4RGSA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with vanilin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with Vanilin
rcsb
source organism Acinetobacter sp. adp1
total genus 42
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgsA00
2DPUA 4B09A 2E1NA 3HYIA 2ZXJA 1TQIA 3ULQB 1LNWA 3NRVA 1P4XA 3HTUA 2VOPA 4OOIA 2QBYA 3GXOA 4YIIA 1YS7A 1HW1A 1T6SA 5E20A 3HOSA 4IRIA 4IPAA 1YIOA 3C1DA 3RPQA 2KIUA 2V9VA 1HQCA 2Q0OA 5L3GA 2PEXA 5LHIA 5CVVA 2K4BA 1KQ0A 2FQ3A 4LJZF 3KZZA 3I59B 2A5YB 1EV7A 4U0YA 4I0BA 3QPTA 4BXUA 3WTWC 1KA8A 1L3LA 4FT8A 1V4RA 2EWNA 4HF2A 5L3BA 1NHAA 5LRSA 1Z1DA 1JHHA 1FP1D 4IRHA 3BZ6A 3T0YA 2EFOA 2HS5A 3ZQ7A 5BQTA 2PMUA 4ENMA 3FXUA 5DV5A 1XGSA 5DUKA 2HKOA 4U7BA 3TGNA 3VEPA 4N9IA 3R0JA 4U88A 4I98B 4LD5A 2O61A 2FEZA 3KFWX 1U3EM 2DI3A 2AXLA 3R4KA 1KU3A 3CO7C 4L9VA 2D1HA 2YX4A 3GFMA 3I0TA 1KQ9A 2JRTA 4EM1A 2OZ6A 3LFKA 1FOKA 5ERIA 4MNUA 2HOEA 5BS6A 3ZMUA 4ENJA 1ZRCA 1FBSA 1SMTA 2A3SA 2P5KA 5DD8A 4LLNA 3F8CA 3MCZA 1BIAA 5D4SA 1DDNA 2EV0A 4ESBA 1OMIA 2K7LA 2K27A 1FYLA 4K2EA 1FZPB 4GGGA 5D8LB 1I1GA 2RN7A 3TOBA 4OIPF 3E6CC 4KN7X 2O6GE 1YQAA 1SD4A 2YU3A 2QQ9A 3WTTC 4I0AA 4OINF 4GYGA 2IP2A 1ZN2A 2O8XA 3F22A 3SZTA 5TJJA 3DFGA 3RPUA 1R5HA 2P6TA 4G6DA 4WF2A 1FSEA 3EETA 3R0AA 1ZARA 3E5XA 2A69F 2DK8A 2XHKA 1J2XA 4S04A 1ULYA 1YLFA 1QZZA 1HKTA 5HDKA 2JSCA 5DCMA 3RIRA 2GA1A 2NYXA 3VODA 1YFHA 4Y13A 1O7LA 6PAXA 5LGNA 3GYHX 4EGYA 3Q5FA 1XSDA 2MA3A 3H92A 4AVPA 1QGPA 4A0ZA 1XGOA 3K1MA 4OIQF 2KJBA 3CUQC 4EGZA 4D0PA 4NQWA 5H6RA 1TQMA 3SZPA 4EV0A 3IL2A 3M8FA 1U78A 1BI2A 4R79A 5LEKA 2CO5A 3V7SA 2QBYB 4M6XA 1XCBA 2M8EA 2QENA 1QQIA 1RZ4A 4YFXF 2RKHA 4OIRF 1K78A 3GEZA 5CVRA 1U5TC 4ESJA 3J80Z 4ZZDA 2FBHA 2LSOA 2O0YA 3T5XA 3ZMVA 5DEQA 4G7OF 1ODDA 3J81Z 5JHUA 1Q1HA 4I2OA 1WWXA 3M9AA 3H3ZA 1IXSB 1LDKB 1P4WA 2GA2A 4UV8A 3FF5A 5HOOA 3KP7A 2FSWA 3HSRA 2QVOA 5CJ9A 4L0ZB 3HUGA 5K5RA 2FXAA 5D5WB 4JBAA 3HSFA 4RB2C 3BWGA 5L3CA 1O3RA 1R23A 2VE8A 1O3TA 3GUDA 3TO6A 2JT1A 2OQGA 5FD5A 3PFIA 1WRJA 4BAYA 1R00A 1BI0A 3ISPA 3EYIA 1TNSA 2ETHA 2HQNA 5AIQA 3WE2A 1F4KA 3MAJA 5LGTA 1FT9A 3ZPLA 2RQPA 4KMFA 3LSTA 4MEYF 4EJOA 1Z9CA 2JTVA 2GWRA 1G4DA 2VC0A 3ELKA 3FXRA 2LF7A 5KK1A 1O3SA 4AIKA 4L5IA 1E17A 4WXCA 1KYWA 5E8GA 2XGXA 2QZ8A 3KLOA 2RC4A 4HDUA 3TO7A 2AS5F 5L3FA 4RAYA 4BQAA 1YG2A 3T8RA 2GXBA 1W5SA 2R7DA 4LMYA 1F5TA 3BPVA 4RB1A 3AAFA 4AIJA 2H09A 1LDJA 3P9CA 4U7DA 3BROA 4PDKA 1OPCA 1FBQA 1HXDA 4M9SA 2ZO4A 5L3EA 2HGCA 4O3MA 2XAHA 2CSOA 1ON1A 1FP2A 3BJ6A 5A2QK 5EEHA 2STTA 2JZYA 2KRFA 5LBQA 5DCMB 4ZYGA 1W4MA 2Z5UA 1K7AA 2F5CA 4KN4X 3R6SA 5J6XA 4EM2A 3K0LA 5D4RA 2JPBA 3EUHA 3J80K 4IHSA 3ZMTA 4M9ZA 4A6DA 3B73A 1P6RA 4A6EA 2VC1A 1YS6A 2DLLA 1FWZA 3GF2A 3SXYA 5JI6A 3KP5A 3HRTA 3KCCA 2Z3YA 4XRFA 2HKXA 1IN5A 2A61A 3WU0A 3MZYA 3ABUA 3WTYC 2D45A 4A12A 4JK1X 4H0EA 3QP6A 2NNNA 1ZG3A 4NB5A 2VBWA 1J0RA 4KUMA 3ZN0A 2OU2A 2QQAA 1XGMA 1K78B 4WK8F 2MH9A 1T38A 2EK5A 2ZNZA 1S3JA 2F5EA 4Y17A 5E8IA 3RJPA 2E7XA 4DQ2A 5K5QA 4ENNA 1RI7A 3DV8A 1U6GA 5E1ZB 1TLHB 1UB9A 1L0OC 4CYDA 4WCGA 1JXSA 2M45A 5L3DA 4LGWA 4ZZLA 3GX4X 2PLYA 3FM5A 3QP5A 5JVTA 2QM3A 3GO5A 3WU1B 3ROUA 1TBXA 2PBIA 4LB5A 3F72A 1Z05A 2CG4A 3CLOA 5J8FA 4HQMA 1ZLKA 4EJVA 3LAPA 4HQEA 5K5OA 4KFCA 4L0YB 3ML6A 1U2WA 5ILSA 3LA3A 4R1HA 5FFXA 1J59A 2RV8A 2Q8KA 2HWVA 2IW5A 5HLIA 3FHZA 1JHFA 3FMRA 2NNYA 1QNTA 5BMZA 3VOEA 1I5ZA 3QU6A 3GVAA 2D1VA 2FMLA 4HV6A 1MJBA 4YIFA 3HTSB 2BBYA 1CF7A 3CDHA 2MLKA 1B9MA 3MQ0A 1MD0A 1T0FA 5IT9K 4Q5SF 2BE5F 1RNLA 3C7JA 3RKXA 1MDMA 2ESNA 4CDGA 3BPXA 3GFJA 3IKVA 4BHCA 1KQ8A 2E1CA 2IT0A 1V3FA 4P55A 4RGSA 5FD6A 1RUOA 3KP2A 1XD7A 1Z91A 2VN2A 3TO9A 3WGHA 3WTZA 3JTHA 1RUNA 2RGVA 4CICA 3F8FA 1J7KA 4UHTA 2HDCA 1O7FA 1J5YA 3BDDA 2DT5A 3SHFA 2Y48A 4M71A 3I4PA 4KNYA 2VBXA 1IF1A 2NRAC 3GWZA 1DPUA 4PCQA 3TKYA 1BOAA 2MC3A 1UHMA 5IT3A 1OYWA 1SFUA 2HYGD 1MJ9A 1OR7A 4EQQA 1DUXC 1TNTA 2E7WA 4M9XA 2W24A 3DXJF 3FMQA 1FPQA 4A0XA 3F21A 5FB2A 4CXFA 4HLXA 2ZMEA 3LWFA 1FY7A 2QYOA 3VFZA 3IHUA 2WC2A 2X0LA 2L4AA 1STZA 2LDUA 5JFRA 4OMZA 5ICFA 1ONVA 4ZH4F 1R36A 5ICEA 1H9TA 1B1BA 3GW2A 1D5VA 4RB3C 2KIMA 1ZREA 2IJLA 4EJUA 1AWCA 3N97A 3F23A 2HYFA 2CQKA 3T1BA 4ASNA 2W57A 1T2KA 1TW3A 2PN6A 2K86A 2R3SA 2JPCA 2H6BA 3DEUA 4AD9A 1MGTA 2EB7A 5DDGA 1S7OA 2GQQA 5HDNA 4RS8A 3V7CA 3M1EA 3JAMZ 4EJWA 2OZUA 5FFZA 4ESFA 3FM3A 3J7AO 1IRFA 4IVNA 4CZZA 3RTRA 2PG4A 1D8JA 3F6VA 3V7RA 3W6JB 1E2XA 1G3YA 3ZN1A 3HHHA 4R8HA 1SMYF 4KT5C 3P9KA 3LQQA 2Z99A 3TDUC 4HDVA 1YYVA 2P6SA 1OKRA 1G3TA 1GXQA 3S2WA 3NEUA 4IRGA 1IW7F 2FRHA 4F7ZA 2VOOA 1QZYA 3FWEA 2BYVE 2K02A 3U9GA 3IWFA 4LFUA 2G7HA 5D5XB 5HS7A 2HTJA 3CTAA 2EJRA 2KIFA 1MKMA 1VTNC 3CJNA 5A2QZ 4EJTA 3GZ6A 1W5TA 2ZNYA 3E3VA 1XDSA 4M73A 4CO8A 1CF7B 1U5TA 3DP7A 4IXAA 1CGPA 4I02A 2DBBA 1XSXA 2W85A 3R60A 3QPHA 3SFZA 4AWXB 1MDMB 3K9TA 2VBYA 3ECOA 1U8RA 4MGRA 3I64A 3GLXA 3C3WA 4A0YA 2PQ8A 2IA1A 1USTA 4UV9A 5AONA 2CGPA 3WTSC 3E5UA 5LGUA 2OAZA 1W7PA 4RGUA 2XAFA 3DQVC 2DU9A 2XRNA 2ZCWA 2XAJA 1FYMA 4FHTA 2W84A 2P7VB 5CVUA 2WWYA 2D2WA 1ZGAA 1K79A 3HRMA 1B9NA 2OQRA 3PQJA 3QU3A 1PDNC 1IN4A 2QQBA 4G94A 2CFXA 2VT3A 1IN7A 3VB2A 4UVCA 2OD5A 4BH9A 2ZMEB 4G7ZF 2QUFA 4ZYHA 5CVIA 2ZFWA 3JAMK 2L54A 1B4AA 1ZRFA 3Q9VA 4N0BA 1R1UA 1FNNA 1IXRC 4KDPA 2VBZA 2P8TA 4XSXF 4LG0A 3FMSA 1XCVA 3EQLF 5D6FA 1I27A 1I6XA 3DPTA 1QPMA 4L5JA 1B6AA 3K69A 5ICGA 2EFWA 1S6LA 2NS0A 4RGRA 1KU7A 4L9NA 5DD4A 3E6MA 5F64A 4YFKF 1C0WA 3NQOA 4I7HA 3F6OA 1ZGJA 2VXZA 2FMYA 1P2FA 4WX9A 3D0SA 2FNPA 4UVBA 2EA2A 3M8EA 3T8TA 3IC7A 5IT9Z 3E5QA 3FXQA 1SFEA 3U1DA 3KETA 3K2ZA 4EVIA 1PP7U 4UUVA 3TDZC 3RKWA 2M5WA 2FBKA 4KIGA 4ENKA 1R58A 3WTVC 4HLYA 4IHTA 2A6EF 5BOXA 4U0VA 1KU2A 5ILUA 1SFXA 2WTEA 4RAZA 3ERED 3KLNA 4HW0A 3H3UA 3F3XA 4ON0A 3V8JA 2L01A 3F8NA 3CUQB 1QO0D 1R1TA 3COAC 4HV5A 3HOTA 2STWA 4LB6B 1SD7A 1YW9A 2M1BA 2ACJA 3CUOA 2TDXA 3BY6A 1FX7A 3WODF 4G8XA 4U0WA 4WXDA 4A5NA 1YTYA 1T98A 2W25A 1DP7P 1D8KA 1KYZA 1U5TB 2EFNA 4Y15A 4WXHA 1XSVA 1WSUA 2PI0A 2HZTA 2EFQA 2BGCA 2ZJ2A 3RKYA 1JGSA 3IKTA 2DFIA 4HF0A 2YSRA 3DF8A 4MTEA 1R7JA 2L02A 2RNJA 2YX7A 3O3KA 5DCFA 2DK5A 4CGZA 4JQFA 4FX0A 4QWQA 2XAGA 1QBJA 5E1XA 1J9IA 3C18A 1LDDA 1W7PB 2P7CB 4M6YA 3HSEA 3RI4A 1ZRDA 5K1YA 1S29A 4E70A 4MEXF 2QWWA 3MEXA 1R5GA 4OIOF 4PGGA 4MTDA 1H9GA 3FZVA 1T39A 1TQPA 4YFNF 5LLQA 2L4MA 2HFHA 1F1ZA 3I58A 3ZMZA 5LRRA 1FC3A 3KEOA 3LAJA 3W6KB 3U2RA 3E6BA 1IRGA 1R1VA 3E97A 3N4MA 1HKQA 5ILVA 3RDIA 3ECHA 3WTXC 5HLGA 3KP3A 4S05A 1ZAOA 3V4GA 4HX4A 4LG0B 1BBYA 1G3SA 4MQVA 2ZBKA 3EDPA 1ZLJA 5AIPA 2DO7A 2L3DA 2PJPA 2PMHA 1BI1A 3I54A 1Z7UA 5FGMA 3BJAA 4Q4ZF 4UNOA 1IXCA 5H20A 4A5MA 4AIHA 2A6HF 2VONA 1TW2A 4P9FA 1S8NA 1ZHFA 3MZHA 2DTRA 3DKWA 4HBLA 2XKOA 5LEJA 2FE3A 4KYWA 1G6NA 4GXOA 1HSJA 4PGHA 2ZKZA 2YPRA 3WTUC 2DPDA 3DPLC 3IRQA 3HRUA 3V8LA 1BC7C 2GZWA 4YG2F 3G3ZA 2O3FA 5FLXK 1R22A 2ELHA 3QOPA 1IZ1A 2HR3A 2UZKA 5F1RA 2H27A 2KKOA 5E18F 4UVAA 2DQRA 3SQNA 3QRFF 2P4WA 3LA2A 2FBIA 3TOAA 2V79A 1SD6A 5HS8A 5H6QA 5J8CA 3PQKA 2Z33A 2Y75A 4MQ9F 3ZMSA 2M30A 2EA4A 3WG9A 4TV7A 2YR2A 2LKPA 1BIBA 4BNCA 2CW0F 4XLNF 1USSA 4BHPA 1FLIA 4Q47A 3I53A 4HOBA 1LVAA 2BV6A 1LEAA 4KA4A 3KE2A 3O6BB 2EFPA 1EH7A 3EYYA 4BHBA 4P9UA 2ADUA 2UXXA 2F2EA 1RIOH 2DQLA 2V1DA 2XKPA 2MLGA 3F8BA 1IAWA 1GHCA 1FYKA 3V8KA 1HW5A 4LLGF 4MHGA 3WGGA 2H94A 5E17F 4IF4A 3D5LA 4I09A 1LJ9A 3WE3A 3L00A 3R61A 5KVRA 2IPQX 2G7UA 4GCVA 2V1UA 3RYRA 5FO5A 4A2UA 1FBUA 3CUQA 3WGIA 1UFMA 2KJCA 2XAQA 3LQRA 3M7GA 2XASA 2V1XA 2ISYA 1Z6TA 3I5UA 2BEOA 2QLZA 3L9FA 1REPC 5D8KB 5CVJA 3BOQA 1XB4A 1UHWA 1B59A 2G9WA 2RDPA 2IA2A 2A68F 4N9HA 3KP4A 1G3WA 3KZYA 2UWMA 2K4JA 2MH2A 3K1NA 1Y0UA 2B0LA 2RVCA 2GAUA 1H0MA 2DW4A 4HAMA 4RGXA 1X3UA 2GXGA 1YO5C 4ZYEA 2PFBA 4Z2YA 3E6DA 3I71A 1BN5A 2F5DA 5HS9A 5D5UB 2P5LC 4BYYA 2M87A 4O6JA 1HW2A 1DPRA 4P5OA 4HYEA 1A04A 5DUIA 3IWZA 1UCRA 2C6YA 2FF4A 3LA7A 1EH6A 1OYIA 4G9YA 2HTSA 4QLCU 4ZYDA 3IRRA 2R7FA 2ISZA 1TTYA 5CYVA 4OU0A 1AOYA 1ON2A 5D5VB 3B02A 2J5PA 2XV4S 1LQ1A 1WI9A 1BM9A 2MD5A 2H6CA 3FX3A 2Y0MA 3JW4A 1O3QA 2VODA 5LHHA 3L09A 2F5FA 2XROA 2FU4A 2IA0A 4DNCA 3HHGA 4GO1A 1P4AA 3JSPA 1XN7A 2V6CA 4L18B 3F8MA 1I1SA 2LF8A 4FX4A 3GFLA 2DAOA 3I59A 1D3YA 3MFKA 1XMKA 4M72A 3P9IA 3BJOA 4KICA 1GVJA 4XSZF 3L2CA 3KP6A 2CWEA 2P5VA 4XBFA 4M74A 3G73A 1J75A 1BJAA 5ED4A 4G7HF 4KMUX 2Z9OA 1P92A 4G6QA 4PZJA 5D6EA 1HBXG 1IN6A 2FNAA 5E1WA 1WQ2A 1Z6RA 5HDGA 4B8XA 1LB2A 2Q2EA 3ZMDA 4NHJA 4KIFA 4UXNA 1KGSA 1IN8A 4OMYA 2O03A 2XUBA 3GZ5A 1GXPA 5JR3A 3OOPA 4GYIA 4WWCA 2HQRA 4EMSA 1WKMA 3K1PA 3JSOA 2WV0A 4HA8A 4Q48A 4P96A 1JE8A 2A07F 1MJAA 3TQNA 2VE9A 2FOKA 3HIFA 1S7AA 2LNBA 3REOA 2FA5A 3Q9SA 2ESHA 1FSHA 1SAXA 1PP8F 4I01A 1HSTA 4L9JA 3J81K 4LK0F 3O2PE 2MBFA 2COMA 1F9NA 5LHGA 1ZG1A 2NAZA 2OA4A 4EM0B 2VT2A 2GIVA 4HX7A 5EEGA 1KU9A 1XDUA 1ZH5A 2EV5A 3CO6C 4O5VA 2XVCA 4RB0A 1XMAA 3OV8A 1YW8A 5BPDA 4ETSA 1BC8C 1XGNA 1EH8A 4LK1F 1IUYA 3MWMA 4XLPF 5HLHA 3P7NA 2UXNA 2IVMA 5FLXZ 3BP8A 4LLLA 3KEQA 2CYYA 1ZYRF 1K6OA 3ABTA 4L9TA 4IJAA 5F6FA 1LEBA 4HF1A 2X4HA 5CLSA 1O57A 2HEOA 3GFIA 4HX8A 2EV6A 5BPIA 3RYPA 1PUEE 1W7PD 3JTGA 1HKSA 2J5OA 1ZG5A 1SD5A 1MZBA 3QAHA 2XIGA 3L7WA 5ICCA 4CHUA 3ZP5A 5DYMA 3HRSA 4HZFA 2IRFG 1YW7A 5HVQC 4KIBA 1OYYA 5TRDA 1BI3A 2OBPA
chains in the Genus database with same CATH superfamily
1A31A 2B9SA 2DPUA 3E0JB 3UR3C 4B09A 2E1NA 4CSWA 3HYIA 2ZXJA 1TQIA 3HJEA 3ULQB 3DWLE 1Z21A 1LNWA 5EGOA 3HM5A 1RKTA 3NRVA 1P4XA 1X58A 3HTUA 4II2A 2VOPA 2K9LA 4OOIA 2WY8Q 2E2JJ 5IYDJ 2DJNA 1LPQA 1I50J 2QBYA 3GXOA 4YIIA 1YRNB 1YS7A 2W1OA 1HW1A 5GP9A 1T6SA 5J40A 5E20A 4F93B 3HOSA 1FOWA 1X19A 5CQEA 3GTGJ 4IRIA 4IPAA 1YIOA 3OYDA 2EIJH 3C1DA 4ZYAA 2VJ4A 3RPQA 2KIUA 2V9VA 1HQCA 1PVEA 2Q0OA 3I9V2 5L3GA 5J1YA 2O9LA 3E7LA 4XLEA 2PEXA 5LHIA 1E3PA 5CVVA 2K4BA 2HPIA 3TW7A 3MKWB 2WBMA 1KQ0A 4D7MA 2FQ3A 1MBJA 3FDYA 3PUFA 4LJZF 3CCJI 3HOXJ 1I3AA 4MFDA 3KZZA 3I59B 1IDYA 2A5YB 2VXDA 1EV7A 1X1AA 5FLVA 4U0YA 3CLQA 2KPMA 3DTIA 3ZCOA 4I0BA 3QPTA 3OYIA 1VQ4I 4BXUA 3WTWC 4DOZA 3FXJA 4BBRJ 1KA8A 1OFCX 2HNHA 5M5YJ 3PSIA 1L3LA 4FT8A 5TGTA 1YITI 2H1KA 1T95A 1V4RA 2EWNA 4A3EJ 2M7AA 5L3BA 2DYSH 2M34A 1XPXA 1NHAA 5LRSA 1Z1DA 4HF2A 1IRZA 1WJ5A 1JHHA 1K83J 3M4OJ 2BY0A 1FP1D 2CUJA 4IRHA 4XKCA 1G59A 1YI2I 2K3PA 1IDZA 1LE8A 3BZ6A 3T0YA 2EFOA 2HS5A 3ZQ7A 3UNGC 5BQTA 1NG7A 2GM4A 1X1PA 2PMUA 2HOAA 4XOTA 4U87A 4ENMA 3FXUA 2LYCA 1J09A 5DV5A 1A36A 2E1MB 1XGSA 5M5WJ 3AFHA 2HKOA 2PMZA 5DUKA 4U7BA 3TGNA 3AG2H 1IJWC 4AIDA 3VEPA 4N9IA 3MVPA 3A0HC 3HEFA 3B6AA 3R0JA 3OS1A 4EEFG 2ZXIA 2Q2EB 4U88A 2BY1A 5CPRB 4I98B 4DYRA 1D1AA 4LD5A 3W2AA 2FEZA 2O61A 3KFWX 1OQYA 1FTZA 1U3EM 2DI3A 3S1NJ 2AXLA 2O7OA 3R4KA 1KU3A 2VKHA 4JX4A 3CO7C 2DA1A 4L9VA 2JA6J 2D1HA 2YX4A 3GFMA 3I0TA 4XL9A 1KQ9A 4XN3A 2JRTA 4KITB 4EM1A 2ZMEC 2OZ6A 3LFKA 1RESA 1FOKA 5ERIA 4UB8C 3A03A 4MNUA 2HOEA 5BS6A 3ZMUA 2R7QA 5EZGA 4ENJA 3HPHA 1ZRCA 1FBSA 4M3FA 1SMTA 2A3SA 1VQOI 3ZQFA 2P5KA 1X4PA 1AU7A 2QKLB 5DD8A 1OCPA 2DT7B 1MBKA 3KZIC 4LLNA 2JUCA 2TCTA 4PJLA 2FD5A 3F8CA 3MCZA 1BIAA 1V5FA 5E3OA 3BG9A 5D4SA 4C3JJ 3TEDA 3S16J 1DDNA 2EV0A 4ESBA 1OMIA 3LSGA 2K7LA 4PSWA 2K27A 3HGGA 1FYLA 4K2EA 1FZPB 4GGGA 5FKLA 1BR1A 5D8LB 5CQGA 3BCAA 1I1GA 3LL7A 3JRIA 2RN7A 3TOBA 4OIPF 2CRGA 3E6CC 3GLLA 4KN7X 2O6GE 2IGMA 1YQAA 2KP6A 3BR1A 1WPKA 3PUBA 4A3JJ 1APLC 2IS2A 3PFYA 1SD4A 1N78A 1T8IA 1P7IA 2E36A 2YU3A 3HKZN 2K3FA 2QQ9A 3WTTC 4I0AA 3PNVA 4OINF 3JRGA 1X1CA 2KDZA 1ZR2A 2LD5A 4GYGA 2EBIA 3CMEI 2JWTA 4PJJA 3DBRB 2IP2A 1ZN2A 2X6WA 2O8XA 3F22A 3SZTA 2FQ4A 5TJJA 3DFGA 5GAHJ 3RPUA 4F92B 2IS6A 1R5HA 2IXSA 2P6TA 3LFUA 4G6DA 4WF2A 1FSEA 3EETA 3FXMA 3R0AA 4XKWA 1ZARA 3E5XA 5DM7F 1UAAA 1RR7A 2ZJPF 2Y0SA 2A69F 2DK8A 3M3YJ 2OCCH 2ME6A 2BHYA 1ACIA 2XSJC 2F4MB 2XHKA 3OS2A 1YX5A 1J2XA 3BR5A 4S04A 1ULYA 1YLFA 1QZZA 3GMEA 4QSHA 1HKTA 5HDKA 2JSCA 2VI6A 5DCMA 1E3HA 2QSGX 3ESWB 3RIRA 2GA1A 2NYXA 3VODA 1YFHA 4NUBA 4CCOA 4Y13A 2LP0A 1O7LA 6PAXA 5LGNA 5GPCA 4PK4A 3GYHX 1ZR4A 4EGYA 3Q5FA 2R93J 1UZCA 5FKNA 5C4XJ 1MBHA 2JRMA 1OISA 1SVLA 1XSDA 2MA3A 3H92A 4AVPA 1QGPA 1BL0A 4A0ZA 1XGOA 3ZQLA 4BQQA 3K1MA 3OS0A 4BE0A 2KJBA 4OIQF 2BXYA 3CUQC 3S15J 4EGZA 2L7FP 1OJLA 1DU0A 4D0PA 3ZQHA 4NQWA 5H6RA 1TQMA 5JLXA 3SZPA 4EV0A 2LC2A 5EGOB 3IL2A 3M8FA 3FHNA 1U78A 1BI2A 3DBHB 4R79A 3M8JA 5LEKA 3UKGA 2CO5A 3CCSI 3V7SA 2QBYB 3V42A 3ONQA 4M6XA 3ZQQA 1POGA 1XCBA 2MGQA 3LSHA 2M8EA 1UG2A 2QENA 1QQIA 1RZ4A 4YFXF 3RCOA 2RKHA 3HZJA 3S17J 2A05A 4OIRF 1K78A 4RAFA 3GEZA 3K7AJ 1BR2A 5CVRA 3I4NJ 1U5TC 2JQ7A 2MC4A 5KCMA 5IP7J 1R49A 4ESJA 3J80Z 3A2KA 4ZZDA 3BR3A 2FBHA 2O5RA 1VZ0A 2LSOA 4IEJA 2O0YA 4C30A 3T5XA 3ZMVA 3VSLA 5DEQA 2VPLA 4G7OF 2BVLA 1D1BA 1Z3YA 4JOMA 1P7JA 4XMYA 1ODDA 3J81Z 5GTHC 5JHUA 1Q1HA 5J4YA 5IOYA 5J3LA 4A3BJ 4I2OA 3CJQB 1WWXA 3M9AA 3H3ZA 3QYBA 1IXSB 5E3MA 1LDKB 3FXOA 1P4WA 3Q3SA 2GA2A 3VPRA 3FKJA 1LUJB 4UV8A 2LBFA 3FF5A 5HOOA 2KRHA 3KP7A 4XK4A 2FSWA 2ZFUA 1GV2A 3HSRA 2QVOA 5CJ9A 4NC6A 4L0ZB 1LE8B 3HUGA 5K5RA 1PUFA 2FXAA 3CCUI 4CCLA 5D5WB 2NVXJ 4JBAA 3HSFA 4RB2C 3BWGA 5L3CA 1MNDA 1RKWA 1O3RA 2KZVA 2NXNB 2Q1ZB 2B7EA 1R23A 2XC7A 2VE8A 1O3TA 2M7BA 2XSDC 3JREA 1MNMC 3GUDA 4HG2A 3TO6A 5J1RA 2DOFA 2V4JC 2JT1A 2OQGA 4PJMA 1Y8RB 3J7AY 5FD5A 3ZR8X 2CV0A 3PFIA 2X48A 3H0GJ 1R4NB 1SEUA 1WRJA 4BAYA 2KL4A 1ZELA 2HQ5A 2WAFA 3KYDB 1R00A 3TP0A 2OJED 1BI0A 3ISPA 2ZXWH 2HXOA 1TNSA 3EYIA 2ETHA 2HQNA 5AIQA 3CCVI 3WE2A 3L2UA 2Y2ZA 2G0EA 1W0TA 1F4KA 4LOCA 3MAJA 5EG0A 5LGTA 1Y56A 1FT9A 4I99C 3ZPLA 2RQPA 4KMFA 3LSTA 4PJ0C 4MEYF 2X1DA 1MNEA 4M3DA 4EJOA 1LKXA 1Z9CA 4XLHA 2JTVA 2GWRA 4C9YA 5J47A 3QWLA 2NOGA 1G4DA 2VC0A 2X85A 1BW5A 2VUMJ 2L2OA 2XGEA 3ELKA 3FXRA 2E2HJ 2QSFX 2LF7A 2D5VA 5KK1A 1XTAA 1O3SA 4AIKA 4UUTA 4BY7J 4L5IA 3K4NA 1H88C 1E17A 4WXCA 2GLOA 2VIXA 2F6CA 1KYWA 5E8GA 4D5CA 2XGXA 2QZ8A 5KAIC 3KLOA 1Z3XA 2LOOA 2RC4A 4HDUA 3TO7A 2JUGA 3CF5F 2AS5F 1X1DA 2ZB9A 2ECBA 4M6VA 3CZ6A 5L3FA 3L2WA 4RAYA 1R6RA 4BQAA 3K2AA 4XKVA 1YG2A 3T8RA 1IGNA 2GXBA 1W5SA 2R7DA 2L9SA 3AL0B 2L9NA 3RPUD 4LMYA 3IUOA 1F5TA 2EPFA 3BPVA 3IAM2 1YX3A 2DJIA 4RB1A 4E7KA 3AAFA 2W00A 5EYRA 4AIJA 2H09A 1LDJA 2IGNA 1TWCJ 4ZDLA 3S3OA 5HNHA 3P9CA 1T08B 3BZCA 4U7DA 1MSFC 4XR6A 2DFEA 5B1AH 3BROA 2Y0SN 4PDKA 2CV2A 1OPCA 2HOSA 3ASOH 4F55A 1FBQA 3S8PA 1TT5B 1HXDA 3OIOA 3PIOF 4C2UA 4M9SA 4IQJA 2ZO4A 5L3EA 2HGCA 3LSMA 3KYLA 4O3MA 1FMVA 2XAHA 3S32A 2OC6A 2CSOA 4B1RA 1ON1A 1VFCA 1FP2A 3BJ6A 5A2QK 5EEHA 2HVRA 2CQ7A 2STTA 2JZYA 2XGCA 1EKEA 2KRFA 5LBQA 3ZOBA 5DCMB 3HOUJ 2HI3A 1W4MA 2Z5UA 4ZYGA 3SDBA 3S1QJ 1ETYA 1K7AA 2MFZA 2F5CA 4KN4X 2KHMA 3R6SA 5J6XA 4EM2A 3K0LA 1BJZA 5D4RA 2JPBA 3EUHA 3J80K 4IHSA 3ZMTA 4M9ZA 5DTDA 3CJRB 1E0EA 1JUSA 4A3DJ 4A6DA 4IHXA 4B4CA 3DKXA 3B73A 3OYLA 1P6RA 1R71A 4A6EA 2VC1A 5HLTA 1YS6A 2DLLA 1FWZA 3GF2A 3SXYA 1E3OC 2X1CA 5JI6A 3K4JA 3KP5A 3HRTA 4AUXA 2JSPA 4IO9F 3RQ4A 3KCCA 2Z3YA 4XRFA 5C4JJ 2HKXA 2DDBA 2W4SA 1IN5A 4NQWB 2AO9A 2BZTA 2DODA 4BGDA 5KHDA 2A61A 5M5XJ 1YJWI 3WU0A 1DU6A 3MZYA 3ABUA 3H5AA 3WTYC 4I6ZA 2IAIA 2D45A 4A12A 4JK1X 4H0EA 3G71I 3QP6A 4L5EA 4RMNA 2NNNA 3CCMI 1ZG3A 4NB5A 2IGKA 2VBWA 1J0RA 2E1OA 4KUMA 3D1NI 3TL4X 4A69C 3ZN0A 2OU2A 2QQAA 1ORKA 3AG1H 1XGMA 1K78B 4WK8F 2MH9A 1T38A 9ANTA 2EK5A 3WHCA 2ZNZA 1S3JA 2F5EA 4FASD 4Y17A 3L1PA 5E8IA 3RJPA 4XRSG 2E7XA 4DQ2A 5K5QA 2ZJRF 4ENNA 2HVSA 1W36D 3RZDJ 1RI7A 2VB6A 1U6GA 2CH0A 3DV8A 5E1ZB 1TLHB 1UB9A 3PSFA 1L0OC 4CYDA 3HOZJ 4WCGA 1JXSA 2M45A 5L3DA 4LGWA 4ZZLA 3GX4X 1Y1WJ 5FKOA 1QVUA 2VJJA 3BT9A 2KDOA 2PLYA 2DDAA 3K4KA 4PFPA 4F52A 2HPMA 3FM5A 3QP5A 1IV6A 5JVTA 4IHYA 4EATA 2HZDA 2CQQA 3EUAA 2QM3A 1MW7A 3GO5A 1HF0A 1JI8A 3K10A 2V1NA 2X6XA 2LBFB 3WU1B 4E7JA 1JKPC 3ROUA 1TBXA 2PBIA 4LB5A 3HUGB 3F72A 1PUFB 1Z05A 2CG4A 3CLOA 3SFIA 3U1KA 5J8FA 4HQMA 1GDTA 1GUUA 1ZLKA 4UY8I 1UJ8A 4EJVA 1FTTA 4NBQA 4D1QA 3LAPA 4QPOA 4HQEA 5K5OA 4ZDOA 3CC4I 1P9QC 4IL6C 1ETKA 4KFCA 4L0YB 3ML6A 2KIQA 1X1BA 2BY3A 1U2WA 3H3VK 4YELA 5ILSA 3LA3A 3QYEA 4R1HA 1NK3P 1HDPA 5FFXA 3S3MA 3ABKH 1J59A 2AHQA 2RV8A 2Q8KA 3JRBA 5KNLA 2HWVA 2IW5A 5HLIA 3FHZA 2Z2SB 4E7HA 1JHFA 3OYNA 3CP8A 3G2BA 5EG0B 3FMRA 2NNYA 1QNTA 3HG9A 3VOEA 5BMZA 1I5ZA 3DTKA 4ZC3A 3QU6A 3GVAA 2D1VA 2FMLA 3ASNH 2WA0A 1B8IA 4HV6A 1MJBA 1UMQA 4YIFA 4B48A 3A01A 3ZQCA 3HTSB 2BBYA 1CF7A 3CDHA 2MLKA 1B9MA 3FK6A 3MQ0A 5DM6F 3CMAI 1MD0A 1T0FA 2LLKA 4A3LJ 5IT9K 4KISA 4Q5SF 2BE5F 2XRLA 3D5RC 1RNLA 3C7JA 1O4XA 3RKXA 2AQFA 1MDMA 2ESNA 4CDGA 3OYCA 3BPXA 1Y0NA 3GFJA 3IKVA 4BHCA 4C2MJ 1KQ8A 4V19K 2XB5A 2E1CA 1V5GA 2IT0A 3BTIA 1V3FA 2DMUA 4P55A 4RGSA 1NTCA 2LMDA 5FD6A 3KP2A 1RUOA 1XD7A 1Z91A 2VN2A 3TO9A 3WGHA 3WTZA 3JTHA 4E7SA 2RGVA 5C44J 1RUNA 4CICA 3F8FA 4XONA 1J7KA 4UHTA 2HDCA 3DCFA 1O7FA 2VQGA 2VL8A 3CD6I 1JUMA 1J5YA 2DA5A 3BDDA 1B72A 3CMYA 2DT5A 2E71A 3KEYA 3SHFA 2EZKA 2Y48A 4M71A 3LNQA 3I4PA 3HC7A 1NK2P 2VBXA 4KNYA 5HODA 1IF1A 1VQ8I 1OCZH 2NRAC 3GWZA 1DPUA 4PCQA 3SEQA 3TKYA 3K70C 1BOAA 1SFOJ 2MC3A 1MMAA 1UHMA 5IT3A 1VQNI 1OYWA 1TWGJ 1X3WB 1SFUA 2HYGD 1MJ9A 1WCMJ 1S7EA 2XF5A 3SEZA 3QOEA 1OR7A 4EQQA 3GZNB 2V9KA 2VPRA 2VASA 3HOVJ 1DUXC 1VQLI 1VQPI 4HSTA 1TNTA 4LIUA 1MIJA 1ETWA 2E7WA 5M3FJ 3DEEA 4M9XA 5DS9A 2W24A 3DXJF 3FMQA 3OSFA 3C2HA 1FPQA 3AG4H 4A0XA 4DBQA 3F21A 5FB2A 4E7IA 4CXFA 2ME0A 4HLXA 2ZMEA 3LWFA 4YRVA 1FY7A 2QYOA 3VFZA 1Z77A 5EJCA 2LK2A 3F0CA 3IHUA 2M4KA 1NH3A 2WC2A 2X0LA 2L4AA 1STZA 1Q1VA 4LIVA 1BOBA 4AYBA 2LDUA 5JFRA 2ECCA 3TBIA 1GVDA 4OMZA 5ICFA 2BXZA 1ONVA 4ZH4F 1R36A 5ICEA 2R4GA 2FOWA 1H9TA 1B1BA 3QODA 3GW2A 1D5VA 4RB3C 3ZRGA 3IH3A 3DLAA 1WZ2A 2KIMA 1SAUA 3HXLA 2IJLA 1ZREA 4MFEA 1D0ZA 2E19A 3TMOA 2E35A 4EJUA 1AWCA 3N97A 3F23A 2HYFA 2CQKA 3CQZJ 1RPWA 2M8GX 3T1BA 1BR4A 4ASNA 4DYQA 2NVYJ 2W57A 3HPGA 1T2KA 4BJ5C 2XDVA 2Z16A 3W2VA 3U21A 1TW3A 2PN6A 2K86A 4BY1J 3CF2A 2R3SA 2JPCA 2H6BA 3LOCA 4NNJA 4QIWN 3AL0C 3DEUA 3A4CA 1W5CC 3BR0A 4AD9A 4D5FA 1MGTA 2EB7A 4DZJA 5DDGA 1S7OA 2GQQA 5HDNA 4IOCF 4RS8A 3V7CA 3M1EA 3BQZA 1X2MA 1Y39A 3JAMZ 4EJWA 2OZUA 4RBOA 5FFZA 5IY5H 2MABA 4ESFA 3FM3A 1QHHD 3J7AO 5IYBJ 1IRFA 4IVNA 4MO7A 4CZZA 3RTRA 1GLNA 1D5YA 2PG4A 1D8JA 1EF4A 3F6VA 3V7RA 3W6JB 2JA2A 3H1CA 3S2HJ 3OL3A 1E2XA 1G3YA 4CUGA 3ZN1A 3HHHA 4R8HA 1SMYF 2R7UA 5IPAA 2DCEA 4KT5C 3G1MA 1TT0A 2EINH 3P9KA 3LQQA 3MKYB 2Z99A 5IP9J 3TDUC 4HDVA 1YHQI 1N77A 1YYVA 2K5CA 4MLOA 1QU3A 5GAGJ 2P6SA 1OKRA 1G3TA 1GXQA 2H1LA 3GCMA 3NEUA 3S2WA 3L2VA 2M3AA 4IRGA 4N4NB 1IW7F 2FRHA 3JCUC 1XS9A 3I3LA 1S5LC 2XF7A 4F7ZA 1ZQ3P 4CCJA 3I4MJ 2VOOA 1QZYA 1R5ID 3JR9A 3FWEA 5K7HA 2BYVE 2K02A 2N8GA 3U9GA 4C2TA 3BZKA 3IWFA 4OWRB 2XF6A 2CMPA 1WJAA 4LFUA 2QEXI 2G7HA 3J7ZI 5D5XB 5HS7A 1GT0C 3L2RA 3ZGKA 2HTJA 5F0CA 4RM3A 3BR6A 3CTAA 2EJRA 2KIFA 2X6YA 4FCYA 1MKMA 4GRIA 1VTNC 3CJNA 5A2QZ 4EJTA 3GZ6A 1VQ9I 1W5TA 5CKTA 5E79C 1JJ8C 2ZNYA 3OIPA 3E3VA 2ZXHA 1U9NA 1WI3A 2QGUA 1XDSA 3WG7H 4M73A 3H0DA 2E60A 1MMSA 1QZEA 1B8IB 2DYRH 2R7XA 3A01B 4CO8A 4V2GA 3QQAA 1CF7B 1U5TA 2CQXA 3DP7A 4IXAA 2V26A 3FIWA 1CGPA 4I02A 2VJIA 4XNFA 1ZTRA 2DBBA 1XSXA 2W85A 4HNTA 1FJLA 4XRMA 4C3IJ 3BC8A 3AG3H 2HYJA 3R60A 1TWFJ 4JX5A 4I76A 3QPHA 2OCEA 3SFZA 4AWXB 1MDMB 3K9TA 2HQAA 2VBYA 2CU7A 3ECOA 1U8RA 1X2NA 4MGRA 1W36C 3I64A 3GTKJ 3GLXA 3C3WA 1KZHA 3PIPF 4A0YA 2CW8A 2PQ8A 3K70D 2IA1A 2DFFA 3K4LA 1USTA 3PNTA 1TWHJ 2QA4I 4UV9A 3E1SA 3L2QA 5AONA 3GTOJ 5EZHA 3VSKA 3WTSC 2CGPA 2CV1A 3A1YA 3BG3A 3ABMH 3E5UA 3HB9A 2A6TA 1B72B 5LGUA 2OAZA 1TP4A 1W7PA 1QA6A 4BE2A 4RGUA 2XAFA 3DQVC 2DU9A 2XRNA 2ZCWA 3CMMA 2XAJA 1MH4A 1ZGWA 1FYMA 3PM1A 4FHTA 2W84A 2K9SA 1LFPA 2P7VB 2X6OA 5CVUA 2WWYA 2Z1DA 4E4HA 1K4SA 2D2WA 2VQLA 1ZGAA 1IV8A 2GBYA 1K79A 3CP2A 5EDNA 3HRMA 1B9NA 2OQRA 2P81A 3ZXSA 3PQJA 3KYCB 3QU3A 1PDNC 1IN4A 2QQBA 1KONA 2IBDA 3NAUA 2I5UA 4M3EA 4G94A 2CFXA 3BTCA 2DMPA 2VT3A 2O8KA 1OCCH 3S1RJ 1IN7A 2WY7Q 3VB2A 3MD2A 3DPUA 4W97A 2GOXB 4UVCA 2OD5A 2JVHA 1K6YA 4BH9A 2ZMEB 2EZLA 4KT6A 4G7ZF 2QUFA 2MG4A 4AYBN 4ZYHA 5CVIA 1A5JA 4HEA2 2ZFWA 3JAMK 2L54A 1QVTA 5LFAA 1B4AA 1ZRFA 3K4BA 5EF6A 1U9OA 2H8WA 5K7FA 3Q9VA 4N0BA 1R1UA 1FNNA 1IXRC 2Y30A 2R5ZA 1A35A 3Q0UA 4KDPA 1GV5A 2VBZA 2P8TA 3IAS2 4XSXF 1VQKI 4LG0A 3FMSA 1XCVA 2X51A 3EQLF 4YIRX 2NVQJ 5D6FA 1I27A 1I6XA 1SVOA 4A3FJ 3DPTA 1JGGA 3HDDA 1QPMA 3VDXA 2KLOA 4XOPA 4L5JA 4BQNA 1B6AA 3K69A 4XN0A 4PSXA 5ICGA 4V2FA 3HOWJ 2EFWA 2ELJA 1S6LA 3NWTA 2NS0A 1IG7A 4BU2A 4RGRA 3DLLF 1K4TA 2JN6A 2JVGA 1BW6A 1KU7A 5B5EC 3IH2A 4L9NA 3OL4A 5DD4A 2OTLI 4QTRA 3E6MA 5F64A 3BCBA 4YFKF 2CJJA 1C0WA 2CUFA 1V54H 2M9HA 3NQOA 4I7HA 2E1MC 2QQ8A 3BTJA 2DOEA 3F6OA 1ZGJA 2VXZA 2FMYA 1P2FA 4WX9A 3OYKA 3D0SA 2FNPA 2R92J 1F43A 3CDIA 4UVBA 5JVGF 2EA2A 3M8EA 3T8TA 3IC7A 5IT9Z 3E5QA 3FXQA 1SFEA 3U1DA 3KETA 2YUSA 2R5YA 1YJNI 1Y8QB 4XLAA 3K2ZA 3BG5A 4EVIA 1PP7U 3C2GA 3DBLB 2VJ5A 2XPVA 4UUVA 3TDZC 3RKWA 2M5WA 3MZ8A 1HA8A 2FBKA 3NARA 4J19A 2VQCA 1VQMI 4KIGA 2BOLA 4ENKA 3PJRA 1R58A 2XPWA 3WTVC 4HLYA 4B3AA 3CDLA 4Y33A 5GAEJ 4IHTA 2FX0A 3PNYA 2A6EF 2OPTA 5FKKA 2ZJQF 5BOXA 3G4SI 3RKQA 4U0VA 1MBEA 4AVZA 4A3CJ 2MSYA 4Y52J 2E34A 1WH5A 2BW3A 3OWTA 1KU2A 4IX7A 5ILUA 1SFXA 2WTEA 4RAZA 3ERED 3KLNA 4HW0A 4XORA 2HU9A 3H3UA 4JX6A 3JRDA 3F3XA 4ON0A 3V8JA 4E6KG 2L01A 1VI0A 3F8NA 2MD0A 3O8HA 1FOXA 3CUQB 3VWBA 2VKDA 4ANJA 2IGOA 2LY1A 3O8GA 1QO0D 4G12A 2R7SA 2NVTJ 2PX9A 1R1TA 3COAC 2JA7J 1OCRH 4HV5A 4JYKA 1R4MB 2RAEA 3HOTA 2STWA 3CESA 4LB6B 1SD7A 1NG6A 1YW9A 3DU6A 4B3XA 2HDWA 2M1BA 4ZTFA 2ACJA 2L5QA 2BY2A 2EILH 1I3QJ 3CUOA 4C3HJ 2TDXA 4IKFA 3BY6A 4FTHA 1FX7A 3WODF 4G8XA 4U0WA 1JUPA 2QKMB 4WXDA 4A5NA 4H4KC 1YTYA 1T98A 1TWAJ 2W25A 1DP7P 1D8KA 1KYZA 3FBNB 4ZDPA 1U5TB 2VKEA 2LKXA 2EFNA 4Y15A 1D1CA 5F1JA 4WXHA 1XSVA 4A93J 3M1CA 1WSUA 2PI0A 2HZTA 1T56A 2EZHA 2EFQA 4RAGA 2BGCA 4BXFA 1RETA 2ZJ2A 3RKYA 1DP3A 2LY2A 1VQ5I 1JGSA 3IKTA 2DFIA 4HF0A 2YSRA 3DF8A 3S3NA 5K7ZA 4MTEA 3QYFA 4CA0A 4J01A 1R7JA 2L02A 4IHWA 2RNJA 2V9PA 3IV5A 4MIMA 3ZQIA 2YX7A 3O3KA 1ETOA 2EZIA 5DCFA 2DK5A 2LFBA 2CQNA 1WJCA 4CGZA 1R9TJ 4RDUA 4JQFA 3RZOJ 2CUZA 3VYRB 1V5EA 1BA5A 2ICWG 4FX0A 2XGDA 4QWQA 2XAGA 1QBJA 5E1XA 1J9IA 3C18A 1HC8A 1HLVA 1JTXA 1LDDA 1W7PB 2P7CB 4PJNA 4M6YA 4XQFA 2OUMA 3HSEA 3RI4A 1ZRDA 3CC7I 4BBSJ 5K1YA 1S29A 2DA4A 2R7VA 3LMMA 4E7LA 4GFBA 3A0BC 4E70A 1YJ9I 4MEXF 2QWWA 1VF9A 3MEXA 1R5GA 1U8BA 2RREA 4OIOF 4IQ4A 5IP6A 3M07A 3AKZA 4X0GA 2K9NA 3PL8A 4PGGA 4MTDA 1HCRA 4AM3A 2E5NA 1H9GA 3FZVA 1T39A 1TQPA 4YFNF 5LLQA 1M1EB 2HOTA 1FOYA 2NOJB 2QF7A 4BQOA 1D0YA 2L4MA 1IUFA 2HFHA 1F1ZA 3EPZA 3I58A 3ZMZA 2Y9YA 1IC8A 5LRRA 1FC3A 3KEOA 2GIZA 3LAJA 1WJDA 5J1UA 4CYCA 2R7RA 3W6KB 3U2RA 3E6BA 2PJRA 1IRGA 1G8XA 1R1VA 3E97A 2Y9ZA 3F9KA 2VQHA 3CCQI 5ILVA 1HKQA 3N4MA 2K40A 3RDIA 1RRJA 3ECHA 3WTXC 4AC0A 2TRTA 5HLGA 3KP3A 1Y1VJ 5F04A 2M0MA 3D5SC 1T0FC 2R5ZB 4S05A 1ZAOA 3V4GA 1W1WE 4KJZA 4HX4A 1XG1A 2CW7A 4LG0B 1BBYA 3GBGA 2FJ1A 1G3SA 1IO2A 4FETA 4MQVA 4F3QA 1F36A 2CUEA 5JHFA 3CC2I 2B63J 2ZBKA 4OAYA 4DBRA 4CCMA 2R7TA 3EDPA 1ZLJA 5AIPA 1ITYA 4Y7NJ 2DO7A 3SYTA 2L3DA 4JP0A 2PJPA 5LD2C 1YIJI 2DMNA 4BS9A 2IS1A 2PMHA 1BI1A 4HRIA 2BHZA 2WB1N 3I54A 2IEKA 3K4CA 1Z7UA 4DIQA 1ETXA 3JRAA 5FGMA 4HNVA 2DA2A 5GPAA 3BJAA 4YEJA 1I39A 4LG3A 4Q4ZF 4UNOA 1IXCA 5H20A 4A5MA 4AIHA 2A6HF 2VONA 1TW2A 1T33A 5B1BH 4P9FA 1S8NA 4IOAF 1PYVA 1ZHFA 3BG7A 2R5YB 3MZHA 3VYTB 2DTRA 4Y3OA 4OAZA 2KZGA 4XRSA 3DKWA 4HBLA 2DXIA 3JRCA 1OR7C 4RM2A 2XKOA 5LEJA 1YE9A 3CCYA 1JJ6C 2FE3A 1OCTC 3W3CA 4BACA 2R7ZJ 4KYWA 1G6NA 2VKVA 4PFOA 4GXOA 4DZPA 1HSJA 4PGHA 3WU2C 2ZKZA 4BL0B 2AXTC 2DA6A 2YPRA 3WTUC 2DPDA 3DPLC 3IRQA 3HRUA 1LFUP 3HGYA 1SFKA 2DN0A 4QPQA 3V8LA 1BC7C 2H8RA 3DKYA 2RQQA 3LSRA 1ZK8A 2GZWA 4YG2F 1Z0XA 3G3ZA 2MYSA 2O3FA 5FLXK 2EIMH 1VNDA 4A3MJ 1R22A 2ELHA 2XB0X 3OYJA 3QOPA 2HXIA 1MSEC 2HDDA 2M4GA 1IZ1A 2HR3A 1CQTA 2BW3B 2WAQA 2LVSA 3LSPA 2UZKA 2ELKA 2X1EA 2LREA 5F1RA 2H27A 2KKOA 2L7MP 5E18F 1TZLA 3MMYB 4FE7A 4UVAA 2DQRA 1AKHA 3SQNA 3H36A 1ENHA 3QRFF 1FMWA 2P4WA 3LA2A 2AQEA 2FBIA 3OYHA 3N05A 3TOAA 2V79A 1SD6A 1VQ7I 2UV1A 3BTLA 5HS8A 1N75A 5H6QA 5J8CA 2NVUB 3W6VA 4DJAA 3IH4A 3BQYA 2K85A 2CFOA 3CJTB 3CCRI 3RQIA 3PQKA 2Z33A 4ABZA 1ETVA 3PO3J 2LY9A 2WADA 2Y75A 1DGWY 4MQ9F 2LH9A 3ZMSA 4F91B 2M30A 2EA4A 3VYSB 3FXLA 4TV7A 3WG9A 1TL8A 4DYCA 1JT6A 2YR2A 2YS9A 5C3EJ 3SJMA 2LKPA 1BIBA 4BNCA 1Y6IA 1ERDA 2R7OA 3B6CA 2CW0F 4XLNF 3JRFA 1USSA 4BHPA 1FLIA 4Q47A 3I53A 2DMTA 4HOBA 1LVAA 2V7FA 3HL2A 4B44A 2BV6A 1LEAA 4KA4A 3KE2A 3O6BB 2EFPA 3HBLA 1EH7A 3EYYA 4BHBA 4P9UA 2ADUA 2UXXA 2F2EA 1RIOH 4D9JA 3C2BA 4XIDA 4AU7A 2DQLA 4BKXA 3PO2J 4RLQA 2V1DA 5F08A 5FLMJ 3BLYA 2XKPA 2MLGA 3F8BA 3FISA 2VLAA 4RA2A 1IAWA 1GHCA 1FYKA 3V8KA 1HW5A 1U0JA 2WV1A 4LLGF 4BDZA 1OCOH 4MHGA 2L9RA 4UUSA 3WGGA 4CH7A 1EA3A 2H94A 2E5ZA 3KIOA 5E17F 4IF4A 3D5LA 3WHBA 1JKOC 4I09A 3K6GA 1MBGA 1LJ9A 2DA7A 3WE3A 3FBIB 3BR2A 3L00A 2A5WA 3R61A 2EH3A 5E3LA 5KVRA 2ID3A 3H35A 2LRDA 2IPQX 2G7UA 1PJRA 4GCVA 3GTJJ 2V1UA 5F0HA 3RYRA 5FO5A 4A2UA 1FBUA 1A6QA 3CUQA 3DTEA 3WGIA 1UFMA 3KPHA 2KJCA 2XAQA 3LQRA 4NDLA 3M7GA 4B43A 2XASA 1MMDA 2V1XA 3OR1C 3OYGA 2K9QA 2ISYA 1Z6TA 3DU5A 3KX2A 1AHDP 3I5UA 2BEOA 2QLZA 4IZZA 3L9FA 2UUZA 1REPC 5D8KB 5CVJA 3BOQA 4RLFA 1XB4A 3OYEA 3LSKA 1UHWA 1XX5A 1B59A 1YOVB 4M3BA 3OYAA 2G9WA 4CYCB 2RDPA 3GTQJ 2IA2A 4BEHA 2A68F 4N9HA 2PJRB 3KP4A 1G3WA 1AA7A 3KZYA 2UWMA 3G1LA 2K4JA 2MH2A 4J00A 3MN2A 3K1NA 1QHGA 1IRXA 3GTMJ 3S14J 5F27A 1Y0UA 2F48A 2B0LA 3DEWA 2RVCA 2GAUA 1H0MA 3OSGA 2DW4A 4HAMA 2P0WA 3OYMA 4RGXA 2KMUA 2L7KA 4P1WA 1H8AC 4FE4A 2DFHA 1X3UA 2GXGA 1YO5C 4ZYEA 2PFBA 2JK3A 4Z2YA 3E6DA 4S0HB 3S93A 3I71A 1BN5A 3VYUB 4X1EA 4HSRA 2F5DA 4BDYA 1JTYA 2KQRA 5HS9A 5FJ8J 1VQ6I 3H9GA 3W2WA 5HNFA 5D5UB 2P5LC 2K9MA 4BYYA 2E2IJ 2M87A 3OYBA 4O6JA 5H2FC 2JJ7A 1HW2A 1DPRA 4P5OA 2CS3A 4HYEA 1A04A 1WJBA 2GXAA 5DUIA 3OR2C 2MW8A 3IWZA 4II3A 3J7YJ 3OIQA 2Y31A 4A3IJ 1UCRA 2F4IA 2C6YA 2FF4A 3LA7A 3SDGA 3G6EI 1EH6A 2PMZN 3CCLI 1JKRC 1X3ZB 3P5JA 1OYIA 1MBFA 4G9YA 3JRHA 2OF7A 2HTSA 1HDDC 4QLCU 2LR8A 4ZYDA 3IRRA 2R7FA 2ISZA 1G2HA 1TTYA 4XKBA 5CYVA 4IHVA 3I55I 4W1UA 4OU0A 3LSIA 1AOYA 1HOMA 3FKIJ 3TP3A 5KAFC 1ON2A 3X2QH 2GOMA 5D5VB 3B02A 1QPIA 2J5PA 2XV4S 3ZQGA 1UG0A 1LQ1A 1WI9A 2KISA 1BM9A 2BVMA 4G6TB 2MD5A 1YRNA 2H6CA 3HOYJ 1FIAA 2Y0MA 3FX3A 3JW4A 1O3QA 5B66C 2VODA 5LHHA 2M0CA 2DOAA 3L09A 2F5FA 2L0KA 2XROA 2FU4A 4X6AJ 2IA0A 4DNCA 2DMQA 1MMNA 3BG6A 3HHGA 2JA5J 2W48A 1N25A 4GO1A 2M2EA 1P4AA 2W7NA 1SC7A 3JSPA 5FKMA 3ERMA 1XN7A 2V6CA 4L18B 1FIPA 1SVMA 3F8MA 1I1SA 2LF8A 4DGWB 5FRNA 1V55H 2WAQN 4FX4A 3GFLA 4NC7A 2I8DA 2DAOA 3I59A 1D3YA 3MFKA 1XMKA 4M72A 2OTJI 1WGXA 3G1OA 4BJTA 4BJ6C 3P9IA 3BJOA 4KICA 1GVJA 3OY9A 4XSZF 3FK7A 1AKHB 3L2CA 2DT6A 3KP6A 4XLFA 2CWEA 2Y69H 2ZSHB 2P5VA 2QCOA 4XBFA 4FISA 4M74A 2JA8J 1A6IA 3G73A 1DGRM 1J75A 1BJAA 5ED4A 3NWSA 4G7HF 4A3GJ 1S9HA 1ZKGA 4KMUX 4B47A 2WB1A 2R7WA 3Q0WA 3SZGA 2Z9OA 4CCNA 3H9JA 1UELB 1FEXA 4N4OB 1P92A 5F0FA 1Z7LA 4G6QA 3MKLA 3RSNA 4CZCA 4PZJA 4GDFA 5D6EA 2NS7A 3OMYA 1IN6A 2FNAA 2JMWA 1HBXG 1RC9A 2DA3A 5E1WA 1WQ2A 2FUG2 4BUPA 1Z6RA 5HDGA 4B8XA 4XICA 1LB2A 4BXXJ 2Q2EA 3ZMDA 4NHJA 4KIFA 4UXNA 1WHUA 2KFDA 3EUKL 1KGSA 1IN8A 4OMYA 1S72I 1Z67A 2O03A 2ID6A 3IP4B 2XUBA 2EIKH 2R0QC 4HPQA 4E7ZA 3GZ5A 1GXPA 2KT0A 5JR3A 3OOPA 4GYIA 4WWCA 5B3SH 2HQRA 4EMSA 1TC3C 1WKMA 3K1PA 3JSOA 2RNGA 5M3MJ 1XC5A 4HNUA 2F5VA 2WV0A 1MH3A 4HA8A 3H5RA 3A02A 4ZTJA 2QSHX 4Q48A 4P96A 4UUSB 1JE8A 2A07F 3EUHC 3LSJA 3TW6A 2XPUA 4LITA 1MJAA 3TQNA 3MKZA 4ZJZA 4PUSA 2VE9A 2FOKA 3HIFA 1RR8C 1S7AA 1ETQA 2IS4A 2LNBA 3REOA 2FA5A 5FROA 1LFBA 3ABLH 4Y4RA 5J4VA 3GTPJ 1I6HJ 3Q9SA 2ESHA 2L9VA 2ZSIB 1W0UA 1FSHA 1SAXA 1PP8F 2LG4A 2X9DA 4I01A 1HSTA 4XLCA 4L9JA 3J81K 4LK0F 2ZC2A 4FQGA 3O2PE 5GADJ 3GTLJ 2MBFA 2COMA 1F9NA 5LHGA 4UB6C 3QPLA 3K4MA 1ZG1A 2NAZA 3H5NA 1JT0A 2OA4A 4EM0B 1QRYA 2LKSA 2VT2A 1XMXA 2GIVA 4HX7A 5EEGA 1KU9A 1XDUA 1ZH5A 1D0XA 2EV5A 3CO6C 4O5VA 2XVCA 3OOUA 1WH7A 1K61A 4RB0A 1UHSA 1XMAA 3OV8A 1X4OA 3FXKA 4BEHB 1YW8A 2I10A 3S1MJ 3HKZA 5BPDA 4ETSA 1BC8C 1XGNA 1EH8A 4LK1F 1IUYA 3MWMA 4XLPF 5HLHA 3P7NA 2UXNA 2IVMA 3H9QA 5FLXZ 3BP8A 2KRCA 2OV7A 2XAUA 4M3GA 5IOZA 4LLLA 3KEQA 1EJ9A 2CYYA 4DW6A 5BNGA 1ZYRF 1OLTA 1K6OA 2HVQA 3ABTA 4L9TA 4NC8A 2NS8A 5FRMA 4IJAA 4BE1A 5F6FA 1LEBA 3S2DJ 1WVRA 4HF1A 1LVKA 2X4HA 5CLSA 2LTPA 3I56I 1O57A 2HEOA 3GFIA 4HX8A 2EV6A 4D7NA 5BPIA 3RYPA 1PUEE 1WJFA 1W7PD 2COBA 3JTGA 1HKSA 1WJEA 4Z6YA 2J5OA 1ZG5A 1SD5A 1MZBA 3QAHA 2XIGA 3L7WA 2DTZA 2W82A 2YU9J 5ICCA 4CHUA 3QPSA 3ZP5A 2L7ZA 2F4OB 2WAEA 5DYMA 1H89C 3HRSA 1JKQC 4HZFA 4A3KJ 4ITVA 2IRFG 1YW7A 4XM3A 3Q0VA 1SANA 1DQUA 5HVQC 1MMGA 5E3NA 4KIBA 5IYCJ 5JLWA 1OYYA 5TRDA 2EQRA 1WFXA 5TISC 5GTIC 3CCEI 5EEAA 1BI3A 2OBPA 3OYFA 2V6EA 4CCKA
chains in the Genus database with same CATH topology
2DPUA 4B09A 2E1NA 3HYIA 2ZXJA 1TQIA 3ULQB 1LNWA 3NRVA 1P4XA 3HTUA 2VOPA 4OOIA 2QBYA 3GXOA 4YIIA 1YS7A 1HW1A 1T6SA 5E20A 3HOSA 4IRIA 4IPAA 1YIOA 3C1DA 3RPQA 2KIUA 2V9VA 1HQCA 2Q0OA 5L3GA 2PEXA 5LHIA 5CVVA 2K4BA 1KQ0A 2FQ3A 4LJZF 3KZZA 3I59B 2A5YB 1EV7A 4U0YA 4I0BA 3QPTA 4BXUA 3WTWC 1KA8A 1L3LA 4FT8A 1V4RA 2EWNA 4HF2A 5L3BA 1NHAA 5LRSA 1Z1DA 1JHHA 1FP1D 4IRHA 3BZ6A 3T0YA 2EFOA 2HS5A 3ZQ7A 5BQTA 2PMUA 4ENMA 3FXUA 5DV5A 1XGSA 5DUKA 2HKOA 4U7BA 3TGNA 3VEPA 4N9IA 3R0JA 4U88A 4I98B 4LD5A 2O61A 2FEZA 3KFWX 1U3EM 2DI3A 2AXLA 3R4KA 1KU3A 3CO7C 4L9VA 2D1HA 2YX4A 3GFMA 3I0TA 1KQ9A 2JRTA 4EM1A 2OZ6A 3LFKA 1FOKA 5ERIA 4MNUA 2HOEA 5BS6A 3ZMUA 4ENJA 1ZRCA 1FBSA 1SMTA 2A3SA 2P5KA 5DD8A 4LLNA 3F8CA 3MCZA 1BIAA 5D4SA 1DDNA 2EV0A 4ESBA 1OMIA 2K7LA 2K27A 1FYLA 4K2EA 1FZPB 4GGGA 5D8LB 1I1GA 2RN7A 3TOBA 4OIPF 3E6CC 4KN7X 2O6GE 1YQAA 1SD4A 2YU3A 2QQ9A 3WTTC 4I0AA 4OINF 4GYGA 2IP2A 1ZN2A 2O8XA 3F22A 3SZTA 5TJJA 3DFGA 3RPUA 1R5HA 2P6TA 4G6DA 4WF2A 1FSEA 3EETA 3R0AA 1ZARA 3E5XA 2A69F 2DK8A 2XHKA 1J2XA 4S04A 1ULYA 1YLFA 1QZZA 1HKTA 5HDKA 2JSCA 5DCMA 3RIRA 2GA1A 2NYXA 3VODA 1YFHA 4Y13A 1O7LA 6PAXA 5LGNA 3GYHX 4EGYA 3Q5FA 1XSDA 2MA3A 3H92A 4AVPA 1QGPA 4A0ZA 1XGOA 3K1MA 4OIQF 2KJBA 3CUQC 4EGZA 4D0PA 4NQWA 5H6RA 1TQMA 3SZPA 4EV0A 3IL2A 3M8FA 1U78A 1BI2A 4R79A 5LEKA 2CO5A 3V7SA 2QBYB 4M6XA 1XCBA 2M8EA 2QENA 1QQIA 1RZ4A 4YFXF 2RKHA 4OIRF 1K78A 3GEZA 5CVRA 1U5TC 4ESJA 3J80Z 4ZZDA 2FBHA 2LSOA 2O0YA 3T5XA 3ZMVA 5DEQA 4G7OF 1ODDA 3J81Z 5JHUA 1Q1HA 4I2OA 1WWXA 3M9AA 3H3ZA 1IXSB 1LDKB 1P4WA 2GA2A 4UV8A 3FF5A 5HOOA 3KP7A 2FSWA 3HSRA 2QVOA 5CJ9A 4L0ZB 3HUGA 5K5RA 2FXAA 5D5WB 4JBAA 3HSFA 4RB2C 3BWGA 5L3CA 1O3RA 1R23A 2VE8A 1O3TA 3GUDA 3TO6A 2JT1A 2OQGA 5FD5A 3PFIA 1WRJA 4BAYA 1R00A 1BI0A 3ISPA 3EYIA 1TNSA 2ETHA 2HQNA 5AIQA 3WE2A 1F4KA 3MAJA 5LGTA 1FT9A 3ZPLA 2RQPA 4KMFA 3LSTA 4MEYF 4EJOA 1Z9CA 2JTVA 2GWRA 1G4DA 2VC0A 3ELKA 3FXRA 2LF7A 5KK1A 1O3SA 4AIKA 4L5IA 1E17A 4WXCA 1KYWA 5E8GA 2XGXA 2QZ8A 3KLOA 2RC4A 4HDUA 3TO7A 2AS5F 5L3FA 4RAYA 4BQAA 1YG2A 3T8RA 2GXBA 1W5SA 2R7DA 4LMYA 1F5TA 3BPVA 4RB1A 3AAFA 4AIJA 2H09A 1LDJA 3P9CA 4U7DA 3BROA 4PDKA 1OPCA 1FBQA 1HXDA 4M9SA 2ZO4A 5L3EA 2HGCA 4O3MA 2XAHA 2CSOA 1ON1A 1FP2A 3BJ6A 5A2QK 5EEHA 2STTA 2JZYA 2KRFA 5LBQA 5DCMB 4ZYGA 1W4MA 2Z5UA 1K7AA 2F5CA 4KN4X 3R6SA 5J6XA 4EM2A 3K0LA 5D4RA 2JPBA 3EUHA 3J80K 4IHSA 3ZMTA 4M9ZA 4A6DA 3B73A 1P6RA 4A6EA 2VC1A 1YS6A 2DLLA 1FWZA 3GF2A 3SXYA 5JI6A 3KP5A 3HRTA 3KCCA 2Z3YA 4XRFA 2HKXA 1IN5A 2A61A 3WU0A 3MZYA 3ABUA 3WTYC 2D45A 4A12A 4JK1X 4H0EA 3QP6A 2NNNA 1ZG3A 4NB5A 2VBWA 1J0RA 4KUMA 3ZN0A 2OU2A 2QQAA 1XGMA 1K78B 4WK8F 2MH9A 1T38A 2EK5A 2ZNZA 1S3JA 2F5EA 4Y17A 5E8IA 3RJPA 2E7XA 4DQ2A 5K5QA 4ENNA 1RI7A 3DV8A 1U6GA 5E1ZB 1TLHB 1UB9A 1L0OC 4CYDA 4WCGA 1JXSA 2M45A 5L3DA 4LGWA 4ZZLA 3GX4X 2PLYA 3FM5A 3QP5A 5JVTA 2QM3A 3GO5A 3WU1B 3ROUA 1TBXA 2PBIA 4LB5A 3F72A 1Z05A 2CG4A 3CLOA 5J8FA 4HQMA 1ZLKA 4EJVA 3LAPA 4HQEA 5K5OA 4KFCA 4L0YB 3ML6A 1U2WA 5ILSA 3LA3A 4R1HA 5FFXA 1J59A 2RV8A 2Q8KA 2HWVA 2IW5A 5HLIA 3FHZA 1JHFA 3FMRA 2NNYA 1QNTA 5BMZA 3VOEA 1I5ZA 3QU6A 3GVAA 2D1VA 2FMLA 4HV6A 1MJBA 4YIFA 3HTSB 2BBYA 1CF7A 3CDHA 2MLKA 1B9MA 3MQ0A 1MD0A 1T0FA 5IT9K 4Q5SF 2BE5F 1RNLA 3C7JA 3RKXA 1MDMA 2ESNA 4CDGA 3BPXA 3GFJA 3IKVA 4BHCA 1KQ8A 2E1CA 2IT0A 1V3FA 4P55A 4RGSA 5FD6A 1RUOA 3KP2A 1XD7A 1Z91A 2VN2A 3TO9A 3WGHA 3WTZA 3JTHA 1RUNA 2RGVA 4CICA 3F8FA 1J7KA 4UHTA 2HDCA 1O7FA 1J5YA 3BDDA 2DT5A 3SHFA 2Y48A 4M71A 3I4PA 4KNYA 2VBXA 1IF1A 2NRAC 3GWZA 1DPUA 4PCQA 3TKYA 1BOAA 2MC3A 1UHMA 5IT3A 1OYWA 1SFUA 2HYGD 1MJ9A 1OR7A 4EQQA 1DUXC 1TNTA 2E7WA 4M9XA 2W24A 3DXJF 3FMQA 1FPQA 4A0XA 3F21A 5FB2A 4CXFA 4HLXA 2ZMEA 3LWFA 1FY7A 2QYOA 3VFZA 3IHUA 2WC2A 2X0LA 2L4AA 1STZA 2LDUA 5JFRA 4OMZA 5ICFA 1ONVA 4ZH4F 1R36A 5ICEA 1H9TA 1B1BA 3GW2A 1D5VA 4RB3C 2KIMA 1ZREA 2IJLA 4EJUA 1AWCA 3N97A 3F23A 2HYFA 2CQKA 3T1BA 4ASNA 2W57A 1T2KA 1TW3A 2PN6A 2K86A 2R3SA 2JPCA 2H6BA 3DEUA 4AD9A 1MGTA 2EB7A 5DDGA 1S7OA 2GQQA 5HDNA 4RS8A 3V7CA 3M1EA 3JAMZ 4EJWA 2OZUA 5FFZA 4ESFA 3FM3A 3J7AO 1IRFA 4IVNA 4CZZA 3RTRA 2PG4A 1D8JA 3F6VA 3V7RA 3W6JB 1E2XA 1G3YA 3ZN1A 3HHHA 4R8HA 1SMYF 4KT5C 3P9KA 3LQQA 2Z99A 3TDUC 4HDVA 1YYVA 2P6SA 1OKRA 1G3TA 1GXQA 3S2WA 3NEUA 4IRGA 1IW7F 2FRHA 4F7ZA 2VOOA 1QZYA 3FWEA 2BYVE 2K02A 3U9GA 3IWFA 4LFUA 2G7HA 5D5XB 5HS7A 2HTJA 3CTAA 2EJRA 2KIFA 1MKMA 1VTNC 3CJNA 5A2QZ 4EJTA 3GZ6A 1W5TA 2ZNYA 3E3VA 1XDSA 4M73A 4CO8A 1CF7B 1U5TA 3DP7A 4IXAA 1CGPA 4I02A 2DBBA 1XSXA 2W85A 3R60A 3QPHA 3SFZA 4AWXB 1MDMB 3K9TA 2VBYA 3ECOA 1U8RA 4MGRA 3I64A 3GLXA 3C3WA 4A0YA 2PQ8A 2IA1A 1USTA 4UV9A 5AONA 2CGPA 3WTSC 3E5UA 5LGUA 2OAZA 1W7PA 4RGUA 2XAFA 3DQVC 2DU9A 2XRNA 2ZCWA 2XAJA 1FYMA 4FHTA 2W84A 2P7VB 5CVUA 2WWYA 2D2WA 1ZGAA 1K79A 3HRMA 1B9NA 2OQRA 3PQJA 3QU3A 1PDNC 1IN4A 2QQBA 4G94A 2CFXA 2VT3A 1IN7A 3VB2A 4UVCA 2OD5A 4BH9A 2ZMEB 4G7ZF 2QUFA 4ZYHA 5CVIA 2ZFWA 3JAMK 2L54A 1B4AA 1ZRFA 3Q9VA 4N0BA 1R1UA 1FNNA 1IXRC 4KDPA 2VBZA 2P8TA 4XSXF 4LG0A 3FMSA 1XCVA 3EQLF 5D6FA 1I27A 1I6XA 3DPTA 1QPMA 4L5JA 1B6AA 3K69A 5ICGA 2EFWA 1S6LA 2NS0A 4RGRA 1KU7A 4L9NA 5DD4A 3E6MA 5F64A 4YFKF 1C0WA 3NQOA 4I7HA 3F6OA 1ZGJA 2VXZA 2FMYA 1P2FA 4WX9A 3D0SA 2FNPA 4UVBA 2EA2A 3M8EA 3T8TA 3IC7A 5IT9Z 3E5QA 3FXQA 1SFEA 3U1DA 3KETA 3K2ZA 4EVIA 1PP7U 4UUVA 3TDZC 3RKWA 2M5WA 2FBKA 4KIGA 4ENKA 1R58A 3WTVC 4HLYA 4IHTA 2A6EF 5BOXA 4U0VA 1KU2A 5ILUA 1SFXA 2WTEA 4RAZA 3ERED 3KLNA 4HW0A 3H3UA 3F3XA 4ON0A 3V8JA 2L01A 3F8NA 3CUQB 1QO0D 1R1TA 3COAC 4HV5A 3HOTA 2STWA 4LB6B 1SD7A 1YW9A 2M1BA 2ACJA 3CUOA 2TDXA 3BY6A 1FX7A 3WODF 4G8XA 4U0WA 4WXDA 4A5NA 1YTYA 1T98A 2W25A 1DP7P 1D8KA 1KYZA 1U5TB 2EFNA 4Y15A 4WXHA 1XSVA 1WSUA 2PI0A 2HZTA 2EFQA 2BGCA 2ZJ2A 3RKYA 1JGSA 3IKTA 2DFIA 4HF0A 2YSRA 3DF8A 4MTEA 1R7JA 2L02A 2RNJA 2YX7A 3O3KA 5DCFA 2DK5A 4CGZA 4JQFA 4FX0A 4QWQA 2XAGA 1QBJA 5E1XA 1J9IA 3C18A 1LDDA 1W7PB 2P7CB 4M6YA 3HSEA 3RI4A 1ZRDA 5K1YA 1S29A 4E70A 4MEXF 2QWWA 3MEXA 1R5GA 4OIOF 4PGGA 4MTDA 1H9GA 3FZVA 1T39A 1TQPA 4YFNF 5LLQA 2L4MA 2HFHA 1F1ZA 3I58A 3ZMZA 5LRRA 1FC3A 3KEOA 3LAJA 3W6KB 3U2RA 3E6BA 1IRGA 1R1VA 3E97A 3N4MA 1HKQA 5ILVA 3RDIA 3ECHA 3WTXC 5HLGA 3KP3A 4S05A 1ZAOA 3V4GA 4HX4A 4LG0B 1BBYA 1G3SA 4MQVA 2ZBKA 3EDPA 1ZLJA 5AIPA 2DO7A 2L3DA 2PJPA 2PMHA 1BI1A 3I54A 1Z7UA 5FGMA 3BJAA 4Q4ZF 4UNOA 1IXCA 5H20A 4A5MA 4AIHA 2A6HF 2VONA 1TW2A 4P9FA 1S8NA 1ZHFA 3MZHA 2DTRA 3DKWA 4HBLA 2XKOA 5LEJA 2FE3A 4KYWA 1G6NA 4GXOA 1HSJA 4PGHA 2ZKZA 2YPRA 3WTUC 2DPDA 3DPLC 3IRQA 3HRUA 3V8LA 1BC7C 2GZWA 4YG2F 3G3ZA 2O3FA 5FLXK 1R22A 2ELHA 3QOPA 1IZ1A 2HR3A 2UZKA 5F1RA 2H27A 2KKOA 5E18F 4UVAA 2DQRA 3SQNA 3QRFF 2P4WA 3LA2A 2FBIA 3TOAA 2V79A 1SD6A 5HS8A 5H6QA 5J8CA 3PQKA 2Z33A 2Y75A 4MQ9F 3ZMSA 2M30A 2EA4A 3WG9A 4TV7A 2YR2A 2LKPA 1BIBA 4BNCA 2CW0F 4XLNF 1USSA 4BHPA 1FLIA 4Q47A 3I53A 4HOBA 1LVAA 2BV6A 1LEAA 4KA4A 3KE2A 3O6BB 2EFPA 1EH7A 3EYYA 4BHBA 4P9UA 2ADUA 2UXXA 2F2EA 1RIOH 2DQLA 2V1DA 2XKPA 2MLGA 3F8BA 1IAWA 1GHCA 1FYKA 3V8KA 1HW5A 4LLGF 4MHGA 3WGGA 2H94A 5E17F 4IF4A 3D5LA 4I09A 1LJ9A 3WE3A 3L00A 3R61A 5KVRA 2IPQX 2G7UA 4GCVA 2V1UA 3RYRA 5FO5A 4A2UA 1FBUA 3CUQA 3WGIA 1UFMA 2KJCA 2XAQA 3LQRA 3M7GA 2XASA 2V1XA 2ISYA 1Z6TA 3I5UA 2BEOA 2QLZA 3L9FA 1REPC 5D8KB 5CVJA 3BOQA 1XB4A 1UHWA 1B59A 2G9WA 2RDPA 2IA2A 2A68F 4N9HA 3KP4A 1G3WA 3KZYA 2UWMA 2K4JA 2MH2A 3K1NA 1Y0UA 2B0LA 2RVCA 2GAUA 1H0MA 2DW4A 4HAMA 4RGXA 1X3UA 2GXGA 1YO5C 4ZYEA 2PFBA 4Z2YA 3E6DA 3I71A 1BN5A 2F5DA 5HS9A 5D5UB 2P5LC 4BYYA 2M87A 4O6JA 1HW2A 1DPRA 4P5OA 4HYEA 1A04A 5DUIA 3IWZA 1UCRA 2C6YA 2FF4A 3LA7A 1EH6A 1OYIA 4G9YA 2HTSA 4QLCU 4ZYDA 3IRRA 2R7FA 2ISZA 1TTYA 5CYVA 4OU0A 1AOYA 1ON2A 5D5VB 3B02A 2J5PA 2XV4S 1LQ1A 1WI9A 1BM9A 2MD5A 2H6CA 3FX3A 2Y0MA 3JW4A 1O3QA 2VODA 5LHHA 3L09A 2F5FA 2XROA 2FU4A 2IA0A 4DNCA 3HHGA 4GO1A 1P4AA 3JSPA 1XN7A 2V6CA 4L18B 3F8MA 1I1SA 2LF8A 4FX4A 3GFLA 2DAOA 3I59A 1D3YA 3MFKA 1XMKA 4M72A 3P9IA 3BJOA 4KICA 1GVJA 4XSZF 3L2CA 3KP6A 2CWEA 2P5VA 4XBFA 4M74A 3G73A 1J75A 1BJAA 5ED4A 4G7HF 4KMUX 2Z9OA 1P92A 4G6QA 4PZJA 5D6EA 1HBXG 1IN6A 2FNAA 5E1WA 1WQ2A 1Z6RA 5HDGA 4B8XA 1LB2A 2Q2EA 3ZMDA 4NHJA 4KIFA 4UXNA 1KGSA 1IN8A 4OMYA 2O03A 2XUBA 3GZ5A 1GXPA 5JR3A 3OOPA 4GYIA 4WWCA 2HQRA 4EMSA 1WKMA 3K1PA 3JSOA 2WV0A 4HA8A 4Q48A 4P96A 1JE8A 2A07F 1MJAA 3TQNA 2VE9A 2FOKA 3HIFA 1S7AA 2LNBA 3REOA 2FA5A 3Q9SA 2ESHA 1FSHA 1SAXA 1PP8F 4I01A 1HSTA 4L9JA 3J81K 4LK0F 3O2PE 2MBFA 2COMA 1F9NA 5LHGA 1ZG1A 2NAZA 2OA4A 4EM0B 2VT2A 2GIVA 4HX7A 5EEGA 1KU9A 1XDUA 1ZH5A 2EV5A 3CO6C 4O5VA 2XVCA 4RB0A 1XMAA 3OV8A 1YW8A 5BPDA 4ETSA 1BC8C 1XGNA 1EH8A 4LK1F 1IUYA 3MWMA 4XLPF 5HLHA 3P7NA 2UXNA 2IVMA 5FLXZ 3BP8A 4LLLA 3KEQA 2CYYA 1ZYRF 1K6OA 3ABTA 4L9TA 4IJAA 5F6FA 1LEBA 4HF1A 2X4HA 5CLSA 1O57A 2HEOA 3GFIA 4HX8A 2EV6A 5BPIA 3RYPA 1PUEE 1W7PD 3JTGA 1HKSA 2J5OA 1ZG5A 1SD5A 1MZBA 3QAHA 2XIGA 3L7WA 5ICCA 4CHUA 3ZP5A 5DYMA 3HRSA 4HZFA 2IRFG 1YW7A 5HVQC 4KIBA 1OYYA 5TRDA 1BI3A 2OBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPU A;  4B09 A;  2E1N A;  3HYI A;  2ZXJ A;  1TQI A;  3ULQ B;  1LNW A;  3NRV A;  1P4X A;  3HTU A;  2VOP A;  4OOI A;  2QBY A;  3GXO A;  4YII A;  1YS7 A;  1HW1 A;  1T6S A;  5E20 A;  3HOS A;  4IRI A;  4IPA A;  1YIO A;  3C1D A;  3RPQ A;  2KIU A;  2V9V A;  1HQC A;  2Q0O A;  5L3G A;  2PEX A;  5LHI A;  5CVV A;  2K4B A;  1KQ0 A;  2FQ3 A;  4LJZ F;  3KZZ A;  3I59 B;  2A5Y B;  1EV7 A;  4U0Y A;  4I0B A;  3QPT A;  4BXU A;  3WTW C;  1KA8 A;  1L3L A;  4FT8 A;  1V4R A;  2EWN A;  4HF2 A;  5L3B A;  1NHA A;  5LRS A;  1Z1D A;  1JHH A;  1FP1 D;  4IRH A;  3BZ6 A;  3T0Y A;  2EFO A;  2HS5 A;  3ZQ7 A;  5BQT A;  2PMU A;  4ENM A;  3FXU A;  5DV5 A;  1XGS A;  5DUK A;  2HKO A;  4U7B A;  3TGN A;  3VEP A;  4N9I A;  3R0J A;  4U88 A;  4I98 B;  4LD5 A;  2O61 A;  2FEZ A;  3KFW X;  1U3E M;  2DI3 A;  2AXL A;  3R4K A;  1KU3 A;  3CO7 C;  4L9V A;  2D1H A;  2YX4 A;  3GFM A;  3I0T A;  1KQ9 A;  2JRT A;  4EM1 A;  2OZ6 A;  3LFK A;  1FOK A;  5ERI A;  4MNU A;  2HOE A;  5BS6 A;  3ZMU A;  4ENJ A;  1ZRC A;  1FBS A;  1SMT A;  2A3S A;  2P5K A;  5DD8 A;  4LLN A;  3F8C A;  3MCZ A;  1BIA A;  5D4S A;  1DDN A;  2EV0 A;  4ESB A;  1OMI A;  2K7L A;  2K27 A;  1FYL A;  4K2E A;  1FZP B;  4GGG A;  5D8L B;  1I1G A;  2RN7 A;  3TOB A;  4OIP F;  3E6C C;  4KN7 X;  2O6G E;  1YQA A;  1SD4 A;  2YU3 A;  2QQ9 A;  3WTT C;  4I0A A;  4OIN F;  4GYG A;  2IP2 A;  1ZN2 A;  2O8X A;  3F22 A;  3SZT A;  5TJJ A;  3DFG A;  3RPU A;  1R5H A;  2P6T A;  4G6D A;  4WF2 A;  1FSE A;  3EET A;  3R0A A;  1ZAR A;  3E5X A;  2A69 F;  2DK8 A;  2XHK A;  1J2X A;  4S04 A;  1ULY A;  1YLF A;  1QZZ A;  1HKT A;  5HDK A;  2JSC A;  5DCM A;  3RIR A;  2GA1 A;  2NYX A;  3VOD A;  1YFH A;  4Y13 A;  1O7L A;  6PAX A;  5LGN A;  3GYH X;  4EGY A;  3Q5F A;  1XSD A;  2MA3 A;  3H92 A;  4AVP A;  1QGP A;  4A0Z A;  1XGO A;  3K1M A;  4OIQ F;  2KJB A;  3CUQ C;  4EGZ A;  4D0P A;  4NQW A;  5H6R A;  1TQM A;  3SZP A;  4EV0 A;  3IL2 A;  3M8F A;  1U78 A;  1BI2 A;  4R79 A;  5LEK A;  2CO5 A;  3V7S A;  2QBY B;  4M6X A;  1XCB A;  2M8E A;  2QEN A;  1QQI A;  1RZ4 A;  4YFX F;  2RKH A;  4OIR F;  1K78 A;  3GEZ A;  5CVR A;  1U5T C;  4ESJ A;  3J80 Z;  4ZZD A;  2FBH A;  2LSO A;  2O0Y A;  3T5X A;  3ZMV A;  5DEQ A;  4G7O F;  1ODD A;  3J81 Z;  5JHU A;  1Q1H A;  4I2O A;  1WWX A;  3M9A A;  3H3Z A;  1IXS B;  1LDK B;  1P4W A;  2GA2 A;  4UV8 A;  3FF5 A;  5HOO A;  3KP7 A;  2FSW A;  3HSR A;  2QVO A;  5CJ9 A;  4L0Z B;  3HUG A;  5K5R A;  2FXA A;  5D5W B;  4JBA A;  3HSF A;  4RB2 C;  3BWG A;  5L3C A;  1O3R A;  1R23 A;  2VE8 A;  1O3T A;  3GUD A;  3TO6 A;  2JT1 A;  2OQG A;  5FD5 A;  3PFI A;  1WRJ A;  4BAY A;  1R00 A;  1BI0 A;  3ISP A;  3EYI A;  1TNS A;  2ETH A;  2HQN A;  5AIQ A;  3WE2 A;  1F4K A;  3MAJ A;  5LGT A;  1FT9 A;  3ZPL A;  2RQP A;  4KMF A;  3LST A;  4MEY F;  4EJO A;  1Z9C A;  2JTV A;  2GWR A;  1G4D A;  2VC0 A;  3ELK A;  3FXR A;  2LF7 A;  5KK1 A;  1O3S A;  4AIK A;  4L5I A;  1E17 A;  4WXC A;  1KYW A;  5E8G A;  2XGX A;  2QZ8 A;  3KLO A;  2RC4 A;  4HDU A;  3TO7 A;  2AS5 F;  5L3F A;  4RAY A;  4BQA A;  1YG2 A;  3T8R A;  2GXB A;  1W5S A;  2R7D A;  4LMY A;  1F5T A;  3BPV A;  4RB1 A;  3AAF A;  4AIJ A;  2H09 A;  1LDJ A;  3P9C A;  4U7D A;  3BRO A;  4PDK A;  1OPC A;  1FBQ A;  1HXD A;  4M9S A;  2ZO4 A;  5L3E A;  2HGC A;  4O3M A;  2XAH A;  2CSO A;  1ON1 A;  1FP2 A;  3BJ6 A;  5A2Q K;  5EEH A;  2STT A;  2JZY A;  2KRF A;  5LBQ A;  5DCM B;  4ZYG A;  1W4M A;  2Z5U A;  1K7A A;  2F5C A;  4KN4 X;  3R6S A;  5J6X A;  4EM2 A;  3K0L A;  5D4R A;  2JPB A;  3EUH A;  3J80 K;  4IHS A;  3ZMT A;  4M9Z A;  4A6D A;  3B73 A;  1P6R A;  4A6E A;  2VC1 A;  1YS6 A;  2DLL A;  1FWZ A;  3GF2 A;  3SXY A;  5JI6 A;  3KP5 A;  3HRT A;  3KCC A;  2Z3Y A;  4XRF A;  2HKX A;  1IN5 A;  2A61 A;  3WU0 A;  3MZY A;  3ABU A;  3WTY C;  2D45 A;  4A12 A;  4JK1 X;  4H0E A;  3QP6 A;  2NNN A;  1ZG3 A;  4NB5 A;  2VBW A;  1J0R A;  4KUM A;  3ZN0 A;  2OU2 A;  2QQA A;  1XGM A;  1K78 B;  4WK8 F;  2MH9 A;  1T38 A;  2EK5 A;  2ZNZ A;  1S3J A;  2F5E A;  4Y17 A;  5E8I A;  3RJP A;  2E7X A;  4DQ2 A;  5K5Q A;  4ENN A;  1RI7 A;  3DV8 A;  1U6G A;  5E1Z B;  1TLH B;  1UB9 A;  1L0O C;  4CYD A;  4WCG A;  1JXS A;  2M45 A;  5L3D A;  4LGW A;  4ZZL A;  3GX4 X;  2PLY A;  3FM5 A;  3QP5 A;  5JVT A;  2QM3 A;  3GO5 A;  3WU1 B;  3ROU A;  1TBX A;  2PBI A;  4LB5 A;  3F72 A;  1Z05 A;  2CG4 A;  3CLO A;  5J8F A;  4HQM A;  1ZLK A;  4EJV A;  3LAP A;  4HQE A;  5K5O A;  4KFC A;  4L0Y B;  3ML6 A;  1U2W A;  5ILS A;  3LA3 A;  4R1H A;  5FFX A;  1J59 A;  2RV8 A;  2Q8K A;  2HWV A;  2IW5 A;  5HLI A;  3FHZ A;  1JHF A;  3FMR A;  2NNY A;  1QNT A;  5BMZ A;  3VOE A;  1I5Z A;  3QU6 A;  3GVA A;  2D1V A;  2FML A;  4HV6 A;  1MJB A;  4YIF A;  3HTS B;  2BBY A;  1CF7 A;  3CDH A;  2MLK A;  1B9M A;  3MQ0 A;  1MD0 A;  1T0F A;  5IT9 K;  4Q5S F;  2BE5 F;  1RNL A;  3C7J A;  3RKX A;  1MDM A;  2ESN A;  4CDG A;  3BPX A;  3GFJ A;  3IKV A;  4BHC A;  1KQ8 A;  2E1C A;  2IT0 A;  1V3F A;  4P55 A;  4RGS A;  5FD6 A;  1RUO A;  3KP2 A;  1XD7 A;  1Z91 A;  2VN2 A;  3TO9 A;  3WGH A;  3WTZ A;  3JTH A;  1RUN A;  2RGV A;  4CIC A;  3F8F A;  1J7K A;  4UHT A;  2HDC A;  1O7F A;  1J5Y A;  3BDD A;  2DT5 A;  3SHF A;  2Y48 A;  4M71 A;  3I4P A;  4KNY A;  2VBX A;  1IF1 A;  2NRA C;  3GWZ A;  1DPU A;  4PCQ A;  3TKY A;  1BOA A;  2MC3 A;  1UHM A;  5IT3 A;  1OYW A;  1SFU A;  2HYG D;  1MJ9 A;  1OR7 A;  4EQQ A;  1DUX C;  1TNT A;  2E7W A;  4M9X A;  2W24 A;  3DXJ F;  3FMQ A;  1FPQ A;  4A0X A;  3F21 A;  5FB2 A;  4CXF A;  4HLX A;  2ZME A;  3LWF A;  1FY7 A;  2QYO A;  3VFZ A;  3IHU A;  2WC2 A;  2X0L A;  2L4A A;  1STZ A;  2LDU A;  5JFR A;  4OMZ A;  5ICF A;  1ONV A;  4ZH4 F;  1R36 A;  5ICE A;  1H9T A;  1B1B A;  3GW2 A;  1D5V A;  4RB3 C;  2KIM A;  1ZRE A;  2IJL A;  4EJU A;  1AWC A;  3N97 A;  3F23 A;  2HYF A;  2CQK A;  3T1B A;  4ASN A;  2W57 A;  1T2K A;  1TW3 A;  2PN6 A;  2K86 A;  2R3S A;  2JPC A;  2H6B A;  3DEU A;  4AD9 A;  1MGT A;  2EB7 A;  5DDG A;  1S7O A;  2GQQ A;  5HDN A;  4RS8 A;  3V7C A;  3M1E A;  3JAM Z;  4EJW A;  2OZU A;  5FFZ A;  4ESF A;  3FM3 A;  3J7A O;  1IRF A;  4IVN A;  4CZZ A;  3RTR A;  2PG4 A;  1D8J A;  3F6V A;  3V7R A;  3W6J B;  1E2X A;  1G3Y A;  3ZN1 A;  3HHH A;  4R8H A;  1SMY F;  4KT5 C;  3P9K A;  3LQQ A;  2Z99 A;  3TDU C;  4HDV A;  1YYV A;  2P6S A;  1OKR A;  1G3T A;  1GXQ A;  3S2W A;  3NEU A;  4IRG A;  1IW7 F;  2FRH A;  4F7Z A;  2VOO A;  1QZY A;  3FWE A;  2BYV E;  2K02 A;  3U9G A;  3IWF A;  4LFU A;  2G7H A;  5D5X B;  5HS7 A;  2HTJ A;  3CTA A;  2EJR A;  2KIF A;  1MKM A;  1VTN C;  3CJN A;  5A2Q Z;  4EJT A;  3GZ6 A;  1W5T A;  2ZNY A;  3E3V A;  1XDS A;  4M73 A;  4CO8 A;  1CF7 B;  1U5T A;  3DP7 A;  4IXA A;  1CGP A;  4I02 A;  2DBB A;  1XSX A;  2W85 A;  3R60 A;  3QPH A;  3SFZ A;  4AWX B;  1MDM B;  3K9T A;  2VBY A;  3ECO A;  1U8R A;  4MGR A;  3I64 A;  3GLX A;  3C3W A;  4A0Y A;  2PQ8 A;  2IA1 A;  1UST A;  4UV9 A;  5AON A;  2CGP A;  3WTS C;  3E5U A;  5LGU A;  2OAZ A;  1W7P A;  4RGU A;  2XAF A;  3DQV C;  2DU9 A;  2XRN A;  2ZCW A;  2XAJ A;  1FYM A;  4FHT A;  2W84 A;  2P7V B;  5CVU A;  2WWY A;  2D2W A;  1ZGA A;  1K79 A;  3HRM A;  1B9N A;  2OQR A;  3PQJ A;  3QU3 A;  1PDN C;  1IN4 A;  2QQB A;  4G94 A;  2CFX A;  2VT3 A;  1IN7 A;  3VB2 A;  4UVC A;  2OD5 A;  4BH9 A;  2ZME B;  4G7Z F;  2QUF A;  4ZYH A;  5CVI A;  2ZFW A;  3JAM K;  2L54 A;  1B4A A;  1ZRF A;  3Q9V A;  4N0B A;  1R1U A;  1FNN A;  1IXR C;  4KDP A;  2VBZ A;  2P8T A;  4XSX F;  4LG0 A;  3FMS A;  1XCV A;  3EQL F;  5D6F A;  1I27 A;  1I6X A;  3DPT A;  1QPM A;  4L5J A;  1B6A A;  3K69 A;  5ICG A;  2EFW A;  1S6L A;  2NS0 A;  4RGR A;  1KU7 A;  4L9N A;  5DD4 A;  3E6M A;  5F64 A;  4YFK F;  1C0W A;  3NQO A;  4I7H A;  3F6O A;  1ZGJ A;  2VXZ A;  2FMY A;  1P2F A;  4WX9 A;  3D0S A;  2FNP A;  4UVB A;  2EA2 A;  3M8E A;  3T8T A;  3IC7 A;  5IT9 Z;  3E5Q A;  3FXQ A;  1SFE A;  3U1D A;  3KET A;  3K2Z A;  4EVI A;  1PP7 U;  4UUV A;  3TDZ C;  3RKW A;  2M5W A;  2FBK A;  4KIG A;  4ENK A;  1R58 A;  3WTV C;  4HLY A;  4IHT A;  2A6E F;  5BOX A;  4U0V A;  1KU2 A;  5ILU A;  1SFX A;  2WTE A;  4RAZ A;  3ERE D;  3KLN A;  4HW0 A;  3H3U A;  3F3X A;  4ON0 A;  3V8J A;  2L01 A;  3F8N A;  3CUQ B;  1QO0 D;  1R1T A;  3COA C;  4HV5 A;  3HOT A;  2STW A;  4LB6 B;  1SD7 A;  1YW9 A;  2M1B A;  2ACJ A;  3CUO A;  2TDX A;  3BY6 A;  1FX7 A;  3WOD F;  4G8X A;  4U0W A;  4WXD A;  4A5N A;  1YTY A;  1T98 A;  2W25 A;  1DP7 P;  1D8K A;  1KYZ A;  1U5T B;  2EFN A;  4Y15 A;  4WXH A;  1XSV A;  1WSU A;  2PI0 A;  2HZT A;  2EFQ A;  2BGC A;  2ZJ2 A;  3RKY A;  1JGS A;  3IKT A;  2DFI A;  4HF0 A;  2YSR A;  3DF8 A;  4MTE A;  1R7J A;  2L02 A;  2RNJ A;  2YX7 A;  3O3K A;  5DCF A;  2DK5 A;  4CGZ A;  4JQF A;  4FX0 A;  4QWQ A;  2XAG A;  1QBJ A;  5E1X A;  1J9I A;  3C18 A;  1LDD A;  1W7P B;  2P7C B;  4M6Y A;  3HSE A;  3RI4 A;  1ZRD A;  5K1Y A;  1S29 A;  4E70 A;  4MEX F;  2QWW A;  3MEX A;  1R5G A;  4OIO F;  4PGG A;  4MTD A;  1H9G A;  3FZV A;  1T39 A;  1TQP A;  4YFN F;  5LLQ A;  2L4M A;  2HFH A;  1F1Z A;  3I58 A;  3ZMZ A;  5LRR A;  1FC3 A;  3KEO A;  3LAJ A;  3W6K B;  3U2R A;  3E6B A;  1IRG A;  1R1V A;  3E97 A;  3N4M A;  1HKQ A;  5ILV A;  3RDI A;  3ECH A;  3WTX C;  5HLG A;  3KP3 A;  4S05 A;  1ZAO A;  3V4G A;  4HX4 A;  4LG0 B;  1BBY A;  1G3S A;  4MQV A;  2ZBK A;  3EDP A;  1ZLJ A;  5AIP A;  2DO7 A;  2L3D A;  2PJP A;  2PMH A;  1BI1 A;  3I54 A;  1Z7U A;  5FGM A;  3BJA A;  4Q4Z F;  4UNO A;  1IXC A;  5H20 A;  4A5M A;  4AIH A;  2A6H F;  2VON A;  1TW2 A;  4P9F A;  1S8N A;  1ZHF A;  3MZH A;  2DTR A;  3DKW A;  4HBL A;  2XKO A;  5LEJ A;  2FE3 A;  4KYW A;  1G6N A;  4GXO A;  1HSJ A;  4PGH A;  2ZKZ A;  2YPR A;  3WTU C;  2DPD A;  3DPL C;  3IRQ A;  3HRU A;  3V8L A;  1BC7 C;  2GZW A;  4YG2 F;  3G3Z A;  2O3F A;  5FLX K;  1R22 A;  2ELH A;  3QOP A;  1IZ1 A;  2HR3 A;  2UZK A;  5F1R A;  2H27 A;  2KKO A;  5E18 F;  4UVA A;  2DQR A;  3SQN A;  3QRF F;  2P4W A;  3LA2 A;  2FBI A;  3TOA A;  2V79 A;  1SD6 A;  5HS8 A;  5H6Q A;  5J8C A;  3PQK A;  2Z33 A;  2Y75 A;  4MQ9 F;  3ZMS A;  2M30 A;  2EA4 A;  3WG9 A;  4TV7 A;  2YR2 A;  2LKP A;  1BIB A;  4BNC A;  2CW0 F;  4XLN F;  1USS A;  4BHP A;  1FLI A;  4Q47 A;  3I53 A;  4HOB A;  1LVA A;  2BV6 A;  1LEA A;  4KA4 A;  3KE2 A;  3O6B B;  2EFP A;  1EH7 A;  3EYY A;  4BHB A;  4P9U A;  2ADU A;  2UXX A;  2F2E A;  1RIO H;  2DQL A;  2V1D A;  2XKP A;  2MLG A;  3F8B A;  1IAW A;  1GHC A;  1FYK A;  3V8K A;  1HW5 A;  4LLG F;  4MHG A;  3WGG A;  2H94 A;  5E17 F;  4IF4 A;  3D5L A;  4I09 A;  1LJ9 A;  3WE3 A;  3L00 A;  3R61 A;  5KVR A;  2IPQ X;  2G7U A;  4GCV A;  2V1U A;  3RYR A;  5FO5 A;  4A2U A;  1FBU A;  3CUQ A;  3WGI A;  1UFM A;  2KJC A;  2XAQ A;  3LQR A;  3M7G A;  2XAS A;  2V1X A;  2ISY A;  1Z6T A;  3I5U A;  2BEO A;  2QLZ A;  3L9F A;  1REP C;  5D8K B;  5CVJ A;  3BOQ A;  1XB4 A;  1UHW A;  1B59 A;  2G9W A;  2RDP A;  2IA2 A;  2A68 F;  4N9H A;  3KP4 A;  1G3W A;  3KZY A;  2UWM A;  2K4J A;  2MH2 A;  3K1N A;  1Y0U A;  2B0L A;  2RVC A;  2GAU A;  1H0M A;  2DW4 A;  4HAM A;  4RGX A;  1X3U A;  2GXG A;  1YO5 C;  4ZYE A;  2PFB A;  4Z2Y A;  3E6D A;  3I71 A;  1BN5 A;  2F5D A;  5HS9 A;  5D5U B;  2P5L C;  4BYY A;  2M87 A;  4O6J A;  1HW2 A;  1DPR A;  4P5O A;  4HYE A;  1A04 A;  5DUI A;  3IWZ A;  1UCR A;  2C6Y A;  2FF4 A;  3LA7 A;  1EH6 A;  1OYI A;  4G9Y A;  2HTS A;  4QLC U;  4ZYD A;  3IRR A;  2R7F A;  2ISZ A;  1TTY A;  5CYV A;  4OU0 A;  1AOY A;  1ON2 A;  5D5V B;  3B02 A;  2J5P A;  2XV4 S;  1LQ1 A;  1WI9 A;  1BM9 A;  2MD5 A;  2H6C A;  3FX3 A;  2Y0M A;  3JW4 A;  1O3Q A;  2VOD A;  5LHH A;  3L09 A;  2F5F A;  2XRO A;  2FU4 A;  2IA0 A;  4DNC A;  3HHG A;  4GO1 A;  1P4A A;  3JSP A;  1XN7 A;  2V6C A;  4L18 B;  3F8M A;  1I1S A;  2LF8 A;  4FX4 A;  3GFL A;  2DAO A;  3I59 A;  1D3Y A;  3MFK A;  1XMK A;  4M72 A;  3P9I A;  3BJO A;  4KIC A;  1GVJ A;  4XSZ F;  3L2C A;  3KP6 A;  2CWE A;  2P5V A;  4XBF A;  4M74 A;  3G73 A;  1J75 A;  1BJA A;  5ED4 A;  4G7H F;  4KMU X;  2Z9O A;  1P92 A;  4G6Q A;  4PZJ A;  5D6E A;  1HBX G;  1IN6 A;  2FNA A;  5E1W A;  1WQ2 A;  1Z6R A;  5HDG A;  4B8X A;  1LB2 A;  2Q2E A;  3ZMD A;  4NHJ A;  4KIF A;  4UXN A;  1KGS A;  1IN8 A;  4OMY A;  2O03 A;  2XUB A;  3GZ5 A;  1GXP A;  5JR3 A;  3OOP A;  4GYI A;  4WWC A;  2HQR A;  4EMS A;  1WKM A;  3K1P A;  3JSO A;  2WV0 A;  4HA8 A;  4Q48 A;  4P96 A;  1JE8 A;  2A07 F;  1MJA A;  3TQN A;  2VE9 A;  2FOK A;  3HIF A;  1S7A A;  2LNB A;  3REO A;  2FA5 A;  3Q9S A;  2ESH A;  1FSH A;  1SAX A;  1PP8 F;  4I01 A;  1HST A;  4L9J A;  3J81 K;  4LK0 F;  3O2P E;  2MBF A;  2COM A;  1F9N A;  5LHG A;  1ZG1 A;  2NAZ A;  2OA4 A;  4EM0 B;  2VT2 A;  2GIV A;  4HX7 A;  5EEG A;  1KU9 A;  1XDU A;  1ZH5 A;  2EV5 A;  3CO6 C;  4O5V A;  2XVC A;  4RB0 A;  1XMA A;  3OV8 A;  1YW8 A;  5BPD A;  4ETS A;  1BC8 C;  1XGN A;  1EH8 A;  4LK1 F;  1IUY A;  3MWM A;  4XLP F;  5HLH A;  3P7N A;  2UXN A;  2IVM A;  5FLX Z;  3BP8 A;  4LLL A;  3KEQ A;  2CYY A;  1ZYR F;  1K6O A;  3ABT A;  4L9T A;  4IJA A;  5F6F A;  1LEB A;  4HF1 A;  2X4H A;  5CLS A;  1O57 A;  2HEO A;  3GFI A;  4HX8 A;  2EV6 A;  5BPI A;  3RYP A;  1PUE E;  1W7P D;  3JTG A;  1HKS A;  2J5O A;  1ZG5 A;  1SD5 A;  1MZB A;  3QAH A;  2XIG A;  3L7W A;  5ICC A;  4CHU A;  3ZP5 A;  5DYM A;  3HRS A;  4HZF A;  2IRF G;  1YW7 A;  5HVQ C;  4KIB A;  1OYY A;  5TRD A;  1BI3 A;  2OBP A; 
#chains in the Genus database with same CATH topology
 1A31 A;  2B9S A;  2DPU A;  3E0J B;  3UR3 C;  4B09 A;  2E1N A;  4CSW A;  3HYI A;  2ZXJ A;  1TQI A;  3HJE A;  3ULQ B;  3DWL E;  1Z21 A;  1LNW A;  5EGO A;  3HM5 A;  1RKT A;  3NRV A;  1P4X A;  1X58 A;  3HTU A;  4II2 A;  2VOP A;  2K9L A;  4OOI A;  2WY8 Q;  2E2J J;  5IYD J;  2DJN A;  1LPQ A;  1I50 J;  2QBY A;  3GXO A;  4YII A;  1YRN B;  1YS7 A;  2W1O A;  1HW1 A;  5GP9 A;  1T6S A;  5J40 A;  5E20 A;  4F93 B;  3HOS A;  1FOW A;  1X19 A;  5CQE A;  3GTG J;  4IRI A;  4IPA A;  1YIO A;  3OYD A;  2EIJ H;  3C1D A;  4ZYA A;  2VJ4 A;  3RPQ A;  2KIU A;  2V9V A;  1HQC A;  1PVE A;  2Q0O A;  3I9V 2;  5L3G A;  5J1Y A;  2O9L A;  3E7L A;  4XLE A;  2PEX A;  5LHI A;  1E3P A;  5CVV A;  2K4B A;  2HPI A;  3TW7 A;  3MKW B;  2WBM A;  1KQ0 A;  4D7M A;  2FQ3 A;  1MBJ A;  3FDY A;  3PUF A;  4LJZ F;  3CCJ I;  3HOX J;  1I3A A;  4MFD A;  3KZZ A;  3I59 B;  1IDY A;  2A5Y B;  2VXD A;  1EV7 A;  1X1A A;  5FLV A;  4U0Y A;  3CLQ A;  2KPM A;  3DTI A;  3ZCO A;  4I0B A;  3QPT A;  3OYI A;  1VQ4 I;  4BXU A;  3WTW C;  4DOZ A;  3FXJ A;  4BBR J;  1KA8 A;  1OFC X;  2HNH A;  5M5Y J;  3PSI A;  1L3L A;  4FT8 A;  5TGT A;  1YIT I;  2H1K A;  1T95 A;  1V4R A;  2EWN A;  4A3E J;  2M7A A;  5L3B A;  2DYS H;  2M34 A;  1XPX A;  1NHA A;  5LRS A;  1Z1D A;  4HF2 A;  1IRZ A;  1WJ5 A;  1JHH A;  1K83 J;  3M4O J;  2BY0 A;  1FP1 D;  2CUJ A;  4IRH A;  4XKC A;  1G59 A;  1YI2 I;  2K3P A;  1IDZ A;  1LE8 A;  3BZ6 A;  3T0Y A;  2EFO A;  2HS5 A;  3ZQ7 A;  3UNG C;  5BQT A;  1NG7 A;  2GM4 A;  1X1P A;  2PMU A;  2HOA A;  4XOT A;  4U87 A;  4ENM A;  3FXU A;  2LYC A;  1J09 A;  5DV5 A;  1A36 A;  2E1M B;  1XGS A;  5M5W J;  3AFH A;  2HKO A;  2PMZ A;  5DUK A;  4U7B A;  3TGN A;  3AG2 H;  1IJW C;  4AID A;  3VEP A;  4N9I A;  3MVP A;  3A0H C;  3HEF A;  3B6A A;  3R0J A;  3OS1 A;  4EEF G;  2ZXI A;  2Q2E B;  4U88 A;  2BY1 A;  5CPR B;  4I98 B;  4DYR A;  1D1A A;  4LD5 A;  3W2A A;  2FEZ A;  2O61 A;  3KFW X;  1OQY A;  1FTZ A;  1U3E M;  2DI3 A;  3S1N J;  2AXL A;  2O7O A;  3R4K A;  1KU3 A;  2VKH A;  4JX4 A;  3CO7 C;  2DA1 A;  4L9V A;  2JA6 J;  2D1H A;  2YX4 A;  3GFM A;  3I0T A;  4XL9 A;  1KQ9 A;  4XN3 A;  2JRT A;  4KIT B;  4EM1 A;  2ZME C;  2OZ6 A;  3LFK A;  1RES A;  1FOK A;  5ERI A;  4UB8 C;  3A03 A;  4MNU A;  2HOE A;  5BS6 A;  3ZMU A;  2R7Q A;  5EZG A;  4ENJ A;  3HPH A;  1ZRC A;  1FBS A;  4M3F A;  1SMT A;  2A3S A;  1VQO I;  3ZQF A;  2P5K A;  1X4P A;  1AU7 A;  2QKL B;  5DD8 A;  1OCP A;  2DT7 B;  1MBK A;  3KZI C;  4LLN A;  2JUC A;  2TCT A;  4PJL A;  2FD5 A;  3F8C A;  3MCZ A;  1BIA A;  1V5F A;  5E3O A;  3BG9 A;  5D4S A;  4C3J J;  3TED A;  3S16 J;  1DDN A;  2EV0 A;  4ESB A;  1OMI A;  3LSG A;  2K7L A;  4PSW A;  2K27 A;  3HGG A;  1FYL A;  4K2E A;  1FZP B;  4GGG A;  5FKL A;  1BR1 A;  5D8L B;  5CQG A;  3BCA A;  1I1G A;  3LL7 A;  3JRI A;  2RN7 A;  3TOB A;  4OIP F;  2CRG A;  3E6C C;  3GLL A;  4KN7 X;  2O6G E;  2IGM A;  1YQA A;  2KP6 A;  3BR1 A;  1WPK A;  3PUB A;  4A3J J;  1APL C;  2IS2 A;  3PFY A;  1SD4 A;  1N78 A;  1T8I A;  1P7I A;  2E36 A;  2YU3 A;  3HKZ N;  2K3F A;  2QQ9 A;  3WTT C;  4I0A A;  3PNV A;  4OIN F;  3JRG A;  1X1C A;  2KDZ A;  1ZR2 A;  2LD5 A;  4GYG A;  2EBI A;  3CME I;  2JWT A;  4PJJ A;  3DBR B;  2IP2 A;  1ZN2 A;  2X6W A;  2O8X A;  3F22 A;  3SZT A;  2FQ4 A;  5TJJ A;  3DFG A;  5GAH J;  3RPU A;  4F92 B;  2IS6 A;  1R5H A;  2IXS A;  2P6T A;  3LFU A;  4G6D A;  4WF2 A;  1FSE A;  3EET A;  3FXM A;  3R0A A;  4XKW A;  1ZAR A;  3E5X A;  5DM7 F;  1UAA A;  1RR7 A;  2ZJP F;  2Y0S A;  2A69 F;  2DK8 A;  3M3Y J;  2OCC H;  2ME6 A;  2BHY A;  1ACI A;  2XSJ C;  2F4M B;  2XHK A;  3OS2 A;  1YX5 A;  1J2X A;  3BR5 A;  4S04 A;  1ULY A;  1YLF A;  1QZZ A;  3GME A;  4QSH A;  1HKT A;  5HDK A;  2JSC A;  2VI6 A;  5DCM A;  1E3H A;  2QSG X;  3ESW B;  3RIR A;  2GA1 A;  2NYX A;  3VOD A;  1YFH A;  4NUB A;  4CCO A;  4Y13 A;  2LP0 A;  1O7L A;  6PAX A;  5LGN A;  5GPC A;  4PK4 A;  3GYH X;  1ZR4 A;  4EGY A;  3Q5F A;  2R93 J;  1UZC A;  5FKN A;  5C4X J;  1MBH A;  2JRM A;  1OIS A;  1SVL A;  1XSD A;  2MA3 A;  3H92 A;  4AVP A;  1QGP A;  1BL0 A;  4A0Z A;  1XGO A;  3ZQL A;  4BQQ A;  3K1M A;  3OS0 A;  4BE0 A;  2KJB A;  4OIQ F;  2BXY A;  3CUQ C;  3S15 J;  4EGZ A;  2L7F P;  1OJL A;  1DU0 A;  4D0P A;  3ZQH A;  4NQW A;  5H6R A;  1TQM A;  5JLX A;  3SZP A;  4EV0 A;  2LC2 A;  5EGO B;  3IL2 A;  3M8F A;  3FHN A;  1U78 A;  1BI2 A;  3DBH B;  4R79 A;  3M8J A;  5LEK A;  3UKG A;  2CO5 A;  3CCS I;  3V7S A;  2QBY B;  3V42 A;  3ONQ A;  4M6X A;  3ZQQ A;  1POG A;  1XCB A;  2MGQ A;  3LSH A;  2M8E A;  1UG2 A;  2QEN A;  1QQI A;  1RZ4 A;  4YFX F;  3RCO A;  2RKH A;  3HZJ A;  3S17 J;  2A05 A;  4OIR F;  1K78 A;  4RAF A;  3GEZ A;  3K7A J;  1BR2 A;  5CVR A;  3I4N J;  1U5T C;  2JQ7 A;  2MC4 A;  5KCM A;  5IP7 J;  1R49 A;  4ESJ A;  3J80 Z;  3A2K A;  4ZZD A;  3BR3 A;  2FBH A;  2O5R A;  1VZ0 A;  2LSO A;  4IEJ A;  2O0Y A;  4C30 A;  3T5X A;  3ZMV A;  3VSL A;  5DEQ A;  2VPL A;  4G7O F;  2BVL A;  1D1B A;  1Z3Y A;  4JOM A;  1P7J A;  4XMY A;  1ODD A;  3J81 Z;  5GTH C;  5JHU A;  1Q1H A;  5J4Y A;  5IOY A;  5J3L A;  4A3B J;  4I2O A;  3CJQ B;  1WWX A;  3M9A A;  3H3Z A;  3QYB A;  1IXS B;  5E3M A;  1LDK B;  3FXO A;  1P4W A;  3Q3S A;  2GA2 A;  3VPR A;  3FKJ A;  1LUJ B;  4UV8 A;  2LBF A;  3FF5 A;  5HOO A;  2KRH A;  3KP7 A;  4XK4 A;  2FSW A;  2ZFU A;  1GV2 A;  3HSR A;  2QVO A;  5CJ9 A;  4NC6 A;  4L0Z B;  1LE8 B;  3HUG A;  5K5R A;  1PUF A;  2FXA A;  3CCU I;  4CCL A;  5D5W B;  2NVX J;  4JBA A;  3HSF A;  4RB2 C;  3BWG A;  5L3C A;  1MND A;  1RKW A;  1O3R A;  2KZV A;  2NXN B;  2Q1Z B;  2B7E A;  1R23 A;  2XC7 A;  2VE8 A;  1O3T A;  2M7B A;  2XSD C;  3JRE A;  1MNM C;  3GUD A;  4HG2 A;  3TO6 A;  5J1R A;  2DOF A;  2V4J C;  2JT1 A;  2OQG A;  4PJM A;  1Y8R B;  3J7A Y;  5FD5 A;  3ZR8 X;  2CV0 A;  3PFI A;  2X48 A;  3H0G J;  1R4N B;  1SEU A;  1WRJ A;  4BAY A;  2KL4 A;  1ZEL A;  2HQ5 A;  2WAF A;  3KYD B;  1R00 A;  3TP0 A;  2OJE D;  1BI0 A;  3ISP A;  2ZXW H;  2HXO A;  1TNS A;  3EYI A;  2ETH A;  2HQN A;  5AIQ A;  3CCV I;  3WE2 A;  3L2U A;  2Y2Z A;  2G0E A;  1W0T A;  1F4K A;  4LOC A;  3MAJ A;  5EG0 A;  5LGT A;  1Y56 A;  1FT9 A;  4I99 C;  3ZPL A;  2RQP A;  4KMF A;  3LST A;  4PJ0 C;  4MEY F;  2X1D A;  1MNE A;  4M3D A;  4EJO A;  1LKX A;  1Z9C A;  4XLH A;  2JTV A;  2GWR A;  4C9Y A;  5J47 A;  3QWL A;  2NOG A;  1G4D A;  2VC0 A;  2X85 A;  1BW5 A;  2VUM J;  2L2O A;  2XGE A;  3ELK A;  3FXR A;  2E2H J;  2QSF X;  2LF7 A;  2D5V A;  5KK1 A;  1XTA A;  1O3S A;  4AIK A;  4UUT A;  4BY7 J;  4L5I A;  3K4N A;  1H88 C;  1E17 A;  4WXC A;  2GLO A;  2VIX A;  2F6C A;  1KYW A;  5E8G A;  4D5C A;  2XGX A;  2QZ8 A;  5KAI C;  3KLO A;  1Z3X A;  2LOO A;  2RC4 A;  4HDU A;  3TO7 A;  2JUG A;  3CF5 F;  2AS5 F;  1X1D A;  2ZB9 A;  2ECB A;  4M6V A;  3CZ6 A;  5L3F A;  3L2W A;  4RAY A;  1R6R A;  4BQA A;  3K2A A;  4XKV A;  1YG2 A;  3T8R A;  1IGN A;  2GXB A;  1W5S A;  2R7D A;  2L9S A;  3AL0 B;  2L9N A;  3RPU D;  4LMY A;  3IUO A;  1F5T A;  2EPF A;  3BPV A;  3IAM 2;  1YX3 A;  2DJI A;  4RB1 A;  4E7K A;  3AAF A;  2W00 A;  5EYR A;  4AIJ A;  2H09 A;  1LDJ A;  2IGN A;  1TWC J;  4ZDL A;  3S3O A;  5HNH A;  3P9C A;  1T08 B;  3BZC A;  4U7D A;  1MSF C;  4XR6 A;  2DFE A;  5B1A H;  3BRO A;  2Y0S N;  4PDK A;  2CV2 A;  1OPC A;  2HOS A;  3ASO H;  4F55 A;  1FBQ A;  3S8P A;  1TT5 B;  1HXD A;  3OIO A;  3PIO F;  4C2U A;  4M9S A;  4IQJ A;  2ZO4 A;  5L3E A;  2HGC A;  3LSM A;  3KYL A;  4O3M A;  1FMV A;  2XAH A;  3S32 A;  2OC6 A;  2CSO A;  4B1R A;  1ON1 A;  1VFC A;  1FP2 A;  3BJ6 A;  5A2Q K;  5EEH A;  2HVR A;  2CQ7 A;  2STT A;  2JZY A;  2XGC A;  1EKE A;  2KRF A;  5LBQ A;  3ZOB A;  5DCM B;  3HOU J;  2HI3 A;  1W4M A;  2Z5U A;  4ZYG A;  3SDB A;  3S1Q J;  1ETY A;  1K7A A;  2MFZ A;  2F5C A;  4KN4 X;  2KHM A;  3R6S A;  5J6X A;  4EM2 A;  3K0L A;  1BJZ A;  5D4R A;  2JPB A;  3EUH A;  3J80 K;  4IHS A;  3ZMT A;  4M9Z A;  5DTD A;  3CJR B;  1E0E A;  1JUS A;  4A3D J;  4A6D A;  4IHX A;  4B4C A;  3DKX A;  3B73 A;  3OYL A;  1P6R A;  1R71 A;  4A6E A;  2VC1 A;  5HLT A;  1YS6 A;  2DLL A;  1FWZ A;  3GF2 A;  3SXY A;  1E3O C;  2X1C A;  5JI6 A;  3K4J A;  3KP5 A;  3HRT A;  4AUX A;  2JSP A;  4IO9 F;  3RQ4 A;  3KCC A;  2Z3Y A;  4XRF A;  5C4J J;  2HKX A;  2DDB A;  2W4S A;  1IN5 A;  4NQW B;  2AO9 A;  2BZT A;  2DOD A;  4BGD A;  5KHD A;  2A61 A;  5M5X J;  1YJW I;  3WU0 A;  1DU6 A;  3MZY A;  3ABU A;  3H5A A;  3WTY C;  4I6Z A;  2IAI A;  2D45 A;  4A12 A;  4JK1 X;  4H0E A;  3G71 I;  3QP6 A;  4L5E A;  4RMN A;  2NNN A;  3CCM I;  1ZG3 A;  4NB5 A;  2IGK A;  2VBW A;  1J0R A;  2E1O A;  4KUM A;  3D1N I;  3TL4 X;  4A69 C;  3ZN0 A;  2OU2 A;  2QQA A;  1ORK A;  3AG1 H;  1XGM A;  1K78 B;  4WK8 F;  2MH9 A;  1T38 A;  9ANT A;  2EK5 A;  3WHC A;  2ZNZ A;  1S3J A;  2F5E A;  4FAS D;  4Y17 A;  3L1P A;  5E8I A;  3RJP A;  4XRS G;  2E7X A;  4DQ2 A;  5K5Q A;  2ZJR F;  4ENN A;  2HVS A;  1W36 D;  3RZD J;  1RI7 A;  2VB6 A;  1U6G A;  2CH0 A;  3DV8 A;  5E1Z B;  1TLH B;  1UB9 A;  3PSF A;  1L0O C;  4CYD A;  3HOZ J;  4WCG A;  1JXS A;  2M45 A;  5L3D A;  4LGW A;  4ZZL A;  3GX4 X;  1Y1W J;  5FKO A;  1QVU A;  2VJJ A;  3BT9 A;  2KDO A;  2PLY A;  2DDA A;  3K4K A;  4PFP A;  4F52 A;  2HPM A;  3FM5 A;  3QP5 A;  1IV6 A;  5JVT A;  4IHY A;  4EAT A;  2HZD A;  2CQQ A;  3EUA A;  2QM3 A;  1MW7 A;  3GO5 A;  1HF0 A;  1JI8 A;  3K10 A;  2V1N A;  2X6X A;  2LBF B;  3WU1 B;  4E7J A;  1JKP C;  3ROU A;  1TBX A;  2PBI A;  4LB5 A;  3HUG B;  3F72 A;  1PUF B;  1Z05 A;  2CG4 A;  3CLO A;  3SFI A;  3U1K A;  5J8F A;  4HQM A;  1GDT A;  1GUU A;  1ZLK A;  4UY8 I;  1UJ8 A;  4EJV A;  1FTT A;  4NBQ A;  4D1Q A;  3LAP A;  4QPO A;  4HQE A;  5K5O A;  4ZDO A;  3CC4 I;  1P9Q C;  4IL6 C;  1ETK A;  4KFC A;  4L0Y B;  3ML6 A;  2KIQ A;  1X1B A;  2BY3 A;  1U2W A;  3H3V K;  4YEL A;  5ILS A;  3LA3 A;  3QYE A;  4R1H A;  1NK3 P;  1HDP A;  5FFX A;  3S3M A;  3ABK H;  1J59 A;  2AHQ A;  2RV8 A;  2Q8K A;  3JRB A;  5KNL A;  2HWV A;  2IW5 A;  5HLI A;  3FHZ A;  2Z2S B;  4E7H A;  1JHF A;  3OYN A;  3CP8 A;  3G2B A;  5EG0 B;  3FMR A;  2NNY A;  1QNT A;  3HG9 A;  3VOE A;  5BMZ A;  1I5Z A;  3DTK A;  4ZC3 A;  3QU6 A;  3GVA A;  2D1V A;  2FML A;  3ASN H;  2WA0 A;  1B8I A;  4HV6 A;  1MJB A;  1UMQ A;  4YIF A;  4B48 A;  3A01 A;  3ZQC A;  3HTS B;  2BBY A;  1CF7 A;  3CDH A;  2MLK A;  1B9M A;  3FK6 A;  3MQ0 A;  5DM6 F;  3CMA I;  1MD0 A;  1T0F A;  2LLK A;  4A3L J;  5IT9 K;  4KIS A;  4Q5S F;  2BE5 F;  2XRL A;  3D5R C;  1RNL A;  3C7J A;  1O4X A;  3RKX A;  2AQF A;  1MDM A;  2ESN A;  4CDG A;  3OYC A;  3BPX A;  1Y0N A;  3GFJ A;  3IKV A;  4BHC A;  4C2M J;  1KQ8 A;  4V19 K;  2XB5 A;  2E1C A;  1V5G A;  2IT0 A;  3BTI A;  1V3F A;  2DMU A;  4P55 A;  4RGS A;  1NTC A;  2LMD A;  5FD6 A;  3KP2 A;  1RUO A;  1XD7 A;  1Z91 A;  2VN2 A;  3TO9 A;  3WGH A;  3WTZ A;  3JTH A;  4E7S A;  2RGV A;  5C44 J;  1RUN A;  4CIC A;  3F8F A;  4XON A;  1J7K A;  4UHT A;  2HDC A;  3DCF A;  1O7F A;  2VQG A;  2VL8 A;  3CD6 I;  1JUM A;  1J5Y A;  2DA5 A;  3BDD A;  1B72 A;  3CMY A;  2DT5 A;  2E71 A;  3KEY A;  3SHF A;  2EZK A;  2Y48 A;  4M71 A;  3LNQ A;  3I4P A;  3HC7 A;  1NK2 P;  2VBX A;  4KNY A;  5HOD A;  1IF1 A;  1VQ8 I;  1OCZ H;  2NRA C;  3GWZ A;  1DPU A;  4PCQ A;  3SEQ A;  3TKY A;  3K70 C;  1BOA A;  1SFO J;  2MC3 A;  1MMA A;  1UHM A;  5IT3 A;  1VQN I;  1OYW A;  1TWG J;  1X3W B;  1SFU A;  2HYG D;  1MJ9 A;  1WCM J;  1S7E A;  2XF5 A;  3SEZ A;  3QOE A;  1OR7 A;  4EQQ A;  3GZN B;  2V9K A;  2VPR A;  2VAS A;  3HOV J;  1DUX C;  1VQL I;  1VQP I;  4HST A;  1TNT A;  4LIU A;  1MIJ A;  1ETW A;  2E7W A;  5M3F J;  3DEE A;  4M9X A;  5DS9 A;  2W24 A;  3DXJ F;  3FMQ A;  3OSF A;  3C2H A;  1FPQ A;  3AG4 H;  4A0X A;  4DBQ A;  3F21 A;  5FB2 A;  4E7I A;  4CXF A;  2ME0 A;  4HLX A;  2ZME A;  3LWF A;  4YRV A;  1FY7 A;  2QYO A;  3VFZ A;  1Z77 A;  5EJC A;  2LK2 A;  3F0C A;  3IHU A;  2M4K A;  1NH3 A;  2WC2 A;  2X0L A;  2L4A A;  1STZ A;  1Q1V A;  4LIV A;  1BOB A;  4AYB A;  2LDU A;  5JFR A;  2ECC A;  3TBI A;  1GVD A;  4OMZ A;  5ICF A;  2BXZ A;  1ONV A;  4ZH4 F;  1R36 A;  5ICE A;  2R4G A;  2FOW A;  1H9T A;  1B1B A;  3QOD A;  3GW2 A;  1D5V A;  4RB3 C;  3ZRG A;  3IH3 A;  3DLA A;  1WZ2 A;  2KIM A;  1SAU A;  3HXL A;  2IJL A;  1ZRE A;  4MFE A;  1D0Z A;  2E19 A;  3TMO A;  2E35 A;  4EJU A;  1AWC A;  3N97 A;  3F23 A;  2HYF A;  2CQK A;  3CQZ J;  1RPW A;  2M8G X;  3T1B A;  1BR4 A;  4ASN A;  4DYQ A;  2NVY J;  2W57 A;  3HPG A;  1T2K A;  4BJ5 C;  2XDV A;  2Z16 A;  3W2V A;  3U21 A;  1TW3 A;  2PN6 A;  2K86 A;  4BY1 J;  3CF2 A;  2R3S A;  2JPC A;  2H6B A;  3LOC A;  4NNJ A;  4QIW N;  3AL0 C;  3DEU A;  3A4C A;  1W5C C;  3BR0 A;  4AD9 A;  4D5F A;  1MGT A;  2EB7 A;  4DZJ A;  5DDG A;  1S7O A;  2GQQ A;  5HDN A;  4IOC F;  4RS8 A;  3V7C A;  3M1E A;  3BQZ A;  1X2M A;  1Y39 A;  3JAM Z;  4EJW A;  2OZU A;  4RBO A;  5FFZ A;  5IY5 H;  2MAB A;  4ESF A;  3FM3 A;  1QHH D;  3J7A O;  5IYB J;  1IRF A;  4IVN A;  4MO7 A;  4CZZ A;  3RTR A;  1GLN A;  1D5Y A;  2PG4 A;  1D8J A;  1EF4 A;  3F6V A;  3V7R A;  3W6J B;  2JA2 A;  3H1C A;  3S2H J;  3OL3 A;  1E2X A;  1G3Y A;  4CUG A;  3ZN1 A;  3HHH A;  4R8H A;  1SMY F;  2R7U A;  5IPA A;  2DCE A;  4KT5 C;  3G1M A;  1TT0 A;  2EIN H;  3P9K A;  3LQQ A;  3MKY B;  2Z99 A;  5IP9 J;  3TDU C;  4HDV A;  1YHQ I;  1N77 A;  1YYV A;  2K5C A;  4MLO A;  1QU3 A;  5GAG J;  2P6S A;  1OKR A;  1G3T A;  1GXQ A;  2H1L A;  3GCM A;  3NEU A;  3S2W A;  3L2V A;  2M3A A;  4IRG A;  4N4N B;  1IW7 F;  2FRH A;  3JCU C;  1XS9 A;  3I3L A;  1S5L C;  2XF7 A;  4F7Z A;  1ZQ3 P;  4CCJ A;  3I4M J;  2VOO A;  1QZY A;  1R5I D;  3JR9 A;  3FWE A;  5K7H A;  2BYV E;  2K02 A;  2N8G A;  3U9G A;  4C2T A;  3BZK A;  3IWF A;  4OWR B;  2XF6 A;  2CMP A;  1WJA A;  4LFU A;  2QEX I;  2G7H A;  3J7Z I;  5D5X B;  5HS7 A;  1GT0 C;  3L2R A;  3ZGK A;  2HTJ A;  5F0C A;  4RM3 A;  3BR6 A;  3CTA A;  2EJR A;  2KIF A;  2X6Y A;  4FCY A;  1MKM A;  4GRI A;  1VTN C;  3CJN A;  5A2Q Z;  4EJT A;  3GZ6 A;  1VQ9 I;  1W5T A;  5CKT A;  5E79 C;  1JJ8 C;  2ZNY A;  3OIP A;  3E3V A;  2ZXH A;  1U9N A;  1WI3 A;  2QGU A;  1XDS A;  3WG7 H;  4M73 A;  3H0D A;  2E60 A;  1MMS A;  1QZE A;  1B8I B;  2DYR H;  2R7X A;  3A01 B;  4CO8 A;  4V2G A;  3QQA A;  1CF7 B;  1U5T A;  2CQX A;  3DP7 A;  4IXA A;  2V26 A;  3FIW A;  1CGP A;  4I02 A;  2VJI A;  4XNF A;  1ZTR A;  2DBB A;  1XSX A;  2W85 A;  4HNT A;  1FJL A;  4XRM A;  4C3I J;  3BC8 A;  3AG3 H;  2HYJ A;  3R60 A;  1TWF J;  4JX5 A;  4I76 A;  3QPH A;  2OCE A;  3SFZ A;  4AWX B;  1MDM B;  3K9T A;  2HQA A;  2VBY A;  2CU7 A;  3ECO A;  1U8R A;  1X2N A;  4MGR A;  1W36 C;  3I64 A;  3GTK J;  3GLX A;  3C3W A;  1KZH A;  3PIP F;  4A0Y A;  2CW8 A;  2PQ8 A;  3K70 D;  2IA1 A;  2DFF A;  3K4L A;  1UST A;  3PNT A;  1TWH J;  2QA4 I;  4UV9 A;  3E1S A;  3L2Q A;  5AON A;  3GTO J;  5EZH A;  3VSK A;  3WTS C;  2CGP A;  2CV1 A;  3A1Y A;  3BG3 A;  3ABM H;  3E5U A;  3HB9 A;  2A6T A;  1B72 B;  5LGU A;  2OAZ A;  1TP4 A;  1W7P A;  1QA6 A;  4BE2 A;  4RGU A;  2XAF A;  3DQV C;  2DU9 A;  2XRN A;  2ZCW A;  3CMM A;  2XAJ A;  1MH4 A;  1ZGW A;  1FYM A;  3PM1 A;  4FHT A;  2W84 A;  2K9S A;  1LFP A;  2P7V B;  2X6O A;  5CVU A;  2WWY A;  2Z1D A;  4E4H A;  1K4S A;  2D2W A;  2VQL A;  1ZGA A;  1IV8 A;  2GBY A;  1K79 A;  3CP2 A;  5EDN A;  3HRM A;  1B9N A;  2OQR A;  2P81 A;  3ZXS A;  3PQJ A;  3KYC B;  3QU3 A;  1PDN C;  1IN4 A;  2QQB A;  1KON A;  2IBD A;  3NAU A;  2I5U A;  4M3E A;  4G94 A;  2CFX A;  3BTC A;  2DMP A;  2VT3 A;  2O8K A;  1OCC H;  3S1R J;  1IN7 A;  2WY7 Q;  3VB2 A;  3MD2 A;  3DPU A;  4W97 A;  2GOX B;  4UVC A;  2OD5 A;  2JVH A;  1K6Y A;  4BH9 A;  2ZME B;  2EZL A;  4KT6 A;  4G7Z F;  2QUF A;  2MG4 A;  4AYB N;  4ZYH A;  5CVI A;  1A5J A;  4HEA 2;  2ZFW A;  3JAM K;  2L54 A;  1QVT A;  5LFA A;  1B4A A;  1ZRF A;  3K4B A;  5EF6 A;  1U9O A;  2H8W A;  5K7F A;  3Q9V A;  4N0B A;  1R1U A;  1FNN A;  1IXR C;  2Y30 A;  2R5Z A;  1A35 A;  3Q0U A;  4KDP A;  1GV5 A;  2VBZ A;  2P8T A;  3IAS 2;  4XSX F;  1VQK I;  4LG0 A;  3FMS A;  1XCV A;  2X51 A;  3EQL F;  4YIR X;  2NVQ J;  5D6F A;  1I27 A;  1I6X A;  1SVO A;  4A3F J;  3DPT A;  1JGG A;  3HDD A;  1QPM A;  3VDX A;  2KLO A;  4XOP A;  4L5J A;  4BQN A;  1B6A A;  3K69 A;  4XN0 A;  4PSX A;  5ICG A;  4V2F A;  3HOW J;  2EFW A;  2ELJ A;  1S6L A;  3NWT A;  2NS0 A;  1IG7 A;  4BU2 A;  4RGR A;  3DLL F;  1K4T A;  2JN6 A;  2JVG A;  1BW6 A;  1KU7 A;  5B5E C;  3IH2 A;  4L9N A;  3OL4 A;  5DD4 A;  2OTL I;  4QTR A;  3E6M A;  5F64 A;  3BCB A;  4YFK F;  2CJJ A;  1C0W A;  2CUF A;  1V54 H;  2M9H A;  3NQO A;  4I7H A;  2E1M C;  2QQ8 A;  3BTJ A;  2DOE A;  3F6O A;  1ZGJ A;  2VXZ A;  2FMY A;  1P2F A;  4WX9 A;  3OYK A;  3D0S A;  2FNP A;  2R92 J;  1F43 A;  3CDI A;  4UVB A;  5JVG F;  2EA2 A;  3M8E A;  3T8T A;  3IC7 A;  5IT9 Z;  3E5Q A;  3FXQ A;  1SFE A;  3U1D A;  3KET A;  2YUS A;  2R5Y A;  1YJN I;  1Y8Q B;  4XLA A;  3K2Z A;  3BG5 A;  4EVI A;  1PP7 U;  3C2G A;  3DBL B;  2VJ5 A;  2XPV A;  4UUV A;  3TDZ C;  3RKW A;  2M5W A;  3MZ8 A;  1HA8 A;  2FBK A;  3NAR A;  4J19 A;  2VQC A;  1VQM I;  4KIG A;  2BOL A;  4ENK A;  3PJR A;  1R58 A;  2XPW A;  3WTV C;  4HLY A;  4B3A A;  3CDL A;  4Y33 A;  5GAE J;  4IHT A;  2FX0 A;  3PNY A;  2A6E F;  2OPT A;  5FKK A;  2ZJQ F;  5BOX A;  3G4S I;  3RKQ A;  4U0V A;  1MBE A;  4AVZ A;  4A3C J;  2MSY A;  4Y52 J;  2E34 A;  1WH5 A;  2BW3 A;  3OWT A;  1KU2 A;  4IX7 A;  5ILU A;  1SFX A;  2WTE A;  4RAZ A;  3ERE D;  3KLN A;  4HW0 A;  4XOR A;  2HU9 A;  3H3U A;  4JX6 A;  3JRD A;  3F3X A;  4ON0 A;  3V8J A;  4E6K G;  2L01 A;  1VI0 A;  3F8N A;  2MD0 A;  3O8H A;  1FOX A;  3CUQ B;  3VWB A;  2VKD A;  4ANJ A;  2IGO A;  2LY1 A;  3O8G A;  1QO0 D;  4G12 A;  2R7S A;  2NVT J;  2PX9 A;  1R1T A;  3COA C;  2JA7 J;  1OCR H;  4HV5 A;  4JYK A;  1R4M B;  2RAE A;  3HOT A;  2STW A;  3CES A;  4LB6 B;  1SD7 A;  1NG6 A;  1YW9 A;  3DU6 A;  4B3X A;  2HDW A;  2M1B A;  4ZTF A;  2ACJ A;  2L5Q A;  2BY2 A;  2EIL H;  1I3Q J;  3CUO A;  4C3H J;  2TDX A;  4IKF A;  3BY6 A;  4FTH A;  1FX7 A;  3WOD F;  4G8X A;  4U0W A;  1JUP A;  2QKM B;  4WXD A;  4A5N A;  4H4K C;  1YTY A;  1T98 A;  1TWA J;  2W25 A;  1DP7 P;  1D8K A;  1KYZ A;  3FBN B;  4ZDP A;  1U5T B;  2VKE A;  2LKX A;  2EFN A;  4Y15 A;  1D1C A;  5F1J A;  4WXH A;  1XSV A;  4A93 J;  3M1C A;  1WSU A;  2PI0 A;  2HZT A;  1T56 A;  2EZH A;  2EFQ A;  4RAG A;  2BGC A;  4BXF A;  1RET A;  2ZJ2 A;  3RKY A;  1DP3 A;  2LY2 A;  1VQ5 I;  1JGS A;  3IKT A;  2DFI A;  4HF0 A;  2YSR A;  3DF8 A;  3S3N A;  5K7Z A;  4MTE A;  3QYF A;  4CA0 A;  4J01 A;  1R7J A;  2L02 A;  4IHW A;  2RNJ A;  2V9P A;  3IV5 A;  4MIM A;  3ZQI A;  2YX7 A;  3O3K A;  1ETO A;  2EZI A;  5DCF A;  2DK5 A;  2LFB A;  2CQN A;  1WJC A;  4CGZ A;  1R9T J;  4RDU A;  4JQF A;  3RZO J;  2CUZ A;  3VYR B;  1V5E A;  1BA5 A;  2ICW G;  4FX0 A;  2XGD A;  4QWQ A;  2XAG A;  1QBJ A;  5E1X A;  1J9I A;  3C18 A;  1HC8 A;  1HLV A;  1JTX A;  1LDD A;  1W7P B;  2P7C B;  4PJN A;  4M6Y A;  4XQF A;  2OUM A;  3HSE A;  3RI4 A;  1ZRD A;  3CC7 I;  4BBS J;  5K1Y A;  1S29 A;  2DA4 A;  2R7V A;  3LMM A;  4E7L A;  4GFB A;  3A0B C;  4E70 A;  1YJ9 I;  4MEX F;  2QWW A;  1VF9 A;  3MEX A;  1R5G A;  1U8B A;  2RRE A;  4OIO F;  4IQ4 A;  5IP6 A;  3M07 A;  3AKZ A;  4X0G A;  2K9N A;  3PL8 A;  4PGG A;  4MTD A;  1HCR A;  4AM3 A;  2E5N A;  1H9G A;  3FZV A;  1T39 A;  1TQP A;  4YFN F;  5LLQ A;  1M1E B;  2HOT A;  1FOY A;  2NOJ B;  2QF7 A;  4BQO A;  1D0Y A;  2L4M A;  1IUF A;  2HFH A;  1F1Z A;  3EPZ A;  3I58 A;  3ZMZ A;  2Y9Y A;  1IC8 A;  5LRR A;  1FC3 A;  3KEO A;  2GIZ A;  3LAJ A;  1WJD A;  5J1U A;  4CYC A;  2R7R A;  3W6K B;  3U2R A;  3E6B A;  2PJR A;  1IRG A;  1G8X A;  1R1V A;  3E97 A;  2Y9Z A;  3F9K A;  2VQH A;  3CCQ I;  5ILV A;  1HKQ A;  3N4M A;  2K40 A;  3RDI A;  1RRJ A;  3ECH A;  3WTX C;  4AC0 A;  2TRT A;  5HLG A;  3KP3 A;  1Y1V J;  5F04 A;  2M0M A;  3D5S C;  1T0F C;  2R5Z B;  4S05 A;  1ZAO A;  3V4G A;  1W1W E;  4KJZ A;  4HX4 A;  1XG1 A;  2CW7 A;  4LG0 B;  1BBY A;  3GBG A;  2FJ1 A;  1G3S A;  1IO2 A;  4FET A;  4MQV A;  4F3Q A;  1F36 A;  2CUE A;  5JHF A;  3CC2 I;  2B63 J;  2ZBK A;  4OAY A;  4DBR A;  4CCM A;  2R7T A;  3EDP A;  1ZLJ A;  5AIP A;  1ITY A;  4Y7N J;  2DO7 A;  3SYT A;  2L3D A;  4JP0 A;  2PJP A;  5LD2 C;  1YIJ I;  2DMN A;  4BS9 A;  2IS1 A;  2PMH A;  1BI1 A;  4HRI A;  2BHZ A;  2WB1 N;  3I54 A;  2IEK A;  3K4C A;  1Z7U A;  4DIQ A;  1ETX A;  3JRA A;  5FGM A;  4HNV A;  2DA2 A;  5GPA A;  3BJA A;  4YEJ A;  1I39 A;  4LG3 A;  4Q4Z F;  4UNO A;  1IXC A;  5H20 A;  4A5M A;  4AIH A;  2A6H F;  2VON A;  1TW2 A;  1T33 A;  5B1B H;  4P9F A;  1S8N A;  4IOA F;  1PYV A;  1ZHF A;  3BG7 A;  2R5Y B;  3MZH A;  3VYT B;  2DTR A;  4Y3O A;  4OAZ A;  2KZG A;  4XRS A;  3DKW A;  4HBL A;  2DXI A;  3JRC A;  1OR7 C;  4RM2 A;  2XKO A;  5LEJ A;  1YE9 A;  3CCY A;  1JJ6 C;  2FE3 A;  1OCT C;  3W3C A;  4BAC A;  2R7Z J;  4KYW A;  1G6N A;  2VKV A;  4PFO A;  4GXO A;  4DZP A;  1HSJ A;  4PGH A;  3WU2 C;  2ZKZ A;  4BL0 B;  2AXT C;  2DA6 A;  2YPR A;  3WTU C;  2DPD A;  3DPL C;  3IRQ A;  3HRU A;  1LFU P;  3HGY A;  1SFK A;  2DN0 A;  4QPQ A;  3V8L A;  1BC7 C;  2H8R A;  3DKY A;  2RQQ A;  3LSR A;  1ZK8 A;  2GZW A;  4YG2 F;  1Z0X A;  3G3Z A;  2MYS A;  2O3F A;  5FLX K;  2EIM H;  1VND A;  4A3M J;  1R22 A;  2ELH A;  2XB0 X;  3OYJ A;  3QOP A;  2HXI A;  1MSE C;  2HDD A;  2M4G A;  1IZ1 A;  2HR3 A;  1CQT A;  2BW3 B;  2WAQ A;  2LVS A;  3LSP A;  2UZK A;  2ELK A;  2X1E A;  2LRE A;  5F1R A;  2H27 A;  2KKO A;  2L7M P;  5E18 F;  1TZL A;  3MMY B;  4FE7 A;  4UVA A;  2DQR A;  1AKH A;  3SQN A;  3H36 A;  1ENH A;  3QRF F;  1FMW A;  2P4W A;  3LA2 A;  2AQE A;  2FBI A;  3OYH A;  3N05 A;  3TOA A;  2V79 A;  1SD6 A;  1VQ7 I;  2UV1 A;  3BTL A;  5HS8 A;  1N75 A;  5H6Q A;  5J8C A;  2NVU B;  3W6V A;  4DJA A;  3IH4 A;  3BQY A;  2K85 A;  2CFO A;  3CJT B;  3CCR I;  3RQI A;  3PQK A;  2Z33 A;  4ABZ A;  1ETV A;  3PO3 J;  2LY9 A;  2WAD A;  2Y75 A;  1DGW Y;  4MQ9 F;  2LH9 A;  3ZMS A;  4F91 B;  2M30 A;  2EA4 A;  3VYS B;  3FXL A;  4TV7 A;  3WG9 A;  1TL8 A;  4DYC A;  1JT6 A;  2YR2 A;  2YS9 A;  5C3E J;  3SJM A;  2LKP A;  1BIB A;  4BNC A;  1Y6I A;  1ERD A;  2R7O A;  3B6C A;  2CW0 F;  4XLN F;  3JRF A;  1USS A;  4BHP A;  1FLI A;  4Q47 A;  3I53 A;  2DMT A;  4HOB A;  1LVA A;  2V7F A;  3HL2 A;  4B44 A;  2BV6 A;  1LEA A;  4KA4 A;  3KE2 A;  3O6B B;  2EFP A;  3HBL A;  1EH7 A;  3EYY A;  4BHB A;  4P9U A;  2ADU A;  2UXX A;  2F2E A;  1RIO H;  4D9J A;  3C2B A;  4XID A;  4AU7 A;  2DQL A;  4BKX A;  3PO2 J;  4RLQ A;  2V1D A;  5F08 A;  5FLM J;  3BLY A;  2XKP A;  2MLG A;  3F8B A;  3FIS A;  2VLA A;  4RA2 A;  1IAW A;  1GHC A;  1FYK A;  3V8K A;  1HW5 A;  1U0J A;  2WV1 A;  4LLG F;  4BDZ A;  1OCO H;  4MHG A;  2L9R A;  4UUS A;  3WGG A;  4CH7 A;  1EA3 A;  2H94 A;  2E5Z A;  3KIO A;  5E17 F;  4IF4 A;  3D5L A;  3WHB A;  1JKO C;  4I09 A;  3K6G A;  1MBG A;  1LJ9 A;  2DA7 A;  3WE3 A;  3FBI B;  3BR2 A;  3L00 A;  2A5W A;  3R61 A;  2EH3 A;  5E3L A;  5KVR A;  2ID3 A;  3H35 A;  2LRD A;  2IPQ X;  2G7U A;  1PJR A;  4GCV A;  3GTJ J;  2V1U A;  5F0H A;  3RYR A;  5FO5 A;  4A2U A;  1FBU A;  1A6Q A;  3CUQ A;  3DTE A;  3WGI A;  1UFM A;  3KPH A;  2KJC A;  2XAQ A;  3LQR A;  4NDL A;  3M7G A;  4B43 A;  2XAS A;  1MMD A;  2V1X A;  3OR1 C;  3OYG A;  2K9Q A;  2ISY A;  1Z6T A;  3DU5 A;  3KX2 A;  1AHD P;  3I5U A;  2BEO A;  2QLZ A;  4IZZ A;  3L9F A;  2UUZ A;  1REP C;  5D8K B;  5CVJ A;  3BOQ A;  4RLF A;  1XB4 A;  3OYE A;  3LSK A;  1UHW A;  1XX5 A;  1B59 A;  1YOV B;  4M3B A;  3OYA A;  2G9W A;  4CYC B;  2RDP A;  3GTQ J;  2IA2 A;  4BEH A;  2A68 F;  4N9H A;  2PJR B;  3KP4 A;  1G3W A;  1AA7 A;  3KZY A;  2UWM A;  3G1L A;  2K4J A;  2MH2 A;  4J00 A;  3MN2 A;  3K1N A;  1QHG A;  1IRX A;  3GTM J;  3S14 J;  5F27 A;  1Y0U A;  2F48 A;  2B0L A;  3DEW A;  2RVC A;  2GAU A;  1H0M A;  3OSG A;  2DW4 A;  4HAM A;  2P0W A;  3OYM A;  4RGX A;  2KMU A;  2L7K A;  4P1W A;  1H8A C;  4FE4 A;  2DFH A;  1X3U A;  2GXG A;  1YO5 C;  4ZYE A;  2PFB A;  2JK3 A;  4Z2Y A;  3E6D A;  4S0H B;  3S93 A;  3I71 A;  1BN5 A;  3VYU B;  4X1E A;  4HSR A;  2F5D A;  4BDY A;  1JTY A;  2KQR A;  5HS9 A;  5FJ8 J;  1VQ6 I;  3H9G A;  3W2W A;  5HNF A;  5D5U B;  2P5L C;  2K9M A;  4BYY A;  2E2I J;  2M87 A;  3OYB A;  4O6J A;  5H2F C;  2JJ7 A;  1HW2 A;  1DPR A;  4P5O A;  2CS3 A;  4HYE A;  1A04 A;  1WJB A;  2GXA A;  5DUI A;  3OR2 C;  2MW8 A;  3IWZ A;  4II3 A;  3J7Y J;  3OIQ A;  2Y31 A;  4A3I J;  1UCR A;  2F4I A;  2C6Y A;  2FF4 A;  3LA7 A;  3SDG A;  3G6E I;  1EH6 A;  2PMZ N;  3CCL I;  1JKR C;  1X3Z B;  3P5J A;  1OYI A;  1MBF A;  4G9Y A;  3JRH A;  2OF7 A;  2HTS A;  1HDD C;  4QLC U;  2LR8 A;  4ZYD A;  3IRR A;  2R7F A;  2ISZ A;  1G2H A;  1TTY A;  4XKB A;  5CYV A;  4IHV A;  3I55 I;  4W1U A;  4OU0 A;  3LSI A;  1AOY A;  1HOM A;  3FKI J;  3TP3 A;  5KAF C;  1ON2 A;  3X2Q H;  2GOM A;  5D5V B;  3B02 A;  1QPI A;  2J5P A;  2XV4 S;  3ZQG A;  1UG0 A;  1LQ1 A;  1WI9 A;  2KIS A;  1BM9 A;  2BVM A;  4G6T B;  2MD5 A;  1YRN A;  2H6C A;  3HOY J;  1FIA A;  2Y0M A;  3FX3 A;  3JW4 A;  1O3Q A;  5B66 C;  2VOD A;  5LHH A;  2M0C A;  2DOA A;  3L09 A;  2F5F A;  2L0K A;  2XRO A;  2FU4 A;  4X6A J;  2IA0 A;  4DNC A;  2DMQ A;  1MMN A;  3BG6 A;  3HHG A;  2JA5 J;  2W48 A;  1N25 A;  4GO1 A;  2M2E A;  1P4A A;  2W7N A;  1SC7 A;  3JSP A;  5FKM A;  3ERM A;  1XN7 A;  2V6C A;  4L18 B;  1FIP A;  1SVM A;  3F8M A;  1I1S A;  2LF8 A;  4DGW B;  5FRN A;  1V55 H;  2WAQ N;  4FX4 A;  3GFL A;  4NC7 A;  2I8D A;  2DAO A;  3I59 A;  1D3Y A;  3MFK A;  1XMK A;  4M72 A;  2OTJ I;  1WGX A;  3G1O A;  4BJT A;  4BJ6 C;  3P9I A;  3BJO A;  4KIC A;  1GVJ A;  3OY9 A;  4XSZ F;  3FK7 A;  1AKH B;  3L2C A;  2DT6 A;  3KP6 A;  4XLF A;  2CWE A;  2Y69 H;  2ZSH B;  2P5V A;  2QCO A;  4XBF A;  4FIS A;  4M74 A;  2JA8 J;  1A6I A;  3G73 A;  1DGR M;  1J75 A;  1BJA A;  5ED4 A;  3NWS A;  4G7H F;  4A3G J;  1S9H A;  1ZKG A;  4KMU X;  4B47 A;  2WB1 A;  2R7W A;  3Q0W A;  3SZG A;  2Z9O A;  4CCN A;  3H9J A;  1UEL B;  1FEX A;  4N4O B;  1P92 A;  5F0F A;  1Z7L A;  4G6Q A;  3MKL A;  3RSN A;  4CZC A;  4PZJ A;  4GDF A;  5D6E A;  2NS7 A;  3OMY A;  1IN6 A;  2FNA A;  2JMW A;  1HBX G;  1RC9 A;  2DA3 A;  5E1W A;  1WQ2 A;  2FUG 2;  4BUP A;  1Z6R A;  5HDG A;  4B8X A;  4XIC A;  1LB2 A;  4BXX J;  2Q2E A;  3ZMD A;  4NHJ A;  4KIF A;  4UXN A;  1WHU A;  2KFD A;  3EUK L;  1KGS A;  1IN8 A;  4OMY A;  1S72 I;  1Z67 A;  2O03 A;  2ID6 A;  3IP4 B;  2XUB A;  2EIK H;  2R0Q C;  4HPQ A;  4E7Z A;  3GZ5 A;  1GXP A;  2KT0 A;  5JR3 A;  3OOP A;  4GYI A;  4WWC A;  5B3S H;  2HQR A;  4EMS A;  1TC3 C;  1WKM A;  3K1P A;  3JSO A;  2RNG A;  5M3M J;  1XC5 A;  4HNU A;  2F5V A;  2WV0 A;  1MH3 A;  4HA8 A;  3H5R A;  3A02 A;  4ZTJ A;  2QSH X;  4Q48 A;  4P96 A;  4UUS B;  1JE8 A;  2A07 F;  3EUH C;  3LSJ A;  3TW6 A;  2XPU A;  4LIT A;  1MJA A;  3TQN A;  3MKZ A;  4ZJZ A;  4PUS A;  2VE9 A;  2FOK A;  3HIF A;  1RR8 C;  1S7A A;  1ETQ A;  2IS4 A;  2LNB A;  3REO A;  2FA5 A;  5FRO A;  1LFB A;  3ABL H;  4Y4R A;  5J4V A;  3GTP J;  1I6H J;  3Q9S A;  2ESH A;  2L9V A;  2ZSI B;  1W0U A;  1FSH A;  1SAX A;  1PP8 F;  2LG4 A;  2X9D A;  4I01 A;  1HST A;  4XLC A;  4L9J A;  3J81 K;  4LK0 F;  2ZC2 A;  4FQG A;  3O2P E;  5GAD J;  3GTL J;  2MBF A;  2COM A;  1F9N A;  5LHG A;  4UB6 C;  3QPL A;  3K4M A;  1ZG1 A;  2NAZ A;  3H5N A;  1JT0 A;  2OA4 A;  4EM0 B;  1QRY A;  2LKS A;  2VT2 A;  1XMX A;  2GIV A;  4HX7 A;  5EEG A;  1KU9 A;  1XDU A;  1ZH5 A;  1D0X A;  2EV5 A;  3CO6 C;  4O5V A;  2XVC A;  3OOU A;  1WH7 A;  1K61 A;  4RB0 A;  1UHS A;  1XMA A;  3OV8 A;  1X4O A;  3FXK A;  4BEH B;  1YW8 A;  2I10 A;  3S1M J;  3HKZ A;  5BPD A;  4ETS A;  1BC8 C;  1XGN A;  1EH8 A;  4LK1 F;  1IUY A;  3MWM A;  4XLP F;  5HLH A;  3P7N A;  2UXN A;  2IVM A;  3H9Q A;  5FLX Z;  3BP8 A;  2KRC A;  2OV7 A;  2XAU A;  4M3G A;  5IOZ A;  4LLL A;  3KEQ A;  1EJ9 A;  2CYY A;  4DW6 A;  5BNG A;  1ZYR F;  1OLT A;  1K6O A;  2HVQ A;  3ABT A;  4L9T A;  4NC8 A;  2NS8 A;  5FRM A;  4IJA A;  4BE1 A;  5F6F A;  1LEB A;  3S2D J;  1WVR A;  4HF1 A;  1LVK A;  2X4H A;  5CLS A;  2LTP A;  3I56 I;  1O57 A;  2HEO A;  3GFI A;  4HX8 A;  2EV6 A;  4D7N A;  5BPI A;  3RYP A;  1PUE E;  1WJF A;  1W7P D;  2COB A;  3JTG A;  1HKS A;  1WJE A;  4Z6Y A;  2J5O A;  1ZG5 A;  1SD5 A;  1MZB A;  3QAH A;  2XIG A;  3L7W A;  2DTZ A;  2W82 A;  2YU9 J;  5ICC A;  4CHU A;  3QPS A;  3ZP5 A;  2L7Z A;  2F4O B;  2WAE A;  5DYM A;  1H89 C;  3HRS A;  1JKQ C;  4HZF A;  4A3K J;  4ITV A;  2IRF G;  1YW7 A;  4XM3 A;  3Q0V A;  1SAN A;  1DQU A;  5HVQ C;  1MMG A;  5E3N A;  4KIB A;  5IYC J;  5JLW A;  1OYY A;  5TRD A;  2EQR A;  1WFX A;  5TIS C;  5GTI C;  3CCE I;  5EEA A;  1BI3 A;  2OBP A;  3OYF A;  2V6E A;  4CCK A; 
#chains in the Genus database with same CATH homology
 2DPU A;  4B09 A;  2E1N A;  3HYI A;  2ZXJ A;  1TQI A;  3ULQ B;  1LNW A;  3NRV A;  1P4X A;  3HTU A;  2VOP A;  4OOI A;  2QBY A;  3GXO A;  4YII A;  1YS7 A;  1HW1 A;  1T6S A;  5E20 A;  3HOS A;  4IRI A;  4IPA A;  1YIO A;  3C1D A;  3RPQ A;  2KIU A;  2V9V A;  1HQC A;  2Q0O A;  5L3G A;  2PEX A;  5LHI A;  5CVV A;  2K4B A;  1KQ0 A;  2FQ3 A;  4LJZ F;  3KZZ A;  3I59 B;  2A5Y B;  1EV7 A;  4U0Y A;  4I0B A;  3QPT A;  4BXU A;  3WTW C;  1KA8 A;  1L3L A;  4FT8 A;  1V4R A;  2EWN A;  4HF2 A;  5L3B A;  1NHA A;  5LRS A;  1Z1D A;  1JHH A;  1FP1 D;  4IRH A;  3BZ6 A;  3T0Y A;  2EFO A;  2HS5 A;  3ZQ7 A;  5BQT A;  2PMU A;  4ENM A;  3FXU A;  5DV5 A;  1XGS A;  5DUK A;  2HKO A;  4U7B A;  3TGN A;  3VEP A;  4N9I A;  3R0J A;  4U88 A;  4I98 B;  4LD5 A;  2O61 A;  2FEZ A;  3KFW X;  1U3E M;  2DI3 A;  2AXL A;  3R4K A;  1KU3 A;  3CO7 C;  4L9V A;  2D1H A;  2YX4 A;  3GFM A;  3I0T A;  1KQ9 A;  2JRT A;  4EM1 A;  2OZ6 A;  3LFK A;  1FOK A;  5ERI A;  4MNU A;  2HOE A;  5BS6 A;  3ZMU A;  4ENJ A;  1ZRC A;  1FBS A;  1SMT A;  2A3S A;  2P5K A;  5DD8 A;  4LLN A;  3F8C A;  3MCZ A;  1BIA A;  5D4S A;  1DDN A;  2EV0 A;  4ESB A;  1OMI A;  2K7L A;  2K27 A;  1FYL A;  4K2E A;  1FZP B;  4GGG A;  5D8L B;  1I1G A;  2RN7 A;  3TOB A;  4OIP F;  3E6C C;  4KN7 X;  2O6G E;  1YQA A;  1SD4 A;  2YU3 A;  2QQ9 A;  3WTT C;  4I0A A;  4OIN F;  4GYG A;  2IP2 A;  1ZN2 A;  2O8X A;  3F22 A;  3SZT A;  5TJJ A;  3DFG A;  3RPU A;  1R5H A;  2P6T A;  4G6D A;  4WF2 A;  1FSE A;  3EET A;  3R0A A;  1ZAR A;  3E5X A;  2A69 F;  2DK8 A;  2XHK A;  1J2X A;  4S04 A;  1ULY A;  1YLF A;  1QZZ A;  1HKT A;  5HDK A;  2JSC A;  5DCM A;  3RIR A;  2GA1 A;  2NYX A;  3VOD A;  1YFH A;  4Y13 A;  1O7L A;  6PAX A;  5LGN A;  3GYH X;  4EGY A;  3Q5F A;  1XSD A;  2MA3 A;  3H92 A;  4AVP A;  1QGP A;  4A0Z A;  1XGO A;  3K1M A;  4OIQ F;  2KJB A;  3CUQ C;  4EGZ A;  4D0P A;  4NQW A;  5H6R A;  1TQM A;  3SZP A;  4EV0 A;  3IL2 A;  3M8F A;  1U78 A;  1BI2 A;  4R79 A;  5LEK A;  2CO5 A;  3V7S A;  2QBY B;  4M6X A;  1XCB A;  2M8E A;  2QEN A;  1QQI A;  1RZ4 A;  4YFX F;  2RKH A;  4OIR F;  1K78 A;  3GEZ A;  5CVR A;  1U5T C;  4ESJ A;  3J80 Z;  4ZZD A;  2FBH A;  2LSO A;  2O0Y A;  3T5X A;  3ZMV A;  5DEQ A;  4G7O F;  1ODD A;  3J81 Z;  5JHU A;  1Q1H A;  4I2O A;  1WWX A;  3M9A A;  3H3Z A;  1IXS B;  1LDK B;  1P4W A;  2GA2 A;  4UV8 A;  3FF5 A;  5HOO A;  3KP7 A;  2FSW A;  3HSR A;  2QVO A;  5CJ9 A;  4L0Z B;  3HUG A;  5K5R A;  2FXA A;  5D5W B;  4JBA A;  3HSF A;  4RB2 C;  3BWG A;  5L3C A;  1O3R A;  1R23 A;  2VE8 A;  1O3T A;  3GUD A;  3TO6 A;  2JT1 A;  2OQG A;  5FD5 A;  3PFI A;  1WRJ A;  4BAY A;  1R00 A;  1BI0 A;  3ISP A;  3EYI A;  1TNS A;  2ETH A;  2HQN A;  5AIQ A;  3WE2 A;  1F4K A;  3MAJ A;  5LGT A;  1FT9 A;  3ZPL A;  2RQP A;  4KMF A;  3LST A;  4MEY F;  4EJO A;  1Z9C A;  2JTV A;  2GWR A;  1G4D A;  2VC0 A;  3ELK A;  3FXR A;  2LF7 A;  5KK1 A;  1O3S A;  4AIK A;  4L5I A;  1E17 A;  4WXC A;  1KYW A;  5E8G A;  2XGX A;  2QZ8 A;  3KLO A;  2RC4 A;  4HDU A;  3TO7 A;  2AS5 F;  5L3F A;  4RAY A;  4BQA A;  1YG2 A;  3T8R A;  2GXB A;  1W5S A;  2R7D A;  4LMY A;  1F5T A;  3BPV A;  4RB1 A;  3AAF A;  4AIJ A;  2H09 A;  1LDJ A;  3P9C A;  4U7D A;  3BRO A;  4PDK A;  1OPC A;  1FBQ A;  1HXD A;  4M9S A;  2ZO4 A;  5L3E A;  2HGC A;  4O3M A;  2XAH A;  2CSO A;  1ON1 A;  1FP2 A;  3BJ6 A;  5A2Q K;  5EEH A;  2STT A;  2JZY A;  2KRF A;  5LBQ A;  5DCM B;  4ZYG A;  1W4M A;  2Z5U A;  1K7A A;  2F5C A;  4KN4 X;  3R6S A;  5J6X A;  4EM2 A;  3K0L A;  5D4R A;  2JPB A;  3EUH A;  3J80 K;  4IHS A;  3ZMT A;  4M9Z A;  4A6D A;  3B73 A;  1P6R A;  4A6E A;  2VC1 A;  1YS6 A;  2DLL A;  1FWZ A;  3GF2 A;  3SXY A;  5JI6 A;  3KP5 A;  3HRT A;  3KCC A;  2Z3Y A;  4XRF A;  2HKX A;  1IN5 A;  2A61 A;  3WU0 A;  3MZY A;  3ABU A;  3WTY C;  2D45 A;  4A12 A;  4JK1 X;  4H0E A;  3QP6 A;  2NNN A;  1ZG3 A;  4NB5 A;  2VBW A;  1J0R A;  4KUM A;  3ZN0 A;  2OU2 A;  2QQA A;  1XGM A;  1K78 B;  4WK8 F;  2MH9 A;  1T38 A;  2EK5 A;  2ZNZ A;  1S3J A;  2F5E A;  4Y17 A;  5E8I A;  3RJP A;  2E7X A;  4DQ2 A;  5K5Q A;  4ENN A;  1RI7 A;  3DV8 A;  1U6G A;  5E1Z B;  1TLH B;  1UB9 A;  1L0O C;  4CYD A;  4WCG A;  1JXS A;  2M45 A;  5L3D A;  4LGW A;  4ZZL A;  3GX4 X;  2PLY A;  3FM5 A;  3QP5 A;  5JVT A;  2QM3 A;  3GO5 A;  3WU1 B;  3ROU A;  1TBX A;  2PBI A;  4LB5 A;  3F72 A;  1Z05 A;  2CG4 A;  3CLO A;  5J8F A;  4HQM A;  1ZLK A;  4EJV A;  3LAP A;  4HQE A;  5K5O A;  4KFC A;  4L0Y B;  3ML6 A;  1U2W A;  5ILS A;  3LA3 A;  4R1H A;  5FFX A;  1J59 A;  2RV8 A;  2Q8K A;  2HWV A;  2IW5 A;  5HLI A;  3FHZ A;  1JHF A;  3FMR A;  2NNY A;  1QNT A;  5BMZ A;  3VOE A;  1I5Z A;  3QU6 A;  3GVA A;  2D1V A;  2FML A;  4HV6 A;  1MJB A;  4YIF A;  3HTS B;  2BBY A;  1CF7 A;  3CDH A;  2MLK A;  1B9M A;  3MQ0 A;  1MD0 A;  1T0F A;  5IT9 K;  4Q5S F;  2BE5 F;  1RNL A;  3C7J A;  3RKX A;  1MDM A;  2ESN A;  4CDG A;  3BPX A;  3GFJ A;  3IKV A;  4BHC A;  1KQ8 A;  2E1C A;  2IT0 A;  1V3F A;  4P55 A;  4RGS A;  5FD6 A;  1RUO A;  3KP2 A;  1XD7 A;  1Z91 A;  2VN2 A;  3TO9 A;  3WGH A;  3WTZ A;  3JTH A;  1RUN A;  2RGV A;  4CIC A;  3F8F A;  1J7K A;  4UHT A;  2HDC A;  1O7F A;  1J5Y A;  3BDD A;  2DT5 A;  3SHF A;  2Y48 A;  4M71 A;  3I4P A;  4KNY A;  2VBX A;  1IF1 A;  2NRA C;  3GWZ A;  1DPU A;  4PCQ A;  3TKY A;  1BOA A;  2MC3 A;  1UHM A;  5IT3 A;  1OYW A;  1SFU A;  2HYG D;  1MJ9 A;  1OR7 A;  4EQQ A;  1DUX C;  1TNT A;  2E7W A;  4M9X A;  2W24 A;  3DXJ F;  3FMQ A;  1FPQ A;  4A0X A;  3F21 A;  5FB2 A;  4CXF A;  4HLX A;  2ZME A;  3LWF A;  1FY7 A;  2QYO A;  3VFZ A;  3IHU A;  2WC2 A;  2X0L A;  2L4A A;  1STZ A;  2LDU A;  5JFR A;  4OMZ A;  5ICF A;  1ONV A;  4ZH4 F;  1R36 A;  5ICE A;  1H9T A;  1B1B A;  3GW2 A;  1D5V A;  4RB3 C;  2KIM A;  1ZRE A;  2IJL A;  4EJU A;  1AWC A;  3N97 A;  3F23 A;  2HYF A;  2CQK A;  3T1B A;  4ASN A;  2W57 A;  1T2K A;  1TW3 A;  2PN6 A;  2K86 A;  2R3S A;  2JPC A;  2H6B A;  3DEU A;  4AD9 A;  1MGT A;  2EB7 A;  5DDG A;  1S7O A;  2GQQ A;  5HDN A;  4RS8 A;  3V7C A;  3M1E A;  3JAM Z;  4EJW A;  2OZU A;  5FFZ A;  4ESF A;  3FM3 A;  3J7A O;  1IRF A;  4IVN A;  4CZZ A;  3RTR A;  2PG4 A;  1D8J A;  3F6V A;  3V7R A;  3W6J B;  1E2X A;  1G3Y A;  3ZN1 A;  3HHH A;  4R8H A;  1SMY F;  4KT5 C;  3P9K A;  3LQQ A;  2Z99 A;  3TDU C;  4HDV A;  1YYV A;  2P6S A;  1OKR A;  1G3T A;  1GXQ A;  3S2W A;  3NEU A;  4IRG A;  1IW7 F;  2FRH A;  4F7Z A;  2VOO A;  1QZY A;  3FWE A;  2BYV E;  2K02 A;  3U9G A;  3IWF A;  4LFU A;  2G7H A;  5D5X B;  5HS7 A;  2HTJ A;  3CTA A;  2EJR A;  2KIF A;  1MKM A;  1VTN C;  3CJN A;  5A2Q Z;  4EJT A;  3GZ6 A;  1W5T A;  2ZNY A;  3E3V A;  1XDS A;  4M73 A;  4CO8 A;  1CF7 B;  1U5T A;  3DP7 A;  4IXA A;  1CGP A;  4I02 A;  2DBB A;  1XSX A;  2W85 A;  3R60 A;  3QPH A;  3SFZ A;  4AWX B;  1MDM B;  3K9T A;  2VBY A;  3ECO A;  1U8R A;  4MGR A;  3I64 A;  3GLX A;  3C3W A;  4A0Y A;  2PQ8 A;  2IA1 A;  1UST A;  4UV9 A;  5AON A;  2CGP A;  3WTS C;  3E5U A;  5LGU A;  2OAZ A;  1W7P A;  4RGU A;  2XAF A;  3DQV C;  2DU9 A;  2XRN A;  2ZCW A;  2XAJ A;  1FYM A;  4FHT A;  2W84 A;  2P7V B;  5CVU A;  2WWY A;  2D2W A;  1ZGA A;  1K79 A;  3HRM A;  1B9N A;  2OQR A;  3PQJ A;  3QU3 A;  1PDN C;  1IN4 A;  2QQB A;  4G94 A;  2CFX A;  2VT3 A;  1IN7 A;  3VB2 A;  4UVC A;  2OD5 A;  4BH9 A;  2ZME B;  4G7Z F;  2QUF A;  4ZYH A;  5CVI A;  2ZFW A;  3JAM K;  2L54 A;  1B4A A;  1ZRF A;  3Q9V A;  4N0B A;  1R1U A;  1FNN A;  1IXR C;  4KDP A;  2VBZ A;  2P8T A;  4XSX F;  4LG0 A;  3FMS A;  1XCV A;  3EQL F;  5D6F A;  1I27 A;  1I6X A;  3DPT A;  1QPM A;  4L5J A;  1B6A A;  3K69 A;  5ICG A;  2EFW A;  1S6L A;  2NS0 A;  4RGR A;  1KU7 A;  4L9N A;  5DD4 A;  3E6M A;  5F64 A;  4YFK F;  1C0W A;  3NQO A;  4I7H A;  3F6O A;  1ZGJ A;  2VXZ A;  2FMY A;  1P2F A;  4WX9 A;  3D0S A;  2FNP A;  4UVB A;  2EA2 A;  3M8E A;  3T8T A;  3IC7 A;  5IT9 Z;  3E5Q A;  3FXQ A;  1SFE A;  3U1D A;  3KET A;  3K2Z A;  4EVI A;  1PP7 U;  4UUV A;  3TDZ C;  3RKW A;  2M5W A;  2FBK A;  4KIG A;  4ENK A;  1R58 A;  3WTV C;  4HLY A;  4IHT A;  2A6E F;  5BOX A;  4U0V A;  1KU2 A;  5ILU A;  1SFX A;  2WTE A;  4RAZ A;  3ERE D;  3KLN A;  4HW0 A;  3H3U A;  3F3X A;  4ON0 A;  3V8J A;  2L01 A;  3F8N A;  3CUQ B;  1QO0 D;  1R1T A;  3COA C;  4HV5 A;  3HOT A;  2STW A;  4LB6 B;  1SD7 A;  1YW9 A;  2M1B A;  2ACJ A;  3CUO A;  2TDX A;  3BY6 A;  1FX7 A;  3WOD F;  4G8X A;  4U0W A;  4WXD A;  4A5N A;  1YTY A;  1T98 A;  2W25 A;  1DP7 P;  1D8K A;  1KYZ A;  1U5T B;  2EFN A;  4Y15 A;  4WXH A;  1XSV A;  1WSU A;  2PI0 A;  2HZT A;  2EFQ A;  2BGC A;  2ZJ2 A;  3RKY A;  1JGS A;  3IKT A;  2DFI A;  4HF0 A;  2YSR A;  3DF8 A;  4MTE A;  1R7J A;  2L02 A;  2RNJ A;  2YX7 A;  3O3K A;  5DCF A;  2DK5 A;  4CGZ A;  4JQF A;  4FX0 A;  4QWQ A;  2XAG A;  1QBJ A;  5E1X A;  1J9I A;  3C18 A;  1LDD A;  1W7P B;  2P7C B;  4M6Y A;  3HSE A;  3RI4 A;  1ZRD A;  5K1Y A;  1S29 A;  4E70 A;  4MEX F;  2QWW A;  3MEX A;  1R5G A;  4OIO F;  4PGG A;  4MTD A;  1H9G A;  3FZV A;  1T39 A;  1TQP A;  4YFN F;  5LLQ A;  2L4M A;  2HFH A;  1F1Z A;  3I58 A;  3ZMZ A;  5LRR A;  1FC3 A;  3KEO A;  3LAJ A;  3W6K B;  3U2R A;  3E6B A;  1IRG A;  1R1V A;  3E97 A;  3N4M A;  1HKQ A;  5ILV A;  3RDI A;  3ECH A;  3WTX C;  5HLG A;  3KP3 A;  4S05 A;  1ZAO A;  3V4G A;  4HX4 A;  4LG0 B;  1BBY A;  1G3S A;  4MQV A;  2ZBK A;  3EDP A;  1ZLJ A;  5AIP A;  2DO7 A;  2L3D A;  2PJP A;  2PMH A;  1BI1 A;  3I54 A;  1Z7U A;  5FGM A;  3BJA A;  4Q4Z F;  4UNO A;  1IXC A;  5H20 A;  4A5M A;  4AIH A;  2A6H F;  2VON A;  1TW2 A;  4P9F A;  1S8N A;  1ZHF A;  3MZH A;  2DTR A;  3DKW A;  4HBL A;  2XKO A;  5LEJ A;  2FE3 A;  4KYW A;  1G6N A;  4GXO A;  1HSJ A;  4PGH A;  2ZKZ A;  2YPR A;  3WTU C;  2DPD A;  3DPL C;  3IRQ A;  3HRU A;  3V8L A;  1BC7 C;  2GZW A;  4YG2 F;  3G3Z A;  2O3F A;  5FLX K;  1R22 A;  2ELH A;  3QOP A;  1IZ1 A;  2HR3 A;  2UZK A;  5F1R A;  2H27 A;  2KKO A;  5E18 F;  4UVA A;  2DQR A;  3SQN A;  3QRF F;  2P4W A;  3LA2 A;  2FBI A;  3TOA A;  2V79 A;  1SD6 A;  5HS8 A;  5H6Q A;  5J8C A;  3PQK A;  2Z33 A;  2Y75 A;  4MQ9 F;  3ZMS A;  2M30 A;  2EA4 A;  3WG9 A;  4TV7 A;  2YR2 A;  2LKP A;  1BIB A;  4BNC A;  2CW0 F;  4XLN F;  1USS A;  4BHP A;  1FLI A;  4Q47 A;  3I53 A;  4HOB A;  1LVA A;  2BV6 A;  1LEA A;  4KA4 A;  3KE2 A;  3O6B B;  2EFP A;  1EH7 A;  3EYY A;  4BHB A;  4P9U A;  2ADU A;  2UXX A;  2F2E A;  1RIO H;  2DQL A;  2V1D A;  2XKP A;  2MLG A;  3F8B A;  1IAW A;  1GHC A;  1FYK A;  3V8K A;  1HW5 A;  4LLG F;  4MHG A;  3WGG A;  2H94 A;  5E17 F;  4IF4 A;  3D5L A;  4I09 A;  1LJ9 A;  3WE3 A;  3L00 A;  3R61 A;  5KVR A;  2IPQ X;  2G7U A;  4GCV A;  2V1U A;  3RYR A;  5FO5 A;  4A2U A;  1FBU A;  3CUQ A;  3WGI A;  1UFM A;  2KJC A;  2XAQ A;  3LQR A;  3M7G A;  2XAS A;  2V1X A;  2ISY A;  1Z6T A;  3I5U A;  2BEO A;  2QLZ A;  3L9F A;  1REP C;  5D8K B;  5CVJ A;  3BOQ A;  1XB4 A;  1UHW A;  1B59 A;  2G9W A;  2RDP A;  2IA2 A;  2A68 F;  4N9H A;  3KP4 A;  1G3W A;  3KZY A;  2UWM A;  2K4J A;  2MH2 A;  3K1N A;  1Y0U A;  2B0L A;  2RVC A;  2GAU A;  1H0M A;  2DW4 A;  4HAM A;  4RGX A;  1X3U A;  2GXG A;  1YO5 C;  4ZYE A;  2PFB A;  4Z2Y A;  3E6D A;  3I71 A;  1BN5 A;  2F5D A;  5HS9 A;  5D5U B;  2P5L C;  4BYY A;  2M87 A;  4O6J A;  1HW2 A;  1DPR A;  4P5O A;  4HYE A;  1A04 A;  5DUI A;  3IWZ A;  1UCR A;  2C6Y A;  2FF4 A;  3LA7 A;  1EH6 A;  1OYI A;  4G9Y A;  2HTS A;  4QLC U;  4ZYD A;  3IRR A;  2R7F A;  2ISZ A;  1TTY A;  5CYV A;  4OU0 A;  1AOY A;  1ON2 A;  5D5V B;  3B02 A;  2J5P A;  2XV4 S;  1LQ1 A;  1WI9 A;  1BM9 A;  2MD5 A;  2H6C A;  3FX3 A;  2Y0M A;  3JW4 A;  1O3Q A;  2VOD A;  5LHH A;  3L09 A;  2F5F A;  2XRO A;  2FU4 A;  2IA0 A;  4DNC A;  3HHG A;  4GO1 A;  1P4A A;  3JSP A;  1XN7 A;  2V6C A;  4L18 B;  3F8M A;  1I1S A;  2LF8 A;  4FX4 A;  3GFL A;  2DAO A;  3I59 A;  1D3Y A;  3MFK A;  1XMK A;  4M72 A;  3P9I A;  3BJO A;  4KIC A;  1GVJ A;  4XSZ F;  3L2C A;  3KP6 A;  2CWE A;  2P5V A;  4XBF A;  4M74 A;  3G73 A;  1J75 A;  1BJA A;  5ED4 A;  4G7H F;  4KMU X;  2Z9O A;  1P92 A;  4G6Q A;  4PZJ A;  5D6E A;  1HBX G;  1IN6 A;  2FNA A;  5E1W A;  1WQ2 A;  1Z6R A;  5HDG A;  4B8X A;  1LB2 A;  2Q2E A;  3ZMD A;  4NHJ A;  4KIF A;  4UXN A;  1KGS A;  1IN8 A;  4OMY A;  2O03 A;  2XUB A;  3GZ5 A;  1GXP A;  5JR3 A;  3OOP A;  4GYI A;  4WWC A;  2HQR A;  4EMS A;  1WKM A;  3K1P A;  3JSO A;  2WV0 A;  4HA8 A;  4Q48 A;  4P96 A;  1JE8 A;  2A07 F;  1MJA A;  3TQN A;  2VE9 A;  2FOK A;  3HIF A;  1S7A A;  2LNB A;  3REO A;  2FA5 A;  3Q9S A;  2ESH A;  1FSH A;  1SAX A;  1PP8 F;  4I01 A;  1HST A;  4L9J A;  3J81 K;  4LK0 F;  3O2P E;  2MBF A;  2COM A;  1F9N A;  5LHG A;  1ZG1 A;  2NAZ A;  2OA4 A;  4EM0 B;  2VT2 A;  2GIV A;  4HX7 A;  5EEG A;  1KU9 A;  1XDU A;  1ZH5 A;  2EV5 A;  3CO6 C;  4O5V A;  2XVC A;  4RB0 A;  1XMA A;  3OV8 A;  1YW8 A;  5BPD A;  4ETS A;  1BC8 C;  1XGN A;  1EH8 A;  4LK1 F;  1IUY A;  3MWM A;  4XLP F;  5HLH A;  3P7N A;  2UXN A;  2IVM A;  5FLX Z;  3BP8 A;  4LLL A;  3KEQ A;  2CYY A;  1ZYR F;  1K6O A;  3ABT A;  4L9T A;  4IJA A;  5F6F A;  1LEB A;  4HF1 A;  2X4H A;  5CLS A;  1O57 A;  2HEO A;  3GFI A;  4HX8 A;  2EV6 A;  5BPI A;  3RYP A;  1PUE E;  1W7P D;  3JTG A;  1HKS A;  2J5O A;  1ZG5 A;  1SD5 A;  1MZB A;  3QAH A;  2XIG A;  3L7W A;  5ICC A;  4CHU A;  3ZP5 A;  5DYM A;  3HRS A;  4HZF A;  2IRF G;  1YW7 A;  5HVQ C;  4KIB A;  1OYY A;  5TRD A;  1BI3 A;  2OBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...