4RGSA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with vanilin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with Vanilin
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
molecule keywords Repressor protein
total genus 42
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rgsA00
4L9VA 4WF2A 4AD9A 1O3SA 2R3SA 4EV0A 2KKOA 1RUNA 3F6OA 3TOBA 2QLZA 3RYRA 1STZA 4HF1A 3HRUA 4RGUA 3ZMVA 1UCRA 1J0RA 3TO6A 2D1HA 3HTSB 4HX4A 3BWGA 4RB1A 5FB2A 3LAJA 4CICA 4O5VA 1KYWA 3FZVA 3VB2A 4A6EA 3SZTA 3KLOA 1HKQA 3H92A 2COMA 1Z9CA 1XD7A 2HYFA 2RDPA 1U5TC 3FMQA 1V3FA 4WXHA 3QU6A 1I5ZA 1ZRFA 2RKHA 2KJCA 4KIFA 3DQVC 5K5QA 3LQRA 3WU1B 1FYKA 1TW2A 5ICFA 5ILVA 3WGGA 3LFKA 2UXXA 1IZ1A 1XMKA 1Z91A 2QUFA 2F2EA 2ZXJA 3C18A 1HQCA 4IJAA 2E7WA 1ZH5A 4S04A 2HQNA 1J75A 3GF2A 1EH6A 4RGSA 3QPTA 3GVAA 4G9YA 1ZAOA 1ON1A 4BHBA 1FSEA 1LEBA 3IWFA 3VODA 3KFWX 1RNLA 4HA8A 2XKOA 4GXOA 2HR3A 3WTXC 4BQAA 2Z33A 4XSXF 1K78A 1ODDA 3LWFA 1NHAA 3J80Z 5H6RA 3F23A 1I27A 4U0YA 3N97A 3ISPA 2XUBA 1BBYA 3HUGA 3T8TA 2DQRA 3KEOA 2MA3A 5LHIA 1FYLA 4NQWA 4G7ZF 2A6EF 3PQKA 4HF2A 1XGOA 4I09A 3EYYA 3H3ZA 2W85A 1T6SA 4CXFA 4LLGF 3F8NA 4JQFA 5FD5A 3WTUC 4NHJA 1W4MA 2FMYA 2F5DA 3HOTA 5HLIA 4A6DA 1WI9A 2VT3A 2QQAA 5CVRA 3G73A 1XSXA 3GFIA 2PMUA 3RIRA 4E70A 4IF4A 2VODA 5JFRA 2VT2A 2HKOA 3F21A 1ZGJA 3CUQA 4HQMA 1WQ2A 2OBPA 2QYOA 2EJRA 2HZTA 2RC4A 1S7AA 2LSOA 3RDIA 3DEUA 1DUXC 2LF7A 2DPDA 1R1TA 3HRSA 2STTA 2V1UA 3DF8A 5E1XA 1B1BA 1TBXA 3C3WA 3REOA 1ZRCA 1UFMA 1D8KA 2H6CA 4EM2A 4A0XA 4ZZDA 5K1YA 3OV8A 3ML6A 4FX4A 2R7FA 2RNJA 3M8EA 4HV6A 2G9WA 5E8IA 4JBAA 2QWWA 4BNCA 2KIMA 3GFLA 3EQLF 4KFCA 4EMSA 1R1VA 4I01A 4WX9A 2MC3A 1B59A 4I98B 4F7ZA 4P96A 2MLKA 2GIVA 2PBIA 1ZHFA 5DD8A 5IT9Z 4UV8A 5FGMA 2QQBA 3GYHX 1UB9A 5HS8A 5CLSA 4BAYA 2DFIA 1QZZA 3U2RA 5LHHA 4Q47A 2V9VA 3I54A 3WTYC 2CW0F 3L7WA 2DO7A 5DYMA 3FWEA 4ENKA 5L3DA 3HRTA 3OOPA 4RAYA 4KT5C 5AONA 5DCFA 3V4GA 2VN2A 3F3XA 4EGYA 2EFQA 5LEJA 2EV0A 3D0SA 1F5TA 2C6YA 4P5OA 1IXCA 1XGMA 3FM5A 2A07F 4OMYA 4Q48A 1FZPB 3ZMDA 1X3UA 5AIPA 2GXBA 1FNNA 1IN5A 1MD0A 3R61A 4HLYA 3O3KA 1XGSA 1R1UA 1FWZA 1S6LA 2FNAA 3QAHA 2PQ8A 2ZKZA 4HYEA 1ZARA 4OOIA 2V79A 3E6DA 2XROA 4KUMA 4EQQA 1T98A 5HDKA 4LFUA 3WTWC 3F8FA 1P4XA 2OQGA 1O3TA 1B9NA 1A04A 4LK1F 5IT9K 2P5VA 4H0EA 2ZMEB 1MJ9A 4YG2F 1PUEE 4KMFA 1ZG1A 2NS0A 2NNYA 1FOKA 1J2XA 1OYWA 1ZREA 2O3FA 2L3DA 3QP6A 4ZYHA 2LF8A 1U5TA 1TTYA 5DD4A 1R5GA 4MGRA 1G3TA 4YIIA 5BPIA 3FMRA 3RTRA 5CVVA 3V8KA 4OMZA 4LJZF 3GUDA 4B8XA 2YR2A 1KU3A 4EM0B 2OQRA 2Y75A 3HSRA 4OINF 1MKMA 4M9SA 5JR3A 3DV8A 2ZCWA 4YFNF 4QLCU 2QZ8A 2F5CA 3WTZA 2CG4A 3WGIA 2BV6A 3MEXA 2OAZA 5LGTA 3ECHA 3L09A 4PDKA 2WWYA 2P7CB 3WE2A 1XN7A 4KN7X 1FBSA 4MEXF 4WWCA 1KQ9A 1JE8A 1J7KA 1O57A 1U2WA 1TQMA 5HOOA 1BM9A 3G3ZA 4BHCA 3KP5A 2QM3A 1G3WA 3CTAA 3GO5A 2XIGA 1UHWA 2QENA 4UV9A 3ELKA 4EVIA 5HLHA 5BS6A 2F5EA 2E7XA 2Z3YA 4A0ZA 1HKSA 1ON2A 4TV7A 4A5NA 3AAFA 4L9TA 3BP8A 2EA2A 2J5PA 1K79A 1S8NA 1MDMA 3SHFA 5D5UB 4N9IA 1J9IA 3BROA 3P9CA 2A6HF 2K4BA 3F8MA 2P4WA 2PN6A 2QBYB 2YPRA 3T8RA 2VOPA 1BIAA 4R1HA 1I1GA 4YIFA 1R58A 1IRGA 1I1SA 2JSCA 2V1DA 1H9GA 2EB7A 2PG4A 1HW2A 2A3SA 1KU9A 2D1VA 3LSTA 1BJAA 1LDDA 1SD4A 2FMLA 1TNTA 2BE5F 2Q8KA 1IN4A 1IN6A 3JW4A 3M1EA 3HTUA 3QP5A 5LRRA 3BJOA 5ILSA 1ZG3A 1P2FA 3GZ6A 2ZBKA 3GZ5A 3V7CA 4RAZA 2K7LA 1W7PD 4HF0A 4RB2C 2MH9A 5LEKA 3WTTC 2W25A 1P4WA 1BI0A 3V8JA 1YLFA 3JTGA 2Z5UA 4XLPF 3KP2A 2IA0A 4CYDA 3QRFF 1TLHB 4I02A 2RVCA 1ZRDA 4IHTA 3IKVA 4BH9A 2CSOA 1D3YA 1FP1D 5HLGA 3JAMZ 1GXQA 3GXOA 3CLOA 3SFZA 3BY6A 5E8GA 2A68F 1HW1A 1LVAA 2HYGD 4HW0A 2O61A 2DK5A 2BEOA 1FYMA 5F6FA 3E97A 4UNOA 3QPHA 1EV7A 4U7BA 5EEHA 2STWA 1JHHA 5F1RA 3SZPA 1SMYF 2ZMEA 4OIPF 1ZLKA 1KGSA 4YFKF 3FXRA 4KYWA 2XHKA 1FP2A 1T0FA 1MJAA 3IRQA 1W5TA 4L9NA 3E3VA 4ZH4F 1XCVA 1WWXA 1BIBA 1ZYRF 5D5WB 3NEUA 2CGPA 1JHFA 1PDNC 2R7DA 1WRJA 4M71A 5DCMB 2AS5F 3I59B 3WTSC 1S3JA 4M74A 5JVTA 2M8EA 1K7AA 5ICGA 3HSEA 2ACJA 5JHUA 3HIFA 2VBWA 2CQKA 5DEQA 4XLNF 1TQPA 2MBFA 1T39A 1SD6A 2ADUA 4HQEA 4YFXF 3BZ6A 3MZYA 2PMHA 5DV5A 3I64A 3R0AA 2LKPA 4IXAA 1BI3A 4S05A 1Q1HA 3I53A 5K5RA 5DUKA 2KIUA 4I7HA 1V4RA 1IRFA 2HS5A 2D2WA 1EH7A 3K1PA 4AIKA 1Z6RA 2A5YB 3E6MA 5LBQA 4U0WA 1YYVA 2Q2EA 2ZFWA 4ZYDA 5JI6A 1CF7B 4LB6B 4A5MA 3BPVA 1YG2A 1MGTA 4CHUA 3Q5FA 1R00A 3V7RA 4ZZLA 4Z2YA 3EDPA 1HBXG 1KQ0A 3I4PA 6PAXA 3SQNA 4MNUA 3BDDA 1L3LA 4EJTA 1L0OC 3J81Z 4WXCA 3ZPLA 3KP3A 5E17F 3CJNA 2IP2A 2H6BA 1Z1DA 4KN4X 3S2WA 4G7OF 4I2OA 3WU0A 3ABUA 5J8CA 3MFKA 3D5LA 2YU3A 4KICA 5D5VB 2K02A 1ZN2A 5L3FA 1IXRC 3TDUC 1P4AA 1R36A 4UUVA 4MTEA 2UXNA 3VEPA 3I59A 1XDUA 2NNNA 2ISYA 2BBYA 3IL2A 4LMYA 1HSTA 1BI2A 1RZ4A 3KLNA 3NQOA 2UWMA 1LJ9A 2FNPA 3FXQA 3B02A 3K1NA 2P6SA 3BPXA 4OU0A 4OIOF 4PCQA 2M87A 2L01A 1QPMA 3DXJF 4Q4ZF 4B09A 1W5SA 3TDZC 4WK8F 2IT0A 2FBKA 1MDMB 2V1XA 2P7VB 1XSVA 4P9FA 4I0AA 2E1NA 4EJWA 2JPCA 5HVQC 4G6QA 5E1ZB 3C1DA 4A0YA 4ENMA 1XB4A 2Z9OA 2H94A 3JTHA 2PFBA 3NRVA 4HZFA 2UZKA 1YS7A 2H09A 1KA8A 2L02A 3CO7C 2EFNA 3RPQA 1P92A 1B6AA 4CO8A 1DPRA 1OMIA 1PP7U 1YW9A 2GWRA 5KK1A 3U1DA 2XGXA 4EJVA 5J8FA 2CO5A 3IKTA 1XGNA 4RS8A 3F6VA 4Q5SF 3LA2A 2YX4A 3VFZA 3JAMK 3RKWA 1HW5A 1Z6TA 5ILUA 1FT9A 3K1MA 4EJUA 5K5OA 1RI7A 1R22A 2F5FA 5D6EA 3TGNA 3JSPA 3P7NA 2L54A 3GFJA 1JGSA 4M72A 4GYIA 1Y0UA 2W24A 3EETA 3PFIA 3I0TA 4LD5A 4RB0A 3RKYA 3CDHA 3T5XA 2FSWA 1E17A 1YQAA 2HEOA 4L0ZB 1G6NA 2G7UA 5L3BA 5CVUA 4G6DA 3WODF 3VOEA 2L4MA 1MZBA 3LAPA 2V6CA 3F22A 2BGCA 1USTA 2XAJA 4AWXB 2DQLA 1PP8F 3KZZA 3U9GA 1Z05A 1I6XA 2M30A 4HLXA 2EV5A 4KNYA 1SFEA 3DPTA 4O6JA 5LHGA 4G94A 2RV8A 1OR7A 1FPQA 2P8TA 3V7SA 4NB5A 5D4SA 2DT5A 5CVJA 1ULYA 1IW7F 4L5IA 2Z99A 4FX0A 2JZYA 1XCBA 3MZHA 3P9KA 1SFXA 3R4KA 4FT8A 3LA3A 3KP6A 3EYIA 2O03A 4FHTA 2DBBA 2TDXA 1E2XA 4DNCA 3F72A 3GX4X 4WCGA 1VTNC 1R7JA 5ICCA 3E5XA 2D45A 3RYPA 2WV0A 1KU2A 2ZO4A 4HAMA 2ZNZA 4GO1A 4MTDA 4L5JA 5ED4A 1O7LA 2NAZA 2PJPA 4ASNA 4L0YB 4R8HA 3KP7A 3KP4A 5D4RA 3ECOA 2GZWA 3FHZA 1UHMA 4XRFA 4KIGA 4MEYF 2VBZA 4EM1A 1U3EM 3K0LA 2VXZA 1P6RA 1U78A 2WC2A 4PZJA 3ZN1A 4ESJA 1J5YA 1BN5A 2CYYA 3CUQC 3HYIA 2MD5A 5DUIA 4M9XA 2CFXA 2QBYA 4UHTA 4A12A 2X4HA 1AWCA 2J5OA 2QQ9A 3GLXA 3HHGA 3R0JA 3ROUA 3SXYA 2KRFA 2O6GE 2HTSA 3DP7A 3L2CA 1G3YA 1SMTA 1REPC 2HQRA 1ZG5A 4ENNA 3ABTA 1T2KA 1RIOH 2ESHA 2HOEA 2BYVE 4UVBA 3TO9A 5DCMA 2XAQA 2LNBA 2EV6A 5BOXA 3MAJA 5DDGA 2IA1A 4KIBA 4N9HA 3O2PE 2JTVA 2OZ6A 1HKTA 2FF4A 2VE8A 4L9JA 2M5WA 4IVNA 2WTEA 2HTJA 4CGZA 2DK8A 3E6CC 1LB2A 5LRSA 3TOAA 3F8BA 1QO0D 2FXAA 1ONVA 4IRGA 4IHSA 3KZYA 3KETA 3DPLC 3M8FA 4CDGA 2XAFA 4LLNA 3FX3A 4L18B 2G7HA 5F64A 1TW3A 4Y13A 3CO6C 2DAOA 3ZN0A 1JXSA 3K2ZA 1YO5C 2FOKA 2OZUA 3R6SA 3KEQA 4RGRA 5KVRA 1ZLJA 2IPQX 2X0LA 5HS9A 2ESNA 1OYYA 1KU7A 1LQ1A 4U88A 2XRNA 2A61A 2B0LA 3MWMA 1RUOA 5FFXA 2DU9A 4ETSA 4Y15A 4MQVA 2ELHA 4LB5A 1XDSA 3LA7A 4JK1X 1QNTA 2VBYA 2GQQA 2VE9A 2PEXA 5ERIA 2EK5A 2MH2A 5H6QA 1J59A 1KYZA 1TQIA 3N4MA 2KJBA 1YIOA 1WKMA 5AIQA 2JRTA 3CUOA 1F4KA 2FEZA 3WTVC 3ZQ7A 1YS6A 5BQTA 2FE3A 4KMUX 3ERED 1FBQA 1BI1A 3RKXA 4ESFA 3CUQB 2PI0A 2DLLA 2MLGA 2Y0MA 2YX7A 3ZP5A 5E20A 1OYIA 3K9TA 5A2QK 3KE2A 4R79A 3HRMA 3ULQB 3K69A 2QVOA 2NRAC 3WE3A 3L9FA 2PLYA 1GXPA 3KCCA 3T0YA 2IRFG 2L4AA 2NYXA 1GHCA 3J7AO 5L3EA 2YSRA 4KA4A 4D0PA 4P55A 4AVPA 2FU4A 1D5VA 2K27A 3RI4A 4HX8A 5L3GA 4LG0A 1B9MA 2ISZA 5E18F 3GEZA 2JPBA 2O0YA 1C0WA 4MHGA 2GA1A 3FF5A 3I71A 2P6TA 1USSA 2VC0A 3HHHA 2ETHA 1OPCA 2RQPA 1SD5A 1O7FA 1B4AA 3E5QA 4M6YA 3IWZA 3J80K 3GW2A 4U0VA 2M1BA 3TO7A 2IVMA 3ZMUA 5D8KB 3I5UA 3H3UA 4BXUA 3T1BA 4AIHA 3PQJA 4GYGA 4UVAA 2W84A 3ZMTA 3BOQA 3I58A 4LK0F 3ZMZA 2H27A 1AOYA 3BJAA 1QZYA 3RPUA 1IXSB 3WG9A 4BHPA 2EFPA 4ZYEA 2EA4A 2GXGA 3E5UA 1K78B 1U5TB 5ICEA 2HGCA 1H0MA 1FC3A 5L3CA 1XSDA 2VOOA 2FA5A 5D6FA 2XAGA 4GCVA 4HX7A 2FBHA 5TJJA 2JT1A 1DDNA 5A2QZ 3RJPA 2DI3A 3FM3A 4WXDA 2DTRA 1MJBA 4HV5A 1OKRA 1IN7A 1CGPA 2K86A 1G4DA 1YW8A 2GA2A 5EEGA 1LNWA 2IA2A 1BC7C 1F1ZA 2FRHA 4N0BA 3Q9SA 4GGGA 2P5KA 5IT3A 1FY7A 3B73A 1S29A 3R60A 2FBIA 4QWQA 2EFOA 4RGXA 5E1WA 2M45A 3O6BB 1KQ8A 1FLIA 5BPDA 5FLXZ 1EH8A 3L00A 1XMAA 5D8LB 2ZNYA 5FFZA 1S7OA 3W6JB 4P9UA 4Y17A 5HDGA 2FQ3A 4G7HF 3WGHA 5FO5A 2AXLA 4HDUA 1QGPA 4LGWA 3W6KB 4LLLA 5HS7A 4LG0B 1HSJA 2HDCA 5CJ9A 4UXNA 3F8CA 2EFWA 2VC1A 1IN8A 2XKPA 2HKXA 1HXDA 5FD6A 3J81K 5CYVA 1T38A 1QBJA 4EGZA 1LDKB 4MQ9F 3COAC 1R5HA 4CZZA 4XBFA 1YW7A 1O3RA 4PGHA 3GWZA 2HWVA 1W7PB 1FSHA 4BYYA 1SD7A 5TRDA 2P5LC 5LGUA 4IRHA 4O3MA 4HBLA 3M9AA 1BC8C 4M9ZA 3DKWA 5LLQA 3QU3A 3GFMA 2XV4S 4IRIA 2RGVA 2XAHA 2GAUA 1U6GA 3P9IA 4K2EA 5D5XB 5FLXK 1G3SA 5HDNA 2K4JA 4U7DA 1LDJA 1U8RA 4KDPA 3LQQA 1SAXA 1FBUA 2E1CA 4HDVA 4HOBA 2O8XA 2A69F 2DW4A 2LDUA 1W7PA 4ON0A 4IPAA 3EUHA 2Q0OA 4UVCA 3MCZA 2XASA 2ZJ2A 1IF1A 3IC7A 5BMZA 2CWEA 2OD5A 1ZGAA 3QOPA 3HSFA 3C7JA 2XVCA 4EJOA 1DP7P 1CF7A 4ENJA 1K6OA 2IJLA 1DPUA 2DPUA 1GVJA 4A2UA 1QQIA 1SFUA 1D8JA 1TNSA 2VBXA 2HFHA 3TKYA 1IUYA 1Z7UA 1O3QA 3E6BA 1R23A 3TQNA 1F9NA 4OIQF 2W57A 4XSZF 3IHUA 4M6XA 5H20A 4I0BA 2KIFA 3FXUA 3V8LA 3HOSA 2OA4A 1BOAA 5J6XA 4OIRF 5CVIA 2VONA 3MQ0A 4G8XA 3IRRA 4ZYGA 3DFGA 2Y48A 4M73A 1WSUA 3ZMSA 1FX7A 2IW5A 3JSOA 4PGGA 4AIJA 3M7GA 4RB3C 2OU2A 3BJ6A 3Q9VA 4ESBA 1YFHA 1YTYA 1IAWA 3FMSA 5LGNA 1LEAA 2EWNA 4DQ2A 2RN7A 1H9TA
chains in the Genus database with same CATH superfamily
2K9LA 2CFOA 4L9VA 4WF2A 3MVPA 4BJ5C 4XM3A 3G1MA 4AD9A 1O3SA 5GPAA 3MMYB 2R3SA 4EV0A 2KKOA 1RUNA 4F91B 3GCMA 3F6OA 3TOBA 2QLZA 1DU6A 3RYRA 1STZA 3PUBA 4HF1A 3HRUA 4RGUA 3ZMVA 3L2QA 3DPUA 1UCRA 4IZZA 1TP4A 3BR2A 2LR8A 1WJBA 1I3QJ 2EZHA 4BKXA 1J0RA 2GXAA 3TO6A 2D1HA 3HTSB 2VJ5A 4J00A 3BQYA 2HQ5A 4XIDA 4HX4A 3BWGA 4RB1A 4CCNA 5FB2A 2ELJA 4PSXA 3LAJA 1LFPA 2X6WA 4CICA 3A01B 4O5VA 2YS9A 1KYWA 3HG9A 3G2BA 3FZVA 3VB2A 4A6EA 3SZTA 5EG0B 2VI6A 1HKQA 2NOJB 3KLOA 3W2WA 2VJJA 3H92A 1X2NA 3CDIA 4B3XA 2COMA 4DZPA 1Z9CA 1XD7A 1WI3A 5GTHC 2HYFA 2LLKA 1U5TC 3FMQA 2RDPA 3S2HJ 1SVOA 2JQ7A 1V3FA 4WXHA 3QU6A 3J7ZI 1I5ZA 1ZRFA 4GRIA 2RKHA 2KJCA 1QRYA 4KIFA 5F1JA 2VL8A 3DQVC 5K5QA 3HOXJ 3CC2I 3LQRA 3OYIA 3S15J 3WU1B 3JRIA 1FYKA 1TW2A 5EG0A 5ICFA 3HOUJ 2K5CA 2LC2A 5KAFC 5ILVA 2BXYA 3WGGA 2CUEA 2M4GA 2MC4A 2VKEA 3LFKA 4FISA 2UXXA 5J4VA 4CCJA 3K70D 1IZ1A 1XMKA 3PNTA 3PSFA 1QHHD 1Z91A 2P0WA 2QUFA 3QQAA 5FJ8J 2F2EA 2KZGA 4E6KG 2ZXJA 1OCCH 3C18A 2BVMA 2CV2A 1PUFA 1S7EA 4BEHA 1HQCA 2I8DA 3TBIA 5LD2C 4IJAA 2MYSA 2E7WA 3GTJJ 3HBLA 1X1BA 3UNGC 2LRDA 1UAAA 1ZH5A 3S1RJ 1I50J 3X2QH 4AYBA 4S04A 2HQNA 3L2VA 1YIJI 3B6AA 4AVZA 2VUMJ 1J75A 3GF2A 3EPZA 1EH6A 4RGSA 3QPTA 2KP6A 5J4YA 2LFBA 2HYJA 3GVAA 5E3LA 3QYFA 4G9YA 3RCOA 1ZAOA 4IOAF 2W4SA 1ON1A 5C3EJ 4BHBA 2NS7A 1FSEA 3SDBA 1LEBA 3IWFA 3VODA 4C2TA 1XMXA 3KFWX 1RNLA 4HPQA 4HA8A 2LKXA 2XKOA 4GXOA 3OYFA 2HR3A 5M3MJ 3WTXC 4BQAA 4DBQA 2Z33A 5GP9A 4XSXF 4CCKA 1K78A 1ODDA 3JRBA 1QHGA 2R5YB 2DMUA 1NHAA 3LWFA 3OYJA 1BR1A 2PJRA 1HF0A 1ERDA 3J80Z 1Z7LA 2DOFA 5H6RA 1SFKA 1SFOJ 1EF4A 4HNTA 3F23A 1I27A 2L9VA 2OJED 3S3MA 4U0YA 3CP8A 3BT9A 3N97A 1SANA 3ISPA 2XUBA 1LFBA 1BBYA 4XN3A 3HUGA 3T8TA 3A02A 2DQRA 3KEOA 2LTPA 1A35A 1XX5A 4HSRA 3AG4H 1BW5A 2MA3A 5LHIA 1FYLA 3KX2A 3HKZN 4XOPA 2ID6A 5B5EC 4NQWA 2QQ8A 3MD2A 5GAGJ 4G7ZF 2AQFA 4RMNA 2A6EF 2WAQN 1I3AA 3PQKA 1RPWA 1Y8QB 5J1YA 4HF2A 1XGOA 3BC8A 1NTCA 4I09A 3TL4X 3OIOA 5E3OA 3EYYA 3H3ZA 2W85A 3TP0A 1T6SA 4CXFA 2EINH 4LLGF 4X6AJ 2CMPA 3F8NA 4JQFA 4PJJA 5FD5A 3WTUC 3CCUI 2TRTA 4P1WA 2R7WA 4A3KJ 1D5YA 2HDDA 2KDOA 4FE4A 4NHJA 1W4MA 2R7SA 2VQGA 2FMYA 2F5DA 3HOTA 5HLIA 4A6DA 1WI9A 2VT3A 5EGOB 4BE0A 2YUSA 1ETWA 1D0ZA 2QQAA 2BVLA 1MMGA 5CVRA 3G73A 1XSXA 3GFIA 2R7RA 4XLCA 2PMUA 2KHMA 2HXIA 1XG1A 3UR3C 2DA6A 4A3IJ 2IS1A 3RIRA 4E70A 4IF4A 2VODA 2KZVA 3ZXSA 5JFRA 2WAEA 2VT2A 1RR7A 2HKOA 2QSFX 1ZGJA 2XRLA 3CUQA 3PUFA 3F21A 3CCMI 2R0QC 1LE8A 3ZQLA 4HQMA 3SEZA 2DODA 2V9KA 3GLLA 4MLOA 1POGA 1WQ2A 2OBPA 2QYOA 2EJRA 2HZTA 2RC4A 1TC3C 1S7AA 2LSOA 4QPOA 3RDIA 3DEUA 4YIRX 4NC7A 1DUXC 1R5ID 1X2MA 1P7IA 2LF7A 2VQHA 2DPDA 1R1TA 3QODA 3HRSA 1LE8B 2STTA 2V1UA 4XLAA 3DF8A 5E1XA 5GADJ 1B1BA 3E1SA 1OJLA 1JI8A 1TBXA 3ZQFA 3C3WA 3REOA 1ZRCA 1UFMA 1D8KA 2H6CA 4EM2A 4I76A 4A0XA 3S1MJ 3H1CA 4ZZDA 1N25A 1D0XA 5K1YA 4OWRB 3OYAA 2DT7B 3OV8A 3ML6A 2JRMA 4FX4A 3ABKH 1T56A 2BY1A 1MSFC 1X4PA 2R7FA 2RNJA 3M8EA 2HNHA 4HV6A 2G9WA 2H1LA 5E8IA 4JBAA 3W6VA 2QWWA 3OS0A 4BNCA 5K7HA 2KIMA 3GFLA 3OWTA 1R4NB 3EQLF 2HI3A 4EMSA 1NK2P 1R1VA 3LNQA 4KFCA 4I01A 4WX9A 3AFHA 4MFEA 2XGDA 2MC3A 3VYRB 1B59A 4I98B 4F7ZA 5J40A 1D0YA 4P96A 2MLKA 2QA4I 3KYDB 2GIVA 2PBIA 4M3EA 1ZHFA 5DD8A 2KQRA 5IT9Z 4UV8A 1X1AA 5FGMA 1H89C 2QQBA 1TT5B 1UB9A 3GYHX 5HS8A 3K4NA 5CLSA 3H5RA 4BAYA 2E35A 1G8XA 2O7OA 2DFIA 2L2OA 3DCFA 1QZZA 3U2RA 1GDTA 5LHHA 4Q47A 2V9VA 3OYMA 3I54A 3WTYC 2CW0F 3L7WA 1VQ9I 1VQNI 3GTQJ 2DO7A 5DYMA 3FWEA 4ENKA 4OAZA 5L3DA 3HRTA 3OOPA 4RAYA 4KT5C 4FQGA 5AONA 5DCFA 3V4GA 2VN2A 2FOWA 5EGOA 3F3XA 3MKWB 2EFQA 1X19A 5LEJA 4EGYA 2EV0A 3D0SA 3F9KA 1F5TA 4NDLA 4PFOA 2C6YA 3G1LA 1I6HJ 2R4GA 2OF7A 3FHNA 4P5OA 1IXCA 1XGMA 1YRNA 1MBJA 3FM5A 4U87A 5TGTA 2A07F 4Q48A 4OMYA 2E36A 3HPGA 5FKOA 1FZPB 2BZTA 2W48A 3ZMDA 1X3UA 3JREA 5AIPA 2BY2A 2GXBA 1MNDA 1FNNA 2DOAA 1IN5A 1MD0A 2V26A 3OR1C 3D5RC 4IHYA 3R61A 2VPLA 2LVSA 1MMDA 4HLYA 3O3KA 1XGSA 3TP3A 1R1UA 1YJ9I 4BACA 1FWZA 2X6XA 1S6LA 3HUGB 4EATA 5K7ZA 2FNAA 3QAHA 2PQ8A 2ZKZA 4HYEA 1ZARA 1O4XA 2FUG2 4OOIA 4A3LJ 2V79A 2DCEA 4MFDA 3E6DA 4S0HB 2XROA 3VYUB 5FLMJ 4F93B 1WFXA 4KUMA 4PSWA 4ANJA 4EQQA 1A6IA 1T98A 2Y0SN 3KZIC 5HDKA 1JGGA 4LFUA 1VQ5I 3WTWC 3F8FA 4E7ZA 2IS4A 1P4XA 3BR3A 2OQGA 1O3TA 1AKHB 4PJNA 3TMOA 2DYSH 4XKVA 1B9NA 1A04A 4LK1F 3HOZJ 2XPWA 1MBFA 2I10A 2P5VA 4H0EA 5IT9K 1ZGWA 1MMAA 2ZMEB 4JX5A 5JLXA 2KT0A 3DKYA 1MJ9A 5B3SH 3D1NI 4YG2F 1PUEE 4KMFA 1ZG1A 2Y30A 3RSNA 2NS0A 2NNYA 1GVDA 1FOKA 4IHVA 2IAIA 1J2XA 1OYWA 2E2IJ 1ZREA 1MBEA 1R49A 3A0BC 4BJTA 2O3FA 2L3DA 4XLFA 3QP6A 3FKIJ 1XPXA 4HRIA 3WG7H 1G59A 4F3QA 3ZQCA 4ZYHA 2LF8A 1U5TA 3S14J 1TTYA 4PJMA 5DD4A 1R5GA 1X1PA 4MGRA 1G3TA 5JLWA 4YIIA 5BPIA 3FMRA 4BXFA 4V19K 2M8GX 3RTRA 4II2A 3C2HA 5EEAA 1MIJA 5CVVA 3V8KA 4OMZA 2OTLI 2B63J 2VJ4A 4FETA 4LJZF 3GUDA 5FKNA 1AHDP 3LMMA 4B8XA 2IGOA 2KDZA 2YR2A 2JA5J 1KU3A 4D7MA 4W97A 4EM0B 2OQRA 2Y75A 3OIPA 2BXZA 5F0HA 1W1WE 3HSRA 1X1DA 4OINF 4BQNA 1OLTA 1MKMA 4M9SA 5JR3A 3DV8A 2ZCWA 4YFNF 4QLCU 5FRNA 2QZ8A 4BQQA 2XGCA 2F5CA 3WTZA 3TW7A 2CG4A 3WGIA 2FJ1A 1WPKA 2BV6A 1VQOI 3MEXA 2LY1A 2OAZA 5LGTA 4A3FJ 3ECHA 1HOMA 3L09A 4PDKA 2WWYA 2P7CB 3KEYA 3WE2A 1XN7A 3ZCOA 2VXDA 3IAM2 1FBSA 4KN7X 4MEXF 4WWCA 2M34A 1KQ9A 1DQUA 2HU9A 4XONA 4B48A 1JE8A 3S16J 2CS3A 1J7KA 2JVGA 1O57A 1U2WA 4CZCA 1TQMA 2ECCA 1BM9A 5HOOA 3G3ZA 3QOEA 3DTKA 4BHCA 3KP5A 5KAIC 2EBIA 4UY8I 3OL3A 2QM3A 2EZIA 5DM6F 3I3LA 3FK7A 1G3WA 3CTAA 3GO5A 3PNVA 2XIGA 3QYEA 1VFCA 4NC6A 4IOCF 3RZDJ 1OCRH 1UHWA 2QENA 4UV9A 2B7EA 3ELKA 3BG9A 3LFUA 2CW8A 4EVIA 5BS6A 5HLHA 2F5EA 2E7XA 1OCOH 2DN0A 2Z3YA 4A0ZA 3S17J 1HKSA 3RPUD 1MH3A 1ON2A 2R7VA 3L2WA 4TV7A 4N4NB 4A5NA 3ZOBA 4L9TA 3BP8A 3AAFA 2EA2A 2J5PA 5FROA 1K79A 3BG5A 2QKMB 1QVTA 1S8NA 2E1OA 2IGNA 2EILH 1MDMA 1B8IB 1A36A 4D7NA 1WVRA 3SHFA 4N9IA 5D5UB 2VJIA 1J9IA 5M5WJ 5DS9A 5EDNA 3BROA 3P9CA 2A6HF 2K4BA 2L5QA 3F8MA 3FKJA 2P4WA 1S72I 2PN6A 5CQGA 2QBYB 2YPRA 3T8RA 2VOPA 1BIAA 2G0EA 4R1HA 4UB6C 1I1GA 1JKOC 1FOWA 4YIFA 1R58A 1IRGA 1I1SA 2JSCA 3MKZA 2V1DA 1H9GA 2EB7A 1HDPA 3LL7A 2PG4A 1HW2A 1JTXA 1ZELA 2A3SA 3PO2J 1KU9A 1W0UA 2QKLB 3VWBA 4XNFA 2D1VA 2DA2A 3LSTA 3HOYJ 2KPMA 4I99C 4DZJA 1S5LC 1BJAA 3O8GA 3HZJA 1ETOA 1LDDA 3JCUC 3OYNA 3H3VK 1JUMA 3IUOA 4XRSG 1SD4A 2FMLA 4CSWA 1TNTA 2BE5F 2Q8KA 2XSDC 1IN4A 1IN6A 2CUJA 3FBIB 3CDLA 3JW4A 3M1EA 1PUFB 3HTUA 3QP5A 2F5VA 5LRRA 1IRXA 4BBRJ 2M3AA 3BJOA 1YX5A 1MMSA 2K3PA 5ILSA 4RAFA 4QSHA 4BQOA 1ZG3A 1P2FA 3CZ6A 3GZ6A 2ZBKA 3GZ5A 3V7CA 2ME6A 4RAZA 1R9TJ 2XB0X 2K7LA 1T8IA 3U21A 1W7PD 2XPVA 2M0CA 4HF0A 2X1EA 4RB2C 2MH9A 2V1NA 2E2HJ 1IUFA 5LEKA 3PIOF 3H0DA 3WTTC 2W25A 4XR6A 3OYDA 5IOZA 1P4WA 3HJEA 1BI0A 3V8JA 1YLFA 3JTGA 1AU7A 3GTLJ 2Z5UA 4XLPF 3KP2A 1MMNA 2IA0A 4CYDA 3L1PA 4A3DJ 4FTHA 3QRFF 1TLHB 3KIOA 4I02A 5HNFA 3S1NJ 4RA2A 2RVCA 4DW6A 1ZRDA 2HVRA 4IHTA 3IKVA 3JRFA 3K4MA 4BH9A 2CSOA 3FXLA 1D3YA 1FP1D 2Q2EB 3ZGKA 2LY9A 5HLGA 2L0KA 3JAMZ 1Y0NA 2FX0A 1GXQA 3GXOA 5HNHA 3CLOA 3PO3J 3SFZA 3BY6A 5E8GA 2A68F 2VB6A 2DA4A 5BNGA 4ZJZA 3H36A 3OYGA 2VIXA 1HW1A 4C9YA 3K4KA 2Y9ZA 2R92J 2XB5A 1LVAA 3DBRB 2HYGD 4HW0A 2DT6A 4KJZA 2O61A 2WY7Q 2DK5A 2BEOA 1FYMA 3DU5A 4CA0A 5F6FA 1QVUA 3PIPF 3BTLA 5GPCA 3E97A 3IV5A 4PFPA 1NH3A 4UNOA 1WH5A 1IC8A 3QPHA 1WH7A 3DWLE 4KT6A 3U1KA 1YJNI 1IDZA 2Z2SB 2ECBA 4Y3OA 3HC7A 1JT0A 1D1BA 1EV7A 2M4KA 5HODA 4U7BA 2WAQA 2DA5A 3CMEI 5EEHA 2STWA 1JHHA 2Q1ZB 3LSIA 1OCPA 5F1RA 3SZPA 3CMMA 1ZR4A 1SMYF 2EPFA 2ZMEA 1NK3P 4OIPF 2OCCH 1ZLKA 4J01A 1KGSA 1OR7C 2KL4A 4YFKF 3FXRA 4KYWA 3JR9A 2XHKA 1B8IA 1FP2A 1T0FA 4XKBA 1MJAA 3PM1A 3IRQA 1W5TA 4L9NA 3E3VA 4ZH4F 1XCVA 1WWXA 4C2MJ 1BIBA 1TWHJ 1ZYRF 5D5WB 3NEUA 2VQCA 2ZB9A 2CGPA 4XRSA 4B47A 2CRGA 1JHFA 1PDNC 3UKGA 4D5FA 2R7DA 1WRJA 5IOYA 3CCJI 4M71A 5DCMB 3I4NJ 3PSIA 3OSFA 3LSGA 2AS5F 2ZMEC 3SEQA 4J19A 4IKFA 3I59B 3WTSC 2A5WA 4JP0A 2BHZA 1S3JA 4M74A 5JVTA 3G1OA 2CU7A 2M8EA 2NVUB 1TWFJ 1WJ5A 2XPUA 1K7AA 5ICGA 1T08B 3HSEA 2ACJA 4ZDPA 1TT0A 5JHUA 3HIFA 2VBWA 1V54H 2CQKA 4IQJA 1R4MB 5DEQA 1FOXA 5IYBJ 1DGWY 3VYTB 2JUCA 1ZKGA 3SDGA 4XLNF 1TQPA 2MBFA 1T39A 2MW8A 1ITYA 3SYTA 1VI0A 1SD6A 2ADUA 3QWLA 2V6EA 1Z21A 4HQEA 4YFXF 3ASOH 2DMPA 3BZ6A 2NOGA 4N4OB 3MZYA 2PMHA 5DV5A 3I64A 3R0AA 1F36A 5C4XJ 2LKPA 1YJWI 4IXAA 1BI3A 1U9OA 3HB9A 4S05A 5CQEA 1Q1HA 3H35A 5EYRA 3L2RA 3I53A 5C44J 1APLC 1EJ9A 5K5RA 5DUKA 3M4OJ 2KIUA 4NNJA 4I7HA 2JN6A 1V4RA 2N8GA 3FXMA 1IRFA 1V5FA 2F6CA 3ESWB 2HS5A 2D2WA 1EH7A 2LOOA 3K1PA 2R7TA 1DU0A 2LKSA 3FISA 1Y56A 4AIKA 4BEHB 4UB8C 1Z6RA 2A5YB 5DTDA 1IG7A 3E6MA 5LBQA 3W2VA 4U0WA 2IEKA 1YYVA 2Q2EA 2ZFWA 4ZYDA 5JI6A 1OQYA 4ZC3A 1CF7B 2Y9YA 3JRGA 1JUPA 4LB6B 2DFHA 4A5MA 3BPVA 2OPTA 1YG2A 1MGTA 4CHUA 3Q5FA 1R00A 3LSRA 3V7RA 1ETXA 4ZZLA 4Z2YA 3EDPA 3G6EI 1HBXG 4NUBA 1KQ0A 3I4PA 6PAXA 3SQNA 4MNUA 2DJIA 5H2FC 5M5YJ 3BDDA 1L3LA 1MBHA 4EJTA 4B43A 1L0OC 3J81Z 2DFEA 4WXCA 3ZPLA 3KP3A 5E17F 3CJNA 5FLVA 2IP2A 3AG1H 2R7OA 2NVYJ 2H6BA 1Z1DA 1HC8A 4KN4X 3OOUA 2HVSA 1H88C 1R6RA 2NS8A 2E1MB 3S2WA 4G7OF 4I2OA 1AKHA 2BY0A 4NBQA 3WU0A 1BR4A 4HG2A 2X1DA 3ABUA 5J8CA 3MFKA 3D5LA 4PJLA 2YU3A 4KICA 3ZQQA 5D5VB 2K02A 1ZN2A 5L3FA 2ZSHB 3ZQHA 2GLOA 1IXRC 3Q0WA 2VKVA 4V2GA 5GAHJ 1K83J 2LMDA 3TDUC 3QPSA 1P4AA 1R36A 4UUVA 2LREA 1IO2A 2PX9A 4MTEA 2UXNA 3VEPA 3I59A 1XDUA 2BW3A 3VYSB 2NNNA 2ISYA 4RAGA 2BBYA 1LVKA 1YOVB 2GBYA 3E0JB 3IL2A 4LMYA 1HSTA 1BI2A 1RZ4A 2WADA 3DLAA 3KLNA 3NQOA 2UWMA 2I5UA 3A4CA 4BS9A 1LJ9A 2LD5A 3BR5A 3FXQA 2FNPA 3B02A 3K1NA 2P6SA 3A0HC 3BPXA 4OU0A 5J3LA 4OIOF 2QEXI 4PCQA 2M87A 5IY5H 2L01A 2HDWA 1R71A 1QPMA 3BCAA 1V5GA 2DYRH 3AG3H 2CJJA 1T0FC 3RQIA 3DXJF 4Q4ZF 3HM5A 4B09A 2HVQA 1W5SA 3TDZC 4WK8F 2A05A 1FIAA 3OYHA 1BOBA 4MIMA 2IT0A 4CYCA 1FTTA 2FBKA 1MDMB 2V1XA 1HLVA 2P7VB 1XSVA 3K4JA 4P9FA 2UV1A 4I0AA 2E1NA 2QSGX 3BLYA 4EJWA 2JPCA 5HVQC 4G6QA 3C1DA 4PJ0C 5E1ZB 2FD5A 4DIQA 1W36C 3CCVI 4BDZA 4A0YA 4ENMA 2E19A 1XB4A 2Z9OA 2H94A 1Y39A 2ZXIA 4CCMA 2CUFA 3FDYA 3CCEI 4F55A 2X6YA 3JTHA 2PFBA 3GTOJ 3NRVA 4HZFA 1GV5A 2UZKA 2K9SA 1M1EB 2QGUA 1YS7A 2H09A 3CJQB 1KA8A 2L02A 4M6VA 1RR8C 2DA7A 5CKTA 3CO7C 2K40A 3OIQA 2JJ7A 3DBHB 4G6TB 3GTPJ 2EFNA 3RPQA 3ZQIA 1EKEA 4NC8A 1P92A 3OS1A 2LK2A 3BG3A 1B6AA 1WJFA 1DPRA 3DU6A 3M8JA 4CO8A 1OMIA 2R5YA 1YW9A 1PP7U 1N77A 2GWRA 5KK1A 1A5JA 3U1DA 2XGXA 4EJVA 5JHFA 3O8HA 5J8FA 2CO5A 3IKTA 1YITI 1Z0XA 1XGNA 4RS8A 3SFIA 3F6VA 2H8RA 4Q5SF 5F0CA 3LA2A 2YX4A 3VFZA 1WJAA 4ZDOA 4C30A 3JAMK 3RKWA 2K9MA 1HW5A 3DEWA 3OY9A 3BZCA 1J09A 2L7KA 1Z6TA 2H8WA 2BY3A 3CD6I 5ILUA 3OYBA 3CF5F 1FT9A 2CUZA 2ICWG 3K1MA 4HNVA 4EJUA 5K5OA 1MH4A 1RI7A 1R22A 2F5FA 3KPHA 1HA8A 3WU2C 2R7QA 3BCBA 2DJNA 5E79C 5D6EA 3HEFA 3TGNA 5EF6A 1IJWC 3K4BA 5F27A 1WGXA 3JSPA 3P7NA 2L54A 1MNMC 1W5CC 3GFJA 2MSYA 4RBOA 1JGSA 1DP3A 4M72A 2DOEA 1XS9A 4GYIA 1Y0UA 2W24A 2OTJI 3EETA 3PFIA 3I0TA 2E5ZA 2JK3A 4LD5A 4RB0A 3V42A 1UHSA 3RKYA 2X9DA 2IGKA 2LH9A 3CDHA 3T5XA 4FCYA 2FSWA 2K9QA 1E17A 3OR2C 1YQAA 2HEOA 4L0ZB 1G6NA 3S32A 4E7IA 2G7UA 5L3BA 5CVUA 2VKDA 4G6DA 2XF6A 4OAYA 3WODF 3VOEA 2L4MA 1MZBA 4A69C 4D9JA 2BOLA 3H0GJ 4HSTA 1B72B 2W00A 2DA3A 3LAPA 3G4SI 2QCOA 3GZNB 3H9GA 5DM7F 2V6CA 1YRNB 1ZR2A 3F22A 2BGCA 1USTA 2XAJA 4YELA 1D1CA 4AWXB 4JYKA 4B3AA 1OCZH 1GUUA 3G71I 1U9NA 3CCSI 4PUSA 2DQLA 4FE7A 1PP8F 3KZZA 3U9GA 3FXOA 1Z05A 3CP2A 1I6XA 3ZRGA 2M30A 3OMYA 2XDVA 1VQ6I 1VQ7I 1Y1VJ 4IHWA 4HLXA 2COBA 2EV5A 2ZC2A 3BR6A 4KNYA 1SFEA 4BY1J 3DPTA 4O6JA 3BG7A 4XLEA 1VF9A 5LHGA 2ME0A 4G94A 2NVXJ 4B1RA 2L9SA 5KHDA 2RV8A 2JSPA 4M3BA 1OR7A 1FPQA 4M3FA 3D5SC 1FIPA 2P8TA 3V7SA 4NB5A 4BE2A 5D4SA 1YHQI 2EIMH 2DT5A 5CVJA 1ULYA 4XRMA 4XOTA 1E3OC 4D1QA 2FQ4A 1IW7F 2DFFA 4L5IA 3S93A 3WHBA 2Z99A 4CCLA 4A3CJ 3J7YJ 3AL0B 2KMUA 3Q0UA 4FX0A 2JZYA 3M1CA 2YU9J 1XCBA 1YX3A 3MZHA 2VPRA 5CPRB 4C3JJ 3P9KA 2CV1A 1SFXA 3R4KA 4FT8A 5F04A 3LA3A 3KP6A 3EYIA 1K4TA 4JX4A 2O03A 4FHTA 2DBBA 3CMAI 2TDXA 1E2XA 2IXSA 3NARA 5IP6A 4DNCA 2JWTA 3F72A 3GX4X 1B72A 4WCGA 3DEEA 1LPQA 1BR2A 3S3NA 3JRHA 1VTNC 1R7JA 1K4SA 5ICCA 3E5XA 2D45A 3RYPA 3DLLF 2QSHX 2WV0A 1KU2A 2ZO4A 4HAMA 2ZNZA 4GO1A 4MTDA 4DYRA 1VQPI 4L5JA 4H4KC 5ED4A 1O7LA 2NAZA 2PJPA 4A3MJ 3BTJA 1ZQ3P 1JJ8C 4ASNA 3HGGA 4L0YB 4R8HA 2CQ7A 1KONA 2JUGA 2WAFA 2HQAA 2JMWA 3KP4A 3KP7A 3EUHC 1Y8RB 5D4RA 3ECOA 3CLQA 2GZWA 3FHZA 1UHMA 4A3JJ 4XRFA 1KZHA 2L9NA 4KIGA 4MEYF 2VBZA 4EM1A 2F4MB 4DBRA 3K0LA 3OSGA 1U3EM 2VXZA 2Y2ZA 4AUXA 3BTIA 2MD0A 4A3EJ 1P6RA 1U78A 1RKWA 4LIVA 2Y31A 3ERMA 2WC2A 3C2GA 2F48A 2WY8Q 2ZJPF 4PZJA 3ZN1A 5HLTA 4CYCB 1J5YA 4ESJA 1BN5A 1Q1VA 2CYYA 2Y0SA 5KNLA 3CUQC 4IL6C 1UELB 3HYIA 1X1CA 2MD5A 3K2AA 5DUIA 4M9XA 2HPIA 2ZXHA 2DXIA 2CFXA 2QBYA 4UHTA 4XICA 4A12A 2X4HA 2IGMA 4BDYA 1AWCA 1WZ2A 2J5OA 3CCLI 5F0FA 1X4OA 2CH0A 4BL0B 1WJDA 3PJRA 2QQ9A 3GLXA 3HHGA 3R0JA 5KCMA 3ROUA 3TEDA 1RETA 1QU3A 3SXYA 2KRFA 3S8PA 4GFBA 2O6GE 4XMYA 2HTSA 3DP7A 3HXLA 3I9V2 3L2CA 1G3YA 1SMTA 4LOCA 1A31A 1REPC 2HQRA 1IV6A 4UUTA 1SC7A 1ZG5A 3OS2A 2ZXWH 4ENNA 3ABTA 1T95A 3HPHA 4X1EA 1T2KA 1RIOH 2ESHA 2HOEA 2BYVE 4UVBA 3HGYA 3TO9A 2DMTA 3TW6A 5DCMA 3W3CA 2XAQA 3AL0C 3CC4I 2LNBA 2EV6A 3DTIA 3MAJA 5BOXA 5DDGA 2IA1A 4KIBA 5TISC 2IS2A 2O9LA 4N9HA 2AXTC 1QZEA 3O2PE 4XQFA 2JTVA 2M7BA 2OZ6A 2E34A 2FF4A 1HKTA 2VE8A 4L9JA 2M5WA 1IRZA 2A6TA 4IVNA 2WTEA 2HTJA 4Y4RA 4CGZA 1ETVA 2DK8A 3E6CC 1G2HA 1LB2A 2V9PA 5LRSA 3TOAA 3F8BA 2VKHA 3A1YA 1UG2A 1PYVA 1QO0D 1U8BA 3S1QJ 2FXAA 4A3BJ 2EH3A 1ONVA 4IRGA 4IHSA 3OYKA 4XORA 4E7SA 2EQRA 3KZYA 2AO9A 3KETA 3NWTA 3DPLC 3FXJA 3M8FA 4CDGA 2XAFA 4E7KA 2E71A 3RZOJ 4LLNA 2KISA 3FX3A 3WHCA 1FMWA 4C2UA 3K10A 2G7HA 4L18B 2LG4A 5F64A 1XTAA 2KLOA 5IP7J 4DJAA 1I39A 3JRAA 1U0JA 1TW3A 4BY7J 4Y13A 2NXNB 2BHYA 3H5NA 3CO6C 2DAOA 1NG7A 3ZN0A 1JXSA 2P81A 3K2ZA 1YO5C 2FOKA 2Z16A 4BE1A 2OZUA 3R6SA 3S3OA 3KEQA 4FASD 2E60A 4RGRA 5KVRA 1ZLJA 2IPQX 2X0LA 1E3PA 5HS9A 1SVMA 1DGRM 5J47A 4GDFA 5IPAA 1JKPC 2ESNA 1OYYA 1UZCA 1KU7A 3S2DJ 1LQ1A 4U88A 2XRNA 2A61A 4CH7A 3OYLA 2B0LA 3MWMA 1RUOA 1SEUA 1LKXA 5FFXA 2DU9A 2WA0A 4ETSA 4Y15A 3MZ8A 2LBFB 4MQVA 2X85A 2ELHA 1W0TA 3AG2H 4B4CA 1XDSA 4II3A 4LB5A 1PVEA 1TWAJ 3LA7A 4A3GJ 4JK1X 2PMZN 1QNTA 2VBYA 2GQQA 3IAS2 2PEXA 2VE9A 3CC7I 2CQNA 5ERIA 1FJLA 2EK5A 2MH2A 5H6QA 3BR0A 1J59A 3VSLA 1KYZA 1TQIA 2KJBA 3N4MA 3GMEA 2E2JJ 1YIOA 4RM3A 1YI2I 2W82A 1WKMA 2DDAA 5AIQA 3MN2A 1GLNA 2HOSA 1VQLI 3CCYA 2JRTA 3I55I 1JJ6C 2X48A 3CUOA 1F4KA 2FEZA 3ZQ7A 3WTVC 1YS6A 5BQTA 1TWCJ 2FE3A 3K4LA 4KMUX 2R7ZJ 1UJ8A 2GOMA 1X3WB 3ERED 4IEJA 1FBQA 3ZQGA 1BI1A 3RKXA 2MGQA 4ESFA 1EA3A 1JT6A 3ASNH 2XF7A 4ABZA 3CUQB 2PI0A 2CQQA 3JRDA 2DLLA 2MLGA 1N78A 2Y0MA 4AM3A 2YX7A 5C4JJ 5E20A 3ZP5A 4CCOA 1OYIA 1Y6IA 3K9TA 5A2QK 4BBSJ 2JA6J 1K6YA 3KE2A 5GTIC 3RKQA 3OL4A 1MBKA 4R79A 2RAEA 3HRMA 3K69A 3ULQB 3DBLB 2ELKA 3GBGA 3BG6A 2QVOA 1SAUA 2HOAA 2KIQA 2NRAC 3WE3A 3H5AA 1SVLA 3DKXA 3VSKA 3L9FA 2HPMA 1JTYA 4ITVA 3PFYA 3CCQI 2PLYA 1GXPA 3KCCA 3T0YA 2IRFG 2HXOA 2L4AA 4F92B 5J1UA 2EIJH 2NYXA 2NVTJ 1GHCA 3J7AO 2AHQA 4Y52J 3Q0VA 1E3HA 1W36D 4JOMA 3VPRA 1QPIA 5L3EA 2M0MA 4XKCA 2DDBA 3CMYA 2YSRA 4KA4A 2CQXA 4D0PA 1V55H 2TCTA 4P55A 4AVPA 2FU4A 5M3FJ 1D5VA 2WV1A 2K27A 2IS6A 1GV2A 1Z3XA 3RI4A 4HX8A 3BZKA 5L3GA 2DA1A 1MW7A 3K6GA 4LG0A 1B9MA 2ISZA 2XAUA 2OUMA 3NWSA 5E18F 2B9SA 3GEZA 2JPBA 2O0YA 1F43A 3NAUA 4MHGA 1C0WA 2GA1A 1Z77A 1RESA 2CV0A 3FF5A 2NVQJ 3I71A 5E3MA 3LSJA 1Z67A 2P6TA 1USSA 3GTGJ 2VC0A 3BR1A 3HHHA 2DTZA 2ETHA 1OPCA 3SZGA 2RQPA 2Z1DA 1SD5A 5FKMA 1O7FA 1T33A 5B66C 4AYBN 1K61A 1B4AA 1QA6A 3E5QA 2XF5A 2WBMA 1LUJB 2V7FA 4M6YA 1CQTA 3IWZA 2RQQA 4W1UA 2X1CA 3J80K 1Y1WJ 3GW2A 4U0VA 5K7FA 4BU2A 2M1BA 3TO7A 2VLAA 3CQZJ 1MNEA 3K4CA 2IVMA 3ZMUA 4HEA2 5D8KB 1ETYA 3I5UA 5IP9J 3H3UA 4BXUA 3T1BA 2BW3B 2EZLA 1WJEA 4AIHA 1ETQA 2L7ZA 3PQJA 2OC6A 4GYGA 4JX6A 4UVAA 2W84A 3ZMTA 3BOQA 3I58A 4LK0F 4AC0A 3A03A 4LG3A 3Q3SA 3ZMZA 2H27A 1AOYA 3A2KA 3BJAA 1X58A 1QZYA 4IHXA 3RPUA 1IXSB 3WG9A 4D5CA 4MO7A 4BHPA 5FKKA 1FEXA 5FKLA 2EFPA 4ZYEA 2EA4A 3EUKL 3RQ4A 2GIZA 2GXGA 3E5UA 1K78B 5B1AH 1U5TB 3AKZA 3GTMJ 1N75A 1H8AC 3F0CA 2R7XA 4HNUA 5ICEA 2HGCA 3CJRB 1FC3A 1H0MA 5L3CA 4E7HA 1XSDA 2VOOA 2FA5A 4IQ4A 5D6FA 1MBGA 4YEJA 3B6CA 1S9HA 2XAGA 2ZFUA 3BTCA 3ONQA 2QF7A 4GCVA 2ZSIB 4HX7A 2FBHA 5TJJA 2JT1A 1VQMI 1DDNA 5A2QZ 3N05A 4RM2A 2D5VA 2ZJRF 3IH2A 4QIWN 5IYDJ 1JUSA 3RJPA 4XK4A 1AA7A 2DI3A 3FM3A 4WXDA 2R5ZB 4KISA 2DTRA 2K9NA 3QYBA 3A01A 4L5EA 1MJBA 4HV5A 3W2AA 1OKRA 4ZYAA 1YE9A 5JVGF 1IN7A 2JA2A 1CGPA 2K86A 4LIUA 3IH4A 4Y33A 2X51A 1G4DA 1YW8A 2GA2A 4XLHA 2M9HA 5EEGA 1LNWA 4X0GA 1BJZA 2IA2A 1BC7C 2E5NA 1PJRA 3VDXA 5GAEJ 1F1ZA 2FRHA 4N0BA 3C2BA 3Q9SA 3ZR8X 3IH3A 2E1MC 4GGGA 3HDDA 2P5KA 5IT3A 1FY7A 3P5JA 5M5XJ 1MSEC 3B73A 1S29A 1X3ZB 3R60A 2M7AA 1RRJA 2FBIA 4IO9F 4QWQA 4ZDLA 2EFOA 4RGXA 5E1WA 2M45A 3O6BB 4QTRA 4AIDA 2RNGA 3KYLA 1TZLA 4E4HA 4V2FA 5EZHA 1IDYA 1GT0C 1OCTC 4KITB 1FLIA 5BPDA 1KQ8A 1FTZA 5FLXZ 2R93J 3L2UA 1FOYA 1EH8A 3L00A 1XMAA 3FK6A 5FRMA 4UUSA 3HKZA 5D8LB 3I56I 2ZNYA 5FFZA 1S7OA 1UMQA 1V5EA 3W6JB 4P9UA 2K85A 2WB1A 4Y17A 2ID3A 4C3IJ 4IX7A 2X6OA 5HDGA 5EJCA 2FQ3A 4G7HF 1UG0A 3WGHA 2KRHA 2AXLA 5FO5A 3SJMA 1TL8A 1VQ4I 4HDUA 4QPQA 4G12A 5F08A 2HOTA 2V4JC 3J7AY 1QGPA 5IYCJ 1ACIA 5E3NA 4B44A 1A6QA 4LGWA 3W6KB 3H9JA 3LOCA 4LLLA 3CJTB 4RLFA 5HS7A 1IV8A 2GOXB 4DYCA 4NQWB 4DGWB 4LG0B 2W7NA 1ZTRA 1HSJA 2HDCA 1ETKA 5B1BH 2EIKH 3CESA 5CJ9A 1WHUA 2VASA 2W1OA 4UXNA 3F8CA 2EFWA 3HOVJ 4A93J 3E7LA 4M3DA 3HOWJ 2VC1A 1IN8A 2KFDA 1HCRA 2XKPA 2HKXA 3LSPA 1HXDA 3LSHA 5FD6A 3J81K 2IBDA 5CYVA 1T38A 2KRCA 9ANTA 1QBJA 4EGZA 1LDKB 2OCEA 4MQ9F 4XKWA 3M3YJ 3KYCB 3QPLA 3COAC 1R5HA 4CZZA 4XBFA 2JA8J 4RLQA 2EZKA 1YW7A 1O3RA 5EZGA 4PGHA 3K70C 3GWZA 2LBFA 1RKTA 3IP4B 4BXXJ 2HWVA 1W7PB 1FSHA 4BYYA 2L7MP 4XN0A 1SD7A 1JKQC 5TRDA 3K7AJ 3BQZA 2P5LC 3I4MJ 1OISA 1TWGJ 1BW6A 5LGUA 1Z3YA 2O5RA 4IRHA 1LFUP 4O3MA 1ZK8A 1FMVA 4HBLA 4M3GA 4I6ZA 3M9AA 1WCMJ 3OYCA 3H9QA 2LY2A 2XC7A 1BC8C 2DMNA 4BUPA 3MKYB 4M9ZA 2L9RA 3DKWA 4E7JA 5LLQA 4PK4A 3QU3A 3GFMA 2F4IA 5LFAA 2XV4S 1OFCX 4IRIA 2RGVA 2XAHA 2GAUA 1U6GA 3ABLH 3P9IA 4K2EA 5D5XB 2H1KA 5FLXK 4BGDA 1HDDC 2K3FA 1G3SA 4YRVA 1P9QC 5HDNA 2K4JA 4U7DA 1LDJA 1U8RA 4KDPA 3LQQA 1SAXA 1FBUA 3CF2A 2R5ZA 2HZDA 2E1CA 4HDVA 4HOBA 2O8XA 2A69F 2DW4A 2LDUA 1NG6A 4E7LA 4CUGA 1W7PA 4ON0A 3HL2A 4LITA 1D1AA 3JRCA 4IPAA 3EUHA 2Q0OA 4Z6YA 2ZJQF 2R7UA 4C3HJ 2CW7A 4UVCA 3MCZA 1VNDA 2XASA 2ZJ2A 4ZTFA 1IF1A 3IC7A 1WJCA 4RDUA 5BMZA 3LSMA 2CWEA 2OD5A 1ZGAA 4F52A 3QOPA 1VZ0A 4AU7A 3HSFA 2LYCA 2WB1N 3C7JA 2XVCA 4EJOA 3GTKJ 1DP7P 1CF7A 4ZTJA 4ENJA 1K6OA 2GM4A 5J1RA 2IJLA 1IGNA 1DPUA 3PL8A 1GVJA 2DPUA 2O8KA 4A2UA 1E0EA 2UUZA 1QQIA 1SFUA 3FXKA 1D8JA 3M07A 1TNSA 2VBXA 3PNYA 2HFHA 3TKYA 1IUYA 1Z7UA 1O3QA 3E6BA 2JA7J 1R23A 2MFZA 2JVHA 2F4OB 4EEFG 2XGEA 1F9NA 2LP0A 3TQNA 4OIQF 2W57A 4XSZF 3IHUA 1ORKA 4M6XA 3CCRI 4BJ6C 5H20A 4I0BA 1VQKI 3ABMH 3EUAA 2XSJC 2RREA 2KIFA 2OV7A 1JKRC 4XL9A 3FXUA 3LSKA 3V8LA 3HOSA 2PJRB 2OA4A 1VQ8I 1BOAA 1P7JA 5J6XA 4OIRF 2Y69H 5CVIA 2VONA 2DMQA 3MQ0A 4G8XA 3IRRA 4ZYGA 4UUSB 3DFGA 2L7FP 2Y48A 1XC5A 4M73A 1WSUA 3ZMSA 1FX7A 1BL0A 2IW5A 3JSOA 4PGGA 3FBNB 2MABA 3DTEA 2MG4A 4AIJA 3MKLA 3M7GA 2M2EA 2VQLA 1RC9A 4RB3C 4Y7NJ 2OU2A 1BA5A 3BJ6A 3Q9VA 4ESBA 1YFHA 3FIWA 4DOZA 1YTYA 1IAWA 3OYEA 3FMSA 5LGNA 1LEAA 2EWNA 2AQEA 1ENHA 4DQ2A 2PMZA 2RN7A 4DYQA 1H9TA
chains in the Genus database with same CATH topology
4L9VA 4WF2A 4AD9A 1O3SA 2R3SA 4EV0A 2KKOA 1RUNA 3F6OA 3TOBA 2QLZA 3RYRA 1STZA 4HF1A 3HRUA 4RGUA 3ZMVA 1UCRA 1J0RA 3TO6A 2D1HA 3HTSB 4HX4A 3BWGA 4RB1A 5FB2A 3LAJA 4CICA 4O5VA 1KYWA 3FZVA 3VB2A 4A6EA 3SZTA 3KLOA 1HKQA 3H92A 2COMA 1Z9CA 1XD7A 2HYFA 2RDPA 1U5TC 3FMQA 1V3FA 4WXHA 3QU6A 1I5ZA 1ZRFA 2RKHA 2KJCA 4KIFA 3DQVC 5K5QA 3LQRA 3WU1B 1FYKA 1TW2A 5ICFA 5ILVA 3WGGA 3LFKA 2UXXA 1IZ1A 1XMKA 1Z91A 2QUFA 2F2EA 2ZXJA 3C18A 1HQCA 4IJAA 2E7WA 1ZH5A 4S04A 2HQNA 1J75A 3GF2A 1EH6A 4RGSA 3QPTA 3GVAA 4G9YA 1ZAOA 1ON1A 4BHBA 1FSEA 1LEBA 3IWFA 3VODA 3KFWX 1RNLA 4HA8A 2XKOA 4GXOA 2HR3A 3WTXC 4BQAA 2Z33A 4XSXF 1K78A 1ODDA 3LWFA 1NHAA 3J80Z 5H6RA 3F23A 1I27A 4U0YA 3N97A 3ISPA 2XUBA 1BBYA 3HUGA 3T8TA 2DQRA 3KEOA 2MA3A 5LHIA 1FYLA 4NQWA 4G7ZF 2A6EF 3PQKA 4HF2A 1XGOA 4I09A 3EYYA 3H3ZA 2W85A 1T6SA 4CXFA 4LLGF 3F8NA 4JQFA 5FD5A 3WTUC 4NHJA 1W4MA 2FMYA 2F5DA 3HOTA 5HLIA 4A6DA 1WI9A 2VT3A 2QQAA 5CVRA 3G73A 1XSXA 3GFIA 2PMUA 3RIRA 4E70A 4IF4A 2VODA 5JFRA 2VT2A 2HKOA 3F21A 1ZGJA 3CUQA 4HQMA 1WQ2A 2OBPA 2QYOA 2EJRA 2HZTA 2RC4A 1S7AA 2LSOA 3RDIA 3DEUA 1DUXC 2LF7A 2DPDA 1R1TA 3HRSA 2STTA 2V1UA 3DF8A 5E1XA 1B1BA 1TBXA 3C3WA 3REOA 1ZRCA 1UFMA 1D8KA 2H6CA 4EM2A 4A0XA 4ZZDA 5K1YA 3OV8A 3ML6A 4FX4A 2R7FA 2RNJA 3M8EA 4HV6A 2G9WA 5E8IA 4JBAA 2QWWA 4BNCA 2KIMA 3GFLA 3EQLF 4KFCA 4EMSA 1R1VA 4I01A 4WX9A 2MC3A 1B59A 4I98B 4F7ZA 4P96A 2MLKA 2GIVA 2PBIA 1ZHFA 5DD8A 5IT9Z 4UV8A 5FGMA 2QQBA 3GYHX 1UB9A 5HS8A 5CLSA 4BAYA 2DFIA 1QZZA 3U2RA 5LHHA 4Q47A 2V9VA 3I54A 3WTYC 2CW0F 3L7WA 2DO7A 5DYMA 3FWEA 4ENKA 5L3DA 3HRTA 3OOPA 4RAYA 4KT5C 5AONA 5DCFA 3V4GA 2VN2A 3F3XA 4EGYA 2EFQA 5LEJA 2EV0A 3D0SA 1F5TA 2C6YA 4P5OA 1IXCA 1XGMA 3FM5A 2A07F 4OMYA 4Q48A 1FZPB 3ZMDA 1X3UA 5AIPA 2GXBA 1FNNA 1IN5A 1MD0A 3R61A 4HLYA 3O3KA 1XGSA 1R1UA 1FWZA 1S6LA 2FNAA 3QAHA 2PQ8A 2ZKZA 4HYEA 1ZARA 4OOIA 2V79A 3E6DA 2XROA 4KUMA 4EQQA 1T98A 5HDKA 4LFUA 3WTWC 3F8FA 1P4XA 2OQGA 1O3TA 1B9NA 1A04A 4LK1F 5IT9K 2P5VA 4H0EA 2ZMEB 1MJ9A 4YG2F 1PUEE 4KMFA 1ZG1A 2NS0A 2NNYA 1FOKA 1J2XA 1OYWA 1ZREA 2O3FA 2L3DA 3QP6A 4ZYHA 2LF8A 1U5TA 1TTYA 5DD4A 1R5GA 4MGRA 1G3TA 4YIIA 5BPIA 3FMRA 3RTRA 5CVVA 3V8KA 4OMZA 4LJZF 3GUDA 4B8XA 2YR2A 1KU3A 4EM0B 2OQRA 2Y75A 3HSRA 4OINF 1MKMA 4M9SA 5JR3A 3DV8A 2ZCWA 4YFNF 4QLCU 2QZ8A 2F5CA 3WTZA 2CG4A 3WGIA 2BV6A 3MEXA 2OAZA 5LGTA 3ECHA 3L09A 4PDKA 2WWYA 2P7CB 3WE2A 1XN7A 4KN7X 1FBSA 4MEXF 4WWCA 1KQ9A 1JE8A 1J7KA 1O57A 1U2WA 1TQMA 5HOOA 1BM9A 3G3ZA 4BHCA 3KP5A 2QM3A 1G3WA 3CTAA 3GO5A 2XIGA 1UHWA 2QENA 4UV9A 3ELKA 4EVIA 5HLHA 5BS6A 2F5EA 2E7XA 2Z3YA 4A0ZA 1HKSA 1ON2A 4TV7A 4A5NA 3AAFA 4L9TA 3BP8A 2EA2A 2J5PA 1K79A 1S8NA 1MDMA 3SHFA 5D5UB 4N9IA 1J9IA 3BROA 3P9CA 2A6HF 2K4BA 3F8MA 2P4WA 2PN6A 2QBYB 2YPRA 3T8RA 2VOPA 1BIAA 4R1HA 1I1GA 4YIFA 1R58A 1IRGA 1I1SA 2JSCA 2V1DA 1H9GA 2EB7A 2PG4A 1HW2A 2A3SA 1KU9A 2D1VA 3LSTA 1BJAA 1LDDA 1SD4A 2FMLA 1TNTA 2BE5F 2Q8KA 1IN4A 1IN6A 3JW4A 3M1EA 3HTUA 3QP5A 5LRRA 3BJOA 5ILSA 1ZG3A 1P2FA 3GZ6A 2ZBKA 3GZ5A 3V7CA 4RAZA 2K7LA 1W7PD 4HF0A 4RB2C 2MH9A 5LEKA 3WTTC 2W25A 1P4WA 1BI0A 3V8JA 1YLFA 3JTGA 2Z5UA 4XLPF 3KP2A 2IA0A 4CYDA 3QRFF 1TLHB 4I02A 2RVCA 1ZRDA 4IHTA 3IKVA 4BH9A 2CSOA 1D3YA 1FP1D 5HLGA 3JAMZ 1GXQA 3GXOA 3CLOA 3SFZA 3BY6A 5E8GA 2A68F 1HW1A 1LVAA 2HYGD 4HW0A 2O61A 2DK5A 2BEOA 1FYMA 5F6FA 3E97A 4UNOA 3QPHA 1EV7A 4U7BA 5EEHA 2STWA 1JHHA 5F1RA 3SZPA 1SMYF 2ZMEA 4OIPF 1ZLKA 1KGSA 4YFKF 3FXRA 4KYWA 2XHKA 1FP2A 1T0FA 1MJAA 3IRQA 1W5TA 4L9NA 3E3VA 4ZH4F 1XCVA 1WWXA 1BIBA 1ZYRF 5D5WB 3NEUA 2CGPA 1JHFA 1PDNC 2R7DA 1WRJA 4M71A 5DCMB 2AS5F 3I59B 3WTSC 1S3JA 4M74A 5JVTA 2M8EA 1K7AA 5ICGA 3HSEA 2ACJA 5JHUA 3HIFA 2VBWA 2CQKA 5DEQA 4XLNF 1TQPA 2MBFA 1T39A 1SD6A 2ADUA 4HQEA 4YFXF 3BZ6A 3MZYA 2PMHA 5DV5A 3I64A 3R0AA 2LKPA 4IXAA 1BI3A 4S05A 1Q1HA 3I53A 5K5RA 5DUKA 2KIUA 4I7HA 1V4RA 1IRFA 2HS5A 2D2WA 1EH7A 3K1PA 4AIKA 1Z6RA 2A5YB 3E6MA 5LBQA 4U0WA 1YYVA 2Q2EA 2ZFWA 4ZYDA 5JI6A 1CF7B 4LB6B 4A5MA 3BPVA 1YG2A 1MGTA 4CHUA 3Q5FA 1R00A 3V7RA 4ZZLA 4Z2YA 3EDPA 1HBXG 1KQ0A 3I4PA 6PAXA 3SQNA 4MNUA 3BDDA 1L3LA 4EJTA 1L0OC 3J81Z 4WXCA 3ZPLA 3KP3A 5E17F 3CJNA 2IP2A 2H6BA 1Z1DA 4KN4X 3S2WA 4G7OF 4I2OA 3WU0A 3ABUA 5J8CA 3MFKA 3D5LA 2YU3A 4KICA 5D5VB 2K02A 1ZN2A 5L3FA 1IXRC 3TDUC 1P4AA 1R36A 4UUVA 4MTEA 2UXNA 3VEPA 3I59A 1XDUA 2NNNA 2ISYA 2BBYA 3IL2A 4LMYA 1HSTA 1BI2A 1RZ4A 3KLNA 3NQOA 2UWMA 1LJ9A 2FNPA 3FXQA 3B02A 3K1NA 2P6SA 3BPXA 4OU0A 4OIOF 4PCQA 2M87A 2L01A 1QPMA 3DXJF 4Q4ZF 4B09A 1W5SA 3TDZC 4WK8F 2IT0A 2FBKA 1MDMB 2V1XA 2P7VB 1XSVA 4P9FA 4I0AA 2E1NA 4EJWA 2JPCA 5HVQC 4G6QA 5E1ZB 3C1DA 4A0YA 4ENMA 1XB4A 2Z9OA 2H94A 3JTHA 2PFBA 3NRVA 4HZFA 2UZKA 1YS7A 2H09A 1KA8A 2L02A 3CO7C 2EFNA 3RPQA 1P92A 1B6AA 4CO8A 1DPRA 1OMIA 1PP7U 1YW9A 2GWRA 5KK1A 3U1DA 2XGXA 4EJVA 5J8FA 2CO5A 3IKTA 1XGNA 4RS8A 3F6VA 4Q5SF 3LA2A 2YX4A 3VFZA 3JAMK 3RKWA 1HW5A 1Z6TA 5ILUA 1FT9A 3K1MA 4EJUA 5K5OA 1RI7A 1R22A 2F5FA 5D6EA 3TGNA 3JSPA 3P7NA 2L54A 3GFJA 1JGSA 4M72A 4GYIA 1Y0UA 2W24A 3EETA 3PFIA 3I0TA 4LD5A 4RB0A 3RKYA 3CDHA 3T5XA 2FSWA 1E17A 1YQAA 2HEOA 4L0ZB 1G6NA 2G7UA 5L3BA 5CVUA 4G6DA 3WODF 3VOEA 2L4MA 1MZBA 3LAPA 2V6CA 3F22A 2BGCA 1USTA 2XAJA 4AWXB 2DQLA 1PP8F 3KZZA 3U9GA 1Z05A 1I6XA 2M30A 4HLXA 2EV5A 4KNYA 1SFEA 3DPTA 4O6JA 5LHGA 4G94A 2RV8A 1OR7A 1FPQA 2P8TA 3V7SA 4NB5A 5D4SA 2DT5A 5CVJA 1ULYA 1IW7F 4L5IA 2Z99A 4FX0A 2JZYA 1XCBA 3MZHA 3P9KA 1SFXA 3R4KA 4FT8A 3LA3A 3KP6A 3EYIA 2O03A 4FHTA 2DBBA 2TDXA 1E2XA 4DNCA 3F72A 3GX4X 4WCGA 1VTNC 1R7JA 5ICCA 3E5XA 2D45A 3RYPA 2WV0A 1KU2A 2ZO4A 4HAMA 2ZNZA 4GO1A 4MTDA 4L5JA 5ED4A 1O7LA 2NAZA 2PJPA 4ASNA 4L0YB 4R8HA 3KP7A 3KP4A 5D4RA 3ECOA 2GZWA 3FHZA 1UHMA 4XRFA 4KIGA 4MEYF 2VBZA 4EM1A 1U3EM 3K0LA 2VXZA 1P6RA 1U78A 2WC2A 4PZJA 3ZN1A 4ESJA 1J5YA 1BN5A 2CYYA 3CUQC 3HYIA 2MD5A 5DUIA 4M9XA 2CFXA 2QBYA 4UHTA 4A12A 2X4HA 1AWCA 2J5OA 2QQ9A 3GLXA 3HHGA 3R0JA 3ROUA 3SXYA 2KRFA 2O6GE 2HTSA 3DP7A 3L2CA 1G3YA 1SMTA 1REPC 2HQRA 1ZG5A 4ENNA 3ABTA 1T2KA 1RIOH 2ESHA 2HOEA 2BYVE 4UVBA 3TO9A 5DCMA 2XAQA 2LNBA 2EV6A 5BOXA 3MAJA 5DDGA 2IA1A 4KIBA 4N9HA 3O2PE 2JTVA 2OZ6A 1HKTA 2FF4A 2VE8A 4L9JA 2M5WA 4IVNA 2WTEA 2HTJA 4CGZA 2DK8A 3E6CC 1LB2A 5LRSA 3TOAA 3F8BA 1QO0D 2FXAA 1ONVA 4IRGA 4IHSA 3KZYA 3KETA 3DPLC 3M8FA 4CDGA 2XAFA 4LLNA 3FX3A 4L18B 2G7HA 5F64A 1TW3A 4Y13A 3CO6C 2DAOA 3ZN0A 1JXSA 3K2ZA 1YO5C 2FOKA 2OZUA 3R6SA 3KEQA 4RGRA 5KVRA 1ZLJA 2IPQX 2X0LA 5HS9A 2ESNA 1OYYA 1KU7A 1LQ1A 4U88A 2XRNA 2A61A 2B0LA 3MWMA 1RUOA 5FFXA 2DU9A 4ETSA 4Y15A 4MQVA 2ELHA 4LB5A 1XDSA 3LA7A 4JK1X 1QNTA 2VBYA 2GQQA 2VE9A 2PEXA 5ERIA 2EK5A 2MH2A 5H6QA 1J59A 1KYZA 1TQIA 3N4MA 2KJBA 1YIOA 1WKMA 5AIQA 2JRTA 3CUOA 1F4KA 2FEZA 3WTVC 3ZQ7A 1YS6A 5BQTA 2FE3A 4KMUX 3ERED 1FBQA 1BI1A 3RKXA 4ESFA 3CUQB 2PI0A 2DLLA 2MLGA 2Y0MA 2YX7A 3ZP5A 5E20A 1OYIA 3K9TA 5A2QK 3KE2A 4R79A 3HRMA 3ULQB 3K69A 2QVOA 2NRAC 3WE3A 3L9FA 2PLYA 1GXPA 3KCCA 3T0YA 2IRFG 2L4AA 2NYXA 1GHCA 3J7AO 5L3EA 2YSRA 4KA4A 4D0PA 4P55A 4AVPA 2FU4A 1D5VA 2K27A 3RI4A 4HX8A 5L3GA 4LG0A 1B9MA 2ISZA 5E18F 3GEZA 2JPBA 2O0YA 1C0WA 4MHGA 2GA1A 3FF5A 3I71A 2P6TA 1USSA 2VC0A 3HHHA 2ETHA 1OPCA 2RQPA 1SD5A 1O7FA 1B4AA 3E5QA 4M6YA 3IWZA 3J80K 3GW2A 4U0VA 2M1BA 3TO7A 2IVMA 3ZMUA 5D8KB 3I5UA 3H3UA 4BXUA 3T1BA 4AIHA 3PQJA 4GYGA 4UVAA 2W84A 3ZMTA 3BOQA 3I58A 4LK0F 3ZMZA 2H27A 1AOYA 3BJAA 1QZYA 3RPUA 1IXSB 3WG9A 4BHPA 2EFPA 4ZYEA 2EA4A 2GXGA 3E5UA 1K78B 1U5TB 5ICEA 2HGCA 1H0MA 1FC3A 5L3CA 1XSDA 2VOOA 2FA5A 5D6FA 2XAGA 4GCVA 4HX7A 2FBHA 5TJJA 2JT1A 1DDNA 5A2QZ 3RJPA 2DI3A 3FM3A 4WXDA 2DTRA 1MJBA 4HV5A 1OKRA 1IN7A 1CGPA 2K86A 1G4DA 1YW8A 2GA2A 5EEGA 1LNWA 2IA2A 1BC7C 1F1ZA 2FRHA 4N0BA 3Q9SA 4GGGA 2P5KA 5IT3A 1FY7A 3B73A 1S29A 3R60A 2FBIA 4QWQA 2EFOA 4RGXA 5E1WA 2M45A 3O6BB 1KQ8A 1FLIA 5BPDA 5FLXZ 1EH8A 3L00A 1XMAA 5D8LB 2ZNYA 5FFZA 1S7OA 3W6JB 4P9UA 4Y17A 5HDGA 2FQ3A 4G7HF 3WGHA 5FO5A 2AXLA 4HDUA 1QGPA 4LGWA 3W6KB 4LLLA 5HS7A 4LG0B 1HSJA 2HDCA 5CJ9A 4UXNA 3F8CA 2EFWA 2VC1A 1IN8A 2XKPA 2HKXA 1HXDA 5FD6A 3J81K 5CYVA 1T38A 1QBJA 4EGZA 1LDKB 4MQ9F 3COAC 1R5HA 4CZZA 4XBFA 1YW7A 1O3RA 4PGHA 3GWZA 2HWVA 1W7PB 1FSHA 4BYYA 1SD7A 5TRDA 2P5LC 5LGUA 4IRHA 4O3MA 4HBLA 3M9AA 1BC8C 4M9ZA 3DKWA 5LLQA 3QU3A 3GFMA 2XV4S 4IRIA 2RGVA 2XAHA 2GAUA 1U6GA 3P9IA 4K2EA 5D5XB 5FLXK 1G3SA 5HDNA 2K4JA 4U7DA 1LDJA 1U8RA 4KDPA 3LQQA 1SAXA 1FBUA 2E1CA 4HDVA 4HOBA 2O8XA 2A69F 2DW4A 2LDUA 1W7PA 4ON0A 4IPAA 3EUHA 2Q0OA 4UVCA 3MCZA 2XASA 2ZJ2A 1IF1A 3IC7A 5BMZA 2CWEA 2OD5A 1ZGAA 3QOPA 3HSFA 3C7JA 2XVCA 4EJOA 1DP7P 1CF7A 4ENJA 1K6OA 2IJLA 1DPUA 2DPUA 1GVJA 4A2UA 1QQIA 1SFUA 1D8JA 1TNSA 2VBXA 2HFHA 3TKYA 1IUYA 1Z7UA 1O3QA 3E6BA 1R23A 3TQNA 1F9NA 4OIQF 2W57A 4XSZF 3IHUA 4M6XA 5H20A 4I0BA 2KIFA 3FXUA 3V8LA 3HOSA 2OA4A 1BOAA 5J6XA 4OIRF 5CVIA 2VONA 3MQ0A 4G8XA 3IRRA 4ZYGA 3DFGA 2Y48A 4M73A 1WSUA 3ZMSA 1FX7A 2IW5A 3JSOA 4PGGA 4AIJA 3M7GA 4RB3C 2OU2A 3BJ6A 3Q9VA 4ESBA 1YFHA 1YTYA 1IAWA 3FMSA 5LGNA 1LEAA 2EWNA 4DQ2A 2RN7A 1H9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9V A;  4WF2 A;  4AD9 A;  1O3S A;  2R3S A;  4EV0 A;  2KKO A;  1RUN A;  3F6O A;  3TOB A;  2QLZ A;  3RYR A;  1STZ A;  4HF1 A;  3HRU A;  4RGU A;  3ZMV A;  1UCR A;  1J0R A;  3TO6 A;  2D1H A;  3HTS B;  4HX4 A;  3BWG A;  4RB1 A;  5FB2 A;  3LAJ A;  4CIC A;  4O5V A;  1KYW A;  3FZV A;  3VB2 A;  4A6E A;  3SZT A;  3KLO A;  1HKQ A;  3H92 A;  2COM A;  1Z9C A;  1XD7 A;  2HYF A;  2RDP A;  1U5T C;  3FMQ A;  1V3F A;  4WXH A;  3QU6 A;  1I5Z A;  1ZRF A;  2RKH A;  2KJC A;  4KIF A;  3DQV C;  5K5Q A;  3LQR A;  3WU1 B;  1FYK A;  1TW2 A;  5ICF A;  5ILV A;  3WGG A;  3LFK A;  2UXX A;  1IZ1 A;  1XMK A;  1Z91 A;  2QUF A;  2F2E A;  2ZXJ A;  3C18 A;  1HQC A;  4IJA A;  2E7W A;  1ZH5 A;  4S04 A;  2HQN A;  1J75 A;  3GF2 A;  1EH6 A;  4RGS A;  3QPT A;  3GVA A;  4G9Y A;  1ZAO A;  1ON1 A;  4BHB A;  1FSE A;  1LEB A;  3IWF A;  3VOD A;  3KFW X;  1RNL A;  4HA8 A;  2XKO A;  4GXO A;  2HR3 A;  3WTX C;  4BQA A;  2Z33 A;  4XSX F;  1K78 A;  1ODD A;  3LWF A;  1NHA A;  3J80 Z;  5H6R A;  3F23 A;  1I27 A;  4U0Y A;  3N97 A;  3ISP A;  2XUB A;  1BBY A;  3HUG A;  3T8T A;  2DQR A;  3KEO A;  2MA3 A;  5LHI A;  1FYL A;  4NQW A;  4G7Z F;  2A6E F;  3PQK A;  4HF2 A;  1XGO A;  4I09 A;  3EYY A;  3H3Z A;  2W85 A;  1T6S A;  4CXF A;  4LLG F;  3F8N A;  4JQF A;  5FD5 A;  3WTU C;  4NHJ A;  1W4M A;  2FMY A;  2F5D A;  3HOT A;  5HLI A;  4A6D A;  1WI9 A;  2VT3 A;  2QQA A;  5CVR A;  3G73 A;  1XSX A;  3GFI A;  2PMU A;  3RIR A;  4E70 A;  4IF4 A;  2VOD A;  5JFR A;  2VT2 A;  2HKO A;  3F21 A;  1ZGJ A;  3CUQ A;  4HQM A;  1WQ2 A;  2OBP A;  2QYO A;  2EJR A;  2HZT A;  2RC4 A;  1S7A A;  2LSO A;  3RDI A;  3DEU A;  1DUX C;  2LF7 A;  2DPD A;  1R1T A;  3HRS A;  2STT A;  2V1U A;  3DF8 A;  5E1X A;  1B1B A;  1TBX A;  3C3W A;  3REO A;  1ZRC A;  1UFM A;  1D8K A;  2H6C A;  4EM2 A;  4A0X A;  4ZZD A;  5K1Y A;  3OV8 A;  3ML6 A;  4FX4 A;  2R7F A;  2RNJ A;  3M8E A;  4HV6 A;  2G9W A;  5E8I A;  4JBA A;  2QWW A;  4BNC A;  2KIM A;  3GFL A;  3EQL F;  4KFC A;  4EMS A;  1R1V A;  4I01 A;  4WX9 A;  2MC3 A;  1B59 A;  4I98 B;  4F7Z A;  4P96 A;  2MLK A;  2GIV A;  2PBI A;  1ZHF A;  5DD8 A;  5IT9 Z;  4UV8 A;  5FGM A;  2QQB A;  3GYH X;  1UB9 A;  5HS8 A;  5CLS A;  4BAY A;  2DFI A;  1QZZ A;  3U2R A;  5LHH A;  4Q47 A;  2V9V A;  3I54 A;  3WTY C;  2CW0 F;  3L7W A;  2DO7 A;  5DYM A;  3FWE A;  4ENK A;  5L3D A;  3HRT A;  3OOP A;  4RAY A;  4KT5 C;  5AON A;  5DCF A;  3V4G A;  2VN2 A;  3F3X A;  4EGY A;  2EFQ A;  5LEJ A;  2EV0 A;  3D0S A;  1F5T A;  2C6Y A;  4P5O A;  1IXC A;  1XGM A;  3FM5 A;  2A07 F;  4OMY A;  4Q48 A;  1FZP B;  3ZMD A;  1X3U A;  5AIP A;  2GXB A;  1FNN A;  1IN5 A;  1MD0 A;  3R61 A;  4HLY A;  3O3K A;  1XGS A;  1R1U A;  1FWZ A;  1S6L A;  2FNA A;  3QAH A;  2PQ8 A;  2ZKZ A;  4HYE A;  1ZAR A;  4OOI A;  2V79 A;  3E6D A;  2XRO A;  4KUM A;  4EQQ A;  1T98 A;  5HDK A;  4LFU A;  3WTW C;  3F8F A;  1P4X A;  2OQG A;  1O3T A;  1B9N A;  1A04 A;  4LK1 F;  5IT9 K;  2P5V A;  4H0E A;  2ZME B;  1MJ9 A;  4YG2 F;  1PUE E;  4KMF A;  1ZG1 A;  2NS0 A;  2NNY A;  1FOK A;  1J2X A;  1OYW A;  1ZRE A;  2O3F A;  2L3D A;  3QP6 A;  4ZYH A;  2LF8 A;  1U5T A;  1TTY A;  5DD4 A;  1R5G A;  4MGR A;  1G3T A;  4YII A;  5BPI A;  3FMR A;  3RTR A;  5CVV A;  3V8K A;  4OMZ A;  4LJZ F;  3GUD A;  4B8X A;  2YR2 A;  1KU3 A;  4EM0 B;  2OQR A;  2Y75 A;  3HSR A;  4OIN F;  1MKM A;  4M9S A;  5JR3 A;  3DV8 A;  2ZCW A;  4YFN F;  4QLC U;  2QZ8 A;  2F5C A;  3WTZ A;  2CG4 A;  3WGI A;  2BV6 A;  3MEX A;  2OAZ A;  5LGT A;  3ECH A;  3L09 A;  4PDK A;  2WWY A;  2P7C B;  3WE2 A;  1XN7 A;  4KN7 X;  1FBS A;  4MEX F;  4WWC A;  1KQ9 A;  1JE8 A;  1J7K A;  1O57 A;  1U2W A;  1TQM A;  5HOO A;  1BM9 A;  3G3Z A;  4BHC A;  3KP5 A;  2QM3 A;  1G3W A;  3CTA A;  3GO5 A;  2XIG A;  1UHW A;  2QEN A;  4UV9 A;  3ELK A;  4EVI A;  5HLH A;  5BS6 A;  2F5E A;  2E7X A;  2Z3Y A;  4A0Z A;  1HKS A;  1ON2 A;  4TV7 A;  4A5N A;  3AAF A;  4L9T A;  3BP8 A;  2EA2 A;  2J5P A;  1K79 A;  1S8N A;  1MDM A;  3SHF A;  5D5U B;  4N9I A;  1J9I A;  3BRO A;  3P9C A;  2A6H F;  2K4B A;  3F8M A;  2P4W A;  2PN6 A;  2QBY B;  2YPR A;  3T8R A;  2VOP A;  1BIA A;  4R1H A;  1I1G A;  4YIF A;  1R58 A;  1IRG A;  1I1S A;  2JSC A;  2V1D A;  1H9G A;  2EB7 A;  2PG4 A;  1HW2 A;  2A3S A;  1KU9 A;  2D1V A;  3LST A;  1BJA A;  1LDD A;  1SD4 A;  2FML A;  1TNT A;  2BE5 F;  2Q8K A;  1IN4 A;  1IN6 A;  3JW4 A;  3M1E A;  3HTU A;  3QP5 A;  5LRR A;  3BJO A;  5ILS A;  1ZG3 A;  1P2F A;  3GZ6 A;  2ZBK A;  3GZ5 A;  3V7C A;  4RAZ A;  2K7L A;  1W7P D;  4HF0 A;  4RB2 C;  2MH9 A;  5LEK A;  3WTT C;  2W25 A;  1P4W A;  1BI0 A;  3V8J A;  1YLF A;  3JTG A;  2Z5U A;  4XLP F;  3KP2 A;  2IA0 A;  4CYD A;  3QRF F;  1TLH B;  4I02 A;  2RVC A;  1ZRD A;  4IHT A;  3IKV A;  4BH9 A;  2CSO A;  1D3Y A;  1FP1 D;  5HLG A;  3JAM Z;  1GXQ A;  3GXO A;  3CLO A;  3SFZ A;  3BY6 A;  5E8G A;  2A68 F;  1HW1 A;  1LVA A;  2HYG D;  4HW0 A;  2O61 A;  2DK5 A;  2BEO A;  1FYM A;  5F6F A;  3E97 A;  4UNO A;  3QPH A;  1EV7 A;  4U7B A;  5EEH A;  2STW A;  1JHH A;  5F1R A;  3SZP A;  1SMY F;  2ZME A;  4OIP F;  1ZLK A;  1KGS A;  4YFK F;  3FXR A;  4KYW A;  2XHK A;  1FP2 A;  1T0F A;  1MJA A;  3IRQ A;  1W5T A;  4L9N A;  3E3V A;  4ZH4 F;  1XCV A;  1WWX A;  1BIB A;  1ZYR F;  5D5W B;  3NEU A;  2CGP A;  1JHF A;  1PDN C;  2R7D A;  1WRJ A;  4M71 A;  5DCM B;  2AS5 F;  3I59 B;  3WTS C;  1S3J A;  4M74 A;  5JVT A;  2M8E A;  1K7A A;  5ICG A;  3HSE A;  2ACJ A;  5JHU A;  3HIF A;  2VBW A;  2CQK A;  5DEQ A;  4XLN F;  1TQP A;  2MBF A;  1T39 A;  1SD6 A;  2ADU A;  4HQE A;  4YFX F;  3BZ6 A;  3MZY A;  2PMH A;  5DV5 A;  3I64 A;  3R0A A;  2LKP A;  4IXA A;  1BI3 A;  4S05 A;  1Q1H A;  3I53 A;  5K5R A;  5DUK A;  2KIU A;  4I7H A;  1V4R A;  1IRF A;  2HS5 A;  2D2W A;  1EH7 A;  3K1P A;  4AIK A;  1Z6R A;  2A5Y B;  3E6M A;  5LBQ A;  4U0W A;  1YYV A;  2Q2E A;  2ZFW A;  4ZYD A;  5JI6 A;  1CF7 B;  4LB6 B;  4A5M A;  3BPV A;  1YG2 A;  1MGT A;  4CHU A;  3Q5F A;  1R00 A;  3V7R A;  4ZZL A;  4Z2Y A;  3EDP A;  1HBX G;  1KQ0 A;  3I4P A;  6PAX A;  3SQN A;  4MNU A;  3BDD A;  1L3L A;  4EJT A;  1L0O C;  3J81 Z;  4WXC A;  3ZPL A;  3KP3 A;  5E17 F;  3CJN A;  2IP2 A;  2H6B A;  1Z1D A;  4KN4 X;  3S2W A;  4G7O F;  4I2O A;  3WU0 A;  3ABU A;  5J8C A;  3MFK A;  3D5L A;  2YU3 A;  4KIC A;  5D5V B;  2K02 A;  1ZN2 A;  5L3F A;  1IXR C;  3TDU C;  1P4A A;  1R36 A;  4UUV A;  4MTE A;  2UXN A;  3VEP A;  3I59 A;  1XDU A;  2NNN A;  2ISY A;  2BBY A;  3IL2 A;  4LMY A;  1HST A;  1BI2 A;  1RZ4 A;  3KLN A;  3NQO A;  2UWM A;  1LJ9 A;  2FNP A;  3FXQ A;  3B02 A;  3K1N A;  2P6S A;  3BPX A;  4OU0 A;  4OIO F;  4PCQ A;  2M87 A;  2L01 A;  1QPM A;  3DXJ F;  4Q4Z F;  4B09 A;  1W5S A;  3TDZ C;  4WK8 F;  2IT0 A;  2FBK A;  1MDM B;  2V1X A;  2P7V B;  1XSV A;  4P9F A;  4I0A A;  2E1N A;  4EJW A;  2JPC A;  5HVQ C;  4G6Q A;  5E1Z B;  3C1D A;  4A0Y A;  4ENM A;  1XB4 A;  2Z9O A;  2H94 A;  3JTH A;  2PFB A;  3NRV A;  4HZF A;  2UZK A;  1YS7 A;  2H09 A;  1KA8 A;  2L02 A;  3CO7 C;  2EFN A;  3RPQ A;  1P92 A;  1B6A A;  4CO8 A;  1DPR A;  1OMI A;  1PP7 U;  1YW9 A;  2GWR A;  5KK1 A;  3U1D A;  2XGX A;  4EJV A;  5J8F A;  2CO5 A;  3IKT A;  1XGN A;  4RS8 A;  3F6V A;  4Q5S F;  3LA2 A;  2YX4 A;  3VFZ A;  3JAM K;  3RKW A;  1HW5 A;  1Z6T A;  5ILU A;  1FT9 A;  3K1M A;  4EJU A;  5K5O A;  1RI7 A;  1R22 A;  2F5F A;  5D6E A;  3TGN A;  3JSP A;  3P7N A;  2L54 A;  3GFJ A;  1JGS A;  4M72 A;  4GYI A;  1Y0U A;  2W24 A;  3EET A;  3PFI A;  3I0T A;  4LD5 A;  4RB0 A;  3RKY A;  3CDH A;  3T5X A;  2FSW A;  1E17 A;  1YQA A;  2HEO A;  4L0Z B;  1G6N A;  2G7U A;  5L3B A;  5CVU A;  4G6D A;  3WOD F;  3VOE A;  2L4M A;  1MZB A;  3LAP A;  2V6C A;  3F22 A;  2BGC A;  1UST A;  2XAJ A;  4AWX B;  2DQL A;  1PP8 F;  3KZZ A;  3U9G A;  1Z05 A;  1I6X A;  2M30 A;  4HLX A;  2EV5 A;  4KNY A;  1SFE A;  3DPT A;  4O6J A;  5LHG A;  4G94 A;  2RV8 A;  1OR7 A;  1FPQ A;  2P8T A;  3V7S A;  4NB5 A;  5D4S A;  2DT5 A;  5CVJ A;  1ULY A;  1IW7 F;  4L5I A;  2Z99 A;  4FX0 A;  2JZY A;  1XCB A;  3MZH A;  3P9K A;  1SFX A;  3R4K A;  4FT8 A;  3LA3 A;  3KP6 A;  3EYI A;  2O03 A;  4FHT A;  2DBB A;  2TDX A;  1E2X A;  4DNC A;  3F72 A;  3GX4 X;  4WCG A;  1VTN C;  1R7J A;  5ICC A;  3E5X A;  2D45 A;  3RYP A;  2WV0 A;  1KU2 A;  2ZO4 A;  4HAM A;  2ZNZ A;  4GO1 A;  4MTD A;  4L5J A;  5ED4 A;  1O7L A;  2NAZ A;  2PJP A;  4ASN A;  4L0Y B;  4R8H A;  3KP7 A;  3KP4 A;  5D4R A;  3ECO A;  2GZW A;  3FHZ A;  1UHM A;  4XRF A;  4KIG A;  4MEY F;  2VBZ A;  4EM1 A;  1U3E M;  3K0L A;  2VXZ A;  1P6R A;  1U78 A;  2WC2 A;  4PZJ A;  3ZN1 A;  4ESJ A;  1J5Y A;  1BN5 A;  2CYY A;  3CUQ C;  3HYI A;  2MD5 A;  5DUI A;  4M9X A;  2CFX A;  2QBY A;  4UHT A;  4A12 A;  2X4H A;  1AWC A;  2J5O A;  2QQ9 A;  3GLX A;  3HHG A;  3R0J A;  3ROU A;  3SXY A;  2KRF A;  2O6G E;  2HTS A;  3DP7 A;  3L2C A;  1G3Y A;  1SMT A;  1REP C;  2HQR A;  1ZG5 A;  4ENN A;  3ABT A;  1T2K A;  1RIO H;  2ESH A;  2HOE A;  2BYV E;  4UVB A;  3TO9 A;  5DCM A;  2XAQ A;  2LNB A;  2EV6 A;  5BOX A;  3MAJ A;  5DDG A;  2IA1 A;  4KIB A;  4N9H A;  3O2P E;  2JTV A;  2OZ6 A;  1HKT A;  2FF4 A;  2VE8 A;  4L9J A;  2M5W A;  4IVN A;  2WTE A;  2HTJ A;  4CGZ A;  2DK8 A;  3E6C C;  1LB2 A;  5LRS A;  3TOA A;  3F8B A;  1QO0 D;  2FXA A;  1ONV A;  4IRG A;  4IHS A;  3KZY A;  3KET A;  3DPL C;  3M8F A;  4CDG A;  2XAF A;  4LLN A;  3FX3 A;  4L18 B;  2G7H A;  5F64 A;  1TW3 A;  4Y13 A;  3CO6 C;  2DAO A;  3ZN0 A;  1JXS A;  3K2Z A;  1YO5 C;  2FOK A;  2OZU A;  3R6S A;  3KEQ A;  4RGR A;  5KVR A;  1ZLJ A;  2IPQ X;  2X0L A;  5HS9 A;  2ESN A;  1OYY A;  1KU7 A;  1LQ1 A;  4U88 A;  2XRN A;  2A61 A;  2B0L A;  3MWM A;  1RUO A;  5FFX A;  2DU9 A;  4ETS A;  4Y15 A;  4MQV A;  2ELH A;  4LB5 A;  1XDS A;  3LA7 A;  4JK1 X;  1QNT A;  2VBY A;  2GQQ A;  2VE9 A;  2PEX A;  5ERI A;  2EK5 A;  2MH2 A;  5H6Q A;  1J59 A;  1KYZ A;  1TQI A;  3N4M A;  2KJB A;  1YIO A;  1WKM A;  5AIQ A;  2JRT A;  3CUO A;  1F4K A;  2FEZ A;  3WTV C;  3ZQ7 A;  1YS6 A;  5BQT A;  2FE3 A;  4KMU X;  3ERE D;  1FBQ A;  1BI1 A;  3RKX A;  4ESF A;  3CUQ B;  2PI0 A;  2DLL A;  2MLG A;  2Y0M A;  2YX7 A;  3ZP5 A;  5E20 A;  1OYI A;  3K9T A;  5A2Q K;  3KE2 A;  4R79 A;  3HRM A;  3ULQ B;  3K69 A;  2QVO A;  2NRA C;  3WE3 A;  3L9F A;  2PLY A;  1GXP A;  3KCC A;  3T0Y A;  2IRF G;  2L4A A;  2NYX A;  1GHC A;  3J7A O;  5L3E A;  2YSR A;  4KA4 A;  4D0P A;  4P55 A;  4AVP A;  2FU4 A;  1D5V A;  2K27 A;  3RI4 A;  4HX8 A;  5L3G A;  4LG0 A;  1B9M A;  2ISZ A;  5E18 F;  3GEZ A;  2JPB A;  2O0Y A;  1C0W A;  4MHG A;  2GA1 A;  3FF5 A;  3I71 A;  2P6T A;  1USS A;  2VC0 A;  3HHH A;  2ETH A;  1OPC A;  2RQP A;  1SD5 A;  1O7F A;  1B4A A;  3E5Q A;  4M6Y A;  3IWZ A;  3J80 K;  3GW2 A;  4U0V A;  2M1B A;  3TO7 A;  2IVM A;  3ZMU A;  5D8K B;  3I5U A;  3H3U A;  4BXU A;  3T1B A;  4AIH A;  3PQJ A;  4GYG A;  4UVA A;  2W84 A;  3ZMT A;  3BOQ A;  3I58 A;  4LK0 F;  3ZMZ A;  2H27 A;  1AOY A;  3BJA A;  1QZY A;  3RPU A;  1IXS B;  3WG9 A;  4BHP A;  2EFP A;  4ZYE A;  2EA4 A;  2GXG A;  3E5U A;  1K78 B;  1U5T B;  5ICE A;  2HGC A;  1H0M A;  1FC3 A;  5L3C A;  1XSD A;  2VOO A;  2FA5 A;  5D6F A;  2XAG A;  4GCV A;  4HX7 A;  2FBH A;  5TJJ A;  2JT1 A;  1DDN A;  5A2Q Z;  3RJP A;  2DI3 A;  3FM3 A;  4WXD A;  2DTR A;  1MJB A;  4HV5 A;  1OKR A;  1IN7 A;  1CGP A;  2K86 A;  1G4D A;  1YW8 A;  2GA2 A;  5EEG A;  1LNW A;  2IA2 A;  1BC7 C;  1F1Z A;  2FRH A;  4N0B A;  3Q9S A;  4GGG A;  2P5K A;  5IT3 A;  1FY7 A;  3B73 A;  1S29 A;  3R60 A;  2FBI A;  4QWQ A;  2EFO A;  4RGX A;  5E1W A;  2M45 A;  3O6B B;  1KQ8 A;  1FLI A;  5BPD A;  5FLX Z;  1EH8 A;  3L00 A;  1XMA A;  5D8L B;  2ZNY A;  5FFZ A;  1S7O A;  3W6J B;  4P9U A;  4Y17 A;  5HDG A;  2FQ3 A;  4G7H F;  3WGH A;  5FO5 A;  2AXL A;  4HDU A;  1QGP A;  4LGW A;  3W6K B;  4LLL A;  5HS7 A;  4LG0 B;  1HSJ A;  2HDC A;  5CJ9 A;  4UXN A;  3F8C A;  2EFW A;  2VC1 A;  1IN8 A;  2XKP A;  2HKX A;  1HXD A;  5FD6 A;  3J81 K;  5CYV A;  1T38 A;  1QBJ A;  4EGZ A;  1LDK B;  4MQ9 F;  3COA C;  1R5H A;  4CZZ A;  4XBF A;  1YW7 A;  1O3R A;  4PGH A;  3GWZ A;  2HWV A;  1W7P B;  1FSH A;  4BYY A;  1SD7 A;  5TRD A;  2P5L C;  5LGU A;  4IRH A;  4O3M A;  4HBL A;  3M9A A;  1BC8 C;  4M9Z A;  3DKW A;  5LLQ A;  3QU3 A;  3GFM A;  2XV4 S;  4IRI A;  2RGV A;  2XAH A;  2GAU A;  1U6G A;  3P9I A;  4K2E A;  5D5X B;  5FLX K;  1G3S A;  5HDN A;  2K4J A;  4U7D A;  1LDJ A;  1U8R A;  4KDP A;  3LQQ A;  1SAX A;  1FBU A;  2E1C A;  4HDV A;  4HOB A;  2O8X A;  2A69 F;  2DW4 A;  2LDU A;  1W7P A;  4ON0 A;  4IPA A;  3EUH A;  2Q0O A;  4UVC A;  3MCZ A;  2XAS A;  2ZJ2 A;  1IF1 A;  3IC7 A;  5BMZ A;  2CWE A;  2OD5 A;  1ZGA A;  3QOP A;  3HSF A;  3C7J A;  2XVC A;  4EJO A;  1DP7 P;  1CF7 A;  4ENJ A;  1K6O A;  2IJL A;  1DPU A;  2DPU A;  1GVJ A;  4A2U A;  1QQI A;  1SFU A;  1D8J A;  1TNS A;  2VBX A;  2HFH A;  3TKY A;  1IUY A;  1Z7U A;  1O3Q A;  3E6B A;  1R23 A;  3TQN A;  1F9N A;  4OIQ F;  2W57 A;  4XSZ F;  3IHU A;  4M6X A;  5H20 A;  4I0B A;  2KIF A;  3FXU A;  3V8L A;  3HOS A;  2OA4 A;  1BOA A;  5J6X A;  4OIR F;  5CVI A;  2VON A;  3MQ0 A;  4G8X A;  3IRR A;  4ZYG A;  3DFG A;  2Y48 A;  4M73 A;  1WSU A;  3ZMS A;  1FX7 A;  2IW5 A;  3JSO A;  4PGG A;  4AIJ A;  3M7G A;  4RB3 C;  2OU2 A;  3BJ6 A;  3Q9V A;  4ESB A;  1YFH A;  1YTY A;  1IAW A;  3FMS A;  5LGN A;  1LEA A;  2EWN A;  4DQ2 A;  2RN7 A;  1H9T A; 
#chains in the Genus database with same CATH topology
 2K9L A;  2CFO A;  4L9V A;  4WF2 A;  3MVP A;  4BJ5 C;  4XM3 A;  3G1M A;  4AD9 A;  1O3S A;  5GPA A;  3MMY B;  2R3S A;  4EV0 A;  2KKO A;  1RUN A;  4F91 B;  3GCM A;  3F6O A;  3TOB A;  2QLZ A;  1DU6 A;  3RYR A;  1STZ A;  3PUB A;  4HF1 A;  3HRU A;  4RGU A;  3ZMV A;  3L2Q A;  3DPU A;  1UCR A;  4IZZ A;  1TP4 A;  3BR2 A;  2LR8 A;  1WJB A;  1I3Q J;  2EZH A;  4BKX A;  1J0R A;  2GXA A;  3TO6 A;  2D1H A;  3HTS B;  2VJ5 A;  4J00 A;  3BQY A;  2HQ5 A;  4XID A;  4HX4 A;  3BWG A;  4RB1 A;  4CCN A;  5FB2 A;  2ELJ A;  4PSX A;  3LAJ A;  1LFP A;  2X6W A;  4CIC A;  3A01 B;  4O5V A;  2YS9 A;  1KYW A;  3HG9 A;  3G2B A;  3FZV A;  3VB2 A;  4A6E A;  3SZT A;  5EG0 B;  2VI6 A;  1HKQ A;  2NOJ B;  3KLO A;  3W2W A;  2VJJ A;  3H92 A;  1X2N A;  3CDI A;  4B3X A;  2COM A;  4DZP A;  1Z9C A;  1XD7 A;  1WI3 A;  5GTH C;  2HYF A;  2LLK A;  1U5T C;  3FMQ A;  2RDP A;  3S2H J;  1SVO A;  2JQ7 A;  1V3F A;  4WXH A;  3QU6 A;  3J7Z I;  1I5Z A;  1ZRF A;  4GRI A;  2RKH A;  2KJC A;  1QRY A;  4KIF A;  5F1J A;  2VL8 A;  3DQV C;  5K5Q A;  3HOX J;  3CC2 I;  3LQR A;  3OYI A;  3S15 J;  3WU1 B;  3JRI A;  1FYK A;  1TW2 A;  5EG0 A;  5ICF A;  3HOU J;  2K5C A;  2LC2 A;  5KAF C;  5ILV A;  2BXY A;  3WGG A;  2CUE A;  2M4G A;  2MC4 A;  2VKE A;  3LFK A;  4FIS A;  2UXX A;  5J4V A;  4CCJ A;  3K70 D;  1IZ1 A;  1XMK A;  3PNT A;  3PSF A;  1QHH D;  1Z91 A;  2P0W A;  2QUF A;  3QQA A;  5FJ8 J;  2F2E A;  2KZG A;  4E6K G;  2ZXJ A;  1OCC H;  3C18 A;  2BVM A;  2CV2 A;  1PUF A;  1S7E A;  4BEH A;  1HQC A;  2I8D A;  3TBI A;  5LD2 C;  4IJA A;  2MYS A;  2E7W A;  3GTJ J;  3HBL A;  1X1B A;  3UNG C;  2LRD A;  1UAA A;  1ZH5 A;  3S1R J;  1I50 J;  3X2Q H;  4AYB A;  4S04 A;  2HQN A;  3L2V A;  1YIJ I;  3B6A A;  4AVZ A;  2VUM J;  1J75 A;  3GF2 A;  3EPZ A;  1EH6 A;  4RGS A;  3QPT A;  2KP6 A;  5J4Y A;  2LFB A;  2HYJ A;  3GVA A;  5E3L A;  3QYF A;  4G9Y A;  3RCO A;  1ZAO A;  4IOA F;  2W4S A;  1ON1 A;  5C3E J;  4BHB A;  2NS7 A;  1FSE A;  3SDB A;  1LEB A;  3IWF A;  3VOD A;  4C2T A;  1XMX A;  3KFW X;  1RNL A;  4HPQ A;  4HA8 A;  2LKX A;  2XKO A;  4GXO A;  3OYF A;  2HR3 A;  5M3M J;  3WTX C;  4BQA A;  4DBQ A;  2Z33 A;  5GP9 A;  4XSX F;  4CCK A;  1K78 A;  1ODD A;  3JRB A;  1QHG A;  2R5Y B;  2DMU A;  1NHA A;  3LWF A;  3OYJ A;  1BR1 A;  2PJR A;  1HF0 A;  1ERD A;  3J80 Z;  1Z7L A;  2DOF A;  5H6R A;  1SFK A;  1SFO J;  1EF4 A;  4HNT A;  3F23 A;  1I27 A;  2L9V A;  2OJE D;  3S3M A;  4U0Y A;  3CP8 A;  3BT9 A;  3N97 A;  1SAN A;  3ISP A;  2XUB A;  1LFB A;  1BBY A;  4XN3 A;  3HUG A;  3T8T A;  3A02 A;  2DQR A;  3KEO A;  2LTP A;  1A35 A;  1XX5 A;  4HSR A;  3AG4 H;  1BW5 A;  2MA3 A;  5LHI A;  1FYL A;  3KX2 A;  3HKZ N;  4XOP A;  2ID6 A;  5B5E C;  4NQW A;  2QQ8 A;  3MD2 A;  5GAG J;  4G7Z F;  2AQF A;  4RMN A;  2A6E F;  2WAQ N;  1I3A A;  3PQK A;  1RPW A;  1Y8Q B;  5J1Y A;  4HF2 A;  1XGO A;  3BC8 A;  1NTC A;  4I09 A;  3TL4 X;  3OIO A;  5E3O A;  3EYY A;  3H3Z A;  2W85 A;  3TP0 A;  1T6S A;  4CXF A;  2EIN H;  4LLG F;  4X6A J;  2CMP A;  3F8N A;  4JQF A;  4PJJ A;  5FD5 A;  3WTU C;  3CCU I;  2TRT A;  4P1W A;  2R7W A;  4A3K J;  1D5Y A;  2HDD A;  2KDO A;  4FE4 A;  4NHJ A;  1W4M A;  2R7S A;  2VQG A;  2FMY A;  2F5D A;  3HOT A;  5HLI A;  4A6D A;  1WI9 A;  2VT3 A;  5EGO B;  4BE0 A;  2YUS A;  1ETW A;  1D0Z A;  2QQA A;  2BVL A;  1MMG A;  5CVR A;  3G73 A;  1XSX A;  3GFI A;  2R7R A;  4XLC A;  2PMU A;  2KHM A;  2HXI A;  1XG1 A;  3UR3 C;  2DA6 A;  4A3I J;  2IS1 A;  3RIR A;  4E70 A;  4IF4 A;  2VOD A;  2KZV A;  3ZXS A;  5JFR A;  2WAE A;  2VT2 A;  1RR7 A;  2HKO A;  2QSF X;  1ZGJ A;  2XRL A;  3CUQ A;  3PUF A;  3F21 A;  3CCM I;  2R0Q C;  1LE8 A;  3ZQL A;  4HQM A;  3SEZ A;  2DOD A;  2V9K A;  3GLL A;  4MLO A;  1POG A;  1WQ2 A;  2OBP A;  2QYO A;  2EJR A;  2HZT A;  2RC4 A;  1TC3 C;  1S7A A;  2LSO A;  4QPO A;  3RDI A;  3DEU A;  4YIR X;  4NC7 A;  1DUX C;  1R5I D;  1X2M A;  1P7I A;  2LF7 A;  2VQH A;  2DPD A;  1R1T A;  3QOD A;  3HRS A;  1LE8 B;  2STT A;  2V1U A;  4XLA A;  3DF8 A;  5E1X A;  5GAD J;  1B1B A;  3E1S A;  1OJL A;  1JI8 A;  1TBX A;  3ZQF A;  3C3W A;  3REO A;  1ZRC A;  1UFM A;  1D8K A;  2H6C A;  4EM2 A;  4I76 A;  4A0X A;  3S1M J;  3H1C A;  4ZZD A;  1N25 A;  1D0X A;  5K1Y A;  4OWR B;  3OYA A;  2DT7 B;  3OV8 A;  3ML6 A;  2JRM A;  4FX4 A;  3ABK H;  1T56 A;  2BY1 A;  1MSF C;  1X4P A;  2R7F A;  2RNJ A;  3M8E A;  2HNH A;  4HV6 A;  2G9W A;  2H1L A;  5E8I A;  4JBA A;  3W6V A;  2QWW A;  3OS0 A;  4BNC A;  5K7H A;  2KIM A;  3GFL A;  3OWT A;  1R4N B;  3EQL F;  2HI3 A;  4EMS A;  1NK2 P;  1R1V A;  3LNQ A;  4KFC A;  4I01 A;  4WX9 A;  3AFH A;  4MFE A;  2XGD A;  2MC3 A;  3VYR B;  1B59 A;  4I98 B;  4F7Z A;  5J40 A;  1D0Y A;  4P96 A;  2MLK A;  2QA4 I;  3KYD B;  2GIV A;  2PBI A;  4M3E A;  1ZHF A;  5DD8 A;  2KQR A;  5IT9 Z;  4UV8 A;  1X1A A;  5FGM A;  1H89 C;  2QQB A;  1TT5 B;  1UB9 A;  3GYH X;  5HS8 A;  3K4N A;  5CLS A;  3H5R A;  4BAY A;  2E35 A;  1G8X A;  2O7O A;  2DFI A;  2L2O A;  3DCF A;  1QZZ A;  3U2R A;  1GDT A;  5LHH A;  4Q47 A;  2V9V A;  3OYM A;  3I54 A;  3WTY C;  2CW0 F;  3L7W A;  1VQ9 I;  1VQN I;  3GTQ J;  2DO7 A;  5DYM A;  3FWE A;  4ENK A;  4OAZ A;  5L3D A;  3HRT A;  3OOP A;  4RAY A;  4KT5 C;  4FQG A;  5AON A;  5DCF A;  3V4G A;  2VN2 A;  2FOW A;  5EGO A;  3F3X A;  3MKW B;  2EFQ A;  1X19 A;  5LEJ A;  4EGY A;  2EV0 A;  3D0S A;  3F9K A;  1F5T A;  4NDL A;  4PFO A;  2C6Y A;  3G1L A;  1I6H J;  2R4G A;  2OF7 A;  3FHN A;  4P5O A;  1IXC A;  1XGM A;  1YRN A;  1MBJ A;  3FM5 A;  4U87 A;  5TGT A;  2A07 F;  4Q48 A;  4OMY A;  2E36 A;  3HPG A;  5FKO A;  1FZP B;  2BZT A;  2W48 A;  3ZMD A;  1X3U A;  3JRE A;  5AIP A;  2BY2 A;  2GXB A;  1MND A;  1FNN A;  2DOA A;  1IN5 A;  1MD0 A;  2V26 A;  3OR1 C;  3D5R C;  4IHY A;  3R61 A;  2VPL A;  2LVS A;  1MMD A;  4HLY A;  3O3K A;  1XGS A;  3TP3 A;  1R1U A;  1YJ9 I;  4BAC A;  1FWZ A;  2X6X A;  1S6L A;  3HUG B;  4EAT A;  5K7Z A;  2FNA A;  3QAH A;  2PQ8 A;  2ZKZ A;  4HYE A;  1ZAR A;  1O4X A;  2FUG 2;  4OOI A;  4A3L J;  2V79 A;  2DCE A;  4MFD A;  3E6D A;  4S0H B;  2XRO A;  3VYU B;  5FLM J;  4F93 B;  1WFX A;  4KUM A;  4PSW A;  4ANJ A;  4EQQ A;  1A6I A;  1T98 A;  2Y0S N;  3KZI C;  5HDK A;  1JGG A;  4LFU A;  1VQ5 I;  3WTW C;  3F8F A;  4E7Z A;  2IS4 A;  1P4X A;  3BR3 A;  2OQG A;  1O3T A;  1AKH B;  4PJN A;  3TMO A;  2DYS H;  4XKV A;  1B9N A;  1A04 A;  4LK1 F;  3HOZ J;  2XPW A;  1MBF A;  2I10 A;  2P5V A;  4H0E A;  5IT9 K;  1ZGW A;  1MMA A;  2ZME B;  4JX5 A;  5JLX A;  2KT0 A;  3DKY A;  1MJ9 A;  5B3S H;  3D1N I;  4YG2 F;  1PUE E;  4KMF A;  1ZG1 A;  2Y30 A;  3RSN A;  2NS0 A;  2NNY A;  1GVD A;  1FOK A;  4IHV A;  2IAI A;  1J2X A;  1OYW A;  2E2I J;  1ZRE A;  1MBE A;  1R49 A;  3A0B C;  4BJT A;  2O3F A;  2L3D A;  4XLF A;  3QP6 A;  3FKI J;  1XPX A;  4HRI A;  3WG7 H;  1G59 A;  4F3Q A;  3ZQC A;  4ZYH A;  2LF8 A;  1U5T A;  3S14 J;  1TTY A;  4PJM A;  5DD4 A;  1R5G A;  1X1P A;  4MGR A;  1G3T A;  5JLW A;  4YII A;  5BPI A;  3FMR A;  4BXF A;  4V19 K;  2M8G X;  3RTR A;  4II2 A;  3C2H A;  5EEA A;  1MIJ A;  5CVV A;  3V8K A;  4OMZ A;  2OTL I;  2B63 J;  2VJ4 A;  4FET A;  4LJZ F;  3GUD A;  5FKN A;  1AHD P;  3LMM A;  4B8X A;  2IGO A;  2KDZ A;  2YR2 A;  2JA5 J;  1KU3 A;  4D7M A;  4W97 A;  4EM0 B;  2OQR A;  2Y75 A;  3OIP A;  2BXZ A;  5F0H A;  1W1W E;  3HSR A;  1X1D A;  4OIN F;  4BQN A;  1OLT A;  1MKM A;  4M9S A;  5JR3 A;  3DV8 A;  2ZCW A;  4YFN F;  4QLC U;  5FRN A;  2QZ8 A;  4BQQ A;  2XGC A;  2F5C A;  3WTZ A;  3TW7 A;  2CG4 A;  3WGI A;  2FJ1 A;  1WPK A;  2BV6 A;  1VQO I;  3MEX A;  2LY1 A;  2OAZ A;  5LGT A;  4A3F J;  3ECH A;  1HOM A;  3L09 A;  4PDK A;  2WWY A;  2P7C B;  3KEY A;  3WE2 A;  1XN7 A;  3ZCO A;  2VXD A;  3IAM 2;  1FBS A;  4KN7 X;  4MEX F;  4WWC A;  2M34 A;  1KQ9 A;  1DQU A;  2HU9 A;  4XON A;  4B48 A;  1JE8 A;  3S16 J;  2CS3 A;  1J7K A;  2JVG A;  1O57 A;  1U2W A;  4CZC A;  1TQM A;  2ECC A;  1BM9 A;  5HOO A;  3G3Z A;  3QOE A;  3DTK A;  4BHC A;  3KP5 A;  5KAI C;  2EBI A;  4UY8 I;  3OL3 A;  2QM3 A;  2EZI A;  5DM6 F;  3I3L A;  3FK7 A;  1G3W A;  3CTA A;  3GO5 A;  3PNV A;  2XIG A;  3QYE A;  1VFC A;  4NC6 A;  4IOC F;  3RZD J;  1OCR H;  1UHW A;  2QEN A;  4UV9 A;  2B7E A;  3ELK A;  3BG9 A;  3LFU A;  2CW8 A;  4EVI A;  5BS6 A;  5HLH A;  2F5E A;  2E7X A;  1OCO H;  2DN0 A;  2Z3Y A;  4A0Z A;  3S17 J;  1HKS A;  3RPU D;  1MH3 A;  1ON2 A;  2R7V A;  3L2W A;  4TV7 A;  4N4N B;  4A5N A;  3ZOB A;  4L9T A;  3BP8 A;  3AAF A;  2EA2 A;  2J5P A;  5FRO A;  1K79 A;  3BG5 A;  2QKM B;  1QVT A;  1S8N A;  2E1O A;  2IGN A;  2EIL H;  1MDM A;  1B8I B;  1A36 A;  4D7N A;  1WVR A;  3SHF A;  4N9I A;  5D5U B;  2VJI A;  1J9I A;  5M5W J;  5DS9 A;  5EDN A;  3BRO A;  3P9C A;  2A6H F;  2K4B A;  2L5Q A;  3F8M A;  3FKJ A;  2P4W A;  1S72 I;  2PN6 A;  5CQG A;  2QBY B;  2YPR A;  3T8R A;  2VOP A;  1BIA A;  2G0E A;  4R1H A;  4UB6 C;  1I1G A;  1JKO C;  1FOW A;  4YIF A;  1R58 A;  1IRG A;  1I1S A;  2JSC A;  3MKZ A;  2V1D A;  1H9G A;  2EB7 A;  1HDP A;  3LL7 A;  2PG4 A;  1HW2 A;  1JTX A;  1ZEL A;  2A3S A;  3PO2 J;  1KU9 A;  1W0U A;  2QKL B;  3VWB A;  4XNF A;  2D1V A;  2DA2 A;  3LST A;  3HOY J;  2KPM A;  4I99 C;  4DZJ A;  1S5L C;  1BJA A;  3O8G A;  3HZJ A;  1ETO A;  1LDD A;  3JCU C;  3OYN A;  3H3V K;  1JUM A;  3IUO A;  4XRS G;  1SD4 A;  2FML A;  4CSW A;  1TNT A;  2BE5 F;  2Q8K A;  2XSD C;  1IN4 A;  1IN6 A;  2CUJ A;  3FBI B;  3CDL A;  3JW4 A;  3M1E A;  1PUF B;  3HTU A;  3QP5 A;  2F5V A;  5LRR A;  1IRX A;  4BBR J;  2M3A A;  3BJO A;  1YX5 A;  1MMS A;  2K3P A;  5ILS A;  4RAF A;  4QSH A;  4BQO A;  1ZG3 A;  1P2F A;  3CZ6 A;  3GZ6 A;  2ZBK A;  3GZ5 A;  3V7C A;  2ME6 A;  4RAZ A;  1R9T J;  2XB0 X;  2K7L A;  1T8I A;  3U21 A;  1W7P D;  2XPV A;  2M0C A;  4HF0 A;  2X1E A;  4RB2 C;  2MH9 A;  2V1N A;  2E2H J;  1IUF A;  5LEK A;  3PIO F;  3H0D A;  3WTT C;  2W25 A;  4XR6 A;  3OYD A;  5IOZ A;  1P4W A;  3HJE A;  1BI0 A;  3V8J A;  1YLF A;  3JTG A;  1AU7 A;  3GTL J;  2Z5U A;  4XLP F;  3KP2 A;  1MMN A;  2IA0 A;  4CYD A;  3L1P A;  4A3D J;  4FTH A;  3QRF F;  1TLH B;  3KIO A;  4I02 A;  5HNF A;  3S1N J;  4RA2 A;  2RVC A;  4DW6 A;  1ZRD A;  2HVR A;  4IHT A;  3IKV A;  3JRF A;  3K4M A;  4BH9 A;  2CSO A;  3FXL A;  1D3Y A;  1FP1 D;  2Q2E B;  3ZGK A;  2LY9 A;  5HLG A;  2L0K A;  3JAM Z;  1Y0N A;  2FX0 A;  1GXQ A;  3GXO A;  5HNH A;  3CLO A;  3PO3 J;  3SFZ A;  3BY6 A;  5E8G A;  2A68 F;  2VB6 A;  2DA4 A;  5BNG A;  4ZJZ A;  3H36 A;  3OYG A;  2VIX A;  1HW1 A;  4C9Y A;  3K4K A;  2Y9Z A;  2R92 J;  2XB5 A;  1LVA A;  3DBR B;  2HYG D;  4HW0 A;  2DT6 A;  4KJZ A;  2O61 A;  2WY7 Q;  2DK5 A;  2BEO A;  1FYM A;  3DU5 A;  4CA0 A;  5F6F A;  1QVU A;  3PIP F;  3BTL A;  5GPC A;  3E97 A;  3IV5 A;  4PFP A;  1NH3 A;  4UNO A;  1WH5 A;  1IC8 A;  3QPH A;  1WH7 A;  3DWL E;  4KT6 A;  3U1K A;  1YJN I;  1IDZ A;  2Z2S B;  2ECB A;  4Y3O A;  3HC7 A;  1JT0 A;  1D1B A;  1EV7 A;  2M4K A;  5HOD A;  4U7B A;  2WAQ A;  2DA5 A;  3CME I;  5EEH A;  2STW A;  1JHH A;  2Q1Z B;  3LSI A;  1OCP A;  5F1R A;  3SZP A;  3CMM A;  1ZR4 A;  1SMY F;  2EPF A;  2ZME A;  1NK3 P;  4OIP F;  2OCC H;  1ZLK A;  4J01 A;  1KGS A;  1OR7 C;  2KL4 A;  4YFK F;  3FXR A;  4KYW A;  3JR9 A;  2XHK A;  1B8I A;  1FP2 A;  1T0F A;  4XKB A;  1MJA A;  3PM1 A;  3IRQ A;  1W5T A;  4L9N A;  3E3V A;  4ZH4 F;  1XCV A;  1WWX A;  4C2M J;  1BIB A;  1TWH J;  1ZYR F;  5D5W B;  3NEU A;  2VQC A;  2ZB9 A;  2CGP A;  4XRS A;  4B47 A;  2CRG A;  1JHF A;  1PDN C;  3UKG A;  4D5F A;  2R7D A;  1WRJ A;  5IOY A;  3CCJ I;  4M71 A;  5DCM B;  3I4N J;  3PSI A;  3OSF A;  3LSG A;  2AS5 F;  2ZME C;  3SEQ A;  4J19 A;  4IKF A;  3I59 B;  3WTS C;  2A5W A;  4JP0 A;  2BHZ A;  1S3J A;  4M74 A;  5JVT A;  3G1O A;  2CU7 A;  2M8E A;  2NVU B;  1TWF J;  1WJ5 A;  2XPU A;  1K7A A;  5ICG A;  1T08 B;  3HSE A;  2ACJ A;  4ZDP A;  1TT0 A;  5JHU A;  3HIF A;  2VBW A;  1V54 H;  2CQK A;  4IQJ A;  1R4M B;  5DEQ A;  1FOX A;  5IYB J;  1DGW Y;  3VYT B;  2JUC A;  1ZKG A;  3SDG A;  4XLN F;  1TQP A;  2MBF A;  1T39 A;  2MW8 A;  1ITY A;  3SYT A;  1VI0 A;  1SD6 A;  2ADU A;  3QWL A;  2V6E A;  1Z21 A;  4HQE A;  4YFX F;  3ASO H;  2DMP A;  3BZ6 A;  2NOG A;  4N4O B;  3MZY A;  2PMH A;  5DV5 A;  3I64 A;  3R0A A;  1F36 A;  5C4X J;  2LKP A;  1YJW I;  4IXA A;  1BI3 A;  1U9O A;  3HB9 A;  4S05 A;  5CQE A;  1Q1H A;  3H35 A;  5EYR A;  3L2R A;  3I53 A;  5C44 J;  1APL C;  1EJ9 A;  5K5R A;  5DUK A;  3M4O J;  2KIU A;  4NNJ A;  4I7H A;  2JN6 A;  1V4R A;  2N8G A;  3FXM A;  1IRF A;  1V5F A;  2F6C A;  3ESW B;  2HS5 A;  2D2W A;  1EH7 A;  2LOO A;  3K1P A;  2R7T A;  1DU0 A;  2LKS A;  3FIS A;  1Y56 A;  4AIK A;  4BEH B;  4UB8 C;  1Z6R A;  2A5Y B;  5DTD A;  1IG7 A;  3E6M A;  5LBQ A;  3W2V A;  4U0W A;  2IEK A;  1YYV A;  2Q2E A;  2ZFW A;  4ZYD A;  5JI6 A;  1OQY A;  4ZC3 A;  1CF7 B;  2Y9Y A;  3JRG A;  1JUP A;  4LB6 B;  2DFH A;  4A5M A;  3BPV A;  2OPT A;  1YG2 A;  1MGT A;  4CHU A;  3Q5F A;  1R00 A;  3LSR A;  3V7R A;  1ETX A;  4ZZL A;  4Z2Y A;  3EDP A;  3G6E I;  1HBX G;  4NUB A;  1KQ0 A;  3I4P A;  6PAX A;  3SQN A;  4MNU A;  2DJI A;  5H2F C;  5M5Y J;  3BDD A;  1L3L A;  1MBH A;  4EJT A;  4B43 A;  1L0O C;  3J81 Z;  2DFE A;  4WXC A;  3ZPL A;  3KP3 A;  5E17 F;  3CJN A;  5FLV A;  2IP2 A;  3AG1 H;  2R7O A;  2NVY J;  2H6B A;  1Z1D A;  1HC8 A;  4KN4 X;  3OOU A;  2HVS A;  1H88 C;  1R6R A;  2NS8 A;  2E1M B;  3S2W A;  4G7O F;  4I2O A;  1AKH A;  2BY0 A;  4NBQ A;  3WU0 A;  1BR4 A;  4HG2 A;  2X1D A;  3ABU A;  5J8C A;  3MFK A;  3D5L A;  4PJL A;  2YU3 A;  4KIC A;  3ZQQ A;  5D5V B;  2K02 A;  1ZN2 A;  5L3F A;  2ZSH B;  3ZQH A;  2GLO A;  1IXR C;  3Q0W A;  2VKV A;  4V2G A;  5GAH J;  1K83 J;  2LMD A;  3TDU C;  3QPS A;  1P4A A;  1R36 A;  4UUV A;  2LRE A;  1IO2 A;  2PX9 A;  4MTE A;  2UXN A;  3VEP A;  3I59 A;  1XDU A;  2BW3 A;  3VYS B;  2NNN A;  2ISY A;  4RAG A;  2BBY A;  1LVK A;  1YOV B;  2GBY A;  3E0J B;  3IL2 A;  4LMY A;  1HST A;  1BI2 A;  1RZ4 A;  2WAD A;  3DLA A;  3KLN A;  3NQO A;  2UWM A;  2I5U A;  3A4C A;  4BS9 A;  1LJ9 A;  2LD5 A;  3BR5 A;  3FXQ A;  2FNP A;  3B02 A;  3K1N A;  2P6S A;  3A0H C;  3BPX A;  4OU0 A;  5J3L A;  4OIO F;  2QEX I;  4PCQ A;  2M87 A;  5IY5 H;  2L01 A;  2HDW A;  1R71 A;  1QPM A;  3BCA A;  1V5G A;  2DYR H;  3AG3 H;  2CJJ A;  1T0F C;  3RQI A;  3DXJ F;  4Q4Z F;  3HM5 A;  4B09 A;  2HVQ A;  1W5S A;  3TDZ C;  4WK8 F;  2A05 A;  1FIA A;  3OYH A;  1BOB A;  4MIM A;  2IT0 A;  4CYC A;  1FTT A;  2FBK A;  1MDM B;  2V1X A;  1HLV A;  2P7V B;  1XSV A;  3K4J A;  4P9F A;  2UV1 A;  4I0A A;  2E1N A;  2QSG X;  3BLY A;  4EJW A;  2JPC A;  5HVQ C;  4G6Q A;  3C1D A;  4PJ0 C;  5E1Z B;  2FD5 A;  4DIQ A;  1W36 C;  3CCV I;  4BDZ A;  4A0Y A;  4ENM A;  2E19 A;  1XB4 A;  2Z9O A;  2H94 A;  1Y39 A;  2ZXI A;  4CCM A;  2CUF A;  3FDY A;  3CCE I;  4F55 A;  2X6Y A;  3JTH A;  2PFB A;  3GTO J;  3NRV A;  4HZF A;  1GV5 A;  2UZK A;  2K9S A;  1M1E B;  2QGU A;  1YS7 A;  2H09 A;  3CJQ B;  1KA8 A;  2L02 A;  4M6V A;  1RR8 C;  2DA7 A;  5CKT A;  3CO7 C;  2K40 A;  3OIQ A;  2JJ7 A;  3DBH B;  4G6T B;  3GTP J;  2EFN A;  3RPQ A;  3ZQI A;  1EKE A;  4NC8 A;  1P92 A;  3OS1 A;  2LK2 A;  3BG3 A;  1B6A A;  1WJF A;  1DPR A;  3DU6 A;  3M8J A;  4CO8 A;  1OMI A;  2R5Y A;  1YW9 A;  1PP7 U;  1N77 A;  2GWR A;  5KK1 A;  1A5J A;  3U1D A;  2XGX A;  4EJV A;  5JHF A;  3O8H A;  5J8F A;  2CO5 A;  3IKT A;  1YIT I;  1Z0X A;  1XGN A;  4RS8 A;  3SFI A;  3F6V A;  2H8R A;  4Q5S F;  5F0C A;  3LA2 A;  2YX4 A;  3VFZ A;  1WJA A;  4ZDO A;  4C30 A;  3JAM K;  3RKW A;  2K9M A;  1HW5 A;  3DEW A;  3OY9 A;  3BZC A;  1J09 A;  2L7K A;  1Z6T A;  2H8W A;  2BY3 A;  3CD6 I;  5ILU A;  3OYB A;  3CF5 F;  1FT9 A;  2CUZ A;  2ICW G;  3K1M A;  4HNV A;  4EJU A;  5K5O A;  1MH4 A;  1RI7 A;  1R22 A;  2F5F A;  3KPH A;  1HA8 A;  3WU2 C;  2R7Q A;  3BCB A;  2DJN A;  5E79 C;  5D6E A;  3HEF A;  3TGN A;  5EF6 A;  1IJW C;  3K4B A;  5F27 A;  1WGX A;  3JSP A;  3P7N A;  2L54 A;  1MNM C;  1W5C C;  3GFJ A;  2MSY A;  4RBO A;  1JGS A;  1DP3 A;  4M72 A;  2DOE A;  1XS9 A;  4GYI A;  1Y0U A;  2W24 A;  2OTJ I;  3EET A;  3PFI A;  3I0T A;  2E5Z A;  2JK3 A;  4LD5 A;  4RB0 A;  3V42 A;  1UHS A;  3RKY A;  2X9D A;  2IGK A;  2LH9 A;  3CDH A;  3T5X A;  4FCY A;  2FSW A;  2K9Q A;  1E17 A;  3OR2 C;  1YQA A;  2HEO A;  4L0Z B;  1G6N A;  3S32 A;  4E7I A;  2G7U A;  5L3B A;  5CVU A;  2VKD A;  4G6D A;  2XF6 A;  4OAY A;  3WOD F;  3VOE A;  2L4M A;  1MZB A;  4A69 C;  4D9J A;  2BOL A;  3H0G J;  4HST A;  1B72 B;  2W00 A;  2DA3 A;  3LAP A;  3G4S I;  2QCO A;  3GZN B;  3H9G A;  5DM7 F;  2V6C A;  1YRN B;  1ZR2 A;  3F22 A;  2BGC A;  1UST A;  2XAJ A;  4YEL A;  1D1C A;  4AWX B;  4JYK A;  4B3A A;  1OCZ H;  1GUU A;  3G71 I;  1U9N A;  3CCS I;  4PUS A;  2DQL A;  4FE7 A;  1PP8 F;  3KZZ A;  3U9G A;  3FXO A;  1Z05 A;  3CP2 A;  1I6X A;  3ZRG A;  2M30 A;  3OMY A;  2XDV A;  1VQ6 I;  1VQ7 I;  1Y1V J;  4IHW A;  4HLX A;  2COB A;  2EV5 A;  2ZC2 A;  3BR6 A;  4KNY A;  1SFE A;  4BY1 J;  3DPT A;  4O6J A;  3BG7 A;  4XLE A;  1VF9 A;  5LHG A;  2ME0 A;  4G94 A;  2NVX J;  4B1R A;  2L9S A;  5KHD A;  2RV8 A;  2JSP A;  4M3B A;  1OR7 A;  1FPQ A;  4M3F A;  3D5S C;  1FIP A;  2P8T A;  3V7S A;  4NB5 A;  4BE2 A;  5D4S A;  1YHQ I;  2EIM H;  2DT5 A;  5CVJ A;  1ULY A;  4XRM A;  4XOT A;  1E3O C;  4D1Q A;  2FQ4 A;  1IW7 F;  2DFF A;  4L5I A;  3S93 A;  3WHB A;  2Z99 A;  4CCL A;  4A3C J;  3J7Y J;  3AL0 B;  2KMU A;  3Q0U A;  4FX0 A;  2JZY A;  3M1C A;  2YU9 J;  1XCB A;  1YX3 A;  3MZH A;  2VPR A;  5CPR B;  4C3J J;  3P9K A;  2CV1 A;  1SFX A;  3R4K A;  4FT8 A;  5F04 A;  3LA3 A;  3KP6 A;  3EYI A;  1K4T A;  4JX4 A;  2O03 A;  4FHT A;  2DBB A;  3CMA I;  2TDX A;  1E2X A;  2IXS A;  3NAR A;  5IP6 A;  4DNC A;  2JWT A;  3F72 A;  3GX4 X;  1B72 A;  4WCG A;  3DEE A;  1LPQ A;  1BR2 A;  3S3N A;  3JRH A;  1VTN C;  1R7J A;  1K4S A;  5ICC A;  3E5X A;  2D45 A;  3RYP A;  3DLL F;  2QSH X;  2WV0 A;  1KU2 A;  2ZO4 A;  4HAM A;  2ZNZ A;  4GO1 A;  4MTD A;  4DYR A;  1VQP I;  4L5J A;  4H4K C;  5ED4 A;  1O7L A;  2NAZ A;  2PJP A;  4A3M J;  3BTJ A;  1ZQ3 P;  1JJ8 C;  4ASN A;  3HGG A;  4L0Y B;  4R8H A;  2CQ7 A;  1KON A;  2JUG A;  2WAF A;  2HQA A;  2JMW A;  3KP4 A;  3KP7 A;  3EUH C;  1Y8R B;  5D4R A;  3ECO A;  3CLQ A;  2GZW A;  3FHZ A;  1UHM A;  4A3J J;  4XRF A;  1KZH A;  2L9N A;  4KIG A;  4MEY F;  2VBZ A;  4EM1 A;  2F4M B;  4DBR A;  3K0L A;  3OSG A;  1U3E M;  2VXZ A;  2Y2Z A;  4AUX A;  3BTI A;  2MD0 A;  4A3E J;  1P6R A;  1U78 A;  1RKW A;  4LIV A;  2Y31 A;  3ERM A;  2WC2 A;  3C2G A;  2F48 A;  2WY8 Q;  2ZJP F;  4PZJ A;  3ZN1 A;  5HLT A;  4CYC B;  1J5Y A;  4ESJ A;  1BN5 A;  1Q1V A;  2CYY A;  2Y0S A;  5KNL A;  3CUQ C;  4IL6 C;  1UEL B;  3HYI A;  1X1C A;  2MD5 A;  3K2A A;  5DUI A;  4M9X A;  2HPI A;  2ZXH A;  2DXI A;  2CFX A;  2QBY A;  4UHT A;  4XIC A;  4A12 A;  2X4H A;  2IGM A;  4BDY A;  1AWC A;  1WZ2 A;  2J5O A;  3CCL I;  5F0F A;  1X4O A;  2CH0 A;  4BL0 B;  1WJD A;  3PJR A;  2QQ9 A;  3GLX A;  3HHG A;  3R0J A;  5KCM A;  3ROU A;  3TED A;  1RET A;  1QU3 A;  3SXY A;  2KRF A;  3S8P A;  4GFB A;  2O6G E;  4XMY A;  2HTS A;  3DP7 A;  3HXL A;  3I9V 2;  3L2C A;  1G3Y A;  1SMT A;  4LOC A;  1A31 A;  1REP C;  2HQR A;  1IV6 A;  4UUT A;  1SC7 A;  1ZG5 A;  3OS2 A;  2ZXW H;  4ENN A;  3ABT A;  1T95 A;  3HPH A;  4X1E A;  1T2K A;  1RIO H;  2ESH A;  2HOE A;  2BYV E;  4UVB A;  3HGY A;  3TO9 A;  2DMT A;  3TW6 A;  5DCM A;  3W3C A;  2XAQ A;  3AL0 C;  3CC4 I;  2LNB A;  2EV6 A;  3DTI A;  3MAJ A;  5BOX A;  5DDG A;  2IA1 A;  4KIB A;  5TIS C;  2IS2 A;  2O9L A;  4N9H A;  2AXT C;  1QZE A;  3O2P E;  4XQF A;  2JTV A;  2M7B A;  2OZ6 A;  2E34 A;  2FF4 A;  1HKT A;  2VE8 A;  4L9J A;  2M5W A;  1IRZ A;  2A6T A;  4IVN A;  2WTE A;  2HTJ A;  4Y4R A;  4CGZ A;  1ETV A;  2DK8 A;  3E6C C;  1G2H A;  1LB2 A;  2V9P A;  5LRS A;  3TOA A;  3F8B A;  2VKH A;  3A1Y A;  1UG2 A;  1PYV A;  1QO0 D;  1U8B A;  3S1Q J;  2FXA A;  4A3B J;  2EH3 A;  1ONV A;  4IRG A;  4IHS A;  3OYK A;  4XOR A;  4E7S A;  2EQR A;  3KZY A;  2AO9 A;  3KET A;  3NWT A;  3DPL C;  3FXJ A;  3M8F A;  4CDG A;  2XAF A;  4E7K A;  2E71 A;  3RZO J;  4LLN A;  2KIS A;  3FX3 A;  3WHC A;  1FMW A;  4C2U A;  3K10 A;  2G7H A;  4L18 B;  2LG4 A;  5F64 A;  1XTA A;  2KLO A;  5IP7 J;  4DJA A;  1I39 A;  3JRA A;  1U0J A;  1TW3 A;  4BY7 J;  4Y13 A;  2NXN B;  2BHY A;  3H5N A;  3CO6 C;  2DAO A;  1NG7 A;  3ZN0 A;  1JXS A;  2P81 A;  3K2Z A;  1YO5 C;  2FOK A;  2Z16 A;  4BE1 A;  2OZU A;  3R6S A;  3S3O A;  3KEQ A;  4FAS D;  2E60 A;  4RGR A;  5KVR A;  1ZLJ A;  2IPQ X;  2X0L A;  1E3P A;  5HS9 A;  1SVM A;  1DGR M;  5J47 A;  4GDF A;  5IPA A;  1JKP C;  2ESN A;  1OYY A;  1UZC A;  1KU7 A;  3S2D J;  1LQ1 A;  4U88 A;  2XRN A;  2A61 A;  4CH7 A;  3OYL A;  2B0L A;  3MWM A;  1RUO A;  1SEU A;  1LKX A;  5FFX A;  2DU9 A;  2WA0 A;  4ETS A;  4Y15 A;  3MZ8 A;  2LBF B;  4MQV A;  2X85 A;  2ELH A;  1W0T A;  3AG2 H;  4B4C A;  1XDS A;  4II3 A;  4LB5 A;  1PVE A;  1TWA J;  3LA7 A;  4A3G J;  4JK1 X;  2PMZ N;  1QNT A;  2VBY A;  2GQQ A;  3IAS 2;  2PEX A;  2VE9 A;  3CC7 I;  2CQN A;  5ERI A;  1FJL A;  2EK5 A;  2MH2 A;  5H6Q A;  3BR0 A;  1J59 A;  3VSL A;  1KYZ A;  1TQI A;  2KJB A;  3N4M A;  3GME A;  2E2J J;  1YIO A;  4RM3 A;  1YI2 I;  2W82 A;  1WKM A;  2DDA A;  5AIQ A;  3MN2 A;  1GLN A;  2HOS A;  1VQL I;  3CCY A;  2JRT A;  3I55 I;  1JJ6 C;  2X48 A;  3CUO A;  1F4K A;  2FEZ A;  3ZQ7 A;  3WTV C;  1YS6 A;  5BQT A;  1TWC J;  2FE3 A;  3K4L A;  4KMU X;  2R7Z J;  1UJ8 A;  2GOM A;  1X3W B;  3ERE D;  4IEJ A;  1FBQ A;  3ZQG A;  1BI1 A;  3RKX A;  2MGQ A;  4ESF A;  1EA3 A;  1JT6 A;  3ASN H;  2XF7 A;  4ABZ A;  3CUQ B;  2PI0 A;  2CQQ A;  3JRD A;  2DLL A;  2MLG A;  1N78 A;  2Y0M A;  4AM3 A;  2YX7 A;  5C4J J;  5E20 A;  3ZP5 A;  4CCO A;  1OYI A;  1Y6I A;  3K9T A;  5A2Q K;  4BBS J;  2JA6 J;  1K6Y A;  3KE2 A;  5GTI C;  3RKQ A;  3OL4 A;  1MBK A;  4R79 A;  2RAE A;  3HRM A;  3K69 A;  3ULQ B;  3DBL B;  2ELK A;  3GBG A;  3BG6 A;  2QVO A;  1SAU A;  2HOA A;  2KIQ A;  2NRA C;  3WE3 A;  3H5A A;  1SVL A;  3DKX A;  3VSK A;  3L9F A;  2HPM A;  1JTY A;  4ITV A;  3PFY A;  3CCQ I;  2PLY A;  1GXP A;  3KCC A;  3T0Y A;  2IRF G;  2HXO A;  2L4A A;  4F92 B;  5J1U A;  2EIJ H;  2NYX A;  2NVT J;  1GHC A;  3J7A O;  2AHQ A;  4Y52 J;  3Q0V A;  1E3H A;  1W36 D;  4JOM A;  3VPR A;  1QPI A;  5L3E A;  2M0M A;  4XKC A;  2DDB A;  3CMY A;  2YSR A;  4KA4 A;  2CQX A;  4D0P A;  1V55 H;  2TCT A;  4P55 A;  4AVP A;  2FU4 A;  5M3F J;  1D5V A;  2WV1 A;  2K27 A;  2IS6 A;  1GV2 A;  1Z3X A;  3RI4 A;  4HX8 A;  3BZK A;  5L3G A;  2DA1 A;  1MW7 A;  3K6G A;  4LG0 A;  1B9M A;  2ISZ A;  2XAU A;  2OUM A;  3NWS A;  5E18 F;  2B9S A;  3GEZ A;  2JPB A;  2O0Y A;  1F43 A;  3NAU A;  4MHG A;  1C0W A;  2GA1 A;  1Z77 A;  1RES A;  2CV0 A;  3FF5 A;  2NVQ J;  3I71 A;  5E3M A;  3LSJ A;  1Z67 A;  2P6T A;  1USS A;  3GTG J;  2VC0 A;  3BR1 A;  3HHH A;  2DTZ A;  2ETH A;  1OPC A;  3SZG A;  2RQP A;  2Z1D A;  1SD5 A;  5FKM A;  1O7F A;  1T33 A;  5B66 C;  4AYB N;  1K61 A;  1B4A A;  1QA6 A;  3E5Q A;  2XF5 A;  2WBM A;  1LUJ B;  2V7F A;  4M6Y A;  1CQT A;  3IWZ A;  2RQQ A;  4W1U A;  2X1C A;  3J80 K;  1Y1W J;  3GW2 A;  4U0V A;  5K7F A;  4BU2 A;  2M1B A;  3TO7 A;  2VLA A;  3CQZ J;  1MNE A;  3K4C A;  2IVM A;  3ZMU A;  4HEA 2;  5D8K B;  1ETY A;  3I5U A;  5IP9 J;  3H3U A;  4BXU A;  3T1B A;  2BW3 B;  2EZL A;  1WJE A;  4AIH A;  1ETQ A;  2L7Z A;  3PQJ A;  2OC6 A;  4GYG A;  4JX6 A;  4UVA A;  2W84 A;  3ZMT A;  3BOQ A;  3I58 A;  4LK0 F;  4AC0 A;  3A03 A;  4LG3 A;  3Q3S A;  3ZMZ A;  2H27 A;  1AOY A;  3A2K A;  3BJA A;  1X58 A;  1QZY A;  4IHX A;  3RPU A;  1IXS B;  3WG9 A;  4D5C A;  4MO7 A;  4BHP A;  5FKK A;  1FEX A;  5FKL A;  2EFP A;  4ZYE A;  2EA4 A;  3EUK L;  3RQ4 A;  2GIZ A;  2GXG A;  3E5U A;  1K78 B;  5B1A H;  1U5T B;  3AKZ A;  3GTM J;  1N75 A;  1H8A C;  3F0C A;  2R7X A;  4HNU A;  5ICE A;  2HGC A;  3CJR B;  1FC3 A;  1H0M A;  5L3C A;  4E7H A;  1XSD A;  2VOO A;  2FA5 A;  4IQ4 A;  5D6F A;  1MBG A;  4YEJ A;  3B6C A;  1S9H A;  2XAG A;  2ZFU A;  3BTC A;  3ONQ A;  2QF7 A;  4GCV A;  2ZSI B;  4HX7 A;  2FBH A;  5TJJ A;  2JT1 A;  1VQM I;  1DDN A;  5A2Q Z;  3N05 A;  4RM2 A;  2D5V A;  2ZJR F;  3IH2 A;  4QIW N;  5IYD J;  1JUS A;  3RJP A;  4XK4 A;  1AA7 A;  2DI3 A;  3FM3 A;  4WXD A;  2R5Z B;  4KIS A;  2DTR A;  2K9N A;  3QYB A;  3A01 A;  4L5E A;  1MJB A;  4HV5 A;  3W2A A;  1OKR A;  4ZYA A;  1YE9 A;  5JVG F;  1IN7 A;  2JA2 A;  1CGP A;  2K86 A;  4LIU A;  3IH4 A;  4Y33 A;  2X51 A;  1G4D A;  1YW8 A;  2GA2 A;  4XLH A;  2M9H A;  5EEG A;  1LNW A;  4X0G A;  1BJZ A;  2IA2 A;  1BC7 C;  2E5N A;  1PJR A;  3VDX A;  5GAE J;  1F1Z A;  2FRH A;  4N0B A;  3C2B A;  3Q9S A;  3ZR8 X;  3IH3 A;  2E1M C;  4GGG A;  3HDD A;  2P5K A;  5IT3 A;  1FY7 A;  3P5J A;  5M5X J;  1MSE C;  3B73 A;  1S29 A;  1X3Z B;  3R60 A;  2M7A A;  1RRJ A;  2FBI A;  4IO9 F;  4QWQ A;  4ZDL A;  2EFO A;  4RGX A;  5E1W A;  2M45 A;  3O6B B;  4QTR A;  4AID A;  2RNG A;  3KYL A;  1TZL A;  4E4H A;  4V2F A;  5EZH A;  1IDY A;  1GT0 C;  1OCT C;  4KIT B;  1FLI A;  5BPD A;  1KQ8 A;  1FTZ A;  5FLX Z;  2R93 J;  3L2U A;  1FOY A;  1EH8 A;  3L00 A;  1XMA A;  3FK6 A;  5FRM A;  4UUS A;  3HKZ A;  5D8L B;  3I56 I;  2ZNY A;  5FFZ A;  1S7O A;  1UMQ A;  1V5E A;  3W6J B;  4P9U A;  2K85 A;  2WB1 A;  4Y17 A;  2ID3 A;  4C3I J;  4IX7 A;  2X6O A;  5HDG A;  5EJC A;  2FQ3 A;  4G7H F;  1UG0 A;  3WGH A;  2KRH A;  2AXL A;  5FO5 A;  3SJM A;  1TL8 A;  1VQ4 I;  4HDU A;  4QPQ A;  4G12 A;  5F08 A;  2HOT A;  2V4J C;  3J7A Y;  1QGP A;  5IYC J;  1ACI A;  5E3N A;  4B44 A;  1A6Q A;  4LGW A;  3W6K B;  3H9J A;  3LOC A;  4LLL A;  3CJT B;  4RLF A;  5HS7 A;  1IV8 A;  2GOX B;  4DYC A;  4NQW B;  4DGW B;  4LG0 B;  2W7N A;  1ZTR A;  1HSJ A;  2HDC A;  1ETK A;  5B1B H;  2EIK H;  3CES A;  5CJ9 A;  1WHU A;  2VAS A;  2W1O A;  4UXN A;  3F8C A;  2EFW A;  3HOV J;  4A93 J;  3E7L A;  4M3D A;  3HOW J;  2VC1 A;  1IN8 A;  2KFD A;  1HCR A;  2XKP A;  2HKX A;  3LSP A;  1HXD A;  3LSH A;  5FD6 A;  3J81 K;  2IBD A;  5CYV A;  1T38 A;  2KRC A;  9ANT A;  1QBJ A;  4EGZ A;  1LDK B;  2OCE A;  4MQ9 F;  4XKW A;  3M3Y J;  3KYC B;  3QPL A;  3COA C;  1R5H A;  4CZZ A;  4XBF A;  2JA8 J;  4RLQ A;  2EZK A;  1YW7 A;  1O3R A;  5EZG A;  4PGH A;  3K70 C;  3GWZ A;  2LBF A;  1RKT A;  3IP4 B;  4BXX J;  2HWV A;  1W7P B;  1FSH A;  4BYY A;  2L7M P;  4XN0 A;  1SD7 A;  1JKQ C;  5TRD A;  3K7A J;  3BQZ A;  2P5L C;  3I4M J;  1OIS A;  1TWG J;  1BW6 A;  5LGU A;  1Z3Y A;  2O5R A;  4IRH A;  1LFU P;  4O3M A;  1ZK8 A;  1FMV A;  4HBL A;  4M3G A;  4I6Z A;  3M9A A;  1WCM J;  3OYC A;  3H9Q A;  2LY2 A;  2XC7 A;  1BC8 C;  2DMN A;  4BUP A;  3MKY B;  4M9Z A;  2L9R A;  3DKW A;  4E7J A;  5LLQ A;  4PK4 A;  3QU3 A;  3GFM A;  2F4I A;  5LFA A;  2XV4 S;  1OFC X;  4IRI A;  2RGV A;  2XAH A;  2GAU A;  1U6G A;  3ABL H;  3P9I A;  4K2E A;  5D5X B;  2H1K A;  5FLX K;  4BGD A;  1HDD C;  2K3F A;  1G3S A;  4YRV A;  1P9Q C;  5HDN A;  2K4J A;  4U7D A;  1LDJ A;  1U8R A;  4KDP A;  3LQQ A;  1SAX A;  1FBU A;  3CF2 A;  2R5Z A;  2HZD A;  2E1C A;  4HDV A;  4HOB A;  2O8X A;  2A69 F;  2DW4 A;  2LDU A;  1NG6 A;  4E7L A;  4CUG A;  1W7P A;  4ON0 A;  3HL2 A;  4LIT A;  1D1A A;  3JRC A;  4IPA A;  3EUH A;  2Q0O A;  4Z6Y A;  2ZJQ F;  2R7U A;  4C3H J;  2CW7 A;  4UVC A;  3MCZ A;  1VND A;  2XAS A;  2ZJ2 A;  4ZTF A;  1IF1 A;  3IC7 A;  1WJC A;  4RDU A;  5BMZ A;  3LSM A;  2CWE A;  2OD5 A;  1ZGA A;  4F52 A;  3QOP A;  1VZ0 A;  4AU7 A;  3HSF A;  2LYC A;  2WB1 N;  3C7J A;  2XVC A;  4EJO A;  3GTK J;  1DP7 P;  1CF7 A;  4ZTJ A;  4ENJ A;  1K6O A;  2GM4 A;  5J1R A;  2IJL A;  1IGN A;  1DPU A;  3PL8 A;  1GVJ A;  2DPU A;  2O8K A;  4A2U A;  1E0E A;  2UUZ A;  1QQI A;  1SFU A;  3FXK A;  1D8J A;  3M07 A;  1TNS A;  2VBX A;  3PNY A;  2HFH A;  3TKY A;  1IUY A;  1Z7U A;  1O3Q A;  3E6B A;  2JA7 J;  1R23 A;  2MFZ A;  2JVH A;  2F4O B;  4EEF G;  2XGE A;  1F9N A;  2LP0 A;  3TQN A;  4OIQ F;  2W57 A;  4XSZ F;  3IHU A;  1ORK A;  4M6X A;  3CCR I;  4BJ6 C;  5H20 A;  4I0B A;  1VQK I;  3ABM H;  3EUA A;  2XSJ C;  2RRE A;  2KIF A;  2OV7 A;  1JKR C;  4XL9 A;  3FXU A;  3LSK A;  3V8L A;  3HOS A;  2PJR B;  2OA4 A;  1VQ8 I;  1BOA A;  1P7J A;  5J6X A;  4OIR F;  2Y69 H;  5CVI A;  2VON A;  2DMQ A;  3MQ0 A;  4G8X A;  3IRR A;  4ZYG A;  4UUS B;  3DFG A;  2L7F P;  2Y48 A;  1XC5 A;  4M73 A;  1WSU A;  3ZMS A;  1FX7 A;  1BL0 A;  2IW5 A;  3JSO A;  4PGG A;  3FBN B;  2MAB A;  3DTE A;  2MG4 A;  4AIJ A;  3MKL A;  3M7G A;  2M2E A;  2VQL A;  1RC9 A;  4RB3 C;  4Y7N J;  2OU2 A;  1BA5 A;  3BJ6 A;  3Q9V A;  4ESB A;  1YFH A;  3FIW A;  4DOZ A;  1YTY A;  1IAW A;  3OYE A;  3FMS A;  5LGN A;  1LEA A;  2EWN A;  2AQE A;  1ENH A;  4DQ2 A;  2PMZ A;  2RN7 A;  4DYQ A;  1H9T A; 
#chains in the Genus database with same CATH homology
 4L9V A;  4WF2 A;  4AD9 A;  1O3S A;  2R3S A;  4EV0 A;  2KKO A;  1RUN A;  3F6O A;  3TOB A;  2QLZ A;  3RYR A;  1STZ A;  4HF1 A;  3HRU A;  4RGU A;  3ZMV A;  1UCR A;  1J0R A;  3TO6 A;  2D1H A;  3HTS B;  4HX4 A;  3BWG A;  4RB1 A;  5FB2 A;  3LAJ A;  4CIC A;  4O5V A;  1KYW A;  3FZV A;  3VB2 A;  4A6E A;  3SZT A;  3KLO A;  1HKQ A;  3H92 A;  2COM A;  1Z9C A;  1XD7 A;  2HYF A;  2RDP A;  1U5T C;  3FMQ A;  1V3F A;  4WXH A;  3QU6 A;  1I5Z A;  1ZRF A;  2RKH A;  2KJC A;  4KIF A;  3DQV C;  5K5Q A;  3LQR A;  3WU1 B;  1FYK A;  1TW2 A;  5ICF A;  5ILV A;  3WGG A;  3LFK A;  2UXX A;  1IZ1 A;  1XMK A;  1Z91 A;  2QUF A;  2F2E A;  2ZXJ A;  3C18 A;  1HQC A;  4IJA A;  2E7W A;  1ZH5 A;  4S04 A;  2HQN A;  1J75 A;  3GF2 A;  1EH6 A;  4RGS A;  3QPT A;  3GVA A;  4G9Y A;  1ZAO A;  1ON1 A;  4BHB A;  1FSE A;  1LEB A;  3IWF A;  3VOD A;  3KFW X;  1RNL A;  4HA8 A;  2XKO A;  4GXO A;  2HR3 A;  3WTX C;  4BQA A;  2Z33 A;  4XSX F;  1K78 A;  1ODD A;  3LWF A;  1NHA A;  3J80 Z;  5H6R A;  3F23 A;  1I27 A;  4U0Y A;  3N97 A;  3ISP A;  2XUB A;  1BBY A;  3HUG A;  3T8T A;  2DQR A;  3KEO A;  2MA3 A;  5LHI A;  1FYL A;  4NQW A;  4G7Z F;  2A6E F;  3PQK A;  4HF2 A;  1XGO A;  4I09 A;  3EYY A;  3H3Z A;  2W85 A;  1T6S A;  4CXF A;  4LLG F;  3F8N A;  4JQF A;  5FD5 A;  3WTU C;  4NHJ A;  1W4M A;  2FMY A;  2F5D A;  3HOT A;  5HLI A;  4A6D A;  1WI9 A;  2VT3 A;  2QQA A;  5CVR A;  3G73 A;  1XSX A;  3GFI A;  2PMU A;  3RIR A;  4E70 A;  4IF4 A;  2VOD A;  5JFR A;  2VT2 A;  2HKO A;  3F21 A;  1ZGJ A;  3CUQ A;  4HQM A;  1WQ2 A;  2OBP A;  2QYO A;  2EJR A;  2HZT A;  2RC4 A;  1S7A A;  2LSO A;  3RDI A;  3DEU A;  1DUX C;  2LF7 A;  2DPD A;  1R1T A;  3HRS A;  2STT A;  2V1U A;  3DF8 A;  5E1X A;  1B1B A;  1TBX A;  3C3W A;  3REO A;  1ZRC A;  1UFM A;  1D8K A;  2H6C A;  4EM2 A;  4A0X A;  4ZZD A;  5K1Y A;  3OV8 A;  3ML6 A;  4FX4 A;  2R7F A;  2RNJ A;  3M8E A;  4HV6 A;  2G9W A;  5E8I A;  4JBA A;  2QWW A;  4BNC A;  2KIM A;  3GFL A;  3EQL F;  4KFC A;  4EMS A;  1R1V A;  4I01 A;  4WX9 A;  2MC3 A;  1B59 A;  4I98 B;  4F7Z A;  4P96 A;  2MLK A;  2GIV A;  2PBI A;  1ZHF A;  5DD8 A;  5IT9 Z;  4UV8 A;  5FGM A;  2QQB A;  3GYH X;  1UB9 A;  5HS8 A;  5CLS A;  4BAY A;  2DFI A;  1QZZ A;  3U2R A;  5LHH A;  4Q47 A;  2V9V A;  3I54 A;  3WTY C;  2CW0 F;  3L7W A;  2DO7 A;  5DYM A;  3FWE A;  4ENK A;  5L3D A;  3HRT A;  3OOP A;  4RAY A;  4KT5 C;  5AON A;  5DCF A;  3V4G A;  2VN2 A;  3F3X A;  4EGY A;  2EFQ A;  5LEJ A;  2EV0 A;  3D0S A;  1F5T A;  2C6Y A;  4P5O A;  1IXC A;  1XGM A;  3FM5 A;  2A07 F;  4OMY A;  4Q48 A;  1FZP B;  3ZMD A;  1X3U A;  5AIP A;  2GXB A;  1FNN A;  1IN5 A;  1MD0 A;  3R61 A;  4HLY A;  3O3K A;  1XGS A;  1R1U A;  1FWZ A;  1S6L A;  2FNA A;  3QAH A;  2PQ8 A;  2ZKZ A;  4HYE A;  1ZAR A;  4OOI A;  2V79 A;  3E6D A;  2XRO A;  4KUM A;  4EQQ A;  1T98 A;  5HDK A;  4LFU A;  3WTW C;  3F8F A;  1P4X A;  2OQG A;  1O3T A;  1B9N A;  1A04 A;  4LK1 F;  5IT9 K;  2P5V A;  4H0E A;  2ZME B;  1MJ9 A;  4YG2 F;  1PUE E;  4KMF A;  1ZG1 A;  2NS0 A;  2NNY A;  1FOK A;  1J2X A;  1OYW A;  1ZRE A;  2O3F A;  2L3D A;  3QP6 A;  4ZYH A;  2LF8 A;  1U5T A;  1TTY A;  5DD4 A;  1R5G A;  4MGR A;  1G3T A;  4YII A;  5BPI A;  3FMR A;  3RTR A;  5CVV A;  3V8K A;  4OMZ A;  4LJZ F;  3GUD A;  4B8X A;  2YR2 A;  1KU3 A;  4EM0 B;  2OQR A;  2Y75 A;  3HSR A;  4OIN F;  1MKM A;  4M9S A;  5JR3 A;  3DV8 A;  2ZCW A;  4YFN F;  4QLC U;  2QZ8 A;  2F5C A;  3WTZ A;  2CG4 A;  3WGI A;  2BV6 A;  3MEX A;  2OAZ A;  5LGT A;  3ECH A;  3L09 A;  4PDK A;  2WWY A;  2P7C B;  3WE2 A;  1XN7 A;  4KN7 X;  1FBS A;  4MEX F;  4WWC A;  1KQ9 A;  1JE8 A;  1J7K A;  1O57 A;  1U2W A;  1TQM A;  5HOO A;  1BM9 A;  3G3Z A;  4BHC A;  3KP5 A;  2QM3 A;  1G3W A;  3CTA A;  3GO5 A;  2XIG A;  1UHW A;  2QEN A;  4UV9 A;  3ELK A;  4EVI A;  5HLH A;  5BS6 A;  2F5E A;  2E7X A;  2Z3Y A;  4A0Z A;  1HKS A;  1ON2 A;  4TV7 A;  4A5N A;  3AAF A;  4L9T A;  3BP8 A;  2EA2 A;  2J5P A;  1K79 A;  1S8N A;  1MDM A;  3SHF A;  5D5U B;  4N9I A;  1J9I A;  3BRO A;  3P9C A;  2A6H F;  2K4B A;  3F8M A;  2P4W A;  2PN6 A;  2QBY B;  2YPR A;  3T8R A;  2VOP A;  1BIA A;  4R1H A;  1I1G A;  4YIF A;  1R58 A;  1IRG A;  1I1S A;  2JSC A;  2V1D A;  1H9G A;  2EB7 A;  2PG4 A;  1HW2 A;  2A3S A;  1KU9 A;  2D1V A;  3LST A;  1BJA A;  1LDD A;  1SD4 A;  2FML A;  1TNT A;  2BE5 F;  2Q8K A;  1IN4 A;  1IN6 A;  3JW4 A;  3M1E A;  3HTU A;  3QP5 A;  5LRR A;  3BJO A;  5ILS A;  1ZG3 A;  1P2F A;  3GZ6 A;  2ZBK A;  3GZ5 A;  3V7C A;  4RAZ A;  2K7L A;  1W7P D;  4HF0 A;  4RB2 C;  2MH9 A;  5LEK A;  3WTT C;  2W25 A;  1P4W A;  1BI0 A;  3V8J A;  1YLF A;  3JTG A;  2Z5U A;  4XLP F;  3KP2 A;  2IA0 A;  4CYD A;  3QRF F;  1TLH B;  4I02 A;  2RVC A;  1ZRD A;  4IHT A;  3IKV A;  4BH9 A;  2CSO A;  1D3Y A;  1FP1 D;  5HLG A;  3JAM Z;  1GXQ A;  3GXO A;  3CLO A;  3SFZ A;  3BY6 A;  5E8G A;  2A68 F;  1HW1 A;  1LVA A;  2HYG D;  4HW0 A;  2O61 A;  2DK5 A;  2BEO A;  1FYM A;  5F6F A;  3E97 A;  4UNO A;  3QPH A;  1EV7 A;  4U7B A;  5EEH A;  2STW A;  1JHH A;  5F1R A;  3SZP A;  1SMY F;  2ZME A;  4OIP F;  1ZLK A;  1KGS A;  4YFK F;  3FXR A;  4KYW A;  2XHK A;  1FP2 A;  1T0F A;  1MJA A;  3IRQ A;  1W5T A;  4L9N A;  3E3V A;  4ZH4 F;  1XCV A;  1WWX A;  1BIB A;  1ZYR F;  5D5W B;  3NEU A;  2CGP A;  1JHF A;  1PDN C;  2R7D A;  1WRJ A;  4M71 A;  5DCM B;  2AS5 F;  3I59 B;  3WTS C;  1S3J A;  4M74 A;  5JVT A;  2M8E A;  1K7A A;  5ICG A;  3HSE A;  2ACJ A;  5JHU A;  3HIF A;  2VBW A;  2CQK A;  5DEQ A;  4XLN F;  1TQP A;  2MBF A;  1T39 A;  1SD6 A;  2ADU A;  4HQE A;  4YFX F;  3BZ6 A;  3MZY A;  2PMH A;  5DV5 A;  3I64 A;  3R0A A;  2LKP A;  4IXA A;  1BI3 A;  4S05 A;  1Q1H A;  3I53 A;  5K5R A;  5DUK A;  2KIU A;  4I7H A;  1V4R A;  1IRF A;  2HS5 A;  2D2W A;  1EH7 A;  3K1P A;  4AIK A;  1Z6R A;  2A5Y B;  3E6M A;  5LBQ A;  4U0W A;  1YYV A;  2Q2E A;  2ZFW A;  4ZYD A;  5JI6 A;  1CF7 B;  4LB6 B;  4A5M A;  3BPV A;  1YG2 A;  1MGT A;  4CHU A;  3Q5F A;  1R00 A;  3V7R A;  4ZZL A;  4Z2Y A;  3EDP A;  1HBX G;  1KQ0 A;  3I4P A;  6PAX A;  3SQN A;  4MNU A;  3BDD A;  1L3L A;  4EJT A;  1L0O C;  3J81 Z;  4WXC A;  3ZPL A;  3KP3 A;  5E17 F;  3CJN A;  2IP2 A;  2H6B A;  1Z1D A;  4KN4 X;  3S2W A;  4G7O F;  4I2O A;  3WU0 A;  3ABU A;  5J8C A;  3MFK A;  3D5L A;  2YU3 A;  4KIC A;  5D5V B;  2K02 A;  1ZN2 A;  5L3F A;  1IXR C;  3TDU C;  1P4A A;  1R36 A;  4UUV A;  4MTE A;  2UXN A;  3VEP A;  3I59 A;  1XDU A;  2NNN A;  2ISY A;  2BBY A;  3IL2 A;  4LMY A;  1HST A;  1BI2 A;  1RZ4 A;  3KLN A;  3NQO A;  2UWM A;  1LJ9 A;  2FNP A;  3FXQ A;  3B02 A;  3K1N A;  2P6S A;  3BPX A;  4OU0 A;  4OIO F;  4PCQ A;  2M87 A;  2L01 A;  1QPM A;  3DXJ F;  4Q4Z F;  4B09 A;  1W5S A;  3TDZ C;  4WK8 F;  2IT0 A;  2FBK A;  1MDM B;  2V1X A;  2P7V B;  1XSV A;  4P9F A;  4I0A A;  2E1N A;  4EJW A;  2JPC A;  5HVQ C;  4G6Q A;  5E1Z B;  3C1D A;  4A0Y A;  4ENM A;  1XB4 A;  2Z9O A;  2H94 A;  3JTH A;  2PFB A;  3NRV A;  4HZF A;  2UZK A;  1YS7 A;  2H09 A;  1KA8 A;  2L02 A;  3CO7 C;  2EFN A;  3RPQ A;  1P92 A;  1B6A A;  4CO8 A;  1DPR A;  1OMI A;  1PP7 U;  1YW9 A;  2GWR A;  5KK1 A;  3U1D A;  2XGX A;  4EJV A;  5J8F A;  2CO5 A;  3IKT A;  1XGN A;  4RS8 A;  3F6V A;  4Q5S F;  3LA2 A;  2YX4 A;  3VFZ A;  3JAM K;  3RKW A;  1HW5 A;  1Z6T A;  5ILU A;  1FT9 A;  3K1M A;  4EJU A;  5K5O A;  1RI7 A;  1R22 A;  2F5F A;  5D6E A;  3TGN A;  3JSP A;  3P7N A;  2L54 A;  3GFJ A;  1JGS A;  4M72 A;  4GYI A;  1Y0U A;  2W24 A;  3EET A;  3PFI A;  3I0T A;  4LD5 A;  4RB0 A;  3RKY A;  3CDH A;  3T5X A;  2FSW A;  1E17 A;  1YQA A;  2HEO A;  4L0Z B;  1G6N A;  2G7U A;  5L3B A;  5CVU A;  4G6D A;  3WOD F;  3VOE A;  2L4M A;  1MZB A;  3LAP A;  2V6C A;  3F22 A;  2BGC A;  1UST A;  2XAJ A;  4AWX B;  2DQL A;  1PP8 F;  3KZZ A;  3U9G A;  1Z05 A;  1I6X A;  2M30 A;  4HLX A;  2EV5 A;  4KNY A;  1SFE A;  3DPT A;  4O6J A;  5LHG A;  4G94 A;  2RV8 A;  1OR7 A;  1FPQ A;  2P8T A;  3V7S A;  4NB5 A;  5D4S A;  2DT5 A;  5CVJ A;  1ULY A;  1IW7 F;  4L5I A;  2Z99 A;  4FX0 A;  2JZY A;  1XCB A;  3MZH A;  3P9K A;  1SFX A;  3R4K A;  4FT8 A;  3LA3 A;  3KP6 A;  3EYI A;  2O03 A;  4FHT A;  2DBB A;  2TDX A;  1E2X A;  4DNC A;  3F72 A;  3GX4 X;  4WCG A;  1VTN C;  1R7J A;  5ICC A;  3E5X A;  2D45 A;  3RYP A;  2WV0 A;  1KU2 A;  2ZO4 A;  4HAM A;  2ZNZ A;  4GO1 A;  4MTD A;  4L5J A;  5ED4 A;  1O7L A;  2NAZ A;  2PJP A;  4ASN A;  4L0Y B;  4R8H A;  3KP7 A;  3KP4 A;  5D4R A;  3ECO A;  2GZW A;  3FHZ A;  1UHM A;  4XRF A;  4KIG A;  4MEY F;  2VBZ A;  4EM1 A;  1U3E M;  3K0L A;  2VXZ A;  1P6R A;  1U78 A;  2WC2 A;  4PZJ A;  3ZN1 A;  4ESJ A;  1J5Y A;  1BN5 A;  2CYY A;  3CUQ C;  3HYI A;  2MD5 A;  5DUI A;  4M9X A;  2CFX A;  2QBY A;  4UHT A;  4A12 A;  2X4H A;  1AWC A;  2J5O A;  2QQ9 A;  3GLX A;  3HHG A;  3R0J A;  3ROU A;  3SXY A;  2KRF A;  2O6G E;  2HTS A;  3DP7 A;  3L2C A;  1G3Y A;  1SMT A;  1REP C;  2HQR A;  1ZG5 A;  4ENN A;  3ABT A;  1T2K A;  1RIO H;  2ESH A;  2HOE A;  2BYV E;  4UVB A;  3TO9 A;  5DCM A;  2XAQ A;  2LNB A;  2EV6 A;  5BOX A;  3MAJ A;  5DDG A;  2IA1 A;  4KIB A;  4N9H A;  3O2P E;  2JTV A;  2OZ6 A;  1HKT A;  2FF4 A;  2VE8 A;  4L9J A;  2M5W A;  4IVN A;  2WTE A;  2HTJ A;  4CGZ A;  2DK8 A;  3E6C C;  1LB2 A;  5LRS A;  3TOA A;  3F8B A;  1QO0 D;  2FXA A;  1ONV A;  4IRG A;  4IHS A;  3KZY A;  3KET A;  3DPL C;  3M8F A;  4CDG A;  2XAF A;  4LLN A;  3FX3 A;  4L18 B;  2G7H A;  5F64 A;  1TW3 A;  4Y13 A;  3CO6 C;  2DAO A;  3ZN0 A;  1JXS A;  3K2Z A;  1YO5 C;  2FOK A;  2OZU A;  3R6S A;  3KEQ A;  4RGR A;  5KVR A;  1ZLJ A;  2IPQ X;  2X0L A;  5HS9 A;  2ESN A;  1OYY A;  1KU7 A;  1LQ1 A;  4U88 A;  2XRN A;  2A61 A;  2B0L A;  3MWM A;  1RUO A;  5FFX A;  2DU9 A;  4ETS A;  4Y15 A;  4MQV A;  2ELH A;  4LB5 A;  1XDS A;  3LA7 A;  4JK1 X;  1QNT A;  2VBY A;  2GQQ A;  2VE9 A;  2PEX A;  5ERI A;  2EK5 A;  2MH2 A;  5H6Q A;  1J59 A;  1KYZ A;  1TQI A;  3N4M A;  2KJB A;  1YIO A;  1WKM A;  5AIQ A;  2JRT A;  3CUO A;  1F4K A;  2FEZ A;  3WTV C;  3ZQ7 A;  1YS6 A;  5BQT A;  2FE3 A;  4KMU X;  3ERE D;  1FBQ A;  1BI1 A;  3RKX A;  4ESF A;  3CUQ B;  2PI0 A;  2DLL A;  2MLG A;  2Y0M A;  2YX7 A;  3ZP5 A;  5E20 A;  1OYI A;  3K9T A;  5A2Q K;  3KE2 A;  4R79 A;  3HRM A;  3ULQ B;  3K69 A;  2QVO A;  2NRA C;  3WE3 A;  3L9F A;  2PLY A;  1GXP A;  3KCC A;  3T0Y A;  2IRF G;  2L4A A;  2NYX A;  1GHC A;  3J7A O;  5L3E A;  2YSR A;  4KA4 A;  4D0P A;  4P55 A;  4AVP A;  2FU4 A;  1D5V A;  2K27 A;  3RI4 A;  4HX8 A;  5L3G A;  4LG0 A;  1B9M A;  2ISZ A;  5E18 F;  3GEZ A;  2JPB A;  2O0Y A;  1C0W A;  4MHG A;  2GA1 A;  3FF5 A;  3I71 A;  2P6T A;  1USS A;  2VC0 A;  3HHH A;  2ETH A;  1OPC A;  2RQP A;  1SD5 A;  1O7F A;  1B4A A;  3E5Q A;  4M6Y A;  3IWZ A;  3J80 K;  3GW2 A;  4U0V A;  2M1B A;  3TO7 A;  2IVM A;  3ZMU A;  5D8K B;  3I5U A;  3H3U A;  4BXU A;  3T1B A;  4AIH A;  3PQJ A;  4GYG A;  4UVA A;  2W84 A;  3ZMT A;  3BOQ A;  3I58 A;  4LK0 F;  3ZMZ A;  2H27 A;  1AOY A;  3BJA A;  1QZY A;  3RPU A;  1IXS B;  3WG9 A;  4BHP A;  2EFP A;  4ZYE A;  2EA4 A;  2GXG A;  3E5U A;  1K78 B;  1U5T B;  5ICE A;  2HGC A;  1H0M A;  1FC3 A;  5L3C A;  1XSD A;  2VOO A;  2FA5 A;  5D6F A;  2XAG A;  4GCV A;  4HX7 A;  2FBH A;  5TJJ A;  2JT1 A;  1DDN A;  5A2Q Z;  3RJP A;  2DI3 A;  3FM3 A;  4WXD A;  2DTR A;  1MJB A;  4HV5 A;  1OKR A;  1IN7 A;  1CGP A;  2K86 A;  1G4D A;  1YW8 A;  2GA2 A;  5EEG A;  1LNW A;  2IA2 A;  1BC7 C;  1F1Z A;  2FRH A;  4N0B A;  3Q9S A;  4GGG A;  2P5K A;  5IT3 A;  1FY7 A;  3B73 A;  1S29 A;  3R60 A;  2FBI A;  4QWQ A;  2EFO A;  4RGX A;  5E1W A;  2M45 A;  3O6B B;  1KQ8 A;  1FLI A;  5BPD A;  5FLX Z;  1EH8 A;  3L00 A;  1XMA A;  5D8L B;  2ZNY A;  5FFZ A;  1S7O A;  3W6J B;  4P9U A;  4Y17 A;  5HDG A;  2FQ3 A;  4G7H F;  3WGH A;  5FO5 A;  2AXL A;  4HDU A;  1QGP A;  4LGW A;  3W6K B;  4LLL A;  5HS7 A;  4LG0 B;  1HSJ A;  2HDC A;  5CJ9 A;  4UXN A;  3F8C A;  2EFW A;  2VC1 A;  1IN8 A;  2XKP A;  2HKX A;  1HXD A;  5FD6 A;  3J81 K;  5CYV A;  1T38 A;  1QBJ A;  4EGZ A;  1LDK B;  4MQ9 F;  3COA C;  1R5H A;  4CZZ A;  4XBF A;  1YW7 A;  1O3R A;  4PGH A;  3GWZ A;  2HWV A;  1W7P B;  1FSH A;  4BYY A;  1SD7 A;  5TRD A;  2P5L C;  5LGU A;  4IRH A;  4O3M A;  4HBL A;  3M9A A;  1BC8 C;  4M9Z A;  3DKW A;  5LLQ A;  3QU3 A;  3GFM A;  2XV4 S;  4IRI A;  2RGV A;  2XAH A;  2GAU A;  1U6G A;  3P9I A;  4K2E A;  5D5X B;  5FLX K;  1G3S A;  5HDN A;  2K4J A;  4U7D A;  1LDJ A;  1U8R A;  4KDP A;  3LQQ A;  1SAX A;  1FBU A;  2E1C A;  4HDV A;  4HOB A;  2O8X A;  2A69 F;  2DW4 A;  2LDU A;  1W7P A;  4ON0 A;  4IPA A;  3EUH A;  2Q0O A;  4UVC A;  3MCZ A;  2XAS A;  2ZJ2 A;  1IF1 A;  3IC7 A;  5BMZ A;  2CWE A;  2OD5 A;  1ZGA A;  3QOP A;  3HSF A;  3C7J A;  2XVC A;  4EJO A;  1DP7 P;  1CF7 A;  4ENJ A;  1K6O A;  2IJL A;  1DPU A;  2DPU A;  1GVJ A;  4A2U A;  1QQI A;  1SFU A;  1D8J A;  1TNS A;  2VBX A;  2HFH A;  3TKY A;  1IUY A;  1Z7U A;  1O3Q A;  3E6B A;  1R23 A;  3TQN A;  1F9N A;  4OIQ F;  2W57 A;  4XSZ F;  3IHU A;  4M6X A;  5H20 A;  4I0B A;  2KIF A;  3FXU A;  3V8L A;  3HOS A;  2OA4 A;  1BOA A;  5J6X A;  4OIR F;  5CVI A;  2VON A;  3MQ0 A;  4G8X A;  3IRR A;  4ZYG A;  3DFG A;  2Y48 A;  4M73 A;  1WSU A;  3ZMS A;  1FX7 A;  2IW5 A;  3JSO A;  4PGG A;  4AIJ A;  3M7G A;  4RB3 C;  2OU2 A;  3BJ6 A;  3Q9V A;  4ESB A;  1YFH A;  1YTY A;  1IAW A;  3FMS A;  5LGN A;  1LEA A;  2EWN A;  4DQ2 A;  2RN7 A;  1H9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...