2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Replication termination protein
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
3SFZA 3BY6A 3FHZA 2A6HF 3PQJA 2FXAA 2JTVA 5FGMA 4KICA 3E6CC 5D8KB 4OIQF 3DF8A 4NHJA 2AS5F 1P92A 3BDDA 2EFNA 2M87A 2OBPA 1W7PD 5E8IA 3VOEA 4EM0B 2QUFA 4O6JA 5IT9Z 1TBXA 1JHHA 3IRQA 2DK5A 5ED4A 1WKMA 2OZ6A 3N4MA 2DO7A 5DCFA 1FWZA 4OIRF 2PI0A 1OKRA 2JT1A 1RIOH 2COMA 2CGPA 2DAOA 2CYYA 4HDUA 1R00A 1QZYA 2HFHA 2JPBA 3Q5FA 1P4XA 1ZG1A 3ABUA 1ZREA 3LA3A 3VB2A 1QZZA 3MFKA 2JPCA 4R8HA 2L01A 2DT5A 3ZMVA 5CYVA 5DCMA 5DUIA 1ZHFA 5EEGA 1IRFA 1ZRFA 2H09A 1FY7A 3F8NA 1NHAA 1L3LA 4OMZA 5CVVA 2ZNZA 1D3YA 2YSRA 3H92A 3I0TA 3S2WA 4HX4A 3C7JA 2NNNA 4A6DA 3I53A 3K1PA 1K78B 2GXBA 3FXRA 3WODF 3PQKA 3BP8A 3COAC 5H6RA 4EJVA 4Q5SF 5HLGA 5CVRA 5BPDA 2VBYA 4XBFA 4L0ZB 3GXOA 4I98B 4A2UA 2HWVA 3SZTA 2ZFWA 3KEOA 5FB2A 2LNBA 3BJOA 1BOAA 5A2QZ 3KLOA 1Y0UA 2G7UA 3O3KA 2FBKA 2M45A 4CZZA 5L3EA 4GXOA 1O3QA 3LAPA 5DDGA 2R7FA 2ESHA 1U6GA 4ASNA 3BROA 1S8NA 1FSEA 3HRMA 5F1RA 3WGGA 5AONA 3HSEA 1J0RA 4M74A 5IT9K 1B9NA 3TOBA 1R1VA 1XMAA 4Z2YA 1LEBA 2BYVE 3KP5A 4ZYHA 3LQQA 2D1VA 4MGRA 3L7WA 2GWRA 2ESNA 1P6RA 1DPUA 3IL2A 2VOPA 4G7OF 5AIQA 4YFXF 1FOKA 1IUYA 1T39A 2G7HA 3E5XA 2XUBA 4GYIA 2MH9A 4CYDA 2XAHA 3DXJF 5CVUA 4BH9A 2HDCA 3EYYA 1V3FA 4EGYA 1R23A 5DCMB 1XGOA 4AVPA 1XDSA 4ZYEA 4M73A 4G94A 5F6FA 2EWNA 4ESFA 3FF5A 5E17F 3TKYA 4HF0A 3RPUA 1LQ1A 2UZKA 4B8XA 4RAYA 3SXYA 2GA2A 3QPTA 2EFQA 4KN4X 1BIBA 3GFMA 4JBAA 1IZ1A 3GFJA 2P5KA 1MGTA 4P55A 1QNTA 4XSZF 1MJBA 2QM3A 2FBHA 1WWXA 2XVCA 3W6KB 2R3SA 3JAMK 5LHIA 3C18A 2Q8KA 4MNUA 2ELHA 4CHUA 3F6VA 2E1NA 4RB1A 2EA4A 2FSWA 1SAXA 4O3MA 2PJPA 1B59A 3RJPA 1IN5A 3DV8A 1UCRA 1YLFA 1K78A 1BI2A 3RKYA 4G7ZF 3CUQB 3G3ZA 2DFIA 4QWQA 3HIFA 4KIFA 2F5CA 1U5TB 1EH7A 3EUHA 2EV0A 5BPIA 3C1DA 3F8CA 1T38A 1FYKA 3TO9A 1T98A 3DPTA 2ZBKA 3ULQB 4CO8A 1EH8A 5J8CA 4MQ9F 2FNAA 4L5IA 2G9WA 3I64A 3IKVA 2KIMA 3WGHA 4LLNA 2P6TA 1HSJA 3IWZA 2QQAA 2EFPA 2V79A 4WXCA 4EGZA 5D6EA 3EETA 1Z1DA 2VXZA 1KQ8A 3FXQA 5LGTA 2X0LA 4AIJA 2VC0A 2RDPA 2KIFA 3BOQA 2IT0A 4ENKA 2WTEA 4DNCA 5FLXZ 4HLYA 3HOSA 4UNOA 4LLLA 1ZH5A 3E5UA 3IHUA 1FSHA 3F22A 1ZG5A 1XB4A 3ZQ7A 1UB9A 1WI9A 2WWYA 4LB5A 1IXSB 3KP3A 1V4RA 5JI6A 1F1ZA 2ZCWA 1MKMA 5LGUA 1HKQA 4Q48A 1D5VA 4M9XA 4MQVA 4YG2F 2IW5A 1DDNA 3NRVA 1OPCA 5AIPA 4L9TA 2D45A 4MHGA 2VE8A 1XMKA 2KIUA 3C3WA 4KDPA 3ZMZA 3RIRA 3CO6C 1OYWA 1R58A 1CGPA 3K1MA 1USSA 2F2EA 4CICA 2O8XA 4EVIA 1FPQA 4A5MA 3W6JB 1LJ9A 1W5SA 1ON1A 4R79A 2A68F 3GYHX 5DV5A 1GXPA 2OA4A 1T2KA 4U0WA 3E6DA 3DP7A 4N9IA 4WK8F 3M9AA 2CSOA 1B1BA 3MZHA 3JTGA 2VT3A 3J81Z 5FO5A 1JGSA 2OD5A 3DEUA 2DW4A 1PP8F 3LAJA 3DQVC 1K7AA 3FM3A 5HDNA 1X3UA 3WU1B 2L54A 1G3TA 2L02A 1ZGAA 1BI3A 1KQ0A 3HRTA 2HZTA 1I27A 3CJNA 3TDUC 4XSXF 2CW0F 4HA8A 4I01A 1U8RA 2W84A 3K1NA 5CJ9A 5FFZA 3MZYA 1R1TA 4WX9A 5TRDA 1OYIA 4GGGA 1FNNA 1OR7A 3WTZA 2D1HA 4TV7A 4UVAA 2LDUA 5JVTA 1ZARA 2ZMEB 4HF1A 4AIKA 1WSUA 1S3JA 2MLGA 1ZN2A 4FT8A 4IVNA 3V7SA 1REPC 4OMYA 3GWZA 5E1ZB 5E8GA 2HYGD 4M72A 4M6XA 5BMZA 1GXQA 3QPHA 4AD9A 1IN6A 4G9YA 4O5VA 2EB7A 2QYOA 3WTVC 4LB6B 2OQGA 3I59A 2VBZA 5LHHA 5HDKA 2ZMEA 2M8EA 1BC8C 5ICEA 1QGPA 3HYIA 2K27A 4U7DA 4OU0A 5ERIA 4RB2C 2FNPA 5J6XA 4XLNF 1K79A 3ML6A 4IXAA 1XSVA 5LEKA 1J9IA 4YIFA 3P9IA 3WTXC 4Y15A 2XASA 2ZXJA 3ECHA 2KRFA 4ZZDA 5ICGA 3EYIA 5LBQA 1Z9CA 2BGCA 1IAWA 2EFWA 4E70A 1XSXA 3O2PE 5K5QA 5HDGA 4K2EA 4L9JA 6PAXA 3HTSB 3BJ6A 5HS7A 5TJJA 3JAMZ 1TQPA 3KZZA 3V4GA 1I1GA 3ZMSA 3RI4A 3J7AO 4KA4A 5JHUA 2HTJA 3T1BA 1J2XA 4RGRA 3KP4A 1FX7A 3L09A 2DPDA 1O3SA 3I58A 2V1UA 2R7DA 4WF2A 1OMIA 2MLKA 1K6OA 1KU9A 3F23A 4ZH4F 3GX4X 4EJWA 2NAZA 3QP5A 3NEUA 4MTDA 4Y13A 2XHKA 3ROUA 1XCVA 1YS7A 4L9NA 4I7HA 3M1EA 1TLHB 2QQ9A 3OOPA 4RGSA 4EJOA 4U88A 3ZP5A 3EQLF 1LNWA 3JTHA 3MAJA 2GXGA 3E6MA 2P7CB 2DTRA 3F72A 4KT5C 2STTA 2XIGA 2RC4A 1BI0A 3FX3A 3HHGA 5D4SA 2O61A 5HS9A 2PEXA 3O6BB 3I4PA 2FE3A 2Z33A 4HAMA 4M6YA 5EEHA 4U0VA 1E2XA 2J5PA 4I09A 3LA7A 1GHCA 3CUOA 1UHMA 1YIOA 3ERED 1Z6RA 1D8JA 1U5TA 3B73A 2ZKZA 3D0SA 2IA2A 3LFKA 1B6AA 2KJBA 5F64A 1DUXC 4KYWA 4P5OA 2V9VA 2O6GE 4HBLA 3M8EA 1H9GA 1LDKB 4N0BA 2DK8A 2YPRA 3WTUC 1KQ9A 2GA1A 3KP6A 1W7PA 2H94A 5BS6A 2BE5F 1YQAA 4ON0A 1SD6A 1T0FA 3ZMTA 4FX0A 3LSTA 5K5OA 3F3XA 4GYGA 4I2OA 5CVIA 3CUQC 5DUKA 2TDXA 4HF2A 1FC3A 2GIVA 1HW5A 2DLLA 4ZZLA 4G6DA 3FZVA 3J81K 2L4MA 1QBJA 2ETHA 3KP2A 5JFRA 2K7LA 2LF8A 2W57A 1RNLA 4EJUA 2P4WA 2EV5A 1O3TA 1PP7U 1H0MA 2IP2A 4I02A 3MCZA 2OU2A 4A12A 1ZGJA 5HVQC 3L00A 5D8LB 3WTTC 2YU3A 4BAYA 1RI7A 1E17A 3MEXA 4DQ2A 5ILVA 5HLIA 3HRUA 4EV0A 2F5FA 3WTSC 2CQKA 4FHTA 3TGNA 4KUMA 3TO6A 2XGXA 1BM9A 1IW7F 4BQAA 2RN7A 2HQRA 2EFOA 3QU6A 2VODA 2DI3A 1YW7A 2CFXA 3QOPA 2NYXA 4P9FA 1IRGA 1P4WA 2E1CA 4M71A 3RKWA 1FZPB 3QU3A 1W4MA 1TTYA 4M9SA 5D6FA 3RTRA 2E7WA 2XV4S 5FLXK 4BNCA 2VOOA 1QO0D 1UHWA 2X4HA 1SD7A 1KU2A 2QZ8A 2NNYA 3GFLA 2BEOA 1Z05A 2GZWA 1HW1A 2STWA 3F8FA 1B4AA 3ELKA 3T5XA 1TNSA 3GEZA 3KZYA 2NRAC 3V8KA 2MA3A 2PFBA 3KETA 2XAFA 4GCVA 2ADUA 4U0YA 2UWMA 2K4JA 1A04A 1DP7P 4RGXA 2VN2A 5LGNA 1G3YA 2KKOA 4PCQA 3TOAA 5K5RA 2GAUA 1CF7A 4EM1A 3T0YA 1F4KA 3WU0A 1LB2A 4U7BA 1XGNA 2B0LA 1L0OC 3E6BA 2HKXA 2WC2A 4UUVA 2KJCA 1MDMA 5FD6A 4OIOF 5D5WB 1JE8A 1MZBA 1KYWA 3H3UA 3GW2A 2H6BA 3TO7A 3GO5A 4KIGA 3F8BA 1ODDA 1BJAA 4BXUA 2HQNA 5ICFA 4LG0B 1U2WA 3F21A 4PDKA 4MTEA 1HQCA 4ETSA 5L3BA 2FU4A 2Y48A 5DD4A 1G3WA 4XRFA 1HKTA 4L0YB 3K2ZA 1I5ZA 2XAJA 3SQNA 1YO5C 3GZ6A 3Q9VA 5E18F 5L3CA 2LF7A 1O57A 1R5HA 5KK1A 3VODA 1SD4A 4F7ZA 4IHSA 3ZPLA 2HS5A 3G73A 5HS8A 4WCGA 1ZRCA 2PMUA 5JR3A 2FMYA 4I0BA 2LKPA 1S29A 2NS0A 3KEQA 1HXDA 2MBFA 3IRRA 4CDGA 1O7LA 1FBQA 5CVJA 5D5XB 4A0XA 3KLNA 1PUEE 5H6QA 3DPLC 4EJTA 4B09A 1P2FA 2YR2A 2BBYA 2E7XA 5DYMA 2XKOA 2VBWA 3VFZA 3CTAA 2L4AA 3EDPA 2ZO4A 4Y17A 3BPVA 4HQEA 2RGVA 5L3GA 1ZAOA 4LG0A 1TW2A 3Q9SA 3R60A 4YFKF 2IA0A 1T6SA 3HTUA 2J5OA 3L9FA 3ZMUA 2RV8A 3M7GA 2FMLA 3LQRA 2OZUA 2W85A 2QENA 1LDDA 3R0JA 3GFIA 4A0ZA 1MDMB 4UV9A 5D5VB 5DEQA 2PBIA 1FP1D 2DBBA 1YYVA 2ACJA 1AWCA 2QLZA 2UXXA 3P9KA 3J80Z 2DQLA 1O7FA 2PMHA 2RVCA 5LRRA 4S05A 4AIHA 4H0EA 2MH2A 4CGZA 3QAHA 3CDHA 1FT9A 4YIIA 3V7CA 2EJRA 1TNTA 1USTA 2XAGA 2ISZA 3RYPA 2ISYA 5FD5A 4QLCU 1XN7A 4RAZA 2HTSA 5A2QK 1FYMA 3R61A 4NQWA 4LLGF 3DKWA 3P7NA 2M5WA 3VEPA 4RGUA 5E20A 2H6CA 1SMYF 4UVCA 3JSOA 5L3DA 1W5TA 4HYEA 1ZRDA 4P9UA 4ENJA 5J8FA 3OV8A 1KU3A 2V1DA 2A6EF 1R5GA 4UVBA 3K69A 1HSTA 3CUQA 1IF1A 1VTNC 4Q4ZF 1KGSA 2VT2A 2HYFA 5DD8A 4KMUX 1U3EM 2Z99A 2CWEA 2Y75A 3I59B 2FBIA 3V7RA 5LEJA 3F8MA 1FBSA 1HKSA 1SFEA 2L3DA 4D0PA 3H3ZA 2ZNYA 1G4DA 1ZLJA 2HGCA 1STZA 4YFNF 5KVRA 2OAZA 1J5YA 1ONVA 4MEXF 2Q2EA 1YW9A 2MC3A 2K02A 1FBUA 2O3FA 1U5TC 4R1HA 1Q1HA 1FYLA 1FP2A 4UV8A 3K9TA 1BIAA 4PZJA 3MWMA 4A5NA 3BWGA 1Z91A 5LLQA 2RKHA 1WQ2A 2RNJA 4EM2A 4ZYDA 1MJ9A 5ICCA 3R4KA 3GUDA 1F5TA 3FWEA 3TDZC 3KFWX 4LMYA 3PFIA 4BHPA 4BYYA 2PLYA 3SHFA 2P5VA 1TQMA 4OIPF 3K0LA 1IXCA 1W7PB 1U78A 4LFUA 2QVOA 4IRGA 1XCBA 2XAQA 3WE3A 3BPXA 3MQ0A 1HW2A 3GVAA 3FM5A 4ENNA 4OINF 5D5UB 2F5DA 3NQOA 1KA8A 1JXSA 1LDJA 1YG2A 4IRHA 2YX4A 2LSOA 3V8JA 3U1DA 5FFXA 3B02A 5CLSA 3R6SA 1J75A 4G7HF 1GVJA 1ZYRF 1BI1A 4L5JA 3FXUA 4S04A 4PGHA 4IHTA 4M9ZA 3IC7A 1XD7A 4ESJA 2PN6A 5K1YA 3HSFA 3JW4A 2P7VB 2DU9A 3ABTA 3U9GA 4L18B 2K86A 3AAFA 1C0WA 2M1BA 2V6CA 1TW3A 2Z5UA 3RDIA 2M30A 2PG4A 1WRJA 1OYYA 5ILSA 4BHBA 3RYRA 3ECOA 5ILUA 2JZYA 3REOA 3DFGA 2RQPA 1I1SA 1F9NA 2A3SA 2XRNA 2O0YA 2DQRA 4JK1X 2EA2A 2Q0OA 2IJLA 4Q47A 1I6XA 4G6QA 1IN7A 1Z7UA 5BOXA 1P4AA 3HRSA 1FLIA 4KIBA 1S7OA 2OQRA 4LJZF 4IRIA 5HOOA 1G6NA 2IPQX 5IT3A 1XDUA 3I54A 4A0YA 1EV7A 1R1UA 1MJAA 3HOTA 4HLXA 2P8TA 3I71A 4ESBA 3WTYC 2HOEA 2BV6A 3U2RA 3ZN0A 4MEYF 3E97A 4HV5A 2K4BA 3HHHA 4PGGA 2WV0A 3M8FA 3GZ5A 1YW8A 3HUGA 5LRSA 4RB0A 3FMQA 4LK0F 1S6LA 4HX7A 1BC7C 4FX4A 2P5LC 2CG4A 3T8TA 5HLHA 3ZMDA 4HZFA 3CO7C 2QQBA 1RUOA 3I5UA 3D5LA 1QPMA 4G8XA 1JHFA 3LWFA 3L2CA 4HV6A 3FMRA 4RS8A 4N9HA 2XKPA 1R22A 2QWWA 1YS6A 3N97A 2DPUA 2AXLA 1MD0A 2ZJ2A 4UXNA 2O03A 2YX7A 1ZG3A 3TQNA 1SD5A 3IWFA 3P9CA 5H20A 1XGSA 4HW0A 4I0AA 2GQQA 1ON2A 3QRFF 1J7KA 3RKXA 5LHGA 1J59A 3E5QA 1D8KA 3E3VA 4ZYGA 2QBYA 2VONA 1XGMA 1LVAA 3LA2A 3FMSA 3IKTA 4LGWA 1UFMA 4BHCA 5E1WA 1ZLKA 1KYZA 2P6SA 2F5EA 2VE9A 4WXDA 3WGIA 3F6OA 3WTWC 2JRTA 2W24A 1XSDA 3SZPA 1ULYA 4RB3C 2FEZA 4XLPF 3QP6A 4HQMA 2IRFG 2UXNA 3T8RA 3J80K 4GO1A 1DPRA 1Z6TA 2VC1A 4WWCA 1IXRC 2Y0MA 1SFUA 4ENMA 4KMFA 3V8LA 3WG9A 2H27A 2W25A 1TQIA 1YFHA 1BN5A 1S7AA 4IF4A 2EK5A 3HSRA 5E1XA 2Z9OA 3KP7A 1O3RA 2A69F 1R7JA 3ISPA 4KFCA 4HX8A 2JSCA 2XROA 2VBXA 3KCCA 3JSPA 1RUNA 2FA5A 2V1XA 4IPAA 4OOIA 1SMTA 4NB5A 2HKOA 2EV6A 1QQIA 2A07F 2FRHA 1CF7B 2C6YA 4IJAA 1LEAA 1IN4A 2QBYB 3RPQA 5L3FA 4HDVA 2A61A 1BBYA 3GLXA 1PDNC 4EQQA 3GF2A 2D2WA 3BZ6A 5BQTA 5D4RA 1YTYA 2FF4A 3R0AA 3BJAA 1AOYA 4P96A 1SFXA 1KU7A 4KN7X 4LK1F 3ZN1A 4JQFA 4L9VA 3CLOA 1G3SA 3WE2A 1R36A 1B9MA 4CXFA 4WXHA 4UHTA 2MD5A 2PQ8A 2Z3YA 4KNYA 3KE2A 4A6EA 1IN8A 1RZ4A 2IA1A 1HBXG 2CO5A 4AWXB 2A5YB 2FOKA 2HEOA 2IVMA 4HOBA 2FQ3A 4LD5A 1EH6A 4EMSA 2HR3A 1H9TA
chains in the Genus database with same CATH superfamily
3A01A 1QU3A 2F5VA 3OYMA 2LRDA 3SFZA 4E7HA 4V2FA 4BY7J 3EUAA 5DTDA 4XKCA 2GIZA 4ZC3A 3BY6A 3VWBA 2JVHA 3JRCA 4W1UA 3FHZA 2A6HF 4DIQA 3AG1H 4IZZA 2BOLA 5TGTA 3ZQFA 1FMVA 2LFBA 3PQJA 2DFFA 4DYRA 4EATA 2O8KA 1T95A 1MSFC 2FXAA 2JTVA 3FIWA 5FGMA 2VPRA 4KICA 4Y7NJ 3E6CC 3KYCB 3DTKA 5D8KB 3WG7H 3JRBA 2M4GA 3IH3A 2X51A 2GM4A 4AIDA 1Y6IA 3KYDB 4OIQF 3DF8A 4ZTFA 1YI2I 4NHJA 3IH4A 2HOSA 1Z0XA 2AS5F 1P92A 3BDDA 1D0ZA 3TBIA 2EFNA 3OYBA 2M87A 2BW3A 2OBPA 3CCRI 1W7PD 4A69C 1MBHA 3NARA 5E8IA 4PJJA 3VOEA 4EM0B 2QUFA 3ABLH 2Q2EB 3G71I 4O6JA 3BG7A 5IT9Z 1FMWA 1JHHA 1TBXA 3TP3A 5HLTA 3FKJA 2DK5A 3IRQA 1HCRA 5ED4A 1WKMA 1ORKA 2OZ6A 3ZGKA 1PUFB 3N4MA 2VKEA 2BW3B 2XF7A 2DO7A 5DCFA 1FEXA 1FWZA 2M9HA 4OIRF 2PX9A 3M8JA 5GTHC 4BJ5C 1RR8C 2FQ4A 2PI0A 1OKRA 4B43A 2JT1A 5B5EC 2E5ZA 1RIOH 1QVTA 1XC5A 1WVRA 4XN3A 1F43A 2COMA 5E3NA 2CGPA 2DAOA 2DA5A 3QWLA 1MBJA 3HOWJ 1SVLA 2CYYA 4C30A 4HDUA 3H5NA 1R00A 1D1AA 4PSXA 2B9SA 4HNVA 3HGYA 5J3LA 1QZYA 2HFHA 2JPBA 1GUUA 3Q5FA 1MMNA 1P4XA 2BY1A 1ZG1A 4ZDOA 3ABUA 1GDTA 3UR3C 1ZREA 1ETXA 3TW6A 3LA3A 4A3BJ 3BR2A 3EPZA 3VB2A 1QZZA 3MFKA 3C2HA 2JPCA 5F1JA 2L5QA 4R8HA 2K9LA 2L01A 2DT5A 3ZMVA 5FLVA 4NC8A 2ELKA 5CYVA 1JGGA 5DCMA 5DUIA 2MSYA 2HXIA 5J1RA 4EEFG 1ZHFA 4DZPA 2B63J 3QYFA 4BKXA 4XICA 1VQ5I 5EEGA 1IRFA 4NDLA 3GTOJ 2XPUA 1VQMI 1ZRFA 2H09A 1FY7A 3F8NA 1NHAA 1L3LA 2HZDA 4OMZA 1D0XA 5CVVA 2X6YA 2ZNZA 1D3YA 5FRNA 2YSRA 3H92A 2VQCA 1JT6A 2E1MB 3KX2A 2DT7B 3I0TA 3S2WA 4HX4A 2WY8Q 3Q0WA 1RPWA 1P7IA 3C7JA 4XN0A 2NNNA 1H89C 4B1RA 4A6DA 1JI8A 2DMNA 3I53A 3K1PA 3KPHA 1K78B 3KZIC 1X4OA 2GXBA 1R4NB 3FXRA 1OFCX 3SDGA 3WODF 3PQKA 3BP8A 3QOEA 3COAC 2CUFA 5H6RA 4EJVA 3HKZN 4AM3A 5FKKA 4Q5SF 2I10A 5HLGA 5CVRA 2NVYJ 2DDBA 5BPDA 2VBYA 4XBFA 4L0ZB 2EZLA 1ZGWA 2ME6A 3J7AY 2Y0SA 2DODA 3OYIA 2R7XA 1BOBA 1PYVA 3GXOA 4I98B 4A2UA 3OYKA 2HWVA 3SZTA 2MC4A 2ZFWA 3KEOA 5FB2A 2LNBA 4CCJA 4RDUA 3BJOA 3PJRA 2X6OA 3LOCA 2IGOA 3OR2C 1BOAA 1VI0A 3I4NJ 3BR0A 2EIKH 1S5LC 2JA2A 5A2QZ 3KLOA 5J1YA 2ZJPF 1Y0UA 3K10A 2G7UA 1BW5A 3O3KA 2JVGA 2FBKA 2XB0X 4Y3OA 2M45A 4CZZA 5L3EA 4GXOA 1O3QA 1D0YA 2R7FA 2ESHA 5DDGA 3LAPA 1U6GA 4ASNA 2LY9A 3BROA 1S8NA 1FSEA 2KRCA 1QZEA 3HRMA 3ONQA 5F1RA 3WGGA 1VFCA 5AONA 3HSEA 1J0RA 5GAHJ 2H1LA 3N05A 3GTKJ 4M74A 4G12A 1WJEA 5IT9K 4B47A 1B9NA 3TOBA 4HNUA 2CV0A 1VQ4I 1R1VA 1AKHA 5CKTA 1TL8A 2HPMA 1XMAA 3M1CA 4Z2YA 4BEHA 4DBRA 1LEBA 2BYVE 3KP5A 4NC7A 2E2HJ 4BBSJ 4ZYHA 2A5WA 3LQQA 4C2TA 1I3AA 2D1VA 1O4XA 1X3WB 4XKWA 4HSRA 4MGRA 3L7WA 1B72A 2GWRA 3BQYA 2ESNA 2L9RA 1P6RA 4H4KC 1DPUA 1IJWC 3IL2A 2VOPA 3BR3A 4G7OF 2K9QA 2IBDA 2CV1A 3C2BA 5AIQA 2WAEA 4YFXF 4C3HJ 2LYCA 4MLOA 4DGWB 4IOCF 1FOKA 1IUYA 4I6ZA 1SANA 1T39A 2G7HA 3E5XA 2XUBA 3DCFA 2IGKA 3VYRB 4XIDA 4GYIA 2JUGA 2R7SA 3DTIA 5HNHA 1DU6A 5GPCA 4XR6A 3K6GA 4E7SA 4C3JJ 5B3SH 2MH9A 4N4NB 2XAHA 4CYDA 1XG1A 2XF5A 3DXJF 2JA8J 1ACIA 5CVUA 4F93B 4BH9A 2HDCA 3EYYA 1V3FA 4EGYA 2D5VA 1HDPA 1R23A 5DCMB 2W82A 1ERDA 3K4BA 1XGOA 2QGUA 2M4KA 2DFHA 4AVPA 2R7OA 1XDSA 1N78A 1F36A 4ZYEA 4M73A 1JTYA 4G94A 3OSGA 1G59A 5F6FA 2EWNA 4C3IJ 1G2HA 5FKMA 4ESFA 2H1KA 1OCOH 3FF5A 5E17F 2XB5A 4CUGA 3L2UA 2JMWA 3OIOA 3RQ4A 1LE8A 3IP4B 3TKYA 4HF0A 3RPUA 1LQ1A 2IS6A 2UZKA 4B8XA 4RAYA 4OAYA 1R49A 2ZXHA 1HOMA 4ZDPA 3SXYA 2LP0A 2GA2A 4D7NA 3QPTA 2EFQA 4KN4X 2BY3A 3LFUA 1DU0A 1WFXA 3HOUJ 1BIBA 3CMMA 3GFMA 4JBAA 1IZ1A 3CF2A 3GFJA 1UG2A 2F48A 1ZQ3P 2IAIA 4BDYA 1WPKA 5KAIC 2HXOA 1V5FA 2P5KA 1MGTA 3OYFA 2VPLA 4PJMA 4P55A 1QNTA 1MNEA 4XSZF 1MJBA 1QHGA 2QM3A 2FBHA 2VLAA 4BY1J 4XQFA 1WWXA 2XVCA 2K3PA 5FLMJ 3W6KB 2R3SA 3C2GA 5LHIA 3JAMK 3C18A 2Q8KA 4MNUA 3W2AA 1WCMJ 2ELHA 4CHUA 3F6VA 2E1NA 4Y52J 1EKEA 1FIAA 4RB1A 2EA4A 1OLTA 3M3YJ 2FSWA 1BW6A 4GRIA 5BNGA 1YJWI 1SAXA 4O3MA 2PJPA 1B59A 3RJPA 1RKWA 2CJJA 1VQ9I 1OCRH 3JRGA 3GTPJ 1IN5A 3DV8A 1H8AC 1UCRA 2GLOA 1K4TA 1ETWA 1ZELA 1X1PA 1YLFA 3OWTA 2B7EA 4XONA 1K78A 1BI2A 4V2GA 2EH3A 3RKYA 5M3FJ 4G7ZF 3CUQB 3G3ZA 4ZYAA 1OJLA 2DFIA 3BCBA 5EG0B 4QWQA 4RM3A 2V26A 4ZDLA 1B8IA 3HIFA 4KIFA 5GAEJ 2F5CA 4D1QA 1U5TB 1EH7A 3EUHA 1Z77A 2EV0A 5BPIA 3OYCA 1ZTRA 3HM5A 3C1DA 3F8CA 1T38A 1FYKA 4II2A 3TO9A 1T98A 3TL4X 4AYBN 2LY1A 5KCMA 3DPTA 2ZBKA 3ULQB 4CO8A 2L2OA 1EH8A 4RAGA 5J8CA 1R9TJ 4GDFA 2M3AA 2LBFA 4BDZA 4MQ9F 2FNAA 4L5IA 4A3DJ 4XLFA 2G9WA 3I64A 3IKVA 2YUSA 3IAM2 3S1NJ 1LFBA 2KIMA 2NS7A 3CDLA 3WGHA 4LLNA 5B1BH 4KITB 2P6TA 3A4CA 1HSJA 3IWZA 1ETKA 2QQAA 3CMEI 2EFPA 2V79A 4WXCA 4EGZA 5D6EA 3EETA 5F08A 2DA7A 1Z1DA 2VXZA 1KQ8A 3FXQA 3NWTA 5LGTA 3HOVJ 2X0LA 4AIJA 2VC0A 2RDPA 1AA7A 2KIFA 4A3MJ 3PUBA 1UG0A 3BOQA 2IT0A 4ENKA 4II3A 2WTEA 4DNCA 4XRSA 5FLXZ 4HLYA 1W0UA 3HOSA 3FK6A 4UNOA 3SEZA 4BQNA 4BE1A 4F91B 4LLLA 1ZH5A 3BG9A 3E5UA 2QSFX 3IHUA 1FSHA 3F22A 1ZG5A 1Y56A 1XB4A 3ZQ7A 3CZ6A 2K5CA 3A03A 4CSWA 1UB9A 2LK2A 1WI9A 2WWYA 5LD2C 3ZRGA 4LB5A 1IXSB 2JUCA 1TT5B 3KP3A 1V4RA 5JI6A 2Y2ZA 1F1ZA 2ZCWA 3G1MA 1MKMA 5LGUA 3CCSI 3I4MJ 1I39A 4MIMA 4A3LJ 1A36A 1HKQA 4Q48A 1ETVA 1D5VA 2A6TA 3ZQQA 1T08B 4M9XA 4MQVA 2NOJB 4YG2F 1YX3A 2IW5A 1DDNA 2OJED 5IYCJ 2VKHA 1GLNA 3TP0A 3RKQA 3AFHA 2DTZA 4GFBA 3NRVA 1FTZA 1HA8A 1OPCA 2ZC2A 5AIPA 4KT6A 2E34A 3E0JB 4L9TA 2D45A 2JN6A 4MHGA 2VE8A 2KLOA 4D5CA 3CMYA 1XMKA 2KIUA 1IRZA 2K9NA 3C3WA 1ENHA 1NG6A 1MMDA 3CMAI 3GTJJ 2LKXA 4KDPA 3PIPF 4FE4A 3L2WA 1OCTC 3ZMZA 3RIRA 4PK4A 1ETYA 1OYWA 1R58A 3CO6C 1CGPA 1VQ8I 1YJNI 3LSMA 3K1MA 1USSA 3BTIA 2Y0SN 2F2EA 2E1OA 2MD0A 1S7EA 4CICA 2O8XA 4EVIA 1FPQA 2VJ5A 4A5MA 1X58A 1LJ9A 3W6JB 1W5SA 1ON1A 1UJ8A 2E1MC 3BG3A 3V42A 4R79A 2M0MA 4Y4RA 2A68F 5F0FA 3GYHX 5DV5A 5DM6F 1GXPA 2OA4A 1T2KA 4U0WA 3PNYA 3E6DA 3DP7A 3E1SA 3H3VK 3QQAA 1TWGJ 4N9IA 2N8GA 4XK4A 3PNTA 4WK8F 4NQWB 3HOYJ 3M9AA 2XRLA 2CSOA 1B1BA 3MZHA 3JTGA 2V7FA 2VT3A 3J81Z 4XNFA 5FO5A 2QKLB 1BL0A 4BS9A 1JGSA 4E6KG 2OD5A 4JX4A 3DEUA 2DW4A 3A2KA 3OYDA 1PP8F 3LAJA 3DQVC 3FXKA 1K7AA 4JX6A 3FM3A 3PSFA 4XORA 5HDNA 2VJIA 2GXAA 1X3UA 2XSDC 3WU1B 2L54A 1G3TA 2L02A 1ZGAA 2L7FP 1BI3A 1KQ0A 3HRTA 3W3CA 2E5NA 4DJAA 1RC9A 2HZTA 2ID3A 1I27A 4S0HB 3CJNA 3TDUC 2R92J 2W7NA 1WHUA 2BY2A 4XSXF 3BR5A 2CW0F 4A3IJ 1WJBA 4HA8A 4I01A 2AXTC 4FASD 1SFOJ 2ELJA 1FOWA 3ZQGA 2CQQA 3K4MA 1U8RA 2W84A 3K1NA 3MKWB 4MFDA 5CJ9A 5FFZA 3MZYA 3H0DA 1R1TA 3NWSA 2YU9J 4WX9A 2M7AA 5TRDA 1QPIA 2PMZA 1OYIA 4GGGA 4HPQA 1FNNA 2NS8A 4DZJA 1OR7A 3WTZA 2D1HA 4TV7A 1DGRM 4UVAA 4OWRB 2DOAA 2G0EA 2LDUA 2LMDA 3MVPA 5JVTA 1ZARA 2ZMEB 3UKGA 4HF1A 4AIKA 4MFEA 5B66C 2LKSA 1WSUA 4PJLA 1S3JA 1QVUA 3LMMA 2MLGA 2NOGA 1H88C 1MBGA 1ZN2A 1UELB 4FT8A 4IVNA 2CUJA 3S14J 3V7SA 1REPC 5JLXA 4OMYA 3GWZA 5E1ZB 5E8GA 2HYGD 3Q0VA 4M72A 4M6XA 5BMZA 1GXQA 3QPHA 4AD9A 3OS2A 1OR7C 1IN6A 3GCMA 4G9YA 4O5VA 2EB7A 2QYOA 2JQ7A 3IAS2 1JJ8C 2DJNA 3G2BA 1RRJA 3WTVC 4LB6B 2OQGA 3I59A 2VBZA 4YEJA 5LHHA 3SEQA 2GBYA 2DJIA 3GTGJ 5HDKA 2ZMEA 2M7BA 1IV8A 3HC7A 2M8EA 1BC8C 2DYRH 3RQIA 5ICEA 1QGPA 3HYIA 1SVMA 4CCNA 2K27A 2K9SA 4U7DA 1TT0A 3JRHA 1MMGA 4OU0A 3BT9A 1A6IA 5ERIA 4RB2C 2FNPA 2KDOA 4XLNF 5J6XA 1K79A 3K4LA 4ZJZA 3ML6A 4IXAA 1JUPA 1XSVA 5LEKA 1JUMA 3JRDA 2EIJH 2M34A 3CDIA 3PO2J 4YIFA 3P9IA 3WHCA 5KAFC 3WTXC 1J9IA 1NK3P 4Y15A 4BXFA 2GOXB 2XASA 4YIRX 2ZXJA 1MMAA 3I56I 3ECHA 2KRFA 4ZZDA 1YITI 5ICGA 3EYIA 3DU6A 5LBQA 1Z9CA 1FTTA 4BJ6C 2BGCA 2NVQJ 1IAWA 2BVLA 4A3CJ 2BVMA 5EZHA 2EFWA 4E70A 1XSXA 4XLAA 1MBEA 4LG3A 3O2PE 5HDGA 5K5QA 3HXLA 2F4MB 3CCUI 1GVDA 1R5ID 1B8IB 5FKOA 4K2EA 2L7ZA 5EG0A 5EZGA 2DOFA 4L9JA 3CCQI 6PAXA 3DKXA 3HTSB 3BJ6A 5HS7A 5TJJA 3JAMZ 1TQPA 3KZZA 3V4GA 1I1GA 3K4JA 1R71A 2BZTA 4XKBA 3BZCA 3ZMSA 3OYGA 3RI4A 3J7AO 4KA4A 5JHUA 2HTJA 1K61A 2IS4A 2X6XA 3T1BA 1J2XA 4RGRA 3KP4A 2M0CA 1FX7A 5GPAA 2MG4A 3L09A 2DPDA 1T0FC 1O3SA 2IEKA 3I58A 2V1UA 2R7DA 4WF2A 3ZXSA 3OYJA 1OMIA 2MLKA 1ZK8A 2L9SA 1K6OA 1KU9A 4X1EA 2ZJQF 3F23A 4ZH4F 2L9VA 3GX4X 4EJWA 4IHVA 2NAZA 2AO9A 3QP5A 3NEUA 2KRHA 4MTDA 2K9MA 1POGA 4E7LA 4Y13A 1D5YA 2EILH 2DA1A 2HDWA 2E71A 2LY2A 2XHKA 3QPLA 3ROUA 2VASA 1XCVA 4A93J 2R7WA 1U9OA 1YS7A 4A3EJ 4L9NA 3VSLA 4I7HA 2MGQA 3M1EA 1TLHB 2QQ9A 3QYBA 2HOAA 3OOPA 3RSNA 4RGSA 1SFKA 4HRIA 2F6CA 4EJOA 1D1CA 4M3GA 3EQLF 4U88A 3ZP5A 2QA4I 3DWLE 1FOYA 1LNWA 2LVSA 5GTIC 3JTHA 4HEA2 1JTXA 2ZB9A 2DCEA 3MAJA 5J1UA 2CUZA 2GXGA 3E6MA 4CCLA 2Z1DA 3S8PA 1TWHJ 1WGXA 3JRAA 2P7CB 2ZSIB 1T8IA 2R5ZB 2DTRA 3F72A 4KT5C 3PO3J 2STTA 2XIGA 5C3EJ 3J7ZI 3WHBA 2RC4A 2OUMA 4QPOA 1BI0A 1Y0NA 3FX3A 3HHGA 3CCMI 2CS3A 2VXDA 5D4SA 2O61A 2V4JC 5HS9A 4F92B 2PEXA 3O6BB 3I4PA 2LTPA 2FE3A 2Z33A 5K7ZA 3ZQLA 4CA0A 2HOTA 4HAMA 4M6YA 5EEHA 4U0VA 1E2XA 2J5PA 3FK7A 2WADA 4I09A 4AC0A 2EIMH 3LA7A 3CCEI 1GHCA 3CUOA 1UHMA 2HI3A 1LPQA 1JUSA 1LKXA 1YIOA 1G8XA 2R4GA 3M4OJ 3MKYB 1IV6A 3QPSA 2IS2A 4XOPA 3ERED 3FISA 4YELA 1XTAA 1Z6RA 1D8JA 1U5TA 1VQ6I 2VJ4A 1VZ0A 3B73A 2PJRB 2ZKZA 1MNMC 3ERMA 3D0SA 4Y33A 3OYHA 3FKIJ 4M3DA 2IA2A 3LFKA 4IOAF 1B6AA 3GTLJ 2KJBA 1I50J 3BZKA 4E7JA 5F64A 1DUXC 4KYWA 2DMPA 4P5OA 2ICWG 2V9VA 2O6GE 3BLYA 4HBLA 3M8EA 1H9GA 4QIWN 1LDKB 4N0BA 2W48A 2DK8A 2YPRA 3WTUC 4OAZA 2R7UA 4BXXJ 1KQ9A 2GA1A 4B3AA 3KP6A 5FROA 3PIOF 1W7PA 3L2QA 2H94A 5BS6A 2BE5F 1YQAA 2OC6A 3G1OA 4ON0A 1SD6A 2V6EA 1T0FA 2BHYA 3ZMTA 4FE7A 3TEDA 4FX0A 3LSTA 3WU2C 5K5OA 1VNDA 3F3XA 2EZKA 4GYGA 3OYLA 4I2OA 5CVIA 3CUQC 2XC7A 5DUKA 2TDXA 4HF2A 1MBFA 1FC3A 2GIVA 3MKLA 4I99C 5KHDA 3S93A 5B1AH 1HW5A 3K4CA 3S1RJ 2DLLA 4ZZLA 5FRMA 4IO9F 3MD2A 4G6DA 3FZVA 3J81K 9ANTA 2L4MA 1QBJA 1ETQA 2RREA 2ETHA 1Z21A 3KP2A 4MO7A 5JFRA 1Y8RB 2K7LA 2LF8A 3CQZJ 3KYLA 4BE2A 2ZJRF 2R7VA 4B4CA 2W57A 4F3QA 3LSGA 1BR4A 1Q1VA 1E3HA 1RNLA 4EJUA 4J00A 2P4WA 2EV5A 2FJ1A 1OCZH 5EDNA 1O3TA 1LE8B 1PP7U 1H0MA 4PFOA 2IP2A 2A05A 3QYEA 4I02A 3MCZA 2OU2A 4A12A 3ABMH 1UZCA 1Y8QB 2KQRA 1ZGJA 5HVQC 3CC2I 3L00A 5D8LB 2HQAA 1PUFA 3WTTC 2YU3A 2LOOA 4BAYA 1PJRA 3FXOA 5DS9A 2VL8A 1RI7A 1E17A 3H5RA 3H5AA 3MEXA 4DQ2A 5ILVA 5HLIA 3DLAA 1TWAJ 3HRUA 2DA4A 2BY0A 3H35A 2AQEA 4EV0A 1IDZA 2F5FA 3WTSC 2CQKA 3AL0C 4D5FA 4FHTA 3TGNA 1A6QA 2HNHA 4KUMA 3TO6A 1BJZA 2XGXA 2HDDA 1BM9A 1IW7F 1X19A 4BQAA 3GMEA 1V54H 4F52A 2RN7A 2HQRA 2JA6J 2EFOA 3QU6A 2VODA 2DI3A 1YW7A 3ZCOA 2CFXA 1SAUA 2CRGA 2LR8A 3QOPA 2JK3A 2NYXA 1ETOA 4E7KA 1QA6A 4P9FA 2VKVA 4AU7A 2UUZA 1UMQA 2RAEA 1IRGA 1P4WA 2E1CA 3IH2A 2CQNA 1YRNA 3AL0B 4M71A 3RKWA 1FZPB 3QU3A 2ID6A 1W4MA 3LNQA 1TTYA 4M9SA 5D6FA 3RTRA 2E7WA 3S2HJ 4UB8C 2CQXA 2XV4S 3AG2H 5FLXK 1A35A 4BNCA 2DMQA 3D5SC 1QO0D 1UHWA 2X4HA 1SD7A 1KU2A 1YIJI 1RETA 2VOOA 4BACA 2KZVA 4M3EA 1X2MA 1AKHB 2QZ8A 2NNYA 4Z6YA 3GFLA 5JLWA 2BEOA 3PM1A 2XPWA 1Z05A 2GZWA 1HW1A 2LREA 3ZQCA 2STWA 3F8FA 1B4AA 2Y69H 3ELKA 5J4VA 3T5XA 2O9LA 1TNSA 3GEZA 1X1CA 4B48A 4RBOA 3KZYA 2NRAC 1WJFA 4BBRJ 4D7MA 3V8KA 3CC7I 2MA3A 2TCTA 1HF0A 2LC2A 4AVZA 2PFBA 2VJJA 3KETA 2V9KA 2XAFA 2ADUA 4GCVA 4U0YA 3JCUC 2UWMA 2K4JA 2O7OA 1A04A 1DP7P 4RGXA 2VN2A 5LGNA 1G3YA 2KKOA 3BG5A 4PCQA 3CESA 3TOAA 3H36A 5CQGA 1A31A 5K5RA 4LIVA 2GAUA 1CF7A 4EM1A 1R4MB 3T0YA 1DGWY 1F4KA 3WU0A 1LB2A 4U7BA 1XGNA 2B0LA 2NVTJ 2HU9A 1L0OC 2P0WA 3E6BA 2HKXA 2WC2A 2V9PA 4UUVA 2KJCA 2OF7A 2Z2SB 3LSHA 5FD6A 1ZR2A 1MDMA 4OIOF 5D5WB 3D1NI 1JE8A 1X1AA 1IO2A 1MZBA 3CD6I 1Y1WJ 1KYWA 3H3UA 3GW2A 2H6BA 2DN0A 2JA5J 3TO7A 5K7FA 2QF7A 3GO5A 4KIGA 3X2QH 1WJAA 2X9DA 3F8BA 3RCOA 1ODDA 3CJRB 2IXSA 2VQLA 1BJAA 3NAUA 2WY7Q 1MMSA 4BXUA 4ZTJA 2HQNA 5ICFA 4LG0B 1U2WA 3F21A 3FDYA 3I9V2 1GV2A 4PDKA 3GTQJ 4MTEA 4E4HA 2R0QC 1HQCA 4ETSA 2OCEA 5E3LA 5L3BA 3K70C 3SYTA 4IHWA 2FU4A 2Y48A 5DD4A 1G3WA 5IOYA 4DYQA 1PVEA 4XRMA 1X1DA 4XRFA 1N25A 5IP7J 5JHFA 1HKTA 4IHXA 4IEJA 4L0YB 1E3PA 1VQOI 1MBKA 3K2ZA 2AHQA 4JP0A 1I5ZA 2XAJA 3SQNA 1W36D 1V5GA 1N77A 1YO5C 3GZ6A 2VIXA 3Q9VA 1I6HJ 5E18F 5L3CA 1SVOA 1TP4A 2L7KA 2LF7A 1O57A 4A3KJ 2VKDA 3GTMJ 1R5HA 3Q3SA 3K7AJ 3O8GA 3DEEA 5KK1A 3VODA 3HJEA 2WV1A 4CCKA 1SD4A 4F7ZA 4IHSA 3TMOA 1BR2A 4U87A 3ZPLA 2HS5A 2W00A 3G73A 2QQ8A 5HS8A 4WCGA 3AKZA 3FBNB 1ZRCA 3OMYA 3I3LA 4PJ0C 2PMUA 1MH4A 2K40A 5JR3A 2Z16A 3HL2A 1ZKGA 2CQ7A 2FMYA 3ZQIA 4I0BA 3RZOJ 1JKQC 4M3FA 2LKPA 1S29A 2NS0A 3KEQA 3CC4I 1MSEC 2OV7A 5TISC 1HXDA 3HPHA 3OS1A 2MBFA 3IRRA 4CDGA 4CZCA 3F0CA 1S72I 1O7LA 2CV2A 1FOXA 1FBQA 2XF6A 5CVJA 3VPRA 5M3MJ 3K4NA 5D5XB 4A0XA 3KLNA 2R5YB 4XM3A 1PUEE 5H6QA 3DPLC 4EJTA 4B09A 1P2FA 3FBIB 2QKMB 3DU5A 2YR2A 2LD5A 2BBYA 1AU7A 2E7XA 5DYMA 2XKOA 1Z3XA 4KISA 2VBWA 3VFZA 3CCLI 3CTAA 1IUFA 2L4AA 1LVKA 3EDPA 3PL8A 2ZO4A 4Y17A 3BPVA 5HODA 2BXZA 4HQEA 2RGVA 5LFAA 3HOXJ 1JT0A 1VQ7I 2EBIA 5L3GA 2EINH 1ZAOA 2FOWA 4LG0A 2R7QA 1X2NA 1TW2A 3OIQA 1P7JA 3CCYA 3Q9SA 3R60A 3MKZA 4YFKF 5IP6A 4CCOA 2R5ZA 2IA0A 3ZOBA 2EZHA 1T6SA 3HTUA 1K4SA 4X0GA 2J5OA 3L9FA 3K70D 3RZDJ 3ZMUA 3W2VA 2RV8A 3M7GA 2FMLA 3LQRA 1VF9A 4NBQA 5GP9A 2OZUA 2W85A 3B6CA 2IGMA 2QENA 3PFYA 2Y30A 1K6YA 1LDDA 3R0JA 3GFIA 5E3OA 5FJ8J 2GOMA 1J09A 4A0ZA 3DEWA 3HKZA 4UV9A 5D5VB 1MDMB 4RM2A 2PBIA 1FP1D 5DEQA 2DBBA 2K85A 2NVXJ 1YYVA 2ACJA 1AWCA 2QLZA 4BL0B 1HDDC 2VUMJ 4JX5A 2UXXA 2XGDA 3P9KA 3J80Z 2DQLA 1O7FA 2PMHA 2RVCA 3MN2A 5LRRA 2E60A 3S16J 1V5EA 3CP2A 4S05A 4AIHA 4H0EA 2MH2A 4CGZA 2X6WA 3QAHA 3HB9A 3CDHA 1FT9A 4YIIA 4CYCB 3V7CA 2Q1ZB 5F27A 1GT0C 3A1YA 4XRSG 2E35A 1OISA 2EJRA 1TNTA 1USTA 2XAGA 3J7YJ 3FXMA 2ISZA 3AG4H 5FKNA 3FHNA 3RYPA 2ISYA 5FD5A 4QLCU 1XN7A 2K3FA 4RAZA 2M8GX 2HTSA 5A2QK 1FYMA 1WJ5A 5M5XJ 4ANJA 2FD5A 3R61A 5E3MA 4NQWA 5EGOB 4LLGF 3DKWA 3P7NA 2XGCA 3LL7A 5F04A 1Y1VJ 1FJLA 3OL3A 4NUBA 2M5WA 4LIUA 3H9JA 3VEPA 4RGUA 5E20A 1WZ2A 3JR9A 3U1KA 2H6CA 5DM7F 2JA7J 1SMYF 1UHSA 4UVCA 5E79C 4UUTA 3QODA 4HG2A 2MW8A 5EF6A 3JSOA 5L3DA 4M6VA 1W5TA 4HYEA 1ZRDA 5HNFA 4DOZA 4P9UA 4UB6C 4A3GJ 2QEXI 4ENJA 2WAQN 5J8FA 3OV8A 1KU3A 2V1DA 2ZSHB 2A6EF 3BCAA 1R5GA 2L9NA 4UVBA 3K69A 2VB6A 1KZHA 1HSTA 3CUQA 1IF1A 4JYKA 1TZLA 1VTNC 4RAFA 4C2MJ 1LFPA 1KGSA 2VT2A 4Q4ZF 2HYFA 1NTCA 5DD8A 4F55A 4KMUX 1U3EM 2Z99A 4NNJA 4FQGA 2CWEA 2X1DA 5IYBJ 1WH5A 3OY9A 2Y75A 3I59B 4DYCA 3K4KA 5H2FC 2FBIA 5KNLA 3S17J 3E7LA 1R6RA 2DOEA 3V7RA 5LEJA 2ME0A 1FBSA 3F8MA 3PNVA 4QTRA 1HKSA 3H9GA 1SFEA 2L3DA 4D0PA 3H3ZA 4CYCA 2ZNYA 1G4DA 1ZLJA 2HGCA 1X4PA 1STZA 3GZNB 2XGEA 4YFNF 5KVRA 1XS9A 1AHDP 2OAZA 1EF4A 5EEAA 3LSJA 1J5YA 1ONVA 1Z67A 4P1WA 4MEXF 2JRMA 2CFOA 2Q2EA 1YW9A 5J4YA 3CCVI 2MC3A 3L2RA 2K02A 1FBUA 2O3FA 1U5TC 1LFUP 4R1HA 1Q1HA 2W4SA 2X85A 1FYLA 2DMTA 1FP2A 2CU7A 3VYSB 1NK2P 2FX0A 4UV8A 3JREA 1JKRC 3Q0UA 3K9TA 1BIAA 4PZJA 3MWMA 4A5NA 3BWGA 1Z91A 3A02A 3LSPA 1T33A 2WB1N 1E3OC 2AQFA 5LLQA 3S1MJ 2RKHA 1IG7A 1WQ2A 2RNJA 1YJ9I 2HVRA 4IHYA 3VSKA 2ZXIA 4PSWA 4EM2A 1I3QJ 4ZYDA 3UNGC 3HEFA 1VQNI 1MJ9A 5ICCA 3R4KA 3GUDA 4E7IA 3G1LA 2LBFB 2H8RA 1F5TA 3FWEA 2KPMA 5JVGF 2EZIA 3P5JA 1CQTA 3TDZC 3KFWX 4LMYA 3PFIA 3ZR8X 4BHPA 4G6TB 4BYYA 2PLYA 3SHFA 2P5VA 1TQMA 4UUSB 4OIPF 3K0LA 1IXCA 1SC7A 1W7PB 1U78A 2CUEA 4LFUA 3OSFA 2QVOA 4IRGA 3A01B 1ZR4A 4BGDA 2ECBA 1XCBA 3OR1C 3VDXA 1W1WE 2XAQA 3WE3A 4HNTA 4JOMA 3BQZA 3BPXA 3MQ0A 3HOZJ 1HW2A 3GVAA 3FM5A 1D1BA 4ENNA 1IDYA 4OINF 4C2UA 5D5UB 2F5DA 3NQOA 3H1CA 1W0TA 1KA8A 1JXSA 3DPUA 2KMUA 2LLKA 2MYSA 1LDJA 2DFEA 5EYRA 1YG2A 4IRHA 2YX4A 2LSOA 3V8JA 4BQOA 3DBRB 3U1DA 3LSIA 5FFXA 3B02A 5CLSA 3R6SA 1J75A 4G7HF 3EUHC 2BXYA 2KZGA 1GVJA 5F0HA 3O8HA 4BQQA 4XL9A 1DP3A 3H9QA 1K83J 1ZYRF 1JKPC 1BI1A 1WJCA 4L5JA 2WAFA 4RA2A 4XLCA 2ZXWH 1VQLI 3FXUA 2KP6A 4RLQA 4V19K 2XAUA 2QCOA 4S04A 2L7MP 2LH9A 4PGHA 4N4OB 4A3JJ 1U0JA 3S3NA 4M9ZA 3IC7A 4QPQA 4DBQA 1IGNA 4IHTA 1XD7A 5C4JJ 1X3ZB 3BR6A 3HPGA 4ESJA 2OPTA 2PN6A 1P9QC 4UUSA 5K1YA 3DLLF 3HSFA 1UAAA 3JW4A 1JJ6C 2P7VB 2DU9A 2OTJI 1XX5A 3ABTA 3U9GA 4L18B 2K86A 3AAFA 1C0WA 2PMZN 5K7HA 2M1BA 2V6CA 4IQ4A 1TW3A 2Z5UA 3RDIA 3OYAA 3SDBA 4CCMA 2KFDA 2E19A 2M30A 2PG4A 1WRJA 1OYYA 4B44A 5ILSA 2KT0A 4E7ZA 2KDZA 4BHBA 2L0KA 3RYRA 3ECOA 1BA5A 2JJ7A 1OCPA 1GV5A 1OQYA 1IRXA 5ILUA 2JZYA 2E2IJ 3REOA 3DFGA 2RQPA 1I1SA 1F9NA 2A3SA 2VQHA 2XRNA 2O0YA 2IS1A 2DQRA 4JK1X 4XKVA 2R7RA 2EA2A 2Q0OA 4LITA 2XSJC 2IJLA 2TRTA 5IP9J 4Q47A 3OL4A 1I6XA 4DW6A 4G6QA 1IN7A 2OCCH 1EJ9A 1WH7A 2E2JJ 1Z7UA 5BOXA 1P4AA 1X1BA 3HRSA 2ZMEC 4KIBA 1FLIA 1LUJB 1S7OA 1TWFJ 2OQRA 4LJZF 4IRIA 5HOOA 2XPVA 2NXNB 1V55H 3S32A 1G6NA 2IPQX 5IT3A 1E0EA 1XDUA 1MNDA 3MMYB 2X48A 3G4SI 2DXIA 3I54A 4XOTA 4A0YA 5EJCA 1Y39A 1EV7A 1R1UA 1MJAA 2E36A 2R7ZJ 5M5YJ 3HOTA 3HZJA 4HLXA 5EGOA 2P8TA 3I71A 4AUXA 4ESBA 3WTYC 1YE9A 2HPIA 2VQGA 1RKTA 2HOEA 2BHZA 4FETA 2BV6A 3U2RA 3L1PA 3ZN0A 2ZFUA 1S9HA 2WA0A 3SJMA 3OOUA 2QSHX 2R7TA 4MEYF 1MW7A 3E97A 4C9YA 4HV5A 4LOCA 2K4BA 5CPRB 2JWTA 3HHHA 4PGGA 1EA3A 2WV0A 3IV5A 3M8FA 3A0BC 3GZ5A 3KEYA 1YW8A 1T56A 3HUGA 5LRSA 3CJTB 1U8BA 4RB0A 3FMQA 4IX7A 4LK0F 1S6LA 4HX7A 1BC7C 4FX4A 2P5LC 4XMYA 2CG4A 1N75A 4RMNA 4RLFA 3T8TA 1HC8A 5HLHA 3PUFA 3ZMDA 1YRNB 2H8WA 2OTLI 3G6EI 4FCYA 4HZFA 3CO7C 4YRVA 1YHQI 4PFPA 2QQBA 3ABKH 2O5RA 3FXJA 1RUOA 1Z3YA 3KIOA 3I5UA 4BU2A 3D5LA 3HBLA 1QPMA 4G8XA 1JHFA 3LWFA 3M07A 3W2WA 2KL4A 3L2CA 4HV6A 3FMRA 3TW7A 4AYBA 4RS8A 4FTHA 3A0HC 2HQ5A 4N9HA 4ITVA 2XKPA 1R22A 4FISA 2QWWA 1YS6A 3N97A 2DPUA 3I55I 3CP8A 2AXLA 2EPFA 1MD0A 1WI3A 2ZJ2A 4W97A 4UXNA 1IC8A 2DA3A 5IY5H 3DBHB 2O03A 2YX7A 2F4OB 1ZG3A 4I76A 2I5UA 2COBA 3TQNA 3S2DJ 1SD5A 3IUOA 3IWFA 1APLC 3P9CA 2DA6A 2R5YA 5IYDJ 5H20A 1XGSA 2WBMA 4HW0A 4I0AA 2GQQA 1ON2A 3QRFF 3ASOH 1J7KA 3RKXA 5F0CA 5LHGA 3E5QA 3JRIA 1J59A 1D8KA 3BC8A 3E3VA 4ZYGA 3AG3H 2MFZA 1XGMA 2QBYA 3ESWB 2VONA 1LVAA 3LA2A 2DYSH 2WB1A 3S3MA 3FMSA 4BUPA 3IKTA 4LGWA 3SZGA 4J01A 1UFMA 1VQPI 4BHCA 1TC3C 1YX5A 4M3BA 3BTLA 2MABA 1NH3A 5E1WA 3MZ8A 1ZLKA 2DDAA 3H0GJ 3CJQB 3BTCA 1KYZA 2P6SA 2F5EA 2VE9A 4WXDA 1MH3A 4PJNA 3GBGA 3WGIA 3F6OA 3WTWC 2JRTA 2R93J 2W24A 1XSDA 3SZPA 3LSKA 2IGNA 2CMPA 3OYNA 1ULYA 3PSIA 4RB3C 2FEZA 2ECCA 3HG9A 4XLPF 3CCJI 2HYJA 1M1EB 3QP6A 4HQMA 2IRFG 2UXNA 3T8RA 3SFIA 3HGGA 2RQQA 3J80K 2V1NA 4GO1A 4D9JA 1DPRA 1QHHD 1Z6TA 2VC1A 4WWCA 1IXRC 2M2EA 4A3FJ 2Y0MA 1FIPA 1SFUA 5J40A 4ENMA 3DKYA 4KMFA 3V8LA 3WG9A 2H27A 3S15J 4UY8I 2W25A 1TQIA 5C44J 2JSPA 1YFHA 1BN5A 1QRYA 1S7AA 4BJTA 4IF4A 3F9KA 2EK5A 4QSHA 3HSRA 2HVQA 5E1XA 2Y31A 2Z9OA 3KP7A 1O3RA 2A69F 1R7JA 3ISPA 4IKFA 3BG6A 4X6AJ 4KFCA 3FXLA 4HX8A 2JSCA 2XROA 1VQKI 1B72B 2VBXA 5GADJ 4IQJA 1XPXA 1NG7A 2CW7A 3OS0A 3KCCA 1W36C 3JSPA 1RUNA 3BTJA 4PUSA 2XDVA 5GAGJ 2FA5A 2V1XA 5J47A 4BEHB 4IPAA 1WJDA 4OOIA 3HDDA 1SMTA 4L5EA 4NB5A 2HKOA 2EV6A 1QQIA 2A07F 3DTEA 1ITYA 2WAQA 3DBLB 2RNGA 2FRHA 1CF7B 4KJZA 2DMUA 2C6YA 3B6AA 4IJAA 5FKLA 1XMXA 1LEAA 1IN4A 4XLHA 1U9NA 2QBYB 3RPQA 3W6VA 1RR7A 5L3FA 2EQRA 4HDVA 2A61A 1BBYA 3LSRA 2CH0A 3GLXA 1PDNC 1RESA 2QSGX 4EQQA 4XLEA 1JKOC 3GF2A 3BR1A 5C4XJ 2D2WA 3BZ6A 5BQTA 2UV1A 3OYEA 5D4RA 3EUKL 2FF4A 2KISA 3R0AA 1YTYA 2P81A 3BJAA 1AOYA 4P96A 2VI6A 1SFXA 1KONA 1YOVB 1KU7A 1HLVA 2Y9YA 4KN7X 2NVUB 2F4IA 4LK1F 3ZN1A 2I8DA 5IOZA 4JQFA 3CLQA 4L9VA 3CLOA 4BE0A 1G3SA 2DA2A 4B3XA 3S3OA 3WE2A 1R36A 1B9MA 4CXFA 4WXHA 2LG4A 1BR1A 3RPUD 2HVSA 2Y9ZA 5IPAA 3OIPA 2YS9A 4UHTA 2KIQA 4CH7A 2MD5A 1MIJA 2KHMA 2X1EA 2CW8A 2FUG2 4ABZA 3GLLA 2X1CA 4IL6C 3VYUB 1A5JA 3JRFA 2PQ8A 2W1OA 2Z3YA 3ZQHA 3CF5F 4KNYA 3D5RC 3VYTB 3KE2A 3S1QJ 1W5CC 4A6EA 3ASNH 2DT6A 2PJRA 3L2VA 4J19A 1IN8A 1RZ4A 2IA1A 5CQEA 1SEUA 1HBXG 2CO5A 1Z7LA 4AWXB 1DQUA 2A5YB 3HUGB 2FOKA 1OCCH 3U21A 2HEOA 2IVMA 4HOBA 1TWCJ 2FQ3A 4HSTA 4LD5A 4NC6A 1EH6A 4EMSA 3K2AA 2HR3A 5M5WJ 1H9TA
chains in the Genus database with same CATH topology
3SFZA 3BY6A 3FHZA 2A6HF 3PQJA 2FXAA 2JTVA 5FGMA 4KICA 3E6CC 5D8KB 4OIQF 3DF8A 4NHJA 2AS5F 1P92A 3BDDA 2EFNA 2M87A 2OBPA 1W7PD 5E8IA 3VOEA 4EM0B 2QUFA 4O6JA 5IT9Z 1TBXA 1JHHA 3IRQA 2DK5A 5ED4A 1WKMA 2OZ6A 3N4MA 2DO7A 5DCFA 1FWZA 4OIRF 2PI0A 1OKRA 2JT1A 1RIOH 2COMA 2CGPA 2DAOA 2CYYA 4HDUA 1R00A 1QZYA 2HFHA 2JPBA 3Q5FA 1P4XA 1ZG1A 3ABUA 1ZREA 3LA3A 3VB2A 1QZZA 3MFKA 2JPCA 4R8HA 2L01A 2DT5A 3ZMVA 5CYVA 5DCMA 5DUIA 1ZHFA 5EEGA 1IRFA 1ZRFA 2H09A 1FY7A 3F8NA 1NHAA 1L3LA 4OMZA 5CVVA 2ZNZA 1D3YA 2YSRA 3H92A 3I0TA 3S2WA 4HX4A 3C7JA 2NNNA 4A6DA 3I53A 3K1PA 1K78B 2GXBA 3FXRA 3WODF 3PQKA 3BP8A 3COAC 5H6RA 4EJVA 4Q5SF 5HLGA 5CVRA 5BPDA 2VBYA 4XBFA 4L0ZB 3GXOA 4I98B 4A2UA 2HWVA 3SZTA 2ZFWA 3KEOA 5FB2A 2LNBA 3BJOA 1BOAA 5A2QZ 3KLOA 1Y0UA 2G7UA 3O3KA 2FBKA 2M45A 4CZZA 5L3EA 4GXOA 1O3QA 3LAPA 5DDGA 2R7FA 2ESHA 1U6GA 4ASNA 3BROA 1S8NA 1FSEA 3HRMA 5F1RA 3WGGA 5AONA 3HSEA 1J0RA 4M74A 5IT9K 1B9NA 3TOBA 1R1VA 1XMAA 4Z2YA 1LEBA 2BYVE 3KP5A 4ZYHA 3LQQA 2D1VA 4MGRA 3L7WA 2GWRA 2ESNA 1P6RA 1DPUA 3IL2A 2VOPA 4G7OF 5AIQA 4YFXF 1FOKA 1IUYA 1T39A 2G7HA 3E5XA 2XUBA 4GYIA 2MH9A 4CYDA 2XAHA 3DXJF 5CVUA 4BH9A 2HDCA 3EYYA 1V3FA 4EGYA 1R23A 5DCMB 1XGOA 4AVPA 1XDSA 4ZYEA 4M73A 4G94A 5F6FA 2EWNA 4ESFA 3FF5A 5E17F 3TKYA 4HF0A 3RPUA 1LQ1A 2UZKA 4B8XA 4RAYA 3SXYA 2GA2A 3QPTA 2EFQA 4KN4X 1BIBA 3GFMA 4JBAA 1IZ1A 3GFJA 2P5KA 1MGTA 4P55A 1QNTA 4XSZF 1MJBA 2QM3A 2FBHA 1WWXA 2XVCA 3W6KB 2R3SA 3JAMK 5LHIA 3C18A 2Q8KA 4MNUA 2ELHA 4CHUA 3F6VA 2E1NA 4RB1A 2EA4A 2FSWA 1SAXA 4O3MA 2PJPA 1B59A 3RJPA 1IN5A 3DV8A 1UCRA 1YLFA 1K78A 1BI2A 3RKYA 4G7ZF 3CUQB 3G3ZA 2DFIA 4QWQA 3HIFA 4KIFA 2F5CA 1U5TB 1EH7A 3EUHA 2EV0A 5BPIA 3C1DA 3F8CA 1T38A 1FYKA 3TO9A 1T98A 3DPTA 2ZBKA 3ULQB 4CO8A 1EH8A 5J8CA 4MQ9F 2FNAA 4L5IA 2G9WA 3I64A 3IKVA 2KIMA 3WGHA 4LLNA 2P6TA 1HSJA 3IWZA 2QQAA 2EFPA 2V79A 4WXCA 4EGZA 5D6EA 3EETA 1Z1DA 2VXZA 1KQ8A 3FXQA 5LGTA 2X0LA 4AIJA 2VC0A 2RDPA 2KIFA 3BOQA 2IT0A 4ENKA 2WTEA 4DNCA 5FLXZ 4HLYA 3HOSA 4UNOA 4LLLA 1ZH5A 3E5UA 3IHUA 1FSHA 3F22A 1ZG5A 1XB4A 3ZQ7A 1UB9A 1WI9A 2WWYA 4LB5A 1IXSB 3KP3A 1V4RA 5JI6A 1F1ZA 2ZCWA 1MKMA 5LGUA 1HKQA 4Q48A 1D5VA 4M9XA 4MQVA 4YG2F 2IW5A 1DDNA 3NRVA 1OPCA 5AIPA 4L9TA 2D45A 4MHGA 2VE8A 1XMKA 2KIUA 3C3WA 4KDPA 3ZMZA 3RIRA 3CO6C 1OYWA 1R58A 1CGPA 3K1MA 1USSA 2F2EA 4CICA 2O8XA 4EVIA 1FPQA 4A5MA 3W6JB 1LJ9A 1W5SA 1ON1A 4R79A 2A68F 3GYHX 5DV5A 1GXPA 2OA4A 1T2KA 4U0WA 3E6DA 3DP7A 4N9IA 4WK8F 3M9AA 2CSOA 1B1BA 3MZHA 3JTGA 2VT3A 3J81Z 5FO5A 1JGSA 2OD5A 3DEUA 2DW4A 1PP8F 3LAJA 3DQVC 1K7AA 3FM3A 5HDNA 1X3UA 3WU1B 2L54A 1G3TA 2L02A 1ZGAA 1BI3A 1KQ0A 3HRTA 2HZTA 1I27A 3CJNA 3TDUC 4XSXF 2CW0F 4HA8A 4I01A 1U8RA 2W84A 3K1NA 5CJ9A 5FFZA 3MZYA 1R1TA 4WX9A 5TRDA 1OYIA 4GGGA 1FNNA 1OR7A 3WTZA 2D1HA 4TV7A 4UVAA 2LDUA 5JVTA 1ZARA 2ZMEB 4HF1A 4AIKA 1WSUA 1S3JA 2MLGA 1ZN2A 4FT8A 4IVNA 3V7SA 1REPC 4OMYA 3GWZA 5E1ZB 5E8GA 2HYGD 4M72A 4M6XA 5BMZA 1GXQA 3QPHA 4AD9A 1IN6A 4G9YA 4O5VA 2EB7A 2QYOA 3WTVC 4LB6B 2OQGA 3I59A 2VBZA 5LHHA 5HDKA 2ZMEA 2M8EA 1BC8C 5ICEA 1QGPA 3HYIA 2K27A 4U7DA 4OU0A 5ERIA 4RB2C 2FNPA 5J6XA 4XLNF 1K79A 3ML6A 4IXAA 1XSVA 5LEKA 1J9IA 4YIFA 3P9IA 3WTXC 4Y15A 2XASA 2ZXJA 3ECHA 2KRFA 4ZZDA 5ICGA 3EYIA 5LBQA 1Z9CA 2BGCA 1IAWA 2EFWA 4E70A 1XSXA 3O2PE 5K5QA 5HDGA 4K2EA 4L9JA 6PAXA 3HTSB 3BJ6A 5HS7A 5TJJA 3JAMZ 1TQPA 3KZZA 3V4GA 1I1GA 3ZMSA 3RI4A 3J7AO 4KA4A 5JHUA 2HTJA 3T1BA 1J2XA 4RGRA 3KP4A 1FX7A 3L09A 2DPDA 1O3SA 3I58A 2V1UA 2R7DA 4WF2A 1OMIA 2MLKA 1K6OA 1KU9A 3F23A 4ZH4F 3GX4X 4EJWA 2NAZA 3QP5A 3NEUA 4MTDA 4Y13A 2XHKA 3ROUA 1XCVA 1YS7A 4L9NA 4I7HA 3M1EA 1TLHB 2QQ9A 3OOPA 4RGSA 4EJOA 4U88A 3ZP5A 3EQLF 1LNWA 3JTHA 3MAJA 2GXGA 3E6MA 2P7CB 2DTRA 3F72A 4KT5C 2STTA 2XIGA 2RC4A 1BI0A 3FX3A 3HHGA 5D4SA 2O61A 5HS9A 2PEXA 3O6BB 3I4PA 2FE3A 2Z33A 4HAMA 4M6YA 5EEHA 4U0VA 1E2XA 2J5PA 4I09A 3LA7A 1GHCA 3CUOA 1UHMA 1YIOA 3ERED 1Z6RA 1D8JA 1U5TA 3B73A 2ZKZA 3D0SA 2IA2A 3LFKA 1B6AA 2KJBA 5F64A 1DUXC 4KYWA 4P5OA 2V9VA 2O6GE 4HBLA 3M8EA 1H9GA 1LDKB 4N0BA 2DK8A 2YPRA 3WTUC 1KQ9A 2GA1A 3KP6A 1W7PA 2H94A 5BS6A 2BE5F 1YQAA 4ON0A 1SD6A 1T0FA 3ZMTA 4FX0A 3LSTA 5K5OA 3F3XA 4GYGA 4I2OA 5CVIA 3CUQC 5DUKA 2TDXA 4HF2A 1FC3A 2GIVA 1HW5A 2DLLA 4ZZLA 4G6DA 3FZVA 3J81K 2L4MA 1QBJA 2ETHA 3KP2A 5JFRA 2K7LA 2LF8A 2W57A 1RNLA 4EJUA 2P4WA 2EV5A 1O3TA 1PP7U 1H0MA 2IP2A 4I02A 3MCZA 2OU2A 4A12A 1ZGJA 5HVQC 3L00A 5D8LB 3WTTC 2YU3A 4BAYA 1RI7A 1E17A 3MEXA 4DQ2A 5ILVA 5HLIA 3HRUA 4EV0A 2F5FA 3WTSC 2CQKA 4FHTA 3TGNA 4KUMA 3TO6A 2XGXA 1BM9A 1IW7F 4BQAA 2RN7A 2HQRA 2EFOA 3QU6A 2VODA 2DI3A 1YW7A 2CFXA 3QOPA 2NYXA 4P9FA 1IRGA 1P4WA 2E1CA 4M71A 3RKWA 1FZPB 3QU3A 1W4MA 1TTYA 4M9SA 5D6FA 3RTRA 2E7WA 2XV4S 5FLXK 4BNCA 2VOOA 1QO0D 1UHWA 2X4HA 1SD7A 1KU2A 2QZ8A 2NNYA 3GFLA 2BEOA 1Z05A 2GZWA 1HW1A 2STWA 3F8FA 1B4AA 3ELKA 3T5XA 1TNSA 3GEZA 3KZYA 2NRAC 3V8KA 2MA3A 2PFBA 3KETA 2XAFA 4GCVA 2ADUA 4U0YA 2UWMA 2K4JA 1A04A 1DP7P 4RGXA 2VN2A 5LGNA 1G3YA 2KKOA 4PCQA 3TOAA 5K5RA 2GAUA 1CF7A 4EM1A 3T0YA 1F4KA 3WU0A 1LB2A 4U7BA 1XGNA 2B0LA 1L0OC 3E6BA 2HKXA 2WC2A 4UUVA 2KJCA 1MDMA 5FD6A 4OIOF 5D5WB 1JE8A 1MZBA 1KYWA 3H3UA 3GW2A 2H6BA 3TO7A 3GO5A 4KIGA 3F8BA 1ODDA 1BJAA 4BXUA 2HQNA 5ICFA 4LG0B 1U2WA 3F21A 4PDKA 4MTEA 1HQCA 4ETSA 5L3BA 2FU4A 2Y48A 5DD4A 1G3WA 4XRFA 1HKTA 4L0YB 3K2ZA 1I5ZA 2XAJA 3SQNA 1YO5C 3GZ6A 3Q9VA 5E18F 5L3CA 2LF7A 1O57A 1R5HA 5KK1A 3VODA 1SD4A 4F7ZA 4IHSA 3ZPLA 2HS5A 3G73A 5HS8A 4WCGA 1ZRCA 2PMUA 5JR3A 2FMYA 4I0BA 2LKPA 1S29A 2NS0A 3KEQA 1HXDA 2MBFA 3IRRA 4CDGA 1O7LA 1FBQA 5CVJA 5D5XB 4A0XA 3KLNA 1PUEE 5H6QA 3DPLC 4EJTA 4B09A 1P2FA 2YR2A 2BBYA 2E7XA 5DYMA 2XKOA 2VBWA 3VFZA 3CTAA 2L4AA 3EDPA 2ZO4A 4Y17A 3BPVA 4HQEA 2RGVA 5L3GA 1ZAOA 4LG0A 1TW2A 3Q9SA 3R60A 4YFKF 2IA0A 1T6SA 3HTUA 2J5OA 3L9FA 3ZMUA 2RV8A 3M7GA 2FMLA 3LQRA 2OZUA 2W85A 2QENA 1LDDA 3R0JA 3GFIA 4A0ZA 1MDMB 4UV9A 5D5VB 5DEQA 2PBIA 1FP1D 2DBBA 1YYVA 2ACJA 1AWCA 2QLZA 2UXXA 3P9KA 3J80Z 2DQLA 1O7FA 2PMHA 2RVCA 5LRRA 4S05A 4AIHA 4H0EA 2MH2A 4CGZA 3QAHA 3CDHA 1FT9A 4YIIA 3V7CA 2EJRA 1TNTA 1USTA 2XAGA 2ISZA 3RYPA 2ISYA 5FD5A 4QLCU 1XN7A 4RAZA 2HTSA 5A2QK 1FYMA 3R61A 4NQWA 4LLGF 3DKWA 3P7NA 2M5WA 3VEPA 4RGUA 5E20A 2H6CA 1SMYF 4UVCA 3JSOA 5L3DA 1W5TA 4HYEA 1ZRDA 4P9UA 4ENJA 5J8FA 3OV8A 1KU3A 2V1DA 2A6EF 1R5GA 4UVBA 3K69A 1HSTA 3CUQA 1IF1A 1VTNC 4Q4ZF 1KGSA 2VT2A 2HYFA 5DD8A 4KMUX 1U3EM 2Z99A 2CWEA 2Y75A 3I59B 2FBIA 3V7RA 5LEJA 3F8MA 1FBSA 1HKSA 1SFEA 2L3DA 4D0PA 3H3ZA 2ZNYA 1G4DA 1ZLJA 2HGCA 1STZA 4YFNF 5KVRA 2OAZA 1J5YA 1ONVA 4MEXF 2Q2EA 1YW9A 2MC3A 2K02A 1FBUA 2O3FA 1U5TC 4R1HA 1Q1HA 1FYLA 1FP2A 4UV8A 3K9TA 1BIAA 4PZJA 3MWMA 4A5NA 3BWGA 1Z91A 5LLQA 2RKHA 1WQ2A 2RNJA 4EM2A 4ZYDA 1MJ9A 5ICCA 3R4KA 3GUDA 1F5TA 3FWEA 3TDZC 3KFWX 4LMYA 3PFIA 4BHPA 4BYYA 2PLYA 3SHFA 2P5VA 1TQMA 4OIPF 3K0LA 1IXCA 1W7PB 1U78A 4LFUA 2QVOA 4IRGA 1XCBA 2XAQA 3WE3A 3BPXA 3MQ0A 1HW2A 3GVAA 3FM5A 4ENNA 4OINF 5D5UB 2F5DA 3NQOA 1KA8A 1JXSA 1LDJA 1YG2A 4IRHA 2YX4A 2LSOA 3V8JA 3U1DA 5FFXA 3B02A 5CLSA 3R6SA 1J75A 4G7HF 1GVJA 1ZYRF 1BI1A 4L5JA 3FXUA 4S04A 4PGHA 4IHTA 4M9ZA 3IC7A 1XD7A 4ESJA 2PN6A 5K1YA 3HSFA 3JW4A 2P7VB 2DU9A 3ABTA 3U9GA 4L18B 2K86A 3AAFA 1C0WA 2M1BA 2V6CA 1TW3A 2Z5UA 3RDIA 2M30A 2PG4A 1WRJA 1OYYA 5ILSA 4BHBA 3RYRA 3ECOA 5ILUA 2JZYA 3REOA 3DFGA 2RQPA 1I1SA 1F9NA 2A3SA 2XRNA 2O0YA 2DQRA 4JK1X 2EA2A 2Q0OA 2IJLA 4Q47A 1I6XA 4G6QA 1IN7A 1Z7UA 5BOXA 1P4AA 3HRSA 1FLIA 4KIBA 1S7OA 2OQRA 4LJZF 4IRIA 5HOOA 1G6NA 2IPQX 5IT3A 1XDUA 3I54A 4A0YA 1EV7A 1R1UA 1MJAA 3HOTA 4HLXA 2P8TA 3I71A 4ESBA 3WTYC 2HOEA 2BV6A 3U2RA 3ZN0A 4MEYF 3E97A 4HV5A 2K4BA 3HHHA 4PGGA 2WV0A 3M8FA 3GZ5A 1YW8A 3HUGA 5LRSA 4RB0A 3FMQA 4LK0F 1S6LA 4HX7A 1BC7C 4FX4A 2P5LC 2CG4A 3T8TA 5HLHA 3ZMDA 4HZFA 3CO7C 2QQBA 1RUOA 3I5UA 3D5LA 1QPMA 4G8XA 1JHFA 3LWFA 3L2CA 4HV6A 3FMRA 4RS8A 4N9HA 2XKPA 1R22A 2QWWA 1YS6A 3N97A 2DPUA 2AXLA 1MD0A 2ZJ2A 4UXNA 2O03A 2YX7A 1ZG3A 3TQNA 1SD5A 3IWFA 3P9CA 5H20A 1XGSA 4HW0A 4I0AA 2GQQA 1ON2A 3QRFF 1J7KA 3RKXA 5LHGA 1J59A 3E5QA 1D8KA 3E3VA 4ZYGA 2QBYA 2VONA 1XGMA 1LVAA 3LA2A 3FMSA 3IKTA 4LGWA 1UFMA 4BHCA 5E1WA 1ZLKA 1KYZA 2P6SA 2F5EA 2VE9A 4WXDA 3WGIA 3F6OA 3WTWC 2JRTA 2W24A 1XSDA 3SZPA 1ULYA 4RB3C 2FEZA 4XLPF 3QP6A 4HQMA 2IRFG 2UXNA 3T8RA 3J80K 4GO1A 1DPRA 1Z6TA 2VC1A 4WWCA 1IXRC 2Y0MA 1SFUA 4ENMA 4KMFA 3V8LA 3WG9A 2H27A 2W25A 1TQIA 1YFHA 1BN5A 1S7AA 4IF4A 2EK5A 3HSRA 5E1XA 2Z9OA 3KP7A 1O3RA 2A69F 1R7JA 3ISPA 4KFCA 4HX8A 2JSCA 2XROA 2VBXA 3KCCA 3JSPA 1RUNA 2FA5A 2V1XA 4IPAA 4OOIA 1SMTA 4NB5A 2HKOA 2EV6A 1QQIA 2A07F 2FRHA 1CF7B 2C6YA 4IJAA 1LEAA 1IN4A 2QBYB 3RPQA 5L3FA 4HDVA 2A61A 1BBYA 3GLXA 1PDNC 4EQQA 3GF2A 2D2WA 3BZ6A 5BQTA 5D4RA 1YTYA 2FF4A 3R0AA 3BJAA 1AOYA 4P96A 1SFXA 1KU7A 4KN7X 4LK1F 3ZN1A 4JQFA 4L9VA 3CLOA 1G3SA 3WE2A 1R36A 1B9MA 4CXFA 4WXHA 4UHTA 2MD5A 2PQ8A 2Z3YA 4KNYA 3KE2A 4A6EA 1IN8A 1RZ4A 2IA1A 1HBXG 2CO5A 4AWXB 2A5YB 2FOKA 2HEOA 2IVMA 4HOBA 2FQ3A 4LD5A 1EH6A 4EMSA 2HR3A 1H9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFZ A;  3BY6 A;  3FHZ A;  2A6H F;  3PQJ A;  2FXA A;  2JTV A;  5FGM A;  4KIC A;  3E6C C;  5D8K B;  4OIQ F;  3DF8 A;  4NHJ A;  2AS5 F;  1P92 A;  3BDD A;  2EFN A;  2M87 A;  2OBP A;  1W7P D;  5E8I A;  3VOE A;  4EM0 B;  2QUF A;  4O6J A;  5IT9 Z;  1TBX A;  1JHH A;  3IRQ A;  2DK5 A;  5ED4 A;  1WKM A;  2OZ6 A;  3N4M A;  2DO7 A;  5DCF A;  1FWZ A;  4OIR F;  2PI0 A;  1OKR A;  2JT1 A;  1RIO H;  2COM A;  2CGP A;  2DAO A;  2CYY A;  4HDU A;  1R00 A;  1QZY A;  2HFH A;  2JPB A;  3Q5F A;  1P4X A;  1ZG1 A;  3ABU A;  1ZRE A;  3LA3 A;  3VB2 A;  1QZZ A;  3MFK A;  2JPC A;  4R8H A;  2L01 A;  2DT5 A;  3ZMV A;  5CYV A;  5DCM A;  5DUI A;  1ZHF A;  5EEG A;  1IRF A;  1ZRF A;  2H09 A;  1FY7 A;  3F8N A;  1NHA A;  1L3L A;  4OMZ A;  5CVV A;  2ZNZ A;  1D3Y A;  2YSR A;  3H92 A;  3I0T A;  3S2W A;  4HX4 A;  3C7J A;  2NNN A;  4A6D A;  3I53 A;  3K1P A;  1K78 B;  2GXB A;  3FXR A;  3WOD F;  3PQK A;  3BP8 A;  3COA C;  5H6R A;  4EJV A;  4Q5S F;  5HLG A;  5CVR A;  5BPD A;  2VBY A;  4XBF A;  4L0Z B;  3GXO A;  4I98 B;  4A2U A;  2HWV A;  3SZT A;  2ZFW A;  3KEO A;  5FB2 A;  2LNB A;  3BJO A;  1BOA A;  5A2Q Z;  3KLO A;  1Y0U A;  2G7U A;  3O3K A;  2FBK A;  2M45 A;  4CZZ A;  5L3E A;  4GXO A;  1O3Q A;  3LAP A;  5DDG A;  2R7F A;  2ESH A;  1U6G A;  4ASN A;  3BRO A;  1S8N A;  1FSE A;  3HRM A;  5F1R A;  3WGG A;  5AON A;  3HSE A;  1J0R A;  4M74 A;  5IT9 K;  1B9N A;  3TOB A;  1R1V A;  1XMA A;  4Z2Y A;  1LEB A;  2BYV E;  3KP5 A;  4ZYH A;  3LQQ A;  2D1V A;  4MGR A;  3L7W A;  2GWR A;  2ESN A;  1P6R A;  1DPU A;  3IL2 A;  2VOP A;  4G7O F;  5AIQ A;  4YFX F;  1FOK A;  1IUY A;  1T39 A;  2G7H A;  3E5X A;  2XUB A;  4GYI A;  2MH9 A;  4CYD A;  2XAH A;  3DXJ F;  5CVU A;  4BH9 A;  2HDC A;  3EYY A;  1V3F A;  4EGY A;  1R23 A;  5DCM B;  1XGO A;  4AVP A;  1XDS A;  4ZYE A;  4M73 A;  4G94 A;  5F6F A;  2EWN A;  4ESF A;  3FF5 A;  5E17 F;  3TKY A;  4HF0 A;  3RPU A;  1LQ1 A;  2UZK A;  4B8X A;  4RAY A;  3SXY A;  2GA2 A;  3QPT A;  2EFQ A;  4KN4 X;  1BIB A;  3GFM A;  4JBA A;  1IZ1 A;  3GFJ A;  2P5K A;  1MGT A;  4P55 A;  1QNT A;  4XSZ F;  1MJB A;  2QM3 A;  2FBH A;  1WWX A;  2XVC A;  3W6K B;  2R3S A;  3JAM K;  5LHI A;  3C18 A;  2Q8K A;  4MNU A;  2ELH A;  4CHU A;  3F6V A;  2E1N A;  4RB1 A;  2EA4 A;  2FSW A;  1SAX A;  4O3M A;  2PJP A;  1B59 A;  3RJP A;  1IN5 A;  3DV8 A;  1UCR A;  1YLF A;  1K78 A;  1BI2 A;  3RKY A;  4G7Z F;  3CUQ B;  3G3Z A;  2DFI A;  4QWQ A;  3HIF A;  4KIF A;  2F5C A;  1U5T B;  1EH7 A;  3EUH A;  2EV0 A;  5BPI A;  3C1D A;  3F8C A;  1T38 A;  1FYK A;  3TO9 A;  1T98 A;  3DPT A;  2ZBK A;  3ULQ B;  4CO8 A;  1EH8 A;  5J8C A;  4MQ9 F;  2FNA A;  4L5I A;  2G9W A;  3I64 A;  3IKV A;  2KIM A;  3WGH A;  4LLN A;  2P6T A;  1HSJ A;  3IWZ A;  2QQA A;  2EFP A;  2V79 A;  4WXC A;  4EGZ A;  5D6E A;  3EET A;  1Z1D A;  2VXZ A;  1KQ8 A;  3FXQ A;  5LGT A;  2X0L A;  4AIJ A;  2VC0 A;  2RDP A;  2KIF A;  3BOQ A;  2IT0 A;  4ENK A;  2WTE A;  4DNC A;  5FLX Z;  4HLY A;  3HOS A;  4UNO A;  4LLL A;  1ZH5 A;  3E5U A;  3IHU A;  1FSH A;  3F22 A;  1ZG5 A;  1XB4 A;  3ZQ7 A;  1UB9 A;  1WI9 A;  2WWY A;  4LB5 A;  1IXS B;  3KP3 A;  1V4R A;  5JI6 A;  1F1Z A;  2ZCW A;  1MKM A;  5LGU A;  1HKQ A;  4Q48 A;  1D5V A;  4M9X A;  4MQV A;  4YG2 F;  2IW5 A;  1DDN A;  3NRV A;  1OPC A;  5AIP A;  4L9T A;  2D45 A;  4MHG A;  2VE8 A;  1XMK A;  2KIU A;  3C3W A;  4KDP A;  3ZMZ A;  3RIR A;  3CO6 C;  1OYW A;  1R58 A;  1CGP A;  3K1M A;  1USS A;  2F2E A;  4CIC A;  2O8X A;  4EVI A;  1FPQ A;  4A5M A;  3W6J B;  1LJ9 A;  1W5S A;  1ON1 A;  4R79 A;  2A68 F;  3GYH X;  5DV5 A;  1GXP A;  2OA4 A;  1T2K A;  4U0W A;  3E6D A;  3DP7 A;  4N9I A;  4WK8 F;  3M9A A;  2CSO A;  1B1B A;  3MZH A;  3JTG A;  2VT3 A;  3J81 Z;  5FO5 A;  1JGS A;  2OD5 A;  3DEU A;  2DW4 A;  1PP8 F;  3LAJ A;  3DQV C;  1K7A A;  3FM3 A;  5HDN A;  1X3U A;  3WU1 B;  2L54 A;  1G3T A;  2L02 A;  1ZGA A;  1BI3 A;  1KQ0 A;  3HRT A;  2HZT A;  1I27 A;  3CJN A;  3TDU C;  4XSX F;  2CW0 F;  4HA8 A;  4I01 A;  1U8R A;  2W84 A;  3K1N A;  5CJ9 A;  5FFZ A;  3MZY A;  1R1T A;  4WX9 A;  5TRD A;  1OYI A;  4GGG A;  1FNN A;  1OR7 A;  3WTZ A;  2D1H A;  4TV7 A;  4UVA A;  2LDU A;  5JVT A;  1ZAR A;  2ZME B;  4HF1 A;  4AIK A;  1WSU A;  1S3J A;  2MLG A;  1ZN2 A;  4FT8 A;  4IVN A;  3V7S A;  1REP C;  4OMY A;  3GWZ A;  5E1Z B;  5E8G A;  2HYG D;  4M72 A;  4M6X A;  5BMZ A;  1GXQ A;  3QPH A;  4AD9 A;  1IN6 A;  4G9Y A;  4O5V A;  2EB7 A;  2QYO A;  3WTV C;  4LB6 B;  2OQG A;  3I59 A;  2VBZ A;  5LHH A;  5HDK A;  2ZME A;  2M8E A;  1BC8 C;  5ICE A;  1QGP A;  3HYI A;  2K27 A;  4U7D A;  4OU0 A;  5ERI A;  4RB2 C;  2FNP A;  5J6X A;  4XLN F;  1K79 A;  3ML6 A;  4IXA A;  1XSV A;  5LEK A;  1J9I A;  4YIF A;  3P9I A;  3WTX C;  4Y15 A;  2XAS A;  2ZXJ A;  3ECH A;  2KRF A;  4ZZD A;  5ICG A;  3EYI A;  5LBQ A;  1Z9C A;  2BGC A;  1IAW A;  2EFW A;  4E70 A;  1XSX A;  3O2P E;  5K5Q A;  5HDG A;  4K2E A;  4L9J A;  6PAX A;  3HTS B;  3BJ6 A;  5HS7 A;  5TJJ A;  3JAM Z;  1TQP A;  3KZZ A;  3V4G A;  1I1G A;  3ZMS A;  3RI4 A;  3J7A O;  4KA4 A;  5JHU A;  2HTJ A;  3T1B A;  1J2X A;  4RGR A;  3KP4 A;  1FX7 A;  3L09 A;  2DPD A;  1O3S A;  3I58 A;  2V1U A;  2R7D A;  4WF2 A;  1OMI A;  2MLK A;  1K6O A;  1KU9 A;  3F23 A;  4ZH4 F;  3GX4 X;  4EJW A;  2NAZ A;  3QP5 A;  3NEU A;  4MTD A;  4Y13 A;  2XHK A;  3ROU A;  1XCV A;  1YS7 A;  4L9N A;  4I7H A;  3M1E A;  1TLH B;  2QQ9 A;  3OOP A;  4RGS A;  4EJO A;  4U88 A;  3ZP5 A;  3EQL F;  1LNW A;  3JTH A;  3MAJ A;  2GXG A;  3E6M A;  2P7C B;  2DTR A;  3F72 A;  4KT5 C;  2STT A;  2XIG A;  2RC4 A;  1BI0 A;  3FX3 A;  3HHG A;  5D4S A;  2O61 A;  5HS9 A;  2PEX A;  3O6B B;  3I4P A;  2FE3 A;  2Z33 A;  4HAM A;  4M6Y A;  5EEH A;  4U0V A;  1E2X A;  2J5P A;  4I09 A;  3LA7 A;  1GHC A;  3CUO A;  1UHM A;  1YIO A;  3ERE D;  1Z6R A;  1D8J A;  1U5T A;  3B73 A;  2ZKZ A;  3D0S A;  2IA2 A;  3LFK A;  1B6A A;  2KJB A;  5F64 A;  1DUX C;  4KYW A;  4P5O A;  2V9V A;  2O6G E;  4HBL A;  3M8E A;  1H9G A;  1LDK B;  4N0B A;  2DK8 A;  2YPR A;  3WTU C;  1KQ9 A;  2GA1 A;  3KP6 A;  1W7P A;  2H94 A;  5BS6 A;  2BE5 F;  1YQA A;  4ON0 A;  1SD6 A;  1T0F A;  3ZMT A;  4FX0 A;  3LST A;  5K5O A;  3F3X A;  4GYG A;  4I2O A;  5CVI A;  3CUQ C;  5DUK A;  2TDX A;  4HF2 A;  1FC3 A;  2GIV A;  1HW5 A;  2DLL A;  4ZZL A;  4G6D A;  3FZV A;  3J81 K;  2L4M A;  1QBJ A;  2ETH A;  3KP2 A;  5JFR A;  2K7L A;  2LF8 A;  2W57 A;  1RNL A;  4EJU A;  2P4W A;  2EV5 A;  1O3T A;  1PP7 U;  1H0M A;  2IP2 A;  4I02 A;  3MCZ A;  2OU2 A;  4A12 A;  1ZGJ A;  5HVQ C;  3L00 A;  5D8L B;  3WTT C;  2YU3 A;  4BAY A;  1RI7 A;  1E17 A;  3MEX A;  4DQ2 A;  5ILV A;  5HLI A;  3HRU A;  4EV0 A;  2F5F A;  3WTS C;  2CQK A;  4FHT A;  3TGN A;  4KUM A;  3TO6 A;  2XGX A;  1BM9 A;  1IW7 F;  4BQA A;  2RN7 A;  2HQR A;  2EFO A;  3QU6 A;  2VOD A;  2DI3 A;  1YW7 A;  2CFX A;  3QOP A;  2NYX A;  4P9F A;  1IRG A;  1P4W A;  2E1C A;  4M71 A;  3RKW A;  1FZP B;  3QU3 A;  1W4M A;  1TTY A;  4M9S A;  5D6F A;  3RTR A;  2E7W A;  2XV4 S;  5FLX K;  4BNC A;  2VOO A;  1QO0 D;  1UHW A;  2X4H A;  1SD7 A;  1KU2 A;  2QZ8 A;  2NNY A;  3GFL A;  2BEO A;  1Z05 A;  2GZW A;  1HW1 A;  2STW A;  3F8F A;  1B4A A;  3ELK A;  3T5X A;  1TNS A;  3GEZ A;  3KZY A;  2NRA C;  3V8K A;  2MA3 A;  2PFB A;  3KET A;  2XAF A;  4GCV A;  2ADU A;  4U0Y A;  2UWM A;  2K4J A;  1A04 A;  1DP7 P;  4RGX A;  2VN2 A;  5LGN A;  1G3Y A;  2KKO A;  4PCQ A;  3TOA A;  5K5R A;  2GAU A;  1CF7 A;  4EM1 A;  3T0Y A;  1F4K A;  3WU0 A;  1LB2 A;  4U7B A;  1XGN A;  2B0L A;  1L0O C;  3E6B A;  2HKX A;  2WC2 A;  4UUV A;  2KJC A;  1MDM A;  5FD6 A;  4OIO F;  5D5W B;  1JE8 A;  1MZB A;  1KYW A;  3H3U A;  3GW2 A;  2H6B A;  3TO7 A;  3GO5 A;  4KIG A;  3F8B A;  1ODD A;  1BJA A;  4BXU A;  2HQN A;  5ICF A;  4LG0 B;  1U2W A;  3F21 A;  4PDK A;  4MTE A;  1HQC A;  4ETS A;  5L3B A;  2FU4 A;  2Y48 A;  5DD4 A;  1G3W A;  4XRF A;  1HKT A;  4L0Y B;  3K2Z A;  1I5Z A;  2XAJ A;  3SQN A;  1YO5 C;  3GZ6 A;  3Q9V A;  5E18 F;  5L3C A;  2LF7 A;  1O57 A;  1R5H A;  5KK1 A;  3VOD A;  1SD4 A;  4F7Z A;  4IHS A;  3ZPL A;  2HS5 A;  3G73 A;  5HS8 A;  4WCG A;  1ZRC A;  2PMU A;  5JR3 A;  2FMY A;  4I0B A;  2LKP A;  1S29 A;  2NS0 A;  3KEQ A;  1HXD A;  2MBF A;  3IRR A;  4CDG A;  1O7L A;  1FBQ A;  5CVJ A;  5D5X B;  4A0X A;  3KLN A;  1PUE E;  5H6Q A;  3DPL C;  4EJT A;  4B09 A;  1P2F A;  2YR2 A;  2BBY A;  2E7X A;  5DYM A;  2XKO A;  2VBW A;  3VFZ A;  3CTA A;  2L4A A;  3EDP A;  2ZO4 A;  4Y17 A;  3BPV A;  4HQE A;  2RGV A;  5L3G A;  1ZAO A;  4LG0 A;  1TW2 A;  3Q9S A;  3R60 A;  4YFK F;  2IA0 A;  1T6S A;  3HTU A;  2J5O A;  3L9F A;  3ZMU A;  2RV8 A;  3M7G A;  2FML A;  3LQR A;  2OZU A;  2W85 A;  2QEN A;  1LDD A;  3R0J A;  3GFI A;  4A0Z A;  1MDM B;  4UV9 A;  5D5V B;  5DEQ A;  2PBI A;  1FP1 D;  2DBB A;  1YYV A;  2ACJ A;  1AWC A;  2QLZ A;  2UXX A;  3P9K A;  3J80 Z;  2DQL A;  1O7F A;  2PMH A;  2RVC A;  5LRR A;  4S05 A;  4AIH A;  4H0E A;  2MH2 A;  4CGZ A;  3QAH A;  3CDH A;  1FT9 A;  4YII A;  3V7C A;  2EJR A;  1TNT A;  1UST A;  2XAG A;  2ISZ A;  3RYP A;  2ISY A;  5FD5 A;  4QLC U;  1XN7 A;  4RAZ A;  2HTS A;  5A2Q K;  1FYM A;  3R61 A;  4NQW A;  4LLG F;  3DKW A;  3P7N A;  2M5W A;  3VEP A;  4RGU A;  5E20 A;  2H6C A;  1SMY F;  4UVC A;  3JSO A;  5L3D A;  1W5T A;  4HYE A;  1ZRD A;  4P9U A;  4ENJ A;  5J8F A;  3OV8 A;  1KU3 A;  2V1D A;  2A6E F;  1R5G A;  4UVB A;  3K69 A;  1HST A;  3CUQ A;  1IF1 A;  1VTN C;  4Q4Z F;  1KGS A;  2VT2 A;  2HYF A;  5DD8 A;  4KMU X;  1U3E M;  2Z99 A;  2CWE A;  2Y75 A;  3I59 B;  2FBI A;  3V7R A;  5LEJ A;  3F8M A;  1FBS A;  1HKS A;  1SFE A;  2L3D A;  4D0P A;  3H3Z A;  2ZNY A;  1G4D A;  1ZLJ A;  2HGC A;  1STZ A;  4YFN F;  5KVR A;  2OAZ A;  1J5Y A;  1ONV A;  4MEX F;  2Q2E A;  1YW9 A;  2MC3 A;  2K02 A;  1FBU A;  2O3F A;  1U5T C;  4R1H A;  1Q1H A;  1FYL A;  1FP2 A;  4UV8 A;  3K9T A;  1BIA A;  4PZJ A;  3MWM A;  4A5N A;  3BWG A;  1Z91 A;  5LLQ A;  2RKH A;  1WQ2 A;  2RNJ A;  4EM2 A;  4ZYD A;  1MJ9 A;  5ICC A;  3R4K A;  3GUD A;  1F5T A;  3FWE A;  3TDZ C;  3KFW X;  4LMY A;  3PFI A;  4BHP A;  4BYY A;  2PLY A;  3SHF A;  2P5V A;  1TQM A;  4OIP F;  3K0L A;  1IXC A;  1W7P B;  1U78 A;  4LFU A;  2QVO A;  4IRG A;  1XCB A;  2XAQ A;  3WE3 A;  3BPX A;  3MQ0 A;  1HW2 A;  3GVA A;  3FM5 A;  4ENN A;  4OIN F;  5D5U B;  2F5D A;  3NQO A;  1KA8 A;  1JXS A;  1LDJ A;  1YG2 A;  4IRH A;  2YX4 A;  2LSO A;  3V8J A;  3U1D A;  5FFX A;  3B02 A;  5CLS A;  3R6S A;  1J75 A;  4G7H F;  1GVJ A;  1ZYR F;  1BI1 A;  4L5J A;  3FXU A;  4S04 A;  4PGH A;  4IHT A;  4M9Z A;  3IC7 A;  1XD7 A;  4ESJ A;  2PN6 A;  5K1Y A;  3HSF A;  3JW4 A;  2P7V B;  2DU9 A;  3ABT A;  3U9G A;  4L18 B;  2K86 A;  3AAF A;  1C0W A;  2M1B A;  2V6C A;  1TW3 A;  2Z5U A;  3RDI A;  2M30 A;  2PG4 A;  1WRJ A;  1OYY A;  5ILS A;  4BHB A;  3RYR A;  3ECO A;  5ILU A;  2JZY A;  3REO A;  3DFG A;  2RQP A;  1I1S A;  1F9N A;  2A3S A;  2XRN A;  2O0Y A;  2DQR A;  4JK1 X;  2EA2 A;  2Q0O A;  2IJL A;  4Q47 A;  1I6X A;  4G6Q A;  1IN7 A;  1Z7U A;  5BOX A;  1P4A A;  3HRS A;  1FLI A;  4KIB A;  1S7O A;  2OQR A;  4LJZ F;  4IRI A;  5HOO A;  1G6N A;  2IPQ X;  5IT3 A;  1XDU A;  3I54 A;  4A0Y A;  1EV7 A;  1R1U A;  1MJA A;  3HOT A;  4HLX A;  2P8T A;  3I71 A;  4ESB A;  3WTY C;  2HOE A;  2BV6 A;  3U2R A;  3ZN0 A;  4MEY F;  3E97 A;  4HV5 A;  2K4B A;  3HHH A;  4PGG A;  2WV0 A;  3M8F A;  3GZ5 A;  1YW8 A;  3HUG A;  5LRS A;  4RB0 A;  3FMQ A;  4LK0 F;  1S6L A;  4HX7 A;  1BC7 C;  4FX4 A;  2P5L C;  2CG4 A;  3T8T A;  5HLH A;  3ZMD A;  4HZF A;  3CO7 C;  2QQB A;  1RUO A;  3I5U A;  3D5L A;  1QPM A;  4G8X A;  1JHF A;  3LWF A;  3L2C A;  4HV6 A;  3FMR A;  4RS8 A;  4N9H A;  2XKP A;  1R22 A;  2QWW A;  1YS6 A;  3N97 A;  2DPU A;  2AXL A;  1MD0 A;  2ZJ2 A;  4UXN A;  2O03 A;  2YX7 A;  1ZG3 A;  3TQN A;  1SD5 A;  3IWF A;  3P9C A;  5H20 A;  1XGS A;  4HW0 A;  4I0A A;  2GQQ A;  1ON2 A;  3QRF F;  1J7K A;  3RKX A;  5LHG A;  1J59 A;  3E5Q A;  1D8K A;  3E3V A;  4ZYG A;  2QBY A;  2VON A;  1XGM A;  1LVA A;  3LA2 A;  3FMS A;  3IKT A;  4LGW A;  1UFM A;  4BHC A;  5E1W A;  1ZLK A;  1KYZ A;  2P6S A;  2F5E A;  2VE9 A;  4WXD A;  3WGI A;  3F6O A;  3WTW C;  2JRT A;  2W24 A;  1XSD A;  3SZP A;  1ULY A;  4RB3 C;  2FEZ A;  4XLP F;  3QP6 A;  4HQM A;  2IRF G;  2UXN A;  3T8R A;  3J80 K;  4GO1 A;  1DPR A;  1Z6T A;  2VC1 A;  4WWC A;  1IXR C;  2Y0M A;  1SFU A;  4ENM A;  4KMF A;  3V8L A;  3WG9 A;  2H27 A;  2W25 A;  1TQI A;  1YFH A;  1BN5 A;  1S7A A;  4IF4 A;  2EK5 A;  3HSR A;  5E1X A;  2Z9O A;  3KP7 A;  1O3R A;  2A69 F;  1R7J A;  3ISP A;  4KFC A;  4HX8 A;  2JSC A;  2XRO A;  2VBX A;  3KCC A;  3JSP A;  1RUN A;  2FA5 A;  2V1X A;  4IPA A;  4OOI A;  1SMT A;  4NB5 A;  2HKO A;  2EV6 A;  1QQI A;  2A07 F;  2FRH A;  1CF7 B;  2C6Y A;  4IJA A;  1LEA A;  1IN4 A;  2QBY B;  3RPQ A;  5L3F A;  4HDV A;  2A61 A;  1BBY A;  3GLX A;  1PDN C;  4EQQ A;  3GF2 A;  2D2W A;  3BZ6 A;  5BQT A;  5D4R A;  1YTY A;  2FF4 A;  3R0A A;  3BJA A;  1AOY A;  4P96 A;  1SFX A;  1KU7 A;  4KN7 X;  4LK1 F;  3ZN1 A;  4JQF A;  4L9V A;  3CLO A;  1G3S A;  3WE2 A;  1R36 A;  1B9M A;  4CXF A;  4WXH A;  4UHT A;  2MD5 A;  2PQ8 A;  2Z3Y A;  4KNY A;  3KE2 A;  4A6E A;  1IN8 A;  1RZ4 A;  2IA1 A;  1HBX G;  2CO5 A;  4AWX B;  2A5Y B;  2FOK A;  2HEO A;  2IVM A;  4HOB A;  2FQ3 A;  4LD5 A;  1EH6 A;  4EMS A;  2HR3 A;  1H9T A; 
#chains in the Genus database with same CATH topology
 3A01 A;  1QU3 A;  2F5V A;  3OYM A;  2LRD A;  3SFZ A;  4E7H A;  4V2F A;  4BY7 J;  3EUA A;  5DTD A;  4XKC A;  2GIZ A;  4ZC3 A;  3BY6 A;  3VWB A;  2JVH A;  3JRC A;  4W1U A;  3FHZ A;  2A6H F;  4DIQ A;  3AG1 H;  4IZZ A;  2BOL A;  5TGT A;  3ZQF A;  1FMV A;  2LFB A;  3PQJ A;  2DFF A;  4DYR A;  4EAT A;  2O8K A;  1T95 A;  1MSF C;  2FXA A;  2JTV A;  3FIW A;  5FGM A;  2VPR A;  4KIC A;  4Y7N J;  3E6C C;  3KYC B;  3DTK A;  5D8K B;  3WG7 H;  3JRB A;  2M4G A;  3IH3 A;  2X51 A;  2GM4 A;  4AID A;  1Y6I A;  3KYD B;  4OIQ F;  3DF8 A;  4ZTF A;  1YI2 I;  4NHJ A;  3IH4 A;  2HOS A;  1Z0X A;  2AS5 F;  1P92 A;  3BDD A;  1D0Z A;  3TBI A;  2EFN A;  3OYB A;  2M87 A;  2BW3 A;  2OBP A;  3CCR I;  1W7P D;  4A69 C;  1MBH A;  3NAR A;  5E8I A;  4PJJ A;  3VOE A;  4EM0 B;  2QUF A;  3ABL H;  2Q2E B;  3G71 I;  4O6J A;  3BG7 A;  5IT9 Z;  1FMW A;  1JHH A;  1TBX A;  3TP3 A;  5HLT A;  3FKJ A;  2DK5 A;  3IRQ A;  1HCR A;  5ED4 A;  1WKM A;  1ORK A;  2OZ6 A;  3ZGK A;  1PUF B;  3N4M A;  2VKE A;  2BW3 B;  2XF7 A;  2DO7 A;  5DCF A;  1FEX A;  1FWZ A;  2M9H A;  4OIR F;  2PX9 A;  3M8J A;  5GTH C;  4BJ5 C;  1RR8 C;  2FQ4 A;  2PI0 A;  1OKR A;  4B43 A;  2JT1 A;  5B5E C;  2E5Z A;  1RIO H;  1QVT A;  1XC5 A;  1WVR A;  4XN3 A;  1F43 A;  2COM A;  5E3N A;  2CGP A;  2DAO A;  2DA5 A;  3QWL A;  1MBJ A;  3HOW J;  1SVL A;  2CYY A;  4C30 A;  4HDU A;  3H5N A;  1R00 A;  1D1A A;  4PSX A;  2B9S A;  4HNV A;  3HGY A;  5J3L A;  1QZY A;  2HFH A;  2JPB A;  1GUU A;  3Q5F A;  1MMN A;  1P4X A;  2BY1 A;  1ZG1 A;  4ZDO A;  3ABU A;  1GDT A;  3UR3 C;  1ZRE A;  1ETX A;  3TW6 A;  3LA3 A;  4A3B J;  3BR2 A;  3EPZ A;  3VB2 A;  1QZZ A;  3MFK A;  3C2H A;  2JPC A;  5F1J A;  2L5Q A;  4R8H A;  2K9L A;  2L01 A;  2DT5 A;  3ZMV A;  5FLV A;  4NC8 A;  2ELK A;  5CYV A;  1JGG A;  5DCM A;  5DUI A;  2MSY A;  2HXI A;  5J1R A;  4EEF G;  1ZHF A;  4DZP A;  2B63 J;  3QYF A;  4BKX A;  4XIC A;  1VQ5 I;  5EEG A;  1IRF A;  4NDL A;  3GTO J;  2XPU A;  1VQM I;  1ZRF A;  2H09 A;  1FY7 A;  3F8N A;  1NHA A;  1L3L A;  2HZD A;  4OMZ A;  1D0X A;  5CVV A;  2X6Y A;  2ZNZ A;  1D3Y A;  5FRN A;  2YSR A;  3H92 A;  2VQC A;  1JT6 A;  2E1M B;  3KX2 A;  2DT7 B;  3I0T A;  3S2W A;  4HX4 A;  2WY8 Q;  3Q0W A;  1RPW A;  1P7I A;  3C7J A;  4XN0 A;  2NNN A;  1H89 C;  4B1R A;  4A6D A;  1JI8 A;  2DMN A;  3I53 A;  3K1P A;  3KPH A;  1K78 B;  3KZI C;  1X4O A;  2GXB A;  1R4N B;  3FXR A;  1OFC X;  3SDG A;  3WOD F;  3PQK A;  3BP8 A;  3QOE A;  3COA C;  2CUF A;  5H6R A;  4EJV A;  3HKZ N;  4AM3 A;  5FKK A;  4Q5S F;  2I10 A;  5HLG A;  5CVR A;  2NVY J;  2DDB A;  5BPD A;  2VBY A;  4XBF A;  4L0Z B;  2EZL A;  1ZGW A;  2ME6 A;  3J7A Y;  2Y0S A;  2DOD A;  3OYI A;  2R7X A;  1BOB A;  1PYV A;  3GXO A;  4I98 B;  4A2U A;  3OYK A;  2HWV A;  3SZT A;  2MC4 A;  2ZFW A;  3KEO A;  5FB2 A;  2LNB A;  4CCJ A;  4RDU A;  3BJO A;  3PJR A;  2X6O A;  3LOC A;  2IGO A;  3OR2 C;  1BOA A;  1VI0 A;  3I4N J;  3BR0 A;  2EIK H;  1S5L C;  2JA2 A;  5A2Q Z;  3KLO A;  5J1Y A;  2ZJP F;  1Y0U A;  3K10 A;  2G7U A;  1BW5 A;  3O3K A;  2JVG A;  2FBK A;  2XB0 X;  4Y3O A;  2M45 A;  4CZZ A;  5L3E A;  4GXO A;  1O3Q A;  1D0Y A;  2R7F A;  2ESH A;  5DDG A;  3LAP A;  1U6G A;  4ASN A;  2LY9 A;  3BRO A;  1S8N A;  1FSE A;  2KRC A;  1QZE A;  3HRM A;  3ONQ A;  5F1R A;  3WGG A;  1VFC A;  5AON A;  3HSE A;  1J0R A;  5GAH J;  2H1L A;  3N05 A;  3GTK J;  4M74 A;  4G12 A;  1WJE A;  5IT9 K;  4B47 A;  1B9N A;  3TOB A;  4HNU A;  2CV0 A;  1VQ4 I;  1R1V A;  1AKH A;  5CKT A;  1TL8 A;  2HPM A;  1XMA A;  3M1C A;  4Z2Y A;  4BEH A;  4DBR A;  1LEB A;  2BYV E;  3KP5 A;  4NC7 A;  2E2H J;  4BBS J;  4ZYH A;  2A5W A;  3LQQ A;  4C2T A;  1I3A A;  2D1V A;  1O4X A;  1X3W B;  4XKW A;  4HSR A;  4MGR A;  3L7W A;  1B72 A;  2GWR A;  3BQY A;  2ESN A;  2L9R A;  1P6R A;  4H4K C;  1DPU A;  1IJW C;  3IL2 A;  2VOP A;  3BR3 A;  4G7O F;  2K9Q A;  2IBD A;  2CV1 A;  3C2B A;  5AIQ A;  2WAE A;  4YFX F;  4C3H J;  2LYC A;  4MLO A;  4DGW B;  4IOC F;  1FOK A;  1IUY A;  4I6Z A;  1SAN A;  1T39 A;  2G7H A;  3E5X A;  2XUB A;  3DCF A;  2IGK A;  3VYR B;  4XID A;  4GYI A;  2JUG A;  2R7S A;  3DTI A;  5HNH A;  1DU6 A;  5GPC A;  4XR6 A;  3K6G A;  4E7S A;  4C3J J;  5B3S H;  2MH9 A;  4N4N B;  2XAH A;  4CYD A;  1XG1 A;  2XF5 A;  3DXJ F;  2JA8 J;  1ACI A;  5CVU A;  4F93 B;  4BH9 A;  2HDC A;  3EYY A;  1V3F A;  4EGY A;  2D5V A;  1HDP A;  1R23 A;  5DCM B;  2W82 A;  1ERD A;  3K4B A;  1XGO A;  2QGU A;  2M4K A;  2DFH A;  4AVP A;  2R7O A;  1XDS A;  1N78 A;  1F36 A;  4ZYE A;  4M73 A;  1JTY A;  4G94 A;  3OSG A;  1G59 A;  5F6F A;  2EWN A;  4C3I J;  1G2H A;  5FKM A;  4ESF A;  2H1K A;  1OCO H;  3FF5 A;  5E17 F;  2XB5 A;  4CUG A;  3L2U A;  2JMW A;  3OIO A;  3RQ4 A;  1LE8 A;  3IP4 B;  3TKY A;  4HF0 A;  3RPU A;  1LQ1 A;  2IS6 A;  2UZK A;  4B8X A;  4RAY A;  4OAY A;  1R49 A;  2ZXH A;  1HOM A;  4ZDP A;  3SXY A;  2LP0 A;  2GA2 A;  4D7N A;  3QPT A;  2EFQ A;  4KN4 X;  2BY3 A;  3LFU A;  1DU0 A;  1WFX A;  3HOU J;  1BIB A;  3CMM A;  3GFM A;  4JBA A;  1IZ1 A;  3CF2 A;  3GFJ A;  1UG2 A;  2F48 A;  1ZQ3 P;  2IAI A;  4BDY A;  1WPK A;  5KAI C;  2HXO A;  1V5F A;  2P5K A;  1MGT A;  3OYF A;  2VPL A;  4PJM A;  4P55 A;  1QNT A;  1MNE A;  4XSZ F;  1MJB A;  1QHG A;  2QM3 A;  2FBH A;  2VLA A;  4BY1 J;  4XQF A;  1WWX A;  2XVC A;  2K3P A;  5FLM J;  3W6K B;  2R3S A;  3C2G A;  5LHI A;  3JAM K;  3C18 A;  2Q8K A;  4MNU A;  3W2A A;  1WCM J;  2ELH A;  4CHU A;  3F6V A;  2E1N A;  4Y52 J;  1EKE A;  1FIA A;  4RB1 A;  2EA4 A;  1OLT A;  3M3Y J;  2FSW A;  1BW6 A;  4GRI A;  5BNG A;  1YJW I;  1SAX A;  4O3M A;  2PJP A;  1B59 A;  3RJP A;  1RKW A;  2CJJ A;  1VQ9 I;  1OCR H;  3JRG A;  3GTP J;  1IN5 A;  3DV8 A;  1H8A C;  1UCR A;  2GLO A;  1K4T A;  1ETW A;  1ZEL A;  1X1P A;  1YLF A;  3OWT A;  2B7E A;  4XON A;  1K78 A;  1BI2 A;  4V2G A;  2EH3 A;  3RKY A;  5M3F J;  4G7Z F;  3CUQ B;  3G3Z A;  4ZYA A;  1OJL A;  2DFI A;  3BCB A;  5EG0 B;  4QWQ A;  4RM3 A;  2V26 A;  4ZDL A;  1B8I A;  3HIF A;  4KIF A;  5GAE J;  2F5C A;  4D1Q A;  1U5T B;  1EH7 A;  3EUH A;  1Z77 A;  2EV0 A;  5BPI A;  3OYC A;  1ZTR A;  3HM5 A;  3C1D A;  3F8C A;  1T38 A;  1FYK A;  4II2 A;  3TO9 A;  1T98 A;  3TL4 X;  4AYB N;  2LY1 A;  5KCM A;  3DPT A;  2ZBK A;  3ULQ B;  4CO8 A;  2L2O A;  1EH8 A;  4RAG A;  5J8C A;  1R9T J;  4GDF A;  2M3A A;  2LBF A;  4BDZ A;  4MQ9 F;  2FNA A;  4L5I A;  4A3D J;  4XLF A;  2G9W A;  3I64 A;  3IKV A;  2YUS A;  3IAM 2;  3S1N J;  1LFB A;  2KIM A;  2NS7 A;  3CDL A;  3WGH A;  4LLN A;  5B1B H;  4KIT B;  2P6T A;  3A4C A;  1HSJ A;  3IWZ A;  1ETK A;  2QQA A;  3CME I;  2EFP A;  2V79 A;  4WXC A;  4EGZ A;  5D6E A;  3EET A;  5F08 A;  2DA7 A;  1Z1D A;  2VXZ A;  1KQ8 A;  3FXQ A;  3NWT A;  5LGT A;  3HOV J;  2X0L A;  4AIJ A;  2VC0 A;  2RDP A;  1AA7 A;  2KIF A;  4A3M J;  3PUB A;  1UG0 A;  3BOQ A;  2IT0 A;  4ENK A;  4II3 A;  2WTE A;  4DNC A;  4XRS A;  5FLX Z;  4HLY A;  1W0U A;  3HOS A;  3FK6 A;  4UNO A;  3SEZ A;  4BQN A;  4BE1 A;  4F91 B;  4LLL A;  1ZH5 A;  3BG9 A;  3E5U A;  2QSF X;  3IHU A;  1FSH A;  3F22 A;  1ZG5 A;  1Y56 A;  1XB4 A;  3ZQ7 A;  3CZ6 A;  2K5C A;  3A03 A;  4CSW A;  1UB9 A;  2LK2 A;  1WI9 A;  2WWY A;  5LD2 C;  3ZRG A;  4LB5 A;  1IXS B;  2JUC A;  1TT5 B;  3KP3 A;  1V4R A;  5JI6 A;  2Y2Z A;  1F1Z A;  2ZCW A;  3G1M A;  1MKM A;  5LGU A;  3CCS I;  3I4M J;  1I39 A;  4MIM A;  4A3L J;  1A36 A;  1HKQ A;  4Q48 A;  1ETV A;  1D5V A;  2A6T A;  3ZQQ A;  1T08 B;  4M9X A;  4MQV A;  2NOJ B;  4YG2 F;  1YX3 A;  2IW5 A;  1DDN A;  2OJE D;  5IYC J;  2VKH A;  1GLN A;  3TP0 A;  3RKQ A;  3AFH A;  2DTZ A;  4GFB A;  3NRV A;  1FTZ A;  1HA8 A;  1OPC A;  2ZC2 A;  5AIP A;  4KT6 A;  2E34 A;  3E0J B;  4L9T A;  2D45 A;  2JN6 A;  4MHG A;  2VE8 A;  2KLO A;  4D5C A;  3CMY A;  1XMK A;  2KIU A;  1IRZ A;  2K9N A;  3C3W A;  1ENH A;  1NG6 A;  1MMD A;  3CMA I;  3GTJ J;  2LKX A;  4KDP A;  3PIP F;  4FE4 A;  3L2W A;  1OCT C;  3ZMZ A;  3RIR A;  4PK4 A;  1ETY A;  1OYW A;  1R58 A;  3CO6 C;  1CGP A;  1VQ8 I;  1YJN I;  3LSM A;  3K1M A;  1USS A;  3BTI A;  2Y0S N;  2F2E A;  2E1O A;  2MD0 A;  1S7E A;  4CIC A;  2O8X A;  4EVI A;  1FPQ A;  2VJ5 A;  4A5M A;  1X58 A;  1LJ9 A;  3W6J B;  1W5S A;  1ON1 A;  1UJ8 A;  2E1M C;  3BG3 A;  3V42 A;  4R79 A;  2M0M A;  4Y4R A;  2A68 F;  5F0F A;  3GYH X;  5DV5 A;  5DM6 F;  1GXP A;  2OA4 A;  1T2K A;  4U0W A;  3PNY A;  3E6D A;  3DP7 A;  3E1S A;  3H3V K;  3QQA A;  1TWG J;  4N9I A;  2N8G A;  4XK4 A;  3PNT A;  4WK8 F;  4NQW B;  3HOY J;  3M9A A;  2XRL A;  2CSO A;  1B1B A;  3MZH A;  3JTG A;  2V7F A;  2VT3 A;  3J81 Z;  4XNF A;  5FO5 A;  2QKL B;  1BL0 A;  4BS9 A;  1JGS A;  4E6K G;  2OD5 A;  4JX4 A;  3DEU A;  2DW4 A;  3A2K A;  3OYD A;  1PP8 F;  3LAJ A;  3DQV C;  3FXK A;  1K7A A;  4JX6 A;  3FM3 A;  3PSF A;  4XOR A;  5HDN A;  2VJI A;  2GXA A;  1X3U A;  2XSD C;  3WU1 B;  2L54 A;  1G3T A;  2L02 A;  1ZGA A;  2L7F P;  1BI3 A;  1KQ0 A;  3HRT A;  3W3C A;  2E5N A;  4DJA A;  1RC9 A;  2HZT A;  2ID3 A;  1I27 A;  4S0H B;  3CJN A;  3TDU C;  2R92 J;  2W7N A;  1WHU A;  2BY2 A;  4XSX F;  3BR5 A;  2CW0 F;  4A3I J;  1WJB A;  4HA8 A;  4I01 A;  2AXT C;  4FAS D;  1SFO J;  2ELJ A;  1FOW A;  3ZQG A;  2CQQ A;  3K4M A;  1U8R A;  2W84 A;  3K1N A;  3MKW B;  4MFD A;  5CJ9 A;  5FFZ A;  3MZY A;  3H0D A;  1R1T A;  3NWS A;  2YU9 J;  4WX9 A;  2M7A A;  5TRD A;  1QPI A;  2PMZ A;  1OYI A;  4GGG A;  4HPQ A;  1FNN A;  2NS8 A;  4DZJ A;  1OR7 A;  3WTZ A;  2D1H A;  4TV7 A;  1DGR M;  4UVA A;  4OWR B;  2DOA A;  2G0E A;  2LDU A;  2LMD A;  3MVP A;  5JVT A;  1ZAR A;  2ZME B;  3UKG A;  4HF1 A;  4AIK A;  4MFE A;  5B66 C;  2LKS A;  1WSU A;  4PJL A;  1S3J A;  1QVU A;  3LMM A;  2MLG A;  2NOG A;  1H88 C;  1MBG A;  1ZN2 A;  1UEL B;  4FT8 A;  4IVN A;  2CUJ A;  3S14 J;  3V7S A;  1REP C;  5JLX A;  4OMY A;  3GWZ A;  5E1Z B;  5E8G A;  2HYG D;  3Q0V A;  4M72 A;  4M6X A;  5BMZ A;  1GXQ A;  3QPH A;  4AD9 A;  3OS2 A;  1OR7 C;  1IN6 A;  3GCM A;  4G9Y A;  4O5V A;  2EB7 A;  2QYO A;  2JQ7 A;  3IAS 2;  1JJ8 C;  2DJN A;  3G2B A;  1RRJ A;  3WTV C;  4LB6 B;  2OQG A;  3I59 A;  2VBZ A;  4YEJ A;  5LHH A;  3SEQ A;  2GBY A;  2DJI A;  3GTG J;  5HDK A;  2ZME A;  2M7B A;  1IV8 A;  3HC7 A;  2M8E A;  1BC8 C;  2DYR H;  3RQI A;  5ICE A;  1QGP A;  3HYI A;  1SVM A;  4CCN A;  2K27 A;  2K9S A;  4U7D A;  1TT0 A;  3JRH A;  1MMG A;  4OU0 A;  3BT9 A;  1A6I A;  5ERI A;  4RB2 C;  2FNP A;  2KDO A;  4XLN F;  5J6X A;  1K79 A;  3K4L A;  4ZJZ A;  3ML6 A;  4IXA A;  1JUP A;  1XSV A;  5LEK A;  1JUM A;  3JRD A;  2EIJ H;  2M34 A;  3CDI A;  3PO2 J;  4YIF A;  3P9I A;  3WHC A;  5KAF C;  3WTX C;  1J9I A;  1NK3 P;  4Y15 A;  4BXF A;  2GOX B;  2XAS A;  4YIR X;  2ZXJ A;  1MMA A;  3I56 I;  3ECH A;  2KRF A;  4ZZD A;  1YIT I;  5ICG A;  3EYI A;  3DU6 A;  5LBQ A;  1Z9C A;  1FTT A;  4BJ6 C;  2BGC A;  2NVQ J;  1IAW A;  2BVL A;  4A3C J;  2BVM A;  5EZH A;  2EFW A;  4E70 A;  1XSX A;  4XLA A;  1MBE A;  4LG3 A;  3O2P E;  5HDG A;  5K5Q A;  3HXL A;  2F4M B;  3CCU I;  1GVD A;  1R5I D;  1B8I B;  5FKO A;  4K2E A;  2L7Z A;  5EG0 A;  5EZG A;  2DOF A;  4L9J A;  3CCQ I;  6PAX A;  3DKX A;  3HTS B;  3BJ6 A;  5HS7 A;  5TJJ A;  3JAM Z;  1TQP A;  3KZZ A;  3V4G A;  1I1G A;  3K4J A;  1R71 A;  2BZT A;  4XKB A;  3BZC A;  3ZMS A;  3OYG A;  3RI4 A;  3J7A O;  4KA4 A;  5JHU A;  2HTJ A;  1K61 A;  2IS4 A;  2X6X A;  3T1B A;  1J2X A;  4RGR A;  3KP4 A;  2M0C A;  1FX7 A;  5GPA A;  2MG4 A;  3L09 A;  2DPD A;  1T0F C;  1O3S A;  2IEK A;  3I58 A;  2V1U A;  2R7D A;  4WF2 A;  3ZXS A;  3OYJ A;  1OMI A;  2MLK A;  1ZK8 A;  2L9S A;  1K6O A;  1KU9 A;  4X1E A;  2ZJQ F;  3F23 A;  4ZH4 F;  2L9V A;  3GX4 X;  4EJW A;  4IHV A;  2NAZ A;  2AO9 A;  3QP5 A;  3NEU A;  2KRH A;  4MTD A;  2K9M A;  1POG A;  4E7L A;  4Y13 A;  1D5Y A;  2EIL H;  2DA1 A;  2HDW A;  2E71 A;  2LY2 A;  2XHK A;  3QPL A;  3ROU A;  2VAS A;  1XCV A;  4A93 J;  2R7W A;  1U9O A;  1YS7 A;  4A3E J;  4L9N A;  3VSL A;  4I7H A;  2MGQ A;  3M1E A;  1TLH B;  2QQ9 A;  3QYB A;  2HOA A;  3OOP A;  3RSN A;  4RGS A;  1SFK A;  4HRI A;  2F6C A;  4EJO A;  1D1C A;  4M3G A;  3EQL F;  4U88 A;  3ZP5 A;  2QA4 I;  3DWL E;  1FOY A;  1LNW A;  2LVS A;  5GTI C;  3JTH A;  4HEA 2;  1JTX A;  2ZB9 A;  2DCE A;  3MAJ A;  5J1U A;  2CUZ A;  2GXG A;  3E6M A;  4CCL A;  2Z1D A;  3S8P A;  1TWH J;  1WGX A;  3JRA A;  2P7C B;  2ZSI B;  1T8I A;  2R5Z B;  2DTR A;  3F72 A;  4KT5 C;  3PO3 J;  2STT A;  2XIG A;  5C3E J;  3J7Z I;  3WHB A;  2RC4 A;  2OUM A;  4QPO A;  1BI0 A;  1Y0N A;  3FX3 A;  3HHG A;  3CCM I;  2CS3 A;  2VXD A;  5D4S A;  2O61 A;  2V4J C;  5HS9 A;  4F92 B;  2PEX A;  3O6B B;  3I4P A;  2LTP A;  2FE3 A;  2Z33 A;  5K7Z A;  3ZQL A;  4CA0 A;  2HOT A;  4HAM A;  4M6Y A;  5EEH A;  4U0V A;  1E2X A;  2J5P A;  3FK7 A;  2WAD A;  4I09 A;  4AC0 A;  2EIM H;  3LA7 A;  3CCE I;  1GHC A;  3CUO A;  1UHM A;  2HI3 A;  1LPQ A;  1JUS A;  1LKX A;  1YIO A;  1G8X A;  2R4G A;  3M4O J;  3MKY B;  1IV6 A;  3QPS A;  2IS2 A;  4XOP A;  3ERE D;  3FIS A;  4YEL A;  1XTA A;  1Z6R A;  1D8J A;  1U5T A;  1VQ6 I;  2VJ4 A;  1VZ0 A;  3B73 A;  2PJR B;  2ZKZ A;  1MNM C;  3ERM A;  3D0S A;  4Y33 A;  3OYH A;  3FKI J;  4M3D A;  2IA2 A;  3LFK A;  4IOA F;  1B6A A;  3GTL J;  2KJB A;  1I50 J;  3BZK A;  4E7J A;  5F64 A;  1DUX C;  4KYW A;  2DMP A;  4P5O A;  2ICW G;  2V9V A;  2O6G E;  3BLY A;  4HBL A;  3M8E A;  1H9G A;  4QIW N;  1LDK B;  4N0B A;  2W48 A;  2DK8 A;  2YPR A;  3WTU C;  4OAZ A;  2R7U A;  4BXX J;  1KQ9 A;  2GA1 A;  4B3A A;  3KP6 A;  5FRO A;  3PIO F;  1W7P A;  3L2Q A;  2H94 A;  5BS6 A;  2BE5 F;  1YQA A;  2OC6 A;  3G1O A;  4ON0 A;  1SD6 A;  2V6E A;  1T0F A;  2BHY A;  3ZMT A;  4FE7 A;  3TED A;  4FX0 A;  3LST A;  3WU2 C;  5K5O A;  1VND A;  3F3X A;  2EZK A;  4GYG A;  3OYL A;  4I2O A;  5CVI A;  3CUQ C;  2XC7 A;  5DUK A;  2TDX A;  4HF2 A;  1MBF A;  1FC3 A;  2GIV A;  3MKL A;  4I99 C;  5KHD A;  3S93 A;  5B1A H;  1HW5 A;  3K4C A;  3S1R J;  2DLL A;  4ZZL A;  5FRM A;  4IO9 F;  3MD2 A;  4G6D A;  3FZV A;  3J81 K;  9ANT A;  2L4M A;  1QBJ A;  1ETQ A;  2RRE A;  2ETH A;  1Z21 A;  3KP2 A;  4MO7 A;  5JFR A;  1Y8R B;  2K7L A;  2LF8 A;  3CQZ J;  3KYL A;  4BE2 A;  2ZJR F;  2R7V A;  4B4C A;  2W57 A;  4F3Q A;  3LSG A;  1BR4 A;  1Q1V A;  1E3H A;  1RNL A;  4EJU A;  4J00 A;  2P4W A;  2EV5 A;  2FJ1 A;  1OCZ H;  5EDN A;  1O3T A;  1LE8 B;  1PP7 U;  1H0M A;  4PFO A;  2IP2 A;  2A05 A;  3QYE A;  4I02 A;  3MCZ A;  2OU2 A;  4A12 A;  3ABM H;  1UZC A;  1Y8Q B;  2KQR A;  1ZGJ A;  5HVQ C;  3CC2 I;  3L00 A;  5D8L B;  2HQA A;  1PUF A;  3WTT C;  2YU3 A;  2LOO A;  4BAY A;  1PJR A;  3FXO A;  5DS9 A;  2VL8 A;  1RI7 A;  1E17 A;  3H5R A;  3H5A A;  3MEX A;  4DQ2 A;  5ILV A;  5HLI A;  3DLA A;  1TWA J;  3HRU A;  2DA4 A;  2BY0 A;  3H35 A;  2AQE A;  4EV0 A;  1IDZ A;  2F5F A;  3WTS C;  2CQK A;  3AL0 C;  4D5F A;  4FHT A;  3TGN A;  1A6Q A;  2HNH A;  4KUM A;  3TO6 A;  1BJZ A;  2XGX A;  2HDD A;  1BM9 A;  1IW7 F;  1X19 A;  4BQA A;  3GME A;  1V54 H;  4F52 A;  2RN7 A;  2HQR A;  2JA6 J;  2EFO A;  3QU6 A;  2VOD A;  2DI3 A;  1YW7 A;  3ZCO A;  2CFX A;  1SAU A;  2CRG A;  2LR8 A;  3QOP A;  2JK3 A;  2NYX A;  1ETO A;  4E7K A;  1QA6 A;  4P9F A;  2VKV A;  4AU7 A;  2UUZ A;  1UMQ A;  2RAE A;  1IRG A;  1P4W A;  2E1C A;  3IH2 A;  2CQN A;  1YRN A;  3AL0 B;  4M71 A;  3RKW A;  1FZP B;  3QU3 A;  2ID6 A;  1W4M A;  3LNQ A;  1TTY A;  4M9S A;  5D6F A;  3RTR A;  2E7W A;  3S2H J;  4UB8 C;  2CQX A;  2XV4 S;  3AG2 H;  5FLX K;  1A35 A;  4BNC A;  2DMQ A;  3D5S C;  1QO0 D;  1UHW A;  2X4H A;  1SD7 A;  1KU2 A;  1YIJ I;  1RET A;  2VOO A;  4BAC A;  2KZV A;  4M3E A;  1X2M A;  1AKH B;  2QZ8 A;  2NNY A;  4Z6Y A;  3GFL A;  5JLW A;  2BEO A;  3PM1 A;  2XPW A;  1Z05 A;  2GZW A;  1HW1 A;  2LRE A;  3ZQC A;  2STW A;  3F8F A;  1B4A A;  2Y69 H;  3ELK A;  5J4V A;  3T5X A;  2O9L A;  1TNS A;  3GEZ A;  1X1C A;  4B48 A;  4RBO A;  3KZY A;  2NRA C;  1WJF A;  4BBR J;  4D7M A;  3V8K A;  3CC7 I;  2MA3 A;  2TCT A;  1HF0 A;  2LC2 A;  4AVZ A;  2PFB A;  2VJJ A;  3KET A;  2V9K A;  2XAF A;  2ADU A;  4GCV A;  4U0Y A;  3JCU C;  2UWM A;  2K4J A;  2O7O A;  1A04 A;  1DP7 P;  4RGX A;  2VN2 A;  5LGN A;  1G3Y A;  2KKO A;  3BG5 A;  4PCQ A;  3CES A;  3TOA A;  3H36 A;  5CQG A;  1A31 A;  5K5R A;  4LIV A;  2GAU A;  1CF7 A;  4EM1 A;  1R4M B;  3T0Y A;  1DGW Y;  1F4K A;  3WU0 A;  1LB2 A;  4U7B A;  1XGN A;  2B0L A;  2NVT J;  2HU9 A;  1L0O C;  2P0W A;  3E6B A;  2HKX A;  2WC2 A;  2V9P A;  4UUV A;  2KJC A;  2OF7 A;  2Z2S B;  3LSH A;  5FD6 A;  1ZR2 A;  1MDM A;  4OIO F;  5D5W B;  3D1N I;  1JE8 A;  1X1A A;  1IO2 A;  1MZB A;  3CD6 I;  1Y1W J;  1KYW A;  3H3U A;  3GW2 A;  2H6B A;  2DN0 A;  2JA5 J;  3TO7 A;  5K7F A;  2QF7 A;  3GO5 A;  4KIG A;  3X2Q H;  1WJA A;  2X9D A;  3F8B A;  3RCO A;  1ODD A;  3CJR B;  2IXS A;  2VQL A;  1BJA A;  3NAU A;  2WY7 Q;  1MMS A;  4BXU A;  4ZTJ A;  2HQN A;  5ICF A;  4LG0 B;  1U2W A;  3F21 A;  3FDY A;  3I9V 2;  1GV2 A;  4PDK A;  3GTQ J;  4MTE A;  4E4H A;  2R0Q C;  1HQC A;  4ETS A;  2OCE A;  5E3L A;  5L3B A;  3K70 C;  3SYT A;  4IHW A;  2FU4 A;  2Y48 A;  5DD4 A;  1G3W A;  5IOY A;  4DYQ A;  1PVE A;  4XRM A;  1X1D A;  4XRF A;  1N25 A;  5IP7 J;  5JHF A;  1HKT A;  4IHX A;  4IEJ A;  4L0Y B;  1E3P A;  1VQO I;  1MBK A;  3K2Z A;  2AHQ A;  4JP0 A;  1I5Z A;  2XAJ A;  3SQN A;  1W36 D;  1V5G A;  1N77 A;  1YO5 C;  3GZ6 A;  2VIX A;  3Q9V A;  1I6H J;  5E18 F;  5L3C A;  1SVO A;  1TP4 A;  2L7K A;  2LF7 A;  1O57 A;  4A3K J;  2VKD A;  3GTM J;  1R5H A;  3Q3S A;  3K7A J;  3O8G A;  3DEE A;  5KK1 A;  3VOD A;  3HJE A;  2WV1 A;  4CCK A;  1SD4 A;  4F7Z A;  4IHS A;  3TMO A;  1BR2 A;  4U87 A;  3ZPL A;  2HS5 A;  2W00 A;  3G73 A;  2QQ8 A;  5HS8 A;  4WCG A;  3AKZ A;  3FBN B;  1ZRC A;  3OMY A;  3I3L A;  4PJ0 C;  2PMU A;  1MH4 A;  2K40 A;  5JR3 A;  2Z16 A;  3HL2 A;  1ZKG A;  2CQ7 A;  2FMY A;  3ZQI A;  4I0B A;  3RZO J;  1JKQ C;  4M3F A;  2LKP A;  1S29 A;  2NS0 A;  3KEQ A;  3CC4 I;  1MSE C;  2OV7 A;  5TIS C;  1HXD A;  3HPH A;  3OS1 A;  2MBF A;  3IRR A;  4CDG A;  4CZC A;  3F0C A;  1S72 I;  1O7L A;  2CV2 A;  1FOX A;  1FBQ A;  2XF6 A;  5CVJ A;  3VPR A;  5M3M J;  3K4N A;  5D5X B;  4A0X A;  3KLN A;  2R5Y B;  4XM3 A;  1PUE E;  5H6Q A;  3DPL C;  4EJT A;  4B09 A;  1P2F A;  3FBI B;  2QKM B;  3DU5 A;  2YR2 A;  2LD5 A;  2BBY A;  1AU7 A;  2E7X A;  5DYM A;  2XKO A;  1Z3X A;  4KIS A;  2VBW A;  3VFZ A;  3CCL I;  3CTA A;  1IUF A;  2L4A A;  1LVK A;  3EDP A;  3PL8 A;  2ZO4 A;  4Y17 A;  3BPV A;  5HOD A;  2BXZ A;  4HQE A;  2RGV A;  5LFA A;  3HOX J;  1JT0 A;  1VQ7 I;  2EBI A;  5L3G A;  2EIN H;  1ZAO A;  2FOW A;  4LG0 A;  2R7Q A;  1X2N A;  1TW2 A;  3OIQ A;  1P7J A;  3CCY A;  3Q9S A;  3R60 A;  3MKZ A;  4YFK F;  5IP6 A;  4CCO A;  2R5Z A;  2IA0 A;  3ZOB A;  2EZH A;  1T6S A;  3HTU A;  1K4S A;  4X0G A;  2J5O A;  3L9F A;  3K70 D;  3RZD J;  3ZMU A;  3W2V A;  2RV8 A;  3M7G A;  2FML A;  3LQR A;  1VF9 A;  4NBQ A;  5GP9 A;  2OZU A;  2W85 A;  3B6C A;  2IGM A;  2QEN A;  3PFY A;  2Y30 A;  1K6Y A;  1LDD A;  3R0J A;  3GFI A;  5E3O A;  5FJ8 J;  2GOM A;  1J09 A;  4A0Z A;  3DEW A;  3HKZ A;  4UV9 A;  5D5V B;  1MDM B;  4RM2 A;  2PBI A;  1FP1 D;  5DEQ A;  2DBB A;  2K85 A;  2NVX J;  1YYV A;  2ACJ A;  1AWC A;  2QLZ A;  4BL0 B;  1HDD C;  2VUM J;  4JX5 A;  2UXX A;  2XGD A;  3P9K A;  3J80 Z;  2DQL A;  1O7F A;  2PMH A;  2RVC A;  3MN2 A;  5LRR A;  2E60 A;  3S16 J;  1V5E A;  3CP2 A;  4S05 A;  4AIH A;  4H0E A;  2MH2 A;  4CGZ A;  2X6W A;  3QAH A;  3HB9 A;  3CDH A;  1FT9 A;  4YII A;  4CYC B;  3V7C A;  2Q1Z B;  5F27 A;  1GT0 C;  3A1Y A;  4XRS G;  2E35 A;  1OIS A;  2EJR A;  1TNT A;  1UST A;  2XAG A;  3J7Y J;  3FXM A;  2ISZ A;  3AG4 H;  5FKN A;  3FHN A;  3RYP A;  2ISY A;  5FD5 A;  4QLC U;  1XN7 A;  2K3F A;  4RAZ A;  2M8G X;  2HTS A;  5A2Q K;  1FYM A;  1WJ5 A;  5M5X J;  4ANJ A;  2FD5 A;  3R61 A;  5E3M A;  4NQW A;  5EGO B;  4LLG F;  3DKW A;  3P7N A;  2XGC A;  3LL7 A;  5F04 A;  1Y1V J;  1FJL A;  3OL3 A;  4NUB A;  2M5W A;  4LIU A;  3H9J A;  3VEP A;  4RGU A;  5E20 A;  1WZ2 A;  3JR9 A;  3U1K A;  2H6C A;  5DM7 F;  2JA7 J;  1SMY F;  1UHS A;  4UVC A;  5E79 C;  4UUT A;  3QOD A;  4HG2 A;  2MW8 A;  5EF6 A;  3JSO A;  5L3D A;  4M6V A;  1W5T A;  4HYE A;  1ZRD A;  5HNF A;  4DOZ A;  4P9U A;  4UB6 C;  4A3G J;  2QEX I;  4ENJ A;  2WAQ N;  5J8F A;  3OV8 A;  1KU3 A;  2V1D A;  2ZSH B;  2A6E F;  3BCA A;  1R5G A;  2L9N A;  4UVB A;  3K69 A;  2VB6 A;  1KZH A;  1HST A;  3CUQ A;  1IF1 A;  4JYK A;  1TZL A;  1VTN C;  4RAF A;  4C2M J;  1LFP A;  1KGS A;  2VT2 A;  4Q4Z F;  2HYF A;  1NTC A;  5DD8 A;  4F55 A;  4KMU X;  1U3E M;  2Z99 A;  4NNJ A;  4FQG A;  2CWE A;  2X1D A;  5IYB J;  1WH5 A;  3OY9 A;  2Y75 A;  3I59 B;  4DYC A;  3K4K A;  5H2F C;  2FBI A;  5KNL A;  3S17 J;  3E7L A;  1R6R A;  2DOE A;  3V7R A;  5LEJ A;  2ME0 A;  1FBS A;  3F8M A;  3PNV A;  4QTR A;  1HKS A;  3H9G A;  1SFE A;  2L3D A;  4D0P A;  3H3Z A;  4CYC A;  2ZNY A;  1G4D A;  1ZLJ A;  2HGC A;  1X4P A;  1STZ A;  3GZN B;  2XGE A;  4YFN F;  5KVR A;  1XS9 A;  1AHD P;  2OAZ A;  1EF4 A;  5EEA A;  3LSJ A;  1J5Y A;  1ONV A;  1Z67 A;  4P1W A;  4MEX F;  2JRM A;  2CFO A;  2Q2E A;  1YW9 A;  5J4Y A;  3CCV I;  2MC3 A;  3L2R A;  2K02 A;  1FBU A;  2O3F A;  1U5T C;  1LFU P;  4R1H A;  1Q1H A;  2W4S A;  2X85 A;  1FYL A;  2DMT A;  1FP2 A;  2CU7 A;  3VYS B;  1NK2 P;  2FX0 A;  4UV8 A;  3JRE A;  1JKR C;  3Q0U A;  3K9T A;  1BIA A;  4PZJ A;  3MWM A;  4A5N A;  3BWG A;  1Z91 A;  3A02 A;  3LSP A;  1T33 A;  2WB1 N;  1E3O C;  2AQF A;  5LLQ A;  3S1M J;  2RKH A;  1IG7 A;  1WQ2 A;  2RNJ A;  1YJ9 I;  2HVR A;  4IHY A;  3VSK A;  2ZXI A;  4PSW A;  4EM2 A;  1I3Q J;  4ZYD A;  3UNG C;  3HEF A;  1VQN I;  1MJ9 A;  5ICC A;  3R4K A;  3GUD A;  4E7I A;  3G1L A;  2LBF B;  2H8R A;  1F5T A;  3FWE A;  2KPM A;  5JVG F;  2EZI A;  3P5J A;  1CQT A;  3TDZ C;  3KFW X;  4LMY A;  3PFI A;  3ZR8 X;  4BHP A;  4G6T B;  4BYY A;  2PLY A;  3SHF A;  2P5V A;  1TQM A;  4UUS B;  4OIP F;  3K0L A;  1IXC A;  1SC7 A;  1W7P B;  1U78 A;  2CUE A;  4LFU A;  3OSF A;  2QVO A;  4IRG A;  3A01 B;  1ZR4 A;  4BGD A;  2ECB A;  1XCB A;  3OR1 C;  3VDX A;  1W1W E;  2XAQ A;  3WE3 A;  4HNT A;  4JOM A;  3BQZ A;  3BPX A;  3MQ0 A;  3HOZ J;  1HW2 A;  3GVA A;  3FM5 A;  1D1B A;  4ENN A;  1IDY A;  4OIN F;  4C2U A;  5D5U B;  2F5D A;  3NQO A;  3H1C A;  1W0T A;  1KA8 A;  1JXS A;  3DPU A;  2KMU A;  2LLK A;  2MYS A;  1LDJ A;  2DFE A;  5EYR A;  1YG2 A;  4IRH A;  2YX4 A;  2LSO A;  3V8J A;  4BQO A;  3DBR B;  3U1D A;  3LSI A;  5FFX A;  3B02 A;  5CLS A;  3R6S A;  1J75 A;  4G7H F;  3EUH C;  2BXY A;  2KZG A;  1GVJ A;  5F0H A;  3O8H A;  4BQQ A;  4XL9 A;  1DP3 A;  3H9Q A;  1K83 J;  1ZYR F;  1JKP C;  1BI1 A;  1WJC A;  4L5J A;  2WAF A;  4RA2 A;  4XLC A;  2ZXW H;  1VQL I;  3FXU A;  2KP6 A;  4RLQ A;  4V19 K;  2XAU A;  2QCO A;  4S04 A;  2L7M P;  2LH9 A;  4PGH A;  4N4O B;  4A3J J;  1U0J A;  3S3N A;  4M9Z A;  3IC7 A;  4QPQ A;  4DBQ A;  1IGN A;  4IHT A;  1XD7 A;  5C4J J;  1X3Z B;  3BR6 A;  3HPG A;  4ESJ A;  2OPT A;  2PN6 A;  1P9Q C;  4UUS A;  5K1Y A;  3DLL F;  3HSF A;  1UAA A;  3JW4 A;  1JJ6 C;  2P7V B;  2DU9 A;  2OTJ I;  1XX5 A;  3ABT A;  3U9G A;  4L18 B;  2K86 A;  3AAF A;  1C0W A;  2PMZ N;  5K7H A;  2M1B A;  2V6C A;  4IQ4 A;  1TW3 A;  2Z5U A;  3RDI A;  3OYA A;  3SDB A;  4CCM A;  2KFD A;  2E19 A;  2M30 A;  2PG4 A;  1WRJ A;  1OYY A;  4B44 A;  5ILS A;  2KT0 A;  4E7Z A;  2KDZ A;  4BHB A;  2L0K A;  3RYR A;  3ECO A;  1BA5 A;  2JJ7 A;  1OCP A;  1GV5 A;  1OQY A;  1IRX A;  5ILU A;  2JZY A;  2E2I J;  3REO A;  3DFG A;  2RQP A;  1I1S A;  1F9N A;  2A3S A;  2VQH A;  2XRN A;  2O0Y A;  2IS1 A;  2DQR A;  4JK1 X;  4XKV A;  2R7R A;  2EA2 A;  2Q0O A;  4LIT A;  2XSJ C;  2IJL A;  2TRT A;  5IP9 J;  4Q47 A;  3OL4 A;  1I6X A;  4DW6 A;  4G6Q A;  1IN7 A;  2OCC H;  1EJ9 A;  1WH7 A;  2E2J J;  1Z7U A;  5BOX A;  1P4A A;  1X1B A;  3HRS A;  2ZME C;  4KIB A;  1FLI A;  1LUJ B;  1S7O A;  1TWF J;  2OQR A;  4LJZ F;  4IRI A;  5HOO A;  2XPV A;  2NXN B;  1V55 H;  3S32 A;  1G6N A;  2IPQ X;  5IT3 A;  1E0E A;  1XDU A;  1MND A;  3MMY B;  2X48 A;  3G4S I;  2DXI A;  3I54 A;  4XOT A;  4A0Y A;  5EJC A;  1Y39 A;  1EV7 A;  1R1U A;  1MJA A;  2E36 A;  2R7Z J;  5M5Y J;  3HOT A;  3HZJ A;  4HLX A;  5EGO A;  2P8T A;  3I71 A;  4AUX A;  4ESB A;  3WTY C;  1YE9 A;  2HPI A;  2VQG A;  1RKT A;  2HOE A;  2BHZ A;  4FET A;  2BV6 A;  3U2R A;  3L1P A;  3ZN0 A;  2ZFU A;  1S9H A;  2WA0 A;  3SJM A;  3OOU A;  2QSH X;  2R7T A;  4MEY F;  1MW7 A;  3E97 A;  4C9Y A;  4HV5 A;  4LOC A;  2K4B A;  5CPR B;  2JWT A;  3HHH A;  4PGG A;  1EA3 A;  2WV0 A;  3IV5 A;  3M8F A;  3A0B C;  3GZ5 A;  3KEY A;  1YW8 A;  1T56 A;  3HUG A;  5LRS A;  3CJT B;  1U8B A;  4RB0 A;  3FMQ A;  4IX7 A;  4LK0 F;  1S6L A;  4HX7 A;  1BC7 C;  4FX4 A;  2P5L C;  4XMY A;  2CG4 A;  1N75 A;  4RMN A;  4RLF A;  3T8T A;  1HC8 A;  5HLH A;  3PUF A;  3ZMD A;  1YRN B;  2H8W A;  2OTL I;  3G6E I;  4FCY A;  4HZF A;  3CO7 C;  4YRV A;  1YHQ I;  4PFP A;  2QQB A;  3ABK H;  2O5R A;  3FXJ A;  1RUO A;  1Z3Y A;  3KIO A;  3I5U A;  4BU2 A;  3D5L A;  3HBL A;  1QPM A;  4G8X A;  1JHF A;  3LWF A;  3M07 A;  3W2W A;  2KL4 A;  3L2C A;  4HV6 A;  3FMR A;  3TW7 A;  4AYB A;  4RS8 A;  4FTH A;  3A0H C;  2HQ5 A;  4N9H A;  4ITV A;  2XKP A;  1R22 A;  4FIS A;  2QWW A;  1YS6 A;  3N97 A;  2DPU A;  3I55 I;  3CP8 A;  2AXL A;  2EPF A;  1MD0 A;  1WI3 A;  2ZJ2 A;  4W97 A;  4UXN A;  1IC8 A;  2DA3 A;  5IY5 H;  3DBH B;  2O03 A;  2YX7 A;  2F4O B;  1ZG3 A;  4I76 A;  2I5U A;  2COB A;  3TQN A;  3S2D J;  1SD5 A;  3IUO A;  3IWF A;  1APL C;  3P9C A;  2DA6 A;  2R5Y A;  5IYD J;  5H20 A;  1XGS A;  2WBM A;  4HW0 A;  4I0A A;  2GQQ A;  1ON2 A;  3QRF F;  3ASO H;  1J7K A;  3RKX A;  5F0C A;  5LHG A;  3E5Q A;  3JRI A;  1J59 A;  1D8K A;  3BC8 A;  3E3V A;  4ZYG A;  3AG3 H;  2MFZ A;  1XGM A;  2QBY A;  3ESW B;  2VON A;  1LVA A;  3LA2 A;  2DYS H;  2WB1 A;  3S3M A;  3FMS A;  4BUP A;  3IKT A;  4LGW A;  3SZG A;  4J01 A;  1UFM A;  1VQP I;  4BHC A;  1TC3 C;  1YX5 A;  4M3B A;  3BTL A;  2MAB A;  1NH3 A;  5E1W A;  3MZ8 A;  1ZLK A;  2DDA A;  3H0G J;  3CJQ B;  3BTC A;  1KYZ A;  2P6S A;  2F5E A;  2VE9 A;  4WXD A;  1MH3 A;  4PJN A;  3GBG A;  3WGI A;  3F6O A;  3WTW C;  2JRT A;  2R93 J;  2W24 A;  1XSD A;  3SZP A;  3LSK A;  2IGN A;  2CMP A;  3OYN A;  1ULY A;  3PSI A;  4RB3 C;  2FEZ A;  2ECC A;  3HG9 A;  4XLP F;  3CCJ I;  2HYJ A;  1M1E B;  3QP6 A;  4HQM A;  2IRF G;  2UXN A;  3T8R A;  3SFI A;  3HGG A;  2RQQ A;  3J80 K;  2V1N A;  4GO1 A;  4D9J A;  1DPR A;  1QHH D;  1Z6T A;  2VC1 A;  4WWC A;  1IXR C;  2M2E A;  4A3F J;  2Y0M A;  1FIP A;  1SFU A;  5J40 A;  4ENM A;  3DKY A;  4KMF A;  3V8L A;  3WG9 A;  2H27 A;  3S15 J;  4UY8 I;  2W25 A;  1TQI A;  5C44 J;  2JSP A;  1YFH A;  1BN5 A;  1QRY A;  1S7A A;  4BJT A;  4IF4 A;  3F9K A;  2EK5 A;  4QSH A;  3HSR A;  2HVQ A;  5E1X A;  2Y31 A;  2Z9O A;  3KP7 A;  1O3R A;  2A69 F;  1R7J A;  3ISP A;  4IKF A;  3BG6 A;  4X6A J;  4KFC A;  3FXL A;  4HX8 A;  2JSC A;  2XRO A;  1VQK I;  1B72 B;  2VBX A;  5GAD J;  4IQJ A;  1XPX A;  1NG7 A;  2CW7 A;  3OS0 A;  3KCC A;  1W36 C;  3JSP A;  1RUN A;  3BTJ A;  4PUS A;  2XDV A;  5GAG J;  2FA5 A;  2V1X A;  5J47 A;  4BEH B;  4IPA A;  1WJD A;  4OOI A;  3HDD A;  1SMT A;  4L5E A;  4NB5 A;  2HKO A;  2EV6 A;  1QQI A;  2A07 F;  3DTE A;  1ITY A;  2WAQ A;  3DBL B;  2RNG A;  2FRH A;  1CF7 B;  4KJZ A;  2DMU A;  2C6Y A;  3B6A A;  4IJA A;  5FKL A;  1XMX A;  1LEA A;  1IN4 A;  4XLH A;  1U9N A;  2QBY B;  3RPQ A;  3W6V A;  1RR7 A;  5L3F A;  2EQR A;  4HDV A;  2A61 A;  1BBY A;  3LSR A;  2CH0 A;  3GLX A;  1PDN C;  1RES A;  2QSG X;  4EQQ A;  4XLE A;  1JKO C;  3GF2 A;  3BR1 A;  5C4X J;  2D2W A;  3BZ6 A;  5BQT A;  2UV1 A;  3OYE A;  5D4R A;  3EUK L;  2FF4 A;  2KIS A;  3R0A A;  1YTY A;  2P81 A;  3BJA A;  1AOY A;  4P96 A;  2VI6 A;  1SFX A;  1KON A;  1YOV B;  1KU7 A;  1HLV A;  2Y9Y A;  4KN7 X;  2NVU B;  2F4I A;  4LK1 F;  3ZN1 A;  2I8D A;  5IOZ A;  4JQF A;  3CLQ A;  4L9V A;  3CLO A;  4BE0 A;  1G3S A;  2DA2 A;  4B3X A;  3S3O A;  3WE2 A;  1R36 A;  1B9M A;  4CXF A;  4WXH A;  2LG4 A;  1BR1 A;  3RPU D;  2HVS A;  2Y9Z A;  5IPA A;  3OIP A;  2YS9 A;  4UHT A;  2KIQ A;  4CH7 A;  2MD5 A;  1MIJ A;  2KHM A;  2X1E A;  2CW8 A;  2FUG 2;  4ABZ A;  3GLL A;  2X1C A;  4IL6 C;  3VYU B;  1A5J A;  3JRF A;  2PQ8 A;  2W1O A;  2Z3Y A;  3ZQH A;  3CF5 F;  4KNY A;  3D5R C;  3VYT B;  3KE2 A;  3S1Q J;  1W5C C;  4A6E A;  3ASN H;  2DT6 A;  2PJR A;  3L2V A;  4J19 A;  1IN8 A;  1RZ4 A;  2IA1 A;  5CQE A;  1SEU A;  1HBX G;  2CO5 A;  1Z7L A;  4AWX B;  1DQU A;  2A5Y B;  3HUG B;  2FOK A;  1OCC H;  3U21 A;  2HEO A;  2IVM A;  4HOB A;  1TWC J;  2FQ3 A;  4HST A;  4LD5 A;  4NC6 A;  1EH6 A;  4EMS A;  3K2A A;  2HR3 A;  5M5W J;  1H9T A; 
#chains in the Genus database with same CATH homology
 3SFZ A;  3BY6 A;  3FHZ A;  2A6H F;  3PQJ A;  2FXA A;  2JTV A;  5FGM A;  4KIC A;  3E6C C;  5D8K B;  4OIQ F;  3DF8 A;  4NHJ A;  2AS5 F;  1P92 A;  3BDD A;  2EFN A;  2M87 A;  2OBP A;  1W7P D;  5E8I A;  3VOE A;  4EM0 B;  2QUF A;  4O6J A;  5IT9 Z;  1TBX A;  1JHH A;  3IRQ A;  2DK5 A;  5ED4 A;  1WKM A;  2OZ6 A;  3N4M A;  2DO7 A;  5DCF A;  1FWZ A;  4OIR F;  2PI0 A;  1OKR A;  2JT1 A;  1RIO H;  2COM A;  2CGP A;  2DAO A;  2CYY A;  4HDU A;  1R00 A;  1QZY A;  2HFH A;  2JPB A;  3Q5F A;  1P4X A;  1ZG1 A;  3ABU A;  1ZRE A;  3LA3 A;  3VB2 A;  1QZZ A;  3MFK A;  2JPC A;  4R8H A;  2L01 A;  2DT5 A;  3ZMV A;  5CYV A;  5DCM A;  5DUI A;  1ZHF A;  5EEG A;  1IRF A;  1ZRF A;  2H09 A;  1FY7 A;  3F8N A;  1NHA A;  1L3L A;  4OMZ A;  5CVV A;  2ZNZ A;  1D3Y A;  2YSR A;  3H92 A;  3I0T A;  3S2W A;  4HX4 A;  3C7J A;  2NNN A;  4A6D A;  3I53 A;  3K1P A;  1K78 B;  2GXB A;  3FXR A;  3WOD F;  3PQK A;  3BP8 A;  3COA C;  5H6R A;  4EJV A;  4Q5S F;  5HLG A;  5CVR A;  5BPD A;  2VBY A;  4XBF A;  4L0Z B;  3GXO A;  4I98 B;  4A2U A;  2HWV A;  3SZT A;  2ZFW A;  3KEO A;  5FB2 A;  2LNB A;  3BJO A;  1BOA A;  5A2Q Z;  3KLO A;  1Y0U A;  2G7U A;  3O3K A;  2FBK A;  2M45 A;  4CZZ A;  5L3E A;  4GXO A;  1O3Q A;  3LAP A;  5DDG A;  2R7F A;  2ESH A;  1U6G A;  4ASN A;  3BRO A;  1S8N A;  1FSE A;  3HRM A;  5F1R A;  3WGG A;  5AON A;  3HSE A;  1J0R A;  4M74 A;  5IT9 K;  1B9N A;  3TOB A;  1R1V A;  1XMA A;  4Z2Y A;  1LEB A;  2BYV E;  3KP5 A;  4ZYH A;  3LQQ A;  2D1V A;  4MGR A;  3L7W A;  2GWR A;  2ESN A;  1P6R A;  1DPU A;  3IL2 A;  2VOP A;  4G7O F;  5AIQ A;  4YFX F;  1FOK A;  1IUY A;  1T39 A;  2G7H A;  3E5X A;  2XUB A;  4GYI A;  2MH9 A;  4CYD A;  2XAH A;  3DXJ F;  5CVU A;  4BH9 A;  2HDC A;  3EYY A;  1V3F A;  4EGY A;  1R23 A;  5DCM B;  1XGO A;  4AVP A;  1XDS A;  4ZYE A;  4M73 A;  4G94 A;  5F6F A;  2EWN A;  4ESF A;  3FF5 A;  5E17 F;  3TKY A;  4HF0 A;  3RPU A;  1LQ1 A;  2UZK A;  4B8X A;  4RAY A;  3SXY A;  2GA2 A;  3QPT A;  2EFQ A;  4KN4 X;  1BIB A;  3GFM A;  4JBA A;  1IZ1 A;  3GFJ A;  2P5K A;  1MGT A;  4P55 A;  1QNT A;  4XSZ F;  1MJB A;  2QM3 A;  2FBH A;  1WWX A;  2XVC A;  3W6K B;  2R3S A;  3JAM K;  5LHI A;  3C18 A;  2Q8K A;  4MNU A;  2ELH A;  4CHU A;  3F6V A;  2E1N A;  4RB1 A;  2EA4 A;  2FSW A;  1SAX A;  4O3M A;  2PJP A;  1B59 A;  3RJP A;  1IN5 A;  3DV8 A;  1UCR A;  1YLF A;  1K78 A;  1BI2 A;  3RKY A;  4G7Z F;  3CUQ B;  3G3Z A;  2DFI A;  4QWQ A;  3HIF A;  4KIF A;  2F5C A;  1U5T B;  1EH7 A;  3EUH A;  2EV0 A;  5BPI A;  3C1D A;  3F8C A;  1T38 A;  1FYK A;  3TO9 A;  1T98 A;  3DPT A;  2ZBK A;  3ULQ B;  4CO8 A;  1EH8 A;  5J8C A;  4MQ9 F;  2FNA A;  4L5I A;  2G9W A;  3I64 A;  3IKV A;  2KIM A;  3WGH A;  4LLN A;  2P6T A;  1HSJ A;  3IWZ A;  2QQA A;  2EFP A;  2V79 A;  4WXC A;  4EGZ A;  5D6E A;  3EET A;  1Z1D A;  2VXZ A;  1KQ8 A;  3FXQ A;  5LGT A;  2X0L A;  4AIJ A;  2VC0 A;  2RDP A;  2KIF A;  3BOQ A;  2IT0 A;  4ENK A;  2WTE A;  4DNC A;  5FLX Z;  4HLY A;  3HOS A;  4UNO A;  4LLL A;  1ZH5 A;  3E5U A;  3IHU A;  1FSH A;  3F22 A;  1ZG5 A;  1XB4 A;  3ZQ7 A;  1UB9 A;  1WI9 A;  2WWY A;  4LB5 A;  1IXS B;  3KP3 A;  1V4R A;  5JI6 A;  1F1Z A;  2ZCW A;  1MKM A;  5LGU A;  1HKQ A;  4Q48 A;  1D5V A;  4M9X A;  4MQV A;  4YG2 F;  2IW5 A;  1DDN A;  3NRV A;  1OPC A;  5AIP A;  4L9T A;  2D45 A;  4MHG A;  2VE8 A;  1XMK A;  2KIU A;  3C3W A;  4KDP A;  3ZMZ A;  3RIR A;  3CO6 C;  1OYW A;  1R58 A;  1CGP A;  3K1M A;  1USS A;  2F2E A;  4CIC A;  2O8X A;  4EVI A;  1FPQ A;  4A5M A;  3W6J B;  1LJ9 A;  1W5S A;  1ON1 A;  4R79 A;  2A68 F;  3GYH X;  5DV5 A;  1GXP A;  2OA4 A;  1T2K A;  4U0W A;  3E6D A;  3DP7 A;  4N9I A;  4WK8 F;  3M9A A;  2CSO A;  1B1B A;  3MZH A;  3JTG A;  2VT3 A;  3J81 Z;  5FO5 A;  1JGS A;  2OD5 A;  3DEU A;  2DW4 A;  1PP8 F;  3LAJ A;  3DQV C;  1K7A A;  3FM3 A;  5HDN A;  1X3U A;  3WU1 B;  2L54 A;  1G3T A;  2L02 A;  1ZGA A;  1BI3 A;  1KQ0 A;  3HRT A;  2HZT A;  1I27 A;  3CJN A;  3TDU C;  4XSX F;  2CW0 F;  4HA8 A;  4I01 A;  1U8R A;  2W84 A;  3K1N A;  5CJ9 A;  5FFZ A;  3MZY A;  1R1T A;  4WX9 A;  5TRD A;  1OYI A;  4GGG A;  1FNN A;  1OR7 A;  3WTZ A;  2D1H A;  4TV7 A;  4UVA A;  2LDU A;  5JVT A;  1ZAR A;  2ZME B;  4HF1 A;  4AIK A;  1WSU A;  1S3J A;  2MLG A;  1ZN2 A;  4FT8 A;  4IVN A;  3V7S A;  1REP C;  4OMY A;  3GWZ A;  5E1Z B;  5E8G A;  2HYG D;  4M72 A;  4M6X A;  5BMZ A;  1GXQ A;  3QPH A;  4AD9 A;  1IN6 A;  4G9Y A;  4O5V A;  2EB7 A;  2QYO A;  3WTV C;  4LB6 B;  2OQG A;  3I59 A;  2VBZ A;  5LHH A;  5HDK A;  2ZME A;  2M8E A;  1BC8 C;  5ICE A;  1QGP A;  3HYI A;  2K27 A;  4U7D A;  4OU0 A;  5ERI A;  4RB2 C;  2FNP A;  5J6X A;  4XLN F;  1K79 A;  3ML6 A;  4IXA A;  1XSV A;  5LEK A;  1J9I A;  4YIF A;  3P9I A;  3WTX C;  4Y15 A;  2XAS A;  2ZXJ A;  3ECH A;  2KRF A;  4ZZD A;  5ICG A;  3EYI A;  5LBQ A;  1Z9C A;  2BGC A;  1IAW A;  2EFW A;  4E70 A;  1XSX A;  3O2P E;  5K5Q A;  5HDG A;  4K2E A;  4L9J A;  6PAX A;  3HTS B;  3BJ6 A;  5HS7 A;  5TJJ A;  3JAM Z;  1TQP A;  3KZZ A;  3V4G A;  1I1G A;  3ZMS A;  3RI4 A;  3J7A O;  4KA4 A;  5JHU A;  2HTJ A;  3T1B A;  1J2X A;  4RGR A;  3KP4 A;  1FX7 A;  3L09 A;  2DPD A;  1O3S A;  3I58 A;  2V1U A;  2R7D A;  4WF2 A;  1OMI A;  2MLK A;  1K6O A;  1KU9 A;  3F23 A;  4ZH4 F;  3GX4 X;  4EJW A;  2NAZ A;  3QP5 A;  3NEU A;  4MTD A;  4Y13 A;  2XHK A;  3ROU A;  1XCV A;  1YS7 A;  4L9N A;  4I7H A;  3M1E A;  1TLH B;  2QQ9 A;  3OOP A;  4RGS A;  4EJO A;  4U88 A;  3ZP5 A;  3EQL F;  1LNW A;  3JTH A;  3MAJ A;  2GXG A;  3E6M A;  2P7C B;  2DTR A;  3F72 A;  4KT5 C;  2STT A;  2XIG A;  2RC4 A;  1BI0 A;  3FX3 A;  3HHG A;  5D4S A;  2O61 A;  5HS9 A;  2PEX A;  3O6B B;  3I4P A;  2FE3 A;  2Z33 A;  4HAM A;  4M6Y A;  5EEH A;  4U0V A;  1E2X A;  2J5P A;  4I09 A;  3LA7 A;  1GHC A;  3CUO A;  1UHM A;  1YIO A;  3ERE D;  1Z6R A;  1D8J A;  1U5T A;  3B73 A;  2ZKZ A;  3D0S A;  2IA2 A;  3LFK A;  1B6A A;  2KJB A;  5F64 A;  1DUX C;  4KYW A;  4P5O A;  2V9V A;  2O6G E;  4HBL A;  3M8E A;  1H9G A;  1LDK B;  4N0B A;  2DK8 A;  2YPR A;  3WTU C;  1KQ9 A;  2GA1 A;  3KP6 A;  1W7P A;  2H94 A;  5BS6 A;  2BE5 F;  1YQA A;  4ON0 A;  1SD6 A;  1T0F A;  3ZMT A;  4FX0 A;  3LST A;  5K5O A;  3F3X A;  4GYG A;  4I2O A;  5CVI A;  3CUQ C;  5DUK A;  2TDX A;  4HF2 A;  1FC3 A;  2GIV A;  1HW5 A;  2DLL A;  4ZZL A;  4G6D A;  3FZV A;  3J81 K;  2L4M A;  1QBJ A;  2ETH A;  3KP2 A;  5JFR A;  2K7L A;  2LF8 A;  2W57 A;  1RNL A;  4EJU A;  2P4W A;  2EV5 A;  1O3T A;  1PP7 U;  1H0M A;  2IP2 A;  4I02 A;  3MCZ A;  2OU2 A;  4A12 A;  1ZGJ A;  5HVQ C;  3L00 A;  5D8L B;  3WTT C;  2YU3 A;  4BAY A;  1RI7 A;  1E17 A;  3MEX A;  4DQ2 A;  5ILV A;  5HLI A;  3HRU A;  4EV0 A;  2F5F A;  3WTS C;  2CQK A;  4FHT A;  3TGN A;  4KUM A;  3TO6 A;  2XGX A;  1BM9 A;  1IW7 F;  4BQA A;  2RN7 A;  2HQR A;  2EFO A;  3QU6 A;  2VOD A;  2DI3 A;  1YW7 A;  2CFX A;  3QOP A;  2NYX A;  4P9F A;  1IRG A;  1P4W A;  2E1C A;  4M71 A;  3RKW A;  1FZP B;  3QU3 A;  1W4M A;  1TTY A;  4M9S A;  5D6F A;  3RTR A;  2E7W A;  2XV4 S;  5FLX K;  4BNC A;  2VOO A;  1QO0 D;  1UHW A;  2X4H A;  1SD7 A;  1KU2 A;  2QZ8 A;  2NNY A;  3GFL A;  2BEO A;  1Z05 A;  2GZW A;  1HW1 A;  2STW A;  3F8F A;  1B4A A;  3ELK A;  3T5X A;  1TNS A;  3GEZ A;  3KZY A;  2NRA C;  3V8K A;  2MA3 A;  2PFB A;  3KET A;  2XAF A;  4GCV A;  2ADU A;  4U0Y A;  2UWM A;  2K4J A;  1A04 A;  1DP7 P;  4RGX A;  2VN2 A;  5LGN A;  1G3Y A;  2KKO A;  4PCQ A;  3TOA A;  5K5R A;  2GAU A;  1CF7 A;  4EM1 A;  3T0Y A;  1F4K A;  3WU0 A;  1LB2 A;  4U7B A;  1XGN A;  2B0L A;  1L0O C;  3E6B A;  2HKX A;  2WC2 A;  4UUV A;  2KJC A;  1MDM A;  5FD6 A;  4OIO F;  5D5W B;  1JE8 A;  1MZB A;  1KYW A;  3H3U A;  3GW2 A;  2H6B A;  3TO7 A;  3GO5 A;  4KIG A;  3F8B A;  1ODD A;  1BJA A;  4BXU A;  2HQN A;  5ICF A;  4LG0 B;  1U2W A;  3F21 A;  4PDK A;  4MTE A;  1HQC A;  4ETS A;  5L3B A;  2FU4 A;  2Y48 A;  5DD4 A;  1G3W A;  4XRF A;  1HKT A;  4L0Y B;  3K2Z A;  1I5Z A;  2XAJ A;  3SQN A;  1YO5 C;  3GZ6 A;  3Q9V A;  5E18 F;  5L3C A;  2LF7 A;  1O57 A;  1R5H A;  5KK1 A;  3VOD A;  1SD4 A;  4F7Z A;  4IHS A;  3ZPL A;  2HS5 A;  3G73 A;  5HS8 A;  4WCG A;  1ZRC A;  2PMU A;  5JR3 A;  2FMY A;  4I0B A;  2LKP A;  1S29 A;  2NS0 A;  3KEQ A;  1HXD A;  2MBF A;  3IRR A;  4CDG A;  1O7L A;  1FBQ A;  5CVJ A;  5D5X B;  4A0X A;  3KLN A;  1PUE E;  5H6Q A;  3DPL C;  4EJT A;  4B09 A;  1P2F A;  2YR2 A;  2BBY A;  2E7X A;  5DYM A;  2XKO A;  2VBW A;  3VFZ A;  3CTA A;  2L4A A;  3EDP A;  2ZO4 A;  4Y17 A;  3BPV A;  4HQE A;  2RGV A;  5L3G A;  1ZAO A;  4LG0 A;  1TW2 A;  3Q9S A;  3R60 A;  4YFK F;  2IA0 A;  1T6S A;  3HTU A;  2J5O A;  3L9F A;  3ZMU A;  2RV8 A;  3M7G A;  2FML A;  3LQR A;  2OZU A;  2W85 A;  2QEN A;  1LDD A;  3R0J A;  3GFI A;  4A0Z A;  1MDM B;  4UV9 A;  5D5V B;  5DEQ A;  2PBI A;  1FP1 D;  2DBB A;  1YYV A;  2ACJ A;  1AWC A;  2QLZ A;  2UXX A;  3P9K A;  3J80 Z;  2DQL A;  1O7F A;  2PMH A;  2RVC A;  5LRR A;  4S05 A;  4AIH A;  4H0E A;  2MH2 A;  4CGZ A;  3QAH A;  3CDH A;  1FT9 A;  4YII A;  3V7C A;  2EJR A;  1TNT A;  1UST A;  2XAG A;  2ISZ A;  3RYP A;  2ISY A;  5FD5 A;  4QLC U;  1XN7 A;  4RAZ A;  2HTS A;  5A2Q K;  1FYM A;  3R61 A;  4NQW A;  4LLG F;  3DKW A;  3P7N A;  2M5W A;  3VEP A;  4RGU A;  5E20 A;  2H6C A;  1SMY F;  4UVC A;  3JSO A;  5L3D A;  1W5T A;  4HYE A;  1ZRD A;  4P9U A;  4ENJ A;  5J8F A;  3OV8 A;  1KU3 A;  2V1D A;  2A6E F;  1R5G A;  4UVB A;  3K69 A;  1HST A;  3CUQ A;  1IF1 A;  1VTN C;  4Q4Z F;  1KGS A;  2VT2 A;  2HYF A;  5DD8 A;  4KMU X;  1U3E M;  2Z99 A;  2CWE A;  2Y75 A;  3I59 B;  2FBI A;  3V7R A;  5LEJ A;  3F8M A;  1FBS A;  1HKS A;  1SFE A;  2L3D A;  4D0P A;  3H3Z A;  2ZNY A;  1G4D A;  1ZLJ A;  2HGC A;  1STZ A;  4YFN F;  5KVR A;  2OAZ A;  1J5Y A;  1ONV A;  4MEX F;  2Q2E A;  1YW9 A;  2MC3 A;  2K02 A;  1FBU A;  2O3F A;  1U5T C;  4R1H A;  1Q1H A;  1FYL A;  1FP2 A;  4UV8 A;  3K9T A;  1BIA A;  4PZJ A;  3MWM A;  4A5N A;  3BWG A;  1Z91 A;  5LLQ A;  2RKH A;  1WQ2 A;  2RNJ A;  4EM2 A;  4ZYD A;  1MJ9 A;  5ICC A;  3R4K A;  3GUD A;  1F5T A;  3FWE A;  3TDZ C;  3KFW X;  4LMY A;  3PFI A;  4BHP A;  4BYY A;  2PLY A;  3SHF A;  2P5V A;  1TQM A;  4OIP F;  3K0L A;  1IXC A;  1W7P B;  1U78 A;  4LFU A;  2QVO A;  4IRG A;  1XCB A;  2XAQ A;  3WE3 A;  3BPX A;  3MQ0 A;  1HW2 A;  3GVA A;  3FM5 A;  4ENN A;  4OIN F;  5D5U B;  2F5D A;  3NQO A;  1KA8 A;  1JXS A;  1LDJ A;  1YG2 A;  4IRH A;  2YX4 A;  2LSO A;  3V8J A;  3U1D A;  5FFX A;  3B02 A;  5CLS A;  3R6S A;  1J75 A;  4G7H F;  1GVJ A;  1ZYR F;  1BI1 A;  4L5J A;  3FXU A;  4S04 A;  4PGH A;  4IHT A;  4M9Z A;  3IC7 A;  1XD7 A;  4ESJ A;  2PN6 A;  5K1Y A;  3HSF A;  3JW4 A;  2P7V B;  2DU9 A;  3ABT A;  3U9G A;  4L18 B;  2K86 A;  3AAF A;  1C0W A;  2M1B A;  2V6C A;  1TW3 A;  2Z5U A;  3RDI A;  2M30 A;  2PG4 A;  1WRJ A;  1OYY A;  5ILS A;  4BHB A;  3RYR A;  3ECO A;  5ILU A;  2JZY A;  3REO A;  3DFG A;  2RQP A;  1I1S A;  1F9N A;  2A3S A;  2XRN A;  2O0Y A;  2DQR A;  4JK1 X;  2EA2 A;  2Q0O A;  2IJL A;  4Q47 A;  1I6X A;  4G6Q A;  1IN7 A;  1Z7U A;  5BOX A;  1P4A A;  3HRS A;  1FLI A;  4KIB A;  1S7O A;  2OQR A;  4LJZ F;  4IRI A;  5HOO A;  1G6N A;  2IPQ X;  5IT3 A;  1XDU A;  3I54 A;  4A0Y A;  1EV7 A;  1R1U A;  1MJA A;  3HOT A;  4HLX A;  2P8T A;  3I71 A;  4ESB A;  3WTY C;  2HOE A;  2BV6 A;  3U2R A;  3ZN0 A;  4MEY F;  3E97 A;  4HV5 A;  2K4B A;  3HHH A;  4PGG A;  2WV0 A;  3M8F A;  3GZ5 A;  1YW8 A;  3HUG A;  5LRS A;  4RB0 A;  3FMQ A;  4LK0 F;  1S6L A;  4HX7 A;  1BC7 C;  4FX4 A;  2P5L C;  2CG4 A;  3T8T A;  5HLH A;  3ZMD A;  4HZF A;  3CO7 C;  2QQB A;  1RUO A;  3I5U A;  3D5L A;  1QPM A;  4G8X A;  1JHF A;  3LWF A;  3L2C A;  4HV6 A;  3FMR A;  4RS8 A;  4N9H A;  2XKP A;  1R22 A;  2QWW A;  1YS6 A;  3N97 A;  2DPU A;  2AXL A;  1MD0 A;  2ZJ2 A;  4UXN A;  2O03 A;  2YX7 A;  1ZG3 A;  3TQN A;  1SD5 A;  3IWF A;  3P9C A;  5H20 A;  1XGS A;  4HW0 A;  4I0A A;  2GQQ A;  1ON2 A;  3QRF F;  1J7K A;  3RKX A;  5LHG A;  1J59 A;  3E5Q A;  1D8K A;  3E3V A;  4ZYG A;  2QBY A;  2VON A;  1XGM A;  1LVA A;  3LA2 A;  3FMS A;  3IKT A;  4LGW A;  1UFM A;  4BHC A;  5E1W A;  1ZLK A;  1KYZ A;  2P6S A;  2F5E A;  2VE9 A;  4WXD A;  3WGI A;  3F6O A;  3WTW C;  2JRT A;  2W24 A;  1XSD A;  3SZP A;  1ULY A;  4RB3 C;  2FEZ A;  4XLP F;  3QP6 A;  4HQM A;  2IRF G;  2UXN A;  3T8R A;  3J80 K;  4GO1 A;  1DPR A;  1Z6T A;  2VC1 A;  4WWC A;  1IXR C;  2Y0M A;  1SFU A;  4ENM A;  4KMF A;  3V8L A;  3WG9 A;  2H27 A;  2W25 A;  1TQI A;  1YFH A;  1BN5 A;  1S7A A;  4IF4 A;  2EK5 A;  3HSR A;  5E1X A;  2Z9O A;  3KP7 A;  1O3R A;  2A69 F;  1R7J A;  3ISP A;  4KFC A;  4HX8 A;  2JSC A;  2XRO A;  2VBX A;  3KCC A;  3JSP A;  1RUN A;  2FA5 A;  2V1X A;  4IPA A;  4OOI A;  1SMT A;  4NB5 A;  2HKO A;  2EV6 A;  1QQI A;  2A07 F;  2FRH A;  1CF7 B;  2C6Y A;  4IJA A;  1LEA A;  1IN4 A;  2QBY B;  3RPQ A;  5L3F A;  4HDV A;  2A61 A;  1BBY A;  3GLX A;  1PDN C;  4EQQ A;  3GF2 A;  2D2W A;  3BZ6 A;  5BQT A;  5D4R A;  1YTY A;  2FF4 A;  3R0A A;  3BJA A;  1AOY A;  4P96 A;  1SFX A;  1KU7 A;  4KN7 X;  4LK1 F;  3ZN1 A;  4JQF A;  4L9V A;  3CLO A;  1G3S A;  3WE2 A;  1R36 A;  1B9M A;  4CXF A;  4WXH A;  4UHT A;  2MD5 A;  2PQ8 A;  2Z3Y A;  4KNY A;  3KE2 A;  4A6E A;  1IN8 A;  1RZ4 A;  2IA1 A;  1HBX G;  2CO5 A;  4AWX B;  2A5Y B;  2FOK A;  2HEO A;  2IVM A;  4HOB A;  2FQ3 A;  4LD5 A;  1EH6 A;  4EMS A;  2HR3 A;  1H9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...