2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication termination protein
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
3JTHA 2HQRA 3ROUA 3REOA 5EEGA 2PMHA 5DD4A 3R4KA 1JGSA 5K1YA 1ZAOA 3N4MA 3SQNA 2XAFA 1DPRA 4QWQA 2J5PA 2OD5A 2ZMEA 4M9SA 3R6SA 4AIHA 5E18F 5TJJA 5FLXZ 2RV8A 2FQ3A 3HOTA 4OIQF 1R22A 1FX7A 1PP8F 3GFMA 5IT9K 2DK8A 3J81K 4EM2A 1MJBA 3WTTC 2P5VA 3VOEA 2R7FA 4XSZF 1G4DA 1DUXC 2HTSA 1SMTA 3KEQA 1XSDA 2ISYA 3F6VA 3ZMZA 2PJPA 4AD9A 3RYRA 1O57A 1LNWA 1VTNC 4G94A 1RI7A 1ZRDA 2Y0MA 1U3EM 3KLNA 1R23A 1G6NA 1ZRFA 3QU3A 1Z1DA 4U88A 2JRTA 5JVTA 2XUBA 2A6EF 5K5OA 2YX4A 3EYYA 4A2UA 3F8FA 3H92A 2BBYA 2PMUA 2V1UA 3FMRA 3VFZA 1R58A 3C1DA 1JXSA 4OIOF 2QQ9A 3GO5A 3ZMVA 2HKXA 5ED4A 1B4AA 3L00A 1P2FA 4XSXF 3S2WA 5DEQA 2O3FA 4KIFA 4HDVA 3M7GA 2W25A 2P7VB 3ERED 2H09A 1MJAA 1FBQA 1J2XA 3E5UA 2F5DA 2H27A 1FBSA 3BZ6A 2P7CB 2BGCA 4EJWA 1XD7A 3FWEA 4M74A 4OMZA 1TNSA 3T1BA 3K9TA 2UXXA 4YFXF 4E70A 5LBQA 1ZG3A 2KIUA 1Z7UA 4AIKA 2O8XA 3ELKA 2FF4A 3V8KA 3W6JB 3L7WA 2EV6A 2ZKZA 4UVAA 4KIGA 1ZHFA 3ABUA 1B9MA 2NYXA 2FOKA 4WWCA 3FXUA 5TRDA 3LA3A 4UHTA 3HRMA 4LFUA 3D0SA 3M8EA 4CHUA 1R1UA 1R5HA 4GCVA 1QZZA 2C6YA 1J7KA 4LG0B 1HW1A 3DKWA 1P4AA 3J80K 2PQ8A 3FM5A 3I4PA 3IC7A 1O3QA 3NRVA 4QLCU 2IW5A 1IXCA 3MFKA 4CDGA 4JQFA 2AXLA 1WQ2A 3PFIA 3ZN0A 5D6EA 2NNNA 3TDZC 2XGXA 3HIFA 2VODA 3QPHA 1AWCA 1FSEA 1ON1A 3FMSA 1ULYA 3RKYA 1FBUA 3OV8A 3MWMA 1STZA 5BPDA 2XAJA 4UUVA 2DAOA 4UVBA 3E6DA 4UXNA 2CWEA 2B0LA 4OIPF 1O7LA 3DPTA 4ZYGA 1W4MA 3Q9SA 3FXRA 3D5LA 3DP7A 3W6KB 1TW2A 2VBWA 5HLIA 4KUMA 5HS9A 2FXAA 4LK0F 4Z2YA 1H0MA 1B6AA 4EV0A 3F8BA 3DPLC 2OA4A 2GZWA 5CVUA 5ILSA 2XRNA 3RDIA 3KZYA 2PFBA 2L4AA 3HUGA 1IRFA 3LAJA 1FY7A 1NHAA 3NEUA 3VEPA 1XDSA 4L9JA 4TV7A 1UB9A 4ENJA 1F4KA 4ZZLA 4I01A 4HAMA 5HOOA 1XCBA 1XCVA 2VONA 2MC3A 4YFKF 3F6OA 2FNPA 2PLYA 3WODF 1QBJA 3E6MA 1A04A 4LGWA 2UZKA 2QWWA 1Z05A 4HQEA 3ZMDA 1BI1A 4OINF 4BXUA 3COAC 1U6GA 2OQRA 5F1RA 2HWVA 2ZXJA 3SFZA 4ENNA 1I1GA 1KU9A 1TNTA 5HDKA 2LDUA 3LQRA 3L2CA 4ASNA 1RIOH 5HS7A 2Q2EA 3GZ6A 4A6EA 1JHFA 5CVJA 5FGMA 3KP3A 4P96A 2YX7A 3KCCA 4BYYA 5L3FA 1SMYF 5LRRA 3AAFA 3GZ5A 1HQCA 3GF2A 1KU7A 5JI6A 1SFUA 4KT5C 1LDJA 1R5GA 5FB2A 4ZZDA 2GQQA 2HEOA 3QAHA 4ZYDA 4HW0A 3ZMTA 1XGSA 4Q5SF 5DYMA 3CUQB 3BWGA 2VC0A 2XVCA 4XBFA 5LHHA 3T8RA 2YU3A 2V1DA 2EJRA 3ZP5A 1HKTA 2ISZA 2LF8A 4PGGA 4JK1X 2GXGA 2VOOA 4M9ZA 4GYGA 1V3FA 1HKQA 1O3TA 4BQAA 2L54A 2W24A 2QM3A 2Z99A 2QUFA 1G3SA 1R7JA 2IPQX 3DQVC 4MTEA 4HV6A 3CUOA 3M9AA 1EH7A 3TKYA 1K79A 3GXOA 1B1BA 3WU0A 1X3UA 3I59A 3GFLA 3K0LA 4IPAA 4DQ2A 1USSA 4I09A 2HDCA 3ZQ7A 2M8EA 4R8HA 1ODDA 1RZ4A 2RNJA 2GA2A 2MD5A 1S3JA 1D8JA 2CG4A 3C3WA 3VODA 3CUQA 3K1PA 5DD8A 4LB5A 3GYHX 3GWZA 1FP1D 4RB1A 5DV5A 1YYVA 4CO8A 3WTVC 4KDPA 3IWFA 5LGNA 4ZH4F 5D4RA 4YG2F 3P9IA 1FNNA 4D0PA 1UHWA 1LB2A 1O3RA 4IRGA 3V7CA 4L0YB 3CUQC 1P4XA 2P5KA 2QZ8A 1IUYA 2D1VA 3IKVA 2Q8KA 5HDNA 1BBYA 3JSOA 3O6BB 2FBHA 3V7SA 3BOQA 4PCQA 1TBXA 4MEYF 1T6SA 4ESJA 1Z6TA 3FM3A 4XRFA 2VT3A 4EGYA 1LEBA 3CLOA 2VXZA 3U9GA 3FHZA 1QZYA 4U0YA 1P4WA 2P8TA 3O3KA 4RGXA 4ENMA 4WXDA 1Z9CA 4S04A 2DU9A 2J5OA 4CZZA 4PZJA 2EA2A 3LSTA 4KNYA 4OOIA 1YW8A 5ILUA 3L9FA 3LFKA 1PDNC 4N9IA 4HF2A 1S7OA 1BC8C 3K1MA 1KYWA 2CYYA 1QO0D 4Q48A 2A3SA 3T0YA 4MQVA 1QNTA 4A0XA 3DEUA 4I7HA 1XGMA 1IF1A 4I0AA 1KYZA 3DXJF 3ISPA 3K1NA 2VBZA 4U7DA 3EDPA 3HYIA 3I54A 4GGGA 3SXYA 4EVIA 2M87A 1SD6A 4WF2A 2HOEA 2ZFWA 3HSRA 2IVMA 4M6YA 1FYLA 3RIRA 2EWNA 1IXSB 5AIQA 1BN5A 1R00A 2P6SA 2DT5A 3JAMZ 4PGHA 3EQLF 4IF4A 1I1SA 2IA2A 1XGNA 4CGZA 5D5XB 2NS0A 4WXHA 5KK1A 4O6JA 2XAQA 5F64A 2CFXA 2F2EA 3LA2A 4ON0A 3L09A 5HDGA 4A0ZA 4Y13A 3H3ZA 3SZPA 2HYGD 4RGSA 2IRFG 1BM9A 1U5TB 5D5VB 3F8MA 4UNOA 5DUKA 1BOAA 1LQ1A 1KA8A 1T39A 1XB4A 3KFWX 2GIVA 1LEAA 2V1XA 4EJVA 4MQ9F 3I64A 1W7PD 5DCMB 4NHJA 1IAWA 4A5MA 2EV5A 2KRFA 1BC7C 5A2QK 4M72A 2V6CA 2EK5A 1K6OA 2RVCA 4HZFA 2FBIA 4NB5A 1RUOA 5FFXA 3G73A 4I2OA 3WE3A 1SD5A 1FSHA 5BPIA 3DF8A 2WV0A 2EFPA 1FLIA 1DPUA 2ZJ2A 1OPCA 2KIFA 5FD5A 4YFNF 1FOKA 2QYOA 1IN8A 3HRSA 3MZYA 4U0WA 2BE5F 2GWRA 5LEJA 3VB2A 3KP2A 2XAHA 2KKOA 2EFNA 4A5NA 4AVPA 3F8NA 4G7ZF 4N0BA 5J8CA 1J9IA 3P9CA 2O0YA 3TOAA 2F5FA 2DK5A 1HBXG 2QENA 4Q4ZF 3FF5A 3HTUA 3Q9VA 1PUEE 1MDMB 4BHBA 4P55A 3BDDA 3JTGA 1UCRA 5H20A 5LEKA 5HLGA 1KGSA 1U5TC 2PN6A 2MH2A 2QVOA 4KIBA 3F8CA 2RDPA 1TQIA 2HYFA 5L3CA 3R61A 3KP7A 2K4BA 2QQBA 3CDHA 1J0RA 2FA5A 1SFEA 2GXBA 2MBFA 4N9HA 5JR3A 5ILVA 2XIGA 2IT0A 1REPC 3RKXA 5LRSA 4R1HA 5K5QA 5E8IA 4WCGA 1IN6A 2K4JA 2CO5A 1IN7A 3BPVA 1OKRA 2LSOA 5AONA 1ZG1A 3RKWA 4R79A 3LA7A 2ELHA 4I02A 2OAZA 2F5EA 1W5TA 4RB0A 2E1NA 4GYIA 1P6RA 3B02A 4NQWA 3HOSA 3HRUA 3I53A 1YS6A 4LG0A 4RB3C 1DP7P 1YLFA 1FPQA 2JT1A 1H9GA 2HQNA 3J7AO 2ZO4A 2IP2A 4FT8A 5LGUA 1K7AA 1HW5A 3EETA 4LD5A 1ZYRF 2MA3A 1SD4A 2FEZA 1XSVA 4EMSA 5FLXK 5E8GA 3IHUA 3I58A 2Z33A 2RQPA 4L9NA 3WU1B 4IHSA 4F7ZA 1BI0A 3ZMSA 1J5YA 2VOPA 1MJ9A 2EFQA 4LLLA 5L3DA 3TO7A 5IT9Z 3I5UA 3Q5FA 3J81Z 1HXDA 1Q1HA 1ZLJA 3FXQA 1ZN2A 3IRRA 4BHPA 1XGOA 4HF0A 4HLXA 3RPQA 3B73A 4GO1A 2XHKA 2Y75A 4IRHA 1OYYA 3DV8A 1DDNA 1G3WA 2A6HF 2JTVA 2ETHA 3R60A 1IW7F 4YIIA 1HW2A 1LVAA 2TDXA 2FSWA 1O7FA 3T8TA 4KN4X 2UWMA 4Y17A 2FU4A 2HKOA 2WC2A 2L01A 3F21A 2O61A 3F3XA 4L0ZB 4FX0A 1W7PB 4O3MA 3FMQA 1XN7A 3I71A 1U2WA 4L9VA 4YIFA 2Q0OA 4HOBA 3ULQB 2HTJA 5ICCA 3E97A 2L3DA 5H6QA 4LLNA 4G7HF 4M73A 1RUNA 2O6GE 1KQ9A 3H3UA 3TO9A 3F72A 3E5QA 2D2WA 3GEZA 1E17A 2HS5A 5E1ZB 4BH9A 2D1HA 1L3LA 4MTDA 5HVQC 2L4MA 1OYIA 3JSPA 1HKSA 2ZCWA 3CO7C 2BV6A 4HQMA 1TQMA 4B09A 1V4RA 2FNAA 2FMLA 2HZTA 1YIOA 1YW7A 4LK1F 4G7OF 1GVJA 5LHIA 4WK8F 2JPBA 5KVRA 2COMA 3R0JA 2PEXA 2K02A 2W84A 1R36A 3BJAA 2JZYA 5BS6A 4P9UA 2P4WA 3JW4A 4M6XA 2W85A 4KMUX 3BJ6A 4ENKA 1K78B 5F6FA 1YS7A 2R3SA 5ICFA 2VE8A 2XV4S 3K2ZA 5FD6A 2NNYA 1J75A 2YR2A 4G8XA 2RC4A 4H0EA 1XDUA 2ZBKA 3HSFA 2QQAA 2CGPA 5J6XA 2A07F 3QU6A 2ZMEB 2GAUA 2STWA 1BI3A 5LHGA 2CSOA 5L3GA 3KETA 5EEHA 4CXFA 3WTXC 1QQIA 4KFCA 1W5SA 2RKHA 2ZNZA 2OZ6A 2PBIA 1G3TA 1EV7A 2F5CA 2LNBA 2A61A 4XLNF 3EYIA 2VN2A 2NAZA 2EB7A 1CF7B 3IL2A 1PP7U 2WTEA 4HA8A 2EV0A 4FX4A 2VBYA 2JPCA 1KQ8A 1YTYA 2M1BA 4U0VA 3WTUC 4I98B 2H6CA 2DPUA 2V9VA 4HDUA 1J59A 6PAXA 5D5WB 1P92A 3HSEA 1OR7A 3BJOA 2QBYB 3HHGA 2M30A 1QPMA 5BMZA 2A5YB 5DDGA 4HX8A 1TTYA 1R1TA 3U2RA 3M8FA 1Y0UA 1D5VA 2HGCA 4RGRA 1MD0A 4AWXB 3HTSB 1B59A 4KA4A 1FYMA 2XKPA 1MKMA 2P6TA 1CF7A 5FFZA 1IN4A 3E3VA 1CGPA 1ZGAA 1KU3A 4A6DA 2DPDA 5K5RA 3KE2A 2ZNYA 1F1ZA 4BAYA 1JHHA 2NRAC 2MH9A 3ECHA 2VE9A 3IRQA 4GXOA 3IWZA 4EM1A 3GUDA 1TLHB 4L5JA 4IHTA 3V8LA 2DQRA 2BEOA 3ML6A 1E2XA 3QP5A 1S8NA 3WGIA 2HFHA 4G9YA 1F5TA 3RYPA 2MLGA 2PG4A 4CICA 2QBYA 4ZYHA 3KEOA 3PQKA 3ZN1A 2M5WA 4RAYA 4A12A 1TW3A 4L9TA 2E1CA 1XMAA 2O03A 2STTA 1T0FA 4EGZA 1XMKA 5L3BA 3ZPLA 1RNLA 4CYDA 2D45A 5ICEA 3CJNA 1FC3A 4ZYEA 5AIPA 3BY6A 3ECOA 5H6RA 1FP2A 2CQKA 1WRJA 2E7WA 1WKMA 4WXCA 4RS8A 2EFOA 5D6FA 4JBAA 1ZGJA 2DO7A 4A0YA 1G3YA 2K86A 1EH6A 3GX4X 4LB6B 5E20A 4U7BA 4DNCA 2BYVE 1U5TA 3RPUA 2H6BA 4OU0A 3I0TA 4M71A 5DCFA 4KMFA 4BHCA 4EJUA 2DBBA 1I5ZA 1XSXA 5IT3A 5BOXA 1ZG5A 2DW4A 5DCMA 4P9FA 3K69A 4FHTA 2IA1A 4K2EA 2YPRA 4LLGF 1L0OC 2ADUA 3V4GA 3WTSC 3EUHA 1B9NA 2FBKA 1S29A 2LF7A 3LAPA 1JE8A 1HSJA 5L3EA 3G3ZA 2WWYA 1C0WA 1H9TA 2PI0A 1YO5C 5CVVA 1ON2A 3WTZA 4MEXF 1U8RA 4OIRF 4HV5A 2IA0A 1QGPA 2ESHA 2K7LA 3GFIA 1UFMA 4P5OA 2VBXA 4G6DA 1OYWA 2FE3A 1MGTA 4MNUA 5E1XA 2K27A 3TDUC 3E6CC 4L18B 1YFHA 1FYKA 1IN5A 3P7NA 5CLSA 5D8KB 2R7DA 3WGHA 1MDMA 3F22A 5J8FA 1ZARA 4G6QA 1BJAA 5DUIA 1EH8A 3KLOA 3FZVA 2OBPA 4PDKA 2Y48A 1YW9A 3MAJA 2XROA 2H94A 2FMYA 1LDDA 2XASA 4UVCA 5E1WA 3IKTA 1U78A 1WI9A 1IZ1A 3O2PE 4EQQA 1LJ9A 5HLHA 4WX9A 1FZPB 3V8JA 2UXNA 2MLKA 4KYWA 4ESBA 2OZUA 3MEXA 4LJZF 2V79A 1Z6RA 4IJAA 2YSRA 2LKPA 1AOYA 2X0LA 2DLLA 2A68F 1BIAA 1FWZA 2L02A 4ESFA 1WSUA 1BI2A 1FT9A 1SFXA 1F9NA 1HSTA 3CTAA 1ZLKA 4HBLA 4HX7A 4UV9A 3T5XA 1O3SA 1Z91A 4ETSA 5LLQA 3JAMK 4IVNA 5JFRA 2HR3A 1T98A 1S6LA 2A69F 1SD7A 5ERIA 3KZZA 2JSCA 3FX3A 2GA1A 3PQJA 5JHUA 2X4HA 3I59B 4IXAA 3WE2A 2OU2A 2G7UA 2IJLA 1ONVA 2Z5UA 1I6XA 3MQ0A 2XKOA 3R0AA 5D8LB 3HHHA 5CYVA 4KN7X 5BQTA 2DTRA 2DQLA 4KICA 5CVIA 3TGNA 4I0BA 4RAZA 3SZTA 3KP5A 2KJBA 3WTWC 3N97A 2G7HA 1WWXA 4EJTA 5D5UB 4EM0B 1D8KA 4M9XA 4AIJA 4B8XA 3E5XA 3TO6A 4HX4A 5HS8A 4OMYA 3QP6A 2AS5F 3RTRA 3MCZA 2RGVA 5A2QZ 2DFIA 3SHFA 4EJOA 2P5LC 2EA4A 3WGGA 5CJ9A 2G9WA 2Z9OA 5D4SA 4XLPF 1LDKB 3MZHA 3KP4A 1KQ0A 2QLZA 2ACJA 4HYEA 3LQQA 4LMYA 2EFWA 4HF1A 2VC1A 1YG2A 3E6BA 1UHMA 2E7XA 2XAGA 1BIBA 4RB2C 1YQAA 5FO5A 2ESNA 4S05A 4UV8A 1IRGA 3WTYC 2CW0F 1W7PA 3GLXA 2FRHA 4IRIA 3CO6C 1D3YA 2RN7A 2KJCA 1USTA 3LWFA 1ZH5A 5LGTA 3J80Z 4BNCA 3F23A 3NQOA 3GFJA 2DI3A 4Y15A 4O5VA 3WG9A 3DFGA 1ZREA 5ICGA 4Q47A 3OOPA 1I27A 1R1VA 3RI4A 3ABTA 4MHGA 1ZRCA 2KIMA 1T38A 5E17F 2M45A 3P9KA 3BP8A 1GXQA 3RJPA 1OMIA 1TQPA 1T2KA 1S7AA 3M1EA 1MZBA 1GHCA 3ZMUA 3QOPA 2W57A 3GVAA 3HRTA 3QPTA 3TQNA 1SAXA 4L5IA 3U1DA 2OQGA 3KP6A 5CVRA 2Z3YA 4MGRA 3BPXA 3C7JA 1KU2A 4RGUA 3QRFF 3BROA 2VT2A 3TOBA 3C18A 1K78A 3GW2A 1IXRC 1GXPA 4HLYA 3V7RA
chains in the Genus database with same CATH superfamily
3JTHA 4XR6A 2HQRA 3ROUA 4A3IJ 1X3ZB 2BVMA 3REOA 5EEGA 2PMHA 3TBIA 2IS4A 1XTAA 3ZQGA 4AIDA 5DD4A 4W1UA 1R9TJ 1WI3A 3R4KA 1JGSA 4DBRA 5K1YA 3K4JA 3FXJA 4QTRA 4BQQA 1N25A 2BOLA 1ZAOA 2WAEA 3BT9A 1K6YA 2LP0A 3LOCA 3N4MA 1I50J 3SQNA 2XAFA 1JUPA 1DPRA 4QWQA 2J5PA 2OD5A 2ZMEA 3HM5A 4M3GA 3GMEA 3FBNB 1IGNA 3GZNB 4M9SA 3R6SA 1YHQI 1CQTA 3CDLA 3S3OA 2KISA 4AIHA 4PJMA 4D1QA 1MNDA 5E18F 1Z7LA 5TJJA 5FLXZ 4BDZA 4BXXJ 2RV8A 5GP9A 5JVGF 3OS2A 2CQXA 2P81A 2FQ3A 1Z67A 2DOAA 3HOTA 4OIQF 1R22A 2I10A 4BKXA 5J4VA 1FX7A 1PP8F 1OCRH 3IH4A 1YX5A 3D5RC 3GFMA 4NUBA 5IT9K 3HDDA 2DK8A 3J81K 3LSIA 4EM2A 1MJBA 1PYVA 3WTTC 2P5VA 2LK2A 3VOEA 4M3FA 2R7FA 3OMYA 1X2MA 2VKDA 5FKLA 4XSZF 3RZDJ 1G4DA 5J1UA 1DUXC 2HTSA 3OYGA 1SMTA 3KEQA 1XSDA 2ISYA 3F6VA 3VWBA 3BR2A 3SEQA 3ZMZA 2PJPA 4AD9A 3RYRA 1Y8QB 3D1NI 1WJBA 3QYBA 1O57A 1SVMA 2WAQA 1LNWA 1VTNC 4A3FJ 1FMWA 3DU6A 4PJ0C 4G94A 1RI7A 1ZRDA 2Y0MA 3ZXSA 2VKVA 1OCTC 2FQ4A 1U3EM 3KLNA 4BJ6C 4AU7A 1IC8A 5EGOA 1R23A 1G6NA 2ELJA 2WBMA 2H1LA 5GADJ 1ZRFA 3QU3A 2R7OA 1A6QA 1Z1DA 4U88A 4UB6C 2JRTA 5JVTA 2XUBA 2L9VA 2COBA 3TL4X 2A6EF 2ZSIB 5K5OA 3ZOBA 2YX4A 3EYYA 4A2UA 4CCKA 1MMSA 3ZCOA 3IAS2 3F8FA 3H92A 3OR1C 2BBYA 1E3PA 2AQEA 2PMUA 4XLAA 2V1UA 3FMRA 2EPFA 2K9LA 2R0QC 3EUKL 1W36C 4E7ZA 1VF9A 2M2EA 3S1RJ 1X4OA 3VFZA 1X1BA 1R58A 3C1DA 1JXSA 1IJWC 3CJTB 1RRJA 3G1LA 2KDZA 4OIOF 2QQ9A 3GO5A 3ZMVA 2O5RA 2HKXA 4CCMA 2LRDA 5ED4A 1B4AA 3L00A 3H36A 1P2FA 2E5ZA 4XSXF 4XQFA 3S2WA 4BQOA 3AG1H 5DEQA 3Q3SA 1XPXA 4BY7J 2O3FA 2QKMB 1UZCA 3K4CA 4KIFA 4HDVA 3M7GA 2M34A 2P7VB 2W25A 2IBDA 3ERED 2UV1A 2BHYA 2PMZN 2H09A 1MJAA 2VASA 4B3AA 2LBFB 1FBQA 1J2XA 4XONA 4JX4A 4BL0B 4IHXA 3E5UA 2F5DA 2H27A 2X6WA 1FBSA 5M3FJ 2PJRA 3CP8A 2W48A 3BZ6A 3L2UA 2P7CB 2BGCA 3DTIA 2BY0A 1JT6A 4EJWA 2F4OB 1XD7A 3TEDA 3FWEA 5C4JJ 2BHZA 2NVQJ 4M74A 4GRIA 2VKEA 2X6YA 2CUFA 4OMZA 2CFOA 1TNSA 3ASNH 2KIQA 1Y6IA 3T1BA 2HU9A 3K9TA 2UXXA 4YFXF 2H1KA 4E70A 5LBQA 4C3IJ 3RQ4A 1MMNA 3KEYA 2L9SA 1ZG3A 2KIUA 1Z7UA 2L9RA 4AIKA 4RLQA 4Y4RA 2O8XA 3ELKA 2FF4A 3BR0A 4XMYA 3V8KA 1FEXA 2QGUA 4A3CJ 3W6JB 3I55I 3L7WA 1D0ZA 2EV6A 2ZKZA 4UVAA 4KIGA 1ZHFA 2ZXHA 3ABUA 2VQHA 1B9MA 4BBRJ 3RKQA 1B8IB 2NYXA 2FOKA 3DLAA 4WWCA 3JRIA 3PM1A 2BW3A 3FXUA 5K7FA 5TRDA 3LA3A 1G8XA 1ZK8A 5F0CA 3J7ZI 2JA6J 2WY7Q 4UHTA 3HRMA 2PMZA 2L5QA 4LFUA 3D0SA 2KDOA 1Y8RB 3M8EA 1H89C 4JP0A 4CHUA 3SDGA 1R1UA 1R5HA 4GCVA 1JI8A 3L2WA 2W1OA 5JHFA 1QZZA 1GT0C 5F0HA 1U9OA 2C6YA 2ZJRF 3PNYA 1XX5A 3L2QA 1J7KA 1YX3A 4LG0B 1HW1A 4LOCA 3DKWA 4PSWA 5HNFA 1P4AA 3J80K 2PQ8A 4G6TB 3FM5A 2D5VA 4M3EA 1ETYA 3I4PA 1XC5A 3IC7A 1O3QA 2LBFA 3NRVA 3OYFA 4QLCU 2IW5A 1IXCA 3MFKA 4CDGA 1ZR2A 4NC7A 4FE4A 4JQFA 1WHUA 2AXLA 1WQ2A 5GAEJ 3FIWA 3PFIA 3E0JB 2NS8A 2NNNA 5D6EA 2XGXA 3TDZC 4PJLA 3ZN0A 3S14J 3HIFA 2VODA 3QPHA 2VIXA 4FTHA 1AWCA 1FSEA 1ON1A 3FMSA 1ULYA 5M3MJ 3RKYA 3OIQA 1FBUA 3OV8A 3MWMA 2XB5A 4MFDA 1STZA 5E3MA 3FKJA 4CZCA 4D7MA 5BPDA 2XAJA 4UUVA 2DAOA 3E6DA 4UXNA 4UVBA 2CWEA 2B0LA 4OIPF 1O7LA 2RNGA 3DPTA 4ZYGA 1W4MA 3Q9SA 4CH7A 5KNLA 2KPMA 3H9GA 3FXRA 3D5LA 3W2WA 4E7LA 3DP7A 3W6KB 2M0MA 2X48A 1JUSA 1TW2A 2VBWA 1IUFA 4BE0A 4EATA 2JUCA 4ZTJA 5HLIA 4KUMA 5HS9A 4C2TA 2FXAA 2BVLA 4LK0F 4Z2YA 1H0MA 1B6AA 4EV0A 4DJAA 3F8BA 3L2VA 1QZEA 1OLTA 2DA7A 4XN0A 3PJRA 3DPLC 2G0EA 2OA4A 1W36D 2GZWA 5CVUA 5ILSA 2XRNA 1U9NA 2EINH 2XSJC 4KJZA 2IS6A 4BDYA 3RDIA 3LSPA 2E36A 1N78A 1VQ4I 3KZYA 2PFBA 2L4AA 3HUGA 5DM7F 5FKOA 1IRFA 3LAJA 2N8GA 2CV2A 4JYKA 1FY7A 5J1YA 2Y30A 1NHAA 3NEUA 3VEPA 2DJNA 1XDSA 4L9JA 1NTCA 4TV7A 1VI0A 2K40A 4FISA 1UB9A 2JA8J 4ENJA 3ERMA 1F4KA 4BS9A 4M6VA 3OYKA 3IH3A 4ZZLA 1LFPA 4I01A 4HAMA 3LSMA 2ID3A 2HVSA 5HOOA 1XCBA 1LKXA 2DA2A 3IV5A 1XCVA 1G2HA 2VONA 1SANA 2DFFA 2MC3A 4D5CA 4YFKF 2JQ7A 1I39A 3F6OA 2DTZA 2FNPA 2PLYA 3WODF 1QBJA 3E6MA 4IOAF 1A04A 2L7FP 4LGWA 3K4BA 2UZKA 2QWWA 1Z05A 2Y2ZA 3MVPA 4A69C 4HQEA 3ZMDA 1BI1A 4J19A 4OINF 4BXUA 3VPRA 3COAC 1U6GA 2OQRA 5F1RA 4E7IA 1IO2A 2EZHA 2HWVA 2ZXJA 3OL4A 1YJWI 4ABZA 3SFZA 4ENNA 1I1GA 2HXIA 1JTYA 5IY5H 3BG3A 1KU9A 2DA6A 2ECCA 1TNTA 2NXNB 5HDKA 2LDUA 3LQRA 3L2CA 1JT0A 4ASNA 1RIOH 5HS7A 2Q2EA 3FHNA 2CJJA 3ZQHA 4A6EA 4AUXA 3GZ6A 1JHFA 5CVJA 2OC6A 3EPZA 5FGMA 3KP3A 4P96A 2YX7A 1WCMJ 3CF2A 1BL0A 3KCCA 3QYFA 3BTCA 4RDUA 4BYYA 2Y31A 5M5YJ 5L3FA 1SMYF 5LRRA 3AAFA 5CPRB 1E0EA 1WVRA 2F4MB 3GZ5A 1HQCA 2DYRH 3GF2A 1KU7A 5JI6A 3E1SA 3UR3C 1SFUA 4KT5C 1LDJA 1R5GA 5FB2A 3VYUB 4ZZDA 2W4SA 4QIWN 3MMYB 2GQQA 2HZDA 3K4KA 3OR2C 2HEOA 3QAHA 2JK3A 4ZYDA 3CD6I 4HW0A 3ZMTA 4OWRB 1XGSA 4Q5SF 1OQYA 4A3JJ 5DYMA 3CUQB 3CC7I 5JLWA 3BWGA 3H1CA 2VC0A 2XVCA 3GTOJ 3PFYA 2JA5J 4MLOA 4XBFA 5LHHA 3T8RA 3OS1A 4UUTA 4DW6A 1FTZA 3RPUD 3CCVI 2YU3A 2OPTA 3SZGA 2HQ5A 2X6OA 1QVTA 3DBHB 2V1DA 1PVEA 4C9YA 3H0GJ 2EJRA 2LKSA 3ZP5A 1HKTA 4KISA 1Z0XA 1TT0A 2VPLA 2R7TA 1BOBA 2ISZA 2DA4A 2E2JJ 3S1QJ 2LF8A 4HNUA 1MBGA 1RPWA 1SAUA 4PGGA 2HOAA 4JK1X 4IHVA 2Z1DA 3JRFA 4IQJA 2GXGA 3CCQI 4B43A 1MNEA 2VOOA 3G1MA 4M9ZA 4GYGA 3S2DJ 2R7SA 1V3FA 1HKQA 1O3TA 4RM3A 2MD0A 4BQAA 2VI6A 2L54A 2Z16A 2W24A 3ABLH 2QM3A 2Z99A 4BJ5C 2QUFA 1G3SA 1R7JA 3SFIA 5FRMA 2CQNA 2IPQX 3DQVC 4MTEA 5J3LA 4HV6A 2K3PA 1FIPA 3CUOA 3M07A 3M9AA 4XKWA 4JOMA 2R4GA 5IYDJ 1EH7A 3TKYA 4NBQA 1K79A 3GXOA 1B1BA 1P7JA 3WU0A 3OYIA 1X3UA 2XDVA 3I59A 1SEUA 3GFLA 3K0LA 1TC3C 5B5EC 2EH3A 3P5JA 4IPAA 2HI3A 4DQ2A 4EEFG 3A2KA 3AG3H 1USSA 4I09A 2HDCA 3QOEA 3ZQ7A 2X6XA 2JWTA 2M8EA 1WGXA 4R8HA 1ODDA 1RZ4A 2RNJA 2GA2A 1LE8A 2MD5A 1S3JA 3E7LA 1D8JA 2CG4A 1X4PA 2DMQA 3C3WA 5EG0A 5IOYA 3VODA 2CV1A 5EDNA 1TL8A 2MG4A 3CUQA 3K1PA 5DD8A 5KHDA 4E7SA 1S72I 5IP9J 4LB5A 3GYHX 3GWZA 1FP1D 5DM6F 4RB1A 2CUEA 5DV5A 1YYVA 1YI2I 2DMUA 4CO8A 3WTVC 3GLLA 1MMDA 1Z77A 3IWFA 5LGNA 4KDPA 2LY2A 4ZH4F 2K9SA 5D4RA 5F1JA 4YG2F 3P9IA 2BXZA 1FNNA 2JN6A 4D0PA 4RAFA 1UHWA 3GCMA 1LB2A 1O3RA 4IRGA 3V7CA 4L0YB 1X1CA 3CUQC 1P4XA 2I5UA 5IYBJ 4W97A 3KZIC 2P5KA 1R6RA 2QZ8A 1IUYA 2D1VA 3K4MA 1IDYA 2MC4A 3IKVA 2IGOA 2Q8KA 5HDNA 1BBYA 4IHWA 3JSOA 3O6BB 2L7ZA 3S16J 2FBHA 2M0CA 3DBRB 1UJ8A 1GLNA 3V7SA 3BOQA 4PCQA 3HG9A 3PNTA 1TBXA 2R7UA 3AG2H 4MEYF 1T6SA 4XM3A 4ESJA 3S1MJ 1Z6TA 3FM3A 2GBYA 2HQAA 4XRFA 2VT3A 4Y3OA 4N4NB 2HYJA 4EGYA 1LEBA 1X19A 4IL6C 2IS2A 3KYDB 2MSYA 3CLOA 2KP6A 4XL9A 1AKHA 1WJDA 1A36A 3PL8A 3FBIB 2V9PA 2GIZA 2VXZA 3U9GA 3FHZA 1QZYA 4U0YA 1P4WA 4V19K 2P8TA 2QEXI 4P1WA 3O3KA 1EKEA 4RGXA 2W7NA 4PSXA 4ENMA 5C4XJ 4B1RA 4WXDA 3DEEA 1Z9CA 4S04A 3RZOJ 2DU9A 2J5OA 4CZZA 1QRYA 2EA2A 3LSTA 4PZJA 1D0XA 3A03A 4OOIA 4KNYA 1ETKA 1YW8A 2DYSH 5ILUA 2GXAA 3L9FA 1VQLI 3GTKJ 3BCBA 3LFKA 4AVZA 1PDNC 2GM4A 4N9IA 4HF2A 2WAFA 1S7OA 3H9QA 1PJRA 1BC8C 2WAQN 1KYWA 3K1MA 3S3NA 4F91B 1B72B 1MBKA 2CYYA 2M7BA 1QO0D 4Q48A 3HGGA 1Y1VJ 2A3SA 3T0YA 4MQVA 1W0UA 1QNTA 2P0WA 4A0XA 3AL0B 3DEUA 3KIOA 3W2AA 4F92B 4I7HA 4PK4A 1I3AA 1XGMA 4OAYA 3G2BA 1K4TA 4XK4A 1IF1A 4I0AA 4YEJA 1KYZA 2FX0A 3DXJF 3OSFA 3ISPA 3OWTA 5EZGA 4DBQA 3JREA 1LFUP 3K1NA 3HOWJ 4E7JA 3LSRA 2VBZA 2DT6A 4V2GA 4U7DA 3EDPA 2DODA 1VQOI 3HYIA 5K7HA 2LYCA 3I54A 3K4NA 1HCRA 2R92J 2WB1N 4GGGA 3SXYA 3GTPJ 4EVIA 2QF7A 3HBLA 2M87A 1SD6A 4WF2A 3K2AA 1ZKGA 4I76A 2HOEA 1BR2A 2ECBA 4A3EJ 2ZFWA 3HSRA 4XKBA 1I6HJ 2OTLI 4DYQA 4XKCA 2IVMA 4M6YA 2XPWA 4Y7NJ 1FYLA 1HF0A 3CJRB 3O8GA 1O4XA 3RIRA 2EWNA 1T8IA 3K6GA 2ICWG 1IXSB 5IP7J 5AIQA 1BN5A 4CYCB 1R00A 4YIRX 2P6SA 5FRNA 2DT5A 2HNHA 1YOVB 3JAMZ 1ENHA 4PGHA 2F6CA 4NDLA 3OY9A 2DXIA 1QPIA 2WA0A 3EQLF 1Y1WJ 2EQRA 4IF4A 3ESWB 1I1SA 2IA2A 1XGNA 4CGZA 5D5XB 4XLCA 2NS0A 2DFHA 4WXHA 5KK1A 4O6JA 2XAQA 5F64A 2CFXA 1GVDA 1A31A 2F2EA 3LA2A 4ON0A 4XNFA 3L09A 3H5RA 5HDGA 4A0ZA 3SYTA 4Y13A 3H3ZA 3SZPA 2HYGD 4C3JJ 3HOVJ 4MIMA 4RGSA 2KL4A 2JRMA 1BM9A 5CQGA 2IRFG 2JMWA 3S2HJ 1U5TB 5D5VB 4DIQA 3F8MA 1D1AA 4UNOA 1YE9A 2WB1A 5DUKA 2RREA 2YU9J 1BOAA 1LQ1A 1KA8A 4B44A 1DP3A 4JX5A 2OV7A 1T39A 1XB4A 3KFWX 1GDTA 2GIVA 2DN0A 1LEAA 2V1XA 4EJVA 4MQ9F 3I64A 5F0FA 1W7PD 2ME0A 3AL0C 5DCMB 4NHJA 1IAWA 5J47A 4II2A 3BG5A 4A5MA 2QA4I 1LVKA 1NG7A 2EV5A 4BY1J 2KRFA 1BC7C 3VYRB 3BLYA 3WG7H 3HC7A 5A2QK 4M72A 4B47A 2A05A 2NOGA 1RR8C 2V6CA 2CQ7A 2VJ5A 2VB6A 2EK5A 1K6OA 3UNGC 3ZQQA 2RVCA 4HZFA 4LIUA 1RR7A 2FBIA 1KZHA 4NB5A 4J00A 4D9JA 2A6TA 2CW8A 3JRHA 2R7VA 1RUOA 3HKZA 5FFXA 3G73A 1S9HA 4I2OA 3WE3A 1SD5A 2R5YB 1FSHA 5BPIA 3DF8A 2WV0A 2EFPA 2RAEA 1WJFA 3OYLA 1DPUA 1FLIA 3SJMA 1QA6A 2R7QA 2ZJ2A 1OPCA 2KIFA 3HPHA 5FD5A 4YFNF 1FOKA 2QYOA 1IN8A 1IV8A 3HRSA 3MZYA 1T0FC 2BE5F 4U0WA 3WU2C 2GWRA 5LEJA 3VB2A 3KP2A 2LG4A 2CQQA 1ERDA 1HA8A 2XAHA 2KKOA 1JJ8C 4HPQA 4CCOA 2EFNA 4A5NA 4AVPA 2NVUB 3F8NA 4G7ZF 4N0BA 5J8CA 1M1EB 1T95A 1J9IA 2R7WA 3P9CA 5EYRA 3H3VK 2O0YA 2IGNA 3I4MJ 3DEWA 2CUJA 3I56I 2A5WA 2WV1A 3CCMI 3JRGA 1JUMA 3TOAA 2F5FA 4J01A 4RLFA 5LD2C 2DK5A 1XS9A 1MH4A 2OCEA 1HBXG 2QENA 4Q4ZF 3FF5A 3HTUA 3Q9VA 4NQWB 2L2OA 1PUEE 3CMYA 1MDMB 4BHBA 2CRGA 4P55A 3BDDA 1Z21A 2NVYJ 1UCRA 2RQQA 3JTGA 5H20A 3LSJA 5LEKA 5HLGA 1KGSA 4F55A 1U5TC 2PN6A 2E2IJ 2MH2A 2QVOA 2DDBA 2EZLA 4KIBA 3J7YJ 4IX7A 3OYBA 3ZRGA 3F8CA 4AC0A 4IO9F 1N75A 2RDPA 1TQIA 2HYFA 5L3CA 3R61A 3KP7A 3FK7A 1VNDA 1JKPC 1DU0A 2E1MB 4C30A 2K4BA 2QQBA 4IZZA 3CDHA 3G4SI 1J0RA 2FA5A 1SFEA 2GXBA 1K83J 2MBFA 2KHMA 3BC8A 4B3XA 4N9HA 3EUHC 1U0JA 5JR3A 5ILVA 2XPVA 2XIGA 1D1CA 5HLTA 2IT0A 1REPC 2KRCA 3RKXA 2K9QA 2E19A 2TCTA 4R1HA 2E35A 4KITB 5LRSA 4PFPA 3BR6A 2IGMA 5FLMJ 3EUAA 5K5QA 1B8IA 2EZIA 1IDZA 3IUOA 1A35A 4GDFA 1ZTRA 5E8IA 4WCGA 2V1NA 1IN6A 2JA2A 2K4JA 2EIMH 2OUMA 2CO5A 4AYBN 1IN7A 4ZJZA 3BPVA 3C2HA 1APLC 1OKRA 1WH7A 4FASD 1KONA 2LSOA 3JCUC 4LITA 5AONA 1ZG1A 2K9NA 3RKWA 4D5FA 4R79A 3LA7A 2ELHA 4I02A 2OAZA 3GTJJ 1BR4A 2F5EA 3K7AJ 3S15J 2Y9ZA 1W5TA 4RB0A 2E1NA 3CMMA 4BU2A 5J4YA 1Z3XA 4GYIA 1P6RA 1QVUA 3RSNA 4X1EA 3B02A 4NQWA 3HOSA 1MBEA 3HRUA 3I53A 4I99C 2LY1A 1YS6A 1OFCX 4LG0A 4RB3C 2R7RA 1EA3A 1DQUA 1DP7P 4XRSG 1YLFA 3A4CA 2DOEA 1FPQA 2JT1A 1H9GA 4ITVA 4PUSA 5C3EJ 2HQNA 3J7AO 2BXYA 2QQ8A 1R71A 2ZO4A 3M8JA 1JKQC 2IGKA 2IP2A 2JVGA 2ZXIA 4FT8A 5LGUA 1K7AA 1HW5A 3EETA 4LD5A 3KYCB 5FKMA 1ZYRF 5IYCJ 2MA3A 1SD4A 3K4LA 2FEZA 1OCZH 4XLHA 3HB9A 3H0DA 1XSVA 4EMSA 5FLXK 4RAGA 3CCUI 4HRIA 3MZ8A 2Z2SB 5E8GA 3FKIJ 3IHUA 3I58A 3S8PA 4ZC3A 4QSHA 5H2FC 3Q0WA 4PJJA 2Z33A 1DGRM 4BUPA 5TISC 1HDPA 2RQPA 4L9NA 5FKKA 4AYBA 2KZVA 3FXKA 1BW6A 4PFOA 3WU1B 4IHSA 4F7ZA 1BI0A 1AU7A 3ZMSA 1J5YA 2VOPA 1MJ9A 2EFQA 4N4OB 3SDBA 4LLLA 5L3DA 3TO7A 1VQ7I 2E1MC 5IT9Z 1ETVA 3I5UA 5B66C 3Q5FA 2E60A 3J81Z 1HXDA 3G1OA 4BJTA 1ITYA 2XSDC 1Q1HA 2HXOA 1ZLJA 3FXQA 1UHSA 3OYAA 2V9KA 1ZN2A 3IRRA 3TW7A 4XIDA 1TWAJ 4BHPA 1XGOA 1EJ9A 4HF0A 4HLXA 3RPQA 4BE1A 3B73A 4GO1A 4QPOA 2XHKA 4ZDLA 4CCNA 1RC9A 2Y75A 4BXFA 4IRHA 1V5GA 2LH9A 1NH3A 4GFBA 1P7IA 2LC2A 3FDYA 3M1CA 1OYYA 1ACIA 3DV8A 2VPRA 4HSTA 1DDNA 1A6IA 1G3WA 2A6HF 1DGWY 2JTVA 2ETHA 3F9KA 1IW7F 3R60A 2VJ4A 4YIIA 1ZR4A 1HW2A 1LVAA 2TDXA 2FSWA 1O7FA 1WZ2A 3T8TA 2VUMJ 2JA7J 4KN4X 2TRTA 2E1OA 4CA0A 2UWMA 4S0HB 4Y17A 5E79C 1R4MB 1WH5A 3HZJA 1ZGWA 3CC4I 2FU4A 3S17J 3RCOA 2BZTA 2HKOA 2Y0SN 2X1EA 2WC2A 2L01A 3I9V2 3F21A 2ZJPF 2X1DA 2O61A 3F3XA 4L0ZB 4FX0A 1W7PB 3BTJA 3ZQLA 1ZQ3P 4O3MA 1YRNB 3KYLA 3FMQA 1XN7A 3I71A 3MKLA 2XGCA 2HDWA 1U2WA 3S93A 4L9VA 1RESA 2MYSA 4YIFA 4BEHB 4UY8I 1LPQA 1U8BA 1IRZA 2Q0OA 3LSKA 4HOBA 3ULQB 2HTJA 3BZKA 2UUZA 3E97A 5ICCA 5E3LA 2HOTA 3HOYJ 4XOPA 2L3DA 5H6QA 4PJNA 4LLNA 4A93J 4G7HF 1WJEA 4M73A 2KQRA 4C2MJ 4NC6A 1RUNA 2VQGA 2O6GE 1KQ9A 3H3UA 3TO9A 3F72A 3E5QA 3U21A 2D2WA 3GEZA 3B6CA 2HPIA 1E17A 1XG1A 2HS5A 5E1ZB 2L9NA 4E6KG 3HOZJ 4BH9A 2D1HA 2XF6A 1L3LA 4MTDA 5HVQC 2L4MA 4XICA 1OYIA 1MMAA 1OCCH 4RMNA 2H8RA 2XGDA 3JSPA 1HKSA 3JRDA 2Y0SA 4DYRA 3VYTB 2ZCWA 3CO7C 2CMPA 3LSGA 2BV6A 4HQMA 1TQMA 4B09A 1GV5A 1V4RA 2FNAA 2FOWA 2FJ1A 2FMLA 2HZTA 1YIOA 1YW7A 2GOMA 3BQZA 3NAUA 4DOZA 4BE2A 3K10A 2W82A 4LK1F 1PUFB 5EJCA 2HPMA 2CH0A 4G7OF 3DBLB 1GVJA 5LHIA 2X1CA 4WK8F 2B9SA 2EIKH 2JPBA 3ZQIA 5KVRA 3H35A 2COMA 3R0JA 4YELA 2PEXA 1W5CC 2K02A 2W84A 1ORKA 2XAUA 1R36A 3BJAA 4BQNA 2JZYA 5BS6A 4P9UA 2JSPA 2E71A 5DS9A 2P4WA 1QHHD 3JW4A 4M6XA 2W85A 1X1DA 4KMUX 3BJ6A 4ENKA 1K78B 5F6FA 1SFOJ 1YS7A 2R3SA 3PIOF 5ICFA 2VE8A 2XV4S 3K2ZA 3OS0A 3ZQCA 5FD6A 2E34A 2NNYA 1J75A 3M4OJ 4HNTA 3FXMA 2YR2A 4G8XA 1WPKA 4UUSB 3D5SC 3BCAA 2RC4A 4H0EA 4IOCF 1XDUA 2ZBKA 3HSFA 2QQAA 4CUGA 2CGPA 5J6XA 2A07F 3QU6A 2ZMEB 2GAUA 1FIAA 5FROA 2STWA 5EZHA 1BI3A 2V7FA 5LHGA 2CSOA 5L3GA 3KETA 2OF7A 5EEHA 3X2QH 4CXFA 2MW8A 1GV2A 2KT0A 3WTXC 3OYEA 2R5ZB 2M9HA 1QQIA 2NVXJ 4KFCA 1W5SA 2RKHA 2ZNZA 5FJ8J 4DZPA 1MBHA 3L1PA 4Z6YA 2OZ6A 2PBIA 1G3TA 1MBJA 5J40A 2V26A 1P9QC 1EV7A 2F5CA 2LNBA 1MSFC 2MABA 1ETQA 2A61A 3Q0VA 1ETOA 3QYEA 1YJ9I 1YJNI 4XLNF 3EYIA 2VN2A 3FISA 2NAZA 3CC2I 1I3QJ 2EB7A 1Y39A 3QPSA 1QU3A 1CF7B 3IL2A 1PP7U 2ELKA 5GPCA 1EF4A 4HNVA 4ANJA 2L7KA 2WTEA 2LD5A 4HA8A 2VXDA 2KFDA 2EV0A 3DPUA 3K70D 4FX4A 1YIJI 1Y0NA 2VBYA 4F52A 3OYNA 2IS1A 1MBFA 2JPCA 2B63J 1Y56A 1KQ8A 1YTYA 2M1BA 1FMVA 3DTEA 3RQIA 2JVHA 4OAZA 4U0VA 1SC7A 3WTUC 2DA3A 1FTTA 2FUG2 4FCYA 4I98B 2H6CA 2DPUA 4B4CA 2V9VA 5FKNA 5EGOB 4HDUA 1V5EA 4IKFA 4X0GA 1IV6A 4E7HA 3A02A 4UUSA 1J59A 4A3GJ 6PAXA 5D5WB 4FQGA 1P92A 3HSEA 3A01B 3A1YA 1OR7A 3BJOA 3FXOA 2I8DA 5FLVA 2QBYB 3HHGA 4DGWB 3F0CA 2M30A 1QPMA 4F3QA 5BMZA 2HDDA 2A5YB 5DDGA 2CS3A 3WHBA 3DKYA 4BACA 4HX8A 1MSEC 1TTYA 1UG2A 2XPUA 1R1TA 5KAFC 2R5ZA 3U2RA 3V42A 3M8FA 1Y0UA 2H8WA 2VL8A 1D5VA 3W6VA 2HGCA 1FOYA 3LMMA 4HSRA 4RGRA 1BW5A 1MD0A 4AWXB 2R7XA 1OR7C 1T56A 3HTSB 1B59A 2ZMEC 5HNHA 4F93B 4KA4A 1QHGA 1FYMA 2XKPA 3J7AY 3S3MA 1MKMA 2P6TA 1CF7A 3OSGA 2EZKA 2LKXA 5FFZA 1LFBA 1IN4A 2M4GA 3E3VA 1WFXA 1CGPA 3KX2A 1ZGAA 2PJRB 4RBOA 1KU3A 2LFBA 5J1RA 4A6DA 3BG9A 2DPDA 5K5RA 3KE2A 2ZNYA 1F1ZA 3VSLA 4BAYA 2K3FA 3ZR8X 5BNGA 1JHHA 2LVSA 4C3HJ 2NRAC 2MH9A 3ZQFA 4XRMA 1B72A 3ECHA 2VE9A 3IRQA 4FETA 1OCOH 3HKZN 3DU5A 4GXOA 3IWZA 1UELB 4EM1A 3W2VA 1X1PA 2EIJH 2F4IA 3GUDA 1TLHB 1ETWA 4L5JA 4IHTA 3V8LA 4G12A 2DQRA 2XGEA 3PO3J 3GTQJ 2BEOA 1YITI 3ML6A 1VZ0A 3KPHA 4U87A 1E2XA 3QP5A 1AHDP 1JKRC 3ASOH 1S8NA 3WGIA 2ID6A 2ZXWH 2HFHA 2ME6A 3LSHA 4G9YA 1F5TA 2KMUA 3A01A 3RYPA 2MLGA 5K7ZA 1W1WE 3NWTA 5GTHC 2BW3B 2PG4A 4CICA 1HDDC 2QBYA 1H88C 1E3HA 4ZYHA 1WJAA 3KEOA 2XB0X 2L7MP 3BG6A 3PNVA 3DTKA 3OYCA 3PQKA 3ZN1A 2M5WA 3O8HA 5GTIC 3OIOA 5F27A 1UAAA 4XOTA 4RAYA 4M3BA 4E7KA 2V6EA 4A12A 1TW3A 4L9TA 2ZFUA 1JKOC 2E1CA 4AM3A 1NG6A 3B6AA 1XMAA 2O03A 1K4SA 2AXTC 3JRCA 1T0FA 4A3KJ 2STTA 4EGZA 1XMKA 2WY8Q 2DOFA 5L3BA 3MD2A 1MH3A 3ZPLA 1ETXA 1MNMC 1RNLA 4CYDA 4RA2A 4CYCA 3A0HC 2D45A 2O9LA 5ICEA 3CJNA 1FC3A 4ZYEA 5AIPA 3BY6A 1MIJA 3ECOA 5H6RA 1HLVA 1FP2A 2CQKA 1WRJA 2E7WA 1WKMA 4QPQA 4WXCA 2E2HJ 1IRXA 2DDAA 4RS8A 3HOUJ 2EFOA 5D6FA 3QQAA 3CF5F 4JBAA 1ZGJA 2V4JC 5EEAA 3AKZA 2DO7A 1W0TA 4A0YA 1G3YA 3FXLA 2K86A 3OYMA 1EH6A 5CQEA 2K5CA 2WADA 2LMDA 1K61A 9ANTA 3CJQB 4E4HA 3GX4X 1F43A 2MFZA 2CW7A 4LB6B 3BR3A 5E20A 4U7BA 4DNCA 2BYVE 2XRLA 1U5TA 3RPUA 3CQZJ 4A3LJ 1VQNI 2H6BA 4OU0A 3I0TA 3ONQA 1FOXA 4M71A 3ZGKA 5DCFA 4BBSJ 4KMFA 4BHCA 4EJUA 4YRVA 2DBBA 1I5ZA 2IAIA 2Y69H 1XSXA 5IT3A 3CZ6A 3I4NJ 5BOXA 1JJ6C 3HL2A 1ZG5A 1V54H 1WJCA 2DW4A 4L5EA 5DCMA 4P9FA 3K69A 5C44J 4FHTA 2IA1A 4K2EA 2YPRA 4LLGF 1L0OC 3NARA 1TZLA 3PIPF 2ADUA 3OOUA 3V4GA 3WTSC 3EUHA 1B9NA 2FBKA 4Y52J 1V5FA 5DTDA 3PO2J 2QSHX 4CCJA 3UKGA 3PSIA 1OISA 1S29A 2LF7A 3LAPA 1JE8A 1AA7A 1HSJA 1POGA 5L3EA 3HUGB 3C2BA 4DYCA 1TWHJ 3G3ZA 2WWYA 1VQ9I 1V55H 2R5YA 1C0WA 1H9TA 2PI0A 3I3LA 5CVVA 1YO5C 2QCOA 2HVQA 1ON2A 5M5WJ 3WTZA 4LG3A 3CMEI 4I6ZA 2VJIA 3DKXA 2LLKA 2AHQA 4MEXF 1U8RA 4XLFA 5M5XJ 4OIRF 4HV5A 1F36A 1E3OC 2IA0A 3GTGJ 2VKHA 1QGPA 2ESHA 2K7LA 3OIPA 2LOOA 2VQLA 2DCEA 2AO9A 3HGYA 3PSFA 3QWLA 3GFIA 5B1BH 1UFMA 1X1AA 3BTIA 1RKWA 2NS7A 2VBXA 4P5OA 4G6DA 1OYWA 2FE3A 2M8GX 1MGTA 1Z3YA 4MNUA 3LL7A 5E1XA 2K27A 3TDUC 1IG7A 4H4KC 3E6CC 1BR1A 4L18B 2DMTA 1YFHA 3ABKH 1R5ID 1FYKA 1IN5A 4A3MJ 4ZTFA 1FOWA 3P7NA 3M3YJ 2VJJA 5CLSA 4XORA 2QSGX 4HEA2 5D8KB 1R49A 2E5NA 2Q2EB 2R7DA 3WGHA 3MN2A 4D7NA 3F22A 1MDMA 5GAGJ 5J8FA 5E3NA 2DMPA 1ZARA 3NWSA 3AG4H 1BJAA 4G6QA 1EH8A 3KLOA 5DUIA 2O8KA 2O7OA 3FZVA 2OBPA 1NK2P 1Q1VA 3DCFA 4C2UA 2OJED 4PDKA 3JRBA 4A3BJ 2Y48A 3PUFA 5EF6A 1YW9A 3MAJA 2XROA 2H94A 2FMYA 1LDDA 2XASA 2L0KA 4UVCA 5E1WA 4LIVA 3IKTA 1U78A 1WI9A 1IZ1A 3O2PE 3HJEA 4EQQA 1LJ9A 1LUJB 2K85A 4UB8C 5HLHA 4WX9A 3MKZA 1FZPB 4XLEA 3V8JA 2UXNA 1OCPA 5KCMA 2MLKA 3LFUA 1HOMA 3CLQA 2DJIA 4KYWA 3S32A 3BZCA 4ESBA 2OZUA 3MEXA 4LJZF 2V79A 1VQKI 2YUSA 3CCJI 3A0BC 1Z6RA 4CCLA 3HEFA 2FD5A 4IJAA 1BJZA 3G71I 4IHYA 2JJ7A 2YSRA 2LKPA 1AOYA 2X0LA 2DLLA 2A68F 1BIAA 1FWZA 2GLOA 2L02A 2CU7A 4ESFA 1WSUA 1NK3P 1RKTA 2CUZA 1BI2A 4HG2A 1G59A 1FT9A 2NVTJ 2ZSHB 4NNJA 3IP4B 1SFXA 1F9NA 3GTMJ 1HSTA 3CTAA 4XKVA 1HC8A 1ZLKA 3W3CA 4HBLA 4HX7A 4UV9A 3T5XA 1O3SA 5TGTA 3PUBA 3BR5A 1Z91A 2QSFX 4ETSA 4KT6A 5LLQA 3JAMK 4IVNA 1SVLA 3DWLE 5JFRA 2HR3A 4V2FA 1T98A 2ZC2A 1S6LA 2A69F 1SD7A 3HXLA 5ERIA 3KZZA 2JSCA 1RETA 4M3DA 1WJ5A 3FX3A 2GA1A 3PQJA 5JHUA 5IPAA 2X4HA 1TWGJ 3I59B 1SFKA 3K70C 1TWCJ 4IXAA 3WE2A 3VSKA 1R4NB 3BG7A 1D1BA 2IXSA 2OU2A 3ABMH 2G7UA 3QODA 3VYSB 1H8AC 2IJLA 1ONVA 2Z5UA 1I6XA 2MGQA 1ZELA 3GTLJ 3MQ0A 1LE8B 2KRHA 3TP3A 2XKOA 3R0AA 5D8LB 3HHHA 5EG0B 5CYVA 4KN7X 5BQTA 4A3DJ 2DTRA 1T33A 2DQLA 4KICA 5CVIA 3TGNA 4I0BA 3L2RA 1VQ5I 4RAZA 3SZTA 3DLLF 2HOSA 3KP5A 2KJBA 3WTWC 3N97A 2G7HA 1WWXA 4EJTA 5D5UB 4EM0B 1D8KA 2JUGA 1X2NA 1VQ8I 4M9XA 4AIJA 4B8XA 3CCYA 3E5XA 3TO6A 4HX4A 1MW7A 5HS8A 3QP6A 2KZGA 4OMYA 3CMAI 2AS5F 5IP6A 4X6AJ 3WHCA 2DA1A 3RTRA 1JTXA 3AFHA 3MCZA 2RGVA 1S5LC 5A2QZ 2DFIA 1TWFJ 1VFCA 3SHFA 4EJOA 1DU6A 5GAHJ 2P5LC 2EA4A 2EILH 2B7EA 3WGGA 5IOZA 2R93J 2X51A 5CJ9A 2VLAA 2G9WA 2QKLB 5GPAA 3SEZA 2Z9OA 2GOXB 5D4SA 4XLPF 1TP4A 4CSWA 4FE7A 3IH2A 2PX9A 1LDKB 2ZB9A 1D0YA 3OYHA 3MZHA 5B1AH 1MMGA 3KP4A 1KQ0A 2QLZA 4II3A 5KAIC 2ACJA 4HYEA 3CCSI 3LQQA 1D5YA 4LMYA 2F48A 2EFWA 2XF5A 4B48A 2EBIA 1AKHB 4HF1A 3N05A 4DZJA 2LY9A 2VC1A 3CESA 1VQ6I 2X85A 1YG2A 3E6BA 1UHMA 2E7XA 2XAGA 2M4KA 1BIBA 4RB2C 1VQMI 1YQAA 5FO5A 3H5NA 3TW6A 1GUUA 2ESNA 3H5AA 4UV8A 3BR1A 4S05A 3GBGA 5B3SH 2Y9YA 1UG0A 2CV0A 1IRGA 3WTYC 2CW0F 3VDXA 5E3OA 1W7PA 2DFEA 4MO7A 5JLXA 1N77A 3BTLA 1YRNA 1TT5B 2BY1A 2Q1ZB 3GLXA 2M3AA 1SVOA 1X58A 1OJLA 4BGDA 3G6EI 2ZJQF 4IEJA 2XC7A 1VQPI 2NOJB 2FRHA 4IRIA 3CO6C 4BEHA 3H9JA 3OYJA 1D3YA 3OYDA 1X3WB 2HVRA 2RN7A 3CCRI 2KJCA 4XN3A 3U1KA 1USTA 3LWFA 3LNQA 1ZH5A 5LGTA 3J80Z 3HOXJ 4BNCA 3JR9A 3F23A 2K9MA 3NQOA 3S1NJ 3GFJA 5F08A 5HODA 3CCLI 2DI3A 3MKYB 4Y15A 3QPLA 4O5VA 3WG9A 3BQYA 3DFGA 4ZDOA 2DMNA 1ZREA 5ICGA 4Q47A 3OOPA 4MFEA 3TMOA 1I27A 2X9DA 1R1VA 4ZDPA 3RI4A 3ABTA 4MHGA 1ZRCA 2KIMA 1T38A 1XMXA 3IAM2 2W00A 3CCEI 5E17F 2OCCH 2M45A 2LTPA 3P9KA 3BP8A 4IQ4A 1GXQA 3RJPA 2R7ZJ 1OMIA 1TQPA 4XRSA 5LFAA 1T2KA 2YS9A 1S7AA 3M1EA 1MZBA 2BY3A 2OTJI 2LR8A 3JRAA 1GHCA 2F5VA 2BY2A 3ZMUA 3QOPA 1PUFA 4ZYAA 5F04A 3CDIA 4NC8A 3MKWB 2W57A 3GVAA 3HRTA 3QPTA 2KLOA 3TQNA 1SAXA 3FK6A 2VQCA 2IEKA 1A5JA 4JX6A 4L5IA 3U1DA 3C2GA 2OQGA 2DT7B 1T08B 3KP6A 2AQFA 2LREA 5CVRA 2Z3YA 5CKTA 1BA5A 4MGRA 2XF7A 1UMQA 3BPXA 3C7JA 4RM2A 1KU2A 2DA5A 4RGUA 3QRFF 4Y33A 3HPGA 3TP0A 3BROA 2VT2A 3TOBA 3C18A 1K78A 3GW2A 1IXRC 1JGGA 1GXPA 3CP2A 3OL3A 1J09A 3Q0UA 4HLYA 1FJLA 1S7EA 2M7AA 3V7RA
chains in the Genus database with same CATH topology
3JTHA 2HQRA 3ROUA 3REOA 5EEGA 2PMHA 5DD4A 3R4KA 1JGSA 5K1YA 1ZAOA 3N4MA 3SQNA 2XAFA 1DPRA 4QWQA 2J5PA 2OD5A 2ZMEA 4M9SA 3R6SA 4AIHA 5E18F 5TJJA 5FLXZ 2RV8A 2FQ3A 3HOTA 4OIQF 1R22A 1FX7A 1PP8F 3GFMA 5IT9K 2DK8A 3J81K 4EM2A 1MJBA 3WTTC 2P5VA 3VOEA 2R7FA 4XSZF 1G4DA 1DUXC 2HTSA 1SMTA 3KEQA 1XSDA 2ISYA 3F6VA 3ZMZA 2PJPA 4AD9A 3RYRA 1O57A 1LNWA 1VTNC 4G94A 1RI7A 1ZRDA 2Y0MA 1U3EM 3KLNA 1R23A 1G6NA 1ZRFA 3QU3A 1Z1DA 4U88A 2JRTA 5JVTA 2XUBA 2A6EF 5K5OA 2YX4A 3EYYA 4A2UA 3F8FA 3H92A 2BBYA 2PMUA 2V1UA 3FMRA 3VFZA 1R58A 3C1DA 1JXSA 4OIOF 2QQ9A 3GO5A 3ZMVA 2HKXA 5ED4A 1B4AA 3L00A 1P2FA 4XSXF 3S2WA 5DEQA 2O3FA 4KIFA 4HDVA 3M7GA 2W25A 2P7VB 3ERED 2H09A 1MJAA 1FBQA 1J2XA 3E5UA 2F5DA 2H27A 1FBSA 3BZ6A 2P7CB 2BGCA 4EJWA 1XD7A 3FWEA 4M74A 4OMZA 1TNSA 3T1BA 3K9TA 2UXXA 4YFXF 4E70A 5LBQA 1ZG3A 2KIUA 1Z7UA 4AIKA 2O8XA 3ELKA 2FF4A 3V8KA 3W6JB 3L7WA 2EV6A 2ZKZA 4UVAA 4KIGA 1ZHFA 3ABUA 1B9MA 2NYXA 2FOKA 4WWCA 3FXUA 5TRDA 3LA3A 4UHTA 3HRMA 4LFUA 3D0SA 3M8EA 4CHUA 1R1UA 1R5HA 4GCVA 1QZZA 2C6YA 1J7KA 4LG0B 1HW1A 3DKWA 1P4AA 3J80K 2PQ8A 3FM5A 3I4PA 3IC7A 1O3QA 3NRVA 4QLCU 2IW5A 1IXCA 3MFKA 4CDGA 4JQFA 2AXLA 1WQ2A 3PFIA 3ZN0A 5D6EA 2NNNA 3TDZC 2XGXA 3HIFA 2VODA 3QPHA 1AWCA 1FSEA 1ON1A 3FMSA 1ULYA 3RKYA 1FBUA 3OV8A 3MWMA 1STZA 5BPDA 2XAJA 4UUVA 2DAOA 4UVBA 3E6DA 4UXNA 2CWEA 2B0LA 4OIPF 1O7LA 3DPTA 4ZYGA 1W4MA 3Q9SA 3FXRA 3D5LA 3DP7A 3W6KB 1TW2A 2VBWA 5HLIA 4KUMA 5HS9A 2FXAA 4LK0F 4Z2YA 1H0MA 1B6AA 4EV0A 3F8BA 3DPLC 2OA4A 2GZWA 5CVUA 5ILSA 2XRNA 3RDIA 3KZYA 2PFBA 2L4AA 3HUGA 1IRFA 3LAJA 1FY7A 1NHAA 3NEUA 3VEPA 1XDSA 4L9JA 4TV7A 1UB9A 4ENJA 1F4KA 4ZZLA 4I01A 4HAMA 5HOOA 1XCBA 1XCVA 2VONA 2MC3A 4YFKF 3F6OA 2FNPA 2PLYA 3WODF 1QBJA 3E6MA 1A04A 4LGWA 2UZKA 2QWWA 1Z05A 4HQEA 3ZMDA 1BI1A 4OINF 4BXUA 3COAC 1U6GA 2OQRA 5F1RA 2HWVA 2ZXJA 3SFZA 4ENNA 1I1GA 1KU9A 1TNTA 5HDKA 2LDUA 3LQRA 3L2CA 4ASNA 1RIOH 5HS7A 2Q2EA 3GZ6A 4A6EA 1JHFA 5CVJA 5FGMA 3KP3A 4P96A 2YX7A 3KCCA 4BYYA 5L3FA 1SMYF 5LRRA 3AAFA 3GZ5A 1HQCA 3GF2A 1KU7A 5JI6A 1SFUA 4KT5C 1LDJA 1R5GA 5FB2A 4ZZDA 2GQQA 2HEOA 3QAHA 4ZYDA 4HW0A 3ZMTA 1XGSA 4Q5SF 5DYMA 3CUQB 3BWGA 2VC0A 2XVCA 4XBFA 5LHHA 3T8RA 2YU3A 2V1DA 2EJRA 3ZP5A 1HKTA 2ISZA 2LF8A 4PGGA 4JK1X 2GXGA 2VOOA 4M9ZA 4GYGA 1V3FA 1HKQA 1O3TA 4BQAA 2L54A 2W24A 2QM3A 2Z99A 2QUFA 1G3SA 1R7JA 2IPQX 3DQVC 4MTEA 4HV6A 3CUOA 3M9AA 1EH7A 3TKYA 1K79A 3GXOA 1B1BA 3WU0A 1X3UA 3I59A 3GFLA 3K0LA 4IPAA 4DQ2A 1USSA 4I09A 2HDCA 3ZQ7A 2M8EA 4R8HA 1ODDA 1RZ4A 2RNJA 2GA2A 2MD5A 1S3JA 1D8JA 2CG4A 3C3WA 3VODA 3CUQA 3K1PA 5DD8A 4LB5A 3GYHX 3GWZA 1FP1D 4RB1A 5DV5A 1YYVA 4CO8A 3WTVC 4KDPA 3IWFA 5LGNA 4ZH4F 5D4RA 4YG2F 3P9IA 1FNNA 4D0PA 1UHWA 1LB2A 1O3RA 4IRGA 3V7CA 4L0YB 3CUQC 1P4XA 2P5KA 2QZ8A 1IUYA 2D1VA 3IKVA 2Q8KA 5HDNA 1BBYA 3JSOA 3O6BB 2FBHA 3V7SA 3BOQA 4PCQA 1TBXA 4MEYF 1T6SA 4ESJA 1Z6TA 3FM3A 4XRFA 2VT3A 4EGYA 1LEBA 3CLOA 2VXZA 3U9GA 3FHZA 1QZYA 4U0YA 1P4WA 2P8TA 3O3KA 4RGXA 4ENMA 4WXDA 1Z9CA 4S04A 2DU9A 2J5OA 4CZZA 4PZJA 2EA2A 3LSTA 4KNYA 4OOIA 1YW8A 5ILUA 3L9FA 3LFKA 1PDNC 4N9IA 4HF2A 1S7OA 1BC8C 3K1MA 1KYWA 2CYYA 1QO0D 4Q48A 2A3SA 3T0YA 4MQVA 1QNTA 4A0XA 3DEUA 4I7HA 1XGMA 1IF1A 4I0AA 1KYZA 3DXJF 3ISPA 3K1NA 2VBZA 4U7DA 3EDPA 3HYIA 3I54A 4GGGA 3SXYA 4EVIA 2M87A 1SD6A 4WF2A 2HOEA 2ZFWA 3HSRA 2IVMA 4M6YA 1FYLA 3RIRA 2EWNA 1IXSB 5AIQA 1BN5A 1R00A 2P6SA 2DT5A 3JAMZ 4PGHA 3EQLF 4IF4A 1I1SA 2IA2A 1XGNA 4CGZA 5D5XB 2NS0A 4WXHA 5KK1A 4O6JA 2XAQA 5F64A 2CFXA 2F2EA 3LA2A 4ON0A 3L09A 5HDGA 4A0ZA 4Y13A 3H3ZA 3SZPA 2HYGD 4RGSA 2IRFG 1BM9A 1U5TB 5D5VB 3F8MA 4UNOA 5DUKA 1BOAA 1LQ1A 1KA8A 1T39A 1XB4A 3KFWX 2GIVA 1LEAA 2V1XA 4EJVA 4MQ9F 3I64A 1W7PD 5DCMB 4NHJA 1IAWA 4A5MA 2EV5A 2KRFA 1BC7C 5A2QK 4M72A 2V6CA 2EK5A 1K6OA 2RVCA 4HZFA 2FBIA 4NB5A 1RUOA 5FFXA 3G73A 4I2OA 3WE3A 1SD5A 1FSHA 5BPIA 3DF8A 2WV0A 2EFPA 1FLIA 1DPUA 2ZJ2A 1OPCA 2KIFA 5FD5A 4YFNF 1FOKA 2QYOA 1IN8A 3HRSA 3MZYA 4U0WA 2BE5F 2GWRA 5LEJA 3VB2A 3KP2A 2XAHA 2KKOA 2EFNA 4A5NA 4AVPA 3F8NA 4G7ZF 4N0BA 5J8CA 1J9IA 3P9CA 2O0YA 3TOAA 2F5FA 2DK5A 1HBXG 2QENA 4Q4ZF 3FF5A 3HTUA 3Q9VA 1PUEE 1MDMB 4BHBA 4P55A 3BDDA 3JTGA 1UCRA 5H20A 5LEKA 5HLGA 1KGSA 1U5TC 2PN6A 2MH2A 2QVOA 4KIBA 3F8CA 2RDPA 1TQIA 2HYFA 5L3CA 3R61A 3KP7A 2K4BA 2QQBA 3CDHA 1J0RA 2FA5A 1SFEA 2GXBA 2MBFA 4N9HA 5JR3A 5ILVA 2XIGA 2IT0A 1REPC 3RKXA 5LRSA 4R1HA 5K5QA 5E8IA 4WCGA 1IN6A 2K4JA 2CO5A 1IN7A 3BPVA 1OKRA 2LSOA 5AONA 1ZG1A 3RKWA 4R79A 3LA7A 2ELHA 4I02A 2OAZA 2F5EA 1W5TA 4RB0A 2E1NA 4GYIA 1P6RA 3B02A 4NQWA 3HOSA 3HRUA 3I53A 1YS6A 4LG0A 4RB3C 1DP7P 1YLFA 1FPQA 2JT1A 1H9GA 2HQNA 3J7AO 2ZO4A 2IP2A 4FT8A 5LGUA 1K7AA 1HW5A 3EETA 4LD5A 1ZYRF 2MA3A 1SD4A 2FEZA 1XSVA 4EMSA 5FLXK 5E8GA 3IHUA 3I58A 2Z33A 2RQPA 4L9NA 3WU1B 4IHSA 4F7ZA 1BI0A 3ZMSA 1J5YA 2VOPA 1MJ9A 2EFQA 4LLLA 5L3DA 3TO7A 5IT9Z 3I5UA 3Q5FA 3J81Z 1HXDA 1Q1HA 1ZLJA 3FXQA 1ZN2A 3IRRA 4BHPA 1XGOA 4HF0A 4HLXA 3RPQA 3B73A 4GO1A 2XHKA 2Y75A 4IRHA 1OYYA 3DV8A 1DDNA 1G3WA 2A6HF 2JTVA 2ETHA 3R60A 1IW7F 4YIIA 1HW2A 1LVAA 2TDXA 2FSWA 1O7FA 3T8TA 4KN4X 2UWMA 4Y17A 2FU4A 2HKOA 2WC2A 2L01A 3F21A 2O61A 3F3XA 4L0ZB 4FX0A 1W7PB 4O3MA 3FMQA 1XN7A 3I71A 1U2WA 4L9VA 4YIFA 2Q0OA 4HOBA 3ULQB 2HTJA 5ICCA 3E97A 2L3DA 5H6QA 4LLNA 4G7HF 4M73A 1RUNA 2O6GE 1KQ9A 3H3UA 3TO9A 3F72A 3E5QA 2D2WA 3GEZA 1E17A 2HS5A 5E1ZB 4BH9A 2D1HA 1L3LA 4MTDA 5HVQC 2L4MA 1OYIA 3JSPA 1HKSA 2ZCWA 3CO7C 2BV6A 4HQMA 1TQMA 4B09A 1V4RA 2FNAA 2FMLA 2HZTA 1YIOA 1YW7A 4LK1F 4G7OF 1GVJA 5LHIA 4WK8F 2JPBA 5KVRA 2COMA 3R0JA 2PEXA 2K02A 2W84A 1R36A 3BJAA 2JZYA 5BS6A 4P9UA 2P4WA 3JW4A 4M6XA 2W85A 4KMUX 3BJ6A 4ENKA 1K78B 5F6FA 1YS7A 2R3SA 5ICFA 2VE8A 2XV4S 3K2ZA 5FD6A 2NNYA 1J75A 2YR2A 4G8XA 2RC4A 4H0EA 1XDUA 2ZBKA 3HSFA 2QQAA 2CGPA 5J6XA 2A07F 3QU6A 2ZMEB 2GAUA 2STWA 1BI3A 5LHGA 2CSOA 5L3GA 3KETA 5EEHA 4CXFA 3WTXC 1QQIA 4KFCA 1W5SA 2RKHA 2ZNZA 2OZ6A 2PBIA 1G3TA 1EV7A 2F5CA 2LNBA 2A61A 4XLNF 3EYIA 2VN2A 2NAZA 2EB7A 1CF7B 3IL2A 1PP7U 2WTEA 4HA8A 2EV0A 4FX4A 2VBYA 2JPCA 1KQ8A 1YTYA 2M1BA 4U0VA 3WTUC 4I98B 2H6CA 2DPUA 2V9VA 4HDUA 1J59A 6PAXA 5D5WB 1P92A 3HSEA 1OR7A 3BJOA 2QBYB 3HHGA 2M30A 1QPMA 5BMZA 2A5YB 5DDGA 4HX8A 1TTYA 1R1TA 3U2RA 3M8FA 1Y0UA 1D5VA 2HGCA 4RGRA 1MD0A 4AWXB 3HTSB 1B59A 4KA4A 1FYMA 2XKPA 1MKMA 2P6TA 1CF7A 5FFZA 1IN4A 3E3VA 1CGPA 1ZGAA 1KU3A 4A6DA 2DPDA 5K5RA 3KE2A 2ZNYA 1F1ZA 4BAYA 1JHHA 2NRAC 2MH9A 3ECHA 2VE9A 3IRQA 4GXOA 3IWZA 4EM1A 3GUDA 1TLHB 4L5JA 4IHTA 3V8LA 2DQRA 2BEOA 3ML6A 1E2XA 3QP5A 1S8NA 3WGIA 2HFHA 4G9YA 1F5TA 3RYPA 2MLGA 2PG4A 4CICA 2QBYA 4ZYHA 3KEOA 3PQKA 3ZN1A 2M5WA 4RAYA 4A12A 1TW3A 4L9TA 2E1CA 1XMAA 2O03A 2STTA 1T0FA 4EGZA 1XMKA 5L3BA 3ZPLA 1RNLA 4CYDA 2D45A 5ICEA 3CJNA 1FC3A 4ZYEA 5AIPA 3BY6A 3ECOA 5H6RA 1FP2A 2CQKA 1WRJA 2E7WA 1WKMA 4WXCA 4RS8A 2EFOA 5D6FA 4JBAA 1ZGJA 2DO7A 4A0YA 1G3YA 2K86A 1EH6A 3GX4X 4LB6B 5E20A 4U7BA 4DNCA 2BYVE 1U5TA 3RPUA 2H6BA 4OU0A 3I0TA 4M71A 5DCFA 4KMFA 4BHCA 4EJUA 2DBBA 1I5ZA 1XSXA 5IT3A 5BOXA 1ZG5A 2DW4A 5DCMA 4P9FA 3K69A 4FHTA 2IA1A 4K2EA 2YPRA 4LLGF 1L0OC 2ADUA 3V4GA 3WTSC 3EUHA 1B9NA 2FBKA 1S29A 2LF7A 3LAPA 1JE8A 1HSJA 5L3EA 3G3ZA 2WWYA 1C0WA 1H9TA 2PI0A 1YO5C 5CVVA 1ON2A 3WTZA 4MEXF 1U8RA 4OIRF 4HV5A 2IA0A 1QGPA 2ESHA 2K7LA 3GFIA 1UFMA 4P5OA 2VBXA 4G6DA 1OYWA 2FE3A 1MGTA 4MNUA 5E1XA 2K27A 3TDUC 3E6CC 4L18B 1YFHA 1FYKA 1IN5A 3P7NA 5CLSA 5D8KB 2R7DA 3WGHA 1MDMA 3F22A 5J8FA 1ZARA 4G6QA 1BJAA 5DUIA 1EH8A 3KLOA 3FZVA 2OBPA 4PDKA 2Y48A 1YW9A 3MAJA 2XROA 2H94A 2FMYA 1LDDA 2XASA 4UVCA 5E1WA 3IKTA 1U78A 1WI9A 1IZ1A 3O2PE 4EQQA 1LJ9A 5HLHA 4WX9A 1FZPB 3V8JA 2UXNA 2MLKA 4KYWA 4ESBA 2OZUA 3MEXA 4LJZF 2V79A 1Z6RA 4IJAA 2YSRA 2LKPA 1AOYA 2X0LA 2DLLA 2A68F 1BIAA 1FWZA 2L02A 4ESFA 1WSUA 1BI2A 1FT9A 1SFXA 1F9NA 1HSTA 3CTAA 1ZLKA 4HBLA 4HX7A 4UV9A 3T5XA 1O3SA 1Z91A 4ETSA 5LLQA 3JAMK 4IVNA 5JFRA 2HR3A 1T98A 1S6LA 2A69F 1SD7A 5ERIA 3KZZA 2JSCA 3FX3A 2GA1A 3PQJA 5JHUA 2X4HA 3I59B 4IXAA 3WE2A 2OU2A 2G7UA 2IJLA 1ONVA 2Z5UA 1I6XA 3MQ0A 2XKOA 3R0AA 5D8LB 3HHHA 5CYVA 4KN7X 5BQTA 2DTRA 2DQLA 4KICA 5CVIA 3TGNA 4I0BA 4RAZA 3SZTA 3KP5A 2KJBA 3WTWC 3N97A 2G7HA 1WWXA 4EJTA 5D5UB 4EM0B 1D8KA 4M9XA 4AIJA 4B8XA 3E5XA 3TO6A 4HX4A 5HS8A 4OMYA 3QP6A 2AS5F 3RTRA 3MCZA 2RGVA 5A2QZ 2DFIA 3SHFA 4EJOA 2P5LC 2EA4A 3WGGA 5CJ9A 2G9WA 2Z9OA 5D4SA 4XLPF 1LDKB 3MZHA 3KP4A 1KQ0A 2QLZA 2ACJA 4HYEA 3LQQA 4LMYA 2EFWA 4HF1A 2VC1A 1YG2A 3E6BA 1UHMA 2E7XA 2XAGA 1BIBA 4RB2C 1YQAA 5FO5A 2ESNA 4S05A 4UV8A 1IRGA 3WTYC 2CW0F 1W7PA 3GLXA 2FRHA 4IRIA 3CO6C 1D3YA 2RN7A 2KJCA 1USTA 3LWFA 1ZH5A 5LGTA 3J80Z 4BNCA 3F23A 3NQOA 3GFJA 2DI3A 4Y15A 4O5VA 3WG9A 3DFGA 1ZREA 5ICGA 4Q47A 3OOPA 1I27A 1R1VA 3RI4A 3ABTA 4MHGA 1ZRCA 2KIMA 1T38A 5E17F 2M45A 3P9KA 3BP8A 1GXQA 3RJPA 1OMIA 1TQPA 1T2KA 1S7AA 3M1EA 1MZBA 1GHCA 3ZMUA 3QOPA 2W57A 3GVAA 3HRTA 3QPTA 3TQNA 1SAXA 4L5IA 3U1DA 2OQGA 3KP6A 5CVRA 2Z3YA 4MGRA 3BPXA 3C7JA 1KU2A 4RGUA 3QRFF 3BROA 2VT2A 3TOBA 3C18A 1K78A 3GW2A 1IXRC 1GXPA 4HLYA 3V7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTH A;  2HQR A;  3ROU A;  3REO A;  5EEG A;  2PMH A;  5DD4 A;  3R4K A;  1JGS A;  5K1Y A;  1ZAO A;  3N4M A;  3SQN A;  2XAF A;  1DPR A;  4QWQ A;  2J5P A;  2OD5 A;  2ZME A;  4M9S A;  3R6S A;  4AIH A;  5E18 F;  5TJJ A;  5FLX Z;  2RV8 A;  2FQ3 A;  3HOT A;  4OIQ F;  1R22 A;  1FX7 A;  1PP8 F;  3GFM A;  5IT9 K;  2DK8 A;  3J81 K;  4EM2 A;  1MJB A;  3WTT C;  2P5V A;  3VOE A;  2R7F A;  4XSZ F;  1G4D A;  1DUX C;  2HTS A;  1SMT A;  3KEQ A;  1XSD A;  2ISY A;  3F6V A;  3ZMZ A;  2PJP A;  4AD9 A;  3RYR A;  1O57 A;  1LNW A;  1VTN C;  4G94 A;  1RI7 A;  1ZRD A;  2Y0M A;  1U3E M;  3KLN A;  1R23 A;  1G6N A;  1ZRF A;  3QU3 A;  1Z1D A;  4U88 A;  2JRT A;  5JVT A;  2XUB A;  2A6E F;  5K5O A;  2YX4 A;  3EYY A;  4A2U A;  3F8F A;  3H92 A;  2BBY A;  2PMU A;  2V1U A;  3FMR A;  3VFZ A;  1R58 A;  3C1D A;  1JXS A;  4OIO F;  2QQ9 A;  3GO5 A;  3ZMV A;  2HKX A;  5ED4 A;  1B4A A;  3L00 A;  1P2F A;  4XSX F;  3S2W A;  5DEQ A;  2O3F A;  4KIF A;  4HDV A;  3M7G A;  2W25 A;  2P7V B;  3ERE D;  2H09 A;  1MJA A;  1FBQ A;  1J2X A;  3E5U A;  2F5D A;  2H27 A;  1FBS A;  3BZ6 A;  2P7C B;  2BGC A;  4EJW A;  1XD7 A;  3FWE A;  4M74 A;  4OMZ A;  1TNS A;  3T1B A;  3K9T A;  2UXX A;  4YFX F;  4E70 A;  5LBQ A;  1ZG3 A;  2KIU A;  1Z7U A;  4AIK A;  2O8X A;  3ELK A;  2FF4 A;  3V8K A;  3W6J B;  3L7W A;  2EV6 A;  2ZKZ A;  4UVA A;  4KIG A;  1ZHF A;  3ABU A;  1B9M A;  2NYX A;  2FOK A;  4WWC A;  3FXU A;  5TRD A;  3LA3 A;  4UHT A;  3HRM A;  4LFU A;  3D0S A;  3M8E A;  4CHU A;  1R1U A;  1R5H A;  4GCV A;  1QZZ A;  2C6Y A;  1J7K A;  4LG0 B;  1HW1 A;  3DKW A;  1P4A A;  3J80 K;  2PQ8 A;  3FM5 A;  3I4P A;  3IC7 A;  1O3Q A;  3NRV A;  4QLC U;  2IW5 A;  1IXC A;  3MFK A;  4CDG A;  4JQF A;  2AXL A;  1WQ2 A;  3PFI A;  3ZN0 A;  5D6E A;  2NNN A;  3TDZ C;  2XGX A;  3HIF A;  2VOD A;  3QPH A;  1AWC A;  1FSE A;  1ON1 A;  3FMS A;  1ULY A;  3RKY A;  1FBU A;  3OV8 A;  3MWM A;  1STZ A;  5BPD A;  2XAJ A;  4UUV A;  2DAO A;  4UVB A;  3E6D A;  4UXN A;  2CWE A;  2B0L A;  4OIP F;  1O7L A;  3DPT A;  4ZYG A;  1W4M A;  3Q9S A;  3FXR A;  3D5L A;  3DP7 A;  3W6K B;  1TW2 A;  2VBW A;  5HLI A;  4KUM A;  5HS9 A;  2FXA A;  4LK0 F;  4Z2Y A;  1H0M A;  1B6A A;  4EV0 A;  3F8B A;  3DPL C;  2OA4 A;  2GZW A;  5CVU A;  5ILS A;  2XRN A;  3RDI A;  3KZY A;  2PFB A;  2L4A A;  3HUG A;  1IRF A;  3LAJ A;  1FY7 A;  1NHA A;  3NEU A;  3VEP A;  1XDS A;  4L9J A;  4TV7 A;  1UB9 A;  4ENJ A;  1F4K A;  4ZZL A;  4I01 A;  4HAM A;  5HOO A;  1XCB A;  1XCV A;  2VON A;  2MC3 A;  4YFK F;  3F6O A;  2FNP A;  2PLY A;  3WOD F;  1QBJ A;  3E6M A;  1A04 A;  4LGW A;  2UZK A;  2QWW A;  1Z05 A;  4HQE A;  3ZMD A;  1BI1 A;  4OIN F;  4BXU A;  3COA C;  1U6G A;  2OQR A;  5F1R A;  2HWV A;  2ZXJ A;  3SFZ A;  4ENN A;  1I1G A;  1KU9 A;  1TNT A;  5HDK A;  2LDU A;  3LQR A;  3L2C A;  4ASN A;  1RIO H;  5HS7 A;  2Q2E A;  3GZ6 A;  4A6E A;  1JHF A;  5CVJ A;  5FGM A;  3KP3 A;  4P96 A;  2YX7 A;  3KCC A;  4BYY A;  5L3F A;  1SMY F;  5LRR A;  3AAF A;  3GZ5 A;  1HQC A;  3GF2 A;  1KU7 A;  5JI6 A;  1SFU A;  4KT5 C;  1LDJ A;  1R5G A;  5FB2 A;  4ZZD A;  2GQQ A;  2HEO A;  3QAH A;  4ZYD A;  4HW0 A;  3ZMT A;  1XGS A;  4Q5S F;  5DYM A;  3CUQ B;  3BWG A;  2VC0 A;  2XVC A;  4XBF A;  5LHH A;  3T8R A;  2YU3 A;  2V1D A;  2EJR A;  3ZP5 A;  1HKT A;  2ISZ A;  2LF8 A;  4PGG A;  4JK1 X;  2GXG A;  2VOO A;  4M9Z A;  4GYG A;  1V3F A;  1HKQ A;  1O3T A;  4BQA A;  2L54 A;  2W24 A;  2QM3 A;  2Z99 A;  2QUF A;  1G3S A;  1R7J A;  2IPQ X;  3DQV C;  4MTE A;  4HV6 A;  3CUO A;  3M9A A;  1EH7 A;  3TKY A;  1K79 A;  3GXO A;  1B1B A;  3WU0 A;  1X3U A;  3I59 A;  3GFL A;  3K0L A;  4IPA A;  4DQ2 A;  1USS A;  4I09 A;  2HDC A;  3ZQ7 A;  2M8E A;  4R8H A;  1ODD A;  1RZ4 A;  2RNJ A;  2GA2 A;  2MD5 A;  1S3J A;  1D8J A;  2CG4 A;  3C3W A;  3VOD A;  3CUQ A;  3K1P A;  5DD8 A;  4LB5 A;  3GYH X;  3GWZ A;  1FP1 D;  4RB1 A;  5DV5 A;  1YYV A;  4CO8 A;  3WTV C;  4KDP A;  3IWF A;  5LGN A;  4ZH4 F;  5D4R A;  4YG2 F;  3P9I A;  1FNN A;  4D0P A;  1UHW A;  1LB2 A;  1O3R A;  4IRG A;  3V7C A;  4L0Y B;  3CUQ C;  1P4X A;  2P5K A;  2QZ8 A;  1IUY A;  2D1V A;  3IKV A;  2Q8K A;  5HDN A;  1BBY A;  3JSO A;  3O6B B;  2FBH A;  3V7S A;  3BOQ A;  4PCQ A;  1TBX A;  4MEY F;  1T6S A;  4ESJ A;  1Z6T A;  3FM3 A;  4XRF A;  2VT3 A;  4EGY A;  1LEB A;  3CLO A;  2VXZ A;  3U9G A;  3FHZ A;  1QZY A;  4U0Y A;  1P4W A;  2P8T A;  3O3K A;  4RGX A;  4ENM A;  4WXD A;  1Z9C A;  4S04 A;  2DU9 A;  2J5O A;  4CZZ A;  4PZJ A;  2EA2 A;  3LST A;  4KNY A;  4OOI A;  1YW8 A;  5ILU A;  3L9F A;  3LFK A;  1PDN C;  4N9I A;  4HF2 A;  1S7O A;  1BC8 C;  3K1M A;  1KYW A;  2CYY A;  1QO0 D;  4Q48 A;  2A3S A;  3T0Y A;  4MQV A;  1QNT A;  4A0X A;  3DEU A;  4I7H A;  1XGM A;  1IF1 A;  4I0A A;  1KYZ A;  3DXJ F;  3ISP A;  3K1N A;  2VBZ A;  4U7D A;  3EDP A;  3HYI A;  3I54 A;  4GGG A;  3SXY A;  4EVI A;  2M87 A;  1SD6 A;  4WF2 A;  2HOE A;  2ZFW A;  3HSR A;  2IVM A;  4M6Y A;  1FYL A;  3RIR A;  2EWN A;  1IXS B;  5AIQ A;  1BN5 A;  1R00 A;  2P6S A;  2DT5 A;  3JAM Z;  4PGH A;  3EQL F;  4IF4 A;  1I1S A;  2IA2 A;  1XGN A;  4CGZ A;  5D5X B;  2NS0 A;  4WXH A;  5KK1 A;  4O6J A;  2XAQ A;  5F64 A;  2CFX A;  2F2E A;  3LA2 A;  4ON0 A;  3L09 A;  5HDG A;  4A0Z A;  4Y13 A;  3H3Z A;  3SZP A;  2HYG D;  4RGS A;  2IRF G;  1BM9 A;  1U5T B;  5D5V B;  3F8M A;  4UNO A;  5DUK A;  1BOA A;  1LQ1 A;  1KA8 A;  1T39 A;  1XB4 A;  3KFW X;  2GIV A;  1LEA A;  2V1X A;  4EJV A;  4MQ9 F;  3I64 A;  1W7P D;  5DCM B;  4NHJ A;  1IAW A;  4A5M A;  2EV5 A;  2KRF A;  1BC7 C;  5A2Q K;  4M72 A;  2V6C A;  2EK5 A;  1K6O A;  2RVC A;  4HZF A;  2FBI A;  4NB5 A;  1RUO A;  5FFX A;  3G73 A;  4I2O A;  3WE3 A;  1SD5 A;  1FSH A;  5BPI A;  3DF8 A;  2WV0 A;  2EFP A;  1FLI A;  1DPU A;  2ZJ2 A;  1OPC A;  2KIF A;  5FD5 A;  4YFN F;  1FOK A;  2QYO A;  1IN8 A;  3HRS A;  3MZY A;  4U0W A;  2BE5 F;  2GWR A;  5LEJ A;  3VB2 A;  3KP2 A;  2XAH A;  2KKO A;  2EFN A;  4A5N A;  4AVP A;  3F8N A;  4G7Z F;  4N0B A;  5J8C A;  1J9I A;  3P9C A;  2O0Y A;  3TOA A;  2F5F A;  2DK5 A;  1HBX G;  2QEN A;  4Q4Z F;  3FF5 A;  3HTU A;  3Q9V A;  1PUE E;  1MDM B;  4BHB A;  4P55 A;  3BDD A;  3JTG A;  1UCR A;  5H20 A;  5LEK A;  5HLG A;  1KGS A;  1U5T C;  2PN6 A;  2MH2 A;  2QVO A;  4KIB A;  3F8C A;  2RDP A;  1TQI A;  2HYF A;  5L3C A;  3R61 A;  3KP7 A;  2K4B A;  2QQB A;  3CDH A;  1J0R A;  2FA5 A;  1SFE A;  2GXB A;  2MBF A;  4N9H A;  5JR3 A;  5ILV A;  2XIG A;  2IT0 A;  1REP C;  3RKX A;  5LRS A;  4R1H A;  5K5Q A;  5E8I A;  4WCG A;  1IN6 A;  2K4J A;  2CO5 A;  1IN7 A;  3BPV A;  1OKR A;  2LSO A;  5AON A;  1ZG1 A;  3RKW A;  4R79 A;  3LA7 A;  2ELH A;  4I02 A;  2OAZ A;  2F5E A;  1W5T A;  4RB0 A;  2E1N A;  4GYI A;  1P6R A;  3B02 A;  4NQW A;  3HOS A;  3HRU A;  3I53 A;  1YS6 A;  4LG0 A;  4RB3 C;  1DP7 P;  1YLF A;  1FPQ A;  2JT1 A;  1H9G A;  2HQN A;  3J7A O;  2ZO4 A;  2IP2 A;  4FT8 A;  5LGU A;  1K7A A;  1HW5 A;  3EET A;  4LD5 A;  1ZYR F;  2MA3 A;  1SD4 A;  2FEZ A;  1XSV A;  4EMS A;  5FLX K;  5E8G A;  3IHU A;  3I58 A;  2Z33 A;  2RQP A;  4L9N A;  3WU1 B;  4IHS A;  4F7Z A;  1BI0 A;  3ZMS A;  1J5Y A;  2VOP A;  1MJ9 A;  2EFQ A;  4LLL A;  5L3D A;  3TO7 A;  5IT9 Z;  3I5U A;  3Q5F A;  3J81 Z;  1HXD A;  1Q1H A;  1ZLJ A;  3FXQ A;  1ZN2 A;  3IRR A;  4BHP A;  1XGO A;  4HF0 A;  4HLX A;  3RPQ A;  3B73 A;  4GO1 A;  2XHK A;  2Y75 A;  4IRH A;  1OYY A;  3DV8 A;  1DDN A;  1G3W A;  2A6H F;  2JTV A;  2ETH A;  3R60 A;  1IW7 F;  4YII A;  1HW2 A;  1LVA A;  2TDX A;  2FSW A;  1O7F A;  3T8T A;  4KN4 X;  2UWM A;  4Y17 A;  2FU4 A;  2HKO A;  2WC2 A;  2L01 A;  3F21 A;  2O61 A;  3F3X A;  4L0Z B;  4FX0 A;  1W7P B;  4O3M A;  3FMQ A;  1XN7 A;  3I71 A;  1U2W A;  4L9V A;  4YIF A;  2Q0O A;  4HOB A;  3ULQ B;  2HTJ A;  5ICC A;  3E97 A;  2L3D A;  5H6Q A;  4LLN A;  4G7H F;  4M73 A;  1RUN A;  2O6G E;  1KQ9 A;  3H3U A;  3TO9 A;  3F72 A;  3E5Q A;  2D2W A;  3GEZ A;  1E17 A;  2HS5 A;  5E1Z B;  4BH9 A;  2D1H A;  1L3L A;  4MTD A;  5HVQ C;  2L4M A;  1OYI A;  3JSP A;  1HKS A;  2ZCW A;  3CO7 C;  2BV6 A;  4HQM A;  1TQM A;  4B09 A;  1V4R A;  2FNA A;  2FML A;  2HZT A;  1YIO A;  1YW7 A;  4LK1 F;  4G7O F;  1GVJ A;  5LHI A;  4WK8 F;  2JPB A;  5KVR A;  2COM A;  3R0J A;  2PEX A;  2K02 A;  2W84 A;  1R36 A;  3BJA A;  2JZY A;  5BS6 A;  4P9U A;  2P4W A;  3JW4 A;  4M6X A;  2W85 A;  4KMU X;  3BJ6 A;  4ENK A;  1K78 B;  5F6F A;  1YS7 A;  2R3S A;  5ICF A;  2VE8 A;  2XV4 S;  3K2Z A;  5FD6 A;  2NNY A;  1J75 A;  2YR2 A;  4G8X A;  2RC4 A;  4H0E A;  1XDU A;  2ZBK A;  3HSF A;  2QQA A;  2CGP A;  5J6X A;  2A07 F;  3QU6 A;  2ZME B;  2GAU A;  2STW A;  1BI3 A;  5LHG A;  2CSO A;  5L3G A;  3KET A;  5EEH A;  4CXF A;  3WTX C;  1QQI A;  4KFC A;  1W5S A;  2RKH A;  2ZNZ A;  2OZ6 A;  2PBI A;  1G3T A;  1EV7 A;  2F5C A;  2LNB A;  2A61 A;  4XLN F;  3EYI A;  2VN2 A;  2NAZ A;  2EB7 A;  1CF7 B;  3IL2 A;  1PP7 U;  2WTE A;  4HA8 A;  2EV0 A;  4FX4 A;  2VBY A;  2JPC A;  1KQ8 A;  1YTY A;  2M1B A;  4U0V A;  3WTU C;  4I98 B;  2H6C A;  2DPU A;  2V9V A;  4HDU A;  1J59 A;  6PAX A;  5D5W B;  1P92 A;  3HSE A;  1OR7 A;  3BJO A;  2QBY B;  3HHG A;  2M30 A;  1QPM A;  5BMZ A;  2A5Y B;  5DDG A;  4HX8 A;  1TTY A;  1R1T A;  3U2R A;  3M8F A;  1Y0U A;  1D5V A;  2HGC A;  4RGR A;  1MD0 A;  4AWX B;  3HTS B;  1B59 A;  4KA4 A;  1FYM A;  2XKP A;  1MKM A;  2P6T A;  1CF7 A;  5FFZ A;  1IN4 A;  3E3V A;  1CGP A;  1ZGA A;  1KU3 A;  4A6D A;  2DPD A;  5K5R A;  3KE2 A;  2ZNY A;  1F1Z A;  4BAY A;  1JHH A;  2NRA C;  2MH9 A;  3ECH A;  2VE9 A;  3IRQ A;  4GXO A;  3IWZ A;  4EM1 A;  3GUD A;  1TLH B;  4L5J A;  4IHT A;  3V8L A;  2DQR A;  2BEO A;  3ML6 A;  1E2X A;  3QP5 A;  1S8N A;  3WGI A;  2HFH A;  4G9Y A;  1F5T A;  3RYP A;  2MLG A;  2PG4 A;  4CIC A;  2QBY A;  4ZYH A;  3KEO A;  3PQK A;  3ZN1 A;  2M5W A;  4RAY A;  4A12 A;  1TW3 A;  4L9T A;  2E1C A;  1XMA A;  2O03 A;  2STT A;  1T0F A;  4EGZ A;  1XMK A;  5L3B A;  3ZPL A;  1RNL A;  4CYD A;  2D45 A;  5ICE A;  3CJN A;  1FC3 A;  4ZYE A;  5AIP A;  3BY6 A;  3ECO A;  5H6R A;  1FP2 A;  2CQK A;  1WRJ A;  2E7W A;  1WKM A;  4WXC A;  4RS8 A;  2EFO A;  5D6F A;  4JBA A;  1ZGJ A;  2DO7 A;  4A0Y A;  1G3Y A;  2K86 A;  1EH6 A;  3GX4 X;  4LB6 B;  5E20 A;  4U7B A;  4DNC A;  2BYV E;  1U5T A;  3RPU A;  2H6B A;  4OU0 A;  3I0T A;  4M71 A;  5DCF A;  4KMF A;  4BHC A;  4EJU A;  2DBB A;  1I5Z A;  1XSX A;  5IT3 A;  5BOX A;  1ZG5 A;  2DW4 A;  5DCM A;  4P9F A;  3K69 A;  4FHT A;  2IA1 A;  4K2E A;  2YPR A;  4LLG F;  1L0O C;  2ADU A;  3V4G A;  3WTS C;  3EUH A;  1B9N A;  2FBK A;  1S29 A;  2LF7 A;  3LAP A;  1JE8 A;  1HSJ A;  5L3E A;  3G3Z A;  2WWY A;  1C0W A;  1H9T A;  2PI0 A;  1YO5 C;  5CVV A;  1ON2 A;  3WTZ A;  4MEX F;  1U8R A;  4OIR F;  4HV5 A;  2IA0 A;  1QGP A;  2ESH A;  2K7L A;  3GFI A;  1UFM A;  4P5O A;  2VBX A;  4G6D A;  1OYW A;  2FE3 A;  1MGT A;  4MNU A;  5E1X A;  2K27 A;  3TDU C;  3E6C C;  4L18 B;  1YFH A;  1FYK A;  1IN5 A;  3P7N A;  5CLS A;  5D8K B;  2R7D A;  3WGH A;  1MDM A;  3F22 A;  5J8F A;  1ZAR A;  4G6Q A;  1BJA A;  5DUI A;  1EH8 A;  3KLO A;  3FZV A;  2OBP A;  4PDK A;  2Y48 A;  1YW9 A;  3MAJ A;  2XRO A;  2H94 A;  2FMY A;  1LDD A;  2XAS A;  4UVC A;  5E1W A;  3IKT A;  1U78 A;  1WI9 A;  1IZ1 A;  3O2P E;  4EQQ A;  1LJ9 A;  5HLH A;  4WX9 A;  1FZP B;  3V8J A;  2UXN A;  2MLK A;  4KYW A;  4ESB A;  2OZU A;  3MEX A;  4LJZ F;  2V79 A;  1Z6R A;  4IJA A;  2YSR A;  2LKP A;  1AOY A;  2X0L A;  2DLL A;  2A68 F;  1BIA A;  1FWZ A;  2L02 A;  4ESF A;  1WSU A;  1BI2 A;  1FT9 A;  1SFX A;  1F9N A;  1HST A;  3CTA A;  1ZLK A;  4HBL A;  4HX7 A;  4UV9 A;  3T5X A;  1O3S A;  1Z91 A;  4ETS A;  5LLQ A;  3JAM K;  4IVN A;  5JFR A;  2HR3 A;  1T98 A;  1S6L A;  2A69 F;  1SD7 A;  5ERI A;  3KZZ A;  2JSC A;  3FX3 A;  2GA1 A;  3PQJ A;  5JHU A;  2X4H A;  3I59 B;  4IXA A;  3WE2 A;  2OU2 A;  2G7U A;  2IJL A;  1ONV A;  2Z5U A;  1I6X A;  3MQ0 A;  2XKO A;  3R0A A;  5D8L B;  3HHH A;  5CYV A;  4KN7 X;  5BQT A;  2DTR A;  2DQL A;  4KIC A;  5CVI A;  3TGN A;  4I0B A;  4RAZ A;  3SZT A;  3KP5 A;  2KJB A;  3WTW C;  3N97 A;  2G7H A;  1WWX A;  4EJT A;  5D5U B;  4EM0 B;  1D8K A;  4M9X A;  4AIJ A;  4B8X A;  3E5X A;  3TO6 A;  4HX4 A;  5HS8 A;  4OMY A;  3QP6 A;  2AS5 F;  3RTR A;  3MCZ A;  2RGV A;  5A2Q Z;  2DFI A;  3SHF A;  4EJO A;  2P5L C;  2EA4 A;  3WGG A;  5CJ9 A;  2G9W A;  2Z9O A;  5D4S A;  4XLP F;  1LDK B;  3MZH A;  3KP4 A;  1KQ0 A;  2QLZ A;  2ACJ A;  4HYE A;  3LQQ A;  4LMY A;  2EFW A;  4HF1 A;  2VC1 A;  1YG2 A;  3E6B A;  1UHM A;  2E7X A;  2XAG A;  1BIB A;  4RB2 C;  1YQA A;  5FO5 A;  2ESN A;  4S05 A;  4UV8 A;  1IRG A;  3WTY C;  2CW0 F;  1W7P A;  3GLX A;  2FRH A;  4IRI A;  3CO6 C;  1D3Y A;  2RN7 A;  2KJC A;  1UST A;  3LWF A;  1ZH5 A;  5LGT A;  3J80 Z;  4BNC A;  3F23 A;  3NQO A;  3GFJ A;  2DI3 A;  4Y15 A;  4O5V A;  3WG9 A;  3DFG A;  1ZRE A;  5ICG A;  4Q47 A;  3OOP A;  1I27 A;  1R1V A;  3RI4 A;  3ABT A;  4MHG A;  1ZRC A;  2KIM A;  1T38 A;  5E17 F;  2M45 A;  3P9K A;  3BP8 A;  1GXQ A;  3RJP A;  1OMI A;  1TQP A;  1T2K A;  1S7A A;  3M1E A;  1MZB A;  1GHC A;  3ZMU A;  3QOP A;  2W57 A;  3GVA A;  3HRT A;  3QPT A;  3TQN A;  1SAX A;  4L5I A;  3U1D A;  2OQG A;  3KP6 A;  5CVR A;  2Z3Y A;  4MGR A;  3BPX A;  3C7J A;  1KU2 A;  4RGU A;  3QRF F;  3BRO A;  2VT2 A;  3TOB A;  3C18 A;  1K78 A;  3GW2 A;  1IXR C;  1GXP A;  4HLY A;  3V7R A; 
#chains in the Genus database with same CATH topology
 3JTH A;  4XR6 A;  2HQR A;  3ROU A;  4A3I J;  1X3Z B;  2BVM A;  3REO A;  5EEG A;  2PMH A;  3TBI A;  2IS4 A;  1XTA A;  3ZQG A;  4AID A;  5DD4 A;  4W1U A;  1R9T J;  1WI3 A;  3R4K A;  1JGS A;  4DBR A;  5K1Y A;  3K4J A;  3FXJ A;  4QTR A;  4BQQ A;  1N25 A;  2BOL A;  1ZAO A;  2WAE A;  3BT9 A;  1K6Y A;  2LP0 A;  3LOC A;  3N4M A;  1I50 J;  3SQN A;  2XAF A;  1JUP A;  1DPR A;  4QWQ A;  2J5P A;  2OD5 A;  2ZME A;  3HM5 A;  4M3G A;  3GME A;  3FBN B;  1IGN A;  3GZN B;  4M9S A;  3R6S A;  1YHQ I;  1CQT A;  3CDL A;  3S3O A;  2KIS A;  4AIH A;  4PJM A;  4D1Q A;  1MND A;  5E18 F;  1Z7L A;  5TJJ A;  5FLX Z;  4BDZ A;  4BXX J;  2RV8 A;  5GP9 A;  5JVG F;  3OS2 A;  2CQX A;  2P81 A;  2FQ3 A;  1Z67 A;  2DOA A;  3HOT A;  4OIQ F;  1R22 A;  2I10 A;  4BKX A;  5J4V A;  1FX7 A;  1PP8 F;  1OCR H;  3IH4 A;  1YX5 A;  3D5R C;  3GFM A;  4NUB A;  5IT9 K;  3HDD A;  2DK8 A;  3J81 K;  3LSI A;  4EM2 A;  1MJB A;  1PYV A;  3WTT C;  2P5V A;  2LK2 A;  3VOE A;  4M3F A;  2R7F A;  3OMY A;  1X2M A;  2VKD A;  5FKL A;  4XSZ F;  3RZD J;  1G4D A;  5J1U A;  1DUX C;  2HTS A;  3OYG A;  1SMT A;  3KEQ A;  1XSD A;  2ISY A;  3F6V A;  3VWB A;  3BR2 A;  3SEQ A;  3ZMZ A;  2PJP A;  4AD9 A;  3RYR A;  1Y8Q B;  3D1N I;  1WJB A;  3QYB A;  1O57 A;  1SVM A;  2WAQ A;  1LNW A;  1VTN C;  4A3F J;  1FMW A;  3DU6 A;  4PJ0 C;  4G94 A;  1RI7 A;  1ZRD A;  2Y0M A;  3ZXS A;  2VKV A;  1OCT C;  2FQ4 A;  1U3E M;  3KLN A;  4BJ6 C;  4AU7 A;  1IC8 A;  5EGO A;  1R23 A;  1G6N A;  2ELJ A;  2WBM A;  2H1L A;  5GAD J;  1ZRF A;  3QU3 A;  2R7O A;  1A6Q A;  1Z1D A;  4U88 A;  4UB6 C;  2JRT A;  5JVT A;  2XUB A;  2L9V A;  2COB A;  3TL4 X;  2A6E F;  2ZSI B;  5K5O A;  3ZOB A;  2YX4 A;  3EYY A;  4A2U A;  4CCK A;  1MMS A;  3ZCO A;  3IAS 2;  3F8F A;  3H92 A;  3OR1 C;  2BBY A;  1E3P A;  2AQE A;  2PMU A;  4XLA A;  2V1U A;  3FMR A;  2EPF A;  2K9L A;  2R0Q C;  3EUK L;  1W36 C;  4E7Z A;  1VF9 A;  2M2E A;  3S1R J;  1X4O A;  3VFZ A;  1X1B A;  1R58 A;  3C1D A;  1JXS A;  1IJW C;  3CJT B;  1RRJ A;  3G1L A;  2KDZ A;  4OIO F;  2QQ9 A;  3GO5 A;  3ZMV A;  2O5R A;  2HKX A;  4CCM A;  2LRD A;  5ED4 A;  1B4A A;  3L00 A;  3H36 A;  1P2F A;  2E5Z A;  4XSX F;  4XQF A;  3S2W A;  4BQO A;  3AG1 H;  5DEQ A;  3Q3S A;  1XPX A;  4BY7 J;  2O3F A;  2QKM B;  1UZC A;  3K4C A;  4KIF A;  4HDV A;  3M7G A;  2M34 A;  2P7V B;  2W25 A;  2IBD A;  3ERE D;  2UV1 A;  2BHY A;  2PMZ N;  2H09 A;  1MJA A;  2VAS A;  4B3A A;  2LBF B;  1FBQ A;  1J2X A;  4XON A;  4JX4 A;  4BL0 B;  4IHX A;  3E5U A;  2F5D A;  2H27 A;  2X6W A;  1FBS A;  5M3F J;  2PJR A;  3CP8 A;  2W48 A;  3BZ6 A;  3L2U A;  2P7C B;  2BGC A;  3DTI A;  2BY0 A;  1JT6 A;  4EJW A;  2F4O B;  1XD7 A;  3TED A;  3FWE A;  5C4J J;  2BHZ A;  2NVQ J;  4M74 A;  4GRI A;  2VKE A;  2X6Y A;  2CUF A;  4OMZ A;  2CFO A;  1TNS A;  3ASN H;  2KIQ A;  1Y6I A;  3T1B A;  2HU9 A;  3K9T A;  2UXX A;  4YFX F;  2H1K A;  4E70 A;  5LBQ A;  4C3I J;  3RQ4 A;  1MMN A;  3KEY A;  2L9S A;  1ZG3 A;  2KIU A;  1Z7U A;  2L9R A;  4AIK A;  4RLQ A;  4Y4R A;  2O8X A;  3ELK A;  2FF4 A;  3BR0 A;  4XMY A;  3V8K A;  1FEX A;  2QGU A;  4A3C J;  3W6J B;  3I55 I;  3L7W A;  1D0Z A;  2EV6 A;  2ZKZ A;  4UVA A;  4KIG A;  1ZHF A;  2ZXH A;  3ABU A;  2VQH A;  1B9M A;  4BBR J;  3RKQ A;  1B8I B;  2NYX A;  2FOK A;  3DLA A;  4WWC A;  3JRI A;  3PM1 A;  2BW3 A;  3FXU A;  5K7F A;  5TRD A;  3LA3 A;  1G8X A;  1ZK8 A;  5F0C A;  3J7Z I;  2JA6 J;  2WY7 Q;  4UHT A;  3HRM A;  2PMZ A;  2L5Q A;  4LFU A;  3D0S A;  2KDO A;  1Y8R B;  3M8E A;  1H89 C;  4JP0 A;  4CHU A;  3SDG A;  1R1U A;  1R5H A;  4GCV A;  1JI8 A;  3L2W A;  2W1O A;  5JHF A;  1QZZ A;  1GT0 C;  5F0H A;  1U9O A;  2C6Y A;  2ZJR F;  3PNY A;  1XX5 A;  3L2Q A;  1J7K A;  1YX3 A;  4LG0 B;  1HW1 A;  4LOC A;  3DKW A;  4PSW A;  5HNF A;  1P4A A;  3J80 K;  2PQ8 A;  4G6T B;  3FM5 A;  2D5V A;  4M3E A;  1ETY A;  3I4P A;  1XC5 A;  3IC7 A;  1O3Q A;  2LBF A;  3NRV A;  3OYF A;  4QLC U;  2IW5 A;  1IXC A;  3MFK A;  4CDG A;  1ZR2 A;  4NC7 A;  4FE4 A;  4JQF A;  1WHU A;  2AXL A;  1WQ2 A;  5GAE J;  3FIW A;  3PFI A;  3E0J B;  2NS8 A;  2NNN A;  5D6E A;  2XGX A;  3TDZ C;  4PJL A;  3ZN0 A;  3S14 J;  3HIF A;  2VOD A;  3QPH A;  2VIX A;  4FTH A;  1AWC A;  1FSE A;  1ON1 A;  3FMS A;  1ULY A;  5M3M J;  3RKY A;  3OIQ A;  1FBU A;  3OV8 A;  3MWM A;  2XB5 A;  4MFD A;  1STZ A;  5E3M A;  3FKJ A;  4CZC A;  4D7M A;  5BPD A;  2XAJ A;  4UUV A;  2DAO A;  3E6D A;  4UXN A;  4UVB A;  2CWE A;  2B0L A;  4OIP F;  1O7L A;  2RNG A;  3DPT A;  4ZYG A;  1W4M A;  3Q9S A;  4CH7 A;  5KNL A;  2KPM A;  3H9G A;  3FXR A;  3D5L A;  3W2W A;  4E7L A;  3DP7 A;  3W6K B;  2M0M A;  2X48 A;  1JUS A;  1TW2 A;  2VBW A;  1IUF A;  4BE0 A;  4EAT A;  2JUC A;  4ZTJ A;  5HLI A;  4KUM A;  5HS9 A;  4C2T A;  2FXA A;  2BVL A;  4LK0 F;  4Z2Y A;  1H0M A;  1B6A A;  4EV0 A;  4DJA A;  3F8B A;  3L2V A;  1QZE A;  1OLT A;  2DA7 A;  4XN0 A;  3PJR A;  3DPL C;  2G0E A;  2OA4 A;  1W36 D;  2GZW A;  5CVU A;  5ILS A;  2XRN A;  1U9N A;  2EIN H;  2XSJ C;  4KJZ A;  2IS6 A;  4BDY A;  3RDI A;  3LSP A;  2E36 A;  1N78 A;  1VQ4 I;  3KZY A;  2PFB A;  2L4A A;  3HUG A;  5DM7 F;  5FKO A;  1IRF A;  3LAJ A;  2N8G A;  2CV2 A;  4JYK A;  1FY7 A;  5J1Y A;  2Y30 A;  1NHA A;  3NEU A;  3VEP A;  2DJN A;  1XDS A;  4L9J A;  1NTC A;  4TV7 A;  1VI0 A;  2K40 A;  4FIS A;  1UB9 A;  2JA8 J;  4ENJ A;  3ERM A;  1F4K A;  4BS9 A;  4M6V A;  3OYK A;  3IH3 A;  4ZZL A;  1LFP A;  4I01 A;  4HAM A;  3LSM A;  2ID3 A;  2HVS A;  5HOO A;  1XCB A;  1LKX A;  2DA2 A;  3IV5 A;  1XCV A;  1G2H A;  2VON A;  1SAN A;  2DFF A;  2MC3 A;  4D5C A;  4YFK F;  2JQ7 A;  1I39 A;  3F6O A;  2DTZ A;  2FNP A;  2PLY A;  3WOD F;  1QBJ A;  3E6M A;  4IOA F;  1A04 A;  2L7F P;  4LGW A;  3K4B A;  2UZK A;  2QWW A;  1Z05 A;  2Y2Z A;  3MVP A;  4A69 C;  4HQE A;  3ZMD A;  1BI1 A;  4J19 A;  4OIN F;  4BXU A;  3VPR A;  3COA C;  1U6G A;  2OQR A;  5F1R A;  4E7I A;  1IO2 A;  2EZH A;  2HWV A;  2ZXJ A;  3OL4 A;  1YJW I;  4ABZ A;  3SFZ A;  4ENN A;  1I1G A;  2HXI A;  1JTY A;  5IY5 H;  3BG3 A;  1KU9 A;  2DA6 A;  2ECC A;  1TNT A;  2NXN B;  5HDK A;  2LDU A;  3LQR A;  3L2C A;  1JT0 A;  4ASN A;  1RIO H;  5HS7 A;  2Q2E A;  3FHN A;  2CJJ A;  3ZQH A;  4A6E A;  4AUX A;  3GZ6 A;  1JHF A;  5CVJ A;  2OC6 A;  3EPZ A;  5FGM A;  3KP3 A;  4P96 A;  2YX7 A;  1WCM J;  3CF2 A;  1BL0 A;  3KCC A;  3QYF A;  3BTC A;  4RDU A;  4BYY A;  2Y31 A;  5M5Y J;  5L3F A;  1SMY F;  5LRR A;  3AAF A;  5CPR B;  1E0E A;  1WVR A;  2F4M B;  3GZ5 A;  1HQC A;  2DYR H;  3GF2 A;  1KU7 A;  5JI6 A;  3E1S A;  3UR3 C;  1SFU A;  4KT5 C;  1LDJ A;  1R5G A;  5FB2 A;  3VYU B;  4ZZD A;  2W4S A;  4QIW N;  3MMY B;  2GQQ A;  2HZD A;  3K4K A;  3OR2 C;  2HEO A;  3QAH A;  2JK3 A;  4ZYD A;  3CD6 I;  4HW0 A;  3ZMT A;  4OWR B;  1XGS A;  4Q5S F;  1OQY A;  4A3J J;  5DYM A;  3CUQ B;  3CC7 I;  5JLW A;  3BWG A;  3H1C A;  2VC0 A;  2XVC A;  3GTO J;  3PFY A;  2JA5 J;  4MLO A;  4XBF A;  5LHH A;  3T8R A;  3OS1 A;  4UUT A;  4DW6 A;  1FTZ A;  3RPU D;  3CCV I;  2YU3 A;  2OPT A;  3SZG A;  2HQ5 A;  2X6O A;  1QVT A;  3DBH B;  2V1D A;  1PVE A;  4C9Y A;  3H0G J;  2EJR A;  2LKS A;  3ZP5 A;  1HKT A;  4KIS A;  1Z0X A;  1TT0 A;  2VPL A;  2R7T A;  1BOB A;  2ISZ A;  2DA4 A;  2E2J J;  3S1Q J;  2LF8 A;  4HNU A;  1MBG A;  1RPW A;  1SAU A;  4PGG A;  2HOA A;  4JK1 X;  4IHV A;  2Z1D A;  3JRF A;  4IQJ A;  2GXG A;  3CCQ I;  4B43 A;  1MNE A;  2VOO A;  3G1M A;  4M9Z A;  4GYG A;  3S2D J;  2R7S A;  1V3F A;  1HKQ A;  1O3T A;  4RM3 A;  2MD0 A;  4BQA A;  2VI6 A;  2L54 A;  2Z16 A;  2W24 A;  3ABL H;  2QM3 A;  2Z99 A;  4BJ5 C;  2QUF A;  1G3S A;  1R7J A;  3SFI A;  5FRM A;  2CQN A;  2IPQ X;  3DQV C;  4MTE A;  5J3L A;  4HV6 A;  2K3P A;  1FIP A;  3CUO A;  3M07 A;  3M9A A;  4XKW A;  4JOM A;  2R4G A;  5IYD J;  1EH7 A;  3TKY A;  4NBQ A;  1K79 A;  3GXO A;  1B1B A;  1P7J A;  3WU0 A;  3OYI A;  1X3U A;  2XDV A;  3I59 A;  1SEU A;  3GFL A;  3K0L A;  1TC3 C;  5B5E C;  2EH3 A;  3P5J A;  4IPA A;  2HI3 A;  4DQ2 A;  4EEF G;  3A2K A;  3AG3 H;  1USS A;  4I09 A;  2HDC A;  3QOE A;  3ZQ7 A;  2X6X A;  2JWT A;  2M8E A;  1WGX A;  4R8H A;  1ODD A;  1RZ4 A;  2RNJ A;  2GA2 A;  1LE8 A;  2MD5 A;  1S3J A;  3E7L A;  1D8J A;  2CG4 A;  1X4P A;  2DMQ A;  3C3W A;  5EG0 A;  5IOY A;  3VOD A;  2CV1 A;  5EDN A;  1TL8 A;  2MG4 A;  3CUQ A;  3K1P A;  5DD8 A;  5KHD A;  4E7S A;  1S72 I;  5IP9 J;  4LB5 A;  3GYH X;  3GWZ A;  1FP1 D;  5DM6 F;  4RB1 A;  2CUE A;  5DV5 A;  1YYV A;  1YI2 I;  2DMU A;  4CO8 A;  3WTV C;  3GLL A;  1MMD A;  1Z77 A;  3IWF A;  5LGN A;  4KDP A;  2LY2 A;  4ZH4 F;  2K9S A;  5D4R A;  5F1J A;  4YG2 F;  3P9I A;  2BXZ A;  1FNN A;  2JN6 A;  4D0P A;  4RAF A;  1UHW A;  3GCM A;  1LB2 A;  1O3R A;  4IRG A;  3V7C A;  4L0Y B;  1X1C A;  3CUQ C;  1P4X A;  2I5U A;  5IYB J;  4W97 A;  3KZI C;  2P5K A;  1R6R A;  2QZ8 A;  1IUY A;  2D1V A;  3K4M A;  1IDY A;  2MC4 A;  3IKV A;  2IGO A;  2Q8K A;  5HDN A;  1BBY A;  4IHW A;  3JSO A;  3O6B B;  2L7Z A;  3S16 J;  2FBH A;  2M0C A;  3DBR B;  1UJ8 A;  1GLN A;  3V7S A;  3BOQ A;  4PCQ A;  3HG9 A;  3PNT A;  1TBX A;  2R7U A;  3AG2 H;  4MEY F;  1T6S A;  4XM3 A;  4ESJ A;  3S1M J;  1Z6T A;  3FM3 A;  2GBY A;  2HQA A;  4XRF A;  2VT3 A;  4Y3O A;  4N4N B;  2HYJ A;  4EGY A;  1LEB A;  1X19 A;  4IL6 C;  2IS2 A;  3KYD B;  2MSY A;  3CLO A;  2KP6 A;  4XL9 A;  1AKH A;  1WJD A;  1A36 A;  3PL8 A;  3FBI B;  2V9P A;  2GIZ A;  2VXZ A;  3U9G A;  3FHZ A;  1QZY A;  4U0Y A;  1P4W A;  4V19 K;  2P8T A;  2QEX I;  4P1W A;  3O3K A;  1EKE A;  4RGX A;  2W7N A;  4PSX A;  4ENM A;  5C4X J;  4B1R A;  4WXD A;  3DEE A;  1Z9C A;  4S04 A;  3RZO J;  2DU9 A;  2J5O A;  4CZZ A;  1QRY A;  2EA2 A;  3LST A;  4PZJ A;  1D0X A;  3A03 A;  4OOI A;  4KNY A;  1ETK A;  1YW8 A;  2DYS H;  5ILU A;  2GXA A;  3L9F A;  1VQL I;  3GTK J;  3BCB A;  3LFK A;  4AVZ A;  1PDN C;  2GM4 A;  4N9I A;  4HF2 A;  2WAF A;  1S7O A;  3H9Q A;  1PJR A;  1BC8 C;  2WAQ N;  1KYW A;  3K1M A;  3S3N A;  4F91 B;  1B72 B;  1MBK A;  2CYY A;  2M7B A;  1QO0 D;  4Q48 A;  3HGG A;  1Y1V J;  2A3S A;  3T0Y A;  4MQV A;  1W0U A;  1QNT A;  2P0W A;  4A0X A;  3AL0 B;  3DEU A;  3KIO A;  3W2A A;  4F92 B;  4I7H A;  4PK4 A;  1I3A A;  1XGM A;  4OAY A;  3G2B A;  1K4T A;  4XK4 A;  1IF1 A;  4I0A A;  4YEJ A;  1KYZ A;  2FX0 A;  3DXJ F;  3OSF A;  3ISP A;  3OWT A;  5EZG A;  4DBQ A;  3JRE A;  1LFU P;  3K1N A;  3HOW J;  4E7J A;  3LSR A;  2VBZ A;  2DT6 A;  4V2G A;  4U7D A;  3EDP A;  2DOD A;  1VQO I;  3HYI A;  5K7H A;  2LYC A;  3I54 A;  3K4N A;  1HCR A;  2R92 J;  2WB1 N;  4GGG A;  3SXY A;  3GTP J;  4EVI A;  2QF7 A;  3HBL A;  2M87 A;  1SD6 A;  4WF2 A;  3K2A A;  1ZKG A;  4I76 A;  2HOE A;  1BR2 A;  2ECB A;  4A3E J;  2ZFW A;  3HSR A;  4XKB A;  1I6H J;  2OTL I;  4DYQ A;  4XKC A;  2IVM A;  4M6Y A;  2XPW A;  4Y7N J;  1FYL A;  1HF0 A;  3CJR B;  3O8G A;  1O4X A;  3RIR A;  2EWN A;  1T8I A;  3K6G A;  2ICW G;  1IXS B;  5IP7 J;  5AIQ A;  1BN5 A;  4CYC B;  1R00 A;  4YIR X;  2P6S A;  5FRN A;  2DT5 A;  2HNH A;  1YOV B;  3JAM Z;  1ENH A;  4PGH A;  2F6C A;  4NDL A;  3OY9 A;  2DXI A;  1QPI A;  2WA0 A;  3EQL F;  1Y1W J;  2EQR A;  4IF4 A;  3ESW B;  1I1S A;  2IA2 A;  1XGN A;  4CGZ A;  5D5X B;  4XLC A;  2NS0 A;  2DFH A;  4WXH A;  5KK1 A;  4O6J A;  2XAQ A;  5F64 A;  2CFX A;  1GVD A;  1A31 A;  2F2E A;  3LA2 A;  4ON0 A;  4XNF A;  3L09 A;  3H5R A;  5HDG A;  4A0Z A;  3SYT A;  4Y13 A;  3H3Z A;  3SZP A;  2HYG D;  4C3J J;  3HOV J;  4MIM A;  4RGS A;  2KL4 A;  2JRM A;  1BM9 A;  5CQG A;  2IRF G;  2JMW A;  3S2H J;  1U5T B;  5D5V B;  4DIQ A;  3F8M A;  1D1A A;  4UNO A;  1YE9 A;  2WB1 A;  5DUK A;  2RRE A;  2YU9 J;  1BOA A;  1LQ1 A;  1KA8 A;  4B44 A;  1DP3 A;  4JX5 A;  2OV7 A;  1T39 A;  1XB4 A;  3KFW X;  1GDT A;  2GIV A;  2DN0 A;  1LEA A;  2V1X A;  4EJV A;  4MQ9 F;  3I64 A;  5F0F A;  1W7P D;  2ME0 A;  3AL0 C;  5DCM B;  4NHJ A;  1IAW A;  5J47 A;  4II2 A;  3BG5 A;  4A5M A;  2QA4 I;  1LVK A;  1NG7 A;  2EV5 A;  4BY1 J;  2KRF A;  1BC7 C;  3VYR B;  3BLY A;  3WG7 H;  3HC7 A;  5A2Q K;  4M72 A;  4B47 A;  2A05 A;  2NOG A;  1RR8 C;  2V6C A;  2CQ7 A;  2VJ5 A;  2VB6 A;  2EK5 A;  1K6O A;  3UNG C;  3ZQQ A;  2RVC A;  4HZF A;  4LIU A;  1RR7 A;  2FBI A;  1KZH A;  4NB5 A;  4J00 A;  4D9J A;  2A6T A;  2CW8 A;  3JRH A;  2R7V A;  1RUO A;  3HKZ A;  5FFX A;  3G73 A;  1S9H A;  4I2O A;  3WE3 A;  1SD5 A;  2R5Y B;  1FSH A;  5BPI A;  3DF8 A;  2WV0 A;  2EFP A;  2RAE A;  1WJF A;  3OYL A;  1DPU A;  1FLI A;  3SJM A;  1QA6 A;  2R7Q A;  2ZJ2 A;  1OPC A;  2KIF A;  3HPH A;  5FD5 A;  4YFN F;  1FOK A;  2QYO A;  1IN8 A;  1IV8 A;  3HRS A;  3MZY A;  1T0F C;  2BE5 F;  4U0W A;  3WU2 C;  2GWR A;  5LEJ A;  3VB2 A;  3KP2 A;  2LG4 A;  2CQQ A;  1ERD A;  1HA8 A;  2XAH A;  2KKO A;  1JJ8 C;  4HPQ A;  4CCO A;  2EFN A;  4A5N A;  4AVP A;  2NVU B;  3F8N A;  4G7Z F;  4N0B A;  5J8C A;  1M1E B;  1T95 A;  1J9I A;  2R7W A;  3P9C A;  5EYR A;  3H3V K;  2O0Y A;  2IGN A;  3I4M J;  3DEW A;  2CUJ A;  3I56 I;  2A5W A;  2WV1 A;  3CCM I;  3JRG A;  1JUM A;  3TOA A;  2F5F A;  4J01 A;  4RLF A;  5LD2 C;  2DK5 A;  1XS9 A;  1MH4 A;  2OCE A;  1HBX G;  2QEN A;  4Q4Z F;  3FF5 A;  3HTU A;  3Q9V A;  4NQW B;  2L2O A;  1PUE E;  3CMY A;  1MDM B;  4BHB A;  2CRG A;  4P55 A;  3BDD A;  1Z21 A;  2NVY J;  1UCR A;  2RQQ A;  3JTG A;  5H20 A;  3LSJ A;  5LEK A;  5HLG A;  1KGS A;  4F55 A;  1U5T C;  2PN6 A;  2E2I J;  2MH2 A;  2QVO A;  2DDB A;  2EZL A;  4KIB A;  3J7Y J;  4IX7 A;  3OYB A;  3ZRG A;  3F8C A;  4AC0 A;  4IO9 F;  1N75 A;  2RDP A;  1TQI A;  2HYF A;  5L3C A;  3R61 A;  3KP7 A;  3FK7 A;  1VND A;  1JKP C;  1DU0 A;  2E1M B;  4C30 A;  2K4B A;  2QQB A;  4IZZ A;  3CDH A;  3G4S I;  1J0R A;  2FA5 A;  1SFE A;  2GXB A;  1K83 J;  2MBF A;  2KHM A;  3BC8 A;  4B3X A;  4N9H A;  3EUH C;  1U0J A;  5JR3 A;  5ILV A;  2XPV A;  2XIG A;  1D1C A;  5HLT A;  2IT0 A;  1REP C;  2KRC A;  3RKX A;  2K9Q A;  2E19 A;  2TCT A;  4R1H A;  2E35 A;  4KIT B;  5LRS A;  4PFP A;  3BR6 A;  2IGM A;  5FLM J;  3EUA A;  5K5Q A;  1B8I A;  2EZI A;  1IDZ A;  3IUO A;  1A35 A;  4GDF A;  1ZTR A;  5E8I A;  4WCG A;  2V1N A;  1IN6 A;  2JA2 A;  2K4J A;  2EIM H;  2OUM A;  2CO5 A;  4AYB N;  1IN7 A;  4ZJZ A;  3BPV A;  3C2H A;  1APL C;  1OKR A;  1WH7 A;  4FAS D;  1KON A;  2LSO A;  3JCU C;  4LIT A;  5AON A;  1ZG1 A;  2K9N A;  3RKW A;  4D5F A;  4R79 A;  3LA7 A;  2ELH A;  4I02 A;  2OAZ A;  3GTJ J;  1BR4 A;  2F5E A;  3K7A J;  3S15 J;  2Y9Z A;  1W5T A;  4RB0 A;  2E1N A;  3CMM A;  4BU2 A;  5J4Y A;  1Z3X A;  4GYI A;  1P6R A;  1QVU A;  3RSN A;  4X1E A;  3B02 A;  4NQW A;  3HOS A;  1MBE A;  3HRU A;  3I53 A;  4I99 C;  2LY1 A;  1YS6 A;  1OFC X;  4LG0 A;  4RB3 C;  2R7R A;  1EA3 A;  1DQU A;  1DP7 P;  4XRS G;  1YLF A;  3A4C A;  2DOE A;  1FPQ A;  2JT1 A;  1H9G A;  4ITV A;  4PUS A;  5C3E J;  2HQN A;  3J7A O;  2BXY A;  2QQ8 A;  1R71 A;  2ZO4 A;  3M8J A;  1JKQ C;  2IGK A;  2IP2 A;  2JVG A;  2ZXI A;  4FT8 A;  5LGU A;  1K7A A;  1HW5 A;  3EET A;  4LD5 A;  3KYC B;  5FKM A;  1ZYR F;  5IYC J;  2MA3 A;  1SD4 A;  3K4L A;  2FEZ A;  1OCZ H;  4XLH A;  3HB9 A;  3H0D A;  1XSV A;  4EMS A;  5FLX K;  4RAG A;  3CCU I;  4HRI A;  3MZ8 A;  2Z2S B;  5E8G A;  3FKI J;  3IHU A;  3I58 A;  3S8P A;  4ZC3 A;  4QSH A;  5H2F C;  3Q0W A;  4PJJ A;  2Z33 A;  1DGR M;  4BUP A;  5TIS C;  1HDP A;  2RQP A;  4L9N A;  5FKK A;  4AYB A;  2KZV A;  3FXK A;  1BW6 A;  4PFO A;  3WU1 B;  4IHS A;  4F7Z A;  1BI0 A;  1AU7 A;  3ZMS A;  1J5Y A;  2VOP A;  1MJ9 A;  2EFQ A;  4N4O B;  3SDB A;  4LLL A;  5L3D A;  3TO7 A;  1VQ7 I;  2E1M C;  5IT9 Z;  1ETV A;  3I5U A;  5B66 C;  3Q5F A;  2E60 A;  3J81 Z;  1HXD A;  3G1O A;  4BJT A;  1ITY A;  2XSD C;  1Q1H A;  2HXO A;  1ZLJ A;  3FXQ A;  1UHS A;  3OYA A;  2V9K A;  1ZN2 A;  3IRR A;  3TW7 A;  4XID A;  1TWA J;  4BHP A;  1XGO A;  1EJ9 A;  4HF0 A;  4HLX A;  3RPQ A;  4BE1 A;  3B73 A;  4GO1 A;  4QPO A;  2XHK A;  4ZDL A;  4CCN A;  1RC9 A;  2Y75 A;  4BXF A;  4IRH A;  1V5G A;  2LH9 A;  1NH3 A;  4GFB A;  1P7I A;  2LC2 A;  3FDY A;  3M1C A;  1OYY A;  1ACI A;  3DV8 A;  2VPR A;  4HST A;  1DDN A;  1A6I A;  1G3W A;  2A6H F;  1DGW Y;  2JTV A;  2ETH A;  3F9K A;  1IW7 F;  3R60 A;  2VJ4 A;  4YII A;  1ZR4 A;  1HW2 A;  1LVA A;  2TDX A;  2FSW A;  1O7F A;  1WZ2 A;  3T8T A;  2VUM J;  2JA7 J;  4KN4 X;  2TRT A;  2E1O A;  4CA0 A;  2UWM A;  4S0H B;  4Y17 A;  5E79 C;  1R4M B;  1WH5 A;  3HZJ A;  1ZGW A;  3CC4 I;  2FU4 A;  3S17 J;  3RCO A;  2BZT A;  2HKO A;  2Y0S N;  2X1E A;  2WC2 A;  2L01 A;  3I9V 2;  3F21 A;  2ZJP F;  2X1D A;  2O61 A;  3F3X A;  4L0Z B;  4FX0 A;  1W7P B;  3BTJ A;  3ZQL A;  1ZQ3 P;  4O3M A;  1YRN B;  3KYL A;  3FMQ A;  1XN7 A;  3I71 A;  3MKL A;  2XGC A;  2HDW A;  1U2W A;  3S93 A;  4L9V A;  1RES A;  2MYS A;  4YIF A;  4BEH B;  4UY8 I;  1LPQ A;  1U8B A;  1IRZ A;  2Q0O A;  3LSK A;  4HOB A;  3ULQ B;  2HTJ A;  3BZK A;  2UUZ A;  3E97 A;  5ICC A;  5E3L A;  2HOT A;  3HOY J;  4XOP A;  2L3D A;  5H6Q A;  4PJN A;  4LLN A;  4A93 J;  4G7H F;  1WJE A;  4M73 A;  2KQR A;  4C2M J;  4NC6 A;  1RUN A;  2VQG A;  2O6G E;  1KQ9 A;  3H3U A;  3TO9 A;  3F72 A;  3E5Q A;  3U21 A;  2D2W A;  3GEZ A;  3B6C A;  2HPI A;  1E17 A;  1XG1 A;  2HS5 A;  5E1Z B;  2L9N A;  4E6K G;  3HOZ J;  4BH9 A;  2D1H A;  2XF6 A;  1L3L A;  4MTD A;  5HVQ C;  2L4M A;  4XIC A;  1OYI A;  1MMA A;  1OCC H;  4RMN A;  2H8R A;  2XGD A;  3JSP A;  1HKS A;  3JRD A;  2Y0S A;  4DYR A;  3VYT B;  2ZCW A;  3CO7 C;  2CMP A;  3LSG A;  2BV6 A;  4HQM A;  1TQM A;  4B09 A;  1GV5 A;  1V4R A;  2FNA A;  2FOW A;  2FJ1 A;  2FML A;  2HZT A;  1YIO A;  1YW7 A;  2GOM A;  3BQZ A;  3NAU A;  4DOZ A;  4BE2 A;  3K10 A;  2W82 A;  4LK1 F;  1PUF B;  5EJC A;  2HPM A;  2CH0 A;  4G7O F;  3DBL B;  1GVJ A;  5LHI A;  2X1C A;  4WK8 F;  2B9S A;  2EIK H;  2JPB A;  3ZQI A;  5KVR A;  3H35 A;  2COM A;  3R0J A;  4YEL A;  2PEX A;  1W5C C;  2K02 A;  2W84 A;  1ORK A;  2XAU A;  1R36 A;  3BJA A;  4BQN A;  2JZY A;  5BS6 A;  4P9U A;  2JSP A;  2E71 A;  5DS9 A;  2P4W A;  1QHH D;  3JW4 A;  4M6X A;  2W85 A;  1X1D A;  4KMU X;  3BJ6 A;  4ENK A;  1K78 B;  5F6F A;  1SFO J;  1YS7 A;  2R3S A;  3PIO F;  5ICF A;  2VE8 A;  2XV4 S;  3K2Z A;  3OS0 A;  3ZQC A;  5FD6 A;  2E34 A;  2NNY A;  1J75 A;  3M4O J;  4HNT A;  3FXM A;  2YR2 A;  4G8X A;  1WPK A;  4UUS B;  3D5S C;  3BCA A;  2RC4 A;  4H0E A;  4IOC F;  1XDU A;  2ZBK A;  3HSF A;  2QQA A;  4CUG A;  2CGP A;  5J6X A;  2A07 F;  3QU6 A;  2ZME B;  2GAU A;  1FIA A;  5FRO A;  2STW A;  5EZH A;  1BI3 A;  2V7F A;  5LHG A;  2CSO A;  5L3G A;  3KET A;  2OF7 A;  5EEH A;  3X2Q H;  4CXF A;  2MW8 A;  1GV2 A;  2KT0 A;  3WTX C;  3OYE A;  2R5Z B;  2M9H A;  1QQI A;  2NVX J;  4KFC A;  1W5S A;  2RKH A;  2ZNZ A;  5FJ8 J;  4DZP A;  1MBH A;  3L1P A;  4Z6Y A;  2OZ6 A;  2PBI A;  1G3T A;  1MBJ A;  5J40 A;  2V26 A;  1P9Q C;  1EV7 A;  2F5C A;  2LNB A;  1MSF C;  2MAB A;  1ETQ A;  2A61 A;  3Q0V A;  1ETO A;  3QYE A;  1YJ9 I;  1YJN I;  4XLN F;  3EYI A;  2VN2 A;  3FIS A;  2NAZ A;  3CC2 I;  1I3Q J;  2EB7 A;  1Y39 A;  3QPS A;  1QU3 A;  1CF7 B;  3IL2 A;  1PP7 U;  2ELK A;  5GPC A;  1EF4 A;  4HNV A;  4ANJ A;  2L7K A;  2WTE A;  2LD5 A;  4HA8 A;  2VXD A;  2KFD A;  2EV0 A;  3DPU A;  3K70 D;  4FX4 A;  1YIJ I;  1Y0N A;  2VBY A;  4F52 A;  3OYN A;  2IS1 A;  1MBF A;  2JPC A;  2B63 J;  1Y56 A;  1KQ8 A;  1YTY A;  2M1B A;  1FMV A;  3DTE A;  3RQI A;  2JVH A;  4OAZ A;  4U0V A;  1SC7 A;  3WTU C;  2DA3 A;  1FTT A;  2FUG 2;  4FCY A;  4I98 B;  2H6C A;  2DPU A;  4B4C A;  2V9V A;  5FKN A;  5EGO B;  4HDU A;  1V5E A;  4IKF A;  4X0G A;  1IV6 A;  4E7H A;  3A02 A;  4UUS A;  1J59 A;  4A3G J;  6PAX A;  5D5W B;  4FQG A;  1P92 A;  3HSE A;  3A01 B;  3A1Y A;  1OR7 A;  3BJO A;  3FXO A;  2I8D A;  5FLV A;  2QBY B;  3HHG A;  4DGW B;  3F0C A;  2M30 A;  1QPM A;  4F3Q A;  5BMZ A;  2HDD A;  2A5Y B;  5DDG A;  2CS3 A;  3WHB A;  3DKY A;  4BAC A;  4HX8 A;  1MSE C;  1TTY A;  1UG2 A;  2XPU A;  1R1T A;  5KAF C;  2R5Z A;  3U2R A;  3V42 A;  3M8F A;  1Y0U A;  2H8W A;  2VL8 A;  1D5V A;  3W6V A;  2HGC A;  1FOY A;  3LMM A;  4HSR A;  4RGR A;  1BW5 A;  1MD0 A;  4AWX B;  2R7X A;  1OR7 C;  1T56 A;  3HTS B;  1B59 A;  2ZME C;  5HNH A;  4F93 B;  4KA4 A;  1QHG A;  1FYM A;  2XKP A;  3J7A Y;  3S3M A;  1MKM A;  2P6T A;  1CF7 A;  3OSG A;  2EZK A;  2LKX A;  5FFZ A;  1LFB A;  1IN4 A;  2M4G A;  3E3V A;  1WFX A;  1CGP A;  3KX2 A;  1ZGA A;  2PJR B;  4RBO A;  1KU3 A;  2LFB A;  5J1R A;  4A6D A;  3BG9 A;  2DPD A;  5K5R A;  3KE2 A;  2ZNY A;  1F1Z A;  3VSL A;  4BAY A;  2K3F A;  3ZR8 X;  5BNG A;  1JHH A;  2LVS A;  4C3H J;  2NRA C;  2MH9 A;  3ZQF A;  4XRM A;  1B72 A;  3ECH A;  2VE9 A;  3IRQ A;  4FET A;  1OCO H;  3HKZ N;  3DU5 A;  4GXO A;  3IWZ A;  1UEL B;  4EM1 A;  3W2V A;  1X1P A;  2EIJ H;  2F4I A;  3GUD A;  1TLH B;  1ETW A;  4L5J A;  4IHT A;  3V8L A;  4G12 A;  2DQR A;  2XGE A;  3PO3 J;  3GTQ J;  2BEO A;  1YIT I;  3ML6 A;  1VZ0 A;  3KPH A;  4U87 A;  1E2X A;  3QP5 A;  1AHD P;  1JKR C;  3ASO H;  1S8N A;  3WGI A;  2ID6 A;  2ZXW H;  2HFH A;  2ME6 A;  3LSH A;  4G9Y A;  1F5T A;  2KMU A;  3A01 A;  3RYP A;  2MLG A;  5K7Z A;  1W1W E;  3NWT A;  5GTH C;  2BW3 B;  2PG4 A;  4CIC A;  1HDD C;  2QBY A;  1H88 C;  1E3H A;  4ZYH A;  1WJA A;  3KEO A;  2XB0 X;  2L7M P;  3BG6 A;  3PNV A;  3DTK A;  3OYC A;  3PQK A;  3ZN1 A;  2M5W A;  3O8H A;  5GTI C;  3OIO A;  5F27 A;  1UAA A;  4XOT A;  4RAY A;  4M3B A;  4E7K A;  2V6E A;  4A12 A;  1TW3 A;  4L9T A;  2ZFU A;  1JKO C;  2E1C A;  4AM3 A;  1NG6 A;  3B6A A;  1XMA A;  2O03 A;  1K4S A;  2AXT C;  3JRC A;  1T0F A;  4A3K J;  2STT A;  4EGZ A;  1XMK A;  2WY8 Q;  2DOF A;  5L3B A;  3MD2 A;  1MH3 A;  3ZPL A;  1ETX A;  1MNM C;  1RNL A;  4CYD A;  4RA2 A;  4CYC A;  3A0H C;  2D45 A;  2O9L A;  5ICE A;  3CJN A;  1FC3 A;  4ZYE A;  5AIP A;  3BY6 A;  1MIJ A;  3ECO A;  5H6R A;  1HLV A;  1FP2 A;  2CQK A;  1WRJ A;  2E7W A;  1WKM A;  4QPQ A;  4WXC A;  2E2H J;  1IRX A;  2DDA A;  4RS8 A;  3HOU J;  2EFO A;  5D6F A;  3QQA A;  3CF5 F;  4JBA A;  1ZGJ A;  2V4J C;  5EEA A;  3AKZ A;  2DO7 A;  1W0T A;  4A0Y A;  1G3Y A;  3FXL A;  2K86 A;  3OYM A;  1EH6 A;  5CQE A;  2K5C A;  2WAD A;  2LMD A;  1K61 A;  9ANT A;  3CJQ B;  4E4H A;  3GX4 X;  1F43 A;  2MFZ A;  2CW7 A;  4LB6 B;  3BR3 A;  5E20 A;  4U7B A;  4DNC A;  2BYV E;  2XRL A;  1U5T A;  3RPU A;  3CQZ J;  4A3L J;  1VQN I;  2H6B A;  4OU0 A;  3I0T A;  3ONQ A;  1FOX A;  4M71 A;  3ZGK A;  5DCF A;  4BBS J;  4KMF A;  4BHC A;  4EJU A;  4YRV A;  2DBB A;  1I5Z A;  2IAI A;  2Y69 H;  1XSX A;  5IT3 A;  3CZ6 A;  3I4N J;  5BOX A;  1JJ6 C;  3HL2 A;  1ZG5 A;  1V54 H;  1WJC A;  2DW4 A;  4L5E A;  5DCM A;  4P9F A;  3K69 A;  5C44 J;  4FHT A;  2IA1 A;  4K2E A;  2YPR A;  4LLG F;  1L0O C;  3NAR A;  1TZL A;  3PIP F;  2ADU A;  3OOU A;  3V4G A;  3WTS C;  3EUH A;  1B9N A;  2FBK A;  4Y52 J;  1V5F A;  5DTD A;  3PO2 J;  2QSH X;  4CCJ A;  3UKG A;  3PSI A;  1OIS A;  1S29 A;  2LF7 A;  3LAP A;  1JE8 A;  1AA7 A;  1HSJ A;  1POG A;  5L3E A;  3HUG B;  3C2B A;  4DYC A;  1TWH J;  3G3Z A;  2WWY A;  1VQ9 I;  1V55 H;  2R5Y A;  1C0W A;  1H9T A;  2PI0 A;  3I3L A;  5CVV A;  1YO5 C;  2QCO A;  2HVQ A;  1ON2 A;  5M5W J;  3WTZ A;  4LG3 A;  3CME I;  4I6Z A;  2VJI A;  3DKX A;  2LLK A;  2AHQ A;  4MEX F;  1U8R A;  4XLF A;  5M5X J;  4OIR F;  4HV5 A;  1F36 A;  1E3O C;  2IA0 A;  3GTG J;  2VKH A;  1QGP A;  2ESH A;  2K7L A;  3OIP A;  2LOO A;  2VQL A;  2DCE A;  2AO9 A;  3HGY A;  3PSF A;  3QWL A;  3GFI A;  5B1B H;  1UFM A;  1X1A A;  3BTI A;  1RKW A;  2NS7 A;  2VBX A;  4P5O A;  4G6D A;  1OYW A;  2FE3 A;  2M8G X;  1MGT A;  1Z3Y A;  4MNU A;  3LL7 A;  5E1X A;  2K27 A;  3TDU C;  1IG7 A;  4H4K C;  3E6C C;  1BR1 A;  4L18 B;  2DMT A;  1YFH A;  3ABK H;  1R5I D;  1FYK A;  1IN5 A;  4A3M J;  4ZTF A;  1FOW A;  3P7N A;  3M3Y J;  2VJJ A;  5CLS A;  4XOR A;  2QSG X;  4HEA 2;  5D8K B;  1R49 A;  2E5N A;  2Q2E B;  2R7D A;  3WGH A;  3MN2 A;  4D7N A;  3F22 A;  1MDM A;  5GAG J;  5J8F A;  5E3N A;  2DMP A;  1ZAR A;  3NWS A;  3AG4 H;  1BJA A;  4G6Q A;  1EH8 A;  3KLO A;  5DUI A;  2O8K A;  2O7O A;  3FZV A;  2OBP A;  1NK2 P;  1Q1V A;  3DCF A;  4C2U A;  2OJE D;  4PDK A;  3JRB A;  4A3B J;  2Y48 A;  3PUF A;  5EF6 A;  1YW9 A;  3MAJ A;  2XRO A;  2H94 A;  2FMY A;  1LDD A;  2XAS A;  2L0K A;  4UVC A;  5E1W A;  4LIV A;  3IKT A;  1U78 A;  1WI9 A;  1IZ1 A;  3O2P E;  3HJE A;  4EQQ A;  1LJ9 A;  1LUJ B;  2K85 A;  4UB8 C;  5HLH A;  4WX9 A;  3MKZ A;  1FZP B;  4XLE A;  3V8J A;  2UXN A;  1OCP A;  5KCM A;  2MLK A;  3LFU A;  1HOM A;  3CLQ A;  2DJI A;  4KYW A;  3S32 A;  3BZC A;  4ESB A;  2OZU A;  3MEX A;  4LJZ F;  2V79 A;  1VQK I;  2YUS A;  3CCJ I;  3A0B C;  1Z6R A;  4CCL A;  3HEF A;  2FD5 A;  4IJA A;  1BJZ A;  3G71 I;  4IHY A;  2JJ7 A;  2YSR A;  2LKP A;  1AOY A;  2X0L A;  2DLL A;  2A68 F;  1BIA A;  1FWZ A;  2GLO A;  2L02 A;  2CU7 A;  4ESF A;  1WSU A;  1NK3 P;  1RKT A;  2CUZ A;  1BI2 A;  4HG2 A;  1G59 A;  1FT9 A;  2NVT J;  2ZSH B;  4NNJ A;  3IP4 B;  1SFX A;  1F9N A;  3GTM J;  1HST A;  3CTA A;  4XKV A;  1HC8 A;  1ZLK A;  3W3C A;  4HBL A;  4HX7 A;  4UV9 A;  3T5X A;  1O3S A;  5TGT A;  3PUB A;  3BR5 A;  1Z91 A;  2QSF X;  4ETS A;  4KT6 A;  5LLQ A;  3JAM K;  4IVN A;  1SVL A;  3DWL E;  5JFR A;  2HR3 A;  4V2F A;  1T98 A;  2ZC2 A;  1S6L A;  2A69 F;  1SD7 A;  3HXL A;  5ERI A;  3KZZ A;  2JSC A;  1RET A;  4M3D A;  1WJ5 A;  3FX3 A;  2GA1 A;  3PQJ A;  5JHU A;  5IPA A;  2X4H A;  1TWG J;  3I59 B;  1SFK A;  3K70 C;  1TWC J;  4IXA A;  3WE2 A;  3VSK A;  1R4N B;  3BG7 A;  1D1B A;  2IXS A;  2OU2 A;  3ABM H;  2G7U A;  3QOD A;  3VYS B;  1H8A C;  2IJL A;  1ONV A;  2Z5U A;  1I6X A;  2MGQ A;  1ZEL A;  3GTL J;  3MQ0 A;  1LE8 B;  2KRH A;  3TP3 A;  2XKO A;  3R0A A;  5D8L B;  3HHH A;  5EG0 B;  5CYV A;  4KN7 X;  5BQT A;  4A3D J;  2DTR A;  1T33 A;  2DQL A;  4KIC A;  5CVI A;  3TGN A;  4I0B A;  3L2R A;  1VQ5 I;  4RAZ A;  3SZT A;  3DLL F;  2HOS A;  3KP5 A;  2KJB A;  3WTW C;  3N97 A;  2G7H A;  1WWX A;  4EJT A;  5D5U B;  4EM0 B;  1D8K A;  2JUG A;  1X2N A;  1VQ8 I;  4M9X A;  4AIJ A;  4B8X A;  3CCY A;  3E5X A;  3TO6 A;  4HX4 A;  1MW7 A;  5HS8 A;  3QP6 A;  2KZG A;  4OMY A;  3CMA I;  2AS5 F;  5IP6 A;  4X6A J;  3WHC A;  2DA1 A;  3RTR A;  1JTX A;  3AFH A;  3MCZ A;  2RGV A;  1S5L C;  5A2Q Z;  2DFI A;  1TWF J;  1VFC A;  3SHF A;  4EJO A;  1DU6 A;  5GAH J;  2P5L C;  2EA4 A;  2EIL H;  2B7E A;  3WGG A;  5IOZ A;  2R93 J;  2X51 A;  5CJ9 A;  2VLA A;  2G9W A;  2QKL B;  5GPA A;  3SEZ A;  2Z9O A;  2GOX B;  5D4S A;  4XLP F;  1TP4 A;  4CSW A;  4FE7 A;  3IH2 A;  2PX9 A;  1LDK B;  2ZB9 A;  1D0Y A;  3OYH A;  3MZH A;  5B1A H;  1MMG A;  3KP4 A;  1KQ0 A;  2QLZ A;  4II3 A;  5KAI C;  2ACJ A;  4HYE A;  3CCS I;  3LQQ A;  1D5Y A;  4LMY A;  2F48 A;  2EFW A;  2XF5 A;  4B48 A;  2EBI A;  1AKH B;  4HF1 A;  3N05 A;  4DZJ A;  2LY9 A;  2VC1 A;  3CES A;  1VQ6 I;  2X85 A;  1YG2 A;  3E6B A;  1UHM A;  2E7X A;  2XAG A;  2M4K A;  1BIB A;  4RB2 C;  1VQM I;  1YQA A;  5FO5 A;  3H5N A;  3TW6 A;  1GUU A;  2ESN A;  3H5A A;  4UV8 A;  3BR1 A;  4S05 A;  3GBG A;  5B3S H;  2Y9Y A;  1UG0 A;  2CV0 A;  1IRG A;  3WTY C;  2CW0 F;  3VDX A;  5E3O A;  1W7P A;  2DFE A;  4MO7 A;  5JLX A;  1N77 A;  3BTL A;  1YRN A;  1TT5 B;  2BY1 A;  2Q1Z B;  3GLX A;  2M3A A;  1SVO A;  1X58 A;  1OJL A;  4BGD A;  3G6E I;  2ZJQ F;  4IEJ A;  2XC7 A;  1VQP I;  2NOJ B;  2FRH A;  4IRI A;  3CO6 C;  4BEH A;  3H9J A;  3OYJ A;  1D3Y A;  3OYD A;  1X3W B;  2HVR A;  2RN7 A;  3CCR I;  2KJC A;  4XN3 A;  3U1K A;  1UST A;  3LWF A;  3LNQ A;  1ZH5 A;  5LGT A;  3J80 Z;  3HOX J;  4BNC A;  3JR9 A;  3F23 A;  2K9M A;  3NQO A;  3S1N J;  3GFJ A;  5F08 A;  5HOD A;  3CCL I;  2DI3 A;  3MKY B;  4Y15 A;  3QPL A;  4O5V A;  3WG9 A;  3BQY A;  3DFG A;  4ZDO A;  2DMN A;  1ZRE A;  5ICG A;  4Q47 A;  3OOP A;  4MFE A;  3TMO A;  1I27 A;  2X9D A;  1R1V A;  4ZDP A;  3RI4 A;  3ABT A;  4MHG A;  1ZRC A;  2KIM A;  1T38 A;  1XMX A;  3IAM 2;  2W00 A;  3CCE I;  5E17 F;  2OCC H;  2M45 A;  2LTP A;  3P9K A;  3BP8 A;  4IQ4 A;  1GXQ A;  3RJP A;  2R7Z J;  1OMI A;  1TQP A;  4XRS A;  5LFA A;  1T2K A;  2YS9 A;  1S7A A;  3M1E A;  1MZB A;  2BY3 A;  2OTJ I;  2LR8 A;  3JRA A;  1GHC A;  2F5V A;  2BY2 A;  3ZMU A;  3QOP A;  1PUF A;  4ZYA A;  5F04 A;  3CDI A;  4NC8 A;  3MKW B;  2W57 A;  3GVA A;  3HRT A;  3QPT A;  2KLO A;  3TQN A;  1SAX A;  3FK6 A;  2VQC A;  2IEK A;  1A5J A;  4JX6 A;  4L5I A;  3U1D A;  3C2G A;  2OQG A;  2DT7 B;  1T08 B;  3KP6 A;  2AQF A;  2LRE A;  5CVR A;  2Z3Y A;  5CKT A;  1BA5 A;  4MGR A;  2XF7 A;  1UMQ A;  3BPX A;  3C7J A;  4RM2 A;  1KU2 A;  2DA5 A;  4RGU A;  3QRF F;  4Y33 A;  3HPG A;  3TP0 A;  3BRO A;  2VT2 A;  3TOB A;  3C18 A;  1K78 A;  3GW2 A;  1IXR C;  1JGG A;  1GXP A;  3CP2 A;  3OL3 A;  1J09 A;  3Q0U A;  4HLY A;  1FJL A;  1S7E A;  2M7A A;  3V7R A; 
#chains in the Genus database with same CATH homology
 3JTH A;  2HQR A;  3ROU A;  3REO A;  5EEG A;  2PMH A;  5DD4 A;  3R4K A;  1JGS A;  5K1Y A;  1ZAO A;  3N4M A;  3SQN A;  2XAF A;  1DPR A;  4QWQ A;  2J5P A;  2OD5 A;  2ZME A;  4M9S A;  3R6S A;  4AIH A;  5E18 F;  5TJJ A;  5FLX Z;  2RV8 A;  2FQ3 A;  3HOT A;  4OIQ F;  1R22 A;  1FX7 A;  1PP8 F;  3GFM A;  5IT9 K;  2DK8 A;  3J81 K;  4EM2 A;  1MJB A;  3WTT C;  2P5V A;  3VOE A;  2R7F A;  4XSZ F;  1G4D A;  1DUX C;  2HTS A;  1SMT A;  3KEQ A;  1XSD A;  2ISY A;  3F6V A;  3ZMZ A;  2PJP A;  4AD9 A;  3RYR A;  1O57 A;  1LNW A;  1VTN C;  4G94 A;  1RI7 A;  1ZRD A;  2Y0M A;  1U3E M;  3KLN A;  1R23 A;  1G6N A;  1ZRF A;  3QU3 A;  1Z1D A;  4U88 A;  2JRT A;  5JVT A;  2XUB A;  2A6E F;  5K5O A;  2YX4 A;  3EYY A;  4A2U A;  3F8F A;  3H92 A;  2BBY A;  2PMU A;  2V1U A;  3FMR A;  3VFZ A;  1R58 A;  3C1D A;  1JXS A;  4OIO F;  2QQ9 A;  3GO5 A;  3ZMV A;  2HKX A;  5ED4 A;  1B4A A;  3L00 A;  1P2F A;  4XSX F;  3S2W A;  5DEQ A;  2O3F A;  4KIF A;  4HDV A;  3M7G A;  2W25 A;  2P7V B;  3ERE D;  2H09 A;  1MJA A;  1FBQ A;  1J2X A;  3E5U A;  2F5D A;  2H27 A;  1FBS A;  3BZ6 A;  2P7C B;  2BGC A;  4EJW A;  1XD7 A;  3FWE A;  4M74 A;  4OMZ A;  1TNS A;  3T1B A;  3K9T A;  2UXX A;  4YFX F;  4E70 A;  5LBQ A;  1ZG3 A;  2KIU A;  1Z7U A;  4AIK A;  2O8X A;  3ELK A;  2FF4 A;  3V8K A;  3W6J B;  3L7W A;  2EV6 A;  2ZKZ A;  4UVA A;  4KIG A;  1ZHF A;  3ABU A;  1B9M A;  2NYX A;  2FOK A;  4WWC A;  3FXU A;  5TRD A;  3LA3 A;  4UHT A;  3HRM A;  4LFU A;  3D0S A;  3M8E A;  4CHU A;  1R1U A;  1R5H A;  4GCV A;  1QZZ A;  2C6Y A;  1J7K A;  4LG0 B;  1HW1 A;  3DKW A;  1P4A A;  3J80 K;  2PQ8 A;  3FM5 A;  3I4P A;  3IC7 A;  1O3Q A;  3NRV A;  4QLC U;  2IW5 A;  1IXC A;  3MFK A;  4CDG A;  4JQF A;  2AXL A;  1WQ2 A;  3PFI A;  3ZN0 A;  5D6E A;  2NNN A;  3TDZ C;  2XGX A;  3HIF A;  2VOD A;  3QPH A;  1AWC A;  1FSE A;  1ON1 A;  3FMS A;  1ULY A;  3RKY A;  1FBU A;  3OV8 A;  3MWM A;  1STZ A;  5BPD A;  2XAJ A;  4UUV A;  2DAO A;  4UVB A;  3E6D A;  4UXN A;  2CWE A;  2B0L A;  4OIP F;  1O7L A;  3DPT A;  4ZYG A;  1W4M A;  3Q9S A;  3FXR A;  3D5L A;  3DP7 A;  3W6K B;  1TW2 A;  2VBW A;  5HLI A;  4KUM A;  5HS9 A;  2FXA A;  4LK0 F;  4Z2Y A;  1H0M A;  1B6A A;  4EV0 A;  3F8B A;  3DPL C;  2OA4 A;  2GZW A;  5CVU A;  5ILS A;  2XRN A;  3RDI A;  3KZY A;  2PFB A;  2L4A A;  3HUG A;  1IRF A;  3LAJ A;  1FY7 A;  1NHA A;  3NEU A;  3VEP A;  1XDS A;  4L9J A;  4TV7 A;  1UB9 A;  4ENJ A;  1F4K A;  4ZZL A;  4I01 A;  4HAM A;  5HOO A;  1XCB A;  1XCV A;  2VON A;  2MC3 A;  4YFK F;  3F6O A;  2FNP A;  2PLY A;  3WOD F;  1QBJ A;  3E6M A;  1A04 A;  4LGW A;  2UZK A;  2QWW A;  1Z05 A;  4HQE A;  3ZMD A;  1BI1 A;  4OIN F;  4BXU A;  3COA C;  1U6G A;  2OQR A;  5F1R A;  2HWV A;  2ZXJ A;  3SFZ A;  4ENN A;  1I1G A;  1KU9 A;  1TNT A;  5HDK A;  2LDU A;  3LQR A;  3L2C A;  4ASN A;  1RIO H;  5HS7 A;  2Q2E A;  3GZ6 A;  4A6E A;  1JHF A;  5CVJ A;  5FGM A;  3KP3 A;  4P96 A;  2YX7 A;  3KCC A;  4BYY A;  5L3F A;  1SMY F;  5LRR A;  3AAF A;  3GZ5 A;  1HQC A;  3GF2 A;  1KU7 A;  5JI6 A;  1SFU A;  4KT5 C;  1LDJ A;  1R5G A;  5FB2 A;  4ZZD A;  2GQQ A;  2HEO A;  3QAH A;  4ZYD A;  4HW0 A;  3ZMT A;  1XGS A;  4Q5S F;  5DYM A;  3CUQ B;  3BWG A;  2VC0 A;  2XVC A;  4XBF A;  5LHH A;  3T8R A;  2YU3 A;  2V1D A;  2EJR A;  3ZP5 A;  1HKT A;  2ISZ A;  2LF8 A;  4PGG A;  4JK1 X;  2GXG A;  2VOO A;  4M9Z A;  4GYG A;  1V3F A;  1HKQ A;  1O3T A;  4BQA A;  2L54 A;  2W24 A;  2QM3 A;  2Z99 A;  2QUF A;  1G3S A;  1R7J A;  2IPQ X;  3DQV C;  4MTE A;  4HV6 A;  3CUO A;  3M9A A;  1EH7 A;  3TKY A;  1K79 A;  3GXO A;  1B1B A;  3WU0 A;  1X3U A;  3I59 A;  3GFL A;  3K0L A;  4IPA A;  4DQ2 A;  1USS A;  4I09 A;  2HDC A;  3ZQ7 A;  2M8E A;  4R8H A;  1ODD A;  1RZ4 A;  2RNJ A;  2GA2 A;  2MD5 A;  1S3J A;  1D8J A;  2CG4 A;  3C3W A;  3VOD A;  3CUQ A;  3K1P A;  5DD8 A;  4LB5 A;  3GYH X;  3GWZ A;  1FP1 D;  4RB1 A;  5DV5 A;  1YYV A;  4CO8 A;  3WTV C;  4KDP A;  3IWF A;  5LGN A;  4ZH4 F;  5D4R A;  4YG2 F;  3P9I A;  1FNN A;  4D0P A;  1UHW A;  1LB2 A;  1O3R A;  4IRG A;  3V7C A;  4L0Y B;  3CUQ C;  1P4X A;  2P5K A;  2QZ8 A;  1IUY A;  2D1V A;  3IKV A;  2Q8K A;  5HDN A;  1BBY A;  3JSO A;  3O6B B;  2FBH A;  3V7S A;  3BOQ A;  4PCQ A;  1TBX A;  4MEY F;  1T6S A;  4ESJ A;  1Z6T A;  3FM3 A;  4XRF A;  2VT3 A;  4EGY A;  1LEB A;  3CLO A;  2VXZ A;  3U9G A;  3FHZ A;  1QZY A;  4U0Y A;  1P4W A;  2P8T A;  3O3K A;  4RGX A;  4ENM A;  4WXD A;  1Z9C A;  4S04 A;  2DU9 A;  2J5O A;  4CZZ A;  4PZJ A;  2EA2 A;  3LST A;  4KNY A;  4OOI A;  1YW8 A;  5ILU A;  3L9F A;  3LFK A;  1PDN C;  4N9I A;  4HF2 A;  1S7O A;  1BC8 C;  3K1M A;  1KYW A;  2CYY A;  1QO0 D;  4Q48 A;  2A3S A;  3T0Y A;  4MQV A;  1QNT A;  4A0X A;  3DEU A;  4I7H A;  1XGM A;  1IF1 A;  4I0A A;  1KYZ A;  3DXJ F;  3ISP A;  3K1N A;  2VBZ A;  4U7D A;  3EDP A;  3HYI A;  3I54 A;  4GGG A;  3SXY A;  4EVI A;  2M87 A;  1SD6 A;  4WF2 A;  2HOE A;  2ZFW A;  3HSR A;  2IVM A;  4M6Y A;  1FYL A;  3RIR A;  2EWN A;  1IXS B;  5AIQ A;  1BN5 A;  1R00 A;  2P6S A;  2DT5 A;  3JAM Z;  4PGH A;  3EQL F;  4IF4 A;  1I1S A;  2IA2 A;  1XGN A;  4CGZ A;  5D5X B;  2NS0 A;  4WXH A;  5KK1 A;  4O6J A;  2XAQ A;  5F64 A;  2CFX A;  2F2E A;  3LA2 A;  4ON0 A;  3L09 A;  5HDG A;  4A0Z A;  4Y13 A;  3H3Z A;  3SZP A;  2HYG D;  4RGS A;  2IRF G;  1BM9 A;  1U5T B;  5D5V B;  3F8M A;  4UNO A;  5DUK A;  1BOA A;  1LQ1 A;  1KA8 A;  1T39 A;  1XB4 A;  3KFW X;  2GIV A;  1LEA A;  2V1X A;  4EJV A;  4MQ9 F;  3I64 A;  1W7P D;  5DCM B;  4NHJ A;  1IAW A;  4A5M A;  2EV5 A;  2KRF A;  1BC7 C;  5A2Q K;  4M72 A;  2V6C A;  2EK5 A;  1K6O A;  2RVC A;  4HZF A;  2FBI A;  4NB5 A;  1RUO A;  5FFX A;  3G73 A;  4I2O A;  3WE3 A;  1SD5 A;  1FSH A;  5BPI A;  3DF8 A;  2WV0 A;  2EFP A;  1FLI A;  1DPU A;  2ZJ2 A;  1OPC A;  2KIF A;  5FD5 A;  4YFN F;  1FOK A;  2QYO A;  1IN8 A;  3HRS A;  3MZY A;  4U0W A;  2BE5 F;  2GWR A;  5LEJ A;  3VB2 A;  3KP2 A;  2XAH A;  2KKO A;  2EFN A;  4A5N A;  4AVP A;  3F8N A;  4G7Z F;  4N0B A;  5J8C A;  1J9I A;  3P9C A;  2O0Y A;  3TOA A;  2F5F A;  2DK5 A;  1HBX G;  2QEN A;  4Q4Z F;  3FF5 A;  3HTU A;  3Q9V A;  1PUE E;  1MDM B;  4BHB A;  4P55 A;  3BDD A;  3JTG A;  1UCR A;  5H20 A;  5LEK A;  5HLG A;  1KGS A;  1U5T C;  2PN6 A;  2MH2 A;  2QVO A;  4KIB A;  3F8C A;  2RDP A;  1TQI A;  2HYF A;  5L3C A;  3R61 A;  3KP7 A;  2K4B A;  2QQB A;  3CDH A;  1J0R A;  2FA5 A;  1SFE A;  2GXB A;  2MBF A;  4N9H A;  5JR3 A;  5ILV A;  2XIG A;  2IT0 A;  1REP C;  3RKX A;  5LRS A;  4R1H A;  5K5Q A;  5E8I A;  4WCG A;  1IN6 A;  2K4J A;  2CO5 A;  1IN7 A;  3BPV A;  1OKR A;  2LSO A;  5AON A;  1ZG1 A;  3RKW A;  4R79 A;  3LA7 A;  2ELH A;  4I02 A;  2OAZ A;  2F5E A;  1W5T A;  4RB0 A;  2E1N A;  4GYI A;  1P6R A;  3B02 A;  4NQW A;  3HOS A;  3HRU A;  3I53 A;  1YS6 A;  4LG0 A;  4RB3 C;  1DP7 P;  1YLF A;  1FPQ A;  2JT1 A;  1H9G A;  2HQN A;  3J7A O;  2ZO4 A;  2IP2 A;  4FT8 A;  5LGU A;  1K7A A;  1HW5 A;  3EET A;  4LD5 A;  1ZYR F;  2MA3 A;  1SD4 A;  2FEZ A;  1XSV A;  4EMS A;  5FLX K;  5E8G A;  3IHU A;  3I58 A;  2Z33 A;  2RQP A;  4L9N A;  3WU1 B;  4IHS A;  4F7Z A;  1BI0 A;  3ZMS A;  1J5Y A;  2VOP A;  1MJ9 A;  2EFQ A;  4LLL A;  5L3D A;  3TO7 A;  5IT9 Z;  3I5U A;  3Q5F A;  3J81 Z;  1HXD A;  1Q1H A;  1ZLJ A;  3FXQ A;  1ZN2 A;  3IRR A;  4BHP A;  1XGO A;  4HF0 A;  4HLX A;  3RPQ A;  3B73 A;  4GO1 A;  2XHK A;  2Y75 A;  4IRH A;  1OYY A;  3DV8 A;  1DDN A;  1G3W A;  2A6H F;  2JTV A;  2ETH A;  3R60 A;  1IW7 F;  4YII A;  1HW2 A;  1LVA A;  2TDX A;  2FSW A;  1O7F A;  3T8T A;  4KN4 X;  2UWM A;  4Y17 A;  2FU4 A;  2HKO A;  2WC2 A;  2L01 A;  3F21 A;  2O61 A;  3F3X A;  4L0Z B;  4FX0 A;  1W7P B;  4O3M A;  3FMQ A;  1XN7 A;  3I71 A;  1U2W A;  4L9V A;  4YIF A;  2Q0O A;  4HOB A;  3ULQ B;  2HTJ A;  5ICC A;  3E97 A;  2L3D A;  5H6Q A;  4LLN A;  4G7H F;  4M73 A;  1RUN A;  2O6G E;  1KQ9 A;  3H3U A;  3TO9 A;  3F72 A;  3E5Q A;  2D2W A;  3GEZ A;  1E17 A;  2HS5 A;  5E1Z B;  4BH9 A;  2D1H A;  1L3L A;  4MTD A;  5HVQ C;  2L4M A;  1OYI A;  3JSP A;  1HKS A;  2ZCW A;  3CO7 C;  2BV6 A;  4HQM A;  1TQM A;  4B09 A;  1V4R A;  2FNA A;  2FML A;  2HZT A;  1YIO A;  1YW7 A;  4LK1 F;  4G7O F;  1GVJ A;  5LHI A;  4WK8 F;  2JPB A;  5KVR A;  2COM A;  3R0J A;  2PEX A;  2K02 A;  2W84 A;  1R36 A;  3BJA A;  2JZY A;  5BS6 A;  4P9U A;  2P4W A;  3JW4 A;  4M6X A;  2W85 A;  4KMU X;  3BJ6 A;  4ENK A;  1K78 B;  5F6F A;  1YS7 A;  2R3S A;  5ICF A;  2VE8 A;  2XV4 S;  3K2Z A;  5FD6 A;  2NNY A;  1J75 A;  2YR2 A;  4G8X A;  2RC4 A;  4H0E A;  1XDU A;  2ZBK A;  3HSF A;  2QQA A;  2CGP A;  5J6X A;  2A07 F;  3QU6 A;  2ZME B;  2GAU A;  2STW A;  1BI3 A;  5LHG A;  2CSO A;  5L3G A;  3KET A;  5EEH A;  4CXF A;  3WTX C;  1QQI A;  4KFC A;  1W5S A;  2RKH A;  2ZNZ A;  2OZ6 A;  2PBI A;  1G3T A;  1EV7 A;  2F5C A;  2LNB A;  2A61 A;  4XLN F;  3EYI A;  2VN2 A;  2NAZ A;  2EB7 A;  1CF7 B;  3IL2 A;  1PP7 U;  2WTE A;  4HA8 A;  2EV0 A;  4FX4 A;  2VBY A;  2JPC A;  1KQ8 A;  1YTY A;  2M1B A;  4U0V A;  3WTU C;  4I98 B;  2H6C A;  2DPU A;  2V9V A;  4HDU A;  1J59 A;  6PAX A;  5D5W B;  1P92 A;  3HSE A;  1OR7 A;  3BJO A;  2QBY B;  3HHG A;  2M30 A;  1QPM A;  5BMZ A;  2A5Y B;  5DDG A;  4HX8 A;  1TTY A;  1R1T A;  3U2R A;  3M8F A;  1Y0U A;  1D5V A;  2HGC A;  4RGR A;  1MD0 A;  4AWX B;  3HTS B;  1B59 A;  4KA4 A;  1FYM A;  2XKP A;  1MKM A;  2P6T A;  1CF7 A;  5FFZ A;  1IN4 A;  3E3V A;  1CGP A;  1ZGA A;  1KU3 A;  4A6D A;  2DPD A;  5K5R A;  3KE2 A;  2ZNY A;  1F1Z A;  4BAY A;  1JHH A;  2NRA C;  2MH9 A;  3ECH A;  2VE9 A;  3IRQ A;  4GXO A;  3IWZ A;  4EM1 A;  3GUD A;  1TLH B;  4L5J A;  4IHT A;  3V8L A;  2DQR A;  2BEO A;  3ML6 A;  1E2X A;  3QP5 A;  1S8N A;  3WGI A;  2HFH A;  4G9Y A;  1F5T A;  3RYP A;  2MLG A;  2PG4 A;  4CIC A;  2QBY A;  4ZYH A;  3KEO A;  3PQK A;  3ZN1 A;  2M5W A;  4RAY A;  4A12 A;  1TW3 A;  4L9T A;  2E1C A;  1XMA A;  2O03 A;  2STT A;  1T0F A;  4EGZ A;  1XMK A;  5L3B A;  3ZPL A;  1RNL A;  4CYD A;  2D45 A;  5ICE A;  3CJN A;  1FC3 A;  4ZYE A;  5AIP A;  3BY6 A;  3ECO A;  5H6R A;  1FP2 A;  2CQK A;  1WRJ A;  2E7W A;  1WKM A;  4WXC A;  4RS8 A;  2EFO A;  5D6F A;  4JBA A;  1ZGJ A;  2DO7 A;  4A0Y A;  1G3Y A;  2K86 A;  1EH6 A;  3GX4 X;  4LB6 B;  5E20 A;  4U7B A;  4DNC A;  2BYV E;  1U5T A;  3RPU A;  2H6B A;  4OU0 A;  3I0T A;  4M71 A;  5DCF A;  4KMF A;  4BHC A;  4EJU A;  2DBB A;  1I5Z A;  1XSX A;  5IT3 A;  5BOX A;  1ZG5 A;  2DW4 A;  5DCM A;  4P9F A;  3K69 A;  4FHT A;  2IA1 A;  4K2E A;  2YPR A;  4LLG F;  1L0O C;  2ADU A;  3V4G A;  3WTS C;  3EUH A;  1B9N A;  2FBK A;  1S29 A;  2LF7 A;  3LAP A;  1JE8 A;  1HSJ A;  5L3E A;  3G3Z A;  2WWY A;  1C0W A;  1H9T A;  2PI0 A;  1YO5 C;  5CVV A;  1ON2 A;  3WTZ A;  4MEX F;  1U8R A;  4OIR F;  4HV5 A;  2IA0 A;  1QGP A;  2ESH A;  2K7L A;  3GFI A;  1UFM A;  4P5O A;  2VBX A;  4G6D A;  1OYW A;  2FE3 A;  1MGT A;  4MNU A;  5E1X A;  2K27 A;  3TDU C;  3E6C C;  4L18 B;  1YFH A;  1FYK A;  1IN5 A;  3P7N A;  5CLS A;  5D8K B;  2R7D A;  3WGH A;  1MDM A;  3F22 A;  5J8F A;  1ZAR A;  4G6Q A;  1BJA A;  5DUI A;  1EH8 A;  3KLO A;  3FZV A;  2OBP A;  4PDK A;  2Y48 A;  1YW9 A;  3MAJ A;  2XRO A;  2H94 A;  2FMY A;  1LDD A;  2XAS A;  4UVC A;  5E1W A;  3IKT A;  1U78 A;  1WI9 A;  1IZ1 A;  3O2P E;  4EQQ A;  1LJ9 A;  5HLH A;  4WX9 A;  1FZP B;  3V8J A;  2UXN A;  2MLK A;  4KYW A;  4ESB A;  2OZU A;  3MEX A;  4LJZ F;  2V79 A;  1Z6R A;  4IJA A;  2YSR A;  2LKP A;  1AOY A;  2X0L A;  2DLL A;  2A68 F;  1BIA A;  1FWZ A;  2L02 A;  4ESF A;  1WSU A;  1BI2 A;  1FT9 A;  1SFX A;  1F9N A;  1HST A;  3CTA A;  1ZLK A;  4HBL A;  4HX7 A;  4UV9 A;  3T5X A;  1O3S A;  1Z91 A;  4ETS A;  5LLQ A;  3JAM K;  4IVN A;  5JFR A;  2HR3 A;  1T98 A;  1S6L A;  2A69 F;  1SD7 A;  5ERI A;  3KZZ A;  2JSC A;  3FX3 A;  2GA1 A;  3PQJ A;  5JHU A;  2X4H A;  3I59 B;  4IXA A;  3WE2 A;  2OU2 A;  2G7U A;  2IJL A;  1ONV A;  2Z5U A;  1I6X A;  3MQ0 A;  2XKO A;  3R0A A;  5D8L B;  3HHH A;  5CYV A;  4KN7 X;  5BQT A;  2DTR A;  2DQL A;  4KIC A;  5CVI A;  3TGN A;  4I0B A;  4RAZ A;  3SZT A;  3KP5 A;  2KJB A;  3WTW C;  3N97 A;  2G7H A;  1WWX A;  4EJT A;  5D5U B;  4EM0 B;  1D8K A;  4M9X A;  4AIJ A;  4B8X A;  3E5X A;  3TO6 A;  4HX4 A;  5HS8 A;  4OMY A;  3QP6 A;  2AS5 F;  3RTR A;  3MCZ A;  2RGV A;  5A2Q Z;  2DFI A;  3SHF A;  4EJO A;  2P5L C;  2EA4 A;  3WGG A;  5CJ9 A;  2G9W A;  2Z9O A;  5D4S A;  4XLP F;  1LDK B;  3MZH A;  3KP4 A;  1KQ0 A;  2QLZ A;  2ACJ A;  4HYE A;  3LQQ A;  4LMY A;  2EFW A;  4HF1 A;  2VC1 A;  1YG2 A;  3E6B A;  1UHM A;  2E7X A;  2XAG A;  1BIB A;  4RB2 C;  1YQA A;  5FO5 A;  2ESN A;  4S05 A;  4UV8 A;  1IRG A;  3WTY C;  2CW0 F;  1W7P A;  3GLX A;  2FRH A;  4IRI A;  3CO6 C;  1D3Y A;  2RN7 A;  2KJC A;  1UST A;  3LWF A;  1ZH5 A;  5LGT A;  3J80 Z;  4BNC A;  3F23 A;  3NQO A;  3GFJ A;  2DI3 A;  4Y15 A;  4O5V A;  3WG9 A;  3DFG A;  1ZRE A;  5ICG A;  4Q47 A;  3OOP A;  1I27 A;  1R1V A;  3RI4 A;  3ABT A;  4MHG A;  1ZRC A;  2KIM A;  1T38 A;  5E17 F;  2M45 A;  3P9K A;  3BP8 A;  1GXQ A;  3RJP A;  1OMI A;  1TQP A;  1T2K A;  1S7A A;  3M1E A;  1MZB A;  1GHC A;  3ZMU A;  3QOP A;  2W57 A;  3GVA A;  3HRT A;  3QPT A;  3TQN A;  1SAX A;  4L5I A;  3U1D A;  2OQG A;  3KP6 A;  5CVR A;  2Z3Y A;  4MGR A;  3BPX A;  3C7J A;  1KU2 A;  4RGU A;  3QRF F;  3BRO A;  2VT2 A;  3TOB A;  3C18 A;  1K78 A;  3GW2 A;  1IXR C;  1GXP A;  4HLY A;  3V7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...