2A07F

Crystal structure of foxp2 bound specifically to dna.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
VRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*AP*CP*TP*AP*TP*GP*AP*AP*AP*CP*AP*AP*AP*TP*TP*TP*TP*
publication title Structure of the Forkhead Domain of FOXP2 Bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 82
sequence length 82
chains with identical sequence G, H, I, J, K
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a07F00
1K7AA 5D6EA 4BYYA 3F8CA 3VEPA 2KJBA 3KP3A 3F8BA 4BH9A 4AIHA 2FXAA 4RAZA 2E7WA 5E1XA 1KQ8A 1TW2A 1F9NA 2IJLA 3E6DA 3HHGA 4KMUX 5E8GA 2IA0A 1T2KA 3Q5FA 3G3ZA 4AIKA 1USSA 2CG4A 5IT3A 2HR3A 1PP7U 4HW0A 1C0WA 1ZGJA 4MQ9F 5DEQA 4A0YA 1U3EM 2M30A 1LJ9A 5CVVA 1G4DA 2UXXA 3L7WA 4KFCA 1J75A 4EGYA 1Z7UA 1USTA 1HKSA 2FOKA 1XGSA 2VBXA 2ESNA 2V1XA 5FFXA 4I01A 1SFUA 4GYIA 3S2WA 2A6EF 5BPIA 2GAUA 5L3EA 1BI0A 2L4MA 5FD5A 3WTXC 3R61A 2DAOA 3ROUA 1BIBA 2EK5A 2G7HA 3BDDA 1QNTA 1ZN2A 2W84A 3T0YA 3OOPA 2Y48A 3F3XA 3ISPA 2FA5A 4K2EA 2C6YA 3GZ5A 4PDKA 4EJUA 4ZYDA 2NAZA 3BJAA 1DPUA 2RGVA 3N4MA 1HKTA 1J59A 3FXRA 1V4RA 3C3WA 2V1DA 3CDHA 3J7AO 2ZMEA 1MZBA 2XASA 2MLKA 4G7ZF 4L9JA 3QU3A 2ZBKA 1P6RA 3L2CA 1O3RA 3U9GA 3V7SA 2P6TA 1HSTA 1OMIA 2EA4A 4E70A 4N0BA 4IVNA 3RDIA 2AXLA 5AIQA 1H9TA 3HOSA 3W6JB 4N9IA 3ZMZA 5LHGA 4EJVA 3P9KA 4KIGA 5CVRA 5D8LB 2L01A 4QWQA 5DD8A 4BNCA 2D2WA 2K4BA 4G9YA 3KP2A 3RKYA 4L0ZB 1KA8A 4B09A 1Z91A 2ZFWA 4OIRF 4HBLA 1UHMA 3LA2A 3OV8A 1IN4A 3K1NA 1OYWA 1S7AA 3GFLA 3QP6A 5K5QA 1S8NA 1HW2A 4G6DA 3IWFA 3J80Z 2GZWA 2OD5A 1WSUA 5D4RA 4P5OA 2A3SA 2BE5F 4UHTA 1QZZA 2VODA 5F1RA 2F5DA 2AS5F 2YX4A 5DCMB 3I58A 5L3FA 1T0FA 1KQ0A 1L3LA 1SD4A 3LWFA 4HDUA 1XB4A 2HQRA 2PFBA 2D1HA 4ESBA 3SZTA 2O3FA 3GF2A 1Z6TA 1YW7A 5L3CA 4BHPA 2CFXA 5J8CA 1TBXA 3GLXA 4QLCU 1RUOA 2L3DA 1F5TA 5HLIA 3HSEA 2RVCA 2DLLA 4RB2C 1T6SA 1R7JA 4ZZLA 1RNLA 2BBYA 1W4MA 2XVCA 4UVBA 2J5PA 1MGTA 2DI3A 2CQKA 1O3TA 4OOIA 3HSFA 4MQVA 1B4AA 2QYOA 3D5LA 2IPQX 3MFKA 4RB0A 2A5YB 2HEOA 1BI2A 1O3QA 2XKPA 2O0YA 3E5UA 3TOAA 4Z2YA 3HYIA 5BPDA 3H92A 5TJJA 2BYVE 4IHTA 4MHGA 1R22A 3M9AA 1T98A 5D8KB 2LDUA 2RNJA 1MJBA 4ENJA 4HF1A 2PN6A 4GO1A 4LG0A 3ERED 5K5RA 3F23A 1AWCA 2F5EA 1Z6RA 2JPBA 2WTEA 1LQ1A 1K78A 3BY6A 1ZH5A 2WWYA 5CVUA 4GYGA 2CSOA 2A61A 2HZTA 5D5UB 4HX4A 1B59A 5L3GA 1OYIA 1ZG3A 4NHJA 2V9VA 2PQ8A 3MQ0A 2PMHA 4EQQA 1ON2A 4S05A 1I27A 2CW0F 4XLPF 1FX7A 2H09A 1XDUA 3MEXA 4I0BA 2W24A 2P5LC 1F1ZA 4XBFA 5LGUA 3GEZA 2PG4A 2HYFA 2ACJA 1XSDA 3FM5A 4HX8A 2RV8A 4KNYA 1O57A 1PDNC 1HW1A 4M9ZA 4OMZA 2HGCA 1GXPA 4KICA 4KN7X 3F6OA 2YR2A 1OYYA 5E20A 3ZMTA 2HQNA 5CLSA 4KT5C 2MH2A 2EFWA 4L18B 1FBQA 1R1TA 4A6DA 5K5OA 1OPCA 4M6YA 1FWZA 2OAZA 3JTGA 5D6FA 3KETA 4YFNF 3SFZA 1P4XA 3VB2A 1BN5A 4PGHA 1TTYA 4Y17A 5ILSA 1J9IA 2YX7A 5AONA 3Q9SA 1D8KA 1G6NA 4HQMA 2LNBA 3IKVA 2DFIA 4OU0A 3PFIA 5JFRA 2YPRA 4L0YB 1TLHB 4OINF 1P2FA 1R1UA 4ZH4F 3GZ6A 2RDPA 3GW2A 2FRHA 1XCVA 3I5UA 3H3UA 4L5JA 2UZKA 5J8FA 3DF8A 4I02A 1ZRCA 4WCGA 1ODDA 2PEXA 1H0MA 2ZJ2A 2B0LA 5LGTA 4EJWA 3K1MA 2FMLA 3SXYA 2HDCA 2A68F 4JK1X 3SQNA 2LF8A 2OQGA 4UV9A 2YSRA 3KCCA 5HDGA 5IT9K 1LDJA 4NB5A 4LJZF 2TDXA 3LA7A 1YQAA 1K6OA 1XMKA 2OBPA 2PBIA 2FBHA 1MJAA 3KEQA 4LK1F 5ILVA 3WE2A 3ABTA 3ECOA 4M72A 2QENA 2BGCA 2GA1A 4H0EA 4OIQF 3T8RA 3AAFA 3E5QA 2DO7A 1MKMA 3F8MA 3I53A 3U1DA 4D0PA 4MTEA 5E17F 1FSEA 1IXSB 3TO6A 5TRDA 1PUEE 4ENMA 1S3JA 4LMYA 1SAXA 2D1VA 3GYHX 4XLNF 4KMFA 4IRGA 3MCZA 4OIPF 2FBKA 1RZ4A 1JHHA 3E5XA 3RYPA 5ED4A 3ZMVA 3HHHA 3F6VA 1NHAA 2ZO4A 4F7ZA 5DUKA 5BQTA 4HYEA 3COAC 3CUQA 1ZG1A 1BC8C 2E1CA 2QZ8A 1J2XA 1KYZA 4I2OA 3MZHA 2GXBA 4HV5A 1QO0D 3J81K 5A2QZ 1FNNA 4UXNA 3ULQB 5E1WA 2ELHA 1GHCA 3QU6A 3IC7A 1R36A 1BOAA 1WQ2A 3R0JA 1KU9A 2JPCA 1YYVA 4EM1A 1YW8A 3C7JA 1MDMA 5HS8A 3EQLF 3F8FA 3WTSC 4ETSA 2Z33A 1R23A 3GUDA 4CO8A 4BQAA 3DPTA 1E17A 2EFQA 3RKXA 2P8TA 1I6XA 4L5IA 1DUXC 2IW5A 1W7PB 2XHKA 5CVJA 4IRIA 2XAQA 3LSTA 3RPUA 3I59B 2Z5UA 2ZCWA 4RS8A 1O7LA 3TOBA 1WI9A 2R7FA 4M74A 4WXCA 5DCMA 3FWEA 3WODF 4RGSA 3QPHA 4FX4A 4O3MA 3B73A 1O3SA 3F22A 1ZYRF 3FMQA 4HQEA 1FP1D 5L3DA 2GIVA 2M87A 4LLNA 3KFWX 2RN7A 5DV5A 2A69F 1YTYA 2P5VA 2PJPA 4HX7A 3RI4A 2EV5A 1IXRC 4WXDA 1SD5A 5ICGA 4CYDA 2E7XA 1SD7A 1J5YA 3JAMK 3LFKA 2VBYA 1FT9A 3TKYA 1S29A 1TNTA 2DTRA 3HRTA 2RC4A 3DFGA 1SMTA 1FP2A 4HZFA 3VFZA 4G6QA 3KEOA 2DK8A 2IVMA 3HOTA 2ESHA 4EJTA 4M71A 4LFUA 1YG2A 1AOYA 3HUGA 1U5TA 1IN5A 4BHCA 2XAJA 2L54A 3KP5A 1ZAOA 1XGOA 2E1NA 2DQRA 4BHBA 3WGHA 2JT1A 3GXOA 4I09A 3DXJF 1BM9A 1G3SA 4ZYHA 5CVIA 1BI1A 1PP8F 3RJPA 3N97A 5HOOA 3RYRA 4EM0B 3O3KA 3IHUA 2OA4A 1MJ9A 2ZNYA 2VXZA 4IF4A 2HS5A 3L09A 3ZPLA 2QWWA 2Q8KA 4YFKF 2EFPA 4Q47A 2XAGA 2GA2A 3L9FA 4DNCA 5LGNA 1XN7A 5LBQA 3BROA 2Z99A 5DUIA 1SD6A 2RKHA 3ZP5A 4LB5A 1Q1HA 1R5HA 5L3BA 3F72A 5D5VB 2D45A 4ESJA 2CO5A 2QVOA 4KN4X 4WWCA 4HDVA 2Q0OA 4CICA 2DK5A 4MTDA 1JE8A 1GXQA 2FBIA 4JBAA 2XROA 1XD7A 3SZPA 2R3SA 1U6GA 4P96A 3P9IA 3CO7C 5EEGA 1HSJA 4WF2A 2VE9A 1J7KA 3EETA 2MA3A 3HRUA 1IRFA 3GO5A 3E3VA 2M45A 4O5VA 1B6AA 3WGGA 3NQOA 5K1YA 2OZUA 1IXCA 2ZMEB 3CJNA 4KUMA 1Y0UA 4TV7A 4HF0A 1T38A 5F64A 1F4KA 2XGXA 4N9HA 5FLXK 3HRSA 2JZYA 5DD4A 3JSPA 4CDGA 2FU4A 1OR7A 1TNSA 2RQPA 2MC3A 3F21A 1IW7F 2L02A 1RI7A 1MD0A 3P9CA 1SFEA 1LDKB 2QBYB 2FSWA 4ENKA 1XGNA 2HWVA 1EH6A 4L9NA 3FZVA 4AWXB 3I0TA 5H6RA 1FZPB 4AD9A 2FEZA 1B9MA 3ZN1A 3ZN0A 1LB2A 1QBJA 4WX9A 4MEYF 2CWEA 1JXSA 3LAJA 1RIOH 1P4WA 4IRHA 2F2EA 4EM2A 1U78A 5HLGA 1BI3A 3FF5A 2X0LA 4HA8A 5E1ZB 3DPLC 4ENNA 3DEUA 2M1BA 3ELKA 3VODA 5HDKA 2FF4A 1HBXG 1B1BA 4A0ZA 1GVJA 2H6CA 2XAHA 3KZZA 4LLLA 3V4GA 1J0RA 1UCRA 1JHFA 1IF1A 3KP6A 3ZMSA 2K27A 2KJCA 1HQCA 3WTVC 3NEUA 3RIRA 1DDNA 1ZARA 2P5KA 5D5XB 3C1DA 2FNPA 1YO5C 2UWMA 5DDGA 3LQQA 3KP7A 3PQKA 2F5FA 3BWGA 3LAPA 3V8JA 4MGRA 4G8XA 3MWMA 3IKTA 4PZJA 1ULYA 3WTYC 3CLOA 4NQWA 4A2UA 4S04A 3R6SA 1TQMA 2NYXA 2K86A 3QAHA 3R60A 2VOOA 4AIJA 5FO5A 1P92A 2HTJA 2IRFG 2O61A 2KIFA 2ZNZA 3I64A 1B9NA 2R7DA 4IXAA 4I7HA 2GQQA 1LDDA 5D4SA 3BP8A 5HS9A 1ZG5A 2GXGA 1IZ1A 1SFXA 3R0AA 2G9WA 2JRTA 4L9TA 2A07F 2DQLA 2DU9A 2EJRA 1YFHA 1WRJA 2K4JA 2L4AA 4LG0B 2H27A 2LSOA 5CJ9A 1ZRFA 1TQIA 4R8HA 4IHSA 2MD5A 4LB6B 3IRRA 1QQIA 1G3TA 1CF7B 3M8FA 2OZ6A 1K79A 1FY7A 1W5TA 2WV0A 4B8XA 1IUYA 2CYYA 2W25A 2VOPA 1D8JA 3FMRA 1JGSA 3KP4A 1KU3A 2O8XA 4XSZF 4LD5A 1UB9A 5LEKA 1HKQA 2V1UA 3I59A 3DQVC 1X3UA 1ZLJA 5BMZA 2J5OA 3T1BA 4XSXF 3BOQA 1FSHA 3TGNA 5BS6A 2HYGD 3DKWA 2DT5A 4ZZDA 4ZYGA 3SHFA 4RB3C 2GWRA 1WKMA 1BC7C 3EUHA 3GFJA 4M6XA 1XSVA 4P9UA 1EV7A 3F8NA 4G94A 5E8IA 2VC1A 2WC2A 1FYMA 4OMYA 3L00A 3RPQA 4CXFA 2EFNA 5HS7A 4Q4ZF 2HTSA 3BPXA 1A04A 1FBSA 1U2WA 4KYWA 1ONVA 3HIFA 1OKRA 3E6MA 3G73A 4KA4A 2XUBA 3WTZA 1FBUA 2VC0A 1SMYF 1U8RA 1FPQA 4DQ2A 4R79A 4ESFA 3GFIA 2VBZA 5JI6A 1DP7P 2VT2A 2Z3YA 3J80K 1LEAA 5BOXA 4UV8A 4P9FA 4YIIA 1G3WA 2P6SA 3WU0A 3K9TA 2VONA 2K7LA 1CGPA 3CUQC 1FYKA 4U0WA 2M8EA 3ZMUA 4BXUA 4A5NA 3MZYA 4IPAA 2KKOA 1ZRDA 4BAYA 3WTTC 2KIUA 3RTRA 1L0OC 1R5GA 2NNNA 1REPC 2OQRA 1XGMA 4Q5SF 2O03A 4CHUA 1W7PD 3K1PA 4CGZA 3CTAA 3FM3A 1RUNA 1YW9A 4GXOA 3GFMA 3IL2A 3QRFF 2M5WA 2DPUA 4FX0A 2VN2A 5IT9Z 4P55A 1BIAA 3WTWC 4A0XA 3K69A 6PAXA 4M9XA 2W57A 3MAJA 1FC3A 1LEBA 1H9GA 5LHIA 2QQAA 2QUFA 4GGGA 3IRQA 3KLOA 3EYIA 4G7OF 2BV6A 1ZHFA 2KRFA 4MEXF 5DCFA 4U7BA 3CUQB 1TQPA 2Y75A 3KE2A 5FD6A 2DW4A 2QQBA 3KLNA 1S6LA 4Y15A 2NRAC 4U0VA 3ECHA 2QBYA 2V79A 2P7CB 3H3ZA 2HFHA 3T5XA 4CZZA 2H94A 1U5TC 5KK1A 1QGPA 4KIFA 4L9VA 1KU2A 4R1HA 4G7HF 4HLXA 3K0LA 4RAYA 1MDMB 4Y13A 1KYWA 5FB2A 1Z9CA 3HTSB 2EV6A 1O7FA 4HF2A 4LK0F 1KQ9A 4RGUA 2FMYA 2G7UA 2FQ3A 2JSCA 2LF7A 3J81Z 1R00A 5LLQA 2ISZA 1LNWA 3ABUA 1ZREA 3HTUA 4UVCA 5ILUA 1D3YA 1KGSA 2Z9OA 1XDSA 2CGPA 3RKWA 4MNUA 5H6QA 3E97A 2STWA 3GX4X 3Q9VA 1V3FA 4EVIA 3U2RA 3QP5A 4M9SA 3V8LA 3TO7A 3W6KB 3E6CC 1R1VA 1WWXA 4JQFA 4I0AA 3QOPA 3EYYA 1FOKA 2K02A 1Z05A 3WU1B 3T8TA 4ZYEA 4U7DA 3WE3A 3FXUA 2ISYA 3KZYA 4HV6A 2MH9A 5LHHA 1U5TB 2A6HF 3FXQA 4Q48A 5F6FA 3JAMZ 4ON0A 2W85A 1STZA 4EGZA 2YU3A 5HLHA 5ICCA 5LRRA 5JVTA 3V8KA 1FLIA 5HVQC 3GVAA 4HOBA 1TW3A 2LKPA 1BJAA 1EH8A 1YIOA 2OU2A 1ON1A 3I4PA 2STTA 3V7RA 3BPVA 1UHWA 3EDPA 4FHTA 3BJ6A 2F5CA 2ZXJA 5D5WB 2HKOA 4RGXA 2XIGA 5JR3A 1CF7A 3DV8A 2QLZA 1XMAA 4U0YA 3K2ZA 2XKOA 4YFXF 2EFOA 3JTHA 3O2PE 3E6BA 3ZQ7A 1ZGAA 5KVRA 2VT3A 4A6EA 2KIMA 2PMUA 3ML6A 2JTVA 2QM3A 2ZKZA 2DBBA 3R4KA 4ASNA 2FNAA 4LLGF 1IN6A 1IN7A 1I5ZA 2XV4S 4KDPA 3TO9A 3FX3A 1IRGA 5J6XA 3WG9A 4A12A 3WGIA 5ERIA 3TQNA 1DPRA 3LQRA 1S7OA 1IAWA 4O6JA 2VBWA 3GWZA 4YG2F 3BJOA 3HRMA 3TDUC 1R58A 5FFZA 4PGGA 3M8EA 4EV0A 1G3YA 3O6BB 1VTNC 1D5VA 4IJAA 4OIOF 3JW4A 1UFMA 1HXDA 3I54A 1HW5A 3V7CA 1E2XA 5A2QK 2IA2A 1XCBA 1YS6A 5CYVA 3BZ6A 1I1SA 1I1GA 2V6CA 4GCVA 2EV0A 2IA1A 2FE3A 1EH7A 4EMSA 3JSOA 4XRFA 1FYLA 5FLXZ 4I98B 2P4WA 1T39A 2BEOA 1IN8A 2UXNA 1P4AA 2NS0A 4WXHA 3M1EA 2XAFA 3I71A 1K78B 4YIFA 3DP7A 5ICFA 2EB7A 4M73A 5ICEA 4HAMA 5H20A 4KIBA 3FHZA 3ZMDA 5EEHA 2HOEA 5E18F 5FGMA 5JHUA 2ADUA 1YLFA 2X4HA 2MBFA 1YS7A 3CUOA 1W7PA 2ETHA 5LRSA 1ZLKA 4HLYA 2IT0A 4LGWA 4AVPA 1XSXA 3VOEA 4RB1A 1KU7A 4U88A 2QQ9A 3PQJA 5HDNA 3M7GA 3WTUC 2EWNA 2PLYA 1W5SA 3P7NA 3LA3A 4RGRA 4FT8A 5AIPA 4UVAA 3B02A 2P7VB 1QPMA 1LVAA 2XRNA 2H6BA 3NRVA 4EJOA 3CO6C 2O6GE 2Q2EA 5DYMA 2EA2A 3REOA 4WK8F 1Z1DA 5LEJA 1QZYA 2IP2A 2VE8A 2COMA 3QPTA 3D0SA 2HKXA 2DPDA 4PCQA 4A5MA 3TDZC 1BBYA 2PI0A 2NNYA 4UNOA 2MLGA 3FMSA 2Y0MA 4UUVA 3IWZA 3C18A 3HSRA
chains in the Genus database with same CATH superfamily
4CYCB 2FX0A 4Y52J 1JUSA 3M1CA 5CQEA 1K7AA 5D6EA 4BYYA 3F8CA 3L2VA 1WFXA 3CC7I 2ME6A 3VEPA 2KJBA 3KP3A 2DCEA 3ZQCA 4IQ4A 3F8BA 4BH9A 3LNQA 3OSGA 1VNDA 2XDVA 4FISA 4AIHA 4CZCA 4UY8I 2FXAA 1PYVA 4RAZA 2E7WA 1TT5B 5E1XA 3TP3A 1KQ8A 4E7KA 1GVDA 1TW2A 2JWTA 3KX2A 1F9NA 2IJLA 3E6DA 3HHGA 1UHSA 4M3DA 4KMUX 3NAUA 2IA0A 5E8GA 1HC8A 1T2KA 1VQNI 4XLCA 3Q5FA 3G3ZA 3S1NJ 4AIKA 1R71A 5LFAA 3TW6A 4A3EJ 1USSA 3DTIA 2CG4A 1EKEA 1VZ0A 5IT3A 2HR3A 1PP7U 4HW0A 3FXMA 3OL3A 2FQ4A 4PSWA 4CCLA 1GLNA 3LSIA 3RZDJ 1C0WA 2R7RA 1ZGJA 4MQ9F 5DEQA 4A0YA 1U3EM 2L7MP 2M30A 1LJ9A 5CVVA 4D1QA 3OS0A 3A1YA 1G4DA 2UXXA 2DODA 2GLOA 3L7WA 4KFCA 1U9NA 1J75A 4EGYA 2IEKA 1ACIA 2W1OA 1BR2A 4XORA 1Z7UA 1USTA 2WBMA 3HB9A 1HKSA 2FOKA 3LSKA 1XGSA 2VBXA 5J40A 2ESNA 2V1XA 2E5ZA 2UUZA 2DOAA 1IRZA 1YITI 3A01B 5FFXA 2N8GA 3K4JA 4I01A 1SFUA 3CP2A 4GYIA 3S2WA 2KHMA 2KRHA 4IO9F 2A6EF 5BPIA 4Y4RA 2GAUA 2X6OA 4RMNA 5L3EA 3FBIB 1FOYA 1BI0A 2L4MA 4NDLA 5FD5A 3WTXC 3R61A 2DAOA 2LBFA 3ROUA 2XPUA 4XNFA 4F52A 1BIBA 3VDXA 2EK5A 2G7HA 3BDDA 4C2MJ 1QNTA 1ZN2A 2E34A 2W84A 3T0YA 3OOPA 3S14J 2Y48A 3F3XA 3W2AA 2KL4A 3GTQJ 3ISPA 2FA5A 4K2EA 2C6YA 3GZ5A 3H35A 4PDKA 4NBQA 1JUMA 4XOPA 2IS1A 4EJUA 4ZYDA 1YX3A 2NAZA 2L9RA 3BJAA 4NC6A 1DPUA 2RGVA 3N4MA 4PSXA 1R4MB 4E7LA 1HKTA 1J59A 5F0HA 3FXRA 4A3LJ 1V4RA 1X1DA 3S93A 2V6EA 2Y30A 3C3WA 2V1DA 1WJ5A 3N05A 2DYRH 3CDHA 1D5YA 3J7AO 2ZMEA 2CUZA 2KT0A 1LPQA 4IHXA 2HQAA 3ZGKA 3RZOJ 1MZBA 2XASA 3K7AJ 1MBEA 2MLKA 4G7ZF 4L9JA 2DA3A 3QU3A 2ZBKA 1P6RA 3L2CA 4V2FA 1FTZA 3J7YJ 3U9GA 1O3RA 3CC4I 3GTMJ 3V7SA 3MD2A 2P6TA 3ZQGA 1HSTA 1KONA 1OMIA 3CCYA 1WH5A 2EA4A 4I99C 2EIMH 4E70A 4N0BA 4IVNA 3L2WA 4RA2A 2JUCA 3LFUA 2AXLA 3RDIA 5AIQA 2GIZA 1H9TA 1Y8QB 2H8RA 3HOSA 4A3FJ 4BE0A 1S9HA 4PFOA 2K9NA 2OJED 2E1MC 3W6JB 4N9IA 3ZMZA 5LHGA 2AQEA 4EJVA 2XF5A 3P9KA 3K4CA 4KIGA 5CVRA 2EPFA 5D8LB 2L01A 5IYDJ 4QWQA 3H36A 1X58A 3BT9A 5DD8A 4BNCA 2D2WA 2M2EA 3GTKJ 5IY5H 2K4BA 4G9YA 3IH3A 5GPAA 3BZKA 3KP2A 3RKYA 1LFUP 3VWBA 4L0ZB 2OC6A 5FLVA 2YUSA 4HNVA 4F91B 3ESWB 3S3NA 1KA8A 4B09A 2QSGX 1Z91A 2ZFWA 4OIRF 3ZOBA 4HBLA 1UHMA 4G6TB 3V42A 5F27A 2OTLI 3ZQFA 1WHUA 3LA2A 3OV8A 1IN4A 3K1NA 4GRIA 1OYWA 1S7AA 3GFLA 3QP6A 4XN0A 5K5QA 3MKWB 3HOWJ 1S8NA 1HW2A 3H5AA 4G6DA 1YOVB 3IWFA 4S0HB 3J80Z 2GZWA 2LG4A 2OD5A 2XGCA 1WSUA 4BEHA 5D4RA 3H1CA 4P5OA 3ZR8X 2A3SA 2BE5F 4UHTA 2CU7A 1N25A 1QZZA 3HZJA 2VODA 5F1RA 2F5DA 2AS5F 2YX4A 5DCMB 3I58A 5L3FA 1T0FA 4W97A 5JLXA 3JRDA 1KQ0A 4GFBA 1L3LA 1SD4A 3LWFA 2EZIA 4HDUA 1XB4A 2HQRA 2PFBA 3BR0A 2NVUB 1NK2P 5EG0A 2D1HA 4ESBA 1AKHB 3SZTA 2BZTA 1JKQC 2O3FA 3ZCOA 1W36C 3GF2A 2VJ5A 1Z6TA 2Y0SN 1ZQ3P 1ERDA 2BOLA 1YW7A 3AG3H 4M6VA 5L3CA 4B47A 4BHPA 2HI3A 2XPWA 1SFKA 1MBHA 2CFXA 3BLYA 5J8CA 2KZGA 1TBXA 2XPVA 1QVTA 3GLXA 3CESA 4QLCU 1RUOA 4ZYAA 2L3DA 1F5TA 5HLIA 3HSEA 3I3LA 3H5NA 2E1MB 4BUPA 1OCPA 2RVCA 2DLLA 3ZRGA 5GAEJ 1ZK8A 1IO2A 4RB2C 1T6SA 4ZJZA 1UELB 1R7JA 2HXOA 4ZZLA 1RNLA 2BBYA 1FJLA 4E7HA 1UG2A 1W4MA 2XVCA 4UVBA 2J5PA 1MGTA 2DI3A 2CQKA 5F04A 2HNHA 1BR4A 4XLFA 1O3TA 2IS6A 1JI8A 2ZXWH 4OOIA 5HNFA 2LFBA 3HSFA 3S16J 4MQVA 3GTLJ 1B4AA 2QYOA 5JVGF 3D5LA 2IPQX 3MFKA 4RB0A 2A5YB 2HEOA 1BI2A 1O3QA 2Y31A 3K4KA 2XKPA 3QQAA 2O0YA 3E5UA 4Y3OA 3TOAA 2LMDA 4Z2YA 1RESA 3HYIA 1OCZH 5BPDA 4L5EA 3H92A 3M07A 2Z2SB 4RAGA 2OTJI 3JRGA 5TJJA 2BYVE 4IHTA 4BBSJ 4MHGA 4CUGA 1R22A 3M9AA 2R5YB 1OCRH 4CCKA 4Y7NJ 1T98A 5D8KB 2LDUA 2AO9A 2RNJA 1MJBA 4ENJA 2B7EA 1BA5A 4HF1A 2PN6A 4GO1A 1LE8A 2K5CA 4XLAA 4LG0A 2JVHA 3ERED 5EYRA 4HRIA 2IGNA 5EJCA 4BGDA 5K5RA 1V54H 3F23A 4XKCA 1AWCA 2F5EA 4IQJA 1Z6RA 2JPBA 1Y1WJ 2WTEA 1LQ1A 1K78A 3BY6A 1ZH5A 3IUOA 5CVUA 3U1KA 2WWYA 4GYGA 2CSOA 2LK2A 3OS2A 3HXLA 2A61A 3B6CA 4AVZA 2HZTA 1XTAA 4CCOA 4HX4A 1B59A 5D5UB 5L3GA 3K70C 1RRJA 3BR1A 2K9LA 1OYIA 1ZG3A 2VB6A 4NHJA 2V9VA 2KDZA 2LRDA 3GMEA 2PQ8A 3MQ0A 2PMHA 1O4XA 3VYRB 2DMPA 1RC9A 1XPXA 4EQQA 2HVRA 1ON2A 2O5RA 4S05A 1I27A 2CW0F 2NVYJ 4XLPF 1FX7A 3FDYA 4MLOA 4FASD 3FK7A 2V4JC 2H09A 1TWCJ 1XDUA 3MEXA 4I0BA 3H0DA 2W24A 1D1AA 3ZQHA 1F1ZA 2P5LC 1QU3A 4XBFA 5LGUA 3GEZA 2PG4A 2HYFA 2ACJA 1IC8A 1XSDA 3FM5A 4HX8A 5M5XJ 4C9YA 2RV8A 4XK4A 4KNYA 3TMOA 1JKRC 1O57A 5CQGA 5IPAA 1PDNC 1HW1A 2M8GX 4M9ZA 4OMZA 2HGCA 3BG9A 4B1RA 1GXPA 1DU6A 5GADJ 4BDYA 3SFIA 2ICWG 4KICA 4KN7X 2DJNA 3SEQA 3F6OA 1VQ7I 2YR2A 1OYYA 5E20A 3AKZA 3ZMTA 4Y33A 2HQNA 5CLSA 5FKOA 3ASOH 4KT5C 2MH2A 4IOCF 2LOOA 2EFWA 2MGQA 5EDNA 2MABA 4L18B 1FBQA 2IS2A 2WAFA 1OCTC 1OCCH 2H8WA 4DOZA 1B8IB 2ELKA 1R1TA 2XSDC 4A6DA 2EQRA 1ZTRA 3CMYA 4A93J 1R9TJ 1IUFA 2L7FP 5K5OA 2W4SA 1OPCA 5E3LA 3K4NA 4M6YA 2WB1A 1FWZA 3H9GA 3DU6A 3H5RA 2IS4A 2OAZA 3JTGA 3DTEA 5D6FA 3KETA 2CUJA 4YFNF 3K2AA 3HKZN 2NS7A 3SFZA 1P4XA 3VB2A 1BN5A 3NWTA 4PGHA 1TTYA 5IYBJ 5C4JJ 1E3PA 4Y17A 5F08A 5ILSA 3MKYB 3S17J 2HVSA 1J9IA 2IXSA 3BG3A 4CYCA 3PNYA 2YX7A 2DFHA 5AONA 3Q9SA 1D8KA 1G6NA 4HQMA 1ZR2A 3LSJA 4E4HA 2LNBA 3IKVA 1B72A 2LH9A 2DFIA 4OU0A 2L0KA 3PFIA 5JFRA 2YPRA 4L0YB 3A0HC 1TLHB 1K4TA 5EZHA 2Y0SA 4OINF 4FTHA 1P2FA 1R1UA 4ZH4F 3JRHA 2RDPA 3GZ6A 4V19K 4PJJA 2W82A 3GW2A 4XRSG 2FRHA 1XCVA 3AL0C 1Y8RB 3I5UA 3LSMA 2QGUA 3H3UA 3G4SI 3RKQA 3QYBA 3BZCA 4L5JA 2UZKA 4E7JA 5J8FA 3DF8A 4I02A 2LREA 4BBRJ 1ZRCA 2XF6A 4WCGA 1JKOC 2VKEA 1ODDA 2PEXA 1H0MA 2ZJ2A 4B43A 3CCEI 2B0LA 5LGTA 4EJWA 3K1MA 4IZZA 2FMLA 3SXYA 2HDCA 2A68F 4JK1X 3SQNA 3PM1A 2LF8A 1OISA 2ID6A 2OQGA 4UV9A 3H9JA 3MKZA 3ZQLA 1XG1A 2YSRA 1TWHJ 3KCCA 5HDGA 2BY2A 5IOZA 2WY7Q 1A31A 1LDJA 2VJJA 4NB5A 5IT9K 5DM6F 2WAQN 4LJZF 2TDXA 3LA7A 3I55I 1ZR4A 4XRMA 1YQAA 2M7AA 1K6OA 1XMKA 2X9DA 3P5JA 3U21A 2OBPA 4DIQA 1X2NA 4D9JA 1JUPA 2PBIA 2FBHA 1MJAA 2XSJC 2DA2A 3KEQA 4LK1F 5ILVA 3WE2A 4C3HJ 3ABTA 2JMWA 3ECOA 4M72A 1NTCA 1YIJI 5B1BH 4QPQA 2QENA 5J1UA 2QSHX 2Y9YA 2BGCA 3PSFA 2GA1A 4H0EA 4OIQF 3T8RA 3E1SA 3AAFA 3L2QA 2DA5A 3E5QA 1X2MA 2R7SA 3K4BA 1VQ9I 2Q1ZB 2DO7A 1A6IA 2VKVA 1MKMA 3F8MA 3I53A 3U1DA 5J1RA 4D0PA 3OR2C 4MTEA 5E17F 1FSEA 1IXSB 3TO6A 1UZCA 5TRDA 1PUEE 4ENMA 1S3JA 4LMYA 5GAGJ 2GOMA 1PUFA 2JA8J 1SAXA 1TZLA 3VYUB 2DJIA 2D1VA 3GYHX 1EA3A 1BW5A 4XLNF 5KCMA 4KMFA 1VQLI 1LVKA 4IRGA 3I4MJ 3MCZA 1R4NB 4OIPF 2FBKA 2RAEA 1RZ4A 3DLAA 3W6VA 1HF0A 3PUBA 2MC4A 1T56A 2CV0A 1JHHA 3E5XA 2OF7A 4J00A 3RYPA 5ED4A 1E3OC 2W7NA 3ZMVA 4IKFA 3HHHA 2ZSHB 3AL0B 3F6VA 1NHAA 2ZO4A 4F7ZA 5DUKA 3E7LA 3FK6A 5BQTA 4HYEA 1HLVA 2VL8A 3COAC 3CUQA 2NVQJ 1ZG1A 1OQYA 1BC8C 2O7OA 3GCMA 5H2FC 3HOVJ 2WV1A 4UUSB 2E1CA 1SFOJ 2QZ8A 4DZPA 5C4XJ 2DMQA 1J2XA 2BXZA 1KYZA 4I2OA 1WJBA 3MZHA 2GXBA 4HV5A 3JR9A 1QO0D 2OCEA 5A2QZ 3J81K 1FNNA 4UXNA 3FXJA 3ULQB 2ZXIA 5E1WA 2ELHA 4BJTA 3DLLF 1GHCA 3QU6A 3IC7A 1R36A 1WVRA 1BOAA 1WQ2A 3R0JA 1KU9A 3DPUA 1PVEA 2JPCA 1YYVA 4EM1A 3NARA 1V5FA 3W3CA 1YW8A 3C7JA 2BW3A 3EPZA 4BQQA 1MDMA 4FE4A 5HS8A 2JA6J 3EQLF 3F8FA 2LKXA 3CCMI 3WTSC 4ETSA 2Z33A 1R23A 2K3FA 3GUDA 1D0XA 4CO8A 2VQHA 4BQAA 3DPTA 1E17A 1ETQA 2EFQA 3RKXA 3DEWA 2P8TA 1I6XA 4L5IA 1DUXC 2IW5A 5DS9A 1W7PB 2X85A 2XHKA 2R5ZA 1Z67A 3FXLA 5J3LA 5CVJA 4IRIA 2XAQA 3LSTA 3K4LA 1AU7A 3RPUA 3I59B 2FUG2 2R7TA 2Z5UA 2ZCWA 5IP7J 1OFCX 4RS8A 1O7LA 3TOBA 1WI9A 3HKZA 2R7FA 4M74A 1SAUA 3BG7A 5FLMJ 3DBRB 3IAM2 5CPRB 3OYKA 3VYSB 2CV2A 2XC7A 2DXIA 4WXCA 5DCMA 3FWEA 3WODF 4RGSA 3QPHA 4FX4A 4J01A 4O3MA 3B73A 1SVLA 1O3SA 1WJEA 3F22A 2LY9A 1ZYRF 3EUAA 3FMQA 2Y2ZA 4HQEA 1FP1D 5L3DA 1K4SA 2GIVA 2M87A 4LLNA 3KFWX 3QYFA 4UB8C 2RN7A 1WI3A 5DV5A 2K40A 2A69F 1YTYA 3L2UA 4A3BJ 2Q2EB 2P5VA 3CCVI 2PJPA 2V26A 4FCYA 4HX7A 3RI4A 1DGWY 5HODA 1AKHA 2EV5A 1IXRC 3PSIA 4XMYA 4WXDA 1SD5A 1RR8C 5ICGA 1FMWA 4CYDA 2E7XA 2G0EA 1SD7A 5CKTA 1J5YA 2KZVA 3JAMK 3LFKA 1JTXA 2EH3A 2VBYA 1MIJA 1FT9A 2HPMA 4CA0A 3TKYA 4J19A 4II3A 4P1WA 3IV5A 3FKJA 3JRCA 1S29A 1TNTA 2DTRA 3HRTA 2RC4A 3DFGA 1SMTA 1FP2A 1Y1VJ 4HZFA 2JA2A 5B1AH 3DBHB 1ENHA 3Q3SA 3VFZA 4CCMA 5KNLA 2W00A 5KHDA 1J09A 4FETA 3DTKA 2DDBA 2PJRB 4G6QA 3PJRA 1YX5A 3ABKH 2DK8A 2IVMA 1GV2A 3KEOA 2M0CA 2CJJA 1FOXA 3OWTA 3HOTA 2ESHA 4EJTA 4M71A 1Z7LA 3ASNH 3TEDA 4LFUA 1YG2A 5M3MJ 1AOYA 3HUGA 4X6AJ 1U5TA 1IN5A 5GTHC 4BHCA 2XAJA 2L54A 3D5SC 3KP5A 1ZAOA 3WU2C 3L1PA 3OYMA 1XGOA 2WAQA 2E1NA 3HGYA 2DQRA 2ZMEC 3C2GA 3DKYA 3M8JA 4BHBA 1Y6IA 1Y56A 2A6TA 3WGHA 2JT1A 3GXOA 1YRNA 4I09A 5B3SH 3DXJF 4E6KG 1G59A 5HNHA 2R0QC 1BM9A 1G3SA 3LOCA 3KPHA 4ZYHA 5CVIA 1BI1A 3LSPA 2VLAA 1W1WE 1HOMA 1PP8F 3MMYB 3RJPA 3N97A 5HOOA 3RYRA 3CDLA 4EM0B 2R5YA 3O3KA 3GZNB 3IHUA 1X4OA 2OA4A 3S1RJ 1MJ9A 2ZNYA 2VXZA 4IF4A 2HS5A 3L09A 3ZPLA 4H4KC 4N4OB 2QWWA 2Q8KA 4YFKF 1ETOA 3FXOA 2M4GA 2EFPA 4Q47A 5IOYA 2HOSA 2WB1N 2X1CA 4QPOA 3OSFA 2M34A 3IP4B 2XAGA 2GA2A 3L9FA 4DNCA 5LGNA 1XN7A 5LBQA 2IGMA 2JRMA 3VSKA 1HDPA 3BROA 2Z99A 1ETWA 2R92J 5DUIA 5EGOA 3CF2A 2IAIA 1SD6A 2RKHA 3K6GA 3SEZA 3PO2J 1OLTA 4UB6C 3CCRI 3ZP5A 4LB5A 1Q1HA 4DZJA 2LP0A 1R5HA 5L3BA 4LOCA 3CJQB 5GP9A 2DA6A 2DMUA 3F72A 5D5VB 2H1LA 3RPUD 2D45A 4ESJA 2CO5A 4ZTFA 4DYRA 2QVOA 4KN4X 4MFDA 4WWCA 5IP6A 4NC8A 4HDVA 1ZGWA 2XGDA 3PNTA 3H9QA 3RQIA 2Q0OA 4CICA 2DK5A 4MTDA 1JE8A 1GXQA 2FBIA 3SZGA 4JBAA 2XROA 1XD7A 2KIQA 3SZPA 2R3SA 1U6GA 5E3NA 2L9NA 4P96A 3P9IA 3CO7C 3S1MJ 2QCOA 5EEGA 1N77A 1HSJA 4WF2A 1SVOA 2VE9A 1HA8A 1E0EA 2L9VA 1J7KA 3EETA 3KYDB 1VQMI 4ABZA 2X6YA 2MA3A 3HRUA 3CF5F 1IRFA 1UAAA 4D5CA 1T0FC 4E7IA 4XL9A 1OJLA 3GO5A 3E3VA 2M45A 1S7EA 4E7ZA 3S1QJ 4O5VA 1B6AA 1N78A 1W5CC 3WGGA 3S2HJ 3NQOA 2DFFA 5K1YA 1IGNA 2OZUA 1IXCA 4HPQA 2ZMEB 3CJNA 4KUMA 1Y0UA 4TV7A 1QA6A 2F4MB 2NOJB 4HF0A 1T38A 3OS1A 5F64A 1BW6A 1F4KA 2F6CA 2XGXA 4N9HA 4AYBN 5FLXK 3HRSA 1VQ8I 2JZYA 5DD4A 3JSPA 4IEJA 4CDGA 2OV7A 4JX5A 2FU4A 1B8IA 1OR7A 2CUEA 4I76A 3SYTA 1TNSA 1R5ID 2ZXHA 3W2WA 2RQPA 2MC3A 2DT6A 3F21A 1MMGA 1IW7F 2VQCA 2L02A 1RI7A 1MD0A 5IP9J 3P9CA 1DU0A 4ZDLA 1SFEA 1LDKB 2I10A 2BVLA 2QBYB 2FSWA 4ENKA 2QKMB 1XGNA 3QYEA 3OYHA 3RCOA 4PK4A 2HWVA 1EH6A 4L9NA 4D7MA 1MMDA 3FZVA 4EATA 4AWXB 3ERMA 4BU2A 1VQ5I 4BDZA 4OAZA 3I0TA 1V5GA 4XOTA 4Z6YA 2O8KA 3HOZJ 5H6RA 1FZPB 2OUMA 3S32A 3AG4H 3FBNB 4AD9A 1WCMJ 2FEZA 1B9MA 2LTPA 4F55A 3ZN1A 4B3AA 3ZN0A 1LB2A 1QBJA 4WX9A 4DYCA 4MEYF 2CWEA 1JXSA 4PJ0C 3LAJA 4PJLA 3OYIA 1T33A 1P4WA 2DA7A 1W0UA 1RIOH 4IRHA 2F2EA 4EM2A 1RKWA 2E19A 1U78A 5HLGA 1BI3A 2DDAA 1M1EB 3FF5A 2X0LA 5EZGA 4HA8A 4ANJA 5E1ZB 3DPLC 5FKLA 4BEHB 3DEUA 4ENNA 2M1BA 3ELKA 2EINH 3VODA 2AQFA 5HDKA 2FF4A 3TW7A 3G71I 1HBXG 1XX5A 3CZ6A 1B1BA 4A0ZA 1GVJA 2H6CA 3CCLI 2HXIA 2NXNB 2XAHA 3CMAI 3KZZA 4KISA 4LLLA 3V4GA 4CCNA 1J0RA 3H3VK 1UCRA 3LMMA 1JHFA 2LR8A 2HPIA 1IF1A 3KP6A 2X1DA 2X51A 2Y9ZA 4C30A 2CUFA 3ZMSA 2K27A 2KJCA 2JUGA 1HQCA 3WTVC 2E71A 2I8DA 3NEUA 3RIRA 1DDNA 1W36D 5EG0B 2DMTA 4HSTA 3OYDA 1ZARA 4X0GA 3LSHA 2P5KA 1Z21A 3OIPA 5D5XB 5TISC 3C1DA 2FNPA 1YO5C 4A69C 2UWMA 3EUKL 5DDGA 2DFEA 3LQQA 2VPRA 1WJFA 5FROA 3KP7A 3RSNA 2BY1A 3PQKA 3OR1C 3KIOA 3GTGJ 3G1OA 3OY9A 2F5FA 1YHQI 2OPTA 1FTTA 3BWGA 3LAPA 3V8JA 4MGRA 1RETA 4G8XA 3K10A 3MWMA 3IKTA 4M3EA 2W48A 1ULYA 4PZJA 4N4NB 3WTYC 3CLOA 4NQWA 3BTIA 4A2UA 4S04A 3R6SA 1TQMA 2LY1A 2NYXA 2K86A 3CCUI 1U0JA 3QAHA 2E2HJ 2QSFX 3R60A 2VOOA 1YI2I 2IGKA 2R7WA 1MNMC 4AIJA 5FO5A 1P92A 2CW8A 2HTJA 2IRFG 1D0YA 2KIFA 2O61A 2ZNZA 3I64A 1B9NA 1Z0XA 4YELA 4XM3A 2R7DA 4IXAA 4MIMA 1BL0A 2CS3A 1WJCA 1NG7A 4I7HA 4ZDPA 3ABMH 5FRMA 2GQQA 4I6ZA 1I3QJ 1YJ9I 1LDDA 3HGGA 3GBGA 5D4SA 4GDFA 3BP8A 5HS9A 4RDUA 4LIVA 5GTIC 2YS9A 1ZG5A 2MSYA 2O9LA 2GXGA 1T95A 1P7IA 2ZJPF 2X48A 1IZ1A 1SFXA 3R0AA 2G9WA 1FEXA 4DJAA 3AG2H 1X1BA 2JRTA 3BG5A 4RM3A 4L9TA 4XKBA 2A07F 2DQLA 1JTYA 1I39A 2DU9A 2EJRA 2F4OB 1LE8B 3HPHA 1YFHA 1WRJA 2K4JA 2L4AA 3BR2A 3Q0WA 1TL8A 3KEYA 2H27A 4LG0B 3SDGA 2FD5A 2LSOA 4PJMA 5CJ9A 2WAEA 3K70D 1LUJB 5TGTA 4CH7A 1ZRFA 1TQIA 4R8HA 4IHSA 2MD5A 4LB6B 4C3IJ 1WJAA 3IRRA 3CCJI 3CCQI 1QQIA 1G3TA 2B9SA 4ITVA 2LD5A 1CF7B 4C3JJ 2CQ7A 3M8FA 3CCSI 2KFDA 2OZ6A 1K79A 2MW8A 2L2OA 5BNGA 2CQQA 4AYBA 5JLWA 1FY7A 1W5TA 1A5JA 2EZLA 2QA4I 4ZTJA 1DP3A 2WV0A 4B8XA 1IUYA 2CYYA 2W25A 2VOPA 1D8JA 3FMRA 1JGSA 4RAFA 3KP4A 5J47A 2X1EA 2XRLA 4BQNA 1KU3A 3F0CA 2E2IJ 2JVGA 2O8XA 4LD5A 1UB9A 4XSZF 2VJ4A 2ZFUA 2DOFA 3KYLA 1YE9A 5LEKA 1HKQA 2V1UA 4A3CJ 1GDTA 1MW7A 1TP4A 4G12A 1F43A 1BJZA 4CSWA 3G1MA 3DQVC 3I59A 3A01A 1SANA 1QPIA 2I5UA 1X3UA 1ZLJA 4MFEA 4BACA 4IHVA 5BMZA 2H1KA 2J5OA 3T1BA 4XRSA 1MMSA 4LG3A 3CQZJ 3BOQA 4XSXF 4A3GJ 1FSHA 2M4KA 3DKXA 4IL6C 3TGNA 2L7KA 1BOBA 2ID3A 5BS6A 1MSFC 4JYKA 2HYGD 3DKWA 2DT5A 4ZZDA 4ZYGA 3SHFA 1P7JA 2WADA 4RB3C 2GWRA 1WH7A 1WKMA 3CJTB 1BC7C 4C2TA 3EUHA 3SDBA 4CCJA 3GFJA 1QHHD 4M6XA 2EIKH 1XSVA 2A05A 4P9UA 1EV7A 3F8NA 4XN3A 1HCRA 4G94A 3DWLE 3CDIA 5E8IA 1CQTA 3HBLA 1ZKGA 2VC1A 2WC2A 1FYMA 4OMYA 1Z3XA 1S5LC 4RBOA 3L00A 3RPQA 4CXFA 3OYCA 2EFNA 5HS7A 4Q4ZF 3UNGC 2HTSA 2XF7A 3BPXA 3A02A 1A04A 1FBSA 1U2WA 4KYWA 1IV8A 3CC2I 3OYBA 2KMUA 1ONVA 3HIFA 3O8HA 2ZJRF 4BXFA 4HNTA 4YEJA 4BE2A 1X1PA 1OKRA 3E6MA 3G73A 2CMPA 4KA4A 2XUBA 4RLQA 3WTZA 1FBUA 4A3MJ 1XMXA 2VC0A 1SMYF 3S2DJ 3VYTB 1U8RA 2DA4A 1FPQA 1MMNA 4XLEA 4DQ2A 4R79A 2VUMJ 3S3OA 4ESFA 3BR5A 2TCTA 3GFIA 2VXDA 2VBZA 3A2KA 2X6XA 5JI6A 1TWGJ 1B72B 5FRNA 1DP7P 2VT2A 4KT6A 4DYQA 2Z3YA 3J80K 1LEAA 5BOXA 2JSPA 3RQ4A 4UV8A 4P9FA 3G1LA 1H89C 3HL2A 3OIQA 4RLFA 4YIIA 1G3WA 2MYSA 2P6SA 1P9QC 2QQ8A 3IH4A 3WU0A 2A5WA 3K9TA 1N75A 4BKXA 1MBGA 2VONA 5FKNA 2K7LA 1CGPA 3CUQC 1FYKA 4U0WA 2M8EA 2PX9A 3ZMUA 4BXUA 3DCFA 3K4MA 2RQQA 3JRFA 4A5NA 1ORKA 3MZYA 1V5EA 4IPAA 2KKOA 4QSHA 4ZDOA 1ZRDA 3BR6A 3DEEA 1SC7A 1AHDP 2V1NA 3I9V2 2DA1A 4PFPA 4BAYA 3WTTC 3PIOF 2Y69H 2KIUA 1K6YA 4IX7A 1VQPI 1VQ4I 1K83J 2P81A 3RTRA 2ME0A 1L0OC 1R5GA 2NNNA 1HDDC 3OYLA 5KAIC 4F93B 1REPC 2OQRA 1XGMA 1I3AA 4Q5SF 2JJ7A 5HLTA 3D1NI 3BR3A 2O03A 4CHUA 2HZDA 2HOAA 4B4CA 1W7PD 3K1PA 2YU9J 4CGZA 3CTAA 1JT0A 3HDDA 1VQ6I 3FM3A 3QPSA 1U8BA 1IV6A 5FJ8J 1FMVA 4AUXA 1RUNA 2HDDA 1YW9A 1JGGA 4GXOA 3GFMA 1DQUA 3CLQA 4B48A 3PO3J 4X1EA 1JJ8C 3IL2A 3QRFF 2M5WA 2DPUA 4FX0A 1IG7A 2VN2A 1SEUA 4F3QA 5IT9Z 4NC7A 4P55A 1BIAA 3WTWC 1S72I 2ZJQF 4LIUA 4A0XA 3K69A 6PAXA 5KAFC 4M9XA 1NG6A 2W57A 2NVTJ 1H88C 4BQOA 4C2UA 1PUFB 3MAJA 1FC3A 5J1YA 1LEBA 1H9GA 1X3WB 5LHIA 1WZ2A 1QZEA 2V9PA 1IDZA 1A36A 2LKSA 2QQAA 1XC5A 4XICA 2QUFA 2UV1A 4XONA 4GGGA 3IRQA 3KLOA 1FOWA 3EYIA 4G7OF 2ZSIB 1XS9A 2BV6A 2BY3A 1ZHFA 2KRFA 4MEXF 2CRGA 1GT0C 5DCFA 4U7BA 3OYEA 3CUQB 4II2A 1TQPA 2PMZN 2Y75A 2CQXA 3KE2A 2R7XA 2F5VA 2M7BA 3GTOJ 5FD6A 1G8XA 2CV1A 2DW4A 2QQBA 3KLNA 1S6LA 2WY8Q 4Y15A 2NRAC 1JT6A 1MBFA 4U0VA 3ECHA 3WHBA 1X1AA 2ECCA 2QBYA 3HPGA 2V79A 9ANTA 1KZHA 2P7CB 3H3ZA 2HFHA 1JJ6C 3T5XA 4MO7A 4CZZA 2H94A 4V2GA 1U5TC 5KK1A 1GUUA 1QGPA 4KIFA 2EBIA 3VSLA 4OWRB 4L9VA 1KU2A 1X4PA 4R1HA 5C3EJ 2FJ1A 2AHQA 2BW3B 4G7HF 4JX4A 4HLXA 3K0LA 4RAYA 4IOAF 1MDMB 2MFZA 1KYWA 2CW7A 4Y13A 5FB2A 2E60A 4QTRA 1Z9CA 3HTSB 2EV6A 1O7FA 4HF2A 4LK0F 1KQ9A 3OIOA 4PUSA 4RGUA 4KITB 2NS8A 1UMQA 2FMYA 2Z16A 1AA7A 1WPKA 5JHFA 2G7UA 3BG6A 2XGEA 4BY7J 2KRCA 2FQ3A 1Q1VA 1OCOH 2JSCA 5M3FJ 2LF7A 3J81Z 2R5ZB 1IDYA 1R00A 5LLQA 2ISZA 2ZB9A 1LNWA 3ABUA 3B6AA 3SJMA 3UKGA 4HNUA 2RNGA 2DYSH 5LD2C 4JOMA 1ZREA 1MSEC 3HTUA 3LL7A 2R7OA 3BTJA 3F9KA 4RM2A 4UVCA 1X3ZB 2GXAA 5ILUA 1D3YA 1KGSA 2Z9OA 2BXYA 1XDSA 3ZQIA 2CH0A 2CGPA 3E0JB 2LBFB 3RKWA 4MNUA 5H6QA 2GBYA 1I50J 3E97A 1NH3A 3LSGA 2K9SA 3J7ZI 2LY2A 2STWA 3J7AY 1G2HA 5DTDA 1Y39A 3GX4X 3A4CA 1MBKA 1ETYA 1WJDA 3VPRA 3Q9VA 1V3FA 1TWAJ 1EJ9A 4EVIA 3MVPA 1LFBA 3U2RA 3QP5A 3NWSA 4M9SA 1POGA 1JKPC 1D1CA 3V8LA 3TO7A 3W6KB 4F92B 5FKKA 3BTLA 3E6CC 1R1VA 1WWXA 4JQFA 1T8IA 1VI0A 4I0AA 1I6HJ 5E3MA 1SVMA 5FKMA 1FIAA 5F1JA 3QOPA 5J4YA 4EEFG 1QRYA 2KPMA 3EYYA 1FOKA 1EF4A 2KISA 3BTCA 2K02A 1Z05A 3WU1B 3T8TA 2F48A 4LITA 4ZYEA 4U7DA 3TBIA 3FISA 2AXTC 2MD0A 3WE3A 3BCAA 3FXUA 4B3XA 2ISYA 2NVXJ 3KZYA 4HV6A 3QOEA 2COBA 3MKLA 2X6WA 2HDWA 2MH9A 5LHHA 5B66C 3HUGB 1VF9A 1U5TB 2IBDA 3CP8A 2OCCH 3ABLH 2EZHA 2A6HF 3AG1H 3PL8A 3FXQA 4Q48A 1RKTA 3OOUA 3JCUC 5F6FA 5M5WJ 3JAMZ 4ON0A 2MG4A 2W85A 2HOTA 2BHYA 1APLC 2DOEA 1STZA 4EGZA 2YU3A 5HLHA 5ICCA 4A3JJ 2DT7B 5LRRA 5JVTA 1Z77A 3V8KA 1FLIA 2VKHA 2KLOA 2V7FA 1VQKI 3L2RA 1YRNB 2K9MA 5K7ZA 5DM7F 1OR7C 2E2JJ 2M0MA 4ZC3A 2RREA 3GVAA 2LVSA 4HOBA 1QVUA 5HVQC 3PIPF 1TW3A 2DMNA 2LKPA 4U87A 1BJAA 1MNDA 4DBRA 2L9SA 2Z1DA 4KJZA 2JA7J 2XAUA 2HU9A 1EH8A 1YIOA 2OU2A 1MMAA 1ON1A 3I4PA 1V55H 2R4GA 1DGRM 4XLHA 2STTA 4XKVA 5GAHJ 3HEFA 3IAS2 3V7RA 3BPVA 4DGWB 1UHWA 3EDPA 4FHTA 3BJ6A 3CMEI 1MBJA 1D1BA 2F4IA 2F5CA 5M5YJ 2ECBA 2ZXJA 4QIWN 3H0GJ 5D5WB 2HKOA 4NNJA 4HEA2 4RGXA 5EGOB 4M3BA 4BL0B 3BC8A 2XIGA 4XR6A 3TP0A 2L5QA 5JR3A 1W0TA 2R7QA 3DV8A 1CF7A 3WG7H 2QLZA 1XMAA 4U0YA 3C2BA 2E1OA 1NK3P 1LKXA 3K2ZA 4A3IJ 4OAYA 2XKOA 4YFXF 2R7VA 1UG0A 2EFOA 2M9HA 1QHGA 3A0BC 3JTHA 3OYGA 1IJWC 3O2PE 2JQ7A 3E6BA 2VASA 5EF6A 3ZQ7A 1ZGAA 5KVRA 2VT3A 5E79C 4A6EA 3LSRA 2KIMA 3M3YJ 3CD6I 2VQLA 3HOUJ 2DN0A 2PMZA 2PMUA 3ML6A 2K3PA 3OYNA 2JTVA 3MZ8A 2HYJA 2QM3A 3Q0VA 2JA5J 3FKIJ 2B63J 2ZKZA 2DBBA 3R4KA 4ASNA 2FNAA 4LLGF 1IN6A 4D7NA 1IN7A 2R7ZJ 1I5ZA 2XV4S 4KDPA 4M3FA 3TO9A 3FX3A 1R49A 1IRGA 5J6XA 3WG9A 4A12A 3WGIA 3TL4X 4NUBA 3BQYA 2BY0A 5ERIA 3TQNA 1DPRA 3LQRA 3KZIC 1S7OA 3UR3C 4YIRX 1IAWA 4O6JA 2VBWA 4A3KJ 1MNEA 2JN6A 4IHWA 1PJRA 3M4OJ 2HQ5A 3S15J 1H8AC 4UUTA 3GWZA 4YG2F 3BJOA 2BVMA 4XIDA 4AM3A 1TT0A 3HRMA 3TDUC 1ETXA 1D0ZA 1R58A 5FFZA 4PGGA 3PFYA 4DW6A 3M8EA 1ETKA 4EV0A 4BE1A 1G3YA 3O6BB 1VTNC 3D5RC 1D5VA 5IYCJ 1ETVA 4IJAA 1RPWA 4OIOF 3I56I 4A3DJ 2BHZA 2TRTA 3FXKA 3JW4A 1UFMA 1HXDA 2KQRA 1HW5A 3I54A 3V7CA 1E2XA 4BJ6C 2IGOA 2EZKA 1R6RA 4B44A 2R7UA 5A2QK 2IA2A 3I4NJ 1XCBA 1TC3C 3G2BA 2ZC2A 3FHNA 2K9QA 1RR7A 1YS6A 3CJRB 2GM4A 1A35A 1UJ8A 5CYVA 3BZ6A 1I1SA 1I1GA 1MH4A 1WGXA 3ZQQA 2V6CA 3Q0UA 4GCVA 2EV0A 2IA1A 4JP0A 4DBQA 2FE3A 1EH7A 4BS9A 4EMSA 3GTPJ 5K7FA 2V9KA 3JSOA 3WHCA 3X2QH 2M3AA 1T08B 4E7SA 5B5EC 3ZXSA 4XRFA 1FYLA 2E35A 3GLLA 5FLXZ 4I98B 2P4WA 4AC0A 1T39A 3JREA 2D5VA 2KDOA 4FE7A 1F36A 4UUSA 2BEOA 1TWFJ 1IN8A 2LYCA 2UXNA 2VIXA 1P4AA 2NS0A 4WXHA 3A03A 3KYCB 1GV5A 4M3GA 3IH2A 5J4VA 2QF7A 2XAFA 3M1EA 3I71A 3QODA 1K78B 4YIFA 5E3OA 3DP7A 2QEXI 5ICFA 2EB7A 3BQZA 3QWLA 4M73A 5ICEA 4HAMA 5H20A 4KIBA 2VQGA 3BCBA 3FHZA 3OMYA 3S3MA 3OYFA 1LFPA 3QPLA 5EEHA 3ZMDA 2HOEA 5E18F 5FGMA 5JHUA 3CMMA 2FOWA 3HJEA 2ADUA 1YLFA 2X4HA 4D5FA 4BY1J 2MBFA 4JX6A 1YS7A 1ITYA 3CUOA 2QKLB 1BR1A 2VKDA 1W7PA 2ETHA 3OL4A 4XQFA 5LRSA 1K61A 2HVQA 4AU7A 4HSRA 1ZLKA 2GOXB 4HLYA 3C2HA 1YJWI 1X19A 2ELJA 4PJNA 2XB0X 2IT0A 2P0WA 4LGWA 2NOGA 1XSXA 2E36A 4AVPA 4HG2A 3VOEA 3HOXJ 4RB1A 1KU7A 1ZELA 1Z3YA 3HOYJ 3AFHA 5GPCA 3W2VA 4U88A 2QQ9A 3PQJA 5HDNA 2L7ZA 4BXXJ 3OYJA 3DBLB 2VJIA 3M7GA 3JRAA 3WTUC 2K85A 2VPLA 2LLKA 2EWNA 2E5NA 2PLYA 3ONQA 1W5SA 1Y0NA 3P7NA 3LA3A 4RGRA 1X1CA 3HC7A 3PUFA 4FT8A 5AIPA 4UVAA 3B02A 1VQOI 2P7VB 1VFCA 1QPMA 1U9OA 1LVAA 2XRNA 2H6BA 4IHYA 3NRVA 2LC2A 3OYAA 2WA0A 3O8GA 4EJOA 2JK3A 2VI6A 2R93J 2CQNA 2DTZA 3CO6C 1YJNI 2O6GE 4NQWB 3PNVA 2Q2EA 5DYMA 5C44J 5F0CA 2EA2A 2CFOA 3REOA 3DU5A 4WK8F 1Z1DA 3JRBA 1MH3A 5LEJA 1QZYA 2IP2A 2VE8A 1FIPA 3FIWA 2XB5A 5K7HA 3G6EI 1IRXA 2COMA 3QPTA 3D0SA 2HKXA 2DPDA 3MN2A 4PCQA 3S8PA 4AIDA 1E3HA 4A5MA 3TDZC 4W1UA 4BJ5C 2KP6A 1A6QA 1BBYA 5F0FA 2PI0A 3JRIA 3EUHC 3HM5A 2PJRA 2NNYA 4UNOA 2MLGA 4FQGA 3FMSA 2Y0MA 3GTJJ 5EEAA 3HG9A 4UUVA 3IWZA 2EILH 3C18A 4XKWA 4YRVA 2EIJH 3HSRA
chains in the Genus database with same CATH topology
1K7AA 5D6EA 4BYYA 3F8CA 3VEPA 2KJBA 3KP3A 3F8BA 4BH9A 4AIHA 2FXAA 4RAZA 2E7WA 5E1XA 1KQ8A 1TW2A 1F9NA 2IJLA 3E6DA 3HHGA 4KMUX 5E8GA 2IA0A 1T2KA 3Q5FA 3G3ZA 4AIKA 1USSA 2CG4A 5IT3A 2HR3A 1PP7U 4HW0A 1C0WA 1ZGJA 4MQ9F 5DEQA 4A0YA 1U3EM 2M30A 1LJ9A 5CVVA 1G4DA 2UXXA 3L7WA 4KFCA 1J75A 4EGYA 1Z7UA 1USTA 1HKSA 2FOKA 1XGSA 2VBXA 2ESNA 2V1XA 5FFXA 4I01A 1SFUA 4GYIA 3S2WA 2A6EF 5BPIA 2GAUA 5L3EA 1BI0A 2L4MA 5FD5A 3WTXC 3R61A 2DAOA 3ROUA 1BIBA 2EK5A 2G7HA 3BDDA 1QNTA 1ZN2A 2W84A 3T0YA 3OOPA 2Y48A 3F3XA 3ISPA 2FA5A 4K2EA 2C6YA 3GZ5A 4PDKA 4EJUA 4ZYDA 2NAZA 3BJAA 1DPUA 2RGVA 3N4MA 1HKTA 1J59A 3FXRA 1V4RA 3C3WA 2V1DA 3CDHA 3J7AO 2ZMEA 1MZBA 2XASA 2MLKA 4G7ZF 4L9JA 3QU3A 2ZBKA 1P6RA 3L2CA 1O3RA 3U9GA 3V7SA 2P6TA 1HSTA 1OMIA 2EA4A 4E70A 4N0BA 4IVNA 3RDIA 2AXLA 5AIQA 1H9TA 3HOSA 3W6JB 4N9IA 3ZMZA 5LHGA 4EJVA 3P9KA 4KIGA 5CVRA 5D8LB 2L01A 4QWQA 5DD8A 4BNCA 2D2WA 2K4BA 4G9YA 3KP2A 3RKYA 4L0ZB 1KA8A 4B09A 1Z91A 2ZFWA 4OIRF 4HBLA 1UHMA 3LA2A 3OV8A 1IN4A 3K1NA 1OYWA 1S7AA 3GFLA 3QP6A 5K5QA 1S8NA 1HW2A 4G6DA 3IWFA 3J80Z 2GZWA 2OD5A 1WSUA 5D4RA 4P5OA 2A3SA 2BE5F 4UHTA 1QZZA 2VODA 5F1RA 2F5DA 2AS5F 2YX4A 5DCMB 3I58A 5L3FA 1T0FA 1KQ0A 1L3LA 1SD4A 3LWFA 4HDUA 1XB4A 2HQRA 2PFBA 2D1HA 4ESBA 3SZTA 2O3FA 3GF2A 1Z6TA 1YW7A 5L3CA 4BHPA 2CFXA 5J8CA 1TBXA 3GLXA 4QLCU 1RUOA 2L3DA 1F5TA 5HLIA 3HSEA 2RVCA 2DLLA 4RB2C 1T6SA 1R7JA 4ZZLA 1RNLA 2BBYA 1W4MA 2XVCA 4UVBA 2J5PA 1MGTA 2DI3A 2CQKA 1O3TA 4OOIA 3HSFA 4MQVA 1B4AA 2QYOA 3D5LA 2IPQX 3MFKA 4RB0A 2A5YB 2HEOA 1BI2A 1O3QA 2XKPA 2O0YA 3E5UA 3TOAA 4Z2YA 3HYIA 5BPDA 3H92A 5TJJA 2BYVE 4IHTA 4MHGA 1R22A 3M9AA 1T98A 5D8KB 2LDUA 2RNJA 1MJBA 4ENJA 4HF1A 2PN6A 4GO1A 4LG0A 3ERED 5K5RA 3F23A 1AWCA 2F5EA 1Z6RA 2JPBA 2WTEA 1LQ1A 1K78A 3BY6A 1ZH5A 2WWYA 5CVUA 4GYGA 2CSOA 2A61A 2HZTA 5D5UB 4HX4A 1B59A 5L3GA 1OYIA 1ZG3A 4NHJA 2V9VA 2PQ8A 3MQ0A 2PMHA 4EQQA 1ON2A 4S05A 1I27A 2CW0F 4XLPF 1FX7A 2H09A 1XDUA 3MEXA 4I0BA 2W24A 2P5LC 1F1ZA 4XBFA 5LGUA 3GEZA 2PG4A 2HYFA 2ACJA 1XSDA 3FM5A 4HX8A 2RV8A 4KNYA 1O57A 1PDNC 1HW1A 4M9ZA 4OMZA 2HGCA 1GXPA 4KICA 4KN7X 3F6OA 2YR2A 1OYYA 5E20A 3ZMTA 2HQNA 5CLSA 4KT5C 2MH2A 2EFWA 4L18B 1FBQA 1R1TA 4A6DA 5K5OA 1OPCA 4M6YA 1FWZA 2OAZA 3JTGA 5D6FA 3KETA 4YFNF 3SFZA 1P4XA 3VB2A 1BN5A 4PGHA 1TTYA 4Y17A 5ILSA 1J9IA 2YX7A 5AONA 3Q9SA 1D8KA 1G6NA 4HQMA 2LNBA 3IKVA 2DFIA 4OU0A 3PFIA 5JFRA 2YPRA 4L0YB 1TLHB 4OINF 1P2FA 1R1UA 4ZH4F 3GZ6A 2RDPA 3GW2A 2FRHA 1XCVA 3I5UA 3H3UA 4L5JA 2UZKA 5J8FA 3DF8A 4I02A 1ZRCA 4WCGA 1ODDA 2PEXA 1H0MA 2ZJ2A 2B0LA 5LGTA 4EJWA 3K1MA 2FMLA 3SXYA 2HDCA 2A68F 4JK1X 3SQNA 2LF8A 2OQGA 4UV9A 2YSRA 3KCCA 5HDGA 5IT9K 1LDJA 4NB5A 4LJZF 2TDXA 3LA7A 1YQAA 1K6OA 1XMKA 2OBPA 2PBIA 2FBHA 1MJAA 3KEQA 4LK1F 5ILVA 3WE2A 3ABTA 3ECOA 4M72A 2QENA 2BGCA 2GA1A 4H0EA 4OIQF 3T8RA 3AAFA 3E5QA 2DO7A 1MKMA 3F8MA 3I53A 3U1DA 4D0PA 4MTEA 5E17F 1FSEA 1IXSB 3TO6A 5TRDA 1PUEE 4ENMA 1S3JA 4LMYA 1SAXA 2D1VA 3GYHX 4XLNF 4KMFA 4IRGA 3MCZA 4OIPF 2FBKA 1RZ4A 1JHHA 3E5XA 3RYPA 5ED4A 3ZMVA 3HHHA 3F6VA 1NHAA 2ZO4A 4F7ZA 5DUKA 5BQTA 4HYEA 3COAC 3CUQA 1ZG1A 1BC8C 2E1CA 2QZ8A 1J2XA 1KYZA 4I2OA 3MZHA 2GXBA 4HV5A 1QO0D 3J81K 5A2QZ 1FNNA 4UXNA 3ULQB 5E1WA 2ELHA 1GHCA 3QU6A 3IC7A 1R36A 1BOAA 1WQ2A 3R0JA 1KU9A 2JPCA 1YYVA 4EM1A 1YW8A 3C7JA 1MDMA 5HS8A 3EQLF 3F8FA 3WTSC 4ETSA 2Z33A 1R23A 3GUDA 4CO8A 4BQAA 3DPTA 1E17A 2EFQA 3RKXA 2P8TA 1I6XA 4L5IA 1DUXC 2IW5A 1W7PB 2XHKA 5CVJA 4IRIA 2XAQA 3LSTA 3RPUA 3I59B 2Z5UA 2ZCWA 4RS8A 1O7LA 3TOBA 1WI9A 2R7FA 4M74A 4WXCA 5DCMA 3FWEA 3WODF 4RGSA 3QPHA 4FX4A 4O3MA 3B73A 1O3SA 3F22A 1ZYRF 3FMQA 4HQEA 1FP1D 5L3DA 2GIVA 2M87A 4LLNA 3KFWX 2RN7A 5DV5A 2A69F 1YTYA 2P5VA 2PJPA 4HX7A 3RI4A 2EV5A 1IXRC 4WXDA 1SD5A 5ICGA 4CYDA 2E7XA 1SD7A 1J5YA 3JAMK 3LFKA 2VBYA 1FT9A 3TKYA 1S29A 1TNTA 2DTRA 3HRTA 2RC4A 3DFGA 1SMTA 1FP2A 4HZFA 3VFZA 4G6QA 3KEOA 2DK8A 2IVMA 3HOTA 2ESHA 4EJTA 4M71A 4LFUA 1YG2A 1AOYA 3HUGA 1U5TA 1IN5A 4BHCA 2XAJA 2L54A 3KP5A 1ZAOA 1XGOA 2E1NA 2DQRA 4BHBA 3WGHA 2JT1A 3GXOA 4I09A 3DXJF 1BM9A 1G3SA 4ZYHA 5CVIA 1BI1A 1PP8F 3RJPA 3N97A 5HOOA 3RYRA 4EM0B 3O3KA 3IHUA 2OA4A 1MJ9A 2ZNYA 2VXZA 4IF4A 2HS5A 3L09A 3ZPLA 2QWWA 2Q8KA 4YFKF 2EFPA 4Q47A 2XAGA 2GA2A 3L9FA 4DNCA 5LGNA 1XN7A 5LBQA 3BROA 2Z99A 5DUIA 1SD6A 2RKHA 3ZP5A 4LB5A 1Q1HA 1R5HA 5L3BA 3F72A 5D5VB 2D45A 4ESJA 2CO5A 2QVOA 4KN4X 4WWCA 4HDVA 2Q0OA 4CICA 2DK5A 4MTDA 1JE8A 1GXQA 2FBIA 4JBAA 2XROA 1XD7A 3SZPA 2R3SA 1U6GA 4P96A 3P9IA 3CO7C 5EEGA 1HSJA 4WF2A 2VE9A 1J7KA 3EETA 2MA3A 3HRUA 1IRFA 3GO5A 3E3VA 2M45A 4O5VA 1B6AA 3WGGA 3NQOA 5K1YA 2OZUA 1IXCA 2ZMEB 3CJNA 4KUMA 1Y0UA 4TV7A 4HF0A 1T38A 5F64A 1F4KA 2XGXA 4N9HA 5FLXK 3HRSA 2JZYA 5DD4A 3JSPA 4CDGA 2FU4A 1OR7A 1TNSA 2RQPA 2MC3A 3F21A 1IW7F 2L02A 1RI7A 1MD0A 3P9CA 1SFEA 1LDKB 2QBYB 2FSWA 4ENKA 1XGNA 2HWVA 1EH6A 4L9NA 3FZVA 4AWXB 3I0TA 5H6RA 1FZPB 4AD9A 2FEZA 1B9MA 3ZN1A 3ZN0A 1LB2A 1QBJA 4WX9A 4MEYF 2CWEA 1JXSA 3LAJA 1RIOH 1P4WA 4IRHA 2F2EA 4EM2A 1U78A 5HLGA 1BI3A 3FF5A 2X0LA 4HA8A 5E1ZB 3DPLC 4ENNA 3DEUA 2M1BA 3ELKA 3VODA 5HDKA 2FF4A 1HBXG 1B1BA 4A0ZA 1GVJA 2H6CA 2XAHA 3KZZA 4LLLA 3V4GA 1J0RA 1UCRA 1JHFA 1IF1A 3KP6A 3ZMSA 2K27A 2KJCA 1HQCA 3WTVC 3NEUA 3RIRA 1DDNA 1ZARA 2P5KA 5D5XB 3C1DA 2FNPA 1YO5C 2UWMA 5DDGA 3LQQA 3KP7A 3PQKA 2F5FA 3BWGA 3LAPA 3V8JA 4MGRA 4G8XA 3MWMA 3IKTA 4PZJA 1ULYA 3WTYC 3CLOA 4NQWA 4A2UA 4S04A 3R6SA 1TQMA 2NYXA 2K86A 3QAHA 3R60A 2VOOA 4AIJA 5FO5A 1P92A 2HTJA 2IRFG 2O61A 2KIFA 2ZNZA 3I64A 1B9NA 2R7DA 4IXAA 4I7HA 2GQQA 1LDDA 5D4SA 3BP8A 5HS9A 1ZG5A 2GXGA 1IZ1A 1SFXA 3R0AA 2G9WA 2JRTA 4L9TA 2A07F 2DQLA 2DU9A 2EJRA 1YFHA 1WRJA 2K4JA 2L4AA 4LG0B 2H27A 2LSOA 5CJ9A 1ZRFA 1TQIA 4R8HA 4IHSA 2MD5A 4LB6B 3IRRA 1QQIA 1G3TA 1CF7B 3M8FA 2OZ6A 1K79A 1FY7A 1W5TA 2WV0A 4B8XA 1IUYA 2CYYA 2W25A 2VOPA 1D8JA 3FMRA 1JGSA 3KP4A 1KU3A 2O8XA 4XSZF 4LD5A 1UB9A 5LEKA 1HKQA 2V1UA 3I59A 3DQVC 1X3UA 1ZLJA 5BMZA 2J5OA 3T1BA 4XSXF 3BOQA 1FSHA 3TGNA 5BS6A 2HYGD 3DKWA 2DT5A 4ZZDA 4ZYGA 3SHFA 4RB3C 2GWRA 1WKMA 1BC7C 3EUHA 3GFJA 4M6XA 1XSVA 4P9UA 1EV7A 3F8NA 4G94A 5E8IA 2VC1A 2WC2A 1FYMA 4OMYA 3L00A 3RPQA 4CXFA 2EFNA 5HS7A 4Q4ZF 2HTSA 3BPXA 1A04A 1FBSA 1U2WA 4KYWA 1ONVA 3HIFA 1OKRA 3E6MA 3G73A 4KA4A 2XUBA 3WTZA 1FBUA 2VC0A 1SMYF 1U8RA 1FPQA 4DQ2A 4R79A 4ESFA 3GFIA 2VBZA 5JI6A 1DP7P 2VT2A 2Z3YA 3J80K 1LEAA 5BOXA 4UV8A 4P9FA 4YIIA 1G3WA 2P6SA 3WU0A 3K9TA 2VONA 2K7LA 1CGPA 3CUQC 1FYKA 4U0WA 2M8EA 3ZMUA 4BXUA 4A5NA 3MZYA 4IPAA 2KKOA 1ZRDA 4BAYA 3WTTC 2KIUA 3RTRA 1L0OC 1R5GA 2NNNA 1REPC 2OQRA 1XGMA 4Q5SF 2O03A 4CHUA 1W7PD 3K1PA 4CGZA 3CTAA 3FM3A 1RUNA 1YW9A 4GXOA 3GFMA 3IL2A 3QRFF 2M5WA 2DPUA 4FX0A 2VN2A 5IT9Z 4P55A 1BIAA 3WTWC 4A0XA 3K69A 6PAXA 4M9XA 2W57A 3MAJA 1FC3A 1LEBA 1H9GA 5LHIA 2QQAA 2QUFA 4GGGA 3IRQA 3KLOA 3EYIA 4G7OF 2BV6A 1ZHFA 2KRFA 4MEXF 5DCFA 4U7BA 3CUQB 1TQPA 2Y75A 3KE2A 5FD6A 2DW4A 2QQBA 3KLNA 1S6LA 4Y15A 2NRAC 4U0VA 3ECHA 2QBYA 2V79A 2P7CB 3H3ZA 2HFHA 3T5XA 4CZZA 2H94A 1U5TC 5KK1A 1QGPA 4KIFA 4L9VA 1KU2A 4R1HA 4G7HF 4HLXA 3K0LA 4RAYA 1MDMB 4Y13A 1KYWA 5FB2A 1Z9CA 3HTSB 2EV6A 1O7FA 4HF2A 4LK0F 1KQ9A 4RGUA 2FMYA 2G7UA 2FQ3A 2JSCA 2LF7A 3J81Z 1R00A 5LLQA 2ISZA 1LNWA 3ABUA 1ZREA 3HTUA 4UVCA 5ILUA 1D3YA 1KGSA 2Z9OA 1XDSA 2CGPA 3RKWA 4MNUA 5H6QA 3E97A 2STWA 3GX4X 3Q9VA 1V3FA 4EVIA 3U2RA 3QP5A 4M9SA 3V8LA 3TO7A 3W6KB 3E6CC 1R1VA 1WWXA 4JQFA 4I0AA 3QOPA 3EYYA 1FOKA 2K02A 1Z05A 3WU1B 3T8TA 4ZYEA 4U7DA 3WE3A 3FXUA 2ISYA 3KZYA 4HV6A 2MH9A 5LHHA 1U5TB 2A6HF 3FXQA 4Q48A 5F6FA 3JAMZ 4ON0A 2W85A 1STZA 4EGZA 2YU3A 5HLHA 5ICCA 5LRRA 5JVTA 3V8KA 1FLIA 5HVQC 3GVAA 4HOBA 1TW3A 2LKPA 1BJAA 1EH8A 1YIOA 2OU2A 1ON1A 3I4PA 2STTA 3V7RA 3BPVA 1UHWA 3EDPA 4FHTA 3BJ6A 2F5CA 2ZXJA 5D5WB 2HKOA 4RGXA 2XIGA 5JR3A 1CF7A 3DV8A 2QLZA 1XMAA 4U0YA 3K2ZA 2XKOA 4YFXF 2EFOA 3JTHA 3O2PE 3E6BA 3ZQ7A 1ZGAA 5KVRA 2VT3A 4A6EA 2KIMA 2PMUA 3ML6A 2JTVA 2QM3A 2ZKZA 2DBBA 3R4KA 4ASNA 2FNAA 4LLGF 1IN6A 1IN7A 1I5ZA 2XV4S 4KDPA 3TO9A 3FX3A 1IRGA 5J6XA 3WG9A 4A12A 3WGIA 5ERIA 3TQNA 1DPRA 3LQRA 1S7OA 1IAWA 4O6JA 2VBWA 3GWZA 4YG2F 3BJOA 3HRMA 3TDUC 1R58A 5FFZA 4PGGA 3M8EA 4EV0A 1G3YA 3O6BB 1VTNC 1D5VA 4IJAA 4OIOF 3JW4A 1UFMA 1HXDA 3I54A 1HW5A 3V7CA 1E2XA 5A2QK 2IA2A 1XCBA 1YS6A 5CYVA 3BZ6A 1I1SA 1I1GA 2V6CA 4GCVA 2EV0A 2IA1A 2FE3A 1EH7A 4EMSA 3JSOA 4XRFA 1FYLA 5FLXZ 4I98B 2P4WA 1T39A 2BEOA 1IN8A 2UXNA 1P4AA 2NS0A 4WXHA 3M1EA 2XAFA 3I71A 1K78B 4YIFA 3DP7A 5ICFA 2EB7A 4M73A 5ICEA 4HAMA 5H20A 4KIBA 3FHZA 3ZMDA 5EEHA 2HOEA 5E18F 5FGMA 5JHUA 2ADUA 1YLFA 2X4HA 2MBFA 1YS7A 3CUOA 1W7PA 2ETHA 5LRSA 1ZLKA 4HLYA 2IT0A 4LGWA 4AVPA 1XSXA 3VOEA 4RB1A 1KU7A 4U88A 2QQ9A 3PQJA 5HDNA 3M7GA 3WTUC 2EWNA 2PLYA 1W5SA 3P7NA 3LA3A 4RGRA 4FT8A 5AIPA 4UVAA 3B02A 2P7VB 1QPMA 1LVAA 2XRNA 2H6BA 3NRVA 4EJOA 3CO6C 2O6GE 2Q2EA 5DYMA 2EA2A 3REOA 4WK8F 1Z1DA 5LEJA 1QZYA 2IP2A 2VE8A 2COMA 3QPTA 3D0SA 2HKXA 2DPDA 4PCQA 4A5MA 3TDZC 1BBYA 2PI0A 2NNYA 4UNOA 2MLGA 3FMSA 2Y0MA 4UUVA 3IWZA 3C18A 3HSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7A A;  5D6E A;  4BYY A;  3F8C A;  3VEP A;  2KJB A;  3KP3 A;  3F8B A;  4BH9 A;  4AIH A;  2FXA A;  4RAZ A;  2E7W A;  5E1X A;  1KQ8 A;  1TW2 A;  1F9N A;  2IJL A;  3E6D A;  3HHG A;  4KMU X;  5E8G A;  2IA0 A;  1T2K A;  3Q5F A;  3G3Z A;  4AIK A;  1USS A;  2CG4 A;  5IT3 A;  2HR3 A;  1PP7 U;  4HW0 A;  1C0W A;  1ZGJ A;  4MQ9 F;  5DEQ A;  4A0Y A;  1U3E M;  2M30 A;  1LJ9 A;  5CVV A;  1G4D A;  2UXX A;  3L7W A;  4KFC A;  1J75 A;  4EGY A;  1Z7U A;  1UST A;  1HKS A;  2FOK A;  1XGS A;  2VBX A;  2ESN A;  2V1X A;  5FFX A;  4I01 A;  1SFU A;  4GYI A;  3S2W A;  2A6E F;  5BPI A;  2GAU A;  5L3E A;  1BI0 A;  2L4M A;  5FD5 A;  3WTX C;  3R61 A;  2DAO A;  3ROU A;  1BIB A;  2EK5 A;  2G7H A;  3BDD A;  1QNT A;  1ZN2 A;  2W84 A;  3T0Y A;  3OOP A;  2Y48 A;  3F3X A;  3ISP A;  2FA5 A;  4K2E A;  2C6Y A;  3GZ5 A;  4PDK A;  4EJU A;  4ZYD A;  2NAZ A;  3BJA A;  1DPU A;  2RGV A;  3N4M A;  1HKT A;  1J59 A;  3FXR A;  1V4R A;  3C3W A;  2V1D A;  3CDH A;  3J7A O;  2ZME A;  1MZB A;  2XAS A;  2MLK A;  4G7Z F;  4L9J A;  3QU3 A;  2ZBK A;  1P6R A;  3L2C A;  1O3R A;  3U9G A;  3V7S A;  2P6T A;  1HST A;  1OMI A;  2EA4 A;  4E70 A;  4N0B A;  4IVN A;  3RDI A;  2AXL A;  5AIQ A;  1H9T A;  3HOS A;  3W6J B;  4N9I A;  3ZMZ A;  5LHG A;  4EJV A;  3P9K A;  4KIG A;  5CVR A;  5D8L B;  2L01 A;  4QWQ A;  5DD8 A;  4BNC A;  2D2W A;  2K4B A;  4G9Y A;  3KP2 A;  3RKY A;  4L0Z B;  1KA8 A;  4B09 A;  1Z91 A;  2ZFW A;  4OIR F;  4HBL A;  1UHM A;  3LA2 A;  3OV8 A;  1IN4 A;  3K1N A;  1OYW A;  1S7A A;  3GFL A;  3QP6 A;  5K5Q A;  1S8N A;  1HW2 A;  4G6D A;  3IWF A;  3J80 Z;  2GZW A;  2OD5 A;  1WSU A;  5D4R A;  4P5O A;  2A3S A;  2BE5 F;  4UHT A;  1QZZ A;  2VOD A;  5F1R A;  2F5D A;  2AS5 F;  2YX4 A;  5DCM B;  3I58 A;  5L3F A;  1T0F A;  1KQ0 A;  1L3L A;  1SD4 A;  3LWF A;  4HDU A;  1XB4 A;  2HQR A;  2PFB A;  2D1H A;  4ESB A;  3SZT A;  2O3F A;  3GF2 A;  1Z6T A;  1YW7 A;  5L3C A;  4BHP A;  2CFX A;  5J8C A;  1TBX A;  3GLX A;  4QLC U;  1RUO A;  2L3D A;  1F5T A;  5HLI A;  3HSE A;  2RVC A;  2DLL A;  4RB2 C;  1T6S A;  1R7J A;  4ZZL A;  1RNL A;  2BBY A;  1W4M A;  2XVC A;  4UVB A;  2J5P A;  1MGT A;  2DI3 A;  2CQK A;  1O3T A;  4OOI A;  3HSF A;  4MQV A;  1B4A A;  2QYO A;  3D5L A;  2IPQ X;  3MFK A;  4RB0 A;  2A5Y B;  2HEO A;  1BI2 A;  1O3Q A;  2XKP A;  2O0Y A;  3E5U A;  3TOA A;  4Z2Y A;  3HYI A;  5BPD A;  3H92 A;  5TJJ A;  2BYV E;  4IHT A;  4MHG A;  1R22 A;  3M9A A;  1T98 A;  5D8K B;  2LDU A;  2RNJ A;  1MJB A;  4ENJ A;  4HF1 A;  2PN6 A;  4GO1 A;  4LG0 A;  3ERE D;  5K5R A;  3F23 A;  1AWC A;  2F5E A;  1Z6R A;  2JPB A;  2WTE A;  1LQ1 A;  1K78 A;  3BY6 A;  1ZH5 A;  2WWY A;  5CVU A;  4GYG A;  2CSO A;  2A61 A;  2HZT A;  5D5U B;  4HX4 A;  1B59 A;  5L3G A;  1OYI A;  1ZG3 A;  4NHJ A;  2V9V A;  2PQ8 A;  3MQ0 A;  2PMH A;  4EQQ A;  1ON2 A;  4S05 A;  1I27 A;  2CW0 F;  4XLP F;  1FX7 A;  2H09 A;  1XDU A;  3MEX A;  4I0B A;  2W24 A;  2P5L C;  1F1Z A;  4XBF A;  5LGU A;  3GEZ A;  2PG4 A;  2HYF A;  2ACJ A;  1XSD A;  3FM5 A;  4HX8 A;  2RV8 A;  4KNY A;  1O57 A;  1PDN C;  1HW1 A;  4M9Z A;  4OMZ A;  2HGC A;  1GXP A;  4KIC A;  4KN7 X;  3F6O A;  2YR2 A;  1OYY A;  5E20 A;  3ZMT A;  2HQN A;  5CLS A;  4KT5 C;  2MH2 A;  2EFW A;  4L18 B;  1FBQ A;  1R1T A;  4A6D A;  5K5O A;  1OPC A;  4M6Y A;  1FWZ A;  2OAZ A;  3JTG A;  5D6F A;  3KET A;  4YFN F;  3SFZ A;  1P4X A;  3VB2 A;  1BN5 A;  4PGH A;  1TTY A;  4Y17 A;  5ILS A;  1J9I A;  2YX7 A;  5AON A;  3Q9S A;  1D8K A;  1G6N A;  4HQM A;  2LNB A;  3IKV A;  2DFI A;  4OU0 A;  3PFI A;  5JFR A;  2YPR A;  4L0Y B;  1TLH B;  4OIN F;  1P2F A;  1R1U A;  4ZH4 F;  3GZ6 A;  2RDP A;  3GW2 A;  2FRH A;  1XCV A;  3I5U A;  3H3U A;  4L5J A;  2UZK A;  5J8F A;  3DF8 A;  4I02 A;  1ZRC A;  4WCG A;  1ODD A;  2PEX A;  1H0M A;  2ZJ2 A;  2B0L A;  5LGT A;  4EJW A;  3K1M A;  2FML A;  3SXY A;  2HDC A;  2A68 F;  4JK1 X;  3SQN A;  2LF8 A;  2OQG A;  4UV9 A;  2YSR A;  3KCC A;  5HDG A;  5IT9 K;  1LDJ A;  4NB5 A;  4LJZ F;  2TDX A;  3LA7 A;  1YQA A;  1K6O A;  1XMK A;  2OBP A;  2PBI A;  2FBH A;  1MJA A;  3KEQ A;  4LK1 F;  5ILV A;  3WE2 A;  3ABT A;  3ECO A;  4M72 A;  2QEN A;  2BGC A;  2GA1 A;  4H0E A;  4OIQ F;  3T8R A;  3AAF A;  3E5Q A;  2DO7 A;  1MKM A;  3F8M A;  3I53 A;  3U1D A;  4D0P A;  4MTE A;  5E17 F;  1FSE A;  1IXS B;  3TO6 A;  5TRD A;  1PUE E;  4ENM A;  1S3J A;  4LMY A;  1SAX A;  2D1V A;  3GYH X;  4XLN F;  4KMF A;  4IRG A;  3MCZ A;  4OIP F;  2FBK A;  1RZ4 A;  1JHH A;  3E5X A;  3RYP A;  5ED4 A;  3ZMV A;  3HHH A;  3F6V A;  1NHA A;  2ZO4 A;  4F7Z A;  5DUK A;  5BQT A;  4HYE A;  3COA C;  3CUQ A;  1ZG1 A;  1BC8 C;  2E1C A;  2QZ8 A;  1J2X A;  1KYZ A;  4I2O A;  3MZH A;  2GXB A;  4HV5 A;  1QO0 D;  3J81 K;  5A2Q Z;  1FNN A;  4UXN A;  3ULQ B;  5E1W A;  2ELH A;  1GHC A;  3QU6 A;  3IC7 A;  1R36 A;  1BOA A;  1WQ2 A;  3R0J A;  1KU9 A;  2JPC A;  1YYV A;  4EM1 A;  1YW8 A;  3C7J A;  1MDM A;  5HS8 A;  3EQL F;  3F8F A;  3WTS C;  4ETS A;  2Z33 A;  1R23 A;  3GUD A;  4CO8 A;  4BQA A;  3DPT A;  1E17 A;  2EFQ A;  3RKX A;  2P8T A;  1I6X A;  4L5I A;  1DUX C;  2IW5 A;  1W7P B;  2XHK A;  5CVJ A;  4IRI A;  2XAQ A;  3LST A;  3RPU A;  3I59 B;  2Z5U A;  2ZCW A;  4RS8 A;  1O7L A;  3TOB A;  1WI9 A;  2R7F A;  4M74 A;  4WXC A;  5DCM A;  3FWE A;  3WOD F;  4RGS A;  3QPH A;  4FX4 A;  4O3M A;  3B73 A;  1O3S A;  3F22 A;  1ZYR F;  3FMQ A;  4HQE A;  1FP1 D;  5L3D A;  2GIV A;  2M87 A;  4LLN A;  3KFW X;  2RN7 A;  5DV5 A;  2A69 F;  1YTY A;  2P5V A;  2PJP A;  4HX7 A;  3RI4 A;  2EV5 A;  1IXR C;  4WXD A;  1SD5 A;  5ICG A;  4CYD A;  2E7X A;  1SD7 A;  1J5Y A;  3JAM K;  3LFK A;  2VBY A;  1FT9 A;  3TKY A;  1S29 A;  1TNT A;  2DTR A;  3HRT A;  2RC4 A;  3DFG A;  1SMT A;  1FP2 A;  4HZF A;  3VFZ A;  4G6Q A;  3KEO A;  2DK8 A;  2IVM A;  3HOT A;  2ESH A;  4EJT A;  4M71 A;  4LFU A;  1YG2 A;  1AOY A;  3HUG A;  1U5T A;  1IN5 A;  4BHC A;  2XAJ A;  2L54 A;  3KP5 A;  1ZAO A;  1XGO A;  2E1N A;  2DQR A;  4BHB A;  3WGH A;  2JT1 A;  3GXO A;  4I09 A;  3DXJ F;  1BM9 A;  1G3S A;  4ZYH A;  5CVI A;  1BI1 A;  1PP8 F;  3RJP A;  3N97 A;  5HOO A;  3RYR A;  4EM0 B;  3O3K A;  3IHU A;  2OA4 A;  1MJ9 A;  2ZNY A;  2VXZ A;  4IF4 A;  2HS5 A;  3L09 A;  3ZPL A;  2QWW A;  2Q8K A;  4YFK F;  2EFP A;  4Q47 A;  2XAG A;  2GA2 A;  3L9F A;  4DNC A;  5LGN A;  1XN7 A;  5LBQ A;  3BRO A;  2Z99 A;  5DUI A;  1SD6 A;  2RKH A;  3ZP5 A;  4LB5 A;  1Q1H A;  1R5H A;  5L3B A;  3F72 A;  5D5V B;  2D45 A;  4ESJ A;  2CO5 A;  2QVO A;  4KN4 X;  4WWC A;  4HDV A;  2Q0O A;  4CIC A;  2DK5 A;  4MTD A;  1JE8 A;  1GXQ A;  2FBI A;  4JBA A;  2XRO A;  1XD7 A;  3SZP A;  2R3S A;  1U6G A;  4P96 A;  3P9I A;  3CO7 C;  5EEG A;  1HSJ A;  4WF2 A;  2VE9 A;  1J7K A;  3EET A;  2MA3 A;  3HRU A;  1IRF A;  3GO5 A;  3E3V A;  2M45 A;  4O5V A;  1B6A A;  3WGG A;  3NQO A;  5K1Y A;  2OZU A;  1IXC A;  2ZME B;  3CJN A;  4KUM A;  1Y0U A;  4TV7 A;  4HF0 A;  1T38 A;  5F64 A;  1F4K A;  2XGX A;  4N9H A;  5FLX K;  3HRS A;  2JZY A;  5DD4 A;  3JSP A;  4CDG A;  2FU4 A;  1OR7 A;  1TNS A;  2RQP A;  2MC3 A;  3F21 A;  1IW7 F;  2L02 A;  1RI7 A;  1MD0 A;  3P9C A;  1SFE A;  1LDK B;  2QBY B;  2FSW A;  4ENK A;  1XGN A;  2HWV A;  1EH6 A;  4L9N A;  3FZV A;  4AWX B;  3I0T A;  5H6R A;  1FZP B;  4AD9 A;  2FEZ A;  1B9M A;  3ZN1 A;  3ZN0 A;  1LB2 A;  1QBJ A;  4WX9 A;  4MEY F;  2CWE A;  1JXS A;  3LAJ A;  1RIO H;  1P4W A;  4IRH A;  2F2E A;  4EM2 A;  1U78 A;  5HLG A;  1BI3 A;  3FF5 A;  2X0L A;  4HA8 A;  5E1Z B;  3DPL C;  4ENN A;  3DEU A;  2M1B A;  3ELK A;  3VOD A;  5HDK A;  2FF4 A;  1HBX G;  1B1B A;  4A0Z A;  1GVJ A;  2H6C A;  2XAH A;  3KZZ A;  4LLL A;  3V4G A;  1J0R A;  1UCR A;  1JHF A;  1IF1 A;  3KP6 A;  3ZMS A;  2K27 A;  2KJC A;  1HQC A;  3WTV C;  3NEU A;  3RIR A;  1DDN A;  1ZAR A;  2P5K A;  5D5X B;  3C1D A;  2FNP A;  1YO5 C;  2UWM A;  5DDG A;  3LQQ A;  3KP7 A;  3PQK A;  2F5F A;  3BWG A;  3LAP A;  3V8J A;  4MGR A;  4G8X A;  3MWM A;  3IKT A;  4PZJ A;  1ULY A;  3WTY C;  3CLO A;  4NQW A;  4A2U A;  4S04 A;  3R6S A;  1TQM A;  2NYX A;  2K86 A;  3QAH A;  3R60 A;  2VOO A;  4AIJ A;  5FO5 A;  1P92 A;  2HTJ A;  2IRF G;  2O61 A;  2KIF A;  2ZNZ A;  3I64 A;  1B9N A;  2R7D A;  4IXA A;  4I7H A;  2GQQ A;  1LDD A;  5D4S A;  3BP8 A;  5HS9 A;  1ZG5 A;  2GXG A;  1IZ1 A;  1SFX A;  3R0A A;  2G9W A;  2JRT A;  4L9T A;  2A07 F;  2DQL A;  2DU9 A;  2EJR A;  1YFH A;  1WRJ A;  2K4J A;  2L4A A;  4LG0 B;  2H27 A;  2LSO A;  5CJ9 A;  1ZRF A;  1TQI A;  4R8H A;  4IHS A;  2MD5 A;  4LB6 B;  3IRR A;  1QQI A;  1G3T A;  1CF7 B;  3M8F A;  2OZ6 A;  1K79 A;  1FY7 A;  1W5T A;  2WV0 A;  4B8X A;  1IUY A;  2CYY A;  2W25 A;  2VOP A;  1D8J A;  3FMR A;  1JGS A;  3KP4 A;  1KU3 A;  2O8X A;  4XSZ F;  4LD5 A;  1UB9 A;  5LEK A;  1HKQ A;  2V1U A;  3I59 A;  3DQV C;  1X3U A;  1ZLJ A;  5BMZ A;  2J5O A;  3T1B A;  4XSX F;  3BOQ A;  1FSH A;  3TGN A;  5BS6 A;  2HYG D;  3DKW A;  2DT5 A;  4ZZD A;  4ZYG A;  3SHF A;  4RB3 C;  2GWR A;  1WKM A;  1BC7 C;  3EUH A;  3GFJ A;  4M6X A;  1XSV A;  4P9U A;  1EV7 A;  3F8N A;  4G94 A;  5E8I A;  2VC1 A;  2WC2 A;  1FYM A;  4OMY A;  3L00 A;  3RPQ A;  4CXF A;  2EFN A;  5HS7 A;  4Q4Z F;  2HTS A;  3BPX A;  1A04 A;  1FBS A;  1U2W A;  4KYW A;  1ONV A;  3HIF A;  1OKR A;  3E6M A;  3G73 A;  4KA4 A;  2XUB A;  3WTZ A;  1FBU A;  2VC0 A;  1SMY F;  1U8R A;  1FPQ A;  4DQ2 A;  4R79 A;  4ESF A;  3GFI A;  2VBZ A;  5JI6 A;  1DP7 P;  2VT2 A;  2Z3Y A;  3J80 K;  1LEA A;  5BOX A;  4UV8 A;  4P9F A;  4YII A;  1G3W A;  2P6S A;  3WU0 A;  3K9T A;  2VON A;  2K7L A;  1CGP A;  3CUQ C;  1FYK A;  4U0W A;  2M8E A;  3ZMU A;  4BXU A;  4A5N A;  3MZY A;  4IPA A;  2KKO A;  1ZRD A;  4BAY A;  3WTT C;  2KIU A;  3RTR A;  1L0O C;  1R5G A;  2NNN A;  1REP C;  2OQR A;  1XGM A;  4Q5S F;  2O03 A;  4CHU A;  1W7P D;  3K1P A;  4CGZ A;  3CTA A;  3FM3 A;  1RUN A;  1YW9 A;  4GXO A;  3GFM A;  3IL2 A;  3QRF F;  2M5W A;  2DPU A;  4FX0 A;  2VN2 A;  5IT9 Z;  4P55 A;  1BIA A;  3WTW C;  4A0X A;  3K69 A;  6PAX A;  4M9X A;  2W57 A;  3MAJ A;  1FC3 A;  1LEB A;  1H9G A;  5LHI A;  2QQA A;  2QUF A;  4GGG A;  3IRQ A;  3KLO A;  3EYI A;  4G7O F;  2BV6 A;  1ZHF A;  2KRF A;  4MEX F;  5DCF A;  4U7B A;  3CUQ B;  1TQP A;  2Y75 A;  3KE2 A;  5FD6 A;  2DW4 A;  2QQB A;  3KLN A;  1S6L A;  4Y15 A;  2NRA C;  4U0V A;  3ECH A;  2QBY A;  2V79 A;  2P7C B;  3H3Z A;  2HFH A;  3T5X A;  4CZZ A;  2H94 A;  1U5T C;  5KK1 A;  1QGP A;  4KIF A;  4L9V A;  1KU2 A;  4R1H A;  4G7H F;  4HLX A;  3K0L A;  4RAY A;  1MDM B;  4Y13 A;  1KYW A;  5FB2 A;  1Z9C A;  3HTS B;  2EV6 A;  1O7F A;  4HF2 A;  4LK0 F;  1KQ9 A;  4RGU A;  2FMY A;  2G7U A;  2FQ3 A;  2JSC A;  2LF7 A;  3J81 Z;  1R00 A;  5LLQ A;  2ISZ A;  1LNW A;  3ABU A;  1ZRE A;  3HTU A;  4UVC A;  5ILU A;  1D3Y A;  1KGS A;  2Z9O A;  1XDS A;  2CGP A;  3RKW A;  4MNU A;  5H6Q A;  3E97 A;  2STW A;  3GX4 X;  3Q9V A;  1V3F A;  4EVI A;  3U2R A;  3QP5 A;  4M9S A;  3V8L A;  3TO7 A;  3W6K B;  3E6C C;  1R1V A;  1WWX A;  4JQF A;  4I0A A;  3QOP A;  3EYY A;  1FOK A;  2K02 A;  1Z05 A;  3WU1 B;  3T8T A;  4ZYE A;  4U7D A;  3WE3 A;  3FXU A;  2ISY A;  3KZY A;  4HV6 A;  2MH9 A;  5LHH A;  1U5T B;  2A6H F;  3FXQ A;  4Q48 A;  5F6F A;  3JAM Z;  4ON0 A;  2W85 A;  1STZ A;  4EGZ A;  2YU3 A;  5HLH A;  5ICC A;  5LRR A;  5JVT A;  3V8K A;  1FLI A;  5HVQ C;  3GVA A;  4HOB A;  1TW3 A;  2LKP A;  1BJA A;  1EH8 A;  1YIO A;  2OU2 A;  1ON1 A;  3I4P A;  2STT A;  3V7R A;  3BPV A;  1UHW A;  3EDP A;  4FHT A;  3BJ6 A;  2F5C A;  2ZXJ A;  5D5W B;  2HKO A;  4RGX A;  2XIG A;  5JR3 A;  1CF7 A;  3DV8 A;  2QLZ A;  1XMA A;  4U0Y A;  3K2Z A;  2XKO A;  4YFX F;  2EFO A;  3JTH A;  3O2P E;  3E6B A;  3ZQ7 A;  1ZGA A;  5KVR A;  2VT3 A;  4A6E A;  2KIM A;  2PMU A;  3ML6 A;  2JTV A;  2QM3 A;  2ZKZ A;  2DBB A;  3R4K A;  4ASN A;  2FNA A;  4LLG F;  1IN6 A;  1IN7 A;  1I5Z A;  2XV4 S;  4KDP A;  3TO9 A;  3FX3 A;  1IRG A;  5J6X A;  3WG9 A;  4A12 A;  3WGI A;  5ERI A;  3TQN A;  1DPR A;  3LQR A;  1S7O A;  1IAW A;  4O6J A;  2VBW A;  3GWZ A;  4YG2 F;  3BJO A;  3HRM A;  3TDU C;  1R58 A;  5FFZ A;  4PGG A;  3M8E A;  4EV0 A;  1G3Y A;  3O6B B;  1VTN C;  1D5V A;  4IJA A;  4OIO F;  3JW4 A;  1UFM A;  1HXD A;  3I54 A;  1HW5 A;  3V7C A;  1E2X A;  5A2Q K;  2IA2 A;  1XCB A;  1YS6 A;  5CYV A;  3BZ6 A;  1I1S A;  1I1G A;  2V6C A;  4GCV A;  2EV0 A;  2IA1 A;  2FE3 A;  1EH7 A;  4EMS A;  3JSO A;  4XRF A;  1FYL A;  5FLX Z;  4I98 B;  2P4W A;  1T39 A;  2BEO A;  1IN8 A;  2UXN A;  1P4A A;  2NS0 A;  4WXH A;  3M1E A;  2XAF A;  3I71 A;  1K78 B;  4YIF A;  3DP7 A;  5ICF A;  2EB7 A;  4M73 A;  5ICE A;  4HAM A;  5H20 A;  4KIB A;  3FHZ A;  3ZMD A;  5EEH A;  2HOE A;  5E18 F;  5FGM A;  5JHU A;  2ADU A;  1YLF A;  2X4H A;  2MBF A;  1YS7 A;  3CUO A;  1W7P A;  2ETH A;  5LRS A;  1ZLK A;  4HLY A;  2IT0 A;  4LGW A;  4AVP A;  1XSX A;  3VOE A;  4RB1 A;  1KU7 A;  4U88 A;  2QQ9 A;  3PQJ A;  5HDN A;  3M7G A;  3WTU C;  2EWN A;  2PLY A;  1W5S A;  3P7N A;  3LA3 A;  4RGR A;  4FT8 A;  5AIP A;  4UVA A;  3B02 A;  2P7V B;  1QPM A;  1LVA A;  2XRN A;  2H6B A;  3NRV A;  4EJO A;  3CO6 C;  2O6G E;  2Q2E A;  5DYM A;  2EA2 A;  3REO A;  4WK8 F;  1Z1D A;  5LEJ A;  1QZY A;  2IP2 A;  2VE8 A;  2COM A;  3QPT A;  3D0S A;  2HKX A;  2DPD A;  4PCQ A;  4A5M A;  3TDZ C;  1BBY A;  2PI0 A;  2NNY A;  4UNO A;  2MLG A;  3FMS A;  2Y0M A;  4UUV A;  3IWZ A;  3C18 A;  3HSR A; 
#chains in the Genus database with same CATH topology
 4CYC B;  2FX0 A;  4Y52 J;  1JUS A;  3M1C A;  5CQE A;  1K7A A;  5D6E A;  4BYY A;  3F8C A;  3L2V A;  1WFX A;  3CC7 I;  2ME6 A;  3VEP A;  2KJB A;  3KP3 A;  2DCE A;  3ZQC A;  4IQ4 A;  3F8B A;  4BH9 A;  3LNQ A;  3OSG A;  1VND A;  2XDV A;  4FIS A;  4AIH A;  4CZC A;  4UY8 I;  2FXA A;  1PYV A;  4RAZ A;  2E7W A;  1TT5 B;  5E1X A;  3TP3 A;  1KQ8 A;  4E7K A;  1GVD A;  1TW2 A;  2JWT A;  3KX2 A;  1F9N A;  2IJL A;  3E6D A;  3HHG A;  1UHS A;  4M3D A;  4KMU X;  3NAU A;  2IA0 A;  5E8G A;  1HC8 A;  1T2K A;  1VQN I;  4XLC A;  3Q5F A;  3G3Z A;  3S1N J;  4AIK A;  1R71 A;  5LFA A;  3TW6 A;  4A3E J;  1USS A;  3DTI A;  2CG4 A;  1EKE A;  1VZ0 A;  5IT3 A;  2HR3 A;  1PP7 U;  4HW0 A;  3FXM A;  3OL3 A;  2FQ4 A;  4PSW A;  4CCL A;  1GLN A;  3LSI A;  3RZD J;  1C0W A;  2R7R A;  1ZGJ A;  4MQ9 F;  5DEQ A;  4A0Y A;  1U3E M;  2L7M P;  2M30 A;  1LJ9 A;  5CVV A;  4D1Q A;  3OS0 A;  3A1Y A;  1G4D A;  2UXX A;  2DOD A;  2GLO A;  3L7W A;  4KFC A;  1U9N A;  1J75 A;  4EGY A;  2IEK A;  1ACI A;  2W1O A;  1BR2 A;  4XOR A;  1Z7U A;  1UST A;  2WBM A;  3HB9 A;  1HKS A;  2FOK A;  3LSK A;  1XGS A;  2VBX A;  5J40 A;  2ESN A;  2V1X A;  2E5Z A;  2UUZ A;  2DOA A;  1IRZ A;  1YIT I;  3A01 B;  5FFX A;  2N8G A;  3K4J A;  4I01 A;  1SFU A;  3CP2 A;  4GYI A;  3S2W A;  2KHM A;  2KRH A;  4IO9 F;  2A6E F;  5BPI A;  4Y4R A;  2GAU A;  2X6O A;  4RMN A;  5L3E A;  3FBI B;  1FOY A;  1BI0 A;  2L4M A;  4NDL A;  5FD5 A;  3WTX C;  3R61 A;  2DAO A;  2LBF A;  3ROU A;  2XPU A;  4XNF A;  4F52 A;  1BIB A;  3VDX A;  2EK5 A;  2G7H A;  3BDD A;  4C2M J;  1QNT A;  1ZN2 A;  2E34 A;  2W84 A;  3T0Y A;  3OOP A;  3S14 J;  2Y48 A;  3F3X A;  3W2A A;  2KL4 A;  3GTQ J;  3ISP A;  2FA5 A;  4K2E A;  2C6Y A;  3GZ5 A;  3H35 A;  4PDK A;  4NBQ A;  1JUM A;  4XOP A;  2IS1 A;  4EJU A;  4ZYD A;  1YX3 A;  2NAZ A;  2L9R A;  3BJA A;  4NC6 A;  1DPU A;  2RGV A;  3N4M A;  4PSX A;  1R4M B;  4E7L A;  1HKT A;  1J59 A;  5F0H A;  3FXR A;  4A3L J;  1V4R A;  1X1D A;  3S93 A;  2V6E A;  2Y30 A;  3C3W A;  2V1D A;  1WJ5 A;  3N05 A;  2DYR H;  3CDH A;  1D5Y A;  3J7A O;  2ZME A;  2CUZ A;  2KT0 A;  1LPQ A;  4IHX A;  2HQA A;  3ZGK A;  3RZO J;  1MZB A;  2XAS A;  3K7A J;  1MBE A;  2MLK A;  4G7Z F;  4L9J A;  2DA3 A;  3QU3 A;  2ZBK A;  1P6R A;  3L2C A;  4V2F A;  1FTZ A;  3J7Y J;  3U9G A;  1O3R A;  3CC4 I;  3GTM J;  3V7S A;  3MD2 A;  2P6T A;  3ZQG A;  1HST A;  1KON A;  1OMI A;  3CCY A;  1WH5 A;  2EA4 A;  4I99 C;  2EIM H;  4E70 A;  4N0B A;  4IVN A;  3L2W A;  4RA2 A;  2JUC A;  3LFU A;  2AXL A;  3RDI A;  5AIQ A;  2GIZ A;  1H9T A;  1Y8Q B;  2H8R A;  3HOS A;  4A3F J;  4BE0 A;  1S9H A;  4PFO A;  2K9N A;  2OJE D;  2E1M C;  3W6J B;  4N9I A;  3ZMZ A;  5LHG A;  2AQE A;  4EJV A;  2XF5 A;  3P9K A;  3K4C A;  4KIG A;  5CVR A;  2EPF A;  5D8L B;  2L01 A;  5IYD J;  4QWQ A;  3H36 A;  1X58 A;  3BT9 A;  5DD8 A;  4BNC A;  2D2W A;  2M2E A;  3GTK J;  5IY5 H;  2K4B A;  4G9Y A;  3IH3 A;  5GPA A;  3BZK A;  3KP2 A;  3RKY A;  1LFU P;  3VWB A;  4L0Z B;  2OC6 A;  5FLV A;  2YUS A;  4HNV A;  4F91 B;  3ESW B;  3S3N A;  1KA8 A;  4B09 A;  2QSG X;  1Z91 A;  2ZFW A;  4OIR F;  3ZOB A;  4HBL A;  1UHM A;  4G6T B;  3V42 A;  5F27 A;  2OTL I;  3ZQF A;  1WHU A;  3LA2 A;  3OV8 A;  1IN4 A;  3K1N A;  4GRI A;  1OYW A;  1S7A A;  3GFL A;  3QP6 A;  4XN0 A;  5K5Q A;  3MKW B;  3HOW J;  1S8N A;  1HW2 A;  3H5A A;  4G6D A;  1YOV B;  3IWF A;  4S0H B;  3J80 Z;  2GZW A;  2LG4 A;  2OD5 A;  2XGC A;  1WSU A;  4BEH A;  5D4R A;  3H1C A;  4P5O A;  3ZR8 X;  2A3S A;  2BE5 F;  4UHT A;  2CU7 A;  1N25 A;  1QZZ A;  3HZJ A;  2VOD A;  5F1R A;  2F5D A;  2AS5 F;  2YX4 A;  5DCM B;  3I58 A;  5L3F A;  1T0F A;  4W97 A;  5JLX A;  3JRD A;  1KQ0 A;  4GFB A;  1L3L A;  1SD4 A;  3LWF A;  2EZI A;  4HDU A;  1XB4 A;  2HQR A;  2PFB A;  3BR0 A;  2NVU B;  1NK2 P;  5EG0 A;  2D1H A;  4ESB A;  1AKH B;  3SZT A;  2BZT A;  1JKQ C;  2O3F A;  3ZCO A;  1W36 C;  3GF2 A;  2VJ5 A;  1Z6T A;  2Y0S N;  1ZQ3 P;  1ERD A;  2BOL A;  1YW7 A;  3AG3 H;  4M6V A;  5L3C A;  4B47 A;  4BHP A;  2HI3 A;  2XPW A;  1SFK A;  1MBH A;  2CFX A;  3BLY A;  5J8C A;  2KZG A;  1TBX A;  2XPV A;  1QVT A;  3GLX A;  3CES A;  4QLC U;  1RUO A;  4ZYA A;  2L3D A;  1F5T A;  5HLI A;  3HSE A;  3I3L A;  3H5N A;  2E1M B;  4BUP A;  1OCP A;  2RVC A;  2DLL A;  3ZRG A;  5GAE J;  1ZK8 A;  1IO2 A;  4RB2 C;  1T6S A;  4ZJZ A;  1UEL B;  1R7J A;  2HXO A;  4ZZL A;  1RNL A;  2BBY A;  1FJL A;  4E7H A;  1UG2 A;  1W4M A;  2XVC A;  4UVB A;  2J5P A;  1MGT A;  2DI3 A;  2CQK A;  5F04 A;  2HNH A;  1BR4 A;  4XLF A;  1O3T A;  2IS6 A;  1JI8 A;  2ZXW H;  4OOI A;  5HNF A;  2LFB A;  3HSF A;  3S16 J;  4MQV A;  3GTL J;  1B4A A;  2QYO A;  5JVG F;  3D5L A;  2IPQ X;  3MFK A;  4RB0 A;  2A5Y B;  2HEO A;  1BI2 A;  1O3Q A;  2Y31 A;  3K4K A;  2XKP A;  3QQA A;  2O0Y A;  3E5U A;  4Y3O A;  3TOA A;  2LMD A;  4Z2Y A;  1RES A;  3HYI A;  1OCZ H;  5BPD A;  4L5E A;  3H92 A;  3M07 A;  2Z2S B;  4RAG A;  2OTJ I;  3JRG A;  5TJJ A;  2BYV E;  4IHT A;  4BBS J;  4MHG A;  4CUG A;  1R22 A;  3M9A A;  2R5Y B;  1OCR H;  4CCK A;  4Y7N J;  1T98 A;  5D8K B;  2LDU A;  2AO9 A;  2RNJ A;  1MJB A;  4ENJ A;  2B7E A;  1BA5 A;  4HF1 A;  2PN6 A;  4GO1 A;  1LE8 A;  2K5C A;  4XLA A;  4LG0 A;  2JVH A;  3ERE D;  5EYR A;  4HRI A;  2IGN A;  5EJC A;  4BGD A;  5K5R A;  1V54 H;  3F23 A;  4XKC A;  1AWC A;  2F5E A;  4IQJ A;  1Z6R A;  2JPB A;  1Y1W J;  2WTE A;  1LQ1 A;  1K78 A;  3BY6 A;  1ZH5 A;  3IUO A;  5CVU A;  3U1K A;  2WWY A;  4GYG A;  2CSO A;  2LK2 A;  3OS2 A;  3HXL A;  2A61 A;  3B6C A;  4AVZ A;  2HZT A;  1XTA A;  4CCO A;  4HX4 A;  1B59 A;  5D5U B;  5L3G A;  3K70 C;  1RRJ A;  3BR1 A;  2K9L A;  1OYI A;  1ZG3 A;  2VB6 A;  4NHJ A;  2V9V A;  2KDZ A;  2LRD A;  3GME A;  2PQ8 A;  3MQ0 A;  2PMH A;  1O4X A;  3VYR B;  2DMP A;  1RC9 A;  1XPX A;  4EQQ A;  2HVR A;  1ON2 A;  2O5R A;  4S05 A;  1I27 A;  2CW0 F;  2NVY J;  4XLP F;  1FX7 A;  3FDY A;  4MLO A;  4FAS D;  3FK7 A;  2V4J C;  2H09 A;  1TWC J;  1XDU A;  3MEX A;  4I0B A;  3H0D A;  2W24 A;  1D1A A;  3ZQH A;  1F1Z A;  2P5L C;  1QU3 A;  4XBF A;  5LGU A;  3GEZ A;  2PG4 A;  2HYF A;  2ACJ A;  1IC8 A;  1XSD A;  3FM5 A;  4HX8 A;  5M5X J;  4C9Y A;  2RV8 A;  4XK4 A;  4KNY A;  3TMO A;  1JKR C;  1O57 A;  5CQG A;  5IPA A;  1PDN C;  1HW1 A;  2M8G X;  4M9Z A;  4OMZ A;  2HGC A;  3BG9 A;  4B1R A;  1GXP A;  1DU6 A;  5GAD J;  4BDY A;  3SFI A;  2ICW G;  4KIC A;  4KN7 X;  2DJN A;  3SEQ A;  3F6O A;  1VQ7 I;  2YR2 A;  1OYY A;  5E20 A;  3AKZ A;  3ZMT A;  4Y33 A;  2HQN A;  5CLS A;  5FKO A;  3ASO H;  4KT5 C;  2MH2 A;  4IOC F;  2LOO A;  2EFW A;  2MGQ A;  5EDN A;  2MAB A;  4L18 B;  1FBQ A;  2IS2 A;  2WAF A;  1OCT C;  1OCC H;  2H8W A;  4DOZ A;  1B8I B;  2ELK A;  1R1T A;  2XSD C;  4A6D A;  2EQR A;  1ZTR A;  3CMY A;  4A93 J;  1R9T J;  1IUF A;  2L7F P;  5K5O A;  2W4S A;  1OPC A;  5E3L A;  3K4N A;  4M6Y A;  2WB1 A;  1FWZ A;  3H9G A;  3DU6 A;  3H5R A;  2IS4 A;  2OAZ A;  3JTG A;  3DTE A;  5D6F A;  3KET A;  2CUJ A;  4YFN F;  3K2A A;  3HKZ N;  2NS7 A;  3SFZ A;  1P4X A;  3VB2 A;  1BN5 A;  3NWT A;  4PGH A;  1TTY A;  5IYB J;  5C4J J;  1E3P A;  4Y17 A;  5F08 A;  5ILS A;  3MKY B;  3S17 J;  2HVS A;  1J9I A;  2IXS A;  3BG3 A;  4CYC A;  3PNY A;  2YX7 A;  2DFH A;  5AON A;  3Q9S A;  1D8K A;  1G6N A;  4HQM A;  1ZR2 A;  3LSJ A;  4E4H A;  2LNB A;  3IKV A;  1B72 A;  2LH9 A;  2DFI A;  4OU0 A;  2L0K A;  3PFI A;  5JFR A;  2YPR A;  4L0Y B;  3A0H C;  1TLH B;  1K4T A;  5EZH A;  2Y0S A;  4OIN F;  4FTH A;  1P2F A;  1R1U A;  4ZH4 F;  3JRH A;  2RDP A;  3GZ6 A;  4V19 K;  4PJJ A;  2W82 A;  3GW2 A;  4XRS G;  2FRH A;  1XCV A;  3AL0 C;  1Y8R B;  3I5U A;  3LSM A;  2QGU A;  3H3U A;  3G4S I;  3RKQ A;  3QYB A;  3BZC A;  4L5J A;  2UZK A;  4E7J A;  5J8F A;  3DF8 A;  4I02 A;  2LRE A;  4BBR J;  1ZRC A;  2XF6 A;  4WCG A;  1JKO C;  2VKE A;  1ODD A;  2PEX A;  1H0M A;  2ZJ2 A;  4B43 A;  3CCE I;  2B0L A;  5LGT A;  4EJW A;  3K1M A;  4IZZ A;  2FML A;  3SXY A;  2HDC A;  2A68 F;  4JK1 X;  3SQN A;  3PM1 A;  2LF8 A;  1OIS A;  2ID6 A;  2OQG A;  4UV9 A;  3H9J A;  3MKZ A;  3ZQL A;  1XG1 A;  2YSR A;  1TWH J;  3KCC A;  5HDG A;  2BY2 A;  5IOZ A;  2WY7 Q;  1A31 A;  1LDJ A;  2VJJ A;  4NB5 A;  5IT9 K;  5DM6 F;  2WAQ N;  4LJZ F;  2TDX A;  3LA7 A;  3I55 I;  1ZR4 A;  4XRM A;  1YQA A;  2M7A A;  1K6O A;  1XMK A;  2X9D A;  3P5J A;  3U21 A;  2OBP A;  4DIQ A;  1X2N A;  4D9J A;  1JUP A;  2PBI A;  2FBH A;  1MJA A;  2XSJ C;  2DA2 A;  3KEQ A;  4LK1 F;  5ILV A;  3WE2 A;  4C3H J;  3ABT A;  2JMW A;  3ECO A;  4M72 A;  1NTC A;  1YIJ I;  5B1B H;  4QPQ A;  2QEN A;  5J1U A;  2QSH X;  2Y9Y A;  2BGC A;  3PSF A;  2GA1 A;  4H0E A;  4OIQ F;  3T8R A;  3E1S A;  3AAF A;  3L2Q A;  2DA5 A;  3E5Q A;  1X2M A;  2R7S A;  3K4B A;  1VQ9 I;  2Q1Z B;  2DO7 A;  1A6I A;  2VKV A;  1MKM A;  3F8M A;  3I53 A;  3U1D A;  5J1R A;  4D0P A;  3OR2 C;  4MTE A;  5E17 F;  1FSE A;  1IXS B;  3TO6 A;  1UZC A;  5TRD A;  1PUE E;  4ENM A;  1S3J A;  4LMY A;  5GAG J;  2GOM A;  1PUF A;  2JA8 J;  1SAX A;  1TZL A;  3VYU B;  2DJI A;  2D1V A;  3GYH X;  1EA3 A;  1BW5 A;  4XLN F;  5KCM A;  4KMF A;  1VQL I;  1LVK A;  4IRG A;  3I4M J;  3MCZ A;  1R4N B;  4OIP F;  2FBK A;  2RAE A;  1RZ4 A;  3DLA A;  3W6V A;  1HF0 A;  3PUB A;  2MC4 A;  1T56 A;  2CV0 A;  1JHH A;  3E5X A;  2OF7 A;  4J00 A;  3RYP A;  5ED4 A;  1E3O C;  2W7N A;  3ZMV A;  4IKF A;  3HHH A;  2ZSH B;  3AL0 B;  3F6V A;  1NHA A;  2ZO4 A;  4F7Z A;  5DUK A;  3E7L A;  3FK6 A;  5BQT A;  4HYE A;  1HLV A;  2VL8 A;  3COA C;  3CUQ A;  2NVQ J;  1ZG1 A;  1OQY A;  1BC8 C;  2O7O A;  3GCM A;  5H2F C;  3HOV J;  2WV1 A;  4UUS B;  2E1C A;  1SFO J;  2QZ8 A;  4DZP A;  5C4X J;  2DMQ A;  1J2X A;  2BXZ A;  1KYZ A;  4I2O A;  1WJB A;  3MZH A;  2GXB A;  4HV5 A;  3JR9 A;  1QO0 D;  2OCE A;  5A2Q Z;  3J81 K;  1FNN A;  4UXN A;  3FXJ A;  3ULQ B;  2ZXI A;  5E1W A;  2ELH A;  4BJT A;  3DLL F;  1GHC A;  3QU6 A;  3IC7 A;  1R36 A;  1WVR A;  1BOA A;  1WQ2 A;  3R0J A;  1KU9 A;  3DPU A;  1PVE A;  2JPC A;  1YYV A;  4EM1 A;  3NAR A;  1V5F A;  3W3C A;  1YW8 A;  3C7J A;  2BW3 A;  3EPZ A;  4BQQ A;  1MDM A;  4FE4 A;  5HS8 A;  2JA6 J;  3EQL F;  3F8F A;  2LKX A;  3CCM I;  3WTS C;  4ETS A;  2Z33 A;  1R23 A;  2K3F A;  3GUD A;  1D0X A;  4CO8 A;  2VQH A;  4BQA A;  3DPT A;  1E17 A;  1ETQ A;  2EFQ A;  3RKX A;  3DEW A;  2P8T A;  1I6X A;  4L5I A;  1DUX C;  2IW5 A;  5DS9 A;  1W7P B;  2X85 A;  2XHK A;  2R5Z A;  1Z67 A;  3FXL A;  5J3L A;  5CVJ A;  4IRI A;  2XAQ A;  3LST A;  3K4L A;  1AU7 A;  3RPU A;  3I59 B;  2FUG 2;  2R7T A;  2Z5U A;  2ZCW A;  5IP7 J;  1OFC X;  4RS8 A;  1O7L A;  3TOB A;  1WI9 A;  3HKZ A;  2R7F A;  4M74 A;  1SAU A;  3BG7 A;  5FLM J;  3DBR B;  3IAM 2;  5CPR B;  3OYK A;  3VYS B;  2CV2 A;  2XC7 A;  2DXI A;  4WXC A;  5DCM A;  3FWE A;  3WOD F;  4RGS A;  3QPH A;  4FX4 A;  4J01 A;  4O3M A;  3B73 A;  1SVL A;  1O3S A;  1WJE A;  3F22 A;  2LY9 A;  1ZYR F;  3EUA A;  3FMQ A;  2Y2Z A;  4HQE A;  1FP1 D;  5L3D A;  1K4S A;  2GIV A;  2M87 A;  4LLN A;  3KFW X;  3QYF A;  4UB8 C;  2RN7 A;  1WI3 A;  5DV5 A;  2K40 A;  2A69 F;  1YTY A;  3L2U A;  4A3B J;  2Q2E B;  2P5V A;  3CCV I;  2PJP A;  2V26 A;  4FCY A;  4HX7 A;  3RI4 A;  1DGW Y;  5HOD A;  1AKH A;  2EV5 A;  1IXR C;  3PSI A;  4XMY A;  4WXD A;  1SD5 A;  1RR8 C;  5ICG A;  1FMW A;  4CYD A;  2E7X A;  2G0E A;  1SD7 A;  5CKT A;  1J5Y A;  2KZV A;  3JAM K;  3LFK A;  1JTX A;  2EH3 A;  2VBY A;  1MIJ A;  1FT9 A;  2HPM A;  4CA0 A;  3TKY A;  4J19 A;  4II3 A;  4P1W A;  3IV5 A;  3FKJ A;  3JRC A;  1S29 A;  1TNT A;  2DTR A;  3HRT A;  2RC4 A;  3DFG A;  1SMT A;  1FP2 A;  1Y1V J;  4HZF A;  2JA2 A;  5B1A H;  3DBH B;  1ENH A;  3Q3S A;  3VFZ A;  4CCM A;  5KNL A;  2W00 A;  5KHD A;  1J09 A;  4FET A;  3DTK A;  2DDB A;  2PJR B;  4G6Q A;  3PJR A;  1YX5 A;  3ABK H;  2DK8 A;  2IVM A;  1GV2 A;  3KEO A;  2M0C A;  2CJJ A;  1FOX A;  3OWT A;  3HOT A;  2ESH A;  4EJT A;  4M71 A;  1Z7L A;  3ASN H;  3TED A;  4LFU A;  1YG2 A;  5M3M J;  1AOY A;  3HUG A;  4X6A J;  1U5T A;  1IN5 A;  5GTH C;  4BHC A;  2XAJ A;  2L54 A;  3D5S C;  3KP5 A;  1ZAO A;  3WU2 C;  3L1P A;  3OYM A;  1XGO A;  2WAQ A;  2E1N A;  3HGY A;  2DQR A;  2ZME C;  3C2G A;  3DKY A;  3M8J A;  4BHB A;  1Y6I A;  1Y56 A;  2A6T A;  3WGH A;  2JT1 A;  3GXO A;  1YRN A;  4I09 A;  5B3S H;  3DXJ F;  4E6K G;  1G59 A;  5HNH A;  2R0Q C;  1BM9 A;  1G3S A;  3LOC A;  3KPH A;  4ZYH A;  5CVI A;  1BI1 A;  3LSP A;  2VLA A;  1W1W E;  1HOM A;  1PP8 F;  3MMY B;  3RJP A;  3N97 A;  5HOO A;  3RYR A;  3CDL A;  4EM0 B;  2R5Y A;  3O3K A;  3GZN B;  3IHU A;  1X4O A;  2OA4 A;  3S1R J;  1MJ9 A;  2ZNY A;  2VXZ A;  4IF4 A;  2HS5 A;  3L09 A;  3ZPL A;  4H4K C;  4N4O B;  2QWW A;  2Q8K A;  4YFK F;  1ETO A;  3FXO A;  2M4G A;  2EFP A;  4Q47 A;  5IOY A;  2HOS A;  2WB1 N;  2X1C A;  4QPO A;  3OSF A;  2M34 A;  3IP4 B;  2XAG A;  2GA2 A;  3L9F A;  4DNC A;  5LGN A;  1XN7 A;  5LBQ A;  2IGM A;  2JRM A;  3VSK A;  1HDP A;  3BRO A;  2Z99 A;  1ETW A;  2R92 J;  5DUI A;  5EGO A;  3CF2 A;  2IAI A;  1SD6 A;  2RKH A;  3K6G A;  3SEZ A;  3PO2 J;  1OLT A;  4UB6 C;  3CCR I;  3ZP5 A;  4LB5 A;  1Q1H A;  4DZJ A;  2LP0 A;  1R5H A;  5L3B A;  4LOC A;  3CJQ B;  5GP9 A;  2DA6 A;  2DMU A;  3F72 A;  5D5V B;  2H1L A;  3RPU D;  2D45 A;  4ESJ A;  2CO5 A;  4ZTF A;  4DYR A;  2QVO A;  4KN4 X;  4MFD A;  4WWC A;  5IP6 A;  4NC8 A;  4HDV A;  1ZGW A;  2XGD A;  3PNT A;  3H9Q A;  3RQI A;  2Q0O A;  4CIC A;  2DK5 A;  4MTD A;  1JE8 A;  1GXQ A;  2FBI A;  3SZG A;  4JBA A;  2XRO A;  1XD7 A;  2KIQ A;  3SZP A;  2R3S A;  1U6G A;  5E3N A;  2L9N A;  4P96 A;  3P9I A;  3CO7 C;  3S1M J;  2QCO A;  5EEG A;  1N77 A;  1HSJ A;  4WF2 A;  1SVO A;  2VE9 A;  1HA8 A;  1E0E A;  2L9V A;  1J7K A;  3EET A;  3KYD B;  1VQM I;  4ABZ A;  2X6Y A;  2MA3 A;  3HRU A;  3CF5 F;  1IRF A;  1UAA A;  4D5C A;  1T0F C;  4E7I A;  4XL9 A;  1OJL A;  3GO5 A;  3E3V A;  2M45 A;  1S7E A;  4E7Z A;  3S1Q J;  4O5V A;  1B6A A;  1N78 A;  1W5C C;  3WGG A;  3S2H J;  3NQO A;  2DFF A;  5K1Y A;  1IGN A;  2OZU A;  1IXC A;  4HPQ A;  2ZME B;  3CJN A;  4KUM A;  1Y0U A;  4TV7 A;  1QA6 A;  2F4M B;  2NOJ B;  4HF0 A;  1T38 A;  3OS1 A;  5F64 A;  1BW6 A;  1F4K A;  2F6C A;  2XGX A;  4N9H A;  4AYB N;  5FLX K;  3HRS A;  1VQ8 I;  2JZY A;  5DD4 A;  3JSP A;  4IEJ A;  4CDG A;  2OV7 A;  4JX5 A;  2FU4 A;  1B8I A;  1OR7 A;  2CUE A;  4I76 A;  3SYT A;  1TNS A;  1R5I D;  2ZXH A;  3W2W A;  2RQP A;  2MC3 A;  2DT6 A;  3F21 A;  1MMG A;  1IW7 F;  2VQC A;  2L02 A;  1RI7 A;  1MD0 A;  5IP9 J;  3P9C A;  1DU0 A;  4ZDL A;  1SFE A;  1LDK B;  2I10 A;  2BVL A;  2QBY B;  2FSW A;  4ENK A;  2QKM B;  1XGN A;  3QYE A;  3OYH A;  3RCO A;  4PK4 A;  2HWV A;  1EH6 A;  4L9N A;  4D7M A;  1MMD A;  3FZV A;  4EAT A;  4AWX B;  3ERM A;  4BU2 A;  1VQ5 I;  4BDZ A;  4OAZ A;  3I0T A;  1V5G A;  4XOT A;  4Z6Y A;  2O8K A;  3HOZ J;  5H6R A;  1FZP B;  2OUM A;  3S32 A;  3AG4 H;  3FBN B;  4AD9 A;  1WCM J;  2FEZ A;  1B9M A;  2LTP A;  4F55 A;  3ZN1 A;  4B3A A;  3ZN0 A;  1LB2 A;  1QBJ A;  4WX9 A;  4DYC A;  4MEY F;  2CWE A;  1JXS A;  4PJ0 C;  3LAJ A;  4PJL A;  3OYI A;  1T33 A;  1P4W A;  2DA7 A;  1W0U A;  1RIO H;  4IRH A;  2F2E A;  4EM2 A;  1RKW A;  2E19 A;  1U78 A;  5HLG A;  1BI3 A;  2DDA A;  1M1E B;  3FF5 A;  2X0L A;  5EZG A;  4HA8 A;  4ANJ A;  5E1Z B;  3DPL C;  5FKL A;  4BEH B;  3DEU A;  4ENN A;  2M1B A;  3ELK A;  2EIN H;  3VOD A;  2AQF A;  5HDK A;  2FF4 A;  3TW7 A;  3G71 I;  1HBX G;  1XX5 A;  3CZ6 A;  1B1B A;  4A0Z A;  1GVJ A;  2H6C A;  3CCL I;  2HXI A;  2NXN B;  2XAH A;  3CMA I;  3KZZ A;  4KIS A;  4LLL A;  3V4G A;  4CCN A;  1J0R A;  3H3V K;  1UCR A;  3LMM A;  1JHF A;  2LR8 A;  2HPI A;  1IF1 A;  3KP6 A;  2X1D A;  2X51 A;  2Y9Z A;  4C30 A;  2CUF A;  3ZMS A;  2K27 A;  2KJC A;  2JUG A;  1HQC A;  3WTV C;  2E71 A;  2I8D A;  3NEU A;  3RIR A;  1DDN A;  1W36 D;  5EG0 B;  2DMT A;  4HST A;  3OYD A;  1ZAR A;  4X0G A;  3LSH A;  2P5K A;  1Z21 A;  3OIP A;  5D5X B;  5TIS C;  3C1D A;  2FNP A;  1YO5 C;  4A69 C;  2UWM A;  3EUK L;  5DDG A;  2DFE A;  3LQQ A;  2VPR A;  1WJF A;  5FRO A;  3KP7 A;  3RSN A;  2BY1 A;  3PQK A;  3OR1 C;  3KIO A;  3GTG J;  3G1O A;  3OY9 A;  2F5F A;  1YHQ I;  2OPT A;  1FTT A;  3BWG A;  3LAP A;  3V8J A;  4MGR A;  1RET A;  4G8X A;  3K10 A;  3MWM A;  3IKT A;  4M3E A;  2W48 A;  1ULY A;  4PZJ A;  4N4N B;  3WTY C;  3CLO A;  4NQW A;  3BTI A;  4A2U A;  4S04 A;  3R6S A;  1TQM A;  2LY1 A;  2NYX A;  2K86 A;  3CCU I;  1U0J A;  3QAH A;  2E2H J;  2QSF X;  3R60 A;  2VOO A;  1YI2 I;  2IGK A;  2R7W A;  1MNM C;  4AIJ A;  5FO5 A;  1P92 A;  2CW8 A;  2HTJ A;  2IRF G;  1D0Y A;  2KIF A;  2O61 A;  2ZNZ A;  3I64 A;  1B9N A;  1Z0X A;  4YEL A;  4XM3 A;  2R7D A;  4IXA A;  4MIM A;  1BL0 A;  2CS3 A;  1WJC A;  1NG7 A;  4I7H A;  4ZDP A;  3ABM H;  5FRM A;  2GQQ A;  4I6Z A;  1I3Q J;  1YJ9 I;  1LDD A;  3HGG A;  3GBG A;  5D4S A;  4GDF A;  3BP8 A;  5HS9 A;  4RDU A;  4LIV A;  5GTI C;  2YS9 A;  1ZG5 A;  2MSY A;  2O9L A;  2GXG A;  1T95 A;  1P7I A;  2ZJP F;  2X48 A;  1IZ1 A;  1SFX A;  3R0A A;  2G9W A;  1FEX A;  4DJA A;  3AG2 H;  1X1B A;  2JRT A;  3BG5 A;  4RM3 A;  4L9T A;  4XKB A;  2A07 F;  2DQL A;  1JTY A;  1I39 A;  2DU9 A;  2EJR A;  2F4O B;  1LE8 B;  3HPH A;  1YFH A;  1WRJ A;  2K4J A;  2L4A A;  3BR2 A;  3Q0W A;  1TL8 A;  3KEY A;  2H27 A;  4LG0 B;  3SDG A;  2FD5 A;  2LSO A;  4PJM A;  5CJ9 A;  2WAE A;  3K70 D;  1LUJ B;  5TGT A;  4CH7 A;  1ZRF A;  1TQI A;  4R8H A;  4IHS A;  2MD5 A;  4LB6 B;  4C3I J;  1WJA A;  3IRR A;  3CCJ I;  3CCQ I;  1QQI A;  1G3T A;  2B9S A;  4ITV A;  2LD5 A;  1CF7 B;  4C3J J;  2CQ7 A;  3M8F A;  3CCS I;  2KFD A;  2OZ6 A;  1K79 A;  2MW8 A;  2L2O A;  5BNG A;  2CQQ A;  4AYB A;  5JLW A;  1FY7 A;  1W5T A;  1A5J A;  2EZL A;  2QA4 I;  4ZTJ A;  1DP3 A;  2WV0 A;  4B8X A;  1IUY A;  2CYY A;  2W25 A;  2VOP A;  1D8J A;  3FMR A;  1JGS A;  4RAF A;  3KP4 A;  5J47 A;  2X1E A;  2XRL A;  4BQN A;  1KU3 A;  3F0C A;  2E2I J;  2JVG A;  2O8X A;  4LD5 A;  1UB9 A;  4XSZ F;  2VJ4 A;  2ZFU A;  2DOF A;  3KYL A;  1YE9 A;  5LEK A;  1HKQ A;  2V1U A;  4A3C J;  1GDT A;  1MW7 A;  1TP4 A;  4G12 A;  1F43 A;  1BJZ A;  4CSW A;  3G1M A;  3DQV C;  3I59 A;  3A01 A;  1SAN A;  1QPI A;  2I5U A;  1X3U A;  1ZLJ A;  4MFE A;  4BAC A;  4IHV A;  5BMZ A;  2H1K A;  2J5O A;  3T1B A;  4XRS A;  1MMS A;  4LG3 A;  3CQZ J;  3BOQ A;  4XSX F;  4A3G J;  1FSH A;  2M4K A;  3DKX A;  4IL6 C;  3TGN A;  2L7K A;  1BOB A;  2ID3 A;  5BS6 A;  1MSF C;  4JYK A;  2HYG D;  3DKW A;  2DT5 A;  4ZZD A;  4ZYG A;  3SHF A;  1P7J A;  2WAD A;  4RB3 C;  2GWR A;  1WH7 A;  1WKM A;  3CJT B;  1BC7 C;  4C2T A;  3EUH A;  3SDB A;  4CCJ A;  3GFJ A;  1QHH D;  4M6X A;  2EIK H;  1XSV A;  2A05 A;  4P9U A;  1EV7 A;  3F8N A;  4XN3 A;  1HCR A;  4G94 A;  3DWL E;  3CDI A;  5E8I A;  1CQT A;  3HBL A;  1ZKG A;  2VC1 A;  2WC2 A;  1FYM A;  4OMY A;  1Z3X A;  1S5L C;  4RBO A;  3L00 A;  3RPQ A;  4CXF A;  3OYC A;  2EFN A;  5HS7 A;  4Q4Z F;  3UNG C;  2HTS A;  2XF7 A;  3BPX A;  3A02 A;  1A04 A;  1FBS A;  1U2W A;  4KYW A;  1IV8 A;  3CC2 I;  3OYB A;  2KMU A;  1ONV A;  3HIF A;  3O8H A;  2ZJR F;  4BXF A;  4HNT A;  4YEJ A;  4BE2 A;  1X1P A;  1OKR A;  3E6M A;  3G73 A;  2CMP A;  4KA4 A;  2XUB A;  4RLQ A;  3WTZ A;  1FBU A;  4A3M J;  1XMX A;  2VC0 A;  1SMY F;  3S2D J;  3VYT B;  1U8R A;  2DA4 A;  1FPQ A;  1MMN A;  4XLE A;  4DQ2 A;  4R79 A;  2VUM J;  3S3O A;  4ESF A;  3BR5 A;  2TCT A;  3GFI A;  2VXD A;  2VBZ A;  3A2K A;  2X6X A;  5JI6 A;  1TWG J;  1B72 B;  5FRN A;  1DP7 P;  2VT2 A;  4KT6 A;  4DYQ A;  2Z3Y A;  3J80 K;  1LEA A;  5BOX A;  2JSP A;  3RQ4 A;  4UV8 A;  4P9F A;  3G1L A;  1H89 C;  3HL2 A;  3OIQ A;  4RLF A;  4YII A;  1G3W A;  2MYS A;  2P6S A;  1P9Q C;  2QQ8 A;  3IH4 A;  3WU0 A;  2A5W A;  3K9T A;  1N75 A;  4BKX A;  1MBG A;  2VON A;  5FKN A;  2K7L A;  1CGP A;  3CUQ C;  1FYK A;  4U0W A;  2M8E A;  2PX9 A;  3ZMU A;  4BXU A;  3DCF A;  3K4M A;  2RQQ A;  3JRF A;  4A5N A;  1ORK A;  3MZY A;  1V5E A;  4IPA A;  2KKO A;  4QSH A;  4ZDO A;  1ZRD A;  3BR6 A;  3DEE A;  1SC7 A;  1AHD P;  2V1N A;  3I9V 2;  2DA1 A;  4PFP A;  4BAY A;  3WTT C;  3PIO F;  2Y69 H;  2KIU A;  1K6Y A;  4IX7 A;  1VQP I;  1VQ4 I;  1K83 J;  2P81 A;  3RTR A;  2ME0 A;  1L0O C;  1R5G A;  2NNN A;  1HDD C;  3OYL A;  5KAI C;  4F93 B;  1REP C;  2OQR A;  1XGM A;  1I3A A;  4Q5S F;  2JJ7 A;  5HLT A;  3D1N I;  3BR3 A;  2O03 A;  4CHU A;  2HZD A;  2HOA A;  4B4C A;  1W7P D;  3K1P A;  2YU9 J;  4CGZ A;  3CTA A;  1JT0 A;  3HDD A;  1VQ6 I;  3FM3 A;  3QPS A;  1U8B A;  1IV6 A;  5FJ8 J;  1FMV A;  4AUX A;  1RUN A;  2HDD A;  1YW9 A;  1JGG A;  4GXO A;  3GFM A;  1DQU A;  3CLQ A;  4B48 A;  3PO3 J;  4X1E A;  1JJ8 C;  3IL2 A;  3QRF F;  2M5W A;  2DPU A;  4FX0 A;  1IG7 A;  2VN2 A;  1SEU A;  4F3Q A;  5IT9 Z;  4NC7 A;  4P55 A;  1BIA A;  3WTW C;  1S72 I;  2ZJQ F;  4LIU A;  4A0X A;  3K69 A;  6PAX A;  5KAF C;  4M9X A;  1NG6 A;  2W57 A;  2NVT J;  1H88 C;  4BQO A;  4C2U A;  1PUF B;  3MAJ A;  1FC3 A;  5J1Y A;  1LEB A;  1H9G A;  1X3W B;  5LHI A;  1WZ2 A;  1QZE A;  2V9P A;  1IDZ A;  1A36 A;  2LKS A;  2QQA A;  1XC5 A;  4XIC A;  2QUF A;  2UV1 A;  4XON A;  4GGG A;  3IRQ A;  3KLO A;  1FOW A;  3EYI A;  4G7O F;  2ZSI B;  1XS9 A;  2BV6 A;  2BY3 A;  1ZHF A;  2KRF A;  4MEX F;  2CRG A;  1GT0 C;  5DCF A;  4U7B A;  3OYE A;  3CUQ B;  4II2 A;  1TQP A;  2PMZ N;  2Y75 A;  2CQX A;  3KE2 A;  2R7X A;  2F5V A;  2M7B A;  3GTO J;  5FD6 A;  1G8X A;  2CV1 A;  2DW4 A;  2QQB A;  3KLN A;  1S6L A;  2WY8 Q;  4Y15 A;  2NRA C;  1JT6 A;  1MBF A;  4U0V A;  3ECH A;  3WHB A;  1X1A A;  2ECC A;  2QBY A;  3HPG A;  2V79 A;  9ANT A;  1KZH A;  2P7C B;  3H3Z A;  2HFH A;  1JJ6 C;  3T5X A;  4MO7 A;  4CZZ A;  2H94 A;  4V2G A;  1U5T C;  5KK1 A;  1GUU A;  1QGP A;  4KIF A;  2EBI A;  3VSL A;  4OWR B;  4L9V A;  1KU2 A;  1X4P A;  4R1H A;  5C3E J;  2FJ1 A;  2AHQ A;  2BW3 B;  4G7H F;  4JX4 A;  4HLX A;  3K0L A;  4RAY A;  4IOA F;  1MDM B;  2MFZ A;  1KYW A;  2CW7 A;  4Y13 A;  5FB2 A;  2E60 A;  4QTR A;  1Z9C A;  3HTS B;  2EV6 A;  1O7F A;  4HF2 A;  4LK0 F;  1KQ9 A;  3OIO A;  4PUS A;  4RGU A;  4KIT B;  2NS8 A;  1UMQ A;  2FMY A;  2Z16 A;  1AA7 A;  1WPK A;  5JHF A;  2G7U A;  3BG6 A;  2XGE A;  4BY7 J;  2KRC A;  2FQ3 A;  1Q1V A;  1OCO H;  2JSC A;  5M3F J;  2LF7 A;  3J81 Z;  2R5Z B;  1IDY A;  1R00 A;  5LLQ A;  2ISZ A;  2ZB9 A;  1LNW A;  3ABU A;  3B6A A;  3SJM A;  3UKG A;  4HNU A;  2RNG A;  2DYS H;  5LD2 C;  4JOM A;  1ZRE A;  1MSE C;  3HTU A;  3LL7 A;  2R7O A;  3BTJ A;  3F9K A;  4RM2 A;  4UVC A;  1X3Z B;  2GXA A;  5ILU A;  1D3Y A;  1KGS A;  2Z9O A;  2BXY A;  1XDS A;  3ZQI A;  2CH0 A;  2CGP A;  3E0J B;  2LBF B;  3RKW A;  4MNU A;  5H6Q A;  2GBY A;  1I50 J;  3E97 A;  1NH3 A;  3LSG A;  2K9S A;  3J7Z I;  2LY2 A;  2STW A;  3J7A Y;  1G2H A;  5DTD A;  1Y39 A;  3GX4 X;  3A4C A;  1MBK A;  1ETY A;  1WJD A;  3VPR A;  3Q9V A;  1V3F A;  1TWA J;  1EJ9 A;  4EVI A;  3MVP A;  1LFB A;  3U2R A;  3QP5 A;  3NWS A;  4M9S A;  1POG A;  1JKP C;  1D1C A;  3V8L A;  3TO7 A;  3W6K B;  4F92 B;  5FKK A;  3BTL A;  3E6C C;  1R1V A;  1WWX A;  4JQF A;  1T8I A;  1VI0 A;  4I0A A;  1I6H J;  5E3M A;  1SVM A;  5FKM A;  1FIA A;  5F1J A;  3QOP A;  5J4Y A;  4EEF G;  1QRY A;  2KPM A;  3EYY A;  1FOK A;  1EF4 A;  2KIS A;  3BTC A;  2K02 A;  1Z05 A;  3WU1 B;  3T8T A;  2F48 A;  4LIT A;  4ZYE A;  4U7D A;  3TBI A;  3FIS A;  2AXT C;  2MD0 A;  3WE3 A;  3BCA A;  3FXU A;  4B3X A;  2ISY A;  2NVX J;  3KZY A;  4HV6 A;  3QOE A;  2COB A;  3MKL A;  2X6W A;  2HDW A;  2MH9 A;  5LHH A;  5B66 C;  3HUG B;  1VF9 A;  1U5T B;  2IBD A;  3CP8 A;  2OCC H;  3ABL H;  2EZH A;  2A6H F;  3AG1 H;  3PL8 A;  3FXQ A;  4Q48 A;  1RKT A;  3OOU A;  3JCU C;  5F6F A;  5M5W J;  3JAM Z;  4ON0 A;  2MG4 A;  2W85 A;  2HOT A;  2BHY A;  1APL C;  2DOE A;  1STZ A;  4EGZ A;  2YU3 A;  5HLH A;  5ICC A;  4A3J J;  2DT7 B;  5LRR A;  5JVT A;  1Z77 A;  3V8K A;  1FLI A;  2VKH A;  2KLO A;  2V7F A;  1VQK I;  3L2R A;  1YRN B;  2K9M A;  5K7Z A;  5DM7 F;  1OR7 C;  2E2J J;  2M0M A;  4ZC3 A;  2RRE A;  3GVA A;  2LVS A;  4HOB A;  1QVU A;  5HVQ C;  3PIP F;  1TW3 A;  2DMN A;  2LKP A;  4U87 A;  1BJA A;  1MND A;  4DBR A;  2L9S A;  2Z1D A;  4KJZ A;  2JA7 J;  2XAU A;  2HU9 A;  1EH8 A;  1YIO A;  2OU2 A;  1MMA A;  1ON1 A;  3I4P A;  1V55 H;  2R4G A;  1DGR M;  4XLH A;  2STT A;  4XKV A;  5GAH J;  3HEF A;  3IAS 2;  3V7R A;  3BPV A;  4DGW B;  1UHW A;  3EDP A;  4FHT A;  3BJ6 A;  3CME I;  1MBJ A;  1D1B A;  2F4I A;  2F5C A;  5M5Y J;  2ECB A;  2ZXJ A;  4QIW N;  3H0G J;  5D5W B;  2HKO A;  4NNJ A;  4HEA 2;  4RGX A;  5EGO B;  4M3B A;  4BL0 B;  3BC8 A;  2XIG A;  4XR6 A;  3TP0 A;  2L5Q A;  5JR3 A;  1W0T A;  2R7Q A;  3DV8 A;  1CF7 A;  3WG7 H;  2QLZ A;  1XMA A;  4U0Y A;  3C2B A;  2E1O A;  1NK3 P;  1LKX A;  3K2Z A;  4A3I J;  4OAY A;  2XKO A;  4YFX F;  2R7V A;  1UG0 A;  2EFO A;  2M9H A;  1QHG A;  3A0B C;  3JTH A;  3OYG A;  1IJW C;  3O2P E;  2JQ7 A;  3E6B A;  2VAS A;  5EF6 A;  3ZQ7 A;  1ZGA A;  5KVR A;  2VT3 A;  5E79 C;  4A6E A;  3LSR A;  2KIM A;  3M3Y J;  3CD6 I;  2VQL A;  3HOU J;  2DN0 A;  2PMZ A;  2PMU A;  3ML6 A;  2K3P A;  3OYN A;  2JTV A;  3MZ8 A;  2HYJ A;  2QM3 A;  3Q0V A;  2JA5 J;  3FKI J;  2B63 J;  2ZKZ A;  2DBB A;  3R4K A;  4ASN A;  2FNA A;  4LLG F;  1IN6 A;  4D7N A;  1IN7 A;  2R7Z J;  1I5Z A;  2XV4 S;  4KDP A;  4M3F A;  3TO9 A;  3FX3 A;  1R49 A;  1IRG A;  5J6X A;  3WG9 A;  4A12 A;  3WGI A;  3TL4 X;  4NUB A;  3BQY A;  2BY0 A;  5ERI A;  3TQN A;  1DPR A;  3LQR A;  3KZI C;  1S7O A;  3UR3 C;  4YIR X;  1IAW A;  4O6J A;  2VBW A;  4A3K J;  1MNE A;  2JN6 A;  4IHW A;  1PJR A;  3M4O J;  2HQ5 A;  3S15 J;  1H8A C;  4UUT A;  3GWZ A;  4YG2 F;  3BJO A;  2BVM A;  4XID A;  4AM3 A;  1TT0 A;  3HRM A;  3TDU C;  1ETX A;  1D0Z A;  1R58 A;  5FFZ A;  4PGG A;  3PFY A;  4DW6 A;  3M8E A;  1ETK A;  4EV0 A;  4BE1 A;  1G3Y A;  3O6B B;  1VTN C;  3D5R C;  1D5V A;  5IYC J;  1ETV A;  4IJA A;  1RPW A;  4OIO F;  3I56 I;  4A3D J;  2BHZ A;  2TRT A;  3FXK A;  3JW4 A;  1UFM A;  1HXD A;  2KQR A;  1HW5 A;  3I54 A;  3V7C A;  1E2X A;  4BJ6 C;  2IGO A;  2EZK A;  1R6R A;  4B44 A;  2R7U A;  5A2Q K;  2IA2 A;  3I4N J;  1XCB A;  1TC3 C;  3G2B A;  2ZC2 A;  3FHN A;  2K9Q A;  1RR7 A;  1YS6 A;  3CJR B;  2GM4 A;  1A35 A;  1UJ8 A;  5CYV A;  3BZ6 A;  1I1S A;  1I1G A;  1MH4 A;  1WGX A;  3ZQQ A;  2V6C A;  3Q0U A;  4GCV A;  2EV0 A;  2IA1 A;  4JP0 A;  4DBQ A;  2FE3 A;  1EH7 A;  4BS9 A;  4EMS A;  3GTP J;  5K7F A;  2V9K A;  3JSO A;  3WHC A;  3X2Q H;  2M3A A;  1T08 B;  4E7S A;  5B5E C;  3ZXS A;  4XRF A;  1FYL A;  2E35 A;  3GLL A;  5FLX Z;  4I98 B;  2P4W A;  4AC0 A;  1T39 A;  3JRE A;  2D5V A;  2KDO A;  4FE7 A;  1F36 A;  4UUS A;  2BEO A;  1TWF J;  1IN8 A;  2LYC A;  2UXN A;  2VIX A;  1P4A A;  2NS0 A;  4WXH A;  3A03 A;  3KYC B;  1GV5 A;  4M3G A;  3IH2 A;  5J4V A;  2QF7 A;  2XAF A;  3M1E A;  3I71 A;  3QOD A;  1K78 B;  4YIF A;  5E3O A;  3DP7 A;  2QEX I;  5ICF A;  2EB7 A;  3BQZ A;  3QWL A;  4M73 A;  5ICE A;  4HAM A;  5H20 A;  4KIB A;  2VQG A;  3BCB A;  3FHZ A;  3OMY A;  3S3M A;  3OYF A;  1LFP A;  3QPL A;  5EEH A;  3ZMD A;  2HOE A;  5E18 F;  5FGM A;  5JHU A;  3CMM A;  2FOW A;  3HJE A;  2ADU A;  1YLF A;  2X4H A;  4D5F A;  4BY1 J;  2MBF A;  4JX6 A;  1YS7 A;  1ITY A;  3CUO A;  2QKL B;  1BR1 A;  2VKD A;  1W7P A;  2ETH A;  3OL4 A;  4XQF A;  5LRS A;  1K61 A;  2HVQ A;  4AU7 A;  4HSR A;  1ZLK A;  2GOX B;  4HLY A;  3C2H A;  1YJW I;  1X19 A;  2ELJ A;  4PJN A;  2XB0 X;  2IT0 A;  2P0W A;  4LGW A;  2NOG A;  1XSX A;  2E36 A;  4AVP A;  4HG2 A;  3VOE A;  3HOX J;  4RB1 A;  1KU7 A;  1ZEL A;  1Z3Y A;  3HOY J;  3AFH A;  5GPC A;  3W2V A;  4U88 A;  2QQ9 A;  3PQJ A;  5HDN A;  2L7Z A;  4BXX J;  3OYJ A;  3DBL B;  2VJI A;  3M7G A;  3JRA A;  3WTU C;  2K85 A;  2VPL A;  2LLK A;  2EWN A;  2E5N A;  2PLY A;  3ONQ A;  1W5S A;  1Y0N A;  3P7N A;  3LA3 A;  4RGR A;  1X1C A;  3HC7 A;  3PUF A;  4FT8 A;  5AIP A;  4UVA A;  3B02 A;  1VQO I;  2P7V B;  1VFC A;  1QPM A;  1U9O A;  1LVA A;  2XRN A;  2H6B A;  4IHY A;  3NRV A;  2LC2 A;  3OYA A;  2WA0 A;  3O8G A;  4EJO A;  2JK3 A;  2VI6 A;  2R93 J;  2CQN A;  2DTZ A;  3CO6 C;  1YJN I;  2O6G E;  4NQW B;  3PNV A;  2Q2E A;  5DYM A;  5C44 J;  5F0C A;  2EA2 A;  2CFO A;  3REO A;  3DU5 A;  4WK8 F;  1Z1D A;  3JRB A;  1MH3 A;  5LEJ A;  1QZY A;  2IP2 A;  2VE8 A;  1FIP A;  3FIW A;  2XB5 A;  5K7H A;  3G6E I;  1IRX A;  2COM A;  3QPT A;  3D0S A;  2HKX A;  2DPD A;  3MN2 A;  4PCQ A;  3S8P A;  4AID A;  1E3H A;  4A5M A;  3TDZ C;  4W1U A;  4BJ5 C;  2KP6 A;  1A6Q A;  1BBY A;  5F0F A;  2PI0 A;  3JRI A;  3EUH C;  3HM5 A;  2PJR A;  2NNY A;  4UNO A;  2MLG A;  4FQG A;  3FMS A;  2Y0M A;  3GTJ J;  5EEA A;  3HG9 A;  4UUV A;  3IWZ A;  2EIL H;  3C18 A;  4XKW A;  4YRV A;  2EIJ H;  3HSR A; 
#chains in the Genus database with same CATH homology
 1K7A A;  5D6E A;  4BYY A;  3F8C A;  3VEP A;  2KJB A;  3KP3 A;  3F8B A;  4BH9 A;  4AIH A;  2FXA A;  4RAZ A;  2E7W A;  5E1X A;  1KQ8 A;  1TW2 A;  1F9N A;  2IJL A;  3E6D A;  3HHG A;  4KMU X;  5E8G A;  2IA0 A;  1T2K A;  3Q5F A;  3G3Z A;  4AIK A;  1USS A;  2CG4 A;  5IT3 A;  2HR3 A;  1PP7 U;  4HW0 A;  1C0W A;  1ZGJ A;  4MQ9 F;  5DEQ A;  4A0Y A;  1U3E M;  2M30 A;  1LJ9 A;  5CVV A;  1G4D A;  2UXX A;  3L7W A;  4KFC A;  1J75 A;  4EGY A;  1Z7U A;  1UST A;  1HKS A;  2FOK A;  1XGS A;  2VBX A;  2ESN A;  2V1X A;  5FFX A;  4I01 A;  1SFU A;  4GYI A;  3S2W A;  2A6E F;  5BPI A;  2GAU A;  5L3E A;  1BI0 A;  2L4M A;  5FD5 A;  3WTX C;  3R61 A;  2DAO A;  3ROU A;  1BIB A;  2EK5 A;  2G7H A;  3BDD A;  1QNT A;  1ZN2 A;  2W84 A;  3T0Y A;  3OOP A;  2Y48 A;  3F3X A;  3ISP A;  2FA5 A;  4K2E A;  2C6Y A;  3GZ5 A;  4PDK A;  4EJU A;  4ZYD A;  2NAZ A;  3BJA A;  1DPU A;  2RGV A;  3N4M A;  1HKT A;  1J59 A;  3FXR A;  1V4R A;  3C3W A;  2V1D A;  3CDH A;  3J7A O;  2ZME A;  1MZB A;  2XAS A;  2MLK A;  4G7Z F;  4L9J A;  3QU3 A;  2ZBK A;  1P6R A;  3L2C A;  1O3R A;  3U9G A;  3V7S A;  2P6T A;  1HST A;  1OMI A;  2EA4 A;  4E70 A;  4N0B A;  4IVN A;  3RDI A;  2AXL A;  5AIQ A;  1H9T A;  3HOS A;  3W6J B;  4N9I A;  3ZMZ A;  5LHG A;  4EJV A;  3P9K A;  4KIG A;  5CVR A;  5D8L B;  2L01 A;  4QWQ A;  5DD8 A;  4BNC A;  2D2W A;  2K4B A;  4G9Y A;  3KP2 A;  3RKY A;  4L0Z B;  1KA8 A;  4B09 A;  1Z91 A;  2ZFW A;  4OIR F;  4HBL A;  1UHM A;  3LA2 A;  3OV8 A;  1IN4 A;  3K1N A;  1OYW A;  1S7A A;  3GFL A;  3QP6 A;  5K5Q A;  1S8N A;  1HW2 A;  4G6D A;  3IWF A;  3J80 Z;  2GZW A;  2OD5 A;  1WSU A;  5D4R A;  4P5O A;  2A3S A;  2BE5 F;  4UHT A;  1QZZ A;  2VOD A;  5F1R A;  2F5D A;  2AS5 F;  2YX4 A;  5DCM B;  3I58 A;  5L3F A;  1T0F A;  1KQ0 A;  1L3L A;  1SD4 A;  3LWF A;  4HDU A;  1XB4 A;  2HQR A;  2PFB A;  2D1H A;  4ESB A;  3SZT A;  2O3F A;  3GF2 A;  1Z6T A;  1YW7 A;  5L3C A;  4BHP A;  2CFX A;  5J8C A;  1TBX A;  3GLX A;  4QLC U;  1RUO A;  2L3D A;  1F5T A;  5HLI A;  3HSE A;  2RVC A;  2DLL A;  4RB2 C;  1T6S A;  1R7J A;  4ZZL A;  1RNL A;  2BBY A;  1W4M A;  2XVC A;  4UVB A;  2J5P A;  1MGT A;  2DI3 A;  2CQK A;  1O3T A;  4OOI A;  3HSF A;  4MQV A;  1B4A A;  2QYO A;  3D5L A;  2IPQ X;  3MFK A;  4RB0 A;  2A5Y B;  2HEO A;  1BI2 A;  1O3Q A;  2XKP A;  2O0Y A;  3E5U A;  3TOA A;  4Z2Y A;  3HYI A;  5BPD A;  3H92 A;  5TJJ A;  2BYV E;  4IHT A;  4MHG A;  1R22 A;  3M9A A;  1T98 A;  5D8K B;  2LDU A;  2RNJ A;  1MJB A;  4ENJ A;  4HF1 A;  2PN6 A;  4GO1 A;  4LG0 A;  3ERE D;  5K5R A;  3F23 A;  1AWC A;  2F5E A;  1Z6R A;  2JPB A;  2WTE A;  1LQ1 A;  1K78 A;  3BY6 A;  1ZH5 A;  2WWY A;  5CVU A;  4GYG A;  2CSO A;  2A61 A;  2HZT A;  5D5U B;  4HX4 A;  1B59 A;  5L3G A;  1OYI A;  1ZG3 A;  4NHJ A;  2V9V A;  2PQ8 A;  3MQ0 A;  2PMH A;  4EQQ A;  1ON2 A;  4S05 A;  1I27 A;  2CW0 F;  4XLP F;  1FX7 A;  2H09 A;  1XDU A;  3MEX A;  4I0B A;  2W24 A;  2P5L C;  1F1Z A;  4XBF A;  5LGU A;  3GEZ A;  2PG4 A;  2HYF A;  2ACJ A;  1XSD A;  3FM5 A;  4HX8 A;  2RV8 A;  4KNY A;  1O57 A;  1PDN C;  1HW1 A;  4M9Z A;  4OMZ A;  2HGC A;  1GXP A;  4KIC A;  4KN7 X;  3F6O A;  2YR2 A;  1OYY A;  5E20 A;  3ZMT A;  2HQN A;  5CLS A;  4KT5 C;  2MH2 A;  2EFW A;  4L18 B;  1FBQ A;  1R1T A;  4A6D A;  5K5O A;  1OPC A;  4M6Y A;  1FWZ A;  2OAZ A;  3JTG A;  5D6F A;  3KET A;  4YFN F;  3SFZ A;  1P4X A;  3VB2 A;  1BN5 A;  4PGH A;  1TTY A;  4Y17 A;  5ILS A;  1J9I A;  2YX7 A;  5AON A;  3Q9S A;  1D8K A;  1G6N A;  4HQM A;  2LNB A;  3IKV A;  2DFI A;  4OU0 A;  3PFI A;  5JFR A;  2YPR A;  4L0Y B;  1TLH B;  4OIN F;  1P2F A;  1R1U A;  4ZH4 F;  3GZ6 A;  2RDP A;  3GW2 A;  2FRH A;  1XCV A;  3I5U A;  3H3U A;  4L5J A;  2UZK A;  5J8F A;  3DF8 A;  4I02 A;  1ZRC A;  4WCG A;  1ODD A;  2PEX A;  1H0M A;  2ZJ2 A;  2B0L A;  5LGT A;  4EJW A;  3K1M A;  2FML A;  3SXY A;  2HDC A;  2A68 F;  4JK1 X;  3SQN A;  2LF8 A;  2OQG A;  4UV9 A;  2YSR A;  3KCC A;  5HDG A;  5IT9 K;  1LDJ A;  4NB5 A;  4LJZ F;  2TDX A;  3LA7 A;  1YQA A;  1K6O A;  1XMK A;  2OBP A;  2PBI A;  2FBH A;  1MJA A;  3KEQ A;  4LK1 F;  5ILV A;  3WE2 A;  3ABT A;  3ECO A;  4M72 A;  2QEN A;  2BGC A;  2GA1 A;  4H0E A;  4OIQ F;  3T8R A;  3AAF A;  3E5Q A;  2DO7 A;  1MKM A;  3F8M A;  3I53 A;  3U1D A;  4D0P A;  4MTE A;  5E17 F;  1FSE A;  1IXS B;  3TO6 A;  5TRD A;  1PUE E;  4ENM A;  1S3J A;  4LMY A;  1SAX A;  2D1V A;  3GYH X;  4XLN F;  4KMF A;  4IRG A;  3MCZ A;  4OIP F;  2FBK A;  1RZ4 A;  1JHH A;  3E5X A;  3RYP A;  5ED4 A;  3ZMV A;  3HHH A;  3F6V A;  1NHA A;  2ZO4 A;  4F7Z A;  5DUK A;  5BQT A;  4HYE A;  3COA C;  3CUQ A;  1ZG1 A;  1BC8 C;  2E1C A;  2QZ8 A;  1J2X A;  1KYZ A;  4I2O A;  3MZH A;  2GXB A;  4HV5 A;  1QO0 D;  3J81 K;  5A2Q Z;  1FNN A;  4UXN A;  3ULQ B;  5E1W A;  2ELH A;  1GHC A;  3QU6 A;  3IC7 A;  1R36 A;  1BOA A;  1WQ2 A;  3R0J A;  1KU9 A;  2JPC A;  1YYV A;  4EM1 A;  1YW8 A;  3C7J A;  1MDM A;  5HS8 A;  3EQL F;  3F8F A;  3WTS C;  4ETS A;  2Z33 A;  1R23 A;  3GUD A;  4CO8 A;  4BQA A;  3DPT A;  1E17 A;  2EFQ A;  3RKX A;  2P8T A;  1I6X A;  4L5I A;  1DUX C;  2IW5 A;  1W7P B;  2XHK A;  5CVJ A;  4IRI A;  2XAQ A;  3LST A;  3RPU A;  3I59 B;  2Z5U A;  2ZCW A;  4RS8 A;  1O7L A;  3TOB A;  1WI9 A;  2R7F A;  4M74 A;  4WXC A;  5DCM A;  3FWE A;  3WOD F;  4RGS A;  3QPH A;  4FX4 A;  4O3M A;  3B73 A;  1O3S A;  3F22 A;  1ZYR F;  3FMQ A;  4HQE A;  1FP1 D;  5L3D A;  2GIV A;  2M87 A;  4LLN A;  3KFW X;  2RN7 A;  5DV5 A;  2A69 F;  1YTY A;  2P5V A;  2PJP A;  4HX7 A;  3RI4 A;  2EV5 A;  1IXR C;  4WXD A;  1SD5 A;  5ICG A;  4CYD A;  2E7X A;  1SD7 A;  1J5Y A;  3JAM K;  3LFK A;  2VBY A;  1FT9 A;  3TKY A;  1S29 A;  1TNT A;  2DTR A;  3HRT A;  2RC4 A;  3DFG A;  1SMT A;  1FP2 A;  4HZF A;  3VFZ A;  4G6Q A;  3KEO A;  2DK8 A;  2IVM A;  3HOT A;  2ESH A;  4EJT A;  4M71 A;  4LFU A;  1YG2 A;  1AOY A;  3HUG A;  1U5T A;  1IN5 A;  4BHC A;  2XAJ A;  2L54 A;  3KP5 A;  1ZAO A;  1XGO A;  2E1N A;  2DQR A;  4BHB A;  3WGH A;  2JT1 A;  3GXO A;  4I09 A;  3DXJ F;  1BM9 A;  1G3S A;  4ZYH A;  5CVI A;  1BI1 A;  1PP8 F;  3RJP A;  3N97 A;  5HOO A;  3RYR A;  4EM0 B;  3O3K A;  3IHU A;  2OA4 A;  1MJ9 A;  2ZNY A;  2VXZ A;  4IF4 A;  2HS5 A;  3L09 A;  3ZPL A;  2QWW A;  2Q8K A;  4YFK F;  2EFP A;  4Q47 A;  2XAG A;  2GA2 A;  3L9F A;  4DNC A;  5LGN A;  1XN7 A;  5LBQ A;  3BRO A;  2Z99 A;  5DUI A;  1SD6 A;  2RKH A;  3ZP5 A;  4LB5 A;  1Q1H A;  1R5H A;  5L3B A;  3F72 A;  5D5V B;  2D45 A;  4ESJ A;  2CO5 A;  2QVO A;  4KN4 X;  4WWC A;  4HDV A;  2Q0O A;  4CIC A;  2DK5 A;  4MTD A;  1JE8 A;  1GXQ A;  2FBI A;  4JBA A;  2XRO A;  1XD7 A;  3SZP A;  2R3S A;  1U6G A;  4P96 A;  3P9I A;  3CO7 C;  5EEG A;  1HSJ A;  4WF2 A;  2VE9 A;  1J7K A;  3EET A;  2MA3 A;  3HRU A;  1IRF A;  3GO5 A;  3E3V A;  2M45 A;  4O5V A;  1B6A A;  3WGG A;  3NQO A;  5K1Y A;  2OZU A;  1IXC A;  2ZME B;  3CJN A;  4KUM A;  1Y0U A;  4TV7 A;  4HF0 A;  1T38 A;  5F64 A;  1F4K A;  2XGX A;  4N9H A;  5FLX K;  3HRS A;  2JZY A;  5DD4 A;  3JSP A;  4CDG A;  2FU4 A;  1OR7 A;  1TNS A;  2RQP A;  2MC3 A;  3F21 A;  1IW7 F;  2L02 A;  1RI7 A;  1MD0 A;  3P9C A;  1SFE A;  1LDK B;  2QBY B;  2FSW A;  4ENK A;  1XGN A;  2HWV A;  1EH6 A;  4L9N A;  3FZV A;  4AWX B;  3I0T A;  5H6R A;  1FZP B;  4AD9 A;  2FEZ A;  1B9M A;  3ZN1 A;  3ZN0 A;  1LB2 A;  1QBJ A;  4WX9 A;  4MEY F;  2CWE A;  1JXS A;  3LAJ A;  1RIO H;  1P4W A;  4IRH A;  2F2E A;  4EM2 A;  1U78 A;  5HLG A;  1BI3 A;  3FF5 A;  2X0L A;  4HA8 A;  5E1Z B;  3DPL C;  4ENN A;  3DEU A;  2M1B A;  3ELK A;  3VOD A;  5HDK A;  2FF4 A;  1HBX G;  1B1B A;  4A0Z A;  1GVJ A;  2H6C A;  2XAH A;  3KZZ A;  4LLL A;  3V4G A;  1J0R A;  1UCR A;  1JHF A;  1IF1 A;  3KP6 A;  3ZMS A;  2K27 A;  2KJC A;  1HQC A;  3WTV C;  3NEU A;  3RIR A;  1DDN A;  1ZAR A;  2P5K A;  5D5X B;  3C1D A;  2FNP A;  1YO5 C;  2UWM A;  5DDG A;  3LQQ A;  3KP7 A;  3PQK A;  2F5F A;  3BWG A;  3LAP A;  3V8J A;  4MGR A;  4G8X A;  3MWM A;  3IKT A;  4PZJ A;  1ULY A;  3WTY C;  3CLO A;  4NQW A;  4A2U A;  4S04 A;  3R6S A;  1TQM A;  2NYX A;  2K86 A;  3QAH A;  3R60 A;  2VOO A;  4AIJ A;  5FO5 A;  1P92 A;  2HTJ A;  2IRF G;  2O61 A;  2KIF A;  2ZNZ A;  3I64 A;  1B9N A;  2R7D A;  4IXA A;  4I7H A;  2GQQ A;  1LDD A;  5D4S A;  3BP8 A;  5HS9 A;  1ZG5 A;  2GXG A;  1IZ1 A;  1SFX A;  3R0A A;  2G9W A;  2JRT A;  4L9T A;  2A07 F;  2DQL A;  2DU9 A;  2EJR A;  1YFH A;  1WRJ A;  2K4J A;  2L4A A;  4LG0 B;  2H27 A;  2LSO A;  5CJ9 A;  1ZRF A;  1TQI A;  4R8H A;  4IHS A;  2MD5 A;  4LB6 B;  3IRR A;  1QQI A;  1G3T A;  1CF7 B;  3M8F A;  2OZ6 A;  1K79 A;  1FY7 A;  1W5T A;  2WV0 A;  4B8X A;  1IUY A;  2CYY A;  2W25 A;  2VOP A;  1D8J A;  3FMR A;  1JGS A;  3KP4 A;  1KU3 A;  2O8X A;  4XSZ F;  4LD5 A;  1UB9 A;  5LEK A;  1HKQ A;  2V1U A;  3I59 A;  3DQV C;  1X3U A;  1ZLJ A;  5BMZ A;  2J5O A;  3T1B A;  4XSX F;  3BOQ A;  1FSH A;  3TGN A;  5BS6 A;  2HYG D;  3DKW A;  2DT5 A;  4ZZD A;  4ZYG A;  3SHF A;  4RB3 C;  2GWR A;  1WKM A;  1BC7 C;  3EUH A;  3GFJ A;  4M6X A;  1XSV A;  4P9U A;  1EV7 A;  3F8N A;  4G94 A;  5E8I A;  2VC1 A;  2WC2 A;  1FYM A;  4OMY A;  3L00 A;  3RPQ A;  4CXF A;  2EFN A;  5HS7 A;  4Q4Z F;  2HTS A;  3BPX A;  1A04 A;  1FBS A;  1U2W A;  4KYW A;  1ONV A;  3HIF A;  1OKR A;  3E6M A;  3G73 A;  4KA4 A;  2XUB A;  3WTZ A;  1FBU A;  2VC0 A;  1SMY F;  1U8R A;  1FPQ A;  4DQ2 A;  4R79 A;  4ESF A;  3GFI A;  2VBZ A;  5JI6 A;  1DP7 P;  2VT2 A;  2Z3Y A;  3J80 K;  1LEA A;  5BOX A;  4UV8 A;  4P9F A;  4YII A;  1G3W A;  2P6S A;  3WU0 A;  3K9T A;  2VON A;  2K7L A;  1CGP A;  3CUQ C;  1FYK A;  4U0W A;  2M8E A;  3ZMU A;  4BXU A;  4A5N A;  3MZY A;  4IPA A;  2KKO A;  1ZRD A;  4BAY A;  3WTT C;  2KIU A;  3RTR A;  1L0O C;  1R5G A;  2NNN A;  1REP C;  2OQR A;  1XGM A;  4Q5S F;  2O03 A;  4CHU A;  1W7P D;  3K1P A;  4CGZ A;  3CTA A;  3FM3 A;  1RUN A;  1YW9 A;  4GXO A;  3GFM A;  3IL2 A;  3QRF F;  2M5W A;  2DPU A;  4FX0 A;  2VN2 A;  5IT9 Z;  4P55 A;  1BIA A;  3WTW C;  4A0X A;  3K69 A;  6PAX A;  4M9X A;  2W57 A;  3MAJ A;  1FC3 A;  1LEB A;  1H9G A;  5LHI A;  2QQA A;  2QUF A;  4GGG A;  3IRQ A;  3KLO A;  3EYI A;  4G7O F;  2BV6 A;  1ZHF A;  2KRF A;  4MEX F;  5DCF A;  4U7B A;  3CUQ B;  1TQP A;  2Y75 A;  3KE2 A;  5FD6 A;  2DW4 A;  2QQB A;  3KLN A;  1S6L A;  4Y15 A;  2NRA C;  4U0V A;  3ECH A;  2QBY A;  2V79 A;  2P7C B;  3H3Z A;  2HFH A;  3T5X A;  4CZZ A;  2H94 A;  1U5T C;  5KK1 A;  1QGP A;  4KIF A;  4L9V A;  1KU2 A;  4R1H A;  4G7H F;  4HLX A;  3K0L A;  4RAY A;  1MDM B;  4Y13 A;  1KYW A;  5FB2 A;  1Z9C A;  3HTS B;  2EV6 A;  1O7F A;  4HF2 A;  4LK0 F;  1KQ9 A;  4RGU A;  2FMY A;  2G7U A;  2FQ3 A;  2JSC A;  2LF7 A;  3J81 Z;  1R00 A;  5LLQ A;  2ISZ A;  1LNW A;  3ABU A;  1ZRE A;  3HTU A;  4UVC A;  5ILU A;  1D3Y A;  1KGS A;  2Z9O A;  1XDS A;  2CGP A;  3RKW A;  4MNU A;  5H6Q A;  3E97 A;  2STW A;  3GX4 X;  3Q9V A;  1V3F A;  4EVI A;  3U2R A;  3QP5 A;  4M9S A;  3V8L A;  3TO7 A;  3W6K B;  3E6C C;  1R1V A;  1WWX A;  4JQF A;  4I0A A;  3QOP A;  3EYY A;  1FOK A;  2K02 A;  1Z05 A;  3WU1 B;  3T8T A;  4ZYE A;  4U7D A;  3WE3 A;  3FXU A;  2ISY A;  3KZY A;  4HV6 A;  2MH9 A;  5LHH A;  1U5T B;  2A6H F;  3FXQ A;  4Q48 A;  5F6F A;  3JAM Z;  4ON0 A;  2W85 A;  1STZ A;  4EGZ A;  2YU3 A;  5HLH A;  5ICC A;  5LRR A;  5JVT A;  3V8K A;  1FLI A;  5HVQ C;  3GVA A;  4HOB A;  1TW3 A;  2LKP A;  1BJA A;  1EH8 A;  1YIO A;  2OU2 A;  1ON1 A;  3I4P A;  2STT A;  3V7R A;  3BPV A;  1UHW A;  3EDP A;  4FHT A;  3BJ6 A;  2F5C A;  2ZXJ A;  5D5W B;  2HKO A;  4RGX A;  2XIG A;  5JR3 A;  1CF7 A;  3DV8 A;  2QLZ A;  1XMA A;  4U0Y A;  3K2Z A;  2XKO A;  4YFX F;  2EFO A;  3JTH A;  3O2P E;  3E6B A;  3ZQ7 A;  1ZGA A;  5KVR A;  2VT3 A;  4A6E A;  2KIM A;  2PMU A;  3ML6 A;  2JTV A;  2QM3 A;  2ZKZ A;  2DBB A;  3R4K A;  4ASN A;  2FNA A;  4LLG F;  1IN6 A;  1IN7 A;  1I5Z A;  2XV4 S;  4KDP A;  3TO9 A;  3FX3 A;  1IRG A;  5J6X A;  3WG9 A;  4A12 A;  3WGI A;  5ERI A;  3TQN A;  1DPR A;  3LQR A;  1S7O A;  1IAW A;  4O6J A;  2VBW A;  3GWZ A;  4YG2 F;  3BJO A;  3HRM A;  3TDU C;  1R58 A;  5FFZ A;  4PGG A;  3M8E A;  4EV0 A;  1G3Y A;  3O6B B;  1VTN C;  1D5V A;  4IJA A;  4OIO F;  3JW4 A;  1UFM A;  1HXD A;  3I54 A;  1HW5 A;  3V7C A;  1E2X A;  5A2Q K;  2IA2 A;  1XCB A;  1YS6 A;  5CYV A;  3BZ6 A;  1I1S A;  1I1G A;  2V6C A;  4GCV A;  2EV0 A;  2IA1 A;  2FE3 A;  1EH7 A;  4EMS A;  3JSO A;  4XRF A;  1FYL A;  5FLX Z;  4I98 B;  2P4W A;  1T39 A;  2BEO A;  1IN8 A;  2UXN A;  1P4A A;  2NS0 A;  4WXH A;  3M1E A;  2XAF A;  3I71 A;  1K78 B;  4YIF A;  3DP7 A;  5ICF A;  2EB7 A;  4M73 A;  5ICE A;  4HAM A;  5H20 A;  4KIB A;  3FHZ A;  3ZMD A;  5EEH A;  2HOE A;  5E18 F;  5FGM A;  5JHU A;  2ADU A;  1YLF A;  2X4H A;  2MBF A;  1YS7 A;  3CUO A;  1W7P A;  2ETH A;  5LRS A;  1ZLK A;  4HLY A;  2IT0 A;  4LGW A;  4AVP A;  1XSX A;  3VOE A;  4RB1 A;  1KU7 A;  4U88 A;  2QQ9 A;  3PQJ A;  5HDN A;  3M7G A;  3WTU C;  2EWN A;  2PLY A;  1W5S A;  3P7N A;  3LA3 A;  4RGR A;  4FT8 A;  5AIP A;  4UVA A;  3B02 A;  2P7V B;  1QPM A;  1LVA A;  2XRN A;  2H6B A;  3NRV A;  4EJO A;  3CO6 C;  2O6G E;  2Q2E A;  5DYM A;  2EA2 A;  3REO A;  4WK8 F;  1Z1D A;  5LEJ A;  1QZY A;  2IP2 A;  2VE8 A;  2COM A;  3QPT A;  3D0S A;  2HKX A;  2DPD A;  4PCQ A;  4A5M A;  3TDZ C;  1BBY A;  2PI0 A;  2NNY A;  4UNO A;  2MLG A;  3FMS A;  2Y0M A;  4UUV A;  3IWZ A;  3C18 A;  3HSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...