2A07F

Crystal structure of foxp2 bound specifically to dna.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
VRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Forkhead Domain of FOXP2 Bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*AP*CP*TP*AP*TP*GP*AP*AP*AP*CP*AP*AP*AP*TP*TP*TP*TP*
total genus 20
structure length 82
sequence length 82
chains with identical sequence G, H, I, J, K
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a07F00
1IW7F 4KNYA 3NRVA 3WTXC 4AIHA 2Q2EA 2DFIA 1Z6RA 2V9VA 1HKSA 1J2XA 3LA2A 5D6EA 1MDMA 2KJBA 2HFHA 1WRJA 2HQNA 4P96A 5FLXK 1L3LA 1IXSB 2ZO4A 2FOKA 5LEJA 1LNWA 2W24A 4IRHA 3TOAA 3T5XA 2L54A 2K02A 3Q9VA 4ESBA 2EV0A 3DPLC 3HIFA 4A0YA 4AD9A 5DEQA 4LGWA 3KLOA 4HF0A 3ZMVA 5LRSA 1PP8F 2RVCA 2IA0A 2Z5UA 5ILUA 1S29A 5CYVA 1LB2A 1HKQA 3I59A 2MH2A 2MH9A 3RPUA 3D5LA 2QVOA 2OU2A 3IL2A 1XSVA 1B9NA 2NRAC 1OR7A 2E1CA 4G7ZF 1K6OA 1Z1DA 3HSRA 3C18A 2EFQA 2DI3A 2KIFA 2PJPA 3PQKA 1HBXG 1XGOA 3BROA 2UXXA 5HS7A 3E5QA 5H6QA 3CO6C 4EGYA 2D2WA 1SFXA 3TO7A 1RNLA 1TQIA 3JTGA 3TQNA 5E1WA 1ZRCA 1YQAA 4M73A 4FX4A 1BC8C 1HW2A 1I27A 2E7XA 1V4RA 5CVUA 1XDUA 3TKYA 4BYYA 1FT9A 2RC4A 4BAYA 3GVAA 4N0BA 1U6GA 4BHCA 1C0WA 4I98B 5FO5A 4N9HA 4I0AA 5K5RA 1TTYA 1ZG1A 2P8TA 5TRDA 1FYKA 2HDCA 2KIMA 1O57A 1EH7A 3BOQA 4GXOA 1I6XA 1IUYA 2L4MA 2A69F 4LMYA 1RZ4A 3RIRA 4L9JA 3DQVC 2EFOA 3LAJA 2UZKA 4EM2A 5CJ9A 5DCMB 1UFMA 3ZMDA 2IPQX 3FM5A 5DUKA 3O6BB 1DPRA 2W57A 1J5YA 1QZYA 2GXBA 4NQWA 4EJWA 1G3WA 2JTVA 3D0SA 5D5UB 1JHHA 5E8GA 3ZMZA 1XCVA 5D8LB 2M87A 1XGMA 4RAYA 1GXPA 1BM9A 2CW0F 2XV4S 3KETA 2P5VA 2V1UA 2YSRA 4UNOA 1ZGAA 2Y48A 3GX4X 1W7PB 2A07F 5LHIA 4U0VA 4P9FA 2DPUA 2JT1A 3JSOA 3F23A 2EK5A 3QU6A 1HSJA 1B1BA 5E18F 5LBQA 5DYMA 3ERED 2OZUA 3HYIA 1EH6A 1IRFA 1LEBA 3DEUA 2O0YA 4ZZDA 3IC7A 2FE3A 4S04A 1CF7A 2KIUA 2PMHA 3CUQC 3F6OA 4CZZA 2ZFWA 3WTUC 3WGHA 3M9AA 1YLFA 1B6AA 1FX7A 1R36A 1IN5A 1LJ9A 1L0OC 2QZ8A 4WXHA 4CO8A 4A5MA 2EV5A 5L3GA 2ZMEB 1ZGJA 4LFUA 6PAXA 3MWMA 2JSCA 1P6RA 2YU3A 1ZRFA 1Z7UA 2Z33A 3GUDA 5D5XB 3K1PA 3EUHA 1R22A 3HRTA 4YG2F 4WK8F 3JAMK 5E1XA 1TBXA 2A61A 3V4GA 2K4JA 4CYDA 1JHFA 1KYZA 1AWCA 2DLLA 2BV6A 4IJAA 5K5QA 2NYXA 5BOXA 1A04A 1G3TA 1HQCA 3LA3A 3WU1B 3I59B 3HSFA 3ABUA 1OYIA 1Y0UA 3T0YA 1LDDA 2HEOA 3NQOA 3MAJA 2XAHA 5F6FA 5ICFA 4XBFA 4BH9A 4I02A 3GFLA 4P9UA 3N4MA 2EFNA 3N97A 5D4SA 3RTRA 2A68F 5CVVA 4EVIA 1HW5A 4GO1A 1K7AA 1CF7B 2MLKA 3BJOA 1ZLKA 1SD5A 5CVRA 2ACJA 2CYYA 5ICCA 2Z9OA 3DF8A 2FA5A 1PDNC 4UVAA 3L00A 2DU9A 1R58A 5LEKA 1FBUA 3F8MA 2EB7A 2DAOA 1P4WA 2HQRA 2PMUA 3ISPA 1B4AA 3NEUA 5F1RA 1USSA 4BXUA 2EFWA 4CDGA 2DQLA 3P9CA 1FWZA 1EV7A 3VODA 2QM3A 4RAZA 2K7LA 4WF2A 2VE9A 4LD5A 2VXZA 1QPMA 4MGRA 4RB1A 4AIJA 1QQIA 3O3KA 4YFKF 5E20A 3TGNA 1GVJA 2LF7A 4LLGF 3FWEA 1P4XA 2O03A 1QGPA 4GCVA 4LK1F 1H9TA 2WC2A 4HX7A 4HV5A 2IJLA 2NNNA 5JI6A 3EYIA 2W85A 2EFPA 1U5TC 5BMZA 3KZZA 4UVBA 2QUFA 1MDMB 2DO7A 3HOSA 2O61A 4UXNA 1BI3A 1G6NA 2HWVA 3J81K 3LA7A 4CICA 1BJAA 3FXRA 4UUVA 4IVNA 4Q4ZF 3ZN1A 1WQ2A 1XB4A 1PP7U 1QO0D 3M7GA 4EM1A 3E6CC 2CGPA 5HDKA 1XD7A 4M9XA 2D1HA 3QRFF 3KP3A 2LKPA 3OOPA 2VN2A 4MEXF 2V6CA 2VT3A 3TDZC 3GXOA 1FY7A 2V1XA 2A6EF 1XN7A 1VTNC 2IP2A 1TW3A 2PEXA 3IWZA 1SMYF 5EEHA 2O8XA 2YR2A 2Z3YA 2Y75A 4RS8A 4G94A 1J0RA 3DP7A 4BHPA 4KMFA 5DV5A 5L3DA 1KQ0A 5HOOA 4ZYHA 2W25A 1MKMA 2DPDA 3GYHX 1Z9CA 1MJBA 1I5ZA 2HTJA 2J5PA 3F72A 2HKOA 1XMKA 3KFWX 3U2RA 3FF5A 4ENJA 2EWNA 3OV8A 1I1GA 5LGTA 2PFBA 3PQJA 2XRNA 2X4HA 5BPDA 2LF8A 2QQAA 1MZBA 1QZZA 4G7OF 3HSEA 4U7BA 2STWA 3ZQ7A 1FSHA 3I64A 3F22A 3HRSA 3F8BA 3KLNA 3W6JB 5D4RA 2H6CA 3LQRA 3ZPLA 1BI0A 2BYVE 2FMLA 4G9YA 3G3ZA 3ZN0A 2C6YA 3M8EA 4D0PA 2J5OA 2NNYA 1P4AA 5BQTA 4H0EA 4DNCA 3QP5A 2FNAA 2B0LA 2L4AA 2JPCA 3CLOA 2H09A 4M6YA 3QPHA 4CHUA 5D8KB 3QPTA 5LHGA 2ZNYA 4JK1X 1GHCA 5KVRA 4BHBA 3MEXA 2MLGA 5K5OA 1TW2A 3R61A 3DV8A 4A0XA 2P6TA 2F5CA 1JE8A 1IAWA 5BS6A 3SFZA 5JR3A 1T38A 3K69A 4GYGA 1NHAA 3IKVA 4OIQF 2WV0A 3Q5FA 3FMRA 2OZ6A 4LG0B 2O3FA 2VBXA 3TDUC 4HQEA 4IPAA 4G6QA 5HDNA 1DUXC 2VC1A 2HYGD 1T2KA 1J75A 1KQ9A 1SFUA 1YS7A 1FSEA 1OKRA 4YIIA 1HKTA 4HX8A 1YW7A 4HLYA 1RI7A 2WTEA 3V7SA 5ERIA 4WWCA 1YIOA 1D5VA 1R7JA 2A6HF 4LLNA 3QOPA 4KDPA 3ML6A 1SFEA 2Q8KA 1ON1A 1W7PD 2MC3A 3V8LA 2K86A 2L3DA 2XAGA 5LGUA 1LVAA 2OBPA 3F21A 2XGXA 5L3EA 1FYMA 5IT9Z 1DP7P 1ZHFA 3BDDA 3DKWA 2L01A 4FHTA 1FLIA 3WODF 4R8HA 5FLXZ 4O5VA 1U2WA 3C3WA 2G7UA 3WTSC 1F9NA 2ESHA 4G8XA 3KP6A 3GW2A 1ODDA 5DD8A 3MQ0A 5LRRA 3SZTA 1RUOA 2R7FA 4OMZA 3KP7A 3E6BA 3FXUA 4F7ZA 1UB9A 1S3JA 3I5UA 4MNUA 3VB2A 3ZMTA 2QLZA 3KE2A 1JGSA 2ZJ2A 2YX7A 3VOEA 2DK5A 1USTA 4FX0A 3CUOA 2X0LA 3IRRA 2ZNZA 2CWEA 1O7LA 3L09A 2ZBKA 1KYWA 2Q0OA 4EJUA 2MBFA 1LDJA 4XLPF 2M8EA 4KIFA 4RGRA 1IF1A 1H9GA 1ONVA 1KA8A 3I53A 1J7KA 5LGNA 2HZTA 4RB2C 3F3XA 3E6DA 4A0ZA 3WGIA 1MD0A 1UHMA 3SHFA 4KICA 4UV8A 1DDNA 3P9IA 1YFHA 1ZLJA 2VBZA 2IT0A 2ISYA 2XAQA 3KP2A 3BJ6A 3I71A 4YFXF 2OA4A 2TDXA 1ON2A 4U0YA 1IXCA 1B59A 2BBYA 4Z2YA 2GWRA 3SZPA 5E8IA 2EV6A 1E17A 2PLYA 4KUMA 4L9VA 4PGHA 5HLHA 2ESNA 1IZ1A 3T8TA 2Y0MA 1F5TA 1ZG5A 4HX4A 5J6XA 1F1ZA 2F5DA 4A5NA 5J8FA 3KZYA 1PUEE 2XVCA 3DPTA 3GO5A 3EQLF 3K9TA 2CFXA 3IHUA 3HUGA 2NAZA 2L02A 1ZARA 4LB5A 1GXQA 1MGTA 4LJZF 4GYIA 1T6SA 1ZRDA 1W7PA 4LB6B 3WE3A 4P55A 1G3YA 1TQMA 1IN6A 3GF2A 3GWZA 2FRHA 1YW9A 4WCGA 2RN7A 4YFNF 2EA2A 3J80K 2HOEA 4EMSA 1ZH5A 3K0LA 1XMAA 4HF1A 3ZMUA 2D45A 3B02A 2RGVA 4EV0A 2FEZA 3ULQB 4L5IA 3FX3A 2E1NA 1UCRA 4IRGA 4KFCA 4XSXF 2E7WA 3IRQA 4Y15A 4M71A 1IN8A 3CUQB 1SD7A 5ILSA 4L9NA 3IWFA 2DTRA 3DFGA 3FM3A 1W5TA 4IHTA 5DDGA 3RKYA 1EH8A 5L3BA 1R23A 2FF4A 2UXNA 2ETHA 5H20A 5IT3A 2MA3A 3FHZA 3FMQA 1BIAA 5DD4A 4G6DA 2VOPA 4XSZF 1FP1D 4LLLA 1R5HA 1X3UA 3LFKA 4R1HA 4M9ZA 2PG4A 1V3FA 2DBBA 4ZYDA 2D1VA 1D8JA 2JZYA 2R3SA 2BE5F 5DCMA 5KK1A 2H94A 3JW4A 1IN7A 4KYWA 1U8RA 2G7HA 3C1DA 1KU7A 1I1SA 2VBWA 4HDUA 2DK8A 3BP8A 3T1BA 4MTEA 4Q48A 5HS9A 3K1MA 2XAFA 2H27A 2XROA 3V8KA 2ZXJA 4EM0B 1LQ1A 3MZHA 5BPIA 4BQAA 4NHJA 1TQPA 2VOOA 1K78B 3KEOA 2A3SA 4I2OA 3HTUA 3HOTA 2HGCA 1J59A 1BIBA 1ZG3A 4S05A 3KP4A 3GFJA 1WKMA 2HTSA 4ESJA 1U5TA 2QWWA 1T39A 3CDHA 4M9SA 5ICGA 1TLHB 2IA1A 4OU0A 5IT9K 3F6VA 5D6FA 3FXQA 3PFIA 4ZH4F 2QENA 2XUBA 4GGGA 5FFXA 3ABTA 2OAZA 4HV6A 5AONA 1WSUA 1G3SA 2FBHA 2ZMEA 1S7AA 3CJNA 3IKTA 4PCQA 4DQ2A 1REPC 4QWQA 2P7VB 2LSOA 1SMTA 1WI9A 4R79A 3GLXA 2FMYA 4HOBA 2NS0A 3HRMA 3E3VA 1R5GA 2JRTA 4MQVA 1S7OA 1R00A 2HR3A 2BGCA 4CXFA 1IXRC 2CSOA 3WTWC 2COMA 4I09A 1AOYA 1ZREA 3V7CA 1T0FA 4TV7A 2CO5A 2GZWA 3U9GA 2CG4A 2KKOA 5A2QZ 3KEQA 1TNSA 2H6BA 3W6KB 3R0AA 3RYPA 3E97A 2M1BA 5E1ZB 1XCBA 3K1NA 4UHTA 1ULYA 1XSDA 4RB3C 1O3RA 1Q1HA 4BNCA 3V8JA 1FOKA 3J7AO 2HYFA 3CO7C 2FU4A 5HDGA 4M6XA 3BPXA 1YTYA 2XHKA 1BI2A 2RNJA 2F5EA 2O6GE 3F8CA 4OMYA 3FMSA 3BJAA 4IXAA 3LQQA 1SD6A 4I7HA 1YS6A 2FBKA 3WG9A 2GIVA 1Z05A 1S8NA 2FBIA 4CGZA 3K2ZA 1W4MA 4YIFA 1SD4A 4WX9A 4ZZLA 2XAJA 1E2XA 1FBSA 2ISZA 1UHWA 4B09A 4RGUA 3I58A 4MEYF 3JAMZ 1MJAA 3Q9SA 4WXDA 4KN4X 4OIOF 4Y13A 2FNPA 2RV8A 3I54A 4IF4A 3U1DA 2QQ9A 2FQ3A 2FSWA 3QP6A 2ELHA 2G9WA 4HF2A 5DCFA 1BBYA 3SXYA 3TOBA 1O7FA 3ECOA 1IRGA 2VBYA 1FNNA 1KU2A 3ZP5A 4KIGA 3QAHA 3SQNA 2KJCA 4L0ZB 1K78A 3DXJF 3MFKA 2VONA 2P5KA 1QNTA 3COAC 4RGSA 4OIRF 5LHHA 5FB2A 1D3YA 2QBYB 4PDKA 3R60A 2GA1A 3VFZA 3CTAA 4HQMA 3J80Z 1U78A 2HKXA 2PBIA 4A2UA 5JFRA 1R1TA 4AIKA 3R6SA 2DW4A 5JHUA 4UVCA 4I0BA 2XASA 1OYWA 1KU9A 4NB5A 5J8CA 1XGNA 3QU3A 2P6SA 2GQQA 4MHGA 2QYOA 3KP5A 3J81Z 4M74A 4M72A 4ASNA 1Z91A 2RDPA 2M5WA 3E6MA 3REOA 1XDSA 2HS5A 4L18B 5HLGA 1Z6TA 1SAXA 2FXAA 1ZYRF 2W84A 1S6LA 5ILVA 3GEZA 4L5JA 2IW5A 3HHHA 3I0TA 2F2EA 1HXDA 2XKOA 4LK0F 3FZVA 2RQPA 1R1UA 3T8RA 3R4KA 1FZPB 1XSXA 5ICEA 3RDIA 3CUQA 5FD5A 1STZA 2P7CB 4EQQA 4LG0A 2GA2A 1MJ9A 1ZN2A 1ZAOA 4JBAA 4E70A 4ESFA 1FP2A 3JSPA 2JPBA 1J9IA 1RUNA 3H3UA 3RKXA 4ENNA 4MQ9F 2ADUA 3S2WA 4EJOA 3BZ6A 4L0YB 4O3MA 3MCZA 5AIPA 1CGPA 4ENMA 3EETA 1P92A 4U0WA 1KQ8A 1YO5C 3WE2A 4KMUX 3H3ZA 1LEAA 4L9TA 5CVIA 3B73A 2WWYA 5FFZA 1K79A 1HW1A 4QLCU 2MD5A 2EA4A 4U88A 2VE8A 3KCCA 3GZ5A 2V79A 2IVMA 1FYLA 5E17F 1OMIA 3R0JA 4HLXA 5D5VB 2VT2A 2K27A 3WTYC 4Y17A 4I01A 2IA2A 1HSTA 3L2CA 3HTSB 4FT8A 5TJJA 4HW0A 3BWGA 4AVPA 4RB0A 1P2FA 4EGZA 2M45A 4AWXB 2XIGA 2KRFA 4OIPF 3L9FA 4N9IA 4K2EA 3BY6A 2AS5F 1T98A 1U5TB 2K4BA 5HVQC 2PQ8A 4ENKA 3EYYA 1JXSA 4EJTA 3VEPA 2QQBA 3ECHA 4A6DA 5FD6A 4XLNF 4Q5SF 3WGGA 2QBYA 1KGSA 2OQGA 2DQRA 2YPRA 4HYEA 3WTZA 2STTA 1YYVA 3E5UA 4HAMA 2P4WA 4JQFA 3LAPA 2V1DA 2VODA 3TO6A 3RKWA 1H0MA 1LDKB 3E5XA 2OQRA 2UWMA 4WXCA 2GXGA 1G4DA 3HHGA 5F64A 4EJVA 4RGXA 3WU0A 3BPVA 2XKPA 4ETSA 1BOAA 3GZ6A 3M1EA 1YG2A 4PZJA 3JTHA 2ZKZA 4MTDA 5AIQA 1B9MA 1OPCA 1FC3A 3GFMA 3MZYA 4HA8A 3L7WA 4Q47A 4UV9A 3LSTA 1D8KA 2M30A 2AXLA 4G7HF 3ZMSA 4IHSA 3F8NA 2PN6A 3ROUA 3WTVC 5L3FA 2F5FA 5HS8A 2PI0A 1XGSA 1R1VA 4HBLA 5FGMA 4KN7X 3HRUA 3RI4A 5ED4A 5CLSA 1TNTA 5D5WB 1U3EM 4A12A 4XRFA 5HLIA 4ON0A 1F4KA 3RJPA 4ZYEA 3F8FA 1RIOH 1BC7C 3P9KA 5EEGA 5DUIA 3WTTC 3AAFA 2IRFG 5H6RA 4A6EA 3V7RA 1BI1A 2P5LC 2OD5A 1WWXA 1BN5A 4OOIA 3G73A 2EJRA 5A2QK 3C7JA 1FBQA 4PGGA 2VC0A 2LDUA 1YW8A 3RPQA 5CVJA 1O3QA 2YX4A 5LLQA 3P7NA 4OINF 2ZCWA 1O3TA 4U7DA 4ZYGA 3M8FA 4O6JA 4HDVA 5L3CA 4IRIA 5JVTA 1FPQA 4KIBA 2LNBA 1W5SA 1O3SA 2DT5A 3LWFA 2CQKA 4KA4A 2GAUA 3RYRA 1DPUA 4KT5C 1KU3A 5K1YA 4HZFA 3O2PE 1OYYA 2BEOA 3GFIA 2R7DA 4B8XA 2Z99A 2A5YB 4P5OA 3H92A 3TO9A 1QBJA 3I4PA 1IN4A 3ELKA 3EDPA 2RKHA
chains in the Genus database with same CATH superfamily
3IAS2 1IW7F 4KNYA 3NRVA 3WTXC 2IAIA 4W97A 2Q2EA 4AIHA 2DFIA 1Z6RA 2ZJPF 4BE1A 2V9VA 1HKSA 1J2XA 3LA2A 5D6EA 1MDMA 2P0WA 2KJBA 1ENHA 2COBA 4IOAF 5IYDJ 2HFHA 1WRJA 3IAM2 2HQNA 4P96A 5FLXK 1RC9A 1L3LA 1IXSB 4RLFA 2HU9A 2BY2A 3H1CA 3ZQLA 2ZO4A 3CCEI 4GFBA 2DA3A 2DCEA 2FOKA 5LEJA 2QSHX 4IQJA 1VQ9I 1LNWA 2W24A 3BQZA 4IRHA 4JX5A 1YX5A 2QSFX 3PIOF 2R7QA 3TOAA 3T5XA 4A3GJ 1AKHB 4A3LJ 2L54A 2F4MB 2K02A 3Q9VA 4ESBA 4A3DJ 2EV0A 3DPLC 4KJZA 4NBQA 2QEXI 3HIFA 4A0YA 4AD9A 1V55H 5DEQA 5GAHJ 4LGWA 2K9SA 3KLOA 4HF0A 3OYJA 4BU2A 4NDLA 3ZMVA 4XICA 5LRSA 1PP8F 1NG6A 2RVCA 2R7OA 3CCRI 2IA0A 4GDFA 2OF7A 2Z5UA 5ILUA 1S29A 5CYVA 2VLAA 1LB2A 3CQZJ 1HKQA 3I59A 4Y33A 1ZR4A 2MH2A 1LE8A 2MH9A 4BEHA 5B66C 3RPUA 2QSGX 1WH5A 3D5LA 2QVOA 2OU2A 3IL2A 1ZGWA 3NARA 2F6CA 2X6XA 1XSVA 2DA6A 1B9NA 2NRAC 4PUSA 1OR7A 1KONA 2E1CA 4G7ZF 1K6OA 1Z1DA 4RM3A 3TP0A 3HSRA 4HEA2 3C18A 2EFQA 2DI3A 2KIFA 2PJPA 1Y1WJ 4AIDA 3PQKA 2X6YA 3I56I 1W1WE 1HBXG 3CJQB 1XGOA 3BROA 2UXXA 2Y2ZA 5HS7A 3NAUA 3S32A 3E5QA 5H6QA 3CO6C 4EGYA 2D2WA 1WJCA 3JR9A 1SFXA 2A5WA 3TO7A 1RNLA 1TQIA 3GZNB 3JTGA 3TQNA 5E1WA 3K70C 3CESA 1ZRCA 1YQAA 4M73A 5F08A 4FX4A 1BC8C 1SVOA 5KAIC 1HW2A 1P9QC 2MFZA 1K83J 1T56A 1I27A 2E7XA 3VPRA 3DTEA 4J01A 1V4RA 5CVUA 2X48A 1I3AA 4XN0A 1XDUA 3PSFA 3TKYA 4BYYA 1FT9A 4BJTA 2EZIA 2RC4A 3E1SA 2JWTA 3CMAI 4BAYA 3GVAA 4N0BA 1U6GA 3A01A 4BHCA 1XS9A 1C0WA 4I98B 5FO5A 4N9HA 1DP3A 2E5NA 4I0AA 5K5RA 3A2KA 1Z21A 1TTYA 4QPOA 2OPTA 1ETOA 3PM1A 3ONQA 1ZG1A 2P8TA 3Q3SA 5J4YA 2CV2A 5TRDA 3MZ8A 3HGYA 1JI8A 1FYKA 2HDCA 2KIMA 1O57A 4F52A 3FK6A 1EH7A 3BG3A 3BOQA 1ACIA 1XPXA 4GXOA 1I6XA 3W3CA 1IUYA 2E34A 1U9NA 2L4MA 4BUPA 2A69F 1TP4A 4LMYA 1RZ4A 3RIRA 3I4NJ 4L9JA 2WB1A 2EFOA 3DQVC 2ME6A 3LAJA 1JJ6C 2UZKA 3K4LA 4EM2A 5CJ9A 5DCMB 5F04A 1IG7A 1UFMA 3ZMDA 2IPQX 3J7AY 3FM5A 3TP3A 1T0FC 2V7FA 1DU0A 4QSHA 5DUKA 1D0YA 3O6BB 1DPRA 3OSFA 2W57A 1Y8QB 4C2UA 2ID3A 3ZQGA 1J5YA 1VFCA 1QZYA 5FRNA 2GXBA 1UZCA 4CCLA 5JHFA 4NQWA 4EJWA 3AL0B 1T33A 1G3WA 2JTVA 3D0SA 1P7JA 5D5UB 1JHHA 5E8GA 3ZMZA 4ZDOA 1XCVA 5D8LB 4A3MJ 2M87A 1XGMA 4PJMA 4RAYA 2GM4A 1GXPA 1BM9A 1VQ4I 4H4KC 2CW0F 1K4SA 2GXAA 1VQMI 2XV4S 3M3YJ 1LFPA 3KETA 2HXOA 4F92B 2P5VA 1MMSA 3FDYA 4B48A 2KP6A 4PJNA 3H5NA 4XRSG 4QIWN 2NVQJ 2V1UA 2YSRA 4UNOA 4PFOA 2MW8A 1ZGAA 2A05A 1X1BA 1Y6IA 2Y48A 3DKXA 1W7PB 3GX4X 2A07F 2IS1A 5LHIA 4A3IJ 3BQYA 4U0VA 3OL4A 3BR0A 4FASD 4P9FA 3OYAA 2DPUA 1HCRA 2JT1A 4AM3A 3JSOA 1Z3YA 3F23A 2NS8A 2H1LA 3KX2A 4BXXJ 1PYVA 2EK5A 3QU6A 1HSJA 1B1BA 5E18F 1ETWA 5LBQA 5DYMA 3S1QJ 3ERED 2V6EA 2BY0A 1IRZA 3SDBA 2OZUA 1EJ9A 3RZDJ 1TWAJ 2RREA 3CC4I 2HQAA 3A1YA 4OAZA 3HYIA 1EH6A 1IRFA 4CCNA 1LEBA 1X1DA 3DEUA 2HDWA 4DGWB 2O0YA 1RPWA 2VUMJ 4ZZDA 3IC7A 2FE3A 3S14J 4UB6C 1X1CA 1W0UA 4S04A 1CF7A 2KIUA 1QA6A 5IP9J 5CPRB 2IBDA 2PMHA 3CUQC 2MG4A 3F6OA 4Y3OA 4CZZA 2KL4A 2ZFWA 1TT5B 2QCOA 3WTUC 3GLLA 5E3LA 4X6AJ 2F48A 2QA4I 2X85A 3M9AA 1OFCX 3WGHA 2PJRB 1YLFA 2FOWA 1V54H 3PNVA 1QU3A 5HODA 1B6AA 1NK2P 5LD2C 1TWFJ 1FX7A 2VQHA 1ITYA 1R49A 2X1EA 1R36A 1IN5A 1JUSA 1DU6A 5C3EJ 1LJ9A 2NXNB 1L0OC 2XRLA 2QZ8A 4WXHA 3DEWA 4HNVA 2ICWG 4C3JJ 4CO8A 3D5SC 2HVQA 5FKOA 4A5MA 4DBRA 2EV5A 5L3GA 2ZMEB 2HVRA 4IHWA 2Y0SN 1ZGJA 3W2VA 4LFUA 4A69C 2DTZA 6PAXA 2M7AA 5GPCA 3MWMA 2JSCA 1P6RA 2YU3A 1X4PA 2Y69H 4GRIA 1ZRFA 1Z7UA 1KZHA 2Z33A 4UY8I 3GUDA 1OJLA 5D5XB 3K1PA 3PUFA 2R7RA 1XX5A 4F55A 1R5ID 3EUHA 3OYLA 1R22A 1ZR2A 2V4JC 3OOUA 3GTQJ 3HRTA 4YG2F 4WK8F 4BY1J 2WAEA 3S3NA 3JAMK 5E1XA 1TBXA 2A61A 4YEJA 5EG0A 2XGEA 4II2A 3V4GA 1U0JA 2K4JA 4CYDA 3BLYA 1JHFA 3CF2A 3HOWJ 2OCCH 3LMMA 1KYZA 5IYBJ 1AWCA 2R7XA 2DLLA 5J47A 2R5ZB 2BV6A 4IJAA 5K5QA 2NYXA 5BOXA 2LBFB 1XMXA 3MVPA 2AXTC 3PL8A 3VYRB 1ETQA 1A04A 1G3TA 1HQCA 3LA3A 4C2TA 4Z6YA 5KAFC 3WU1B 1JT0A 3I59B 3HSFA 3ABUA 2EIKH 1OYIA 1Y0UA 3T0YA 3VYUB 3JREA 1XG1A 1LDDA 2HEOA 3NQOA 1X4OA 2X1CA 1EF4A 1A6IA 3UKGA 3OIQA 3MAJA 2XAHA 1WH7A 5F6FA 3H36A 5ICFA 4XBFA 4BH9A 1ZELA 4I02A 3GFLA 5IY5H 4P9UA 5EGOB 2CH0A 3BR2A 3N4MA 2EFNA 3N97A 5D4SA 3W2WA 1WHUA 3RTRA 1BR2A 2A68F 4JYKA 3CZ6A 5CVVA 5C4JJ 5FKLA 4EVIA 3C2HA 2JK3A 3KYLA 1D1CA 3OYFA 1HW5A 3L2QA 4GO1A 4DZPA 1K7AA 3G6EI 1CF7B 4UUSA 2MLKA 3BJOA 1ZLKA 2MC4A 3DU6A 1SD5A 5CVRA 2ACJA 2CYYA 5ICCA 4NUBA 1OCTC 2Z9OA 2MD0A 2OV7A 2R0QC 3DF8A 3DKYA 2FA5A 1PDNC 3I4MJ 1Y56A 2VI6A 3BZCA 2F4OB 5GPAA 4UVAA 1W5CC 2JN6A 4RM2A 2BHYA 3L00A 2DU9A 1R58A 3GTPJ 1MBGA 5LEKA 1FBUA 2ZXIA 3F8MA 1NK3P 4M3BA 3G71I 2EB7A 3C2BA 2DAOA 1P4WA 2LTPA 2CQ7A 5FJ8J 3EUAA 3LSIA 4D5CA 2ZMEC 2HQRA 1VQ7I 3IP4B 2PMUA 3ISPA 1B4AA 3NEUA 5F1RA 1USSA 4BXUA 1AHDP 2EFWA 3OYDA 2IS4A 1BA5A 4XK4A 4CDGA 2DQLA 1T95A 3P9CA 1MNMC 1FWZA 1EV7A 1GT0C 2LKSA 3VODA 2QM3A 1N78A 1JKQC 2K3FA 2HPMA 3HZJA 4LIVA 3OMYA 4RAZA 5K7FA 1SVMA 2K7LA 1IDZA 3AFHA 4WF2A 5KCMA 2VE9A 1F43A 4LD5A 4XKWA 1IJWC 3CMEI 2RQQA 1I50J 1LKXA 4M3DA 2VXZA 2XPUA 1QPMA 4ZTJA 4MGRA 4RB1A 3S2DJ 3PNTA 2M9HA 4AIJA 4AYBA 1QQIA 3O3KA 4V19K 3DPUA 3RSNA 4YFKF 5E20A 3TGNA 1GVJA 4LITA 2CQQA 2LF7A 4LLGF 2HQ5A 2V9KA 1P4XA 3FWEA 2O03A 1QGPA 4AUXA 4GCVA 4OAYA 4LK1F 1H9TA 2WC2A 4HX7A 2ELKA 4HV5A 2IJLA 1G8XA 1SAUA 2NNNA 5JI6A 3EYIA 2W85A 4BJ6C 3DU5A 2EFPA 1U5TC 4ABZA 3A03A 3HPGA 5BMZA 2F5VA 3KZZA 2HPIA 3HOZJ 2KRCA 4UVBA 2QUFA 3JRHA 2DO7A 3G1MA 3HOSA 1MDMB 2O61A 2E71A 3OIOA 1VNDA 4UXNA 1BI3A 1G6NA 2HWVA 3J81K 3LA7A 4CICA 3JRBA 2E5ZA 2LG4A 1BJAA 3FXRA 4UUVA 4IVNA 1VQ8I 4XR6A 4Q4ZF 3S2HJ 1U8BA 4QPQA 3ZN1A 4A3FJ 1WQ2A 1RESA 2MSYA 5C44J 3ABLH 1XB4A 3JCUC 3AKZA 1PP7U 1QO0D 4JP0A 3M7GA 4EM1A 3E6CC 2Y9ZA 2CGPA 5HDKA 3FBNB 3AL0C 1XD7A 4M9XA 2D1HA 2JRMA 3QRFF 3QQAA 3KP3A 5IPAA 4E7SA 2LKPA 2ZJRF 2M8GX 2BW3B 3OOPA 2VN2A 2JA6J 1OCOH 4MEXF 3PFYA 2V6CA 2VT3A 2R7VA 1UAAA 1VQ6I 3I9V2 3TDZC 3GXOA 1FY7A 2LYCA 2FUG2 1T08B 2ZSIB 4A93J 2V1XA 2LFBA 3OYGA 2A6EF 1ERDA 3M07A 1XN7A 1VTNC 5FKKA 2IP2A 1TW3A 3LNQA 5F1JA 3OYKA 3ESWB 2PEXA 3IWZA 1SMYF 3QPLA 5EEHA 5HLTA 2O8XA 5IOYA 2YR2A 2Z3YA 2LOOA 2VQCA 2Y75A 4RS8A 5JLWA 1JKPC 4G94A 3IUOA 1J0RA 3DP7A 4BHPA 1GDTA 4KMFA 2DOEA 5DV5A 5L3DA 2R5ZA 1KQ0A 5HOOA 3BG7A 4ZYHA 2W25A 1MKMA 2DPDA 2O9LA 2Z1DA 4RDUA 3GYHX 1Z9CA 1MJBA 4U87A 1I5ZA 3P5JA 2HTJA 3FISA 4CH7A 2J5PA 3F72A 2JJ7A 3MD2A 2HKOA 4PSXA 1XMKA 3ZQQA 3KFWX 2RNGA 4Y52J 4AU7A 1D0XA 3U2RA 3FF5A 3UNGC 3L2WA 4DIQA 3PO2J 4ENJA 3DLLF 2EWNA 3H0GJ 2IEKA 5DS9A 1QZEA 3OV8A 1I1GA 2CS3A 5LGTA 2PFBA 3PQJA 2XRNA 2AHQA 2X4HA 5BPDA 2LF8A 2MABA 3S3MA 2QQAA 4NQWB 1MZBA 1QZZA 2KISA 3HSEA 4G7OF 2VPLA 4U7BA 2STWA 3ZQ7A 2XB5A 2ZB9A 2PMZA 3FXOA 1FSHA 3I64A 4EEFG 3F22A 2CUEA 3HRSA 1LE8B 2XGDA 4MO7A 3F8BA 1X2MA 1JUMA 3KLNA 3W6JB 5D4RA 2H6CA 2K9LA 4XIDA 4XM3A 3G2BA 3LQRA 3ZPLA 3QYBA 1BI0A 2BYVE 3OYHA 3H35A 2DMNA 2FMLA 3G3ZA 4G9YA 2R93J 3CCVI 2O8KA 3ZN0A 2C6YA 2R7TA 3GTLJ 2NOJB 1FOYA 3M8EA 1JKRC 4IOCF 3H5RA 4D7NA 2O7OA 1OCPA 4N4NB 4D0PA 2J5OA 2NNYA 1X3WB 1X3ZB 1LVKA 1P4AA 2KRHA 5BQTA 4PJLA 4H0EA 1IV6A 4DNCA 2R4GA 1HLVA 3QP5A 2FNAA 2B0LA 3OIPA 2L4AA 2JPCA 3ERMA 1W36C 3CLOA 2H09A 4M6YA 3QPHA 4CHUA 3D1NI 1MBJA 5F0CA 3A02A 5D8KB 3QPTA 4S0HB 5LHGA 1FTTA 2ZNYA 4A3CJ 5GP9A 4JK1X 4RAFA 1GHCA 5KVRA 1RRJA 1F36A 2LK2A 4BHBA 2VKHA 3M1CA 1BR4A 2LY1A 3K70D 2B9SA 3MEXA 5GTIC 2MLGA 5K5OA 3G4SI 1TW2A 3LL7A 3R61A 3DV8A 1YJWI 4A0XA 2P6TA 2F5CA 2IGOA 2DN0A 1JE8A 1IAWA 5BS6A 3SFZA 5JR3A 2PMZN 2L7FP 1T38A 3K69A 4A3JJ 4GYGA 1NHAA 1PVEA 2DODA 1BW6A 3IKVA 2HOSA 1YJ9I 2WV0A 4OIQF 3BR3A 2TRTA 3BG6A 3Q5FA 2HDDA 3FMRA 2JUGA 2OTLI 2OZ6A 1G59A 2ECCA 4BQOA 4LG0B 2O3FA 5M5YJ 4DZJA 2K40A 3HC7A 1WFXA 2VBXA 3I55I 2WAFA 4DYCA 2OTJI 3TDUC 1HDPA 3WG7H 2HXIA 4HQEA 4I99C 4IPAA 4G6QA 5HDNA 4BACA 2MGQA 1MNDA 1DUXC 2VC1A 3FHNA 2HYGD 1T2KA 1J75A 1KQ9A 1SFUA 2NVXJ 1FJLA 3BG5A 1YS7A 1FSEA 1OKRA 4Y4RA 4YIIA 3CCMI 4HX8A 1HKTA 1YW7A 1JJ8C 3CDIA 2Y30A 4ZC3A 4HLYA 4BJ5C 1H8AC 1RI7A 3HG9A 1D1BA 2W00A 3VDXA 4A3EJ 3OR2C 2WTEA 3V7SA 2M2EA 5ERIA 4WWCA 2DDBA 1Y8RB 2X9DA 2KPMA 1YIOA 3G1LA 1D5VA 1R7JA 2A6HF 3CCYA 4LLNA 3A4CA 2D5VA 3QOPA 2VQGA 5TISC 4KDPA 3ML6A 4C3IJ 1SFEA 2QQ8A 1ON1A 1W7PD 2Q8KA 1MH4A 2MC3A 3V8LA 2K86A 1E0EA 2L3DA 2XAGA 5LGUA 5C4XJ 1LVAA 2OBPA 2GLOA 3K4MA 3F21A 2N8GA 4V2FA 2XGXA 5L3EA 1FYMA 3EUKL 5IT9Z 1DP7P 3BG9A 1ZHFA 1YRNA 1DQUA 2UV1A 3BDDA 1R71A 1IRXA 3DKWA 2P81A 2I10A 2L01A 3CCSI 1LFUP 2UUZA 4FHTA 3K4BA 1FLIA 3WODF 4R8HA 2DA7A 5FLXZ 2KDOA 4V2GA 4O5VA 1U2WA 4MFDA 5TGTA 3C3WA 3OYBA 2G7UA 4J00A 3FXMA 1WJFA 1VQ5I 1BL0A 1QHHD 3WTSC 1F9NA 3DCFA 2ESHA 4G8XA 3KP6A 2VJ5A 3GW2A 1YJNI 1ODDA 3HOVJ 2XC7A 5DD8A 3MQ0A 2VPRA 2Y0SA 2L7MP 5LRRA 3SZTA 2DXIA 1ZKGA 1RUOA 3S1NJ 2R7FA 2BY1A 4OMZA 3KP7A 2WY8Q 3E6BA 1TWGJ 3OY9A 3OYCA 3FXUA 3H5AA 4F7ZA 1UB9A 3AG1H 2MYSA 1K6YA 1S3JA 3I5UA 3O8GA 4MNUA 2LY2A 2Y9YA 4XLCA 3VB2A 4PJJA 5H2FC 3ZMTA 1IO2A 2QLZA 3KE2A 1Z7LA 3H9GA 1JGSA 2DMPA 2ZJ2A 2W4SA 2VB6A 2DOAA 2YX7A 3I3LA 3HOXJ 3VOEA 2DK5A 1USTA 4FX0A 1Q1VA 1YE9A 3CUOA 2EZKA 2X0LA 3IRRA 3BT9A 2Y31A 3DTIA 2B7EA 2ZNZA 2CWEA 2LKXA 1O7LA 2DOFA 3L09A 2ZBKA 1XC5A 4AYBN 1YITI 1KYWA 2M7BA 2Q0OA 4EJUA 4XLEA 3BCAA 2MBFA 1LDJA 4ITVA 4XLPF 2M8EA 1GV5A 4KIFA 4XRSA 4AVZA 2EBIA 1VI0A 2WAQA 5DM7F 4KT6A 1B8IB 4RGRA 1PJRA 1IF1A 1H9GA 1ONVA 1KA8A 2VJJA 1T8IA 3OS2A 2E1MB 3I53A 2WV1A 1J7KA 3C2GA 3S17J 1TT0A 2ZFUA 3RKQA 2K9QA 2ZC2A 5LGNA 2HZTA 4RB2C 3F3XA 4RMNA 3E6DA 1BR1A 4A0ZA 5KHDA 4FE4A 3WGIA 4B3XA 2Q1ZB 2R7ZJ 1MD0A 1UHMA 3SHFA 4KICA 4UV8A 2LR8A 1DDNA 3P9IA 3JRGA 4BBSJ 1YFHA 1X58A 1ZLJA 2QGUA 3IV5A 4BQQA 5GADJ 4MFEA 2VBZA 2PJRA 2IT0A 2ISYA 2OUMA 3F0CA 1E3HA 2XAQA 3KP2A 3BJ6A 2JMWA 3I71A 1TC3C 4YFXF 2CMPA 2OA4A 2VKEA 2TDXA 1ON2A 1H89C 4U0YA 4M3GA 1IXCA 5E3MA 1B59A 2BBYA 2CV0A 4Z2YA 2GWRA 2R5YB 1MMAA 3SZPA 5E8IA 2EV6A 3NWTA 1E17A 2PLYA 1R6RA 4KUMA 4L9VA 5J1RA 4PGHA 1FMVA 5HLHA 2GOMA 1UHSA 2ESNA 1IZ1A 2BZTA 1AKHA 3T8TA 4B4CA 4XLFA 1MSFC 3S16J 2Y0MA 2WB1N 1F5TA 1ZG5A 3Q0WA 4HX4A 1NTCA 5FROA 3BCBA 5J6XA 4DYQA 1F1ZA 1N77A 2F5DA 4A5NA 5J8FA 3KZYA 4M3FA 2JA2A 1SC7A 2LRDA 3MMYB 1PUEE 1YI2I 2IGMA 2XVCA 3DPTA 3GO5A 3EQLF 2L2OA 3K9TA 2IGKA 3MKYB 2CFXA 3IHUA 3HUGA 2NAZA 2L02A 1ZARA 5F0HA 5GAEJ 4E7HA 3JRCA 1MMNA 4LB5A 1GXQA 1MGTA 4LJZF 4GYIA 1T6SA 1TL8A 1ZRDA 1W7PA 1EA3A 4LB6B 3IH2A 3M4OJ 3WE3A 2WY7Q 4P55A 1G3YA 4C3HJ 1TQMA 4F91B 1DGRM 1IN6A 3GF2A 3GWZA 2XF6A 3HJEA 1WZ2A 2FRHA 1YW9A 4XL9A 4G6TB 5F0FA 2VKVA 4WCGA 1NG7A 2RN7A 4YFNF 1VQLI 1A5JA 1BW5A 2EA2A 3K4CA 3J80K 2HOEA 2LLKA 3H9QA 2KZVA 4EMSA 1ZH5A 2G0EA 3K0LA 2K9NA 1I39A 1XMAA 5J3LA 4HF1A 3ZMUA 3ABMH 3E7LA 4FCYA 2JVHA 4UUTA 1TZLA 2D45A 3B02A 2RGVA 4CCJA 4EV0A 2FEZA 1WI3A 3ULQB 4L5IA 3FX3A 2E1NA 1UCRA 4IRGA 4KFCA 2K85A 4XSXF 3BR6A 1OCCH 2E7WA 4MIMA 3IRQA 4E7IA 3QOEA 4Y15A 4ANJA 4M71A 1IN8A 3L1PA 4IHYA 2XDVA 2AQEA 3ZQFA 3CUQB 1SD7A 5ILSA 4L9NA 3IWFA 2DTRA 3DFGA 3FM3A 3ZXSA 4QTRA 1W5TA 4IHTA 2LC2A 5DDGA 1MBKA 2OCEA 2VXDA 3RKYA 1EH8A 1Z0XA 3FKJA 4DBQA 4F3QA 3JRIA 2LH9A 5L3BA 1A31A 5K7HA 1R23A 2FF4A 3MKLA 2UXNA 2ETHA 4NC7A 2XSDC 1R4NB 5H20A 4BGDA 1OCZH 4CCKA 5IT3A 2MA3A 4FQGA 4I76A 3FHZA 3FMQA 1BIAA 5CQEA 5DD4A 5J1YA 1WCMJ 4G6DA 2VOPA 3CCLI 4XSZF 2H8RA 4FTHA 1FP1D 4LLLA 4XKCA 4XQFA 1R5HA 3K6GA 1X3UA 3LFKA 3RQIA 2KDZA 4R1HA 4M9ZA 2EPFA 2PG4A 1V3FA 2DBBA 1S72I 4ZYDA 2D1VA 3IH4A 1NH3A 1D8JA 2JZYA 2R3SA 2X6WA 2BE5F 4AC0A 5EYRA 5DCMA 2FQ4A 5KK1A 2H94A 3FXLA 3JW4A 4FISA 1ETYA 1IN7A 2L9VA 4KYWA 1U8RA 2G7HA 3PJRA 3CJTB 3C1DA 1KU7A 1I1SA 2VBWA 4B3AA 5BNGA 4HDUA 2BXYA 2DK8A 3CC7I 3BP8A 3T1BA 4BQNA 5DM6F 4MTEA 4Q48A 5HS9A 4UUSB 3K1MA 3KIOA 2XAFA 2H27A 2EH3A 3BR1A 2XROA 3V8KA 2CFOA 4J19A 2ZXJA 4EM0B 2EINH 1OLTA 2E36A 2W48A 1WJEA 3CJRB 3L2VA 2CU7A 2HNHA 1LQ1A 3MZHA 5BPIA 4BQAA 1R4MB 4NHJA 1TQPA 3LFUA 4YIRX 4YELA 3HUGB 3FKIJ 3RPUD 2VOOA 1K78B 4YRVA 2KIQA 3KEOA 1JGGA 2A3SA 4XNFA 2BY3A 2YUSA 4I2OA 2R92J 2X6OA 3H0DA 1UG0A 3HTUA 5J1UA 1PUFA 3RCOA 3HOTA 2HGCA 4NNJA 1FIAA 4BEHB 4X0GA 1J59A 4E7JA 1BIBA 2YS9A 1ZG3A 3ZQIA 2IS6A 1Y39A 1S7EA 3DBRB 4S05A 3KP4A 3GFJA 1WKMA 2HTSA 4E7LA 4ESJA 1U5TA 2QWWA 5EGOA 1T39A 4B43A 3CDHA 4M9SA 1IDYA 5ICGA 1TLHB 3AG4H 2CV1A 2IA1A 3VYSB 4OU0A 3GMEA 4HSRA 1BOBA 5IT9K 4XORA 4XOPA 3F6VA 5D6FA 3OYEA 1RR8C 3FXQA 3PFIA 5JLXA 4ZH4F 2QENA 4W1UA 2XUBA 4GGGA 1ORKA 5FFXA 3ABTA 3S93A 1E3OC 2OAZA 1D0ZA 4HV6A 5AONA 5HNFA 5FRMA 1K4TA 1WSUA 1G3SA 2FBHA 3N05A 2W1OA 5KNLA 2ZMEA 1S7AA 1HC8A 3CJNA 3WHBA 2ELJA 2M0CA 3IKTA 3A0BC 5HNHA 1OQYA 4PCQA 5EJCA 4DQ2A 1REPC 4XRMA 1V5FA 4QWQA 1UG2A 4RLQA 1MMGA 2P7VB 1FOXA 2LSOA 1QVUA 3S15J 2R7WA 1SMTA 3CD6I 3S3OA 4E6KG 1WI9A 4R79A 2NVTJ 1QHGA 3GLXA 2FMYA 3AG3H 1MH3A 1Z3XA 4HOBA 5EG0B 3HGGA 3K4KA 2NS0A 1JT6A 3HRMA 5M3MJ 2KZGA 1MSEC 3E3VA 1R5GA 2DMUA 2JRTA 4MQVA 1S7OA 2FX0A 4XLAA 1R00A 2HR3A 4XKBA 3GBGA 1I6HJ 3X2QH 2LY9A 2BGCA 4CXFA 1IXRC 1MBFA 2CSOA 3CCQI 1ETXA 4BBRJ 2AQFA 3WTWC 2COMA 2I5UA 4I09A 2DMTA 1AOYA 1ZREA 3V7CA 1T0FA 2BVLA 4TV7A 2CO5A 2GZWA 4II3A 3SDGA 2CG4A 5E79C 3U9GA 2KKOA 2K5CA 1ETVA 1D5YA 5A2QZ 3KEQA 1TNSA 5K7ZA 2H6BA 1W36D 4XOTA 3W6KB 3R0AA 5F27A 4JOMA 4D1QA 4Y7NJ 3RYPA 3E97A 2M1BA 3LSJA 5E1ZB 4IQ4A 4BDYA 1XCBA 2L7ZA 4F93B 3DTKA 3K1NA 1VQOI 3VYTB 1D1AA 4UHTA 1JUPA 2F4IA 1K61A 2H1KA 1WJBA 1ULYA 4DYRA 3H3VK 1XSDA 4X1EA 4RB3C 3CCUI 1O3RA 2AO9A 1Q1HA 1IV8A 4BNCA 5EDNA 3V8JA 3DEEA 3UR3C 1FOKA 3J7AO 2HYFA 2DA5A 1HDDC 2M0MA 3K4NA 5EZHA 5B1AH 2ZJQF 3CO7C 2FU4A 2XF5A 5HDGA 4M6XA 3BPXA 3QYEA 1YTYA 2XHKA 3K4JA 2XPVA 1YRNB 1BI2A 2RNJA 2F5EA 5FLVA 2O6GE 3S8PA 3F8CA 5B3SH 3HXLA 3OYMA 4OMYA 3FMSA 3BJAA 4LG3A 4IXAA 2BVMA 3LQQA 1SD6A 4C9YA 4RBOA 3LSMA 4I7HA 3FBIB 2EZHA 1YS6A 2FBKA 3WG9A 3HL2A 2GIVA 2DFEA 1Z05A 1WJDA 1S8NA 3IH3A 2FBIA 3HM5A 4IL6C 1LFBA 4IO9F 4CGZA 2L5QA 1HF0A 3K2ZA 1W4MA 2WAQN 1SD4A 4YIFA 4WX9A 4ZZLA 2XAJA 1E2XA 1FBSA 4DW6A 2ISZA 1UHWA 4B09A 4RGUA 3I58A 1RR7A 4MEYF 3JAMZ 4C30A 1ETKA 2BOLA 4UB8C 3GTKJ 2EIMH 3HPHA 4B44A 2KHMA 2NVYJ 1MJAA 3Q9SA 3HDDA 4CZCA 2CUZA 3DBHB 3FK7A 4WXDA 1APLC 5B5EC 4KN4X 4OIOF 1OISA 4Y13A 2YU9J 2QKMB 2FNPA 2RV8A 1WGXA 3I54A 4IF4A 1VF9A 3U1DA 2QQ9A 4IX7A 2OC6A 3DLAA 3HEFA 2FQ3A 4CCMA 3S1MJ 3QWLA 4P1WA 2FSWA 3GCMA 3QP6A 2ELHA 3ZQHA 2G9WA 3OYNA 4HF2A 2XB0X 5DCFA 1BBYA 3SXYA 1MMDA 1SFKA 3DBLB 3TOBA 1O7FA 3ECOA 3VSLA 3CP8A 1IRGA 2VBYA 1FNNA 1RKTA 3TW7A 4BKXA 1KU2A 1TWHJ 4M6VA 1YX3A 2V1NA 5GTHC 5E3NA 2WA0A 3SEQA 3ZP5A 4KIGA 3QAHA 3SQNA 2KJCA 4L0ZB 1K78A 3DXJF 1MIJA 2HI3A 2BXZA 4C2MJ 3MFKA 2VONA 2P5KA 4ZDPA 1QNTA 3GTMJ 3COAC 4RGSA 4OIRF 5LHHA 5FB2A 2L7KA 3PO3J 3ZQCA 1D3YA 2HOAA 2QBYB 3CCJI 1SFOJ 4PDKA 3R60A 5GAGJ 2GA1A 3VFZA 3CTAA 3WHCA 2JSPA 4HQMA 2XF7A 4L5EA 2H8WA 2E2HJ 3J80Z 1U78A 3VWBA 3TEDA 1RETA 2HKXA 2M3AA 4N4OB 3SEZA 3AG2H 1U9OA 2PBIA 2DA1A 4A2UA 2I8DA 5JFRA 1R1TA 2W7NA 4AIKA 3QODA 3R6SA 2DW4A 2DYSH 5JHUA 4UVCA 4I0BA 2CQXA 2XASA 4PK4A 1OYWA 1KU9A 4NB5A 5J8CA 1XGNA 3QU3A 2P6SA 2GQQA 4MHGA 2QYOA 5LFAA 3KP5A 4EATA 2XAUA 3J81Z 4M74A 3TBIA 1Y0NA 2FJ1A 3TL4X 4BXFA 4CCOA 2GOXB 3E0JB 2DMQA 4M72A 3TMOA 4ASNA 1O4XA 3D5RC 1Z91A 1HA8A 1VQPI 4B1RA 5IP7J 2JA5J 2RDPA 1UELB 4MLOA 4CSWA 1V5EA 2M5WA 3E6MA 2LP0A 3KPHA 3REOA 1XDSA 2HS5A 4L18B 1GLNA 5HLGA 1Z6TA 1SAXA 3Q0UA 2FXAA 2KFDA 3OR1C 1TWCJ 1ZYRF 2W84A 3K7AJ 3B6AA 1S6LA 2L9SA 2VASA 5ILVA 3GEZA 4L5JA 2IW5A 4HNTA 3HHHA 1YOVB 3I0TA 3BC8A 3LOCA 2Z16A 2F2EA 1HXDA 2XKOA 4LK0F 4BY7J 3FZVA 2DFHA 2RQPA 4IHXA 1R1UA 2JA8J 3EPZA 1VQNI 3T8RA 3R4KA 4BS9A 3SYTA 3HKZN 1MBEA 1FZPB 1XSXA 5ICEA 3RDIA 4BL0B 1IC8A 4D9JA 3CUQA 1AA7A 5FD5A 1N75A 4XLHA 2GIZA 3VSKA 3LSPA 1E3PA 1J09A 2W82A 5FLMJ 3MKZA 5CKTA 2IGNA 1A6QA 3BTCA 1STZA 2L9NA 3L2UA 2P7CB 4XONA 2ZSHB 1B8IA 4EQQA 4BDZA 5FKMA 4LG0A 2GA2A 1MJ9A 1ZN2A 1ZAOA 2JQ7A 4JBAA 4RAGA 1SEUA 4E70A 5M3FJ 4ESFA 2KMUA 1XTAA 1FP2A 2DJIA 2L0KA 3JSPA 4ZDLA 1DGWY 2JPBA 1J9IA 1RUNA 3CMYA 1OCRH 2DFFA 3H3UA 3Q0VA 3RKXA 3FIWA 4ENNA 3HOUJ 4MQ9F 2A6TA 4A3BJ 3SFIA 2ADUA 3CLQA 3S2WA 4EJOA 5EZGA 3BZ6A 4D5FA 3JRAA 4L0YB 3CC2I 2Z2SB 3ZGKA 4O3MA 2V9PA 2KT0A 3G1OA 3MCZA 5AIPA 1FOWA 3CMMA 1H88C 1CGPA 2E2JJ 4ENMA 2CUFA 3EETA 1P92A 2ME0A 3OS1A 4U0WA 2FD5A 4CUGA 2B63J 1KQ8A 2CRGA 2WBMA 1YO5C 3WE2A 4KMUX 4LIUA 2E2IJ 4E4HA 3H3ZA 1LEAA 4L9TA 5CVIA 3B73A 2WWYA 5FFZA 3BTLA 3O8HA 1HW1A 3EUHC 1K79A 4QLCU 2MD5A 3JRFA 3KYCB 1S5LC 1WVRA 2EA4A 1A36A 4M3EA 4BE0A 4U88A 1RKWA 2EQRA 1P7IA 2VE8A 3KCCA 1FTZA 2E35A 3MKWB 4IKFA 4XKVA 3GZ5A 2V79A 4B47A 3PNYA 2IVMA 3JRDA 1FYLA 2IS2A 1OMIA 1OR7C 5E17F 3R0JA 2R5YA 4HLXA 5D5VB 3RQ4A 1EKEA 2VT2A 5M5XJ 2K27A 4JX4A 4OWRB 3WTYC 2EILH 4I01A 2IA2A 1HSTA 4Y17A 3ZOBA 1FEXA 4IHVA 2K9MA 2E1MC 4E7KA 3LSKA 1A35A 1Y1VJ 3L2CA 3HTSB 4FT8A 1W0TA 2O5RA 5TJJA 3RZOJ 1X2NA 4HW0A 2WADA 3ZR8X 3BWGA 4AVPA 4RB0A 1S9HA 2CJJA 1P2FA 1X1AA 4DOZA 4EGZA 2M45A 1WPKA 3V42A 4AWXB 2XIGA 1ZK8A 2KRFA 2EZLA 4OIPF 3ASOH 3BTJA 4PJ0C 3L9FA 4N9IA 5FKNA 2IXSA 2M4GA 4K2EA 2QF7A 2X51A 4PSWA 1WJAA 3BY6A 2AS5F 1T98A 2EIJH 3MN2A 4ZTFA 1U5TB 4HRIA 4PFPA 2K4BA 5HVQC 1ZTRA 3GTJJ 2PQ8A 3GTOJ 2VJIA 4ENKA 3K10A 1ZQ3P 4NC6A 2KLOA 2TCTA 3EYYA 5CQGA 5IP6A 1JXSA 1POGA 3PUBA 4EJTA 2R7SA 4NC8A 1FMWA 9ANTA 3VEPA 2QQBA 3ECHA 3CDLA 2VIXA 4A6DA 5IYCJ 1JTXA 2LMDA 4KISA 5FD6A 4XLNF 3LSHA 1LPQA 3HBLA 4Q5SF 3WGGA 2QBYA 4I6ZA 2BW3A 1KGSA 2JVGA 4D7MA 2OQGA 2DQRA 2YPRA 5B1BH 4HYEA 3WTZA 2STTA 1YYVA 3E5UA 4HAMA 2P4WA 2XPWA 2V26A 2DA4A 3K2AA 4JQFA 1AU7A 2L9RA 3LAPA 2V1DA 2VODA 1X19A 3TO6A 3RKWA 1H0MA 2DT6A 2HOTA 1LDKB 3E5XA 2OQRA 2UWMA 2E19A 1YIJI 2Q2EB 1JKOC 3KZIC 4WXCA 2GXGA 5JVGF 1G4DA 3HHGA 5F64A 2PX9A 3WU2C 4RGXA 4EJVA 3WU0A 1V5GA 5M5WJ 1GVDA 3BPVA 4HG2A 2HZDA 2NS7A 2XKPA 2X1DA 1QRYA 5DTDA 4ETSA 2CUJA 1FIPA 1BOAA 2QKLB 3PIPF 3GZ6A 2VL8A 3BZKA 3CP2A 2NOGA 3F9KA 3M1EA 1YG2A 4PZJA 3JTHA 3W6VA 2DYRH 2ZKZA 1MBHA 4MTDA 2ZXHA 3BR5A 3ABKH 1JTYA 5EF6A 2LVSA 3KEYA 2R7UA 4JX6A 5AIQA 2NVUB 2DJNA 1GV2A 4IEJA 3NWSA 1B9MA 1OPCA 1FC3A 3FXJA 3KYDB 3GFMA 4FETA 3MZYA 3S1RJ 3HOYJ 4HA8A 2ZXWH 2HVSA 3L7WA 1HOMA 2ID6A 1VQKI 4Q47A 1VZ0A 2VJ4A 4UV9A 2DT7B 3LSTA 3U1KA 3LSRA 1D8KA 2M30A 4ZJZA 2LBFA 2AXLA 4G7HF 1YHQI 3ZCOA 3ZMSA 4XN3A 4IHSA 2CQNA 3F8NA 3H9JA 5E3OA 4DJAA 5J4VA 3TW6A 1R9TJ 2PN6A 3ROUA 3WTVC 5L3FA 3OWTA 3OS0A 1CQTA 1IGNA 2ECBA 2K3PA 2F5FA 3OSGA 5HS8A 1UMQA 1Z77A 2VQLA 3W2AA 2PI0A 5EEAA 1XGSA 4HNUA 3M8JA 1R1VA 4HBLA 5FGMA 4KN7X 2DDAA 3HRUA 3RI4A 2M4KA 5ED4A 4RA2A 1QPIA 3J7YJ 5CLSA 5IOZA 1TNTA 2XGCA 5D5WB 1U3EM 4A12A 4XRFA 5HLIA 3HKZA 3LSGA 4FE7A 3BTIA 4ON0A 3J7ZI 1F4KA 2M34A 1M1EB 3RJPA 2JUCA 4ZYEA 2RAEA 3F8FA 1RIOH 1WJ5A 3SJMA 3P9KA 5EEGA 5DUIA 1BJZA 3WTTC 3AAFA 1LUJB 3HB9A 1BC7C 2IRFG 5H6RA 1PUFB 3CF5F 4A6EA 3V7RA 3B6CA 1BI1A 2P5LC 2OD5A 2CW7A 2XSJC 1WWXA 4HPQA 1X1PA 3SZGA 1BN5A 1MNEA 4OOIA 3G73A 4G12A 2LREA 2EJRA 5A2QK 2KQRA 3C7JA 1FBQA 4PGGA 4E7ZA 2JA7J 2VC0A 2HYJA 4A3KJ 2LDUA 3DWLE 2E1OA 1YW8A 3RPQA 5CVJA 1SANA 1O3QA 4BE2A 2YX4A 3ZRGA 5LLQA 3P7NA 2E60A 4OINF 3A0HC 2ZCWA 2GBYA 1O3TA 3OL3A 4U7DA 4LOCA 4ZYGA 3M8FA 4O6JA 1B72A 4HDVA 2DA2A 5L3CA 2LD5A 4IRIA 5JVTA 1FPQA 4KIBA 1UJ8A 1MW7A 3GTGJ 3QPSA 1I3QJ 2LNBA 3FXKA 4KITB 3QYFA 3OYIA 1QVTA 1W5SA 3U21A 4IZZA 1O3SA 2DT5A 3LWFA 2CQKA 1GUUA 4KA4A 2CW8A 5J40A 4HSTA 2GAUA 1N25A 4CYCA 2OJED 3RYRA 4CA0A 1DPUA 4KT5C 4XMYA 1KU3A 5K1YA 4CYCB 3PSIA 1Z67A 1SVLA 1IUFA 4HZFA 3O2PE 1OYYA 2BEOA 3GFIA 2R7DA 4B8XA 3A01B 2Z99A 2A5YB 2VKDA 4P5OA 3H92A 3L2RA 1B72B 3ASNH 3TO9A 1QBJA 3I4PA 2BHZA 1IN4A 3ELKA 4ZYAA 3EDPA 1G2HA 2RKHA
chains in the Genus database with same CATH topology
1IW7F 4KNYA 3NRVA 3WTXC 4AIHA 2Q2EA 2DFIA 1Z6RA 2V9VA 1HKSA 1J2XA 3LA2A 5D6EA 1MDMA 2KJBA 2HFHA 1WRJA 2HQNA 4P96A 5FLXK 1L3LA 1IXSB 2ZO4A 2FOKA 5LEJA 1LNWA 2W24A 4IRHA 3TOAA 3T5XA 2L54A 2K02A 3Q9VA 4ESBA 2EV0A 3DPLC 3HIFA 4A0YA 4AD9A 5DEQA 4LGWA 3KLOA 4HF0A 3ZMVA 5LRSA 1PP8F 2RVCA 2IA0A 2Z5UA 5ILUA 1S29A 5CYVA 1LB2A 1HKQA 3I59A 2MH2A 2MH9A 3RPUA 3D5LA 2QVOA 2OU2A 3IL2A 1XSVA 1B9NA 2NRAC 1OR7A 2E1CA 4G7ZF 1K6OA 1Z1DA 3HSRA 3C18A 2EFQA 2DI3A 2KIFA 2PJPA 3PQKA 1HBXG 1XGOA 3BROA 2UXXA 5HS7A 3E5QA 5H6QA 3CO6C 4EGYA 2D2WA 1SFXA 3TO7A 1RNLA 1TQIA 3JTGA 3TQNA 5E1WA 1ZRCA 1YQAA 4M73A 4FX4A 1BC8C 1HW2A 1I27A 2E7XA 1V4RA 5CVUA 1XDUA 3TKYA 4BYYA 1FT9A 2RC4A 4BAYA 3GVAA 4N0BA 1U6GA 4BHCA 1C0WA 4I98B 5FO5A 4N9HA 4I0AA 5K5RA 1TTYA 1ZG1A 2P8TA 5TRDA 1FYKA 2HDCA 2KIMA 1O57A 1EH7A 3BOQA 4GXOA 1I6XA 1IUYA 2L4MA 2A69F 4LMYA 1RZ4A 3RIRA 4L9JA 3DQVC 2EFOA 3LAJA 2UZKA 4EM2A 5CJ9A 5DCMB 1UFMA 3ZMDA 2IPQX 3FM5A 5DUKA 3O6BB 1DPRA 2W57A 1J5YA 1QZYA 2GXBA 4NQWA 4EJWA 1G3WA 2JTVA 3D0SA 5D5UB 1JHHA 5E8GA 3ZMZA 1XCVA 5D8LB 2M87A 1XGMA 4RAYA 1GXPA 1BM9A 2CW0F 2XV4S 3KETA 2P5VA 2V1UA 2YSRA 4UNOA 1ZGAA 2Y48A 3GX4X 1W7PB 2A07F 5LHIA 4U0VA 4P9FA 2DPUA 2JT1A 3JSOA 3F23A 2EK5A 3QU6A 1HSJA 1B1BA 5E18F 5LBQA 5DYMA 3ERED 2OZUA 3HYIA 1EH6A 1IRFA 1LEBA 3DEUA 2O0YA 4ZZDA 3IC7A 2FE3A 4S04A 1CF7A 2KIUA 2PMHA 3CUQC 3F6OA 4CZZA 2ZFWA 3WTUC 3WGHA 3M9AA 1YLFA 1B6AA 1FX7A 1R36A 1IN5A 1LJ9A 1L0OC 2QZ8A 4WXHA 4CO8A 4A5MA 2EV5A 5L3GA 2ZMEB 1ZGJA 4LFUA 6PAXA 3MWMA 2JSCA 1P6RA 2YU3A 1ZRFA 1Z7UA 2Z33A 3GUDA 5D5XB 3K1PA 3EUHA 1R22A 3HRTA 4YG2F 4WK8F 3JAMK 5E1XA 1TBXA 2A61A 3V4GA 2K4JA 4CYDA 1JHFA 1KYZA 1AWCA 2DLLA 2BV6A 4IJAA 5K5QA 2NYXA 5BOXA 1A04A 1G3TA 1HQCA 3LA3A 3WU1B 3I59B 3HSFA 3ABUA 1OYIA 1Y0UA 3T0YA 1LDDA 2HEOA 3NQOA 3MAJA 2XAHA 5F6FA 5ICFA 4XBFA 4BH9A 4I02A 3GFLA 4P9UA 3N4MA 2EFNA 3N97A 5D4SA 3RTRA 2A68F 5CVVA 4EVIA 1HW5A 4GO1A 1K7AA 1CF7B 2MLKA 3BJOA 1ZLKA 1SD5A 5CVRA 2ACJA 2CYYA 5ICCA 2Z9OA 3DF8A 2FA5A 1PDNC 4UVAA 3L00A 2DU9A 1R58A 5LEKA 1FBUA 3F8MA 2EB7A 2DAOA 1P4WA 2HQRA 2PMUA 3ISPA 1B4AA 3NEUA 5F1RA 1USSA 4BXUA 2EFWA 4CDGA 2DQLA 3P9CA 1FWZA 1EV7A 3VODA 2QM3A 4RAZA 2K7LA 4WF2A 2VE9A 4LD5A 2VXZA 1QPMA 4MGRA 4RB1A 4AIJA 1QQIA 3O3KA 4YFKF 5E20A 3TGNA 1GVJA 2LF7A 4LLGF 3FWEA 1P4XA 2O03A 1QGPA 4GCVA 4LK1F 1H9TA 2WC2A 4HX7A 4HV5A 2IJLA 2NNNA 5JI6A 3EYIA 2W85A 2EFPA 1U5TC 5BMZA 3KZZA 4UVBA 2QUFA 1MDMB 2DO7A 3HOSA 2O61A 4UXNA 1BI3A 1G6NA 2HWVA 3J81K 3LA7A 4CICA 1BJAA 3FXRA 4UUVA 4IVNA 4Q4ZF 3ZN1A 1WQ2A 1XB4A 1PP7U 1QO0D 3M7GA 4EM1A 3E6CC 2CGPA 5HDKA 1XD7A 4M9XA 2D1HA 3QRFF 3KP3A 2LKPA 3OOPA 2VN2A 4MEXF 2V6CA 2VT3A 3TDZC 3GXOA 1FY7A 2V1XA 2A6EF 1XN7A 1VTNC 2IP2A 1TW3A 2PEXA 3IWZA 1SMYF 5EEHA 2O8XA 2YR2A 2Z3YA 2Y75A 4RS8A 4G94A 1J0RA 3DP7A 4BHPA 4KMFA 5DV5A 5L3DA 1KQ0A 5HOOA 4ZYHA 2W25A 1MKMA 2DPDA 3GYHX 1Z9CA 1MJBA 1I5ZA 2HTJA 2J5PA 3F72A 2HKOA 1XMKA 3KFWX 3U2RA 3FF5A 4ENJA 2EWNA 3OV8A 1I1GA 5LGTA 2PFBA 3PQJA 2XRNA 2X4HA 5BPDA 2LF8A 2QQAA 1MZBA 1QZZA 4G7OF 3HSEA 4U7BA 2STWA 3ZQ7A 1FSHA 3I64A 3F22A 3HRSA 3F8BA 3KLNA 3W6JB 5D4RA 2H6CA 3LQRA 3ZPLA 1BI0A 2BYVE 2FMLA 4G9YA 3G3ZA 3ZN0A 2C6YA 3M8EA 4D0PA 2J5OA 2NNYA 1P4AA 5BQTA 4H0EA 4DNCA 3QP5A 2FNAA 2B0LA 2L4AA 2JPCA 3CLOA 2H09A 4M6YA 3QPHA 4CHUA 5D8KB 3QPTA 5LHGA 2ZNYA 4JK1X 1GHCA 5KVRA 4BHBA 3MEXA 2MLGA 5K5OA 1TW2A 3R61A 3DV8A 4A0XA 2P6TA 2F5CA 1JE8A 1IAWA 5BS6A 3SFZA 5JR3A 1T38A 3K69A 4GYGA 1NHAA 3IKVA 4OIQF 2WV0A 3Q5FA 3FMRA 2OZ6A 4LG0B 2O3FA 2VBXA 3TDUC 4HQEA 4IPAA 4G6QA 5HDNA 1DUXC 2VC1A 2HYGD 1T2KA 1J75A 1KQ9A 1SFUA 1YS7A 1FSEA 1OKRA 4YIIA 1HKTA 4HX8A 1YW7A 4HLYA 1RI7A 2WTEA 3V7SA 5ERIA 4WWCA 1YIOA 1D5VA 1R7JA 2A6HF 4LLNA 3QOPA 4KDPA 3ML6A 1SFEA 2Q8KA 1ON1A 1W7PD 2MC3A 3V8LA 2K86A 2L3DA 2XAGA 5LGUA 1LVAA 2OBPA 3F21A 2XGXA 5L3EA 1FYMA 5IT9Z 1DP7P 1ZHFA 3BDDA 3DKWA 2L01A 4FHTA 1FLIA 3WODF 4R8HA 5FLXZ 4O5VA 1U2WA 3C3WA 2G7UA 3WTSC 1F9NA 2ESHA 4G8XA 3KP6A 3GW2A 1ODDA 5DD8A 3MQ0A 5LRRA 3SZTA 1RUOA 2R7FA 4OMZA 3KP7A 3E6BA 3FXUA 4F7ZA 1UB9A 1S3JA 3I5UA 4MNUA 3VB2A 3ZMTA 2QLZA 3KE2A 1JGSA 2ZJ2A 2YX7A 3VOEA 2DK5A 1USTA 4FX0A 3CUOA 2X0LA 3IRRA 2ZNZA 2CWEA 1O7LA 3L09A 2ZBKA 1KYWA 2Q0OA 4EJUA 2MBFA 1LDJA 4XLPF 2M8EA 4KIFA 4RGRA 1IF1A 1H9GA 1ONVA 1KA8A 3I53A 1J7KA 5LGNA 2HZTA 4RB2C 3F3XA 3E6DA 4A0ZA 3WGIA 1MD0A 1UHMA 3SHFA 4KICA 4UV8A 1DDNA 3P9IA 1YFHA 1ZLJA 2VBZA 2IT0A 2ISYA 2XAQA 3KP2A 3BJ6A 3I71A 4YFXF 2OA4A 2TDXA 1ON2A 4U0YA 1IXCA 1B59A 2BBYA 4Z2YA 2GWRA 3SZPA 5E8IA 2EV6A 1E17A 2PLYA 4KUMA 4L9VA 4PGHA 5HLHA 2ESNA 1IZ1A 3T8TA 2Y0MA 1F5TA 1ZG5A 4HX4A 5J6XA 1F1ZA 2F5DA 4A5NA 5J8FA 3KZYA 1PUEE 2XVCA 3DPTA 3GO5A 3EQLF 3K9TA 2CFXA 3IHUA 3HUGA 2NAZA 2L02A 1ZARA 4LB5A 1GXQA 1MGTA 4LJZF 4GYIA 1T6SA 1ZRDA 1W7PA 4LB6B 3WE3A 4P55A 1G3YA 1TQMA 1IN6A 3GF2A 3GWZA 2FRHA 1YW9A 4WCGA 2RN7A 4YFNF 2EA2A 3J80K 2HOEA 4EMSA 1ZH5A 3K0LA 1XMAA 4HF1A 3ZMUA 2D45A 3B02A 2RGVA 4EV0A 2FEZA 3ULQB 4L5IA 3FX3A 2E1NA 1UCRA 4IRGA 4KFCA 4XSXF 2E7WA 3IRQA 4Y15A 4M71A 1IN8A 3CUQB 1SD7A 5ILSA 4L9NA 3IWFA 2DTRA 3DFGA 3FM3A 1W5TA 4IHTA 5DDGA 3RKYA 1EH8A 5L3BA 1R23A 2FF4A 2UXNA 2ETHA 5H20A 5IT3A 2MA3A 3FHZA 3FMQA 1BIAA 5DD4A 4G6DA 2VOPA 4XSZF 1FP1D 4LLLA 1R5HA 1X3UA 3LFKA 4R1HA 4M9ZA 2PG4A 1V3FA 2DBBA 4ZYDA 2D1VA 1D8JA 2JZYA 2R3SA 2BE5F 5DCMA 5KK1A 2H94A 3JW4A 1IN7A 4KYWA 1U8RA 2G7HA 3C1DA 1KU7A 1I1SA 2VBWA 4HDUA 2DK8A 3BP8A 3T1BA 4MTEA 4Q48A 5HS9A 3K1MA 2XAFA 2H27A 2XROA 3V8KA 2ZXJA 4EM0B 1LQ1A 3MZHA 5BPIA 4BQAA 4NHJA 1TQPA 2VOOA 1K78B 3KEOA 2A3SA 4I2OA 3HTUA 3HOTA 2HGCA 1J59A 1BIBA 1ZG3A 4S05A 3KP4A 3GFJA 1WKMA 2HTSA 4ESJA 1U5TA 2QWWA 1T39A 3CDHA 4M9SA 5ICGA 1TLHB 2IA1A 4OU0A 5IT9K 3F6VA 5D6FA 3FXQA 3PFIA 4ZH4F 2QENA 2XUBA 4GGGA 5FFXA 3ABTA 2OAZA 4HV6A 5AONA 1WSUA 1G3SA 2FBHA 2ZMEA 1S7AA 3CJNA 3IKTA 4PCQA 4DQ2A 1REPC 4QWQA 2P7VB 2LSOA 1SMTA 1WI9A 4R79A 3GLXA 2FMYA 4HOBA 2NS0A 3HRMA 3E3VA 1R5GA 2JRTA 4MQVA 1S7OA 1R00A 2HR3A 2BGCA 4CXFA 1IXRC 2CSOA 3WTWC 2COMA 4I09A 1AOYA 1ZREA 3V7CA 1T0FA 4TV7A 2CO5A 2GZWA 3U9GA 2CG4A 2KKOA 5A2QZ 3KEQA 1TNSA 2H6BA 3W6KB 3R0AA 3RYPA 3E97A 2M1BA 5E1ZB 1XCBA 3K1NA 4UHTA 1ULYA 1XSDA 4RB3C 1O3RA 1Q1HA 4BNCA 3V8JA 1FOKA 3J7AO 2HYFA 3CO7C 2FU4A 5HDGA 4M6XA 3BPXA 1YTYA 2XHKA 1BI2A 2RNJA 2F5EA 2O6GE 3F8CA 4OMYA 3FMSA 3BJAA 4IXAA 3LQQA 1SD6A 4I7HA 1YS6A 2FBKA 3WG9A 2GIVA 1Z05A 1S8NA 2FBIA 4CGZA 3K2ZA 1W4MA 4YIFA 1SD4A 4WX9A 4ZZLA 2XAJA 1E2XA 1FBSA 2ISZA 1UHWA 4B09A 4RGUA 3I58A 4MEYF 3JAMZ 1MJAA 3Q9SA 4WXDA 4KN4X 4OIOF 4Y13A 2FNPA 2RV8A 3I54A 4IF4A 3U1DA 2QQ9A 2FQ3A 2FSWA 3QP6A 2ELHA 2G9WA 4HF2A 5DCFA 1BBYA 3SXYA 3TOBA 1O7FA 3ECOA 1IRGA 2VBYA 1FNNA 1KU2A 3ZP5A 4KIGA 3QAHA 3SQNA 2KJCA 4L0ZB 1K78A 3DXJF 3MFKA 2VONA 2P5KA 1QNTA 3COAC 4RGSA 4OIRF 5LHHA 5FB2A 1D3YA 2QBYB 4PDKA 3R60A 2GA1A 3VFZA 3CTAA 4HQMA 3J80Z 1U78A 2HKXA 2PBIA 4A2UA 5JFRA 1R1TA 4AIKA 3R6SA 2DW4A 5JHUA 4UVCA 4I0BA 2XASA 1OYWA 1KU9A 4NB5A 5J8CA 1XGNA 3QU3A 2P6SA 2GQQA 4MHGA 2QYOA 3KP5A 3J81Z 4M74A 4M72A 4ASNA 1Z91A 2RDPA 2M5WA 3E6MA 3REOA 1XDSA 2HS5A 4L18B 5HLGA 1Z6TA 1SAXA 2FXAA 1ZYRF 2W84A 1S6LA 5ILVA 3GEZA 4L5JA 2IW5A 3HHHA 3I0TA 2F2EA 1HXDA 2XKOA 4LK0F 3FZVA 2RQPA 1R1UA 3T8RA 3R4KA 1FZPB 1XSXA 5ICEA 3RDIA 3CUQA 5FD5A 1STZA 2P7CB 4EQQA 4LG0A 2GA2A 1MJ9A 1ZN2A 1ZAOA 4JBAA 4E70A 4ESFA 1FP2A 3JSPA 2JPBA 1J9IA 1RUNA 3H3UA 3RKXA 4ENNA 4MQ9F 2ADUA 3S2WA 4EJOA 3BZ6A 4L0YB 4O3MA 3MCZA 5AIPA 1CGPA 4ENMA 3EETA 1P92A 4U0WA 1KQ8A 1YO5C 3WE2A 4KMUX 3H3ZA 1LEAA 4L9TA 5CVIA 3B73A 2WWYA 5FFZA 1K79A 1HW1A 4QLCU 2MD5A 2EA4A 4U88A 2VE8A 3KCCA 3GZ5A 2V79A 2IVMA 1FYLA 5E17F 1OMIA 3R0JA 4HLXA 5D5VB 2VT2A 2K27A 3WTYC 4Y17A 4I01A 2IA2A 1HSTA 3L2CA 3HTSB 4FT8A 5TJJA 4HW0A 3BWGA 4AVPA 4RB0A 1P2FA 4EGZA 2M45A 4AWXB 2XIGA 2KRFA 4OIPF 3L9FA 4N9IA 4K2EA 3BY6A 2AS5F 1T98A 1U5TB 2K4BA 5HVQC 2PQ8A 4ENKA 3EYYA 1JXSA 4EJTA 3VEPA 2QQBA 3ECHA 4A6DA 5FD6A 4XLNF 4Q5SF 3WGGA 2QBYA 1KGSA 2OQGA 2DQRA 2YPRA 4HYEA 3WTZA 2STTA 1YYVA 3E5UA 4HAMA 2P4WA 4JQFA 3LAPA 2V1DA 2VODA 3TO6A 3RKWA 1H0MA 1LDKB 3E5XA 2OQRA 2UWMA 4WXCA 2GXGA 1G4DA 3HHGA 5F64A 4EJVA 4RGXA 3WU0A 3BPVA 2XKPA 4ETSA 1BOAA 3GZ6A 3M1EA 1YG2A 4PZJA 3JTHA 2ZKZA 4MTDA 5AIQA 1B9MA 1OPCA 1FC3A 3GFMA 3MZYA 4HA8A 3L7WA 4Q47A 4UV9A 3LSTA 1D8KA 2M30A 2AXLA 4G7HF 3ZMSA 4IHSA 3F8NA 2PN6A 3ROUA 3WTVC 5L3FA 2F5FA 5HS8A 2PI0A 1XGSA 1R1VA 4HBLA 5FGMA 4KN7X 3HRUA 3RI4A 5ED4A 5CLSA 1TNTA 5D5WB 1U3EM 4A12A 4XRFA 5HLIA 4ON0A 1F4KA 3RJPA 4ZYEA 3F8FA 1RIOH 1BC7C 3P9KA 5EEGA 5DUIA 3WTTC 3AAFA 2IRFG 5H6RA 4A6EA 3V7RA 1BI1A 2P5LC 2OD5A 1WWXA 1BN5A 4OOIA 3G73A 2EJRA 5A2QK 3C7JA 1FBQA 4PGGA 2VC0A 2LDUA 1YW8A 3RPQA 5CVJA 1O3QA 2YX4A 5LLQA 3P7NA 4OINF 2ZCWA 1O3TA 4U7DA 4ZYGA 3M8FA 4O6JA 4HDVA 5L3CA 4IRIA 5JVTA 1FPQA 4KIBA 2LNBA 1W5SA 1O3SA 2DT5A 3LWFA 2CQKA 4KA4A 2GAUA 3RYRA 1DPUA 4KT5C 1KU3A 5K1YA 4HZFA 3O2PE 1OYYA 2BEOA 3GFIA 2R7DA 4B8XA 2Z99A 2A5YB 4P5OA 3H92A 3TO9A 1QBJA 3I4PA 1IN4A 3ELKA 3EDPA 2RKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 F;  4KNY A;  3NRV A;  3WTX C;  4AIH A;  2Q2E A;  2DFI A;  1Z6R A;  2V9V A;  1HKS A;  1J2X A;  3LA2 A;  5D6E A;  1MDM A;  2KJB A;  2HFH A;  1WRJ A;  2HQN A;  4P96 A;  5FLX K;  1L3L A;  1IXS B;  2ZO4 A;  2FOK A;  5LEJ A;  1LNW A;  2W24 A;  4IRH A;  3TOA A;  3T5X A;  2L54 A;  2K02 A;  3Q9V A;  4ESB A;  2EV0 A;  3DPL C;  3HIF A;  4A0Y A;  4AD9 A;  5DEQ A;  4LGW A;  3KLO A;  4HF0 A;  3ZMV A;  5LRS A;  1PP8 F;  2RVC A;  2IA0 A;  2Z5U A;  5ILU A;  1S29 A;  5CYV A;  1LB2 A;  1HKQ A;  3I59 A;  2MH2 A;  2MH9 A;  3RPU A;  3D5L A;  2QVO A;  2OU2 A;  3IL2 A;  1XSV A;  1B9N A;  2NRA C;  1OR7 A;  2E1C A;  4G7Z F;  1K6O A;  1Z1D A;  3HSR A;  3C18 A;  2EFQ A;  2DI3 A;  2KIF A;  2PJP A;  3PQK A;  1HBX G;  1XGO A;  3BRO A;  2UXX A;  5HS7 A;  3E5Q A;  5H6Q A;  3CO6 C;  4EGY A;  2D2W A;  1SFX A;  3TO7 A;  1RNL A;  1TQI A;  3JTG A;  3TQN A;  5E1W A;  1ZRC A;  1YQA A;  4M73 A;  4FX4 A;  1BC8 C;  1HW2 A;  1I27 A;  2E7X A;  1V4R A;  5CVU A;  1XDU A;  3TKY A;  4BYY A;  1FT9 A;  2RC4 A;  4BAY A;  3GVA A;  4N0B A;  1U6G A;  4BHC A;  1C0W A;  4I98 B;  5FO5 A;  4N9H A;  4I0A A;  5K5R A;  1TTY A;  1ZG1 A;  2P8T A;  5TRD A;  1FYK A;  2HDC A;  2KIM A;  1O57 A;  1EH7 A;  3BOQ A;  4GXO A;  1I6X A;  1IUY A;  2L4M A;  2A69 F;  4LMY A;  1RZ4 A;  3RIR A;  4L9J A;  3DQV C;  2EFO A;  3LAJ A;  2UZK A;  4EM2 A;  5CJ9 A;  5DCM B;  1UFM A;  3ZMD A;  2IPQ X;  3FM5 A;  5DUK A;  3O6B B;  1DPR A;  2W57 A;  1J5Y A;  1QZY A;  2GXB A;  4NQW A;  4EJW A;  1G3W A;  2JTV A;  3D0S A;  5D5U B;  1JHH A;  5E8G A;  3ZMZ A;  1XCV A;  5D8L B;  2M87 A;  1XGM A;  4RAY A;  1GXP A;  1BM9 A;  2CW0 F;  2XV4 S;  3KET A;  2P5V A;  2V1U A;  2YSR A;  4UNO A;  1ZGA A;  2Y48 A;  3GX4 X;  1W7P B;  2A07 F;  5LHI A;  4U0V A;  4P9F A;  2DPU A;  2JT1 A;  3JSO A;  3F23 A;  2EK5 A;  3QU6 A;  1HSJ A;  1B1B A;  5E18 F;  5LBQ A;  5DYM A;  3ERE D;  2OZU A;  3HYI A;  1EH6 A;  1IRF A;  1LEB A;  3DEU A;  2O0Y A;  4ZZD A;  3IC7 A;  2FE3 A;  4S04 A;  1CF7 A;  2KIU A;  2PMH A;  3CUQ C;  3F6O A;  4CZZ A;  2ZFW A;  3WTU C;  3WGH A;  3M9A A;  1YLF A;  1B6A A;  1FX7 A;  1R36 A;  1IN5 A;  1LJ9 A;  1L0O C;  2QZ8 A;  4WXH A;  4CO8 A;  4A5M A;  2EV5 A;  5L3G A;  2ZME B;  1ZGJ A;  4LFU A;  6PAX A;  3MWM A;  2JSC A;  1P6R A;  2YU3 A;  1ZRF A;  1Z7U A;  2Z33 A;  3GUD A;  5D5X B;  3K1P A;  3EUH A;  1R22 A;  3HRT A;  4YG2 F;  4WK8 F;  3JAM K;  5E1X A;  1TBX A;  2A61 A;  3V4G A;  2K4J A;  4CYD A;  1JHF A;  1KYZ A;  1AWC A;  2DLL A;  2BV6 A;  4IJA A;  5K5Q A;  2NYX A;  5BOX A;  1A04 A;  1G3T A;  1HQC A;  3LA3 A;  3WU1 B;  3I59 B;  3HSF A;  3ABU A;  1OYI A;  1Y0U A;  3T0Y A;  1LDD A;  2HEO A;  3NQO A;  3MAJ A;  2XAH A;  5F6F A;  5ICF A;  4XBF A;  4BH9 A;  4I02 A;  3GFL A;  4P9U A;  3N4M A;  2EFN A;  3N97 A;  5D4S A;  3RTR A;  2A68 F;  5CVV A;  4EVI A;  1HW5 A;  4GO1 A;  1K7A A;  1CF7 B;  2MLK A;  3BJO A;  1ZLK A;  1SD5 A;  5CVR A;  2ACJ A;  2CYY A;  5ICC A;  2Z9O A;  3DF8 A;  2FA5 A;  1PDN C;  4UVA A;  3L00 A;  2DU9 A;  1R58 A;  5LEK A;  1FBU A;  3F8M A;  2EB7 A;  2DAO A;  1P4W A;  2HQR A;  2PMU A;  3ISP A;  1B4A A;  3NEU A;  5F1R A;  1USS A;  4BXU A;  2EFW A;  4CDG A;  2DQL A;  3P9C A;  1FWZ A;  1EV7 A;  3VOD A;  2QM3 A;  4RAZ A;  2K7L A;  4WF2 A;  2VE9 A;  4LD5 A;  2VXZ A;  1QPM A;  4MGR A;  4RB1 A;  4AIJ A;  1QQI A;  3O3K A;  4YFK F;  5E20 A;  3TGN A;  1GVJ A;  2LF7 A;  4LLG F;  3FWE A;  1P4X A;  2O03 A;  1QGP A;  4GCV A;  4LK1 F;  1H9T A;  2WC2 A;  4HX7 A;  4HV5 A;  2IJL A;  2NNN A;  5JI6 A;  3EYI A;  2W85 A;  2EFP A;  1U5T C;  5BMZ A;  3KZZ A;  4UVB A;  2QUF A;  1MDM B;  2DO7 A;  3HOS A;  2O61 A;  4UXN A;  1BI3 A;  1G6N A;  2HWV A;  3J81 K;  3LA7 A;  4CIC A;  1BJA A;  3FXR A;  4UUV A;  4IVN A;  4Q4Z F;  3ZN1 A;  1WQ2 A;  1XB4 A;  1PP7 U;  1QO0 D;  3M7G A;  4EM1 A;  3E6C C;  2CGP A;  5HDK A;  1XD7 A;  4M9X A;  2D1H A;  3QRF F;  3KP3 A;  2LKP A;  3OOP A;  2VN2 A;  4MEX F;  2V6C A;  2VT3 A;  3TDZ C;  3GXO A;  1FY7 A;  2V1X A;  2A6E F;  1XN7 A;  1VTN C;  2IP2 A;  1TW3 A;  2PEX A;  3IWZ A;  1SMY F;  5EEH A;  2O8X A;  2YR2 A;  2Z3Y A;  2Y75 A;  4RS8 A;  4G94 A;  1J0R A;  3DP7 A;  4BHP A;  4KMF A;  5DV5 A;  5L3D A;  1KQ0 A;  5HOO A;  4ZYH A;  2W25 A;  1MKM A;  2DPD A;  3GYH X;  1Z9C A;  1MJB A;  1I5Z A;  2HTJ A;  2J5P A;  3F72 A;  2HKO A;  1XMK A;  3KFW X;  3U2R A;  3FF5 A;  4ENJ A;  2EWN A;  3OV8 A;  1I1G A;  5LGT A;  2PFB A;  3PQJ A;  2XRN A;  2X4H A;  5BPD A;  2LF8 A;  2QQA A;  1MZB A;  1QZZ A;  4G7O F;  3HSE A;  4U7B A;  2STW A;  3ZQ7 A;  1FSH A;  3I64 A;  3F22 A;  3HRS A;  3F8B A;  3KLN A;  3W6J B;  5D4R A;  2H6C A;  3LQR A;  3ZPL A;  1BI0 A;  2BYV E;  2FML A;  4G9Y A;  3G3Z A;  3ZN0 A;  2C6Y A;  3M8E A;  4D0P A;  2J5O A;  2NNY A;  1P4A A;  5BQT A;  4H0E A;  4DNC A;  3QP5 A;  2FNA A;  2B0L A;  2L4A A;  2JPC A;  3CLO A;  2H09 A;  4M6Y A;  3QPH A;  4CHU A;  5D8K B;  3QPT A;  5LHG A;  2ZNY A;  4JK1 X;  1GHC A;  5KVR A;  4BHB A;  3MEX A;  2MLG A;  5K5O A;  1TW2 A;  3R61 A;  3DV8 A;  4A0X A;  2P6T A;  2F5C A;  1JE8 A;  1IAW A;  5BS6 A;  3SFZ A;  5JR3 A;  1T38 A;  3K69 A;  4GYG A;  1NHA A;  3IKV A;  4OIQ F;  2WV0 A;  3Q5F A;  3FMR A;  2OZ6 A;  4LG0 B;  2O3F A;  2VBX A;  3TDU C;  4HQE A;  4IPA A;  4G6Q A;  5HDN A;  1DUX C;  2VC1 A;  2HYG D;  1T2K A;  1J75 A;  1KQ9 A;  1SFU A;  1YS7 A;  1FSE A;  1OKR A;  4YII A;  1HKT A;  4HX8 A;  1YW7 A;  4HLY A;  1RI7 A;  2WTE A;  3V7S A;  5ERI A;  4WWC A;  1YIO A;  1D5V A;  1R7J A;  2A6H F;  4LLN A;  3QOP A;  4KDP A;  3ML6 A;  1SFE A;  2Q8K A;  1ON1 A;  1W7P D;  2MC3 A;  3V8L A;  2K86 A;  2L3D A;  2XAG A;  5LGU A;  1LVA A;  2OBP A;  3F21 A;  2XGX A;  5L3E A;  1FYM A;  5IT9 Z;  1DP7 P;  1ZHF A;  3BDD A;  3DKW A;  2L01 A;  4FHT A;  1FLI A;  3WOD F;  4R8H A;  5FLX Z;  4O5V A;  1U2W A;  3C3W A;  2G7U A;  3WTS C;  1F9N A;  2ESH A;  4G8X A;  3KP6 A;  3GW2 A;  1ODD A;  5DD8 A;  3MQ0 A;  5LRR A;  3SZT A;  1RUO A;  2R7F A;  4OMZ A;  3KP7 A;  3E6B A;  3FXU A;  4F7Z A;  1UB9 A;  1S3J A;  3I5U A;  4MNU A;  3VB2 A;  3ZMT A;  2QLZ A;  3KE2 A;  1JGS A;  2ZJ2 A;  2YX7 A;  3VOE A;  2DK5 A;  1UST A;  4FX0 A;  3CUO A;  2X0L A;  3IRR A;  2ZNZ A;  2CWE A;  1O7L A;  3L09 A;  2ZBK A;  1KYW A;  2Q0O A;  4EJU A;  2MBF A;  1LDJ A;  4XLP F;  2M8E A;  4KIF A;  4RGR A;  1IF1 A;  1H9G A;  1ONV A;  1KA8 A;  3I53 A;  1J7K A;  5LGN A;  2HZT A;  4RB2 C;  3F3X A;  3E6D A;  4A0Z A;  3WGI A;  1MD0 A;  1UHM A;  3SHF A;  4KIC A;  4UV8 A;  1DDN A;  3P9I A;  1YFH A;  1ZLJ A;  2VBZ A;  2IT0 A;  2ISY A;  2XAQ A;  3KP2 A;  3BJ6 A;  3I71 A;  4YFX F;  2OA4 A;  2TDX A;  1ON2 A;  4U0Y A;  1IXC A;  1B59 A;  2BBY A;  4Z2Y A;  2GWR A;  3SZP A;  5E8I A;  2EV6 A;  1E17 A;  2PLY A;  4KUM A;  4L9V A;  4PGH A;  5HLH A;  2ESN A;  1IZ1 A;  3T8T A;  2Y0M A;  1F5T A;  1ZG5 A;  4HX4 A;  5J6X A;  1F1Z A;  2F5D A;  4A5N A;  5J8F A;  3KZY A;  1PUE E;  2XVC A;  3DPT A;  3GO5 A;  3EQL F;  3K9T A;  2CFX A;  3IHU A;  3HUG A;  2NAZ A;  2L02 A;  1ZAR A;  4LB5 A;  1GXQ A;  1MGT A;  4LJZ F;  4GYI A;  1T6S A;  1ZRD A;  1W7P A;  4LB6 B;  3WE3 A;  4P55 A;  1G3Y A;  1TQM A;  1IN6 A;  3GF2 A;  3GWZ A;  2FRH A;  1YW9 A;  4WCG A;  2RN7 A;  4YFN F;  2EA2 A;  3J80 K;  2HOE A;  4EMS A;  1ZH5 A;  3K0L A;  1XMA A;  4HF1 A;  3ZMU A;  2D45 A;  3B02 A;  2RGV A;  4EV0 A;  2FEZ A;  3ULQ B;  4L5I A;  3FX3 A;  2E1N A;  1UCR A;  4IRG A;  4KFC A;  4XSX F;  2E7W A;  3IRQ A;  4Y15 A;  4M71 A;  1IN8 A;  3CUQ B;  1SD7 A;  5ILS A;  4L9N A;  3IWF A;  2DTR A;  3DFG A;  3FM3 A;  1W5T A;  4IHT A;  5DDG A;  3RKY A;  1EH8 A;  5L3B A;  1R23 A;  2FF4 A;  2UXN A;  2ETH A;  5H20 A;  5IT3 A;  2MA3 A;  3FHZ A;  3FMQ A;  1BIA A;  5DD4 A;  4G6D A;  2VOP A;  4XSZ F;  1FP1 D;  4LLL A;  1R5H A;  1X3U A;  3LFK A;  4R1H A;  4M9Z A;  2PG4 A;  1V3F A;  2DBB A;  4ZYD A;  2D1V A;  1D8J A;  2JZY A;  2R3S A;  2BE5 F;  5DCM A;  5KK1 A;  2H94 A;  3JW4 A;  1IN7 A;  4KYW A;  1U8R A;  2G7H A;  3C1D A;  1KU7 A;  1I1S A;  2VBW A;  4HDU A;  2DK8 A;  3BP8 A;  3T1B A;  4MTE A;  4Q48 A;  5HS9 A;  3K1M A;  2XAF A;  2H27 A;  2XRO A;  3V8K A;  2ZXJ A;  4EM0 B;  1LQ1 A;  3MZH A;  5BPI A;  4BQA A;  4NHJ A;  1TQP A;  2VOO A;  1K78 B;  3KEO A;  2A3S A;  4I2O A;  3HTU A;  3HOT A;  2HGC A;  1J59 A;  1BIB A;  1ZG3 A;  4S05 A;  3KP4 A;  3GFJ A;  1WKM A;  2HTS A;  4ESJ A;  1U5T A;  2QWW A;  1T39 A;  3CDH A;  4M9S A;  5ICG A;  1TLH B;  2IA1 A;  4OU0 A;  5IT9 K;  3F6V A;  5D6F A;  3FXQ A;  3PFI A;  4ZH4 F;  2QEN A;  2XUB A;  4GGG A;  5FFX A;  3ABT A;  2OAZ A;  4HV6 A;  5AON A;  1WSU A;  1G3S A;  2FBH A;  2ZME A;  1S7A A;  3CJN A;  3IKT A;  4PCQ A;  4DQ2 A;  1REP C;  4QWQ A;  2P7V B;  2LSO A;  1SMT A;  1WI9 A;  4R79 A;  3GLX A;  2FMY A;  4HOB A;  2NS0 A;  3HRM A;  3E3V A;  1R5G A;  2JRT A;  4MQV A;  1S7O A;  1R00 A;  2HR3 A;  2BGC A;  4CXF A;  1IXR C;  2CSO A;  3WTW C;  2COM A;  4I09 A;  1AOY A;  1ZRE A;  3V7C A;  1T0F A;  4TV7 A;  2CO5 A;  2GZW A;  3U9G A;  2CG4 A;  2KKO A;  5A2Q Z;  3KEQ A;  1TNS A;  2H6B A;  3W6K B;  3R0A A;  3RYP A;  3E97 A;  2M1B A;  5E1Z B;  1XCB A;  3K1N A;  4UHT A;  1ULY A;  1XSD A;  4RB3 C;  1O3R A;  1Q1H A;  4BNC A;  3V8J A;  1FOK A;  3J7A O;  2HYF A;  3CO7 C;  2FU4 A;  5HDG A;  4M6X A;  3BPX A;  1YTY A;  2XHK A;  1BI2 A;  2RNJ A;  2F5E A;  2O6G E;  3F8C A;  4OMY A;  3FMS A;  3BJA A;  4IXA A;  3LQQ A;  1SD6 A;  4I7H A;  1YS6 A;  2FBK A;  3WG9 A;  2GIV A;  1Z05 A;  1S8N A;  2FBI A;  4CGZ A;  3K2Z A;  1W4M A;  4YIF A;  1SD4 A;  4WX9 A;  4ZZL A;  2XAJ A;  1E2X A;  1FBS A;  2ISZ A;  1UHW A;  4B09 A;  4RGU A;  3I58 A;  4MEY F;  3JAM Z;  1MJA A;  3Q9S A;  4WXD A;  4KN4 X;  4OIO F;  4Y13 A;  2FNP A;  2RV8 A;  3I54 A;  4IF4 A;  3U1D A;  2QQ9 A;  2FQ3 A;  2FSW A;  3QP6 A;  2ELH A;  2G9W A;  4HF2 A;  5DCF A;  1BBY A;  3SXY A;  3TOB A;  1O7F A;  3ECO A;  1IRG A;  2VBY A;  1FNN A;  1KU2 A;  3ZP5 A;  4KIG A;  3QAH A;  3SQN A;  2KJC A;  4L0Z B;  1K78 A;  3DXJ F;  3MFK A;  2VON A;  2P5K A;  1QNT A;  3COA C;  4RGS A;  4OIR F;  5LHH A;  5FB2 A;  1D3Y A;  2QBY B;  4PDK A;  3R60 A;  2GA1 A;  3VFZ A;  3CTA A;  4HQM A;  3J80 Z;  1U78 A;  2HKX A;  2PBI A;  4A2U A;  5JFR A;  1R1T A;  4AIK A;  3R6S A;  2DW4 A;  5JHU A;  4UVC A;  4I0B A;  2XAS A;  1OYW A;  1KU9 A;  4NB5 A;  5J8C A;  1XGN A;  3QU3 A;  2P6S A;  2GQQ A;  4MHG A;  2QYO A;  3KP5 A;  3J81 Z;  4M74 A;  4M72 A;  4ASN A;  1Z91 A;  2RDP A;  2M5W A;  3E6M A;  3REO A;  1XDS A;  2HS5 A;  4L18 B;  5HLG A;  1Z6T A;  1SAX A;  2FXA A;  1ZYR F;  2W84 A;  1S6L A;  5ILV A;  3GEZ A;  4L5J A;  2IW5 A;  3HHH A;  3I0T A;  2F2E A;  1HXD A;  2XKO A;  4LK0 F;  3FZV A;  2RQP A;  1R1U A;  3T8R A;  3R4K A;  1FZP B;  1XSX A;  5ICE A;  3RDI A;  3CUQ A;  5FD5 A;  1STZ A;  2P7C B;  4EQQ A;  4LG0 A;  2GA2 A;  1MJ9 A;  1ZN2 A;  1ZAO A;  4JBA A;  4E70 A;  4ESF A;  1FP2 A;  3JSP A;  2JPB A;  1J9I A;  1RUN A;  3H3U A;  3RKX A;  4ENN A;  4MQ9 F;  2ADU A;  3S2W A;  4EJO A;  3BZ6 A;  4L0Y B;  4O3M A;  3MCZ A;  5AIP A;  1CGP A;  4ENM A;  3EET A;  1P92 A;  4U0W A;  1KQ8 A;  1YO5 C;  3WE2 A;  4KMU X;  3H3Z A;  1LEA A;  4L9T A;  5CVI A;  3B73 A;  2WWY A;  5FFZ A;  1K79 A;  1HW1 A;  4QLC U;  2MD5 A;  2EA4 A;  4U88 A;  2VE8 A;  3KCC A;  3GZ5 A;  2V79 A;  2IVM A;  1FYL A;  5E17 F;  1OMI A;  3R0J A;  4HLX A;  5D5V B;  2VT2 A;  2K27 A;  3WTY C;  4Y17 A;  4I01 A;  2IA2 A;  1HST A;  3L2C A;  3HTS B;  4FT8 A;  5TJJ A;  4HW0 A;  3BWG A;  4AVP A;  4RB0 A;  1P2F A;  4EGZ A;  2M45 A;  4AWX B;  2XIG A;  2KRF A;  4OIP F;  3L9F A;  4N9I A;  4K2E A;  3BY6 A;  2AS5 F;  1T98 A;  1U5T B;  2K4B A;  5HVQ C;  2PQ8 A;  4ENK A;  3EYY A;  1JXS A;  4EJT A;  3VEP A;  2QQB A;  3ECH A;  4A6D A;  5FD6 A;  4XLN F;  4Q5S F;  3WGG A;  2QBY A;  1KGS A;  2OQG A;  2DQR A;  2YPR A;  4HYE A;  3WTZ A;  2STT A;  1YYV A;  3E5U A;  4HAM A;  2P4W A;  4JQF A;  3LAP A;  2V1D A;  2VOD A;  3TO6 A;  3RKW A;  1H0M A;  1LDK B;  3E5X A;  2OQR A;  2UWM A;  4WXC A;  2GXG A;  1G4D A;  3HHG A;  5F64 A;  4EJV A;  4RGX A;  3WU0 A;  3BPV A;  2XKP A;  4ETS A;  1BOA A;  3GZ6 A;  3M1E A;  1YG2 A;  4PZJ A;  3JTH A;  2ZKZ A;  4MTD A;  5AIQ A;  1B9M A;  1OPC A;  1FC3 A;  3GFM A;  3MZY A;  4HA8 A;  3L7W A;  4Q47 A;  4UV9 A;  3LST A;  1D8K A;  2M30 A;  2AXL A;  4G7H F;  3ZMS A;  4IHS A;  3F8N A;  2PN6 A;  3ROU A;  3WTV C;  5L3F A;  2F5F A;  5HS8 A;  2PI0 A;  1XGS A;  1R1V A;  4HBL A;  5FGM A;  4KN7 X;  3HRU A;  3RI4 A;  5ED4 A;  5CLS A;  1TNT A;  5D5W B;  1U3E M;  4A12 A;  4XRF A;  5HLI A;  4ON0 A;  1F4K A;  3RJP A;  4ZYE A;  3F8F A;  1RIO H;  1BC7 C;  3P9K A;  5EEG A;  5DUI A;  3WTT C;  3AAF A;  2IRF G;  5H6R A;  4A6E A;  3V7R A;  1BI1 A;  2P5L C;  2OD5 A;  1WWX A;  1BN5 A;  4OOI A;  3G73 A;  2EJR A;  5A2Q K;  3C7J A;  1FBQ A;  4PGG A;  2VC0 A;  2LDU A;  1YW8 A;  3RPQ A;  5CVJ A;  1O3Q A;  2YX4 A;  5LLQ A;  3P7N A;  4OIN F;  2ZCW A;  1O3T A;  4U7D A;  4ZYG A;  3M8F A;  4O6J A;  4HDV A;  5L3C A;  4IRI A;  5JVT A;  1FPQ A;  4KIB A;  2LNB A;  1W5S A;  1O3S A;  2DT5 A;  3LWF A;  2CQK A;  4KA4 A;  2GAU A;  3RYR A;  1DPU A;  4KT5 C;  1KU3 A;  5K1Y A;  4HZF A;  3O2P E;  1OYY A;  2BEO A;  3GFI A;  2R7D A;  4B8X A;  2Z99 A;  2A5Y B;  4P5O A;  3H92 A;  3TO9 A;  1QBJ A;  3I4P A;  1IN4 A;  3ELK A;  3EDP A;  2RKH A; 
#chains in the Genus database with same CATH topology
 3IAS 2;  1IW7 F;  4KNY A;  3NRV A;  3WTX C;  2IAI A;  4W97 A;  2Q2E A;  4AIH A;  2DFI A;  1Z6R A;  2ZJP F;  4BE1 A;  2V9V A;  1HKS A;  1J2X A;  3LA2 A;  5D6E A;  1MDM A;  2P0W A;  2KJB A;  1ENH A;  2COB A;  4IOA F;  5IYD J;  2HFH A;  1WRJ A;  3IAM 2;  2HQN A;  4P96 A;  5FLX K;  1RC9 A;  1L3L A;  1IXS B;  4RLF A;  2HU9 A;  2BY2 A;  3H1C A;  3ZQL A;  2ZO4 A;  3CCE I;  4GFB A;  2DA3 A;  2DCE A;  2FOK A;  5LEJ A;  2QSH X;  4IQJ A;  1VQ9 I;  1LNW A;  2W24 A;  3BQZ A;  4IRH A;  4JX5 A;  1YX5 A;  2QSF X;  3PIO F;  2R7Q A;  3TOA A;  3T5X A;  4A3G J;  1AKH B;  4A3L J;  2L54 A;  2F4M B;  2K02 A;  3Q9V A;  4ESB A;  4A3D J;  2EV0 A;  3DPL C;  4KJZ A;  4NBQ A;  2QEX I;  3HIF A;  4A0Y A;  4AD9 A;  1V55 H;  5DEQ A;  5GAH J;  4LGW A;  2K9S A;  3KLO A;  4HF0 A;  3OYJ A;  4BU2 A;  4NDL A;  3ZMV A;  4XIC A;  5LRS A;  1PP8 F;  1NG6 A;  2RVC A;  2R7O A;  3CCR I;  2IA0 A;  4GDF A;  2OF7 A;  2Z5U A;  5ILU A;  1S29 A;  5CYV A;  2VLA A;  1LB2 A;  3CQZ J;  1HKQ A;  3I59 A;  4Y33 A;  1ZR4 A;  2MH2 A;  1LE8 A;  2MH9 A;  4BEH A;  5B66 C;  3RPU A;  2QSG X;  1WH5 A;  3D5L A;  2QVO A;  2OU2 A;  3IL2 A;  1ZGW A;  3NAR A;  2F6C A;  2X6X A;  1XSV A;  2DA6 A;  1B9N A;  2NRA C;  4PUS A;  1OR7 A;  1KON A;  2E1C A;  4G7Z F;  1K6O A;  1Z1D A;  4RM3 A;  3TP0 A;  3HSR A;  4HEA 2;  3C18 A;  2EFQ A;  2DI3 A;  2KIF A;  2PJP A;  1Y1W J;  4AID A;  3PQK A;  2X6Y A;  3I56 I;  1W1W E;  1HBX G;  3CJQ B;  1XGO A;  3BRO A;  2UXX A;  2Y2Z A;  5HS7 A;  3NAU A;  3S32 A;  3E5Q A;  5H6Q A;  3CO6 C;  4EGY A;  2D2W A;  1WJC A;  3JR9 A;  1SFX A;  2A5W A;  3TO7 A;  1RNL A;  1TQI A;  3GZN B;  3JTG A;  3TQN A;  5E1W A;  3K70 C;  3CES A;  1ZRC A;  1YQA A;  4M73 A;  5F08 A;  4FX4 A;  1BC8 C;  1SVO A;  5KAI C;  1HW2 A;  1P9Q C;  2MFZ A;  1K83 J;  1T56 A;  1I27 A;  2E7X A;  3VPR A;  3DTE A;  4J01 A;  1V4R A;  5CVU A;  2X48 A;  1I3A A;  4XN0 A;  1XDU A;  3PSF A;  3TKY A;  4BYY A;  1FT9 A;  4BJT A;  2EZI A;  2RC4 A;  3E1S A;  2JWT A;  3CMA I;  4BAY A;  3GVA A;  4N0B A;  1U6G A;  3A01 A;  4BHC A;  1XS9 A;  1C0W A;  4I98 B;  5FO5 A;  4N9H A;  1DP3 A;  2E5N A;  4I0A A;  5K5R A;  3A2K A;  1Z21 A;  1TTY A;  4QPO A;  2OPT A;  1ETO A;  3PM1 A;  3ONQ A;  1ZG1 A;  2P8T A;  3Q3S A;  5J4Y A;  2CV2 A;  5TRD A;  3MZ8 A;  3HGY A;  1JI8 A;  1FYK A;  2HDC A;  2KIM A;  1O57 A;  4F52 A;  3FK6 A;  1EH7 A;  3BG3 A;  3BOQ A;  1ACI A;  1XPX A;  4GXO A;  1I6X A;  3W3C A;  1IUY A;  2E34 A;  1U9N A;  2L4M A;  4BUP A;  2A69 F;  1TP4 A;  4LMY A;  1RZ4 A;  3RIR A;  3I4N J;  4L9J A;  2WB1 A;  2EFO A;  3DQV C;  2ME6 A;  3LAJ A;  1JJ6 C;  2UZK A;  3K4L A;  4EM2 A;  5CJ9 A;  5DCM B;  5F04 A;  1IG7 A;  1UFM A;  3ZMD A;  2IPQ X;  3J7A Y;  3FM5 A;  3TP3 A;  1T0F C;  2V7F A;  1DU0 A;  4QSH A;  5DUK A;  1D0Y A;  3O6B B;  1DPR A;  3OSF A;  2W57 A;  1Y8Q B;  4C2U A;  2ID3 A;  3ZQG A;  1J5Y A;  1VFC A;  1QZY A;  5FRN A;  2GXB A;  1UZC A;  4CCL A;  5JHF A;  4NQW A;  4EJW A;  3AL0 B;  1T33 A;  1G3W A;  2JTV A;  3D0S A;  1P7J A;  5D5U B;  1JHH A;  5E8G A;  3ZMZ A;  4ZDO A;  1XCV A;  5D8L B;  4A3M J;  2M87 A;  1XGM A;  4PJM A;  4RAY A;  2GM4 A;  1GXP A;  1BM9 A;  1VQ4 I;  4H4K C;  2CW0 F;  1K4S A;  2GXA A;  1VQM I;  2XV4 S;  3M3Y J;  1LFP A;  3KET A;  2HXO A;  4F92 B;  2P5V A;  1MMS A;  3FDY A;  4B48 A;  2KP6 A;  4PJN A;  3H5N A;  4XRS G;  4QIW N;  2NVQ J;  2V1U A;  2YSR A;  4UNO A;  4PFO A;  2MW8 A;  1ZGA A;  2A05 A;  1X1B A;  1Y6I A;  2Y48 A;  3DKX A;  1W7P B;  3GX4 X;  2A07 F;  2IS1 A;  5LHI A;  4A3I J;  3BQY A;  4U0V A;  3OL4 A;  3BR0 A;  4FAS D;  4P9F A;  3OYA A;  2DPU A;  1HCR A;  2JT1 A;  4AM3 A;  3JSO A;  1Z3Y A;  3F23 A;  2NS8 A;  2H1L A;  3KX2 A;  4BXX J;  1PYV A;  2EK5 A;  3QU6 A;  1HSJ A;  1B1B A;  5E18 F;  1ETW A;  5LBQ A;  5DYM A;  3S1Q J;  3ERE D;  2V6E A;  2BY0 A;  1IRZ A;  3SDB A;  2OZU A;  1EJ9 A;  3RZD J;  1TWA J;  2RRE A;  3CC4 I;  2HQA A;  3A1Y A;  4OAZ A;  3HYI A;  1EH6 A;  1IRF A;  4CCN A;  1LEB A;  1X1D A;  3DEU A;  2HDW A;  4DGW B;  2O0Y A;  1RPW A;  2VUM J;  4ZZD A;  3IC7 A;  2FE3 A;  3S14 J;  4UB6 C;  1X1C A;  1W0U A;  4S04 A;  1CF7 A;  2KIU A;  1QA6 A;  5IP9 J;  5CPR B;  2IBD A;  2PMH A;  3CUQ C;  2MG4 A;  3F6O A;  4Y3O A;  4CZZ A;  2KL4 A;  2ZFW A;  1TT5 B;  2QCO A;  3WTU C;  3GLL A;  5E3L A;  4X6A J;  2F48 A;  2QA4 I;  2X85 A;  3M9A A;  1OFC X;  3WGH A;  2PJR B;  1YLF A;  2FOW A;  1V54 H;  3PNV A;  1QU3 A;  5HOD A;  1B6A A;  1NK2 P;  5LD2 C;  1TWF J;  1FX7 A;  2VQH A;  1ITY A;  1R49 A;  2X1E A;  1R36 A;  1IN5 A;  1JUS A;  1DU6 A;  5C3E J;  1LJ9 A;  2NXN B;  1L0O C;  2XRL A;  2QZ8 A;  4WXH A;  3DEW A;  4HNV A;  2ICW G;  4C3J J;  4CO8 A;  3D5S C;  2HVQ A;  5FKO A;  4A5M A;  4DBR A;  2EV5 A;  5L3G A;  2ZME B;  2HVR A;  4IHW A;  2Y0S N;  1ZGJ A;  3W2V A;  4LFU A;  4A69 C;  2DTZ A;  6PAX A;  2M7A A;  5GPC A;  3MWM A;  2JSC A;  1P6R A;  2YU3 A;  1X4P A;  2Y69 H;  4GRI A;  1ZRF A;  1Z7U A;  1KZH A;  2Z33 A;  4UY8 I;  3GUD A;  1OJL A;  5D5X B;  3K1P A;  3PUF A;  2R7R A;  1XX5 A;  4F55 A;  1R5I D;  3EUH A;  3OYL A;  1R22 A;  1ZR2 A;  2V4J C;  3OOU A;  3GTQ J;  3HRT A;  4YG2 F;  4WK8 F;  4BY1 J;  2WAE A;  3S3N A;  3JAM K;  5E1X A;  1TBX A;  2A61 A;  4YEJ A;  5EG0 A;  2XGE A;  4II2 A;  3V4G A;  1U0J A;  2K4J A;  4CYD A;  3BLY A;  1JHF A;  3CF2 A;  3HOW J;  2OCC H;  3LMM A;  1KYZ A;  5IYB J;  1AWC A;  2R7X A;  2DLL A;  5J47 A;  2R5Z B;  2BV6 A;  4IJA A;  5K5Q A;  2NYX A;  5BOX A;  2LBF B;  1XMX A;  3MVP A;  2AXT C;  3PL8 A;  3VYR B;  1ETQ A;  1A04 A;  1G3T A;  1HQC A;  3LA3 A;  4C2T A;  4Z6Y A;  5KAF C;  3WU1 B;  1JT0 A;  3I59 B;  3HSF A;  3ABU A;  2EIK H;  1OYI A;  1Y0U A;  3T0Y A;  3VYU B;  3JRE A;  1XG1 A;  1LDD A;  2HEO A;  3NQO A;  1X4O A;  2X1C A;  1EF4 A;  1A6I A;  3UKG A;  3OIQ A;  3MAJ A;  2XAH A;  1WH7 A;  5F6F A;  3H36 A;  5ICF A;  4XBF A;  4BH9 A;  1ZEL A;  4I02 A;  3GFL A;  5IY5 H;  4P9U A;  5EGO B;  2CH0 A;  3BR2 A;  3N4M A;  2EFN A;  3N97 A;  5D4S A;  3W2W A;  1WHU A;  3RTR A;  1BR2 A;  2A68 F;  4JYK A;  3CZ6 A;  5CVV A;  5C4J J;  5FKL A;  4EVI A;  3C2H A;  2JK3 A;  3KYL A;  1D1C A;  3OYF A;  1HW5 A;  3L2Q A;  4GO1 A;  4DZP A;  1K7A A;  3G6E I;  1CF7 B;  4UUS A;  2MLK A;  3BJO A;  1ZLK A;  2MC4 A;  3DU6 A;  1SD5 A;  5CVR A;  2ACJ A;  2CYY A;  5ICC A;  4NUB A;  1OCT C;  2Z9O A;  2MD0 A;  2OV7 A;  2R0Q C;  3DF8 A;  3DKY A;  2FA5 A;  1PDN C;  3I4M J;  1Y56 A;  2VI6 A;  3BZC A;  2F4O B;  5GPA A;  4UVA A;  1W5C C;  2JN6 A;  4RM2 A;  2BHY A;  3L00 A;  2DU9 A;  1R58 A;  3GTP J;  1MBG A;  5LEK A;  1FBU A;  2ZXI A;  3F8M A;  1NK3 P;  4M3B A;  3G71 I;  2EB7 A;  3C2B A;  2DAO A;  1P4W A;  2LTP A;  2CQ7 A;  5FJ8 J;  3EUA A;  3LSI A;  4D5C A;  2ZME C;  2HQR A;  1VQ7 I;  3IP4 B;  2PMU A;  3ISP A;  1B4A A;  3NEU A;  5F1R A;  1USS A;  4BXU A;  1AHD P;  2EFW A;  3OYD A;  2IS4 A;  1BA5 A;  4XK4 A;  4CDG A;  2DQL A;  1T95 A;  3P9C A;  1MNM C;  1FWZ A;  1EV7 A;  1GT0 C;  2LKS A;  3VOD A;  2QM3 A;  1N78 A;  1JKQ C;  2K3F A;  2HPM A;  3HZJ A;  4LIV A;  3OMY A;  4RAZ A;  5K7F A;  1SVM A;  2K7L A;  1IDZ A;  3AFH A;  4WF2 A;  5KCM A;  2VE9 A;  1F43 A;  4LD5 A;  4XKW A;  1IJW C;  3CME I;  2RQQ A;  1I50 J;  1LKX A;  4M3D A;  2VXZ A;  2XPU A;  1QPM A;  4ZTJ A;  4MGR A;  4RB1 A;  3S2D J;  3PNT A;  2M9H A;  4AIJ A;  4AYB A;  1QQI A;  3O3K A;  4V19 K;  3DPU A;  3RSN A;  4YFK F;  5E20 A;  3TGN A;  1GVJ A;  4LIT A;  2CQQ A;  2LF7 A;  4LLG F;  2HQ5 A;  2V9K A;  1P4X A;  3FWE A;  2O03 A;  1QGP A;  4AUX A;  4GCV A;  4OAY A;  4LK1 F;  1H9T A;  2WC2 A;  4HX7 A;  2ELK A;  4HV5 A;  2IJL A;  1G8X A;  1SAU A;  2NNN A;  5JI6 A;  3EYI A;  2W85 A;  4BJ6 C;  3DU5 A;  2EFP A;  1U5T C;  4ABZ A;  3A03 A;  3HPG A;  5BMZ A;  2F5V A;  3KZZ A;  2HPI A;  3HOZ J;  2KRC A;  4UVB A;  2QUF A;  3JRH A;  2DO7 A;  3G1M A;  3HOS A;  1MDM B;  2O61 A;  2E71 A;  3OIO A;  1VND A;  4UXN A;  1BI3 A;  1G6N A;  2HWV A;  3J81 K;  3LA7 A;  4CIC A;  3JRB A;  2E5Z A;  2LG4 A;  1BJA A;  3FXR A;  4UUV A;  4IVN A;  1VQ8 I;  4XR6 A;  4Q4Z F;  3S2H J;  1U8B A;  4QPQ A;  3ZN1 A;  4A3F J;  1WQ2 A;  1RES A;  2MSY A;  5C44 J;  3ABL H;  1XB4 A;  3JCU C;  3AKZ A;  1PP7 U;  1QO0 D;  4JP0 A;  3M7G A;  4EM1 A;  3E6C C;  2Y9Z A;  2CGP A;  5HDK A;  3FBN B;  3AL0 C;  1XD7 A;  4M9X A;  2D1H A;  2JRM A;  3QRF F;  3QQA A;  3KP3 A;  5IPA A;  4E7S A;  2LKP A;  2ZJR F;  2M8G X;  2BW3 B;  3OOP A;  2VN2 A;  2JA6 J;  1OCO H;  4MEX F;  3PFY A;  2V6C A;  2VT3 A;  2R7V A;  1UAA A;  1VQ6 I;  3I9V 2;  3TDZ C;  3GXO A;  1FY7 A;  2LYC A;  2FUG 2;  1T08 B;  2ZSI B;  4A93 J;  2V1X A;  2LFB A;  3OYG A;  2A6E F;  1ERD A;  3M07 A;  1XN7 A;  1VTN C;  5FKK A;  2IP2 A;  1TW3 A;  3LNQ A;  5F1J A;  3OYK A;  3ESW B;  2PEX A;  3IWZ A;  1SMY F;  3QPL A;  5EEH A;  5HLT A;  2O8X A;  5IOY A;  2YR2 A;  2Z3Y A;  2LOO A;  2VQC A;  2Y75 A;  4RS8 A;  5JLW A;  1JKP C;  4G94 A;  3IUO A;  1J0R A;  3DP7 A;  4BHP A;  1GDT A;  4KMF A;  2DOE A;  5DV5 A;  5L3D A;  2R5Z A;  1KQ0 A;  5HOO A;  3BG7 A;  4ZYH A;  2W25 A;  1MKM A;  2DPD A;  2O9L A;  2Z1D A;  4RDU A;  3GYH X;  1Z9C A;  1MJB A;  4U87 A;  1I5Z A;  3P5J A;  2HTJ A;  3FIS A;  4CH7 A;  2J5P A;  3F72 A;  2JJ7 A;  3MD2 A;  2HKO A;  4PSX A;  1XMK A;  3ZQQ A;  3KFW X;  2RNG A;  4Y52 J;  4AU7 A;  1D0X A;  3U2R A;  3FF5 A;  3UNG C;  3L2W A;  4DIQ A;  3PO2 J;  4ENJ A;  3DLL F;  2EWN A;  3H0G J;  2IEK A;  5DS9 A;  1QZE A;  3OV8 A;  1I1G A;  2CS3 A;  5LGT A;  2PFB A;  3PQJ A;  2XRN A;  2AHQ A;  2X4H A;  5BPD A;  2LF8 A;  2MAB A;  3S3M A;  2QQA A;  4NQW B;  1MZB A;  1QZZ A;  2KIS A;  3HSE A;  4G7O F;  2VPL A;  4U7B A;  2STW A;  3ZQ7 A;  2XB5 A;  2ZB9 A;  2PMZ A;  3FXO A;  1FSH A;  3I64 A;  4EEF G;  3F22 A;  2CUE A;  3HRS A;  1LE8 B;  2XGD A;  4MO7 A;  3F8B A;  1X2M A;  1JUM A;  3KLN A;  3W6J B;  5D4R A;  2H6C A;  2K9L A;  4XID A;  4XM3 A;  3G2B A;  3LQR A;  3ZPL A;  3QYB A;  1BI0 A;  2BYV E;  3OYH A;  3H35 A;  2DMN A;  2FML A;  3G3Z A;  4G9Y A;  2R93 J;  3CCV I;  2O8K A;  3ZN0 A;  2C6Y A;  2R7T A;  3GTL J;  2NOJ B;  1FOY A;  3M8E A;  1JKR C;  4IOC F;  3H5R A;  4D7N A;  2O7O A;  1OCP A;  4N4N B;  4D0P A;  2J5O A;  2NNY A;  1X3W B;  1X3Z B;  1LVK A;  1P4A A;  2KRH A;  5BQT A;  4PJL A;  4H0E A;  1IV6 A;  4DNC A;  2R4G A;  1HLV A;  3QP5 A;  2FNA A;  2B0L A;  3OIP A;  2L4A A;  2JPC A;  3ERM A;  1W36 C;  3CLO A;  2H09 A;  4M6Y A;  3QPH A;  4CHU A;  3D1N I;  1MBJ A;  5F0C A;  3A02 A;  5D8K B;  3QPT A;  4S0H B;  5LHG A;  1FTT A;  2ZNY A;  4A3C J;  5GP9 A;  4JK1 X;  4RAF A;  1GHC A;  5KVR A;  1RRJ A;  1F36 A;  2LK2 A;  4BHB A;  2VKH A;  3M1C A;  1BR4 A;  2LY1 A;  3K70 D;  2B9S A;  3MEX A;  5GTI C;  2MLG A;  5K5O A;  3G4S I;  1TW2 A;  3LL7 A;  3R61 A;  3DV8 A;  1YJW I;  4A0X A;  2P6T A;  2F5C A;  2IGO A;  2DN0 A;  1JE8 A;  1IAW A;  5BS6 A;  3SFZ A;  5JR3 A;  2PMZ N;  2L7F P;  1T38 A;  3K69 A;  4A3J J;  4GYG A;  1NHA A;  1PVE A;  2DOD A;  1BW6 A;  3IKV A;  2HOS A;  1YJ9 I;  2WV0 A;  4OIQ F;  3BR3 A;  2TRT A;  3BG6 A;  3Q5F A;  2HDD A;  3FMR A;  2JUG A;  2OTL I;  2OZ6 A;  1G59 A;  2ECC A;  4BQO A;  4LG0 B;  2O3F A;  5M5Y J;  4DZJ A;  2K40 A;  3HC7 A;  1WFX A;  2VBX A;  3I55 I;  2WAF A;  4DYC A;  2OTJ I;  3TDU C;  1HDP A;  3WG7 H;  2HXI A;  4HQE A;  4I99 C;  4IPA A;  4G6Q A;  5HDN A;  4BAC A;  2MGQ A;  1MND A;  1DUX C;  2VC1 A;  3FHN A;  2HYG D;  1T2K A;  1J75 A;  1KQ9 A;  1SFU A;  2NVX J;  1FJL A;  3BG5 A;  1YS7 A;  1FSE A;  1OKR A;  4Y4R A;  4YII A;  3CCM I;  4HX8 A;  1HKT A;  1YW7 A;  1JJ8 C;  3CDI A;  2Y30 A;  4ZC3 A;  4HLY A;  4BJ5 C;  1H8A C;  1RI7 A;  3HG9 A;  1D1B A;  2W00 A;  3VDX A;  4A3E J;  3OR2 C;  2WTE A;  3V7S A;  2M2E A;  5ERI A;  4WWC A;  2DDB A;  1Y8R B;  2X9D A;  2KPM A;  1YIO A;  3G1L A;  1D5V A;  1R7J A;  2A6H F;  3CCY A;  4LLN A;  3A4C A;  2D5V A;  3QOP A;  2VQG A;  5TIS C;  4KDP A;  3ML6 A;  4C3I J;  1SFE A;  2QQ8 A;  1ON1 A;  1W7P D;  2Q8K A;  1MH4 A;  2MC3 A;  3V8L A;  2K86 A;  1E0E A;  2L3D A;  2XAG A;  5LGU A;  5C4X J;  1LVA A;  2OBP A;  2GLO A;  3K4M A;  3F21 A;  2N8G A;  4V2F A;  2XGX A;  5L3E A;  1FYM A;  3EUK L;  5IT9 Z;  1DP7 P;  3BG9 A;  1ZHF A;  1YRN A;  1DQU A;  2UV1 A;  3BDD A;  1R71 A;  1IRX A;  3DKW A;  2P81 A;  2I10 A;  2L01 A;  3CCS I;  1LFU P;  2UUZ A;  4FHT A;  3K4B A;  1FLI A;  3WOD F;  4R8H A;  2DA7 A;  5FLX Z;  2KDO A;  4V2G A;  4O5V A;  1U2W A;  4MFD A;  5TGT A;  3C3W A;  3OYB A;  2G7U A;  4J00 A;  3FXM A;  1WJF A;  1VQ5 I;  1BL0 A;  1QHH D;  3WTS C;  1F9N A;  3DCF A;  2ESH A;  4G8X A;  3KP6 A;  2VJ5 A;  3GW2 A;  1YJN I;  1ODD A;  3HOV J;  2XC7 A;  5DD8 A;  3MQ0 A;  2VPR A;  2Y0S A;  2L7M P;  5LRR A;  3SZT A;  2DXI A;  1ZKG A;  1RUO A;  3S1N J;  2R7F A;  2BY1 A;  4OMZ A;  3KP7 A;  2WY8 Q;  3E6B A;  1TWG J;  3OY9 A;  3OYC A;  3FXU A;  3H5A A;  4F7Z A;  1UB9 A;  3AG1 H;  2MYS A;  1K6Y A;  1S3J A;  3I5U A;  3O8G A;  4MNU A;  2LY2 A;  2Y9Y A;  4XLC A;  3VB2 A;  4PJJ A;  5H2F C;  3ZMT A;  1IO2 A;  2QLZ A;  3KE2 A;  1Z7L A;  3H9G A;  1JGS A;  2DMP A;  2ZJ2 A;  2W4S A;  2VB6 A;  2DOA A;  2YX7 A;  3I3L A;  3HOX J;  3VOE A;  2DK5 A;  1UST A;  4FX0 A;  1Q1V A;  1YE9 A;  3CUO A;  2EZK A;  2X0L A;  3IRR A;  3BT9 A;  2Y31 A;  3DTI A;  2B7E A;  2ZNZ A;  2CWE A;  2LKX A;  1O7L A;  2DOF A;  3L09 A;  2ZBK A;  1XC5 A;  4AYB N;  1YIT I;  1KYW A;  2M7B A;  2Q0O A;  4EJU A;  4XLE A;  3BCA A;  2MBF A;  1LDJ A;  4ITV A;  4XLP F;  2M8E A;  1GV5 A;  4KIF A;  4XRS A;  4AVZ A;  2EBI A;  1VI0 A;  2WAQ A;  5DM7 F;  4KT6 A;  1B8I B;  4RGR A;  1PJR A;  1IF1 A;  1H9G A;  1ONV A;  1KA8 A;  2VJJ A;  1T8I A;  3OS2 A;  2E1M B;  3I53 A;  2WV1 A;  1J7K A;  3C2G A;  3S17 J;  1TT0 A;  2ZFU A;  3RKQ A;  2K9Q A;  2ZC2 A;  5LGN A;  2HZT A;  4RB2 C;  3F3X A;  4RMN A;  3E6D A;  1BR1 A;  4A0Z A;  5KHD A;  4FE4 A;  3WGI A;  4B3X A;  2Q1Z B;  2R7Z J;  1MD0 A;  1UHM A;  3SHF A;  4KIC A;  4UV8 A;  2LR8 A;  1DDN A;  3P9I A;  3JRG A;  4BBS J;  1YFH A;  1X58 A;  1ZLJ A;  2QGU A;  3IV5 A;  4BQQ A;  5GAD J;  4MFE A;  2VBZ A;  2PJR A;  2IT0 A;  2ISY A;  2OUM A;  3F0C A;  1E3H A;  2XAQ A;  3KP2 A;  3BJ6 A;  2JMW A;  3I71 A;  1TC3 C;  4YFX F;  2CMP A;  2OA4 A;  2VKE A;  2TDX A;  1ON2 A;  1H89 C;  4U0Y A;  4M3G A;  1IXC A;  5E3M A;  1B59 A;  2BBY A;  2CV0 A;  4Z2Y A;  2GWR A;  2R5Y B;  1MMA A;  3SZP A;  5E8I A;  2EV6 A;  3NWT A;  1E17 A;  2PLY A;  1R6R A;  4KUM A;  4L9V A;  5J1R A;  4PGH A;  1FMV A;  5HLH A;  2GOM A;  1UHS A;  2ESN A;  1IZ1 A;  2BZT A;  1AKH A;  3T8T A;  4B4C A;  4XLF A;  1MSF C;  3S16 J;  2Y0M A;  2WB1 N;  1F5T A;  1ZG5 A;  3Q0W A;  4HX4 A;  1NTC A;  5FRO A;  3BCB A;  5J6X A;  4DYQ A;  1F1Z A;  1N77 A;  2F5D A;  4A5N A;  5J8F A;  3KZY A;  4M3F A;  2JA2 A;  1SC7 A;  2LRD A;  3MMY B;  1PUE E;  1YI2 I;  2IGM A;  2XVC A;  3DPT A;  3GO5 A;  3EQL F;  2L2O A;  3K9T A;  2IGK A;  3MKY B;  2CFX A;  3IHU A;  3HUG A;  2NAZ A;  2L02 A;  1ZAR A;  5F0H A;  5GAE J;  4E7H A;  3JRC A;  1MMN A;  4LB5 A;  1GXQ A;  1MGT A;  4LJZ F;  4GYI A;  1T6S A;  1TL8 A;  1ZRD A;  1W7P A;  1EA3 A;  4LB6 B;  3IH2 A;  3M4O J;  3WE3 A;  2WY7 Q;  4P55 A;  1G3Y A;  4C3H J;  1TQM A;  4F91 B;  1DGR M;  1IN6 A;  3GF2 A;  3GWZ A;  2XF6 A;  3HJE A;  1WZ2 A;  2FRH A;  1YW9 A;  4XL9 A;  4G6T B;  5F0F A;  2VKV A;  4WCG A;  1NG7 A;  2RN7 A;  4YFN F;  1VQL I;  1A5J A;  1BW5 A;  2EA2 A;  3K4C A;  3J80 K;  2HOE A;  2LLK A;  3H9Q A;  2KZV A;  4EMS A;  1ZH5 A;  2G0E A;  3K0L A;  2K9N A;  1I39 A;  1XMA A;  5J3L A;  4HF1 A;  3ZMU A;  3ABM H;  3E7L A;  4FCY A;  2JVH A;  4UUT A;  1TZL A;  2D45 A;  3B02 A;  2RGV A;  4CCJ A;  4EV0 A;  2FEZ A;  1WI3 A;  3ULQ B;  4L5I A;  3FX3 A;  2E1N A;  1UCR A;  4IRG A;  4KFC A;  2K85 A;  4XSX F;  3BR6 A;  1OCC H;  2E7W A;  4MIM A;  3IRQ A;  4E7I A;  3QOE A;  4Y15 A;  4ANJ A;  4M71 A;  1IN8 A;  3L1P A;  4IHY A;  2XDV A;  2AQE A;  3ZQF A;  3CUQ B;  1SD7 A;  5ILS A;  4L9N A;  3IWF A;  2DTR A;  3DFG A;  3FM3 A;  3ZXS A;  4QTR A;  1W5T A;  4IHT A;  2LC2 A;  5DDG A;  1MBK A;  2OCE A;  2VXD A;  3RKY A;  1EH8 A;  1Z0X A;  3FKJ A;  4DBQ A;  4F3Q A;  3JRI A;  2LH9 A;  5L3B A;  1A31 A;  5K7H A;  1R23 A;  2FF4 A;  3MKL A;  2UXN A;  2ETH A;  4NC7 A;  2XSD C;  1R4N B;  5H20 A;  4BGD A;  1OCZ H;  4CCK A;  5IT3 A;  2MA3 A;  4FQG A;  4I76 A;  3FHZ A;  3FMQ A;  1BIA A;  5CQE A;  5DD4 A;  5J1Y A;  1WCM J;  4G6D A;  2VOP A;  3CCL I;  4XSZ F;  2H8R A;  4FTH A;  1FP1 D;  4LLL A;  4XKC A;  4XQF A;  1R5H A;  3K6G A;  1X3U A;  3LFK A;  3RQI A;  2KDZ A;  4R1H A;  4M9Z A;  2EPF A;  2PG4 A;  1V3F A;  2DBB A;  1S72 I;  4ZYD A;  2D1V A;  3IH4 A;  1NH3 A;  1D8J A;  2JZY A;  2R3S A;  2X6W A;  2BE5 F;  4AC0 A;  5EYR A;  5DCM A;  2FQ4 A;  5KK1 A;  2H94 A;  3FXL A;  3JW4 A;  4FIS A;  1ETY A;  1IN7 A;  2L9V A;  4KYW A;  1U8R A;  2G7H A;  3PJR A;  3CJT B;  3C1D A;  1KU7 A;  1I1S A;  2VBW A;  4B3A A;  5BNG A;  4HDU A;  2BXY A;  2DK8 A;  3CC7 I;  3BP8 A;  3T1B A;  4BQN A;  5DM6 F;  4MTE A;  4Q48 A;  5HS9 A;  4UUS B;  3K1M A;  3KIO A;  2XAF A;  2H27 A;  2EH3 A;  3BR1 A;  2XRO A;  3V8K A;  2CFO A;  4J19 A;  2ZXJ A;  4EM0 B;  2EIN H;  1OLT A;  2E36 A;  2W48 A;  1WJE A;  3CJR B;  3L2V A;  2CU7 A;  2HNH A;  1LQ1 A;  3MZH A;  5BPI A;  4BQA A;  1R4M B;  4NHJ A;  1TQP A;  3LFU A;  4YIR X;  4YEL A;  3HUG B;  3FKI J;  3RPU D;  2VOO A;  1K78 B;  4YRV A;  2KIQ A;  3KEO A;  1JGG A;  2A3S A;  4XNF A;  2BY3 A;  2YUS A;  4I2O A;  2R92 J;  2X6O A;  3H0D A;  1UG0 A;  3HTU A;  5J1U A;  1PUF A;  3RCO A;  3HOT A;  2HGC A;  4NNJ A;  1FIA A;  4BEH B;  4X0G A;  1J59 A;  4E7J A;  1BIB A;  2YS9 A;  1ZG3 A;  3ZQI A;  2IS6 A;  1Y39 A;  1S7E A;  3DBR B;  4S05 A;  3KP4 A;  3GFJ A;  1WKM A;  2HTS A;  4E7L A;  4ESJ A;  1U5T A;  2QWW A;  5EGO A;  1T39 A;  4B43 A;  3CDH A;  4M9S A;  1IDY A;  5ICG A;  1TLH B;  3AG4 H;  2CV1 A;  2IA1 A;  3VYS B;  4OU0 A;  3GME A;  4HSR A;  1BOB A;  5IT9 K;  4XOR A;  4XOP A;  3F6V A;  5D6F A;  3OYE A;  1RR8 C;  3FXQ A;  3PFI A;  5JLX A;  4ZH4 F;  2QEN A;  4W1U A;  2XUB A;  4GGG A;  1ORK A;  5FFX A;  3ABT A;  3S93 A;  1E3O C;  2OAZ A;  1D0Z A;  4HV6 A;  5AON A;  5HNF A;  5FRM A;  1K4T A;  1WSU A;  1G3S A;  2FBH A;  3N05 A;  2W1O A;  5KNL A;  2ZME A;  1S7A A;  1HC8 A;  3CJN A;  3WHB A;  2ELJ A;  2M0C A;  3IKT A;  3A0B C;  5HNH A;  1OQY A;  4PCQ A;  5EJC A;  4DQ2 A;  1REP C;  4XRM A;  1V5F A;  4QWQ A;  1UG2 A;  4RLQ A;  1MMG A;  2P7V B;  1FOX A;  2LSO A;  1QVU A;  3S15 J;  2R7W A;  1SMT A;  3CD6 I;  3S3O A;  4E6K G;  1WI9 A;  4R79 A;  2NVT J;  1QHG A;  3GLX A;  2FMY A;  3AG3 H;  1MH3 A;  1Z3X A;  4HOB A;  5EG0 B;  3HGG A;  3K4K A;  2NS0 A;  1JT6 A;  3HRM A;  5M3M J;  2KZG A;  1MSE C;  3E3V A;  1R5G A;  2DMU A;  2JRT A;  4MQV A;  1S7O A;  2FX0 A;  4XLA A;  1R00 A;  2HR3 A;  4XKB A;  3GBG A;  1I6H J;  3X2Q H;  2LY9 A;  2BGC A;  4CXF A;  1IXR C;  1MBF A;  2CSO A;  3CCQ I;  1ETX A;  4BBR J;  2AQF A;  3WTW C;  2COM A;  2I5U A;  4I09 A;  2DMT A;  1AOY A;  1ZRE A;  3V7C A;  1T0F A;  2BVL A;  4TV7 A;  2CO5 A;  2GZW A;  4II3 A;  3SDG A;  2CG4 A;  5E79 C;  3U9G A;  2KKO A;  2K5C A;  1ETV A;  1D5Y A;  5A2Q Z;  3KEQ A;  1TNS A;  5K7Z A;  2H6B A;  1W36 D;  4XOT A;  3W6K B;  3R0A A;  5F27 A;  4JOM A;  4D1Q A;  4Y7N J;  3RYP A;  3E97 A;  2M1B A;  3LSJ A;  5E1Z B;  4IQ4 A;  4BDY A;  1XCB A;  2L7Z A;  4F93 B;  3DTK A;  3K1N A;  1VQO I;  3VYT B;  1D1A A;  4UHT A;  1JUP A;  2F4I A;  1K61 A;  2H1K A;  1WJB A;  1ULY A;  4DYR A;  3H3V K;  1XSD A;  4X1E A;  4RB3 C;  3CCU I;  1O3R A;  2AO9 A;  1Q1H A;  1IV8 A;  4BNC A;  5EDN A;  3V8J A;  3DEE A;  3UR3 C;  1FOK A;  3J7A O;  2HYF A;  2DA5 A;  1HDD C;  2M0M A;  3K4N A;  5EZH A;  5B1A H;  2ZJQ F;  3CO7 C;  2FU4 A;  2XF5 A;  5HDG A;  4M6X A;  3BPX A;  3QYE A;  1YTY A;  2XHK A;  3K4J A;  2XPV A;  1YRN B;  1BI2 A;  2RNJ A;  2F5E A;  5FLV A;  2O6G E;  3S8P A;  3F8C A;  5B3S H;  3HXL A;  3OYM A;  4OMY A;  3FMS A;  3BJA A;  4LG3 A;  4IXA A;  2BVM A;  3LQQ A;  1SD6 A;  4C9Y A;  4RBO A;  3LSM A;  4I7H A;  3FBI B;  2EZH A;  1YS6 A;  2FBK A;  3WG9 A;  3HL2 A;  2GIV A;  2DFE A;  1Z05 A;  1WJD A;  1S8N A;  3IH3 A;  2FBI A;  3HM5 A;  4IL6 C;  1LFB A;  4IO9 F;  4CGZ A;  2L5Q A;  1HF0 A;  3K2Z A;  1W4M A;  2WAQ N;  1SD4 A;  4YIF A;  4WX9 A;  4ZZL A;  2XAJ A;  1E2X A;  1FBS A;  4DW6 A;  2ISZ A;  1UHW A;  4B09 A;  4RGU A;  3I58 A;  1RR7 A;  4MEY F;  3JAM Z;  4C30 A;  1ETK A;  2BOL A;  4UB8 C;  3GTK J;  2EIM H;  3HPH A;  4B44 A;  2KHM A;  2NVY J;  1MJA A;  3Q9S A;  3HDD A;  4CZC A;  2CUZ A;  3DBH B;  3FK7 A;  4WXD A;  1APL C;  5B5E C;  4KN4 X;  4OIO F;  1OIS A;  4Y13 A;  2YU9 J;  2QKM B;  2FNP A;  2RV8 A;  1WGX A;  3I54 A;  4IF4 A;  1VF9 A;  3U1D A;  2QQ9 A;  4IX7 A;  2OC6 A;  3DLA A;  3HEF A;  2FQ3 A;  4CCM A;  3S1M J;  3QWL A;  4P1W A;  2FSW A;  3GCM A;  3QP6 A;  2ELH A;  3ZQH A;  2G9W A;  3OYN A;  4HF2 A;  2XB0 X;  5DCF A;  1BBY A;  3SXY A;  1MMD A;  1SFK A;  3DBL B;  3TOB A;  1O7F A;  3ECO A;  3VSL A;  3CP8 A;  1IRG A;  2VBY A;  1FNN A;  1RKT A;  3TW7 A;  4BKX A;  1KU2 A;  1TWH J;  4M6V A;  1YX3 A;  2V1N A;  5GTH C;  5E3N A;  2WA0 A;  3SEQ A;  3ZP5 A;  4KIG A;  3QAH A;  3SQN A;  2KJC A;  4L0Z B;  1K78 A;  3DXJ F;  1MIJ A;  2HI3 A;  2BXZ A;  4C2M J;  3MFK A;  2VON A;  2P5K A;  4ZDP A;  1QNT A;  3GTM J;  3COA C;  4RGS A;  4OIR F;  5LHH A;  5FB2 A;  2L7K A;  3PO3 J;  3ZQC A;  1D3Y A;  2HOA A;  2QBY B;  3CCJ I;  1SFO J;  4PDK A;  3R60 A;  5GAG J;  2GA1 A;  3VFZ A;  3CTA A;  3WHC A;  2JSP A;  4HQM A;  2XF7 A;  4L5E A;  2H8W A;  2E2H J;  3J80 Z;  1U78 A;  3VWB A;  3TED A;  1RET A;  2HKX A;  2M3A A;  4N4O B;  3SEZ A;  3AG2 H;  1U9O A;  2PBI A;  2DA1 A;  4A2U A;  2I8D A;  5JFR A;  1R1T A;  2W7N A;  4AIK A;  3QOD A;  3R6S A;  2DW4 A;  2DYS H;  5JHU A;  4UVC A;  4I0B A;  2CQX A;  2XAS A;  4PK4 A;  1OYW A;  1KU9 A;  4NB5 A;  5J8C A;  1XGN A;  3QU3 A;  2P6S A;  2GQQ A;  4MHG A;  2QYO A;  5LFA A;  3KP5 A;  4EAT A;  2XAU A;  3J81 Z;  4M74 A;  3TBI A;  1Y0N A;  2FJ1 A;  3TL4 X;  4BXF A;  4CCO A;  2GOX B;  3E0J B;  2DMQ A;  4M72 A;  3TMO A;  4ASN A;  1O4X A;  3D5R C;  1Z91 A;  1HA8 A;  1VQP I;  4B1R A;  5IP7 J;  2JA5 J;  2RDP A;  1UEL B;  4MLO A;  4CSW A;  1V5E A;  2M5W A;  3E6M A;  2LP0 A;  3KPH A;  3REO A;  1XDS A;  2HS5 A;  4L18 B;  1GLN A;  5HLG A;  1Z6T A;  1SAX A;  3Q0U A;  2FXA A;  2KFD A;  3OR1 C;  1TWC J;  1ZYR F;  2W84 A;  3K7A J;  3B6A A;  1S6L A;  2L9S A;  2VAS A;  5ILV A;  3GEZ A;  4L5J A;  2IW5 A;  4HNT A;  3HHH A;  1YOV B;  3I0T A;  3BC8 A;  3LOC A;  2Z16 A;  2F2E A;  1HXD A;  2XKO A;  4LK0 F;  4BY7 J;  3FZV A;  2DFH A;  2RQP A;  4IHX A;  1R1U A;  2JA8 J;  3EPZ A;  1VQN I;  3T8R A;  3R4K A;  4BS9 A;  3SYT A;  3HKZ N;  1MBE A;  1FZP B;  1XSX A;  5ICE A;  3RDI A;  4BL0 B;  1IC8 A;  4D9J A;  3CUQ A;  1AA7 A;  5FD5 A;  1N75 A;  4XLH A;  2GIZ A;  3VSK A;  3LSP A;  1E3P A;  1J09 A;  2W82 A;  5FLM J;  3MKZ A;  5CKT A;  2IGN A;  1A6Q A;  3BTC A;  1STZ A;  2L9N A;  3L2U A;  2P7C B;  4XON A;  2ZSH B;  1B8I A;  4EQQ A;  4BDZ A;  5FKM A;  4LG0 A;  2GA2 A;  1MJ9 A;  1ZN2 A;  1ZAO A;  2JQ7 A;  4JBA A;  4RAG A;  1SEU A;  4E70 A;  5M3F J;  4ESF A;  2KMU A;  1XTA A;  1FP2 A;  2DJI A;  2L0K A;  3JSP A;  4ZDL A;  1DGW Y;  2JPB A;  1J9I A;  1RUN A;  3CMY A;  1OCR H;  2DFF A;  3H3U A;  3Q0V A;  3RKX A;  3FIW A;  4ENN A;  3HOU J;  4MQ9 F;  2A6T A;  4A3B J;  3SFI A;  2ADU A;  3CLQ A;  3S2W A;  4EJO A;  5EZG A;  3BZ6 A;  4D5F A;  3JRA A;  4L0Y B;  3CC2 I;  2Z2S B;  3ZGK A;  4O3M A;  2V9P A;  2KT0 A;  3G1O A;  3MCZ A;  5AIP A;  1FOW A;  3CMM A;  1H88 C;  1CGP A;  2E2J J;  4ENM A;  2CUF A;  3EET A;  1P92 A;  2ME0 A;  3OS1 A;  4U0W A;  2FD5 A;  4CUG A;  2B63 J;  1KQ8 A;  2CRG A;  2WBM A;  1YO5 C;  3WE2 A;  4KMU X;  4LIU A;  2E2I J;  4E4H A;  3H3Z A;  1LEA A;  4L9T A;  5CVI A;  3B73 A;  2WWY A;  5FFZ A;  3BTL A;  3O8H A;  1HW1 A;  3EUH C;  1K79 A;  4QLC U;  2MD5 A;  3JRF A;  3KYC B;  1S5L C;  1WVR A;  2EA4 A;  1A36 A;  4M3E A;  4BE0 A;  4U88 A;  1RKW A;  2EQR A;  1P7I A;  2VE8 A;  3KCC A;  1FTZ A;  2E35 A;  3MKW B;  4IKF A;  4XKV A;  3GZ5 A;  2V79 A;  4B47 A;  3PNY A;  2IVM A;  3JRD A;  1FYL A;  2IS2 A;  1OMI A;  1OR7 C;  5E17 F;  3R0J A;  2R5Y A;  4HLX A;  5D5V B;  3RQ4 A;  1EKE A;  2VT2 A;  5M5X J;  2K27 A;  4JX4 A;  4OWR B;  3WTY C;  2EIL H;  4I01 A;  2IA2 A;  1HST A;  4Y17 A;  3ZOB A;  1FEX A;  4IHV A;  2K9M A;  2E1M C;  4E7K A;  3LSK A;  1A35 A;  1Y1V J;  3L2C A;  3HTS B;  4FT8 A;  1W0T A;  2O5R A;  5TJJ A;  3RZO J;  1X2N A;  4HW0 A;  2WAD A;  3ZR8 X;  3BWG A;  4AVP A;  4RB0 A;  1S9H A;  2CJJ A;  1P2F A;  1X1A A;  4DOZ A;  4EGZ A;  2M45 A;  1WPK A;  3V42 A;  4AWX B;  2XIG A;  1ZK8 A;  2KRF A;  2EZL A;  4OIP F;  3ASO H;  3BTJ A;  4PJ0 C;  3L9F A;  4N9I A;  5FKN A;  2IXS A;  2M4G A;  4K2E A;  2QF7 A;  2X51 A;  4PSW A;  1WJA A;  3BY6 A;  2AS5 F;  1T98 A;  2EIJ H;  3MN2 A;  4ZTF A;  1U5T B;  4HRI A;  4PFP A;  2K4B A;  5HVQ C;  1ZTR A;  3GTJ J;  2PQ8 A;  3GTO J;  2VJI A;  4ENK A;  3K10 A;  1ZQ3 P;  4NC6 A;  2KLO A;  2TCT A;  3EYY A;  5CQG A;  5IP6 A;  1JXS A;  1POG A;  3PUB A;  4EJT A;  2R7S A;  4NC8 A;  1FMW A;  9ANT A;  3VEP A;  2QQB A;  3ECH A;  3CDL A;  2VIX A;  4A6D A;  5IYC J;  1JTX A;  2LMD A;  4KIS A;  5FD6 A;  4XLN F;  3LSH A;  1LPQ A;  3HBL A;  4Q5S F;  3WGG A;  2QBY A;  4I6Z A;  2BW3 A;  1KGS A;  2JVG A;  4D7M A;  2OQG A;  2DQR A;  2YPR A;  5B1B H;  4HYE A;  3WTZ A;  2STT A;  1YYV A;  3E5U A;  4HAM A;  2P4W A;  2XPW A;  2V26 A;  2DA4 A;  3K2A A;  4JQF A;  1AU7 A;  2L9R A;  3LAP A;  2V1D A;  2VOD A;  1X19 A;  3TO6 A;  3RKW A;  1H0M A;  2DT6 A;  2HOT A;  1LDK B;  3E5X A;  2OQR A;  2UWM A;  2E19 A;  1YIJ I;  2Q2E B;  1JKO C;  3KZI C;  4WXC A;  2GXG A;  5JVG F;  1G4D A;  3HHG A;  5F64 A;  2PX9 A;  3WU2 C;  4RGX A;  4EJV A;  3WU0 A;  1V5G A;  5M5W J;  1GVD A;  3BPV A;  4HG2 A;  2HZD A;  2NS7 A;  2XKP A;  2X1D A;  1QRY A;  5DTD A;  4ETS A;  2CUJ A;  1FIP A;  1BOA A;  2QKL B;  3PIP F;  3GZ6 A;  2VL8 A;  3BZK A;  3CP2 A;  2NOG A;  3F9K A;  3M1E A;  1YG2 A;  4PZJ A;  3JTH A;  3W6V A;  2DYR H;  2ZKZ A;  1MBH A;  4MTD A;  2ZXH A;  3BR5 A;  3ABK H;  1JTY A;  5EF6 A;  2LVS A;  3KEY A;  2R7U A;  4JX6 A;  5AIQ A;  2NVU B;  2DJN A;  1GV2 A;  4IEJ A;  3NWS A;  1B9M A;  1OPC A;  1FC3 A;  3FXJ A;  3KYD B;  3GFM A;  4FET A;  3MZY A;  3S1R J;  3HOY J;  4HA8 A;  2ZXW H;  2HVS A;  3L7W A;  1HOM A;  2ID6 A;  1VQK I;  4Q47 A;  1VZ0 A;  2VJ4 A;  4UV9 A;  2DT7 B;  3LST A;  3U1K A;  3LSR A;  1D8K A;  2M30 A;  4ZJZ A;  2LBF A;  2AXL A;  4G7H F;  1YHQ I;  3ZCO A;  3ZMS A;  4XN3 A;  4IHS A;  2CQN A;  3F8N A;  3H9J A;  5E3O A;  4DJA A;  5J4V A;  3TW6 A;  1R9T J;  2PN6 A;  3ROU A;  3WTV C;  5L3F A;  3OWT A;  3OS0 A;  1CQT A;  1IGN A;  2ECB A;  2K3P A;  2F5F A;  3OSG A;  5HS8 A;  1UMQ A;  1Z77 A;  2VQL A;  3W2A A;  2PI0 A;  5EEA A;  1XGS A;  4HNU A;  3M8J A;  1R1V A;  4HBL A;  5FGM A;  4KN7 X;  2DDA A;  3HRU A;  3RI4 A;  2M4K A;  5ED4 A;  4RA2 A;  1QPI A;  3J7Y J;  5CLS A;  5IOZ A;  1TNT A;  2XGC A;  5D5W B;  1U3E M;  4A12 A;  4XRF A;  5HLI A;  3HKZ A;  3LSG A;  4FE7 A;  3BTI A;  4ON0 A;  3J7Z I;  1F4K A;  2M34 A;  1M1E B;  3RJP A;  2JUC A;  4ZYE A;  2RAE A;  3F8F A;  1RIO H;  1WJ5 A;  3SJM A;  3P9K A;  5EEG A;  5DUI A;  1BJZ A;  3WTT C;  3AAF A;  1LUJ B;  3HB9 A;  1BC7 C;  2IRF G;  5H6R A;  1PUF B;  3CF5 F;  4A6E A;  3V7R A;  3B6C A;  1BI1 A;  2P5L C;  2OD5 A;  2CW7 A;  2XSJ C;  1WWX A;  4HPQ A;  1X1P A;  3SZG A;  1BN5 A;  1MNE A;  4OOI A;  3G73 A;  4G12 A;  2LRE A;  2EJR A;  5A2Q K;  2KQR A;  3C7J A;  1FBQ A;  4PGG A;  4E7Z A;  2JA7 J;  2VC0 A;  2HYJ A;  4A3K J;  2LDU A;  3DWL E;  2E1O A;  1YW8 A;  3RPQ A;  5CVJ A;  1SAN A;  1O3Q A;  4BE2 A;  2YX4 A;  3ZRG A;  5LLQ A;  3P7N A;  2E60 A;  4OIN F;  3A0H C;  2ZCW A;  2GBY A;  1O3T A;  3OL3 A;  4U7D A;  4LOC A;  4ZYG A;  3M8F A;  4O6J A;  1B72 A;  4HDV A;  2DA2 A;  5L3C A;  2LD5 A;  4IRI A;  5JVT A;  1FPQ A;  4KIB A;  1UJ8 A;  1MW7 A;  3GTG J;  3QPS A;  1I3Q J;  2LNB A;  3FXK A;  4KIT B;  3QYF A;  3OYI A;  1QVT A;  1W5S A;  3U21 A;  4IZZ A;  1O3S A;  2DT5 A;  3LWF A;  2CQK A;  1GUU A;  4KA4 A;  2CW8 A;  5J40 A;  4HST A;  2GAU A;  1N25 A;  4CYC A;  2OJE D;  3RYR A;  4CA0 A;  1DPU A;  4KT5 C;  4XMY A;  1KU3 A;  5K1Y A;  4CYC B;  3PSI A;  1Z67 A;  1SVL A;  1IUF A;  4HZF A;  3O2P E;  1OYY A;  2BEO A;  3GFI A;  2R7D A;  4B8X A;  3A01 B;  2Z99 A;  2A5Y B;  2VKD A;  4P5O A;  3H92 A;  3L2R A;  1B72 B;  3ASN H;  3TO9 A;  1QBJ A;  3I4P A;  2BHZ A;  1IN4 A;  3ELK A;  4ZYA A;  3EDP A;  1G2H A;  2RKH A; 
#chains in the Genus database with same CATH homology
 1IW7 F;  4KNY A;  3NRV A;  3WTX C;  4AIH A;  2Q2E A;  2DFI A;  1Z6R A;  2V9V A;  1HKS A;  1J2X A;  3LA2 A;  5D6E A;  1MDM A;  2KJB A;  2HFH A;  1WRJ A;  2HQN A;  4P96 A;  5FLX K;  1L3L A;  1IXS B;  2ZO4 A;  2FOK A;  5LEJ A;  1LNW A;  2W24 A;  4IRH A;  3TOA A;  3T5X A;  2L54 A;  2K02 A;  3Q9V A;  4ESB A;  2EV0 A;  3DPL C;  3HIF A;  4A0Y A;  4AD9 A;  5DEQ A;  4LGW A;  3KLO A;  4HF0 A;  3ZMV A;  5LRS A;  1PP8 F;  2RVC A;  2IA0 A;  2Z5U A;  5ILU A;  1S29 A;  5CYV A;  1LB2 A;  1HKQ A;  3I59 A;  2MH2 A;  2MH9 A;  3RPU A;  3D5L A;  2QVO A;  2OU2 A;  3IL2 A;  1XSV A;  1B9N A;  2NRA C;  1OR7 A;  2E1C A;  4G7Z F;  1K6O A;  1Z1D A;  3HSR A;  3C18 A;  2EFQ A;  2DI3 A;  2KIF A;  2PJP A;  3PQK A;  1HBX G;  1XGO A;  3BRO A;  2UXX A;  5HS7 A;  3E5Q A;  5H6Q A;  3CO6 C;  4EGY A;  2D2W A;  1SFX A;  3TO7 A;  1RNL A;  1TQI A;  3JTG A;  3TQN A;  5E1W A;  1ZRC A;  1YQA A;  4M73 A;  4FX4 A;  1BC8 C;  1HW2 A;  1I27 A;  2E7X A;  1V4R A;  5CVU A;  1XDU A;  3TKY A;  4BYY A;  1FT9 A;  2RC4 A;  4BAY A;  3GVA A;  4N0B A;  1U6G A;  4BHC A;  1C0W A;  4I98 B;  5FO5 A;  4N9H A;  4I0A A;  5K5R A;  1TTY A;  1ZG1 A;  2P8T A;  5TRD A;  1FYK A;  2HDC A;  2KIM A;  1O57 A;  1EH7 A;  3BOQ A;  4GXO A;  1I6X A;  1IUY A;  2L4M A;  2A69 F;  4LMY A;  1RZ4 A;  3RIR A;  4L9J A;  3DQV C;  2EFO A;  3LAJ A;  2UZK A;  4EM2 A;  5CJ9 A;  5DCM B;  1UFM A;  3ZMD A;  2IPQ X;  3FM5 A;  5DUK A;  3O6B B;  1DPR A;  2W57 A;  1J5Y A;  1QZY A;  2GXB A;  4NQW A;  4EJW A;  1G3W A;  2JTV A;  3D0S A;  5D5U B;  1JHH A;  5E8G A;  3ZMZ A;  1XCV A;  5D8L B;  2M87 A;  1XGM A;  4RAY A;  1GXP A;  1BM9 A;  2CW0 F;  2XV4 S;  3KET A;  2P5V A;  2V1U A;  2YSR A;  4UNO A;  1ZGA A;  2Y48 A;  3GX4 X;  1W7P B;  2A07 F;  5LHI A;  4U0V A;  4P9F A;  2DPU A;  2JT1 A;  3JSO A;  3F23 A;  2EK5 A;  3QU6 A;  1HSJ A;  1B1B A;  5E18 F;  5LBQ A;  5DYM A;  3ERE D;  2OZU A;  3HYI A;  1EH6 A;  1IRF A;  1LEB A;  3DEU A;  2O0Y A;  4ZZD A;  3IC7 A;  2FE3 A;  4S04 A;  1CF7 A;  2KIU A;  2PMH A;  3CUQ C;  3F6O A;  4CZZ A;  2ZFW A;  3WTU C;  3WGH A;  3M9A A;  1YLF A;  1B6A A;  1FX7 A;  1R36 A;  1IN5 A;  1LJ9 A;  1L0O C;  2QZ8 A;  4WXH A;  4CO8 A;  4A5M A;  2EV5 A;  5L3G A;  2ZME B;  1ZGJ A;  4LFU A;  6PAX A;  3MWM A;  2JSC A;  1P6R A;  2YU3 A;  1ZRF A;  1Z7U A;  2Z33 A;  3GUD A;  5D5X B;  3K1P A;  3EUH A;  1R22 A;  3HRT A;  4YG2 F;  4WK8 F;  3JAM K;  5E1X A;  1TBX A;  2A61 A;  3V4G A;  2K4J A;  4CYD A;  1JHF A;  1KYZ A;  1AWC A;  2DLL A;  2BV6 A;  4IJA A;  5K5Q A;  2NYX A;  5BOX A;  1A04 A;  1G3T A;  1HQC A;  3LA3 A;  3WU1 B;  3I59 B;  3HSF A;  3ABU A;  1OYI A;  1Y0U A;  3T0Y A;  1LDD A;  2HEO A;  3NQO A;  3MAJ A;  2XAH A;  5F6F A;  5ICF A;  4XBF A;  4BH9 A;  4I02 A;  3GFL A;  4P9U A;  3N4M A;  2EFN A;  3N97 A;  5D4S A;  3RTR A;  2A68 F;  5CVV A;  4EVI A;  1HW5 A;  4GO1 A;  1K7A A;  1CF7 B;  2MLK A;  3BJO A;  1ZLK A;  1SD5 A;  5CVR A;  2ACJ A;  2CYY A;  5ICC A;  2Z9O A;  3DF8 A;  2FA5 A;  1PDN C;  4UVA A;  3L00 A;  2DU9 A;  1R58 A;  5LEK A;  1FBU A;  3F8M A;  2EB7 A;  2DAO A;  1P4W A;  2HQR A;  2PMU A;  3ISP A;  1B4A A;  3NEU A;  5F1R A;  1USS A;  4BXU A;  2EFW A;  4CDG A;  2DQL A;  3P9C A;  1FWZ A;  1EV7 A;  3VOD A;  2QM3 A;  4RAZ A;  2K7L A;  4WF2 A;  2VE9 A;  4LD5 A;  2VXZ A;  1QPM A;  4MGR A;  4RB1 A;  4AIJ A;  1QQI A;  3O3K A;  4YFK F;  5E20 A;  3TGN A;  1GVJ A;  2LF7 A;  4LLG F;  3FWE A;  1P4X A;  2O03 A;  1QGP A;  4GCV A;  4LK1 F;  1H9T A;  2WC2 A;  4HX7 A;  4HV5 A;  2IJL A;  2NNN A;  5JI6 A;  3EYI A;  2W85 A;  2EFP A;  1U5T C;  5BMZ A;  3KZZ A;  4UVB A;  2QUF A;  1MDM B;  2DO7 A;  3HOS A;  2O61 A;  4UXN A;  1BI3 A;  1G6N A;  2HWV A;  3J81 K;  3LA7 A;  4CIC A;  1BJA A;  3FXR A;  4UUV A;  4IVN A;  4Q4Z F;  3ZN1 A;  1WQ2 A;  1XB4 A;  1PP7 U;  1QO0 D;  3M7G A;  4EM1 A;  3E6C C;  2CGP A;  5HDK A;  1XD7 A;  4M9X A;  2D1H A;  3QRF F;  3KP3 A;  2LKP A;  3OOP A;  2VN2 A;  4MEX F;  2V6C A;  2VT3 A;  3TDZ C;  3GXO A;  1FY7 A;  2V1X A;  2A6E F;  1XN7 A;  1VTN C;  2IP2 A;  1TW3 A;  2PEX A;  3IWZ A;  1SMY F;  5EEH A;  2O8X A;  2YR2 A;  2Z3Y A;  2Y75 A;  4RS8 A;  4G94 A;  1J0R A;  3DP7 A;  4BHP A;  4KMF A;  5DV5 A;  5L3D A;  1KQ0 A;  5HOO A;  4ZYH A;  2W25 A;  1MKM A;  2DPD A;  3GYH X;  1Z9C A;  1MJB A;  1I5Z A;  2HTJ A;  2J5P A;  3F72 A;  2HKO A;  1XMK A;  3KFW X;  3U2R A;  3FF5 A;  4ENJ A;  2EWN A;  3OV8 A;  1I1G A;  5LGT A;  2PFB A;  3PQJ A;  2XRN A;  2X4H A;  5BPD A;  2LF8 A;  2QQA A;  1MZB A;  1QZZ A;  4G7O F;  3HSE A;  4U7B A;  2STW A;  3ZQ7 A;  1FSH A;  3I64 A;  3F22 A;  3HRS A;  3F8B A;  3KLN A;  3W6J B;  5D4R A;  2H6C A;  3LQR A;  3ZPL A;  1BI0 A;  2BYV E;  2FML A;  4G9Y A;  3G3Z A;  3ZN0 A;  2C6Y A;  3M8E A;  4D0P A;  2J5O A;  2NNY A;  1P4A A;  5BQT A;  4H0E A;  4DNC A;  3QP5 A;  2FNA A;  2B0L A;  2L4A A;  2JPC A;  3CLO A;  2H09 A;  4M6Y A;  3QPH A;  4CHU A;  5D8K B;  3QPT A;  5LHG A;  2ZNY A;  4JK1 X;  1GHC A;  5KVR A;  4BHB A;  3MEX A;  2MLG A;  5K5O A;  1TW2 A;  3R61 A;  3DV8 A;  4A0X A;  2P6T A;  2F5C A;  1JE8 A;  1IAW A;  5BS6 A;  3SFZ A;  5JR3 A;  1T38 A;  3K69 A;  4GYG A;  1NHA A;  3IKV A;  4OIQ F;  2WV0 A;  3Q5F A;  3FMR A;  2OZ6 A;  4LG0 B;  2O3F A;  2VBX A;  3TDU C;  4HQE A;  4IPA A;  4G6Q A;  5HDN A;  1DUX C;  2VC1 A;  2HYG D;  1T2K A;  1J75 A;  1KQ9 A;  1SFU A;  1YS7 A;  1FSE A;  1OKR A;  4YII A;  1HKT A;  4HX8 A;  1YW7 A;  4HLY A;  1RI7 A;  2WTE A;  3V7S A;  5ERI A;  4WWC A;  1YIO A;  1D5V A;  1R7J A;  2A6H F;  4LLN A;  3QOP A;  4KDP A;  3ML6 A;  1SFE A;  2Q8K A;  1ON1 A;  1W7P D;  2MC3 A;  3V8L A;  2K86 A;  2L3D A;  2XAG A;  5LGU A;  1LVA A;  2OBP A;  3F21 A;  2XGX A;  5L3E A;  1FYM A;  5IT9 Z;  1DP7 P;  1ZHF A;  3BDD A;  3DKW A;  2L01 A;  4FHT A;  1FLI A;  3WOD F;  4R8H A;  5FLX Z;  4O5V A;  1U2W A;  3C3W A;  2G7U A;  3WTS C;  1F9N A;  2ESH A;  4G8X A;  3KP6 A;  3GW2 A;  1ODD A;  5DD8 A;  3MQ0 A;  5LRR A;  3SZT A;  1RUO A;  2R7F A;  4OMZ A;  3KP7 A;  3E6B A;  3FXU A;  4F7Z A;  1UB9 A;  1S3J A;  3I5U A;  4MNU A;  3VB2 A;  3ZMT A;  2QLZ A;  3KE2 A;  1JGS A;  2ZJ2 A;  2YX7 A;  3VOE A;  2DK5 A;  1UST A;  4FX0 A;  3CUO A;  2X0L A;  3IRR A;  2ZNZ A;  2CWE A;  1O7L A;  3L09 A;  2ZBK A;  1KYW A;  2Q0O A;  4EJU A;  2MBF A;  1LDJ A;  4XLP F;  2M8E A;  4KIF A;  4RGR A;  1IF1 A;  1H9G A;  1ONV A;  1KA8 A;  3I53 A;  1J7K A;  5LGN A;  2HZT A;  4RB2 C;  3F3X A;  3E6D A;  4A0Z A;  3WGI A;  1MD0 A;  1UHM A;  3SHF A;  4KIC A;  4UV8 A;  1DDN A;  3P9I A;  1YFH A;  1ZLJ A;  2VBZ A;  2IT0 A;  2ISY A;  2XAQ A;  3KP2 A;  3BJ6 A;  3I71 A;  4YFX F;  2OA4 A;  2TDX A;  1ON2 A;  4U0Y A;  1IXC A;  1B59 A;  2BBY A;  4Z2Y A;  2GWR A;  3SZP A;  5E8I A;  2EV6 A;  1E17 A;  2PLY A;  4KUM A;  4L9V A;  4PGH A;  5HLH A;  2ESN A;  1IZ1 A;  3T8T A;  2Y0M A;  1F5T A;  1ZG5 A;  4HX4 A;  5J6X A;  1F1Z A;  2F5D A;  4A5N A;  5J8F A;  3KZY A;  1PUE E;  2XVC A;  3DPT A;  3GO5 A;  3EQL F;  3K9T A;  2CFX A;  3IHU A;  3HUG A;  2NAZ A;  2L02 A;  1ZAR A;  4LB5 A;  1GXQ A;  1MGT A;  4LJZ F;  4GYI A;  1T6S A;  1ZRD A;  1W7P A;  4LB6 B;  3WE3 A;  4P55 A;  1G3Y A;  1TQM A;  1IN6 A;  3GF2 A;  3GWZ A;  2FRH A;  1YW9 A;  4WCG A;  2RN7 A;  4YFN F;  2EA2 A;  3J80 K;  2HOE A;  4EMS A;  1ZH5 A;  3K0L A;  1XMA A;  4HF1 A;  3ZMU A;  2D45 A;  3B02 A;  2RGV A;  4EV0 A;  2FEZ A;  3ULQ B;  4L5I A;  3FX3 A;  2E1N A;  1UCR A;  4IRG A;  4KFC A;  4XSX F;  2E7W A;  3IRQ A;  4Y15 A;  4M71 A;  1IN8 A;  3CUQ B;  1SD7 A;  5ILS A;  4L9N A;  3IWF A;  2DTR A;  3DFG A;  3FM3 A;  1W5T A;  4IHT A;  5DDG A;  3RKY A;  1EH8 A;  5L3B A;  1R23 A;  2FF4 A;  2UXN A;  2ETH A;  5H20 A;  5IT3 A;  2MA3 A;  3FHZ A;  3FMQ A;  1BIA A;  5DD4 A;  4G6D A;  2VOP A;  4XSZ F;  1FP1 D;  4LLL A;  1R5H A;  1X3U A;  3LFK A;  4R1H A;  4M9Z A;  2PG4 A;  1V3F A;  2DBB A;  4ZYD A;  2D1V A;  1D8J A;  2JZY A;  2R3S A;  2BE5 F;  5DCM A;  5KK1 A;  2H94 A;  3JW4 A;  1IN7 A;  4KYW A;  1U8R A;  2G7H A;  3C1D A;  1KU7 A;  1I1S A;  2VBW A;  4HDU A;  2DK8 A;  3BP8 A;  3T1B A;  4MTE A;  4Q48 A;  5HS9 A;  3K1M A;  2XAF A;  2H27 A;  2XRO A;  3V8K A;  2ZXJ A;  4EM0 B;  1LQ1 A;  3MZH A;  5BPI A;  4BQA A;  4NHJ A;  1TQP A;  2VOO A;  1K78 B;  3KEO A;  2A3S A;  4I2O A;  3HTU A;  3HOT A;  2HGC A;  1J59 A;  1BIB A;  1ZG3 A;  4S05 A;  3KP4 A;  3GFJ A;  1WKM A;  2HTS A;  4ESJ A;  1U5T A;  2QWW A;  1T39 A;  3CDH A;  4M9S A;  5ICG A;  1TLH B;  2IA1 A;  4OU0 A;  5IT9 K;  3F6V A;  5D6F A;  3FXQ A;  3PFI A;  4ZH4 F;  2QEN A;  2XUB A;  4GGG A;  5FFX A;  3ABT A;  2OAZ A;  4HV6 A;  5AON A;  1WSU A;  1G3S A;  2FBH A;  2ZME A;  1S7A A;  3CJN A;  3IKT A;  4PCQ A;  4DQ2 A;  1REP C;  4QWQ A;  2P7V B;  2LSO A;  1SMT A;  1WI9 A;  4R79 A;  3GLX A;  2FMY A;  4HOB A;  2NS0 A;  3HRM A;  3E3V A;  1R5G A;  2JRT A;  4MQV A;  1S7O A;  1R00 A;  2HR3 A;  2BGC A;  4CXF A;  1IXR C;  2CSO A;  3WTW C;  2COM A;  4I09 A;  1AOY A;  1ZRE A;  3V7C A;  1T0F A;  4TV7 A;  2CO5 A;  2GZW A;  3U9G A;  2CG4 A;  2KKO A;  5A2Q Z;  3KEQ A;  1TNS A;  2H6B A;  3W6K B;  3R0A A;  3RYP A;  3E97 A;  2M1B A;  5E1Z B;  1XCB A;  3K1N A;  4UHT A;  1ULY A;  1XSD A;  4RB3 C;  1O3R A;  1Q1H A;  4BNC A;  3V8J A;  1FOK A;  3J7A O;  2HYF A;  3CO7 C;  2FU4 A;  5HDG A;  4M6X A;  3BPX A;  1YTY A;  2XHK A;  1BI2 A;  2RNJ A;  2F5E A;  2O6G E;  3F8C A;  4OMY A;  3FMS A;  3BJA A;  4IXA A;  3LQQ A;  1SD6 A;  4I7H A;  1YS6 A;  2FBK A;  3WG9 A;  2GIV A;  1Z05 A;  1S8N A;  2FBI A;  4CGZ A;  3K2Z A;  1W4M A;  4YIF A;  1SD4 A;  4WX9 A;  4ZZL A;  2XAJ A;  1E2X A;  1FBS A;  2ISZ A;  1UHW A;  4B09 A;  4RGU A;  3I58 A;  4MEY F;  3JAM Z;  1MJA A;  3Q9S A;  4WXD A;  4KN4 X;  4OIO F;  4Y13 A;  2FNP A;  2RV8 A;  3I54 A;  4IF4 A;  3U1D A;  2QQ9 A;  2FQ3 A;  2FSW A;  3QP6 A;  2ELH A;  2G9W A;  4HF2 A;  5DCF A;  1BBY A;  3SXY A;  3TOB A;  1O7F A;  3ECO A;  1IRG A;  2VBY A;  1FNN A;  1KU2 A;  3ZP5 A;  4KIG A;  3QAH A;  3SQN A;  2KJC A;  4L0Z B;  1K78 A;  3DXJ F;  3MFK A;  2VON A;  2P5K A;  1QNT A;  3COA C;  4RGS A;  4OIR F;  5LHH A;  5FB2 A;  1D3Y A;  2QBY B;  4PDK A;  3R60 A;  2GA1 A;  3VFZ A;  3CTA A;  4HQM A;  3J80 Z;  1U78 A;  2HKX A;  2PBI A;  4A2U A;  5JFR A;  1R1T A;  4AIK A;  3R6S A;  2DW4 A;  5JHU A;  4UVC A;  4I0B A;  2XAS A;  1OYW A;  1KU9 A;  4NB5 A;  5J8C A;  1XGN A;  3QU3 A;  2P6S A;  2GQQ A;  4MHG A;  2QYO A;  3KP5 A;  3J81 Z;  4M74 A;  4M72 A;  4ASN A;  1Z91 A;  2RDP A;  2M5W A;  3E6M A;  3REO A;  1XDS A;  2HS5 A;  4L18 B;  5HLG A;  1Z6T A;  1SAX A;  2FXA A;  1ZYR F;  2W84 A;  1S6L A;  5ILV A;  3GEZ A;  4L5J A;  2IW5 A;  3HHH A;  3I0T A;  2F2E A;  1HXD A;  2XKO A;  4LK0 F;  3FZV A;  2RQP A;  1R1U A;  3T8R A;  3R4K A;  1FZP B;  1XSX A;  5ICE A;  3RDI A;  3CUQ A;  5FD5 A;  1STZ A;  2P7C B;  4EQQ A;  4LG0 A;  2GA2 A;  1MJ9 A;  1ZN2 A;  1ZAO A;  4JBA A;  4E70 A;  4ESF A;  1FP2 A;  3JSP A;  2JPB A;  1J9I A;  1RUN A;  3H3U A;  3RKX A;  4ENN A;  4MQ9 F;  2ADU A;  3S2W A;  4EJO A;  3BZ6 A;  4L0Y B;  4O3M A;  3MCZ A;  5AIP A;  1CGP A;  4ENM A;  3EET A;  1P92 A;  4U0W A;  1KQ8 A;  1YO5 C;  3WE2 A;  4KMU X;  3H3Z A;  1LEA A;  4L9T A;  5CVI A;  3B73 A;  2WWY A;  5FFZ A;  1K79 A;  1HW1 A;  4QLC U;  2MD5 A;  2EA4 A;  4U88 A;  2VE8 A;  3KCC A;  3GZ5 A;  2V79 A;  2IVM A;  1FYL A;  5E17 F;  1OMI A;  3R0J A;  4HLX A;  5D5V B;  2VT2 A;  2K27 A;  3WTY C;  4Y17 A;  4I01 A;  2IA2 A;  1HST A;  3L2C A;  3HTS B;  4FT8 A;  5TJJ A;  4HW0 A;  3BWG A;  4AVP A;  4RB0 A;  1P2F A;  4EGZ A;  2M45 A;  4AWX B;  2XIG A;  2KRF A;  4OIP F;  3L9F A;  4N9I A;  4K2E A;  3BY6 A;  2AS5 F;  1T98 A;  1U5T B;  2K4B A;  5HVQ C;  2PQ8 A;  4ENK A;  3EYY A;  1JXS A;  4EJT A;  3VEP A;  2QQB A;  3ECH A;  4A6D A;  5FD6 A;  4XLN F;  4Q5S F;  3WGG A;  2QBY A;  1KGS A;  2OQG A;  2DQR A;  2YPR A;  4HYE A;  3WTZ A;  2STT A;  1YYV A;  3E5U A;  4HAM A;  2P4W A;  4JQF A;  3LAP A;  2V1D A;  2VOD A;  3TO6 A;  3RKW A;  1H0M A;  1LDK B;  3E5X A;  2OQR A;  2UWM A;  4WXC A;  2GXG A;  1G4D A;  3HHG A;  5F64 A;  4EJV A;  4RGX A;  3WU0 A;  3BPV A;  2XKP A;  4ETS A;  1BOA A;  3GZ6 A;  3M1E A;  1YG2 A;  4PZJ A;  3JTH A;  2ZKZ A;  4MTD A;  5AIQ A;  1B9M A;  1OPC A;  1FC3 A;  3GFM A;  3MZY A;  4HA8 A;  3L7W A;  4Q47 A;  4UV9 A;  3LST A;  1D8K A;  2M30 A;  2AXL A;  4G7H F;  3ZMS A;  4IHS A;  3F8N A;  2PN6 A;  3ROU A;  3WTV C;  5L3F A;  2F5F A;  5HS8 A;  2PI0 A;  1XGS A;  1R1V A;  4HBL A;  5FGM A;  4KN7 X;  3HRU A;  3RI4 A;  5ED4 A;  5CLS A;  1TNT A;  5D5W B;  1U3E M;  4A12 A;  4XRF A;  5HLI A;  4ON0 A;  1F4K A;  3RJP A;  4ZYE A;  3F8F A;  1RIO H;  1BC7 C;  3P9K A;  5EEG A;  5DUI A;  3WTT C;  3AAF A;  2IRF G;  5H6R A;  4A6E A;  3V7R A;  1BI1 A;  2P5L C;  2OD5 A;  1WWX A;  1BN5 A;  4OOI A;  3G73 A;  2EJR A;  5A2Q K;  3C7J A;  1FBQ A;  4PGG A;  2VC0 A;  2LDU A;  1YW8 A;  3RPQ A;  5CVJ A;  1O3Q A;  2YX4 A;  5LLQ A;  3P7N A;  4OIN F;  2ZCW A;  1O3T A;  4U7D A;  4ZYG A;  3M8F A;  4O6J A;  4HDV A;  5L3C A;  4IRI A;  5JVT A;  1FPQ A;  4KIB A;  2LNB A;  1W5S A;  1O3S A;  2DT5 A;  3LWF A;  2CQK A;  4KA4 A;  2GAU A;  3RYR A;  1DPU A;  4KT5 C;  1KU3 A;  5K1Y A;  4HZF A;  3O2P E;  1OYY A;  2BEO A;  3GFI A;  2R7D A;  4B8X A;  2Z99 A;  2A5Y B;  4P5O A;  3H92 A;  3TO9 A;  1QBJ A;  3I4P A;  1IN4 A;  3ELK A;  3EDP A;  2RKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...