3CUQB

Integrated structural and functional model of the human escrt-ii complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
204
Chain Sequence
KNISEAFEDLSKLMIKAKEMVELSKSIANKDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 55
structure length 204
sequence length 214
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqB02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqB03
4HZFA 2B0LA 3GUDA 3FXUA 2C6YA 4EV0A 4JK1X 1TNSA 4G9YA 2HS5A 5F6FA 1STZA 4P96A 2VT3A 1BI2A 5LGUA 2VBWA 4B8XA 2A6HF 2NNNA 4HLXA 2UXNA 2ZJ2A 2OU2A 1U6GA 1IN7A 4N9HA 1P4XA 4I02A 4OOIA 1SFEA 1KYZA 3I58A 5JFRA 3WTYC 2K02A 1FOKA 2V79A 1UHWA 1GXPA 1W4MA 3EUHA 4A12A 1R23A 4HX8A 2D1HA 1V3FA 4CDGA 3HRTA 1MZBA 3DKWA 4FT8A 1KU3A 2EV6A 1KGSA 2OA4A 1G3SA 2XASA 4G7ZF 2MLGA 3KETA 2NS0A 1HKSA 1U5TA 2IRFG 2PQ8A 4GCVA 3ML6A 2DQRA 1T2KA 2JPBA 4L5JA 2OZUA 2VBZA 2QQBA 1U3EM 3PQJA 3E5XA 2VOPA 5AIQA 1O3SA 1R00A 2DFIA 1C0WA 4I2OA 5ICEA 5D5XB 1FBUA 5E1ZB 1YS7A 4HV6A 3FMSA 1OYWA 4U7BA 1FBQA 3F8NA 2P6TA 5LRSA 2EWNA 3KP5A 3BWGA 5BMZA 4U88A 1O3QA 2KJCA 3I5UA 5BPDA 1WQ2A 3K1MA 3IWFA 5L3FA 1TQIA 4QLCU 2ZNZA 4HQMA 2P8TA 4CO8A 1LVAA 3LSTA 1LDDA 2GWRA 3P7NA 1Z91A 1W7PB 3FHZA 5EEGA 2X0LA 4XLPF 1KA8A 1F5TA 2QBYB 4HV5A 1JE8A 3HSEA 6PAXA 1ZARA 5ERIA 3W6KB 4NHJA 4ZZDA 1HW1A 1O7FA 1QNTA 3QPHA 1ZGAA 2L4MA 1D8KA 3KEOA 3K0LA 3FWEA 2ISYA 4RGSA 1B4AA 1P4WA 1USSA 4Y17A 2STWA 3BP8A 1QZZA 3ZMZA 3CTAA 2TDXA 5L3BA 1XB4A 5FGMA 1R5GA 3VODA 2FOKA 1FLIA 5CLSA 1TQMA 1IUYA 2PBIA 1T39A 3OV8A 1JHHA 2QYOA 4WF2A 3AAFA 4I0AA 3KEQA 1K6OA 2XKOA 4A6DA 2P7VB 2G7UA 3Q5FA 3FZVA 4M9ZA 1RNLA 2EA2A 4OIQF 1SMYF 3MCZA 2ZFWA 3CUQC 3WTWC 3QAHA 4XRFA 1MDMA 4R79A 3I4PA 1LEAA 1B9NA 3E5QA 2EV0A 4CXFA 3KP2A 2H94A 3CJNA 2VC1A 1FZPB 4HF0A 4HX4A 1ZH5A 4ENKA 2A5YB 1OYYA 2YR2A 5FB2A 4Y15A 2LF7A 4QWQA 3RKYA 3VEPA 3F72A 5DCMB 3V7RA 4KMFA 1WWXA 1YFHA 1OMIA 3GZ5A 3E6BA 5ILVA 5HVQC 1DPRA 3GVAA 2G9WA 2VE9A 1A04A 1AWCA 1QBJA 2CG4A 2W57A 1WI9A 4Q4ZF 2DK8A 2H6CA 1EH7A 4MEYF 4L0YB 3C7JA 5HS7A 2XAHA 3HSRA 4IVNA 4U0VA 1J75A 5HDKA 4HF2A 2O8XA 4CYDA 3MQ0A 2OQGA 2M8EA 2P6SA 4M9SA 4RB1A 3HRSA 2EFPA 4OIPF 1E2XA 2CFXA 4YIIA 1KU7A 3R61A 2L3DA 1XD7A 2OBPA 3J81K 1P2FA 2GQQA 1X3UA 1PDNC 4A6EA 4G7OF 1P4AA 3ROUA 1BN5A 3RIRA 4XLNF 1TW3A 5E1WA 4EVIA 3BPVA 5E20A 5CVVA 2HOEA 4OINF 3V7CA 2M30A 1Z7UA 2PI0A 5DD8A 4ETSA 2OQRA 1SMTA 1TLHB 3K9TA 2WTEA 1KU2A 3IWZA 4P9UA 4PGGA 1ODDA 5CJ9A 1G6NA 2IPQX 2VE8A 1R1VA 2JSCA 2K27A 4I7HA 4BHBA 1FSHA 4KIFA 4WK8F 2STTA 4EMSA 4EJUA 1B1BA 1XSDA 1K7AA 2IA1A 2CWEA 5HLHA 1TBXA 1RUOA 2BE5F 4L9TA 2HTSA 5DUIA 2RNJA 3W6JB 2VXZA 2Y75A 1ZRDA 4E70A 1XGOA 4CZZA 3V8JA 1O3TA 5E18F 1PP8F 3HTSB 3NRVA 5LGNA 4N9IA 1WKMA 2BBYA 2FU4A 3WTUC 5HS9A 1YS6A 3D5LA 2DAOA 4ZYEA 1R5HA 1IRGA 3KP7A 2HGCA 4M71A 1JXSA 1I6XA 4AIKA 2F5CA 4MQVA 1O57A 2XAGA 5J8FA 1TQPA 2PG4A 4KT5C 3TO7A 2Z99A 1W7PA 2YPRA 3KE2A 3V7SA 4IJAA 4KUMA 4OMZA 2D45A 2QBYA 3TOBA 2HZTA 2EJRA 4RB3C 1BJAA 1T0FA 4HX7A 3KP4A 1BBYA 3HRMA 3ECOA 1I27A 5CYVA 3CUOA 3M7GA 3K2ZA 3U1DA 2XKPA 3C1DA 5E17F 4UVBA 2DW4A 4N0BA 4UVCA 3FXQA 2ZBKA 1XDUA 4UXNA 3D0SA 2LF8A 3TQNA 4XBFA 1T38A 1ZHFA 3C18A 2H6BA 5D5VB 3WTSC 1D8JA 5FO5A 3CO7C 1VTNC 2RQPA 4RGUA 4K2EA 2XV4S 3JTGA 3E6MA 2A3SA 3F8FA 4WXCA 1IF1A 3WG9A 2FE3A 4ESBA 5KVRA 4ESFA 3MFKA 2MA3A 3LA7A 3GO5A 2ESHA 1MJAA 5DYMA 2GA2A 1B6AA 3HOSA 3GFMA 4DNCA 2JTVA 3DPTA 1KQ0A 4ENNA 1FYMA 2IP2A 2HR3A 1S8NA 4XSXF 4WXHA 1XGNA 3FMRA 4RB2C 4MEXF 4BQAA 2Q0OA 3DF8A 3GW2A 5DCMA 4KN4X 1IN6A 3MZHA 4PZJA 4M73A 2DLLA 5KK1A 2ACJA 1U8RA 5D6FA 2EFWA 1YYVA 2GAUA 1CGPA 3E3VA 1ZN2A 4Z2YA 4BH9A 3ZP5A 3F23A 3GEZA 2FF4A 1S29A 4M72A 4HOBA 1YLFA 2O03A 1F9NA 2ZKZA 1YW8A 1HXDA 4B09A 2X4HA 1WRJA 1TTYA 4GO1A 3WTZA 5A2QK 1YW9A 1QQIA 2AS5F 3EETA 2FMYA 5TJJA 5HS8A 4WX9A 3BDDA 3RDIA 3GFJA 5JHUA 2H27A 5L3EA 4WCGA 5D8KB 2D2WA 1O3RA 2EA4A 2L54A 2GXBA 1R1TA 3JSPA 3BOQA 4ON0A 3ZMDA 4A5MA 4DQ2A 4NQWA 3DP7A 1LDJA 3KFWX 3G3ZA 1Z1DA 1FC3A 1G4DA 4LLGF 2QVOA 5LLQA 4EGYA 1MJBA 1W5TA 2QWWA 2V9VA 1E17A 2IJLA 4M6XA 2FNAA 3P9KA 4LB5A 1BI1A 1R7JA 3GFLA 3JSOA 1HKQA 4WXDA 4G6QA 4AWXB 1IXCA 1I1GA 4GXOA 4HLYA 1OKRA 1YQAA 1V4RA 1PP7U 1ZYRF 3BJ6A 1UB9A 2K7LA 1L0OC 2K4JA 1GVJA 2LSOA 1OYIA 4M6YA 2EK5A 3B73A 4H0EA 2ZO4A 2R3SA 1KQ8A 1BM9A 3I71A 1XDSA 4RAYA 2VBXA 1XN7A 5L3CA 4AD9A 2A61A 2L02A 4AIJA 3J7AO 1ZG1A 4IPAA 2HEOA 1HQCA 2UXXA 3TKYA 5LEJA 1K78B 3WGIA 3CLOA 1UHMA 4MNUA 5A2QZ 1S7OA 5DCFA 4ZYGA 5FD5A 5H20A 2MBFA 3V8KA 2XHKA 4EJTA 4EJVA 3TDZC 3SHFA 1H9TA 3IC7A 4M9XA 3C3WA 3L09A 2CO5A 4L9NA 3RKWA 1MKMA 2K86A 3WTVC 2VN2A 2VODA 3LQQA 3DXJF 2Q2EA 3ZPLA 2RGVA 3LA3A 4L18B 2FBHA 1FP1D 1Q1HA 3K69A 2GZWA 3L7WA 2HWVA 3LWFA 4UV9A 2IW5A 2FXAA 4ASNA 3G73A 1FWZA 2A07F 1ZLKA 2IA2A 3EYIA 5DD4A 1AOYA 1XMAA 3DFGA 3QP6A 3CO6C 4IRHA 4KNYA 1FY7A 2VBYA 2DPUA 3IKVA 3CUQB 3FX3A 3LFKA 5BPIA 3QU3A 3M8FA 4IRGA 1Z9CA 3HRUA 2GIVA 1JGSA 5K1YA 1U5TC 1IN5A 1SD5A 2L01A 2W24A 2DU9A 1ULYA 2XAQA 1R36A 1YIOA 4ESJA 2O61A 2VONA 1BC7C 2O6GE 1SFXA 1XSXA 5BQTA 2NAZA 4YG2F 1LNWA 3N97A 2HYGD 2J5PA 3MZYA 2W84A 3I54A 1FYLA 1S7AA 2YX4A 2E1NA 4BXUA 1ZLJA 1IN4A 2A69F 2H09A 3SZPA 1H0MA 4JBAA 1FNNA 1IAWA 1DDNA 1W7PD 5TRDA 4BAYA 1F4KA 1IZ1A 2BV6A 1ONVA 4XSZF 1MD0A 5DV5A 1LEBA 4HF1A 3U9GA 2RVCA 5DEQA 3QP5A 3H92A 4HA8A 4UHTA 2DQLA 2FRHA 3PFIA 4TV7A 2P5KA 2HKOA 1USTA 3F6OA 3K1PA 2HFHA 3JTHA 1YO5C 4HYEA 1U78A 1LQ1A 2VOOA 2WWYA 3FMQA 5ICFA 2CSOA 4P55A 3GX4X 1J59A 3T5XA 1CF7B 1PUEE 4O5VA 4O3MA 1FBSA 4EM1A 1UCRA 3KLOA 3OOPA 4KIGA 3ELKA 2PMUA 1L3LA 2IT0A 1FX7A 4EGZA 4LLNA 1Z6RA 2P5LC 1RZ4A 1IRFA 2Z5UA 3T1BA 1KU9A 4LGWA 2ZCWA 4EQQA 5HDNA 5F1RA 4YFNF 3MAJA 4ZZLA 4BYYA 4KYWA 1BIBA 3Q9VA 3KZZA 3WGHA 2E1CA 2FNPA 2KIMA 3ZMVA 4GYIA 1QO0D 2MLKA 2KRFA 2A68F 5ED4A 1ON2A 2WV0A 5LRRA 1IXSB 5J8CA 2FBKA 2RC4A 1TNTA 3REOA 1BI3A 2PN6A 2ZXJA 3T8RA 2OD5A 2J5OA 4ZH4F 3DQVC 4I98B 2F5EA 2CQKA 2EFNA 2P7CB 5H6RA 4ENMA 1BC8C 5IT9K 2XROA 3QOPA 3J81Z 3RJPA 4I0BA 4HAMA 3BROA 3R60A 2EFOA 1IXRC 2Y0MA 1FP2A 2DO7A 4G94A 5JI6A 1ZG3A 4Q5SF 5D6EA 2HQNA 2ZNYA 4IRIA 1IW7F 4RS8A 2QUFA 4OU0A 4Q48A 1BOAA 4FX0A 2G7HA 4MQ9F 1HSTA 5FFZA 3V4GA 5D8LB 4Q47A 2ELHA 1I1SA 3BJOA 4BHCA 1J2XA 3TO6A 1P6RA 2NNYA 5ICCA 3KZYA 4EJWA 1MGTA 4WWCA 4G7HF 1D5VA 1K78A 4O6JA 4PDKA 1GHCA 3DEUA 2ADUA 5D5WB 3GYHX 3HHGA 1HSJA 2O3FA 3RYRA 1OR7A 1EH8A 2OZ6A 3F8BA 3QPTA 5L3GA 2NYXA 4MGRA 3VFZA 3VOEA 4P9FA 2ZMEA 3M8EA 5ILSA 1ZGJA 1LDKB 3KCCA 3QRFF 5LGTA 4Y13A 3R0AA 2AXLA 2LKPA 5BS6A 3MEXA 1MJ9A 3DV8A 2CYYA 4RGXA 3L2CA 2L4AA 3SQNA 4HQEA 4OIOF 2DI3A 3RYPA 4AIHA 1J9IA 4KICA 1R1UA 3TOAA 3CUQA 1S6LA 2VC0A 3I64A 4R1HA 1FSEA 4PCQA 1ZAOA 2FSWA 4D0PA 2KIFA 3PQKA 2V1UA 3J80K 4L9VA 5IT9Z 3WU0A 3F8CA 3SXYA 1H9GA 3ULQB 4MTDA 4LB6B 4YFKF 3N4MA 5DDGA 5CVJA 3T0YA 4A2UA 4S05A 3SZTA 2W85A 2COMA 4LFUA 3E6CC 4UNOA 2PJPA 2HQRA 4JQFA 1J5YA 3HIFA 3MWMA 2QM3A 3WTTC 1HW2A 3R6SA 4ENJA 1LJ9A 1BIAA 2KKOA 1G3YA 3HTUA 1QGPA 2K4BA 3F3XA 4PGHA 2KIUA 4GGGA 1XMKA 3HSFA 5F64A 3WE3A 2GXGA 2QLZA 2QZ8A 2KJBA 2JZYA 5LHIA 3HOTA 5FFXA 4NB5A 1SAXA 3FF5A 4BHPA 4LG0B 5JVTA 2F2EA 4MHGA 2GA1A 4L0ZB 1CF7A 2NRAC 4RGRA 3B02A 4AVPA 2FMLA 2M87A 1YG2A 2IA0A 2FQ3A 3GFIA 3LQRA 4CHUA 3ZN1A 3WE2A 5E1XA 1SD6A 3Q9SA 3KP3A 2DTRA 3QU6A 1P92A 2Q8KA 3SFZA 1ZRFA 3GXOA 2PFBA 2LDUA 2Z33A 2HYFA 2CGPA 2FBIA 1XSVA 2E7WA 3J80Z 1IN8A 1HKTA 2QQAA 3I59A 2A6EF 5E8IA 4UUVA 1R58A 1FT9A 2QQ9A 2WC2A 2MH2A 4KN7X 2FA5A 2OAZA 4L5IA 3KP6A 4GYGA 4IF4A 3BY6A 3NQOA 1B59A 4IHSA 3GLXA 1QPMA 1JHFA 1RUNA 2RV8A 3L00A 5D4RA 2CW0F 2PEXA 4M74A 2HTJA 3EQLF 1Y0UA 4A5NA 4RAZA 2BEOA 4OIRF 3ECHA 5D4SA 3R0JA 3O3KA 3IRRA 3BJAA 4EM0B 4MTEA 2ZMEB 3P9IA 3FXRA 3VB2A 5LBQA 3F8MA 5JR3A 2V1XA 3V8LA 1B9MA 4YIFA 3ERED 3WTXC 3JW4A 4HW0A 4A0XA 1FYKA 1XCVA 2R7FA 2MD5A 3ABUA 3IHUA 1ZRCA 3O2PE 4CICA 5LEKA 2YX7A 2D1VA 2EB7A 5ICGA 5HDGA 3ZMTA 1T6SA 2E7XA 1XGSA 2DBBA 3ZMUA 4HBLA 3HHHA 2YU3A 1HW5A 3TGNA 2PMHA 1GXQA 4YFXF 3BPXA 4S04A 5CVIA 4U7DA 3NEUA 2BYVE 3RPQA 3IL2A 3TO9A 3R4KA 2JT1A 4LD5A 1YTYA 3GZ6A 4KA4A 3JAMK 3IRQA 2XAJA 1J0RA 2YSRA 5AONA 3I0TA 1UFMA 3RPUA 2RDPA 2P5VA 4A0YA 1QZYA 1SD4A 5FD6A 3E97A 4KFCA 1I5ZA 4IXAA 2JRTA 4LLLA 4OMYA 5E8GA 2MC3A 1T98A 4LK0F 1REPC 1R22A 3ISPA 1U5TB 2XUBA 3EYYA 2DT5A 2UZKA 3ZN0A 3F22A 3COAC 5H6QA 1HBXG 4G6DA 1DPUA 3WGGA 4LJZF 3ABTA 4HDUA 2BGCA 1W5SA 2FEZA 3M1EA 3LAJA 2F5FA 4R8HA 2EV5A 1K79A 4L9JA 2M5WA 5K5RA 5L3DA 1WSUA 2F5DA 2LNBA 5CVUA 5DUKA 2JPCA 5BOXA 4RB0A 3FM3A 1U2WA 5K5QA 3FM5A 2XRNA 1KYWA 2HDCA 1YW7A 1TW2A 4BNCA 4FX4A 1J7KA 1SFUA 4A0ZA 3WU1B 3RTRA 1LB2A 3T8TA 2XGXA 2V1DA 1EV7A 3GF2A 1ZREA 3ZMSA 3L9FA 5EEHA 3KLNA 4LMYA 1RI7A 3TDUC 2XIGA 3I59B 3H3UA 4LG0A 5FLXK 3ZQ7A 5D5UB 5ILUA 3E5UA 5AIPA 2HKXA 3JAMZ 5HLGA 4EM2A 2XAFA 4KMUX 3LA2A 4FHTA 5LHGA 4EJOA 3F6VA 2EFQA 5HOOA 4ZYDA 2RKHA 2Z9OA 1EH6A 3I53A 3GWZA 4HDVA 3U2RA 3BZ6A 2MH9A 1D3YA 1RIOH 4P5OA 4KIBA 2V6CA 2ETHA 4G8XA 2VT2A 2O0YA 5LHHA 3DPLC 3LAPA 4F7ZA 5HLIA 2RN7A 1FPQA 3RI4A 1NHAA 1OPCA 4KDPA 2DK5A 3F21A 1MDMB 3P9CA 3M9AA 5J6XA 3HUGA 5IT3A 3E6DA 4I09A 1BI0A 1O7LA 2R7DA 2M1BA 3CDHA 4U0WA 2Y48A 4ZYHA 1ON1A 3EDPA 3K1NA 4I01A 4U0YA 3O6BB 1G3WA 2UWMA 1XGMA 4CGZA 4UV8A 4IHTA 1DUXC 3H3ZA 5K5OA 1Z05A 1S3JA 3IKTA 2ISZA 1F1ZA 3S2WA 2IVMA 1XCBA 4UVAA 1G3TA 3HYIA 2W25A 1ZG5A 2ESNA 3RKXA 1SD7A 2Z3YA 2QENA 5CVRA 2DPDA 2M45A 3WODF 2P4WA 4LK1F 1KQ9A 1Z6TA 2XVCA 2PLYA 5FLXZ 1DP7P
chains in the Genus database with same CATH superfamily
1YJNI 2CQNA 4HZFA 2B0LA 3ZQQA 1I6HJ 3GUDA 3FXUA 2C6YA 4EV0A 2L9NA 4CCMA 3S15J 4JK1X 1TNSA 4G9YA 1ZELA 1AA7A 2HS5A 5F6FA 1STZA 5FKNA 4P96A 2VT3A 1BI2A 3K70C 4B44A 5LGUA 2VBWA 3S17J 2NVTJ 1PVEA 3ABLH 2CQ7A 4D9JA 4B8XA 2A6HF 2NNNA 4HLXA 2R7UA 2UXNA 3OYEA 3A0HC 2ZJ2A 4IHWA 2BY1A 2OU2A 4D5FA 1U6GA 2LVSA 1IN7A 1OCOH 4N9HA 1P4XA 4I02A 1MBEA 2AO9A 2IAIA 1QZEA 4Y4RA 4BQOA 4OOIA 1SFEA 1KYZA 1E3OC 3I58A 5TISC 2OCEA 3H1CA 3TBIA 2X1DA 5JFRA 1EF4A 3WTYC 2K02A 1FOKA 2V79A 4HNTA 1XS9A 1UHWA 1GXPA 4V2GA 1W4MA 3EUHA 4A12A 1R23A 1TWAJ 4HX8A 1YRNB 2D1HA 3LSGA 1V3FA 1UMQA 4CDGA 4A3JJ 3HRTA 1MZBA 2NVXJ 3DKWA 3HB9A 4FT8A 1GUUA 4BY7J 2CQQA 2LKXA 1RRJA 1AHDP 1KU3A 2EV6A 3X2QH 1KGSA 2OA4A 1G3SA 1JI8A 4RMNA 2XASA 4GRIA 4G7ZF 2LBFB 2MLGA 3BCAA 3KETA 1G59A 2NS0A 1ETOA 1VF9A 3VWBA 1HKSA 1U5TA 2IRFG 2PQ8A 4GCVA 2JJ7A 3ML6A 2DQRA 1T2KA 2JPBA 4L5JA 2OZUA 2VBZA 2QQBA 1U3EM 4M3FA 2CQXA 3PQJA 3E5XA 4EATA 4A3LJ 5AIQA 3BG3A 3TMOA 2VOPA 1O3SA 1R00A 2DFIA 4UB6C 1C0WA 1YX3A 4I2OA 5ICEA 5D5XB 1FBUA 5E1ZB 3OL3A 2FX0A 1YS7A 1QVTA 1K6YA 3PNVA 4RAFA 4Y7NJ 4HV6A 3FMSA 3SJMA 2HOTA 1OYWA 1MMNA 2COBA 3FK6A 3DPUA 1FBQA 3F8NA 2P6TA 5EGOB 4U7BA 4CA0A 2VKHA 4Y33A 5CQGA 5LRSA 5FKLA 3I4MJ 2EWNA 3KP5A 4V2FA 2Y9ZA 3BWGA 5BMZA 4JX6A 4U88A 1O3QA 3AG3H 2KJCA 1FOWA 2BY2A 1QA6A 3I5UA 2VKEA 2MD0A 5BPDA 3I55I 1Y56A 1S9HA 3L2RA 3H0DA 1WQ2A 3K1MA 2QSHX 3IWFA 1OCRH 3IP4B 5L3FA 4BDYA 1TQIA 4QLCU 3BR0A 2ZNZA 4C2UA 4HQMA 2P8TA 4CO8A 1LVAA 3LSTA 1LDDA 2GWRA 2GIZA 3ASOH 4E7SA 1MNMC 3P7NA 1Z91A 4CCKA 1SEUA 1RKWA 1W7PB 2JVGA 4QPOA 4XQFA 3FHZA 5EEGA 1SANA 3SEZA 3ZQCA 1IRXA 2X0LA 4XLPF 1IJWC 2LYCA 1KA8A 5FJ8J 2EBIA 3K4NA 2ZJPF 1F5TA 2QBYB 4HV5A 1JE8A 3HGGA 3HSEA 3S8PA 6PAXA 2ID3A 3BT9A 1ZARA 1HCRA 5ERIA 4W97A 3W6KB 4NC6A 1WHUA 1Z77A 2M0CA 3CP8A 3NAUA 2ZXIA 3G2BA 4NHJA 1UG0A 4ZZDA 3D5RC 2FJ1A 1HW1A 1O7FA 1QNTA 2H1KA 3QPHA 1ZGAA 2IGOA 3DEWA 2L4MA 1D8KA 3KEOA 3K0LA 3FWEA 1X2MA 2M8GX 5HNHA 2ISYA 3JR9A 4RGSA 1XC5A 1B4AA 3CCYA 4M6VA 2HYJA 1P4WA 1USSA 4Y17A 3RPUD 2STWA 2PMZN 1NG7A 3BP8A 2HI3A 4RBOA 2VQGA 1QZZA 2VQHA 3ZMZA 3CTAA 2TDXA 5L3BA 1XB4A 5FGMA 1R5GA 3VODA 2FOKA 4F55A 5K7FA 4YIRX 1FLIA 2EIKH 5CLSA 1TQMA 1IUYA 1EKEA 2B9SA 2PBIA 5CQEA 3ERMA 2LMDA 1JHHA 1PJRA 3OV8A 1T39A 2QYOA 4WF2A 4C2MJ 4NC8A 3AAFA 4BJ6C 5HODA 2DA6A 5F0CA 4I0AA 2DMPA 3KEQA 3MD2A 1K6OA 2XKOA 4A6DA 2LFBA 3CJRB 1KZHA 4ZC3A 3ZGKA 3MKWB 1YJ9I 4I76A 2P7VB 2WAFA 3ABKH 2G7UA 3Q5FA 3PM1A 3GTPJ 3CF2A 3FZVA 4M9ZA 1RNLA 2EA2A 4OIQF 3A03A 1SMYF 3MCZA 4PSWA 3A01B 3ABMH 2ZFWA 3CUQC 3WTWC 3QAHA 4XRFA 3BZKA 1MDMA 4XLAA 2CU7A 4FE7A 2WV1A 4R79A 2JMWA 1LEAA 3I4PA 3ZQIA 4C9YA 2BVMA 1B9NA 4NC7A 3E5QA 4DYRA 2Z1DA 2DA2A 4BQNA 2EV0A 4LITA 1V55H 3S1QJ 3S93A 3VPRA 1DQUA 4CXFA 3KP2A 3LSJA 3AKZA 1ZQ3P 3BR6A 2ZJQF 3HG9A 1WJDA 3K2AA 2H94A 3CJNA 2VC1A 4CH7A 2VI6A 1FZPB 2M3AA 2JVHA 3DU5A 4HF0A 4HX4A 3SEQA 1ZH5A 4ENKA 3IUOA 2Y0SA 3QODA 2A5YB 1OYYA 2YR2A 3CJQB 1MBJA 3B6AA 5FB2A 4Y15A 2DMUA 2ME6A 2ECBA 3CCUI 3FXKA 1FOXA 2LF7A 2IEKA 2DYRH 4QWQA 1ZKGA 3DU6A 3RKYA 2PX9A 3VEPA 3HKZA 3F72A 2R93J 1G2HA 5DCMB 1ORKA 3V7RA 4KMFA 1WWXA 1BL0A 5EDNA 1YFHA 1OMIA 3MKLA 3GZ5A 3E6BA 5ILVA 5HVQC 1DPRA 4CZCA 1F36A 4F92B 4B4CA 3OYHA 3GVAA 2G9WA 4N4OB 3AL0B 2VE9A 1A04A 3VSKA 4J19A 1AWCA 1QBJA 2CG4A 2W57A 1WI9A 3HGYA 4Q4ZF 1M1EB 2DK8A 2PJRB 2H6CA 3A02A 1K4TA 1EH7A 4MEYF 4L0YB 2LY2A 2KP6A 3S1NJ 2LG4A 3LSPA 1IDZA 5GPAA 3C7JA 2HXOA 2W7NA 4BE2A 5HS7A 2MC4A 2AQFA 2XAHA 1ETVA 2L5QA 3HSRA 1UAAA 4IVNA 2VJIA 4U0VA 4XKWA 1D0XA 1ENHA 1J75A 5HDKA 1I39A 4C3JJ 2JQ7A 4HF2A 2O8XA 4CYDA 2RAEA 3MQ0A 2OQGA 2M8EA 2P6SA 2W00A 4M9SA 4RB1A 3HRSA 3DBLB 2EFPA 2UUZA 4OIPF 1E2XA 1B72A 2CFXA 4YIIA 3GTLJ 5JLWA 4LIUA 1OCZH 1KU7A 1IRZA 1X1CA 3R61A 2L3DA 1XD7A 2OBPA 4MO7A 1P2FA 2K9QA 3J81K 2GQQA 1X3UA 1PDNC 4A6EA 4E7HA 1I50J 4G7OF 1P4AA 3QPSA 3SYTA 4N4NB 3ROUA 3ESWB 1BN5A 2W48A 4XLNF 3RIRA 1HLVA 1TW3A 5E1WA 4EVIA 1VQ7I 3K4BA 4HSRA 2R0QC 1HDDC 3BPVA 5E20A 5CVVA 3U1KA 2KPMA 2HOEA 4A3IJ 2E60A 3PSFA 4OINF 3H9JA 3V7CA 1WPKA 9ANTA 2M30A 3MN2A 1Z7UA 2PI0A 5J1YA 1YRNA 4NQWB 5DD8A 3BTLA 4ETSA 2OQRA 1SMTA 1TLHB 3K9TA 2JK3A 2DFEA 3L2UA 2A6TA 2WTEA 1KU2A 3CCEI 3IWZA 2H8RA 4P9UA 4PGGA 1ODDA 5CJ9A 1G6NA 4PFOA 3ZR8X 2IPQX 2VE8A 1R1VA 2GXAA 2JSCA 4LG3A 2K27A 2LBFA 1FMWA 3FXLA 4I7HA 4BHBA 3FDYA 1FSHA 5BNGA 2V7FA 4KIFA 4WK8F 2STTA 4EMSA 2R7TA 4EJUA 1K83J 1IV6A 2DJNA 5GTIC 1B1BA 1XSDA 3CC2I 3F0CA 4XN0A 1WFXA 4J00A 2IA1A 1K7AA 2CWEA 5HLHA 1TBXA 1MBKA 2L9RA 1ZK8A 3DCFA 1X19A 1RUOA 5F27A 1QPIA 2VJ4A 2BE5F 4L9TA 2HTSA 1P7IA 3GCMA 2NXNB 3ZXSA 2RNJA 3W6JB 2VXZA 2Y75A 2Y31A 5DUIA 1F43A 1ZRDA 2CUFA 2FUG2 4E70A 1XGOA 4CCNA 4KISA 4CZZA 3V8JA 1I3AA 1B8IB 1O3TA 5E18F 1PP8F 2QSGX 3HTSB 3NRVA 5C4XJ 5LGNA 4N9IA 3JRCA 1WKMA 4PSXA 1IO2A 3ZQLA 2ZJRF 5EGOA 5EG0B 2HVRA 2XSJC 1R49A 2BBYA 2DT7B 2H8WA 2FU4A 2L9SA 3W2VA 1POGA 5EZGA 4IQ4A 2VLAA 2VUMJ 3WTUC 5HS9A 1YS6A 3D5LA 2DAOA 4JX4A 3G1OA 4ZYEA 2EZKA 1R5HA 2XB0X 1IRGA 5DM7F 3KP7A 1MSEC 2HGCA 4M71A 3ZQFA 1JXSA 5JVGF 1JJ8C 1I6XA 3CDLA 1IUFA 3IH3A 2IGMA 4AIKA 5F04A 2F5CA 1X3ZB 4MQVA 3DLAA 1O57A 1UJ8A 2XAGA 3CESA 5J8FA 1TQPA 4UB8C 2Q1ZB 1W5CC 3D5SC 3RZDJ 2PG4A 4KT5C 3KYDB 3HOXJ 1XMXA 3TO7A 2XC7A 5FRNA 4W1UA 1WJAA 2Z99A 3KPHA 3FISA 1W7PA 2W4SA 2YPRA 3KE2A 3V7SA 5HLTA 1GVDA 2X6WA 1OCPA 2YUSA 4IJAA 5E3OA 4KUMA 2B63J 4OMZA 3IAM2 2D45A 2QBYA 2DXIA 2EINH 3TOBA 3NARA 3BR5A 2IBDA 4XRSA 2HZTA 4XR6A 4BU2A 4IOAF 2EJRA 2E34A 4RB3C 1BJAA 1T0FA 4HX7A 5F0HA 3DTIA 1D1CA 2JA5J 2HOAA 3S1RJ 2AQEA 3S3MA 1TZLA 3KP4A 1BBYA 3HRMA 3A2KA 3ECOA 2R7WA 1I27A 1X3WB 5CYVA 3CUOA 2WADA 3M7GA 1JUPA 2QGUA 3K2ZA 4X1EA 2RQQA 3U1DA 3OOUA 5JLXA 2XKPA 3DKXA 3C1DA 2IXSA 5KHDA 3G1MA 4QIWN 5E17F 4UVBA 2DW4A 1UHSA 4N0BA 4UVCA 2DMTA 3FXQA 2ZBKA 5H2FC 5IY5H 1P9QC 3OIPA 1KONA 1XX5A 3P5JA 1XDUA 1K61A 4UXNA 3D0SA 3M3YJ 2CUJA 2LF8A 3TQNA 4XBFA 4I99C 1T38A 1ZHFA 2VPLA 3C18A 1R5ID 2XSDC 2H6BA 5D5VB 1RR7A 5FRMA 3WTSC 3JRHA 5KNLA 2WB1A 1H8AC 4A3DJ 5FO5A 4LIVA 3CO7C 1D8JA 3FKJA 2DA4A 2L7ZA 5EZHA 2M7BA 1BA5A 3ZOBA 1VTNC 2RQPA 3BR1A 1VQNI 3UKGA 4RGUA 4K2EA 2XV4S 3JTGA 3E6MA 1JKRC 2A3SA 3F8FA 4A3EJ 1MSFC 2M7AA 3A01A 4WXCA 3PIOF 1IF1A 3WG9A 3BTJA 5KAIC 1WI3A 3MZ8A 2FE3A 4XL9A 1SFKA 3QYBA 1ETQA 1R4NB 2ZSHB 4ESBA 5KVRA 1JGGA 2CV2A 2E1MB 2EQRA 4ESFA 3HPHA 3MFKA 5E3NA 5M3FJ 3HOYJ 2E1OA 3S14J 2MA3A 2I10A 3LA7A 3GO5A 2ESHA 3C2BA 1MJAA 5DYMA 5J1RA 5DS9A 2WAQN 1AU7A 3OMYA 2VPRA 1W36D 2K9SA 2H1LA 2QA4I 3K4JA 2VXDA 2GA2A 4MFEA 1B6AA 3HOSA 4QTRA 5EJCA 3GFMA 2JTVA 3DPTA 4DNCA 4ZYAA 1KQ0A 4XK4A 5C44J 4ENNA 1RR8C 1FYMA 2IP2A 3HDDA 2HR3A 2KDOA 1S8NA 3HZJA 4XSXF 4WXHA 1XGNA 1A6QA 1VQOI 1SC7A 3FMRA 5FKMA 4RB2C 5GAGJ 3BLYA 4MEXF 1VQ6I 2P81A 4BQAA 4MFDA 1B72B 1G8XA 2Q0OA 3DF8A 1PUFB 2MYSA 3GW2A 5DCMA 3JRFA 4KN4X 1IN6A 3MZHA 3QYFA 4PZJA 2DA1A 1DU6A 4M73A 2D5VA 1LE8A 1UG2A 2DLLA 5KK1A 2ACJA 1U8RA 5D6FA 2HQ5A 1YYVA 2EFWA 2GAUA 1CGPA 3E3VA 1WJEA 1LFBA 1ZN2A 2X48A 3GTGJ 4Z2YA 5J1UA 2LR8A 4BH9A 3S32A 3ZQHA 4XLHA 1JT0A 4ZDLA 2PJRA 3W6VA 3ZP5A 3HL2A 4MIMA 2XGEA 3F23A 5IOZA 1YOVB 3GEZA 1DGWY 4UY8I 2FF4A 4KT6A 1S29A 4M72A 4HOBA 3JRGA 1YLFA 2O03A 3K4MA 2LH9A 2JA7J 5HNFA 4BGDA 1NK3P 3S16J 4M3DA 2LP0A 2Y69H 1F9NA 2ZKZA 3QQAA 1YW8A 1HXDA 1TT0A 2F6CA 4B09A 2X4HA 2KFDA 2F4IA 1WRJA 2L9VA 1ZGWA 1TTYA 1H88C 4GO1A 2DFHA 2DMNA 3RKQA 3WTZA 4IEJA 3RCOA 3VYSB 1BJZA 1Z21A 3K10A 4CCLA 1YW9A 3M07A 4XLFA 5A2QK 1QQIA 4BACA 3EETA 2AS5F 2DMQA 2FMYA 5TJJA 5HS8A 1Y1VJ 3BDDA 3RDIA 4WX9A 4A93J 4A3GJ 3GFJA 3LFUA 1BOBA 5LD2C 2V1NA 5JHUA 5J4VA 1YJWI 4QSHA 2H27A 2CS3A 3H0GJ 5L3EA 4WCGA 5D8KB 2D2WA 4CYCB 1O3RA 2EA4A 2K9MA 2L54A 2GXBA 1R1TA 3JSPA 4FE4A 3BOQA 4H4KC 4ON0A 3ZMDA 3OYNA 4CSWA 1V54H 2DJIA 2NS8A 4A5MA 1R4MB 4DQ2A 1JKQC 4NQWA 4RM2A 2NVQJ 3DP7A 1LDJA 3IAS2 1OISA 2XF6A 4G12A 3KFWX 3G3ZA 2BY0A 1Z1DA 3Q0VA 3JRBA 1T08B 2HQAA 1FC3A 1G4DA 2NS7A 4LLGF 2QVOA 2W82A 5LLQA 2BOLA 4EGYA 2DFFA 4E7JA 1MJBA 3A4CA 4UUTA 1W5TA 2QWWA 1TWFJ 4EEFG 2V9VA 1E17A 1Z3YA 2IJLA 2WBMA 4M6XA 2FNAA 4RM3A 1TL8A 3CCJI 3P9KA 1XTAA 4LB5A 4IOCF 1BI1A 4XN3A 1R7JA 3GFLA 3JSOA 1HKQA 4WXDA 1JTYA 4AIDA 1JKPC 2OPTA 4G6QA 4AWXB 1IXCA 1I1GA 2L0KA 2LOOA 4GXOA 4HLYA 4IO9F 1OKRA 1YQAA 4AYBN 2R7RA 2VASA 1V4RA 3PO2J 3ZQGA 3HEFA 2IGNA 1MNEA 4DJAA 1B8IA 4XOTA 1PP7U 1ZYRF 1V5FA 3BJ6A 3SZGA 4XNFA 1UB9A 2K7LA 1Y1WJ 3TL4X 1JT6A 3LOCA 2IS1A 1L0OC 2VQCA 5EG0A 4XRSG 2K4JA 1TP4A 1GVJA 2LSOA 1OYIA 3I3LA 3TW7A 4F52A 4A3FJ 4M6YA 2V9KA 5F08A 2EK5A 5FLVA 3B73A 1OR7C 4H0EA 3L2QA 2ZO4A 2R3SA 1IDYA 3H5AA 2JRMA 1VZ0A 3GMEA 2XGDA 5EF6A 1KQ8A 1BM9A 5FLMJ 2Y9YA 2MG4A 3I71A 3CP2A 1XDSA 4BXXJ 2ZMEC 4RAYA 5B1BH 3S3OA 2VBXA 1R9TJ 1XN7A 5KCMA 4MLOA 1K4SA 1IV8A 5IPAA 5L3CA 2HNHA 4AD9A 2A61A 2WA0A 3HXLA 2L02A 5LFAA 3DBRB 2GLOA 3H36A 5TGTA 4RLFA 2EZLA 5IYCJ 4AIJA 3K4CA 3J7AO 1VI0A 1VQ5I 1ZG1A 4IPAA 2HEOA 1HQCA 4BY1J 2UXXA 3OIQA 4D5CA 3TKYA 4HSTA 1FEXA 3AG2H 5LEJA 1K78B 2KHMA 3WGIA 1RPWA 3OYDA 4ZTFA 4OWRB 1ZR2A 3CLOA 1UHMA 5F0FA 4MNUA 5A2QZ 1S7OA 3DTEA 5M5WJ 5DCFA 4ZYGA 3O8GA 5FD5A 5H20A 2KIQA 3DWLE 2MBFA 2WY7Q 3V8KA 2JUCA 5C3EJ 1A36A 2XHKA 3NWSA 3RZOJ 4EJTA 3K4KA 2ID6A 3HOZJ 2XAUA 3GZNB 4EJVA 3O8HA 3TDZC 3Q0WA 3SHFA 4BXFA 1H9TA 3IC7A 5GP9A 1QHGA 4CUGA 4M9XA 2AXTC 4B43A 4BJ5C 4PFPA 3C3WA 3L09A 2CO5A 4L9NA 2EZHA 4HNUA 3RKWA 3EUKL 1MKMA 2K86A 1D0ZA 3WTVC 4XM3A 2VN2A 1VQLI 2VODA 4IKFA 3LSKA 2XF5A 3LQQA 3DXJF 3HJEA 2Q2EA 2KISA 3ZPLA 2RGVA 4E4HA 3LA3A 5M5YJ 4L18B 5JHFA 3S3NA 2FBHA 1MMSA 1FP1D 1A5JA 1Q1HA 2XPWA 4QPQA 3K69A 3HPGA 2GZWA 3L7WA 2HWVA 3LWFA 4UV9A 3CF5F 3DEEA 2VIXA 2IW5A 2FXAA 4ASNA 3G73A 1X4PA 1FWZA 3K70D 4AUXA 2A07F 1ZLKA 2IA2A 3EYIA 1S7EA 4YEJA 5DD4A 1MBFA 2EZIA 1XMAA 1AOYA 3DFGA 3QP6A 2OTJI 2K9NA 4PUSA 3CO6C 1SFOJ 4IRHA 2MFZA 4S0HB 1S5LC 3BTCA 3LMMA 1SAUA 5J4YA 4KNYA 1FY7A 2VBYA 4FETA 3WU2C 2L7MP 2DPUA 3IKVA 2DA3A 1LE8B 5K7HA 2LY1A 3CUQB 3FX3A 3LFKA 5BPIA 3QU3A 3M8FA 4IRGA 3FK7A 2LD5A 1MH4A 1Z9CA 1D1AA 1VQ8I 2WAEA 3HRUA 2QKMB 2RREA 2GIVA 1AKHB 1JGSA 2V9PA 3ONQA 1U5TC 5K1YA 1OLTA 1IN5A 2KRCA 3K7AJ 1SD5A 2L01A 2W24A 2DU9A 3FIWA 1ULYA 2XAQA 2K3FA 1R36A 3BG5A 4AU7A 1YIOA 2VKVA 3GBGA 4ESJA 2O61A 4Y52J 2VONA 1BC7C 2ZB9A 2O6GE 1SFXA 1ETYA 1XSXA 5BQTA 2NAZA 1NG6A 4YG2F 1LNWA 3A1YA 3N97A 2HYGD 2J5PA 1WGXA 2CUEA 1NK2P 2E35A 3MZYA 4ZJZA 1QHHD 3LL7A 4E7LA 1OCTC 2W84A 3I54A 4M3EA 1S7AA 2YX4A 4PJJA 2E1NA 1FYLA 3L2VA 4BXUA 1ZLJA 1IN4A 4II3A 4IHYA 1PUFA 5IYBJ 4FTHA 4ZTJA 1VQPI 2A69F 2H09A 3SZPA 1TWHJ 2OF7A 2P0WA 2EILH 3B6CA 1H0MA 4JBAA 1FNNA 1IAWA 1BR1A 3I9V2 1DDNA 1W7PD 5TRDA 4XIDA 4BAYA 3E0JB 1WJBA 3TP0A 4A3CJ 3CLQA 1F4KA 1IZ1A 2BV6A 1ONVA 4XSZF 3OS0A 1MD0A 1SVMA 5DV5A 2FQ4A 2K85A 1R71A 1LEBA 4HF1A 3U9GA 4BJTA 2RVCA 2JA6J 5DEQA 1NTCA 3QP5A 3OYFA 3H92A 4HA8A 2DN0A 1XG1A 2O8KA 4UHTA 2DQLA 2UV1A 1HA8A 2KRHA 3PSIA 2VL8A 2FRHA 3BTIA 3PFIA 4TV7A 2P5KA 2NOJB 2HKOA 2QKLB 1USTA 3F6OA 3K1PA 2HFHA 2OCCH 3JTHA 1YO5C 4HYEA 1U78A 3PFYA 4XICA 1W0UA 3H35A 3E1SA 3BCBA 1LQ1A 2WWYA 2VOOA 4F93B 2GOMA 3FMQA 5ICFA 5J3LA 1D5YA 2DA5A 1Y6IA 2CV0A 2CSOA 2AHQA 3PUFA 4P55A 3W2AA 3GX4X 1LPQA 3T5XA 1J59A 1CF7B 1PUEE 2LK2A 1GDTA 4O5VA 4O3MA 5F1JA 2R5ZB 3D1NI 1FBSA 4EM1A 2QEXI 1UCRA 3SFIA 3KLOA 3OOPA 4KIGA 3ELKA 4CYCA 2PMUA 3FKIJ 5B3SH 1L3LA 1MMAA 2RNGA 2IT0A 1FX7A 4EGZA 4LLNA 1Z6RA 3BQYA 1U8BA 2P5LC 2E2HJ 1RZ4A 1IRFA 2Z5UA 3RQIA 1FOYA 4PK4A 3T1BA 1KU9A 1YITI 1EA3A 4LGWA 2ZCWA 3VSLA 4EQQA 5HDNA 2M2EA 5F1RA 4YFNF 3CC4I 3MAJA 4ZZLA 2XDVA 3BR3A 2R7XA 4BYYA 4KYWA 1BIBA 1PYVA 3VYUB 3Q9VA 3QWLA 1DP3A 3KZZA 3WGHA 2E1CA 1FIAA 3SDGA 3LSMA 2FNPA 2KIMA 2IGKA 3Q0UA 4IZZA 1HDPA 3ZMVA 4GYIA 1QO0D 2ZXHA 3KX2A 2MLKA 2KRFA 2A68F 5ED4A 1ON2A 2BVLA 2WV0A 1X58A 4ABZA 1XPXA 5LRRA 1IXSB 4ZDOA 5J8CA 3FXJA 2FBKA 2RC4A 3M1CA 3OYAA 1TNTA 3REOA 4E7ZA 1BI3A 2PN6A 3OYLA 2ZXJA 3T8RA 2DT6A 2OD5A 2JN6A 1BR2A 4DZJA 2J5OA 4ZH4F 3DQVC 4I98B 4C30A 2F5EA 2CQKA 2EFNA 3VYRB 4E6KG 4XORA 5H6RA 2P7CB 4ENMA 1BC8C 1MH3A 1A31A 4AM3A 2XROA 3QOPA 1HC8A 1WH5A 5IT9K 3J81Z 4BEHB 4Z6YA 3RJPA 4I0BA 4HAMA 4XKCA 1UELB 3F9KA 3BROA 3R60A 2EFOA 1IXRC 2Y0MA 1FP2A 2DO7A 4PJNA 4G94A 2X1CA 5IP9J 5JI6A 1N78A 1ZG3A 4Q5SF 5D6EA 3L2WA 2HQNA 2ZNYA 2R4GA 4IRIA 2K5CA 4FCYA 1IW7F 1FTTA 4RS8A 1EJ9A 2QUFA 4OU0A 4Q48A 4FQGA 1BOAA 4FX0A 2FOWA 2G7HA 4MQ9F 3G4SI 3S2DJ 2DOEA 2PMZA 3TEDA 1HSTA 5FFZA 3V4GA 1O4XA 5D8LB 4Q47A 2ELHA 3CCLI 2Q2EB 1I1SA 3BJOA 2XF7A 4B48A 4BHCA 1J2XA 2X51A 2Y30A 3TO6A 1Z67A 1P6RA 1VQ4I 2NNYA 3CDIA 1MMGA 3KZYA 5ICCA 2R5YA 4BQQA 4EJWA 2IS2A 3BG9A 2VJJA 5KAFC 3OY9A 1MGTA 4WWCA 4G7HF 2X1EA 1D5VA 1K78A 4O6JA 4PDKA 1GHCA 3DEUA 2ADUA 2K3PA 1OQYA 5D5WB 3U21A 3BQZA 3GYHX 3HHGA 1HSJA 3LSHA 3K6GA 1ETXA 5FKKA 2O3FA 2R7OA 3BZCA 1E3HA 3OYBA 3RYRA 1OR7A 2Y0SN 1EH8A 3PNYA 2OZ6A 4ZDPA 3F8BA 4XLEA 3QPTA 5L3GA 3W3CA 1JKOC 2NYXA 2NVUB 4MGRA 4NUBA 4X0GA 3VFZA 3VOEA 1Y8RB 3OR1C 4P9FA 2ZMEA 3C2HA 3M8EA 1JUSA 3DKYA 4DZPA 2Y2ZA 5ILSA 1ZGJA 1V5EA 4BDZA 3N05A 4PJMA 3HKZN 4B3AA 1LDKB 3KCCA 2BZTA 2O5RA 3QRFF 5LGTA 5DTDA 4Y13A 2M34A 5GTHC 3CD6I 2KMUA 4ITVA 3R0AA 3FXMA 2AXLA 4UUSB 2LKPA 2F5VA 4CCJA 5BS6A 1WCMJ 3BG6A 2R7SA 3MEXA 4BBSJ 1W0TA 1MJ9A 2OC6A 3DV8A 4IX7A 2X6OA 2HDWA 1SVOA 1TWCJ 2CYYA 4RGXA 1YIJI 2E2JJ 3PNTA 3L2CA 2L4AA 4F3QA 3SQNA 4HQEA 4OIOF 2DI3A 1E3PA 2KQRA 2F48A 4FISA 4V19K 3RYPA 2HVQA 4AIHA 1J9IA 4D7NA 4KICA 4A69C 2NOGA 2EPFA 1RC9A 3CCRI 2M4KA 5B1AH 1R1UA 3TOAA 3CUQA 1S6LA 2VC0A 3I64A 4R1HA 1FSEA 4J01A 2V6EA 4PCQA 2LTPA 5B5EC 1VFCA 4BBRJ 1Y0NA 1ZAOA 3KIOA 1D0YA 5E3MA 2FSWA 2DYSH 4D0PA 2B7EA 2MW8A 2KIFA 3PQKA 2BHZA 2V1UA 1AKHA 3J80K 4D1QA 4L9VA 5IT9Z 3CMYA 2K9LA 3CCMI 3WU0A 4C2TA 3HOVJ 1DGRM 4DYCA 1X4OA 3EPZA 1LKXA 3F8CA 3SXYA 4DYQA 1H9GA 3ULQB 4MTDA 1J09A 4LB6B 5FROA 2GM4A 4YFKF 3N4MA 1D1BA 3AG1H 3MKZA 4HNVA 5DDGA 2QQ8A 5CVJA 3T0YA 3MKYB 4A2UA 4II2A 4S05A 5GAEJ 3SZTA 3KZIC 2W85A 1T56A 1R6RA 2COMA 2ZFUA 2CFOA 4LFUA 3RQ4A 2CW7A 3FXOA 1QVUA 3E6CC 4UNOA 2PJPA 4JOMA 2GOXB 2HQRA 2L2OA 1Z0XA 2HXIA 5J47A 4JQFA 1J5YA 3BC8A 3HIFA 3MWMA 3IV5A 2X9DA 1DU0A 4XOPA 1YHQI 4DW6A 5M3MJ 2QM3A 1WH7A 4AC0A 3JRAA 1S72I 1IG7A 3WTTC 1HW2A 2HOSA 4CCOA 1X1DA 1WVRA 3R6SA 2ZXWH 2OJED 3DTKA 4ENJA 3OWTA 1LJ9A 2LRDA 1BIAA 2KKOA 4BE0A 4XRMA 1G3YA 3HTUA 2BW3B 1QGPA 2K4BA 3H9QA 1ZTRA 3F3XA 4PGHA 2KIUA 4GGGA 3EUAA 5FKOA 2KDZA 1XMKA 3H5RA 3HSFA 5F64A 3WE3A 1RKTA 5IP7J 2GXGA 2KLOA 3V42A 2QLZA 3GTQJ 3W2WA 2QZ8A 2KJBA 3GLLA 2JZYA 5LHIA 2LLKA 3HOTA 1YE9A 1T95A 3VDXA 5FFXA 1X1AA 4NB5A 2E5ZA 3OS2A 2HZDA 1SAXA 2BHYA 3FF5A 4BHPA 4D7MA 3PIPF 2OTLI 1T0FC 2M9HA 4LG0B 2L7KA 2F2EA 5JVTA 5M5XJ 4MHGA 1A35A 1MNDA 3OYIA 4IQJA 2GA1A 3IH4A 1Y39A 4L0ZB 1CF7A 2NRAC 4RGRA 3B02A 2R5ZA 3TP3A 4X6AJ 2A05A 3OYJA 4AVPA 2FMLA 4A3KJ 2M87A 1LFPA 1YG2A 2IA0A 2FQ3A 3GFIA 3OYCA 3LQRA 4CHUA 3ZN1A 1IGNA 3WE2A 1W1WE 5E1XA 1SD6A 2K40A 3Q9SA 4XONA 3KP3A 3QOEA 1LFUP 3GTKJ 2KZGA 4OAZA 4RDUA 2XRLA 4B3XA 2DTRA 2O9LA 2XGCA 3QU6A 1P92A 3JRIA 2Q8KA 1YI2I 3SFZA 1Z3XA 1ZRFA 3GXOA 2PFBA 5IYDJ 2O7OA 1MIJA 2LDUA 2Z33A 3OL4A 2HYFA 3OYKA 2CGPA 2R7ZJ 2E5NA 1I3QJ 2FBIA 1XSVA 2E7WA 3J80Z 5B66C 3NWTA 1WJCA 1IN8A 1Q1VA 1MBGA 1HKTA 2QQAA 3I59A 2A6EF 3RSNA 5C4JJ 4A3BJ 1X1PA 1GV5A 5E8IA 4HG2A 4UUVA 2VJ5A 1R58A 2HU9A 3UR3C 4NDLA 1FT9A 2QQ9A 2WC2A 2MH2A 2F4OB 3HUGB 4KN7X 2FA5A 2OAZA 4L5IA 3KP6A 4GYGA 2R5YB 4IF4A 3BY6A 4HRIA 2E19A 3NQOA 1B59A 1GLNA 4IHSA 3GLXA 4NNJA 1QPMA 1JHFA 2R7QA 1RUNA 1U0JA 2EIJH 2RV8A 5GAHJ 2HVSA 3L00A 5D4RA 2KZVA 2VKDA 2CW0F 2PEXA 4E7IA 4BEHA 4M74A 1RETA 2HTJA 4IHVA 3EQLF 1Y0UA 3H3VK 4A5NA 4RAZA 1LUJB 2BEOA 4OIRF 2KT0A 3ECHA 5D4SA 2WY8Q 3H9GA 3OSFA 3R0JA 2BXZA 3O3KA 3IRRA 4C3IJ 3BJAA 2WB1N 3Q3SA 4MTEA 2ZMEB 4EM0B 3OSGA 3GTMJ 3P9IA 3FXRA 2OV7A 3VB2A 3HOWJ 5LBQA 3F8MA 4KJZA 3C2GA 3MVPA 5JR3A 2V1XA 3V8LA 3CMMA 1FTZA 3M8JA 3PJRA 1B9MA 3AL0C 4YIFA 3CMEI 1ERDA 3ERED 3WTXC 3JW4A 4HW0A 3OYMA 1N77A 2JA8J 3ZCOA 4A0XA 1FYKA 1XCVA 2R7FA 2MD5A 2TCTA 3ABUA 1ACIA 3IHUA 1ZRCA 3I4NJ 3EUHC 4BE1A 4JYKA 3O2PE 1E0EA 4CICA 1X2NA 1VNDA 3MMYB 5LEKA 2YX7A 2D1VA 2LY9A 2EB7A 2X85A 5ICGA 5HDGA 3ZMTA 1T6SA 2KL4A 2E7XA 1XGSA 2DBBA 3ZMUA 4HBLA 3J7AY 1GV2A 3FBNB 3HHHA 2EIMH 5K7ZA 4DIQA 2R7VA 2MSYA 3DBHB 2ELJA 2QF7A 2YU3A 1HW5A 3TGNA 2PMHA 1GXQA 4IL6C 4BS9A 3AG4H 4YFXF 3BPXA 5E3LA 3PO3J 4S04A 4G6TB 5CVIA 3ZRGA 4U7DA 3NEUA 2BYVE 2WAQA 5GPCA 2X6XA 1VQMI 3RPQA 2EH3A 4DOZA 4YRVA 3IL2A 3TO9A 2M4GA 2DODA 3J7YJ 3BR2A 3R4KA 2JT1A 4LD5A 1YTYA 1WJFA 3GZ6A 1T33A 4UUSA 1JJ6C 3ASNH 4BKXA 2ZSIB 1UZCA 4KA4A 3K4LA 3JAMK 5CPRB 4FASD 4OAYA 3CJTB 3JRDA 3IRQA 2XAJA 1J0RA 2CH0A 3KYCB 2VB6A 2YSRA 4XKBA 2Z2SB 2DDAA 5AONA 4IHXA 3LSRA 3I0TA 1UFMA 3RPUA 4DGWB 1W36C 1IC8A 2RDPA 2QSFX 1ETKA 2P5VA 4A0YA 1QZYA 1OJLA 2NVYJ 2DCEA 1SD4A 5FD6A 2E71A 1BW5A 2XPVA 1Y8QB 3E97A 4AVZA 4KFCA 3CQZJ 1I5ZA 4IXAA 2JRTA 3H5NA 5E79C 2V26A 4LLLA 5IOYA 2ELKA 4OMYA 5CKTA 5E8GA 1VQKI 2MC3A 1T98A 1APLC 4LK0F 3E7LA 1REPC 1R22A 3FBIB 4HEA2 1WZ2A 2N8GA 2ICWG 3ISPA 4JX5A 1U5TB 2XUBA 3QYEA 2TRTA 4XMYA 3LNQA 3EYYA 2DT5A 2Z16A 2UZKA 3ZN0A 3F22A 3COAC 3KEYA 2MGQA 5H6QA 1HBXG 3OR2C 4G6DA 1BR4A 1DPUA 2DOAA 3WGGA 2DOFA 4LJZF 2V4JC 3ABTA 1MMDA 2XB5A 4HDUA 3WHCA 2BGCA 4F91B 5EEAA 4E7KA 3M4OJ 2F4MB 1W5SA 1U9OA 2FEZA 3M1EA 1GT0C 3LAJA 2F5FA 4R8HA 3OIOA 2EV5A 4B1RA 1K79A 4L9JA 2M5WA 2L7FP 5K5RA 5L3DA 1WSUA 2F5DA 2LNBA 5CVUA 1WJ5A 1T8IA 5DUKA 3OS1A 2ECCA 1HOMA 1QU3A 4NBQA 2JPCA 3SDBA 5BOXA 4RB0A 4RLQA 3FM3A 1U2WA 5K5QA 2BY3A 4DBRA 5DM6F 3FM5A 2XRNA 1P7JA 1KYWA 3J7ZI 2HDCA 1YW7A 4GDFA 3S1MJ 4M3GA 1TW2A 2CRGA 4BNCA 2XPUA 1ETWA 3CCQI 2IS4A 4U87A 4FX4A 3G6EI 3G71I 1J7KA 4RA2A 1SFUA 4A0ZA 3WU1B 2BW3A 3JCUC 3RTRA 2CUZA 1MBHA 2LKSA 2R92J 4XKVA 1LB2A 2FD5A 3QPLA 3T8TA 4C3HJ 1U9NA 2XGXA 2DA7A 2V1DA 1EV7A 3GF2A 1ZREA 3ZMSA 3L9FA 2HPMA 2JA2A 5EEHA 3KLNA 2OUMA 4LMYA 5J40A 2JWTA 1RI7A 4BL0B 1CQTA 3TDUC 3CMAI 2XIGA 3I59B 1V5GA 3H3UA 4LG0A 5FLXK 3ZQ7A 4ANJA 5D5UB 4KITB 2HPIA 5ILUA 3E5UA 2JSPA 5AIPA 2HKXA 1NH3A 3JAMZ 3PUBA 5HLGA 3S2HJ 4EM2A 4DBQA 2XAFA 3HC7A 4AYBA 3JREA 4KMUX 3LA2A 4FHTA 1MW7A 5LHGA 2I5UA 4EJOA 4XLCA 3F6VA 2YU9J 2QCOA 2EFQA 5HOOA 4ZYDA 2IS6A 2RKHA 3A0BC 1VQ9I 3VYTB 4M3BA 4L5EA 3GTOJ 2Z9OA 2E2IJ 1EH6A 3I53A 5EYRA 3GWZA 2CW8A 3CCVI 4A3MJ 1JUMA 4HDVA 3U2RA 3BZ6A 2BXYA 2MH9A 1D3YA 1RIOH 4P5OA 1LVKA 3TW6A 1FMVA 4KIBA 1RESA 2MABA 2V6CA 2ETHA 4I6ZA 4G8XA 1YX5A 2VT2A 2CJJA 4PJ0C 5IP6A 1X1BA 2JUGA 2M0MA 2O0YA 3WHBA 3PL8A 5LHHA 4YELA 3BG7A 3DPLC 3LAPA 3HOUJ 4F7ZA 5HLIA 2RN7A 1FPQA 3RI4A 3I56I 1NHAA 2LC2A 3OYGA 1OPCA 4KDPA 2DK5A 4BUPA 3F21A 1MDMB 3P9CA 3M9AA 1FJLA 5J6XA 3HUGA 3L1PA 2E1MC 2ME0A 3G1LA 4P1WA 5IT3A 3HBLA 2CV1A 3KYLA 3E6DA 3HM5A 4LOCA 2G0EA 4I09A 2ZC2A 1BI0A 2W1OA 1ZR4A 2CMPA 1O7LA 2R7DA 3CCSI 4HPQA 2M1BA 1JTXA 1N75A 1OCCH 3CDHA 3CZ6A 1FIPA 4U0WA 2Y48A 2LREA 4ZYHA 1ON1A 1SVLA 3EDPA 3K1NA 1OFCX 1N25A 4I01A 4U0YA 3FHNA 3O6BB 1G3WA 2UWMA 1TT5B 1XGMA 5GADJ 4CGZA 4UV8A 4Y3OA 4IHTA 1DUXC 3H3ZA 1TWGJ 1TC3C 5K5OA 1Z05A 4PJLA 1S3JA 3IKTA 2DTZA 2ISZA 1QRYA 2I8DA 2E36A 1ITYA 1F1ZA 2GBYA 3S2WA 2IVMA 3DLLF 1XCBA 1H89C 2A5WA 4UVAA 3IH2A 1G3TA 2HDDA 3HYIA 3UNGC 2W25A 1Z7LA 4RAGA 2X6YA 1ZG5A 1A6IA 3GTJJ 2ESNA 4B47A 4JP0A 3RKXA 1SD7A 2Z3YA 4GFBA 2QENA 5CVRA 2DPDA 3CC7I 1HF0A 2M45A 3AFHA 3WODF 2P4WA 2VQLA 2DDBA 3LSIA 1BW6A 4LK1F 3WG7H 1KQ9A 1Z6TA 2XVCA 2PLYA 5FLXZ 2YS9A 1DP7P
chains in the Genus database with same CATH topology
4HZFA 2B0LA 3GUDA 3FXUA 2C6YA 4EV0A 4JK1X 1TNSA 4G9YA 2HS5A 5F6FA 1STZA 4P96A 2VT3A 1BI2A 5LGUA 2VBWA 4B8XA 2A6HF 2NNNA 4HLXA 2UXNA 2ZJ2A 2OU2A 1U6GA 1IN7A 4N9HA 1P4XA 4I02A 4OOIA 1SFEA 1KYZA 3I58A 5JFRA 3WTYC 2K02A 1FOKA 2V79A 1UHWA 1GXPA 1W4MA 3EUHA 4A12A 1R23A 4HX8A 2D1HA 1V3FA 4CDGA 3HRTA 1MZBA 3DKWA 4FT8A 1KU3A 2EV6A 1KGSA 2OA4A 1G3SA 2XASA 4G7ZF 2MLGA 3KETA 2NS0A 1HKSA 1U5TA 2IRFG 2PQ8A 4GCVA 3ML6A 2DQRA 1T2KA 2JPBA 4L5JA 2OZUA 2VBZA 2QQBA 1U3EM 3PQJA 3E5XA 2VOPA 5AIQA 1O3SA 1R00A 2DFIA 1C0WA 4I2OA 5ICEA 5D5XB 1FBUA 5E1ZB 1YS7A 4HV6A 3FMSA 1OYWA 4U7BA 1FBQA 3F8NA 2P6TA 5LRSA 2EWNA 3KP5A 3BWGA 5BMZA 4U88A 1O3QA 2KJCA 3I5UA 5BPDA 1WQ2A 3K1MA 3IWFA 5L3FA 1TQIA 4QLCU 2ZNZA 4HQMA 2P8TA 4CO8A 1LVAA 3LSTA 1LDDA 2GWRA 3P7NA 1Z91A 1W7PB 3FHZA 5EEGA 2X0LA 4XLPF 1KA8A 1F5TA 2QBYB 4HV5A 1JE8A 3HSEA 6PAXA 1ZARA 5ERIA 3W6KB 4NHJA 4ZZDA 1HW1A 1O7FA 1QNTA 3QPHA 1ZGAA 2L4MA 1D8KA 3KEOA 3K0LA 3FWEA 2ISYA 4RGSA 1B4AA 1P4WA 1USSA 4Y17A 2STWA 3BP8A 1QZZA 3ZMZA 3CTAA 2TDXA 5L3BA 1XB4A 5FGMA 1R5GA 3VODA 2FOKA 1FLIA 5CLSA 1TQMA 1IUYA 2PBIA 1T39A 3OV8A 1JHHA 2QYOA 4WF2A 3AAFA 4I0AA 3KEQA 1K6OA 2XKOA 4A6DA 2P7VB 2G7UA 3Q5FA 3FZVA 4M9ZA 1RNLA 2EA2A 4OIQF 1SMYF 3MCZA 2ZFWA 3CUQC 3WTWC 3QAHA 4XRFA 1MDMA 4R79A 3I4PA 1LEAA 1B9NA 3E5QA 2EV0A 4CXFA 3KP2A 2H94A 3CJNA 2VC1A 1FZPB 4HF0A 4HX4A 1ZH5A 4ENKA 2A5YB 1OYYA 2YR2A 5FB2A 4Y15A 2LF7A 4QWQA 3RKYA 3VEPA 3F72A 5DCMB 3V7RA 4KMFA 1WWXA 1YFHA 1OMIA 3GZ5A 3E6BA 5ILVA 5HVQC 1DPRA 3GVAA 2G9WA 2VE9A 1A04A 1AWCA 1QBJA 2CG4A 2W57A 1WI9A 4Q4ZF 2DK8A 2H6CA 1EH7A 4MEYF 4L0YB 3C7JA 5HS7A 2XAHA 3HSRA 4IVNA 4U0VA 1J75A 5HDKA 4HF2A 2O8XA 4CYDA 3MQ0A 2OQGA 2M8EA 2P6SA 4M9SA 4RB1A 3HRSA 2EFPA 4OIPF 1E2XA 2CFXA 4YIIA 1KU7A 3R61A 2L3DA 1XD7A 2OBPA 3J81K 1P2FA 2GQQA 1X3UA 1PDNC 4A6EA 4G7OF 1P4AA 3ROUA 1BN5A 3RIRA 4XLNF 1TW3A 5E1WA 4EVIA 3BPVA 5E20A 5CVVA 2HOEA 4OINF 3V7CA 2M30A 1Z7UA 2PI0A 5DD8A 4ETSA 2OQRA 1SMTA 1TLHB 3K9TA 2WTEA 1KU2A 3IWZA 4P9UA 4PGGA 1ODDA 5CJ9A 1G6NA 2IPQX 2VE8A 1R1VA 2JSCA 2K27A 4I7HA 4BHBA 1FSHA 4KIFA 4WK8F 2STTA 4EMSA 4EJUA 1B1BA 1XSDA 1K7AA 2IA1A 2CWEA 5HLHA 1TBXA 1RUOA 2BE5F 4L9TA 2HTSA 5DUIA 2RNJA 3W6JB 2VXZA 2Y75A 1ZRDA 4E70A 1XGOA 4CZZA 3V8JA 1O3TA 5E18F 1PP8F 3HTSB 3NRVA 5LGNA 4N9IA 1WKMA 2BBYA 2FU4A 3WTUC 5HS9A 1YS6A 3D5LA 2DAOA 4ZYEA 1R5HA 1IRGA 3KP7A 2HGCA 4M71A 1JXSA 1I6XA 4AIKA 2F5CA 4MQVA 1O57A 2XAGA 5J8FA 1TQPA 2PG4A 4KT5C 3TO7A 2Z99A 1W7PA 2YPRA 3KE2A 3V7SA 4IJAA 4KUMA 4OMZA 2D45A 2QBYA 3TOBA 2HZTA 2EJRA 4RB3C 1BJAA 1T0FA 4HX7A 3KP4A 1BBYA 3HRMA 3ECOA 1I27A 5CYVA 3CUOA 3M7GA 3K2ZA 3U1DA 2XKPA 3C1DA 5E17F 4UVBA 2DW4A 4N0BA 4UVCA 3FXQA 2ZBKA 1XDUA 4UXNA 3D0SA 2LF8A 3TQNA 4XBFA 1T38A 1ZHFA 3C18A 2H6BA 5D5VB 3WTSC 1D8JA 5FO5A 3CO7C 1VTNC 2RQPA 4RGUA 4K2EA 2XV4S 3JTGA 3E6MA 2A3SA 3F8FA 4WXCA 1IF1A 3WG9A 2FE3A 4ESBA 5KVRA 4ESFA 3MFKA 2MA3A 3LA7A 3GO5A 2ESHA 1MJAA 5DYMA 2GA2A 1B6AA 3HOSA 3GFMA 4DNCA 2JTVA 3DPTA 1KQ0A 4ENNA 1FYMA 2IP2A 2HR3A 1S8NA 4XSXF 4WXHA 1XGNA 3FMRA 4RB2C 4MEXF 4BQAA 2Q0OA 3DF8A 3GW2A 5DCMA 4KN4X 1IN6A 3MZHA 4PZJA 4M73A 2DLLA 5KK1A 2ACJA 1U8RA 5D6FA 2EFWA 1YYVA 2GAUA 1CGPA 3E3VA 1ZN2A 4Z2YA 4BH9A 3ZP5A 3F23A 3GEZA 2FF4A 1S29A 4M72A 4HOBA 1YLFA 2O03A 1F9NA 2ZKZA 1YW8A 1HXDA 4B09A 2X4HA 1WRJA 1TTYA 4GO1A 3WTZA 5A2QK 1YW9A 1QQIA 2AS5F 3EETA 2FMYA 5TJJA 5HS8A 4WX9A 3BDDA 3RDIA 3GFJA 5JHUA 2H27A 5L3EA 4WCGA 5D8KB 2D2WA 1O3RA 2EA4A 2L54A 2GXBA 1R1TA 3JSPA 3BOQA 4ON0A 3ZMDA 4A5MA 4DQ2A 4NQWA 3DP7A 1LDJA 3KFWX 3G3ZA 1Z1DA 1FC3A 1G4DA 4LLGF 2QVOA 5LLQA 4EGYA 1MJBA 1W5TA 2QWWA 2V9VA 1E17A 2IJLA 4M6XA 2FNAA 3P9KA 4LB5A 1BI1A 1R7JA 3GFLA 3JSOA 1HKQA 4WXDA 4G6QA 4AWXB 1IXCA 1I1GA 4GXOA 4HLYA 1OKRA 1YQAA 1V4RA 1PP7U 1ZYRF 3BJ6A 1UB9A 2K7LA 1L0OC 2K4JA 1GVJA 2LSOA 1OYIA 4M6YA 2EK5A 3B73A 4H0EA 2ZO4A 2R3SA 1KQ8A 1BM9A 3I71A 1XDSA 4RAYA 2VBXA 1XN7A 5L3CA 4AD9A 2A61A 2L02A 4AIJA 3J7AO 1ZG1A 4IPAA 2HEOA 1HQCA 2UXXA 3TKYA 5LEJA 1K78B 3WGIA 3CLOA 1UHMA 4MNUA 5A2QZ 1S7OA 5DCFA 4ZYGA 5FD5A 5H20A 2MBFA 3V8KA 2XHKA 4EJTA 4EJVA 3TDZC 3SHFA 1H9TA 3IC7A 4M9XA 3C3WA 3L09A 2CO5A 4L9NA 3RKWA 1MKMA 2K86A 3WTVC 2VN2A 2VODA 3LQQA 3DXJF 2Q2EA 3ZPLA 2RGVA 3LA3A 4L18B 2FBHA 1FP1D 1Q1HA 3K69A 2GZWA 3L7WA 2HWVA 3LWFA 4UV9A 2IW5A 2FXAA 4ASNA 3G73A 1FWZA 2A07F 1ZLKA 2IA2A 3EYIA 5DD4A 1AOYA 1XMAA 3DFGA 3QP6A 3CO6C 4IRHA 4KNYA 1FY7A 2VBYA 2DPUA 3IKVA 3CUQB 3FX3A 3LFKA 5BPIA 3QU3A 3M8FA 4IRGA 1Z9CA 3HRUA 2GIVA 1JGSA 5K1YA 1U5TC 1IN5A 1SD5A 2L01A 2W24A 2DU9A 1ULYA 2XAQA 1R36A 1YIOA 4ESJA 2O61A 2VONA 1BC7C 2O6GE 1SFXA 1XSXA 5BQTA 2NAZA 4YG2F 1LNWA 3N97A 2HYGD 2J5PA 3MZYA 2W84A 3I54A 1FYLA 1S7AA 2YX4A 2E1NA 4BXUA 1ZLJA 1IN4A 2A69F 2H09A 3SZPA 1H0MA 4JBAA 1FNNA 1IAWA 1DDNA 1W7PD 5TRDA 4BAYA 1F4KA 1IZ1A 2BV6A 1ONVA 4XSZF 1MD0A 5DV5A 1LEBA 4HF1A 3U9GA 2RVCA 5DEQA 3QP5A 3H92A 4HA8A 4UHTA 2DQLA 2FRHA 3PFIA 4TV7A 2P5KA 2HKOA 1USTA 3F6OA 3K1PA 2HFHA 3JTHA 1YO5C 4HYEA 1U78A 1LQ1A 2VOOA 2WWYA 3FMQA 5ICFA 2CSOA 4P55A 3GX4X 1J59A 3T5XA 1CF7B 1PUEE 4O5VA 4O3MA 1FBSA 4EM1A 1UCRA 3KLOA 3OOPA 4KIGA 3ELKA 2PMUA 1L3LA 2IT0A 1FX7A 4EGZA 4LLNA 1Z6RA 2P5LC 1RZ4A 1IRFA 2Z5UA 3T1BA 1KU9A 4LGWA 2ZCWA 4EQQA 5HDNA 5F1RA 4YFNF 3MAJA 4ZZLA 4BYYA 4KYWA 1BIBA 3Q9VA 3KZZA 3WGHA 2E1CA 2FNPA 2KIMA 3ZMVA 4GYIA 1QO0D 2MLKA 2KRFA 2A68F 5ED4A 1ON2A 2WV0A 5LRRA 1IXSB 5J8CA 2FBKA 2RC4A 1TNTA 3REOA 1BI3A 2PN6A 2ZXJA 3T8RA 2OD5A 2J5OA 4ZH4F 3DQVC 4I98B 2F5EA 2CQKA 2EFNA 2P7CB 5H6RA 4ENMA 1BC8C 5IT9K 2XROA 3QOPA 3J81Z 3RJPA 4I0BA 4HAMA 3BROA 3R60A 2EFOA 1IXRC 2Y0MA 1FP2A 2DO7A 4G94A 5JI6A 1ZG3A 4Q5SF 5D6EA 2HQNA 2ZNYA 4IRIA 1IW7F 4RS8A 2QUFA 4OU0A 4Q48A 1BOAA 4FX0A 2G7HA 4MQ9F 1HSTA 5FFZA 3V4GA 5D8LB 4Q47A 2ELHA 1I1SA 3BJOA 4BHCA 1J2XA 3TO6A 1P6RA 2NNYA 5ICCA 3KZYA 4EJWA 1MGTA 4WWCA 4G7HF 1D5VA 1K78A 4O6JA 4PDKA 1GHCA 3DEUA 2ADUA 5D5WB 3GYHX 3HHGA 1HSJA 2O3FA 3RYRA 1OR7A 1EH8A 2OZ6A 3F8BA 3QPTA 5L3GA 2NYXA 4MGRA 3VFZA 3VOEA 4P9FA 2ZMEA 3M8EA 5ILSA 1ZGJA 1LDKB 3KCCA 3QRFF 5LGTA 4Y13A 3R0AA 2AXLA 2LKPA 5BS6A 3MEXA 1MJ9A 3DV8A 2CYYA 4RGXA 3L2CA 2L4AA 3SQNA 4HQEA 4OIOF 2DI3A 3RYPA 4AIHA 1J9IA 4KICA 1R1UA 3TOAA 3CUQA 1S6LA 2VC0A 3I64A 4R1HA 1FSEA 4PCQA 1ZAOA 2FSWA 4D0PA 2KIFA 3PQKA 2V1UA 3J80K 4L9VA 5IT9Z 3WU0A 3F8CA 3SXYA 1H9GA 3ULQB 4MTDA 4LB6B 4YFKF 3N4MA 5DDGA 5CVJA 3T0YA 4A2UA 4S05A 3SZTA 2W85A 2COMA 4LFUA 3E6CC 4UNOA 2PJPA 2HQRA 4JQFA 1J5YA 3HIFA 3MWMA 2QM3A 3WTTC 1HW2A 3R6SA 4ENJA 1LJ9A 1BIAA 2KKOA 1G3YA 3HTUA 1QGPA 2K4BA 3F3XA 4PGHA 2KIUA 4GGGA 1XMKA 3HSFA 5F64A 3WE3A 2GXGA 2QLZA 2QZ8A 2KJBA 2JZYA 5LHIA 3HOTA 5FFXA 4NB5A 1SAXA 3FF5A 4BHPA 4LG0B 5JVTA 2F2EA 4MHGA 2GA1A 4L0ZB 1CF7A 2NRAC 4RGRA 3B02A 4AVPA 2FMLA 2M87A 1YG2A 2IA0A 2FQ3A 3GFIA 3LQRA 4CHUA 3ZN1A 3WE2A 5E1XA 1SD6A 3Q9SA 3KP3A 2DTRA 3QU6A 1P92A 2Q8KA 3SFZA 1ZRFA 3GXOA 2PFBA 2LDUA 2Z33A 2HYFA 2CGPA 2FBIA 1XSVA 2E7WA 3J80Z 1IN8A 1HKTA 2QQAA 3I59A 2A6EF 5E8IA 4UUVA 1R58A 1FT9A 2QQ9A 2WC2A 2MH2A 4KN7X 2FA5A 2OAZA 4L5IA 3KP6A 4GYGA 4IF4A 3BY6A 3NQOA 1B59A 4IHSA 3GLXA 1QPMA 1JHFA 1RUNA 2RV8A 3L00A 5D4RA 2CW0F 2PEXA 4M74A 2HTJA 3EQLF 1Y0UA 4A5NA 4RAZA 2BEOA 4OIRF 3ECHA 5D4SA 3R0JA 3O3KA 3IRRA 3BJAA 4EM0B 4MTEA 2ZMEB 3P9IA 3FXRA 3VB2A 5LBQA 3F8MA 5JR3A 2V1XA 3V8LA 1B9MA 4YIFA 3ERED 3WTXC 3JW4A 4HW0A 4A0XA 1FYKA 1XCVA 2R7FA 2MD5A 3ABUA 3IHUA 1ZRCA 3O2PE 4CICA 5LEKA 2YX7A 2D1VA 2EB7A 5ICGA 5HDGA 3ZMTA 1T6SA 2E7XA 1XGSA 2DBBA 3ZMUA 4HBLA 3HHHA 2YU3A 1HW5A 3TGNA 2PMHA 1GXQA 4YFXF 3BPXA 4S04A 5CVIA 4U7DA 3NEUA 2BYVE 3RPQA 3IL2A 3TO9A 3R4KA 2JT1A 4LD5A 1YTYA 3GZ6A 4KA4A 3JAMK 3IRQA 2XAJA 1J0RA 2YSRA 5AONA 3I0TA 1UFMA 3RPUA 2RDPA 2P5VA 4A0YA 1QZYA 1SD4A 5FD6A 3E97A 4KFCA 1I5ZA 4IXAA 2JRTA 4LLLA 4OMYA 5E8GA 2MC3A 1T98A 4LK0F 1REPC 1R22A 3ISPA 1U5TB 2XUBA 3EYYA 2DT5A 2UZKA 3ZN0A 3F22A 3COAC 5H6QA 1HBXG 4G6DA 1DPUA 3WGGA 4LJZF 3ABTA 4HDUA 2BGCA 1W5SA 2FEZA 3M1EA 3LAJA 2F5FA 4R8HA 2EV5A 1K79A 4L9JA 2M5WA 5K5RA 5L3DA 1WSUA 2F5DA 2LNBA 5CVUA 5DUKA 2JPCA 5BOXA 4RB0A 3FM3A 1U2WA 5K5QA 3FM5A 2XRNA 1KYWA 2HDCA 1YW7A 1TW2A 4BNCA 4FX4A 1J7KA 1SFUA 4A0ZA 3WU1B 3RTRA 1LB2A 3T8TA 2XGXA 2V1DA 1EV7A 3GF2A 1ZREA 3ZMSA 3L9FA 5EEHA 3KLNA 4LMYA 1RI7A 3TDUC 2XIGA 3I59B 3H3UA 4LG0A 5FLXK 3ZQ7A 5D5UB 5ILUA 3E5UA 5AIPA 2HKXA 3JAMZ 5HLGA 4EM2A 2XAFA 4KMUX 3LA2A 4FHTA 5LHGA 4EJOA 3F6VA 2EFQA 5HOOA 4ZYDA 2RKHA 2Z9OA 1EH6A 3I53A 3GWZA 4HDVA 3U2RA 3BZ6A 2MH9A 1D3YA 1RIOH 4P5OA 4KIBA 2V6CA 2ETHA 4G8XA 2VT2A 2O0YA 5LHHA 3DPLC 3LAPA 4F7ZA 5HLIA 2RN7A 1FPQA 3RI4A 1NHAA 1OPCA 4KDPA 2DK5A 3F21A 1MDMB 3P9CA 3M9AA 5J6XA 3HUGA 5IT3A 3E6DA 4I09A 1BI0A 1O7LA 2R7DA 2M1BA 3CDHA 4U0WA 2Y48A 4ZYHA 1ON1A 3EDPA 3K1NA 4I01A 4U0YA 3O6BB 1G3WA 2UWMA 1XGMA 4CGZA 4UV8A 4IHTA 1DUXC 3H3ZA 5K5OA 1Z05A 1S3JA 3IKTA 2ISZA 1F1ZA 3S2WA 2IVMA 1XCBA 4UVAA 1G3TA 3HYIA 2W25A 1ZG5A 2ESNA 3RKXA 1SD7A 2Z3YA 2QENA 5CVRA 2DPDA 2M45A 3WODF 2P4WA 4LK1F 1KQ9A 1Z6TA 2XVCA 2PLYA 5FLXZ 1DP7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZF A;  2B0L A;  3GUD A;  3FXU A;  2C6Y A;  4EV0 A;  4JK1 X;  1TNS A;  4G9Y A;  2HS5 A;  5F6F A;  1STZ A;  4P96 A;  2VT3 A;  1BI2 A;  5LGU A;  2VBW A;  4B8X A;  2A6H F;  2NNN A;  4HLX A;  2UXN A;  2ZJ2 A;  2OU2 A;  1U6G A;  1IN7 A;  4N9H A;  1P4X A;  4I02 A;  4OOI A;  1SFE A;  1KYZ A;  3I58 A;  5JFR A;  3WTY C;  2K02 A;  1FOK A;  2V79 A;  1UHW A;  1GXP A;  1W4M A;  3EUH A;  4A12 A;  1R23 A;  4HX8 A;  2D1H A;  1V3F A;  4CDG A;  3HRT A;  1MZB A;  3DKW A;  4FT8 A;  1KU3 A;  2EV6 A;  1KGS A;  2OA4 A;  1G3S A;  2XAS A;  4G7Z F;  2MLG A;  3KET A;  2NS0 A;  1HKS A;  1U5T A;  2IRF G;  2PQ8 A;  4GCV A;  3ML6 A;  2DQR A;  1T2K A;  2JPB A;  4L5J A;  2OZU A;  2VBZ A;  2QQB A;  1U3E M;  3PQJ A;  3E5X A;  2VOP A;  5AIQ A;  1O3S A;  1R00 A;  2DFI A;  1C0W A;  4I2O A;  5ICE A;  5D5X B;  1FBU A;  5E1Z B;  1YS7 A;  4HV6 A;  3FMS A;  1OYW A;  4U7B A;  1FBQ A;  3F8N A;  2P6T A;  5LRS A;  2EWN A;  3KP5 A;  3BWG A;  5BMZ A;  4U88 A;  1O3Q A;  2KJC A;  3I5U A;  5BPD A;  1WQ2 A;  3K1M A;  3IWF A;  5L3F A;  1TQI A;  4QLC U;  2ZNZ A;  4HQM A;  2P8T A;  4CO8 A;  1LVA A;  3LST A;  1LDD A;  2GWR A;  3P7N A;  1Z91 A;  1W7P B;  3FHZ A;  5EEG A;  2X0L A;  4XLP F;  1KA8 A;  1F5T A;  2QBY B;  4HV5 A;  1JE8 A;  3HSE A;  6PAX A;  1ZAR A;  5ERI A;  3W6K B;  4NHJ A;  4ZZD A;  1HW1 A;  1O7F A;  1QNT A;  3QPH A;  1ZGA A;  2L4M A;  1D8K A;  3KEO A;  3K0L A;  3FWE A;  2ISY A;  4RGS A;  1B4A A;  1P4W A;  1USS A;  4Y17 A;  2STW A;  3BP8 A;  1QZZ A;  3ZMZ A;  3CTA A;  2TDX A;  5L3B A;  1XB4 A;  5FGM A;  1R5G A;  3VOD A;  2FOK A;  1FLI A;  5CLS A;  1TQM A;  1IUY A;  2PBI A;  1T39 A;  3OV8 A;  1JHH A;  2QYO A;  4WF2 A;  3AAF A;  4I0A A;  3KEQ A;  1K6O A;  2XKO A;  4A6D A;  2P7V B;  2G7U A;  3Q5F A;  3FZV A;  4M9Z A;  1RNL A;  2EA2 A;  4OIQ F;  1SMY F;  3MCZ A;  2ZFW A;  3CUQ C;  3WTW C;  3QAH A;  4XRF A;  1MDM A;  4R79 A;  3I4P A;  1LEA A;  1B9N A;  3E5Q A;  2EV0 A;  4CXF A;  3KP2 A;  2H94 A;  3CJN A;  2VC1 A;  1FZP B;  4HF0 A;  4HX4 A;  1ZH5 A;  4ENK A;  2A5Y B;  1OYY A;  2YR2 A;  5FB2 A;  4Y15 A;  2LF7 A;  4QWQ A;  3RKY A;  3VEP A;  3F72 A;  5DCM B;  3V7R A;  4KMF A;  1WWX A;  1YFH A;  1OMI A;  3GZ5 A;  3E6B A;  5ILV A;  5HVQ C;  1DPR A;  3GVA A;  2G9W A;  2VE9 A;  1A04 A;  1AWC A;  1QBJ A;  2CG4 A;  2W57 A;  1WI9 A;  4Q4Z F;  2DK8 A;  2H6C A;  1EH7 A;  4MEY F;  4L0Y B;  3C7J A;  5HS7 A;  2XAH A;  3HSR A;  4IVN A;  4U0V A;  1J75 A;  5HDK A;  4HF2 A;  2O8X A;  4CYD A;  3MQ0 A;  2OQG A;  2M8E A;  2P6S A;  4M9S A;  4RB1 A;  3HRS A;  2EFP A;  4OIP F;  1E2X A;  2CFX A;  4YII A;  1KU7 A;  3R61 A;  2L3D A;  1XD7 A;  2OBP A;  3J81 K;  1P2F A;  2GQQ A;  1X3U A;  1PDN C;  4A6E A;  4G7O F;  1P4A A;  3ROU A;  1BN5 A;  3RIR A;  4XLN F;  1TW3 A;  5E1W A;  4EVI A;  3BPV A;  5E20 A;  5CVV A;  2HOE A;  4OIN F;  3V7C A;  2M30 A;  1Z7U A;  2PI0 A;  5DD8 A;  4ETS A;  2OQR A;  1SMT A;  1TLH B;  3K9T A;  2WTE A;  1KU2 A;  3IWZ A;  4P9U A;  4PGG A;  1ODD A;  5CJ9 A;  1G6N A;  2IPQ X;  2VE8 A;  1R1V A;  2JSC A;  2K27 A;  4I7H A;  4BHB A;  1FSH A;  4KIF A;  4WK8 F;  2STT A;  4EMS A;  4EJU A;  1B1B A;  1XSD A;  1K7A A;  2IA1 A;  2CWE A;  5HLH A;  1TBX A;  1RUO A;  2BE5 F;  4L9T A;  2HTS A;  5DUI A;  2RNJ A;  3W6J B;  2VXZ A;  2Y75 A;  1ZRD A;  4E70 A;  1XGO A;  4CZZ A;  3V8J A;  1O3T A;  5E18 F;  1PP8 F;  3HTS B;  3NRV A;  5LGN A;  4N9I A;  1WKM A;  2BBY A;  2FU4 A;  3WTU C;  5HS9 A;  1YS6 A;  3D5L A;  2DAO A;  4ZYE A;  1R5H A;  1IRG A;  3KP7 A;  2HGC A;  4M71 A;  1JXS A;  1I6X A;  4AIK A;  2F5C A;  4MQV A;  1O57 A;  2XAG A;  5J8F A;  1TQP A;  2PG4 A;  4KT5 C;  3TO7 A;  2Z99 A;  1W7P A;  2YPR A;  3KE2 A;  3V7S A;  4IJA A;  4KUM A;  4OMZ A;  2D45 A;  2QBY A;  3TOB A;  2HZT A;  2EJR A;  4RB3 C;  1BJA A;  1T0F A;  4HX7 A;  3KP4 A;  1BBY A;  3HRM A;  3ECO A;  1I27 A;  5CYV A;  3CUO A;  3M7G A;  3K2Z A;  3U1D A;  2XKP A;  3C1D A;  5E17 F;  4UVB A;  2DW4 A;  4N0B A;  4UVC A;  3FXQ A;  2ZBK A;  1XDU A;  4UXN A;  3D0S A;  2LF8 A;  3TQN A;  4XBF A;  1T38 A;  1ZHF A;  3C18 A;  2H6B A;  5D5V B;  3WTS C;  1D8J A;  5FO5 A;  3CO7 C;  1VTN C;  2RQP A;  4RGU A;  4K2E A;  2XV4 S;  3JTG A;  3E6M A;  2A3S A;  3F8F A;  4WXC A;  1IF1 A;  3WG9 A;  2FE3 A;  4ESB A;  5KVR A;  4ESF A;  3MFK A;  2MA3 A;  3LA7 A;  3GO5 A;  2ESH A;  1MJA A;  5DYM A;  2GA2 A;  1B6A A;  3HOS A;  3GFM A;  4DNC A;  2JTV A;  3DPT A;  1KQ0 A;  4ENN A;  1FYM A;  2IP2 A;  2HR3 A;  1S8N A;  4XSX F;  4WXH A;  1XGN A;  3FMR A;  4RB2 C;  4MEX F;  4BQA A;  2Q0O A;  3DF8 A;  3GW2 A;  5DCM A;  4KN4 X;  1IN6 A;  3MZH A;  4PZJ A;  4M73 A;  2DLL A;  5KK1 A;  2ACJ A;  1U8R A;  5D6F A;  2EFW A;  1YYV A;  2GAU A;  1CGP A;  3E3V A;  1ZN2 A;  4Z2Y A;  4BH9 A;  3ZP5 A;  3F23 A;  3GEZ A;  2FF4 A;  1S29 A;  4M72 A;  4HOB A;  1YLF A;  2O03 A;  1F9N A;  2ZKZ A;  1YW8 A;  1HXD A;  4B09 A;  2X4H A;  1WRJ A;  1TTY A;  4GO1 A;  3WTZ A;  5A2Q K;  1YW9 A;  1QQI A;  2AS5 F;  3EET A;  2FMY A;  5TJJ A;  5HS8 A;  4WX9 A;  3BDD A;  3RDI A;  3GFJ A;  5JHU A;  2H27 A;  5L3E A;  4WCG A;  5D8K B;  2D2W A;  1O3R A;  2EA4 A;  2L54 A;  2GXB A;  1R1T A;  3JSP A;  3BOQ A;  4ON0 A;  3ZMD A;  4A5M A;  4DQ2 A;  4NQW A;  3DP7 A;  1LDJ A;  3KFW X;  3G3Z A;  1Z1D A;  1FC3 A;  1G4D A;  4LLG F;  2QVO A;  5LLQ A;  4EGY A;  1MJB A;  1W5T A;  2QWW A;  2V9V A;  1E17 A;  2IJL A;  4M6X A;  2FNA A;  3P9K A;  4LB5 A;  1BI1 A;  1R7J A;  3GFL A;  3JSO A;  1HKQ A;  4WXD A;  4G6Q A;  4AWX B;  1IXC A;  1I1G A;  4GXO A;  4HLY A;  1OKR A;  1YQA A;  1V4R A;  1PP7 U;  1ZYR F;  3BJ6 A;  1UB9 A;  2K7L A;  1L0O C;  2K4J A;  1GVJ A;  2LSO A;  1OYI A;  4M6Y A;  2EK5 A;  3B73 A;  4H0E A;  2ZO4 A;  2R3S A;  1KQ8 A;  1BM9 A;  3I71 A;  1XDS A;  4RAY A;  2VBX A;  1XN7 A;  5L3C A;  4AD9 A;  2A61 A;  2L02 A;  4AIJ A;  3J7A O;  1ZG1 A;  4IPA A;  2HEO A;  1HQC A;  2UXX A;  3TKY A;  5LEJ A;  1K78 B;  3WGI A;  3CLO A;  1UHM A;  4MNU A;  5A2Q Z;  1S7O A;  5DCF A;  4ZYG A;  5FD5 A;  5H20 A;  2MBF A;  3V8K A;  2XHK A;  4EJT A;  4EJV A;  3TDZ C;  3SHF A;  1H9T A;  3IC7 A;  4M9X A;  3C3W A;  3L09 A;  2CO5 A;  4L9N A;  3RKW A;  1MKM A;  2K86 A;  3WTV C;  2VN2 A;  2VOD A;  3LQQ A;  3DXJ F;  2Q2E A;  3ZPL A;  2RGV A;  3LA3 A;  4L18 B;  2FBH A;  1FP1 D;  1Q1H A;  3K69 A;  2GZW A;  3L7W A;  2HWV A;  3LWF A;  4UV9 A;  2IW5 A;  2FXA A;  4ASN A;  3G73 A;  1FWZ A;  2A07 F;  1ZLK A;  2IA2 A;  3EYI A;  5DD4 A;  1AOY A;  1XMA A;  3DFG A;  3QP6 A;  3CO6 C;  4IRH A;  4KNY A;  1FY7 A;  2VBY A;  2DPU A;  3IKV A;  3CUQ B;  3FX3 A;  3LFK A;  5BPI A;  3QU3 A;  3M8F A;  4IRG A;  1Z9C A;  3HRU A;  2GIV A;  1JGS A;  5K1Y A;  1U5T C;  1IN5 A;  1SD5 A;  2L01 A;  2W24 A;  2DU9 A;  1ULY A;  2XAQ A;  1R36 A;  1YIO A;  4ESJ A;  2O61 A;  2VON A;  1BC7 C;  2O6G E;  1SFX A;  1XSX A;  5BQT A;  2NAZ A;  4YG2 F;  1LNW A;  3N97 A;  2HYG D;  2J5P A;  3MZY A;  2W84 A;  3I54 A;  1FYL A;  1S7A A;  2YX4 A;  2E1N A;  4BXU A;  1ZLJ A;  1IN4 A;  2A69 F;  2H09 A;  3SZP A;  1H0M A;  4JBA A;  1FNN A;  1IAW A;  1DDN A;  1W7P D;  5TRD A;  4BAY A;  1F4K A;  1IZ1 A;  2BV6 A;  1ONV A;  4XSZ F;  1MD0 A;  5DV5 A;  1LEB A;  4HF1 A;  3U9G A;  2RVC A;  5DEQ A;  3QP5 A;  3H92 A;  4HA8 A;  4UHT A;  2DQL A;  2FRH A;  3PFI A;  4TV7 A;  2P5K A;  2HKO A;  1UST A;  3F6O A;  3K1P A;  2HFH A;  3JTH A;  1YO5 C;  4HYE A;  1U78 A;  1LQ1 A;  2VOO A;  2WWY A;  3FMQ A;  5ICF A;  2CSO A;  4P55 A;  3GX4 X;  1J59 A;  3T5X A;  1CF7 B;  1PUE E;  4O5V A;  4O3M A;  1FBS A;  4EM1 A;  1UCR A;  3KLO A;  3OOP A;  4KIG A;  3ELK A;  2PMU A;  1L3L A;  2IT0 A;  1FX7 A;  4EGZ A;  4LLN A;  1Z6R A;  2P5L C;  1RZ4 A;  1IRF A;  2Z5U A;  3T1B A;  1KU9 A;  4LGW A;  2ZCW A;  4EQQ A;  5HDN A;  5F1R A;  4YFN F;  3MAJ A;  4ZZL A;  4BYY A;  4KYW A;  1BIB A;  3Q9V A;  3KZZ A;  3WGH A;  2E1C A;  2FNP A;  2KIM A;  3ZMV A;  4GYI A;  1QO0 D;  2MLK A;  2KRF A;  2A68 F;  5ED4 A;  1ON2 A;  2WV0 A;  5LRR A;  1IXS B;  5J8C A;  2FBK A;  2RC4 A;  1TNT A;  3REO A;  1BI3 A;  2PN6 A;  2ZXJ A;  3T8R A;  2OD5 A;  2J5O A;  4ZH4 F;  3DQV C;  4I98 B;  2F5E A;  2CQK A;  2EFN A;  2P7C B;  5H6R A;  4ENM A;  1BC8 C;  5IT9 K;  2XRO A;  3QOP A;  3J81 Z;  3RJP A;  4I0B A;  4HAM A;  3BRO A;  3R60 A;  2EFO A;  1IXR C;  2Y0M A;  1FP2 A;  2DO7 A;  4G94 A;  5JI6 A;  1ZG3 A;  4Q5S F;  5D6E A;  2HQN A;  2ZNY A;  4IRI A;  1IW7 F;  4RS8 A;  2QUF A;  4OU0 A;  4Q48 A;  1BOA A;  4FX0 A;  2G7H A;  4MQ9 F;  1HST A;  5FFZ A;  3V4G A;  5D8L B;  4Q47 A;  2ELH A;  1I1S A;  3BJO A;  4BHC A;  1J2X A;  3TO6 A;  1P6R A;  2NNY A;  5ICC A;  3KZY A;  4EJW A;  1MGT A;  4WWC A;  4G7H F;  1D5V A;  1K78 A;  4O6J A;  4PDK A;  1GHC A;  3DEU A;  2ADU A;  5D5W B;  3GYH X;  3HHG A;  1HSJ A;  2O3F A;  3RYR A;  1OR7 A;  1EH8 A;  2OZ6 A;  3F8B A;  3QPT A;  5L3G A;  2NYX A;  4MGR A;  3VFZ A;  3VOE A;  4P9F A;  2ZME A;  3M8E A;  5ILS A;  1ZGJ A;  1LDK B;  3KCC A;  3QRF F;  5LGT A;  4Y13 A;  3R0A A;  2AXL A;  2LKP A;  5BS6 A;  3MEX A;  1MJ9 A;  3DV8 A;  2CYY A;  4RGX A;  3L2C A;  2L4A A;  3SQN A;  4HQE A;  4OIO F;  2DI3 A;  3RYP A;  4AIH A;  1J9I A;  4KIC A;  1R1U A;  3TOA A;  3CUQ A;  1S6L A;  2VC0 A;  3I64 A;  4R1H A;  1FSE A;  4PCQ A;  1ZAO A;  2FSW A;  4D0P A;  2KIF A;  3PQK A;  2V1U A;  3J80 K;  4L9V A;  5IT9 Z;  3WU0 A;  3F8C A;  3SXY A;  1H9G A;  3ULQ B;  4MTD A;  4LB6 B;  4YFK F;  3N4M A;  5DDG A;  5CVJ A;  3T0Y A;  4A2U A;  4S05 A;  3SZT A;  2W85 A;  2COM A;  4LFU A;  3E6C C;  4UNO A;  2PJP A;  2HQR A;  4JQF A;  1J5Y A;  3HIF A;  3MWM A;  2QM3 A;  3WTT C;  1HW2 A;  3R6S A;  4ENJ A;  1LJ9 A;  1BIA A;  2KKO A;  1G3Y A;  3HTU A;  1QGP A;  2K4B A;  3F3X A;  4PGH A;  2KIU A;  4GGG A;  1XMK A;  3HSF A;  5F64 A;  3WE3 A;  2GXG A;  2QLZ A;  2QZ8 A;  2KJB A;  2JZY A;  5LHI A;  3HOT A;  5FFX A;  4NB5 A;  1SAX A;  3FF5 A;  4BHP A;  4LG0 B;  5JVT A;  2F2E A;  4MHG A;  2GA1 A;  4L0Z B;  1CF7 A;  2NRA C;  4RGR A;  3B02 A;  4AVP A;  2FML A;  2M87 A;  1YG2 A;  2IA0 A;  2FQ3 A;  3GFI A;  3LQR A;  4CHU A;  3ZN1 A;  3WE2 A;  5E1X A;  1SD6 A;  3Q9S A;  3KP3 A;  2DTR A;  3QU6 A;  1P92 A;  2Q8K A;  3SFZ A;  1ZRF A;  3GXO A;  2PFB A;  2LDU A;  2Z33 A;  2HYF A;  2CGP A;  2FBI A;  1XSV A;  2E7W A;  3J80 Z;  1IN8 A;  1HKT A;  2QQA A;  3I59 A;  2A6E F;  5E8I A;  4UUV A;  1R58 A;  1FT9 A;  2QQ9 A;  2WC2 A;  2MH2 A;  4KN7 X;  2FA5 A;  2OAZ A;  4L5I A;  3KP6 A;  4GYG A;  4IF4 A;  3BY6 A;  3NQO A;  1B59 A;  4IHS A;  3GLX A;  1QPM A;  1JHF A;  1RUN A;  2RV8 A;  3L00 A;  5D4R A;  2CW0 F;  2PEX A;  4M74 A;  2HTJ A;  3EQL F;  1Y0U A;  4A5N A;  4RAZ A;  2BEO A;  4OIR F;  3ECH A;  5D4S A;  3R0J A;  3O3K A;  3IRR A;  3BJA A;  4EM0 B;  4MTE A;  2ZME B;  3P9I A;  3FXR A;  3VB2 A;  5LBQ A;  3F8M A;  5JR3 A;  2V1X A;  3V8L A;  1B9M A;  4YIF A;  3ERE D;  3WTX C;  3JW4 A;  4HW0 A;  4A0X A;  1FYK A;  1XCV A;  2R7F A;  2MD5 A;  3ABU A;  3IHU A;  1ZRC A;  3O2P E;  4CIC A;  5LEK A;  2YX7 A;  2D1V A;  2EB7 A;  5ICG A;  5HDG A;  3ZMT A;  1T6S A;  2E7X A;  1XGS A;  2DBB A;  3ZMU A;  4HBL A;  3HHH A;  2YU3 A;  1HW5 A;  3TGN A;  2PMH A;  1GXQ A;  4YFX F;  3BPX A;  4S04 A;  5CVI A;  4U7D A;  3NEU A;  2BYV E;  3RPQ A;  3IL2 A;  3TO9 A;  3R4K A;  2JT1 A;  4LD5 A;  1YTY A;  3GZ6 A;  4KA4 A;  3JAM K;  3IRQ A;  2XAJ A;  1J0R A;  2YSR A;  5AON A;  3I0T A;  1UFM A;  3RPU A;  2RDP A;  2P5V A;  4A0Y A;  1QZY A;  1SD4 A;  5FD6 A;  3E97 A;  4KFC A;  1I5Z A;  4IXA A;  2JRT A;  4LLL A;  4OMY A;  5E8G A;  2MC3 A;  1T98 A;  4LK0 F;  1REP C;  1R22 A;  3ISP A;  1U5T B;  2XUB A;  3EYY A;  2DT5 A;  2UZK A;  3ZN0 A;  3F22 A;  3COA C;  5H6Q A;  1HBX G;  4G6D A;  1DPU A;  3WGG A;  4LJZ F;  3ABT A;  4HDU A;  2BGC A;  1W5S A;  2FEZ A;  3M1E A;  3LAJ A;  2F5F A;  4R8H A;  2EV5 A;  1K79 A;  4L9J A;  2M5W A;  5K5R A;  5L3D A;  1WSU A;  2F5D A;  2LNB A;  5CVU A;  5DUK A;  2JPC A;  5BOX A;  4RB0 A;  3FM3 A;  1U2W A;  5K5Q A;  3FM5 A;  2XRN A;  1KYW A;  2HDC A;  1YW7 A;  1TW2 A;  4BNC A;  4FX4 A;  1J7K A;  1SFU A;  4A0Z A;  3WU1 B;  3RTR A;  1LB2 A;  3T8T A;  2XGX A;  2V1D A;  1EV7 A;  3GF2 A;  1ZRE A;  3ZMS A;  3L9F A;  5EEH A;  3KLN A;  4LMY A;  1RI7 A;  3TDU C;  2XIG A;  3I59 B;  3H3U A;  4LG0 A;  5FLX K;  3ZQ7 A;  5D5U B;  5ILU A;  3E5U A;  5AIP A;  2HKX A;  3JAM Z;  5HLG A;  4EM2 A;  2XAF A;  4KMU X;  3LA2 A;  4FHT A;  5LHG A;  4EJO A;  3F6V A;  2EFQ A;  5HOO A;  4ZYD A;  2RKH A;  2Z9O A;  1EH6 A;  3I53 A;  3GWZ A;  4HDV A;  3U2R A;  3BZ6 A;  2MH9 A;  1D3Y A;  1RIO H;  4P5O A;  4KIB A;  2V6C A;  2ETH A;  4G8X A;  2VT2 A;  2O0Y A;  5LHH A;  3DPL C;  3LAP A;  4F7Z A;  5HLI A;  2RN7 A;  1FPQ A;  3RI4 A;  1NHA A;  1OPC A;  4KDP A;  2DK5 A;  3F21 A;  1MDM B;  3P9C A;  3M9A A;  5J6X A;  3HUG A;  5IT3 A;  3E6D A;  4I09 A;  1BI0 A;  1O7L A;  2R7D A;  2M1B A;  3CDH A;  4U0W A;  2Y48 A;  4ZYH A;  1ON1 A;  3EDP A;  3K1N A;  4I01 A;  4U0Y A;  3O6B B;  1G3W A;  2UWM A;  1XGM A;  4CGZ A;  4UV8 A;  4IHT A;  1DUX C;  3H3Z A;  5K5O A;  1Z05 A;  1S3J A;  3IKT A;  2ISZ A;  1F1Z A;  3S2W A;  2IVM A;  1XCB A;  4UVA A;  1G3T A;  3HYI A;  2W25 A;  1ZG5 A;  2ESN A;  3RKX A;  1SD7 A;  2Z3Y A;  2QEN A;  5CVR A;  2DPD A;  2M45 A;  3WOD F;  2P4W A;  4LK1 F;  1KQ9 A;  1Z6T A;  2XVC A;  2PLY A;  5FLX Z;  1DP7 P; 
#chains in the Genus database with same CATH topology
 1YJN I;  2CQN A;  4HZF A;  2B0L A;  3ZQQ A;  1I6H J;  3GUD A;  3FXU A;  2C6Y A;  4EV0 A;  2L9N A;  4CCM A;  3S15 J;  4JK1 X;  1TNS A;  4G9Y A;  1ZEL A;  1AA7 A;  2HS5 A;  5F6F A;  1STZ A;  5FKN A;  4P96 A;  2VT3 A;  1BI2 A;  3K70 C;  4B44 A;  5LGU A;  2VBW A;  3S17 J;  2NVT J;  1PVE A;  3ABL H;  2CQ7 A;  4D9J A;  4B8X A;  2A6H F;  2NNN A;  4HLX A;  2R7U A;  2UXN A;  3OYE A;  3A0H C;  2ZJ2 A;  4IHW A;  2BY1 A;  2OU2 A;  4D5F A;  1U6G A;  2LVS A;  1IN7 A;  1OCO H;  4N9H A;  1P4X A;  4I02 A;  1MBE A;  2AO9 A;  2IAI A;  1QZE A;  4Y4R A;  4BQO A;  4OOI A;  1SFE A;  1KYZ A;  1E3O C;  3I58 A;  5TIS C;  2OCE A;  3H1C A;  3TBI A;  2X1D A;  5JFR A;  1EF4 A;  3WTY C;  2K02 A;  1FOK A;  2V79 A;  4HNT A;  1XS9 A;  1UHW A;  1GXP A;  4V2G A;  1W4M A;  3EUH A;  4A12 A;  1R23 A;  1TWA J;  4HX8 A;  1YRN B;  2D1H A;  3LSG A;  1V3F A;  1UMQ A;  4CDG A;  4A3J J;  3HRT A;  1MZB A;  2NVX J;  3DKW A;  3HB9 A;  4FT8 A;  1GUU A;  4BY7 J;  2CQQ A;  2LKX A;  1RRJ A;  1AHD P;  1KU3 A;  2EV6 A;  3X2Q H;  1KGS A;  2OA4 A;  1G3S A;  1JI8 A;  4RMN A;  2XAS A;  4GRI A;  4G7Z F;  2LBF B;  2MLG A;  3BCA A;  3KET A;  1G59 A;  2NS0 A;  1ETO A;  1VF9 A;  3VWB A;  1HKS A;  1U5T A;  2IRF G;  2PQ8 A;  4GCV A;  2JJ7 A;  3ML6 A;  2DQR A;  1T2K A;  2JPB A;  4L5J A;  2OZU A;  2VBZ A;  2QQB A;  1U3E M;  4M3F A;  2CQX A;  3PQJ A;  3E5X A;  4EAT A;  4A3L J;  5AIQ A;  3BG3 A;  3TMO A;  2VOP A;  1O3S A;  1R00 A;  2DFI A;  4UB6 C;  1C0W A;  1YX3 A;  4I2O A;  5ICE A;  5D5X B;  1FBU A;  5E1Z B;  3OL3 A;  2FX0 A;  1YS7 A;  1QVT A;  1K6Y A;  3PNV A;  4RAF A;  4Y7N J;  4HV6 A;  3FMS A;  3SJM A;  2HOT A;  1OYW A;  1MMN A;  2COB A;  3FK6 A;  3DPU A;  1FBQ A;  3F8N A;  2P6T A;  5EGO B;  4U7B A;  4CA0 A;  2VKH A;  4Y33 A;  5CQG A;  5LRS A;  5FKL A;  3I4M J;  2EWN A;  3KP5 A;  4V2F A;  2Y9Z A;  3BWG A;  5BMZ A;  4JX6 A;  4U88 A;  1O3Q A;  3AG3 H;  2KJC A;  1FOW A;  2BY2 A;  1QA6 A;  3I5U A;  2VKE A;  2MD0 A;  5BPD A;  3I55 I;  1Y56 A;  1S9H A;  3L2R A;  3H0D A;  1WQ2 A;  3K1M A;  2QSH X;  3IWF A;  1OCR H;  3IP4 B;  5L3F A;  4BDY A;  1TQI A;  4QLC U;  3BR0 A;  2ZNZ A;  4C2U A;  4HQM A;  2P8T A;  4CO8 A;  1LVA A;  3LST A;  1LDD A;  2GWR A;  2GIZ A;  3ASO H;  4E7S A;  1MNM C;  3P7N A;  1Z91 A;  4CCK A;  1SEU A;  1RKW A;  1W7P B;  2JVG A;  4QPO A;  4XQF A;  3FHZ A;  5EEG A;  1SAN A;  3SEZ A;  3ZQC A;  1IRX A;  2X0L A;  4XLP F;  1IJW C;  2LYC A;  1KA8 A;  5FJ8 J;  2EBI A;  3K4N A;  2ZJP F;  1F5T A;  2QBY B;  4HV5 A;  1JE8 A;  3HGG A;  3HSE A;  3S8P A;  6PAX A;  2ID3 A;  3BT9 A;  1ZAR A;  1HCR A;  5ERI A;  4W97 A;  3W6K B;  4NC6 A;  1WHU A;  1Z77 A;  2M0C A;  3CP8 A;  3NAU A;  2ZXI A;  3G2B A;  4NHJ A;  1UG0 A;  4ZZD A;  3D5R C;  2FJ1 A;  1HW1 A;  1O7F A;  1QNT A;  2H1K A;  3QPH A;  1ZGA A;  2IGO A;  3DEW A;  2L4M A;  1D8K A;  3KEO A;  3K0L A;  3FWE A;  1X2M A;  2M8G X;  5HNH A;  2ISY A;  3JR9 A;  4RGS A;  1XC5 A;  1B4A A;  3CCY A;  4M6V A;  2HYJ A;  1P4W A;  1USS A;  4Y17 A;  3RPU D;  2STW A;  2PMZ N;  1NG7 A;  3BP8 A;  2HI3 A;  4RBO A;  2VQG A;  1QZZ A;  2VQH A;  3ZMZ A;  3CTA A;  2TDX A;  5L3B A;  1XB4 A;  5FGM A;  1R5G A;  3VOD A;  2FOK A;  4F55 A;  5K7F A;  4YIR X;  1FLI A;  2EIK H;  5CLS A;  1TQM A;  1IUY A;  1EKE A;  2B9S A;  2PBI A;  5CQE A;  3ERM A;  2LMD A;  1JHH A;  1PJR A;  3OV8 A;  1T39 A;  2QYO A;  4WF2 A;  4C2M J;  4NC8 A;  3AAF A;  4BJ6 C;  5HOD A;  2DA6 A;  5F0C A;  4I0A A;  2DMP A;  3KEQ A;  3MD2 A;  1K6O A;  2XKO A;  4A6D A;  2LFB A;  3CJR B;  1KZH A;  4ZC3 A;  3ZGK A;  3MKW B;  1YJ9 I;  4I76 A;  2P7V B;  2WAF A;  3ABK H;  2G7U A;  3Q5F A;  3PM1 A;  3GTP J;  3CF2 A;  3FZV A;  4M9Z A;  1RNL A;  2EA2 A;  4OIQ F;  3A03 A;  1SMY F;  3MCZ A;  4PSW A;  3A01 B;  3ABM H;  2ZFW A;  3CUQ C;  3WTW C;  3QAH A;  4XRF A;  3BZK A;  1MDM A;  4XLA A;  2CU7 A;  4FE7 A;  2WV1 A;  4R79 A;  2JMW A;  1LEA A;  3I4P A;  3ZQI A;  4C9Y A;  2BVM A;  1B9N A;  4NC7 A;  3E5Q A;  4DYR A;  2Z1D A;  2DA2 A;  4BQN A;  2EV0 A;  4LIT A;  1V55 H;  3S1Q J;  3S93 A;  3VPR A;  1DQU A;  4CXF A;  3KP2 A;  3LSJ A;  3AKZ A;  1ZQ3 P;  3BR6 A;  2ZJQ F;  3HG9 A;  1WJD A;  3K2A A;  2H94 A;  3CJN A;  2VC1 A;  4CH7 A;  2VI6 A;  1FZP B;  2M3A A;  2JVH A;  3DU5 A;  4HF0 A;  4HX4 A;  3SEQ A;  1ZH5 A;  4ENK A;  3IUO A;  2Y0S A;  3QOD A;  2A5Y B;  1OYY A;  2YR2 A;  3CJQ B;  1MBJ A;  3B6A A;  5FB2 A;  4Y15 A;  2DMU A;  2ME6 A;  2ECB A;  3CCU I;  3FXK A;  1FOX A;  2LF7 A;  2IEK A;  2DYR H;  4QWQ A;  1ZKG A;  3DU6 A;  3RKY A;  2PX9 A;  3VEP A;  3HKZ A;  3F72 A;  2R93 J;  1G2H A;  5DCM B;  1ORK A;  3V7R A;  4KMF A;  1WWX A;  1BL0 A;  5EDN A;  1YFH A;  1OMI A;  3MKL A;  3GZ5 A;  3E6B A;  5ILV A;  5HVQ C;  1DPR A;  4CZC A;  1F36 A;  4F92 B;  4B4C A;  3OYH A;  3GVA A;  2G9W A;  4N4O B;  3AL0 B;  2VE9 A;  1A04 A;  3VSK A;  4J19 A;  1AWC A;  1QBJ A;  2CG4 A;  2W57 A;  1WI9 A;  3HGY A;  4Q4Z F;  1M1E B;  2DK8 A;  2PJR B;  2H6C A;  3A02 A;  1K4T A;  1EH7 A;  4MEY F;  4L0Y B;  2LY2 A;  2KP6 A;  3S1N J;  2LG4 A;  3LSP A;  1IDZ A;  5GPA A;  3C7J A;  2HXO A;  2W7N A;  4BE2 A;  5HS7 A;  2MC4 A;  2AQF A;  2XAH A;  1ETV A;  2L5Q A;  3HSR A;  1UAA A;  4IVN A;  2VJI A;  4U0V A;  4XKW A;  1D0X A;  1ENH A;  1J75 A;  5HDK A;  1I39 A;  4C3J J;  2JQ7 A;  4HF2 A;  2O8X A;  4CYD A;  2RAE A;  3MQ0 A;  2OQG A;  2M8E A;  2P6S A;  2W00 A;  4M9S A;  4RB1 A;  3HRS A;  3DBL B;  2EFP A;  2UUZ A;  4OIP F;  1E2X A;  1B72 A;  2CFX A;  4YII A;  3GTL J;  5JLW A;  4LIU A;  1OCZ H;  1KU7 A;  1IRZ A;  1X1C A;  3R61 A;  2L3D A;  1XD7 A;  2OBP A;  4MO7 A;  1P2F A;  2K9Q A;  3J81 K;  2GQQ A;  1X3U A;  1PDN C;  4A6E A;  4E7H A;  1I50 J;  4G7O F;  1P4A A;  3QPS A;  3SYT A;  4N4N B;  3ROU A;  3ESW B;  1BN5 A;  2W48 A;  4XLN F;  3RIR A;  1HLV A;  1TW3 A;  5E1W A;  4EVI A;  1VQ7 I;  3K4B A;  4HSR A;  2R0Q C;  1HDD C;  3BPV A;  5E20 A;  5CVV A;  3U1K A;  2KPM A;  2HOE A;  4A3I J;  2E60 A;  3PSF A;  4OIN F;  3H9J A;  3V7C A;  1WPK A;  9ANT A;  2M30 A;  3MN2 A;  1Z7U A;  2PI0 A;  5J1Y A;  1YRN A;  4NQW B;  5DD8 A;  3BTL A;  4ETS A;  2OQR A;  1SMT A;  1TLH B;  3K9T A;  2JK3 A;  2DFE A;  3L2U A;  2A6T A;  2WTE A;  1KU2 A;  3CCE I;  3IWZ A;  2H8R A;  4P9U A;  4PGG A;  1ODD A;  5CJ9 A;  1G6N A;  4PFO A;  3ZR8 X;  2IPQ X;  2VE8 A;  1R1V A;  2GXA A;  2JSC A;  4LG3 A;  2K27 A;  2LBF A;  1FMW A;  3FXL A;  4I7H A;  4BHB A;  3FDY A;  1FSH A;  5BNG A;  2V7F A;  4KIF A;  4WK8 F;  2STT A;  4EMS A;  2R7T A;  4EJU A;  1K83 J;  1IV6 A;  2DJN A;  5GTI C;  1B1B A;  1XSD A;  3CC2 I;  3F0C A;  4XN0 A;  1WFX A;  4J00 A;  2IA1 A;  1K7A A;  2CWE A;  5HLH A;  1TBX A;  1MBK A;  2L9R A;  1ZK8 A;  3DCF A;  1X19 A;  1RUO A;  5F27 A;  1QPI A;  2VJ4 A;  2BE5 F;  4L9T A;  2HTS A;  1P7I A;  3GCM A;  2NXN B;  3ZXS A;  2RNJ A;  3W6J B;  2VXZ A;  2Y75 A;  2Y31 A;  5DUI A;  1F43 A;  1ZRD A;  2CUF A;  2FUG 2;  4E70 A;  1XGO A;  4CCN A;  4KIS A;  4CZZ A;  3V8J A;  1I3A A;  1B8I B;  1O3T A;  5E18 F;  1PP8 F;  2QSG X;  3HTS B;  3NRV A;  5C4X J;  5LGN A;  4N9I A;  3JRC A;  1WKM A;  4PSX A;  1IO2 A;  3ZQL A;  2ZJR F;  5EGO A;  5EG0 B;  2HVR A;  2XSJ C;  1R49 A;  2BBY A;  2DT7 B;  2H8W A;  2FU4 A;  2L9S A;  3W2V A;  1POG A;  5EZG A;  4IQ4 A;  2VLA A;  2VUM J;  3WTU C;  5HS9 A;  1YS6 A;  3D5L A;  2DAO A;  4JX4 A;  3G1O A;  4ZYE A;  2EZK A;  1R5H A;  2XB0 X;  1IRG A;  5DM7 F;  3KP7 A;  1MSE C;  2HGC A;  4M71 A;  3ZQF A;  1JXS A;  5JVG F;  1JJ8 C;  1I6X A;  3CDL A;  1IUF A;  3IH3 A;  2IGM A;  4AIK A;  5F04 A;  2F5C A;  1X3Z B;  4MQV A;  3DLA A;  1O57 A;  1UJ8 A;  2XAG A;  3CES A;  5J8F A;  1TQP A;  4UB8 C;  2Q1Z B;  1W5C C;  3D5S C;  3RZD J;  2PG4 A;  4KT5 C;  3KYD B;  3HOX J;  1XMX A;  3TO7 A;  2XC7 A;  5FRN A;  4W1U A;  1WJA A;  2Z99 A;  3KPH A;  3FIS A;  1W7P A;  2W4S A;  2YPR A;  3KE2 A;  3V7S A;  5HLT A;  1GVD A;  2X6W A;  1OCP A;  2YUS A;  4IJA A;  5E3O A;  4KUM A;  2B63 J;  4OMZ A;  3IAM 2;  2D45 A;  2QBY A;  2DXI A;  2EIN H;  3TOB A;  3NAR A;  3BR5 A;  2IBD A;  4XRS A;  2HZT A;  4XR6 A;  4BU2 A;  4IOA F;  2EJR A;  2E34 A;  4RB3 C;  1BJA A;  1T0F A;  4HX7 A;  5F0H A;  3DTI A;  1D1C A;  2JA5 J;  2HOA A;  3S1R J;  2AQE A;  3S3M A;  1TZL A;  3KP4 A;  1BBY A;  3HRM A;  3A2K A;  3ECO A;  2R7W A;  1I27 A;  1X3W B;  5CYV A;  3CUO A;  2WAD A;  3M7G A;  1JUP A;  2QGU A;  3K2Z A;  4X1E A;  2RQQ A;  3U1D A;  3OOU A;  5JLX A;  2XKP A;  3DKX A;  3C1D A;  2IXS A;  5KHD A;  3G1M A;  4QIW N;  5E17 F;  4UVB A;  2DW4 A;  1UHS A;  4N0B A;  4UVC A;  2DMT A;  3FXQ A;  2ZBK A;  5H2F C;  5IY5 H;  1P9Q C;  3OIP A;  1KON A;  1XX5 A;  3P5J A;  1XDU A;  1K61 A;  4UXN A;  3D0S A;  3M3Y J;  2CUJ A;  2LF8 A;  3TQN A;  4XBF A;  4I99 C;  1T38 A;  1ZHF A;  2VPL A;  3C18 A;  1R5I D;  2XSD C;  2H6B A;  5D5V B;  1RR7 A;  5FRM A;  3WTS C;  3JRH A;  5KNL A;  2WB1 A;  1H8A C;  4A3D J;  5FO5 A;  4LIV A;  3CO7 C;  1D8J A;  3FKJ A;  2DA4 A;  2L7Z A;  5EZH A;  2M7B A;  1BA5 A;  3ZOB A;  1VTN C;  2RQP A;  3BR1 A;  1VQN I;  3UKG A;  4RGU A;  4K2E A;  2XV4 S;  3JTG A;  3E6M A;  1JKR C;  2A3S A;  3F8F A;  4A3E J;  1MSF C;  2M7A A;  3A01 A;  4WXC A;  3PIO F;  1IF1 A;  3WG9 A;  3BTJ A;  5KAI C;  1WI3 A;  3MZ8 A;  2FE3 A;  4XL9 A;  1SFK A;  3QYB A;  1ETQ A;  1R4N B;  2ZSH B;  4ESB A;  5KVR A;  1JGG A;  2CV2 A;  2E1M B;  2EQR A;  4ESF A;  3HPH A;  3MFK A;  5E3N A;  5M3F J;  3HOY J;  2E1O A;  3S14 J;  2MA3 A;  2I10 A;  3LA7 A;  3GO5 A;  2ESH A;  3C2B A;  1MJA A;  5DYM A;  5J1R A;  5DS9 A;  2WAQ N;  1AU7 A;  3OMY A;  2VPR A;  1W36 D;  2K9S A;  2H1L A;  2QA4 I;  3K4J A;  2VXD A;  2GA2 A;  4MFE A;  1B6A A;  3HOS A;  4QTR A;  5EJC A;  3GFM A;  2JTV A;  3DPT A;  4DNC A;  4ZYA A;  1KQ0 A;  4XK4 A;  5C44 J;  4ENN A;  1RR8 C;  1FYM A;  2IP2 A;  3HDD A;  2HR3 A;  2KDO A;  1S8N A;  3HZJ A;  4XSX F;  4WXH A;  1XGN A;  1A6Q A;  1VQO I;  1SC7 A;  3FMR A;  5FKM A;  4RB2 C;  5GAG J;  3BLY A;  4MEX F;  1VQ6 I;  2P81 A;  4BQA A;  4MFD A;  1B72 B;  1G8X A;  2Q0O A;  3DF8 A;  1PUF B;  2MYS A;  3GW2 A;  5DCM A;  3JRF A;  4KN4 X;  1IN6 A;  3MZH A;  3QYF A;  4PZJ A;  2DA1 A;  1DU6 A;  4M73 A;  2D5V A;  1LE8 A;  1UG2 A;  2DLL A;  5KK1 A;  2ACJ A;  1U8R A;  5D6F A;  2HQ5 A;  1YYV A;  2EFW A;  2GAU A;  1CGP A;  3E3V A;  1WJE A;  1LFB A;  1ZN2 A;  2X48 A;  3GTG J;  4Z2Y A;  5J1U A;  2LR8 A;  4BH9 A;  3S32 A;  3ZQH A;  4XLH A;  1JT0 A;  4ZDL A;  2PJR A;  3W6V A;  3ZP5 A;  3HL2 A;  4MIM A;  2XGE A;  3F23 A;  5IOZ A;  1YOV B;  3GEZ A;  1DGW Y;  4UY8 I;  2FF4 A;  4KT6 A;  1S29 A;  4M72 A;  4HOB A;  3JRG A;  1YLF A;  2O03 A;  3K4M A;  2LH9 A;  2JA7 J;  5HNF A;  4BGD A;  1NK3 P;  3S16 J;  4M3D A;  2LP0 A;  2Y69 H;  1F9N A;  2ZKZ A;  3QQA A;  1YW8 A;  1HXD A;  1TT0 A;  2F6C A;  4B09 A;  2X4H A;  2KFD A;  2F4I A;  1WRJ A;  2L9V A;  1ZGW A;  1TTY A;  1H88 C;  4GO1 A;  2DFH A;  2DMN A;  3RKQ A;  3WTZ A;  4IEJ A;  3RCO A;  3VYS B;  1BJZ A;  1Z21 A;  3K10 A;  4CCL A;  1YW9 A;  3M07 A;  4XLF A;  5A2Q K;  1QQI A;  4BAC A;  3EET A;  2AS5 F;  2DMQ A;  2FMY A;  5TJJ A;  5HS8 A;  1Y1V J;  3BDD A;  3RDI A;  4WX9 A;  4A93 J;  4A3G J;  3GFJ A;  3LFU A;  1BOB A;  5LD2 C;  2V1N A;  5JHU A;  5J4V A;  1YJW I;  4QSH A;  2H27 A;  2CS3 A;  3H0G J;  5L3E A;  4WCG A;  5D8K B;  2D2W A;  4CYC B;  1O3R A;  2EA4 A;  2K9M A;  2L54 A;  2GXB A;  1R1T A;  3JSP A;  4FE4 A;  3BOQ A;  4H4K C;  4ON0 A;  3ZMD A;  3OYN A;  4CSW A;  1V54 H;  2DJI A;  2NS8 A;  4A5M A;  1R4M B;  4DQ2 A;  1JKQ C;  4NQW A;  4RM2 A;  2NVQ J;  3DP7 A;  1LDJ A;  3IAS 2;  1OIS A;  2XF6 A;  4G12 A;  3KFW X;  3G3Z A;  2BY0 A;  1Z1D A;  3Q0V A;  3JRB A;  1T08 B;  2HQA A;  1FC3 A;  1G4D A;  2NS7 A;  4LLG F;  2QVO A;  2W82 A;  5LLQ A;  2BOL A;  4EGY A;  2DFF A;  4E7J A;  1MJB A;  3A4C A;  4UUT A;  1W5T A;  2QWW A;  1TWF J;  4EEF G;  2V9V A;  1E17 A;  1Z3Y A;  2IJL A;  2WBM A;  4M6X A;  2FNA A;  4RM3 A;  1TL8 A;  3CCJ I;  3P9K A;  1XTA A;  4LB5 A;  4IOC F;  1BI1 A;  4XN3 A;  1R7J A;  3GFL A;  3JSO A;  1HKQ A;  4WXD A;  1JTY A;  4AID A;  1JKP C;  2OPT A;  4G6Q A;  4AWX B;  1IXC A;  1I1G A;  2L0K A;  2LOO A;  4GXO A;  4HLY A;  4IO9 F;  1OKR A;  1YQA A;  4AYB N;  2R7R A;  2VAS A;  1V4R A;  3PO2 J;  3ZQG A;  3HEF A;  2IGN A;  1MNE A;  4DJA A;  1B8I A;  4XOT A;  1PP7 U;  1ZYR F;  1V5F A;  3BJ6 A;  3SZG A;  4XNF A;  1UB9 A;  2K7L A;  1Y1W J;  3TL4 X;  1JT6 A;  3LOC A;  2IS1 A;  1L0O C;  2VQC A;  5EG0 A;  4XRS G;  2K4J A;  1TP4 A;  1GVJ A;  2LSO A;  1OYI A;  3I3L A;  3TW7 A;  4F52 A;  4A3F J;  4M6Y A;  2V9K A;  5F08 A;  2EK5 A;  5FLV A;  3B73 A;  1OR7 C;  4H0E A;  3L2Q A;  2ZO4 A;  2R3S A;  1IDY A;  3H5A A;  2JRM A;  1VZ0 A;  3GME A;  2XGD A;  5EF6 A;  1KQ8 A;  1BM9 A;  5FLM J;  2Y9Y A;  2MG4 A;  3I71 A;  3CP2 A;  1XDS A;  4BXX J;  2ZME C;  4RAY A;  5B1B H;  3S3O A;  2VBX A;  1R9T J;  1XN7 A;  5KCM A;  4MLO A;  1K4S A;  1IV8 A;  5IPA A;  5L3C A;  2HNH A;  4AD9 A;  2A61 A;  2WA0 A;  3HXL A;  2L02 A;  5LFA A;  3DBR B;  2GLO A;  3H36 A;  5TGT A;  4RLF A;  2EZL A;  5IYC J;  4AIJ A;  3K4C A;  3J7A O;  1VI0 A;  1VQ5 I;  1ZG1 A;  4IPA A;  2HEO A;  1HQC A;  4BY1 J;  2UXX A;  3OIQ A;  4D5C A;  3TKY A;  4HST A;  1FEX A;  3AG2 H;  5LEJ A;  1K78 B;  2KHM A;  3WGI A;  1RPW A;  3OYD A;  4ZTF A;  4OWR B;  1ZR2 A;  3CLO A;  1UHM A;  5F0F A;  4MNU A;  5A2Q Z;  1S7O A;  3DTE A;  5M5W J;  5DCF A;  4ZYG A;  3O8G A;  5FD5 A;  5H20 A;  2KIQ A;  3DWL E;  2MBF A;  2WY7 Q;  3V8K A;  2JUC A;  5C3E J;  1A36 A;  2XHK A;  3NWS A;  3RZO J;  4EJT A;  3K4K A;  2ID6 A;  3HOZ J;  2XAU A;  3GZN B;  4EJV A;  3O8H A;  3TDZ C;  3Q0W A;  3SHF A;  4BXF A;  1H9T A;  3IC7 A;  5GP9 A;  1QHG A;  4CUG A;  4M9X A;  2AXT C;  4B43 A;  4BJ5 C;  4PFP A;  3C3W A;  3L09 A;  2CO5 A;  4L9N A;  2EZH A;  4HNU A;  3RKW A;  3EUK L;  1MKM A;  2K86 A;  1D0Z A;  3WTV C;  4XM3 A;  2VN2 A;  1VQL I;  2VOD A;  4IKF A;  3LSK A;  2XF5 A;  3LQQ A;  3DXJ F;  3HJE A;  2Q2E A;  2KIS A;  3ZPL A;  2RGV A;  4E4H A;  3LA3 A;  5M5Y J;  4L18 B;  5JHF A;  3S3N A;  2FBH A;  1MMS A;  1FP1 D;  1A5J A;  1Q1H A;  2XPW A;  4QPQ A;  3K69 A;  3HPG A;  2GZW A;  3L7W A;  2HWV A;  3LWF A;  4UV9 A;  3CF5 F;  3DEE A;  2VIX A;  2IW5 A;  2FXA A;  4ASN A;  3G73 A;  1X4P A;  1FWZ A;  3K70 D;  4AUX A;  2A07 F;  1ZLK A;  2IA2 A;  3EYI A;  1S7E A;  4YEJ A;  5DD4 A;  1MBF A;  2EZI A;  1XMA A;  1AOY A;  3DFG A;  3QP6 A;  2OTJ I;  2K9N A;  4PUS A;  3CO6 C;  1SFO J;  4IRH A;  2MFZ A;  4S0H B;  1S5L C;  3BTC A;  3LMM A;  1SAU A;  5J4Y A;  4KNY A;  1FY7 A;  2VBY A;  4FET A;  3WU2 C;  2L7M P;  2DPU A;  3IKV A;  2DA3 A;  1LE8 B;  5K7H A;  2LY1 A;  3CUQ B;  3FX3 A;  3LFK A;  5BPI A;  3QU3 A;  3M8F A;  4IRG A;  3FK7 A;  2LD5 A;  1MH4 A;  1Z9C A;  1D1A A;  1VQ8 I;  2WAE A;  3HRU A;  2QKM B;  2RRE A;  2GIV A;  1AKH B;  1JGS A;  2V9P A;  3ONQ A;  1U5T C;  5K1Y A;  1OLT A;  1IN5 A;  2KRC A;  3K7A J;  1SD5 A;  2L01 A;  2W24 A;  2DU9 A;  3FIW A;  1ULY A;  2XAQ A;  2K3F A;  1R36 A;  3BG5 A;  4AU7 A;  1YIO A;  2VKV A;  3GBG A;  4ESJ A;  2O61 A;  4Y52 J;  2VON A;  1BC7 C;  2ZB9 A;  2O6G E;  1SFX A;  1ETY A;  1XSX A;  5BQT A;  2NAZ A;  1NG6 A;  4YG2 F;  1LNW A;  3A1Y A;  3N97 A;  2HYG D;  2J5P A;  1WGX A;  2CUE A;  1NK2 P;  2E35 A;  3MZY A;  4ZJZ A;  1QHH D;  3LL7 A;  4E7L A;  1OCT C;  2W84 A;  3I54 A;  4M3E A;  1S7A A;  2YX4 A;  4PJJ A;  2E1N A;  1FYL A;  3L2V A;  4BXU A;  1ZLJ A;  1IN4 A;  4II3 A;  4IHY A;  1PUF A;  5IYB J;  4FTH A;  4ZTJ A;  1VQP I;  2A69 F;  2H09 A;  3SZP A;  1TWH J;  2OF7 A;  2P0W A;  2EIL H;  3B6C A;  1H0M A;  4JBA A;  1FNN A;  1IAW A;  1BR1 A;  3I9V 2;  1DDN A;  1W7P D;  5TRD A;  4XID A;  4BAY A;  3E0J B;  1WJB A;  3TP0 A;  4A3C J;  3CLQ A;  1F4K A;  1IZ1 A;  2BV6 A;  1ONV A;  4XSZ F;  3OS0 A;  1MD0 A;  1SVM A;  5DV5 A;  2FQ4 A;  2K85 A;  1R71 A;  1LEB A;  4HF1 A;  3U9G A;  4BJT A;  2RVC A;  2JA6 J;  5DEQ A;  1NTC A;  3QP5 A;  3OYF A;  3H92 A;  4HA8 A;  2DN0 A;  1XG1 A;  2O8K A;  4UHT A;  2DQL A;  2UV1 A;  1HA8 A;  2KRH A;  3PSI A;  2VL8 A;  2FRH A;  3BTI A;  3PFI A;  4TV7 A;  2P5K A;  2NOJ B;  2HKO A;  2QKL B;  1UST A;  3F6O A;  3K1P A;  2HFH A;  2OCC H;  3JTH A;  1YO5 C;  4HYE A;  1U78 A;  3PFY A;  4XIC A;  1W0U A;  3H35 A;  3E1S A;  3BCB A;  1LQ1 A;  2WWY A;  2VOO A;  4F93 B;  2GOM A;  3FMQ A;  5ICF A;  5J3L A;  1D5Y A;  2DA5 A;  1Y6I A;  2CV0 A;  2CSO A;  2AHQ A;  3PUF A;  4P55 A;  3W2A A;  3GX4 X;  1LPQ A;  3T5X A;  1J59 A;  1CF7 B;  1PUE E;  2LK2 A;  1GDT A;  4O5V A;  4O3M A;  5F1J A;  2R5Z B;  3D1N I;  1FBS A;  4EM1 A;  2QEX I;  1UCR A;  3SFI A;  3KLO A;  3OOP A;  4KIG A;  3ELK A;  4CYC A;  2PMU A;  3FKI J;  5B3S H;  1L3L A;  1MMA A;  2RNG A;  2IT0 A;  1FX7 A;  4EGZ A;  4LLN A;  1Z6R A;  3BQY A;  1U8B A;  2P5L C;  2E2H J;  1RZ4 A;  1IRF A;  2Z5U A;  3RQI A;  1FOY A;  4PK4 A;  3T1B A;  1KU9 A;  1YIT I;  1EA3 A;  4LGW A;  2ZCW A;  3VSL A;  4EQQ A;  5HDN A;  2M2E A;  5F1R A;  4YFN F;  3CC4 I;  3MAJ A;  4ZZL A;  2XDV A;  3BR3 A;  2R7X A;  4BYY A;  4KYW A;  1BIB A;  1PYV A;  3VYU B;  3Q9V A;  3QWL A;  1DP3 A;  3KZZ A;  3WGH A;  2E1C A;  1FIA A;  3SDG A;  3LSM A;  2FNP A;  2KIM A;  2IGK A;  3Q0U A;  4IZZ A;  1HDP A;  3ZMV A;  4GYI A;  1QO0 D;  2ZXH A;  3KX2 A;  2MLK A;  2KRF A;  2A68 F;  5ED4 A;  1ON2 A;  2BVL A;  2WV0 A;  1X58 A;  4ABZ A;  1XPX A;  5LRR A;  1IXS B;  4ZDO A;  5J8C A;  3FXJ A;  2FBK A;  2RC4 A;  3M1C A;  3OYA A;  1TNT A;  3REO A;  4E7Z A;  1BI3 A;  2PN6 A;  3OYL A;  2ZXJ A;  3T8R A;  2DT6 A;  2OD5 A;  2JN6 A;  1BR2 A;  4DZJ A;  2J5O A;  4ZH4 F;  3DQV C;  4I98 B;  4C30 A;  2F5E A;  2CQK A;  2EFN A;  3VYR B;  4E6K G;  4XOR A;  5H6R A;  2P7C B;  4ENM A;  1BC8 C;  1MH3 A;  1A31 A;  4AM3 A;  2XRO A;  3QOP A;  1HC8 A;  1WH5 A;  5IT9 K;  3J81 Z;  4BEH B;  4Z6Y A;  3RJP A;  4I0B A;  4HAM A;  4XKC A;  1UEL B;  3F9K A;  3BRO A;  3R60 A;  2EFO A;  1IXR C;  2Y0M A;  1FP2 A;  2DO7 A;  4PJN A;  4G94 A;  2X1C A;  5IP9 J;  5JI6 A;  1N78 A;  1ZG3 A;  4Q5S F;  5D6E A;  3L2W A;  2HQN A;  2ZNY A;  2R4G A;  4IRI A;  2K5C A;  4FCY A;  1IW7 F;  1FTT A;  4RS8 A;  1EJ9 A;  2QUF A;  4OU0 A;  4Q48 A;  4FQG A;  1BOA A;  4FX0 A;  2FOW A;  2G7H A;  4MQ9 F;  3G4S I;  3S2D J;  2DOE A;  2PMZ A;  3TED A;  1HST A;  5FFZ A;  3V4G A;  1O4X A;  5D8L B;  4Q47 A;  2ELH A;  3CCL I;  2Q2E B;  1I1S A;  3BJO A;  2XF7 A;  4B48 A;  4BHC A;  1J2X A;  2X51 A;  2Y30 A;  3TO6 A;  1Z67 A;  1P6R A;  1VQ4 I;  2NNY A;  3CDI A;  1MMG A;  3KZY A;  5ICC A;  2R5Y A;  4BQQ A;  4EJW A;  2IS2 A;  3BG9 A;  2VJJ A;  5KAF C;  3OY9 A;  1MGT A;  4WWC A;  4G7H F;  2X1E A;  1D5V A;  1K78 A;  4O6J A;  4PDK A;  1GHC A;  3DEU A;  2ADU A;  2K3P A;  1OQY A;  5D5W B;  3U21 A;  3BQZ A;  3GYH X;  3HHG A;  1HSJ A;  3LSH A;  3K6G A;  1ETX A;  5FKK A;  2O3F A;  2R7O A;  3BZC A;  1E3H A;  3OYB A;  3RYR A;  1OR7 A;  2Y0S N;  1EH8 A;  3PNY A;  2OZ6 A;  4ZDP A;  3F8B A;  4XLE A;  3QPT A;  5L3G A;  3W3C A;  1JKO C;  2NYX A;  2NVU B;  4MGR A;  4NUB A;  4X0G A;  3VFZ A;  3VOE A;  1Y8R B;  3OR1 C;  4P9F A;  2ZME A;  3C2H A;  3M8E A;  1JUS A;  3DKY A;  4DZP A;  2Y2Z A;  5ILS A;  1ZGJ A;  1V5E A;  4BDZ A;  3N05 A;  4PJM A;  3HKZ N;  4B3A A;  1LDK B;  3KCC A;  2BZT A;  2O5R A;  3QRF F;  5LGT A;  5DTD A;  4Y13 A;  2M34 A;  5GTH C;  3CD6 I;  2KMU A;  4ITV A;  3R0A A;  3FXM A;  2AXL A;  4UUS B;  2LKP A;  2F5V A;  4CCJ A;  5BS6 A;  1WCM J;  3BG6 A;  2R7S A;  3MEX A;  4BBS J;  1W0T A;  1MJ9 A;  2OC6 A;  3DV8 A;  4IX7 A;  2X6O A;  2HDW A;  1SVO A;  1TWC J;  2CYY A;  4RGX A;  1YIJ I;  2E2J J;  3PNT A;  3L2C A;  2L4A A;  4F3Q A;  3SQN A;  4HQE A;  4OIO F;  2DI3 A;  1E3P A;  2KQR A;  2F48 A;  4FIS A;  4V19 K;  3RYP A;  2HVQ A;  4AIH A;  1J9I A;  4D7N A;  4KIC A;  4A69 C;  2NOG A;  2EPF A;  1RC9 A;  3CCR I;  2M4K A;  5B1A H;  1R1U A;  3TOA A;  3CUQ A;  1S6L A;  2VC0 A;  3I64 A;  4R1H A;  1FSE A;  4J01 A;  2V6E A;  4PCQ A;  2LTP A;  5B5E C;  1VFC A;  4BBR J;  1Y0N A;  1ZAO A;  3KIO A;  1D0Y A;  5E3M A;  2FSW A;  2DYS H;  4D0P A;  2B7E A;  2MW8 A;  2KIF A;  3PQK A;  2BHZ A;  2V1U A;  1AKH A;  3J80 K;  4D1Q A;  4L9V A;  5IT9 Z;  3CMY A;  2K9L A;  3CCM I;  3WU0 A;  4C2T A;  3HOV J;  1DGR M;  4DYC A;  1X4O A;  3EPZ A;  1LKX A;  3F8C A;  3SXY A;  4DYQ A;  1H9G A;  3ULQ B;  4MTD A;  1J09 A;  4LB6 B;  5FRO A;  2GM4 A;  4YFK F;  3N4M A;  1D1B A;  3AG1 H;  3MKZ A;  4HNV A;  5DDG A;  2QQ8 A;  5CVJ A;  3T0Y A;  3MKY B;  4A2U A;  4II2 A;  4S05 A;  5GAE J;  3SZT A;  3KZI C;  2W85 A;  1T56 A;  1R6R A;  2COM A;  2ZFU A;  2CFO A;  4LFU A;  3RQ4 A;  2CW7 A;  3FXO A;  1QVU A;  3E6C C;  4UNO A;  2PJP A;  4JOM A;  2GOX B;  2HQR A;  2L2O A;  1Z0X A;  2HXI A;  5J47 A;  4JQF A;  1J5Y A;  3BC8 A;  3HIF A;  3MWM A;  3IV5 A;  2X9D A;  1DU0 A;  4XOP A;  1YHQ I;  4DW6 A;  5M3M J;  2QM3 A;  1WH7 A;  4AC0 A;  3JRA A;  1S72 I;  1IG7 A;  3WTT C;  1HW2 A;  2HOS A;  4CCO A;  1X1D A;  1WVR A;  3R6S A;  2ZXW H;  2OJE D;  3DTK A;  4ENJ A;  3OWT A;  1LJ9 A;  2LRD A;  1BIA A;  2KKO A;  4BE0 A;  4XRM A;  1G3Y A;  3HTU A;  2BW3 B;  1QGP A;  2K4B A;  3H9Q A;  1ZTR A;  3F3X A;  4PGH A;  2KIU A;  4GGG A;  3EUA A;  5FKO A;  2KDZ A;  1XMK A;  3H5R A;  3HSF A;  5F64 A;  3WE3 A;  1RKT A;  5IP7 J;  2GXG A;  2KLO A;  3V42 A;  2QLZ A;  3GTQ J;  3W2W A;  2QZ8 A;  2KJB A;  3GLL A;  2JZY A;  5LHI A;  2LLK A;  3HOT A;  1YE9 A;  1T95 A;  3VDX A;  5FFX A;  1X1A A;  4NB5 A;  2E5Z A;  3OS2 A;  2HZD A;  1SAX A;  2BHY A;  3FF5 A;  4BHP A;  4D7M A;  3PIP F;  2OTL I;  1T0F C;  2M9H A;  4LG0 B;  2L7K A;  2F2E A;  5JVT A;  5M5X J;  4MHG A;  1A35 A;  1MND A;  3OYI A;  4IQJ A;  2GA1 A;  3IH4 A;  1Y39 A;  4L0Z B;  1CF7 A;  2NRA C;  4RGR A;  3B02 A;  2R5Z A;  3TP3 A;  4X6A J;  2A05 A;  3OYJ A;  4AVP A;  2FML A;  4A3K J;  2M87 A;  1LFP A;  1YG2 A;  2IA0 A;  2FQ3 A;  3GFI A;  3OYC A;  3LQR A;  4CHU A;  3ZN1 A;  1IGN A;  3WE2 A;  1W1W E;  5E1X A;  1SD6 A;  2K40 A;  3Q9S A;  4XON A;  3KP3 A;  3QOE A;  1LFU P;  3GTK J;  2KZG A;  4OAZ A;  4RDU A;  2XRL A;  4B3X A;  2DTR A;  2O9L A;  2XGC A;  3QU6 A;  1P92 A;  3JRI A;  2Q8K A;  1YI2 I;  3SFZ A;  1Z3X A;  1ZRF A;  3GXO A;  2PFB A;  5IYD J;  2O7O A;  1MIJ A;  2LDU A;  2Z33 A;  3OL4 A;  2HYF A;  3OYK A;  2CGP A;  2R7Z J;  2E5N A;  1I3Q J;  2FBI A;  1XSV A;  2E7W A;  3J80 Z;  5B66 C;  3NWT A;  1WJC A;  1IN8 A;  1Q1V A;  1MBG A;  1HKT A;  2QQA A;  3I59 A;  2A6E F;  3RSN A;  5C4J J;  4A3B J;  1X1P A;  1GV5 A;  5E8I A;  4HG2 A;  4UUV A;  2VJ5 A;  1R58 A;  2HU9 A;  3UR3 C;  4NDL A;  1FT9 A;  2QQ9 A;  2WC2 A;  2MH2 A;  2F4O B;  3HUG B;  4KN7 X;  2FA5 A;  2OAZ A;  4L5I A;  3KP6 A;  4GYG A;  2R5Y B;  4IF4 A;  3BY6 A;  4HRI A;  2E19 A;  3NQO A;  1B59 A;  1GLN A;  4IHS A;  3GLX A;  4NNJ A;  1QPM A;  1JHF A;  2R7Q A;  1RUN A;  1U0J A;  2EIJ H;  2RV8 A;  5GAH J;  2HVS A;  3L00 A;  5D4R A;  2KZV A;  2VKD A;  2CW0 F;  2PEX A;  4E7I A;  4BEH A;  4M74 A;  1RET A;  2HTJ A;  4IHV A;  3EQL F;  1Y0U A;  3H3V K;  4A5N A;  4RAZ A;  1LUJ B;  2BEO A;  4OIR F;  2KT0 A;  3ECH A;  5D4S A;  2WY8 Q;  3H9G A;  3OSF A;  3R0J A;  2BXZ A;  3O3K A;  3IRR A;  4C3I J;  3BJA A;  2WB1 N;  3Q3S A;  4MTE A;  2ZME B;  4EM0 B;  3OSG A;  3GTM J;  3P9I A;  3FXR A;  2OV7 A;  3VB2 A;  3HOW J;  5LBQ A;  3F8M A;  4KJZ A;  3C2G A;  3MVP A;  5JR3 A;  2V1X A;  3V8L A;  3CMM A;  1FTZ A;  3M8J A;  3PJR A;  1B9M A;  3AL0 C;  4YIF A;  3CME I;  1ERD A;  3ERE D;  3WTX C;  3JW4 A;  4HW0 A;  3OYM A;  1N77 A;  2JA8 J;  3ZCO A;  4A0X A;  1FYK A;  1XCV A;  2R7F A;  2MD5 A;  2TCT A;  3ABU A;  1ACI A;  3IHU A;  1ZRC A;  3I4N J;  3EUH C;  4BE1 A;  4JYK A;  3O2P E;  1E0E A;  4CIC A;  1X2N A;  1VND A;  3MMY B;  5LEK A;  2YX7 A;  2D1V A;  2LY9 A;  2EB7 A;  2X85 A;  5ICG A;  5HDG A;  3ZMT A;  1T6S A;  2KL4 A;  2E7X A;  1XGS A;  2DBB A;  3ZMU A;  4HBL A;  3J7A Y;  1GV2 A;  3FBN B;  3HHH A;  2EIM H;  5K7Z A;  4DIQ A;  2R7V A;  2MSY A;  3DBH B;  2ELJ A;  2QF7 A;  2YU3 A;  1HW5 A;  3TGN A;  2PMH A;  1GXQ A;  4IL6 C;  4BS9 A;  3AG4 H;  4YFX F;  3BPX A;  5E3L A;  3PO3 J;  4S04 A;  4G6T B;  5CVI A;  3ZRG A;  4U7D A;  3NEU A;  2BYV E;  2WAQ A;  5GPC A;  2X6X A;  1VQM I;  3RPQ A;  2EH3 A;  4DOZ A;  4YRV A;  3IL2 A;  3TO9 A;  2M4G A;  2DOD A;  3J7Y J;  3BR2 A;  3R4K A;  2JT1 A;  4LD5 A;  1YTY A;  1WJF A;  3GZ6 A;  1T33 A;  4UUS A;  1JJ6 C;  3ASN H;  4BKX A;  2ZSI B;  1UZC A;  4KA4 A;  3K4L A;  3JAM K;  5CPR B;  4FAS D;  4OAY A;  3CJT B;  3JRD A;  3IRQ A;  2XAJ A;  1J0R A;  2CH0 A;  3KYC B;  2VB6 A;  2YSR A;  4XKB A;  2Z2S B;  2DDA A;  5AON A;  4IHX A;  3LSR A;  3I0T A;  1UFM A;  3RPU A;  4DGW B;  1W36 C;  1IC8 A;  2RDP A;  2QSF X;  1ETK A;  2P5V A;  4A0Y A;  1QZY A;  1OJL A;  2NVY J;  2DCE A;  1SD4 A;  5FD6 A;  2E71 A;  1BW5 A;  2XPV A;  1Y8Q B;  3E97 A;  4AVZ A;  4KFC A;  3CQZ J;  1I5Z A;  4IXA A;  2JRT A;  3H5N A;  5E79 C;  2V26 A;  4LLL A;  5IOY A;  2ELK A;  4OMY A;  5CKT A;  5E8G A;  1VQK I;  2MC3 A;  1T98 A;  1APL C;  4LK0 F;  3E7L A;  1REP C;  1R22 A;  3FBI B;  4HEA 2;  1WZ2 A;  2N8G A;  2ICW G;  3ISP A;  4JX5 A;  1U5T B;  2XUB A;  3QYE A;  2TRT A;  4XMY A;  3LNQ A;  3EYY A;  2DT5 A;  2Z16 A;  2UZK A;  3ZN0 A;  3F22 A;  3COA C;  3KEY A;  2MGQ A;  5H6Q A;  1HBX G;  3OR2 C;  4G6D A;  1BR4 A;  1DPU A;  2DOA A;  3WGG A;  2DOF A;  4LJZ F;  2V4J C;  3ABT A;  1MMD A;  2XB5 A;  4HDU A;  3WHC A;  2BGC A;  4F91 B;  5EEA A;  4E7K A;  3M4O J;  2F4M B;  1W5S A;  1U9O A;  2FEZ A;  3M1E A;  1GT0 C;  3LAJ A;  2F5F A;  4R8H A;  3OIO A;  2EV5 A;  4B1R A;  1K79 A;  4L9J A;  2M5W A;  2L7F P;  5K5R A;  5L3D A;  1WSU A;  2F5D A;  2LNB A;  5CVU A;  1WJ5 A;  1T8I A;  5DUK A;  3OS1 A;  2ECC A;  1HOM A;  1QU3 A;  4NBQ A;  2JPC A;  3SDB A;  5BOX A;  4RB0 A;  4RLQ A;  3FM3 A;  1U2W A;  5K5Q A;  2BY3 A;  4DBR A;  5DM6 F;  3FM5 A;  2XRN A;  1P7J A;  1KYW A;  3J7Z I;  2HDC A;  1YW7 A;  4GDF A;  3S1M J;  4M3G A;  1TW2 A;  2CRG A;  4BNC A;  2XPU A;  1ETW A;  3CCQ I;  2IS4 A;  4U87 A;  4FX4 A;  3G6E I;  3G71 I;  1J7K A;  4RA2 A;  1SFU A;  4A0Z A;  3WU1 B;  2BW3 A;  3JCU C;  3RTR A;  2CUZ A;  1MBH A;  2LKS A;  2R92 J;  4XKV A;  1LB2 A;  2FD5 A;  3QPL A;  3T8T A;  4C3H J;  1U9N A;  2XGX A;  2DA7 A;  2V1D A;  1EV7 A;  3GF2 A;  1ZRE A;  3ZMS A;  3L9F A;  2HPM A;  2JA2 A;  5EEH A;  3KLN A;  2OUM A;  4LMY A;  5J40 A;  2JWT A;  1RI7 A;  4BL0 B;  1CQT A;  3TDU C;  3CMA I;  2XIG A;  3I59 B;  1V5G A;  3H3U A;  4LG0 A;  5FLX K;  3ZQ7 A;  4ANJ A;  5D5U B;  4KIT B;  2HPI A;  5ILU A;  3E5U A;  2JSP A;  5AIP A;  2HKX A;  1NH3 A;  3JAM Z;  3PUB A;  5HLG A;  3S2H J;  4EM2 A;  4DBQ A;  2XAF A;  3HC7 A;  4AYB A;  3JRE A;  4KMU X;  3LA2 A;  4FHT A;  1MW7 A;  5LHG A;  2I5U A;  4EJO A;  4XLC A;  3F6V A;  2YU9 J;  2QCO A;  2EFQ A;  5HOO A;  4ZYD A;  2IS6 A;  2RKH A;  3A0B C;  1VQ9 I;  3VYT B;  4M3B A;  4L5E A;  3GTO J;  2Z9O A;  2E2I J;  1EH6 A;  3I53 A;  5EYR A;  3GWZ A;  2CW8 A;  3CCV I;  4A3M J;  1JUM A;  4HDV A;  3U2R A;  3BZ6 A;  2BXY A;  2MH9 A;  1D3Y A;  1RIO H;  4P5O A;  1LVK A;  3TW6 A;  1FMV A;  4KIB A;  1RES A;  2MAB A;  2V6C A;  2ETH A;  4I6Z A;  4G8X A;  1YX5 A;  2VT2 A;  2CJJ A;  4PJ0 C;  5IP6 A;  1X1B A;  2JUG A;  2M0M A;  2O0Y A;  3WHB A;  3PL8 A;  5LHH A;  4YEL A;  3BG7 A;  3DPL C;  3LAP A;  3HOU J;  4F7Z A;  5HLI A;  2RN7 A;  1FPQ A;  3RI4 A;  3I56 I;  1NHA A;  2LC2 A;  3OYG A;  1OPC A;  4KDP A;  2DK5 A;  4BUP A;  3F21 A;  1MDM B;  3P9C A;  3M9A A;  1FJL A;  5J6X A;  3HUG A;  3L1P A;  2E1M C;  2ME0 A;  3G1L A;  4P1W A;  5IT3 A;  3HBL A;  2CV1 A;  3KYL A;  3E6D A;  3HM5 A;  4LOC A;  2G0E A;  4I09 A;  2ZC2 A;  1BI0 A;  2W1O A;  1ZR4 A;  2CMP A;  1O7L A;  2R7D A;  3CCS I;  4HPQ A;  2M1B A;  1JTX A;  1N75 A;  1OCC H;  3CDH A;  3CZ6 A;  1FIP A;  4U0W A;  2Y48 A;  2LRE A;  4ZYH A;  1ON1 A;  1SVL A;  3EDP A;  3K1N A;  1OFC X;  1N25 A;  4I01 A;  4U0Y A;  3FHN A;  3O6B B;  1G3W A;  2UWM A;  1TT5 B;  1XGM A;  5GAD J;  4CGZ A;  4UV8 A;  4Y3O A;  4IHT A;  1DUX C;  3H3Z A;  1TWG J;  1TC3 C;  5K5O A;  1Z05 A;  4PJL A;  1S3J A;  3IKT A;  2DTZ A;  2ISZ A;  1QRY A;  2I8D A;  2E36 A;  1ITY A;  1F1Z A;  2GBY A;  3S2W A;  2IVM A;  3DLL F;  1XCB A;  1H89 C;  2A5W A;  4UVA A;  3IH2 A;  1G3T A;  2HDD A;  3HYI A;  3UNG C;  2W25 A;  1Z7L A;  4RAG A;  2X6Y A;  1ZG5 A;  1A6I A;  3GTJ J;  2ESN A;  4B47 A;  4JP0 A;  3RKX A;  1SD7 A;  2Z3Y A;  4GFB A;  2QEN A;  5CVR A;  2DPD A;  3CC7 I;  1HF0 A;  2M45 A;  3AFH A;  3WOD F;  2P4W A;  2VQL A;  2DDB A;  3LSI A;  1BW6 A;  4LK1 F;  3WG7 H;  1KQ9 A;  1Z6T A;  2XVC A;  2PLY A;  5FLX Z;  2YS9 A;  1DP7 P; 
#chains in the Genus database with same CATH homology
 4HZF A;  2B0L A;  3GUD A;  3FXU A;  2C6Y A;  4EV0 A;  4JK1 X;  1TNS A;  4G9Y A;  2HS5 A;  5F6F A;  1STZ A;  4P96 A;  2VT3 A;  1BI2 A;  5LGU A;  2VBW A;  4B8X A;  2A6H F;  2NNN A;  4HLX A;  2UXN A;  2ZJ2 A;  2OU2 A;  1U6G A;  1IN7 A;  4N9H A;  1P4X A;  4I02 A;  4OOI A;  1SFE A;  1KYZ A;  3I58 A;  5JFR A;  3WTY C;  2K02 A;  1FOK A;  2V79 A;  1UHW A;  1GXP A;  1W4M A;  3EUH A;  4A12 A;  1R23 A;  4HX8 A;  2D1H A;  1V3F A;  4CDG A;  3HRT A;  1MZB A;  3DKW A;  4FT8 A;  1KU3 A;  2EV6 A;  1KGS A;  2OA4 A;  1G3S A;  2XAS A;  4G7Z F;  2MLG A;  3KET A;  2NS0 A;  1HKS A;  1U5T A;  2IRF G;  2PQ8 A;  4GCV A;  3ML6 A;  2DQR A;  1T2K A;  2JPB A;  4L5J A;  2OZU A;  2VBZ A;  2QQB A;  1U3E M;  3PQJ A;  3E5X A;  2VOP A;  5AIQ A;  1O3S A;  1R00 A;  2DFI A;  1C0W A;  4I2O A;  5ICE A;  5D5X B;  1FBU A;  5E1Z B;  1YS7 A;  4HV6 A;  3FMS A;  1OYW A;  4U7B A;  1FBQ A;  3F8N A;  2P6T A;  5LRS A;  2EWN A;  3KP5 A;  3BWG A;  5BMZ A;  4U88 A;  1O3Q A;  2KJC A;  3I5U A;  5BPD A;  1WQ2 A;  3K1M A;  3IWF A;  5L3F A;  1TQI A;  4QLC U;  2ZNZ A;  4HQM A;  2P8T A;  4CO8 A;  1LVA A;  3LST A;  1LDD A;  2GWR A;  3P7N A;  1Z91 A;  1W7P B;  3FHZ A;  5EEG A;  2X0L A;  4XLP F;  1KA8 A;  1F5T A;  2QBY B;  4HV5 A;  1JE8 A;  3HSE A;  6PAX A;  1ZAR A;  5ERI A;  3W6K B;  4NHJ A;  4ZZD A;  1HW1 A;  1O7F A;  1QNT A;  3QPH A;  1ZGA A;  2L4M A;  1D8K A;  3KEO A;  3K0L A;  3FWE A;  2ISY A;  4RGS A;  1B4A A;  1P4W A;  1USS A;  4Y17 A;  2STW A;  3BP8 A;  1QZZ A;  3ZMZ A;  3CTA A;  2TDX A;  5L3B A;  1XB4 A;  5FGM A;  1R5G A;  3VOD A;  2FOK A;  1FLI A;  5CLS A;  1TQM A;  1IUY A;  2PBI A;  1T39 A;  3OV8 A;  1JHH A;  2QYO A;  4WF2 A;  3AAF A;  4I0A A;  3KEQ A;  1K6O A;  2XKO A;  4A6D A;  2P7V B;  2G7U A;  3Q5F A;  3FZV A;  4M9Z A;  1RNL A;  2EA2 A;  4OIQ F;  1SMY F;  3MCZ A;  2ZFW A;  3CUQ C;  3WTW C;  3QAH A;  4XRF A;  1MDM A;  4R79 A;  3I4P A;  1LEA A;  1B9N A;  3E5Q A;  2EV0 A;  4CXF A;  3KP2 A;  2H94 A;  3CJN A;  2VC1 A;  1FZP B;  4HF0 A;  4HX4 A;  1ZH5 A;  4ENK A;  2A5Y B;  1OYY A;  2YR2 A;  5FB2 A;  4Y15 A;  2LF7 A;  4QWQ A;  3RKY A;  3VEP A;  3F72 A;  5DCM B;  3V7R A;  4KMF A;  1WWX A;  1YFH A;  1OMI A;  3GZ5 A;  3E6B A;  5ILV A;  5HVQ C;  1DPR A;  3GVA A;  2G9W A;  2VE9 A;  1A04 A;  1AWC A;  1QBJ A;  2CG4 A;  2W57 A;  1WI9 A;  4Q4Z F;  2DK8 A;  2H6C A;  1EH7 A;  4MEY F;  4L0Y B;  3C7J A;  5HS7 A;  2XAH A;  3HSR A;  4IVN A;  4U0V A;  1J75 A;  5HDK A;  4HF2 A;  2O8X A;  4CYD A;  3MQ0 A;  2OQG A;  2M8E A;  2P6S A;  4M9S A;  4RB1 A;  3HRS A;  2EFP A;  4OIP F;  1E2X A;  2CFX A;  4YII A;  1KU7 A;  3R61 A;  2L3D A;  1XD7 A;  2OBP A;  3J81 K;  1P2F A;  2GQQ A;  1X3U A;  1PDN C;  4A6E A;  4G7O F;  1P4A A;  3ROU A;  1BN5 A;  3RIR A;  4XLN F;  1TW3 A;  5E1W A;  4EVI A;  3BPV A;  5E20 A;  5CVV A;  2HOE A;  4OIN F;  3V7C A;  2M30 A;  1Z7U A;  2PI0 A;  5DD8 A;  4ETS A;  2OQR A;  1SMT A;  1TLH B;  3K9T A;  2WTE A;  1KU2 A;  3IWZ A;  4P9U A;  4PGG A;  1ODD A;  5CJ9 A;  1G6N A;  2IPQ X;  2VE8 A;  1R1V A;  2JSC A;  2K27 A;  4I7H A;  4BHB A;  1FSH A;  4KIF A;  4WK8 F;  2STT A;  4EMS A;  4EJU A;  1B1B A;  1XSD A;  1K7A A;  2IA1 A;  2CWE A;  5HLH A;  1TBX A;  1RUO A;  2BE5 F;  4L9T A;  2HTS A;  5DUI A;  2RNJ A;  3W6J B;  2VXZ A;  2Y75 A;  1ZRD A;  4E70 A;  1XGO A;  4CZZ A;  3V8J A;  1O3T A;  5E18 F;  1PP8 F;  3HTS B;  3NRV A;  5LGN A;  4N9I A;  1WKM A;  2BBY A;  2FU4 A;  3WTU C;  5HS9 A;  1YS6 A;  3D5L A;  2DAO A;  4ZYE A;  1R5H A;  1IRG A;  3KP7 A;  2HGC A;  4M71 A;  1JXS A;  1I6X A;  4AIK A;  2F5C A;  4MQV A;  1O57 A;  2XAG A;  5J8F A;  1TQP A;  2PG4 A;  4KT5 C;  3TO7 A;  2Z99 A;  1W7P A;  2YPR A;  3KE2 A;  3V7S A;  4IJA A;  4KUM A;  4OMZ A;  2D45 A;  2QBY A;  3TOB A;  2HZT A;  2EJR A;  4RB3 C;  1BJA A;  1T0F A;  4HX7 A;  3KP4 A;  1BBY A;  3HRM A;  3ECO A;  1I27 A;  5CYV A;  3CUO A;  3M7G A;  3K2Z A;  3U1D A;  2XKP A;  3C1D A;  5E17 F;  4UVB A;  2DW4 A;  4N0B A;  4UVC A;  3FXQ A;  2ZBK A;  1XDU A;  4UXN A;  3D0S A;  2LF8 A;  3TQN A;  4XBF A;  1T38 A;  1ZHF A;  3C18 A;  2H6B A;  5D5V B;  3WTS C;  1D8J A;  5FO5 A;  3CO7 C;  1VTN C;  2RQP A;  4RGU A;  4K2E A;  2XV4 S;  3JTG A;  3E6M A;  2A3S A;  3F8F A;  4WXC A;  1IF1 A;  3WG9 A;  2FE3 A;  4ESB A;  5KVR A;  4ESF A;  3MFK A;  2MA3 A;  3LA7 A;  3GO5 A;  2ESH A;  1MJA A;  5DYM A;  2GA2 A;  1B6A A;  3HOS A;  3GFM A;  4DNC A;  2JTV A;  3DPT A;  1KQ0 A;  4ENN A;  1FYM A;  2IP2 A;  2HR3 A;  1S8N A;  4XSX F;  4WXH A;  1XGN A;  3FMR A;  4RB2 C;  4MEX F;  4BQA A;  2Q0O A;  3DF8 A;  3GW2 A;  5DCM A;  4KN4 X;  1IN6 A;  3MZH A;  4PZJ A;  4M73 A;  2DLL A;  5KK1 A;  2ACJ A;  1U8R A;  5D6F A;  2EFW A;  1YYV A;  2GAU A;  1CGP A;  3E3V A;  1ZN2 A;  4Z2Y A;  4BH9 A;  3ZP5 A;  3F23 A;  3GEZ A;  2FF4 A;  1S29 A;  4M72 A;  4HOB A;  1YLF A;  2O03 A;  1F9N A;  2ZKZ A;  1YW8 A;  1HXD A;  4B09 A;  2X4H A;  1WRJ A;  1TTY A;  4GO1 A;  3WTZ A;  5A2Q K;  1YW9 A;  1QQI A;  2AS5 F;  3EET A;  2FMY A;  5TJJ A;  5HS8 A;  4WX9 A;  3BDD A;  3RDI A;  3GFJ A;  5JHU A;  2H27 A;  5L3E A;  4WCG A;  5D8K B;  2D2W A;  1O3R A;  2EA4 A;  2L54 A;  2GXB A;  1R1T A;  3JSP A;  3BOQ A;  4ON0 A;  3ZMD A;  4A5M A;  4DQ2 A;  4NQW A;  3DP7 A;  1LDJ A;  3KFW X;  3G3Z A;  1Z1D A;  1FC3 A;  1G4D A;  4LLG F;  2QVO A;  5LLQ A;  4EGY A;  1MJB A;  1W5T A;  2QWW A;  2V9V A;  1E17 A;  2IJL A;  4M6X A;  2FNA A;  3P9K A;  4LB5 A;  1BI1 A;  1R7J A;  3GFL A;  3JSO A;  1HKQ A;  4WXD A;  4G6Q A;  4AWX B;  1IXC A;  1I1G A;  4GXO A;  4HLY A;  1OKR A;  1YQA A;  1V4R A;  1PP7 U;  1ZYR F;  3BJ6 A;  1UB9 A;  2K7L A;  1L0O C;  2K4J A;  1GVJ A;  2LSO A;  1OYI A;  4M6Y A;  2EK5 A;  3B73 A;  4H0E A;  2ZO4 A;  2R3S A;  1KQ8 A;  1BM9 A;  3I71 A;  1XDS A;  4RAY A;  2VBX A;  1XN7 A;  5L3C A;  4AD9 A;  2A61 A;  2L02 A;  4AIJ A;  3J7A O;  1ZG1 A;  4IPA A;  2HEO A;  1HQC A;  2UXX A;  3TKY A;  5LEJ A;  1K78 B;  3WGI A;  3CLO A;  1UHM A;  4MNU A;  5A2Q Z;  1S7O A;  5DCF A;  4ZYG A;  5FD5 A;  5H20 A;  2MBF A;  3V8K A;  2XHK A;  4EJT A;  4EJV A;  3TDZ C;  3SHF A;  1H9T A;  3IC7 A;  4M9X A;  3C3W A;  3L09 A;  2CO5 A;  4L9N A;  3RKW A;  1MKM A;  2K86 A;  3WTV C;  2VN2 A;  2VOD A;  3LQQ A;  3DXJ F;  2Q2E A;  3ZPL A;  2RGV A;  3LA3 A;  4L18 B;  2FBH A;  1FP1 D;  1Q1H A;  3K69 A;  2GZW A;  3L7W A;  2HWV A;  3LWF A;  4UV9 A;  2IW5 A;  2FXA A;  4ASN A;  3G73 A;  1FWZ A;  2A07 F;  1ZLK A;  2IA2 A;  3EYI A;  5DD4 A;  1AOY A;  1XMA A;  3DFG A;  3QP6 A;  3CO6 C;  4IRH A;  4KNY A;  1FY7 A;  2VBY A;  2DPU A;  3IKV A;  3CUQ B;  3FX3 A;  3LFK A;  5BPI A;  3QU3 A;  3M8F A;  4IRG A;  1Z9C A;  3HRU A;  2GIV A;  1JGS A;  5K1Y A;  1U5T C;  1IN5 A;  1SD5 A;  2L01 A;  2W24 A;  2DU9 A;  1ULY A;  2XAQ A;  1R36 A;  1YIO A;  4ESJ A;  2O61 A;  2VON A;  1BC7 C;  2O6G E;  1SFX A;  1XSX A;  5BQT A;  2NAZ A;  4YG2 F;  1LNW A;  3N97 A;  2HYG D;  2J5P A;  3MZY A;  2W84 A;  3I54 A;  1FYL A;  1S7A A;  2YX4 A;  2E1N A;  4BXU A;  1ZLJ A;  1IN4 A;  2A69 F;  2H09 A;  3SZP A;  1H0M A;  4JBA A;  1FNN A;  1IAW A;  1DDN A;  1W7P D;  5TRD A;  4BAY A;  1F4K A;  1IZ1 A;  2BV6 A;  1ONV A;  4XSZ F;  1MD0 A;  5DV5 A;  1LEB A;  4HF1 A;  3U9G A;  2RVC A;  5DEQ A;  3QP5 A;  3H92 A;  4HA8 A;  4UHT A;  2DQL A;  2FRH A;  3PFI A;  4TV7 A;  2P5K A;  2HKO A;  1UST A;  3F6O A;  3K1P A;  2HFH A;  3JTH A;  1YO5 C;  4HYE A;  1U78 A;  1LQ1 A;  2VOO A;  2WWY A;  3FMQ A;  5ICF A;  2CSO A;  4P55 A;  3GX4 X;  1J59 A;  3T5X A;  1CF7 B;  1PUE E;  4O5V A;  4O3M A;  1FBS A;  4EM1 A;  1UCR A;  3KLO A;  3OOP A;  4KIG A;  3ELK A;  2PMU A;  1L3L A;  2IT0 A;  1FX7 A;  4EGZ A;  4LLN A;  1Z6R A;  2P5L C;  1RZ4 A;  1IRF A;  2Z5U A;  3T1B A;  1KU9 A;  4LGW A;  2ZCW A;  4EQQ A;  5HDN A;  5F1R A;  4YFN F;  3MAJ A;  4ZZL A;  4BYY A;  4KYW A;  1BIB A;  3Q9V A;  3KZZ A;  3WGH A;  2E1C A;  2FNP A;  2KIM A;  3ZMV A;  4GYI A;  1QO0 D;  2MLK A;  2KRF A;  2A68 F;  5ED4 A;  1ON2 A;  2WV0 A;  5LRR A;  1IXS B;  5J8C A;  2FBK A;  2RC4 A;  1TNT A;  3REO A;  1BI3 A;  2PN6 A;  2ZXJ A;  3T8R A;  2OD5 A;  2J5O A;  4ZH4 F;  3DQV C;  4I98 B;  2F5E A;  2CQK A;  2EFN A;  2P7C B;  5H6R A;  4ENM A;  1BC8 C;  5IT9 K;  2XRO A;  3QOP A;  3J81 Z;  3RJP A;  4I0B A;  4HAM A;  3BRO A;  3R60 A;  2EFO A;  1IXR C;  2Y0M A;  1FP2 A;  2DO7 A;  4G94 A;  5JI6 A;  1ZG3 A;  4Q5S F;  5D6E A;  2HQN A;  2ZNY A;  4IRI A;  1IW7 F;  4RS8 A;  2QUF A;  4OU0 A;  4Q48 A;  1BOA A;  4FX0 A;  2G7H A;  4MQ9 F;  1HST A;  5FFZ A;  3V4G A;  5D8L B;  4Q47 A;  2ELH A;  1I1S A;  3BJO A;  4BHC A;  1J2X A;  3TO6 A;  1P6R A;  2NNY A;  5ICC A;  3KZY A;  4EJW A;  1MGT A;  4WWC A;  4G7H F;  1D5V A;  1K78 A;  4O6J A;  4PDK A;  1GHC A;  3DEU A;  2ADU A;  5D5W B;  3GYH X;  3HHG A;  1HSJ A;  2O3F A;  3RYR A;  1OR7 A;  1EH8 A;  2OZ6 A;  3F8B A;  3QPT A;  5L3G A;  2NYX A;  4MGR A;  3VFZ A;  3VOE A;  4P9F A;  2ZME A;  3M8E A;  5ILS A;  1ZGJ A;  1LDK B;  3KCC A;  3QRF F;  5LGT A;  4Y13 A;  3R0A A;  2AXL A;  2LKP A;  5BS6 A;  3MEX A;  1MJ9 A;  3DV8 A;  2CYY A;  4RGX A;  3L2C A;  2L4A A;  3SQN A;  4HQE A;  4OIO F;  2DI3 A;  3RYP A;  4AIH A;  1J9I A;  4KIC A;  1R1U A;  3TOA A;  3CUQ A;  1S6L A;  2VC0 A;  3I64 A;  4R1H A;  1FSE A;  4PCQ A;  1ZAO A;  2FSW A;  4D0P A;  2KIF A;  3PQK A;  2V1U A;  3J80 K;  4L9V A;  5IT9 Z;  3WU0 A;  3F8C A;  3SXY A;  1H9G A;  3ULQ B;  4MTD A;  4LB6 B;  4YFK F;  3N4M A;  5DDG A;  5CVJ A;  3T0Y A;  4A2U A;  4S05 A;  3SZT A;  2W85 A;  2COM A;  4LFU A;  3E6C C;  4UNO A;  2PJP A;  2HQR A;  4JQF A;  1J5Y A;  3HIF A;  3MWM A;  2QM3 A;  3WTT C;  1HW2 A;  3R6S A;  4ENJ A;  1LJ9 A;  1BIA A;  2KKO A;  1G3Y A;  3HTU A;  1QGP A;  2K4B A;  3F3X A;  4PGH A;  2KIU A;  4GGG A;  1XMK A;  3HSF A;  5F64 A;  3WE3 A;  2GXG A;  2QLZ A;  2QZ8 A;  2KJB A;  2JZY A;  5LHI A;  3HOT A;  5FFX A;  4NB5 A;  1SAX A;  3FF5 A;  4BHP A;  4LG0 B;  5JVT A;  2F2E A;  4MHG A;  2GA1 A;  4L0Z B;  1CF7 A;  2NRA C;  4RGR A;  3B02 A;  4AVP A;  2FML A;  2M87 A;  1YG2 A;  2IA0 A;  2FQ3 A;  3GFI A;  3LQR A;  4CHU A;  3ZN1 A;  3WE2 A;  5E1X A;  1SD6 A;  3Q9S A;  3KP3 A;  2DTR A;  3QU6 A;  1P92 A;  2Q8K A;  3SFZ A;  1ZRF A;  3GXO A;  2PFB A;  2LDU A;  2Z33 A;  2HYF A;  2CGP A;  2FBI A;  1XSV A;  2E7W A;  3J80 Z;  1IN8 A;  1HKT A;  2QQA A;  3I59 A;  2A6E F;  5E8I A;  4UUV A;  1R58 A;  1FT9 A;  2QQ9 A;  2WC2 A;  2MH2 A;  4KN7 X;  2FA5 A;  2OAZ A;  4L5I A;  3KP6 A;  4GYG A;  4IF4 A;  3BY6 A;  3NQO A;  1B59 A;  4IHS A;  3GLX A;  1QPM A;  1JHF A;  1RUN A;  2RV8 A;  3L00 A;  5D4R A;  2CW0 F;  2PEX A;  4M74 A;  2HTJ A;  3EQL F;  1Y0U A;  4A5N A;  4RAZ A;  2BEO A;  4OIR F;  3ECH A;  5D4S A;  3R0J A;  3O3K A;  3IRR A;  3BJA A;  4EM0 B;  4MTE A;  2ZME B;  3P9I A;  3FXR A;  3VB2 A;  5LBQ A;  3F8M A;  5JR3 A;  2V1X A;  3V8L A;  1B9M A;  4YIF A;  3ERE D;  3WTX C;  3JW4 A;  4HW0 A;  4A0X A;  1FYK A;  1XCV A;  2R7F A;  2MD5 A;  3ABU A;  3IHU A;  1ZRC A;  3O2P E;  4CIC A;  5LEK A;  2YX7 A;  2D1V A;  2EB7 A;  5ICG A;  5HDG A;  3ZMT A;  1T6S A;  2E7X A;  1XGS A;  2DBB A;  3ZMU A;  4HBL A;  3HHH A;  2YU3 A;  1HW5 A;  3TGN A;  2PMH A;  1GXQ A;  4YFX F;  3BPX A;  4S04 A;  5CVI A;  4U7D A;  3NEU A;  2BYV E;  3RPQ A;  3IL2 A;  3TO9 A;  3R4K A;  2JT1 A;  4LD5 A;  1YTY A;  3GZ6 A;  4KA4 A;  3JAM K;  3IRQ A;  2XAJ A;  1J0R A;  2YSR A;  5AON A;  3I0T A;  1UFM A;  3RPU A;  2RDP A;  2P5V A;  4A0Y A;  1QZY A;  1SD4 A;  5FD6 A;  3E97 A;  4KFC A;  1I5Z A;  4IXA A;  2JRT A;  4LLL A;  4OMY A;  5E8G A;  2MC3 A;  1T98 A;  4LK0 F;  1REP C;  1R22 A;  3ISP A;  1U5T B;  2XUB A;  3EYY A;  2DT5 A;  2UZK A;  3ZN0 A;  3F22 A;  3COA C;  5H6Q A;  1HBX G;  4G6D A;  1DPU A;  3WGG A;  4LJZ F;  3ABT A;  4HDU A;  2BGC A;  1W5S A;  2FEZ A;  3M1E A;  3LAJ A;  2F5F A;  4R8H A;  2EV5 A;  1K79 A;  4L9J A;  2M5W A;  5K5R A;  5L3D A;  1WSU A;  2F5D A;  2LNB A;  5CVU A;  5DUK A;  2JPC A;  5BOX A;  4RB0 A;  3FM3 A;  1U2W A;  5K5Q A;  3FM5 A;  2XRN A;  1KYW A;  2HDC A;  1YW7 A;  1TW2 A;  4BNC A;  4FX4 A;  1J7K A;  1SFU A;  4A0Z A;  3WU1 B;  3RTR A;  1LB2 A;  3T8T A;  2XGX A;  2V1D A;  1EV7 A;  3GF2 A;  1ZRE A;  3ZMS A;  3L9F A;  5EEH A;  3KLN A;  4LMY A;  1RI7 A;  3TDU C;  2XIG A;  3I59 B;  3H3U A;  4LG0 A;  5FLX K;  3ZQ7 A;  5D5U B;  5ILU A;  3E5U A;  5AIP A;  2HKX A;  3JAM Z;  5HLG A;  4EM2 A;  2XAF A;  4KMU X;  3LA2 A;  4FHT A;  5LHG A;  4EJO A;  3F6V A;  2EFQ A;  5HOO A;  4ZYD A;  2RKH A;  2Z9O A;  1EH6 A;  3I53 A;  3GWZ A;  4HDV A;  3U2R A;  3BZ6 A;  2MH9 A;  1D3Y A;  1RIO H;  4P5O A;  4KIB A;  2V6C A;  2ETH A;  4G8X A;  2VT2 A;  2O0Y A;  5LHH A;  3DPL C;  3LAP A;  4F7Z A;  5HLI A;  2RN7 A;  1FPQ A;  3RI4 A;  1NHA A;  1OPC A;  4KDP A;  2DK5 A;  3F21 A;  1MDM B;  3P9C A;  3M9A A;  5J6X A;  3HUG A;  5IT3 A;  3E6D A;  4I09 A;  1BI0 A;  1O7L A;  2R7D A;  2M1B A;  3CDH A;  4U0W A;  2Y48 A;  4ZYH A;  1ON1 A;  3EDP A;  3K1N A;  4I01 A;  4U0Y A;  3O6B B;  1G3W A;  2UWM A;  1XGM A;  4CGZ A;  4UV8 A;  4IHT A;  1DUX C;  3H3Z A;  5K5O A;  1Z05 A;  1S3J A;  3IKT A;  2ISZ A;  1F1Z A;  3S2W A;  2IVM A;  1XCB A;  4UVA A;  1G3T A;  3HYI A;  2W25 A;  1ZG5 A;  2ESN A;  3RKX A;  1SD7 A;  2Z3Y A;  2QEN A;  5CVR A;  2DPD A;  2M45 A;  3WOD F;  2P4W A;  4LK1 F;  1KQ9 A;  1Z6T A;  2XVC A;  2PLY A;  5FLX Z;  1DP7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...