2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
b'RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication termination protein
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
5HS7A 3VFZA 3RDIA 3V8KA 2W84A 1P4XA 4UXNA 2O03A 1IZ1A 1K79A 1FOKA 5ICEA 2PEXA 1DDNA 3F8CA 3HHGA 1GVJA 1H9TA 1IXRC 3GFMA 2W85A 1P4AA 4LG0B 2YSRA 1P92A 2F5CA 3ELKA 1KU3A 3ZP5A 1ZHFA 5JHUA 4XLNF 4XSZF 2IJLA 1EH8A 4R1HA 4MNUA 3LQQA 1HXDA 3GLXA 5JFRA 2DTRA 2O0YA 1SFUA 4LLGF 1O3SA 4P55A 3J81Z 1SAXA 1Z6RA 2PBIA 2OQRA 2QM3A 1KQ9A 2HQRA 4LD5A 2A6EF 1YQAA 2D1VA 1G3SA 1YW8A 2MLKA 3TO7A 4OIPF 1A04A 3RPQA 4N0BA 1FZPB 4AWXB 3C18A 1W4MA 4CHUA 3L00A 3C1DA 3DV8A 2F2EA 5TJJA 5LGTA 5LGUA 3U2RA 4PCQA 4OU0A 4P9UA 2X4HA 4Y13A 2XROA 4LB6B 2G9WA 4EMSA 3BY6A 1U5TA 1BBYA 1ZG1A 1ONVA 2NNYA 5HS9A 3RJPA 3MZHA 3ECOA 2OBPA 3DP7A 4U0WA 1FWZA 3GX4X 5IT3A 4IRGA 1D8KA 4AD9A 4BAYA 3M9AA 1O3QA 3Q9VA 2FEZA 1ZARA 5ICCA 3PQJA 4GYGA 2P5LC 3TO6A 4O5VA 3GFLA 4EM2A 4GO1A 4ZYHA 2QWWA 3E6DA 3F8FA 2GXGA 1QGPA 2NS0A 1R5HA 2EWNA 2GA1A 3HHHA 1REPC 4I01A 3L9FA 2Y0MA 1IRGA 1KU2A 5ERIA 1KU9A 2MLGA 2H94A 3MWMA 4OOIA 1T39A 2QBYA 5DCMB 5H20A 2PN6A 2VXZA 2ESNA 4I0AA 3HOSA 3TQNA 5DUIA 3HYIA 4ZYEA 2L02A 2VT2A 3IHUA 1SMYF 2G7HA 1UFMA 3GW2A 3T0YA 3V8JA 3K9TA 1S8NA 4YFXF 3E5QA 3IWZA 2V1UA 2DT5A 4LMYA 5L3GA 2HOEA 2TDXA 1RZ4A 4M74A 1R7JA 1HBXG 1PDNC 5D5VB 1J9IA 1KQ0A 3LAPA 2LKPA 1RUNA 1XB4A 2HR3A 4UVBA 4EJUA 2D2WA 2A5YB 3MAJA 2CQKA 2HYFA 2HTJA 4HV5A 1LEBA 1HSJA 1ZLJA 1ZAOA 6PAXA 2DK5A 1YFHA 1X3UA 2PJPA 3FF5A 3CJNA 2HKOA 4LFUA 2IA1A 5K5QA 2HWVA 2H6CA 4KMUX 3I59A 2EB7A 3BZ6A 3D5LA 4CXFA 3K0LA 3DKWA 1XDUA 3NEUA 1QNTA 2WC2A 1PUEE 1U5TB 3FWEA 4TV7A 5BOXA 5BQTA 2A3SA 2V9VA 5E20A 2P6SA 1CGPA 1ZREA 1OYWA 2MD5A 4LLNA 5LHIA 1F1ZA 1NHAA 5LHGA 2ELHA 1BI1A 2P5VA 5HVQC 3RTRA 4A12A 3E5XA 5L3CA 2DO7A 2ISYA 1H9GA 3KLOA 2C6YA 4GGGA 2BBYA 1KYZA 1YW7A 3HSFA 1R58A 1KYWA 2FF4A 1R1VA 1H0MA 1ZN2A 2K86A 1Z1DA 3GZ5A 4GCVA 2RQPA 5KK1A 4UHTA 5FD6A 2WTEA 2VBYA 4YFNF 4EM1A 3LA3A 3ABUA 2W24A 3HRTA 2K02A 1U78A 2K27A 3GFJA 4GYIA 2AS5F 2FSWA 1J7KA 3KEQA 4LK1F 3F23A 2Z33A 4S05A 1VTNC 1W7PB 5LRSA 1YLFA 4B09A 3IRQA 4QLCU 4HV6A 2UXXA 1SD5A 4NQWA 5KVRA 4HOBA 3KZYA 3HTUA 3IWFA 1LNWA 4L9JA 5D4SA 3M7GA 3J80K 1B9MA 1IF1A 5L3BA 1BJAA 2YPRA 1K6OA 2OQGA 4LB5A 1V3FA 2HDCA 3FMRA 2D45A 2FOKA 2VOOA 3CDHA 1IUYA 1I5ZA 4A0ZA 3GO5A 3KE2A 4I2OA 2M45A 3ERED 5BPDA 2Y48A 3O6BB 3N4MA 2DBBA 1I27A 3K1MA 3L09A 3S2WA 1ODDA 5D6FA 2ZFWA 2J5PA 4CICA 4ZZDA 3LA7A 5LRRA 5ILUA 2VODA 5TRDA 2ADUA 1BI2A 5EEGA 5BMZA 4B8XA 2CW0F 1FSHA 3ULQB 2IT0A 2HEOA 3FXQA 4CYDA 4HQMA 1U3EM 4HX4A 3HSEA 3ML6A 4CZZA 3P9CA 1HW5A 1ULYA 2E1NA 3R0AA 5BS6A 2OD5A 3IKVA 2PLYA 1LEAA 4Y15A 1Z05A 4ON0A 1R36A 1TQIA 2V79A 1ZGJA 3TKYA 3MFKA 2YX7A 1R1UA 1DP7P 3EDPA 3TOAA 1MKMA 1FX7A 4L18B 5BPIA 1BOAA 1I6XA 1ZH5A 1U8RA 3GXOA 4HX7A 1P6RA 1MDMB 2VOPA 2JT1A 2KRFA 4CDGA 3ZMTA 5A2QK 1JGSA 4HZFA 4HF0A 4IF4A 4G94A 2O6GE 2ACJA 4I02A 3R0JA 3TOBA 2XAFA 2UWMA 1MJBA 1Q1HA 2M30A 3F8NA 3RKYA 1HW2A 1O3TA 1KQ8A 3CO6C 3E6CC 4IJAA 3H92A 3WU1B 2DQRA 2CFXA 4Y17A 2Q0OA 2XUBA 3EETA 3KP5A 1CF7A 5HLGA 1OR7A 1WRJA 3DPTA 4H0EA 3C3WA 4YIFA 5D5UB 1QZYA 2Z3YA 4AIJA 5K1YA 4AIKA 3QPTA 1FNNA 3EYIA 1MD0A 4G6QA 1MZBA 3BPVA 4IHTA 4G7OF 4OMYA 4IRHA 5HOOA 4G7HF 1MJAA 1HKQA 3V7CA 4UVCA 4QWQA 1JXSA 3HUGA 1Z91A 2IA2A 3BJAA 3F72A 2Y75A 1XGNA 3KEOA 2E1CA 3HRSA 4CGZA 1T6SA 3GUDA 5HS8A 3HOTA 1XN7A 3KP4A 4HQEA 3T1BA 1FP2A 2QVOA 1GXQA 1HKTA 4KICA 2RKHA 5AONA 5EEHA 5AIQA 3WTUC 3GZ6A 2XASA 4BNCA 3RIRA 2K4JA 3SZTA 3ZMVA 3GFIA 2RN7A 5FLXK 2K4BA 5E1XA 2ZCWA 1R1TA 1B1BA 2EA4A 2LSOA 2NNNA 5FB2A 3BP8A 1XSVA 3ZMZA 1P2FA 1PP7U 1UB9A 3WTVC 3U1DA 1O7FA 4EGZA 2WWYA 1BC8C 4RB0A 1O57A 4DNCA 4A0YA 4AVPA 1TW3A 2BE5F 3FMQA 4EM0B 1D8JA 4EGYA 3ZMSA 4HDVA 1C0WA 1SD7A 4PGHA 1RIOH 4Q5SF 3V7SA 1W7PD 2V1DA 1USTA 2VN2A 4HBLA 4OINF 4HDUA 4U0VA 3I54A 2LNBA 2FA5A 1TNTA 4KT5C 1XGMA 2RNJA 2QYOA 2FMLA 4DQ2A 1SD6A 5LHHA 4KN7X 3F3XA 3E3VA 5HDKA 1XSXA 1JHFA 4MEYF 4IVNA 4UUVA 1ON2A 5LBQA 2JZYA 3HRMA 3K2ZA 1T98A 4EV0A 4KDPA 1TBXA 4P5OA 5FD5A 4ZH4F 4HAMA 4MHGA 3W6JB 3TGNA 3M8EA 4G9YA 3FMSA 3V8LA 1J59A 1S7OA 3HSRA 3CTAA 2KIUA 3ZQ7A 5LEJA 3KLNA 3QPHA 4ESFA 2HGCA 4U7BA 1J75A 3ZN0A 1YYVA 1QBJA 3DF8A 4U7DA 2GIVA 1K78A 1L0OC 2EFQA 2Z5UA 3LQRA 3BJ6A 2BV6A 4MEXF 4M9SA 2M87A 2PMHA 3WGHA 5IT9K 3VEPA 1EH6A 3E97A 2IRFG 2XAGA 5A2QZ 4WXDA 4F7ZA 5F64A 5J6XA 1ZLKA 2EK5A 1XDSA 4L0ZB 4R8HA 3U9GA 2RV8A 5ILSA 3WTZA 2RC4A 5J8FA 2XAQA 1FYMA 1TNSA 2PQ8A 4ENKA 2EFPA 2EFOA 3CUQA 2KJCA 2PG4A 1XSDA 4YFKF 4O6JA 1IRFA 3WTXC 1FC3A 3M8FA 4ETSA 2JPBA 4WCGA 1UHWA 4FHTA 2PI0A 3JTGA 2UXNA 1W5TA 3CUQC 3WTTC 1XMAA 3ABTA 4LJZF 1K7AA 2ZMEA 4KA4A 4XLPF 2HYGD 1D5VA 1SMTA 1YTYA 2F5DA 5AIPA 3EUHA 3QP6A 1QQIA 2RVCA 4PDKA 4RGXA 4KFCA 3QU6A 2G7UA 2JRTA 5HDNA 4O3MA 1XCVA 5CVUA 3FZVA 1LDDA 3WGGA 3EYYA 3K1PA 4KIBA 3SHFA 1OKRA 4KUMA 3OV8A 4M9ZA 3QAHA 5E18F 4JQFA 1E2XA 1F9NA 1Z9CA 4UV8A 2CYYA 2CO5A 2DW4A 3FM5A 3V4GA 2STWA 1HSTA 3COAC 4S04A 4KMFA 3FXRA 5DD4A 1G6NA 4LLLA 4M9XA 3F22A 3IL2A 3QRFF 5FLXZ 1R22A 4L9NA 3KP2A 3TDUC 2H09A 2Q8KA 1AOYA 2QBYB 5CVRA 1UHMA 3KP3A 3IC7A 3N97A 2F5FA 1MJ9A 1JE8A 2L4AA 1R5GA 2ZXJA 4UVAA 4YIIA 1Z6TA 2VC0A 2P4WA 1B4AA 2FBKA 1FBSA 4RS8A 5D5XB 3R61A 2CGPA 1D3YA 3P7NA 4UNOA 1ZG3A 3C7JA 3ECHA 3MCZA 4RGRA 2COMA 3BDDA 2A68F 5CYVA 1WI9A 2OZUA 3I71A 1KA8A 4GXOA 2XKOA 2WV0A 1V4RA 4PZJA 2LF8A 1IW7F 2DPUA 2E7WA 5E1WA 5J8CA 3DQVC 4OIRF 2V1XA 4A5NA 4HX8A 3T8TA 4L0YB 2M5WA 5D5WB 4XSXF 4WXCA 2QZ8A 1BM9A 4I0BA 2FBHA 4LGWA 1AWCA 2XIGA 2VT3A 4M6XA 1QPMA 2D1HA 3BOQA 4EJTA 2OZ6A 4EQQA 3WGIA 1RUOA 3G3ZA 1XGSA 4R79A 2RDPA 2GXBA 5D6EA 2QENA 3KP7A 3F6OA 3RYRA 1LB2A 3I59B 3RYPA 2EFNA 2LF7A 3VOEA 3CO7C 3G73A 2A07F 1KU7A 2J5OA 5D8KB 2MC3A 1OYIA 2ZNZA 3WE3A 4NB5A 2VBZA 3OOPA 2FE3A 2ISZA 5CVJA 4A6DA 3H3ZA 2L3DA 5FO5A 1W5SA 2K7LA 1IN6A 4JK1X 2IW5A 2P7CB 1G3WA 4XRFA 3L2CA 1U6GA 2LDUA 5IT9Z 4L9TA 1BI3A 2VBXA 1B6AA 2CSOA 1SD4A 4HLXA 4BQAA 3JAMK 4JBAA 3B02A 4RGUA 3WTYC 2XV4S 3IKTA 2MH2A 3E5UA 1FBUA 3I53A 4MTEA 1DPRA 4BXUA 2DK8A 1DPUA 4P9FA 2R3SA 5FGMA 3WTWC 1FPQA 1WQ2A 2P7VB 1LDKB 2ESHA 2IA0A 2ETHA 1STZA 2X0LA 4NHJA 3CLOA 2FXAA 1ZRDA 1E17A 2L4MA 4BHBA 4KYWA 2DAOA 1USSA 3P9KA 1RI7A 4U0YA 1ZRFA 2HZTA 2Q2EA 1LVAA 4G8XA 4HYEA 2JTVA 4KIFA 4E70A 4I09A 1S29A 5H6QA 3ZMDA 2OA4A 3D0SA 4ESJA 4RGSA 2A6HF 1FYKA 3FXUA 4M72A 5FFZA 1QO0D 3ZPLA 3HIFA 1PP8F 5DCMA 1DUXC 1OYYA 2KKOA 3B73A 5H6RA 3LSTA 1I1GA 3LFKA 4ZZLA 1Z7UA 4RB2C 1F4KA 1XMKA 5LEKA 5K5OA 4I98B 2HQNA 2HFHA 5JR3A 2DLLA 2BYVE 3WG9A 2BGCA 2ZKZA 2MBFA 3FM3A 1J5YA 4HLYA 1I1SA 2L01A 1IN4A 2QUFA 3MZYA 3DXJF 3I64A 3ROUA 4IHSA 3JSOA 2EJRA 5E1ZB 3O2PE 2IVMA 3ISPA 4ZYGA 2CG4A 1HW1A 2PFBA 2FNAA 4KN4X 2A61A 3RKWA 3KETA 2VBWA 2HTSA 1L3LA 1T0FA 3SFZA 3DFGA 1TLHB 5DUKA 1FT9A 2P6TA 5HDGA 3H3UA 5FFXA 3RPUA 3GF2A 3BWGA 2MA3A 4OIOF 4A5MA 5DYMA 3J80Z 3AAFA 1YG2A 4BYYA 1FBQA 5D4RA 3K1NA 2V6CA 3M1EA 1XCBA 3WODF 4IXAA 2ZBKA 2XVCA 1FSEA 3WTSC 3VODA 3W6KB 3BROA 2YU3A 2EA2A 2VE9A 4WX9A 2RGVA 3DPLC 3VB2A 2O3FA 4MGRA 3BJOA 4Q47A 2W25A 3RKXA 3F21A 3I4PA 2ZO4A 1U5TC 3KZZA 5HLHA 3KFWX 1FLIA 3Q9SA 5ED4A 1CF7B 1B9NA 1LQ1A 2HS5A 4BH9A 3E6MA 1FY7A 5L3FA 1U2WA 3T5XA 1B59A 3NRVA 4HF1A 1HQCA 2FNPA 2GA2A 3T8RA 1YIOA 1TQMA 2ZJ2A 1UCRA 4M71A 4LK0F 1Y0UA 1R00A 2VONA 5D8LB 4G6DA 4KIGA 4Q4ZF 1IAWA 4FT8A 2R7DA 1IN8A 3TO9A 3V7RA 1RNLA 2VE8A 1W7PA 2QQAA 4A6EA 3I5UA 4L5JA 1IXSB 4L5IA 4U88A 3JAMZ 3HTSB 1LDJA 3TDZC 3MQ0A 3SXYA 3GVAA 3WU0A 1EV7A 1OPCA 4K2EA 3L7WA 3FHZA 1IN5A 5JVTA 1GXPA 4KNYA 1QZZA 3ZMUA 3JW4A 2EV6A 3QU3A 2KIMA 3R6SA 4HA8A 4ENJA 1J2XA 2YX4A 2JPCA 3KCCA 3LA2A 3HRUA 3LAJA 1T38A 5ICGA 4I7HA 2PMUA 5ICFA 5F6FA 1XD7A 3ZN1A 5DD8A 2AXLA 2KJBA 3QP5A 1IXCA 2DI3A 4WF2A 4YG2F 4M6YA 3RI4A 4ENNA 4WWCA 3SQNA 3WE2A 2FBIA 2OAZA 5CVVA 1EH7A 2H27A 1JHHA 2NYXA 2IPQX 1O7LA 4FX4A 3NQOA 3GYHX 2FRHA 3I58A 2XAHA 5E8GA 1YS6A 3GWZA 1BN5A 2W57A 1ZGAA 1HKSA 5ILVA 3J7AO 5JI6A 1G3YA 2DFIA 3FX3A 5DCFA 2M1BA 4UV9A 3E6BA 3QOPA 1MDMA 4HW0A 1TQPA 2JSCA 1GHCA 2NRAC 3GEZA 1ON1A 3DEUA 3J81K 3K69A 4OMZA 4RAYA 4ESBA 1G4DA 2XHKA 5CVIA 2DPDA 3IRRA 2UZKA 3JSPA 1TW2A 3JTHA 1S7AA 2FQ3A 4PGGA 1K78B 3R60A 4D0PA 4WXHA 2Z9OA 4EJWA 3CUOA 4A2UA 5LLQA 4IRIA 1BC7C 4WK8F 4FX0A 2YR2A 2Z99A 5K5RA 5CJ9A 1ZRCA 2GQQA 1WWXA 4N9HA 1ZG5A 4ENMA 1P4WA 2O8XA 2HKXA 2P5KA 2FU4A 1BIAA 4XBFA 4LG0A 1SFEA 2F5EA 1G3TA 3F8MA 3CUQB 1S6LA 2EFWA 1BI0A 2XKPA 4BHPA 1YS7A 4RAZA 4MQVA 2XGXA 3KP6A 1IN7A 1WKMA 4L9VA 1J0RA 3Q5FA 4Z2YA 4MTDA 3P9IA 4MQ9F 4EJVA 4Q48A 4ZYDA 1T2KA 2KIFA 2ZMEB 4EVIA 1YW9A 2QQ9A 5L3DA 2NAZA 3F6VA 2GWRA 2OU2A 2FMYA 2IP2A 2XAJA 2GZWA 2QLZA 2R7FA 4A0XA 4ASNA 4BHCA 1R23A 2P8TA 5LGNA 3F8BA 4RB3C 4P96A 5DV5A 5L3EA 1XGOA 2M8EA 1BIBA 1LJ9A 5F1RA 2STTA 3MEXA 4N9IA 2DQLA 1FP1D 3O3KA 4RB1A 3EQLF 5CLSA 1WSUA 1FYLA 3PFIA 1YO5C 3SZPA 2GAUA 1SFXA 5E8IA 2O61A 3I0TA 2VC1A 1ZYRF 1F5TA 3PQKA 2XRNA 2H6BA 2BEOA 3LWFA 4CO8A 4G7ZF 1OMIA 2B0LA 1KGSA 2EV5A 1TTYA 2E7XA 4IPAA 4OIQF 2ZNYA 3R4KA 5DDGA 4EJOA 5HLIA 2MH9A 3REOA 4M73A 2L54A 5DEQA 2A69F 2EV0A 3BPXA 1O3RA 4HF2A 2CWEA 2QQBA 2DU9A 1MGTA 1S3JA 5E17F 4AIHA
chains in the Genus database with same CATH superfamily
5HS7A 3VFZA 1VQPI 2K9LA 3RDIA 3V8KA 3GTOJ 2W84A 1P4XA 2PMZA 4BY7J 1OR7C 4UXNA 5FLMJ 4E7KA 2O03A 4HSRA 1G2HA 1IZ1A 1X4PA 1K79A 3PSIA 1FOKA 1RKWA 3W6VA 3FBIB 2GIZA 5ICEA 2H1LA 3LSPA 2PEXA 4D5CA 1TC3C 4PFOA 1DDNA 3F8CA 1YOVB 3HHGA 1GVJA 3S8PA 3CCRI 1WZ2A 1H9TA 1IXRC 3GFMA 3TW6A 4FTHA 2W85A 1P4AA 1MMDA 3ZQIA 4LG0B 2YSRA 1P92A 2F5CA 3ELKA 3A01A 1KU3A 3ZP5A 1ZHFA 5JHUA 2M2EA 4XLNF 4XSZF 1A35A 4OWRB 4RM2A 2IJLA 3C2GA 2ME6A 2VKDA 4V19K 1EH8A 4R1HA 4F93B 4MNUA 1NG7A 3LQQA 2DA4A 1HXDA 3TBIA 3GLXA 5JFRA 1EA3A 1OCRH 5CQEA 4LG3A 2DTRA 3K2AA 2O0YA 2KZGA 4XLAA 1SFUA 4LLGF 1O3SA 4P55A 3J81Z 1SAXA 1Z6RA 2Y30A 3BZCA 2BXYA 2DOFA 2PBIA 2RAEA 5GAEJ 1SFOJ 4HEA2 2OQRA 2QM3A 3A03A 1KQ9A 1X2MA 2HQRA 2D5VA 1OISA 4LD5A 2A6EF 1YQAA 2D1VA 1G3SA 2EZKA 1YW8A 3TP0A 2XC7A 1JKOC 2MLKA 4I6ZA 3TO7A 4OIPF 1QZEA 1A04A 2BY2A 3PM1A 4N0BA 3RPQA 1FZPB 4KJZA 3PUBA 4AWXB 3C18A 1W4MA 4GRIA 4J19A 4CHUA 3L00A 1LKXA 3C1DA 1D0ZA 3GTMJ 1VF9A 3HGYA 3DV8A 4BXXJ 2F2EA 3GCMA 5TJJA 5LGTA 5LGUA 1ERDA 4B1RA 1TL8A 3U2RA 2BZTA 3HGGA 4PCQA 2L7KA 4LOCA 1S5LC 4OU0A 4P9UA 2X4HA 4Y13A 2CV0A 2ID3A 2XROA 2MW8A 4PFPA 4XLCA 4LB6B 2G9WA 2PX9A 2JK3A 2YS9A 4EMSA 4CH7A 3BY6A 1U5TA 4BQOA 1BBYA 1ZG1A 1ONVA 3FXKA 5HS9A 2NNYA 4FQGA 3RJPA 1XX5A 2QSHX 3MZHA 3JRBA 3ECOA 2CQXA 1LFBA 2OBPA 2VPRA 2V26A 3DP7A 4U0WA 1FWZA 2GBYA 2QKLB 4CCLA 3GX4X 5IT3A 2LK2A 3CMYA 4IRGA 3G71I 2R7VA 3CCVI 1D8KA 1UZCA 1GV5A 4AD9A 4BAYA 3M9AA 1O3QA 3Q9VA 4CA0A 2FEZA 1ZARA 5ICCA 3PQJA 1B72A 4CSWA 2HXIA 2I5UA 4GYGA 2P5LC 3TO6A 4O5VA 2LOOA 4PJNA 3GFLA 4EM2A 2X85A 1S9HA 2Z2SB 4GO1A 4ZYHA 2QWWA 4C2MJ 2K5CA 3E6DA 3F8FA 1YX3A 2GXGA 3HJEA 5BNGA 1QGPA 4S0HB 2NS0A 4DGWB 1R5HA 2EWNA 2GA1A 3HPGA 1MIJA 3PO2J 1SVMA 5HNHA 2Q2EB 4NC8A 3SJMA 3HHHA 1REPC 2NVXJ 2E60A 4I01A 3L9FA 3RZOJ 2Y0MA 1IRGA 4UUSA 2R0QC 3OYJA 3IAS2 5J4YA 2K3PA 4CUGA 1KU2A 2E1MB 5ERIA 4AM3A 1KU9A 1IV8A 2MLGA 2H94A 3MWMA 3CJQB 1W0TA 4DYCA 4OOIA 4IHYA 1QVTA 3OYFA 3SDGA 1T39A 2MSYA 4AYBN 1K4TA 2NOJB 2JA6J 1Y8QB 3GTPJ 3K70C 1Z7LA 2QBYA 5DCMB 5H20A 2PN6A 2VXZA 2ESNA 4I0AA 3SEZA 1B8IA 3HOSA 3CF2A 4FE4A 1X1CA 2ZB9A 3TQNA 5DUIA 3HYIA 4ZYEA 2L02A 3PNVA 2FD5A 2VT2A 3QYEA 3GTGJ 4I99C 3IHUA 1SMYF 2G7HA 1I3AA 2W48A 1JUPA 4OAZA 1UFMA 3GW2A 3OR2C 1ZR2A 3MVPA 3T0YA 4BE1A 2E2HJ 3V8JA 3K9TA 1S8NA 4YFXF 3E5QA 3IWZA 2V1UA 4UY8I 5GPAA 4CZCA 2DODA 2DT5A 1RKTA 4LMYA 5L3GA 2HOEA 2TDXA 2LBFA 2NVUB 3CCUI 1RZ4A 1J09A 4M74A 3BR1A 1R7JA 1HBXG 1P7IA 2VQLA 3CP2A 3DCFA 1PDNC 4I76A 1TZLA 3LSGA 3FBNB 4B44A 1MH4A 5D5VB 1J9IA 1KQ0A 4V2GA 3AKZA 3LAPA 4X0GA 2QKMB 1NK3P 4AIDA 2LKPA 3JRFA 1TT0A 1RUNA 1XB4A 2LP0A 4XICA 1QHHD 2HR3A 5M5XJ 4UVBA 4EJUA 2I10A 2D2WA 3DTKA 4IL6C 2A5YB 3MAJA 1JTXA 1IC8A 2CQKA 2HYFA 2HTJA 2JVHA 4HV5A 1LEBA 1HSJA 3FKJA 1ZLJA 2HDWA 2KIQA 3IUOA 1ZAOA 1X4OA 3BG7A 6PAXA 4M3GA 1TWAJ 4AC0A 4DIQA 2DK5A 1YFHA 1X3UA 2PJPA 3FF5A 3NAUA 3CJNA 1HDDC 2HKOA 4B3XA 4LFUA 2R5YB 2R7WA 4KISA 2IA1A 1ETQA 5J1UA 4A3KJ 1X1AA 5K5QA 5CQGA 2HWVA 2LKSA 2H6CA 2ZXHA 3S17J 3PIOF 4KMUX 2M9HA 3I59A 2EB7A 3CMMA 3BZ6A 3D5LA 4CXFA 3K0LA 3DKWA 1XDUA 2KZVA 3NEUA 1QNTA 1I6HJ 1YHQI 4A3CJ 2WC2A 2EIKH 1PUEE 1QA6A 1U5TB 5F27A 3FWEA 4TV7A 3ZGKA 3OYMA 5BOXA 5BQTA 3BR2A 3HZJA 2A3SA 4E7IA 2V9VA 5E20A 5M3MJ 1EJ9A 2P6SA 3EPZA 1Y6IA 3ABKH 1CGPA 4IKFA 1ZREA 4YELA 1OYWA 2MD5A 3ZQFA 4LLNA 5LHIA 1G59A 3BR5A 1F1ZA 1NHAA 5DM6F 5LHGA 2JUCA 2ELHA 1GV2A 3EUHC 1ETVA 2L9SA 3FXJA 1BI1A 2A6TA 2P5VA 5HVQC 3RTRA 4A12A 2JRMA 1MBJA 1TWFJ 3DKXA 3E5XA 5L3CA 2DO7A 2ISYA 1H9GA 3KLOA 2OCCH 2C6YA 3S15J 5J1YA 3I3LA 2ID6A 3K4NA 2DDAA 4GGGA 2BBYA 1UHSA 1KYZA 1YW7A 1ORKA 3HSFA 1R58A 5KNLA 1KYWA 3L2QA 1HDPA 2FF4A 1MBGA 1R1VA 1H0MA 3D5RC 5FKOA 4E7JA 1ZN2A 1AU7A 2K86A 1Z1DA 3WHBA 4C3JJ 4UUSB 5IP9J 3GZ5A 2EINH 4GCVA 2RQPA 3DBLB 2VUMJ 5KK1A 4UHTA 5FD6A 3QPSA 3G1MA 2GM4A 2JWTA 2HXOA 5IY5H 3CCSI 2WTEA 2VBYA 1R5ID 2KDOA 1OCPA 3QQAA 2XB5A 3S1QJ 4YFNF 4EM1A 3LA3A 3ABUA 4IQ4A 1WPKA 2W24A 3HRTA 1FJLA 2K02A 1U78A 2K27A 2PJRA 3BT9A 1Z21A 3GFJA 3PIPF 1MNMC 2IS2A 4GYIA 3A0BC 3TP3A 4CCNA 2AS5F 2FSWA 3D1NI 3TL4X 1J7KA 5CPRB 3KEQA 4LK1F 3F23A 3U21A 4S05A 2Z33A 1VTNC 4IOCF 1W7PB 2V9PA 3H0GJ 5LRSA 1YLFA 4B09A 3IRQA 2H8WA 4QLCU 2JA8J 2DT6A 4BJ6C 4HV6A 2UXXA 1SD5A 4NQWA 5KVRA 2NVTJ 2XSJC 4H4KC 4HOBA 3KZYA 3HTUA 3IWFA 1LNWA 3S1MJ 4ITVA 3W3CA 3W2WA 4XRSA 5EGOB 5HLTA 1PJRA 3QWLA 4L9JA 3CZ6A 5D4SA 2E36A 3M7GA 3SEQA 2QGUA 3J80K 1B9MA 4XIDA 2CUJA 1IF1A 5L3BA 1BJAA 2CW7A 2YPRA 1K6OA 2OQGA 4F91B 4G6TB 1RR8C 4LB5A 3G2BA 1V3FA 2HDCA 3FMRA 2D45A 1Y1WJ 5EYRA 1Z77A 1SVLA 2ZXIA 3CQZJ 1QRYA 2FOKA 2VOOA 3CDHA 1IUYA 1I5ZA 4A0ZA 3GO5A 3KE2A 3DKYA 4I2OA 1A36A 2M45A 4BGDA 4RMNA 3H36A 3ERED 5B5EC 3K4BA 3KYDB 4XMYA 1PUFA 2FUG2 5BPDA 2Y48A 3O6BB 3N4MA 3H1CA 2DBBA 1I27A 3K1MA 3QPLA 3VPRA 2VKHA 3L09A 3S2WA 1ODDA 2OC6A 5D6FA 2ZFWA 2J5PA 4CICA 2VPLA 4ZZDA 2DA2A 3LA7A 5LRRA 5ILUA 4HNUA 2VODA 2HZDA 2O9LA 5TRDA 2ADUA 1BI2A 5EEGA 3NWTA 3VYTB 5BMZA 2BW3B 5GTIC 3JRDA 3HDDA 4B8XA 4BJ5C 2CW0F 2DDBA 1N75A 3DTIA 4XKBA 3OYIA 1FSHA 3ULQB 2IT0A 1JUSA 2HEOA 2R7UA 3FXQA 3JRIA 4CYDA 4HQMA 3OWTA 4EEFG 4HX4A 1U3EM 1DP3A 3HSEA 3ML6A 4CZZA 3HG9A 4A3GJ 3P9CA 1HW5A 1VQ5I 1ULYA 3BZKA 2E1NA 4C3IJ 3R0AA 4Z6YA 5BS6A 1PYVA 2OV7A 4A3DJ 2OD5A 3IKVA 2PLYA 3TW7A 1LEAA 4Y15A 1Z05A 4ON0A 5B3SH 1R36A 3NWSA 1TQIA 2V79A 9ANTA 3VYRB 1ZGJA 3A2KA 3AG3H 3TKYA 3RZDJ 2VKVA 3DBHB 3MFKA 1N25A 2YX7A 1R1UA 1DP7P 3EDPA 1APLC 2BVLA 4BY1J 2QCOA 4JOMA 3OYHA 3TOAA 1IRXA 3G1LA 1MKMA 1FX7A 4L18B 2XSDC 5JLWA 5BPIA 4QPQA 1VQ9I 1BOAA 1I6XA 2LG4A 2R7RA 1ZH5A 1U8RA 3M1CA 3GXOA 2F4OB 2ZJRF 4HX7A 1P6RA 1MDMB 2DJNA 2VOPA 3CC7I 1FTZA 1SVOA 2EZLA 2JT1A 1UMQA 1WJDA 3BCBA 2KRFA 4CDGA 3ZMTA 5A2QK 1JGSA 2XB0X 3S14J 4HZFA 3H3VK 4FE7A 4HF0A 4IF4A 4G94A 5GAGJ 2O6GE 4UB6C 1UJ8A 1FOWA 2ACJA 4I02A 3ZQGA 3R0JA 3TOBA 3LMMA 2XAFA 2UWMA 1WH7A 3HPHA 4NC7A 1MJBA 1Q1HA 3OYBA 2M30A 3F8NA 2LMDA 3RKYA 3G4SI 1HW2A 1O3TA 2IGKA 1KQ8A 3CO6C 3E6CC 4IJAA 2Z16A 2LD5A 3S2DJ 1S7EA 3H92A 3WU1B 2DQRA 2CFXA 2KPMA 4Y17A 2LTPA 1M1EB 2VL8A 2Q0OA 2XUBA 3EETA 3KP5A 1CF7A 5HLGA 2AHQA 4Y33A 1OR7A 4MIMA 1WRJA 3DPTA 4AUXA 3L2WA 4XKVA 4H0EA 1JI8A 2H8RA 3OYGA 3C3WA 1X1DA 3J7YJ 3OYEA 4YIFA 5D5UB 2V9KA 1QZYA 3CF5F 2Z3YA 4AIJA 5K1YA 1ETOA 3QPTA 4AIKA 3CCEI 3HBLA 4XRMA 4EATA 1FNNA 3EYIA 1LUJB 3S32A 4IHWA 2MG4A 3S3MA 1MD0A 3BG6A 4G6QA 2GOXB 1YE9A 1MZBA 4A3MJ 3BQYA 3L2UA 4Y4RA 1YJWI 3BPVA 3BR6A 4IHTA 4G7OF 5IP6A 3OYNA 4OMYA 2K85A 4IRHA 3RPUD 2P81A 3PL8A 3ZR8X 1MBKA 3RQIA 5HOOA 1AHDP 3FK7A 4D7NA 4G7HF 1MJAA 2CQ7A 1HKQA 1GLNA 3V7CA 1WHUA 2DOEA 2K9QA 4UVCA 2CUFA 2JN6A 4QWQA 1JXSA 3HUGA 3RKQA 4KT6A 1Z91A 1ETWA 2IA2A 3Q0VA 1Y0NA 3I4MJ 3Q3SA 3BJAA 3F72A 2Y75A 1ENHA 2IAIA 1XGNA 1Y1VJ 3BTIA 4RAGA 4C2TA 3KEOA 2E1CA 3GTLJ 4RAFA 3HRSA 4CGZA 1T6SA 4JX6A 5F0FA 2NXNB 4A69C 1PUFB 3GUDA 5HS8A 3HOTA 2HDDA 1BL0A 5C4XJ 1XN7A 3KP4A 3OL3A 2Y9ZA 4HQEA 1U9OA 3AL0C 2LY1A 2X6XA 3T1BA 1FP2A 1D1BA 4B3AA 2QVOA 1WH5A 4CCKA 1GXQA 1HKTA 2DA7A 1Z0XA 3N05A 4KICA 2RKHA 5AONA 3M3YJ 5EEHA 1SFKA 2KLOA 5AIQA 3WTUC 3GZ6A 2XASA 4BNCA 3RIRA 2K4JA 2DMTA 3SZTA 2XPWA 3OMYA 1VQOI 3ZMVA 3K4LA 1A6IA 3GFIA 2KQRA 2F4MB 2RN7A 5FLXK 3HM5A 2IBDA 2JA7J 2K4BA 5E1XA 2ZCWA 1R1TA 1B1BA 5KAFC 2QSFX 2EA4A 2LSOA 2NNNA 1LE8A 1F43A 3NARA 5FB2A 1XC5A 3BP8A 5HNFA 3HOWJ 1XSVA 3ZMZA 1P2FA 1PP7U 3U1KA 1UB9A 2VASA 3WTVC 1HCRA 3U1DA 1O7FA 4EGZA 2WWYA 1BC8C 2E2JJ 2VJ4A 3W2AA 2QA4I 4RB0A 1O57A 2Y2ZA 4DNCA 4A0YA 4BE2A 2LH9A 4AVPA 1TW3A 2Y9YA 2BY0A 2OUMA 3ESWB 2BE5F 2P0WA 2YUSA 3FMQA 4EM0B 5DS9A 1D8JA 2UV1A 4EGYA 2HU9A 3ABLH 4XOPA 3MN2A 5C44J 3ZMSA 1V54H 4HDVA 1C0WA 1SD7A 4PGHA 3I4NJ 1RIOH 4Q5SF 3OIQA 1DGWY 3JRCA 3V7SA 3UNGC 1W7PD 3OSFA 1JJ8C 3CESA 1SC7A 2V1DA 1T0FC 3KX2A 2MYSA 3LSHA 1USTA 2VN2A 4HBLA 4OINF 4DBQA 3I55I 4U0VA 3I54A 4HDUA 3HOYJ 2LNBA 2FA5A 1TNTA 1WVRA 4KT5C 1XGMA 2RNJA 2QYOA 3EUAA 2Y69H 2FMLA 4DQ2A 2EH3A 1SD6A 5LHHA 4KN7X 2L7ZA 1V5FA 3F3XA 4N4NB 1D0YA 4Y7NJ 3D5SC 4RLFA 1X1PA 3E3VA 4C30A 3FK6A 3ABMH 4Y3OA 2B7EA 3SFIA 1GDTA 5HDKA 4XKCA 1XSXA 3BCAA 2M4KA 5J3LA 5KCMA 1WJ5A 1JHFA 3KYCB 2LLKA 3L2RA 1WJEA 2VQGA 1H89C 2IS4A 2VQCA 2HPMA 4MEYF 3PJRA 2R4GA 4IVNA 4UUVA 2LREA 2JSPA 1ON2A 5LBQA 2JZYA 3JRHA 3HRMA 4RA2A 3K2ZA 4DYRA 2ZSIB 3QOEA 2JA5J 1T98A 4EV0A 2X1CA 1Y56A 2OTLI 3GZNB 4KDPA 1HA8A 1TBXA 1DQUA 3QYBA 4P5OA 5FD5A 4ZH4F 3K4JA 4HAMA 4MHGA 3W6JB 2XF6A 3OYDA 3TGNA 3VDXA 1HF0A 3M8EA 4G9YA 4LITA 3FMSA 4BKXA 1RRJA 1I39A 3V8LA 3A1YA 1J59A 2A05A 1S7OA 3HSRA 5CKTA 3CTAA 2KIUA 4AYBA 1TP4A 3ZQ7A 1JUMA 5LEJA 2CUEA 5IYCJ 2VJ5A 3DEEA 4CYCA 3KLNA 3S3OA 3QPHA 4ESFA 2HGCA 2AO9A 2BVMA 2EILH 4U7BA 1J75A 3ZN0A 1YYVA 1QBJA 3DF8A 4U7DA 2DCEA 1XMXA 3ZXSA 5IP7J 2GIVA 1K78A 1L0OC 2DFEA 2EFQA 2XAUA 3HUGB 3K6GA 3A01B 2Z5UA 4ZC3A 1T8IA 2LY9A 3CDLA 3AG1H 2HI3A 1RC9A 3LQRA 4JYKA 3CLQA 1X3WB 3BJ6A 2BV6A 3RCOA 4MEXF 1OJLA 1OCTC 4M9SA 4X1EA 2M87A 2PMHA 3F0CA 3WGHA 5IT9K 3VEPA 2A5WA 1EH6A 3VSLA 3E97A 2IRFG 2XAGA 5A2QZ 2FJ1A 5J40A 1YIJI 1POGA 1T56A 2BHYA 3FIWA 4WXDA 4F7ZA 2HNHA 4FCYA 3GTKJ 1GVDA 2BY1A 2R7OA 1OCCH 5F64A 5J6XA 1ZLKA 2EK5A 1XDSA 4L0ZB 5FRMA 2IS1A 3IP4B 4R8HA 2CJJA 1BJZA 3U9GA 1EKEA 1VNDA 2OJED 2V6EA 1K83J 1ZKGA 2RV8A 3O8HA 1VQ7I 3EUKL 3LSMA 5ILSA 3WTZA 2RC4A 5J8FA 2XAQA 3S3NA 1FYMA 3VWBA 1TNSA 1AKHA 2PQ8A 4ENKA 2EFPA 2QQ8A 3CUQA 1MMAA 2ECCA 1RPWA 2EFOA 4NNJA 2KFDA 1K61A 2KJCA 3F9KA 2PG4A 2W7NA 2WAQN 1XSDA 3A02A 3Q0UA 4YFKF 3IV5A 4O6JA 1IRFA 3VYSB 3WTXC 1YITI 2ME0A 1FC3A 3M8FA 2WAEA 1BR2A 2JPBA 4ETSA 3BTJA 1LE8B 2JA2A 4XK4A 5IYDJ 4IO9F 4RLQA 2DYSH 1FTTA 4WCGA 4BACA 3M8JA 5JVGF 2CFOA 1UHWA 4FHTA 2PI0A 3JTGA 2UXNA 1W5TA 5FLVA 3B6CA 3CUQC 3WTTC 1XMAA 3AG4H 3ABTA 4LJZF 1K7AA 2ZMEA 2K9MA 2HOAA 1VFCA 3CDIA 4XLPF 4KA4A 2HYGD 1V5GA 3MD2A 1D5VA 1SMTA 2ECBA 1YTYA 1X19A 1DU0A 2F5DA 3BC8A 5E3MA 2VQHA 3CJTB 5AIPA 3EUHA 2E5ZA 3IH4A 3QP6A 1YX5A 1QQIA 2CMPA 1MBFA 2M34A 1E0EA 4C3HJ 2RQQA 1XPXA 2RVCA 3OYLA 4CCJA 4PDKA 2ZMEC 4RM3A 1RESA 4RGXA 4KFCA 3QU6A 2G7UA 2WV1A 4F3QA 3UR3C 1V55H 2JRTA 5HDNA 4O3MA 2DMQA 3LSJA 2TCTA 2L5QA 1XCVA 5CVUA 3FZVA 1D1CA 1B72B 1HOMA 1LDDA 3WGGA 1NH3A 1QHGA 3EYYA 3K1PA 5GP9A 4KIBA 1MMNA 3SHFA 4IHXA 1OKRA 1HLVA 4V2FA 4XONA 3KPHA 4KUMA 3CCMI 1D1AA 3OV8A 4M9ZA 2JJ7A 3QAHA 4JQFA 5E18F 1SEUA 1E2XA 4BEHA 5IOZA 1F9NA 1Z9CA 4UV8A 2DMUA 2XRLA 1OFCX 5FKLA 4E7HA 3OL4A 3GLLA 1OQYA 2CYYA 2CO5A 2DW4A 3FM5A 3V4GA 2STWA 1HSTA 3COAC 4S04A 4KMFA 2I8DA 1YRNA 3FXRA 2K9NA 1ZELA 2KRCA 5DD4A 2KT0A 2R92J 1G6NA 2BXZA 4LLLA 1Y39A 4M9XA 3F22A 1U0JA 3IL2A 5E3LA 3CD6I 3QRFF 5FLXZ 2B9SA 1R22A 4L9NA 3KP2A 1KZHA 3TDUC 2H09A 1R4MB 3I9V2 4FISA 5FRNA 2Q8KA 1UG0A 4D7MA 2R7TA 2ELJA 1AOYA 2QBYB 2DJIA 5CVRA 1LPQA 1K4SA 1B8IB 4E7ZA 1VQKI 1UHMA 2VI6A 3E7LA 1DGRM 2HVRA 3KP3A 3IC7A 4DZJA 3N97A 3MMYB 4CYCB 1FOYA 2F5FA 2IGNA 1MJ9A 1TWHJ 1JE8A 2L4AA 1TWCJ 1R5GA 2CS3A 2ZXJA 1ETXA 4MLOA 4UVAA 4YIIA 4ZDLA 2MABA 1Z6TA 2VC0A 2P4WA 1B4AA 2FBKA 1FBSA 5EG0A 2V7FA 4RS8A 4B48A 5H2FC 5D5XB 3R61A 2CGPA 1D3YA 5LFAA 2DMPA 5B66C 5KAIC 3P7NA 2L7FP 3S16J 4UNOA 1ZG3A 3C7JA 3ECHA 3MCZA 4RGRA 2B63J 2LBFB 3ERMA 2COMA 3BDDA 2VJJA 2V4JC 2A68F 1FMWA 2R5ZA 3MKLA 4IEJA 4DZPA 5CYVA 4A3EJ 3OOUA 1WI9A 2OZUA 1ZK8A 3I71A 1KA8A 1N78A 3S1RJ 4PK4A 2COBA 4GXOA 2WADA 2XKOA 2WV0A 1V4RA 4PZJA 2LF8A 1IW7F 2DPUA 2E7WA 3DTEA 5E1WA 5J8CA 3DQVC 4OIRF 2V1XA 4A5NA 4HX8A 3T8TA 1ZTRA 4L0YB 2M5WA 2K9SA 4JP0A 5D5WB 2IEKA 4XSXF 4WXCA 2QZ8A 1BM9A 2LFBA 4I0BA 4II2A 2FBHA 2W4SA 1E3PA 4LGWA 1AWCA 4BJTA 1ZR4A 2XIGA 3H0DA 2VT3A 4M6XA 1QPMA 2L9VA 2D1HA 3BOQA 4EJTA 2CH0A 2OZ6A 4EQQA 3WGIA 1MNDA 3CCJI 1RUOA 3G3ZA 2CQNA 1XGSA 4M6VA 3M07A 4R79A 2RDPA 2GXBA 4PJ0C 4PJJA 1D0XA 2QENA 3KP7A 5D6EA 3V42A 3F6OA 3S2HJ 3DBRB 1R6RA 3FKIJ 2RREA 3K4CA 3RYRA 1LB2A 3I59B 2E71A 3RYPA 2EFNA 1TWGJ 2LF7A 3VOEA 3CO7C 3G73A 2A07F 1KU7A 2J5OA 3CCYA 3K4KA 4IOAF 1Q1VA 4XRSG 3PFYA 5D8KB 2M0CA 1OYIA 2MC3A 2ZNZA 4XQFA 3WE3A 4NB5A 4DYQA 2HQ5A 2VBZA 1T95A 3OOPA 3PSFA 2FE3A 2ISZA 1WJBA 5CVJA 4A6DA 2IS6A 3H3ZA 2JMWA 2L3DA 2E35A 5F04A 2LVSA 5EDNA 3HOXJ 4DW6A 5FO5A 1E3OC 1SAUA 1W5SA 2X9DA 3FXOA 3HXLA 2R7ZJ 1RETA 2K7LA 4OAYA 1IN6A 1OCZH 4JK1X 2IW5A 3GTJJ 2P7CB 1LFUP 3AG2H 2ELKA 3ZCOA 1G3WA 3LSIA 2E1OA 4XRFA 3L2CA 1U6GA 1JJ6C 4X6AJ 1FEXA 2MC4A 2LDUA 5IT9Z 3MKWB 1R4NB 4L9TA 2EPFA 3OS1A 1BI3A 4HRIA 2VBXA 5F0HA 2E2IJ 1B6AA 1OCOH 2CSOA 4HNTA 1SD4A 4HLXA 4N4OB 4E6KG 4RDUA 4BQQA 3JAMK 1N77A 4BQAA 1UELB 4JBAA 3B02A 4RGUA 3WTYC 4QPOA 4GDFA 2XV4S 3IKTA 2MH2A 3E5UA 1FBUA 3I53A 2KP6A 1DPRA 2NS7A 2DK8A 4MTEA 4P9FA 4BXUA 5K7FA 2R3SA 1DPUA 5FGMA 3WTWC 1FPQA 1WQ2A 5FJ8J 1R9TJ 3OYAA 3WHCA 1WJCA 1MBEA 2ICWG 2P7VB 5E3NA 4ZTFA 1LDKB 1IRZA 2ESHA 3DLAA 2ZJQF 4UB8C 2IA0A 2ETHA 4F92B 2DN0A 2QSGX 5EZHA 1BA5A 1STZA 2X0LA 4NHJA 2PJRB 3CLOA 2FXAA 1IV6A 1ZRDA 2L4MA 4BHBA 1E17A 1A6QA 1GUUA 4D9JA 5J1RA 4KYWA 1JKPC 4JX5A 2DAOA 1USSA 3P9KA 5FKKA 1RI7A 4U0YA 1ZRFA 2HZTA 2DXIA 2Q2EA 1BR4A 2KISA 1LVAA 1RR7A 4BDZA 4G8XA 3B6AA 4HYEA 2JTVA 4KIFA 2FOWA 4NQWB 2R7QA 4XL9A 1IO2A 1H8AC 4E70A 1Z3YA 1IG7A 4I09A 2JVGA 2IXSA 1S29A 4NC6A 5H6QA 2FX0A 3ZMDA 2MD0A 5EG0B 2OA4A 3D0SA 4ESJA 3OIPA 4RGSA 2A6HF 2X6WA 2F6CA 5M5YJ 1FYKA 1PVEA 1T33A 3FXUA 4M72A 4P1WA 5FFZA 1O4XA 4GFBA 1QO0D 4Y52J 2XF7A 3ZPLA 3HIFA 1PP8F 3BG3A 5DCMA 3DEWA 2E1MC 2EZHA 1DUXC 4QTRA 3S1NJ 2R5ZB 3KEYA 1OYYA 2KKOA 3B73A 1EF4A 5H6RA 1WJFA 1I1GA 3LSTA 3LFKA 4PUSA 4ZZLA 2M0MA 3X2QH 1Z7UA 3BLYA 3HOUJ 2W1OA 4RB2C 1F4KA 2F4IA 3CCQI 2VIXA 1XMKA 5LEKA 4KITB 5K5OA 2KRHA 2XF5A 4I98B 2HQNA 2HFHA 2ZXWH 5JR3A 2DLLA 2E19A 4BUPA 2BYVE 4BBSJ 3WG9A 2BGCA 4ZDPA 4FASD 5DM7F 3ZQQA 2ZKZA 2MBFA 4J00A 3CC4I 3FM3A 1J5YA 4HLYA 5KHDA 2NS8A 1U9NA 1I1SA 4ANJA 2XGEA 2L01A 1IN4A 4DBRA 2QUFA 3MZYA 2X51A 2N8GA 3OYCA 2HVSA 2OF7A 2IGOA 3DXJF 3I64A 3ROUA 4IHSA 4AVZA 1X2NA 3JSOA 2EJRA 3PNYA 5E1ZB 3O2PE 1JKQC 1D5YA 5IOYA 2IVMA 3ISPA 4ZYGA 3ZQLA 2XDVA 3W2VA 2CG4A 1HW1A 1MNEA 1E3HA 2PFBA 5EEAA 2FNAA 3K70D 3PNTA 2ZSHB 2TRTA 4KN4X 4UUTA 1W36D 1I3QJ 2A61A 3RKWA 3KETA 1ZQ3P 1R71A 2VBWA 2Z1DA 3OIOA 2HTSA 3P5JA 1L3LA 3SDBA 2R7XA 3ASNH 1T0FA 3SFZA 3DFGA 5FKNA 1TLHB 3HC7A 5DUKA 1FT9A 3CMEI 2P6TA 2LRDA 3H3UA 5HDGA 5FFXA 3RPUA 3GF2A 2R5YA 3BWGA 2AXTC 5JHFA 1NK2P 4QIWN 2MA3A 1UG2A 4OIOF 4XOTA 4A5MA 5DYMA 3J80Z 1VQNI 2DYRH 1YG2A 4BYYA 3AAFA 1FBQA 4ABZA 3C2BA 4NDLA 2O8KA 2EIMH 5TISC 5D4RA 3K1NA 2V6CA 2RNGA 3M1EA 2XPVA 1XCBA 2ZJPF 3WODF 4II3A 3GMEA 4IXAA 2ZBKA 2XVCA 2DOAA 1FSEA 3WTSC 3VODA 3W6KB 1MMGA 3BROA 3DLLF 2OTJI 2YU3A 1MSFC 1IGNA 2EA2A 5GADJ 2VE9A 2HOSA 4WX9A 2RGVA 3CC2I 1TT5B 2M8GX 3DPLC 3VB2A 1YJNI 2YU9J 1WCMJ 2O3FA 3JR9A 4MGRA 3BJOA 4BS9A 2LYCA 4MFEA 4Q47A 5E79C 2W25A 3RKXA 5GTHC 2OPTA 3F21A 3I4PA 2ZO4A 1U5TC 3DU6A 3KZZA 5HLHA 3IH2A 3KFWX 3MKYB 1FLIA 4ZTJA 1U8BA 3Q9SA 1ETKA 3TEDA 5ED4A 3J7AY 5DTDA 3OY9A 4NBQA 1B9NA 1CF7B 1LQ1A 5EZGA 4PSWA 4QSHA 4C2UA 2HS5A 3IAM2 4BH9A 2M4GA 3E6MA 2W00A 1FY7A 3L1PA 5L3FA 1U2WA 1SANA 1NTCA 3T5XA 4HPQA 4C9YA 4A93J 1A5JA 4M3DA 1B59A 1VI0A 2F5VA 1YI2I 3NRVA 1ITYA 4HF1A 1HQCA 4FETA 2CV1A 5F1JA 2FNPA 2GA2A 1GT0C 3T8RA 2EBIA 1YIOA 1MSEC 2R93J 2X6YA 1TQMA 2ZJ2A 1UCRA 1FIPA 5EJCA 4ZYAA 5J47A 2DA5A 4M71A 5FKMA 4LK0F 3HOZJ 1Y0UA 1R00A 2VONA 4E7LA 1OLTA 4G6DA 4XNFA 3SYTA 3VYUB 4KIGA 5D8LB 3CCLI 1W1WE 2VXDA 1V5EA 4Q4ZF 1IAWA 4J01A 4FT8A 2R7DA 1IN8A 3TO9A 3S93A 1YJ9I 1WI3A 1W36C 1FIAA 2WY7Q 3V7RA 1RNLA 2VE8A 4ZDOA 4XLEA 5F08A 3AL0B 1BW5A 1F36A 1W7PA 2QQAA 3BG5A 2H1KA 4A6EA 2NVYJ 3FDYA 5EF6A 1XS9A 3I5UA 4F55A 3ASOH 4L5JA 2GOMA 1IXSB 2VJIA 1X3ZB 4L5IA 1VQ8I 1BR1A 4U88A 4W97A 1WGXA 1BW6A 3JAMZ 2M7BA 4DJAA 5EGOA 1Y8RB 3HTSB 1LDJA 1P9QC 2BHZA 3TDZC 2CUZA 2CW8A 3MQ0A 2LKXA 3SXYA 5M3FJ 3ZRGA 5B1AH 3GVAA 4XR6A 3WU0A 2JQ7A 1Z67A 1VQLI 1KONA 1EV7A 1OPCA 4XKWA 4K2EA 1BOBA 3L7WA 3PO3J 2DFFA 3FHZA 1IJWC 1IN5A 5JVTA 1GXPA 3OS2A 4KNYA 1QZZA 3ZMUA 3CMAI 2DFHA 3JW4A 2EV6A 3QU3A 4CCMA 4YRVA 2R7SA 4IX7A 2KIMA 4IHVA 3HOVJ 3R6SA 3TMOA 1IDZA 4HA8A 4ENJA 1J2XA 2HVQA 2YX4A 2JPCA 1LFPA 4A3BJ 2CU7A 2WAQA 2QF7A 4BQNA 3KCCA 2GLOA 2AQFA 2XGCA 3LA2A 3HRUA 2BY3A 3Q0WA 2VLAA 3BR0A 3LAJA 1T38A 5ICGA 4I7HA 2PMUA 2KHMA 3H5AA 3L2VA 5ICFA 5F6FA 1XD7A 3ZN1A 5DD8A 2AXLA 2KJBA 2BW3A 3QP5A 1IXCA 2F48A 2G0EA 2Y31A 2DI3A 5C4JJ 4WF2A 4DOZA 4YG2F 3RSNA 2O7OA 2E34A 2X48A 4M6YA 1VQ4I 2GXAA 3RI4A 3DPUA 3H9QA 4ENNA 1JTYA 4WWCA 3SQNA 3WE2A 2FBIA 4U87A 3HEFA 2OAZA 5CVVA 4F52A 1EH7A 2DA3A 4PSXA 1JHHA 4D5FA 2H27A 2NYXA 2X1EA 2IPQX 1O7LA 3MKZA 4FX4A 2XPUA 4E4HA 3A0HC 3NQOA 3GTQJ 1IUFA 3GYHX 1WFXA 2FRHA 3I58A 2XAHA 1AA7A 5E8GA 1YS6A 2EZIA 3GWZA 2CRGA 3H35A 2ZFUA 2HOTA 1BN5A 2DT7B 2CV2A 3ZQHA 2W57A 2NOGA 1ZGAA 3SZGA 4BL0B 3J7ZI 3H5RA 2M7AA 1HKSA 1HC8A 3BR3A 2AQEA 5ILVA 5JI6A 3J7AO 1G3YA 2DFIA 5E3OA 2VKEA 3FX3A 2L9RA 5DCFA 2M1BA 2WAFA 4UV9A 3ZQCA 3E6BA 3QOPA 1MDMA 1X58A 4HW0A 5IYBJ 1TQPA 1DU6A 2DTZA 1MH3A 2JSCA 3G6EI 4B43A 1GHCA 2NRAC 3GEZA 1FMVA 1ON1A 3DEUA 3FXMA 3J81K 3DWLE 3KYLA 2O5RA 3K69A 4OMZA 4RAYA 3FISA 1QU3A 4ESBA 1G4DA 1JT0A 3QODA 4XLFA 3PUFA 1T08B 2XHKA 2WA0A 5CVIA 3CP8A 2WB1N 3ONQA 4ZJZA 2MFZA 3OS0A 4M3FA 2DPDA 3IRRA 3JRAA 3FHNA 3I56I 2UZKA 5C3EJ 2BOLA 2HYJA 2LR8A 2WB1A 3CJRB 4B4CA 2FQ4A 3QYFA 2Q1ZB 2Y0SN 3JSPA 2MGQA 2VB6A 1TW2A 3JTHA 1S7AA 2FQ3A 2OCEA 4PGGA 1K78B 3R60A 3HKZN 5JLXA 4XN3A 4D0PA 1ZGWA 2Y0SA 4XORA 4WXHA 2Z9OA 3BTLA 1VQ6I 3HL2A 4EJWA 2UUZA 2IGMA 3CUOA 4LIUA 3HKZA 4A2UA 1VQMI 5LLQA 2DA6A 4A3LJ 2DA1A 4CCOA 4IRIA 2LC2A 1BC7C 4WK8F 4FX0A 5B1BH 2YR2A 2Z99A 2EIJH 5K5RA 3GBGA 5CJ9A 5HODA 1NG6A 2GQQA 1ZRCA 1WWXA 4IZZA 4N9HA 3A4CA 1H88C 5LD2C 1ZG5A 4ENMA 1P4WA 3BQZA 2O8XA 2HKXA 3C2HA 2P5KA 4M3EA 4XLHA 3WG7H 1W0UA 2FU4A 1ETYA 2M3AA 4YIRX 5IPAA 4BE0A 1BIAA 3ZOBA 2W82A 4XBFA 4LG0A 1SFEA 2F5EA 1G3TA 4AU7A 1G8XA 2L9NA 3BG9A 1JT6A 2WBMA 4BXFA 1AKHB 4BDYA 2L7MP 3F8MA 3CUQB 3O8GA 1S6LA 1BI0A 2EFWA 3OSGA 4B47A 2XKPA 4BHPA 1YS7A 4RAZA 4MQVA 2NVQJ 2XGXA 3KP6A 1IN7A 1WKMA 4L9VA 2HPIA 4PJLA 3M4OJ 1J0RA 3Q5FA 4Z2YA 1LVKA 4MTDA 3LNQA 3P9IA 3HB9A 4MQ9F 4W1UA 3G1OA 4EJVA 4HSTA 4Q48A 4ZYDA 2HQAA 4NUBA 1MBHA 1T2KA 2KIFA 2L0KA 2V1NA 2ZMEB 3VSKA 2DMNA 4JX4A 4EVIA 1YW9A 3E1SA 2QQ9A 5L3DA 2NAZA 3F6VA 1R49A 3LL7A 3UKGA 2GWRA 2EQRA 2OU2A 2FMYA 3K4MA 2IP2A 1Z3XA 2XAJA 2GZWA 5FROA 2QLZA 1W5CC 2R7FA 4A0XA 1FOXA 4ASNA 1QVUA 3AFHA 2K3FA 1XTAA 4BHCA 3JRGA 1R23A 2P8TA 5LGNA 1CQTA 3F8BA 3BTCA 4A3IJ 4RB3C 3H5NA 4P96A 2L2OA 4MFDA 1VZ0A 5DV5A 3E0JB 2E5NA 1XGOA 5L3EA 3MZ8A 2CQQA 2M8EA 3WU2C 5GPCA 3LSKA 1BIBA 4HG2A 4M3BA 1LJ9A 5F1RA 1MW7A 4A3JJ 2STTA 2JUGA 2WY8Q 4RBOA 1JGGA 3MEXA 2LY2A 4N9IA 5TGTA 5K7HA 2DQLA 5F0CA 1FP1D 3O3KA 5J4VA 4BEHB 2KDZA 4IQJA 4RB1A 3EQLF 3RQ4A 5GAHJ 1JKRC 1MMSA 1K6YA 3JCUC 5CLSA 1WSUA 1UAAA 1FYLA 3PFIA 1YO5C 3SZPA 1I50J 4BU2A 2GAUA 4BBRJ 3H9GA 1SFXA 5E8IA 1YRNB 3OYKA 4E7SA 4MO7A 2ZC2A 3IH3A 1P7JA 2O61A 3DU5A 3I0TA 2VC1A 3LSRA 5M5WJ 1ZYRF 1F5TA 1ACIA 3KIOA 4A3FJ 3H9JA 3PQKA 1QPIA 1WJAA 1IDYA 3FXLA 2XRNA 2H6BA 2XGDA 2K40A 2BEOA 1S72I 3LWFA 4CO8A 5K7ZA 4G7ZF 3K10A 2KMUA 1OMIA 2B0LA 1KGSA 2EV5A 1X1BA 3LOCA 1TTYA 2E7XA 2KL4A 4IPAA 4OIQF 4LIVA 2QEXI 2ZNYA 3R4KA 4G12A 3JREA 5DDGA 4L5EA 4HNVA 4EJOA 5HLIA 2MH9A 4D1QA 3KZIC 3LFUA 3REOA 4M73A 2L54A 5DEQA 2A69F 2EV0A 3BPXA 4XM3A 1O3RA 4YEJA 4HF2A 1A31A 2CWEA 1XG1A 2PMZN 2QQBA 2X1DA 2DU9A 1MGTA 1S3JA 3OR1C 5E17F 4AIHA 4PJMA 3K7AJ 4XN0A 2X6OA
chains in the Genus database with same CATH topology
5HS7A 3VFZA 3RDIA 3V8KA 2W84A 1P4XA 4UXNA 2O03A 1IZ1A 1K79A 1FOKA 5ICEA 2PEXA 1DDNA 3F8CA 3HHGA 1GVJA 1H9TA 1IXRC 3GFMA 2W85A 1P4AA 4LG0B 2YSRA 1P92A 2F5CA 3ELKA 1KU3A 3ZP5A 1ZHFA 5JHUA 4XLNF 4XSZF 2IJLA 1EH8A 4R1HA 4MNUA 3LQQA 1HXDA 3GLXA 5JFRA 2DTRA 2O0YA 1SFUA 4LLGF 1O3SA 4P55A 3J81Z 1SAXA 1Z6RA 2PBIA 2OQRA 2QM3A 1KQ9A 2HQRA 4LD5A 2A6EF 1YQAA 2D1VA 1G3SA 1YW8A 2MLKA 3TO7A 4OIPF 1A04A 3RPQA 4N0BA 1FZPB 4AWXB 3C18A 1W4MA 4CHUA 3L00A 3C1DA 3DV8A 2F2EA 5TJJA 5LGTA 5LGUA 3U2RA 4PCQA 4OU0A 4P9UA 2X4HA 4Y13A 2XROA 4LB6B 2G9WA 4EMSA 3BY6A 1U5TA 1BBYA 1ZG1A 1ONVA 2NNYA 5HS9A 3RJPA 3MZHA 3ECOA 2OBPA 3DP7A 4U0WA 1FWZA 3GX4X 5IT3A 4IRGA 1D8KA 4AD9A 4BAYA 3M9AA 1O3QA 3Q9VA 2FEZA 1ZARA 5ICCA 3PQJA 4GYGA 2P5LC 3TO6A 4O5VA 3GFLA 4EM2A 4GO1A 4ZYHA 2QWWA 3E6DA 3F8FA 2GXGA 1QGPA 2NS0A 1R5HA 2EWNA 2GA1A 3HHHA 1REPC 4I01A 3L9FA 2Y0MA 1IRGA 1KU2A 5ERIA 1KU9A 2MLGA 2H94A 3MWMA 4OOIA 1T39A 2QBYA 5DCMB 5H20A 2PN6A 2VXZA 2ESNA 4I0AA 3HOSA 3TQNA 5DUIA 3HYIA 4ZYEA 2L02A 2VT2A 3IHUA 1SMYF 2G7HA 1UFMA 3GW2A 3T0YA 3V8JA 3K9TA 1S8NA 4YFXF 3E5QA 3IWZA 2V1UA 2DT5A 4LMYA 5L3GA 2HOEA 2TDXA 1RZ4A 4M74A 1R7JA 1HBXG 1PDNC 5D5VB 1J9IA 1KQ0A 3LAPA 2LKPA 1RUNA 1XB4A 2HR3A 4UVBA 4EJUA 2D2WA 2A5YB 3MAJA 2CQKA 2HYFA 2HTJA 4HV5A 1LEBA 1HSJA 1ZLJA 1ZAOA 6PAXA 2DK5A 1YFHA 1X3UA 2PJPA 3FF5A 3CJNA 2HKOA 4LFUA 2IA1A 5K5QA 2HWVA 2H6CA 4KMUX 3I59A 2EB7A 3BZ6A 3D5LA 4CXFA 3K0LA 3DKWA 1XDUA 3NEUA 1QNTA 2WC2A 1PUEE 1U5TB 3FWEA 4TV7A 5BOXA 5BQTA 2A3SA 2V9VA 5E20A 2P6SA 1CGPA 1ZREA 1OYWA 2MD5A 4LLNA 5LHIA 1F1ZA 1NHAA 5LHGA 2ELHA 1BI1A 2P5VA 5HVQC 3RTRA 4A12A 3E5XA 5L3CA 2DO7A 2ISYA 1H9GA 3KLOA 2C6YA 4GGGA 2BBYA 1KYZA 1YW7A 3HSFA 1R58A 1KYWA 2FF4A 1R1VA 1H0MA 1ZN2A 2K86A 1Z1DA 3GZ5A 4GCVA 2RQPA 5KK1A 4UHTA 5FD6A 2WTEA 2VBYA 4YFNF 4EM1A 3LA3A 3ABUA 2W24A 3HRTA 2K02A 1U78A 2K27A 3GFJA 4GYIA 2AS5F 2FSWA 1J7KA 3KEQA 4LK1F 3F23A 2Z33A 4S05A 1VTNC 1W7PB 5LRSA 1YLFA 4B09A 3IRQA 4QLCU 4HV6A 2UXXA 1SD5A 4NQWA 5KVRA 4HOBA 3KZYA 3HTUA 3IWFA 1LNWA 4L9JA 5D4SA 3M7GA 3J80K 1B9MA 1IF1A 5L3BA 1BJAA 2YPRA 1K6OA 2OQGA 4LB5A 1V3FA 2HDCA 3FMRA 2D45A 2FOKA 2VOOA 3CDHA 1IUYA 1I5ZA 4A0ZA 3GO5A 3KE2A 4I2OA 2M45A 3ERED 5BPDA 2Y48A 3O6BB 3N4MA 2DBBA 1I27A 3K1MA 3L09A 3S2WA 1ODDA 5D6FA 2ZFWA 2J5PA 4CICA 4ZZDA 3LA7A 5LRRA 5ILUA 2VODA 5TRDA 2ADUA 1BI2A 5EEGA 5BMZA 4B8XA 2CW0F 1FSHA 3ULQB 2IT0A 2HEOA 3FXQA 4CYDA 4HQMA 1U3EM 4HX4A 3HSEA 3ML6A 4CZZA 3P9CA 1HW5A 1ULYA 2E1NA 3R0AA 5BS6A 2OD5A 3IKVA 2PLYA 1LEAA 4Y15A 1Z05A 4ON0A 1R36A 1TQIA 2V79A 1ZGJA 3TKYA 3MFKA 2YX7A 1R1UA 1DP7P 3EDPA 3TOAA 1MKMA 1FX7A 4L18B 5BPIA 1BOAA 1I6XA 1ZH5A 1U8RA 3GXOA 4HX7A 1P6RA 1MDMB 2VOPA 2JT1A 2KRFA 4CDGA 3ZMTA 5A2QK 1JGSA 4HZFA 4HF0A 4IF4A 4G94A 2O6GE 2ACJA 4I02A 3R0JA 3TOBA 2XAFA 2UWMA 1MJBA 1Q1HA 2M30A 3F8NA 3RKYA 1HW2A 1O3TA 1KQ8A 3CO6C 3E6CC 4IJAA 3H92A 3WU1B 2DQRA 2CFXA 4Y17A 2Q0OA 2XUBA 3EETA 3KP5A 1CF7A 5HLGA 1OR7A 1WRJA 3DPTA 4H0EA 3C3WA 4YIFA 5D5UB 1QZYA 2Z3YA 4AIJA 5K1YA 4AIKA 3QPTA 1FNNA 3EYIA 1MD0A 4G6QA 1MZBA 3BPVA 4IHTA 4G7OF 4OMYA 4IRHA 5HOOA 4G7HF 1MJAA 1HKQA 3V7CA 4UVCA 4QWQA 1JXSA 3HUGA 1Z91A 2IA2A 3BJAA 3F72A 2Y75A 1XGNA 3KEOA 2E1CA 3HRSA 4CGZA 1T6SA 3GUDA 5HS8A 3HOTA 1XN7A 3KP4A 4HQEA 3T1BA 1FP2A 2QVOA 1GXQA 1HKTA 4KICA 2RKHA 5AONA 5EEHA 5AIQA 3WTUC 3GZ6A 2XASA 4BNCA 3RIRA 2K4JA 3SZTA 3ZMVA 3GFIA 2RN7A 5FLXK 2K4BA 5E1XA 2ZCWA 1R1TA 1B1BA 2EA4A 2LSOA 2NNNA 5FB2A 3BP8A 1XSVA 3ZMZA 1P2FA 1PP7U 1UB9A 3WTVC 3U1DA 1O7FA 4EGZA 2WWYA 1BC8C 4RB0A 1O57A 4DNCA 4A0YA 4AVPA 1TW3A 2BE5F 3FMQA 4EM0B 1D8JA 4EGYA 3ZMSA 4HDVA 1C0WA 1SD7A 4PGHA 1RIOH 4Q5SF 3V7SA 1W7PD 2V1DA 1USTA 2VN2A 4HBLA 4OINF 4HDUA 4U0VA 3I54A 2LNBA 2FA5A 1TNTA 4KT5C 1XGMA 2RNJA 2QYOA 2FMLA 4DQ2A 1SD6A 5LHHA 4KN7X 3F3XA 3E3VA 5HDKA 1XSXA 1JHFA 4MEYF 4IVNA 4UUVA 1ON2A 5LBQA 2JZYA 3HRMA 3K2ZA 1T98A 4EV0A 4KDPA 1TBXA 4P5OA 5FD5A 4ZH4F 4HAMA 4MHGA 3W6JB 3TGNA 3M8EA 4G9YA 3FMSA 3V8LA 1J59A 1S7OA 3HSRA 3CTAA 2KIUA 3ZQ7A 5LEJA 3KLNA 3QPHA 4ESFA 2HGCA 4U7BA 1J75A 3ZN0A 1YYVA 1QBJA 3DF8A 4U7DA 2GIVA 1K78A 1L0OC 2EFQA 2Z5UA 3LQRA 3BJ6A 2BV6A 4MEXF 4M9SA 2M87A 2PMHA 3WGHA 5IT9K 3VEPA 1EH6A 3E97A 2IRFG 2XAGA 5A2QZ 4WXDA 4F7ZA 5F64A 5J6XA 1ZLKA 2EK5A 1XDSA 4L0ZB 4R8HA 3U9GA 2RV8A 5ILSA 3WTZA 2RC4A 5J8FA 2XAQA 1FYMA 1TNSA 2PQ8A 4ENKA 2EFPA 2EFOA 3CUQA 2KJCA 2PG4A 1XSDA 4YFKF 4O6JA 1IRFA 3WTXC 1FC3A 3M8FA 4ETSA 2JPBA 4WCGA 1UHWA 4FHTA 2PI0A 3JTGA 2UXNA 1W5TA 3CUQC 3WTTC 1XMAA 3ABTA 4LJZF 1K7AA 2ZMEA 4KA4A 4XLPF 2HYGD 1D5VA 1SMTA 1YTYA 2F5DA 5AIPA 3EUHA 3QP6A 1QQIA 2RVCA 4PDKA 4RGXA 4KFCA 3QU6A 2G7UA 2JRTA 5HDNA 4O3MA 1XCVA 5CVUA 3FZVA 1LDDA 3WGGA 3EYYA 3K1PA 4KIBA 3SHFA 1OKRA 4KUMA 3OV8A 4M9ZA 3QAHA 5E18F 4JQFA 1E2XA 1F9NA 1Z9CA 4UV8A 2CYYA 2CO5A 2DW4A 3FM5A 3V4GA 2STWA 1HSTA 3COAC 4S04A 4KMFA 3FXRA 5DD4A 1G6NA 4LLLA 4M9XA 3F22A 3IL2A 3QRFF 5FLXZ 1R22A 4L9NA 3KP2A 3TDUC 2H09A 2Q8KA 1AOYA 2QBYB 5CVRA 1UHMA 3KP3A 3IC7A 3N97A 2F5FA 1MJ9A 1JE8A 2L4AA 1R5GA 2ZXJA 4UVAA 4YIIA 1Z6TA 2VC0A 2P4WA 1B4AA 2FBKA 1FBSA 4RS8A 5D5XB 3R61A 2CGPA 1D3YA 3P7NA 4UNOA 1ZG3A 3C7JA 3ECHA 3MCZA 4RGRA 2COMA 3BDDA 2A68F 5CYVA 1WI9A 2OZUA 3I71A 1KA8A 4GXOA 2XKOA 2WV0A 1V4RA 4PZJA 2LF8A 1IW7F 2DPUA 2E7WA 5E1WA 5J8CA 3DQVC 4OIRF 2V1XA 4A5NA 4HX8A 3T8TA 4L0YB 2M5WA 5D5WB 4XSXF 4WXCA 2QZ8A 1BM9A 4I0BA 2FBHA 4LGWA 1AWCA 2XIGA 2VT3A 4M6XA 1QPMA 2D1HA 3BOQA 4EJTA 2OZ6A 4EQQA 3WGIA 1RUOA 3G3ZA 1XGSA 4R79A 2RDPA 2GXBA 5D6EA 2QENA 3KP7A 3F6OA 3RYRA 1LB2A 3I59B 3RYPA 2EFNA 2LF7A 3VOEA 3CO7C 3G73A 2A07F 1KU7A 2J5OA 5D8KB 2MC3A 1OYIA 2ZNZA 3WE3A 4NB5A 2VBZA 3OOPA 2FE3A 2ISZA 5CVJA 4A6DA 3H3ZA 2L3DA 5FO5A 1W5SA 2K7LA 1IN6A 4JK1X 2IW5A 2P7CB 1G3WA 4XRFA 3L2CA 1U6GA 2LDUA 5IT9Z 4L9TA 1BI3A 2VBXA 1B6AA 2CSOA 1SD4A 4HLXA 4BQAA 3JAMK 4JBAA 3B02A 4RGUA 3WTYC 2XV4S 3IKTA 2MH2A 3E5UA 1FBUA 3I53A 4MTEA 1DPRA 4BXUA 2DK8A 1DPUA 4P9FA 2R3SA 5FGMA 3WTWC 1FPQA 1WQ2A 2P7VB 1LDKB 2ESHA 2IA0A 2ETHA 1STZA 2X0LA 4NHJA 3CLOA 2FXAA 1ZRDA 1E17A 2L4MA 4BHBA 4KYWA 2DAOA 1USSA 3P9KA 1RI7A 4U0YA 1ZRFA 2HZTA 2Q2EA 1LVAA 4G8XA 4HYEA 2JTVA 4KIFA 4E70A 4I09A 1S29A 5H6QA 3ZMDA 2OA4A 3D0SA 4ESJA 4RGSA 2A6HF 1FYKA 3FXUA 4M72A 5FFZA 1QO0D 3ZPLA 3HIFA 1PP8F 5DCMA 1DUXC 1OYYA 2KKOA 3B73A 5H6RA 3LSTA 1I1GA 3LFKA 4ZZLA 1Z7UA 4RB2C 1F4KA 1XMKA 5LEKA 5K5OA 4I98B 2HQNA 2HFHA 5JR3A 2DLLA 2BYVE 3WG9A 2BGCA 2ZKZA 2MBFA 3FM3A 1J5YA 4HLYA 1I1SA 2L01A 1IN4A 2QUFA 3MZYA 3DXJF 3I64A 3ROUA 4IHSA 3JSOA 2EJRA 5E1ZB 3O2PE 2IVMA 3ISPA 4ZYGA 2CG4A 1HW1A 2PFBA 2FNAA 4KN4X 2A61A 3RKWA 3KETA 2VBWA 2HTSA 1L3LA 1T0FA 3SFZA 3DFGA 1TLHB 5DUKA 1FT9A 2P6TA 5HDGA 3H3UA 5FFXA 3RPUA 3GF2A 3BWGA 2MA3A 4OIOF 4A5MA 5DYMA 3J80Z 3AAFA 1YG2A 4BYYA 1FBQA 5D4RA 3K1NA 2V6CA 3M1EA 1XCBA 3WODF 4IXAA 2ZBKA 2XVCA 1FSEA 3WTSC 3VODA 3W6KB 3BROA 2YU3A 2EA2A 2VE9A 4WX9A 2RGVA 3DPLC 3VB2A 2O3FA 4MGRA 3BJOA 4Q47A 2W25A 3RKXA 3F21A 3I4PA 2ZO4A 1U5TC 3KZZA 5HLHA 3KFWX 1FLIA 3Q9SA 5ED4A 1CF7B 1B9NA 1LQ1A 2HS5A 4BH9A 3E6MA 1FY7A 5L3FA 1U2WA 3T5XA 1B59A 3NRVA 4HF1A 1HQCA 2FNPA 2GA2A 3T8RA 1YIOA 1TQMA 2ZJ2A 1UCRA 4M71A 4LK0F 1Y0UA 1R00A 2VONA 5D8LB 4G6DA 4KIGA 4Q4ZF 1IAWA 4FT8A 2R7DA 1IN8A 3TO9A 3V7RA 1RNLA 2VE8A 1W7PA 2QQAA 4A6EA 3I5UA 4L5JA 1IXSB 4L5IA 4U88A 3JAMZ 3HTSB 1LDJA 3TDZC 3MQ0A 3SXYA 3GVAA 3WU0A 1EV7A 1OPCA 4K2EA 3L7WA 3FHZA 1IN5A 5JVTA 1GXPA 4KNYA 1QZZA 3ZMUA 3JW4A 2EV6A 3QU3A 2KIMA 3R6SA 4HA8A 4ENJA 1J2XA 2YX4A 2JPCA 3KCCA 3LA2A 3HRUA 3LAJA 1T38A 5ICGA 4I7HA 2PMUA 5ICFA 5F6FA 1XD7A 3ZN1A 5DD8A 2AXLA 2KJBA 3QP5A 1IXCA 2DI3A 4WF2A 4YG2F 4M6YA 3RI4A 4ENNA 4WWCA 3SQNA 3WE2A 2FBIA 2OAZA 5CVVA 1EH7A 2H27A 1JHHA 2NYXA 2IPQX 1O7LA 4FX4A 3NQOA 3GYHX 2FRHA 3I58A 2XAHA 5E8GA 1YS6A 3GWZA 1BN5A 2W57A 1ZGAA 1HKSA 5ILVA 3J7AO 5JI6A 1G3YA 2DFIA 3FX3A 5DCFA 2M1BA 4UV9A 3E6BA 3QOPA 1MDMA 4HW0A 1TQPA 2JSCA 1GHCA 2NRAC 3GEZA 1ON1A 3DEUA 3J81K 3K69A 4OMZA 4RAYA 4ESBA 1G4DA 2XHKA 5CVIA 2DPDA 3IRRA 2UZKA 3JSPA 1TW2A 3JTHA 1S7AA 2FQ3A 4PGGA 1K78B 3R60A 4D0PA 4WXHA 2Z9OA 4EJWA 3CUOA 4A2UA 5LLQA 4IRIA 1BC7C 4WK8F 4FX0A 2YR2A 2Z99A 5K5RA 5CJ9A 1ZRCA 2GQQA 1WWXA 4N9HA 1ZG5A 4ENMA 1P4WA 2O8XA 2HKXA 2P5KA 2FU4A 1BIAA 4XBFA 4LG0A 1SFEA 2F5EA 1G3TA 3F8MA 3CUQB 1S6LA 2EFWA 1BI0A 2XKPA 4BHPA 1YS7A 4RAZA 4MQVA 2XGXA 3KP6A 1IN7A 1WKMA 4L9VA 1J0RA 3Q5FA 4Z2YA 4MTDA 3P9IA 4MQ9F 4EJVA 4Q48A 4ZYDA 1T2KA 2KIFA 2ZMEB 4EVIA 1YW9A 2QQ9A 5L3DA 2NAZA 3F6VA 2GWRA 2OU2A 2FMYA 2IP2A 2XAJA 2GZWA 2QLZA 2R7FA 4A0XA 4ASNA 4BHCA 1R23A 2P8TA 5LGNA 3F8BA 4RB3C 4P96A 5DV5A 5L3EA 1XGOA 2M8EA 1BIBA 1LJ9A 5F1RA 2STTA 3MEXA 4N9IA 2DQLA 1FP1D 3O3KA 4RB1A 3EQLF 5CLSA 1WSUA 1FYLA 3PFIA 1YO5C 3SZPA 2GAUA 1SFXA 5E8IA 2O61A 3I0TA 2VC1A 1ZYRF 1F5TA 3PQKA 2XRNA 2H6BA 2BEOA 3LWFA 4CO8A 4G7ZF 1OMIA 2B0LA 1KGSA 2EV5A 1TTYA 2E7XA 4IPAA 4OIQF 2ZNYA 3R4KA 5DDGA 4EJOA 5HLIA 2MH9A 3REOA 4M73A 2L54A 5DEQA 2A69F 2EV0A 3BPXA 1O3RA 4HF2A 2CWEA 2QQBA 2DU9A 1MGTA 1S3JA 5E17F 4AIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HS7 A;  3VFZ A;  3RDI A;  3V8K A;  2W84 A;  1P4X A;  4UXN A;  2O03 A;  1IZ1 A;  1K79 A;  1FOK A;  5ICE A;  2PEX A;  1DDN A;  3F8C A;  3HHG A;  1GVJ A;  1H9T A;  1IXR C;  3GFM A;  2W85 A;  1P4A A;  4LG0 B;  2YSR A;  1P92 A;  2F5C A;  3ELK A;  1KU3 A;  3ZP5 A;  1ZHF A;  5JHU A;  4XLN F;  4XSZ F;  2IJL A;  1EH8 A;  4R1H A;  4MNU A;  3LQQ A;  1HXD A;  3GLX A;  5JFR A;  2DTR A;  2O0Y A;  1SFU A;  4LLG F;  1O3S A;  4P55 A;  3J81 Z;  1SAX A;  1Z6R A;  2PBI A;  2OQR A;  2QM3 A;  1KQ9 A;  2HQR A;  4LD5 A;  2A6E F;  1YQA A;  2D1V A;  1G3S A;  1YW8 A;  2MLK A;  3TO7 A;  4OIP F;  1A04 A;  3RPQ A;  4N0B A;  1FZP B;  4AWX B;  3C18 A;  1W4M A;  4CHU A;  3L00 A;  3C1D A;  3DV8 A;  2F2E A;  5TJJ A;  5LGT A;  5LGU A;  3U2R A;  4PCQ A;  4OU0 A;  4P9U A;  2X4H A;  4Y13 A;  2XRO A;  4LB6 B;  2G9W A;  4EMS A;  3BY6 A;  1U5T A;  1BBY A;  1ZG1 A;  1ONV A;  2NNY A;  5HS9 A;  3RJP A;  3MZH A;  3ECO A;  2OBP A;  3DP7 A;  4U0W A;  1FWZ A;  3GX4 X;  5IT3 A;  4IRG A;  1D8K A;  4AD9 A;  4BAY A;  3M9A A;  1O3Q A;  3Q9V A;  2FEZ A;  1ZAR A;  5ICC A;  3PQJ A;  4GYG A;  2P5L C;  3TO6 A;  4O5V A;  3GFL A;  4EM2 A;  4GO1 A;  4ZYH A;  2QWW A;  3E6D A;  3F8F A;  2GXG A;  1QGP A;  2NS0 A;  1R5H A;  2EWN A;  2GA1 A;  3HHH A;  1REP C;  4I01 A;  3L9F A;  2Y0M A;  1IRG A;  1KU2 A;  5ERI A;  1KU9 A;  2MLG A;  2H94 A;  3MWM A;  4OOI A;  1T39 A;  2QBY A;  5DCM B;  5H20 A;  2PN6 A;  2VXZ A;  2ESN A;  4I0A A;  3HOS A;  3TQN A;  5DUI A;  3HYI A;  4ZYE A;  2L02 A;  2VT2 A;  3IHU A;  1SMY F;  2G7H A;  1UFM A;  3GW2 A;  3T0Y A;  3V8J A;  3K9T A;  1S8N A;  4YFX F;  3E5Q A;  3IWZ A;  2V1U A;  2DT5 A;  4LMY A;  5L3G A;  2HOE A;  2TDX A;  1RZ4 A;  4M74 A;  1R7J A;  1HBX G;  1PDN C;  5D5V B;  1J9I A;  1KQ0 A;  3LAP A;  2LKP A;  1RUN A;  1XB4 A;  2HR3 A;  4UVB A;  4EJU A;  2D2W A;  2A5Y B;  3MAJ A;  2CQK A;  2HYF A;  2HTJ A;  4HV5 A;  1LEB A;  1HSJ A;  1ZLJ A;  1ZAO A;  6PAX A;  2DK5 A;  1YFH A;  1X3U A;  2PJP A;  3FF5 A;  3CJN A;  2HKO A;  4LFU A;  2IA1 A;  5K5Q A;  2HWV A;  2H6C A;  4KMU X;  3I59 A;  2EB7 A;  3BZ6 A;  3D5L A;  4CXF A;  3K0L A;  3DKW A;  1XDU A;  3NEU A;  1QNT A;  2WC2 A;  1PUE E;  1U5T B;  3FWE A;  4TV7 A;  5BOX A;  5BQT A;  2A3S A;  2V9V A;  5E20 A;  2P6S A;  1CGP A;  1ZRE A;  1OYW A;  2MD5 A;  4LLN A;  5LHI A;  1F1Z A;  1NHA A;  5LHG A;  2ELH A;  1BI1 A;  2P5V A;  5HVQ C;  3RTR A;  4A12 A;  3E5X A;  5L3C A;  2DO7 A;  2ISY A;  1H9G A;  3KLO A;  2C6Y A;  4GGG A;  2BBY A;  1KYZ A;  1YW7 A;  3HSF A;  1R58 A;  1KYW A;  2FF4 A;  1R1V A;  1H0M A;  1ZN2 A;  2K86 A;  1Z1D A;  3GZ5 A;  4GCV A;  2RQP A;  5KK1 A;  4UHT A;  5FD6 A;  2WTE A;  2VBY A;  4YFN F;  4EM1 A;  3LA3 A;  3ABU A;  2W24 A;  3HRT A;  2K02 A;  1U78 A;  2K27 A;  3GFJ A;  4GYI A;  2AS5 F;  2FSW A;  1J7K A;  3KEQ A;  4LK1 F;  3F23 A;  2Z33 A;  4S05 A;  1VTN C;  1W7P B;  5LRS A;  1YLF A;  4B09 A;  3IRQ A;  4QLC U;  4HV6 A;  2UXX A;  1SD5 A;  4NQW A;  5KVR A;  4HOB A;  3KZY A;  3HTU A;  3IWF A;  1LNW A;  4L9J A;  5D4S A;  3M7G A;  3J80 K;  1B9M A;  1IF1 A;  5L3B A;  1BJA A;  2YPR A;  1K6O A;  2OQG A;  4LB5 A;  1V3F A;  2HDC A;  3FMR A;  2D45 A;  2FOK A;  2VOO A;  3CDH A;  1IUY A;  1I5Z A;  4A0Z A;  3GO5 A;  3KE2 A;  4I2O A;  2M45 A;  3ERE D;  5BPD A;  2Y48 A;  3O6B B;  3N4M A;  2DBB A;  1I27 A;  3K1M A;  3L09 A;  3S2W A;  1ODD A;  5D6F A;  2ZFW A;  2J5P A;  4CIC A;  4ZZD A;  3LA7 A;  5LRR A;  5ILU A;  2VOD A;  5TRD A;  2ADU A;  1BI2 A;  5EEG A;  5BMZ A;  4B8X A;  2CW0 F;  1FSH A;  3ULQ B;  2IT0 A;  2HEO A;  3FXQ A;  4CYD A;  4HQM A;  1U3E M;  4HX4 A;  3HSE A;  3ML6 A;  4CZZ A;  3P9C A;  1HW5 A;  1ULY A;  2E1N A;  3R0A A;  5BS6 A;  2OD5 A;  3IKV A;  2PLY A;  1LEA A;  4Y15 A;  1Z05 A;  4ON0 A;  1R36 A;  1TQI A;  2V79 A;  1ZGJ A;  3TKY A;  3MFK A;  2YX7 A;  1R1U A;  1DP7 P;  3EDP A;  3TOA A;  1MKM A;  1FX7 A;  4L18 B;  5BPI A;  1BOA A;  1I6X A;  1ZH5 A;  1U8R A;  3GXO A;  4HX7 A;  1P6R A;  1MDM B;  2VOP A;  2JT1 A;  2KRF A;  4CDG A;  3ZMT A;  5A2Q K;  1JGS A;  4HZF A;  4HF0 A;  4IF4 A;  4G94 A;  2O6G E;  2ACJ A;  4I02 A;  3R0J A;  3TOB A;  2XAF A;  2UWM A;  1MJB A;  1Q1H A;  2M30 A;  3F8N A;  3RKY A;  1HW2 A;  1O3T A;  1KQ8 A;  3CO6 C;  3E6C C;  4IJA A;  3H92 A;  3WU1 B;  2DQR A;  2CFX A;  4Y17 A;  2Q0O A;  2XUB A;  3EET A;  3KP5 A;  1CF7 A;  5HLG A;  1OR7 A;  1WRJ A;  3DPT A;  4H0E A;  3C3W A;  4YIF A;  5D5U B;  1QZY A;  2Z3Y A;  4AIJ A;  5K1Y A;  4AIK A;  3QPT A;  1FNN A;  3EYI A;  1MD0 A;  4G6Q A;  1MZB A;  3BPV A;  4IHT A;  4G7O F;  4OMY A;  4IRH A;  5HOO A;  4G7H F;  1MJA A;  1HKQ A;  3V7C A;  4UVC A;  4QWQ A;  1JXS A;  3HUG A;  1Z91 A;  2IA2 A;  3BJA A;  3F72 A;  2Y75 A;  1XGN A;  3KEO A;  2E1C A;  3HRS A;  4CGZ A;  1T6S A;  3GUD A;  5HS8 A;  3HOT A;  1XN7 A;  3KP4 A;  4HQE A;  3T1B A;  1FP2 A;  2QVO A;  1GXQ A;  1HKT A;  4KIC A;  2RKH A;  5AON A;  5EEH A;  5AIQ A;  3WTU C;  3GZ6 A;  2XAS A;  4BNC A;  3RIR A;  2K4J A;  3SZT A;  3ZMV A;  3GFI A;  2RN7 A;  5FLX K;  2K4B A;  5E1X A;  2ZCW A;  1R1T A;  1B1B A;  2EA4 A;  2LSO A;  2NNN A;  5FB2 A;  3BP8 A;  1XSV A;  3ZMZ A;  1P2F A;  1PP7 U;  1UB9 A;  3WTV C;  3U1D A;  1O7F A;  4EGZ A;  2WWY A;  1BC8 C;  4RB0 A;  1O57 A;  4DNC A;  4A0Y A;  4AVP A;  1TW3 A;  2BE5 F;  3FMQ A;  4EM0 B;  1D8J A;  4EGY A;  3ZMS A;  4HDV A;  1C0W A;  1SD7 A;  4PGH A;  1RIO H;  4Q5S F;  3V7S A;  1W7P D;  2V1D A;  1UST A;  2VN2 A;  4HBL A;  4OIN F;  4HDU A;  4U0V A;  3I54 A;  2LNB A;  2FA5 A;  1TNT A;  4KT5 C;  1XGM A;  2RNJ A;  2QYO A;  2FML A;  4DQ2 A;  1SD6 A;  5LHH A;  4KN7 X;  3F3X A;  3E3V A;  5HDK A;  1XSX A;  1JHF A;  4MEY F;  4IVN A;  4UUV A;  1ON2 A;  5LBQ A;  2JZY A;  3HRM A;  3K2Z A;  1T98 A;  4EV0 A;  4KDP A;  1TBX A;  4P5O A;  5FD5 A;  4ZH4 F;  4HAM A;  4MHG A;  3W6J B;  3TGN A;  3M8E A;  4G9Y A;  3FMS A;  3V8L A;  1J59 A;  1S7O A;  3HSR A;  3CTA A;  2KIU A;  3ZQ7 A;  5LEJ A;  3KLN A;  3QPH A;  4ESF A;  2HGC A;  4U7B A;  1J75 A;  3ZN0 A;  1YYV A;  1QBJ A;  3DF8 A;  4U7D A;  2GIV A;  1K78 A;  1L0O C;  2EFQ A;  2Z5U A;  3LQR A;  3BJ6 A;  2BV6 A;  4MEX F;  4M9S A;  2M87 A;  2PMH A;  3WGH A;  5IT9 K;  3VEP A;  1EH6 A;  3E97 A;  2IRF G;  2XAG A;  5A2Q Z;  4WXD A;  4F7Z A;  5F64 A;  5J6X A;  1ZLK A;  2EK5 A;  1XDS A;  4L0Z B;  4R8H A;  3U9G A;  2RV8 A;  5ILS A;  3WTZ A;  2RC4 A;  5J8F A;  2XAQ A;  1FYM A;  1TNS A;  2PQ8 A;  4ENK A;  2EFP A;  2EFO A;  3CUQ A;  2KJC A;  2PG4 A;  1XSD A;  4YFK F;  4O6J A;  1IRF A;  3WTX C;  1FC3 A;  3M8F A;  4ETS A;  2JPB A;  4WCG A;  1UHW A;  4FHT A;  2PI0 A;  3JTG A;  2UXN A;  1W5T A;  3CUQ C;  3WTT C;  1XMA A;  3ABT A;  4LJZ F;  1K7A A;  2ZME A;  4KA4 A;  4XLP F;  2HYG D;  1D5V A;  1SMT A;  1YTY A;  2F5D A;  5AIP A;  3EUH A;  3QP6 A;  1QQI A;  2RVC A;  4PDK A;  4RGX A;  4KFC A;  3QU6 A;  2G7U A;  2JRT A;  5HDN A;  4O3M A;  1XCV A;  5CVU A;  3FZV A;  1LDD A;  3WGG A;  3EYY A;  3K1P A;  4KIB A;  3SHF A;  1OKR A;  4KUM A;  3OV8 A;  4M9Z A;  3QAH A;  5E18 F;  4JQF A;  1E2X A;  1F9N A;  1Z9C A;  4UV8 A;  2CYY A;  2CO5 A;  2DW4 A;  3FM5 A;  3V4G A;  2STW A;  1HST A;  3COA C;  4S04 A;  4KMF A;  3FXR A;  5DD4 A;  1G6N A;  4LLL A;  4M9X A;  3F22 A;  3IL2 A;  3QRF F;  5FLX Z;  1R22 A;  4L9N A;  3KP2 A;  3TDU C;  2H09 A;  2Q8K A;  1AOY A;  2QBY B;  5CVR A;  1UHM A;  3KP3 A;  3IC7 A;  3N97 A;  2F5F A;  1MJ9 A;  1JE8 A;  2L4A A;  1R5G A;  2ZXJ A;  4UVA A;  4YII A;  1Z6T A;  2VC0 A;  2P4W A;  1B4A A;  2FBK A;  1FBS A;  4RS8 A;  5D5X B;  3R61 A;  2CGP A;  1D3Y A;  3P7N A;  4UNO A;  1ZG3 A;  3C7J A;  3ECH A;  3MCZ A;  4RGR A;  2COM A;  3BDD A;  2A68 F;  5CYV A;  1WI9 A;  2OZU A;  3I71 A;  1KA8 A;  4GXO A;  2XKO A;  2WV0 A;  1V4R A;  4PZJ A;  2LF8 A;  1IW7 F;  2DPU A;  2E7W A;  5E1W A;  5J8C A;  3DQV C;  4OIR F;  2V1X A;  4A5N A;  4HX8 A;  3T8T A;  4L0Y B;  2M5W A;  5D5W B;  4XSX F;  4WXC A;  2QZ8 A;  1BM9 A;  4I0B A;  2FBH A;  4LGW A;  1AWC A;  2XIG A;  2VT3 A;  4M6X A;  1QPM A;  2D1H A;  3BOQ A;  4EJT A;  2OZ6 A;  4EQQ A;  3WGI A;  1RUO A;  3G3Z A;  1XGS A;  4R79 A;  2RDP A;  2GXB A;  5D6E A;  2QEN A;  3KP7 A;  3F6O A;  3RYR A;  1LB2 A;  3I59 B;  3RYP A;  2EFN A;  2LF7 A;  3VOE A;  3CO7 C;  3G73 A;  2A07 F;  1KU7 A;  2J5O A;  5D8K B;  2MC3 A;  1OYI A;  2ZNZ A;  3WE3 A;  4NB5 A;  2VBZ A;  3OOP A;  2FE3 A;  2ISZ A;  5CVJ A;  4A6D A;  3H3Z A;  2L3D A;  5FO5 A;  1W5S A;  2K7L A;  1IN6 A;  4JK1 X;  2IW5 A;  2P7C B;  1G3W A;  4XRF A;  3L2C A;  1U6G A;  2LDU A;  5IT9 Z;  4L9T A;  1BI3 A;  2VBX A;  1B6A A;  2CSO A;  1SD4 A;  4HLX A;  4BQA A;  3JAM K;  4JBA A;  3B02 A;  4RGU A;  3WTY C;  2XV4 S;  3IKT A;  2MH2 A;  3E5U A;  1FBU A;  3I53 A;  4MTE A;  1DPR A;  4BXU A;  2DK8 A;  1DPU A;  4P9F A;  2R3S A;  5FGM A;  3WTW C;  1FPQ A;  1WQ2 A;  2P7V B;  1LDK B;  2ESH A;  2IA0 A;  2ETH A;  1STZ A;  2X0L A;  4NHJ A;  3CLO A;  2FXA A;  1ZRD A;  1E17 A;  2L4M A;  4BHB A;  4KYW A;  2DAO A;  1USS A;  3P9K A;  1RI7 A;  4U0Y A;  1ZRF A;  2HZT A;  2Q2E A;  1LVA A;  4G8X A;  4HYE A;  2JTV A;  4KIF A;  4E70 A;  4I09 A;  1S29 A;  5H6Q A;  3ZMD A;  2OA4 A;  3D0S A;  4ESJ A;  4RGS A;  2A6H F;  1FYK A;  3FXU A;  4M72 A;  5FFZ A;  1QO0 D;  3ZPL A;  3HIF A;  1PP8 F;  5DCM A;  1DUX C;  1OYY A;  2KKO A;  3B73 A;  5H6R A;  3LST A;  1I1G A;  3LFK A;  4ZZL A;  1Z7U A;  4RB2 C;  1F4K A;  1XMK A;  5LEK A;  5K5O A;  4I98 B;  2HQN A;  2HFH A;  5JR3 A;  2DLL A;  2BYV E;  3WG9 A;  2BGC A;  2ZKZ A;  2MBF A;  3FM3 A;  1J5Y A;  4HLY A;  1I1S A;  2L01 A;  1IN4 A;  2QUF A;  3MZY A;  3DXJ F;  3I64 A;  3ROU A;  4IHS A;  3JSO A;  2EJR A;  5E1Z B;  3O2P E;  2IVM A;  3ISP A;  4ZYG A;  2CG4 A;  1HW1 A;  2PFB A;  2FNA A;  4KN4 X;  2A61 A;  3RKW A;  3KET A;  2VBW A;  2HTS A;  1L3L A;  1T0F A;  3SFZ A;  3DFG A;  1TLH B;  5DUK A;  1FT9 A;  2P6T A;  5HDG A;  3H3U A;  5FFX A;  3RPU A;  3GF2 A;  3BWG A;  2MA3 A;  4OIO F;  4A5M A;  5DYM A;  3J80 Z;  3AAF A;  1YG2 A;  4BYY A;  1FBQ A;  5D4R A;  3K1N A;  2V6C A;  3M1E A;  1XCB A;  3WOD F;  4IXA A;  2ZBK A;  2XVC A;  1FSE A;  3WTS C;  3VOD A;  3W6K B;  3BRO A;  2YU3 A;  2EA2 A;  2VE9 A;  4WX9 A;  2RGV A;  3DPL C;  3VB2 A;  2O3F A;  4MGR A;  3BJO A;  4Q47 A;  2W25 A;  3RKX A;  3F21 A;  3I4P A;  2ZO4 A;  1U5T C;  3KZZ A;  5HLH A;  3KFW X;  1FLI A;  3Q9S A;  5ED4 A;  1CF7 B;  1B9N A;  1LQ1 A;  2HS5 A;  4BH9 A;  3E6M A;  1FY7 A;  5L3F A;  1U2W A;  3T5X A;  1B59 A;  3NRV A;  4HF1 A;  1HQC A;  2FNP A;  2GA2 A;  3T8R A;  1YIO A;  1TQM A;  2ZJ2 A;  1UCR A;  4M71 A;  4LK0 F;  1Y0U A;  1R00 A;  2VON A;  5D8L B;  4G6D A;  4KIG A;  4Q4Z F;  1IAW A;  4FT8 A;  2R7D A;  1IN8 A;  3TO9 A;  3V7R A;  1RNL A;  2VE8 A;  1W7P A;  2QQA A;  4A6E A;  3I5U A;  4L5J A;  1IXS B;  4L5I A;  4U88 A;  3JAM Z;  3HTS B;  1LDJ A;  3TDZ C;  3MQ0 A;  3SXY A;  3GVA A;  3WU0 A;  1EV7 A;  1OPC A;  4K2E A;  3L7W A;  3FHZ A;  1IN5 A;  5JVT A;  1GXP A;  4KNY A;  1QZZ A;  3ZMU A;  3JW4 A;  2EV6 A;  3QU3 A;  2KIM A;  3R6S A;  4HA8 A;  4ENJ A;  1J2X A;  2YX4 A;  2JPC A;  3KCC A;  3LA2 A;  3HRU A;  3LAJ A;  1T38 A;  5ICG A;  4I7H A;  2PMU A;  5ICF A;  5F6F A;  1XD7 A;  3ZN1 A;  5DD8 A;  2AXL A;  2KJB A;  3QP5 A;  1IXC A;  2DI3 A;  4WF2 A;  4YG2 F;  4M6Y A;  3RI4 A;  4ENN A;  4WWC A;  3SQN A;  3WE2 A;  2FBI A;  2OAZ A;  5CVV A;  1EH7 A;  2H27 A;  1JHH A;  2NYX A;  2IPQ X;  1O7L A;  4FX4 A;  3NQO A;  3GYH X;  2FRH A;  3I58 A;  2XAH A;  5E8G A;  1YS6 A;  3GWZ A;  1BN5 A;  2W57 A;  1ZGA A;  1HKS A;  5ILV A;  3J7A O;  5JI6 A;  1G3Y A;  2DFI A;  3FX3 A;  5DCF A;  2M1B A;  4UV9 A;  3E6B A;  3QOP A;  1MDM A;  4HW0 A;  1TQP A;  2JSC A;  1GHC A;  2NRA C;  3GEZ A;  1ON1 A;  3DEU A;  3J81 K;  3K69 A;  4OMZ A;  4RAY A;  4ESB A;  1G4D A;  2XHK A;  5CVI A;  2DPD A;  3IRR A;  2UZK A;  3JSP A;  1TW2 A;  3JTH A;  1S7A A;  2FQ3 A;  4PGG A;  1K78 B;  3R60 A;  4D0P A;  4WXH A;  2Z9O A;  4EJW A;  3CUO A;  4A2U A;  5LLQ A;  4IRI A;  1BC7 C;  4WK8 F;  4FX0 A;  2YR2 A;  2Z99 A;  5K5R A;  5CJ9 A;  1ZRC A;  2GQQ A;  1WWX A;  4N9H A;  1ZG5 A;  4ENM A;  1P4W A;  2O8X A;  2HKX A;  2P5K A;  2FU4 A;  1BIA A;  4XBF A;  4LG0 A;  1SFE A;  2F5E A;  1G3T A;  3F8M A;  3CUQ B;  1S6L A;  2EFW A;  1BI0 A;  2XKP A;  4BHP A;  1YS7 A;  4RAZ A;  4MQV A;  2XGX A;  3KP6 A;  1IN7 A;  1WKM A;  4L9V A;  1J0R A;  3Q5F A;  4Z2Y A;  4MTD A;  3P9I A;  4MQ9 F;  4EJV A;  4Q48 A;  4ZYD A;  1T2K A;  2KIF A;  2ZME B;  4EVI A;  1YW9 A;  2QQ9 A;  5L3D A;  2NAZ A;  3F6V A;  2GWR A;  2OU2 A;  2FMY A;  2IP2 A;  2XAJ A;  2GZW A;  2QLZ A;  2R7F A;  4A0X A;  4ASN A;  4BHC A;  1R23 A;  2P8T A;  5LGN A;  3F8B A;  4RB3 C;  4P96 A;  5DV5 A;  5L3E A;  1XGO A;  2M8E A;  1BIB A;  1LJ9 A;  5F1R A;  2STT A;  3MEX A;  4N9I A;  2DQL A;  1FP1 D;  3O3K A;  4RB1 A;  3EQL F;  5CLS A;  1WSU A;  1FYL A;  3PFI A;  1YO5 C;  3SZP A;  2GAU A;  1SFX A;  5E8I A;  2O61 A;  3I0T A;  2VC1 A;  1ZYR F;  1F5T A;  3PQK A;  2XRN A;  2H6B A;  2BEO A;  3LWF A;  4CO8 A;  4G7Z F;  1OMI A;  2B0L A;  1KGS A;  2EV5 A;  1TTY A;  2E7X A;  4IPA A;  4OIQ F;  2ZNY A;  3R4K A;  5DDG A;  4EJO A;  5HLI A;  2MH9 A;  3REO A;  4M73 A;  2L54 A;  5DEQ A;  2A69 F;  2EV0 A;  3BPX A;  1O3R A;  4HF2 A;  2CWE A;  2QQB A;  2DU9 A;  1MGT A;  1S3J A;  5E17 F;  4AIH A; 
#chains in the Genus database with same CATH topology
 5HS7 A;  3VFZ A;  1VQP I;  2K9L A;  3RDI A;  3V8K A;  3GTO J;  2W84 A;  1P4X A;  2PMZ A;  4BY7 J;  1OR7 C;  4UXN A;  5FLM J;  4E7K A;  2O03 A;  4HSR A;  1G2H A;  1IZ1 A;  1X4P A;  1K79 A;  3PSI A;  1FOK A;  1RKW A;  3W6V A;  3FBI B;  2GIZ A;  5ICE A;  2H1L A;  3LSP A;  2PEX A;  4D5C A;  1TC3 C;  4PFO A;  1DDN A;  3F8C A;  1YOV B;  3HHG A;  1GVJ A;  3S8P A;  3CCR I;  1WZ2 A;  1H9T A;  1IXR C;  3GFM A;  3TW6 A;  4FTH A;  2W85 A;  1P4A A;  1MMD A;  3ZQI A;  4LG0 B;  2YSR A;  1P92 A;  2F5C A;  3ELK A;  3A01 A;  1KU3 A;  3ZP5 A;  1ZHF A;  5JHU A;  2M2E A;  4XLN F;  4XSZ F;  1A35 A;  4OWR B;  4RM2 A;  2IJL A;  3C2G A;  2ME6 A;  2VKD A;  4V19 K;  1EH8 A;  4R1H A;  4F93 B;  4MNU A;  1NG7 A;  3LQQ A;  2DA4 A;  1HXD A;  3TBI A;  3GLX A;  5JFR A;  1EA3 A;  1OCR H;  5CQE A;  4LG3 A;  2DTR A;  3K2A A;  2O0Y A;  2KZG A;  4XLA A;  1SFU A;  4LLG F;  1O3S A;  4P55 A;  3J81 Z;  1SAX A;  1Z6R A;  2Y30 A;  3BZC A;  2BXY A;  2DOF A;  2PBI A;  2RAE A;  5GAE J;  1SFO J;  4HEA 2;  2OQR A;  2QM3 A;  3A03 A;  1KQ9 A;  1X2M A;  2HQR A;  2D5V A;  1OIS A;  4LD5 A;  2A6E F;  1YQA A;  2D1V A;  1G3S A;  2EZK A;  1YW8 A;  3TP0 A;  2XC7 A;  1JKO C;  2MLK A;  4I6Z A;  3TO7 A;  4OIP F;  1QZE A;  1A04 A;  2BY2 A;  3PM1 A;  4N0B A;  3RPQ A;  1FZP B;  4KJZ A;  3PUB A;  4AWX B;  3C18 A;  1W4M A;  4GRI A;  4J19 A;  4CHU A;  3L00 A;  1LKX A;  3C1D A;  1D0Z A;  3GTM J;  1VF9 A;  3HGY A;  3DV8 A;  4BXX J;  2F2E A;  3GCM A;  5TJJ A;  5LGT A;  5LGU A;  1ERD A;  4B1R A;  1TL8 A;  3U2R A;  2BZT A;  3HGG A;  4PCQ A;  2L7K A;  4LOC A;  1S5L C;  4OU0 A;  4P9U A;  2X4H A;  4Y13 A;  2CV0 A;  2ID3 A;  2XRO A;  2MW8 A;  4PFP A;  4XLC A;  4LB6 B;  2G9W A;  2PX9 A;  2JK3 A;  2YS9 A;  4EMS A;  4CH7 A;  3BY6 A;  1U5T A;  4BQO A;  1BBY A;  1ZG1 A;  1ONV A;  3FXK A;  5HS9 A;  2NNY A;  4FQG A;  3RJP A;  1XX5 A;  2QSH X;  3MZH A;  3JRB A;  3ECO A;  2CQX A;  1LFB A;  2OBP A;  2VPR A;  2V26 A;  3DP7 A;  4U0W A;  1FWZ A;  2GBY A;  2QKL B;  4CCL A;  3GX4 X;  5IT3 A;  2LK2 A;  3CMY A;  4IRG A;  3G71 I;  2R7V A;  3CCV I;  1D8K A;  1UZC A;  1GV5 A;  4AD9 A;  4BAY A;  3M9A A;  1O3Q A;  3Q9V A;  4CA0 A;  2FEZ A;  1ZAR A;  5ICC A;  3PQJ A;  1B72 A;  4CSW A;  2HXI A;  2I5U A;  4GYG A;  2P5L C;  3TO6 A;  4O5V A;  2LOO A;  4PJN A;  3GFL A;  4EM2 A;  2X85 A;  1S9H A;  2Z2S B;  4GO1 A;  4ZYH A;  2QWW A;  4C2M J;  2K5C A;  3E6D A;  3F8F A;  1YX3 A;  2GXG A;  3HJE A;  5BNG A;  1QGP A;  4S0H B;  2NS0 A;  4DGW B;  1R5H A;  2EWN A;  2GA1 A;  3HPG A;  1MIJ A;  3PO2 J;  1SVM A;  5HNH A;  2Q2E B;  4NC8 A;  3SJM A;  3HHH A;  1REP C;  2NVX J;  2E60 A;  4I01 A;  3L9F A;  3RZO J;  2Y0M A;  1IRG A;  4UUS A;  2R0Q C;  3OYJ A;  3IAS 2;  5J4Y A;  2K3P A;  4CUG A;  1KU2 A;  2E1M B;  5ERI A;  4AM3 A;  1KU9 A;  1IV8 A;  2MLG A;  2H94 A;  3MWM A;  3CJQ B;  1W0T A;  4DYC A;  4OOI A;  4IHY A;  1QVT A;  3OYF A;  3SDG A;  1T39 A;  2MSY A;  4AYB N;  1K4T A;  2NOJ B;  2JA6 J;  1Y8Q B;  3GTP J;  3K70 C;  1Z7L A;  2QBY A;  5DCM B;  5H20 A;  2PN6 A;  2VXZ A;  2ESN A;  4I0A A;  3SEZ A;  1B8I A;  3HOS A;  3CF2 A;  4FE4 A;  1X1C A;  2ZB9 A;  3TQN A;  5DUI A;  3HYI A;  4ZYE A;  2L02 A;  3PNV A;  2FD5 A;  2VT2 A;  3QYE A;  3GTG J;  4I99 C;  3IHU A;  1SMY F;  2G7H A;  1I3A A;  2W48 A;  1JUP A;  4OAZ A;  1UFM A;  3GW2 A;  3OR2 C;  1ZR2 A;  3MVP A;  3T0Y A;  4BE1 A;  2E2H J;  3V8J A;  3K9T A;  1S8N A;  4YFX F;  3E5Q A;  3IWZ A;  2V1U A;  4UY8 I;  5GPA A;  4CZC A;  2DOD A;  2DT5 A;  1RKT A;  4LMY A;  5L3G A;  2HOE A;  2TDX A;  2LBF A;  2NVU B;  3CCU I;  1RZ4 A;  1J09 A;  4M74 A;  3BR1 A;  1R7J A;  1HBX G;  1P7I A;  2VQL A;  3CP2 A;  3DCF A;  1PDN C;  4I76 A;  1TZL A;  3LSG A;  3FBN B;  4B44 A;  1MH4 A;  5D5V B;  1J9I A;  1KQ0 A;  4V2G A;  3AKZ A;  3LAP A;  4X0G A;  2QKM B;  1NK3 P;  4AID A;  2LKP A;  3JRF A;  1TT0 A;  1RUN A;  1XB4 A;  2LP0 A;  4XIC A;  1QHH D;  2HR3 A;  5M5X J;  4UVB A;  4EJU A;  2I10 A;  2D2W A;  3DTK A;  4IL6 C;  2A5Y B;  3MAJ A;  1JTX A;  1IC8 A;  2CQK A;  2HYF A;  2HTJ A;  2JVH A;  4HV5 A;  1LEB A;  1HSJ A;  3FKJ A;  1ZLJ A;  2HDW A;  2KIQ A;  3IUO A;  1ZAO A;  1X4O A;  3BG7 A;  6PAX A;  4M3G A;  1TWA J;  4AC0 A;  4DIQ A;  2DK5 A;  1YFH A;  1X3U A;  2PJP A;  3FF5 A;  3NAU A;  3CJN A;  1HDD C;  2HKO A;  4B3X A;  4LFU A;  2R5Y B;  2R7W A;  4KIS A;  2IA1 A;  1ETQ A;  5J1U A;  4A3K J;  1X1A A;  5K5Q A;  5CQG A;  2HWV A;  2LKS A;  2H6C A;  2ZXH A;  3S17 J;  3PIO F;  4KMU X;  2M9H A;  3I59 A;  2EB7 A;  3CMM A;  3BZ6 A;  3D5L A;  4CXF A;  3K0L A;  3DKW A;  1XDU A;  2KZV A;  3NEU A;  1QNT A;  1I6H J;  1YHQ I;  4A3C J;  2WC2 A;  2EIK H;  1PUE E;  1QA6 A;  1U5T B;  5F27 A;  3FWE A;  4TV7 A;  3ZGK A;  3OYM A;  5BOX A;  5BQT A;  3BR2 A;  3HZJ A;  2A3S A;  4E7I A;  2V9V A;  5E20 A;  5M3M J;  1EJ9 A;  2P6S A;  3EPZ A;  1Y6I A;  3ABK H;  1CGP A;  4IKF A;  1ZRE A;  4YEL A;  1OYW A;  2MD5 A;  3ZQF A;  4LLN A;  5LHI A;  1G59 A;  3BR5 A;  1F1Z A;  1NHA A;  5DM6 F;  5LHG A;  2JUC A;  2ELH A;  1GV2 A;  3EUH C;  1ETV A;  2L9S A;  3FXJ A;  1BI1 A;  2A6T A;  2P5V A;  5HVQ C;  3RTR A;  4A12 A;  2JRM A;  1MBJ A;  1TWF J;  3DKX A;  3E5X A;  5L3C A;  2DO7 A;  2ISY A;  1H9G A;  3KLO A;  2OCC H;  2C6Y A;  3S15 J;  5J1Y A;  3I3L A;  2ID6 A;  3K4N A;  2DDA A;  4GGG A;  2BBY A;  1UHS A;  1KYZ A;  1YW7 A;  1ORK A;  3HSF A;  1R58 A;  5KNL A;  1KYW A;  3L2Q A;  1HDP A;  2FF4 A;  1MBG A;  1R1V A;  1H0M A;  3D5R C;  5FKO A;  4E7J A;  1ZN2 A;  1AU7 A;  2K86 A;  1Z1D A;  3WHB A;  4C3J J;  4UUS B;  5IP9 J;  3GZ5 A;  2EIN H;  4GCV A;  2RQP A;  3DBL B;  2VUM J;  5KK1 A;  4UHT A;  5FD6 A;  3QPS A;  3G1M A;  2GM4 A;  2JWT A;  2HXO A;  5IY5 H;  3CCS I;  2WTE A;  2VBY A;  1R5I D;  2KDO A;  1OCP A;  3QQA A;  2XB5 A;  3S1Q J;  4YFN F;  4EM1 A;  3LA3 A;  3ABU A;  4IQ4 A;  1WPK A;  2W24 A;  3HRT A;  1FJL A;  2K02 A;  1U78 A;  2K27 A;  2PJR A;  3BT9 A;  1Z21 A;  3GFJ A;  3PIP F;  1MNM C;  2IS2 A;  4GYI A;  3A0B C;  3TP3 A;  4CCN A;  2AS5 F;  2FSW A;  3D1N I;  3TL4 X;  1J7K A;  5CPR B;  3KEQ A;  4LK1 F;  3F23 A;  3U21 A;  4S05 A;  2Z33 A;  1VTN C;  4IOC F;  1W7P B;  2V9P A;  3H0G J;  5LRS A;  1YLF A;  4B09 A;  3IRQ A;  2H8W A;  4QLC U;  2JA8 J;  2DT6 A;  4BJ6 C;  4HV6 A;  2UXX A;  1SD5 A;  4NQW A;  5KVR A;  2NVT J;  2XSJ C;  4H4K C;  4HOB A;  3KZY A;  3HTU A;  3IWF A;  1LNW A;  3S1M J;  4ITV A;  3W3C A;  3W2W A;  4XRS A;  5EGO B;  5HLT A;  1PJR A;  3QWL A;  4L9J A;  3CZ6 A;  5D4S A;  2E36 A;  3M7G A;  3SEQ A;  2QGU A;  3J80 K;  1B9M A;  4XID A;  2CUJ A;  1IF1 A;  5L3B A;  1BJA A;  2CW7 A;  2YPR A;  1K6O A;  2OQG A;  4F91 B;  4G6T B;  1RR8 C;  4LB5 A;  3G2B A;  1V3F A;  2HDC A;  3FMR A;  2D45 A;  1Y1W J;  5EYR A;  1Z77 A;  1SVL A;  2ZXI A;  3CQZ J;  1QRY A;  2FOK A;  2VOO A;  3CDH A;  1IUY A;  1I5Z A;  4A0Z A;  3GO5 A;  3KE2 A;  3DKY A;  4I2O A;  1A36 A;  2M45 A;  4BGD A;  4RMN A;  3H36 A;  3ERE D;  5B5E C;  3K4B A;  3KYD B;  4XMY A;  1PUF A;  2FUG 2;  5BPD A;  2Y48 A;  3O6B B;  3N4M A;  3H1C A;  2DBB A;  1I27 A;  3K1M A;  3QPL A;  3VPR A;  2VKH A;  3L09 A;  3S2W A;  1ODD A;  2OC6 A;  5D6F A;  2ZFW A;  2J5P A;  4CIC A;  2VPL A;  4ZZD A;  2DA2 A;  3LA7 A;  5LRR A;  5ILU A;  4HNU A;  2VOD A;  2HZD A;  2O9L A;  5TRD A;  2ADU A;  1BI2 A;  5EEG A;  3NWT A;  3VYT B;  5BMZ A;  2BW3 B;  5GTI C;  3JRD A;  3HDD A;  4B8X A;  4BJ5 C;  2CW0 F;  2DDB A;  1N75 A;  3DTI A;  4XKB A;  3OYI A;  1FSH A;  3ULQ B;  2IT0 A;  1JUS A;  2HEO A;  2R7U A;  3FXQ A;  3JRI A;  4CYD A;  4HQM A;  3OWT A;  4EEF G;  4HX4 A;  1U3E M;  1DP3 A;  3HSE A;  3ML6 A;  4CZZ A;  3HG9 A;  4A3G J;  3P9C A;  1HW5 A;  1VQ5 I;  1ULY A;  3BZK A;  2E1N A;  4C3I J;  3R0A A;  4Z6Y A;  5BS6 A;  1PYV A;  2OV7 A;  4A3D J;  2OD5 A;  3IKV A;  2PLY A;  3TW7 A;  1LEA A;  4Y15 A;  1Z05 A;  4ON0 A;  5B3S H;  1R36 A;  3NWS A;  1TQI A;  2V79 A;  9ANT A;  3VYR B;  1ZGJ A;  3A2K A;  3AG3 H;  3TKY A;  3RZD J;  2VKV A;  3DBH B;  3MFK A;  1N25 A;  2YX7 A;  1R1U A;  1DP7 P;  3EDP A;  1APL C;  2BVL A;  4BY1 J;  2QCO A;  4JOM A;  3OYH A;  3TOA A;  1IRX A;  3G1L A;  1MKM A;  1FX7 A;  4L18 B;  2XSD C;  5JLW A;  5BPI A;  4QPQ A;  1VQ9 I;  1BOA A;  1I6X A;  2LG4 A;  2R7R A;  1ZH5 A;  1U8R A;  3M1C A;  3GXO A;  2F4O B;  2ZJR F;  4HX7 A;  1P6R A;  1MDM B;  2DJN A;  2VOP A;  3CC7 I;  1FTZ A;  1SVO A;  2EZL A;  2JT1 A;  1UMQ A;  1WJD A;  3BCB A;  2KRF A;  4CDG A;  3ZMT A;  5A2Q K;  1JGS A;  2XB0 X;  3S14 J;  4HZF A;  3H3V K;  4FE7 A;  4HF0 A;  4IF4 A;  4G94 A;  5GAG J;  2O6G E;  4UB6 C;  1UJ8 A;  1FOW A;  2ACJ A;  4I02 A;  3ZQG A;  3R0J A;  3TOB A;  3LMM A;  2XAF A;  2UWM A;  1WH7 A;  3HPH A;  4NC7 A;  1MJB A;  1Q1H A;  3OYB A;  2M30 A;  3F8N A;  2LMD A;  3RKY A;  3G4S I;  1HW2 A;  1O3T A;  2IGK A;  1KQ8 A;  3CO6 C;  3E6C C;  4IJA A;  2Z16 A;  2LD5 A;  3S2D J;  1S7E A;  3H92 A;  3WU1 B;  2DQR A;  2CFX A;  2KPM A;  4Y17 A;  2LTP A;  1M1E B;  2VL8 A;  2Q0O A;  2XUB A;  3EET A;  3KP5 A;  1CF7 A;  5HLG A;  2AHQ A;  4Y33 A;  1OR7 A;  4MIM A;  1WRJ A;  3DPT A;  4AUX A;  3L2W A;  4XKV A;  4H0E A;  1JI8 A;  2H8R A;  3OYG A;  3C3W A;  1X1D A;  3J7Y J;  3OYE A;  4YIF A;  5D5U B;  2V9K A;  1QZY A;  3CF5 F;  2Z3Y A;  4AIJ A;  5K1Y A;  1ETO A;  3QPT A;  4AIK A;  3CCE I;  3HBL A;  4XRM A;  4EAT A;  1FNN A;  3EYI A;  1LUJ B;  3S32 A;  4IHW A;  2MG4 A;  3S3M A;  1MD0 A;  3BG6 A;  4G6Q A;  2GOX B;  1YE9 A;  1MZB A;  4A3M J;  3BQY A;  3L2U A;  4Y4R A;  1YJW I;  3BPV A;  3BR6 A;  4IHT A;  4G7O F;  5IP6 A;  3OYN A;  4OMY A;  2K85 A;  4IRH A;  3RPU D;  2P81 A;  3PL8 A;  3ZR8 X;  1MBK A;  3RQI A;  5HOO A;  1AHD P;  3FK7 A;  4D7N A;  4G7H F;  1MJA A;  2CQ7 A;  1HKQ A;  1GLN A;  3V7C A;  1WHU A;  2DOE A;  2K9Q A;  4UVC A;  2CUF A;  2JN6 A;  4QWQ A;  1JXS A;  3HUG A;  3RKQ A;  4KT6 A;  1Z91 A;  1ETW A;  2IA2 A;  3Q0V A;  1Y0N A;  3I4M J;  3Q3S A;  3BJA A;  3F72 A;  2Y75 A;  1ENH A;  2IAI A;  1XGN A;  1Y1V J;  3BTI A;  4RAG A;  4C2T A;  3KEO A;  2E1C A;  3GTL J;  4RAF A;  3HRS A;  4CGZ A;  1T6S A;  4JX6 A;  5F0F A;  2NXN B;  4A69 C;  1PUF B;  3GUD A;  5HS8 A;  3HOT A;  2HDD A;  1BL0 A;  5C4X J;  1XN7 A;  3KP4 A;  3OL3 A;  2Y9Z A;  4HQE A;  1U9O A;  3AL0 C;  2LY1 A;  2X6X A;  3T1B A;  1FP2 A;  1D1B A;  4B3A A;  2QVO A;  1WH5 A;  4CCK A;  1GXQ A;  1HKT A;  2DA7 A;  1Z0X A;  3N05 A;  4KIC A;  2RKH A;  5AON A;  3M3Y J;  5EEH A;  1SFK A;  2KLO A;  5AIQ A;  3WTU C;  3GZ6 A;  2XAS A;  4BNC A;  3RIR A;  2K4J A;  2DMT A;  3SZT A;  2XPW A;  3OMY A;  1VQO I;  3ZMV A;  3K4L A;  1A6I A;  3GFI A;  2KQR A;  2F4M B;  2RN7 A;  5FLX K;  3HM5 A;  2IBD A;  2JA7 J;  2K4B A;  5E1X A;  2ZCW A;  1R1T A;  1B1B A;  5KAF C;  2QSF X;  2EA4 A;  2LSO A;  2NNN A;  1LE8 A;  1F43 A;  3NAR A;  5FB2 A;  1XC5 A;  3BP8 A;  5HNF A;  3HOW J;  1XSV A;  3ZMZ A;  1P2F A;  1PP7 U;  3U1K A;  1UB9 A;  2VAS A;  3WTV C;  1HCR A;  3U1D A;  1O7F A;  4EGZ A;  2WWY A;  1BC8 C;  2E2J J;  2VJ4 A;  3W2A A;  2QA4 I;  4RB0 A;  1O57 A;  2Y2Z A;  4DNC A;  4A0Y A;  4BE2 A;  2LH9 A;  4AVP A;  1TW3 A;  2Y9Y A;  2BY0 A;  2OUM A;  3ESW B;  2BE5 F;  2P0W A;  2YUS A;  3FMQ A;  4EM0 B;  5DS9 A;  1D8J A;  2UV1 A;  4EGY A;  2HU9 A;  3ABL H;  4XOP A;  3MN2 A;  5C44 J;  3ZMS A;  1V54 H;  4HDV A;  1C0W A;  1SD7 A;  4PGH A;  3I4N J;  1RIO H;  4Q5S F;  3OIQ A;  1DGW Y;  3JRC A;  3V7S A;  3UNG C;  1W7P D;  3OSF A;  1JJ8 C;  3CES A;  1SC7 A;  2V1D A;  1T0F C;  3KX2 A;  2MYS A;  3LSH A;  1UST A;  2VN2 A;  4HBL A;  4OIN F;  4DBQ A;  3I55 I;  4U0V A;  3I54 A;  4HDU A;  3HOY J;  2LNB A;  2FA5 A;  1TNT A;  1WVR A;  4KT5 C;  1XGM A;  2RNJ A;  2QYO A;  3EUA A;  2Y69 H;  2FML A;  4DQ2 A;  2EH3 A;  1SD6 A;  5LHH A;  4KN7 X;  2L7Z A;  1V5F A;  3F3X A;  4N4N B;  1D0Y A;  4Y7N J;  3D5S C;  4RLF A;  1X1P A;  3E3V A;  4C30 A;  3FK6 A;  3ABM H;  4Y3O A;  2B7E A;  3SFI A;  1GDT A;  5HDK A;  4XKC A;  1XSX A;  3BCA A;  2M4K A;  5J3L A;  5KCM A;  1WJ5 A;  1JHF A;  3KYC B;  2LLK A;  3L2R A;  1WJE A;  2VQG A;  1H89 C;  2IS4 A;  2VQC A;  2HPM A;  4MEY F;  3PJR A;  2R4G A;  4IVN A;  4UUV A;  2LRE A;  2JSP A;  1ON2 A;  5LBQ A;  2JZY A;  3JRH A;  3HRM A;  4RA2 A;  3K2Z A;  4DYR A;  2ZSI B;  3QOE A;  2JA5 J;  1T98 A;  4EV0 A;  2X1C A;  1Y56 A;  2OTL I;  3GZN B;  4KDP A;  1HA8 A;  1TBX A;  1DQU A;  3QYB A;  4P5O A;  5FD5 A;  4ZH4 F;  3K4J A;  4HAM A;  4MHG A;  3W6J B;  2XF6 A;  3OYD A;  3TGN A;  3VDX A;  1HF0 A;  3M8E A;  4G9Y A;  4LIT A;  3FMS A;  4BKX A;  1RRJ A;  1I39 A;  3V8L A;  3A1Y A;  1J59 A;  2A05 A;  1S7O A;  3HSR A;  5CKT A;  3CTA A;  2KIU A;  4AYB A;  1TP4 A;  3ZQ7 A;  1JUM A;  5LEJ A;  2CUE A;  5IYC J;  2VJ5 A;  3DEE A;  4CYC A;  3KLN A;  3S3O A;  3QPH A;  4ESF A;  2HGC A;  2AO9 A;  2BVM A;  2EIL H;  4U7B A;  1J75 A;  3ZN0 A;  1YYV A;  1QBJ A;  3DF8 A;  4U7D A;  2DCE A;  1XMX A;  3ZXS A;  5IP7 J;  2GIV A;  1K78 A;  1L0O C;  2DFE A;  2EFQ A;  2XAU A;  3HUG B;  3K6G A;  3A01 B;  2Z5U A;  4ZC3 A;  1T8I A;  2LY9 A;  3CDL A;  3AG1 H;  2HI3 A;  1RC9 A;  3LQR A;  4JYK A;  3CLQ A;  1X3W B;  3BJ6 A;  2BV6 A;  3RCO A;  4MEX F;  1OJL A;  1OCT C;  4M9S A;  4X1E A;  2M87 A;  2PMH A;  3F0C A;  3WGH A;  5IT9 K;  3VEP A;  2A5W A;  1EH6 A;  3VSL A;  3E97 A;  2IRF G;  2XAG A;  5A2Q Z;  2FJ1 A;  5J40 A;  1YIJ I;  1POG A;  1T56 A;  2BHY A;  3FIW A;  4WXD A;  4F7Z A;  2HNH A;  4FCY A;  3GTK J;  1GVD A;  2BY1 A;  2R7O A;  1OCC H;  5F64 A;  5J6X A;  1ZLK A;  2EK5 A;  1XDS A;  4L0Z B;  5FRM A;  2IS1 A;  3IP4 B;  4R8H A;  2CJJ A;  1BJZ A;  3U9G A;  1EKE A;  1VND A;  2OJE D;  2V6E A;  1K83 J;  1ZKG A;  2RV8 A;  3O8H A;  1VQ7 I;  3EUK L;  3LSM A;  5ILS A;  3WTZ A;  2RC4 A;  5J8F A;  2XAQ A;  3S3N A;  1FYM A;  3VWB A;  1TNS A;  1AKH A;  2PQ8 A;  4ENK A;  2EFP A;  2QQ8 A;  3CUQ A;  1MMA A;  2ECC A;  1RPW A;  2EFO A;  4NNJ A;  2KFD A;  1K61 A;  2KJC A;  3F9K A;  2PG4 A;  2W7N A;  2WAQ N;  1XSD A;  3A02 A;  3Q0U A;  4YFK F;  3IV5 A;  4O6J A;  1IRF A;  3VYS B;  3WTX C;  1YIT I;  2ME0 A;  1FC3 A;  3M8F A;  2WAE A;  1BR2 A;  2JPB A;  4ETS A;  3BTJ A;  1LE8 B;  2JA2 A;  4XK4 A;  5IYD J;  4IO9 F;  4RLQ A;  2DYS H;  1FTT A;  4WCG A;  4BAC A;  3M8J A;  5JVG F;  2CFO A;  1UHW A;  4FHT A;  2PI0 A;  3JTG A;  2UXN A;  1W5T A;  5FLV A;  3B6C A;  3CUQ C;  3WTT C;  1XMA A;  3AG4 H;  3ABT A;  4LJZ F;  1K7A A;  2ZME A;  2K9M A;  2HOA A;  1VFC A;  3CDI A;  4XLP F;  4KA4 A;  2HYG D;  1V5G A;  3MD2 A;  1D5V A;  1SMT A;  2ECB A;  1YTY A;  1X19 A;  1DU0 A;  2F5D A;  3BC8 A;  5E3M A;  2VQH A;  3CJT B;  5AIP A;  3EUH A;  2E5Z A;  3IH4 A;  3QP6 A;  1YX5 A;  1QQI A;  2CMP A;  1MBF A;  2M34 A;  1E0E A;  4C3H J;  2RQQ A;  1XPX A;  2RVC A;  3OYL A;  4CCJ A;  4PDK A;  2ZME C;  4RM3 A;  1RES A;  4RGX A;  4KFC A;  3QU6 A;  2G7U A;  2WV1 A;  4F3Q A;  3UR3 C;  1V55 H;  2JRT A;  5HDN A;  4O3M A;  2DMQ A;  3LSJ A;  2TCT A;  2L5Q A;  1XCV A;  5CVU A;  3FZV A;  1D1C A;  1B72 B;  1HOM A;  1LDD A;  3WGG A;  1NH3 A;  1QHG A;  3EYY A;  3K1P A;  5GP9 A;  4KIB A;  1MMN A;  3SHF A;  4IHX A;  1OKR A;  1HLV A;  4V2F A;  4XON A;  3KPH A;  4KUM A;  3CCM I;  1D1A A;  3OV8 A;  4M9Z A;  2JJ7 A;  3QAH A;  4JQF A;  5E18 F;  1SEU A;  1E2X A;  4BEH A;  5IOZ A;  1F9N A;  1Z9C A;  4UV8 A;  2DMU A;  2XRL A;  1OFC X;  5FKL A;  4E7H A;  3OL4 A;  3GLL A;  1OQY A;  2CYY A;  2CO5 A;  2DW4 A;  3FM5 A;  3V4G A;  2STW A;  1HST A;  3COA C;  4S04 A;  4KMF A;  2I8D A;  1YRN A;  3FXR A;  2K9N A;  1ZEL A;  2KRC A;  5DD4 A;  2KT0 A;  2R92 J;  1G6N A;  2BXZ A;  4LLL A;  1Y39 A;  4M9X A;  3F22 A;  1U0J A;  3IL2 A;  5E3L A;  3CD6 I;  3QRF F;  5FLX Z;  2B9S A;  1R22 A;  4L9N A;  3KP2 A;  1KZH A;  3TDU C;  2H09 A;  1R4M B;  3I9V 2;  4FIS A;  5FRN A;  2Q8K A;  1UG0 A;  4D7M A;  2R7T A;  2ELJ A;  1AOY A;  2QBY B;  2DJI A;  5CVR A;  1LPQ A;  1K4S A;  1B8I B;  4E7Z A;  1VQK I;  1UHM A;  2VI6 A;  3E7L A;  1DGR M;  2HVR A;  3KP3 A;  3IC7 A;  4DZJ A;  3N97 A;  3MMY B;  4CYC B;  1FOY A;  2F5F A;  2IGN A;  1MJ9 A;  1TWH J;  1JE8 A;  2L4A A;  1TWC J;  1R5G A;  2CS3 A;  2ZXJ A;  1ETX A;  4MLO A;  4UVA A;  4YII A;  4ZDL A;  2MAB A;  1Z6T A;  2VC0 A;  2P4W A;  1B4A A;  2FBK A;  1FBS A;  5EG0 A;  2V7F A;  4RS8 A;  4B48 A;  5H2F C;  5D5X B;  3R61 A;  2CGP A;  1D3Y A;  5LFA A;  2DMP A;  5B66 C;  5KAI C;  3P7N A;  2L7F P;  3S16 J;  4UNO A;  1ZG3 A;  3C7J A;  3ECH A;  3MCZ A;  4RGR A;  2B63 J;  2LBF B;  3ERM A;  2COM A;  3BDD A;  2VJJ A;  2V4J C;  2A68 F;  1FMW A;  2R5Z A;  3MKL A;  4IEJ A;  4DZP A;  5CYV A;  4A3E J;  3OOU A;  1WI9 A;  2OZU A;  1ZK8 A;  3I71 A;  1KA8 A;  1N78 A;  3S1R J;  4PK4 A;  2COB A;  4GXO A;  2WAD A;  2XKO A;  2WV0 A;  1V4R A;  4PZJ A;  2LF8 A;  1IW7 F;  2DPU A;  2E7W A;  3DTE A;  5E1W A;  5J8C A;  3DQV C;  4OIR F;  2V1X A;  4A5N A;  4HX8 A;  3T8T A;  1ZTR A;  4L0Y B;  2M5W A;  2K9S A;  4JP0 A;  5D5W B;  2IEK A;  4XSX F;  4WXC A;  2QZ8 A;  1BM9 A;  2LFB A;  4I0B A;  4II2 A;  2FBH A;  2W4S A;  1E3P A;  4LGW A;  1AWC A;  4BJT A;  1ZR4 A;  2XIG A;  3H0D A;  2VT3 A;  4M6X A;  1QPM A;  2L9V A;  2D1H A;  3BOQ A;  4EJT A;  2CH0 A;  2OZ6 A;  4EQQ A;  3WGI A;  1MND A;  3CCJ I;  1RUO A;  3G3Z A;  2CQN A;  1XGS A;  4M6V A;  3M07 A;  4R79 A;  2RDP A;  2GXB A;  4PJ0 C;  4PJJ A;  1D0X A;  2QEN A;  3KP7 A;  5D6E A;  3V42 A;  3F6O A;  3S2H J;  3DBR B;  1R6R A;  3FKI J;  2RRE A;  3K4C A;  3RYR A;  1LB2 A;  3I59 B;  2E71 A;  3RYP A;  2EFN A;  1TWG J;  2LF7 A;  3VOE A;  3CO7 C;  3G73 A;  2A07 F;  1KU7 A;  2J5O A;  3CCY A;  3K4K A;  4IOA F;  1Q1V A;  4XRS G;  3PFY A;  5D8K B;  2M0C A;  1OYI A;  2MC3 A;  2ZNZ A;  4XQF A;  3WE3 A;  4NB5 A;  4DYQ A;  2HQ5 A;  2VBZ A;  1T95 A;  3OOP A;  3PSF A;  2FE3 A;  2ISZ A;  1WJB A;  5CVJ A;  4A6D A;  2IS6 A;  3H3Z A;  2JMW A;  2L3D A;  2E35 A;  5F04 A;  2LVS A;  5EDN A;  3HOX J;  4DW6 A;  5FO5 A;  1E3O C;  1SAU A;  1W5S A;  2X9D A;  3FXO A;  3HXL A;  2R7Z J;  1RET A;  2K7L A;  4OAY A;  1IN6 A;  1OCZ H;  4JK1 X;  2IW5 A;  3GTJ J;  2P7C B;  1LFU P;  3AG2 H;  2ELK A;  3ZCO A;  1G3W A;  3LSI A;  2E1O A;  4XRF A;  3L2C A;  1U6G A;  1JJ6 C;  4X6A J;  1FEX A;  2MC4 A;  2LDU A;  5IT9 Z;  3MKW B;  1R4N B;  4L9T A;  2EPF A;  3OS1 A;  1BI3 A;  4HRI A;  2VBX A;  5F0H A;  2E2I J;  1B6A A;  1OCO H;  2CSO A;  4HNT A;  1SD4 A;  4HLX A;  4N4O B;  4E6K G;  4RDU A;  4BQQ A;  3JAM K;  1N77 A;  4BQA A;  1UEL B;  4JBA A;  3B02 A;  4RGU A;  3WTY C;  4QPO A;  4GDF A;  2XV4 S;  3IKT A;  2MH2 A;  3E5U A;  1FBU A;  3I53 A;  2KP6 A;  1DPR A;  2NS7 A;  2DK8 A;  4MTE A;  4P9F A;  4BXU A;  5K7F A;  2R3S A;  1DPU A;  5FGM A;  3WTW C;  1FPQ A;  1WQ2 A;  5FJ8 J;  1R9T J;  3OYA A;  3WHC A;  1WJC A;  1MBE A;  2ICW G;  2P7V B;  5E3N A;  4ZTF A;  1LDK B;  1IRZ A;  2ESH A;  3DLA A;  2ZJQ F;  4UB8 C;  2IA0 A;  2ETH A;  4F92 B;  2DN0 A;  2QSG X;  5EZH A;  1BA5 A;  1STZ A;  2X0L A;  4NHJ A;  2PJR B;  3CLO A;  2FXA A;  1IV6 A;  1ZRD A;  2L4M A;  4BHB A;  1E17 A;  1A6Q A;  1GUU A;  4D9J A;  5J1R A;  4KYW A;  1JKP C;  4JX5 A;  2DAO A;  1USS A;  3P9K A;  5FKK A;  1RI7 A;  4U0Y A;  1ZRF A;  2HZT A;  2DXI A;  2Q2E A;  1BR4 A;  2KIS A;  1LVA A;  1RR7 A;  4BDZ A;  4G8X A;  3B6A A;  4HYE A;  2JTV A;  4KIF A;  2FOW A;  4NQW B;  2R7Q A;  4XL9 A;  1IO2 A;  1H8A C;  4E70 A;  1Z3Y A;  1IG7 A;  4I09 A;  2JVG A;  2IXS A;  1S29 A;  4NC6 A;  5H6Q A;  2FX0 A;  3ZMD A;  2MD0 A;  5EG0 B;  2OA4 A;  3D0S A;  4ESJ A;  3OIP A;  4RGS A;  2A6H F;  2X6W A;  2F6C A;  5M5Y J;  1FYK A;  1PVE A;  1T33 A;  3FXU A;  4M72 A;  4P1W A;  5FFZ A;  1O4X A;  4GFB A;  1QO0 D;  4Y52 J;  2XF7 A;  3ZPL A;  3HIF A;  1PP8 F;  3BG3 A;  5DCM A;  3DEW A;  2E1M C;  2EZH A;  1DUX C;  4QTR A;  3S1N J;  2R5Z B;  3KEY A;  1OYY A;  2KKO A;  3B73 A;  1EF4 A;  5H6R A;  1WJF A;  1I1G A;  3LST A;  3LFK A;  4PUS A;  4ZZL A;  2M0M A;  3X2Q H;  1Z7U A;  3BLY A;  3HOU J;  2W1O A;  4RB2 C;  1F4K A;  2F4I A;  3CCQ I;  2VIX A;  1XMK A;  5LEK A;  4KIT B;  5K5O A;  2KRH A;  2XF5 A;  4I98 B;  2HQN A;  2HFH A;  2ZXW H;  5JR3 A;  2DLL A;  2E19 A;  4BUP A;  2BYV E;  4BBS J;  3WG9 A;  2BGC A;  4ZDP A;  4FAS D;  5DM7 F;  3ZQQ A;  2ZKZ A;  2MBF A;  4J00 A;  3CC4 I;  3FM3 A;  1J5Y A;  4HLY A;  5KHD A;  2NS8 A;  1U9N A;  1I1S A;  4ANJ A;  2XGE A;  2L01 A;  1IN4 A;  4DBR A;  2QUF A;  3MZY A;  2X51 A;  2N8G A;  3OYC A;  2HVS A;  2OF7 A;  2IGO A;  3DXJ F;  3I64 A;  3ROU A;  4IHS A;  4AVZ A;  1X2N A;  3JSO A;  2EJR A;  3PNY A;  5E1Z B;  3O2P E;  1JKQ C;  1D5Y A;  5IOY A;  2IVM A;  3ISP A;  4ZYG A;  3ZQL A;  2XDV A;  3W2V A;  2CG4 A;  1HW1 A;  1MNE A;  1E3H A;  2PFB A;  5EEA A;  2FNA A;  3K70 D;  3PNT A;  2ZSH B;  2TRT A;  4KN4 X;  4UUT A;  1W36 D;  1I3Q J;  2A61 A;  3RKW A;  3KET A;  1ZQ3 P;  1R71 A;  2VBW A;  2Z1D A;  3OIO A;  2HTS A;  3P5J A;  1L3L A;  3SDB A;  2R7X A;  3ASN H;  1T0F A;  3SFZ A;  3DFG A;  5FKN A;  1TLH B;  3HC7 A;  5DUK A;  1FT9 A;  3CME I;  2P6T A;  2LRD A;  3H3U A;  5HDG A;  5FFX A;  3RPU A;  3GF2 A;  2R5Y A;  3BWG A;  2AXT C;  5JHF A;  1NK2 P;  4QIW N;  2MA3 A;  1UG2 A;  4OIO F;  4XOT A;  4A5M A;  5DYM A;  3J80 Z;  1VQN I;  2DYR H;  1YG2 A;  4BYY A;  3AAF A;  1FBQ A;  4ABZ A;  3C2B A;  4NDL A;  2O8K A;  2EIM H;  5TIS C;  5D4R A;  3K1N A;  2V6C A;  2RNG A;  3M1E A;  2XPV A;  1XCB A;  2ZJP F;  3WOD F;  4II3 A;  3GME A;  4IXA A;  2ZBK A;  2XVC A;  2DOA A;  1FSE A;  3WTS C;  3VOD A;  3W6K B;  1MMG A;  3BRO A;  3DLL F;  2OTJ I;  2YU3 A;  1MSF C;  1IGN A;  2EA2 A;  5GAD J;  2VE9 A;  2HOS A;  4WX9 A;  2RGV A;  3CC2 I;  1TT5 B;  2M8G X;  3DPL C;  3VB2 A;  1YJN I;  2YU9 J;  1WCM J;  2O3F A;  3JR9 A;  4MGR A;  3BJO A;  4BS9 A;  2LYC A;  4MFE A;  4Q47 A;  5E79 C;  2W25 A;  3RKX A;  5GTH C;  2OPT A;  3F21 A;  3I4P A;  2ZO4 A;  1U5T C;  3DU6 A;  3KZZ A;  5HLH A;  3IH2 A;  3KFW X;  3MKY B;  1FLI A;  4ZTJ A;  1U8B A;  3Q9S A;  1ETK A;  3TED A;  5ED4 A;  3J7A Y;  5DTD A;  3OY9 A;  4NBQ A;  1B9N A;  1CF7 B;  1LQ1 A;  5EZG A;  4PSW A;  4QSH A;  4C2U A;  2HS5 A;  3IAM 2;  4BH9 A;  2M4G A;  3E6M A;  2W00 A;  1FY7 A;  3L1P A;  5L3F A;  1U2W A;  1SAN A;  1NTC A;  3T5X A;  4HPQ A;  4C9Y A;  4A93 J;  1A5J A;  4M3D A;  1B59 A;  1VI0 A;  2F5V A;  1YI2 I;  3NRV A;  1ITY A;  4HF1 A;  1HQC A;  4FET A;  2CV1 A;  5F1J A;  2FNP A;  2GA2 A;  1GT0 C;  3T8R A;  2EBI A;  1YIO A;  1MSE C;  2R93 J;  2X6Y A;  1TQM A;  2ZJ2 A;  1UCR A;  1FIP A;  5EJC A;  4ZYA A;  5J47 A;  2DA5 A;  4M71 A;  5FKM A;  4LK0 F;  3HOZ J;  1Y0U A;  1R00 A;  2VON A;  4E7L A;  1OLT A;  4G6D A;  4XNF A;  3SYT A;  3VYU B;  4KIG A;  5D8L B;  3CCL I;  1W1W E;  2VXD A;  1V5E A;  4Q4Z F;  1IAW A;  4J01 A;  4FT8 A;  2R7D A;  1IN8 A;  3TO9 A;  3S93 A;  1YJ9 I;  1WI3 A;  1W36 C;  1FIA A;  2WY7 Q;  3V7R A;  1RNL A;  2VE8 A;  4ZDO A;  4XLE A;  5F08 A;  3AL0 B;  1BW5 A;  1F36 A;  1W7P A;  2QQA A;  3BG5 A;  2H1K A;  4A6E A;  2NVY J;  3FDY A;  5EF6 A;  1XS9 A;  3I5U A;  4F55 A;  3ASO H;  4L5J A;  2GOM A;  1IXS B;  2VJI A;  1X3Z B;  4L5I A;  1VQ8 I;  1BR1 A;  4U88 A;  4W97 A;  1WGX A;  1BW6 A;  3JAM Z;  2M7B A;  4DJA A;  5EGO A;  1Y8R B;  3HTS B;  1LDJ A;  1P9Q C;  2BHZ A;  3TDZ C;  2CUZ A;  2CW8 A;  3MQ0 A;  2LKX A;  3SXY A;  5M3F J;  3ZRG A;  5B1A H;  3GVA A;  4XR6 A;  3WU0 A;  2JQ7 A;  1Z67 A;  1VQL I;  1KON A;  1EV7 A;  1OPC A;  4XKW A;  4K2E A;  1BOB A;  3L7W A;  3PO3 J;  2DFF A;  3FHZ A;  1IJW C;  1IN5 A;  5JVT A;  1GXP A;  3OS2 A;  4KNY A;  1QZZ A;  3ZMU A;  3CMA I;  2DFH A;  3JW4 A;  2EV6 A;  3QU3 A;  4CCM A;  4YRV A;  2R7S A;  4IX7 A;  2KIM A;  4IHV A;  3HOV J;  3R6S A;  3TMO A;  1IDZ A;  4HA8 A;  4ENJ A;  1J2X A;  2HVQ A;  2YX4 A;  2JPC A;  1LFP A;  4A3B J;  2CU7 A;  2WAQ A;  2QF7 A;  4BQN A;  3KCC A;  2GLO A;  2AQF A;  2XGC A;  3LA2 A;  3HRU A;  2BY3 A;  3Q0W A;  2VLA A;  3BR0 A;  3LAJ A;  1T38 A;  5ICG A;  4I7H A;  2PMU A;  2KHM A;  3H5A A;  3L2V A;  5ICF A;  5F6F A;  1XD7 A;  3ZN1 A;  5DD8 A;  2AXL A;  2KJB A;  2BW3 A;  3QP5 A;  1IXC A;  2F48 A;  2G0E A;  2Y31 A;  2DI3 A;  5C4J J;  4WF2 A;  4DOZ A;  4YG2 F;  3RSN A;  2O7O A;  2E34 A;  2X48 A;  4M6Y A;  1VQ4 I;  2GXA A;  3RI4 A;  3DPU A;  3H9Q A;  4ENN A;  1JTY A;  4WWC A;  3SQN A;  3WE2 A;  2FBI A;  4U87 A;  3HEF A;  2OAZ A;  5CVV A;  4F52 A;  1EH7 A;  2DA3 A;  4PSX A;  1JHH A;  4D5F A;  2H27 A;  2NYX A;  2X1E A;  2IPQ X;  1O7L A;  3MKZ A;  4FX4 A;  2XPU A;  4E4H A;  3A0H C;  3NQO A;  3GTQ J;  1IUF A;  3GYH X;  1WFX A;  2FRH A;  3I58 A;  2XAH A;  1AA7 A;  5E8G A;  1YS6 A;  2EZI A;  3GWZ A;  2CRG A;  3H35 A;  2ZFU A;  2HOT A;  1BN5 A;  2DT7 B;  2CV2 A;  3ZQH A;  2W57 A;  2NOG A;  1ZGA A;  3SZG A;  4BL0 B;  3J7Z I;  3H5R A;  2M7A A;  1HKS A;  1HC8 A;  3BR3 A;  2AQE A;  5ILV A;  5JI6 A;  3J7A O;  1G3Y A;  2DFI A;  5E3O A;  2VKE A;  3FX3 A;  2L9R A;  5DCF A;  2M1B A;  2WAF A;  4UV9 A;  3ZQC A;  3E6B A;  3QOP A;  1MDM A;  1X58 A;  4HW0 A;  5IYB J;  1TQP A;  1DU6 A;  2DTZ A;  1MH3 A;  2JSC A;  3G6E I;  4B43 A;  1GHC A;  2NRA C;  3GEZ A;  1FMV A;  1ON1 A;  3DEU A;  3FXM A;  3J81 K;  3DWL E;  3KYL A;  2O5R A;  3K69 A;  4OMZ A;  4RAY A;  3FIS A;  1QU3 A;  4ESB A;  1G4D A;  1JT0 A;  3QOD A;  4XLF A;  3PUF A;  1T08 B;  2XHK A;  2WA0 A;  5CVI A;  3CP8 A;  2WB1 N;  3ONQ A;  4ZJZ A;  2MFZ A;  3OS0 A;  4M3F A;  2DPD A;  3IRR A;  3JRA A;  3FHN A;  3I56 I;  2UZK A;  5C3E J;  2BOL A;  2HYJ A;  2LR8 A;  2WB1 A;  3CJR B;  4B4C A;  2FQ4 A;  3QYF A;  2Q1Z B;  2Y0S N;  3JSP A;  2MGQ A;  2VB6 A;  1TW2 A;  3JTH A;  1S7A A;  2FQ3 A;  2OCE A;  4PGG A;  1K78 B;  3R60 A;  3HKZ N;  5JLX A;  4XN3 A;  4D0P A;  1ZGW A;  2Y0S A;  4XOR A;  4WXH A;  2Z9O A;  3BTL A;  1VQ6 I;  3HL2 A;  4EJW A;  2UUZ A;  2IGM A;  3CUO A;  4LIU A;  3HKZ A;  4A2U A;  1VQM I;  5LLQ A;  2DA6 A;  4A3L J;  2DA1 A;  4CCO A;  4IRI A;  2LC2 A;  1BC7 C;  4WK8 F;  4FX0 A;  5B1B H;  2YR2 A;  2Z99 A;  2EIJ H;  5K5R A;  3GBG A;  5CJ9 A;  5HOD A;  1NG6 A;  2GQQ A;  1ZRC A;  1WWX A;  4IZZ A;  4N9H A;  3A4C A;  1H88 C;  5LD2 C;  1ZG5 A;  4ENM A;  1P4W A;  3BQZ A;  2O8X A;  2HKX A;  3C2H A;  2P5K A;  4M3E A;  4XLH A;  3WG7 H;  1W0U A;  2FU4 A;  1ETY A;  2M3A A;  4YIR X;  5IPA A;  4BE0 A;  1BIA A;  3ZOB A;  2W82 A;  4XBF A;  4LG0 A;  1SFE A;  2F5E A;  1G3T A;  4AU7 A;  1G8X A;  2L9N A;  3BG9 A;  1JT6 A;  2WBM A;  4BXF A;  1AKH B;  4BDY A;  2L7M P;  3F8M A;  3CUQ B;  3O8G A;  1S6L A;  1BI0 A;  2EFW A;  3OSG A;  4B47 A;  2XKP A;  4BHP A;  1YS7 A;  4RAZ A;  4MQV A;  2NVQ J;  2XGX A;  3KP6 A;  1IN7 A;  1WKM A;  4L9V A;  2HPI A;  4PJL A;  3M4O J;  1J0R A;  3Q5F A;  4Z2Y A;  1LVK A;  4MTD A;  3LNQ A;  3P9I A;  3HB9 A;  4MQ9 F;  4W1U A;  3G1O A;  4EJV A;  4HST A;  4Q48 A;  4ZYD A;  2HQA A;  4NUB A;  1MBH A;  1T2K A;  2KIF A;  2L0K A;  2V1N A;  2ZME B;  3VSK A;  2DMN A;  4JX4 A;  4EVI A;  1YW9 A;  3E1S A;  2QQ9 A;  5L3D A;  2NAZ A;  3F6V A;  1R49 A;  3LL7 A;  3UKG A;  2GWR A;  2EQR A;  2OU2 A;  2FMY A;  3K4M A;  2IP2 A;  1Z3X A;  2XAJ A;  2GZW A;  5FRO A;  2QLZ A;  1W5C C;  2R7F A;  4A0X A;  1FOX A;  4ASN A;  1QVU A;  3AFH A;  2K3F A;  1XTA A;  4BHC A;  3JRG A;  1R23 A;  2P8T A;  5LGN A;  1CQT A;  3F8B A;  3BTC A;  4A3I J;  4RB3 C;  3H5N A;  4P96 A;  2L2O A;  4MFD A;  1VZ0 A;  5DV5 A;  3E0J B;  2E5N A;  1XGO A;  5L3E A;  3MZ8 A;  2CQQ A;  2M8E A;  3WU2 C;  5GPC A;  3LSK A;  1BIB A;  4HG2 A;  4M3B A;  1LJ9 A;  5F1R A;  1MW7 A;  4A3J J;  2STT A;  2JUG A;  2WY8 Q;  4RBO A;  1JGG A;  3MEX A;  2LY2 A;  4N9I A;  5TGT A;  5K7H A;  2DQL A;  5F0C A;  1FP1 D;  3O3K A;  5J4V A;  4BEH B;  2KDZ A;  4IQJ A;  4RB1 A;  3EQL F;  3RQ4 A;  5GAH J;  1JKR C;  1MMS A;  1K6Y A;  3JCU C;  5CLS A;  1WSU A;  1UAA A;  1FYL A;  3PFI A;  1YO5 C;  3SZP A;  1I50 J;  4BU2 A;  2GAU A;  4BBR J;  3H9G A;  1SFX A;  5E8I A;  1YRN B;  3OYK A;  4E7S A;  4MO7 A;  2ZC2 A;  3IH3 A;  1P7J A;  2O61 A;  3DU5 A;  3I0T A;  2VC1 A;  3LSR A;  5M5W J;  1ZYR F;  1F5T A;  1ACI A;  3KIO A;  4A3F J;  3H9J A;  3PQK A;  1QPI A;  1WJA A;  1IDY A;  3FXL A;  2XRN A;  2H6B A;  2XGD A;  2K40 A;  2BEO A;  1S72 I;  3LWF A;  4CO8 A;  5K7Z A;  4G7Z F;  3K10 A;  2KMU A;  1OMI A;  2B0L A;  1KGS A;  2EV5 A;  1X1B A;  3LOC A;  1TTY A;  2E7X A;  2KL4 A;  4IPA A;  4OIQ F;  4LIV A;  2QEX I;  2ZNY A;  3R4K A;  4G12 A;  3JRE A;  5DDG A;  4L5E A;  4HNV A;  4EJO A;  5HLI A;  2MH9 A;  4D1Q A;  3KZI C;  3LFU A;  3REO A;  4M73 A;  2L54 A;  5DEQ A;  2A69 F;  2EV0 A;  3BPX A;  4XM3 A;  1O3R A;  4YEJ A;  4HF2 A;  1A31 A;  2CWE A;  1XG1 A;  2PMZ N;  2QQB A;  2X1D A;  2DU9 A;  1MGT A;  1S3J A;  3OR1 C;  5E17 F;  4AIH A;  4PJM A;  3K7A J;  4XN0 A;  2X6O A; 
#chains in the Genus database with same CATH homology
 5HS7 A;  3VFZ A;  3RDI A;  3V8K A;  2W84 A;  1P4X A;  4UXN A;  2O03 A;  1IZ1 A;  1K79 A;  1FOK A;  5ICE A;  2PEX A;  1DDN A;  3F8C A;  3HHG A;  1GVJ A;  1H9T A;  1IXR C;  3GFM A;  2W85 A;  1P4A A;  4LG0 B;  2YSR A;  1P92 A;  2F5C A;  3ELK A;  1KU3 A;  3ZP5 A;  1ZHF A;  5JHU A;  4XLN F;  4XSZ F;  2IJL A;  1EH8 A;  4R1H A;  4MNU A;  3LQQ A;  1HXD A;  3GLX A;  5JFR A;  2DTR A;  2O0Y A;  1SFU A;  4LLG F;  1O3S A;  4P55 A;  3J81 Z;  1SAX A;  1Z6R A;  2PBI A;  2OQR A;  2QM3 A;  1KQ9 A;  2HQR A;  4LD5 A;  2A6E F;  1YQA A;  2D1V A;  1G3S A;  1YW8 A;  2MLK A;  3TO7 A;  4OIP F;  1A04 A;  3RPQ A;  4N0B A;  1FZP B;  4AWX B;  3C18 A;  1W4M A;  4CHU A;  3L00 A;  3C1D A;  3DV8 A;  2F2E A;  5TJJ A;  5LGT A;  5LGU A;  3U2R A;  4PCQ A;  4OU0 A;  4P9U A;  2X4H A;  4Y13 A;  2XRO A;  4LB6 B;  2G9W A;  4EMS A;  3BY6 A;  1U5T A;  1BBY A;  1ZG1 A;  1ONV A;  2NNY A;  5HS9 A;  3RJP A;  3MZH A;  3ECO A;  2OBP A;  3DP7 A;  4U0W A;  1FWZ A;  3GX4 X;  5IT3 A;  4IRG A;  1D8K A;  4AD9 A;  4BAY A;  3M9A A;  1O3Q A;  3Q9V A;  2FEZ A;  1ZAR A;  5ICC A;  3PQJ A;  4GYG A;  2P5L C;  3TO6 A;  4O5V A;  3GFL A;  4EM2 A;  4GO1 A;  4ZYH A;  2QWW A;  3E6D A;  3F8F A;  2GXG A;  1QGP A;  2NS0 A;  1R5H A;  2EWN A;  2GA1 A;  3HHH A;  1REP C;  4I01 A;  3L9F A;  2Y0M A;  1IRG A;  1KU2 A;  5ERI A;  1KU9 A;  2MLG A;  2H94 A;  3MWM A;  4OOI A;  1T39 A;  2QBY A;  5DCM B;  5H20 A;  2PN6 A;  2VXZ A;  2ESN A;  4I0A A;  3HOS A;  3TQN A;  5DUI A;  3HYI A;  4ZYE A;  2L02 A;  2VT2 A;  3IHU A;  1SMY F;  2G7H A;  1UFM A;  3GW2 A;  3T0Y A;  3V8J A;  3K9T A;  1S8N A;  4YFX F;  3E5Q A;  3IWZ A;  2V1U A;  2DT5 A;  4LMY A;  5L3G A;  2HOE A;  2TDX A;  1RZ4 A;  4M74 A;  1R7J A;  1HBX G;  1PDN C;  5D5V B;  1J9I A;  1KQ0 A;  3LAP A;  2LKP A;  1RUN A;  1XB4 A;  2HR3 A;  4UVB A;  4EJU A;  2D2W A;  2A5Y B;  3MAJ A;  2CQK A;  2HYF A;  2HTJ A;  4HV5 A;  1LEB A;  1HSJ A;  1ZLJ A;  1ZAO A;  6PAX A;  2DK5 A;  1YFH A;  1X3U A;  2PJP A;  3FF5 A;  3CJN A;  2HKO A;  4LFU A;  2IA1 A;  5K5Q A;  2HWV A;  2H6C A;  4KMU X;  3I59 A;  2EB7 A;  3BZ6 A;  3D5L A;  4CXF A;  3K0L A;  3DKW A;  1XDU A;  3NEU A;  1QNT A;  2WC2 A;  1PUE E;  1U5T B;  3FWE A;  4TV7 A;  5BOX A;  5BQT A;  2A3S A;  2V9V A;  5E20 A;  2P6S A;  1CGP A;  1ZRE A;  1OYW A;  2MD5 A;  4LLN A;  5LHI A;  1F1Z A;  1NHA A;  5LHG A;  2ELH A;  1BI1 A;  2P5V A;  5HVQ C;  3RTR A;  4A12 A;  3E5X A;  5L3C A;  2DO7 A;  2ISY A;  1H9G A;  3KLO A;  2C6Y A;  4GGG A;  2BBY A;  1KYZ A;  1YW7 A;  3HSF A;  1R58 A;  1KYW A;  2FF4 A;  1R1V A;  1H0M A;  1ZN2 A;  2K86 A;  1Z1D A;  3GZ5 A;  4GCV A;  2RQP A;  5KK1 A;  4UHT A;  5FD6 A;  2WTE A;  2VBY A;  4YFN F;  4EM1 A;  3LA3 A;  3ABU A;  2W24 A;  3HRT A;  2K02 A;  1U78 A;  2K27 A;  3GFJ A;  4GYI A;  2AS5 F;  2FSW A;  1J7K A;  3KEQ A;  4LK1 F;  3F23 A;  2Z33 A;  4S05 A;  1VTN C;  1W7P B;  5LRS A;  1YLF A;  4B09 A;  3IRQ A;  4QLC U;  4HV6 A;  2UXX A;  1SD5 A;  4NQW A;  5KVR A;  4HOB A;  3KZY A;  3HTU A;  3IWF A;  1LNW A;  4L9J A;  5D4S A;  3M7G A;  3J80 K;  1B9M A;  1IF1 A;  5L3B A;  1BJA A;  2YPR A;  1K6O A;  2OQG A;  4LB5 A;  1V3F A;  2HDC A;  3FMR A;  2D45 A;  2FOK A;  2VOO A;  3CDH A;  1IUY A;  1I5Z A;  4A0Z A;  3GO5 A;  3KE2 A;  4I2O A;  2M45 A;  3ERE D;  5BPD A;  2Y48 A;  3O6B B;  3N4M A;  2DBB A;  1I27 A;  3K1M A;  3L09 A;  3S2W A;  1ODD A;  5D6F A;  2ZFW A;  2J5P A;  4CIC A;  4ZZD A;  3LA7 A;  5LRR A;  5ILU A;  2VOD A;  5TRD A;  2ADU A;  1BI2 A;  5EEG A;  5BMZ A;  4B8X A;  2CW0 F;  1FSH A;  3ULQ B;  2IT0 A;  2HEO A;  3FXQ A;  4CYD A;  4HQM A;  1U3E M;  4HX4 A;  3HSE A;  3ML6 A;  4CZZ A;  3P9C A;  1HW5 A;  1ULY A;  2E1N A;  3R0A A;  5BS6 A;  2OD5 A;  3IKV A;  2PLY A;  1LEA A;  4Y15 A;  1Z05 A;  4ON0 A;  1R36 A;  1TQI A;  2V79 A;  1ZGJ A;  3TKY A;  3MFK A;  2YX7 A;  1R1U A;  1DP7 P;  3EDP A;  3TOA A;  1MKM A;  1FX7 A;  4L18 B;  5BPI A;  1BOA A;  1I6X A;  1ZH5 A;  1U8R A;  3GXO A;  4HX7 A;  1P6R A;  1MDM B;  2VOP A;  2JT1 A;  2KRF A;  4CDG A;  3ZMT A;  5A2Q K;  1JGS A;  4HZF A;  4HF0 A;  4IF4 A;  4G94 A;  2O6G E;  2ACJ A;  4I02 A;  3R0J A;  3TOB A;  2XAF A;  2UWM A;  1MJB A;  1Q1H A;  2M30 A;  3F8N A;  3RKY A;  1HW2 A;  1O3T A;  1KQ8 A;  3CO6 C;  3E6C C;  4IJA A;  3H92 A;  3WU1 B;  2DQR A;  2CFX A;  4Y17 A;  2Q0O A;  2XUB A;  3EET A;  3KP5 A;  1CF7 A;  5HLG A;  1OR7 A;  1WRJ A;  3DPT A;  4H0E A;  3C3W A;  4YIF A;  5D5U B;  1QZY A;  2Z3Y A;  4AIJ A;  5K1Y A;  4AIK A;  3QPT A;  1FNN A;  3EYI A;  1MD0 A;  4G6Q A;  1MZB A;  3BPV A;  4IHT A;  4G7O F;  4OMY A;  4IRH A;  5HOO A;  4G7H F;  1MJA A;  1HKQ A;  3V7C A;  4UVC A;  4QWQ A;  1JXS A;  3HUG A;  1Z91 A;  2IA2 A;  3BJA A;  3F72 A;  2Y75 A;  1XGN A;  3KEO A;  2E1C A;  3HRS A;  4CGZ A;  1T6S A;  3GUD A;  5HS8 A;  3HOT A;  1XN7 A;  3KP4 A;  4HQE A;  3T1B A;  1FP2 A;  2QVO A;  1GXQ A;  1HKT A;  4KIC A;  2RKH A;  5AON A;  5EEH A;  5AIQ A;  3WTU C;  3GZ6 A;  2XAS A;  4BNC A;  3RIR A;  2K4J A;  3SZT A;  3ZMV A;  3GFI A;  2RN7 A;  5FLX K;  2K4B A;  5E1X A;  2ZCW A;  1R1T A;  1B1B A;  2EA4 A;  2LSO A;  2NNN A;  5FB2 A;  3BP8 A;  1XSV A;  3ZMZ A;  1P2F A;  1PP7 U;  1UB9 A;  3WTV C;  3U1D A;  1O7F A;  4EGZ A;  2WWY A;  1BC8 C;  4RB0 A;  1O57 A;  4DNC A;  4A0Y A;  4AVP A;  1TW3 A;  2BE5 F;  3FMQ A;  4EM0 B;  1D8J A;  4EGY A;  3ZMS A;  4HDV A;  1C0W A;  1SD7 A;  4PGH A;  1RIO H;  4Q5S F;  3V7S A;  1W7P D;  2V1D A;  1UST A;  2VN2 A;  4HBL A;  4OIN F;  4HDU A;  4U0V A;  3I54 A;  2LNB A;  2FA5 A;  1TNT A;  4KT5 C;  1XGM A;  2RNJ A;  2QYO A;  2FML A;  4DQ2 A;  1SD6 A;  5LHH A;  4KN7 X;  3F3X A;  3E3V A;  5HDK A;  1XSX A;  1JHF A;  4MEY F;  4IVN A;  4UUV A;  1ON2 A;  5LBQ A;  2JZY A;  3HRM A;  3K2Z A;  1T98 A;  4EV0 A;  4KDP A;  1TBX A;  4P5O A;  5FD5 A;  4ZH4 F;  4HAM A;  4MHG A;  3W6J B;  3TGN A;  3M8E A;  4G9Y A;  3FMS A;  3V8L A;  1J59 A;  1S7O A;  3HSR A;  3CTA A;  2KIU A;  3ZQ7 A;  5LEJ A;  3KLN A;  3QPH A;  4ESF A;  2HGC A;  4U7B A;  1J75 A;  3ZN0 A;  1YYV A;  1QBJ A;  3DF8 A;  4U7D A;  2GIV A;  1K78 A;  1L0O C;  2EFQ A;  2Z5U A;  3LQR A;  3BJ6 A;  2BV6 A;  4MEX F;  4M9S A;  2M87 A;  2PMH A;  3WGH A;  5IT9 K;  3VEP A;  1EH6 A;  3E97 A;  2IRF G;  2XAG A;  5A2Q Z;  4WXD A;  4F7Z A;  5F64 A;  5J6X A;  1ZLK A;  2EK5 A;  1XDS A;  4L0Z B;  4R8H A;  3U9G A;  2RV8 A;  5ILS A;  3WTZ A;  2RC4 A;  5J8F A;  2XAQ A;  1FYM A;  1TNS A;  2PQ8 A;  4ENK A;  2EFP A;  2EFO A;  3CUQ A;  2KJC A;  2PG4 A;  1XSD A;  4YFK F;  4O6J A;  1IRF A;  3WTX C;  1FC3 A;  3M8F A;  4ETS A;  2JPB A;  4WCG A;  1UHW A;  4FHT A;  2PI0 A;  3JTG A;  2UXN A;  1W5T A;  3CUQ C;  3WTT C;  1XMA A;  3ABT A;  4LJZ F;  1K7A A;  2ZME A;  4KA4 A;  4XLP F;  2HYG D;  1D5V A;  1SMT A;  1YTY A;  2F5D A;  5AIP A;  3EUH A;  3QP6 A;  1QQI A;  2RVC A;  4PDK A;  4RGX A;  4KFC A;  3QU6 A;  2G7U A;  2JRT A;  5HDN A;  4O3M A;  1XCV A;  5CVU A;  3FZV A;  1LDD A;  3WGG A;  3EYY A;  3K1P A;  4KIB A;  3SHF A;  1OKR A;  4KUM A;  3OV8 A;  4M9Z A;  3QAH A;  5E18 F;  4JQF A;  1E2X A;  1F9N A;  1Z9C A;  4UV8 A;  2CYY A;  2CO5 A;  2DW4 A;  3FM5 A;  3V4G A;  2STW A;  1HST A;  3COA C;  4S04 A;  4KMF A;  3FXR A;  5DD4 A;  1G6N A;  4LLL A;  4M9X A;  3F22 A;  3IL2 A;  3QRF F;  5FLX Z;  1R22 A;  4L9N A;  3KP2 A;  3TDU C;  2H09 A;  2Q8K A;  1AOY A;  2QBY B;  5CVR A;  1UHM A;  3KP3 A;  3IC7 A;  3N97 A;  2F5F A;  1MJ9 A;  1JE8 A;  2L4A A;  1R5G A;  2ZXJ A;  4UVA A;  4YII A;  1Z6T A;  2VC0 A;  2P4W A;  1B4A A;  2FBK A;  1FBS A;  4RS8 A;  5D5X B;  3R61 A;  2CGP A;  1D3Y A;  3P7N A;  4UNO A;  1ZG3 A;  3C7J A;  3ECH A;  3MCZ A;  4RGR A;  2COM A;  3BDD A;  2A68 F;  5CYV A;  1WI9 A;  2OZU A;  3I71 A;  1KA8 A;  4GXO A;  2XKO A;  2WV0 A;  1V4R A;  4PZJ A;  2LF8 A;  1IW7 F;  2DPU A;  2E7W A;  5E1W A;  5J8C A;  3DQV C;  4OIR F;  2V1X A;  4A5N A;  4HX8 A;  3T8T A;  4L0Y B;  2M5W A;  5D5W B;  4XSX F;  4WXC A;  2QZ8 A;  1BM9 A;  4I0B A;  2FBH A;  4LGW A;  1AWC A;  2XIG A;  2VT3 A;  4M6X A;  1QPM A;  2D1H A;  3BOQ A;  4EJT A;  2OZ6 A;  4EQQ A;  3WGI A;  1RUO A;  3G3Z A;  1XGS A;  4R79 A;  2RDP A;  2GXB A;  5D6E A;  2QEN A;  3KP7 A;  3F6O A;  3RYR A;  1LB2 A;  3I59 B;  3RYP A;  2EFN A;  2LF7 A;  3VOE A;  3CO7 C;  3G73 A;  2A07 F;  1KU7 A;  2J5O A;  5D8K B;  2MC3 A;  1OYI A;  2ZNZ A;  3WE3 A;  4NB5 A;  2VBZ A;  3OOP A;  2FE3 A;  2ISZ A;  5CVJ A;  4A6D A;  3H3Z A;  2L3D A;  5FO5 A;  1W5S A;  2K7L A;  1IN6 A;  4JK1 X;  2IW5 A;  2P7C B;  1G3W A;  4XRF A;  3L2C A;  1U6G A;  2LDU A;  5IT9 Z;  4L9T A;  1BI3 A;  2VBX A;  1B6A A;  2CSO A;  1SD4 A;  4HLX A;  4BQA A;  3JAM K;  4JBA A;  3B02 A;  4RGU A;  3WTY C;  2XV4 S;  3IKT A;  2MH2 A;  3E5U A;  1FBU A;  3I53 A;  4MTE A;  1DPR A;  4BXU A;  2DK8 A;  1DPU A;  4P9F A;  2R3S A;  5FGM A;  3WTW C;  1FPQ A;  1WQ2 A;  2P7V B;  1LDK B;  2ESH A;  2IA0 A;  2ETH A;  1STZ A;  2X0L A;  4NHJ A;  3CLO A;  2FXA A;  1ZRD A;  1E17 A;  2L4M A;  4BHB A;  4KYW A;  2DAO A;  1USS A;  3P9K A;  1RI7 A;  4U0Y A;  1ZRF A;  2HZT A;  2Q2E A;  1LVA A;  4G8X A;  4HYE A;  2JTV A;  4KIF A;  4E70 A;  4I09 A;  1S29 A;  5H6Q A;  3ZMD A;  2OA4 A;  3D0S A;  4ESJ A;  4RGS A;  2A6H F;  1FYK A;  3FXU A;  4M72 A;  5FFZ A;  1QO0 D;  3ZPL A;  3HIF A;  1PP8 F;  5DCM A;  1DUX C;  1OYY A;  2KKO A;  3B73 A;  5H6R A;  3LST A;  1I1G A;  3LFK A;  4ZZL A;  1Z7U A;  4RB2 C;  1F4K A;  1XMK A;  5LEK A;  5K5O A;  4I98 B;  2HQN A;  2HFH A;  5JR3 A;  2DLL A;  2BYV E;  3WG9 A;  2BGC A;  2ZKZ A;  2MBF A;  3FM3 A;  1J5Y A;  4HLY A;  1I1S A;  2L01 A;  1IN4 A;  2QUF A;  3MZY A;  3DXJ F;  3I64 A;  3ROU A;  4IHS A;  3JSO A;  2EJR A;  5E1Z B;  3O2P E;  2IVM A;  3ISP A;  4ZYG A;  2CG4 A;  1HW1 A;  2PFB A;  2FNA A;  4KN4 X;  2A61 A;  3RKW A;  3KET A;  2VBW A;  2HTS A;  1L3L A;  1T0F A;  3SFZ A;  3DFG A;  1TLH B;  5DUK A;  1FT9 A;  2P6T A;  5HDG A;  3H3U A;  5FFX A;  3RPU A;  3GF2 A;  3BWG A;  2MA3 A;  4OIO F;  4A5M A;  5DYM A;  3J80 Z;  3AAF A;  1YG2 A;  4BYY A;  1FBQ A;  5D4R A;  3K1N A;  2V6C A;  3M1E A;  1XCB A;  3WOD F;  4IXA A;  2ZBK A;  2XVC A;  1FSE A;  3WTS C;  3VOD A;  3W6K B;  3BRO A;  2YU3 A;  2EA2 A;  2VE9 A;  4WX9 A;  2RGV A;  3DPL C;  3VB2 A;  2O3F A;  4MGR A;  3BJO A;  4Q47 A;  2W25 A;  3RKX A;  3F21 A;  3I4P A;  2ZO4 A;  1U5T C;  3KZZ A;  5HLH A;  3KFW X;  1FLI A;  3Q9S A;  5ED4 A;  1CF7 B;  1B9N A;  1LQ1 A;  2HS5 A;  4BH9 A;  3E6M A;  1FY7 A;  5L3F A;  1U2W A;  3T5X A;  1B59 A;  3NRV A;  4HF1 A;  1HQC A;  2FNP A;  2GA2 A;  3T8R A;  1YIO A;  1TQM A;  2ZJ2 A;  1UCR A;  4M71 A;  4LK0 F;  1Y0U A;  1R00 A;  2VON A;  5D8L B;  4G6D A;  4KIG A;  4Q4Z F;  1IAW A;  4FT8 A;  2R7D A;  1IN8 A;  3TO9 A;  3V7R A;  1RNL A;  2VE8 A;  1W7P A;  2QQA A;  4A6E A;  3I5U A;  4L5J A;  1IXS B;  4L5I A;  4U88 A;  3JAM Z;  3HTS B;  1LDJ A;  3TDZ C;  3MQ0 A;  3SXY A;  3GVA A;  3WU0 A;  1EV7 A;  1OPC A;  4K2E A;  3L7W A;  3FHZ A;  1IN5 A;  5JVT A;  1GXP A;  4KNY A;  1QZZ A;  3ZMU A;  3JW4 A;  2EV6 A;  3QU3 A;  2KIM A;  3R6S A;  4HA8 A;  4ENJ A;  1J2X A;  2YX4 A;  2JPC A;  3KCC A;  3LA2 A;  3HRU A;  3LAJ A;  1T38 A;  5ICG A;  4I7H A;  2PMU A;  5ICF A;  5F6F A;  1XD7 A;  3ZN1 A;  5DD8 A;  2AXL A;  2KJB A;  3QP5 A;  1IXC A;  2DI3 A;  4WF2 A;  4YG2 F;  4M6Y A;  3RI4 A;  4ENN A;  4WWC A;  3SQN A;  3WE2 A;  2FBI A;  2OAZ A;  5CVV A;  1EH7 A;  2H27 A;  1JHH A;  2NYX A;  2IPQ X;  1O7L A;  4FX4 A;  3NQO A;  3GYH X;  2FRH A;  3I58 A;  2XAH A;  5E8G A;  1YS6 A;  3GWZ A;  1BN5 A;  2W57 A;  1ZGA A;  1HKS A;  5ILV A;  3J7A O;  5JI6 A;  1G3Y A;  2DFI A;  3FX3 A;  5DCF A;  2M1B A;  4UV9 A;  3E6B A;  3QOP A;  1MDM A;  4HW0 A;  1TQP A;  2JSC A;  1GHC A;  2NRA C;  3GEZ A;  1ON1 A;  3DEU A;  3J81 K;  3K69 A;  4OMZ A;  4RAY A;  4ESB A;  1G4D A;  2XHK A;  5CVI A;  2DPD A;  3IRR A;  2UZK A;  3JSP A;  1TW2 A;  3JTH A;  1S7A A;  2FQ3 A;  4PGG A;  1K78 B;  3R60 A;  4D0P A;  4WXH A;  2Z9O A;  4EJW A;  3CUO A;  4A2U A;  5LLQ A;  4IRI A;  1BC7 C;  4WK8 F;  4FX0 A;  2YR2 A;  2Z99 A;  5K5R A;  5CJ9 A;  1ZRC A;  2GQQ A;  1WWX A;  4N9H A;  1ZG5 A;  4ENM A;  1P4W A;  2O8X A;  2HKX A;  2P5K A;  2FU4 A;  1BIA A;  4XBF A;  4LG0 A;  1SFE A;  2F5E A;  1G3T A;  3F8M A;  3CUQ B;  1S6L A;  2EFW A;  1BI0 A;  2XKP A;  4BHP A;  1YS7 A;  4RAZ A;  4MQV A;  2XGX A;  3KP6 A;  1IN7 A;  1WKM A;  4L9V A;  1J0R A;  3Q5F A;  4Z2Y A;  4MTD A;  3P9I A;  4MQ9 F;  4EJV A;  4Q48 A;  4ZYD A;  1T2K A;  2KIF A;  2ZME B;  4EVI A;  1YW9 A;  2QQ9 A;  5L3D A;  2NAZ A;  3F6V A;  2GWR A;  2OU2 A;  2FMY A;  2IP2 A;  2XAJ A;  2GZW A;  2QLZ A;  2R7F A;  4A0X A;  4ASN A;  4BHC A;  1R23 A;  2P8T A;  5LGN A;  3F8B A;  4RB3 C;  4P96 A;  5DV5 A;  5L3E A;  1XGO A;  2M8E A;  1BIB A;  1LJ9 A;  5F1R A;  2STT A;  3MEX A;  4N9I A;  2DQL A;  1FP1 D;  3O3K A;  4RB1 A;  3EQL F;  5CLS A;  1WSU A;  1FYL A;  3PFI A;  1YO5 C;  3SZP A;  2GAU A;  1SFX A;  5E8I A;  2O61 A;  3I0T A;  2VC1 A;  1ZYR F;  1F5T A;  3PQK A;  2XRN A;  2H6B A;  2BEO A;  3LWF A;  4CO8 A;  4G7Z F;  1OMI A;  2B0L A;  1KGS A;  2EV5 A;  1TTY A;  2E7X A;  4IPA A;  4OIQ F;  2ZNY A;  3R4K A;  5DDG A;  4EJO A;  5HLI A;  2MH9 A;  3REO A;  4M73 A;  2L54 A;  5DEQ A;  2A69 F;  2EV0 A;  3BPX A;  1O3R A;  4HF2 A;  2CWE A;  2QQB A;  2DU9 A;  1MGT A;  1S3J A;  5E17 F;  4AIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...