3WE2A

Structure of blm rqc domain bound to a phosphate ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
TRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Bloom syndrome protein
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3we2A00
3ECOA 4AIJA 3ABUA 2OA4A 4E70A 3BJOA 3I59A 4CO8A 3CJNA 5K5OA 2E7WA 3PQJA 3ZMZA 1ZGJA 2EB7A 4DNCA 2XAFA 1JHFA 2FNAA 4IXAA 1ULYA 1MKMA 5FLXK 2PJPA 4TV7A 4Z2YA 4ENKA 2XRNA 1ZGAA 2GAUA 1ZRDA 4M9SA 4A2UA 2HKXA 1G6NA 3SHFA 1IRFA 2OD5A 5H6QA 1REPC 4KN7X 2HQRA 2L01A 2K7LA 1KU7A 3WTYC 3ABTA 2M87A 1U2WA 3R61A 4EJWA 3M1EA 3T1BA 4LK0F 4WF2A 3QRFF 3PQKA 3ERED 4PDKA 4EJVA 1BI3A 1IN5A 2ESNA 4BHCA 2E7XA 2VXZA 2NAZA 1ZAOA 3RJPA 2KIMA 1LDKB 4XLPF 1S29A 3FHZA 1IRGA 3KCCA 4BAYA 1Z6RA 3QPHA 1FP1D 2V1XA 5DEQA 3HSRA 2G9WA 3QP5A 1R1UA 1P6RA 5K5QA 2XAQA 1FWZA 4RB2C 1J59A 3V7CA 4WXHA 5D5XB 2ELHA 1ZG3A 2EJRA 1B6AA 2O3FA 2B0LA 2E1CA 3WGIA 2CYYA 5ICCA 3KP7A 5FD5A 1HXDA 1OMIA 2W57A 1PDNC 5AIQA 4P55A 4UV9A 2UWMA 5E20A 3FWEA 4FX0A 1SMTA 3U1DA 2L02A 2QWWA 1LVAA 4L9JA 1SD7A 4LG0B 1HBXG 2XAGA 1S3JA 1USSA 2K02A 1MD0A 4IF4A 4ETSA 4LLNA 4HLXA 1TW3A 4GYGA 1X3UA 4RAZA 4ZH4F 1YFHA 2PLYA 4O3MA 2HEOA 4EVIA 5HOOA 2OAZA 3N97A 3EYYA 1HW2A 3RI4A 4A12A 5ED4A 3JSPA 1HQCA 5E1WA 3HSEA 3C3WA 3BOQA 3GFIA 3LQQA 2PI0A 1XMAA 5FGMA 3ZP5A 5F64A 4L18B 1V3FA 1G4DA 1XDUA 2IT0A 5D4SA 3ML6A 5L3FA 2XKOA 4FX4A 3D0SA 2WV0A 1EV7A 1H9TA 2RVCA 2HTSA 5ICGA 1LEAA 2CO5A 2F5CA 4Y13A 1FBQA 4I02A 2ZNYA 4L9NA 2O03A 3E3VA 2JSCA 3V8LA 1D3YA 3KZYA 5CVVA 4UUVA 2F5DA 5DD4A 3EUHA 3E97A 3RYRA 5BQTA 1P4WA 3KE2A 1MDMB 4GO1A 3D5LA 2ISZA 2WC2A 5D6FA 3F8NA 3NQOA 2BGCA 5K5RA 3R0JA 1IN7A 2PMUA 1UHWA 1MJAA 2XAHA 3V8KA 2ZFWA 1BIBA 3BPVA 2EFOA 4M74A 4G8XA 1HSJA 4O6JA 1YS6A 4LLLA 1GVJA 1R5HA 1WRJA 4FT8A 4B09A 2W84A 3E5XA 4HDVA 3J7AO 4AIHA 3FMRA 4HLYA 1GXPA 4UVBA 1F4KA 1XB4A 1F9NA 1TBXA 1UFMA 2OZ6A 3WTVC 2PEXA 1W7PB 1FBUA 3SZTA 4Y15A 2DK8A 2XVCA 4Q4ZF 3ZMUA 2O61A 1SFEA 3CDHA 3LFKA 4HDUA 3TGNA 1WQ2A 4A5MA 2KJCA 2M8EA 4I09A 1STZA 1LDDA 2F5FA 1NHAA 4EJOA 3ZMDA 2OBPA 3BZ6A 2RNJA 4IRHA 4ZYDA 3K9TA 5E1ZB 1HW1A 2NRAC 5A2QK 2HTJA 5ICFA 1O3QA 1T2KA 4IHSA 1ZREA 2DFIA 3Q9VA 4M6YA 2OU2A 2OQRA 1HW5A 2DLLA 5ILUA 3FMSA 5JFRA 3NRVA 2J5PA 2OQGA 3KFWX 2MH9A 1U5TB 2VBZA 3CLOA 4Q5SF 2BEOA 4RGRA 4P9FA 3K1PA 5J8FA 1FSHA 1R1TA 2DT5A 3F3XA 2FRHA 4XBFA 2V1DA 2Q8KA 5JR3A 3MAJA 1FP2A 4HQMA 2QM3A 1U78A 4I01A 3KEOA 4IVNA 4N0BA 4PCQA 1R5GA 1BBYA 1XN7A 1SMYF 4YFNF 4O5VA 2UXNA 1EH8A 3M9AA 3M8FA 2GXGA 5CLSA 1TW2A 4OIPF 3F8BA 1DPRA 2COMA 3Q5FA 4S05A 3HSFA 2GA1A 2DAOA 3K1NA 5FLXZ 3BY6A 4U0WA 2YSRA 4MQ9F 4HQEA 4AD9A 1S7OA 3VODA 3FF5A 2FEZA 5E8IA 1RNLA 2VC0A 2IPQX 3MCZA 4ZZDA 2JPCA 3M8EA 2FBIA 2DO7A 2VODA 5CJ9A 4CHUA 4PZJA 2CGPA 3U9GA 2ADUA 3IL2A 2BE5F 4WXDA 3T8TA 4P96A 2HDCA 2NS0A 5LRRA 4MTDA 5IT3A 1ZRCA 1XSDA 5AIPA 1BI0A 4ENJA 3WTWC 2NYXA 3R6SA 4MNUA 3K2ZA 4IRGA 3GXOA 3T8RA 4ASNA 2QLZA 1IAWA 2EV5A 1AWCA 1F1ZA 1LNWA 2ESHA 2RDPA 4LG0A 1SFXA 4I7HA 1IXSB 1W5SA 4HBLA 3ZMVA 4EJTA 3E5QA 2F2EA 5BPDA 1U3EM 1CF7A 5CVJA 2STWA 2VBYA 3JAMZ 3GZ5A 4LD5A 3KLOA 1KQ8A 2R7FA 2MBFA 4RGXA 4HW0A 1QQIA 2IJLA 1I1GA 2R3SA 3DEUA 3HTUA 4OIOF 3E6BA 3F8MA 3RYPA 2GA2A 1WI9A 4HZFA 3WE2A 3MWMA 4CYDA 2P8TA 3HIFA 4P5OA 1IZ1A 1Q1HA 2NNYA 1YO5C 2LSOA 3ISPA 1I1SA 4G7OF 3I4PA 1K79A 2Z99A 2FMLA 1W7PD 4IPAA 2HS5A 3BPXA 4I0AA 2BYVE 3LA3A 3CO6C 4HV5A 1G3YA 1JHHA 4FHTA 3KP2A 3QU3A 2A61A 4UNOA 4BQAA 2VN2A 2QENA 3SXYA 3DPTA 2L54A 2W25A 3LSTA 3GX4X 3SFZA 3ZMTA 1BIAA 4R1HA 1I27A 3WU1B 5HLHA 1YLFA 3TO7A 4YFKF 2HQNA 4KNYA 4I2OA 3ZN1A 1DUXC 4NB5A 4M72A 1FNNA 5DD8A 1WWXA 4OIQF 1YW9A 2M1BA 1FZPB 4U0YA 1FOKA 2KIUA 2VE8A 5DCFA 2EFNA 3MEXA 3GYHX 2GXBA 1D8KA 2HGCA 5DYMA 5D5VB 1B1BA 1OYYA 3MFKA 1MJ9A 2H09A 3U2RA 2FMYA 3SZPA 4YFXF 3V7SA 1P4AA 3F23A 1KGSA 1FT9A 4YG2F 4BYYA 2BV6A 1ZARA 4IRIA 2LNBA 1MJBA 2ISYA 4N9HA 1B9NA 4KT5C 5CVUA 2AS5F 5LEKA 2JPBA 5DUKA 2HKOA 2KIFA 4UV8A 2YX4A 3M7GA 4LB6B 3P9KA 4B8XA 5ERIA 1DP7P 1BI1A 3F72A 2EFPA 6PAXA 1XMKA 1J5YA 1Z7UA 1ODDA 2A3SA 3L09A 3WGGA 3RTRA 5J8CA 5HDNA 1Z6TA 1E17A 3RDIA 5LHIA 2PQ8A 5CYVA 1UCRA 2V79A 2WTEA 3VFZA 4ZYEA 3RKYA 2VC1A 3JAMK 2M30A 5ILVA 1TNTA 2FF4A 3P7NA 3T5XA 2DPDA 1LDJA 4XSXF 2IA1A 1IXCA 4A0YA 2A69F 2CSOA 1FYLA 1YG2A 1TQPA 4CXFA 1U6GA 3QAHA 2X0LA 2FE3A 1YTYA 5HLGA 3I5UA 4L5IA 1FC3A 4GYIA 3CO7C 2EA2A 4CGZA 3L2CA 2O6GE 1O7LA 1PP7U 3KZZA 5ILSA 2D1VA 1W7PA 3I58A 2VE9A 4IJAA 1SFUA 2VBXA 5JVTA 4RB0A 1J2XA 3IKTA 4AIKA 1TNSA 5CVRA 1ZLJA 3N4MA 4XLNF 4KUMA 1I6XA 3FXRA 4WX9A 2FNPA 2MD5A 4S04A 3C1DA 4AWXB 4D0PA 5HVQC 3VEPA 2ACJA 4BXUA 4RGSA 5DUIA 1U8RA 5CVIA 2DTRA 5F6FA 4OOIA 1R22A 2EWNA 2JT1A 5FB2A 1XGSA 2FBHA 2EV6A 1A04A 3R0AA 4MTEA 4HX4A 1FPQA 4LMYA 3J81K 4OMYA 3J81Z 3E5UA 1IN6A 3DFGA 4UVAA 4HX7A 2HWVA 4EGZA 4Q48A 4CDGA 1YW7A 2KRFA 1G3SA 2Y48A 2KKOA 4U7DA 2A5YB 1ON2A 3L9FA 5BMZA 3I0TA 1FSEA 3F6VA 3BJ6A 2QZ8A 3GFLA 4EV0A 1XDSA 1UHMA 4BHPA 4HYEA 3MQ0A 3CUQB 4YIFA 4HX8A 4BNCA 2D45A 3OOPA 4G7ZF 1IXRC 1O3SA 1KU2A 1H0MA 3HYIA 2O8XA 2V6CA 1JXSA 3S2WA 1FLIA 2YU3A 3JW4A 1TQMA 3F21A 2FQ3A 5D5WB 1MDMA 1FYMA 1KA8A 3T0YA 1R23A 1YQAA 1RI7A 4LJZF 5IT9Z 4KMFA 1YW8A 3FZVA 5HDKA 4HF1A 3JSOA 3WTUC 2MC3A 3L7WA 1XGMA 3C18A 3H3ZA 3V7RA 5H20A 2DQLA 1SD6A 2A6HF 1CF7B 3TDUC 3GVAA 2XV4S 1VTNC 4A0XA 2ZXJA 3B73A 5A2QZ 1BJAA 5LHGA 2L4AA 1ZN2A 5D5UB 5HS9A 4G7HF 1SD5A 1S6LA 1ONVA 2M45A 3IRQA 3LA7A 1HKQA 4ESBA 1QPMA 5FO5A 2MH2A 4M71A 2P5LC 4ZYGA 2Y75A 4MHGA 3IRRA 3TOBA 1WSUA 4MEYF 5EEHA 2VOOA 3HUGA 4L0YB 4GXOA 1HKTA 1BOAA 2VT2A 2Z33A 2A6EF 3IKVA 3E6MA 5ICEA 5D8LB 5LGNA 1JGSA 3TOAA 2J5OA 2LDUA 5AONA 3ZQ7A 4MGRA 3LAPA 3WTXC 3GW2A 3KP3A 1QGPA 3HRUA 4KN4X 1QBJA 2O0YA 3JTGA 3DV8A 4RAYA 1J9IA 1R00A 2P6SA 1FYKA 2BBYA 1W5TA 3FXUA 2DBBA 1T38A 1EH7A 1USTA 3TKYA 4LFUA 4U88A 2G7HA 1HKSA 4L5JA 5LRSA 4QLCU 4PGHA 3TO9A 1SAXA 3B02A 3FX3A 2HR3A 2L4MA 1BM9A 3KLNA 4UXNA 1H9GA 3FM3A 2GIVA 3IHUA 2P6TA 3WODF 3BDDA 1KU9A 2TDXA 2YPRA 2DPUA 3CUQC 2XAJA 1KU3A 3GF2A 1Z1DA 2PN6A 2XUBA 2FBKA 1TLHB 4A0ZA 2K4BA 2MLKA 3TO6A 4EMSA 1GHCA 4IHTA 3RIRA 3GO5A 5FFXA 1FX7A 3H3UA 1Z91A 4DQ2A 3WTSC 1T6SA 2GWRA 2IVMA 1KYZA 2FU4A 4KIGA 1PUEE 4KFCA 2H94A 4JQFA 1W4MA 2DI3A 2P7CB 4G6DA 3EDPA 1FBSA 4ZYHA 1IW7F 3JTHA 1DDNA 2FSWA 4F7ZA 4M73A 3HOSA 1ZG1A 2ZKZA 3GFJA 4KICA 5L3GA 3KP4A 1QZYA 5L3BA 3MZHA 4MEXF 5L3CA 4Y17A 3GLXA 4P9UA 3C7JA 2XHKA 5LLQA 1O3TA 2QVOA 1LQ1A 3GWZA 3QP6A 2HOEA 2D1HA 1QZZA 3FMQA 5FFZA 4WWCA 3QOPA 1E2XA 2GZWA 4ESFA 1B59A 1S7AA 4QWQA 4EM0B 4WXCA 3L00A 4EM1A 2PFBA 2RV8A 5HLIA 3V8JA 2QBYB 2DQRA 3EETA 1IN4A 3EYIA 4KMUX 3GFMA 2DW4A 5BPIA 2EK5A 2ETHA 3ZMSA 3O3KA 3RKWA 3OV8A 4LB5A 3G73A 4RB1A 1L0OC 3KP6A 1GXQA 1RIOH 4ESJA 3I59B 3ECHA 2XKPA 2ZMEA 5HS8A 2LF8A 4A6DA 3O2PE 3I71A 1P92A 4RGUA 4KIBA 4YIIA 3WTZA 4UHTA 4ON0A 5LGUA 1F5TA 2QQ9A 2RN7A 3GEZA 1BC8C 1IUYA 5D6EA 5BS6A 3FM5A 2IA0A 4KA4A 4LGWA 2EFWA 2DU9A 4G9YA 3H92A 4GGGA 1O7FA 1LEBA 4Q47A 2IW5A 5E8GA 2KJBA 3LQRA 3Q9SA 5HS7A 2JZYA 3KP5A 1R58A 1P4XA 2VOPA 2ZBKA 3CUOA 2XASA 1QNTA 1V4RA 2L3DA 4EJUA 5K1YA 2ZCWA 2JTVA 5LGTA 1DPUA 4A6EA 3RKXA 2VT3A 1XCBA 1ON1A 3COAC 4I98B 1R1VA 2Z5UA 3K1MA 3RPUA 3VB2A 1T0FA 1RUNA 3HRTA 1I5ZA 1B4AA 2W85A 2GQQA 4A5NA 2X4HA 4GCVA 3FXQA 4ENMA 2K4JA 1K6OA 2RGVA 3ULQB 2MA3A 2LKPA 3G3ZA 4G94A 5D8KB 2ZJ2A 4HF2A 3P9IA 1K7AA 2QUFA 3QPTA 2A68F 3CUQA 2P4WA 1P2FA 4XRFA 3SQNA 1Y0UA 3F6OA 1R36A 2A07F 1AOYA 3P9CA 2K86A 5KK1A 2EFQA 4G6QA 5KVRA 3W6JB 5BOXA 1OR7A 1T39A 2V1UA 3GUDA 1J7KA 4LK1F 1BC7C 2RKHA 1PP8F 2FOKA 2YR2A 3HOTA 4L0ZB 3I64A 1U5TA 4EGYA 2HFHA 3KETA 4OIRF 4OINF 3WE3A 4L9TA 1LJ9A 1RUOA 2P5KA 3DXJF 5E18F 3E6CC 1OPCA 1S8NA 2IP2A 1KQ0A 1R7JA 2ZMEB 1ZG5A 4M9ZA 2IRFG 3AAFA 3BROA 5L3DA 3W6KB 2FXAA 1KYWA 1YS7A 2QQAA 5D4RA 2H27A 3DQVC 4H0EA 5TRDA 3PFIA 2MLGA 3WG9A 1IN8A 1RZ4A 1OYWA 3V4GA 4PGGA 5JHUA 1ZYRF 4M9XA 2HYGD 2V9VA 4ENNA 1XSVA 3IC7A 1TQIA 1UB9A 2UXXA 3DP7A 2Q0OA 1ZH5A 4BH9A 3F8FA 1BI2A 2H6CA 3WU0A 2CFXA 2D2WA 2Q2EA 2QBYA 5DV5A 2ZNZA 1SD4A 3J80K 5DCMA 1YIOA 2CW0F 1K78B 2K27A 4WCGA 5F1RA 2Y0MA 5E17F 2E1NA 1XCVA 2H6BA 1K78A 1WKMA 2WWYA 3HRMA 3I53A 4WK8F 2XIGA 3NEUA 3VOEA 2IA2A 3LWFA 2RC4A 3TQNA 4I0BA 2P5VA 4R8HA 2VONA 2XROA 5E1XA 3F22A 2AXLA 2XGXA 2YX7A 4EM2A 4CZZA 3WGHA 3IWZA 1O3RA 3RPQA 5EEGA 3TDZC 4R79A 1MZBA 4OU0A 4NHJA 2P7VB 5HDGA 3KEQA 1T98A 4RB3C 1ZRFA 3O6BB 1B9MA 5J6XA 3QU6A 1QO0D 2OZUA 1D8JA 3E6DA 4XSZF 1HSTA 2M5WA 2DK5A 2PBIA 1MGTA 3R4KA 3ELKA 5FD6A 2STTA 2JRTA 2PG4A 1ZHFA 2CG4A 2UZKA 3WTTC 2QYOA 1D5VA 1EH6A 2EV0A 3REOA 3K69A 1KQ9A 4KDPA 4AVPA 4M6XA 2QQBA 4HAMA 5L3EA 1G3WA 3DPLC 4BHBA 4U0VA 1OKRA 1YYVA 4HOBA 1Z9CA 1TTYA 4ZZLA 4EQQA 1G3TA 5LHHA 2C6YA 1C0WA 3LA2A 5DDGA 3HHGA 4LLGF 2VBWA 3ZPLA 1O57A 2F5EA 4UVCA 3BWGA 4CICA 4K2EA 4OMZA 2ZO4A 4HV6A 1IF1A 3HTSB 3ZN0A 4MQVA 3DF8A 1J75A 5DCMB 3LAJA 1XGOA 1Z05A 2HZTA 1ZLKA 3R60A 1BN5A 1FY7A 3HHHA 3F8CA 3IWFA 3BP8A 2Z3YA 3MZYA 5IT9K 3EQLF 3CTAA 3K0LA 5H6RA 1U5TC 1XD7A 5LBQA 4JK1X 5LEJA 3GZ6A 2R7DA 2W24A 5TJJA 2LF7A 3ROUA 2CQKA 1XSXA 4N9IA 3J80Z 2CWEA 5JI6A 2HYFA 2RQPA 4L9VA 1OYIA 3I54A 4HF0A 4JBAA 2NNNA 3HRSA 1L3LA 3BJAA 4KIFA 4NQWA 4RS8A 1JE8A 1LB2A 2EA4A 3DKWA 2FA5A 1CGPA 2PMHA 4U7BA 2Z9OA 1XGNA 1J0RA 2G7UA 4KYWA 4HA8A
chains in the Genus database with same CATH superfamily
3QPLA 2HXIA 2JQ7A 3ECOA 4AIJA 3ABUA 2OA4A 1AA7A 2I5UA 4E70A 3BJOA 4J01A 3I59A 4CO8A 2X85A 2UV1A 3CJNA 3TBIA 5K5OA 1FEXA 2E7WA 1JI8A 3ABKH 3PQJA 3ZMZA 2DMTA 3S3NA 2BZTA 1ZGJA 3BQZA 1RKTA 2EB7A 4DNCA 2XAFA 1JHFA 2FNAA 1QA6A 3CP8A 4ITVA 4IXAA 4UB6C 1ULYA 1MKMA 1HLVA 1FOWA 5FLXK 3Q0VA 2PJPA 2KDOA 4IKFA 2VASA 3P5JA 4TV7A 4AIDA 4AYBN 4Z2YA 4ENKA 1WFXA 2XRNA 5IYDJ 1ZGAA 2GAUA 1ZRDA 4HG2A 4M9SA 1GDTA 1MBJA 1XX5A 4A2UA 2HKXA 1G6NA 3SHFA 1IRFA 4LG3A 2OD5A 1OCCH 5H6QA 1REPC 2BXZA 4KN7X 2HQRA 2VQLA 5FLVA 2L01A 1GT0C 2K7LA 1KU7A 3WTYC 3ABTA 2JK3A 2M87A 1X1AA 2WB1A 3PFYA 4A3FJ 1U2WA 2IAIA 2MFZA 2B7EA 3R61A 4EJWA 2AO9A 3WG7H 1DP3A 2BW3B 3M1EA 4LK0F 4WF2A 3T1BA 3QRFF 3CCYA 3BR0A 3PQKA 2ZXIA 3ERED 4PDKA 2VQCA 4EJVA 1BI3A 1IN5A 2ESNA 4IQ4A 1AKHA 4BHCA 2YU9J 2ZC2A 2E7XA 2VXZA 2NAZA 1ZAOA 3RJPA 2KIMA 3NWTA 1LDKB 4RLFA 4XLPF 1S29A 4DZPA 3FHZA 1IV6A 1SVMA 4QSHA 2GIZA 1IRGA 3KCCA 4BAYA 5C44J 1JT0A 1Z6RA 1ETWA 3QPHA 1FP1D 2M7BA 3OYFA 1DGWY 2V1XA 3HGGA 5DEQA 1RR7A 1R4NB 2CUFA 2HYJA 3HSRA 2G9WA 5C4JJ 3QP5A 3M3YJ 1R1UA 1P6RA 1SEUA 2KP6A 4B3AA 1X3WB 5K5QA 2XAQA 1FWZA 4RB2C 1K6YA 1J59A 3V7CA 4WXHA 2NVUB 4XLEA 2CW7A 5D5XB 2ELHA 1YX5A 1ZG3A 1ZQ3P 1Y1WJ 2EJRA 1B6AA 3ZCOA 5BNGA 2O3FA 4X6AJ 2B0LA 2R7WA 2L0KA 3DWLE 1DGRM 1RR8C 2E1CA 3WGIA 2CYYA 5ICCA 3KP7A 5FD5A 1HXDA 1OMIA 2W57A 1PDNC 5AIQA 4P55A 3ZQIA 4UV9A 2UWMA 5E20A 3FWEA 4FX0A 2VQGA 5C3EJ 2MYSA 2Z16A 3W6VA 1Z7LA 2XF6A 4PJ0C 1SMTA 2L5QA 4MLOA 3U1DA 2L02A 1DU6A 1XTAA 2QWWA 3OYEA 4A3KJ 3H9QA 1LVAA 5B3SH 4L9JA 1SD7A 4LG0B 1HBXG 2XAGA 1S3JA 1USSA 2K02A 4BJ6C 3BTCA 4J00A 1MNEA 1MD0A 4IF4A 4ETSA 4LLNA 1TT0A 3U1KA 2CS3A 2GM4A 4BBRJ 4HLXA 2HDDA 1TW3A 4GYGA 1X3UA 2LC2A 4RAZA 4ZH4F 1YFHA 3OWTA 4GRIA 2PLYA 4O3MA 2HEOA 5F0CA 4EVIA 3JRDA 5HOOA 3ASNH 2OAZA 3N97A 3HOVJ 3EYYA 4UUTA 3PUFA 1HW2A 3DKYA 1YRNB 4H4KC 3TMOA 3L1PA 4BUPA 2PJRA 2O9LA 5FRNA 3RI4A 4A12A 5ED4A 3JSPA 1HQCA 5E1WA 2GXAA 1IO2A 4XRSA 5JLXA 3HSEA 1X4PA 1SFOJ 3C3WA 3BOQA 3GFIA 2VXDA 3LQQA 2CUEA 1IDYA 3MD2A 2PI0A 4DBRA 4KT6A 1XMAA 5FGMA 4UUSB 2OUMA 3SEQA 3ZP5A 3JRHA 5F64A 4L18B 3CF2A 4FTHA 1WVRA 4A3CJ 1V3FA 1G4DA 1XDUA 2IT0A 5D4SA 3ML6A 5L3FA 1K83J 2XKOA 2M2EA 4FX4A 2K9QA 4CCOA 4V2FA 3D0SA 4F52A 2WV0A 1EV7A 3CQZJ 1H9TA 2RVCA 2HTSA 1OCPA 5ICGA 3CCEI 4MIMA 2QSFX 2CQXA 2XPUA 3FKIJ 1LEAA 2CO5A 2F5CA 1W1WE 4Y13A 1VI0A 2DA4A 2K9SA 1FBQA 4PK4A 3Q3SA 4I02A 3HM5A 2ZNYA 2BY2A 2B9SA 4L9NA 3VDXA 2O03A 3E3VA 4XOPA 4ZYAA 1VQ6I 5EG0B 3MMYB 1Y39A 1BW6A 1TT5B 2JSCA 4L5EA 1MNMC 3V8LA 1D3YA 3KZYA 5CVVA 4UUVA 3G6EI 2F5DA 1D0YA 5DD4A 3EUHA 2QKLB 3E97A 3D1NI 2IS2A 3RYRA 2AXTC 2XC7A 3OSGA 1MMAA 5BQTA 1N77A 1P4WA 1FIPA 3KE2A 4M3GA 1MDMB 4GO1A 3G71I 3D5LA 3D5RC 2ISZA 1XC5A 2WC2A 5D6FA 3QYEA 3F8NA 4UB8C 1X1CA 3NQOA 2M9HA 1WGXA 2BGCA 5K5RA 3R0JA 1IN7A 2PMUA 2E1MC 2HVRA 1UHWA 2X1DA 1MJAA 2XAHA 4MO7A 1XPXA 4GFBA 3V8KA 1J09A 2ZFWA 1BIBA 2IS1A 2MD0A 3OYDA 1X1DA 3BPVA 2EFOA 3WU2C 5M3FJ 4M74A 4G8XA 1HSJA 4O6JA 3S8PA 1YS6A 3A01B 4LLLA 2EBIA 4XLAA 2ZXWH 1IG7A 1BL0A 1GVJA 2JA8J 1R5HA 3OR1C 1WRJA 4FT8A 1VQPI 4B09A 2W84A 3E5XA 4ANJA 2FQ4A 4HDVA 1S9HA 4AIHA 5LFAA 3J7AO 4U87A 3DBLB 3FMRA 4V19K 3J7AY 4HLYA 1GXPA 3H5NA 4UVBA 1F4KA 2DMNA 1XB4A 2R5YA 4XRSG 1F9NA 1TBXA 1UFMA 3EUKL 2IBDA 2OZ6A 3WTVC 2PEXA 1W7PB 1FBUA 3CMMA 3KEYA 1KZHA 3SZTA 1WH5A 1LPQA 4Y15A 4BXFA 1AKHB 1MBGA 2DK8A 2VPRA 2Y31A 2DA7A 2XVCA 3HB9A 3PSFA 4Q4ZF 3ZMUA 1LFBA 2O61A 1OCRH 2RQQA 1SFEA 1OFCX 3CDHA 5F1JA 3LFKA 4HDUA 1EKEA 3TGNA 2BY3A 3JCUC 1WQ2A 3TEDA 4A5MA 2KJCA 2M8EA 4I09A 1STZA 1G2HA 1LDDA 1B8IB 1NHAA 2F5FA 2W82A 4EJOA 3ZMDA 2OBPA 3BZ6A 3V42A 2RNJA 4RBOA 4IRHA 1MBHA 3IUOA 4ZYDA 3K9TA 5E1ZB 4B43A 2L9NA 4E7HA 1HW1A 2NRAC 5A2QK 2HTJA 3AG3H 5ICFA 4MFEA 3HOYJ 1O3QA 1NG7A 3CF5F 2EPFA 2QF7A 3IH2A 3BTIA 2CJJA 1T2KA 2O5RA 4IHSA 1ZREA 2DFIA 4J19A 3Q9VA 4M6YA 3VWBA 2OU2A 2XF7A 3DLAA 2EH3A 2OQRA 5CQGA 1BR2A 1IJWC 3RKQA 1HW5A 1F43A 2DLLA 5ILUA 2WV1A 3GZNB 1G8XA 3FMSA 5JFRA 3NRVA 1T33A 1YJ9I 4PSWA 5IP6A 2J5PA 4XL9A 2OQGA 3KFWX 2MH9A 1U5TB 4AVZA 4Y3OA 2VBZA 3AL0B 3CLOA 4Q5SF 1HDDC 2BEOA 3AKZA 2E71A 1ETKA 4RGRA 4FISA 4B1RA 3QWLA 2H8RA 2OC6A 4P9FA 3K1PA 3JRCA 5J8FA 1FSHA 1R1TA 3BR3A 3QOEA 2DT5A 3F3XA 2K40A 2FRHA 2TCTA 3SEZA 4XBFA 2KISA 2V1DA 2XSJC 2Q8KA 3DPUA 2R7VA 1UG2A 1RRJA 5JR3A 3MAJA 1FP2A 2KRCA 2XPWA 3H5AA 5K7ZA 4HQMA 1DQUA 5FRMA 2A6TA 1U0JA 2CW8A 2QM3A 2M3AA 2UUZA 1U78A 2I10A 3K4KA 4II3A 2B63J 4I01A 3KEOA 2NOGA 4IVNA 2JA5J 5FKOA 1GVDA 4N0BA 4PCQA 4DYCA 1R5GA 2Q2EB 1BBYA 3W2WA 1XN7A 1SMYF 4BS9A 5IPAA 3OMYA 2BHYA 4YFNF 4O5VA 2UXNA 3L2QA 1EH8A 1MIJA 4XLHA 1VQ4I 3M9AA 2RNGA 3M8FA 3S17J 2GXGA 3FBIB 5B66C 5CLSA 1TW2A 1ITYA 4OIPF 3F8BA 1DPRA 5B1AH 2COMA 5EEAA 3Q5FA 3HSFA 2GA1A 4BEHA 4S05A 1VQLI 2DAOA 5E3NA 3H9JA 3K1NA 5FLXZ 3BY6A 2X6OA 4U0WA 1A35A 3RZOJ 2IS4A 3LSIA 4BY1J 3A03A 2VLAA 2YSRA 2COBA 4MQ9F 3ABLH 2QEXI 2AHQA 4HQEA 4AD9A 1PJRA 1S7OA 2RAEA 3VODA 3FF5A 1WJBA 5IY5H 4D9JA 2BXYA 2FEZA 5E8IA 4D5FA 3FXKA 1RNLA 2VC0A 3HGYA 1Y0NA 1V54H 5LD2C 1VQ5I 1WPKA 4ZJZA 2F5VA 2IPQX 3MCZA 4ZZDA 3HL2A 1PVEA 2JPCA 2DN0A 3M8EA 5J1YA 1ZKGA 1BW5A 2FBIA 2LMDA 4G12A 2DO7A 4PUSA 5CJ9A 4QIWN 2L9SA 1LFUP 2VODA 1FTZA 4CHUA 4PZJA 3CC7I 2CGPA 1RESA 3U9GA 2ADUA 3IL2A 5FKLA 2BE5F 4WXDA 2EZKA 4RMNA 3T8TA 2VPLA 4P96A 1MSEC 4DYRA 3EUHC 2HDCA 3G1OA 3LOCA 2NS0A 5LRRA 4MTDA 5IT3A 3K4MA 1ZRCA 4II2A 5EJCA 1XSDA 3OS2A 1VQOI 5AIPA 1BI0A 3VYSB 2IS6A 2LLKA 2JRMA 3WTWC 4ENJA 5KCMA 3L2RA 1ZR4A 2LY1A 2NYXA 2EZIA 3R6SA 4MNUA 3K2ZA 2BW3A 3GXOA 4IRGA 3T8RA 4CYCA 4BJTA 1VNDA 4DJAA 4ASNA 5F08A 2HU9A 2O8KA 2QLZA 1YOVB 2EV5A 2LK2A 1IAWA 1AWCA 1F1ZA 2H1LA 1LNWA 2ESHA 2RDPA 4M3DA 3UKGA 2E34A 1PUFA 2E36A 1JJ6C 5EGOB 2NVTJ 4LG0A 1SFXA 4I7HA 1IXSB 2W7NA 1W5SA 4NNJA 4HBLA 3A02A 2HQ5A 3ZMVA 4DYQA 4EJTA 3E5QA 2F2EA 1ZTRA 4A3LJ 5J3LA 1VF9A 5BPDA 1U3EM 1S5LC 1CF7A 5CVJA 3DTEA 4ZC3A 2STWA 2VBYA 3JAMZ 4B48A 3GZ5A 3FHNA 3QODA 4LD5A 3BG7A 3KLOA 1KQ8A 2FUG2 2O7OA 2R7FA 1VQ8I 1V5EA 3CCSI 2MBFA 4RGXA 4HW0A 3FK6A 4XICA 1QQIA 2IJLA 2KPMA 3RCOA 1I1GA 5CPRB 4AUXA 2R3SA 3DEUA 1UAAA 3A2KA 2KMUA 3IH3A 3BT9A 3HTUA 2QSGX 3GCMA 4JOMA 4BACA 2DTZA 4HPQA 5JHFA 4OIOF 3E6BA 2ZMEC 3PNYA 4XM3A 3F8MA 1IGNA 1X1BA 3RYPA 2GA2A 1WI9A 4HZFA 1HF0A 3WE2A 3MWMA 1K61A 2JN6A 1E3OC 4CYDA 3MZ8A 1EJ9A 2P8TA 3HIFA 3ZQQA 2IGMA 1ETVA 4B47A 4P5OA 1IZ1A 1Q1HA 2NNYA 1YO5C 2LSOA 3ISPA 1I1SA 4M3EA 3MKZA 1Z77A 2XF5A 3I4PA 5E3LA 4G7OF 1HCRA 3OYCA 1K79A 1E3PA 3G1MA 2Z99A 2FMLA 1W7PD 4IPAA 2HS5A 1I3QJ 3BPXA 4I0AA 3OL3A 2PJRB 2BYVE 3LA3A 3CO6C 4HV5A 1G3YA 1V55H 1JHHA 4FHTA 3KP2A 3QU3A 2A61A 1YJNI 4UNOA 4BQAA 2VN2A 1MH3A 2QENA 3SXYA 2NXNB 3DPTA 2L54A 2KIQA 5IP9J 2W25A 3PIPF 3LSTA 3GX4X 1LKXA 3SFZA 3ZMTA 1BR4A 1BIAA 2Z2SB 1BOBA 4R1HA 3LNQA 1I27A 3WU1B 2HQAA 1YLFA 5HLHA 3TO7A 3ZQGA 4YFKF 2HQNA 4KNYA 4I2OA 1TWHJ 2LG4A 2KQRA 3ZN1A 1DUXC 4NB5A 4M72A 1FNNA 5DD8A 3HUGB 1WWXA 4OIQF 1YW9A 2M1BA 5KHDA 1FZPB 4FASD 2IXSA 4AC0A 4U0YA 1FOKA 2KIUA 2VE8A 3HBLA 5JVGF 5DCFA 1X1PA 2EFNA 2E2HJ 2L7MP 3MEXA 3GYHX 2GXBA 1D8KA 1TWAJ 2HGCA 3CESA 1RPWA 3OIPA 4E7IA 5DYMA 4PFOA 3X2QH 3J7YJ 1FMVA 2L7ZA 1B1BA 5D5VB 4ZTJA 4A3BJ 2JUGA 1OYYA 3MFKA 1MJ9A 2H09A 3U2RA 3PJRA 2FMYA 3SZPA 4YFXF 2XSDC 3PNTA 3V7SA 5GTIC 1P4AA 2VL8A 4PSXA 1WJCA 3DKXA 2CQNA 3F23A 3K70C 2R7QA 2VJIA 1VQKI 2ZJRF 3S2HJ 1YX3A 3FXLA 1KGSA 1FT9A 4YG2F 1O4XA 3FXMA 4BYYA 2BV6A 4B3XA 1ZARA 4IRIA 1WJFA 4RAGA 1I50J 2LNBA 2R4GA 1TWFJ 1G59A 1MJBA 2ISYA 4N9HA 4UUSA 3LSRA 3DEWA 1B9NA 4KT5C 3BZKA 4DOZA 2NS8A 2EQRA 5CVUA 2AS5F 3LSJA 5GTHC 4A69C 3FISA 5LEKA 2R7XA 2JPBA 5DUKA 3GTLJ 2HKOA 3Q0UA 2KIFA 1UG0A 4UV8A 2YX4A 3I3LA 1TZLA 1EA3A 1D0ZA 1UZCA 3D5SC 2ICWG 3M7GA 4LB6B 4D7NA 1SFKA 1Y6IA 3P9KA 3S3MA 2JA6J 3HG9A 5TISC 4B8XA 4PJLA 3KX2A 5ERIA 3OYMA 1DP7P 4ZDLA 4IOCF 1BI1A 2QA4I 4E7KA 3F72A 2CV2A 1R5ID 1E0EA 1FOYA 2EFPA 6PAXA 1QZEA 1XMKA 4M3BA 2XGCA 1YE9A 1J5YA 1Z7UA 1ODDA 2A3SA 3L09A 3WGGA 2HOAA 4NC6A 4XKBA 3RTRA 1R71A 1IRZA 5J8CA 5HDNA 1Z6TA 1E17A 3RDIA 5LHIA 2CUZA 2PQ8A 2XRLA 5IOYA 3IV5A 5CYVA 1UCRA 3SFIA 2V79A 3JRBA 2WTEA 3VFZA 3SYTA 3RKYA 4ZYEA 1BR1A 4FE4A 4EEFG 4ZDPA 2VC1A 4A3DJ 3JAMK 4XKWA 2M30A 2R7UA 5ILVA 2I8DA 2IEKA 1TNTA 2FF4A 1TL8A 3P7NA 2V9PA 3M8JA 3T5XA 2E2JJ 5HNFA 3CCMI 2DPDA 2JMWA 1LDJA 4EATA 4XSXF 2IA1A 1IXCA 4A0YA 2KFDA 3GTJJ 2A69F 3ZXSA 1WJDA 5DS9A 2LY9A 2CSOA 4BE2A 1FYLA 1YG2A 1MBFA 4JX6A 1TQPA 2FOWA 1K4TA 4CXFA 1IC8A 1U6GA 3QAHA 4NDLA 2X0LA 4XRMA 3OYJA 2FE3A 1YTYA 5HLGA 2DA5A 3I5UA 4L5IA 4IO9F 2K9NA 3BQYA 2K85A 3CC2I 1FC3A 4GYIA 4FE7A 3CO7C 3DCFA 2EA2A 3ZOBA 2XPVA 4CGZA 3L2CA 2O6GE 1O7LA 1PP7U 1VQ9I 4AYBA 3KZZA 3E7LA 4BU2A 2WADA 2D1VA 5ILSA 4F92B 1YHQI 1PUFB 1W7PA 3I58A 2PMZN 2VE9A 4IJAA 4HSTA 1SFUA 2VBXA 1X19A 4W1UA 1F36A 5JVTA 1MMSA 4CSWA 4RB0A 1J2XA 2KZGA 2DFHA 3IKTA 2DA3A 4AIKA 3HOZJ 2YUSA 1X2MA 1TNSA 5CVRA 1RETA 3LFUA 4BDYA 4XONA 4BJ5C 4C2TA 4BXXJ 3LSGA 1ZLJA 3I9V2 3N4MA 1WI3A 3DTIA 4KUMA 4XLNF 5EZGA 1UJ8A 1I6XA 2LREA 4I76A 2PMZA 4JX4A 4BEHB 3FXRA 4WX9A 2FNPA 3H1CA 2MD5A 4S04A 1Q1VA 3C1DA 5DM7F 1D5YA 1GLNA 4AWXB 4D0PA 3CZ6A 3VEPA 5HVQC 2ACJA 4BXUA 4RGSA 2V7FA 3TP0A 5DUIA 3BLYA 1U8RA 4XQFA 5CVIA 2DTRA 5F6FA 4NC7A 5IYCJ 1JTXA 4CCKA 1AHDP 4Z6YA 4OOIA 1R22A 3LMMA 2EWNA 1VFCA 9ANTA 2JT1A 5FB2A 1XGSA 2FBHA 2EV6A 1A04A 3R0AA 4MTEA 4HX4A 1NTCA 1FPQA 3OYIA 1U9OA 3AG4H 1MH4A 4LMYA 3J81K 3HOWJ 1T95A 4OMYA 2OF7A 3J81Z 4XKCA 2V6EA 4I6ZA 4Y33A 4JX5A 2AQEA 3E5UA 3CDLA 1IN6A 3DFGA 4UVAA 2ZSHB 3ERMA 4HX7A 2HWVA 2FX0A 4Q48A 4EGZA 4CDGA 1YW7A 2KRFA 1G3SA 1P7JA 2KHMA 2VJ4A 2EZLA 2Y48A 2KKOA 4G6TB 4XN0A 2A5YB 4U7DA 3B6CA 3OOUA 3K2AA 1ON2A 3L9FA 5BMZA 3I0TA 1FSEA 3F6VA 3BJ6A 2QZ8A 3GFLA 4A3GJ 4EV0A 1XDSA 1UHMA 4BHPA 4CCNA 4HYEA 4YRVA 3GTQJ 3SDGA 3S1QJ 3MQ0A 3CUQB 4YIFA 1GV5A 2IGOA 4HX8A 2K9LA 4BNCA 4LIVA 2OPTA 2WY7Q 1VQ7I 2D45A 1A5JA 3OOPA 3O8GA 1D0XA 2QKMB 2P81A 3H35A 2VJJA 4G7ZF 2IGKA 3WHCA 2JVHA 4IHVA 5HODA 2R93J 1IXRC 1O3SA 1KU2A 1HOMA 1H0MA 3HYIA 2O8XA 2R5ZA 1ZELA 3K70D 2V6CA 2OTLI 1WJAA 2K3PA 1JXSA 2HI3A 3S2WA 1FTTA 3EUAA 3HKZN 3S16J 2JA2A 2LBFB 2KLOA 2BOLA 3CMEI 3BCBA 2L7KA 3PM1A 1FLIA 2OJED 1RC9A 2DCEA 1MNDA 2YU3A 3JW4A 1R4MB 1TQMA 2FQ3A 2W1OA 1GV2A 5D5WB 3F21A 1MDMA 5GAGJ 1FYMA 1KA8A 3T0YA 1BJZA 4XR6A 3A1YA 1R23A 4HSRA 1YQAA 1RI7A 2WBMA 4LJZF 1AU7A 5IT9Z 1Z3XA 4KMFA 1YW8A 2BHZA 2K9MA 3FZVA 5HDKA 4HF1A 3JSOA 3WTUC 2MC3A 2M7AA 3L7WA 1XGMA 3C18A 3H3ZA 3V7RA 1OQYA 1DU0A 1NG6A 5H20A 2DQLA 1SD6A 2A6HF 4KITB 1CF7B 4B44A 3I4NJ 3CC4I 1U9NA 3TDUC 3GVAA 2XV4S 1VTNC 4A0XA 2PX9A 2F4OB 2ZXJA 5EZHA 2CUJA 3SZGA 3B73A 5A2QZ 2ELJA 1LUJB 4N4OB 1BJAA 5LHGA 1QPIA 3NWSA 4IZZA 3PUBA 1QVTA 2E2IJ 2L4AA 1ZN2A 2A5WA 4CUGA 2E19A 5D5UB 1IRXA 5HS9A 4G7HF 1T8IA 1SD5A 1S6LA 2HXOA 1ONVA 2M45A 3IRQA 3M1CA 1XG1A 3LA7A 1HKQA 4ESBA 1QPMA 5FO5A 2MH2A 3VPRA 4M71A 5J47A 5F04A 2Y9YA 3HKZA 1H88C 2JVGA 2P5LC 2R0QC 4OWRB 4ZYGA 2Y30A 2Y75A 3OYLA 2K5CA 3HC7A 4MHGA 3IRRA 1B72B 1CQTA 3TOBA 3H5RA 1WSUA 1GUUA 4MEYF 2DA2A 5EEHA 2VOOA 3HUGA 4L0YB 4DZJA 1WJEA 1MBEA 3PO2J 4GXOA 1X3ZB 1HKTA 1BOAA 2VT2A 3O8HA 3ZQFA 2Z33A 1FJLA 2VB6A 2A6EF 3IKVA 3A0HC 3E6MA 5ICEA 5D8LB 4NUBA 5LGNA 3CCLI 1JGSA 1LVKA 3KIOA 1ORKA 3TOAA 2J5OA 2LDUA 5AONA 3ZQ7A 4MGRA 3LAPA 3WTXC 3GW2A 3KP3A 1QGPA 3HRUA 2LR8A 2OCEA 3C2BA 3AFHA 2CQQA 4RDUA 4KN4X 1QBJA 2R7OA 4HNUA 4BBSJ 3I55I 2ZXHA 4P1WA 2O0YA 2Y69H 1PYVA 4V2GA 3MKWB 3JTGA 2NVXJ 3DV8A 1A31A 4RAYA 4RM3A 2ECBA 1J9IA 1R9TJ 1R00A 2P6SA 2M8GX 3MVPA 1W0TA 3DU5A 3FBNB 4PJMA 2RREA 1FYKA 1JT6A 1W5TA 2BBYA 3FXUA 4XLFA 3GTOJ 2DBBA 4E7JA 2DOEA 3CCVI 2E1MB 1T38A 1U8BA 1EH7A 1USTA 1X58A 3TKYA 5GAHJ 2HPMA 2OCCH 4QPQA 2GOXB 4LFUA 1QHHD 1E3HA 4S0HB 3BTJA 3OR2C 4U88A 2CFOA 1I39A 2DOFA 2G7HA 1HKSA 4L5JA 1TWGJ 4QLCU 5LRSA 3ZQCA 2WY8Q 4Y4RA 4PGHA 2W48A 3TO9A 2JUCA 1Z3YA 3B02A 1SAXA 3FX3A 2HR3A 1QVUA 1HDPA 2L4MA 1BM9A 2DA1A 3KLNA 2X51A 3CD6I 4UXNA 1T08B 1H9GA 5K7HA 3ONQA 3FM3A 2GIVA 2LY2A 2V1NA 3IHUA 2P6TA 3L2WA 2IGNA 4X0GA 1W5CC 3IAM2 3WODF 2KL4A 3BDDA 1KU9A 2TDXA 2YPRA 2D5VA 2DPUA 3CUQC 2FJ1A 4BQQA 3CCJI 1FOXA 2XAJA 3VSLA 1KU3A 3GF2A 4C2MJ 1Z1DA 2DJIA 2PN6A 4F91B 5F0HA 2XUBA 1Y1VJ 1Z0XA 3DTKA 3N05A 2FBKA 1TLHB 4DW6A 3HPHA 1OCTC 3NAUA 4A0ZA 4UY8I 1V5FA 1IV8A 4YELA 2GBYA 3HPGA 3ZRGA 2K4BA 2MLKA 3TO6A 4EMSA 1KONA 1GHCA 3OL4A 2EIJH 2X48A 3U21A 4IHTA 1Y56A 3RIRA 3GO5A 4DBQA 1JJ8C 5FFXA 1SVLA 1FX7A 3H3UA 1Z91A 4DQ2A 3WTSC 1T6SA 2GWRA 2H1KA 4IOAF 1T0FC 3LSPA 2DMPA 2EIKH 2IVMA 1KYZA 2FU4A 4KIGA 3VYUB 1Y8QB 1PUEE 4KFCA 2H94A 2VI6A 2V9KA 4JQFA 1W4MA 2DI3A 3BCAA 1UELB 2VQHA 2P7CB 4G6DA 1OLTA 2WAFA 4ABZA 4C3HJ 2Y0SN 1JKRC 3EDPA 2DA6A 3TP3A 1P7IA 4QPOA 1FBSA 4ZYHA 3FIWA 1IW7F 4CYCB 5HNHA 3JTHA 3CLQA 3C2GA 1DDNA 2FSWA 5B1BH 4F7ZA 4M73A 3HOSA 1D1CA 4OAZA 1ZG1A 2ZKZA 5F27A 3GFJA 2R5ZB 4C3IJ 1SAUA 4A3JJ 4KICA 5L3GA 3KPHA 3KP4A 5H2FC 1QZYA 2AQFA 2ZFUA 1QU3A 5L3BA 1OR7C 3MZHA 4MEXF 5L3CA 3FK7A 1ETXA 2BY1A 4Y17A 2DJNA 3GLXA 4JYKA 1YIJI 4P9UA 1FMWA 3GTMJ 2CV1A 4B4CA 3C7JA 2XHKA 4RM2A 2X6XA 5LLQA 1O3TA 3VYTB 2CU7A 4XLCA 3OYBA 3BR6A 2QVOA 1LQ1A 3GWZA 4HNTA 5EF6A 2HVQA 3QP6A 4I99C 1WCMJ 2HOEA 4BQOA 4PJNA 2DYSH 4IX7A 4W97A 2D1HA 1QZZA 3FMQA 5FFZA 4WWCA 3QOPA 1JGGA 1E2XA 2GZWA 5FKKA 3JRGA 1WHUA 4ESFA 2DDBA 1B59A 1S7AA 3BTLA 3VYRB 4QWQA 2LH9A 4EM0B 3SDBA 3H3VK 2ZB9A 1I3AA 4WXCA 2L2OA 2Q1ZB 3L00A 1ZR2A 3J7ZI 3MKYB 4EM1A 3FDYA 2VKEA 2PFBA 5TGTA 2RV8A 5HLIA 2MGQA 3V8JA 5FLMJ 4C30A 2MABA 1ETQA 2ECCA 2QBYB 3JREA 4D5CA 2DQRA 3EETA 1IN4A 3EYIA 1B72A 2L7FP 4KMUX 2QSHX 5KNLA 3GFMA 4RAFA 2XDVA 2MG4A 3OYNA 2DW4A 3OS1A 1D1BA 2EK5A 2ETHA 2QGUA 3ESWB 5BPIA 3ZMSA 3CMAI 3O3KA 5GP9A 3UNGC 4GDFA 3RKWA 1I6HJ 4YIRX 3OY9A 3OV8A 4LB5A 1A6IA 4A93J 3DBRB 1X2NA 4RB1A 3G73A 2M4KA 3CCUI 1L0OC 2BVMA 3KP6A 1GXQA 1JKPC 3QYBA 1RIOH 5IP7J 4ESJA 3I59B 1UHSA 3ECHA 2VKVA 2R7TA 2XKPA 2ZMEA 3GBGA 4KISA 5HS8A 3WHBA 2LF8A 3GTPJ 4A6DA 3O2PE 2QQ8A 1R49A 3I71A 1P92A 5DM6F 3QQAA 1XMXA 4RGUA 4BE1A 4IQJA 4KIBA 4DGWB 4HNVA 4YIIA 3WTZA 4UHTA 4ON0A 2F6CA 5LGUA 2VJ5A 3ZQLA 1F5TA 2QQ9A 2RN7A 3GEZA 1BC8C 1IUYA 5D6EA 3TL4X 5BS6A 4RLQA 4HEA2 3FM5A 4PJJA 5FROA 2OTJI 2IA0A 2VKDA 3DLLF 4KA4A 5GPCA 5GPAA 4IHWA 1BA5A 4LGWA 2EFWA 3UR3C 2DU9A 4G9YA 3H92A 4GGGA 1S72I 3PO3J 4XKVA 1MW7A 5J4YA 1ZGWA 2LRDA 1O7FA 2DFFA 1LEBA 4Q47A 5J4VA 2IW5A 1W36D 5E8GA 2KJBA 3PL8A 2LKSA 3LQRA 3S15J 1UMQA 2HOTA 1ETYA 3Q9SA 2H8WA 3JRFA 5HS7A 3HXLA 2JZYA 3KP5A 3ZR8X 1R58A 2DDAA 1P4XA 3CCQI 2VOPA 2ZBKA 1MMGA 3CUOA 1ERDA 2XASA 1QNTA 1V4RA 1T56A 2XAUA 3EPZA 3BR5A 2L3DA 4EJUA 3DEEA 1OCZH 5K1YA 2ZCWA 2JTVA 4CH7A 4ZTFA 5LGTA 3SJMA 4F3QA 2M34A 4XORA 5M5WJ 1DPUA 4A6EA 3RKXA 2VT3A 1VZ0A 1XCBA 1ON1A 3HJEA 2EINH 3COAC 1APLC 4I98B 1R1VA 5E79C 1JUPA 5FKMA 1A6QA 2Z5UA 3K1MA 1RKWA 5E3MA 3S32A 4XNFA 3PSIA 2Y9ZA 5FJ8J 3RPUA 2XB5A 3VB2A 1T0FA 1RUNA 2LYCA 3H36A 3HRTA 1YJWI 2DT7B 1HA8A 2F4IA 1I5ZA 3AG1H 1B4AA 2W85A 2GQQA 4A5NA 2X4HA 4GCVA 2TRTA 3FXQA 4ENMA 4A3IJ 2K4JA 5B5EC 1K6OA 3G4SI 4A3EJ 1ACIA 2RGVA 3ULQB 2F4MB 5KAIC 2MA3A 3K4LA 2HVSA 2LKPA 3G3ZA 4G94A 2WAQA 2ZSIB 3E0JB 5D8KB 2ZJ2A 1Y8RB 4HF2A 3LSMA 3P9IA 1K7AA 1Z21A 2QUFA 2DOAA 2EILH 2MC4A 2VIXA 5FKNA 4E6KG 3JRAA 3QPTA 2R7SA 2A68F 5EDNA 2BY0A 3CUQA 3H0GJ 2P4WA 2X9DA 1NK3P 1P2FA 4BDZA 4XRFA 3SQNA 3K4CA 1Y0UA 2HNHA 3E1SA 3F6OA 1R36A 3F9KA 1P9QC 2A07F 3H9GA 3P9CA 1AOYA 2K86A 5KK1A 2EFQA 4G6QA 5KVRA 3W6JB 5BOXA 1OR7A 2W00A 1T39A 4QTRA 2V1UA 3GUDA 1J7KA 4LK1F 3HZJA 1BC7C 1ENHA 4LIUA 2HDWA 2RKHA 5M3MJ 3AG2H 4NBQA 2LD5A 1PP8F 2FOKA 2YR2A 4IEJA 3HOTA 4L0ZB 4KJZA 4F93B 3I64A 4BE0A 3I4MJ 1H89C 1U5TA 4AM3A 3W2VA 2R92J 4EGYA 3K6GA 2XGEA 2HFHA 3KETA 4OIRF 3BR2A 4OINF 2KRHA 2MSYA 5M5YJ 1IDZA 3WE3A 2DFEA 4L9TA 3ZQHA 1B8IA 3S3OA 3JR9A 4IHYA 1LJ9A 1RUOA 3DBHB 2VUMJ 2P5KA 3DXJF 5E18F 2DMUA 2LBFA 2MW8A 2X1EA 2NVQJ 3BG6A 3E6CC 1OPCA 1S8NA 2IP2A 1KQ0A 1R7JA 2ZMEB 3BG9A 3HEFA 1ZG5A 4M9ZA 3CJTB 4ZDOA 2IRFG 1YI2I 3S1NJ 2X6WA 4BL0B 3AAFA 1OCOH 3BROA 5L3DA 3W6KB 2FXAA 1WH7A 2N8GA 1SC7A 1KYWA 4C2UA 1YS7A 2QQAA 2ZJPF 4BGDA 2ME6A 4M3FA 3TW6A 5D4RA 4E4HA 1JTYA 2M0MA 2LOOA 4PFPA 4C3JJ 2H27A 1VQNI 1JUSA 3DQVC 4BY7J 2R7RA 2VKHA 4H0EA 5TRDA 3BR1A 3PFIA 5E3OA 2WA0A 2MLGA 3CCRI 2ID6A 3OIOA 3W3CA 1OJLA 3WG9A 4CCJA 1W0UA 1IN8A 1RZ4A 1OYWA 3V4GA 3GLLA 4NC8A 4PGGA 4XK4A 5J1UA 1ZYRF 4M9XA 5JHUA 2HYGD 2V9VA 4ENNA 3PIOF 1XSVA 4LOCA 3IC7A 1WJ5A 3GTGJ 1TQIA 1UB9A 2GLOA 2UXXA 3IH4A 4XOTA 3DP7A 4BKXA 3RQIA 2CH0A 5K7FA 2Q0OA 3LL7A 1ZH5A 4BH9A 3F8FA 3TW7A 1BI2A 1V5GA 2H6CA 3FXJA 3WU0A 1MSFC 2CFXA 5F0FA 2R7ZJ 3Q0WA 2D2WA 5EYRA 2Q2EA 4BQNA 2ZJQF 1WZ2A 2QBYA 5DV5A 1MMDA 4C9YA 2ZNZA 1SD4A 3J80K 1POGA 2KDZA 4FCYA 5DCMA 1YIOA 2CW0F 1K78B 2E1OA 2K27A 3HDDA 2JJ7A 4WCGA 1R6RA 5F1RA 2Y0MA 5E17F 1N75A 2WB1N 2E1NA 4IL6C 4NQWB 2LFBA 1XCVA 3GTKJ 2EZHA 3CJRB 2H6BA 1K78A 1YRNA 1WKMA 3L2UA 5J1RA 2WWYA 3A01A 3HRMA 3I53A 3L2VA 2QCOA 4WK8F 2XIGA 1FIAA 3NEUA 4F55A 3VOEA 2ELKA 2IA2A 2NVYJ 2CQ7A 2KZVA 5CKTA 3LWFA 4N4NB 2RC4A 1JKOC 3TQNA 3FXOA 4I0BA 2P5VA 4R8HA 2VONA 2XROA 2JSPA 5E1XA 5EG0A 3F22A 1JUMA 2A05A 3KZIC 2AXLA 3BZCA 2XGXA 2YX7A 4Y7NJ 1XS9A 4EM2A 3A4CA 3JRIA 3S2DJ 4CZZA 1LFPA 2JA7J 1A36A 2FD5A 2M4GA 3CP2A 1ZK8A 3VSKA 3CDIA 3WGHA 3IWZA 2WAQN 1O3RA 2G0EA 3RPQA 5C4XJ 3I56I 1X4OA 5EEGA 5EGOA 3TDZC 4R79A 4OAYA 1MZBA 2Z1DA 3DU6A 4OU0A 5CQEA 4NHJA 2P7VB 5HDGA 3KEQA 4E7SA 1T98A 1YITI 2V4JC 1NH3A 4RB3C 1ZRFA 3M4OJ 1MMNA 3BG5A 3O6BB 1B9MA 5J6XA 3PNVA 3QU6A 1QO0D 2OZUA 1D1AA 3RPUD 1HC8A 1D8JA 2BVLA 3E6DA 4XSZF 1HSTA 4IHXA 2M5WA 4X1EA 2DK5A 2PBIA 4DIQA 3A0BC 2R5YB 1MGTA 3R4KA 3ELKA 3ZGKA 5FD6A 2STTA 4Y52J 2JRTA 2PG4A 2Y2ZA 2DT6A 3OYHA 1ZHFA 2CG4A 2NOJB 1TWCJ 2UZKA 1TC3C 3WTTC 2QYOA 3ABMH 3LSKA 5IYBJ 2WAEA 1D5VA 1OISA 1SVOA 5KAFC 1EH6A 2ME0A 2E5NA 2CV0A 2EV0A 3REOA 3K69A 3OS0A 1EF4A 1KQ9A 4KDPA 4AVPA 3FKJA 4M6XA 2QQBA 4HAMA 2Y0SA 5L3EA 1IUFA 2KT0A 1G3WA 3IP4B 1VQMI 4D7MA 3DPLC 3IAS2 1H8AC 4JP0A 3MN2A 4U0VA 4BHBA 1OKRA 3S14J 3MKLA 2P0WA 3G1LA 3AL0C 1YYVA 3LSHA 4HOBA 1Z9CA 1TTYA 4ZZLA 2XGDA 4EQQA 1G3TA 3S93A 2V26A 3K4JA 3RSNA 5LHHA 4CCLA 4E7ZA 3OYGA 5JLWA 2C6YA 1C0WA 2M0CA 3BG3A 1K4SA 3LA2A 3KYCB 3W2AA 3F0CA 4FETA 2LTPA 5DDGA 1N78A 3HHGA 2W4SA 4LLGF 2X6YA 3S1MJ 2VBWA 3ZPLA 1QHGA 1O57A 4MFDA 5M5XJ 2F5EA 4UVCA 3BWGA 4CICA 1TP4A 4K2EA 3OSFA 1LE8A 1W36C 2LVSA 1Z67A 4OMZA 4CCMA 2DXIA 2DODA 2ZO4A 3KYLA 3K10A 3M07A 3RZDJ 5J40A 2LP0A 3QPSA 2DMQA 2X1CA 4HV6A 3HOXJ 1LE8B 1IF1A 3C2HA 3HTSB 3ZN0A 3NARA 4MQVA 3DF8A 4A3MJ 3KYDB 4XMYA 4CA0A 3OYAA 1J75A 5DCMB 3LAJA 2LKXA 1XGOA 1Z05A 2HZTA 1NK2P 4E7LA 2HZDA 1ZLKA 3R60A 1BN5A 3B6AA 2CRGA 1FY7A 4D1QA 1MBKA 3F8CA 3HHHA 3IWFA 2K3FA 2Z3YA 3BP8A 2EIMH 3MZYA 2YS9A 2HOSA 3HOUJ 1ETOA 3OIQA 3CMYA 5IT9K 3EQLF 4LITA 1SANA 3CTAA 2L9RA 3K0LA 4YEJA 1U5TC 5H6RA 5GADJ 1XD7A 5LBQA 3S1RJ 4JK1X 5LEJA 2OV7A 3GZ6A 2F48A 4HRIA 2E5ZA 2R7DA 2W24A 5TJJA 3RQ4A 4AU7A 2LF7A 3ASOH 2JWTA 4CZCA 3ROUA 5DTDA 2CQKA 2XB0X 1XSXA 4N9IA 5IOZA 2E35A 3GMEA 5HLTA 3K4NA 3J80Z 2CWEA 5JI6A 1S7EA 2HYFA 4XN3A 2RQPA 4L9VA 1OYIA 3I54A 4HF0A 4JBAA 4FQGA 2NNNA 3HRSA 3G2BA 3QYFA 1JKQC 1N25A 1L3LA 2CMPA 3BJAA 4KIFA 3BC8A 4NQWA 4RS8A 1JE8A 3H0DA 4XIDA 2NS7A 3OYKA 4M6VA 2EA4A 1LB2A 4RA2A 3DKWA 1M1EB 3CJQB 2GOMA 2FA5A 1CGPA 2PMHA 4U7BA 2Z9OA 1XGNA 1J0RA 3K7AJ 2DYRH 2ID3A 1QRYA 2G7UA 2L9VA 2HPIA 5GAEJ 3K4BA 4KYWA 2E60A 4HA8A
chains in the Genus database with same CATH topology
3ECOA 4AIJA 3ABUA 2OA4A 4E70A 3BJOA 3I59A 4CO8A 3CJNA 5K5OA 2E7WA 3PQJA 3ZMZA 1ZGJA 2EB7A 4DNCA 2XAFA 1JHFA 2FNAA 4IXAA 1ULYA 1MKMA 5FLXK 2PJPA 4TV7A 4Z2YA 4ENKA 2XRNA 1ZGAA 2GAUA 1ZRDA 4M9SA 4A2UA 2HKXA 1G6NA 3SHFA 1IRFA 2OD5A 5H6QA 1REPC 4KN7X 2HQRA 2L01A 2K7LA 1KU7A 3WTYC 3ABTA 2M87A 1U2WA 3R61A 4EJWA 3M1EA 3T1BA 4LK0F 4WF2A 3QRFF 3PQKA 3ERED 4PDKA 4EJVA 1BI3A 1IN5A 2ESNA 4BHCA 2E7XA 2VXZA 2NAZA 1ZAOA 3RJPA 2KIMA 1LDKB 4XLPF 1S29A 3FHZA 1IRGA 3KCCA 4BAYA 1Z6RA 3QPHA 1FP1D 2V1XA 5DEQA 3HSRA 2G9WA 3QP5A 1R1UA 1P6RA 5K5QA 2XAQA 1FWZA 4RB2C 1J59A 3V7CA 4WXHA 5D5XB 2ELHA 1ZG3A 2EJRA 1B6AA 2O3FA 2B0LA 2E1CA 3WGIA 2CYYA 5ICCA 3KP7A 5FD5A 1HXDA 1OMIA 2W57A 1PDNC 5AIQA 4P55A 4UV9A 2UWMA 5E20A 3FWEA 4FX0A 1SMTA 3U1DA 2L02A 2QWWA 1LVAA 4L9JA 1SD7A 4LG0B 1HBXG 2XAGA 1S3JA 1USSA 2K02A 1MD0A 4IF4A 4ETSA 4LLNA 4HLXA 1TW3A 4GYGA 1X3UA 4RAZA 4ZH4F 1YFHA 2PLYA 4O3MA 2HEOA 4EVIA 5HOOA 2OAZA 3N97A 3EYYA 1HW2A 3RI4A 4A12A 5ED4A 3JSPA 1HQCA 5E1WA 3HSEA 3C3WA 3BOQA 3GFIA 3LQQA 2PI0A 1XMAA 5FGMA 3ZP5A 5F64A 4L18B 1V3FA 1G4DA 1XDUA 2IT0A 5D4SA 3ML6A 5L3FA 2XKOA 4FX4A 3D0SA 2WV0A 1EV7A 1H9TA 2RVCA 2HTSA 5ICGA 1LEAA 2CO5A 2F5CA 4Y13A 1FBQA 4I02A 2ZNYA 4L9NA 2O03A 3E3VA 2JSCA 3V8LA 1D3YA 3KZYA 5CVVA 4UUVA 2F5DA 5DD4A 3EUHA 3E97A 3RYRA 5BQTA 1P4WA 3KE2A 1MDMB 4GO1A 3D5LA 2ISZA 2WC2A 5D6FA 3F8NA 3NQOA 2BGCA 5K5RA 3R0JA 1IN7A 2PMUA 1UHWA 1MJAA 2XAHA 3V8KA 2ZFWA 1BIBA 3BPVA 2EFOA 4M74A 4G8XA 1HSJA 4O6JA 1YS6A 4LLLA 1GVJA 1R5HA 1WRJA 4FT8A 4B09A 2W84A 3E5XA 4HDVA 3J7AO 4AIHA 3FMRA 4HLYA 1GXPA 4UVBA 1F4KA 1XB4A 1F9NA 1TBXA 1UFMA 2OZ6A 3WTVC 2PEXA 1W7PB 1FBUA 3SZTA 4Y15A 2DK8A 2XVCA 4Q4ZF 3ZMUA 2O61A 1SFEA 3CDHA 3LFKA 4HDUA 3TGNA 1WQ2A 4A5MA 2KJCA 2M8EA 4I09A 1STZA 1LDDA 2F5FA 1NHAA 4EJOA 3ZMDA 2OBPA 3BZ6A 2RNJA 4IRHA 4ZYDA 3K9TA 5E1ZB 1HW1A 2NRAC 5A2QK 2HTJA 5ICFA 1O3QA 1T2KA 4IHSA 1ZREA 2DFIA 3Q9VA 4M6YA 2OU2A 2OQRA 1HW5A 2DLLA 5ILUA 3FMSA 5JFRA 3NRVA 2J5PA 2OQGA 3KFWX 2MH9A 1U5TB 2VBZA 3CLOA 4Q5SF 2BEOA 4RGRA 4P9FA 3K1PA 5J8FA 1FSHA 1R1TA 2DT5A 3F3XA 2FRHA 4XBFA 2V1DA 2Q8KA 5JR3A 3MAJA 1FP2A 4HQMA 2QM3A 1U78A 4I01A 3KEOA 4IVNA 4N0BA 4PCQA 1R5GA 1BBYA 1XN7A 1SMYF 4YFNF 4O5VA 2UXNA 1EH8A 3M9AA 3M8FA 2GXGA 5CLSA 1TW2A 4OIPF 3F8BA 1DPRA 2COMA 3Q5FA 4S05A 3HSFA 2GA1A 2DAOA 3K1NA 5FLXZ 3BY6A 4U0WA 2YSRA 4MQ9F 4HQEA 4AD9A 1S7OA 3VODA 3FF5A 2FEZA 5E8IA 1RNLA 2VC0A 2IPQX 3MCZA 4ZZDA 2JPCA 3M8EA 2FBIA 2DO7A 2VODA 5CJ9A 4CHUA 4PZJA 2CGPA 3U9GA 2ADUA 3IL2A 2BE5F 4WXDA 3T8TA 4P96A 2HDCA 2NS0A 5LRRA 4MTDA 5IT3A 1ZRCA 1XSDA 5AIPA 1BI0A 4ENJA 3WTWC 2NYXA 3R6SA 4MNUA 3K2ZA 4IRGA 3GXOA 3T8RA 4ASNA 2QLZA 1IAWA 2EV5A 1AWCA 1F1ZA 1LNWA 2ESHA 2RDPA 4LG0A 1SFXA 4I7HA 1IXSB 1W5SA 4HBLA 3ZMVA 4EJTA 3E5QA 2F2EA 5BPDA 1U3EM 1CF7A 5CVJA 2STWA 2VBYA 3JAMZ 3GZ5A 4LD5A 3KLOA 1KQ8A 2R7FA 2MBFA 4RGXA 4HW0A 1QQIA 2IJLA 1I1GA 2R3SA 3DEUA 3HTUA 4OIOF 3E6BA 3F8MA 3RYPA 2GA2A 1WI9A 4HZFA 3WE2A 3MWMA 4CYDA 2P8TA 3HIFA 4P5OA 1IZ1A 1Q1HA 2NNYA 1YO5C 2LSOA 3ISPA 1I1SA 4G7OF 3I4PA 1K79A 2Z99A 2FMLA 1W7PD 4IPAA 2HS5A 3BPXA 4I0AA 2BYVE 3LA3A 3CO6C 4HV5A 1G3YA 1JHHA 4FHTA 3KP2A 3QU3A 2A61A 4UNOA 4BQAA 2VN2A 2QENA 3SXYA 3DPTA 2L54A 2W25A 3LSTA 3GX4X 3SFZA 3ZMTA 1BIAA 4R1HA 1I27A 3WU1B 5HLHA 1YLFA 3TO7A 4YFKF 2HQNA 4KNYA 4I2OA 3ZN1A 1DUXC 4NB5A 4M72A 1FNNA 5DD8A 1WWXA 4OIQF 1YW9A 2M1BA 1FZPB 4U0YA 1FOKA 2KIUA 2VE8A 5DCFA 2EFNA 3MEXA 3GYHX 2GXBA 1D8KA 2HGCA 5DYMA 5D5VB 1B1BA 1OYYA 3MFKA 1MJ9A 2H09A 3U2RA 2FMYA 3SZPA 4YFXF 3V7SA 1P4AA 3F23A 1KGSA 1FT9A 4YG2F 4BYYA 2BV6A 1ZARA 4IRIA 2LNBA 1MJBA 2ISYA 4N9HA 1B9NA 4KT5C 5CVUA 2AS5F 5LEKA 2JPBA 5DUKA 2HKOA 2KIFA 4UV8A 2YX4A 3M7GA 4LB6B 3P9KA 4B8XA 5ERIA 1DP7P 1BI1A 3F72A 2EFPA 6PAXA 1XMKA 1J5YA 1Z7UA 1ODDA 2A3SA 3L09A 3WGGA 3RTRA 5J8CA 5HDNA 1Z6TA 1E17A 3RDIA 5LHIA 2PQ8A 5CYVA 1UCRA 2V79A 2WTEA 3VFZA 4ZYEA 3RKYA 2VC1A 3JAMK 2M30A 5ILVA 1TNTA 2FF4A 3P7NA 3T5XA 2DPDA 1LDJA 4XSXF 2IA1A 1IXCA 4A0YA 2A69F 2CSOA 1FYLA 1YG2A 1TQPA 4CXFA 1U6GA 3QAHA 2X0LA 2FE3A 1YTYA 5HLGA 3I5UA 4L5IA 1FC3A 4GYIA 3CO7C 2EA2A 4CGZA 3L2CA 2O6GE 1O7LA 1PP7U 3KZZA 5ILSA 2D1VA 1W7PA 3I58A 2VE9A 4IJAA 1SFUA 2VBXA 5JVTA 4RB0A 1J2XA 3IKTA 4AIKA 1TNSA 5CVRA 1ZLJA 3N4MA 4XLNF 4KUMA 1I6XA 3FXRA 4WX9A 2FNPA 2MD5A 4S04A 3C1DA 4AWXB 4D0PA 5HVQC 3VEPA 2ACJA 4BXUA 4RGSA 5DUIA 1U8RA 5CVIA 2DTRA 5F6FA 4OOIA 1R22A 2EWNA 2JT1A 5FB2A 1XGSA 2FBHA 2EV6A 1A04A 3R0AA 4MTEA 4HX4A 1FPQA 4LMYA 3J81K 4OMYA 3J81Z 3E5UA 1IN6A 3DFGA 4UVAA 4HX7A 2HWVA 4EGZA 4Q48A 4CDGA 1YW7A 2KRFA 1G3SA 2Y48A 2KKOA 4U7DA 2A5YB 1ON2A 3L9FA 5BMZA 3I0TA 1FSEA 3F6VA 3BJ6A 2QZ8A 3GFLA 4EV0A 1XDSA 1UHMA 4BHPA 4HYEA 3MQ0A 3CUQB 4YIFA 4HX8A 4BNCA 2D45A 3OOPA 4G7ZF 1IXRC 1O3SA 1KU2A 1H0MA 3HYIA 2O8XA 2V6CA 1JXSA 3S2WA 1FLIA 2YU3A 3JW4A 1TQMA 3F21A 2FQ3A 5D5WB 1MDMA 1FYMA 1KA8A 3T0YA 1R23A 1YQAA 1RI7A 4LJZF 5IT9Z 4KMFA 1YW8A 3FZVA 5HDKA 4HF1A 3JSOA 3WTUC 2MC3A 3L7WA 1XGMA 3C18A 3H3ZA 3V7RA 5H20A 2DQLA 1SD6A 2A6HF 1CF7B 3TDUC 3GVAA 2XV4S 1VTNC 4A0XA 2ZXJA 3B73A 5A2QZ 1BJAA 5LHGA 2L4AA 1ZN2A 5D5UB 5HS9A 4G7HF 1SD5A 1S6LA 1ONVA 2M45A 3IRQA 3LA7A 1HKQA 4ESBA 1QPMA 5FO5A 2MH2A 4M71A 2P5LC 4ZYGA 2Y75A 4MHGA 3IRRA 3TOBA 1WSUA 4MEYF 5EEHA 2VOOA 3HUGA 4L0YB 4GXOA 1HKTA 1BOAA 2VT2A 2Z33A 2A6EF 3IKVA 3E6MA 5ICEA 5D8LB 5LGNA 1JGSA 3TOAA 2J5OA 2LDUA 5AONA 3ZQ7A 4MGRA 3LAPA 3WTXC 3GW2A 3KP3A 1QGPA 3HRUA 4KN4X 1QBJA 2O0YA 3JTGA 3DV8A 4RAYA 1J9IA 1R00A 2P6SA 1FYKA 2BBYA 1W5TA 3FXUA 2DBBA 1T38A 1EH7A 1USTA 3TKYA 4LFUA 4U88A 2G7HA 1HKSA 4L5JA 5LRSA 4QLCU 4PGHA 3TO9A 1SAXA 3B02A 3FX3A 2HR3A 2L4MA 1BM9A 3KLNA 4UXNA 1H9GA 3FM3A 2GIVA 3IHUA 2P6TA 3WODF 3BDDA 1KU9A 2TDXA 2YPRA 2DPUA 3CUQC 2XAJA 1KU3A 3GF2A 1Z1DA 2PN6A 2XUBA 2FBKA 1TLHB 4A0ZA 2K4BA 2MLKA 3TO6A 4EMSA 1GHCA 4IHTA 3RIRA 3GO5A 5FFXA 1FX7A 3H3UA 1Z91A 4DQ2A 3WTSC 1T6SA 2GWRA 2IVMA 1KYZA 2FU4A 4KIGA 1PUEE 4KFCA 2H94A 4JQFA 1W4MA 2DI3A 2P7CB 4G6DA 3EDPA 1FBSA 4ZYHA 1IW7F 3JTHA 1DDNA 2FSWA 4F7ZA 4M73A 3HOSA 1ZG1A 2ZKZA 3GFJA 4KICA 5L3GA 3KP4A 1QZYA 5L3BA 3MZHA 4MEXF 5L3CA 4Y17A 3GLXA 4P9UA 3C7JA 2XHKA 5LLQA 1O3TA 2QVOA 1LQ1A 3GWZA 3QP6A 2HOEA 2D1HA 1QZZA 3FMQA 5FFZA 4WWCA 3QOPA 1E2XA 2GZWA 4ESFA 1B59A 1S7AA 4QWQA 4EM0B 4WXCA 3L00A 4EM1A 2PFBA 2RV8A 5HLIA 3V8JA 2QBYB 2DQRA 3EETA 1IN4A 3EYIA 4KMUX 3GFMA 2DW4A 5BPIA 2EK5A 2ETHA 3ZMSA 3O3KA 3RKWA 3OV8A 4LB5A 3G73A 4RB1A 1L0OC 3KP6A 1GXQA 1RIOH 4ESJA 3I59B 3ECHA 2XKPA 2ZMEA 5HS8A 2LF8A 4A6DA 3O2PE 3I71A 1P92A 4RGUA 4KIBA 4YIIA 3WTZA 4UHTA 4ON0A 5LGUA 1F5TA 2QQ9A 2RN7A 3GEZA 1BC8C 1IUYA 5D6EA 5BS6A 3FM5A 2IA0A 4KA4A 4LGWA 2EFWA 2DU9A 4G9YA 3H92A 4GGGA 1O7FA 1LEBA 4Q47A 2IW5A 5E8GA 2KJBA 3LQRA 3Q9SA 5HS7A 2JZYA 3KP5A 1R58A 1P4XA 2VOPA 2ZBKA 3CUOA 2XASA 1QNTA 1V4RA 2L3DA 4EJUA 5K1YA 2ZCWA 2JTVA 5LGTA 1DPUA 4A6EA 3RKXA 2VT3A 1XCBA 1ON1A 3COAC 4I98B 1R1VA 2Z5UA 3K1MA 3RPUA 3VB2A 1T0FA 1RUNA 3HRTA 1I5ZA 1B4AA 2W85A 2GQQA 4A5NA 2X4HA 4GCVA 3FXQA 4ENMA 2K4JA 1K6OA 2RGVA 3ULQB 2MA3A 2LKPA 3G3ZA 4G94A 5D8KB 2ZJ2A 4HF2A 3P9IA 1K7AA 2QUFA 3QPTA 2A68F 3CUQA 2P4WA 1P2FA 4XRFA 3SQNA 1Y0UA 3F6OA 1R36A 2A07F 1AOYA 3P9CA 2K86A 5KK1A 2EFQA 4G6QA 5KVRA 3W6JB 5BOXA 1OR7A 1T39A 2V1UA 3GUDA 1J7KA 4LK1F 1BC7C 2RKHA 1PP8F 2FOKA 2YR2A 3HOTA 4L0ZB 3I64A 1U5TA 4EGYA 2HFHA 3KETA 4OIRF 4OINF 3WE3A 4L9TA 1LJ9A 1RUOA 2P5KA 3DXJF 5E18F 3E6CC 1OPCA 1S8NA 2IP2A 1KQ0A 1R7JA 2ZMEB 1ZG5A 4M9ZA 2IRFG 3AAFA 3BROA 5L3DA 3W6KB 2FXAA 1KYWA 1YS7A 2QQAA 5D4RA 2H27A 3DQVC 4H0EA 5TRDA 3PFIA 2MLGA 3WG9A 1IN8A 1RZ4A 1OYWA 3V4GA 4PGGA 5JHUA 1ZYRF 4M9XA 2HYGD 2V9VA 4ENNA 1XSVA 3IC7A 1TQIA 1UB9A 2UXXA 3DP7A 2Q0OA 1ZH5A 4BH9A 3F8FA 1BI2A 2H6CA 3WU0A 2CFXA 2D2WA 2Q2EA 2QBYA 5DV5A 2ZNZA 1SD4A 3J80K 5DCMA 1YIOA 2CW0F 1K78B 2K27A 4WCGA 5F1RA 2Y0MA 5E17F 2E1NA 1XCVA 2H6BA 1K78A 1WKMA 2WWYA 3HRMA 3I53A 4WK8F 2XIGA 3NEUA 3VOEA 2IA2A 3LWFA 2RC4A 3TQNA 4I0BA 2P5VA 4R8HA 2VONA 2XROA 5E1XA 3F22A 2AXLA 2XGXA 2YX7A 4EM2A 4CZZA 3WGHA 3IWZA 1O3RA 3RPQA 5EEGA 3TDZC 4R79A 1MZBA 4OU0A 4NHJA 2P7VB 5HDGA 3KEQA 1T98A 4RB3C 1ZRFA 3O6BB 1B9MA 5J6XA 3QU6A 1QO0D 2OZUA 1D8JA 3E6DA 4XSZF 1HSTA 2M5WA 2DK5A 2PBIA 1MGTA 3R4KA 3ELKA 5FD6A 2STTA 2JRTA 2PG4A 1ZHFA 2CG4A 2UZKA 3WTTC 2QYOA 1D5VA 1EH6A 2EV0A 3REOA 3K69A 1KQ9A 4KDPA 4AVPA 4M6XA 2QQBA 4HAMA 5L3EA 1G3WA 3DPLC 4BHBA 4U0VA 1OKRA 1YYVA 4HOBA 1Z9CA 1TTYA 4ZZLA 4EQQA 1G3TA 5LHHA 2C6YA 1C0WA 3LA2A 5DDGA 3HHGA 4LLGF 2VBWA 3ZPLA 1O57A 2F5EA 4UVCA 3BWGA 4CICA 4K2EA 4OMZA 2ZO4A 4HV6A 1IF1A 3HTSB 3ZN0A 4MQVA 3DF8A 1J75A 5DCMB 3LAJA 1XGOA 1Z05A 2HZTA 1ZLKA 3R60A 1BN5A 1FY7A 3HHHA 3F8CA 3IWFA 3BP8A 2Z3YA 3MZYA 5IT9K 3EQLF 3CTAA 3K0LA 5H6RA 1U5TC 1XD7A 5LBQA 4JK1X 5LEJA 3GZ6A 2R7DA 2W24A 5TJJA 2LF7A 3ROUA 2CQKA 1XSXA 4N9IA 3J80Z 2CWEA 5JI6A 2HYFA 2RQPA 4L9VA 1OYIA 3I54A 4HF0A 4JBAA 2NNNA 3HRSA 1L3LA 3BJAA 4KIFA 4NQWA 4RS8A 1JE8A 1LB2A 2EA4A 3DKWA 2FA5A 1CGPA 2PMHA 4U7BA 2Z9OA 1XGNA 1J0RA 2G7UA 4KYWA 4HA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ECO A;  4AIJ A;  3ABU A;  2OA4 A;  4E70 A;  3BJO A;  3I59 A;  4CO8 A;  3CJN A;  5K5O A;  2E7W A;  3PQJ A;  3ZMZ A;  1ZGJ A;  2EB7 A;  4DNC A;  2XAF A;  1JHF A;  2FNA A;  4IXA A;  1ULY A;  1MKM A;  5FLX K;  2PJP A;  4TV7 A;  4Z2Y A;  4ENK A;  2XRN A;  1ZGA A;  2GAU A;  1ZRD A;  4M9S A;  4A2U A;  2HKX A;  1G6N A;  3SHF A;  1IRF A;  2OD5 A;  5H6Q A;  1REP C;  4KN7 X;  2HQR A;  2L01 A;  2K7L A;  1KU7 A;  3WTY C;  3ABT A;  2M87 A;  1U2W A;  3R61 A;  4EJW A;  3M1E A;  3T1B A;  4LK0 F;  4WF2 A;  3QRF F;  3PQK A;  3ERE D;  4PDK A;  4EJV A;  1BI3 A;  1IN5 A;  2ESN A;  4BHC A;  2E7X A;  2VXZ A;  2NAZ A;  1ZAO A;  3RJP A;  2KIM A;  1LDK B;  4XLP F;  1S29 A;  3FHZ A;  1IRG A;  3KCC A;  4BAY A;  1Z6R A;  3QPH A;  1FP1 D;  2V1X A;  5DEQ A;  3HSR A;  2G9W A;  3QP5 A;  1R1U A;  1P6R A;  5K5Q A;  2XAQ A;  1FWZ A;  4RB2 C;  1J59 A;  3V7C A;  4WXH A;  5D5X B;  2ELH A;  1ZG3 A;  2EJR A;  1B6A A;  2O3F A;  2B0L A;  2E1C A;  3WGI A;  2CYY A;  5ICC A;  3KP7 A;  5FD5 A;  1HXD A;  1OMI A;  2W57 A;  1PDN C;  5AIQ A;  4P55 A;  4UV9 A;  2UWM A;  5E20 A;  3FWE A;  4FX0 A;  1SMT A;  3U1D A;  2L02 A;  2QWW A;  1LVA A;  4L9J A;  1SD7 A;  4LG0 B;  1HBX G;  2XAG A;  1S3J A;  1USS A;  2K02 A;  1MD0 A;  4IF4 A;  4ETS A;  4LLN A;  4HLX A;  1TW3 A;  4GYG A;  1X3U A;  4RAZ A;  4ZH4 F;  1YFH A;  2PLY A;  4O3M A;  2HEO A;  4EVI A;  5HOO A;  2OAZ A;  3N97 A;  3EYY A;  1HW2 A;  3RI4 A;  4A12 A;  5ED4 A;  3JSP A;  1HQC A;  5E1W A;  3HSE A;  3C3W A;  3BOQ A;  3GFI A;  3LQQ A;  2PI0 A;  1XMA A;  5FGM A;  3ZP5 A;  5F64 A;  4L18 B;  1V3F A;  1G4D A;  1XDU A;  2IT0 A;  5D4S A;  3ML6 A;  5L3F A;  2XKO A;  4FX4 A;  3D0S A;  2WV0 A;  1EV7 A;  1H9T A;  2RVC A;  2HTS A;  5ICG A;  1LEA A;  2CO5 A;  2F5C A;  4Y13 A;  1FBQ A;  4I02 A;  2ZNY A;  4L9N A;  2O03 A;  3E3V A;  2JSC A;  3V8L A;  1D3Y A;  3KZY A;  5CVV A;  4UUV A;  2F5D A;  5DD4 A;  3EUH A;  3E97 A;  3RYR A;  5BQT A;  1P4W A;  3KE2 A;  1MDM B;  4GO1 A;  3D5L A;  2ISZ A;  2WC2 A;  5D6F A;  3F8N A;  3NQO A;  2BGC A;  5K5R A;  3R0J A;  1IN7 A;  2PMU A;  1UHW A;  1MJA A;  2XAH A;  3V8K A;  2ZFW A;  1BIB A;  3BPV A;  2EFO A;  4M74 A;  4G8X A;  1HSJ A;  4O6J A;  1YS6 A;  4LLL A;  1GVJ A;  1R5H A;  1WRJ A;  4FT8 A;  4B09 A;  2W84 A;  3E5X A;  4HDV A;  3J7A O;  4AIH A;  3FMR A;  4HLY A;  1GXP A;  4UVB A;  1F4K A;  1XB4 A;  1F9N A;  1TBX A;  1UFM A;  2OZ6 A;  3WTV C;  2PEX A;  1W7P B;  1FBU A;  3SZT A;  4Y15 A;  2DK8 A;  2XVC A;  4Q4Z F;  3ZMU A;  2O61 A;  1SFE A;  3CDH A;  3LFK A;  4HDU A;  3TGN A;  1WQ2 A;  4A5M A;  2KJC A;  2M8E A;  4I09 A;  1STZ A;  1LDD A;  2F5F A;  1NHA A;  4EJO A;  3ZMD A;  2OBP A;  3BZ6 A;  2RNJ A;  4IRH A;  4ZYD A;  3K9T A;  5E1Z B;  1HW1 A;  2NRA C;  5A2Q K;  2HTJ A;  5ICF A;  1O3Q A;  1T2K A;  4IHS A;  1ZRE A;  2DFI A;  3Q9V A;  4M6Y A;  2OU2 A;  2OQR A;  1HW5 A;  2DLL A;  5ILU A;  3FMS A;  5JFR A;  3NRV A;  2J5P A;  2OQG A;  3KFW X;  2MH9 A;  1U5T B;  2VBZ A;  3CLO A;  4Q5S F;  2BEO A;  4RGR A;  4P9F A;  3K1P A;  5J8F A;  1FSH A;  1R1T A;  2DT5 A;  3F3X A;  2FRH A;  4XBF A;  2V1D A;  2Q8K A;  5JR3 A;  3MAJ A;  1FP2 A;  4HQM A;  2QM3 A;  1U78 A;  4I01 A;  3KEO A;  4IVN A;  4N0B A;  4PCQ A;  1R5G A;  1BBY A;  1XN7 A;  1SMY F;  4YFN F;  4O5V A;  2UXN A;  1EH8 A;  3M9A A;  3M8F A;  2GXG A;  5CLS A;  1TW2 A;  4OIP F;  3F8B A;  1DPR A;  2COM A;  3Q5F A;  4S05 A;  3HSF A;  2GA1 A;  2DAO A;  3K1N A;  5FLX Z;  3BY6 A;  4U0W A;  2YSR A;  4MQ9 F;  4HQE A;  4AD9 A;  1S7O A;  3VOD A;  3FF5 A;  2FEZ A;  5E8I A;  1RNL A;  2VC0 A;  2IPQ X;  3MCZ A;  4ZZD A;  2JPC A;  3M8E A;  2FBI A;  2DO7 A;  2VOD A;  5CJ9 A;  4CHU A;  4PZJ A;  2CGP A;  3U9G A;  2ADU A;  3IL2 A;  2BE5 F;  4WXD A;  3T8T A;  4P96 A;  2HDC A;  2NS0 A;  5LRR A;  4MTD A;  5IT3 A;  1ZRC A;  1XSD A;  5AIP A;  1BI0 A;  4ENJ A;  3WTW C;  2NYX A;  3R6S A;  4MNU A;  3K2Z A;  4IRG A;  3GXO A;  3T8R A;  4ASN A;  2QLZ A;  1IAW A;  2EV5 A;  1AWC A;  1F1Z A;  1LNW A;  2ESH A;  2RDP A;  4LG0 A;  1SFX A;  4I7H A;  1IXS B;  1W5S A;  4HBL A;  3ZMV A;  4EJT A;  3E5Q A;  2F2E A;  5BPD A;  1U3E M;  1CF7 A;  5CVJ A;  2STW A;  2VBY A;  3JAM Z;  3GZ5 A;  4LD5 A;  3KLO A;  1KQ8 A;  2R7F A;  2MBF A;  4RGX A;  4HW0 A;  1QQI A;  2IJL A;  1I1G A;  2R3S A;  3DEU A;  3HTU A;  4OIO F;  3E6B A;  3F8M A;  3RYP A;  2GA2 A;  1WI9 A;  4HZF A;  3WE2 A;  3MWM A;  4CYD A;  2P8T A;  3HIF A;  4P5O A;  1IZ1 A;  1Q1H A;  2NNY A;  1YO5 C;  2LSO A;  3ISP A;  1I1S A;  4G7O F;  3I4P A;  1K79 A;  2Z99 A;  2FML A;  1W7P D;  4IPA A;  2HS5 A;  3BPX A;  4I0A A;  2BYV E;  3LA3 A;  3CO6 C;  4HV5 A;  1G3Y A;  1JHH A;  4FHT A;  3KP2 A;  3QU3 A;  2A61 A;  4UNO A;  4BQA A;  2VN2 A;  2QEN A;  3SXY A;  3DPT A;  2L54 A;  2W25 A;  3LST A;  3GX4 X;  3SFZ A;  3ZMT A;  1BIA A;  4R1H A;  1I27 A;  3WU1 B;  5HLH A;  1YLF A;  3TO7 A;  4YFK F;  2HQN A;  4KNY A;  4I2O A;  3ZN1 A;  1DUX C;  4NB5 A;  4M72 A;  1FNN A;  5DD8 A;  1WWX A;  4OIQ F;  1YW9 A;  2M1B A;  1FZP B;  4U0Y A;  1FOK A;  2KIU A;  2VE8 A;  5DCF A;  2EFN A;  3MEX A;  3GYH X;  2GXB A;  1D8K A;  2HGC A;  5DYM A;  5D5V B;  1B1B A;  1OYY A;  3MFK A;  1MJ9 A;  2H09 A;  3U2R A;  2FMY A;  3SZP A;  4YFX F;  3V7S A;  1P4A A;  3F23 A;  1KGS A;  1FT9 A;  4YG2 F;  4BYY A;  2BV6 A;  1ZAR A;  4IRI A;  2LNB A;  1MJB A;  2ISY A;  4N9H A;  1B9N A;  4KT5 C;  5CVU A;  2AS5 F;  5LEK A;  2JPB A;  5DUK A;  2HKO A;  2KIF A;  4UV8 A;  2YX4 A;  3M7G A;  4LB6 B;  3P9K A;  4B8X A;  5ERI A;  1DP7 P;  1BI1 A;  3F72 A;  2EFP A;  6PAX A;  1XMK A;  1J5Y A;  1Z7U A;  1ODD A;  2A3S A;  3L09 A;  3WGG A;  3RTR A;  5J8C A;  5HDN A;  1Z6T A;  1E17 A;  3RDI A;  5LHI A;  2PQ8 A;  5CYV A;  1UCR A;  2V79 A;  2WTE A;  3VFZ A;  4ZYE A;  3RKY A;  2VC1 A;  3JAM K;  2M30 A;  5ILV A;  1TNT A;  2FF4 A;  3P7N A;  3T5X A;  2DPD A;  1LDJ A;  4XSX F;  2IA1 A;  1IXC A;  4A0Y A;  2A69 F;  2CSO A;  1FYL A;  1YG2 A;  1TQP A;  4CXF A;  1U6G A;  3QAH A;  2X0L A;  2FE3 A;  1YTY A;  5HLG A;  3I5U A;  4L5I A;  1FC3 A;  4GYI A;  3CO7 C;  2EA2 A;  4CGZ A;  3L2C A;  2O6G E;  1O7L A;  1PP7 U;  3KZZ A;  5ILS A;  2D1V A;  1W7P A;  3I58 A;  2VE9 A;  4IJA A;  1SFU A;  2VBX A;  5JVT A;  4RB0 A;  1J2X A;  3IKT A;  4AIK A;  1TNS A;  5CVR A;  1ZLJ A;  3N4M A;  4XLN F;  4KUM A;  1I6X A;  3FXR A;  4WX9 A;  2FNP A;  2MD5 A;  4S04 A;  3C1D A;  4AWX B;  4D0P A;  5HVQ C;  3VEP A;  2ACJ A;  4BXU A;  4RGS A;  5DUI A;  1U8R A;  5CVI A;  2DTR A;  5F6F A;  4OOI A;  1R22 A;  2EWN A;  2JT1 A;  5FB2 A;  1XGS A;  2FBH A;  2EV6 A;  1A04 A;  3R0A A;  4MTE A;  4HX4 A;  1FPQ A;  4LMY A;  3J81 K;  4OMY A;  3J81 Z;  3E5U A;  1IN6 A;  3DFG A;  4UVA A;  4HX7 A;  2HWV A;  4EGZ A;  4Q48 A;  4CDG A;  1YW7 A;  2KRF A;  1G3S A;  2Y48 A;  2KKO A;  4U7D A;  2A5Y B;  1ON2 A;  3L9F A;  5BMZ A;  3I0T A;  1FSE A;  3F6V A;  3BJ6 A;  2QZ8 A;  3GFL A;  4EV0 A;  1XDS A;  1UHM A;  4BHP A;  4HYE A;  3MQ0 A;  3CUQ B;  4YIF A;  4HX8 A;  4BNC A;  2D45 A;  3OOP A;  4G7Z F;  1IXR C;  1O3S A;  1KU2 A;  1H0M A;  3HYI A;  2O8X A;  2V6C A;  1JXS A;  3S2W A;  1FLI A;  2YU3 A;  3JW4 A;  1TQM A;  3F21 A;  2FQ3 A;  5D5W B;  1MDM A;  1FYM A;  1KA8 A;  3T0Y A;  1R23 A;  1YQA A;  1RI7 A;  4LJZ F;  5IT9 Z;  4KMF A;  1YW8 A;  3FZV A;  5HDK A;  4HF1 A;  3JSO A;  3WTU C;  2MC3 A;  3L7W A;  1XGM A;  3C18 A;  3H3Z A;  3V7R A;  5H20 A;  2DQL A;  1SD6 A;  2A6H F;  1CF7 B;  3TDU C;  3GVA A;  2XV4 S;  1VTN C;  4A0X A;  2ZXJ A;  3B73 A;  5A2Q Z;  1BJA A;  5LHG A;  2L4A A;  1ZN2 A;  5D5U B;  5HS9 A;  4G7H F;  1SD5 A;  1S6L A;  1ONV A;  2M45 A;  3IRQ A;  3LA7 A;  1HKQ A;  4ESB A;  1QPM A;  5FO5 A;  2MH2 A;  4M71 A;  2P5L C;  4ZYG A;  2Y75 A;  4MHG A;  3IRR A;  3TOB A;  1WSU A;  4MEY F;  5EEH A;  2VOO A;  3HUG A;  4L0Y B;  4GXO A;  1HKT A;  1BOA A;  2VT2 A;  2Z33 A;  2A6E F;  3IKV A;  3E6M A;  5ICE A;  5D8L B;  5LGN A;  1JGS A;  3TOA A;  2J5O A;  2LDU A;  5AON A;  3ZQ7 A;  4MGR A;  3LAP A;  3WTX C;  3GW2 A;  3KP3 A;  1QGP A;  3HRU A;  4KN4 X;  1QBJ A;  2O0Y A;  3JTG A;  3DV8 A;  4RAY A;  1J9I A;  1R00 A;  2P6S A;  1FYK A;  2BBY A;  1W5T A;  3FXU A;  2DBB A;  1T38 A;  1EH7 A;  1UST A;  3TKY A;  4LFU A;  4U88 A;  2G7H A;  1HKS A;  4L5J A;  5LRS A;  4QLC U;  4PGH A;  3TO9 A;  1SAX A;  3B02 A;  3FX3 A;  2HR3 A;  2L4M A;  1BM9 A;  3KLN A;  4UXN A;  1H9G A;  3FM3 A;  2GIV A;  3IHU A;  2P6T A;  3WOD F;  3BDD A;  1KU9 A;  2TDX A;  2YPR A;  2DPU A;  3CUQ C;  2XAJ A;  1KU3 A;  3GF2 A;  1Z1D A;  2PN6 A;  2XUB A;  2FBK A;  1TLH B;  4A0Z A;  2K4B A;  2MLK A;  3TO6 A;  4EMS A;  1GHC A;  4IHT A;  3RIR A;  3GO5 A;  5FFX A;  1FX7 A;  3H3U A;  1Z91 A;  4DQ2 A;  3WTS C;  1T6S A;  2GWR A;  2IVM A;  1KYZ A;  2FU4 A;  4KIG A;  1PUE E;  4KFC A;  2H94 A;  4JQF A;  1W4M A;  2DI3 A;  2P7C B;  4G6D A;  3EDP A;  1FBS A;  4ZYH A;  1IW7 F;  3JTH A;  1DDN A;  2FSW A;  4F7Z A;  4M73 A;  3HOS A;  1ZG1 A;  2ZKZ A;  3GFJ A;  4KIC A;  5L3G A;  3KP4 A;  1QZY A;  5L3B A;  3MZH A;  4MEX F;  5L3C A;  4Y17 A;  3GLX A;  4P9U A;  3C7J A;  2XHK A;  5LLQ A;  1O3T A;  2QVO A;  1LQ1 A;  3GWZ A;  3QP6 A;  2HOE A;  2D1H A;  1QZZ A;  3FMQ A;  5FFZ A;  4WWC A;  3QOP A;  1E2X A;  2GZW A;  4ESF A;  1B59 A;  1S7A A;  4QWQ A;  4EM0 B;  4WXC A;  3L00 A;  4EM1 A;  2PFB A;  2RV8 A;  5HLI A;  3V8J A;  2QBY B;  2DQR A;  3EET A;  1IN4 A;  3EYI A;  4KMU X;  3GFM A;  2DW4 A;  5BPI A;  2EK5 A;  2ETH A;  3ZMS A;  3O3K A;  3RKW A;  3OV8 A;  4LB5 A;  3G73 A;  4RB1 A;  1L0O C;  3KP6 A;  1GXQ A;  1RIO H;  4ESJ A;  3I59 B;  3ECH A;  2XKP A;  2ZME A;  5HS8 A;  2LF8 A;  4A6D A;  3O2P E;  3I71 A;  1P92 A;  4RGU A;  4KIB A;  4YII A;  3WTZ A;  4UHT A;  4ON0 A;  5LGU A;  1F5T A;  2QQ9 A;  2RN7 A;  3GEZ A;  1BC8 C;  1IUY A;  5D6E A;  5BS6 A;  3FM5 A;  2IA0 A;  4KA4 A;  4LGW A;  2EFW A;  2DU9 A;  4G9Y A;  3H92 A;  4GGG A;  1O7F A;  1LEB A;  4Q47 A;  2IW5 A;  5E8G A;  2KJB A;  3LQR A;  3Q9S A;  5HS7 A;  2JZY A;  3KP5 A;  1R58 A;  1P4X A;  2VOP A;  2ZBK A;  3CUO A;  2XAS A;  1QNT A;  1V4R A;  2L3D A;  4EJU A;  5K1Y A;  2ZCW A;  2JTV A;  5LGT A;  1DPU A;  4A6E A;  3RKX A;  2VT3 A;  1XCB A;  1ON1 A;  3COA C;  4I98 B;  1R1V A;  2Z5U A;  3K1M A;  3RPU A;  3VB2 A;  1T0F A;  1RUN A;  3HRT A;  1I5Z A;  1B4A A;  2W85 A;  2GQQ A;  4A5N A;  2X4H A;  4GCV A;  3FXQ A;  4ENM A;  2K4J A;  1K6O A;  2RGV A;  3ULQ B;  2MA3 A;  2LKP A;  3G3Z A;  4G94 A;  5D8K B;  2ZJ2 A;  4HF2 A;  3P9I A;  1K7A A;  2QUF A;  3QPT A;  2A68 F;  3CUQ A;  2P4W A;  1P2F A;  4XRF A;  3SQN A;  1Y0U A;  3F6O A;  1R36 A;  2A07 F;  1AOY A;  3P9C A;  2K86 A;  5KK1 A;  2EFQ A;  4G6Q A;  5KVR A;  3W6J B;  5BOX A;  1OR7 A;  1T39 A;  2V1U A;  3GUD A;  1J7K A;  4LK1 F;  1BC7 C;  2RKH A;  1PP8 F;  2FOK A;  2YR2 A;  3HOT A;  4L0Z B;  3I64 A;  1U5T A;  4EGY A;  2HFH A;  3KET A;  4OIR F;  4OIN F;  3WE3 A;  4L9T A;  1LJ9 A;  1RUO A;  2P5K A;  3DXJ F;  5E18 F;  3E6C C;  1OPC A;  1S8N A;  2IP2 A;  1KQ0 A;  1R7J A;  2ZME B;  1ZG5 A;  4M9Z A;  2IRF G;  3AAF A;  3BRO A;  5L3D A;  3W6K B;  2FXA A;  1KYW A;  1YS7 A;  2QQA A;  5D4R A;  2H27 A;  3DQV C;  4H0E A;  5TRD A;  3PFI A;  2MLG A;  3WG9 A;  1IN8 A;  1RZ4 A;  1OYW A;  3V4G A;  4PGG A;  5JHU A;  1ZYR F;  4M9X A;  2HYG D;  2V9V A;  4ENN A;  1XSV A;  3IC7 A;  1TQI A;  1UB9 A;  2UXX A;  3DP7 A;  2Q0O A;  1ZH5 A;  4BH9 A;  3F8F A;  1BI2 A;  2H6C A;  3WU0 A;  2CFX A;  2D2W A;  2Q2E A;  2QBY A;  5DV5 A;  2ZNZ A;  1SD4 A;  3J80 K;  5DCM A;  1YIO A;  2CW0 F;  1K78 B;  2K27 A;  4WCG A;  5F1R A;  2Y0M A;  5E17 F;  2E1N A;  1XCV A;  2H6B A;  1K78 A;  1WKM A;  2WWY A;  3HRM A;  3I53 A;  4WK8 F;  2XIG A;  3NEU A;  3VOE A;  2IA2 A;  3LWF A;  2RC4 A;  3TQN A;  4I0B A;  2P5V A;  4R8H A;  2VON A;  2XRO A;  5E1X A;  3F22 A;  2AXL A;  2XGX A;  2YX7 A;  4EM2 A;  4CZZ A;  3WGH A;  3IWZ A;  1O3R A;  3RPQ A;  5EEG A;  3TDZ C;  4R79 A;  1MZB A;  4OU0 A;  4NHJ A;  2P7V B;  5HDG A;  3KEQ A;  1T98 A;  4RB3 C;  1ZRF A;  3O6B B;  1B9M A;  5J6X A;  3QU6 A;  1QO0 D;  2OZU A;  1D8J A;  3E6D A;  4XSZ F;  1HST A;  2M5W A;  2DK5 A;  2PBI A;  1MGT A;  3R4K A;  3ELK A;  5FD6 A;  2STT A;  2JRT A;  2PG4 A;  1ZHF A;  2CG4 A;  2UZK A;  3WTT C;  2QYO A;  1D5V A;  1EH6 A;  2EV0 A;  3REO A;  3K69 A;  1KQ9 A;  4KDP A;  4AVP A;  4M6X A;  2QQB A;  4HAM A;  5L3E A;  1G3W A;  3DPL C;  4BHB A;  4U0V A;  1OKR A;  1YYV A;  4HOB A;  1Z9C A;  1TTY A;  4ZZL A;  4EQQ A;  1G3T A;  5LHH A;  2C6Y A;  1C0W A;  3LA2 A;  5DDG A;  3HHG A;  4LLG F;  2VBW A;  3ZPL A;  1O57 A;  2F5E A;  4UVC A;  3BWG A;  4CIC A;  4K2E A;  4OMZ A;  2ZO4 A;  4HV6 A;  1IF1 A;  3HTS B;  3ZN0 A;  4MQV A;  3DF8 A;  1J75 A;  5DCM B;  3LAJ A;  1XGO A;  1Z05 A;  2HZT A;  1ZLK A;  3R60 A;  1BN5 A;  1FY7 A;  3HHH A;  3F8C A;  3IWF A;  3BP8 A;  2Z3Y A;  3MZY A;  5IT9 K;  3EQL F;  3CTA A;  3K0L A;  5H6R A;  1U5T C;  1XD7 A;  5LBQ A;  4JK1 X;  5LEJ A;  3GZ6 A;  2R7D A;  2W24 A;  5TJJ A;  2LF7 A;  3ROU A;  2CQK A;  1XSX A;  4N9I A;  3J80 Z;  2CWE A;  5JI6 A;  2HYF A;  2RQP A;  4L9V A;  1OYI A;  3I54 A;  4HF0 A;  4JBA A;  2NNN A;  3HRS A;  1L3L A;  3BJA A;  4KIF A;  4NQW A;  4RS8 A;  1JE8 A;  1LB2 A;  2EA4 A;  3DKW A;  2FA5 A;  1CGP A;  2PMH A;  4U7B A;  2Z9O A;  1XGN A;  1J0R A;  2G7U A;  4KYW A;  4HA8 A; 
#chains in the Genus database with same CATH topology
 3QPL A;  2HXI A;  2JQ7 A;  3ECO A;  4AIJ A;  3ABU A;  2OA4 A;  1AA7 A;  2I5U A;  4E70 A;  3BJO A;  4J01 A;  3I59 A;  4CO8 A;  2X85 A;  2UV1 A;  3CJN A;  3TBI A;  5K5O A;  1FEX A;  2E7W A;  1JI8 A;  3ABK H;  3PQJ A;  3ZMZ A;  2DMT A;  3S3N A;  2BZT A;  1ZGJ A;  3BQZ A;  1RKT A;  2EB7 A;  4DNC A;  2XAF A;  1JHF A;  2FNA A;  1QA6 A;  3CP8 A;  4ITV A;  4IXA A;  4UB6 C;  1ULY A;  1MKM A;  1HLV A;  1FOW A;  5FLX K;  3Q0V A;  2PJP A;  2KDO A;  4IKF A;  2VAS A;  3P5J A;  4TV7 A;  4AID A;  4AYB N;  4Z2Y A;  4ENK A;  1WFX A;  2XRN A;  5IYD J;  1ZGA A;  2GAU A;  1ZRD A;  4HG2 A;  4M9S A;  1GDT A;  1MBJ A;  1XX5 A;  4A2U A;  2HKX A;  1G6N A;  3SHF A;  1IRF A;  4LG3 A;  2OD5 A;  1OCC H;  5H6Q A;  1REP C;  2BXZ A;  4KN7 X;  2HQR A;  2VQL A;  5FLV A;  2L01 A;  1GT0 C;  2K7L A;  1KU7 A;  3WTY C;  3ABT A;  2JK3 A;  2M87 A;  1X1A A;  2WB1 A;  3PFY A;  4A3F J;  1U2W A;  2IAI A;  2MFZ A;  2B7E A;  3R61 A;  4EJW A;  2AO9 A;  3WG7 H;  1DP3 A;  2BW3 B;  3M1E A;  4LK0 F;  4WF2 A;  3T1B A;  3QRF F;  3CCY A;  3BR0 A;  3PQK A;  2ZXI A;  3ERE D;  4PDK A;  2VQC A;  4EJV A;  1BI3 A;  1IN5 A;  2ESN A;  4IQ4 A;  1AKH A;  4BHC A;  2YU9 J;  2ZC2 A;  2E7X A;  2VXZ A;  2NAZ A;  1ZAO A;  3RJP A;  2KIM A;  3NWT A;  1LDK B;  4RLF A;  4XLP F;  1S29 A;  4DZP A;  3FHZ A;  1IV6 A;  1SVM A;  4QSH A;  2GIZ A;  1IRG A;  3KCC A;  4BAY A;  5C44 J;  1JT0 A;  1Z6R A;  1ETW A;  3QPH A;  1FP1 D;  2M7B A;  3OYF A;  1DGW Y;  2V1X A;  3HGG A;  5DEQ A;  1RR7 A;  1R4N B;  2CUF A;  2HYJ A;  3HSR A;  2G9W A;  5C4J J;  3QP5 A;  3M3Y J;  1R1U A;  1P6R A;  1SEU A;  2KP6 A;  4B3A A;  1X3W B;  5K5Q A;  2XAQ A;  1FWZ A;  4RB2 C;  1K6Y A;  1J59 A;  3V7C A;  4WXH A;  2NVU B;  4XLE A;  2CW7 A;  5D5X B;  2ELH A;  1YX5 A;  1ZG3 A;  1ZQ3 P;  1Y1W J;  2EJR A;  1B6A A;  3ZCO A;  5BNG A;  2O3F A;  4X6A J;  2B0L A;  2R7W A;  2L0K A;  3DWL E;  1DGR M;  1RR8 C;  2E1C A;  3WGI A;  2CYY A;  5ICC A;  3KP7 A;  5FD5 A;  1HXD A;  1OMI A;  2W57 A;  1PDN C;  5AIQ A;  4P55 A;  3ZQI A;  4UV9 A;  2UWM A;  5E20 A;  3FWE A;  4FX0 A;  2VQG A;  5C3E J;  2MYS A;  2Z16 A;  3W6V A;  1Z7L A;  2XF6 A;  4PJ0 C;  1SMT A;  2L5Q A;  4MLO A;  3U1D A;  2L02 A;  1DU6 A;  1XTA A;  2QWW A;  3OYE A;  4A3K J;  3H9Q A;  1LVA A;  5B3S H;  4L9J A;  1SD7 A;  4LG0 B;  1HBX G;  2XAG A;  1S3J A;  1USS A;  2K02 A;  4BJ6 C;  3BTC A;  4J00 A;  1MNE A;  1MD0 A;  4IF4 A;  4ETS A;  4LLN A;  1TT0 A;  3U1K A;  2CS3 A;  2GM4 A;  4BBR J;  4HLX A;  2HDD A;  1TW3 A;  4GYG A;  1X3U A;  2LC2 A;  4RAZ A;  4ZH4 F;  1YFH A;  3OWT A;  4GRI A;  2PLY A;  4O3M A;  2HEO A;  5F0C A;  4EVI A;  3JRD A;  5HOO A;  3ASN H;  2OAZ A;  3N97 A;  3HOV J;  3EYY A;  4UUT A;  3PUF A;  1HW2 A;  3DKY A;  1YRN B;  4H4K C;  3TMO A;  3L1P A;  4BUP A;  2PJR A;  2O9L A;  5FRN A;  3RI4 A;  4A12 A;  5ED4 A;  3JSP A;  1HQC A;  5E1W A;  2GXA A;  1IO2 A;  4XRS A;  5JLX A;  3HSE A;  1X4P A;  1SFO J;  3C3W A;  3BOQ A;  3GFI A;  2VXD A;  3LQQ A;  2CUE A;  1IDY A;  3MD2 A;  2PI0 A;  4DBR A;  4KT6 A;  1XMA A;  5FGM A;  4UUS B;  2OUM A;  3SEQ A;  3ZP5 A;  3JRH A;  5F64 A;  4L18 B;  3CF2 A;  4FTH A;  1WVR A;  4A3C J;  1V3F A;  1G4D A;  1XDU A;  2IT0 A;  5D4S A;  3ML6 A;  5L3F A;  1K83 J;  2XKO A;  2M2E A;  4FX4 A;  2K9Q A;  4CCO A;  4V2F A;  3D0S A;  4F52 A;  2WV0 A;  1EV7 A;  3CQZ J;  1H9T A;  2RVC A;  2HTS A;  1OCP A;  5ICG A;  3CCE I;  4MIM A;  2QSF X;  2CQX A;  2XPU A;  3FKI J;  1LEA A;  2CO5 A;  2F5C A;  1W1W E;  4Y13 A;  1VI0 A;  2DA4 A;  2K9S A;  1FBQ A;  4PK4 A;  3Q3S A;  4I02 A;  3HM5 A;  2ZNY A;  2BY2 A;  2B9S A;  4L9N A;  3VDX A;  2O03 A;  3E3V A;  4XOP A;  4ZYA A;  1VQ6 I;  5EG0 B;  3MMY B;  1Y39 A;  1BW6 A;  1TT5 B;  2JSC A;  4L5E A;  1MNM C;  3V8L A;  1D3Y A;  3KZY A;  5CVV A;  4UUV A;  3G6E I;  2F5D A;  1D0Y A;  5DD4 A;  3EUH A;  2QKL B;  3E97 A;  3D1N I;  2IS2 A;  3RYR A;  2AXT C;  2XC7 A;  3OSG A;  1MMA A;  5BQT A;  1N77 A;  1P4W A;  1FIP A;  3KE2 A;  4M3G A;  1MDM B;  4GO1 A;  3G71 I;  3D5L A;  3D5R C;  2ISZ A;  1XC5 A;  2WC2 A;  5D6F A;  3QYE A;  3F8N A;  4UB8 C;  1X1C A;  3NQO A;  2M9H A;  1WGX A;  2BGC A;  5K5R A;  3R0J A;  1IN7 A;  2PMU A;  2E1M C;  2HVR A;  1UHW A;  2X1D A;  1MJA A;  2XAH A;  4MO7 A;  1XPX A;  4GFB A;  3V8K A;  1J09 A;  2ZFW A;  1BIB A;  2IS1 A;  2MD0 A;  3OYD A;  1X1D A;  3BPV A;  2EFO A;  3WU2 C;  5M3F J;  4M74 A;  4G8X A;  1HSJ A;  4O6J A;  3S8P A;  1YS6 A;  3A01 B;  4LLL A;  2EBI A;  4XLA A;  2ZXW H;  1IG7 A;  1BL0 A;  1GVJ A;  2JA8 J;  1R5H A;  3OR1 C;  1WRJ A;  4FT8 A;  1VQP I;  4B09 A;  2W84 A;  3E5X A;  4ANJ A;  2FQ4 A;  4HDV A;  1S9H A;  4AIH A;  5LFA A;  3J7A O;  4U87 A;  3DBL B;  3FMR A;  4V19 K;  3J7A Y;  4HLY A;  1GXP A;  3H5N A;  4UVB A;  1F4K A;  2DMN A;  1XB4 A;  2R5Y A;  4XRS G;  1F9N A;  1TBX A;  1UFM A;  3EUK L;  2IBD A;  2OZ6 A;  3WTV C;  2PEX A;  1W7P B;  1FBU A;  3CMM A;  3KEY A;  1KZH A;  3SZT A;  1WH5 A;  1LPQ A;  4Y15 A;  4BXF A;  1AKH B;  1MBG A;  2DK8 A;  2VPR A;  2Y31 A;  2DA7 A;  2XVC A;  3HB9 A;  3PSF A;  4Q4Z F;  3ZMU A;  1LFB A;  2O61 A;  1OCR H;  2RQQ A;  1SFE A;  1OFC X;  3CDH A;  5F1J A;  3LFK A;  4HDU A;  1EKE A;  3TGN A;  2BY3 A;  3JCU C;  1WQ2 A;  3TED A;  4A5M A;  2KJC A;  2M8E A;  4I09 A;  1STZ A;  1G2H A;  1LDD A;  1B8I B;  1NHA A;  2F5F A;  2W82 A;  4EJO A;  3ZMD A;  2OBP A;  3BZ6 A;  3V42 A;  2RNJ A;  4RBO A;  4IRH A;  1MBH A;  3IUO A;  4ZYD A;  3K9T A;  5E1Z B;  4B43 A;  2L9N A;  4E7H A;  1HW1 A;  2NRA C;  5A2Q K;  2HTJ A;  3AG3 H;  5ICF A;  4MFE A;  3HOY J;  1O3Q A;  1NG7 A;  3CF5 F;  2EPF A;  2QF7 A;  3IH2 A;  3BTI A;  2CJJ A;  1T2K A;  2O5R A;  4IHS A;  1ZRE A;  2DFI A;  4J19 A;  3Q9V A;  4M6Y A;  3VWB A;  2OU2 A;  2XF7 A;  3DLA A;  2EH3 A;  2OQR A;  5CQG A;  1BR2 A;  1IJW C;  3RKQ A;  1HW5 A;  1F43 A;  2DLL A;  5ILU A;  2WV1 A;  3GZN B;  1G8X A;  3FMS A;  5JFR A;  3NRV A;  1T33 A;  1YJ9 I;  4PSW A;  5IP6 A;  2J5P A;  4XL9 A;  2OQG A;  3KFW X;  2MH9 A;  1U5T B;  4AVZ A;  4Y3O A;  2VBZ A;  3AL0 B;  3CLO A;  4Q5S F;  1HDD C;  2BEO A;  3AKZ A;  2E71 A;  1ETK A;  4RGR A;  4FIS A;  4B1R A;  3QWL A;  2H8R A;  2OC6 A;  4P9F A;  3K1P A;  3JRC A;  5J8F A;  1FSH A;  1R1T A;  3BR3 A;  3QOE A;  2DT5 A;  3F3X A;  2K40 A;  2FRH A;  2TCT A;  3SEZ A;  4XBF A;  2KIS A;  2V1D A;  2XSJ C;  2Q8K A;  3DPU A;  2R7V A;  1UG2 A;  1RRJ A;  5JR3 A;  3MAJ A;  1FP2 A;  2KRC A;  2XPW A;  3H5A A;  5K7Z A;  4HQM A;  1DQU A;  5FRM A;  2A6T A;  1U0J A;  2CW8 A;  2QM3 A;  2M3A A;  2UUZ A;  1U78 A;  2I10 A;  3K4K A;  4II3 A;  2B63 J;  4I01 A;  3KEO A;  2NOG A;  4IVN A;  2JA5 J;  5FKO A;  1GVD A;  4N0B A;  4PCQ A;  4DYC A;  1R5G A;  2Q2E B;  1BBY A;  3W2W A;  1XN7 A;  1SMY F;  4BS9 A;  5IPA A;  3OMY A;  2BHY A;  4YFN F;  4O5V A;  2UXN A;  3L2Q A;  1EH8 A;  1MIJ A;  4XLH A;  1VQ4 I;  3M9A A;  2RNG A;  3M8F A;  3S17 J;  2GXG A;  3FBI B;  5B66 C;  5CLS A;  1TW2 A;  1ITY A;  4OIP F;  3F8B A;  1DPR A;  5B1A H;  2COM A;  5EEA A;  3Q5F A;  3HSF A;  2GA1 A;  4BEH A;  4S05 A;  1VQL I;  2DAO A;  5E3N A;  3H9J A;  3K1N A;  5FLX Z;  3BY6 A;  2X6O A;  4U0W A;  1A35 A;  3RZO J;  2IS4 A;  3LSI A;  4BY1 J;  3A03 A;  2VLA A;  2YSR A;  2COB A;  4MQ9 F;  3ABL H;  2QEX I;  2AHQ A;  4HQE A;  4AD9 A;  1PJR A;  1S7O A;  2RAE A;  3VOD A;  3FF5 A;  1WJB A;  5IY5 H;  4D9J A;  2BXY A;  2FEZ A;  5E8I A;  4D5F A;  3FXK A;  1RNL A;  2VC0 A;  3HGY A;  1Y0N A;  1V54 H;  5LD2 C;  1VQ5 I;  1WPK A;  4ZJZ A;  2F5V A;  2IPQ X;  3MCZ A;  4ZZD A;  3HL2 A;  1PVE A;  2JPC A;  2DN0 A;  3M8E A;  5J1Y A;  1ZKG A;  1BW5 A;  2FBI A;  2LMD A;  4G12 A;  2DO7 A;  4PUS A;  5CJ9 A;  4QIW N;  2L9S A;  1LFU P;  2VOD A;  1FTZ A;  4CHU A;  4PZJ A;  3CC7 I;  2CGP A;  1RES A;  3U9G A;  2ADU A;  3IL2 A;  5FKL A;  2BE5 F;  4WXD A;  2EZK A;  4RMN A;  3T8T A;  2VPL A;  4P96 A;  1MSE C;  4DYR A;  3EUH C;  2HDC A;  3G1O A;  3LOC A;  2NS0 A;  5LRR A;  4MTD A;  5IT3 A;  3K4M A;  1ZRC A;  4II2 A;  5EJC A;  1XSD A;  3OS2 A;  1VQO I;  5AIP A;  1BI0 A;  3VYS B;  2IS6 A;  2LLK A;  2JRM A;  3WTW C;  4ENJ A;  5KCM A;  3L2R A;  1ZR4 A;  2LY1 A;  2NYX A;  2EZI A;  3R6S A;  4MNU A;  3K2Z A;  2BW3 A;  3GXO A;  4IRG A;  3T8R A;  4CYC A;  4BJT A;  1VND A;  4DJA A;  4ASN A;  5F08 A;  2HU9 A;  2O8K A;  2QLZ A;  1YOV B;  2EV5 A;  2LK2 A;  1IAW A;  1AWC A;  1F1Z A;  2H1L A;  1LNW A;  2ESH A;  2RDP A;  4M3D A;  3UKG A;  2E34 A;  1PUF A;  2E36 A;  1JJ6 C;  5EGO B;  2NVT J;  4LG0 A;  1SFX A;  4I7H A;  1IXS B;  2W7N A;  1W5S A;  4NNJ A;  4HBL A;  3A02 A;  2HQ5 A;  3ZMV A;  4DYQ A;  4EJT A;  3E5Q A;  2F2E A;  1ZTR A;  4A3L J;  5J3L A;  1VF9 A;  5BPD A;  1U3E M;  1S5L C;  1CF7 A;  5CVJ A;  3DTE A;  4ZC3 A;  2STW A;  2VBY A;  3JAM Z;  4B48 A;  3GZ5 A;  3FHN A;  3QOD A;  4LD5 A;  3BG7 A;  3KLO A;  1KQ8 A;  2FUG 2;  2O7O A;  2R7F A;  1VQ8 I;  1V5E A;  3CCS I;  2MBF A;  4RGX A;  4HW0 A;  3FK6 A;  4XIC A;  1QQI A;  2IJL A;  2KPM A;  3RCO A;  1I1G A;  5CPR B;  4AUX A;  2R3S A;  3DEU A;  1UAA A;  3A2K A;  2KMU A;  3IH3 A;  3BT9 A;  3HTU A;  2QSG X;  3GCM A;  4JOM A;  4BAC A;  2DTZ A;  4HPQ A;  5JHF A;  4OIO F;  3E6B A;  2ZME C;  3PNY A;  4XM3 A;  3F8M A;  1IGN A;  1X1B A;  3RYP A;  2GA2 A;  1WI9 A;  4HZF A;  1HF0 A;  3WE2 A;  3MWM A;  1K61 A;  2JN6 A;  1E3O C;  4CYD A;  3MZ8 A;  1EJ9 A;  2P8T A;  3HIF A;  3ZQQ A;  2IGM A;  1ETV A;  4B47 A;  4P5O A;  1IZ1 A;  1Q1H A;  2NNY A;  1YO5 C;  2LSO A;  3ISP A;  1I1S A;  4M3E A;  3MKZ A;  1Z77 A;  2XF5 A;  3I4P A;  5E3L A;  4G7O F;  1HCR A;  3OYC A;  1K79 A;  1E3P A;  3G1M A;  2Z99 A;  2FML A;  1W7P D;  4IPA A;  2HS5 A;  1I3Q J;  3BPX A;  4I0A A;  3OL3 A;  2PJR B;  2BYV E;  3LA3 A;  3CO6 C;  4HV5 A;  1G3Y A;  1V55 H;  1JHH A;  4FHT A;  3KP2 A;  3QU3 A;  2A61 A;  1YJN I;  4UNO A;  4BQA A;  2VN2 A;  1MH3 A;  2QEN A;  3SXY A;  2NXN B;  3DPT A;  2L54 A;  2KIQ A;  5IP9 J;  2W25 A;  3PIP F;  3LST A;  3GX4 X;  1LKX A;  3SFZ A;  3ZMT A;  1BR4 A;  1BIA A;  2Z2S B;  1BOB A;  4R1H A;  3LNQ A;  1I27 A;  3WU1 B;  2HQA A;  1YLF A;  5HLH A;  3TO7 A;  3ZQG A;  4YFK F;  2HQN A;  4KNY A;  4I2O A;  1TWH J;  2LG4 A;  2KQR A;  3ZN1 A;  1DUX C;  4NB5 A;  4M72 A;  1FNN A;  5DD8 A;  3HUG B;  1WWX A;  4OIQ F;  1YW9 A;  2M1B A;  5KHD A;  1FZP B;  4FAS D;  2IXS A;  4AC0 A;  4U0Y A;  1FOK A;  2KIU A;  2VE8 A;  3HBL A;  5JVG F;  5DCF A;  1X1P A;  2EFN A;  2E2H J;  2L7M P;  3MEX A;  3GYH X;  2GXB A;  1D8K A;  1TWA J;  2HGC A;  3CES A;  1RPW A;  3OIP A;  4E7I A;  5DYM A;  4PFO A;  3X2Q H;  3J7Y J;  1FMV A;  2L7Z A;  1B1B A;  5D5V B;  4ZTJ A;  4A3B J;  2JUG A;  1OYY A;  3MFK A;  1MJ9 A;  2H09 A;  3U2R A;  3PJR A;  2FMY A;  3SZP A;  4YFX F;  2XSD C;  3PNT A;  3V7S A;  5GTI C;  1P4A A;  2VL8 A;  4PSX A;  1WJC A;  3DKX A;  2CQN A;  3F23 A;  3K70 C;  2R7Q A;  2VJI A;  1VQK I;  2ZJR F;  3S2H J;  1YX3 A;  3FXL A;  1KGS A;  1FT9 A;  4YG2 F;  1O4X A;  3FXM A;  4BYY A;  2BV6 A;  4B3X A;  1ZAR A;  4IRI A;  1WJF A;  4RAG A;  1I50 J;  2LNB A;  2R4G A;  1TWF J;  1G59 A;  1MJB A;  2ISY A;  4N9H A;  4UUS A;  3LSR A;  3DEW A;  1B9N A;  4KT5 C;  3BZK A;  4DOZ A;  2NS8 A;  2EQR A;  5CVU A;  2AS5 F;  3LSJ A;  5GTH C;  4A69 C;  3FIS A;  5LEK A;  2R7X A;  2JPB A;  5DUK A;  3GTL J;  2HKO A;  3Q0U A;  2KIF A;  1UG0 A;  4UV8 A;  2YX4 A;  3I3L A;  1TZL A;  1EA3 A;  1D0Z A;  1UZC A;  3D5S C;  2ICW G;  3M7G A;  4LB6 B;  4D7N A;  1SFK A;  1Y6I A;  3P9K A;  3S3M A;  2JA6 J;  3HG9 A;  5TIS C;  4B8X A;  4PJL A;  3KX2 A;  5ERI A;  3OYM A;  1DP7 P;  4ZDL A;  4IOC F;  1BI1 A;  2QA4 I;  4E7K A;  3F72 A;  2CV2 A;  1R5I D;  1E0E A;  1FOY A;  2EFP A;  6PAX A;  1QZE A;  1XMK A;  4M3B A;  2XGC A;  1YE9 A;  1J5Y A;  1Z7U A;  1ODD A;  2A3S A;  3L09 A;  3WGG A;  2HOA A;  4NC6 A;  4XKB A;  3RTR A;  1R71 A;  1IRZ A;  5J8C A;  5HDN A;  1Z6T A;  1E17 A;  3RDI A;  5LHI A;  2CUZ A;  2PQ8 A;  2XRL A;  5IOY A;  3IV5 A;  5CYV A;  1UCR A;  3SFI A;  2V79 A;  3JRB A;  2WTE A;  3VFZ A;  3SYT A;  3RKY A;  4ZYE A;  1BR1 A;  4FE4 A;  4EEF G;  4ZDP A;  2VC1 A;  4A3D J;  3JAM K;  4XKW A;  2M30 A;  2R7U A;  5ILV A;  2I8D A;  2IEK A;  1TNT A;  2FF4 A;  1TL8 A;  3P7N A;  2V9P A;  3M8J A;  3T5X A;  2E2J J;  5HNF A;  3CCM I;  2DPD A;  2JMW A;  1LDJ A;  4EAT A;  4XSX F;  2IA1 A;  1IXC A;  4A0Y A;  2KFD A;  3GTJ J;  2A69 F;  3ZXS A;  1WJD A;  5DS9 A;  2LY9 A;  2CSO A;  4BE2 A;  1FYL A;  1YG2 A;  1MBF A;  4JX6 A;  1TQP A;  2FOW A;  1K4T A;  4CXF A;  1IC8 A;  1U6G A;  3QAH A;  4NDL A;  2X0L A;  4XRM A;  3OYJ A;  2FE3 A;  1YTY A;  5HLG A;  2DA5 A;  3I5U A;  4L5I A;  4IO9 F;  2K9N A;  3BQY A;  2K85 A;  3CC2 I;  1FC3 A;  4GYI A;  4FE7 A;  3CO7 C;  3DCF A;  2EA2 A;  3ZOB A;  2XPV A;  4CGZ A;  3L2C A;  2O6G E;  1O7L A;  1PP7 U;  1VQ9 I;  4AYB A;  3KZZ A;  3E7L A;  4BU2 A;  2WAD A;  2D1V A;  5ILS A;  4F92 B;  1YHQ I;  1PUF B;  1W7P A;  3I58 A;  2PMZ N;  2VE9 A;  4IJA A;  4HST A;  1SFU A;  2VBX A;  1X19 A;  4W1U A;  1F36 A;  5JVT A;  1MMS A;  4CSW A;  4RB0 A;  1J2X A;  2KZG A;  2DFH A;  3IKT A;  2DA3 A;  4AIK A;  3HOZ J;  2YUS A;  1X2M A;  1TNS A;  5CVR A;  1RET A;  3LFU A;  4BDY A;  4XON A;  4BJ5 C;  4C2T A;  4BXX J;  3LSG A;  1ZLJ A;  3I9V 2;  3N4M A;  1WI3 A;  3DTI A;  4KUM A;  4XLN F;  5EZG A;  1UJ8 A;  1I6X A;  2LRE A;  4I76 A;  2PMZ A;  4JX4 A;  4BEH B;  3FXR A;  4WX9 A;  2FNP A;  3H1C A;  2MD5 A;  4S04 A;  1Q1V A;  3C1D A;  5DM7 F;  1D5Y A;  1GLN A;  4AWX B;  4D0P A;  3CZ6 A;  3VEP A;  5HVQ C;  2ACJ A;  4BXU A;  4RGS A;  2V7F A;  3TP0 A;  5DUI A;  3BLY A;  1U8R A;  4XQF A;  5CVI A;  2DTR A;  5F6F A;  4NC7 A;  5IYC J;  1JTX A;  4CCK A;  1AHD P;  4Z6Y A;  4OOI A;  1R22 A;  3LMM A;  2EWN A;  1VFC A;  9ANT A;  2JT1 A;  5FB2 A;  1XGS A;  2FBH A;  2EV6 A;  1A04 A;  3R0A A;  4MTE A;  4HX4 A;  1NTC A;  1FPQ A;  3OYI A;  1U9O A;  3AG4 H;  1MH4 A;  4LMY A;  3J81 K;  3HOW J;  1T95 A;  4OMY A;  2OF7 A;  3J81 Z;  4XKC A;  2V6E A;  4I6Z A;  4Y33 A;  4JX5 A;  2AQE A;  3E5U A;  3CDL A;  1IN6 A;  3DFG A;  4UVA A;  2ZSH B;  3ERM A;  4HX7 A;  2HWV A;  2FX0 A;  4Q48 A;  4EGZ A;  4CDG A;  1YW7 A;  2KRF A;  1G3S A;  1P7J A;  2KHM A;  2VJ4 A;  2EZL A;  2Y48 A;  2KKO A;  4G6T B;  4XN0 A;  2A5Y B;  4U7D A;  3B6C A;  3OOU A;  3K2A A;  1ON2 A;  3L9F A;  5BMZ A;  3I0T A;  1FSE A;  3F6V A;  3BJ6 A;  2QZ8 A;  3GFL A;  4A3G J;  4EV0 A;  1XDS A;  1UHM A;  4BHP A;  4CCN A;  4HYE A;  4YRV A;  3GTQ J;  3SDG A;  3S1Q J;  3MQ0 A;  3CUQ B;  4YIF A;  1GV5 A;  2IGO A;  4HX8 A;  2K9L A;  4BNC A;  4LIV A;  2OPT A;  2WY7 Q;  1VQ7 I;  2D45 A;  1A5J A;  3OOP A;  3O8G A;  1D0X A;  2QKM B;  2P81 A;  3H35 A;  2VJJ A;  4G7Z F;  2IGK A;  3WHC A;  2JVH A;  4IHV A;  5HOD A;  2R93 J;  1IXR C;  1O3S A;  1KU2 A;  1HOM A;  1H0M A;  3HYI A;  2O8X A;  2R5Z A;  1ZEL A;  3K70 D;  2V6C A;  2OTL I;  1WJA A;  2K3P A;  1JXS A;  2HI3 A;  3S2W A;  1FTT A;  3EUA A;  3HKZ N;  3S16 J;  2JA2 A;  2LBF B;  2KLO A;  2BOL A;  3CME I;  3BCB A;  2L7K A;  3PM1 A;  1FLI A;  2OJE D;  1RC9 A;  2DCE A;  1MND A;  2YU3 A;  3JW4 A;  1R4M B;  1TQM A;  2FQ3 A;  2W1O A;  1GV2 A;  5D5W B;  3F21 A;  1MDM A;  5GAG J;  1FYM A;  1KA8 A;  3T0Y A;  1BJZ A;  4XR6 A;  3A1Y A;  1R23 A;  4HSR A;  1YQA A;  1RI7 A;  2WBM A;  4LJZ F;  1AU7 A;  5IT9 Z;  1Z3X A;  4KMF A;  1YW8 A;  2BHZ A;  2K9M A;  3FZV A;  5HDK A;  4HF1 A;  3JSO A;  3WTU C;  2MC3 A;  2M7A A;  3L7W A;  1XGM A;  3C18 A;  3H3Z A;  3V7R A;  1OQY A;  1DU0 A;  1NG6 A;  5H20 A;  2DQL A;  1SD6 A;  2A6H F;  4KIT B;  1CF7 B;  4B44 A;  3I4N J;  3CC4 I;  1U9N A;  3TDU C;  3GVA A;  2XV4 S;  1VTN C;  4A0X A;  2PX9 A;  2F4O B;  2ZXJ A;  5EZH A;  2CUJ A;  3SZG A;  3B73 A;  5A2Q Z;  2ELJ A;  1LUJ B;  4N4O B;  1BJA A;  5LHG A;  1QPI A;  3NWS A;  4IZZ A;  3PUB A;  1QVT A;  2E2I J;  2L4A A;  1ZN2 A;  2A5W A;  4CUG A;  2E19 A;  5D5U B;  1IRX A;  5HS9 A;  4G7H F;  1T8I A;  1SD5 A;  1S6L A;  2HXO A;  1ONV A;  2M45 A;  3IRQ A;  3M1C A;  1XG1 A;  3LA7 A;  1HKQ A;  4ESB A;  1QPM A;  5FO5 A;  2MH2 A;  3VPR A;  4M71 A;  5J47 A;  5F04 A;  2Y9Y A;  3HKZ A;  1H88 C;  2JVG A;  2P5L C;  2R0Q C;  4OWR B;  4ZYG A;  2Y30 A;  2Y75 A;  3OYL A;  2K5C A;  3HC7 A;  4MHG A;  3IRR A;  1B72 B;  1CQT A;  3TOB A;  3H5R A;  1WSU A;  1GUU A;  4MEY F;  2DA2 A;  5EEH A;  2VOO A;  3HUG A;  4L0Y B;  4DZJ A;  1WJE A;  1MBE A;  3PO2 J;  4GXO A;  1X3Z B;  1HKT A;  1BOA A;  2VT2 A;  3O8H A;  3ZQF A;  2Z33 A;  1FJL A;  2VB6 A;  2A6E F;  3IKV A;  3A0H C;  3E6M A;  5ICE A;  5D8L B;  4NUB A;  5LGN A;  3CCL I;  1JGS A;  1LVK A;  3KIO A;  1ORK A;  3TOA A;  2J5O A;  2LDU A;  5AON A;  3ZQ7 A;  4MGR A;  3LAP A;  3WTX C;  3GW2 A;  3KP3 A;  1QGP A;  3HRU A;  2LR8 A;  2OCE A;  3C2B A;  3AFH A;  2CQQ A;  4RDU A;  4KN4 X;  1QBJ A;  2R7O A;  4HNU A;  4BBS J;  3I55 I;  2ZXH A;  4P1W A;  2O0Y A;  2Y69 H;  1PYV A;  4V2G A;  3MKW B;  3JTG A;  2NVX J;  3DV8 A;  1A31 A;  4RAY A;  4RM3 A;  2ECB A;  1J9I A;  1R9T J;  1R00 A;  2P6S A;  2M8G X;  3MVP A;  1W0T A;  3DU5 A;  3FBN B;  4PJM A;  2RRE A;  1FYK A;  1JT6 A;  1W5T A;  2BBY A;  3FXU A;  4XLF A;  3GTO J;  2DBB A;  4E7J A;  2DOE A;  3CCV I;  2E1M B;  1T38 A;  1U8B A;  1EH7 A;  1UST A;  1X58 A;  3TKY A;  5GAH J;  2HPM A;  2OCC H;  4QPQ A;  2GOX B;  4LFU A;  1QHH D;  1E3H A;  4S0H B;  3BTJ A;  3OR2 C;  4U88 A;  2CFO A;  1I39 A;  2DOF A;  2G7H A;  1HKS A;  4L5J A;  1TWG J;  4QLC U;  5LRS A;  3ZQC A;  2WY8 Q;  4Y4R A;  4PGH A;  2W48 A;  3TO9 A;  2JUC A;  1Z3Y A;  3B02 A;  1SAX A;  3FX3 A;  2HR3 A;  1QVU A;  1HDP A;  2L4M A;  1BM9 A;  2DA1 A;  3KLN A;  2X51 A;  3CD6 I;  4UXN A;  1T08 B;  1H9G A;  5K7H A;  3ONQ A;  3FM3 A;  2GIV A;  2LY2 A;  2V1N A;  3IHU A;  2P6T A;  3L2W A;  2IGN A;  4X0G A;  1W5C C;  3IAM 2;  3WOD F;  2KL4 A;  3BDD A;  1KU9 A;  2TDX A;  2YPR A;  2D5V A;  2DPU A;  3CUQ C;  2FJ1 A;  4BQQ A;  3CCJ I;  1FOX A;  2XAJ A;  3VSL A;  1KU3 A;  3GF2 A;  4C2M J;  1Z1D A;  2DJI A;  2PN6 A;  4F91 B;  5F0H A;  2XUB A;  1Y1V J;  1Z0X A;  3DTK A;  3N05 A;  2FBK A;  1TLH B;  4DW6 A;  3HPH A;  1OCT C;  3NAU A;  4A0Z A;  4UY8 I;  1V5F A;  1IV8 A;  4YEL A;  2GBY A;  3HPG A;  3ZRG A;  2K4B A;  2MLK A;  3TO6 A;  4EMS A;  1KON A;  1GHC A;  3OL4 A;  2EIJ H;  2X48 A;  3U21 A;  4IHT A;  1Y56 A;  3RIR A;  3GO5 A;  4DBQ A;  1JJ8 C;  5FFX A;  1SVL A;  1FX7 A;  3H3U A;  1Z91 A;  4DQ2 A;  3WTS C;  1T6S A;  2GWR A;  2H1K A;  4IOA F;  1T0F C;  3LSP A;  2DMP A;  2EIK H;  2IVM A;  1KYZ A;  2FU4 A;  4KIG A;  3VYU B;  1Y8Q B;  1PUE E;  4KFC A;  2H94 A;  2VI6 A;  2V9K A;  4JQF A;  1W4M A;  2DI3 A;  3BCA A;  1UEL B;  2VQH A;  2P7C B;  4G6D A;  1OLT A;  2WAF A;  4ABZ A;  4C3H J;  2Y0S N;  1JKR C;  3EDP A;  2DA6 A;  3TP3 A;  1P7I A;  4QPO A;  1FBS A;  4ZYH A;  3FIW A;  1IW7 F;  4CYC B;  5HNH A;  3JTH A;  3CLQ A;  3C2G A;  1DDN A;  2FSW A;  5B1B H;  4F7Z A;  4M73 A;  3HOS A;  1D1C A;  4OAZ A;  1ZG1 A;  2ZKZ A;  5F27 A;  3GFJ A;  2R5Z B;  4C3I J;  1SAU A;  4A3J J;  4KIC A;  5L3G A;  3KPH A;  3KP4 A;  5H2F C;  1QZY A;  2AQF A;  2ZFU A;  1QU3 A;  5L3B A;  1OR7 C;  3MZH A;  4MEX F;  5L3C A;  3FK7 A;  1ETX A;  2BY1 A;  4Y17 A;  2DJN A;  3GLX A;  4JYK A;  1YIJ I;  4P9U A;  1FMW A;  3GTM J;  2CV1 A;  4B4C A;  3C7J A;  2XHK A;  4RM2 A;  2X6X A;  5LLQ A;  1O3T A;  3VYT B;  2CU7 A;  4XLC A;  3OYB A;  3BR6 A;  2QVO A;  1LQ1 A;  3GWZ A;  4HNT A;  5EF6 A;  2HVQ A;  3QP6 A;  4I99 C;  1WCM J;  2HOE A;  4BQO A;  4PJN A;  2DYS H;  4IX7 A;  4W97 A;  2D1H A;  1QZZ A;  3FMQ A;  5FFZ A;  4WWC A;  3QOP A;  1JGG A;  1E2X A;  2GZW A;  5FKK A;  3JRG A;  1WHU A;  4ESF A;  2DDB A;  1B59 A;  1S7A A;  3BTL A;  3VYR B;  4QWQ A;  2LH9 A;  4EM0 B;  3SDB A;  3H3V K;  2ZB9 A;  1I3A A;  4WXC A;  2L2O A;  2Q1Z B;  3L00 A;  1ZR2 A;  3J7Z I;  3MKY B;  4EM1 A;  3FDY A;  2VKE A;  2PFB A;  5TGT A;  2RV8 A;  5HLI A;  2MGQ A;  3V8J A;  5FLM J;  4C30 A;  2MAB A;  1ETQ A;  2ECC A;  2QBY B;  3JRE A;  4D5C A;  2DQR A;  3EET A;  1IN4 A;  3EYI A;  1B72 A;  2L7F P;  4KMU X;  2QSH X;  5KNL A;  3GFM A;  4RAF A;  2XDV A;  2MG4 A;  3OYN A;  2DW4 A;  3OS1 A;  1D1B A;  2EK5 A;  2ETH A;  2QGU A;  3ESW B;  5BPI A;  3ZMS A;  3CMA I;  3O3K A;  5GP9 A;  3UNG C;  4GDF A;  3RKW A;  1I6H J;  4YIR X;  3OY9 A;  3OV8 A;  4LB5 A;  1A6I A;  4A93 J;  3DBR B;  1X2N A;  4RB1 A;  3G73 A;  2M4K A;  3CCU I;  1L0O C;  2BVM A;  3KP6 A;  1GXQ A;  1JKP C;  3QYB A;  1RIO H;  5IP7 J;  4ESJ A;  3I59 B;  1UHS A;  3ECH A;  2VKV A;  2R7T A;  2XKP A;  2ZME A;  3GBG A;  4KIS A;  5HS8 A;  3WHB A;  2LF8 A;  3GTP J;  4A6D A;  3O2P E;  2QQ8 A;  1R49 A;  3I71 A;  1P92 A;  5DM6 F;  3QQA A;  1XMX A;  4RGU A;  4BE1 A;  4IQJ A;  4KIB A;  4DGW B;  4HNV A;  4YII A;  3WTZ A;  4UHT A;  4ON0 A;  2F6C A;  5LGU A;  2VJ5 A;  3ZQL A;  1F5T A;  2QQ9 A;  2RN7 A;  3GEZ A;  1BC8 C;  1IUY A;  5D6E A;  3TL4 X;  5BS6 A;  4RLQ A;  4HEA 2;  3FM5 A;  4PJJ A;  5FRO A;  2OTJ I;  2IA0 A;  2VKD A;  3DLL F;  4KA4 A;  5GPC A;  5GPA A;  4IHW A;  1BA5 A;  4LGW A;  2EFW A;  3UR3 C;  2DU9 A;  4G9Y A;  3H92 A;  4GGG A;  1S72 I;  3PO3 J;  4XKV A;  1MW7 A;  5J4Y A;  1ZGW A;  2LRD A;  1O7F A;  2DFF A;  1LEB A;  4Q47 A;  5J4V A;  2IW5 A;  1W36 D;  5E8G A;  2KJB A;  3PL8 A;  2LKS A;  3LQR A;  3S15 J;  1UMQ A;  2HOT A;  1ETY A;  3Q9S A;  2H8W A;  3JRF A;  5HS7 A;  3HXL A;  2JZY A;  3KP5 A;  3ZR8 X;  1R58 A;  2DDA A;  1P4X A;  3CCQ I;  2VOP A;  2ZBK A;  1MMG A;  3CUO A;  1ERD A;  2XAS A;  1QNT A;  1V4R A;  1T56 A;  2XAU A;  3EPZ A;  3BR5 A;  2L3D A;  4EJU A;  3DEE A;  1OCZ H;  5K1Y A;  2ZCW A;  2JTV A;  4CH7 A;  4ZTF A;  5LGT A;  3SJM A;  4F3Q A;  2M34 A;  4XOR A;  5M5W J;  1DPU A;  4A6E A;  3RKX A;  2VT3 A;  1VZ0 A;  1XCB A;  1ON1 A;  3HJE A;  2EIN H;  3COA C;  1APL C;  4I98 B;  1R1V A;  5E79 C;  1JUP A;  5FKM A;  1A6Q A;  2Z5U A;  3K1M A;  1RKW A;  5E3M A;  3S32 A;  4XNF A;  3PSI A;  2Y9Z A;  5FJ8 J;  3RPU A;  2XB5 A;  3VB2 A;  1T0F A;  1RUN A;  2LYC A;  3H36 A;  3HRT A;  1YJW I;  2DT7 B;  1HA8 A;  2F4I A;  1I5Z A;  3AG1 H;  1B4A A;  2W85 A;  2GQQ A;  4A5N A;  2X4H A;  4GCV A;  2TRT A;  3FXQ A;  4ENM A;  4A3I J;  2K4J A;  5B5E C;  1K6O A;  3G4S I;  4A3E J;  1ACI A;  2RGV A;  3ULQ B;  2F4M B;  5KAI C;  2MA3 A;  3K4L A;  2HVS A;  2LKP A;  3G3Z A;  4G94 A;  2WAQ A;  2ZSI B;  3E0J B;  5D8K B;  2ZJ2 A;  1Y8R B;  4HF2 A;  3LSM A;  3P9I A;  1K7A A;  1Z21 A;  2QUF A;  2DOA A;  2EIL H;  2MC4 A;  2VIX A;  5FKN A;  4E6K G;  3JRA A;  3QPT A;  2R7S A;  2A68 F;  5EDN A;  2BY0 A;  3CUQ A;  3H0G J;  2P4W A;  2X9D A;  1NK3 P;  1P2F A;  4BDZ A;  4XRF A;  3SQN A;  3K4C A;  1Y0U A;  2HNH A;  3E1S A;  3F6O A;  1R36 A;  3F9K A;  1P9Q C;  2A07 F;  3H9G A;  3P9C A;  1AOY A;  2K86 A;  5KK1 A;  2EFQ A;  4G6Q A;  5KVR A;  3W6J B;  5BOX A;  1OR7 A;  2W00 A;  1T39 A;  4QTR A;  2V1U A;  3GUD A;  1J7K A;  4LK1 F;  3HZJ A;  1BC7 C;  1ENH A;  4LIU A;  2HDW A;  2RKH A;  5M3M J;  3AG2 H;  4NBQ A;  2LD5 A;  1PP8 F;  2FOK A;  2YR2 A;  4IEJ A;  3HOT A;  4L0Z B;  4KJZ A;  4F93 B;  3I64 A;  4BE0 A;  3I4M J;  1H89 C;  1U5T A;  4AM3 A;  3W2V A;  2R92 J;  4EGY A;  3K6G A;  2XGE A;  2HFH A;  3KET A;  4OIR F;  3BR2 A;  4OIN F;  2KRH A;  2MSY A;  5M5Y J;  1IDZ A;  3WE3 A;  2DFE A;  4L9T A;  3ZQH A;  1B8I A;  3S3O A;  3JR9 A;  4IHY A;  1LJ9 A;  1RUO A;  3DBH B;  2VUM J;  2P5K A;  3DXJ F;  5E18 F;  2DMU A;  2LBF A;  2MW8 A;  2X1E A;  2NVQ J;  3BG6 A;  3E6C C;  1OPC A;  1S8N A;  2IP2 A;  1KQ0 A;  1R7J A;  2ZME B;  3BG9 A;  3HEF A;  1ZG5 A;  4M9Z A;  3CJT B;  4ZDO A;  2IRF G;  1YI2 I;  3S1N J;  2X6W A;  4BL0 B;  3AAF A;  1OCO H;  3BRO A;  5L3D A;  3W6K B;  2FXA A;  1WH7 A;  2N8G A;  1SC7 A;  1KYW A;  4C2U A;  1YS7 A;  2QQA A;  2ZJP F;  4BGD A;  2ME6 A;  4M3F A;  3TW6 A;  5D4R A;  4E4H A;  1JTY A;  2M0M A;  2LOO A;  4PFP A;  4C3J J;  2H27 A;  1VQN I;  1JUS A;  3DQV C;  4BY7 J;  2R7R A;  2VKH A;  4H0E A;  5TRD A;  3BR1 A;  3PFI A;  5E3O A;  2WA0 A;  2MLG A;  3CCR I;  2ID6 A;  3OIO A;  3W3C A;  1OJL A;  3WG9 A;  4CCJ A;  1W0U A;  1IN8 A;  1RZ4 A;  1OYW A;  3V4G A;  3GLL A;  4NC8 A;  4PGG A;  4XK4 A;  5J1U A;  1ZYR F;  4M9X A;  5JHU A;  2HYG D;  2V9V A;  4ENN A;  3PIO F;  1XSV A;  4LOC A;  3IC7 A;  1WJ5 A;  3GTG J;  1TQI A;  1UB9 A;  2GLO A;  2UXX A;  3IH4 A;  4XOT A;  3DP7 A;  4BKX A;  3RQI A;  2CH0 A;  5K7F A;  2Q0O A;  3LL7 A;  1ZH5 A;  4BH9 A;  3F8F A;  3TW7 A;  1BI2 A;  1V5G A;  2H6C A;  3FXJ A;  3WU0 A;  1MSF C;  2CFX A;  5F0F A;  2R7Z J;  3Q0W A;  2D2W A;  5EYR A;  2Q2E A;  4BQN A;  2ZJQ F;  1WZ2 A;  2QBY A;  5DV5 A;  1MMD A;  4C9Y A;  2ZNZ A;  1SD4 A;  3J80 K;  1POG A;  2KDZ A;  4FCY A;  5DCM A;  1YIO A;  2CW0 F;  1K78 B;  2E1O A;  2K27 A;  3HDD A;  2JJ7 A;  4WCG A;  1R6R A;  5F1R A;  2Y0M A;  5E17 F;  1N75 A;  2WB1 N;  2E1N A;  4IL6 C;  4NQW B;  2LFB A;  1XCV A;  3GTK J;  2EZH A;  3CJR B;  2H6B A;  1K78 A;  1YRN A;  1WKM A;  3L2U A;  5J1R A;  2WWY A;  3A01 A;  3HRM A;  3I53 A;  3L2V A;  2QCO A;  4WK8 F;  2XIG A;  1FIA A;  3NEU A;  4F55 A;  3VOE A;  2ELK A;  2IA2 A;  2NVY J;  2CQ7 A;  2KZV A;  5CKT A;  3LWF A;  4N4N B;  2RC4 A;  1JKO C;  3TQN A;  3FXO A;  4I0B A;  2P5V A;  4R8H A;  2VON A;  2XRO A;  2JSP A;  5E1X A;  5EG0 A;  3F22 A;  1JUM A;  2A05 A;  3KZI C;  2AXL A;  3BZC A;  2XGX A;  2YX7 A;  4Y7N J;  1XS9 A;  4EM2 A;  3A4C A;  3JRI A;  3S2D J;  4CZZ A;  1LFP A;  2JA7 J;  1A36 A;  2FD5 A;  2M4G A;  3CP2 A;  1ZK8 A;  3VSK A;  3CDI A;  3WGH A;  3IWZ A;  2WAQ N;  1O3R A;  2G0E A;  3RPQ A;  5C4X J;  3I56 I;  1X4O A;  5EEG A;  5EGO A;  3TDZ C;  4R79 A;  4OAY A;  1MZB A;  2Z1D A;  3DU6 A;  4OU0 A;  5CQE A;  4NHJ A;  2P7V B;  5HDG A;  3KEQ A;  4E7S A;  1T98 A;  1YIT I;  2V4J C;  1NH3 A;  4RB3 C;  1ZRF A;  3M4O J;  1MMN A;  3BG5 A;  3O6B B;  1B9M A;  5J6X A;  3PNV A;  3QU6 A;  1QO0 D;  2OZU A;  1D1A A;  3RPU D;  1HC8 A;  1D8J A;  2BVL A;  3E6D A;  4XSZ F;  1HST A;  4IHX A;  2M5W A;  4X1E A;  2DK5 A;  2PBI A;  4DIQ A;  3A0B C;  2R5Y B;  1MGT A;  3R4K A;  3ELK A;  3ZGK A;  5FD6 A;  2STT A;  4Y52 J;  2JRT A;  2PG4 A;  2Y2Z A;  2DT6 A;  3OYH A;  1ZHF A;  2CG4 A;  2NOJ B;  1TWC J;  2UZK A;  1TC3 C;  3WTT C;  2QYO A;  3ABM H;  3LSK A;  5IYB J;  2WAE A;  1D5V A;  1OIS A;  1SVO A;  5KAF C;  1EH6 A;  2ME0 A;  2E5N A;  2CV0 A;  2EV0 A;  3REO A;  3K69 A;  3OS0 A;  1EF4 A;  1KQ9 A;  4KDP A;  4AVP A;  3FKJ A;  4M6X A;  2QQB A;  4HAM A;  2Y0S A;  5L3E A;  1IUF A;  2KT0 A;  1G3W A;  3IP4 B;  1VQM I;  4D7M A;  3DPL C;  3IAS 2;  1H8A C;  4JP0 A;  3MN2 A;  4U0V A;  4BHB A;  1OKR A;  3S14 J;  3MKL A;  2P0W A;  3G1L A;  3AL0 C;  1YYV A;  3LSH A;  4HOB A;  1Z9C A;  1TTY A;  4ZZL A;  2XGD A;  4EQQ A;  1G3T A;  3S93 A;  2V26 A;  3K4J A;  3RSN A;  5LHH A;  4CCL A;  4E7Z A;  3OYG A;  5JLW A;  2C6Y A;  1C0W A;  2M0C A;  3BG3 A;  1K4S A;  3LA2 A;  3KYC B;  3W2A A;  3F0C A;  4FET A;  2LTP A;  5DDG A;  1N78 A;  3HHG A;  2W4S A;  4LLG F;  2X6Y A;  3S1M J;  2VBW A;  3ZPL A;  1QHG A;  1O57 A;  4MFD A;  5M5X J;  2F5E A;  4UVC A;  3BWG A;  4CIC A;  1TP4 A;  4K2E A;  3OSF A;  1LE8 A;  1W36 C;  2LVS A;  1Z67 A;  4OMZ A;  4CCM A;  2DXI A;  2DOD A;  2ZO4 A;  3KYL A;  3K10 A;  3M07 A;  3RZD J;  5J40 A;  2LP0 A;  3QPS A;  2DMQ A;  2X1C A;  4HV6 A;  3HOX J;  1LE8 B;  1IF1 A;  3C2H A;  3HTS B;  3ZN0 A;  3NAR A;  4MQV A;  3DF8 A;  4A3M J;  3KYD B;  4XMY A;  4CA0 A;  3OYA A;  1J75 A;  5DCM B;  3LAJ A;  2LKX A;  1XGO A;  1Z05 A;  2HZT A;  1NK2 P;  4E7L A;  2HZD A;  1ZLK A;  3R60 A;  1BN5 A;  3B6A A;  2CRG A;  1FY7 A;  4D1Q A;  1MBK A;  3F8C A;  3HHH A;  3IWF A;  2K3F A;  2Z3Y A;  3BP8 A;  2EIM H;  3MZY A;  2YS9 A;  2HOS A;  3HOU J;  1ETO A;  3OIQ A;  3CMY A;  5IT9 K;  3EQL F;  4LIT A;  1SAN A;  3CTA A;  2L9R A;  3K0L A;  4YEJ A;  1U5T C;  5H6R A;  5GAD J;  1XD7 A;  5LBQ A;  3S1R J;  4JK1 X;  5LEJ A;  2OV7 A;  3GZ6 A;  2F48 A;  4HRI A;  2E5Z A;  2R7D A;  2W24 A;  5TJJ A;  3RQ4 A;  4AU7 A;  2LF7 A;  3ASO H;  2JWT A;  4CZC A;  3ROU A;  5DTD A;  2CQK A;  2XB0 X;  1XSX A;  4N9I A;  5IOZ A;  2E35 A;  3GME A;  5HLT A;  3K4N A;  3J80 Z;  2CWE A;  5JI6 A;  1S7E A;  2HYF A;  4XN3 A;  2RQP A;  4L9V A;  1OYI A;  3I54 A;  4HF0 A;  4JBA A;  4FQG A;  2NNN A;  3HRS A;  3G2B A;  3QYF A;  1JKQ C;  1N25 A;  1L3L A;  2CMP A;  3BJA A;  4KIF A;  3BC8 A;  4NQW A;  4RS8 A;  1JE8 A;  3H0D A;  4XID A;  2NS7 A;  3OYK A;  4M6V A;  2EA4 A;  1LB2 A;  4RA2 A;  3DKW A;  1M1E B;  3CJQ B;  2GOM A;  2FA5 A;  1CGP A;  2PMH A;  4U7B A;  2Z9O A;  1XGN A;  1J0R A;  3K7A J;  2DYR H;  2ID3 A;  1QRY A;  2G7U A;  2L9V A;  2HPI A;  5GAE J;  3K4B A;  4KYW A;  2E60 A;  4HA8 A; 
#chains in the Genus database with same CATH homology
 3ECO A;  4AIJ A;  3ABU A;  2OA4 A;  4E70 A;  3BJO A;  3I59 A;  4CO8 A;  3CJN A;  5K5O A;  2E7W A;  3PQJ A;  3ZMZ A;  1ZGJ A;  2EB7 A;  4DNC A;  2XAF A;  1JHF A;  2FNA A;  4IXA A;  1ULY A;  1MKM A;  5FLX K;  2PJP A;  4TV7 A;  4Z2Y A;  4ENK A;  2XRN A;  1ZGA A;  2GAU A;  1ZRD A;  4M9S A;  4A2U A;  2HKX A;  1G6N A;  3SHF A;  1IRF A;  2OD5 A;  5H6Q A;  1REP C;  4KN7 X;  2HQR A;  2L01 A;  2K7L A;  1KU7 A;  3WTY C;  3ABT A;  2M87 A;  1U2W A;  3R61 A;  4EJW A;  3M1E A;  3T1B A;  4LK0 F;  4WF2 A;  3QRF F;  3PQK A;  3ERE D;  4PDK A;  4EJV A;  1BI3 A;  1IN5 A;  2ESN A;  4BHC A;  2E7X A;  2VXZ A;  2NAZ A;  1ZAO A;  3RJP A;  2KIM A;  1LDK B;  4XLP F;  1S29 A;  3FHZ A;  1IRG A;  3KCC A;  4BAY A;  1Z6R A;  3QPH A;  1FP1 D;  2V1X A;  5DEQ A;  3HSR A;  2G9W A;  3QP5 A;  1R1U A;  1P6R A;  5K5Q A;  2XAQ A;  1FWZ A;  4RB2 C;  1J59 A;  3V7C A;  4WXH A;  5D5X B;  2ELH A;  1ZG3 A;  2EJR A;  1B6A A;  2O3F A;  2B0L A;  2E1C A;  3WGI A;  2CYY A;  5ICC A;  3KP7 A;  5FD5 A;  1HXD A;  1OMI A;  2W57 A;  1PDN C;  5AIQ A;  4P55 A;  4UV9 A;  2UWM A;  5E20 A;  3FWE A;  4FX0 A;  1SMT A;  3U1D A;  2L02 A;  2QWW A;  1LVA A;  4L9J A;  1SD7 A;  4LG0 B;  1HBX G;  2XAG A;  1S3J A;  1USS A;  2K02 A;  1MD0 A;  4IF4 A;  4ETS A;  4LLN A;  4HLX A;  1TW3 A;  4GYG A;  1X3U A;  4RAZ A;  4ZH4 F;  1YFH A;  2PLY A;  4O3M A;  2HEO A;  4EVI A;  5HOO A;  2OAZ A;  3N97 A;  3EYY A;  1HW2 A;  3RI4 A;  4A12 A;  5ED4 A;  3JSP A;  1HQC A;  5E1W A;  3HSE A;  3C3W A;  3BOQ A;  3GFI A;  3LQQ A;  2PI0 A;  1XMA A;  5FGM A;  3ZP5 A;  5F64 A;  4L18 B;  1V3F A;  1G4D A;  1XDU A;  2IT0 A;  5D4S A;  3ML6 A;  5L3F A;  2XKO A;  4FX4 A;  3D0S A;  2WV0 A;  1EV7 A;  1H9T A;  2RVC A;  2HTS A;  5ICG A;  1LEA A;  2CO5 A;  2F5C A;  4Y13 A;  1FBQ A;  4I02 A;  2ZNY A;  4L9N A;  2O03 A;  3E3V A;  2JSC A;  3V8L A;  1D3Y A;  3KZY A;  5CVV A;  4UUV A;  2F5D A;  5DD4 A;  3EUH A;  3E97 A;  3RYR A;  5BQT A;  1P4W A;  3KE2 A;  1MDM B;  4GO1 A;  3D5L A;  2ISZ A;  2WC2 A;  5D6F A;  3F8N A;  3NQO A;  2BGC A;  5K5R A;  3R0J A;  1IN7 A;  2PMU A;  1UHW A;  1MJA A;  2XAH A;  3V8K A;  2ZFW A;  1BIB A;  3BPV A;  2EFO A;  4M74 A;  4G8X A;  1HSJ A;  4O6J A;  1YS6 A;  4LLL A;  1GVJ A;  1R5H A;  1WRJ A;  4FT8 A;  4B09 A;  2W84 A;  3E5X A;  4HDV A;  3J7A O;  4AIH A;  3FMR A;  4HLY A;  1GXP A;  4UVB A;  1F4K A;  1XB4 A;  1F9N A;  1TBX A;  1UFM A;  2OZ6 A;  3WTV C;  2PEX A;  1W7P B;  1FBU A;  3SZT A;  4Y15 A;  2DK8 A;  2XVC A;  4Q4Z F;  3ZMU A;  2O61 A;  1SFE A;  3CDH A;  3LFK A;  4HDU A;  3TGN A;  1WQ2 A;  4A5M A;  2KJC A;  2M8E A;  4I09 A;  1STZ A;  1LDD A;  2F5F A;  1NHA A;  4EJO A;  3ZMD A;  2OBP A;  3BZ6 A;  2RNJ A;  4IRH A;  4ZYD A;  3K9T A;  5E1Z B;  1HW1 A;  2NRA C;  5A2Q K;  2HTJ A;  5ICF A;  1O3Q A;  1T2K A;  4IHS A;  1ZRE A;  2DFI A;  3Q9V A;  4M6Y A;  2OU2 A;  2OQR A;  1HW5 A;  2DLL A;  5ILU A;  3FMS A;  5JFR A;  3NRV A;  2J5P A;  2OQG A;  3KFW X;  2MH9 A;  1U5T B;  2VBZ A;  3CLO A;  4Q5S F;  2BEO A;  4RGR A;  4P9F A;  3K1P A;  5J8F A;  1FSH A;  1R1T A;  2DT5 A;  3F3X A;  2FRH A;  4XBF A;  2V1D A;  2Q8K A;  5JR3 A;  3MAJ A;  1FP2 A;  4HQM A;  2QM3 A;  1U78 A;  4I01 A;  3KEO A;  4IVN A;  4N0B A;  4PCQ A;  1R5G A;  1BBY A;  1XN7 A;  1SMY F;  4YFN F;  4O5V A;  2UXN A;  1EH8 A;  3M9A A;  3M8F A;  2GXG A;  5CLS A;  1TW2 A;  4OIP F;  3F8B A;  1DPR A;  2COM A;  3Q5F A;  4S05 A;  3HSF A;  2GA1 A;  2DAO A;  3K1N A;  5FLX Z;  3BY6 A;  4U0W A;  2YSR A;  4MQ9 F;  4HQE A;  4AD9 A;  1S7O A;  3VOD A;  3FF5 A;  2FEZ A;  5E8I A;  1RNL A;  2VC0 A;  2IPQ X;  3MCZ A;  4ZZD A;  2JPC A;  3M8E A;  2FBI A;  2DO7 A;  2VOD A;  5CJ9 A;  4CHU A;  4PZJ A;  2CGP A;  3U9G A;  2ADU A;  3IL2 A;  2BE5 F;  4WXD A;  3T8T A;  4P96 A;  2HDC A;  2NS0 A;  5LRR A;  4MTD A;  5IT3 A;  1ZRC A;  1XSD A;  5AIP A;  1BI0 A;  4ENJ A;  3WTW C;  2NYX A;  3R6S A;  4MNU A;  3K2Z A;  4IRG A;  3GXO A;  3T8R A;  4ASN A;  2QLZ A;  1IAW A;  2EV5 A;  1AWC A;  1F1Z A;  1LNW A;  2ESH A;  2RDP A;  4LG0 A;  1SFX A;  4I7H A;  1IXS B;  1W5S A;  4HBL A;  3ZMV A;  4EJT A;  3E5Q A;  2F2E A;  5BPD A;  1U3E M;  1CF7 A;  5CVJ A;  2STW A;  2VBY A;  3JAM Z;  3GZ5 A;  4LD5 A;  3KLO A;  1KQ8 A;  2R7F A;  2MBF A;  4RGX A;  4HW0 A;  1QQI A;  2IJL A;  1I1G A;  2R3S A;  3DEU A;  3HTU A;  4OIO F;  3E6B A;  3F8M A;  3RYP A;  2GA2 A;  1WI9 A;  4HZF A;  3WE2 A;  3MWM A;  4CYD A;  2P8T A;  3HIF A;  4P5O A;  1IZ1 A;  1Q1H A;  2NNY A;  1YO5 C;  2LSO A;  3ISP A;  1I1S A;  4G7O F;  3I4P A;  1K79 A;  2Z99 A;  2FML A;  1W7P D;  4IPA A;  2HS5 A;  3BPX A;  4I0A A;  2BYV E;  3LA3 A;  3CO6 C;  4HV5 A;  1G3Y A;  1JHH A;  4FHT A;  3KP2 A;  3QU3 A;  2A61 A;  4UNO A;  4BQA A;  2VN2 A;  2QEN A;  3SXY A;  3DPT A;  2L54 A;  2W25 A;  3LST A;  3GX4 X;  3SFZ A;  3ZMT A;  1BIA A;  4R1H A;  1I27 A;  3WU1 B;  5HLH A;  1YLF A;  3TO7 A;  4YFK F;  2HQN A;  4KNY A;  4I2O A;  3ZN1 A;  1DUX C;  4NB5 A;  4M72 A;  1FNN A;  5DD8 A;  1WWX A;  4OIQ F;  1YW9 A;  2M1B A;  1FZP B;  4U0Y A;  1FOK A;  2KIU A;  2VE8 A;  5DCF A;  2EFN A;  3MEX A;  3GYH X;  2GXB A;  1D8K A;  2HGC A;  5DYM A;  5D5V B;  1B1B A;  1OYY A;  3MFK A;  1MJ9 A;  2H09 A;  3U2R A;  2FMY A;  3SZP A;  4YFX F;  3V7S A;  1P4A A;  3F23 A;  1KGS A;  1FT9 A;  4YG2 F;  4BYY A;  2BV6 A;  1ZAR A;  4IRI A;  2LNB A;  1MJB A;  2ISY A;  4N9H A;  1B9N A;  4KT5 C;  5CVU A;  2AS5 F;  5LEK A;  2JPB A;  5DUK A;  2HKO A;  2KIF A;  4UV8 A;  2YX4 A;  3M7G A;  4LB6 B;  3P9K A;  4B8X A;  5ERI A;  1DP7 P;  1BI1 A;  3F72 A;  2EFP A;  6PAX A;  1XMK A;  1J5Y A;  1Z7U A;  1ODD A;  2A3S A;  3L09 A;  3WGG A;  3RTR A;  5J8C A;  5HDN A;  1Z6T A;  1E17 A;  3RDI A;  5LHI A;  2PQ8 A;  5CYV A;  1UCR A;  2V79 A;  2WTE A;  3VFZ A;  4ZYE A;  3RKY A;  2VC1 A;  3JAM K;  2M30 A;  5ILV A;  1TNT A;  2FF4 A;  3P7N A;  3T5X A;  2DPD A;  1LDJ A;  4XSX F;  2IA1 A;  1IXC A;  4A0Y A;  2A69 F;  2CSO A;  1FYL A;  1YG2 A;  1TQP A;  4CXF A;  1U6G A;  3QAH A;  2X0L A;  2FE3 A;  1YTY A;  5HLG A;  3I5U A;  4L5I A;  1FC3 A;  4GYI A;  3CO7 C;  2EA2 A;  4CGZ A;  3L2C A;  2O6G E;  1O7L A;  1PP7 U;  3KZZ A;  5ILS A;  2D1V A;  1W7P A;  3I58 A;  2VE9 A;  4IJA A;  1SFU A;  2VBX A;  5JVT A;  4RB0 A;  1J2X A;  3IKT A;  4AIK A;  1TNS A;  5CVR A;  1ZLJ A;  3N4M A;  4XLN F;  4KUM A;  1I6X A;  3FXR A;  4WX9 A;  2FNP A;  2MD5 A;  4S04 A;  3C1D A;  4AWX B;  4D0P A;  5HVQ C;  3VEP A;  2ACJ A;  4BXU A;  4RGS A;  5DUI A;  1U8R A;  5CVI A;  2DTR A;  5F6F A;  4OOI A;  1R22 A;  2EWN A;  2JT1 A;  5FB2 A;  1XGS A;  2FBH A;  2EV6 A;  1A04 A;  3R0A A;  4MTE A;  4HX4 A;  1FPQ A;  4LMY A;  3J81 K;  4OMY A;  3J81 Z;  3E5U A;  1IN6 A;  3DFG A;  4UVA A;  4HX7 A;  2HWV A;  4EGZ A;  4Q48 A;  4CDG A;  1YW7 A;  2KRF A;  1G3S A;  2Y48 A;  2KKO A;  4U7D A;  2A5Y B;  1ON2 A;  3L9F A;  5BMZ A;  3I0T A;  1FSE A;  3F6V A;  3BJ6 A;  2QZ8 A;  3GFL A;  4EV0 A;  1XDS A;  1UHM A;  4BHP A;  4HYE A;  3MQ0 A;  3CUQ B;  4YIF A;  4HX8 A;  4BNC A;  2D45 A;  3OOP A;  4G7Z F;  1IXR C;  1O3S A;  1KU2 A;  1H0M A;  3HYI A;  2O8X A;  2V6C A;  1JXS A;  3S2W A;  1FLI A;  2YU3 A;  3JW4 A;  1TQM A;  3F21 A;  2FQ3 A;  5D5W B;  1MDM A;  1FYM A;  1KA8 A;  3T0Y A;  1R23 A;  1YQA A;  1RI7 A;  4LJZ F;  5IT9 Z;  4KMF A;  1YW8 A;  3FZV A;  5HDK A;  4HF1 A;  3JSO A;  3WTU C;  2MC3 A;  3L7W A;  1XGM A;  3C18 A;  3H3Z A;  3V7R A;  5H20 A;  2DQL A;  1SD6 A;  2A6H F;  1CF7 B;  3TDU C;  3GVA A;  2XV4 S;  1VTN C;  4A0X A;  2ZXJ A;  3B73 A;  5A2Q Z;  1BJA A;  5LHG A;  2L4A A;  1ZN2 A;  5D5U B;  5HS9 A;  4G7H F;  1SD5 A;  1S6L A;  1ONV A;  2M45 A;  3IRQ A;  3LA7 A;  1HKQ A;  4ESB A;  1QPM A;  5FO5 A;  2MH2 A;  4M71 A;  2P5L C;  4ZYG A;  2Y75 A;  4MHG A;  3IRR A;  3TOB A;  1WSU A;  4MEY F;  5EEH A;  2VOO A;  3HUG A;  4L0Y B;  4GXO A;  1HKT A;  1BOA A;  2VT2 A;  2Z33 A;  2A6E F;  3IKV A;  3E6M A;  5ICE A;  5D8L B;  5LGN A;  1JGS A;  3TOA A;  2J5O A;  2LDU A;  5AON A;  3ZQ7 A;  4MGR A;  3LAP A;  3WTX C;  3GW2 A;  3KP3 A;  1QGP A;  3HRU A;  4KN4 X;  1QBJ A;  2O0Y A;  3JTG A;  3DV8 A;  4RAY A;  1J9I A;  1R00 A;  2P6S A;  1FYK A;  2BBY A;  1W5T A;  3FXU A;  2DBB A;  1T38 A;  1EH7 A;  1UST A;  3TKY A;  4LFU A;  4U88 A;  2G7H A;  1HKS A;  4L5J A;  5LRS A;  4QLC U;  4PGH A;  3TO9 A;  1SAX A;  3B02 A;  3FX3 A;  2HR3 A;  2L4M A;  1BM9 A;  3KLN A;  4UXN A;  1H9G A;  3FM3 A;  2GIV A;  3IHU A;  2P6T A;  3WOD F;  3BDD A;  1KU9 A;  2TDX A;  2YPR A;  2DPU A;  3CUQ C;  2XAJ A;  1KU3 A;  3GF2 A;  1Z1D A;  2PN6 A;  2XUB A;  2FBK A;  1TLH B;  4A0Z A;  2K4B A;  2MLK A;  3TO6 A;  4EMS A;  1GHC A;  4IHT A;  3RIR A;  3GO5 A;  5FFX A;  1FX7 A;  3H3U A;  1Z91 A;  4DQ2 A;  3WTS C;  1T6S A;  2GWR A;  2IVM A;  1KYZ A;  2FU4 A;  4KIG A;  1PUE E;  4KFC A;  2H94 A;  4JQF A;  1W4M A;  2DI3 A;  2P7C B;  4G6D A;  3EDP A;  1FBS A;  4ZYH A;  1IW7 F;  3JTH A;  1DDN A;  2FSW A;  4F7Z A;  4M73 A;  3HOS A;  1ZG1 A;  2ZKZ A;  3GFJ A;  4KIC A;  5L3G A;  3KP4 A;  1QZY A;  5L3B A;  3MZH A;  4MEX F;  5L3C A;  4Y17 A;  3GLX A;  4P9U A;  3C7J A;  2XHK A;  5LLQ A;  1O3T A;  2QVO A;  1LQ1 A;  3GWZ A;  3QP6 A;  2HOE A;  2D1H A;  1QZZ A;  3FMQ A;  5FFZ A;  4WWC A;  3QOP A;  1E2X A;  2GZW A;  4ESF A;  1B59 A;  1S7A A;  4QWQ A;  4EM0 B;  4WXC A;  3L00 A;  4EM1 A;  2PFB A;  2RV8 A;  5HLI A;  3V8J A;  2QBY B;  2DQR A;  3EET A;  1IN4 A;  3EYI A;  4KMU X;  3GFM A;  2DW4 A;  5BPI A;  2EK5 A;  2ETH A;  3ZMS A;  3O3K A;  3RKW A;  3OV8 A;  4LB5 A;  3G73 A;  4RB1 A;  1L0O C;  3KP6 A;  1GXQ A;  1RIO H;  4ESJ A;  3I59 B;  3ECH A;  2XKP A;  2ZME A;  5HS8 A;  2LF8 A;  4A6D A;  3O2P E;  3I71 A;  1P92 A;  4RGU A;  4KIB A;  4YII A;  3WTZ A;  4UHT A;  4ON0 A;  5LGU A;  1F5T A;  2QQ9 A;  2RN7 A;  3GEZ A;  1BC8 C;  1IUY A;  5D6E A;  5BS6 A;  3FM5 A;  2IA0 A;  4KA4 A;  4LGW A;  2EFW A;  2DU9 A;  4G9Y A;  3H92 A;  4GGG A;  1O7F A;  1LEB A;  4Q47 A;  2IW5 A;  5E8G A;  2KJB A;  3LQR A;  3Q9S A;  5HS7 A;  2JZY A;  3KP5 A;  1R58 A;  1P4X A;  2VOP A;  2ZBK A;  3CUO A;  2XAS A;  1QNT A;  1V4R A;  2L3D A;  4EJU A;  5K1Y A;  2ZCW A;  2JTV A;  5LGT A;  1DPU A;  4A6E A;  3RKX A;  2VT3 A;  1XCB A;  1ON1 A;  3COA C;  4I98 B;  1R1V A;  2Z5U A;  3K1M A;  3RPU A;  3VB2 A;  1T0F A;  1RUN A;  3HRT A;  1I5Z A;  1B4A A;  2W85 A;  2GQQ A;  4A5N A;  2X4H A;  4GCV A;  3FXQ A;  4ENM A;  2K4J A;  1K6O A;  2RGV A;  3ULQ B;  2MA3 A;  2LKP A;  3G3Z A;  4G94 A;  5D8K B;  2ZJ2 A;  4HF2 A;  3P9I A;  1K7A A;  2QUF A;  3QPT A;  2A68 F;  3CUQ A;  2P4W A;  1P2F A;  4XRF A;  3SQN A;  1Y0U A;  3F6O A;  1R36 A;  2A07 F;  1AOY A;  3P9C A;  2K86 A;  5KK1 A;  2EFQ A;  4G6Q A;  5KVR A;  3W6J B;  5BOX A;  1OR7 A;  1T39 A;  2V1U A;  3GUD A;  1J7K A;  4LK1 F;  1BC7 C;  2RKH A;  1PP8 F;  2FOK A;  2YR2 A;  3HOT A;  4L0Z B;  3I64 A;  1U5T A;  4EGY A;  2HFH A;  3KET A;  4OIR F;  4OIN F;  3WE3 A;  4L9T A;  1LJ9 A;  1RUO A;  2P5K A;  3DXJ F;  5E18 F;  3E6C C;  1OPC A;  1S8N A;  2IP2 A;  1KQ0 A;  1R7J A;  2ZME B;  1ZG5 A;  4M9Z A;  2IRF G;  3AAF A;  3BRO A;  5L3D A;  3W6K B;  2FXA A;  1KYW A;  1YS7 A;  2QQA A;  5D4R A;  2H27 A;  3DQV C;  4H0E A;  5TRD A;  3PFI A;  2MLG A;  3WG9 A;  1IN8 A;  1RZ4 A;  1OYW A;  3V4G A;  4PGG A;  5JHU A;  1ZYR F;  4M9X A;  2HYG D;  2V9V A;  4ENN A;  1XSV A;  3IC7 A;  1TQI A;  1UB9 A;  2UXX A;  3DP7 A;  2Q0O A;  1ZH5 A;  4BH9 A;  3F8F A;  1BI2 A;  2H6C A;  3WU0 A;  2CFX A;  2D2W A;  2Q2E A;  2QBY A;  5DV5 A;  2ZNZ A;  1SD4 A;  3J80 K;  5DCM A;  1YIO A;  2CW0 F;  1K78 B;  2K27 A;  4WCG A;  5F1R A;  2Y0M A;  5E17 F;  2E1N A;  1XCV A;  2H6B A;  1K78 A;  1WKM A;  2WWY A;  3HRM A;  3I53 A;  4WK8 F;  2XIG A;  3NEU A;  3VOE A;  2IA2 A;  3LWF A;  2RC4 A;  3TQN A;  4I0B A;  2P5V A;  4R8H A;  2VON A;  2XRO A;  5E1X A;  3F22 A;  2AXL A;  2XGX A;  2YX7 A;  4EM2 A;  4CZZ A;  3WGH A;  3IWZ A;  1O3R A;  3RPQ A;  5EEG A;  3TDZ C;  4R79 A;  1MZB A;  4OU0 A;  4NHJ A;  2P7V B;  5HDG A;  3KEQ A;  1T98 A;  4RB3 C;  1ZRF A;  3O6B B;  1B9M A;  5J6X A;  3QU6 A;  1QO0 D;  2OZU A;  1D8J A;  3E6D A;  4XSZ F;  1HST A;  2M5W A;  2DK5 A;  2PBI A;  1MGT A;  3R4K A;  3ELK A;  5FD6 A;  2STT A;  2JRT A;  2PG4 A;  1ZHF A;  2CG4 A;  2UZK A;  3WTT C;  2QYO A;  1D5V A;  1EH6 A;  2EV0 A;  3REO A;  3K69 A;  1KQ9 A;  4KDP A;  4AVP A;  4M6X A;  2QQB A;  4HAM A;  5L3E A;  1G3W A;  3DPL C;  4BHB A;  4U0V A;  1OKR A;  1YYV A;  4HOB A;  1Z9C A;  1TTY A;  4ZZL A;  4EQQ A;  1G3T A;  5LHH A;  2C6Y A;  1C0W A;  3LA2 A;  5DDG A;  3HHG A;  4LLG F;  2VBW A;  3ZPL A;  1O57 A;  2F5E A;  4UVC A;  3BWG A;  4CIC A;  4K2E A;  4OMZ A;  2ZO4 A;  4HV6 A;  1IF1 A;  3HTS B;  3ZN0 A;  4MQV A;  3DF8 A;  1J75 A;  5DCM B;  3LAJ A;  1XGO A;  1Z05 A;  2HZT A;  1ZLK A;  3R60 A;  1BN5 A;  1FY7 A;  3HHH A;  3F8C A;  3IWF A;  3BP8 A;  2Z3Y A;  3MZY A;  5IT9 K;  3EQL F;  3CTA A;  3K0L A;  5H6R A;  1U5T C;  1XD7 A;  5LBQ A;  4JK1 X;  5LEJ A;  3GZ6 A;  2R7D A;  2W24 A;  5TJJ A;  2LF7 A;  3ROU A;  2CQK A;  1XSX A;  4N9I A;  3J80 Z;  2CWE A;  5JI6 A;  2HYF A;  2RQP A;  4L9V A;  1OYI A;  3I54 A;  4HF0 A;  4JBA A;  2NNN A;  3HRS A;  1L3L A;  3BJA A;  4KIF A;  4NQW A;  4RS8 A;  1JE8 A;  1LB2 A;  2EA4 A;  3DKW A;  2FA5 A;  1CGP A;  2PMH A;  4U7B A;  2Z9O A;  1XGN A;  1J0R A;  2G7U A;  4KYW A;  4HA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...