3WE2A

Structure of blm rqc domain bound to a phosphate ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
TRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Bloom syndrome protein
publication title Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3we2A00
4RGSA 2NYXA 1OYIA 5HOOA 4NB5A 4ZYEA 1H0MA 3E5XA 5F1RA 3FHZA 3BJOA 4HV6A 4QLCU 1DPUA 1SFUA 3W6KB 2MLKA 2GXGA 3C1DA 1TW2A 2LKPA 1EH6A 2M8EA 4P9FA 1D8JA 2IVMA 2MLGA 4Z2YA 5BPIA 2IW5A 2DU9A 1QNTA 5A2QZ 1TBXA 5D5XB 2HR3A 1U6GA 2LDUA 5BQTA 2FEZA 5HVQC 3AAFA 4M9ZA 2K27A 4AD9A 2G7HA 1HW1A 2IPQX 4M9SA 1FY7A 4YG2F 3D5LA 2HEOA 4M6YA 3WTTC 1XD7A 1S29A 4A6DA 3SXYA 5DUKA 2W85A 4PGHA 4YIFA 3HRUA 1XGMA 2V1DA 3CUQA 3REOA 4HX8A 5FGMA 4MHGA 3T8TA 2RVCA 1MDMB 4EMSA 3I59B 2YX7A 1FZPB 4NHJA 4EGYA 2FXAA 3DF8A 2W57A 2MA3A 1ZREA 2GQQA 1O7FA 4B09A 5D6FA 4LK0F 3IRRA 2HZTA 3J81Z 3JAMZ 3H3UA 4WK8F 3QPTA 2EWNA 2ACJA 3RYRA 1XSDA 5L3DA 2EV6A 1JHHA 3WTXC 3BJ6A 2MH2A 4ZYHA 4EM2A 3ZMSA 3RTRA 1XMKA 4LG0B 5D6EA 2UXXA 2HTSA 3U9GA 1T2KA 3ABUA 1FYLA 2Y0MA 1U5TB 2GXBA 4MGRA 5DV5A 1XCBA 4O6JA 4MQVA 4XLPF 2EB7A 1AWCA 1S8NA 2O61A 3NQOA 3WGHA 2W25A 5E20A 4MTEA 2PEXA 2KKOA 1YS7A 4U7DA 1GVJA 4G8XA 2XROA 5AIQA 3E6MA 1FT9A 1HBXG 2XHKA 2K7LA 1CF7B 5CVRA 4FHTA 1W4MA 1BN5A 3S2WA 1A04A 5LEKA 1YIOA 3CJNA 4A0YA 4FT8A 3HHGA 3FM5A 3K0LA 3F8FA 5LRSA 3RPUA 1OKRA 2OA4A 3V7SA 4L0ZB 5DD4A 3V8JA 3Q9SA 1ZGAA 2Y48A 4BAYA 3E97A 3QOPA 2COMA 5D8LB 5JFRA 3CDHA 1JGSA 2D1VA 4Q48A 3RYPA 2HGCA 2WV0A 1RZ4A 3QU3A 4JQFA 4CDGA 2X0LA 1G6NA 2A68F 2DBBA 1ULYA 4BHCA 4KA4A 3K1MA 3IKVA 2VBXA 1GXPA 4IRIA 4IHSA 2CW0F 2M45A 2M30A 3R61A 5CVIA 5BS6A 2EFWA 2DT5A 2QWWA 1RNLA 2PFBA 4YFKF 2DI3A 1ZH5A 1ZLKA 3E6DA 2FBHA 2A6EF 3F21A 5A2QK 2O3FA 4L0YB 2ZXJA 4MQ9F 3ELKA 5L3GA 4I98B 2HQRA 2P5LC 1S3JA 5E17F 1IXRC 4RGRA 1B59A 3V8KA 5D4RA 4BHBA 3ZQ7A 4I09A 4UVBA 1PUEE 2DQRA 4LFUA 2Q8KA 4O5VA 3KP3A 1ZLJA 1PP7U 3WTVC 5IT9Z 2RGVA 4OINF 4G7HF 2FRHA 3ZMVA 2J5PA 2V9VA 3HUGA 3KP2A 3DXJF 4EM0B 2BBYA 3VB2A 1U78A 3IL2A 1OYWA 1IXCA 4K2EA 3RPQA 5L3EA 1ZG5A 2PMUA 3HRSA 3ZN1A 1WI9A 2UXNA 3J81K 3JAMK 2K86A 2RNJA 4UUVA 3E3VA 4I2OA 2OU2A 2R3SA 3E6CC 3HHHA 4HX4A 1R23A 3F8CA 2Z9OA 1F5TA 1FWZA 6PAXA 4AIKA 5J8FA 2GA1A 3GXOA 2KJCA 1IN7A 4S05A 2AS5F 4G7OF 2PLYA 2J5OA 2A07F 3ZMUA 5HS9A 3F22A 5FFXA 2ISZA 3MAJA 1P4WA 4HBLA 4O3MA 3WU1B 2JRTA 1MDMA 3I59A 4ZZLA 1MKMA 4ASNA 2JPBA 1FSEA 4LLGF 4BH9A 4BHPA 3I64A 2STWA 4U88A 4IF4A 2V6CA 3T8RA 4IRHA 1H9TA 5EEHA 1RIOH 2A6HF 2RV8A 3ECHA 1IRGA 3BOQA 4HA8A 2KRFA 3QAHA 2EV5A 1R5HA 3ML6A 4Y13A 1G3WA 1STZA 1JE8A 3KZZA 5ILSA 2A5YB 4KNYA 1B1BA 5HLHA 2OZ6A 4EJTA 4IRGA 4BXUA 1XB4A 3EYIA 1UHWA 2HWVA 5K5RA 3HTSB 5DCFA 4ON0A 2H6CA 2CFXA 4LG0A 1KYWA 3BY6A 2HYGD 1RUOA 2WTEA 5E1ZB 4Y17A 1DUXC 1J0RA 4ENMA 2FBIA 2KIUA 1GXQA 2ADUA 3HOSA 3LQQA 2R7FA 2QENA 2ZFWA 3KLNA 1I1GA 1XCVA 2TDXA 2DPUA 3LFKA 4YFNF 1U2WA 2QYOA 2PQ8A 2MBFA 4HLYA 1H9GA 4R1HA 4KIFA 4NQWA 3GX4X 4OU0A 4XRFA 1HW2A 1R22A 2GZWA 3V4GA 1ZRCA 4PZJA 4WXDA 2EFPA 5DYMA 2AXLA 3WTUC 3GFLA 3MWMA 1HSTA 1CF7A 1TQPA 5D4SA 3CUQC 1C0WA 2F5FA 3L7WA 3V8LA 1YW9A 2ESNA 3I54A 1GHCA 3GZ5A 3CO6C 2A3SA 1FYMA 2H6BA 1IZ1A 2MC3A 1ZARA 3R0JA 1ZHFA 2HOEA 3DP7A 3HSFA 2XUBA 1F1ZA 2V1UA 3J7AO 5AIPA 2V79A 3GYHX 1BC7C 3GFMA 3K9TA 4G94A 5CVUA 2O8XA 4CO8A 5IT9K 3RKWA 2IJLA 3ZMTA 1QZYA 3QP5A 4U0YA 4YIIA 2ZMEB 1T0FA 2FU4A 3ISPA 4FX0A 3SZTA 2VONA 1ZG3A 1LJ9A 4G7ZF 5DEQA 4WXHA 4TV7A 4M6XA 2K4BA 3F6VA 4HF0A 1WWXA 1U8RA 4YFXF 3MCZA 2JT1A 3WU0A 1HKSA 3K1PA 1W5SA 1I5ZA 1USSA 3F8NA 4MEXF 1O3SA 5H6RA 4N0BA 3ZMDA 2CYYA 1YW7A 1JHFA 2W84A 2MD5A 3F8BA 2VBYA 3KFWX 4E70A 3LA3A 3RDIA 1IUYA 3H92A 1QGPA 2K02A 5E18F 2FMYA 4HDUA 3KLOA 3O2PE 1MD0A 1Z9CA 4UHTA 3FWEA 3IC7A 4LB6B 2M87A 3R60A 4HX7A 1KU3A 2E7XA 4LLLA 1BI0A 2EJRA 1F4KA 1IN5A 2DAOA 1FYKA 1T6SA 3MEXA 1R00A 1SMYF 1V4RA 3ZP5A 3V7RA 2BE5F 1ZRDA 1F9NA 1YYVA 3P9CA 5ICEA 2FBKA 3GVAA 3V7CA 2P5KA 5LHGA 4UVCA 2DTRA 1IAWA 2HFHA 3DV8A 4N9HA 3TOBA 1MJBA 1KYZA 2L02A 1FP2A 1J9IA 4ZYDA 1P4AA 1R1UA 2DK8A 3TQNA 2XV4S 4KIGA 1L0OC 1W7PB 4LLNA 3L00A 4L18B 2IP2A 2P5VA 3M9AA 4WCGA 2DW4A 4Q4ZF 3BPXA 3M8FA 1E2XA 3J80K 5E1XA 4CXFA 2VXZA 2F5EA 1VTNC 3HRTA 3EDPA 3I4PA 1P2FA 1HXDA 4WX9A 1TNSA 3EETA 1D8KA 4M71A 1Z7UA 1IN4A 1TW3A 4IPAA 2D45A 2EA2A 2ZCWA 2GWRA 1O7LA 3KP5A 1FNNA 2L4MA 3QP6A 1J59A 1YO5C 2GA2A 3ULQB 5J6XA 1PDNC 1AOYA 1BIAA 2ESHA 3PFIA 4ZYGA 2GAUA 1R7JA 3IHUA 4U7BA 3W6JB 4HOBA 1FPQA 5ICFA 3F3XA 4KICA 2BV6A 5CVJA 3RKYA 1SAXA 4WF2A 3TKYA 4JBAA 1BOAA 1BM9A 3U2RA 4FX4A 2FNAA 2LF8A 1QPMA 4EVIA 3U1DA 4HZFA 4EM1A 2Z3YA 2QQAA 1FLIA 3FMRA 3MFKA 2P8TA 1DPRA 2YSRA 3ECOA 1EH7A 3D0SA 2RDPA 1S7OA 1MZBA 2QBYB 2F5DA 2FMLA 5LRRA 1LDJA 1BJAA 2ZNYA 4HQMA 1ON1A 3HOTA 4CGZA 1B9MA 5EEGA 1J2XA 4BQAA 4LD5A 1EV7A 5TRDA 5JR3A 4CICA 1FBUA 4RB3C 1OYYA 4LK1F 3F6OA 1X3UA 4UVAA 2VC1A 4EV0A 1W7PD 1SD4A 2NNYA 3CUQB 1TQIA 2Q2EA 3GO5A 4JK1X 5L3BA 2VC0A 1CGPA 3FMSA 1I27A 2JSCA 3WG9A 5L3CA 2HYFA 3PQJA 3I58A 2VT3A 3BZ6A 1K6OA 3B02A 3SZPA 1TTYA 5CVVA 1T39A 3R6SA 4RGUA 1FC3A 1IF1A 5F64A 2Z33A 3GFJA 1B9NA 5H6QA 3M1EA 4WXCA 3L2CA 2DQLA 3RI4A 4HF1A 1K79A 3T0YA 4RB2C 1G3YA 5K5OA 2OQRA 5BOXA 2ISYA 2XAJA 3ZMZA 2BGCA 2ZMEA 2FSWA 2HQNA 3BDDA 3GFIA 5HS7A 4LJZF 2ELHA 2K4JA 4IJAA 4UNOA 1TNTA 1OMIA 3JTHA 1BBYA 2KJBA 2D1HA 2CG4A 1XSVA 1ZG1A 1R36A 2Y75A 4P55A 2ZNZA 2CQKA 5DUIA 2L4AA 4Q5SF 4MNUA 5D5VB 4OIRF 2JPCA 2R7DA 2HDCA 2Q0OA 4ZH4F 3JTGA 1XGSA 1QO0D 1ZYRF 3VOEA 4ESFA 3DKWA 2NRAC 1HW5A 1KA8A 5KK1A 3LAJA 2EV0A 4ENJA 4G6QA 4B8XA 2FF4A 4L5JA 1I6XA 2ZKZA 3LWFA 1XDSA 4HF2A 4D0PA 4GYIA 5E8IA 3HYIA 1K7AA 5HLGA 3QU6A 1BI1A 4MEYF 3HRMA 2Z5UA 2YX4A 2VODA 3LA7A 3JSPA 3T5XA 3SHFA 2CWEA 2OZUA 4MTDA 2OQGA 1USTA 1U5TA 1O57A 5D5UB 4QWQA 3KZYA 5LHHA 2QQBA 3K69A 2DLLA 2FQ3A 2KIMA 3G3ZA 1HSJA 1KQ0A 1ZGJA 3C7JA 2X4HA 1G3TA 4I01A 1YQAA 2QUFA 3TO7A 2H09A 1MJ9A 2RKHA 3K2ZA 1K78B 3WE3A 1S7AA 2XRNA 2XAGA 4GXOA 1U3EM 2D2WA 4U0VA 3F72A 3WTYC 2DO7A 3EYYA 1OR7A 3WGIA 2WWYA 3IWZA 3Q5FA 3NRVA 4S04A 1HQCA 5LGTA 2PI0A 5BMZA 2UWMA 4P96A 5TJJA 2G9WA 5H20A 5HDGA 4RAZA 1KQ8A 4RAYA 1BIBA 3GLXA 5KVRA 2HKOA 4XBFA 5LBQA 2IA2A 2M1BA 2LF7A 2E7WA 4UXNA 1LDDA 2E1CA 4A6EA 1UHMA 5CLSA 1B4AA 2Z99A 5F6FA 2EK5A 2XAHA 2NS0A 5LHIA 3VODA 1YLFA 4UV9A 4IHTA 3DFGA 3L09A 3ROUA 3IWFA 4I0AA 3R4KA 3KP7A 5FLXZ 4A0ZA 5FFZA 3WODF 5HS8A 2IA1A 3O3KA 1BI2A 4UV8A 1V3FA 1QQIA 4AIHA 4DQ2A 2BEOA 2QBYA 1LB2A 2A69F 5HDKA 5E8GA 4HDVA 3EQLF 1ON2A 4CZZA 5ERIA 1R58A 3DEUA 1ONVA 2CO5A 3FXRA 1REPC 1MGTA 1FSHA 3HIFA 4A0XA 3FX3A 4P5OA 1Y0UA 1J5YA 5CYVA 3RIRA 3IRQA 5DCMB 3O6BB 4L9VA 3BWGA 1O3TA 2MH9A 4KMFA 4EJOA 5ILVA 1BC8C 1IXSB 4KYWA 2P4WA 5ED4A 2QLZA 1WQ2A 5BPDA 3N4MA 1QBJA 2P6SA 2VE8A 1XN7A 3LSTA 3FM3A 3C3WA 4OOIA 3ZN0A 4EJUA 2PJPA 2L54A 4KIBA 4WWCA 2DFIA 1W5TA 4KN4X 1DDNA 4OIQF 4DNCA 1TQMA 3SFZA 2IT0A 2O0YA 3HSEA 2M5WA 1ZN2A 3HTUA 1WSUA 3OOPA 3VFZA 4BYYA 2QZ8A 3M8EA 5K5QA 4HAMA 3I5UA 2RQPA 3RJPA 3CTAA 4PGGA 4PDKA 3KP6A 3C18A 3FMQA 1XGOA 1FP1D 3B73A 2JTVA 2RC4A 4L9JA 3EUHA 5DDGA 1G3SA 1P92A 3KCCA 4RB1A 2B0LA 1FOKA 5AONA 2G7UA 2XKOA 5HLIA 4XLNF 4HV5A 4AWXB 3I53A 3TOAA 1KQ9A 1XSXA 3TO9A 3TDUC 1BI3A 1IN8A 2YPRA 4RS8A 3H3ZA 5D5WB 4R8HA 4F7ZA 4GO1A 3LAPA 2A61A 1LEAA 2P7CB 4LGWA 4A12A 4XSXF 4R79A 1KGSA 1J75A 4ENKA 2VBWA 3GWZA 2GIVA 3FF5A 2NAZA 5FD6A 4G9YA 3E5UA 5ILUA 1J7KA 2L01A 2YR2A 4A5NA 3BJAA 1LEBA 4RB0A 3R0AA 1LVAA 2XKPA 4IXAA 4L9NA 4KUMA 2XIGA 2H27A 3CUOA 3FXUA 1Z6RA 1DP7P 2VOOA 1SMTA 4OMZA 4M9XA 1NHAA 4HW0A 2FOKA 5E1WA 1E17A 3MQ0A 2FA5A 3KP4A 5J8CA 2XGXA 3NEUA 3IKTA 4OIPF 3LQRA 2FE3A 2PG4A 1O3QA 2XAQA 1I1SA 2V1XA 1SD7A 2XASA 4H0EA 3GW2A 1K78A 1MJAA 3ZPLA 3QRFF 1YFHA 2F5CA 5JHUA 4AVPA 5FLXK 4L5IA 4ETSA 2O03A 3M7GA 1RI7A 4N9IA 4Q47A 3GZ6A 2HTJA 4GGGA 4KFCA 3DPLC 2OAZA 5L3FA 2EFNA 1WKMA 3G73A 3T1BA 1ODDA 2KIFA 3BPVA 3KE2A 4I7HA 4A2UA 2UZKA 1LQ1A 4EJVA 4AIJA 2XVCA 4LB5A 3TO6A 3P7NA 5D8KB 5DD8A 2XAFA 1R1VA 4CHUA 2QQ9A 3F23A 1D3YA 4ESJA 3I0TA 2HS5A 4M74A 3COAC 4HQEA 2HKXA 2VBZA 2NNNA 3F8MA 4BNCA 4I02A 1Z6TA 4PCQA 1OPCA 2OBPA 3JSOA 1KU7A 5ICCA 4EJWA 1FBQA 4M72A 1SD5A 1S6LA 1ZAOA 1XMAA 3GUDA 4HLXA 5LEJA 2STTA 2FNPA 4GYGA 2ZBKA 1P6RA 1R5GA 3BROA 4ZZDA 1SFXA 3WTZA 1EH8A 2VOPA 1T98A 3KETA 2RN7A 3ERED 1WRJA 4EGZA 1HKQA 3DQVC 4M73A 3PQKA 3P9KA 1U5TC 4G6DA 1SD6A 5FB2A 4KT5C 1HKTA 2ZO4A 1KU2A 4RGXA 2LSOA 2QVOA 1JXSA 4OIOF 4HYEA 5HDNA 2DPDA 2IA0A 1D5VA 1O3RA 4KMUX 1YS6A 2OD5A 4XSZF 2PMHA 2H94A 5FO5A 5DCMA 1UCRA 1YTYA 1IW7F 5FD5A 4IVNA 3I71A 1P4XA 2F2EA 5IT3A 2WC2A 2YU3A 4LMYA 2EFOA 4U0WA 3RKXA 1QZZA 4A5MA 1L3LA 3CLOA 2EA4A 1RUNA 1IRFA 3KEQA 3N97A 4KDPA 4EQQA 2E1NA 1UFMA 4KN7X 3FZVA 1TLHB 3K1NA 5LGNA 1XGNA 3L9FA 3GF2A 4L9TA 5JI6A 3ABTA 2W24A 1LNWA 4ESBA 3WTWC 5ICGA 1SFEA 2DK5A 2PN6A 5CJ9A 4CYDA 1UB9A 1Z05A 2VN2A 1W7PA 3E5QA 2VT2A 3OV8A 3J80Z 2P7VB 3WTSC 3MZHA 3FXQA 1KU9A 3WGGA 3JW4A 2LNBA 4I0BA 5JVTA 3CO7C 3P9IA 4OMYA 3SQNA 1Z91A 3TGNA 2JZYA 3VEPA 2C6YA 1FX7A 1YG2A 3QPHA 1G4DA 1T38A 3E6BA 2IRFG 3Q9VA 5K1YA 1Z1DA 1IN6A 2P6TA 1Q1HA 4ENNA 2ETHA 3HSRA 1YW8A 2VE9A 1FBSA 1LDKB 3MZYA 3DPTA 4P9UA 3GEZA 2QM3A 2BYVE 1B6AA 1PP8F 1R1TA 3LA2A 5LGUA 1ZRFA 2CGPA 3KEOA 4GCVA 1XDUA 2ZJ2A 3BP8A 2O6GE 2CSOA 4Y15A 2PBIA 2EFQA 3TDZC 5LLQA 2L3DA 3WE2A
chains in the Genus database with same CATH superfamily
2BY2A 2O7OA 4RGSA 2NYXA 1E0EA 1OYIA 1MMGA 3ZCOA 2LD5A 4CCMA 5FKMA 4ZJZA 5HOOA 2EINH 4NB5A 4ZYEA 1H0MA 3E5XA 5GAHJ 5F1RA 3FHZA 2R7RA 3F0CA 3BJOA 4HV6A 4PJLA 2L5QA 4QLCU 1DPUA 1SFUA 3W6KB 2MLKA 2GXGA 1YITI 4XKWA 3C1DA 2DMPA 1TW2A 2LKPA 1HDPA 1EH6A 2M8EA 1R9TJ 4P9FA 1D8JA 2VQCA 2IVMA 4IX7A 4X1EA 5E3LA 1XTAA 1Q1VA 3K4BA 1R5ID 2MLGA 5EGOA 3SJMA 4Z2YA 5BPIA 3FXMA 3OR2C 1RPWA 1PUFB 2IW5A 2K9SA 2X48A 1WJCA 2DU9A 1Y0NA 1PYVA 1QNTA 5CQGA 5A2QZ 1TBXA 5D5XB 2HR3A 1U6GA 2LDUA 5BQTA 4BE1A 2FEZA 5HVQC 3AAFA 3CDIA 4M9ZA 3DKXA 1V55H 4BDZA 2K27A 4AD9A 2X6WA 2P0WA 2XSJC 2HOTA 1VQ5I 2G7HA 1HW1A 2IPQX 1B8IB 2R7ZJ 4M9SA 1FY7A 3S8PA 4V2FA 4YG2F 3W3CA 3D5LA 2VI6A 2HEOA 2R5ZA 4M6YA 5EF6A 4FE4A 3WTTC 1XD7A 1S29A 2HQAA 4A6DA 2R7TA 5E79C 3VSKA 3ZGKA 1RKTA 1IDZA 3SXYA 1VQ8I 5DUKA 3O8HA 2L9VA 5EJCA 2W85A 4PGHA 4YIFA 3HRUA 4PJMA 1XGMA 2E2JJ 2V1DA 5CKTA 2VJ4A 4C2TA 2M4GA 3CUQA 3H9QA 1OCCH 4RA2A 3REOA 4HX8A 4M6VA 4OAYA 5FGMA 4MHGA 3K6GA 3OSFA 3T8TA 1HCRA 4C9YA 2NOGA 2RVCA 1MDMB 1I3QJ 4EMSA 3I59B 1ETWA 2YX7A 2LK2A 1FZPB 4HRIA 4NHJA 4EGYA 2FXAA 3DF8A 2W57A 4CH7A 2MA3A 3CCRI 2BY1A 1EKEA 1ZREA 3EPZA 2GQQA 1O7FA 3AFHA 1QPIA 2VUMJ 2E35A 2I8DA 4B09A 3LOCA 5EEAA 3OL4A 5D6FA 1FTZA 2BY3A 4LK0F 3IRRA 2HZTA 3J81Z 2LP0A 4UUTA 3JAMZ 3H3UA 4II2A 3A4CA 4WK8F 3GTLJ 2HPMA 1WFXA 1VFCA 3QPTA 5JLXA 2CW8A 2EWNA 2ACJA 1BL0A 4MIMA 3RYRA 1XSDA 5L3DA 2EV6A 2VQGA 1YHQI 4UB6C 1X58A 3BR6A 3CQZJ 2NVUB 4RBOA 1JHHA 3WTXC 3BJ6A 4XRSG 3K4LA 2MH2A 2ID6A 2DMTA 3OYLA 2WB1N 2QKLB 1Z3YA 4ZYHA 4EM2A 4ABZA 4N4OB 3ZMSA 5KNLA 1X1BA 4HSRA 2DMNA 4E7KA 3DTIA 5CQEA 3RTRA 1LKXA 3PSIA 1XMKA 3HOWJ 1VQMI 1ZELA 4LG0B 5D6EA 4XMYA 3KYDB 2UXXA 2HTSA 5M5XJ 3U9GA 1T2KA 2XPUA 3ABUA 2Y31A 4D9JA 3HOZJ 1T33A 1FYLA 5EDNA 3GBGA 2Y0MA 1U5TB 3A03A 2GXBA 5H2FC 3ZR8X 5F27A 2JN6A 4MGRA 5DV5A 1XCBA 3HZJA 4CYCA 1W5CC 4O6JA 1JGGA 4MQVA 3PUBA 3S32A 4XLPF 2EB7A 2DYRH 1AWCA 1S8NA 2O61A 3BZKA 1EA3A 2XGEA 1EF4A 3NQOA 3WGHA 3MKZA 2W25A 5E20A 2IGMA 4MTEA 2YU9J 2HZDA 3S2DJ 1NTCA 5IP6A 3HOYJ 4NQWB 2LKXA 1VQ9I 2PEXA 3A02A 3K4MA 4HSTA 2KKOA 4QIWN 1YS7A 4U7DA 1GVJA 3OYCA 4G8XA 2XROA 2CUFA 5AIQA 3E6MA 1V5FA 3K10A 1FT9A 1HBXG 1OQYA 3FBIB 3HBLA 1YJNI 4DYRA 2XHKA 5J4VA 1T56A 2K7LA 2R4GA 1CF7B 5CVRA 2VQHA 4BQOA 4FHTA 2VIXA 4XONA 1W4MA 1BN5A 5FKNA 3S2WA 3CF5F 1A04A 1IUFA 3ESWB 1DP3A 3GCMA 3CC7I 3D5SC 2MSYA 5IOZA 2KQRA 5LEKA 1YIOA 1YX3A 3G2BA 3CJNA 3C2BA 2M9HA 3UNGC 2XC7A 4A0YA 5C3EJ 3Q3SA 4FT8A 2ECBA 3PO2J 3HHGA 4C2MJ 3FM5A 3K0LA 3NAUA 3ZQGA 3F8FA 4MFEA 1RR7A 3H35A 5LRSA 3RZDJ 3RPUA 2KIQA 1D1BA 1OKRA 2OA4A 3V7SA 3HDDA 4L0ZB 1QHGA 5DD4A 3V8JA 2BY0A 2WB1A 3FXOA 3Q9SA 5C4XJ 3S3MA 3D1NI 1ZGAA 2Y48A 4XLHA 2FUG2 4BAYA 2MGQA 3E97A 3HOXJ 3A01B 3QOPA 4ZYAA 2COMA 1MBKA 5D8LB 5JFRA 2CUEA 3CDHA 1JGSA 3BC8A 4E7IA 1A5JA 2D1VA 4Q48A 3RYPA 2HGCA 2WV0A 1D1CA 1RZ4A 2R7OA 3QU3A 4DIQA 3BCBA 2Q1ZB 4JQFA 2V26A 3X2QH 4CDGA 3ZOBA 4Y33A 2X0LA 1G6NA 2M8GX 1I50J 2A68F 3KIOA 2DBBA 1ULYA 4BHCA 4KA4A 3K1MA 2DXIA 3IKVA 2VBXA 1GXPA 4IRIA 4IHSA 2CW0F 2O5RA 2M45A 4XKBA 2M30A 3R61A 5E3NA 5CVIA 3PM1A 2K5CA 2ZMEC 5BS6A 1AKHA 1D0ZA 1J09A 2EFWA 2CUZA 3M1CA 2BZTA 1R4NB 4L5EA 2DT5A 2DODA 2QWWA 4PJ0C 4A3FJ 1RNLA 2PFBA 2K9QA 4MFDA 1X2NA 4CZCA 1R4MB 4YFKF 3HOVJ 4CCOA 2DI3A 4LITA 5GTIC 2KDZA 1TWAJ 1ZH5A 1ZLKA 3E6DA 3K4KA 2LR8A 2FBHA 4BJ6C 1JUPA 2A6EF 3F21A 5A2QK 2O3FA 4L0YB 2CU7A 2EZHA 2ZXJA 3DEWA 3TP3A 4MQ9F 3ELKA 5L3GA 5FRNA 2XPVA 3M07A 4I98B 4CCJA 2HQRA 2AQEA 3IAS2 2P5LC 2JA8J 1S3JA 5E17F 1IXRC 1MBGA 1UAAA 4RGRA 1B59A 2PMZN 3V8KA 5D4RA 1UHSA 4BHBA 2M3AA 3ZQ7A 4I09A 4UVBA 1PUEE 2DQRA 3G4SI 4LFUA 2Q8KA 3DU6A 3P5JA 4JP0A 4O5VA 3KP3A 1D5YA 1ZLJA 2MD0A 1PP7U 3WTVC 5IT9Z 2MC4A 2RGVA 4GDFA 3OYKA 3PJRA 4OINF 2LKSA 1Z21A 3W2WA 1LFPA 4XLAA 4GFBA 5FROA 3HGGA 1YJ9I 4G7HF 3DLLF 4B44A 2K3PA 2FRHA 3ZMVA 1BJZA 1RESA 4BBRJ 5GPCA 2J5PA 2V9VA 3HUGA 3HOUJ 3KP2A 3DXJF 2TCTA 4EM0B 1HF0A 2BBYA 3C2GA 3VB2A 1X4OA 1DGRM 2RNGA 4JX4A 3HL2A 1U78A 1E3HA 3DBLB 2OV7A 4HNVA 2H8WA 3PIOF 3IL2A 5KAIC 2X6YA 1OYWA 1IXCA 4K2EA 3RPQA 2HVSA 5L3EA 2X6XA 1ZG5A 2IS4A 3ZQCA 1POGA 2PMUA 3OMYA 3HRSA 3ZN1A 1PUFA 4CSWA 2HDWA 4A3EJ 5GAGJ 1WI9A 1VQKI 2UXNA 3J81K 1KZHA 2KPMA 3JAMK 1UELB 4ITVA 2K86A 2RNJA 2M7AA 5J1UA 2MFZA 4C2UA 1ZKGA 3AL0C 1S7EA 2BVMA 3FK6A 4UUVA 3OYAA 2L7ZA 3E3VA 3Q0WA 4RMNA 4I2OA 3HB9A 2OU2A 2R3SA 1B8IA 3E6CC 3HHHA 2R0QC 4BBSJ 1GLNA 1IDYA 4UUSB 5IPAA 4HX4A 1R23A 3F8CA 2Z9OA 3IP4B 2BXYA 1A6QA 2MYSA 3OR1C 4DBQA 1KONA 4E7SA 3AG4H 4RDUA 1VQOI 2CFOA 1O4XA 1F5TA 1FWZA 6PAXA 4AM3A 4AIKA 5J8FA 2GA1A 2E1MC 3GXOA 2KJCA 3CCJI 1AHDP 1APLC 1IN7A 4BEHA 4S05A 2AS5F 4G7OF 4IOCF 2PLYA 2Y69H 2J5OA 5F0FA 5K7HA 2A07F 3ZMUA 5HS9A 3F22A 5FFXA 1Y1VJ 2ISZA 1E3OC 1Y56A 3MAJA 1P4WA 2BHYA 2Y0SN 4HBLA 4BKXA 2BW3B 2W7NA 4A3IJ 4O3MA 4UY8I 3WU1B 2JRTA 3HPHA 1MDMA 1X2MA 3I59A 1MIJA 1GUUA 1OR7C 4ZZLA 1MKMA 2DJNA 3RZOJ 4ASNA 2JPBA 1ETXA 1FSEA 4LLGF 4BH9A 4MO7A 4BHPA 4HNUA 1SEUA 3C2HA 3I64A 3AG2H 1MH4A 2Z16A 2STWA 2JA6J 4U88A 3CZ6A 4IF4A 2V6CA 3T8RA 2ZJQF 4IRHA 3W6VA 1H9TA 5EEHA 1RIOH 3SEQA 2A6HF 2RV8A 3ECHA 1IRGA 2TRTA 2AHQA 3BOQA 1LE8A 4HA8A 2A6TA 2KRFA 3CCYA 3QAHA 1R71A 2EV5A 1A35A 1R5HA 2E5ZA 3Q0VA 3CJTB 3ML6A 1WHUA 4Y13A 2JA7J 1G3WA 1STZA 3EUKL 3HGYA 1JE8A 2GOMA 4ZDLA 3AKZA 1N78A 3KZZA 1NG7A 4E7LA 3FXJA 2V7FA 4I99C 1HC8A 5ILSA 2A5YB 4PUSA 4J00A 4KNYA 1WVRA 4XKCA 1B1BA 5HLHA 2OZ6A 5IYBJ 4EJTA 2UV1A 2XF7A 1ZK8A 4IRGA 4BXUA 1TWHJ 2LBFA 1XB4A 3EYIA 4EEFG 1UHWA 3MKLA 3EUAA 2HWVA 1MBHA 3HKZN 5K5RA 3HTSB 5DCFA 4ON0A 2H6CA 2OPTA 1WI3A 2CFXA 4LG0A 3LSMA 2FOWA 1KYWA 1BR4A 1I3AA 1YE9A 3CMMA 3BY6A 4DBRA 2HYGD 3HM5A 1BA5A 1RUOA 1DGWY 1JKQC 4D7MA 2L9RA 4QSHA 2WTEA 2EILH 3BR2A 4J01A 2FX0A 2HOAA 5E1ZB 4Y17A 1DUXC 2K3FA 1J0RA 4ENMA 2FBIA 3QODA 4NNJA 2KIUA 1GXQA 2ADUA 3K4JA 4B3XA 3OY9A 3HOSA 1HOMA 2HVRA 3LQQA 1QRYA 3RCOA 2Y9ZA 1ETKA 2R7FA 2QENA 2M7BA 2ZFWA 3KLNA 1I1GA 2CMPA 2LVSA 1XCVA 2TDXA 2DPUA 1OCRH 2KZVA 3LFKA 3RQIA 4YFNF 1U2WA 2QYOA 2PQ8A 2MBFA 4HLYA 3M8JA 1H9GA 2Y0SA 3BR0A 4R1HA 4KIFA 4NQWA 3GX4X 4OU0A 4LOCA 4XK4A 1Y39A 4XRFA 1HW2A 1R22A 2QCOA 2JVGA 1OISA 2GZWA 3V4GA 1Z3XA 4PSWA 3CC4I 2R5YB 1ZRCA 4XN3A 4PZJA 4WXDA 2EFPA 5DYMA 3BTJA 4E6KG 2AXLA 3WTUC 3GFLA 5EG0B 3MWMA 1HSTA 3JRAA 3I4NJ 4CCNA 3TW7A 1GV5A 2F4IA 5B5EC 1CF7A 2ZSIB 4N4NB 1TQPA 5D4SA 3CUQC 1C0WA 2F5FA 4IHVA 3CMAI 2WAQN 3L7WA 3V8LA 2ZJRF 4FISA 1YW9A 3B6AA 1FIAA 2ESNA 3I54A 1GHCA 1P9QC 3GZ5A 5B1AH 1X1AA 3CO6C 2A3SA 2BOLA 1FYMA 2H6BA 2IS1A 1IZ1A 2F5VA 2MC3A 1ZARA 2W00A 2EBIA 1S9HA 3S1MJ 3R0JA 1F43A 4JX6A 3W2AA 2ME6A 1ZHFA 1W0TA 2HOEA 3DP7A 4XM3A 2L7KA 2XUBA 3HSFA 4NDLA 2HPIA 2PX9A 3I3LA 1F1ZA 2OCEA 4F55A 2V1UA 1WJDA 1NK3P 3ERMA 1OCOH 2HNHA 3A01A 3J7AO 4RM2A 3TL4X 5AIPA 2DA7A 3HKZA 1YI2I 2V79A 3HJEA 3GYHX 2DT6A 2A05A 3GFMA 1BC7C 2V9PA 4FE7A 3JRHA 1VQ7I 3K9TA 4G94A 5CVUA 2VQLA 1FEXA 2O8XA 1RKWA 3A0BC 4CO8A 5IT9K 3RKWA 3OYBA 1VQNI 2YS9A 2IJLA 3VYUB 2VXDA 3ZMTA 3V42A 1QZYA 3BTCA 3QP5A 1MNMC 2ELKA 4U0YA 4DZPA 3LSHA 4YIIA 2ZMEB 2JQ7A 4Y52J 1T0FA 1I39A 2FU4A 3ISPA 4FX0A 3SZTA 2VONA 1ZG3A 1LJ9A 4G7ZF 4B4CA 5DEQA 4WXHA 4S0HB 4TV7A 4M6XA 2K4BA 3F6VA 4HF0A 2AQFA 3JRDA 1WWXA 1WPKA 2P81A 5HODA 3L2RA 2Z2SB 4YFXF 3MCZA 1U8RA 2JT1A 1HLVA 1YX5A 3WU0A 5LFAA 1HKSA 3EUHC 1GT0C 3K1PA 1W5SA 5HNHA 3MZ8A 1I5ZA 1USSA 2V9KA 3F8NA 3L2UA 3UKGA 4MEXF 1O3SA 5H6RA 2CJJA 2NVQJ 3KYLA 1R6RA 4N0BA 3ZMDA 4BQQA 3OYGA 1RC9A 2CYYA 1YW7A 1JHFA 2W84A 2MD5A 3F8BA 2VBYA 3KFWX 4ZC3A 4E70A 3LA3A 3RDIA 3K4NA 2KFDA 1IUYA 1BR2A 3Q0UA 3H92A 1QGPA 2K02A 3PNVA 2EIJH 2FMYA 5E18F 4HDUA 3KLOA 2WAQA 3O2PE 1MD0A 1Z9CA 3G71I 4UHTA 4B3AA 3FWEA 2E19A 1SVMA 2CQNA 3IC7A 3MMYB 5J1RA 1GV2A 4LB6B 2M87A 1U9OA 2XGDA 3R60A 4HX7A 4I6ZA 1KU3A 3NWSA 4PJNA 3WG7H 2OF7A 2E7XA 5IP7J 4LLLA 1X1CA 2OCCH 3WHCA 1BI0A 2EJRA 1F4KA 3VWBA 4BQNA 1IN5A 1M1EB 2DAOA 2WADA 2F6CA 1FYKA 3B6CA 1YRNB 3UR3C 1T6SA 2E2HJ 2V6EA 3OYJA 3MEXA 1R00A 1SMYF 5B66C 1V4RA 1ORKA 3ZP5A 1OCZH 4D5CA 3V7RA 2BE5F 1ZRDA 1F9NA 1MBEA 1YYVA 3P9CA 2DFHA 5ICEA 2FBKA 3GVAA 2NS7A 3V7CA 2X85A 2P5KA 4B48A 5LHGA 4UVCA 2DTRA 1VNDA 1IAWA 3CESA 2HFHA 1ENHA 1Y8RB 2DN0A 3DV8A 4N9HA 3TOBA 3FISA 4DJAA 2N8GA 1MJBA 2CV2A 3AL0B 2I10A 4KISA 1KYZA 4ZDPA 1X1DA 2IGNA 2L02A 1FP2A 1FOXA 1J9IA 4ZYDA 2XRLA 1P4AA 3PFYA 3CJQB 2E36A 4YRVA 3BG3A 1R1UA 2DK8A 3TQNA 1TC3C 5IOYA 2XV4S 5EYRA 5F04A 4KIGA 1L0OC 1W7PB 3KZIC 3L00A 4L18B 4LLNA 4UUSA 2IP2A 3JRFA 4RAFA 2KT0A 2P5VA 2BVLA 3M9AA 4WCGA 2E1MB 2DW4A 3I56I 1EJ9A 2DA2A 4Q4ZF 1WJBA 1Y6IA 2FJ1A 4AYBA 3BPXA 3M8FA 1E2XA 2XF6A 4F92B 4ANJA 2HOSA 4DYQA 3J80K 5E1XA 4CXFA 2VXZA 2F5EA 1XMXA 3TMOA 1VTNC 4QPQA 3HRTA 2XPWA 2LY9A 3EDPA 3I4PA 4RLQA 2CQQA 2QSHX 1I6HJ 3FXKA 2KL4A 3QPLA 1P2FA 3TBIA 2QSGX 1LPQA 2RREA 3BR1A 5J47A 3DCFA 4M3GA 1HXDA 4WX9A 2ME0A 3DU5A 1TNSA 2DOEA 1D8KA 2KP6A 3EETA 4M71A 1Z7UA 1IN4A 1TW3A 4IPAA 4LIUA 4E7JA 1JJ6C 1A6IA 2QSFX 4BE2A 2D45A 2EA2A 2ZCWA 2GWRA 1O7LA 3KP5A 2B7EA 1FNNA 2L4MA 3QP6A 3RKQA 1Y1WJ 1J59A 1YO5C 2GA2A 4DW6A 3ULQB 4XNFA 3G1MA 5J6XA 5E3OA 1PDNC 1AOYA 1BIAA 2GIZA 2L7FP 2ESHA 3CF2A 2DFEA 3LSKA 3PFIA 5LD2C 4ZYGA 3OIOA 1A31A 1OLTA 1R7JA 2GAUA 4C3HJ 3IHUA 3S16J 1SANA 4U7BA 3W6JB 1IG7A 4HOBA 1FPQA 5ICFA 3I9V2 3TP0A 1ZR2A 3F3XA 3H5RA 3ONQA 4KICA 2BV6A 1T95A 4IKFA 5CVJA 1LFUP 1XG1A 3RKYA 1SAXA 4WF2A 4YIRX 3TKYA 4JBAA 1QZEA 4YELA 1JKOC 4H4KC 3WHBA 2W82A 4PJJA 1MW7A 1BOAA 1BM9A 3U2RA 4FX4A 4PFOA 1IV8A 5DTDA 2FNAA 2LF8A 3ABMH 3JCUC 3I4MJ 2DA4A 4E4HA 1QPMA 2EIMH 4EVIA 1ETQA 3CCEI 2LMDA 4HZFA 3U1DA 3VYRB 2JA2A 2Z3YA 4EM1A 4F93B 2QQAA 1FLIA 3FMRA 3MFKA 2P8TA 2KRCA 2VJJA 2EPFA 5F0CA 4Y3OA 1DPRA 2YSRA 4XKVA 3ECOA 1EH7A 3IV5A 1QA6A 3D0SA 3S1QJ 2RDPA 2EIKH 1S7OA 3GLLA 5FRMA 3E0JB 3IH2A 1MZBA 4G12A 2QEXI 2F5DA 2LYCA 2QBYB 1P7JA 4GRIA 2FMLA 5LRRA 1LDJA 2R7WA 5J40A 1BJAA 2E71A 2ZNYA 4HEA2 4HQMA 1DU6A 1ON1A 3HOTA 4CGZA 2JK3A 2DMQA 1B9MA 5EEGA 1J2XA 1Z77A 3NWTA 4BQAA 4LD5A 1EV7A 2MW8A 5TRDA 4BDYA 1NH3A 3GTPJ 5JR3A 4CICA 1X4PA 4A3CJ 1FBUA 4RB3C 1OYYA 4LK1F 3F6OA 3RQ4A 1X3UA 4UVAA 2ID3A 2M0MA 2VC1A 2X51A 2KLOA 2M34A 2HVQA 4EV0A 1AU7A 1W7PD 5EG0A 2LH9A 3LNQA 5K7FA 1SD4A 4EATA 2NNYA 3CUQB 1TQIA 2Q2EA 3GO5A 3BTIA 2EH3A 1U8BA 4JK1X 5L3BA 1WGXA 1G8XA 2VC0A 1CGPA 4II3A 1FMWA 1Z0XA 3FMSA 3K7AJ 1IO2A 3PSFA 1I27A 2JSCA 3WG9A 5L3CA 4KT6A 3CCVI 2HYFA 2X9DA 2V1NA 3PQJA 3I58A 1WJ5A 2VT3A 3BZ6A 4Y4RA 1TP4A 1K6OA 2ZSHB 2MABA 3B02A 3FXLA 3SZPA 1FTTA 1TTYA 2L2OA 4PK4A 2KZGA 5CVVA 4AC0A 5J4YA 1JT0A 1YOVB 1W0UA 1T39A 1HA8A 3R6SA 4FTHA 4U87A 3S14J 4RGUA 2L9SA 2F4MB 4D5FA 1FC3A 1IF1A 5F64A 2DA5A 2Z33A 3GFJA 1B9NA 5H6QA 1SVLA 3M1EA 2WAFA 4WXCA 3L2CA 2VB6A 2DQLA 3RI4A 4HF1A 3OYNA 2E60A 3MD2A 2CS3A 2L9NA 4NC6A 1K79A 3T0YA 4RB2C 1G3YA 3HC7A 3BG5A 1MMNA 5K5OA 1G59A 1MSFC 2VKEA 4A3DJ 2GBYA 2OQRA 5BOXA 3DPUA 1Z7LA 1VQLI 5M3MJ 2ISYA 2DMUA 3BR3A 2VASA 2XAJA 4A3MJ 3ZMZA 5C44J 1OCPA 2BGCA 2ZMEA 4M3DA 2HYJA 1D1AA 1GVDA 2R92J 2FSWA 2HQNA 4A69C 3G1LA 3BDDA 3GFIA 3PO3J 5HS7A 4LJZF 2ELHA 1XX5A 3IUOA 2K4JA 2Y30A 4RAGA 2NOJB 4IJAA 1WH7A 5J1YA 5HNFA 1QVTA 3CCSI 2R7SA 2GXAA 4UNOA 4CYCB 3NARA 1TNTA 1OMIA 4ZTFA 3JTHA 1SC7A 1BBYA 2KJBA 5B1BH 2D1HA 2CG4A 1XSVA 1ZG1A 1R36A 2CH0A 2Y75A 3KEYA 4IEJA 4P55A 4E7ZA 1H89C 2EQRA 2LLKA 3FKJA 4XLEA 2ZNZA 2CQKA 5DUIA 2L4AA 3CP8A 3DBHB 3PIPF 4Q5SF 3DTKA 3DBRB 3G1OA 2AXTC 1AA7A 4E7HA 2GLOA 4MNUA 5D5VB 4OIRF 4RLFA 2JPCA 2LREA 2K40A 2XDVA 2R7DA 1WH5A 2HDCA 2Q0OA 4ZH4F 3JTGA 4XLCA 3ASNH 1TWGJ 1XGSA 1QO0D 3LSGA 2WAEA 1FJLA 1ZYRF 3VOEA 4ESFA 5IP9J 2K9MA 4IL6C 3DKWA 3FHNA 3OIQA 2NRAC 2PJRB 1HW5A 3LMMA 3HG9A 1KA8A 5KK1A 1V5GA 3LAJA 2EV0A 3FKIJ 4IHXA 4ENJA 5EZHA 1YRNA 4G6QA 4B8XA 2VL8A 1SVOA 2LTPA 2VPRA 2RQQA 3ZQHA 2FF4A 3BG7A 2KMUA 1UJ8A 4L5JA 2VKHA 1I6XA 2ZKZA 5KAFC 2VJ5A 3LWFA 1XDSA 3H5NA 4F52A 4HF2A 3BQYA 4D0PA 4GYIA 5E8IA 1X3ZB 3HYIA 2X1DA 1K7AA 5HLGA 1QVUA 3CJRB 3DKYA 3QU6A 1BI1A 2ELJA 4MEYF 3ZQLA 3HRMA 3L1PA 2GM4A 2Z5UA 3QYBA 1RETA 2YX4A 3H9JA 3S1RJ 3LSIA 3JRCA 2VODA 3LA7A 4D7NA 4IO9F 3JSPA 1D0YA 3T5XA 3SHFA 2ZFUA 4XOPA 1E3PA 2CWEA 1ETOA 2OZUA 4MTDA 2OQGA 1USTA 1U5TA 1O57A 5FKLA 1K4TA 5D5UB 4QWQA 1BR1A 2KISA 3KZYA 3GTOJ 4P1WA 5GP9A 1FOYA 1K4SA 5LHHA 2QQBA 3K69A 1IGNA 2DLLA 2FQ3A 3KX2A 2KIMA 2LC2A 3G3ZA 1B72B 1ZTRA 1HSJA 3CCMI 1KQ0A 1ZGJA 3H36A 3C7JA 3VSLA 2DOAA 1MNEA 2X4HA 3SYTA 1G3TA 2E34A 2DOFA 2DCEA 4I01A 3CLQA 1ITYA 1YQAA 2QUFA 3TO7A 2H09A 2K9LA 1MJ9A 2RKHA 3K2ZA 1K78B 2KRHA 3WE3A 1T0FC 1S7AA 4NUBA 2XRNA 2XAGA 4GXOA 2VKVA 1U3EM 3S1NJ 2D2WA 4U0VA 1VQ6I 3ZQFA 1WJEA 3F72A 3WTYC 2DO7A 3EYYA 5GPAA 2H1KA 2OC6A 2CRGA 2VLAA 1X1PA 1OR7A 2JWTA 3WGIA 5C4JJ 2WWYA 3IWZA 2OUMA 3K2AA 4HPQA 3NRVA 4S04A 3Q5FA 1H8AC 1HQCA 5LGTA 1JTXA 2PI0A 5BMZA 4B47A 2UWMA 3S3NA 4P96A 4JX5A 3O8GA 5TJJA 3MN2A 3ZQQA 3GTQJ 2G9WA 5H20A 3SZGA 4AVZA 3H9GA 5HDGA 4RAZA 1KQ8A 4RAYA 2BHZA 1BIBA 2OJED 3GLXA 5KVRA 2HKOA 4XBFA 1N77A 2Y9YA 1OCTC 4YEJA 2CW7A 5LBQA 2IA2A 2MG4A 1HDDC 2M1BA 1JT6A 1DU0A 2IS2A 2LF7A 3KPHA 5FLVA 2E7WA 4UXNA 1LDDA 2E1CA 2AO9A 4A6EA 3CCLI 1QU3A 1D0XA 1UHMA 5CLSA 1B4AA 5M3FJ 2Z99A 3U21A 5F6FA 1PJRA 2EK5A 3OYEA 4IHYA 4M3FA 4BXFA 2XAHA 2NS0A 3HUGB 5LHIA 3VODA 1YLFA 4UV9A 2WV1A 4IHTA 3DFGA 2ZJPF 3DEEA 2E1OA 3L09A 2JVHA 1FOWA 5DS9A 3ROUA 1WJAA 3IWFA 2XGCA 3R4KA 4I0AA 1MSEC 4BU2A 3KP7A 5FLXZ 4I76A 2LRDA 2G0EA 4A0ZA 1TWCJ 5FFZA 3WODF 5HS8A 2IA1A 3O3KA 1BI2A 2IGOA 4UV8A 3VPRA 4CCLA 1V3FA 1QQIA 4AIHA 4DQ2A 2E2IJ 2BEOA 1X19A 2QBYA 1WZ2A 3K70D 4V2GA 1WJFA 1LB2A 2A69F 3DWLE 2B9SA 5HDKA 5E8GA 3RPUD 1LFBA 3OL3A 4HDVA 3EQLF 3BTLA 2R7QA 1ON2A 4BJ5C 2JJ7A 4CZZA 2R7UA 3BQZA 4AYBN 3OIPA 2HXOA 3K4CA 4QTRA 3HXLA 5ERIA 2VPLA 4BY1J 4KITB 1R58A 3G6EI 3DEUA 1ONVA 2CO5A 3FXRA 2QF7A 1REPC 3OS1A 2B63J 1MGTA 5JHFA 2D5VA 4BEHB 1FSHA 3HIFA 3ZRGA 2NXNB 4A0XA 3FX3A 4P5OA 1K83J 4BY7J 1VZ0A 1Y0UA 4CUGA 1J5YA 1PVEA 3SDGA 2WY7Q 4FASD 5CYVA 1MMAA 3OWTA 3RIRA 3OYHA 3IRQA 3VYSB 5DCMB 5E3MA 1T08B 3O6BB 4NC7A 3CC2I 4L9VA 3BWGA 1O3TA 2MH9A 4KMFA 3FIWA 4EJOA 4Z6YA 2VKDA 5ILVA 5M5WJ 3A0HC 1BC8C 2QQ8A 1IXSB 4KYWA 2P4WA 1DQUA 5ED4A 2QLZA 1WQ2A 5BPDA 2L7MP 4AU7A 3N4MA 1QBJA 4XLFA 4RM3A 2P6SA 2VE8A 1XN7A 3LSTA 4ZTJA 4IHWA 2O8KA 5FLMJ 5FKOA 3FM3A 2IBDA 3C3WA 2UUZA 2X1CA 3CCQI 4OOIA 3ZN0A 3ZQIA 3AG3H 1LE8B 2A5WA 3OS0A 4EJUA 2PJPA 2L54A 4KIBA 4WWCA 2M2EA 5IYDJ 3H1CA 3K70C 2O9LA 2DFIA 5GTHC 1W5TA 4KN4X 3HPGA 3RSNA 4Y7NJ 1H88C 1DDNA 4OIQF 2H8RA 4DNCA 4XL9A 1TQMA 3SFZA 2IT0A 3BLYA 2O0YA 3HSEA 2M5WA 4CA0A 1YJWI 2ZC2A 1ZN2A 3HTUA 4X6AJ 2LBFB 2IAIA 1WSUA 3OOPA 3VFZA 1IV6A 4BYYA 2QZ8A 3M8EA 3GTKJ 2HXIA 5K5QA 4HAMA 3I5UA 2QA4I 2RQPA 3ASOH 1F36A 3OYFA 3RJPA 1V5EA 3CTAA 3LSJA 3OOUA 4PGGA 5B3SH 5M5YJ 2W1OA 2EZKA 3KP6A 2M4KA 3C18A 4PDKA 2XSDC 2LG4A 3QWLA 4FETA 4D1QA 3FMQA 1XGOA 3QQAA 1FP1D 3B73A 4XQFA 2JTVA 2RC4A 4L9JA 3EUHA 4F91B 2LY1A 4BE0A 5DDGA 1ZR4A 1IC8A 2OTLI 1G3SA 1P92A 3KCCA 4RB1A 2B0LA 2DA1A 1FOKA 5K7ZA 2KHMA 5AONA 1XS9A 2G7UA 2XKOA 2ZB9A 3E1SA 5HLIA 4XLNF 4HV5A 2BW3A 3H5AA 3BG9A 3ZXSA 4AWXB 1JI8A 3I53A 1BW6A 3TOAA 1VF9A 1KQ9A 3GZNB 5FJ8J 1XSXA 4XR6A 3SFIA 2CQ7A 3TO9A 4C3JJ 4IQ4A 3TDUC 1BI3A 3CP2A 1IN8A 3L2QA 2YPRA 1ERDA 9ANTA 4X0GA 4RS8A 5HLTA 1ETYA 3H3ZA 5D5WB 1MNDA 3M4OJ 4FCYA 2QKMB 2F4OB 4R8HA 4F7ZA 4GO1A 3OYDA 3LAPA 2A61A 2PJRA 1LEAA 2RAEA 2P7CB 2K85A 3BZCA 3JRGA 3IH3A 1ETVA 2EZLA 2X6OA 4LGWA 3S93A 4A12A 4XSXF 2JUGA 4XIDA 2LOOA 1P7IA 2DA6A 2YUSA 4R79A 2ZXWH 1KGSA 2IEKA 2CV1A 1XC5A 1J75A 3E7LA 4ENKA 2VBWA 3GWZA 2GIVA 3FF5A 2NAZA 4NC8A 5FD6A 4LIVA 4G9YA 3E5UA 2V4JC 5ILUA 3GTGJ 1J7KA 1QHHD 2L01A 2YR2A 5BNGA 3BJAA 4A5NA 1VQPI 4A3BJ 1LEBA 2CQXA 4RB0A 3BG6A 3R0AA 1LVAA 5KHDA 3H0GJ 1K61A 5F0HA 2XKPA 4IXAA 4L9NA 2IGKA 4KUMA 1RRJA 1X3WB 5FKKA 2XIGA 2HQ5A 2H27A 3CUOA 5GAEJ 3FXUA 2XB0X 1Z6RA 4C3IJ 4ZDOA 4BGDA 5EGOB 1DP7P 2CUJA 2FQ4A 2ICWG 2VOOA 1SMTA 4OMZA 4M9XA 1W36D 4XRMA 4OAZA 1NHAA 4HW0A 2FOKA 5IY5H 5E1WA 3QOEA 1E17A 1B72A 3MQ0A 2FA5A 3KP4A 5J8CA 1TL8A 2XGXA 3NEUA 3IKTA 4OIPF 2Z1DA 3LQRA 4XRSA 2FE3A 2PG4A 4DGWB 1O3QA 1G2HA 2XAQA 1I1SA 1TZLA 2V1XA 1SD7A 2NVYJ 2W48A 2XASA 4H0EA 3GW2A 1K78A 1MJAA 2R5ZB 3ZPLA 3I55I 3BCAA 4G6TB 3QRFF 2I5UA 1YFHA 3A2KA 2F5CA 3LFUA 5JHUA 3L2VA 2WBMA 4AVPA 4XICA 3AG1H 2DDAA 3SEZA 3A1YA 2R5YA 4DZJA 5FLXK 2XB5A 3TW6A 4L5IA 4A3JJ 4ETSA 4B43A 2O03A 4W1UA 3M7GA 1RI7A 4N9IA 4Q47A 1Z67A 3GZ6A 2HTJA 4GGGA 5GADJ 3M3YJ 3JRBA 2JA5J 4KFCA 3DPLC 2OAZA 5L3FA 2EFNA 1OJLA 1WKMA 2L0KA 3G73A 3T1BA 1ODDA 2KIFA 3BPVA 4OWRB 3KE2A 4I7HA 4NBQA 2ECCA 4A2UA 2UZKA 2DTZA 1Y8QB 1LQ1A 3QYFA 3MKWB 5EZGA 4EJVA 4AIJA 2XVCA 3LSRA 2ZXIA 3TO6A 3J7ZI 4LB5A 2Y2ZA 3P7NA 1VQ4I 5D8KB 5DD8A 4IZZA 2XAFA 3CDLA 1XPXA 1R1VA 4QPOA 4CHUA 2LY2A 4XORA 2QQ9A 4CCKA 3F23A 1W36C 3BT9A 1MBFA 1D3YA 4ESJA 3I0TA 2HS5A 3PL8A 4M74A 2R7XA 3COAC 4HQEA 2HKXA 2VBZA 1VI0A 2NNNA 2DDBA 3F8MA 1LVKA 4DYCA 4BNCA 4I02A 1Z6TA 4PCQA 1OPCA 2DYSH 2OBPA 2X1EA 4IOAF 3JSOA 2VJIA 1KU7A 3OYIA 1JTYA 1TT0A 1SFOJ 5ICCA 4EJWA 1GDTA 1FBQA 1CQTA 4F3QA 4M72A 3CCUI 1MMSA 1SD5A 1JUMA 3OS2A 1S6LA 1ZAOA 1XMAA 3VDXA 2R93J 3GUDA 4HLXA 5LEJA 2STTA 2FNPA 5F08A 1MH3A 3S2HJ 5TGTA 4GYGA 4A3KJ 2WY8Q 2ZBKA 1P6RA 1R5GA 1IRXA 2IXSA 3BROA 4ZZDA 2CV0A 4BXXJ 1UMQA 1SFXA 3WTZA 2JMWA 2OTJI 3LL7A 5CPRB 1EH8A 3JR9A 3LSPA 3GTJJ 4IQJA 3WU2C 1T98A 2VOPA 3KETA 2RN7A 1A36A 3ERED 1JKPC 1WRJA 4UB8C 4EGZA 1HKQA 2COBA 1RR8C 3DQVC 4M73A 4C30A 3PQKA 3P9KA 5TISC 1U5TC 4G6DA 1SD6A 3JREA 1K6YA 5FB2A 2DA3A 4KT5C 1HKTA 2NVTJ 3J7YJ 4JYKA 2JUCA 2ZO4A 2M0CA 3HEFA 1KU2A 4RGXA 4A3GJ 3W2VA 2LSOA 2QVOA 1JXSA 4OIOF 4XOTA 4HYEA 4BS9A 5HDNA 3DTEA 2DPDA 1T8IA 2IA0A 3S15J 3OYMA 1BW5A 1D5VA 1O3RA 4KMUX 1YS6A 2OD5A 4XSZF 2PMHA 2H94A 5FO5A 5DCMA 1UCRA 1YTYA 3BR5A 1IW7F 3DLAA 1V54H 5FD5A 4IVNA 3I71A 3PNYA 2HU9A 1P4XA 2PMZA 2BXZA 2F2EA 5IT3A 2R7VA 2WC2A 2YU3A 4LMYA 1OFCX 2EFOA 3GMEA 4U0WA 2IS6A 3H0DA 5KCMA 3RKXA 1QZZA 4A5MA 1L3LA 1FIPA 4AUXA 3CLOA 2EA4A 3QPSA 3D5RC 4JOMA 1RUNA 3J7AY 1IRFA 3KEQA 3PUFA 3N97A 1ZQ3P 3CMYA 4KDPA 5J3LA 4EQQA 3S3OA 2HDDA 4BJTA 1UG0A 2E1NA 2NVXJ 1UFMA 4KN7X 1N25A 1TLHB 3FZVA 3K1NA 1U9NA 3FDYA 5LGNA 1XGNA 1JJ8C 2H1LA 3L9FA 5F1JA 4LG3A 3GF2A 4L9TA 2GOXB 5JI6A 2WA0A 3ABTA 2XF5A 1FMVA 2W24A 4FQGA 1LNWA 2FD5A 4BL0B 4ESBA 1YIJI 1MBJA 3WTWC 3L2WA 5ICGA 1SFEA 1MMDA 3H3VK 2DK5A 3KYCB 2QGUA 5DM6F 2PN6A 4W97A 5CJ9A 2JRMA 2W4SA 1UB9A 4CYDA 4BACA 1Z05A 4HNTA 2VN2A 4HG2A 1R49A 1UZCA 1W7PA 2ZXHA 4BUPA 1S72I 4M3BA 3E5QA 1TT5B 2VT2A 3OV8A 3J80Z 2P7VB 1SFKA 3N05A 4DOZA 2DT7B 3WTSC 3MZHA 1U0JA 3FXQA 1KU9A 4MLOA 2LFBA 3WGGA 3JW4A 2LNBA 3CMEI 1AKHB 2K9NA 1W1WE 1N75A 4XN0A 4I0BA 4KJZA 5JVTA 3OSGA 3CO7C 3P9IA 3ABLH 4OMYA 3CD6I 3TEDA 1JKRC 4B1RA 2E5NA 3JRIA 5DM7F 1NG6A 3SQNA 2HI3A 1Z91A 3TGNA 2JZYA 3VEPA 3ABKH 2C6YA 5JVGF 1S5LC 3IH4A 2JSPA 1FX7A 3MVPA 3FK7A 4AIDA 1YG2A 3F9KA 1UG2A 3QPHA 1G4DA 1T38A 3E6BA 1ZGWA 2IRFG 3Q9VA 4PSXA 5K1YA 1LUJB 1Z1DA 2EZIA 1IN6A 2P6TA 4J19A 4A3LJ 1Q1HA 4ENNA 4V19K 2ETHA 3HSRA 1YW8A 3SDBA 3IAM2 3MKYB 1WCMJ 1IRZA 2VE9A 1FBSA 5IYCJ 5JLWA 1LDKB 3MZYA 4A93J 3QYEA 3DPTA 4P9UA 3GEZA 1BOBA 1TWFJ 2DJIA 2QM3A 2BYVE 2F48A 3FBNB 3GTMJ 1ACIA 3S17J 1B6AA 1SAUA 1PP8F 2Q2EB 1R1TA 3LA2A 5LGUA 1ZRFA 3PNTA 2CGPA 3KEOA 4GCVA 4M3EA 1XDUA 3U1KA 2ZJ2A 3BP8A 1JUSA 2O6GE 2CSOA 4Y15A 2XAUA 2DFFA 4PFPA 2PBIA 1NK2P 2KDOA 2EFQA 2NS8A 3VYTB 3TDZC 5LLQA 2L3DA 3WE2A 1IJWC
chains in the Genus database with same CATH topology
4RGSA 2NYXA 1OYIA 5HOOA 4NB5A 4ZYEA 1H0MA 3E5XA 5F1RA 3FHZA 3BJOA 4HV6A 4QLCU 1DPUA 1SFUA 3W6KB 2MLKA 2GXGA 3C1DA 1TW2A 2LKPA 1EH6A 2M8EA 4P9FA 1D8JA 2IVMA 2MLGA 4Z2YA 5BPIA 2IW5A 2DU9A 1QNTA 5A2QZ 1TBXA 5D5XB 2HR3A 1U6GA 2LDUA 5BQTA 2FEZA 5HVQC 3AAFA 4M9ZA 2K27A 4AD9A 2G7HA 1HW1A 2IPQX 4M9SA 1FY7A 4YG2F 3D5LA 2HEOA 4M6YA 3WTTC 1XD7A 1S29A 4A6DA 3SXYA 5DUKA 2W85A 4PGHA 4YIFA 3HRUA 1XGMA 2V1DA 3CUQA 3REOA 4HX8A 5FGMA 4MHGA 3T8TA 2RVCA 1MDMB 4EMSA 3I59B 2YX7A 1FZPB 4NHJA 4EGYA 2FXAA 3DF8A 2W57A 2MA3A 1ZREA 2GQQA 1O7FA 4B09A 5D6FA 4LK0F 3IRRA 2HZTA 3J81Z 3JAMZ 3H3UA 4WK8F 3QPTA 2EWNA 2ACJA 3RYRA 1XSDA 5L3DA 2EV6A 1JHHA 3WTXC 3BJ6A 2MH2A 4ZYHA 4EM2A 3ZMSA 3RTRA 1XMKA 4LG0B 5D6EA 2UXXA 2HTSA 3U9GA 1T2KA 3ABUA 1FYLA 2Y0MA 1U5TB 2GXBA 4MGRA 5DV5A 1XCBA 4O6JA 4MQVA 4XLPF 2EB7A 1AWCA 1S8NA 2O61A 3NQOA 3WGHA 2W25A 5E20A 4MTEA 2PEXA 2KKOA 1YS7A 4U7DA 1GVJA 4G8XA 2XROA 5AIQA 3E6MA 1FT9A 1HBXG 2XHKA 2K7LA 1CF7B 5CVRA 4FHTA 1W4MA 1BN5A 3S2WA 1A04A 5LEKA 1YIOA 3CJNA 4A0YA 4FT8A 3HHGA 3FM5A 3K0LA 3F8FA 5LRSA 3RPUA 1OKRA 2OA4A 3V7SA 4L0ZB 5DD4A 3V8JA 3Q9SA 1ZGAA 2Y48A 4BAYA 3E97A 3QOPA 2COMA 5D8LB 5JFRA 3CDHA 1JGSA 2D1VA 4Q48A 3RYPA 2HGCA 2WV0A 1RZ4A 3QU3A 4JQFA 4CDGA 2X0LA 1G6NA 2A68F 2DBBA 1ULYA 4BHCA 4KA4A 3K1MA 3IKVA 2VBXA 1GXPA 4IRIA 4IHSA 2CW0F 2M45A 2M30A 3R61A 5CVIA 5BS6A 2EFWA 2DT5A 2QWWA 1RNLA 2PFBA 4YFKF 2DI3A 1ZH5A 1ZLKA 3E6DA 2FBHA 2A6EF 3F21A 5A2QK 2O3FA 4L0YB 2ZXJA 4MQ9F 3ELKA 5L3GA 4I98B 2HQRA 2P5LC 1S3JA 5E17F 1IXRC 4RGRA 1B59A 3V8KA 5D4RA 4BHBA 3ZQ7A 4I09A 4UVBA 1PUEE 2DQRA 4LFUA 2Q8KA 4O5VA 3KP3A 1ZLJA 1PP7U 3WTVC 5IT9Z 2RGVA 4OINF 4G7HF 2FRHA 3ZMVA 2J5PA 2V9VA 3HUGA 3KP2A 3DXJF 4EM0B 2BBYA 3VB2A 1U78A 3IL2A 1OYWA 1IXCA 4K2EA 3RPQA 5L3EA 1ZG5A 2PMUA 3HRSA 3ZN1A 1WI9A 2UXNA 3J81K 3JAMK 2K86A 2RNJA 4UUVA 3E3VA 4I2OA 2OU2A 2R3SA 3E6CC 3HHHA 4HX4A 1R23A 3F8CA 2Z9OA 1F5TA 1FWZA 6PAXA 4AIKA 5J8FA 2GA1A 3GXOA 2KJCA 1IN7A 4S05A 2AS5F 4G7OF 2PLYA 2J5OA 2A07F 3ZMUA 5HS9A 3F22A 5FFXA 2ISZA 3MAJA 1P4WA 4HBLA 4O3MA 3WU1B 2JRTA 1MDMA 3I59A 4ZZLA 1MKMA 4ASNA 2JPBA 1FSEA 4LLGF 4BH9A 4BHPA 3I64A 2STWA 4U88A 4IF4A 2V6CA 3T8RA 4IRHA 1H9TA 5EEHA 1RIOH 2A6HF 2RV8A 3ECHA 1IRGA 3BOQA 4HA8A 2KRFA 3QAHA 2EV5A 1R5HA 3ML6A 4Y13A 1G3WA 1STZA 1JE8A 3KZZA 5ILSA 2A5YB 4KNYA 1B1BA 5HLHA 2OZ6A 4EJTA 4IRGA 4BXUA 1XB4A 3EYIA 1UHWA 2HWVA 5K5RA 3HTSB 5DCFA 4ON0A 2H6CA 2CFXA 4LG0A 1KYWA 3BY6A 2HYGD 1RUOA 2WTEA 5E1ZB 4Y17A 1DUXC 1J0RA 4ENMA 2FBIA 2KIUA 1GXQA 2ADUA 3HOSA 3LQQA 2R7FA 2QENA 2ZFWA 3KLNA 1I1GA 1XCVA 2TDXA 2DPUA 3LFKA 4YFNF 1U2WA 2QYOA 2PQ8A 2MBFA 4HLYA 1H9GA 4R1HA 4KIFA 4NQWA 3GX4X 4OU0A 4XRFA 1HW2A 1R22A 2GZWA 3V4GA 1ZRCA 4PZJA 4WXDA 2EFPA 5DYMA 2AXLA 3WTUC 3GFLA 3MWMA 1HSTA 1CF7A 1TQPA 5D4SA 3CUQC 1C0WA 2F5FA 3L7WA 3V8LA 1YW9A 2ESNA 3I54A 1GHCA 3GZ5A 3CO6C 2A3SA 1FYMA 2H6BA 1IZ1A 2MC3A 1ZARA 3R0JA 1ZHFA 2HOEA 3DP7A 3HSFA 2XUBA 1F1ZA 2V1UA 3J7AO 5AIPA 2V79A 3GYHX 1BC7C 3GFMA 3K9TA 4G94A 5CVUA 2O8XA 4CO8A 5IT9K 3RKWA 2IJLA 3ZMTA 1QZYA 3QP5A 4U0YA 4YIIA 2ZMEB 1T0FA 2FU4A 3ISPA 4FX0A 3SZTA 2VONA 1ZG3A 1LJ9A 4G7ZF 5DEQA 4WXHA 4TV7A 4M6XA 2K4BA 3F6VA 4HF0A 1WWXA 1U8RA 4YFXF 3MCZA 2JT1A 3WU0A 1HKSA 3K1PA 1W5SA 1I5ZA 1USSA 3F8NA 4MEXF 1O3SA 5H6RA 4N0BA 3ZMDA 2CYYA 1YW7A 1JHFA 2W84A 2MD5A 3F8BA 2VBYA 3KFWX 4E70A 3LA3A 3RDIA 1IUYA 3H92A 1QGPA 2K02A 5E18F 2FMYA 4HDUA 3KLOA 3O2PE 1MD0A 1Z9CA 4UHTA 3FWEA 3IC7A 4LB6B 2M87A 3R60A 4HX7A 1KU3A 2E7XA 4LLLA 1BI0A 2EJRA 1F4KA 1IN5A 2DAOA 1FYKA 1T6SA 3MEXA 1R00A 1SMYF 1V4RA 3ZP5A 3V7RA 2BE5F 1ZRDA 1F9NA 1YYVA 3P9CA 5ICEA 2FBKA 3GVAA 3V7CA 2P5KA 5LHGA 4UVCA 2DTRA 1IAWA 2HFHA 3DV8A 4N9HA 3TOBA 1MJBA 1KYZA 2L02A 1FP2A 1J9IA 4ZYDA 1P4AA 1R1UA 2DK8A 3TQNA 2XV4S 4KIGA 1L0OC 1W7PB 4LLNA 3L00A 4L18B 2IP2A 2P5VA 3M9AA 4WCGA 2DW4A 4Q4ZF 3BPXA 3M8FA 1E2XA 3J80K 5E1XA 4CXFA 2VXZA 2F5EA 1VTNC 3HRTA 3EDPA 3I4PA 1P2FA 1HXDA 4WX9A 1TNSA 3EETA 1D8KA 4M71A 1Z7UA 1IN4A 1TW3A 4IPAA 2D45A 2EA2A 2ZCWA 2GWRA 1O7LA 3KP5A 1FNNA 2L4MA 3QP6A 1J59A 1YO5C 2GA2A 3ULQB 5J6XA 1PDNC 1AOYA 1BIAA 2ESHA 3PFIA 4ZYGA 2GAUA 1R7JA 3IHUA 4U7BA 3W6JB 4HOBA 1FPQA 5ICFA 3F3XA 4KICA 2BV6A 5CVJA 3RKYA 1SAXA 4WF2A 3TKYA 4JBAA 1BOAA 1BM9A 3U2RA 4FX4A 2FNAA 2LF8A 1QPMA 4EVIA 3U1DA 4HZFA 4EM1A 2Z3YA 2QQAA 1FLIA 3FMRA 3MFKA 2P8TA 1DPRA 2YSRA 3ECOA 1EH7A 3D0SA 2RDPA 1S7OA 1MZBA 2QBYB 2F5DA 2FMLA 5LRRA 1LDJA 1BJAA 2ZNYA 4HQMA 1ON1A 3HOTA 4CGZA 1B9MA 5EEGA 1J2XA 4BQAA 4LD5A 1EV7A 5TRDA 5JR3A 4CICA 1FBUA 4RB3C 1OYYA 4LK1F 3F6OA 1X3UA 4UVAA 2VC1A 4EV0A 1W7PD 1SD4A 2NNYA 3CUQB 1TQIA 2Q2EA 3GO5A 4JK1X 5L3BA 2VC0A 1CGPA 3FMSA 1I27A 2JSCA 3WG9A 5L3CA 2HYFA 3PQJA 3I58A 2VT3A 3BZ6A 1K6OA 3B02A 3SZPA 1TTYA 5CVVA 1T39A 3R6SA 4RGUA 1FC3A 1IF1A 5F64A 2Z33A 3GFJA 1B9NA 5H6QA 3M1EA 4WXCA 3L2CA 2DQLA 3RI4A 4HF1A 1K79A 3T0YA 4RB2C 1G3YA 5K5OA 2OQRA 5BOXA 2ISYA 2XAJA 3ZMZA 2BGCA 2ZMEA 2FSWA 2HQNA 3BDDA 3GFIA 5HS7A 4LJZF 2ELHA 2K4JA 4IJAA 4UNOA 1TNTA 1OMIA 3JTHA 1BBYA 2KJBA 2D1HA 2CG4A 1XSVA 1ZG1A 1R36A 2Y75A 4P55A 2ZNZA 2CQKA 5DUIA 2L4AA 4Q5SF 4MNUA 5D5VB 4OIRF 2JPCA 2R7DA 2HDCA 2Q0OA 4ZH4F 3JTGA 1XGSA 1QO0D 1ZYRF 3VOEA 4ESFA 3DKWA 2NRAC 1HW5A 1KA8A 5KK1A 3LAJA 2EV0A 4ENJA 4G6QA 4B8XA 2FF4A 4L5JA 1I6XA 2ZKZA 3LWFA 1XDSA 4HF2A 4D0PA 4GYIA 5E8IA 3HYIA 1K7AA 5HLGA 3QU6A 1BI1A 4MEYF 3HRMA 2Z5UA 2YX4A 2VODA 3LA7A 3JSPA 3T5XA 3SHFA 2CWEA 2OZUA 4MTDA 2OQGA 1USTA 1U5TA 1O57A 5D5UB 4QWQA 3KZYA 5LHHA 2QQBA 3K69A 2DLLA 2FQ3A 2KIMA 3G3ZA 1HSJA 1KQ0A 1ZGJA 3C7JA 2X4HA 1G3TA 4I01A 1YQAA 2QUFA 3TO7A 2H09A 1MJ9A 2RKHA 3K2ZA 1K78B 3WE3A 1S7AA 2XRNA 2XAGA 4GXOA 1U3EM 2D2WA 4U0VA 3F72A 3WTYC 2DO7A 3EYYA 1OR7A 3WGIA 2WWYA 3IWZA 3Q5FA 3NRVA 4S04A 1HQCA 5LGTA 2PI0A 5BMZA 2UWMA 4P96A 5TJJA 2G9WA 5H20A 5HDGA 4RAZA 1KQ8A 4RAYA 1BIBA 3GLXA 5KVRA 2HKOA 4XBFA 5LBQA 2IA2A 2M1BA 2LF7A 2E7WA 4UXNA 1LDDA 2E1CA 4A6EA 1UHMA 5CLSA 1B4AA 2Z99A 5F6FA 2EK5A 2XAHA 2NS0A 5LHIA 3VODA 1YLFA 4UV9A 4IHTA 3DFGA 3L09A 3ROUA 3IWFA 4I0AA 3R4KA 3KP7A 5FLXZ 4A0ZA 5FFZA 3WODF 5HS8A 2IA1A 3O3KA 1BI2A 4UV8A 1V3FA 1QQIA 4AIHA 4DQ2A 2BEOA 2QBYA 1LB2A 2A69F 5HDKA 5E8GA 4HDVA 3EQLF 1ON2A 4CZZA 5ERIA 1R58A 3DEUA 1ONVA 2CO5A 3FXRA 1REPC 1MGTA 1FSHA 3HIFA 4A0XA 3FX3A 4P5OA 1Y0UA 1J5YA 5CYVA 3RIRA 3IRQA 5DCMB 3O6BB 4L9VA 3BWGA 1O3TA 2MH9A 4KMFA 4EJOA 5ILVA 1BC8C 1IXSB 4KYWA 2P4WA 5ED4A 2QLZA 1WQ2A 5BPDA 3N4MA 1QBJA 2P6SA 2VE8A 1XN7A 3LSTA 3FM3A 3C3WA 4OOIA 3ZN0A 4EJUA 2PJPA 2L54A 4KIBA 4WWCA 2DFIA 1W5TA 4KN4X 1DDNA 4OIQF 4DNCA 1TQMA 3SFZA 2IT0A 2O0YA 3HSEA 2M5WA 1ZN2A 3HTUA 1WSUA 3OOPA 3VFZA 4BYYA 2QZ8A 3M8EA 5K5QA 4HAMA 3I5UA 2RQPA 3RJPA 3CTAA 4PGGA 4PDKA 3KP6A 3C18A 3FMQA 1XGOA 1FP1D 3B73A 2JTVA 2RC4A 4L9JA 3EUHA 5DDGA 1G3SA 1P92A 3KCCA 4RB1A 2B0LA 1FOKA 5AONA 2G7UA 2XKOA 5HLIA 4XLNF 4HV5A 4AWXB 3I53A 3TOAA 1KQ9A 1XSXA 3TO9A 3TDUC 1BI3A 1IN8A 2YPRA 4RS8A 3H3ZA 5D5WB 4R8HA 4F7ZA 4GO1A 3LAPA 2A61A 1LEAA 2P7CB 4LGWA 4A12A 4XSXF 4R79A 1KGSA 1J75A 4ENKA 2VBWA 3GWZA 2GIVA 3FF5A 2NAZA 5FD6A 4G9YA 3E5UA 5ILUA 1J7KA 2L01A 2YR2A 4A5NA 3BJAA 1LEBA 4RB0A 3R0AA 1LVAA 2XKPA 4IXAA 4L9NA 4KUMA 2XIGA 2H27A 3CUOA 3FXUA 1Z6RA 1DP7P 2VOOA 1SMTA 4OMZA 4M9XA 1NHAA 4HW0A 2FOKA 5E1WA 1E17A 3MQ0A 2FA5A 3KP4A 5J8CA 2XGXA 3NEUA 3IKTA 4OIPF 3LQRA 2FE3A 2PG4A 1O3QA 2XAQA 1I1SA 2V1XA 1SD7A 2XASA 4H0EA 3GW2A 1K78A 1MJAA 3ZPLA 3QRFF 1YFHA 2F5CA 5JHUA 4AVPA 5FLXK 4L5IA 4ETSA 2O03A 3M7GA 1RI7A 4N9IA 4Q47A 3GZ6A 2HTJA 4GGGA 4KFCA 3DPLC 2OAZA 5L3FA 2EFNA 1WKMA 3G73A 3T1BA 1ODDA 2KIFA 3BPVA 3KE2A 4I7HA 4A2UA 2UZKA 1LQ1A 4EJVA 4AIJA 2XVCA 4LB5A 3TO6A 3P7NA 5D8KB 5DD8A 2XAFA 1R1VA 4CHUA 2QQ9A 3F23A 1D3YA 4ESJA 3I0TA 2HS5A 4M74A 3COAC 4HQEA 2HKXA 2VBZA 2NNNA 3F8MA 4BNCA 4I02A 1Z6TA 4PCQA 1OPCA 2OBPA 3JSOA 1KU7A 5ICCA 4EJWA 1FBQA 4M72A 1SD5A 1S6LA 1ZAOA 1XMAA 3GUDA 4HLXA 5LEJA 2STTA 2FNPA 4GYGA 2ZBKA 1P6RA 1R5GA 3BROA 4ZZDA 1SFXA 3WTZA 1EH8A 2VOPA 1T98A 3KETA 2RN7A 3ERED 1WRJA 4EGZA 1HKQA 3DQVC 4M73A 3PQKA 3P9KA 1U5TC 4G6DA 1SD6A 5FB2A 4KT5C 1HKTA 2ZO4A 1KU2A 4RGXA 2LSOA 2QVOA 1JXSA 4OIOF 4HYEA 5HDNA 2DPDA 2IA0A 1D5VA 1O3RA 4KMUX 1YS6A 2OD5A 4XSZF 2PMHA 2H94A 5FO5A 5DCMA 1UCRA 1YTYA 1IW7F 5FD5A 4IVNA 3I71A 1P4XA 2F2EA 5IT3A 2WC2A 2YU3A 4LMYA 2EFOA 4U0WA 3RKXA 1QZZA 4A5MA 1L3LA 3CLOA 2EA4A 1RUNA 1IRFA 3KEQA 3N97A 4KDPA 4EQQA 2E1NA 1UFMA 4KN7X 3FZVA 1TLHB 3K1NA 5LGNA 1XGNA 3L9FA 3GF2A 4L9TA 5JI6A 3ABTA 2W24A 1LNWA 4ESBA 3WTWC 5ICGA 1SFEA 2DK5A 2PN6A 5CJ9A 4CYDA 1UB9A 1Z05A 2VN2A 1W7PA 3E5QA 2VT2A 3OV8A 3J80Z 2P7VB 3WTSC 3MZHA 3FXQA 1KU9A 3WGGA 3JW4A 2LNBA 4I0BA 5JVTA 3CO7C 3P9IA 4OMYA 3SQNA 1Z91A 3TGNA 2JZYA 3VEPA 2C6YA 1FX7A 1YG2A 3QPHA 1G4DA 1T38A 3E6BA 2IRFG 3Q9VA 5K1YA 1Z1DA 1IN6A 2P6TA 1Q1HA 4ENNA 2ETHA 3HSRA 1YW8A 2VE9A 1FBSA 1LDKB 3MZYA 3DPTA 4P9UA 3GEZA 2QM3A 2BYVE 1B6AA 1PP8F 1R1TA 3LA2A 5LGUA 1ZRFA 2CGPA 3KEOA 4GCVA 1XDUA 2ZJ2A 3BP8A 2O6GE 2CSOA 4Y15A 2PBIA 2EFQA 3TDZC 5LLQA 2L3DA 3WE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGS A;  2NYX A;  1OYI A;  5HOO A;  4NB5 A;  4ZYE A;  1H0M A;  3E5X A;  5F1R A;  3FHZ A;  3BJO A;  4HV6 A;  4QLC U;  1DPU A;  1SFU A;  3W6K B;  2MLK A;  2GXG A;  3C1D A;  1TW2 A;  2LKP A;  1EH6 A;  2M8E A;  4P9F A;  1D8J A;  2IVM A;  2MLG A;  4Z2Y A;  5BPI A;  2IW5 A;  2DU9 A;  1QNT A;  5A2Q Z;  1TBX A;  5D5X B;  2HR3 A;  1U6G A;  2LDU A;  5BQT A;  2FEZ A;  5HVQ C;  3AAF A;  4M9Z A;  2K27 A;  4AD9 A;  2G7H A;  1HW1 A;  2IPQ X;  4M9S A;  1FY7 A;  4YG2 F;  3D5L A;  2HEO A;  4M6Y A;  3WTT C;  1XD7 A;  1S29 A;  4A6D A;  3SXY A;  5DUK A;  2W85 A;  4PGH A;  4YIF A;  3HRU A;  1XGM A;  2V1D A;  3CUQ A;  3REO A;  4HX8 A;  5FGM A;  4MHG A;  3T8T A;  2RVC A;  1MDM B;  4EMS A;  3I59 B;  2YX7 A;  1FZP B;  4NHJ A;  4EGY A;  2FXA A;  3DF8 A;  2W57 A;  2MA3 A;  1ZRE A;  2GQQ A;  1O7F A;  4B09 A;  5D6F A;  4LK0 F;  3IRR A;  2HZT A;  3J81 Z;  3JAM Z;  3H3U A;  4WK8 F;  3QPT A;  2EWN A;  2ACJ A;  3RYR A;  1XSD A;  5L3D A;  2EV6 A;  1JHH A;  3WTX C;  3BJ6 A;  2MH2 A;  4ZYH A;  4EM2 A;  3ZMS A;  3RTR A;  1XMK A;  4LG0 B;  5D6E A;  2UXX A;  2HTS A;  3U9G A;  1T2K A;  3ABU A;  1FYL A;  2Y0M A;  1U5T B;  2GXB A;  4MGR A;  5DV5 A;  1XCB A;  4O6J A;  4MQV A;  4XLP F;  2EB7 A;  1AWC A;  1S8N A;  2O61 A;  3NQO A;  3WGH A;  2W25 A;  5E20 A;  4MTE A;  2PEX A;  2KKO A;  1YS7 A;  4U7D A;  1GVJ A;  4G8X A;  2XRO A;  5AIQ A;  3E6M A;  1FT9 A;  1HBX G;  2XHK A;  2K7L A;  1CF7 B;  5CVR A;  4FHT A;  1W4M A;  1BN5 A;  3S2W A;  1A04 A;  5LEK A;  1YIO A;  3CJN A;  4A0Y A;  4FT8 A;  3HHG A;  3FM5 A;  3K0L A;  3F8F A;  5LRS A;  3RPU A;  1OKR A;  2OA4 A;  3V7S A;  4L0Z B;  5DD4 A;  3V8J A;  3Q9S A;  1ZGA A;  2Y48 A;  4BAY A;  3E97 A;  3QOP A;  2COM A;  5D8L B;  5JFR A;  3CDH A;  1JGS A;  2D1V A;  4Q48 A;  3RYP A;  2HGC A;  2WV0 A;  1RZ4 A;  3QU3 A;  4JQF A;  4CDG A;  2X0L A;  1G6N A;  2A68 F;  2DBB A;  1ULY A;  4BHC A;  4KA4 A;  3K1M A;  3IKV A;  2VBX A;  1GXP A;  4IRI A;  4IHS A;  2CW0 F;  2M45 A;  2M30 A;  3R61 A;  5CVI A;  5BS6 A;  2EFW A;  2DT5 A;  2QWW A;  1RNL A;  2PFB A;  4YFK F;  2DI3 A;  1ZH5 A;  1ZLK A;  3E6D A;  2FBH A;  2A6E F;  3F21 A;  5A2Q K;  2O3F A;  4L0Y B;  2ZXJ A;  4MQ9 F;  3ELK A;  5L3G A;  4I98 B;  2HQR A;  2P5L C;  1S3J A;  5E17 F;  1IXR C;  4RGR A;  1B59 A;  3V8K A;  5D4R A;  4BHB A;  3ZQ7 A;  4I09 A;  4UVB A;  1PUE E;  2DQR A;  4LFU A;  2Q8K A;  4O5V A;  3KP3 A;  1ZLJ A;  1PP7 U;  3WTV C;  5IT9 Z;  2RGV A;  4OIN F;  4G7H F;  2FRH A;  3ZMV A;  2J5P A;  2V9V A;  3HUG A;  3KP2 A;  3DXJ F;  4EM0 B;  2BBY A;  3VB2 A;  1U78 A;  3IL2 A;  1OYW A;  1IXC A;  4K2E A;  3RPQ A;  5L3E A;  1ZG5 A;  2PMU A;  3HRS A;  3ZN1 A;  1WI9 A;  2UXN A;  3J81 K;  3JAM K;  2K86 A;  2RNJ A;  4UUV A;  3E3V A;  4I2O A;  2OU2 A;  2R3S A;  3E6C C;  3HHH A;  4HX4 A;  1R23 A;  3F8C A;  2Z9O A;  1F5T A;  1FWZ A;  6PAX A;  4AIK A;  5J8F A;  2GA1 A;  3GXO A;  2KJC A;  1IN7 A;  4S05 A;  2AS5 F;  4G7O F;  2PLY A;  2J5O A;  2A07 F;  3ZMU A;  5HS9 A;  3F22 A;  5FFX A;  2ISZ A;  3MAJ A;  1P4W A;  4HBL A;  4O3M A;  3WU1 B;  2JRT A;  1MDM A;  3I59 A;  4ZZL A;  1MKM A;  4ASN A;  2JPB A;  1FSE A;  4LLG F;  4BH9 A;  4BHP A;  3I64 A;  2STW A;  4U88 A;  4IF4 A;  2V6C A;  3T8R A;  4IRH A;  1H9T A;  5EEH A;  1RIO H;  2A6H F;  2RV8 A;  3ECH A;  1IRG A;  3BOQ A;  4HA8 A;  2KRF A;  3QAH A;  2EV5 A;  1R5H A;  3ML6 A;  4Y13 A;  1G3W A;  1STZ A;  1JE8 A;  3KZZ A;  5ILS A;  2A5Y B;  4KNY A;  1B1B A;  5HLH A;  2OZ6 A;  4EJT A;  4IRG A;  4BXU A;  1XB4 A;  3EYI A;  1UHW A;  2HWV A;  5K5R A;  3HTS B;  5DCF A;  4ON0 A;  2H6C A;  2CFX A;  4LG0 A;  1KYW A;  3BY6 A;  2HYG D;  1RUO A;  2WTE A;  5E1Z B;  4Y17 A;  1DUX C;  1J0R A;  4ENM A;  2FBI A;  2KIU A;  1GXQ A;  2ADU A;  3HOS A;  3LQQ A;  2R7F A;  2QEN A;  2ZFW A;  3KLN A;  1I1G A;  1XCV A;  2TDX A;  2DPU A;  3LFK A;  4YFN F;  1U2W A;  2QYO A;  2PQ8 A;  2MBF A;  4HLY A;  1H9G A;  4R1H A;  4KIF A;  4NQW A;  3GX4 X;  4OU0 A;  4XRF A;  1HW2 A;  1R22 A;  2GZW A;  3V4G A;  1ZRC A;  4PZJ A;  4WXD A;  2EFP A;  5DYM A;  2AXL A;  3WTU C;  3GFL A;  3MWM A;  1HST A;  1CF7 A;  1TQP A;  5D4S A;  3CUQ C;  1C0W A;  2F5F A;  3L7W A;  3V8L A;  1YW9 A;  2ESN A;  3I54 A;  1GHC A;  3GZ5 A;  3CO6 C;  2A3S A;  1FYM A;  2H6B A;  1IZ1 A;  2MC3 A;  1ZAR A;  3R0J A;  1ZHF A;  2HOE A;  3DP7 A;  3HSF A;  2XUB A;  1F1Z A;  2V1U A;  3J7A O;  5AIP A;  2V79 A;  3GYH X;  1BC7 C;  3GFM A;  3K9T A;  4G94 A;  5CVU A;  2O8X A;  4CO8 A;  5IT9 K;  3RKW A;  2IJL A;  3ZMT A;  1QZY A;  3QP5 A;  4U0Y A;  4YII A;  2ZME B;  1T0F A;  2FU4 A;  3ISP A;  4FX0 A;  3SZT A;  2VON A;  1ZG3 A;  1LJ9 A;  4G7Z F;  5DEQ A;  4WXH A;  4TV7 A;  4M6X A;  2K4B A;  3F6V A;  4HF0 A;  1WWX A;  1U8R A;  4YFX F;  3MCZ A;  2JT1 A;  3WU0 A;  1HKS A;  3K1P A;  1W5S A;  1I5Z A;  1USS A;  3F8N A;  4MEX F;  1O3S A;  5H6R A;  4N0B A;  3ZMD A;  2CYY A;  1YW7 A;  1JHF A;  2W84 A;  2MD5 A;  3F8B A;  2VBY A;  3KFW X;  4E70 A;  3LA3 A;  3RDI A;  1IUY A;  3H92 A;  1QGP A;  2K02 A;  5E18 F;  2FMY A;  4HDU A;  3KLO A;  3O2P E;  1MD0 A;  1Z9C A;  4UHT A;  3FWE A;  3IC7 A;  4LB6 B;  2M87 A;  3R60 A;  4HX7 A;  1KU3 A;  2E7X A;  4LLL A;  1BI0 A;  2EJR A;  1F4K A;  1IN5 A;  2DAO A;  1FYK A;  1T6S A;  3MEX A;  1R00 A;  1SMY F;  1V4R A;  3ZP5 A;  3V7R A;  2BE5 F;  1ZRD A;  1F9N A;  1YYV A;  3P9C A;  5ICE A;  2FBK A;  3GVA A;  3V7C A;  2P5K A;  5LHG A;  4UVC A;  2DTR A;  1IAW A;  2HFH A;  3DV8 A;  4N9H A;  3TOB A;  1MJB A;  1KYZ A;  2L02 A;  1FP2 A;  1J9I A;  4ZYD A;  1P4A A;  1R1U A;  2DK8 A;  3TQN A;  2XV4 S;  4KIG A;  1L0O C;  1W7P B;  4LLN A;  3L00 A;  4L18 B;  2IP2 A;  2P5V A;  3M9A A;  4WCG A;  2DW4 A;  4Q4Z F;  3BPX A;  3M8F A;  1E2X A;  3J80 K;  5E1X A;  4CXF A;  2VXZ A;  2F5E A;  1VTN C;  3HRT A;  3EDP A;  3I4P A;  1P2F A;  1HXD A;  4WX9 A;  1TNS A;  3EET A;  1D8K A;  4M71 A;  1Z7U A;  1IN4 A;  1TW3 A;  4IPA A;  2D45 A;  2EA2 A;  2ZCW A;  2GWR A;  1O7L A;  3KP5 A;  1FNN A;  2L4M A;  3QP6 A;  1J59 A;  1YO5 C;  2GA2 A;  3ULQ B;  5J6X A;  1PDN C;  1AOY A;  1BIA A;  2ESH A;  3PFI A;  4ZYG A;  2GAU A;  1R7J A;  3IHU A;  4U7B A;  3W6J B;  4HOB A;  1FPQ A;  5ICF A;  3F3X A;  4KIC A;  2BV6 A;  5CVJ A;  3RKY A;  1SAX A;  4WF2 A;  3TKY A;  4JBA A;  1BOA A;  1BM9 A;  3U2R A;  4FX4 A;  2FNA A;  2LF8 A;  1QPM A;  4EVI A;  3U1D A;  4HZF A;  4EM1 A;  2Z3Y A;  2QQA A;  1FLI A;  3FMR A;  3MFK A;  2P8T A;  1DPR A;  2YSR A;  3ECO A;  1EH7 A;  3D0S A;  2RDP A;  1S7O A;  1MZB A;  2QBY B;  2F5D A;  2FML A;  5LRR A;  1LDJ A;  1BJA A;  2ZNY A;  4HQM A;  1ON1 A;  3HOT A;  4CGZ A;  1B9M A;  5EEG A;  1J2X A;  4BQA A;  4LD5 A;  1EV7 A;  5TRD A;  5JR3 A;  4CIC A;  1FBU A;  4RB3 C;  1OYY A;  4LK1 F;  3F6O A;  1X3U A;  4UVA A;  2VC1 A;  4EV0 A;  1W7P D;  1SD4 A;  2NNY A;  3CUQ B;  1TQI A;  2Q2E A;  3GO5 A;  4JK1 X;  5L3B A;  2VC0 A;  1CGP A;  3FMS A;  1I27 A;  2JSC A;  3WG9 A;  5L3C A;  2HYF A;  3PQJ A;  3I58 A;  2VT3 A;  3BZ6 A;  1K6O A;  3B02 A;  3SZP A;  1TTY A;  5CVV A;  1T39 A;  3R6S A;  4RGU A;  1FC3 A;  1IF1 A;  5F64 A;  2Z33 A;  3GFJ A;  1B9N A;  5H6Q A;  3M1E A;  4WXC A;  3L2C A;  2DQL A;  3RI4 A;  4HF1 A;  1K79 A;  3T0Y A;  4RB2 C;  1G3Y A;  5K5O A;  2OQR A;  5BOX A;  2ISY A;  2XAJ A;  3ZMZ A;  2BGC A;  2ZME A;  2FSW A;  2HQN A;  3BDD A;  3GFI A;  5HS7 A;  4LJZ F;  2ELH A;  2K4J A;  4IJA A;  4UNO A;  1TNT A;  1OMI A;  3JTH A;  1BBY A;  2KJB A;  2D1H A;  2CG4 A;  1XSV A;  1ZG1 A;  1R36 A;  2Y75 A;  4P55 A;  2ZNZ A;  2CQK A;  5DUI A;  2L4A A;  4Q5S F;  4MNU A;  5D5V B;  4OIR F;  2JPC A;  2R7D A;  2HDC A;  2Q0O A;  4ZH4 F;  3JTG A;  1XGS A;  1QO0 D;  1ZYR F;  3VOE A;  4ESF A;  3DKW A;  2NRA C;  1HW5 A;  1KA8 A;  5KK1 A;  3LAJ A;  2EV0 A;  4ENJ A;  4G6Q A;  4B8X A;  2FF4 A;  4L5J A;  1I6X A;  2ZKZ A;  3LWF A;  1XDS A;  4HF2 A;  4D0P A;  4GYI A;  5E8I A;  3HYI A;  1K7A A;  5HLG A;  3QU6 A;  1BI1 A;  4MEY F;  3HRM A;  2Z5U A;  2YX4 A;  2VOD A;  3LA7 A;  3JSP A;  3T5X A;  3SHF A;  2CWE A;  2OZU A;  4MTD A;  2OQG A;  1UST A;  1U5T A;  1O57 A;  5D5U B;  4QWQ A;  3KZY A;  5LHH A;  2QQB A;  3K69 A;  2DLL A;  2FQ3 A;  2KIM A;  3G3Z A;  1HSJ A;  1KQ0 A;  1ZGJ A;  3C7J A;  2X4H A;  1G3T A;  4I01 A;  1YQA A;  2QUF A;  3TO7 A;  2H09 A;  1MJ9 A;  2RKH A;  3K2Z A;  1K78 B;  3WE3 A;  1S7A A;  2XRN A;  2XAG A;  4GXO A;  1U3E M;  2D2W A;  4U0V A;  3F72 A;  3WTY C;  2DO7 A;  3EYY A;  1OR7 A;  3WGI A;  2WWY A;  3IWZ A;  3Q5F A;  3NRV A;  4S04 A;  1HQC A;  5LGT A;  2PI0 A;  5BMZ A;  2UWM A;  4P96 A;  5TJJ A;  2G9W A;  5H20 A;  5HDG A;  4RAZ A;  1KQ8 A;  4RAY A;  1BIB A;  3GLX A;  5KVR A;  2HKO A;  4XBF A;  5LBQ A;  2IA2 A;  2M1B A;  2LF7 A;  2E7W A;  4UXN A;  1LDD A;  2E1C A;  4A6E A;  1UHM A;  5CLS A;  1B4A A;  2Z99 A;  5F6F A;  2EK5 A;  2XAH A;  2NS0 A;  5LHI A;  3VOD A;  1YLF A;  4UV9 A;  4IHT A;  3DFG A;  3L09 A;  3ROU A;  3IWF A;  4I0A A;  3R4K A;  3KP7 A;  5FLX Z;  4A0Z A;  5FFZ A;  3WOD F;  5HS8 A;  2IA1 A;  3O3K A;  1BI2 A;  4UV8 A;  1V3F A;  1QQI A;  4AIH A;  4DQ2 A;  2BEO A;  2QBY A;  1LB2 A;  2A69 F;  5HDK A;  5E8G A;  4HDV A;  3EQL F;  1ON2 A;  4CZZ A;  5ERI A;  1R58 A;  3DEU A;  1ONV A;  2CO5 A;  3FXR A;  1REP C;  1MGT A;  1FSH A;  3HIF A;  4A0X A;  3FX3 A;  4P5O A;  1Y0U A;  1J5Y A;  5CYV A;  3RIR A;  3IRQ A;  5DCM B;  3O6B B;  4L9V A;  3BWG A;  1O3T A;  2MH9 A;  4KMF A;  4EJO A;  5ILV A;  1BC8 C;  1IXS B;  4KYW A;  2P4W A;  5ED4 A;  2QLZ A;  1WQ2 A;  5BPD A;  3N4M A;  1QBJ A;  2P6S A;  2VE8 A;  1XN7 A;  3LST A;  3FM3 A;  3C3W A;  4OOI A;  3ZN0 A;  4EJU A;  2PJP A;  2L54 A;  4KIB A;  4WWC A;  2DFI A;  1W5T A;  4KN4 X;  1DDN A;  4OIQ F;  4DNC A;  1TQM A;  3SFZ A;  2IT0 A;  2O0Y A;  3HSE A;  2M5W A;  1ZN2 A;  3HTU A;  1WSU A;  3OOP A;  3VFZ A;  4BYY A;  2QZ8 A;  3M8E A;  5K5Q A;  4HAM A;  3I5U A;  2RQP A;  3RJP A;  3CTA A;  4PGG A;  4PDK A;  3KP6 A;  3C18 A;  3FMQ A;  1XGO A;  1FP1 D;  3B73 A;  2JTV A;  2RC4 A;  4L9J A;  3EUH A;  5DDG A;  1G3S A;  1P92 A;  3KCC A;  4RB1 A;  2B0L A;  1FOK A;  5AON A;  2G7U A;  2XKO A;  5HLI A;  4XLN F;  4HV5 A;  4AWX B;  3I53 A;  3TOA A;  1KQ9 A;  1XSX A;  3TO9 A;  3TDU C;  1BI3 A;  1IN8 A;  2YPR A;  4RS8 A;  3H3Z A;  5D5W B;  4R8H A;  4F7Z A;  4GO1 A;  3LAP A;  2A61 A;  1LEA A;  2P7C B;  4LGW A;  4A12 A;  4XSX F;  4R79 A;  1KGS A;  1J75 A;  4ENK A;  2VBW A;  3GWZ A;  2GIV A;  3FF5 A;  2NAZ A;  5FD6 A;  4G9Y A;  3E5U A;  5ILU A;  1J7K A;  2L01 A;  2YR2 A;  4A5N A;  3BJA A;  1LEB A;  4RB0 A;  3R0A A;  1LVA A;  2XKP A;  4IXA A;  4L9N A;  4KUM A;  2XIG A;  2H27 A;  3CUO A;  3FXU A;  1Z6R A;  1DP7 P;  2VOO A;  1SMT A;  4OMZ A;  4M9X A;  1NHA A;  4HW0 A;  2FOK A;  5E1W A;  1E17 A;  3MQ0 A;  2FA5 A;  3KP4 A;  5J8C A;  2XGX A;  3NEU A;  3IKT A;  4OIP F;  3LQR A;  2FE3 A;  2PG4 A;  1O3Q A;  2XAQ A;  1I1S A;  2V1X A;  1SD7 A;  2XAS A;  4H0E A;  3GW2 A;  1K78 A;  1MJA A;  3ZPL A;  3QRF F;  1YFH A;  2F5C A;  5JHU A;  4AVP A;  5FLX K;  4L5I A;  4ETS A;  2O03 A;  3M7G A;  1RI7 A;  4N9I A;  4Q47 A;  3GZ6 A;  2HTJ A;  4GGG A;  4KFC A;  3DPL C;  2OAZ A;  5L3F A;  2EFN A;  1WKM A;  3G73 A;  3T1B A;  1ODD A;  2KIF A;  3BPV A;  3KE2 A;  4I7H A;  4A2U A;  2UZK A;  1LQ1 A;  4EJV A;  4AIJ A;  2XVC A;  4LB5 A;  3TO6 A;  3P7N A;  5D8K B;  5DD8 A;  2XAF A;  1R1V A;  4CHU A;  2QQ9 A;  3F23 A;  1D3Y A;  4ESJ A;  3I0T A;  2HS5 A;  4M74 A;  3COA C;  4HQE A;  2HKX A;  2VBZ A;  2NNN A;  3F8M A;  4BNC A;  4I02 A;  1Z6T A;  4PCQ A;  1OPC A;  2OBP A;  3JSO A;  1KU7 A;  5ICC A;  4EJW A;  1FBQ A;  4M72 A;  1SD5 A;  1S6L A;  1ZAO A;  1XMA A;  3GUD A;  4HLX A;  5LEJ A;  2STT A;  2FNP A;  4GYG A;  2ZBK A;  1P6R A;  1R5G A;  3BRO A;  4ZZD A;  1SFX A;  3WTZ A;  1EH8 A;  2VOP A;  1T98 A;  3KET A;  2RN7 A;  3ERE D;  1WRJ A;  4EGZ A;  1HKQ A;  3DQV C;  4M73 A;  3PQK A;  3P9K A;  1U5T C;  4G6D A;  1SD6 A;  5FB2 A;  4KT5 C;  1HKT A;  2ZO4 A;  1KU2 A;  4RGX A;  2LSO A;  2QVO A;  1JXS A;  4OIO F;  4HYE A;  5HDN A;  2DPD A;  2IA0 A;  1D5V A;  1O3R A;  4KMU X;  1YS6 A;  2OD5 A;  4XSZ F;  2PMH A;  2H94 A;  5FO5 A;  5DCM A;  1UCR A;  1YTY A;  1IW7 F;  5FD5 A;  4IVN A;  3I71 A;  1P4X A;  2F2E A;  5IT3 A;  2WC2 A;  2YU3 A;  4LMY A;  2EFO A;  4U0W A;  3RKX A;  1QZZ A;  4A5M A;  1L3L A;  3CLO A;  2EA4 A;  1RUN A;  1IRF A;  3KEQ A;  3N97 A;  4KDP A;  4EQQ A;  2E1N A;  1UFM A;  4KN7 X;  3FZV A;  1TLH B;  3K1N A;  5LGN A;  1XGN A;  3L9F A;  3GF2 A;  4L9T A;  5JI6 A;  3ABT A;  2W24 A;  1LNW A;  4ESB A;  3WTW C;  5ICG A;  1SFE A;  2DK5 A;  2PN6 A;  5CJ9 A;  4CYD A;  1UB9 A;  1Z05 A;  2VN2 A;  1W7P A;  3E5Q A;  2VT2 A;  3OV8 A;  3J80 Z;  2P7V B;  3WTS C;  3MZH A;  3FXQ A;  1KU9 A;  3WGG A;  3JW4 A;  2LNB A;  4I0B A;  5JVT A;  3CO7 C;  3P9I A;  4OMY A;  3SQN A;  1Z91 A;  3TGN A;  2JZY A;  3VEP A;  2C6Y A;  1FX7 A;  1YG2 A;  3QPH A;  1G4D A;  1T38 A;  3E6B A;  2IRF G;  3Q9V A;  5K1Y A;  1Z1D A;  1IN6 A;  2P6T A;  1Q1H A;  4ENN A;  2ETH A;  3HSR A;  1YW8 A;  2VE9 A;  1FBS A;  1LDK B;  3MZY A;  3DPT A;  4P9U A;  3GEZ A;  2QM3 A;  2BYV E;  1B6A A;  1PP8 F;  1R1T A;  3LA2 A;  5LGU A;  1ZRF A;  2CGP A;  3KEO A;  4GCV A;  1XDU A;  2ZJ2 A;  3BP8 A;  2O6G E;  2CSO A;  4Y15 A;  2PBI A;  2EFQ A;  3TDZ C;  5LLQ A;  2L3D A;  3WE2 A; 
#chains in the Genus database with same CATH topology
 2BY2 A;  2O7O A;  4RGS A;  2NYX A;  1E0E A;  1OYI A;  1MMG A;  3ZCO A;  2LD5 A;  4CCM A;  5FKM A;  4ZJZ A;  5HOO A;  2EIN H;  4NB5 A;  4ZYE A;  1H0M A;  3E5X A;  5GAH J;  5F1R A;  3FHZ A;  2R7R A;  3F0C A;  3BJO A;  4HV6 A;  4PJL A;  2L5Q A;  4QLC U;  1DPU A;  1SFU A;  3W6K B;  2MLK A;  2GXG A;  1YIT I;  4XKW A;  3C1D A;  2DMP A;  1TW2 A;  2LKP A;  1HDP A;  1EH6 A;  2M8E A;  1R9T J;  4P9F A;  1D8J A;  2VQC A;  2IVM A;  4IX7 A;  4X1E A;  5E3L A;  1XTA A;  1Q1V A;  3K4B A;  1R5I D;  2MLG A;  5EGO A;  3SJM A;  4Z2Y A;  5BPI A;  3FXM A;  3OR2 C;  1RPW A;  1PUF B;  2IW5 A;  2K9S A;  2X48 A;  1WJC A;  2DU9 A;  1Y0N A;  1PYV A;  1QNT A;  5CQG A;  5A2Q Z;  1TBX A;  5D5X B;  2HR3 A;  1U6G A;  2LDU A;  5BQT A;  4BE1 A;  2FEZ A;  5HVQ C;  3AAF A;  3CDI A;  4M9Z A;  3DKX A;  1V55 H;  4BDZ A;  2K27 A;  4AD9 A;  2X6W A;  2P0W A;  2XSJ C;  2HOT A;  1VQ5 I;  2G7H A;  1HW1 A;  2IPQ X;  1B8I B;  2R7Z J;  4M9S A;  1FY7 A;  3S8P A;  4V2F A;  4YG2 F;  3W3C A;  3D5L A;  2VI6 A;  2HEO A;  2R5Z A;  4M6Y A;  5EF6 A;  4FE4 A;  3WTT C;  1XD7 A;  1S29 A;  2HQA A;  4A6D A;  2R7T A;  5E79 C;  3VSK A;  3ZGK A;  1RKT A;  1IDZ A;  3SXY A;  1VQ8 I;  5DUK A;  3O8H A;  2L9V A;  5EJC A;  2W85 A;  4PGH A;  4YIF A;  3HRU A;  4PJM A;  1XGM A;  2E2J J;  2V1D A;  5CKT A;  2VJ4 A;  4C2T A;  2M4G A;  3CUQ A;  3H9Q A;  1OCC H;  4RA2 A;  3REO A;  4HX8 A;  4M6V A;  4OAY A;  5FGM A;  4MHG A;  3K6G A;  3OSF A;  3T8T A;  1HCR A;  4C9Y A;  2NOG A;  2RVC A;  1MDM B;  1I3Q J;  4EMS A;  3I59 B;  1ETW A;  2YX7 A;  2LK2 A;  1FZP B;  4HRI A;  4NHJ A;  4EGY A;  2FXA A;  3DF8 A;  2W57 A;  4CH7 A;  2MA3 A;  3CCR I;  2BY1 A;  1EKE A;  1ZRE A;  3EPZ A;  2GQQ A;  1O7F A;  3AFH A;  1QPI A;  2VUM J;  2E35 A;  2I8D A;  4B09 A;  3LOC A;  5EEA A;  3OL4 A;  5D6F A;  1FTZ A;  2BY3 A;  4LK0 F;  3IRR A;  2HZT A;  3J81 Z;  2LP0 A;  4UUT A;  3JAM Z;  3H3U A;  4II2 A;  3A4C A;  4WK8 F;  3GTL J;  2HPM A;  1WFX A;  1VFC A;  3QPT A;  5JLX A;  2CW8 A;  2EWN A;  2ACJ A;  1BL0 A;  4MIM A;  3RYR A;  1XSD A;  5L3D A;  2EV6 A;  2VQG A;  1YHQ I;  4UB6 C;  1X58 A;  3BR6 A;  3CQZ J;  2NVU B;  4RBO A;  1JHH A;  3WTX C;  3BJ6 A;  4XRS G;  3K4L A;  2MH2 A;  2ID6 A;  2DMT A;  3OYL A;  2WB1 N;  2QKL B;  1Z3Y A;  4ZYH A;  4EM2 A;  4ABZ A;  4N4O B;  3ZMS A;  5KNL A;  1X1B A;  4HSR A;  2DMN A;  4E7K A;  3DTI A;  5CQE A;  3RTR A;  1LKX A;  3PSI A;  1XMK A;  3HOW J;  1VQM I;  1ZEL A;  4LG0 B;  5D6E A;  4XMY A;  3KYD B;  2UXX A;  2HTS A;  5M5X J;  3U9G A;  1T2K A;  2XPU A;  3ABU A;  2Y31 A;  4D9J A;  3HOZ J;  1T33 A;  1FYL A;  5EDN A;  3GBG A;  2Y0M A;  1U5T B;  3A03 A;  2GXB A;  5H2F C;  3ZR8 X;  5F27 A;  2JN6 A;  4MGR A;  5DV5 A;  1XCB A;  3HZJ A;  4CYC A;  1W5C C;  4O6J A;  1JGG A;  4MQV A;  3PUB A;  3S32 A;  4XLP F;  2EB7 A;  2DYR H;  1AWC A;  1S8N A;  2O61 A;  3BZK A;  1EA3 A;  2XGE A;  1EF4 A;  3NQO A;  3WGH A;  3MKZ A;  2W25 A;  5E20 A;  2IGM A;  4MTE A;  2YU9 J;  2HZD A;  3S2D J;  1NTC A;  5IP6 A;  3HOY J;  4NQW B;  2LKX A;  1VQ9 I;  2PEX A;  3A02 A;  3K4M A;  4HST A;  2KKO A;  4QIW N;  1YS7 A;  4U7D A;  1GVJ A;  3OYC A;  4G8X A;  2XRO A;  2CUF A;  5AIQ A;  3E6M A;  1V5F A;  3K10 A;  1FT9 A;  1HBX G;  1OQY A;  3FBI B;  3HBL A;  1YJN I;  4DYR A;  2XHK A;  5J4V A;  1T56 A;  2K7L A;  2R4G A;  1CF7 B;  5CVR A;  2VQH A;  4BQO A;  4FHT A;  2VIX A;  4XON A;  1W4M A;  1BN5 A;  5FKN A;  3S2W A;  3CF5 F;  1A04 A;  1IUF A;  3ESW B;  1DP3 A;  3GCM A;  3CC7 I;  3D5S C;  2MSY A;  5IOZ A;  2KQR A;  5LEK A;  1YIO A;  1YX3 A;  3G2B A;  3CJN A;  3C2B A;  2M9H A;  3UNG C;  2XC7 A;  4A0Y A;  5C3E J;  3Q3S A;  4FT8 A;  2ECB A;  3PO2 J;  3HHG A;  4C2M J;  3FM5 A;  3K0L A;  3NAU A;  3ZQG A;  3F8F A;  4MFE A;  1RR7 A;  3H35 A;  5LRS A;  3RZD J;  3RPU A;  2KIQ A;  1D1B A;  1OKR A;  2OA4 A;  3V7S A;  3HDD A;  4L0Z B;  1QHG A;  5DD4 A;  3V8J A;  2BY0 A;  2WB1 A;  3FXO A;  3Q9S A;  5C4X J;  3S3M A;  3D1N I;  1ZGA A;  2Y48 A;  4XLH A;  2FUG 2;  4BAY A;  2MGQ A;  3E97 A;  3HOX J;  3A01 B;  3QOP A;  4ZYA A;  2COM A;  1MBK A;  5D8L B;  5JFR A;  2CUE A;  3CDH A;  1JGS A;  3BC8 A;  4E7I A;  1A5J A;  2D1V A;  4Q48 A;  3RYP A;  2HGC A;  2WV0 A;  1D1C A;  1RZ4 A;  2R7O A;  3QU3 A;  4DIQ A;  3BCB A;  2Q1Z B;  4JQF A;  2V26 A;  3X2Q H;  4CDG A;  3ZOB A;  4Y33 A;  2X0L A;  1G6N A;  2M8G X;  1I50 J;  2A68 F;  3KIO A;  2DBB A;  1ULY A;  4BHC A;  4KA4 A;  3K1M A;  2DXI A;  3IKV A;  2VBX A;  1GXP A;  4IRI A;  4IHS A;  2CW0 F;  2O5R A;  2M45 A;  4XKB A;  2M30 A;  3R61 A;  5E3N A;  5CVI A;  3PM1 A;  2K5C A;  2ZME C;  5BS6 A;  1AKH A;  1D0Z A;  1J09 A;  2EFW A;  2CUZ A;  3M1C A;  2BZT A;  1R4N B;  4L5E A;  2DT5 A;  2DOD A;  2QWW A;  4PJ0 C;  4A3F J;  1RNL A;  2PFB A;  2K9Q A;  4MFD A;  1X2N A;  4CZC A;  1R4M B;  4YFK F;  3HOV J;  4CCO A;  2DI3 A;  4LIT A;  5GTI C;  2KDZ A;  1TWA J;  1ZH5 A;  1ZLK A;  3E6D A;  3K4K A;  2LR8 A;  2FBH A;  4BJ6 C;  1JUP A;  2A6E F;  3F21 A;  5A2Q K;  2O3F A;  4L0Y B;  2CU7 A;  2EZH A;  2ZXJ A;  3DEW A;  3TP3 A;  4MQ9 F;  3ELK A;  5L3G A;  5FRN A;  2XPV A;  3M07 A;  4I98 B;  4CCJ A;  2HQR A;  2AQE A;  3IAS 2;  2P5L C;  2JA8 J;  1S3J A;  5E17 F;  1IXR C;  1MBG A;  1UAA A;  4RGR A;  1B59 A;  2PMZ N;  3V8K A;  5D4R A;  1UHS A;  4BHB A;  2M3A A;  3ZQ7 A;  4I09 A;  4UVB A;  1PUE E;  2DQR A;  3G4S I;  4LFU A;  2Q8K A;  3DU6 A;  3P5J A;  4JP0 A;  4O5V A;  3KP3 A;  1D5Y A;  1ZLJ A;  2MD0 A;  1PP7 U;  3WTV C;  5IT9 Z;  2MC4 A;  2RGV A;  4GDF A;  3OYK A;  3PJR A;  4OIN F;  2LKS A;  1Z21 A;  3W2W A;  1LFP A;  4XLA A;  4GFB A;  5FRO A;  3HGG A;  1YJ9 I;  4G7H F;  3DLL F;  4B44 A;  2K3P A;  2FRH A;  3ZMV A;  1BJZ A;  1RES A;  4BBR J;  5GPC A;  2J5P A;  2V9V A;  3HUG A;  3HOU J;  3KP2 A;  3DXJ F;  2TCT A;  4EM0 B;  1HF0 A;  2BBY A;  3C2G A;  3VB2 A;  1X4O A;  1DGR M;  2RNG A;  4JX4 A;  3HL2 A;  1U78 A;  1E3H A;  3DBL B;  2OV7 A;  4HNV A;  2H8W A;  3PIO F;  3IL2 A;  5KAI C;  2X6Y A;  1OYW A;  1IXC A;  4K2E A;  3RPQ A;  2HVS A;  5L3E A;  2X6X A;  1ZG5 A;  2IS4 A;  3ZQC A;  1POG A;  2PMU A;  3OMY A;  3HRS A;  3ZN1 A;  1PUF A;  4CSW A;  2HDW A;  4A3E J;  5GAG J;  1WI9 A;  1VQK I;  2UXN A;  3J81 K;  1KZH A;  2KPM A;  3JAM K;  1UEL B;  4ITV A;  2K86 A;  2RNJ A;  2M7A A;  5J1U A;  2MFZ A;  4C2U A;  1ZKG A;  3AL0 C;  1S7E A;  2BVM A;  3FK6 A;  4UUV A;  3OYA A;  2L7Z A;  3E3V A;  3Q0W A;  4RMN A;  4I2O A;  3HB9 A;  2OU2 A;  2R3S A;  1B8I A;  3E6C C;  3HHH A;  2R0Q C;  4BBS J;  1GLN A;  1IDY A;  4UUS B;  5IPA A;  4HX4 A;  1R23 A;  3F8C A;  2Z9O A;  3IP4 B;  2BXY A;  1A6Q A;  2MYS A;  3OR1 C;  4DBQ A;  1KON A;  4E7S A;  3AG4 H;  4RDU A;  1VQO I;  2CFO A;  1O4X A;  1F5T A;  1FWZ A;  6PAX A;  4AM3 A;  4AIK A;  5J8F A;  2GA1 A;  2E1M C;  3GXO A;  2KJC A;  3CCJ I;  1AHD P;  1APL C;  1IN7 A;  4BEH A;  4S05 A;  2AS5 F;  4G7O F;  4IOC F;  2PLY A;  2Y69 H;  2J5O A;  5F0F A;  5K7H A;  2A07 F;  3ZMU A;  5HS9 A;  3F22 A;  5FFX A;  1Y1V J;  2ISZ A;  1E3O C;  1Y56 A;  3MAJ A;  1P4W A;  2BHY A;  2Y0S N;  4HBL A;  4BKX A;  2BW3 B;  2W7N A;  4A3I J;  4O3M A;  4UY8 I;  3WU1 B;  2JRT A;  3HPH A;  1MDM A;  1X2M A;  3I59 A;  1MIJ A;  1GUU A;  1OR7 C;  4ZZL A;  1MKM A;  2DJN A;  3RZO J;  4ASN A;  2JPB A;  1ETX A;  1FSE A;  4LLG F;  4BH9 A;  4MO7 A;  4BHP A;  4HNU A;  1SEU A;  3C2H A;  3I64 A;  3AG2 H;  1MH4 A;  2Z16 A;  2STW A;  2JA6 J;  4U88 A;  3CZ6 A;  4IF4 A;  2V6C A;  3T8R A;  2ZJQ F;  4IRH A;  3W6V A;  1H9T A;  5EEH A;  1RIO H;  3SEQ A;  2A6H F;  2RV8 A;  3ECH A;  1IRG A;  2TRT A;  2AHQ A;  3BOQ A;  1LE8 A;  4HA8 A;  2A6T A;  2KRF A;  3CCY A;  3QAH A;  1R71 A;  2EV5 A;  1A35 A;  1R5H A;  2E5Z A;  3Q0V A;  3CJT B;  3ML6 A;  1WHU A;  4Y13 A;  2JA7 J;  1G3W A;  1STZ A;  3EUK L;  3HGY A;  1JE8 A;  2GOM A;  4ZDL A;  3AKZ A;  1N78 A;  3KZZ A;  1NG7 A;  4E7L A;  3FXJ A;  2V7F A;  4I99 C;  1HC8 A;  5ILS A;  2A5Y B;  4PUS A;  4J00 A;  4KNY A;  1WVR A;  4XKC A;  1B1B A;  5HLH A;  2OZ6 A;  5IYB J;  4EJT A;  2UV1 A;  2XF7 A;  1ZK8 A;  4IRG A;  4BXU A;  1TWH J;  2LBF A;  1XB4 A;  3EYI A;  4EEF G;  1UHW A;  3MKL A;  3EUA A;  2HWV A;  1MBH A;  3HKZ N;  5K5R A;  3HTS B;  5DCF A;  4ON0 A;  2H6C A;  2OPT A;  1WI3 A;  2CFX A;  4LG0 A;  3LSM A;  2FOW A;  1KYW A;  1BR4 A;  1I3A A;  1YE9 A;  3CMM A;  3BY6 A;  4DBR A;  2HYG D;  3HM5 A;  1BA5 A;  1RUO A;  1DGW Y;  1JKQ C;  4D7M A;  2L9R A;  4QSH A;  2WTE A;  2EIL H;  3BR2 A;  4J01 A;  2FX0 A;  2HOA A;  5E1Z B;  4Y17 A;  1DUX C;  2K3F A;  1J0R A;  4ENM A;  2FBI A;  3QOD A;  4NNJ A;  2KIU A;  1GXQ A;  2ADU A;  3K4J A;  4B3X A;  3OY9 A;  3HOS A;  1HOM A;  2HVR A;  3LQQ A;  1QRY A;  3RCO A;  2Y9Z A;  1ETK A;  2R7F A;  2QEN A;  2M7B A;  2ZFW A;  3KLN A;  1I1G A;  2CMP A;  2LVS A;  1XCV A;  2TDX A;  2DPU A;  1OCR H;  2KZV A;  3LFK A;  3RQI A;  4YFN F;  1U2W A;  2QYO A;  2PQ8 A;  2MBF A;  4HLY A;  3M8J A;  1H9G A;  2Y0S A;  3BR0 A;  4R1H A;  4KIF A;  4NQW A;  3GX4 X;  4OU0 A;  4LOC A;  4XK4 A;  1Y39 A;  4XRF A;  1HW2 A;  1R22 A;  2QCO A;  2JVG A;  1OIS A;  2GZW A;  3V4G A;  1Z3X A;  4PSW A;  3CC4 I;  2R5Y B;  1ZRC A;  4XN3 A;  4PZJ A;  4WXD A;  2EFP A;  5DYM A;  3BTJ A;  4E6K G;  2AXL A;  3WTU C;  3GFL A;  5EG0 B;  3MWM A;  1HST A;  3JRA A;  3I4N J;  4CCN A;  3TW7 A;  1GV5 A;  2F4I A;  5B5E C;  1CF7 A;  2ZSI B;  4N4N B;  1TQP A;  5D4S A;  3CUQ C;  1C0W A;  2F5F A;  4IHV A;  3CMA I;  2WAQ N;  3L7W A;  3V8L A;  2ZJR F;  4FIS A;  1YW9 A;  3B6A A;  1FIA A;  2ESN A;  3I54 A;  1GHC A;  1P9Q C;  3GZ5 A;  5B1A H;  1X1A A;  3CO6 C;  2A3S A;  2BOL A;  1FYM A;  2H6B A;  2IS1 A;  1IZ1 A;  2F5V A;  2MC3 A;  1ZAR A;  2W00 A;  2EBI A;  1S9H A;  3S1M J;  3R0J A;  1F43 A;  4JX6 A;  3W2A A;  2ME6 A;  1ZHF A;  1W0T A;  2HOE A;  3DP7 A;  4XM3 A;  2L7K A;  2XUB A;  3HSF A;  4NDL A;  2HPI A;  2PX9 A;  3I3L A;  1F1Z A;  2OCE A;  4F55 A;  2V1U A;  1WJD A;  1NK3 P;  3ERM A;  1OCO H;  2HNH A;  3A01 A;  3J7A O;  4RM2 A;  3TL4 X;  5AIP A;  2DA7 A;  3HKZ A;  1YI2 I;  2V79 A;  3HJE A;  3GYH X;  2DT6 A;  2A05 A;  3GFM A;  1BC7 C;  2V9P A;  4FE7 A;  3JRH A;  1VQ7 I;  3K9T A;  4G94 A;  5CVU A;  2VQL A;  1FEX A;  2O8X A;  1RKW A;  3A0B C;  4CO8 A;  5IT9 K;  3RKW A;  3OYB A;  1VQN I;  2YS9 A;  2IJL A;  3VYU B;  2VXD A;  3ZMT A;  3V42 A;  1QZY A;  3BTC A;  3QP5 A;  1MNM C;  2ELK A;  4U0Y A;  4DZP A;  3LSH A;  4YII A;  2ZME B;  2JQ7 A;  4Y52 J;  1T0F A;  1I39 A;  2FU4 A;  3ISP A;  4FX0 A;  3SZT A;  2VON A;  1ZG3 A;  1LJ9 A;  4G7Z F;  4B4C A;  5DEQ A;  4WXH A;  4S0H B;  4TV7 A;  4M6X A;  2K4B A;  3F6V A;  4HF0 A;  2AQF A;  3JRD A;  1WWX A;  1WPK A;  2P81 A;  5HOD A;  3L2R A;  2Z2S B;  4YFX F;  3MCZ A;  1U8R A;  2JT1 A;  1HLV A;  1YX5 A;  3WU0 A;  5LFA A;  1HKS A;  3EUH C;  1GT0 C;  3K1P A;  1W5S A;  5HNH A;  3MZ8 A;  1I5Z A;  1USS A;  2V9K A;  3F8N A;  3L2U A;  3UKG A;  4MEX F;  1O3S A;  5H6R A;  2CJJ A;  2NVQ J;  3KYL A;  1R6R A;  4N0B A;  3ZMD A;  4BQQ A;  3OYG A;  1RC9 A;  2CYY A;  1YW7 A;  1JHF A;  2W84 A;  2MD5 A;  3F8B A;  2VBY A;  3KFW X;  4ZC3 A;  4E70 A;  3LA3 A;  3RDI A;  3K4N A;  2KFD A;  1IUY A;  1BR2 A;  3Q0U A;  3H92 A;  1QGP A;  2K02 A;  3PNV A;  2EIJ H;  2FMY A;  5E18 F;  4HDU A;  3KLO A;  2WAQ A;  3O2P E;  1MD0 A;  1Z9C A;  3G71 I;  4UHT A;  4B3A A;  3FWE A;  2E19 A;  1SVM A;  2CQN A;  3IC7 A;  3MMY B;  5J1R A;  1GV2 A;  4LB6 B;  2M87 A;  1U9O A;  2XGD A;  3R60 A;  4HX7 A;  4I6Z A;  1KU3 A;  3NWS A;  4PJN A;  3WG7 H;  2OF7 A;  2E7X A;  5IP7 J;  4LLL A;  1X1C A;  2OCC H;  3WHC A;  1BI0 A;  2EJR A;  1F4K A;  3VWB A;  4BQN A;  1IN5 A;  1M1E B;  2DAO A;  2WAD A;  2F6C A;  1FYK A;  3B6C A;  1YRN B;  3UR3 C;  1T6S A;  2E2H J;  2V6E A;  3OYJ A;  3MEX A;  1R00 A;  1SMY F;  5B66 C;  1V4R A;  1ORK A;  3ZP5 A;  1OCZ H;  4D5C A;  3V7R A;  2BE5 F;  1ZRD A;  1F9N A;  1MBE A;  1YYV A;  3P9C A;  2DFH A;  5ICE A;  2FBK A;  3GVA A;  2NS7 A;  3V7C A;  2X85 A;  2P5K A;  4B48 A;  5LHG A;  4UVC A;  2DTR A;  1VND A;  1IAW A;  3CES A;  2HFH A;  1ENH A;  1Y8R B;  2DN0 A;  3DV8 A;  4N9H A;  3TOB A;  3FIS A;  4DJA A;  2N8G A;  1MJB A;  2CV2 A;  3AL0 B;  2I10 A;  4KIS A;  1KYZ A;  4ZDP A;  1X1D A;  2IGN A;  2L02 A;  1FP2 A;  1FOX A;  1J9I A;  4ZYD A;  2XRL A;  1P4A A;  3PFY A;  3CJQ B;  2E36 A;  4YRV A;  3BG3 A;  1R1U A;  2DK8 A;  3TQN A;  1TC3 C;  5IOY A;  2XV4 S;  5EYR A;  5F04 A;  4KIG A;  1L0O C;  1W7P B;  3KZI C;  3L00 A;  4L18 B;  4LLN A;  4UUS A;  2IP2 A;  3JRF A;  4RAF A;  2KT0 A;  2P5V A;  2BVL A;  3M9A A;  4WCG A;  2E1M B;  2DW4 A;  3I56 I;  1EJ9 A;  2DA2 A;  4Q4Z F;  1WJB A;  1Y6I A;  2FJ1 A;  4AYB A;  3BPX A;  3M8F A;  1E2X A;  2XF6 A;  4F92 B;  4ANJ A;  2HOS A;  4DYQ A;  3J80 K;  5E1X A;  4CXF A;  2VXZ A;  2F5E A;  1XMX A;  3TMO A;  1VTN C;  4QPQ A;  3HRT A;  2XPW A;  2LY9 A;  3EDP A;  3I4P A;  4RLQ A;  2CQQ A;  2QSH X;  1I6H J;  3FXK A;  2KL4 A;  3QPL A;  1P2F A;  3TBI A;  2QSG X;  1LPQ A;  2RRE A;  3BR1 A;  5J47 A;  3DCF A;  4M3G A;  1HXD A;  4WX9 A;  2ME0 A;  3DU5 A;  1TNS A;  2DOE A;  1D8K A;  2KP6 A;  3EET A;  4M71 A;  1Z7U A;  1IN4 A;  1TW3 A;  4IPA A;  4LIU A;  4E7J A;  1JJ6 C;  1A6I A;  2QSF X;  4BE2 A;  2D45 A;  2EA2 A;  2ZCW A;  2GWR A;  1O7L A;  3KP5 A;  2B7E A;  1FNN A;  2L4M A;  3QP6 A;  3RKQ A;  1Y1W J;  1J59 A;  1YO5 C;  2GA2 A;  4DW6 A;  3ULQ B;  4XNF A;  3G1M A;  5J6X A;  5E3O A;  1PDN C;  1AOY A;  1BIA A;  2GIZ A;  2L7F P;  2ESH A;  3CF2 A;  2DFE A;  3LSK A;  3PFI A;  5LD2 C;  4ZYG A;  3OIO A;  1A31 A;  1OLT A;  1R7J A;  2GAU A;  4C3H J;  3IHU A;  3S16 J;  1SAN A;  4U7B A;  3W6J B;  1IG7 A;  4HOB A;  1FPQ A;  5ICF A;  3I9V 2;  3TP0 A;  1ZR2 A;  3F3X A;  3H5R A;  3ONQ A;  4KIC A;  2BV6 A;  1T95 A;  4IKF A;  5CVJ A;  1LFU P;  1XG1 A;  3RKY A;  1SAX A;  4WF2 A;  4YIR X;  3TKY A;  4JBA A;  1QZE A;  4YEL A;  1JKO C;  4H4K C;  3WHB A;  2W82 A;  4PJJ A;  1MW7 A;  1BOA A;  1BM9 A;  3U2R A;  4FX4 A;  4PFO A;  1IV8 A;  5DTD A;  2FNA A;  2LF8 A;  3ABM H;  3JCU C;  3I4M J;  2DA4 A;  4E4H A;  1QPM A;  2EIM H;  4EVI A;  1ETQ A;  3CCE I;  2LMD A;  4HZF A;  3U1D A;  3VYR B;  2JA2 A;  2Z3Y A;  4EM1 A;  4F93 B;  2QQA A;  1FLI A;  3FMR A;  3MFK A;  2P8T A;  2KRC A;  2VJJ A;  2EPF A;  5F0C A;  4Y3O A;  1DPR A;  2YSR A;  4XKV A;  3ECO A;  1EH7 A;  3IV5 A;  1QA6 A;  3D0S A;  3S1Q J;  2RDP A;  2EIK H;  1S7O A;  3GLL A;  5FRM A;  3E0J B;  3IH2 A;  1MZB A;  4G12 A;  2QEX I;  2F5D A;  2LYC A;  2QBY B;  1P7J A;  4GRI A;  2FML A;  5LRR A;  1LDJ A;  2R7W A;  5J40 A;  1BJA A;  2E71 A;  2ZNY A;  4HEA 2;  4HQM A;  1DU6 A;  1ON1 A;  3HOT A;  4CGZ A;  2JK3 A;  2DMQ A;  1B9M A;  5EEG A;  1J2X A;  1Z77 A;  3NWT A;  4BQA A;  4LD5 A;  1EV7 A;  2MW8 A;  5TRD A;  4BDY A;  1NH3 A;  3GTP J;  5JR3 A;  4CIC A;  1X4P A;  4A3C J;  1FBU A;  4RB3 C;  1OYY A;  4LK1 F;  3F6O A;  3RQ4 A;  1X3U A;  4UVA A;  2ID3 A;  2M0M A;  2VC1 A;  2X51 A;  2KLO A;  2M34 A;  2HVQ A;  4EV0 A;  1AU7 A;  1W7P D;  5EG0 A;  2LH9 A;  3LNQ A;  5K7F A;  1SD4 A;  4EAT A;  2NNY A;  3CUQ B;  1TQI A;  2Q2E A;  3GO5 A;  3BTI A;  2EH3 A;  1U8B A;  4JK1 X;  5L3B A;  1WGX A;  1G8X A;  2VC0 A;  1CGP A;  4II3 A;  1FMW A;  1Z0X A;  3FMS A;  3K7A J;  1IO2 A;  3PSF A;  1I27 A;  2JSC A;  3WG9 A;  5L3C A;  4KT6 A;  3CCV I;  2HYF A;  2X9D A;  2V1N A;  3PQJ A;  3I58 A;  1WJ5 A;  2VT3 A;  3BZ6 A;  4Y4R A;  1TP4 A;  1K6O A;  2ZSH B;  2MAB A;  3B02 A;  3FXL A;  3SZP A;  1FTT A;  1TTY A;  2L2O A;  4PK4 A;  2KZG A;  5CVV A;  4AC0 A;  5J4Y A;  1JT0 A;  1YOV B;  1W0U A;  1T39 A;  1HA8 A;  3R6S A;  4FTH A;  4U87 A;  3S14 J;  4RGU A;  2L9S A;  2F4M B;  4D5F A;  1FC3 A;  1IF1 A;  5F64 A;  2DA5 A;  2Z33 A;  3GFJ A;  1B9N A;  5H6Q A;  1SVL A;  3M1E A;  2WAF A;  4WXC A;  3L2C A;  2VB6 A;  2DQL A;  3RI4 A;  4HF1 A;  3OYN A;  2E60 A;  3MD2 A;  2CS3 A;  2L9N A;  4NC6 A;  1K79 A;  3T0Y A;  4RB2 C;  1G3Y A;  3HC7 A;  3BG5 A;  1MMN A;  5K5O A;  1G59 A;  1MSF C;  2VKE A;  4A3D J;  2GBY A;  2OQR A;  5BOX A;  3DPU A;  1Z7L A;  1VQL I;  5M3M J;  2ISY A;  2DMU A;  3BR3 A;  2VAS A;  2XAJ A;  4A3M J;  3ZMZ A;  5C44 J;  1OCP A;  2BGC A;  2ZME A;  4M3D A;  2HYJ A;  1D1A A;  1GVD A;  2R92 J;  2FSW A;  2HQN A;  4A69 C;  3G1L A;  3BDD A;  3GFI A;  3PO3 J;  5HS7 A;  4LJZ F;  2ELH A;  1XX5 A;  3IUO A;  2K4J A;  2Y30 A;  4RAG A;  2NOJ B;  4IJA A;  1WH7 A;  5J1Y A;  5HNF A;  1QVT A;  3CCS I;  2R7S A;  2GXA A;  4UNO A;  4CYC B;  3NAR A;  1TNT A;  1OMI A;  4ZTF A;  3JTH A;  1SC7 A;  1BBY A;  2KJB A;  5B1B H;  2D1H A;  2CG4 A;  1XSV A;  1ZG1 A;  1R36 A;  2CH0 A;  2Y75 A;  3KEY A;  4IEJ A;  4P55 A;  4E7Z A;  1H89 C;  2EQR A;  2LLK A;  3FKJ A;  4XLE A;  2ZNZ A;  2CQK A;  5DUI A;  2L4A A;  3CP8 A;  3DBH B;  3PIP F;  4Q5S F;  3DTK A;  3DBR B;  3G1O A;  2AXT C;  1AA7 A;  4E7H A;  2GLO A;  4MNU A;  5D5V B;  4OIR F;  4RLF A;  2JPC A;  2LRE A;  2K40 A;  2XDV A;  2R7D A;  1WH5 A;  2HDC A;  2Q0O A;  4ZH4 F;  3JTG A;  4XLC A;  3ASN H;  1TWG J;  1XGS A;  1QO0 D;  3LSG A;  2WAE A;  1FJL A;  1ZYR F;  3VOE A;  4ESF A;  5IP9 J;  2K9M A;  4IL6 C;  3DKW A;  3FHN A;  3OIQ A;  2NRA C;  2PJR B;  1HW5 A;  3LMM A;  3HG9 A;  1KA8 A;  5KK1 A;  1V5G A;  3LAJ A;  2EV0 A;  3FKI J;  4IHX A;  4ENJ A;  5EZH A;  1YRN A;  4G6Q A;  4B8X A;  2VL8 A;  1SVO A;  2LTP A;  2VPR A;  2RQQ A;  3ZQH A;  2FF4 A;  3BG7 A;  2KMU A;  1UJ8 A;  4L5J A;  2VKH A;  1I6X A;  2ZKZ A;  5KAF C;  2VJ5 A;  3LWF A;  1XDS A;  3H5N A;  4F52 A;  4HF2 A;  3BQY A;  4D0P A;  4GYI A;  5E8I A;  1X3Z B;  3HYI A;  2X1D A;  1K7A A;  5HLG A;  1QVU A;  3CJR B;  3DKY A;  3QU6 A;  1BI1 A;  2ELJ A;  4MEY F;  3ZQL A;  3HRM A;  3L1P A;  2GM4 A;  2Z5U A;  3QYB A;  1RET A;  2YX4 A;  3H9J A;  3S1R J;  3LSI A;  3JRC A;  2VOD A;  3LA7 A;  4D7N A;  4IO9 F;  3JSP A;  1D0Y A;  3T5X A;  3SHF A;  2ZFU A;  4XOP A;  1E3P A;  2CWE A;  1ETO A;  2OZU A;  4MTD A;  2OQG A;  1UST A;  1U5T A;  1O57 A;  5FKL A;  1K4T A;  5D5U B;  4QWQ A;  1BR1 A;  2KIS A;  3KZY A;  3GTO J;  4P1W A;  5GP9 A;  1FOY A;  1K4S A;  5LHH A;  2QQB A;  3K69 A;  1IGN A;  2DLL A;  2FQ3 A;  3KX2 A;  2KIM A;  2LC2 A;  3G3Z A;  1B72 B;  1ZTR A;  1HSJ A;  3CCM I;  1KQ0 A;  1ZGJ A;  3H36 A;  3C7J A;  3VSL A;  2DOA A;  1MNE A;  2X4H A;  3SYT A;  1G3T A;  2E34 A;  2DOF A;  2DCE A;  4I01 A;  3CLQ A;  1ITY A;  1YQA A;  2QUF A;  3TO7 A;  2H09 A;  2K9L A;  1MJ9 A;  2RKH A;  3K2Z A;  1K78 B;  2KRH A;  3WE3 A;  1T0F C;  1S7A A;  4NUB A;  2XRN A;  2XAG A;  4GXO A;  2VKV A;  1U3E M;  3S1N J;  2D2W A;  4U0V A;  1VQ6 I;  3ZQF A;  1WJE A;  3F72 A;  3WTY C;  2DO7 A;  3EYY A;  5GPA A;  2H1K A;  2OC6 A;  2CRG A;  2VLA A;  1X1P A;  1OR7 A;  2JWT A;  3WGI A;  5C4J J;  2WWY A;  3IWZ A;  2OUM A;  3K2A A;  4HPQ A;  3NRV A;  4S04 A;  3Q5F A;  1H8A C;  1HQC A;  5LGT A;  1JTX A;  2PI0 A;  5BMZ A;  4B47 A;  2UWM A;  3S3N A;  4P96 A;  4JX5 A;  3O8G A;  5TJJ A;  3MN2 A;  3ZQQ A;  3GTQ J;  2G9W A;  5H20 A;  3SZG A;  4AVZ A;  3H9G A;  5HDG A;  4RAZ A;  1KQ8 A;  4RAY A;  2BHZ A;  1BIB A;  2OJE D;  3GLX A;  5KVR A;  2HKO A;  4XBF A;  1N77 A;  2Y9Y A;  1OCT C;  4YEJ A;  2CW7 A;  5LBQ A;  2IA2 A;  2MG4 A;  1HDD C;  2M1B A;  1JT6 A;  1DU0 A;  2IS2 A;  2LF7 A;  3KPH A;  5FLV A;  2E7W A;  4UXN A;  1LDD A;  2E1C A;  2AO9 A;  4A6E A;  3CCL I;  1QU3 A;  1D0X A;  1UHM A;  5CLS A;  1B4A A;  5M3F J;  2Z99 A;  3U21 A;  5F6F A;  1PJR A;  2EK5 A;  3OYE A;  4IHY A;  4M3F A;  4BXF A;  2XAH A;  2NS0 A;  3HUG B;  5LHI A;  3VOD A;  1YLF A;  4UV9 A;  2WV1 A;  4IHT A;  3DFG A;  2ZJP F;  3DEE A;  2E1O A;  3L09 A;  2JVH A;  1FOW A;  5DS9 A;  3ROU A;  1WJA A;  3IWF A;  2XGC A;  3R4K A;  4I0A A;  1MSE C;  4BU2 A;  3KP7 A;  5FLX Z;  4I76 A;  2LRD A;  2G0E A;  4A0Z A;  1TWC J;  5FFZ A;  3WOD F;  5HS8 A;  2IA1 A;  3O3K A;  1BI2 A;  2IGO A;  4UV8 A;  3VPR A;  4CCL A;  1V3F A;  1QQI A;  4AIH A;  4DQ2 A;  2E2I J;  2BEO A;  1X19 A;  2QBY A;  1WZ2 A;  3K70 D;  4V2G A;  1WJF A;  1LB2 A;  2A69 F;  3DWL E;  2B9S A;  5HDK A;  5E8G A;  3RPU D;  1LFB A;  3OL3 A;  4HDV A;  3EQL F;  3BTL A;  2R7Q A;  1ON2 A;  4BJ5 C;  2JJ7 A;  4CZZ A;  2R7U A;  3BQZ A;  4AYB N;  3OIP A;  2HXO A;  3K4C A;  4QTR A;  3HXL A;  5ERI A;  2VPL A;  4BY1 J;  4KIT B;  1R58 A;  3G6E I;  3DEU A;  1ONV A;  2CO5 A;  3FXR A;  2QF7 A;  1REP C;  3OS1 A;  2B63 J;  1MGT A;  5JHF A;  2D5V A;  4BEH B;  1FSH A;  3HIF A;  3ZRG A;  2NXN B;  4A0X A;  3FX3 A;  4P5O A;  1K83 J;  4BY7 J;  1VZ0 A;  1Y0U A;  4CUG A;  1J5Y A;  1PVE A;  3SDG A;  2WY7 Q;  4FAS D;  5CYV A;  1MMA A;  3OWT A;  3RIR A;  3OYH A;  3IRQ A;  3VYS B;  5DCM B;  5E3M A;  1T08 B;  3O6B B;  4NC7 A;  3CC2 I;  4L9V A;  3BWG A;  1O3T A;  2MH9 A;  4KMF A;  3FIW A;  4EJO A;  4Z6Y A;  2VKD A;  5ILV A;  5M5W J;  3A0H C;  1BC8 C;  2QQ8 A;  1IXS B;  4KYW A;  2P4W A;  1DQU A;  5ED4 A;  2QLZ A;  1WQ2 A;  5BPD A;  2L7M P;  4AU7 A;  3N4M A;  1QBJ A;  4XLF A;  4RM3 A;  2P6S A;  2VE8 A;  1XN7 A;  3LST A;  4ZTJ A;  4IHW A;  2O8K A;  5FLM J;  5FKO A;  3FM3 A;  2IBD A;  3C3W A;  2UUZ A;  2X1C A;  3CCQ I;  4OOI A;  3ZN0 A;  3ZQI A;  3AG3 H;  1LE8 B;  2A5W A;  3OS0 A;  4EJU A;  2PJP A;  2L54 A;  4KIB A;  4WWC A;  2M2E A;  5IYD J;  3H1C A;  3K70 C;  2O9L A;  2DFI A;  5GTH C;  1W5T A;  4KN4 X;  3HPG A;  3RSN A;  4Y7N J;  1H88 C;  1DDN A;  4OIQ F;  2H8R A;  4DNC A;  4XL9 A;  1TQM A;  3SFZ A;  2IT0 A;  3BLY A;  2O0Y A;  3HSE A;  2M5W A;  4CA0 A;  1YJW I;  2ZC2 A;  1ZN2 A;  3HTU A;  4X6A J;  2LBF B;  2IAI A;  1WSU A;  3OOP A;  3VFZ A;  1IV6 A;  4BYY A;  2QZ8 A;  3M8E A;  3GTK J;  2HXI A;  5K5Q A;  4HAM A;  3I5U A;  2QA4 I;  2RQP A;  3ASO H;  1F36 A;  3OYF A;  3RJP A;  1V5E A;  3CTA A;  3LSJ A;  3OOU A;  4PGG A;  5B3S H;  5M5Y J;  2W1O A;  2EZK A;  3KP6 A;  2M4K A;  3C18 A;  4PDK A;  2XSD C;  2LG4 A;  3QWL A;  4FET A;  4D1Q A;  3FMQ A;  1XGO A;  3QQA A;  1FP1 D;  3B73 A;  4XQF A;  2JTV A;  2RC4 A;  4L9J A;  3EUH A;  4F91 B;  2LY1 A;  4BE0 A;  5DDG A;  1ZR4 A;  1IC8 A;  2OTL I;  1G3S A;  1P92 A;  3KCC A;  4RB1 A;  2B0L A;  2DA1 A;  1FOK A;  5K7Z A;  2KHM A;  5AON A;  1XS9 A;  2G7U A;  2XKO A;  2ZB9 A;  3E1S A;  5HLI A;  4XLN F;  4HV5 A;  2BW3 A;  3H5A A;  3BG9 A;  3ZXS A;  4AWX B;  1JI8 A;  3I53 A;  1BW6 A;  3TOA A;  1VF9 A;  1KQ9 A;  3GZN B;  5FJ8 J;  1XSX A;  4XR6 A;  3SFI A;  2CQ7 A;  3TO9 A;  4C3J J;  4IQ4 A;  3TDU C;  1BI3 A;  3CP2 A;  1IN8 A;  3L2Q A;  2YPR A;  1ERD A;  9ANT A;  4X0G A;  4RS8 A;  5HLT A;  1ETY A;  3H3Z A;  5D5W B;  1MND A;  3M4O J;  4FCY A;  2QKM B;  2F4O B;  4R8H A;  4F7Z A;  4GO1 A;  3OYD A;  3LAP A;  2A61 A;  2PJR A;  1LEA A;  2RAE A;  2P7C B;  2K85 A;  3BZC A;  3JRG A;  3IH3 A;  1ETV A;  2EZL A;  2X6O A;  4LGW A;  3S93 A;  4A12 A;  4XSX F;  2JUG A;  4XID A;  2LOO A;  1P7I A;  2DA6 A;  2YUS A;  4R79 A;  2ZXW H;  1KGS A;  2IEK A;  2CV1 A;  1XC5 A;  1J75 A;  3E7L A;  4ENK A;  2VBW A;  3GWZ A;  2GIV A;  3FF5 A;  2NAZ A;  4NC8 A;  5FD6 A;  4LIV A;  4G9Y A;  3E5U A;  2V4J C;  5ILU A;  3GTG J;  1J7K A;  1QHH D;  2L01 A;  2YR2 A;  5BNG A;  3BJA A;  4A5N A;  1VQP I;  4A3B J;  1LEB A;  2CQX A;  4RB0 A;  3BG6 A;  3R0A A;  1LVA A;  5KHD A;  3H0G J;  1K61 A;  5F0H A;  2XKP A;  4IXA A;  4L9N A;  2IGK A;  4KUM A;  1RRJ A;  1X3W B;  5FKK A;  2XIG A;  2HQ5 A;  2H27 A;  3CUO A;  5GAE J;  3FXU A;  2XB0 X;  1Z6R A;  4C3I J;  4ZDO A;  4BGD A;  5EGO B;  1DP7 P;  2CUJ A;  2FQ4 A;  2ICW G;  2VOO A;  1SMT A;  4OMZ A;  4M9X A;  1W36 D;  4XRM A;  4OAZ A;  1NHA A;  4HW0 A;  2FOK A;  5IY5 H;  5E1W A;  3QOE A;  1E17 A;  1B72 A;  3MQ0 A;  2FA5 A;  3KP4 A;  5J8C A;  1TL8 A;  2XGX A;  3NEU A;  3IKT A;  4OIP F;  2Z1D A;  3LQR A;  4XRS A;  2FE3 A;  2PG4 A;  4DGW B;  1O3Q A;  1G2H A;  2XAQ A;  1I1S A;  1TZL A;  2V1X A;  1SD7 A;  2NVY J;  2W48 A;  2XAS A;  4H0E A;  3GW2 A;  1K78 A;  1MJA A;  2R5Z B;  3ZPL A;  3I55 I;  3BCA A;  4G6T B;  3QRF F;  2I5U A;  1YFH A;  3A2K A;  2F5C A;  3LFU A;  5JHU A;  3L2V A;  2WBM A;  4AVP A;  4XIC A;  3AG1 H;  2DDA A;  3SEZ A;  3A1Y A;  2R5Y A;  4DZJ A;  5FLX K;  2XB5 A;  3TW6 A;  4L5I A;  4A3J J;  4ETS A;  4B43 A;  2O03 A;  4W1U A;  3M7G A;  1RI7 A;  4N9I A;  4Q47 A;  1Z67 A;  3GZ6 A;  2HTJ A;  4GGG A;  5GAD J;  3M3Y J;  3JRB A;  2JA5 J;  4KFC A;  3DPL C;  2OAZ A;  5L3F A;  2EFN A;  1OJL A;  1WKM A;  2L0K A;  3G73 A;  3T1B A;  1ODD A;  2KIF A;  3BPV A;  4OWR B;  3KE2 A;  4I7H A;  4NBQ A;  2ECC A;  4A2U A;  2UZK A;  2DTZ A;  1Y8Q B;  1LQ1 A;  3QYF A;  3MKW B;  5EZG A;  4EJV A;  4AIJ A;  2XVC A;  3LSR A;  2ZXI A;  3TO6 A;  3J7Z I;  4LB5 A;  2Y2Z A;  3P7N A;  1VQ4 I;  5D8K B;  5DD8 A;  4IZZ A;  2XAF A;  3CDL A;  1XPX A;  1R1V A;  4QPO A;  4CHU A;  2LY2 A;  4XOR A;  2QQ9 A;  4CCK A;  3F23 A;  1W36 C;  3BT9 A;  1MBF A;  1D3Y A;  4ESJ A;  3I0T A;  2HS5 A;  3PL8 A;  4M74 A;  2R7X A;  3COA C;  4HQE A;  2HKX A;  2VBZ A;  1VI0 A;  2NNN A;  2DDB A;  3F8M A;  1LVK A;  4DYC A;  4BNC A;  4I02 A;  1Z6T A;  4PCQ A;  1OPC A;  2DYS H;  2OBP A;  2X1E A;  4IOA F;  3JSO A;  2VJI A;  1KU7 A;  3OYI A;  1JTY A;  1TT0 A;  1SFO J;  5ICC A;  4EJW A;  1GDT A;  1FBQ A;  1CQT A;  4F3Q A;  4M72 A;  3CCU I;  1MMS A;  1SD5 A;  1JUM A;  3OS2 A;  1S6L A;  1ZAO A;  1XMA A;  3VDX A;  2R93 J;  3GUD A;  4HLX A;  5LEJ A;  2STT A;  2FNP A;  5F08 A;  1MH3 A;  3S2H J;  5TGT A;  4GYG A;  4A3K J;  2WY8 Q;  2ZBK A;  1P6R A;  1R5G A;  1IRX A;  2IXS A;  3BRO A;  4ZZD A;  2CV0 A;  4BXX J;  1UMQ A;  1SFX A;  3WTZ A;  2JMW A;  2OTJ I;  3LL7 A;  5CPR B;  1EH8 A;  3JR9 A;  3LSP A;  3GTJ J;  4IQJ A;  3WU2 C;  1T98 A;  2VOP A;  3KET A;  2RN7 A;  1A36 A;  3ERE D;  1JKP C;  1WRJ A;  4UB8 C;  4EGZ A;  1HKQ A;  2COB A;  1RR8 C;  3DQV C;  4M73 A;  4C30 A;  3PQK A;  3P9K A;  5TIS C;  1U5T C;  4G6D A;  1SD6 A;  3JRE A;  1K6Y A;  5FB2 A;  2DA3 A;  4KT5 C;  1HKT A;  2NVT J;  3J7Y J;  4JYK A;  2JUC A;  2ZO4 A;  2M0C A;  3HEF A;  1KU2 A;  4RGX A;  4A3G J;  3W2V A;  2LSO A;  2QVO A;  1JXS A;  4OIO F;  4XOT A;  4HYE A;  4BS9 A;  5HDN A;  3DTE A;  2DPD A;  1T8I A;  2IA0 A;  3S15 J;  3OYM A;  1BW5 A;  1D5V A;  1O3R A;  4KMU X;  1YS6 A;  2OD5 A;  4XSZ F;  2PMH A;  2H94 A;  5FO5 A;  5DCM A;  1UCR A;  1YTY A;  3BR5 A;  1IW7 F;  3DLA A;  1V54 H;  5FD5 A;  4IVN A;  3I71 A;  3PNY A;  2HU9 A;  1P4X A;  2PMZ A;  2BXZ A;  2F2E A;  5IT3 A;  2R7V A;  2WC2 A;  2YU3 A;  4LMY A;  1OFC X;  2EFO A;  3GME A;  4U0W A;  2IS6 A;  3H0D A;  5KCM A;  3RKX A;  1QZZ A;  4A5M A;  1L3L A;  1FIP A;  4AUX A;  3CLO A;  2EA4 A;  3QPS A;  3D5R C;  4JOM A;  1RUN A;  3J7A Y;  1IRF A;  3KEQ A;  3PUF A;  3N97 A;  1ZQ3 P;  3CMY A;  4KDP A;  5J3L A;  4EQQ A;  3S3O A;  2HDD A;  4BJT A;  1UG0 A;  2E1N A;  2NVX J;  1UFM A;  4KN7 X;  1N25 A;  1TLH B;  3FZV A;  3K1N A;  1U9N A;  3FDY A;  5LGN A;  1XGN A;  1JJ8 C;  2H1L A;  3L9F A;  5F1J A;  4LG3 A;  3GF2 A;  4L9T A;  2GOX B;  5JI6 A;  2WA0 A;  3ABT A;  2XF5 A;  1FMV A;  2W24 A;  4FQG A;  1LNW A;  2FD5 A;  4BL0 B;  4ESB A;  1YIJ I;  1MBJ A;  3WTW C;  3L2W A;  5ICG A;  1SFE A;  1MMD A;  3H3V K;  2DK5 A;  3KYC B;  2QGU A;  5DM6 F;  2PN6 A;  4W97 A;  5CJ9 A;  2JRM A;  2W4S A;  1UB9 A;  4CYD A;  4BAC A;  1Z05 A;  4HNT A;  2VN2 A;  4HG2 A;  1R49 A;  1UZC A;  1W7P A;  2ZXH A;  4BUP A;  1S72 I;  4M3B A;  3E5Q A;  1TT5 B;  2VT2 A;  3OV8 A;  3J80 Z;  2P7V B;  1SFK A;  3N05 A;  4DOZ A;  2DT7 B;  3WTS C;  3MZH A;  1U0J A;  3FXQ A;  1KU9 A;  4MLO A;  2LFB A;  3WGG A;  3JW4 A;  2LNB A;  3CME I;  1AKH B;  2K9N A;  1W1W E;  1N75 A;  4XN0 A;  4I0B A;  4KJZ A;  5JVT A;  3OSG A;  3CO7 C;  3P9I A;  3ABL H;  4OMY A;  3CD6 I;  3TED A;  1JKR C;  4B1R A;  2E5N A;  3JRI A;  5DM7 F;  1NG6 A;  3SQN A;  2HI3 A;  1Z91 A;  3TGN A;  2JZY A;  3VEP A;  3ABK H;  2C6Y A;  5JVG F;  1S5L C;  3IH4 A;  2JSP A;  1FX7 A;  3MVP A;  3FK7 A;  4AID A;  1YG2 A;  3F9K A;  1UG2 A;  3QPH A;  1G4D A;  1T38 A;  3E6B A;  1ZGW A;  2IRF G;  3Q9V A;  4PSX A;  5K1Y A;  1LUJ B;  1Z1D A;  2EZI A;  1IN6 A;  2P6T A;  4J19 A;  4A3L J;  1Q1H A;  4ENN A;  4V19 K;  2ETH A;  3HSR A;  1YW8 A;  3SDB A;  3IAM 2;  3MKY B;  1WCM J;  1IRZ A;  2VE9 A;  1FBS A;  5IYC J;  5JLW A;  1LDK B;  3MZY A;  4A93 J;  3QYE A;  3DPT A;  4P9U A;  3GEZ A;  1BOB A;  1TWF J;  2DJI A;  2QM3 A;  2BYV E;  2F48 A;  3FBN B;  3GTM J;  1ACI A;  3S17 J;  1B6A A;  1SAU A;  1PP8 F;  2Q2E B;  1R1T A;  3LA2 A;  5LGU A;  1ZRF A;  3PNT A;  2CGP A;  3KEO A;  4GCV A;  4M3E A;  1XDU A;  3U1K A;  2ZJ2 A;  3BP8 A;  1JUS A;  2O6G E;  2CSO A;  4Y15 A;  2XAU A;  2DFF A;  4PFP A;  2PBI A;  1NK2 P;  2KDO A;  2EFQ A;  2NS8 A;  3VYT B;  3TDZ C;  5LLQ A;  2L3D A;  3WE2 A;  1IJW C; 
#chains in the Genus database with same CATH homology
 4RGS A;  2NYX A;  1OYI A;  5HOO A;  4NB5 A;  4ZYE A;  1H0M A;  3E5X A;  5F1R A;  3FHZ A;  3BJO A;  4HV6 A;  4QLC U;  1DPU A;  1SFU A;  3W6K B;  2MLK A;  2GXG A;  3C1D A;  1TW2 A;  2LKP A;  1EH6 A;  2M8E A;  4P9F A;  1D8J A;  2IVM A;  2MLG A;  4Z2Y A;  5BPI A;  2IW5 A;  2DU9 A;  1QNT A;  5A2Q Z;  1TBX A;  5D5X B;  2HR3 A;  1U6G A;  2LDU A;  5BQT A;  2FEZ A;  5HVQ C;  3AAF A;  4M9Z A;  2K27 A;  4AD9 A;  2G7H A;  1HW1 A;  2IPQ X;  4M9S A;  1FY7 A;  4YG2 F;  3D5L A;  2HEO A;  4M6Y A;  3WTT C;  1XD7 A;  1S29 A;  4A6D A;  3SXY A;  5DUK A;  2W85 A;  4PGH A;  4YIF A;  3HRU A;  1XGM A;  2V1D A;  3CUQ A;  3REO A;  4HX8 A;  5FGM A;  4MHG A;  3T8T A;  2RVC A;  1MDM B;  4EMS A;  3I59 B;  2YX7 A;  1FZP B;  4NHJ A;  4EGY A;  2FXA A;  3DF8 A;  2W57 A;  2MA3 A;  1ZRE A;  2GQQ A;  1O7F A;  4B09 A;  5D6F A;  4LK0 F;  3IRR A;  2HZT A;  3J81 Z;  3JAM Z;  3H3U A;  4WK8 F;  3QPT A;  2EWN A;  2ACJ A;  3RYR A;  1XSD A;  5L3D A;  2EV6 A;  1JHH A;  3WTX C;  3BJ6 A;  2MH2 A;  4ZYH A;  4EM2 A;  3ZMS A;  3RTR A;  1XMK A;  4LG0 B;  5D6E A;  2UXX A;  2HTS A;  3U9G A;  1T2K A;  3ABU A;  1FYL A;  2Y0M A;  1U5T B;  2GXB A;  4MGR A;  5DV5 A;  1XCB A;  4O6J A;  4MQV A;  4XLP F;  2EB7 A;  1AWC A;  1S8N A;  2O61 A;  3NQO A;  3WGH A;  2W25 A;  5E20 A;  4MTE A;  2PEX A;  2KKO A;  1YS7 A;  4U7D A;  1GVJ A;  4G8X A;  2XRO A;  5AIQ A;  3E6M A;  1FT9 A;  1HBX G;  2XHK A;  2K7L A;  1CF7 B;  5CVR A;  4FHT A;  1W4M A;  1BN5 A;  3S2W A;  1A04 A;  5LEK A;  1YIO A;  3CJN A;  4A0Y A;  4FT8 A;  3HHG A;  3FM5 A;  3K0L A;  3F8F A;  5LRS A;  3RPU A;  1OKR A;  2OA4 A;  3V7S A;  4L0Z B;  5DD4 A;  3V8J A;  3Q9S A;  1ZGA A;  2Y48 A;  4BAY A;  3E97 A;  3QOP A;  2COM A;  5D8L B;  5JFR A;  3CDH A;  1JGS A;  2D1V A;  4Q48 A;  3RYP A;  2HGC A;  2WV0 A;  1RZ4 A;  3QU3 A;  4JQF A;  4CDG A;  2X0L A;  1G6N A;  2A68 F;  2DBB A;  1ULY A;  4BHC A;  4KA4 A;  3K1M A;  3IKV A;  2VBX A;  1GXP A;  4IRI A;  4IHS A;  2CW0 F;  2M45 A;  2M30 A;  3R61 A;  5CVI A;  5BS6 A;  2EFW A;  2DT5 A;  2QWW A;  1RNL A;  2PFB A;  4YFK F;  2DI3 A;  1ZH5 A;  1ZLK A;  3E6D A;  2FBH A;  2A6E F;  3F21 A;  5A2Q K;  2O3F A;  4L0Y B;  2ZXJ A;  4MQ9 F;  3ELK A;  5L3G A;  4I98 B;  2HQR A;  2P5L C;  1S3J A;  5E17 F;  1IXR C;  4RGR A;  1B59 A;  3V8K A;  5D4R A;  4BHB A;  3ZQ7 A;  4I09 A;  4UVB A;  1PUE E;  2DQR A;  4LFU A;  2Q8K A;  4O5V A;  3KP3 A;  1ZLJ A;  1PP7 U;  3WTV C;  5IT9 Z;  2RGV A;  4OIN F;  4G7H F;  2FRH A;  3ZMV A;  2J5P A;  2V9V A;  3HUG A;  3KP2 A;  3DXJ F;  4EM0 B;  2BBY A;  3VB2 A;  1U78 A;  3IL2 A;  1OYW A;  1IXC A;  4K2E A;  3RPQ A;  5L3E A;  1ZG5 A;  2PMU A;  3HRS A;  3ZN1 A;  1WI9 A;  2UXN A;  3J81 K;  3JAM K;  2K86 A;  2RNJ A;  4UUV A;  3E3V A;  4I2O A;  2OU2 A;  2R3S A;  3E6C C;  3HHH A;  4HX4 A;  1R23 A;  3F8C A;  2Z9O A;  1F5T A;  1FWZ A;  6PAX A;  4AIK A;  5J8F A;  2GA1 A;  3GXO A;  2KJC A;  1IN7 A;  4S05 A;  2AS5 F;  4G7O F;  2PLY A;  2J5O A;  2A07 F;  3ZMU A;  5HS9 A;  3F22 A;  5FFX A;  2ISZ A;  3MAJ A;  1P4W A;  4HBL A;  4O3M A;  3WU1 B;  2JRT A;  1MDM A;  3I59 A;  4ZZL A;  1MKM A;  4ASN A;  2JPB A;  1FSE A;  4LLG F;  4BH9 A;  4BHP A;  3I64 A;  2STW A;  4U88 A;  4IF4 A;  2V6C A;  3T8R A;  4IRH A;  1H9T A;  5EEH A;  1RIO H;  2A6H F;  2RV8 A;  3ECH A;  1IRG A;  3BOQ A;  4HA8 A;  2KRF A;  3QAH A;  2EV5 A;  1R5H A;  3ML6 A;  4Y13 A;  1G3W A;  1STZ A;  1JE8 A;  3KZZ A;  5ILS A;  2A5Y B;  4KNY A;  1B1B A;  5HLH A;  2OZ6 A;  4EJT A;  4IRG A;  4BXU A;  1XB4 A;  3EYI A;  1UHW A;  2HWV A;  5K5R A;  3HTS B;  5DCF A;  4ON0 A;  2H6C A;  2CFX A;  4LG0 A;  1KYW A;  3BY6 A;  2HYG D;  1RUO A;  2WTE A;  5E1Z B;  4Y17 A;  1DUX C;  1J0R A;  4ENM A;  2FBI A;  2KIU A;  1GXQ A;  2ADU A;  3HOS A;  3LQQ A;  2R7F A;  2QEN A;  2ZFW A;  3KLN A;  1I1G A;  1XCV A;  2TDX A;  2DPU A;  3LFK A;  4YFN F;  1U2W A;  2QYO A;  2PQ8 A;  2MBF A;  4HLY A;  1H9G A;  4R1H A;  4KIF A;  4NQW A;  3GX4 X;  4OU0 A;  4XRF A;  1HW2 A;  1R22 A;  2GZW A;  3V4G A;  1ZRC A;  4PZJ A;  4WXD A;  2EFP A;  5DYM A;  2AXL A;  3WTU C;  3GFL A;  3MWM A;  1HST A;  1CF7 A;  1TQP A;  5D4S A;  3CUQ C;  1C0W A;  2F5F A;  3L7W A;  3V8L A;  1YW9 A;  2ESN A;  3I54 A;  1GHC A;  3GZ5 A;  3CO6 C;  2A3S A;  1FYM A;  2H6B A;  1IZ1 A;  2MC3 A;  1ZAR A;  3R0J A;  1ZHF A;  2HOE A;  3DP7 A;  3HSF A;  2XUB A;  1F1Z A;  2V1U A;  3J7A O;  5AIP A;  2V79 A;  3GYH X;  1BC7 C;  3GFM A;  3K9T A;  4G94 A;  5CVU A;  2O8X A;  4CO8 A;  5IT9 K;  3RKW A;  2IJL A;  3ZMT A;  1QZY A;  3QP5 A;  4U0Y A;  4YII A;  2ZME B;  1T0F A;  2FU4 A;  3ISP A;  4FX0 A;  3SZT A;  2VON A;  1ZG3 A;  1LJ9 A;  4G7Z F;  5DEQ A;  4WXH A;  4TV7 A;  4M6X A;  2K4B A;  3F6V A;  4HF0 A;  1WWX A;  1U8R A;  4YFX F;  3MCZ A;  2JT1 A;  3WU0 A;  1HKS A;  3K1P A;  1W5S A;  1I5Z A;  1USS A;  3F8N A;  4MEX F;  1O3S A;  5H6R A;  4N0B A;  3ZMD A;  2CYY A;  1YW7 A;  1JHF A;  2W84 A;  2MD5 A;  3F8B A;  2VBY A;  3KFW X;  4E70 A;  3LA3 A;  3RDI A;  1IUY A;  3H92 A;  1QGP A;  2K02 A;  5E18 F;  2FMY A;  4HDU A;  3KLO A;  3O2P E;  1MD0 A;  1Z9C A;  4UHT A;  3FWE A;  3IC7 A;  4LB6 B;  2M87 A;  3R60 A;  4HX7 A;  1KU3 A;  2E7X A;  4LLL A;  1BI0 A;  2EJR A;  1F4K A;  1IN5 A;  2DAO A;  1FYK A;  1T6S A;  3MEX A;  1R00 A;  1SMY F;  1V4R A;  3ZP5 A;  3V7R A;  2BE5 F;  1ZRD A;  1F9N A;  1YYV A;  3P9C A;  5ICE A;  2FBK A;  3GVA A;  3V7C A;  2P5K A;  5LHG A;  4UVC A;  2DTR A;  1IAW A;  2HFH A;  3DV8 A;  4N9H A;  3TOB A;  1MJB A;  1KYZ A;  2L02 A;  1FP2 A;  1J9I A;  4ZYD A;  1P4A A;  1R1U A;  2DK8 A;  3TQN A;  2XV4 S;  4KIG A;  1L0O C;  1W7P B;  4LLN A;  3L00 A;  4L18 B;  2IP2 A;  2P5V A;  3M9A A;  4WCG A;  2DW4 A;  4Q4Z F;  3BPX A;  3M8F A;  1E2X A;  3J80 K;  5E1X A;  4CXF A;  2VXZ A;  2F5E A;  1VTN C;  3HRT A;  3EDP A;  3I4P A;  1P2F A;  1HXD A;  4WX9 A;  1TNS A;  3EET A;  1D8K A;  4M71 A;  1Z7U A;  1IN4 A;  1TW3 A;  4IPA A;  2D45 A;  2EA2 A;  2ZCW A;  2GWR A;  1O7L A;  3KP5 A;  1FNN A;  2L4M A;  3QP6 A;  1J59 A;  1YO5 C;  2GA2 A;  3ULQ B;  5J6X A;  1PDN C;  1AOY A;  1BIA A;  2ESH A;  3PFI A;  4ZYG A;  2GAU A;  1R7J A;  3IHU A;  4U7B A;  3W6J B;  4HOB A;  1FPQ A;  5ICF A;  3F3X A;  4KIC A;  2BV6 A;  5CVJ A;  3RKY A;  1SAX A;  4WF2 A;  3TKY A;  4JBA A;  1BOA A;  1BM9 A;  3U2R A;  4FX4 A;  2FNA A;  2LF8 A;  1QPM A;  4EVI A;  3U1D A;  4HZF A;  4EM1 A;  2Z3Y A;  2QQA A;  1FLI A;  3FMR A;  3MFK A;  2P8T A;  1DPR A;  2YSR A;  3ECO A;  1EH7 A;  3D0S A;  2RDP A;  1S7O A;  1MZB A;  2QBY B;  2F5D A;  2FML A;  5LRR A;  1LDJ A;  1BJA A;  2ZNY A;  4HQM A;  1ON1 A;  3HOT A;  4CGZ A;  1B9M A;  5EEG A;  1J2X A;  4BQA A;  4LD5 A;  1EV7 A;  5TRD A;  5JR3 A;  4CIC A;  1FBU A;  4RB3 C;  1OYY A;  4LK1 F;  3F6O A;  1X3U A;  4UVA A;  2VC1 A;  4EV0 A;  1W7P D;  1SD4 A;  2NNY A;  3CUQ B;  1TQI A;  2Q2E A;  3GO5 A;  4JK1 X;  5L3B A;  2VC0 A;  1CGP A;  3FMS A;  1I27 A;  2JSC A;  3WG9 A;  5L3C A;  2HYF A;  3PQJ A;  3I58 A;  2VT3 A;  3BZ6 A;  1K6O A;  3B02 A;  3SZP A;  1TTY A;  5CVV A;  1T39 A;  3R6S A;  4RGU A;  1FC3 A;  1IF1 A;  5F64 A;  2Z33 A;  3GFJ A;  1B9N A;  5H6Q A;  3M1E A;  4WXC A;  3L2C A;  2DQL A;  3RI4 A;  4HF1 A;  1K79 A;  3T0Y A;  4RB2 C;  1G3Y A;  5K5O A;  2OQR A;  5BOX A;  2ISY A;  2XAJ A;  3ZMZ A;  2BGC A;  2ZME A;  2FSW A;  2HQN A;  3BDD A;  3GFI A;  5HS7 A;  4LJZ F;  2ELH A;  2K4J A;  4IJA A;  4UNO A;  1TNT A;  1OMI A;  3JTH A;  1BBY A;  2KJB A;  2D1H A;  2CG4 A;  1XSV A;  1ZG1 A;  1R36 A;  2Y75 A;  4P55 A;  2ZNZ A;  2CQK A;  5DUI A;  2L4A A;  4Q5S F;  4MNU A;  5D5V B;  4OIR F;  2JPC A;  2R7D A;  2HDC A;  2Q0O A;  4ZH4 F;  3JTG A;  1XGS A;  1QO0 D;  1ZYR F;  3VOE A;  4ESF A;  3DKW A;  2NRA C;  1HW5 A;  1KA8 A;  5KK1 A;  3LAJ A;  2EV0 A;  4ENJ A;  4G6Q A;  4B8X A;  2FF4 A;  4L5J A;  1I6X A;  2ZKZ A;  3LWF A;  1XDS A;  4HF2 A;  4D0P A;  4GYI A;  5E8I A;  3HYI A;  1K7A A;  5HLG A;  3QU6 A;  1BI1 A;  4MEY F;  3HRM A;  2Z5U A;  2YX4 A;  2VOD A;  3LA7 A;  3JSP A;  3T5X A;  3SHF A;  2CWE A;  2OZU A;  4MTD A;  2OQG A;  1UST A;  1U5T A;  1O57 A;  5D5U B;  4QWQ A;  3KZY A;  5LHH A;  2QQB A;  3K69 A;  2DLL A;  2FQ3 A;  2KIM A;  3G3Z A;  1HSJ A;  1KQ0 A;  1ZGJ A;  3C7J A;  2X4H A;  1G3T A;  4I01 A;  1YQA A;  2QUF A;  3TO7 A;  2H09 A;  1MJ9 A;  2RKH A;  3K2Z A;  1K78 B;  3WE3 A;  1S7A A;  2XRN A;  2XAG A;  4GXO A;  1U3E M;  2D2W A;  4U0V A;  3F72 A;  3WTY C;  2DO7 A;  3EYY A;  1OR7 A;  3WGI A;  2WWY A;  3IWZ A;  3Q5F A;  3NRV A;  4S04 A;  1HQC A;  5LGT A;  2PI0 A;  5BMZ A;  2UWM A;  4P96 A;  5TJJ A;  2G9W A;  5H20 A;  5HDG A;  4RAZ A;  1KQ8 A;  4RAY A;  1BIB A;  3GLX A;  5KVR A;  2HKO A;  4XBF A;  5LBQ A;  2IA2 A;  2M1B A;  2LF7 A;  2E7W A;  4UXN A;  1LDD A;  2E1C A;  4A6E A;  1UHM A;  5CLS A;  1B4A A;  2Z99 A;  5F6F A;  2EK5 A;  2XAH A;  2NS0 A;  5LHI A;  3VOD A;  1YLF A;  4UV9 A;  4IHT A;  3DFG A;  3L09 A;  3ROU A;  3IWF A;  4I0A A;  3R4K A;  3KP7 A;  5FLX Z;  4A0Z A;  5FFZ A;  3WOD F;  5HS8 A;  2IA1 A;  3O3K A;  1BI2 A;  4UV8 A;  1V3F A;  1QQI A;  4AIH A;  4DQ2 A;  2BEO A;  2QBY A;  1LB2 A;  2A69 F;  5HDK A;  5E8G A;  4HDV A;  3EQL F;  1ON2 A;  4CZZ A;  5ERI A;  1R58 A;  3DEU A;  1ONV A;  2CO5 A;  3FXR A;  1REP C;  1MGT A;  1FSH A;  3HIF A;  4A0X A;  3FX3 A;  4P5O A;  1Y0U A;  1J5Y A;  5CYV A;  3RIR A;  3IRQ A;  5DCM B;  3O6B B;  4L9V A;  3BWG A;  1O3T A;  2MH9 A;  4KMF A;  4EJO A;  5ILV A;  1BC8 C;  1IXS B;  4KYW A;  2P4W A;  5ED4 A;  2QLZ A;  1WQ2 A;  5BPD A;  3N4M A;  1QBJ A;  2P6S A;  2VE8 A;  1XN7 A;  3LST A;  3FM3 A;  3C3W A;  4OOI A;  3ZN0 A;  4EJU A;  2PJP A;  2L54 A;  4KIB A;  4WWC A;  2DFI A;  1W5T A;  4KN4 X;  1DDN A;  4OIQ F;  4DNC A;  1TQM A;  3SFZ A;  2IT0 A;  2O0Y A;  3HSE A;  2M5W A;  1ZN2 A;  3HTU A;  1WSU A;  3OOP A;  3VFZ A;  4BYY A;  2QZ8 A;  3M8E A;  5K5Q A;  4HAM A;  3I5U A;  2RQP A;  3RJP A;  3CTA A;  4PGG A;  4PDK A;  3KP6 A;  3C18 A;  3FMQ A;  1XGO A;  1FP1 D;  3B73 A;  2JTV A;  2RC4 A;  4L9J A;  3EUH A;  5DDG A;  1G3S A;  1P92 A;  3KCC A;  4RB1 A;  2B0L A;  1FOK A;  5AON A;  2G7U A;  2XKO A;  5HLI A;  4XLN F;  4HV5 A;  4AWX B;  3I53 A;  3TOA A;  1KQ9 A;  1XSX A;  3TO9 A;  3TDU C;  1BI3 A;  1IN8 A;  2YPR A;  4RS8 A;  3H3Z A;  5D5W B;  4R8H A;  4F7Z A;  4GO1 A;  3LAP A;  2A61 A;  1LEA A;  2P7C B;  4LGW A;  4A12 A;  4XSX F;  4R79 A;  1KGS A;  1J75 A;  4ENK A;  2VBW A;  3GWZ A;  2GIV A;  3FF5 A;  2NAZ A;  5FD6 A;  4G9Y A;  3E5U A;  5ILU A;  1J7K A;  2L01 A;  2YR2 A;  4A5N A;  3BJA A;  1LEB A;  4RB0 A;  3R0A A;  1LVA A;  2XKP A;  4IXA A;  4L9N A;  4KUM A;  2XIG A;  2H27 A;  3CUO A;  3FXU A;  1Z6R A;  1DP7 P;  2VOO A;  1SMT A;  4OMZ A;  4M9X A;  1NHA A;  4HW0 A;  2FOK A;  5E1W A;  1E17 A;  3MQ0 A;  2FA5 A;  3KP4 A;  5J8C A;  2XGX A;  3NEU A;  3IKT A;  4OIP F;  3LQR A;  2FE3 A;  2PG4 A;  1O3Q A;  2XAQ A;  1I1S A;  2V1X A;  1SD7 A;  2XAS A;  4H0E A;  3GW2 A;  1K78 A;  1MJA A;  3ZPL A;  3QRF F;  1YFH A;  2F5C A;  5JHU A;  4AVP A;  5FLX K;  4L5I A;  4ETS A;  2O03 A;  3M7G A;  1RI7 A;  4N9I A;  4Q47 A;  3GZ6 A;  2HTJ A;  4GGG A;  4KFC A;  3DPL C;  2OAZ A;  5L3F A;  2EFN A;  1WKM A;  3G73 A;  3T1B A;  1ODD A;  2KIF A;  3BPV A;  3KE2 A;  4I7H A;  4A2U A;  2UZK A;  1LQ1 A;  4EJV A;  4AIJ A;  2XVC A;  4LB5 A;  3TO6 A;  3P7N A;  5D8K B;  5DD8 A;  2XAF A;  1R1V A;  4CHU A;  2QQ9 A;  3F23 A;  1D3Y A;  4ESJ A;  3I0T A;  2HS5 A;  4M74 A;  3COA C;  4HQE A;  2HKX A;  2VBZ A;  2NNN A;  3F8M A;  4BNC A;  4I02 A;  1Z6T A;  4PCQ A;  1OPC A;  2OBP A;  3JSO A;  1KU7 A;  5ICC A;  4EJW A;  1FBQ A;  4M72 A;  1SD5 A;  1S6L A;  1ZAO A;  1XMA A;  3GUD A;  4HLX A;  5LEJ A;  2STT A;  2FNP A;  4GYG A;  2ZBK A;  1P6R A;  1R5G A;  3BRO A;  4ZZD A;  1SFX A;  3WTZ A;  1EH8 A;  2VOP A;  1T98 A;  3KET A;  2RN7 A;  3ERE D;  1WRJ A;  4EGZ A;  1HKQ A;  3DQV C;  4M73 A;  3PQK A;  3P9K A;  1U5T C;  4G6D A;  1SD6 A;  5FB2 A;  4KT5 C;  1HKT A;  2ZO4 A;  1KU2 A;  4RGX A;  2LSO A;  2QVO A;  1JXS A;  4OIO F;  4HYE A;  5HDN A;  2DPD A;  2IA0 A;  1D5V A;  1O3R A;  4KMU X;  1YS6 A;  2OD5 A;  4XSZ F;  2PMH A;  2H94 A;  5FO5 A;  5DCM A;  1UCR A;  1YTY A;  1IW7 F;  5FD5 A;  4IVN A;  3I71 A;  1P4X A;  2F2E A;  5IT3 A;  2WC2 A;  2YU3 A;  4LMY A;  2EFO A;  4U0W A;  3RKX A;  1QZZ A;  4A5M A;  1L3L A;  3CLO A;  2EA4 A;  1RUN A;  1IRF A;  3KEQ A;  3N97 A;  4KDP A;  4EQQ A;  2E1N A;  1UFM A;  4KN7 X;  3FZV A;  1TLH B;  3K1N A;  5LGN A;  1XGN A;  3L9F A;  3GF2 A;  4L9T A;  5JI6 A;  3ABT A;  2W24 A;  1LNW A;  4ESB A;  3WTW C;  5ICG A;  1SFE A;  2DK5 A;  2PN6 A;  5CJ9 A;  4CYD A;  1UB9 A;  1Z05 A;  2VN2 A;  1W7P A;  3E5Q A;  2VT2 A;  3OV8 A;  3J80 Z;  2P7V B;  3WTS C;  3MZH A;  3FXQ A;  1KU9 A;  3WGG A;  3JW4 A;  2LNB A;  4I0B A;  5JVT A;  3CO7 C;  3P9I A;  4OMY A;  3SQN A;  1Z91 A;  3TGN A;  2JZY A;  3VEP A;  2C6Y A;  1FX7 A;  1YG2 A;  3QPH A;  1G4D A;  1T38 A;  3E6B A;  2IRF G;  3Q9V A;  5K1Y A;  1Z1D A;  1IN6 A;  2P6T A;  1Q1H A;  4ENN A;  2ETH A;  3HSR A;  1YW8 A;  2VE9 A;  1FBS A;  1LDK B;  3MZY A;  3DPT A;  4P9U A;  3GEZ A;  2QM3 A;  2BYV E;  1B6A A;  1PP8 F;  1R1T A;  3LA2 A;  5LGU A;  1ZRF A;  2CGP A;  3KEO A;  4GCV A;  1XDU A;  2ZJ2 A;  3BP8 A;  2O6G E;  2CSO A;  4Y15 A;  2PBI A;  2EFQ A;  3TDZ C;  5LLQ A;  2L3D A;  3WE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...