3GYHX

Crystal structure analysis of s. pombe atl in complex with damaged dna containing pob
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
publication title Flipping of alkylated DNA damage bridges base and nucleotide excision repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gyhX00
1HKTA 4M74A 4ON0A 3EETA 3EDPA 1UFMA 2FQ3A 1I1GA 1RI7A 3GFIA 1USTA 3AAFA 3I54A 5AONA 3D0SA 5TRDA 4F7ZA 2JRTA 2A6EF 3U1DA 1JXSA 3REOA 3K1PA 3TOBA 4S04A 2EV5A 5CVUA 3WG9A 2IP2A 1WSUA 2P5VA 1FX7A 3K2ZA 3F3XA 3GX4X 2W85A 2H94A 4HX8A 3ZMUA 2ZCWA 5ICGA 1CF7A 4UHTA 3RIRA 2OBPA 1QGPA 2DK8A 3DF8A 2PMHA 2IJLA 3D5LA 2XGXA 1T98A 1IN6A 2FNAA 5BPIA 4MEXF 5DDGA 4ZYEA 1XGSA 2F5CA 4ZZLA 2HTSA 1XMKA 4IVNA 3P9KA 3M7GA 5LGNA 1B4AA 1HSJA 3MFKA 1RUOA 4E70A 2HKOA 5EEHA 2OZ6A 3DV8A 2H6CA 1HW5A 4NB5A 1BC8C 1ZREA 1P4WA 1QO0D 2FF4A 4A0XA 4LLNA 3RYRA 2L54A 1B6AA 1SMYF 4BQAA 1R5GA 4CHUA 1NHAA 1PDNC 4UV9A 1ZLKA 4LMYA 3L09A 3R0JA 4IRHA 1LQ1A 1Z7UA 3I4PA 4HF0A 2MD5A 3CUQC 1WI9A 3I59B 4P9UA 1G6NA 5BQTA 1TQMA 3FXRA 3FHZA 4M73A 4TV7A 1KQ8A 1XDSA 3IWZA 4HLYA 5ILSA 2XASA 4HLXA 3FXUA 2FA5A 3FF5A 4L9NA 1R1TA 2L01A 1JE8A 2BYVE 1R23A 5H20A 4EGYA 4IRIA 2RGVA 4L5JA 2V6CA 1ZN2A 3I71A 5KVRA 1F4KA 4HQEA 4HOBA 4B09A 2V9VA 3FM3A 3RPQA 4AIHA 1CGPA 5J8FA 1SFXA 2FMLA 1TLHB 1AWCA 1R7JA 4MQVA 1TBXA 4Q5SF 2RN7A 3BDDA 3SZPA 2W24A 2HQRA 2K7LA 2W25A 4RGSA 5J8CA 4ENNA 5CJ9A 2KKOA 4PGHA 3WTUC 3WTXC 3M8EA 3QRFF 1C0WA 1WWXA 2ELHA 2HWVA 3LWFA 2ZMEA 3E97A 1E17A 4GGGA 2O0YA 1G3SA 2XRNA 3ZQ7A 2M45A 5D6EA 4EJUA 3IKTA 1I1SA 1YTYA 5FLXZ 2BV6A 2AXLA 1REPC 4HBLA 3WE3A 2FE3A 2OU2A 2HYGD 1XN7A 1EV7A 3Q9SA 4LLGF 5D6FA 4L18B 3ERED 3I5UA 2JZYA 3V7RA 4RB2C 2LNBA 2VXZA 1RUNA 3VEPA 4LFUA 4A5NA 2PEXA 4KN4X 1Q1HA 2CYYA 3ROUA 3C18A 2H6BA 1MD0A 2EA4A 2CQKA 1E2XA 5LEJA 3QP6A 5DD4A 3SHFA 1KU7A 1XSDA 3F22A 1DUXC 4JK1X 1QBJA 3RKXA 3GZ6A 2FEZA 2PN6A 3EQLF 3TDZC 1Z9CA 3ZMVA 3R60A 4MHGA 3FZVA 1SMTA 2RKHA 4KIFA 1FBQA 1Z1DA 4L9TA 3CJNA 2KRFA 3H3ZA 1O57A 2K27A 3Q5FA 1HQCA 1IN8A 4WXDA 5CVRA 3ABTA 4UVAA 5L3GA 5FFXA 2OZUA 1KU3A 2GAUA 3HOSA 2A61A 2F5FA 1I5ZA 4P55A 2DAOA 4L0ZB 1V3FA 1S7AA 3K69A 5ICFA 3E6DA 4RS8A 1EH7A 4U7DA 4AD9A 4U0VA 2R7DA 2FU4A 4WK8F 1BC7C 2D45A 3HHGA 4RGRA 3M1EA 2O3FA 4LK1F 4FT8A 4A0YA 1ZYRF 2FBIA 3CO7C 4U7BA 2CG4A 1L3LA 2FNPA 2LDUA 1FSEA 2A07F 2XV4S 2HYFA 4YFXF 3R61A 1BIAA 1U3EM 1W5SA 2XKPA 4MTDA 1STZA 4HZFA 3E6BA 2EFNA 3KP5A 3FM5A 3KEOA 2WV0A 2XVCA 5LHIA 3LFKA 2Z99A 2EFWA 3P9IA 3QP5A 2XAHA 1MDMB 5LBQA 4ASNA 2V1DA 5E1XA 2QQAA 1T0FA 1V4RA 3RYPA 1TNSA 3VFZA 3V8KA 3O3KA 1IRGA 3VOEA 5D8KB 2J5OA 1FZPB 2XAFA 4AIJA 4N9IA 4Y17A 5D4SA 4GYGA 3QOPA 4OINF 1O3TA 4RB3C 3LAJA 5HDNA 1JGSA 1P92A 2HKXA 1G3YA 2GA1A 3I59A 1YS7A 4LG0B 5LEKA 4N9HA 2NNYA 2CGPA 5HOOA 2W84A 3E6CC 4PDKA 4S05A 1O7FA 3IKVA 1XCBA 3BPXA 3CO6C 5CLSA 1J9IA 1Y0UA 4ESBA 3I58A 4L0YB 2R7FA 3K9TA 5CVIA 4XRFA 4ESFA 2KIFA 1PP8F 3GYHX 4KNYA 1OYWA 5CVJA 3F21A 1S3JA 1LB2A 2DLLA 4A12A 4I09A 1LDKB 4MQ9F 5K5RA 4L5IA 2VBZA 2ACJA 3ZMTA 1LJ9A 5E8IA 5LHHA 3ABUA 3MWMA 2A69F 5HVQC 2DI3A 3TO7A 3ML6A 1FWZA 1SD5A 2IPQX 1HW1A 4Y13A 1KYWA 4IHTA 5J6XA 3WTSC 4EM1A 4HV5A 4G9YA 1KA8A 3HIFA 3DPTA 2WC2A 4A5MA 1FLIA 3VODA 5A2QK 3B02A 2K4JA 3QAHA 2P4WA 2LSOA 3MZHA 5F6FA 2CWEA 2O6GE 3GWZA 2STTA 4IRGA 1YQAA 2EV6A 3FX3A 2H27A 3U2RA 2YSRA 2QBYA 1R00A 3WTTC 2CFXA 4HW0A 2ZXJA 1H9GA 4MEYF 1EH8A 2ZNZA 2E1NA 2ISYA 1YW9A 1BIBA 5HS9A 3CTAA 5DCFA 2DQRA 3KZYA 3C1DA 2PJPA 1QZZA 2JT1A 3FMRA 3CUQB 2XHKA 5FLXK 4ETSA 1BN5A 1ZRFA 3BOQA 3BP8A 3GFJA 3HRTA 1S8NA 4ENJA 3G3ZA 2IVMA 4P5OA 3Q9VA 4CGZA 2QUFA 2MBFA 1MZBA 3HRUA 2UWMA 3OV8A 5E1ZB 3F6OA 4FX4A 3J81K 5HLHA 5HS8A 4EMSA 1WKMA 3TO6A 1OMIA 4HAMA 1JHHA 2X4HA 4WF2A 2P6SA 4UNOA 3HYIA 4WXCA 5L3DA 2QWWA 3O2PE 3WTYC 4Q4ZF 1BBYA 3GLXA 4M6XA 4UVBA 2OAZA 1W5TA 3HUGA 1YW8A 4OMZA 3T5XA 2DPDA 2NRAC 2P7CB 4NHJA 3RTRA 1B59A 3NEUA 2GIVA 4IPAA 5DCMB 1ZH5A 4YIFA 3L00A 4IXAA 3SFZA 2JPCA 2OQGA 2NYXA 2PG4A 2ETHA 1J5YA 3ZPLA 1D8KA 4JQFA 3RI4A 1LNWA 2FMYA 5IT9K 4CO8A 2QVOA 2Q0OA 5FD5A 2TDXA 2FOKA 1ZG5A 1XCVA 2DFIA 1OR7A 5HDKA 1R58A 5LHGA 3JTGA 4I02A 4CDGA 4P9FA 5D8LB 3KE2A 4N0BA 4EJWA 2HGCA 5BOXA 2DT5A 2QQBA 3BROA 4UV8A 5A2QZ 1FYLA 4O6JA 1XGNA 1ZG3A 1U5TB 1MDMA 2ESNA 3N97A 2GZWA 4YFKF 4UVCA 2IRFG 3ECOA 2VT2A 3RJPA 4MTEA 2L4MA 2RVCA 1W7PB 2KJBA 4EVIA 2ZO4A 4G94A 3SXYA 2YR2A 3BJAA 4B8XA 2P7VB 4M72A 1FSHA 4Y15A 4EQQA 1U6GA 1B9MA 1FT9A 4MGRA 4ZYDA 4I0AA 2UXNA 3WTVC 4G6QA 5JI6A 2F2EA 1MKMA 3CUOA 1ULYA 2EWNA 5JFRA 2QQ9A 1XGOA 5IT3A 2FBHA 1HSTA 3HRSA 4ZZDA 4DNCA 4KT5C 5ILVA 1T6SA 5FB2A 1QQIA 3BY6A 1YFHA 1D8JA 4IHSA 5K1YA 1YG2A 3ECHA 2K4BA 3J81Z 2ZNYA 3WGGA 3KP6A 5FD6A 3GEZA 4GO1A 2GXGA 1LEBA 3JW4A 2G7UA 5F1RA 4ESJA 2V79A 5LGUA 3GXOA 4AWXB 3GVAA 5BPDA 2H09A 1RZ4A 3HSRA 3KP7A 1GVJA 4UXNA 5DV5A 3DEUA 1UHMA 3KLNA 3ZN1A 2HDCA 3KCCA 2HFHA 3LSTA 1O7LA 1P4XA 3O6BB 1Z6TA 4KMUX 4WXHA 2GWRA 1JHFA 1MJBA 4JBAA 2VBWA 1J59A 3JTHA 4U0YA 1QNTA 2B0LA 4OMYA 3FXQA 1A04A 3K0LA 2IA1A 1AOYA 1HKSA 1K79A 1B1BA 1PP7U 5CYVA 2IA2A 1ZAOA 5ICCA 3ZMDA 1O3SA 5IT9Z 2GA2A 2HR3A 2OA4A 4GCVA 3ISPA 3IC7A 1MGTA 2VC1A 4I2OA 4YFNF 3V8JA 2XROA 2Q2EA 2MA3A 3TQNA 2DW4A 5E8GA 1HKQA 1ZGJA 1USSA 2PI0A 2OQRA 3HHHA 5AIPA 4RGXA 3NQOA 1YO5C 1HBXG 4XSZF 2IA0A 3H92A 1Z91A 4YIIA 4LB5A 1RIOH 3LA3A 4KN7X 3ZP5A 4M6YA 2YPRA 2QM3A 3TDUC 2KIUA 2WWYA 1LDDA 1OYIA 1I6XA 2Y0MA 2MC3A 4IF4A 1G4DA 5LGTA 4BHCA 2MH2A 1BOAA 2M1BA 5ERIA 3T0YA 2YX7A 1IN4A 4H0EA 1YLFA 3C7JA 1VTNC 1KU2A 1WRJA 2RQPA 3L9FA 1F5TA 1TW2A 4FHTA 4A2UA 3ZN0A 4ENMA 1FBSA 2AS5F 2FRHA 4I01A 4A6DA 1D3YA 2OD5A 2WTEA 1IW7F 3LQRA 2L02A 3LAPA 1F1ZA 3I53A 5DEQA 2MLGA 4U88A 4BYYA 4EJVA 3F8MA 2IT0A 1ZLJA 5DCMA 3ULQB 3S2WA 2ZMEB 1S7OA 1S29A 3E6MA 2M8EA 1EH6A 2RNJA 2A5YB 2XAGA 1SD6A 4R79A 1XB4A 1FOKA 3LA2A 4UUVA 1IN7A 5ICEA 5D5VB 3GO5A 1R36A 1MJ9A 4XLNF 2UZKA 1G3WA 4WWCA 1F9NA 2ADUA 2IW5A 3J7AO 4AVPA 3DFGA 2BBYA 4O5VA 5D5UB 1KQ9A 2EB7A 2Z9OA 5L3CA 2VBXA 1IRFA 2Z5UA 1XMAA 3KETA 3BWGA 2HZTA 3HRMA 1R1UA 4XBFA 5HDGA 2Y48A 3U9GA 3M9AA 3WTWC 4RAZA 4XSXF 4KYWA 1P2FA 3F8BA 3RKWA 1U5TA 1ZHFA 4LK0F 1BI1A 1XD7A 1DDNA 3T8RA 3JAMK 3BZ6A 3J80Z 1BI0A 3I64A 4I7HA 3TGNA 2KJCA 2ZFWA 2VOPA 2L4AA 3WGIA 5LLQA 2ZKZA 5H6QA 3F72A 1RNLA 4HV6A 4G8XA 3OOPA 5DUKA 3L7WA 4BNCA 2HS5A 1SFEA 4EJTA 1HXDA 3V8LA 1LVAA 2O8XA 1KQ0A 2VBYA 2M5WA 1QZYA 4PGGA 1OKRA 2QLZA 4HX4A 4CYDA 2ZJ2A 2G9WA 4EV0A 3CLOA 2EV0A 5FO5A 1XGMA 3V7SA 4LB6B 1GXQA 1O3QA 1IXRC 1TTYA 4RGUA 3V7CA 1J75A 1DP7P 4HA8A 3F23A 3LQQA 3DPLC 4G7HF 2K86A 3QPTA 1ON1A 4KA4A 1SFUA 1GXPA 2EK5A 2D1VA 1PUEE 5TJJA 2DBBA 5K5OA 1X3UA 4I0BA 2RC4A 5AIQA 3IL2A 3B73A 3CDHA 4Q47A 3N4MA 1TQIA 4KUMA 3F6VA 1UHWA 1Z05A 1FBUA 5L3BA 1XSVA 1DPUA 4A0ZA 4FX0A 2K02A 2PMUA 2VE8A 3P7NA 2P5KA 3R4KA 1IN5A 3KP3A 4HF2A 3KP4A 1UB9A 3JSOA 4OU0A 1J0RA 1K78B 3KZZA 4ZYGA 1IXCA 5JHUA 4HDUA 1FNNA 1OYYA 3F8NA 2ZBKA 4G6DA 1TNTA 3ZMZA 4PZJA 5JR3A 1U8RA 2Y75A 4ZYHA 3F8FA 2DPUA 1B9NA 2O03A 4KMFA 1Z6RA 3HSEA 2P8TA 4CXFA 1R5HA 3R0AA 4BH9A 3E5QA 5FFZA 2HOEA 5E17F 3WODF 3E5XA 4HYEA 5D5WB 4HQMA 1G3TA 2EA2A 3COAC 3C3WA 3PFIA 3WTZA 4R1HA 5KK1A 2D2WA 3JAMZ 3MQ0A 2NNNA 5DYMA 2DQLA 3MEXA 3QU6A 4BHBA 2A68F 4KDPA 2W57A 1D5VA 2LF8A 2J5PA 1P4AA 4OIQF 2MH9A 2A6HF 2P5LC 5BMZA 4K2EA 3V4GA 3QU3A 1FYKA 3QPHA 2YU3A 3PQJA 3KP2A 2X0LA 4EGZA 1SD4A 3WGHA 1J2XA 2R3SA 3KLOA 4RB0A 4RAYA 3JSPA 2HEOA 4OOIA 2VC0A 4KIGA 2O61A 4CICA 1QPMA 3KFWX 4QWQA 1IXSB 4MNUA 1U78A 2VOOA 5DUIA 2FXAA 2XIGA 4PCQA 1T38A 2A3SA 4GXOA 2PQ8A 3GFMA 4L9JA 1W7PD 4LG0A 1YYVA 3BJOA 3T8TA 1L0OC 4Z2YA 3FWEA 3E3VA 4M9SA 3E5UA 4LD5A 3GFLA 2BE5F 4RB1A 5EEGA 3EUHA 2XKOA 4OIRF 2E7WA 2DU9A 5DD8A 2RDPA 2XAJA 2QBYB 4NQWA 3IWFA 4M71A 3MCZA 1XDUA 2BEOA 1KU9A 1ZGAA 2E7XA 1H9TA 1FY7A 1T39A 3R6SA 2COMA 2DTRA 4P96A 1CF7B 2HTJA 5BS6A 2VT3A 1R22A 2ESHA 1J7KA 2LF7A 3DQVC 3WU0A 4HF1A 1ONVA 5ILUA 3RPUA 2YX4A 2F5DA 3NRVA 5HS7A 1U5TC 5HLGA 1MJAA 4L9VA 5HLIA 2VN2A 4WCGA 5D5XB 3I0TA 3P9CA 4M9XA 2XUBA 2QYOA 3M8FA 5E18F 3K1MA 1T2KA 1K6OA 3EYIA 1ODDA 1WQ2A 3HOTA 5E20A 1H0MA 2JTVA 5JVTA 4OIOF 4ZH4F 1P6RA 2M30A 1ZRDA 1BI3A 3L2CA 3J80K 1BJAA 4AIKA 2L3DA 3WU1B 2Z33A 1FP1D 1YW7A 2VODA 3LA7A 3RKYA 3GF2A 1BI2A 4O3MA 3IHUA 3HTSB 1ON2A 1KGSA 3FMQA 4QLCU 4LGWA 5K5QA 4KICA 6PAXA 3IRRA 4ENKA 2PBIA 3CUQA 4CZZA 3GW2A 3SZTA 3ELKA 2EFPA 2EJRA 1TQPA 1IAWA 1W4MA 2CO5A 2M87A 5LRSA 1SD7A 2LKPA 3BJ6A 5D4RA 3SQNA 1XSXA 4XLPF 2V1UA 4EJOA 1GHCA 2PLYA 3HTUA 4BXUA 1OPCA 1ZARA 3K1NA 2E1CA 1BM9A 4A6EA 5E1WA 3DKWA 1R1VA 3TKYA 1YS6A 4LJZF 2EFOA 2CSOA 2DK5A 4G7OF 3TO9A 1O3RA 4IJAA 1K78A 2VE9A 3FMSA 2STWA 4KIBA 2JSCA 1DPRA 2UXXA 3G73A 4YG2F 1LDJA 1K7AA 3W6JB 2FSWA 5ED4A 5FGMA 1SAXA 2Q8KA 2HQNA 4HDVA 3PQKA 2EFQA 3MZYA 5L3EA 2KIMA 3T1BA 5L3FA 2QENA 3EYYA 4GYIA 4WX9A 1FPQA 2JPBA 2CW0F 2MLKA 3WE2A 2C6YA 2GQQA 2DO7A 2Z3YA 1U2WA 1S6LA 4R8HA 4KFCA 4I98B 3H3UA 4Q48A 3GZ5A 4BHPA 3IRQA 4BAYA 2QZ8A 1YIOA 1FC3A 4U0WA 4M9ZA 3ZMSA 3VB2A 2NS0A 5CVVA 1FP2A 4LLLA 4OIPF 3W6KB 4G7ZF 1UCRA 5F64A 2GXBA 2PFBA 2ISZA 2D1HA 2VONA 3BPVA 1IF1A 3DP7A 2FBKA 1HW2A 1LEAA 1FYMA 1TW3A 3RDIA 4D0PA 3DXJF 1ZG1A 1ZRCA 3HSFA 3GUDA 3F8CA 2RV8A 1W7PA 4HX7A 2G7HA 3MAJA 1KYZA 1IUYA 1IZ1A 2P6TA 5LRRA 2F5EA 3KEQA 4EM2A 1I27A 2NAZA 5H6RA 2BGCA 4DQ2A 3TOAA 4EM0B 2V1XA 2XAQA
chains in the Genus database with same CATH superfamily
1HKTA 4M74A 4ON0A 2CUEA 2QEXI 3EETA 3EDPA 1UFMA 3GTGJ 3S2HJ 4B44A 2FQ3A 1I1GA 3K4JA 1GDTA 1RI7A 2DFHA 3GFIA 1USTA 3AAFA 2X1DA 5F0CA 3I54A 5AONA 3D0SA 5TRDA 1OCCH 1YX5A 1QRYA 3HXLA 4F7ZA 3JRGA 4BE0A 2JRTA 5EEAA 2A6EF 3U1DA 1IO2A 1ZK8A 2NXNB 1POGA 1JXSA 3EUHC 3REOA 3UKGA 3K1PA 3UR3C 1D1BA 2BOLA 2EH3A 2R7WA 2W1OA 3TOBA 4S04A 2EV5A 2XSDC 2M7AA 2ECCA 5CVUA 2IP2A 1X1CA 3WG9A 5HLTA 3OYGA 1WSUA 2P5VA 5KHDA 1FX7A 3K2ZA 4BEHA 3DWLE 1Y1VJ 3F3XA 4BKXA 3GX4X 3MZ8A 1DGWY 2W85A 4LOCA 2H94A 4HX8A 3ZMUA 3CQZJ 2ZCWA 2X48A 4P1WA 5DM6F 5ICGA 2HVSA 1CF7A 4UHTA 2LREA 3RIRA 1XS9A 2OBPA 1QGPA 2DK8A 3DF8A 3OYMA 1VQOI 4BE1A 2PMHA 3OYCA 3A01A 2IJLA 3D5LA 2XGXA 1GT0C 1H89C 1OCZH 1T98A 3K4BA 2Q2EB 1IN6A 2LRDA 3K4KA 4X0GA 1ETKA 2OF7A 2FNAA 4DYCA 3LFUA 5EZGA 5BPIA 3ZRGA 3TBIA 4BGDA 4MEXF 2OUMA 4NNJA 5DDGA 4Y33A 4ZYEA 2EZLA 5EDNA 1XGSA 1VQPI 2F5CA 4ZZLA 4XRMA 4DZPA 2HTSA 1ETWA 1LFBA 1XMKA 4BJ5C 2QCOA 3FKJA 1TWGJ 4IVNA 2HU9A 3P9KA 1HDDC 4KITB 3M7GA 5LGNA 1B4AA 3PM1A 3K70D 1HSJA 2HYJA 2O7OA 3HKZN 3MFKA 1RUOA 3SDBA 3W6VA 4E70A 2HKOA 3BQYA 5EEHA 3C2BA 1TP4A 2OZ6A 3DV8A 4AU7A 2LYCA 3CLQA 1MBJA 1VQ4I 1VI0A 2H6CA 1WI3A 1HW5A 3FXOA 1RRJA 4NB5A 1BC8C 1ZREA 1VQ5I 1P4WA 1QO0D 2FF4A 1TWHJ 1SFOJ 4XM3A 4A0XA 1RESA 2E2IJ 2W00A 4LLNA 1IRZA 3S3OA 2JWTA 3RYRA 2L54A 1B6AA 1SMYF 2VXDA 4ZDPA 1JJ8C 4BQAA 1R5GA 4CHUA 2HVQA 3ABMH 1NHAA 3I3LA 5CPRB 1PDNC 4UV9A 4RAFA 4J19A 4LMYA 3L09A 1ZLKA 3R0JA 4IRHA 1LQ1A 1Z7UA 3H36A 3I4PA 4GRIA 3O8HA 2QF7A 4XR6A 4HF0A 2JN6A 2MD5A 2L9NA 3CUQC 2CUZA 3MMYB 1WI9A 2LBFA 1SC7A 1QU3A 3VYTB 2CMPA 5EGOA 3I59B 4P9UA 1G6NA 5BQTA 2F4IA 1PVEA 4NBQA 1TQMA 3FXRA 5M3MJ 3FHZA 4M73A 4TV7A 3OYIA 1IC8A 5LD2C 5IOYA 1U8BA 2IEKA 1BR2A 3W2WA 4XRSG 3HOWJ 5E3NA 1HCRA 1MBHA 1KQ8A 1Z77A 4AUXA 1XDSA 2DOEA 2WA0A 3IWZA 3ZQFA 4HLYA 5ILSA 3S1NJ 2XASA 4HLXA 2I5UA 3FXUA 2FA5A 3FF5A 1YE9A 3GZNB 2COBA 4L9NA 1S5LC 3HC7A 1R1TA 2L01A 1JE8A 2BYVE 3MD2A 3OYBA 1R23A 5H20A 1ETVA 2BXYA 4EGYA 4IRIA 2LVSA 2EIJH 2RGVA 2LY9A 4L5JA 2V6CA 3QWLA 4PJLA 1ZN2A 4M3DA 3I71A 5KVRA 1F4KA 5M5WJ 4HQEA 4HOBA 2X1CA 3OR1C 1FOWA 4IO9F 4IHYA 4B09A 2V9VA 3FM3A 3RPQA 4AIHA 2DMNA 1EJ9A 1F36A 3VYRB 1CGPA 3BTIA 5J8FA 5GTHC 1SFXA 2FMLA 1TLHB 4XK4A 1AWCA 1R7JA 4FTHA 2MYSA 4MQVA 1TBXA 2DA1A 4Q5SF 2RN7A 3BDDA 3SZPA 2W24A 5IY5H 3CCQI 2HQRA 2R7SA 2NVYJ 2K7LA 2W25A 5FKOA 4RGSA 5J8CA 4ENNA 2M4KA 5CJ9A 1MMAA 5FJ8J 2KKOA 1SVLA 2G0EA 4PGHA 4BY7J 1WJBA 3HOZJ 2DA5A 3WTUC 1MIJA 5F04A 3WTXC 4OAZA 3M8EA 5FROA 3QRFF 3SEQA 4CUGA 3BG3A 2DFFA 4V2GA 3HDDA 3LSIA 1WWXA 1C0WA 1Y8QB 2ELHA 2HWVA 3LWFA 2ZMEA 1ETQA 3E97A 4DJAA 1E17A 4GGGA 3DLLF 2O0YA 1G3SA 1WJAA 4A3LJ 1IDYA 2XRNA 1DU6A 3ZQ7A 4G12A 2XSJC 3CMYA 5IYBJ 3S1QJ 2M45A 5D6EA 4EJUA 5JHFA 2L9SA 1TL8A 4B47A 3IKTA 2ID6A 3SZGA 3CDIA 1I1SA 1YTYA 1A5JA 2DN0A 4E7ZA 3OMYA 5C3EJ 3LL7A 2DMPA 5FLXZ 2BV6A 3OYNA 2AXLA 2BHZA 1REPC 4HBLA 3VYUB 2CS3A 3WE3A 2FE3A 2OU2A 5GAEJ 4ANJA 2HYGD 1X58A 3RZOJ 1XN7A 4IL6C 1EV7A 3Q9SA 4LLGF 1I50J 2KRCA 1S7EA 5D6FA 3LOCA 1JT0A 3VWBA 4L18B 9ANTA 3PO2J 3DPUA 3AG4H 3ERED 2KDOA 5IP6A 2V9PA 2XF7A 3Q0WA 4XKCA 3I5UA 2JZYA 2V7FA 3V7RA 4UB6C 4BQQA 4C3HJ 1TT5B 4XLHA 4E4HA 4CCLA 4RB2C 2LNBA 2VXZA 2OTJI 1RUNA 3VEPA 3CD6I 4LFUA 3ZXSA 4A5NA 2PEXA 4KN4X 2PMZN 3HKZA 3OIPA 1Q1HA 2CYYA 2V26A 2H1KA 2KP6A 3ROUA 3C18A 4C2TA 1E3PA 2VKEA 4S0HB 4XIDA 2H6BA 4YELA 1MD0A 2MFZA 2HXOA 2EA4A 5GP9A 1FIPA 1VQKI 5FLVA 3BR1A 2CQKA 4D1QA 1E2XA 2BY0A 5LEJA 1AU7A 3DBLB 1ORKA 3QP6A 5DD4A 3FK6A 3SHFA 1KU7A 1XSDA 3F22A 5J4VA 1DUXC 2PX9A 4JK1X 1QBJA 2VB6A 3RKXA 3U1KA 4XRSA 1WCMJ 4DBQA 4IHWA 3LSPA 3GZ6A 2FEZA 2PN6A 3EQLF 3TDZC 5DTDA 3S15J 3E7LA 1Z9CA 4RLFA 4Y3OA 3ZMVA 3R60A 4NC8A 4MHGA 1U9OA 3FZVA 1SMTA 2LH9A 3RZDJ 3ZQGA 2RKHA 1JUMA 4KIFA 1FBQA 1Z1DA 1E3OC 4L9TA 3CJNA 2KRFA 3H3ZA 4PUSA 1O57A 2K27A 3RQIA 1RKWA 3Q5FA 1D1AA 3CCYA 2P81A 1HQCA 2MSYA 3JRFA 4RDUA 4BDYA 1LE8A 1IN8A 2CV1A 4WXDA 3MKYB 3GLLA 5CVRA 3ABTA 1H88C 4F3QA 4UVAA 5L3GA 5FFXA 2OZUA 1KU3A 2GAUA 3HOSA 4W1UA 2WB1N 3BCAA 3IAM2 3W2VA 2A61A 3H5RA 3KIOA 4CYCB 2F5FA 1I5ZA 4P55A 1BA5A 2F4OB 2DAOA 4L0ZB 1V3FA 4PFOA 1S7AA 3K69A 1JTYA 2IAIA 5ICFA 4B1RA 3TL4X 3OIOA 3OYJA 3BG9A 3E6DA 4RS8A 2ME6A 5E3OA 3OYEA 2GOMA 4KISA 1EH7A 1R4MB 4U7DA 3BR5A 4AD9A 4U0VA 5DS9A 2R7DA 2FU4A 1MMGA 4C3IJ 4WK8F 2M34A 3S8PA 4D7MA 3I56I 1B8IB 1BC7C 3PO3J 2D45A 1QHGA 2ZJQF 1Z3XA 2H8WA 2VKDA 3PNYA 3HHGA 4RGRA 2W48A 3M1EA 4E7HA 2O3FA 4LK1F 4FT8A 4A0YA 3AG3H 1ZYRF 2FBIA 3HGGA 4F52A 3GTMJ 3CO7C 5B66C 4U7BA 3FK7A 2CG4A 1L3LA 1IV8A 2FNPA 4HRIA 2LDUA 1FSEA 2A07F 3VDXA 1ETOA 5BNGA 3L2UA 2XV4S 2HYFA 4YFXF 3R61A 2K9NA 2RREA 3K7AJ 1BIAA 1U3EM 2F4MB 2R7OA 1W5SA 1QVTA 2XKPA 4MTDA 1UJ8A 3W2AA 1STZA 2GIZA 3BG7A 4HZFA 3E6BA 3S2DJ 2EFNA 3KP5A 1HDPA 2FJ1A 3FM5A 3N05A 1NK2P 3KEOA 4NDLA 2WV0A 2XVCA 1EKEA 3QOEA 5LHIA 4C3JJ 3LFKA 2Z99A 5J4YA 2NVQJ 3E0JB 3PFYA 2NVXJ 2EFWA 4DGWB 3P9IA 5HNFA 3QP5A 2XAHA 3IV5A 1MDMB 1E0EA 2A5WA 5LBQA 3MKWB 2K9QA 2EBIA 1P7IA 4ASNA 3S3MA 1XPXA 1RKTA 2V1DA 2VJ5A 3OS0A 5E1XA 2QQAA 1T0FA 1V4RA 4QPOA 3RYPA 5KNLA 1TNSA 3VFZA 1K4TA 3V8KA 3H35A 3O3KA 1IRGA 3DU5A 2ZC2A 3VOEA 1N25A 5D8KB 2J5OA 1FZPB 4MFDA 2XAFA 1WPKA 4AIJA 4N9IA 4C2UA 4Y17A 2DDAA 5D4SA 5M3FJ 4GYGA 4DYQA 3QOPA 4OINF 1O3TA 4RB3C 3LAJA 2JVHA 4PJ0C 3BZCA 5HDNA 3KX2A 4Y7NJ 2XPUA 3RCOA 1JGSA 1P92A 2HKXA 2WAQA 4LIUA 2HPMA 1G3YA 2GA1A 1ZR2A 3BLYA 3I59A 4J01A 3LNQA 1YS7A 5J1YA 1MMDA 5J1RA 4ZDOA 4LG0B 5LEKA 4N9HA 4LIVA 2NNYA 1E3HA 2CGPA 3MVPA 5HOOA 2W84A 3A4CA 4QTRA 3E6CC 4JX4A 2M3AA 2E35A 3FISA 4PDKA 4S05A 4UB8C 1O7FA 3IKVA 1XCBA 3BPXA 3S16J 3NWTA 3CO6C 3IH4A 4BJTA 5CLSA 1J9IA 1Y0UA 2R93J 4ESBA 1JJ6C 3TW6A 1PUFA 1R5ID 3I58A 4CA0A 4L0YB 2R7FA 3K9TA 5CVIA 1G59A 4XRFA 5EJCA 4ESFA 1QVUA 2KIFA 5EG0B 1PP8F 3GYHX 4KNYA 1OYWA 5CVJA 3F21A 1D0YA 2JUGA 1S3JA 1LB2A 2DLLA 1WGXA 4A12A 4I09A 1LDKB 4MQ9F 2DA6A 5K5RA 4L5IA 1A31A 1BL0A 2VBZA 1UAAA 3HGYA 3ZMTA 2ACJA 1LJ9A 5E8IA 1WH7A 5LHHA 2ZJPF 3K10A 3ABUA 3MWMA 2DODA 1X4PA 2A69F 4RBOA 5HVQC 4W97A 2DI3A 3QQAA 3TO7A 2X9DA 3LSMA 3ML6A 4MLOA 2VPLA 2DYSH 1FWZA 1SD5A 2IPQX 3IAS2 3OYDA 1HW1A 3DBRB 5J1UA 3ZOBA 4JP0A 2WAEA 3FXLA 1Z3YA 4Y13A 1KYWA 1ZGWA 3CCLI 4IHTA 5J6XA 2LOOA 2EIKH 3JRAA 2Z16A 3CP2A 3H0DA 3WU2C 3PUFA 1T33A 1K6YA 3WTSC 1CQTA 1UMQA 4EM1A 4DZJA 4HV5A 4G9YA 5GAHJ 1KA8A 3LSJA 2IS2A 2ZMEC 3HIFA 4G6TB 3DPTA 5C44J 2M4GA 3GCMA 4AC0A 2L7KA 2WC2A 3G1OA 1SFKA 3CJRB 4XOTA 1VZ0A 3NARA 3VODA 4A5MA 4F91B 2LFBA 5A2QK 3B02A 2K4JA 3QAHA 2P4WA 1YOVB 2HQAA 1FMVA 2LSOA 3MZHA 5F6FA 3CCSI 2CWEA 3GTJJ 3OL3A 2O6GE 2R7RA 1MBGA 3QPLA 3GWZA 3CMAI 4UUTA 1T95A 1MSEC 2ZB9A 5FKKA 4CSWA 2STTA 3K4CA 4XNFA 4IRGA 1YQAA 4UY8I 2LMDA 2ZJRF 3OY9A 2EV6A 1Y8RB 3FX3A 3DTKA 3CZ6A 4FASD 2H27A 3U2RA 2BW3A 2DYRH 4HSTA 5KAIC 2YSRA 2QBYA 1R00A 1IRXA 2XF5A 3OIQA 2CFXA 3H5AA 5FKMA 3WTTC 4HW0A 3K6GA 3PSIA 2ZXJA 1H9GA 1V5EA 4MEYF 4CCNA 1NK3P 3QPSA 2B63J 2QSHX 2NOGA 1EH8A 2ZNZA 2E1NA 4NC7A 2ISYA 1YW9A 2XGCA 1BIBA 5HS9A 5F1JA 3CTAA 1XMXA 4E7KA 5DCFA 2DQRA 3KZYA 2Y69H 2LD5A 1WZ2A 3C1DA 2L0KA 2KDZA 2PJPA 1QZZA 2JT1A 4LG3A 1SAUA 2JJ7A 2VQGA 3FMRA 2DFEA 3CUQB 2XHKA 2HDWA 2L7ZA 2WV1A 4FE7A 4J00A 5FLXK 4ETSA 1IV6A 1BN5A 3CC7I 2QGUA 1X3WB 2F6CA 1ZRFA 3A03A 3SYTA 3BOQA 3BP8A 2YUSA 3P5JA 1PYVA 3GFJA 3HRTA 1S8NA 1WVRA 4ENJA 2KISA 4PSXA 3G3ZA 4BBSJ 1D0ZA 3FKIJ 2GBYA 4D9JA 5GAGJ 2IVMA 3X2QH 4P5OA 3L2WA 2CUFA 1IUFA 3Q9VA 3SJMA 4CGZA 1ZTRA 1OCOH 2QUFA 3JRIA 2MBFA 1MZBA 3HRUA 2UWMA 2OPTA 2O8KA 3OV8A 3L2QA 5E1ZB 1GUUA 3F6OA 4FX4A 3J81K 5HLHA 3DEWA 4DBRA 5HS8A 4EMSA 2X6WA 5FKNA 1WKMA 3OYHA 3LMMA 5TGTA 1AKHB 3OYFA 3TO6A 4HNUA 1T8IA 2CFOA 1OMIA 5EF6A 4NUBA 4HAMA 1BW6A 1JHHA 2X4HA 4WF2A 2P6SA 4UNOA 3HYIA 4WXCA 1YJNI 1JGGA 1RR7A 2DA7A 5L3DA 5FRNA 2QWWA 3O2PE 3WTYC 1TZLA 4Q4ZF 2ICWG 2R5ZB 3SFIA 5GPCA 1BBYA 4PFPA 3GLXA 4M6XA 4UVBA 5KCMA 4A3KJ 2OAZA 1S72I 1W5TA 3HUGA 4XQFA 4AYBN 2DA4A 2HNHA 3QYEA 1Z67A 3JR9A 2E71A 1X1DA 1YW8A 4BUPA 3AG2H 4OMZA 3T5XA 2E34A 3DTEA 2DPDA 5K7ZA 2NRAC 1N75A 4B3AA 4E7IA 4KJZA 5F0FA 2P7CB 4NHJA 3K4LA 3RTRA 1B59A 1WJ5A 3NEUA 2GIVA 4IPAA 2PJRA 2JA6J 5DCMB 1UG0A 1ZH5A 4YIFA 3JRBA 1R71A 3AL0B 3K70C 4B4CA 2OTLI 3L00A 2L9RA 4IXAA 3SFZA 2JPCA 2XGDA 2OQGA 2NYXA 2JRMA 2PG4A 3RQ4A 3ZGKA 1TWAJ 2ETHA 2R5YA 1J5YA 3ZPLA 1D8KA 1U9NA 2K5CA 1HC8A 4JQFA 3RI4A 4A3BJ 1LNWA 2FMYA 4CCOA 1Y6IA 5IT9K 2LG4A 4CO8A 1ZQ3P 1JUSA 2Y0SN 2QVOA 2Q0OA 3OSFA 5FD5A 3S32A 2EPFA 2TDXA 2FOKA 1KONA 1ZG5A 1ETXA 1XCVA 1RETA 2DFIA 2KL4A 5EZHA 1OR7A 5HDKA 3ASNH 1R58A 5LHGA 2VASA 3JTGA 3A02A 1YJWI 4I02A 4B3XA 4YEJA 4CDGA 3H1CA 3GTLJ 3FXMA 4P9FA 5D8LB 2CJJA 3KE2A 2FQ4A 3S3NA 4N0BA 4EJWA 1X1BA 2HGCA 5BOXA 3PIOF 2DT5A 2QQBA 3BROA 4UV8A 5GADJ 5A2QZ 2VLAA 4F93B 1FYLA 3RKQA 3ZQLA 3OYLA 2NVUB 4O6JA 1XGNA 4Y4RA 1ZG3A 1U5TB 1MDMA 2BY2A 4ZYAA 2ESNA 3N97A 2VQLA 2N8GA 2GZWA 4YFKF 4HNTA 4UVCA 2IRFG 1T0FC 4N4NB 3ECOA 4XKWA 2VT2A 3RJPA 3KYLA 1Z7LA 1H8AC 3HM5A 2K3PA 4MTEA 2L4MA 2RVCA 2W82A 2AQEA 2DJNA 5JLXA 1W7PB 3ZQCA 2KJBA 2EZHA 2YU9J 4EVIA 2ZO4A 4G94A 3SXYA 2YR2A 3JCUC 3BJAA 1I39A 2P7VB 3ABKH 3FHNA 4M72A 4B8XA 1FSHA 4Y15A 4EQQA 4BJ6C 1U6GA 2IXSA 1B9MA 3BTLA 1FT9A 4MGRA 1YRNB 3I4MJ 4ZYDA 4I0AA 1BJZA 2RAEA 4H4KC 2UXNA 3BR0A 2M8GX 3L2RA 1EF4A 3WTVC 1FMWA 2R7QA 4G6QA 5JI6A 2F2EA 2MD0A 1MKMA 4QPQA 3CUOA 2R7UA 3GMEA 2HXIA 2Z1DA 1ULYA 2EWNA 3L2VA 2DJIA 2GM4A 1VQLI 5JFRA 3M8JA 2QQ9A 1XGOA 2Q1ZB 3UNGC 5E3MA 3HEFA 5IT3A 2FBHA 1W1WE 1JUPA 1HSTA 3HRSA 3SDGA 1Y39A 5FRMA 4ZZDA 3VSKA 2XPVA 4DNCA 1TWCJ 1G2HA 2E1MB 3BTJA 4KT5C 2LP0A 1OQYA 1MBKA 3OWTA 5ILVA 1T6SA 1ZELA 5FB2A 2WAQN 1QQIA 1NH3A 3BY6A 3FBIB 4XKBA 1YFHA 1D8JA 4IHSA 5K1YA 1X3ZB 1YG2A 5TISC 5JVGF 3J7ZI 3ECHA 2K4BA 3J81Z 2LK2A 2ZNYA 3WGGA 3KP6A 5FD6A 2HZDA 3GEZA 4GO1A 2GXGA 5LFAA 3JW4A 1LEBA 2G7UA 5F1RA 4ESJA 4N4OB 1PJRA 2FX0A 2V79A 3G1MA 2EIMH 5LGUA 3GXOA 4UUSB 2IS6A 4MO7A 4ABZA 2XRLA 2JA2A 3PUBA 4AWXB 3CC2I 3GVAA 1LVKA 5BPDA 2H09A 1RZ4A 4YRVA 3HSRA 1I3QJ 2VQHA 3KP7A 5CQEA 1GVJA 4UXNA 1FOXA 2VJJA 3GTQJ 5DV5A 3DEUA 1UHMA 1YI2I 3OOUA 4PJNA 3KLNA 3ZN1A 2X6XA 3Q0UA 4AYBA 4D7NA 2HDCA 3KCCA 3H3VK 2HFHA 3LSTA 1O7LA 1P4XA 3O6BB 1Z6TA 4KMUX 2HOTA 3CCVI 3PJRA 2DTZA 3FIWA 4WXHA 2W7NA 2GWRA 3CCMI 1JHFA 3G1LA 1MJBA 1VFCA 4JBAA 2VBWA 3CC4I 4X1EA 1J59A 2RNGA 4CCKA 2BZTA 3JTHA 1ETYA 4U0YA 1QNTA 2B0LA 4RA2A 4OMYA 3FXQA 4XN0A 4BDZA 1A04A 3K0LA 3HPHA 2IA1A 3ERMA 1OCPA 2QQ8A 5E79C 1R49A 1AOYA 1HKSA 3DU6A 1K79A 1B1BA 4BBRJ 1FJLA 1P9QC 2DOFA 1PP7U 2MC4A 2CQQA 1ERDA 3OYKA 1D1CA 4BS9A 1HLVA 3B6AA 2IA2A 5CYVA 4XOPA 1ZAOA 1A6QA 2HQ5A 5ICCA 3ZMDA 1W36D 2KQRA 3PL8A 1O3SA 5IT9Z 3HBLA 2GA2A 1IGNA 1DU0A 2HR3A 2OA4A 3KPHA 4GCVA 1YHQI 3TP3A 3ISPA 1OISA 3IC7A 2Y0SA 2M0CA 2DCEA 1MGTA 3HOYJ 2K9LA 1I3AA 2VC1A 2VJIA 4D5CA 2Z2SB 4I2OA 4FQGA 4YFNF 3DCFA 3V8JA 2XROA 2DDBA 3SEZA 2W4SA 2Q2EA 2JA5J 2MA3A 2LKXA 2LBFB 2MW8A 1D0XA 1Y56A 3I55I 5EGOB 3TQNA 2DW4A 5E8GA 1HKQA 3QYFA 1ZGJA 1USSA 5B1AH 2PI0A 2OQRA 1A6IA 1IJWC 1UHSA 3HHHA 5AIPA 4RGXA 3NQOA 4RAGA 1YO5C 4XSZF 1HBXG 3DBHB 2OJED 2X1EA 4DYRA 1QA6A 1HOMA 3C2GA 2IA0A 3H92A 2Y2ZA 5E3LA 1Z91A 2VKVA 2JMWA 3QODA 4YIIA 4LB5A 2R0QC 1RIOH 3LA3A 2TRTA 4PK4A 5IPAA 1WJDA 1VQMI 4KN7X 2L7MP 3ZP5A 4M6YA 2YPRA 1WJCA 2QM3A 1MSFC 3DKXA 5B3SH 2TCTA 3TDUC 2GXAA 1JT6A 2GOXB 1S9HA 2KIUA 2WWYA 1AKHA 5IYDJ 2DT6A 1LDDA 1OYIA 1I6XA 2Y0MA 3DTIA 2KIQA 2MC3A 1TWFJ 4IF4A 1G4DA 5LGTA 4BY1J 4BHCA 2MH2A 1BOAA 2M1BA 4HG2A 5ERIA 3T0YA 1IG7A 2E36A 2YX7A 1IN4A 4H0EA 1YLFA 3C7JA 4CCJA 1VTNC 1KU2A 4II2A 1WRJA 2CV2A 2RQPA 3L9FA 1JKOC 1APLC 1F5TA 1TW2A 3F0CA 2XF6A 4FHTA 4EATA 4A2UA 2R4GA 3ZN0A 4ENMA 1FBSA 2E19A 2AS5F 2FRHA 3CMEI 4I01A 4A6DA 2BY3A 1D3YA 1TC3C 2OD5A 3JRDA 3OSGA 2WTEA 2R7VA 1IW7F 3LQRA 2L02A 2X51A 4GFBA 3LAPA 3BQZA 4MIMA 1F1ZA 2KPMA 3I53A 5DEQA 1XTAA 2MLGA 4U88A 4BYYA 4EJVA 3F8MA 2IT0A 1OCTC 3S1MJ 1VQ7I 1ZLJA 5DCMA 3ULQB 4I76A 2E60A 2ZMEB 2K3FA 1S7OA 5EYRA 1S29A 3S2WA 3E6MA 3IH2A 2DA3A 2M8EA 2WADA 2HI3A 2RNJA 1EH6A 1SVOA 2A5YB 2M7BA 1DQUA 2XAGA 5J40A 3MN2A 4F92B 3HJEA 3J7AY 1SD6A 1MNDA 4R79A 3V42A 1XB4A 1RPWA 3E1SA 1FOKA 3LA2A 4UUVA 1IN7A 5ICEA 1SEUA 5HODA 5D5VB 3GO5A 1R36A 1MJ9A 4XLNF 5IP9J 2UZKA 1G3WA 4WWCA 2B9SA 1F9NA 4GDFA 2ADUA 2IW5A 4XICA 1HA8A 3J7AO 2EZIA 4AVPA 4DOZA 3DFGA 2BBYA 4NQWB 4B48A 1OR7C 4O5VA 5D5UB 2QSFX 3EUAA 1KQ9A 3IP4B 2L9VA 2EB7A 2Z9OA 5L3CA 4ZTJA 2VBXA 1IRFA 2Z5UA 1XMAA 3KETA 2ID3A 3BWGA 3I9V2 2HZTA 3HRMA 1R1UA 4XBFA 5HDGA 3G71I 2Y48A 5IYCJ 1W0UA 4JOMA 3U9GA 1Y0NA 3M9AA 1LKXA 3WTWC 4RAZA 4XSXF 1LFUP 2YS9A 4KYWA 1P2FA 3F8BA 1UELB 3VSLA 4QSHA 3RKWA 2MG4A 4D5FA 5M5XJ 1U5TA 1ZHFA 2ZXIA 4LK0F 4RLQA 1BI1A 1XD7A 1DDNA 1VQ9I 3T8RA 3JAMK 1MW7A 3BZ6A 3LSHA 3JRHA 2V4JC 1BI0A 3J80Z 3VYSB 3I64A 4I7HA 1YX3A 3TGNA 2KJCA 3LSRA 2ZFWA 3CF5F 2BY1A 3DLAA 2VOPA 4BXXJ 2L4AA 3WGIA 4AVZA 1ZR4A 5LLQA 3ASOH 3RPUD 1WH5A 2ZKZA 5H6QA 3F72A 2IS4A 1RNLA 4HV6A 5IP7J 2XC7A 4G8XA 3OOPA 1YRNA 1MNEA 5DUKA 3L7WA 4BNCA 1SANA 1VNDA 1YIJI 4XL9A 2D5VA 2HS5A 1SFEA 4A3MJ 4EJTA 1HXDA 4FISA 3V8LA 3GTOJ 3TMOA 3S93A 1LVAA 2O8XA 1KQ0A 2VBYA 3D5SC 2K40A 2M5WA 1QZYA 1T56A 1G8XA 4PGGA 1OKRA 2QLZA 4HX4A 4LITA 1FTZA 4CYDA 4AM3A 3A0HC 3BG5A 5F0HA 2ZJ2A 2B7EA 2G9WA 4EV0A 3CLOA 2EV0A 2A6TA 5FO5A 1LE8B 2FUG2 1XGMA 3J7YJ 3V7SA 3F9KA 4LB6B 1GXQA 1O3QA 1MNMC 1IXRC 2LC2A 4C9YA 4PJMA 4FCYA 1TTYA 4RGUA 2Y31A 3V7CA 1J75A 2HVRA 1DP7P 1T08B 4HA8A 1DGRM 1D5YA 4A3DJ 2WY7Q 3G6EI 2H1LA 2VPRA 4FETA 2M0MA 2V6EA 1FOYA 3F23A 1A35A 2OC6A 1W5CC 3LQQA 2VUMJ 4BE2A 3DPLC 4G7HF 2CUJA 2K86A 3GTPJ 3QPTA 1ON1A 5FKLA 3RSNA 4KA4A 1SFUA 1GXPA 1GV5A 4B43A 2EK5A 1JTXA 2D1VA 2QKLB 3CDLA 3JREA 1PUEE 5TJJA 2E1OA 2DT7B 1JI8A 3Q0VA 3MKLA 2IGNA 3B6CA 2X85A 4UUSA 3HG9A 4JYKA 2DBBA 5K5OA 1X3UA 3VPRA 4F55A 4I0BA 2RC4A 5AIQA 3ONQA 3IL2A 3M4OJ 2UV1A 3B73A 5C4JJ 4IKFA 4X6AJ 4M6VA 3CDHA 4Q47A 2VJ4A 3N4MA 1TQIA 4KUMA 3F6VA 1UHWA 2LTPA 4IOCF 3CCRI 4EEFG 1Z05A 2QA4I 1FBUA 4U87A 5L3BA 1XSVA 1DPUA 2KHMA 3NWSA 4A0ZA 2A05A 4FX0A 1MMNA 2K02A 2PMUA 2VE8A 1JKQC 3M3YJ 3P7NA 2P5KA 5J47A 1OCRH 2MABA 3R4KA 1IN5A 1JKPC 3KP3A 3BCBA 2XB5A 3KP4A 4HF2A 1UB9A 2IS1A 3JSOA 1HF0A 5CKTA 4XLFA 4OU0A 3DKYA 3D5RC 4IZZA 2JK3A 1J0RA 1K78B 1FTTA 2ELJA 4A3GJ 3KZZA 4ZYGA 3KZIC 4BXFA 1NG6A 1Q1VA 1IXCA 2AQFA 1ITYA 2XGEA 3HOVJ 3ZQQA 3BR3A 5JHUA 3TW7A 4HDUA 1FNNA 1OYYA 2MGQA 4CYCA 3F8NA 4OAYA 1X1AA 4BQNA 2Y9YA 2NS7A 2ZBKA 4G6DA 1TNTA 4ITVA 1WHUA 2KLOA 4PZJA 3ZMZA 5JR3A 1U8RA 2Y75A 4ZYHA 2EZKA 2O9LA 3F8FA 3HOXJ 2DPUA 3A2KA 1LPQA 1B9NA 2O03A 4KMFA 1V54H 1Z6RA 3HSEA 2CQNA 2P8TA 3BG6A 1R5HA 3PNVA 4CXFA 1B8IA 4L5EA 2OCEA 3R0AA 4BH9A 2K9MA 3E5QA 5K7HA 2VL8A 5FFZA 2HOEA 2H8RA 5E17F 2AHQA 2KRHA 4RMNA 1MBFA 2CH0A 2JVGA 3WODF 2BHYA 3E5XA 4HYEA 3TEDA 3ZCOA 5D5WB 4HQMA 1G3TA 2E5ZA 2EA2A 3COAC 4XMYA 4IOAF 3C3WA 3PFIA 3D1NI 3IUOA 3WTZA 4R1HA 5KK1A 2D2WA 3JAMZ 3MQ0A 2NNNA 5GPAA 5DYMA 1R6RA 4E6KG 1PUFB 1V5FA 1M1EB 2DQLA 3MEXA 3QU6A 4BHBA 2A68F 4RM3A 4KDPA 1ACIA 3I4NJ 2W57A 3OS1A 2HPIA 2LY1A 1D5VA 2LF8A 2J5PA 4PSWA 2BVLA 4QIWN 1VQ8I 4IEJA 4C2MJ 1P4AA 3PIPF 1Y1WJ 2HDDA 3CCJI 4OIQF 1JKRC 2MH9A 1YITI 3S14J 2A6HF 4HSRA 4XKVA 2P0WA 2EINH 5J3LA 3GTKJ 1QHHD 3BC8A 3Q3SA 2P5LC 1GVDA 2IGMA 5BMZA 4C30A 4K2EA 3W3CA 1WFXA 3FBNB 3S17J 4PJJA 3V4GA 3QU3A 3G2BA 1FYKA 3QPHA 2YU3A 3PQJA 2HOAA 1B72B 4V2FA 3KP2A 2X0LA 3HL2A 4EGZA 1SD4A 3WGHA 3KYCB 1J2XA 2R3SA 2OCCH 1IDZA 4A3FJ 3KLOA 4RB0A 1K61A 4RAYA 3CESA 1UG2A 3JSPA 2HEOA 3ESWB 2VC0A 4KIGA 1P7JA 4OOIA 4CICA 2QSGX 2O61A 2CW8A 1QPMA 2Y30A 3A0BC 3KFWX 3H0GJ 3FXJA 3O8GA 4QWQA 1IXSB 2RQQA 4MNUA 3OYAA 1U78A 2V1NA 5DUIA 2VOOA 4DIQA 3CJTB 1FEXA 2ZXWH 5JLWA 5B1BH 2X6OA 4KT6A 1X1PA 3H9JA 2FXAA 2XIGA 2CW7A 4HEA2 5KAFC 4PCQA 1T38A 1ZKGA 2A3SA 3AL0C 4GXOA 1BOBA 4V19K 2CRGA 4IX7A 3JRCA 2HOSA 2E5NA 3AKZA 2PQ8A 3GFMA 5DM7F 4L9JA 1W7PD 4LG0A 1YYVA 3BJOA 3T8TA 2V9KA 2QKMB 1I6HJ 1L0OC 4Z2YA 2UUZA 3FWEA 3E3VA 4M9SA 3E5UA 2F48A 4LD5A 1QPIA 3GFLA 3WHBA 2BE5F 4IHXA 2DMQA 4HNVA 4MFEA 1FIAA 3GBGA 4RB1A 5EEGA 1R9TJ 4IHVA 2ZSIB 1TT0A 3EUHA 2XPWA 2BXZA 4XLCA 3ZQHA 2XKOA 1K83J 2E7WA 3K2AA 2DU9A 4OIRF 4BEHB 2BW3B 5EG0A 5DD8A 2ELKA 2RDPA 2XAJA 2QBYB 4FE4A 3KEYA 4NQWA 1NG7A 3IWFA 4M71A 5M5YJ 2KZVA 3MCZA 1XDUA 3G4SI 4IQ4A 2BEOA 2EILH 1KU9A 3HZJA 1ZGAA 2WY8Q 2E7XA 1H9TA 1FY7A 1T39A 3R6SA 2COMA 1NTCA 2DTRA 2ECBA 2L5QA 4P96A 5CQGA 4ZTFA 2HTJA 1CF7B 5BS6A 2VT3A 1R22A 2ESHA 2WAFA 4A3IJ 1J7KA 2LF7A 2XDVA 3DQVC 3WU0A 3A01B 4HF1A 1ONVA 5ILUA 3RPUA 2YX4A 2F5DA 3NRVA 5HS7A 3BT9A 1U5TC 5HLGA 1MJAA 4L9VA 5HLIA 2VN2A 4WCGA 2GLOA 5D5XB 2LKSA 3H9GA 4I6ZA 3I0TA 4ZJZA 3L1PA 2IGOA 2I8DA 3P9CA 4M9XA 1X2MA 2XUBA 2QYOA 4XN3A 3M8FA 4ZDLA 5E18F 1WJFA 2CQ7A 4BQOA 3K1MA 1T2KA 1K6OA 1MH3A 3EYIA 1ODDA 3WG7H 3ZQIA 1WQ2A 2XB0X 2AXTC 2JA7J 1V55H 2E2HJ 3HOTA 4M3BA 2K85A 5E20A 2NOJB 3OR2C 4CZCA 1H0MA 2KFDA 2JTVA 5HNHA 5JVTA 5GTIC 4OIOF 4ZH4F 4A93J 3BR6A 1P6RA 2M30A 1XC5A 1ZRDA 1R4NB 3LSKA 2M2EA 5K7FA 1BI3A 3L2CA 1OJLA 2ZFUA 3TP0A 3J80K 1BJAA 2NS8A 1YJ9I 3AG1H 2L3DA 2LY2A 3WU1B 2Z33A 1FP1D 4AIKA 1YW7A 3FDYA 4JX5A 2VI6A 2VODA 3LA7A 3RKYA 3BTCA 1OLTA 2Y9ZA 2BVMA 3GF2A 1BI2A 4O3MA 2E1MC 3IHUA 2R7XA 3HUGB 3HTSB 1ON2A 1KGSA 5F08A 3FMQA 4QLCU 3OL4A 4LGWA 3BR2A 4E7JA 3CCEI 4ZC3A 2JA8J 4E7SA 1Z21A 3K4NA 5K5QA 4KICA 3CP8A 2JQ7A 6PAXA 3IRRA 3PSFA 2R7ZJ 3ABLH 1EA3A 4ENKA 5H2FC 4E7LA 1X19A 2PBIA 2PJRB 5C4XJ 3U21A 2F5VA 1BR1A 3CUQA 2E2JJ 1X2NA 2ZSHB 1KZHA 4CZZA 3GW2A 2ME0A 2EQRA 3SZTA 1OFCX 3ELKA 4RM2A 3FXKA 1O4XA 1XG1A 1FLIA 3NAUA 3CMMA 2VIXA 1N77A 1GV2A 2EFPA 2EJRA 2WBMA 1TQPA 4CH7A 1W4MA 1IAWA 3M1CA 2R5YB 1BW5A 2CO5A 3HB9A 4I99C 3EPZA 2M87A 2K9SA 4NC6A 5LRSA 1WJEA 1SD7A 2LLKA 2X6YA 4BL0B 5B5EC 4IQJA 2LKPA 1W0TA 3BJ6A 2CQXA 5D4RA 1K4SA 3SQNA 1XSXA 4XLPF 3MKZA 1LFPA 2DXIA 2V1UA 4EJOA 1GHCA 1W36C 1RC9A 3WHCA 2IBDA 5IOZA 2PLYA 4II3A 3HTUA 3PNTA 1OPCA 4BXUA 1ZARA 1GLNA 3K1NA 1BM9A 4A6EA 5E1WA 2E1CA 3DKWA 1R1VA 2LR8A 3TKYA 1YS6A 4LJZF 2EFOA 2JSPA 2CSOA 1DP3A 2CV0A 4A3EJ 4Y52J 1SVMA 3C2HA 2DK5A 4XONA 1N78A 4G7OF 3TO9A 1O3RA 3ZR8X 3OS2A 3EUKL 4IJAA 2R5ZA 3BZKA 1K78A 1AHDP 2VE9A 1U0JA 4M3EA 1ENHA 3FMSA 2STWA 4KIBA 2JSCA 2R92J 1DPRA 4YIRX 1MH4A 4A3CJ 2UXXA 3G73A 2OV7A 4YG2F 1LDJA 1K7AA 2FD5A 3W6JB 1MMSA 1Z0XA 2FSWA 5ED4A 5FGMA 4DW6A 3KYDB 1LUJB 2ZXHA 1SAXA 2NVTJ 2Q8KA 2HQNA 4HDVA 3CJQB 3PQKA 1V5GA 2EFQA 3MZYA 5L3EA 3HPGA 2KIMA 4XLEA 3T1BA 5L3FA 4A3JJ 2QENA 3EYYA 4GYIA 4WX9A 1FPQA 2DA2A 2JPBA 1QZEA 4A69C 2CW0F 4HPQA 4BACA 3H9QA 2MLKA 3WE2A 2C6YA 3IH3A 2GQQA 2I10A 1F43A 1AA7A 2DO7A 2Z3YA 2XAUA 1U2WA 1S6LA 4R8HA 3K4MA 4KFCA 1VQ6I 4I98B 3H3UA 4Q48A 3GZ5A 2KZGA 2L7FP 4JX6A 4BHPA 1J09A 3IRQA 4BAYA 2QZ8A 5FLMJ 1YIOA 2PMZA 1FC3A 4M3GA 1A36A 4XORA 1XX5A 2CU7A 5F27A 4U0WA 4M9ZA 3ZMSA 3VB2A 2NS0A 1BR4A 1UZCA 5CVVA 1FP2A 4LLLA 4OIPF 3QYBA 4CCMA 2O5RA 3W6KB 4G7ZF 1UCRA 5F64A 2GXBA 2PFBA 2ISZA 2D1HA 2VKHA 2R7TA 2AO9A 2VONA 3BPVA 2DOAA 2KMUA 3A1YA 2DMTA 1IF1A 3DP7A 4AIDA 2IGKA 2FBKA 2FOWA 1HW2A 3H5NA 1LEAA 1FYMA 1TW3A 4Z6YA 3RDIA 4D0PA 1VF9A 3DXJF 2JUCA 1ZG1A 1ZRCA 3HSFA 3GUDA 3DEEA 3F8CA 2KT0A 3HOUJ 1B72A 1X4OA 4M3FA 2RV8A 1W7PA 4HX7A 2DMUA 4BU2A 2VQCA 2G7HA 3MAJA 1MBEA 1KYZA 1IUYA 1RR8C 1IZ1A 2P6TA 4XLAA 5LRRA 2F5EA 2M9HA 3CF2A 3KEQA 3LSGA 4EM2A 1I27A 4OWRB 3CCUI 2NAZA 2L2OA 5H6RA 2BGCA 4DQ2A 3AFHA 3TOAA 3M07A 4EM0B 2V1XA 3S1RJ 1VQNI 2WB1A 2XAQA
chains in the Genus database with same CATH topology
1HKTA 4M74A 4ON0A 3EETA 3EDPA 1UFMA 2FQ3A 1I1GA 1RI7A 3GFIA 1USTA 3AAFA 3I54A 5AONA 3D0SA 5TRDA 4F7ZA 2JRTA 2A6EF 3U1DA 1JXSA 3REOA 3K1PA 3TOBA 4S04A 2EV5A 5CVUA 3WG9A 2IP2A 1WSUA 2P5VA 1FX7A 3K2ZA 3F3XA 3GX4X 2W85A 2H94A 4HX8A 3ZMUA 2ZCWA 5ICGA 1CF7A 4UHTA 3RIRA 2OBPA 1QGPA 2DK8A 3DF8A 2PMHA 2IJLA 3D5LA 2XGXA 1T98A 1IN6A 2FNAA 5BPIA 4MEXF 5DDGA 4ZYEA 1XGSA 2F5CA 4ZZLA 2HTSA 1XMKA 4IVNA 3P9KA 3M7GA 5LGNA 1B4AA 1HSJA 3MFKA 1RUOA 4E70A 2HKOA 5EEHA 2OZ6A 3DV8A 2H6CA 1HW5A 4NB5A 1BC8C 1ZREA 1P4WA 1QO0D 2FF4A 4A0XA 4LLNA 3RYRA 2L54A 1B6AA 1SMYF 4BQAA 1R5GA 4CHUA 1NHAA 1PDNC 4UV9A 1ZLKA 4LMYA 3L09A 3R0JA 4IRHA 1LQ1A 1Z7UA 3I4PA 4HF0A 2MD5A 3CUQC 1WI9A 3I59B 4P9UA 1G6NA 5BQTA 1TQMA 3FXRA 3FHZA 4M73A 4TV7A 1KQ8A 1XDSA 3IWZA 4HLYA 5ILSA 2XASA 4HLXA 3FXUA 2FA5A 3FF5A 4L9NA 1R1TA 2L01A 1JE8A 2BYVE 1R23A 5H20A 4EGYA 4IRIA 2RGVA 4L5JA 2V6CA 1ZN2A 3I71A 5KVRA 1F4KA 4HQEA 4HOBA 4B09A 2V9VA 3FM3A 3RPQA 4AIHA 1CGPA 5J8FA 1SFXA 2FMLA 1TLHB 1AWCA 1R7JA 4MQVA 1TBXA 4Q5SF 2RN7A 3BDDA 3SZPA 2W24A 2HQRA 2K7LA 2W25A 4RGSA 5J8CA 4ENNA 5CJ9A 2KKOA 4PGHA 3WTUC 3WTXC 3M8EA 3QRFF 1C0WA 1WWXA 2ELHA 2HWVA 3LWFA 2ZMEA 3E97A 1E17A 4GGGA 2O0YA 1G3SA 2XRNA 3ZQ7A 2M45A 5D6EA 4EJUA 3IKTA 1I1SA 1YTYA 5FLXZ 2BV6A 2AXLA 1REPC 4HBLA 3WE3A 2FE3A 2OU2A 2HYGD 1XN7A 1EV7A 3Q9SA 4LLGF 5D6FA 4L18B 3ERED 3I5UA 2JZYA 3V7RA 4RB2C 2LNBA 2VXZA 1RUNA 3VEPA 4LFUA 4A5NA 2PEXA 4KN4X 1Q1HA 2CYYA 3ROUA 3C18A 2H6BA 1MD0A 2EA4A 2CQKA 1E2XA 5LEJA 3QP6A 5DD4A 3SHFA 1KU7A 1XSDA 3F22A 1DUXC 4JK1X 1QBJA 3RKXA 3GZ6A 2FEZA 2PN6A 3EQLF 3TDZC 1Z9CA 3ZMVA 3R60A 4MHGA 3FZVA 1SMTA 2RKHA 4KIFA 1FBQA 1Z1DA 4L9TA 3CJNA 2KRFA 3H3ZA 1O57A 2K27A 3Q5FA 1HQCA 1IN8A 4WXDA 5CVRA 3ABTA 4UVAA 5L3GA 5FFXA 2OZUA 1KU3A 2GAUA 3HOSA 2A61A 2F5FA 1I5ZA 4P55A 2DAOA 4L0ZB 1V3FA 1S7AA 3K69A 5ICFA 3E6DA 4RS8A 1EH7A 4U7DA 4AD9A 4U0VA 2R7DA 2FU4A 4WK8F 1BC7C 2D45A 3HHGA 4RGRA 3M1EA 2O3FA 4LK1F 4FT8A 4A0YA 1ZYRF 2FBIA 3CO7C 4U7BA 2CG4A 1L3LA 2FNPA 2LDUA 1FSEA 2A07F 2XV4S 2HYFA 4YFXF 3R61A 1BIAA 1U3EM 1W5SA 2XKPA 4MTDA 1STZA 4HZFA 3E6BA 2EFNA 3KP5A 3FM5A 3KEOA 2WV0A 2XVCA 5LHIA 3LFKA 2Z99A 2EFWA 3P9IA 3QP5A 2XAHA 1MDMB 5LBQA 4ASNA 2V1DA 5E1XA 2QQAA 1T0FA 1V4RA 3RYPA 1TNSA 3VFZA 3V8KA 3O3KA 1IRGA 3VOEA 5D8KB 2J5OA 1FZPB 2XAFA 4AIJA 4N9IA 4Y17A 5D4SA 4GYGA 3QOPA 4OINF 1O3TA 4RB3C 3LAJA 5HDNA 1JGSA 1P92A 2HKXA 1G3YA 2GA1A 3I59A 1YS7A 4LG0B 5LEKA 4N9HA 2NNYA 2CGPA 5HOOA 2W84A 3E6CC 4PDKA 4S05A 1O7FA 3IKVA 1XCBA 3BPXA 3CO6C 5CLSA 1J9IA 1Y0UA 4ESBA 3I58A 4L0YB 2R7FA 3K9TA 5CVIA 4XRFA 4ESFA 2KIFA 1PP8F 3GYHX 4KNYA 1OYWA 5CVJA 3F21A 1S3JA 1LB2A 2DLLA 4A12A 4I09A 1LDKB 4MQ9F 5K5RA 4L5IA 2VBZA 2ACJA 3ZMTA 1LJ9A 5E8IA 5LHHA 3ABUA 3MWMA 2A69F 5HVQC 2DI3A 3TO7A 3ML6A 1FWZA 1SD5A 2IPQX 1HW1A 4Y13A 1KYWA 4IHTA 5J6XA 3WTSC 4EM1A 4HV5A 4G9YA 1KA8A 3HIFA 3DPTA 2WC2A 4A5MA 1FLIA 3VODA 5A2QK 3B02A 2K4JA 3QAHA 2P4WA 2LSOA 3MZHA 5F6FA 2CWEA 2O6GE 3GWZA 2STTA 4IRGA 1YQAA 2EV6A 3FX3A 2H27A 3U2RA 2YSRA 2QBYA 1R00A 3WTTC 2CFXA 4HW0A 2ZXJA 1H9GA 4MEYF 1EH8A 2ZNZA 2E1NA 2ISYA 1YW9A 1BIBA 5HS9A 3CTAA 5DCFA 2DQRA 3KZYA 3C1DA 2PJPA 1QZZA 2JT1A 3FMRA 3CUQB 2XHKA 5FLXK 4ETSA 1BN5A 1ZRFA 3BOQA 3BP8A 3GFJA 3HRTA 1S8NA 4ENJA 3G3ZA 2IVMA 4P5OA 3Q9VA 4CGZA 2QUFA 2MBFA 1MZBA 3HRUA 2UWMA 3OV8A 5E1ZB 3F6OA 4FX4A 3J81K 5HLHA 5HS8A 4EMSA 1WKMA 3TO6A 1OMIA 4HAMA 1JHHA 2X4HA 4WF2A 2P6SA 4UNOA 3HYIA 4WXCA 5L3DA 2QWWA 3O2PE 3WTYC 4Q4ZF 1BBYA 3GLXA 4M6XA 4UVBA 2OAZA 1W5TA 3HUGA 1YW8A 4OMZA 3T5XA 2DPDA 2NRAC 2P7CB 4NHJA 3RTRA 1B59A 3NEUA 2GIVA 4IPAA 5DCMB 1ZH5A 4YIFA 3L00A 4IXAA 3SFZA 2JPCA 2OQGA 2NYXA 2PG4A 2ETHA 1J5YA 3ZPLA 1D8KA 4JQFA 3RI4A 1LNWA 2FMYA 5IT9K 4CO8A 2QVOA 2Q0OA 5FD5A 2TDXA 2FOKA 1ZG5A 1XCVA 2DFIA 1OR7A 5HDKA 1R58A 5LHGA 3JTGA 4I02A 4CDGA 4P9FA 5D8LB 3KE2A 4N0BA 4EJWA 2HGCA 5BOXA 2DT5A 2QQBA 3BROA 4UV8A 5A2QZ 1FYLA 4O6JA 1XGNA 1ZG3A 1U5TB 1MDMA 2ESNA 3N97A 2GZWA 4YFKF 4UVCA 2IRFG 3ECOA 2VT2A 3RJPA 4MTEA 2L4MA 2RVCA 1W7PB 2KJBA 4EVIA 2ZO4A 4G94A 3SXYA 2YR2A 3BJAA 4B8XA 2P7VB 4M72A 1FSHA 4Y15A 4EQQA 1U6GA 1B9MA 1FT9A 4MGRA 4ZYDA 4I0AA 2UXNA 3WTVC 4G6QA 5JI6A 2F2EA 1MKMA 3CUOA 1ULYA 2EWNA 5JFRA 2QQ9A 1XGOA 5IT3A 2FBHA 1HSTA 3HRSA 4ZZDA 4DNCA 4KT5C 5ILVA 1T6SA 5FB2A 1QQIA 3BY6A 1YFHA 1D8JA 4IHSA 5K1YA 1YG2A 3ECHA 2K4BA 3J81Z 2ZNYA 3WGGA 3KP6A 5FD6A 3GEZA 4GO1A 2GXGA 1LEBA 3JW4A 2G7UA 5F1RA 4ESJA 2V79A 5LGUA 3GXOA 4AWXB 3GVAA 5BPDA 2H09A 1RZ4A 3HSRA 3KP7A 1GVJA 4UXNA 5DV5A 3DEUA 1UHMA 3KLNA 3ZN1A 2HDCA 3KCCA 2HFHA 3LSTA 1O7LA 1P4XA 3O6BB 1Z6TA 4KMUX 4WXHA 2GWRA 1JHFA 1MJBA 4JBAA 2VBWA 1J59A 3JTHA 4U0YA 1QNTA 2B0LA 4OMYA 3FXQA 1A04A 3K0LA 2IA1A 1AOYA 1HKSA 1K79A 1B1BA 1PP7U 5CYVA 2IA2A 1ZAOA 5ICCA 3ZMDA 1O3SA 5IT9Z 2GA2A 2HR3A 2OA4A 4GCVA 3ISPA 3IC7A 1MGTA 2VC1A 4I2OA 4YFNF 3V8JA 2XROA 2Q2EA 2MA3A 3TQNA 2DW4A 5E8GA 1HKQA 1ZGJA 1USSA 2PI0A 2OQRA 3HHHA 5AIPA 4RGXA 3NQOA 1YO5C 1HBXG 4XSZF 2IA0A 3H92A 1Z91A 4YIIA 4LB5A 1RIOH 3LA3A 4KN7X 3ZP5A 4M6YA 2YPRA 2QM3A 3TDUC 2KIUA 2WWYA 1LDDA 1OYIA 1I6XA 2Y0MA 2MC3A 4IF4A 1G4DA 5LGTA 4BHCA 2MH2A 1BOAA 2M1BA 5ERIA 3T0YA 2YX7A 1IN4A 4H0EA 1YLFA 3C7JA 1VTNC 1KU2A 1WRJA 2RQPA 3L9FA 1F5TA 1TW2A 4FHTA 4A2UA 3ZN0A 4ENMA 1FBSA 2AS5F 2FRHA 4I01A 4A6DA 1D3YA 2OD5A 2WTEA 1IW7F 3LQRA 2L02A 3LAPA 1F1ZA 3I53A 5DEQA 2MLGA 4U88A 4BYYA 4EJVA 3F8MA 2IT0A 1ZLJA 5DCMA 3ULQB 3S2WA 2ZMEB 1S7OA 1S29A 3E6MA 2M8EA 1EH6A 2RNJA 2A5YB 2XAGA 1SD6A 4R79A 1XB4A 1FOKA 3LA2A 4UUVA 1IN7A 5ICEA 5D5VB 3GO5A 1R36A 1MJ9A 4XLNF 2UZKA 1G3WA 4WWCA 1F9NA 2ADUA 2IW5A 3J7AO 4AVPA 3DFGA 2BBYA 4O5VA 5D5UB 1KQ9A 2EB7A 2Z9OA 5L3CA 2VBXA 1IRFA 2Z5UA 1XMAA 3KETA 3BWGA 2HZTA 3HRMA 1R1UA 4XBFA 5HDGA 2Y48A 3U9GA 3M9AA 3WTWC 4RAZA 4XSXF 4KYWA 1P2FA 3F8BA 3RKWA 1U5TA 1ZHFA 4LK0F 1BI1A 1XD7A 1DDNA 3T8RA 3JAMK 3BZ6A 3J80Z 1BI0A 3I64A 4I7HA 3TGNA 2KJCA 2ZFWA 2VOPA 2L4AA 3WGIA 5LLQA 2ZKZA 5H6QA 3F72A 1RNLA 4HV6A 4G8XA 3OOPA 5DUKA 3L7WA 4BNCA 2HS5A 1SFEA 4EJTA 1HXDA 3V8LA 1LVAA 2O8XA 1KQ0A 2VBYA 2M5WA 1QZYA 4PGGA 1OKRA 2QLZA 4HX4A 4CYDA 2ZJ2A 2G9WA 4EV0A 3CLOA 2EV0A 5FO5A 1XGMA 3V7SA 4LB6B 1GXQA 1O3QA 1IXRC 1TTYA 4RGUA 3V7CA 1J75A 1DP7P 4HA8A 3F23A 3LQQA 3DPLC 4G7HF 2K86A 3QPTA 1ON1A 4KA4A 1SFUA 1GXPA 2EK5A 2D1VA 1PUEE 5TJJA 2DBBA 5K5OA 1X3UA 4I0BA 2RC4A 5AIQA 3IL2A 3B73A 3CDHA 4Q47A 3N4MA 1TQIA 4KUMA 3F6VA 1UHWA 1Z05A 1FBUA 5L3BA 1XSVA 1DPUA 4A0ZA 4FX0A 2K02A 2PMUA 2VE8A 3P7NA 2P5KA 3R4KA 1IN5A 3KP3A 4HF2A 3KP4A 1UB9A 3JSOA 4OU0A 1J0RA 1K78B 3KZZA 4ZYGA 1IXCA 5JHUA 4HDUA 1FNNA 1OYYA 3F8NA 2ZBKA 4G6DA 1TNTA 3ZMZA 4PZJA 5JR3A 1U8RA 2Y75A 4ZYHA 3F8FA 2DPUA 1B9NA 2O03A 4KMFA 1Z6RA 3HSEA 2P8TA 4CXFA 1R5HA 3R0AA 4BH9A 3E5QA 5FFZA 2HOEA 5E17F 3WODF 3E5XA 4HYEA 5D5WB 4HQMA 1G3TA 2EA2A 3COAC 3C3WA 3PFIA 3WTZA 4R1HA 5KK1A 2D2WA 3JAMZ 3MQ0A 2NNNA 5DYMA 2DQLA 3MEXA 3QU6A 4BHBA 2A68F 4KDPA 2W57A 1D5VA 2LF8A 2J5PA 1P4AA 4OIQF 2MH9A 2A6HF 2P5LC 5BMZA 4K2EA 3V4GA 3QU3A 1FYKA 3QPHA 2YU3A 3PQJA 3KP2A 2X0LA 4EGZA 1SD4A 3WGHA 1J2XA 2R3SA 3KLOA 4RB0A 4RAYA 3JSPA 2HEOA 4OOIA 2VC0A 4KIGA 2O61A 4CICA 1QPMA 3KFWX 4QWQA 1IXSB 4MNUA 1U78A 2VOOA 5DUIA 2FXAA 2XIGA 4PCQA 1T38A 2A3SA 4GXOA 2PQ8A 3GFMA 4L9JA 1W7PD 4LG0A 1YYVA 3BJOA 3T8TA 1L0OC 4Z2YA 3FWEA 3E3VA 4M9SA 3E5UA 4LD5A 3GFLA 2BE5F 4RB1A 5EEGA 3EUHA 2XKOA 4OIRF 2E7WA 2DU9A 5DD8A 2RDPA 2XAJA 2QBYB 4NQWA 3IWFA 4M71A 3MCZA 1XDUA 2BEOA 1KU9A 1ZGAA 2E7XA 1H9TA 1FY7A 1T39A 3R6SA 2COMA 2DTRA 4P96A 1CF7B 2HTJA 5BS6A 2VT3A 1R22A 2ESHA 1J7KA 2LF7A 3DQVC 3WU0A 4HF1A 1ONVA 5ILUA 3RPUA 2YX4A 2F5DA 3NRVA 5HS7A 1U5TC 5HLGA 1MJAA 4L9VA 5HLIA 2VN2A 4WCGA 5D5XB 3I0TA 3P9CA 4M9XA 2XUBA 2QYOA 3M8FA 5E18F 3K1MA 1T2KA 1K6OA 3EYIA 1ODDA 1WQ2A 3HOTA 5E20A 1H0MA 2JTVA 5JVTA 4OIOF 4ZH4F 1P6RA 2M30A 1ZRDA 1BI3A 3L2CA 3J80K 1BJAA 4AIKA 2L3DA 3WU1B 2Z33A 1FP1D 1YW7A 2VODA 3LA7A 3RKYA 3GF2A 1BI2A 4O3MA 3IHUA 3HTSB 1ON2A 1KGSA 3FMQA 4QLCU 4LGWA 5K5QA 4KICA 6PAXA 3IRRA 4ENKA 2PBIA 3CUQA 4CZZA 3GW2A 3SZTA 3ELKA 2EFPA 2EJRA 1TQPA 1IAWA 1W4MA 2CO5A 2M87A 5LRSA 1SD7A 2LKPA 3BJ6A 5D4RA 3SQNA 1XSXA 4XLPF 2V1UA 4EJOA 1GHCA 2PLYA 3HTUA 4BXUA 1OPCA 1ZARA 3K1NA 2E1CA 1BM9A 4A6EA 5E1WA 3DKWA 1R1VA 3TKYA 1YS6A 4LJZF 2EFOA 2CSOA 2DK5A 4G7OF 3TO9A 1O3RA 4IJAA 1K78A 2VE9A 3FMSA 2STWA 4KIBA 2JSCA 1DPRA 2UXXA 3G73A 4YG2F 1LDJA 1K7AA 3W6JB 2FSWA 5ED4A 5FGMA 1SAXA 2Q8KA 2HQNA 4HDVA 3PQKA 2EFQA 3MZYA 5L3EA 2KIMA 3T1BA 5L3FA 2QENA 3EYYA 4GYIA 4WX9A 1FPQA 2JPBA 2CW0F 2MLKA 3WE2A 2C6YA 2GQQA 2DO7A 2Z3YA 1U2WA 1S6LA 4R8HA 4KFCA 4I98B 3H3UA 4Q48A 3GZ5A 4BHPA 3IRQA 4BAYA 2QZ8A 1YIOA 1FC3A 4U0WA 4M9ZA 3ZMSA 3VB2A 2NS0A 5CVVA 1FP2A 4LLLA 4OIPF 3W6KB 4G7ZF 1UCRA 5F64A 2GXBA 2PFBA 2ISZA 2D1HA 2VONA 3BPVA 1IF1A 3DP7A 2FBKA 1HW2A 1LEAA 1FYMA 1TW3A 3RDIA 4D0PA 3DXJF 1ZG1A 1ZRCA 3HSFA 3GUDA 3F8CA 2RV8A 1W7PA 4HX7A 2G7HA 3MAJA 1KYZA 1IUYA 1IZ1A 2P6TA 5LRRA 2F5EA 3KEQA 4EM2A 1I27A 2NAZA 5H6RA 2BGCA 4DQ2A 3TOAA 4EM0B 2V1XA 2XAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKT A;  4M74 A;  4ON0 A;  3EET A;  3EDP A;  1UFM A;  2FQ3 A;  1I1G A;  1RI7 A;  3GFI A;  1UST A;  3AAF A;  3I54 A;  5AON A;  3D0S A;  5TRD A;  4F7Z A;  2JRT A;  2A6E F;  3U1D A;  1JXS A;  3REO A;  3K1P A;  3TOB A;  4S04 A;  2EV5 A;  5CVU A;  3WG9 A;  2IP2 A;  1WSU A;  2P5V A;  1FX7 A;  3K2Z A;  3F3X A;  3GX4 X;  2W85 A;  2H94 A;  4HX8 A;  3ZMU A;  2ZCW A;  5ICG A;  1CF7 A;  4UHT A;  3RIR A;  2OBP A;  1QGP A;  2DK8 A;  3DF8 A;  2PMH A;  2IJL A;  3D5L A;  2XGX A;  1T98 A;  1IN6 A;  2FNA A;  5BPI A;  4MEX F;  5DDG A;  4ZYE A;  1XGS A;  2F5C A;  4ZZL A;  2HTS A;  1XMK A;  4IVN A;  3P9K A;  3M7G A;  5LGN A;  1B4A A;  1HSJ A;  3MFK A;  1RUO A;  4E70 A;  2HKO A;  5EEH A;  2OZ6 A;  3DV8 A;  2H6C A;  1HW5 A;  4NB5 A;  1BC8 C;  1ZRE A;  1P4W A;  1QO0 D;  2FF4 A;  4A0X A;  4LLN A;  3RYR A;  2L54 A;  1B6A A;  1SMY F;  4BQA A;  1R5G A;  4CHU A;  1NHA A;  1PDN C;  4UV9 A;  1ZLK A;  4LMY A;  3L09 A;  3R0J A;  4IRH A;  1LQ1 A;  1Z7U A;  3I4P A;  4HF0 A;  2MD5 A;  3CUQ C;  1WI9 A;  3I59 B;  4P9U A;  1G6N A;  5BQT A;  1TQM A;  3FXR A;  3FHZ A;  4M73 A;  4TV7 A;  1KQ8 A;  1XDS A;  3IWZ A;  4HLY A;  5ILS A;  2XAS A;  4HLX A;  3FXU A;  2FA5 A;  3FF5 A;  4L9N A;  1R1T A;  2L01 A;  1JE8 A;  2BYV E;  1R23 A;  5H20 A;  4EGY A;  4IRI A;  2RGV A;  4L5J A;  2V6C A;  1ZN2 A;  3I71 A;  5KVR A;  1F4K A;  4HQE A;  4HOB A;  4B09 A;  2V9V A;  3FM3 A;  3RPQ A;  4AIH A;  1CGP A;  5J8F A;  1SFX A;  2FML A;  1TLH B;  1AWC A;  1R7J A;  4MQV A;  1TBX A;  4Q5S F;  2RN7 A;  3BDD A;  3SZP A;  2W24 A;  2HQR A;  2K7L A;  2W25 A;  4RGS A;  5J8C A;  4ENN A;  5CJ9 A;  2KKO A;  4PGH A;  3WTU C;  3WTX C;  3M8E A;  3QRF F;  1C0W A;  1WWX A;  2ELH A;  2HWV A;  3LWF A;  2ZME A;  3E97 A;  1E17 A;  4GGG A;  2O0Y A;  1G3S A;  2XRN A;  3ZQ7 A;  2M45 A;  5D6E A;  4EJU A;  3IKT A;  1I1S A;  1YTY A;  5FLX Z;  2BV6 A;  2AXL A;  1REP C;  4HBL A;  3WE3 A;  2FE3 A;  2OU2 A;  2HYG D;  1XN7 A;  1EV7 A;  3Q9S A;  4LLG F;  5D6F A;  4L18 B;  3ERE D;  3I5U A;  2JZY A;  3V7R A;  4RB2 C;  2LNB A;  2VXZ A;  1RUN A;  3VEP A;  4LFU A;  4A5N A;  2PEX A;  4KN4 X;  1Q1H A;  2CYY A;  3ROU A;  3C18 A;  2H6B A;  1MD0 A;  2EA4 A;  2CQK A;  1E2X A;  5LEJ A;  3QP6 A;  5DD4 A;  3SHF A;  1KU7 A;  1XSD A;  3F22 A;  1DUX C;  4JK1 X;  1QBJ A;  3RKX A;  3GZ6 A;  2FEZ A;  2PN6 A;  3EQL F;  3TDZ C;  1Z9C A;  3ZMV A;  3R60 A;  4MHG A;  3FZV A;  1SMT A;  2RKH A;  4KIF A;  1FBQ A;  1Z1D A;  4L9T A;  3CJN A;  2KRF A;  3H3Z A;  1O57 A;  2K27 A;  3Q5F A;  1HQC A;  1IN8 A;  4WXD A;  5CVR A;  3ABT A;  4UVA A;  5L3G A;  5FFX A;  2OZU A;  1KU3 A;  2GAU A;  3HOS A;  2A61 A;  2F5F A;  1I5Z A;  4P55 A;  2DAO A;  4L0Z B;  1V3F A;  1S7A A;  3K69 A;  5ICF A;  3E6D A;  4RS8 A;  1EH7 A;  4U7D A;  4AD9 A;  4U0V A;  2R7D A;  2FU4 A;  4WK8 F;  1BC7 C;  2D45 A;  3HHG A;  4RGR A;  3M1E A;  2O3F A;  4LK1 F;  4FT8 A;  4A0Y A;  1ZYR F;  2FBI A;  3CO7 C;  4U7B A;  2CG4 A;  1L3L A;  2FNP A;  2LDU A;  1FSE A;  2A07 F;  2XV4 S;  2HYF A;  4YFX F;  3R61 A;  1BIA A;  1U3E M;  1W5S A;  2XKP A;  4MTD A;  1STZ A;  4HZF A;  3E6B A;  2EFN A;  3KP5 A;  3FM5 A;  3KEO A;  2WV0 A;  2XVC A;  5LHI A;  3LFK A;  2Z99 A;  2EFW A;  3P9I A;  3QP5 A;  2XAH A;  1MDM B;  5LBQ A;  4ASN A;  2V1D A;  5E1X A;  2QQA A;  1T0F A;  1V4R A;  3RYP A;  1TNS A;  3VFZ A;  3V8K A;  3O3K A;  1IRG A;  3VOE A;  5D8K B;  2J5O A;  1FZP B;  2XAF A;  4AIJ A;  4N9I A;  4Y17 A;  5D4S A;  4GYG A;  3QOP A;  4OIN F;  1O3T A;  4RB3 C;  3LAJ A;  5HDN A;  1JGS A;  1P92 A;  2HKX A;  1G3Y A;  2GA1 A;  3I59 A;  1YS7 A;  4LG0 B;  5LEK A;  4N9H A;  2NNY A;  2CGP A;  5HOO A;  2W84 A;  3E6C C;  4PDK A;  4S05 A;  1O7F A;  3IKV A;  1XCB A;  3BPX A;  3CO6 C;  5CLS A;  1J9I A;  1Y0U A;  4ESB A;  3I58 A;  4L0Y B;  2R7F A;  3K9T A;  5CVI A;  4XRF A;  4ESF A;  2KIF A;  1PP8 F;  3GYH X;  4KNY A;  1OYW A;  5CVJ A;  3F21 A;  1S3J A;  1LB2 A;  2DLL A;  4A12 A;  4I09 A;  1LDK B;  4MQ9 F;  5K5R A;  4L5I A;  2VBZ A;  2ACJ A;  3ZMT A;  1LJ9 A;  5E8I A;  5LHH A;  3ABU A;  3MWM A;  2A69 F;  5HVQ C;  2DI3 A;  3TO7 A;  3ML6 A;  1FWZ A;  1SD5 A;  2IPQ X;  1HW1 A;  4Y13 A;  1KYW A;  4IHT A;  5J6X A;  3WTS C;  4EM1 A;  4HV5 A;  4G9Y A;  1KA8 A;  3HIF A;  3DPT A;  2WC2 A;  4A5M A;  1FLI A;  3VOD A;  5A2Q K;  3B02 A;  2K4J A;  3QAH A;  2P4W A;  2LSO A;  3MZH A;  5F6F A;  2CWE A;  2O6G E;  3GWZ A;  2STT A;  4IRG A;  1YQA A;  2EV6 A;  3FX3 A;  2H27 A;  3U2R A;  2YSR A;  2QBY A;  1R00 A;  3WTT C;  2CFX A;  4HW0 A;  2ZXJ A;  1H9G A;  4MEY F;  1EH8 A;  2ZNZ A;  2E1N A;  2ISY A;  1YW9 A;  1BIB A;  5HS9 A;  3CTA A;  5DCF A;  2DQR A;  3KZY A;  3C1D A;  2PJP A;  1QZZ A;  2JT1 A;  3FMR A;  3CUQ B;  2XHK A;  5FLX K;  4ETS A;  1BN5 A;  1ZRF A;  3BOQ A;  3BP8 A;  3GFJ A;  3HRT A;  1S8N A;  4ENJ A;  3G3Z A;  2IVM A;  4P5O A;  3Q9V A;  4CGZ A;  2QUF A;  2MBF A;  1MZB A;  3HRU A;  2UWM A;  3OV8 A;  5E1Z B;  3F6O A;  4FX4 A;  3J81 K;  5HLH A;  5HS8 A;  4EMS A;  1WKM A;  3TO6 A;  1OMI A;  4HAM A;  1JHH A;  2X4H A;  4WF2 A;  2P6S A;  4UNO A;  3HYI A;  4WXC A;  5L3D A;  2QWW A;  3O2P E;  3WTY C;  4Q4Z F;  1BBY A;  3GLX A;  4M6X A;  4UVB A;  2OAZ A;  1W5T A;  3HUG A;  1YW8 A;  4OMZ A;  3T5X A;  2DPD A;  2NRA C;  2P7C B;  4NHJ A;  3RTR A;  1B59 A;  3NEU A;  2GIV A;  4IPA A;  5DCM B;  1ZH5 A;  4YIF A;  3L00 A;  4IXA A;  3SFZ A;  2JPC A;  2OQG A;  2NYX A;  2PG4 A;  2ETH A;  1J5Y A;  3ZPL A;  1D8K A;  4JQF A;  3RI4 A;  1LNW A;  2FMY A;  5IT9 K;  4CO8 A;  2QVO A;  2Q0O A;  5FD5 A;  2TDX A;  2FOK A;  1ZG5 A;  1XCV A;  2DFI A;  1OR7 A;  5HDK A;  1R58 A;  5LHG A;  3JTG A;  4I02 A;  4CDG A;  4P9F A;  5D8L B;  3KE2 A;  4N0B A;  4EJW A;  2HGC A;  5BOX A;  2DT5 A;  2QQB A;  3BRO A;  4UV8 A;  5A2Q Z;  1FYL A;  4O6J A;  1XGN A;  1ZG3 A;  1U5T B;  1MDM A;  2ESN A;  3N97 A;  2GZW A;  4YFK F;  4UVC A;  2IRF G;  3ECO A;  2VT2 A;  3RJP A;  4MTE A;  2L4M A;  2RVC A;  1W7P B;  2KJB A;  4EVI A;  2ZO4 A;  4G94 A;  3SXY A;  2YR2 A;  3BJA A;  4B8X A;  2P7V B;  4M72 A;  1FSH A;  4Y15 A;  4EQQ A;  1U6G A;  1B9M A;  1FT9 A;  4MGR A;  4ZYD A;  4I0A A;  2UXN A;  3WTV C;  4G6Q A;  5JI6 A;  2F2E A;  1MKM A;  3CUO A;  1ULY A;  2EWN A;  5JFR A;  2QQ9 A;  1XGO A;  5IT3 A;  2FBH A;  1HST A;  3HRS A;  4ZZD A;  4DNC A;  4KT5 C;  5ILV A;  1T6S A;  5FB2 A;  1QQI A;  3BY6 A;  1YFH A;  1D8J A;  4IHS A;  5K1Y A;  1YG2 A;  3ECH A;  2K4B A;  3J81 Z;  2ZNY A;  3WGG A;  3KP6 A;  5FD6 A;  3GEZ A;  4GO1 A;  2GXG A;  1LEB A;  3JW4 A;  2G7U A;  5F1R A;  4ESJ A;  2V79 A;  5LGU A;  3GXO A;  4AWX B;  3GVA A;  5BPD A;  2H09 A;  1RZ4 A;  3HSR A;  3KP7 A;  1GVJ A;  4UXN A;  5DV5 A;  3DEU A;  1UHM A;  3KLN A;  3ZN1 A;  2HDC A;  3KCC A;  2HFH A;  3LST A;  1O7L A;  1P4X A;  3O6B B;  1Z6T A;  4KMU X;  4WXH A;  2GWR A;  1JHF A;  1MJB A;  4JBA A;  2VBW A;  1J59 A;  3JTH A;  4U0Y A;  1QNT A;  2B0L A;  4OMY A;  3FXQ A;  1A04 A;  3K0L A;  2IA1 A;  1AOY A;  1HKS A;  1K79 A;  1B1B A;  1PP7 U;  5CYV A;  2IA2 A;  1ZAO A;  5ICC A;  3ZMD A;  1O3S A;  5IT9 Z;  2GA2 A;  2HR3 A;  2OA4 A;  4GCV A;  3ISP A;  3IC7 A;  1MGT A;  2VC1 A;  4I2O A;  4YFN F;  3V8J A;  2XRO A;  2Q2E A;  2MA3 A;  3TQN A;  2DW4 A;  5E8G A;  1HKQ A;  1ZGJ A;  1USS A;  2PI0 A;  2OQR A;  3HHH A;  5AIP A;  4RGX A;  3NQO A;  1YO5 C;  1HBX G;  4XSZ F;  2IA0 A;  3H92 A;  1Z91 A;  4YII A;  4LB5 A;  1RIO H;  3LA3 A;  4KN7 X;  3ZP5 A;  4M6Y A;  2YPR A;  2QM3 A;  3TDU C;  2KIU A;  2WWY A;  1LDD A;  1OYI A;  1I6X A;  2Y0M A;  2MC3 A;  4IF4 A;  1G4D A;  5LGT A;  4BHC A;  2MH2 A;  1BOA A;  2M1B A;  5ERI A;  3T0Y A;  2YX7 A;  1IN4 A;  4H0E A;  1YLF A;  3C7J A;  1VTN C;  1KU2 A;  1WRJ A;  2RQP A;  3L9F A;  1F5T A;  1TW2 A;  4FHT A;  4A2U A;  3ZN0 A;  4ENM A;  1FBS A;  2AS5 F;  2FRH A;  4I01 A;  4A6D A;  1D3Y A;  2OD5 A;  2WTE A;  1IW7 F;  3LQR A;  2L02 A;  3LAP A;  1F1Z A;  3I53 A;  5DEQ A;  2MLG A;  4U88 A;  4BYY A;  4EJV A;  3F8M A;  2IT0 A;  1ZLJ A;  5DCM A;  3ULQ B;  3S2W A;  2ZME B;  1S7O A;  1S29 A;  3E6M A;  2M8E A;  1EH6 A;  2RNJ A;  2A5Y B;  2XAG A;  1SD6 A;  4R79 A;  1XB4 A;  1FOK A;  3LA2 A;  4UUV A;  1IN7 A;  5ICE A;  5D5V B;  3GO5 A;  1R36 A;  1MJ9 A;  4XLN F;  2UZK A;  1G3W A;  4WWC A;  1F9N A;  2ADU A;  2IW5 A;  3J7A O;  4AVP A;  3DFG A;  2BBY A;  4O5V A;  5D5U B;  1KQ9 A;  2EB7 A;  2Z9O A;  5L3C A;  2VBX A;  1IRF A;  2Z5U A;  1XMA A;  3KET A;  3BWG A;  2HZT A;  3HRM A;  1R1U A;  4XBF A;  5HDG A;  2Y48 A;  3U9G A;  3M9A A;  3WTW C;  4RAZ A;  4XSX F;  4KYW A;  1P2F A;  3F8B A;  3RKW A;  1U5T A;  1ZHF A;  4LK0 F;  1BI1 A;  1XD7 A;  1DDN A;  3T8R A;  3JAM K;  3BZ6 A;  3J80 Z;  1BI0 A;  3I64 A;  4I7H A;  3TGN A;  2KJC A;  2ZFW A;  2VOP A;  2L4A A;  3WGI A;  5LLQ A;  2ZKZ A;  5H6Q A;  3F72 A;  1RNL A;  4HV6 A;  4G8X A;  3OOP A;  5DUK A;  3L7W A;  4BNC A;  2HS5 A;  1SFE A;  4EJT A;  1HXD A;  3V8L A;  1LVA A;  2O8X A;  1KQ0 A;  2VBY A;  2M5W A;  1QZY A;  4PGG A;  1OKR A;  2QLZ A;  4HX4 A;  4CYD A;  2ZJ2 A;  2G9W A;  4EV0 A;  3CLO A;  2EV0 A;  5FO5 A;  1XGM A;  3V7S A;  4LB6 B;  1GXQ A;  1O3Q A;  1IXR C;  1TTY A;  4RGU A;  3V7C A;  1J75 A;  1DP7 P;  4HA8 A;  3F23 A;  3LQQ A;  3DPL C;  4G7H F;  2K86 A;  3QPT A;  1ON1 A;  4KA4 A;  1SFU A;  1GXP A;  2EK5 A;  2D1V A;  1PUE E;  5TJJ A;  2DBB A;  5K5O A;  1X3U A;  4I0B A;  2RC4 A;  5AIQ A;  3IL2 A;  3B73 A;  3CDH A;  4Q47 A;  3N4M A;  1TQI A;  4KUM A;  3F6V A;  1UHW A;  1Z05 A;  1FBU A;  5L3B A;  1XSV A;  1DPU A;  4A0Z A;  4FX0 A;  2K02 A;  2PMU A;  2VE8 A;  3P7N A;  2P5K A;  3R4K A;  1IN5 A;  3KP3 A;  4HF2 A;  3KP4 A;  1UB9 A;  3JSO A;  4OU0 A;  1J0R A;  1K78 B;  3KZZ A;  4ZYG A;  1IXC A;  5JHU A;  4HDU A;  1FNN A;  1OYY A;  3F8N A;  2ZBK A;  4G6D A;  1TNT A;  3ZMZ A;  4PZJ A;  5JR3 A;  1U8R A;  2Y75 A;  4ZYH A;  3F8F A;  2DPU A;  1B9N A;  2O03 A;  4KMF A;  1Z6R A;  3HSE A;  2P8T A;  4CXF A;  1R5H A;  3R0A A;  4BH9 A;  3E5Q A;  5FFZ A;  2HOE A;  5E17 F;  3WOD F;  3E5X A;  4HYE A;  5D5W B;  4HQM A;  1G3T A;  2EA2 A;  3COA C;  3C3W A;  3PFI A;  3WTZ A;  4R1H A;  5KK1 A;  2D2W A;  3JAM Z;  3MQ0 A;  2NNN A;  5DYM A;  2DQL A;  3MEX A;  3QU6 A;  4BHB A;  2A68 F;  4KDP A;  2W57 A;  1D5V A;  2LF8 A;  2J5P A;  1P4A A;  4OIQ F;  2MH9 A;  2A6H F;  2P5L C;  5BMZ A;  4K2E A;  3V4G A;  3QU3 A;  1FYK A;  3QPH A;  2YU3 A;  3PQJ A;  3KP2 A;  2X0L A;  4EGZ A;  1SD4 A;  3WGH A;  1J2X A;  2R3S A;  3KLO A;  4RB0 A;  4RAY A;  3JSP A;  2HEO A;  4OOI A;  2VC0 A;  4KIG A;  2O61 A;  4CIC A;  1QPM A;  3KFW X;  4QWQ A;  1IXS B;  4MNU A;  1U78 A;  2VOO A;  5DUI A;  2FXA A;  2XIG A;  4PCQ A;  1T38 A;  2A3S A;  4GXO A;  2PQ8 A;  3GFM A;  4L9J A;  1W7P D;  4LG0 A;  1YYV A;  3BJO A;  3T8T A;  1L0O C;  4Z2Y A;  3FWE A;  3E3V A;  4M9S A;  3E5U A;  4LD5 A;  3GFL A;  2BE5 F;  4RB1 A;  5EEG A;  3EUH A;  2XKO A;  4OIR F;  2E7W A;  2DU9 A;  5DD8 A;  2RDP A;  2XAJ A;  2QBY B;  4NQW A;  3IWF A;  4M71 A;  3MCZ A;  1XDU A;  2BEO A;  1KU9 A;  1ZGA A;  2E7X A;  1H9T A;  1FY7 A;  1T39 A;  3R6S A;  2COM A;  2DTR A;  4P96 A;  1CF7 B;  2HTJ A;  5BS6 A;  2VT3 A;  1R22 A;  2ESH A;  1J7K A;  2LF7 A;  3DQV C;  3WU0 A;  4HF1 A;  1ONV A;  5ILU A;  3RPU A;  2YX4 A;  2F5D A;  3NRV A;  5HS7 A;  1U5T C;  5HLG A;  1MJA A;  4L9V A;  5HLI A;  2VN2 A;  4WCG A;  5D5X B;  3I0T A;  3P9C A;  4M9X A;  2XUB A;  2QYO A;  3M8F A;  5E18 F;  3K1M A;  1T2K A;  1K6O A;  3EYI A;  1ODD A;  1WQ2 A;  3HOT A;  5E20 A;  1H0M A;  2JTV A;  5JVT A;  4OIO F;  4ZH4 F;  1P6R A;  2M30 A;  1ZRD A;  1BI3 A;  3L2C A;  3J80 K;  1BJA A;  4AIK A;  2L3D A;  3WU1 B;  2Z33 A;  1FP1 D;  1YW7 A;  2VOD A;  3LA7 A;  3RKY A;  3GF2 A;  1BI2 A;  4O3M A;  3IHU A;  3HTS B;  1ON2 A;  1KGS A;  3FMQ A;  4QLC U;  4LGW A;  5K5Q A;  4KIC A;  6PAX A;  3IRR A;  4ENK A;  2PBI A;  3CUQ A;  4CZZ A;  3GW2 A;  3SZT A;  3ELK A;  2EFP A;  2EJR A;  1TQP A;  1IAW A;  1W4M A;  2CO5 A;  2M87 A;  5LRS A;  1SD7 A;  2LKP A;  3BJ6 A;  5D4R A;  3SQN A;  1XSX A;  4XLP F;  2V1U A;  4EJO A;  1GHC A;  2PLY A;  3HTU A;  4BXU A;  1OPC A;  1ZAR A;  3K1N A;  2E1C A;  1BM9 A;  4A6E A;  5E1W A;  3DKW A;  1R1V A;  3TKY A;  1YS6 A;  4LJZ F;  2EFO A;  2CSO A;  2DK5 A;  4G7O F;  3TO9 A;  1O3R A;  4IJA A;  1K78 A;  2VE9 A;  3FMS A;  2STW A;  4KIB A;  2JSC A;  1DPR A;  2UXX A;  3G73 A;  4YG2 F;  1LDJ A;  1K7A A;  3W6J B;  2FSW A;  5ED4 A;  5FGM A;  1SAX A;  2Q8K A;  2HQN A;  4HDV A;  3PQK A;  2EFQ A;  3MZY A;  5L3E A;  2KIM A;  3T1B A;  5L3F A;  2QEN A;  3EYY A;  4GYI A;  4WX9 A;  1FPQ A;  2JPB A;  2CW0 F;  2MLK A;  3WE2 A;  2C6Y A;  2GQQ A;  2DO7 A;  2Z3Y A;  1U2W A;  1S6L A;  4R8H A;  4KFC A;  4I98 B;  3H3U A;  4Q48 A;  3GZ5 A;  4BHP A;  3IRQ A;  4BAY A;  2QZ8 A;  1YIO A;  1FC3 A;  4U0W A;  4M9Z A;  3ZMS A;  3VB2 A;  2NS0 A;  5CVV A;  1FP2 A;  4LLL A;  4OIP F;  3W6K B;  4G7Z F;  1UCR A;  5F64 A;  2GXB A;  2PFB A;  2ISZ A;  2D1H A;  2VON A;  3BPV A;  1IF1 A;  3DP7 A;  2FBK A;  1HW2 A;  1LEA A;  1FYM A;  1TW3 A;  3RDI A;  4D0P A;  3DXJ F;  1ZG1 A;  1ZRC A;  3HSF A;  3GUD A;  3F8C A;  2RV8 A;  1W7P A;  4HX7 A;  2G7H A;  3MAJ A;  1KYZ A;  1IUY A;  1IZ1 A;  2P6T A;  5LRR A;  2F5E A;  3KEQ A;  4EM2 A;  1I27 A;  2NAZ A;  5H6R A;  2BGC A;  4DQ2 A;  3TOA A;  4EM0 B;  2V1X A;  2XAQ A; 
#chains in the Genus database with same CATH topology
 1HKT A;  4M74 A;  4ON0 A;  2CUE A;  2QEX I;  3EET A;  3EDP A;  1UFM A;  3GTG J;  3S2H J;  4B44 A;  2FQ3 A;  1I1G A;  3K4J A;  1GDT A;  1RI7 A;  2DFH A;  3GFI A;  1UST A;  3AAF A;  2X1D A;  5F0C A;  3I54 A;  5AON A;  3D0S A;  5TRD A;  1OCC H;  1YX5 A;  1QRY A;  3HXL A;  4F7Z A;  3JRG A;  4BE0 A;  2JRT A;  5EEA A;  2A6E F;  3U1D A;  1IO2 A;  1ZK8 A;  2NXN B;  1POG A;  1JXS A;  3EUH C;  3REO A;  3UKG A;  3K1P A;  3UR3 C;  1D1B A;  2BOL A;  2EH3 A;  2R7W A;  2W1O A;  3TOB A;  4S04 A;  2EV5 A;  2XSD C;  2M7A A;  2ECC A;  5CVU A;  2IP2 A;  1X1C A;  3WG9 A;  5HLT A;  3OYG A;  1WSU A;  2P5V A;  5KHD A;  1FX7 A;  3K2Z A;  4BEH A;  3DWL E;  1Y1V J;  3F3X A;  4BKX A;  3GX4 X;  3MZ8 A;  1DGW Y;  2W85 A;  4LOC A;  2H94 A;  4HX8 A;  3ZMU A;  3CQZ J;  2ZCW A;  2X48 A;  4P1W A;  5DM6 F;  5ICG A;  2HVS A;  1CF7 A;  4UHT A;  2LRE A;  3RIR A;  1XS9 A;  2OBP A;  1QGP A;  2DK8 A;  3DF8 A;  3OYM A;  1VQO I;  4BE1 A;  2PMH A;  3OYC A;  3A01 A;  2IJL A;  3D5L A;  2XGX A;  1GT0 C;  1H89 C;  1OCZ H;  1T98 A;  3K4B A;  2Q2E B;  1IN6 A;  2LRD A;  3K4K A;  4X0G A;  1ETK A;  2OF7 A;  2FNA A;  4DYC A;  3LFU A;  5EZG A;  5BPI A;  3ZRG A;  3TBI A;  4BGD A;  4MEX F;  2OUM A;  4NNJ A;  5DDG A;  4Y33 A;  4ZYE A;  2EZL A;  5EDN A;  1XGS A;  1VQP I;  2F5C A;  4ZZL A;  4XRM A;  4DZP A;  2HTS A;  1ETW A;  1LFB A;  1XMK A;  4BJ5 C;  2QCO A;  3FKJ A;  1TWG J;  4IVN A;  2HU9 A;  3P9K A;  1HDD C;  4KIT B;  3M7G A;  5LGN A;  1B4A A;  3PM1 A;  3K70 D;  1HSJ A;  2HYJ A;  2O7O A;  3HKZ N;  3MFK A;  1RUO A;  3SDB A;  3W6V A;  4E70 A;  2HKO A;  3BQY A;  5EEH A;  3C2B A;  1TP4 A;  2OZ6 A;  3DV8 A;  4AU7 A;  2LYC A;  3CLQ A;  1MBJ A;  1VQ4 I;  1VI0 A;  2H6C A;  1WI3 A;  1HW5 A;  3FXO A;  1RRJ A;  4NB5 A;  1BC8 C;  1ZRE A;  1VQ5 I;  1P4W A;  1QO0 D;  2FF4 A;  1TWH J;  1SFO J;  4XM3 A;  4A0X A;  1RES A;  2E2I J;  2W00 A;  4LLN A;  1IRZ A;  3S3O A;  2JWT A;  3RYR A;  2L54 A;  1B6A A;  1SMY F;  2VXD A;  4ZDP A;  1JJ8 C;  4BQA A;  1R5G A;  4CHU A;  2HVQ A;  3ABM H;  1NHA A;  3I3L A;  5CPR B;  1PDN C;  4UV9 A;  4RAF A;  4J19 A;  4LMY A;  3L09 A;  1ZLK A;  3R0J A;  4IRH A;  1LQ1 A;  1Z7U A;  3H36 A;  3I4P A;  4GRI A;  3O8H A;  2QF7 A;  4XR6 A;  4HF0 A;  2JN6 A;  2MD5 A;  2L9N A;  3CUQ C;  2CUZ A;  3MMY B;  1WI9 A;  2LBF A;  1SC7 A;  1QU3 A;  3VYT B;  2CMP A;  5EGO A;  3I59 B;  4P9U A;  1G6N A;  5BQT A;  2F4I A;  1PVE A;  4NBQ A;  1TQM A;  3FXR A;  5M3M J;  3FHZ A;  4M73 A;  4TV7 A;  3OYI A;  1IC8 A;  5LD2 C;  5IOY A;  1U8B A;  2IEK A;  1BR2 A;  3W2W A;  4XRS G;  3HOW J;  5E3N A;  1HCR A;  1MBH A;  1KQ8 A;  1Z77 A;  4AUX A;  1XDS A;  2DOE A;  2WA0 A;  3IWZ A;  3ZQF A;  4HLY A;  5ILS A;  3S1N J;  2XAS A;  4HLX A;  2I5U A;  3FXU A;  2FA5 A;  3FF5 A;  1YE9 A;  3GZN B;  2COB A;  4L9N A;  1S5L C;  3HC7 A;  1R1T A;  2L01 A;  1JE8 A;  2BYV E;  3MD2 A;  3OYB A;  1R23 A;  5H20 A;  1ETV A;  2BXY A;  4EGY A;  4IRI A;  2LVS A;  2EIJ H;  2RGV A;  2LY9 A;  4L5J A;  2V6C A;  3QWL A;  4PJL A;  1ZN2 A;  4M3D A;  3I71 A;  5KVR A;  1F4K A;  5M5W J;  4HQE A;  4HOB A;  2X1C A;  3OR1 C;  1FOW A;  4IO9 F;  4IHY A;  4B09 A;  2V9V A;  3FM3 A;  3RPQ A;  4AIH A;  2DMN A;  1EJ9 A;  1F36 A;  3VYR B;  1CGP A;  3BTI A;  5J8F A;  5GTH C;  1SFX A;  2FML A;  1TLH B;  4XK4 A;  1AWC A;  1R7J A;  4FTH A;  2MYS A;  4MQV A;  1TBX A;  2DA1 A;  4Q5S F;  2RN7 A;  3BDD A;  3SZP A;  2W24 A;  5IY5 H;  3CCQ I;  2HQR A;  2R7S A;  2NVY J;  2K7L A;  2W25 A;  5FKO A;  4RGS A;  5J8C A;  4ENN A;  2M4K A;  5CJ9 A;  1MMA A;  5FJ8 J;  2KKO A;  1SVL A;  2G0E A;  4PGH A;  4BY7 J;  1WJB A;  3HOZ J;  2DA5 A;  3WTU C;  1MIJ A;  5F04 A;  3WTX C;  4OAZ A;  3M8E A;  5FRO A;  3QRF F;  3SEQ A;  4CUG A;  3BG3 A;  2DFF A;  4V2G A;  3HDD A;  3LSI A;  1WWX A;  1C0W A;  1Y8Q B;  2ELH A;  2HWV A;  3LWF A;  2ZME A;  1ETQ A;  3E97 A;  4DJA A;  1E17 A;  4GGG A;  3DLL F;  2O0Y A;  1G3S A;  1WJA A;  4A3L J;  1IDY A;  2XRN A;  1DU6 A;  3ZQ7 A;  4G12 A;  2XSJ C;  3CMY A;  5IYB J;  3S1Q J;  2M45 A;  5D6E A;  4EJU A;  5JHF A;  2L9S A;  1TL8 A;  4B47 A;  3IKT A;  2ID6 A;  3SZG A;  3CDI A;  1I1S A;  1YTY A;  1A5J A;  2DN0 A;  4E7Z A;  3OMY A;  5C3E J;  3LL7 A;  2DMP A;  5FLX Z;  2BV6 A;  3OYN A;  2AXL A;  2BHZ A;  1REP C;  4HBL A;  3VYU B;  2CS3 A;  3WE3 A;  2FE3 A;  2OU2 A;  5GAE J;  4ANJ A;  2HYG D;  1X58 A;  3RZO J;  1XN7 A;  4IL6 C;  1EV7 A;  3Q9S A;  4LLG F;  1I50 J;  2KRC A;  1S7E A;  5D6F A;  3LOC A;  1JT0 A;  3VWB A;  4L18 B;  9ANT A;  3PO2 J;  3DPU A;  3AG4 H;  3ERE D;  2KDO A;  5IP6 A;  2V9P A;  2XF7 A;  3Q0W A;  4XKC A;  3I5U A;  2JZY A;  2V7F A;  3V7R A;  4UB6 C;  4BQQ A;  4C3H J;  1TT5 B;  4XLH A;  4E4H A;  4CCL A;  4RB2 C;  2LNB A;  2VXZ A;  2OTJ I;  1RUN A;  3VEP A;  3CD6 I;  4LFU A;  3ZXS A;  4A5N A;  2PEX A;  4KN4 X;  2PMZ N;  3HKZ A;  3OIP A;  1Q1H A;  2CYY A;  2V26 A;  2H1K A;  2KP6 A;  3ROU A;  3C18 A;  4C2T A;  1E3P A;  2VKE A;  4S0H B;  4XID A;  2H6B A;  4YEL A;  1MD0 A;  2MFZ A;  2HXO A;  2EA4 A;  5GP9 A;  1FIP A;  1VQK I;  5FLV A;  3BR1 A;  2CQK A;  4D1Q A;  1E2X A;  2BY0 A;  5LEJ A;  1AU7 A;  3DBL B;  1ORK A;  3QP6 A;  5DD4 A;  3FK6 A;  3SHF A;  1KU7 A;  1XSD A;  3F22 A;  5J4V A;  1DUX C;  2PX9 A;  4JK1 X;  1QBJ A;  2VB6 A;  3RKX A;  3U1K A;  4XRS A;  1WCM J;  4DBQ A;  4IHW A;  3LSP A;  3GZ6 A;  2FEZ A;  2PN6 A;  3EQL F;  3TDZ C;  5DTD A;  3S15 J;  3E7L A;  1Z9C A;  4RLF A;  4Y3O A;  3ZMV A;  3R60 A;  4NC8 A;  4MHG A;  1U9O A;  3FZV A;  1SMT A;  2LH9 A;  3RZD J;  3ZQG A;  2RKH A;  1JUM A;  4KIF A;  1FBQ A;  1Z1D A;  1E3O C;  4L9T A;  3CJN A;  2KRF A;  3H3Z A;  4PUS A;  1O57 A;  2K27 A;  3RQI A;  1RKW A;  3Q5F A;  1D1A A;  3CCY A;  2P81 A;  1HQC A;  2MSY A;  3JRF A;  4RDU A;  4BDY A;  1LE8 A;  1IN8 A;  2CV1 A;  4WXD A;  3MKY B;  3GLL A;  5CVR A;  3ABT A;  1H88 C;  4F3Q A;  4UVA A;  5L3G A;  5FFX A;  2OZU A;  1KU3 A;  2GAU A;  3HOS A;  4W1U A;  2WB1 N;  3BCA A;  3IAM 2;  3W2V A;  2A61 A;  3H5R A;  3KIO A;  4CYC B;  2F5F A;  1I5Z A;  4P55 A;  1BA5 A;  2F4O B;  2DAO A;  4L0Z B;  1V3F A;  4PFO A;  1S7A A;  3K69 A;  1JTY A;  2IAI A;  5ICF A;  4B1R A;  3TL4 X;  3OIO A;  3OYJ A;  3BG9 A;  3E6D A;  4RS8 A;  2ME6 A;  5E3O A;  3OYE A;  2GOM A;  4KIS A;  1EH7 A;  1R4M B;  4U7D A;  3BR5 A;  4AD9 A;  4U0V A;  5DS9 A;  2R7D A;  2FU4 A;  1MMG A;  4C3I J;  4WK8 F;  2M34 A;  3S8P A;  4D7M A;  3I56 I;  1B8I B;  1BC7 C;  3PO3 J;  2D45 A;  1QHG A;  2ZJQ F;  1Z3X A;  2H8W A;  2VKD A;  3PNY A;  3HHG A;  4RGR A;  2W48 A;  3M1E A;  4E7H A;  2O3F A;  4LK1 F;  4FT8 A;  4A0Y A;  3AG3 H;  1ZYR F;  2FBI A;  3HGG A;  4F52 A;  3GTM J;  3CO7 C;  5B66 C;  4U7B A;  3FK7 A;  2CG4 A;  1L3L A;  1IV8 A;  2FNP A;  4HRI A;  2LDU A;  1FSE A;  2A07 F;  3VDX A;  1ETO A;  5BNG A;  3L2U A;  2XV4 S;  2HYF A;  4YFX F;  3R61 A;  2K9N A;  2RRE A;  3K7A J;  1BIA A;  1U3E M;  2F4M B;  2R7O A;  1W5S A;  1QVT A;  2XKP A;  4MTD A;  1UJ8 A;  3W2A A;  1STZ A;  2GIZ A;  3BG7 A;  4HZF A;  3E6B A;  3S2D J;  2EFN A;  3KP5 A;  1HDP A;  2FJ1 A;  3FM5 A;  3N05 A;  1NK2 P;  3KEO A;  4NDL A;  2WV0 A;  2XVC A;  1EKE A;  3QOE A;  5LHI A;  4C3J J;  3LFK A;  2Z99 A;  5J4Y A;  2NVQ J;  3E0J B;  3PFY A;  2NVX J;  2EFW A;  4DGW B;  3P9I A;  5HNF A;  3QP5 A;  2XAH A;  3IV5 A;  1MDM B;  1E0E A;  2A5W A;  5LBQ A;  3MKW B;  2K9Q A;  2EBI A;  1P7I A;  4ASN A;  3S3M A;  1XPX A;  1RKT A;  2V1D A;  2VJ5 A;  3OS0 A;  5E1X A;  2QQA A;  1T0F A;  1V4R A;  4QPO A;  3RYP A;  5KNL A;  1TNS A;  3VFZ A;  1K4T A;  3V8K A;  3H35 A;  3O3K A;  1IRG A;  3DU5 A;  2ZC2 A;  3VOE A;  1N25 A;  5D8K B;  2J5O A;  1FZP B;  4MFD A;  2XAF A;  1WPK A;  4AIJ A;  4N9I A;  4C2U A;  4Y17 A;  2DDA A;  5D4S A;  5M3F J;  4GYG A;  4DYQ A;  3QOP A;  4OIN F;  1O3T A;  4RB3 C;  3LAJ A;  2JVH A;  4PJ0 C;  3BZC A;  5HDN A;  3KX2 A;  4Y7N J;  2XPU A;  3RCO A;  1JGS A;  1P92 A;  2HKX A;  2WAQ A;  4LIU A;  2HPM A;  1G3Y A;  2GA1 A;  1ZR2 A;  3BLY A;  3I59 A;  4J01 A;  3LNQ A;  1YS7 A;  5J1Y A;  1MMD A;  5J1R A;  4ZDO A;  4LG0 B;  5LEK A;  4N9H A;  4LIV A;  2NNY A;  1E3H A;  2CGP A;  3MVP A;  5HOO A;  2W84 A;  3A4C A;  4QTR A;  3E6C C;  4JX4 A;  2M3A A;  2E35 A;  3FIS A;  4PDK A;  4S05 A;  4UB8 C;  1O7F A;  3IKV A;  1XCB A;  3BPX A;  3S16 J;  3NWT A;  3CO6 C;  3IH4 A;  4BJT A;  5CLS A;  1J9I A;  1Y0U A;  2R93 J;  4ESB A;  1JJ6 C;  3TW6 A;  1PUF A;  1R5I D;  3I58 A;  4CA0 A;  4L0Y B;  2R7F A;  3K9T A;  5CVI A;  1G59 A;  4XRF A;  5EJC A;  4ESF A;  1QVU A;  2KIF A;  5EG0 B;  1PP8 F;  3GYH X;  4KNY A;  1OYW A;  5CVJ A;  3F21 A;  1D0Y A;  2JUG A;  1S3J A;  1LB2 A;  2DLL A;  1WGX A;  4A12 A;  4I09 A;  1LDK B;  4MQ9 F;  2DA6 A;  5K5R A;  4L5I A;  1A31 A;  1BL0 A;  2VBZ A;  1UAA A;  3HGY A;  3ZMT A;  2ACJ A;  1LJ9 A;  5E8I A;  1WH7 A;  5LHH A;  2ZJP F;  3K10 A;  3ABU A;  3MWM A;  2DOD A;  1X4P A;  2A69 F;  4RBO A;  5HVQ C;  4W97 A;  2DI3 A;  3QQA A;  3TO7 A;  2X9D A;  3LSM A;  3ML6 A;  4MLO A;  2VPL A;  2DYS H;  1FWZ A;  1SD5 A;  2IPQ X;  3IAS 2;  3OYD A;  1HW1 A;  3DBR B;  5J1U A;  3ZOB A;  4JP0 A;  2WAE A;  3FXL A;  1Z3Y A;  4Y13 A;  1KYW A;  1ZGW A;  3CCL I;  4IHT A;  5J6X A;  2LOO A;  2EIK H;  3JRA A;  2Z16 A;  3CP2 A;  3H0D A;  3WU2 C;  3PUF A;  1T33 A;  1K6Y A;  3WTS C;  1CQT A;  1UMQ A;  4EM1 A;  4DZJ A;  4HV5 A;  4G9Y A;  5GAH J;  1KA8 A;  3LSJ A;  2IS2 A;  2ZME C;  3HIF A;  4G6T B;  3DPT A;  5C44 J;  2M4G A;  3GCM A;  4AC0 A;  2L7K A;  2WC2 A;  3G1O A;  1SFK A;  3CJR B;  4XOT A;  1VZ0 A;  3NAR A;  3VOD A;  4A5M A;  4F91 B;  2LFB A;  5A2Q K;  3B02 A;  2K4J A;  3QAH A;  2P4W A;  1YOV B;  2HQA A;  1FMV A;  2LSO A;  3MZH A;  5F6F A;  3CCS I;  2CWE A;  3GTJ J;  3OL3 A;  2O6G E;  2R7R A;  1MBG A;  3QPL A;  3GWZ A;  3CMA I;  4UUT A;  1T95 A;  1MSE C;  2ZB9 A;  5FKK A;  4CSW A;  2STT A;  3K4C A;  4XNF A;  4IRG A;  1YQA A;  4UY8 I;  2LMD A;  2ZJR F;  3OY9 A;  2EV6 A;  1Y8R B;  3FX3 A;  3DTK A;  3CZ6 A;  4FAS D;  2H27 A;  3U2R A;  2BW3 A;  2DYR H;  4HST A;  5KAI C;  2YSR A;  2QBY A;  1R00 A;  1IRX A;  2XF5 A;  3OIQ A;  2CFX A;  3H5A A;  5FKM A;  3WTT C;  4HW0 A;  3K6G A;  3PSI A;  2ZXJ A;  1H9G A;  1V5E A;  4MEY F;  4CCN A;  1NK3 P;  3QPS A;  2B63 J;  2QSH X;  2NOG A;  1EH8 A;  2ZNZ A;  2E1N A;  4NC7 A;  2ISY A;  1YW9 A;  2XGC A;  1BIB A;  5HS9 A;  5F1J A;  3CTA A;  1XMX A;  4E7K A;  5DCF A;  2DQR A;  3KZY A;  2Y69 H;  2LD5 A;  1WZ2 A;  3C1D A;  2L0K A;  2KDZ A;  2PJP A;  1QZZ A;  2JT1 A;  4LG3 A;  1SAU A;  2JJ7 A;  2VQG A;  3FMR A;  2DFE A;  3CUQ B;  2XHK A;  2HDW A;  2L7Z A;  2WV1 A;  4FE7 A;  4J00 A;  5FLX K;  4ETS A;  1IV6 A;  1BN5 A;  3CC7 I;  2QGU A;  1X3W B;  2F6C A;  1ZRF A;  3A03 A;  3SYT A;  3BOQ A;  3BP8 A;  2YUS A;  3P5J A;  1PYV A;  3GFJ A;  3HRT A;  1S8N A;  1WVR A;  4ENJ A;  2KIS A;  4PSX A;  3G3Z A;  4BBS J;  1D0Z A;  3FKI J;  2GBY A;  4D9J A;  5GAG J;  2IVM A;  3X2Q H;  4P5O A;  3L2W A;  2CUF A;  1IUF A;  3Q9V A;  3SJM A;  4CGZ A;  1ZTR A;  1OCO H;  2QUF A;  3JRI A;  2MBF A;  1MZB A;  3HRU A;  2UWM A;  2OPT A;  2O8K A;  3OV8 A;  3L2Q A;  5E1Z B;  1GUU A;  3F6O A;  4FX4 A;  3J81 K;  5HLH A;  3DEW A;  4DBR A;  5HS8 A;  4EMS A;  2X6W A;  5FKN A;  1WKM A;  3OYH A;  3LMM A;  5TGT A;  1AKH B;  3OYF A;  3TO6 A;  4HNU A;  1T8I A;  2CFO A;  1OMI A;  5EF6 A;  4NUB A;  4HAM A;  1BW6 A;  1JHH A;  2X4H A;  4WF2 A;  2P6S A;  4UNO A;  3HYI A;  4WXC A;  1YJN I;  1JGG A;  1RR7 A;  2DA7 A;  5L3D A;  5FRN A;  2QWW A;  3O2P E;  3WTY C;  1TZL A;  4Q4Z F;  2ICW G;  2R5Z B;  3SFI A;  5GPC A;  1BBY A;  4PFP A;  3GLX A;  4M6X A;  4UVB A;  5KCM A;  4A3K J;  2OAZ A;  1S72 I;  1W5T A;  3HUG A;  4XQF A;  4AYB N;  2DA4 A;  2HNH A;  3QYE A;  1Z67 A;  3JR9 A;  2E71 A;  1X1D A;  1YW8 A;  4BUP A;  3AG2 H;  4OMZ A;  3T5X A;  2E34 A;  3DTE A;  2DPD A;  5K7Z A;  2NRA C;  1N75 A;  4B3A A;  4E7I A;  4KJZ A;  5F0F A;  2P7C B;  4NHJ A;  3K4L A;  3RTR A;  1B59 A;  1WJ5 A;  3NEU A;  2GIV A;  4IPA A;  2PJR A;  2JA6 J;  5DCM B;  1UG0 A;  1ZH5 A;  4YIF A;  3JRB A;  1R71 A;  3AL0 B;  3K70 C;  4B4C A;  2OTL I;  3L00 A;  2L9R A;  4IXA A;  3SFZ A;  2JPC A;  2XGD A;  2OQG A;  2NYX A;  2JRM A;  2PG4 A;  3RQ4 A;  3ZGK A;  1TWA J;  2ETH A;  2R5Y A;  1J5Y A;  3ZPL A;  1D8K A;  1U9N A;  2K5C A;  1HC8 A;  4JQF A;  3RI4 A;  4A3B J;  1LNW A;  2FMY A;  4CCO A;  1Y6I A;  5IT9 K;  2LG4 A;  4CO8 A;  1ZQ3 P;  1JUS A;  2Y0S N;  2QVO A;  2Q0O A;  3OSF A;  5FD5 A;  3S32 A;  2EPF A;  2TDX A;  2FOK A;  1KON A;  1ZG5 A;  1ETX A;  1XCV A;  1RET A;  2DFI A;  2KL4 A;  5EZH A;  1OR7 A;  5HDK A;  3ASN H;  1R58 A;  5LHG A;  2VAS A;  3JTG A;  3A02 A;  1YJW I;  4I02 A;  4B3X A;  4YEJ A;  4CDG A;  3H1C A;  3GTL J;  3FXM A;  4P9F A;  5D8L B;  2CJJ A;  3KE2 A;  2FQ4 A;  3S3N A;  4N0B A;  4EJW A;  1X1B A;  2HGC A;  5BOX A;  3PIO F;  2DT5 A;  2QQB A;  3BRO A;  4UV8 A;  5GAD J;  5A2Q Z;  2VLA A;  4F93 B;  1FYL A;  3RKQ A;  3ZQL A;  3OYL A;  2NVU B;  4O6J A;  1XGN A;  4Y4R A;  1ZG3 A;  1U5T B;  1MDM A;  2BY2 A;  4ZYA A;  2ESN A;  3N97 A;  2VQL A;  2N8G A;  2GZW A;  4YFK F;  4HNT A;  4UVC A;  2IRF G;  1T0F C;  4N4N B;  3ECO A;  4XKW A;  2VT2 A;  3RJP A;  3KYL A;  1Z7L A;  1H8A C;  3HM5 A;  2K3P A;  4MTE A;  2L4M A;  2RVC A;  2W82 A;  2AQE A;  2DJN A;  5JLX A;  1W7P B;  3ZQC A;  2KJB A;  2EZH A;  2YU9 J;  4EVI A;  2ZO4 A;  4G94 A;  3SXY A;  2YR2 A;  3JCU C;  3BJA A;  1I39 A;  2P7V B;  3ABK H;  3FHN A;  4M72 A;  4B8X A;  1FSH A;  4Y15 A;  4EQQ A;  4BJ6 C;  1U6G A;  2IXS A;  1B9M A;  3BTL A;  1FT9 A;  4MGR A;  1YRN B;  3I4M J;  4ZYD A;  4I0A A;  1BJZ A;  2RAE A;  4H4K C;  2UXN A;  3BR0 A;  2M8G X;  3L2R A;  1EF4 A;  3WTV C;  1FMW A;  2R7Q A;  4G6Q A;  5JI6 A;  2F2E A;  2MD0 A;  1MKM A;  4QPQ A;  3CUO A;  2R7U A;  3GME A;  2HXI A;  2Z1D A;  1ULY A;  2EWN A;  3L2V A;  2DJI A;  2GM4 A;  1VQL I;  5JFR A;  3M8J A;  2QQ9 A;  1XGO A;  2Q1Z B;  3UNG C;  5E3M A;  3HEF A;  5IT3 A;  2FBH A;  1W1W E;  1JUP A;  1HST A;  3HRS A;  3SDG A;  1Y39 A;  5FRM A;  4ZZD A;  3VSK A;  2XPV A;  4DNC A;  1TWC J;  1G2H A;  2E1M B;  3BTJ A;  4KT5 C;  2LP0 A;  1OQY A;  1MBK A;  3OWT A;  5ILV A;  1T6S A;  1ZEL A;  5FB2 A;  2WAQ N;  1QQI A;  1NH3 A;  3BY6 A;  3FBI B;  4XKB A;  1YFH A;  1D8J A;  4IHS A;  5K1Y A;  1X3Z B;  1YG2 A;  5TIS C;  5JVG F;  3J7Z I;  3ECH A;  2K4B A;  3J81 Z;  2LK2 A;  2ZNY A;  3WGG A;  3KP6 A;  5FD6 A;  2HZD A;  3GEZ A;  4GO1 A;  2GXG A;  5LFA A;  3JW4 A;  1LEB A;  2G7U A;  5F1R A;  4ESJ A;  4N4O B;  1PJR A;  2FX0 A;  2V79 A;  3G1M A;  2EIM H;  5LGU A;  3GXO A;  4UUS B;  2IS6 A;  4MO7 A;  4ABZ A;  2XRL A;  2JA2 A;  3PUB A;  4AWX B;  3CC2 I;  3GVA A;  1LVK A;  5BPD A;  2H09 A;  1RZ4 A;  4YRV A;  3HSR A;  1I3Q J;  2VQH A;  3KP7 A;  5CQE A;  1GVJ A;  4UXN A;  1FOX A;  2VJJ A;  3GTQ J;  5DV5 A;  3DEU A;  1UHM A;  1YI2 I;  3OOU A;  4PJN A;  3KLN A;  3ZN1 A;  2X6X A;  3Q0U A;  4AYB A;  4D7N A;  2HDC A;  3KCC A;  3H3V K;  2HFH A;  3LST A;  1O7L A;  1P4X A;  3O6B B;  1Z6T A;  4KMU X;  2HOT A;  3CCV I;  3PJR A;  2DTZ A;  3FIW A;  4WXH A;  2W7N A;  2GWR A;  3CCM I;  1JHF A;  3G1L A;  1MJB A;  1VFC A;  4JBA A;  2VBW A;  3CC4 I;  4X1E A;  1J59 A;  2RNG A;  4CCK A;  2BZT A;  3JTH A;  1ETY A;  4U0Y A;  1QNT A;  2B0L A;  4RA2 A;  4OMY A;  3FXQ A;  4XN0 A;  4BDZ A;  1A04 A;  3K0L A;  3HPH A;  2IA1 A;  3ERM A;  1OCP A;  2QQ8 A;  5E79 C;  1R49 A;  1AOY A;  1HKS A;  3DU6 A;  1K79 A;  1B1B A;  4BBR J;  1FJL A;  1P9Q C;  2DOF A;  1PP7 U;  2MC4 A;  2CQQ A;  1ERD A;  3OYK A;  1D1C A;  4BS9 A;  1HLV A;  3B6A A;  2IA2 A;  5CYV A;  4XOP A;  1ZAO A;  1A6Q A;  2HQ5 A;  5ICC A;  3ZMD A;  1W36 D;  2KQR A;  3PL8 A;  1O3S A;  5IT9 Z;  3HBL A;  2GA2 A;  1IGN A;  1DU0 A;  2HR3 A;  2OA4 A;  3KPH A;  4GCV A;  1YHQ I;  3TP3 A;  3ISP A;  1OIS A;  3IC7 A;  2Y0S A;  2M0C A;  2DCE A;  1MGT A;  3HOY J;  2K9L A;  1I3A A;  2VC1 A;  2VJI A;  4D5C A;  2Z2S B;  4I2O A;  4FQG A;  4YFN F;  3DCF A;  3V8J A;  2XRO A;  2DDB A;  3SEZ A;  2W4S A;  2Q2E A;  2JA5 J;  2MA3 A;  2LKX A;  2LBF B;  2MW8 A;  1D0X A;  1Y56 A;  3I55 I;  5EGO B;  3TQN A;  2DW4 A;  5E8G A;  1HKQ A;  3QYF A;  1ZGJ A;  1USS A;  5B1A H;  2PI0 A;  2OQR A;  1A6I A;  1IJW C;  1UHS A;  3HHH A;  5AIP A;  4RGX A;  3NQO A;  4RAG A;  1YO5 C;  4XSZ F;  1HBX G;  3DBH B;  2OJE D;  2X1E A;  4DYR A;  1QA6 A;  1HOM A;  3C2G A;  2IA0 A;  3H92 A;  2Y2Z A;  5E3L A;  1Z91 A;  2VKV A;  2JMW A;  3QOD A;  4YII A;  4LB5 A;  2R0Q C;  1RIO H;  3LA3 A;  2TRT A;  4PK4 A;  5IPA A;  1WJD A;  1VQM I;  4KN7 X;  2L7M P;  3ZP5 A;  4M6Y A;  2YPR A;  1WJC A;  2QM3 A;  1MSF C;  3DKX A;  5B3S H;  2TCT A;  3TDU C;  2GXA A;  1JT6 A;  2GOX B;  1S9H A;  2KIU A;  2WWY A;  1AKH A;  5IYD J;  2DT6 A;  1LDD A;  1OYI A;  1I6X A;  2Y0M A;  3DTI A;  2KIQ A;  2MC3 A;  1TWF J;  4IF4 A;  1G4D A;  5LGT A;  4BY1 J;  4BHC A;  2MH2 A;  1BOA A;  2M1B A;  4HG2 A;  5ERI A;  3T0Y A;  1IG7 A;  2E36 A;  2YX7 A;  1IN4 A;  4H0E A;  1YLF A;  3C7J A;  4CCJ A;  1VTN C;  1KU2 A;  4II2 A;  1WRJ A;  2CV2 A;  2RQP A;  3L9F A;  1JKO C;  1APL C;  1F5T A;  1TW2 A;  3F0C A;  2XF6 A;  4FHT A;  4EAT A;  4A2U A;  2R4G A;  3ZN0 A;  4ENM A;  1FBS A;  2E19 A;  2AS5 F;  2FRH A;  3CME I;  4I01 A;  4A6D A;  2BY3 A;  1D3Y A;  1TC3 C;  2OD5 A;  3JRD A;  3OSG A;  2WTE A;  2R7V A;  1IW7 F;  3LQR A;  2L02 A;  2X51 A;  4GFB A;  3LAP A;  3BQZ A;  4MIM A;  1F1Z A;  2KPM A;  3I53 A;  5DEQ A;  1XTA A;  2MLG A;  4U88 A;  4BYY A;  4EJV A;  3F8M A;  2IT0 A;  1OCT C;  3S1M J;  1VQ7 I;  1ZLJ A;  5DCM A;  3ULQ B;  4I76 A;  2E60 A;  2ZME B;  2K3F A;  1S7O A;  5EYR A;  1S29 A;  3S2W A;  3E6M A;  3IH2 A;  2DA3 A;  2M8E A;  2WAD A;  2HI3 A;  2RNJ A;  1EH6 A;  1SVO A;  2A5Y B;  2M7B A;  1DQU A;  2XAG A;  5J40 A;  3MN2 A;  4F92 B;  3HJE A;  3J7A Y;  1SD6 A;  1MND A;  4R79 A;  3V42 A;  1XB4 A;  1RPW A;  3E1S A;  1FOK A;  3LA2 A;  4UUV A;  1IN7 A;  5ICE A;  1SEU A;  5HOD A;  5D5V B;  3GO5 A;  1R36 A;  1MJ9 A;  4XLN F;  5IP9 J;  2UZK A;  1G3W A;  4WWC A;  2B9S A;  1F9N A;  4GDF A;  2ADU A;  2IW5 A;  4XIC A;  1HA8 A;  3J7A O;  2EZI A;  4AVP A;  4DOZ A;  3DFG A;  2BBY A;  4NQW B;  4B48 A;  1OR7 C;  4O5V A;  5D5U B;  2QSF X;  3EUA A;  1KQ9 A;  3IP4 B;  2L9V A;  2EB7 A;  2Z9O A;  5L3C A;  4ZTJ A;  2VBX A;  1IRF A;  2Z5U A;  1XMA A;  3KET A;  2ID3 A;  3BWG A;  3I9V 2;  2HZT A;  3HRM A;  1R1U A;  4XBF A;  5HDG A;  3G71 I;  2Y48 A;  5IYC J;  1W0U A;  4JOM A;  3U9G A;  1Y0N A;  3M9A A;  1LKX A;  3WTW C;  4RAZ A;  4XSX F;  1LFU P;  2YS9 A;  4KYW A;  1P2F A;  3F8B A;  1UEL B;  3VSL A;  4QSH A;  3RKW A;  2MG4 A;  4D5F A;  5M5X J;  1U5T A;  1ZHF A;  2ZXI A;  4LK0 F;  4RLQ A;  1BI1 A;  1XD7 A;  1DDN A;  1VQ9 I;  3T8R A;  3JAM K;  1MW7 A;  3BZ6 A;  3LSH A;  3JRH A;  2V4J C;  1BI0 A;  3J80 Z;  3VYS B;  3I64 A;  4I7H A;  1YX3 A;  3TGN A;  2KJC A;  3LSR A;  2ZFW A;  3CF5 F;  2BY1 A;  3DLA A;  2VOP A;  4BXX J;  2L4A A;  3WGI A;  4AVZ A;  1ZR4 A;  5LLQ A;  3ASO H;  3RPU D;  1WH5 A;  2ZKZ A;  5H6Q A;  3F72 A;  2IS4 A;  1RNL A;  4HV6 A;  5IP7 J;  2XC7 A;  4G8X A;  3OOP A;  1YRN A;  1MNE A;  5DUK A;  3L7W A;  4BNC A;  1SAN A;  1VND A;  1YIJ I;  4XL9 A;  2D5V A;  2HS5 A;  1SFE A;  4A3M J;  4EJT A;  1HXD A;  4FIS A;  3V8L A;  3GTO J;  3TMO A;  3S93 A;  1LVA A;  2O8X A;  1KQ0 A;  2VBY A;  3D5S C;  2K40 A;  2M5W A;  1QZY A;  1T56 A;  1G8X A;  4PGG A;  1OKR A;  2QLZ A;  4HX4 A;  4LIT A;  1FTZ A;  4CYD A;  4AM3 A;  3A0H C;  3BG5 A;  5F0H A;  2ZJ2 A;  2B7E A;  2G9W A;  4EV0 A;  3CLO A;  2EV0 A;  2A6T A;  5FO5 A;  1LE8 B;  2FUG 2;  1XGM A;  3J7Y J;  3V7S A;  3F9K A;  4LB6 B;  1GXQ A;  1O3Q A;  1MNM C;  1IXR C;  2LC2 A;  4C9Y A;  4PJM A;  4FCY A;  1TTY A;  4RGU A;  2Y31 A;  3V7C A;  1J75 A;  2HVR A;  1DP7 P;  1T08 B;  4HA8 A;  1DGR M;  1D5Y A;  4A3D J;  2WY7 Q;  3G6E I;  2H1L A;  2VPR A;  4FET A;  2M0M A;  2V6E A;  1FOY A;  3F23 A;  1A35 A;  2OC6 A;  1W5C C;  3LQQ A;  2VUM J;  4BE2 A;  3DPL C;  4G7H F;  2CUJ A;  2K86 A;  3GTP J;  3QPT A;  1ON1 A;  5FKL A;  3RSN A;  4KA4 A;  1SFU A;  1GXP A;  1GV5 A;  4B43 A;  2EK5 A;  1JTX A;  2D1V A;  2QKL B;  3CDL A;  3JRE A;  1PUE E;  5TJJ A;  2E1O A;  2DT7 B;  1JI8 A;  3Q0V A;  3MKL A;  2IGN A;  3B6C A;  2X85 A;  4UUS A;  3HG9 A;  4JYK A;  2DBB A;  5K5O A;  1X3U A;  3VPR A;  4F55 A;  4I0B A;  2RC4 A;  5AIQ A;  3ONQ A;  3IL2 A;  3M4O J;  2UV1 A;  3B73 A;  5C4J J;  4IKF A;  4X6A J;  4M6V A;  3CDH A;  4Q47 A;  2VJ4 A;  3N4M A;  1TQI A;  4KUM A;  3F6V A;  1UHW A;  2LTP A;  4IOC F;  3CCR I;  4EEF G;  1Z05 A;  2QA4 I;  1FBU A;  4U87 A;  5L3B A;  1XSV A;  1DPU A;  2KHM A;  3NWS A;  4A0Z A;  2A05 A;  4FX0 A;  1MMN A;  2K02 A;  2PMU A;  2VE8 A;  1JKQ C;  3M3Y J;  3P7N A;  2P5K A;  5J47 A;  1OCR H;  2MAB A;  3R4K A;  1IN5 A;  1JKP C;  3KP3 A;  3BCB A;  2XB5 A;  3KP4 A;  4HF2 A;  1UB9 A;  2IS1 A;  3JSO A;  1HF0 A;  5CKT A;  4XLF A;  4OU0 A;  3DKY A;  3D5R C;  4IZZ A;  2JK3 A;  1J0R A;  1K78 B;  1FTT A;  2ELJ A;  4A3G J;  3KZZ A;  4ZYG A;  3KZI C;  4BXF A;  1NG6 A;  1Q1V A;  1IXC A;  2AQF A;  1ITY A;  2XGE A;  3HOV J;  3ZQQ A;  3BR3 A;  5JHU A;  3TW7 A;  4HDU A;  1FNN A;  1OYY A;  2MGQ A;  4CYC A;  3F8N A;  4OAY A;  1X1A A;  4BQN A;  2Y9Y A;  2NS7 A;  2ZBK A;  4G6D A;  1TNT A;  4ITV A;  1WHU A;  2KLO A;  4PZJ A;  3ZMZ A;  5JR3 A;  1U8R A;  2Y75 A;  4ZYH A;  2EZK A;  2O9L A;  3F8F A;  3HOX J;  2DPU A;  3A2K A;  1LPQ A;  1B9N A;  2O03 A;  4KMF A;  1V54 H;  1Z6R A;  3HSE A;  2CQN A;  2P8T A;  3BG6 A;  1R5H A;  3PNV A;  4CXF A;  1B8I A;  4L5E A;  2OCE A;  3R0A A;  4BH9 A;  2K9M A;  3E5Q A;  5K7H A;  2VL8 A;  5FFZ A;  2HOE A;  2H8R A;  5E17 F;  2AHQ A;  2KRH A;  4RMN A;  1MBF A;  2CH0 A;  2JVG A;  3WOD F;  2BHY A;  3E5X A;  4HYE A;  3TED A;  3ZCO A;  5D5W B;  4HQM A;  1G3T A;  2E5Z A;  2EA2 A;  3COA C;  4XMY A;  4IOA F;  3C3W A;  3PFI A;  3D1N I;  3IUO A;  3WTZ A;  4R1H A;  5KK1 A;  2D2W A;  3JAM Z;  3MQ0 A;  2NNN A;  5GPA A;  5DYM A;  1R6R A;  4E6K G;  1PUF B;  1V5F A;  1M1E B;  2DQL A;  3MEX A;  3QU6 A;  4BHB A;  2A68 F;  4RM3 A;  4KDP A;  1ACI A;  3I4N J;  2W57 A;  3OS1 A;  2HPI A;  2LY1 A;  1D5V A;  2LF8 A;  2J5P A;  4PSW A;  2BVL A;  4QIW N;  1VQ8 I;  4IEJ A;  4C2M J;  1P4A A;  3PIP F;  1Y1W J;  2HDD A;  3CCJ I;  4OIQ F;  1JKR C;  2MH9 A;  1YIT I;  3S14 J;  2A6H F;  4HSR A;  4XKV A;  2P0W A;  2EIN H;  5J3L A;  3GTK J;  1QHH D;  3BC8 A;  3Q3S A;  2P5L C;  1GVD A;  2IGM A;  5BMZ A;  4C30 A;  4K2E A;  3W3C A;  1WFX A;  3FBN B;  3S17 J;  4PJJ A;  3V4G A;  3QU3 A;  3G2B A;  1FYK A;  3QPH A;  2YU3 A;  3PQJ A;  2HOA A;  1B72 B;  4V2F A;  3KP2 A;  2X0L A;  3HL2 A;  4EGZ A;  1SD4 A;  3WGH A;  3KYC B;  1J2X A;  2R3S A;  2OCC H;  1IDZ A;  4A3F J;  3KLO A;  4RB0 A;  1K61 A;  4RAY A;  3CES A;  1UG2 A;  3JSP A;  2HEO A;  3ESW B;  2VC0 A;  4KIG A;  1P7J A;  4OOI A;  4CIC A;  2QSG X;  2O61 A;  2CW8 A;  1QPM A;  2Y30 A;  3A0B C;  3KFW X;  3H0G J;  3FXJ A;  3O8G A;  4QWQ A;  1IXS B;  2RQQ A;  4MNU A;  3OYA A;  1U78 A;  2V1N A;  5DUI A;  2VOO A;  4DIQ A;  3CJT B;  1FEX A;  2ZXW H;  5JLW A;  5B1B H;  2X6O A;  4KT6 A;  1X1P A;  3H9J A;  2FXA A;  2XIG A;  2CW7 A;  4HEA 2;  5KAF C;  4PCQ A;  1T38 A;  1ZKG A;  2A3S A;  3AL0 C;  4GXO A;  1BOB A;  4V19 K;  2CRG A;  4IX7 A;  3JRC A;  2HOS A;  2E5N A;  3AKZ A;  2PQ8 A;  3GFM A;  5DM7 F;  4L9J A;  1W7P D;  4LG0 A;  1YYV A;  3BJO A;  3T8T A;  2V9K A;  2QKM B;  1I6H J;  1L0O C;  4Z2Y A;  2UUZ A;  3FWE A;  3E3V A;  4M9S A;  3E5U A;  2F48 A;  4LD5 A;  1QPI A;  3GFL A;  3WHB A;  2BE5 F;  4IHX A;  2DMQ A;  4HNV A;  4MFE A;  1FIA A;  3GBG A;  4RB1 A;  5EEG A;  1R9T J;  4IHV A;  2ZSI B;  1TT0 A;  3EUH A;  2XPW A;  2BXZ A;  4XLC A;  3ZQH A;  2XKO A;  1K83 J;  2E7W A;  3K2A A;  2DU9 A;  4OIR F;  4BEH B;  2BW3 B;  5EG0 A;  5DD8 A;  2ELK A;  2RDP A;  2XAJ A;  2QBY B;  4FE4 A;  3KEY A;  4NQW A;  1NG7 A;  3IWF A;  4M71 A;  5M5Y J;  2KZV A;  3MCZ A;  1XDU A;  3G4S I;  4IQ4 A;  2BEO A;  2EIL H;  1KU9 A;  3HZJ A;  1ZGA A;  2WY8 Q;  2E7X A;  1H9T A;  1FY7 A;  1T39 A;  3R6S A;  2COM A;  1NTC A;  2DTR A;  2ECB A;  2L5Q A;  4P96 A;  5CQG A;  4ZTF A;  2HTJ A;  1CF7 B;  5BS6 A;  2VT3 A;  1R22 A;  2ESH A;  2WAF A;  4A3I J;  1J7K A;  2LF7 A;  2XDV A;  3DQV C;  3WU0 A;  3A01 B;  4HF1 A;  1ONV A;  5ILU A;  3RPU A;  2YX4 A;  2F5D A;  3NRV A;  5HS7 A;  3BT9 A;  1U5T C;  5HLG A;  1MJA A;  4L9V A;  5HLI A;  2VN2 A;  4WCG A;  2GLO A;  5D5X B;  2LKS A;  3H9G A;  4I6Z A;  3I0T A;  4ZJZ A;  3L1P A;  2IGO A;  2I8D A;  3P9C A;  4M9X A;  1X2M A;  2XUB A;  2QYO A;  4XN3 A;  3M8F A;  4ZDL A;  5E18 F;  1WJF A;  2CQ7 A;  4BQO A;  3K1M A;  1T2K A;  1K6O A;  1MH3 A;  3EYI A;  1ODD A;  3WG7 H;  3ZQI A;  1WQ2 A;  2XB0 X;  2AXT C;  2JA7 J;  1V55 H;  2E2H J;  3HOT A;  4M3B A;  2K85 A;  5E20 A;  2NOJ B;  3OR2 C;  4CZC A;  1H0M A;  2KFD A;  2JTV A;  5HNH A;  5JVT A;  5GTI C;  4OIO F;  4ZH4 F;  4A93 J;  3BR6 A;  1P6R A;  2M30 A;  1XC5 A;  1ZRD A;  1R4N B;  3LSK A;  2M2E A;  5K7F A;  1BI3 A;  3L2C A;  1OJL A;  2ZFU A;  3TP0 A;  3J80 K;  1BJA A;  2NS8 A;  1YJ9 I;  3AG1 H;  2L3D A;  2LY2 A;  3WU1 B;  2Z33 A;  1FP1 D;  4AIK A;  1YW7 A;  3FDY A;  4JX5 A;  2VI6 A;  2VOD A;  3LA7 A;  3RKY A;  3BTC A;  1OLT A;  2Y9Z A;  2BVM A;  3GF2 A;  1BI2 A;  4O3M A;  2E1M C;  3IHU A;  2R7X A;  3HUG B;  3HTS B;  1ON2 A;  1KGS A;  5F08 A;  3FMQ A;  4QLC U;  3OL4 A;  4LGW A;  3BR2 A;  4E7J A;  3CCE I;  4ZC3 A;  2JA8 J;  4E7S A;  1Z21 A;  3K4N A;  5K5Q A;  4KIC A;  3CP8 A;  2JQ7 A;  6PAX A;  3IRR A;  3PSF A;  2R7Z J;  3ABL H;  1EA3 A;  4ENK A;  5H2F C;  4E7L A;  1X19 A;  2PBI A;  2PJR B;  5C4X J;  3U21 A;  2F5V A;  1BR1 A;  3CUQ A;  2E2J J;  1X2N A;  2ZSH B;  1KZH A;  4CZZ A;  3GW2 A;  2ME0 A;  2EQR A;  3SZT A;  1OFC X;  3ELK A;  4RM2 A;  3FXK A;  1O4X A;  1XG1 A;  1FLI A;  3NAU A;  3CMM A;  2VIX A;  1N77 A;  1GV2 A;  2EFP A;  2EJR A;  2WBM A;  1TQP A;  4CH7 A;  1W4M A;  1IAW A;  3M1C A;  2R5Y B;  1BW5 A;  2CO5 A;  3HB9 A;  4I99 C;  3EPZ A;  2M87 A;  2K9S A;  4NC6 A;  5LRS A;  1WJE A;  1SD7 A;  2LLK A;  2X6Y A;  4BL0 B;  5B5E C;  4IQJ A;  2LKP A;  1W0T A;  3BJ6 A;  2CQX A;  5D4R A;  1K4S A;  3SQN A;  1XSX A;  4XLP F;  3MKZ A;  1LFP A;  2DXI A;  2V1U A;  4EJO A;  1GHC A;  1W36 C;  1RC9 A;  3WHC A;  2IBD A;  5IOZ A;  2PLY A;  4II3 A;  3HTU A;  3PNT A;  1OPC A;  4BXU A;  1ZAR A;  1GLN A;  3K1N A;  1BM9 A;  4A6E A;  5E1W A;  2E1C A;  3DKW A;  1R1V A;  2LR8 A;  3TKY A;  1YS6 A;  4LJZ F;  2EFO A;  2JSP A;  2CSO A;  1DP3 A;  2CV0 A;  4A3E J;  4Y52 J;  1SVM A;  3C2H A;  2DK5 A;  4XON A;  1N78 A;  4G7O F;  3TO9 A;  1O3R A;  3ZR8 X;  3OS2 A;  3EUK L;  4IJA A;  2R5Z A;  3BZK A;  1K78 A;  1AHD P;  2VE9 A;  1U0J A;  4M3E A;  1ENH A;  3FMS A;  2STW A;  4KIB A;  2JSC A;  2R92 J;  1DPR A;  4YIR X;  1MH4 A;  4A3C J;  2UXX A;  3G73 A;  2OV7 A;  4YG2 F;  1LDJ A;  1K7A A;  2FD5 A;  3W6J B;  1MMS A;  1Z0X A;  2FSW A;  5ED4 A;  5FGM A;  4DW6 A;  3KYD B;  1LUJ B;  2ZXH A;  1SAX A;  2NVT J;  2Q8K A;  2HQN A;  4HDV A;  3CJQ B;  3PQK A;  1V5G A;  2EFQ A;  3MZY A;  5L3E A;  3HPG A;  2KIM A;  4XLE A;  3T1B A;  5L3F A;  4A3J J;  2QEN A;  3EYY A;  4GYI A;  4WX9 A;  1FPQ A;  2DA2 A;  2JPB A;  1QZE A;  4A69 C;  2CW0 F;  4HPQ A;  4BAC A;  3H9Q A;  2MLK A;  3WE2 A;  2C6Y A;  3IH3 A;  2GQQ A;  2I10 A;  1F43 A;  1AA7 A;  2DO7 A;  2Z3Y A;  2XAU A;  1U2W A;  1S6L A;  4R8H A;  3K4M A;  4KFC A;  1VQ6 I;  4I98 B;  3H3U A;  4Q48 A;  3GZ5 A;  2KZG A;  2L7F P;  4JX6 A;  4BHP A;  1J09 A;  3IRQ A;  4BAY A;  2QZ8 A;  5FLM J;  1YIO A;  2PMZ A;  1FC3 A;  4M3G A;  1A36 A;  4XOR A;  1XX5 A;  2CU7 A;  5F27 A;  4U0W A;  4M9Z A;  3ZMS A;  3VB2 A;  2NS0 A;  1BR4 A;  1UZC A;  5CVV A;  1FP2 A;  4LLL A;  4OIP F;  3QYB A;  4CCM A;  2O5R A;  3W6K B;  4G7Z F;  1UCR A;  5F64 A;  2GXB A;  2PFB A;  2ISZ A;  2D1H A;  2VKH A;  2R7T A;  2AO9 A;  2VON A;  3BPV A;  2DOA A;  2KMU A;  3A1Y A;  2DMT A;  1IF1 A;  3DP7 A;  4AID A;  2IGK A;  2FBK A;  2FOW A;  1HW2 A;  3H5N A;  1LEA A;  1FYM A;  1TW3 A;  4Z6Y A;  3RDI A;  4D0P A;  1VF9 A;  3DXJ F;  2JUC A;  1ZG1 A;  1ZRC A;  3HSF A;  3GUD A;  3DEE A;  3F8C A;  2KT0 A;  3HOU J;  1B72 A;  1X4O A;  4M3F A;  2RV8 A;  1W7P A;  4HX7 A;  2DMU A;  4BU2 A;  2VQC A;  2G7H A;  3MAJ A;  1MBE A;  1KYZ A;  1IUY A;  1RR8 C;  1IZ1 A;  2P6T A;  4XLA A;  5LRR A;  2F5E A;  2M9H A;  3CF2 A;  3KEQ A;  3LSG A;  4EM2 A;  1I27 A;  4OWR B;  3CCU I;  2NAZ A;  2L2O A;  5H6R A;  2BGC A;  4DQ2 A;  3AFH A;  3TOA A;  3M07 A;  4EM0 B;  2V1X A;  3S1R J;  1VQN I;  2WB1 A;  2XAQ A; 
#chains in the Genus database with same CATH homology
 1HKT A;  4M74 A;  4ON0 A;  3EET A;  3EDP A;  1UFM A;  2FQ3 A;  1I1G A;  1RI7 A;  3GFI A;  1UST A;  3AAF A;  3I54 A;  5AON A;  3D0S A;  5TRD A;  4F7Z A;  2JRT A;  2A6E F;  3U1D A;  1JXS A;  3REO A;  3K1P A;  3TOB A;  4S04 A;  2EV5 A;  5CVU A;  3WG9 A;  2IP2 A;  1WSU A;  2P5V A;  1FX7 A;  3K2Z A;  3F3X A;  3GX4 X;  2W85 A;  2H94 A;  4HX8 A;  3ZMU A;  2ZCW A;  5ICG A;  1CF7 A;  4UHT A;  3RIR A;  2OBP A;  1QGP A;  2DK8 A;  3DF8 A;  2PMH A;  2IJL A;  3D5L A;  2XGX A;  1T98 A;  1IN6 A;  2FNA A;  5BPI A;  4MEX F;  5DDG A;  4ZYE A;  1XGS A;  2F5C A;  4ZZL A;  2HTS A;  1XMK A;  4IVN A;  3P9K A;  3M7G A;  5LGN A;  1B4A A;  1HSJ A;  3MFK A;  1RUO A;  4E70 A;  2HKO A;  5EEH A;  2OZ6 A;  3DV8 A;  2H6C A;  1HW5 A;  4NB5 A;  1BC8 C;  1ZRE A;  1P4W A;  1QO0 D;  2FF4 A;  4A0X A;  4LLN A;  3RYR A;  2L54 A;  1B6A A;  1SMY F;  4BQA A;  1R5G A;  4CHU A;  1NHA A;  1PDN C;  4UV9 A;  1ZLK A;  4LMY A;  3L09 A;  3R0J A;  4IRH A;  1LQ1 A;  1Z7U A;  3I4P A;  4HF0 A;  2MD5 A;  3CUQ C;  1WI9 A;  3I59 B;  4P9U A;  1G6N A;  5BQT A;  1TQM A;  3FXR A;  3FHZ A;  4M73 A;  4TV7 A;  1KQ8 A;  1XDS A;  3IWZ A;  4HLY A;  5ILS A;  2XAS A;  4HLX A;  3FXU A;  2FA5 A;  3FF5 A;  4L9N A;  1R1T A;  2L01 A;  1JE8 A;  2BYV E;  1R23 A;  5H20 A;  4EGY A;  4IRI A;  2RGV A;  4L5J A;  2V6C A;  1ZN2 A;  3I71 A;  5KVR A;  1F4K A;  4HQE A;  4HOB A;  4B09 A;  2V9V A;  3FM3 A;  3RPQ A;  4AIH A;  1CGP A;  5J8F A;  1SFX A;  2FML A;  1TLH B;  1AWC A;  1R7J A;  4MQV A;  1TBX A;  4Q5S F;  2RN7 A;  3BDD A;  3SZP A;  2W24 A;  2HQR A;  2K7L A;  2W25 A;  4RGS A;  5J8C A;  4ENN A;  5CJ9 A;  2KKO A;  4PGH A;  3WTU C;  3WTX C;  3M8E A;  3QRF F;  1C0W A;  1WWX A;  2ELH A;  2HWV A;  3LWF A;  2ZME A;  3E97 A;  1E17 A;  4GGG A;  2O0Y A;  1G3S A;  2XRN A;  3ZQ7 A;  2M45 A;  5D6E A;  4EJU A;  3IKT A;  1I1S A;  1YTY A;  5FLX Z;  2BV6 A;  2AXL A;  1REP C;  4HBL A;  3WE3 A;  2FE3 A;  2OU2 A;  2HYG D;  1XN7 A;  1EV7 A;  3Q9S A;  4LLG F;  5D6F A;  4L18 B;  3ERE D;  3I5U A;  2JZY A;  3V7R A;  4RB2 C;  2LNB A;  2VXZ A;  1RUN A;  3VEP A;  4LFU A;  4A5N A;  2PEX A;  4KN4 X;  1Q1H A;  2CYY A;  3ROU A;  3C18 A;  2H6B A;  1MD0 A;  2EA4 A;  2CQK A;  1E2X A;  5LEJ A;  3QP6 A;  5DD4 A;  3SHF A;  1KU7 A;  1XSD A;  3F22 A;  1DUX C;  4JK1 X;  1QBJ A;  3RKX A;  3GZ6 A;  2FEZ A;  2PN6 A;  3EQL F;  3TDZ C;  1Z9C A;  3ZMV A;  3R60 A;  4MHG A;  3FZV A;  1SMT A;  2RKH A;  4KIF A;  1FBQ A;  1Z1D A;  4L9T A;  3CJN A;  2KRF A;  3H3Z A;  1O57 A;  2K27 A;  3Q5F A;  1HQC A;  1IN8 A;  4WXD A;  5CVR A;  3ABT A;  4UVA A;  5L3G A;  5FFX A;  2OZU A;  1KU3 A;  2GAU A;  3HOS A;  2A61 A;  2F5F A;  1I5Z A;  4P55 A;  2DAO A;  4L0Z B;  1V3F A;  1S7A A;  3K69 A;  5ICF A;  3E6D A;  4RS8 A;  1EH7 A;  4U7D A;  4AD9 A;  4U0V A;  2R7D A;  2FU4 A;  4WK8 F;  1BC7 C;  2D45 A;  3HHG A;  4RGR A;  3M1E A;  2O3F A;  4LK1 F;  4FT8 A;  4A0Y A;  1ZYR F;  2FBI A;  3CO7 C;  4U7B A;  2CG4 A;  1L3L A;  2FNP A;  2LDU A;  1FSE A;  2A07 F;  2XV4 S;  2HYF A;  4YFX F;  3R61 A;  1BIA A;  1U3E M;  1W5S A;  2XKP A;  4MTD A;  1STZ A;  4HZF A;  3E6B A;  2EFN A;  3KP5 A;  3FM5 A;  3KEO A;  2WV0 A;  2XVC A;  5LHI A;  3LFK A;  2Z99 A;  2EFW A;  3P9I A;  3QP5 A;  2XAH A;  1MDM B;  5LBQ A;  4ASN A;  2V1D A;  5E1X A;  2QQA A;  1T0F A;  1V4R A;  3RYP A;  1TNS A;  3VFZ A;  3V8K A;  3O3K A;  1IRG A;  3VOE A;  5D8K B;  2J5O A;  1FZP B;  2XAF A;  4AIJ A;  4N9I A;  4Y17 A;  5D4S A;  4GYG A;  3QOP A;  4OIN F;  1O3T A;  4RB3 C;  3LAJ A;  5HDN A;  1JGS A;  1P92 A;  2HKX A;  1G3Y A;  2GA1 A;  3I59 A;  1YS7 A;  4LG0 B;  5LEK A;  4N9H A;  2NNY A;  2CGP A;  5HOO A;  2W84 A;  3E6C C;  4PDK A;  4S05 A;  1O7F A;  3IKV A;  1XCB A;  3BPX A;  3CO6 C;  5CLS A;  1J9I A;  1Y0U A;  4ESB A;  3I58 A;  4L0Y B;  2R7F A;  3K9T A;  5CVI A;  4XRF A;  4ESF A;  2KIF A;  1PP8 F;  3GYH X;  4KNY A;  1OYW A;  5CVJ A;  3F21 A;  1S3J A;  1LB2 A;  2DLL A;  4A12 A;  4I09 A;  1LDK B;  4MQ9 F;  5K5R A;  4L5I A;  2VBZ A;  2ACJ A;  3ZMT A;  1LJ9 A;  5E8I A;  5LHH A;  3ABU A;  3MWM A;  2A69 F;  5HVQ C;  2DI3 A;  3TO7 A;  3ML6 A;  1FWZ A;  1SD5 A;  2IPQ X;  1HW1 A;  4Y13 A;  1KYW A;  4IHT A;  5J6X A;  3WTS C;  4EM1 A;  4HV5 A;  4G9Y A;  1KA8 A;  3HIF A;  3DPT A;  2WC2 A;  4A5M A;  1FLI A;  3VOD A;  5A2Q K;  3B02 A;  2K4J A;  3QAH A;  2P4W A;  2LSO A;  3MZH A;  5F6F A;  2CWE A;  2O6G E;  3GWZ A;  2STT A;  4IRG A;  1YQA A;  2EV6 A;  3FX3 A;  2H27 A;  3U2R A;  2YSR A;  2QBY A;  1R00 A;  3WTT C;  2CFX A;  4HW0 A;  2ZXJ A;  1H9G A;  4MEY F;  1EH8 A;  2ZNZ A;  2E1N A;  2ISY A;  1YW9 A;  1BIB A;  5HS9 A;  3CTA A;  5DCF A;  2DQR A;  3KZY A;  3C1D A;  2PJP A;  1QZZ A;  2JT1 A;  3FMR A;  3CUQ B;  2XHK A;  5FLX K;  4ETS A;  1BN5 A;  1ZRF A;  3BOQ A;  3BP8 A;  3GFJ A;  3HRT A;  1S8N A;  4ENJ A;  3G3Z A;  2IVM A;  4P5O A;  3Q9V A;  4CGZ A;  2QUF A;  2MBF A;  1MZB A;  3HRU A;  2UWM A;  3OV8 A;  5E1Z B;  3F6O A;  4FX4 A;  3J81 K;  5HLH A;  5HS8 A;  4EMS A;  1WKM A;  3TO6 A;  1OMI A;  4HAM A;  1JHH A;  2X4H A;  4WF2 A;  2P6S A;  4UNO A;  3HYI A;  4WXC A;  5L3D A;  2QWW A;  3O2P E;  3WTY C;  4Q4Z F;  1BBY A;  3GLX A;  4M6X A;  4UVB A;  2OAZ A;  1W5T A;  3HUG A;  1YW8 A;  4OMZ A;  3T5X A;  2DPD A;  2NRA C;  2P7C B;  4NHJ A;  3RTR A;  1B59 A;  3NEU A;  2GIV A;  4IPA A;  5DCM B;  1ZH5 A;  4YIF A;  3L00 A;  4IXA A;  3SFZ A;  2JPC A;  2OQG A;  2NYX A;  2PG4 A;  2ETH A;  1J5Y A;  3ZPL A;  1D8K A;  4JQF A;  3RI4 A;  1LNW A;  2FMY A;  5IT9 K;  4CO8 A;  2QVO A;  2Q0O A;  5FD5 A;  2TDX A;  2FOK A;  1ZG5 A;  1XCV A;  2DFI A;  1OR7 A;  5HDK A;  1R58 A;  5LHG A;  3JTG A;  4I02 A;  4CDG A;  4P9F A;  5D8L B;  3KE2 A;  4N0B A;  4EJW A;  2HGC A;  5BOX A;  2DT5 A;  2QQB A;  3BRO A;  4UV8 A;  5A2Q Z;  1FYL A;  4O6J A;  1XGN A;  1ZG3 A;  1U5T B;  1MDM A;  2ESN A;  3N97 A;  2GZW A;  4YFK F;  4UVC A;  2IRF G;  3ECO A;  2VT2 A;  3RJP A;  4MTE A;  2L4M A;  2RVC A;  1W7P B;  2KJB A;  4EVI A;  2ZO4 A;  4G94 A;  3SXY A;  2YR2 A;  3BJA A;  4B8X A;  2P7V B;  4M72 A;  1FSH A;  4Y15 A;  4EQQ A;  1U6G A;  1B9M A;  1FT9 A;  4MGR A;  4ZYD A;  4I0A A;  2UXN A;  3WTV C;  4G6Q A;  5JI6 A;  2F2E A;  1MKM A;  3CUO A;  1ULY A;  2EWN A;  5JFR A;  2QQ9 A;  1XGO A;  5IT3 A;  2FBH A;  1HST A;  3HRS A;  4ZZD A;  4DNC A;  4KT5 C;  5ILV A;  1T6S A;  5FB2 A;  1QQI A;  3BY6 A;  1YFH A;  1D8J A;  4IHS A;  5K1Y A;  1YG2 A;  3ECH A;  2K4B A;  3J81 Z;  2ZNY A;  3WGG A;  3KP6 A;  5FD6 A;  3GEZ A;  4GO1 A;  2GXG A;  1LEB A;  3JW4 A;  2G7U A;  5F1R A;  4ESJ A;  2V79 A;  5LGU A;  3GXO A;  4AWX B;  3GVA A;  5BPD A;  2H09 A;  1RZ4 A;  3HSR A;  3KP7 A;  1GVJ A;  4UXN A;  5DV5 A;  3DEU A;  1UHM A;  3KLN A;  3ZN1 A;  2HDC A;  3KCC A;  2HFH A;  3LST A;  1O7L A;  1P4X A;  3O6B B;  1Z6T A;  4KMU X;  4WXH A;  2GWR A;  1JHF A;  1MJB A;  4JBA A;  2VBW A;  1J59 A;  3JTH A;  4U0Y A;  1QNT A;  2B0L A;  4OMY A;  3FXQ A;  1A04 A;  3K0L A;  2IA1 A;  1AOY A;  1HKS A;  1K79 A;  1B1B A;  1PP7 U;  5CYV A;  2IA2 A;  1ZAO A;  5ICC A;  3ZMD A;  1O3S A;  5IT9 Z;  2GA2 A;  2HR3 A;  2OA4 A;  4GCV A;  3ISP A;  3IC7 A;  1MGT A;  2VC1 A;  4I2O A;  4YFN F;  3V8J A;  2XRO A;  2Q2E A;  2MA3 A;  3TQN A;  2DW4 A;  5E8G A;  1HKQ A;  1ZGJ A;  1USS A;  2PI0 A;  2OQR A;  3HHH A;  5AIP A;  4RGX A;  3NQO A;  1YO5 C;  1HBX G;  4XSZ F;  2IA0 A;  3H92 A;  1Z91 A;  4YII A;  4LB5 A;  1RIO H;  3LA3 A;  4KN7 X;  3ZP5 A;  4M6Y A;  2YPR A;  2QM3 A;  3TDU C;  2KIU A;  2WWY A;  1LDD A;  1OYI A;  1I6X A;  2Y0M A;  2MC3 A;  4IF4 A;  1G4D A;  5LGT A;  4BHC A;  2MH2 A;  1BOA A;  2M1B A;  5ERI A;  3T0Y A;  2YX7 A;  1IN4 A;  4H0E A;  1YLF A;  3C7J A;  1VTN C;  1KU2 A;  1WRJ A;  2RQP A;  3L9F A;  1F5T A;  1TW2 A;  4FHT A;  4A2U A;  3ZN0 A;  4ENM A;  1FBS A;  2AS5 F;  2FRH A;  4I01 A;  4A6D A;  1D3Y A;  2OD5 A;  2WTE A;  1IW7 F;  3LQR A;  2L02 A;  3LAP A;  1F1Z A;  3I53 A;  5DEQ A;  2MLG A;  4U88 A;  4BYY A;  4EJV A;  3F8M A;  2IT0 A;  1ZLJ A;  5DCM A;  3ULQ B;  3S2W A;  2ZME B;  1S7O A;  1S29 A;  3E6M A;  2M8E A;  1EH6 A;  2RNJ A;  2A5Y B;  2XAG A;  1SD6 A;  4R79 A;  1XB4 A;  1FOK A;  3LA2 A;  4UUV A;  1IN7 A;  5ICE A;  5D5V B;  3GO5 A;  1R36 A;  1MJ9 A;  4XLN F;  2UZK A;  1G3W A;  4WWC A;  1F9N A;  2ADU A;  2IW5 A;  3J7A O;  4AVP A;  3DFG A;  2BBY A;  4O5V A;  5D5U B;  1KQ9 A;  2EB7 A;  2Z9O A;  5L3C A;  2VBX A;  1IRF A;  2Z5U A;  1XMA A;  3KET A;  3BWG A;  2HZT A;  3HRM A;  1R1U A;  4XBF A;  5HDG A;  2Y48 A;  3U9G A;  3M9A A;  3WTW C;  4RAZ A;  4XSX F;  4KYW A;  1P2F A;  3F8B A;  3RKW A;  1U5T A;  1ZHF A;  4LK0 F;  1BI1 A;  1XD7 A;  1DDN A;  3T8R A;  3JAM K;  3BZ6 A;  3J80 Z;  1BI0 A;  3I64 A;  4I7H A;  3TGN A;  2KJC A;  2ZFW A;  2VOP A;  2L4A A;  3WGI A;  5LLQ A;  2ZKZ A;  5H6Q A;  3F72 A;  1RNL A;  4HV6 A;  4G8X A;  3OOP A;  5DUK A;  3L7W A;  4BNC A;  2HS5 A;  1SFE A;  4EJT A;  1HXD A;  3V8L A;  1LVA A;  2O8X A;  1KQ0 A;  2VBY A;  2M5W A;  1QZY A;  4PGG A;  1OKR A;  2QLZ A;  4HX4 A;  4CYD A;  2ZJ2 A;  2G9W A;  4EV0 A;  3CLO A;  2EV0 A;  5FO5 A;  1XGM A;  3V7S A;  4LB6 B;  1GXQ A;  1O3Q A;  1IXR C;  1TTY A;  4RGU A;  3V7C A;  1J75 A;  1DP7 P;  4HA8 A;  3F23 A;  3LQQ A;  3DPL C;  4G7H F;  2K86 A;  3QPT A;  1ON1 A;  4KA4 A;  1SFU A;  1GXP A;  2EK5 A;  2D1V A;  1PUE E;  5TJJ A;  2DBB A;  5K5O A;  1X3U A;  4I0B A;  2RC4 A;  5AIQ A;  3IL2 A;  3B73 A;  3CDH A;  4Q47 A;  3N4M A;  1TQI A;  4KUM A;  3F6V A;  1UHW A;  1Z05 A;  1FBU A;  5L3B A;  1XSV A;  1DPU A;  4A0Z A;  4FX0 A;  2K02 A;  2PMU A;  2VE8 A;  3P7N A;  2P5K A;  3R4K A;  1IN5 A;  3KP3 A;  4HF2 A;  3KP4 A;  1UB9 A;  3JSO A;  4OU0 A;  1J0R A;  1K78 B;  3KZZ A;  4ZYG A;  1IXC A;  5JHU A;  4HDU A;  1FNN A;  1OYY A;  3F8N A;  2ZBK A;  4G6D A;  1TNT A;  3ZMZ A;  4PZJ A;  5JR3 A;  1U8R A;  2Y75 A;  4ZYH A;  3F8F A;  2DPU A;  1B9N A;  2O03 A;  4KMF A;  1Z6R A;  3HSE A;  2P8T A;  4CXF A;  1R5H A;  3R0A A;  4BH9 A;  3E5Q A;  5FFZ A;  2HOE A;  5E17 F;  3WOD F;  3E5X A;  4HYE A;  5D5W B;  4HQM A;  1G3T A;  2EA2 A;  3COA C;  3C3W A;  3PFI A;  3WTZ A;  4R1H A;  5KK1 A;  2D2W A;  3JAM Z;  3MQ0 A;  2NNN A;  5DYM A;  2DQL A;  3MEX A;  3QU6 A;  4BHB A;  2A68 F;  4KDP A;  2W57 A;  1D5V A;  2LF8 A;  2J5P A;  1P4A A;  4OIQ F;  2MH9 A;  2A6H F;  2P5L C;  5BMZ A;  4K2E A;  3V4G A;  3QU3 A;  1FYK A;  3QPH A;  2YU3 A;  3PQJ A;  3KP2 A;  2X0L A;  4EGZ A;  1SD4 A;  3WGH A;  1J2X A;  2R3S A;  3KLO A;  4RB0 A;  4RAY A;  3JSP A;  2HEO A;  4OOI A;  2VC0 A;  4KIG A;  2O61 A;  4CIC A;  1QPM A;  3KFW X;  4QWQ A;  1IXS B;  4MNU A;  1U78 A;  2VOO A;  5DUI A;  2FXA A;  2XIG A;  4PCQ A;  1T38 A;  2A3S A;  4GXO A;  2PQ8 A;  3GFM A;  4L9J A;  1W7P D;  4LG0 A;  1YYV A;  3BJO A;  3T8T A;  1L0O C;  4Z2Y A;  3FWE A;  3E3V A;  4M9S A;  3E5U A;  4LD5 A;  3GFL A;  2BE5 F;  4RB1 A;  5EEG A;  3EUH A;  2XKO A;  4OIR F;  2E7W A;  2DU9 A;  5DD8 A;  2RDP A;  2XAJ A;  2QBY B;  4NQW A;  3IWF A;  4M71 A;  3MCZ A;  1XDU A;  2BEO A;  1KU9 A;  1ZGA A;  2E7X A;  1H9T A;  1FY7 A;  1T39 A;  3R6S A;  2COM A;  2DTR A;  4P96 A;  1CF7 B;  2HTJ A;  5BS6 A;  2VT3 A;  1R22 A;  2ESH A;  1J7K A;  2LF7 A;  3DQV C;  3WU0 A;  4HF1 A;  1ONV A;  5ILU A;  3RPU A;  2YX4 A;  2F5D A;  3NRV A;  5HS7 A;  1U5T C;  5HLG A;  1MJA A;  4L9V A;  5HLI A;  2VN2 A;  4WCG A;  5D5X B;  3I0T A;  3P9C A;  4M9X A;  2XUB A;  2QYO A;  3M8F A;  5E18 F;  3K1M A;  1T2K A;  1K6O A;  3EYI A;  1ODD A;  1WQ2 A;  3HOT A;  5E20 A;  1H0M A;  2JTV A;  5JVT A;  4OIO F;  4ZH4 F;  1P6R A;  2M30 A;  1ZRD A;  1BI3 A;  3L2C A;  3J80 K;  1BJA A;  4AIK A;  2L3D A;  3WU1 B;  2Z33 A;  1FP1 D;  1YW7 A;  2VOD A;  3LA7 A;  3RKY A;  3GF2 A;  1BI2 A;  4O3M A;  3IHU A;  3HTS B;  1ON2 A;  1KGS A;  3FMQ A;  4QLC U;  4LGW A;  5K5Q A;  4KIC A;  6PAX A;  3IRR A;  4ENK A;  2PBI A;  3CUQ A;  4CZZ A;  3GW2 A;  3SZT A;  3ELK A;  2EFP A;  2EJR A;  1TQP A;  1IAW A;  1W4M A;  2CO5 A;  2M87 A;  5LRS A;  1SD7 A;  2LKP A;  3BJ6 A;  5D4R A;  3SQN A;  1XSX A;  4XLP F;  2V1U A;  4EJO A;  1GHC A;  2PLY A;  3HTU A;  4BXU A;  1OPC A;  1ZAR A;  3K1N A;  2E1C A;  1BM9 A;  4A6E A;  5E1W A;  3DKW A;  1R1V A;  3TKY A;  1YS6 A;  4LJZ F;  2EFO A;  2CSO A;  2DK5 A;  4G7O F;  3TO9 A;  1O3R A;  4IJA A;  1K78 A;  2VE9 A;  3FMS A;  2STW A;  4KIB A;  2JSC A;  1DPR A;  2UXX A;  3G73 A;  4YG2 F;  1LDJ A;  1K7A A;  3W6J B;  2FSW A;  5ED4 A;  5FGM A;  1SAX A;  2Q8K A;  2HQN A;  4HDV A;  3PQK A;  2EFQ A;  3MZY A;  5L3E A;  2KIM A;  3T1B A;  5L3F A;  2QEN A;  3EYY A;  4GYI A;  4WX9 A;  1FPQ A;  2JPB A;  2CW0 F;  2MLK A;  3WE2 A;  2C6Y A;  2GQQ A;  2DO7 A;  2Z3Y A;  1U2W A;  1S6L A;  4R8H A;  4KFC A;  4I98 B;  3H3U A;  4Q48 A;  3GZ5 A;  4BHP A;  3IRQ A;  4BAY A;  2QZ8 A;  1YIO A;  1FC3 A;  4U0W A;  4M9Z A;  3ZMS A;  3VB2 A;  2NS0 A;  5CVV A;  1FP2 A;  4LLL A;  4OIP F;  3W6K B;  4G7Z F;  1UCR A;  5F64 A;  2GXB A;  2PFB A;  2ISZ A;  2D1H A;  2VON A;  3BPV A;  1IF1 A;  3DP7 A;  2FBK A;  1HW2 A;  1LEA A;  1FYM A;  1TW3 A;  3RDI A;  4D0P A;  3DXJ F;  1ZG1 A;  1ZRC A;  3HSF A;  3GUD A;  3F8C A;  2RV8 A;  1W7P A;  4HX7 A;  2G7H A;  3MAJ A;  1KYZ A;  1IUY A;  1IZ1 A;  2P6T A;  5LRR A;  2F5E A;  3KEQ A;  4EM2 A;  1I27 A;  2NAZ A;  5H6R A;  2BGC A;  4DQ2 A;  3TOA A;  4EM0 B;  2V1X A;  2XAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...