3WE2A

Structure of blm rqc domain bound to a phosphate ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
TRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bloom syndrome protein
publication title Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3we2A00
4YIFA 2DFIA 5D5UB 5ICCA 3V7SA 2ZBKA 2JT1A 1MKMA 3WTWC 2IW5A 2JPCA 1RIOH 3JAMZ 1X3UA 3F8BA 5JVTA 3I54A 5L3GA 4U0YA 3GZ5A 2BV6A 4RB2C 3WGIA 2P7VB 5L3EA 1L3LA 1DPUA 4AIKA 2EFQA 5K1YA 2IP2A 1FSEA 2E7XA 5FLXK 2G9WA 3NEUA 2Q0OA 3R61A 4CZZA 3WGHA 1OYYA 3E5QA 3RIRA 4IHTA 3J7AO 2E7WA 1ZGJA 2HKXA 3GF2A 4M9XA 1IN5A 3HRUA 2HYFA 5L3CA 3F23A 3EDPA 3NRVA 4ZYEA 5LEJA 1IW7F 3HTUA 1RZ4A 4ZH4F 3OOPA 2M87A 3LA7A 1FP1D 2GQQA 2ZJ2A 1H0MA 2D1VA 1OMIA 1FBSA 3M7GA 2DU9A 1Z9CA 3K1PA 3L09A 4LGWA 1U8RA 4WXCA 2CSOA 3EETA 4N0BA 1S29A 1E2XA 1SFXA 4WK8F 3FM5A 3LFKA 2D1HA 2CYYA 1ZG5A 1LDJA 4EM1A 4EQQA 2OA4A 3SQNA 3T8TA 4RGXA 1XB4A 3WTYC 4A0XA 1K7AA 4FHTA 5CVRA 4KDPA 1H9GA 1R1UA 3DKWA 2FF4A 4KT5C 1KU3A 5ED4A 1RI7A 3M1EA 2FMLA 1WKMA 3LSTA 2Z9OA 3CLOA 1S6LA 1QPMA 2VE9A 1LDKB 5AIQA 1HQCA 1KYZA 1TQIA 1P6RA 1UB9A 5L3DA 3W6KB 2DTRA 2L4MA 2W24A 1RNLA 2FNAA 1TNSA 3F8MA 2VC1A 3P9KA 1PDNC 4IPAA 1YLFA 3RDIA 3J81K 4L0ZB 2GA2A 1XGMA 4AVPA 4U7DA 3U9GA 5BMZA 2ADUA 2BEOA 4Y15A 2EK5A 3ZMVA 4M71A 5HS9A 1QZYA 2NNNA 3HHGA 2RV8A 2L01A 4CYDA 3FZVA 1JHFA 4EM0B 5K5OA 3ROUA 1YQAA 3D0SA 4KA4A 1TQPA 1UFMA 2KRFA 3WTSC 2HQNA 3I4PA 3GLXA 2EFPA 2ZMEB 4LB6B 5LLQA 3I71A 2Z99A 3FWEA 1CF7A 3W6JB 1Z05A 4KNYA 5ERIA 4A5MA 3ZQ7A 1J0RA 2EV6A 2NNYA 2JTVA 1V4RA 2JPBA 4L0YB 3DFGA 2GXGA 3VEPA 4WXDA 2KIFA 3K1NA 1XD7A 2R7FA 3QPHA 2VBZA 2CFXA 2XKOA 5LGUA 3DXJF 5CVIA 2FMYA 4AIHA 3ECOA 4P96A 2M30A 2RGVA 2COMA 4BHCA 3TOBA 2X0LA 2LSOA 2OD5A 4ZZDA 4RGRA 3QU3A 1PP7U 4U0WA 3K0LA 5ILUA 1KU2A 1P4AA 2HTSA 1Z91A 3BJOA 3QRFF 2J5PA 4PCQA 3GVAA 2QUFA 2QWWA 2IPQX 2GA1A 4G7ZF 4RGUA 1P4XA 2IT0A 2PI0A 3HTSB 2XAFA 4IVNA 3WODF 3HOSA 2E1CA 1QZZA 4WF2A 2H6BA 1HSTA 2F5FA 3BJ6A 2P7CB 4ZYDA 2L3DA 1TTYA 2W57A 2DK8A 4LG0B 2IA0A 3WE3A 4I0BA 4M6YA 1USSA 2ZMEA 1BI3A 2ACJA 1U78A 3R0AA 4G9YA 2DI3A 4IRIA 2PMUA 1STZA 4OMZA 5CVJA 2JZYA 4KUMA 1MDMB 2HS5A 3MZHA 4UNOA 1SD4A 3DPTA 5LBQA 3O2PE 4LD5A 2PBIA 4L5JA 1DDNA 4KN7X 4HF0A 4GCVA 4GYIA 1B1BA 4EV0A 1KYWA 4L9NA 4IF4A 1DPRA 1G3TA 2VBYA 4XSZF 1EH6A 3G73A 4WX9A 4JQFA 5DV5A 4HX4A 1S3JA 1O3QA 5J6XA 3M9AA 2FXAA 5FD5A 2VT3A 1W4MA 3CDHA 3DQVC 4IJAA 5L3BA 3KP4A 2F5EA 2VONA 4PGGA 2BGCA 2G7HA 5D4RA 3F72A 4WWCA 3R60A 4YFNF 3L2CA 2MLGA 1ULYA 2Z3YA 1E17A 5BPIA 1IN6A 3EUHA 3H92A 4PZJA 3CTAA 3RKXA 3L7WA 4ENNA 5IT3A 2DAOA 3CJNA 4P55A 2RQPA 4UXNA 5J8FA 3KP7A 2V1DA 4EJOA 3ULQB 5E18F 5H20A 2JSCA 1IXSB 2ZKZA 5FLXZ 5FD6A 2LDUA 4UHTA 2P5VA 2QQBA 1O7LA 4I7HA 3E5XA 4D0PA 4LG0A 1ZAOA 5BS6A 2CO5A 2PN6A 5BOXA 5KVRA 3F6OA 4S05A 2ETHA 3LAPA 3R6SA 2YR2A 2RVCA 3JSPA 3I5UA 4Q47A 3HYIA 2EFWA 3TDUC 2ELHA 3QAHA 3HRSA 1FX7A 3P9IA 2DPUA 1BIBA 3N97A 1BI2A 1LEBA 2QVOA 4KN4X 1XN7A 2HTJA 3ERED 1B9MA 4NHJA 2K86A 3FXUA 3REOA 4E70A 3J80K 4HLXA 2BE5F 1GVJA 1ZLJA 5JHUA 3LQRA 4ENMA 4FX4A 5F64A 1XDUA 5JI6A 1JE8A 2STWA 4ENJA 4U88A 4A2UA 1IUYA 2UXNA 3TQNA 1TBXA 3BY6A 3TOAA 2M5WA 2ISYA 3MFKA 4UVBA 4A6DA 4HZFA 4P9UA 5A2QZ 5D8KB 3V7CA 2QZ8A 5H6RA 1HSJA 1BC8C 3G3ZA 4HV6A 2OBPA 1J59A 3KP5A 1BC7C 2WV0A 4LK0F 4YFKF 5CVVA 1LQ1A 1R22A 2P6TA 1IRGA 2QM3A 4M74A 3WE2A 2M1BA 2A07F 1I1GA 5LHIA 5E8GA 3SZPA 3U1DA 2FQ3A 1BIAA 2ZCWA 2ZNZA 1VTNC 1FP2A 2GWRA 1U2WA 5JFRA 2A61A 4ETSA 3ZP5A 5FB2A 4EM2A 3HOTA 3WU0A 1R58A 3P7NA 4Q48A 2V6CA 2G7UA 1I6XA 1T6SA 3EYYA 3GWZA 3K1MA 1Y0UA 4IRHA 4KIFA 3HSRA 3BJAA 2DQRA 2CQKA 2XRNA 1LJ9A 3I59B 2MBFA 2O3FA 1XDSA 3E6CC 2P5KA 1KU9A 1HW5A 4OU0A 1CF7B 2Q2EA 3IWZA 5ILVA 4H0EA 4NQWA 4MEYF 5CYVA 3SHFA 2DPDA 1I1SA 3OV8A 2NRAC 3LA2A 2QYOA 3FXRA 2QQ9A 3FMQA 2HFHA 4M73A 2HGCA 3M8EA 3T5XA 3TGNA 1W7PD 4KIGA 1OPCA 2CG4A 1YS7A 3IL2A 1YYVA 2P4WA 2FNPA 1ZRDA 2IA2A 3CUQA 2J5OA 1R00A 1BOAA 3MAJA 2CW0F 4RGSA 3ZN1A 2OQRA 3Q9VA 1KQ8A 1R1TA 5LHGA 1YIOA 2Z5UA 1KQ0A 2ZO4A 4U7BA 5D6EA 1F4KA 1IF1A 5IT9Z 1OYIA 1R7JA 2VN2A 3FM3A 2HOEA 3ZMUA 3SZTA 3RI4A 2GXBA 4RB3C 1MJAA 3ZN0A 5AIPA 3R0JA 1U5TB 3I59A 5HDGA 3JAMK 3GFIA 3B73A 4KICA 3LAJA 2EV0A 1MJ9A 2IRFG 1FNNA 2XV4S 3V8LA 3KZZA 3E97A 1ZG1A 2F5DA 3F21A 1V3FA 5LEKA 1XMKA 1IN8A 4I98B 1MGTA 3MZYA 2XASA 2FBKA 4I02A 1AOYA 4A6EA 2O03A 1ZGAA 4AIJA 3ABUA 4M6XA 5LGTA 2FBIA 1JXSA 2HZTA 4FT8A 5K5RA 1G3SA 1FPQA 2XAQA 4M9ZA 4AWXB 2O6GE 3R4KA 3Q5FA 4NB5A 3DPLC 5LRSA 3DP7A 2O0YA 4KIBA 1KA8A 4BYYA 4OMYA 1B9NA 4BAYA 4CDGA 1SD6A 3V7RA 2VXZA 2FE3A 2VBXA 4GXOA 4EGYA 1ZRFA 1EV7A 3QP6A 4BXUA 4KYWA 3HSEA 4OIQF 2HQRA 4IHSA 1QQIA 2H94A 3C18A 4HDVA 1ZH5A 1YW8A 1B4AA 3KLNA 3HRMA 3HIFA 5DEQA 4CXFA 1LVAA 3JSOA 4DQ2A 3K9TA 3WTZA 4XRFA 4ESBA 1R1VA 2RN7A 1U5TA 2XAGA 5J8CA 4B8XA 4RB0A 3F22A 1YFHA 1NHAA 4BQAA 4PDKA 2A6EF 4L9VA 4JK1X 4GO1A 1B6AA 3L9FA 4LLNA 3LQQA 2DBBA 2XKPA 2EA4A 3ZMZA 1SD5A 3GO5A 3GEZA 1FOKA 1FLIA 1Q1HA 2ZXJA 1S7AA 4L18B 4WXHA 3HRTA 1I5ZA 4ASNA 4Q4ZF 2QLZA 1KU7A 1FT9A 4OIPF 1SMTA 3WGGA 3JW4A 2L4AA 4GYGA 1R23A 5ICFA 3GXOA 3E5UA 1TW2A 1I27A 2K7LA 1GXPA 1U6GA 4GGGA 1C0WA 3T8RA 1S8NA 3NQOA 1TLHB 3FXQA 1G4DA 2LF8A 3P9CA 2GAUA 5BPDA 1FYLA 1GHCA 3ZMSA 3ECHA 2OAZA 3IKVA 1ZG3A 4L5IA 1U3EM 3MQ0A 3BOQA 1K79A 3IRQA 1FY7A 4EVIA 2PQ8A 1G6NA 1O57A 3BP8A 2H09A 4M72A 1HBXG 2UWMA 5FGMA 2QBYB 1TNTA 3ZPLA 3CO7C 3VODA 3H3ZA 4FX0A 3KP6A 1ZHFA 4LJZF 4MHGA 3GZ6A 1ZN2A 1S7OA 3QPTA 5ICGA 6PAXA 1B59A 4HQEA 3CUQC 4UV8A 1YO5C 3ISPA 1ODDA 5D5WB 3RPQA 4P9FA 2VOOA 4LLLA 2BYVE 3QP5A 1UHWA 1Z7UA 2IVMA 4G6QA 3VOEA 1D8KA 3JTHA 4I0AA 1FBUA 5F1RA 1HKQA 2DW4A 1G3WA 2E1NA 2XUBA 3ABTA 1RUOA 2EV5A 3F6VA 3CUOA 1W5TA 5LHHA 1LB2A 2W25A 3RYRA 5FFZA 3KEQA 2UXXA 2ISZA 4RS8A 5E17F 1Z6TA 3AAFA 4XSXF 4OIRF 1T39A 2NYXA 4MTEA 3TO7A 1TW3A 1W7PB 1W5SA 5E20A 1MJBA 3KP3A 1K78A 3LWFA 1ONVA 3V8KA 2FA5A 1SFUA 2OQGA 5D6FA 1FZPB 2LF7A 1Z6RA 2EJRA 3GW2A 4HV5A 3DF8A 1FYKA 3FMRA 1P4WA 3MCZA 2MA3A 1QO0D 5E1ZB 3GUDA 2UZKA 1WQ2A 4G94A 4EJVA 4ZYGA 1G3YA 4MEXF 3K69A 1YW7A 1USTA 2QBYA 2RNJA 3V4GA 3WU1B 3DV8A 1T38A 3MEXA 3J81Z 3RKYA 1P92A 2DLLA 3CUQB 5HDKA 4L9TA 4MNUA 5D8LB 2A69F 4LB5A 2FRHA 3ZMDA 2YX7A 1FBQA 2MLKA 3BROA 1XCVA 5LGNA 3FMSA 2P5LC 3KEOA 3F8FA 2STTA 1BM9A 5FFXA 2H6CA 2A68F 4CGZA 3VFZA 2YU3A 1XMAA 2Z33A 2WTEA 1WRJA 2V9VA 2CGPA 4QLCU 4RB1A 2VBWA 5ILSA 4S04A 4KFCA 1WI9A 4OIOF 1ZYRF 2Y0MA 3KFWX 4A12A 3C1DA 2YSRA 1U5TC 1ZLKA 4MGRA 2O8XA 1LEAA 2KIUA 4UV9A 4EMSA 4XBFA 4JBAA 3LA3A 4G6DA 1FWZA 1PP8F 1W7PA 1K6OA 2A6HF 2V1UA 1QNTA 3T0YA 4HDUA 5HVQC 2XVCA 1IRFA 3KP2A 4N9IA 4EJWA 1PUEE 4Q5SF 1D3YA 1J9IA 4R79A 3TDZC 1FYMA 4EJUA 3RYPA 5DCFA 5HLHA 3GYHX 5CJ9A 4A5NA 1OKRA 3N4MA 1FC3A 1YW9A 3FF5A 2A3SA 2IJLA 5HDNA 1BN5A 4HAMA 2EFOA 2YX4A 2HWVA 2W85A 2L54A 4BNCA 3JTGA 2FOKA 5H6QA 1R5HA 5HOOA 3L00A 5A2QK 4R1HA 2PLYA 2HDCA 2ESNA 2NS0A 1AWCA 1F5TA 2EWNA 5L3FA 5DCMB 4XLPF 2HR3A 3CO6C 1XGNA 3RKWA 1YTYA 4PGHA 5DD8A 3RPUA 2XAHA 2X4HA 2VC0A 3GFMA 2OZ6A 3BDDA 1HW2A 1XSXA 4ON0A 3E6DA 1T98A 4P5OA 2VE8A 4ZYHA 2R3SA 2PMHA 2BBYA 1XGOA 4Y17A 2KJBA 4LLGF 5BQTA 2VODA 2RDPA 3I53A 2KIMA 3I58A 3WTUC 2Y75A 4CO8A 3FX3A 1EH7A 4KMUX 5KK1A 1H9TA 1EH8A 1DP7P 1ZRCA 4G7OF 2FEZA 4CICA 4Y13A 3C7JA 5DYMA 5JR3A 1L0OC 4A0ZA 2GZWA 1IAWA 4KMFA 4U0VA 2PG4A 1J7KA 2RC4A 2R7DA 5D5VB 2VOPA 5E1WA 3GX4X 5F6FA 1BJAA 5DUKA 2ZFWA 3PQKA 4MQ9F 3KE2A 2WC2A 1ON1A 2ESHA 3HUGA 5ICEA 4MQVA 5TRDA 2D45A 4EJTA 4HOBA 1J75A 3F8NA 1R5GA 4ESJA 4HX7A 4G7HF 2XROA 2DO7A 5FO5A 2B0LA 2PFBA 5K5QA 5DCMA 4F7ZA 4HF2A 3ELKA 3QU6A 3IC7A 1BI1A 2MD5A 4LFUA 4IXAA 3SXYA 2K4JA 2HEOA 2DQLA 3ML6A 1JGSA 1ON2A 3O6BB 3V8JA 4BHPA 2GIVA 2H27A 1BBYA 1MZBA 2K02A 2XHKA 2C6YA 4LK1F 2ZNYA 1J5YA 2AS5F 4XLNF 3I0TA 5IT9K 1SD7A 4M9SA 3FHZA 1IN7A 1IXCA 1R36A 2CWEA 3C3WA 3KLOA 1ZREA 5CVUA 2OZUA 1Z1DA 4Z2YA 4AD9A 3J80Z 4ENKA 1KGSA 1MD0A 2W84A 4K2EA 1O3SA 3DEUA 4OINF 3QOPA 1ZARA 4OOIA 2OU2A 1XSVA 2NAZA 1OR7A 5AONA 3U2RA 1XSDA 1T2KA 1J2XA 4HBLA 1GXQA 4I2OA 4QWQA 3IHUA 3EYIA 3O3KA 4UVCA 1OYWA 2HKOA 2MH2A 3VB2A 2LNBA 2L02A 1DUXC 3E3VA 1QBJA 1TQMA 3SFZA 2F5CA 1O7FA 1K78B 3GFJA 1LNWA 3RTRA 1WWXA 2F2EA 2XAJA 3HSFA 4N9HA 3MWMA 4O6JA 4HA8A 3WTXC 1WSUA 5EEGA 1CGPA 2M8EA 1HKTA 2KJCA 5DD4A 3KETA 1F9NA 2P6SA 2V79A 1SAXA 4R8HA 5TJJA 2FSWA 4I09A 4EGZA 2TDXA 2XIGA 5D5XB 3K2ZA 2VT2A 2DK5A 1SFEA 4IRGA 2MH9A 4HX8A 5HLGA 3S2WA 2Q8KA 4YIIA 1BI0A 4LMYA 1YG2A 3KCCA 2YPRA 4O5VA 4O3MA 3ZMTA 3TO6A 2M45A 3F3XA 2AXLA 2HYGD 1KQ9A 5HS7A 1T0FA 4TV7A 3PFIA 3PQJA 3TO9A 3T1BA 1UCRA 1FSHA 4HYEA 5DDGA 5HLIA 2XGXA 2LKPA 3BPVA 4B09A 1UHMA 5HS8A 3B02A 3Q9SA 4ZZLA 4MTDA 2V1XA 4A0YA 2QENA 4ESFA 2D2WA 4RAYA 1LDDA 5E8IA 3TKYA 3IRRA 1F1ZA 2KKOA 1MDMA 1JHHA 3COAC 2Y48A 4BH9A 1HW1A 1IXRC 1IZ1A 2P8TA 4DNCA 1YS6A 3WTVC 3IKTA 3BWGA 4BHBA 2FU4A 3WG9A 3M8FA 3WTTC 2PJPA 3BZ6A 3E6MA 4HQMA 2EFNA 4HW0A 1A04A 5E1XA 4G8XA 4CHUA 4YFXF 1D5VA 1XCBA 1HXDA 1IN4A 2A5YB 3F8CA 4RAZA 2DT5A 2EB7A 4UUVA 3D5LA 1P2FA 5LRRA 3H3UA 1RUNA 1XGSA 4WCGA 5DUIA 2FBHA 4HLYA 1D8JA 4YG2F 2IA1A 2QQAA 2PEXA 3KZYA 3GFLA 2MC3A 4HF1A 1QGPA 2WWYA 2EA2A 1REPC 4L9JA 2O61A 1O3TA 1SMYF 4I01A 3E6BA 3RJPA 2RKHA 2K27A 1HKSA 2K4BA 5CLSA 4UVAA 5D4SA 2JRTA 3HHHA 3BPXA 3IWFA 3I64A 3EQLF 1O3RA 5EEHA
chains in the Genus database with same CATH superfamily
3ZQIA 4FE7A 2DDBA 4YIFA 4C9YA 2DFIA 2VJIA 2X6XA 5D5UB 5ICCA 2LMDA 2G0EA 2ZBKA 3V7SA 4F92B 2JT1A 1MKMA 3HZJA 3WTWC 2DTZA 2IW5A 3GTKJ 4UUTA 4XMYA 2VQLA 1N25A 2LBFB 2JPCA 1RIOH 1PJRA 1GV2A 3BC8A 3JAMZ 1X3UA 3F8BA 2V4JC 1XS9A 4FE4A 5JVTA 2QCOA 4DW6A 3I54A 1IG7A 2E19A 5L3GA 4U0YA 3GZ5A 2BV6A 1MH3A 4RB2C 3WGIA 2P7VB 5L3EA 2YS9A 1X1PA 1L3LA 1DPUA 1GUUA 4AIKA 2EFQA 3CF2A 2IP2A 1FSEA 2E7XA 2Q1ZB 5K1YA 2G9WA 3NEUA 1T95A 5FLXK 4II2A 2Q0OA 3R61A 4C2MJ 4CZZA 1QU3A 3WGHA 1OYYA 3E5QA 3RIRA 4IHTA 3J7AO 4L5EA 2V6EA 3HB9A 2E7WA 1ZGJA 1HDPA 1JUPA 2HKXA 2L7FP 3GF2A 4M9XA 3PO3J 2LVSA 1IN5A 3HRUA 2HYFA 3UNGC 2KMUA 5L3CA 3H9GA 3P5JA 3IAS2 3GTMJ 3RKQA 3F23A 3EDPA 3NRVA 4ZYEA 5LEJA 1IW7F 1VF9A 3HTUA 2X1DA 1JI8A 1RZ4A 4ZH4F 3OOPA 1PVEA 2M87A 3LA7A 1FP1D 4A3CJ 2GQQA 3JRGA 2KDOA 4DBQA 2ZJ2A 3L2UA 1WJAA 2ZC2A 3SEQA 2QGUA 1IDYA 2WBMA 1AHDP 1H0MA 3Q3SA 4B3AA 2IGNA 4BKXA 1LKXA 3D1NI 2D1VA 1OMIA 1SAUA 3AKZA 1FBSA 2EZLA 4XL9A 3B6CA 3FIWA 3M7GA 4B4CA 2DU9A 1Z9CA 3K1PA 3K2AA 3L09A 4LGWA 1U8RA 4WXCA 2CSOA 3EETA 4LOCA 4N0BA 1X3WB 1VZ0A 2ZMEC 1S29A 1E2XA 1SFXA 2DMTA 4WK8F 3FM5A 2BZTA 3LFKA 1I50J 2D1HA 2F4IA 2CYYA 1UJ8A 1ZG5A 1LDJA 4EM1A 4EQQA 2ELKA 2OA4A 3SQNA 3T8TA 5DTDA 1OR7C 3ZOBA 4RGXA 1XB4A 2V7FA 4XICA 3WTYC 1QHHD 2DMUA 4A0XA 4V19K 5JHFA 1K7AA 1JKOC 1B8IA 2OC6A 4B43A 4FHTA 4BY7J 5CVRA 2X6WA 3OYBA 2O8KA 4HSRA 4KDPA 1H9GA 1R1UA 2XSJC 3DKWA 2FF4A 4KT5C 3IUOA 3A0BC 3A1YA 2R5ZA 3BR3A 4F91B 3CCMI 1KU3A 5ED4A 2LFBA 1RI7A 3M1EA 1FOXA 3CJQB 1MMGA 2XRLA 2FMLA 1WKMA 3LSTA 4UY8I 2Z9OA 2Y31A 3CLOA 4A3KJ 3H1CA 1S6LA 1QPMA 5FKOA 2IXSA 2GIZA 1LDKB 2VE9A 5AIQA 1G59A 3HEFA 1HQCA 1KYZA 1GT0C 1TQIA 3I9V2 1P6RA 1UB9A 5L3DA 1OCCH 2DMQA 3GZNB 1ETYA 2LBFA 3W6KB 2CJJA 2DTRA 1ETXA 2L4MA 2Y2ZA 3CF5F 2QSFX 2XGCA 5IOYA 5FROA 1YRNB 2W24A 1RNLA 3G4SI 2FNAA 5GPAA 1TNSA 3F8MA 2VC1A 3BTLA 3P9KA 1PDNC 4IPAA 1YLFA 2E1MC 3RDIA 3J81K 4A3BJ 1ZK8A 2HXIA 4L0ZB 2GA2A 1XGMA 4AVPA 3HOYJ 4U7DA 1TWGJ 1Z7LA 3U9GA 4UB6C 5BMZA 1APLC 4IZZA 2ADUA 2LTPA 3JRAA 1YJWI 2BEOA 4Y15A 4GRIA 2EK5A 3ZMVA 3OYDA 4M71A 4P1WA 2JVHA 4CA0A 5HS9A 3OYLA 2QSHX 1QZYA 3IV5A 2NNNA 3HHGA 4BS9A 2RV8A 3ZQQA 2L01A 4CYDA 1U9OA 4BJTA 3FZVA 5FKMA 5IOZA 1JHFA 3DLLF 4EM0B 2CV1A 3A02A 3BT9A 5K5OA 3ROUA 1YQAA 3D0SA 4KA4A 2DFFA 4XRSG 1TQPA 1UFMA 2KRFA 5E79C 3WTSC 2HQNA 4BDZA 3DBHB 3OYFA 3DLAA 3I4PA 1RR8C 3GLXA 3S2DJ 2N8GA 4A3JJ 5FJ8J 4NC8A 3NWSA 2EFPA 3CCVI 3PL8A 4X6AJ 2ZMEB 4LB6B 5LLQA 3HOXJ 3I71A 2Z99A 3CDIA 3FWEA 1CF7A 3W6JB 2DA1A 1Z05A 3HG9A 4KNYA 5ERIA 2KIQA 4A5MA 1WFXA 3CESA 3ZQ7A 1J0RA 2EV6A 3TP3A 2E60A 2NNYA 3IH3A 2JTVA 4XQFA 2X48A 1V4RA 4JOMA 1XTAA 2JPBA 4Y4RA 4L0YB 3HGYA 3DFGA 1FIAA 5K7FA 2GXGA 3VEPA 4WXDA 1WJEA 2KIFA 3F9KA 3K1NA 1IUFA 4IHYA 1Y1VJ 1XD7A 2R7FA 2WB1A 4Y52J 3QPHA 1NG7A 2VBZA 2CFXA 2XKOA 3ZR8X 2E35A 5IPAA 2LH9A 1W36D 5LGUA 1EA3A 5J1YA 2Y0SN 3DXJF 5CVIA 2FMYA 4AIHA 3ECOA 4P96A 1WJCA 2M30A 2RGVA 4I99C 1D0YA 2COMA 4BHCA 3TOBA 2XB0X 1A6QA 2X0LA 2NS7A 2LSOA 3SYTA 4NDLA 2OD5A 4ZZDA 4RGRA 3QU3A 1PP7U 4BGDA 4U0WA 1MNEA 4IL6C 3K0LA 1VNDA 1Z0XA 5ILUA 1KU2A 3JRHA 2JA7J 3JCUC 4AM3A 1P4AA 3DBLB 2HTSA 2OUMA 1P7JA 1Z91A 3BJOA 3RZDJ 3QRFF 2J5PA 4PCQA 2LKXA 1E0EA 2CQNA 3GVAA 1YRNA 2I5UA 2X1EA 2QUFA 4NNJA 2DODA 2QWWA 2IPQX 2GA1A 4G7ZF 4RGUA 1P4XA 2M8GX 2IT0A 2PI0A 3HOWJ 2BY1A 4UB8C 2MSYA 1IC8A 3HTSB 1XX5A 2L7MP 1S72I 5C4XJ 4E7HA 2XAFA 4IVNA 3WODF 3HOSA 2E1CA 3H5AA 5IP6A 2MG4A 1VQPI 1UAAA 2LG4A 1JKPC 1QZZA 4WF2A 2H6BA 2TRTA 1HSTA 2F5FA 3BJ6A 4E7LA 2QEXI 4BY1J 3I4MJ 2O7OA 3DU6A 3TP0A 2CQXA 2W48A 1A31A 2P7CB 3MD2A 3SFIA 3U1KA 4ZYDA 3J7ZI 1ETWA 3W2VA 1YX5A 2L3DA 3KIOA 1F36A 1OCTC 3EUKL 2O5RA 1TTYA 3LSKA 1FTZA 2W57A 2EQRA 2DK8A 3G1OA 3BTCA 5M5YJ 1A5JA 4LG0B 2IA0A 3Q0VA 3CMEI 2HU9A 2ZFUA 3S8PA 3WE3A 4I0BA 4M6YA 4QPOA 3NARA 2I8DA 3LFUA 1USSA 2ZMEA 1BI3A 1KONA 2ACJA 2GM4A 4UUSB 1U78A 2JUCA 3R0AA 3CCLI 4G9YA 2EH3A 2DI3A 2OCEA 2PMUA 2HVSA 4IRIA 1STZA 4OMZA 5CVJA 2JZYA 3ZQHA 4KUMA 1MDMB 3RSNA 2HS5A 1Y8RB 3MZHA 4B48A 3SJMA 1NG6A 1H89C 4UNOA 1SD4A 3DPTA 3MZ8A 5LBQA 3O2PE 3ZRGA 4LD5A 1ZR4A 4JX5A 2PBIA 1UELB 3ABKH 4L5JA 5EF6A 1DDNA 4KN7X 2R93J 4HF0A 4GCVA 1SC7A 4PSXA 1FMVA 1TT0A 4GFBA 4GYIA 2ZJRF 3CD6I 1B1BA 4EV0A 1KYWA 4L9NA 1R5ID 2FUG2 4V2GA 1MMNA 1DPRA 2K3FA 1G3TA 3QYEA 4IF4A 2VBYA 1GDTA 4XSZF 5FLMJ 1JUMA 1WH7A 4E7SA 2W82A 1POGA 1EH6A 3G73A 1TC3C 2JA6J 4WX9A 1VQ9I 4DZJA 4JQFA 5DV5A 1V54H 4HX4A 2XDVA 2R7RA 1DU6A 1S3JA 3M1CA 2VLAA 2IS2A 1VQ6I 1ZGWA 1O3QA 4PJLA 5J6XA 1OJLA 3M9AA 2FXAA 4CZCA 2VJ4A 5FD5A 1LE8B 3CMMA 2VT3A 1W4MA 3CDHA 3DQVC 2V9PA 4IJAA 2OTLI 5L3BA 1T56A 3KP4A 4A3GJ 2F5EA 2VONA 4MO7A 4PGGA 1QPIA 3W3CA 3CQZJ 2VQHA 5DM7F 2BGCA 5EGOB 2G7HA 5B1AH 1MIJA 3S3NA 1WJ5A 2EIMH 5D4RA 4D1QA 3F72A 4WWCA 4A69C 4IOCF 3R60A 4PFOA 4YFNF 2MFZA 2BVMA 3L2CA 2MLGA 1ULYA 1TZLA 2Z3YA 1E17A 2NOGA 5BPIA 3DKYA 1IN6A 3EUHA 3H92A 4PZJA 3CTAA 3RKXA 3L7WA 3QYBA 1EKEA 3A0HC 4ENNA 5IT3A 2DAOA 3CJNA 4P55A 2RQPA 4DBRA 4UXNA 4XM3A 5J8FA 3KP7A 3I3LA 2V1DA 4M3FA 3G1LA 3ULQB 1JT6A 2QQ8A 4EJOA 5E18F 4H4KC 5H20A 4I6ZA 4IOAF 2R0QC 1SVOA 2JSCA 1DU0A 1IXSB 2E5ZA 2IAIA 1JKRC 1EF4A 2ZKZA 1X19A 5FLXZ 5FD6A 3S3MA 3S1RJ 2LDUA 4ZDLA 1WI3A 4UHTA 2AHQA 3EUAA 2ZB9A 2OPTA 2P5VA 5F0CA 2QQBA 2VUMJ 1O7LA 1G8XA 1BR4A 2VKEA 1GV5A 4I7HA 3E5XA 2GXAA 4D0PA 4LG0A 1ZAOA 5BS6A 2CO5A 2Z1DA 2PN6A 1W5CC 4EATA 3BG5A 5BOXA 5J1RA 4XRMA 5KVRA 3F6OA 3J7AY 4BJ5C 2LP0A 4S05A 1PUFB 2ETHA 3LAPA 3GCMA 2YR2A 3R6SA 2RVCA 2IGMA 3K7AJ 3JSPA 3C2HA 2M0CA 4FISA 3I5UA 1OCOH 1WJBA 4Q47A 4G12A 3OSFA 3CP8A 4PFPA 5GAEJ 3HYIA 1R4MB 3S1MJ 1ERDA 2EFWA 5IP7J 3TDUC 5FRNA 2ELHA 2CU7A 3QAHA 1FEXA 5HLTA 2K9SA 3HRSA 2BOLA 3W2WA 1FX7A 2DMPA 3DKXA 3P9IA 3H9JA 2DPUA 1BIBA 3N97A 2EZIA 1BI2A 5FKNA 1LEBA 2QVOA 4KN4X 1U9NA 1XN7A 3S16J 4BQNA 1UZCA 1W1WE 1X1BA 2WAQN 2HTJA 2KQRA 1X1DA 3VSKA 3CCUI 3ERED 3TMOA 1B9MA 4NHJA 2K86A 2TCTA 2NVUB 3FXUA 5FLVA 3REOA 4E70A 3QPSA 3J80K 3O8GA 4HLXA 2BE5F 1ETOA 1GVJA 1ZLJA 5JHUA 3AG2H 4D7NA 2BY2A 2Q2EB 2KLOA 3LQRA 1RR7A 3ZCOA 5HNFA 4IX7A 4ENMA 4ZDOA 1R9TJ 4FX4A 1LE8A 3ZQGA 5F64A 4NQWB 1XDUA 4J01A 2CV0A 5JI6A 1JE8A 2K85A 2STWA 1RC9A 5C3EJ 4ENJA 1YHQI 4MIMA 3O8HA 4U88A 2CUEA 4F3QA 2XGDA 1TWCJ 3H36A 4DYRA 2M7AA 4A2UA 1W36C 1NK2P 3HPHA 2ZXWH 1IUYA 2UXNA 3TQNA 1TBXA 2CQQA 3BY6A 3TOAA 2M5WA 4BQQA 3HOVJ 2ISYA 3MFKA 1B8IB 2OV7A 4UVBA 4A6DA 4HZFA 1IRXA 3OR2C 4P9UA 3TW6A 5A2QZ 5D8KB 3V7CA 3DBRB 2QZ8A 5H6RA 1HSJA 1X1CA 3PFYA 3ASNH 1F43A 2R5ZB 1BC8C 3G3ZA 4HV6A 2IGKA 2OBPA 1J59A 3KP5A 1BC7C 2WV0A 1AU7A 4LK0F 2HPMA 1CQTA 4YFKF 5CVVA 1LQ1A 1R22A 2P6TA 1IRGA 2QM3A 4M74A 2E1OA 3Q0WA 5EZGA 2M1BA 3WE2A 3LMMA 2A07F 1I1GA 5GP9A 5LHIA 1W0UA 5E8GA 3SZPA 2IS1A 3CJTB 3U1DA 2FQ3A 3JREA 1BIAA 2ZCWA 3M07A 2ZNZA 1FP2A 1I3AA 2GWRA 1VTNC 1U8BA 2DXIA 1U2WA 2M4KA 5JFRA 3S17J 2A61A 4ETSA 3ZP5A 4BXXJ 5FB2A 1PUFA 4EM2A 3B6AA 1RRJA 3OYIA 3PUBA 5F1JA 5GTIC 3HOTA 3WU0A 3S14J 5HNHA 1R58A 2ID3A 3KEYA 3P7NA 5HODA 4PK4A 4Q48A 2DT7B 2V6CA 4BE2A 2G7UA 1I6XA 5TGTA 1T6SA 2VI6A 3EYYA 1WGXA 3GWZA 3GTGJ 4HEA2 3K1MA 1Y0UA 2PMZN 3HDDA 3S1NJ 5F27A 4IRHA 4KIFA 2E2IJ 3HSRA 2Y9YA 3BJAA 2JA2A 4IEJA 3E0JB 2DQRA 2CQKA 3QOEA 5E3NA 1B72A 4RLQA 4A3DJ 2XRNA 1Y8QB 3PIPF 1LJ9A 3I59B 2L7ZA 3ZQLA 2MBFA 5M3MJ 2LREA 3MVPA 3OYHA 2O3FA 1XDSA 3GTPJ 3S32A 3E6CC 3RQIA 5M3FJ 2M0MA 2P5KA 1KU9A 2DA4A 4DOZA 2NS8A 2PMZA 4C2TA 3DTIA 5M5WJ 4XKVA 1HW5A 4OU0A 3NAUA 3VYUB 1CF7B 3C2GA 4XNFA 2Q2EA 3IWZA 3BR0A 3JR9A 1GLNA 5ILVA 2UV1A 4H0EA 2R7UA 2HPIA 3FXLA 4NQWA 1VQKI 4MEYF 5CYVA 3SHFA 2DPDA 4B44A 1I1SA 2R7VA 3ABMH 3OV8A 2NRAC 2CFOA 1TWHJ 1TL8A 1LVKA 3LA2A 4JX6A 2QYOA 1V5FA 2EINH 1VI0A 3GTLJ 3FXRA 3OYCA 2QQ9A 3FMQA 3X2QH 3HJEA 2HFHA 4M73A 2HGCA 3M8EA 3T5XA 3TGNA 1W7PD 3K4JA 4C30A 5GADJ 1VQ5I 2EZKA 2F4MB 3DEWA 4KIGA 5CQGA 2KT0A 1OPCA 3DTKA 4CSWA 2CG4A 1YS7A 3OL4A 3IL2A 1YYVA 2CUJA 1Z67A 2P4WA 1GVDA 1P9QC 3OYKA 2FNPA 1ZRDA 2IA2A 4BU2A 3CUQA 1Z3XA 1PYVA 4M3GA 3DPUA 2J5OA 3G2BA 1R00A 1BOAA 3MAJA 3ASOH 2CW0F 3BTJA 4RGSA 3CDLA 1XC5A 3ZN1A 2OQRA 3Q9VA 1KQ8A 2R7WA 4J19A 2MC4A 1R1TA 5LHGA 2MW8A 4PJJA 1YIOA 2Z5UA 2IBDA 2BHZA 2ME6A 3BG9A 2GLOA 2DJIA 1KQ0A 2ZO4A 4U7BA 1BW6A 5D6EA 1F4KA 1FIPA 1IF1A 5IT9Z 2Y30A 3S15J 3PSFA 3KX2A 1OYIA 4JP0A 2V1NA 1XG1A 1R7JA 2VN2A 1N77A 2LLKA 3FM3A 2HOEA 2JA8J 3H35A 5BNGA 2KP6A 3IP4B 4IHVA 2F4OB 2Z2SB 3ZMUA 3BCBA 1ITYA 4B1RA 2EIJH 3EUHC 2HOSA 2DMNA 2HVRA 3SZTA 2M9HA 4XLCA 3RI4A 2GXBA 4RB3C 1MJAA 2PX9A 3ZN0A 5AIPA 3R0JA 1U5TB 3A4CA 3L1PA 2IS4A 3I59A 5HDGA 3JAMK 3GFIA 2LR8A 9ANTA 2HNHA 3B73A 4KICA 5FKKA 3MMYB 3LAJA 3AL0C 3M8JA 2EV0A 1MJ9A 2IRFG 1FNNA 2DOEA 2XV4S 3V8LA 3CCEI 3KZZA 3E97A 1ZG1A 2F5DA 4NC7A 1BOBA 1MBEA 1V3FA 3LOCA 3F21A 2XPUA 1IGNA 5TISC 5LEKA 3GTOJ 3LNQA 4HPQA 1XMKA 1IN8A 1OCRH 3HKZN 4I98B 1MGTA 3MZYA 5EEAA 2XASA 4JX4A 2FBKA 4I02A 2JVGA 4AIDA 1AOYA 4A6EA 3RPUD 2VPRA 2O03A 4CCNA 3JRIA 2JMWA 1ZGAA 1ZTRA 4AIJA 4XONA 3ABUA 4M6XA 5LGTA 2FBIA 1JXSA 2RAEA 2HZTA 2XGEA 3H0GJ 4FT8A 2XC7A 3PNYA 1YJNI 1XPXA 5K5RA 2LY9A 1FTTA 1QVUA 2R7OA 4II3A 5GAGJ 1G3SA 1FPQA 4E4HA 2VB6A 3OS0A 2XAQA 1MMAA 4M9ZA 4AWXB 1X58A 1BW5A 2JK3A 2O6GE 2W1OA 3R4KA 2WADA 1D1AA 3Q5FA 2FQ4A 4NB5A 4XRSA 3DPLC 1IDZA 5LRSA 3IH4A 3DP7A 2O0YA 2KHMA 4KIBA 1KA8A 4BYYA 4OMYA 1B9NA 4BAYA 3FXJA 2E34A 4J00A 1LPQA 4CDGA 1SD6A 3ERMA 3V7RA 5DS9A 3L2VA 2VXZA 2FE3A 2VBXA 4GXOA 5M5XJ 3DEEA 4EGYA 1ZRFA 1EV7A 2Y0SA 2CV2A 3QP6A 3BR1A 3TL4X 4BXUA 4KYWA 3S93A 3HSEA 3G1MA 3D5RC 1ZELA 4CUGA 4GDFA 1E3PA 1VQ4I 4OIQF 2HQRA 3MKZA 3J7YJ 4IHSA 3U21A 1QQIA 3C2BA 2KDZA 2A05A 2H94A 4BDYA 3C18A 1ENHA 4HDVA 1ZH5A 4ZDPA 1YW8A 2ECCA 4MFEA 2JWTA 1B4AA 2VXDA 3PUFA 4D7MA 2M2EA 3KLNA 3HRMA 3QQAA 3HIFA 1LFUP 5DEQA 4CXFA 1LVAA 3JSOA 4DQ2A 3OL3A 2KZGA 3K9TA 4YEJA 3WTZA 4XRFA 3AL0B 4ESBA 2X6OA 1R1VA 3VYRB 1OQYA 2KL4A 3DWLE 2RN7A 1U5TA 2XAGA 5J8CA 3OYNA 4B8XA 4RB0A 3F22A 1JJ6C 1YITI 1YFHA 4XR6A 2CQ7A 3EPZA 1O4XA 1NHAA 3RCOA 4BQAA 4PDKA 2A6EF 4C3IJ 3WHBA 4L9VA 2V9KA 2L9VA 4JK1X 1R71A 2LC2A 2L5QA 3E1SA 4MLOA 4GO1A 2LRDA 3WG7H 1B6AA 5K7HA 1I6HJ 3L9FA 4QSHA 4LLNA 3LQQA 2DBBA 3ZGKA 2XKPA 1YOVB 2EA4A 2AQFA 3ZMZA 1ETQA 1SD5A 3HPGA 1NTCA 1MSEC 3GO5A 3GEZA 1FOKA 1DGWY 1FLIA 1Q1HA 2ZXJA 1S7AA 5DM6F 3FXMA 2BVLA 1VQNI 4L18B 2VKVA 1UG2A 4WXHA 3HRTA 1UMQA 1I5ZA 2YUSA 4ASNA 2EZHA 3FDYA 4CCOA 4EEFG 4Q4ZF 2HOTA 2QLZA 1KU7A 1FT9A 4OIPF 1SMTA 3WGGA 3JW4A 2L4AA 4GYGA 1R23A 5ICFA 1A36A 1OLTA 3GXOA 3E5UA 4IKFA 3CJRB 1TW2A 5KAFC 1I27A 4QIWN 1DP3A 2KZVA 2K7LA 1GXPA 2NVXJ 1U6GA 4GGGA 3DTEA 4X1EA 4LIUA 1C0WA 3T8RA 1S8NA 2QSGX 3NQOA 5F04A 2GOXB 3K4NA 1Z3YA 2ZJQF 1TLHB 3FXQA 4OAYA 4BBRJ 1G4DA 2LF8A 2HDDA 2DN0A 3P9CA 2F5VA 3PSIA 4C3HJ 2GAUA 3H3VK 2JUGA 5BPDA 1X3ZB 1FYLA 4ZJZA 2DOFA 1GHCA 3ZMSA 3ECHA 1K61A 2OAZA 3IKVA 1X1AA 1ZG3A 3VSLA 4L5IA 4D9JA 3MKWB 1U3EM 2HYJA 3MQ0A 4C3JJ 4XN3A 3GLLA 5J4YA 4DZPA 1D1CA 3BOQA 1K79A 1HCRA 3IRQA 1MMDA 1FY7A 1AKHB 2HQAA 2A6TA 4EVIA 2PQ8A 3N05A 5B1BH 1G6NA 1O57A 3BP8A 1TT5B 3NWTA 2H09A 4M72A 1HBXG 5JLXA 3M4OJ 2UWMA 5FGMA 2QBYB 2LKSA 4RA2A 3QODA 1QA6A 4NUBA 2MABA 1TNTA 3ZPLA 3CO7C 1EJ9A 2R7ZJ 3VODA 2DA6A 3H3ZA 3FKIJ 4FX0A 3A01B 4YRVA 3KP6A 1R4NB 4AYBN 4E7ZA 1ZHFA 4LJZF 2K3PA 1MBFA 3AFHA 3BQZA 3KYDB 4MHGA 2W7NA 5GAHJ 3GZ6A 1ZN2A 4BE1A 1S7OA 2KFDA 4F93B 4DIQA 3QPTA 3HOUJ 5ICGA 2XB5A 6PAXA 1B59A 4HQEA 2DA2A 3CUQC 1Y1WJ 4UV8A 4V2FA 1YO5C 3ISPA 5F08A 1ODDA 4DJAA 5D5WB 3CMYA 1MNDA 3FBIB 3RPQA 1VQ7I 4NBQA 3FK7A 4P9FA 2VOOA 4OWRB 1HDDC 4ABZA 4LLLA 2BYVE 3QP5A 2K40A 1UHWA 1Z7UA 1T8IA 2IVMA 3SEZA 2RREA 4G6QA 1K4SA 3VYTB 3VOEA 1HF0A 1BL0A 1D8KA 3JTHA 4I0AA 1FBUA 2COBA 4B3XA 2JRMA 5F1RA 3OYMA 1SFKA 1HKQA 1OISA 1V5EA 2DW4A 1G3WA 2R7TA 5EG0B 4I76A 2E1NA 2WY7Q 4QPQA 4DGWB 2XUBA 3RZOJ 3ABTA 3BQYA 1RUOA 2EV5A 3F6VA 3CUOA 1B72B 1W5TA 5LHHA 3PNTA 1LB2A 1TWAJ 3D5SC 2W25A 2KPMA 3RYRA 5GTHC 1NK3P 5FFZA 1S9HA 3GMEA 2HQ5A 3KEQA 3K4BA 3OMYA 3CCQI 4A93J 2UXXA 2XPWA 2ISZA 4RS8A 1Z21A 2GBYA 5E17F 4RBOA 1SVLA 2K9MA 1Z6TA 3AAFA 3BG3A 4XSXF 4G6TB 2I10A 4OIRF 4X0GA 1T39A 4ZYAA 4M6VA 1IRZA 2NYXA 4MTEA 3TO7A 2NVYJ 1MBKA 1TW3A 1W7PB 2WAQA 1W5SA 5E20A 1MJBA 3KP3A 1DGRM 1K78A 3GBGA 5J40A 3LWFA 1ONVA 3OYGA 3V8KA 2FA5A 1Y0NA 1SFUA 2OQGA 2XF6A 5D6FA 1ORKA 5CKTA 1FZPB 3W2AA 2LF7A 1Z6RA 2DA3A 2EJRA 4RM3A 4A3FJ 3GW2A 4HV5A 3DF8A 1FYKA 4BXFA 3FMRA 1P4WA 3MCZA 4M3EA 2MA3A 1QO0D 5E1ZB 3GUDA 2UZKA 3I4NJ 3QYFA 1WQ2A 4G94A 4IHWA 1AKHA 4BBSJ 2XSDC 2E5NA 4EJVA 4ZYGA 1G3YA 4A3IJ 2ZSHB 4E7JA 2LK2A 4MEXF 2ZJPF 3K69A 2JQ7A 1YW7A 1USTA 2QBYA 2RNJA 1WCMJ 3V4GA 3L2QA 1MH4A 2HXOA 5B3SH 1JUSA 3OWTA 3DV8A 1X4PA 3WU1B 3OYAA 3S1QJ 5J4VA 3OIOA 2NXNB 3FK6A 1T38A 1OCPA 2NVTJ 1YX3A 3MEXA 1FJLA 3J81Z 2PJRA 3RKYA 1P92A 2DLLA 3CUQB 5HDKA 3A01A 2LY2A 2RQQA 1I3QJ 4L9TA 2L7KA 2BXZA 4MNUA 5D8LB 3I56I 4XKCA 3K4KA 3G71I 3BR2A 1E3OC 2A69F 4D5CA 1H88C 3OIPA 1RPWA 4LB5A 2FRHA 3ZMDA 2HOAA 2YX7A 1FBQA 3OY9A 2MLKA 3BROA 1XCVA 5IYBJ 1VQMI 1K83J 1IJWC 5LGNA 3A03A 3FMSA 2P5LC 3KEOA 2OF7A 3TW7A 2QKMB 4Y33A 4IQJA 3F8FA 2STTA 1BM9A 5LD2C 5FFXA 2H6CA 3AG4H 3TEDA 4D5FA 3H5RA 2WA0A 2ZXHA 3LSHA 2KISA 1QHGA 1JTXA 2A68F 1FMWA 1TP4A 4CGZA 5EG0A 2LOOA 3VFZA 2YU3A 1XMAA 3ZQCA 2R7QA 2Z33A 2WTEA 3KYCB 1WRJA 2K5CA 2LY1A 4PJ0C 2V9VA 1YJ9I 2CGPA 4QLCU 1Y56A 4A3EJ 4RB1A 2VBWA 5ILSA 4S04A 4YELA 4JYKA 4KFCA 1WI9A 4HG2A 4OIOF 2X1CA 1D0XA 1ZYRF 2Y0MA 3KFWX 3OR1C 4CCMA 3UR3C 4A12A 3C1DA 2YSRA 1U5TC 1ZLKA 4MGRA 2O8XA 1LEAA 2KIUA 3E7LA 4UV9A 4EMSA 4XBFA 1BR2A 3CC2I 2DOAA 2BY3A 4JBAA 3LA3A 5C44J 2DA7A 1FWZA 4G6DA 3GTQJ 1PP8F 1W7PA 2WAEA 3JRDA 2LD5A 2W4SA 1MBHA 2F6CA 3CC4I 1W0TA 1SANA 1K6OA 2A6HF 2V1UA 1QNTA 3BZCA 4BE0A 3T0YA 4HDUA 2L2OA 5HVQC 2JN6A 2XVCA 1IRFA 3VDXA 4LG3A 2IGOA 2P81A 3FKJA 4AU7A 3HOZJ 3KP2A 4N9IA 4EJWA 1D1BA 1PUEE 4Q5SF 2DYRH 2CRGA 1D3YA 3CCYA 1I39A 1J9IA 4R79A 3K10A 3TDZC 3CCSI 4U87A 4RDUA 1FYMA 4EJUA 1IO2A 4RAGA 3RYPA 2DA5A 2CMPA 5B5EC 3CLQA 3HBLA 2XF5A 1ZQ3P 2EILH 4AVZA 2VL8A 2VIXA 1A35A 1DQUA 3CCJI 5DCFA 5HLHA 1XMXA 2VKHA 5CJ9A 3GYHX 4A5NA 1OKRA 3N4MA 1FC3A 1WHUA 3WHCA 2MGQA 2L9RA 4A3LJ 1YW9A 2XPVA 2A3SA 2HZDA 3FF5A 2IJLA 5HDNA 1BN5A 4HAMA 1FOYA 2EFOA 2YX4A 5EYRA 2HWVA 5IYDJ 2W85A 2L54A 3S3OA 3SDGA 4BNCA 2K9QA 3K4MA 2BW3B 3JTGA 3SDBA 3HUGB 2FOKA 4BL0B 4DYCA 1ETVA 1LFBA 3K70D 2XF7A 5H6QA 1R5HA 5HOOA 3L00A 5A2QK 3UKGA 4R1HA 2PLYA 1HC8A 3K4LA 5CQEA 2HDCA 2ESNA 2ECBA 3IH2A 2LYCA 1T33A 2P0WA 2R5YB 2NS0A 4KISA 2DCEA 1AWCA 1IV6A 1F5TA 1MSFC 3BR6A 4RMNA 2EWNA 4E7KA 5L3FA 5DCMB 4XLPF 2HR3A 3CO6C 1XGNA 1YI2I 4BJ6C 3L2WA 1JJ8C 2CW8A 3TBIA 2CW7A 3RKWA 2X51A 1ZR2A 1YTYA 2AQEA 4PGHA 5DD8A 3RPUA 5K7ZA 2XAHA 1MNMC 2X4HA 1RKWA 2VC0A 5F0FA 2R4GA 3GFMA 2OZ6A 3BDDA 1HW2A 1XSXA 4ON0A 4BUPA 3E6DA 4BEHB 1T98A 4KJZA 5IYCJ 1R6RA 4M3BA 5CPRB 4P5OA 1MW7A 2VE8A 4RAFA 2H1KA 3KPHA 2O9LA 1ZKGA 2WY8Q 1T0FC 4ZYHA 5IY5H 2R3SA 4Y7NJ 5E3LA 4XLEA 2PMHA 1MBJA 2M4GA 2BBYA 4S0HB 1KZHA 3BG6A 1XGOA 3LSGA 4Y17A 2M3AA 4XKBA 1JKQC 1HOMA 2MD0A 3PNVA 2KJBA 4LLGF 5BQTA 3AG1H 2AXTC 2VODA 4HRIA 3K6GA 4MFDA 2RDPA 3HKZA 3I53A 2UUZA 3BZKA 2KIMA 2WB1N 3I58A 4YIRX 3WTUC 2JA5J 3W6VA 1RKTA 4M3DA 2Y75A 4XLHA 4CO8A 1WPKA 1EH7A 3FX3A 2VPLA 4KMUX 5KK1A 1H9TA 1EH8A 5KCMA 2L9SA 4BQOA 1DP7P 4ITVA 1ZRCA 4G7OF 2FEZA 4CICA 4Y13A 3C7JA 4N4NB 2EBIA 4FQGA 5DYMA 4CCKA 1L0OC 4A0ZA 2GZWA 5JR3A 4ZTJA 1IAWA 3BTIA 5LFAA 2B7EA 3CCRI 1X2MA 2D5VA 4KMFA 4U0VA 2PG4A 1J7KA 2RC4A 2R7DA 3AG3H 4HNVA 5D5VB 4XIDA 2VOPA 5E1WA 3GX4X 2ZXIA 5F6FA 1BJAA 4DYQA 5DUKA 2ZFWA 4BACA 3PQKA 5B66C 4MQ9F 3KE2A 2BW3A 2WC2A 4HNUA 3SZGA 1ON1A 1R49A 5EZHA 1E3HA 2ESHA 3HUGA 5ICEA 4MQVA 5TRDA 1V5GA 1WJDA 2D45A 3FBNB 4EJTA 4CYCB 4PJMA 4CCJA 4HOBA 1J75A 2W00A 3F8NA 3OIQA 4FTHA 1R5GA 4ESJA 3A2KA 4HX7A 1QZEA 2E1MB 2XROA 4G7HF 2YU9J 2R5YA 1WH5A 2DO7A 1V55H 3ABLH 3LSJA 5FO5A 2B0LA 2PFBA 1SFOJ 3CC7I 3FXOA 5K5QA 5DCMA 4F7ZA 4W1UA 4IHXA 4HF2A 2M7BA 3ELKA 3MN2A 3QU6A 3BCAA 3IC7A 2CUFA 3DCFA 4XOTA 1BI1A 2MD5A 1BJZA 4IXAA 4LFUA 3SXYA 2K4JA 5KNLA 2HEOA 2E36A 3HXLA 3OS2A 1H8AC 2DDAA 2DQLA 3ML6A 2H8WA 1JGSA 1ON2A 3O6BB 3DU5A 3V8JA 4BHPA 3Q0UA 2GIVA 2H27A 1BBYA 2FX0A 4BEHA 1JGGA 3OYJA 1MZBA 2K02A 2XHKA 3KZIC 2C6YA 2DFEA 4LK1F 3K4CA 1K6YA 2ZNYA 3H9QA 1J5YA 4XLFA 3ONQA 2AS5F 4XLNF 3I0TA 5J1UA 1UG0A 5IT9K 2BY0A 1SD7A 4M9SA 3FHZA 3VWBA 3QWLA 4F55A 1HA8A 1IN7A 1IXCA 2ZSIB 3G6EI 1R36A 1WJFA 4LIVA 2CWEA 5GPCA 4CH7A 4F52A 2H1LA 1TWFJ 3C3WA 3KLOA 4IQ4A 1ZREA 2R7SA 5CVUA 2OZUA 1Z1DA 4Z2YA 3BG7A 4XOPA 4AD9A 3J80Z 4ENKA 1KGSA 2AO9A 1MD0A 3HL2A 3RQ4A 2W84A 5EDNA 4K2EA 1O3SA 2HDWA 2EPFA 2M34A 2E2JJ 4N4OB 3DEUA 4PUSA 4OINF 3QOPA 1ZARA 4OOIA 2F48A 2X6YA 2OU2A 1XSVA 2E71A 2NAZA 1OR7A 2OCCH 5AONA 2B63J 3FHNA 3FISA 3U2RA 3V42A 1XSDA 4PJNA 1T2KA 2IS6A 3OS1A 1J2XA 2VQGA 1J09A 4HBLA 1GXQA 4I2OA 4QWQA 4E7IA 3IHUA 3EYIA 3O3KA 4UVCA 4HNTA 1OYWA 2HKOA 2MH2A 3VB2A 2OTJI 1RETA 2LNBA 1UHSA 3JRFA 2L02A 1DUXC 3S2HJ 3E3VA 2VJJA 1QBJA 1TQMA 3SFZA 2F5CA 5E3OA 1VQLI 2KRCA 1S5LC 4B47A 1O7FA 4RLFA 1K78B 1YE9A 2ME0A 3GFJA 2FJ1A 1LNWA 5F0HA 3RTRA 1OCZH 3ESWB 1NH3A 2K9LA 1WWXA 2F2EA 1VFCA 2XAJA 1ETKA 3HSFA 4N9HA 4QTRA 3MWMA 4O6JA 4HA8A 1LFPA 1OFCX 3WTXC 1WSUA 5EEGA 1WZ2A 5KAIC 1CGPA 1S7EA 2M8EA 3M3YJ 1HKTA 2QA4I 2KJCA 5DD4A 4KITB 3KETA 1G2HA 1F9NA 2P6SA 2DFHA 4CYCA 4XK4A 2V79A 1SAXA 4R8HA 1WVRA 2H8RA 5FKLA 3F0CA 2CUZA 2NVQJ 5TJJA 2KRHA 2FSWA 2JSPA 1BR1A 4I09A 3LSRA 4OAZA 2QKLB 3LSPA 4A3MJ 4EGZA 2TDXA 2XIGA 5D5XB 4NC6A 3K2ZA 1AA7A 1P7IA 1Z77A 2VT2A 2FD5A 2DK5A 3K70C 1SFEA 4IRGA 2MH9A 4AUXA 2PJRB 4HX8A 5HLGA 3OYEA 2E2HJ 3S2WA 2Q8KA 4YIIA 1BI0A 1K4TA 5JLWA 3LSIA 4LMYA 1YG2A 2VJ5A 2L9NA 3WU2C 3KCCA 2YPRA 4O5VA 4O3MA 2QF7A 3ZMTA 3TO6A 1X2NA 2M45A 3F3XA 2AXLA 2HYGD 1KQ9A 5HS7A 1T0FA 4TV7A 3PFIA 3PQJA 3TO9A 2IEKA 2ID6A 3PM1A 3T1BA 1UCRA 1FSHA 4HYEA 1JTYA 1MMSA 1QRYA 5DDGA 5HLIA 4AYBA 2XGXA 4AC0A 3PJRA 3CP2A 3FXKA 2LKPA 3BPVA 1SVMA 4B09A 3KYLA 4ZTFA 1UHMA 5HS8A 3B02A 3CZ6A 2EIKH 2WAFA 4ANJA 5E3MA 3LSMA 3Q9SA 4Y3OA 1X4OA 4ZZLA 3BR5A 4LITA 4MTDA 2V1XA 2BXYA 5IP9J 1VQOI 2VKDA 4A0YA 1IV8A 2QENA 1N75A 2Z16A 4ESFA 2D2WA 3GTJJ 4KT6A 1D5YA 4RAYA 2GOMA 1LDDA 4UUSA 5E8IA 1ACIA 1HLVA 4XORA 4ZC3A 5EJCA 3TKYA 3IRRA 2V26A 2VASA 1A6IA 1F1ZA 2KKOA 1MDMA 1JHHA 3COAC 2B9SA 1QVTA 2HI3A 3PIOF 2Y48A 4BH9A 1HW1A 1IXRC 1IZ1A 2X9DA 3I55I 2DJNA 2P8TA 4DNCA 1YS6A 3QPLA 2DT6A 3WTVC 5J47A 1FOWA 3IKTA 2Y69H 3BWGA 5J3LA 4W97A 4BHBA 4E6KG 2FU4A 3WG9A 3CMAI 3M8FA 3WTTC 1Y39A 4FCYA 2PJPA 3JRCA 3BZ6A 3OOUA 3OSGA 3IAM2 3E6MA 4RM2A 4HQMA 2EFNA 3BLYA 2K9NA 3VYSB 2X85A 1SEUA 4HSTA 1A04A 4HW0A 2L0KA 2BHYA 5E1XA 5FRMA 4G8XA 4CHUA 1Y6IA 5H2FC 2A5WA 4YFXF 3PO2J 1D5VA 4XLAA 1XCBA 1HXDA 1IN4A 2VQCA 1MBGA 2A5YB 3F8CA 1Q1VA 1D0ZA 4RAZA 2DT5A 1VQ8I 1U0JA 3ZXSA 2EB7A 4UUVA 3D5LA 1P2FA 5LRRA 2NOJB 3H3UA 2XAUA 1RUNA 1XGSA 4WCGA 5DUIA 2FBHA 4HLYA 1D8JA 4PSWA 4XN0A 4YG2F 4Z6YA 4CCLA 2RNGA 4C2UA 2R92J 1LUJB 2HVQA 2IA1A 2PEXA 2QQAA 2DYSH 3L2RA 3KZYA 5KHDA 1RESA 5EGOA 3GFLA 2MC3A 5JVGF 4HF1A 1QGPA 2WWYA 2EA2A 1T08B 1REPC 4L9JA 4FETA 2O61A 1O3TA 1JT0A 1SMYF 2MYSA 1M1EB 4I01A 3JRBA 2ICWG 4IO9F 3E6BA 3RJPA 2RKHA 2WV1A 2K27A 1HKSA 2CS3A 2FOWA 2R7XA 3HM5A 3VPRA 1BA5A 2Y9ZA 3MKLA 2OJED 3MKYB 3H0DA 3ZQFA 2K4BA 4XKWA 4UVAA 5CLSA 5D4SA 3HC7A 2JRTA 3HHHA 2CH0A 3H5NA 3HGGA 3BPXA 5C4JJ 3IWFA 3I64A 2ELJA 3EQLF 3LL7A 4FASD 1O3RA 1N78A 1YIJI 5EEHA 2JJ7A
chains in the Genus database with same CATH topology
4YIFA 2DFIA 5D5UB 5ICCA 3V7SA 2ZBKA 2JT1A 1MKMA 3WTWC 2IW5A 2JPCA 1RIOH 3JAMZ 1X3UA 3F8BA 5JVTA 3I54A 5L3GA 4U0YA 3GZ5A 2BV6A 4RB2C 3WGIA 2P7VB 5L3EA 1L3LA 1DPUA 4AIKA 2EFQA 5K1YA 2IP2A 1FSEA 2E7XA 5FLXK 2G9WA 3NEUA 2Q0OA 3R61A 4CZZA 3WGHA 1OYYA 3E5QA 3RIRA 4IHTA 3J7AO 2E7WA 1ZGJA 2HKXA 3GF2A 4M9XA 1IN5A 3HRUA 2HYFA 5L3CA 3F23A 3EDPA 3NRVA 4ZYEA 5LEJA 1IW7F 3HTUA 1RZ4A 4ZH4F 3OOPA 2M87A 3LA7A 1FP1D 2GQQA 2ZJ2A 1H0MA 2D1VA 1OMIA 1FBSA 3M7GA 2DU9A 1Z9CA 3K1PA 3L09A 4LGWA 1U8RA 4WXCA 2CSOA 3EETA 4N0BA 1S29A 1E2XA 1SFXA 4WK8F 3FM5A 3LFKA 2D1HA 2CYYA 1ZG5A 1LDJA 4EM1A 4EQQA 2OA4A 3SQNA 3T8TA 4RGXA 1XB4A 3WTYC 4A0XA 1K7AA 4FHTA 5CVRA 4KDPA 1H9GA 1R1UA 3DKWA 2FF4A 4KT5C 1KU3A 5ED4A 1RI7A 3M1EA 2FMLA 1WKMA 3LSTA 2Z9OA 3CLOA 1S6LA 1QPMA 2VE9A 1LDKB 5AIQA 1HQCA 1KYZA 1TQIA 1P6RA 1UB9A 5L3DA 3W6KB 2DTRA 2L4MA 2W24A 1RNLA 2FNAA 1TNSA 3F8MA 2VC1A 3P9KA 1PDNC 4IPAA 1YLFA 3RDIA 3J81K 4L0ZB 2GA2A 1XGMA 4AVPA 4U7DA 3U9GA 5BMZA 2ADUA 2BEOA 4Y15A 2EK5A 3ZMVA 4M71A 5HS9A 1QZYA 2NNNA 3HHGA 2RV8A 2L01A 4CYDA 3FZVA 1JHFA 4EM0B 5K5OA 3ROUA 1YQAA 3D0SA 4KA4A 1TQPA 1UFMA 2KRFA 3WTSC 2HQNA 3I4PA 3GLXA 2EFPA 2ZMEB 4LB6B 5LLQA 3I71A 2Z99A 3FWEA 1CF7A 3W6JB 1Z05A 4KNYA 5ERIA 4A5MA 3ZQ7A 1J0RA 2EV6A 2NNYA 2JTVA 1V4RA 2JPBA 4L0YB 3DFGA 2GXGA 3VEPA 4WXDA 2KIFA 3K1NA 1XD7A 2R7FA 3QPHA 2VBZA 2CFXA 2XKOA 5LGUA 3DXJF 5CVIA 2FMYA 4AIHA 3ECOA 4P96A 2M30A 2RGVA 2COMA 4BHCA 3TOBA 2X0LA 2LSOA 2OD5A 4ZZDA 4RGRA 3QU3A 1PP7U 4U0WA 3K0LA 5ILUA 1KU2A 1P4AA 2HTSA 1Z91A 3BJOA 3QRFF 2J5PA 4PCQA 3GVAA 2QUFA 2QWWA 2IPQX 2GA1A 4G7ZF 4RGUA 1P4XA 2IT0A 2PI0A 3HTSB 2XAFA 4IVNA 3WODF 3HOSA 2E1CA 1QZZA 4WF2A 2H6BA 1HSTA 2F5FA 3BJ6A 2P7CB 4ZYDA 2L3DA 1TTYA 2W57A 2DK8A 4LG0B 2IA0A 3WE3A 4I0BA 4M6YA 1USSA 2ZMEA 1BI3A 2ACJA 1U78A 3R0AA 4G9YA 2DI3A 4IRIA 2PMUA 1STZA 4OMZA 5CVJA 2JZYA 4KUMA 1MDMB 2HS5A 3MZHA 4UNOA 1SD4A 3DPTA 5LBQA 3O2PE 4LD5A 2PBIA 4L5JA 1DDNA 4KN7X 4HF0A 4GCVA 4GYIA 1B1BA 4EV0A 1KYWA 4L9NA 4IF4A 1DPRA 1G3TA 2VBYA 4XSZF 1EH6A 3G73A 4WX9A 4JQFA 5DV5A 4HX4A 1S3JA 1O3QA 5J6XA 3M9AA 2FXAA 5FD5A 2VT3A 1W4MA 3CDHA 3DQVC 4IJAA 5L3BA 3KP4A 2F5EA 2VONA 4PGGA 2BGCA 2G7HA 5D4RA 3F72A 4WWCA 3R60A 4YFNF 3L2CA 2MLGA 1ULYA 2Z3YA 1E17A 5BPIA 1IN6A 3EUHA 3H92A 4PZJA 3CTAA 3RKXA 3L7WA 4ENNA 5IT3A 2DAOA 3CJNA 4P55A 2RQPA 4UXNA 5J8FA 3KP7A 2V1DA 4EJOA 3ULQB 5E18F 5H20A 2JSCA 1IXSB 2ZKZA 5FLXZ 5FD6A 2LDUA 4UHTA 2P5VA 2QQBA 1O7LA 4I7HA 3E5XA 4D0PA 4LG0A 1ZAOA 5BS6A 2CO5A 2PN6A 5BOXA 5KVRA 3F6OA 4S05A 2ETHA 3LAPA 3R6SA 2YR2A 2RVCA 3JSPA 3I5UA 4Q47A 3HYIA 2EFWA 3TDUC 2ELHA 3QAHA 3HRSA 1FX7A 3P9IA 2DPUA 1BIBA 3N97A 1BI2A 1LEBA 2QVOA 4KN4X 1XN7A 2HTJA 3ERED 1B9MA 4NHJA 2K86A 3FXUA 3REOA 4E70A 3J80K 4HLXA 2BE5F 1GVJA 1ZLJA 5JHUA 3LQRA 4ENMA 4FX4A 5F64A 1XDUA 5JI6A 1JE8A 2STWA 4ENJA 4U88A 4A2UA 1IUYA 2UXNA 3TQNA 1TBXA 3BY6A 3TOAA 2M5WA 2ISYA 3MFKA 4UVBA 4A6DA 4HZFA 4P9UA 5A2QZ 5D8KB 3V7CA 2QZ8A 5H6RA 1HSJA 1BC8C 3G3ZA 4HV6A 2OBPA 1J59A 3KP5A 1BC7C 2WV0A 4LK0F 4YFKF 5CVVA 1LQ1A 1R22A 2P6TA 1IRGA 2QM3A 4M74A 3WE2A 2M1BA 2A07F 1I1GA 5LHIA 5E8GA 3SZPA 3U1DA 2FQ3A 1BIAA 2ZCWA 2ZNZA 1VTNC 1FP2A 2GWRA 1U2WA 5JFRA 2A61A 4ETSA 3ZP5A 5FB2A 4EM2A 3HOTA 3WU0A 1R58A 3P7NA 4Q48A 2V6CA 2G7UA 1I6XA 1T6SA 3EYYA 3GWZA 3K1MA 1Y0UA 4IRHA 4KIFA 3HSRA 3BJAA 2DQRA 2CQKA 2XRNA 1LJ9A 3I59B 2MBFA 2O3FA 1XDSA 3E6CC 2P5KA 1KU9A 1HW5A 4OU0A 1CF7B 2Q2EA 3IWZA 5ILVA 4H0EA 4NQWA 4MEYF 5CYVA 3SHFA 2DPDA 1I1SA 3OV8A 2NRAC 3LA2A 2QYOA 3FXRA 2QQ9A 3FMQA 2HFHA 4M73A 2HGCA 3M8EA 3T5XA 3TGNA 1W7PD 4KIGA 1OPCA 2CG4A 1YS7A 3IL2A 1YYVA 2P4WA 2FNPA 1ZRDA 2IA2A 3CUQA 2J5OA 1R00A 1BOAA 3MAJA 2CW0F 4RGSA 3ZN1A 2OQRA 3Q9VA 1KQ8A 1R1TA 5LHGA 1YIOA 2Z5UA 1KQ0A 2ZO4A 4U7BA 5D6EA 1F4KA 1IF1A 5IT9Z 1OYIA 1R7JA 2VN2A 3FM3A 2HOEA 3ZMUA 3SZTA 3RI4A 2GXBA 4RB3C 1MJAA 3ZN0A 5AIPA 3R0JA 1U5TB 3I59A 5HDGA 3JAMK 3GFIA 3B73A 4KICA 3LAJA 2EV0A 1MJ9A 2IRFG 1FNNA 2XV4S 3V8LA 3KZZA 3E97A 1ZG1A 2F5DA 3F21A 1V3FA 5LEKA 1XMKA 1IN8A 4I98B 1MGTA 3MZYA 2XASA 2FBKA 4I02A 1AOYA 4A6EA 2O03A 1ZGAA 4AIJA 3ABUA 4M6XA 5LGTA 2FBIA 1JXSA 2HZTA 4FT8A 5K5RA 1G3SA 1FPQA 2XAQA 4M9ZA 4AWXB 2O6GE 3R4KA 3Q5FA 4NB5A 3DPLC 5LRSA 3DP7A 2O0YA 4KIBA 1KA8A 4BYYA 4OMYA 1B9NA 4BAYA 4CDGA 1SD6A 3V7RA 2VXZA 2FE3A 2VBXA 4GXOA 4EGYA 1ZRFA 1EV7A 3QP6A 4BXUA 4KYWA 3HSEA 4OIQF 2HQRA 4IHSA 1QQIA 2H94A 3C18A 4HDVA 1ZH5A 1YW8A 1B4AA 3KLNA 3HRMA 3HIFA 5DEQA 4CXFA 1LVAA 3JSOA 4DQ2A 3K9TA 3WTZA 4XRFA 4ESBA 1R1VA 2RN7A 1U5TA 2XAGA 5J8CA 4B8XA 4RB0A 3F22A 1YFHA 1NHAA 4BQAA 4PDKA 2A6EF 4L9VA 4JK1X 4GO1A 1B6AA 3L9FA 4LLNA 3LQQA 2DBBA 2XKPA 2EA4A 3ZMZA 1SD5A 3GO5A 3GEZA 1FOKA 1FLIA 1Q1HA 2ZXJA 1S7AA 4L18B 4WXHA 3HRTA 1I5ZA 4ASNA 4Q4ZF 2QLZA 1KU7A 1FT9A 4OIPF 1SMTA 3WGGA 3JW4A 2L4AA 4GYGA 1R23A 5ICFA 3GXOA 3E5UA 1TW2A 1I27A 2K7LA 1GXPA 1U6GA 4GGGA 1C0WA 3T8RA 1S8NA 3NQOA 1TLHB 3FXQA 1G4DA 2LF8A 3P9CA 2GAUA 5BPDA 1FYLA 1GHCA 3ZMSA 3ECHA 2OAZA 3IKVA 1ZG3A 4L5IA 1U3EM 3MQ0A 3BOQA 1K79A 3IRQA 1FY7A 4EVIA 2PQ8A 1G6NA 1O57A 3BP8A 2H09A 4M72A 1HBXG 2UWMA 5FGMA 2QBYB 1TNTA 3ZPLA 3CO7C 3VODA 3H3ZA 4FX0A 3KP6A 1ZHFA 4LJZF 4MHGA 3GZ6A 1ZN2A 1S7OA 3QPTA 5ICGA 6PAXA 1B59A 4HQEA 3CUQC 4UV8A 1YO5C 3ISPA 1ODDA 5D5WB 3RPQA 4P9FA 2VOOA 4LLLA 2BYVE 3QP5A 1UHWA 1Z7UA 2IVMA 4G6QA 3VOEA 1D8KA 3JTHA 4I0AA 1FBUA 5F1RA 1HKQA 2DW4A 1G3WA 2E1NA 2XUBA 3ABTA 1RUOA 2EV5A 3F6VA 3CUOA 1W5TA 5LHHA 1LB2A 2W25A 3RYRA 5FFZA 3KEQA 2UXXA 2ISZA 4RS8A 5E17F 1Z6TA 3AAFA 4XSXF 4OIRF 1T39A 2NYXA 4MTEA 3TO7A 1TW3A 1W7PB 1W5SA 5E20A 1MJBA 3KP3A 1K78A 3LWFA 1ONVA 3V8KA 2FA5A 1SFUA 2OQGA 5D6FA 1FZPB 2LF7A 1Z6RA 2EJRA 3GW2A 4HV5A 3DF8A 1FYKA 3FMRA 1P4WA 3MCZA 2MA3A 1QO0D 5E1ZB 3GUDA 2UZKA 1WQ2A 4G94A 4EJVA 4ZYGA 1G3YA 4MEXF 3K69A 1YW7A 1USTA 2QBYA 2RNJA 3V4GA 3WU1B 3DV8A 1T38A 3MEXA 3J81Z 3RKYA 1P92A 2DLLA 3CUQB 5HDKA 4L9TA 4MNUA 5D8LB 2A69F 4LB5A 2FRHA 3ZMDA 2YX7A 1FBQA 2MLKA 3BROA 1XCVA 5LGNA 3FMSA 2P5LC 3KEOA 3F8FA 2STTA 1BM9A 5FFXA 2H6CA 2A68F 4CGZA 3VFZA 2YU3A 1XMAA 2Z33A 2WTEA 1WRJA 2V9VA 2CGPA 4QLCU 4RB1A 2VBWA 5ILSA 4S04A 4KFCA 1WI9A 4OIOF 1ZYRF 2Y0MA 3KFWX 4A12A 3C1DA 2YSRA 1U5TC 1ZLKA 4MGRA 2O8XA 1LEAA 2KIUA 4UV9A 4EMSA 4XBFA 4JBAA 3LA3A 4G6DA 1FWZA 1PP8F 1W7PA 1K6OA 2A6HF 2V1UA 1QNTA 3T0YA 4HDUA 5HVQC 2XVCA 1IRFA 3KP2A 4N9IA 4EJWA 1PUEE 4Q5SF 1D3YA 1J9IA 4R79A 3TDZC 1FYMA 4EJUA 3RYPA 5DCFA 5HLHA 3GYHX 5CJ9A 4A5NA 1OKRA 3N4MA 1FC3A 1YW9A 3FF5A 2A3SA 2IJLA 5HDNA 1BN5A 4HAMA 2EFOA 2YX4A 2HWVA 2W85A 2L54A 4BNCA 3JTGA 2FOKA 5H6QA 1R5HA 5HOOA 3L00A 5A2QK 4R1HA 2PLYA 2HDCA 2ESNA 2NS0A 1AWCA 1F5TA 2EWNA 5L3FA 5DCMB 4XLPF 2HR3A 3CO6C 1XGNA 3RKWA 1YTYA 4PGHA 5DD8A 3RPUA 2XAHA 2X4HA 2VC0A 3GFMA 2OZ6A 3BDDA 1HW2A 1XSXA 4ON0A 3E6DA 1T98A 4P5OA 2VE8A 4ZYHA 2R3SA 2PMHA 2BBYA 1XGOA 4Y17A 2KJBA 4LLGF 5BQTA 2VODA 2RDPA 3I53A 2KIMA 3I58A 3WTUC 2Y75A 4CO8A 3FX3A 1EH7A 4KMUX 5KK1A 1H9TA 1EH8A 1DP7P 1ZRCA 4G7OF 2FEZA 4CICA 4Y13A 3C7JA 5DYMA 5JR3A 1L0OC 4A0ZA 2GZWA 1IAWA 4KMFA 4U0VA 2PG4A 1J7KA 2RC4A 2R7DA 5D5VB 2VOPA 5E1WA 3GX4X 5F6FA 1BJAA 5DUKA 2ZFWA 3PQKA 4MQ9F 3KE2A 2WC2A 1ON1A 2ESHA 3HUGA 5ICEA 4MQVA 5TRDA 2D45A 4EJTA 4HOBA 1J75A 3F8NA 1R5GA 4ESJA 4HX7A 4G7HF 2XROA 2DO7A 5FO5A 2B0LA 2PFBA 5K5QA 5DCMA 4F7ZA 4HF2A 3ELKA 3QU6A 3IC7A 1BI1A 2MD5A 4LFUA 4IXAA 3SXYA 2K4JA 2HEOA 2DQLA 3ML6A 1JGSA 1ON2A 3O6BB 3V8JA 4BHPA 2GIVA 2H27A 1BBYA 1MZBA 2K02A 2XHKA 2C6YA 4LK1F 2ZNYA 1J5YA 2AS5F 4XLNF 3I0TA 5IT9K 1SD7A 4M9SA 3FHZA 1IN7A 1IXCA 1R36A 2CWEA 3C3WA 3KLOA 1ZREA 5CVUA 2OZUA 1Z1DA 4Z2YA 4AD9A 3J80Z 4ENKA 1KGSA 1MD0A 2W84A 4K2EA 1O3SA 3DEUA 4OINF 3QOPA 1ZARA 4OOIA 2OU2A 1XSVA 2NAZA 1OR7A 5AONA 3U2RA 1XSDA 1T2KA 1J2XA 4HBLA 1GXQA 4I2OA 4QWQA 3IHUA 3EYIA 3O3KA 4UVCA 1OYWA 2HKOA 2MH2A 3VB2A 2LNBA 2L02A 1DUXC 3E3VA 1QBJA 1TQMA 3SFZA 2F5CA 1O7FA 1K78B 3GFJA 1LNWA 3RTRA 1WWXA 2F2EA 2XAJA 3HSFA 4N9HA 3MWMA 4O6JA 4HA8A 3WTXC 1WSUA 5EEGA 1CGPA 2M8EA 1HKTA 2KJCA 5DD4A 3KETA 1F9NA 2P6SA 2V79A 1SAXA 4R8HA 5TJJA 2FSWA 4I09A 4EGZA 2TDXA 2XIGA 5D5XB 3K2ZA 2VT2A 2DK5A 1SFEA 4IRGA 2MH9A 4HX8A 5HLGA 3S2WA 2Q8KA 4YIIA 1BI0A 4LMYA 1YG2A 3KCCA 2YPRA 4O5VA 4O3MA 3ZMTA 3TO6A 2M45A 3F3XA 2AXLA 2HYGD 1KQ9A 5HS7A 1T0FA 4TV7A 3PFIA 3PQJA 3TO9A 3T1BA 1UCRA 1FSHA 4HYEA 5DDGA 5HLIA 2XGXA 2LKPA 3BPVA 4B09A 1UHMA 5HS8A 3B02A 3Q9SA 4ZZLA 4MTDA 2V1XA 4A0YA 2QENA 4ESFA 2D2WA 4RAYA 1LDDA 5E8IA 3TKYA 3IRRA 1F1ZA 2KKOA 1MDMA 1JHHA 3COAC 2Y48A 4BH9A 1HW1A 1IXRC 1IZ1A 2P8TA 4DNCA 1YS6A 3WTVC 3IKTA 3BWGA 4BHBA 2FU4A 3WG9A 3M8FA 3WTTC 2PJPA 3BZ6A 3E6MA 4HQMA 2EFNA 4HW0A 1A04A 5E1XA 4G8XA 4CHUA 4YFXF 1D5VA 1XCBA 1HXDA 1IN4A 2A5YB 3F8CA 4RAZA 2DT5A 2EB7A 4UUVA 3D5LA 1P2FA 5LRRA 3H3UA 1RUNA 1XGSA 4WCGA 5DUIA 2FBHA 4HLYA 1D8JA 4YG2F 2IA1A 2QQAA 2PEXA 3KZYA 3GFLA 2MC3A 4HF1A 1QGPA 2WWYA 2EA2A 1REPC 4L9JA 2O61A 1O3TA 1SMYF 4I01A 3E6BA 3RJPA 2RKHA 2K27A 1HKSA 2K4BA 5CLSA 4UVAA 5D4SA 2JRTA 3HHHA 3BPXA 3IWFA 3I64A 3EQLF 1O3RA 5EEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIF A;  2DFI A;  5D5U B;  5ICC A;  3V7S A;  2ZBK A;  2JT1 A;  1MKM A;  3WTW C;  2IW5 A;  2JPC A;  1RIO H;  3JAM Z;  1X3U A;  3F8B A;  5JVT A;  3I54 A;  5L3G A;  4U0Y A;  3GZ5 A;  2BV6 A;  4RB2 C;  3WGI A;  2P7V B;  5L3E A;  1L3L A;  1DPU A;  4AIK A;  2EFQ A;  5K1Y A;  2IP2 A;  1FSE A;  2E7X A;  5FLX K;  2G9W A;  3NEU A;  2Q0O A;  3R61 A;  4CZZ A;  3WGH A;  1OYY A;  3E5Q A;  3RIR A;  4IHT A;  3J7A O;  2E7W A;  1ZGJ A;  2HKX A;  3GF2 A;  4M9X A;  1IN5 A;  3HRU A;  2HYF A;  5L3C A;  3F23 A;  3EDP A;  3NRV A;  4ZYE A;  5LEJ A;  1IW7 F;  3HTU A;  1RZ4 A;  4ZH4 F;  3OOP A;  2M87 A;  3LA7 A;  1FP1 D;  2GQQ A;  2ZJ2 A;  1H0M A;  2D1V A;  1OMI A;  1FBS A;  3M7G A;  2DU9 A;  1Z9C A;  3K1P A;  3L09 A;  4LGW A;  1U8R A;  4WXC A;  2CSO A;  3EET A;  4N0B A;  1S29 A;  1E2X A;  1SFX A;  4WK8 F;  3FM5 A;  3LFK A;  2D1H A;  2CYY A;  1ZG5 A;  1LDJ A;  4EM1 A;  4EQQ A;  2OA4 A;  3SQN A;  3T8T A;  4RGX A;  1XB4 A;  3WTY C;  4A0X A;  1K7A A;  4FHT A;  5CVR A;  4KDP A;  1H9G A;  1R1U A;  3DKW A;  2FF4 A;  4KT5 C;  1KU3 A;  5ED4 A;  1RI7 A;  3M1E A;  2FML A;  1WKM A;  3LST A;  2Z9O A;  3CLO A;  1S6L A;  1QPM A;  2VE9 A;  1LDK B;  5AIQ A;  1HQC A;  1KYZ A;  1TQI A;  1P6R A;  1UB9 A;  5L3D A;  3W6K B;  2DTR A;  2L4M A;  2W24 A;  1RNL A;  2FNA A;  1TNS A;  3F8M A;  2VC1 A;  3P9K A;  1PDN C;  4IPA A;  1YLF A;  3RDI A;  3J81 K;  4L0Z B;  2GA2 A;  1XGM A;  4AVP A;  4U7D A;  3U9G A;  5BMZ A;  2ADU A;  2BEO A;  4Y15 A;  2EK5 A;  3ZMV A;  4M71 A;  5HS9 A;  1QZY A;  2NNN A;  3HHG A;  2RV8 A;  2L01 A;  4CYD A;  3FZV A;  1JHF A;  4EM0 B;  5K5O A;  3ROU A;  1YQA A;  3D0S A;  4KA4 A;  1TQP A;  1UFM A;  2KRF A;  3WTS C;  2HQN A;  3I4P A;  3GLX A;  2EFP A;  2ZME B;  4LB6 B;  5LLQ A;  3I71 A;  2Z99 A;  3FWE A;  1CF7 A;  3W6J B;  1Z05 A;  4KNY A;  5ERI A;  4A5M A;  3ZQ7 A;  1J0R A;  2EV6 A;  2NNY A;  2JTV A;  1V4R A;  2JPB A;  4L0Y B;  3DFG A;  2GXG A;  3VEP A;  4WXD A;  2KIF A;  3K1N A;  1XD7 A;  2R7F A;  3QPH A;  2VBZ A;  2CFX A;  2XKO A;  5LGU A;  3DXJ F;  5CVI A;  2FMY A;  4AIH A;  3ECO A;  4P96 A;  2M30 A;  2RGV A;  2COM A;  4BHC A;  3TOB A;  2X0L A;  2LSO A;  2OD5 A;  4ZZD A;  4RGR A;  3QU3 A;  1PP7 U;  4U0W A;  3K0L A;  5ILU A;  1KU2 A;  1P4A A;  2HTS A;  1Z91 A;  3BJO A;  3QRF F;  2J5P A;  4PCQ A;  3GVA A;  2QUF A;  2QWW A;  2IPQ X;  2GA1 A;  4G7Z F;  4RGU A;  1P4X A;  2IT0 A;  2PI0 A;  3HTS B;  2XAF A;  4IVN A;  3WOD F;  3HOS A;  2E1C A;  1QZZ A;  4WF2 A;  2H6B A;  1HST A;  2F5F A;  3BJ6 A;  2P7C B;  4ZYD A;  2L3D A;  1TTY A;  2W57 A;  2DK8 A;  4LG0 B;  2IA0 A;  3WE3 A;  4I0B A;  4M6Y A;  1USS A;  2ZME A;  1BI3 A;  2ACJ A;  1U78 A;  3R0A A;  4G9Y A;  2DI3 A;  4IRI A;  2PMU A;  1STZ A;  4OMZ A;  5CVJ A;  2JZY A;  4KUM A;  1MDM B;  2HS5 A;  3MZH A;  4UNO A;  1SD4 A;  3DPT A;  5LBQ A;  3O2P E;  4LD5 A;  2PBI A;  4L5J A;  1DDN A;  4KN7 X;  4HF0 A;  4GCV A;  4GYI A;  1B1B A;  4EV0 A;  1KYW A;  4L9N A;  4IF4 A;  1DPR A;  1G3T A;  2VBY A;  4XSZ F;  1EH6 A;  3G73 A;  4WX9 A;  4JQF A;  5DV5 A;  4HX4 A;  1S3J A;  1O3Q A;  5J6X A;  3M9A A;  2FXA A;  5FD5 A;  2VT3 A;  1W4M A;  3CDH A;  3DQV C;  4IJA A;  5L3B A;  3KP4 A;  2F5E A;  2VON A;  4PGG A;  2BGC A;  2G7H A;  5D4R A;  3F72 A;  4WWC A;  3R60 A;  4YFN F;  3L2C A;  2MLG A;  1ULY A;  2Z3Y A;  1E17 A;  5BPI A;  1IN6 A;  3EUH A;  3H92 A;  4PZJ A;  3CTA A;  3RKX A;  3L7W A;  4ENN A;  5IT3 A;  2DAO A;  3CJN A;  4P55 A;  2RQP A;  4UXN A;  5J8F A;  3KP7 A;  2V1D A;  4EJO A;  3ULQ B;  5E18 F;  5H20 A;  2JSC A;  1IXS B;  2ZKZ A;  5FLX Z;  5FD6 A;  2LDU A;  4UHT A;  2P5V A;  2QQB A;  1O7L A;  4I7H A;  3E5X A;  4D0P A;  4LG0 A;  1ZAO A;  5BS6 A;  2CO5 A;  2PN6 A;  5BOX A;  5KVR A;  3F6O A;  4S05 A;  2ETH A;  3LAP A;  3R6S A;  2YR2 A;  2RVC A;  3JSP A;  3I5U A;  4Q47 A;  3HYI A;  2EFW A;  3TDU C;  2ELH A;  3QAH A;  3HRS A;  1FX7 A;  3P9I A;  2DPU A;  1BIB A;  3N97 A;  1BI2 A;  1LEB A;  2QVO A;  4KN4 X;  1XN7 A;  2HTJ A;  3ERE D;  1B9M A;  4NHJ A;  2K86 A;  3FXU A;  3REO A;  4E70 A;  3J80 K;  4HLX A;  2BE5 F;  1GVJ A;  1ZLJ A;  5JHU A;  3LQR A;  4ENM A;  4FX4 A;  5F64 A;  1XDU A;  5JI6 A;  1JE8 A;  2STW A;  4ENJ A;  4U88 A;  4A2U A;  1IUY A;  2UXN A;  3TQN A;  1TBX A;  3BY6 A;  3TOA A;  2M5W A;  2ISY A;  3MFK A;  4UVB A;  4A6D A;  4HZF A;  4P9U A;  5A2Q Z;  5D8K B;  3V7C A;  2QZ8 A;  5H6R A;  1HSJ A;  1BC8 C;  3G3Z A;  4HV6 A;  2OBP A;  1J59 A;  3KP5 A;  1BC7 C;  2WV0 A;  4LK0 F;  4YFK F;  5CVV A;  1LQ1 A;  1R22 A;  2P6T A;  1IRG A;  2QM3 A;  4M74 A;  3WE2 A;  2M1B A;  2A07 F;  1I1G A;  5LHI A;  5E8G A;  3SZP A;  3U1D A;  2FQ3 A;  1BIA A;  2ZCW A;  2ZNZ A;  1VTN C;  1FP2 A;  2GWR A;  1U2W A;  5JFR A;  2A61 A;  4ETS A;  3ZP5 A;  5FB2 A;  4EM2 A;  3HOT A;  3WU0 A;  1R58 A;  3P7N A;  4Q48 A;  2V6C A;  2G7U A;  1I6X A;  1T6S A;  3EYY A;  3GWZ A;  3K1M A;  1Y0U A;  4IRH A;  4KIF A;  3HSR A;  3BJA A;  2DQR A;  2CQK A;  2XRN A;  1LJ9 A;  3I59 B;  2MBF A;  2O3F A;  1XDS A;  3E6C C;  2P5K A;  1KU9 A;  1HW5 A;  4OU0 A;  1CF7 B;  2Q2E A;  3IWZ A;  5ILV A;  4H0E A;  4NQW A;  4MEY F;  5CYV A;  3SHF A;  2DPD A;  1I1S A;  3OV8 A;  2NRA C;  3LA2 A;  2QYO A;  3FXR A;  2QQ9 A;  3FMQ A;  2HFH A;  4M73 A;  2HGC A;  3M8E A;  3T5X A;  3TGN A;  1W7P D;  4KIG A;  1OPC A;  2CG4 A;  1YS7 A;  3IL2 A;  1YYV A;  2P4W A;  2FNP A;  1ZRD A;  2IA2 A;  3CUQ A;  2J5O A;  1R00 A;  1BOA A;  3MAJ A;  2CW0 F;  4RGS A;  3ZN1 A;  2OQR A;  3Q9V A;  1KQ8 A;  1R1T A;  5LHG A;  1YIO A;  2Z5U A;  1KQ0 A;  2ZO4 A;  4U7B A;  5D6E A;  1F4K A;  1IF1 A;  5IT9 Z;  1OYI A;  1R7J A;  2VN2 A;  3FM3 A;  2HOE A;  3ZMU A;  3SZT A;  3RI4 A;  2GXB A;  4RB3 C;  1MJA A;  3ZN0 A;  5AIP A;  3R0J A;  1U5T B;  3I59 A;  5HDG A;  3JAM K;  3GFI A;  3B73 A;  4KIC A;  3LAJ A;  2EV0 A;  1MJ9 A;  2IRF G;  1FNN A;  2XV4 S;  3V8L A;  3KZZ A;  3E97 A;  1ZG1 A;  2F5D A;  3F21 A;  1V3F A;  5LEK A;  1XMK A;  1IN8 A;  4I98 B;  1MGT A;  3MZY A;  2XAS A;  2FBK A;  4I02 A;  1AOY A;  4A6E A;  2O03 A;  1ZGA A;  4AIJ A;  3ABU A;  4M6X A;  5LGT A;  2FBI A;  1JXS A;  2HZT A;  4FT8 A;  5K5R A;  1G3S A;  1FPQ A;  2XAQ A;  4M9Z A;  4AWX B;  2O6G E;  3R4K A;  3Q5F A;  4NB5 A;  3DPL C;  5LRS A;  3DP7 A;  2O0Y A;  4KIB A;  1KA8 A;  4BYY A;  4OMY A;  1B9N A;  4BAY A;  4CDG A;  1SD6 A;  3V7R A;  2VXZ A;  2FE3 A;  2VBX A;  4GXO A;  4EGY A;  1ZRF A;  1EV7 A;  3QP6 A;  4BXU A;  4KYW A;  3HSE A;  4OIQ F;  2HQR A;  4IHS A;  1QQI A;  2H94 A;  3C18 A;  4HDV A;  1ZH5 A;  1YW8 A;  1B4A A;  3KLN A;  3HRM A;  3HIF A;  5DEQ A;  4CXF A;  1LVA A;  3JSO A;  4DQ2 A;  3K9T A;  3WTZ A;  4XRF A;  4ESB A;  1R1V A;  2RN7 A;  1U5T A;  2XAG A;  5J8C A;  4B8X A;  4RB0 A;  3F22 A;  1YFH A;  1NHA A;  4BQA A;  4PDK A;  2A6E F;  4L9V A;  4JK1 X;  4GO1 A;  1B6A A;  3L9F A;  4LLN A;  3LQQ A;  2DBB A;  2XKP A;  2EA4 A;  3ZMZ A;  1SD5 A;  3GO5 A;  3GEZ A;  1FOK A;  1FLI A;  1Q1H A;  2ZXJ A;  1S7A A;  4L18 B;  4WXH A;  3HRT A;  1I5Z A;  4ASN A;  4Q4Z F;  2QLZ A;  1KU7 A;  1FT9 A;  4OIP F;  1SMT A;  3WGG A;  3JW4 A;  2L4A A;  4GYG A;  1R23 A;  5ICF A;  3GXO A;  3E5U A;  1TW2 A;  1I27 A;  2K7L A;  1GXP A;  1U6G A;  4GGG A;  1C0W A;  3T8R A;  1S8N A;  3NQO A;  1TLH B;  3FXQ A;  1G4D A;  2LF8 A;  3P9C A;  2GAU A;  5BPD A;  1FYL A;  1GHC A;  3ZMS A;  3ECH A;  2OAZ A;  3IKV A;  1ZG3 A;  4L5I A;  1U3E M;  3MQ0 A;  3BOQ A;  1K79 A;  3IRQ A;  1FY7 A;  4EVI A;  2PQ8 A;  1G6N A;  1O57 A;  3BP8 A;  2H09 A;  4M72 A;  1HBX G;  2UWM A;  5FGM A;  2QBY B;  1TNT A;  3ZPL A;  3CO7 C;  3VOD A;  3H3Z A;  4FX0 A;  3KP6 A;  1ZHF A;  4LJZ F;  4MHG A;  3GZ6 A;  1ZN2 A;  1S7O A;  3QPT A;  5ICG A;  6PAX A;  1B59 A;  4HQE A;  3CUQ C;  4UV8 A;  1YO5 C;  3ISP A;  1ODD A;  5D5W B;  3RPQ A;  4P9F A;  2VOO A;  4LLL A;  2BYV E;  3QP5 A;  1UHW A;  1Z7U A;  2IVM A;  4G6Q A;  3VOE A;  1D8K A;  3JTH A;  4I0A A;  1FBU A;  5F1R A;  1HKQ A;  2DW4 A;  1G3W A;  2E1N A;  2XUB A;  3ABT A;  1RUO A;  2EV5 A;  3F6V A;  3CUO A;  1W5T A;  5LHH A;  1LB2 A;  2W25 A;  3RYR A;  5FFZ A;  3KEQ A;  2UXX A;  2ISZ A;  4RS8 A;  5E17 F;  1Z6T A;  3AAF A;  4XSX F;  4OIR F;  1T39 A;  2NYX A;  4MTE A;  3TO7 A;  1TW3 A;  1W7P B;  1W5S A;  5E20 A;  1MJB A;  3KP3 A;  1K78 A;  3LWF A;  1ONV A;  3V8K A;  2FA5 A;  1SFU A;  2OQG A;  5D6F A;  1FZP B;  2LF7 A;  1Z6R A;  2EJR A;  3GW2 A;  4HV5 A;  3DF8 A;  1FYK A;  3FMR A;  1P4W A;  3MCZ A;  2MA3 A;  1QO0 D;  5E1Z B;  3GUD A;  2UZK A;  1WQ2 A;  4G94 A;  4EJV A;  4ZYG A;  1G3Y A;  4MEX F;  3K69 A;  1YW7 A;  1UST A;  2QBY A;  2RNJ A;  3V4G A;  3WU1 B;  3DV8 A;  1T38 A;  3MEX A;  3J81 Z;  3RKY A;  1P92 A;  2DLL A;  3CUQ B;  5HDK A;  4L9T A;  4MNU A;  5D8L B;  2A69 F;  4LB5 A;  2FRH A;  3ZMD A;  2YX7 A;  1FBQ A;  2MLK A;  3BRO A;  1XCV A;  5LGN A;  3FMS A;  2P5L C;  3KEO A;  3F8F A;  2STT A;  1BM9 A;  5FFX A;  2H6C A;  2A68 F;  4CGZ A;  3VFZ A;  2YU3 A;  1XMA A;  2Z33 A;  2WTE A;  1WRJ A;  2V9V A;  2CGP A;  4QLC U;  4RB1 A;  2VBW A;  5ILS A;  4S04 A;  4KFC A;  1WI9 A;  4OIO F;  1ZYR F;  2Y0M A;  3KFW X;  4A12 A;  3C1D A;  2YSR A;  1U5T C;  1ZLK A;  4MGR A;  2O8X A;  1LEA A;  2KIU A;  4UV9 A;  4EMS A;  4XBF A;  4JBA A;  3LA3 A;  4G6D A;  1FWZ A;  1PP8 F;  1W7P A;  1K6O A;  2A6H F;  2V1U A;  1QNT A;  3T0Y A;  4HDU A;  5HVQ C;  2XVC A;  1IRF A;  3KP2 A;  4N9I A;  4EJW A;  1PUE E;  4Q5S F;  1D3Y A;  1J9I A;  4R79 A;  3TDZ C;  1FYM A;  4EJU A;  3RYP A;  5DCF A;  5HLH A;  3GYH X;  5CJ9 A;  4A5N A;  1OKR A;  3N4M A;  1FC3 A;  1YW9 A;  3FF5 A;  2A3S A;  2IJL A;  5HDN A;  1BN5 A;  4HAM A;  2EFO A;  2YX4 A;  2HWV A;  2W85 A;  2L54 A;  4BNC A;  3JTG A;  2FOK A;  5H6Q A;  1R5H A;  5HOO A;  3L00 A;  5A2Q K;  4R1H A;  2PLY A;  2HDC A;  2ESN A;  2NS0 A;  1AWC A;  1F5T A;  2EWN A;  5L3F A;  5DCM B;  4XLP F;  2HR3 A;  3CO6 C;  1XGN A;  3RKW A;  1YTY A;  4PGH A;  5DD8 A;  3RPU A;  2XAH A;  2X4H A;  2VC0 A;  3GFM A;  2OZ6 A;  3BDD A;  1HW2 A;  1XSX A;  4ON0 A;  3E6D A;  1T98 A;  4P5O A;  2VE8 A;  4ZYH A;  2R3S A;  2PMH A;  2BBY A;  1XGO A;  4Y17 A;  2KJB A;  4LLG F;  5BQT A;  2VOD A;  2RDP A;  3I53 A;  2KIM A;  3I58 A;  3WTU C;  2Y75 A;  4CO8 A;  3FX3 A;  1EH7 A;  4KMU X;  5KK1 A;  1H9T A;  1EH8 A;  1DP7 P;  1ZRC A;  4G7O F;  2FEZ A;  4CIC A;  4Y13 A;  3C7J A;  5DYM A;  5JR3 A;  1L0O C;  4A0Z A;  2GZW A;  1IAW A;  4KMF A;  4U0V A;  2PG4 A;  1J7K A;  2RC4 A;  2R7D A;  5D5V B;  2VOP A;  5E1W A;  3GX4 X;  5F6F A;  1BJA A;  5DUK A;  2ZFW A;  3PQK A;  4MQ9 F;  3KE2 A;  2WC2 A;  1ON1 A;  2ESH A;  3HUG A;  5ICE A;  4MQV A;  5TRD A;  2D45 A;  4EJT A;  4HOB A;  1J75 A;  3F8N A;  1R5G A;  4ESJ A;  4HX7 A;  4G7H F;  2XRO A;  2DO7 A;  5FO5 A;  2B0L A;  2PFB A;  5K5Q A;  5DCM A;  4F7Z A;  4HF2 A;  3ELK A;  3QU6 A;  3IC7 A;  1BI1 A;  2MD5 A;  4LFU A;  4IXA A;  3SXY A;  2K4J A;  2HEO A;  2DQL A;  3ML6 A;  1JGS A;  1ON2 A;  3O6B B;  3V8J A;  4BHP A;  2GIV A;  2H27 A;  1BBY A;  1MZB A;  2K02 A;  2XHK A;  2C6Y A;  4LK1 F;  2ZNY A;  1J5Y A;  2AS5 F;  4XLN F;  3I0T A;  5IT9 K;  1SD7 A;  4M9S A;  3FHZ A;  1IN7 A;  1IXC A;  1R36 A;  2CWE A;  3C3W A;  3KLO A;  1ZRE A;  5CVU A;  2OZU A;  1Z1D A;  4Z2Y A;  4AD9 A;  3J80 Z;  4ENK A;  1KGS A;  1MD0 A;  2W84 A;  4K2E A;  1O3S A;  3DEU A;  4OIN F;  3QOP A;  1ZAR A;  4OOI A;  2OU2 A;  1XSV A;  2NAZ A;  1OR7 A;  5AON A;  3U2R A;  1XSD A;  1T2K A;  1J2X A;  4HBL A;  1GXQ A;  4I2O A;  4QWQ A;  3IHU A;  3EYI A;  3O3K A;  4UVC A;  1OYW A;  2HKO A;  2MH2 A;  3VB2 A;  2LNB A;  2L02 A;  1DUX C;  3E3V A;  1QBJ A;  1TQM A;  3SFZ A;  2F5C A;  1O7F A;  1K78 B;  3GFJ A;  1LNW A;  3RTR A;  1WWX A;  2F2E A;  2XAJ A;  3HSF A;  4N9H A;  3MWM A;  4O6J A;  4HA8 A;  3WTX C;  1WSU A;  5EEG A;  1CGP A;  2M8E A;  1HKT A;  2KJC A;  5DD4 A;  3KET A;  1F9N A;  2P6S A;  2V79 A;  1SAX A;  4R8H A;  5TJJ A;  2FSW A;  4I09 A;  4EGZ A;  2TDX A;  2XIG A;  5D5X B;  3K2Z A;  2VT2 A;  2DK5 A;  1SFE A;  4IRG A;  2MH9 A;  4HX8 A;  5HLG A;  3S2W A;  2Q8K A;  4YII A;  1BI0 A;  4LMY A;  1YG2 A;  3KCC A;  2YPR A;  4O5V A;  4O3M A;  3ZMT A;  3TO6 A;  2M45 A;  3F3X A;  2AXL A;  2HYG D;  1KQ9 A;  5HS7 A;  1T0F A;  4TV7 A;  3PFI A;  3PQJ A;  3TO9 A;  3T1B A;  1UCR A;  1FSH A;  4HYE A;  5DDG A;  5HLI A;  2XGX A;  2LKP A;  3BPV A;  4B09 A;  1UHM A;  5HS8 A;  3B02 A;  3Q9S A;  4ZZL A;  4MTD A;  2V1X A;  4A0Y A;  2QEN A;  4ESF A;  2D2W A;  4RAY A;  1LDD A;  5E8I A;  3TKY A;  3IRR A;  1F1Z A;  2KKO A;  1MDM A;  1JHH A;  3COA C;  2Y48 A;  4BH9 A;  1HW1 A;  1IXR C;  1IZ1 A;  2P8T A;  4DNC A;  1YS6 A;  3WTV C;  3IKT A;  3BWG A;  4BHB A;  2FU4 A;  3WG9 A;  3M8F A;  3WTT C;  2PJP A;  3BZ6 A;  3E6M A;  4HQM A;  2EFN A;  4HW0 A;  1A04 A;  5E1X A;  4G8X A;  4CHU A;  4YFX F;  1D5V A;  1XCB A;  1HXD A;  1IN4 A;  2A5Y B;  3F8C A;  4RAZ A;  2DT5 A;  2EB7 A;  4UUV A;  3D5L A;  1P2F A;  5LRR A;  3H3U A;  1RUN A;  1XGS A;  4WCG A;  5DUI A;  2FBH A;  4HLY A;  1D8J A;  4YG2 F;  2IA1 A;  2QQA A;  2PEX A;  3KZY A;  3GFL A;  2MC3 A;  4HF1 A;  1QGP A;  2WWY A;  2EA2 A;  1REP C;  4L9J A;  2O61 A;  1O3T A;  1SMY F;  4I01 A;  3E6B A;  3RJP A;  2RKH A;  2K27 A;  1HKS A;  2K4B A;  5CLS A;  4UVA A;  5D4S A;  2JRT A;  3HHH A;  3BPX A;  3IWF A;  3I64 A;  3EQL F;  1O3R A;  5EEH A; 
#chains in the Genus database with same CATH topology
 3ZQI A;  4FE7 A;  2DDB A;  4YIF A;  4C9Y A;  2DFI A;  2VJI A;  2X6X A;  5D5U B;  5ICC A;  2LMD A;  2G0E A;  2ZBK A;  3V7S A;  4F92 B;  2JT1 A;  1MKM A;  3HZJ A;  3WTW C;  2DTZ A;  2IW5 A;  3GTK J;  4UUT A;  4XMY A;  2VQL A;  1N25 A;  2LBF B;  2JPC A;  1RIO H;  1PJR A;  1GV2 A;  3BC8 A;  3JAM Z;  1X3U A;  3F8B A;  2V4J C;  1XS9 A;  4FE4 A;  5JVT A;  2QCO A;  4DW6 A;  3I54 A;  1IG7 A;  2E19 A;  5L3G A;  4U0Y A;  3GZ5 A;  2BV6 A;  1MH3 A;  4RB2 C;  3WGI A;  2P7V B;  5L3E A;  2YS9 A;  1X1P A;  1L3L A;  1DPU A;  1GUU A;  4AIK A;  2EFQ A;  3CF2 A;  2IP2 A;  1FSE A;  2E7X A;  2Q1Z B;  5K1Y A;  2G9W A;  3NEU A;  1T95 A;  5FLX K;  4II2 A;  2Q0O A;  3R61 A;  4C2M J;  4CZZ A;  1QU3 A;  3WGH A;  1OYY A;  3E5Q A;  3RIR A;  4IHT A;  3J7A O;  4L5E A;  2V6E A;  3HB9 A;  2E7W A;  1ZGJ A;  1HDP A;  1JUP A;  2HKX A;  2L7F P;  3GF2 A;  4M9X A;  3PO3 J;  2LVS A;  1IN5 A;  3HRU A;  2HYF A;  3UNG C;  2KMU A;  5L3C A;  3H9G A;  3P5J A;  3IAS 2;  3GTM J;  3RKQ A;  3F23 A;  3EDP A;  3NRV A;  4ZYE A;  5LEJ A;  1IW7 F;  1VF9 A;  3HTU A;  2X1D A;  1JI8 A;  1RZ4 A;  4ZH4 F;  3OOP A;  1PVE A;  2M87 A;  3LA7 A;  1FP1 D;  4A3C J;  2GQQ A;  3JRG A;  2KDO A;  4DBQ A;  2ZJ2 A;  3L2U A;  1WJA A;  2ZC2 A;  3SEQ A;  2QGU A;  1IDY A;  2WBM A;  1AHD P;  1H0M A;  3Q3S A;  4B3A A;  2IGN A;  4BKX A;  1LKX A;  3D1N I;  2D1V A;  1OMI A;  1SAU A;  3AKZ A;  1FBS A;  2EZL A;  4XL9 A;  3B6C A;  3FIW A;  3M7G A;  4B4C A;  2DU9 A;  1Z9C A;  3K1P A;  3K2A A;  3L09 A;  4LGW A;  1U8R A;  4WXC A;  2CSO A;  3EET A;  4LOC A;  4N0B A;  1X3W B;  1VZ0 A;  2ZME C;  1S29 A;  1E2X A;  1SFX A;  2DMT A;  4WK8 F;  3FM5 A;  2BZT A;  3LFK A;  1I50 J;  2D1H A;  2F4I A;  2CYY A;  1UJ8 A;  1ZG5 A;  1LDJ A;  4EM1 A;  4EQQ A;  2ELK A;  2OA4 A;  3SQN A;  3T8T A;  5DTD A;  1OR7 C;  3ZOB A;  4RGX A;  1XB4 A;  2V7F A;  4XIC A;  3WTY C;  1QHH D;  2DMU A;  4A0X A;  4V19 K;  5JHF A;  1K7A A;  1JKO C;  1B8I A;  2OC6 A;  4B43 A;  4FHT A;  4BY7 J;  5CVR A;  2X6W A;  3OYB A;  2O8K A;  4HSR A;  4KDP A;  1H9G A;  1R1U A;  2XSJ C;  3DKW A;  2FF4 A;  4KT5 C;  3IUO A;  3A0B C;  3A1Y A;  2R5Z A;  3BR3 A;  4F91 B;  3CCM I;  1KU3 A;  5ED4 A;  2LFB A;  1RI7 A;  3M1E A;  1FOX A;  3CJQ B;  1MMG A;  2XRL A;  2FML A;  1WKM A;  3LST A;  4UY8 I;  2Z9O A;  2Y31 A;  3CLO A;  4A3K J;  3H1C A;  1S6L A;  1QPM A;  5FKO A;  2IXS A;  2GIZ A;  1LDK B;  2VE9 A;  5AIQ A;  1G59 A;  3HEF A;  1HQC A;  1KYZ A;  1GT0 C;  1TQI A;  3I9V 2;  1P6R A;  1UB9 A;  5L3D A;  1OCC H;  2DMQ A;  3GZN B;  1ETY A;  2LBF A;  3W6K B;  2CJJ A;  2DTR A;  1ETX A;  2L4M A;  2Y2Z A;  3CF5 F;  2QSF X;  2XGC A;  5IOY A;  5FRO A;  1YRN B;  2W24 A;  1RNL A;  3G4S I;  2FNA A;  5GPA A;  1TNS A;  3F8M A;  2VC1 A;  3BTL A;  3P9K A;  1PDN C;  4IPA A;  1YLF A;  2E1M C;  3RDI A;  3J81 K;  4A3B J;  1ZK8 A;  2HXI A;  4L0Z B;  2GA2 A;  1XGM A;  4AVP A;  3HOY J;  4U7D A;  1TWG J;  1Z7L A;  3U9G A;  4UB6 C;  5BMZ A;  1APL C;  4IZZ A;  2ADU A;  2LTP A;  3JRA A;  1YJW I;  2BEO A;  4Y15 A;  4GRI A;  2EK5 A;  3ZMV A;  3OYD A;  4M71 A;  4P1W A;  2JVH A;  4CA0 A;  5HS9 A;  3OYL A;  2QSH X;  1QZY A;  3IV5 A;  2NNN A;  3HHG A;  4BS9 A;  2RV8 A;  3ZQQ A;  2L01 A;  4CYD A;  1U9O A;  4BJT A;  3FZV A;  5FKM A;  5IOZ A;  1JHF A;  3DLL F;  4EM0 B;  2CV1 A;  3A02 A;  3BT9 A;  5K5O A;  3ROU A;  1YQA A;  3D0S A;  4KA4 A;  2DFF A;  4XRS G;  1TQP A;  1UFM A;  2KRF A;  5E79 C;  3WTS C;  2HQN A;  4BDZ A;  3DBH B;  3OYF A;  3DLA A;  3I4P A;  1RR8 C;  3GLX A;  3S2D J;  2N8G A;  4A3J J;  5FJ8 J;  4NC8 A;  3NWS A;  2EFP A;  3CCV I;  3PL8 A;  4X6A J;  2ZME B;  4LB6 B;  5LLQ A;  3HOX J;  3I71 A;  2Z99 A;  3CDI A;  3FWE A;  1CF7 A;  3W6J B;  2DA1 A;  1Z05 A;  3HG9 A;  4KNY A;  5ERI A;  2KIQ A;  4A5M A;  1WFX A;  3CES A;  3ZQ7 A;  1J0R A;  2EV6 A;  3TP3 A;  2E60 A;  2NNY A;  3IH3 A;  2JTV A;  4XQF A;  2X48 A;  1V4R A;  4JOM A;  1XTA A;  2JPB A;  4Y4R A;  4L0Y B;  3HGY A;  3DFG A;  1FIA A;  5K7F A;  2GXG A;  3VEP A;  4WXD A;  1WJE A;  2KIF A;  3F9K A;  3K1N A;  1IUF A;  4IHY A;  1Y1V J;  1XD7 A;  2R7F A;  2WB1 A;  4Y52 J;  3QPH A;  1NG7 A;  2VBZ A;  2CFX A;  2XKO A;  3ZR8 X;  2E35 A;  5IPA A;  2LH9 A;  1W36 D;  5LGU A;  1EA3 A;  5J1Y A;  2Y0S N;  3DXJ F;  5CVI A;  2FMY A;  4AIH A;  3ECO A;  4P96 A;  1WJC A;  2M30 A;  2RGV A;  4I99 C;  1D0Y A;  2COM A;  4BHC A;  3TOB A;  2XB0 X;  1A6Q A;  2X0L A;  2NS7 A;  2LSO A;  3SYT A;  4NDL A;  2OD5 A;  4ZZD A;  4RGR A;  3QU3 A;  1PP7 U;  4BGD A;  4U0W A;  1MNE A;  4IL6 C;  3K0L A;  1VND A;  1Z0X A;  5ILU A;  1KU2 A;  3JRH A;  2JA7 J;  3JCU C;  4AM3 A;  1P4A A;  3DBL B;  2HTS A;  2OUM A;  1P7J A;  1Z91 A;  3BJO A;  3RZD J;  3QRF F;  2J5P A;  4PCQ A;  2LKX A;  1E0E A;  2CQN A;  3GVA A;  1YRN A;  2I5U A;  2X1E A;  2QUF A;  4NNJ A;  2DOD A;  2QWW A;  2IPQ X;  2GA1 A;  4G7Z F;  4RGU A;  1P4X A;  2M8G X;  2IT0 A;  2PI0 A;  3HOW J;  2BY1 A;  4UB8 C;  2MSY A;  1IC8 A;  3HTS B;  1XX5 A;  2L7M P;  1S72 I;  5C4X J;  4E7H A;  2XAF A;  4IVN A;  3WOD F;  3HOS A;  2E1C A;  3H5A A;  5IP6 A;  2MG4 A;  1VQP I;  1UAA A;  2LG4 A;  1JKP C;  1QZZ A;  4WF2 A;  2H6B A;  2TRT A;  1HST A;  2F5F A;  3BJ6 A;  4E7L A;  2QEX I;  4BY1 J;  3I4M J;  2O7O A;  3DU6 A;  3TP0 A;  2CQX A;  2W48 A;  1A31 A;  2P7C B;  3MD2 A;  3SFI A;  3U1K A;  4ZYD A;  3J7Z I;  1ETW A;  3W2V A;  1YX5 A;  2L3D A;  3KIO A;  1F36 A;  1OCT C;  3EUK L;  2O5R A;  1TTY A;  3LSK A;  1FTZ A;  2W57 A;  2EQR A;  2DK8 A;  3G1O A;  3BTC A;  5M5Y J;  1A5J A;  4LG0 B;  2IA0 A;  3Q0V A;  3CME I;  2HU9 A;  2ZFU A;  3S8P A;  3WE3 A;  4I0B A;  4M6Y A;  4QPO A;  3NAR A;  2I8D A;  3LFU A;  1USS A;  2ZME A;  1BI3 A;  1KON A;  2ACJ A;  2GM4 A;  4UUS B;  1U78 A;  2JUC A;  3R0A A;  3CCL I;  4G9Y A;  2EH3 A;  2DI3 A;  2OCE A;  2PMU A;  2HVS A;  4IRI A;  1STZ A;  4OMZ A;  5CVJ A;  2JZY A;  3ZQH A;  4KUM A;  1MDM B;  3RSN A;  2HS5 A;  1Y8R B;  3MZH A;  4B48 A;  3SJM A;  1NG6 A;  1H89 C;  4UNO A;  1SD4 A;  3DPT A;  3MZ8 A;  5LBQ A;  3O2P E;  3ZRG A;  4LD5 A;  1ZR4 A;  4JX5 A;  2PBI A;  1UEL B;  3ABK H;  4L5J A;  5EF6 A;  1DDN A;  4KN7 X;  2R93 J;  4HF0 A;  4GCV A;  1SC7 A;  4PSX A;  1FMV A;  1TT0 A;  4GFB A;  4GYI A;  2ZJR F;  3CD6 I;  1B1B A;  4EV0 A;  1KYW A;  4L9N A;  1R5I D;  2FUG 2;  4V2G A;  1MMN A;  1DPR A;  2K3F A;  1G3T A;  3QYE A;  4IF4 A;  2VBY A;  1GDT A;  4XSZ F;  5FLM J;  1JUM A;  1WH7 A;  4E7S A;  2W82 A;  1POG A;  1EH6 A;  3G73 A;  1TC3 C;  2JA6 J;  4WX9 A;  1VQ9 I;  4DZJ A;  4JQF A;  5DV5 A;  1V54 H;  4HX4 A;  2XDV A;  2R7R A;  1DU6 A;  1S3J A;  3M1C A;  2VLA A;  2IS2 A;  1VQ6 I;  1ZGW A;  1O3Q A;  4PJL A;  5J6X A;  1OJL A;  3M9A A;  2FXA A;  4CZC A;  2VJ4 A;  5FD5 A;  1LE8 B;  3CMM A;  2VT3 A;  1W4M A;  3CDH A;  3DQV C;  2V9P A;  4IJA A;  2OTL I;  5L3B A;  1T56 A;  3KP4 A;  4A3G J;  2F5E A;  2VON A;  4MO7 A;  4PGG A;  1QPI A;  3W3C A;  3CQZ J;  2VQH A;  5DM7 F;  2BGC A;  5EGO B;  2G7H A;  5B1A H;  1MIJ A;  3S3N A;  1WJ5 A;  2EIM H;  5D4R A;  4D1Q A;  3F72 A;  4WWC A;  4A69 C;  4IOC F;  3R60 A;  4PFO A;  4YFN F;  2MFZ A;  2BVM A;  3L2C A;  2MLG A;  1ULY A;  1TZL A;  2Z3Y A;  1E17 A;  2NOG A;  5BPI A;  3DKY A;  1IN6 A;  3EUH A;  3H92 A;  4PZJ A;  3CTA A;  3RKX A;  3L7W A;  3QYB A;  1EKE A;  3A0H C;  4ENN A;  5IT3 A;  2DAO A;  3CJN A;  4P55 A;  2RQP A;  4DBR A;  4UXN A;  4XM3 A;  5J8F A;  3KP7 A;  3I3L A;  2V1D A;  4M3F A;  3G1L A;  3ULQ B;  1JT6 A;  2QQ8 A;  4EJO A;  5E18 F;  4H4K C;  5H20 A;  4I6Z A;  4IOA F;  2R0Q C;  1SVO A;  2JSC A;  1DU0 A;  1IXS B;  2E5Z A;  2IAI A;  1JKR C;  1EF4 A;  2ZKZ A;  1X19 A;  5FLX Z;  5FD6 A;  3S3M A;  3S1R J;  2LDU A;  4ZDL A;  1WI3 A;  4UHT A;  2AHQ A;  3EUA A;  2ZB9 A;  2OPT A;  2P5V A;  5F0C A;  2QQB A;  2VUM J;  1O7L A;  1G8X A;  1BR4 A;  2VKE A;  1GV5 A;  4I7H A;  3E5X A;  2GXA A;  4D0P A;  4LG0 A;  1ZAO A;  5BS6 A;  2CO5 A;  2Z1D A;  2PN6 A;  1W5C C;  4EAT A;  3BG5 A;  5BOX A;  5J1R A;  4XRM A;  5KVR A;  3F6O A;  3J7A Y;  4BJ5 C;  2LP0 A;  4S05 A;  1PUF B;  2ETH A;  3LAP A;  3GCM A;  2YR2 A;  3R6S A;  2RVC A;  2IGM A;  3K7A J;  3JSP A;  3C2H A;  2M0C A;  4FIS A;  3I5U A;  1OCO H;  1WJB A;  4Q47 A;  4G12 A;  3OSF A;  3CP8 A;  4PFP A;  5GAE J;  3HYI A;  1R4M B;  3S1M J;  1ERD A;  2EFW A;  5IP7 J;  3TDU C;  5FRN A;  2ELH A;  2CU7 A;  3QAH A;  1FEX A;  5HLT A;  2K9S A;  3HRS A;  2BOL A;  3W2W A;  1FX7 A;  2DMP A;  3DKX A;  3P9I A;  3H9J A;  2DPU A;  1BIB A;  3N97 A;  2EZI A;  1BI2 A;  5FKN A;  1LEB A;  2QVO A;  4KN4 X;  1U9N A;  1XN7 A;  3S16 J;  4BQN A;  1UZC A;  1W1W E;  1X1B A;  2WAQ N;  2HTJ A;  2KQR A;  1X1D A;  3VSK A;  3CCU I;  3ERE D;  3TMO A;  1B9M A;  4NHJ A;  2K86 A;  2TCT A;  2NVU B;  3FXU A;  5FLV A;  3REO A;  4E70 A;  3QPS A;  3J80 K;  3O8G A;  4HLX A;  2BE5 F;  1ETO A;  1GVJ A;  1ZLJ A;  5JHU A;  3AG2 H;  4D7N A;  2BY2 A;  2Q2E B;  2KLO A;  3LQR A;  1RR7 A;  3ZCO A;  5HNF A;  4IX7 A;  4ENM A;  4ZDO A;  1R9T J;  4FX4 A;  1LE8 A;  3ZQG A;  5F64 A;  4NQW B;  1XDU A;  4J01 A;  2CV0 A;  5JI6 A;  1JE8 A;  2K85 A;  2STW A;  1RC9 A;  5C3E J;  4ENJ A;  1YHQ I;  4MIM A;  3O8H A;  4U88 A;  2CUE A;  4F3Q A;  2XGD A;  1TWC J;  3H36 A;  4DYR A;  2M7A A;  4A2U A;  1W36 C;  1NK2 P;  3HPH A;  2ZXW H;  1IUY A;  2UXN A;  3TQN A;  1TBX A;  2CQQ A;  3BY6 A;  3TOA A;  2M5W A;  4BQQ A;  3HOV J;  2ISY A;  3MFK A;  1B8I B;  2OV7 A;  4UVB A;  4A6D A;  4HZF A;  1IRX A;  3OR2 C;  4P9U A;  3TW6 A;  5A2Q Z;  5D8K B;  3V7C A;  3DBR B;  2QZ8 A;  5H6R A;  1HSJ A;  1X1C A;  3PFY A;  3ASN H;  1F43 A;  2R5Z B;  1BC8 C;  3G3Z A;  4HV6 A;  2IGK A;  2OBP A;  1J59 A;  3KP5 A;  1BC7 C;  2WV0 A;  1AU7 A;  4LK0 F;  2HPM A;  1CQT A;  4YFK F;  5CVV A;  1LQ1 A;  1R22 A;  2P6T A;  1IRG A;  2QM3 A;  4M74 A;  2E1O A;  3Q0W A;  5EZG A;  2M1B A;  3WE2 A;  3LMM A;  2A07 F;  1I1G A;  5GP9 A;  5LHI A;  1W0U A;  5E8G A;  3SZP A;  2IS1 A;  3CJT B;  3U1D A;  2FQ3 A;  3JRE A;  1BIA A;  2ZCW A;  3M07 A;  2ZNZ A;  1FP2 A;  1I3A A;  2GWR A;  1VTN C;  1U8B A;  2DXI A;  1U2W A;  2M4K A;  5JFR A;  3S17 J;  2A61 A;  4ETS A;  3ZP5 A;  4BXX J;  5FB2 A;  1PUF A;  4EM2 A;  3B6A A;  1RRJ A;  3OYI A;  3PUB A;  5F1J A;  5GTI C;  3HOT A;  3WU0 A;  3S14 J;  5HNH A;  1R58 A;  2ID3 A;  3KEY A;  3P7N A;  5HOD A;  4PK4 A;  4Q48 A;  2DT7 B;  2V6C A;  4BE2 A;  2G7U A;  1I6X A;  5TGT A;  1T6S A;  2VI6 A;  3EYY A;  1WGX A;  3GWZ A;  3GTG J;  4HEA 2;  3K1M A;  1Y0U A;  2PMZ N;  3HDD A;  3S1N J;  5F27 A;  4IRH A;  4KIF A;  2E2I J;  3HSR A;  2Y9Y A;  3BJA A;  2JA2 A;  4IEJ A;  3E0J B;  2DQR A;  2CQK A;  3QOE A;  5E3N A;  1B72 A;  4RLQ A;  4A3D J;  2XRN A;  1Y8Q B;  3PIP F;  1LJ9 A;  3I59 B;  2L7Z A;  3ZQL A;  2MBF A;  5M3M J;  2LRE A;  3MVP A;  3OYH A;  2O3F A;  1XDS A;  3GTP J;  3S32 A;  3E6C C;  3RQI A;  5M3F J;  2M0M A;  2P5K A;  1KU9 A;  2DA4 A;  4DOZ A;  2NS8 A;  2PMZ A;  4C2T A;  3DTI A;  5M5W J;  4XKV A;  1HW5 A;  4OU0 A;  3NAU A;  3VYU B;  1CF7 B;  3C2G A;  4XNF A;  2Q2E A;  3IWZ A;  3BR0 A;  3JR9 A;  1GLN A;  5ILV A;  2UV1 A;  4H0E A;  2R7U A;  2HPI A;  3FXL A;  4NQW A;  1VQK I;  4MEY F;  5CYV A;  3SHF A;  2DPD A;  4B44 A;  1I1S A;  2R7V A;  3ABM H;  3OV8 A;  2NRA C;  2CFO A;  1TWH J;  1TL8 A;  1LVK A;  3LA2 A;  4JX6 A;  2QYO A;  1V5F A;  2EIN H;  1VI0 A;  3GTL J;  3FXR A;  3OYC A;  2QQ9 A;  3FMQ A;  3X2Q H;  3HJE A;  2HFH A;  4M73 A;  2HGC A;  3M8E A;  3T5X A;  3TGN A;  1W7P D;  3K4J A;  4C30 A;  5GAD J;  1VQ5 I;  2EZK A;  2F4M B;  3DEW A;  4KIG A;  5CQG A;  2KT0 A;  1OPC A;  3DTK A;  4CSW A;  2CG4 A;  1YS7 A;  3OL4 A;  3IL2 A;  1YYV A;  2CUJ A;  1Z67 A;  2P4W A;  1GVD A;  1P9Q C;  3OYK A;  2FNP A;  1ZRD A;  2IA2 A;  4BU2 A;  3CUQ A;  1Z3X A;  1PYV A;  4M3G A;  3DPU A;  2J5O A;  3G2B A;  1R00 A;  1BOA A;  3MAJ A;  3ASO H;  2CW0 F;  3BTJ A;  4RGS A;  3CDL A;  1XC5 A;  3ZN1 A;  2OQR A;  3Q9V A;  1KQ8 A;  2R7W A;  4J19 A;  2MC4 A;  1R1T A;  5LHG A;  2MW8 A;  4PJJ A;  1YIO A;  2Z5U A;  2IBD A;  2BHZ A;  2ME6 A;  3BG9 A;  2GLO A;  2DJI A;  1KQ0 A;  2ZO4 A;  4U7B A;  1BW6 A;  5D6E A;  1F4K A;  1FIP A;  1IF1 A;  5IT9 Z;  2Y30 A;  3S15 J;  3PSF A;  3KX2 A;  1OYI A;  4JP0 A;  2V1N A;  1XG1 A;  1R7J A;  2VN2 A;  1N77 A;  2LLK A;  3FM3 A;  2HOE A;  2JA8 J;  3H35 A;  5BNG A;  2KP6 A;  3IP4 B;  4IHV A;  2F4O B;  2Z2S B;  3ZMU A;  3BCB A;  1ITY A;  4B1R A;  2EIJ H;  3EUH C;  2HOS A;  2DMN A;  2HVR A;  3SZT A;  2M9H A;  4XLC A;  3RI4 A;  2GXB A;  4RB3 C;  1MJA A;  2PX9 A;  3ZN0 A;  5AIP A;  3R0J A;  1U5T B;  3A4C A;  3L1P A;  2IS4 A;  3I59 A;  5HDG A;  3JAM K;  3GFI A;  2LR8 A;  9ANT A;  2HNH A;  3B73 A;  4KIC A;  5FKK A;  3MMY B;  3LAJ A;  3AL0 C;  3M8J A;  2EV0 A;  1MJ9 A;  2IRF G;  1FNN A;  2DOE A;  2XV4 S;  3V8L A;  3CCE I;  3KZZ A;  3E97 A;  1ZG1 A;  2F5D A;  4NC7 A;  1BOB A;  1MBE A;  1V3F A;  3LOC A;  3F21 A;  2XPU A;  1IGN A;  5TIS C;  5LEK A;  3GTO J;  3LNQ A;  4HPQ A;  1XMK A;  1IN8 A;  1OCR H;  3HKZ N;  4I98 B;  1MGT A;  3MZY A;  5EEA A;  2XAS A;  4JX4 A;  2FBK A;  4I02 A;  2JVG A;  4AID A;  1AOY A;  4A6E A;  3RPU D;  2VPR A;  2O03 A;  4CCN A;  3JRI A;  2JMW A;  1ZGA A;  1ZTR A;  4AIJ A;  4XON A;  3ABU A;  4M6X A;  5LGT A;  2FBI A;  1JXS A;  2RAE A;  2HZT A;  2XGE A;  3H0G J;  4FT8 A;  2XC7 A;  3PNY A;  1YJN I;  1XPX A;  5K5R A;  2LY9 A;  1FTT A;  1QVU A;  2R7O A;  4II3 A;  5GAG J;  1G3S A;  1FPQ A;  4E4H A;  2VB6 A;  3OS0 A;  2XAQ A;  1MMA A;  4M9Z A;  4AWX B;  1X58 A;  1BW5 A;  2JK3 A;  2O6G E;  2W1O A;  3R4K A;  2WAD A;  1D1A A;  3Q5F A;  2FQ4 A;  4NB5 A;  4XRS A;  3DPL C;  1IDZ A;  5LRS A;  3IH4 A;  3DP7 A;  2O0Y A;  2KHM A;  4KIB A;  1KA8 A;  4BYY A;  4OMY A;  1B9N A;  4BAY A;  3FXJ A;  2E34 A;  4J00 A;  1LPQ A;  4CDG A;  1SD6 A;  3ERM A;  3V7R A;  5DS9 A;  3L2V A;  2VXZ A;  2FE3 A;  2VBX A;  4GXO A;  5M5X J;  3DEE A;  4EGY A;  1ZRF A;  1EV7 A;  2Y0S A;  2CV2 A;  3QP6 A;  3BR1 A;  3TL4 X;  4BXU A;  4KYW A;  3S93 A;  3HSE A;  3G1M A;  3D5R C;  1ZEL A;  4CUG A;  4GDF A;  1E3P A;  1VQ4 I;  4OIQ F;  2HQR A;  3MKZ A;  3J7Y J;  4IHS A;  3U21 A;  1QQI A;  3C2B A;  2KDZ A;  2A05 A;  2H94 A;  4BDY A;  3C18 A;  1ENH A;  4HDV A;  1ZH5 A;  4ZDP A;  1YW8 A;  2ECC A;  4MFE A;  2JWT A;  1B4A A;  2VXD A;  3PUF A;  4D7M A;  2M2E A;  3KLN A;  3HRM A;  3QQA A;  3HIF A;  1LFU P;  5DEQ A;  4CXF A;  1LVA A;  3JSO A;  4DQ2 A;  3OL3 A;  2KZG A;  3K9T A;  4YEJ A;  3WTZ A;  4XRF A;  3AL0 B;  4ESB A;  2X6O A;  1R1V A;  3VYR B;  1OQY A;  2KL4 A;  3DWL E;  2RN7 A;  1U5T A;  2XAG A;  5J8C A;  3OYN A;  4B8X A;  4RB0 A;  3F22 A;  1JJ6 C;  1YIT I;  1YFH A;  4XR6 A;  2CQ7 A;  3EPZ A;  1O4X A;  1NHA A;  3RCO A;  4BQA A;  4PDK A;  2A6E F;  4C3I J;  3WHB A;  4L9V A;  2V9K A;  2L9V A;  4JK1 X;  1R71 A;  2LC2 A;  2L5Q A;  3E1S A;  4MLO A;  4GO1 A;  2LRD A;  3WG7 H;  1B6A A;  5K7H A;  1I6H J;  3L9F A;  4QSH A;  4LLN A;  3LQQ A;  2DBB A;  3ZGK A;  2XKP A;  1YOV B;  2EA4 A;  2AQF A;  3ZMZ A;  1ETQ A;  1SD5 A;  3HPG A;  1NTC A;  1MSE C;  3GO5 A;  3GEZ A;  1FOK A;  1DGW Y;  1FLI A;  1Q1H A;  2ZXJ A;  1S7A A;  5DM6 F;  3FXM A;  2BVL A;  1VQN I;  4L18 B;  2VKV A;  1UG2 A;  4WXH A;  3HRT A;  1UMQ A;  1I5Z A;  2YUS A;  4ASN A;  2EZH A;  3FDY A;  4CCO A;  4EEF G;  4Q4Z F;  2HOT A;  2QLZ A;  1KU7 A;  1FT9 A;  4OIP F;  1SMT A;  3WGG A;  3JW4 A;  2L4A A;  4GYG A;  1R23 A;  5ICF A;  1A36 A;  1OLT A;  3GXO A;  3E5U A;  4IKF A;  3CJR B;  1TW2 A;  5KAF C;  1I27 A;  4QIW N;  1DP3 A;  2KZV A;  2K7L A;  1GXP A;  2NVX J;  1U6G A;  4GGG A;  3DTE A;  4X1E A;  4LIU A;  1C0W A;  3T8R A;  1S8N A;  2QSG X;  3NQO A;  5F04 A;  2GOX B;  3K4N A;  1Z3Y A;  2ZJQ F;  1TLH B;  3FXQ A;  4OAY A;  4BBR J;  1G4D A;  2LF8 A;  2HDD A;  2DN0 A;  3P9C A;  2F5V A;  3PSI A;  4C3H J;  2GAU A;  3H3V K;  2JUG A;  5BPD A;  1X3Z B;  1FYL A;  4ZJZ A;  2DOF A;  1GHC A;  3ZMS A;  3ECH A;  1K61 A;  2OAZ A;  3IKV A;  1X1A A;  1ZG3 A;  3VSL A;  4L5I A;  4D9J A;  3MKW B;  1U3E M;  2HYJ A;  3MQ0 A;  4C3J J;  4XN3 A;  3GLL A;  5J4Y A;  4DZP A;  1D1C A;  3BOQ A;  1K79 A;  1HCR A;  3IRQ A;  1MMD A;  1FY7 A;  1AKH B;  2HQA A;  2A6T A;  4EVI A;  2PQ8 A;  3N05 A;  5B1B H;  1G6N A;  1O57 A;  3BP8 A;  1TT5 B;  3NWT A;  2H09 A;  4M72 A;  1HBX G;  5JLX A;  3M4O J;  2UWM A;  5FGM A;  2QBY B;  2LKS A;  4RA2 A;  3QOD A;  1QA6 A;  4NUB A;  2MAB A;  1TNT A;  3ZPL A;  3CO7 C;  1EJ9 A;  2R7Z J;  3VOD A;  2DA6 A;  3H3Z A;  3FKI J;  4FX0 A;  3A01 B;  4YRV A;  3KP6 A;  1R4N B;  4AYB N;  4E7Z A;  1ZHF A;  4LJZ F;  2K3P A;  1MBF A;  3AFH A;  3BQZ A;  3KYD B;  4MHG A;  2W7N A;  5GAH J;  3GZ6 A;  1ZN2 A;  4BE1 A;  1S7O A;  2KFD A;  4F93 B;  4DIQ A;  3QPT A;  3HOU J;  5ICG A;  2XB5 A;  6PAX A;  1B59 A;  4HQE A;  2DA2 A;  3CUQ C;  1Y1W J;  4UV8 A;  4V2F A;  1YO5 C;  3ISP A;  5F08 A;  1ODD A;  4DJA A;  5D5W B;  3CMY A;  1MND A;  3FBI B;  3RPQ A;  1VQ7 I;  4NBQ A;  3FK7 A;  4P9F A;  2VOO A;  4OWR B;  1HDD C;  4ABZ A;  4LLL A;  2BYV E;  3QP5 A;  2K40 A;  1UHW A;  1Z7U A;  1T8I A;  2IVM A;  3SEZ A;  2RRE A;  4G6Q A;  1K4S A;  3VYT B;  3VOE A;  1HF0 A;  1BL0 A;  1D8K A;  3JTH A;  4I0A A;  1FBU A;  2COB A;  4B3X A;  2JRM A;  5F1R A;  3OYM A;  1SFK A;  1HKQ A;  1OIS A;  1V5E A;  2DW4 A;  1G3W A;  2R7T A;  5EG0 B;  4I76 A;  2E1N A;  2WY7 Q;  4QPQ A;  4DGW B;  2XUB A;  3RZO J;  3ABT A;  3BQY A;  1RUO A;  2EV5 A;  3F6V A;  3CUO A;  1B72 B;  1W5T A;  5LHH A;  3PNT A;  1LB2 A;  1TWA J;  3D5S C;  2W25 A;  2KPM A;  3RYR A;  5GTH C;  1NK3 P;  5FFZ A;  1S9H A;  3GME A;  2HQ5 A;  3KEQ A;  3K4B A;  3OMY A;  3CCQ I;  4A93 J;  2UXX A;  2XPW A;  2ISZ A;  4RS8 A;  1Z21 A;  2GBY A;  5E17 F;  4RBO A;  1SVL A;  2K9M A;  1Z6T A;  3AAF A;  3BG3 A;  4XSX F;  4G6T B;  2I10 A;  4OIR F;  4X0G A;  1T39 A;  4ZYA A;  4M6V A;  1IRZ A;  2NYX A;  4MTE A;  3TO7 A;  2NVY J;  1MBK A;  1TW3 A;  1W7P B;  2WAQ A;  1W5S A;  5E20 A;  1MJB A;  3KP3 A;  1DGR M;  1K78 A;  3GBG A;  5J40 A;  3LWF A;  1ONV A;  3OYG A;  3V8K A;  2FA5 A;  1Y0N A;  1SFU A;  2OQG A;  2XF6 A;  5D6F A;  1ORK A;  5CKT A;  1FZP B;  3W2A A;  2LF7 A;  1Z6R A;  2DA3 A;  2EJR A;  4RM3 A;  4A3F J;  3GW2 A;  4HV5 A;  3DF8 A;  1FYK A;  4BXF A;  3FMR A;  1P4W A;  3MCZ A;  4M3E A;  2MA3 A;  1QO0 D;  5E1Z B;  3GUD A;  2UZK A;  3I4N J;  3QYF A;  1WQ2 A;  4G94 A;  4IHW A;  1AKH A;  4BBS J;  2XSD C;  2E5N A;  4EJV A;  4ZYG A;  1G3Y A;  4A3I J;  2ZSH B;  4E7J A;  2LK2 A;  4MEX F;  2ZJP F;  3K69 A;  2JQ7 A;  1YW7 A;  1UST A;  2QBY A;  2RNJ A;  1WCM J;  3V4G A;  3L2Q A;  1MH4 A;  2HXO A;  5B3S H;  1JUS A;  3OWT A;  3DV8 A;  1X4P A;  3WU1 B;  3OYA A;  3S1Q J;  5J4V A;  3OIO A;  2NXN B;  3FK6 A;  1T38 A;  1OCP A;  2NVT J;  1YX3 A;  3MEX A;  1FJL A;  3J81 Z;  2PJR A;  3RKY A;  1P92 A;  2DLL A;  3CUQ B;  5HDK A;  3A01 A;  2LY2 A;  2RQQ A;  1I3Q J;  4L9T A;  2L7K A;  2BXZ A;  4MNU A;  5D8L B;  3I56 I;  4XKC A;  3K4K A;  3G71 I;  3BR2 A;  1E3O C;  2A69 F;  4D5C A;  1H88 C;  3OIP A;  1RPW A;  4LB5 A;  2FRH A;  3ZMD A;  2HOA A;  2YX7 A;  1FBQ A;  3OY9 A;  2MLK A;  3BRO A;  1XCV A;  5IYB J;  1VQM I;  1K83 J;  1IJW C;  5LGN A;  3A03 A;  3FMS A;  2P5L C;  3KEO A;  2OF7 A;  3TW7 A;  2QKM B;  4Y33 A;  4IQJ A;  3F8F A;  2STT A;  1BM9 A;  5LD2 C;  5FFX A;  2H6C A;  3AG4 H;  3TED A;  4D5F A;  3H5R A;  2WA0 A;  2ZXH A;  3LSH A;  2KIS A;  1QHG A;  1JTX A;  2A68 F;  1FMW A;  1TP4 A;  4CGZ A;  5EG0 A;  2LOO A;  3VFZ A;  2YU3 A;  1XMA A;  3ZQC A;  2R7Q A;  2Z33 A;  2WTE A;  3KYC B;  1WRJ A;  2K5C A;  2LY1 A;  4PJ0 C;  2V9V A;  1YJ9 I;  2CGP A;  4QLC U;  1Y56 A;  4A3E J;  4RB1 A;  2VBW A;  5ILS A;  4S04 A;  4YEL A;  4JYK A;  4KFC A;  1WI9 A;  4HG2 A;  4OIO F;  2X1C A;  1D0X A;  1ZYR F;  2Y0M A;  3KFW X;  3OR1 C;  4CCM A;  3UR3 C;  4A12 A;  3C1D A;  2YSR A;  1U5T C;  1ZLK A;  4MGR A;  2O8X A;  1LEA A;  2KIU A;  3E7L A;  4UV9 A;  4EMS A;  4XBF A;  1BR2 A;  3CC2 I;  2DOA A;  2BY3 A;  4JBA A;  3LA3 A;  5C44 J;  2DA7 A;  1FWZ A;  4G6D A;  3GTQ J;  1PP8 F;  1W7P A;  2WAE A;  3JRD A;  2LD5 A;  2W4S A;  1MBH A;  2F6C A;  3CC4 I;  1W0T A;  1SAN A;  1K6O A;  2A6H F;  2V1U A;  1QNT A;  3BZC A;  4BE0 A;  3T0Y A;  4HDU A;  2L2O A;  5HVQ C;  2JN6 A;  2XVC A;  1IRF A;  3VDX A;  4LG3 A;  2IGO A;  2P81 A;  3FKJ A;  4AU7 A;  3HOZ J;  3KP2 A;  4N9I A;  4EJW A;  1D1B A;  1PUE E;  4Q5S F;  2DYR H;  2CRG A;  1D3Y A;  3CCY A;  1I39 A;  1J9I A;  4R79 A;  3K10 A;  3TDZ C;  3CCS I;  4U87 A;  4RDU A;  1FYM A;  4EJU A;  1IO2 A;  4RAG A;  3RYP A;  2DA5 A;  2CMP A;  5B5E C;  3CLQ A;  3HBL A;  2XF5 A;  1ZQ3 P;  2EIL H;  4AVZ A;  2VL8 A;  2VIX A;  1A35 A;  1DQU A;  3CCJ I;  5DCF A;  5HLH A;  1XMX A;  2VKH A;  5CJ9 A;  3GYH X;  4A5N A;  1OKR A;  3N4M A;  1FC3 A;  1WHU A;  3WHC A;  2MGQ A;  2L9R A;  4A3L J;  1YW9 A;  2XPV A;  2A3S A;  2HZD A;  3FF5 A;  2IJL A;  5HDN A;  1BN5 A;  4HAM A;  1FOY A;  2EFO A;  2YX4 A;  5EYR A;  2HWV A;  5IYD J;  2W85 A;  2L54 A;  3S3O A;  3SDG A;  4BNC A;  2K9Q A;  3K4M A;  2BW3 B;  3JTG A;  3SDB A;  3HUG B;  2FOK A;  4BL0 B;  4DYC A;  1ETV A;  1LFB A;  3K70 D;  2XF7 A;  5H6Q A;  1R5H A;  5HOO A;  3L00 A;  5A2Q K;  3UKG A;  4R1H A;  2PLY A;  1HC8 A;  3K4L A;  5CQE A;  2HDC A;  2ESN A;  2ECB A;  3IH2 A;  2LYC A;  1T33 A;  2P0W A;  2R5Y B;  2NS0 A;  4KIS A;  2DCE A;  1AWC A;  1IV6 A;  1F5T A;  1MSF C;  3BR6 A;  4RMN A;  2EWN A;  4E7K A;  5L3F A;  5DCM B;  4XLP F;  2HR3 A;  3CO6 C;  1XGN A;  1YI2 I;  4BJ6 C;  3L2W A;  1JJ8 C;  2CW8 A;  3TBI A;  2CW7 A;  3RKW A;  2X51 A;  1ZR2 A;  1YTY A;  2AQE A;  4PGH A;  5DD8 A;  3RPU A;  5K7Z A;  2XAH A;  1MNM C;  2X4H A;  1RKW A;  2VC0 A;  5F0F A;  2R4G A;  3GFM A;  2OZ6 A;  3BDD A;  1HW2 A;  1XSX A;  4ON0 A;  4BUP A;  3E6D A;  4BEH B;  1T98 A;  4KJZ A;  5IYC J;  1R6R A;  4M3B A;  5CPR B;  4P5O A;  1MW7 A;  2VE8 A;  4RAF A;  2H1K A;  3KPH A;  2O9L A;  1ZKG A;  2WY8 Q;  1T0F C;  4ZYH A;  5IY5 H;  2R3S A;  4Y7N J;  5E3L A;  4XLE A;  2PMH A;  1MBJ A;  2M4G A;  2BBY A;  4S0H B;  1KZH A;  3BG6 A;  1XGO A;  3LSG A;  4Y17 A;  2M3A A;  4XKB A;  1JKQ C;  1HOM A;  2MD0 A;  3PNV A;  2KJB A;  4LLG F;  5BQT A;  3AG1 H;  2AXT C;  2VOD A;  4HRI A;  3K6G A;  4MFD A;  2RDP A;  3HKZ A;  3I53 A;  2UUZ A;  3BZK A;  2KIM A;  2WB1 N;  3I58 A;  4YIR X;  3WTU C;  2JA5 J;  3W6V A;  1RKT A;  4M3D A;  2Y75 A;  4XLH A;  4CO8 A;  1WPK A;  1EH7 A;  3FX3 A;  2VPL A;  4KMU X;  5KK1 A;  1H9T A;  1EH8 A;  5KCM A;  2L9S A;  4BQO A;  1DP7 P;  4ITV A;  1ZRC A;  4G7O F;  2FEZ A;  4CIC A;  4Y13 A;  3C7J A;  4N4N B;  2EBI A;  4FQG A;  5DYM A;  4CCK A;  1L0O C;  4A0Z A;  2GZW A;  5JR3 A;  4ZTJ A;  1IAW A;  3BTI A;  5LFA A;  2B7E A;  3CCR I;  1X2M A;  2D5V A;  4KMF A;  4U0V A;  2PG4 A;  1J7K A;  2RC4 A;  2R7D A;  3AG3 H;  4HNV A;  5D5V B;  4XID A;  2VOP A;  5E1W A;  3GX4 X;  2ZXI A;  5F6F A;  1BJA A;  4DYQ A;  5DUK A;  2ZFW A;  4BAC A;  3PQK A;  5B66 C;  4MQ9 F;  3KE2 A;  2BW3 A;  2WC2 A;  4HNU A;  3SZG A;  1ON1 A;  1R49 A;  5EZH A;  1E3H A;  2ESH A;  3HUG A;  5ICE A;  4MQV A;  5TRD A;  1V5G A;  1WJD A;  2D45 A;  3FBN B;  4EJT A;  4CYC B;  4PJM A;  4CCJ A;  4HOB A;  1J75 A;  2W00 A;  3F8N A;  3OIQ A;  4FTH A;  1R5G A;  4ESJ A;  3A2K A;  4HX7 A;  1QZE A;  2E1M B;  2XRO A;  4G7H F;  2YU9 J;  2R5Y A;  1WH5 A;  2DO7 A;  1V55 H;  3ABL H;  3LSJ A;  5FO5 A;  2B0L A;  2PFB A;  1SFO J;  3CC7 I;  3FXO A;  5K5Q A;  5DCM A;  4F7Z A;  4W1U A;  4IHX A;  4HF2 A;  2M7B A;  3ELK A;  3MN2 A;  3QU6 A;  3BCA A;  3IC7 A;  2CUF A;  3DCF A;  4XOT A;  1BI1 A;  2MD5 A;  1BJZ A;  4IXA A;  4LFU A;  3SXY A;  2K4J A;  5KNL A;  2HEO A;  2E36 A;  3HXL A;  3OS2 A;  1H8A C;  2DDA A;  2DQL A;  3ML6 A;  2H8W A;  1JGS A;  1ON2 A;  3O6B B;  3DU5 A;  3V8J A;  4BHP A;  3Q0U A;  2GIV A;  2H27 A;  1BBY A;  2FX0 A;  4BEH A;  1JGG A;  3OYJ A;  1MZB A;  2K02 A;  2XHK A;  3KZI C;  2C6Y A;  2DFE A;  4LK1 F;  3K4C A;  1K6Y A;  2ZNY A;  3H9Q A;  1J5Y A;  4XLF A;  3ONQ A;  2AS5 F;  4XLN F;  3I0T A;  5J1U A;  1UG0 A;  5IT9 K;  2BY0 A;  1SD7 A;  4M9S A;  3FHZ A;  3VWB A;  3QWL A;  4F55 A;  1HA8 A;  1IN7 A;  1IXC A;  2ZSI B;  3G6E I;  1R36 A;  1WJF A;  4LIV A;  2CWE A;  5GPC A;  4CH7 A;  4F52 A;  2H1L A;  1TWF J;  3C3W A;  3KLO A;  4IQ4 A;  1ZRE A;  2R7S A;  5CVU A;  2OZU A;  1Z1D A;  4Z2Y A;  3BG7 A;  4XOP A;  4AD9 A;  3J80 Z;  4ENK A;  1KGS A;  2AO9 A;  1MD0 A;  3HL2 A;  3RQ4 A;  2W84 A;  5EDN A;  4K2E A;  1O3S A;  2HDW A;  2EPF A;  2M34 A;  2E2J J;  4N4O B;  3DEU A;  4PUS A;  4OIN F;  3QOP A;  1ZAR A;  4OOI A;  2F48 A;  2X6Y A;  2OU2 A;  1XSV A;  2E71 A;  2NAZ A;  1OR7 A;  2OCC H;  5AON A;  2B63 J;  3FHN A;  3FIS A;  3U2R A;  3V42 A;  1XSD A;  4PJN A;  1T2K A;  2IS6 A;  3OS1 A;  1J2X A;  2VQG A;  1J09 A;  4HBL A;  1GXQ A;  4I2O A;  4QWQ A;  4E7I A;  3IHU A;  3EYI A;  3O3K A;  4UVC A;  4HNT A;  1OYW A;  2HKO A;  2MH2 A;  3VB2 A;  2OTJ I;  1RET A;  2LNB A;  1UHS A;  3JRF A;  2L02 A;  1DUX C;  3S2H J;  3E3V A;  2VJJ A;  1QBJ A;  1TQM A;  3SFZ A;  2F5C A;  5E3O A;  1VQL I;  2KRC A;  1S5L C;  4B47 A;  1O7F A;  4RLF A;  1K78 B;  1YE9 A;  2ME0 A;  3GFJ A;  2FJ1 A;  1LNW A;  5F0H A;  3RTR A;  1OCZ H;  3ESW B;  1NH3 A;  2K9L A;  1WWX A;  2F2E A;  1VFC A;  2XAJ A;  1ETK A;  3HSF A;  4N9H A;  4QTR A;  3MWM A;  4O6J A;  4HA8 A;  1LFP A;  1OFC X;  3WTX C;  1WSU A;  5EEG A;  1WZ2 A;  5KAI C;  1CGP A;  1S7E A;  2M8E A;  3M3Y J;  1HKT A;  2QA4 I;  2KJC A;  5DD4 A;  4KIT B;  3KET A;  1G2H A;  1F9N A;  2P6S A;  2DFH A;  4CYC A;  4XK4 A;  2V79 A;  1SAX A;  4R8H A;  1WVR A;  2H8R A;  5FKL A;  3F0C A;  2CUZ A;  2NVQ J;  5TJJ A;  2KRH A;  2FSW A;  2JSP A;  1BR1 A;  4I09 A;  3LSR A;  4OAZ A;  2QKL B;  3LSP A;  4A3M J;  4EGZ A;  2TDX A;  2XIG A;  5D5X B;  4NC6 A;  3K2Z A;  1AA7 A;  1P7I A;  1Z77 A;  2VT2 A;  2FD5 A;  2DK5 A;  3K70 C;  1SFE A;  4IRG A;  2MH9 A;  4AUX A;  2PJR B;  4HX8 A;  5HLG A;  3OYE A;  2E2H J;  3S2W A;  2Q8K A;  4YII A;  1BI0 A;  1K4T A;  5JLW A;  3LSI A;  4LMY A;  1YG2 A;  2VJ5 A;  2L9N A;  3WU2 C;  3KCC A;  2YPR A;  4O5V A;  4O3M A;  2QF7 A;  3ZMT A;  3TO6 A;  1X2N A;  2M45 A;  3F3X A;  2AXL A;  2HYG D;  1KQ9 A;  5HS7 A;  1T0F A;  4TV7 A;  3PFI A;  3PQJ A;  3TO9 A;  2IEK A;  2ID6 A;  3PM1 A;  3T1B A;  1UCR A;  1FSH A;  4HYE A;  1JTY A;  1MMS A;  1QRY A;  5DDG A;  5HLI A;  4AYB A;  2XGX A;  4AC0 A;  3PJR A;  3CP2 A;  3FXK A;  2LKP A;  3BPV A;  1SVM A;  4B09 A;  3KYL A;  4ZTF A;  1UHM A;  5HS8 A;  3B02 A;  3CZ6 A;  2EIK H;  2WAF A;  4ANJ A;  5E3M A;  3LSM A;  3Q9S A;  4Y3O A;  1X4O A;  4ZZL A;  3BR5 A;  4LIT A;  4MTD A;  2V1X A;  2BXY A;  5IP9 J;  1VQO I;  2VKD A;  4A0Y A;  1IV8 A;  2QEN A;  1N75 A;  2Z16 A;  4ESF A;  2D2W A;  3GTJ J;  4KT6 A;  1D5Y A;  4RAY A;  2GOM A;  1LDD A;  4UUS A;  5E8I A;  1ACI A;  1HLV A;  4XOR A;  4ZC3 A;  5EJC A;  3TKY A;  3IRR A;  2V26 A;  2VAS A;  1A6I A;  1F1Z A;  2KKO A;  1MDM A;  1JHH A;  3COA C;  2B9S A;  1QVT A;  2HI3 A;  3PIO F;  2Y48 A;  4BH9 A;  1HW1 A;  1IXR C;  1IZ1 A;  2X9D A;  3I55 I;  2DJN A;  2P8T A;  4DNC A;  1YS6 A;  3QPL A;  2DT6 A;  3WTV C;  5J47 A;  1FOW A;  3IKT A;  2Y69 H;  3BWG A;  5J3L A;  4W97 A;  4BHB A;  4E6K G;  2FU4 A;  3WG9 A;  3CMA I;  3M8F A;  3WTT C;  1Y39 A;  4FCY A;  2PJP A;  3JRC A;  3BZ6 A;  3OOU A;  3OSG A;  3IAM 2;  3E6M A;  4RM2 A;  4HQM A;  2EFN A;  3BLY A;  2K9N A;  3VYS B;  2X85 A;  1SEU A;  4HST A;  1A04 A;  4HW0 A;  2L0K A;  2BHY A;  5E1X A;  5FRM A;  4G8X A;  4CHU A;  1Y6I A;  5H2F C;  2A5W A;  4YFX F;  3PO2 J;  1D5V A;  4XLA A;  1XCB A;  1HXD A;  1IN4 A;  2VQC A;  1MBG A;  2A5Y B;  3F8C A;  1Q1V A;  1D0Z A;  4RAZ A;  2DT5 A;  1VQ8 I;  1U0J A;  3ZXS A;  2EB7 A;  4UUV A;  3D5L A;  1P2F A;  5LRR A;  2NOJ B;  3H3U A;  2XAU A;  1RUN A;  1XGS A;  4WCG A;  5DUI A;  2FBH A;  4HLY A;  1D8J A;  4PSW A;  4XN0 A;  4YG2 F;  4Z6Y A;  4CCL A;  2RNG A;  4C2U A;  2R92 J;  1LUJ B;  2HVQ A;  2IA1 A;  2PEX A;  2QQA A;  2DYS H;  3L2R A;  3KZY A;  5KHD A;  1RES A;  5EGO A;  3GFL A;  2MC3 A;  5JVG F;  4HF1 A;  1QGP A;  2WWY A;  2EA2 A;  1T08 B;  1REP C;  4L9J A;  4FET A;  2O61 A;  1O3T A;  1JT0 A;  1SMY F;  2MYS A;  1M1E B;  4I01 A;  3JRB A;  2ICW G;  4IO9 F;  3E6B A;  3RJP A;  2RKH A;  2WV1 A;  2K27 A;  1HKS A;  2CS3 A;  2FOW A;  2R7X A;  3HM5 A;  3VPR A;  1BA5 A;  2Y9Z A;  3MKL A;  2OJE D;  3MKY B;  3H0D A;  3ZQF A;  2K4B A;  4XKW A;  4UVA A;  5CLS A;  5D4S A;  3HC7 A;  2JRT A;  3HHH A;  2CH0 A;  3H5N A;  3HGG A;  3BPX A;  5C4J J;  3IWF A;  3I64 A;  2ELJ A;  3EQL F;  3LL7 A;  4FAS D;  1O3R A;  1N78 A;  1YIJ I;  5EEH A;  2JJ7 A; 
#chains in the Genus database with same CATH homology
 4YIF A;  2DFI A;  5D5U B;  5ICC A;  3V7S A;  2ZBK A;  2JT1 A;  1MKM A;  3WTW C;  2IW5 A;  2JPC A;  1RIO H;  3JAM Z;  1X3U A;  3F8B A;  5JVT A;  3I54 A;  5L3G A;  4U0Y A;  3GZ5 A;  2BV6 A;  4RB2 C;  3WGI A;  2P7V B;  5L3E A;  1L3L A;  1DPU A;  4AIK A;  2EFQ A;  5K1Y A;  2IP2 A;  1FSE A;  2E7X A;  5FLX K;  2G9W A;  3NEU A;  2Q0O A;  3R61 A;  4CZZ A;  3WGH A;  1OYY A;  3E5Q A;  3RIR A;  4IHT A;  3J7A O;  2E7W A;  1ZGJ A;  2HKX A;  3GF2 A;  4M9X A;  1IN5 A;  3HRU A;  2HYF A;  5L3C A;  3F23 A;  3EDP A;  3NRV A;  4ZYE A;  5LEJ A;  1IW7 F;  3HTU A;  1RZ4 A;  4ZH4 F;  3OOP A;  2M87 A;  3LA7 A;  1FP1 D;  2GQQ A;  2ZJ2 A;  1H0M A;  2D1V A;  1OMI A;  1FBS A;  3M7G A;  2DU9 A;  1Z9C A;  3K1P A;  3L09 A;  4LGW A;  1U8R A;  4WXC A;  2CSO A;  3EET A;  4N0B A;  1S29 A;  1E2X A;  1SFX A;  4WK8 F;  3FM5 A;  3LFK A;  2D1H A;  2CYY A;  1ZG5 A;  1LDJ A;  4EM1 A;  4EQQ A;  2OA4 A;  3SQN A;  3T8T A;  4RGX A;  1XB4 A;  3WTY C;  4A0X A;  1K7A A;  4FHT A;  5CVR A;  4KDP A;  1H9G A;  1R1U A;  3DKW A;  2FF4 A;  4KT5 C;  1KU3 A;  5ED4 A;  1RI7 A;  3M1E A;  2FML A;  1WKM A;  3LST A;  2Z9O A;  3CLO A;  1S6L A;  1QPM A;  2VE9 A;  1LDK B;  5AIQ A;  1HQC A;  1KYZ A;  1TQI A;  1P6R A;  1UB9 A;  5L3D A;  3W6K B;  2DTR A;  2L4M A;  2W24 A;  1RNL A;  2FNA A;  1TNS A;  3F8M A;  2VC1 A;  3P9K A;  1PDN C;  4IPA A;  1YLF A;  3RDI A;  3J81 K;  4L0Z B;  2GA2 A;  1XGM A;  4AVP A;  4U7D A;  3U9G A;  5BMZ A;  2ADU A;  2BEO A;  4Y15 A;  2EK5 A;  3ZMV A;  4M71 A;  5HS9 A;  1QZY A;  2NNN A;  3HHG A;  2RV8 A;  2L01 A;  4CYD A;  3FZV A;  1JHF A;  4EM0 B;  5K5O A;  3ROU A;  1YQA A;  3D0S A;  4KA4 A;  1TQP A;  1UFM A;  2KRF A;  3WTS C;  2HQN A;  3I4P A;  3GLX A;  2EFP A;  2ZME B;  4LB6 B;  5LLQ A;  3I71 A;  2Z99 A;  3FWE A;  1CF7 A;  3W6J B;  1Z05 A;  4KNY A;  5ERI A;  4A5M A;  3ZQ7 A;  1J0R A;  2EV6 A;  2NNY A;  2JTV A;  1V4R A;  2JPB A;  4L0Y B;  3DFG A;  2GXG A;  3VEP A;  4WXD A;  2KIF A;  3K1N A;  1XD7 A;  2R7F A;  3QPH A;  2VBZ A;  2CFX A;  2XKO A;  5LGU A;  3DXJ F;  5CVI A;  2FMY A;  4AIH A;  3ECO A;  4P96 A;  2M30 A;  2RGV A;  2COM A;  4BHC A;  3TOB A;  2X0L A;  2LSO A;  2OD5 A;  4ZZD A;  4RGR A;  3QU3 A;  1PP7 U;  4U0W A;  3K0L A;  5ILU A;  1KU2 A;  1P4A A;  2HTS A;  1Z91 A;  3BJO A;  3QRF F;  2J5P A;  4PCQ A;  3GVA A;  2QUF A;  2QWW A;  2IPQ X;  2GA1 A;  4G7Z F;  4RGU A;  1P4X A;  2IT0 A;  2PI0 A;  3HTS B;  2XAF A;  4IVN A;  3WOD F;  3HOS A;  2E1C A;  1QZZ A;  4WF2 A;  2H6B A;  1HST A;  2F5F A;  3BJ6 A;  2P7C B;  4ZYD A;  2L3D A;  1TTY A;  2W57 A;  2DK8 A;  4LG0 B;  2IA0 A;  3WE3 A;  4I0B A;  4M6Y A;  1USS A;  2ZME A;  1BI3 A;  2ACJ A;  1U78 A;  3R0A A;  4G9Y A;  2DI3 A;  4IRI A;  2PMU A;  1STZ A;  4OMZ A;  5CVJ A;  2JZY A;  4KUM A;  1MDM B;  2HS5 A;  3MZH A;  4UNO A;  1SD4 A;  3DPT A;  5LBQ A;  3O2P E;  4LD5 A;  2PBI A;  4L5J A;  1DDN A;  4KN7 X;  4HF0 A;  4GCV A;  4GYI A;  1B1B A;  4EV0 A;  1KYW A;  4L9N A;  4IF4 A;  1DPR A;  1G3T A;  2VBY A;  4XSZ F;  1EH6 A;  3G73 A;  4WX9 A;  4JQF A;  5DV5 A;  4HX4 A;  1S3J A;  1O3Q A;  5J6X A;  3M9A A;  2FXA A;  5FD5 A;  2VT3 A;  1W4M A;  3CDH A;  3DQV C;  4IJA A;  5L3B A;  3KP4 A;  2F5E A;  2VON A;  4PGG A;  2BGC A;  2G7H A;  5D4R A;  3F72 A;  4WWC A;  3R60 A;  4YFN F;  3L2C A;  2MLG A;  1ULY A;  2Z3Y A;  1E17 A;  5BPI A;  1IN6 A;  3EUH A;  3H92 A;  4PZJ A;  3CTA A;  3RKX A;  3L7W A;  4ENN A;  5IT3 A;  2DAO A;  3CJN A;  4P55 A;  2RQP A;  4UXN A;  5J8F A;  3KP7 A;  2V1D A;  4EJO A;  3ULQ B;  5E18 F;  5H20 A;  2JSC A;  1IXS B;  2ZKZ A;  5FLX Z;  5FD6 A;  2LDU A;  4UHT A;  2P5V A;  2QQB A;  1O7L A;  4I7H A;  3E5X A;  4D0P A;  4LG0 A;  1ZAO A;  5BS6 A;  2CO5 A;  2PN6 A;  5BOX A;  5KVR A;  3F6O A;  4S05 A;  2ETH A;  3LAP A;  3R6S A;  2YR2 A;  2RVC A;  3JSP A;  3I5U A;  4Q47 A;  3HYI A;  2EFW A;  3TDU C;  2ELH A;  3QAH A;  3HRS A;  1FX7 A;  3P9I A;  2DPU A;  1BIB A;  3N97 A;  1BI2 A;  1LEB A;  2QVO A;  4KN4 X;  1XN7 A;  2HTJ A;  3ERE D;  1B9M A;  4NHJ A;  2K86 A;  3FXU A;  3REO A;  4E70 A;  3J80 K;  4HLX A;  2BE5 F;  1GVJ A;  1ZLJ A;  5JHU A;  3LQR A;  4ENM A;  4FX4 A;  5F64 A;  1XDU A;  5JI6 A;  1JE8 A;  2STW A;  4ENJ A;  4U88 A;  4A2U A;  1IUY A;  2UXN A;  3TQN A;  1TBX A;  3BY6 A;  3TOA A;  2M5W A;  2ISY A;  3MFK A;  4UVB A;  4A6D A;  4HZF A;  4P9U A;  5A2Q Z;  5D8K B;  3V7C A;  2QZ8 A;  5H6R A;  1HSJ A;  1BC8 C;  3G3Z A;  4HV6 A;  2OBP A;  1J59 A;  3KP5 A;  1BC7 C;  2WV0 A;  4LK0 F;  4YFK F;  5CVV A;  1LQ1 A;  1R22 A;  2P6T A;  1IRG A;  2QM3 A;  4M74 A;  3WE2 A;  2M1B A;  2A07 F;  1I1G A;  5LHI A;  5E8G A;  3SZP A;  3U1D A;  2FQ3 A;  1BIA A;  2ZCW A;  2ZNZ A;  1VTN C;  1FP2 A;  2GWR A;  1U2W A;  5JFR A;  2A61 A;  4ETS A;  3ZP5 A;  5FB2 A;  4EM2 A;  3HOT A;  3WU0 A;  1R58 A;  3P7N A;  4Q48 A;  2V6C A;  2G7U A;  1I6X A;  1T6S A;  3EYY A;  3GWZ A;  3K1M A;  1Y0U A;  4IRH A;  4KIF A;  3HSR A;  3BJA A;  2DQR A;  2CQK A;  2XRN A;  1LJ9 A;  3I59 B;  2MBF A;  2O3F A;  1XDS A;  3E6C C;  2P5K A;  1KU9 A;  1HW5 A;  4OU0 A;  1CF7 B;  2Q2E A;  3IWZ A;  5ILV A;  4H0E A;  4NQW A;  4MEY F;  5CYV A;  3SHF A;  2DPD A;  1I1S A;  3OV8 A;  2NRA C;  3LA2 A;  2QYO A;  3FXR A;  2QQ9 A;  3FMQ A;  2HFH A;  4M73 A;  2HGC A;  3M8E A;  3T5X A;  3TGN A;  1W7P D;  4KIG A;  1OPC A;  2CG4 A;  1YS7 A;  3IL2 A;  1YYV A;  2P4W A;  2FNP A;  1ZRD A;  2IA2 A;  3CUQ A;  2J5O A;  1R00 A;  1BOA A;  3MAJ A;  2CW0 F;  4RGS A;  3ZN1 A;  2OQR A;  3Q9V A;  1KQ8 A;  1R1T A;  5LHG A;  1YIO A;  2Z5U A;  1KQ0 A;  2ZO4 A;  4U7B A;  5D6E A;  1F4K A;  1IF1 A;  5IT9 Z;  1OYI A;  1R7J A;  2VN2 A;  3FM3 A;  2HOE A;  3ZMU A;  3SZT A;  3RI4 A;  2GXB A;  4RB3 C;  1MJA A;  3ZN0 A;  5AIP A;  3R0J A;  1U5T B;  3I59 A;  5HDG A;  3JAM K;  3GFI A;  3B73 A;  4KIC A;  3LAJ A;  2EV0 A;  1MJ9 A;  2IRF G;  1FNN A;  2XV4 S;  3V8L A;  3KZZ A;  3E97 A;  1ZG1 A;  2F5D A;  3F21 A;  1V3F A;  5LEK A;  1XMK A;  1IN8 A;  4I98 B;  1MGT A;  3MZY A;  2XAS A;  2FBK A;  4I02 A;  1AOY A;  4A6E A;  2O03 A;  1ZGA A;  4AIJ A;  3ABU A;  4M6X A;  5LGT A;  2FBI A;  1JXS A;  2HZT A;  4FT8 A;  5K5R A;  1G3S A;  1FPQ A;  2XAQ A;  4M9Z A;  4AWX B;  2O6G E;  3R4K A;  3Q5F A;  4NB5 A;  3DPL C;  5LRS A;  3DP7 A;  2O0Y A;  4KIB A;  1KA8 A;  4BYY A;  4OMY A;  1B9N A;  4BAY A;  4CDG A;  1SD6 A;  3V7R A;  2VXZ A;  2FE3 A;  2VBX A;  4GXO A;  4EGY A;  1ZRF A;  1EV7 A;  3QP6 A;  4BXU A;  4KYW A;  3HSE A;  4OIQ F;  2HQR A;  4IHS A;  1QQI A;  2H94 A;  3C18 A;  4HDV A;  1ZH5 A;  1YW8 A;  1B4A A;  3KLN A;  3HRM A;  3HIF A;  5DEQ A;  4CXF A;  1LVA A;  3JSO A;  4DQ2 A;  3K9T A;  3WTZ A;  4XRF A;  4ESB A;  1R1V A;  2RN7 A;  1U5T A;  2XAG A;  5J8C A;  4B8X A;  4RB0 A;  3F22 A;  1YFH A;  1NHA A;  4BQA A;  4PDK A;  2A6E F;  4L9V A;  4JK1 X;  4GO1 A;  1B6A A;  3L9F A;  4LLN A;  3LQQ A;  2DBB A;  2XKP A;  2EA4 A;  3ZMZ A;  1SD5 A;  3GO5 A;  3GEZ A;  1FOK A;  1FLI A;  1Q1H A;  2ZXJ A;  1S7A A;  4L18 B;  4WXH A;  3HRT A;  1I5Z A;  4ASN A;  4Q4Z F;  2QLZ A;  1KU7 A;  1FT9 A;  4OIP F;  1SMT A;  3WGG A;  3JW4 A;  2L4A A;  4GYG A;  1R23 A;  5ICF A;  3GXO A;  3E5U A;  1TW2 A;  1I27 A;  2K7L A;  1GXP A;  1U6G A;  4GGG A;  1C0W A;  3T8R A;  1S8N A;  3NQO A;  1TLH B;  3FXQ A;  1G4D A;  2LF8 A;  3P9C A;  2GAU A;  5BPD A;  1FYL A;  1GHC A;  3ZMS A;  3ECH A;  2OAZ A;  3IKV A;  1ZG3 A;  4L5I A;  1U3E M;  3MQ0 A;  3BOQ A;  1K79 A;  3IRQ A;  1FY7 A;  4EVI A;  2PQ8 A;  1G6N A;  1O57 A;  3BP8 A;  2H09 A;  4M72 A;  1HBX G;  2UWM A;  5FGM A;  2QBY B;  1TNT A;  3ZPL A;  3CO7 C;  3VOD A;  3H3Z A;  4FX0 A;  3KP6 A;  1ZHF A;  4LJZ F;  4MHG A;  3GZ6 A;  1ZN2 A;  1S7O A;  3QPT A;  5ICG A;  6PAX A;  1B59 A;  4HQE A;  3CUQ C;  4UV8 A;  1YO5 C;  3ISP A;  1ODD A;  5D5W B;  3RPQ A;  4P9F A;  2VOO A;  4LLL A;  2BYV E;  3QP5 A;  1UHW A;  1Z7U A;  2IVM A;  4G6Q A;  3VOE A;  1D8K A;  3JTH A;  4I0A A;  1FBU A;  5F1R A;  1HKQ A;  2DW4 A;  1G3W A;  2E1N A;  2XUB A;  3ABT A;  1RUO A;  2EV5 A;  3F6V A;  3CUO A;  1W5T A;  5LHH A;  1LB2 A;  2W25 A;  3RYR A;  5FFZ A;  3KEQ A;  2UXX A;  2ISZ A;  4RS8 A;  5E17 F;  1Z6T A;  3AAF A;  4XSX F;  4OIR F;  1T39 A;  2NYX A;  4MTE A;  3TO7 A;  1TW3 A;  1W7P B;  1W5S A;  5E20 A;  1MJB A;  3KP3 A;  1K78 A;  3LWF A;  1ONV A;  3V8K A;  2FA5 A;  1SFU A;  2OQG A;  5D6F A;  1FZP B;  2LF7 A;  1Z6R A;  2EJR A;  3GW2 A;  4HV5 A;  3DF8 A;  1FYK A;  3FMR A;  1P4W A;  3MCZ A;  2MA3 A;  1QO0 D;  5E1Z B;  3GUD A;  2UZK A;  1WQ2 A;  4G94 A;  4EJV A;  4ZYG A;  1G3Y A;  4MEX F;  3K69 A;  1YW7 A;  1UST A;  2QBY A;  2RNJ A;  3V4G A;  3WU1 B;  3DV8 A;  1T38 A;  3MEX A;  3J81 Z;  3RKY A;  1P92 A;  2DLL A;  3CUQ B;  5HDK A;  4L9T A;  4MNU A;  5D8L B;  2A69 F;  4LB5 A;  2FRH A;  3ZMD A;  2YX7 A;  1FBQ A;  2MLK A;  3BRO A;  1XCV A;  5LGN A;  3FMS A;  2P5L C;  3KEO A;  3F8F A;  2STT A;  1BM9 A;  5FFX A;  2H6C A;  2A68 F;  4CGZ A;  3VFZ A;  2YU3 A;  1XMA A;  2Z33 A;  2WTE A;  1WRJ A;  2V9V A;  2CGP A;  4QLC U;  4RB1 A;  2VBW A;  5ILS A;  4S04 A;  4KFC A;  1WI9 A;  4OIO F;  1ZYR F;  2Y0M A;  3KFW X;  4A12 A;  3C1D A;  2YSR A;  1U5T C;  1ZLK A;  4MGR A;  2O8X A;  1LEA A;  2KIU A;  4UV9 A;  4EMS A;  4XBF A;  4JBA A;  3LA3 A;  4G6D A;  1FWZ A;  1PP8 F;  1W7P A;  1K6O A;  2A6H F;  2V1U A;  1QNT A;  3T0Y A;  4HDU A;  5HVQ C;  2XVC A;  1IRF A;  3KP2 A;  4N9I A;  4EJW A;  1PUE E;  4Q5S F;  1D3Y A;  1J9I A;  4R79 A;  3TDZ C;  1FYM A;  4EJU A;  3RYP A;  5DCF A;  5HLH A;  3GYH X;  5CJ9 A;  4A5N A;  1OKR A;  3N4M A;  1FC3 A;  1YW9 A;  3FF5 A;  2A3S A;  2IJL A;  5HDN A;  1BN5 A;  4HAM A;  2EFO A;  2YX4 A;  2HWV A;  2W85 A;  2L54 A;  4BNC A;  3JTG A;  2FOK A;  5H6Q A;  1R5H A;  5HOO A;  3L00 A;  5A2Q K;  4R1H A;  2PLY A;  2HDC A;  2ESN A;  2NS0 A;  1AWC A;  1F5T A;  2EWN A;  5L3F A;  5DCM B;  4XLP F;  2HR3 A;  3CO6 C;  1XGN A;  3RKW A;  1YTY A;  4PGH A;  5DD8 A;  3RPU A;  2XAH A;  2X4H A;  2VC0 A;  3GFM A;  2OZ6 A;  3BDD A;  1HW2 A;  1XSX A;  4ON0 A;  3E6D A;  1T98 A;  4P5O A;  2VE8 A;  4ZYH A;  2R3S A;  2PMH A;  2BBY A;  1XGO A;  4Y17 A;  2KJB A;  4LLG F;  5BQT A;  2VOD A;  2RDP A;  3I53 A;  2KIM A;  3I58 A;  3WTU C;  2Y75 A;  4CO8 A;  3FX3 A;  1EH7 A;  4KMU X;  5KK1 A;  1H9T A;  1EH8 A;  1DP7 P;  1ZRC A;  4G7O F;  2FEZ A;  4CIC A;  4Y13 A;  3C7J A;  5DYM A;  5JR3 A;  1L0O C;  4A0Z A;  2GZW A;  1IAW A;  4KMF A;  4U0V A;  2PG4 A;  1J7K A;  2RC4 A;  2R7D A;  5D5V B;  2VOP A;  5E1W A;  3GX4 X;  5F6F A;  1BJA A;  5DUK A;  2ZFW A;  3PQK A;  4MQ9 F;  3KE2 A;  2WC2 A;  1ON1 A;  2ESH A;  3HUG A;  5ICE A;  4MQV A;  5TRD A;  2D45 A;  4EJT A;  4HOB A;  1J75 A;  3F8N A;  1R5G A;  4ESJ A;  4HX7 A;  4G7H F;  2XRO A;  2DO7 A;  5FO5 A;  2B0L A;  2PFB A;  5K5Q A;  5DCM A;  4F7Z A;  4HF2 A;  3ELK A;  3QU6 A;  3IC7 A;  1BI1 A;  2MD5 A;  4LFU A;  4IXA A;  3SXY A;  2K4J A;  2HEO A;  2DQL A;  3ML6 A;  1JGS A;  1ON2 A;  3O6B B;  3V8J A;  4BHP A;  2GIV A;  2H27 A;  1BBY A;  1MZB A;  2K02 A;  2XHK A;  2C6Y A;  4LK1 F;  2ZNY A;  1J5Y A;  2AS5 F;  4XLN F;  3I0T A;  5IT9 K;  1SD7 A;  4M9S A;  3FHZ A;  1IN7 A;  1IXC A;  1R36 A;  2CWE A;  3C3W A;  3KLO A;  1ZRE A;  5CVU A;  2OZU A;  1Z1D A;  4Z2Y A;  4AD9 A;  3J80 Z;  4ENK A;  1KGS A;  1MD0 A;  2W84 A;  4K2E A;  1O3S A;  3DEU A;  4OIN F;  3QOP A;  1ZAR A;  4OOI A;  2OU2 A;  1XSV A;  2NAZ A;  1OR7 A;  5AON A;  3U2R A;  1XSD A;  1T2K A;  1J2X A;  4HBL A;  1GXQ A;  4I2O A;  4QWQ A;  3IHU A;  3EYI A;  3O3K A;  4UVC A;  1OYW A;  2HKO A;  2MH2 A;  3VB2 A;  2LNB A;  2L02 A;  1DUX C;  3E3V A;  1QBJ A;  1TQM A;  3SFZ A;  2F5C A;  1O7F A;  1K78 B;  3GFJ A;  1LNW A;  3RTR A;  1WWX A;  2F2E A;  2XAJ A;  3HSF A;  4N9H A;  3MWM A;  4O6J A;  4HA8 A;  3WTX C;  1WSU A;  5EEG A;  1CGP A;  2M8E A;  1HKT A;  2KJC A;  5DD4 A;  3KET A;  1F9N A;  2P6S A;  2V79 A;  1SAX A;  4R8H A;  5TJJ A;  2FSW A;  4I09 A;  4EGZ A;  2TDX A;  2XIG A;  5D5X B;  3K2Z A;  2VT2 A;  2DK5 A;  1SFE A;  4IRG A;  2MH9 A;  4HX8 A;  5HLG A;  3S2W A;  2Q8K A;  4YII A;  1BI0 A;  4LMY A;  1YG2 A;  3KCC A;  2YPR A;  4O5V A;  4O3M A;  3ZMT A;  3TO6 A;  2M45 A;  3F3X A;  2AXL A;  2HYG D;  1KQ9 A;  5HS7 A;  1T0F A;  4TV7 A;  3PFI A;  3PQJ A;  3TO9 A;  3T1B A;  1UCR A;  1FSH A;  4HYE A;  5DDG A;  5HLI A;  2XGX A;  2LKP A;  3BPV A;  4B09 A;  1UHM A;  5HS8 A;  3B02 A;  3Q9S A;  4ZZL A;  4MTD A;  2V1X A;  4A0Y A;  2QEN A;  4ESF A;  2D2W A;  4RAY A;  1LDD A;  5E8I A;  3TKY A;  3IRR A;  1F1Z A;  2KKO A;  1MDM A;  1JHH A;  3COA C;  2Y48 A;  4BH9 A;  1HW1 A;  1IXR C;  1IZ1 A;  2P8T A;  4DNC A;  1YS6 A;  3WTV C;  3IKT A;  3BWG A;  4BHB A;  2FU4 A;  3WG9 A;  3M8F A;  3WTT C;  2PJP A;  3BZ6 A;  3E6M A;  4HQM A;  2EFN A;  4HW0 A;  1A04 A;  5E1X A;  4G8X A;  4CHU A;  4YFX F;  1D5V A;  1XCB A;  1HXD A;  1IN4 A;  2A5Y B;  3F8C A;  4RAZ A;  2DT5 A;  2EB7 A;  4UUV A;  3D5L A;  1P2F A;  5LRR A;  3H3U A;  1RUN A;  1XGS A;  4WCG A;  5DUI A;  2FBH A;  4HLY A;  1D8J A;  4YG2 F;  2IA1 A;  2QQA A;  2PEX A;  3KZY A;  3GFL A;  2MC3 A;  4HF1 A;  1QGP A;  2WWY A;  2EA2 A;  1REP C;  4L9J A;  2O61 A;  1O3T A;  1SMY F;  4I01 A;  3E6B A;  3RJP A;  2RKH A;  2K27 A;  1HKS A;  2K4B A;  5CLS A;  4UVA A;  5D4S A;  2JRT A;  3HHH A;  3BPX A;  3IWF A;  3I64 A;  3EQL F;  1O3R A;  5EEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...