2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication termination protein
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
4LGWA 1LVAA 2QENA 5EEGA 2XHKA 4MGRA 3V7RA 2OQRA 3RKWA 2NRAC 2ETHA 4KT5C 4IHTA 1TBXA 3HSFA 3ZN1A 1R7JA 3V8JA 3VFZA 1YLFA 4LK1F 5CJ9A 1XN7A 1I5ZA 1Z1DA 1FSHA 4DQ2A 4U7BA 3K69A 5K5RA 2EK5A 4HYEA 3T8TA 4LLLA 1DDNA 2HTJA 4I0AA 3GUDA 5HLIA 1WI9A 5DCFA 2HS5A 4PGHA 2CG4A 3I53A 1CGPA 3GWZA 2A68F 2GXBA 1GXPA 4BNCA 3T8RA 4EMSA 2AXLA 3FMSA 3Q9VA 3R6SA 1P4XA 2JTVA 4A0XA 2KIFA 1HSJA 2IPQX 1IRGA 2Z99A 3BY6A 2F5DA 1XCVA 4A0YA 5DEQA 2LF7A 4EJVA 2P8TA 2YSRA 2JZYA 4GXOA 3QPHA 4FHTA 3F8FA 1MD0A 1G3SA 3S2WA 2H27A 1FBUA 1HXDA 4BH9A 1O3RA 1QZYA 3DKWA 2VC1A 3FM5A 2ZMEB 1IXRC 3R4KA 1FC3A 4L9TA 3IKVA 3BJ6A 3W6KB 4YIFA 4EGZA 2YR2A 3M8EA 2VC0A 2UWMA 1ONVA 1XD7A 3DQVC 1BI0A 2MD5A 3WTTC 5ILSA 4RB1A 1R1UA 4YFKF 1CF7A 4OMZA 4KIFA 5HDGA 1X3UA 2XRNA 1YW8A 1TW3A 2EB7A 1J2XA 2VT3A 3G73A 3E5XA 4KMUX 1BIAA 3ZP5A 3ISPA 5AIQA 2IJLA 1ZLJA 4JBAA 3QU3A 2F5CA 4UVAA 3WGGA 2O8XA 4Y15A 4TV7A 5ERIA 5E1WA 2PFBA 4HV6A 1TTYA 1YS6A 3CUQC 1I6XA 1ZARA 2OBPA 3SXYA 1J59A 1DPUA 3DF8A 5JI6A 1Q1HA 1UFMA 1FYMA 5D4RA 4ENMA 3IRQA 4I02A 4BQAA 4GYGA 5KK1A 2H09A 4D0PA 2VE8A 4M9XA 5FLXZ 4IHSA 1T6SA 3H92A 4R1HA 1WSUA 2MH2A 3FMRA 1G3TA 4M72A 3PFIA 2DI3A 4G6QA 3TO7A 5L3GA 2PLYA 4IRGA 2ZO4A 3NQOA 5CVVA 2FOKA 3RPQA 3C18A 2Q2EA 3RIRA 1C0WA 4ZYDA 3FF5A 4UVBA 2K02A 4BYYA 1SD6A 4CHUA 3R0JA 3QPTA 5D5VB 1T39A 3L2CA 1R1VA 3WE2A 2EFOA 4RGSA 3WU1B 2FQ3A 1T98A 1WWXA 2ACJA 2LKPA 5BPIA 4ETSA 2DPUA 1G3WA 4WX9A 3MEXA 5D5XB 3U9GA 4LK0F 2P5VA 4KMFA 4EJOA 1F5TA 4RAZA 3MAJA 2O61A 1KGSA 4KICA 5FD6A 5L3EA 2DT5A 2A3SA 2FA5A 1U5TC 1XDSA 1LNWA 1QBJA 2IVMA 4HZFA 4XSZF 5ILVA 1T2KA 2MLKA 2PJPA 2R3SA 2R7DA 3P9IA 4L5JA 2HGCA 4KDPA 4M6XA 1IXSB 2PMHA 2EJRA 2F5EA 4EJUA 3HRMA 2VOPA 2P7CB 3CO6C 4LB6B 2VODA 2GZWA 5HS8A 4BHCA 1W7PA 4JK1X 3L00A 4LG0B 2GQQA 4YIIA 2ZJ2A 1LEBA 1RUOA 2FNAA 2V6CA 1LDJA 3KP7A 2PQ8A 4ESBA 2RN7A 3IHUA 3WE3A 4KNYA 5LEKA 2IW5A 4P96A 1K78B 2WWYA 2COMA 5IT9Z 3D0SA 1MZBA 3JTHA 3K1NA 3KFWX 1Z6TA 3TO6A 1D3YA 3M7GA 1OMIA 3CDHA 5BS6A 2RNJA 3H3ZA 4XLNF 1GVJA 3TKYA 1TW2A 3GFMA 1RNLA 4U0YA 3HRUA 1MDMB 4I7HA 2QM3A 1P4WA 4M9SA 4G7OF 2G7HA 3ZQ7A 3EYYA 1SFEA 3D5LA 1UB9A 6PAXA 1ULYA 1ZRFA 1IRFA 1B59A 1TNTA 5DUKA 1IUYA 3TDUC 2W25A 3QU6A 3IWZA 4WXHA 3IL2A 5F1RA 2LNBA 2QQ9A 4Z2YA 2IA1A 2QVOA 2VN2A 5CYVA 1IN7A 2DAOA 1KQ9A 2EFWA 4AIKA 4Q5SF 4BHBA 3I58A 4O5VA 3FMQA 3KEOA 1I1GA 2KRFA 4L9VA 1USTA 2OQGA 5LGNA 3M1EA 3LFKA 2VOOA 2HQNA 2IRFG 2A61A 4IPAA 3E3VA 2X0LA 5IT3A 5J8CA 2DO7A 5DV5A 4HX4A 4A6EA 4HX7A 1FT9A 4MTEA 1KU7A 2Z5UA 3TGNA 3ZMTA 3SHFA 1O3TA 3N97A 4ZH4F 2O6GE 1YO5C 2CFXA 2M87A 2P5KA 4OINF 2RC4A 4ENKA 1G3YA 3K1MA 4OOIA 2XAQA 5TRDA 2ZBKA 1DPRA 4HOBA 3I54A 1MJAA 2QBYA 3RKYA 4M73A 4B8XA 3CUQA 5H6RA 4U7DA 5D6FA 2J5OA 1YS7A 1F9NA 2VBYA 1Z7UA 3WG9A 4HDUA 2FE3A 1OYIA 2XV4S 1BC7C 4Y13A 2X4HA 1J0RA 5DD4A 1KU9A 1YTYA 4PCQA 2AS5F 4HQMA 1LEAA 1F4KA 1YW7A 2ZCWA 3RYRA 2L02A 3V8KA 4ENJA 3M9AA 3L9FA 3GFIA 3I4PA 3ECOA 4AD9A 5LGUA 1FP2A 3ZPLA 2STTA 1FP1D 5DCMB 3ELKA 3KLNA 1KYZA 2W85A 4OIPF 2W57A 1MJBA 3RPUA 1TQMA 1J9IA 2F5FA 3T5XA 4LLGF 2DK5A 1EH6A 5F64A 1V4RA 4I0BA 4DNCA 1RI7A 4WK8F 2MA3A 3P9CA 5J8FA 2DU9A 3VEPA 5JHUA 3WTXC 1U3EM 1SMTA 3DV8A 1E2XA 1MJ9A 2FBKA 4Q47A 2VT2A 3DPLC 1USSA 1P6RA 3KLOA 2Q8KA 2CGPA 3VOEA 3TDZC 5HS7A 1T0FA 1U5TA 1JE8A 3J81K 5HS9A 2FMYA 4AVPA 4P9FA 3BP8A 2A6HF 5D5UB 1S3JA 4M6YA 4OMYA 3BDDA 1G4DA 3BJOA 1HBXG 3ZMVA 1FBSA 1FYLA 1IXCA 2V1UA 2A07F 3E6CC 3V7SA 4CICA 3HHHA 3FZVA 3E6DA 4MNUA 2L4MA 3P7NA 1EH7A 4A12A 3K2ZA 2LDUA 3F8MA 4CYDA 3T0YA 3WTUC 1PP7U 2L01A 3CO7C 5HOOA 3QOPA 3FHZA 2XVCA 3FXUA 5DD8A 4R8HA 4HQEA 3DEUA 1P4AA 3I59A 5DDGA 5D6EA 2ELHA 2IA0A 2DQRA 1H0MA 2A69F 3GEZA 5F6FA 2ZXJA 5LEJA 3MWMA 3H3UA 1D5VA 3DXJF 1S7OA 3O2PE 4O3MA 3EYIA 3QP6A 1TQIA 1OKRA 4P5OA 1Z6RA 2CW0F 5E1XA 4EQQA 1D8KA 5K5QA 1BIBA 2H6BA 3LA3A 2RQPA 5E20A 2P6SA 2XIGA 3LQRA 3L7WA 4YFNF 2W24A 4NQWA 3C7JA 1BJAA 2BGCA 3L09A 3BOQA 5JVTA 1QZZA 1XGMA 4ESFA 4OIRF 3EQLF 3BWGA 2B0LA 4EGYA 2KKOA 2QQAA 2K86A 2GA1A 3WTYC 4XSXF 1K79A 2L4AA 4HAMA 2C6YA 1XSDA 2ZKZA 4ZYHA 3KP6A 2ADUA 4RB0A 2EFNA 2FU4A 3B73A 2OD5A 4NHJA 3P9KA 3C1DA 1KU3A 2XROA 2VE9A 3F8CA 4RGXA 3EDPA 1LDDA 4BXUA 5E8IA 4ENNA 2ZMEA 3GX4X 3V7CA 1OR7A 2H6CA 4CZZA 2M1BA 5DUIA 4G6DA 4M71A 1YQAA 1R00A 2VBWA 2QQBA 1UHWA 4FT8A 4HF0A 4UNOA 2A6EF 1B4AA 5L3CA 1W7PB 4KIGA 3WU0A 4ZZLA 2L54A 2NAZA 1PDNC 1FOKA 1J5YA 1YG2A 2YX4A 1RUNA 1ODDA 4CO8A 3ULQB 3GVAA 3JTGA 4ASNA 4UHTA 2V1DA 2YX7A 4KN4X 3ZMZA 2FBIA 2DTRA 3LA2A 3ML6A 2HR3A 1FLIA 1QQIA 3BPXA 1V3FA 1U8RA 4HW0A 3K0LA 2TDXA 3FXQA 1FSEA 3TO9A 2OZUA 1RZ4A 3KEQA 4CDGA 5K5OA 5ILUA 2ISZA 4A2UA 4GCVA 5CVIA 5L3BA 4PDKA 3REOA 3C3WA 1EV7A 1B9MA 3WGIA 2DW4A 3E97A 5FFZA 4IRHA 4IRIA 1IW7F 2NS0A 2HKXA 1ZYRF 4A0ZA 5HLGA 3SZTA 3Q9SA 1TQPA 3ZN0A 5LHGA 1SD5A 4S04A 4L0ZB 4HV5A 1ZN2A 4MEYF 4HLXA 4OIQF 1T38A 5H20A 5LBQA 2O03A 2VBXA 4GGGA 3F21A 1A04A 2E7XA 4WXDA 3ABUA 3VB2A 3GO5A 1J75A 2E1NA 2JSCA 2G7UA 3Q5FA 4LLNA 2PMUA 5LRSA 4OIOF 3V8LA 3LA7A 3BJAA 2ESNA 5D8LB 4EM1A 3F72A 2V9VA 2DFIA 3GW2A 2HFHA 1R5HA 3FXRA 2GWRA 2HWVA 3ZMSA 3GXOA 2K4JA 1ZH5A 5A2QK 5E18F 3U1DA 3LSTA 3O3KA 2PEXA 3DFGA 1R5GA 3CUOA 3CJNA 2M30A 5ED4A 2E1CA 4IVNA 3GZ5A 3W6JB 1K7AA 2K7LA 2ZNYA 4UXNA 1XGSA 2PN6A 4Q4ZF 1R58A 3R60A 5CVRA 4UV8A 3JSOA 1Y0UA 4K2EA 2XAFA 4AWXB 2RVCA 2M5WA 3KP4A 5D4SA 4Q48A 1Z91A 3K9TA 1E17A 2KIMA 1K6OA 3ZMUA 4LG0A 2CWEA 1KA8A 5ICGA 2H94A 4WWCA 3NEUA 2PG4A 1O7LA 2QZ8A 4BAYA 1HSTA 4BHPA 4A5NA 4U0VA 4RB2C 1K78A 3GYHX 2OU2A 3F6OA 3DPTA 3JW4A 1O3QA 2OA4A 2WV0A 5LHIA 4MQVA 1L3LA 4LMYA 2D2WA 3F22A 2DBBA 1ZAOA 3LQQA 5E17F 4M74A 2IP2A 2M45A 1YFHA 2XAGA 1ZHFA 3BPVA 2WC2A 4LFUA 2MH9A 3QRFF 1HQCA 1MDMA 1FX7A 4ZYEA 1IN8A 3LAJA 2P5LC 5E1ZB 2HOEA 5ICCA 2P7VB 1IN6A 3OV8A 2Z9OA 2CO5A 3LWFA 3AAFA 2HDCA 5EEHA 2K4BA 5JFRA 2GXGA 3KZZA 3J81Z 2EV6A 1SD4A 5AIPA 3JAMK 2FBHA 1OYYA 4EJTA 3VODA 2RGVA 4L9JA 4N9HA 1JHFA 4P55A 2Z33A 4CGZA 4HBLA 2NYXA 4G7HF 1PP8F 3HHGA 2FNPA 3ZMDA 1SFXA 2V79A 3IKTA 4GO1A 3WTVC 3BZ6A 2J5PA 1NHAA 1ZG3A 1FWZA 3HRTA 1JXSA 2XKPA 1ZGJA 2Y0MA 4EM2A 3M8FA 2QWWA 5BOXA 2G9WA 4N0BA 1HW2A 3KZYA 4U0WA 1QNTA 1WKMA 3IRRA 1HKTA 1W5TA 2XUBA 3SZPA 2QUFA 1LDKB 4Y17A 1CF7B 1SFUA 4A6DA 1Z9CA 1I1SA 4UV9A 5KVRA 4MTDA 4G9YA 4QWQA 4KUMA 3T1BA 1SAXA 2VXZA 1B6AA 1BC8C 2IT0A 2UZKA 1W7PD 2FXAA 3RKXA 4G8XA 1BBYA 1HW5A 5DYMA 4FX0A 4QLCU 1O57A 2QYOA 2RDPA 3I71A 3E5QA 3E5UA 4I98B 3DP7A 2FRHA 3NRVA 4XRFA 2BBYA 2FMLA 3FWEA 1G6NA 5DCMA 5AONA 2D1VA 2O3FA 1U6GA 1QGPA 4YG2F 2E7WA 1KQ0A 1W5SA 5J6XA 3HYIA 1O3SA 3N4MA 1IN5A 1HKQA 2MC3A 5HDNA 3QAHA 4L18B 3HRSA 3ECHA 3J7AO 4MHGA 5FGMA 5HLHA 5LRRA 1AWCA 1REPC 3PQJA 2EFQA 2Q0OA 5K1YA 3RJPA 4F7ZA 1F1ZA 1VTNC 5ICEA 3HUGA 2NNYA 2PI0A 1R23A 3I5UA 3FX3A 5CVUA 4RS8A 1R22A 1GXQA 3WGHA 4UVCA 3E6BA 2DLLA 3EETA 2XASA 2YPRA 1B1BA 2STWA 2HQRA 3G3ZA 4IXAA 4WF2A 3KP2A 5L3DA 1HKSA 5D8KB 1ZG1A 1BOAA 1BI2A 5BMZA 4A5MA 2YU3A 3HTSB 1OPCA 4G94A 1LQ1A 1XSVA 3CTAA 3SQNA 2JPBA 3CLOA 4ON0A 4P9UA 5BQTA 2OAZA 1D8JA 2JPCA 2ZFWA 4NB5A 3RYPA 2EA4A 5CVJA 1S29A 5FB2A 3TOBA 1UHMA 2UXNA 3ERED 3IC7A 4HLYA 2HYFA 4EJWA 4I09A 1YYVA 2RV8A 4MEXF 2LSOA 3WTSC 3GLXA 3F8NA 3MZYA 1S6LA 1S8NA 1QO0D 5H6QA 1FBQA 4L9NA 1H9TA 5LHHA 3O6BB 2P6TA 3K1PA 4H0EA 2BEOA 2WTEA 4PGGA 3GF2A 1L0OC 5HDKA 3WTZA 3TQNA 1YW9A 3PQKA 2W84A 4ZYGA 2DK8A 1ZRCA 1IAWA 3ABTA 4RGUA 2MBFA 1IN4A 1Z05A 2HZTA 1JGSA 5FO5A 5LLQA 3R61A 3GFJA 2QLZA 4HF1A 2V1XA 2VONA 3MFKA 2GAUA 4LB5A 4MQ9F 2IA2A 5FFXA 3WODF 2RKHA 1U78A 1TNSA 1LJ9A 5FLXK 1PUEE 2XKOA 4RAYA 4I01A 1MGTA 5A2QZ 1DP7P 2ZNZA 3LAPA 1WRJA 2VBZA 1TLHB 3HIFA 4M9ZA 1IZ1A 1STZA 2GA2A 1ON2A 3B02A 1S7AA 2GIVA 3E6MA 2EFPA 1R1TA 4EVIA 1H9GA 3RI4A 2CSOA 1EH8A 3EUHA 2FEZA 1YIOA 2BYVE 1W4MA 3R0AA 4ZZDA 1KU2A 5ICFA 4L5IA 5L3FA 2P4WA 4O6JA 3HSRA 2F2EA 4U88A 2Z3YA 1ZREA 5FD5A 4LD5A 4RGRA 2BV6A 1XSXA 1LB2A 5LGTA 1R36A 1BI1A 4IF4A 1DUXC 1ZLKA 4YFXF 2K27A 4I2OA 4WXCA 3MCZA 1J7KA 3V4GA 2L3DA 2FF4A 4KN7X 1SD7A 2KJCA 1AOYA 4RB3C 4AIJA 3COAC 2EV5A 2XAJA 5HVQC 2QBYB 1UCRA 4AIHA 3CUQB 3HTUA 2BE5F 3MZHA 3KETA 4KIBA 3OOPA 5TJJA 3IWFA 3J80Z 3GZ6A 1FPQA 1XGNA 1B9NA 2XGXA 4KYWA 1XCBA 4XBFA 4R79A 2R7FA 2HEOA 1BN5A 3F3XA 1XGOA 2OZ6A 2KIUA 3FM3A 4HA8A 3RDIA 3KE2A 1KYWA 1WQ2A 3KCCA 1BM9A 1ZGAA 1XMKA 5D5WB 5IT9K 2XAHA 2PBIA 3JAMZ 2DQLA 5BPDA 1IF1A 2ESHA 2HYGD 4KA4A 2EWNA 4KFCA 2JRTA 4ESJA 2A5YB 4E70A 1MKMA 2JT1A 5E8GA 3HOTA 4CXFA 2KJBA 3MQ0A 4S05A 3BROA 2DPDA 2FSWA 1ZG5A 1OYWA 1XMAA 3U2RA 2MLGA 1FNNA 1ZRDA 3JSPA 1JHHA 2M8EA 3J80K 2EV0A 2CYYA 4XLPF 3RTRA 3I64A 4OU0A 4EV0A 1XB4A 2LF8A 3HOSA 1FY7A 2O0YA 2HTSA 1FZPB 1U5TB 3HSEA 4JQFA 1P2FA 4PZJA 5JR3A 4EM0B 4HX8A 4IJAA 3KP3A 2NNNA 1XDUA 3I0TA 1I27A 2Y48A 2ISYA 4L0YB 4FX4A 2D1HA 3F6VA 4UUVA 2UXXA 4B09A 4LJZF 3F23A 4HF2A 3WTWC 4GYIA 2HKOA 1BI3A 3ROUA 1P92A 4HDVA 3GFLA 3KP5A 1KQ8A 1QPMA 3SFZA 4WCGA 2Y75A 5CLSA 2D45A 3QP5A 2CQKA 1HW1A 3TOAA 3I59B 3F8BA 1O7FA 1FYKA 1U2WA 1RIOH 4G7ZF 1GHCA 1SMYF 4N9IA 2EA2A 1ON1A
chains in the Genus database with same CATH superfamily
4LGWA 1LVAA 5FKOA 2QENA 5TGTA 5EEGA 1JTYA 2L7FP 3A0HC 4YEJA 2M0MA 2XHKA 4MGRA 3V7RA 2CUZA 4BEHB 3L2WA 3PSFA 4BE1A 1VQ9I 3C2GA 2OQRA 2MG4A 1GLNA 3RKWA 2NRAC 2ETHA 4KT5C 4IHTA 1TBXA 3W6VA 3HSFA 3ZN1A 1R7JA 3VYSB 4C3IJ 3H1CA 3V8JA 4EATA 5IOYA 3VFZA 1YLFA 2KQRA 4LK1F 1TL8A 3A0BC 5CJ9A 4HNUA 2M4KA 1XN7A 1I5ZA 2E5NA 1TWFJ 3VDXA 5DS9A 3ZQHA 2FD5A 1TWHJ 2AO9A 1Z1DA 3SEQA 3OYLA 1FSHA 3PO2J 1Z77A 3JREA 1MNDA 4DQ2A 4IOCF 2X48A 4B3AA 4U7BA 1BJZA 3K69A 4G12A 5K5RA 1RRJA 3QODA 4OAZA 2EK5A 4HYEA 4NQWB 3T8TA 4LLLA 1DDNA 5CPRB 1X4PA 2HTJA 3BG9A 3GUDA 4I0AA 5HLIA 1WI9A 1Z3YA 5DCFA 5EG0A 4UUSA 3HEFA 3HJEA 2HI3A 2HS5A 3LSJA 4KITB 4A3EJ 4PGHA 3OYIA 1MH3A 2CG4A 3I53A 1CGPA 3GWZA 2A68F 4BS9A 1GXPA 4BNCA 2GXBA 4P1WA 1VQ7I 3T8RA 1H88C 3TL4X 4V2FA 4EMSA 3OY9A 2AXLA 2DT7B 3CMMA 2K40A 3FMSA 3M1CA 3Q9VA 2WB1N 3R6SA 1P4XA 4G6TB 4E7JA 2JTVA 4QSHA 4A0XA 1D1AA 2KIFA 1HSJA 2IPQX 1IRGA 2Z99A 3BY6A 2EIJH 2CUEA 2F5DA 2V7FA 1WJFA 2M34A 2L0KA 1XCVA 2VJ5A 3PUFA 4A0YA 5DEQA 1LUJB 2IS6A 2LF7A 4EJVA 2JUGA 2P8TA 4XLAA 1VQ5I 2YSRA 2JZYA 4GXOA 3QPHA 4FHTA 4XIDA 2WV1A 3U21A 3WHBA 3PJRA 3F8FA 1MD0A 1G3SA 3S2WA 2H27A 2DMTA 1FBUA 1HXDA 2CQQA 2EPFA 4BH9A 1O3RA 1V54H 1SEUA 1QZYA 2HPMA 3DKWA 2VC1A 2D5VA 2ZSHB 3CMEI 1XS9A 3FM5A 2ZMEB 1DU6A 1IXRC 3R4KA 1FC3A 3H9QA 2JSPA 2TCTA 4L9TA 3IKVA 3BQYA 3BJ6A 3W6KB 4YIFA 5EEAA 4EGZA 3JR9A 1VQ4I 2YR2A 3M8EA 5E3NA 2VASA 2VC0A 2UWMA 5C3EJ 2VI6A 1ONVA 1XD7A 1VQNI 2FX0A 3DQVC 4XORA 1BI0A 2MD5A 3WTTC 5ILSA 4RB1A 3KEYA 3OYDA 1R1UA 4KJZA 4YFKF 1Z21A 1CF7A 4OMZA 4KIFA 3ZCOA 2XPVA 5HDGA 1X3UA 2XRNA 1G59A 4NDLA 1YW8A 1TW3A 3SJMA 2EB7A 3ZQFA 1X19A 3FXMA 4FISA 2XSJC 2MGQA 1J2XA 4XLEA 2VJJA 2VT3A 3D1NI 1ENHA 3G73A 3E5XA 4PJJA 4KMUX 1BIAA 2XGCA 2XB0X 3ZP5A 3ISPA 1ETYA 3QQAA 1T56A 5AIQA 2IJLA 3F9KA 4ITVA 1ZLJA 2PMZN 3BQZA 4AIDA 4JBAA 3QU3A 4DZPA 2F5CA 4UVAA 3WGGA 2WA0A 2O8XA 4Y15A 4C2TA 2E35A 2Z16A 4NBQA 3I9V2 4KT6A 4TV7A 4FETA 5ERIA 1IC8A 5E1WA 3VSLA 1BR4A 2BY3A 2PFBA 4HV6A 1TTYA 1YS6A 3DBLB 3CUQC 1I6XA 1ZARA 4RBOA 3H5RA 2OBPA 4XN3A 3ZQGA 3SXYA 3MD2A 1J59A 1DPUA 2CH0A 2LFBA 3DF8A 5JI6A 3BTLA 1Q1HA 3IUOA 1GUUA 1UFMA 1FYMA 5D4RA 2CFOA 4ENMA 3IRQA 1BA5A 4I02A 4BQAA 1BR1A 4GYGA 3W2AA 2K5CA 2LBFB 5KK1A 2H09A 4D0PA 2DCEA 2VE8A 4NC7A 4M9XA 1YRNA 5FLXZ 1TWAJ 3KYCB 2VUMJ 5IP7J 2WY8Q 4IHSA 1T6SA 3H92A 1XTAA 1FOWA 4R1HA 2ZJPF 1WSUA 3A2KA 2MH2A 4UB8C 3FMRA 1G3TA 4M72A 3PFIA 2DI3A 1IG7A 4G6QA 2CW7A 3TO7A 5L3GA 3LSRA 5JHFA 3MKWB 2PLYA 4IRGA 1QPIA 2ZO4A 3NQOA 5CVVA 2FOKA 3RPQA 3C18A 2Q2EA 3RIRA 2ID3A 1S72I 3H9JA 1C0WA 1UG2A 4ZYDA 3FF5A 5J1RA 4QPOA 4S0HB 3PNYA 4UVBA 2K02A 4BYYA 1SD6A 4CHUA 1WH7A 3R0JA 3QPTA 5D5VB 1T39A 1MH4A 4RLFA 3L2CA 2Y0SA 1R1VA 3B6CA 3WE2A 2WY7Q 2RQQA 5GAEJ 2R0QC 1QA6A 2EFOA 4RGSA 3WU1B 2DN0A 2FQ3A 4D1QA 1T98A 1HLVA 1WWXA 4FTHA 1MNEA 2ACJA 2HVRA 1MBKA 2LKPA 4AU7A 4ETSA 5BPIA 4V19K 4QIWN 3LSHA 2R4GA 2DPUA 3I4MJ 1G3WA 2ZC2A 2JA8J 3E1SA 1MBJA 4BJ6C 4WX9A 4AVZA 3MEXA 3RPUD 3HDDA 5D5XB 3HC7A 3U9GA 4LK0F 1JT0A 1QHHD 2F4OB 2OF7A 2P5VA 2ME6A 3J7YJ 3BG5A 4EJOA 1F5TA 4KMFA 5J4VA 4RAZA 2EZIA 3MAJA 3ESWB 1OCOH 4RM2A 3OS1A 2O61A 1T0FC 2V1NA 1KGSA 4JX6A 4KICA 5FD6A 5L3EA 5KAIC 2MABA 2DT5A 5JLXA 2A3SA 2FA5A 3U1KA 2M2EA 2BVLA 1U5TC 1XDSA 1MMNA 1LNWA 1QBJA 2IVMA 4B48A 5IP9J 4HZFA 4XSZF 1YX5A 5ILVA 2MLKA 1T2KA 2BXZA 2LG4A 3SFIA 2PJPA 2R3SA 3K10A 1WGXA 2IXSA 2L7KA 1ZR4A 1N25A 2R7DA 1YJ9I 5IOZA 3P9IA 2ELJA 4L5JA 4X0GA 2HGCA 4KDPA 4Y4RA 4M6XA 1FIPA 1IXSB 2OPTA 3ABKH 5IYBJ 2PMHA 2EJRA 5KHDA 3QYBA 2F5EA 1SANA 1X1CA 2X1DA 2QSHX 4EJUA 3BR2A 1AU7A 3HRMA 2VOPA 2P7CB 2EINH 3CO6C 3OR2C 4LB6B 2VODA 1X1BA 4ZYAA 1W0UA 2M7AA 2GZWA 4F3QA 5HS8A 4BHCA 1W7PA 4JK1X 3L00A 3DLLF 4LG0B 2GQQA 4YIIA 2ZJ2A 3KYLA 1LEBA 1FEXA 2M8GX 3OS0A 3K4BA 5GAHJ 1RUOA 2FNAA 2MW8A 1E3PA 1D1CA 1X58A 2V6CA 2JQ7A 1LDJA 3KP7A 3DPUA 1R4NB 1VQOI 2PQ8A 4ESBA 2RN7A 1MBHA 3H3VK 1T95A 1MBFA 4XKVA 3GTKJ 3IHUA 2CRGA 3WE3A 3RZOJ 4KNYA 5LEKA 2IW5A 2E2JJ 4P96A 1K78B 2WWYA 1OLTA 2COMA 3I56I 5IT9Z 3D0SA 3DU6A 2BY1A 1MZBA 2CUJA 3JTHA 2DOEA 2JA2A 3K1NA 1EA3A 1QVUA 2LREA 1DGRM 3KFWX 1Z6TA 4IQJA 2M3AA 2AQEA 2XPUA 2R5YB 3TO6A 4D5FA 1D3YA 3M7GA 3V42A 1FIAA 3CDHA 1OMIA 5BS6A 2RNJA 2JVHA 3H3ZA 3FIWA 4XLNF 2CW8A 1N77A 1GVJA 3TKYA 3RQIA 5B5EC 1HA8A 1TW2A 3GFMA 4RAFA 3BR1A 1RNLA 3DKYA 4U0YA 3HRUA 3JRBA 1MDMB 4I7HA 3CC2I 2QM3A 1P4WA 4M9SA 4G7OF 2G7HA 4ZDPA 2ZSIB 5F0HA 5DM7F 2H1LA 4GDFA 3ZQ7A 5EGOB 3EYYA 1ZK8A 1SFEA 3D5LA 1UB9A 6PAXA 1ULYA 1ZRFA 1IRFA 1WFXA 4M3DA 1B59A 1TNTA 1YE9A 2CUFA 5DUKA 1IUYA 1LVKA 1FOYA 3TDUC 2W25A 3BR3A 3QU6A 3IWZA 4WXHA 3IL2A 2DMNA 5F1RA 1OCPA 2E1OA 2LNBA 2QQ9A 2IA1A 2V9KA 4Z2YA 3DBRB 3S2HJ 2QVOA 2VN2A 2E2HJ 5CYVA 1IN7A 3A03A 2DAOA 1KQ9A 1WHUA 1Y0NA 3L1PA 3AL0C 2EFWA 1LFBA 4AIKA 3LSGA 4HSTA 1O4XA 2WAQN 4Q5SF 3KZIC 2LTPA 5CQGA 4BHBA 4A3JJ 4IQ4A 3I58A 1NK2P 2XF7A 4O5VA 3FMQA 5EZHA 3KYDB 5K7ZA 2X6YA 3KEOA 1I1GA 4A3DJ 2KRFA 4CA0A 4DYRA 4L9VA 1USTA 2OQGA 5IPAA 5LGNA 3M1EA 1UJ8A 3LFKA 4XNFA 5EJCA 2VOOA 4XRMA 3PNTA 3GTJJ 4OAYA 2CU7A 2HQNA 2IRFG 2A61A 2AHQA 2HXIA 1KZHA 4IPAA 3E3VA 5J3LA 3VWBA 2X0LA 5IT3A 3H0DA 2V4JC 5J8CA 2DO7A 3GTPJ 5DV5A 3HB9A 4HX4A 1YITI 4A6EA 4HX7A 1FT9A 4MTEA 2QEXI 1KU7A 2Z5UA 3PIOF 1MBGA 3TGNA 3ZMTA 3SHFA 4RM3A 1O3TA 2VB6A 3N97A 4C2MJ 4ZH4F 2ZMEC 2O6GE 1YO5C 2CFXA 2M87A 2P5KA 2DJNA 4OINF 5C4XJ 2RC4A 1EKEA 1BOBA 2VQLA 4ENKA 3H5AA 1G3YA 3K1MA 1PUFA 4OOIA 2XAQA 2W48A 5TRDA 2ZBKA 1A6IA 2WB1A 1DPRA 4HOBA 3I54A 1MJAA 1P7JA 1V5GA 2QBYA 3RKYA 1ETKA 1JGGA 3OSFA 4M73A 2KLOA 4B8XA 3CUQA 2WBMA 5H6RA 4U7DA 3HXLA 5D6FA 2J5OA 4PSWA 5DM6F 4BXXJ 1YS7A 1F9NA 4C2UA 1HOMA 2V9PA 2L9NA 3AG4H 1Y1WJ 2VBYA 1Z7UA 3WG9A 4HDUA 2FE3A 1OYIA 2XV4S 2E19A 3K4JA 1BC7C 5K7HA 4Y13A 1HDPA 1IO2A 2DA4A 2LH9A 2X4HA 1J0RA 3AFHA 1JUPA 4IKFA 5B3SH 1RR7A 2DMPA 5DD4A 3OL3A 1KU9A 1YTYA 4PCQA 2AS5F 4E7IA 4HQMA 5J1UA 3BTCA 1LEAA 2FUG2 4HRIA 2F48A 4A3GJ 1JUSA 5IP6A 2VLAA 1F4KA 5FKNA 1YW7A 5TISC 4CCMA 2ZCWA 2NVXJ 3DLAA 3RYRA 2L02A 4E4HA 2NS8A 4ZC3A 3V8KA 3I55I 4ENJA 3M9AA 3L9FA 5M3MJ 3GFIA 4A69C 2X51A 1JT6A 3I4PA 3ECOA 4AD9A 3BR0A 2KZVA 5LGUA 3ZQIA 1FP2A 3ZPLA 2STTA 3TMOA 1FP1D 1G8XA 5DCMB 1VQPI 2DODA 2ZXIA 3DEWA 3ELKA 3CCQI 2DT6A 1UG0A 3KLNA 1KYZA 2HDWA 2W85A 4OIPF 2KHMA 2VKVA 3K4KA 2W57A 1MJBA 3RPUA 1IGNA 2HXOA 2HVQA 3BT9A 3BG6A 1A5JA 1TQMA 3OIPA 1J9IA 2F5FA 3T5XA 3WU2C 4FASD 2HDDA 3ASOH 2R93J 4LLGF 5BNGA 2DK5A 2PMZA 1EH6A 4CCJA 5F64A 4BE0A 1XC5A 3E0JB 1P7IA 1V4RA 1MBEA 4I0BA 2IAIA 4DNCA 1RI7A 4DBQA 4AM3A 4WK8F 2MA3A 4CCNA 3RCOA 3P9CA 3ABLH 5J8FA 2DU9A 3VEPA 5JHUA 4Z6YA 3WTXC 3AG2H 2XSDC 1I6HJ 1U3EM 1SMTA 5IYCJ 3CESA 3DV8A 3HUGB 4IOAF 1E2XA 1MJ9A 2FBKA 4Q47A 3A02A 5F04A 2NVUB 2VT2A 3DPLC 4CH7A 2JA6J 1USSA 2E71A 1P6RA 4A3IJ 3KLOA 2Q8KA 2CGPA 1X1DA 3VOEA 5J1YA 1F36A 3TDZC 5HS7A 2VL8A 1T0FA 3HPHA 4XLCA 2V6EA 4CYCB 2BHZA 4MFEA 1APLC 2ID6A 2VQHA 3VYTB 1U5TA 2DA6A 1JE8A 2DA5A 1ZR2A 2EIKH 3OYJA 3UKGA 3J81K 3S3NA 5HS9A 4F55A 2FMYA 4MO7A 4AVPA 4P9FA 2ZXWH 4IHVA 4XOTA 3BP8A 2A6HF 4RA2A 1S3JA 4M6YA 5D5UB 4OMYA 3JRCA 2F4MB 3BDDA 1JJ6C 1G4DA 1A6QA 3BJOA 3SDGA 1HBXG 3ZMVA 1FBSA 1FYLA 3OWTA 1IXCA 2V1UA 2A07F 3E6CC 3V7SA 2VJ4A 1GV2A 4CICA 3HHHA 3ZXSA 4HPQA 2HOSA 3FZVA 5KAFC 3E6DA 4MNUA 2ZJRF 2XDVA 2L4MA 1RKTA 3P7NA 1EH7A 3HOYJ 4A12A 1G2HA 4C3JJ 3K2ZA 3HGYA 3W3CA 1NH3A 4A3LJ 2LDUA 3EUKL 3F8MA 4CYDA 3L2QA 4E7LA 2CJJA 3T0YA 3WTUC 1PP7U 2K9SA 2L01A 3CO7C 2IS4A 4ANJA 5HOOA 2VKHA 1WCMJ 1TT0A 3QOPA 4E7SA 5J40A 3FHZA 1JJ8C 2XVCA 3FXUA 1X4OA 4FQGA 1V5FA 5DD8A 3J7ZI 1Y39A 4R8HA 5B1BH 2EIMH 3OYAA 4OWRB 2DFFA 3DTKA 3ABMH 3KIOA 4HQEA 3GLLA 4M3FA 3DEUA 1B72B 1P4AA 2NVQJ 3I59A 5DDGA 1D0YA 5D6EA 1S7EA 2X1EA 4ZDOA 2ELHA 1MNMC 2IA0A 2DQRA 1H0MA 2KIQA 2DOAA 2A69F 3W2WA 3CMAI 2HVSA 3BTJA 3GEZA 5F6FA 4A3BJ 3JRGA 1F43A 1A35A 2ZXJA 5LEJA 1LE8B 3DEEA 3MWMA 3H3UA 1D5VA 3DTIA 3DXJF 4JX5A 5EZGA 1YIJI 1S7OA 2ZJQF 3O2PE 2MC4A 2QA4I 1VQ8I 5GP9A 4O3MA 2PX9A 3EYIA 3QP6A 1TQIA 2WAEA 1OKRA 1TWCJ 4P5OA 1Z6RA 2CW0F 4Y3OA 3BTIA 4AUXA 3PFYA 5E1XA 5CQEA 4EQQA 1D8KA 3QWLA 3DKXA 5K5QA 2A5WA 2B9SA 1BIBA 4L5EA 3IAM2 2H6BA 5GAGJ 3LA3A 5EF6A 3L2UA 2RQPA 5E20A 3OYGA 2CQ7A 1W5CC 2P6SA 4XQFA 2XIGA 2DA1A 3L7WA 3LQRA 4YFNF 4A3CJ 2W24A 4NQWA 3C7JA 1BJAA 5GPAA 2BGCA 3D5RC 4DGWB 3L09A 4PJ0C 3OYNA 3BOQA 5JVTA 1QZZA 1XGMA 4LITA 1Y1VJ 4BL0B 4ESFA 1GT0C 4OIRF 1A36A 1SVOA 3EQLF 3BWGA 3HOZJ 5F0CA 2B0LA 4EGYA 2KKOA 2QQAA 3S15J 2K86A 1Z0XA 3Q0WA 2GA1A 3ONQA 2JWTA 3WTYC 4XSXF 4I6ZA 1K79A 1ZELA 3G1OA 3MKLA 2L4AA 4XM3A 2E2IJ 4HAMA 2C6YA 1XSDA 2ZKZA 4ZYHA 2BY2A 2ZB9A 1AKHA 3KP6A 2ADUA 2LY1A 2W00A 3K4CA 4RB0A 3HZJA 2EFNA 2FU4A 3B73A 4X6AJ 2OD5A 1LKXA 4NHJA 3BC8A 4CCKA 2RREA 2NS7A 3P9KA 4PJNA 3C1DA 2ZXHA 1OQYA 1KU3A 3G1LA 4XMYA 2MD0A 2XROA 5FKMA 4LIUA 3IV5A 2DMQA 1ETOA 2OC6A 4KISA 2VE9A 3IH4A 3F8CA 3DU5A 1ETWA 3EDPA 4RGXA 1LDDA 4B43A 5E8IA 4BXUA 2ZMEA 3K70D 4ENNA 1YOVB 3GX4X 2G0EA 3V7CA 1TWGJ 1OR7A 2DTZA 2H6CA 1WJDA 4CZZA 2M1BA 5DUIA 4BDYA 5FLMJ 3J7AY 4G6DA 4XLFA 3BCBA 3Q0UA 2IGMA 4M71A 1U0JA 1YQAA 2L7ZA 1R00A 2VBWA 2QQBA 3IH3A 1UHWA 4FT8A 4HF0A 3MKYB 4A93J 1R5ID 2R7VA 4UNOA 2A6EF 1B4AA 1W7PB 2XGDA 4KIGA 3WU0A 3G2BA 2L54A 2NAZA 4ZZLA 5L3CA 1J5YA 1PDNC 1FOKA 1YG2A 2YX4A 1RUNA 2M4GA 1ODDA 5FKLA 2OTJI 4CO8A 4DJAA 4C9YA 2JN6A 3ULQB 3VYRB 3GVAA 3JTGA 3S8PA 1N75A 4DYQA 4ASNA 1JUMA 4UHTA 3CJQB 1VF9A 2V1DA 2YX7A 4KN4X 1X2NA 2NVYJ 3ZMZA 1QHGA 2R7RA 2FBIA 4LOCA 4PFOA 3QOEA 2E36A 2DTRA 1POGA 4A3KJ 2WAQA 3CF5F 3LA2A 3ML6A 2RNGA 2DYSH 1OCRH 2HR3A 4RAGA 1FLIA 3X2QH 2LK2A 2Y2ZA 3KPHA 1QQIA 2A6TA 3BPXA 3K2AA 1V3FA 1U8RA 2JA5J 4HW0A 2BW3B 3K0LA 3SYTA 1FMWA 1Q1VA 3HBLA 1ZGWA 2TDXA 3NWTA 1QVTA 3FXQA 3HG9A 1FTZA 1FSEA 1U8BA 3GTQJ 3QYEA 3TO9A 4BQNA 1VQKI 2OZUA 1D0XA 1PVEA 3K6GA 1UHSA 1RZ4A 2BOLA 3LSMA 3KEQA 4E7ZA 4Y33A 4CDGA 3HOXJ 3GTMJ 2EILH 2LMDA 5K5OA 1ETXA 5ILUA 5M5XJ 2ISZA 4A2UA 4XONA 4GCVA 3OL4A 5CVIA 1I3QJ 4PDKA 3REOA 3C3WA 5L3BA 1EV7A 1B9MA 3WGIA 1ZQ3P 2DW4A 3E97A 5FFZA 4IRHA 3OIQA 4IRIA 1IW7F 2NS0A 3F0CA 2HKXA 1OCTC 2VPLA 3CCSI 4XRSG 3PIPF 3ERMA 1BW5A 1ZYRF 4A0ZA 5F1JA 2YU9J 5HLGA 3SZTA 3Q9SA 1TQPA 2W82A 3ZN0A 5LHGA 1SD5A 3CDIA 4S04A 2GOMA 4B1RA 4L0ZB 1ORKA 2VPRA 3S14J 4HV5A 1ZN2A 4MEYF 4HLXA 3CJTB 2Y30A 4OIQF 1T38A 3QYFA 3FISA 4D5CA 5H20A 5LBQA 2O03A 2VBXA 4GGGA 1XPXA 1BW6A 3H9GA 2H8RA 3GBGA 3F21A 1A04A 2E7XA 2XF5A 2LD5A 3H36A 4WXDA 3ABUA 3VB2A 1UELB 3N05A 3GO5A 3S3OA 1SFOJ 4B4CA 1J75A 2E1NA 2JSCA 2G7UA 3Q5FA 4LLNA 2PMUA 1OFCX 5LRSA 4OIOF 1MMDA 3V8LA 2KP6A 2OCCH 5HLTA 3LA7A 3BJAA 2N8GA 2ESNA 3I4NJ 5D8LB 4BJ5C 4EM1A 3F72A 3CCJI 4IO9F 1TZLA 3IH2A 2V9VA 2DFIA 3GW2A 2HFHA 5B1AH 2HNHA 1R5HA 3FXRA 2EZHA 2GWRA 4FCYA 2HWVA 3ZMSA 1MW7A 2EQRA 3GXOA 2K4JA 2XF6A 1ZH5A 4JYKA 5A2QK 3CLQA 1WPKA 5E18F 3LSIA 5FKKA 3U1DA 3LSTA 4QPQA 4B47A 3AG1H 3O3KA 2MSYA 2Z2SB 1Z3XA 2WADA 5HNFA 2PEXA 3DFGA 1R5GA 3CUOA 2WAFA 4IHXA 2VQGA 3CJNA 3A4CA 3H0GJ 2M30A 5LFAA 5ED4A 5M3FJ 1SC7A 1AHDP 2E1CA 3GMEA 4IVNA 3GZ5A 3W6JB 4BJTA 1K7AA 1LFPA 1RC9A 2K7LA 2ZNYA 3ZRGA 2KDOA 3OOUA 1YJNI 4UXNA 3HL2A 1XGSA 2PN6A 2YUSA 3NWSA 1ETVA 4Q4ZF 3UNGC 5KNLA 1U9NA 5M5YJ 1R58A 3R60A 4PJMA 2GBYA 3O8HA 5CVRA 4IHWA 2HQ5A 4UV8A 3MN2A 3MKZA 1WJAA 2R7WA 3JSOA 1Y0UA 1GDTA 4K2EA 2XAFA 4RMNA 4M3EA 3HM5A 4AWXB 1JKRC 1U9OA 2RVCA 2K85A 2Y69H 3EPZA 3A01B 2M5WA 1VFCA 3KP4A 5D4SA 4Q48A 1Z91A 3K9TA 3G71I 1E17A 2KIMA 5J47A 5IYDJ 1K6OA 2GOXB 3ZMUA 4LG0A 4XRSA 3L2RA 2AXTC 3RKQA 2CWEA 1KA8A 5ICGA 5GTIC 1OCZH 3S3MA 2H94A 4WWCA 1WJ5A 3DCFA 2F5VA 3NEUA 2PG4A 1NTCA 1O7LA 1DGWY 3SEZA 4PSXA 2QZ8A 4XN0A 4BAYA 1HSTA 4BHPA 3S17J 2LR8A 4A5NA 2OTLI 3LMMA 1LPQA 4U0VA 4RB2C 1B8IA 2B63J 1X3ZB 5E3OA 3ZQCA 1K78A 3GYHX 2Y9YA 1OR7C 2L9SA 2OU2A 3DPTA 3F6OA 1Z7LA 4U87A 3JW4A 3RSNA 1O3QA 4YIRX 2QSGX 3BCAA 4I76A 2R5YA 1N78A 2OA4A 2WV0A 3OS2A 3AG3H 5LHIA 4MQVA 1L3LA 4LMYA 2D2WA 3PL8A 2DBBA 3F22A 1E3HA 1ZAOA 2XRLA 3B6AA 4HG2A 3LQQA 1FMVA 4MLOA 4M74A 3HKZN 4YRVA 1VQMI 5E17F 3H35A 2IP2A 2CQXA 2M45A 1XX5A 1YFHA 2XAGA 3TW6A 1ZHFA 1S9HA 2WC2A 3BPVA 2K9LA 4LFUA 2MH9A 3QRFF 1IDZA 1HQCA 2R7TA 3DWLE 1W0TA 2L5QA 1MDMA 2O5RA 1FX7A 1SFKA 4DBRA 4ZYEA 1IN8A 3OYBA 3LAJA 1T8IA 2P5LC 5E1ZB 3GCMA 4AYBA 2PJRA 4DYCA 3CC4I 2HOEA 4I99C 5ICCA 1E3OC 2P7VB 1IN6A 5E79C 3LOCA 3OV8A 2Z9OA 2CO5A 4PJLA 3LWFA 3CZ6A 4B3XA 1WJBA 3NAUA 3AAFA 2HDCA 5EEHA 2K4BA 5JFRA 5EG0B 2GXGA 3KZZA 4UUSB 4XKCA 3J81Z 2LKXA 2XGEA 4DIQA 4F52A 2EV6A 2NOGA 1SD4A 5AIPA 3JAMK 4JX4A 2FBHA 1OYYA 4EJTA 1MMGA 3VODA 2E60A 2RGVA 4L9JA 4N9HA 1JHFA 2FJ1A 4P55A 3M07A 1Y8RB 2Z33A 1IV6A 4CGZA 5C44J 4HBLA 2NYXA 2H8WA 3CJRB 1YHQI 4G7HF 1PP8F 3HHGA 2FNPA 2X6OA 3CDLA 1SFXA 3ZMDA 1D1BA 2V79A 2HOTA 3IKTA 1RPWA 2IGNA 2QQ8A 4GO1A 3WTVC 3BZ6A 3Q0VA 5B66C 1V55H 2J5PA 2KT0A 3EUHC 4HEA2 1NG7A 3OYFA 5FROA 1NHAA 4QTRA 4PFPA 2V26A 2R5ZA 1ZG3A 1FWZA 1FJLA 3HRTA 1XMXA 2LY9A 1JXSA 3GTOJ 2XKPA 1ZGJA 2CS3A 2Y0MA 2DOFA 1IRXA 3IAS2 4EM2A 3M8FA 1HCRA 2QWWA 4II3A 5BOXA 2G9WA 2DXIA 4N0BA 1HW2A 3KZYA 3BR5A 4U0WA 1QNTA 1WKMA 3IRRA 1HKTA 1FOXA 1W5TA 2XUBA 3SZPA 2QUFA 2F6CA 1LDKB 1W36D 4Y17A 1Z67A 4EEFG 1CF7B 1SFUA 1IV8A 4A6DA 1Z9CA 1I1SA 4UV9A 5KVRA 1RR8C 4MTDA 4G9YA 4QWQA 3FHNA 4KUMA 2A05A 4E7HA 1K4TA 1VZ0A 3T1BA 4XOPA 1OJLA 3UR3C 2VXZA 4F93B 1SAXA 2VKDA 1B6AA 1BC8C 1RKWA 4NNJA 2IT0A 5FRMA 3JRDA 2CV1A 2UZKA 1W7PD 2XB5A 3CCLI 2FXAA 3RKXA 4G8XA 1ERDA 1BBYA 1HW5A 4RDUA 5DYMA 4FX0A 4QLCU 4JP0A 2NVTJ 3BLYA 2JVGA 1O57A 2QYOA 2LY2A 4BY1J 2I8DA 2ICWG 2RDPA 3I71A 4LG3A 5JVGF 2M7BA 4XICA 3E5QA 3E5UA 1H89C 4I98B 2DYRH 4BDZA 5HNHA 3DP7A 2FRHA 3NRVA 4XRFA 2X6XA 2BBYA 2FMLA 3AL0B 2HPIA 1G6NA 3FWEA 5DCMA 1X1PA 2X6WA 5AONA 4PUSA 2D1VA 2O3FA 1U6GA 2DDAA 2JK3A 1LFUP 1QGPA 4YG2F 3W2VA 1DQUA 4BUPA 2E7WA 1KQ0A 2QGUA 2W7NA 2M9HA 1W5SA 2K9NA 4AYBN 2KISA 4X1EA 1MSFC 5J6XA 2VKEA 3OIOA 1SVMA 3HYIA 1O3SA 1AKHB 3N4MA 3HOWJ 3CMYA 1IN5A 1JI8A 1HKQA 2MC3A 3CP2A 1HDDC 1V5EA 5HDNA 1YRNB 3QAHA 4L18B 3HRSA 3G4SI 1M1EB 2QKLB 1EF4A 5FJ8J 3ECHA 3J7AO 4MHGA 3WG7H 5FGMA 5HLHA 2R92J 1BR2A 5LRRA 1AWCA 4J19A 1REPC 3PQJA 4CSWA 1MMSA 2EFQA 2Q0OA 5K1YA 4BEHA 3RJPA 4F7ZA 4E6KG 1F1ZA 1VQ6I 3OYCA 1VTNC 5ICEA 3HUGA 2FQ4A 4IZZA 1JKQC 2NNYA 3GZNB 2PI0A 3DTEA 2Q2EB 3GTLJ 2DFEA 1R23A 4CZCA 1T08B 5GTHC 3I5UA 1JKOC 4JOMA 1QZEA 1R4MB 3FX3A 4BQQA 2MYSA 2LYCA 5CVUA 4IEJA 4CYCA 4RS8A 4DZJA 1R22A 1GXQA 3WGHA 4UVCA 3E6BA 2DLLA 3LFUA 5FLVA 2XPWA 3JRAA 3EETA 2XASA 2YPRA 1B1BA 2STWA 1WJCA 2HQRA 2UUZA 3G3ZA 4IXAA 2COBA 4D7MA 2CV2A 1TT5B 2O8KA 2EBIA 4WF2A 1EJ9A 3KP2A 5L3DA 3S1MJ 5M5WJ 2OJED 4BKXA 1HKSA 4CCLA 5D8KB 2DA3A 1H8AC 4CUGA 1ZG1A 2X1CA 1VI0A 4FE4A 1BOAA 1BI2A 4N4NB 5FRNA 5BMZA 2BVMA 1K4SA 3P5JA 3C2HA 4A5MA 2YU3A 2HYJA 1I50J 3AKZA 1K83J 1R9TJ 2OCEA 3HTSB 1VNDA 4UY8I 3K70C 1OPCA 4G94A 5HODA 1XSVA 3CTAA 1NG6A 1LQ1A 3TW7A 1ACIA 3SQNA 2JPBA 3CLOA 2K3PA 2BHYA 3LL7A 4ON0A 4P9UA 1IJWC 5BQTA 2OAZA 4M3GA 3O8GA 1D8JA 2JPCA 2ZFWA 3OR1C 3FDYA 1X1AA 2P81A 5GPCA 3K7AJ 2QF7A 4NB5A 3RYPA 2EA4A 5CVJA 1S29A 2VJIA 5FB2A 3TOBA 2O7OA 1UHMA 3CCEI 3Q3SA 2UXNA 5F08A 3ERED 1R71A 1B72A 1D5YA 3IC7A 4A3FJ 4HLYA 2HYFA 4EJWA 4I09A 3FXKA 1YYVA 2RV8A 3ASNH 2LSOA 4MEXF 1Y8QB 3WTSC 3GLXA 3F8NA 3MZYA 4ZTJA 1S6LA 2E1MB 3RZDJ 1GVDA 2GM4A 1S8NA 1QO0D 1LE8A 5H6QA 1FBQA 4L9NA 4BBSJ 2R7QA 1H9TA 1RETA 5LHHA 5C4JJ 4XR6A 2QCOA 2JJ7A 2L9VA 3O6BB 2P6TA 2BXYA 3K1PA 4H0EA 3FXLA 3BZKA 2BEOA 4XL9A 4GFBA 4M6VA 4BBRJ 3D5SC 2WTEA 1HC8A 4PGGA 3GF2A 1L0OC 3G6EI 5HDKA 3WTZA 3TQNA 1YW9A 3PQKA 2W84A 4ZYGA 4J01A 2DK8A 1ZRCA 3TBIA 1E0EA 1X2MA 1IAWA 1DP3A 3ABTA 3PO3J 4RGUA 5F27A 2MBFA 4UUTA 4A3MJ 1JKPC 1OCCH 1IN4A 1Z05A 2HZTA 3CCYA 1JGSA 5FO5A 5LLQA 1R49A 3R61A 4IX7A 3GFJA 2QLZA 3L2VA 2ZFUA 2ME0A 4HF1A 2HOAA 3BG3A 2V1XA 2VONA 1P9QC 2KRHA 3MVPA 3MFKA 3PSIA 2GAUA 2NXNB 4D9JA 4LB5A 4MQ9F 2IA2A 2QSFX 5FFXA 3WODF 2M0CA 5GADJ 4IHYA 3CF2A 4C3HJ 2RKHA 1U78A 4LIVA 1TNSA 1LJ9A 2ECBA 3CCMI 2LVSA 5FLXK 1PUEE 2AQFA 4BY7J 2W4SA 2XKOA 4RAYA 4I01A 1MGTA 3C2BA 5A2QZ 3JRFA 1DP7P 2LBFA 2ZNZA 3H5NA 3LNQA 3LAPA 2GXAA 2LLKA 1S5LC 1WRJA 2VBZA 5J4YA 1TLHB 1WH5A 2Y9ZA 3HIFA 4M9ZA 3CP8A 1IZ1A 2ELKA 1UZCA 3CCRI 2KZGA 1K61A 1STZA 2GA2A 1ON2A 3B02A 1S7AA 2VXDA 3SDBA 2GIVA 1WI3A 3E6MA 3S32A 2EFPA 1R1TA 3TP0A 4EVIA 1H9GA 3RI4A 2CSOA 2I10A 2IBDA 1IUFA 1EH8A 3EUHA 2FEZA 5DTDA 3HKZA 1YIOA 3BZCA 2BYVE 1W4MA 3FKIJ 3A1YA 4YELA 3R0AA 1T33A 2EZLA 1SVLA 1ITYA 2OV7A 4ZZDA 1GV5A 4DOZA 1KU2A 3S1NJ 5ICFA 2IS1A 4MIMA 1HF0A 2RAEA 4L5IA 2R7SA 5L3FA 1Y56A 2P4WA 4O6JA 1WZ2A 3HSRA 3K4MA 2F2EA 1TP4A 4U88A 2Z3YA 3CCUI 1ZREA 3CD6I 5FD5A 4LD5A 4RGRA 2BV6A 1XSXA 1BL0A 4N4OB 3TP3A 1LB2A 5LGTA 3M8JA 2F4IA 2NOJB 1R36A 1BI1A 4IF4A 1DUXC 3M4OJ 3IP4B 3S1RJ 1ZLKA 4YFXF 2K27A 3EUAA 3QPSA 5EYRA 2IEKA 2Z1DA 4I2OA 1MIJA 2XAUA 4WXCA 5LD2C 3MCZA 1J7KA 3QPLA 4J00A 3NARA 3TEDA 4XK4A 3V4GA 2R7UA 1B8IB 2JUCA 2R7XA 2L3DA 2QKMB 2FF4A 4KN7X 1SD7A 2KJCA 3MZ8A 4RB3C 4AIJA 4E7KA 1AOYA 2VIXA 3COAC 3S1QJ 2MFZA 3CQZJ 3WHCA 1UMQA 2L9RA 4BQOA 5F0FA 2X9DA 2JA7J 3JRIA 1PUFB 1WVRA 4XLHA 4ZTFA 2KPMA 2BZTA 2EV5A 1VQLI 2BY0A 2XAJA 4D7NA 2BW3A 5CKTA 2EH3A 5H2FC 1IRZA 2ECCA 3I3LA 1JTXA 3K4LA 5HVQC 2QBYB 2O9LA 1PYVA 5E3LA 2HZDA 1UCRA 4AIHA 2OUMA 2IGKA 3CUQB 4ZDLA 2L7MP 1DU0A 1QRYA 1XG1A 3HTUA 2BE5F 4RLQA 3MZHA 3OSGA 2K9MA 4H4KC 3KETA 4KIBA 3LSKA 3G1MA 4XKWA 5JLWA 2R7ZJ 4W1UA 3JCUC 3FK6A 4DW6A 3OOPA 2B7EA 5TJJA 3IWFA 4CCOA 3J80Z 2Y0SN 3GZ6A 2PJRB 3GTGJ 1FPQA 2P0WA 3HOVJ 3ZQQA 4BE2A 4HNVA 2Q1ZB 1XGNA 2CMPA 3SZGA 3DBHB 1B9NA 2XGXA 4KYWA 1KONA 3BR6A 4BU2A 1XCBA 1QU3A 5KCMA 4BXFA 3E7LA 4XBFA 4HNTA 3FKJA 4R79A 2R7FA 1YI2I 2HEOA 1BN5A 3F3XA 3M3YJ 3CCVI 1XGOA 4XKBA 2OZ6A 2VQCA 2KIUA 3FXJA 3FM3A 4HA8A 3RDIA 2DFHA 2EZKA 3KE2A 3OYKA 1A31A 1KYWA 1WQ2A 2IGOA 3KCCA 3VPRA 2H1KA 1BM9A 2KRCA 4UB6C 1ZGAA 1XMKA 3BG7A 5D5WB 5IT9K 2XAHA 2PBIA 3JAMZ 2DQLA 3HPGA 4F92B 5BPDA 1IF1A 2DMUA 2ESHA 4AC0A 3S93A 2HYGD 4B44A 4PK4A 4KA4A 2EWNA 1X3WB 4KFCA 2JRTA 1CQTA 4ESJA 2A5YB 4E70A 1MKMA 2JT1A 3OYHA 5E8GA 1I39A 3HOTA 4CXFA 3PUBA 1PJRA 2KJBA 3MQ0A 3JRHA 2DA2A 4S05A 4Y52J 2R5ZB 1OISA 2JMWA 3BROA 3OYEA 2E5ZA 2LP0A 2FSWA 1ZG5A 2DPDA 2XC7A 3CC7I 1OYWA 1XMAA 3U2RA 2MLGA 2LKSA 4W97A 3RQ4A 1FNNA 4M3BA 3JSPA 1ZRDA 2LC2A 4IL6C 1NK3P 3VSKA 4BGDA 1JHHA 2M8EA 3J80K 2EV0A 4BACA 1J09A 2GIZA 2CYYA 4XLPF 2CQNA 3RTRA 3I64A 2KL4A 1MMAA 3PM1A 4MFDA 3ZR8X 4OU0A 2IS2A 1YX3A 5EGOA 4EV0A 1XB4A 2DJIA 2LF8A 1ETQA 2W1OA 3HOSA 1FY7A 2R7OA 4HSRA 2O0YA 1IDYA 2LRDA 2HTSA 3FK7A 1FZPB 1U5TB 3HSEA 1W1WE 3HOUJ 4JQFA 3FXOA 2KMUA 1YJWI 4C30A 1P2FA 4PZJA 4NC8A 2DA7A 5JR3A 2YS9A 3ZOBA 4EM0B 4HX8A 4IJAA 2K9QA 3KP3A 2Y31A 2NNNA 1ZKGA 1XDUA 3I0TA 2GLOA 1I27A 3FBIB 4V2GA 2X85A 2Y48A 2ISYA 4L0YB 3HGGA 1ZTRA 5K7FA 3OMYA 2JRMA 4ZJZA 1TC3C 4FX4A 2L2OA 3S2DJ 3KX2A 2D1HA 3A01A 3ZGKA 3S16J 9ANTA 3F6VA 2HQAA 4UUVA 1Y6IA 2UXXA 4II2A 4B09A 4LJZF 3F23A 4HF2A 3K4NA 3WTWC 4GYIA 5IY5H 5E3MA 4ABZA 4NUBA 3VYUB 2E34A 2HKOA 2CV0A 1BI3A 1D0ZA 3ROUA 3OYMA 1P92A 2UV1A 4HDVA 1R6RA 3GFLA 3KP5A 3PNVA 4Y7NJ 2I5UA 3FBNB 1KQ8A 2K3FA 2KFDA 1QPMA 2TRTA 4F91B 1UAAA 2KDZA 3SFZA 2FOWA 1W36C 2HU9A 3ZQLA 4WCGA 2DDBA 2LOOA 2Y75A 1K6YA 5CLSA 2D45A 1MSEC 3QP5A 4NC6A 2CQKA 1HW1A 3TOAA 3I59B 3F8BA 1FTTA 1O7FA 5EDNA 1I3AA 3LSPA 1U2WA 1FYKA 4GRIA 1WJEA 1RIOH 4FE7A 4G7ZF 2E1MC 1GHCA 1AA7A 1SMYF 4N9IA 2EA2A 1ON1A 3MMYB 1RESA 1SAUA
chains in the Genus database with same CATH topology
4LGWA 1LVAA 2QENA 5EEGA 2XHKA 4MGRA 3V7RA 2OQRA 3RKWA 2NRAC 2ETHA 4KT5C 4IHTA 1TBXA 3HSFA 3ZN1A 1R7JA 3V8JA 3VFZA 1YLFA 4LK1F 5CJ9A 1XN7A 1I5ZA 1Z1DA 1FSHA 4DQ2A 4U7BA 3K69A 5K5RA 2EK5A 4HYEA 3T8TA 4LLLA 1DDNA 2HTJA 4I0AA 3GUDA 5HLIA 1WI9A 5DCFA 2HS5A 4PGHA 2CG4A 3I53A 1CGPA 3GWZA 2A68F 2GXBA 1GXPA 4BNCA 3T8RA 4EMSA 2AXLA 3FMSA 3Q9VA 3R6SA 1P4XA 2JTVA 4A0XA 2KIFA 1HSJA 2IPQX 1IRGA 2Z99A 3BY6A 2F5DA 1XCVA 4A0YA 5DEQA 2LF7A 4EJVA 2P8TA 2YSRA 2JZYA 4GXOA 3QPHA 4FHTA 3F8FA 1MD0A 1G3SA 3S2WA 2H27A 1FBUA 1HXDA 4BH9A 1O3RA 1QZYA 3DKWA 2VC1A 3FM5A 2ZMEB 1IXRC 3R4KA 1FC3A 4L9TA 3IKVA 3BJ6A 3W6KB 4YIFA 4EGZA 2YR2A 3M8EA 2VC0A 2UWMA 1ONVA 1XD7A 3DQVC 1BI0A 2MD5A 3WTTC 5ILSA 4RB1A 1R1UA 4YFKF 1CF7A 4OMZA 4KIFA 5HDGA 1X3UA 2XRNA 1YW8A 1TW3A 2EB7A 1J2XA 2VT3A 3G73A 3E5XA 4KMUX 1BIAA 3ZP5A 3ISPA 5AIQA 2IJLA 1ZLJA 4JBAA 3QU3A 2F5CA 4UVAA 3WGGA 2O8XA 4Y15A 4TV7A 5ERIA 5E1WA 2PFBA 4HV6A 1TTYA 1YS6A 3CUQC 1I6XA 1ZARA 2OBPA 3SXYA 1J59A 1DPUA 3DF8A 5JI6A 1Q1HA 1UFMA 1FYMA 5D4RA 4ENMA 3IRQA 4I02A 4BQAA 4GYGA 5KK1A 2H09A 4D0PA 2VE8A 4M9XA 5FLXZ 4IHSA 1T6SA 3H92A 4R1HA 1WSUA 2MH2A 3FMRA 1G3TA 4M72A 3PFIA 2DI3A 4G6QA 3TO7A 5L3GA 2PLYA 4IRGA 2ZO4A 3NQOA 5CVVA 2FOKA 3RPQA 3C18A 2Q2EA 3RIRA 1C0WA 4ZYDA 3FF5A 4UVBA 2K02A 4BYYA 1SD6A 4CHUA 3R0JA 3QPTA 5D5VB 1T39A 3L2CA 1R1VA 3WE2A 2EFOA 4RGSA 3WU1B 2FQ3A 1T98A 1WWXA 2ACJA 2LKPA 5BPIA 4ETSA 2DPUA 1G3WA 4WX9A 3MEXA 5D5XB 3U9GA 4LK0F 2P5VA 4KMFA 4EJOA 1F5TA 4RAZA 3MAJA 2O61A 1KGSA 4KICA 5FD6A 5L3EA 2DT5A 2A3SA 2FA5A 1U5TC 1XDSA 1LNWA 1QBJA 2IVMA 4HZFA 4XSZF 5ILVA 1T2KA 2MLKA 2PJPA 2R3SA 2R7DA 3P9IA 4L5JA 2HGCA 4KDPA 4M6XA 1IXSB 2PMHA 2EJRA 2F5EA 4EJUA 3HRMA 2VOPA 2P7CB 3CO6C 4LB6B 2VODA 2GZWA 5HS8A 4BHCA 1W7PA 4JK1X 3L00A 4LG0B 2GQQA 4YIIA 2ZJ2A 1LEBA 1RUOA 2FNAA 2V6CA 1LDJA 3KP7A 2PQ8A 4ESBA 2RN7A 3IHUA 3WE3A 4KNYA 5LEKA 2IW5A 4P96A 1K78B 2WWYA 2COMA 5IT9Z 3D0SA 1MZBA 3JTHA 3K1NA 3KFWX 1Z6TA 3TO6A 1D3YA 3M7GA 1OMIA 3CDHA 5BS6A 2RNJA 3H3ZA 4XLNF 1GVJA 3TKYA 1TW2A 3GFMA 1RNLA 4U0YA 3HRUA 1MDMB 4I7HA 2QM3A 1P4WA 4M9SA 4G7OF 2G7HA 3ZQ7A 3EYYA 1SFEA 3D5LA 1UB9A 6PAXA 1ULYA 1ZRFA 1IRFA 1B59A 1TNTA 5DUKA 1IUYA 3TDUC 2W25A 3QU6A 3IWZA 4WXHA 3IL2A 5F1RA 2LNBA 2QQ9A 4Z2YA 2IA1A 2QVOA 2VN2A 5CYVA 1IN7A 2DAOA 1KQ9A 2EFWA 4AIKA 4Q5SF 4BHBA 3I58A 4O5VA 3FMQA 3KEOA 1I1GA 2KRFA 4L9VA 1USTA 2OQGA 5LGNA 3M1EA 3LFKA 2VOOA 2HQNA 2IRFG 2A61A 4IPAA 3E3VA 2X0LA 5IT3A 5J8CA 2DO7A 5DV5A 4HX4A 4A6EA 4HX7A 1FT9A 4MTEA 1KU7A 2Z5UA 3TGNA 3ZMTA 3SHFA 1O3TA 3N97A 4ZH4F 2O6GE 1YO5C 2CFXA 2M87A 2P5KA 4OINF 2RC4A 4ENKA 1G3YA 3K1MA 4OOIA 2XAQA 5TRDA 2ZBKA 1DPRA 4HOBA 3I54A 1MJAA 2QBYA 3RKYA 4M73A 4B8XA 3CUQA 5H6RA 4U7DA 5D6FA 2J5OA 1YS7A 1F9NA 2VBYA 1Z7UA 3WG9A 4HDUA 2FE3A 1OYIA 2XV4S 1BC7C 4Y13A 2X4HA 1J0RA 5DD4A 1KU9A 1YTYA 4PCQA 2AS5F 4HQMA 1LEAA 1F4KA 1YW7A 2ZCWA 3RYRA 2L02A 3V8KA 4ENJA 3M9AA 3L9FA 3GFIA 3I4PA 3ECOA 4AD9A 5LGUA 1FP2A 3ZPLA 2STTA 1FP1D 5DCMB 3ELKA 3KLNA 1KYZA 2W85A 4OIPF 2W57A 1MJBA 3RPUA 1TQMA 1J9IA 2F5FA 3T5XA 4LLGF 2DK5A 1EH6A 5F64A 1V4RA 4I0BA 4DNCA 1RI7A 4WK8F 2MA3A 3P9CA 5J8FA 2DU9A 3VEPA 5JHUA 3WTXC 1U3EM 1SMTA 3DV8A 1E2XA 1MJ9A 2FBKA 4Q47A 2VT2A 3DPLC 1USSA 1P6RA 3KLOA 2Q8KA 2CGPA 3VOEA 3TDZC 5HS7A 1T0FA 1U5TA 1JE8A 3J81K 5HS9A 2FMYA 4AVPA 4P9FA 3BP8A 2A6HF 5D5UB 1S3JA 4M6YA 4OMYA 3BDDA 1G4DA 3BJOA 1HBXG 3ZMVA 1FBSA 1FYLA 1IXCA 2V1UA 2A07F 3E6CC 3V7SA 4CICA 3HHHA 3FZVA 3E6DA 4MNUA 2L4MA 3P7NA 1EH7A 4A12A 3K2ZA 2LDUA 3F8MA 4CYDA 3T0YA 3WTUC 1PP7U 2L01A 3CO7C 5HOOA 3QOPA 3FHZA 2XVCA 3FXUA 5DD8A 4R8HA 4HQEA 3DEUA 1P4AA 3I59A 5DDGA 5D6EA 2ELHA 2IA0A 2DQRA 1H0MA 2A69F 3GEZA 5F6FA 2ZXJA 5LEJA 3MWMA 3H3UA 1D5VA 3DXJF 1S7OA 3O2PE 4O3MA 3EYIA 3QP6A 1TQIA 1OKRA 4P5OA 1Z6RA 2CW0F 5E1XA 4EQQA 1D8KA 5K5QA 1BIBA 2H6BA 3LA3A 2RQPA 5E20A 2P6SA 2XIGA 3LQRA 3L7WA 4YFNF 2W24A 4NQWA 3C7JA 1BJAA 2BGCA 3L09A 3BOQA 5JVTA 1QZZA 1XGMA 4ESFA 4OIRF 3EQLF 3BWGA 2B0LA 4EGYA 2KKOA 2QQAA 2K86A 2GA1A 3WTYC 4XSXF 1K79A 2L4AA 4HAMA 2C6YA 1XSDA 2ZKZA 4ZYHA 3KP6A 2ADUA 4RB0A 2EFNA 2FU4A 3B73A 2OD5A 4NHJA 3P9KA 3C1DA 1KU3A 2XROA 2VE9A 3F8CA 4RGXA 3EDPA 1LDDA 4BXUA 5E8IA 4ENNA 2ZMEA 3GX4X 3V7CA 1OR7A 2H6CA 4CZZA 2M1BA 5DUIA 4G6DA 4M71A 1YQAA 1R00A 2VBWA 2QQBA 1UHWA 4FT8A 4HF0A 4UNOA 2A6EF 1B4AA 5L3CA 1W7PB 4KIGA 3WU0A 4ZZLA 2L54A 2NAZA 1PDNC 1FOKA 1J5YA 1YG2A 2YX4A 1RUNA 1ODDA 4CO8A 3ULQB 3GVAA 3JTGA 4ASNA 4UHTA 2V1DA 2YX7A 4KN4X 3ZMZA 2FBIA 2DTRA 3LA2A 3ML6A 2HR3A 1FLIA 1QQIA 3BPXA 1V3FA 1U8RA 4HW0A 3K0LA 2TDXA 3FXQA 1FSEA 3TO9A 2OZUA 1RZ4A 3KEQA 4CDGA 5K5OA 5ILUA 2ISZA 4A2UA 4GCVA 5CVIA 5L3BA 4PDKA 3REOA 3C3WA 1EV7A 1B9MA 3WGIA 2DW4A 3E97A 5FFZA 4IRHA 4IRIA 1IW7F 2NS0A 2HKXA 1ZYRF 4A0ZA 5HLGA 3SZTA 3Q9SA 1TQPA 3ZN0A 5LHGA 1SD5A 4S04A 4L0ZB 4HV5A 1ZN2A 4MEYF 4HLXA 4OIQF 1T38A 5H20A 5LBQA 2O03A 2VBXA 4GGGA 3F21A 1A04A 2E7XA 4WXDA 3ABUA 3VB2A 3GO5A 1J75A 2E1NA 2JSCA 2G7UA 3Q5FA 4LLNA 2PMUA 5LRSA 4OIOF 3V8LA 3LA7A 3BJAA 2ESNA 5D8LB 4EM1A 3F72A 2V9VA 2DFIA 3GW2A 2HFHA 1R5HA 3FXRA 2GWRA 2HWVA 3ZMSA 3GXOA 2K4JA 1ZH5A 5A2QK 5E18F 3U1DA 3LSTA 3O3KA 2PEXA 3DFGA 1R5GA 3CUOA 3CJNA 2M30A 5ED4A 2E1CA 4IVNA 3GZ5A 3W6JB 1K7AA 2K7LA 2ZNYA 4UXNA 1XGSA 2PN6A 4Q4ZF 1R58A 3R60A 5CVRA 4UV8A 3JSOA 1Y0UA 4K2EA 2XAFA 4AWXB 2RVCA 2M5WA 3KP4A 5D4SA 4Q48A 1Z91A 3K9TA 1E17A 2KIMA 1K6OA 3ZMUA 4LG0A 2CWEA 1KA8A 5ICGA 2H94A 4WWCA 3NEUA 2PG4A 1O7LA 2QZ8A 4BAYA 1HSTA 4BHPA 4A5NA 4U0VA 4RB2C 1K78A 3GYHX 2OU2A 3F6OA 3DPTA 3JW4A 1O3QA 2OA4A 2WV0A 5LHIA 4MQVA 1L3LA 4LMYA 2D2WA 3F22A 2DBBA 1ZAOA 3LQQA 5E17F 4M74A 2IP2A 2M45A 1YFHA 2XAGA 1ZHFA 3BPVA 2WC2A 4LFUA 2MH9A 3QRFF 1HQCA 1MDMA 1FX7A 4ZYEA 1IN8A 3LAJA 2P5LC 5E1ZB 2HOEA 5ICCA 2P7VB 1IN6A 3OV8A 2Z9OA 2CO5A 3LWFA 3AAFA 2HDCA 5EEHA 2K4BA 5JFRA 2GXGA 3KZZA 3J81Z 2EV6A 1SD4A 5AIPA 3JAMK 2FBHA 1OYYA 4EJTA 3VODA 2RGVA 4L9JA 4N9HA 1JHFA 4P55A 2Z33A 4CGZA 4HBLA 2NYXA 4G7HF 1PP8F 3HHGA 2FNPA 3ZMDA 1SFXA 2V79A 3IKTA 4GO1A 3WTVC 3BZ6A 2J5PA 1NHAA 1ZG3A 1FWZA 3HRTA 1JXSA 2XKPA 1ZGJA 2Y0MA 4EM2A 3M8FA 2QWWA 5BOXA 2G9WA 4N0BA 1HW2A 3KZYA 4U0WA 1QNTA 1WKMA 3IRRA 1HKTA 1W5TA 2XUBA 3SZPA 2QUFA 1LDKB 4Y17A 1CF7B 1SFUA 4A6DA 1Z9CA 1I1SA 4UV9A 5KVRA 4MTDA 4G9YA 4QWQA 4KUMA 3T1BA 1SAXA 2VXZA 1B6AA 1BC8C 2IT0A 2UZKA 1W7PD 2FXAA 3RKXA 4G8XA 1BBYA 1HW5A 5DYMA 4FX0A 4QLCU 1O57A 2QYOA 2RDPA 3I71A 3E5QA 3E5UA 4I98B 3DP7A 2FRHA 3NRVA 4XRFA 2BBYA 2FMLA 3FWEA 1G6NA 5DCMA 5AONA 2D1VA 2O3FA 1U6GA 1QGPA 4YG2F 2E7WA 1KQ0A 1W5SA 5J6XA 3HYIA 1O3SA 3N4MA 1IN5A 1HKQA 2MC3A 5HDNA 3QAHA 4L18B 3HRSA 3ECHA 3J7AO 4MHGA 5FGMA 5HLHA 5LRRA 1AWCA 1REPC 3PQJA 2EFQA 2Q0OA 5K1YA 3RJPA 4F7ZA 1F1ZA 1VTNC 5ICEA 3HUGA 2NNYA 2PI0A 1R23A 3I5UA 3FX3A 5CVUA 4RS8A 1R22A 1GXQA 3WGHA 4UVCA 3E6BA 2DLLA 3EETA 2XASA 2YPRA 1B1BA 2STWA 2HQRA 3G3ZA 4IXAA 4WF2A 3KP2A 5L3DA 1HKSA 5D8KB 1ZG1A 1BOAA 1BI2A 5BMZA 4A5MA 2YU3A 3HTSB 1OPCA 4G94A 1LQ1A 1XSVA 3CTAA 3SQNA 2JPBA 3CLOA 4ON0A 4P9UA 5BQTA 2OAZA 1D8JA 2JPCA 2ZFWA 4NB5A 3RYPA 2EA4A 5CVJA 1S29A 5FB2A 3TOBA 1UHMA 2UXNA 3ERED 3IC7A 4HLYA 2HYFA 4EJWA 4I09A 1YYVA 2RV8A 4MEXF 2LSOA 3WTSC 3GLXA 3F8NA 3MZYA 1S6LA 1S8NA 1QO0D 5H6QA 1FBQA 4L9NA 1H9TA 5LHHA 3O6BB 2P6TA 3K1PA 4H0EA 2BEOA 2WTEA 4PGGA 3GF2A 1L0OC 5HDKA 3WTZA 3TQNA 1YW9A 3PQKA 2W84A 4ZYGA 2DK8A 1ZRCA 1IAWA 3ABTA 4RGUA 2MBFA 1IN4A 1Z05A 2HZTA 1JGSA 5FO5A 5LLQA 3R61A 3GFJA 2QLZA 4HF1A 2V1XA 2VONA 3MFKA 2GAUA 4LB5A 4MQ9F 2IA2A 5FFXA 3WODF 2RKHA 1U78A 1TNSA 1LJ9A 5FLXK 1PUEE 2XKOA 4RAYA 4I01A 1MGTA 5A2QZ 1DP7P 2ZNZA 3LAPA 1WRJA 2VBZA 1TLHB 3HIFA 4M9ZA 1IZ1A 1STZA 2GA2A 1ON2A 3B02A 1S7AA 2GIVA 3E6MA 2EFPA 1R1TA 4EVIA 1H9GA 3RI4A 2CSOA 1EH8A 3EUHA 2FEZA 1YIOA 2BYVE 1W4MA 3R0AA 4ZZDA 1KU2A 5ICFA 4L5IA 5L3FA 2P4WA 4O6JA 3HSRA 2F2EA 4U88A 2Z3YA 1ZREA 5FD5A 4LD5A 4RGRA 2BV6A 1XSXA 1LB2A 5LGTA 1R36A 1BI1A 4IF4A 1DUXC 1ZLKA 4YFXF 2K27A 4I2OA 4WXCA 3MCZA 1J7KA 3V4GA 2L3DA 2FF4A 4KN7X 1SD7A 2KJCA 1AOYA 4RB3C 4AIJA 3COAC 2EV5A 2XAJA 5HVQC 2QBYB 1UCRA 4AIHA 3CUQB 3HTUA 2BE5F 3MZHA 3KETA 4KIBA 3OOPA 5TJJA 3IWFA 3J80Z 3GZ6A 1FPQA 1XGNA 1B9NA 2XGXA 4KYWA 1XCBA 4XBFA 4R79A 2R7FA 2HEOA 1BN5A 3F3XA 1XGOA 2OZ6A 2KIUA 3FM3A 4HA8A 3RDIA 3KE2A 1KYWA 1WQ2A 3KCCA 1BM9A 1ZGAA 1XMKA 5D5WB 5IT9K 2XAHA 2PBIA 3JAMZ 2DQLA 5BPDA 1IF1A 2ESHA 2HYGD 4KA4A 2EWNA 4KFCA 2JRTA 4ESJA 2A5YB 4E70A 1MKMA 2JT1A 5E8GA 3HOTA 4CXFA 2KJBA 3MQ0A 4S05A 3BROA 2DPDA 2FSWA 1ZG5A 1OYWA 1XMAA 3U2RA 2MLGA 1FNNA 1ZRDA 3JSPA 1JHHA 2M8EA 3J80K 2EV0A 2CYYA 4XLPF 3RTRA 3I64A 4OU0A 4EV0A 1XB4A 2LF8A 3HOSA 1FY7A 2O0YA 2HTSA 1FZPB 1U5TB 3HSEA 4JQFA 1P2FA 4PZJA 5JR3A 4EM0B 4HX8A 4IJAA 3KP3A 2NNNA 1XDUA 3I0TA 1I27A 2Y48A 2ISYA 4L0YB 4FX4A 2D1HA 3F6VA 4UUVA 2UXXA 4B09A 4LJZF 3F23A 4HF2A 3WTWC 4GYIA 2HKOA 1BI3A 3ROUA 1P92A 4HDVA 3GFLA 3KP5A 1KQ8A 1QPMA 3SFZA 4WCGA 2Y75A 5CLSA 2D45A 3QP5A 2CQKA 1HW1A 3TOAA 3I59B 3F8BA 1O7FA 1FYKA 1U2WA 1RIOH 4G7ZF 1GHCA 1SMYF 4N9IA 2EA2A 1ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGW A;  1LVA A;  2QEN A;  5EEG A;  2XHK A;  4MGR A;  3V7R A;  2OQR A;  3RKW A;  2NRA C;  2ETH A;  4KT5 C;  4IHT A;  1TBX A;  3HSF A;  3ZN1 A;  1R7J A;  3V8J A;  3VFZ A;  1YLF A;  4LK1 F;  5CJ9 A;  1XN7 A;  1I5Z A;  1Z1D A;  1FSH A;  4DQ2 A;  4U7B A;  3K69 A;  5K5R A;  2EK5 A;  4HYE A;  3T8T A;  4LLL A;  1DDN A;  2HTJ A;  4I0A A;  3GUD A;  5HLI A;  1WI9 A;  5DCF A;  2HS5 A;  4PGH A;  2CG4 A;  3I53 A;  1CGP A;  3GWZ A;  2A68 F;  2GXB A;  1GXP A;  4BNC A;  3T8R A;  4EMS A;  2AXL A;  3FMS A;  3Q9V A;  3R6S A;  1P4X A;  2JTV A;  4A0X A;  2KIF A;  1HSJ A;  2IPQ X;  1IRG A;  2Z99 A;  3BY6 A;  2F5D A;  1XCV A;  4A0Y A;  5DEQ A;  2LF7 A;  4EJV A;  2P8T A;  2YSR A;  2JZY A;  4GXO A;  3QPH A;  4FHT A;  3F8F A;  1MD0 A;  1G3S A;  3S2W A;  2H27 A;  1FBU A;  1HXD A;  4BH9 A;  1O3R A;  1QZY A;  3DKW A;  2VC1 A;  3FM5 A;  2ZME B;  1IXR C;  3R4K A;  1FC3 A;  4L9T A;  3IKV A;  3BJ6 A;  3W6K B;  4YIF A;  4EGZ A;  2YR2 A;  3M8E A;  2VC0 A;  2UWM A;  1ONV A;  1XD7 A;  3DQV C;  1BI0 A;  2MD5 A;  3WTT C;  5ILS A;  4RB1 A;  1R1U A;  4YFK F;  1CF7 A;  4OMZ A;  4KIF A;  5HDG A;  1X3U A;  2XRN A;  1YW8 A;  1TW3 A;  2EB7 A;  1J2X A;  2VT3 A;  3G73 A;  3E5X A;  4KMU X;  1BIA A;  3ZP5 A;  3ISP A;  5AIQ A;  2IJL A;  1ZLJ A;  4JBA A;  3QU3 A;  2F5C A;  4UVA A;  3WGG A;  2O8X A;  4Y15 A;  4TV7 A;  5ERI A;  5E1W A;  2PFB A;  4HV6 A;  1TTY A;  1YS6 A;  3CUQ C;  1I6X A;  1ZAR A;  2OBP A;  3SXY A;  1J59 A;  1DPU A;  3DF8 A;  5JI6 A;  1Q1H A;  1UFM A;  1FYM A;  5D4R A;  4ENM A;  3IRQ A;  4I02 A;  4BQA A;  4GYG A;  5KK1 A;  2H09 A;  4D0P A;  2VE8 A;  4M9X A;  5FLX Z;  4IHS A;  1T6S A;  3H92 A;  4R1H A;  1WSU A;  2MH2 A;  3FMR A;  1G3T A;  4M72 A;  3PFI A;  2DI3 A;  4G6Q A;  3TO7 A;  5L3G A;  2PLY A;  4IRG A;  2ZO4 A;  3NQO A;  5CVV A;  2FOK A;  3RPQ A;  3C18 A;  2Q2E A;  3RIR A;  1C0W A;  4ZYD A;  3FF5 A;  4UVB A;  2K02 A;  4BYY A;  1SD6 A;  4CHU A;  3R0J A;  3QPT A;  5D5V B;  1T39 A;  3L2C A;  1R1V A;  3WE2 A;  2EFO A;  4RGS A;  3WU1 B;  2FQ3 A;  1T98 A;  1WWX A;  2ACJ A;  2LKP A;  5BPI A;  4ETS A;  2DPU A;  1G3W A;  4WX9 A;  3MEX A;  5D5X B;  3U9G A;  4LK0 F;  2P5V A;  4KMF A;  4EJO A;  1F5T A;  4RAZ A;  3MAJ A;  2O61 A;  1KGS A;  4KIC A;  5FD6 A;  5L3E A;  2DT5 A;  2A3S A;  2FA5 A;  1U5T C;  1XDS A;  1LNW A;  1QBJ A;  2IVM A;  4HZF A;  4XSZ F;  5ILV A;  1T2K A;  2MLK A;  2PJP A;  2R3S A;  2R7D A;  3P9I A;  4L5J A;  2HGC A;  4KDP A;  4M6X A;  1IXS B;  2PMH A;  2EJR A;  2F5E A;  4EJU A;  3HRM A;  2VOP A;  2P7C B;  3CO6 C;  4LB6 B;  2VOD A;  2GZW A;  5HS8 A;  4BHC A;  1W7P A;  4JK1 X;  3L00 A;  4LG0 B;  2GQQ A;  4YII A;  2ZJ2 A;  1LEB A;  1RUO A;  2FNA A;  2V6C A;  1LDJ A;  3KP7 A;  2PQ8 A;  4ESB A;  2RN7 A;  3IHU A;  3WE3 A;  4KNY A;  5LEK A;  2IW5 A;  4P96 A;  1K78 B;  2WWY A;  2COM A;  5IT9 Z;  3D0S A;  1MZB A;  3JTH A;  3K1N A;  3KFW X;  1Z6T A;  3TO6 A;  1D3Y A;  3M7G A;  1OMI A;  3CDH A;  5BS6 A;  2RNJ A;  3H3Z A;  4XLN F;  1GVJ A;  3TKY A;  1TW2 A;  3GFM A;  1RNL A;  4U0Y A;  3HRU A;  1MDM B;  4I7H A;  2QM3 A;  1P4W A;  4M9S A;  4G7O F;  2G7H A;  3ZQ7 A;  3EYY A;  1SFE A;  3D5L A;  1UB9 A;  6PAX A;  1ULY A;  1ZRF A;  1IRF A;  1B59 A;  1TNT A;  5DUK A;  1IUY A;  3TDU C;  2W25 A;  3QU6 A;  3IWZ A;  4WXH A;  3IL2 A;  5F1R A;  2LNB A;  2QQ9 A;  4Z2Y A;  2IA1 A;  2QVO A;  2VN2 A;  5CYV A;  1IN7 A;  2DAO A;  1KQ9 A;  2EFW A;  4AIK A;  4Q5S F;  4BHB A;  3I58 A;  4O5V A;  3FMQ A;  3KEO A;  1I1G A;  2KRF A;  4L9V A;  1UST A;  2OQG A;  5LGN A;  3M1E A;  3LFK A;  2VOO A;  2HQN A;  2IRF G;  2A61 A;  4IPA A;  3E3V A;  2X0L A;  5IT3 A;  5J8C A;  2DO7 A;  5DV5 A;  4HX4 A;  4A6E A;  4HX7 A;  1FT9 A;  4MTE A;  1KU7 A;  2Z5U A;  3TGN A;  3ZMT A;  3SHF A;  1O3T A;  3N97 A;  4ZH4 F;  2O6G E;  1YO5 C;  2CFX A;  2M87 A;  2P5K A;  4OIN F;  2RC4 A;  4ENK A;  1G3Y A;  3K1M A;  4OOI A;  2XAQ A;  5TRD A;  2ZBK A;  1DPR A;  4HOB A;  3I54 A;  1MJA A;  2QBY A;  3RKY A;  4M73 A;  4B8X A;  3CUQ A;  5H6R A;  4U7D A;  5D6F A;  2J5O A;  1YS7 A;  1F9N A;  2VBY A;  1Z7U A;  3WG9 A;  4HDU A;  2FE3 A;  1OYI A;  2XV4 S;  1BC7 C;  4Y13 A;  2X4H A;  1J0R A;  5DD4 A;  1KU9 A;  1YTY A;  4PCQ A;  2AS5 F;  4HQM A;  1LEA A;  1F4K A;  1YW7 A;  2ZCW A;  3RYR A;  2L02 A;  3V8K A;  4ENJ A;  3M9A A;  3L9F A;  3GFI A;  3I4P A;  3ECO A;  4AD9 A;  5LGU A;  1FP2 A;  3ZPL A;  2STT A;  1FP1 D;  5DCM B;  3ELK A;  3KLN A;  1KYZ A;  2W85 A;  4OIP F;  2W57 A;  1MJB A;  3RPU A;  1TQM A;  1J9I A;  2F5F A;  3T5X A;  4LLG F;  2DK5 A;  1EH6 A;  5F64 A;  1V4R A;  4I0B A;  4DNC A;  1RI7 A;  4WK8 F;  2MA3 A;  3P9C A;  5J8F A;  2DU9 A;  3VEP A;  5JHU A;  3WTX C;  1U3E M;  1SMT A;  3DV8 A;  1E2X A;  1MJ9 A;  2FBK A;  4Q47 A;  2VT2 A;  3DPL C;  1USS A;  1P6R A;  3KLO A;  2Q8K A;  2CGP A;  3VOE A;  3TDZ C;  5HS7 A;  1T0F A;  1U5T A;  1JE8 A;  3J81 K;  5HS9 A;  2FMY A;  4AVP A;  4P9F A;  3BP8 A;  2A6H F;  5D5U B;  1S3J A;  4M6Y A;  4OMY A;  3BDD A;  1G4D A;  3BJO A;  1HBX G;  3ZMV A;  1FBS A;  1FYL A;  1IXC A;  2V1U A;  2A07 F;  3E6C C;  3V7S A;  4CIC A;  3HHH A;  3FZV A;  3E6D A;  4MNU A;  2L4M A;  3P7N A;  1EH7 A;  4A12 A;  3K2Z A;  2LDU A;  3F8M A;  4CYD A;  3T0Y A;  3WTU C;  1PP7 U;  2L01 A;  3CO7 C;  5HOO A;  3QOP A;  3FHZ A;  2XVC A;  3FXU A;  5DD8 A;  4R8H A;  4HQE A;  3DEU A;  1P4A A;  3I59 A;  5DDG A;  5D6E A;  2ELH A;  2IA0 A;  2DQR A;  1H0M A;  2A69 F;  3GEZ A;  5F6F A;  2ZXJ A;  5LEJ A;  3MWM A;  3H3U A;  1D5V A;  3DXJ F;  1S7O A;  3O2P E;  4O3M A;  3EYI A;  3QP6 A;  1TQI A;  1OKR A;  4P5O A;  1Z6R A;  2CW0 F;  5E1X A;  4EQQ A;  1D8K A;  5K5Q A;  1BIB A;  2H6B A;  3LA3 A;  2RQP A;  5E20 A;  2P6S A;  2XIG A;  3LQR A;  3L7W A;  4YFN F;  2W24 A;  4NQW A;  3C7J A;  1BJA A;  2BGC A;  3L09 A;  3BOQ A;  5JVT A;  1QZZ A;  1XGM A;  4ESF A;  4OIR F;  3EQL F;  3BWG A;  2B0L A;  4EGY A;  2KKO A;  2QQA A;  2K86 A;  2GA1 A;  3WTY C;  4XSX F;  1K79 A;  2L4A A;  4HAM A;  2C6Y A;  1XSD A;  2ZKZ A;  4ZYH A;  3KP6 A;  2ADU A;  4RB0 A;  2EFN A;  2FU4 A;  3B73 A;  2OD5 A;  4NHJ A;  3P9K A;  3C1D A;  1KU3 A;  2XRO A;  2VE9 A;  3F8C A;  4RGX A;  3EDP A;  1LDD A;  4BXU A;  5E8I A;  4ENN A;  2ZME A;  3GX4 X;  3V7C A;  1OR7 A;  2H6C A;  4CZZ A;  2M1B A;  5DUI A;  4G6D A;  4M71 A;  1YQA A;  1R00 A;  2VBW A;  2QQB A;  1UHW A;  4FT8 A;  4HF0 A;  4UNO A;  2A6E F;  1B4A A;  5L3C A;  1W7P B;  4KIG A;  3WU0 A;  4ZZL A;  2L54 A;  2NAZ A;  1PDN C;  1FOK A;  1J5Y A;  1YG2 A;  2YX4 A;  1RUN A;  1ODD A;  4CO8 A;  3ULQ B;  3GVA A;  3JTG A;  4ASN A;  4UHT A;  2V1D A;  2YX7 A;  4KN4 X;  3ZMZ A;  2FBI A;  2DTR A;  3LA2 A;  3ML6 A;  2HR3 A;  1FLI A;  1QQI A;  3BPX A;  1V3F A;  1U8R A;  4HW0 A;  3K0L A;  2TDX A;  3FXQ A;  1FSE A;  3TO9 A;  2OZU A;  1RZ4 A;  3KEQ A;  4CDG A;  5K5O A;  5ILU A;  2ISZ A;  4A2U A;  4GCV A;  5CVI A;  5L3B A;  4PDK A;  3REO A;  3C3W A;  1EV7 A;  1B9M A;  3WGI A;  2DW4 A;  3E97 A;  5FFZ A;  4IRH A;  4IRI A;  1IW7 F;  2NS0 A;  2HKX A;  1ZYR F;  4A0Z A;  5HLG A;  3SZT A;  3Q9S A;  1TQP A;  3ZN0 A;  5LHG A;  1SD5 A;  4S04 A;  4L0Z B;  4HV5 A;  1ZN2 A;  4MEY F;  4HLX A;  4OIQ F;  1T38 A;  5H20 A;  5LBQ A;  2O03 A;  2VBX A;  4GGG A;  3F21 A;  1A04 A;  2E7X A;  4WXD A;  3ABU A;  3VB2 A;  3GO5 A;  1J75 A;  2E1N A;  2JSC A;  2G7U A;  3Q5F A;  4LLN A;  2PMU A;  5LRS A;  4OIO F;  3V8L A;  3LA7 A;  3BJA A;  2ESN A;  5D8L B;  4EM1 A;  3F72 A;  2V9V A;  2DFI A;  3GW2 A;  2HFH A;  1R5H A;  3FXR A;  2GWR A;  2HWV A;  3ZMS A;  3GXO A;  2K4J A;  1ZH5 A;  5A2Q K;  5E18 F;  3U1D A;  3LST A;  3O3K A;  2PEX A;  3DFG A;  1R5G A;  3CUO A;  3CJN A;  2M30 A;  5ED4 A;  2E1C A;  4IVN A;  3GZ5 A;  3W6J B;  1K7A A;  2K7L A;  2ZNY A;  4UXN A;  1XGS A;  2PN6 A;  4Q4Z F;  1R58 A;  3R60 A;  5CVR A;  4UV8 A;  3JSO A;  1Y0U A;  4K2E A;  2XAF A;  4AWX B;  2RVC A;  2M5W A;  3KP4 A;  5D4S A;  4Q48 A;  1Z91 A;  3K9T A;  1E17 A;  2KIM A;  1K6O A;  3ZMU A;  4LG0 A;  2CWE A;  1KA8 A;  5ICG A;  2H94 A;  4WWC A;  3NEU A;  2PG4 A;  1O7L A;  2QZ8 A;  4BAY A;  1HST A;  4BHP A;  4A5N A;  4U0V A;  4RB2 C;  1K78 A;  3GYH X;  2OU2 A;  3F6O A;  3DPT A;  3JW4 A;  1O3Q A;  2OA4 A;  2WV0 A;  5LHI A;  4MQV A;  1L3L A;  4LMY A;  2D2W A;  3F22 A;  2DBB A;  1ZAO A;  3LQQ A;  5E17 F;  4M74 A;  2IP2 A;  2M45 A;  1YFH A;  2XAG A;  1ZHF A;  3BPV A;  2WC2 A;  4LFU A;  2MH9 A;  3QRF F;  1HQC A;  1MDM A;  1FX7 A;  4ZYE A;  1IN8 A;  3LAJ A;  2P5L C;  5E1Z B;  2HOE A;  5ICC A;  2P7V B;  1IN6 A;  3OV8 A;  2Z9O A;  2CO5 A;  3LWF A;  3AAF A;  2HDC A;  5EEH A;  2K4B A;  5JFR A;  2GXG A;  3KZZ A;  3J81 Z;  2EV6 A;  1SD4 A;  5AIP A;  3JAM K;  2FBH A;  1OYY A;  4EJT A;  3VOD A;  2RGV A;  4L9J A;  4N9H A;  1JHF A;  4P55 A;  2Z33 A;  4CGZ A;  4HBL A;  2NYX A;  4G7H F;  1PP8 F;  3HHG A;  2FNP A;  3ZMD A;  1SFX A;  2V79 A;  3IKT A;  4GO1 A;  3WTV C;  3BZ6 A;  2J5P A;  1NHA A;  1ZG3 A;  1FWZ A;  3HRT A;  1JXS A;  2XKP A;  1ZGJ A;  2Y0M A;  4EM2 A;  3M8F A;  2QWW A;  5BOX A;  2G9W A;  4N0B A;  1HW2 A;  3KZY A;  4U0W A;  1QNT A;  1WKM A;  3IRR A;  1HKT A;  1W5T A;  2XUB A;  3SZP A;  2QUF A;  1LDK B;  4Y17 A;  1CF7 B;  1SFU A;  4A6D A;  1Z9C A;  1I1S A;  4UV9 A;  5KVR A;  4MTD A;  4G9Y A;  4QWQ A;  4KUM A;  3T1B A;  1SAX A;  2VXZ A;  1B6A A;  1BC8 C;  2IT0 A;  2UZK A;  1W7P D;  2FXA A;  3RKX A;  4G8X A;  1BBY A;  1HW5 A;  5DYM A;  4FX0 A;  4QLC U;  1O57 A;  2QYO A;  2RDP A;  3I71 A;  3E5Q A;  3E5U A;  4I98 B;  3DP7 A;  2FRH A;  3NRV A;  4XRF A;  2BBY A;  2FML A;  3FWE A;  1G6N A;  5DCM A;  5AON A;  2D1V A;  2O3F A;  1U6G A;  1QGP A;  4YG2 F;  2E7W A;  1KQ0 A;  1W5S A;  5J6X A;  3HYI A;  1O3S A;  3N4M A;  1IN5 A;  1HKQ A;  2MC3 A;  5HDN A;  3QAH A;  4L18 B;  3HRS A;  3ECH A;  3J7A O;  4MHG A;  5FGM A;  5HLH A;  5LRR A;  1AWC A;  1REP C;  3PQJ A;  2EFQ A;  2Q0O A;  5K1Y A;  3RJP A;  4F7Z A;  1F1Z A;  1VTN C;  5ICE A;  3HUG A;  2NNY A;  2PI0 A;  1R23 A;  3I5U A;  3FX3 A;  5CVU A;  4RS8 A;  1R22 A;  1GXQ A;  3WGH A;  4UVC A;  3E6B A;  2DLL A;  3EET A;  2XAS A;  2YPR A;  1B1B A;  2STW A;  2HQR A;  3G3Z A;  4IXA A;  4WF2 A;  3KP2 A;  5L3D A;  1HKS A;  5D8K B;  1ZG1 A;  1BOA A;  1BI2 A;  5BMZ A;  4A5M A;  2YU3 A;  3HTS B;  1OPC A;  4G94 A;  1LQ1 A;  1XSV A;  3CTA A;  3SQN A;  2JPB A;  3CLO A;  4ON0 A;  4P9U A;  5BQT A;  2OAZ A;  1D8J A;  2JPC A;  2ZFW A;  4NB5 A;  3RYP A;  2EA4 A;  5CVJ A;  1S29 A;  5FB2 A;  3TOB A;  1UHM A;  2UXN A;  3ERE D;  3IC7 A;  4HLY A;  2HYF A;  4EJW A;  4I09 A;  1YYV A;  2RV8 A;  4MEX F;  2LSO A;  3WTS C;  3GLX A;  3F8N A;  3MZY A;  1S6L A;  1S8N A;  1QO0 D;  5H6Q A;  1FBQ A;  4L9N A;  1H9T A;  5LHH A;  3O6B B;  2P6T A;  3K1P A;  4H0E A;  2BEO A;  2WTE A;  4PGG A;  3GF2 A;  1L0O C;  5HDK A;  3WTZ A;  3TQN A;  1YW9 A;  3PQK A;  2W84 A;  4ZYG A;  2DK8 A;  1ZRC A;  1IAW A;  3ABT A;  4RGU A;  2MBF A;  1IN4 A;  1Z05 A;  2HZT A;  1JGS A;  5FO5 A;  5LLQ A;  3R61 A;  3GFJ A;  2QLZ A;  4HF1 A;  2V1X A;  2VON A;  3MFK A;  2GAU A;  4LB5 A;  4MQ9 F;  2IA2 A;  5FFX A;  3WOD F;  2RKH A;  1U78 A;  1TNS A;  1LJ9 A;  5FLX K;  1PUE E;  2XKO A;  4RAY A;  4I01 A;  1MGT A;  5A2Q Z;  1DP7 P;  2ZNZ A;  3LAP A;  1WRJ A;  2VBZ A;  1TLH B;  3HIF A;  4M9Z A;  1IZ1 A;  1STZ A;  2GA2 A;  1ON2 A;  3B02 A;  1S7A A;  2GIV A;  3E6M A;  2EFP A;  1R1T A;  4EVI A;  1H9G A;  3RI4 A;  2CSO A;  1EH8 A;  3EUH A;  2FEZ A;  1YIO A;  2BYV E;  1W4M A;  3R0A A;  4ZZD A;  1KU2 A;  5ICF A;  4L5I A;  5L3F A;  2P4W A;  4O6J A;  3HSR A;  2F2E A;  4U88 A;  2Z3Y A;  1ZRE A;  5FD5 A;  4LD5 A;  4RGR A;  2BV6 A;  1XSX A;  1LB2 A;  5LGT A;  1R36 A;  1BI1 A;  4IF4 A;  1DUX C;  1ZLK A;  4YFX F;  2K27 A;  4I2O A;  4WXC A;  3MCZ A;  1J7K A;  3V4G A;  2L3D A;  2FF4 A;  4KN7 X;  1SD7 A;  2KJC A;  1AOY A;  4RB3 C;  4AIJ A;  3COA C;  2EV5 A;  2XAJ A;  5HVQ C;  2QBY B;  1UCR A;  4AIH A;  3CUQ B;  3HTU A;  2BE5 F;  3MZH A;  3KET A;  4KIB A;  3OOP A;  5TJJ A;  3IWF A;  3J80 Z;  3GZ6 A;  1FPQ A;  1XGN A;  1B9N A;  2XGX A;  4KYW A;  1XCB A;  4XBF A;  4R79 A;  2R7F A;  2HEO A;  1BN5 A;  3F3X A;  1XGO A;  2OZ6 A;  2KIU A;  3FM3 A;  4HA8 A;  3RDI A;  3KE2 A;  1KYW A;  1WQ2 A;  3KCC A;  1BM9 A;  1ZGA A;  1XMK A;  5D5W B;  5IT9 K;  2XAH A;  2PBI A;  3JAM Z;  2DQL A;  5BPD A;  1IF1 A;  2ESH A;  2HYG D;  4KA4 A;  2EWN A;  4KFC A;  2JRT A;  4ESJ A;  2A5Y B;  4E70 A;  1MKM A;  2JT1 A;  5E8G A;  3HOT A;  4CXF A;  2KJB A;  3MQ0 A;  4S05 A;  3BRO A;  2DPD A;  2FSW A;  1ZG5 A;  1OYW A;  1XMA A;  3U2R A;  2MLG A;  1FNN A;  1ZRD A;  3JSP A;  1JHH A;  2M8E A;  3J80 K;  2EV0 A;  2CYY A;  4XLP F;  3RTR A;  3I64 A;  4OU0 A;  4EV0 A;  1XB4 A;  2LF8 A;  3HOS A;  1FY7 A;  2O0Y A;  2HTS A;  1FZP B;  1U5T B;  3HSE A;  4JQF A;  1P2F A;  4PZJ A;  5JR3 A;  4EM0 B;  4HX8 A;  4IJA A;  3KP3 A;  2NNN A;  1XDU A;  3I0T A;  1I27 A;  2Y48 A;  2ISY A;  4L0Y B;  4FX4 A;  2D1H A;  3F6V A;  4UUV A;  2UXX A;  4B09 A;  4LJZ F;  3F23 A;  4HF2 A;  3WTW C;  4GYI A;  2HKO A;  1BI3 A;  3ROU A;  1P92 A;  4HDV A;  3GFL A;  3KP5 A;  1KQ8 A;  1QPM A;  3SFZ A;  4WCG A;  2Y75 A;  5CLS A;  2D45 A;  3QP5 A;  2CQK A;  1HW1 A;  3TOA A;  3I59 B;  3F8B A;  1O7F A;  1FYK A;  1U2W A;  1RIO H;  4G7Z F;  1GHC A;  1SMY F;  4N9I A;  2EA2 A;  1ON1 A; 
#chains in the Genus database with same CATH topology
 4LGW A;  1LVA A;  5FKO A;  2QEN A;  5TGT A;  5EEG A;  1JTY A;  2L7F P;  3A0H C;  4YEJ A;  2M0M A;  2XHK A;  4MGR A;  3V7R A;  2CUZ A;  4BEH B;  3L2W A;  3PSF A;  4BE1 A;  1VQ9 I;  3C2G A;  2OQR A;  2MG4 A;  1GLN A;  3RKW A;  2NRA C;  2ETH A;  4KT5 C;  4IHT A;  1TBX A;  3W6V A;  3HSF A;  3ZN1 A;  1R7J A;  3VYS B;  4C3I J;  3H1C A;  3V8J A;  4EAT A;  5IOY A;  3VFZ A;  1YLF A;  2KQR A;  4LK1 F;  1TL8 A;  3A0B C;  5CJ9 A;  4HNU A;  2M4K A;  1XN7 A;  1I5Z A;  2E5N A;  1TWF J;  3VDX A;  5DS9 A;  3ZQH A;  2FD5 A;  1TWH J;  2AO9 A;  1Z1D A;  3SEQ A;  3OYL A;  1FSH A;  3PO2 J;  1Z77 A;  3JRE A;  1MND A;  4DQ2 A;  4IOC F;  2X48 A;  4B3A A;  4U7B A;  1BJZ A;  3K69 A;  4G12 A;  5K5R A;  1RRJ A;  3QOD A;  4OAZ A;  2EK5 A;  4HYE A;  4NQW B;  3T8T A;  4LLL A;  1DDN A;  5CPR B;  1X4P A;  2HTJ A;  3BG9 A;  3GUD A;  4I0A A;  5HLI A;  1WI9 A;  1Z3Y A;  5DCF A;  5EG0 A;  4UUS A;  3HEF A;  3HJE A;  2HI3 A;  2HS5 A;  3LSJ A;  4KIT B;  4A3E J;  4PGH A;  3OYI A;  1MH3 A;  2CG4 A;  3I53 A;  1CGP A;  3GWZ A;  2A68 F;  4BS9 A;  1GXP A;  4BNC A;  2GXB A;  4P1W A;  1VQ7 I;  3T8R A;  1H88 C;  3TL4 X;  4V2F A;  4EMS A;  3OY9 A;  2AXL A;  2DT7 B;  3CMM A;  2K40 A;  3FMS A;  3M1C A;  3Q9V A;  2WB1 N;  3R6S A;  1P4X A;  4G6T B;  4E7J A;  2JTV A;  4QSH A;  4A0X A;  1D1A A;  2KIF A;  1HSJ A;  2IPQ X;  1IRG A;  2Z99 A;  3BY6 A;  2EIJ H;  2CUE A;  2F5D A;  2V7F A;  1WJF A;  2M34 A;  2L0K A;  1XCV A;  2VJ5 A;  3PUF A;  4A0Y A;  5DEQ A;  1LUJ B;  2IS6 A;  2LF7 A;  4EJV A;  2JUG A;  2P8T A;  4XLA A;  1VQ5 I;  2YSR A;  2JZY A;  4GXO A;  3QPH A;  4FHT A;  4XID A;  2WV1 A;  3U21 A;  3WHB A;  3PJR A;  3F8F A;  1MD0 A;  1G3S A;  3S2W A;  2H27 A;  2DMT A;  1FBU A;  1HXD A;  2CQQ A;  2EPF A;  4BH9 A;  1O3R A;  1V54 H;  1SEU A;  1QZY A;  2HPM A;  3DKW A;  2VC1 A;  2D5V A;  2ZSH B;  3CME I;  1XS9 A;  3FM5 A;  2ZME B;  1DU6 A;  1IXR C;  3R4K A;  1FC3 A;  3H9Q A;  2JSP A;  2TCT A;  4L9T A;  3IKV A;  3BQY A;  3BJ6 A;  3W6K B;  4YIF A;  5EEA A;  4EGZ A;  3JR9 A;  1VQ4 I;  2YR2 A;  3M8E A;  5E3N A;  2VAS A;  2VC0 A;  2UWM A;  5C3E J;  2VI6 A;  1ONV A;  1XD7 A;  1VQN I;  2FX0 A;  3DQV C;  4XOR A;  1BI0 A;  2MD5 A;  3WTT C;  5ILS A;  4RB1 A;  3KEY A;  3OYD A;  1R1U A;  4KJZ A;  4YFK F;  1Z21 A;  1CF7 A;  4OMZ A;  4KIF A;  3ZCO A;  2XPV A;  5HDG A;  1X3U A;  2XRN A;  1G59 A;  4NDL A;  1YW8 A;  1TW3 A;  3SJM A;  2EB7 A;  3ZQF A;  1X19 A;  3FXM A;  4FIS A;  2XSJ C;  2MGQ A;  1J2X A;  4XLE A;  2VJJ A;  2VT3 A;  3D1N I;  1ENH A;  3G73 A;  3E5X A;  4PJJ A;  4KMU X;  1BIA A;  2XGC A;  2XB0 X;  3ZP5 A;  3ISP A;  1ETY A;  3QQA A;  1T56 A;  5AIQ A;  2IJL A;  3F9K A;  4ITV A;  1ZLJ A;  2PMZ N;  3BQZ A;  4AID A;  4JBA A;  3QU3 A;  4DZP A;  2F5C A;  4UVA A;  3WGG A;  2WA0 A;  2O8X A;  4Y15 A;  4C2T A;  2E35 A;  2Z16 A;  4NBQ A;  3I9V 2;  4KT6 A;  4TV7 A;  4FET A;  5ERI A;  1IC8 A;  5E1W A;  3VSL A;  1BR4 A;  2BY3 A;  2PFB A;  4HV6 A;  1TTY A;  1YS6 A;  3DBL B;  3CUQ C;  1I6X A;  1ZAR A;  4RBO A;  3H5R A;  2OBP A;  4XN3 A;  3ZQG A;  3SXY A;  3MD2 A;  1J59 A;  1DPU A;  2CH0 A;  2LFB A;  3DF8 A;  5JI6 A;  3BTL A;  1Q1H A;  3IUO A;  1GUU A;  1UFM A;  1FYM A;  5D4R A;  2CFO A;  4ENM A;  3IRQ A;  1BA5 A;  4I02 A;  4BQA A;  1BR1 A;  4GYG A;  3W2A A;  2K5C A;  2LBF B;  5KK1 A;  2H09 A;  4D0P A;  2DCE A;  2VE8 A;  4NC7 A;  4M9X A;  1YRN A;  5FLX Z;  1TWA J;  3KYC B;  2VUM J;  5IP7 J;  2WY8 Q;  4IHS A;  1T6S A;  3H92 A;  1XTA A;  1FOW A;  4R1H A;  2ZJP F;  1WSU A;  3A2K A;  2MH2 A;  4UB8 C;  3FMR A;  1G3T A;  4M72 A;  3PFI A;  2DI3 A;  1IG7 A;  4G6Q A;  2CW7 A;  3TO7 A;  5L3G A;  3LSR A;  5JHF A;  3MKW B;  2PLY A;  4IRG A;  1QPI A;  2ZO4 A;  3NQO A;  5CVV A;  2FOK A;  3RPQ A;  3C18 A;  2Q2E A;  3RIR A;  2ID3 A;  1S72 I;  3H9J A;  1C0W A;  1UG2 A;  4ZYD A;  3FF5 A;  5J1R A;  4QPO A;  4S0H B;  3PNY A;  4UVB A;  2K02 A;  4BYY A;  1SD6 A;  4CHU A;  1WH7 A;  3R0J A;  3QPT A;  5D5V B;  1T39 A;  1MH4 A;  4RLF A;  3L2C A;  2Y0S A;  1R1V A;  3B6C A;  3WE2 A;  2WY7 Q;  2RQQ A;  5GAE J;  2R0Q C;  1QA6 A;  2EFO A;  4RGS A;  3WU1 B;  2DN0 A;  2FQ3 A;  4D1Q A;  1T98 A;  1HLV A;  1WWX A;  4FTH A;  1MNE A;  2ACJ A;  2HVR A;  1MBK A;  2LKP A;  4AU7 A;  4ETS A;  5BPI A;  4V19 K;  4QIW N;  3LSH A;  2R4G A;  2DPU A;  3I4M J;  1G3W A;  2ZC2 A;  2JA8 J;  3E1S A;  1MBJ A;  4BJ6 C;  4WX9 A;  4AVZ A;  3MEX A;  3RPU D;  3HDD A;  5D5X B;  3HC7 A;  3U9G A;  4LK0 F;  1JT0 A;  1QHH D;  2F4O B;  2OF7 A;  2P5V A;  2ME6 A;  3J7Y J;  3BG5 A;  4EJO A;  1F5T A;  4KMF A;  5J4V A;  4RAZ A;  2EZI A;  3MAJ A;  3ESW B;  1OCO H;  4RM2 A;  3OS1 A;  2O61 A;  1T0F C;  2V1N A;  1KGS A;  4JX6 A;  4KIC A;  5FD6 A;  5L3E A;  5KAI C;  2MAB A;  2DT5 A;  5JLX A;  2A3S A;  2FA5 A;  3U1K A;  2M2E A;  2BVL A;  1U5T C;  1XDS A;  1MMN A;  1LNW A;  1QBJ A;  2IVM A;  4B48 A;  5IP9 J;  4HZF A;  4XSZ F;  1YX5 A;  5ILV A;  2MLK A;  1T2K A;  2BXZ A;  2LG4 A;  3SFI A;  2PJP A;  2R3S A;  3K10 A;  1WGX A;  2IXS A;  2L7K A;  1ZR4 A;  1N25 A;  2R7D A;  1YJ9 I;  5IOZ A;  3P9I A;  2ELJ A;  4L5J A;  4X0G A;  2HGC A;  4KDP A;  4Y4R A;  4M6X A;  1FIP A;  1IXS B;  2OPT A;  3ABK H;  5IYB J;  2PMH A;  2EJR A;  5KHD A;  3QYB A;  2F5E A;  1SAN A;  1X1C A;  2X1D A;  2QSH X;  4EJU A;  3BR2 A;  1AU7 A;  3HRM A;  2VOP A;  2P7C B;  2EIN H;  3CO6 C;  3OR2 C;  4LB6 B;  2VOD A;  1X1B A;  4ZYA A;  1W0U A;  2M7A A;  2GZW A;  4F3Q A;  5HS8 A;  4BHC A;  1W7P A;  4JK1 X;  3L00 A;  3DLL F;  4LG0 B;  2GQQ A;  4YII A;  2ZJ2 A;  3KYL A;  1LEB A;  1FEX A;  2M8G X;  3OS0 A;  3K4B A;  5GAH J;  1RUO A;  2FNA A;  2MW8 A;  1E3P A;  1D1C A;  1X58 A;  2V6C A;  2JQ7 A;  1LDJ A;  3KP7 A;  3DPU A;  1R4N B;  1VQO I;  2PQ8 A;  4ESB A;  2RN7 A;  1MBH A;  3H3V K;  1T95 A;  1MBF A;  4XKV A;  3GTK J;  3IHU A;  2CRG A;  3WE3 A;  3RZO J;  4KNY A;  5LEK A;  2IW5 A;  2E2J J;  4P96 A;  1K78 B;  2WWY A;  1OLT A;  2COM A;  3I56 I;  5IT9 Z;  3D0S A;  3DU6 A;  2BY1 A;  1MZB A;  2CUJ A;  3JTH A;  2DOE A;  2JA2 A;  3K1N A;  1EA3 A;  1QVU A;  2LRE A;  1DGR M;  3KFW X;  1Z6T A;  4IQJ A;  2M3A A;  2AQE A;  2XPU A;  2R5Y B;  3TO6 A;  4D5F A;  1D3Y A;  3M7G A;  3V42 A;  1FIA A;  3CDH A;  1OMI A;  5BS6 A;  2RNJ A;  2JVH A;  3H3Z A;  3FIW A;  4XLN F;  2CW8 A;  1N77 A;  1GVJ A;  3TKY A;  3RQI A;  5B5E C;  1HA8 A;  1TW2 A;  3GFM A;  4RAF A;  3BR1 A;  1RNL A;  3DKY A;  4U0Y A;  3HRU A;  3JRB A;  1MDM B;  4I7H A;  3CC2 I;  2QM3 A;  1P4W A;  4M9S A;  4G7O F;  2G7H A;  4ZDP A;  2ZSI B;  5F0H A;  5DM7 F;  2H1L A;  4GDF A;  3ZQ7 A;  5EGO B;  3EYY A;  1ZK8 A;  1SFE A;  3D5L A;  1UB9 A;  6PAX A;  1ULY A;  1ZRF A;  1IRF A;  1WFX A;  4M3D A;  1B59 A;  1TNT A;  1YE9 A;  2CUF A;  5DUK A;  1IUY A;  1LVK A;  1FOY A;  3TDU C;  2W25 A;  3BR3 A;  3QU6 A;  3IWZ A;  4WXH A;  3IL2 A;  2DMN A;  5F1R A;  1OCP A;  2E1O A;  2LNB A;  2QQ9 A;  2IA1 A;  2V9K A;  4Z2Y A;  3DBR B;  3S2H J;  2QVO A;  2VN2 A;  2E2H J;  5CYV A;  1IN7 A;  3A03 A;  2DAO A;  1KQ9 A;  1WHU A;  1Y0N A;  3L1P A;  3AL0 C;  2EFW A;  1LFB A;  4AIK A;  3LSG A;  4HST A;  1O4X A;  2WAQ N;  4Q5S F;  3KZI C;  2LTP A;  5CQG A;  4BHB A;  4A3J J;  4IQ4 A;  3I58 A;  1NK2 P;  2XF7 A;  4O5V A;  3FMQ A;  5EZH A;  3KYD B;  5K7Z A;  2X6Y A;  3KEO A;  1I1G A;  4A3D J;  2KRF A;  4CA0 A;  4DYR A;  4L9V A;  1UST A;  2OQG A;  5IPA A;  5LGN A;  3M1E A;  1UJ8 A;  3LFK A;  4XNF A;  5EJC A;  2VOO A;  4XRM A;  3PNT A;  3GTJ J;  4OAY A;  2CU7 A;  2HQN A;  2IRF G;  2A61 A;  2AHQ A;  2HXI A;  1KZH A;  4IPA A;  3E3V A;  5J3L A;  3VWB A;  2X0L A;  5IT3 A;  3H0D A;  2V4J C;  5J8C A;  2DO7 A;  3GTP J;  5DV5 A;  3HB9 A;  4HX4 A;  1YIT I;  4A6E A;  4HX7 A;  1FT9 A;  4MTE A;  2QEX I;  1KU7 A;  2Z5U A;  3PIO F;  1MBG A;  3TGN A;  3ZMT A;  3SHF A;  4RM3 A;  1O3T A;  2VB6 A;  3N97 A;  4C2M J;  4ZH4 F;  2ZME C;  2O6G E;  1YO5 C;  2CFX A;  2M87 A;  2P5K A;  2DJN A;  4OIN F;  5C4X J;  2RC4 A;  1EKE A;  1BOB A;  2VQL A;  4ENK A;  3H5A A;  1G3Y A;  3K1M A;  1PUF A;  4OOI A;  2XAQ A;  2W48 A;  5TRD A;  2ZBK A;  1A6I A;  2WB1 A;  1DPR A;  4HOB A;  3I54 A;  1MJA A;  1P7J A;  1V5G A;  2QBY A;  3RKY A;  1ETK A;  1JGG A;  3OSF A;  4M73 A;  2KLO A;  4B8X A;  3CUQ A;  2WBM A;  5H6R A;  4U7D A;  3HXL A;  5D6F A;  2J5O A;  4PSW A;  5DM6 F;  4BXX J;  1YS7 A;  1F9N A;  4C2U A;  1HOM A;  2V9P A;  2L9N A;  3AG4 H;  1Y1W J;  2VBY A;  1Z7U A;  3WG9 A;  4HDU A;  2FE3 A;  1OYI A;  2XV4 S;  2E19 A;  3K4J A;  1BC7 C;  5K7H A;  4Y13 A;  1HDP A;  1IO2 A;  2DA4 A;  2LH9 A;  2X4H A;  1J0R A;  3AFH A;  1JUP A;  4IKF A;  5B3S H;  1RR7 A;  2DMP A;  5DD4 A;  3OL3 A;  1KU9 A;  1YTY A;  4PCQ A;  2AS5 F;  4E7I A;  4HQM A;  5J1U A;  3BTC A;  1LEA A;  2FUG 2;  4HRI A;  2F48 A;  4A3G J;  1JUS A;  5IP6 A;  2VLA A;  1F4K A;  5FKN A;  1YW7 A;  5TIS C;  4CCM A;  2ZCW A;  2NVX J;  3DLA A;  3RYR A;  2L02 A;  4E4H A;  2NS8 A;  4ZC3 A;  3V8K A;  3I55 I;  4ENJ A;  3M9A A;  3L9F A;  5M3M J;  3GFI A;  4A69 C;  2X51 A;  1JT6 A;  3I4P A;  3ECO A;  4AD9 A;  3BR0 A;  2KZV A;  5LGU A;  3ZQI A;  1FP2 A;  3ZPL A;  2STT A;  3TMO A;  1FP1 D;  1G8X A;  5DCM B;  1VQP I;  2DOD A;  2ZXI A;  3DEW A;  3ELK A;  3CCQ I;  2DT6 A;  1UG0 A;  3KLN A;  1KYZ A;  2HDW A;  2W85 A;  4OIP F;  2KHM A;  2VKV A;  3K4K A;  2W57 A;  1MJB A;  3RPU A;  1IGN A;  2HXO A;  2HVQ A;  3BT9 A;  3BG6 A;  1A5J A;  1TQM A;  3OIP A;  1J9I A;  2F5F A;  3T5X A;  3WU2 C;  4FAS D;  2HDD A;  3ASO H;  2R93 J;  4LLG F;  5BNG A;  2DK5 A;  2PMZ A;  1EH6 A;  4CCJ A;  5F64 A;  4BE0 A;  1XC5 A;  3E0J B;  1P7I A;  1V4R A;  1MBE A;  4I0B A;  2IAI A;  4DNC A;  1RI7 A;  4DBQ A;  4AM3 A;  4WK8 F;  2MA3 A;  4CCN A;  3RCO A;  3P9C A;  3ABL H;  5J8F A;  2DU9 A;  3VEP A;  5JHU A;  4Z6Y A;  3WTX C;  3AG2 H;  2XSD C;  1I6H J;  1U3E M;  1SMT A;  5IYC J;  3CES A;  3DV8 A;  3HUG B;  4IOA F;  1E2X A;  1MJ9 A;  2FBK A;  4Q47 A;  3A02 A;  5F04 A;  2NVU B;  2VT2 A;  3DPL C;  4CH7 A;  2JA6 J;  1USS A;  2E71 A;  1P6R A;  4A3I J;  3KLO A;  2Q8K A;  2CGP A;  1X1D A;  3VOE A;  5J1Y A;  1F36 A;  3TDZ C;  5HS7 A;  2VL8 A;  1T0F A;  3HPH A;  4XLC A;  2V6E A;  4CYC B;  2BHZ A;  4MFE A;  1APL C;  2ID6 A;  2VQH A;  3VYT B;  1U5T A;  2DA6 A;  1JE8 A;  2DA5 A;  1ZR2 A;  2EIK H;  3OYJ A;  3UKG A;  3J81 K;  3S3N A;  5HS9 A;  4F55 A;  2FMY A;  4MO7 A;  4AVP A;  4P9F A;  2ZXW H;  4IHV A;  4XOT A;  3BP8 A;  2A6H F;  4RA2 A;  1S3J A;  4M6Y A;  5D5U B;  4OMY A;  3JRC A;  2F4M B;  3BDD A;  1JJ6 C;  1G4D A;  1A6Q A;  3BJO A;  3SDG A;  1HBX G;  3ZMV A;  1FBS A;  1FYL A;  3OWT A;  1IXC A;  2V1U A;  2A07 F;  3E6C C;  3V7S A;  2VJ4 A;  1GV2 A;  4CIC A;  3HHH A;  3ZXS A;  4HPQ A;  2HOS A;  3FZV A;  5KAF C;  3E6D A;  4MNU A;  2ZJR F;  2XDV A;  2L4M A;  1RKT A;  3P7N A;  1EH7 A;  3HOY J;  4A12 A;  1G2H A;  4C3J J;  3K2Z A;  3HGY A;  3W3C A;  1NH3 A;  4A3L J;  2LDU A;  3EUK L;  3F8M A;  4CYD A;  3L2Q A;  4E7L A;  2CJJ A;  3T0Y A;  3WTU C;  1PP7 U;  2K9S A;  2L01 A;  3CO7 C;  2IS4 A;  4ANJ A;  5HOO A;  2VKH A;  1WCM J;  1TT0 A;  3QOP A;  4E7S A;  5J40 A;  3FHZ A;  1JJ8 C;  2XVC A;  3FXU A;  1X4O A;  4FQG A;  1V5F A;  5DD8 A;  3J7Z I;  1Y39 A;  4R8H A;  5B1B H;  2EIM H;  3OYA A;  4OWR B;  2DFF A;  3DTK A;  3ABM H;  3KIO A;  4HQE A;  3GLL A;  4M3F A;  3DEU A;  1B72 B;  1P4A A;  2NVQ J;  3I59 A;  5DDG A;  1D0Y A;  5D6E A;  1S7E A;  2X1E A;  4ZDO A;  2ELH A;  1MNM C;  2IA0 A;  2DQR A;  1H0M A;  2KIQ A;  2DOA A;  2A69 F;  3W2W A;  3CMA I;  2HVS A;  3BTJ A;  3GEZ A;  5F6F A;  4A3B J;  3JRG A;  1F43 A;  1A35 A;  2ZXJ A;  5LEJ A;  1LE8 B;  3DEE A;  3MWM A;  3H3U A;  1D5V A;  3DTI A;  3DXJ F;  4JX5 A;  5EZG A;  1YIJ I;  1S7O A;  2ZJQ F;  3O2P E;  2MC4 A;  2QA4 I;  1VQ8 I;  5GP9 A;  4O3M A;  2PX9 A;  3EYI A;  3QP6 A;  1TQI A;  2WAE A;  1OKR A;  1TWC J;  4P5O A;  1Z6R A;  2CW0 F;  4Y3O A;  3BTI A;  4AUX A;  3PFY A;  5E1X A;  5CQE A;  4EQQ A;  1D8K A;  3QWL A;  3DKX A;  5K5Q A;  2A5W A;  2B9S A;  1BIB A;  4L5E A;  3IAM 2;  2H6B A;  5GAG J;  3LA3 A;  5EF6 A;  3L2U A;  2RQP A;  5E20 A;  3OYG A;  2CQ7 A;  1W5C C;  2P6S A;  4XQF A;  2XIG A;  2DA1 A;  3L7W A;  3LQR A;  4YFN F;  4A3C J;  2W24 A;  4NQW A;  3C7J A;  1BJA A;  5GPA A;  2BGC A;  3D5R C;  4DGW B;  3L09 A;  4PJ0 C;  3OYN A;  3BOQ A;  5JVT A;  1QZZ A;  1XGM A;  4LIT A;  1Y1V J;  4BL0 B;  4ESF A;  1GT0 C;  4OIR F;  1A36 A;  1SVO A;  3EQL F;  3BWG A;  3HOZ J;  5F0C A;  2B0L A;  4EGY A;  2KKO A;  2QQA A;  3S15 J;  2K86 A;  1Z0X A;  3Q0W A;  2GA1 A;  3ONQ A;  2JWT A;  3WTY C;  4XSX F;  4I6Z A;  1K79 A;  1ZEL A;  3G1O A;  3MKL A;  2L4A A;  4XM3 A;  2E2I J;  4HAM A;  2C6Y A;  1XSD A;  2ZKZ A;  4ZYH A;  2BY2 A;  2ZB9 A;  1AKH A;  3KP6 A;  2ADU A;  2LY1 A;  2W00 A;  3K4C A;  4RB0 A;  3HZJ A;  2EFN A;  2FU4 A;  3B73 A;  4X6A J;  2OD5 A;  1LKX A;  4NHJ A;  3BC8 A;  4CCK A;  2RRE A;  2NS7 A;  3P9K A;  4PJN A;  3C1D A;  2ZXH A;  1OQY A;  1KU3 A;  3G1L A;  4XMY A;  2MD0 A;  2XRO A;  5FKM A;  4LIU A;  3IV5 A;  2DMQ A;  1ETO A;  2OC6 A;  4KIS A;  2VE9 A;  3IH4 A;  3F8C A;  3DU5 A;  1ETW A;  3EDP A;  4RGX A;  1LDD A;  4B43 A;  5E8I A;  4BXU A;  2ZME A;  3K70 D;  4ENN A;  1YOV B;  3GX4 X;  2G0E A;  3V7C A;  1TWG J;  1OR7 A;  2DTZ A;  2H6C A;  1WJD A;  4CZZ A;  2M1B A;  5DUI A;  4BDY A;  5FLM J;  3J7A Y;  4G6D A;  4XLF A;  3BCB A;  3Q0U A;  2IGM A;  4M71 A;  1U0J A;  1YQA A;  2L7Z A;  1R00 A;  2VBW A;  2QQB A;  3IH3 A;  1UHW A;  4FT8 A;  4HF0 A;  3MKY B;  4A93 J;  1R5I D;  2R7V A;  4UNO A;  2A6E F;  1B4A A;  1W7P B;  2XGD A;  4KIG A;  3WU0 A;  3G2B A;  2L54 A;  2NAZ A;  4ZZL A;  5L3C A;  1J5Y A;  1PDN C;  1FOK A;  1YG2 A;  2YX4 A;  1RUN A;  2M4G A;  1ODD A;  5FKL A;  2OTJ I;  4CO8 A;  4DJA A;  4C9Y A;  2JN6 A;  3ULQ B;  3VYR B;  3GVA A;  3JTG A;  3S8P A;  1N75 A;  4DYQ A;  4ASN A;  1JUM A;  4UHT A;  3CJQ B;  1VF9 A;  2V1D A;  2YX7 A;  4KN4 X;  1X2N A;  2NVY J;  3ZMZ A;  1QHG A;  2R7R A;  2FBI A;  4LOC A;  4PFO A;  3QOE A;  2E36 A;  2DTR A;  1POG A;  4A3K J;  2WAQ A;  3CF5 F;  3LA2 A;  3ML6 A;  2RNG A;  2DYS H;  1OCR H;  2HR3 A;  4RAG A;  1FLI A;  3X2Q H;  2LK2 A;  2Y2Z A;  3KPH A;  1QQI A;  2A6T A;  3BPX A;  3K2A A;  1V3F A;  1U8R A;  2JA5 J;  4HW0 A;  2BW3 B;  3K0L A;  3SYT A;  1FMW A;  1Q1V A;  3HBL A;  1ZGW A;  2TDX A;  3NWT A;  1QVT A;  3FXQ A;  3HG9 A;  1FTZ A;  1FSE A;  1U8B A;  3GTQ J;  3QYE A;  3TO9 A;  4BQN A;  1VQK I;  2OZU A;  1D0X A;  1PVE A;  3K6G A;  1UHS A;  1RZ4 A;  2BOL A;  3LSM A;  3KEQ A;  4E7Z A;  4Y33 A;  4CDG A;  3HOX J;  3GTM J;  2EIL H;  2LMD A;  5K5O A;  1ETX A;  5ILU A;  5M5X J;  2ISZ A;  4A2U A;  4XON A;  4GCV A;  3OL4 A;  5CVI A;  1I3Q J;  4PDK A;  3REO A;  3C3W A;  5L3B A;  1EV7 A;  1B9M A;  3WGI A;  1ZQ3 P;  2DW4 A;  3E97 A;  5FFZ A;  4IRH A;  3OIQ A;  4IRI A;  1IW7 F;  2NS0 A;  3F0C A;  2HKX A;  1OCT C;  2VPL A;  3CCS I;  4XRS G;  3PIP F;  3ERM A;  1BW5 A;  1ZYR F;  4A0Z A;  5F1J A;  2YU9 J;  5HLG A;  3SZT A;  3Q9S A;  1TQP A;  2W82 A;  3ZN0 A;  5LHG A;  1SD5 A;  3CDI A;  4S04 A;  2GOM A;  4B1R A;  4L0Z B;  1ORK A;  2VPR A;  3S14 J;  4HV5 A;  1ZN2 A;  4MEY F;  4HLX A;  3CJT B;  2Y30 A;  4OIQ F;  1T38 A;  3QYF A;  3FIS A;  4D5C A;  5H20 A;  5LBQ A;  2O03 A;  2VBX A;  4GGG A;  1XPX A;  1BW6 A;  3H9G A;  2H8R A;  3GBG A;  3F21 A;  1A04 A;  2E7X A;  2XF5 A;  2LD5 A;  3H36 A;  4WXD A;  3ABU A;  3VB2 A;  1UEL B;  3N05 A;  3GO5 A;  3S3O A;  1SFO J;  4B4C A;  1J75 A;  2E1N A;  2JSC A;  2G7U A;  3Q5F A;  4LLN A;  2PMU A;  1OFC X;  5LRS A;  4OIO F;  1MMD A;  3V8L A;  2KP6 A;  2OCC H;  5HLT A;  3LA7 A;  3BJA A;  2N8G A;  2ESN A;  3I4N J;  5D8L B;  4BJ5 C;  4EM1 A;  3F72 A;  3CCJ I;  4IO9 F;  1TZL A;  3IH2 A;  2V9V A;  2DFI A;  3GW2 A;  2HFH A;  5B1A H;  2HNH A;  1R5H A;  3FXR A;  2EZH A;  2GWR A;  4FCY A;  2HWV A;  3ZMS A;  1MW7 A;  2EQR A;  3GXO A;  2K4J A;  2XF6 A;  1ZH5 A;  4JYK A;  5A2Q K;  3CLQ A;  1WPK A;  5E18 F;  3LSI A;  5FKK A;  3U1D A;  3LST A;  4QPQ A;  4B47 A;  3AG1 H;  3O3K A;  2MSY A;  2Z2S B;  1Z3X A;  2WAD A;  5HNF A;  2PEX A;  3DFG A;  1R5G A;  3CUO A;  2WAF A;  4IHX A;  2VQG A;  3CJN A;  3A4C A;  3H0G J;  2M30 A;  5LFA A;  5ED4 A;  5M3F J;  1SC7 A;  1AHD P;  2E1C A;  3GME A;  4IVN A;  3GZ5 A;  3W6J B;  4BJT A;  1K7A A;  1LFP A;  1RC9 A;  2K7L A;  2ZNY A;  3ZRG A;  2KDO A;  3OOU A;  1YJN I;  4UXN A;  3HL2 A;  1XGS A;  2PN6 A;  2YUS A;  3NWS A;  1ETV A;  4Q4Z F;  3UNG C;  5KNL A;  1U9N A;  5M5Y J;  1R58 A;  3R60 A;  4PJM A;  2GBY A;  3O8H A;  5CVR A;  4IHW A;  2HQ5 A;  4UV8 A;  3MN2 A;  3MKZ A;  1WJA A;  2R7W A;  3JSO A;  1Y0U A;  1GDT A;  4K2E A;  2XAF A;  4RMN A;  4M3E A;  3HM5 A;  4AWX B;  1JKR C;  1U9O A;  2RVC A;  2K85 A;  2Y69 H;  3EPZ A;  3A01 B;  2M5W A;  1VFC A;  3KP4 A;  5D4S A;  4Q48 A;  1Z91 A;  3K9T A;  3G71 I;  1E17 A;  2KIM A;  5J47 A;  5IYD J;  1K6O A;  2GOX B;  3ZMU A;  4LG0 A;  4XRS A;  3L2R A;  2AXT C;  3RKQ A;  2CWE A;  1KA8 A;  5ICG A;  5GTI C;  1OCZ H;  3S3M A;  2H94 A;  4WWC A;  1WJ5 A;  3DCF A;  2F5V A;  3NEU A;  2PG4 A;  1NTC A;  1O7L A;  1DGW Y;  3SEZ A;  4PSX A;  2QZ8 A;  4XN0 A;  4BAY A;  1HST A;  4BHP A;  3S17 J;  2LR8 A;  4A5N A;  2OTL I;  3LMM A;  1LPQ A;  4U0V A;  4RB2 C;  1B8I A;  2B63 J;  1X3Z B;  5E3O A;  3ZQC A;  1K78 A;  3GYH X;  2Y9Y A;  1OR7 C;  2L9S A;  2OU2 A;  3DPT A;  3F6O A;  1Z7L A;  4U87 A;  3JW4 A;  3RSN A;  1O3Q A;  4YIR X;  2QSG X;  3BCA A;  4I76 A;  2R5Y A;  1N78 A;  2OA4 A;  2WV0 A;  3OS2 A;  3AG3 H;  5LHI A;  4MQV A;  1L3L A;  4LMY A;  2D2W A;  3PL8 A;  2DBB A;  3F22 A;  1E3H A;  1ZAO A;  2XRL A;  3B6A A;  4HG2 A;  3LQQ A;  1FMV A;  4MLO A;  4M74 A;  3HKZ N;  4YRV A;  1VQM I;  5E17 F;  3H35 A;  2IP2 A;  2CQX A;  2M45 A;  1XX5 A;  1YFH A;  2XAG A;  3TW6 A;  1ZHF A;  1S9H A;  2WC2 A;  3BPV A;  2K9L A;  4LFU A;  2MH9 A;  3QRF F;  1IDZ A;  1HQC A;  2R7T A;  3DWL E;  1W0T A;  2L5Q A;  1MDM A;  2O5R A;  1FX7 A;  1SFK A;  4DBR A;  4ZYE A;  1IN8 A;  3OYB A;  3LAJ A;  1T8I A;  2P5L C;  5E1Z B;  3GCM A;  4AYB A;  2PJR A;  4DYC A;  3CC4 I;  2HOE A;  4I99 C;  5ICC A;  1E3O C;  2P7V B;  1IN6 A;  5E79 C;  3LOC A;  3OV8 A;  2Z9O A;  2CO5 A;  4PJL A;  3LWF A;  3CZ6 A;  4B3X A;  1WJB A;  3NAU A;  3AAF A;  2HDC A;  5EEH A;  2K4B A;  5JFR A;  5EG0 B;  2GXG A;  3KZZ A;  4UUS B;  4XKC A;  3J81 Z;  2LKX A;  2XGE A;  4DIQ A;  4F52 A;  2EV6 A;  2NOG A;  1SD4 A;  5AIP A;  3JAM K;  4JX4 A;  2FBH A;  1OYY A;  4EJT A;  1MMG A;  3VOD A;  2E60 A;  2RGV A;  4L9J A;  4N9H A;  1JHF A;  2FJ1 A;  4P55 A;  3M07 A;  1Y8R B;  2Z33 A;  1IV6 A;  4CGZ A;  5C44 J;  4HBL A;  2NYX A;  2H8W A;  3CJR B;  1YHQ I;  4G7H F;  1PP8 F;  3HHG A;  2FNP A;  2X6O A;  3CDL A;  1SFX A;  3ZMD A;  1D1B A;  2V79 A;  2HOT A;  3IKT A;  1RPW A;  2IGN A;  2QQ8 A;  4GO1 A;  3WTV C;  3BZ6 A;  3Q0V A;  5B66 C;  1V55 H;  2J5P A;  2KT0 A;  3EUH C;  4HEA 2;  1NG7 A;  3OYF A;  5FRO A;  1NHA A;  4QTR A;  4PFP A;  2V26 A;  2R5Z A;  1ZG3 A;  1FWZ A;  1FJL A;  3HRT A;  1XMX A;  2LY9 A;  1JXS A;  3GTO J;  2XKP A;  1ZGJ A;  2CS3 A;  2Y0M A;  2DOF A;  1IRX A;  3IAS 2;  4EM2 A;  3M8F A;  1HCR A;  2QWW A;  4II3 A;  5BOX A;  2G9W A;  2DXI A;  4N0B A;  1HW2 A;  3KZY A;  3BR5 A;  4U0W A;  1QNT A;  1WKM A;  3IRR A;  1HKT A;  1FOX A;  1W5T A;  2XUB A;  3SZP A;  2QUF A;  2F6C A;  1LDK B;  1W36 D;  4Y17 A;  1Z67 A;  4EEF G;  1CF7 B;  1SFU A;  1IV8 A;  4A6D A;  1Z9C A;  1I1S A;  4UV9 A;  5KVR A;  1RR8 C;  4MTD A;  4G9Y A;  4QWQ A;  3FHN A;  4KUM A;  2A05 A;  4E7H A;  1K4T A;  1VZ0 A;  3T1B A;  4XOP A;  1OJL A;  3UR3 C;  2VXZ A;  4F93 B;  1SAX A;  2VKD A;  1B6A A;  1BC8 C;  1RKW A;  4NNJ A;  2IT0 A;  5FRM A;  3JRD A;  2CV1 A;  2UZK A;  1W7P D;  2XB5 A;  3CCL I;  2FXA A;  3RKX A;  4G8X A;  1ERD A;  1BBY A;  1HW5 A;  4RDU A;  5DYM A;  4FX0 A;  4QLC U;  4JP0 A;  2NVT J;  3BLY A;  2JVG A;  1O57 A;  2QYO A;  2LY2 A;  4BY1 J;  2I8D A;  2ICW G;  2RDP A;  3I71 A;  4LG3 A;  5JVG F;  2M7B A;  4XIC A;  3E5Q A;  3E5U A;  1H89 C;  4I98 B;  2DYR H;  4BDZ A;  5HNH A;  3DP7 A;  2FRH A;  3NRV A;  4XRF A;  2X6X A;  2BBY A;  2FML A;  3AL0 B;  2HPI A;  1G6N A;  3FWE A;  5DCM A;  1X1P A;  2X6W A;  5AON A;  4PUS A;  2D1V A;  2O3F A;  1U6G A;  2DDA A;  2JK3 A;  1LFU P;  1QGP A;  4YG2 F;  3W2V A;  1DQU A;  4BUP A;  2E7W A;  1KQ0 A;  2QGU A;  2W7N A;  2M9H A;  1W5S A;  2K9N A;  4AYB N;  2KIS A;  4X1E A;  1MSF C;  5J6X A;  2VKE A;  3OIO A;  1SVM A;  3HYI A;  1O3S A;  1AKH B;  3N4M A;  3HOW J;  3CMY A;  1IN5 A;  1JI8 A;  1HKQ A;  2MC3 A;  3CP2 A;  1HDD C;  1V5E A;  5HDN A;  1YRN B;  3QAH A;  4L18 B;  3HRS A;  3G4S I;  1M1E B;  2QKL B;  1EF4 A;  5FJ8 J;  3ECH A;  3J7A O;  4MHG A;  3WG7 H;  5FGM A;  5HLH A;  2R92 J;  1BR2 A;  5LRR A;  1AWC A;  4J19 A;  1REP C;  3PQJ A;  4CSW A;  1MMS A;  2EFQ A;  2Q0O A;  5K1Y A;  4BEH A;  3RJP A;  4F7Z A;  4E6K G;  1F1Z A;  1VQ6 I;  3OYC A;  1VTN C;  5ICE A;  3HUG A;  2FQ4 A;  4IZZ A;  1JKQ C;  2NNY A;  3GZN B;  2PI0 A;  3DTE A;  2Q2E B;  3GTL J;  2DFE A;  1R23 A;  4CZC A;  1T08 B;  5GTH C;  3I5U A;  1JKO C;  4JOM A;  1QZE A;  1R4M B;  3FX3 A;  4BQQ A;  2MYS A;  2LYC A;  5CVU A;  4IEJ A;  4CYC A;  4RS8 A;  4DZJ A;  1R22 A;  1GXQ A;  3WGH A;  4UVC A;  3E6B A;  2DLL A;  3LFU A;  5FLV A;  2XPW A;  3JRA A;  3EET A;  2XAS A;  2YPR A;  1B1B A;  2STW A;  1WJC A;  2HQR A;  2UUZ A;  3G3Z A;  4IXA A;  2COB A;  4D7M A;  2CV2 A;  1TT5 B;  2O8K A;  2EBI A;  4WF2 A;  1EJ9 A;  3KP2 A;  5L3D A;  3S1M J;  5M5W J;  2OJE D;  4BKX A;  1HKS A;  4CCL A;  5D8K B;  2DA3 A;  1H8A C;  4CUG A;  1ZG1 A;  2X1C A;  1VI0 A;  4FE4 A;  1BOA A;  1BI2 A;  4N4N B;  5FRN A;  5BMZ A;  2BVM A;  1K4S A;  3P5J A;  3C2H A;  4A5M A;  2YU3 A;  2HYJ A;  1I50 J;  3AKZ A;  1K83 J;  1R9T J;  2OCE A;  3HTS B;  1VND A;  4UY8 I;  3K70 C;  1OPC A;  4G94 A;  5HOD A;  1XSV A;  3CTA A;  1NG6 A;  1LQ1 A;  3TW7 A;  1ACI A;  3SQN A;  2JPB A;  3CLO A;  2K3P A;  2BHY A;  3LL7 A;  4ON0 A;  4P9U A;  1IJW C;  5BQT A;  2OAZ A;  4M3G A;  3O8G A;  1D8J A;  2JPC A;  2ZFW A;  3OR1 C;  3FDY A;  1X1A A;  2P81 A;  5GPC A;  3K7A J;  2QF7 A;  4NB5 A;  3RYP A;  2EA4 A;  5CVJ A;  1S29 A;  2VJI A;  5FB2 A;  3TOB A;  2O7O A;  1UHM A;  3CCE I;  3Q3S A;  2UXN A;  5F08 A;  3ERE D;  1R71 A;  1B72 A;  1D5Y A;  3IC7 A;  4A3F J;  4HLY A;  2HYF A;  4EJW A;  4I09 A;  3FXK A;  1YYV A;  2RV8 A;  3ASN H;  2LSO A;  4MEX F;  1Y8Q B;  3WTS C;  3GLX A;  3F8N A;  3MZY A;  4ZTJ A;  1S6L A;  2E1M B;  3RZD J;  1GVD A;  2GM4 A;  1S8N A;  1QO0 D;  1LE8 A;  5H6Q A;  1FBQ A;  4L9N A;  4BBS J;  2R7Q A;  1H9T A;  1RET A;  5LHH A;  5C4J J;  4XR6 A;  2QCO A;  2JJ7 A;  2L9V A;  3O6B B;  2P6T A;  2BXY A;  3K1P A;  4H0E A;  3FXL A;  3BZK A;  2BEO A;  4XL9 A;  4GFB A;  4M6V A;  4BBR J;  3D5S C;  2WTE A;  1HC8 A;  4PGG A;  3GF2 A;  1L0O C;  3G6E I;  5HDK A;  3WTZ A;  3TQN A;  1YW9 A;  3PQK A;  2W84 A;  4ZYG A;  4J01 A;  2DK8 A;  1ZRC A;  3TBI A;  1E0E A;  1X2M A;  1IAW A;  1DP3 A;  3ABT A;  3PO3 J;  4RGU A;  5F27 A;  2MBF A;  4UUT A;  4A3M J;  1JKP C;  1OCC H;  1IN4 A;  1Z05 A;  2HZT A;  3CCY A;  1JGS A;  5FO5 A;  5LLQ A;  1R49 A;  3R61 A;  4IX7 A;  3GFJ A;  2QLZ A;  3L2V A;  2ZFU A;  2ME0 A;  4HF1 A;  2HOA A;  3BG3 A;  2V1X A;  2VON A;  1P9Q C;  2KRH A;  3MVP A;  3MFK A;  3PSI A;  2GAU A;  2NXN B;  4D9J A;  4LB5 A;  4MQ9 F;  2IA2 A;  2QSF X;  5FFX A;  3WOD F;  2M0C A;  5GAD J;  4IHY A;  3CF2 A;  4C3H J;  2RKH A;  1U78 A;  4LIV A;  1TNS A;  1LJ9 A;  2ECB A;  3CCM I;  2LVS A;  5FLX K;  1PUE E;  2AQF A;  4BY7 J;  2W4S A;  2XKO A;  4RAY A;  4I01 A;  1MGT A;  3C2B A;  5A2Q Z;  3JRF A;  1DP7 P;  2LBF A;  2ZNZ A;  3H5N A;  3LNQ A;  3LAP A;  2GXA A;  2LLK A;  1S5L C;  1WRJ A;  2VBZ A;  5J4Y A;  1TLH B;  1WH5 A;  2Y9Z A;  3HIF A;  4M9Z A;  3CP8 A;  1IZ1 A;  2ELK A;  1UZC A;  3CCR I;  2KZG A;  1K61 A;  1STZ A;  2GA2 A;  1ON2 A;  3B02 A;  1S7A A;  2VXD A;  3SDB A;  2GIV A;  1WI3 A;  3E6M A;  3S32 A;  2EFP A;  1R1T A;  3TP0 A;  4EVI A;  1H9G A;  3RI4 A;  2CSO A;  2I10 A;  2IBD A;  1IUF A;  1EH8 A;  3EUH A;  2FEZ A;  5DTD A;  3HKZ A;  1YIO A;  3BZC A;  2BYV E;  1W4M A;  3FKI J;  3A1Y A;  4YEL A;  3R0A A;  1T33 A;  2EZL A;  1SVL A;  1ITY A;  2OV7 A;  4ZZD A;  1GV5 A;  4DOZ A;  1KU2 A;  3S1N J;  5ICF A;  2IS1 A;  4MIM A;  1HF0 A;  2RAE A;  4L5I A;  2R7S A;  5L3F A;  1Y56 A;  2P4W A;  4O6J A;  1WZ2 A;  3HSR A;  3K4M A;  2F2E A;  1TP4 A;  4U88 A;  2Z3Y A;  3CCU I;  1ZRE A;  3CD6 I;  5FD5 A;  4LD5 A;  4RGR A;  2BV6 A;  1XSX A;  1BL0 A;  4N4O B;  3TP3 A;  1LB2 A;  5LGT A;  3M8J A;  2F4I A;  2NOJ B;  1R36 A;  1BI1 A;  4IF4 A;  1DUX C;  3M4O J;  3IP4 B;  3S1R J;  1ZLK A;  4YFX F;  2K27 A;  3EUA A;  3QPS A;  5EYR A;  2IEK A;  2Z1D A;  4I2O A;  1MIJ A;  2XAU A;  4WXC A;  5LD2 C;  3MCZ A;  1J7K A;  3QPL A;  4J00 A;  3NAR A;  3TED A;  4XK4 A;  3V4G A;  2R7U A;  1B8I B;  2JUC A;  2R7X A;  2L3D A;  2QKM B;  2FF4 A;  4KN7 X;  1SD7 A;  2KJC A;  3MZ8 A;  4RB3 C;  4AIJ A;  4E7K A;  1AOY A;  2VIX A;  3COA C;  3S1Q J;  2MFZ A;  3CQZ J;  3WHC A;  1UMQ A;  2L9R A;  4BQO A;  5F0F A;  2X9D A;  2JA7 J;  3JRI A;  1PUF B;  1WVR A;  4XLH A;  4ZTF A;  2KPM A;  2BZT A;  2EV5 A;  1VQL I;  2BY0 A;  2XAJ A;  4D7N A;  2BW3 A;  5CKT A;  2EH3 A;  5H2F C;  1IRZ A;  2ECC A;  3I3L A;  1JTX A;  3K4L A;  5HVQ C;  2QBY B;  2O9L A;  1PYV A;  5E3L A;  2HZD A;  1UCR A;  4AIH A;  2OUM A;  2IGK A;  3CUQ B;  4ZDL A;  2L7M P;  1DU0 A;  1QRY A;  1XG1 A;  3HTU A;  2BE5 F;  4RLQ A;  3MZH A;  3OSG A;  2K9M A;  4H4K C;  3KET A;  4KIB A;  3LSK A;  3G1M A;  4XKW A;  5JLW A;  2R7Z J;  4W1U A;  3JCU C;  3FK6 A;  4DW6 A;  3OOP A;  2B7E A;  5TJJ A;  3IWF A;  4CCO A;  3J80 Z;  2Y0S N;  3GZ6 A;  2PJR B;  3GTG J;  1FPQ A;  2P0W A;  3HOV J;  3ZQQ A;  4BE2 A;  4HNV A;  2Q1Z B;  1XGN A;  2CMP A;  3SZG A;  3DBH B;  1B9N A;  2XGX A;  4KYW A;  1KON A;  3BR6 A;  4BU2 A;  1XCB A;  1QU3 A;  5KCM A;  4BXF A;  3E7L A;  4XBF A;  4HNT A;  3FKJ A;  4R79 A;  2R7F A;  1YI2 I;  2HEO A;  1BN5 A;  3F3X A;  3M3Y J;  3CCV I;  1XGO A;  4XKB A;  2OZ6 A;  2VQC A;  2KIU A;  3FXJ A;  3FM3 A;  4HA8 A;  3RDI A;  2DFH A;  2EZK A;  3KE2 A;  3OYK A;  1A31 A;  1KYW A;  1WQ2 A;  2IGO A;  3KCC A;  3VPR A;  2H1K A;  1BM9 A;  2KRC A;  4UB6 C;  1ZGA A;  1XMK A;  3BG7 A;  5D5W B;  5IT9 K;  2XAH A;  2PBI A;  3JAM Z;  2DQL A;  3HPG A;  4F92 B;  5BPD A;  1IF1 A;  2DMU A;  2ESH A;  4AC0 A;  3S93 A;  2HYG D;  4B44 A;  4PK4 A;  4KA4 A;  2EWN A;  1X3W B;  4KFC A;  2JRT A;  1CQT A;  4ESJ A;  2A5Y B;  4E70 A;  1MKM A;  2JT1 A;  3OYH A;  5E8G A;  1I39 A;  3HOT A;  4CXF A;  3PUB A;  1PJR A;  2KJB A;  3MQ0 A;  3JRH A;  2DA2 A;  4S05 A;  4Y52 J;  2R5Z B;  1OIS A;  2JMW A;  3BRO A;  3OYE A;  2E5Z A;  2LP0 A;  2FSW A;  1ZG5 A;  2DPD A;  2XC7 A;  3CC7 I;  1OYW A;  1XMA A;  3U2R A;  2MLG A;  2LKS A;  4W97 A;  3RQ4 A;  1FNN A;  4M3B A;  3JSP A;  1ZRD A;  2LC2 A;  4IL6 C;  1NK3 P;  3VSK A;  4BGD A;  1JHH A;  2M8E A;  3J80 K;  2EV0 A;  4BAC A;  1J09 A;  2GIZ A;  2CYY A;  4XLP F;  2CQN A;  3RTR A;  3I64 A;  2KL4 A;  1MMA A;  3PM1 A;  4MFD A;  3ZR8 X;  4OU0 A;  2IS2 A;  1YX3 A;  5EGO A;  4EV0 A;  1XB4 A;  2DJI A;  2LF8 A;  1ETQ A;  2W1O A;  3HOS A;  1FY7 A;  2R7O A;  4HSR A;  2O0Y A;  1IDY A;  2LRD A;  2HTS A;  3FK7 A;  1FZP B;  1U5T B;  3HSE A;  1W1W E;  3HOU J;  4JQF A;  3FXO A;  2KMU A;  1YJW I;  4C30 A;  1P2F A;  4PZJ A;  4NC8 A;  2DA7 A;  5JR3 A;  2YS9 A;  3ZOB A;  4EM0 B;  4HX8 A;  4IJA A;  2K9Q A;  3KP3 A;  2Y31 A;  2NNN A;  1ZKG A;  1XDU A;  3I0T A;  2GLO A;  1I27 A;  3FBI B;  4V2G A;  2X85 A;  2Y48 A;  2ISY A;  4L0Y B;  3HGG A;  1ZTR A;  5K7F A;  3OMY A;  2JRM A;  4ZJZ A;  1TC3 C;  4FX4 A;  2L2O A;  3S2D J;  3KX2 A;  2D1H A;  3A01 A;  3ZGK A;  3S16 J;  9ANT A;  3F6V A;  2HQA A;  4UUV A;  1Y6I A;  2UXX A;  4II2 A;  4B09 A;  4LJZ F;  3F23 A;  4HF2 A;  3K4N A;  3WTW C;  4GYI A;  5IY5 H;  5E3M A;  4ABZ A;  4NUB A;  3VYU B;  2E34 A;  2HKO A;  2CV0 A;  1BI3 A;  1D0Z A;  3ROU A;  3OYM A;  1P92 A;  2UV1 A;  4HDV A;  1R6R A;  3GFL A;  3KP5 A;  3PNV A;  4Y7N J;  2I5U A;  3FBN B;  1KQ8 A;  2K3F A;  2KFD A;  1QPM A;  2TRT A;  4F91 B;  1UAA A;  2KDZ A;  3SFZ A;  2FOW A;  1W36 C;  2HU9 A;  3ZQL A;  4WCG A;  2DDB A;  2LOO A;  2Y75 A;  1K6Y A;  5CLS A;  2D45 A;  1MSE C;  3QP5 A;  4NC6 A;  2CQK A;  1HW1 A;  3TOA A;  3I59 B;  3F8B A;  1FTT A;  1O7F A;  5EDN A;  1I3A A;  3LSP A;  1U2W A;  1FYK A;  4GRI A;  1WJE A;  1RIO H;  4FE7 A;  4G7Z F;  2E1M C;  1GHC A;  1AA7 A;  1SMY F;  4N9I A;  2EA2 A;  1ON1 A;  3MMY B;  1RES A;  1SAU A; 
#chains in the Genus database with same CATH homology
 4LGW A;  1LVA A;  2QEN A;  5EEG A;  2XHK A;  4MGR A;  3V7R A;  2OQR A;  3RKW A;  2NRA C;  2ETH A;  4KT5 C;  4IHT A;  1TBX A;  3HSF A;  3ZN1 A;  1R7J A;  3V8J A;  3VFZ A;  1YLF A;  4LK1 F;  5CJ9 A;  1XN7 A;  1I5Z A;  1Z1D A;  1FSH A;  4DQ2 A;  4U7B A;  3K69 A;  5K5R A;  2EK5 A;  4HYE A;  3T8T A;  4LLL A;  1DDN A;  2HTJ A;  4I0A A;  3GUD A;  5HLI A;  1WI9 A;  5DCF A;  2HS5 A;  4PGH A;  2CG4 A;  3I53 A;  1CGP A;  3GWZ A;  2A68 F;  2GXB A;  1GXP A;  4BNC A;  3T8R A;  4EMS A;  2AXL A;  3FMS A;  3Q9V A;  3R6S A;  1P4X A;  2JTV A;  4A0X A;  2KIF A;  1HSJ A;  2IPQ X;  1IRG A;  2Z99 A;  3BY6 A;  2F5D A;  1XCV A;  4A0Y A;  5DEQ A;  2LF7 A;  4EJV A;  2P8T A;  2YSR A;  2JZY A;  4GXO A;  3QPH A;  4FHT A;  3F8F A;  1MD0 A;  1G3S A;  3S2W A;  2H27 A;  1FBU A;  1HXD A;  4BH9 A;  1O3R A;  1QZY A;  3DKW A;  2VC1 A;  3FM5 A;  2ZME B;  1IXR C;  3R4K A;  1FC3 A;  4L9T A;  3IKV A;  3BJ6 A;  3W6K B;  4YIF A;  4EGZ A;  2YR2 A;  3M8E A;  2VC0 A;  2UWM A;  1ONV A;  1XD7 A;  3DQV C;  1BI0 A;  2MD5 A;  3WTT C;  5ILS A;  4RB1 A;  1R1U A;  4YFK F;  1CF7 A;  4OMZ A;  4KIF A;  5HDG A;  1X3U A;  2XRN A;  1YW8 A;  1TW3 A;  2EB7 A;  1J2X A;  2VT3 A;  3G73 A;  3E5X A;  4KMU X;  1BIA A;  3ZP5 A;  3ISP A;  5AIQ A;  2IJL A;  1ZLJ A;  4JBA A;  3QU3 A;  2F5C A;  4UVA A;  3WGG A;  2O8X A;  4Y15 A;  4TV7 A;  5ERI A;  5E1W A;  2PFB A;  4HV6 A;  1TTY A;  1YS6 A;  3CUQ C;  1I6X A;  1ZAR A;  2OBP A;  3SXY A;  1J59 A;  1DPU A;  3DF8 A;  5JI6 A;  1Q1H A;  1UFM A;  1FYM A;  5D4R A;  4ENM A;  3IRQ A;  4I02 A;  4BQA A;  4GYG A;  5KK1 A;  2H09 A;  4D0P A;  2VE8 A;  4M9X A;  5FLX Z;  4IHS A;  1T6S A;  3H92 A;  4R1H A;  1WSU A;  2MH2 A;  3FMR A;  1G3T A;  4M72 A;  3PFI A;  2DI3 A;  4G6Q A;  3TO7 A;  5L3G A;  2PLY A;  4IRG A;  2ZO4 A;  3NQO A;  5CVV A;  2FOK A;  3RPQ A;  3C18 A;  2Q2E A;  3RIR A;  1C0W A;  4ZYD A;  3FF5 A;  4UVB A;  2K02 A;  4BYY A;  1SD6 A;  4CHU A;  3R0J A;  3QPT A;  5D5V B;  1T39 A;  3L2C A;  1R1V A;  3WE2 A;  2EFO A;  4RGS A;  3WU1 B;  2FQ3 A;  1T98 A;  1WWX A;  2ACJ A;  2LKP A;  5BPI A;  4ETS A;  2DPU A;  1G3W A;  4WX9 A;  3MEX A;  5D5X B;  3U9G A;  4LK0 F;  2P5V A;  4KMF A;  4EJO A;  1F5T A;  4RAZ A;  3MAJ A;  2O61 A;  1KGS A;  4KIC A;  5FD6 A;  5L3E A;  2DT5 A;  2A3S A;  2FA5 A;  1U5T C;  1XDS A;  1LNW A;  1QBJ A;  2IVM A;  4HZF A;  4XSZ F;  5ILV A;  1T2K A;  2MLK A;  2PJP A;  2R3S A;  2R7D A;  3P9I A;  4L5J A;  2HGC A;  4KDP A;  4M6X A;  1IXS B;  2PMH A;  2EJR A;  2F5E A;  4EJU A;  3HRM A;  2VOP A;  2P7C B;  3CO6 C;  4LB6 B;  2VOD A;  2GZW A;  5HS8 A;  4BHC A;  1W7P A;  4JK1 X;  3L00 A;  4LG0 B;  2GQQ A;  4YII A;  2ZJ2 A;  1LEB A;  1RUO A;  2FNA A;  2V6C A;  1LDJ A;  3KP7 A;  2PQ8 A;  4ESB A;  2RN7 A;  3IHU A;  3WE3 A;  4KNY A;  5LEK A;  2IW5 A;  4P96 A;  1K78 B;  2WWY A;  2COM A;  5IT9 Z;  3D0S A;  1MZB A;  3JTH A;  3K1N A;  3KFW X;  1Z6T A;  3TO6 A;  1D3Y A;  3M7G A;  1OMI A;  3CDH A;  5BS6 A;  2RNJ A;  3H3Z A;  4XLN F;  1GVJ A;  3TKY A;  1TW2 A;  3GFM A;  1RNL A;  4U0Y A;  3HRU A;  1MDM B;  4I7H A;  2QM3 A;  1P4W A;  4M9S A;  4G7O F;  2G7H A;  3ZQ7 A;  3EYY A;  1SFE A;  3D5L A;  1UB9 A;  6PAX A;  1ULY A;  1ZRF A;  1IRF A;  1B59 A;  1TNT A;  5DUK A;  1IUY A;  3TDU C;  2W25 A;  3QU6 A;  3IWZ A;  4WXH A;  3IL2 A;  5F1R A;  2LNB A;  2QQ9 A;  4Z2Y A;  2IA1 A;  2QVO A;  2VN2 A;  5CYV A;  1IN7 A;  2DAO A;  1KQ9 A;  2EFW A;  4AIK A;  4Q5S F;  4BHB A;  3I58 A;  4O5V A;  3FMQ A;  3KEO A;  1I1G A;  2KRF A;  4L9V A;  1UST A;  2OQG A;  5LGN A;  3M1E A;  3LFK A;  2VOO A;  2HQN A;  2IRF G;  2A61 A;  4IPA A;  3E3V A;  2X0L A;  5IT3 A;  5J8C A;  2DO7 A;  5DV5 A;  4HX4 A;  4A6E A;  4HX7 A;  1FT9 A;  4MTE A;  1KU7 A;  2Z5U A;  3TGN A;  3ZMT A;  3SHF A;  1O3T A;  3N97 A;  4ZH4 F;  2O6G E;  1YO5 C;  2CFX A;  2M87 A;  2P5K A;  4OIN F;  2RC4 A;  4ENK A;  1G3Y A;  3K1M A;  4OOI A;  2XAQ A;  5TRD A;  2ZBK A;  1DPR A;  4HOB A;  3I54 A;  1MJA A;  2QBY A;  3RKY A;  4M73 A;  4B8X A;  3CUQ A;  5H6R A;  4U7D A;  5D6F A;  2J5O A;  1YS7 A;  1F9N A;  2VBY A;  1Z7U A;  3WG9 A;  4HDU A;  2FE3 A;  1OYI A;  2XV4 S;  1BC7 C;  4Y13 A;  2X4H A;  1J0R A;  5DD4 A;  1KU9 A;  1YTY A;  4PCQ A;  2AS5 F;  4HQM A;  1LEA A;  1F4K A;  1YW7 A;  2ZCW A;  3RYR A;  2L02 A;  3V8K A;  4ENJ A;  3M9A A;  3L9F A;  3GFI A;  3I4P A;  3ECO A;  4AD9 A;  5LGU A;  1FP2 A;  3ZPL A;  2STT A;  1FP1 D;  5DCM B;  3ELK A;  3KLN A;  1KYZ A;  2W85 A;  4OIP F;  2W57 A;  1MJB A;  3RPU A;  1TQM A;  1J9I A;  2F5F A;  3T5X A;  4LLG F;  2DK5 A;  1EH6 A;  5F64 A;  1V4R A;  4I0B A;  4DNC A;  1RI7 A;  4WK8 F;  2MA3 A;  3P9C A;  5J8F A;  2DU9 A;  3VEP A;  5JHU A;  3WTX C;  1U3E M;  1SMT A;  3DV8 A;  1E2X A;  1MJ9 A;  2FBK A;  4Q47 A;  2VT2 A;  3DPL C;  1USS A;  1P6R A;  3KLO A;  2Q8K A;  2CGP A;  3VOE A;  3TDZ C;  5HS7 A;  1T0F A;  1U5T A;  1JE8 A;  3J81 K;  5HS9 A;  2FMY A;  4AVP A;  4P9F A;  3BP8 A;  2A6H F;  5D5U B;  1S3J A;  4M6Y A;  4OMY A;  3BDD A;  1G4D A;  3BJO A;  1HBX G;  3ZMV A;  1FBS A;  1FYL A;  1IXC A;  2V1U A;  2A07 F;  3E6C C;  3V7S A;  4CIC A;  3HHH A;  3FZV A;  3E6D A;  4MNU A;  2L4M A;  3P7N A;  1EH7 A;  4A12 A;  3K2Z A;  2LDU A;  3F8M A;  4CYD A;  3T0Y A;  3WTU C;  1PP7 U;  2L01 A;  3CO7 C;  5HOO A;  3QOP A;  3FHZ A;  2XVC A;  3FXU A;  5DD8 A;  4R8H A;  4HQE A;  3DEU A;  1P4A A;  3I59 A;  5DDG A;  5D6E A;  2ELH A;  2IA0 A;  2DQR A;  1H0M A;  2A69 F;  3GEZ A;  5F6F A;  2ZXJ A;  5LEJ A;  3MWM A;  3H3U A;  1D5V A;  3DXJ F;  1S7O A;  3O2P E;  4O3M A;  3EYI A;  3QP6 A;  1TQI A;  1OKR A;  4P5O A;  1Z6R A;  2CW0 F;  5E1X A;  4EQQ A;  1D8K A;  5K5Q A;  1BIB A;  2H6B A;  3LA3 A;  2RQP A;  5E20 A;  2P6S A;  2XIG A;  3LQR A;  3L7W A;  4YFN F;  2W24 A;  4NQW A;  3C7J A;  1BJA A;  2BGC A;  3L09 A;  3BOQ A;  5JVT A;  1QZZ A;  1XGM A;  4ESF A;  4OIR F;  3EQL F;  3BWG A;  2B0L A;  4EGY A;  2KKO A;  2QQA A;  2K86 A;  2GA1 A;  3WTY C;  4XSX F;  1K79 A;  2L4A A;  4HAM A;  2C6Y A;  1XSD A;  2ZKZ A;  4ZYH A;  3KP6 A;  2ADU A;  4RB0 A;  2EFN A;  2FU4 A;  3B73 A;  2OD5 A;  4NHJ A;  3P9K A;  3C1D A;  1KU3 A;  2XRO A;  2VE9 A;  3F8C A;  4RGX A;  3EDP A;  1LDD A;  4BXU A;  5E8I A;  4ENN A;  2ZME A;  3GX4 X;  3V7C A;  1OR7 A;  2H6C A;  4CZZ A;  2M1B A;  5DUI A;  4G6D A;  4M71 A;  1YQA A;  1R00 A;  2VBW A;  2QQB A;  1UHW A;  4FT8 A;  4HF0 A;  4UNO A;  2A6E F;  1B4A A;  5L3C A;  1W7P B;  4KIG A;  3WU0 A;  4ZZL A;  2L54 A;  2NAZ A;  1PDN C;  1FOK A;  1J5Y A;  1YG2 A;  2YX4 A;  1RUN A;  1ODD A;  4CO8 A;  3ULQ B;  3GVA A;  3JTG A;  4ASN A;  4UHT A;  2V1D A;  2YX7 A;  4KN4 X;  3ZMZ A;  2FBI A;  2DTR A;  3LA2 A;  3ML6 A;  2HR3 A;  1FLI A;  1QQI A;  3BPX A;  1V3F A;  1U8R A;  4HW0 A;  3K0L A;  2TDX A;  3FXQ A;  1FSE A;  3TO9 A;  2OZU A;  1RZ4 A;  3KEQ A;  4CDG A;  5K5O A;  5ILU A;  2ISZ A;  4A2U A;  4GCV A;  5CVI A;  5L3B A;  4PDK A;  3REO A;  3C3W A;  1EV7 A;  1B9M A;  3WGI A;  2DW4 A;  3E97 A;  5FFZ A;  4IRH A;  4IRI A;  1IW7 F;  2NS0 A;  2HKX A;  1ZYR F;  4A0Z A;  5HLG A;  3SZT A;  3Q9S A;  1TQP A;  3ZN0 A;  5LHG A;  1SD5 A;  4S04 A;  4L0Z B;  4HV5 A;  1ZN2 A;  4MEY F;  4HLX A;  4OIQ F;  1T38 A;  5H20 A;  5LBQ A;  2O03 A;  2VBX A;  4GGG A;  3F21 A;  1A04 A;  2E7X A;  4WXD A;  3ABU A;  3VB2 A;  3GO5 A;  1J75 A;  2E1N A;  2JSC A;  2G7U A;  3Q5F A;  4LLN A;  2PMU A;  5LRS A;  4OIO F;  3V8L A;  3LA7 A;  3BJA A;  2ESN A;  5D8L B;  4EM1 A;  3F72 A;  2V9V A;  2DFI A;  3GW2 A;  2HFH A;  1R5H A;  3FXR A;  2GWR A;  2HWV A;  3ZMS A;  3GXO A;  2K4J A;  1ZH5 A;  5A2Q K;  5E18 F;  3U1D A;  3LST A;  3O3K A;  2PEX A;  3DFG A;  1R5G A;  3CUO A;  3CJN A;  2M30 A;  5ED4 A;  2E1C A;  4IVN A;  3GZ5 A;  3W6J B;  1K7A A;  2K7L A;  2ZNY A;  4UXN A;  1XGS A;  2PN6 A;  4Q4Z F;  1R58 A;  3R60 A;  5CVR A;  4UV8 A;  3JSO A;  1Y0U A;  4K2E A;  2XAF A;  4AWX B;  2RVC A;  2M5W A;  3KP4 A;  5D4S A;  4Q48 A;  1Z91 A;  3K9T A;  1E17 A;  2KIM A;  1K6O A;  3ZMU A;  4LG0 A;  2CWE A;  1KA8 A;  5ICG A;  2H94 A;  4WWC A;  3NEU A;  2PG4 A;  1O7L A;  2QZ8 A;  4BAY A;  1HST A;  4BHP A;  4A5N A;  4U0V A;  4RB2 C;  1K78 A;  3GYH X;  2OU2 A;  3F6O A;  3DPT A;  3JW4 A;  1O3Q A;  2OA4 A;  2WV0 A;  5LHI A;  4MQV A;  1L3L A;  4LMY A;  2D2W A;  3F22 A;  2DBB A;  1ZAO A;  3LQQ A;  5E17 F;  4M74 A;  2IP2 A;  2M45 A;  1YFH A;  2XAG A;  1ZHF A;  3BPV A;  2WC2 A;  4LFU A;  2MH9 A;  3QRF F;  1HQC A;  1MDM A;  1FX7 A;  4ZYE A;  1IN8 A;  3LAJ A;  2P5L C;  5E1Z B;  2HOE A;  5ICC A;  2P7V B;  1IN6 A;  3OV8 A;  2Z9O A;  2CO5 A;  3LWF A;  3AAF A;  2HDC A;  5EEH A;  2K4B A;  5JFR A;  2GXG A;  3KZZ A;  3J81 Z;  2EV6 A;  1SD4 A;  5AIP A;  3JAM K;  2FBH A;  1OYY A;  4EJT A;  3VOD A;  2RGV A;  4L9J A;  4N9H A;  1JHF A;  4P55 A;  2Z33 A;  4CGZ A;  4HBL A;  2NYX A;  4G7H F;  1PP8 F;  3HHG A;  2FNP A;  3ZMD A;  1SFX A;  2V79 A;  3IKT A;  4GO1 A;  3WTV C;  3BZ6 A;  2J5P A;  1NHA A;  1ZG3 A;  1FWZ A;  3HRT A;  1JXS A;  2XKP A;  1ZGJ A;  2Y0M A;  4EM2 A;  3M8F A;  2QWW A;  5BOX A;  2G9W A;  4N0B A;  1HW2 A;  3KZY A;  4U0W A;  1QNT A;  1WKM A;  3IRR A;  1HKT A;  1W5T A;  2XUB A;  3SZP A;  2QUF A;  1LDK B;  4Y17 A;  1CF7 B;  1SFU A;  4A6D A;  1Z9C A;  1I1S A;  4UV9 A;  5KVR A;  4MTD A;  4G9Y A;  4QWQ A;  4KUM A;  3T1B A;  1SAX A;  2VXZ A;  1B6A A;  1BC8 C;  2IT0 A;  2UZK A;  1W7P D;  2FXA A;  3RKX A;  4G8X A;  1BBY A;  1HW5 A;  5DYM A;  4FX0 A;  4QLC U;  1O57 A;  2QYO A;  2RDP A;  3I71 A;  3E5Q A;  3E5U A;  4I98 B;  3DP7 A;  2FRH A;  3NRV A;  4XRF A;  2BBY A;  2FML A;  3FWE A;  1G6N A;  5DCM A;  5AON A;  2D1V A;  2O3F A;  1U6G A;  1QGP A;  4YG2 F;  2E7W A;  1KQ0 A;  1W5S A;  5J6X A;  3HYI A;  1O3S A;  3N4M A;  1IN5 A;  1HKQ A;  2MC3 A;  5HDN A;  3QAH A;  4L18 B;  3HRS A;  3ECH A;  3J7A O;  4MHG A;  5FGM A;  5HLH A;  5LRR A;  1AWC A;  1REP C;  3PQJ A;  2EFQ A;  2Q0O A;  5K1Y A;  3RJP A;  4F7Z A;  1F1Z A;  1VTN C;  5ICE A;  3HUG A;  2NNY A;  2PI0 A;  1R23 A;  3I5U A;  3FX3 A;  5CVU A;  4RS8 A;  1R22 A;  1GXQ A;  3WGH A;  4UVC A;  3E6B A;  2DLL A;  3EET A;  2XAS A;  2YPR A;  1B1B A;  2STW A;  2HQR A;  3G3Z A;  4IXA A;  4WF2 A;  3KP2 A;  5L3D A;  1HKS A;  5D8K B;  1ZG1 A;  1BOA A;  1BI2 A;  5BMZ A;  4A5M A;  2YU3 A;  3HTS B;  1OPC A;  4G94 A;  1LQ1 A;  1XSV A;  3CTA A;  3SQN A;  2JPB A;  3CLO A;  4ON0 A;  4P9U A;  5BQT A;  2OAZ A;  1D8J A;  2JPC A;  2ZFW A;  4NB5 A;  3RYP A;  2EA4 A;  5CVJ A;  1S29 A;  5FB2 A;  3TOB A;  1UHM A;  2UXN A;  3ERE D;  3IC7 A;  4HLY A;  2HYF A;  4EJW A;  4I09 A;  1YYV A;  2RV8 A;  4MEX F;  2LSO A;  3WTS C;  3GLX A;  3F8N A;  3MZY A;  1S6L A;  1S8N A;  1QO0 D;  5H6Q A;  1FBQ A;  4L9N A;  1H9T A;  5LHH A;  3O6B B;  2P6T A;  3K1P A;  4H0E A;  2BEO A;  2WTE A;  4PGG A;  3GF2 A;  1L0O C;  5HDK A;  3WTZ A;  3TQN A;  1YW9 A;  3PQK A;  2W84 A;  4ZYG A;  2DK8 A;  1ZRC A;  1IAW A;  3ABT A;  4RGU A;  2MBF A;  1IN4 A;  1Z05 A;  2HZT A;  1JGS A;  5FO5 A;  5LLQ A;  3R61 A;  3GFJ A;  2QLZ A;  4HF1 A;  2V1X A;  2VON A;  3MFK A;  2GAU A;  4LB5 A;  4MQ9 F;  2IA2 A;  5FFX A;  3WOD F;  2RKH A;  1U78 A;  1TNS A;  1LJ9 A;  5FLX K;  1PUE E;  2XKO A;  4RAY A;  4I01 A;  1MGT A;  5A2Q Z;  1DP7 P;  2ZNZ A;  3LAP A;  1WRJ A;  2VBZ A;  1TLH B;  3HIF A;  4M9Z A;  1IZ1 A;  1STZ A;  2GA2 A;  1ON2 A;  3B02 A;  1S7A A;  2GIV A;  3E6M A;  2EFP A;  1R1T A;  4EVI A;  1H9G A;  3RI4 A;  2CSO A;  1EH8 A;  3EUH A;  2FEZ A;  1YIO A;  2BYV E;  1W4M A;  3R0A A;  4ZZD A;  1KU2 A;  5ICF A;  4L5I A;  5L3F A;  2P4W A;  4O6J A;  3HSR A;  2F2E A;  4U88 A;  2Z3Y A;  1ZRE A;  5FD5 A;  4LD5 A;  4RGR A;  2BV6 A;  1XSX A;  1LB2 A;  5LGT A;  1R36 A;  1BI1 A;  4IF4 A;  1DUX C;  1ZLK A;  4YFX F;  2K27 A;  4I2O A;  4WXC A;  3MCZ A;  1J7K A;  3V4G A;  2L3D A;  2FF4 A;  4KN7 X;  1SD7 A;  2KJC A;  1AOY A;  4RB3 C;  4AIJ A;  3COA C;  2EV5 A;  2XAJ A;  5HVQ C;  2QBY B;  1UCR A;  4AIH A;  3CUQ B;  3HTU A;  2BE5 F;  3MZH A;  3KET A;  4KIB A;  3OOP A;  5TJJ A;  3IWF A;  3J80 Z;  3GZ6 A;  1FPQ A;  1XGN A;  1B9N A;  2XGX A;  4KYW A;  1XCB A;  4XBF A;  4R79 A;  2R7F A;  2HEO A;  1BN5 A;  3F3X A;  1XGO A;  2OZ6 A;  2KIU A;  3FM3 A;  4HA8 A;  3RDI A;  3KE2 A;  1KYW A;  1WQ2 A;  3KCC A;  1BM9 A;  1ZGA A;  1XMK A;  5D5W B;  5IT9 K;  2XAH A;  2PBI A;  3JAM Z;  2DQL A;  5BPD A;  1IF1 A;  2ESH A;  2HYG D;  4KA4 A;  2EWN A;  4KFC A;  2JRT A;  4ESJ A;  2A5Y B;  4E70 A;  1MKM A;  2JT1 A;  5E8G A;  3HOT A;  4CXF A;  2KJB A;  3MQ0 A;  4S05 A;  3BRO A;  2DPD A;  2FSW A;  1ZG5 A;  1OYW A;  1XMA A;  3U2R A;  2MLG A;  1FNN A;  1ZRD A;  3JSP A;  1JHH A;  2M8E A;  3J80 K;  2EV0 A;  2CYY A;  4XLP F;  3RTR A;  3I64 A;  4OU0 A;  4EV0 A;  1XB4 A;  2LF8 A;  3HOS A;  1FY7 A;  2O0Y A;  2HTS A;  1FZP B;  1U5T B;  3HSE A;  4JQF A;  1P2F A;  4PZJ A;  5JR3 A;  4EM0 B;  4HX8 A;  4IJA A;  3KP3 A;  2NNN A;  1XDU A;  3I0T A;  1I27 A;  2Y48 A;  2ISY A;  4L0Y B;  4FX4 A;  2D1H A;  3F6V A;  4UUV A;  2UXX A;  4B09 A;  4LJZ F;  3F23 A;  4HF2 A;  3WTW C;  4GYI A;  2HKO A;  1BI3 A;  3ROU A;  1P92 A;  4HDV A;  3GFL A;  3KP5 A;  1KQ8 A;  1QPM A;  3SFZ A;  4WCG A;  2Y75 A;  5CLS A;  2D45 A;  3QP5 A;  2CQK A;  1HW1 A;  3TOA A;  3I59 B;  3F8B A;  1O7F A;  1FYK A;  1U2W A;  1RIO H;  4G7Z F;  1GHC A;  1SMY F;  4N9I A;  2EA2 A;  1ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...