2DQRA

Crystal structure of the replication terminator protein mutant rtp.e39k.r42q
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
107
Chain Sequence
RSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLKVLQSEFKEIGFKPNHTEVYRSLHELLDDGILKQIEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Replication termination protein
total genus 39
structure length 107
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dqrA00
2PLYA 2HZTA 2PMUA 3PQJA 4WF2A 1F4KA 1HKQA 5JR3A 1H9TA 4OMZA 3F21A 4KYWA 3SQNA 3PQKA 1G3WA 2LF8A 4Q5SF 3RYPA 2DQLA 3ECHA 2QWWA 3ZP5A 4IF4A 3FHZA 2OZ6A 2QQ9A 2FA5A 5CYVA 1TQMA 2O6GE 2P5VA 3M8EA 5AIPA 1I6XA 2DK5A 4U88A 2O61A 3P9KA 5IT3A 1U5TB 3EQLF 4HZFA 4HX4A 5L3BA 3HHHA 5ICFA 5L3FA 3G3ZA 3ELKA 2F5CA 2G7UA 4EJWA 3GFMA 1WQ2A 2IA1A 5K5OA 1LDJA 1GVJA 4LGWA 2M8EA 5L3GA 3TGNA 5FGMA 5ED4A 4HW0A 4HDVA 3ZN1A 4JBAA 1FYMA 3TO9A 4HQEA 3V7RA 3GX4X 1LJ9A 4EVIA 4BHCA 1WRJA 1YS7A 1BN5A 4KIFA 1B9NA 3ULQB 3GFJA 3KEOA 2Y48A 2BE5F 4KDPA 2FNPA 4EM1A 4U0YA 3FZVA 3WODF 1HQCA 1JGSA 3WTTC 2P5KA 2YX7A 1TTYA 2OD5A 2COMA 2HTJA 1ODDA 3QPTA 3W6JB 4IHTA 1IXCA 1QZYA 4A5NA 1KQ8A 2HFHA 2KRFA 4JQFA 4IHSA 3F8CA 1B6AA 4PGHA 2E7WA 5DCMB 3K69A 1TQIA 4HBLA 3F6OA 2D2WA 1CF7A 3SXYA 2ESHA 2RDPA 3F8BA 2PBIA 2PEXA 2V79A 2MA3A 5LHHA 3IRRA 2RNJA 4D0PA 4L5JA 2DK8A 1D3YA 5H6RA 3MQ0A 2DU9A 1IXRC 2H6CA 2YPRA 4BYYA 4CXFA 4KN4X 1USSA 1RUOA 2RC4A 4NHJA 2XIGA 2V1UA 1R7JA 2QYOA 3CUQA 1JE8A 3SZPA 1AWCA 3D0SA 2LF7A 2W25A 5HVQC 3M7GA 2YU3A 1FBSA 2DO7A 1J7KA 1SFXA 3KP5A 3TOAA 5CVIA 3NEUA 5BPDA 2EB7A 4MEXF 1FY7A 5DV5A 5ILVA 3F8FA 4I7HA 2XAQA 3HSEA 2L01A 2HKXA 4I2OA 5FLXK 1BIBA 4M9SA 4KMFA 3GYHX 1UFMA 2QZ8A 1E17A 1XMAA 3KP7A 2KIFA 3RI4A 3GO5A 3JAMK 4ZZLA 1YTYA 3DEUA 2QQBA 4EGYA 1MZBA 3I59B 4M71A 5LEKA 4KICA 1P92A 3Q9SA 2C6YA 2M30A 1PP7U 3L7WA 2DPUA 3KZYA 3JAMZ 3QP6A 4AIJA 4ZYEA 2YX4A 2J5OA 3V7SA 1EV7A 5BOXA 4Q47A 1ZLKA 1K7AA 1FLIA 4XSZF 1QO0D 2ESNA 4LLLA 5DD8A 3L09A 4A0YA 2X4HA 1OR7A 1LNWA 3TDUC 3J80Z 3RIRA 4EQQA 2O8XA 2MH9A 3KZZA 3FXQA 1ZG1A 3GXOA 4GO1A 5FO5A 3R61A 4GYIA 1FBQA 3CO7C 1KYZA 1YQAA 1R5HA 3GFLA 4WXDA 3P7NA 3T8TA 1ZRCA 3MAJA 3WGGA 4KIGA 4HX8A 1ZGJA 3WG9A 4P9UA 4KN7X 4QLCU 3VOEA 2FBIA 4R1HA 5J6XA 2AXLA 2MLGA 1SAXA 2LNBA 2A68F 3DF8A 1MJBA 5DCMA 2VOOA 3QRFF 1K6OA 1L0OC 3KCCA 4ZZDA 3QAHA 5HOOA 1REPC 4Q4ZF 4ZYGA 3U2RA 2EFNA 2EFPA 4A0XA 3REOA 2HWVA 1G3SA 1J5YA 1QNTA 4M6YA 5DYMA 4HV5A 3KETA 1HXDA 1G6NA 2DT5A 3BZ6A 2OU2A 3JW4A 2L3DA 4A6EA 2IPQX 4AD9A 5CJ9A 1U5TC 3LWFA 2ZCWA 5E1ZB 2CWEA 4NB5A 3VFZA 2V1DA 2CO5A 2EFOA 5FLXZ 3GUDA 2GQQA 5CVJA 5DD4A 2XGXA 3KLNA 4AIHA 4MQ9F 2XROA 1USTA 5A2QK 2LDUA 1MKMA 4OINF 2Z9OA 4TV7A 4EGZA 4AWXB 3V7CA 3K1NA 1XN7A 2FBKA 3BJOA 3ZQ7A 4HF0A 3FM5A 3GZ6A 3O2PE 4GCVA 2HYFA 5CVUA 4G6QA 2GIVA 1W7PD 3HYIA 1Z6RA 2GXBA 3FMSA 2QUFA 4WCGA 4A12A 4N9HA 2Q2EA 4O6JA 3T1BA 1LDKB 1P2FA 3WE3A 3GWZA 5D4SA 2V6CA 3S2WA 3TOBA 4I98B 5E8GA 3LAPA 3KP2A 2X0LA 5L3CA 4P55A 1FOKA 2NS0A 1XSVA 2VBZA 4GXOA 5J8FA 3L9FA 5H6QA 4ENKA 1I5ZA 3HRTA 1S8NA 3WTZA 1UCRA 3M1EA 3U9GA 3RPUA 1IXSB 5BPIA 3BJ6A 4OIRF 1T0FA 3GZ5A 2IT0A 3KLOA 3LA2A 4ETSA 1YS6A 1KU9A 3K1PA 2L4AA 2ZNZA 3R6SA 1GXPA 5CVRA 2EA2A 4ZYHA 3O6BB 1FP2A 5TRDA 2K27A 3FF5A 1TW3A 3GLXA 4ESFA 3T0YA 1ZYRF 2MC3A 1STZA 2OAZA 1NHAA 4M6XA 5HS7A 1LDDA 5E17F 4OU0A 2A07F 1EH7A 2XHKA 3J81K 2P6TA 1XGOA 4I0AA 3DPTA 3PFIA 1XB4A 2H27A 4OIOF 3HOSA 1BM9A 2FQ3A 1ZG3A 3ZMTA 5ICCA 5DUIA 3BOQA 3BDDA 3D5LA 1F5TA 4KIBA 3HSRA 5AONA 3TDZC 3N4MA 1U6GA 4IXAA 3I54A 4A5MA 3J81Z 4IRIA 4L0YB 3RYRA 2QBYA 1YO5C 2PFBA 2PQ8A 2XV4S 3MEXA 1E2XA 5J8CA 3M8FA 1YFHA 4MEYF 4I02A 3V8LA 1H9GA 3TO7A 3F8MA 1U8RA 3MWMA 5CVVA 3RDIA 2VE9A 3WGHA 1O3TA 4HOBA 4RGSA 4H0EA 2Y0MA 5JHUA 1FNNA 5FD6A 4B8XA 2Z99A 3ABTA 2FOKA 3K1MA 1FT9A 4PGGA 3ZPLA 2BV6A 1YLFA 5D5XB 2QVOA 1G3TA 4ASNA 2XKPA 1V3FA 1R58A 2XAFA 1HSTA 1LEBA 1KQ0A 2IRFG 5EEHA 2EJRA 1S7OA 4P96A 3KEQA 1KU2A 4GGGA 4LD5A 3ROUA 3B73A 2WWYA 3WU1B 4LG0B 3MCZA 2V1XA 2ADUA 4L9NA 3HOTA 1SMYF 1OKRA 4A0ZA 1D8JA 2PJPA 4F7ZA 2VXZA 4OIPF 3RKXA 4L18B 3IWZA 4M72A 3F22A 1QBJA 6PAXA 1OYYA 3CDHA 3HHGA 2XRNA 3R0JA 5FFXA 1RIOH 4PDKA 3ZMUA 2A3SA 1XMKA 2JTVA 1O3QA 1XDSA 4LJZF 1O3RA 1DUXC 1EH6A 4RB0A 2M5WA 4RGUA 2LKPA 4RGXA 3GF2A 4KNYA 5E20A 5D6FA 3GVAA 3V8KA 5E18F 3RJPA 3MFKA 5LEJA 4IVNA 3RPQA 2G9WA 4MGRA 2YR2A 3DXJF 1ZRFA 4I0BA 4XSXF 1QQIA 1EH8A 1TNSA 1P6RA 1S7AA 3I53A 1O3SA 2J5PA 3E5QA 1S3JA 2D1VA 2CFXA 1FYLA 3ABUA 2XAJA 1XSXA 1R1VA 3T8RA 1U5TA 2MLKA 3M9AA 1ZGAA 2HS5A 2HKOA 4A2UA 2VBXA 1IUYA 1PUEE 3LFKA 2E1CA 2DPDA 2M45A 4WXHA 3CUOA 3DKWA 1BJAA 1ZLJA 3JTHA 2P7VB 2DFIA 1XCBA 2GZWA 3IKVA 1K79A 2CG4A 3KP4A 2NRAC 1W5TA 2O03A 4I01A 3O3KA 4O3MA 4HV6A 3E97A 1ZARA 5DUKA 3FXUA 2EWNA 3IWFA 3QPHA 2A5YB 1DPRA 2XAHA 3AAFA 1MDMA 3C3WA 3CTAA 5CLSA 3HRUA 3ERED 3J80K 2VOPA 3GFIA 2OA4A 2CSOA 4RB1A 4UNOA 2IP2A 3ZN0A 4OIQF 1MGTA 3ZMSA 4HDUA 5ILUA 2UXXA 3LSTA 4XLNF 1WKMA 2EFWA 1ZRDA 1J0RA 1IW7F 4Z2YA 1UHMA 2VODA 4HQMA 1IN4A 1I1SA 2FNAA 5D5WB 4BH9A 5LGTA 4R79A 2VN2A 3FXRA 4KFCA 2H6BA 3H3UA 5F1RA 1ZG5A 2Y75A 2OQGA 1R23A 4NQWA 2NNNA 1UB9A 1C0WA 1X3UA 1JHFA 2FF4A 4HA8A 1OYIA 3TO6A 4A6DA 2A61A 1IRFA 2RKHA 2ZBKA 1U3EM 4U7DA 4FHTA 1LB2A 5FD5A 2BEOA 1ON1A 4ON0A 1T6SA 3SZTA 4CICA 2A69F 3SHFA 2ISYA 4HYEA 2B0LA 4IJAA 4PZJA 2ELHA 1FBUA 1W5SA 2IVMA 5E1WA 1VTNC 3P9IA 3HTUA 4RAYA 2BGCA 2HOEA 4HF2A 1XGMA 2V9VA 1IN6A 4YFKF 5HS8A 5HLIA 5AIQA 4L9JA 3E5UA 2IJLA 1QPMA 1ZN2A 1XCVA 2G7HA 3NQOA 3OV8A 2VBWA 3CO6C 1ZREA 1Z9CA 2W24A 3ML6A 5DCFA 5FFZA 1XGNA 4IRHA 1P4XA 3BPVA 2WV0A 4LK1F 1BI2A 1Z05A 1SFUA 2ZFWA 3TKYA 2ZXJA 1H0MA 3MZYA 1WWXA 3C18A 3ECOA 2F5DA 3HTSB 1MD0A 4CO8A 1LEAA 4ENJA 2EV0A 1HW5A 4LB6B 5LBQA 4G7HF 3C1DA 3L2CA 4CGZA 4LG0A 1IN5A 1JXSA 3R0AA 3KP3A 4Q48A 1HBXG 1YW9A 3DP7A 4G9YA 3WTWC 3HRMA 4UUVA 3BWGA 1W7PB 1BOAA 3FX3A 4M9ZA 2CGPA 1SD5A 2FU4A 4ZH4F 3KP6A 1BIAA 3I0TA 4EM0B 4EJOA 5BS6A 5K1YA 2AS5F 2ZJ2A 2ACJA 2EV5A 1QGPA 4BHPA 4RB3C 3N97A 1GHCA 3K9TA 2HQRA 2P5LC 4UVBA 1B9MA 2FE3A 2OZUA 3F23A 1F1ZA 2LSOA 4L9TA 3FMRA 4WX9A 2KIMA 1J59A 1IN8A 3IC7A 3BP8A 2ISZA 2A6HF 3GW2A 1KYWA 2PG4A 3QOPA 2STWA 4FX4A 1Q1HA 4R8HA 1FSEA 4DNCA 4ESJA 1YIOA 5F6FA 1B4AA 2M87A 1T98A 4FX0A 4U0WA 5E1XA 2MH2A 4P5OA 4ENMA 4E70A 2DAOA 4KMUX 1OYWA 4IPAA 3KFWX 5K5QA 1TW2A 2F5FA 4Y13A 3NRVA 2GA2A 4IRGA 2RQPA 3OOPA 1R5GA 3WTUC 2JPBA 2PN6A 4YFNF 1O57A 4G8XA 3J7AO 3EYYA 2JZYA 1HSJA 5IT9K 1AOYA 2DBBA 3VB2A 5HDNA 4S05A 3B02A 2R7FA 4G7ZF 4CZZA 2UWMA 4N0BA 2QM3A 2HTSA 2D1HA 2L54A 5ERIA 2HEOA 5K5RA 2EA4A 4MQVA 1ULYA 4KUMA 1W4MA 1T2KA 2GXGA 4HAMA 1P4AA 2IA0A 2FXAA 3DPLC 2QLZA 3TQNA 5HLHA 2KJBA 2E1NA 2RN7A 1ZAOA 4L5IA 1RUNA 1GXQA 4MTEA 5E8IA 4WXCA 1F9NA 4YIIA 5D8KB 1CGPA 4G94A 4MHGA 3I59A 2ZMEA 4YG2F 4BQAA 3RTRA 3WTSC 3DFGA 1TNTA 3R4KA 2EK5A 1J9IA 2XKOA 3I58A 1JHHA 2ZO4A 4EMSA 1U2WA 1KGSA 1LVAA 5BMZA 4L0ZB 1RZ4A 2FRHA 5TJJA 4RS8A 3FM3A 1FP1D 2W57A 1FSHA 3KE2A 1MJAA 3LQRA 2A6EF 4N9IA 1TBXA 3ZMDA 5D8LB 1FZPB 1XGSA 4EJVA 1DPUA 1Z7UA 5F64A 2DTRA 3EUHA 4ZYDA 1YW8A 2JPCA 1A04A 3E5XA 2UXNA 4BXUA 1CF7B 5LLQA 3VEPA 2XUBA 2DW4A 4JK1X 2HQNA 3WE2A 1LQ1A 4ESBA 3WTVC 3HSFA 5HS9A 5JFRA 4U0VA 2IA2A 2Q8KA 2KIUA 3SFZA 2H09A 1WSUA 4LLGF 4OOIA 4P9FA 2W84A 2W85A 1R1UA 3BJAA 1J75A 2M1BA 4O5VA 4EJTA 4M9XA 1BBYA 5L3DA 2VC0A 4LK0F 1BI3A 1OMIA 1ON2A 3GEZA 4BNCA 1IZ1A 1HKTA 2K4BA 2KKOA 3QU3A 3W6KB 3WTYC 1HW2A 2O3FA 1YW7A 3EDPA 3QP5A 4M73A 2XASA 4BAYA 1MJ9A 1FX7A 2FMYA 2XAGA 2EFQA 4LFUA 4RB2C 2GA1A 1IF1A 4ENNA 3U1DA 3F6VA 2WC2A 5EEGA 1PDNC 5LGUA 1ZHFA 1O7LA 1IRGA 4U7BA 3Q5FA 1FPQA 4BHBA 5FB2A 1BC7C 5D5VB 1L3LA 2JT1A 2QQAA 2VE8A 2CYYA 1XD7A 1J2XA 4RAZA 4XRFA 1BI0A 1OPCA 1D8KA 1MDMB 4AVPA 5LGNA 3WGIA 4UV8A 2K7LA 1TQPA 3H92A 3L00A 3HRSA 4M74A 3V8JA 4MNUA 1I27A 5HLGA 5BQTA 3MZHA 1KU7A 2NYXA 2HGCA 5LRRA 1S6LA 4YIFA 4WK8F 1XDUA 2TDXA 1T38A 1ZH5A 3BY6A 3ZMZA 1HKSA 1SMTA 2FMLA 2BBYA 3IL2A 5LHIA 3K2ZA 1SFEA 2ZNYA 1FYKA 3F72A 2PMHA 1TLHB 3RKYA 1G3YA 3ISPA 1K78B 1DDNA 4YFXF 5LRSA 1UHWA 2VONA 2OQRA 4UVAA 1B59A 3WU0A 2F2EA 5HDGA 2DQRA 2NAZA 2STTA 3I4PA 4EJUA 1Y0UA 3G73A 1V4RA 2GAUA 1R22A 3LQQA 1YYVA 3IKTA 4HLXA 2D45A 3CJNA 2PI0A 2CQKA 1Z6TA 4WWCA 2P4WA 5D4RA 3I5UA 4OMYA 3E6BA 2O0YA 4HLYA 1R36A 5ICEA 5IT9Z 2L02A 2RV8A 4PCQA 5ICGA 2Z5UA 4CHUA 3C7JA 5JI6A 4EM2A 5KVRA 1G4DA 1SD6A 2H94A 4CDGA 3EYIA 3JSPA 4AIKA 2VBYA 2P7CB 1KA8A 4MTDA 3BROA 2RVCA 1R00A 1S29A 2DI3A 4LMYA 2Z33A 1W7PA 3I64A 2K02A 1K78A 1SD4A 2BYVE 2WTEA 4Y15A 3RKWA 3LA7A 2HR3A 3DQVC 4UVCA 2VT3A 1QZZA 2R7DA 2VT2A 2KJCA 4LB5A 2YSRA 1Z91A 3CLOA 2DLLA 1PP8F 1YG2A 1XSDA 3P9CA 2FEZA 2ETHA 3E6DA 4FT8A 2FBHA 1RI7A 4UXNA 3EETA 4XLPF 3F3XA 3JSOA 2GWRA 3E6MA 3I71A 2FSWA 1HW1A 3R60A 2CW0F 3VODA 4Y17A 3COAC 2HDCA 2NNYA 2F5EA 5LHGA 5JVTA 2QBYB 4I09A 2OBPA 1T39A 4GYGA 1IN7A 4L9VA 5KK1A 4RGRA 4G7OF 4HX7A 2RGVA 2MBFA 1U78A 1DP7P 2P6SA 3WTXC 1O7FA 1BI1A 4LLNA 2K4JA 2HYGD 3DV8A 3Q9VA 3QU6A 2MD5A 2Z3YA 4CYDA 4DQ2A 4S04A 2EV6A 1WI9A 3K0LA 3T5XA 3ZMVA 3CUQB 2R3SA 5D5UB 5H20A 4UHTA 2Q0OA 3HUGA 3CUQC 4QWQA 3IRQA 1FWZA 1KQ9A 4KA4A 5D6EA 2P8TA 2L4MA 1P4WA 3FMQA 5HDKA 2UZKA 4KT5C 1KU3A 2IW5A 3LA3A 4XBFA 2E7XA 1D5VA 2ZKZA 1FC3A 3LAJA 3IHUA 1R1TA 3BPXA 4B09A 4EV0A 1RNLA 5DDGA 1I1GA 4K2EA 1BC8C 1IAWA 3FWEA 3E3VA 5L3EA 1Z1DA 3H3ZA 2JSCA 1B1BA 3JTGA 3F8NA 1SD7A 1ONVA 2XVCA 3HIFA 4G6DA 2VC1A 2JRTA 2K86A 5DEQA 5ILSA 4HF1A 2ZMEB 5A2QZ 3E6CC 3V4GA 4UV9A 2QENA
chains in the Genus database with same CATH superfamily
2PLYA 2K3PA 4XN0A 2HZTA 2PMUA 4BY1J 3PQJA 4WF2A 1F4KA 1HKQA 5JR3A 3JR9A 1H9TA 2CQNA 2AO9A 4OMZA 1MIJA 3F21A 4KYWA 2ID3A 4XONA 3SQNA 2KISA 3CZ6A 3PQKA 1G3WA 2LF8A 3CJQB 5TISC 4Q5SF 4B43A 3RYPA 2DQLA 3OWTA 3ECHA 2QWWA 3ZP5A 4NC6A 4IF4A 2CS3A 3X2QH 1OCPA 3FHZA 2OZ6A 1JI8A 2XSJC 3ASNH 4ITVA 2E35A 1TP4A 4CA0A 2QQ9A 2HPMA 3G1MA 2FA5A 5CYVA 1TQMA 2O6GE 1QPIA 2P5VA 1WJ5A 3M8EA 5AIPA 3U21A 1I6XA 2JJ7A 2DK5A 4XLHA 3BCBA 4U88A 4NNJA 2O61A 4C2MJ 1FEXA 3HGGA 3MVPA 4PSXA 3I56I 3P9KA 5IT3A 2RAEA 1U5TB 5DTDA 3O8HA 5KCMA 3EQLF 4HZFA 3FISA 4HX4A 4M3BA 5EG0B 3L2UA 2ME6A 3DWLE 2Z1DA 5L3BA 4M6VA 2EZIA 3HHHA 5ICFA 2AHQA 1Z7LA 3Q0UA 5L3FA 3H3VK 3FK6A 3G3ZA 3ELKA 3KYCB 2F5CA 4BUPA 1V5FA 2DN0A 2IGKA 2JSPA 3DU5A 2G7UA 4EJWA 1MMAA 2NVQJ 3GFMA 1WQ2A 3B6CA 2EH3A 2IA1A 5K5OA 1LDJA 1GVJA 4LGWA 4A3BJ 2M8EA 5L3GA 3TGNA 2KL4A 4I76A 3PO2J 5FGMA 2QSFX 5ED4A 4HW0A 4HDVA 1IV6A 3ZN1A 2WAFA 2IS2A 3CMEI 3HOVJ 5E3OA 3QPSA 4JBAA 3TO9A 5HNFA 1FYMA 1XC5A 4HQEA 3V7RA 3GX4X 1LJ9A 1DU6A 1AKHB 2HQAA 3CMYA 1ERDA 4JOMA 4EVIA 4BHCA 3ZQHA 2CUZA 1JJ8C 1WRJA 1OISA 2QKLB 2RQQA 1YS7A 1BN5A 4KIFA 1B9NA 4J01A 3ULQB 3LFUA 1K6YA 4F3QA 3GFJA 3KEOA 1FOYA 4M3FA 2Y48A 2BE5F 4KDPA 5GTIC 1QHHD 2FNPA 4EM1A 4A3GJ 4U0YA 2ID6A 2MSYA 1VQ5I 2HYJA 3MMYB 3FZVA 4HNUA 2PJRB 1TT5B 3ABLH 3WODF 2KMUA 1HQCA 1JGSA 1XS9A 4C2UA 3I9V2 3WTTC 2P5KA 2YX7A 1TWHJ 1TTYA 2OD5A 4LG3A 4YIRX 2COMA 2HTJA 1ODDA 3OIQA 3QPTA 3DKXA 3LSGA 3W6JB 3CCYA 3FXKA 4IHTA 1IXCA 1QZYA 3PIPF 2COBA 4A5NA 1KQ8A 4OAYA 2HFHA 2KRFA 4JQFA 2VKHA 3K4CA 5GPAA 3LNQA 4IHSA 1FMWA 4JP0A 4BE2A 3F8CA 3H9JA 2ZJPF 4DIQA 2QF7A 1B6AA 4PGHA 3LOCA 2L9RA 3KYDB 2E7WA 5DCMB 3K69A 1TQIA 5F04A 1X1DA 4HBLA 3F6OA 2D2WA 3PSIA 1CF7A 3SXYA 2ESHA 4Z6YA 2RDPA 3S14J 1AU7A 5K7HA 3TEDA 3F8BA 2PBIA 3D5RC 1WCMJ 3HB9A 2BXYA 1TL8A 3GCMA 3PIOF 1LFUP 2X1DA 5KNLA 3CCJI 3VSKA 2PEXA 1T08B 2V79A 2MA3A 5LHHA 3IRRA 1YIJI 2GOXB 2W4SA 3CMMA 4BE1A 2RNJA 4DJAA 1LUJB 2DJNA 1B72A 4D0PA 4L5JA 2JUGA 2DK8A 4E7HA 1D3YA 3DLAA 5H6RA 2CFOA 4IZZA 4A3MJ 2O9LA 1UHSA 4BACA 1SFOJ 3MQ0A 2DU9A 2Y9ZA 1IXRC 2YPRA 2H6CA 4BYYA 4CXFA 1TWAJ 2DTZA 3Q3SA 4KN4X 2DOFA 1USSA 3ZOBA 1RUOA 2RC4A 3HM5A 3J7AY 2R7XA 1G59A 4NHJA 4MLOA 2XIGA 2MYSA 1ETWA 2ZJRF 2R7WA 3VPRA 2V1UA 2E2JJ 3OYBA 1R7JA 2QYOA 3CUQA 4IOAF 1JE8A 3SZPA 3FK7A 4CSWA 1AWCA 3D0SA 2LF7A 2JMWA 2DMPA 3RQ4A 2W25A 3M7GA 2YU3A 1FBSA 2DO7A 5HVQC 1J7KA 1SFXA 3KP5A 3TOAA 3K6GA 4XOTA 2Z2SB 3DTKA 5CVIA 3NEUA 2PJRA 2DYSH 5BPDA 2OUMA 2EB7A 1ETYA 1HOMA 2BY0A 2JUCA 1VQMI 1Z3YA 4MEXF 1FY7A 3S1QJ 1DGRM 5DV5A 2MG4A 4C30A 5ILVA 3F8FA 4I7HA 2XAQA 5KHDA 2Y2ZA 3HSEA 2HQ5A 2L01A 2KQRA 5IYDJ 2HKXA 4I2OA 5B66C 5FLXK 1BIBA 3BTJA 3K4LA 4M9SA 1T8IA 4L5EA 1ZGWA 3RZOJ 2F48A 4A69C 4KMFA 3IAM2 1O4XA 3GYHX 1UFMA 5KAIC 3VYRB 2DOEA 2QZ8A 1E17A 1VI0A 1XMAA 3KP7A 2LMDA 3HG9A 2H8WA 3QYEA 2KIFA 2DT6A 3K4KA 3RI4A 3K4NA 1I50J 2XB0X 1IV8A 4D5FA 2AQFA 3GO5A 1OLTA 2Y0SA 2DA1A 3JAMK 3GTOJ 4ZZLA 1QRYA 1YTYA 4JX6A 2VKEA 1H8AC 1X2MA 2L7MP 3DEUA 2QQBA 4EGYA 1MZBA 3GZNB 3I59B 2DDAA 4M71A 3E7LA 4RAGA 5LEKA 4UUSA 4KICA 1P92A 2LK2A 2M8GX 3Q9SA 4A3IJ 3FXJA 2C6YA 2M30A 4BJ5C 1PP7U 1Q1VA 2M4KA 2VQHA 3L7WA 3QPLA 2DPUA 3KZYA 3JAMZ 3QP6A 2XF7A 4AIJA 4ZYEA 2YX4A 4BDZA 2J5OA 5F27A 4ABZA 3V7SA 2M2EA 2XGEA 1EV7A 5BOXA 2R7TA 3H5NA 4Q47A 1ZLKA 2WY7Q 1K7AA 1FLIA 2KHMA 1WZ2A 4XSZF 2CV0A 1QO0D 2ESNA 3PNYA 2ZB9A 4LLLA 5DD8A 2L9VA 3L09A 3L2RA 2R4GA 1QHGA 4A0YA 2X4HA 1Z21A 1OR7A 1LNWA 1K83J 3TDUC 3RIRA 3J80Z 3OY9A 1GV2A 2DFHA 5GADJ 1FMVA 4PK4A 4EQQA 2O8XA 4G6TB 4BXFA 2MH9A 3KZZA 2NVYJ 3FXQA 1JKPC 1ZG1A 1WHUA 3RQIA 3GXOA 2R5ZB 3JRFA 4GO1A 5FO5A 4B44A 3D1NI 1JTXA 4XKWA 3R61A 1JKRC 4KT6A 2BHYA 3GTQJ 2EQRA 3G1LA 4GYIA 1FBQA 3CO7C 1KYZA 4S0HB 2NVUB 5E3MA 3E1SA 1YQAA 4BY7J 5IP6A 2DA4A 1BR1A 2V6EA 4Y7NJ 5CKTA 1R5HA 3GFLA 1IG7A 1PVEA 2ZXIA 1JJ6C 5EGOB 4WXDA 2LVSA 3P7NA 3T8TA 1ZRCA 1OCZH 3MAJA 5FLVA 2CW7A 4KIGA 3WGGA 3ZRGA 4HX8A 3S1MJ 1ZGJA 2WB1A 1Y8RB 4XLAA 5M5XJ 3WG9A 3DTIA 1MBHA 4P9UA 4KITB 2V1NA 4KN7X 4DBQA 1HC8A 4QLCU 4BJTA 1MNDA 3VOEA 2FBIA 3CF2A 4R1HA 1RKWA 5J6XA 1TWFJ 2AXLA 3EUKL 5JLWA 2QEXI 1YJNI 2MLGA 1BW6A 1DQUA 2LNBA 1SAXA 2A68F 2HVRA 3DF8A 4BL0B 4YEJA 1MJBA 1SAUA 2OF7A 5DCMA 2VOOA 5F08A 1IO2A 3QRFF 1K6OA 2VXDA 2WADA 4XORA 3JRAA 1L0OC 1SANA 3IH2A 3KCCA 2MW8A 4ZZDA 2HDWA 2QGUA 3QAHA 5HOOA 1REPC 1OFCX 3S15J 3I3LA 2VASA 4Q4ZF 4XK4A 1EA3A 1JUMA 4ZYGA 1A35A 3U2RA 2EFNA 2EFPA 4A0XA 3REOA 3JRHA 1YRNB 3SEZA 3SDGA 3OYGA 2HWVA 1G3SA 1J5YA 1QNTA 4M6YA 1G2HA 5DS9A 5DYMA 3PL8A 2IGNA 1BR4A 2OC6A 4HV5A 1VQ7I 3IH4A 3KETA 1HXDA 1G6NA 2DT5A 3BZ6A 5FKNA 5H2FC 2OU2A 1D1BA 2L3DA 3JW4A 1MSEC 2IBDA 4A6EA 2IPQX 1IJWC 2L7KA 5CJ9A 4AD9A 4A3DJ 4HNVA 1U5TC 3LWFA 2ZCWA 5E1ZB 4CCLA 2CWEA 3J7ZI 1HDDC 4NB5A 2EPFA 2KT0A 3VFZA 1N77A 1BJZA 2V1DA 4IOCF 2CO5A 2EFOA 5FLXZ 2XRLA 3GUDA 1MMSA 1FJLA 2M7AA 4V2FA 2GQQA 5CVJA 5DD4A 2XGXA 3KLNA 4AIHA 4MQ9F 2XROA 1USTA 5A2QK 2LDUA 1MKMA 1IDYA 2Y30A 3S32A 2LRDA 4FE7A 1YI2I 1AKHA 3BG9A 1EF4A 3CCVI 4OINF 1OCRH 4ZDOA 3CC2I 2L9SA 2G0EA 2Z9OA 4CCNA 2LP0A 4TV7A 4C2TA 4EGZA 2N8GA 1V5EA 4AWXB 3V7CA 1P9QC 3K1NA 1XN7A 2FBKA 1YRNA 3BJOA 2E34A 4XL9A 3ZQ7A 2LC2A 4XOPA 4HF0A 4CZCA 3FM5A 3GZ6A 3O2PE 1OCOH 3O8GA 1A6QA 4GCVA 3QYFA 2HYFA 3OYKA 2M34A 5CVUA 3TW6A 2DFFA 4G6QA 2GIVA 3HKZN 1W7PD 3HYIA 1Z6RA 3LSRA 2E2IJ 2X6YA 2GXBA 2RREA 1NG7A 3FMSA 2QUFA 3IP4B 2JVGA 1MBEA 4ZDLA 3HGYA 4DOZA 4WCGA 4A12A 4N9HA 2Q2EA 1BR2A 4O6JA 1POGA 3T1BA 1LDKB 1WJFA 2I5UA 5J47A 1T0FC 1P2FA 1X4PA 3WE3A 4AUXA 2X1EA 3GWZA 5D4SA 2XF5A 2V6CA 1IC8A 3S2WA 5FKLA 3TOBA 2W00A 3WHCA 4I98B 5IOYA 5E8GA 1V5GA 3H36A 3LAPA 3KP2A 4IKFA 2VJIA 2X0LA 2M4GA 5L3CA 4IQ4A 3CCSI 1NH3A 4P55A 4QPQA 3KPHA 1FOKA 2NS0A 1XTAA 1XSVA 2VBZA 4GXOA 4AC0A 5J8FA 1UG2A 1T33A 1QVUA 2LKSA 1I5ZA 3L9FA 5H6QA 4ENKA 2LD5A 3HRTA 4NQWB 1S8NA 3WTZA 1UCRA 2V26A 3M1EA 5K7ZA 3U9GA 3RPUA 1D1AA 1IXSB 5JHFA 5BPIA 3BJ6A 4BU2A 4OIRF 2X6XA 3BTCA 3PNTA 2CU7A 3HKZA 1T0FA 3GZ5A 2IT0A 2VI6A 4RAFA 4XMYA 4Y52J 4MFEA 3KLOA 5FROA 3VYTB 3M07A 3LA2A 4FQGA 4ETSA 4A3CJ 1HDPA 2Y9YA 5J3LA 1YS6A 3QOEA 1KU9A 2V7FA 3K1PA 3HBLA 2L4AA 2ZNZA 3R6SA 3G71I 4UB8C 4D1QA 1GXPA 4DYCA 5F0HA 3BG6A 3FXMA 4ZDPA 3CCMI 3TBIA 5CVRA 2PX9A 5GAEJ 2EA2A 1MBFA 4BEHA 3C2GA 4ZYHA 2KRHA 3O6BB 1FP2A 5TRDA 3G1OA 4LOCA 2K27A 3FF5A 1TW3A 3GLXA 2FX0A 4ESFA 3T0YA 3AL0C 1T56A 1ZYRF 2MC3A 1STZA 3A0BC 3KYLA 2OAZA 1NHAA 4M6XA 4EATA 1MNEA 5HS7A 2OV7A 2DMTA 3AG2H 1R71A 4E7JA 1J09A 1LDDA 5E17F 1R4NB 4OU0A 2A07F 2KRCA 2RNGA 4II2A 5EG0A 1EH7A 2XHKA 2ZMEC 3J81K 3ASOH 4XRSA 2P6TA 2CH0A 1XGOA 3CP2A 4I0AA 3DPTA 3BTLA 4KISA 3PFIA 1XB4A 2H27A 4OIOF 3SDBA 3ONQA 1ETKA 3HOSA 1BM9A 2FQ3A 1ITYA 1ZG3A 1RC9A 4LIVA 3ZMTA 5ICCA 5DUIA 3BOQA 2DOAA 3DTEA 3BDDA 1HCRA 3D5LA 1F5TA 2E5NA 4KIBA 3HSRA 1I3AA 4F52A 5AONA 3TDZC 3N4MA 3CCRI 1JKOC 2F5VA 1U6GA 4IXAA 3I54A 5J1YA 4A5MA 3J81Z 4IRIA 2VQCA 3UNGC 4QTRA 4L0YB 3RYRA 2QBYA 1YO5C 2PFBA 5C44J 2PQ8A 5E3NA 3HEFA 2CUFA 3NWTA 1T95A 2XV4S 1FOXA 3FBIB 1VNDA 3MEXA 2JWTA 1E2XA 5J8CA 1VQ6I 3M8FA 1YFHA 2QSHX 4MEYF 1QZEA 2HXIA 4IX7A 4I02A 3LL7A 3DPUA 3V8LA 1H9GA 4RA2A 2K5CA 3TO7A 3HOZJ 3F8MA 1U8RA 3MWMA 5CVVA 1M1EB 1SVOA 3RDIA 4D7MA 2VE9A 1RR7A 1VZ0A 3WGHA 1O3TA 2B63J 1KONA 4HOBA 2F4MB 3BR0A 2YUSA 4RGSA 1H88C 1NG6A 4H0EA 2Y0MA 5JHUA 1FNNA 4OWRB 5FD6A 4B8XA 2Z99A 3ABTA 2FOKA 3K1MA 2VIXA 1FT9A 4PGGA 2DODA 3ZPLA 2BV6A 1YLFA 2VB6A 3VYUB 5D5XB 2WAQA 4NBQA 2DA7A 2QVOA 1G3TA 4ASNA 5M5YJ 2XKPA 1V3FA 1R58A 2XAFA 2IS1A 1D0ZA 1HSTA 1LEBA 2ICWG 3A03A 3GMEA 1KQ0A 2H1KA 2IRFG 5EEHA 2EJRA 1S7OA 2NVTJ 5FKOA 4P96A 3KEQA 5EJCA 4JX4A 1KU2A 4GGGA 1QU3A 3BR5A 2MD0A 4LD5A 4J00A 1JUPA 3ROUA 2O8KA 3B73A 2WWYA 2P81A 3WU1B 4LG0B 3OYDA 4PUSA 2E60A 2V1XA 3MCZA 1QA6A 2ADUA 2KFDA 2HZDA 4L9NA 5DM7F 3HOTA 1SMYF 3CC4I 2BY1A 1OKRA 4A0ZA 3H5RA 3HPHA 2BVLA 1UG0A 4FASD 1A31A 1D8JA 1SVLA 2PJPA 4ZYAA 4F7ZA 2LBFA 2VXZA 1W36C 4OIPF 3RKXA 4L18B 3L2VA 3JREA 3IWZA 4M72A 3F22A 3W2WA 3LSPA 3HOYJ 5M3FJ 1QBJA 1V54H 1MBGA 2DA6A 2X6WA 4AYBA 4N4OB 6PAXA 2FUG2 2M0MA 1OYYA 3BG5A 3CDHA 2HVSA 3HHGA 2XRNA 3R0JA 5FFXA 2LTPA 4HG2A 1YJ9I 1RIOH 4RM3A 4PDKA 2CV2A 3ZMUA 2VQGA 3ZGKA 2P0WA 2A3SA 1XMKA 2JTVA 5HLTA 1O3QA 4U87A 3LSHA 1XDSA 2HOSA 4LJZF 2E71A 1EH6A 1O3RA 1DUXC 4RB0A 2R7VA 3A01A 1IDZA 2FOWA 4RM2A 1RKTA 4C3HJ 4XN3A 2KDOA 2M5WA 4RGUA 1WJDA 2ECCA 2LKPA 4RGXA 3GF2A 4KNYA 2EZLA 4PFOA 5D6FA 5E20A 1GLNA 3GVAA 3V8KA 5E18F 3RJPA 3MFKA 3OL3A 5LEJA 4IVNA 3RPQA 3LSIA 3GTJJ 2E5ZA 4A3JJ 2F6CA 2G9WA 2DA2A 3JCUC 4MGRA 1GDTA 4UUTA 2VJ4A 2YR2A 3V42A 3H1CA 2EZKA 1YITI 3JRGA 3DXJF 3C2BA 1ZRFA 1CQTA 4I0BA 4XSXF 2LREA 2ECBA 2R93J 1QQIA 1EH8A 2XSDC 1TNSA 5GAHJ 1P6RA 1S7AA 3I53A 1O3SA 4UUSB 2J5PA 4QSHA 5BNGA 2W82A 2GIZA 3E5QA 3H0GJ 1S3JA 4F92B 3OR1C 2D1VA 2LR8A 2CFXA 3ABUA 1FYLA 4BBSJ 2XAJA 3OMYA 1XSXA 2L0KA 4MO7A 1W5CC 1R1VA 4W97A 3T8RA 1U5TA 2MLKA 2QSGX 2CQQA 3M9AA 4E6KG 2L2OA 1ZGAA 5J1RA 2HS5A 2HKOA 1OCTC 4F91B 4A2UA 2VBXA 1IUYA 2VJJA 2X85A 4B48A 1PUEE 3LFKA 2E1CA 2E2HJ 5C4XJ 2M45A 2DPDA 3DKWA 3CUOA 4WXHA 1BJAA 1ZLJA 3JTHA 1ZTRA 2GXAA 2P7VB 1Y0NA 3HDDA 4LITA 2JA5J 2VL8A 1S7EA 2DFIA 1XCBA 2GZWA 3IKVA 1K79A 2CG4A 3KP4A 3K4BA 5LFAA 3MKZA 1MSFC 2NRAC 2K85A 1W5TA 1GV5A 1WH5A 2O03A 3O3KA 4I01A 4O3MA 4HV6A 3E97A 1ZARA 3VDXA 5DUKA 3FXUA 2LY1A 2IS4A 1XX5A 9ANTA 2EWNA 3IWFA 2DJIA 2X51A 4E7KA 3QPHA 3H9QA 1VQOI 2CMPA 2A5YB 1DPRA 2XAHA 1LFBA 3AAFA 2JN6A 3UKGA 1JKQC 4M3EA 1RRJA 1MDMA 3C3WA 3CTAA 1PJRA 2VPRA 5CLSA 4DGWB 3HRUA 3ERED 3J80K 2VOPA 1MW7A 2OA4A 1WI3A 3GFIA 4ZTFA 3HOWJ 2CSOA 3L2WA 2DMUA 1R49A 4RB1A 4UNOA 2IP2A 3ZN0A 4OIQF 2DDBA 1MGTA 1PYVA 4NUBA 3ZMSA 1ZELA 2E1OA 4HDUA 3PM1A 5ILUA 4MFDA 4FE4A 2ZC2A 3SZGA 2UXXA 3LSTA 4XLNF 1WKMA 1X1AA 1ORKA 5B3SH 2AQEA 3OIOA 2EFWA 1VFCA 1ZRDA 2R92J 1J0RA 1F36A 1S72I 4A3KJ 1IW7F 4Z2YA 3S2HJ 1LE8A 1UHMA 2VODA 2DA3A 4HQMA 4BQOA 3KZIC 1IN4A 4PJMA 1I1SA 2FNAA 5D5WB 1YHQI 3OIPA 3AG3H 1Y6IA 4BH9A 5LGTA 2LG4A 4R79A 1QVTA 2VN2A 3FXRA 4KFCA 4FISA 2H6BA 2DFEA 2TRTA 4A93J 5IYBJ 3H3UA 5F1RA 1U8BA 1Z67A 4XQFA 1Y56A 1ZG5A 2Y75A 2OQGA 2JA2A 4NC7A 1R23A 1FTZA 4FETA 4NQWA 2VKVA 3OYIA 2NNNA 3QYBA 3DEWA 3AL0B 1X1BA 2F4IA 1UB9A 1LFPA 1C0WA 1X3UA 1JHFA 2FF4A 4HA8A 4DYRA 2DT7B 1GVDA 1OYIA 3H9GA 3TO6A 1X1PA 3NWSA 4Y3OA 2CRGA 2LLKA 2A61A 1LVKA 4A6DA 1IRFA 2RKHA 3CESA 1VQ9I 3FXOA 2X9DA 2ZBKA 4PJNA 1U3EM 1W1WE 4U7DA 4XR6A 4FHTA 1LB2A 5FD5A 2BEOA 1ON1A 4QPOA 1B8IB 4ON0A 3F0CA 1T6SA 4RBOA 1TT0A 3QWLA 3SZTA 2WV1A 5GPCA 4CICA 3RSNA 4IHYA 4RMNA 2A69F 3CJTB 3GTKJ 3LSKA 3GBGA 2OCEA 4M3DA 1WJEA 1ENHA 3SHFA 3BR3A 3CDLA 2ISYA 2BW3B 1UJ8A 2O7OA 4HYEA 1JGGA 2B0LA 2JQ7A 4IJAA 2NVXJ 5C4JJ 3S8PA 4PZJA 2ELHA 3A01B 1VQ4I 1IUFA 3MZ8A 1FBUA 1W5SA 4PJJA 1PUFA 1R9TJ 2BZTA 2IVMA 5E1WA 3CCEI 2TCTA 1VTNC 2B7EA 3P9IA 3M3YJ 1FOWA 3HTUA 4RAYA 2BGCA 2LH9A 2HOEA 4HF2A 1K4SA 2IGOA 1XGMA 3QQAA 4XKBA 2V9VA 3OYJA 1IN6A 4BJ6C 4YFKF 5HS8A 5HLIA 5AIQA 1S9HA 4D9JA 4L9JA 1ZQ3P 3E5UA 2O5RA 4CCKA 2IJLA 1QPMA 1ZN2A 1XCVA 2CUJA 2G7HA 2HXOA 3NQOA 3OYEA 3OV8A 3S93A 1A6IA 2VBWA 5E3LA 3CO6C 4ZTJA 1ZREA 3OR2C 1Z9CA 2W24A 5IPAA 1W0TA 4ZJZA 3EPZA 3ML6A 1X19A 5DCFA 1APLC 5FFZA 4H4KC 1XGNA 4IRHA 1YJWI 2PMZA 2X48A 1P4XA 3BPVA 2WV0A 4LK1F 1BI2A 3A02A 1Z05A 4X0GA 1ETOA 1SFUA 2MFZA 5GAGJ 2ZFWA 1ETVA 3BR6A 1JTYA 1GT0C 2MC4A 4AM3A 3TKYA 2ZXJA 3OS1A 1ETXA 1W0UA 1H0MA 3MZYA 1WWXA 1TWGJ 2LBFB 3C18A 2ZSIB 2FJ1A 3ECOA 1RR8C 2R5YB 2F5DA 3M8JA 1I39A 2LY9A 1MD0A 2XAUA 4CO8A 3HTSB 1LEAA 4ENJA 2EV0A 1HW5A 4LB6B 4E7SA 5LBQA 4GRIA 1LKXA 5FJ8J 3CCLI 4II3A 4G7HF 3C1DA 4PSWA 2BVMA 3LSMA 3L2CA 3CP8A 4CGZA 4LG0A 1IN5A 1JXSA 2HU9A 3F9KA 3R0AA 3KP3A 1MNMC 1WPKA 4BKXA 4Q48A 4BGDA 1HBXG 1YW9A 3DP7A 4A3EJ 2M3AA 4G9YA 3IV5A 5FKKA 4B47A 3WTWC 5E79C 3BCAA 2UUZA 3HRMA 4UUVA 1D0XA 3BWGA 1W7PB 1BOAA 2OTJI 3FX3A 4XKVA 5IP7J 1U9NA 4M9ZA 2CGPA 2QKMB 1SD5A 2FU4A 1SC7A 4ZH4F 3KP6A 1BIAA 3I0TA 4I99C 3BR1A 3VYSB 3MKWB 4EM0B 2EIKH 1U9OA 4EJOA 4V2GA 2JK3A 3PNVA 1G8XA 3UR3C 5BS6A 2E1MC 5K1YA 2ZJ2A 2XPUA 2ACJA 2A05A 2AS5F 2EV5A 1QGPA 4X6AJ 1YX5A 4BHPA 4RB3C 1MBJA 3OS0A 3N97A 3GTGJ 3HZJA 3ZQQA 1GHCA 3K9TA 2HQRA 2P5LC 3BG3A 4IEJA 1B9MA 4UVBA 3LSJA 4AU7A 4GFBA 2Y0SN 2FE3A 1R4MB 3G2BA 1FIPA 2OZUA 2LKXA 3E0JB 1WJAA 2R0QC 3F23A 1F1ZA 2LSOA 4L9TA 2FQ4A 3FMRA 4CYCB 4E7LA 1YE9A 4WX9A 2KIMA 1J59A 2M7BA 1IN8A 4N4NB 3BZCA 3IC7A 3BP8A 4C3IJ 2ISZA 2A6HF 3GW2A 2B9SA 1KYWA 2PG4A 1OCCH 3H35A 3A1YA 3QOPA 3AFHA 2STWA 4FX4A 2QCOA 1Q1HA 4R8HA 1FSEA 4DNCA 3BLYA 4ESJA 1YIOA 5F6FA 1B4AA 2JA6J 2M87A 1T98A 4PJLA 5EDNA 1V55H 4FX0A 4U0WA 5E1XA 2MH2A 4P5OA 4E70A 4DZPA 2DAOA 4KMUX 1OYWA 2CUEA 3C2HA 4IPAA 3KFWX 4PJ0C 3CD6I 5JVGF 2HOTA 5K5QA 1TW2A 2F5FA 4Y13A 3NRVA 2GA2A 4IRGA 2YU9J 2RQPA 4A3FJ 3BQZA 3OOPA 2X6OA 1E3OC 1WH7A 1R5GA 3WTUC 2JPBA 2PN6A 2BHZA 1VF9A 4AYBN 4YFNF 3DEEA 5GP9A 1O57A 4G8XA 3ZQGA 3J7AO 3JRCA 4V19K 4Y33A 3EYYA 5F1JA 1DU0A 3WHBA 2JZYA 3OYLA 1HSJA 5EGOA 4NDLA 4AVZA 5IT9K 1AOYA 1E3HA 1JUSA 2DBBA 3VB2A 3ZQLA 4B4CA 5B1BH 5HDNA 4S05A 3B02A 1UZCA 4DBRA 3S17J 1D0YA 3OSFA 2K3FA 3BG7A 2NOGA 2R7FA 4CZZA 4G7ZF 2UWMA 4N0BA 2QM3A 2HTSA 2D1HA 2R7QA 2L54A 4XLCA 3K4MA 2ELJA 5ERIA 2R5ZA 2HEOA 5K5RA 2EA4A 4MQVA 1ULYA 4KUMA 1W4MA 1T2KA 5LD2C 3H5AA 1WVRA 2NXNB 3HL2A 2GXGA 3RZDJ 1NK3P 4HAMA 1P4AA 3GTPJ 2IA0A 3PO3J 2X1CA 3EUAA 4J19A 1IGNA 2HOAA 3MKYB 3CCQI 2ZJQF 2MABA 2YS9A 5B5EC 2FXAA 2XPVA 1X2NA 3DPLC 2IS6A 1S5LC 1ZKGA 3S3OA 2QLZA 1X3ZB 3TQNA 2GM4A 5EEAA 2I10A 5HLHA 3U1KA 1IRXA 2KJBA 3JRDA 2E1NA 2RN7A 1ZAOA 4L5IA 3VSLA 1RUNA 1ACIA 4W1UA 1RPWA 3SFIA 3D5SC 1GXQA 2LY2A 4MTEA 5E8IA 4WXCA 3ABKH 1F9NA 4YIIA 1OJLA 1YX3A 2ME0A 3AG1H 5D8KB 3K70C 1CGPA 3N05A 4G94A 3OL4A 2CQXA 4G12A 3AKZA 4EEFG 1H89C 4MHGA 3I59A 2ZMEA 3OYMA 4YG2F 4BQAA 3RTRA 2IGMA 1ZR4A 3WTSC 3DFGA 1TNTA 3K10A 3R4KA 1TWCJ 4GDFA 3TL4X 2EK5A 2EIMH 1J9IA 2EILH 3ERMA 2XKOA 1EKEA 3CF5F 3I58A 3OYFA 5J1UA 3W6VA 1JHHA 1X58A 2ZO4A 5CPRB 4EMSA 1U2WA 1KGSA 1LVAA 5BMZA 4L0ZB 1RZ4A 2FRHA 5TJJA 4RS8A 3Q0VA 3G6EI 3FM3A 1FP1D 2W57A 4AIDA 1FSHA 3KE2A 1MJAA 3OYAA 2OTLI 3A4CA 3LQRA 2V9KA 2A6EF 4N9IA 1TBXA 3ZMDA 5D8LB 5FRMA 3SYTA 1FZPB 4UY8I 2ZSHB 2W1OA 1LE8B 1XGSA 1D1CA 4EJVA 3CLQA 1DPUA 4F55A 1Z7UA 3PJRA 2M9HA 5F64A 2DTRA 3EUHA 1X4OA 4ZYDA 3WU2C 1YW8A 2JPCA 2WB1N 2JRMA 3L2QA 2L7FP 1A04A 2DMQA 3E5XA 2WAQN 3IH3A 2UXNA 4BXUA 3VWBA 2KZVA 2BY2A 3DU6A 1W36D 1CF7B 5F0FA 2LYCA 3VEPA 5LLQA 4IHWA 2XUBA 2DW4A 4M3GA 4FCYA 4JK1X 1ETQA 2HQNA 2ZXWH 3LMMA 3WE2A 3OYCA 1LQ1A 4ESBA 3WTVC 4JX5A 3HSFA 1JT0A 2BW3A 5HS9A 5JFRA 1I3QJ 3K7AJ 1SEUA 2L9NA 2K9QA 4U0VA 2IA2A 2Q8KA 2HDDA 2KIUA 3SFZA 2H09A 1WSUA 2HVQA 4LLGF 4OOIA 2R7UA 4P9FA 4BBRJ 2W84A 2CV1A 1WGXA 2W85A 1R1UA 1ZK8A 3BJAA 4NC8A 1J75A 2R7SA 5KAFC 2GOMA 2PMZN 2M1BA 4O5VA 4EJTA 4BQNA 4M9XA 1BBYA 3IAS2 5L3DA 4CH7A 3I4MJ 2VC0A 2DYRH 4Y4RA 5TGTA 4LK0F 1BI3A 1OMIA 2NS7A 1AA7A 3DBHB 1B72B 1ON2A 3RKQA 3GEZA 2H1LA 4BNCA 4UB6C 3MD2A 2VPLA 1IZ1A 1WJBA 1HKTA 4CCMA 2K4BA 2KKOA 2Y69H 3HPGA 1VQKI 3QU3A 3W6KB 3WTYC 2KDZA 1HW2A 2O3FA 1Y1VJ 1Y39A 4F93B 1YW7A 4BS9A 3PFYA 4CCJA 3K70D 2R5YA 3EDPA 1FTTA 1MMNA 2F4OB 3QP5A 4M73A 2MGQA 2XASA 3ZQFA 2VLAA 4KJZA 1HA8A 4BAYA 4XNFA 1MJ9A 1FX7A 2DCEA 2FMYA 2XAGA 2EFQA 3TP3A 4LFUA 4ZC3A 4RB2C 2GA1A 1IF1A 4ENNA 3U1DA 1P7IA 3F6VA 2WC2A 5EEGA 2KPMA 1A5JA 3ZR8X 5C3EJ 3BQYA 1PDNC 3KX2A 2WBMA 1N75A 4E7ZA 5LGUA 3S1RJ 2UV1A 1ZHFA 1O7LA 1IRGA 4U7BA 2KIQA 3FXLA 3Q5FA 1FPQA 4BHBA 5FB2A 1BC7C 2OCCH 2CW8A 5D5VB 1L3LA 4HEA2 2HNHA 5EZHA 2EBIA 1KZHA 3GTLJ 2JT1A 4P1WA 4IQJA 2QQAA 1YOVB 2BOLA 4B3XA 3ZXSA 2VE8A 2ZFUA 2R7RA 2CYYA 4DYQA 1XD7A 1J2XA 2ZXHA 4XM3A 4RAZA 4YELA 1D5YA 1MMDA 2L7ZA 1ZR2A 2DXIA 2BXZA 4XRFA 1BI0A 3HOUJ 3S1NJ 4B3AA 3DLLF 1U0JA 2D5VA 3K2AA 2K9LA 3M4OJ 1K4TA 1OPCA 1D8KA 4ANJA 3HOXJ 1MDMB 4AVPA 5LGNA 1OQYA 4UV8A 2K7LA 3WGIA 4XIDA 1TQPA 3H92A 1NTCA 3L00A 1Z0XA 3HRSA 4M74A 3V8JA 4MNUA 1I27A 3FIWA 5HLGA 5BQTA 3MZHA 4D5CA 2HPIA 2BY3A 1KU7A 2NYXA 2R7OA 4I6ZA 2HGCA 5LRRA 1S6LA 5EZGA 3TMOA 1XDUA 2TDXA 4YIFA 4WK8F 1T38A 1ZH5A 5FRNA 2XPWA 3I4NJ 3BY6A 1DP3A 3ZMZA 3OYHA 1HKSA 1SFKA 2XGDA 3BR2A 2E1MB 5GTHC 3PSFA 2QQ8A 3Q0WA 1VQPI 3S2DJ 1XG1A 3CJRB 1SMTA 5HODA 2FMLA 2BBYA 3IL2A 2VQLA 5LHIA 3K2ZA 2E36A 1SFEA 2XDVA 2XF6A 2ZNYA 4XRMA 1FYKA 4A3LJ 3F72A 2CJJA 2PMHA 2V4JC 3JRBA 3S3NA 2EIJH 3PUFA 3RCOA 3NARA 3JRIA 3GTMJ 1TLHB 5M5WJ 2I8DA 3HUGB 3RKYA 1G3YA 3ISPA 4BDYA 3FKJA 2HI3A 5IYCJ 4IO9F 1K78B 1DDNA 3FDYA 5M3MJ 4YFXF 3BTIA 4E4HA 5LRSA 1UHWA 1XMXA 2VONA 1BL0A 2OQRA 3HJEA 2K9SA 1X1CA 4UVAA 3OYNA 5EYRA 1B59A 1UAAA 3QODA 4HSTA 3WU0A 2F2EA 5HDGA 2DQRA 1DGWY 2NAZA 3I4PA 2STTA 4EJUA 1BA5A 1Y0UA 2AXTC 5F0CA 2KZGA 3G73A 1V4RA 1JT6A 2GAUA 4RLFA 1R22A 3LQQA 1YYVA 3IKTA 2ELKA 5CQEA 4HLXA 2D45A 1TZLA 3CJNA 2PI0A 2CQKA 1Z6TA 4WWCA 2P4WA 3DCFA 3H0DA 5D4RA 3I5UA 1NK2P 4OMYA 3E6BA 2O0YA 4HLYA 1R36A 4IL6C 1HLVA 5JLXA 5ICEA 5IT9Z 3W3CA 2GLOA 5J4YA 1WJCA 2L02A 2RV8A 3HC7A 2Y31A 4PCQA 3J7YJ 5ICGA 2Z5UA 2CQ7A 3B6AA 4BE0A 2KP6A 2WA0A 4CHUA 3C7JA 5JI6A 1E3PA 2EZHA 4EM2A 3A2KA 5KVRA 4QIWN 1Y1WJ 1G4DA 1SD6A 1WFXA 2H94A 4CDGA 3EYIA 3JSPA 1F43A 4AIKA 4XICA 2VBYA 2P7CB 2W48A 2K9MA 2VKDA 3M1CA 1Y8QB 3MKLA 1KA8A 4MTDA 3ABMH 3BROA 2RVCA 3MN2A 4DZJA 2Q1ZB 1R00A 1MH4A 3TP0A 3CMAI 3WG7H 4HNTA 3IUOA 1S29A 1RESA 2DI3A 4LMYA 2Z33A 5DM6F 1W7PA 3I64A 2K02A 1MH3A 1K78A 1SD4A 4XKCA 4RLQA 1UELB 3BZKA 2BYVE 5IOZA 4IHXA 2A5WA 2EINH 4IHVA 2A6TA 5EF6A 2WTEA 4C9YA 4Y15A 3RKWA 3LA7A 2HR3A 3SJMA 3DQVC 3NAUA 4UVCA 2VT3A 3G4SI 1IRZA 1QZZA 3OOUA 2R7DA 3BT9A 3S3MA 2K9NA 3CCUI 2VT2A 2FD5A 2KJCA 3FKIJ 4LB5A 2YSRA 3KEYA 3BC8A 1Z91A 3CLOA 2DLLA 2KLOA 4C3JJ 1PP8F 3TW7A 1YG2A 1XSDA 3P9CA 1SVMA 2FEZA 1A36A 3CC7I 1N78A 1E0EA 1GUUA 3I55I 3DBLB 2ETHA 3CDIA 3E6DA 4FT8A 2FBHA 1RI7A 3RPUD 2JA8J 1RETA 4LIUA 4UXNA 5B1AH 3EETA 4XLPF 1K61A 1OR7C 2NS8A 2IAIA 2XGCA 3F3XA 2Z16A 4XLEA 2NOJB 2OJED 4HRIA 3JSOA 2GWRA 3E6MA 3I71A 2FSWA 2IEKA 1HW1A 1TC3C 1Z77A 3R60A 2CW0F 3SEQA 3K4JA 3VODA 4Y17A 3COAC 2HDCA 2NNYA 3DKYA 2F5EA 5LHGA 5JVTA 2QBYB 4I09A 2OBPA 3FBNB 1T39A 4GYGA 2V9PA 5J40A 1IN7A 4YRVA 4L9VA 3A0HC 3DBRB 1VQLI 1VQNI 2WY8Q 4XRSG 5KK1A 4RGRA 4FTHA 2GBYA 1AHDP 4HX7A 4G7OF 1BW5A 2DMNA 2IXSA 3CQZJ 1VQ8I 4CUGA 2E19A 3FHNA 2L5QA 2RGVA 2MBFA 5IY5H 2QA4I 1U78A 1LPQA 1DP7P 1FIAA 2P6SA 3WTXC 5K7FA 1O7FA 3ZQIA 3L1PA 4DW6A 1BI1A 4LLNA 1XPXA 2K4JA 1MBKA 2HYGD 1HF0A 3DV8A 3Q9VA 1PUFB 5FKMA 3QU6A 4D7NA 2MD5A 2Z3YA 3ZCOA 4CYDA 4DQ2A 5HNHA 2VUMJ 2R7ZJ 4S04A 2EV6A 1WI9A 3AG4H 3EUHC 3K0LA 3T5XA 3ZMVA 3CUQB 2R3SA 5D5UB 5H20A 4UHTA 2Q0OA 3HUGA 3CUQC 5J4VA 4QWQA 4E7IA 2WAEA 1N25A 5CQGA 3IRQA 4PFPA 4JYKA 1MMGA 4BEHB 1BOBA 1P7JA 1FWZA 1KQ9A 4KA4A 2XB5A 2JVHA 3ZQCA 4B1RA 5D6EA 2P8TA 2DA5A 2L4MA 1X3WB 4HPQA 1P4WA 2H8RA 3FMQA 5HDKA 1R6RA 1UMQA 2UZKA 4BQQA 4KT5C 1KU3A 2IW5A 3LA3A 4XBFA 2E7XA 3OSGA 3PUBA 1D5VA 3KIOA 2ZKZA 1FC3A 2XC7A 3LAJA 3IHUA 4RDUA 1R1TA 3BPXA 4CCOA 4B09A 4EV0A 1RNLA 5DDGA 4ENMA 1I1GA 4HSRA 3S16J 1EJ9A 4K2EA 2LFBA 4MIMA 3P5JA 5FLMJ 1BC8C 1IAWA 3FWEA 4BXXJ 4OAZA 2OPTA 3E3VA 5L3EA 2JA7J 1Z1DA 3H3ZA 3HXLA 2JSCA 1B8IA 1B1BA 3JTGA 4XLFA 3F8NA 1SD7A 1ONVA 2XVCA 3HIFA 1R5ID 4X1EA 2K40A 5IP9J 4G6DA 2VC1A 3GLLA 2JRTA 2K86A 2M0CA 5DEQA 5ILSA 4HF1A 3W2AA 4CYCA 2ZMEB 2LOOA 2VJ5A 3ESWB 5A2QZ 1I6HJ 3E6CC 2Q2EB 3V4GA 1Z3XA 4UV9A 2W7NA 2QENA 3W2VA 3OS2A
chains in the Genus database with same CATH topology
2PLYA 2HZTA 2PMUA 3PQJA 4WF2A 1F4KA 1HKQA 5JR3A 1H9TA 4OMZA 3F21A 4KYWA 3SQNA 3PQKA 1G3WA 2LF8A 4Q5SF 3RYPA 2DQLA 3ECHA 2QWWA 3ZP5A 4IF4A 3FHZA 2OZ6A 2QQ9A 2FA5A 5CYVA 1TQMA 2O6GE 2P5VA 3M8EA 5AIPA 1I6XA 2DK5A 4U88A 2O61A 3P9KA 5IT3A 1U5TB 3EQLF 4HZFA 4HX4A 5L3BA 3HHHA 5ICFA 5L3FA 3G3ZA 3ELKA 2F5CA 2G7UA 4EJWA 3GFMA 1WQ2A 2IA1A 5K5OA 1LDJA 1GVJA 4LGWA 2M8EA 5L3GA 3TGNA 5FGMA 5ED4A 4HW0A 4HDVA 3ZN1A 4JBAA 1FYMA 3TO9A 4HQEA 3V7RA 3GX4X 1LJ9A 4EVIA 4BHCA 1WRJA 1YS7A 1BN5A 4KIFA 1B9NA 3ULQB 3GFJA 3KEOA 2Y48A 2BE5F 4KDPA 2FNPA 4EM1A 4U0YA 3FZVA 3WODF 1HQCA 1JGSA 3WTTC 2P5KA 2YX7A 1TTYA 2OD5A 2COMA 2HTJA 1ODDA 3QPTA 3W6JB 4IHTA 1IXCA 1QZYA 4A5NA 1KQ8A 2HFHA 2KRFA 4JQFA 4IHSA 3F8CA 1B6AA 4PGHA 2E7WA 5DCMB 3K69A 1TQIA 4HBLA 3F6OA 2D2WA 1CF7A 3SXYA 2ESHA 2RDPA 3F8BA 2PBIA 2PEXA 2V79A 2MA3A 5LHHA 3IRRA 2RNJA 4D0PA 4L5JA 2DK8A 1D3YA 5H6RA 3MQ0A 2DU9A 1IXRC 2H6CA 2YPRA 4BYYA 4CXFA 4KN4X 1USSA 1RUOA 2RC4A 4NHJA 2XIGA 2V1UA 1R7JA 2QYOA 3CUQA 1JE8A 3SZPA 1AWCA 3D0SA 2LF7A 2W25A 5HVQC 3M7GA 2YU3A 1FBSA 2DO7A 1J7KA 1SFXA 3KP5A 3TOAA 5CVIA 3NEUA 5BPDA 2EB7A 4MEXF 1FY7A 5DV5A 5ILVA 3F8FA 4I7HA 2XAQA 3HSEA 2L01A 2HKXA 4I2OA 5FLXK 1BIBA 4M9SA 4KMFA 3GYHX 1UFMA 2QZ8A 1E17A 1XMAA 3KP7A 2KIFA 3RI4A 3GO5A 3JAMK 4ZZLA 1YTYA 3DEUA 2QQBA 4EGYA 1MZBA 3I59B 4M71A 5LEKA 4KICA 1P92A 3Q9SA 2C6YA 2M30A 1PP7U 3L7WA 2DPUA 3KZYA 3JAMZ 3QP6A 4AIJA 4ZYEA 2YX4A 2J5OA 3V7SA 1EV7A 5BOXA 4Q47A 1ZLKA 1K7AA 1FLIA 4XSZF 1QO0D 2ESNA 4LLLA 5DD8A 3L09A 4A0YA 2X4HA 1OR7A 1LNWA 3TDUC 3J80Z 3RIRA 4EQQA 2O8XA 2MH9A 3KZZA 3FXQA 1ZG1A 3GXOA 4GO1A 5FO5A 3R61A 4GYIA 1FBQA 3CO7C 1KYZA 1YQAA 1R5HA 3GFLA 4WXDA 3P7NA 3T8TA 1ZRCA 3MAJA 3WGGA 4KIGA 4HX8A 1ZGJA 3WG9A 4P9UA 4KN7X 4QLCU 3VOEA 2FBIA 4R1HA 5J6XA 2AXLA 2MLGA 1SAXA 2LNBA 2A68F 3DF8A 1MJBA 5DCMA 2VOOA 3QRFF 1K6OA 1L0OC 3KCCA 4ZZDA 3QAHA 5HOOA 1REPC 4Q4ZF 4ZYGA 3U2RA 2EFNA 2EFPA 4A0XA 3REOA 2HWVA 1G3SA 1J5YA 1QNTA 4M6YA 5DYMA 4HV5A 3KETA 1HXDA 1G6NA 2DT5A 3BZ6A 2OU2A 3JW4A 2L3DA 4A6EA 2IPQX 4AD9A 5CJ9A 1U5TC 3LWFA 2ZCWA 5E1ZB 2CWEA 4NB5A 3VFZA 2V1DA 2CO5A 2EFOA 5FLXZ 3GUDA 2GQQA 5CVJA 5DD4A 2XGXA 3KLNA 4AIHA 4MQ9F 2XROA 1USTA 5A2QK 2LDUA 1MKMA 4OINF 2Z9OA 4TV7A 4EGZA 4AWXB 3V7CA 3K1NA 1XN7A 2FBKA 3BJOA 3ZQ7A 4HF0A 3FM5A 3GZ6A 3O2PE 4GCVA 2HYFA 5CVUA 4G6QA 2GIVA 1W7PD 3HYIA 1Z6RA 2GXBA 3FMSA 2QUFA 4WCGA 4A12A 4N9HA 2Q2EA 4O6JA 3T1BA 1LDKB 1P2FA 3WE3A 3GWZA 5D4SA 2V6CA 3S2WA 3TOBA 4I98B 5E8GA 3LAPA 3KP2A 2X0LA 5L3CA 4P55A 1FOKA 2NS0A 1XSVA 2VBZA 4GXOA 5J8FA 3L9FA 5H6QA 4ENKA 1I5ZA 3HRTA 1S8NA 3WTZA 1UCRA 3M1EA 3U9GA 3RPUA 1IXSB 5BPIA 3BJ6A 4OIRF 1T0FA 3GZ5A 2IT0A 3KLOA 3LA2A 4ETSA 1YS6A 1KU9A 3K1PA 2L4AA 2ZNZA 3R6SA 1GXPA 5CVRA 2EA2A 4ZYHA 3O6BB 1FP2A 5TRDA 2K27A 3FF5A 1TW3A 3GLXA 4ESFA 3T0YA 1ZYRF 2MC3A 1STZA 2OAZA 1NHAA 4M6XA 5HS7A 1LDDA 5E17F 4OU0A 2A07F 1EH7A 2XHKA 3J81K 2P6TA 1XGOA 4I0AA 3DPTA 3PFIA 1XB4A 2H27A 4OIOF 3HOSA 1BM9A 2FQ3A 1ZG3A 3ZMTA 5ICCA 5DUIA 3BOQA 3BDDA 3D5LA 1F5TA 4KIBA 3HSRA 5AONA 3TDZC 3N4MA 1U6GA 4IXAA 3I54A 4A5MA 3J81Z 4IRIA 4L0YB 3RYRA 2QBYA 1YO5C 2PFBA 2PQ8A 2XV4S 3MEXA 1E2XA 5J8CA 3M8FA 1YFHA 4MEYF 4I02A 3V8LA 1H9GA 3TO7A 3F8MA 1U8RA 3MWMA 5CVVA 3RDIA 2VE9A 3WGHA 1O3TA 4HOBA 4RGSA 4H0EA 2Y0MA 5JHUA 1FNNA 5FD6A 4B8XA 2Z99A 3ABTA 2FOKA 3K1MA 1FT9A 4PGGA 3ZPLA 2BV6A 1YLFA 5D5XB 2QVOA 1G3TA 4ASNA 2XKPA 1V3FA 1R58A 2XAFA 1HSTA 1LEBA 1KQ0A 2IRFG 5EEHA 2EJRA 1S7OA 4P96A 3KEQA 1KU2A 4GGGA 4LD5A 3ROUA 3B73A 2WWYA 3WU1B 4LG0B 3MCZA 2V1XA 2ADUA 4L9NA 3HOTA 1SMYF 1OKRA 4A0ZA 1D8JA 2PJPA 4F7ZA 2VXZA 4OIPF 3RKXA 4L18B 3IWZA 4M72A 3F22A 1QBJA 6PAXA 1OYYA 3CDHA 3HHGA 2XRNA 3R0JA 5FFXA 1RIOH 4PDKA 3ZMUA 2A3SA 1XMKA 2JTVA 1O3QA 1XDSA 4LJZF 1O3RA 1DUXC 1EH6A 4RB0A 2M5WA 4RGUA 2LKPA 4RGXA 3GF2A 4KNYA 5E20A 5D6FA 3GVAA 3V8KA 5E18F 3RJPA 3MFKA 5LEJA 4IVNA 3RPQA 2G9WA 4MGRA 2YR2A 3DXJF 1ZRFA 4I0BA 4XSXF 1QQIA 1EH8A 1TNSA 1P6RA 1S7AA 3I53A 1O3SA 2J5PA 3E5QA 1S3JA 2D1VA 2CFXA 1FYLA 3ABUA 2XAJA 1XSXA 1R1VA 3T8RA 1U5TA 2MLKA 3M9AA 1ZGAA 2HS5A 2HKOA 4A2UA 2VBXA 1IUYA 1PUEE 3LFKA 2E1CA 2DPDA 2M45A 4WXHA 3CUOA 3DKWA 1BJAA 1ZLJA 3JTHA 2P7VB 2DFIA 1XCBA 2GZWA 3IKVA 1K79A 2CG4A 3KP4A 2NRAC 1W5TA 2O03A 4I01A 3O3KA 4O3MA 4HV6A 3E97A 1ZARA 5DUKA 3FXUA 2EWNA 3IWFA 3QPHA 2A5YB 1DPRA 2XAHA 3AAFA 1MDMA 3C3WA 3CTAA 5CLSA 3HRUA 3ERED 3J80K 2VOPA 3GFIA 2OA4A 2CSOA 4RB1A 4UNOA 2IP2A 3ZN0A 4OIQF 1MGTA 3ZMSA 4HDUA 5ILUA 2UXXA 3LSTA 4XLNF 1WKMA 2EFWA 1ZRDA 1J0RA 1IW7F 4Z2YA 1UHMA 2VODA 4HQMA 1IN4A 1I1SA 2FNAA 5D5WB 4BH9A 5LGTA 4R79A 2VN2A 3FXRA 4KFCA 2H6BA 3H3UA 5F1RA 1ZG5A 2Y75A 2OQGA 1R23A 4NQWA 2NNNA 1UB9A 1C0WA 1X3UA 1JHFA 2FF4A 4HA8A 1OYIA 3TO6A 4A6DA 2A61A 1IRFA 2RKHA 2ZBKA 1U3EM 4U7DA 4FHTA 1LB2A 5FD5A 2BEOA 1ON1A 4ON0A 1T6SA 3SZTA 4CICA 2A69F 3SHFA 2ISYA 4HYEA 2B0LA 4IJAA 4PZJA 2ELHA 1FBUA 1W5SA 2IVMA 5E1WA 1VTNC 3P9IA 3HTUA 4RAYA 2BGCA 2HOEA 4HF2A 1XGMA 2V9VA 1IN6A 4YFKF 5HS8A 5HLIA 5AIQA 4L9JA 3E5UA 2IJLA 1QPMA 1ZN2A 1XCVA 2G7HA 3NQOA 3OV8A 2VBWA 3CO6C 1ZREA 1Z9CA 2W24A 3ML6A 5DCFA 5FFZA 1XGNA 4IRHA 1P4XA 3BPVA 2WV0A 4LK1F 1BI2A 1Z05A 1SFUA 2ZFWA 3TKYA 2ZXJA 1H0MA 3MZYA 1WWXA 3C18A 3ECOA 2F5DA 3HTSB 1MD0A 4CO8A 1LEAA 4ENJA 2EV0A 1HW5A 4LB6B 5LBQA 4G7HF 3C1DA 3L2CA 4CGZA 4LG0A 1IN5A 1JXSA 3R0AA 3KP3A 4Q48A 1HBXG 1YW9A 3DP7A 4G9YA 3WTWC 3HRMA 4UUVA 3BWGA 1W7PB 1BOAA 3FX3A 4M9ZA 2CGPA 1SD5A 2FU4A 4ZH4F 3KP6A 1BIAA 3I0TA 4EM0B 4EJOA 5BS6A 5K1YA 2AS5F 2ZJ2A 2ACJA 2EV5A 1QGPA 4BHPA 4RB3C 3N97A 1GHCA 3K9TA 2HQRA 2P5LC 4UVBA 1B9MA 2FE3A 2OZUA 3F23A 1F1ZA 2LSOA 4L9TA 3FMRA 4WX9A 2KIMA 1J59A 1IN8A 3IC7A 3BP8A 2ISZA 2A6HF 3GW2A 1KYWA 2PG4A 3QOPA 2STWA 4FX4A 1Q1HA 4R8HA 1FSEA 4DNCA 4ESJA 1YIOA 5F6FA 1B4AA 2M87A 1T98A 4FX0A 4U0WA 5E1XA 2MH2A 4P5OA 4ENMA 4E70A 2DAOA 4KMUX 1OYWA 4IPAA 3KFWX 5K5QA 1TW2A 2F5FA 4Y13A 3NRVA 2GA2A 4IRGA 2RQPA 3OOPA 1R5GA 3WTUC 2JPBA 2PN6A 4YFNF 1O57A 4G8XA 3J7AO 3EYYA 2JZYA 1HSJA 5IT9K 1AOYA 2DBBA 3VB2A 5HDNA 4S05A 3B02A 2R7FA 4G7ZF 4CZZA 2UWMA 4N0BA 2QM3A 2HTSA 2D1HA 2L54A 5ERIA 2HEOA 5K5RA 2EA4A 4MQVA 1ULYA 4KUMA 1W4MA 1T2KA 2GXGA 4HAMA 1P4AA 2IA0A 2FXAA 3DPLC 2QLZA 3TQNA 5HLHA 2KJBA 2E1NA 2RN7A 1ZAOA 4L5IA 1RUNA 1GXQA 4MTEA 5E8IA 4WXCA 1F9NA 4YIIA 5D8KB 1CGPA 4G94A 4MHGA 3I59A 2ZMEA 4YG2F 4BQAA 3RTRA 3WTSC 3DFGA 1TNTA 3R4KA 2EK5A 1J9IA 2XKOA 3I58A 1JHHA 2ZO4A 4EMSA 1U2WA 1KGSA 1LVAA 5BMZA 4L0ZB 1RZ4A 2FRHA 5TJJA 4RS8A 3FM3A 1FP1D 2W57A 1FSHA 3KE2A 1MJAA 3LQRA 2A6EF 4N9IA 1TBXA 3ZMDA 5D8LB 1FZPB 1XGSA 4EJVA 1DPUA 1Z7UA 5F64A 2DTRA 3EUHA 4ZYDA 1YW8A 2JPCA 1A04A 3E5XA 2UXNA 4BXUA 1CF7B 5LLQA 3VEPA 2XUBA 2DW4A 4JK1X 2HQNA 3WE2A 1LQ1A 4ESBA 3WTVC 3HSFA 5HS9A 5JFRA 4U0VA 2IA2A 2Q8KA 2KIUA 3SFZA 2H09A 1WSUA 4LLGF 4OOIA 4P9FA 2W84A 2W85A 1R1UA 3BJAA 1J75A 2M1BA 4O5VA 4EJTA 4M9XA 1BBYA 5L3DA 2VC0A 4LK0F 1BI3A 1OMIA 1ON2A 3GEZA 4BNCA 1IZ1A 1HKTA 2K4BA 2KKOA 3QU3A 3W6KB 3WTYC 1HW2A 2O3FA 1YW7A 3EDPA 3QP5A 4M73A 2XASA 4BAYA 1MJ9A 1FX7A 2FMYA 2XAGA 2EFQA 4LFUA 4RB2C 2GA1A 1IF1A 4ENNA 3U1DA 3F6VA 2WC2A 5EEGA 1PDNC 5LGUA 1ZHFA 1O7LA 1IRGA 4U7BA 3Q5FA 1FPQA 4BHBA 5FB2A 1BC7C 5D5VB 1L3LA 2JT1A 2QQAA 2VE8A 2CYYA 1XD7A 1J2XA 4RAZA 4XRFA 1BI0A 1OPCA 1D8KA 1MDMB 4AVPA 5LGNA 3WGIA 4UV8A 2K7LA 1TQPA 3H92A 3L00A 3HRSA 4M74A 3V8JA 4MNUA 1I27A 5HLGA 5BQTA 3MZHA 1KU7A 2NYXA 2HGCA 5LRRA 1S6LA 4YIFA 4WK8F 1XDUA 2TDXA 1T38A 1ZH5A 3BY6A 3ZMZA 1HKSA 1SMTA 2FMLA 2BBYA 3IL2A 5LHIA 3K2ZA 1SFEA 2ZNYA 1FYKA 3F72A 2PMHA 1TLHB 3RKYA 1G3YA 3ISPA 1K78B 1DDNA 4YFXF 5LRSA 1UHWA 2VONA 2OQRA 4UVAA 1B59A 3WU0A 2F2EA 5HDGA 2DQRA 2NAZA 2STTA 3I4PA 4EJUA 1Y0UA 3G73A 1V4RA 2GAUA 1R22A 3LQQA 1YYVA 3IKTA 4HLXA 2D45A 3CJNA 2PI0A 2CQKA 1Z6TA 4WWCA 2P4WA 5D4RA 3I5UA 4OMYA 3E6BA 2O0YA 4HLYA 1R36A 5ICEA 5IT9Z 2L02A 2RV8A 4PCQA 5ICGA 2Z5UA 4CHUA 3C7JA 5JI6A 4EM2A 5KVRA 1G4DA 1SD6A 2H94A 4CDGA 3EYIA 3JSPA 4AIKA 2VBYA 2P7CB 1KA8A 4MTDA 3BROA 2RVCA 1R00A 1S29A 2DI3A 4LMYA 2Z33A 1W7PA 3I64A 2K02A 1K78A 1SD4A 2BYVE 2WTEA 4Y15A 3RKWA 3LA7A 2HR3A 3DQVC 4UVCA 2VT3A 1QZZA 2R7DA 2VT2A 2KJCA 4LB5A 2YSRA 1Z91A 3CLOA 2DLLA 1PP8F 1YG2A 1XSDA 3P9CA 2FEZA 2ETHA 3E6DA 4FT8A 2FBHA 1RI7A 4UXNA 3EETA 4XLPF 3F3XA 3JSOA 2GWRA 3E6MA 3I71A 2FSWA 1HW1A 3R60A 2CW0F 3VODA 4Y17A 3COAC 2HDCA 2NNYA 2F5EA 5LHGA 5JVTA 2QBYB 4I09A 2OBPA 1T39A 4GYGA 1IN7A 4L9VA 5KK1A 4RGRA 4G7OF 4HX7A 2RGVA 2MBFA 1U78A 1DP7P 2P6SA 3WTXC 1O7FA 1BI1A 4LLNA 2K4JA 2HYGD 3DV8A 3Q9VA 3QU6A 2MD5A 2Z3YA 4CYDA 4DQ2A 4S04A 2EV6A 1WI9A 3K0LA 3T5XA 3ZMVA 3CUQB 2R3SA 5D5UB 5H20A 4UHTA 2Q0OA 3HUGA 3CUQC 4QWQA 3IRQA 1FWZA 1KQ9A 4KA4A 5D6EA 2P8TA 2L4MA 1P4WA 3FMQA 5HDKA 2UZKA 4KT5C 1KU3A 2IW5A 3LA3A 4XBFA 2E7XA 1D5VA 2ZKZA 1FC3A 3LAJA 3IHUA 1R1TA 3BPXA 4B09A 4EV0A 1RNLA 5DDGA 1I1GA 4K2EA 1BC8C 1IAWA 3FWEA 3E3VA 5L3EA 1Z1DA 3H3ZA 2JSCA 1B1BA 3JTGA 3F8NA 1SD7A 1ONVA 2XVCA 3HIFA 4G6DA 2VC1A 2JRTA 2K86A 5DEQA 5ILSA 4HF1A 2ZMEB 5A2QZ 3E6CC 3V4GA 4UV9A 2QENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLY A;  2HZT A;  2PMU A;  3PQJ A;  4WF2 A;  1F4K A;  1HKQ A;  5JR3 A;  1H9T A;  4OMZ A;  3F21 A;  4KYW A;  3SQN A;  3PQK A;  1G3W A;  2LF8 A;  4Q5S F;  3RYP A;  2DQL A;  3ECH A;  2QWW A;  3ZP5 A;  4IF4 A;  3FHZ A;  2OZ6 A;  2QQ9 A;  2FA5 A;  5CYV A;  1TQM A;  2O6G E;  2P5V A;  3M8E A;  5AIP A;  1I6X A;  2DK5 A;  4U88 A;  2O61 A;  3P9K A;  5IT3 A;  1U5T B;  3EQL F;  4HZF A;  4HX4 A;  5L3B A;  3HHH A;  5ICF A;  5L3F A;  3G3Z A;  3ELK A;  2F5C A;  2G7U A;  4EJW A;  3GFM A;  1WQ2 A;  2IA1 A;  5K5O A;  1LDJ A;  1GVJ A;  4LGW A;  2M8E A;  5L3G A;  3TGN A;  5FGM A;  5ED4 A;  4HW0 A;  4HDV A;  3ZN1 A;  4JBA A;  1FYM A;  3TO9 A;  4HQE A;  3V7R A;  3GX4 X;  1LJ9 A;  4EVI A;  4BHC A;  1WRJ A;  1YS7 A;  1BN5 A;  4KIF A;  1B9N A;  3ULQ B;  3GFJ A;  3KEO A;  2Y48 A;  2BE5 F;  4KDP A;  2FNP A;  4EM1 A;  4U0Y A;  3FZV A;  3WOD F;  1HQC A;  1JGS A;  3WTT C;  2P5K A;  2YX7 A;  1TTY A;  2OD5 A;  2COM A;  2HTJ A;  1ODD A;  3QPT A;  3W6J B;  4IHT A;  1IXC A;  1QZY A;  4A5N A;  1KQ8 A;  2HFH A;  2KRF A;  4JQF A;  4IHS A;  3F8C A;  1B6A A;  4PGH A;  2E7W A;  5DCM B;  3K69 A;  1TQI A;  4HBL A;  3F6O A;  2D2W A;  1CF7 A;  3SXY A;  2ESH A;  2RDP A;  3F8B A;  2PBI A;  2PEX A;  2V79 A;  2MA3 A;  5LHH A;  3IRR A;  2RNJ A;  4D0P A;  4L5J A;  2DK8 A;  1D3Y A;  5H6R A;  3MQ0 A;  2DU9 A;  1IXR C;  2H6C A;  2YPR A;  4BYY A;  4CXF A;  4KN4 X;  1USS A;  1RUO A;  2RC4 A;  4NHJ A;  2XIG A;  2V1U A;  1R7J A;  2QYO A;  3CUQ A;  1JE8 A;  3SZP A;  1AWC A;  3D0S A;  2LF7 A;  2W25 A;  5HVQ C;  3M7G A;  2YU3 A;  1FBS A;  2DO7 A;  1J7K A;  1SFX A;  3KP5 A;  3TOA A;  5CVI A;  3NEU A;  5BPD A;  2EB7 A;  4MEX F;  1FY7 A;  5DV5 A;  5ILV A;  3F8F A;  4I7H A;  2XAQ A;  3HSE A;  2L01 A;  2HKX A;  4I2O A;  5FLX K;  1BIB A;  4M9S A;  4KMF A;  3GYH X;  1UFM A;  2QZ8 A;  1E17 A;  1XMA A;  3KP7 A;  2KIF A;  3RI4 A;  3GO5 A;  3JAM K;  4ZZL A;  1YTY A;  3DEU A;  2QQB A;  4EGY A;  1MZB A;  3I59 B;  4M71 A;  5LEK A;  4KIC A;  1P92 A;  3Q9S A;  2C6Y A;  2M30 A;  1PP7 U;  3L7W A;  2DPU A;  3KZY A;  3JAM Z;  3QP6 A;  4AIJ A;  4ZYE A;  2YX4 A;  2J5O A;  3V7S A;  1EV7 A;  5BOX A;  4Q47 A;  1ZLK A;  1K7A A;  1FLI A;  4XSZ F;  1QO0 D;  2ESN A;  4LLL A;  5DD8 A;  3L09 A;  4A0Y A;  2X4H A;  1OR7 A;  1LNW A;  3TDU C;  3J80 Z;  3RIR A;  4EQQ A;  2O8X A;  2MH9 A;  3KZZ A;  3FXQ A;  1ZG1 A;  3GXO A;  4GO1 A;  5FO5 A;  3R61 A;  4GYI A;  1FBQ A;  3CO7 C;  1KYZ A;  1YQA A;  1R5H A;  3GFL A;  4WXD A;  3P7N A;  3T8T A;  1ZRC A;  3MAJ A;  3WGG A;  4KIG A;  4HX8 A;  1ZGJ A;  3WG9 A;  4P9U A;  4KN7 X;  4QLC U;  3VOE A;  2FBI A;  4R1H A;  5J6X A;  2AXL A;  2MLG A;  1SAX A;  2LNB A;  2A68 F;  3DF8 A;  1MJB A;  5DCM A;  2VOO A;  3QRF F;  1K6O A;  1L0O C;  3KCC A;  4ZZD A;  3QAH A;  5HOO A;  1REP C;  4Q4Z F;  4ZYG A;  3U2R A;  2EFN A;  2EFP A;  4A0X A;  3REO A;  2HWV A;  1G3S A;  1J5Y A;  1QNT A;  4M6Y A;  5DYM A;  4HV5 A;  3KET A;  1HXD A;  1G6N A;  2DT5 A;  3BZ6 A;  2OU2 A;  3JW4 A;  2L3D A;  4A6E A;  2IPQ X;  4AD9 A;  5CJ9 A;  1U5T C;  3LWF A;  2ZCW A;  5E1Z B;  2CWE A;  4NB5 A;  3VFZ A;  2V1D A;  2CO5 A;  2EFO A;  5FLX Z;  3GUD A;  2GQQ A;  5CVJ A;  5DD4 A;  2XGX A;  3KLN A;  4AIH A;  4MQ9 F;  2XRO A;  1UST A;  5A2Q K;  2LDU A;  1MKM A;  4OIN F;  2Z9O A;  4TV7 A;  4EGZ A;  4AWX B;  3V7C A;  3K1N A;  1XN7 A;  2FBK A;  3BJO A;  3ZQ7 A;  4HF0 A;  3FM5 A;  3GZ6 A;  3O2P E;  4GCV A;  2HYF A;  5CVU A;  4G6Q A;  2GIV A;  1W7P D;  3HYI A;  1Z6R A;  2GXB A;  3FMS A;  2QUF A;  4WCG A;  4A12 A;  4N9H A;  2Q2E A;  4O6J A;  3T1B A;  1LDK B;  1P2F A;  3WE3 A;  3GWZ A;  5D4S A;  2V6C A;  3S2W A;  3TOB A;  4I98 B;  5E8G A;  3LAP A;  3KP2 A;  2X0L A;  5L3C A;  4P55 A;  1FOK A;  2NS0 A;  1XSV A;  2VBZ A;  4GXO A;  5J8F A;  3L9F A;  5H6Q A;  4ENK A;  1I5Z A;  3HRT A;  1S8N A;  3WTZ A;  1UCR A;  3M1E A;  3U9G A;  3RPU A;  1IXS B;  5BPI A;  3BJ6 A;  4OIR F;  1T0F A;  3GZ5 A;  2IT0 A;  3KLO A;  3LA2 A;  4ETS A;  1YS6 A;  1KU9 A;  3K1P A;  2L4A A;  2ZNZ A;  3R6S A;  1GXP A;  5CVR A;  2EA2 A;  4ZYH A;  3O6B B;  1FP2 A;  5TRD A;  2K27 A;  3FF5 A;  1TW3 A;  3GLX A;  4ESF A;  3T0Y A;  1ZYR F;  2MC3 A;  1STZ A;  2OAZ A;  1NHA A;  4M6X A;  5HS7 A;  1LDD A;  5E17 F;  4OU0 A;  2A07 F;  1EH7 A;  2XHK A;  3J81 K;  2P6T A;  1XGO A;  4I0A A;  3DPT A;  3PFI A;  1XB4 A;  2H27 A;  4OIO F;  3HOS A;  1BM9 A;  2FQ3 A;  1ZG3 A;  3ZMT A;  5ICC A;  5DUI A;  3BOQ A;  3BDD A;  3D5L A;  1F5T A;  4KIB A;  3HSR A;  5AON A;  3TDZ C;  3N4M A;  1U6G A;  4IXA A;  3I54 A;  4A5M A;  3J81 Z;  4IRI A;  4L0Y B;  3RYR A;  2QBY A;  1YO5 C;  2PFB A;  2PQ8 A;  2XV4 S;  3MEX A;  1E2X A;  5J8C A;  3M8F A;  1YFH A;  4MEY F;  4I02 A;  3V8L A;  1H9G A;  3TO7 A;  3F8M A;  1U8R A;  3MWM A;  5CVV A;  3RDI A;  2VE9 A;  3WGH A;  1O3T A;  4HOB A;  4RGS A;  4H0E A;  2Y0M A;  5JHU A;  1FNN A;  5FD6 A;  4B8X A;  2Z99 A;  3ABT A;  2FOK A;  3K1M A;  1FT9 A;  4PGG A;  3ZPL A;  2BV6 A;  1YLF A;  5D5X B;  2QVO A;  1G3T A;  4ASN A;  2XKP A;  1V3F A;  1R58 A;  2XAF A;  1HST A;  1LEB A;  1KQ0 A;  2IRF G;  5EEH A;  2EJR A;  1S7O A;  4P96 A;  3KEQ A;  1KU2 A;  4GGG A;  4LD5 A;  3ROU A;  3B73 A;  2WWY A;  3WU1 B;  4LG0 B;  3MCZ A;  2V1X A;  2ADU A;  4L9N A;  3HOT A;  1SMY F;  1OKR A;  4A0Z A;  1D8J A;  2PJP A;  4F7Z A;  2VXZ A;  4OIP F;  3RKX A;  4L18 B;  3IWZ A;  4M72 A;  3F22 A;  1QBJ A;  6PAX A;  1OYY A;  3CDH A;  3HHG A;  2XRN A;  3R0J A;  5FFX A;  1RIO H;  4PDK A;  3ZMU A;  2A3S A;  1XMK A;  2JTV A;  1O3Q A;  1XDS A;  4LJZ F;  1O3R A;  1DUX C;  1EH6 A;  4RB0 A;  2M5W A;  4RGU A;  2LKP A;  4RGX A;  3GF2 A;  4KNY A;  5E20 A;  5D6F A;  3GVA A;  3V8K A;  5E18 F;  3RJP A;  3MFK A;  5LEJ A;  4IVN A;  3RPQ A;  2G9W A;  4MGR A;  2YR2 A;  3DXJ F;  1ZRF A;  4I0B A;  4XSX F;  1QQI A;  1EH8 A;  1TNS A;  1P6R A;  1S7A A;  3I53 A;  1O3S A;  2J5P A;  3E5Q A;  1S3J A;  2D1V A;  2CFX A;  1FYL A;  3ABU A;  2XAJ A;  1XSX A;  1R1V A;  3T8R A;  1U5T A;  2MLK A;  3M9A A;  1ZGA A;  2HS5 A;  2HKO A;  4A2U A;  2VBX A;  1IUY A;  1PUE E;  3LFK A;  2E1C A;  2DPD A;  2M45 A;  4WXH A;  3CUO A;  3DKW A;  1BJA A;  1ZLJ A;  3JTH A;  2P7V B;  2DFI A;  1XCB A;  2GZW A;  3IKV A;  1K79 A;  2CG4 A;  3KP4 A;  2NRA C;  1W5T A;  2O03 A;  4I01 A;  3O3K A;  4O3M A;  4HV6 A;  3E97 A;  1ZAR A;  5DUK A;  3FXU A;  2EWN A;  3IWF A;  3QPH A;  2A5Y B;  1DPR A;  2XAH A;  3AAF A;  1MDM A;  3C3W A;  3CTA A;  5CLS A;  3HRU A;  3ERE D;  3J80 K;  2VOP A;  3GFI A;  2OA4 A;  2CSO A;  4RB1 A;  4UNO A;  2IP2 A;  3ZN0 A;  4OIQ F;  1MGT A;  3ZMS A;  4HDU A;  5ILU A;  2UXX A;  3LST A;  4XLN F;  1WKM A;  2EFW A;  1ZRD A;  1J0R A;  1IW7 F;  4Z2Y A;  1UHM A;  2VOD A;  4HQM A;  1IN4 A;  1I1S A;  2FNA A;  5D5W B;  4BH9 A;  5LGT A;  4R79 A;  2VN2 A;  3FXR A;  4KFC A;  2H6B A;  3H3U A;  5F1R A;  1ZG5 A;  2Y75 A;  2OQG A;  1R23 A;  4NQW A;  2NNN A;  1UB9 A;  1C0W A;  1X3U A;  1JHF A;  2FF4 A;  4HA8 A;  1OYI A;  3TO6 A;  4A6D A;  2A61 A;  1IRF A;  2RKH A;  2ZBK A;  1U3E M;  4U7D A;  4FHT A;  1LB2 A;  5FD5 A;  2BEO A;  1ON1 A;  4ON0 A;  1T6S A;  3SZT A;  4CIC A;  2A69 F;  3SHF A;  2ISY A;  4HYE A;  2B0L A;  4IJA A;  4PZJ A;  2ELH A;  1FBU A;  1W5S A;  2IVM A;  5E1W A;  1VTN C;  3P9I A;  3HTU A;  4RAY A;  2BGC A;  2HOE A;  4HF2 A;  1XGM A;  2V9V A;  1IN6 A;  4YFK F;  5HS8 A;  5HLI A;  5AIQ A;  4L9J A;  3E5U A;  2IJL A;  1QPM A;  1ZN2 A;  1XCV A;  2G7H A;  3NQO A;  3OV8 A;  2VBW A;  3CO6 C;  1ZRE A;  1Z9C A;  2W24 A;  3ML6 A;  5DCF A;  5FFZ A;  1XGN A;  4IRH A;  1P4X A;  3BPV A;  2WV0 A;  4LK1 F;  1BI2 A;  1Z05 A;  1SFU A;  2ZFW A;  3TKY A;  2ZXJ A;  1H0M A;  3MZY A;  1WWX A;  3C18 A;  3ECO A;  2F5D A;  3HTS B;  1MD0 A;  4CO8 A;  1LEA A;  4ENJ A;  2EV0 A;  1HW5 A;  4LB6 B;  5LBQ A;  4G7H F;  3C1D A;  3L2C A;  4CGZ A;  4LG0 A;  1IN5 A;  1JXS A;  3R0A A;  3KP3 A;  4Q48 A;  1HBX G;  1YW9 A;  3DP7 A;  4G9Y A;  3WTW C;  3HRM A;  4UUV A;  3BWG A;  1W7P B;  1BOA A;  3FX3 A;  4M9Z A;  2CGP A;  1SD5 A;  2FU4 A;  4ZH4 F;  3KP6 A;  1BIA A;  3I0T A;  4EM0 B;  4EJO A;  5BS6 A;  5K1Y A;  2AS5 F;  2ZJ2 A;  2ACJ A;  2EV5 A;  1QGP A;  4BHP A;  4RB3 C;  3N97 A;  1GHC A;  3K9T A;  2HQR A;  2P5L C;  4UVB A;  1B9M A;  2FE3 A;  2OZU A;  3F23 A;  1F1Z A;  2LSO A;  4L9T A;  3FMR A;  4WX9 A;  2KIM A;  1J59 A;  1IN8 A;  3IC7 A;  3BP8 A;  2ISZ A;  2A6H F;  3GW2 A;  1KYW A;  2PG4 A;  3QOP A;  2STW A;  4FX4 A;  1Q1H A;  4R8H A;  1FSE A;  4DNC A;  4ESJ A;  1YIO A;  5F6F A;  1B4A A;  2M87 A;  1T98 A;  4FX0 A;  4U0W A;  5E1X A;  2MH2 A;  4P5O A;  4ENM A;  4E70 A;  2DAO A;  4KMU X;  1OYW A;  4IPA A;  3KFW X;  5K5Q A;  1TW2 A;  2F5F A;  4Y13 A;  3NRV A;  2GA2 A;  4IRG A;  2RQP A;  3OOP A;  1R5G A;  3WTU C;  2JPB A;  2PN6 A;  4YFN F;  1O57 A;  4G8X A;  3J7A O;  3EYY A;  2JZY A;  1HSJ A;  5IT9 K;  1AOY A;  2DBB A;  3VB2 A;  5HDN A;  4S05 A;  3B02 A;  2R7F A;  4G7Z F;  4CZZ A;  2UWM A;  4N0B A;  2QM3 A;  2HTS A;  2D1H A;  2L54 A;  5ERI A;  2HEO A;  5K5R A;  2EA4 A;  4MQV A;  1ULY A;  4KUM A;  1W4M A;  1T2K A;  2GXG A;  4HAM A;  1P4A A;  2IA0 A;  2FXA A;  3DPL C;  2QLZ A;  3TQN A;  5HLH A;  2KJB A;  2E1N A;  2RN7 A;  1ZAO A;  4L5I A;  1RUN A;  1GXQ A;  4MTE A;  5E8I A;  4WXC A;  1F9N A;  4YII A;  5D8K B;  1CGP A;  4G94 A;  4MHG A;  3I59 A;  2ZME A;  4YG2 F;  4BQA A;  3RTR A;  3WTS C;  3DFG A;  1TNT A;  3R4K A;  2EK5 A;  1J9I A;  2XKO A;  3I58 A;  1JHH A;  2ZO4 A;  4EMS A;  1U2W A;  1KGS A;  1LVA A;  5BMZ A;  4L0Z B;  1RZ4 A;  2FRH A;  5TJJ A;  4RS8 A;  3FM3 A;  1FP1 D;  2W57 A;  1FSH A;  3KE2 A;  1MJA A;  3LQR A;  2A6E F;  4N9I A;  1TBX A;  3ZMD A;  5D8L B;  1FZP B;  1XGS A;  4EJV A;  1DPU A;  1Z7U A;  5F64 A;  2DTR A;  3EUH A;  4ZYD A;  1YW8 A;  2JPC A;  1A04 A;  3E5X A;  2UXN A;  4BXU A;  1CF7 B;  5LLQ A;  3VEP A;  2XUB A;  2DW4 A;  4JK1 X;  2HQN A;  3WE2 A;  1LQ1 A;  4ESB A;  3WTV C;  3HSF A;  5HS9 A;  5JFR A;  4U0V A;  2IA2 A;  2Q8K A;  2KIU A;  3SFZ A;  2H09 A;  1WSU A;  4LLG F;  4OOI A;  4P9F A;  2W84 A;  2W85 A;  1R1U A;  3BJA A;  1J75 A;  2M1B A;  4O5V A;  4EJT A;  4M9X A;  1BBY A;  5L3D A;  2VC0 A;  4LK0 F;  1BI3 A;  1OMI A;  1ON2 A;  3GEZ A;  4BNC A;  1IZ1 A;  1HKT A;  2K4B A;  2KKO A;  3QU3 A;  3W6K B;  3WTY C;  1HW2 A;  2O3F A;  1YW7 A;  3EDP A;  3QP5 A;  4M73 A;  2XAS A;  4BAY A;  1MJ9 A;  1FX7 A;  2FMY A;  2XAG A;  2EFQ A;  4LFU A;  4RB2 C;  2GA1 A;  1IF1 A;  4ENN A;  3U1D A;  3F6V A;  2WC2 A;  5EEG A;  1PDN C;  5LGU A;  1ZHF A;  1O7L A;  1IRG A;  4U7B A;  3Q5F A;  1FPQ A;  4BHB A;  5FB2 A;  1BC7 C;  5D5V B;  1L3L A;  2JT1 A;  2QQA A;  2VE8 A;  2CYY A;  1XD7 A;  1J2X A;  4RAZ A;  4XRF A;  1BI0 A;  1OPC A;  1D8K A;  1MDM B;  4AVP A;  5LGN A;  3WGI A;  4UV8 A;  2K7L A;  1TQP A;  3H92 A;  3L00 A;  3HRS A;  4M74 A;  3V8J A;  4MNU A;  1I27 A;  5HLG A;  5BQT A;  3MZH A;  1KU7 A;  2NYX A;  2HGC A;  5LRR A;  1S6L A;  4YIF A;  4WK8 F;  1XDU A;  2TDX A;  1T38 A;  1ZH5 A;  3BY6 A;  3ZMZ A;  1HKS A;  1SMT A;  2FML A;  2BBY A;  3IL2 A;  5LHI A;  3K2Z A;  1SFE A;  2ZNY A;  1FYK A;  3F72 A;  2PMH A;  1TLH B;  3RKY A;  1G3Y A;  3ISP A;  1K78 B;  1DDN A;  4YFX F;  5LRS A;  1UHW A;  2VON A;  2OQR A;  4UVA A;  1B59 A;  3WU0 A;  2F2E A;  5HDG A;  2DQR A;  2NAZ A;  2STT A;  3I4P A;  4EJU A;  1Y0U A;  3G73 A;  1V4R A;  2GAU A;  1R22 A;  3LQQ A;  1YYV A;  3IKT A;  4HLX A;  2D45 A;  3CJN A;  2PI0 A;  2CQK A;  1Z6T A;  4WWC A;  2P4W A;  5D4R A;  3I5U A;  4OMY A;  3E6B A;  2O0Y A;  4HLY A;  1R36 A;  5ICE A;  5IT9 Z;  2L02 A;  2RV8 A;  4PCQ A;  5ICG A;  2Z5U A;  4CHU A;  3C7J A;  5JI6 A;  4EM2 A;  5KVR A;  1G4D A;  1SD6 A;  2H94 A;  4CDG A;  3EYI A;  3JSP A;  4AIK A;  2VBY A;  2P7C B;  1KA8 A;  4MTD A;  3BRO A;  2RVC A;  1R00 A;  1S29 A;  2DI3 A;  4LMY A;  2Z33 A;  1W7P A;  3I64 A;  2K02 A;  1K78 A;  1SD4 A;  2BYV E;  2WTE A;  4Y15 A;  3RKW A;  3LA7 A;  2HR3 A;  3DQV C;  4UVC A;  2VT3 A;  1QZZ A;  2R7D A;  2VT2 A;  2KJC A;  4LB5 A;  2YSR A;  1Z91 A;  3CLO A;  2DLL A;  1PP8 F;  1YG2 A;  1XSD A;  3P9C A;  2FEZ A;  2ETH A;  3E6D A;  4FT8 A;  2FBH A;  1RI7 A;  4UXN A;  3EET A;  4XLP F;  3F3X A;  3JSO A;  2GWR A;  3E6M A;  3I71 A;  2FSW A;  1HW1 A;  3R60 A;  2CW0 F;  3VOD A;  4Y17 A;  3COA C;  2HDC A;  2NNY A;  2F5E A;  5LHG A;  5JVT A;  2QBY B;  4I09 A;  2OBP A;  1T39 A;  4GYG A;  1IN7 A;  4L9V A;  5KK1 A;  4RGR A;  4G7O F;  4HX7 A;  2RGV A;  2MBF A;  1U78 A;  1DP7 P;  2P6S A;  3WTX C;  1O7F A;  1BI1 A;  4LLN A;  2K4J A;  2HYG D;  3DV8 A;  3Q9V A;  3QU6 A;  2MD5 A;  2Z3Y A;  4CYD A;  4DQ2 A;  4S04 A;  2EV6 A;  1WI9 A;  3K0L A;  3T5X A;  3ZMV A;  3CUQ B;  2R3S A;  5D5U B;  5H20 A;  4UHT A;  2Q0O A;  3HUG A;  3CUQ C;  4QWQ A;  3IRQ A;  1FWZ A;  1KQ9 A;  4KA4 A;  5D6E A;  2P8T A;  2L4M A;  1P4W A;  3FMQ A;  5HDK A;  2UZK A;  4KT5 C;  1KU3 A;  2IW5 A;  3LA3 A;  4XBF A;  2E7X A;  1D5V A;  2ZKZ A;  1FC3 A;  3LAJ A;  3IHU A;  1R1T A;  3BPX A;  4B09 A;  4EV0 A;  1RNL A;  5DDG A;  1I1G A;  4K2E A;  1BC8 C;  1IAW A;  3FWE A;  3E3V A;  5L3E A;  1Z1D A;  3H3Z A;  2JSC A;  1B1B A;  3JTG A;  3F8N A;  1SD7 A;  1ONV A;  2XVC A;  3HIF A;  4G6D A;  2VC1 A;  2JRT A;  2K86 A;  5DEQ A;  5ILS A;  4HF1 A;  2ZME B;  5A2Q Z;  3E6C C;  3V4G A;  4UV9 A;  2QEN A; 
#chains in the Genus database with same CATH topology
 2PLY A;  2K3P A;  4XN0 A;  2HZT A;  2PMU A;  4BY1 J;  3PQJ A;  4WF2 A;  1F4K A;  1HKQ A;  5JR3 A;  3JR9 A;  1H9T A;  2CQN A;  2AO9 A;  4OMZ A;  1MIJ A;  3F21 A;  4KYW A;  2ID3 A;  4XON A;  3SQN A;  2KIS A;  3CZ6 A;  3PQK A;  1G3W A;  2LF8 A;  3CJQ B;  5TIS C;  4Q5S F;  4B43 A;  3RYP A;  2DQL A;  3OWT A;  3ECH A;  2QWW A;  3ZP5 A;  4NC6 A;  4IF4 A;  2CS3 A;  3X2Q H;  1OCP A;  3FHZ A;  2OZ6 A;  1JI8 A;  2XSJ C;  3ASN H;  4ITV A;  2E35 A;  1TP4 A;  4CA0 A;  2QQ9 A;  2HPM A;  3G1M A;  2FA5 A;  5CYV A;  1TQM A;  2O6G E;  1QPI A;  2P5V A;  1WJ5 A;  3M8E A;  5AIP A;  3U21 A;  1I6X A;  2JJ7 A;  2DK5 A;  4XLH A;  3BCB A;  4U88 A;  4NNJ A;  2O61 A;  4C2M J;  1FEX A;  3HGG A;  3MVP A;  4PSX A;  3I56 I;  3P9K A;  5IT3 A;  2RAE A;  1U5T B;  5DTD A;  3O8H A;  5KCM A;  3EQL F;  4HZF A;  3FIS A;  4HX4 A;  4M3B A;  5EG0 B;  3L2U A;  2ME6 A;  3DWL E;  2Z1D A;  5L3B A;  4M6V A;  2EZI A;  3HHH A;  5ICF A;  2AHQ A;  1Z7L A;  3Q0U A;  5L3F A;  3H3V K;  3FK6 A;  3G3Z A;  3ELK A;  3KYC B;  2F5C A;  4BUP A;  1V5F A;  2DN0 A;  2IGK A;  2JSP A;  3DU5 A;  2G7U A;  4EJW A;  1MMA A;  2NVQ J;  3GFM A;  1WQ2 A;  3B6C A;  2EH3 A;  2IA1 A;  5K5O A;  1LDJ A;  1GVJ A;  4LGW A;  4A3B J;  2M8E A;  5L3G A;  3TGN A;  2KL4 A;  4I76 A;  3PO2 J;  5FGM A;  2QSF X;  5ED4 A;  4HW0 A;  4HDV A;  1IV6 A;  3ZN1 A;  2WAF A;  2IS2 A;  3CME I;  3HOV J;  5E3O A;  3QPS A;  4JBA A;  3TO9 A;  5HNF A;  1FYM A;  1XC5 A;  4HQE A;  3V7R A;  3GX4 X;  1LJ9 A;  1DU6 A;  1AKH B;  2HQA A;  3CMY A;  1ERD A;  4JOM A;  4EVI A;  4BHC A;  3ZQH A;  2CUZ A;  1JJ8 C;  1WRJ A;  1OIS A;  2QKL B;  2RQQ A;  1YS7 A;  1BN5 A;  4KIF A;  1B9N A;  4J01 A;  3ULQ B;  3LFU A;  1K6Y A;  4F3Q A;  3GFJ A;  3KEO A;  1FOY A;  4M3F A;  2Y48 A;  2BE5 F;  4KDP A;  5GTI C;  1QHH D;  2FNP A;  4EM1 A;  4A3G J;  4U0Y A;  2ID6 A;  2MSY A;  1VQ5 I;  2HYJ A;  3MMY B;  3FZV A;  4HNU A;  2PJR B;  1TT5 B;  3ABL H;  3WOD F;  2KMU A;  1HQC A;  1JGS A;  1XS9 A;  4C2U A;  3I9V 2;  3WTT C;  2P5K A;  2YX7 A;  1TWH J;  1TTY A;  2OD5 A;  4LG3 A;  4YIR X;  2COM A;  2HTJ A;  1ODD A;  3OIQ A;  3QPT A;  3DKX A;  3LSG A;  3W6J B;  3CCY A;  3FXK A;  4IHT A;  1IXC A;  1QZY A;  3PIP F;  2COB A;  4A5N A;  1KQ8 A;  4OAY A;  2HFH A;  2KRF A;  4JQF A;  2VKH A;  3K4C A;  5GPA A;  3LNQ A;  4IHS A;  1FMW A;  4JP0 A;  4BE2 A;  3F8C A;  3H9J A;  2ZJP F;  4DIQ A;  2QF7 A;  1B6A A;  4PGH A;  3LOC A;  2L9R A;  3KYD B;  2E7W A;  5DCM B;  3K69 A;  1TQI A;  5F04 A;  1X1D A;  4HBL A;  3F6O A;  2D2W A;  3PSI A;  1CF7 A;  3SXY A;  2ESH A;  4Z6Y A;  2RDP A;  3S14 J;  1AU7 A;  5K7H A;  3TED A;  3F8B A;  2PBI A;  3D5R C;  1WCM J;  3HB9 A;  2BXY A;  1TL8 A;  3GCM A;  3PIO F;  1LFU P;  2X1D A;  5KNL A;  3CCJ I;  3VSK A;  2PEX A;  1T08 B;  2V79 A;  2MA3 A;  5LHH A;  3IRR A;  1YIJ I;  2GOX B;  2W4S A;  3CMM A;  4BE1 A;  2RNJ A;  4DJA A;  1LUJ B;  2DJN A;  1B72 A;  4D0P A;  4L5J A;  2JUG A;  2DK8 A;  4E7H A;  1D3Y A;  3DLA A;  5H6R A;  2CFO A;  4IZZ A;  4A3M J;  2O9L A;  1UHS A;  4BAC A;  1SFO J;  3MQ0 A;  2DU9 A;  2Y9Z A;  1IXR C;  2YPR A;  2H6C A;  4BYY A;  4CXF A;  1TWA J;  2DTZ A;  3Q3S A;  4KN4 X;  2DOF A;  1USS A;  3ZOB A;  1RUO A;  2RC4 A;  3HM5 A;  3J7A Y;  2R7X A;  1G59 A;  4NHJ A;  4MLO A;  2XIG A;  2MYS A;  1ETW A;  2ZJR F;  2R7W A;  3VPR A;  2V1U A;  2E2J J;  3OYB A;  1R7J A;  2QYO A;  3CUQ A;  4IOA F;  1JE8 A;  3SZP A;  3FK7 A;  4CSW A;  1AWC A;  3D0S A;  2LF7 A;  2JMW A;  2DMP A;  3RQ4 A;  2W25 A;  3M7G A;  2YU3 A;  1FBS A;  2DO7 A;  5HVQ C;  1J7K A;  1SFX A;  3KP5 A;  3TOA A;  3K6G A;  4XOT A;  2Z2S B;  3DTK A;  5CVI A;  3NEU A;  2PJR A;  2DYS H;  5BPD A;  2OUM A;  2EB7 A;  1ETY A;  1HOM A;  2BY0 A;  2JUC A;  1VQM I;  1Z3Y A;  4MEX F;  1FY7 A;  3S1Q J;  1DGR M;  5DV5 A;  2MG4 A;  4C30 A;  5ILV A;  3F8F A;  4I7H A;  2XAQ A;  5KHD A;  2Y2Z A;  3HSE A;  2HQ5 A;  2L01 A;  2KQR A;  5IYD J;  2HKX A;  4I2O A;  5B66 C;  5FLX K;  1BIB A;  3BTJ A;  3K4L A;  4M9S A;  1T8I A;  4L5E A;  1ZGW A;  3RZO J;  2F48 A;  4A69 C;  4KMF A;  3IAM 2;  1O4X A;  3GYH X;  1UFM A;  5KAI C;  3VYR B;  2DOE A;  2QZ8 A;  1E17 A;  1VI0 A;  1XMA A;  3KP7 A;  2LMD A;  3HG9 A;  2H8W A;  3QYE A;  2KIF A;  2DT6 A;  3K4K A;  3RI4 A;  3K4N A;  1I50 J;  2XB0 X;  1IV8 A;  4D5F A;  2AQF A;  3GO5 A;  1OLT A;  2Y0S A;  2DA1 A;  3JAM K;  3GTO J;  4ZZL A;  1QRY A;  1YTY A;  4JX6 A;  2VKE A;  1H8A C;  1X2M A;  2L7M P;  3DEU A;  2QQB A;  4EGY A;  1MZB A;  3GZN B;  3I59 B;  2DDA A;  4M71 A;  3E7L A;  4RAG A;  5LEK A;  4UUS A;  4KIC A;  1P92 A;  2LK2 A;  2M8G X;  3Q9S A;  4A3I J;  3FXJ A;  2C6Y A;  2M30 A;  4BJ5 C;  1PP7 U;  1Q1V A;  2M4K A;  2VQH A;  3L7W A;  3QPL A;  2DPU A;  3KZY A;  3JAM Z;  3QP6 A;  2XF7 A;  4AIJ A;  4ZYE A;  2YX4 A;  4BDZ A;  2J5O A;  5F27 A;  4ABZ A;  3V7S A;  2M2E A;  2XGE A;  1EV7 A;  5BOX A;  2R7T A;  3H5N A;  4Q47 A;  1ZLK A;  2WY7 Q;  1K7A A;  1FLI A;  2KHM A;  1WZ2 A;  4XSZ F;  2CV0 A;  1QO0 D;  2ESN A;  3PNY A;  2ZB9 A;  4LLL A;  5DD8 A;  2L9V A;  3L09 A;  3L2R A;  2R4G A;  1QHG A;  4A0Y A;  2X4H A;  1Z21 A;  1OR7 A;  1LNW A;  1K83 J;  3TDU C;  3RIR A;  3J80 Z;  3OY9 A;  1GV2 A;  2DFH A;  5GAD J;  1FMV A;  4PK4 A;  4EQQ A;  2O8X A;  4G6T B;  4BXF A;  2MH9 A;  3KZZ A;  2NVY J;  3FXQ A;  1JKP C;  1ZG1 A;  1WHU A;  3RQI A;  3GXO A;  2R5Z B;  3JRF A;  4GO1 A;  5FO5 A;  4B44 A;  3D1N I;  1JTX A;  4XKW A;  3R61 A;  1JKR C;  4KT6 A;  2BHY A;  3GTQ J;  2EQR A;  3G1L A;  4GYI A;  1FBQ A;  3CO7 C;  1KYZ A;  4S0H B;  2NVU B;  5E3M A;  3E1S A;  1YQA A;  4BY7 J;  5IP6 A;  2DA4 A;  1BR1 A;  2V6E A;  4Y7N J;  5CKT A;  1R5H A;  3GFL A;  1IG7 A;  1PVE A;  2ZXI A;  1JJ6 C;  5EGO B;  4WXD A;  2LVS A;  3P7N A;  3T8T A;  1ZRC A;  1OCZ H;  3MAJ A;  5FLV A;  2CW7 A;  4KIG A;  3WGG A;  3ZRG A;  4HX8 A;  3S1M J;  1ZGJ A;  2WB1 A;  1Y8R B;  4XLA A;  5M5X J;  3WG9 A;  3DTI A;  1MBH A;  4P9U A;  4KIT B;  2V1N A;  4KN7 X;  4DBQ A;  1HC8 A;  4QLC U;  4BJT A;  1MND A;  3VOE A;  2FBI A;  3CF2 A;  4R1H A;  1RKW A;  5J6X A;  1TWF J;  2AXL A;  3EUK L;  5JLW A;  2QEX I;  1YJN I;  2MLG A;  1BW6 A;  1DQU A;  2LNB A;  1SAX A;  2A68 F;  2HVR A;  3DF8 A;  4BL0 B;  4YEJ A;  1MJB A;  1SAU A;  2OF7 A;  5DCM A;  2VOO A;  5F08 A;  1IO2 A;  3QRF F;  1K6O A;  2VXD A;  2WAD A;  4XOR A;  3JRA A;  1L0O C;  1SAN A;  3IH2 A;  3KCC A;  2MW8 A;  4ZZD A;  2HDW A;  2QGU A;  3QAH A;  5HOO A;  1REP C;  1OFC X;  3S15 J;  3I3L A;  2VAS A;  4Q4Z F;  4XK4 A;  1EA3 A;  1JUM A;  4ZYG A;  1A35 A;  3U2R A;  2EFN A;  2EFP A;  4A0X A;  3REO A;  3JRH A;  1YRN B;  3SEZ A;  3SDG A;  3OYG A;  2HWV A;  1G3S A;  1J5Y A;  1QNT A;  4M6Y A;  1G2H A;  5DS9 A;  5DYM A;  3PL8 A;  2IGN A;  1BR4 A;  2OC6 A;  4HV5 A;  1VQ7 I;  3IH4 A;  3KET A;  1HXD A;  1G6N A;  2DT5 A;  3BZ6 A;  5FKN A;  5H2F C;  2OU2 A;  1D1B A;  2L3D A;  3JW4 A;  1MSE C;  2IBD A;  4A6E A;  2IPQ X;  1IJW C;  2L7K A;  5CJ9 A;  4AD9 A;  4A3D J;  4HNV A;  1U5T C;  3LWF A;  2ZCW A;  5E1Z B;  4CCL A;  2CWE A;  3J7Z I;  1HDD C;  4NB5 A;  2EPF A;  2KT0 A;  3VFZ A;  1N77 A;  1BJZ A;  2V1D A;  4IOC F;  2CO5 A;  2EFO A;  5FLX Z;  2XRL A;  3GUD A;  1MMS A;  1FJL A;  2M7A A;  4V2F A;  2GQQ A;  5CVJ A;  5DD4 A;  2XGX A;  3KLN A;  4AIH A;  4MQ9 F;  2XRO A;  1UST A;  5A2Q K;  2LDU A;  1MKM A;  1IDY A;  2Y30 A;  3S32 A;  2LRD A;  4FE7 A;  1YI2 I;  1AKH A;  3BG9 A;  1EF4 A;  3CCV I;  4OIN F;  1OCR H;  4ZDO A;  3CC2 I;  2L9S A;  2G0E A;  2Z9O A;  4CCN A;  2LP0 A;  4TV7 A;  4C2T A;  4EGZ A;  2N8G A;  1V5E A;  4AWX B;  3V7C A;  1P9Q C;  3K1N A;  1XN7 A;  2FBK A;  1YRN A;  3BJO A;  2E34 A;  4XL9 A;  3ZQ7 A;  2LC2 A;  4XOP A;  4HF0 A;  4CZC A;  3FM5 A;  3GZ6 A;  3O2P E;  1OCO H;  3O8G A;  1A6Q A;  4GCV A;  3QYF A;  2HYF A;  3OYK A;  2M34 A;  5CVU A;  3TW6 A;  2DFF A;  4G6Q A;  2GIV A;  3HKZ N;  1W7P D;  3HYI A;  1Z6R A;  3LSR A;  2E2I J;  2X6Y A;  2GXB A;  2RRE A;  1NG7 A;  3FMS A;  2QUF A;  3IP4 B;  2JVG A;  1MBE A;  4ZDL A;  3HGY A;  4DOZ A;  4WCG A;  4A12 A;  4N9H A;  2Q2E A;  1BR2 A;  4O6J A;  1POG A;  3T1B A;  1LDK B;  1WJF A;  2I5U A;  5J47 A;  1T0F C;  1P2F A;  1X4P A;  3WE3 A;  4AUX A;  2X1E A;  3GWZ A;  5D4S A;  2XF5 A;  2V6C A;  1IC8 A;  3S2W A;  5FKL A;  3TOB A;  2W00 A;  3WHC A;  4I98 B;  5IOY A;  5E8G A;  1V5G A;  3H36 A;  3LAP A;  3KP2 A;  4IKF A;  2VJI A;  2X0L A;  2M4G A;  5L3C A;  4IQ4 A;  3CCS I;  1NH3 A;  4P55 A;  4QPQ A;  3KPH A;  1FOK A;  2NS0 A;  1XTA A;  1XSV A;  2VBZ A;  4GXO A;  4AC0 A;  5J8F A;  1UG2 A;  1T33 A;  1QVU A;  2LKS A;  1I5Z A;  3L9F A;  5H6Q A;  4ENK A;  2LD5 A;  3HRT A;  4NQW B;  1S8N A;  3WTZ A;  1UCR A;  2V26 A;  3M1E A;  5K7Z A;  3U9G A;  3RPU A;  1D1A A;  1IXS B;  5JHF A;  5BPI A;  3BJ6 A;  4BU2 A;  4OIR F;  2X6X A;  3BTC A;  3PNT A;  2CU7 A;  3HKZ A;  1T0F A;  3GZ5 A;  2IT0 A;  2VI6 A;  4RAF A;  4XMY A;  4Y52 J;  4MFE A;  3KLO A;  5FRO A;  3VYT B;  3M07 A;  3LA2 A;  4FQG A;  4ETS A;  4A3C J;  1HDP A;  2Y9Y A;  5J3L A;  1YS6 A;  3QOE A;  1KU9 A;  2V7F A;  3K1P A;  3HBL A;  2L4A A;  2ZNZ A;  3R6S A;  3G71 I;  4UB8 C;  4D1Q A;  1GXP A;  4DYC A;  5F0H A;  3BG6 A;  3FXM A;  4ZDP A;  3CCM I;  3TBI A;  5CVR A;  2PX9 A;  5GAE J;  2EA2 A;  1MBF A;  4BEH A;  3C2G A;  4ZYH A;  2KRH A;  3O6B B;  1FP2 A;  5TRD A;  3G1O A;  4LOC A;  2K27 A;  3FF5 A;  1TW3 A;  3GLX A;  2FX0 A;  4ESF A;  3T0Y A;  3AL0 C;  1T56 A;  1ZYR F;  2MC3 A;  1STZ A;  3A0B C;  3KYL A;  2OAZ A;  1NHA A;  4M6X A;  4EAT A;  1MNE A;  5HS7 A;  2OV7 A;  2DMT A;  3AG2 H;  1R71 A;  4E7J A;  1J09 A;  1LDD A;  5E17 F;  1R4N B;  4OU0 A;  2A07 F;  2KRC A;  2RNG A;  4II2 A;  5EG0 A;  1EH7 A;  2XHK A;  2ZME C;  3J81 K;  3ASO H;  4XRS A;  2P6T A;  2CH0 A;  1XGO A;  3CP2 A;  4I0A A;  3DPT A;  3BTL A;  4KIS A;  3PFI A;  1XB4 A;  2H27 A;  4OIO F;  3SDB A;  3ONQ A;  1ETK A;  3HOS A;  1BM9 A;  2FQ3 A;  1ITY A;  1ZG3 A;  1RC9 A;  4LIV A;  3ZMT A;  5ICC A;  5DUI A;  3BOQ A;  2DOA A;  3DTE A;  3BDD A;  1HCR A;  3D5L A;  1F5T A;  2E5N A;  4KIB A;  3HSR A;  1I3A A;  4F52 A;  5AON A;  3TDZ C;  3N4M A;  3CCR I;  1JKO C;  2F5V A;  1U6G A;  4IXA A;  3I54 A;  5J1Y A;  4A5M A;  3J81 Z;  4IRI A;  2VQC A;  3UNG C;  4QTR A;  4L0Y B;  3RYR A;  2QBY A;  1YO5 C;  2PFB A;  5C44 J;  2PQ8 A;  5E3N A;  3HEF A;  2CUF A;  3NWT A;  1T95 A;  2XV4 S;  1FOX A;  3FBI B;  1VND A;  3MEX A;  2JWT A;  1E2X A;  5J8C A;  1VQ6 I;  3M8F A;  1YFH A;  2QSH X;  4MEY F;  1QZE A;  2HXI A;  4IX7 A;  4I02 A;  3LL7 A;  3DPU A;  3V8L A;  1H9G A;  4RA2 A;  2K5C A;  3TO7 A;  3HOZ J;  3F8M A;  1U8R A;  3MWM A;  5CVV A;  1M1E B;  1SVO A;  3RDI A;  4D7M A;  2VE9 A;  1RR7 A;  1VZ0 A;  3WGH A;  1O3T A;  2B63 J;  1KON A;  4HOB A;  2F4M B;  3BR0 A;  2YUS A;  4RGS A;  1H88 C;  1NG6 A;  4H0E A;  2Y0M A;  5JHU A;  1FNN A;  4OWR B;  5FD6 A;  4B8X A;  2Z99 A;  3ABT A;  2FOK A;  3K1M A;  2VIX A;  1FT9 A;  4PGG A;  2DOD A;  3ZPL A;  2BV6 A;  1YLF A;  2VB6 A;  3VYU B;  5D5X B;  2WAQ A;  4NBQ A;  2DA7 A;  2QVO A;  1G3T A;  4ASN A;  5M5Y J;  2XKP A;  1V3F A;  1R58 A;  2XAF A;  2IS1 A;  1D0Z A;  1HST A;  1LEB A;  2ICW G;  3A03 A;  3GME A;  1KQ0 A;  2H1K A;  2IRF G;  5EEH A;  2EJR A;  1S7O A;  2NVT J;  5FKO A;  4P96 A;  3KEQ A;  5EJC A;  4JX4 A;  1KU2 A;  4GGG A;  1QU3 A;  3BR5 A;  2MD0 A;  4LD5 A;  4J00 A;  1JUP A;  3ROU A;  2O8K A;  3B73 A;  2WWY A;  2P81 A;  3WU1 B;  4LG0 B;  3OYD A;  4PUS A;  2E60 A;  2V1X A;  3MCZ A;  1QA6 A;  2ADU A;  2KFD A;  2HZD A;  4L9N A;  5DM7 F;  3HOT A;  1SMY F;  3CC4 I;  2BY1 A;  1OKR A;  4A0Z A;  3H5R A;  3HPH A;  2BVL A;  1UG0 A;  4FAS D;  1A31 A;  1D8J A;  1SVL A;  2PJP A;  4ZYA A;  4F7Z A;  2LBF A;  2VXZ A;  1W36 C;  4OIP F;  3RKX A;  4L18 B;  3L2V A;  3JRE A;  3IWZ A;  4M72 A;  3F22 A;  3W2W A;  3LSP A;  3HOY J;  5M3F J;  1QBJ A;  1V54 H;  1MBG A;  2DA6 A;  2X6W A;  4AYB A;  4N4O B;  6PAX A;  2FUG 2;  2M0M A;  1OYY A;  3BG5 A;  3CDH A;  2HVS A;  3HHG A;  2XRN A;  3R0J A;  5FFX A;  2LTP A;  4HG2 A;  1YJ9 I;  1RIO H;  4RM3 A;  4PDK A;  2CV2 A;  3ZMU A;  2VQG A;  3ZGK A;  2P0W A;  2A3S A;  1XMK A;  2JTV A;  5HLT A;  1O3Q A;  4U87 A;  3LSH A;  1XDS A;  2HOS A;  4LJZ F;  2E71 A;  1EH6 A;  1O3R A;  1DUX C;  4RB0 A;  2R7V A;  3A01 A;  1IDZ A;  2FOW A;  4RM2 A;  1RKT A;  4C3H J;  4XN3 A;  2KDO A;  2M5W A;  4RGU A;  1WJD A;  2ECC A;  2LKP A;  4RGX A;  3GF2 A;  4KNY A;  2EZL A;  4PFO A;  5D6F A;  5E20 A;  1GLN A;  3GVA A;  3V8K A;  5E18 F;  3RJP A;  3MFK A;  3OL3 A;  5LEJ A;  4IVN A;  3RPQ A;  3LSI A;  3GTJ J;  2E5Z A;  4A3J J;  2F6C A;  2G9W A;  2DA2 A;  3JCU C;  4MGR A;  1GDT A;  4UUT A;  2VJ4 A;  2YR2 A;  3V42 A;  3H1C A;  2EZK A;  1YIT I;  3JRG A;  3DXJ F;  3C2B A;  1ZRF A;  1CQT A;  4I0B A;  4XSX F;  2LRE A;  2ECB A;  2R93 J;  1QQI A;  1EH8 A;  2XSD C;  1TNS A;  5GAH J;  1P6R A;  1S7A A;  3I53 A;  1O3S A;  4UUS B;  2J5P A;  4QSH A;  5BNG A;  2W82 A;  2GIZ A;  3E5Q A;  3H0G J;  1S3J A;  4F92 B;  3OR1 C;  2D1V A;  2LR8 A;  2CFX A;  3ABU A;  1FYL A;  4BBS J;  2XAJ A;  3OMY A;  1XSX A;  2L0K A;  4MO7 A;  1W5C C;  1R1V A;  4W97 A;  3T8R A;  1U5T A;  2MLK A;  2QSG X;  2CQQ A;  3M9A A;  4E6K G;  2L2O A;  1ZGA A;  5J1R A;  2HS5 A;  2HKO A;  1OCT C;  4F91 B;  4A2U A;  2VBX A;  1IUY A;  2VJJ A;  2X85 A;  4B48 A;  1PUE E;  3LFK A;  2E1C A;  2E2H J;  5C4X J;  2M45 A;  2DPD A;  3DKW A;  3CUO A;  4WXH A;  1BJA A;  1ZLJ A;  3JTH A;  1ZTR A;  2GXA A;  2P7V B;  1Y0N A;  3HDD A;  4LIT A;  2JA5 J;  2VL8 A;  1S7E A;  2DFI A;  1XCB A;  2GZW A;  3IKV A;  1K79 A;  2CG4 A;  3KP4 A;  3K4B A;  5LFA A;  3MKZ A;  1MSF C;  2NRA C;  2K85 A;  1W5T A;  1GV5 A;  1WH5 A;  2O03 A;  3O3K A;  4I01 A;  4O3M A;  4HV6 A;  3E97 A;  1ZAR A;  3VDX A;  5DUK A;  3FXU A;  2LY1 A;  2IS4 A;  1XX5 A;  9ANT A;  2EWN A;  3IWF A;  2DJI A;  2X51 A;  4E7K A;  3QPH A;  3H9Q A;  1VQO I;  2CMP A;  2A5Y B;  1DPR A;  2XAH A;  1LFB A;  3AAF A;  2JN6 A;  3UKG A;  1JKQ C;  4M3E A;  1RRJ A;  1MDM A;  3C3W A;  3CTA A;  1PJR A;  2VPR A;  5CLS A;  4DGW B;  3HRU A;  3ERE D;  3J80 K;  2VOP A;  1MW7 A;  2OA4 A;  1WI3 A;  3GFI A;  4ZTF A;  3HOW J;  2CSO A;  3L2W A;  2DMU A;  1R49 A;  4RB1 A;  4UNO A;  2IP2 A;  3ZN0 A;  4OIQ F;  2DDB A;  1MGT A;  1PYV A;  4NUB A;  3ZMS A;  1ZEL A;  2E1O A;  4HDU A;  3PM1 A;  5ILU A;  4MFD A;  4FE4 A;  2ZC2 A;  3SZG A;  2UXX A;  3LST A;  4XLN F;  1WKM A;  1X1A A;  1ORK A;  5B3S H;  2AQE A;  3OIO A;  2EFW A;  1VFC A;  1ZRD A;  2R92 J;  1J0R A;  1F36 A;  1S72 I;  4A3K J;  1IW7 F;  4Z2Y A;  3S2H J;  1LE8 A;  1UHM A;  2VOD A;  2DA3 A;  4HQM A;  4BQO A;  3KZI C;  1IN4 A;  4PJM A;  1I1S A;  2FNA A;  5D5W B;  1YHQ I;  3OIP A;  3AG3 H;  1Y6I A;  4BH9 A;  5LGT A;  2LG4 A;  4R79 A;  1QVT A;  2VN2 A;  3FXR A;  4KFC A;  4FIS A;  2H6B A;  2DFE A;  2TRT A;  4A93 J;  5IYB J;  3H3U A;  5F1R A;  1U8B A;  1Z67 A;  4XQF A;  1Y56 A;  1ZG5 A;  2Y75 A;  2OQG A;  2JA2 A;  4NC7 A;  1R23 A;  1FTZ A;  4FET A;  4NQW A;  2VKV A;  3OYI A;  2NNN A;  3QYB A;  3DEW A;  3AL0 B;  1X1B A;  2F4I A;  1UB9 A;  1LFP A;  1C0W A;  1X3U A;  1JHF A;  2FF4 A;  4HA8 A;  4DYR A;  2DT7 B;  1GVD A;  1OYI A;  3H9G A;  3TO6 A;  1X1P A;  3NWS A;  4Y3O A;  2CRG A;  2LLK A;  2A61 A;  1LVK A;  4A6D A;  1IRF A;  2RKH A;  3CES A;  1VQ9 I;  3FXO A;  2X9D A;  2ZBK A;  4PJN A;  1U3E M;  1W1W E;  4U7D A;  4XR6 A;  4FHT A;  1LB2 A;  5FD5 A;  2BEO A;  1ON1 A;  4QPO A;  1B8I B;  4ON0 A;  3F0C A;  1T6S A;  4RBO A;  1TT0 A;  3QWL A;  3SZT A;  2WV1 A;  5GPC A;  4CIC A;  3RSN A;  4IHY A;  4RMN A;  2A69 F;  3CJT B;  3GTK J;  3LSK A;  3GBG A;  2OCE A;  4M3D A;  1WJE A;  1ENH A;  3SHF A;  3BR3 A;  3CDL A;  2ISY A;  2BW3 B;  1UJ8 A;  2O7O A;  4HYE A;  1JGG A;  2B0L A;  2JQ7 A;  4IJA A;  2NVX J;  5C4J J;  3S8P A;  4PZJ A;  2ELH A;  3A01 B;  1VQ4 I;  1IUF A;  3MZ8 A;  1FBU A;  1W5S A;  4PJJ A;  1PUF A;  1R9T J;  2BZT A;  2IVM A;  5E1W A;  3CCE I;  2TCT A;  1VTN C;  2B7E A;  3P9I A;  3M3Y J;  1FOW A;  3HTU A;  4RAY A;  2BGC A;  2LH9 A;  2HOE A;  4HF2 A;  1K4S A;  2IGO A;  1XGM A;  3QQA A;  4XKB A;  2V9V A;  3OYJ A;  1IN6 A;  4BJ6 C;  4YFK F;  5HS8 A;  5HLI A;  5AIQ A;  1S9H A;  4D9J A;  4L9J A;  1ZQ3 P;  3E5U A;  2O5R A;  4CCK A;  2IJL A;  1QPM A;  1ZN2 A;  1XCV A;  2CUJ A;  2G7H A;  2HXO A;  3NQO A;  3OYE A;  3OV8 A;  3S93 A;  1A6I A;  2VBW A;  5E3L A;  3CO6 C;  4ZTJ A;  1ZRE A;  3OR2 C;  1Z9C A;  2W24 A;  5IPA A;  1W0T A;  4ZJZ A;  3EPZ A;  3ML6 A;  1X19 A;  5DCF A;  1APL C;  5FFZ A;  4H4K C;  1XGN A;  4IRH A;  1YJW I;  2PMZ A;  2X48 A;  1P4X A;  3BPV A;  2WV0 A;  4LK1 F;  1BI2 A;  3A02 A;  1Z05 A;  4X0G A;  1ETO A;  1SFU A;  2MFZ A;  5GAG J;  2ZFW A;  1ETV A;  3BR6 A;  1JTY A;  1GT0 C;  2MC4 A;  4AM3 A;  3TKY A;  2ZXJ A;  3OS1 A;  1ETX A;  1W0U A;  1H0M A;  3MZY A;  1WWX A;  1TWG J;  2LBF B;  3C18 A;  2ZSI B;  2FJ1 A;  3ECO A;  1RR8 C;  2R5Y B;  2F5D A;  3M8J A;  1I39 A;  2LY9 A;  1MD0 A;  2XAU A;  4CO8 A;  3HTS B;  1LEA A;  4ENJ A;  2EV0 A;  1HW5 A;  4LB6 B;  4E7S A;  5LBQ A;  4GRI A;  1LKX A;  5FJ8 J;  3CCL I;  4II3 A;  4G7H F;  3C1D A;  4PSW A;  2BVM A;  3LSM A;  3L2C A;  3CP8 A;  4CGZ A;  4LG0 A;  1IN5 A;  1JXS A;  2HU9 A;  3F9K A;  3R0A A;  3KP3 A;  1MNM C;  1WPK A;  4BKX A;  4Q48 A;  4BGD A;  1HBX G;  1YW9 A;  3DP7 A;  4A3E J;  2M3A A;  4G9Y A;  3IV5 A;  5FKK A;  4B47 A;  3WTW C;  5E79 C;  3BCA A;  2UUZ A;  3HRM A;  4UUV A;  1D0X A;  3BWG A;  1W7P B;  1BOA A;  2OTJ I;  3FX3 A;  4XKV A;  5IP7 J;  1U9N A;  4M9Z A;  2CGP A;  2QKM B;  1SD5 A;  2FU4 A;  1SC7 A;  4ZH4 F;  3KP6 A;  1BIA A;  3I0T A;  4I99 C;  3BR1 A;  3VYS B;  3MKW B;  4EM0 B;  2EIK H;  1U9O A;  4EJO A;  4V2G A;  2JK3 A;  3PNV A;  1G8X A;  3UR3 C;  5BS6 A;  2E1M C;  5K1Y A;  2ZJ2 A;  2XPU A;  2ACJ A;  2A05 A;  2AS5 F;  2EV5 A;  1QGP A;  4X6A J;  1YX5 A;  4BHP A;  4RB3 C;  1MBJ A;  3OS0 A;  3N97 A;  3GTG J;  3HZJ A;  3ZQQ A;  1GHC A;  3K9T A;  2HQR A;  2P5L C;  3BG3 A;  4IEJ A;  1B9M A;  4UVB A;  3LSJ A;  4AU7 A;  4GFB A;  2Y0S N;  2FE3 A;  1R4M B;  3G2B A;  1FIP A;  2OZU A;  2LKX A;  3E0J B;  1WJA A;  2R0Q C;  3F23 A;  1F1Z A;  2LSO A;  4L9T A;  2FQ4 A;  3FMR A;  4CYC B;  4E7L A;  1YE9 A;  4WX9 A;  2KIM A;  1J59 A;  2M7B A;  1IN8 A;  4N4N B;  3BZC A;  3IC7 A;  3BP8 A;  4C3I J;  2ISZ A;  2A6H F;  3GW2 A;  2B9S A;  1KYW A;  2PG4 A;  1OCC H;  3H35 A;  3A1Y A;  3QOP A;  3AFH A;  2STW A;  4FX4 A;  2QCO A;  1Q1H A;  4R8H A;  1FSE A;  4DNC A;  3BLY A;  4ESJ A;  1YIO A;  5F6F A;  1B4A A;  2JA6 J;  2M87 A;  1T98 A;  4PJL A;  5EDN A;  1V55 H;  4FX0 A;  4U0W A;  5E1X A;  2MH2 A;  4P5O A;  4E70 A;  4DZP A;  2DAO A;  4KMU X;  1OYW A;  2CUE A;  3C2H A;  4IPA A;  3KFW X;  4PJ0 C;  3CD6 I;  5JVG F;  2HOT A;  5K5Q A;  1TW2 A;  2F5F A;  4Y13 A;  3NRV A;  2GA2 A;  4IRG A;  2YU9 J;  2RQP A;  4A3F J;  3BQZ A;  3OOP A;  2X6O A;  1E3O C;  1WH7 A;  1R5G A;  3WTU C;  2JPB A;  2PN6 A;  2BHZ A;  1VF9 A;  4AYB N;  4YFN F;  3DEE A;  5GP9 A;  1O57 A;  4G8X A;  3ZQG A;  3J7A O;  3JRC A;  4V19 K;  4Y33 A;  3EYY A;  5F1J A;  1DU0 A;  3WHB A;  2JZY A;  3OYL A;  1HSJ A;  5EGO A;  4NDL A;  4AVZ A;  5IT9 K;  1AOY A;  1E3H A;  1JUS A;  2DBB A;  3VB2 A;  3ZQL A;  4B4C A;  5B1B H;  5HDN A;  4S05 A;  3B02 A;  1UZC A;  4DBR A;  3S17 J;  1D0Y A;  3OSF A;  2K3F A;  3BG7 A;  2NOG A;  2R7F A;  4CZZ A;  4G7Z F;  2UWM A;  4N0B A;  2QM3 A;  2HTS A;  2D1H A;  2R7Q A;  2L54 A;  4XLC A;  3K4M A;  2ELJ A;  5ERI A;  2R5Z A;  2HEO A;  5K5R A;  2EA4 A;  4MQV A;  1ULY A;  4KUM A;  1W4M A;  1T2K A;  5LD2 C;  3H5A A;  1WVR A;  2NXN B;  3HL2 A;  2GXG A;  3RZD J;  1NK3 P;  4HAM A;  1P4A A;  3GTP J;  2IA0 A;  3PO3 J;  2X1C A;  3EUA A;  4J19 A;  1IGN A;  2HOA A;  3MKY B;  3CCQ I;  2ZJQ F;  2MAB A;  2YS9 A;  5B5E C;  2FXA A;  2XPV A;  1X2N A;  3DPL C;  2IS6 A;  1S5L C;  1ZKG A;  3S3O A;  2QLZ A;  1X3Z B;  3TQN A;  2GM4 A;  5EEA A;  2I10 A;  5HLH A;  3U1K A;  1IRX A;  2KJB A;  3JRD A;  2E1N A;  2RN7 A;  1ZAO A;  4L5I A;  3VSL A;  1RUN A;  1ACI A;  4W1U A;  1RPW A;  3SFI A;  3D5S C;  1GXQ A;  2LY2 A;  4MTE A;  5E8I A;  4WXC A;  3ABK H;  1F9N A;  4YII A;  1OJL A;  1YX3 A;  2ME0 A;  3AG1 H;  5D8K B;  3K70 C;  1CGP A;  3N05 A;  4G94 A;  3OL4 A;  2CQX A;  4G12 A;  3AKZ A;  4EEF G;  1H89 C;  4MHG A;  3I59 A;  2ZME A;  3OYM A;  4YG2 F;  4BQA A;  3RTR A;  2IGM A;  1ZR4 A;  3WTS C;  3DFG A;  1TNT A;  3K10 A;  3R4K A;  1TWC J;  4GDF A;  3TL4 X;  2EK5 A;  2EIM H;  1J9I A;  2EIL H;  3ERM A;  2XKO A;  1EKE A;  3CF5 F;  3I58 A;  3OYF A;  5J1U A;  3W6V A;  1JHH A;  1X58 A;  2ZO4 A;  5CPR B;  4EMS A;  1U2W A;  1KGS A;  1LVA A;  5BMZ A;  4L0Z B;  1RZ4 A;  2FRH A;  5TJJ A;  4RS8 A;  3Q0V A;  3G6E I;  3FM3 A;  1FP1 D;  2W57 A;  4AID A;  1FSH A;  3KE2 A;  1MJA A;  3OYA A;  2OTL I;  3A4C A;  3LQR A;  2V9K A;  2A6E F;  4N9I A;  1TBX A;  3ZMD A;  5D8L B;  5FRM A;  3SYT A;  1FZP B;  4UY8 I;  2ZSH B;  2W1O A;  1LE8 B;  1XGS A;  1D1C A;  4EJV A;  3CLQ A;  1DPU A;  4F55 A;  1Z7U A;  3PJR A;  2M9H A;  5F64 A;  2DTR A;  3EUH A;  1X4O A;  4ZYD A;  3WU2 C;  1YW8 A;  2JPC A;  2WB1 N;  2JRM A;  3L2Q A;  2L7F P;  1A04 A;  2DMQ A;  3E5X A;  2WAQ N;  3IH3 A;  2UXN A;  4BXU A;  3VWB A;  2KZV A;  2BY2 A;  3DU6 A;  1W36 D;  1CF7 B;  5F0F A;  2LYC A;  3VEP A;  5LLQ A;  4IHW A;  2XUB A;  2DW4 A;  4M3G A;  4FCY A;  4JK1 X;  1ETQ A;  2HQN A;  2ZXW H;  3LMM A;  3WE2 A;  3OYC A;  1LQ1 A;  4ESB A;  3WTV C;  4JX5 A;  3HSF A;  1JT0 A;  2BW3 A;  5HS9 A;  5JFR A;  1I3Q J;  3K7A J;  1SEU A;  2L9N A;  2K9Q A;  4U0V A;  2IA2 A;  2Q8K A;  2HDD A;  2KIU A;  3SFZ A;  2H09 A;  1WSU A;  2HVQ A;  4LLG F;  4OOI A;  2R7U A;  4P9F A;  4BBR J;  2W84 A;  2CV1 A;  1WGX A;  2W85 A;  1R1U A;  1ZK8 A;  3BJA A;  4NC8 A;  1J75 A;  2R7S A;  5KAF C;  2GOM A;  2PMZ N;  2M1B A;  4O5V A;  4EJT A;  4BQN A;  4M9X A;  1BBY A;  3IAS 2;  5L3D A;  4CH7 A;  3I4M J;  2VC0 A;  2DYR H;  4Y4R A;  5TGT A;  4LK0 F;  1BI3 A;  1OMI A;  2NS7 A;  1AA7 A;  3DBH B;  1B72 B;  1ON2 A;  3RKQ A;  3GEZ A;  2H1L A;  4BNC A;  4UB6 C;  3MD2 A;  2VPL A;  1IZ1 A;  1WJB A;  1HKT A;  4CCM A;  2K4B A;  2KKO A;  2Y69 H;  3HPG A;  1VQK I;  3QU3 A;  3W6K B;  3WTY C;  2KDZ A;  1HW2 A;  2O3F A;  1Y1V J;  1Y39 A;  4F93 B;  1YW7 A;  4BS9 A;  3PFY A;  4CCJ A;  3K70 D;  2R5Y A;  3EDP A;  1FTT A;  1MMN A;  2F4O B;  3QP5 A;  4M73 A;  2MGQ A;  2XAS A;  3ZQF A;  2VLA A;  4KJZ A;  1HA8 A;  4BAY A;  4XNF A;  1MJ9 A;  1FX7 A;  2DCE A;  2FMY A;  2XAG A;  2EFQ A;  3TP3 A;  4LFU A;  4ZC3 A;  4RB2 C;  2GA1 A;  1IF1 A;  4ENN A;  3U1D A;  1P7I A;  3F6V A;  2WC2 A;  5EEG A;  2KPM A;  1A5J A;  3ZR8 X;  5C3E J;  3BQY A;  1PDN C;  3KX2 A;  2WBM A;  1N75 A;  4E7Z A;  5LGU A;  3S1R J;  2UV1 A;  1ZHF A;  1O7L A;  1IRG A;  4U7B A;  2KIQ A;  3FXL A;  3Q5F A;  1FPQ A;  4BHB A;  5FB2 A;  1BC7 C;  2OCC H;  2CW8 A;  5D5V B;  1L3L A;  4HEA 2;  2HNH A;  5EZH A;  2EBI A;  1KZH A;  3GTL J;  2JT1 A;  4P1W A;  4IQJ A;  2QQA A;  1YOV B;  2BOL A;  4B3X A;  3ZXS A;  2VE8 A;  2ZFU A;  2R7R A;  2CYY A;  4DYQ A;  1XD7 A;  1J2X A;  2ZXH A;  4XM3 A;  4RAZ A;  4YEL A;  1D5Y A;  1MMD A;  2L7Z A;  1ZR2 A;  2DXI A;  2BXZ A;  4XRF A;  1BI0 A;  3HOU J;  3S1N J;  4B3A A;  3DLL F;  1U0J A;  2D5V A;  3K2A A;  2K9L A;  3M4O J;  1K4T A;  1OPC A;  1D8K A;  4ANJ A;  3HOX J;  1MDM B;  4AVP A;  5LGN A;  1OQY A;  4UV8 A;  2K7L A;  3WGI A;  4XID A;  1TQP A;  3H92 A;  1NTC A;  3L00 A;  1Z0X A;  3HRS A;  4M74 A;  3V8J A;  4MNU A;  1I27 A;  3FIW A;  5HLG A;  5BQT A;  3MZH A;  4D5C A;  2HPI A;  2BY3 A;  1KU7 A;  2NYX A;  2R7O A;  4I6Z A;  2HGC A;  5LRR A;  1S6L A;  5EZG A;  3TMO A;  1XDU A;  2TDX A;  4YIF A;  4WK8 F;  1T38 A;  1ZH5 A;  5FRN A;  2XPW A;  3I4N J;  3BY6 A;  1DP3 A;  3ZMZ A;  3OYH A;  1HKS A;  1SFK A;  2XGD A;  3BR2 A;  2E1M B;  5GTH C;  3PSF A;  2QQ8 A;  3Q0W A;  1VQP I;  3S2D J;  1XG1 A;  3CJR B;  1SMT A;  5HOD A;  2FML A;  2BBY A;  3IL2 A;  2VQL A;  5LHI A;  3K2Z A;  2E36 A;  1SFE A;  2XDV A;  2XF6 A;  2ZNY A;  4XRM A;  1FYK A;  4A3L J;  3F72 A;  2CJJ A;  2PMH A;  2V4J C;  3JRB A;  3S3N A;  2EIJ H;  3PUF A;  3RCO A;  3NAR A;  3JRI A;  3GTM J;  1TLH B;  5M5W J;  2I8D A;  3HUG B;  3RKY A;  1G3Y A;  3ISP A;  4BDY A;  3FKJ A;  2HI3 A;  5IYC J;  4IO9 F;  1K78 B;  1DDN A;  3FDY A;  5M3M J;  4YFX F;  3BTI A;  4E4H A;  5LRS A;  1UHW A;  1XMX A;  2VON A;  1BL0 A;  2OQR A;  3HJE A;  2K9S A;  1X1C A;  4UVA A;  3OYN A;  5EYR A;  1B59 A;  1UAA A;  3QOD A;  4HST A;  3WU0 A;  2F2E A;  5HDG A;  2DQR A;  1DGW Y;  2NAZ A;  3I4P A;  2STT A;  4EJU A;  1BA5 A;  1Y0U A;  2AXT C;  5F0C A;  2KZG A;  3G73 A;  1V4R A;  1JT6 A;  2GAU A;  4RLF A;  1R22 A;  3LQQ A;  1YYV A;  3IKT A;  2ELK A;  5CQE A;  4HLX A;  2D45 A;  1TZL A;  3CJN A;  2PI0 A;  2CQK A;  1Z6T A;  4WWC A;  2P4W A;  3DCF A;  3H0D A;  5D4R A;  3I5U A;  1NK2 P;  4OMY A;  3E6B A;  2O0Y A;  4HLY A;  1R36 A;  4IL6 C;  1HLV A;  5JLX A;  5ICE A;  5IT9 Z;  3W3C A;  2GLO A;  5J4Y A;  1WJC A;  2L02 A;  2RV8 A;  3HC7 A;  2Y31 A;  4PCQ A;  3J7Y J;  5ICG A;  2Z5U A;  2CQ7 A;  3B6A A;  4BE0 A;  2KP6 A;  2WA0 A;  4CHU A;  3C7J A;  5JI6 A;  1E3P A;  2EZH A;  4EM2 A;  3A2K A;  5KVR A;  4QIW N;  1Y1W J;  1G4D A;  1SD6 A;  1WFX A;  2H94 A;  4CDG A;  3EYI A;  3JSP A;  1F43 A;  4AIK A;  4XIC A;  2VBY A;  2P7C B;  2W48 A;  2K9M A;  2VKD A;  3M1C A;  1Y8Q B;  3MKL A;  1KA8 A;  4MTD A;  3ABM H;  3BRO A;  2RVC A;  3MN2 A;  4DZJ A;  2Q1Z B;  1R00 A;  1MH4 A;  3TP0 A;  3CMA I;  3WG7 H;  4HNT A;  3IUO A;  1S29 A;  1RES A;  2DI3 A;  4LMY A;  2Z33 A;  5DM6 F;  1W7P A;  3I64 A;  2K02 A;  1MH3 A;  1K78 A;  1SD4 A;  4XKC A;  4RLQ A;  1UEL B;  3BZK A;  2BYV E;  5IOZ A;  4IHX A;  2A5W A;  2EIN H;  4IHV A;  2A6T A;  5EF6 A;  2WTE A;  4C9Y A;  4Y15 A;  3RKW A;  3LA7 A;  2HR3 A;  3SJM A;  3DQV C;  3NAU A;  4UVC A;  2VT3 A;  3G4S I;  1IRZ A;  1QZZ A;  3OOU A;  2R7D A;  3BT9 A;  3S3M A;  2K9N A;  3CCU I;  2VT2 A;  2FD5 A;  2KJC A;  3FKI J;  4LB5 A;  2YSR A;  3KEY A;  3BC8 A;  1Z91 A;  3CLO A;  2DLL A;  2KLO A;  4C3J J;  1PP8 F;  3TW7 A;  1YG2 A;  1XSD A;  3P9C A;  1SVM A;  2FEZ A;  1A36 A;  3CC7 I;  1N78 A;  1E0E A;  1GUU A;  3I55 I;  3DBL B;  2ETH A;  3CDI A;  3E6D A;  4FT8 A;  2FBH A;  1RI7 A;  3RPU D;  2JA8 J;  1RET A;  4LIU A;  4UXN A;  5B1A H;  3EET A;  4XLP F;  1K61 A;  1OR7 C;  2NS8 A;  2IAI A;  2XGC A;  3F3X A;  2Z16 A;  4XLE A;  2NOJ B;  2OJE D;  4HRI A;  3JSO A;  2GWR A;  3E6M A;  3I71 A;  2FSW A;  2IEK A;  1HW1 A;  1TC3 C;  1Z77 A;  3R60 A;  2CW0 F;  3SEQ A;  3K4J A;  3VOD A;  4Y17 A;  3COA C;  2HDC A;  2NNY A;  3DKY A;  2F5E A;  5LHG A;  5JVT A;  2QBY B;  4I09 A;  2OBP A;  3FBN B;  1T39 A;  4GYG A;  2V9P A;  5J40 A;  1IN7 A;  4YRV A;  4L9V A;  3A0H C;  3DBR B;  1VQL I;  1VQN I;  2WY8 Q;  4XRS G;  5KK1 A;  4RGR A;  4FTH A;  2GBY A;  1AHD P;  4HX7 A;  4G7O F;  1BW5 A;  2DMN A;  2IXS A;  3CQZ J;  1VQ8 I;  4CUG A;  2E19 A;  3FHN A;  2L5Q A;  2RGV A;  2MBF A;  5IY5 H;  2QA4 I;  1U78 A;  1LPQ A;  1DP7 P;  1FIA A;  2P6S A;  3WTX C;  5K7F A;  1O7F A;  3ZQI A;  3L1P A;  4DW6 A;  1BI1 A;  4LLN A;  1XPX A;  2K4J A;  1MBK A;  2HYG D;  1HF0 A;  3DV8 A;  3Q9V A;  1PUF B;  5FKM A;  3QU6 A;  4D7N A;  2MD5 A;  2Z3Y A;  3ZCO A;  4CYD A;  4DQ2 A;  5HNH A;  2VUM J;  2R7Z J;  4S04 A;  2EV6 A;  1WI9 A;  3AG4 H;  3EUH C;  3K0L A;  3T5X A;  3ZMV A;  3CUQ B;  2R3S A;  5D5U B;  5H20 A;  4UHT A;  2Q0O A;  3HUG A;  3CUQ C;  5J4V A;  4QWQ A;  4E7I A;  2WAE A;  1N25 A;  5CQG A;  3IRQ A;  4PFP A;  4JYK A;  1MMG A;  4BEH B;  1BOB A;  1P7J A;  1FWZ A;  1KQ9 A;  4KA4 A;  2XB5 A;  2JVH A;  3ZQC A;  4B1R A;  5D6E A;  2P8T A;  2DA5 A;  2L4M A;  1X3W B;  4HPQ A;  1P4W A;  2H8R A;  3FMQ A;  5HDK A;  1R6R A;  1UMQ A;  2UZK A;  4BQQ A;  4KT5 C;  1KU3 A;  2IW5 A;  3LA3 A;  4XBF A;  2E7X A;  3OSG A;  3PUB A;  1D5V A;  3KIO A;  2ZKZ A;  1FC3 A;  2XC7 A;  3LAJ A;  3IHU A;  4RDU A;  1R1T A;  3BPX A;  4CCO A;  4B09 A;  4EV0 A;  1RNL A;  5DDG A;  4ENM A;  1I1G A;  4HSR A;  3S16 J;  1EJ9 A;  4K2E A;  2LFB A;  4MIM A;  3P5J A;  5FLM J;  1BC8 C;  1IAW A;  3FWE A;  4BXX J;  4OAZ A;  2OPT A;  3E3V A;  5L3E A;  2JA7 J;  1Z1D A;  3H3Z A;  3HXL A;  2JSC A;  1B8I A;  1B1B A;  3JTG A;  4XLF A;  3F8N A;  1SD7 A;  1ONV A;  2XVC A;  3HIF A;  1R5I D;  4X1E A;  2K40 A;  5IP9 J;  4G6D A;  2VC1 A;  3GLL A;  2JRT A;  2K86 A;  2M0C A;  5DEQ A;  5ILS A;  4HF1 A;  3W2A A;  4CYC A;  2ZME B;  2LOO A;  2VJ5 A;  3ESW B;  5A2Q Z;  1I6H J;  3E6C C;  2Q2E B;  3V4G A;  1Z3X A;  4UV9 A;  2W7N A;  2QEN A;  3W2V A;  3OS2 A; 
#chains in the Genus database with same CATH homology
 2PLY A;  2HZT A;  2PMU A;  3PQJ A;  4WF2 A;  1F4K A;  1HKQ A;  5JR3 A;  1H9T A;  4OMZ A;  3F21 A;  4KYW A;  3SQN A;  3PQK A;  1G3W A;  2LF8 A;  4Q5S F;  3RYP A;  2DQL A;  3ECH A;  2QWW A;  3ZP5 A;  4IF4 A;  3FHZ A;  2OZ6 A;  2QQ9 A;  2FA5 A;  5CYV A;  1TQM A;  2O6G E;  2P5V A;  3M8E A;  5AIP A;  1I6X A;  2DK5 A;  4U88 A;  2O61 A;  3P9K A;  5IT3 A;  1U5T B;  3EQL F;  4HZF A;  4HX4 A;  5L3B A;  3HHH A;  5ICF A;  5L3F A;  3G3Z A;  3ELK A;  2F5C A;  2G7U A;  4EJW A;  3GFM A;  1WQ2 A;  2IA1 A;  5K5O A;  1LDJ A;  1GVJ A;  4LGW A;  2M8E A;  5L3G A;  3TGN A;  5FGM A;  5ED4 A;  4HW0 A;  4HDV A;  3ZN1 A;  4JBA A;  1FYM A;  3TO9 A;  4HQE A;  3V7R A;  3GX4 X;  1LJ9 A;  4EVI A;  4BHC A;  1WRJ A;  1YS7 A;  1BN5 A;  4KIF A;  1B9N A;  3ULQ B;  3GFJ A;  3KEO A;  2Y48 A;  2BE5 F;  4KDP A;  2FNP A;  4EM1 A;  4U0Y A;  3FZV A;  3WOD F;  1HQC A;  1JGS A;  3WTT C;  2P5K A;  2YX7 A;  1TTY A;  2OD5 A;  2COM A;  2HTJ A;  1ODD A;  3QPT A;  3W6J B;  4IHT A;  1IXC A;  1QZY A;  4A5N A;  1KQ8 A;  2HFH A;  2KRF A;  4JQF A;  4IHS A;  3F8C A;  1B6A A;  4PGH A;  2E7W A;  5DCM B;  3K69 A;  1TQI A;  4HBL A;  3F6O A;  2D2W A;  1CF7 A;  3SXY A;  2ESH A;  2RDP A;  3F8B A;  2PBI A;  2PEX A;  2V79 A;  2MA3 A;  5LHH A;  3IRR A;  2RNJ A;  4D0P A;  4L5J A;  2DK8 A;  1D3Y A;  5H6R A;  3MQ0 A;  2DU9 A;  1IXR C;  2H6C A;  2YPR A;  4BYY A;  4CXF A;  4KN4 X;  1USS A;  1RUO A;  2RC4 A;  4NHJ A;  2XIG A;  2V1U A;  1R7J A;  2QYO A;  3CUQ A;  1JE8 A;  3SZP A;  1AWC A;  3D0S A;  2LF7 A;  2W25 A;  5HVQ C;  3M7G A;  2YU3 A;  1FBS A;  2DO7 A;  1J7K A;  1SFX A;  3KP5 A;  3TOA A;  5CVI A;  3NEU A;  5BPD A;  2EB7 A;  4MEX F;  1FY7 A;  5DV5 A;  5ILV A;  3F8F A;  4I7H A;  2XAQ A;  3HSE A;  2L01 A;  2HKX A;  4I2O A;  5FLX K;  1BIB A;  4M9S A;  4KMF A;  3GYH X;  1UFM A;  2QZ8 A;  1E17 A;  1XMA A;  3KP7 A;  2KIF A;  3RI4 A;  3GO5 A;  3JAM K;  4ZZL A;  1YTY A;  3DEU A;  2QQB A;  4EGY A;  1MZB A;  3I59 B;  4M71 A;  5LEK A;  4KIC A;  1P92 A;  3Q9S A;  2C6Y A;  2M30 A;  1PP7 U;  3L7W A;  2DPU A;  3KZY A;  3JAM Z;  3QP6 A;  4AIJ A;  4ZYE A;  2YX4 A;  2J5O A;  3V7S A;  1EV7 A;  5BOX A;  4Q47 A;  1ZLK A;  1K7A A;  1FLI A;  4XSZ F;  1QO0 D;  2ESN A;  4LLL A;  5DD8 A;  3L09 A;  4A0Y A;  2X4H A;  1OR7 A;  1LNW A;  3TDU C;  3J80 Z;  3RIR A;  4EQQ A;  2O8X A;  2MH9 A;  3KZZ A;  3FXQ A;  1ZG1 A;  3GXO A;  4GO1 A;  5FO5 A;  3R61 A;  4GYI A;  1FBQ A;  3CO7 C;  1KYZ A;  1YQA A;  1R5H A;  3GFL A;  4WXD A;  3P7N A;  3T8T A;  1ZRC A;  3MAJ A;  3WGG A;  4KIG A;  4HX8 A;  1ZGJ A;  3WG9 A;  4P9U A;  4KN7 X;  4QLC U;  3VOE A;  2FBI A;  4R1H A;  5J6X A;  2AXL A;  2MLG A;  1SAX A;  2LNB A;  2A68 F;  3DF8 A;  1MJB A;  5DCM A;  2VOO A;  3QRF F;  1K6O A;  1L0O C;  3KCC A;  4ZZD A;  3QAH A;  5HOO A;  1REP C;  4Q4Z F;  4ZYG A;  3U2R A;  2EFN A;  2EFP A;  4A0X A;  3REO A;  2HWV A;  1G3S A;  1J5Y A;  1QNT A;  4M6Y A;  5DYM A;  4HV5 A;  3KET A;  1HXD A;  1G6N A;  2DT5 A;  3BZ6 A;  2OU2 A;  3JW4 A;  2L3D A;  4A6E A;  2IPQ X;  4AD9 A;  5CJ9 A;  1U5T C;  3LWF A;  2ZCW A;  5E1Z B;  2CWE A;  4NB5 A;  3VFZ A;  2V1D A;  2CO5 A;  2EFO A;  5FLX Z;  3GUD A;  2GQQ A;  5CVJ A;  5DD4 A;  2XGX A;  3KLN A;  4AIH A;  4MQ9 F;  2XRO A;  1UST A;  5A2Q K;  2LDU A;  1MKM A;  4OIN F;  2Z9O A;  4TV7 A;  4EGZ A;  4AWX B;  3V7C A;  3K1N A;  1XN7 A;  2FBK A;  3BJO A;  3ZQ7 A;  4HF0 A;  3FM5 A;  3GZ6 A;  3O2P E;  4GCV A;  2HYF A;  5CVU A;  4G6Q A;  2GIV A;  1W7P D;  3HYI A;  1Z6R A;  2GXB A;  3FMS A;  2QUF A;  4WCG A;  4A12 A;  4N9H A;  2Q2E A;  4O6J A;  3T1B A;  1LDK B;  1P2F A;  3WE3 A;  3GWZ A;  5D4S A;  2V6C A;  3S2W A;  3TOB A;  4I98 B;  5E8G A;  3LAP A;  3KP2 A;  2X0L A;  5L3C A;  4P55 A;  1FOK A;  2NS0 A;  1XSV A;  2VBZ A;  4GXO A;  5J8F A;  3L9F A;  5H6Q A;  4ENK A;  1I5Z A;  3HRT A;  1S8N A;  3WTZ A;  1UCR A;  3M1E A;  3U9G A;  3RPU A;  1IXS B;  5BPI A;  3BJ6 A;  4OIR F;  1T0F A;  3GZ5 A;  2IT0 A;  3KLO A;  3LA2 A;  4ETS A;  1YS6 A;  1KU9 A;  3K1P A;  2L4A A;  2ZNZ A;  3R6S A;  1GXP A;  5CVR A;  2EA2 A;  4ZYH A;  3O6B B;  1FP2 A;  5TRD A;  2K27 A;  3FF5 A;  1TW3 A;  3GLX A;  4ESF A;  3T0Y A;  1ZYR F;  2MC3 A;  1STZ A;  2OAZ A;  1NHA A;  4M6X A;  5HS7 A;  1LDD A;  5E17 F;  4OU0 A;  2A07 F;  1EH7 A;  2XHK A;  3J81 K;  2P6T A;  1XGO A;  4I0A A;  3DPT A;  3PFI A;  1XB4 A;  2H27 A;  4OIO F;  3HOS A;  1BM9 A;  2FQ3 A;  1ZG3 A;  3ZMT A;  5ICC A;  5DUI A;  3BOQ A;  3BDD A;  3D5L A;  1F5T A;  4KIB A;  3HSR A;  5AON A;  3TDZ C;  3N4M A;  1U6G A;  4IXA A;  3I54 A;  4A5M A;  3J81 Z;  4IRI A;  4L0Y B;  3RYR A;  2QBY A;  1YO5 C;  2PFB A;  2PQ8 A;  2XV4 S;  3MEX A;  1E2X A;  5J8C A;  3M8F A;  1YFH A;  4MEY F;  4I02 A;  3V8L A;  1H9G A;  3TO7 A;  3F8M A;  1U8R A;  3MWM A;  5CVV A;  3RDI A;  2VE9 A;  3WGH A;  1O3T A;  4HOB A;  4RGS A;  4H0E A;  2Y0M A;  5JHU A;  1FNN A;  5FD6 A;  4B8X A;  2Z99 A;  3ABT A;  2FOK A;  3K1M A;  1FT9 A;  4PGG A;  3ZPL A;  2BV6 A;  1YLF A;  5D5X B;  2QVO A;  1G3T A;  4ASN A;  2XKP A;  1V3F A;  1R58 A;  2XAF A;  1HST A;  1LEB A;  1KQ0 A;  2IRF G;  5EEH A;  2EJR A;  1S7O A;  4P96 A;  3KEQ A;  1KU2 A;  4GGG A;  4LD5 A;  3ROU A;  3B73 A;  2WWY A;  3WU1 B;  4LG0 B;  3MCZ A;  2V1X A;  2ADU A;  4L9N A;  3HOT A;  1SMY F;  1OKR A;  4A0Z A;  1D8J A;  2PJP A;  4F7Z A;  2VXZ A;  4OIP F;  3RKX A;  4L18 B;  3IWZ A;  4M72 A;  3F22 A;  1QBJ A;  6PAX A;  1OYY A;  3CDH A;  3HHG A;  2XRN A;  3R0J A;  5FFX A;  1RIO H;  4PDK A;  3ZMU A;  2A3S A;  1XMK A;  2JTV A;  1O3Q A;  1XDS A;  4LJZ F;  1O3R A;  1DUX C;  1EH6 A;  4RB0 A;  2M5W A;  4RGU A;  2LKP A;  4RGX A;  3GF2 A;  4KNY A;  5E20 A;  5D6F A;  3GVA A;  3V8K A;  5E18 F;  3RJP A;  3MFK A;  5LEJ A;  4IVN A;  3RPQ A;  2G9W A;  4MGR A;  2YR2 A;  3DXJ F;  1ZRF A;  4I0B A;  4XSX F;  1QQI A;  1EH8 A;  1TNS A;  1P6R A;  1S7A A;  3I53 A;  1O3S A;  2J5P A;  3E5Q A;  1S3J A;  2D1V A;  2CFX A;  1FYL A;  3ABU A;  2XAJ A;  1XSX A;  1R1V A;  3T8R A;  1U5T A;  2MLK A;  3M9A A;  1ZGA A;  2HS5 A;  2HKO A;  4A2U A;  2VBX A;  1IUY A;  1PUE E;  3LFK A;  2E1C A;  2DPD A;  2M45 A;  4WXH A;  3CUO A;  3DKW A;  1BJA A;  1ZLJ A;  3JTH A;  2P7V B;  2DFI A;  1XCB A;  2GZW A;  3IKV A;  1K79 A;  2CG4 A;  3KP4 A;  2NRA C;  1W5T A;  2O03 A;  4I01 A;  3O3K A;  4O3M A;  4HV6 A;  3E97 A;  1ZAR A;  5DUK A;  3FXU A;  2EWN A;  3IWF A;  3QPH A;  2A5Y B;  1DPR A;  2XAH A;  3AAF A;  1MDM A;  3C3W A;  3CTA A;  5CLS A;  3HRU A;  3ERE D;  3J80 K;  2VOP A;  3GFI A;  2OA4 A;  2CSO A;  4RB1 A;  4UNO A;  2IP2 A;  3ZN0 A;  4OIQ F;  1MGT A;  3ZMS A;  4HDU A;  5ILU A;  2UXX A;  3LST A;  4XLN F;  1WKM A;  2EFW A;  1ZRD A;  1J0R A;  1IW7 F;  4Z2Y A;  1UHM A;  2VOD A;  4HQM A;  1IN4 A;  1I1S A;  2FNA A;  5D5W B;  4BH9 A;  5LGT A;  4R79 A;  2VN2 A;  3FXR A;  4KFC A;  2H6B A;  3H3U A;  5F1R A;  1ZG5 A;  2Y75 A;  2OQG A;  1R23 A;  4NQW A;  2NNN A;  1UB9 A;  1C0W A;  1X3U A;  1JHF A;  2FF4 A;  4HA8 A;  1OYI A;  3TO6 A;  4A6D A;  2A61 A;  1IRF A;  2RKH A;  2ZBK A;  1U3E M;  4U7D A;  4FHT A;  1LB2 A;  5FD5 A;  2BEO A;  1ON1 A;  4ON0 A;  1T6S A;  3SZT A;  4CIC A;  2A69 F;  3SHF A;  2ISY A;  4HYE A;  2B0L A;  4IJA A;  4PZJ A;  2ELH A;  1FBU A;  1W5S A;  2IVM A;  5E1W A;  1VTN C;  3P9I A;  3HTU A;  4RAY A;  2BGC A;  2HOE A;  4HF2 A;  1XGM A;  2V9V A;  1IN6 A;  4YFK F;  5HS8 A;  5HLI A;  5AIQ A;  4L9J A;  3E5U A;  2IJL A;  1QPM A;  1ZN2 A;  1XCV A;  2G7H A;  3NQO A;  3OV8 A;  2VBW A;  3CO6 C;  1ZRE A;  1Z9C A;  2W24 A;  3ML6 A;  5DCF A;  5FFZ A;  1XGN A;  4IRH A;  1P4X A;  3BPV A;  2WV0 A;  4LK1 F;  1BI2 A;  1Z05 A;  1SFU A;  2ZFW A;  3TKY A;  2ZXJ A;  1H0M A;  3MZY A;  1WWX A;  3C18 A;  3ECO A;  2F5D A;  3HTS B;  1MD0 A;  4CO8 A;  1LEA A;  4ENJ A;  2EV0 A;  1HW5 A;  4LB6 B;  5LBQ A;  4G7H F;  3C1D A;  3L2C A;  4CGZ A;  4LG0 A;  1IN5 A;  1JXS A;  3R0A A;  3KP3 A;  4Q48 A;  1HBX G;  1YW9 A;  3DP7 A;  4G9Y A;  3WTW C;  3HRM A;  4UUV A;  3BWG A;  1W7P B;  1BOA A;  3FX3 A;  4M9Z A;  2CGP A;  1SD5 A;  2FU4 A;  4ZH4 F;  3KP6 A;  1BIA A;  3I0T A;  4EM0 B;  4EJO A;  5BS6 A;  5K1Y A;  2AS5 F;  2ZJ2 A;  2ACJ A;  2EV5 A;  1QGP A;  4BHP A;  4RB3 C;  3N97 A;  1GHC A;  3K9T A;  2HQR A;  2P5L C;  4UVB A;  1B9M A;  2FE3 A;  2OZU A;  3F23 A;  1F1Z A;  2LSO A;  4L9T A;  3FMR A;  4WX9 A;  2KIM A;  1J59 A;  1IN8 A;  3IC7 A;  3BP8 A;  2ISZ A;  2A6H F;  3GW2 A;  1KYW A;  2PG4 A;  3QOP A;  2STW A;  4FX4 A;  1Q1H A;  4R8H A;  1FSE A;  4DNC A;  4ESJ A;  1YIO A;  5F6F A;  1B4A A;  2M87 A;  1T98 A;  4FX0 A;  4U0W A;  5E1X A;  2MH2 A;  4P5O A;  4ENM A;  4E70 A;  2DAO A;  4KMU X;  1OYW A;  4IPA A;  3KFW X;  5K5Q A;  1TW2 A;  2F5F A;  4Y13 A;  3NRV A;  2GA2 A;  4IRG A;  2RQP A;  3OOP A;  1R5G A;  3WTU C;  2JPB A;  2PN6 A;  4YFN F;  1O57 A;  4G8X A;  3J7A O;  3EYY A;  2JZY A;  1HSJ A;  5IT9 K;  1AOY A;  2DBB A;  3VB2 A;  5HDN A;  4S05 A;  3B02 A;  2R7F A;  4G7Z F;  4CZZ A;  2UWM A;  4N0B A;  2QM3 A;  2HTS A;  2D1H A;  2L54 A;  5ERI A;  2HEO A;  5K5R A;  2EA4 A;  4MQV A;  1ULY A;  4KUM A;  1W4M A;  1T2K A;  2GXG A;  4HAM A;  1P4A A;  2IA0 A;  2FXA A;  3DPL C;  2QLZ A;  3TQN A;  5HLH A;  2KJB A;  2E1N A;  2RN7 A;  1ZAO A;  4L5I A;  1RUN A;  1GXQ A;  4MTE A;  5E8I A;  4WXC A;  1F9N A;  4YII A;  5D8K B;  1CGP A;  4G94 A;  4MHG A;  3I59 A;  2ZME A;  4YG2 F;  4BQA A;  3RTR A;  3WTS C;  3DFG A;  1TNT A;  3R4K A;  2EK5 A;  1J9I A;  2XKO A;  3I58 A;  1JHH A;  2ZO4 A;  4EMS A;  1U2W A;  1KGS A;  1LVA A;  5BMZ A;  4L0Z B;  1RZ4 A;  2FRH A;  5TJJ A;  4RS8 A;  3FM3 A;  1FP1 D;  2W57 A;  1FSH A;  3KE2 A;  1MJA A;  3LQR A;  2A6E F;  4N9I A;  1TBX A;  3ZMD A;  5D8L B;  1FZP B;  1XGS A;  4EJV A;  1DPU A;  1Z7U A;  5F64 A;  2DTR A;  3EUH A;  4ZYD A;  1YW8 A;  2JPC A;  1A04 A;  3E5X A;  2UXN A;  4BXU A;  1CF7 B;  5LLQ A;  3VEP A;  2XUB A;  2DW4 A;  4JK1 X;  2HQN A;  3WE2 A;  1LQ1 A;  4ESB A;  3WTV C;  3HSF A;  5HS9 A;  5JFR A;  4U0V A;  2IA2 A;  2Q8K A;  2KIU A;  3SFZ A;  2H09 A;  1WSU A;  4LLG F;  4OOI A;  4P9F A;  2W84 A;  2W85 A;  1R1U A;  3BJA A;  1J75 A;  2M1B A;  4O5V A;  4EJT A;  4M9X A;  1BBY A;  5L3D A;  2VC0 A;  4LK0 F;  1BI3 A;  1OMI A;  1ON2 A;  3GEZ A;  4BNC A;  1IZ1 A;  1HKT A;  2K4B A;  2KKO A;  3QU3 A;  3W6K B;  3WTY C;  1HW2 A;  2O3F A;  1YW7 A;  3EDP A;  3QP5 A;  4M73 A;  2XAS A;  4BAY A;  1MJ9 A;  1FX7 A;  2FMY A;  2XAG A;  2EFQ A;  4LFU A;  4RB2 C;  2GA1 A;  1IF1 A;  4ENN A;  3U1D A;  3F6V A;  2WC2 A;  5EEG A;  1PDN C;  5LGU A;  1ZHF A;  1O7L A;  1IRG A;  4U7B A;  3Q5F A;  1FPQ A;  4BHB A;  5FB2 A;  1BC7 C;  5D5V B;  1L3L A;  2JT1 A;  2QQA A;  2VE8 A;  2CYY A;  1XD7 A;  1J2X A;  4RAZ A;  4XRF A;  1BI0 A;  1OPC A;  1D8K A;  1MDM B;  4AVP A;  5LGN A;  3WGI A;  4UV8 A;  2K7L A;  1TQP A;  3H92 A;  3L00 A;  3HRS A;  4M74 A;  3V8J A;  4MNU A;  1I27 A;  5HLG A;  5BQT A;  3MZH A;  1KU7 A;  2NYX A;  2HGC A;  5LRR A;  1S6L A;  4YIF A;  4WK8 F;  1XDU A;  2TDX A;  1T38 A;  1ZH5 A;  3BY6 A;  3ZMZ A;  1HKS A;  1SMT A;  2FML A;  2BBY A;  3IL2 A;  5LHI A;  3K2Z A;  1SFE A;  2ZNY A;  1FYK A;  3F72 A;  2PMH A;  1TLH B;  3RKY A;  1G3Y A;  3ISP A;  1K78 B;  1DDN A;  4YFX F;  5LRS A;  1UHW A;  2VON A;  2OQR A;  4UVA A;  1B59 A;  3WU0 A;  2F2E A;  5HDG A;  2DQR A;  2NAZ A;  2STT A;  3I4P A;  4EJU A;  1Y0U A;  3G73 A;  1V4R A;  2GAU A;  1R22 A;  3LQQ A;  1YYV A;  3IKT A;  4HLX A;  2D45 A;  3CJN A;  2PI0 A;  2CQK A;  1Z6T A;  4WWC A;  2P4W A;  5D4R A;  3I5U A;  4OMY A;  3E6B A;  2O0Y A;  4HLY A;  1R36 A;  5ICE A;  5IT9 Z;  2L02 A;  2RV8 A;  4PCQ A;  5ICG A;  2Z5U A;  4CHU A;  3C7J A;  5JI6 A;  4EM2 A;  5KVR A;  1G4D A;  1SD6 A;  2H94 A;  4CDG A;  3EYI A;  3JSP A;  4AIK A;  2VBY A;  2P7C B;  1KA8 A;  4MTD A;  3BRO A;  2RVC A;  1R00 A;  1S29 A;  2DI3 A;  4LMY A;  2Z33 A;  1W7P A;  3I64 A;  2K02 A;  1K78 A;  1SD4 A;  2BYV E;  2WTE A;  4Y15 A;  3RKW A;  3LA7 A;  2HR3 A;  3DQV C;  4UVC A;  2VT3 A;  1QZZ A;  2R7D A;  2VT2 A;  2KJC A;  4LB5 A;  2YSR A;  1Z91 A;  3CLO A;  2DLL A;  1PP8 F;  1YG2 A;  1XSD A;  3P9C A;  2FEZ A;  2ETH A;  3E6D A;  4FT8 A;  2FBH A;  1RI7 A;  4UXN A;  3EET A;  4XLP F;  3F3X A;  3JSO A;  2GWR A;  3E6M A;  3I71 A;  2FSW A;  1HW1 A;  3R60 A;  2CW0 F;  3VOD A;  4Y17 A;  3COA C;  2HDC A;  2NNY A;  2F5E A;  5LHG A;  5JVT A;  2QBY B;  4I09 A;  2OBP A;  1T39 A;  4GYG A;  1IN7 A;  4L9V A;  5KK1 A;  4RGR A;  4G7O F;  4HX7 A;  2RGV A;  2MBF A;  1U78 A;  1DP7 P;  2P6S A;  3WTX C;  1O7F A;  1BI1 A;  4LLN A;  2K4J A;  2HYG D;  3DV8 A;  3Q9V A;  3QU6 A;  2MD5 A;  2Z3Y A;  4CYD A;  4DQ2 A;  4S04 A;  2EV6 A;  1WI9 A;  3K0L A;  3T5X A;  3ZMV A;  3CUQ B;  2R3S A;  5D5U B;  5H20 A;  4UHT A;  2Q0O A;  3HUG A;  3CUQ C;  4QWQ A;  3IRQ A;  1FWZ A;  1KQ9 A;  4KA4 A;  5D6E A;  2P8T A;  2L4M A;  1P4W A;  3FMQ A;  5HDK A;  2UZK A;  4KT5 C;  1KU3 A;  2IW5 A;  3LA3 A;  4XBF A;  2E7X A;  1D5V A;  2ZKZ A;  1FC3 A;  3LAJ A;  3IHU A;  1R1T A;  3BPX A;  4B09 A;  4EV0 A;  1RNL A;  5DDG A;  1I1G A;  4K2E A;  1BC8 C;  1IAW A;  3FWE A;  3E3V A;  5L3E A;  1Z1D A;  3H3Z A;  2JSC A;  1B1B A;  3JTG A;  3F8N A;  1SD7 A;  1ONV A;  2XVC A;  3HIF A;  4G6D A;  2VC1 A;  2JRT A;  2K86 A;  5DEQ A;  5ILS A;  4HF1 A;  2ZME B;  5A2Q Z;  3E6C C;  3V4G A;  4UV9 A;  2QEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...