2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Replication termination protein
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
4UHTA 2Y0MA 1MJ9A 3V7CA 3V4GA 5DCFA 2QZ8A 2MC3A 3TGNA 3L9FA 1P2FA 3C18A 5ILSA 2GWRA 2PMUA 4O3MA 2PLYA 1X3UA 1O3SA 5TJJA 1L3LA 3SXYA 4G6QA 3E6MA 2K4JA 5ICCA 4PDKA 3BP8A 3KCCA 2ZCWA 1TNSA 2L54A 2GIVA 2PMHA 2FQ3A 2ADUA 2K4BA 1XSXA 2JZYA 1C0WA 1ZHFA 5HDNA 3E6CC 2O0YA 1T39A 1D3YA 5ICFA 3BPVA 1R5GA 1BI3A 2BGCA 2CQKA 3ECOA 4WX9A 3MCZA 1HQCA 3L00A 4Q48A 2KIMA 3GFLA 4M9ZA 2HQNA 3DEUA 2M1BA 2X4HA 4GYGA 1FYMA 1IAWA 3ZMUA 1O3QA 2Z5UA 1KU2A 3EDPA 1BC8C 1ON1A 3TKYA 4UNOA 1WKMA 3EQLF 3WTUC 3IKTA 4KMFA 1E2XA 2VE9A 1UFMA 4IXAA 2HDCA 4BH9A 1FP1D 3CTAA 3ZQ7A 5IT9K 1S6LA 3DPTA 2FBHA 3E5XA 5ILVA 2PN6A 5D5WB 2FBKA 4IHTA 5JHUA 1XSDA 3V8KA 4G94A 2EFNA 2IJLA 2KJCA 3FXQA 2ZMEA 2XAQA 1OMIA 2A6EF 1BN5A 2QWWA 4U7DA 2IVMA 3GZ5A 4G9YA 2HOEA 4MNUA 2FSWA 2O03A 4E70A 3I53A 5ED4A 4CYDA 4PGHA 1FPQA 2F5EA 4ENKA 2WC2A 2EJRA 2A6HF 4XBFA 5LEJA 3I0TA 1B6AA 4BHBA 4NHJA 3R0AA 2VT3A 5F64A 1OYYA 1IUYA 4HOBA 3F8MA 1I5ZA 3CO6C 3D0SA 1T6SA 2V6CA 3G73A 3BROA 4I7HA 3H3ZA 1BOAA 2AXLA 3HSFA 1FSHA 3TDUC 4L9JA 2IA2A 3T0YA 3KZZA 2HS5A 3MQ0A 2A69F 2DU9A 1WQ2A 2W57A 4HLYA 3GFIA 3E5QA 3I59B 2HTSA 3EETA 2PFBA 1O3TA 2Q2EA 2IRFG 1R7JA 2M30A 2FMYA 1CF7A 4P55A 3QOPA 1J0RA 3NRVA 2MD5A 1K79A 4AVPA 4RGSA 4CHUA 5IT3A 1ZG5A 1MD0A 3P7NA 3L09A 1ZGAA 1OYIA 3VOEA 2F2EA 4IVNA 5JR3A 2VT2A 1EV7A 3P9IA 1PP8F 4N9HA 4HA8A 3M8FA 3M7GA 4LB6B 4L5IA 4JK1X 4EMSA 5LRRA 2NYXA 1F5TA 3E6BA 1XDSA 5DDGA 1OPCA 3JW4A 2BYVE 4HDUA 1QNTA 4EJTA 3WTWC 2K7LA 1LQ1A 5AIQA 1R36A 4N9IA 2P8TA 1WWXA 2VN2A 4XLPF 4Y17A 3O2PE 5DYMA 4WK8F 2DQLA 1YYVA 2XIGA 2G7UA 2NNYA 4A6DA 4UUVA 4BNCA 1YFHA 3KEOA 2VOOA 2DI3A 1HKQA 4EJVA 4ZYEA 4DNCA 4LLNA 4BHPA 5D5UB 1ON2A 3JAMZ 1BM9A 5L3GA 3Q5FA 1STZA 1HW2A 3GFJA 2QBYB 3EYIA 3I71A 1XD7A 2A5YB 4I2OA 3ZP5A 3GFMA 3GXOA 3FXRA 4M72A 1HBXG 4Y13A 5EEHA 2ETHA 5FB2A 2ZKZA 2KJBA 4HAMA 3SQNA 2F5DA 3E97A 2HYGD 1Y0UA 3FM3A 2QBYA 2HR3A 3JSOA 1ZAOA 4RB3C 1GVJA 1XDUA 2XAHA 2Z33A 3DP7A 3HRTA 2P5KA 2HWVA 1JHFA 2EV5A 2ESHA 2HGCA 2EFQA 5E1WA 2VBXA 2M87A 1FOKA 3ZMZA 4G7ZF 1D8JA 1G3WA 1DUXC 1HKSA 2FMLA 3SZTA 3C7JA 1KU3A 3O6BB 2ZNYA 5HS8A 5K5QA 3WTSC 2EB7A 1LEBA 4ZH4F 2EFPA 3FM5A 1B9MA 2ELHA 3WTVC 3C1DA 1XGSA 4XSXF 1K6OA 4LK1F 2PG4A 2NNNA 3ROUA 2Z3YA 3TDZC 3N4MA 2MH2A 2G7HA 2FF4A 4ETSA 1USSA 2J5PA 1QBJA 1FSEA 4ENNA 1MDMA 1TNTA 3K0LA 3KP6A 1JE8A 3JSPA 2DBBA 4MTEA 1XN7A 2FNPA 2DK8A 2FU4A 3ISPA 3FWEA 2WV0A 4G7HF 1ZRDA 4PCQA 3LA7A 3KP4A 3R61A 3WGIA 1FLIA 1FC3A 3QP5A 4P96A 3K69A 1OYWA 3HSRA 1P4AA 3KP5A 2NS0A 1ONVA 3CUQA 4OIOF 5CJ9A 4L0YB 1LB2A 1CF7B 2EWNA 2EK5A 3GWZA 5A2QZ 2MLGA 4A12A 3HRMA 4U7BA 3IWFA 1R5HA 1HKTA 6PAXA 4HBLA 1LVAA 5HLGA 1G3YA 3R0JA 2FBIA 4M73A 4I02A 1U2WA 2ESNA 2UXXA 3SZPA 4KUMA 3RIRA 1K78B 1REPC 2FXAA 3BDDA 2DTRA 4LFUA 2VBYA 2FRHA 1ZH5A 4M6YA 4HW0A 5L3BA 4BHCA 4CO8A 4P9FA 3M9AA 1SD7A 3CJNA 1KYWA 3SHFA 1DPRA 1PDNC 1ZGJA 2IPQX 4HF0A 3F8BA 4IHSA 1BI0A 3RYRA 2DK5A 2YPRA 2H09A 4R79A 1DPUA 5BQTA 4K2EA 5D8LB 4RS8A 1ZRFA 1EH7A 4RGUA 1H9TA 1HSTA 2XROA 1KYZA 2UZKA 1I27A 5E8IA 2YU3A 3WTTC 3HRUA 4G7OF 3GX4X 5DUKA 1Z1DA 1EH8A 1FY7A 3ZPLA 1RZ4A 1DP7P 1IN5A 4KN7X 4R8HA 1ZLKA 1B4AA 5EEGA 3LFKA 4DQ2A 4OU0A 4EQQA 1GHCA 2E7XA 2STTA 2J5OA 3CUOA 4P5OA 1U8RA 3ZMDA 1R1TA 2HKOA 2GAUA 1R58A 3LWFA 4GGGA 3W6KB 2D1VA 2RGVA 3S2WA 3BJOA 2V1XA 1KQ0A 4A0YA 2W25A 4AIJA 1FBQA 2HQRA 4R1HA 4HF1A 2D45A 3WGHA 4I01A 1TQPA 5BMZA 3REOA 3WTYC 1F9NA 1XGMA 4M74A 4CZZA 2R3SA 4B8XA 2LDUA 4EGYA 2VC1A 5JFRA 5TRDA 1W7PD 5ICGA 2ZFWA 4AIHA 1U5TC 5DD8A 4IRGA 3JAMK 5KVRA 2QLZA 2OZUA 1GXQA 3FX3A 1S3JA 2BEOA 1WSUA 4UVCA 1BBYA 4HYEA 4UXNA 3F6OA 3HYIA 2QYOA 4AIKA 1TBXA 4ZZDA 1P4WA 1LEAA 3CO7C 2RDPA 5DV5A 1FX7A 3PFIA 4WF2A 1QZYA 3R6SA 5DEQA 4GO1A 2YR2A 1B1BA 2XASA 4KIBA 1OKRA 1Z6RA 2Q0OA 5CVIA 2ACJA 2KRFA 3VEPA 1FYKA 5D6EA 4EJWA 3L2CA 1R1UA 1HW5A 2HTJA 3LAJA 5L3DA 4L9TA 5D8KB 1FP2A 3RI4A 5E17F 4G8XA 3FHZA 2DO7A 2ZXJA 3U9GA 1A04A 4WXHA 2HEOA 4BXUA 2XAGA 2KIUA 1SMTA 4A5NA 1FT9A 4LLLA 4U0YA 1ZREA 2XUBA 2LNBA 3LA3A 5E1XA 3ZN1A 2WWYA 2QQ9A 5J6XA 2HFHA 1ZG1A 3E3VA 4YIIA 2KKOA 3O3KA 1P92A 4WWCA 3RPUA 4U0WA 5ILUA 4LG0A 5HS7A 2HZTA 5D5XB 2TDXA 1YW7A 2FA5A 1JHHA 1I1SA 1MDMB 3IRRA 5DCMB 5LHIA 4L5JA 2CO5A 2L02A 2VOPA 2VXZA 1TW3A 3T8TA 4NQWA 2VC0A 5LHGA 2CW0F 4GXOA 3R4KA 4OMZA 2ZNZA 3LQRA 2IA1A 3F21A 2IA0A 3DXJF 1IW7F 4ON0A 4FX0A 5BOXA 1S7AA 3I4PA 2RV8A 1XGOA 1KGSA 3KFWX 2EFOA 1SAXA 2COMA 1MJAA 4MTDA 1BIAA 4LMYA 1UB9A 3MWMA 2A68F 4MQ9F 4WCGA 2RKHA 3JTGA 3V7SA 3PQKA 2E1CA 3WTZA 3RDIA 2QQBA 1UHWA 1LNWA 2RC4A 4TV7A 4JQFA 2X0LA 2IP2A 1XCBA 2H6CA 1IRGA 2L01A 4EM1A 1YW8A 1LJ9A 3K1NA 3LA2A 2FEZA 3E5UA 4MEYF 1J7KA 5HLIA 3GEZA 4I98B 1W7PA 1VTNC 4ESFA 5BS6A 1JGSA 3F6VA 3L7WA 3FZVA 3VB2A 4G6DA 3QP6A 2XKPA 3HHGA 2OD5A 3CUQB 2L3DA 1MZBA 4XLNF 3E6DA 3TOAA 5DUIA 3DF8A 1GXPA 3QRFF 5HDGA 4CICA 1JXSA 3ULQB 3MZYA 2GXGA 1LDKB 1TTYA 2P5LC 5E18F 1RI7A 3P9CA 3RKWA 1IXRC 3BJ6A 3H92A 1QGPA 4L18B 2RN7A 4IF4A 3J81K 2XVCA 5LGUA 3LAPA 2DPDA 2O61A 3SFZA 3WGGA 2MLKA 3LQQA 4PZJA 2OZ6A 4U0VA 3KP3A 4EVIA 3Q9VA 1OR7A 1USTA 5CVJA 3ZMSA 1R22A 2JPBA 3GO5A 1KA8A 3KEQA 3K2ZA 5JI6A 3HHHA 1TW2A 4NB5A 2P6TA 4ZYDA 4KFCA 1LDJA 3IC7A 1W5TA 2YX7A 1E17A 3J7AO 4U88A 5FD5A 2VBWA 4HQEA 3HTSB 4A2UA 1IF1A 5LBQA 4QWQA 1XCVA 2RVCA 3HOTA 2M45A 4OIRF 3QU6A 2DAOA 1KQ8A 2RQPA 2R7FA 2L4MA 2EV0A 2AS5F 4UV8A 4N0BA 4WXDA 1XGNA 2QM3A 2UXNA 5E20A 5DD4A 5FFXA 2XRNA 2MH9A 3BWGA 4RAYA 4S05A 5H6QA 2P6SA 4ESBA 5FLXK 4RAZA 2C6YA 2Z9OA 2STWA 3QPTA 3T5XA 3KP2A 1Q1HA 4OIQF 1U78A 1Z6TA 4YG2F 3QU3A 4EV0A 2BE5F 3KZYA 2GQQA 1FWZA 2DFIA 2XKOA 4BYYA 5DCMA 1R00A 4F7ZA 3F8FA 2QUFA 5H6RA 5CVUA 1UHMA 2QQAA 3WODF 4XRFA 4ENJA 4B09A 1J75A 4CGZA 2DQRA 4FX4A 1Z7UA 3ML6A 1ODDA 4UV9A 3I58A 2IT0A 1F4KA 1YS6A 3I59A 3GLXA 4KMUX 3HRSA 3BOQA 3RKXA 1RNLA 1P4XA 2ZO4A 3HOSA 4RB0A 5HDKA 1W4MA 3QAHA 4Q4ZF 2ZMEB 2CWEA 1PUEE 2XAJA 4HZFA 1ZG3A 3BZ6A 3TO6A 3W6JB 5HS9A 1BJAA 2CG4A 4MQVA 4ENMA 5KK1A 3FMRA 4QLCU 3OOPA 4M71A 4XSZF 4LG0B 2CGPA 1SD4A 3F8NA 4YIFA 3OV8A 3PQJA 5K5RA 1J2XA 3U1DA 2MA3A 1SFXA 1K7AA 2O6GE 3WG9A 4I09A 2DW4A 5CYVA 1K78A 2H27A 4YFKF 3F22A 2W84A 2K86A 1IXSB 2ISYA 3DV8A 1Z91A 1S7OA 4WXCA 3I5UA 5L3FA 1R1VA 4CXFA 3RYPA 1YIOA 3N97A 3M1EA 2LF7A 2CFXA 2LSOA 1O7LA 2O8XA 2H94A 3IKVA 2ISZA 5LEKA 1B9NA 2H6BA 4AD9A 1TLHB 2DLLA 4A0ZA 2DT5A 1ZYRF 2V1DA 3FMSA 2RNJA 1AOYA 4KYWA 3LSTA 2K02A 1XSVA 3F72A 1IN8A 3DPLC 2NRAC 3M8EA 1HW1A 4UVBA 5JVTA 5BPIA 1YO5C 2ZJ2A 1XB4A 4IRIA 5AONA 1SD6A 2IW5A 1WI9A 1LDDA 1MJBA 2JT1A 2HKXA 1W7PB 2W85A 2E1NA 2JPCA 4OOIA 5CVRA 4ESJA 5FLXZ 5HOOA 2B0LA 2O3FA 3RJPA 2PJPA 2KIFA 2P5VA 3Q9SA 4MEXF 1SMYF 3GUDA 1BIBA 3H3UA 2E7WA 5D4RA 2A3SA 1G4DA 4OINF 2JTVA 4M9SA 2MBFA 4GYIA 3V8LA 2V1UA 2Z99A 3RTRA 4LGWA 4GCVA 4KN4X 4I0BA 3TQNA 1QPMA 1YQAA 2XV4S 1BI1A 3WE3A 4HV6A 2GXBA 4OIPF 2K27A 1WRJA 4Z2YA 3IL2A 5K5OA 2W24A 2A07F 2EV6A 2P7VB 5F1RA 2Y75A 1D5VA 3ERED 3DQVC 1IXCA 1I1GA 1T98A 2PQ8A 3J80K 1YLFA 1BI2A 4KA4A 5FD6A 1CGPA 4M6XA 1PP7U 3BY6A 1IN4A 1IN6A 2DPUA 1O7FA 3V7RA 2OAZA 2QENA 1G3SA 5FGMA 4A6EA 3HIFA 3K1PA 3V8JA 1FBSA 1FNNA 2EA2A 1FZPB 5FFZA 5LGNA 1Z05A 3ECHA 3DKWA 1R23A 4UVAA 4LJZF 4KNYA 4P9UA 4H0EA 3F8CA 4HX7A 3R60A 4Q47A 4L9VA 1S29A 2OBPA 3ABTA 2LKPA 5IT9Z 1U5TB 1HSJA 3K9TA 5CVVA 5F6FA 1FBUA 3IWZA 1J9IA 3WU1B 1L0OC 1QQIA 4HX8A 4RB1A 3TO7A 2BV6A 1U5TA 2EFWA 1QO0D 1KU9A 5D6FA 4PGGA 4L9NA 4MGRA 1D8KA 2XGXA 3J81Z 1XMAA 5ERIA 1U3EM 3P9KA 5J8FA 1SD5A 2EA4A 2NAZA 2YSRA 4KIFA 4RGXA 2Y48A 5CLSA 2F5FA 5L3CA 4FT8A 5LRSA 4Q5SF 4MHGA 4RB2C 2G9WA 4KDPA 4ZYGA 4KT5C 1ZLJA 4ZYHA 1J59A 1ULYA 2BBYA 4EGZA 3MFKA 3I54A 1J5YA 5D5VB 2JRTA 1S8NA 2QVOA 3ZMTA 3RPQA 1TQIA 1ZRCA 4YFNF 1KU7A 3G3ZA 4IPAA 3MEXA 2OQGA 2XHKA 5LHHA 4LK0F 1YG2A 2VBZA 3WE2A 1YW9A 3I64A 1T0FA 3U2RA 2PBIA 3CLOA 4A5MA 1QZZA 3FMQA 4HX4A 3COAC 3KLOA 1F1ZA 2CSOA 3IHUA 3NQOA 3GVAA 2M8EA 1DDNA 3F3XA 3GYHX 1BC7C 5E8GA 1V3FA 3VFZA 3TOBA 3MAJA 2VODA 3IRQA 1NHAA 1EH6A 2D1HA 2PEXA 3J80Z 4CDGA 2P4WA 5LLQA 1ZN2A 2FNAA 2OQRA 1Z9CA 1IRFA 3BPXA 4HLXA 1IZ1A 3ZMVA 5D4SA 4LD5A 3FXUA 1V4RA 5HVQC 3NEUA 4L0ZB 4IRHA 4LB5A 5ICEA 2FOKA 4M9XA 3T1BA 1RUNA 4O6JA 1RUOA 4YFXF 1YTYA 4BAYA 4ZZLA 3B02A 5BPDA 3GZ6A 1UCRA 3AAFA 4AWXB 3K1MA 2OA4A 4HDVA 4LLGF 3QPHA 1XMKA 2GA2A 4KICA 2FE3A 1U6GA 1IN7A 5HLHA 4EM2A 4EM0B 2P7CB 2L4AA 2V79A 3GF2A 2PI0A 3CDHA 2CYYA 4A0XA 1SFUA 2HYFA 3BJAA 4HF2A 5AIPA 3ABUA 2R7DA 1RIOH 3TO9A 1TQMA 1MKMA 5LGTA 4HQMA 3C3WA 3WU0A 2VONA 4JBAA 3T8RA 2GA1A 2V9VA 1B59A 3ZN0A 1W5SA 2UWMA 1P6RA 4O5VA 4EJUA 2Q8KA 1O57A 3FF5A 2YX4A 5E1ZB 1G6NA 3KLNA 1AWCA 1HXDA 5K1YA 3KE2A 2JSCA 1O3RA 1ZARA 3WTXC 4FHTA 2VE8A 3HTUA 4Y15A 4IJAA 3CUQC 2D2WA 4S04A 1KQ9A 2XAFA 5L3EA 3MZHA 3KETA 4HV5A 3EYYA 3RKYA 3D5LA 3HUGA 1MGTA 2WTEA 5J8CA 1YS7A 1T38A 4ASNA 1FYLA 2GZWA 1SFEA 3DFGA 4D0PA 3JTHA 3B73A 4I0AA 2OU2A 2F5CA 1T2KA 4BQAA 3EUHA 3KP7A 2M5WA 4EJOA 1G3TA 1H0MA 2A61A 5H20A 4OMYA 4RGRA 2LF8A 3F23A 2ZBKA 5FO5A 3VODA 1I6XA 3ELKA 4KIGA 5A2QK 1H9GA 3GW2A 3HSEA
chains in the Genus database with same CATH superfamily
2LVSA 4UHTA 2Y0MA 2ME6A 2VQGA 1MJ9A 2E60A 4F55A 3V7CA 3V4GA 5DCFA 2LRDA 2QZ8A 3VYSB 2MC3A 3H0DA 3TGNA 5GPAA 3L9FA 1P2FA 1T0FC 5EYRA 4NUBA 4BQQA 3C18A 5ILSA 1ETVA 4XONA 4XICA 4D7MA 2KZGA 2GWRA 2WV1A 2PMUA 3L2QA 3ZQCA 4FQGA 2IBDA 2W4SA 3HEFA 4GRIA 3K4BA 4O3MA 2PLYA 1X3UA 4E6KG 1O3SA 2L2OA 5TJJA 1QHHD 1L3LA 3SXYA 4G6QA 3IH4A 1IG7A 3E6MA 3IH3A 2PMZA 3JRHA 2K4JA 5ICCA 3OOUA 4PDKA 3BP8A 2KFDA 2UUZA 3KCCA 1D1BA 3C2GA 4BACA 2ZCWA 1TNSA 4L5EA 4YRVA 2JJ7A 2L54A 2GIVA 2PMHA 3OYMA 3C2BA 2FQ3A 2ADUA 2EILH 2IGOA 2K4BA 1XSXA 1K83J 2IXSA 2JZYA 3ZCOA 2H8WA 1C0WA 1ZHFA 1U8BA 3I9V2 3KYDB 2LR8A 4RAFA 2JA7J 3NWSA 5HDNA 3E6CC 5IP7J 2O0YA 1T39A 1D3YA 2X6XA 5ICFA 3S32A 3BPVA 1R5GA 3BLYA 1BI3A 1X3WB 4BBRJ 3BC8A 2IAIA 1FIPA 2LY1A 3ZR8X 3M1CA 2BGCA 3MKZA 2CQKA 2VJJA 3PM1A 3ECOA 4WX9A 3MCZA 1HQCA 3CD6I 3L00A 1K61A 4Q48A 1T95A 2KIMA 4BKXA 2DYSH 3GFLA 1A35A 3RPUD 3HC7A 3OYIA 4M9ZA 2HQNA 3DEUA 2M1BA 2X4HA 3LSIA 5FKKA 4GYGA 3CMEI 3ZQLA 1TT5B 1FYMA 1IAWA 1Y8RB 3ZMUA 2EH3A 4IZZA 1O3QA 1K4TA 2Z5UA 1KU2A 3EDPA 2OTJI 1OISA 1BC8C 2KLOA 3FBNB 1ON1A 3TKYA 3GTJJ 4HNUA 1OCTC 4UNOA 4AM3A 1WKMA 3EQLF 1TP4A 3WTUC 3IKTA 4KMFA 1E2XA 2L9SA 2VE9A 1UFMA 4ZTJA 3CCMI 1Q1VA 2HXIA 2CW7A 4IXAA 2HDCA 1PYVA 4BH9A 2CV1A 1FP1D 3CTAA 3ZQ7A 3CJTB 2ZJRF 2V7FA 2E34A 1MSFC 3CCJI 3LSGA 5IT9K 1S6LA 3DPTA 2FBHA 3W3CA 4E7SA 5J1YA 3PNVA 3E5XA 5ILVA 2V9PA 2L7FP 2HDWA 2PN6A 3M8JA 5D5WB 2R0QC 1ACIA 2CFOA 2FBKA 4IHTA 5JHUA 3ZQHA 1XSDA 3I56I 3X2QH 3S1QJ 1RC9A 3V8KA 4G94A 2EFNA 4PFPA 2IJLA 3K70C 3BTLA 2KJCA 2DMUA 1DU6A 4A3MJ 3FXQA 3OY9A 3W2VA 2ZMEA 5DM7F 2XAQA 1OMIA 2A6EF 2CH0A 5IYDJ 1SC7A 1BN5A 2QWWA 2X1EA 2FQ4A 4U7DA 1HDDC 3GZNB 4NC6A 2IVMA 3GZ5A 4G9YA 4D7NA 2ZC2A 3EUAA 2HOEA 4MNUA 1CQTA 1XS9A 2FSWA 4PK4A 5BNGA 2O03A 3K4CA 4E70A 3I53A 5ED4A 4CYDA 4PGHA 1FPQA 3BG9A 2F5EA 4ENKA 2WC2A 2EJRA 4OWRB 1W0UA 1HCRA 2A6HF 2VKHA 2Z1DA 4XBFA 2E2JJ 2KIQA 5LEJA 1VQLI 3I0TA 1B6AA 1DGWY 4BHBA 3CCSI 4NHJA 3OYJA 5EG0B 3OYGA 3R0AA 2IS4A 2VT3A 2QSHX 4MFDA 1D0XA 5F64A 4BEHA 1OYYA 1IUYA 4HOBA 3CMMA 5C4JJ 2V4JC 2KQRA 2QGUA 3BR1A 2EIKH 2DA6A 3F8MA 1I5ZA 4HG2A 3FXJA 3AG2H 3CO6C 2DJNA 1BR1A 3D0SA 1T6SA 3HOVJ 3FBIB 2V6CA 3G73A 3ZQQA 3BROA 2DA4A 4I7HA 2HVSA 3DTKA 1BW5A 3H36A 3H3ZA 1BOAA 2AXLA 3HSFA 4XOPA 1FSHA 2K5CA 2XF5A 3OYHA 4A3EJ 3TDUC 4L9JA 2IA2A 4QSHA 3T0YA 3KZZA 3PNYA 2HS5A 1R9TJ 3HPGA 3S93A 3JRIA 4CZCA 1TZLA 3MQ0A 3ASNH 2A69F 2DU9A 1X1CA 1WQ2A 1N78A 3HBLA 4C3JJ 3HG9A 4BQOA 2W57A 4HLYA 1YX3A 3GFIA 3E5QA 3I59B 3TMOA 5KNLA 1YJWI 2H8RA 4BJTA 4QPOA 3VSLA 2HTSA 3EETA 2CUJA 3G6EI 2K85A 2PFBA 1O3TA 2Q2EA 2IRFG 2KRHA 1R7JA 2M30A 4XLFA 2FMYA 4C2MJ 1CF7A 4P55A 3QOPA 3FXMA 3O8GA 1R5ID 1Z3XA 1J0RA 1YJ9I 4BBSJ 3NRVA 3H0GJ 4PJNA 2ZFUA 5F04A 4AU7A 3OR1C 2MD5A 3C2HA 1GDTA 1K79A 4AVPA 4RGSA 4CHUA 4IEJA 2W82A 3E0JB 5IT3A 1ZG5A 1MD0A 3P7NA 4PSXA 1WPKA 2A5WA 3UKGA 3L09A 4AYBN 1ZGAA 1OYIA 3VOEA 2F2EA 4IVNA 2YU9J 5JR3A 2EPFA 2E2HJ 4B4CA 4J19A 2JVGA 2V9KA 1IRXA 2VT2A 3G4SI 2ELJA 1EV7A 3P9IA 1PP8F 2DFEA 4HA8A 4N9HA 2IS1A 1R4NB 4BQNA 3M8FA 3M7GA 2LBFB 4LB6B 2NVXJ 4L5IA 1IV6A 2QA4I 4JK1X 4EMSA 5LRRA 2NYXA 2DA7A 3E6BA 1SFOJ 1F5TA 3ZXSA 2F5VA 4UUSB 1XDSA 3KX2A 2IGNA 2K3PA 1E3OC 5DDGA 2BY0A 2ECCA 1OPCA 3BZCA 3JW4A 2BYVE 4HDUA 1QNTA 3PO2J 3A1YA 2JRMA 3DLAA 4EJTA 1PJRA 3WTWC 3LNQA 2K7LA 4F52A 1LQ1A 2CS3A 5AIQA 3NARA 1R36A 4N9IA 2P8TA 1WWXA 1MNDA 2VN2A 4XLPF 4Y17A 3GTKJ 3O2PE 4C2TA 5DYMA 3PSIA 2DQLA 4WK8F 5F0FA 1YYVA 2XIGA 1LE8A 2G7UA 4HSTA 4MLOA 2NNYA 4A6DA 4UUVA 3G1LA 4BNCA 2MC4A 1YFHA 3DBHB 3A01B 3KEOA 3OS0A 1W36D 1FTTA 3ZQIA 3RCOA 2VOOA 2DI3A 2DT6A 3I3LA 1HKQA 3IAM2 4EJVA 4ZYEA 5C3EJ 1R49A 1LFUP 3CC7I 4DNCA 4LLNA 4M3DA 4BHPA 2W7NA 2XGCA 5D5UB 1ON2A 3JAMZ 5B3SH 1BM9A 1TWFJ 1TL8A 4IHVA 5L3GA 3Q5FA 1STZA 1HW2A 3GFJA 2QBYB 3EYIA 3I71A 2JUGA 2LKSA 1XD7A 2A5YB 3VYRB 2IGMA 2DN0A 2VJIA 4I2OA 3ZP5A 3GFMA 3E7LA 3VYUB 2L9VA 4B43A 3GXOA 3FXRA 2R7QA 4M72A 3H9QA 3QYBA 1HBXG 4AYBA 4Y13A 4V19K 5EEHA 2ETHA 5FB2A 1A36A 2ZKZA 2KJBA 4HAMA 4XRSA 4E7JA 4MO7A 3SQNA 2HI3A 2Y31A 1B72B 2F5DA 3E97A 3FHNA 3CF5F 4CA0A 1LFPA 2HYGD 1Y0UA 2EINH 3FM3A 2QBYA 2HR3A 4BL0B 4ITVA 4II2A 3JSOA 1PVEA 2VPLA 3RKQA 1MBGA 1ZAOA 5K7HA 4RB3C 2MD0A 3TP0A 1OCZH 1GVJA 4FETA 1XDUA 2FOWA 2XAHA 2Z33A 3DP7A 3HRTA 2BW3A 2P5KA 3PIPF 2HWVA 2K9LA 1JHFA 2EV5A 4DYRA 2ESHA 2HGCA 2EFQA 5E1WA 2VBXA 1VQPI 1ZKGA 1GVDA 2M87A 1FOKA 3ZMZA 2X1DA 4G7ZF 1D8JA 1G3WA 1DUXC 1HKSA 1MMAA 2FMLA 3MZ8A 3A03A 4KJZA 3SZTA 3C7JA 1FOYA 1KU3A 3O6BB 2ZNYA 3B6AA 5HS8A 3OL3A 5F1JA 4U87A 2ZSHB 5K5QA 2EB7A 2OV7A 5K7ZA 5IYCJ 3WTSC 4ZH4F 1LEBA 3FM5A 2EFPA 4M3EA 1B9MA 2ELHA 3WTVC 3C1DA 4LITA 1XGSA 3L2RA 4XSXF 1K6OA 4LK1F 2KZVA 2PG4A 2RNGA 2NNNA 4CCJA 3HDDA 1ZTRA 1WFXA 3ROUA 2Z3YA 3TDZC 3CCRI 2M4GA 3N4MA 1X19A 2MH2A 1VFCA 2G7HA 5DM6F 1EA3A 1I3AA 4C3IJ 2LY2A 2FF4A 1RKTA 4ETSA 1MMSA 4E7ZA 2DA3A 1USSA 2NVYJ 2J5PA 4CSWA 5TGTA 4Z6YA 1QBJA 2QF7A 3H1CA 3EPZA 1FSEA 2HVQA 2HYJA 4ENNA 1MDMA 1TNTA 3K0LA 4E7IA 4JX4A 3KP6A 2B7EA 1JE8A 3JSPA 4CYCB 3FK7A 2XPWA 2Y9YA 2DBBA 2M7BA 4LG3A 5CQGA 3HOXJ 4MTEA 4IHWA 4BUPA 1XN7A 2FNPA 2DK8A 2FU4A 4D9JA 3ISPA 3FWEA 2XRLA 4W1UA 1GV2A 1D5YA 3WHCA 2WV0A 4G7HF 1ZRDA 4PSWA 3W6VA 1LFBA 3BTIA 4PCQA 3LA7A 4MFEA 1VQ4I 3KP4A 2ZXWH 3R61A 1JUMA 4F93B 2BZTA 3WGIA 1WZ2A 1FLIA 4BXXJ 1NK2P 3BTJA 5KHDA 1G2HA 2BW3B 1P7IA 1FC3A 4XRMA 3QP5A 4P96A 3JRDA 3ONQA 3K69A 4CCMA 4P1WA 2F6CA 1OYWA 3HSRA 1P4AA 3KP5A 2NS0A 1ONVA 1FOWA 2OPTA 1RRJA 3W2AA 4A3GJ 3CUQA 4OIOF 4IOCF 5CJ9A 4L0YB 1B72A 2BHZA 1LB2A 2M9HA 1CF7B 1A6QA 2EWNA 2EK5A 3GWZA 5A2QZ 2MLGA 4A12A 4IO9F 3HRMA 2L5QA 4U7BA 3IWFA 2MW8A 1R5HA 1HKTA 2ZJQF 3CZ6A 6PAXA 3S1MJ 4HBLA 3BTCA 1LVAA 5HLGA 1G3YA 3I55I 1ZGWA 2XF6A 3OR2C 3R0JA 3ZRGA 2XPUA 2FBIA 4UB6C 2O8KA 2CQQA 4M3BA 4M73A 4XLHA 3OYBA 3DBLB 4I02A 1GLNA 1U2WA 3I4MJ 4B47A 3OIOA 2VL8A 3K4KA 2ESNA 2UXXA 3SZPA 4KUMA 4NDLA 1Y56A 3RIRA 1K78B 3S3OA 1REPC 2FXAA 1QRYA 3BDDA 2DTZA 2XB5A 2DTRA 4LFUA 2VBYA 2R5YB 2FRHA 4XM3A 2E5ZA 4XORA 1ZH5A 4M6YA 4HW0A 5L3BA 4BHCA 1YHQI 4CO8A 3K4MA 3M9AA 1SD7A 4P9FA 2R7RA 3QPSA 3CJNA 1KYWA 3SHFA 1DPRA 1VQ8I 3RZOJ 1PDNC 1ZGJA 2IPQX 4HF0A 3F8BA 2NS8A 1BI0A 3D5RC 4IHSA 3RYRA 1A6IA 2DK5A 2YPRA 2BOLA 2H09A 3HZJA 1U0JA 3FK6A 1MNMC 4IHXA 2OUMA 3FISA 4R79A 1ZR4A 1DPUA 5BQTA 4K2EA 1ORKA 2HXOA 5D8LB 3CC2I 4RS8A 1EH7A 1ZRFA 4RGUA 1H9TA 1HSTA 2DFFA 2XROA 1KYZA 5IY5H 1I27A 2UZKA 1JKPC 5E8IA 2YS9A 5M5YJ 1SFKA 4A3KJ 2YU3A 3WTTC 1QPIA 3D5SC 3HRUA 4G7OF 4PJLA 2Z16A 4B44A 1ERDA 3GX4X 5DUKA 5GTIC 1OJLA 1Z1DA 3EUKL 1MMDA 1EH8A 4XN0A 1FY7A 3ZPLA 1WH7A 4B3XA 1HOMA 5J1UA 1RZ4A 3MD2A 1DP7P 1IN5A 4KN7X 4R8HA 3OYEA 1ZLKA 1B4AA 5EF6A 5EEGA 3LFKA 4DQ2A 3DKYA 2E5NA 4OU0A 4EQQA 1GHCA 2R7UA 2E7XA 5E3MA 2STTA 3M4OJ 2J5OA 3CUOA 4P5OA 2K3FA 1U8RA 1MMNA 3ZMDA 1R1TA 2HKOA 3ABKH 3CCLI 4XK4A 5GAGJ 2AO9A 5EEAA 1R71A 4FTHA 4J00A 2GAUA 3PFYA 3FIWA 1UELB 1R58A 2BY3A 2P81A 3LWFA 4GGGA 4QTRA 4BE1A 3W6KB 3LOCA 2D1VA 2RGVA 1JT0A 2IEKA 3S2WA 4YELA 3BJOA 2V1XA 1KQ0A 4A0YA 3RQ4A 2W25A 4Y4RA 4AIJA 2DFHA 1GV5A 1FBQA 2Y9ZA 2HQRA 1LUJB 3G71I 4R1HA 4UB8C 2HDDA 2BHYA 4HF1A 2D45A 5H2FC 2IS2A 2CQXA 1X58A 3Q0WA 1TQPA 4I01A 3WGHA 5BMZA 2R93J 3BCAA 3REOA 3WTYC 5M3FJ 1JTXA 1F9NA 3BZKA 1JKOC 2CV0A 1XGMA 4M74A 4CZZA 2PJRB 1J09A 2R3SA 4QPQA 3OYDA 4B8XA 3SJMA 2LDUA 3PUFA 4EGYA 1H88C 2VC1A 4DZPA 5JFRA 5TRDA 1W7PD 4JX6A 1PUFA 3SEQA 5ICGA 2ZFWA 4CCKA 2QEXI 1W1WE 2L7MP 4AIHA 3JRFA 1U5TC 1V54H 2DCEA 5DD8A 4IRGA 3JAMK 5KVRA 2QLZA 2OZUA 5TISC 1GXQA 3FX3A 3PJRA 1S3JA 2BEOA 1DQUA 1WSUA 4UVCA 3BQZA 1BBYA 4HYEA 5J3LA 4UXNA 3F6OA 3HYIA 3K70D 2R7TA 3KPHA 4BE2A 2QYOA 4EATA 1ETWA 4F92B 4BS9A 4AIKA 4BDZA 4D1QA 1XC5A 1HDPA 1YX5A 1TBXA 4ZZDA 1P4WA 5IOYA 1QHGA 5IP9J 1QA6A 3OS1A 4FISA 2K9SA 1LEAA 5LFAA 3CO7C 3HXLA 2RDPA 1MBFA 2QQ8A 5DV5A 5C44J 1FX7A 3AG1H 2OJED 3PFIA 2DODA 4WF2A 1QVUA 1QZYA 2ZXIA 1BR2A 5DEQA 3R6SA 4GO1A 4XN3A 2YR2A 4C9YA 1IC8A 1JUSA 1B1BA 2XASA 4KIBA 1OKRA 1Z6RA 2FJ1A 2Q0OA 5CVIA 2ACJA 5DTDA 2KRFA 2DA1A 3CMYA 3LSJA 4Y3OA 1FJLA 3CQZJ 3VEPA 3RQIA 1FYKA 2LMDA 5D6EA 1K6YA 4EJWA 3L2CA 4FASD 1JI8A 5HODA 2E1OA 5GAEJ 3LSPA 1R1UA 1HW5A 2HTJA 3LAJA 5L3DA 3OIQA 4L9TA 5D8KB 1G59A 1FP2A 2DXIA 1W0TA 1RESA 3RI4A 4IHYA 5E17F 4G8XA 3FHZA 4BU2A 2DO7A 2ZXJA 1RETA 1V5GA 3U9GA 1A04A 4WXHA 3DLLF 3HGYA 2OC6A 2WAQN 2HEOA 3BR5A 4BXUA 3OYKA 2XAGA 2KIUA 5E3LA 1Z77A 2GLOA 1MBEA 1SMTA 2M0CA 1FEXA 3B6CA 3P5JA 4JYKA 3QQAA 4A5NA 1ZR2A 1FT9A 4LLLA 1V55H 4U0YA 1ZREA 2XUBA 2LY9A 2LNBA 1WJDA 1ENHA 2WB1N 3LA3A 5E1XA 3SDGA 1X2MA 2BY2A 3ZN1A 2QQ9A 5J6XA 2WWYA 2HFHA 3K4NA 1ZG1A 4V2GA 3E3VA 2MYSA 4YIIA 2GM4A 2KKOA 4RM2A 3O3KA 1UHSA 1P92A 2KISA 4WWCA 2IS6A 2KDOA 2VQLA 3RPUA 4U0WA 5ILUA 4ZC3A 4LG0A 2VKVA 2RAEA 5HS7A 3K7AJ 2HZTA 2K9NA 3QOEA 2PX9A 5FLVA 5D5XB 3DU6A 3BR6A 2TDXA 3BT9A 1XG1A 2XPVA 2JA8J 1YW7A 2DMNA 3L2UA 4ANJA 2FA5A 5JLWA 1JHHA 2LH9A 1OCRH 1I1SA 1MDMB 3IRRA 5DCMB 3LSKA 5LHIA 2JMWA 1S9HA 1HC8A 4L5JA 2CMPA 1O4XA 4HNTA 2ECBA 2CO5A 2L02A 2VOPA 3TW6A 2VXZA 3CP8A 1TW3A 1OR7C 3T8TA 2JN6A 4NQWA 2VC0A 3S3MA 5LHGA 2HOTA 4IQJA 2CW0F 4GXOA 4N4NB 2O7OA 3R4KA 1X4PA 2WAQA 4OMZA 2ZNZA 4JX5A 2WA0A 3LQRA 2IA1A 4ZDLA 4UUTA 2RQQA 4A3IJ 1DGRM 5EZHA 3F21A 1TWGJ 2I10A 1GT0C 4RM3A 5KAIC 2IA0A 3DXJF 1FOXA 1LVKA 2CQNA 2HOSA 1IW7F 4ON0A 4FX0A 5BOXA 1X1PA 1E0EA 3S1NJ 2M4KA 3NAUA 2JSPA 1YOVB 4DYCA 1S7AA 4HSRA 1I50J 2DDAA 2RV8A 3I4PA 3OIPA 1XGOA 1KGSA 3KFWX 2BXYA 2EFOA 4PJJA 1SAXA 3H5NA 2COMA 1MJAA 4MTDA 1BIAA 2CRGA 4DJAA 3KYLA 1N77A 3IV5A 1QVTA 2DYRH 4LMYA 1W36C 4NC8A 4DIQA 1UB9A 3CJRB 3MWMA 4BJ5C 2A68F 1S72I 4MQ9F 4WCGA 2RKHA 3JTGA 3V7SA 4A3BJ 3PQKA 3MKWB 2E1CA 3WTZA 3RDIA 2QQBA 1UHWA 4XQFA 1LNWA 3WHBA 2RC4A 1AKHB 2HQAA 2LP0A 4AUXA 4TV7A 1B8IB 4JQFA 2X0LA 2IP2A 1XCBA 2H6CA 5J47A 1IRGA 2L01A 4EM1A 1YW8A 1LJ9A 3K1NA 1SVMA 2VIXA 4W97A 3JRCA 1WGXA 3S14J 3LA2A 1B8IA 2FEZA 3E5UA 4MEYF 1HLVA 1AKHA 4C3HJ 5E3OA 1J7KA 3VYTB 4DBQA 5HLIA 3GEZA 5JLXA 4I98B 1W7PA 4RBOA 5M3MJ 5KCMA 1VTNC 1WH5A 2HPIA 2YUSA 4ESFA 5HNHA 1T33A 5BS6A 1K4SA 2K9QA 3SEZA 1JGSA 1WI3A 1VQ9I 3ASOH 2JUCA 2CU7A 1LE8B 3BG3A 1ZQ3P 5GPCA 3Q0VA 5FRMA 2VJ5A 3GTPJ 2WADA 3F6VA 3L7WA 4NC7A 4B48A 2JA5J 3FZVA 3VB2A 4G6DA 4XKWA 3S16J 2W1OA 3QP6A 3GTMJ 2XKPA 3GTQJ 3HHGA 1D0YA 2OD5A 2QKMB 4KITB 3CUQB 2W48A 2L3DA 1MZBA 2LYCA 4XLNF 1P9QC 3E6DA 3TOAA 5DUIA 5B5EC 3DF8A 1GXPA 3QRFF 4NNJA 1VF9A 5HDGA 2FX0A 4CICA 3TEDA 3ULQB 1JXSA 3MZYA 2GXGA 1LDKB 1TTYA 2E1MB 1OFCX 2P5LC 5E18F 2KT0A 3V42A 2GOMA 2X6YA 1RI7A 3K2AA 3QYEA 3P9CA 3RKWA 1IXRC 2X9DA 2WAFA 3BJ6A 3H92A 2M34A 4XMYA 1QGPA 3J7ZI 4LIVA 1ZK8A 4L18B 1UMQA 2RN7A 4C2UA 4IF4A 4DW6A 3LSHA 2XVCA 5LGUA 3J81K 3LAPA 2DPDA 2O61A 3SFZA 3WGGA 1HF0A 1WJ5A 3U1KA 1S7EA 2MLKA 3LQQA 4PZJA 4F3QA 4IOAF 2OZ6A 2O9LA 2R4GA 1JJ6C 2F4IA 4U0VA 1FIAA 1BW6A 2DJIA 1OCOH 2GBYA 3KP3A 4EVIA 3Q9VA 3J7AY 1OR7A 2EIMH 1X3ZB 3OWTA 1YITI 4E7HA 1XX5A 1USTA 5CVJA 3ZMSA 1R22A 3ZGKA 2HNHA 2W00A 2JPBA 3GO5A 1KA8A 4FE4A 3KEQA 3K2ZA 2QCOA 2E19A 3H3VK 5JI6A 1KZHA 3HHHA 1OLTA 1TW2A 2X48A 2P6TA 4NB5A 4ZYDA 1NK3P 1MH4A 4I76A 4KFCA 1WJBA 1LDJA 3IC7A 1W5TA 4EEFG 2YX7A 1FTZA 3M07A 1E17A 2I8DA 3J7AO 5FKLA 3DTIA 4KT6A 4U88A 4J01A 5FD5A 2VBWA 4HQEA 3EUHC 3HTSB 2Q1ZB 1D1AA 2EZKA 5J4YA 3A4CA 4A2UA 1IF1A 3SDBA 5K7FA 5LBQA 3Q3SA 4QWQA 2ID3A 2P0WA 2TCTA 1XCVA 4X6AJ 2RVCA 2NVQJ 3HOTA 3S17J 2M45A 4A93J 4OIRF 1WVRA 3BR3A 3QU6A 2DAOA 1KQ8A 2RQPA 3K4JA 2R7FA 2L7ZA 1MNEA 4BXFA 1T8IA 2L4MA 2EV0A 1SANA 4MIMA 2AS5F 4CUGA 4UV8A 5FKMA 4N0BA 4A3CJ 4WXDA 1KONA 1XGNA 2WY7Q 2QM3A 2Y69H 3CLQA 2UXNA 5E20A 5DD4A 5FFXA 3CF2A 4XL9A 3MKYB 3S2DJ 2XRNA 2MH9A 2XDVA 2WB1A 3JCUC 3BWGA 4RAYA 1SAUA 4DGWB 4S05A 1YRNA 5H6QA 2P6SA 3ESWB 2R7XA 2R7VA 4ESBA 5FLXK 1WJAA 2R7WA 4RAZA 1JGGA 1U9NA 2C6YA 2Z9OA 3LFUA 2ZXHA 4FCYA 1R6RA 4S0HB 3CCEI 1VZ0A 2STWA 3QPTA 2BVMA 3T5XA 3KP2A 1Q1HA 3L1PA 4OIQF 1U78A 1Z6TA 1MBHA 4YG2F 3ZQGA 3QU3A 4ZDOA 3H9GA 2BY1A 4EV0A 2ELKA 2BE5F 2JK3A 4PUSA 1T56A 3KZYA 2GQQA 2E35A 1FWZA 3LSRA 2DFIA 2XKOA 4ZJZA 4BYYA 5DCMA 1R00A 5J4VA 2MFZA 2OTLI 4GFBA 4HPQA 4HRIA 4F7ZA 4M3FA 3F8FA 2QUFA 3ABLH 2R5YA 5EDNA 2CW8A 2ME0A 4G6TB 5H6RA 3K10A 1F43A 5CVUA 3VPRA 1UHMA 2LC2A 2NOGA 1YRNB 2QQAA 1I6HJ 3WODF 5J40A 3GTLJ 4XRFA 4ENJA 4B09A 1J75A 4CGZA 2DQRA 4FX4A 5FRNA 1DP3A 3LSMA 4FE7A 2M2EA 2IGKA 2CUEA 2O5RA 3HKZN 3ZOBA 1Z7UA 3DTEA 3ML6A 3JREA 1EJ9A 1D1CA 4XLAA 1ODDA 4UV9A 2NOJB 1NH3A 3GTGJ 3I58A 2IT0A 3VDXA 1F4KA 1YI2I 1YS6A 2DMQA 3I59A 3GLXA 4LOCA 1Z67A 4B3AA 4KMUX 3HRSA 3BOQA 4BY7J 3RKXA 2M0MA 1RNLA 1P4XA 2ZO4A 9ANTA 1T08B 3GMEA 3HOSA 3VSKA 3CDIA 4RB0A 5HDKA 1VQMI 1MIJA 3ZQFA 2WY8Q 1W4MA 3QAHA 5M5XJ 2ZMEB 4Q4ZF 2CQ7A 2HQ5A 2CWEA 2L9NA 1PUEE 2XAJA 1S5LC 4HZFA 4UY8I 5EG0A 1ZG3A 3BZ6A 3TO6A 1BOBA 5HS9A 3W6JB 3A0BC 1BJAA 1UZCA 2CG4A 4MQVA 2X1CA 4ENMA 2EZIA 2RREA 1LKXA 3FMRA 5KK1A 3HL2A 3OYCA 3FXOA 4QLCU 3OOPA 4M71A 3TBIA 1JT6A 3A01A 3S8PA 2AQFA 5E3NA 4XSZF 4LG0B 2DDBA 3CC4I 2CGPA 1SD4A 4A3JJ 2KRCA 3A2KA 4D5CA 1AU7A 3F8NA 4YIFA 1WJFA 2UV1A 3GTOJ 3OV8A 3PQJA 1VQNI 5K5RA 1ETOA 2R92J 2MGQA 1J2XA 2Z2SB 5F0CA 3U1DA 1R4MB 2DA5A 2MA3A 1SFXA 1K7AA 2O6GE 3WG9A 5GADJ 4I09A 1Y0NA 3HOYJ 1IGNA 2DW4A 5B1AH 5CYVA 1H89C 3MKLA 1K78A 2H27A 4YFKF 1H8AC 3OSFA 3F22A 4IX7A 3BR0A 2W84A 4IL6C 2K86A 1X1DA 3CJQB 3AKZA 2MG4A 1IXSB 3BG5A 2ISYA 3DV8A 1UG0A 5F0HA 1Z91A 1S7OA 4X0GA 2EQRA 2E1MC 3UR3C 2L7KA 1IUFA 4WXCA 3I5UA 5L3FA 1R1VA 2VQHA 3F9KA 1N75A 4CXFA 3U21A 3RYPA 1YIOA 3OYFA 2VQCA 3N97A 3IH2A 3M1EA 1I3QJ 2JQ7A 2LF7A 3ABMH 1NG6A 2CFXA 2LSOA 4UUSA 1O7LA 2O8XA 1X2NA 2CV2A 2H94A 5F08A 4BJ6C 3IKVA 2ISZA 5LEKA 1B9NA 2LFBA 1TWHJ 2H6BA 4AD9A 1GUUA 1TLHB 1X4OA 2DLLA 4A0ZA 2DT5A 4E7LA 1ZYRF 2V1DA 2ZSIB 2OF7A 2CUZA 3TW7A 3FMSA 2X6OA 2H1LA 2ID6A 3L2WA 2RNJA 2XB0X 1AOYA 3D1NI 4KYWA 3LSTA 1BJZA 4XNFA 2K02A 1W5CC 1XSVA 2HZDA 3F72A 1IN8A 1HA8A 3DPLC 5HLTA 2NRAC 4HNVA 2BXZA 3M8EA 1HW1A 2EZLA 3CCVI 3S3NA 2F48A 3RZDJ 4UVBA 5JVTA 5JHFA 4CCNA 5BPIA 1YO5C 2ZJ2A 1XB4A 5AONA 5FROA 4IRIA 1SD6A 1Y6IA 1F36A 2IW5A 1WI9A 3KIOA 1LDDA 1RR7A 1MJBA 3NWTA 2JT1A 2LREA 5IYBJ 2HKXA 1W7PB 2W85A 2WAEA 3BCBA 2E1NA 3CP2A 2JPCA 5M5WJ 4OOIA 2NXNB 5CVRA 1UAAA 4ESJA 1ITYA 3AG3H 1OCPA 2MABA 5FLXZ 3QYFA 5HOOA 2E2IJ 2B0LA 4GDFA 2O3FA 3RJPA 2PJPA 2KIFA 4F91B 3CCYA 3H35A 1OCCH 2X6WA 1TC3C 2P5VA 3Q9SA 4MEXF 1SMYF 3GUDA 1BIBA 3OMYA 3H3UA 3BQYA 3ERMA 3BG6A 1QU3A 4XRSG 2E7WA 2VPRA 5D4RA 2A3SA 1G4DA 4OINF 2JTVA 5C4XJ 4M9SA 2MBFA 4GYIA 3V8LA 2V1UA 4H4KC 2Z99A 3RTRA 1IO2A 4LGWA 2DOEA 4GCVA 3W2WA 4KN4X 3DWLE 1EF4A 3H5RA 3HB9A 2AXTC 4I0BA 2X85A 3TQNA 1QPMA 1M1EB 1YQAA 2XV4S 3HOZJ 1BI1A 3WE3A 4HV6A 2GXBA 2VB6A 4OIPF 2A05A 4RA2A 2HOAA 2K27A 1FMVA 1WRJA 4Z2YA 3IL2A 5K5OA 4CCOA 5HNFA 2LG4A 2W24A 2E71A 2LD5A 2A07F 2EV6A 2B63J 2KPMA 2VKDA 2P7VB 2H1KA 1XMXA 4YEJA 2F4MB 3S15J 5F1RA 2Y75A 1D5VA 2VI6A 3ERED 2XF7A 5B1BH 3DQVC 4XKBA 1IXCA 1I1GA 1T98A 2PQ8A 3H5AA 1POGA 3J80K 1YLFA 3HM5A 1RKWA 5IOZA 1LPQA 1BI2A 5LD2C 2OCEA 4KA4A 2Y0SA 5IP6A 5FD6A 5IPAA 3PO3J 3TL4X 1CGPA 4M6XA 1PP7U 2JA2A 4NQWB 1P7JA 3BY6A 1IN4A 3GCMA 1U9OA 1IN6A 2DPUA 4CH7A 4RMNA 4DZJA 1O7FA 3V7RA 2OAZA 3G1OA 2NVTJ 2L9RA 1D0ZA 4D5FA 3A02A 2QENA 2V6EA 1G3SA 2AHQA 5FGMA 4A6EA 3HIFA 1TT0A 4XKVA 2DOAA 3K1PA 3V8JA 4ZTFA 2DT7B 1ETQA 1JTYA 1FBSA 1SVOA 4ABZA 1FNNA 5EGOB 2EA2A 1FZPB 5FFZA 4X1EA 3WU2C 3FXKA 1Z05A 5LGNA 3CDLA 3ECHA 3DKWA 4OAYA 1APLC 1VQKI 1MMGA 1R23A 3DU5A 5EJCA 2GOXB 4UVAA 3PSFA 4LJZF 4P9UA 4H0EA 4KNYA 5CPRB 1A31A 3F8CA 4XLCA 4HX7A 3QODA 3KZIC 1V5FA 3R60A 4Q47A 4RLQA 4L9VA 1S29A 2OBPA 4XKCA 3ABTA 2LKPA 5EGOA 4A3DJ 3CESA 5IT9Z 4A3LJ 4M6VA 2B9SA 4PJMA 3S2HJ 1U5TB 1IJWC 3MVPA 1HSJA 3K9TA 5CVVA 5F6FA 1FBUA 3IWZA 5CKTA 1J9IA 1BA5A 3WU1B 1L0OC 1QQIA 4HX8A 4RB1A 3G1MA 2QSGX 1MH3A 3HKZA 2BV6A 3TO7A 2MSYA 1U5TA 2WBMA 2EFWA 4I6ZA 1QO0D 1KU9A 5D6FA 1RR8C 5FLMJ 5EZGA 4M3GA 1E3PA 1YE9A 4BGDA 4PGGA 1X1AA 5GTHC 2XAUA 4L9NA 4MGRA 1Y39A 1BL0A 1D8KA 3OL4A 4I99C 2QKLB 2XGXA 3J81Z 2VUMJ 1XMAA 5ERIA 3J7YJ 4DOZA 1U3EM 3P9KA 3QPLA 5J8FA 1SD5A 2R7OA 2EA4A 1ZELA 3FKJA 2NAZA 3FKIJ 2YSRA 4KIFA 2R7SA 4RGXA 2Y48A 5CLSA 2F5FA 5FKOA 5L3CA 2X51A 3LL7A 4DYQA 4FT8A 3HOWJ 1Y1VJ 3IUOA 4ZDPA 1SVLA 3F0CA 5LRSA 2EZHA 4MHGA 4Q5SF 3I4NJ 4RB2C 2OCCH 3CCUI 4C30A 2Y30A 2JWTA 2G9WA 4KDPA 4ZYGA 3AFHA 4KT5C 2LLKA 2GXAA 1ZLJA 2EBIA 4PJ0C 4ZYHA 4ZYAA 1AA7A 4Y7NJ 4XR6A 3DPUA 4JP0A 2KHMA 1J59A 1ULYA 1Z0XA 2BBYA 4EGZA 1EKEA 1Z3YA 1IRZA 3MFKA 1MBJA 3I54A 1J5YA 4AC0A 3VWBA 4KISA 5DS9A 5D5VB 2JRTA 3O8HA 5J1RA 1S8NA 2QVOA 3ZMTA 3GLLA 3RPQA 1TQIA 1ZRCA 2F4OB 2K40A 2JVHA 4YFNF 1KU7A 1MSEC 3G3ZA 4IPAA 4CCLA 3MEXA 2OQGA 2XHKA 5LHHA 4LK0F 1YG2A 1Y8QB 2XGEA 2VBZA 3RSNA 5GAHJ 3WE2A 1YW9A 3I64A 1T0FA 4RLFA 3FXLA 3U2RA 2AQEA 2PBIA 3OYNA 3CLOA 2Y0SN 2LTPA 4A5MA 5E79C 2HVRA 1QZZA 3FMQA 4HX4A 3COAC 2LK2A 4DBRA 4BY1J 3KLOA 1VNDA 1F1ZA 3AG4H 3HUGB 2CSOA 3IHUA 2R7ZJ 3NQOA 2XSDC 3GVAA 4G12A 3SFIA 3TP3A 2M8EA 3FDYA 1DDNA 3F3XA 3IP4B 3GYHX 4A69C 3HJEA 1BC7C 3OS2A 5E8GA 1V3FA 4QIWN 3VFZA 3TOBA 3MAJA 1ETKA 2VODA 3E1SA 2NVUB 3IRQA 1TWAJ 1NHAA 1EH6A 2D1HA 2M7AA 2PEXA 3J80Z 4E4HA 1MBKA 2DOFA 4CDGA 2R5ZB 2PJRA 1WHUA 2P4WA 5LLQA 4BE0A 1ZN2A 2LKXA 2FNAA 2OQRA 1Z9CA 1IRFA 3BPXA 1ETYA 4HLXA 1IZ1A 1JJ8C 3JRBA 1NG7A 2LOOA 3ZMVA 5D4SA 1MW7A 4BEHB 4LD5A 2E36A 3LMMA 2VASA 3FXUA 2FUG2 1V4RA 1Z7LA 1Z21A 3L2VA 5HVQC 5JVGF 2R5ZA 1JKQC 3NEUA 1VQ7I 2CUFA 4L0ZB 4IRHA 2FD5A 4LB5A 4NBQA 5ICEA 1IDZA 2FOKA 2DA2A 4M9XA 3T1BA 1RUNA 4O6JA 1RUOA 4YFXF 1E3HA 2V1NA 3UNGC 3AL0C 1ETXA 1XTAA 1BR4A 4XOTA 4YIRX 4XLEA 1YTYA 3SZGA 4RAGA 4E7KA 3BG7A 4BAYA 4ZZLA 1YJNI 1VI0A 3GBGA 3B02A 1AHDP 5F27A 5BPDA 1VQ6I 3CMAI 3K4LA 1OQYA 3IAS2 2TRTA 3DKXA 3GZ6A 2VKEA 2HPMA 2CJJA 1UCRA 3SYTA 3AAFA 4AWXB 1XPXA 3K1MA 1I39A 3Q0UA 3PNTA 5FJ8J 2OA4A 3DEEA 4HDVA 4LLGF 2GIZA 3QPHA 2VLAA 1XMKA 2GA2A 4KICA 2FE3A 4Y33A 2KL4A 1X1BA 3OYAA 1U6GA 2LBFA 1IN7A 5HLHA 3PIOF 1N25A 2KDZA 4EM2A 1UG2A 4EM0B 2P7CB 4IKFA 3OYLA 2XC7A 2L4AA 2V79A 2JA6J 3GF2A 1DU0A 3KEYA 3HPHA 2PI0A 3JRAA 2VJ4A 3CDHA 3AL0B 1PUFB 4A3FJ 1FMWA 4V2FA 2CYYA 4A0XA 1SFUA 2PMZN 1WJEA 2HYFA 3BJAA 3BR2A 5CQEA 4HF2A 5AIPA 3ABUA 2R7DA 1RIOH 1TWCJ 1VQOI 1WCMJ 4IQ4A 1WJCA 3TO9A 4N4OB 1TQMA 3HGGA 1IDYA 2I5UA 1VQ5I 1MKMA 2XGDA 5LGTA 4HQMA 4Y52J 3C3WA 1A5JA 3DCFA 3N05A 5FKNA 2G0EA 3MN2A 3WU0A 3H9JA 1Y1WJ 2VONA 4JBAA 3T8RA 1YIJI 2GA1A 2KP6A 3WG7H 2V9VA 2QSFX 3DEWA 1B59A 2ICWG 4AVZA 3ZN0A 1W5SA 2UWMA 2KMUA 2M8GX 1P6RA 4O5VA 3K6GA 4EJUA 5B66C 3G2BA 2Q8KA 1V5EA 1O57A 3FF5A 1JKRC 3MMYB 4OAZA 2YX4A 5E1ZB 5GP9A 4AIDA 1G6NA 3KLNA 3CCQI 1AWCA 1HXDA 5K1YA 3OSGA 4LIUA 3A0HC 3HOUJ 3KE2A 2JSCA 2VXDA 1O3RA 1ZARA 2HU9A 3WTXC 2ZJPF 4BDYA 2ZB9A 1NTCA 4FHTA 2Q2EB 2DMTA 2VE8A 3HTUA 3JRGA 4Y15A 4IJAA 3CUQC 2NS7A 2D2WA 1G8XA 4S04A 1KQ9A 2XAFA 4JOMA 5L3EA 3MZHA 2COBA 2D5VA 3KETA 4HV5A 2ZMEC 3EYYA 3RKYA 1IV8A 5KAFC 3D5LA 2EIJH 2K9MA 3DBRB 3HUGA 1MGTA 2M3AA 2WTEA 1YS7A 5J8CA 1T38A 2DMPA 4ASNA 1RPWA 1FYLA 1SEUA 2GZWA 1SFEA 3S1RJ 3DFGA 4D0PA 3JTHA 4HEA2 3B73A 4I0AA 3M3YJ 4XIDA 2OU2A 2N8GA 2F5CA 3QWLA 3KYCB 1T2KA 4BQAA 3EUHA 4II3A 2L0KA 2M5WA 3KP7A 3PL8A 2XSJC 1G3TA 4EJOA 2A6TA 1H0MA 3JR9A 2A61A 5H20A 4OMYA 2Y2ZA 4RGRA 4B1RA 4CYCA 2BVLA 2LF8A 3F23A 2ZBKA 5FO5A 2V26A 1I6XA 3VODA 3ELKA 4KIGA 1QZEA 4RDUA 4PFOA 5A2QK 1UJ8A 3PUBA 1H9GA 1JUPA 3GW2A 3HSEA
chains in the Genus database with same CATH topology
4UHTA 2Y0MA 1MJ9A 3V7CA 3V4GA 5DCFA 2QZ8A 2MC3A 3TGNA 3L9FA 1P2FA 3C18A 5ILSA 2GWRA 2PMUA 4O3MA 2PLYA 1X3UA 1O3SA 5TJJA 1L3LA 3SXYA 4G6QA 3E6MA 2K4JA 5ICCA 4PDKA 3BP8A 3KCCA 2ZCWA 1TNSA 2L54A 2GIVA 2PMHA 2FQ3A 2ADUA 2K4BA 1XSXA 2JZYA 1C0WA 1ZHFA 5HDNA 3E6CC 2O0YA 1T39A 1D3YA 5ICFA 3BPVA 1R5GA 1BI3A 2BGCA 2CQKA 3ECOA 4WX9A 3MCZA 1HQCA 3L00A 4Q48A 2KIMA 3GFLA 4M9ZA 2HQNA 3DEUA 2M1BA 2X4HA 4GYGA 1FYMA 1IAWA 3ZMUA 1O3QA 2Z5UA 1KU2A 3EDPA 1BC8C 1ON1A 3TKYA 4UNOA 1WKMA 3EQLF 3WTUC 3IKTA 4KMFA 1E2XA 2VE9A 1UFMA 4IXAA 2HDCA 4BH9A 1FP1D 3CTAA 3ZQ7A 5IT9K 1S6LA 3DPTA 2FBHA 3E5XA 5ILVA 2PN6A 5D5WB 2FBKA 4IHTA 5JHUA 1XSDA 3V8KA 4G94A 2EFNA 2IJLA 2KJCA 3FXQA 2ZMEA 2XAQA 1OMIA 2A6EF 1BN5A 2QWWA 4U7DA 2IVMA 3GZ5A 4G9YA 2HOEA 4MNUA 2FSWA 2O03A 4E70A 3I53A 5ED4A 4CYDA 4PGHA 1FPQA 2F5EA 4ENKA 2WC2A 2EJRA 2A6HF 4XBFA 5LEJA 3I0TA 1B6AA 4BHBA 4NHJA 3R0AA 2VT3A 5F64A 1OYYA 1IUYA 4HOBA 3F8MA 1I5ZA 3CO6C 3D0SA 1T6SA 2V6CA 3G73A 3BROA 4I7HA 3H3ZA 1BOAA 2AXLA 3HSFA 1FSHA 3TDUC 4L9JA 2IA2A 3T0YA 3KZZA 2HS5A 3MQ0A 2A69F 2DU9A 1WQ2A 2W57A 4HLYA 3GFIA 3E5QA 3I59B 2HTSA 3EETA 2PFBA 1O3TA 2Q2EA 2IRFG 1R7JA 2M30A 2FMYA 1CF7A 4P55A 3QOPA 1J0RA 3NRVA 2MD5A 1K79A 4AVPA 4RGSA 4CHUA 5IT3A 1ZG5A 1MD0A 3P7NA 3L09A 1ZGAA 1OYIA 3VOEA 2F2EA 4IVNA 5JR3A 2VT2A 1EV7A 3P9IA 1PP8F 4N9HA 4HA8A 3M8FA 3M7GA 4LB6B 4L5IA 4JK1X 4EMSA 5LRRA 2NYXA 1F5TA 3E6BA 1XDSA 5DDGA 1OPCA 3JW4A 2BYVE 4HDUA 1QNTA 4EJTA 3WTWC 2K7LA 1LQ1A 5AIQA 1R36A 4N9IA 2P8TA 1WWXA 2VN2A 4XLPF 4Y17A 3O2PE 5DYMA 4WK8F 2DQLA 1YYVA 2XIGA 2G7UA 2NNYA 4A6DA 4UUVA 4BNCA 1YFHA 3KEOA 2VOOA 2DI3A 1HKQA 4EJVA 4ZYEA 4DNCA 4LLNA 4BHPA 5D5UB 1ON2A 3JAMZ 1BM9A 5L3GA 3Q5FA 1STZA 1HW2A 3GFJA 2QBYB 3EYIA 3I71A 1XD7A 2A5YB 4I2OA 3ZP5A 3GFMA 3GXOA 3FXRA 4M72A 1HBXG 4Y13A 5EEHA 2ETHA 5FB2A 2ZKZA 2KJBA 4HAMA 3SQNA 2F5DA 3E97A 2HYGD 1Y0UA 3FM3A 2QBYA 2HR3A 3JSOA 1ZAOA 4RB3C 1GVJA 1XDUA 2XAHA 2Z33A 3DP7A 3HRTA 2P5KA 2HWVA 1JHFA 2EV5A 2ESHA 2HGCA 2EFQA 5E1WA 2VBXA 2M87A 1FOKA 3ZMZA 4G7ZF 1D8JA 1G3WA 1DUXC 1HKSA 2FMLA 3SZTA 3C7JA 1KU3A 3O6BB 2ZNYA 5HS8A 5K5QA 3WTSC 2EB7A 1LEBA 4ZH4F 2EFPA 3FM5A 1B9MA 2ELHA 3WTVC 3C1DA 1XGSA 4XSXF 1K6OA 4LK1F 2PG4A 2NNNA 3ROUA 2Z3YA 3TDZC 3N4MA 2MH2A 2G7HA 2FF4A 4ETSA 1USSA 2J5PA 1QBJA 1FSEA 4ENNA 1MDMA 1TNTA 3K0LA 3KP6A 1JE8A 3JSPA 2DBBA 4MTEA 1XN7A 2FNPA 2DK8A 2FU4A 3ISPA 3FWEA 2WV0A 4G7HF 1ZRDA 4PCQA 3LA7A 3KP4A 3R61A 3WGIA 1FLIA 1FC3A 3QP5A 4P96A 3K69A 1OYWA 3HSRA 1P4AA 3KP5A 2NS0A 1ONVA 3CUQA 4OIOF 5CJ9A 4L0YB 1LB2A 1CF7B 2EWNA 2EK5A 3GWZA 5A2QZ 2MLGA 4A12A 3HRMA 4U7BA 3IWFA 1R5HA 1HKTA 6PAXA 4HBLA 1LVAA 5HLGA 1G3YA 3R0JA 2FBIA 4M73A 4I02A 1U2WA 2ESNA 2UXXA 3SZPA 4KUMA 3RIRA 1K78B 1REPC 2FXAA 3BDDA 2DTRA 4LFUA 2VBYA 2FRHA 1ZH5A 4M6YA 4HW0A 5L3BA 4BHCA 4CO8A 4P9FA 3M9AA 1SD7A 3CJNA 1KYWA 3SHFA 1DPRA 1PDNC 1ZGJA 2IPQX 4HF0A 3F8BA 4IHSA 1BI0A 3RYRA 2DK5A 2YPRA 2H09A 4R79A 1DPUA 5BQTA 4K2EA 5D8LB 4RS8A 1ZRFA 1EH7A 4RGUA 1H9TA 1HSTA 2XROA 1KYZA 2UZKA 1I27A 5E8IA 2YU3A 3WTTC 3HRUA 4G7OF 3GX4X 5DUKA 1Z1DA 1EH8A 1FY7A 3ZPLA 1RZ4A 1DP7P 1IN5A 4KN7X 4R8HA 1ZLKA 1B4AA 5EEGA 3LFKA 4DQ2A 4OU0A 4EQQA 1GHCA 2E7XA 2STTA 2J5OA 3CUOA 4P5OA 1U8RA 3ZMDA 1R1TA 2HKOA 2GAUA 1R58A 3LWFA 4GGGA 3W6KB 2D1VA 2RGVA 3S2WA 3BJOA 2V1XA 1KQ0A 4A0YA 2W25A 4AIJA 1FBQA 2HQRA 4R1HA 4HF1A 2D45A 3WGHA 4I01A 1TQPA 5BMZA 3REOA 3WTYC 1F9NA 1XGMA 4M74A 4CZZA 2R3SA 4B8XA 2LDUA 4EGYA 2VC1A 5JFRA 5TRDA 1W7PD 5ICGA 2ZFWA 4AIHA 1U5TC 5DD8A 4IRGA 3JAMK 5KVRA 2QLZA 2OZUA 1GXQA 3FX3A 1S3JA 2BEOA 1WSUA 4UVCA 1BBYA 4HYEA 4UXNA 3F6OA 3HYIA 2QYOA 4AIKA 1TBXA 4ZZDA 1P4WA 1LEAA 3CO7C 2RDPA 5DV5A 1FX7A 3PFIA 4WF2A 1QZYA 3R6SA 5DEQA 4GO1A 2YR2A 1B1BA 2XASA 4KIBA 1OKRA 1Z6RA 2Q0OA 5CVIA 2ACJA 2KRFA 3VEPA 1FYKA 5D6EA 4EJWA 3L2CA 1R1UA 1HW5A 2HTJA 3LAJA 5L3DA 4L9TA 5D8KB 1FP2A 3RI4A 5E17F 4G8XA 3FHZA 2DO7A 2ZXJA 3U9GA 1A04A 4WXHA 2HEOA 4BXUA 2XAGA 2KIUA 1SMTA 4A5NA 1FT9A 4LLLA 4U0YA 1ZREA 2XUBA 2LNBA 3LA3A 5E1XA 3ZN1A 2WWYA 2QQ9A 5J6XA 2HFHA 1ZG1A 3E3VA 4YIIA 2KKOA 3O3KA 1P92A 4WWCA 3RPUA 4U0WA 5ILUA 4LG0A 5HS7A 2HZTA 5D5XB 2TDXA 1YW7A 2FA5A 1JHHA 1I1SA 1MDMB 3IRRA 5DCMB 5LHIA 4L5JA 2CO5A 2L02A 2VOPA 2VXZA 1TW3A 3T8TA 4NQWA 2VC0A 5LHGA 2CW0F 4GXOA 3R4KA 4OMZA 2ZNZA 3LQRA 2IA1A 3F21A 2IA0A 3DXJF 1IW7F 4ON0A 4FX0A 5BOXA 1S7AA 3I4PA 2RV8A 1XGOA 1KGSA 3KFWX 2EFOA 1SAXA 2COMA 1MJAA 4MTDA 1BIAA 4LMYA 1UB9A 3MWMA 2A68F 4MQ9F 4WCGA 2RKHA 3JTGA 3V7SA 3PQKA 2E1CA 3WTZA 3RDIA 2QQBA 1UHWA 1LNWA 2RC4A 4TV7A 4JQFA 2X0LA 2IP2A 1XCBA 2H6CA 1IRGA 2L01A 4EM1A 1YW8A 1LJ9A 3K1NA 3LA2A 2FEZA 3E5UA 4MEYF 1J7KA 5HLIA 3GEZA 4I98B 1W7PA 1VTNC 4ESFA 5BS6A 1JGSA 3F6VA 3L7WA 3FZVA 3VB2A 4G6DA 3QP6A 2XKPA 3HHGA 2OD5A 3CUQB 2L3DA 1MZBA 4XLNF 3E6DA 3TOAA 5DUIA 3DF8A 1GXPA 3QRFF 5HDGA 4CICA 1JXSA 3ULQB 3MZYA 2GXGA 1LDKB 1TTYA 2P5LC 5E18F 1RI7A 3P9CA 3RKWA 1IXRC 3BJ6A 3H92A 1QGPA 4L18B 2RN7A 4IF4A 3J81K 2XVCA 5LGUA 3LAPA 2DPDA 2O61A 3SFZA 3WGGA 2MLKA 3LQQA 4PZJA 2OZ6A 4U0VA 3KP3A 4EVIA 3Q9VA 1OR7A 1USTA 5CVJA 3ZMSA 1R22A 2JPBA 3GO5A 1KA8A 3KEQA 3K2ZA 5JI6A 3HHHA 1TW2A 4NB5A 2P6TA 4ZYDA 4KFCA 1LDJA 3IC7A 1W5TA 2YX7A 1E17A 3J7AO 4U88A 5FD5A 2VBWA 4HQEA 3HTSB 4A2UA 1IF1A 5LBQA 4QWQA 1XCVA 2RVCA 3HOTA 2M45A 4OIRF 3QU6A 2DAOA 1KQ8A 2RQPA 2R7FA 2L4MA 2EV0A 2AS5F 4UV8A 4N0BA 4WXDA 1XGNA 2QM3A 2UXNA 5E20A 5DD4A 5FFXA 2XRNA 2MH9A 3BWGA 4RAYA 4S05A 5H6QA 2P6SA 4ESBA 5FLXK 4RAZA 2C6YA 2Z9OA 2STWA 3QPTA 3T5XA 3KP2A 1Q1HA 4OIQF 1U78A 1Z6TA 4YG2F 3QU3A 4EV0A 2BE5F 3KZYA 2GQQA 1FWZA 2DFIA 2XKOA 4BYYA 5DCMA 1R00A 4F7ZA 3F8FA 2QUFA 5H6RA 5CVUA 1UHMA 2QQAA 3WODF 4XRFA 4ENJA 4B09A 1J75A 4CGZA 2DQRA 4FX4A 1Z7UA 3ML6A 1ODDA 4UV9A 3I58A 2IT0A 1F4KA 1YS6A 3I59A 3GLXA 4KMUX 3HRSA 3BOQA 3RKXA 1RNLA 1P4XA 2ZO4A 3HOSA 4RB0A 5HDKA 1W4MA 3QAHA 4Q4ZF 2ZMEB 2CWEA 1PUEE 2XAJA 4HZFA 1ZG3A 3BZ6A 3TO6A 3W6JB 5HS9A 1BJAA 2CG4A 4MQVA 4ENMA 5KK1A 3FMRA 4QLCU 3OOPA 4M71A 4XSZF 4LG0B 2CGPA 1SD4A 3F8NA 4YIFA 3OV8A 3PQJA 5K5RA 1J2XA 3U1DA 2MA3A 1SFXA 1K7AA 2O6GE 3WG9A 4I09A 2DW4A 5CYVA 1K78A 2H27A 4YFKF 3F22A 2W84A 2K86A 1IXSB 2ISYA 3DV8A 1Z91A 1S7OA 4WXCA 3I5UA 5L3FA 1R1VA 4CXFA 3RYPA 1YIOA 3N97A 3M1EA 2LF7A 2CFXA 2LSOA 1O7LA 2O8XA 2H94A 3IKVA 2ISZA 5LEKA 1B9NA 2H6BA 4AD9A 1TLHB 2DLLA 4A0ZA 2DT5A 1ZYRF 2V1DA 3FMSA 2RNJA 1AOYA 4KYWA 3LSTA 2K02A 1XSVA 3F72A 1IN8A 3DPLC 2NRAC 3M8EA 1HW1A 4UVBA 5JVTA 5BPIA 1YO5C 2ZJ2A 1XB4A 4IRIA 5AONA 1SD6A 2IW5A 1WI9A 1LDDA 1MJBA 2JT1A 2HKXA 1W7PB 2W85A 2E1NA 2JPCA 4OOIA 5CVRA 4ESJA 5FLXZ 5HOOA 2B0LA 2O3FA 3RJPA 2PJPA 2KIFA 2P5VA 3Q9SA 4MEXF 1SMYF 3GUDA 1BIBA 3H3UA 2E7WA 5D4RA 2A3SA 1G4DA 4OINF 2JTVA 4M9SA 2MBFA 4GYIA 3V8LA 2V1UA 2Z99A 3RTRA 4LGWA 4GCVA 4KN4X 4I0BA 3TQNA 1QPMA 1YQAA 2XV4S 1BI1A 3WE3A 4HV6A 2GXBA 4OIPF 2K27A 1WRJA 4Z2YA 3IL2A 5K5OA 2W24A 2A07F 2EV6A 2P7VB 5F1RA 2Y75A 1D5VA 3ERED 3DQVC 1IXCA 1I1GA 1T98A 2PQ8A 3J80K 1YLFA 1BI2A 4KA4A 5FD6A 1CGPA 4M6XA 1PP7U 3BY6A 1IN4A 1IN6A 2DPUA 1O7FA 3V7RA 2OAZA 2QENA 1G3SA 5FGMA 4A6EA 3HIFA 3K1PA 3V8JA 1FBSA 1FNNA 2EA2A 1FZPB 5FFZA 5LGNA 1Z05A 3ECHA 3DKWA 1R23A 4UVAA 4LJZF 4KNYA 4P9UA 4H0EA 3F8CA 4HX7A 3R60A 4Q47A 4L9VA 1S29A 2OBPA 3ABTA 2LKPA 5IT9Z 1U5TB 1HSJA 3K9TA 5CVVA 5F6FA 1FBUA 3IWZA 1J9IA 3WU1B 1L0OC 1QQIA 4HX8A 4RB1A 3TO7A 2BV6A 1U5TA 2EFWA 1QO0D 1KU9A 5D6FA 4PGGA 4L9NA 4MGRA 1D8KA 2XGXA 3J81Z 1XMAA 5ERIA 1U3EM 3P9KA 5J8FA 1SD5A 2EA4A 2NAZA 2YSRA 4KIFA 4RGXA 2Y48A 5CLSA 2F5FA 5L3CA 4FT8A 5LRSA 4Q5SF 4MHGA 4RB2C 2G9WA 4KDPA 4ZYGA 4KT5C 1ZLJA 4ZYHA 1J59A 1ULYA 2BBYA 4EGZA 3MFKA 3I54A 1J5YA 5D5VB 2JRTA 1S8NA 2QVOA 3ZMTA 3RPQA 1TQIA 1ZRCA 4YFNF 1KU7A 3G3ZA 4IPAA 3MEXA 2OQGA 2XHKA 5LHHA 4LK0F 1YG2A 2VBZA 3WE2A 1YW9A 3I64A 1T0FA 3U2RA 2PBIA 3CLOA 4A5MA 1QZZA 3FMQA 4HX4A 3COAC 3KLOA 1F1ZA 2CSOA 3IHUA 3NQOA 3GVAA 2M8EA 1DDNA 3F3XA 3GYHX 1BC7C 5E8GA 1V3FA 3VFZA 3TOBA 3MAJA 2VODA 3IRQA 1NHAA 1EH6A 2D1HA 2PEXA 3J80Z 4CDGA 2P4WA 5LLQA 1ZN2A 2FNAA 2OQRA 1Z9CA 1IRFA 3BPXA 4HLXA 1IZ1A 3ZMVA 5D4SA 4LD5A 3FXUA 1V4RA 5HVQC 3NEUA 4L0ZB 4IRHA 4LB5A 5ICEA 2FOKA 4M9XA 3T1BA 1RUNA 4O6JA 1RUOA 4YFXF 1YTYA 4BAYA 4ZZLA 3B02A 5BPDA 3GZ6A 1UCRA 3AAFA 4AWXB 3K1MA 2OA4A 4HDVA 4LLGF 3QPHA 1XMKA 2GA2A 4KICA 2FE3A 1U6GA 1IN7A 5HLHA 4EM2A 4EM0B 2P7CB 2L4AA 2V79A 3GF2A 2PI0A 3CDHA 2CYYA 4A0XA 1SFUA 2HYFA 3BJAA 4HF2A 5AIPA 3ABUA 2R7DA 1RIOH 3TO9A 1TQMA 1MKMA 5LGTA 4HQMA 3C3WA 3WU0A 2VONA 4JBAA 3T8RA 2GA1A 2V9VA 1B59A 3ZN0A 1W5SA 2UWMA 1P6RA 4O5VA 4EJUA 2Q8KA 1O57A 3FF5A 2YX4A 5E1ZB 1G6NA 3KLNA 1AWCA 1HXDA 5K1YA 3KE2A 2JSCA 1O3RA 1ZARA 3WTXC 4FHTA 2VE8A 3HTUA 4Y15A 4IJAA 3CUQC 2D2WA 4S04A 1KQ9A 2XAFA 5L3EA 3MZHA 3KETA 4HV5A 3EYYA 3RKYA 3D5LA 3HUGA 1MGTA 2WTEA 5J8CA 1YS7A 1T38A 4ASNA 1FYLA 2GZWA 1SFEA 3DFGA 4D0PA 3JTHA 3B73A 4I0AA 2OU2A 2F5CA 1T2KA 4BQAA 3EUHA 3KP7A 2M5WA 4EJOA 1G3TA 1H0MA 2A61A 5H20A 4OMYA 4RGRA 2LF8A 3F23A 2ZBKA 5FO5A 3VODA 1I6XA 3ELKA 4KIGA 5A2QK 1H9GA 3GW2A 3HSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UHT A;  2Y0M A;  1MJ9 A;  3V7C A;  3V4G A;  5DCF A;  2QZ8 A;  2MC3 A;  3TGN A;  3L9F A;  1P2F A;  3C18 A;  5ILS A;  2GWR A;  2PMU A;  4O3M A;  2PLY A;  1X3U A;  1O3S A;  5TJJ A;  1L3L A;  3SXY A;  4G6Q A;  3E6M A;  2K4J A;  5ICC A;  4PDK A;  3BP8 A;  3KCC A;  2ZCW A;  1TNS A;  2L54 A;  2GIV A;  2PMH A;  2FQ3 A;  2ADU A;  2K4B A;  1XSX A;  2JZY A;  1C0W A;  1ZHF A;  5HDN A;  3E6C C;  2O0Y A;  1T39 A;  1D3Y A;  5ICF A;  3BPV A;  1R5G A;  1BI3 A;  2BGC A;  2CQK A;  3ECO A;  4WX9 A;  3MCZ A;  1HQC A;  3L00 A;  4Q48 A;  2KIM A;  3GFL A;  4M9Z A;  2HQN A;  3DEU A;  2M1B A;  2X4H A;  4GYG A;  1FYM A;  1IAW A;  3ZMU A;  1O3Q A;  2Z5U A;  1KU2 A;  3EDP A;  1BC8 C;  1ON1 A;  3TKY A;  4UNO A;  1WKM A;  3EQL F;  3WTU C;  3IKT A;  4KMF A;  1E2X A;  2VE9 A;  1UFM A;  4IXA A;  2HDC A;  4BH9 A;  1FP1 D;  3CTA A;  3ZQ7 A;  5IT9 K;  1S6L A;  3DPT A;  2FBH A;  3E5X A;  5ILV A;  2PN6 A;  5D5W B;  2FBK A;  4IHT A;  5JHU A;  1XSD A;  3V8K A;  4G94 A;  2EFN A;  2IJL A;  2KJC A;  3FXQ A;  2ZME A;  2XAQ A;  1OMI A;  2A6E F;  1BN5 A;  2QWW A;  4U7D A;  2IVM A;  3GZ5 A;  4G9Y A;  2HOE A;  4MNU A;  2FSW A;  2O03 A;  4E70 A;  3I53 A;  5ED4 A;  4CYD A;  4PGH A;  1FPQ A;  2F5E A;  4ENK A;  2WC2 A;  2EJR A;  2A6H F;  4XBF A;  5LEJ A;  3I0T A;  1B6A A;  4BHB A;  4NHJ A;  3R0A A;  2VT3 A;  5F64 A;  1OYY A;  1IUY A;  4HOB A;  3F8M A;  1I5Z A;  3CO6 C;  3D0S A;  1T6S A;  2V6C A;  3G73 A;  3BRO A;  4I7H A;  3H3Z A;  1BOA A;  2AXL A;  3HSF A;  1FSH A;  3TDU C;  4L9J A;  2IA2 A;  3T0Y A;  3KZZ A;  2HS5 A;  3MQ0 A;  2A69 F;  2DU9 A;  1WQ2 A;  2W57 A;  4HLY A;  3GFI A;  3E5Q A;  3I59 B;  2HTS A;  3EET A;  2PFB A;  1O3T A;  2Q2E A;  2IRF G;  1R7J A;  2M30 A;  2FMY A;  1CF7 A;  4P55 A;  3QOP A;  1J0R A;  3NRV A;  2MD5 A;  1K79 A;  4AVP A;  4RGS A;  4CHU A;  5IT3 A;  1ZG5 A;  1MD0 A;  3P7N A;  3L09 A;  1ZGA A;  1OYI A;  3VOE A;  2F2E A;  4IVN A;  5JR3 A;  2VT2 A;  1EV7 A;  3P9I A;  1PP8 F;  4N9H A;  4HA8 A;  3M8F A;  3M7G A;  4LB6 B;  4L5I A;  4JK1 X;  4EMS A;  5LRR A;  2NYX A;  1F5T A;  3E6B A;  1XDS A;  5DDG A;  1OPC A;  3JW4 A;  2BYV E;  4HDU A;  1QNT A;  4EJT A;  3WTW C;  2K7L A;  1LQ1 A;  5AIQ A;  1R36 A;  4N9I A;  2P8T A;  1WWX A;  2VN2 A;  4XLP F;  4Y17 A;  3O2P E;  5DYM A;  4WK8 F;  2DQL A;  1YYV A;  2XIG A;  2G7U A;  2NNY A;  4A6D A;  4UUV A;  4BNC A;  1YFH A;  3KEO A;  2VOO A;  2DI3 A;  1HKQ A;  4EJV A;  4ZYE A;  4DNC A;  4LLN A;  4BHP A;  5D5U B;  1ON2 A;  3JAM Z;  1BM9 A;  5L3G A;  3Q5F A;  1STZ A;  1HW2 A;  3GFJ A;  2QBY B;  3EYI A;  3I71 A;  1XD7 A;  2A5Y B;  4I2O A;  3ZP5 A;  3GFM A;  3GXO A;  3FXR A;  4M72 A;  1HBX G;  4Y13 A;  5EEH A;  2ETH A;  5FB2 A;  2ZKZ A;  2KJB A;  4HAM A;  3SQN A;  2F5D A;  3E97 A;  2HYG D;  1Y0U A;  3FM3 A;  2QBY A;  2HR3 A;  3JSO A;  1ZAO A;  4RB3 C;  1GVJ A;  1XDU A;  2XAH A;  2Z33 A;  3DP7 A;  3HRT A;  2P5K A;  2HWV A;  1JHF A;  2EV5 A;  2ESH A;  2HGC A;  2EFQ A;  5E1W A;  2VBX A;  2M87 A;  1FOK A;  3ZMZ A;  4G7Z F;  1D8J A;  1G3W A;  1DUX C;  1HKS A;  2FML A;  3SZT A;  3C7J A;  1KU3 A;  3O6B B;  2ZNY A;  5HS8 A;  5K5Q A;  3WTS C;  2EB7 A;  1LEB A;  4ZH4 F;  2EFP A;  3FM5 A;  1B9M A;  2ELH A;  3WTV C;  3C1D A;  1XGS A;  4XSX F;  1K6O A;  4LK1 F;  2PG4 A;  2NNN A;  3ROU A;  2Z3Y A;  3TDZ C;  3N4M A;  2MH2 A;  2G7H A;  2FF4 A;  4ETS A;  1USS A;  2J5P A;  1QBJ A;  1FSE A;  4ENN A;  1MDM A;  1TNT A;  3K0L A;  3KP6 A;  1JE8 A;  3JSP A;  2DBB A;  4MTE A;  1XN7 A;  2FNP A;  2DK8 A;  2FU4 A;  3ISP A;  3FWE A;  2WV0 A;  4G7H F;  1ZRD A;  4PCQ A;  3LA7 A;  3KP4 A;  3R61 A;  3WGI A;  1FLI A;  1FC3 A;  3QP5 A;  4P96 A;  3K69 A;  1OYW A;  3HSR A;  1P4A A;  3KP5 A;  2NS0 A;  1ONV A;  3CUQ A;  4OIO F;  5CJ9 A;  4L0Y B;  1LB2 A;  1CF7 B;  2EWN A;  2EK5 A;  3GWZ A;  5A2Q Z;  2MLG A;  4A12 A;  3HRM A;  4U7B A;  3IWF A;  1R5H A;  1HKT A;  6PAX A;  4HBL A;  1LVA A;  5HLG A;  1G3Y A;  3R0J A;  2FBI A;  4M73 A;  4I02 A;  1U2W A;  2ESN A;  2UXX A;  3SZP A;  4KUM A;  3RIR A;  1K78 B;  1REP C;  2FXA A;  3BDD A;  2DTR A;  4LFU A;  2VBY A;  2FRH A;  1ZH5 A;  4M6Y A;  4HW0 A;  5L3B A;  4BHC A;  4CO8 A;  4P9F A;  3M9A A;  1SD7 A;  3CJN A;  1KYW A;  3SHF A;  1DPR A;  1PDN C;  1ZGJ A;  2IPQ X;  4HF0 A;  3F8B A;  4IHS A;  1BI0 A;  3RYR A;  2DK5 A;  2YPR A;  2H09 A;  4R79 A;  1DPU A;  5BQT A;  4K2E A;  5D8L B;  4RS8 A;  1ZRF A;  1EH7 A;  4RGU A;  1H9T A;  1HST A;  2XRO A;  1KYZ A;  2UZK A;  1I27 A;  5E8I A;  2YU3 A;  3WTT C;  3HRU A;  4G7O F;  3GX4 X;  5DUK A;  1Z1D A;  1EH8 A;  1FY7 A;  3ZPL A;  1RZ4 A;  1DP7 P;  1IN5 A;  4KN7 X;  4R8H A;  1ZLK A;  1B4A A;  5EEG A;  3LFK A;  4DQ2 A;  4OU0 A;  4EQQ A;  1GHC A;  2E7X A;  2STT A;  2J5O A;  3CUO A;  4P5O A;  1U8R A;  3ZMD A;  1R1T A;  2HKO A;  2GAU A;  1R58 A;  3LWF A;  4GGG A;  3W6K B;  2D1V A;  2RGV A;  3S2W A;  3BJO A;  2V1X A;  1KQ0 A;  4A0Y A;  2W25 A;  4AIJ A;  1FBQ A;  2HQR A;  4R1H A;  4HF1 A;  2D45 A;  3WGH A;  4I01 A;  1TQP A;  5BMZ A;  3REO A;  3WTY C;  1F9N A;  1XGM A;  4M74 A;  4CZZ A;  2R3S A;  4B8X A;  2LDU A;  4EGY A;  2VC1 A;  5JFR A;  5TRD A;  1W7P D;  5ICG A;  2ZFW A;  4AIH A;  1U5T C;  5DD8 A;  4IRG A;  3JAM K;  5KVR A;  2QLZ A;  2OZU A;  1GXQ A;  3FX3 A;  1S3J A;  2BEO A;  1WSU A;  4UVC A;  1BBY A;  4HYE A;  4UXN A;  3F6O A;  3HYI A;  2QYO A;  4AIK A;  1TBX A;  4ZZD A;  1P4W A;  1LEA A;  3CO7 C;  2RDP A;  5DV5 A;  1FX7 A;  3PFI A;  4WF2 A;  1QZY A;  3R6S A;  5DEQ A;  4GO1 A;  2YR2 A;  1B1B A;  2XAS A;  4KIB A;  1OKR A;  1Z6R A;  2Q0O A;  5CVI A;  2ACJ A;  2KRF A;  3VEP A;  1FYK A;  5D6E A;  4EJW A;  3L2C A;  1R1U A;  1HW5 A;  2HTJ A;  3LAJ A;  5L3D A;  4L9T A;  5D8K B;  1FP2 A;  3RI4 A;  5E17 F;  4G8X A;  3FHZ A;  2DO7 A;  2ZXJ A;  3U9G A;  1A04 A;  4WXH A;  2HEO A;  4BXU A;  2XAG A;  2KIU A;  1SMT A;  4A5N A;  1FT9 A;  4LLL A;  4U0Y A;  1ZRE A;  2XUB A;  2LNB A;  3LA3 A;  5E1X A;  3ZN1 A;  2WWY A;  2QQ9 A;  5J6X A;  2HFH A;  1ZG1 A;  3E3V A;  4YII A;  2KKO A;  3O3K A;  1P92 A;  4WWC A;  3RPU A;  4U0W A;  5ILU A;  4LG0 A;  5HS7 A;  2HZT A;  5D5X B;  2TDX A;  1YW7 A;  2FA5 A;  1JHH A;  1I1S A;  1MDM B;  3IRR A;  5DCM B;  5LHI A;  4L5J A;  2CO5 A;  2L02 A;  2VOP A;  2VXZ A;  1TW3 A;  3T8T A;  4NQW A;  2VC0 A;  5LHG A;  2CW0 F;  4GXO A;  3R4K A;  4OMZ A;  2ZNZ A;  3LQR A;  2IA1 A;  3F21 A;  2IA0 A;  3DXJ F;  1IW7 F;  4ON0 A;  4FX0 A;  5BOX A;  1S7A A;  3I4P A;  2RV8 A;  1XGO A;  1KGS A;  3KFW X;  2EFO A;  1SAX A;  2COM A;  1MJA A;  4MTD A;  1BIA A;  4LMY A;  1UB9 A;  3MWM A;  2A68 F;  4MQ9 F;  4WCG A;  2RKH A;  3JTG A;  3V7S A;  3PQK A;  2E1C A;  3WTZ A;  3RDI A;  2QQB A;  1UHW A;  1LNW A;  2RC4 A;  4TV7 A;  4JQF A;  2X0L A;  2IP2 A;  1XCB A;  2H6C A;  1IRG A;  2L01 A;  4EM1 A;  1YW8 A;  1LJ9 A;  3K1N A;  3LA2 A;  2FEZ A;  3E5U A;  4MEY F;  1J7K A;  5HLI A;  3GEZ A;  4I98 B;  1W7P A;  1VTN C;  4ESF A;  5BS6 A;  1JGS A;  3F6V A;  3L7W A;  3FZV A;  3VB2 A;  4G6D A;  3QP6 A;  2XKP A;  3HHG A;  2OD5 A;  3CUQ B;  2L3D A;  1MZB A;  4XLN F;  3E6D A;  3TOA A;  5DUI A;  3DF8 A;  1GXP A;  3QRF F;  5HDG A;  4CIC A;  1JXS A;  3ULQ B;  3MZY A;  2GXG A;  1LDK B;  1TTY A;  2P5L C;  5E18 F;  1RI7 A;  3P9C A;  3RKW A;  1IXR C;  3BJ6 A;  3H92 A;  1QGP A;  4L18 B;  2RN7 A;  4IF4 A;  3J81 K;  2XVC A;  5LGU A;  3LAP A;  2DPD A;  2O61 A;  3SFZ A;  3WGG A;  2MLK A;  3LQQ A;  4PZJ A;  2OZ6 A;  4U0V A;  3KP3 A;  4EVI A;  3Q9V A;  1OR7 A;  1UST A;  5CVJ A;  3ZMS A;  1R22 A;  2JPB A;  3GO5 A;  1KA8 A;  3KEQ A;  3K2Z A;  5JI6 A;  3HHH A;  1TW2 A;  4NB5 A;  2P6T A;  4ZYD A;  4KFC A;  1LDJ A;  3IC7 A;  1W5T A;  2YX7 A;  1E17 A;  3J7A O;  4U88 A;  5FD5 A;  2VBW A;  4HQE A;  3HTS B;  4A2U A;  1IF1 A;  5LBQ A;  4QWQ A;  1XCV A;  2RVC A;  3HOT A;  2M45 A;  4OIR F;  3QU6 A;  2DAO A;  1KQ8 A;  2RQP A;  2R7F A;  2L4M A;  2EV0 A;  2AS5 F;  4UV8 A;  4N0B A;  4WXD A;  1XGN A;  2QM3 A;  2UXN A;  5E20 A;  5DD4 A;  5FFX A;  2XRN A;  2MH9 A;  3BWG A;  4RAY A;  4S05 A;  5H6Q A;  2P6S A;  4ESB A;  5FLX K;  4RAZ A;  2C6Y A;  2Z9O A;  2STW A;  3QPT A;  3T5X A;  3KP2 A;  1Q1H A;  4OIQ F;  1U78 A;  1Z6T A;  4YG2 F;  3QU3 A;  4EV0 A;  2BE5 F;  3KZY A;  2GQQ A;  1FWZ A;  2DFI A;  2XKO A;  4BYY A;  5DCM A;  1R00 A;  4F7Z A;  3F8F A;  2QUF A;  5H6R A;  5CVU A;  1UHM A;  2QQA A;  3WOD F;  4XRF A;  4ENJ A;  4B09 A;  1J75 A;  4CGZ A;  2DQR A;  4FX4 A;  1Z7U A;  3ML6 A;  1ODD A;  4UV9 A;  3I58 A;  2IT0 A;  1F4K A;  1YS6 A;  3I59 A;  3GLX A;  4KMU X;  3HRS A;  3BOQ A;  3RKX A;  1RNL A;  1P4X A;  2ZO4 A;  3HOS A;  4RB0 A;  5HDK A;  1W4M A;  3QAH A;  4Q4Z F;  2ZME B;  2CWE A;  1PUE E;  2XAJ A;  4HZF A;  1ZG3 A;  3BZ6 A;  3TO6 A;  3W6J B;  5HS9 A;  1BJA A;  2CG4 A;  4MQV A;  4ENM A;  5KK1 A;  3FMR A;  4QLC U;  3OOP A;  4M71 A;  4XSZ F;  4LG0 B;  2CGP A;  1SD4 A;  3F8N A;  4YIF A;  3OV8 A;  3PQJ A;  5K5R A;  1J2X A;  3U1D A;  2MA3 A;  1SFX A;  1K7A A;  2O6G E;  3WG9 A;  4I09 A;  2DW4 A;  5CYV A;  1K78 A;  2H27 A;  4YFK F;  3F22 A;  2W84 A;  2K86 A;  1IXS B;  2ISY A;  3DV8 A;  1Z91 A;  1S7O A;  4WXC A;  3I5U A;  5L3F A;  1R1V A;  4CXF A;  3RYP A;  1YIO A;  3N97 A;  3M1E A;  2LF7 A;  2CFX A;  2LSO A;  1O7L A;  2O8X A;  2H94 A;  3IKV A;  2ISZ A;  5LEK A;  1B9N A;  2H6B A;  4AD9 A;  1TLH B;  2DLL A;  4A0Z A;  2DT5 A;  1ZYR F;  2V1D A;  3FMS A;  2RNJ A;  1AOY A;  4KYW A;  3LST A;  2K02 A;  1XSV A;  3F72 A;  1IN8 A;  3DPL C;  2NRA C;  3M8E A;  1HW1 A;  4UVB A;  5JVT A;  5BPI A;  1YO5 C;  2ZJ2 A;  1XB4 A;  4IRI A;  5AON A;  1SD6 A;  2IW5 A;  1WI9 A;  1LDD A;  1MJB A;  2JT1 A;  2HKX A;  1W7P B;  2W85 A;  2E1N A;  2JPC A;  4OOI A;  5CVR A;  4ESJ A;  5FLX Z;  5HOO A;  2B0L A;  2O3F A;  3RJP A;  2PJP A;  2KIF A;  2P5V A;  3Q9S A;  4MEX F;  1SMY F;  3GUD A;  1BIB A;  3H3U A;  2E7W A;  5D4R A;  2A3S A;  1G4D A;  4OIN F;  2JTV A;  4M9S A;  2MBF A;  4GYI A;  3V8L A;  2V1U A;  2Z99 A;  3RTR A;  4LGW A;  4GCV A;  4KN4 X;  4I0B A;  3TQN A;  1QPM A;  1YQA A;  2XV4 S;  1BI1 A;  3WE3 A;  4HV6 A;  2GXB A;  4OIP F;  2K27 A;  1WRJ A;  4Z2Y A;  3IL2 A;  5K5O A;  2W24 A;  2A07 F;  2EV6 A;  2P7V B;  5F1R A;  2Y75 A;  1D5V A;  3ERE D;  3DQV C;  1IXC A;  1I1G A;  1T98 A;  2PQ8 A;  3J80 K;  1YLF A;  1BI2 A;  4KA4 A;  5FD6 A;  1CGP A;  4M6X A;  1PP7 U;  3BY6 A;  1IN4 A;  1IN6 A;  2DPU A;  1O7F A;  3V7R A;  2OAZ A;  2QEN A;  1G3S A;  5FGM A;  4A6E A;  3HIF A;  3K1P A;  3V8J A;  1FBS A;  1FNN A;  2EA2 A;  1FZP B;  5FFZ A;  5LGN A;  1Z05 A;  3ECH A;  3DKW A;  1R23 A;  4UVA A;  4LJZ F;  4KNY A;  4P9U A;  4H0E A;  3F8C A;  4HX7 A;  3R60 A;  4Q47 A;  4L9V A;  1S29 A;  2OBP A;  3ABT A;  2LKP A;  5IT9 Z;  1U5T B;  1HSJ A;  3K9T A;  5CVV A;  5F6F A;  1FBU A;  3IWZ A;  1J9I A;  3WU1 B;  1L0O C;  1QQI A;  4HX8 A;  4RB1 A;  3TO7 A;  2BV6 A;  1U5T A;  2EFW A;  1QO0 D;  1KU9 A;  5D6F A;  4PGG A;  4L9N A;  4MGR A;  1D8K A;  2XGX A;  3J81 Z;  1XMA A;  5ERI A;  1U3E M;  3P9K A;  5J8F A;  1SD5 A;  2EA4 A;  2NAZ A;  2YSR A;  4KIF A;  4RGX A;  2Y48 A;  5CLS A;  2F5F A;  5L3C A;  4FT8 A;  5LRS A;  4Q5S F;  4MHG A;  4RB2 C;  2G9W A;  4KDP A;  4ZYG A;  4KT5 C;  1ZLJ A;  4ZYH A;  1J59 A;  1ULY A;  2BBY A;  4EGZ A;  3MFK A;  3I54 A;  1J5Y A;  5D5V B;  2JRT A;  1S8N A;  2QVO A;  3ZMT A;  3RPQ A;  1TQI A;  1ZRC A;  4YFN F;  1KU7 A;  3G3Z A;  4IPA A;  3MEX A;  2OQG A;  2XHK A;  5LHH A;  4LK0 F;  1YG2 A;  2VBZ A;  3WE2 A;  1YW9 A;  3I64 A;  1T0F A;  3U2R A;  2PBI A;  3CLO A;  4A5M A;  1QZZ A;  3FMQ A;  4HX4 A;  3COA C;  3KLO A;  1F1Z A;  2CSO A;  3IHU A;  3NQO A;  3GVA A;  2M8E A;  1DDN A;  3F3X A;  3GYH X;  1BC7 C;  5E8G A;  1V3F A;  3VFZ A;  3TOB A;  3MAJ A;  2VOD A;  3IRQ A;  1NHA A;  1EH6 A;  2D1H A;  2PEX A;  3J80 Z;  4CDG A;  2P4W A;  5LLQ A;  1ZN2 A;  2FNA A;  2OQR A;  1Z9C A;  1IRF A;  3BPX A;  4HLX A;  1IZ1 A;  3ZMV A;  5D4S A;  4LD5 A;  3FXU A;  1V4R A;  5HVQ C;  3NEU A;  4L0Z B;  4IRH A;  4LB5 A;  5ICE A;  2FOK A;  4M9X A;  3T1B A;  1RUN A;  4O6J A;  1RUO A;  4YFX F;  1YTY A;  4BAY A;  4ZZL A;  3B02 A;  5BPD A;  3GZ6 A;  1UCR A;  3AAF A;  4AWX B;  3K1M A;  2OA4 A;  4HDV A;  4LLG F;  3QPH A;  1XMK A;  2GA2 A;  4KIC A;  2FE3 A;  1U6G A;  1IN7 A;  5HLH A;  4EM2 A;  4EM0 B;  2P7C B;  2L4A A;  2V79 A;  3GF2 A;  2PI0 A;  3CDH A;  2CYY A;  4A0X A;  1SFU A;  2HYF A;  3BJA A;  4HF2 A;  5AIP A;  3ABU A;  2R7D A;  1RIO H;  3TO9 A;  1TQM A;  1MKM A;  5LGT A;  4HQM A;  3C3W A;  3WU0 A;  2VON A;  4JBA A;  3T8R A;  2GA1 A;  2V9V A;  1B59 A;  3ZN0 A;  1W5S A;  2UWM A;  1P6R A;  4O5V A;  4EJU A;  2Q8K A;  1O57 A;  3FF5 A;  2YX4 A;  5E1Z B;  1G6N A;  3KLN A;  1AWC A;  1HXD A;  5K1Y A;  3KE2 A;  2JSC A;  1O3R A;  1ZAR A;  3WTX C;  4FHT A;  2VE8 A;  3HTU A;  4Y15 A;  4IJA A;  3CUQ C;  2D2W A;  4S04 A;  1KQ9 A;  2XAF A;  5L3E A;  3MZH A;  3KET A;  4HV5 A;  3EYY A;  3RKY A;  3D5L A;  3HUG A;  1MGT A;  2WTE A;  5J8C A;  1YS7 A;  1T38 A;  4ASN A;  1FYL A;  2GZW A;  1SFE A;  3DFG A;  4D0P A;  3JTH A;  3B73 A;  4I0A A;  2OU2 A;  2F5C A;  1T2K A;  4BQA A;  3EUH A;  3KP7 A;  2M5W A;  4EJO A;  1G3T A;  1H0M A;  2A61 A;  5H20 A;  4OMY A;  4RGR A;  2LF8 A;  3F23 A;  2ZBK A;  5FO5 A;  3VOD A;  1I6X A;  3ELK A;  4KIG A;  5A2Q K;  1H9G A;  3GW2 A;  3HSE A; 
#chains in the Genus database with same CATH topology
 2LVS A;  4UHT A;  2Y0M A;  2ME6 A;  2VQG A;  1MJ9 A;  2E60 A;  4F55 A;  3V7C A;  3V4G A;  5DCF A;  2LRD A;  2QZ8 A;  3VYS B;  2MC3 A;  3H0D A;  3TGN A;  5GPA A;  3L9F A;  1P2F A;  1T0F C;  5EYR A;  4NUB A;  4BQQ A;  3C18 A;  5ILS A;  1ETV A;  4XON A;  4XIC A;  4D7M A;  2KZG A;  2GWR A;  2WV1 A;  2PMU A;  3L2Q A;  3ZQC A;  4FQG A;  2IBD A;  2W4S A;  3HEF A;  4GRI A;  3K4B A;  4O3M A;  2PLY A;  1X3U A;  4E6K G;  1O3S A;  2L2O A;  5TJJ A;  1QHH D;  1L3L A;  3SXY A;  4G6Q A;  3IH4 A;  1IG7 A;  3E6M A;  3IH3 A;  2PMZ A;  3JRH A;  2K4J A;  5ICC A;  3OOU A;  4PDK A;  3BP8 A;  2KFD A;  2UUZ A;  3KCC A;  1D1B A;  3C2G A;  4BAC A;  2ZCW A;  1TNS A;  4L5E A;  4YRV A;  2JJ7 A;  2L54 A;  2GIV A;  2PMH A;  3OYM A;  3C2B A;  2FQ3 A;  2ADU A;  2EIL H;  2IGO A;  2K4B A;  1XSX A;  1K83 J;  2IXS A;  2JZY A;  3ZCO A;  2H8W A;  1C0W A;  1ZHF A;  1U8B A;  3I9V 2;  3KYD B;  2LR8 A;  4RAF A;  2JA7 J;  3NWS A;  5HDN A;  3E6C C;  5IP7 J;  2O0Y A;  1T39 A;  1D3Y A;  2X6X A;  5ICF A;  3S32 A;  3BPV A;  1R5G A;  3BLY A;  1BI3 A;  1X3W B;  4BBR J;  3BC8 A;  2IAI A;  1FIP A;  2LY1 A;  3ZR8 X;  3M1C A;  2BGC A;  3MKZ A;  2CQK A;  2VJJ A;  3PM1 A;  3ECO A;  4WX9 A;  3MCZ A;  1HQC A;  3CD6 I;  3L00 A;  1K61 A;  4Q48 A;  1T95 A;  2KIM A;  4BKX A;  2DYS H;  3GFL A;  1A35 A;  3RPU D;  3HC7 A;  3OYI A;  4M9Z A;  2HQN A;  3DEU A;  2M1B A;  2X4H A;  3LSI A;  5FKK A;  4GYG A;  3CME I;  3ZQL A;  1TT5 B;  1FYM A;  1IAW A;  1Y8R B;  3ZMU A;  2EH3 A;  4IZZ A;  1O3Q A;  1K4T A;  2Z5U A;  1KU2 A;  3EDP A;  2OTJ I;  1OIS A;  1BC8 C;  2KLO A;  3FBN B;  1ON1 A;  3TKY A;  3GTJ J;  4HNU A;  1OCT C;  4UNO A;  4AM3 A;  1WKM A;  3EQL F;  1TP4 A;  3WTU C;  3IKT A;  4KMF A;  1E2X A;  2L9S A;  2VE9 A;  1UFM A;  4ZTJ A;  3CCM I;  1Q1V A;  2HXI A;  2CW7 A;  4IXA A;  2HDC A;  1PYV A;  4BH9 A;  2CV1 A;  1FP1 D;  3CTA A;  3ZQ7 A;  3CJT B;  2ZJR F;  2V7F A;  2E34 A;  1MSF C;  3CCJ I;  3LSG A;  5IT9 K;  1S6L A;  3DPT A;  2FBH A;  3W3C A;  4E7S A;  5J1Y A;  3PNV A;  3E5X A;  5ILV A;  2V9P A;  2L7F P;  2HDW A;  2PN6 A;  3M8J A;  5D5W B;  2R0Q C;  1ACI A;  2CFO A;  2FBK A;  4IHT A;  5JHU A;  3ZQH A;  1XSD A;  3I56 I;  3X2Q H;  3S1Q J;  1RC9 A;  3V8K A;  4G94 A;  2EFN A;  4PFP A;  2IJL A;  3K70 C;  3BTL A;  2KJC A;  2DMU A;  1DU6 A;  4A3M J;  3FXQ A;  3OY9 A;  3W2V A;  2ZME A;  5DM7 F;  2XAQ A;  1OMI A;  2A6E F;  2CH0 A;  5IYD J;  1SC7 A;  1BN5 A;  2QWW A;  2X1E A;  2FQ4 A;  4U7D A;  1HDD C;  3GZN B;  4NC6 A;  2IVM A;  3GZ5 A;  4G9Y A;  4D7N A;  2ZC2 A;  3EUA A;  2HOE A;  4MNU A;  1CQT A;  1XS9 A;  2FSW A;  4PK4 A;  5BNG A;  2O03 A;  3K4C A;  4E70 A;  3I53 A;  5ED4 A;  4CYD A;  4PGH A;  1FPQ A;  3BG9 A;  2F5E A;  4ENK A;  2WC2 A;  2EJR A;  4OWR B;  1W0U A;  1HCR A;  2A6H F;  2VKH A;  2Z1D A;  4XBF A;  2E2J J;  2KIQ A;  5LEJ A;  1VQL I;  3I0T A;  1B6A A;  1DGW Y;  4BHB A;  3CCS I;  4NHJ A;  3OYJ A;  5EG0 B;  3OYG A;  3R0A A;  2IS4 A;  2VT3 A;  2QSH X;  4MFD A;  1D0X A;  5F64 A;  4BEH A;  1OYY A;  1IUY A;  4HOB A;  3CMM A;  5C4J J;  2V4J C;  2KQR A;  2QGU A;  3BR1 A;  2EIK H;  2DA6 A;  3F8M A;  1I5Z A;  4HG2 A;  3FXJ A;  3AG2 H;  3CO6 C;  2DJN A;  1BR1 A;  3D0S A;  1T6S A;  3HOV J;  3FBI B;  2V6C A;  3G73 A;  3ZQQ A;  3BRO A;  2DA4 A;  4I7H A;  2HVS A;  3DTK A;  1BW5 A;  3H36 A;  3H3Z A;  1BOA A;  2AXL A;  3HSF A;  4XOP A;  1FSH A;  2K5C A;  2XF5 A;  3OYH A;  4A3E J;  3TDU C;  4L9J A;  2IA2 A;  4QSH A;  3T0Y A;  3KZZ A;  3PNY A;  2HS5 A;  1R9T J;  3HPG A;  3S93 A;  3JRI A;  4CZC A;  1TZL A;  3MQ0 A;  3ASN H;  2A69 F;  2DU9 A;  1X1C A;  1WQ2 A;  1N78 A;  3HBL A;  4C3J J;  3HG9 A;  4BQO A;  2W57 A;  4HLY A;  1YX3 A;  3GFI A;  3E5Q A;  3I59 B;  3TMO A;  5KNL A;  1YJW I;  2H8R A;  4BJT A;  4QPO A;  3VSL A;  2HTS A;  3EET A;  2CUJ A;  3G6E I;  2K85 A;  2PFB A;  1O3T A;  2Q2E A;  2IRF G;  2KRH A;  1R7J A;  2M30 A;  4XLF A;  2FMY A;  4C2M J;  1CF7 A;  4P55 A;  3QOP A;  3FXM A;  3O8G A;  1R5I D;  1Z3X A;  1J0R A;  1YJ9 I;  4BBS J;  3NRV A;  3H0G J;  4PJN A;  2ZFU A;  5F04 A;  4AU7 A;  3OR1 C;  2MD5 A;  3C2H A;  1GDT A;  1K79 A;  4AVP A;  4RGS A;  4CHU A;  4IEJ A;  2W82 A;  3E0J B;  5IT3 A;  1ZG5 A;  1MD0 A;  3P7N A;  4PSX A;  1WPK A;  2A5W A;  3UKG A;  3L09 A;  4AYB N;  1ZGA A;  1OYI A;  3VOE A;  2F2E A;  4IVN A;  2YU9 J;  5JR3 A;  2EPF A;  2E2H J;  4B4C A;  4J19 A;  2JVG A;  2V9K A;  1IRX A;  2VT2 A;  3G4S I;  2ELJ A;  1EV7 A;  3P9I A;  1PP8 F;  2DFE A;  4HA8 A;  4N9H A;  2IS1 A;  1R4N B;  4BQN A;  3M8F A;  3M7G A;  2LBF B;  4LB6 B;  2NVX J;  4L5I A;  1IV6 A;  2QA4 I;  4JK1 X;  4EMS A;  5LRR A;  2NYX A;  2DA7 A;  3E6B A;  1SFO J;  1F5T A;  3ZXS A;  2F5V A;  4UUS B;  1XDS A;  3KX2 A;  2IGN A;  2K3P A;  1E3O C;  5DDG A;  2BY0 A;  2ECC A;  1OPC A;  3BZC A;  3JW4 A;  2BYV E;  4HDU A;  1QNT A;  3PO2 J;  3A1Y A;  2JRM A;  3DLA A;  4EJT A;  1PJR A;  3WTW C;  3LNQ A;  2K7L A;  4F52 A;  1LQ1 A;  2CS3 A;  5AIQ A;  3NAR A;  1R36 A;  4N9I A;  2P8T A;  1WWX A;  1MND A;  2VN2 A;  4XLP F;  4Y17 A;  3GTK J;  3O2P E;  4C2T A;  5DYM A;  3PSI A;  2DQL A;  4WK8 F;  5F0F A;  1YYV A;  2XIG A;  1LE8 A;  2G7U A;  4HST A;  4MLO A;  2NNY A;  4A6D A;  4UUV A;  3G1L A;  4BNC A;  2MC4 A;  1YFH A;  3DBH B;  3A01 B;  3KEO A;  3OS0 A;  1W36 D;  1FTT A;  3ZQI A;  3RCO A;  2VOO A;  2DI3 A;  2DT6 A;  3I3L A;  1HKQ A;  3IAM 2;  4EJV A;  4ZYE A;  5C3E J;  1R49 A;  1LFU P;  3CC7 I;  4DNC A;  4LLN A;  4M3D A;  4BHP A;  2W7N A;  2XGC A;  5D5U B;  1ON2 A;  3JAM Z;  5B3S H;  1BM9 A;  1TWF J;  1TL8 A;  4IHV A;  5L3G A;  3Q5F A;  1STZ A;  1HW2 A;  3GFJ A;  2QBY B;  3EYI A;  3I71 A;  2JUG A;  2LKS A;  1XD7 A;  2A5Y B;  3VYR B;  2IGM A;  2DN0 A;  2VJI A;  4I2O A;  3ZP5 A;  3GFM A;  3E7L A;  3VYU B;  2L9V A;  4B43 A;  3GXO A;  3FXR A;  2R7Q A;  4M72 A;  3H9Q A;  3QYB A;  1HBX G;  4AYB A;  4Y13 A;  4V19 K;  5EEH A;  2ETH A;  5FB2 A;  1A36 A;  2ZKZ A;  2KJB A;  4HAM A;  4XRS A;  4E7J A;  4MO7 A;  3SQN A;  2HI3 A;  2Y31 A;  1B72 B;  2F5D A;  3E97 A;  3FHN A;  3CF5 F;  4CA0 A;  1LFP A;  2HYG D;  1Y0U A;  2EIN H;  3FM3 A;  2QBY A;  2HR3 A;  4BL0 B;  4ITV A;  4II2 A;  3JSO A;  1PVE A;  2VPL A;  3RKQ A;  1MBG A;  1ZAO A;  5K7H A;  4RB3 C;  2MD0 A;  3TP0 A;  1OCZ H;  1GVJ A;  4FET A;  1XDU A;  2FOW A;  2XAH A;  2Z33 A;  3DP7 A;  3HRT A;  2BW3 A;  2P5K A;  3PIP F;  2HWV A;  2K9L A;  1JHF A;  2EV5 A;  4DYR A;  2ESH A;  2HGC A;  2EFQ A;  5E1W A;  2VBX A;  1VQP I;  1ZKG A;  1GVD A;  2M87 A;  1FOK A;  3ZMZ A;  2X1D A;  4G7Z F;  1D8J A;  1G3W A;  1DUX C;  1HKS A;  1MMA A;  2FML A;  3MZ8 A;  3A03 A;  4KJZ A;  3SZT A;  3C7J A;  1FOY A;  1KU3 A;  3O6B B;  2ZNY A;  3B6A A;  5HS8 A;  3OL3 A;  5F1J A;  4U87 A;  2ZSH B;  5K5Q A;  2EB7 A;  2OV7 A;  5K7Z A;  5IYC J;  3WTS C;  4ZH4 F;  1LEB A;  3FM5 A;  2EFP A;  4M3E A;  1B9M A;  2ELH A;  3WTV C;  3C1D A;  4LIT A;  1XGS A;  3L2R A;  4XSX F;  1K6O A;  4LK1 F;  2KZV A;  2PG4 A;  2RNG A;  2NNN A;  4CCJ A;  3HDD A;  1ZTR A;  1WFX A;  3ROU A;  2Z3Y A;  3TDZ C;  3CCR I;  2M4G A;  3N4M A;  1X19 A;  2MH2 A;  1VFC A;  2G7H A;  5DM6 F;  1EA3 A;  1I3A A;  4C3I J;  2LY2 A;  2FF4 A;  1RKT A;  4ETS A;  1MMS A;  4E7Z A;  2DA3 A;  1USS A;  2NVY J;  2J5P A;  4CSW A;  5TGT A;  4Z6Y A;  1QBJ A;  2QF7 A;  3H1C A;  3EPZ A;  1FSE A;  2HVQ A;  2HYJ A;  4ENN A;  1MDM A;  1TNT A;  3K0L A;  4E7I A;  4JX4 A;  3KP6 A;  2B7E A;  1JE8 A;  3JSP A;  4CYC B;  3FK7 A;  2XPW A;  2Y9Y A;  2DBB A;  2M7B A;  4LG3 A;  5CQG A;  3HOX J;  4MTE A;  4IHW A;  4BUP A;  1XN7 A;  2FNP A;  2DK8 A;  2FU4 A;  4D9J A;  3ISP A;  3FWE A;  2XRL A;  4W1U A;  1GV2 A;  1D5Y A;  3WHC A;  2WV0 A;  4G7H F;  1ZRD A;  4PSW A;  3W6V A;  1LFB A;  3BTI A;  4PCQ A;  3LA7 A;  4MFE A;  1VQ4 I;  3KP4 A;  2ZXW H;  3R61 A;  1JUM A;  4F93 B;  2BZT A;  3WGI A;  1WZ2 A;  1FLI A;  4BXX J;  1NK2 P;  3BTJ A;  5KHD A;  1G2H A;  2BW3 B;  1P7I A;  1FC3 A;  4XRM A;  3QP5 A;  4P96 A;  3JRD A;  3ONQ A;  3K69 A;  4CCM A;  4P1W A;  2F6C A;  1OYW A;  3HSR A;  1P4A A;  3KP5 A;  2NS0 A;  1ONV A;  1FOW A;  2OPT A;  1RRJ A;  3W2A A;  4A3G J;  3CUQ A;  4OIO F;  4IOC F;  5CJ9 A;  4L0Y B;  1B72 A;  2BHZ A;  1LB2 A;  2M9H A;  1CF7 B;  1A6Q A;  2EWN A;  2EK5 A;  3GWZ A;  5A2Q Z;  2MLG A;  4A12 A;  4IO9 F;  3HRM A;  2L5Q A;  4U7B A;  3IWF A;  2MW8 A;  1R5H A;  1HKT A;  2ZJQ F;  3CZ6 A;  6PAX A;  3S1M J;  4HBL A;  3BTC A;  1LVA A;  5HLG A;  1G3Y A;  3I55 I;  1ZGW A;  2XF6 A;  3OR2 C;  3R0J A;  3ZRG A;  2XPU A;  2FBI A;  4UB6 C;  2O8K A;  2CQQ A;  4M3B A;  4M73 A;  4XLH A;  3OYB A;  3DBL B;  4I02 A;  1GLN A;  1U2W A;  3I4M J;  4B47 A;  3OIO A;  2VL8 A;  3K4K A;  2ESN A;  2UXX A;  3SZP A;  4KUM A;  4NDL A;  1Y56 A;  3RIR A;  1K78 B;  3S3O A;  1REP C;  2FXA A;  1QRY A;  3BDD A;  2DTZ A;  2XB5 A;  2DTR A;  4LFU A;  2VBY A;  2R5Y B;  2FRH A;  4XM3 A;  2E5Z A;  4XOR A;  1ZH5 A;  4M6Y A;  4HW0 A;  5L3B A;  4BHC A;  1YHQ I;  4CO8 A;  3K4M A;  3M9A A;  1SD7 A;  4P9F A;  2R7R A;  3QPS A;  3CJN A;  1KYW A;  3SHF A;  1DPR A;  1VQ8 I;  3RZO J;  1PDN C;  1ZGJ A;  2IPQ X;  4HF0 A;  3F8B A;  2NS8 A;  1BI0 A;  3D5R C;  4IHS A;  3RYR A;  1A6I A;  2DK5 A;  2YPR A;  2BOL A;  2H09 A;  3HZJ A;  1U0J A;  3FK6 A;  1MNM C;  4IHX A;  2OUM A;  3FIS A;  4R79 A;  1ZR4 A;  1DPU A;  5BQT A;  4K2E A;  1ORK A;  2HXO A;  5D8L B;  3CC2 I;  4RS8 A;  1EH7 A;  1ZRF A;  4RGU A;  1H9T A;  1HST A;  2DFF A;  2XRO A;  1KYZ A;  5IY5 H;  1I27 A;  2UZK A;  1JKP C;  5E8I A;  2YS9 A;  5M5Y J;  1SFK A;  4A3K J;  2YU3 A;  3WTT C;  1QPI A;  3D5S C;  3HRU A;  4G7O F;  4PJL A;  2Z16 A;  4B44 A;  1ERD A;  3GX4 X;  5DUK A;  5GTI C;  1OJL A;  1Z1D A;  3EUK L;  1MMD A;  1EH8 A;  4XN0 A;  1FY7 A;  3ZPL A;  1WH7 A;  4B3X A;  1HOM A;  5J1U A;  1RZ4 A;  3MD2 A;  1DP7 P;  1IN5 A;  4KN7 X;  4R8H A;  3OYE A;  1ZLK A;  1B4A A;  5EF6 A;  5EEG A;  3LFK A;  4DQ2 A;  3DKY A;  2E5N A;  4OU0 A;  4EQQ A;  1GHC A;  2R7U A;  2E7X A;  5E3M A;  2STT A;  3M4O J;  2J5O A;  3CUO A;  4P5O A;  2K3F A;  1U8R A;  1MMN A;  3ZMD A;  1R1T A;  2HKO A;  3ABK H;  3CCL I;  4XK4 A;  5GAG J;  2AO9 A;  5EEA A;  1R71 A;  4FTH A;  4J00 A;  2GAU A;  3PFY A;  3FIW A;  1UEL B;  1R58 A;  2BY3 A;  2P81 A;  3LWF A;  4GGG A;  4QTR A;  4BE1 A;  3W6K B;  3LOC A;  2D1V A;  2RGV A;  1JT0 A;  2IEK A;  3S2W A;  4YEL A;  3BJO A;  2V1X A;  1KQ0 A;  4A0Y A;  3RQ4 A;  2W25 A;  4Y4R A;  4AIJ A;  2DFH A;  1GV5 A;  1FBQ A;  2Y9Z A;  2HQR A;  1LUJ B;  3G71 I;  4R1H A;  4UB8 C;  2HDD A;  2BHY A;  4HF1 A;  2D45 A;  5H2F C;  2IS2 A;  2CQX A;  1X58 A;  3Q0W A;  1TQP A;  4I01 A;  3WGH A;  5BMZ A;  2R93 J;  3BCA A;  3REO A;  3WTY C;  5M3F J;  1JTX A;  1F9N A;  3BZK A;  1JKO C;  2CV0 A;  1XGM A;  4M74 A;  4CZZ A;  2PJR B;  1J09 A;  2R3S A;  4QPQ A;  3OYD A;  4B8X A;  3SJM A;  2LDU A;  3PUF A;  4EGY A;  1H88 C;  2VC1 A;  4DZP A;  5JFR A;  5TRD A;  1W7P D;  4JX6 A;  1PUF A;  3SEQ A;  5ICG A;  2ZFW A;  4CCK A;  2QEX I;  1W1W E;  2L7M P;  4AIH A;  3JRF A;  1U5T C;  1V54 H;  2DCE A;  5DD8 A;  4IRG A;  3JAM K;  5KVR A;  2QLZ A;  2OZU A;  5TIS C;  1GXQ A;  3FX3 A;  3PJR A;  1S3J A;  2BEO A;  1DQU A;  1WSU A;  4UVC A;  3BQZ A;  1BBY A;  4HYE A;  5J3L A;  4UXN A;  3F6O A;  3HYI A;  3K70 D;  2R7T A;  3KPH A;  4BE2 A;  2QYO A;  4EAT A;  1ETW A;  4F92 B;  4BS9 A;  4AIK A;  4BDZ A;  4D1Q A;  1XC5 A;  1HDP A;  1YX5 A;  1TBX A;  4ZZD A;  1P4W A;  5IOY A;  1QHG A;  5IP9 J;  1QA6 A;  3OS1 A;  4FIS A;  2K9S A;  1LEA A;  5LFA A;  3CO7 C;  3HXL A;  2RDP A;  1MBF A;  2QQ8 A;  5DV5 A;  5C44 J;  1FX7 A;  3AG1 H;  2OJE D;  3PFI A;  2DOD A;  4WF2 A;  1QVU A;  1QZY A;  2ZXI A;  1BR2 A;  5DEQ A;  3R6S A;  4GO1 A;  4XN3 A;  2YR2 A;  4C9Y A;  1IC8 A;  1JUS A;  1B1B A;  2XAS A;  4KIB A;  1OKR A;  1Z6R A;  2FJ1 A;  2Q0O A;  5CVI A;  2ACJ A;  5DTD A;  2KRF A;  2DA1 A;  3CMY A;  3LSJ A;  4Y3O A;  1FJL A;  3CQZ J;  3VEP A;  3RQI A;  1FYK A;  2LMD A;  5D6E A;  1K6Y A;  4EJW A;  3L2C A;  4FAS D;  1JI8 A;  5HOD A;  2E1O A;  5GAE J;  3LSP A;  1R1U A;  1HW5 A;  2HTJ A;  3LAJ A;  5L3D A;  3OIQ A;  4L9T A;  5D8K B;  1G59 A;  1FP2 A;  2DXI A;  1W0T A;  1RES A;  3RI4 A;  4IHY A;  5E17 F;  4G8X A;  3FHZ A;  4BU2 A;  2DO7 A;  2ZXJ A;  1RET A;  1V5G A;  3U9G A;  1A04 A;  4WXH A;  3DLL F;  3HGY A;  2OC6 A;  2WAQ N;  2HEO A;  3BR5 A;  4BXU A;  3OYK A;  2XAG A;  2KIU A;  5E3L A;  1Z77 A;  2GLO A;  1MBE A;  1SMT A;  2M0C A;  1FEX A;  3B6C A;  3P5J A;  4JYK A;  3QQA A;  4A5N A;  1ZR2 A;  1FT9 A;  4LLL A;  1V55 H;  4U0Y A;  1ZRE A;  2XUB A;  2LY9 A;  2LNB A;  1WJD A;  1ENH A;  2WB1 N;  3LA3 A;  5E1X A;  3SDG A;  1X2M A;  2BY2 A;  3ZN1 A;  2QQ9 A;  5J6X A;  2WWY A;  2HFH A;  3K4N A;  1ZG1 A;  4V2G A;  3E3V A;  2MYS A;  4YII A;  2GM4 A;  2KKO A;  4RM2 A;  3O3K A;  1UHS A;  1P92 A;  2KIS A;  4WWC A;  2IS6 A;  2KDO A;  2VQL A;  3RPU A;  4U0W A;  5ILU A;  4ZC3 A;  4LG0 A;  2VKV A;  2RAE A;  5HS7 A;  3K7A J;  2HZT A;  2K9N A;  3QOE A;  2PX9 A;  5FLV A;  5D5X B;  3DU6 A;  3BR6 A;  2TDX A;  3BT9 A;  1XG1 A;  2XPV A;  2JA8 J;  1YW7 A;  2DMN A;  3L2U A;  4ANJ A;  2FA5 A;  5JLW A;  1JHH A;  2LH9 A;  1OCR H;  1I1S A;  1MDM B;  3IRR A;  5DCM B;  3LSK A;  5LHI A;  2JMW A;  1S9H A;  1HC8 A;  4L5J A;  2CMP A;  1O4X A;  4HNT A;  2ECB A;  2CO5 A;  2L02 A;  2VOP A;  3TW6 A;  2VXZ A;  3CP8 A;  1TW3 A;  1OR7 C;  3T8T A;  2JN6 A;  4NQW A;  2VC0 A;  3S3M A;  5LHG A;  2HOT A;  4IQJ A;  2CW0 F;  4GXO A;  4N4N B;  2O7O A;  3R4K A;  1X4P A;  2WAQ A;  4OMZ A;  2ZNZ A;  4JX5 A;  2WA0 A;  3LQR A;  2IA1 A;  4ZDL A;  4UUT A;  2RQQ A;  4A3I J;  1DGR M;  5EZH A;  3F21 A;  1TWG J;  2I10 A;  1GT0 C;  4RM3 A;  5KAI C;  2IA0 A;  3DXJ F;  1FOX A;  1LVK A;  2CQN A;  2HOS A;  1IW7 F;  4ON0 A;  4FX0 A;  5BOX A;  1X1P A;  1E0E A;  3S1N J;  2M4K A;  3NAU A;  2JSP A;  1YOV B;  4DYC A;  1S7A A;  4HSR A;  1I50 J;  2DDA A;  2RV8 A;  3I4P A;  3OIP A;  1XGO A;  1KGS A;  3KFW X;  2BXY A;  2EFO A;  4PJJ A;  1SAX A;  3H5N A;  2COM A;  1MJA A;  4MTD A;  1BIA A;  2CRG A;  4DJA A;  3KYL A;  1N77 A;  3IV5 A;  1QVT A;  2DYR H;  4LMY A;  1W36 C;  4NC8 A;  4DIQ A;  1UB9 A;  3CJR B;  3MWM A;  4BJ5 C;  2A68 F;  1S72 I;  4MQ9 F;  4WCG A;  2RKH A;  3JTG A;  3V7S A;  4A3B J;  3PQK A;  3MKW B;  2E1C A;  3WTZ A;  3RDI A;  2QQB A;  1UHW A;  4XQF A;  1LNW A;  3WHB A;  2RC4 A;  1AKH B;  2HQA A;  2LP0 A;  4AUX A;  4TV7 A;  1B8I B;  4JQF A;  2X0L A;  2IP2 A;  1XCB A;  2H6C A;  5J47 A;  1IRG A;  2L01 A;  4EM1 A;  1YW8 A;  1LJ9 A;  3K1N A;  1SVM A;  2VIX A;  4W97 A;  3JRC A;  1WGX A;  3S14 J;  3LA2 A;  1B8I A;  2FEZ A;  3E5U A;  4MEY F;  1HLV A;  1AKH A;  4C3H J;  5E3O A;  1J7K A;  3VYT B;  4DBQ A;  5HLI A;  3GEZ A;  5JLX A;  4I98 B;  1W7P A;  4RBO A;  5M3M J;  5KCM A;  1VTN C;  1WH5 A;  2HPI A;  2YUS A;  4ESF A;  5HNH A;  1T33 A;  5BS6 A;  1K4S A;  2K9Q A;  3SEZ A;  1JGS A;  1WI3 A;  1VQ9 I;  3ASO H;  2JUC A;  2CU7 A;  1LE8 B;  3BG3 A;  1ZQ3 P;  5GPC A;  3Q0V A;  5FRM A;  2VJ5 A;  3GTP J;  2WAD A;  3F6V A;  3L7W A;  4NC7 A;  4B48 A;  2JA5 J;  3FZV A;  3VB2 A;  4G6D A;  4XKW A;  3S16 J;  2W1O A;  3QP6 A;  3GTM J;  2XKP A;  3GTQ J;  3HHG A;  1D0Y A;  2OD5 A;  2QKM B;  4KIT B;  3CUQ B;  2W48 A;  2L3D A;  1MZB A;  2LYC A;  4XLN F;  1P9Q C;  3E6D A;  3TOA A;  5DUI A;  5B5E C;  3DF8 A;  1GXP A;  3QRF F;  4NNJ A;  1VF9 A;  5HDG A;  2FX0 A;  4CIC A;  3TED A;  3ULQ B;  1JXS A;  3MZY A;  2GXG A;  1LDK B;  1TTY A;  2E1M B;  1OFC X;  2P5L C;  5E18 F;  2KT0 A;  3V42 A;  2GOM A;  2X6Y A;  1RI7 A;  3K2A A;  3QYE A;  3P9C A;  3RKW A;  1IXR C;  2X9D A;  2WAF A;  3BJ6 A;  3H92 A;  2M34 A;  4XMY A;  1QGP A;  3J7Z I;  4LIV A;  1ZK8 A;  4L18 B;  1UMQ A;  2RN7 A;  4C2U A;  4IF4 A;  4DW6 A;  3LSH A;  2XVC A;  5LGU A;  3J81 K;  3LAP A;  2DPD A;  2O61 A;  3SFZ A;  3WGG A;  1HF0 A;  1WJ5 A;  3U1K A;  1S7E A;  2MLK A;  3LQQ A;  4PZJ A;  4F3Q A;  4IOA F;  2OZ6 A;  2O9L A;  2R4G A;  1JJ6 C;  2F4I A;  4U0V A;  1FIA A;  1BW6 A;  2DJI A;  1OCO H;  2GBY A;  3KP3 A;  4EVI A;  3Q9V A;  3J7A Y;  1OR7 A;  2EIM H;  1X3Z B;  3OWT A;  1YIT I;  4E7H A;  1XX5 A;  1UST A;  5CVJ A;  3ZMS A;  1R22 A;  3ZGK A;  2HNH A;  2W00 A;  2JPB A;  3GO5 A;  1KA8 A;  4FE4 A;  3KEQ A;  3K2Z A;  2QCO A;  2E19 A;  3H3V K;  5JI6 A;  1KZH A;  3HHH A;  1OLT A;  1TW2 A;  2X48 A;  2P6T A;  4NB5 A;  4ZYD A;  1NK3 P;  1MH4 A;  4I76 A;  4KFC A;  1WJB A;  1LDJ A;  3IC7 A;  1W5T A;  4EEF G;  2YX7 A;  1FTZ A;  3M07 A;  1E17 A;  2I8D A;  3J7A O;  5FKL A;  3DTI A;  4KT6 A;  4U88 A;  4J01 A;  5FD5 A;  2VBW A;  4HQE A;  3EUH C;  3HTS B;  2Q1Z B;  1D1A A;  2EZK A;  5J4Y A;  3A4C A;  4A2U A;  1IF1 A;  3SDB A;  5K7F A;  5LBQ A;  3Q3S A;  4QWQ A;  2ID3 A;  2P0W A;  2TCT A;  1XCV A;  4X6A J;  2RVC A;  2NVQ J;  3HOT A;  3S17 J;  2M45 A;  4A93 J;  4OIR F;  1WVR A;  3BR3 A;  3QU6 A;  2DAO A;  1KQ8 A;  2RQP A;  3K4J A;  2R7F A;  2L7Z A;  1MNE A;  4BXF A;  1T8I A;  2L4M A;  2EV0 A;  1SAN A;  4MIM A;  2AS5 F;  4CUG A;  4UV8 A;  5FKM A;  4N0B A;  4A3C J;  4WXD A;  1KON A;  1XGN A;  2WY7 Q;  2QM3 A;  2Y69 H;  3CLQ A;  2UXN A;  5E20 A;  5DD4 A;  5FFX A;  3CF2 A;  4XL9 A;  3MKY B;  3S2D J;  2XRN A;  2MH9 A;  2XDV A;  2WB1 A;  3JCU C;  3BWG A;  4RAY A;  1SAU A;  4DGW B;  4S05 A;  1YRN A;  5H6Q A;  2P6S A;  3ESW B;  2R7X A;  2R7V A;  4ESB A;  5FLX K;  1WJA A;  2R7W A;  4RAZ A;  1JGG A;  1U9N A;  2C6Y A;  2Z9O A;  3LFU A;  2ZXH A;  4FCY A;  1R6R A;  4S0H B;  3CCE I;  1VZ0 A;  2STW A;  3QPT A;  2BVM A;  3T5X A;  3KP2 A;  1Q1H A;  3L1P A;  4OIQ F;  1U78 A;  1Z6T A;  1MBH A;  4YG2 F;  3ZQG A;  3QU3 A;  4ZDO A;  3H9G A;  2BY1 A;  4EV0 A;  2ELK A;  2BE5 F;  2JK3 A;  4PUS A;  1T56 A;  3KZY A;  2GQQ A;  2E35 A;  1FWZ A;  3LSR A;  2DFI A;  2XKO A;  4ZJZ A;  4BYY A;  5DCM A;  1R00 A;  5J4V A;  2MFZ A;  2OTL I;  4GFB A;  4HPQ A;  4HRI A;  4F7Z A;  4M3F A;  3F8F A;  2QUF A;  3ABL H;  2R5Y A;  5EDN A;  2CW8 A;  2ME0 A;  4G6T B;  5H6R A;  3K10 A;  1F43 A;  5CVU A;  3VPR A;  1UHM A;  2LC2 A;  2NOG A;  1YRN B;  2QQA A;  1I6H J;  3WOD F;  5J40 A;  3GTL J;  4XRF A;  4ENJ A;  4B09 A;  1J75 A;  4CGZ A;  2DQR A;  4FX4 A;  5FRN A;  1DP3 A;  3LSM A;  4FE7 A;  2M2E A;  2IGK A;  2CUE A;  2O5R A;  3HKZ N;  3ZOB A;  1Z7U A;  3DTE A;  3ML6 A;  3JRE A;  1EJ9 A;  1D1C A;  4XLA A;  1ODD A;  4UV9 A;  2NOJ B;  1NH3 A;  3GTG J;  3I58 A;  2IT0 A;  3VDX A;  1F4K A;  1YI2 I;  1YS6 A;  2DMQ A;  3I59 A;  3GLX A;  4LOC A;  1Z67 A;  4B3A A;  4KMU X;  3HRS A;  3BOQ A;  4BY7 J;  3RKX A;  2M0M A;  1RNL A;  1P4X A;  2ZO4 A;  9ANT A;  1T08 B;  3GME A;  3HOS A;  3VSK A;  3CDI A;  4RB0 A;  5HDK A;  1VQM I;  1MIJ A;  3ZQF A;  2WY8 Q;  1W4M A;  3QAH A;  5M5X J;  2ZME B;  4Q4Z F;  2CQ7 A;  2HQ5 A;  2CWE A;  2L9N A;  1PUE E;  2XAJ A;  1S5L C;  4HZF A;  4UY8 I;  5EG0 A;  1ZG3 A;  3BZ6 A;  3TO6 A;  1BOB A;  5HS9 A;  3W6J B;  3A0B C;  1BJA A;  1UZC A;  2CG4 A;  4MQV A;  2X1C A;  4ENM A;  2EZI A;  2RRE A;  1LKX A;  3FMR A;  5KK1 A;  3HL2 A;  3OYC A;  3FXO A;  4QLC U;  3OOP A;  4M71 A;  3TBI A;  1JT6 A;  3A01 A;  3S8P A;  2AQF A;  5E3N A;  4XSZ F;  4LG0 B;  2DDB A;  3CC4 I;  2CGP A;  1SD4 A;  4A3J J;  2KRC A;  3A2K A;  4D5C A;  1AU7 A;  3F8N A;  4YIF A;  1WJF A;  2UV1 A;  3GTO J;  3OV8 A;  3PQJ A;  1VQN I;  5K5R A;  1ETO A;  2R92 J;  2MGQ A;  1J2X A;  2Z2S B;  5F0C A;  3U1D A;  1R4M B;  2DA5 A;  2MA3 A;  1SFX A;  1K7A A;  2O6G E;  3WG9 A;  5GAD J;  4I09 A;  1Y0N A;  3HOY J;  1IGN A;  2DW4 A;  5B1A H;  5CYV A;  1H89 C;  3MKL A;  1K78 A;  2H27 A;  4YFK F;  1H8A C;  3OSF A;  3F22 A;  4IX7 A;  3BR0 A;  2W84 A;  4IL6 C;  2K86 A;  1X1D A;  3CJQ B;  3AKZ A;  2MG4 A;  1IXS B;  3BG5 A;  2ISY A;  3DV8 A;  1UG0 A;  5F0H A;  1Z91 A;  1S7O A;  4X0G A;  2EQR A;  2E1M C;  3UR3 C;  2L7K A;  1IUF A;  4WXC A;  3I5U A;  5L3F A;  1R1V A;  2VQH A;  3F9K A;  1N75 A;  4CXF A;  3U21 A;  3RYP A;  1YIO A;  3OYF A;  2VQC A;  3N97 A;  3IH2 A;  3M1E A;  1I3Q J;  2JQ7 A;  2LF7 A;  3ABM H;  1NG6 A;  2CFX A;  2LSO A;  4UUS A;  1O7L A;  2O8X A;  1X2N A;  2CV2 A;  2H94 A;  5F08 A;  4BJ6 C;  3IKV A;  2ISZ A;  5LEK A;  1B9N A;  2LFB A;  1TWH J;  2H6B A;  4AD9 A;  1GUU A;  1TLH B;  1X4O A;  2DLL A;  4A0Z A;  2DT5 A;  4E7L A;  1ZYR F;  2V1D A;  2ZSI B;  2OF7 A;  2CUZ A;  3TW7 A;  3FMS A;  2X6O A;  2H1L A;  2ID6 A;  3L2W A;  2RNJ A;  2XB0 X;  1AOY A;  3D1N I;  4KYW A;  3LST A;  1BJZ A;  4XNF A;  2K02 A;  1W5C C;  1XSV A;  2HZD A;  3F72 A;  1IN8 A;  1HA8 A;  3DPL C;  5HLT A;  2NRA C;  4HNV A;  2BXZ A;  3M8E A;  1HW1 A;  2EZL A;  3CCV I;  3S3N A;  2F48 A;  3RZD J;  4UVB A;  5JVT A;  5JHF A;  4CCN A;  5BPI A;  1YO5 C;  2ZJ2 A;  1XB4 A;  5AON A;  5FRO A;  4IRI A;  1SD6 A;  1Y6I A;  1F36 A;  2IW5 A;  1WI9 A;  3KIO A;  1LDD A;  1RR7 A;  1MJB A;  3NWT A;  2JT1 A;  2LRE A;  5IYB J;  2HKX A;  1W7P B;  2W85 A;  2WAE A;  3BCB A;  2E1N A;  3CP2 A;  2JPC A;  5M5W J;  4OOI A;  2NXN B;  5CVR A;  1UAA A;  4ESJ A;  1ITY A;  3AG3 H;  1OCP A;  2MAB A;  5FLX Z;  3QYF A;  5HOO A;  2E2I J;  2B0L A;  4GDF A;  2O3F A;  3RJP A;  2PJP A;  2KIF A;  4F91 B;  3CCY A;  3H35 A;  1OCC H;  2X6W A;  1TC3 C;  2P5V A;  3Q9S A;  4MEX F;  1SMY F;  3GUD A;  1BIB A;  3OMY A;  3H3U A;  3BQY A;  3ERM A;  3BG6 A;  1QU3 A;  4XRS G;  2E7W A;  2VPR A;  5D4R A;  2A3S A;  1G4D A;  4OIN F;  2JTV A;  5C4X J;  4M9S A;  2MBF A;  4GYI A;  3V8L A;  2V1U A;  4H4K C;  2Z99 A;  3RTR A;  1IO2 A;  4LGW A;  2DOE A;  4GCV A;  3W2W A;  4KN4 X;  3DWL E;  1EF4 A;  3H5R A;  3HB9 A;  2AXT C;  4I0B A;  2X85 A;  3TQN A;  1QPM A;  1M1E B;  1YQA A;  2XV4 S;  3HOZ J;  1BI1 A;  3WE3 A;  4HV6 A;  2GXB A;  2VB6 A;  4OIP F;  2A05 A;  4RA2 A;  2HOA A;  2K27 A;  1FMV A;  1WRJ A;  4Z2Y A;  3IL2 A;  5K5O A;  4CCO A;  5HNF A;  2LG4 A;  2W24 A;  2E71 A;  2LD5 A;  2A07 F;  2EV6 A;  2B63 J;  2KPM A;  2VKD A;  2P7V B;  2H1K A;  1XMX A;  4YEJ A;  2F4M B;  3S15 J;  5F1R A;  2Y75 A;  1D5V A;  2VI6 A;  3ERE D;  2XF7 A;  5B1B H;  3DQV C;  4XKB A;  1IXC A;  1I1G A;  1T98 A;  2PQ8 A;  3H5A A;  1POG A;  3J80 K;  1YLF A;  3HM5 A;  1RKW A;  5IOZ A;  1LPQ A;  1BI2 A;  5LD2 C;  2OCE A;  4KA4 A;  2Y0S A;  5IP6 A;  5FD6 A;  5IPA A;  3PO3 J;  3TL4 X;  1CGP A;  4M6X A;  1PP7 U;  2JA2 A;  4NQW B;  1P7J A;  3BY6 A;  1IN4 A;  3GCM A;  1U9O A;  1IN6 A;  2DPU A;  4CH7 A;  4RMN A;  4DZJ A;  1O7F A;  3V7R A;  2OAZ A;  3G1O A;  2NVT J;  2L9R A;  1D0Z A;  4D5F A;  3A02 A;  2QEN A;  2V6E A;  1G3S A;  2AHQ A;  5FGM A;  4A6E A;  3HIF A;  1TT0 A;  4XKV A;  2DOA A;  3K1P A;  3V8J A;  4ZTF A;  2DT7 B;  1ETQ A;  1JTY A;  1FBS A;  1SVO A;  4ABZ A;  1FNN A;  5EGO B;  2EA2 A;  1FZP B;  5FFZ A;  4X1E A;  3WU2 C;  3FXK A;  1Z05 A;  5LGN A;  3CDL A;  3ECH A;  3DKW A;  4OAY A;  1APL C;  1VQK I;  1MMG A;  1R23 A;  3DU5 A;  5EJC A;  2GOX B;  4UVA A;  3PSF A;  4LJZ F;  4P9U A;  4H0E A;  4KNY A;  5CPR B;  1A31 A;  3F8C A;  4XLC A;  4HX7 A;  3QOD A;  3KZI C;  1V5F A;  3R60 A;  4Q47 A;  4RLQ A;  4L9V A;  1S29 A;  2OBP A;  4XKC A;  3ABT A;  2LKP A;  5EGO A;  4A3D J;  3CES A;  5IT9 Z;  4A3L J;  4M6V A;  2B9S A;  4PJM A;  3S2H J;  1U5T B;  1IJW C;  3MVP A;  1HSJ A;  3K9T A;  5CVV A;  5F6F A;  1FBU A;  3IWZ A;  5CKT A;  1J9I A;  1BA5 A;  3WU1 B;  1L0O C;  1QQI A;  4HX8 A;  4RB1 A;  3G1M A;  2QSG X;  1MH3 A;  3HKZ A;  2BV6 A;  3TO7 A;  2MSY A;  1U5T A;  2WBM A;  2EFW A;  4I6Z A;  1QO0 D;  1KU9 A;  5D6F A;  1RR8 C;  5FLM J;  5EZG A;  4M3G A;  1E3P A;  1YE9 A;  4BGD A;  4PGG A;  1X1A A;  5GTH C;  2XAU A;  4L9N A;  4MGR A;  1Y39 A;  1BL0 A;  1D8K A;  3OL4 A;  4I99 C;  2QKL B;  2XGX A;  3J81 Z;  2VUM J;  1XMA A;  5ERI A;  3J7Y J;  4DOZ A;  1U3E M;  3P9K A;  3QPL A;  5J8F A;  1SD5 A;  2R7O A;  2EA4 A;  1ZEL A;  3FKJ A;  2NAZ A;  3FKI J;  2YSR A;  4KIF A;  2R7S A;  4RGX A;  2Y48 A;  5CLS A;  2F5F A;  5FKO A;  5L3C A;  2X51 A;  3LL7 A;  4DYQ A;  4FT8 A;  3HOW J;  1Y1V J;  3IUO A;  4ZDP A;  1SVL A;  3F0C A;  5LRS A;  2EZH A;  4MHG A;  4Q5S F;  3I4N J;  4RB2 C;  2OCC H;  3CCU I;  4C30 A;  2Y30 A;  2JWT A;  2G9W A;  4KDP A;  4ZYG A;  3AFH A;  4KT5 C;  2LLK A;  2GXA A;  1ZLJ A;  2EBI A;  4PJ0 C;  4ZYH A;  4ZYA A;  1AA7 A;  4Y7N J;  4XR6 A;  3DPU A;  4JP0 A;  2KHM A;  1J59 A;  1ULY A;  1Z0X A;  2BBY A;  4EGZ A;  1EKE A;  1Z3Y A;  1IRZ A;  3MFK A;  1MBJ A;  3I54 A;  1J5Y A;  4AC0 A;  3VWB A;  4KIS A;  5DS9 A;  5D5V B;  2JRT A;  3O8H A;  5J1R A;  1S8N A;  2QVO A;  3ZMT A;  3GLL A;  3RPQ A;  1TQI A;  1ZRC A;  2F4O B;  2K40 A;  2JVH A;  4YFN F;  1KU7 A;  1MSE C;  3G3Z A;  4IPA A;  4CCL A;  3MEX A;  2OQG A;  2XHK A;  5LHH A;  4LK0 F;  1YG2 A;  1Y8Q B;  2XGE A;  2VBZ A;  3RSN A;  5GAH J;  3WE2 A;  1YW9 A;  3I64 A;  1T0F A;  4RLF A;  3FXL A;  3U2R A;  2AQE A;  2PBI A;  3OYN A;  3CLO A;  2Y0S N;  2LTP A;  4A5M A;  5E79 C;  2HVR A;  1QZZ A;  3FMQ A;  4HX4 A;  3COA C;  2LK2 A;  4DBR A;  4BY1 J;  3KLO A;  1VND A;  1F1Z A;  3AG4 H;  3HUG B;  2CSO A;  3IHU A;  2R7Z J;  3NQO A;  2XSD C;  3GVA A;  4G12 A;  3SFI A;  3TP3 A;  2M8E A;  3FDY A;  1DDN A;  3F3X A;  3IP4 B;  3GYH X;  4A69 C;  3HJE A;  1BC7 C;  3OS2 A;  5E8G A;  1V3F A;  4QIW N;  3VFZ A;  3TOB A;  3MAJ A;  1ETK A;  2VOD A;  3E1S A;  2NVU B;  3IRQ A;  1TWA J;  1NHA A;  1EH6 A;  2D1H A;  2M7A A;  2PEX A;  3J80 Z;  4E4H A;  1MBK A;  2DOF A;  4CDG A;  2R5Z B;  2PJR A;  1WHU A;  2P4W A;  5LLQ A;  4BE0 A;  1ZN2 A;  2LKX A;  2FNA A;  2OQR A;  1Z9C A;  1IRF A;  3BPX A;  1ETY A;  4HLX A;  1IZ1 A;  1JJ8 C;  3JRB A;  1NG7 A;  2LOO A;  3ZMV A;  5D4S A;  1MW7 A;  4BEH B;  4LD5 A;  2E36 A;  3LMM A;  2VAS A;  3FXU A;  2FUG 2;  1V4R A;  1Z7L A;  1Z21 A;  3L2V A;  5HVQ C;  5JVG F;  2R5Z A;  1JKQ C;  3NEU A;  1VQ7 I;  2CUF A;  4L0Z B;  4IRH A;  2FD5 A;  4LB5 A;  4NBQ A;  5ICE A;  1IDZ A;  2FOK A;  2DA2 A;  4M9X A;  3T1B A;  1RUN A;  4O6J A;  1RUO A;  4YFX F;  1E3H A;  2V1N A;  3UNG C;  3AL0 C;  1ETX A;  1XTA A;  1BR4 A;  4XOT A;  4YIR X;  4XLE A;  1YTY A;  3SZG A;  4RAG A;  4E7K A;  3BG7 A;  4BAY A;  4ZZL A;  1YJN I;  1VI0 A;  3GBG A;  3B02 A;  1AHD P;  5F27 A;  5BPD A;  1VQ6 I;  3CMA I;  3K4L A;  1OQY A;  3IAS 2;  2TRT A;  3DKX A;  3GZ6 A;  2VKE A;  2HPM A;  2CJJ A;  1UCR A;  3SYT A;  3AAF A;  4AWX B;  1XPX A;  3K1M A;  1I39 A;  3Q0U A;  3PNT A;  5FJ8 J;  2OA4 A;  3DEE A;  4HDV A;  4LLG F;  2GIZ A;  3QPH A;  2VLA A;  1XMK A;  2GA2 A;  4KIC A;  2FE3 A;  4Y33 A;  2KL4 A;  1X1B A;  3OYA A;  1U6G A;  2LBF A;  1IN7 A;  5HLH A;  3PIO F;  1N25 A;  2KDZ A;  4EM2 A;  1UG2 A;  4EM0 B;  2P7C B;  4IKF A;  3OYL A;  2XC7 A;  2L4A A;  2V79 A;  2JA6 J;  3GF2 A;  1DU0 A;  3KEY A;  3HPH A;  2PI0 A;  3JRA A;  2VJ4 A;  3CDH A;  3AL0 B;  1PUF B;  4A3F J;  1FMW A;  4V2F A;  2CYY A;  4A0X A;  1SFU A;  2PMZ N;  1WJE A;  2HYF A;  3BJA A;  3BR2 A;  5CQE A;  4HF2 A;  5AIP A;  3ABU A;  2R7D A;  1RIO H;  1TWC J;  1VQO I;  1WCM J;  4IQ4 A;  1WJC A;  3TO9 A;  4N4O B;  1TQM A;  3HGG A;  1IDY A;  2I5U A;  1VQ5 I;  1MKM A;  2XGD A;  5LGT A;  4HQM A;  4Y52 J;  3C3W A;  1A5J A;  3DCF A;  3N05 A;  5FKN A;  2G0E A;  3MN2 A;  3WU0 A;  3H9J A;  1Y1W J;  2VON A;  4JBA A;  3T8R A;  1YIJ I;  2GA1 A;  2KP6 A;  3WG7 H;  2V9V A;  2QSF X;  3DEW A;  1B59 A;  2ICW G;  4AVZ A;  3ZN0 A;  1W5S A;  2UWM A;  2KMU A;  2M8G X;  1P6R A;  4O5V A;  3K6G A;  4EJU A;  5B66 C;  3G2B A;  2Q8K A;  1V5E A;  1O57 A;  3FF5 A;  1JKR C;  3MMY B;  4OAZ A;  2YX4 A;  5E1Z B;  5GP9 A;  4AID A;  1G6N A;  3KLN A;  3CCQ I;  1AWC A;  1HXD A;  5K1Y A;  3OSG A;  4LIU A;  3A0H C;  3HOU J;  3KE2 A;  2JSC A;  2VXD A;  1O3R A;  1ZAR A;  2HU9 A;  3WTX C;  2ZJP F;  4BDY A;  2ZB9 A;  1NTC A;  4FHT A;  2Q2E B;  2DMT A;  2VE8 A;  3HTU A;  3JRG A;  4Y15 A;  4IJA A;  3CUQ C;  2NS7 A;  2D2W A;  1G8X A;  4S04 A;  1KQ9 A;  2XAF A;  4JOM A;  5L3E A;  3MZH A;  2COB A;  2D5V A;  3KET A;  4HV5 A;  2ZME C;  3EYY A;  3RKY A;  1IV8 A;  5KAF C;  3D5L A;  2EIJ H;  2K9M A;  3DBR B;  3HUG A;  1MGT A;  2M3A A;  2WTE A;  1YS7 A;  5J8C A;  1T38 A;  2DMP A;  4ASN A;  1RPW A;  1FYL A;  1SEU A;  2GZW A;  1SFE A;  3S1R J;  3DFG A;  4D0P A;  3JTH A;  4HEA 2;  3B73 A;  4I0A A;  3M3Y J;  4XID A;  2OU2 A;  2N8G A;  2F5C A;  3QWL A;  3KYC B;  1T2K A;  4BQA A;  3EUH A;  4II3 A;  2L0K A;  2M5W A;  3KP7 A;  3PL8 A;  2XSJ C;  1G3T A;  4EJO A;  2A6T A;  1H0M A;  3JR9 A;  2A61 A;  5H20 A;  4OMY A;  2Y2Z A;  4RGR A;  4B1R A;  4CYC A;  2BVL A;  2LF8 A;  3F23 A;  2ZBK A;  5FO5 A;  2V26 A;  1I6X A;  3VOD A;  3ELK A;  4KIG A;  1QZE A;  4RDU A;  4PFO A;  5A2Q K;  1UJ8 A;  3PUB A;  1H9G A;  1JUP A;  3GW2 A;  3HSE A; 
#chains in the Genus database with same CATH homology
 4UHT A;  2Y0M A;  1MJ9 A;  3V7C A;  3V4G A;  5DCF A;  2QZ8 A;  2MC3 A;  3TGN A;  3L9F A;  1P2F A;  3C18 A;  5ILS A;  2GWR A;  2PMU A;  4O3M A;  2PLY A;  1X3U A;  1O3S A;  5TJJ A;  1L3L A;  3SXY A;  4G6Q A;  3E6M A;  2K4J A;  5ICC A;  4PDK A;  3BP8 A;  3KCC A;  2ZCW A;  1TNS A;  2L54 A;  2GIV A;  2PMH A;  2FQ3 A;  2ADU A;  2K4B A;  1XSX A;  2JZY A;  1C0W A;  1ZHF A;  5HDN A;  3E6C C;  2O0Y A;  1T39 A;  1D3Y A;  5ICF A;  3BPV A;  1R5G A;  1BI3 A;  2BGC A;  2CQK A;  3ECO A;  4WX9 A;  3MCZ A;  1HQC A;  3L00 A;  4Q48 A;  2KIM A;  3GFL A;  4M9Z A;  2HQN A;  3DEU A;  2M1B A;  2X4H A;  4GYG A;  1FYM A;  1IAW A;  3ZMU A;  1O3Q A;  2Z5U A;  1KU2 A;  3EDP A;  1BC8 C;  1ON1 A;  3TKY A;  4UNO A;  1WKM A;  3EQL F;  3WTU C;  3IKT A;  4KMF A;  1E2X A;  2VE9 A;  1UFM A;  4IXA A;  2HDC A;  4BH9 A;  1FP1 D;  3CTA A;  3ZQ7 A;  5IT9 K;  1S6L A;  3DPT A;  2FBH A;  3E5X A;  5ILV A;  2PN6 A;  5D5W B;  2FBK A;  4IHT A;  5JHU A;  1XSD A;  3V8K A;  4G94 A;  2EFN A;  2IJL A;  2KJC A;  3FXQ A;  2ZME A;  2XAQ A;  1OMI A;  2A6E F;  1BN5 A;  2QWW A;  4U7D A;  2IVM A;  3GZ5 A;  4G9Y A;  2HOE A;  4MNU A;  2FSW A;  2O03 A;  4E70 A;  3I53 A;  5ED4 A;  4CYD A;  4PGH A;  1FPQ A;  2F5E A;  4ENK A;  2WC2 A;  2EJR A;  2A6H F;  4XBF A;  5LEJ A;  3I0T A;  1B6A A;  4BHB A;  4NHJ A;  3R0A A;  2VT3 A;  5F64 A;  1OYY A;  1IUY A;  4HOB A;  3F8M A;  1I5Z A;  3CO6 C;  3D0S A;  1T6S A;  2V6C A;  3G73 A;  3BRO A;  4I7H A;  3H3Z A;  1BOA A;  2AXL A;  3HSF A;  1FSH A;  3TDU C;  4L9J A;  2IA2 A;  3T0Y A;  3KZZ A;  2HS5 A;  3MQ0 A;  2A69 F;  2DU9 A;  1WQ2 A;  2W57 A;  4HLY A;  3GFI A;  3E5Q A;  3I59 B;  2HTS A;  3EET A;  2PFB A;  1O3T A;  2Q2E A;  2IRF G;  1R7J A;  2M30 A;  2FMY A;  1CF7 A;  4P55 A;  3QOP A;  1J0R A;  3NRV A;  2MD5 A;  1K79 A;  4AVP A;  4RGS A;  4CHU A;  5IT3 A;  1ZG5 A;  1MD0 A;  3P7N A;  3L09 A;  1ZGA A;  1OYI A;  3VOE A;  2F2E A;  4IVN A;  5JR3 A;  2VT2 A;  1EV7 A;  3P9I A;  1PP8 F;  4N9H A;  4HA8 A;  3M8F A;  3M7G A;  4LB6 B;  4L5I A;  4JK1 X;  4EMS A;  5LRR A;  2NYX A;  1F5T A;  3E6B A;  1XDS A;  5DDG A;  1OPC A;  3JW4 A;  2BYV E;  4HDU A;  1QNT A;  4EJT A;  3WTW C;  2K7L A;  1LQ1 A;  5AIQ A;  1R36 A;  4N9I A;  2P8T A;  1WWX A;  2VN2 A;  4XLP F;  4Y17 A;  3O2P E;  5DYM A;  4WK8 F;  2DQL A;  1YYV A;  2XIG A;  2G7U A;  2NNY A;  4A6D A;  4UUV A;  4BNC A;  1YFH A;  3KEO A;  2VOO A;  2DI3 A;  1HKQ A;  4EJV A;  4ZYE A;  4DNC A;  4LLN A;  4BHP A;  5D5U B;  1ON2 A;  3JAM Z;  1BM9 A;  5L3G A;  3Q5F A;  1STZ A;  1HW2 A;  3GFJ A;  2QBY B;  3EYI A;  3I71 A;  1XD7 A;  2A5Y B;  4I2O A;  3ZP5 A;  3GFM A;  3GXO A;  3FXR A;  4M72 A;  1HBX G;  4Y13 A;  5EEH A;  2ETH A;  5FB2 A;  2ZKZ A;  2KJB A;  4HAM A;  3SQN A;  2F5D A;  3E97 A;  2HYG D;  1Y0U A;  3FM3 A;  2QBY A;  2HR3 A;  3JSO A;  1ZAO A;  4RB3 C;  1GVJ A;  1XDU A;  2XAH A;  2Z33 A;  3DP7 A;  3HRT A;  2P5K A;  2HWV A;  1JHF A;  2EV5 A;  2ESH A;  2HGC A;  2EFQ A;  5E1W A;  2VBX A;  2M87 A;  1FOK A;  3ZMZ A;  4G7Z F;  1D8J A;  1G3W A;  1DUX C;  1HKS A;  2FML A;  3SZT A;  3C7J A;  1KU3 A;  3O6B B;  2ZNY A;  5HS8 A;  5K5Q A;  3WTS C;  2EB7 A;  1LEB A;  4ZH4 F;  2EFP A;  3FM5 A;  1B9M A;  2ELH A;  3WTV C;  3C1D A;  1XGS A;  4XSX F;  1K6O A;  4LK1 F;  2PG4 A;  2NNN A;  3ROU A;  2Z3Y A;  3TDZ C;  3N4M A;  2MH2 A;  2G7H A;  2FF4 A;  4ETS A;  1USS A;  2J5P A;  1QBJ A;  1FSE A;  4ENN A;  1MDM A;  1TNT A;  3K0L A;  3KP6 A;  1JE8 A;  3JSP A;  2DBB A;  4MTE A;  1XN7 A;  2FNP A;  2DK8 A;  2FU4 A;  3ISP A;  3FWE A;  2WV0 A;  4G7H F;  1ZRD A;  4PCQ A;  3LA7 A;  3KP4 A;  3R61 A;  3WGI A;  1FLI A;  1FC3 A;  3QP5 A;  4P96 A;  3K69 A;  1OYW A;  3HSR A;  1P4A A;  3KP5 A;  2NS0 A;  1ONV A;  3CUQ A;  4OIO F;  5CJ9 A;  4L0Y B;  1LB2 A;  1CF7 B;  2EWN A;  2EK5 A;  3GWZ A;  5A2Q Z;  2MLG A;  4A12 A;  3HRM A;  4U7B A;  3IWF A;  1R5H A;  1HKT A;  6PAX A;  4HBL A;  1LVA A;  5HLG A;  1G3Y A;  3R0J A;  2FBI A;  4M73 A;  4I02 A;  1U2W A;  2ESN A;  2UXX A;  3SZP A;  4KUM A;  3RIR A;  1K78 B;  1REP C;  2FXA A;  3BDD A;  2DTR A;  4LFU A;  2VBY A;  2FRH A;  1ZH5 A;  4M6Y A;  4HW0 A;  5L3B A;  4BHC A;  4CO8 A;  4P9F A;  3M9A A;  1SD7 A;  3CJN A;  1KYW A;  3SHF A;  1DPR A;  1PDN C;  1ZGJ A;  2IPQ X;  4HF0 A;  3F8B A;  4IHS A;  1BI0 A;  3RYR A;  2DK5 A;  2YPR A;  2H09 A;  4R79 A;  1DPU A;  5BQT A;  4K2E A;  5D8L B;  4RS8 A;  1ZRF A;  1EH7 A;  4RGU A;  1H9T A;  1HST A;  2XRO A;  1KYZ A;  2UZK A;  1I27 A;  5E8I A;  2YU3 A;  3WTT C;  3HRU A;  4G7O F;  3GX4 X;  5DUK A;  1Z1D A;  1EH8 A;  1FY7 A;  3ZPL A;  1RZ4 A;  1DP7 P;  1IN5 A;  4KN7 X;  4R8H A;  1ZLK A;  1B4A A;  5EEG A;  3LFK A;  4DQ2 A;  4OU0 A;  4EQQ A;  1GHC A;  2E7X A;  2STT A;  2J5O A;  3CUO A;  4P5O A;  1U8R A;  3ZMD A;  1R1T A;  2HKO A;  2GAU A;  1R58 A;  3LWF A;  4GGG A;  3W6K B;  2D1V A;  2RGV A;  3S2W A;  3BJO A;  2V1X A;  1KQ0 A;  4A0Y A;  2W25 A;  4AIJ A;  1FBQ A;  2HQR A;  4R1H A;  4HF1 A;  2D45 A;  3WGH A;  4I01 A;  1TQP A;  5BMZ A;  3REO A;  3WTY C;  1F9N A;  1XGM A;  4M74 A;  4CZZ A;  2R3S A;  4B8X A;  2LDU A;  4EGY A;  2VC1 A;  5JFR A;  5TRD A;  1W7P D;  5ICG A;  2ZFW A;  4AIH A;  1U5T C;  5DD8 A;  4IRG A;  3JAM K;  5KVR A;  2QLZ A;  2OZU A;  1GXQ A;  3FX3 A;  1S3J A;  2BEO A;  1WSU A;  4UVC A;  1BBY A;  4HYE A;  4UXN A;  3F6O A;  3HYI A;  2QYO A;  4AIK A;  1TBX A;  4ZZD A;  1P4W A;  1LEA A;  3CO7 C;  2RDP A;  5DV5 A;  1FX7 A;  3PFI A;  4WF2 A;  1QZY A;  3R6S A;  5DEQ A;  4GO1 A;  2YR2 A;  1B1B A;  2XAS A;  4KIB A;  1OKR A;  1Z6R A;  2Q0O A;  5CVI A;  2ACJ A;  2KRF A;  3VEP A;  1FYK A;  5D6E A;  4EJW A;  3L2C A;  1R1U A;  1HW5 A;  2HTJ A;  3LAJ A;  5L3D A;  4L9T A;  5D8K B;  1FP2 A;  3RI4 A;  5E17 F;  4G8X A;  3FHZ A;  2DO7 A;  2ZXJ A;  3U9G A;  1A04 A;  4WXH A;  2HEO A;  4BXU A;  2XAG A;  2KIU A;  1SMT A;  4A5N A;  1FT9 A;  4LLL A;  4U0Y A;  1ZRE A;  2XUB A;  2LNB A;  3LA3 A;  5E1X A;  3ZN1 A;  2WWY A;  2QQ9 A;  5J6X A;  2HFH A;  1ZG1 A;  3E3V A;  4YII A;  2KKO A;  3O3K A;  1P92 A;  4WWC A;  3RPU A;  4U0W A;  5ILU A;  4LG0 A;  5HS7 A;  2HZT A;  5D5X B;  2TDX A;  1YW7 A;  2FA5 A;  1JHH A;  1I1S A;  1MDM B;  3IRR A;  5DCM B;  5LHI A;  4L5J A;  2CO5 A;  2L02 A;  2VOP A;  2VXZ A;  1TW3 A;  3T8T A;  4NQW A;  2VC0 A;  5LHG A;  2CW0 F;  4GXO A;  3R4K A;  4OMZ A;  2ZNZ A;  3LQR A;  2IA1 A;  3F21 A;  2IA0 A;  3DXJ F;  1IW7 F;  4ON0 A;  4FX0 A;  5BOX A;  1S7A A;  3I4P A;  2RV8 A;  1XGO A;  1KGS A;  3KFW X;  2EFO A;  1SAX A;  2COM A;  1MJA A;  4MTD A;  1BIA A;  4LMY A;  1UB9 A;  3MWM A;  2A68 F;  4MQ9 F;  4WCG A;  2RKH A;  3JTG A;  3V7S A;  3PQK A;  2E1C A;  3WTZ A;  3RDI A;  2QQB A;  1UHW A;  1LNW A;  2RC4 A;  4TV7 A;  4JQF A;  2X0L A;  2IP2 A;  1XCB A;  2H6C A;  1IRG A;  2L01 A;  4EM1 A;  1YW8 A;  1LJ9 A;  3K1N A;  3LA2 A;  2FEZ A;  3E5U A;  4MEY F;  1J7K A;  5HLI A;  3GEZ A;  4I98 B;  1W7P A;  1VTN C;  4ESF A;  5BS6 A;  1JGS A;  3F6V A;  3L7W A;  3FZV A;  3VB2 A;  4G6D A;  3QP6 A;  2XKP A;  3HHG A;  2OD5 A;  3CUQ B;  2L3D A;  1MZB A;  4XLN F;  3E6D A;  3TOA A;  5DUI A;  3DF8 A;  1GXP A;  3QRF F;  5HDG A;  4CIC A;  1JXS A;  3ULQ B;  3MZY A;  2GXG A;  1LDK B;  1TTY A;  2P5L C;  5E18 F;  1RI7 A;  3P9C A;  3RKW A;  1IXR C;  3BJ6 A;  3H92 A;  1QGP A;  4L18 B;  2RN7 A;  4IF4 A;  3J81 K;  2XVC A;  5LGU A;  3LAP A;  2DPD A;  2O61 A;  3SFZ A;  3WGG A;  2MLK A;  3LQQ A;  4PZJ A;  2OZ6 A;  4U0V A;  3KP3 A;  4EVI A;  3Q9V A;  1OR7 A;  1UST A;  5CVJ A;  3ZMS A;  1R22 A;  2JPB A;  3GO5 A;  1KA8 A;  3KEQ A;  3K2Z A;  5JI6 A;  3HHH A;  1TW2 A;  4NB5 A;  2P6T A;  4ZYD A;  4KFC A;  1LDJ A;  3IC7 A;  1W5T A;  2YX7 A;  1E17 A;  3J7A O;  4U88 A;  5FD5 A;  2VBW A;  4HQE A;  3HTS B;  4A2U A;  1IF1 A;  5LBQ A;  4QWQ A;  1XCV A;  2RVC A;  3HOT A;  2M45 A;  4OIR F;  3QU6 A;  2DAO A;  1KQ8 A;  2RQP A;  2R7F A;  2L4M A;  2EV0 A;  2AS5 F;  4UV8 A;  4N0B A;  4WXD A;  1XGN A;  2QM3 A;  2UXN A;  5E20 A;  5DD4 A;  5FFX A;  2XRN A;  2MH9 A;  3BWG A;  4RAY A;  4S05 A;  5H6Q A;  2P6S A;  4ESB A;  5FLX K;  4RAZ A;  2C6Y A;  2Z9O A;  2STW A;  3QPT A;  3T5X A;  3KP2 A;  1Q1H A;  4OIQ F;  1U78 A;  1Z6T A;  4YG2 F;  3QU3 A;  4EV0 A;  2BE5 F;  3KZY A;  2GQQ A;  1FWZ A;  2DFI A;  2XKO A;  4BYY A;  5DCM A;  1R00 A;  4F7Z A;  3F8F A;  2QUF A;  5H6R A;  5CVU A;  1UHM A;  2QQA A;  3WOD F;  4XRF A;  4ENJ A;  4B09 A;  1J75 A;  4CGZ A;  2DQR A;  4FX4 A;  1Z7U A;  3ML6 A;  1ODD A;  4UV9 A;  3I58 A;  2IT0 A;  1F4K A;  1YS6 A;  3I59 A;  3GLX A;  4KMU X;  3HRS A;  3BOQ A;  3RKX A;  1RNL A;  1P4X A;  2ZO4 A;  3HOS A;  4RB0 A;  5HDK A;  1W4M A;  3QAH A;  4Q4Z F;  2ZME B;  2CWE A;  1PUE E;  2XAJ A;  4HZF A;  1ZG3 A;  3BZ6 A;  3TO6 A;  3W6J B;  5HS9 A;  1BJA A;  2CG4 A;  4MQV A;  4ENM A;  5KK1 A;  3FMR A;  4QLC U;  3OOP A;  4M71 A;  4XSZ F;  4LG0 B;  2CGP A;  1SD4 A;  3F8N A;  4YIF A;  3OV8 A;  3PQJ A;  5K5R A;  1J2X A;  3U1D A;  2MA3 A;  1SFX A;  1K7A A;  2O6G E;  3WG9 A;  4I09 A;  2DW4 A;  5CYV A;  1K78 A;  2H27 A;  4YFK F;  3F22 A;  2W84 A;  2K86 A;  1IXS B;  2ISY A;  3DV8 A;  1Z91 A;  1S7O A;  4WXC A;  3I5U A;  5L3F A;  1R1V A;  4CXF A;  3RYP A;  1YIO A;  3N97 A;  3M1E A;  2LF7 A;  2CFX A;  2LSO A;  1O7L A;  2O8X A;  2H94 A;  3IKV A;  2ISZ A;  5LEK A;  1B9N A;  2H6B A;  4AD9 A;  1TLH B;  2DLL A;  4A0Z A;  2DT5 A;  1ZYR F;  2V1D A;  3FMS A;  2RNJ A;  1AOY A;  4KYW A;  3LST A;  2K02 A;  1XSV A;  3F72 A;  1IN8 A;  3DPL C;  2NRA C;  3M8E A;  1HW1 A;  4UVB A;  5JVT A;  5BPI A;  1YO5 C;  2ZJ2 A;  1XB4 A;  4IRI A;  5AON A;  1SD6 A;  2IW5 A;  1WI9 A;  1LDD A;  1MJB A;  2JT1 A;  2HKX A;  1W7P B;  2W85 A;  2E1N A;  2JPC A;  4OOI A;  5CVR A;  4ESJ A;  5FLX Z;  5HOO A;  2B0L A;  2O3F A;  3RJP A;  2PJP A;  2KIF A;  2P5V A;  3Q9S A;  4MEX F;  1SMY F;  3GUD A;  1BIB A;  3H3U A;  2E7W A;  5D4R A;  2A3S A;  1G4D A;  4OIN F;  2JTV A;  4M9S A;  2MBF A;  4GYI A;  3V8L A;  2V1U A;  2Z99 A;  3RTR A;  4LGW A;  4GCV A;  4KN4 X;  4I0B A;  3TQN A;  1QPM A;  1YQA A;  2XV4 S;  1BI1 A;  3WE3 A;  4HV6 A;  2GXB A;  4OIP F;  2K27 A;  1WRJ A;  4Z2Y A;  3IL2 A;  5K5O A;  2W24 A;  2A07 F;  2EV6 A;  2P7V B;  5F1R A;  2Y75 A;  1D5V A;  3ERE D;  3DQV C;  1IXC A;  1I1G A;  1T98 A;  2PQ8 A;  3J80 K;  1YLF A;  1BI2 A;  4KA4 A;  5FD6 A;  1CGP A;  4M6X A;  1PP7 U;  3BY6 A;  1IN4 A;  1IN6 A;  2DPU A;  1O7F A;  3V7R A;  2OAZ A;  2QEN A;  1G3S A;  5FGM A;  4A6E A;  3HIF A;  3K1P A;  3V8J A;  1FBS A;  1FNN A;  2EA2 A;  1FZP B;  5FFZ A;  5LGN A;  1Z05 A;  3ECH A;  3DKW A;  1R23 A;  4UVA A;  4LJZ F;  4KNY A;  4P9U A;  4H0E A;  3F8C A;  4HX7 A;  3R60 A;  4Q47 A;  4L9V A;  1S29 A;  2OBP A;  3ABT A;  2LKP A;  5IT9 Z;  1U5T B;  1HSJ A;  3K9T A;  5CVV A;  5F6F A;  1FBU A;  3IWZ A;  1J9I A;  3WU1 B;  1L0O C;  1QQI A;  4HX8 A;  4RB1 A;  3TO7 A;  2BV6 A;  1U5T A;  2EFW A;  1QO0 D;  1KU9 A;  5D6F A;  4PGG A;  4L9N A;  4MGR A;  1D8K A;  2XGX A;  3J81 Z;  1XMA A;  5ERI A;  1U3E M;  3P9K A;  5J8F A;  1SD5 A;  2EA4 A;  2NAZ A;  2YSR A;  4KIF A;  4RGX A;  2Y48 A;  5CLS A;  2F5F A;  5L3C A;  4FT8 A;  5LRS A;  4Q5S F;  4MHG A;  4RB2 C;  2G9W A;  4KDP A;  4ZYG A;  4KT5 C;  1ZLJ A;  4ZYH A;  1J59 A;  1ULY A;  2BBY A;  4EGZ A;  3MFK A;  3I54 A;  1J5Y A;  5D5V B;  2JRT A;  1S8N A;  2QVO A;  3ZMT A;  3RPQ A;  1TQI A;  1ZRC A;  4YFN F;  1KU7 A;  3G3Z A;  4IPA A;  3MEX A;  2OQG A;  2XHK A;  5LHH A;  4LK0 F;  1YG2 A;  2VBZ A;  3WE2 A;  1YW9 A;  3I64 A;  1T0F A;  3U2R A;  2PBI A;  3CLO A;  4A5M A;  1QZZ A;  3FMQ A;  4HX4 A;  3COA C;  3KLO A;  1F1Z A;  2CSO A;  3IHU A;  3NQO A;  3GVA A;  2M8E A;  1DDN A;  3F3X A;  3GYH X;  1BC7 C;  5E8G A;  1V3F A;  3VFZ A;  3TOB A;  3MAJ A;  2VOD A;  3IRQ A;  1NHA A;  1EH6 A;  2D1H A;  2PEX A;  3J80 Z;  4CDG A;  2P4W A;  5LLQ A;  1ZN2 A;  2FNA A;  2OQR A;  1Z9C A;  1IRF A;  3BPX A;  4HLX A;  1IZ1 A;  3ZMV A;  5D4S A;  4LD5 A;  3FXU A;  1V4R A;  5HVQ C;  3NEU A;  4L0Z B;  4IRH A;  4LB5 A;  5ICE A;  2FOK A;  4M9X A;  3T1B A;  1RUN A;  4O6J A;  1RUO A;  4YFX F;  1YTY A;  4BAY A;  4ZZL A;  3B02 A;  5BPD A;  3GZ6 A;  1UCR A;  3AAF A;  4AWX B;  3K1M A;  2OA4 A;  4HDV A;  4LLG F;  3QPH A;  1XMK A;  2GA2 A;  4KIC A;  2FE3 A;  1U6G A;  1IN7 A;  5HLH A;  4EM2 A;  4EM0 B;  2P7C B;  2L4A A;  2V79 A;  3GF2 A;  2PI0 A;  3CDH A;  2CYY A;  4A0X A;  1SFU A;  2HYF A;  3BJA A;  4HF2 A;  5AIP A;  3ABU A;  2R7D A;  1RIO H;  3TO9 A;  1TQM A;  1MKM A;  5LGT A;  4HQM A;  3C3W A;  3WU0 A;  2VON A;  4JBA A;  3T8R A;  2GA1 A;  2V9V A;  1B59 A;  3ZN0 A;  1W5S A;  2UWM A;  1P6R A;  4O5V A;  4EJU A;  2Q8K A;  1O57 A;  3FF5 A;  2YX4 A;  5E1Z B;  1G6N A;  3KLN A;  1AWC A;  1HXD A;  5K1Y A;  3KE2 A;  2JSC A;  1O3R A;  1ZAR A;  3WTX C;  4FHT A;  2VE8 A;  3HTU A;  4Y15 A;  4IJA A;  3CUQ C;  2D2W A;  4S04 A;  1KQ9 A;  2XAF A;  5L3E A;  3MZH A;  3KET A;  4HV5 A;  3EYY A;  3RKY A;  3D5L A;  3HUG A;  1MGT A;  2WTE A;  5J8C A;  1YS7 A;  1T38 A;  4ASN A;  1FYL A;  2GZW A;  1SFE A;  3DFG A;  4D0P A;  3JTH A;  3B73 A;  4I0A A;  2OU2 A;  2F5C A;  1T2K A;  4BQA A;  3EUH A;  3KP7 A;  2M5W A;  4EJO A;  1G3T A;  1H0M A;  2A61 A;  5H20 A;  4OMY A;  4RGR A;  2LF8 A;  3F23 A;  2ZBK A;  5FO5 A;  3VOD A;  1I6X A;  3ELK A;  4KIG A;  5A2Q K;  1H9G A;  3GW2 A;  3HSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...