B;  2EFQ A;  5DD8 A;  5H6Q A;  3F6O A;  4GDF A;  2WB1 A;  4CO8 A;  4IZZ A;  3IL2 A;  4Z6Y A;  3OMY A;  2L02 A;  2QBY B;  2LLK A;  4UB6 C;  1REP C;  3MZ8 A;  2QGU A;  1V3F A;  4M6V A;  5L3F A;  5CJ9 A;  3BRO A;  3MCZ A;  5BOX A;  1DU0 A;  2A5W A;  4C3H J;  3ERE D;  1YIJ I;  1NH3 A;  2KLO A;  4HV5 A;  1IUF A;  1ZGW A;  1QZY A;  2LRD A;  2FF4 A;  2ISY A;  1RIO H;  3VWB A;  3M1C A;  3Q9V A;  5D4R A;  3MKZ A;  1VFC A;  1VQO I;  2LOO A;  4KJZ A;  1IUY A;  1W0T A;  3NRV A;  2JMW A;  2DMN A;  3FM3 A;  1IGN A;  5FKN A;  5H2F C;  2MC3 A;  2NNN A;  4MNU A;  1BW6 A;  3BR2 A;  3F72 A;  3JRG A;  6PAX A;  2FX0 A;  5CVU A;  5FB2 A;  1H88 C;  4EMS A;  1XGO A;  3BR6 A;  1I3Q J;  4U87 A;  5E20 A;  4K2E A;  3W2V A;  3E5X A;  2F5V A;  3REO A;  3TO9 A;  2O7O A;  4DYC A;  1YFH A;  4QSH A;  5FD6 A;  5F04 A;  2R4G A;  3QU6 A;  3OYJ A;  2AQF A;  3F23 A;  5EGO B;  5DM6 F;  5HNH A;  5GTI C;  5LGT A;  4E7Z A;  2QSH X;  4FCY A;  5CVJ A;  4U7B A;  3S8P A;  5HLH A;  3DWL E;  1GVJ A;  2X6W A;  3HGY A;  4EJU A;  5AIP A;  3DBR B;  1J5Y A;  2CW0 F;  2OC6 A;  1VQM I;  1ENH A;  3ZMZ A;  1YTY A;  1FT9 A;  1ZAR A;  1Z7L A;  5M3M J;  2P8T A;  4BE2 A;  2E1M B;  3KEQ A;  4HA8 A;  1QGP A;  2JPC A;  2WC2 A;  1BI2 A;  1GLN A;  1UHM A;  3I64 A;  4FX0 A;  2Y75 A;  1E3O C;  3C3W A;  4AU7 A;  2F5E A;  1TWC J;  3GUD A;  4KT5 C;  5K7H A;  4BU2 A;  3HRS A;  4L18 B;  2W84 A;  3M8J A;  2FBI A;  2LK2 A;  1BL0 A;  2QEX I;  3BJ6 A;  2F6C A;  1JKR C;  2ZFW A;  2STW A;  3ZPL A;  4D1Q A;  1B8I A;  1P2F A;  1LQ1 A;  4A3L J;  4HF1 A;  1MMS A;  3KP2 A;  3TDU C;  2KIF A;  4OOI A;  2A69 F;  2CH0 A;  4ZYH A;  2LBF B;  3DKX A;  1IDZ A;  3VOE A;  4C2T A;  4G6D A;  1G3W A;  3V8K A;  4A3I J;  4MFD A;  4H4K C;  4C30 A;  2CUZ A;  1ITY A;  4Y3O A;  1E3P A;  1R36 A;  2HYJ A;  1QNT A;  4KYW A;  3OYN A;  3SZT A;  1OCT C;  2BY2 A;  3FHN A;  3HOY J;  2KHM A;  3BG6 A;  2DJI A;  3FXU A;  5IP7 J;  3R6S A;  3ERM A;  2RN7 A;  3LL7 A;  5A2Q K;  1AKH B;  4II2 A;  3S3O A;  3MKW B;  1I1S A;  1U78 A;  3PIO F;  3GME A;  4JX6 A;  5LLQ A;  3CUQ B;  4XM3 A;  2IS2 A;  3GTP J;  3I3L A;  2IEK A;  3TBI A;  5BMZ A;  1E17 A;  3I55 I;  2DOD A;  2YU3 A;  4HW0 A;  5E3O A;  2M8E A;  3LST A;  4ENJ A;  1ZR2 A;  2PN6 A;  2L7K A;  2HPM A;  1GV2 A;  2BE5 F;  1IW7 F;  1RRJ A;  3J80 K;  4ASN A;  3CJT B;  5IYC J;  4CDG A;  5ILV A;  1HW5 A;  4H0E A;  5ED4 A;  2H8W A;  4CCM A;  4IL6 C;  1I39 A;  2FU4 A;  1W36 D;  1XMX A;  5JFR A;  4P55 A;  4XLH A;  3HB9 A;  4A69 C;  3BZ6 A;  3KX2 A;  1C0W A;  2E1M C;  4CGZ A;  2HVR A;  1PUF A;  2BGC A;  5H20 A;  2BY1 A;  2DK5 A;  2XGX A;  1FJL A;  2F48 A;  1W5S A;  2WTE A;  2Z33 A;  3P9C A;  3E97 A;  3LSP A;  5EJC A;  3FKI J;  3HUG A;  3FBN B;  4BJT A;  1MBG A;  2YR2 A;  4ZZL A;  3QOE A;  1RNL A;  3HGG A;  1OIS A;  3G2B A;  2JN6 A;  4IXA A;  1XN7 A;  2JRM A;  2A5Y B;  3CCM I;  4RM3 A;  3HSF A;  2YS9 A;  4CYC A;  4L9N A;  4IHY A;  3NAU A;  3QYF A;  4LG0 B;  2HQA A;  3HKZ A;  4GFB A;  2XPU A;  4IHV A;  1S5L C;  3FK7 A;  4E6K G;  4IOA F;  2YU9 J;  2AHQ A;  1HDD C;  3MZY A;  1MGT A;  1TNT A;  1HW1 A;  2V1X A;  4CYD A;  3I71 A;  5F1J A;  1X1P A;  3F8F A;  1P6R A;  1WCM J;  3L2R A;  1OJL A;  3A0B C;  3WU0 A;  5HDK A;  1Y0N A;  1ACI A;  2VC1 A;  2ME0 A;  1X3W B;  2IA1 A;  3T1B A;  1T0F C;  2JQ7 A;  3BPV A;  4E7J A;  3H5N A;  4X6A J;  3SXY A;  2R7R A;  5FO5 A;  2FNA A;  2LD5 A;  3CMY A;  4ENM A;  3BOQ A;  4IHT A;  4HEA 2;  3K9T A;  2IRF G;  4CH7 A;  3DPL C;  3DKY A;  3QP6 A;  3S2D J;  2EPF A;  2DQR A;  5JVT A;  4BNC A;  3G6E I;  3TP0 A;  3CCU I;  1I6H J;  4XID A;  3CUQ C;  1GXP A;  2JJ7 A;  1MMA A;  1U0J A;  1WI9 A;  2P6T A;  2OA4 A;  5GAH J;  4RS8 A;  3HOS A;  3SJM A;  1FYM A;  1SFK A;  4I6Z A;  2HPI A;  2QZ8 A;  5L3G A;  4A3M J;  2ZSI B;  4F93 B;  2P0W A;  5IY5 H;  3JRA A;  1ZG5 A;  2PMH A;  1GV5 A;  2I10 A;  4AC0 A;  5IP6 A;  4IOC F;  1ZQ3 P;  1U2W A;  2QKL B;  3MVP A;  1IXR C;  1G3T A;  2LG4 A;  1JGG A;  2QEN A;  3QOD A;  1BN5 A;  1JUS A;  1R4N B;  2CUE A;  4OAY A;  4BQQ A;  3K4C A;  4B43 A;  3OOU A;  5D5U B;  1YRN A;  3S1M J;  3IHU A;  1SEU A;  3NEU A;  1NG6 A;  1F9N A;  4F3Q A;  1A31 A;  3PSF A;  5FFX A;  1NHA A;  1MJB A;  2Z1D A;  1J9I A;  1Y8Q B;  2AXT C;  2DK8 A;  3ABM H;  5LRR A;  4O3M A;  4NB5 A;  2EFO A;  2GXB A;  3CP2 A;  1JT0 A;  2ELJ A;  1IV6 A;  2GOX B;  2DDB A;  2K9M A;  2KPM A;  4I98 B;  4MEY F;  3BTI A;  4TV7 A;  2JSC A;  3QP5 A;  2D2W A;  4XRM A;  3KPH A;  1G3Y A;  2NYX A;  4LFU A;  1R7J A;  2CJJ A;  3WTW C;  4L0Y B;  2MW8 A;  2O8X A;  3LQR A;  4IJA A;  5FRN A;  4QWQ A;  5JLX A;  2E2H J;  5JHU A;  1QU3 A;  3IWF A;  1VQP I;  1LDJ A;  4WWC A;  2XGC A;  1TQM A;  1WJE A;  3ZQL A;  4RA2 A;  2EZL A;  3E0J B;  2L7M P;  3DQV C;  4PFP A;  3LSG A;  4A3K J;  2EZK A;  3K4L A;  2KDZ A;  3OR2 C;  1VQ4 I;  1IRZ A;  2HXO A;  2I8D A;  4BY7 J;  1D0Z A;  4I99 C;  4YFX F;  5A2Q Z;  4ABZ A;  5IOZ A;  1QA6 A;  2WAF A;  3CF5 F;  3K1P A;  1W7P B;  2ZJP F;  5ICE A;  2K7L A;  1HLV A;  2R7U A;  4RGR A;  3S17 J;  1KYZ A;  3S93 A;  1YIO A;  1R1T A;  5EEA A;  1BA5 A;  2FUG 2;  1KU3 A;  2LFB A;  2AS5 F;  1O7F A;  1X3U A;  2ZSH B;  3FXK A;  3J80 Z;  1Y8R B;  3UNG C;  2V79 A;  1X1D A;  2LY9 A;  4DBR A;  1FZP B;  4CA0 A;  3RPU D;  1IN4 A;  3SZG A;  1MH3 A;  3MFK A;  3ZQG A;  4GCV A;  1QZZ A;  3RKQ A;  3I56 I;  1YJW I;  5C3E J;  3BQZ A;  2EWN A;  4ZYG A;  1F1Z A;  4N9I A;  1E2X A;  4UV8 A;  1G2H A;  4BEH A;  1H9T A;  4MQV A;  3CUO A;  2EV5 A;  3ZQ7 A;  2Y2Z A;  3JRF A;  2K3F A;  3H1C A;  3PQK A;  1S7A A;  1T95 A;  1Z77 A;  1TL8 A;  4CCN A;  3RTR A;  1I5Z A;  1IN8 A;  4X1E A;  3ZR8 X;  3IAS 2;  2QQA A;  2R3S A;  4L0Z B;  1T33 A;  5HDG A;  3GEZ A;  1OKR A;  2CYY A;  2OZU A;  4BAC A;  2L4M A;  2M0C A;  2ZJR F;  4DYR A;  4XBF A;  1OYI A;  2F4I A;  5LEK A;  1A6Q A;  2V1U A;  2XPW A;  1ZR4 A;  4A0Z A;  4AID A;  2D45 A;  2DJN A;  3KE2 A;  1B8I B;  4P5O A;  2A07 F;  2Y48 A;  2K9N A;  3QQA A;  3WG7 H;  4JP0 A;  2PI0 A;  9ANT A;  4EAT A;  1SD4 A;  2TDX A;  3SDB A;  1MNM C;  4EM0 B;  5D5W B;  2D1H A;  2OCC H;  4RLQ A;  1YX3 A;  3LSH A;  3N97 A;  1B9N A;  4V2F A;  5LEJ A;  1D0Y A;  4B4C A;  5JVG F;  5BPD A;  1BOB A;  3I54 A;  2VON A;  1JHH A;  4HQM A;  1UG0 A;  3WTY C;  3V7S A;  2XF5 A;  5LGN A;  5J3L A;  4IVN A;  4U7D A;  2ZFU A;  1J75 A;  2W48 A;  2BXY A;  2KZG A;  2CMP A;  3MAJ A;  3WTU C;  4J00 A;  4M9S A;  2QSF X;  2XKO A;  5FLX Z;  4HQE A;  1ZLK A;  3ZN1 A;  2Y9Z A;  4KMF A;  2XAJ A;  5K1Y A;  5HLI A;  1SC7 A;  3DBL B;  4RGU A;  5HLT A;  5F0F A;  1GVD A;  2PMU A;  5IT9 K;  5E18 F;  3L2V A;  4RB1 A;  3PO2 J;  3CD6 I;  3I5U A;  1I27 A;  4F52 A;  3LSI A;  2LRE A;  1WVR A;  4NQW A;  4YIR X;  1R23 A;  1R5H A;  2DOF A;  4Q48 A;  4QPO A;  1TW3 A;  4EJV A;  4CUG A;  1T8I A;  3VYT B;  3GTK J;  1WFX A;  4NNJ A;  3JSO A;  1X4O A;  3F8C A;  3L2W A;  2LH9 A;  2HOS A;  4M3G A;  3HRU A;  3E6B A;  5L3E A;  2FQ4 A;  2MBF A;  4KIS A;  2QQB A;  3GW2 A;  2BV6 A;  4PJJ A;  3BZC A;  4XON A;  1T6S A;  5J40 A;  3WHB A;  4C3J J;  1ZN2 A;  5ILU A;  3TQN A;  1PUF B;  4CIC A;  4JX4 A;  2CSO A;  2ELK A;  3NAR A;  4O5V A;  3O8G A;  3HDD A;  1D3Y A;  4PUS A;  4MLO A;  4UVA A;  3PM1 A;  3HRM A;  3HUG B;  3C2H A;  1O4X A;  3BP8 A;  1E0E A;  1SD6 A;  4AD9 A;  2ETH A;  2DMQ A;  4XMY A;  1RI7 A;  3GX4 X;  2MA3 A;  4CYC B;  1KU7 A;  2X6X A;  2JVG A;  2CW7 A;  1VF9 A;  3KP3 A;  3W2A A;  1B6A A;  1X2M A;  5JR3 A;  2WAD A;  5EF6 A;  1S7O A;  2GA1 A;  5LFA A;  5DM7 F;  1R4M B;  1O3T A;  4NHJ A;  5F0C A;  3ESW B;  3CC7 I;  4R8H A;  3TDZ C;  1R1V A;  2CO5 A;  2H09 A;  1Y1W J;  3FKJ A;  4I01 A;  2OUM A;  1J59 A;  1W5C C;  3A0H C;  1JT6 A;  2B0L A;  4EJO A;  2O61 A;  3T8T A;  4A5M A;  1RUO A;  2PMZ A;  4Q4Z F;  4ENK A;  4D5F A;  5EEH A;  2QA4 I;  3V4G A;  4XOP A;  2K02 A;  2LF8 A;  4AIJ A;  3E3V A;  3HOX J;  2NOJ B;  1ETW A;  1YS7 A;  3SQN A;  3UKG A;  1ZRF A;  3GF2 A;  1QBJ A;  3OSF A;  5CVR A;  4ZDO A;  1Z67 A;  4ZDP A;  1MMN A;  3H36 A;  2Y31 A;  1WH5 A;  3KP7 A;  3G73 A;  2V1N A;  1IRX A;  3I4M J;  3O8H A;  1GT0 C;  3OSG A;  1AU7 A;  4XLP F;  3H3V K;  2DT5 A;  3Q5F A;  2OTJ I;  2DLL A;  2VOO A;  1HXD A;  1W5T A;  5D8K B;  3ZQI A;  4G6Q A;  2X1C A;  1WWX A;  2E19 A;  2V9K A;  1DP7 P;  4WX9 A;  3IH3 A;  2DA1 A;  1MMG A;  4IRH A;  2A05 A;  2G0E A;  5F64 A;  4PJ0 C;  2XC7 A;  2UZK A;  1YOV B;  3HXL A;  3MN2 A;  1KZH A;  2W24 A;  5KAF C;  2F5C A;  1BI1 A;  1IAW A;  3PL8 A;  2Q0O A;  2A3S A;  2HFH A;  2NS0 A;  4RLF A;  2GWR A;  5DUI A;  3BR1 A;  3FBI B;  4AYB A;  1YYV A;  5L3C A;  4A3E J;  3RJP A;  1YRN B;  2DYS H;  4LIT A;  3SDG A;  3AAF A;  1BR1 A;  1BC8 C;  4CSW A;  5EZH A;  1Z0X A;  4CCK A;  1X1B A;  1ETV A;  4L5E A;  5K7F A;  4U88 A;  1WSU A;  1KGS A;  4RB0 A;  5HS9 A;  2EJR A;  3O2P E;  4BGD A;  1KQ0 A;  3DCF A;  3DPU A;  5HNF A;  2EBI A;  3QYB A;  2MFZ A;  2M34 A;  4A3C J;  2PBI A;  2N8G A;  2XSD C;  2EIL H;  4A6D A;  2GZW A;  2RQP A;  1XGS A;  4P9U A;  1D8K A;  2ZKZ A;  3ZQH A;  2VBX A;  3BPX A;  2G7H A;  1FPQ A;  2VIX A;  2JA6 J;  5J4Y A;  4KNY A;  4RM2 A;  1J09 A;  3CC2 I;  4FET A;  2X9D A;  2Y30 A;  2E7X A;  4J19 A;  4EJT A;  1OCO H;  4A3G J;  2RVC A;  3S14 J;  3SFZ A;  5CQG A;  2ID6 A;  4RAG A;  5IP9 J;  1QHH D;  1YJN I;  1FMW A;  4BUP A;  5B66 C;  3MKY B;  3L09 A;  1I50 J;  2DMU A;  2DQL A;  4BJ6 C;  4Y17 A;  1J2X A;  1D1C A;  2NS7 A;  2OAZ A;  1Z3Y A;  4YEJ A;  1P9Q C;  1DPU A;  3CLO A;  2CU7 A;  2ZNY A;  1X1C A;  3CMM A;  3TW6 A;  3FXO A;  1UJ8 A;  4UV9 A;  3VSL A;  1BIA A;  4FQG A;  2DA3 A;  4XN3 A;  5F6F A;  3LAJ A;  2O6G E;  1FBU A;  4BY1 J;  3ZQQ A;  2FBK A;  1S8N A;  4A6E A;  2UWM A;  2X51 A;  1QZE A;  5HLG A;  4HOB A;  2CUJ A;  2DA6 A;  5ICF A;  1MD0 A;  2M4K A;  3ABT A;  3RKW A;  1FSH A;  1XDS A;  5FFZ A;  4XL9 A;  3CQZ J;  4L5I A;  2RV8 A;  5J47 A;  3VOD A;  4FE4 A;  4M6X A;  4XRS A;  2XGD A;  1UFM A;  3WHC A;  3B02 A;  3LQQ A;  2CFO A;  2V9V A;  5B1B H;  2FOK A;  2W00 A;  2ESH A;  2X4H A;  3BTC A;  3LA7 A;  5KK1 A;  3Q3S A;  4BEH B;  3LAP A;  4C2M J;  4BH9 A;  3MKL A;  2H6B A;  2M30 A;  3OWT A;  1SAN A;  1MND A;  1OQY A;  4LIV A;  2MH9 A;  4BYY A;  1FOW A;  2QSG X;  1J0R A;  1IXS B;  1HCR A;  1MSE C;  2J5O A;  2FJ1 A;  4LOC A;  4W1U A;  5DUK A;  5FJ8 J;  2DFF A;  2M0M A;  4A93 J;  2EIN H;  2NXN B;  2BHZ A;  3OIQ A;  1FC3 A;  3J81 K;  3A4C A;  4A0Y A;  2GXA A;  2PJR A;  3A1Y A;  3J7Z I;  4M72 A;  4PGG A;  5GP9 A;  4XIC A;  3X2Q H;  1ZG1 A;  3LFK A;  4EJW A;  2QQ8 A;  3HOW J;  4XQF A;  2GIZ A;  5AIQ A;  2PX9 A;  4KIG A;  4NC6 A;  1R5I D;  2KP6 A;  2XDV A;  2Z5U A;  4G12 A;  5HOO A;  3FHZ A;  1HC8 A;  4XK4 A;  2CV0 A;  1EH6 A;  4YII A;  3BTJ A;  1RUN A;  2XF6 A;  1CF7 B;  1BR4 A;  2PJP A;  3EET A;  1MJ9 A;  2HDC A;  4E7L A;  2K40 A;  1I3A A;  2CQN A;  3S3N A;  3J7Y J;  1LB2 A;  1P4W A;  1RR7 A;  1YW8 A;  1SFO J;  2WV0 A;  5J1R A;  1MH4 A;  4KDP A;  1K83 J;  2VJJ A;  5TJJ A;  1LDK B;  2Q1Z B;  2PG4 A;  4D0P A;  2IVM A;  1DPR A;  2MYS A;  1MIJ A;  4HZF A;  4HF0 A;  1LEA A;  4V2G A;  4AIK A;  4LK1 F;  5F0H A;  3WGI A;  2LR8 A;  4KN7 X;  2UUZ A;  4D5C A;  2M5W A;  2QKM B;  4NQW B;  1RC9 A;  2VXD A;  1ZRD A;  1XSX A;  4HNT A;  3QRF F;  5K7Z A;  3FMQ A;  2E1C A;  2RNJ A;  2JT1 A;  5K5O A;  2QQ9 A;  3V8L A;  1AHD P;  4HX7 A;  3PJR A;  1U9N A;  2NNY A;  3T8R A;  1DDN A;  3JTH A;  5DEQ A;  3U21 A;  5LD2 C;  1B72 A;  5IT3 A;  4DNC A;  3GTM J;  2X48 A;  4LLL A;  3M8E A;  3MMY B;  3TMO A;  4DW6 A;  3WGG A;  5GPA A;  1Y39 A;  1O3Q A;  1XMK A;  2YX7 A;  2GLO A;  2LF7 A;  4HYE A;  2K27 A;  2E71 A;  4BE1 A;  1TNS A;  2X6Y A;  2EFW A;  3EQL F;  3MWM A;  4MTD A;  2RAE A; 
#chains in the Genus database with same CATH homology
 5DD4 A;  1HKQ A;  4G7Z F;  1ZHF A;  1V4R A;  4G7O F;  3ZMS A;  3ABU A;  1IRG A;  2P7V B;  2HWV A;  1U5T A;  3E6M A;  3JW4 A;  5D4S A;  4S04 A;  1YW9 A;  1J7K A;  3TO7 A;  3F8M A;  3HRT A;  2VE8 A;  3RKX A;  4PDK A;  3E5U A;  4Y13 A;  1FLI A;  4WXH A;  3PFI A;  2NAZ A;  4LLN A;  4LD5 A;  3EUH A;  4LK0 F;  4ZZD A;  2DI3 A;  2HZT A;  4YG2 F;  4L9V A;  4HV6 A;  2JTV A;  3BWG A;  4M74 A;  2DW4 A;  3MZH A;  1DUX C;  5BS6 A;  2KIU A;  2VBY A;  2CG4 A;  1ZRE A;  3ISP A;  2H27 A;  3L2C A;  4KA4 A;  2DPU A;  1ZGJ A;  2EA4 A;  4BHC A;  5JI6 A;  1XCB A;  3VB2 A;  3LA2 A;  1U8R A;  2Q2E A;  4HX4 A;  1MDM A;  2P4W A;  2Y0M A;  3CO6 C;  3ECO A;  2XVC A;  3COA C;  4XSX F;  3VFZ A;  4OIP F;  2XAS A;  3JSP A;  3WTZ A;  5CVI A;  3J81 Z;  5J8F A;  3S2W A;  1D5V A;  4GYI A;  4XSZ F;  1UB9 A;  1YO5 C;  3HHG A;  4FX4 A;  4WXD A;  5E1Z B;  3T5X A;  3KLO A;  2OD5 A;  1PP8 F;  2GIV A;  2NRA C;  3ELK A;  1LEB A;  2EK5 A;  3RYP A;  4ENN A;  2FQ3 A;  5FGM A;  2BEO A;  4A5N A;  5D6F A;  3CDH A;  5AON A;  1A04 A;  4I02 A;  3QAH A;  5HDN A;  2ZNZ A;  3M8F A;  4IRG A;  1AOY A;  5FD5 A;  3GZ6 A;  1XSV A;  3GFL A;  1TTY A;  5DDG A;  1HSJ A;  2W25 A;  2OBP A;  1H0M A;  2A61 A;  4KN4 X;  1SD5 A;  3FWE A;  2R7F A;  1USS A;  2PEX A;  3GFJ A;  3P7N A;  1UHW A;  1FBQ A;  2CWE A;  3WG9 A;  2DBB A;  4XLN F;  4U0W A;  4KIB A;  3BY6 A;  2FNP A;  3C7J A;  3GWZ A;  4YIF A;  2ADU A;  5K5R A;  4OMY A;  2V1D A;  3M9A A;  3KP5 A;  1KU2 A;  1FYL A;  2HS5 A;  1JXS A;  3R61 A;  1IN5 A;  3JTG A;  1T38 A;  2P7C B;  4MEX F;  4LB5 A;  3EYY A;  3HSR A;  5EEG A;  4BXU A;  1IRF A;  3WOD F;  1L3L A;  1XSD A;  1XCV A;  2RC4 A;  4E70 A;  5D5X B;  4ESJ A;  2COM A;  2VT2 A;  1K7A A;  5D5V B;  1KYW A;  5BPI A;  1S29 A;  2G7U A;  5F1R A;  4CXF A;  2ZJ2 A;  2XRN A;  4FT8 A;  4HLY A;  4UHT A;  1XDU A;  2PFB A;  4IPA A;  1Z6R A;  2LSO A;  1FP2 A;  1KA8 A;  3F6V A;  2KJC A;  2FA5 A;  1Z1D A;  3Q9S A;  2IA0 A;  4ZYD A;  3R0J A;  2KKO A;  4O6J A;  2V6C A;  2W57 A;  1HKT A;  2UXX A;  3LWF A;  1EV7 A;  3P9I A;  1R22 A;  2LKP A;  1F4K A;  1XD7 A;  3HHH A;  4B8X A;  2L4A A;  4I0B A;  4IHS A;  2L54 A;  2XIG A;  5CVV A;  1F5T A;  3F22 A;  5HS7 A;  2XAH A;  3WE3 A;  2OQR A;  4KIF A;  3C18 A;  3CUQ A;  2P6S A;  4ESB A;  2YPR A;  2Z99 A;  3ZMT A;  3GFM A;  2DTR A;  1UST A;  2A6H F;  3ML6 A;  1MJA A;  4A12 A;  1ONV A;  1YG2 A;  2VOD A;  3RPU A;  1ZRC A;  3SZP A;  3W6K B;  4RAZ A;  3F3X A;  1MDM B;  4QLC U;  1W7P D;  4G7H F;  3M7G A;  4IRI A;  2GQQ A;  5H6R A;  2VE9 A;  4HBL A;  5DCF A;  2XRO A;  1B9M A;  3QPH A;  2FML A;  4Y15 A;  3R0A A;  4IF4 A;  4FHT A;  1U5T C;  4U0Y A;  2FMY A;  1T2K A;  2ZO4 A;  4LB6 B;  1Q1H A;  5BQT A;  3RDI A;  2QLZ A;  2A6E F;  2VBW A;  3WTX C;  1JGS A;  2E1N A;  3E5Q A;  2HEO A;  4EVI A;  2QWW A;  4JQF A;  1I1G A;  2KRF A;  3K1M A;  2VT3 A;  4N0B A;  4EM2 A;  1XMA A;  3D5L A;  2W85 A;  3TKY A;  4I0A A;  2D1V A;  2HTJ A;  4L9T A;  3V8J A;  2JPB A;  3I59 A;  4PGH A;  3FX3 A;  2DFI A;  4ON0 A;  3BJA A;  2J5P A;  3BDD A;  3DPT A;  4GYG A;  2ACJ A;  3IRR A;  2H6C A;  4YFK F;  3ULQ B;  1KQ8 A;  1G3S A;  2FEZ A;  3GXO A;  4HLX A;  1ZGA A;  2X0L A;  3KLN A;  3WTV C;  3ZP5 A;  5L3D A;  4Q5S F;  3E6D A;  1K79 A;  2HKO A;  3BJO A;  5IT9 Z;  1IN6 A;  1BI3 A;  4EV0 A;  3HOT A;  3L9F A;  4OIO F;  3ECH A;  4HDU A;  2HKX A;  1WRJ A;  4A2U A;  3KZY A;  2ISZ A;  2LDU A;  2JRT A;  4Q47 A;  2AXL A;  1R1U A;  4M73 A;  1EH7 A;  1BI0 A;  3CO7 C;  4F7Z A;  4PCQ A;  5DYM A;  3DP7 A;  2KIM A;  1BJA A;  1K78 A;  3O6B B;  1I6X A;  5E1W A;  1S3J A;  4G8X A;  4G94 A;  2STT A;  2YX4 A;  5E8G A;  4U0V A;  3DKW A;  3RPQ A;  3P9K A;  3U9G A;  1HW2 A;  3TO6 A;  3HYI A;  1IN7 A;  2QUF A;  3GVA A;  2DO7 A;  1B1B A;  1W7P A;  4WXC A;  5CLS A;  3WE2 A;  1B59 A;  2HTS A;  2VOP A;  1XGN A;  2EB7 A;  2RGV A;  2P5K A;  3FMR A;  4S05 A;  1FX7 A;  2WWY A;  1OYW A;  5LHG A;  5ICC A;  2HQR A;  1ZYR F;  4HX8 A;  3DFG A;  3FF5 A;  2PLY A;  2OU2 A;  2QVO A;  3JAM K;  5E8I A;  2GA2 A;  1MZB A;  2FBH A;  4LGW A;  2RDP A;  1O7L A;  1WKM A;  3V7R A;  1FYK A;  1PUE E;  2P5V A;  3D0S A;  1H9G A;  2LNB A;  3CTA A;  2FE3 A;  1TBX A;  1SMT A;  2EFN A;  5D8L B;  1LVA A;  2O03 A;  2EFP A;  4GXO A;  1OR7 A;  3C1D A;  2IJL A;  3K0L A;  2M87 A;  3FXR A;  1FWZ A;  4MTE A;  1FY7 A;  3QU3 A;  4M9Z A;  1KQ9 A;  1JE8 A;  5KVR A;  1IZ1 A;  4ETS A;  3L7W A;  2VBZ A;  3RIR A;  4KFC A;  3R4K A;  1YQA A;  3F21 A;  1LJ9 A;  1FP1 D;  3QOP A;  3TOA A;  1Z7U A;  3IRQ A;  2MLG A;  3TOB A;  1P4A A;  5CYV A;  1R5G A;  5ERI A;  3GO5 A;  1IF1 A;  2ZBK A;  1QPM A;  2HR3 A;  3SHF A;  1HKS A;  4MQ9 F;  1WQ2 A;  1P4X A;  2FRH A;  1BBY A;  3FM5 A;  1ZAO A;  1W4M A;  4M71 A;  3GZ5 A;  2XHK A;  2HGC A;  2EV6 A;  2ZXJ A;  3H3Z A;  1BIB A;  4M6Y A;  4OIQ F;  3GYH X;  2MD5 A;  1Z6T A;  1LNW A;  1ZLJ A;  1TQP A;  2HOE A;  4PZJ A;  4JBA A;  3WGH A;  4BAY A;  4ESF A;  4LLG F;  4I7H A;  2K4B A;  1OYY A;  3DEU A;  4BHB A;  2ZME A;  4N9H A;  4KMU X;  4I09 A;  4BQA A;  2L3D A;  3I0T A;  2E7W A;  2XAG A;  3VEP A;  3IKV A;  4L9J A;  1D8J A;  3I59 B;  2MH2 A;  2FSW A;  2OQG A;  2Q8K A;  1EH8 A;  2ELH A;  3FMS A;  1G4D A;  2CGP A;  5FLX K;  3N4M A;  1O57 A;  3J7A O;  2BBY A;  3PQJ A;  3I58 A;  4DQ2 A;  2IA2 A;  3K1N A;  1LDD A;  2H94 A;  3WTS C;  3HTS B;  2JZY A;  1YLF A;  4UXN A;  1SFE A;  2M1B A;  3JAM Z;  4M9X A;  3F8B A;  3M1E A;  5LRS A;  1FBS A;  1Z91 A;  1OPC A;  1ON1 A;  3B73 A;  2O3F A;  4EM1 A;  1ON2 A;  2QM3 A;  1TQI A;  5DCM A;  3DF8 A;  3E6C C;  1O3R A;  3FZV A;  3RI4 A;  1PP7 U;  3I4P A;  1XGM A;  1T39 A;  2Z3Y A;  4EQQ A;  1O3S A;  3EDP A;  2MLK A;  4HF2 A;  3V7C A;  2P5L C;  1U6G A;  3CJN A;  3WU1 B;  2KJB A;  3IC7 A;  2YSR A;  1FNN A;  1K78 B;  2R7D A;  4UVC A;  1R58 A;  2M45 A;  4LMY A;  2L01 A;  4RB3 C;  4GO1 A;  4WF2 A;  4EGZ A;  2QYO A;  1SFX A;  1SMY F;  2QBY A;  4KIC A;  3IKT A;  2IT0 A;  4AWX B;  5HVQ C;  3ZN0 A;  1AWC A;  4ZH4 F;  2DU9 A;  2BYV E;  2A68 F;  2ZCW A;  1U3E M;  2DAO A;  1TW2 A;  2K4J A;  1ZH5 A;  3MQ0 A;  4AIH A;  5J8C A;  2XAF A;  3KP6 A;  4YFN F;  2F2E A;  2RKH A;  4EGY A;  2DPD A;  2VN2 A;  4I2O A;  2O0Y A;  3IWZ A;  4CHU A;  3KCC A;  3LA3 A;  4RGX A;  4HAM A;  4WK8 F;  1ZG3 A;  1FSE A;  3GLX A;  1MKM A;  2G9W A;  1XB4 A;  3HIF A;  4AVP A;  2C6Y A;  1STZ A;  2IW5 A;  3HSE A;  1FOK A;  1BC7 C;  4R1H A;  3KZZ A;  2HQN A;  4P96 A;  3F8N A;  3EYI A;  2OZ6 A;  3TGN A;  1S6L A;  3I53 A;  4UVB A;  4UNO A;  2EV0 A;  1CF7 A;  5DV5 A;  5HS8 A;  1OMI A;  2XAQ A;  1U5T B;  4RGS A;  1PDN C;  4OIN F;  3KEO A;  4ZYE A;  3GFI A;  3KP4 A;  1YW7 A;  3ZMU A;  4BHP A;  4OU0 A;  4G9Y A;  3DXJ F;  2CQK A;  2VC0 A;  2HYF A;  4P9F A;  4MHG A;  1TLH B;  1T0F A;  2EA2 A;  1CGP A;  1ULY A;  5LBQ A;  2UXN A;  1L0O C;  3U1D A;  1JHF A;  3QPT A;  5ILS A;  2ESN A;  2XKP A;  4RB2 C;  3MEX A;  3FXQ A;  5D6E A;  4Z2Y A;  1T98 A;  1HST A;  5LHI A;  4MGR A;  2VXZ A;  1B4A A;  2IPQ X;  3W6J B;  1BM9 A;  1ODD A;  3WTT C;  4A0X A;  4LJZ F;  1UCR A;  4KUM A;  2IP2 A;  3RYR A;  3K2Z A;  1SAX A;  4L5J A;  1BOA A;  3O3K A;  4OIR F;  3ZMV A;  4B09 A;  2ZME B;  4XRF A;  5ICG A;  3G3Z A;  1SFU A;  2PQ8 A;  1GXQ A;  1HBX G;  2K86 A;  2Z9O A;  3HTU A;  1QO0 D;  3L00 A;  4CZZ A;  2XUB A;  4LG0 A;  4JK1 X;  5LHH A;  2GXG A;  3K69 A;  5K5Q A;  5E1X A;  3OV8 A;  5E17 F;  1QQI A;  1YS6 A;  2F5F A;  3ZMD A;  4UUV A;  4GGG A;  1G6N A;  1KU9 A;  4WCG A;  3DV8 A;  3U2R A;  5L3B A;  3RKY A;  2GAU A;  3T0Y A;  2F5D A;  1VTN C;  1Z9C A;  4RAY A;  1IXC A;  3KET A;  3KFW X;  2FXA A;  5DCM B;  3H3U A;  1GHC A;  3H92 A;  4HDV A;  3R60 A;  1R00 A;  1RZ4 A;  5J6X A;  2CFX A;  3NQO A;  1K6O A;  2HYG D;  5LGU A;  1HQC A;  1Y0U A;  1Z05 A;  5TRD A;  2XV4 S;  3ROU A;  4OMZ A;  4R79 A;  1P92 A;  1SD7 A;  3OOP A;  2EFQ A;  5DD8 A;  5H6Q A;  3F6O A;  4CO8 A;  3IL2 A;  2L02 A;  2QBY B;  1REP C;  1V3F A;  5L3F A;  5CJ9 A;  3BRO A;  3MCZ A;  5BOX A;  3ERE D;  4HV5 A;  1QZY A;  2FF4 A;  2ISY A;  1RIO H;  3Q9V A;  5D4R A;  1IUY A;  3NRV A;  3FM3 A;  2MC3 A;  2NNN A;  4MNU A;  3F72 A;  6PAX A;  5CVU A;  5FB2 A;  4EMS A;  1XGO A;  5E20 A;  4K2E A;  3E5X A;  1YFH A;  3REO A;  3TO9 A;  5FD6 A;  3QU6 A;  3F23 A;  5LGT A;  5CVJ A;  4U7B A;  5HLH A;  1GVJ A;  4EJU A;  5AIP A;  1J5Y A;  2CW0 F;  3ZMZ A;  1YTY A;  1FT9 A;  1ZAR A;  2P8T A;  3KEQ A;  4HA8 A;  1QGP A;  2JPC A;  2WC2 A;  1BI2 A;  3I64 A;  1UHM A;  4FX0 A;  2Y75 A;  3C3W A;  2F5E A;  3GUD A;  4KT5 C;  3HRS A;  4L18 B;  2W84 A;  2FBI A;  3BJ6 A;  3ZPL A;  2ZFW A;  2STW A;  1P2F A;  1LQ1 A;  4HF1 A;  3TDU C;  3KP2 A;  2KIF A;  4OOI A;  2A69 F;  4ZYH A;  3VOE A;  4G6D A;  1G3W A;  3V8K A;  1R36 A;  1QNT A;  4KYW A;  3SZT A;  3FXU A;  3R6S A;  5A2Q K;  2RN7 A;  1I1S A;  1U78 A;  5LLQ A;  3CUQ B;  5BMZ A;  1E17 A;  2YU3 A;  4HW0 A;  4ENJ A;  2M8E A;  3LST A;  2PN6 A;  2BE5 F;  1IW7 F;  3J80 K;  4ASN A;  4CDG A;  5ILV A;  1HW5 A;  4H0E A;  5ED4 A;  2FU4 A;  5JFR A;  4P55 A;  3BZ6 A;  1C0W A;  4CGZ A;  2BGC A;  5H20 A;  2DK5 A;  2XGX A;  1W5S A;  2WTE A;  2Z33 A;  3P9C A;  3E97 A;  3HUG A;  2YR2 A;  4ZZL A;  1RNL A;  4IXA A;  1XN7 A;  2A5Y B;  3HSF A;  4L9N A;  4LG0 B;  3MZY A;  1MGT A;  1TNT A;  1HW1 A;  2V1X A;  4CYD A;  3I71 A;  3F8F A;  1P6R A;  3WU0 A;  5HDK A;  2VC1 A;  2IA1 A;  3T1B A;  3BPV A;  3SXY A;  5FO5 A;  2FNA A;  4ENM A;  3BOQ A;  4IHT A;  3K9T A;  2IRF G;  3DPL C;  3QP6 A;  2DQR A;  5JVT A;  4BNC A;  3CUQ C;  1GXP A;  1WI9 A;  2P6T A;  2OA4 A;  4RS8 A;  3HOS A;  1FYM A;  2QZ8 A;  5L3G A;  1ZG5 A;  2PMH A;  1U2W A;  1IXR C;  1G3T A;  2QEN A;  1BN5 A;  5D5U B;  3IHU A;  3NEU A;  1F9N A;  5FFX A;  1NHA A;  1MJB A;  1J9I A;  2DK8 A;  2GXB A;  5LRR A;  4O3M A;  4NB5 A;  2EFO A;  4I98 B;  4MEY F;  4TV7 A;  2JSC A;  3QP5 A;  2D2W A;  1G3Y A;  2NYX A;  4LFU A;  1R7J A;  3WTW C;  4L0Y B;  2O8X A;  3LQR A;  4IJA A;  4QWQ A;  5JHU A;  3IWF A;  1LDJ A;  4WWC A;  1TQM A;  3DQV C;  4YFX F;  5A2Q Z;  3K1P A;  1W7P B;  5ICE A;  2K7L A;  4RGR A;  1KYZ A;  1YIO A;  1R1T A;  1KU3 A;  2AS5 F;  1O7F A;  1X3U A;  3J80 Z;  2V79 A;  1FZP B;  1IN4 A;  3MFK A;  4GCV A;  1QZZ A;  2EWN A;  4ZYG A;  1F1Z A;  4N9I A;  1E2X A;  4UV8 A;  1H9T A;  4MQV A;  3CUO A;  2EV5 A;  3ZQ7 A;  3PQK A;  1S7A A;  3RTR A;  1I5Z A;  1IN8 A;  2QQA A;  2R3S A;  4L0Z B;  5HDG A;  3GEZ A;  1OKR A;  2CYY A;  2OZU A;  2L4M A;  4XBF A;  1OYI A;  5LEK A;  2V1U A;  4A0Z A;  2D45 A;  3KE2 A;  4P5O A;  2A07 F;  2Y48 A;  2PI0 A;  1SD4 A;  2TDX A;  4EM0 B;  5D5W B;  2D1H A;  3N97 A;  1B9N A;  5LEJ A;  5BPD A;  3I54 A;  2VON A;  1JHH A;  4HQM A;  3WTY C;  3V7S A;  5LGN A;  4IVN A;  4U7D A;  1J75 A;  3WTU C;  3MAJ A;  4M9S A;  2XKO A;  5FLX Z;  4HQE A;  1ZLK A;  3ZN1 A;  4KMF A;  2XAJ A;  5K1Y A;  5HLI A;  4RGU A;  2PMU A;  5IT9 K;  5E18 F;  4RB1 A;  3I5U A;  1I27 A;  4NQW A;  1R23 A;  1R5H A;  4Q48 A;  1TW3 A;  4EJV A;  3JSO A;  3F8C A;  3HRU A;  3E6B A;  5L3E A;  2MBF A;  2QQB A;  3GW2 A;  2BV6 A;  1T6S A;  1ZN2 A;  5ILU A;  3TQN A;  4CIC A;  2CSO A;  4O5V A;  1D3Y A;  4UVA A;  3HRM A;  3BP8 A;  1SD6 A;  4AD9 A;  2ETH A;  1RI7 A;  3GX4 X;  2MA3 A;  1KU7 A;  3KP3 A;  1B6A A;  5JR3 A;  1S7O A;  2GA1 A;  1O3T A;  4NHJ A;  4R8H A;  3TDZ C;  1R1V A;  2CO5 A;  2H09 A;  4I01 A;  1J59 A;  2B0L A;  4EJO A;  2O61 A;  3T8T A;  4A5M A;  1RUO A;  4Q4Z F;  4ENK A;  5EEH A;  3V4G A;  2K02 A;  2LF8 A;  4AIJ A;  3E3V A;  1YS7 A;  3SQN A;  1ZRF A;  3GF2 A;  1QBJ A;  5CVR A;  3G73 A;  3KP7 A;  4XLP F;  2DT5 A;  3Q5F A;  2DLL A;  2VOO A;  1HXD A;  1W5T A;  5D8K B;  4G6Q A;  1WWX A;  1DP7 P;  4WX9 A;  4IRH A;  5F64 A;  2UZK A;  2W24 A;  2F5C A;  1BI1 A;  1IAW A;  2Q0O A;  2A3S A;  2HFH A;  2NS0 A;  2GWR A;  5DUI A;  1YYV A;  5L3C A;  3RJP A;  3AAF A;  1BC8 C;  4U88 A;  1WSU A;  1KGS A;  4RB0 A;  5HS9 A;  2EJR A;  3O2P E;  1KQ0 A;  2PBI A;  4A6D A;  2GZW A;  2RQP A;  1XGS A;  4P9U A;  1D8K A;  2ZKZ A;  2VBX A;  3BPX A;  2G7H A;  1FPQ A;  4KNY A;  2E7X A;  4EJT A;  2RVC A;  3SFZ A;  3L09 A;  2DQL A;  4Y17 A;  1J2X A;  2OAZ A;  1DPU A;  3CLO A;  2ZNY A;  4UV9 A;  1BIA A;  5F6F A;  3LAJ A;  2O6G E;  1FBU A;  2FBK A;  1S8N A;  4A6E A;  2UWM A;  5HLG A;  4HOB A;  5ICF A;  1MD0 A;  3ABT A;  3RKW A;  1FSH A;  1XDS A;  5FFZ A;  4L5I A;  2RV8 A;  3VOD A;  4M6X A;  1UFM A;  3B02 A;  3LQQ A;  2V9V A;  2FOK A;  2ESH A;  2X4H A;  3LA7 A;  5KK1 A;  3LAP A;  4BH9 A;  2H6B A;  2M30 A;  2MH9 A;  4BYY A;  1J0R A;  1IXS B;  2J5O A;  5DUK A;  1FC3 A;  3J81 K;  4A0Y A;  4M72 A;  4PGG A;  1ZG1 A;  3LFK A;  4EJW A;  5AIQ A;  4KIG A;  2Z5U A;  5HOO A;  3FHZ A;  1EH6 A;  4YII A;  1RUN A;  1CF7 B;  2PJP A;  3EET A;  1MJ9 A;  2HDC A;  1LB2 A;  1P4W A;  1YW8 A;  2WV0 A;  4KDP A;  5TJJ A;  1LDK B;  4D0P A;  2PG4 A;  2IVM A;  1DPR A;  4HZF A;  4HF0 A;  1LEA A;  4AIK A;  4LK1 F;  3WGI A;  4KN7 X;  1ZRD A;  2M5W A;  1XSX A;  3QRF F;  3FMQ A;  2E1C A;  2RNJ A;  2JT1 A;  5K5O A;  2QQ9 A;  3V8L A;  4HX7 A;  2NNY A;  3T8R A;  1DDN A;  3JTH A;  5DEQ A;  5IT3 A;  4DNC A;  4LLL A;  3M8E A;  3WGG A;  1O3Q A;  1XMK A;  2YX7 A;  2LF7 A;  4HYE A;  2K27 A;  1TNS A;  2EFW A;  3EQL F;  3MWM A;  4MTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...