2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Replication termination protein
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
1R23A 2GWRA 2EFWA 2RN7A 5FB2A 1YW9A 2QQAA 1HQCA 4PZJA 2HOEA 2QQ9A 3WTUC 3GLXA 4HDUA 4HZFA 4G6QA 2EJRA 2XAQA 3OOPA 1ZAOA 3MAJA 5D8LB 4U0WA 5ICCA 2NNNA 2Y75A 2RGVA 1S3JA 4R79A 4MEXF 2PMHA 1L3LA 1QZZA 1QNTA 2FA5A 3LA2A 1A04A 2MH2A 2XASA 2H27A 4WK8F 2UZKA 3HRMA 3ZMZA 1XDUA 5EEGA 3SZPA 4AVPA 5JFRA 3SQNA 3ISPA 4OU0A 5HDKA 3FX3A 3VEPA 1P4AA 1MDMB 4A2UA 2D1VA 2MLKA 3C1DA 2EV0A 4HX8A 4EJOA 2O3FA 4CXFA 3F8MA 2K02A 3REOA 4O3MA 2O03A 1H0MA 3I54A 2IVMA 5DD4A 2K7LA 3CTAA 4G7ZF 2FOKA 3RKXA 4S05A 3R4KA 5F64A 1W7PA 4L5JA 1HKQA 2A61A 2EFPA 2R7FA 1F5TA 3SXYA 4NQWA 2VN2A 2FRHA 4DQ2A 2F5CA 2L01A 3LAPA 4Q47A 4B09A 3J81Z 1FSEA 2EFOA 2WTEA 3B73A 4I09A 2XAFA 3TOBA 4HQEA 1LDDA 4ON0A 5IT9K 1K7AA 1K78B 5CVIA 4ENNA 3QPHA 3ZMUA 3KEOA 3PFIA 1AOYA 2KIUA 1FBQA 2CYYA 3DFGA 4Y17A 4HA8A 3ZMTA 2GIVA 2IA2A 2GZWA 4RB1A 2EA2A 1ZG5A 1WSUA 2Z33A 4YG2F 1U5TB 3GW2A 3Q9SA 3ZN1A 4E70A 4P5OA 2IW5A 3ULQB 2VXZA 3HHGA 4L5IA 3J81K 4F7ZA 4G8XA 1BN5A 2L54A 1YS6A 4A6EA 1TNTA 5CJ9A 3DPLC 3CUQB 4YFKF 5DUKA 1O3SA 1OYYA 2M5WA 3ABUA 4ZYGA 4OIQF 1KU7A 3KP7A 1S8NA 3GF2A 5E1XA 1KQ8A 1E2XA 3RPUA 1L0OC 3TO6A 3GFLA 1IZ1A 1O7FA 4KIFA 4BNCA 1ON2A 4CICA 5F6FA 1JE8A 5L3GA 2G9WA 2ETHA 2Q2EA 2JRTA 2XHKA 2P6TA 2YPRA 1XSDA 3DEUA 2DLLA 5FD5A 3GVAA 1XD7A 2EV5A 3I71A 2W24A 3BZ6A 2ISZA 2IPQX 4EGZA 3MCZA 1P92A 3LA3A 4LLNA 4ZZLA 4LFUA 4U0VA 4LK1F 1LQ1A 1XB4A 5TRDA 1HSJA 1SD4A 2OQGA 1XGNA 4YFXF 3FWEA 4M9SA 2UXNA 3ZP5A 3NRVA 2XKOA 3W6JB 3F8CA 3TO7A 5HDNA 5D4RA 3O2PE 1BM9A 3L09A 2EWNA 3FM5A 2ZFWA 1JHFA 3L00A 4BAYA 2IP2A 4M6YA 4Q4ZF 4U7BA 2DQLA 4XLPF 4KT5C 2E7XA 3GUDA 4ESFA 3MZYA 4ZH4F 3DF8A 1G3YA 4Q5SF 5F1RA 1YYVA 2F2EA 2VT3A 2MH9A 3GFIA 1YQAA 4I2OA 5KK1A 2QBYA 5L3EA 3NEUA 5EEHA 4XBFA 2D2WA 3R6SA 3O3KA 2X0LA 4M73A 3BPVA 1R36A 4KUMA 3EYIA 2Z9OA 5HOOA 2HEOA 1ZG1A 3I59B 3CLOA 3ZMDA 4IPAA 5HDGA 3S2WA 2F5FA 1FYKA 3R0AA 5E17F 3E6BA 1USSA 2IJLA 3GFMA 2DBBA 1Z1DA 4KNYA 3ZMVA 3IHUA 4G7OF 1MJ9A 2QENA 2HDCA 3MEXA 5HVQC 6PAXA 2DW4A 1UFMA 1MKMA 2W57A 3ELKA 3KZYA 4IHTA 3IC7A 1GXQA 1GHCA 5JHUA 1DUXC 2AS5F 1QO0D 3WTZA 2GXGA 3KP3A 3NQOA 2DQRA 4L9TA 1LDKB 1RNLA 1HSTA 3TDZC 2HTJA 4M71A 3KEQA 2RC4A 3BROA 1QZYA 3CUOA 2PLYA 3FHZA 3E6MA 5AONA 2FF4A 4EVIA 2EFNA 1IXSB 1HKTA 2P5LC 1I5ZA 1P6RA 4OMYA 2HYFA 4A0YA 4L9NA 1KU9A 2OD5A 1B59A 3P9CA 3E5UA 2MC3A 2V6CA 1IXRC 2VE8A 4UV8A 1QGPA 2WWYA 3KP4A 2XRNA 5D5VB 1SFUA 1TTYA 3F3XA 4XLNF 4Y15A 4WX9A 1K79A 4D0PA 2Y48A 1U8RA 3WU1B 4L0ZB 5FD6A 2QUFA 4ENJA 2HKOA 3PQKA 3K1NA 4RAYA 3LWFA 1U6GA 1IF1A 4RB3C 3C3WA 1FY7A 2ZNYA 1IRGA 1KU2A 2A5YB 1X3UA 1JXSA 3I53A 4RAZA 3M8EA 2VOOA 4LGWA 1KYWA 4WXHA 3WGIA 2D45A 4IHSA 2QQBA 1ZRFA 1BBYA 3R0JA 2RDPA 4ENMA 1IAWA 1C0WA 4RGRA 4MQ9F 3G73A 1LEAA 2LF8A 1R1UA 1MD0A 2M30A 3V8JA 2FMYA 4MTEA 3KCCA 2JSCA 4BH9A 4EM2A 1Z6TA 1LEBA 4IVNA 5D4SA 4M6XA 3GZ5A 4RS8A 3E3VA 4EM1A 2ZCWA 3WG9A 3K0LA 2Y0MA 2IT0A 4UUVA 3QPTA 5AIPA 2BV6A 1TW3A 1STZA 5FO5A 5K5OA 1RIOH 1U3EM 1XSXA 4KMFA 1OYIA 4BQAA 4EGYA 2DI3A 4M9XA 2HGCA 1KQ9A 3JSOA 1BI1A 5CVVA 5ERIA 4KA4A 4UVCA 4IXAA 2XVCA 5ICFA 1S29A 1D8JA 1R00A 3V7RA 1D8KA 2PBIA 2J5OA 5BQTA 3QU6A 2O61A 4MEYF 3BDDA 1FSHA 2XROA 2COMA 4L9JA 1G3TA 5K5QA 5ICEA 1WKMA 2FNAA 1REPC 2X4HA 1MGTA 2G7HA 5LHHA 2Q8KA 5DDGA 1BI3A 2Q0OA 1I1GA 2W85A 2YU3A 3F6OA 2HQNA 2KRFA 2IA0A 3O6BB 5L3FA 1D5VA 1IN6A 1RUNA 1U2WA 1XGSA 3HOSA 3HUGA 2BGCA 3Q5FA 1IN7A 4I0BA 2FXAA 3ZMSA 4OINF 2HQRA 2Z99A 1SFEA 3FMSA 3L7WA 4Y13A 5TJJA 2M45A 1TQPA 2XIGA 3RKYA 3RKWA 2FSWA 4CHUA 4YIIA 2ZKZA 5CVJA 4LG0A 3EUHA 3OV8A 3WODF 3U1DA 3AAFA 1UHWA 1BC8C 2W25A 1ON1A 1ZGAA 4GYGA 5H20A 2V1DA 1HW5A 2O0YA 3B02A 1OPCA 2VBZA 1HKSA 3KFWX 3G3ZA 1FWZA 3VODA 5HLIA 2WC2A 2CQKA 1ULYA 1NHAA 1LVAA 1W7PB 1YFHA 4OOIA 2HYGD 1YTYA 4GYIA 1DPRA 1Z91A 4M72A 2CW0F 1S6LA 1F4KA 3WTSC 3SHFA 4AD9A 3N97A 5JR3A 5DUIA 4TV7A 4EJTA 3QRFF 1LNWA 3LSTA 3KLNA 4LG0B 4HDVA 4I02A 4HYEA 5LHIA 5FFXA 2Z5UA 1J9IA 1KU3A 5ILUA 3DPTA 2V9VA 1T39A 4HF2A 2K4BA 4ESJA 2NS0A 3ABTA 2OZUA 2FEZA 1ZGJA 1BOAA 3ECOA 1GVJA 3IL2A 1ZYRF 5DEQA 3DXJF 4UVBA 4EJVA 1FP1D 3T1BA 2FBKA 3V7SA 1USTA 4AIKA 4IF4A 3HHHA 2A3SA 3ECHA 3EYYA 4NB5A 4GO1A 4L9VA 3ZQ7A 5HLGA 3N4MA 1TBXA 4CYDA 4A5NA 2V79A 1BIAA 3ERED 1OMIA 3V7CA 5BPDA 4EMSA 4PCQA 5FGMA 1SD5A 2P8TA 1FBUA 3DV8A 2VBWA 1S7AA 1O7LA 1KQ0A 3M8FA 4KMUX 1ZHFA 3HSFA 4FX4A 2YX4A 2Z3YA 4G7HF 2PMUA 1ZN2A 1XCVA 2H6CA 1FT9A 3FMRA 1FX7A 3FXQA 1OYWA 2RNJA 5CVRA 4HOBA 4H0EA 3RYRA 2STTA 1YG2A 2FBIA 3P9KA 1FNNA 1WRJA 5E8GA 2UWMA 4ZYHA 1SD7A 1XDSA 4G94A 4M9ZA 3TDUC 1P4XA 3I5UA 2D1HA 4L18B 5ILSA 3F6VA 3RDIA 1CF7A 1FC3A 1V3FA 3MWMA 1PDNC 4KYWA 1J7KA 1SFXA 3TOAA 3FXRA 4PDKA 3KP2A 1Z7UA 5D6FA 1KGSA 1XGMA 1F9NA 3SZTA 1LJ9A 3FXUA 2KIMA 4IRHA 3DQVC 4MQVA 4FX0A 4ENKA 3E5XA 1TQMA 2XGXA 3P9IA 2ADUA 4U0YA 2QM3A 4MNUA 5CLSA 1YIOA 2E1NA 3H3UA 2RVCA 4P55A 3HRUA 3F21A 4A0XA 4HV5A 2STWA 2ZO4A 2K27A 2P5KA 2VT2A 1IN4A 1CF7B 3JTHA 2CWEA 2CG4A 4OMZA 4ZYEA 4XSZF 2DT5A 2DO7A 1HBXG 4UNOA 1JHHA 5DD8A 2K86A 5HS9A 5LLQA 2R7DA 2QBYB 2L3DA 4KIBA 2RKHA 3E6CC 2XAGA 4OIOF 2YSRA 5K1YA 2OBPA 3Q9VA 5E1WA 4PGGA 3VFZA 2DU9A 4IRGA 2VC0A 1UCRA 1QPMA 2EK5A 1FOKA 2ZXJA 3C18A 5L3BA 5HS7A 3QU3A 3GX4X 3DKWA 1HW1A 3E6DA 1GXPA 4GXOA 1DDNA 1ZLKA 4LB6B 3F22A 1R5HA 1G3WA 4LD5A 3GO5A 5H6RA 1IW7F 2OAZA 1J75A 3QOPA 1OR7A 2PG4A 1P4WA 4RGUA 2WV0A 4LLGF 4ZYDA 2JPCA 1HXDA 2H94A 3M7GA 1XMKA 1U78A 2VC1A 3PQJA 3ROUA 2JZYA 3EETA 1J2XA 4LMYA 3HSRA 3U9GA 2LSOA 2HTSA 4M74A 3WGHA 1Q1HA 4N9HA 1BI0A 1YO5C 5DCMA 1T98A 4HLXA 1EH6A 2A68F 4RGSA 2NNYA 4N0BA 5CVUA 3J80Z 2FE3A 2VONA 3KETA 3CDHA 4LB5A 2R3SA 1R22A 3WTWC 3KE2A 3HOTA 2NYXA 1QQIA 1IUYA 3FF5A 5A2QZ 5J8FA 2BE5F 1FYLA 4JBAA 2JT1A 3QAHA 1ZARA 1YLFA 3GWZA 1B9NA 1FPQA 1Z05A 2XAHA 4U7DA 4NHJA 1KYZA 4G9YA 2GA2A 2EV6A 4ESBA 1W7PD 3K1MA 1G6NA 3LFKA 3VOEA 1O3TA 1BJAA 3RJPA 2IA1A 2YX7A 1T38A 2CFXA 2A6HF 4MTDA 5A2QK 2QLZA 2TDXA 2P7CB 3IRQA 5LGNA 2XKPA 1EH7A 1T0FA 1Y0UA 1MDMA 4EJWA 3D0SA 4KN7X 4AIHA 3R61A 3KP6A 1F1ZA 1RZ4A 3RYPA 3P7NA 4BHBA 3E97A 2VBYA 5BMZA 1Z6RA 2YR2A 5D5UB 1XCBA 4KICA 5LGTA 3K9TA 3H92A 3I4PA 3LQQA 4EJUA 1P2FA 5J6XA 4JQFA 4A6DA 2HWVA 2VODA 1AWCA 4FT8A 1U5TC 4HLYA 5LRSA 2LF7A 2NRAC 2HR3A 5FFZA 2VE9A 1LB2A 1J59A 2EA4A 2M87A 1SMYF 3JTGA 4PGHA 3TKYA 2MBFA 2VOPA 4EQQA 4XRFA 4CDGA 4XSXF 2FNPA 1ONVA 2ZBKA 1B9MA 1K78A 3CUQC 2HZTA 1E17A 2LKPA 2HKXA 3IKTA 2ZMEA 1TNSA 4I0AA 2LDUA 2OU2A 4CGZA 2P7VB 2XV4S 5IT9Z 1DPUA 1WQ2A 4I7HA 4BYYA 5LBQA 2A6EF 4LK0F 3V8KA 3FZVA 5IT3A 4HW0A 4HF0A 1U5TA 3HYIA 4HX7A 2ACJA 2O8XA 3GYHX 4HX4A 1YS7A 2P4WA 3IKVA 3CUQA 4BHCA 4N9IA 5LGUA 4P96A 4P9FA 2GA1A 5D6EA 1TW2A 4MHGA 4G6DA 2DPUA 2E1CA 2ZMEB 2UXXA 3BJ6A 2NAZA 3HRSA 4JK1X 5L3CA 4UV9A 3IRRA 3CO6C 1ZRCA 2BEOA 1VTNC 3BOQA 3GZ6A 2PJPA 5CYVA 4AIJA 1LDJA 1K6OA 5DYMA 1DP7P 3BP8A 3FM3A 4WWCA 1XSVA 1EV7A 4WCGA 1XGOA 4A5MA 3VB2A 5E1ZB 5LEJA 3QP6A 2OQRA 3ML6A 5FLXZ 1S7OA 2V1XA 4O6JA 1ZLJA 1IRFA 3GEZA 5LHGA 4QWQA 5ICGA 1O57A 4OIRF 2L4MA 1TLHB 5ILVA 1MZBA 2BBYA 1D3YA 3BY6A 4I01A 4OIPF 2CSOA 3RI4A 1FLIA 4BHPA 4YIFA 1R5GA 2PI0A 4KDPA 4LLLA 2DTRA 1H9GA 4Q48A 2MA3A 1ODDA 3WTXC 4AWXB 2MD5A 2BYVE 3F72A 4KIGA 4UVAA 1YW8A 5FLXK 2XAJA 1T6SA 3HRTA 3KZZA 1FBSA 1BIBA 1Z9CA 4QLCU 1R1VA 3K69A 3WU0A 2XUBA 2F5DA 3F8NA 1FYMA 2P5VA 1G4DA 4RB2C 3RPQA 1G3SA 5J8CA 4S04A 4P9UA 1TQIA 3WE2A 4O5VA 3WTVC 3BWGA 2FU4A 3L9FA 1XN7A 3H3ZA 2RQPA 3HTSB 1UB9A 3EDPA 2ZJ2A 1SD6A 4R8HA 4LJZF 1PUEE 2DAOA 1ZH5A 4UHTA 1WWXA 2A69F 2L02A 2ESNA 2IRFG 4KFCA 2LNBA 3CJNA 3WGGA 3MQ0A 1OKRA 4L0YB 4A0ZA 2FQ3A 1FP2A 3JSPA 1R1TA 3I59A 2JTVA 5E18F 2ELHA 2GQQA 4KN4X 5BPIA 4DNCA 3ZN0A 4HBLA 3QP5A 1SMTA 3IWFA 5LRRA 3I0TA 2OZ6A 4CZZA 2QZ8A 2PQ8A 1O3RA 1PP7U 1T2KA 3I58A 2DK5A 2FMLA 3LAJA 4IRIA 2DFIA 3K1PA 2HFHA 3HSEA 2DPDA 1IN8A 1MJBA 3E5QA 1H9TA 3ZPLA 2H09A 2GXBA 1I1SA 3V8LA 2P6SA 5JVTA 2QVOA 3I64A 1WI9A 5LEKA 3JAMZ 1IN5A 2M1BA 1SAXA 3SFZA 3F23A 3T0YA 5ED4A 2MLGA 4HV6A 3MFKA 3T8TA 4U88A 3JW4A 3T5XA 3BPXA 5DV5A 5E20A 3LA7A 5AIQA 4HQMA 2GAUA 3GXOA 4GCVA 1UHMA 3TQNA 4ETSA 4K2EA 3BJOA 2B0LA 2PN6A 4HAMA 1V4RA 4WF2A 3JAMK 2H6BA 1J5YA 2KIFA 3GFJA 3R60A 4B8XA 2ESHA 3WTYC 1R7JA 2JPBA 3M1EA 1BC7C 1FZPB 2G7UA 1KA8A 3FMQA 2KJCA 2F5EA 2V1UA 2RV8A 1RI7A 2L4AA 3F8BA 2ISYA 3LQRA 5DCFA 4ZZDA 5D5XB 1I27A 3HTUA 3KP5A 4WXCA 4GGGA 2W84A 1CGPA 3T8RA 1YW7A 4BXUA 2OA4A 2C6YA 4RB0A 2A07F 1W4MA 1W5SA 3RTRA 3TGNA 4ASNA 3TO9A 1ZRDA 3IWZA 5L3DA 3F8FA 5D8KB 3HIFA 2DK8A 3COAC 3MZHA 2FBHA 4R1HA 1IXCA 3W6KB 5BS6A 3U2RA 4I98B 3KLOA 1J0RA 2KKOA 3WTTC 2PEXA 3J7AO 5E8IA 1B4AA 1O3QA 1ZG3A 3CO7C 1B1BA 3BJAA 1ZREA 3DP7A 1W5TA 3K2ZA 2ZNZA 3EQLF 3WE3A 4IJAA 4EV0A 1R58A 4A12A 1EH8A 2K4JA 5HS8A 2HS5A 2VBXA 4WXDA 4RGXA 2QYOA 3L2CA 1BI2A 1JGSA 2PFBA 5K5RA 1I6XA 1MJAA 1HW2A 3V4GA 2CGPA 2EB7A 5D5WB 1XMAA 2J5PA 2CO5A 1B6AA 3D5LA 4Z2YA 2EFQA 5DCMB 2M8EA 4EM0B 4MGRA 1QBJA 3J80K 2E7WA 2KJBA 5JI6A 5HLHA 5KVRA 1PP8F 4CO8A 5BOXA 4YFNF 3RIRA 2AXLA 4FHTA 2QWWA 4HF1A 2O6GE 1RUOA 5H6QA 3M9AA 4UXNA 3C7JA
chains in the Genus database with same CATH superfamily
4IZZA 3BTIA 1R23A 1V5FA 1Z0XA 2GWRA 2EFWA 2RN7A 3MKLA 2A6TA 5FB2A 1YW9A 2QQAA 1HQCA 4PZJA 2HOEA 2QQ9A 1TWCJ 3WTUC 2DMUA 3GLXA 3BG3A 4HDUA 4BDZA 2CU7A 4HZFA 4G6QA 2MSYA 2EJRA 2XAQA 3SFIA 3OOPA 1ZAOA 2X1CA 3MAJA 5D8LB 4U0WA 5DS9A 2JA6J 5ICCA 2NNNA 2VPRA 2R7RA 2Y75A 2RGVA 1S3JA 2BHYA 4R79A 2ZJQF 1JJ6C 2K5CA 1M1EB 4MEXF 2PMHA 1L3LA 4D7MA 3G6EI 1HCRA 1QZZA 2LG4A 1XTAA 5E3OA 2M4KA 3JRAA 1QNTA 2FA5A 1TL8A 3LA2A 1X2NA 1A04A 2MH2A 2BOLA 3CCRI 3FBNB 2XASA 5EJCA 3ASOH 4NC6A 2H27A 5FRMA 2WAEA 4WK8F 2BY3A 2UZKA 1U9OA 3HRMA 2WB1N 1V5GA 3ZMZA 3HDDA 1YHQI 1XDUA 5EEGA 4YEJA 3JRDA 3SZPA 4AVPA 5JFRA 3SQNA 2EPFA 3ISPA 4OU0A 5HDKA 3FX3A 1BW6A 3RCOA 3RSNA 3VEPA 5C4XJ 1P4AA 1MDMB 4A2UA 2D1VA 2KP6A 2MLKA 3C1DA 2EV0A 2VJ4A 3DBLB 2XF7A 5IYDJ 4HX8A 4EJOA 1Y0NA 5FRNA 2O3FA 4RBOA 4CXFA 3W6VA 2DMQA 3F8MA 2K02A 3REOA 4O3MA 1WJEA 2XPVA 2BVMA 2O03A 3L2UA 3CC7I 2LBFA 1H0MA 3CP2A 3I54A 2M7BA 2IVMA 4CCLA 1ETXA 5DD4A 4ZTFA 1Y8RB 2JSPA 5JHFA 2BY0A 4QSHA 3CDIA 2K7LA 3CTAA 2JWTA 4G7ZF 2FOKA 3RKXA 4II2A 3R4KA 1VNDA 4S05A 5F64A 3PNYA 2VJIA 4UY8I 3S15J 2ELKA 1W7PA 4L5JA 4BQNA 1ACIA 1HKQA 2A61A 2EFPA 4XICA 2R7FA 3VYUB 2VJ5A 3SXYA 4NQWA 1MMAA 1F5TA 1JI8A 2VN2A 2V7FA 1JKQC 4UB8C 1MBHA 2FRHA 1EKEA 2JA2A 4DQ2A 1MMSA 3G71I 2F5CA 1X1PA 2L01A 3LAPA 5C4JJ 4Q47A 1RPWA 4NNJA 5F04A 4AYBN 4B09A 3J81Z 3KIOA 1FSEA 2CMPA 2EFOA 2WTEA 1FOWA 3EUKL 1Y56A 3B73A 1MBFA 4I09A 3VYSB 2XAFA 2VQGA 1MNDA 2RQQA 3HM5A 3TOBA 4HQEA 3CLQA 2M7AA 2E5ZA 1OISA 1LDDA 4ON0A 2QA4I 1EF4A 2ZFUA 5IT9K 1FEXA 4XKBA 1K7AA 1K78B 5CVIA 4ENNA 1LE8A 3ZXSA 2DA5A 4MO7A 3QPHA 3ZMUA 3KEOA 3PFIA 4HRIA 5EDNA 4OAZA 2KIUA 3A01A 1AOYA 1DP3A 1FBQA 2CYYA 3DFGA 3JCUC 3CCLI 4Y17A 4DW6A 4NDLA 1XC5A 4HA8A 2I8DA 3FBIB 3ZMTA 2GIVA 1D0YA 2IA2A 2K9MA 1U0JA 2GZWA 4RB1A 2EA2A 1ZG5A 1UG0A 4J00A 1WSUA 2DA2A 2Z33A 4YG2F 1U5TB 3WHCA 1BL0A 3GW2A 3LMMA 5GAHJ 3Q9SA 3ZN1A 1D1BA 1SAUA 4P5OA 4E70A 2IW5A 3ULQB 2VXZA 2DJIA 3HHGA 4L5IA 3J81K 4F7ZA 3OS2A 5FKNA 2R4GA 1VQMI 2CFOA 3EPZA 5J3LA 1RR8C 4G8XA 1BN5A 3D5SC 4XLFA 1Z3XA 2L54A 1Y1WJ 4DBQA 3BTCA 1R6RA 4PJ0C 1YS6A 4A6EA 1TNTA 2L9NA 1JTYA 1FIPA 5CJ9A 5IYBJ 3DPLC 3CUQB 2IS6A 4YFKF 1YRNA 5C3EJ 5TISC 5DUKA 1O3SA 3BT9A 3OYGA 1OYYA 4BBSJ 2M5WA 3ABUA 3ZQQA 1LE8B 4JOMA 4ZYGA 4OIQF 3A01B 1NG7A 2LC2A 4XONA 1I3QJ 2CH0A 2CQ7A 4BBRJ 3KP7A 1KU7A 2PMZN 4BXXJ 3I55I 1S8NA 3GF2A 5E1XA 3KX2A 1KQ8A 3HGYA 1WJDA 1E2XA 3S8PA 2G0EA 2K3FA 1L0OC 3RPUA 3TO6A 1VFCA 1ETQA 3UKGA 4B44A 3GFLA 5FJ8J 1IZ1A 1HA8A 2OTJI 1O7FA 1TWAJ 4KIFA 2M4GA 4XNFA 1X2MA 3ZOBA 2W1OA 4BNCA 1ON2A 1POGA 4CICA 1H8AC 4IEJA 2GM4A 1ZQ3P 3ZR8X 5B5EC 2OPTA 5F6FA 1XS9A 1JE8A 5L3GA 2G9WA 1D0ZA 2ETHA 2CW8A 3OL3A 3ASNH 2Q2EA 5EGOB 4DIQA 2JRTA 1JUSA 2XHKA 3QOEA 3A02A 3K4KA 3WU2C 3M4OJ 2P6TA 2Q1ZB 2YPRA 4F3QA 3H9JA 1XSDA 2KDOA 3DEUA 3FKIJ 3PIPF 4FE4A 2DLLA 5FD5A 4XLEA 5KAIC 4HSTA 3GVAA 1XD7A 2BZTA 2OF7A 2RREA 1MSFC 2EV5A 1GV5A 3I71A 2W24A 2WY7Q 4BE0A 4A3JJ 3HC7A 3BZ6A 2ISZA 2IPQX 4EGZA 2L7ZA 4Y33A 1TZLA 3MCZA 1P92A 3LA3A 4LLNA 4UUSB 2TCTA 4NC8A 3OSGA 4ZZLA 3S16J 1ITYA 4LFUA 4U0VA 4LK1F 4RLFA 1LQ1A 1XB4A 3PNTA 3M3YJ 3CDLA 5TRDA 3KEYA 2JA7J 3JRFA 2EIKH 2EBIA 1HSJA 1SD4A 3GTMJ 2OQGA 3MD2A 4BS9A 4BXFA 1XGNA 2R5YB 4YFXF 3FWEA 4M9SA 4F93B 2UXNA 1HC8A 5F1JA 3Q0VA 2Q2EB 3ZP5A 1R4MB 2CJJA 3NRVA 3C2BA 1F36A 4B48A 1QVUA 2P0WA 1PVEA 2XKOA 2Z1DA 3W6JB 3F8CA 3TO7A 5HDNA 5D4RA 2WBMA 1MW7A 3O2PE 1WFXA 1BM9A 1T33A 3L09A 3K2AA 2EWNA 3FM5A 2ZFWA 1JHFA 2K3PA 3L00A 1KZHA 4BAYA 3RZDJ 2IP2A 4M6YA 4Q4ZF 4AYBA 2DMNA 4U7BA 3OL4A 4XN3A 2DQLA 2JA5J 5CKTA 4XLPF 1D5YA 4KT5C 4JX6A 4MFEA 1R5ID 4IHYA 2E7XA 3GUDA 4ESFA 3H36A 3MZYA 4ZH4F 2LKSA 1I3AA 3DF8A 1G3YA 4Q5SF 1GDTA 1YYVA 2HQ5A 3BR3A 5F1RA 2F2EA 2VT3A 2GBYA 2MH9A 3GFIA 3CQZJ 1I6HJ 1YQAA 4I2OA 1X4OA 3K4CA 2W7NA 2LH9A 5EG0B 3BQYA 5KK1A 2QBYA 5L3EA 1VQ4I 5JLWA 3NEUA 2JJ7A 5EEHA 4V2FA 4XBFA 2D2WA 3R6SA 4CA0A 3O3KA 2X0LA 3JREA 4N4OB 4M73A 3BPVA 1R36A 4KUMA 1VQ5I 1J09A 3EYIA 4Y3OA 4KISA 2Z9OA 5HOOA 2X51A 3IH3A 2HEOA 1ZG1A 3I59B 3TEDA 3AL0B 3CLOA 4A93J 4D5FA 3ZMDA 4IPAA 5HDGA 1NK2P 1S5LC 3SEQA 3S2WA 1OCRH 3QYBA 2F5FA 3M8JA 3OYDA 1FYKA 2R5ZB 3R0AA 4NBQA 5E17F 4ABZA 3E6BA 3SJMA 1USSA 3W2WA 2Y30A 2IJLA 3GFMA 4RM3A 2E2HJ 4PJLA 2DBBA 3RQ4A 1SVOA 4A3LJ 1Z1DA 4E7ZA 4KNYA 3ZMVA 3IHUA 2VB6A 4G7OF 4BJ6C 1WJAA 1MJ9A 1LFBA 2KFDA 5EYRA 2QENA 2HDCA 3MEXA 3DKXA 5HVQC 6PAXA 2BHZA 2DW4A 1UFMA 1MKMA 3K6GA 4DYRA 2W57A 2E2JJ 3ELKA 2PMZA 3KZYA 1VQKI 2VQLA 2X1EA 3LSKA 1RETA 4IHTA 3IC7A 1GXQA 1GHCA 3DPUA 5J40A 4B47A 1ZK8A 5JHUA 1D0XA 3TW7A 1PUFA 1B72B 1DUXC 2CW7A 2AS5F 1QO0D 2R7QA 2HOAA 3WTZA 1P9QC 2GXGA 3KP3A 3NQOA 2DQRA 4L9TA 1S9HA 1LDKB 4UXNA 1RNLA 2ME6A 3J7AY 3HOYJ 2O9LA 4E7HA 1WJ5A 1HSTA 1N75A 1ZTRA 3TDZC 2HTJA 2P81A 2M8GX 4M71A 5B3SH 3KEQA 1WH5A 3QPLA 2RC4A 3BROA 1JUMA 1QZYA 3CUOA 1BJZA 2PLYA 3FHZA 2X9DA 1Y39A 1TWGJ 3E6MA 5AONA 2FF4A 4EVIA 2DYSH 3CP8A 2NS7A 3A1YA 2EFNA 1IXSB 1HKTA 2P5LC 3VSLA 2ZXIA 1I5ZA 1P6RA 4OMYA 3CESA 3GTGJ 2HYFA 4A0YA 1WZ2A 1G8XA 3PL8A 4L9NA 1KU9A 2NOGA 2L0KA 2O8KA 2OD5A 2GXAA 4CZCA 4EEFG 1B59A 1V5EA 3HL2A 3P9CA 3E5UA 1AKHB 4FISA 2MC3A 2V6CA 1IXRC 2VE8A 3H0GJ 4UV8A 1QGPA 2WWYA 4D5CA 3KP4A 2XRNA 5D5VB 5F0HA 1SFUA 1TTYA 2JRMA 3CMMA 3F3XA 4XLNF 4Y15A 4WX9A 1K79A 3KYCB 4D0PA 3A4CA 3M07A 4AU7A 2Y48A 1U8RA 3WU1B 4L0ZB 4GFBA 4PJNA 3OWTA 3QYFA 5FD6A 2QUFA 4ENJA 2HKOA 2BXZA 5F27A 3PQKA 3K1NA 4RAYA 3LWFA 5FKMA 3BR0A 3IAM2 4YIRX 1UJ8A 4LIUA 5CPRB 1U6GA 1IF1A 3DKYA 4FCYA 1SEUA 5K7HA 4RB3C 3C3WA 1FY7A 2ZNYA 1IRGA 1KU2A 2Y2ZA 1N78A 5GADJ 2A5YB 2CQQA 1X3UA 1NTCA 2OJED 1DGRM 1JXSA 3I53A 3HB9A 3ZQHA 4RAZA 2ZJRF 2HVSA 1OQYA 1BW5A 3M8EA 2VOOA 4LGWA 1YX5A 1KYWA 4WXHA 3WGIA 2D45A 4IHSA 1X1DA 2EINH 2QQBA 2IGNA 2IS4A 2NVUB 1ERDA 1ZRFA 1BBYA 1YI2I 4F91B 5E3MA 1N25A 3R0JA 3HBLA 2RDPA 3S17J 4ENMA 1IAWA 1C0WA 2D5VA 4RGRA 3L2QA 3S14J 4MQ9F 3G73A 4MLOA 5M5WJ 5M3FJ 1LEAA 2LF8A 2JQ7A 1R1UA 1MD0A 2M30A 2WAFA 1OFCX 3V8JA 3BG9A 2FMYA 2LD5A 3N05A 4PJJA 3ZCOA 2R92J 2OC6A 1RKWA 4MTEA 2NOJB 3KCCA 2JSCA 3BTLA 1ZELA 3BG5A 5HODA 2VI6A 1IG7A 4BH9A 4HNTA 1VQ7I 2K9QA 2X6YA 1Z6TA 2DDAA 4EM2A 1X1CA 1LEBA 1S7EA 3ABMH 5H2FC 2KRHA 4IVNA 5D4SA 4M6XA 3A0HC 3GZ5A 4RS8A 1A5JA 3DU5A 3E3VA 4EM1A 2ZCWA 3D1NI 1A6IA 3WG9A 3OYHA 3K0LA 2Y0MA 2DT6A 2L7FP 2VKVA 2IT0A 4UUVA 3QPTA 4M3FA 5AIPA 3GTKJ 2BV6A 1ETYA 1Z3YA 4B4CA 1TW3A 1STZA 5FO5A 4BUPA 5K5OA 1RIOH 3Q0WA 1U3EM 1OJLA 1XSXA 2V9PA 4DYQA 4KMFA 1OYIA 2VKHA 4BQAA 4EGYA 4EATA 2DI3A 3DEWA 2HGCA 4M9XA 4V2GA 1KQ9A 3H5NA 5J1RA 1EJ9A 3JSOA 1BI1A 4A3IJ 1U8BA 5CVVA 3H5RA 5ERIA 4KA4A 1TP4A 5HNHA 4UVCA 4IXAA 2KISA 2GIZA 4BE1A 4A3FJ 2XVCA 1IUFA 5ICFA 1S29A 1D8JA 1R00A 2BW3B 3V7RA 2E35A 3A2KA 1XMXA 1S72I 3FXKA 1D8KA 2LTPA 3ABKH 3ABLH 2HNHA 3QODA 1QPIA 3KYLA 2PBIA 2J5OA 5BQTA 3QU6A 2O61A 3G1LA 2ZMEC 3I56I 2L7KA 4MEYF 1H89C 3BDDA 3I9V2 1FSHA 3Q3SA 1IC8A 2XROA 2COMA 4L9JA 1G3TA 2YS9A 5K5QA 2ZC2A 4XM3A 5ICEA 1WKMA 2FNAA 3DU6A 2DT7B 4XKVA 1GT0C 1WH7A 1REPC 3HPGA 2X4HA 1MGTA 2G7HA 4IOCF 5LHHA 2DXIA 5EF6A 3S2DJ 2CUFA 2Q8KA 1E0EA 5DDGA 3MKWB 1UELB 1TC3C 1BI3A 2M0MA 5JVGF 2DFHA 3DTKA 2Q0OA 1I1GA 2W85A 3EUHC 2YU3A 3TBIA 3F6OA 2DA6A 2HQNA 2KRFA 2IA0A 1IRZA 3O6BB 2E71A 5E3LA 5L3FA 1IN6A 1MNEA 3CF5F 1D5VA 1RUNA 1U2WA 1XGSA 2X6XA 3HOSA 3HUGA 3W2VA 2BGCA 4ZJZA 3KZIC 3GLLA 3Q5FA 1IN7A 1YJWI 4I0BA 2FXAA 5J4VA 5IP7J 4XMYA 4CCOA 3ZMSA 4OINF 1K4SA 2HQRA 2Z99A 1SFEA 3FMSA 2IS1A 3L7WA 4Y13A 5TJJA 2KL4A 2CUZA 2M45A 2ZSHB 1TQPA 3GMEA 1GV2A 2XIGA 4PSXA 3RKYA 1VQNI 4B43A 3RKWA 4AUXA 4XL9A 2FSWA 3RZOJ 4CHUA 1VQLI 3NAUA 3LOCA 4YIIA 2ZKZA 5CVJA 4LG0A 3EUHA 3OV8A 3WODF 3U1DA 5GAEJ 2E1MC 3FIWA 3AAFA 1UHWA 1BC8C 2LBFB 2W25A 1ON1A 2W4SA 2BY2A 1ZGAA 4GYGA 2XDVA 1K6YA 2IAIA 2JN6A 2MG4A 5H20A 2V1DA 2EQRA 1MBKA 1HW5A 2O0YA 3B02A 1OPCA 4HSRA 2VBZA 2XSDC 1YJ9I 1HKSA 4XLHA 3KFWX 2VKDA 3G3ZA 1FWZA 3VODA 3OS1A 5B1BH 1MH3A 5HLIA 2ID6A 2L9RA 4CCJA 2WC2A 2WADA 2CQKA 1ULYA 1NHAA 1LVAA 1W7PB 2IGMA 3IH2A 1YFHA 4OOIA 2HYGD 1YTYA 4GYIA 1DPRA 1Z91A 1NH3A 3I4NJ 2CRGA 4M72A 4NQWB 3FHNA 3FXMA 2CW0F 1JJ8C 1S6LA 2QQ8A 1T8IA 2LR8A 1F4KA 2COBA 3WTSC 2V6EA 3SHFA 2LFBA 3BR2A 2R7TA 2KRCA 2IGKA 4AD9A 3N97A 2O7OA 3ZQFA 5JR3A 4Z6YA 3JRIA 5DUIA 4XLCA 5K7ZA 4TV7A 1HF0A 4A3CJ 4EJTA 3QRFF 1X1BA 3CCVI 1LNWA 2K9SA 3AG1H 3GZNB 3LSTA 3KLNA 3MZ8A 2DJNA 3V42A 4LG0B 4HDVA 2JVHA 2DODA 2RNGA 4AIDA 3S3OA 4I02A 4HYEA 5LHIA 5FFXA 3AG2H 3GBGA 4DGWB 2Z5UA 1J9IA 1W0UA 3RQIA 1N77A 1KU3A 5ILUA 5GAGJ 3DPTA 2V9VA 1T39A 2LOOA 4JYKA 4HF2A 2K4BA 5TGTA 3ERMA 4ESJA 2NS0A 3ABTA 5IOZA 2OZUA 2FEZA 4H4KC 1ZGJA 1BOAA 3ECOA 1GVJA 3IL2A 1ZYRF 5DEQA 3DXJF 1WJFA 4UVBA 3VYTB 4XRSG 4EJVA 1FP1D 2AXTC 3T1BA 3VYRB 2HXOA 2FBKA 3V7SA 1Z7LA 2L9VA 1USTA 4AIKA 4IF4A 3ESWB 3HHHA 3DBRB 4PJMA 2V4JC 2W00A 4MFDA 2A3SA 3ECHA 3EYYA 4IHWA 1RESA 3AG4H 4NB5A 5GPCA 3E7LA 3PUBA 5HLTA 1JKRC 4GO1A 1OCZH 4L9VA 3ZQ7A 1YX3A 5HLGA 1IV6A 1LVKA 3N4MA 4G6TB 2XF6A 3OR1C 2Y9ZA 1TBXA 4CYDA 4A5NA 2V79A 1Y6IA 3ZGKA 1BIAA 3ERED 1AHDP 1OMIA 2MFZA 3V7CA 1YRNB 5BPDA 1IV8A 3FISA 4EMSA 4DZPA 2VLAA 4PCQA 3BG7A 2Y0SA 3QYEA 4X1EA 2DA1A 2A05A 5FGMA 1SD5A 2P8TA 3BR6A 1E3HA 2GOMA 1TWFJ 1LFUP 3PO2J 1FBUA 3DV8A 2F4OB 4ZDLA 2VBWA 1S7AA 4LOCA 5J1UA 1O7LA 2JMWA 2VUMJ 1KQ0A 2FUG2 3M8FA 4KMUX 1ZHFA 3B6CA 3HSFA 5E79C 4FX4A 1BR1A 4BJ5C 1YITI 4FTHA 3OIPA 1ZGWA 1SANA 2CV2A 2JUGA 2YX4A 2Z3YA 2B7EA 2NXNB 2PMUA 4M3DA 1ZN2A 4G7HF 1B8IA 1XCVA 2NVQJ 2H6CA 2ZSIB 1FT9A 1BR4A 2R7OA 3FMRA 1FX7A 4CCMA 1I50J 3CJTB 3PUFA 3FXQA 1OYWA 3PNVA 2RNJA 2L9SA 3A0BC 5CVRA 1OCCH 4HOBA 4H0EA 3RYRA 2STTA 3Q0UA 1YG2A 2FBIA 2E60A 2QGUA 5J1YA 3P9KA 1FNNA 1WRJA 2V1NA 5E8GA 2UWMA 4ZYHA 1SD7A 1XDSA 1ZR4A 1MSEC 2FQ4A 1A36A 4DZJA 1XX5A 1X58A 4G94A 4M9ZA 4A69C 4QIWN 3LSGA 2MD0A 4M3GA 4BDYA 2M3AA 2HDWA 4PSWA 3TDUC 4JP0A 1PYVA 1P4XA 4IQJA 3I5UA 2D1HA 1XG1A 4L18B 4XRMA 5ILSA 3F6VA 3RDIA 1CF7A 1FC3A 1V3FA 2EZIA 4E6KG 3MWMA 1PDNC 4KYWA 5J47A 1J7KA 2HPIA 1SFXA 2B63J 3TOAA 3BCBA 3FXRA 4PDKA 3KP2A 1Z7UA 5D6FA 1KGSA 1XGMA 1F9NA 4ZDPA 3SZTA 1LJ9A 2KHMA 2KIMA 3FXUA 1JKOC 2QKLB 4IRHA 3DQVC 4MQVA 2QSHX 5LD2C 2XB5A 3G2BA 2EZLA 4ENKA 3E5XA 2CUJA 1TQMA 2XGXA 3P9IA 4P1WA 2ADUA 4U0YA 3FXOA 2QM3A 3HJEA 2DN0A 4MNUA 5CLSA 1YIOA 2E1NA 2M34A 5F08A 3DBHB 2ELJA 3H3UA 1WCMJ 2RVCA 4P55A 2E34A 3HRUA 1RC9A 3F21A 2K40A 4HV5A 3U1KA 4A0XA 1G59A 2STWA 2ZO4A 2K27A 2P5KA 1LFPA 2VT2A 3HOVJ 3B6AA 1OCPA 1ETOA 2ZJPF 1W36D 4HG2A 1D1AA 1FTTA 1V54H 3K10A 1AU7A 2R93J 3GTJJ 1IN4A 2MYSA 1CF7B 2JUCA 2AO9A 3JTHA 2CWEA 4D1QA 4XORA 4Y7NJ 3CC2I 5FKKA 2CG4A 2OV7A 4OMZA 4ZYEA 3CJQB 3G1OA 4XSZF 2LREA 2DT5A 2DO7A 4OWRB 1HBXG 4UNOA 1JHHA 2CUEA 2K86A 5DD8A 3CCYA 1R49A 4CH7A 3M1CA 3CC4I 4BGDA 5HS9A 5LLQA 2R7DA 2RAEA 3OYMA 2QBYB 3J7ZI 5FROA 2JK3A 3U21A 4X6AJ 4IOAF 3AKZA 2L3DA 5F0CA 3S1MJ 3C2GA 4KIBA 2RKHA 2HZDA 3E6CC 1E3PA 4GDFA 2XAGA 1WJBA 4IQ4A 4OIOF 1QRYA 1OR7C 3HOWJ 2NVYJ 2YSRA 5K1YA 2IBDA 5HNFA 2OBPA 2XF5A 3Q9VA 2YU9J 5E1WA 4PGGA 3W2AA 1JTXA 2DOAA 1YE9A 3VFZA 3CMEI 2DU9A 4IRGA 2VC0A 1RKTA 3GTPJ 2PJRA 1UCRA 1QPMA 2EK5A 1FOKA 1MMNA 2ZXJA 3C18A 1IRXA 2BVLA 5L3BA 2LK2A 3HEFA 2NVXJ 5HS7A 3QU3A 5GTIC 3GX4X 3DKWA 1HW1A 2O5RA 3E6DA 1I39A 1K83J 1GXPA 2L2OA 2DOEA 4GXOA 2F4MB 1DDNA 3HOXJ 1ZLKA 4LB6B 3F22A 1R5HA 1G3WA 4LD5A 2QSGX 3GO5A 5H6RA 3H9GA 1IW7F 2OAZA 2XPWA 2CV1A 1J75A 3QOPA 2KZGA 4UUTA 1SVLA 1OR7A 2PG4A 1NK3P 1JT0A 4A3MJ 1P4WA 2AQEA 4RGUA 2XC7A 3OYBA 1KONA 2WV0A 4LLGF 2R7VA 2VL8A 3VSKA 2JPCA 4ZYDA 1HXDA 2H94A 3L1PA 3M7GA 3K70D 1LKXA 1R4NB 2DA4A 1PUFB 2LY2A 1XMKA 1CQTA 3CD6I 1U78A 1RR7A 2KLOA 2VC1A 3PQJA 2JA8J 3ROUA 1LUJB 2JZYA 3EETA 1J2XA 2QSFX 3QPSA 2PJRB 3J7YJ 4LMYA 3VWBA 3HSRA 1WPKA 5IY5H 4J01A 5DM6F 3U9GA 1DQUA 2HTSA 2LSOA 4M74A 2VXDA 3WGHA 3LSHA 1Q1HA 4N9HA 4C3IJ 1BI0A 2GOXB 5DCMA 1YO5C 1T98A 2OUMA 4AC0A 2XSJC 4HLXA 2V26A 1EH6A 2A68F 4CUGA 3HGGA 4RGSA 2NNYA 1MH4A 3S1NJ 4N0BA 5CVUA 2WV1A 3J80Z 3EUAA 2FE3A 2VONA 1X19A 3KETA 3CDHA 4LB5A 2R3SA 1R22A 2BY1A 4S0HB 1G2HA 3WTWC 4BEHA 3CCJI 1QU3A 3KE2A 3HOTA 2NYXA 1QQIA 1HDPA 1DGWY 5IPAA 3G4SI 1IUYA 3FF5A 1Z67A 5A2QZ 4E4HA 5J8FA 1QVTA 2BE5F 1FYLA 3IV5A 2H8RA 4D7NA 4JBAA 4NC7A 1FIAA 2JT1A 2KQRA 1DU0A 1BR2A 3QAHA 4BQOA 4Y4RA 4YRVA 1O4XA 4C2UA 1ZARA 1YLFA 2LY9A 1T0FC 4C3JJ 3JRCA 2DFFA 3GWZA 4MIMA 4LITA 5GP9A 1B9NA 1FPQA 1Z05A 2XAHA 2DFEA 2NVTJ 1F43A 2LYCA 4J19A 5KHDA 2B9SA 4U7DA 3K70C 4NHJA 1KYZA 4G9YA 3OYAA 4KITB 2GA2A 2EV6A 3FDYA 4ESBA 1W7PD 3K1MA 1G6NA 3LFKA 3VOEA 1O3TA 1IGNA 1JUPA 3H1CA 2XB0X 4IKFA 2ICWG 4E7JA 1BJAA 3RJPA 2IA1A 2YX7A 2ME0A 2CFXA 1T38A 2A6HF 4MTDA 3CF2A 1ORKA 3S32A 3TL4X 1SC7A 5A2QK 5B1AH 2QLZA 1VZ0A 2TDXA 3DLAA 2EZHA 2P7CB 3IRQA 2R7XA 4B1RA 2M0CA 5DTDA 5LGNA 2E36A 2XKPA 1EH7A 3WHBA 1T0FA 3H9QA 4XKCA 1Y0UA 4E7LA 1MDMA 2VIXA 2LY1A 4EJWA 1UAAA 3D0SA 2DOFA 4KN7X 4AIHA 4W97A 3R61A 3S1QJ 3GTOJ 3KP6A 2R0QC 1F1ZA 1RZ4A 3CJRB 2XGCA 1MMDA 3KYDB 3RYPA 3P7NA 4C30A 2R7UA 4BHBA 3E97A 3BLYA 2VBYA 4JX4A 5BMZA 3BTJA 1Z6RA 2YR2A 5D5UB 4C2TA 3C2HA 3UR3C 4HNVA 4L5EA 1XCBA 2Y0SN 1AA7A 4KICA 2VASA 3BCAA 5LGTA 3SEZA 3K9TA 3MMYB 3I4MJ 3OYNA 3H92A 3I4PA 4FASD 1W5CC 4DJAA 3BZCA 3LQQA 4XIDA 4EJUA 4A3BJ 2L5QA 1JKPC 1P2FA 5J6XA 4JQFA 4A6DA 2HWVA 1LPQA 1IO2A 1RRJA 1HLVA 2VODA 1MBGA 4QTRA 1AWCA 1D1CA 4FT8A 1U5TC 1T56A 5FKLA 4HLYA 3SZGA 5LRSA 2X48A 2LF7A 1ENHA 2NRAC 2HR3A 5FFZA 2VE9A 1LB2A 4CCKA 1J59A 2EA4A 3F0CA 4PUSA 2HOTA 2LLKA 2M87A 3ZQGA 1SMYF 3JTGA 4PGHA 3S3NA 3FK6A 3TKYA 1R9TJ 2MBFA 5KAFC 2VOPA 4EQQA 4XRFA 3MKYB 5K7FA 1GVDA 4CDGA 4XSXF 2FNPA 1ONVA 2ZBKA 1B9MA 1K78A 3CUQC 2HZTA 3HKZA 1E17A 2LKPA 2HKXA 3IKTA 2ZMEA 1TNSA 4I0AA 2LDUA 2IGOA 2OU2A 4CGZA 2P7VB 2XV4S 2VJJA 3SYTA 5IP9J 2DMPA 5IT9Z 4GRIA 1DPUA 5EEAA 1BOBA 1WQ2A 4G12A 4I7HA 4M6VA 4BYYA 5LBQA 2A6EF 1FTZA 3CMAI 3E1SA 3RPUD 2X85A 4LK0F 3CCSI 2E1OA 3V8KA 3FZVA 4I99C 1H88C 5IT3A 1SVMA 4HW0A 4HF0A 1U5TA 3HYIA 1WI3A 2IS2A 1WHUA 4HX7A 4FE7A 3VPRA 2ACJA 3MVPA 1XPXA 4F92B 2UUZA 2O8XA 1NG6A 3DLLF 2EIJH 3GYHX 4HX4A 3QQAA 1YS7A 5BNGA 1MMGA 2V9KA 5M5XJ 3JRHA 2XGDA 2P4WA 3IKVA 2YUSA 9ANTA 2EIMH 2KPMA 3CUQA 4BHCA 4N9IA 3OYKA 5LGUA 4BE2A 4P96A 4UB6C 4P9FA 4RLQA 2GA1A 2HPMA 2MW8A 2E5NA 5D6EA 1TT0A 3HUGB 2WAQA 4RDUA 2Y69H 4ZC3A 4C3HJ 1TW2A 4MHGA 3OIQA 3LSRA 4G6DA 2DPUA 2E1CA 2ZMEB 3ZQCA 2UXXA 3OR2C 4U87A 4XN0A 3BJ6A 1MIJA 2E19A 2NAZA 3HRSA 2VKEA 4JK1X 4UV9A 5L3CA 3IRRA 3CO6C 2FOWA 1ZRCA 3K4LA 2BEOA 2KIQA 1VTNC 3MKZA 3BOQA 1Z21A 3DEEA 4I6ZA 2JVGA 2X1DA 3PSIA 3GZ6A 2PJPA 5CYVA 4AIJA 4RM2A 4ZTJA 1LDJA 2X6OA 3X2QH 1K6OA 3D5RC 5DYMA 1DP7P 3BP8A 1ETWA 3FM3A 4WWCA 2WA0A 3LSPA 1R71A 1XSVA 3ONQA 1EV7A 4WCGA 1XGOA 2FD5A 4A5MA 3VB2A 5E1ZB 5LEJA 4CSWA 3QP6A 2OQRA 3ML6A 3TP0A 4XK4A 3CZ6A 5FLXZ 5C44J 1S7OA 3FK7A 4FQGA 5M3MJ 5EGOA 4PFPA 2V1XA 4O6JA 2LMDA 1Q1VA 1ZLJA 1IRFA 4ZDOA 2R7WA 1YJNI 3GEZA 5LHGA 4QWQA 3OYCA 1UG2A 5ICGA 1O57A 4OIRF 1VQOI 3BR5A 1ETKA 2HOSA 1W1WE 3ZQLA 2L4MA 1TLHB 2VQHA 3LFUA 1ZKGA 1T08B 2MGQA 5ILVA 1MZBA 2BBYA 1D3YA 4OAYA 3BY6A 4I01A 2W48A 4OIPF 1UZCA 4UUSA 2CSOA 2HYJA 4DBRA 3RI4A 1FLIA 3I3LA 4BHPA 5FLVA 4YIFA 4PK4A 1R5GA 2PI0A 4QPOA 4ITVA 4KDPA 2W82A 4LLLA 2DTRA 1H9GA 4Q48A 2IEKA 2LVSA 2E1MB 2MA3A 1ODDA 2I10A 3WTXC 4AWXB 2GLOA 3GTQJ 2KT0A 1FJLA 2CQXA 2MD5A 2BYVE 3BR1A 3F72A 3GTLJ 4KIGA 4UVAA 3JRGA 1QHGA 1YW8A 5FLXK 2XAJA 4HNUA 2R5YA 1T6SA 3PSFA 1X3WB 3HRTA 2MABA 3KZZA 1FBSA 1BIBA 3DCFA 5GPAA 4D9JA 4W1UA 2AHQA 2F6CA 1GUUA 1Z9CA 5FKOA 4XKWA 1VF9A 2Y9YA 4QLCU 1R1VA 3K69A 3VDXA 3WU0A 5DM7F 2R7ZJ 2XUBA 2F5DA 2CQNA 3F8NA 1FYMA 3ZQIA 2X6WA 1TT5B 2P5VA 3F9KA 1PJRA 1G4DA 4RB2C 3RPQA 1VQ6I 3AFHA 1G3SA 5J8CA 2H1KA 2WB1A 3LSIA 4ANJA 4S04A 1FOYA 4XR6A 2QEXI 2DYRH 2LP0A 4P9UA 1VQ9I 3AL0C 1P7IA 3HOUJ 3H35A 1TQIA 1X3ZB 3WE2A 4O5VA 3S3MA 3WTVC 3BWGA 4XOTA 1VQPI 2DTZA 2FU4A 3L9FA 1XN7A 1FMVA 3H3ZA 2RQPA 3HTSB 1SFKA 3DWLE 2LRDA 1UB9A 3AG3H 1HDDC 4XOPA 3EDPA 2ZJ2A 2DA3A 4B3AA 4PFOA 5FLMJ 1SD6A 4R8HA 1Z77A 3OS0A 4LJZF 1PUEE 2DAOA 1ZH5A 2ID3A 4UHTA 1WWXA 2KMUA 2A69F 5EG0A 2L02A 2ESNA 1A35A 3CCQI 4AVZA 4F52A 2IRFG 2LNBA 4KFCA 3RKQA 3CJNA 3WGGA 3KPHA 3MQ0A 3OIOA 4BACA 4XRSA 2K85A 1OKRA 5KCMA 4L0YB 4A3EJ 4A0ZA 3FXLA 3E0JB 4AM3A 2XAUA 1Y1VJ 3O8HA 1JGGA 2FQ3A 1FP2A 3JSPA 4CCNA 3H0DA 1R1TA 3I59A 2JTVA 5E18F 1WVRA 2ELHA 1A31A 1X1AA 3L2RA 3CCEI 2GQQA 4ZYAA 4KN4X 5BPIA 1B8IB 1TWHJ 4DNCA 3IP4B 3ZN0A 4HBLA 3QP5A 2R5ZA 1SMTA 3IWFA 5LRRA 2VPLA 1MBJA 4BJTA 3I0TA 4QPQA 3H3VK 5EZGA 2L7MP 5EZHA 2M9HA 2OZ6A 4V19K 1FOXA 4CZZA 2QZ8A 2NS8A 1YIJI 2PQ8A 4IX7A 1O3RA 2PX9A 1PP7U 1T2KA 3I58A 5LFAA 2DK5A 3NWSA 3CCMI 2FMLA 1BA5A 2XRLA 3LAJA 5KNLA 2HI3A 2Y31A 3OYLA 1OLTA 4IRIA 2DFIA 2ZB9A 3K1PA 2HFHA 5M5YJ 4DYCA 2XPUA 2UV1A 3HSEA 3OOUA 3PFYA 4CYCA 2DPDA 1U9NA 2DMTA 2OCEA 1DU6A 2KZVA 1IN8A 1MJBA 3HG9A 2CS3A 3SDBA 3PJRA 3E5QA 1H9TA 3ZPLA 2H09A 3BZKA 2GXBA 4IO9F 3UNGC 4RAGA 1I1SA 2I5UA 3V8LA 2P6SA 5JVTA 2QVOA 1A6QA 2H8WA 3I64A 1WI9A 4BL0B 1B72A 3NWTA 2F48A 5LEKA 3JAMZ 1IN5A 4BU2A 2QF7A 2M1BA 1SAXA 3SFZA 3F23A 1WJCA 3K4NA 3T0YA 2ECBA 5ED4A 4IL6C 4C2MJ 2MLGA 3L2WA 2DCEA 4HV6A 3MFKA 3T8TA 4U88A 4BKXA 1WGXA 2A5WA 5F0FA 3JW4A 4BY7J 3WG7H 3T5XA 3BPXA 5DV5A 5E20A 1FMWA 3FKJA 3K4JA 1K4TA 3LA7A 5AIQA 4HQMA 2GAUA 3GXOA 4GCVA 1UHMA 3TQNA 4ETSA 3JRBA 2KDZA 4K2EA 3LNQA 3OSFA 2ZXHA 3BJOA 3PIOF 2DDBA 2HU9A 2IXSA 2B0LA 1IDYA 3TP3A 4CYCB 3G1MA 2PN6A 3S93A 3BQZA 2HVRA 4HAMA 1W0TA 1AKHA 4A3DJ 1V4RA 2K9LA 5IP6A 3CMYA 4WF2A 3JAMK 2F4IA 4Y52J 3H5AA 4BQQA 4F55A 2FX0A 2H6BA 4II3A 1J5YA 2KIFA 3HOZJ 4M3BA 3GFJA 3R60A 4B8XA 5CQGA 3ZRGA 3FXJA 3SDGA 1P7JA 2ESHA 2HQAA 2WY8Q 3K7AJ 3WTYC 1R7JA 2JPBA 1GLNA 3M1EA 3LL7A 1BC7C 1OCTC 3DTIA 1FZPB 2G7UA 3DTEA 3BC8A 1KA8A 3K4MA 3PO3J 4FETA 3FMQA 3L2VA 2EILH 3HZJA 2DA7A 2HXIA 4DOZA 2KJCA 1W36C 2F5EA 5E3NA 3A03A 2V1UA 3TW6A 2Z2SB 3HKZN 2EZKA 1QA6A 2RV8A 1RI7A 4JX5A 5J4YA 2L4AA 3LSMA 3OYJA 3F8BA 2ISYA 3LQRA 3S1RJ 5DCFA 4IHVA 4YELA 5D5XB 4ZZDA 1MNMC 2CV0A 3P5JA 3OYFA 3K4BA 1SFOJ 1I27A 3HTUA 4KT6A 3KP5A 4WXCA 3IUOA 4GGGA 2W84A 3OMYA 1CGPA 4XLAA 3T8RA 1UHSA 2R7SA 1YW7A 1VI0A 2OA4A 4BXUA 2C6YA 3IAS2 3QWLA 4KJZA 4RB0A 2H1LA 2A07F 2OTLI 1W4MA 1W5SA 3RTRA 1E3OC 3TGNA 2M2EA 4ASNA 3TO9A 1ZRDA 3IWZA 2HVQA 5L3DA 3F8FA 4HPQA 5CQEA 3HPHA 2FJ1A 5D8KB 3HIFA 2DK8A 2TRTA 3COAC 3MZHA 2AQFA 5GTHC 2FBHA 4R1HA 1IXCA 3W6KB 2N8GA 5BS6A 3U2RA 4I98B 2QCOA 3KLOA 1J0RA 4LG3A 2KKOA 2K9NA 4B3XA 3WTTC 3OYIA 1YOVB 3W3CA 4M3EA 2PEXA 4LIVA 1IDZA 3GCMA 2VQCA 5E8IA 1ZR2A 2HDDA 1B4AA 1O3QA 4I76A 1K61A 3J7AO 1ZG3A 3CO7C 4HEA2 1B1BA 4X0GA 4A3GJ 3BJAA 1QZEA 2WAQN 1QHHD 1ZREA 3DP7A 1W5TA 3K2ZA 1ETVA 3IH4A 2ZNZA 3EQLF 3WE3A 3MN2A 3NARA 4IJAA 1JT6A 4EV0A 1R58A 3OY9A 4A12A 3S2HJ 1VQ8I 2F5VA 1X4PA 1EH8A 2K4JA 4NUBA 4RA2A 5HS8A 2XGEA 4XQFA 1APLC 4E7KA 2BXYA 2HS5A 2VBXA 2ECCA 4WXDA 3HXLA 4RGXA 1HOMA 1MBEA 2QYOA 3L2CA 1BI2A 4C9YA 1JGSA 3JR9A 3PM1A 2PFBA 3TMOA 5K5RA 1IJWC 1I6XA 1MJAA 4N4NB 3OYEA 1HW2A 3V4GA 1Y8QB 2CGPA 5IOYA 2EB7A 5D5WB 2OCCH 1V55H 1XMAA 1T95A 2J5PA 2CO5A 1OCOH 1B6AA 3D5LA 3O8GA 4Z2YA 2E2IJ 2EFQA 5DCMB 2M8EA 5JLXA 4MGRA 4EM0B 1QBJA 2MC4A 3J80K 2E7WA 2KJBA 4RAFA 5JI6A 5HLHA 2QKMB 1EA3A 5KVRA 1PP8F 4IHXA 3LSJA 4CO8A 5BOXA 4YFNF 3RIRA 4BY1J 2AXLA 2BW3A 2Z16A 4FHTA 1UMQA 3BG6A 3CCUI 2QWWA 4HF1A 4BEHB 2O6GE 2ZXWH 1RUOA 5H6QA 4A3KJ 4E7SA 2EH3A 4E7IA 4RMNA 2LKXA 5IYCJ 3M9AA 4FX0A 5B66C 3C7JA
chains in the Genus database with same CATH topology
1R23A 2GWRA 2EFWA 2RN7A 5FB2A 1YW9A 2QQAA 1HQCA 4PZJA 2HOEA 2QQ9A 3WTUC 3GLXA 4HDUA 4HZFA 4G6QA 2EJRA 2XAQA 3OOPA 1ZAOA 3MAJA 5D8LB 4U0WA 5ICCA 2NNNA 2Y75A 2RGVA 1S3JA 4R79A 4MEXF 2PMHA 1L3LA 1QZZA 1QNTA 2FA5A 3LA2A 1A04A 2MH2A 2XASA 2H27A 4WK8F 2UZKA 3HRMA 3ZMZA 1XDUA 5EEGA 3SZPA 4AVPA 5JFRA 3SQNA 3ISPA 4OU0A 5HDKA 3FX3A 3VEPA 1P4AA 1MDMB 4A2UA 2D1VA 2MLKA 3C1DA 2EV0A 4HX8A 4EJOA 2O3FA 4CXFA 3F8MA 2K02A 3REOA 4O3MA 2O03A 1H0MA 3I54A 2IVMA 5DD4A 2K7LA 3CTAA 4G7ZF 2FOKA 3RKXA 4S05A 3R4KA 5F64A 1W7PA 4L5JA 1HKQA 2A61A 2EFPA 2R7FA 1F5TA 3SXYA 4NQWA 2VN2A 2FRHA 4DQ2A 2F5CA 2L01A 3LAPA 4Q47A 4B09A 3J81Z 1FSEA 2EFOA 2WTEA 3B73A 4I09A 2XAFA 3TOBA 4HQEA 1LDDA 4ON0A 5IT9K 1K7AA 1K78B 5CVIA 4ENNA 3QPHA 3ZMUA 3KEOA 3PFIA 1AOYA 2KIUA 1FBQA 2CYYA 3DFGA 4Y17A 4HA8A 3ZMTA 2GIVA 2IA2A 2GZWA 4RB1A 2EA2A 1ZG5A 1WSUA 2Z33A 4YG2F 1U5TB 3GW2A 3Q9SA 3ZN1A 4E70A 4P5OA 2IW5A 3ULQB 2VXZA 3HHGA 4L5IA 3J81K 4F7ZA 4G8XA 1BN5A 2L54A 1YS6A 4A6EA 1TNTA 5CJ9A 3DPLC 3CUQB 4YFKF 5DUKA 1O3SA 1OYYA 2M5WA 3ABUA 4ZYGA 4OIQF 1KU7A 3KP7A 1S8NA 3GF2A 5E1XA 1KQ8A 1E2XA 3RPUA 1L0OC 3TO6A 3GFLA 1IZ1A 1O7FA 4KIFA 4BNCA 1ON2A 4CICA 5F6FA 1JE8A 5L3GA 2G9WA 2ETHA 2Q2EA 2JRTA 2XHKA 2P6TA 2YPRA 1XSDA 3DEUA 2DLLA 5FD5A 3GVAA 1XD7A 2EV5A 3I71A 2W24A 3BZ6A 2ISZA 2IPQX 4EGZA 3MCZA 1P92A 3LA3A 4LLNA 4ZZLA 4LFUA 4U0VA 4LK1F 1LQ1A 1XB4A 5TRDA 1HSJA 1SD4A 2OQGA 1XGNA 4YFXF 3FWEA 4M9SA 2UXNA 3ZP5A 3NRVA 2XKOA 3W6JB 3F8CA 3TO7A 5HDNA 5D4RA 3O2PE 1BM9A 3L09A 2EWNA 3FM5A 2ZFWA 1JHFA 3L00A 4BAYA 2IP2A 4M6YA 4Q4ZF 4U7BA 2DQLA 4XLPF 4KT5C 2E7XA 3GUDA 4ESFA 3MZYA 4ZH4F 3DF8A 1G3YA 4Q5SF 5F1RA 1YYVA 2F2EA 2VT3A 2MH9A 3GFIA 1YQAA 4I2OA 5KK1A 2QBYA 5L3EA 3NEUA 5EEHA 4XBFA 2D2WA 3R6SA 3O3KA 2X0LA 4M73A 3BPVA 1R36A 4KUMA 3EYIA 2Z9OA 5HOOA 2HEOA 1ZG1A 3I59B 3CLOA 3ZMDA 4IPAA 5HDGA 3S2WA 2F5FA 1FYKA 3R0AA 5E17F 3E6BA 1USSA 2IJLA 3GFMA 2DBBA 1Z1DA 4KNYA 3ZMVA 3IHUA 4G7OF 1MJ9A 2QENA 2HDCA 3MEXA 5HVQC 6PAXA 2DW4A 1UFMA 1MKMA 2W57A 3ELKA 3KZYA 4IHTA 3IC7A 1GXQA 1GHCA 5JHUA 1DUXC 2AS5F 1QO0D 3WTZA 2GXGA 3KP3A 3NQOA 2DQRA 4L9TA 1LDKB 1RNLA 1HSTA 3TDZC 2HTJA 4M71A 3KEQA 2RC4A 3BROA 1QZYA 3CUOA 2PLYA 3FHZA 3E6MA 5AONA 2FF4A 4EVIA 2EFNA 1IXSB 1HKTA 2P5LC 1I5ZA 1P6RA 4OMYA 2HYFA 4A0YA 4L9NA 1KU9A 2OD5A 1B59A 3P9CA 3E5UA 2MC3A 2V6CA 1IXRC 2VE8A 4UV8A 1QGPA 2WWYA 3KP4A 2XRNA 5D5VB 1SFUA 1TTYA 3F3XA 4XLNF 4Y15A 4WX9A 1K79A 4D0PA 2Y48A 1U8RA 3WU1B 4L0ZB 5FD6A 2QUFA 4ENJA 2HKOA 3PQKA 3K1NA 4RAYA 3LWFA 1U6GA 1IF1A 4RB3C 3C3WA 1FY7A 2ZNYA 1IRGA 1KU2A 2A5YB 1X3UA 1JXSA 3I53A 4RAZA 3M8EA 2VOOA 4LGWA 1KYWA 4WXHA 3WGIA 2D45A 4IHSA 2QQBA 1ZRFA 1BBYA 3R0JA 2RDPA 4ENMA 1IAWA 1C0WA 4RGRA 4MQ9F 3G73A 1LEAA 2LF8A 1R1UA 1MD0A 2M30A 3V8JA 2FMYA 4MTEA 3KCCA 2JSCA 4BH9A 4EM2A 1Z6TA 1LEBA 4IVNA 5D4SA 4M6XA 3GZ5A 4RS8A 3E3VA 4EM1A 2ZCWA 3WG9A 3K0LA 2Y0MA 2IT0A 4UUVA 3QPTA 5AIPA 2BV6A 1TW3A 1STZA 5FO5A 5K5OA 1RIOH 1U3EM 1XSXA 4KMFA 1OYIA 4BQAA 4EGYA 2DI3A 4M9XA 2HGCA 1KQ9A 3JSOA 1BI1A 5CVVA 5ERIA 4KA4A 4UVCA 4IXAA 2XVCA 5ICFA 1S29A 1D8JA 1R00A 3V7RA 1D8KA 2PBIA 2J5OA 5BQTA 3QU6A 2O61A 4MEYF 3BDDA 1FSHA 2XROA 2COMA 4L9JA 1G3TA 5K5QA 5ICEA 1WKMA 2FNAA 1REPC 2X4HA 1MGTA 2G7HA 5LHHA 2Q8KA 5DDGA 1BI3A 2Q0OA 1I1GA 2W85A 2YU3A 3F6OA 2HQNA 2KRFA 2IA0A 3O6BB 5L3FA 1D5VA 1IN6A 1RUNA 1U2WA 1XGSA 3HOSA 3HUGA 2BGCA 3Q5FA 1IN7A 4I0BA 2FXAA 3ZMSA 4OINF 2HQRA 2Z99A 1SFEA 3FMSA 3L7WA 4Y13A 5TJJA 2M45A 1TQPA 2XIGA 3RKYA 3RKWA 2FSWA 4CHUA 4YIIA 2ZKZA 5CVJA 4LG0A 3EUHA 3OV8A 3WODF 3U1DA 3AAFA 1UHWA 1BC8C 2W25A 1ON1A 1ZGAA 4GYGA 5H20A 2V1DA 1HW5A 2O0YA 3B02A 1OPCA 2VBZA 1HKSA 3KFWX 3G3ZA 1FWZA 3VODA 5HLIA 2WC2A 2CQKA 1ULYA 1NHAA 1LVAA 1W7PB 1YFHA 4OOIA 2HYGD 1YTYA 4GYIA 1DPRA 1Z91A 4M72A 2CW0F 1S6LA 1F4KA 3WTSC 3SHFA 4AD9A 3N97A 5JR3A 5DUIA 4TV7A 4EJTA 3QRFF 1LNWA 3LSTA 3KLNA 4LG0B 4HDVA 4I02A 4HYEA 5LHIA 5FFXA 2Z5UA 1J9IA 1KU3A 5ILUA 3DPTA 2V9VA 1T39A 4HF2A 2K4BA 4ESJA 2NS0A 3ABTA 2OZUA 2FEZA 1ZGJA 1BOAA 3ECOA 1GVJA 3IL2A 1ZYRF 5DEQA 3DXJF 4UVBA 4EJVA 1FP1D 3T1BA 2FBKA 3V7SA 1USTA 4AIKA 4IF4A 3HHHA 2A3SA 3ECHA 3EYYA 4NB5A 4GO1A 4L9VA 3ZQ7A 5HLGA 3N4MA 1TBXA 4CYDA 4A5NA 2V79A 1BIAA 3ERED 1OMIA 3V7CA 5BPDA 4EMSA 4PCQA 5FGMA 1SD5A 2P8TA 1FBUA 3DV8A 2VBWA 1S7AA 1O7LA 1KQ0A 3M8FA 4KMUX 1ZHFA 3HSFA 4FX4A 2YX4A 2Z3YA 4G7HF 2PMUA 1ZN2A 1XCVA 2H6CA 1FT9A 3FMRA 1FX7A 3FXQA 1OYWA 2RNJA 5CVRA 4HOBA 4H0EA 3RYRA 2STTA 1YG2A 2FBIA 3P9KA 1FNNA 1WRJA 5E8GA 2UWMA 4ZYHA 1SD7A 1XDSA 4G94A 4M9ZA 3TDUC 1P4XA 3I5UA 2D1HA 4L18B 5ILSA 3F6VA 3RDIA 1CF7A 1FC3A 1V3FA 3MWMA 1PDNC 4KYWA 1J7KA 1SFXA 3TOAA 3FXRA 4PDKA 3KP2A 1Z7UA 5D6FA 1KGSA 1XGMA 1F9NA 3SZTA 1LJ9A 3FXUA 2KIMA 4IRHA 3DQVC 4MQVA 4FX0A 4ENKA 3E5XA 1TQMA 2XGXA 3P9IA 2ADUA 4U0YA 2QM3A 4MNUA 5CLSA 1YIOA 2E1NA 3H3UA 2RVCA 4P55A 3HRUA 3F21A 4A0XA 4HV5A 2STWA 2ZO4A 2K27A 2P5KA 2VT2A 1IN4A 1CF7B 3JTHA 2CWEA 2CG4A 4OMZA 4ZYEA 4XSZF 2DT5A 2DO7A 1HBXG 4UNOA 1JHHA 5DD8A 2K86A 5HS9A 5LLQA 2R7DA 2QBYB 2L3DA 4KIBA 2RKHA 3E6CC 2XAGA 4OIOF 2YSRA 5K1YA 2OBPA 3Q9VA 5E1WA 4PGGA 3VFZA 2DU9A 4IRGA 2VC0A 1UCRA 1QPMA 2EK5A 1FOKA 2ZXJA 3C18A 5L3BA 5HS7A 3QU3A 3GX4X 3DKWA 1HW1A 3E6DA 1GXPA 4GXOA 1DDNA 1ZLKA 4LB6B 3F22A 1R5HA 1G3WA 4LD5A 3GO5A 5H6RA 1IW7F 2OAZA 1J75A 3QOPA 1OR7A 2PG4A 1P4WA 4RGUA 2WV0A 4LLGF 4ZYDA 2JPCA 1HXDA 2H94A 3M7GA 1XMKA 1U78A 2VC1A 3PQJA 3ROUA 2JZYA 3EETA 1J2XA 4LMYA 3HSRA 3U9GA 2LSOA 2HTSA 4M74A 3WGHA 1Q1HA 4N9HA 1BI0A 1YO5C 5DCMA 1T98A 4HLXA 1EH6A 2A68F 4RGSA 2NNYA 4N0BA 5CVUA 3J80Z 2FE3A 2VONA 3KETA 3CDHA 4LB5A 2R3SA 1R22A 3WTWC 3KE2A 3HOTA 2NYXA 1QQIA 1IUYA 3FF5A 5A2QZ 5J8FA 2BE5F 1FYLA 4JBAA 2JT1A 3QAHA 1ZARA 1YLFA 3GWZA 1B9NA 1FPQA 1Z05A 2XAHA 4U7DA 4NHJA 1KYZA 4G9YA 2GA2A 2EV6A 4ESBA 1W7PD 3K1MA 1G6NA 3LFKA 3VOEA 1O3TA 1BJAA 3RJPA 2IA1A 2YX7A 1T38A 2CFXA 2A6HF 4MTDA 5A2QK 2QLZA 2TDXA 2P7CB 3IRQA 5LGNA 2XKPA 1EH7A 1T0FA 1Y0UA 1MDMA 4EJWA 3D0SA 4KN7X 4AIHA 3R61A 3KP6A 1F1ZA 1RZ4A 3RYPA 3P7NA 4BHBA 3E97A 2VBYA 5BMZA 1Z6RA 2YR2A 5D5UB 1XCBA 4KICA 5LGTA 3K9TA 3H92A 3I4PA 3LQQA 4EJUA 1P2FA 5J6XA 4JQFA 4A6DA 2HWVA 2VODA 1AWCA 4FT8A 1U5TC 4HLYA 5LRSA 2LF7A 2NRAC 2HR3A 5FFZA 2VE9A 1LB2A 1J59A 2EA4A 2M87A 1SMYF 3JTGA 4PGHA 3TKYA 2MBFA 2VOPA 4EQQA 4XRFA 4CDGA 4XSXF 2FNPA 1ONVA 2ZBKA 1B9MA 1K78A 3CUQC 2HZTA 1E17A 2LKPA 2HKXA 3IKTA 2ZMEA 1TNSA 4I0AA 2LDUA 2OU2A 4CGZA 2P7VB 2XV4S 5IT9Z 1DPUA 1WQ2A 4I7HA 4BYYA 5LBQA 2A6EF 4LK0F 3V8KA 3FZVA 5IT3A 4HW0A 4HF0A 1U5TA 3HYIA 4HX7A 2ACJA 2O8XA 3GYHX 4HX4A 1YS7A 2P4WA 3IKVA 3CUQA 4BHCA 4N9IA 5LGUA 4P96A 4P9FA 2GA1A 5D6EA 1TW2A 4MHGA 4G6DA 2DPUA 2E1CA 2ZMEB 2UXXA 3BJ6A 2NAZA 3HRSA 4JK1X 5L3CA 4UV9A 3IRRA 3CO6C 1ZRCA 2BEOA 1VTNC 3BOQA 3GZ6A 2PJPA 5CYVA 4AIJA 1LDJA 1K6OA 5DYMA 1DP7P 3BP8A 3FM3A 4WWCA 1XSVA 1EV7A 4WCGA 1XGOA 4A5MA 3VB2A 5E1ZB 5LEJA 3QP6A 2OQRA 3ML6A 5FLXZ 1S7OA 2V1XA 4O6JA 1ZLJA 1IRFA 3GEZA 5LHGA 4QWQA 5ICGA 1O57A 4OIRF 2L4MA 1TLHB 5ILVA 1MZBA 2BBYA 1D3YA 3BY6A 4I01A 4OIPF 2CSOA 3RI4A 1FLIA 4BHPA 4YIFA 1R5GA 2PI0A 4KDPA 4LLLA 2DTRA 1H9GA 4Q48A 2MA3A 1ODDA 3WTXC 4AWXB 2MD5A 2BYVE 3F72A 4KIGA 4UVAA 1YW8A 5FLXK 2XAJA 1T6SA 3HRTA 3KZZA 1FBSA 1BIBA 1Z9CA 4QLCU 1R1VA 3K69A 3WU0A 2XUBA 2F5DA 3F8NA 1FYMA 2P5VA 1G4DA 4RB2C 3RPQA 1G3SA 5J8CA 4S04A 4P9UA 1TQIA 3WE2A 4O5VA 3WTVC 3BWGA 2FU4A 3L9FA 1XN7A 3H3ZA 2RQPA 3HTSB 1UB9A 3EDPA 2ZJ2A 1SD6A 4R8HA 4LJZF 1PUEE 2DAOA 1ZH5A 4UHTA 1WWXA 2A69F 2L02A 2ESNA 2IRFG 4KFCA 2LNBA 3CJNA 3WGGA 3MQ0A 1OKRA 4L0YB 4A0ZA 2FQ3A 1FP2A 3JSPA 1R1TA 3I59A 2JTVA 5E18F 2ELHA 2GQQA 4KN4X 5BPIA 4DNCA 3ZN0A 4HBLA 3QP5A 1SMTA 3IWFA 5LRRA 3I0TA 2OZ6A 4CZZA 2QZ8A 2PQ8A 1O3RA 1PP7U 1T2KA 3I58A 2DK5A 2FMLA 3LAJA 4IRIA 2DFIA 3K1PA 2HFHA 3HSEA 2DPDA 1IN8A 1MJBA 3E5QA 1H9TA 3ZPLA 2H09A 2GXBA 1I1SA 3V8LA 2P6SA 5JVTA 2QVOA 3I64A 1WI9A 5LEKA 3JAMZ 1IN5A 2M1BA 1SAXA 3SFZA 3F23A 3T0YA 5ED4A 2MLGA 4HV6A 3MFKA 3T8TA 4U88A 3JW4A 3T5XA 3BPXA 5DV5A 5E20A 3LA7A 5AIQA 4HQMA 2GAUA 3GXOA 4GCVA 1UHMA 3TQNA 4ETSA 4K2EA 3BJOA 2B0LA 2PN6A 4HAMA 1V4RA 4WF2A 3JAMK 2H6BA 1J5YA 2KIFA 3GFJA 3R60A 4B8XA 2ESHA 3WTYC 1R7JA 2JPBA 3M1EA 1BC7C 1FZPB 2G7UA 1KA8A 3FMQA 2KJCA 2F5EA 2V1UA 2RV8A 1RI7A 2L4AA 3F8BA 2ISYA 3LQRA 5DCFA 4ZZDA 5D5XB 1I27A 3HTUA 3KP5A 4WXCA 4GGGA 2W84A 1CGPA 3T8RA 1YW7A 4BXUA 2OA4A 2C6YA 4RB0A 2A07F 1W4MA 1W5SA 3RTRA 3TGNA 4ASNA 3TO9A 1ZRDA 3IWZA 5L3DA 3F8FA 5D8KB 3HIFA 2DK8A 3COAC 3MZHA 2FBHA 4R1HA 1IXCA 3W6KB 5BS6A 3U2RA 4I98B 3KLOA 1J0RA 2KKOA 3WTTC 2PEXA 3J7AO 5E8IA 1B4AA 1O3QA 1ZG3A 3CO7C 1B1BA 3BJAA 1ZREA 3DP7A 1W5TA 3K2ZA 2ZNZA 3EQLF 3WE3A 4IJAA 4EV0A 1R58A 4A12A 1EH8A 2K4JA 5HS8A 2HS5A 2VBXA 4WXDA 4RGXA 2QYOA 3L2CA 1BI2A 1JGSA 2PFBA 5K5RA 1I6XA 1MJAA 1HW2A 3V4GA 2CGPA 2EB7A 5D5WB 1XMAA 2J5PA 2CO5A 1B6AA 3D5LA 4Z2YA 2EFQA 5DCMB 2M8EA 4EM0B 4MGRA 1QBJA 3J80K 2E7WA 2KJBA 5JI6A 5HLHA 5KVRA 1PP8F 4CO8A 5BOXA 4YFNF 3RIRA 2AXLA 4FHTA 2QWWA 4HF1A 2O6GE 1RUOA 5H6QA 3M9AA 4UXNA 3C7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R23 A;  2GWR A;  2EFW A;  2RN7 A;  5FB2 A;  1YW9 A;  2QQA A;  1HQC A;  4PZJ A;  2HOE A;  2QQ9 A;  3WTU C;  3GLX A;  4HDU A;  4HZF A;  4G6Q A;  2EJR A;  2XAQ A;  3OOP A;  1ZAO A;  3MAJ A;  5D8L B;  4U0W A;  5ICC A;  2NNN A;  2Y75 A;  2RGV A;  1S3J A;  4R79 A;  4MEX F;  2PMH A;  1L3L A;  1QZZ A;  1QNT A;  2FA5 A;  3LA2 A;  1A04 A;  2MH2 A;  2XAS A;  2H27 A;  4WK8 F;  2UZK A;  3HRM A;  3ZMZ A;  1XDU A;  5EEG A;  3SZP A;  4AVP A;  5JFR A;  3SQN A;  3ISP A;  4OU0 A;  5HDK A;  3FX3 A;  3VEP A;  1P4A A;  1MDM B;  4A2U A;  2D1V A;  2MLK A;  3C1D A;  2EV0 A;  4HX8 A;  4EJO A;  2O3F A;  4CXF A;  3F8M A;  2K02 A;  3REO A;  4O3M A;  2O03 A;  1H0M A;  3I54 A;  2IVM A;  5DD4 A;  2K7L A;  3CTA A;  4G7Z F;  2FOK A;  3RKX A;  4S05 A;  3R4K A;  5F64 A;  1W7P A;  4L5J A;  1HKQ A;  2A61 A;  2EFP A;  2R7F A;  1F5T A;  3SXY A;  4NQW A;  2VN2 A;  2FRH A;  4DQ2 A;  2F5C A;  2L01 A;  3LAP A;  4Q47 A;  4B09 A;  3J81 Z;  1FSE A;  2EFO A;  2WTE A;  3B73 A;  4I09 A;  2XAF A;  3TOB A;  4HQE A;  1LDD A;  4ON0 A;  5IT9 K;  1K7A A;  1K78 B;  5CVI A;  4ENN A;  3QPH A;  3ZMU A;  3KEO A;  3PFI A;  1AOY A;  2KIU A;  1FBQ A;  2CYY A;  3DFG A;  4Y17 A;  4HA8 A;  3ZMT A;  2GIV A;  2IA2 A;  2GZW A;  4RB1 A;  2EA2 A;  1ZG5 A;  1WSU A;  2Z33 A;  4YG2 F;  1U5T B;  3GW2 A;  3Q9S A;  3ZN1 A;  4E70 A;  4P5O A;  2IW5 A;  3ULQ B;  2VXZ A;  3HHG A;  4L5I A;  3J81 K;  4F7Z A;  4G8X A;  1BN5 A;  2L54 A;  1YS6 A;  4A6E A;  1TNT A;  5CJ9 A;  3DPL C;  3CUQ B;  4YFK F;  5DUK A;  1O3S A;  1OYY A;  2M5W A;  3ABU A;  4ZYG A;  4OIQ F;  1KU7 A;  3KP7 A;  1S8N A;  3GF2 A;  5E1X A;  1KQ8 A;  1E2X A;  3RPU A;  1L0O C;  3TO6 A;  3GFL A;  1IZ1 A;  1O7F A;  4KIF A;  4BNC A;  1ON2 A;  4CIC A;  5F6F A;  1JE8 A;  5L3G A;  2G9W A;  2ETH A;  2Q2E A;  2JRT A;  2XHK A;  2P6T A;  2YPR A;  1XSD A;  3DEU A;  2DLL A;  5FD5 A;  3GVA A;  1XD7 A;  2EV5 A;  3I71 A;  2W24 A;  3BZ6 A;  2ISZ A;  2IPQ X;  4EGZ A;  3MCZ A;  1P92 A;  3LA3 A;  4LLN A;  4ZZL A;  4LFU A;  4U0V A;  4LK1 F;  1LQ1 A;  1XB4 A;  5TRD A;  1HSJ A;  1SD4 A;  2OQG A;  1XGN A;  4YFX F;  3FWE A;  4M9S A;  2UXN A;  3ZP5 A;  3NRV A;  2XKO A;  3W6J B;  3F8C A;  3TO7 A;  5HDN A;  5D4R A;  3O2P E;  1BM9 A;  3L09 A;  2EWN A;  3FM5 A;  2ZFW A;  1JHF A;  3L00 A;  4BAY A;  2IP2 A;  4M6Y A;  4Q4Z F;  4U7B A;  2DQL A;  4XLP F;  4KT5 C;  2E7X A;  3GUD A;  4ESF A;  3MZY A;  4ZH4 F;  3DF8 A;  1G3Y A;  4Q5S F;  5F1R A;  1YYV A;  2F2E A;  2VT3 A;  2MH9 A;  3GFI A;  1YQA A;  4I2O A;  5KK1 A;  2QBY A;  5L3E A;  3NEU A;  5EEH A;  4XBF A;  2D2W A;  3R6S A;  3O3K A;  2X0L A;  4M73 A;  3BPV A;  1R36 A;  4KUM A;  3EYI A;  2Z9O A;  5HOO A;  2HEO A;  1ZG1 A;  3I59 B;  3CLO A;  3ZMD A;  4IPA A;  5HDG A;  3S2W A;  2F5F A;  1FYK A;  3R0A A;  5E17 F;  3E6B A;  1USS A;  2IJL A;  3GFM A;  2DBB A;  1Z1D A;  4KNY A;  3ZMV A;  3IHU A;  4G7O F;  1MJ9 A;  2QEN A;  2HDC A;  3MEX A;  5HVQ C;  6PAX A;  2DW4 A;  1UFM A;  1MKM A;  2W57 A;  3ELK A;  3KZY A;  4IHT A;  3IC7 A;  1GXQ A;  1GHC A;  5JHU A;  1DUX C;  2AS5 F;  1QO0 D;  3WTZ A;  2GXG A;  3KP3 A;  3NQO A;  2DQR A;  4L9T A;  1LDK B;  1RNL A;  1HST A;  3TDZ C;  2HTJ A;  4M71 A;  3KEQ A;  2RC4 A;  3BRO A;  1QZY A;  3CUO A;  2PLY A;  3FHZ A;  3E6M A;  5AON A;  2FF4 A;  4EVI A;  2EFN A;  1IXS B;  1HKT A;  2P5L C;  1I5Z A;  1P6R A;  4OMY A;  2HYF A;  4A0Y A;  4L9N A;  1KU9 A;  2OD5 A;  1B59 A;  3P9C A;  3E5U A;  2MC3 A;  2V6C A;  1IXR C;  2VE8 A;  4UV8 A;  1QGP A;  2WWY A;  3KP4 A;  2XRN A;  5D5V B;  1SFU A;  1TTY A;  3F3X A;  4XLN F;  4Y15 A;  4WX9 A;  1K79 A;  4D0P A;  2Y48 A;  1U8R A;  3WU1 B;  4L0Z B;  5FD6 A;  2QUF A;  4ENJ A;  2HKO A;  3PQK A;  3K1N A;  4RAY A;  3LWF A;  1U6G A;  1IF1 A;  4RB3 C;  3C3W A;  1FY7 A;  2ZNY A;  1IRG A;  1KU2 A;  2A5Y B;  1X3U A;  1JXS A;  3I53 A;  4RAZ A;  3M8E A;  2VOO A;  4LGW A;  1KYW A;  4WXH A;  3WGI A;  2D45 A;  4IHS A;  2QQB A;  1ZRF A;  1BBY A;  3R0J A;  2RDP A;  4ENM A;  1IAW A;  1C0W A;  4RGR A;  4MQ9 F;  3G73 A;  1LEA A;  2LF8 A;  1R1U A;  1MD0 A;  2M30 A;  3V8J A;  2FMY A;  4MTE A;  3KCC A;  2JSC A;  4BH9 A;  4EM2 A;  1Z6T A;  1LEB A;  4IVN A;  5D4S A;  4M6X A;  3GZ5 A;  4RS8 A;  3E3V A;  4EM1 A;  2ZCW A;  3WG9 A;  3K0L A;  2Y0M A;  2IT0 A;  4UUV A;  3QPT A;  5AIP A;  2BV6 A;  1TW3 A;  1STZ A;  5FO5 A;  5K5O A;  1RIO H;  1U3E M;  1XSX A;  4KMF A;  1OYI A;  4BQA A;  4EGY A;  2DI3 A;  4M9X A;  2HGC A;  1KQ9 A;  3JSO A;  1BI1 A;  5CVV A;  5ERI A;  4KA4 A;  4UVC A;  4IXA A;  2XVC A;  5ICF A;  1S29 A;  1D8J A;  1R00 A;  3V7R A;  1D8K A;  2PBI A;  2J5O A;  5BQT A;  3QU6 A;  2O61 A;  4MEY F;  3BDD A;  1FSH A;  2XRO A;  2COM A;  4L9J A;  1G3T A;  5K5Q A;  5ICE A;  1WKM A;  2FNA A;  1REP C;  2X4H A;  1MGT A;  2G7H A;  5LHH A;  2Q8K A;  5DDG A;  1BI3 A;  2Q0O A;  1I1G A;  2W85 A;  2YU3 A;  3F6O A;  2HQN A;  2KRF A;  2IA0 A;  3O6B B;  5L3F A;  1D5V A;  1IN6 A;  1RUN A;  1U2W A;  1XGS A;  3HOS A;  3HUG A;  2BGC A;  3Q5F A;  1IN7 A;  4I0B A;  2FXA A;  3ZMS A;  4OIN F;  2HQR A;  2Z99 A;  1SFE A;  3FMS A;  3L7W A;  4Y13 A;  5TJJ A;  2M45 A;  1TQP A;  2XIG A;  3RKY A;  3RKW A;  2FSW A;  4CHU A;  4YII A;  2ZKZ A;  5CVJ A;  4LG0 A;  3EUH A;  3OV8 A;  3WOD F;  3U1D A;  3AAF A;  1UHW A;  1BC8 C;  2W25 A;  1ON1 A;  1ZGA A;  4GYG A;  5H20 A;  2V1D A;  1HW5 A;  2O0Y A;  3B02 A;  1OPC A;  2VBZ A;  1HKS A;  3KFW X;  3G3Z A;  1FWZ A;  3VOD A;  5HLI A;  2WC2 A;  2CQK A;  1ULY A;  1NHA A;  1LVA A;  1W7P B;  1YFH A;  4OOI A;  2HYG D;  1YTY A;  4GYI A;  1DPR A;  1Z91 A;  4M72 A;  2CW0 F;  1S6L A;  1F4K A;  3WTS C;  3SHF A;  4AD9 A;  3N97 A;  5JR3 A;  5DUI A;  4TV7 A;  4EJT A;  3QRF F;  1LNW A;  3LST A;  3KLN A;  4LG0 B;  4HDV A;  4I02 A;  4HYE A;  5LHI A;  5FFX A;  2Z5U A;  1J9I A;  1KU3 A;  5ILU A;  3DPT A;  2V9V A;  1T39 A;  4HF2 A;  2K4B A;  4ESJ A;  2NS0 A;  3ABT A;  2OZU A;  2FEZ A;  1ZGJ A;  1BOA A;  3ECO A;  1GVJ A;  3IL2 A;  1ZYR F;  5DEQ A;  3DXJ F;  4UVB A;  4EJV A;  1FP1 D;  3T1B A;  2FBK A;  3V7S A;  1UST A;  4AIK A;  4IF4 A;  3HHH A;  2A3S A;  3ECH A;  3EYY A;  4NB5 A;  4GO1 A;  4L9V A;  3ZQ7 A;  5HLG A;  3N4M A;  1TBX A;  4CYD A;  4A5N A;  2V79 A;  1BIA A;  3ERE D;  1OMI A;  3V7C A;  5BPD A;  4EMS A;  4PCQ A;  5FGM A;  1SD5 A;  2P8T A;  1FBU A;  3DV8 A;  2VBW A;  1S7A A;  1O7L A;  1KQ0 A;  3M8F A;  4KMU X;  1ZHF A;  3HSF A;  4FX4 A;  2YX4 A;  2Z3Y A;  4G7H F;  2PMU A;  1ZN2 A;  1XCV A;  2H6C A;  1FT9 A;  3FMR A;  1FX7 A;  3FXQ A;  1OYW A;  2RNJ A;  5CVR A;  4HOB A;  4H0E A;  3RYR A;  2STT A;  1YG2 A;  2FBI A;  3P9K A;  1FNN A;  1WRJ A;  5E8G A;  2UWM A;  4ZYH A;  1SD7 A;  1XDS A;  4G94 A;  4M9Z A;  3TDU C;  1P4X A;  3I5U A;  2D1H A;  4L18 B;  5ILS A;  3F6V A;  3RDI A;  1CF7 A;  1FC3 A;  1V3F A;  3MWM A;  1PDN C;  4KYW A;  1J7K A;  1SFX A;  3TOA A;  3FXR A;  4PDK A;  3KP2 A;  1Z7U A;  5D6F A;  1KGS A;  1XGM A;  1F9N A;  3SZT A;  1LJ9 A;  3FXU A;  2KIM A;  4IRH A;  3DQV C;  4MQV A;  4FX0 A;  4ENK A;  3E5X A;  1TQM A;  2XGX A;  3P9I A;  2ADU A;  4U0Y A;  2QM3 A;  4MNU A;  5CLS A;  1YIO A;  2E1N A;  3H3U A;  2RVC A;  4P55 A;  3HRU A;  3F21 A;  4A0X A;  4HV5 A;  2STW A;  2ZO4 A;  2K27 A;  2P5K A;  2VT2 A;  1IN4 A;  1CF7 B;  3JTH A;  2CWE A;  2CG4 A;  4OMZ A;  4ZYE A;  4XSZ F;  2DT5 A;  2DO7 A;  1HBX G;  4UNO A;  1JHH A;  5DD8 A;  2K86 A;  5HS9 A;  5LLQ A;  2R7D A;  2QBY B;  2L3D A;  4KIB A;  2RKH A;  3E6C C;  2XAG A;  4OIO F;  2YSR A;  5K1Y A;  2OBP A;  3Q9V A;  5E1W A;  4PGG A;  3VFZ A;  2DU9 A;  4IRG A;  2VC0 A;  1UCR A;  1QPM A;  2EK5 A;  1FOK A;  2ZXJ A;  3C18 A;  5L3B A;  5HS7 A;  3QU3 A;  3GX4 X;  3DKW A;  1HW1 A;  3E6D A;  1GXP A;  4GXO A;  1DDN A;  1ZLK A;  4LB6 B;  3F22 A;  1R5H A;  1G3W A;  4LD5 A;  3GO5 A;  5H6R A;  1IW7 F;  2OAZ A;  1J75 A;  3QOP A;  1OR7 A;  2PG4 A;  1P4W A;  4RGU A;  2WV0 A;  4LLG F;  4ZYD A;  2JPC A;  1HXD A;  2H94 A;  3M7G A;  1XMK A;  1U78 A;  2VC1 A;  3PQJ A;  3ROU A;  2JZY A;  3EET A;  1J2X A;  4LMY A;  3HSR A;  3U9G A;  2LSO A;  2HTS A;  4M74 A;  3WGH A;  1Q1H A;  4N9H A;  1BI0 A;  1YO5 C;  5DCM A;  1T98 A;  4HLX A;  1EH6 A;  2A68 F;  4RGS A;  2NNY A;  4N0B A;  5CVU A;  3J80 Z;  2FE3 A;  2VON A;  3KET A;  3CDH A;  4LB5 A;  2R3S A;  1R22 A;  3WTW C;  3KE2 A;  3HOT A;  2NYX A;  1QQI A;  1IUY A;  3FF5 A;  5A2Q Z;  5J8F A;  2BE5 F;  1FYL A;  4JBA A;  2JT1 A;  3QAH A;  1ZAR A;  1YLF A;  3GWZ A;  1B9N A;  1FPQ A;  1Z05 A;  2XAH A;  4U7D A;  4NHJ A;  1KYZ A;  4G9Y A;  2GA2 A;  2EV6 A;  4ESB A;  1W7P D;  3K1M A;  1G6N A;  3LFK A;  3VOE A;  1O3T A;  1BJA A;  3RJP A;  2IA1 A;  2YX7 A;  1T38 A;  2CFX A;  2A6H F;  4MTD A;  5A2Q K;  2QLZ A;  2TDX A;  2P7C B;  3IRQ A;  5LGN A;  2XKP A;  1EH7 A;  1T0F A;  1Y0U A;  1MDM A;  4EJW A;  3D0S A;  4KN7 X;  4AIH A;  3R61 A;  3KP6 A;  1F1Z A;  1RZ4 A;  3RYP A;  3P7N A;  4BHB A;  3E97 A;  2VBY A;  5BMZ A;  1Z6R A;  2YR2 A;  5D5U B;  1XCB A;  4KIC A;  5LGT A;  3K9T A;  3H92 A;  3I4P A;  3LQQ A;  4EJU A;  1P2F A;  5J6X A;  4JQF A;  4A6D A;  2HWV A;  2VOD A;  1AWC A;  4FT8 A;  1U5T C;  4HLY A;  5LRS A;  2LF7 A;  2NRA C;  2HR3 A;  5FFZ A;  2VE9 A;  1LB2 A;  1J59 A;  2EA4 A;  2M87 A;  1SMY F;  3JTG A;  4PGH A;  3TKY A;  2MBF A;  2VOP A;  4EQQ A;  4XRF A;  4CDG A;  4XSX F;  2FNP A;  1ONV A;  2ZBK A;  1B9M A;  1K78 A;  3CUQ C;  2HZT A;  1E17 A;  2LKP A;  2HKX A;  3IKT A;  2ZME A;  1TNS A;  4I0A A;  2LDU A;  2OU2 A;  4CGZ A;  2P7V B;  2XV4 S;  5IT9 Z;  1DPU A;  1WQ2 A;  4I7H A;  4BYY A;  5LBQ A;  2A6E F;  4LK0 F;  3V8K A;  3FZV A;  5IT3 A;  4HW0 A;  4HF0 A;  1U5T A;  3HYI A;  4HX7 A;  2ACJ A;  2O8X A;  3GYH X;  4HX4 A;  1YS7 A;  2P4W A;  3IKV A;  3CUQ A;  4BHC A;  4N9I A;  5LGU A;  4P96 A;  4P9F A;  2GA1 A;  5D6E A;  1TW2 A;  4MHG A;  4G6D A;  2DPU A;  2E1C A;  2ZME B;  2UXX A;  3BJ6 A;  2NAZ A;  3HRS A;  4JK1 X;  5L3C A;  4UV9 A;  3IRR A;  3CO6 C;  1ZRC A;  2BEO A;  1VTN C;  3BOQ A;  3GZ6 A;  2PJP A;  5CYV A;  4AIJ A;  1LDJ A;  1K6O A;  5DYM A;  1DP7 P;  3BP8 A;  3FM3 A;  4WWC A;  1XSV A;  1EV7 A;  4WCG A;  1XGO A;  4A5M A;  3VB2 A;  5E1Z B;  5LEJ A;  3QP6 A;  2OQR A;  3ML6 A;  5FLX Z;  1S7O A;  2V1X A;  4O6J A;  1ZLJ A;  1IRF A;  3GEZ A;  5LHG A;  4QWQ A;  5ICG A;  1O57 A;  4OIR F;  2L4M A;  1TLH B;  5ILV A;  1MZB A;  2BBY A;  1D3Y A;  3BY6 A;  4I01 A;  4OIP F;  2CSO A;  3RI4 A;  1FLI A;  4BHP A;  4YIF A;  1R5G A;  2PI0 A;  4KDP A;  4LLL A;  2DTR A;  1H9G A;  4Q48 A;  2MA3 A;  1ODD A;  3WTX C;  4AWX B;  2MD5 A;  2BYV E;  3F72 A;  4KIG A;  4UVA A;  1YW8 A;  5FLX K;  2XAJ A;  1T6S A;  3HRT A;  3KZZ A;  1FBS A;  1BIB A;  1Z9C A;  4QLC U;  1R1V A;  3K69 A;  3WU0 A;  2XUB A;  2F5D A;  3F8N A;  1FYM A;  2P5V A;  1G4D A;  4RB2 C;  3RPQ A;  1G3S A;  5J8C A;  4S04 A;  4P9U A;  1TQI A;  3WE2 A;  4O5V A;  3WTV C;  3BWG A;  2FU4 A;  3L9F A;  1XN7 A;  3H3Z A;  2RQP A;  3HTS B;  1UB9 A;  3EDP A;  2ZJ2 A;  1SD6 A;  4R8H A;  4LJZ F;  1PUE E;  2DAO A;  1ZH5 A;  4UHT A;  1WWX A;  2A69 F;  2L02 A;  2ESN A;  2IRF G;  4KFC A;  2LNB A;  3CJN A;  3WGG A;  3MQ0 A;  1OKR A;  4L0Y B;  4A0Z A;  2FQ3 A;  1FP2 A;  3JSP A;  1R1T A;  3I59 A;  2JTV A;  5E18 F;  2ELH A;  2GQQ A;  4KN4 X;  5BPI A;  4DNC A;  3ZN0 A;  4HBL A;  3QP5 A;  1SMT A;  3IWF A;  5LRR A;  3I0T A;  2OZ6 A;  4CZZ A;  2QZ8 A;  2PQ8 A;  1O3R A;  1PP7 U;  1T2K A;  3I58 A;  2DK5 A;  2FML A;  3LAJ A;  4IRI A;  2DFI A;  3K1P A;  2HFH A;  3HSE A;  2DPD A;  1IN8 A;  1MJB A;  3E5Q A;  1H9T A;  3ZPL A;  2H09 A;  2GXB A;  1I1S A;  3V8L A;  2P6S A;  5JVT A;  2QVO A;  3I64 A;  1WI9 A;  5LEK A;  3JAM Z;  1IN5 A;  2M1B A;  1SAX A;  3SFZ A;  3F23 A;  3T0Y A;  5ED4 A;  2MLG A;  4HV6 A;  3MFK A;  3T8T A;  4U88 A;  3JW4 A;  3T5X A;  3BPX A;  5DV5 A;  5E20 A;  3LA7 A;  5AIQ A;  4HQM A;  2GAU A;  3GXO A;  4GCV A;  1UHM A;  3TQN A;  4ETS A;  4K2E A;  3BJO A;  2B0L A;  2PN6 A;  4HAM A;  1V4R A;  4WF2 A;  3JAM K;  2H6B A;  1J5Y A;  2KIF A;  3GFJ A;  3R60 A;  4B8X A;  2ESH A;  3WTY C;  1R7J A;  2JPB A;  3M1E A;  1BC7 C;  1FZP B;  2G7U A;  1KA8 A;  3FMQ A;  2KJC A;  2F5E A;  2V1U A;  2RV8 A;  1RI7 A;  2L4A A;  3F8B A;  2ISY A;  3LQR A;  5DCF A;  4ZZD A;  5D5X B;  1I27 A;  3HTU A;  3KP5 A;  4WXC A;  4GGG A;  2W84 A;  1CGP A;  3T8R A;  1YW7 A;  4BXU A;  2OA4 A;  2C6Y A;  4RB0 A;  2A07 F;  1W4M A;  1W5S A;  3RTR A;  3TGN A;  4ASN A;  3TO9 A;  1ZRD A;  3IWZ A;  5L3D A;  3F8F A;  5D8K B;  3HIF A;  2DK8 A;  3COA C;  3MZH A;  2FBH A;  4R1H A;  1IXC A;  3W6K B;  5BS6 A;  3U2R A;  4I98 B;  3KLO A;  1J0R A;  2KKO A;  3WTT C;  2PEX A;  3J7A O;  5E8I A;  1B4A A;  1O3Q A;  1ZG3 A;  3CO7 C;  1B1B A;  3BJA A;  1ZRE A;  3DP7 A;  1W5T A;  3K2Z A;  2ZNZ A;  3EQL F;  3WE3 A;  4IJA A;  4EV0 A;  1R58 A;  4A12 A;  1EH8 A;  2K4J A;  5HS8 A;  2HS5 A;  2VBX A;  4WXD A;  4RGX A;  2QYO A;  3L2C A;  1BI2 A;  1JGS A;  2PFB A;  5K5R A;  1I6X A;  1MJA A;  1HW2 A;  3V4G A;  2CGP A;  2EB7 A;  5D5W B;  1XMA A;  2J5P A;  2CO5 A;  1B6A A;  3D5L A;  4Z2Y A;  2EFQ A;  5DCM B;  2M8E A;  4EM0 B;  4MGR A;  1QBJ A;  3J80 K;  2E7W A;  2KJB A;  5JI6 A;  5HLH A;  5KVR A;  1PP8 F;  4CO8 A;  5BOX A;  4YFN F;  3RIR A;  2AXL A;  4FHT A;  2QWW A;  4HF1 A;  2O6G E;  1RUO A;  5H6Q A;  3M9A A;  4UXN A;  3C7J A; 
#chains in the Genus database with same CATH topology
 4IZZ A;  3BTI A;  1R23 A;  1V5F A;  1Z0X A;  2GWR A;  2EFW A;  2RN7 A;  3MKL A;  2A6T A;  5FB2 A;  1YW9 A;  2QQA A;  1HQC A;  4PZJ A;  2HOE A;  2QQ9 A;  1TWC J;  3WTU C;  2DMU A;  3GLX A;  3BG3 A;  4HDU A;  4BDZ A;  2CU7 A;  4HZF A;  4G6Q A;  2MSY A;  2EJR A;  2XAQ A;  3SFI A;  3OOP A;  1ZAO A;  2X1C A;  3MAJ A;  5D8L B;  4U0W A;  5DS9 A;  2JA6 J;  5ICC A;  2NNN A;  2VPR A;  2R7R A;  2Y75 A;  2RGV A;  1S3J A;  2BHY A;  4R79 A;  2ZJQ F;  1JJ6 C;  2K5C A;  1M1E B;  4MEX F;  2PMH A;  1L3L A;  4D7M A;  3G6E I;  1HCR A;  1QZZ A;  2LG4 A;  1XTA A;  5E3O A;  2M4K A;  3JRA A;  1QNT A;  2FA5 A;  1TL8 A;  3LA2 A;  1X2N A;  1A04 A;  2MH2 A;  2BOL A;  3CCR I;  3FBN B;  2XAS A;  5EJC A;  3ASO H;  4NC6 A;  2H27 A;  5FRM A;  2WAE A;  4WK8 F;  2BY3 A;  2UZK A;  1U9O A;  3HRM A;  2WB1 N;  1V5G A;  3ZMZ A;  3HDD A;  1YHQ I;  1XDU A;  5EEG A;  4YEJ A;  3JRD A;  3SZP A;  4AVP A;  5JFR A;  3SQN A;  2EPF A;  3ISP A;  4OU0 A;  5HDK A;  3FX3 A;  1BW6 A;  3RCO A;  3RSN A;  3VEP A;  5C4X J;  1P4A A;  1MDM B;  4A2U A;  2D1V A;  2KP6 A;  2MLK A;  3C1D A;  2EV0 A;  2VJ4 A;  3DBL B;  2XF7 A;  5IYD J;  4HX8 A;  4EJO A;  1Y0N A;  5FRN A;  2O3F A;  4RBO A;  4CXF A;  3W6V A;  2DMQ A;  3F8M A;  2K02 A;  3REO A;  4O3M A;  1WJE A;  2XPV A;  2BVM A;  2O03 A;  3L2U A;  3CC7 I;  2LBF A;  1H0M A;  3CP2 A;  3I54 A;  2M7B A;  2IVM A;  4CCL A;  1ETX A;  5DD4 A;  4ZTF A;  1Y8R B;  2JSP A;  5JHF A;  2BY0 A;  4QSH A;  3CDI A;  2K7L A;  3CTA A;  2JWT A;  4G7Z F;  2FOK A;  3RKX A;  4II2 A;  3R4K A;  1VND A;  4S05 A;  5F64 A;  3PNY A;  2VJI A;  4UY8 I;  3S15 J;  2ELK A;  1W7P A;  4L5J A;  4BQN A;  1ACI A;  1HKQ A;  2A61 A;  2EFP A;  4XIC A;  2R7F A;  3VYU B;  2VJ5 A;  3SXY A;  4NQW A;  1MMA A;  1F5T A;  1JI8 A;  2VN2 A;  2V7F A;  1JKQ C;  4UB8 C;  1MBH A;  2FRH A;  1EKE A;  2JA2 A;  4DQ2 A;  1MMS A;  3G71 I;  2F5C A;  1X1P A;  2L01 A;  3LAP A;  5C4J J;  4Q47 A;  1RPW A;  4NNJ A;  5F04 A;  4AYB N;  4B09 A;  3J81 Z;  3KIO A;  1FSE A;  2CMP A;  2EFO A;  2WTE A;  1FOW A;  3EUK L;  1Y56 A;  3B73 A;  1MBF A;  4I09 A;  3VYS B;  2XAF A;  2VQG A;  1MND A;  2RQQ A;  3HM5 A;  3TOB A;  4HQE A;  3CLQ A;  2M7A A;  2E5Z A;  1OIS A;  1LDD A;  4ON0 A;  2QA4 I;  1EF4 A;  2ZFU A;  5IT9 K;  1FEX A;  4XKB A;  1K7A A;  1K78 B;  5CVI A;  4ENN A;  1LE8 A;  3ZXS A;  2DA5 A;  4MO7 A;  3QPH A;  3ZMU A;  3KEO A;  3PFI A;  4HRI A;  5EDN A;  4OAZ A;  2KIU A;  3A01 A;  1AOY A;  1DP3 A;  1FBQ A;  2CYY A;  3DFG A;  3JCU C;  3CCL I;  4Y17 A;  4DW6 A;  4NDL A;  1XC5 A;  4HA8 A;  2I8D A;  3FBI B;  3ZMT A;  2GIV A;  1D0Y A;  2IA2 A;  2K9M A;  1U0J A;  2GZW A;  4RB1 A;  2EA2 A;  1ZG5 A;  1UG0 A;  4J00 A;  1WSU A;  2DA2 A;  2Z33 A;  4YG2 F;  1U5T B;  3WHC A;  1BL0 A;  3GW2 A;  3LMM A;  5GAH J;  3Q9S A;  3ZN1 A;  1D1B A;  1SAU A;  4P5O A;  4E70 A;  2IW5 A;  3ULQ B;  2VXZ A;  2DJI A;  3HHG A;  4L5I A;  3J81 K;  4F7Z A;  3OS2 A;  5FKN A;  2R4G A;  1VQM I;  2CFO A;  3EPZ A;  5J3L A;  1RR8 C;  4G8X A;  1BN5 A;  3D5S C;  4XLF A;  1Z3X A;  2L54 A;  1Y1W J;  4DBQ A;  3BTC A;  1R6R A;  4PJ0 C;  1YS6 A;  4A6E A;  1TNT A;  2L9N A;  1JTY A;  1FIP A;  5CJ9 A;  5IYB J;  3DPL C;  3CUQ B;  2IS6 A;  4YFK F;  1YRN A;  5C3E J;  5TIS C;  5DUK A;  1O3S A;  3BT9 A;  3OYG A;  1OYY A;  4BBS J;  2M5W A;  3ABU A;  3ZQQ A;  1LE8 B;  4JOM A;  4ZYG A;  4OIQ F;  3A01 B;  1NG7 A;  2LC2 A;  4XON A;  1I3Q J;  2CH0 A;  2CQ7 A;  4BBR J;  3KP7 A;  1KU7 A;  2PMZ N;  4BXX J;  3I55 I;  1S8N A;  3GF2 A;  5E1X A;  3KX2 A;  1KQ8 A;  3HGY A;  1WJD A;  1E2X A;  3S8P A;  2G0E A;  2K3F A;  1L0O C;  3RPU A;  3TO6 A;  1VFC A;  1ETQ A;  3UKG A;  4B44 A;  3GFL A;  5FJ8 J;  1IZ1 A;  1HA8 A;  2OTJ I;  1O7F A;  1TWA J;  4KIF A;  2M4G A;  4XNF A;  1X2M A;  3ZOB A;  2W1O A;  4BNC A;  1ON2 A;  1POG A;  4CIC A;  1H8A C;  4IEJ A;  2GM4 A;  1ZQ3 P;  3ZR8 X;  5B5E C;  2OPT A;  5F6F A;  1XS9 A;  1JE8 A;  5L3G A;  2G9W A;  1D0Z A;  2ETH A;  2CW8 A;  3OL3 A;  3ASN H;  2Q2E A;  5EGO B;  4DIQ A;  2JRT A;  1JUS A;  2XHK A;  3QOE A;  3A02 A;  3K4K A;  3WU2 C;  3M4O J;  2P6T A;  2Q1Z B;  2YPR A;  4F3Q A;  3H9J A;  1XSD A;  2KDO A;  3DEU A;  3FKI J;  3PIP F;  4FE4 A;  2DLL A;  5FD5 A;  4XLE A;  5KAI C;  4HST A;  3GVA A;  1XD7 A;  2BZT A;  2OF7 A;  2RRE A;  1MSF C;  2EV5 A;  1GV5 A;  3I71 A;  2W24 A;  2WY7 Q;  4BE0 A;  4A3J J;  3HC7 A;  3BZ6 A;  2ISZ A;  2IPQ X;  4EGZ A;  2L7Z A;  4Y33 A;  1TZL A;  3MCZ A;  1P92 A;  3LA3 A;  4LLN A;  4UUS B;  2TCT A;  4NC8 A;  3OSG A;  4ZZL A;  3S16 J;  1ITY A;  4LFU A;  4U0V A;  4LK1 F;  4RLF A;  1LQ1 A;  1XB4 A;  3PNT A;  3M3Y J;  3CDL A;  5TRD A;  3KEY A;  2JA7 J;  3JRF A;  2EIK H;  2EBI A;  1HSJ A;  1SD4 A;  3GTM J;  2OQG A;  3MD2 A;  4BS9 A;  4BXF A;  1XGN A;  2R5Y B;  4YFX F;  3FWE A;  4M9S A;  4F93 B;  2UXN A;  1HC8 A;  5F1J A;  3Q0V A;  2Q2E B;  3ZP5 A;  1R4M B;  2CJJ A;  3NRV A;  3C2B A;  1F36 A;  4B48 A;  1QVU A;  2P0W A;  1PVE A;  2XKO A;  2Z1D A;  3W6J B;  3F8C A;  3TO7 A;  5HDN A;  5D4R A;  2WBM A;  1MW7 A;  3O2P E;  1WFX A;  1BM9 A;  1T33 A;  3L09 A;  3K2A A;  2EWN A;  3FM5 A;  2ZFW A;  1JHF A;  2K3P A;  3L00 A;  1KZH A;  4BAY A;  3RZD J;  2IP2 A;  4M6Y A;  4Q4Z F;  4AYB A;  2DMN A;  4U7B A;  3OL4 A;  4XN3 A;  2DQL A;  2JA5 J;  5CKT A;  4XLP F;  1D5Y A;  4KT5 C;  4JX6 A;  4MFE A;  1R5I D;  4IHY A;  2E7X A;  3GUD A;  4ESF A;  3H36 A;  3MZY A;  4ZH4 F;  2LKS A;  1I3A A;  3DF8 A;  1G3Y A;  4Q5S F;  1GDT A;  1YYV A;  2HQ5 A;  3BR3 A;  5F1R A;  2F2E A;  2VT3 A;  2GBY A;  2MH9 A;  3GFI A;  3CQZ J;  1I6H J;  1YQA A;  4I2O A;  1X4O A;  3K4C A;  2W7N A;  2LH9 A;  5EG0 B;  3BQY A;  5KK1 A;  2QBY A;  5L3E A;  1VQ4 I;  5JLW A;  3NEU A;  2JJ7 A;  5EEH A;  4V2F A;  4XBF A;  2D2W A;  3R6S A;  4CA0 A;  3O3K A;  2X0L A;  3JRE A;  4N4O B;  4M73 A;  3BPV A;  1R36 A;  4KUM A;  1VQ5 I;  1J09 A;  3EYI A;  4Y3O A;  4KIS A;  2Z9O A;  5HOO A;  2X51 A;  3IH3 A;  2HEO A;  1ZG1 A;  3I59 B;  3TED A;  3AL0 B;  3CLO A;  4A93 J;  4D5F A;  3ZMD A;  4IPA A;  5HDG A;  1NK2 P;  1S5L C;  3SEQ A;  3S2W A;  1OCR H;  3QYB A;  2F5F A;  3M8J A;  3OYD A;  1FYK A;  2R5Z B;  3R0A A;  4NBQ A;  5E17 F;  4ABZ A;  3E6B A;  3SJM A;  1USS A;  3W2W A;  2Y30 A;  2IJL A;  3GFM A;  4RM3 A;  2E2H J;  4PJL A;  2DBB A;  3RQ4 A;  1SVO A;  4A3L J;  1Z1D A;  4E7Z A;  4KNY A;  3ZMV A;  3IHU A;  2VB6 A;  4G7O F;  4BJ6 C;  1WJA A;  1MJ9 A;  1LFB A;  2KFD A;  5EYR A;  2QEN A;  2HDC A;  3MEX A;  3DKX A;  5HVQ C;  6PAX A;  2BHZ A;  2DW4 A;  1UFM A;  1MKM A;  3K6G A;  4DYR A;  2W57 A;  2E2J J;  3ELK A;  2PMZ A;  3KZY A;  1VQK I;  2VQL A;  2X1E A;  3LSK A;  1RET A;  4IHT A;  3IC7 A;  1GXQ A;  1GHC A;  3DPU A;  5J40 A;  4B47 A;  1ZK8 A;  5JHU A;  1D0X A;  3TW7 A;  1PUF A;  1B72 B;  1DUX C;  2CW7 A;  2AS5 F;  1QO0 D;  2R7Q A;  2HOA A;  3WTZ A;  1P9Q C;  2GXG A;  3KP3 A;  3NQO A;  2DQR A;  4L9T A;  1S9H A;  1LDK B;  4UXN A;  1RNL A;  2ME6 A;  3J7A Y;  3HOY J;  2O9L A;  4E7H A;  1WJ5 A;  1HST A;  1N75 A;  1ZTR A;  3TDZ C;  2HTJ A;  2P81 A;  2M8G X;  4M71 A;  5B3S H;  3KEQ A;  1WH5 A;  3QPL A;  2RC4 A;  3BRO A;  1JUM A;  1QZY A;  3CUO A;  1BJZ A;  2PLY A;  3FHZ A;  2X9D A;  1Y39 A;  1TWG J;  3E6M A;  5AON A;  2FF4 A;  4EVI A;  2DYS H;  3CP8 A;  2NS7 A;  3A1Y A;  2EFN A;  1IXS B;  1HKT A;  2P5L C;  3VSL A;  2ZXI A;  1I5Z A;  1P6R A;  4OMY A;  3CES A;  3GTG J;  2HYF A;  4A0Y A;  1WZ2 A;  1G8X A;  3PL8 A;  4L9N A;  1KU9 A;  2NOG A;  2L0K A;  2O8K A;  2OD5 A;  2GXA A;  4CZC A;  4EEF G;  1B59 A;  1V5E A;  3HL2 A;  3P9C A;  3E5U A;  1AKH B;  4FIS A;  2MC3 A;  2V6C A;  1IXR C;  2VE8 A;  3H0G J;  4UV8 A;  1QGP A;  2WWY A;  4D5C A;  3KP4 A;  2XRN A;  5D5V B;  5F0H A;  1SFU A;  1TTY A;  2JRM A;  3CMM A;  3F3X A;  4XLN F;  4Y15 A;  4WX9 A;  1K79 A;  3KYC B;  4D0P A;  3A4C A;  3M07 A;  4AU7 A;  2Y48 A;  1U8R A;  3WU1 B;  4L0Z B;  4GFB A;  4PJN A;  3OWT A;  3QYF A;  5FD6 A;  2QUF A;  4ENJ A;  2HKO A;  2BXZ A;  5F27 A;  3PQK A;  3K1N A;  4RAY A;  3LWF A;  5FKM A;  3BR0 A;  3IAM 2;  4YIR X;  1UJ8 A;  4LIU A;  5CPR B;  1U6G A;  1IF1 A;  3DKY A;  4FCY A;  1SEU A;  5K7H A;  4RB3 C;  3C3W A;  1FY7 A;  2ZNY A;  1IRG A;  1KU2 A;  2Y2Z A;  1N78 A;  5GAD J;  2A5Y B;  2CQQ A;  1X3U A;  1NTC A;  2OJE D;  1DGR M;  1JXS A;  3I53 A;  3HB9 A;  3ZQH A;  4RAZ A;  2ZJR F;  2HVS A;  1OQY A;  1BW5 A;  3M8E A;  2VOO A;  4LGW A;  1YX5 A;  1KYW A;  4WXH A;  3WGI A;  2D45 A;  4IHS A;  1X1D A;  2EIN H;  2QQB A;  2IGN A;  2IS4 A;  2NVU B;  1ERD A;  1ZRF A;  1BBY A;  1YI2 I;  4F91 B;  5E3M A;  1N25 A;  3R0J A;  3HBL A;  2RDP A;  3S17 J;  4ENM A;  1IAW A;  1C0W A;  2D5V A;  4RGR A;  3L2Q A;  3S14 J;  4MQ9 F;  3G73 A;  4MLO A;  5M5W J;  5M3F J;  1LEA A;  2LF8 A;  2JQ7 A;  1R1U A;  1MD0 A;  2M30 A;  2WAF A;  1OFC X;  3V8J A;  3BG9 A;  2FMY A;  2LD5 A;  3N05 A;  4PJJ A;  3ZCO A;  2R92 J;  2OC6 A;  1RKW A;  4MTE A;  2NOJ B;  3KCC A;  2JSC A;  3BTL A;  1ZEL A;  3BG5 A;  5HOD A;  2VI6 A;  1IG7 A;  4BH9 A;  4HNT A;  1VQ7 I;  2K9Q A;  2X6Y A;  1Z6T A;  2DDA A;  4EM2 A;  1X1C A;  1LEB A;  1S7E A;  3ABM H;  5H2F C;  2KRH A;  4IVN A;  5D4S A;  4M6X A;  3A0H C;  3GZ5 A;  4RS8 A;  1A5J A;  3DU5 A;  3E3V A;  4EM1 A;  2ZCW A;  3D1N I;  1A6I A;  3WG9 A;  3OYH A;  3K0L A;  2Y0M A;  2DT6 A;  2L7F P;  2VKV A;  2IT0 A;  4UUV A;  3QPT A;  4M3F A;  5AIP A;  3GTK J;  2BV6 A;  1ETY A;  1Z3Y A;  4B4C A;  1TW3 A;  1STZ A;  5FO5 A;  4BUP A;  5K5O A;  1RIO H;  3Q0W A;  1U3E M;  1OJL A;  1XSX A;  2V9P A;  4DYQ A;  4KMF A;  1OYI A;  2VKH A;  4BQA A;  4EGY A;  4EAT A;  2DI3 A;  3DEW A;  2HGC A;  4M9X A;  4V2G A;  1KQ9 A;  3H5N A;  5J1R A;  1EJ9 A;  3JSO A;  1BI1 A;  4A3I J;  1U8B A;  5CVV A;  3H5R A;  5ERI A;  4KA4 A;  1TP4 A;  5HNH A;  4UVC A;  4IXA A;  2KIS A;  2GIZ A;  4BE1 A;  4A3F J;  2XVC A;  1IUF A;  5ICF A;  1S29 A;  1D8J A;  1R00 A;  2BW3 B;  3V7R A;  2E35 A;  3A2K A;  1XMX A;  1S72 I;  3FXK A;  1D8K A;  2LTP A;  3ABK H;  3ABL H;  2HNH A;  3QOD A;  1QPI A;  3KYL A;  2PBI A;  2J5O A;  5BQT A;  3QU6 A;  2O61 A;  3G1L A;  2ZME C;  3I56 I;  2L7K A;  4MEY F;  1H89 C;  3BDD A;  3I9V 2;  1FSH A;  3Q3S A;  1IC8 A;  2XRO A;  2COM A;  4L9J A;  1G3T A;  2YS9 A;  5K5Q A;  2ZC2 A;  4XM3 A;  5ICE A;  1WKM A;  2FNA A;  3DU6 A;  2DT7 B;  4XKV A;  1GT0 C;  1WH7 A;  1REP C;  3HPG A;  2X4H A;  1MGT A;  2G7H A;  4IOC F;  5LHH A;  2DXI A;  5EF6 A;  3S2D J;  2CUF A;  2Q8K A;  1E0E A;  5DDG A;  3MKW B;  1UEL B;  1TC3 C;  1BI3 A;  2M0M A;  5JVG F;  2DFH A;  3DTK A;  2Q0O A;  1I1G A;  2W85 A;  3EUH C;  2YU3 A;  3TBI A;  3F6O A;  2DA6 A;  2HQN A;  2KRF A;  2IA0 A;  1IRZ A;  3O6B B;  2E71 A;  5E3L A;  5L3F A;  1IN6 A;  1MNE A;  3CF5 F;  1D5V A;  1RUN A;  1U2W A;  1XGS A;  2X6X A;  3HOS A;  3HUG A;  3W2V A;  2BGC A;  4ZJZ A;  3KZI C;  3GLL A;  3Q5F A;  1IN7 A;  1YJW I;  4I0B A;  2FXA A;  5J4V A;  5IP7 J;  4XMY A;  4CCO A;  3ZMS A;  4OIN F;  1K4S A;  2HQR A;  2Z99 A;  1SFE A;  3FMS A;  2IS1 A;  3L7W A;  4Y13 A;  5TJJ A;  2KL4 A;  2CUZ A;  2M45 A;  2ZSH B;  1TQP A;  3GME A;  1GV2 A;  2XIG A;  4PSX A;  3RKY A;  1VQN I;  4B43 A;  3RKW A;  4AUX A;  4XL9 A;  2FSW A;  3RZO J;  4CHU A;  1VQL I;  3NAU A;  3LOC A;  4YII A;  2ZKZ A;  5CVJ A;  4LG0 A;  3EUH A;  3OV8 A;  3WOD F;  3U1D A;  5GAE J;  2E1M C;  3FIW A;  3AAF A;  1UHW A;  1BC8 C;  2LBF B;  2W25 A;  1ON1 A;  2W4S A;  2BY2 A;  1ZGA A;  4GYG A;  2XDV A;  1K6Y A;  2IAI A;  2JN6 A;  2MG4 A;  5H20 A;  2V1D A;  2EQR A;  1MBK A;  1HW5 A;  2O0Y A;  3B02 A;  1OPC A;  4HSR A;  2VBZ A;  2XSD C;  1YJ9 I;  1HKS A;  4XLH A;  3KFW X;  2VKD A;  3G3Z A;  1FWZ A;  3VOD A;  3OS1 A;  5B1B H;  1MH3 A;  5HLI A;  2ID6 A;  2L9R A;  4CCJ A;  2WC2 A;  2WAD A;  2CQK A;  1ULY A;  1NHA A;  1LVA A;  1W7P B;  2IGM A;  3IH2 A;  1YFH A;  4OOI A;  2HYG D;  1YTY A;  4GYI A;  1DPR A;  1Z91 A;  1NH3 A;  3I4N J;  2CRG A;  4M72 A;  4NQW B;  3FHN A;  3FXM A;  2CW0 F;  1JJ8 C;  1S6L A;  2QQ8 A;  1T8I A;  2LR8 A;  1F4K A;  2COB A;  3WTS C;  2V6E A;  3SHF A;  2LFB A;  3BR2 A;  2R7T A;  2KRC A;  2IGK A;  4AD9 A;  3N97 A;  2O7O A;  3ZQF A;  5JR3 A;  4Z6Y A;  3JRI A;  5DUI A;  4XLC A;  5K7Z A;  4TV7 A;  1HF0 A;  4A3C J;  4EJT A;  3QRF F;  1X1B A;  3CCV I;  1LNW A;  2K9S A;  3AG1 H;  3GZN B;  3LST A;  3KLN A;  3MZ8 A;  2DJN A;  3V42 A;  4LG0 B;  4HDV A;  2JVH A;  2DOD A;  2RNG A;  4AID A;  3S3O A;  4I02 A;  4HYE A;  5LHI A;  5FFX A;  3AG2 H;  3GBG A;  4DGW B;  2Z5U A;  1J9I A;  1W0U A;  3RQI A;  1N77 A;  1KU3 A;  5ILU A;  5GAG J;  3DPT A;  2V9V A;  1T39 A;  2LOO A;  4JYK A;  4HF2 A;  2K4B A;  5TGT A;  3ERM A;  4ESJ A;  2NS0 A;  3ABT A;  5IOZ A;  2OZU A;  2FEZ A;  4H4K C;  1ZGJ A;  1BOA A;  3ECO A;  1GVJ A;  3IL2 A;  1ZYR F;  5DEQ A;  3DXJ F;  1WJF A;  4UVB A;  3VYT B;  4XRS G;  4EJV A;  1FP1 D;  2AXT C;  3T1B A;  3VYR B;  2HXO A;  2FBK A;  3V7S A;  1Z7L A;  2L9V A;  1UST A;  4AIK A;  4IF4 A;  3ESW B;  3HHH A;  3DBR B;  4PJM A;  2V4J C;  2W00 A;  4MFD A;  2A3S A;  3ECH A;  3EYY A;  4IHW A;  1RES A;  3AG4 H;  4NB5 A;  5GPC A;  3E7L A;  3PUB A;  5HLT A;  1JKR C;  4GO1 A;  1OCZ H;  4L9V A;  3ZQ7 A;  1YX3 A;  5HLG A;  1IV6 A;  1LVK A;  3N4M A;  4G6T B;  2XF6 A;  3OR1 C;  2Y9Z A;  1TBX A;  4CYD A;  4A5N A;  2V79 A;  1Y6I A;  3ZGK A;  1BIA A;  3ERE D;  1AHD P;  1OMI A;  2MFZ A;  3V7C A;  1YRN B;  5BPD A;  1IV8 A;  3FIS A;  4EMS A;  4DZP A;  2VLA A;  4PCQ A;  3BG7 A;  2Y0S A;  3QYE A;  4X1E A;  2DA1 A;  2A05 A;  5FGM A;  1SD5 A;  2P8T A;  3BR6 A;  1E3H A;  2GOM A;  1TWF J;  1LFU P;  3PO2 J;  1FBU A;  3DV8 A;  2F4O B;  4ZDL A;  2VBW A;  1S7A A;  4LOC A;  5J1U A;  1O7L A;  2JMW A;  2VUM J;  1KQ0 A;  2FUG 2;  3M8F A;  4KMU X;  1ZHF A;  3B6C A;  3HSF A;  5E79 C;  4FX4 A;  1BR1 A;  4BJ5 C;  1YIT I;  4FTH A;  3OIP A;  1ZGW A;  1SAN A;  2CV2 A;  2JUG A;  2YX4 A;  2Z3Y A;  2B7E A;  2NXN B;  2PMU A;  4M3D A;  1ZN2 A;  4G7H F;  1B8I A;  1XCV A;  2NVQ J;  2H6C A;  2ZSI B;  1FT9 A;  1BR4 A;  2R7O A;  3FMR A;  1FX7 A;  4CCM A;  1I50 J;  3CJT B;  3PUF A;  3FXQ A;  1OYW A;  3PNV A;  2RNJ A;  2L9S A;  3A0B C;  5CVR A;  1OCC H;  4HOB A;  4H0E A;  3RYR A;  2STT A;  3Q0U A;  1YG2 A;  2FBI A;  2E60 A;  2QGU A;  5J1Y A;  3P9K A;  1FNN A;  1WRJ A;  2V1N A;  5E8G A;  2UWM A;  4ZYH A;  1SD7 A;  1XDS A;  1ZR4 A;  1MSE C;  2FQ4 A;  1A36 A;  4DZJ A;  1XX5 A;  1X58 A;  4G94 A;  4M9Z A;  4A69 C;  4QIW N;  3LSG A;  2MD0 A;  4M3G A;  4BDY A;  2M3A A;  2HDW A;  4PSW A;  3TDU C;  4JP0 A;  1PYV A;  1P4X A;  4IQJ A;  3I5U A;  2D1H A;  1XG1 A;  4L18 B;  4XRM A;  5ILS A;  3F6V A;  3RDI A;  1CF7 A;  1FC3 A;  1V3F A;  2EZI A;  4E6K G;  3MWM A;  1PDN C;  4KYW A;  5J47 A;  1J7K A;  2HPI A;  1SFX A;  2B63 J;  3TOA A;  3BCB A;  3FXR A;  4PDK A;  3KP2 A;  1Z7U A;  5D6F A;  1KGS A;  1XGM A;  1F9N A;  4ZDP A;  3SZT A;  1LJ9 A;  2KHM A;  2KIM A;  3FXU A;  1JKO C;  2QKL B;  4IRH A;  3DQV C;  4MQV A;  2QSH X;  5LD2 C;  2XB5 A;  3G2B A;  2EZL A;  4ENK A;  3E5X A;  2CUJ A;  1TQM A;  2XGX A;  3P9I A;  4P1W A;  2ADU A;  4U0Y A;  3FXO A;  2QM3 A;  3HJE A;  2DN0 A;  4MNU A;  5CLS A;  1YIO A;  2E1N A;  2M34 A;  5F08 A;  3DBH B;  2ELJ A;  3H3U A;  1WCM J;  2RVC A;  4P55 A;  2E34 A;  3HRU A;  1RC9 A;  3F21 A;  2K40 A;  4HV5 A;  3U1K A;  4A0X A;  1G59 A;  2STW A;  2ZO4 A;  2K27 A;  2P5K A;  1LFP A;  2VT2 A;  3HOV J;  3B6A A;  1OCP A;  1ETO A;  2ZJP F;  1W36 D;  4HG2 A;  1D1A A;  1FTT A;  1V54 H;  3K10 A;  1AU7 A;  2R93 J;  3GTJ J;  1IN4 A;  2MYS A;  1CF7 B;  2JUC A;  2AO9 A;  3JTH A;  2CWE A;  4D1Q A;  4XOR A;  4Y7N J;  3CC2 I;  5FKK A;  2CG4 A;  2OV7 A;  4OMZ A;  4ZYE A;  3CJQ B;  3G1O A;  4XSZ F;  2LRE A;  2DT5 A;  2DO7 A;  4OWR B;  1HBX G;  4UNO A;  1JHH A;  2CUE A;  2K86 A;  5DD8 A;  3CCY A;  1R49 A;  4CH7 A;  3M1C A;  3CC4 I;  4BGD A;  5HS9 A;  5LLQ A;  2R7D A;  2RAE A;  3OYM A;  2QBY B;  3J7Z I;  5FRO A;  2JK3 A;  3U21 A;  4X6A J;  4IOA F;  3AKZ A;  2L3D A;  5F0C A;  3S1M J;  3C2G A;  4KIB A;  2RKH A;  2HZD A;  3E6C C;  1E3P A;  4GDF A;  2XAG A;  1WJB A;  4IQ4 A;  4OIO F;  1QRY A;  1OR7 C;  3HOW J;  2NVY J;  2YSR A;  5K1Y A;  2IBD A;  5HNF A;  2OBP A;  2XF5 A;  3Q9V A;  2YU9 J;  5E1W A;  4PGG A;  3W2A A;  1JTX A;  2DOA A;  1YE9 A;  3VFZ A;  3CME I;  2DU9 A;  4IRG A;  2VC0 A;  1RKT A;  3GTP J;  2PJR A;  1UCR A;  1QPM A;  2EK5 A;  1FOK A;  1MMN A;  2ZXJ A;  3C18 A;  1IRX A;  2BVL A;  5L3B A;  2LK2 A;  3HEF A;  2NVX J;  5HS7 A;  3QU3 A;  5GTI C;  3GX4 X;  3DKW A;  1HW1 A;  2O5R A;  3E6D A;  1I39 A;  1K83 J;  1GXP A;  2L2O A;  2DOE A;  4GXO A;  2F4M B;  1DDN A;  3HOX J;  1ZLK A;  4LB6 B;  3F22 A;  1R5H A;  1G3W A;  4LD5 A;  2QSG X;  3GO5 A;  5H6R A;  3H9G A;  1IW7 F;  2OAZ A;  2XPW A;  2CV1 A;  1J75 A;  3QOP A;  2KZG A;  4UUT A;  1SVL A;  1OR7 A;  2PG4 A;  1NK3 P;  1JT0 A;  4A3M J;  1P4W A;  2AQE A;  4RGU A;  2XC7 A;  3OYB A;  1KON A;  2WV0 A;  4LLG F;  2R7V A;  2VL8 A;  3VSK A;  2JPC A;  4ZYD A;  1HXD A;  2H94 A;  3L1P A;  3M7G A;  3K70 D;  1LKX A;  1R4N B;  2DA4 A;  1PUF B;  2LY2 A;  1XMK A;  1CQT A;  3CD6 I;  1U78 A;  1RR7 A;  2KLO A;  2VC1 A;  3PQJ A;  2JA8 J;  3ROU A;  1LUJ B;  2JZY A;  3EET A;  1J2X A;  2QSF X;  3QPS A;  2PJR B;  3J7Y J;  4LMY A;  3VWB A;  3HSR A;  1WPK A;  5IY5 H;  4J01 A;  5DM6 F;  3U9G A;  1DQU A;  2HTS A;  2LSO A;  4M74 A;  2VXD A;  3WGH A;  3LSH A;  1Q1H A;  4N9H A;  4C3I J;  1BI0 A;  2GOX B;  5DCM A;  1YO5 C;  1T98 A;  2OUM A;  4AC0 A;  2XSJ C;  4HLX A;  2V26 A;  1EH6 A;  2A68 F;  4CUG A;  3HGG A;  4RGS A;  2NNY A;  1MH4 A;  3S1N J;  4N0B A;  5CVU A;  2WV1 A;  3J80 Z;  3EUA A;  2FE3 A;  2VON A;  1X19 A;  3KET A;  3CDH A;  4LB5 A;  2R3S A;  1R22 A;  2BY1 A;  4S0H B;  1G2H A;  3WTW C;  4BEH A;  3CCJ I;  1QU3 A;  3KE2 A;  3HOT A;  2NYX A;  1QQI A;  1HDP A;  1DGW Y;  5IPA A;  3G4S I;  1IUY A;  3FF5 A;  1Z67 A;  5A2Q Z;  4E4H A;  5J8F A;  1QVT A;  2BE5 F;  1FYL A;  3IV5 A;  2H8R A;  4D7N A;  4JBA A;  4NC7 A;  1FIA A;  2JT1 A;  2KQR A;  1DU0 A;  1BR2 A;  3QAH A;  4BQO A;  4Y4R A;  4YRV A;  1O4X A;  4C2U A;  1ZAR A;  1YLF A;  2LY9 A;  1T0F C;  4C3J J;  3JRC A;  2DFF A;  3GWZ A;  4MIM A;  4LIT A;  5GP9 A;  1B9N A;  1FPQ A;  1Z05 A;  2XAH A;  2DFE A;  2NVT J;  1F43 A;  2LYC A;  4J19 A;  5KHD A;  2B9S A;  4U7D A;  3K70 C;  4NHJ A;  1KYZ A;  4G9Y A;  3OYA A;  4KIT B;  2GA2 A;  2EV6 A;  3FDY A;  4ESB A;  1W7P D;  3K1M A;  1G6N A;  3LFK A;  3VOE A;  1O3T A;  1IGN A;  1JUP A;  3H1C A;  2XB0 X;  4IKF A;  2ICW G;  4E7J A;  1BJA A;  3RJP A;  2IA1 A;  2YX7 A;  2ME0 A;  2CFX A;  1T38 A;  2A6H F;  4MTD A;  3CF2 A;  1ORK A;  3S32 A;  3TL4 X;  1SC7 A;  5A2Q K;  5B1A H;  2QLZ A;  1VZ0 A;  2TDX A;  3DLA A;  2EZH A;  2P7C B;  3IRQ A;  2R7X A;  4B1R A;  2M0C A;  5DTD A;  5LGN A;  2E36 A;  2XKP A;  1EH7 A;  3WHB A;  1T0F A;  3H9Q A;  4XKC A;  1Y0U A;  4E7L A;  1MDM A;  2VIX A;  2LY1 A;  4EJW A;  1UAA A;  3D0S A;  2DOF A;  4KN7 X;  4AIH A;  4W97 A;  3R61 A;  3S1Q J;  3GTO J;  3KP6 A;  2R0Q C;  1F1Z A;  1RZ4 A;  3CJR B;  2XGC A;  1MMD A;  3KYD B;  3RYP A;  3P7N A;  4C30 A;  2R7U A;  4BHB A;  3E97 A;  3BLY A;  2VBY A;  4JX4 A;  5BMZ A;  3BTJ A;  1Z6R A;  2YR2 A;  5D5U B;  4C2T A;  3C2H A;  3UR3 C;  4HNV A;  4L5E A;  1XCB A;  2Y0S N;  1AA7 A;  4KIC A;  2VAS A;  3BCA A;  5LGT A;  3SEZ A;  3K9T A;  3MMY B;  3I4M J;  3OYN A;  3H92 A;  3I4P A;  4FAS D;  1W5C C;  4DJA A;  3BZC A;  3LQQ A;  4XID A;  4EJU A;  4A3B J;  2L5Q A;  1JKP C;  1P2F A;  5J6X A;  4JQF A;  4A6D A;  2HWV A;  1LPQ A;  1IO2 A;  1RRJ A;  1HLV A;  2VOD A;  1MBG A;  4QTR A;  1AWC A;  1D1C A;  4FT8 A;  1U5T C;  1T56 A;  5FKL A;  4HLY A;  3SZG A;  5LRS A;  2X48 A;  2LF7 A;  1ENH A;  2NRA C;  2HR3 A;  5FFZ A;  2VE9 A;  1LB2 A;  4CCK A;  1J59 A;  2EA4 A;  3F0C A;  4PUS A;  2HOT A;  2LLK A;  2M87 A;  3ZQG A;  1SMY F;  3JTG A;  4PGH A;  3S3N A;  3FK6 A;  3TKY A;  1R9T J;  2MBF A;  5KAF C;  2VOP A;  4EQQ A;  4XRF A;  3MKY B;  5K7F A;  1GVD A;  4CDG A;  4XSX F;  2FNP A;  1ONV A;  2ZBK A;  1B9M A;  1K78 A;  3CUQ C;  2HZT A;  3HKZ A;  1E17 A;  2LKP A;  2HKX A;  3IKT A;  2ZME A;  1TNS A;  4I0A A;  2LDU A;  2IGO A;  2OU2 A;  4CGZ A;  2P7V B;  2XV4 S;  2VJJ A;  3SYT A;  5IP9 J;  2DMP A;  5IT9 Z;  4GRI A;  1DPU A;  5EEA A;  1BOB A;  1WQ2 A;  4G12 A;  4I7H A;  4M6V A;  4BYY A;  5LBQ A;  2A6E F;  1FTZ A;  3CMA I;  3E1S A;  3RPU D;  2X85 A;  4LK0 F;  3CCS I;  2E1O A;  3V8K A;  3FZV A;  4I99 C;  1H88 C;  5IT3 A;  1SVM A;  4HW0 A;  4HF0 A;  1U5T A;  3HYI A;  1WI3 A;  2IS2 A;  1WHU A;  4HX7 A;  4FE7 A;  3VPR A;  2ACJ A;  3MVP A;  1XPX A;  4F92 B;  2UUZ A;  2O8X A;  1NG6 A;  3DLL F;  2EIJ H;  3GYH X;  4HX4 A;  3QQA A;  1YS7 A;  5BNG A;  1MMG A;  2V9K A;  5M5X J;  3JRH A;  2XGD A;  2P4W A;  3IKV A;  2YUS A;  9ANT A;  2EIM H;  2KPM A;  3CUQ A;  4BHC A;  4N9I A;  3OYK A;  5LGU A;  4BE2 A;  4P96 A;  4UB6 C;  4P9F A;  4RLQ A;  2GA1 A;  2HPM A;  2MW8 A;  2E5N A;  5D6E A;  1TT0 A;  3HUG B;  2WAQ A;  4RDU A;  2Y69 H;  4ZC3 A;  4C3H J;  1TW2 A;  4MHG A;  3OIQ A;  3LSR A;  4G6D A;  2DPU A;  2E1C A;  2ZME B;  3ZQC A;  2UXX A;  3OR2 C;  4U87 A;  4XN0 A;  3BJ6 A;  1MIJ A;  2E19 A;  2NAZ A;  3HRS A;  2VKE A;  4JK1 X;  4UV9 A;  5L3C A;  3IRR A;  3CO6 C;  2FOW A;  1ZRC A;  3K4L A;  2BEO A;  2KIQ A;  1VTN C;  3MKZ A;  3BOQ A;  1Z21 A;  3DEE A;  4I6Z A;  2JVG A;  2X1D A;  3PSI A;  3GZ6 A;  2PJP A;  5CYV A;  4AIJ A;  4RM2 A;  4ZTJ A;  1LDJ A;  2X6O A;  3X2Q H;  1K6O A;  3D5R C;  5DYM A;  1DP7 P;  3BP8 A;  1ETW A;  3FM3 A;  4WWC A;  2WA0 A;  3LSP A;  1R71 A;  1XSV A;  3ONQ A;  1EV7 A;  4WCG A;  1XGO A;  2FD5 A;  4A5M A;  3VB2 A;  5E1Z B;  5LEJ A;  4CSW A;  3QP6 A;  2OQR A;  3ML6 A;  3TP0 A;  4XK4 A;  3CZ6 A;  5FLX Z;  5C44 J;  1S7O A;  3FK7 A;  4FQG A;  5M3M J;  5EGO A;  4PFP A;  2V1X A;  4O6J A;  2LMD A;  1Q1V A;  1ZLJ A;  1IRF A;  4ZDO A;  2R7W A;  1YJN I;  3GEZ A;  5LHG A;  4QWQ A;  3OYC A;  1UG2 A;  5ICG A;  1O57 A;  4OIR F;  1VQO I;  3BR5 A;  1ETK A;  2HOS A;  1W1W E;  3ZQL A;  2L4M A;  1TLH B;  2VQH A;  3LFU A;  1ZKG A;  1T08 B;  2MGQ A;  5ILV A;  1MZB A;  2BBY A;  1D3Y A;  4OAY A;  3BY6 A;  4I01 A;  2W48 A;  4OIP F;  1UZC A;  4UUS A;  2CSO A;  2HYJ A;  4DBR A;  3RI4 A;  1FLI A;  3I3L A;  4BHP A;  5FLV A;  4YIF A;  4PK4 A;  1R5G A;  2PI0 A;  4QPO A;  4ITV A;  4KDP A;  2W82 A;  4LLL A;  2DTR A;  1H9G A;  4Q48 A;  2IEK A;  2LVS A;  2E1M B;  2MA3 A;  1ODD A;  2I10 A;  3WTX C;  4AWX B;  2GLO A;  3GTQ J;  2KT0 A;  1FJL A;  2CQX A;  2MD5 A;  2BYV E;  3BR1 A;  3F72 A;  3GTL J;  4KIG A;  4UVA A;  3JRG A;  1QHG A;  1YW8 A;  5FLX K;  2XAJ A;  4HNU A;  2R5Y A;  1T6S A;  3PSF A;  1X3W B;  3HRT A;  2MAB A;  3KZZ A;  1FBS A;  1BIB A;  3DCF A;  5GPA A;  4D9J A;  4W1U A;  2AHQ A;  2F6C A;  1GUU A;  1Z9C A;  5FKO A;  4XKW A;  1VF9 A;  2Y9Y A;  4QLC U;  1R1V A;  3K69 A;  3VDX A;  3WU0 A;  5DM7 F;  2R7Z J;  2XUB A;  2F5D A;  2CQN A;  3F8N A;  1FYM A;  3ZQI A;  2X6W A;  1TT5 B;  2P5V A;  3F9K A;  1PJR A;  1G4D A;  4RB2 C;  3RPQ A;  1VQ6 I;  3AFH A;  1G3S A;  5J8C A;  2H1K A;  2WB1 A;  3LSI A;  4ANJ A;  4S04 A;  1FOY A;  4XR6 A;  2QEX I;  2DYR H;  2LP0 A;  4P9U A;  1VQ9 I;  3AL0 C;  1P7I A;  3HOU J;  3H35 A;  1TQI A;  1X3Z B;  3WE2 A;  4O5V A;  3S3M A;  3WTV C;  3BWG A;  4XOT A;  1VQP I;  2DTZ A;  2FU4 A;  3L9F A;  1XN7 A;  1FMV A;  3H3Z A;  2RQP A;  3HTS B;  1SFK A;  3DWL E;  2LRD A;  1UB9 A;  3AG3 H;  1HDD C;  4XOP A;  3EDP A;  2ZJ2 A;  2DA3 A;  4B3A A;  4PFO A;  5FLM J;  1SD6 A;  4R8H A;  1Z77 A;  3OS0 A;  4LJZ F;  1PUE E;  2DAO A;  1ZH5 A;  2ID3 A;  4UHT A;  1WWX A;  2KMU A;  2A69 F;  5EG0 A;  2L02 A;  2ESN A;  1A35 A;  3CCQ I;  4AVZ A;  4F52 A;  2IRF G;  2LNB A;  4KFC A;  3RKQ A;  3CJN A;  3WGG A;  3KPH A;  3MQ0 A;  3OIO A;  4BAC A;  4XRS A;  2K85 A;  1OKR A;  5KCM A;  4L0Y B;  4A3E J;  4A0Z A;  3FXL A;  3E0J B;  4AM3 A;  2XAU A;  1Y1V J;  3O8H A;  1JGG A;  2FQ3 A;  1FP2 A;  3JSP A;  4CCN A;  3H0D A;  1R1T A;  3I59 A;  2JTV A;  5E18 F;  1WVR A;  2ELH A;  1A31 A;  1X1A A;  3L2R A;  3CCE I;  2GQQ A;  4ZYA A;  4KN4 X;  5BPI A;  1B8I B;  1TWH J;  4DNC A;  3IP4 B;  3ZN0 A;  4HBL A;  3QP5 A;  2R5Z A;  1SMT A;  3IWF A;  5LRR A;  2VPL A;  1MBJ A;  4BJT A;  3I0T A;  4QPQ A;  3H3V K;  5EZG A;  2L7M P;  5EZH A;  2M9H A;  2OZ6 A;  4V19 K;  1FOX A;  4CZZ A;  2QZ8 A;  2NS8 A;  1YIJ I;  2PQ8 A;  4IX7 A;  1O3R A;  2PX9 A;  1PP7 U;  1T2K A;  3I58 A;  5LFA A;  2DK5 A;  3NWS A;  3CCM I;  2FML A;  1BA5 A;  2XRL A;  3LAJ A;  5KNL A;  2HI3 A;  2Y31 A;  3OYL A;  1OLT A;  4IRI A;  2DFI A;  2ZB9 A;  3K1P A;  2HFH A;  5M5Y J;  4DYC A;  2XPU A;  2UV1 A;  3HSE A;  3OOU A;  3PFY A;  4CYC A;  2DPD A;  1U9N A;  2DMT A;  2OCE A;  1DU6 A;  2KZV A;  1IN8 A;  1MJB A;  3HG9 A;  2CS3 A;  3SDB A;  3PJR A;  3E5Q A;  1H9T A;  3ZPL A;  2H09 A;  3BZK A;  2GXB A;  4IO9 F;  3UNG C;  4RAG A;  1I1S A;  2I5U A;  3V8L A;  2P6S A;  5JVT A;  2QVO A;  1A6Q A;  2H8W A;  3I64 A;  1WI9 A;  4BL0 B;  1B72 A;  3NWT A;  2F48 A;  5LEK A;  3JAM Z;  1IN5 A;  4BU2 A;  2QF7 A;  2M1B A;  1SAX A;  3SFZ A;  3F23 A;  1WJC A;  3K4N A;  3T0Y A;  2ECB A;  5ED4 A;  4IL6 C;  4C2M J;  2MLG A;  3L2W A;  2DCE A;  4HV6 A;  3MFK A;  3T8T A;  4U88 A;  4BKX A;  1WGX A;  2A5W A;  5F0F A;  3JW4 A;  4BY7 J;  3WG7 H;  3T5X A;  3BPX A;  5DV5 A;  5E20 A;  1FMW A;  3FKJ A;  3K4J A;  1K4T A;  3LA7 A;  5AIQ A;  4HQM A;  2GAU A;  3GXO A;  4GCV A;  1UHM A;  3TQN A;  4ETS A;  3JRB A;  2KDZ A;  4K2E A;  3LNQ A;  3OSF A;  2ZXH A;  3BJO A;  3PIO F;  2DDB A;  2HU9 A;  2IXS A;  2B0L A;  1IDY A;  3TP3 A;  4CYC B;  3G1M A;  2PN6 A;  3S93 A;  3BQZ A;  2HVR A;  4HAM A;  1W0T A;  1AKH A;  4A3D J;  1V4R A;  2K9L A;  5IP6 A;  3CMY A;  4WF2 A;  3JAM K;  2F4I A;  4Y52 J;  3H5A A;  4BQQ A;  4F55 A;  2FX0 A;  2H6B A;  4II3 A;  1J5Y A;  2KIF A;  3HOZ J;  4M3B A;  3GFJ A;  3R60 A;  4B8X A;  5CQG A;  3ZRG A;  3FXJ A;  3SDG A;  1P7J A;  2ESH A;  2HQA A;  2WY8 Q;  3K7A J;  3WTY C;  1R7J A;  2JPB A;  1GLN A;  3M1E A;  3LL7 A;  1BC7 C;  1OCT C;  3DTI A;  1FZP B;  2G7U A;  3DTE A;  3BC8 A;  1KA8 A;  3K4M A;  3PO3 J;  4FET A;  3FMQ A;  3L2V A;  2EIL H;  3HZJ A;  2DA7 A;  2HXI A;  4DOZ A;  2KJC A;  1W36 C;  2F5E A;  5E3N A;  3A03 A;  2V1U A;  3TW6 A;  2Z2S B;  3HKZ N;  2EZK A;  1QA6 A;  2RV8 A;  1RI7 A;  4JX5 A;  5J4Y A;  2L4A A;  3LSM A;  3OYJ A;  3F8B A;  2ISY A;  3LQR A;  3S1R J;  5DCF A;  4IHV A;  4YEL A;  5D5X B;  4ZZD A;  1MNM C;  2CV0 A;  3P5J A;  3OYF A;  3K4B A;  1SFO J;  1I27 A;  3HTU A;  4KT6 A;  3KP5 A;  4WXC A;  3IUO A;  4GGG A;  2W84 A;  3OMY A;  1CGP A;  4XLA A;  3T8R A;  1UHS A;  2R7S A;  1YW7 A;  1VI0 A;  2OA4 A;  4BXU A;  2C6Y A;  3IAS 2;  3QWL A;  4KJZ A;  4RB0 A;  2H1L A;  2A07 F;  2OTL I;  1W4M A;  1W5S A;  3RTR A;  1E3O C;  3TGN A;  2M2E A;  4ASN A;  3TO9 A;  1ZRD A;  3IWZ A;  2HVQ A;  5L3D A;  3F8F A;  4HPQ A;  5CQE A;  3HPH A;  2FJ1 A;  5D8K B;  3HIF A;  2DK8 A;  2TRT A;  3COA C;  3MZH A;  2AQF A;  5GTH C;  2FBH A;  4R1H A;  1IXC A;  3W6K B;  2N8G A;  5BS6 A;  3U2R A;  4I98 B;  2QCO A;  3KLO A;  1J0R A;  4LG3 A;  2KKO A;  2K9N A;  4B3X A;  3WTT C;  3OYI A;  1YOV B;  3W3C A;  4M3E A;  2PEX A;  4LIV A;  1IDZ A;  3GCM A;  2VQC A;  5E8I A;  1ZR2 A;  2HDD A;  1B4A A;  1O3Q A;  4I76 A;  1K61 A;  3J7A O;  1ZG3 A;  3CO7 C;  4HEA 2;  1B1B A;  4X0G A;  4A3G J;  3BJA A;  1QZE A;  2WAQ N;  1QHH D;  1ZRE A;  3DP7 A;  1W5T A;  3K2Z A;  1ETV A;  3IH4 A;  2ZNZ A;  3EQL F;  3WE3 A;  3MN2 A;  3NAR A;  4IJA A;  1JT6 A;  4EV0 A;  1R58 A;  3OY9 A;  4A12 A;  3S2H J;  1VQ8 I;  2F5V A;  1X4P A;  1EH8 A;  2K4J A;  4NUB A;  4RA2 A;  5HS8 A;  2XGE A;  4XQF A;  1APL C;  4E7K A;  2BXY A;  2HS5 A;  2VBX A;  2ECC A;  4WXD A;  3HXL A;  4RGX A;  1HOM A;  1MBE A;  2QYO A;  3L2C A;  1BI2 A;  4C9Y A;  1JGS A;  3JR9 A;  3PM1 A;  2PFB A;  3TMO A;  5K5R A;  1IJW C;  1I6X A;  1MJA A;  4N4N B;  3OYE A;  1HW2 A;  3V4G A;  1Y8Q B;  2CGP A;  5IOY A;  2EB7 A;  5D5W B;  2OCC H;  1V55 H;  1XMA A;  1T95 A;  2J5P A;  2CO5 A;  1OCO H;  1B6A A;  3D5L A;  3O8G A;  4Z2Y A;  2E2I J;  2EFQ A;  5DCM B;  2M8E A;  5JLX A;  4MGR A;  4EM0 B;  1QBJ A;  2MC4 A;  3J80 K;  2E7W A;  2KJB A;  4RAF A;  5JI6 A;  5HLH A;  2QKM B;  1EA3 A;  5KVR A;  1PP8 F;  4IHX A;  3LSJ A;  4CO8 A;  5BOX A;  4YFN F;  3RIR A;  4BY1 J;  2AXL A;  2BW3 A;  2Z16 A;  4FHT A;  1UMQ A;  3BG6 A;  3CCU I;  2QWW A;  4HF1 A;  4BEH B;  2O6G E;  2ZXW H;  1RUO A;  5H6Q A;  4A3K J;  4E7S A;  2EH3 A;  4E7I A;  4RMN A;  2LKX A;  5IYC J;  3M9A A;  4FX0 A;  5B66 C;  3C7J A; 
#chains in the Genus database with same CATH homology
 1R23 A;  2GWR A;  2EFW A;  2RN7 A;  5FB2 A;  1YW9 A;  2QQA A;  1HQC A;  4PZJ A;  2HOE A;  2QQ9 A;  3WTU C;  3GLX A;  4HDU A;  4HZF A;  4G6Q A;  2EJR A;  2XAQ A;  3OOP A;  1ZAO A;  3MAJ A;  5D8L B;  4U0W A;  5ICC A;  2NNN A;  2Y75 A;  2RGV A;  1S3J A;  4R79 A;  4MEX F;  2PMH A;  1L3L A;  1QZZ A;  1QNT A;  2FA5 A;  3LA2 A;  1A04 A;  2MH2 A;  2XAS A;  2H27 A;  4WK8 F;  2UZK A;  3HRM A;  3ZMZ A;  1XDU A;  5EEG A;  3SZP A;  4AVP A;  5JFR A;  3SQN A;  3ISP A;  4OU0 A;  5HDK A;  3FX3 A;  3VEP A;  1P4A A;  1MDM B;  4A2U A;  2D1V A;  2MLK A;  3C1D A;  2EV0 A;  4HX8 A;  4EJO A;  2O3F A;  4CXF A;  3F8M A;  2K02 A;  3REO A;  4O3M A;  2O03 A;  1H0M A;  3I54 A;  2IVM A;  5DD4 A;  2K7L A;  3CTA A;  4G7Z F;  2FOK A;  3RKX A;  4S05 A;  3R4K A;  5F64 A;  1W7P A;  4L5J A;  1HKQ A;  2A61 A;  2EFP A;  2R7F A;  1F5T A;  3SXY A;  4NQW A;  2VN2 A;  2FRH A;  4DQ2 A;  2F5C A;  2L01 A;  3LAP A;  4Q47 A;  4B09 A;  3J81 Z;  1FSE A;  2EFO A;  2WTE A;  3B73 A;  4I09 A;  2XAF A;  3TOB A;  4HQE A;  1LDD A;  4ON0 A;  5IT9 K;  1K7A A;  1K78 B;  5CVI A;  4ENN A;  3QPH A;  3ZMU A;  3KEO A;  3PFI A;  1AOY A;  2KIU A;  1FBQ A;  2CYY A;  3DFG A;  4Y17 A;  4HA8 A;  3ZMT A;  2GIV A;  2IA2 A;  2GZW A;  4RB1 A;  2EA2 A;  1ZG5 A;  1WSU A;  2Z33 A;  4YG2 F;  1U5T B;  3GW2 A;  3Q9S A;  3ZN1 A;  4E70 A;  4P5O A;  2IW5 A;  3ULQ B;  2VXZ A;  3HHG A;  4L5I A;  3J81 K;  4F7Z A;  4G8X A;  1BN5 A;  2L54 A;  1YS6 A;  4A6E A;  1TNT A;  5CJ9 A;  3DPL C;  3CUQ B;  4YFK F;  5DUK A;  1O3S A;  1OYY A;  2M5W A;  3ABU A;  4ZYG A;  4OIQ F;  1KU7 A;  3KP7 A;  1S8N A;  3GF2 A;  5E1X A;  1KQ8 A;  1E2X A;  3RPU A;  1L0O C;  3TO6 A;  3GFL A;  1IZ1 A;  1O7F A;  4KIF A;  4BNC A;  1ON2 A;  4CIC A;  5F6F A;  1JE8 A;  5L3G A;  2G9W A;  2ETH A;  2Q2E A;  2JRT A;  2XHK A;  2P6T A;  2YPR A;  1XSD A;  3DEU A;  2DLL A;  5FD5 A;  3GVA A;  1XD7 A;  2EV5 A;  3I71 A;  2W24 A;  3BZ6 A;  2ISZ A;  2IPQ X;  4EGZ A;  3MCZ A;  1P92 A;  3LA3 A;  4LLN A;  4ZZL A;  4LFU A;  4U0V A;  4LK1 F;  1LQ1 A;  1XB4 A;  5TRD A;  1HSJ A;  1SD4 A;  2OQG A;  1XGN A;  4YFX F;  3FWE A;  4M9S A;  2UXN A;  3ZP5 A;  3NRV A;  2XKO A;  3W6J B;  3F8C A;  3TO7 A;  5HDN A;  5D4R A;  3O2P E;  1BM9 A;  3L09 A;  2EWN A;  3FM5 A;  2ZFW A;  1JHF A;  3L00 A;  4BAY A;  2IP2 A;  4M6Y A;  4Q4Z F;  4U7B A;  2DQL A;  4XLP F;  4KT5 C;  2E7X A;  3GUD A;  4ESF A;  3MZY A;  4ZH4 F;  3DF8 A;  1G3Y A;  4Q5S F;  5F1R A;  1YYV A;  2F2E A;  2VT3 A;  2MH9 A;  3GFI A;  1YQA A;  4I2O A;  5KK1 A;  2QBY A;  5L3E A;  3NEU A;  5EEH A;  4XBF A;  2D2W A;  3R6S A;  3O3K A;  2X0L A;  4M73 A;  3BPV A;  1R36 A;  4KUM A;  3EYI A;  2Z9O A;  5HOO A;  2HEO A;  1ZG1 A;  3I59 B;  3CLO A;  3ZMD A;  4IPA A;  5HDG A;  3S2W A;  2F5F A;  1FYK A;  3R0A A;  5E17 F;  3E6B A;  1USS A;  2IJL A;  3GFM A;  2DBB A;  1Z1D A;  4KNY A;  3ZMV A;  3IHU A;  4G7O F;  1MJ9 A;  2QEN A;  2HDC A;  3MEX A;  5HVQ C;  6PAX A;  2DW4 A;  1UFM A;  1MKM A;  2W57 A;  3ELK A;  3KZY A;  4IHT A;  3IC7 A;  1GXQ A;  1GHC A;  5JHU A;  1DUX C;  2AS5 F;  1QO0 D;  3WTZ A;  2GXG A;  3KP3 A;  3NQO A;  2DQR A;  4L9T A;  1LDK B;  1RNL A;  1HST A;  3TDZ C;  2HTJ A;  4M71 A;  3KEQ A;  2RC4 A;  3BRO A;  1QZY A;  3CUO A;  2PLY A;  3FHZ A;  3E6M A;  5AON A;  2FF4 A;  4EVI A;  2EFN A;  1IXS B;  1HKT A;  2P5L C;  1I5Z A;  1P6R A;  4OMY A;  2HYF A;  4A0Y A;  4L9N A;  1KU9 A;  2OD5 A;  1B59 A;  3P9C A;  3E5U A;  2MC3 A;  2V6C A;  1IXR C;  2VE8 A;  4UV8 A;  1QGP A;  2WWY A;  3KP4 A;  2XRN A;  5D5V B;  1SFU A;  1TTY A;  3F3X A;  4XLN F;  4Y15 A;  4WX9 A;  1K79 A;  4D0P A;  2Y48 A;  1U8R A;  3WU1 B;  4L0Z B;  5FD6 A;  2QUF A;  4ENJ A;  2HKO A;  3PQK A;  3K1N A;  4RAY A;  3LWF A;  1U6G A;  1IF1 A;  4RB3 C;  3C3W A;  1FY7 A;  2ZNY A;  1IRG A;  1KU2 A;  2A5Y B;  1X3U A;  1JXS A;  3I53 A;  4RAZ A;  3M8E A;  2VOO A;  4LGW A;  1KYW A;  4WXH A;  3WGI A;  2D45 A;  4IHS A;  2QQB A;  1ZRF A;  1BBY A;  3R0J A;  2RDP A;  4ENM A;  1IAW A;  1C0W A;  4RGR A;  4MQ9 F;  3G73 A;  1LEA A;  2LF8 A;  1R1U A;  1MD0 A;  2M30 A;  3V8J A;  2FMY A;  4MTE A;  3KCC A;  2JSC A;  4BH9 A;  4EM2 A;  1Z6T A;  1LEB A;  4IVN A;  5D4S A;  4M6X A;  3GZ5 A;  4RS8 A;  3E3V A;  4EM1 A;  2ZCW A;  3WG9 A;  3K0L A;  2Y0M A;  2IT0 A;  4UUV A;  3QPT A;  5AIP A;  2BV6 A;  1TW3 A;  1STZ A;  5FO5 A;  5K5O A;  1RIO H;  1U3E M;  1XSX A;  4KMF A;  1OYI A;  4BQA A;  4EGY A;  2DI3 A;  4M9X A;  2HGC A;  1KQ9 A;  3JSO A;  1BI1 A;  5CVV A;  5ERI A;  4KA4 A;  4UVC A;  4IXA A;  2XVC A;  5ICF A;  1S29 A;  1D8J A;  1R00 A;  3V7R A;  1D8K A;  2PBI A;  2J5O A;  5BQT A;  3QU6 A;  2O61 A;  4MEY F;  3BDD A;  1FSH A;  2XRO A;  2COM A;  4L9J A;  1G3T A;  5K5Q A;  5ICE A;  1WKM A;  2FNA A;  1REP C;  2X4H A;  1MGT A;  2G7H A;  5LHH A;  2Q8K A;  5DDG A;  1BI3 A;  2Q0O A;  1I1G A;  2W85 A;  2YU3 A;  3F6O A;  2HQN A;  2KRF A;  2IA0 A;  3O6B B;  5L3F A;  1D5V A;  1IN6 A;  1RUN A;  1U2W A;  1XGS A;  3HOS A;  3HUG A;  2BGC A;  3Q5F A;  1IN7 A;  4I0B A;  2FXA A;  3ZMS A;  4OIN F;  2HQR A;  2Z99 A;  1SFE A;  3FMS A;  3L7W A;  4Y13 A;  5TJJ A;  2M45 A;  1TQP A;  2XIG A;  3RKY A;  3RKW A;  2FSW A;  4CHU A;  4YII A;  2ZKZ A;  5CVJ A;  4LG0 A;  3EUH A;  3OV8 A;  3WOD F;  3U1D A;  3AAF A;  1UHW A;  1BC8 C;  2W25 A;  1ON1 A;  1ZGA A;  4GYG A;  5H20 A;  2V1D A;  1HW5 A;  2O0Y A;  3B02 A;  1OPC A;  2VBZ A;  1HKS A;  3KFW X;  3G3Z A;  1FWZ A;  3VOD A;  5HLI A;  2WC2 A;  2CQK A;  1ULY A;  1NHA A;  1LVA A;  1W7P B;  1YFH A;  4OOI A;  2HYG D;  1YTY A;  4GYI A;  1DPR A;  1Z91 A;  4M72 A;  2CW0 F;  1S6L A;  1F4K A;  3WTS C;  3SHF A;  4AD9 A;  3N97 A;  5JR3 A;  5DUI A;  4TV7 A;  4EJT A;  3QRF F;  1LNW A;  3LST A;  3KLN A;  4LG0 B;  4HDV A;  4I02 A;  4HYE A;  5LHI A;  5FFX A;  2Z5U A;  1J9I A;  1KU3 A;  5ILU A;  3DPT A;  2V9V A;  1T39 A;  4HF2 A;  2K4B A;  4ESJ A;  2NS0 A;  3ABT A;  2OZU A;  2FEZ A;  1ZGJ A;  1BOA A;  3ECO A;  1GVJ A;  3IL2 A;  1ZYR F;  5DEQ A;  3DXJ F;  4UVB A;  4EJV A;  1FP1 D;  3T1B A;  2FBK A;  3V7S A;  1UST A;  4AIK A;  4IF4 A;  3HHH A;  2A3S A;  3ECH A;  3EYY A;  4NB5 A;  4GO1 A;  4L9V A;  3ZQ7 A;  5HLG A;  3N4M A;  1TBX A;  4CYD A;  4A5N A;  2V79 A;  1BIA A;  3ERE D;  1OMI A;  3V7C A;  5BPD A;  4EMS A;  4PCQ A;  5FGM A;  1SD5 A;  2P8T A;  1FBU A;  3DV8 A;  2VBW A;  1S7A A;  1O7L A;  1KQ0 A;  3M8F A;  4KMU X;  1ZHF A;  3HSF A;  4FX4 A;  2YX4 A;  2Z3Y A;  4G7H F;  2PMU A;  1ZN2 A;  1XCV A;  2H6C A;  1FT9 A;  3FMR A;  1FX7 A;  3FXQ A;  1OYW A;  2RNJ A;  5CVR A;  4HOB A;  4H0E A;  3RYR A;  2STT A;  1YG2 A;  2FBI A;  3P9K A;  1FNN A;  1WRJ A;  5E8G A;  2UWM A;  4ZYH A;  1SD7 A;  1XDS A;  4G94 A;  4M9Z A;  3TDU C;  1P4X A;  3I5U A;  2D1H A;  4L18 B;  5ILS A;  3F6V A;  3RDI A;  1CF7 A;  1FC3 A;  1V3F A;  3MWM A;  1PDN C;  4KYW A;  1J7K A;  1SFX A;  3TOA A;  3FXR A;  4PDK A;  3KP2 A;  1Z7U A;  5D6F A;  1KGS A;  1XGM A;  1F9N A;  3SZT A;  1LJ9 A;  3FXU A;  2KIM A;  4IRH A;  3DQV C;  4MQV A;  4FX0 A;  4ENK A;  3E5X A;  1TQM A;  2XGX A;  3P9I A;  2ADU A;  4U0Y A;  2QM3 A;  4MNU A;  5CLS A;  1YIO A;  2E1N A;  3H3U A;  2RVC A;  4P55 A;  3HRU A;  3F21 A;  4A0X A;  4HV5 A;  2STW A;  2ZO4 A;  2K27 A;  2P5K A;  2VT2 A;  1IN4 A;  1CF7 B;  3JTH A;  2CWE A;  2CG4 A;  4OMZ A;  4ZYE A;  4XSZ F;  2DT5 A;  2DO7 A;  1HBX G;  4UNO A;  1JHH A;  5DD8 A;  2K86 A;  5HS9 A;  5LLQ A;  2R7D A;  2QBY B;  2L3D A;  4KIB A;  2RKH A;  3E6C C;  2XAG A;  4OIO F;  2YSR A;  5K1Y A;  2OBP A;  3Q9V A;  5E1W A;  4PGG A;  3VFZ A;  2DU9 A;  4IRG A;  2VC0 A;  1UCR A;  1QPM A;  2EK5 A;  1FOK A;  2ZXJ A;  3C18 A;  5L3B A;  5HS7 A;  3QU3 A;  3GX4 X;  3DKW A;  1HW1 A;  3E6D A;  1GXP A;  4GXO A;  1DDN A;  1ZLK A;  4LB6 B;  3F22 A;  1R5H A;  1G3W A;  4LD5 A;  3GO5 A;  5H6R A;  1IW7 F;  2OAZ A;  1J75 A;  3QOP A;  1OR7 A;  2PG4 A;  1P4W A;  4RGU A;  2WV0 A;  4LLG F;  4ZYD A;  2JPC A;  1HXD A;  2H94 A;  3M7G A;  1XMK A;  1U78 A;  2VC1 A;  3PQJ A;  3ROU A;  2JZY A;  3EET A;  1J2X A;  4LMY A;  3HSR A;  3U9G A;  2LSO A;  2HTS A;  4M74 A;  3WGH A;  1Q1H A;  4N9H A;  1BI0 A;  1YO5 C;  5DCM A;  1T98 A;  4HLX A;  1EH6 A;  2A68 F;  4RGS A;  2NNY A;  4N0B A;  5CVU A;  3J80 Z;  2FE3 A;  2VON A;  3KET A;  3CDH A;  4LB5 A;  2R3S A;  1R22 A;  3WTW C;  3KE2 A;  3HOT A;  2NYX A;  1QQI A;  1IUY A;  3FF5 A;  5A2Q Z;  5J8F A;  2BE5 F;  1FYL A;  4JBA A;  2JT1 A;  3QAH A;  1ZAR A;  1YLF A;  3GWZ A;  1B9N A;  1FPQ A;  1Z05 A;  2XAH A;  4U7D A;  4NHJ A;  1KYZ A;  4G9Y A;  2GA2 A;  2EV6 A;  4ESB A;  1W7P D;  3K1M A;  1G6N A;  3LFK A;  3VOE A;  1O3T A;  1BJA A;  3RJP A;  2IA1 A;  2YX7 A;  1T38 A;  2CFX A;  2A6H F;  4MTD A;  5A2Q K;  2QLZ A;  2TDX A;  2P7C B;  3IRQ A;  5LGN A;  2XKP A;  1EH7 A;  1T0F A;  1Y0U A;  1MDM A;  4EJW A;  3D0S A;  4KN7 X;  4AIH A;  3R61 A;  3KP6 A;  1F1Z A;  1RZ4 A;  3RYP A;  3P7N A;  4BHB A;  3E97 A;  2VBY A;  5BMZ A;  1Z6R A;  2YR2 A;  5D5U B;  1XCB A;  4KIC A;  5LGT A;  3K9T A;  3H92 A;  3I4P A;  3LQQ A;  4EJU A;  1P2F A;  5J6X A;  4JQF A;  4A6D A;  2HWV A;  2VOD A;  1AWC A;  4FT8 A;  1U5T C;  4HLY A;  5LRS A;  2LF7 A;  2NRA C;  2HR3 A;  5FFZ A;  2VE9 A;  1LB2 A;  1J59 A;  2EA4 A;  2M87 A;  1SMY F;  3JTG A;  4PGH A;  3TKY A;  2MBF A;  2VOP A;  4EQQ A;  4XRF A;  4CDG A;  4XSX F;  2FNP A;  1ONV A;  2ZBK A;  1B9M A;  1K78 A;  3CUQ C;  2HZT A;  1E17 A;  2LKP A;  2HKX A;  3IKT A;  2ZME A;  1TNS A;  4I0A A;  2LDU A;  2OU2 A;  4CGZ A;  2P7V B;  2XV4 S;  5IT9 Z;  1DPU A;  1WQ2 A;  4I7H A;  4BYY A;  5LBQ A;  2A6E F;  4LK0 F;  3V8K A;  3FZV A;  5IT3 A;  4HW0 A;  4HF0 A;  1U5T A;  3HYI A;  4HX7 A;  2ACJ A;  2O8X A;  3GYH X;  4HX4 A;  1YS7 A;  2P4W A;  3IKV A;  3CUQ A;  4BHC A;  4N9I A;  5LGU A;  4P96 A;  4P9F A;  2GA1 A;  5D6E A;  1TW2 A;  4MHG A;  4G6D A;  2DPU A;  2E1C A;  2ZME B;  2UXX A;  3BJ6 A;  2NAZ A;  3HRS A;  4JK1 X;  5L3C A;  4UV9 A;  3IRR A;  3CO6 C;  1ZRC A;  2BEO A;  1VTN C;  3BOQ A;  3GZ6 A;  2PJP A;  5CYV A;  4AIJ A;  1LDJ A;  1K6O A;  5DYM A;  1DP7 P;  3BP8 A;  3FM3 A;  4WWC A;  1XSV A;  1EV7 A;  4WCG A;  1XGO A;  4A5M A;  3VB2 A;  5E1Z B;  5LEJ A;  3QP6 A;  2OQR A;  3ML6 A;  5FLX Z;  1S7O A;  2V1X A;  4O6J A;  1ZLJ A;  1IRF A;  3GEZ A;  5LHG A;  4QWQ A;  5ICG A;  1O57 A;  4OIR F;  2L4M A;  1TLH B;  5ILV A;  1MZB A;  2BBY A;  1D3Y A;  3BY6 A;  4I01 A;  4OIP F;  2CSO A;  3RI4 A;  1FLI A;  4BHP A;  4YIF A;  1R5G A;  2PI0 A;  4KDP A;  4LLL A;  2DTR A;  1H9G A;  4Q48 A;  2MA3 A;  1ODD A;  3WTX C;  4AWX B;  2MD5 A;  2BYV E;  3F72 A;  4KIG A;  4UVA A;  1YW8 A;  5FLX K;  2XAJ A;  1T6S A;  3HRT A;  3KZZ A;  1FBS A;  1BIB A;  1Z9C A;  4QLC U;  1R1V A;  3K69 A;  3WU0 A;  2XUB A;  2F5D A;  3F8N A;  1FYM A;  2P5V A;  1G4D A;  4RB2 C;  3RPQ A;  1G3S A;  5J8C A;  4S04 A;  4P9U A;  1TQI A;  3WE2 A;  4O5V A;  3WTV C;  3BWG A;  2FU4 A;  3L9F A;  1XN7 A;  3H3Z A;  2RQP A;  3HTS B;  1UB9 A;  3EDP A;  2ZJ2 A;  1SD6 A;  4R8H A;  4LJZ F;  1PUE E;  2DAO A;  1ZH5 A;  4UHT A;  1WWX A;  2A69 F;  2L02 A;  2ESN A;  2IRF G;  4KFC A;  2LNB A;  3CJN A;  3WGG A;  3MQ0 A;  1OKR A;  4L0Y B;  4A0Z A;  2FQ3 A;  1FP2 A;  3JSP A;  1R1T A;  3I59 A;  2JTV A;  5E18 F;  2ELH A;  2GQQ A;  4KN4 X;  5BPI A;  4DNC A;  3ZN0 A;  4HBL A;  3QP5 A;  1SMT A;  3IWF A;  5LRR A;  3I0T A;  2OZ6 A;  4CZZ A;  2QZ8 A;  2PQ8 A;  1O3R A;  1PP7 U;  1T2K A;  3I58 A;  2DK5 A;  2FML A;  3LAJ A;  4IRI A;  2DFI A;  3K1P A;  2HFH A;  3HSE A;  2DPD A;  1IN8 A;  1MJB A;  3E5Q A;  1H9T A;  3ZPL A;  2H09 A;  2GXB A;  1I1S A;  3V8L A;  2P6S A;  5JVT A;  2QVO A;  3I64 A;  1WI9 A;  5LEK A;  3JAM Z;  1IN5 A;  2M1B A;  1SAX A;  3SFZ A;  3F23 A;  3T0Y A;  5ED4 A;  2MLG A;  4HV6 A;  3MFK A;  3T8T A;  4U88 A;  3JW4 A;  3T5X A;  3BPX A;  5DV5 A;  5E20 A;  3LA7 A;  5AIQ A;  4HQM A;  2GAU A;  3GXO A;  4GCV A;  1UHM A;  3TQN A;  4ETS A;  4K2E A;  3BJO A;  2B0L A;  2PN6 A;  4HAM A;  1V4R A;  4WF2 A;  3JAM K;  2H6B A;  1J5Y A;  2KIF A;  3GFJ A;  3R60 A;  4B8X A;  2ESH A;  3WTY C;  1R7J A;  2JPB A;  3M1E A;  1BC7 C;  1FZP B;  2G7U A;  1KA8 A;  3FMQ A;  2KJC A;  2F5E A;  2V1U A;  2RV8 A;  1RI7 A;  2L4A A;  3F8B A;  2ISY A;  3LQR A;  5DCF A;  4ZZD A;  5D5X B;  1I27 A;  3HTU A;  3KP5 A;  4WXC A;  4GGG A;  2W84 A;  1CGP A;  3T8R A;  1YW7 A;  4BXU A;  2OA4 A;  2C6Y A;  4RB0 A;  2A07 F;  1W4M A;  1W5S A;  3RTR A;  3TGN A;  4ASN A;  3TO9 A;  1ZRD A;  3IWZ A;  5L3D A;  3F8F A;  5D8K B;  3HIF A;  2DK8 A;  3COA C;  3MZH A;  2FBH A;  4R1H A;  1IXC A;  3W6K B;  5BS6 A;  3U2R A;  4I98 B;  3KLO A;  1J0R A;  2KKO A;  3WTT C;  2PEX A;  3J7A O;  5E8I A;  1B4A A;  1O3Q A;  1ZG3 A;  3CO7 C;  1B1B A;  3BJA A;  1ZRE A;  3DP7 A;  1W5T A;  3K2Z A;  2ZNZ A;  3EQL F;  3WE3 A;  4IJA A;  4EV0 A;  1R58 A;  4A12 A;  1EH8 A;  2K4J A;  5HS8 A;  2HS5 A;  2VBX A;  4WXD A;  4RGX A;  2QYO A;  3L2C A;  1BI2 A;  1JGS A;  2PFB A;  5K5R A;  1I6X A;  1MJA A;  1HW2 A;  3V4G A;  2CGP A;  2EB7 A;  5D5W B;  1XMA A;  2J5P A;  2CO5 A;  1B6A A;  3D5L A;  4Z2Y A;  2EFQ A;  5DCM B;  2M8E A;  4EM0 B;  4MGR A;  1QBJ A;  3J80 K;  2E7W A;  2KJB A;  5JI6 A;  5HLH A;  5KVR A;  1PP8 F;  4CO8 A;  5BOX A;  4YFN F;  3RIR A;  2AXL A;  4FHT A;  2QWW A;  4HF1 A;  2O6G E;  1RUO A;  5H6Q A;  3M9A A;  4UXN A;  3C7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...