1AKHB

Mat a1/alpha2/dna ternary complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhB00
3S2DJ 3JRHA 2WAQN 5IYCJ 3OIOA 4GFBA 1OJLA 4JP0A 3MKLA 4CYCB 2XB0X 4AC0A 1IDZA 2EZKA 1ZGWA 2W48A 1O4XA 3JRDA 9ANTA 3HOUJ 5FJ8J 5IYDJ 1K83J 1B72A 4A3EJ 1T33A 3S16J 1RKTA 2NS8A 1Q1VA 5GPCA 3FISA 2VUMJ 2L7FP 1ZR4A 1ETOA 1IG7A 2O9LA 2LR8A 4BBSJ 2LY9A 4FCYA 1K61A 1WH7A 5EF6A 3GTOJ 5F27A 4HNVA 3SDGA 2NVYJ 2DMUA 3H0GJ 5FKKA 4A3BJ 3I4NJ 4QIWN 2M9HA 4FTHA 4A3DJ 5BNGA 2NVQJ 4UUTA 2HOAA 5F08A 4DYQA 1ITYA 2GBYA 2VKEA 1TWHJ 2DMNA 3A03A 2DA1A 1X2NA 1JT6A 3BG9A 4UUSA 3D1NI 2L7ZA 2R5ZA 5IOYA 1X2MA 2ME0A 5FKMA 4XRSG 3ZQLA 1QVUA 3C2BA 5C44J 2DTZA 2H1KA 1Y1WJ 2XPWA 4DZJA 2DA3A 4M6VA 4M3FA 4V2GA 1PUFB 5E3MA 5K7HA 4MFEA 5DTDA 2HDDA 2NVTJ 3G1LA 1FJLA 5IP6A 1FTZA 1HDDC 2CRGA 2D5VA 2X9DA 4FISA 1ZKGA 2XGEA 3BG3A 1AHDP 1VNDA 2GLOA 2M8GX 3CCYA 5DS9A 2WB1N 4QTRA 2EQRA 5J1RA 3K7AJ 4M3GA 1LFBA 1FIPA 1NK2P 1I50J 3UKGA 3LSGA 1GUUA 3A02A 4A3IJ 3BR3A 1JUSA 1JUPA 4A3LJ 2IEKA 3S15J 5FKNA 1BA5A 1SANA 3HGYA 5JLXA 3S1MJ 2Y9ZA 1ETWA 3HOYJ 3LSRA 4C3HJ 3S1RJ 3JRFA 4V2FA 4I6ZA 3IV5A 1IC8A 3F0CA 4BXXJ 1IV6A 1FIAA 2Y31A 1H88C 2VKVA 2K9SA 1ETVA 1POGA 4J19A 4W1UA 3JR9A 5EZGA 4B3AA 5F1JA 5C4JJ 1RETA 3GTLJ 1IGNA 3BTJA 1SFOJ 3BT9A 2M34A 2DMTA 4IHXA 4MO7A 3FK6A 3IH3A 1ETYA 2XGCA 4C2MJ 2E19A 2I10A 1OFCX 2EH3A 3G1OA 2R5ZB 3BTCA 3BR6A 1CQTA 3WHBA 3A01A 1JGGA 5E3NA 3CDLA 2EZHA 2HOSA 3ZQHA 1WI3A 2MG4A 2DA4A 2AHQA 3RZOJ 4JX4A 5J3LA 1RR7A 2XPVA 1W0UA 5C4XJ 3HBLA 1DU6A 2WV1A 1ZQ3P 3VPRA 3TW6A 4MIMA 2G0EA 2NVXJ 3ZQFA 2R7ZJ 4BY1J 3Q0VA 4M3BA 3JRGA 2XSDC 5EDNA 3CMYA 1GV5A 2IAIA 1UMQA 1TWCJ 4MFDA 2L7MP 5GPAA 1XC5A 5F0CA 1QVTA 3WHCA 1I6HJ 2OF7A 3PO3J 3G1MA 4FE4A 1TWGJ 3TW7A 4JX6A 3BQYA 1VF9A 2HI3A 2ID3A 2L0KA 3FK7A 4BBRJ 4DYCA 5FKOA 4FE7A 1TC3C 2ECCA 3TP0A 1PUFA 1MNMC 2ZB9A 4AYBN 2X6OA 3JRAA 2KT0A 1RKWA 3ZQCA 4C3IJ 3RKQA 2LP0A 2DA6A 4EEFG 1T56A 3M4OJ 2FD5A 2CQQA 2DMPA 4L5EA 1Z77A 5J1UA 1S7EA 1HF0A 1MSEC 5J1YA 3HOWJ 1BW5A 4D7MA 3BR5A 1OCPA 1RPWA 3Q0WA 3S14J 1B72B 2MGQA 3HEFA 2LTPA 3IH2A 5EZHA 1JT0A 4XRSA 5IPAA 1BL0A 5E3OA 2O8KA 4A3GJ 1ETKA 4DYRA 1QPIA 2DJNA 2XRLA 3GTJJ 1U9NA 2KDZA 1HDPA 5EYRA 2L9RA 1HLVA 1JTXA 1ZR2A 1A5JA 3QPLA 4DZPA 4B4CA 1AU7A 4M3DA 2HOTA 1FTTA 1TWAJ 1JKQC 3GBGA 1H89C 4D5CA 1BW6A 1U9OA 5M5YJ 4W97A 2DA2A 3M3YJ 2COBA 3SJMA 3RQIA 2LK2A 4JX5A 1MBFA 4XIDA 1IRZA 4G12A 3JRCA 3A01B 4D5FA 3BQZA 3BR1A 2ECBA 3BTIA 2YU9J 1MBGA 2HXOA 2VPRA 1AKHB 3HOVJ 1LFUP 2E1OA 1BJZA 2DA7A 2VI6A 4LOCA 3CQZJ 4IHWA 2NS7A 3O8GA 3OSFA 2N8GA 1MBJA 4X6AJ 5EGOB 1OCTC 3GTGJ 2M0CA 1ETXA 4AUXA 2GM4A 1TWFJ 2JWTA 2JA6J 2MSYA 2JA5J 2YS9A 3DEWA 1IDYA 5F0HA 3O8HA 4BKXA 1UHSA 1W0TA 5HODA 2LD5A 2JJ7A 2M2EA 2H8RA 4RBOA 1HOMA 5F04A 4ABZA 3ZOBA 3PM1A 4IEJA 2R92J 4M3EA 1VFCA 2CUEA 2PMZN 1XG1A 3HGGA 4IHYA 1F36A 1APLC 1MBEA 1XS9A 1WGXA 1WPKA 2XPUA 1MBKA 3QPSA 2FJ1A 3E7LA 1UG2A 2ELKA 2K40A 1RESA 5IP9J 1D5YA 3FIWA 1A6IA 2R0QC 3ZQIA 5IP7J 2IBDA 2CU7A 4S0HB 1P7JA 3HM5A 2B63J 4NDLA 2NOGA 3S1NJ 1GVDA 3Q0UA 5FLMJ 4I76A 1LE8A 2E2HJ 2E2IJ 2DA5A 4QSHA 2R5YA 3GTQJ 3LNQA 3HOZJ 4MLOA 1I3QJ 2X48A 1E3OC 3L1PA 2TCTA 3JRBA 4Y52J 3S1QJ 1MBHA 2FQ4A 3FKIJ 2QF7A 2CUFA 2R93J 1Y1VJ 2JA8J 3HKZN 1JKOC 2ID6A 2QCOA 2MW8A 1MSFC 2E2JJ 1IUFA 3TP3A 3QQAA 4XK4A 3NARA 1IJWC 5M5WJ 4Y7NJ 4UUSB 2EZIA 2Y9YA 4A3FJ 1ZK8A 3MVPA 1QRYA 4BY7J 5FLVA 3Q3SA 1G2HA 1GT0C 1AKHA 3BR0A 3LSPA 1B8IA 3GTPJ 1EF4A 1P7IA 3IH4A 5JLWA 1NK3P 4A3CJ 2JN6A 3S2HJ 2Y2ZA 2CJJA 5EG0B 1JKRC 5M5XJ 4D7NA 5F0FA 3K2AA 1LE8B 3H3VK 1F43A 4X1EA 3BG5A 4CYCA 1GV2A 2RAEA 2JMWA 5K7ZA 5EEAA 1YRNB 5IOZA 3NAUA 1JKPC 2LVSA 1GDTA 3B6AA 1ORKA 2XB5A 4B1RA 2LFBA 5FKLA 4RDUA 3HOXJ 3LSJA 5EG0A 2CQXA 1U78A 2OPTA 1U8BA 2AO9A 1ZTRA 2EBIA 4XRMA 2LKXA 4IHVA 2JA7J 4A3MJ 5IYBJ 1ETQA 4DW6A 1B8IB 3GTMJ 1ENHA 1WH5A 4JYKA 1JTYA 5E3LA 2XGDA 3LOCA 5C3EJ 3HB9A 1NTCA 2TRTA 1X58A 3B6CA 3DCFA 2YUSA 4XICA 2JK3A 2O7OA 5K7FA 3SFIA 1YRNA 3PO2J 4A3JJ 3BR2A 2HYJA 5M3MJ 3OOUA 3BTLA 2Y30A 1MH3A 2K9NA 1WCMJ 3OSGA 3TEDA 2ME6A 3S17J 1MH4A 1R9TJ 4A93J 2P81A 2R5YB 3GTKJ 2DN0A 3JRIA 3JREA 3MN2A 1JUMA 3HDDA 2K9QA 3I4MJ 2HXIA 4C3JJ 2Y0SN 1FEXA 2FX0A 5GP9A 4A69C 2DMQA 3ZQGA 1H8AC 4A3KJ 1JJ8C 2HQ5A 1HCRA 1Z0XA 1DU0A 3W6VA 2EZLA 5EGOA 5M3FJ 1VI0A 3RZDJ 2LLKA 1JJ6C
chains in the Genus database with same CATH superfamily
2PQ8A 2VIXA 3K6GA 5FFXA 3CP8A 2VJJA 2NVUB 1V54H 2QQ8A 4ETSA 4AC0A 2KRHA 3OYKA 4OINF 3OYMA 1IDZA 4CDGA 3NWTA 1D3YA 4PSWA 1G3YA 1VQ4I 1D0ZA 4GCVA 2D1HA 3E1SA 3S16J 1X1AA 3M1CA 1ZR4A 2PJPA 2DAOA 4E4HA 3ABTA 3BWGA 3G73A 1SFXA 2ZMEC 4FCYA 3PUFA 3RKYA 3GTOJ 3JSOA 2VBXA 2EB7A 1HSTA 2NVYJ 1IXSB 3TO7A 4RLQA 3H0GJ 3HC7A 1BI2A 3K70C 1TZLA 4HX7A 2M9HA 1MMNA 1J09A 5D4SA 2JQ7A 2BYVE 3D0SA 4UUTA 1GHCA 3FF5A 5F08A 1ITYA 2WY7Q 2GBYA 1LPQA 2DMNA 2FQ3A 2A5YB 4HOBA 3OYLA 4UUSA 2BY3A 5D6FA 1BOAA 1XB4A 4XRSG 2LKSA 3E6BA 4DZJA 4BJ5C 4M6VA 1Y0UA 3RCOA 1PUFB 1MKMA 3JTHA 2FOWA 4KNYA 1JE8A 1TNSA 4RGSA 5DTDA 5GTIC 3IP4B 2IP2A 5J4YA 5K7HA 3ABUA 4M6YA 1FJLA 2Z16A 4GRIA 1FTZA 1G3TA 2E5NA 3LSIA 2IPQX 2QVOA 3G4SI 2D5VA 1KU2A 3E5QA 2LBFB 4C30A 5LEKA 3BJ6A 1RIOH 2CH0A 5BPDA 1NG7A 2IJLA 5J1RA 3K7AJ 1FIPA 5HLTA 3UKGA 5ICGA 1DP3A 1UG0A 1GUUA 5H2FC 1SVLA 3GZ6A 1JUSA 1JUPA 2A69F 2AS5F 4A3LJ 3NEUA 2RKHA 5FKNA 1R00A 6PAXA 4BDZA 4V19K 3HGYA 4EM1A 3TKYA 3HOYJ 1ETWA 1X3WB 4C3HJ 2XAUA 2VKHA 3F8BA 2CFXA 3F0CA 1IC8A 4A0YA 4EGYA 1OQYA 2MLGA 4KT5C 2Y31A 3IL2A 2L3DA 2VJIA 1POGA 4J19A 4E7JA 2KIUA 2L4MA 1LKXA 5AIPA 3CUQC 1XGSA 5C4JJ 2EIJH 1Z7LA 2ZSHB 1L3LA 5E1WA 5ICCA 2M34A 4RA2A 3FK6A 3IH3A 2JZYA 4HSRA 3COAC 4UV8A 1J59A 2E19A 2I10A 1PP8F 4KDPA 4KT6A 3BR6A 3WHBA 3RYPA 3V7RA 2XVCA 5ICEA 3IRRA 2XAGA 5CKTA 3ZQHA 2DA4A 2VB6A 3M8FA 4C2TA 1UFMA 1K78A 3KP6A 2X6YA 4E7IA 4GYGA 1KQ8A 3HBLA 1W5CC 5GAHJ 1UAAA 2JVHA 2VOOA 3S93A 2NYXA 3K4KA 1ZQ3P 3L9FA 2HR3A 2HTSA 4XLAA 4XR6A 4M9XA 3TW6A 3WGGA 2IS4A 2NVXJ 3ZQFA 3EUHC 4ZYAA 4IJAA 3Q0VA 4EGZA 4BY1J 1G4DA 5JVTA 4BS9A 3VFZA 3T1BA 2X0LA 3HOTA 2MA3A 2WC2A 1D1CA 2FMLA 1YX3A 1BBYA 2VJ5A 2L7MP 4PK4A 2X1CA 1U5TB 5KAIC 1XD7A 4G9YA 1X1CA 5F0CA 4O5VA 1A35A 2KPMA 3VSLA 1ZGAA 2X1EA 4JX6A 4DYCA 5FKOA 2GAUA 2DK5A 3TP0A 4A6EA 4CZZA 4XM3A 1R6RA 1M1EB 1N78A 3CMAI 2KT0A 3BCBA 2DA6A 5CVJA 2FD5A 2PFBA 4LIVA 2DMPA 1UJ8A 2P5VA 1QU3A 3G2BA 4E70A 5J1YA 4D7MA 3E6MA 1FOYA 1HW5A 4MQVA 4YEJA 4LG0A 3IWZA 3LA7A 1WWXA 3LMMA 2K4BA 1YIJI 5IPAA 3BROA 1ETKA 4DYRA 2DJNA 3QPTA 2KRFA 2XRLA 3BC8A 1SEUA 2P4WA 1U9NA 2YU3A 1E17A 1XGOA 1ZREA 2QYOA 3V8JA 5H6RA 5E17F 1W7PB 3EQLF 5LFAA 3QPLA 1KONA 1STZA 1WJFA 2R7QA 4G6TB 2PMZA 2HOTA 1TWAJ 4A3CJ 1JKQC 3GBGA 3P9CA 3AL0B 3J7YJ 4HRIA 4IHTA 1KQ0A 1XGNA 2Y0SA 4W97A 4J01A 2MH2A 5F1RA 2KZGA 2O03A 3RQIA 2ESHA 4MHGA 1P2FA 2ZXIA 2NAZA 3TBIA 2OZ6A 3DQVC 5IT9K 3BTIA 2YU9J 5DV5A 1ODDA 3CQZJ 3K4BA 4JOMA 1UCRA 2NS7A 4KMUX 2H6BA 1MBJA 3BP8A 5E8GA 2EIMH 3KZZA 3N97A 1Y8QB 2XAQA 3CTAA 4OIQF 2RC4A 1T6SA 2PI0A 4G6QA 4AUXA 1B59A 2IGMA 4EJOA 2BBYA 3GLLA 1FZPB 3OL3A 4XKWA 4PJNA 4BHPA 2MSYA 3DEWA 1X1BA 2ZFUA 5TISC 3R0JA 1QQIA 4HDUA 5FRNA 3H9GA 1SD4A 2JJ7A 2LD5A 1QGPA 5J40A 1QHHD 5AONA 3MFKA 1WSUA 3DKWA 2RN7A 1ERDA 4RB0A 1KA8A 4H0EA 2CUEA 3G71I 4WWCA 4EM0B 3IRQA 3F72A 1IO2A 1WPKA 1V4RA 2DLLA 3GWZA 3E7LA 1UG2A 2M4KA 2EJRA 2ZNYA 3C1DA 3HIFA 3IAM2 1FMWA 3KP5A 2IBDA 3HM5A 3L2CA 3ERMA 2Y48A 5FLMJ 2CMPA 5KAFC 3WTZA 2O3FA 4QSHA 2ZFWA 1LDJA 3GTQJ 2CQ7A 3H36A 2DT7B 5J8CA 5DCMB 4CCMA 3L1PA 1U5TA 1Z6RA 2GWRA 2TCTA 4XKVA 4ON0A 3ZRGA 3JRBA 1RC9A 2EFQA 1MIJA 3V4GA 3U2RA 3QOEA 5DUKA 1YQAA 3FXJA 2QF7A 3PIPF 4ZYHA 1U8RA 2CG4A 2GXBA 1YE9A 4A0ZA 3W3CA 2ID6A 4AVZA 4RM3A 3TP3A 3OV8A 2P5LC 3LSKA 3CCVI 5M5WJ 4XKBA 4YELA 3SXYA 4A3FJ 3H9QA 4HQEA 3RI4A 1LFPA 3Q3SA 4LB6B 5BMZA 4IHSA 4DGWB 1AKHA 3BR0A 1WJEA 3ZQQA 1NK3P 5ICFA 2F5FA 4WX9A 3S2HJ 1VZ0A 1BN5A 2R4GA 2QBYB 2CJJA 2QEXI 1QNTA 1TQPA 2WA0A 5D5VB 2IS1A 1F43A 1TT0A 4CYCA 1DUXC 1ZYRF 4I99C 1W36C 4HA8A 4CHUA 1GV2A 1EH6A 3EUAA 2JMWA 4D1QA 5E1ZB 1MGTA 3M8EA 4I98B 2X85A 2M30A 2Z99A 3LSTA 3ROUA 1I1GA 1WQ2A 2FU4A 3GEZA 3TDZC 3NAUA 2IGKA 2LVSA 3BLYA 4L0ZB 4AU7A 4Y13A 3DBLB 4B1RA 1J9IA 4P1WA 1R1VA 1R23A 4GYIA 3HOXJ 1BIBA 2L9NA 3E6CC 3LSJA 5EG0A 4X0GA 2OPTA 2AO9A 1ZTRA 2EBIA 4XMYA 3L2UA 2GIZA 3KLNA 2PX9A 4KIGA 4A3MJ 5ILUA 2IGNA 1E3PA 3KPHA 3OYHA 5IT9Z 1BI1A 4Q4ZF 1IRXA 2M1BA 4E6KG 3JSPA 4UB6C 2VJ4A 3D5LA 4KUMA 3F8NA 3M07A 5E3LA 4MGRA 3LOCA 2MD0A 4R79A 4NHJA 1TTYA 2BHYA 3K9TA 1X58A 3B6CA 3DCFA 1X3ZB 3M8JA 5K7FA 1SC7A 1YRNA 3A1YA 2BVMA 4BH9A 4NBQA 5LBQA 2R7UA 4LFUA 1MMAA 1VQ9I 4U7DA 4E7ZA 1MH3A 2K9NA 4XRFA 2LREA 5HS8A 1WCMJ 1FEXA 2QLZA 3GLXA 3S17J 4A93J 1A36A 4RGXA 3K1NA 3BCAA 1S8NA 3KZIC 2O6GE 3I4MJ 1BM9A 3LSHA 5D5XB 3OYIA 3I4PA 4AYBA 3P7NA 2X1DA 2FEZA 4C9YA 4HBLA 1DGRM 3R0AA 4ENKA 3FKJA 2DMQA 2IS2A 3KFWX 2DPUA 1ZAOA 5HLGA 1R4MB 2DBBA 2HQ5A 1JJ8C 1FBSA 1Z0XA 5J4VA 3Q9SA 4PUSA 5EGOA 3LA2A 3IKTA 1JJ6C 2K85A 2X51A 4HSTA 3S2DJ 1WI9A 2WAQN 4HF0A 2OD5A 2CO5A 4JP0A 4CYCB 1HQCA 2XB0X 3R61A 1OCRH 1SD7A 3RQ4A 2EZKA 5L3CA 2YX7A 1D8KA 2W48A 5DUIA 3JRDA 2LF7A 5JVGF 1O4XA 2EFNA 5IYDJ 4LG0B 3CZ6A 3H9JA 1J5YA 1YI2I 5FD6A 1CF7B 1T33A 3SHFA 2VT3A 2V6EA 1R5HA 1RKTA 4YFNF 1ZRCA 3FM5A 1MJAA 1Y8RB 1PP7U 3FISA 2VUMJ 2FBIA 1TT5B 2ICWG 4XOTA 3LAPA 3L09A 1ETOA 2O9LA 2DT5A 4EM2A 3S3MA 1K6YA 4II3A 3WG9A 1FMVA 1KU9A 1KQ9A 1WH7A 5F27A 2D2WA 3J81Z 4Y33A 2K86A 2ZO4A 2RGVA 3T5XA 2DMUA 4A3BJ 2CUZA 5FKKA 4C2UA 1VQLI 1GLNA 4FTHA 3N4MA 2A61A 4WXHA 4ZC3A 1XCBA 5J6XA 2NVQJ 2V9PA 4CA0A 4UNOA 2W1OA 4XN3A 3KP3A 5HNHA 4IZZA 4MTEA 3K2ZA 1TWHJ 2XKOA 2W85A 1ZN2A 4L9JA 3P9IA 2OV7A 4CXFA 2RDPA 1S72I 3DEEA 1YJ9I 2QQAA 2R5ZA 2JA2A 2ME0A 3QP6A 5FKMA 4F7ZA 3EDPA 1O57A 3ZQLA 3C2BA 4S04A 2DTZA 3WTYC 5JHFA 2H1KA 1T95A 3HSRA 2ISYA 4EMSA 3CCJI 4M9SA 3C2HA 2IRFG 2QZ8A 3BDDA 3BPVA 5F64A 2R3SA 1FOKA 1Y0NA 4NQWA 2HVQA 5FLXK 2EILH 1FSHA 3J7AY 3I71A 1B1BA 3RPUD 2R7RA 1MJBA 2CRGA 2X9DA 4I02A 2WAEA 1ZKGA 5B66C 1RUNA 2RV8A 3BG3A 3FHZA 1D1BA 1YW7A 1VNDA 1VQ8I 1S5LC 2HFHA 3ASOH 1HXDA 3F8MA 2EQRA 5GADJ 3FM3A 4AVPA 4BDYA 3ELKA 1I50J 2IA0A 4IQ4A 4Q48A 4L0YB 3I53A 1BR4A 2CWEA 3PL8A 1K6OA 2IW5A 4A3IJ 3F9KA 3OMYA 3ZXSA 3FXLA 3S15J 2VE8A 3KP7A 2OTJI 1QPMA 1XTAA 3LSRA 4V2FA 3JCUC 4I6ZA 3SZPA 1W5TA 3ABLH 3ISPA 4IO9F 2XAFA 3FXMA 2K9SA 3VOEA 2BXYA 3ZMSA 3F23A 3JR9A 2PJRB 2OBPA 4YFXF 5EZGA 4RS8A 4KIBA 1FOWA 1IGNA 3BTJA 2DMTA 2LF8A 4FX4A 2EA4A 5CPRB 2RQPA 2EFPA 4YIFA 1ETYA 5F6FA 2CGPA 1G3SA 3C3WA 4C2MJ 1WJDA 3S8PA 1LEBA 1OFCX 2VQLA 3DTEA 2R7VA 3HSEA 2CSOA 4DOZA 4KMFA 1F1ZA 3BTCA 2XAJA 1R36A 1JGGA 5KCMA 3PSFA 4EATA 1PUEE 2GOXB 5B3SH 1WJAA 4EJWA 1IXCA 2FBHA 1WKMA 1YJNI 3OS0A 2LBFA 2JPCA 2DTRA 1D8JA 4CCKA 3IUOA 3UR3C 3ZQ7A 2L9VA 3OR2C 1HBXG 4KN7X 3DEUA 3UNGC 5A2QZ 1YOVB 3J81K 4CGZA 2EWNA 1L0OC 4MEYF 2Q8KA 2WV1A 2XGXA 1YIOA 4LB5A 3BZ6A 2FSWA 1OYIA 3ECOA 4JQFA 2GA2A 4I7HA 4XORA 2CQNA 2XSDC 2E7XA 3WE3A 3CMYA 4RLFA 2IAIA 3E3VA 1ZARA 2KJBA 1QO0D 1ZLJA 4K2EA 3H3UA 5E18F 4GDFA 3QRFF 1GXPA 1UMQA 3SQNA 5KK1A 5GPAA 3GUDA 2ZMEB 2MABA 3WHCA 3P9KA 1EV7A 1QHGA 3ZCOA 1USSA 4YFKF 3DF8A 4FE4A 1TWGJ 3TW7A 1OMIA 4BBRJ 1VF9A 2ID3A 2L0KA 2XF5A 1IN6A 3AG4H 2D1VA 1SAXA 3P5JA 2CW8A 1ON2A 3KX2A 2F6CA 4U0WA 4BQOA 4AYBN 2P5KA 2X6OA 1N25A 3MMYB 2AXTC 1Z6TA 2WTEA 3I54A 3ZR8X 3JRAA 4EEFG 1T56A 2QENA 1Z77A 1YLFA 3FXQA 3SYTA 1MSEC 1BW5A 1ZG5A 4XSXF 1RPWA 2TDXA 2EFOA 2MC3A 1R71A 5DD8A 3VSKA 5EZHA 4HYEA 3PNTA 4LITA 4OOIA 3ZMZA 1JT0A 2VODA 4A3GJ 4WXDA 3KCCA 3LSMA 4ZZDA 1QPIA 2E1MC 2KQRA 1SFUA 3V7SA 1I1SA 1O3SA 3PNYA 1R5GA 2CUJA 5EYRA 3DPUA 4M74A 1ZR2A 2K7LA 2GA1A 4I0BA 3WGIA 4G8XA 1P92A 5FGMA 5TJJA 4DZPA 4HG2A 3V8KA 3OYDA 3FXUA 4WXCA 4M3DA 1T8IA 3OOPA 3TDUC 4D5CA 1BW6A 1U9OA 3KIOA 2ZBKA 5DM6F 3RSNA 2DA2A 5ERIA 1MNEA 3CLOA 1X4OA 4YIIA 3M3YJ 3IWFA 4S05A 1IN4A 1MBFA 4AIJA 3GW2A 4XIDA 4R1HA 1IRZA 5LLQA 3S3OA 2VQCA 4XLEA 1XSDA 3JRCA 3ZGKA 4UVAA 4D5FA 4XBFA 4B3XA 1AKHB 2ETHA 3FHNA 5K5OA 4ZTFA 1EA3A 2E1OA 1LFUP 2H27A 2DA7A 1B9NA 4NC6A 2NNNA 2DT6A 4QPOA 3RYRA 4WCGA 2VN2A 2LH9A 1XSVA 1SVOA 3AG3H 1OCTC 3GTGJ 1ZELA 3CMMA 4EV0A 1TBXA 2OUMA 3K1PA 2JA5J 2YS9A 2DFFA 1YJWI 3E97A 4BKXA 1UHSA 1W0TA 4Q47A 2FNAA 2M2EA 5HLIA 4U88A 5F04A 3HUGA 4F3QA 3PM1A 2R92J 4M3EA 1XGMA 2EV6A 1XG1A 2ELJA 4U0VA 5L3EA 1YITI 2BY0A 1XS9A 5A2QK 2BHZA 1YW9A 3MCZA 4RB2C 2DK8A 1MBKA 2KDOA 2ELKA 4L9VA 1RESA 5IP9J 1UB9A 4YIRX 4BE1A 3ZQIA 2ZJRF 5IP7J 4S0HB 1XDSA 1P7JA 2LSOA 3QODA 4NDLA 2NOGA 2PLYA 4WK8F 1WJBA 2OAZA 3S1NJ 2HTJA 3FXRA 3K4MA 2UXNA 3K70D 1E2XA 4KISA 4G6DA 4N0BA 1LE8A 3ZP5A 2E2HJ 2E2IJ 2JT1A 4BNCA 3LNQA 3HRMA 3HOZJ 4U7BA 3ML6A 3IKVA 1I3QJ 1YW8A 1MW7A 2V6CA 2HVRA 4Y52J 3W2WA 2AXLA 5AIQA 3FKIJ 4DQ2A 1XSXA 1LVAA 4BHCA 2P6TA 2Z3YA 2CUFA 3F21A 1V3FA 2DU9A 2YSRA 1I39A 1MSFC 3DLLF 2HYGD 1LVKA 1IJWC 4Y7NJ 2Y9YA 2DODA 2YX4A 2Z2SB 1I27A 1QRYA 3GFMA 1C0WA 2V79A 1GT0C 1TNTA 3I58A 5K1YA 2K3FA 1HSJA 3OYJA 2PG4A 2Y2ZA 2LY1A 1RUOA 1Z05A 1YX5A 2WBMA 4IX7A 1KU3A 3K2AA 3SZTA 1S7AA 1T0FA 5ED4A 2W57A 2F4IA 4ESBA 5K7ZA 3EYYA 4R8HA 3CDHA 2HS5A 5TRDA 3T8RA 3ZMVA 2YPRA 3BPXA 2E71A 1JKPC 4KJZA 4OAYA 1O3TA 2QQ9A 5CVIA 2M87A 2XB5A 2FOKA 2F5CA 3LL7A 2VC0A 2DI3A 2KLOA 1DPUA 3WTVC 4RDUA 2G7HA 2CQXA 2X4HA 2LDUA 5HS7A 1U8BA 1FT9A 2GQQA 4XRMA 4IHVA 1J7KA 2K3PA 5JI6A 2K9LA 3BZCA 1S3JA 5IYBJ 1VQNI 2W82A 3T0YA 2Z33A 1ZRFA 2JRMA 1SFKA 1JTYA 5C3EJ 3HB9A 4KA4A 3EYIA 1NTCA 3HL2A 4XN0A 2ZXHA 1WFXA 1QBJA 2YUSA 4BE0A 2JK3A 3I5UA 3SFIA 3VWBA 1LUJB 3MD2A 2VL8A 5K5RA 4JK1X 3GO5A 1WJCA 5LRSA 2OQRA 2HYJA 2V26A 4PDKA 2WB1A 3N05A 3OYGA 2Y30A 4ZJZA 3VYRB 4O6JA 5HVQC 3ERED 1B9MA 3TEDA 2OCCH 4JBAA 1E3HA 1RZ4A 4N9IA 4A5MA 4PGHA 4M73A 2DN0A 3OS2A 5LHGA 3JRIA 3JREA 3HPHA 4E7SA 1SFEA 2HXIA 3ABMH 4P55A 2A05A 2Y0SN 4B09A 3CCMI 2A5WA 4IRHA 5GP9A 1SD5A 4P5OA 2A3SA 3AKZA 4AIKA 3IC7A 4ZH4F 1HCRA 2DO7A 2L01A 4O3MA 2EZLA 3JTGA 1X1PA 2W24A 1ON1A 2XDVA 4ZTJA 5HOOA 5LRRA 3E0JB 2WWYA 4KFCA 5IYCJ 5D6EA 2K4JA 3OIOA 4CSWA 4GFBA 1OJLA 3CESA 5LGNA 3BG6A 3MKLA 2JTVA 3EETA 3S2WA 3W6JB 4AIHA 2DW4A 1X3UA 3FMSA 2WAFA 4I09A 1R7JA 3HOUJ 5FJ8J 1MDMB 1J0RA 1KZHA 2A68F 1B72A 3PQJA 4A3EJ 1ZRDA 2F5VA 4UVCA 2W4SA 1BR1A 3LA3A 4HX8A 2L4AA 3RKXA 3VEPA 1XDUA 5GPCA 2CS3A 3CCLI 3RDIA 4IPAA 3KYDB 4XQFA 1IG7A 2LR8A 4BBSJ 2P8TA 2LY9A 1K61A 1FY7A 4II2A 3RJPA 1DPRA 2DJIA 3F22A 3SDGA 3MKZA 5ILSA 3HKZA 2DCEA 1Q1HA 4QIWN 2GZWA 4GO1A 3KEQA 4A5NA 1Z21A 2QSGX 1BC8C 1ZH5A 1K7AA 2HOAA 4DYQA 3KLOA 2XSJC 5FROA 1EH8A 3A03A 2DA1A 2KISA 3PSIA 1X2NA 3BG9A 1QVUA 5C44J 3MKYB 3VYUB 4HLXA 1Y1WJ 4CCOA 1A31A 1SMYF 2DA3A 2XAHA 3ZMUA 5BOXA 3KYCB 5E1XA 3OYFA 4XKCA 1V55H 4N4NB 2L54A 1IAWA 4GXOA 2DFIA 4MFEA 2NVTJ 3G1LA 3M1EA 2LKPA 3FWEA 3JAMZ 5IP6A 1VQPI 3O2PE 4B8XA 1HDDC 3AG2H 3I59B 4LK1F 4FISA 4L5IA 3PIOF 5D8KB 3A2KA 2E7WA 4KIFA 1AHDP 1ZG3A 1BC7C 3FZVA 5D5UB 1CGPA 4UY8I 1OPCA 1DDNA 2M8GX 1YS6A 5DS9A 3OYCA 2WB1N 4QTRA 3FBNB 1W4MA 4PJMA 4M3GA 1LFBA 1NK2P 1USTA 2QKMB 3E6DA 1Z1DA 4F92B 4OAZA 4RB1A 4MEXF 3BZKA 3A02A 1FX7A 2VKDA 3BR3A 4I0AA 5GTHC 1HA8A 1LNWA 4XLNF 2CQKA 5CQEA 4IF4A 1BA5A 1TLHB 4E7LA 1T98A 4XLCA 5JLXA 3BG7A 4IRGA 4NC8A 1RRJA 2A6HF 4IQJA 2NS0A 4RGUA 1RNLA 3AAFA 1H88C 3K0LA 3PFIA 2E5ZA 3WTWC 1ETVA 4BQAA 3K4NA 4XSZF 3DXJF 4W1UA 4HNUA 2EV0A 3QPHA 5F1JA 4B43A 4CO8A 2WAQA 2PMUA 4Z6YA 3PQKA 2WY8Q 1RETA 1YYVA 3BT9A 4MO7A 1A04A 2XHKA 3PFYA 3R6SA 3SZGA 2O5RA 2Y75A 3W2VA 4GGGA 1TQMA 4N4OB 1BJAA 2EH3A 3G1OA 5BS6A 2H1LA 2R5ZB 1S6LA 1CQTA 1B4AA 2IVMA 2BOLA 2EV5A 5E3NA 3CDLA 1MJ9A 4IOAF 1UHWA 2ZKZA 1WI3A 2MG4A 4F93B 3F8CA 1F5TA 2CV1A 3ECHA 3H5RA 4NNJA 4ENMA 1RR7A 4CH7A 3I9V2 3R4KA 1JHHA 2XPVA 1W0UA 3MAJA 5J8FA 4BHBA 2KJCA 5KVRA 2QUFA 3NQOA 4KICA 2H6CA 3DBHB 3G3ZA 1DU6A 2VBWA 2Z9OA 4FHTA 5DM7F 5CLSA 2Y69H 3FXOA 2XASA 3GXOA 4KN4X 2V1XA 4M3BA 3JRGA 1GV5A 3AL0C 1SMTA 4LIUA 1FBUA 4BAYA 2HNHA 4M6XA 3WE2A 1TWCJ 1PDNC 5H20A 3A0HC 2R7WA 2BZTA 1O3QA 4ESFA 1I6HJ 2OF7A 3K4JA 5DYMA 2IGOA 3FK7A 3A4CA 3DKYA 5CYVA 2F4OB 3H92A 1PUFA 2BXZA 1MNMC 3L7WA 2FE3A 2ZB9A 2W00A 2VT2A 1TW2A 1RKWA 3DTIA 4HEA2 5DD4A 4N9HA 4ZDLA 1I3AA 2M3AA 3ASNH 4F55A 3DV8A 2CQQA 4L5EA 5J1UA 2HEOA 5D8LB 1HF0A 3X2QH 3HOWJ 2GIVA 2P7CB 3BR5A 4ZDPA 3PUBA 3Q0WA 3MZ8A 2HQNA 3HEFA 4HNTA 1VQ7I 2LTPA 1LJ9A 2L5QA 3CCRI 2VC1A 3QP5A 4HX4A 2DYRH 3LFKA 2KIFA 4ASNA 3OY9A 1HDPA 2O8XA 2L9RA 1FYKA 1HLVA 1K4TA 1V5EA 1JTXA 3J7AO 3DBRB 4FASD 4P9UA 1YO5C 2K02A 1A5JA 4L9TA 2B0LA 4B4CA 3D5SC 1P6RA 4L5JA 2BW3B 3FDYA 4I2OA 2X6XA 2V7FA 3H5NA 1H89C 4XOPA 3IHUA 2JPBA 2ZJQF 1LB2A 2VQGA 3GFJA 3ZN1A 3SJMA 1FBQA 1DQUA 2LK2A 5E79C 5LEJA 4A12A 1N77A 2KIMA 3I59A 4CICA 2L2OA 4DJAA 2JVGA 2M4GA 3TMOA 3A01B 4PFPA 3BQZA 3BR1A 2ECBA 4BU2A 2VPRA 4U87A 4ZYDA 2DDAA 1JI8A 4HAMA 1O3RA 4LOCA 4IHWA 3O8GA 3OSFA 5JHUA 4DBQA 2I5UA 4RM2A 2BE5F 1QZYA 3FMRA 4B44A 2E60A 3I55I 3OYBA 2HQRA 3QU3A 1ULYA 2GM4A 1TWFJ 2M0MA 4B47A 3CCQI 2JWTA 2XV4S 5CVVA 2JA6J 2J5PA 1ZG1A 1O7LA 3I56I 1IDYA 3O8HA 1NG6A 2VXZA 5LGUA 1OCCH 3HRUA 2H8RA 3B73A 1O7FA 2VBZA 4ABZA 2QBYA 1D5VA 3HRTA 4IEJA 3GTPJ 2UWMA 4UVBA 2OU2A 1KGSA 1VFCA 1LDDA 1R22A 1F9NA 3HGGA 4IHYA 4NQWB 4F91B 1APLC 2YR2A 3CC7I 3U1DA 1QA6A 4NUBA 4PJJA 3QPSA 2FJ1A 1AOYA 3R60A 2K40A 1IN8A 5DEQA 2DDBA 1D5YA 2R0QC 4CCJA 4FETA 2KFDA 2L9SA 2B63J 1S7OA 1T0FC 3ABKH 4G7OF 3Q0UA 2QKLB 4I76A 1MMDA 3VYSB 2M8EA 1OISA 3T8TA 2BVLA 5FRMA 2R5YA 4LMYA 5B1AH 2HOEA 2HPIA 4IRIA 5D5WB 1DP7P 3L2WA 2VXDA 1GVJA 4EJUA 1MBHA 2FQ4A 3HSFA 4PJ0C 2E1MB 4LLGF 2HVSA 2V9VA 4LJZF 2R93J 1Y1VJ 3TO6A 2JA8J 1WHUA 3HKZN 4G7ZF 4RAGA 1P4XA 2MW8A 2QCOA 2ZXWH 3CO7C 2RQQA 3I3LA 2E2JJ 1PJRA 2K27A 3NARA 1IV8A 4XK4A 3LQRA 1PVEA 1D1AA 3JAMK 5HNFA 5FLVA 4BY7J 2O0YA 1G2HA 1XX5A 2DQLA 3LSPA 2PEXA 1B8IA 5DCMA 3ESWB 4ZZLA 2P6SA 1P7IA 1X1DA 2XKPA 3KE2A 4FX0A 2F5EA 5EJCA 1PYVA 3E5XA 3OIQA 3U21A 4AD9A 5E20A 1VQOI 2PN6A 1S29A 2MFZA 3KEYA 1JKRC 2RNGA 3B02A 5F0FA 5M5XJ 3H3VK 2XF7A 1SVMA 2RAEA 2EFWA 4LD5A 3TQNA 2VASA 4A2UA 5CJ9A 1W7PD 1QZEA 4UB8C 4ENNA 3GYHX 5IOZA 3Q9VA 2LYCA 2QA4I 3I64A 4XNFA 2A6EF 3WTXC 1FOXA 4OMYA 2R7OA 1OR7C 3F6OA 4LLNA 1BOBA 1JGSA 1NH3A 2UZKA 1J2XA 3W6KB 2VPLA 2LG4A 4CCNA 3OIPA 2LFBA 5FKLA 3CUOA 2CW7A 3L2VA 3SFZA 1Z91A 1Z67A 3DLAA 2LKXA 1Z9CA 4QPQA 3PNVA 2WV0A 4PFOA 1ETQA 3CCEI 5GAGJ 4OIOF 2JUCA 4BQNA 1ENHA 4BGDA 4MNUA 5LD2C 2VE9A 4JYKA 5CVUA 1TL8A 1T39A 4BXUA 4YG2F 3QU6A 2Z5UA 1K4SA 1EJ9A 4HDVA 5J47A 1ACIA 1WVRA 3TO9A 2IS6A 2J5OA 3S3NA 4XICA 3HG9A 5HLHA 2O7OA 1IN7A 4PZJA 4DBRA 4UHTA 5B5EC 3BR2A 4Y15A 1WJ5A 2UXXA 3K4LA 2L7KA 3EUKL 3CJTB 2KIQA 3OSGA 1H9TA 2MH9A 4UV9A 2ME6A 1OR7A 3CJQB 1R9TJ 1AWCA 4RGRA 1SAUA 3GTKJ 2DYSH 3MN2A 2XF6A 1JUMA 2K9QA 2V1NA 3LWFA 3F3XA 2IXSA 5HS9A 2KP6A 2RREA 4C3JJ 1HKTA 4BJTA 5FO5A 1ZLKA 2E35A 2FX0A 2I8DA 3HYIA 1XMXA 4BXFA 4CCLA 3QAHA 2HGCA 2BW3A 2JSCA 2OC6A 5L3FA 3HTSB 4IKFA 2KZVA 4RAFA 4BL0B 4A3KJ 4XLHA 1ONVA 2FBKA 1R1TA 3FX3A 2LY2A 2Y0MA 4PJLA 1FPQA 3OYNA 3RZDJ 1FLIA 2LLKA 1OCOH 3DPLC 3JRHA 3CC4I 2R7TA 1G8XA 2A07F 4AIDA 3QWLA 4HV5A 3GX4X 2QQBA 1IZ1A 2L02A 1ZGWA 1HW1A 5IT3A 9ANTA 3KP4A 2IT0A 3BJOA 3CP2A 1K83J 1FP2A 2NS8A 4U0YA 1Q1VA 3HHGA 3MQ0A 2ZNZA 2XC7A 3CD6I 2L7FP 3DU6A 4OWRB 4LK0F 3CC2I 5EF6A 4PCQA 4HNVA 5HDKA 2A6TA 2FNPA 4MQ9F 5BPIA 4Y4RA 5CVRA 1OKRA 3OS1A 3KEOA 2ADUA 2Z1DA 3I4NJ 3LQQA 3K10A 4QWQA 2M7AA 4HV6A 4HF2A 2VOPA 2HU9A 3K1MA 5LHHA 4A3DJ 2DOEA 1UELB 5BNGA 1K78B 2R7SA 4RAYA 3GFIA 1AA7A 4Q5SF 1QZZA 2R7DA 2VKEA 1TP4A 1HW2A 4XLFA 1OYYA 2VBYA 1P4WA 2MBFA 3GZ5A 2HYFA 2XIGA 2HPMA 1JT6A 1VQ5I 3D1NI 2HWVA 2L7ZA 2JSPA 4CZCA 1X2MA 5IOYA 2JUGA 3QOPA 2ZXJA 3H5AA 4MTDA 2XPWA 2COMA 4LG3A 1UZCA 5KHDA 2DOAA 1N75A 4M3FA 4BE2A 4V2GA 3QYFA 2V1DA 2E1CA 5E3MA 2IA2A 2F5DA 4A6DA 3S32A 2FXAA 2HDDA 3GCMA 4L9NA 5HDNA 1OLTA 1KYWA 5K5QA 4QLCU 3OWTA 3U1KA 1B6AA 2K9MA 2KL4A 1HKSA 2STTA 4I01A 2UV1A 3GZNB 2XGEA 3AG1H 1J75A 2V1UA 2CYYA 3CUQB 4UXNA 1FNNA 4ZYGA 2GLOA 3CCYA 1D0YA 3AFHA 4EQQA 5EEHA 2E1NA 3QYEA 5L3GA 5D4RA 4HZFA 2GXGA 1IRFA 2OZUA 2HDWA 3L2RA 3LSGA 3QYBA 1VQKI 1I5ZA 3G6EI 3HZJA 2W84A 2IEKA 1R4NB 2LOOA 1SANA 4Y17A 3H1CA 3S1MJ 3BJAA 2Y9ZA 1D0XA 3GVAA 1JHFA 3L2QA 1BIAA 2PMHA 4RMNA 3JRFA 3S1RJ 3IV5A 2DFEA 4G7HF 4BXXJ 4RB3C 2AQFA 2ZMEA 4BQQA 1IV6A 1FIAA 2O61A 3CMEI 1BR2A 3KYLA 2VKVA 3OR1C 4NC7A 2ELHA 2GXAA 2EK5A 4HF1A 4B3AA 1U3EM 4Y3OA 2K5CA 3RKWA 3GTLJ 3F8FA 2H8WA 4E7KA 1SFOJ 4IHXA 2MC4A 2LNBA 4LGWA 4DNCA 2XGCA 2X6WA 2QGUA 4UUVA 1MNDA 3DKXA 1S9HA 5BQTA 3J80K 1R5ID 1T38A 3A01A 2PJRA 3CF5F 2Q0OA 4HW0A 2HKOA 4NB5A 1OYWA 1FYMA 2FMYA 2EZHA 4Z2YA 2HOSA 2V9KA 2NRAC 2AHQA 3RZOJ 3A0BC 4JX4A 5J3LA 2EPFA 4A0XA 1E0EA 1MMGA 2M5WA 4CUGA 2JRTA 2W25A 1U0JA 5C4XJ 3H3ZA 3LFUA 4EJVA 2RNJA 2WADA 1W7PA 1EH7A 2IA1A 4ESJA 3VODA 3VPRA 1YTYA 3TGNA 1X4PA 4MIMA 4HPQA 1R1UA 1MD0A 2G0EA 1G3WA 2P0WA 4FT8A 5IY5H 3HTUA 3RIRA 3VYTB 2ISZA 2R7ZJ 3CCSI 5EDNA 1LDKB 3WTSC 4AWXB 4LLLA 4KYWA 1ZHFA 2BV6A 3M7GA 3C2GA 2KRCA 4BUPA 4MFDA 3VB2A 3K4CA 1XC5A 3DFGA 2STWA 1QVTA 2C6YA 4ZYEA 3PO3J 4PSXA 2EA2A 3G1MA 3BQYA 1RR8C 2HI3A 1P4AA 3IAS2 4FE7A 1TC3C 2ECCA 4F52A 2QSHX 2CV0A 3ONQA 4CYDA 3FMQA 4HLYA 2QSFX 1YG2A 2VLAA 3K69A 3ZQCA 4C3IJ 1KYZA 3RKQA 2LP0A 4ENJA 3M4OJ 5FLXZ 3GFLA 2D45A 3RTRA 1S7EA 4RAZA 1IF1A 3WGHA 1IXRC 1FWZA 3DTKA 1OCPA 2EINH 1MDMA 1I6XA 2ZC2A 3S14J 1B72B 2MGQA 3CUQA 4ITVA 1MMSA 5L3BA 2ZJ2A 1WZ2A 1Z3XA 3HUGB 3EUHA 3IH2A 1R49A 4XRSA 1W5SA 1BL0A 5E3OA 2O8KA 1VQMI 1P9QC 3DU5A 2BGCA 3GTJJ 3WTTC 2KDZA 2G9WA 3H35A 3NRVA 3MEXA 1RI7A 5KNLA 2B9SA 1YS7A 2OJED 4EJTA 3VDXA 4BYYA 1AU7A 1OCZH 1FTTA 2BY1A 2P7VB 2ESNA 4P9FA 2ZJPF 1T2KA 2KKOA 5M5YJ 4BACA 2COBA 2DXIA 5FB2A 4JX5A 3U9GA 1FC3A 2NOJB 3HHHA 4G12A 3OL4A 3Q5FA 1VQ6I 5B1BH 3GF2A 3E5UA 3TL4X 1MBGA 2HXOA 3HOVJ 5LHIA 2R7XA 5DDGA 1BJZA 4DIQA 2VI6A 1HC8A 3ULQB 3M9AA 2N8GA 2HDCA 3EPZA 5FFZA 4X6AJ 2V4JC 5EGOB 1T08B 3HOSA 2M0CA 2VQHA 2HZTA 1ETXA 1IRGA 3MZHA 4IVNA 1Y56A 2UUZA 1W36D 4G94A 1Z7UA 2KHMA 2FRHA 3W2AA 1F4KA 4OMZA 5F0HA 3WG7H 2CV2A 2W7NA 3SEQA 2Q1ZB 5HODA 4PGGA 1XMAA 4RBOA 3ZN0A 1HOMA 3MWMA 3ZOBA 3HPGA 4OIRF 1W1WE 4IL6C 1U2WA 3JW4A 5CQGA 3REOA 2PMZN 2PBIA 2OTLI 2MYSA 1EF4A 1F36A 3MZYA 3ZMDA 1IW7F 1MBEA 1UHMA 3D5RC 3WU1B 2Q2EA 3CF2A 3TOBA 1XPXA 1WGXA 2ZCWA 1Y6IA 3GMEA 3NWSA 2XPUA 3OYEA 4L18B 2OQGA 5E8IA 4KITB 2DOFA 2EIKH 3O6BB 4BEHA 3O3KA 1BI0A 3BOQA 2H94A 2LC2A 3BY6A 1TQIA 3FIWA 1A6IA 2E34A 4AM3A 2MLKA 2CU7A 4H4KC 2CW0F 3WTUC 3HXLA 2R7FA 3L00A 1GVDA 1TW3A 2HKXA 1FSEA 4XL9A 5H6QA 4P96A 2ACJA 3SDBA 2DA5A 3LAJA 5FD5A 3H0DA 3C7JA 1IN5A 4MLOA 4B48A 2X48A 1E3OC 3DPTA 2E36A 1FP1D 1LEAA 3S1QJ 4M72A 1H9GA 3OYAA 2F48A 5GAEJ 1HKQA 1LQ1A 1JKOC 1JXSA 4M9ZA 1IUFA 1XN7A 3J7ZI 2NNYA 3QQAA 1NHAA 4UUSB 2EZIA 1ZK8A 2FA5A 2LMDA 3CJRB 3MVPA 4OU0A 5JR3A 3KETA 4EVIA 1XMKA 1FYLA 3FBIB 4XONA 5LGTA 4OIPF 2H09A 2BY2A 3IH4A 5TGTA 5JLWA 1R58A 2JN6A 1YFHA 4IOCF 2MD5A 5EG0B 1EKEA 1A6QA 3ZMTA 4D7NA 1VTNC 3CLQA 2M45A 4E7HA 1LE8B 1K79A 4BJ6C 4X1EA 3BG5A 1WRJA 2DPDA 3V42A 4YRVA 3TOAA 3RPQA 5DCFA 1H0MA 2FUG2 3CO6C 5EEAA 2F4MB 1YRNB 3C18A 1IUYA 4BEHB 4TV7A 3B6AA 4WF2A 1GDTA 1ORKA 4FQGA 2Q2EB 5L3DA 2KMUA 3FXKA 3V8LA 2AQEA 5JFRA 2QM3A 1U78A 3RPUA 2GOMA 4ZDOA 2JA7J 3KZYA 1X19A 2DFHA 1Z3YA 2B7EA 4DW6A 1KU7A 1B8IB 4J00A 3GTMJ 1WH5A 2M7BA 4M71A 2ZSIB 2XGDA 2DQRA 2LRDA 1MZBA 1BI3A 1G59A 3HJEA 5ILVA 2TRTA 4IXAA 3CDIA 2CFOA 2F2EA 3DWLE 2RVCA 3SEZA 2XROA 3PO2J 3J80Z 4D9JA 4HQMA 1REPC 3F6VA 3CCUI 2OCEA 1G6NA 1U5TC 4A3JJ 2QWWA 3I0TA 2VONA 1Y39A 5M3MJ 5EEGA 1GXQA 3BTLA 1V5FA 3OOUA 1CF7A 2OA4A 2HZDA 5HDGA 4ANJA 3V7CA 1YHQI 3KP2A 1MH4A 2P81A 1ZGJA 2R5YB 3WU2C 2NXNB 3DP7A 3HDDA 1U6GA 1V5GA 1XCVA 2BEOA 2XRNA 2HQAA 1SD6A 2G7UA 3WODF 3PJRA 3WU0A 4A69C 1DGWY 2FF4A 3ZQGA 3MKWB 1H8AC 4D0PA 3ZPLA 1DU0A 3HRSA 3W6VA 4XLPF 5M3FJ 1VI0A 3CJNA 2XUBA
chains in the Genus database with same CATH topology
3S2DJ 3JRHA 2WAQN 5IYCJ 3OIOA 4GFBA 1OJLA 4JP0A 3MKLA 4CYCB 2XB0X 4AC0A 1IDZA 2EZKA 1ZGWA 2W48A 1O4XA 3JRDA 9ANTA 3HOUJ 5FJ8J 5IYDJ 1K83J 1B72A 4A3EJ 1T33A 3S16J 1RKTA 2NS8A 1Q1VA 5GPCA 3FISA 2VUMJ 2L7FP 1ZR4A 1ETOA 1IG7A 2O9LA 2LR8A 4BBSJ 2LY9A 4FCYA 1K61A 1WH7A 5EF6A 3GTOJ 5F27A 4HNVA 3SDGA 2NVYJ 2DMUA 3H0GJ 5FKKA 4A3BJ 3I4NJ 4QIWN 2M9HA 4FTHA 4A3DJ 5BNGA 2NVQJ 4UUTA 2HOAA 5F08A 4DYQA 1ITYA 2GBYA 2VKEA 1TWHJ 2DMNA 3A03A 2DA1A 1X2NA 1JT6A 3BG9A 4UUSA 3D1NI 2L7ZA 2R5ZA 5IOYA 1X2MA 2ME0A 5FKMA 4XRSG 3ZQLA 1QVUA 3C2BA 5C44J 2DTZA 2H1KA 1Y1WJ 2XPWA 4DZJA 2DA3A 4M6VA 4M3FA 4V2GA 1PUFB 5E3MA 5K7HA 4MFEA 5DTDA 2HDDA 2NVTJ 3G1LA 1FJLA 5IP6A 1FTZA 1HDDC 2CRGA 2D5VA 2X9DA 4FISA 1ZKGA 2XGEA 3BG3A 1AHDP 1VNDA 2GLOA 2M8GX 3CCYA 5DS9A 2WB1N 4QTRA 2EQRA 5J1RA 3K7AJ 4M3GA 1LFBA 1FIPA 1NK2P 1I50J 3UKGA 3LSGA 1GUUA 3A02A 4A3IJ 3BR3A 1JUSA 1JUPA 4A3LJ 2IEKA 3S15J 5FKNA 1BA5A 1SANA 3HGYA 5JLXA 3S1MJ 2Y9ZA 1ETWA 3HOYJ 3LSRA 4C3HJ 3S1RJ 3JRFA 4V2FA 4I6ZA 3IV5A 1IC8A 3F0CA 4BXXJ 1IV6A 1FIAA 2Y31A 1H88C 2VKVA 2K9SA 1ETVA 1POGA 4J19A 4W1UA 3JR9A 5EZGA 4B3AA 5F1JA 5C4JJ 1RETA 3GTLJ 1IGNA 3BTJA 1SFOJ 3BT9A 2M34A 2DMTA 4IHXA 4MO7A 3FK6A 3IH3A 1ETYA 2XGCA 4C2MJ 2E19A 2I10A 1OFCX 2EH3A 3G1OA 2R5ZB 3BTCA 3BR6A 1CQTA 3WHBA 3A01A 1JGGA 5E3NA 3CDLA 2EZHA 2HOSA 3ZQHA 1WI3A 2MG4A 2DA4A 2AHQA 3RZOJ 4JX4A 5J3LA 1RR7A 2XPVA 1W0UA 5C4XJ 3HBLA 1DU6A 2WV1A 1ZQ3P 3VPRA 3TW6A 4MIMA 2G0EA 2NVXJ 3ZQFA 2R7ZJ 4BY1J 3Q0VA 4M3BA 3JRGA 2XSDC 5EDNA 3CMYA 1GV5A 2IAIA 1UMQA 1TWCJ 4MFDA 2L7MP 5GPAA 1XC5A 5F0CA 1QVTA 3WHCA 1I6HJ 2OF7A 3PO3J 3G1MA 4FE4A 1TWGJ 3TW7A 4JX6A 3BQYA 1VF9A 2HI3A 2ID3A 2L0KA 3FK7A 4BBRJ 4DYCA 5FKOA 4FE7A 1TC3C 2ECCA 3TP0A 1PUFA 1MNMC 2ZB9A 4AYBN 2X6OA 3JRAA 2KT0A 1RKWA 3ZQCA 4C3IJ 3RKQA 2LP0A 2DA6A 4EEFG 1T56A 3M4OJ 2FD5A 2CQQA 2DMPA 4L5EA 1Z77A 5J1UA 1S7EA 1HF0A 1MSEC 5J1YA 3HOWJ 1BW5A 4D7MA 3BR5A 1OCPA 1RPWA 3Q0WA 3S14J 1B72B 2MGQA 3HEFA 2LTPA 3IH2A 5EZHA 1JT0A 4XRSA 5IPAA 1BL0A 5E3OA 2O8KA 4A3GJ 1ETKA 4DYRA 1QPIA 2DJNA 2XRLA 3GTJJ 1U9NA 2KDZA 1HDPA 5EYRA 2L9RA 1HLVA 1JTXA 1ZR2A 1A5JA 3QPLA 4DZPA 4B4CA 1AU7A 4M3DA 2HOTA 1FTTA 1TWAJ 1JKQC 3GBGA 1H89C 4D5CA 1BW6A 1U9OA 5M5YJ 4W97A 2DA2A 3M3YJ 2COBA 3SJMA 3RQIA 2LK2A 4JX5A 1MBFA 4XIDA 1IRZA 4G12A 3JRCA 3A01B 4D5FA 3BQZA 3BR1A 2ECBA 3BTIA 2YU9J 1MBGA 2HXOA 2VPRA 1AKHB 3HOVJ 1LFUP 2E1OA 1BJZA 2DA7A 2VI6A 4LOCA 3CQZJ 4IHWA 2NS7A 3O8GA 3OSFA 2N8GA 1MBJA 4X6AJ 5EGOB 1OCTC 3GTGJ 2M0CA 1ETXA 4AUXA 2GM4A 1TWFJ 2JWTA 2JA6J 2MSYA 2JA5J 2YS9A 3DEWA 1IDYA 5F0HA 3O8HA 4BKXA 1UHSA 1W0TA 5HODA 2LD5A 2JJ7A 2M2EA 2H8RA 4RBOA 1HOMA 5F04A 4ABZA 3ZOBA 3PM1A 4IEJA 2R92J 4M3EA 1VFCA 2CUEA 2PMZN 1XG1A 3HGGA 4IHYA 1F36A 1APLC 1MBEA 1XS9A 1WGXA 1WPKA 2XPUA 1MBKA 3QPSA 2FJ1A 3E7LA 1UG2A 2ELKA 2K40A 1RESA 5IP9J 1D5YA 3FIWA 1A6IA 2R0QC 3ZQIA 5IP7J 2IBDA 2CU7A 4S0HB 1P7JA 3HM5A 2B63J 4NDLA 2NOGA 3S1NJ 1GVDA 3Q0UA 5FLMJ 4I76A 1LE8A 2E2HJ 2E2IJ 2DA5A 4QSHA 2R5YA 3GTQJ 3LNQA 3HOZJ 4MLOA 1I3QJ 2X48A 1E3OC 3L1PA 2TCTA 3JRBA 4Y52J 3S1QJ 1MBHA 2FQ4A 3FKIJ 2QF7A 2CUFA 2R93J 1Y1VJ 2JA8J 3HKZN 1JKOC 2ID6A 2QCOA 2MW8A 1MSFC 2E2JJ 1IUFA 3TP3A 3QQAA 4XK4A 3NARA 1IJWC 5M5WJ 4Y7NJ 4UUSB 2EZIA 2Y9YA 4A3FJ 1ZK8A 3MVPA 1QRYA 4BY7J 5FLVA 3Q3SA 1G2HA 1GT0C 1AKHA 3BR0A 3LSPA 1B8IA 3GTPJ 1EF4A 1P7IA 3IH4A 5JLWA 1NK3P 4A3CJ 2JN6A 3S2HJ 2Y2ZA 2CJJA 5EG0B 1JKRC 5M5XJ 4D7NA 5F0FA 3K2AA 1LE8B 3H3VK 1F43A 4X1EA 3BG5A 4CYCA 1GV2A 2RAEA 2JMWA 5K7ZA 5EEAA 1YRNB 5IOZA 3NAUA 1JKPC 2LVSA 1GDTA 3B6AA 1ORKA 2XB5A 4B1RA 2LFBA 5FKLA 4RDUA 3HOXJ 3LSJA 5EG0A 2CQXA 1U78A 2OPTA 1U8BA 2AO9A 1ZTRA 2EBIA 4XRMA 2LKXA 4IHVA 2JA7J 4A3MJ 5IYBJ 1ETQA 4DW6A 1B8IB 3GTMJ 1ENHA 1WH5A 4JYKA 1JTYA 5E3LA 2XGDA 3LOCA 5C3EJ 3HB9A 1NTCA 2TRTA 1X58A 3B6CA 3DCFA 2YUSA 4XICA 2JK3A 2O7OA 5K7FA 3SFIA 1YRNA 3PO2J 4A3JJ 3BR2A 2HYJA 5M3MJ 3OOUA 3BTLA 2Y30A 1MH3A 2K9NA 1WCMJ 3OSGA 3TEDA 2ME6A 3S17J 1MH4A 1R9TJ 4A93J 2P81A 2R5YB 3GTKJ 2DN0A 3JRIA 3JREA 3MN2A 1JUMA 3HDDA 2K9QA 3I4MJ 2HXIA 4C3JJ 2Y0SN 1FEXA 2FX0A 5GP9A 4A69C 2DMQA 3ZQGA 1H8AC 4A3KJ 1JJ8C 2HQ5A 1HCRA 1Z0XA 1DU0A 3W6VA 2EZLA 5EGOA 5M3FJ 1VI0A 3RZDJ 2LLKA 1JJ6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D J;  3JRH A;  2WAQ N;  5IYC J;  3OIO A;  4GFB A;  1OJL A;  4JP0 A;  3MKL A;  4CYC B;  2XB0 X;  4AC0 A;  1IDZ A;  2EZK A;  1ZGW A;  2W48 A;  1O4X A;  3JRD A;  9ANT A;  3HOU J;  5FJ8 J;  5IYD J;  1K83 J;  1B72 A;  4A3E J;  1T33 A;  3S16 J;  1RKT A;  2NS8 A;  1Q1V A;  5GPC A;  3FIS A;  2VUM J;  2L7F P;  1ZR4 A;  1ETO A;  1IG7 A;  2O9L A;  2LR8 A;  4BBS J;  2LY9 A;  4FCY A;  1K61 A;  1WH7 A;  5EF6 A;  3GTO J;  5F27 A;  4HNV A;  3SDG A;  2NVY J;  2DMU A;  3H0G J;  5FKK A;  4A3B J;  3I4N J;  4QIW N;  2M9H A;  4FTH A;  4A3D J;  5BNG A;  2NVQ J;  4UUT A;  2HOA A;  5F08 A;  4DYQ A;  1ITY A;  2GBY A;  2VKE A;  1TWH J;  2DMN A;  3A03 A;  2DA1 A;  1X2N A;  1JT6 A;  3BG9 A;  4UUS A;  3D1N I;  2L7Z A;  2R5Z A;  5IOY A;  1X2M A;  2ME0 A;  5FKM A;  4XRS G;  3ZQL A;  1QVU A;  3C2B A;  5C44 J;  2DTZ A;  2H1K A;  1Y1W J;  2XPW A;  4DZJ A;  2DA3 A;  4M6V A;  4M3F A;  4V2G A;  1PUF B;  5E3M A;  5K7H A;  4MFE A;  5DTD A;  2HDD A;  2NVT J;  3G1L A;  1FJL A;  5IP6 A;  1FTZ A;  1HDD C;  2CRG A;  2D5V A;  2X9D A;  4FIS A;  1ZKG A;  2XGE A;  3BG3 A;  1AHD P;  1VND A;  2GLO A;  2M8G X;  3CCY A;  5DS9 A;  2WB1 N;  4QTR A;  2EQR A;  5J1R A;  3K7A J;  4M3G A;  1LFB A;  1FIP A;  1NK2 P;  1I50 J;  3UKG A;  3LSG A;  1GUU A;  3A02 A;  4A3I J;  3BR3 A;  1JUS A;  1JUP A;  4A3L J;  2IEK A;  3S15 J;  5FKN A;  1BA5 A;  1SAN A;  3HGY A;  5JLX A;  3S1M J;  2Y9Z A;  1ETW A;  3HOY J;  3LSR A;  4C3H J;  3S1R J;  3JRF A;  4V2F A;  4I6Z A;  3IV5 A;  1IC8 A;  3F0C A;  4BXX J;  1IV6 A;  1FIA A;  2Y31 A;  1H88 C;  2VKV A;  2K9S A;  1ETV A;  1POG A;  4J19 A;  4W1U A;  3JR9 A;  5EZG A;  4B3A A;  5F1J A;  5C4J J;  1RET A;  3GTL J;  1IGN A;  3BTJ A;  1SFO J;  3BT9 A;  2M34 A;  2DMT A;  4IHX A;  4MO7 A;  3FK6 A;  3IH3 A;  1ETY A;  2XGC A;  4C2M J;  2E19 A;  2I10 A;  1OFC X;  2EH3 A;  3G1O A;  2R5Z B;  3BTC A;  3BR6 A;  1CQT A;  3WHB A;  3A01 A;  1JGG A;  5E3N A;  3CDL A;  2EZH A;  2HOS A;  3ZQH A;  1WI3 A;  2MG4 A;  2DA4 A;  2AHQ A;  3RZO J;  4JX4 A;  5J3L A;  1RR7 A;  2XPV A;  1W0U A;  5C4X J;  3HBL A;  1DU6 A;  2WV1 A;  1ZQ3 P;  3VPR A;  3TW6 A;  4MIM A;  2G0E A;  2NVX J;  3ZQF A;  2R7Z J;  4BY1 J;  3Q0V A;  4M3B A;  3JRG A;  2XSD C;  5EDN A;  3CMY A;  1GV5 A;  2IAI A;  1UMQ A;  1TWC J;  4MFD A;  2L7M P;  5GPA A;  1XC5 A;  5F0C A;  1QVT A;  3WHC A;  1I6H J;  2OF7 A;  3PO3 J;  3G1M A;  4FE4 A;  1TWG J;  3TW7 A;  4JX6 A;  3BQY A;  1VF9 A;  2HI3 A;  2ID3 A;  2L0K A;  3FK7 A;  4BBR J;  4DYC A;  5FKO A;  4FE7 A;  1TC3 C;  2ECC A;  3TP0 A;  1PUF A;  1MNM C;  2ZB9 A;  4AYB N;  2X6O A;  3JRA A;  2KT0 A;  1RKW A;  3ZQC A;  4C3I J;  3RKQ A;  2LP0 A;  2DA6 A;  4EEF G;  1T56 A;  3M4O J;  2FD5 A;  2CQQ A;  2DMP A;  4L5E A;  1Z77 A;  5J1U A;  1S7E A;  1HF0 A;  1MSE C;  5J1Y A;  3HOW J;  1BW5 A;  4D7M A;  3BR5 A;  1OCP A;  1RPW A;  3Q0W A;  3S14 J;  1B72 B;  2MGQ A;  3HEF A;  2LTP A;  3IH2 A;  5EZH A;  1JT0 A;  4XRS A;  5IPA A;  1BL0 A;  5E3O A;  2O8K A;  4A3G J;  1ETK A;  4DYR A;  1QPI A;  2DJN A;  2XRL A;  3GTJ J;  1U9N A;  2KDZ A;  1HDP A;  5EYR A;  2L9R A;  1HLV A;  1JTX A;  1ZR2 A;  1A5J A;  3QPL A;  4DZP A;  4B4C A;  1AU7 A;  4M3D A;  2HOT A;  1FTT A;  1TWA J;  1JKQ C;  3GBG A;  1H89 C;  4D5C A;  1BW6 A;  1U9O A;  5M5Y J;  4W97 A;  2DA2 A;  3M3Y J;  2COB A;  3SJM A;  3RQI A;  2LK2 A;  4JX5 A;  1MBF A;  4XID A;  1IRZ A;  4G12 A;  3JRC A;  3A01 B;  4D5F A;  3BQZ A;  3BR1 A;  2ECB A;  3BTI A;  2YU9 J;  1MBG A;  2HXO A;  2VPR A;  1AKH B;  3HOV J;  1LFU P;  2E1O A;  1BJZ A;  2DA7 A;  2VI6 A;  4LOC A;  3CQZ J;  4IHW A;  2NS7 A;  3O8G A;  3OSF A;  2N8G A;  1MBJ A;  4X6A J;  5EGO B;  1OCT C;  3GTG J;  2M0C A;  1ETX A;  4AUX A;  2GM4 A;  1TWF J;  2JWT A;  2JA6 J;  2MSY A;  2JA5 J;  2YS9 A;  3DEW A;  1IDY A;  5F0H A;  3O8H A;  4BKX A;  1UHS A;  1W0T A;  5HOD A;  2LD5 A;  2JJ7 A;  2M2E A;  2H8R A;  4RBO A;  1HOM A;  5F04 A;  4ABZ A;  3ZOB A;  3PM1 A;  4IEJ A;  2R92 J;  4M3E A;  1VFC A;  2CUE A;  2PMZ N;  1XG1 A;  3HGG A;  4IHY A;  1F36 A;  1APL C;  1MBE A;  1XS9 A;  1WGX A;  1WPK A;  2XPU A;  1MBK A;  3QPS A;  2FJ1 A;  3E7L A;  1UG2 A;  2ELK A;  2K40 A;  1RES A;  5IP9 J;  1D5Y A;  3FIW A;  1A6I A;  2R0Q C;  3ZQI A;  5IP7 J;  2IBD A;  2CU7 A;  4S0H B;  1P7J A;  3HM5 A;  2B63 J;  4NDL A;  2NOG A;  3S1N J;  1GVD A;  3Q0U A;  5FLM J;  4I76 A;  1LE8 A;  2E2H J;  2E2I J;  2DA5 A;  4QSH A;  2R5Y A;  3GTQ J;  3LNQ A;  3HOZ J;  4MLO A;  1I3Q J;  2X48 A;  1E3O C;  3L1P A;  2TCT A;  3JRB A;  4Y52 J;  3S1Q J;  1MBH A;  2FQ4 A;  3FKI J;  2QF7 A;  2CUF A;  2R93 J;  1Y1V J;  2JA8 J;  3HKZ N;  1JKO C;  2ID6 A;  2QCO A;  2MW8 A;  1MSF C;  2E2J J;  1IUF A;  3TP3 A;  3QQA A;  4XK4 A;  3NAR A;  1IJW C;  5M5W J;  4Y7N J;  4UUS B;  2EZI A;  2Y9Y A;  4A3F J;  1ZK8 A;  3MVP A;  1QRY A;  4BY7 J;  5FLV A;  3Q3S A;  1G2H A;  1GT0 C;  1AKH A;  3BR0 A;  3LSP A;  1B8I A;  3GTP J;  1EF4 A;  1P7I A;  3IH4 A;  5JLW A;  1NK3 P;  4A3C J;  2JN6 A;  3S2H J;  2Y2Z A;  2CJJ A;  5EG0 B;  1JKR C;  5M5X J;  4D7N A;  5F0F A;  3K2A A;  1LE8 B;  3H3V K;  1F43 A;  4X1E A;  3BG5 A;  4CYC A;  1GV2 A;  2RAE A;  2JMW A;  5K7Z A;  5EEA A;  1YRN B;  5IOZ A;  3NAU A;  1JKP C;  2LVS A;  1GDT A;  3B6A A;  1ORK A;  2XB5 A;  4B1R A;  2LFB A;  5FKL A;  4RDU A;  3HOX J;  3LSJ A;  5EG0 A;  2CQX A;  1U78 A;  2OPT A;  1U8B A;  2AO9 A;  1ZTR A;  2EBI A;  4XRM A;  2LKX A;  4IHV A;  2JA7 J;  4A3M J;  5IYB J;  1ETQ A;  4DW6 A;  1B8I B;  3GTM J;  1ENH A;  1WH5 A;  4JYK A;  1JTY A;  5E3L A;  2XGD A;  3LOC A;  5C3E J;  3HB9 A;  1NTC A;  2TRT A;  1X58 A;  3B6C A;  3DCF A;  2YUS A;  4XIC A;  2JK3 A;  2O7O A;  5K7F A;  3SFI A;  1YRN A;  3PO2 J;  4A3J J;  3BR2 A;  2HYJ A;  5M3M J;  3OOU A;  3BTL A;  2Y30 A;  1MH3 A;  2K9N A;  1WCM J;  3OSG A;  3TED A;  2ME6 A;  3S17 J;  1MH4 A;  1R9T J;  4A93 J;  2P81 A;  2R5Y B;  3GTK J;  2DN0 A;  3JRI A;  3JRE A;  3MN2 A;  1JUM A;  3HDD A;  2K9Q A;  3I4M J;  2HXI A;  4C3J J;  2Y0S N;  1FEX A;  2FX0 A;  5GP9 A;  4A69 C;  2DMQ A;  3ZQG A;  1H8A C;  4A3K J;  1JJ8 C;  2HQ5 A;  1HCR A;  1Z0X A;  1DU0 A;  3W6V A;  2EZL A;  5EGO A;  5M3F J;  1VI0 A;  3RZD J;  2LLK A;  1JJ6 C; 
#chains in the Genus database with same CATH topology
 2PQ8 A;  2VIX A;  3K6G A;  5FFX A;  3CP8 A;  2VJJ A;  2NVU B;  1V54 H;  2QQ8 A;  4ETS A;  4AC0 A;  2KRH A;  3OYK A;  4OIN F;  3OYM A;  1IDZ A;  4CDG A;  3NWT A;  1D3Y A;  4PSW A;  1G3Y A;  1VQ4 I;  1D0Z A;  4GCV A;  2D1H A;  3E1S A;  3S16 J;  1X1A A;  3M1C A;  1ZR4 A;  2PJP A;  2DAO A;  4E4H A;  3ABT A;  3BWG A;  3G73 A;  1SFX A;  2ZME C;  4FCY A;  3PUF A;  3RKY A;  3GTO J;  3JSO A;  2VBX A;  2EB7 A;  1HST A;  2NVY J;  1IXS B;  3TO7 A;  4RLQ A;  3H0G J;  3HC7 A;  1BI2 A;  3K70 C;  1TZL A;  4HX7 A;  2M9H A;  1MMN A;  1J09 A;  5D4S A;  2JQ7 A;  2BYV E;  3D0S A;  4UUT A;  1GHC A;  3FF5 A;  5F08 A;  1ITY A;  2WY7 Q;  2GBY A;  1LPQ A;  2DMN A;  2FQ3 A;  2A5Y B;  4HOB A;  3OYL A;  4UUS A;  2BY3 A;  5D6F A;  1BOA A;  1XB4 A;  4XRS G;  2LKS A;  3E6B A;  4DZJ A;  4BJ5 C;  4M6V A;  1Y0U A;  3RCO A;  1PUF B;  1MKM A;  3JTH A;  2FOW A;  4KNY A;  1JE8 A;  1TNS A;  4RGS A;  5DTD A;  5GTI C;  3IP4 B;  2IP2 A;  5J4Y A;  5K7H A;  3ABU A;  4M6Y A;  1FJL A;  2Z16 A;  4GRI A;  1FTZ A;  1G3T A;  2E5N A;  3LSI A;  2IPQ X;  2QVO A;  3G4S I;  2D5V A;  1KU2 A;  3E5Q A;  2LBF B;  4C30 A;  5LEK A;  3BJ6 A;  1RIO H;  2CH0 A;  5BPD A;  1NG7 A;  2IJL A;  5J1R A;  3K7A J;  1FIP A;  5HLT A;  3UKG A;  5ICG A;  1DP3 A;  1UG0 A;  1GUU A;  5H2F C;  1SVL A;  3GZ6 A;  1JUS A;  1JUP A;  2A69 F;  2AS5 F;  4A3L J;  3NEU A;  2RKH A;  5FKN A;  1R00 A;  6PAX A;  4BDZ A;  4V19 K;  3HGY A;  4EM1 A;  3TKY A;  3HOY J;  1ETW A;  1X3W B;  4C3H J;  2XAU A;  2VKH A;  3F8B A;  2CFX A;  3F0C A;  1IC8 A;  4A0Y A;  4EGY A;  1OQY A;  2MLG A;  4KT5 C;  2Y31 A;  3IL2 A;  2L3D A;  2VJI A;  1POG A;  4J19 A;  4E7J A;  2KIU A;  2L4M A;  1LKX A;  5AIP A;  3CUQ C;  1XGS A;  5C4J J;  2EIJ H;  1Z7L A;  2ZSH B;  1L3L A;  5E1W A;  5ICC A;  2M34 A;  4RA2 A;  3FK6 A;  3IH3 A;  2JZY A;  4HSR A;  3COA C;  4UV8 A;  1J59 A;  2E19 A;  2I10 A;  1PP8 F;  4KDP A;  4KT6 A;  3BR6 A;  3WHB A;  3RYP A;  3V7R A;  2XVC A;  5ICE A;  3IRR A;  2XAG A;  5CKT A;  3ZQH A;  2DA4 A;  2VB6 A;  3M8F A;  4C2T A;  1UFM A;  1K78 A;  3KP6 A;  2X6Y A;  4E7I A;  4GYG A;  1KQ8 A;  3HBL A;  1W5C C;  5GAH J;  1UAA A;  2JVH A;  2VOO A;  3S93 A;  2NYX A;  3K4K A;  1ZQ3 P;  3L9F A;  2HR3 A;  2HTS A;  4XLA A;  4XR6 A;  4M9X A;  3TW6 A;  3WGG A;  2IS4 A;  2NVX J;  3ZQF A;  3EUH C;  4ZYA A;  4IJA A;  3Q0V A;  4EGZ A;  4BY1 J;  1G4D A;  5JVT A;  4BS9 A;  3VFZ A;  3T1B A;  2X0L A;  3HOT A;  2MA3 A;  2WC2 A;  1D1C A;  2FML A;  1YX3 A;  1BBY A;  2VJ5 A;  2L7M P;  4PK4 A;  2X1C A;  1U5T B;  5KAI C;  1XD7 A;  4G9Y A;  1X1C A;  5F0C A;  4O5V A;  1A35 A;  2KPM A;  3VSL A;  1ZGA A;  2X1E A;  4JX6 A;  4DYC A;  5FKO A;  2GAU A;  2DK5 A;  3TP0 A;  4A6E A;  4CZZ A;  4XM3 A;  1R6R A;  1M1E B;  1N78 A;  3CMA I;  2KT0 A;  3BCB A;  2DA6 A;  5CVJ A;  2FD5 A;  2PFB A;  4LIV A;  2DMP A;  1UJ8 A;  2P5V A;  1QU3 A;  3G2B A;  4E70 A;  5J1Y A;  4D7M A;  3E6M A;  1FOY A;  1HW5 A;  4MQV A;  4YEJ A;  4LG0 A;  3IWZ A;  3LA7 A;  1WWX A;  3LMM A;  2K4B A;  1YIJ I;  5IPA A;  3BRO A;  1ETK A;  4DYR A;  2DJN A;  3QPT A;  2KRF A;  2XRL A;  3BC8 A;  1SEU A;  2P4W A;  1U9N A;  2YU3 A;  1E17 A;  1XGO A;  1ZRE A;  2QYO A;  3V8J A;  5H6R A;  5E17 F;  1W7P B;  3EQL F;  5LFA A;  3QPL A;  1KON A;  1STZ A;  1WJF A;  2R7Q A;  4G6T B;  2PMZ A;  2HOT A;  1TWA J;  4A3C J;  1JKQ C;  3GBG A;  3P9C A;  3AL0 B;  3J7Y J;  4HRI A;  4IHT A;  1KQ0 A;  1XGN A;  2Y0S A;  4W97 A;  4J01 A;  2MH2 A;  5F1R A;  2KZG A;  2O03 A;  3RQI A;  2ESH A;  4MHG A;  1P2F A;  2ZXI A;  2NAZ A;  3TBI A;  2OZ6 A;  3DQV C;  5IT9 K;  3BTI A;  2YU9 J;  5DV5 A;  1ODD A;  3CQZ J;  3K4B A;  4JOM A;  1UCR A;  2NS7 A;  4KMU X;  2H6B A;  1MBJ A;  3BP8 A;  5E8G A;  2EIM H;  3KZZ A;  3N97 A;  1Y8Q B;  2XAQ A;  3CTA A;  4OIQ F;  2RC4 A;  1T6S A;  2PI0 A;  4G6Q A;  4AUX A;  1B59 A;  2IGM A;  4EJO A;  2BBY A;  3GLL A;  1FZP B;  3OL3 A;  4XKW A;  4PJN A;  4BHP A;  2MSY A;  3DEW A;  1X1B A;  2ZFU A;  5TIS C;  3R0J A;  1QQI A;  4HDU A;  5FRN A;  3H9G A;  1SD4 A;  2JJ7 A;  2LD5 A;  1QGP A;  5J40 A;  1QHH D;  5AON A;  3MFK A;  1WSU A;  3DKW A;  2RN7 A;  1ERD A;  4RB0 A;  1KA8 A;  4H0E A;  2CUE A;  3G71 I;  4WWC A;  4EM0 B;  3IRQ A;  3F72 A;  1IO2 A;  1WPK A;  1V4R A;  2DLL A;  3GWZ A;  3E7L A;  1UG2 A;  2M4K A;  2EJR A;  2ZNY A;  3C1D A;  3HIF A;  3IAM 2;  1FMW A;  3KP5 A;  2IBD A;  3HM5 A;  3L2C A;  3ERM A;  2Y48 A;  5FLM J;  2CMP A;  5KAF C;  3WTZ A;  2O3F A;  4QSH A;  2ZFW A;  1LDJ A;  3GTQ J;  2CQ7 A;  3H36 A;  2DT7 B;  5J8C A;  5DCM B;  4CCM A;  3L1P A;  1U5T A;  1Z6R A;  2GWR A;  2TCT A;  4XKV A;  4ON0 A;  3ZRG A;  3JRB A;  1RC9 A;  2EFQ A;  1MIJ A;  3V4G A;  3U2R A;  3QOE A;  5DUK A;  1YQA A;  3FXJ A;  2QF7 A;  3PIP F;  4ZYH A;  1U8R A;  2CG4 A;  2GXB A;  1YE9 A;  4A0Z A;  3W3C A;  2ID6 A;  4AVZ A;  4RM3 A;  3TP3 A;  3OV8 A;  2P5L C;  3LSK A;  3CCV I;  5M5W J;  4XKB A;  4YEL A;  3SXY A;  4A3F J;  3H9Q A;  4HQE A;  3RI4 A;  1LFP A;  3Q3S A;  4LB6 B;  5BMZ A;  4IHS A;  4DGW B;  1AKH A;  3BR0 A;  1WJE A;  3ZQQ A;  1NK3 P;  5ICF A;  2F5F A;  4WX9 A;  3S2H J;  1VZ0 A;  1BN5 A;  2R4G A;  2QBY B;  2CJJ A;  2QEX I;  1QNT A;  1TQP A;  2WA0 A;  5D5V B;  2IS1 A;  1F43 A;  1TT0 A;  4CYC A;  1DUX C;  1ZYR F;  4I99 C;  1W36 C;  4HA8 A;  4CHU A;  1GV2 A;  1EH6 A;  3EUA A;  2JMW A;  4D1Q A;  5E1Z B;  1MGT A;  3M8E A;  4I98 B;  2X85 A;  2M30 A;  2Z99 A;  3LST A;  3ROU A;  1I1G A;  1WQ2 A;  2FU4 A;  3GEZ A;  3TDZ C;  3NAU A;  2IGK A;  2LVS A;  3BLY A;  4L0Z B;  4AU7 A;  4Y13 A;  3DBL B;  4B1R A;  1J9I A;  4P1W A;  1R1V A;  1R23 A;  4GYI A;  3HOX J;  1BIB A;  2L9N A;  3E6C C;  3LSJ A;  5EG0 A;  4X0G A;  2OPT A;  2AO9 A;  1ZTR A;  2EBI A;  4XMY A;  3L2U A;  2GIZ A;  3KLN A;  2PX9 A;  4KIG A;  4A3M J;  5ILU A;  2IGN A;  1E3P A;  3KPH A;  3OYH A;  5IT9 Z;  1BI1 A;  4Q4Z F;  1IRX A;  2M1B A;  4E6K G;  3JSP A;  4UB6 C;  2VJ4 A;  3D5L A;  4KUM A;  3F8N A;  3M07 A;  5E3L A;  4MGR A;  3LOC A;  2MD0 A;  4R79 A;  4NHJ A;  1TTY A;  2BHY A;  3K9T A;  1X58 A;  3B6C A;  3DCF A;  1X3Z B;  3M8J A;  5K7F A;  1SC7 A;  1YRN A;  3A1Y A;  2BVM A;  4BH9 A;  4NBQ A;  5LBQ A;  2R7U A;  4LFU A;  1MMA A;  1VQ9 I;  4U7D A;  4E7Z A;  1MH3 A;  2K9N A;  4XRF A;  2LRE A;  5HS8 A;  1WCM J;  1FEX A;  2QLZ A;  3GLX A;  3S17 J;  4A93 J;  1A36 A;  4RGX A;  3K1N A;  3BCA A;  1S8N A;  3KZI C;  2O6G E;  3I4M J;  1BM9 A;  3LSH A;  5D5X B;  3OYI A;  3I4P A;  4AYB A;  3P7N A;  2X1D A;  2FEZ A;  4C9Y A;  4HBL A;  1DGR M;  3R0A A;  4ENK A;  3FKJ A;  2DMQ A;  2IS2 A;  3KFW X;  2DPU A;  1ZAO A;  5HLG A;  1R4M B;  2DBB A;  2HQ5 A;  1JJ8 C;  1FBS A;  1Z0X A;  5J4V A;  3Q9S A;  4PUS A;  5EGO A;  3LA2 A;  3IKT A;  1JJ6 C;  2K85 A;  2X51 A;  4HST A;  3S2D J;  1WI9 A;  2WAQ N;  4HF0 A;  2OD5 A;  2CO5 A;  4JP0 A;  4CYC B;  1HQC A;  2XB0 X;  3R61 A;  1OCR H;  1SD7 A;  3RQ4 A;  2EZK A;  5L3C A;  2YX7 A;  1D8K A;  2W48 A;  5DUI A;  3JRD A;  2LF7 A;  5JVG F;  1O4X A;  2EFN A;  5IYD J;  4LG0 B;  3CZ6 A;  3H9J A;  1J5Y A;  1YI2 I;  5FD6 A;  1CF7 B;  1T33 A;  3SHF A;  2VT3 A;  2V6E A;  1R5H A;  1RKT A;  4YFN F;  1ZRC A;  3FM5 A;  1MJA A;  1Y8R B;  1PP7 U;  3FIS A;  2VUM J;  2FBI A;  1TT5 B;  2ICW G;  4XOT A;  3LAP A;  3L09 A;  1ETO A;  2O9L A;  2DT5 A;  4EM2 A;  3S3M A;  1K6Y A;  4II3 A;  3WG9 A;  1FMV A;  1KU9 A;  1KQ9 A;  1WH7 A;  5F27 A;  2D2W A;  3J81 Z;  4Y33 A;  2K86 A;  2ZO4 A;  2RGV A;  3T5X A;  2DMU A;  4A3B J;  2CUZ A;  5FKK A;  4C2U A;  1VQL I;  1GLN A;  4FTH A;  3N4M A;  2A61 A;  4WXH A;  4ZC3 A;  1XCB A;  5J6X A;  2NVQ J;  2V9P A;  4CA0 A;  4UNO A;  2W1O A;  4XN3 A;  3KP3 A;  5HNH A;  4IZZ A;  4MTE A;  3K2Z A;  1TWH J;  2XKO A;  2W85 A;  1ZN2 A;  4L9J A;  3P9I A;  2OV7 A;  4CXF A;  2RDP A;  1S72 I;  3DEE A;  1YJ9 I;  2QQA A;  2R5Z A;  2JA2 A;  2ME0 A;  3QP6 A;  5FKM A;  4F7Z A;  3EDP A;  1O57 A;  3ZQL A;  3C2B A;  4S04 A;  2DTZ A;  3WTY C;  5JHF A;  2H1K A;  1T95 A;  3HSR A;  2ISY A;  4EMS A;  3CCJ I;  4M9S A;  3C2H A;  2IRF G;  2QZ8 A;  3BDD A;  3BPV A;  5F64 A;  2R3S A;  1FOK A;  1Y0N A;  4NQW A;  2HVQ A;  5FLX K;  2EIL H;  1FSH A;  3J7A Y;  3I71 A;  1B1B A;  3RPU D;  2R7R A;  1MJB A;  2CRG A;  2X9D A;  4I02 A;  2WAE A;  1ZKG A;  5B66 C;  1RUN A;  2RV8 A;  3BG3 A;  3FHZ A;  1D1B A;  1YW7 A;  1VND A;  1VQ8 I;  1S5L C;  2HFH A;  3ASO H;  1HXD A;  3F8M A;  2EQR A;  5GAD J;  3FM3 A;  4AVP A;  4BDY A;  3ELK A;  1I50 J;  2IA0 A;  4IQ4 A;  4Q48 A;  4L0Y B;  3I53 A;  1BR4 A;  2CWE A;  3PL8 A;  1K6O A;  2IW5 A;  4A3I J;  3F9K A;  3OMY A;  3ZXS A;  3FXL A;  3S15 J;  2VE8 A;  3KP7 A;  2OTJ I;  1QPM A;  1XTA A;  3LSR A;  4V2F A;  3JCU C;  4I6Z A;  3SZP A;  1W5T A;  3ABL H;  3ISP A;  4IO9 F;  2XAF A;  3FXM A;  2K9S A;  3VOE A;  2BXY A;  3ZMS A;  3F23 A;  3JR9 A;  2PJR B;  2OBP A;  4YFX F;  5EZG A;  4RS8 A;  4KIB A;  1FOW A;  1IGN A;  3BTJ A;  2DMT A;  2LF8 A;  4FX4 A;  2EA4 A;  5CPR B;  2RQP A;  2EFP A;  4YIF A;  1ETY A;  5F6F A;  2CGP A;  1G3S A;  3C3W A;  4C2M J;  1WJD A;  3S8P A;  1LEB A;  1OFC X;  2VQL A;  3DTE A;  2R7V A;  3HSE A;  2CSO A;  4DOZ A;  4KMF A;  1F1Z A;  3BTC A;  2XAJ A;  1R36 A;  1JGG A;  5KCM A;  3PSF A;  4EAT A;  1PUE E;  2GOX B;  5B3S H;  1WJA A;  4EJW A;  1IXC A;  2FBH A;  1WKM A;  1YJN I;  3OS0 A;  2LBF A;  2JPC A;  2DTR A;  1D8J A;  4CCK A;  3IUO A;  3UR3 C;  3ZQ7 A;  2L9V A;  3OR2 C;  1HBX G;  4KN7 X;  3DEU A;  3UNG C;  5A2Q Z;  1YOV B;  3J81 K;  4CGZ A;  2EWN A;  1L0O C;  4MEY F;  2Q8K A;  2WV1 A;  2XGX A;  1YIO A;  4LB5 A;  3BZ6 A;  2FSW A;  1OYI A;  3ECO A;  4JQF A;  2GA2 A;  4I7H A;  4XOR A;  2CQN A;  2XSD C;  2E7X A;  3WE3 A;  3CMY A;  4RLF A;  2IAI A;  3E3V A;  1ZAR A;  2KJB A;  1QO0 D;  1ZLJ A;  4K2E A;  3H3U A;  5E18 F;  4GDF A;  3QRF F;  1GXP A;  1UMQ A;  3SQN A;  5KK1 A;  5GPA A;  3GUD A;  2ZME B;  2MAB A;  3WHC A;  3P9K A;  1EV7 A;  1QHG A;  3ZCO A;  1USS A;  4YFK F;  3DF8 A;  4FE4 A;  1TWG J;  3TW7 A;  1OMI A;  4BBR J;  1VF9 A;  2ID3 A;  2L0K A;  2XF5 A;  1IN6 A;  3AG4 H;  2D1V A;  1SAX A;  3P5J A;  2CW8 A;  1ON2 A;  3KX2 A;  2F6C A;  4U0W A;  4BQO A;  4AYB N;  2P5K A;  2X6O A;  1N25 A;  3MMY B;  2AXT C;  1Z6T A;  2WTE A;  3I54 A;  3ZR8 X;  3JRA A;  4EEF G;  1T56 A;  2QEN A;  1Z77 A;  1YLF A;  3FXQ A;  3SYT A;  1MSE C;  1BW5 A;  1ZG5 A;  4XSX F;  1RPW A;  2TDX A;  2EFO A;  2MC3 A;  1R71 A;  5DD8 A;  3VSK A;  5EZH A;  4HYE A;  3PNT A;  4LIT A;  4OOI A;  3ZMZ A;  1JT0 A;  2VOD A;  4A3G J;  4WXD A;  3KCC A;  3LSM A;  4ZZD A;  1QPI A;  2E1M C;  2KQR A;  1SFU A;  3V7S A;  1I1S A;  1O3S A;  3PNY A;  1R5G A;  2CUJ A;  5EYR A;  3DPU A;  4M74 A;  1ZR2 A;  2K7L A;  2GA1 A;  4I0B A;  3WGI A;  4G8X A;  1P92 A;  5FGM A;  5TJJ A;  4DZP A;  4HG2 A;  3V8K A;  3OYD A;  3FXU A;  4WXC A;  4M3D A;  1T8I A;  3OOP A;  3TDU C;  4D5C A;  1BW6 A;  1U9O A;  3KIO A;  2ZBK A;  5DM6 F;  3RSN A;  2DA2 A;  5ERI A;  1MNE A;  3CLO A;  1X4O A;  4YII A;  3M3Y J;  3IWF A;  4S05 A;  1IN4 A;  1MBF A;  4AIJ A;  3GW2 A;  4XID A;  4R1H A;  1IRZ A;  5LLQ A;  3S3O A;  2VQC A;  4XLE A;  1XSD A;  3JRC A;  3ZGK A;  4UVA A;  4D5F A;  4XBF A;  4B3X A;  1AKH B;  2ETH A;  3FHN A;  5K5O A;  4ZTF A;  1EA3 A;  2E1O A;  1LFU P;  2H27 A;  2DA7 A;  1B9N A;  4NC6 A;  2NNN A;  2DT6 A;  4QPO A;  3RYR A;  4WCG A;  2VN2 A;  2LH9 A;  1XSV A;  1SVO A;  3AG3 H;  1OCT C;  3GTG J;  1ZEL A;  3CMM A;  4EV0 A;  1TBX A;  2OUM A;  3K1P A;  2JA5 J;  2YS9 A;  2DFF A;  1YJW I;  3E97 A;  4BKX A;  1UHS A;  1W0T A;  4Q47 A;  2FNA A;  2M2E A;  5HLI A;  4U88 A;  5F04 A;  3HUG A;  4F3Q A;  3PM1 A;  2R92 J;  4M3E A;  1XGM A;  2EV6 A;  1XG1 A;  2ELJ A;  4U0V A;  5L3E A;  1YIT I;  2BY0 A;  1XS9 A;  5A2Q K;  2BHZ A;  1YW9 A;  3MCZ A;  4RB2 C;  2DK8 A;  1MBK A;  2KDO A;  2ELK A;  4L9V A;  1RES A;  5IP9 J;  1UB9 A;  4YIR X;  4BE1 A;  3ZQI A;  2ZJR F;  5IP7 J;  4S0H B;  1XDS A;  1P7J A;  2LSO A;  3QOD A;  4NDL A;  2NOG A;  2PLY A;  4WK8 F;  1WJB A;  2OAZ A;  3S1N J;  2HTJ A;  3FXR A;  3K4M A;  2UXN A;  3K70 D;  1E2X A;  4KIS A;  4G6D A;  4N0B A;  1LE8 A;  3ZP5 A;  2E2H J;  2E2I J;  2JT1 A;  4BNC A;  3LNQ A;  3HRM A;  3HOZ J;  4U7B A;  3ML6 A;  3IKV A;  1I3Q J;  1YW8 A;  1MW7 A;  2V6C A;  2HVR A;  4Y52 J;  3W2W A;  2AXL A;  5AIQ A;  3FKI J;  4DQ2 A;  1XSX A;  1LVA A;  4BHC A;  2P6T A;  2Z3Y A;  2CUF A;  3F21 A;  1V3F A;  2DU9 A;  2YSR A;  1I39 A;  1MSF C;  3DLL F;  2HYG D;  1LVK A;  1IJW C;  4Y7N J;  2Y9Y A;  2DOD A;  2YX4 A;  2Z2S B;  1I27 A;  1QRY A;  3GFM A;  1C0W A;  2V79 A;  1GT0 C;  1TNT A;  3I58 A;  5K1Y A;  2K3F A;  1HSJ A;  3OYJ A;  2PG4 A;  2Y2Z A;  2LY1 A;  1RUO A;  1Z05 A;  1YX5 A;  2WBM A;  4IX7 A;  1KU3 A;  3K2A A;  3SZT A;  1S7A A;  1T0F A;  5ED4 A;  2W57 A;  2F4I A;  4ESB A;  5K7Z A;  3EYY A;  4R8H A;  3CDH A;  2HS5 A;  5TRD A;  3T8R A;  3ZMV A;  2YPR A;  3BPX A;  2E71 A;  1JKP C;  4KJZ A;  4OAY A;  1O3T A;  2QQ9 A;  5CVI A;  2M87 A;  2XB5 A;  2FOK A;  2F5C A;  3LL7 A;  2VC0 A;  2DI3 A;  2KLO A;  1DPU A;  3WTV C;  4RDU A;  2G7H A;  2CQX A;  2X4H A;  2LDU A;  5HS7 A;  1U8B A;  1FT9 A;  2GQQ A;  4XRM A;  4IHV A;  1J7K A;  2K3P A;  5JI6 A;  2K9L A;  3BZC A;  1S3J A;  5IYB J;  1VQN I;  2W82 A;  3T0Y A;  2Z33 A;  1ZRF A;  2JRM A;  1SFK A;  1JTY A;  5C3E J;  3HB9 A;  4KA4 A;  3EYI A;  1NTC A;  3HL2 A;  4XN0 A;  2ZXH A;  1WFX A;  1QBJ A;  2YUS A;  4BE0 A;  2JK3 A;  3I5U A;  3SFI A;  3VWB A;  1LUJ B;  3MD2 A;  2VL8 A;  5K5R A;  4JK1 X;  3GO5 A;  1WJC A;  5LRS A;  2OQR A;  2HYJ A;  2V26 A;  4PDK A;  2WB1 A;  3N05 A;  3OYG A;  2Y30 A;  4ZJZ A;  3VYR B;  4O6J A;  5HVQ C;  3ERE D;  1B9M A;  3TED A;  2OCC H;  4JBA A;  1E3H A;  1RZ4 A;  4N9I A;  4A5M A;  4PGH A;  4M73 A;  2DN0 A;  3OS2 A;  5LHG A;  3JRI A;  3JRE A;  3HPH A;  4E7S A;  1SFE A;  2HXI A;  3ABM H;  4P55 A;  2A05 A;  2Y0S N;  4B09 A;  3CCM I;  2A5W A;  4IRH A;  5GP9 A;  1SD5 A;  4P5O A;  2A3S A;  3AKZ A;  4AIK A;  3IC7 A;  4ZH4 F;  1HCR A;  2DO7 A;  2L01 A;  4O3M A;  2EZL A;  3JTG A;  1X1P A;  2W24 A;  1ON1 A;  2XDV A;  4ZTJ A;  5HOO A;  5LRR A;  3E0J B;  2WWY A;  4KFC A;  5IYC J;  5D6E A;  2K4J A;  3OIO A;  4CSW A;  4GFB A;  1OJL A;  3CES A;  5LGN A;  3BG6 A;  3MKL A;  2JTV A;  3EET A;  3S2W A;  3W6J B;  4AIH A;  2DW4 A;  1X3U A;  3FMS A;  2WAF A;  4I09 A;  1R7J A;  3HOU J;  5FJ8 J;  1MDM B;  1J0R A;  1KZH A;  2A68 F;  1B72 A;  3PQJ A;  4A3E J;  1ZRD A;  2F5V A;  4UVC A;  2W4S A;  1BR1 A;  3LA3 A;  4HX8 A;  2L4A A;  3RKX A;  3VEP A;  1XDU A;  5GPC A;  2CS3 A;  3CCL I;  3RDI A;  4IPA A;  3KYD B;  4XQF A;  1IG7 A;  2LR8 A;  4BBS J;  2P8T A;  2LY9 A;  1K61 A;  1FY7 A;  4II2 A;  3RJP A;  1DPR A;  2DJI A;  3F22 A;  3SDG A;  3MKZ A;  5ILS A;  3HKZ A;  2DCE A;  1Q1H A;  4QIW N;  2GZW A;  4GO1 A;  3KEQ A;  4A5N A;  1Z21 A;  2QSG X;  1BC8 C;  1ZH5 A;  1K7A A;  2HOA A;  4DYQ A;  3KLO A;  2XSJ C;  5FRO A;  1EH8 A;  3A03 A;  2DA1 A;  2KIS A;  3PSI A;  1X2N A;  3BG9 A;  1QVU A;  5C44 J;  3MKY B;  3VYU B;  4HLX A;  1Y1W J;  4CCO A;  1A31 A;  1SMY F;  2DA3 A;  2XAH A;  3ZMU A;  5BOX A;  3KYC B;  5E1X A;  3OYF A;  4XKC A;  1V55 H;  4N4N B;  2L54 A;  1IAW A;  4GXO A;  2DFI A;  4MFE A;  2NVT J;  3G1L A;  3M1E A;  2LKP A;  3FWE A;  3JAM Z;  5IP6 A;  1VQP I;  3O2P E;  4B8X A;  1HDD C;  3AG2 H;  3I59 B;  4LK1 F;  4FIS A;  4L5I A;  3PIO F;  5D8K B;  3A2K A;  2E7W A;  4KIF A;  1AHD P;  1ZG3 A;  1BC7 C;  3FZV A;  5D5U B;  1CGP A;  4UY8 I;  1OPC A;  1DDN A;  2M8G X;  1YS6 A;  5DS9 A;  3OYC A;  2WB1 N;  4QTR A;  3FBN B;  1W4M A;  4PJM A;  4M3G A;  1LFB A;  1NK2 P;  1UST A;  2QKM B;  3E6D A;  1Z1D A;  4F92 B;  4OAZ A;  4RB1 A;  4MEX F;  3BZK A;  3A02 A;  1FX7 A;  2VKD A;  3BR3 A;  4I0A A;  5GTH C;  1HA8 A;  1LNW A;  4XLN F;  2CQK A;  5CQE A;  4IF4 A;  1BA5 A;  1TLH B;  4E7L A;  1T98 A;  4XLC A;  5JLX A;  3BG7 A;  4IRG A;  4NC8 A;  1RRJ A;  2A6H F;  4IQJ A;  2NS0 A;  4RGU A;  1RNL A;  3AAF A;  1H88 C;  3K0L A;  3PFI A;  2E5Z A;  3WTW C;  1ETV A;  4BQA A;  3K4N A;  4XSZ F;  3DXJ F;  4W1U A;  4HNU A;  2EV0 A;  3QPH A;  5F1J A;  4B43 A;  4CO8 A;  2WAQ A;  2PMU A;  4Z6Y A;  3PQK A;  2WY8 Q;  1RET A;  1YYV A;  3BT9 A;  4MO7 A;  1A04 A;  2XHK A;  3PFY A;  3R6S A;  3SZG A;  2O5R A;  2Y75 A;  3W2V A;  4GGG A;  1TQM A;  4N4O B;  1BJA A;  2EH3 A;  3G1O A;  5BS6 A;  2H1L A;  2R5Z B;  1S6L A;  1CQT A;  1B4A A;  2IVM A;  2BOL A;  2EV5 A;  5E3N A;  3CDL A;  1MJ9 A;  4IOA F;  1UHW A;  2ZKZ A;  1WI3 A;  2MG4 A;  4F93 B;  3F8C A;  1F5T A;  2CV1 A;  3ECH A;  3H5R A;  4NNJ A;  4ENM A;  1RR7 A;  4CH7 A;  3I9V 2;  3R4K A;  1JHH A;  2XPV A;  1W0U A;  3MAJ A;  5J8F A;  4BHB A;  2KJC A;  5KVR A;  2QUF A;  3NQO A;  4KIC A;  2H6C A;  3DBH B;  3G3Z A;  1DU6 A;  2VBW A;  2Z9O A;  4FHT A;  5DM7 F;  5CLS A;  2Y69 H;  3FXO A;  2XAS A;  3GXO A;  4KN4 X;  2V1X A;  4M3B A;  3JRG A;  1GV5 A;  3AL0 C;  1SMT A;  4LIU A;  1FBU A;  4BAY A;  2HNH A;  4M6X A;  3WE2 A;  1TWC J;  1PDN C;  5H20 A;  3A0H C;  2R7W A;  2BZT A;  1O3Q A;  4ESF A;  1I6H J;  2OF7 A;  3K4J A;  5DYM A;  2IGO A;  3FK7 A;  3A4C A;  3DKY A;  5CYV A;  2F4O B;  3H92 A;  1PUF A;  2BXZ A;  1MNM C;  3L7W A;  2FE3 A;  2ZB9 A;  2W00 A;  2VT2 A;  1TW2 A;  1RKW A;  3DTI A;  4HEA 2;  5DD4 A;  4N9H A;  4ZDL A;  1I3A A;  2M3A A;  3ASN H;  4F55 A;  3DV8 A;  2CQQ A;  4L5E A;  5J1U A;  2HEO A;  5D8L B;  1HF0 A;  3X2Q H;  3HOW J;  2GIV A;  2P7C B;  3BR5 A;  4ZDP A;  3PUB A;  3Q0W A;  3MZ8 A;  2HQN A;  3HEF A;  4HNT A;  1VQ7 I;  2LTP A;  1LJ9 A;  2L5Q A;  3CCR I;  2VC1 A;  3QP5 A;  4HX4 A;  2DYR H;  3LFK A;  2KIF A;  4ASN A;  3OY9 A;  1HDP A;  2O8X A;  2L9R A;  1FYK A;  1HLV A;  1K4T A;  1V5E A;  1JTX A;  3J7A O;  3DBR B;  4FAS D;  4P9U A;  1YO5 C;  2K02 A;  1A5J A;  4L9T A;  2B0L A;  4B4C A;  3D5S C;  1P6R A;  4L5J A;  2BW3 B;  3FDY A;  4I2O A;  2X6X A;  2V7F A;  3H5N A;  1H89 C;  4XOP A;  3IHU A;  2JPB A;  2ZJQ F;  1LB2 A;  2VQG A;  3GFJ A;  3ZN1 A;  3SJM A;  1FBQ A;  1DQU A;  2LK2 A;  5E79 C;  5LEJ A;  4A12 A;  1N77 A;  2KIM A;  3I59 A;  4CIC A;  2L2O A;  4DJA A;  2JVG A;  2M4G A;  3TMO A;  3A01 B;  4PFP A;  3BQZ A;  3BR1 A;  2ECB A;  4BU2 A;  2VPR A;  4U87 A;  4ZYD A;  2DDA A;  1JI8 A;  4HAM A;  1O3R A;  4LOC A;  4IHW A;  3O8G A;  3OSF A;  5JHU A;  4DBQ A;  2I5U A;  4RM2 A;  2BE5 F;  1QZY A;  3FMR A;  4B44 A;  2E60 A;  3I55 I;  3OYB A;  2HQR A;  3QU3 A;  1ULY A;  2GM4 A;  1TWF J;  2M0M A;  4B47 A;  3CCQ I;  2JWT A;  2XV4 S;  5CVV A;  2JA6 J;  2J5P A;  1ZG1 A;  1O7L A;  3I56 I;  1IDY A;  3O8H A;  1NG6 A;  2VXZ A;  5LGU A;  1OCC H;  3HRU A;  2H8R A;  3B73 A;  1O7F A;  2VBZ A;  4ABZ A;  2QBY A;  1D5V A;  3HRT A;  4IEJ A;  3GTP J;  2UWM A;  4UVB A;  2OU2 A;  1KGS A;  1VFC A;  1LDD A;  1R22 A;  1F9N A;  3HGG A;  4IHY A;  4NQW B;  4F91 B;  1APL C;  2YR2 A;  3CC7 I;  3U1D A;  1QA6 A;  4NUB A;  4PJJ A;  3QPS A;  2FJ1 A;  1AOY A;  3R60 A;  2K40 A;  1IN8 A;  5DEQ A;  2DDB A;  1D5Y A;  2R0Q C;  4CCJ A;  4FET A;  2KFD A;  2L9S A;  2B63 J;  1S7O A;  1T0F C;  3ABK H;  4G7O F;  3Q0U A;  2QKL B;  4I76 A;  1MMD A;  3VYS B;  2M8E A;  1OIS A;  3T8T A;  2BVL A;  5FRM A;  2R5Y A;  4LMY A;  5B1A H;  2HOE A;  2HPI A;  4IRI A;  5D5W B;  1DP7 P;  3L2W A;  2VXD A;  1GVJ A;  4EJU A;  1MBH A;  2FQ4 A;  3HSF A;  4PJ0 C;  2E1M B;  4LLG F;  2HVS A;  2V9V A;  4LJZ F;  2R93 J;  1Y1V J;  3TO6 A;  2JA8 J;  1WHU A;  3HKZ N;  4G7Z F;  4RAG A;  1P4X A;  2MW8 A;  2QCO A;  2ZXW H;  3CO7 C;  2RQQ A;  3I3L A;  2E2J J;  1PJR A;  2K27 A;  3NAR A;  1IV8 A;  4XK4 A;  3LQR A;  1PVE A;  1D1A A;  3JAM K;  5HNF A;  5FLV A;  4BY7 J;  2O0Y A;  1G2H A;  1XX5 A;  2DQL A;  3LSP A;  2PEX A;  1B8I A;  5DCM A;  3ESW B;  4ZZL A;  2P6S A;  1P7I A;  1X1D A;  2XKP A;  3KE2 A;  4FX0 A;  2F5E A;  5EJC A;  1PYV A;  3E5X A;  3OIQ A;  3U21 A;  4AD9 A;  5E20 A;  1VQO I;  2PN6 A;  1S29 A;  2MFZ A;  3KEY A;  1JKR C;  2RNG A;  3B02 A;  5F0F A;  5M5X J;  3H3V K;  2XF7 A;  1SVM A;  2RAE A;  2EFW A;  4LD5 A;  3TQN A;  2VAS A;  4A2U A;  5CJ9 A;  1W7P D;  1QZE A;  4UB8 C;  4ENN A;  3GYH X;  5IOZ A;  3Q9V A;  2LYC A;  2QA4 I;  3I64 A;  4XNF A;  2A6E F;  3WTX C;  1FOX A;  4OMY A;  2R7O A;  1OR7 C;  3F6O A;  4LLN A;  1BOB A;  1JGS A;  1NH3 A;  2UZK A;  1J2X A;  3W6K B;  2VPL A;  2LG4 A;  4CCN A;  3OIP A;  2LFB A;  5FKL A;  3CUO A;  2CW7 A;  3L2V A;  3SFZ A;  1Z91 A;  1Z67 A;  3DLA A;  2LKX A;  1Z9C A;  4QPQ A;  3PNV A;  2WV0 A;  4PFO A;  1ETQ A;  3CCE I;  5GAG J;  4OIO F;  2JUC A;  4BQN A;  1ENH A;  4BGD A;  4MNU A;  5LD2 C;  2VE9 A;  4JYK A;  5CVU A;  1TL8 A;  1T39 A;  4BXU A;  4YG2 F;  3QU6 A;  2Z5U A;  1K4S A;  1EJ9 A;  4HDV A;  5J47 A;  1ACI A;  1WVR A;  3TO9 A;  2IS6 A;  2J5O A;  3S3N A;  4XIC A;  3HG9 A;  5HLH A;  2O7O A;  1IN7 A;  4PZJ A;  4DBR A;  4UHT A;  5B5E C;  3BR2 A;  4Y15 A;  1WJ5 A;  2UXX A;  3K4L A;  2L7K A;  3EUK L;  3CJT B;  2KIQ A;  3OSG A;  1H9T A;  2MH9 A;  4UV9 A;  2ME6 A;  1OR7 A;  3CJQ B;  1R9T J;  1AWC A;  4RGR A;  1SAU A;  3GTK J;  2DYS H;  3MN2 A;  2XF6 A;  1JUM A;  2K9Q A;  2V1N A;  3LWF A;  3F3X A;  2IXS A;  5HS9 A;  2KP6 A;  2RRE A;  4C3J J;  1HKT A;  4BJT A;  5FO5 A;  1ZLK A;  2E35 A;  2FX0 A;  2I8D A;  3HYI A;  1XMX A;  4BXF A;  4CCL A;  3QAH A;  2HGC A;  2BW3 A;  2JSC A;  2OC6 A;  5L3F A;  3HTS B;  4IKF A;  2KZV A;  4RAF A;  4BL0 B;  4A3K J;  4XLH A;  1ONV A;  2FBK A;  1R1T A;  3FX3 A;  2LY2 A;  2Y0M A;  4PJL A;  1FPQ A;  3OYN A;  3RZD J;  1FLI A;  2LLK A;  1OCO H;  3DPL C;  3JRH A;  3CC4 I;  2R7T A;  1G8X A;  2A07 F;  4AID A;  3QWL A;  4HV5 A;  3GX4 X;  2QQB A;  1IZ1 A;  2L02 A;  1ZGW A;  1HW1 A;  5IT3 A;  9ANT A;  3KP4 A;  2IT0 A;  3BJO A;  3CP2 A;  1K83 J;  1FP2 A;  2NS8 A;  4U0Y A;  1Q1V A;  3HHG A;  3MQ0 A;  2ZNZ A;  2XC7 A;  3CD6 I;  2L7F P;  3DU6 A;  4OWR B;  4LK0 F;  3CC2 I;  5EF6 A;  4PCQ A;  4HNV A;  5HDK A;  2A6T A;  2FNP A;  4MQ9 F;  5BPI A;  4Y4R A;  5CVR A;  1OKR A;  3OS1 A;  3KEO A;  2ADU A;  2Z1D A;  3I4N J;  3LQQ A;  3K10 A;  4QWQ A;  2M7A A;  4HV6 A;  4HF2 A;  2VOP A;  2HU9 A;  3K1M A;  5LHH A;  4A3D J;  2DOE A;  1UEL B;  5BNG A;  1K78 B;  2R7S A;  4RAY A;  3GFI A;  1AA7 A;  4Q5S F;  1QZZ A;  2R7D A;  2VKE A;  1TP4 A;  1HW2 A;  4XLF A;  1OYY A;  2VBY A;  1P4W A;  2MBF A;  3GZ5 A;  2HYF A;  2XIG A;  2HPM A;  1JT6 A;  1VQ5 I;  3D1N I;  2HWV A;  2L7Z A;  2JSP A;  4CZC A;  1X2M A;  5IOY A;  2JUG A;  3QOP A;  2ZXJ A;  3H5A A;  4MTD A;  2XPW A;  2COM A;  4LG3 A;  1UZC A;  5KHD A;  2DOA A;  1N75 A;  4M3F A;  4BE2 A;  4V2G A;  3QYF A;  2V1D A;  2E1C A;  5E3M A;  2IA2 A;  2F5D A;  4A6D A;  3S32 A;  2FXA A;  2HDD A;  3GCM A;  4L9N A;  5HDN A;  1OLT A;  1KYW A;  5K5Q A;  4QLC U;  3OWT A;  3U1K A;  1B6A A;  2K9M A;  2KL4 A;  1HKS A;  2STT A;  4I01 A;  2UV1 A;  3GZN B;  2XGE A;  3AG1 H;  1J75 A;  2V1U A;  2CYY A;  3CUQ B;  4UXN A;  1FNN A;  4ZYG A;  2GLO A;  3CCY A;  1D0Y A;  3AFH A;  4EQQ A;  5EEH A;  2E1N A;  3QYE A;  5L3G A;  5D4R A;  4HZF A;  2GXG A;  1IRF A;  2OZU A;  2HDW A;  3L2R A;  3LSG A;  3QYB A;  1VQK I;  1I5Z A;  3G6E I;  3HZJ A;  2W84 A;  2IEK A;  1R4N B;  2LOO A;  1SAN A;  4Y17 A;  3H1C A;  3S1M J;  3BJA A;  2Y9Z A;  1D0X A;  3GVA A;  1JHF A;  3L2Q A;  1BIA A;  2PMH A;  4RMN A;  3JRF A;  3S1R J;  3IV5 A;  2DFE A;  4G7H F;  4BXX J;  4RB3 C;  2AQF A;  2ZME A;  4BQQ A;  1IV6 A;  1FIA A;  2O61 A;  3CME I;  1BR2 A;  3KYL A;  2VKV A;  3OR1 C;  4NC7 A;  2ELH A;  2GXA A;  2EK5 A;  4HF1 A;  4B3A A;  1U3E M;  4Y3O A;  2K5C A;  3RKW A;  3GTL J;  3F8F A;  2H8W A;  4E7K A;  1SFO J;  4IHX A;  2MC4 A;  2LNB A;  4LGW A;  4DNC A;  2XGC A;  2X6W A;  2QGU A;  4UUV A;  1MND A;  3DKX A;  1S9H A;  5BQT A;  3J80 K;  1R5I D;  1T38 A;  3A01 A;  2PJR A;  3CF5 F;  2Q0O A;  4HW0 A;  2HKO A;  4NB5 A;  1OYW A;  1FYM A;  2FMY A;  2EZH A;  4Z2Y A;  2HOS A;  2V9K A;  2NRA C;  2AHQ A;  3RZO J;  3A0B C;  4JX4 A;  5J3L A;  2EPF A;  4A0X A;  1E0E A;  1MMG A;  2M5W A;  4CUG A;  2JRT A;  2W25 A;  1U0J A;  5C4X J;  3H3Z A;  3LFU A;  4EJV A;  2RNJ A;  2WAD A;  1W7P A;  1EH7 A;  2IA1 A;  4ESJ A;  3VOD A;  3VPR A;  1YTY A;  3TGN A;  1X4P A;  4MIM A;  4HPQ A;  1R1U A;  1MD0 A;  2G0E A;  1G3W A;  2P0W A;  4FT8 A;  5IY5 H;  3HTU A;  3RIR A;  3VYT B;  2ISZ A;  2R7Z J;  3CCS I;  5EDN A;  1LDK B;  3WTS C;  4AWX B;  4LLL A;  4KYW A;  1ZHF A;  2BV6 A;  3M7G A;  3C2G A;  2KRC A;  4BUP A;  4MFD A;  3VB2 A;  3K4C A;  1XC5 A;  3DFG A;  2STW A;  1QVT A;  2C6Y A;  4ZYE A;  3PO3 J;  4PSX A;  2EA2 A;  3G1M A;  3BQY A;  1RR8 C;  2HI3 A;  1P4A A;  3IAS 2;  4FE7 A;  1TC3 C;  2ECC A;  4F52 A;  2QSH X;  2CV0 A;  3ONQ A;  4CYD A;  3FMQ A;  4HLY A;  2QSF X;  1YG2 A;  2VLA A;  3K69 A;  3ZQC A;  4C3I J;  1KYZ A;  3RKQ A;  2LP0 A;  4ENJ A;  3M4O J;  5FLX Z;  3GFL A;  2D45 A;  3RTR A;  1S7E A;  4RAZ A;  1IF1 A;  3WGH A;  1IXR C;  1FWZ A;  3DTK A;  1OCP A;  2EIN H;  1MDM A;  1I6X A;  2ZC2 A;  3S14 J;  1B72 B;  2MGQ A;  3CUQ A;  4ITV A;  1MMS A;  5L3B A;  2ZJ2 A;  1WZ2 A;  1Z3X A;  3HUG B;  3EUH A;  3IH2 A;  1R49 A;  4XRS A;  1W5S A;  1BL0 A;  5E3O A;  2O8K A;  1VQM I;  1P9Q C;  3DU5 A;  2BGC A;  3GTJ J;  3WTT C;  2KDZ A;  2G9W A;  3H35 A;  3NRV A;  3MEX A;  1RI7 A;  5KNL A;  2B9S A;  1YS7 A;  2OJE D;  4EJT A;  3VDX A;  4BYY A;  1AU7 A;  1OCZ H;  1FTT A;  2BY1 A;  2P7V B;  2ESN A;  4P9F A;  2ZJP F;  1T2K A;  2KKO A;  5M5Y J;  4BAC A;  2COB A;  2DXI A;  5FB2 A;  4JX5 A;  3U9G A;  1FC3 A;  2NOJ B;  3HHH A;  4G12 A;  3OL4 A;  3Q5F A;  1VQ6 I;  5B1B H;  3GF2 A;  3E5U A;  3TL4 X;  1MBG A;  2HXO A;  3HOV J;  5LHI A;  2R7X A;  5DDG A;  1BJZ A;  4DIQ A;  2VI6 A;  1HC8 A;  3ULQ B;  3M9A A;  2N8G A;  2HDC A;  3EPZ A;  5FFZ A;  4X6A J;  2V4J C;  5EGO B;  1T08 B;  3HOS A;  2M0C A;  2VQH A;  2HZT A;  1ETX A;  1IRG A;  3MZH A;  4IVN A;  1Y56 A;  2UUZ A;  1W36 D;  4G94 A;  1Z7U A;  2KHM A;  2FRH A;  3W2A A;  1F4K A;  4OMZ A;  5F0H A;  3WG7 H;  2CV2 A;  2W7N A;  3SEQ A;  2Q1Z B;  5HOD A;  4PGG A;  1XMA A;  4RBO A;  3ZN0 A;  1HOM A;  3MWM A;  3ZOB A;  3HPG A;  4OIR F;  1W1W E;  4IL6 C;  1U2W A;  3JW4 A;  5CQG A;  3REO A;  2PMZ N;  2PBI A;  2OTL I;  2MYS A;  1EF4 A;  1F36 A;  3MZY A;  3ZMD A;  1IW7 F;  1MBE A;  1UHM A;  3D5R C;  3WU1 B;  2Q2E A;  3CF2 A;  3TOB A;  1XPX A;  1WGX A;  2ZCW A;  1Y6I A;  3GME A;  3NWS A;  2XPU A;  3OYE A;  4L18 B;  2OQG A;  5E8I A;  4KIT B;  2DOF A;  2EIK H;  3O6B B;  4BEH A;  3O3K A;  1BI0 A;  3BOQ A;  2H94 A;  2LC2 A;  3BY6 A;  1TQI A;  3FIW A;  1A6I A;  2E34 A;  4AM3 A;  2MLK A;  2CU7 A;  4H4K C;  2CW0 F;  3WTU C;  3HXL A;  2R7F A;  3L00 A;  1GVD A;  1TW3 A;  2HKX A;  1FSE A;  4XL9 A;  5H6Q A;  4P96 A;  2ACJ A;  3SDB A;  2DA5 A;  3LAJ A;  5FD5 A;  3H0D A;  3C7J A;  1IN5 A;  4MLO A;  4B48 A;  2X48 A;  1E3O C;  3DPT A;  2E36 A;  1FP1 D;  1LEA A;  3S1Q J;  4M72 A;  1H9G A;  3OYA A;  2F48 A;  5GAE J;  1HKQ A;  1LQ1 A;  1JKO C;  1JXS A;  4M9Z A;  1IUF A;  1XN7 A;  3J7Z I;  2NNY A;  3QQA A;  1NHA A;  4UUS B;  2EZI A;  1ZK8 A;  2FA5 A;  2LMD A;  3CJR B;  3MVP A;  4OU0 A;  5JR3 A;  3KET A;  4EVI A;  1XMK A;  1FYL A;  3FBI B;  4XON A;  5LGT A;  4OIP F;  2H09 A;  2BY2 A;  3IH4 A;  5TGT A;  5JLW A;  1R58 A;  2JN6 A;  1YFH A;  4IOC F;  2MD5 A;  5EG0 B;  1EKE A;  1A6Q A;  3ZMT A;  4D7N A;  1VTN C;  3CLQ A;  2M45 A;  4E7H A;  1LE8 B;  1K79 A;  4BJ6 C;  4X1E A;  3BG5 A;  1WRJ A;  2DPD A;  3V42 A;  4YRV A;  3TOA A;  3RPQ A;  5DCF A;  1H0M A;  2FUG 2;  3CO6 C;  5EEA A;  2F4M B;  1YRN B;  3C18 A;  1IUY A;  4BEH B;  4TV7 A;  3B6A A;  4WF2 A;  1GDT A;  1ORK A;  4FQG A;  2Q2E B;  5L3D A;  2KMU A;  3FXK A;  3V8L A;  2AQE A;  5JFR A;  2QM3 A;  1U78 A;  3RPU A;  2GOM A;  4ZDO A;  2JA7 J;  3KZY A;  1X19 A;  2DFH A;  1Z3Y A;  2B7E A;  4DW6 A;  1KU7 A;  1B8I B;  4J00 A;  3GTM J;  1WH5 A;  2M7B A;  4M71 A;  2ZSI B;  2XGD A;  2DQR A;  2LRD A;  1MZB A;  1BI3 A;  1G59 A;  3HJE A;  5ILV A;  2TRT A;  4IXA A;  3CDI A;  2CFO A;  2F2E A;  3DWL E;  2RVC A;  3SEZ A;  2XRO A;  3PO2 J;  3J80 Z;  4D9J A;  4HQM A;  1REP C;  3F6V A;  3CCU I;  2OCE A;  1G6N A;  1U5T C;  4A3J J;  2QWW A;  3I0T A;  2VON A;  1Y39 A;  5M3M J;  5EEG A;  1GXQ A;  3BTL A;  1V5F A;  3OOU A;  1CF7 A;  2OA4 A;  2HZD A;  5HDG A;  4ANJ A;  3V7C A;  1YHQ I;  3KP2 A;  1MH4 A;  2P81 A;  1ZGJ A;  2R5Y B;  3WU2 C;  2NXN B;  3DP7 A;  3HDD A;  1U6G A;  1V5G A;  1XCV A;  2BEO A;  2XRN A;  2HQA A;  1SD6 A;  2G7U A;  3WOD F;  3PJR A;  3WU0 A;  4A69 C;  1DGW Y;  2FF4 A;  3ZQG A;  3MKW B;  1H8A C;  4D0P A;  3ZPL A;  1DU0 A;  3HRS A;  3W6V A;  4XLP F;  5M3F J;  1VI0 A;  3CJN A;  2XUB A; 
#chains in the Genus database with same CATH homology
 3S2D J;  3JRH A;  2WAQ N;  5IYC J;  3OIO A;  4GFB A;  1OJL A;  4JP0 A;  3MKL A;  4CYC B;  2XB0 X;  4AC0 A;  1IDZ A;  2EZK A;  1ZGW A;  2W48 A;  1O4X A;  3JRD A;  9ANT A;  3HOU J;  5FJ8 J;  5IYD J;  1K83 J;  1B72 A;  4A3E J;  1T33 A;  3S16 J;  1RKT A;  2NS8 A;  1Q1V A;  5GPC A;  3FIS A;  2VUM J;  2L7F P;  1ZR4 A;  1ETO A;  1IG7 A;  2O9L A;  2LR8 A;  4BBS J;  2LY9 A;  4FCY A;  1K61 A;  1WH7 A;  5EF6 A;  3GTO J;  5F27 A;  4HNV A;  3SDG A;  2NVY J;  2DMU A;  3H0G J;  5FKK A;  4A3B J;  3I4N J;  4QIW N;  2M9H A;  4FTH A;  4A3D J;  5BNG A;  2NVQ J;  4UUT A;  2HOA A;  5F08 A;  4DYQ A;  1ITY A;  2GBY A;  2VKE A;  1TWH J;  2DMN A;  3A03 A;  2DA1 A;  1X2N A;  1JT6 A;  3BG9 A;  4UUS A;  3D1N I;  2L7Z A;  2R5Z A;  5IOY A;  1X2M A;  2ME0 A;  5FKM A;  4XRS G;  3ZQL A;  1QVU A;  3C2B A;  5C44 J;  2DTZ A;  2H1K A;  1Y1W J;  2XPW A;  4DZJ A;  2DA3 A;  4M6V A;  4M3F A;  4V2G A;  1PUF B;  5E3M A;  5K7H A;  4MFE A;  5DTD A;  2HDD A;  2NVT J;  3G1L A;  1FJL A;  5IP6 A;  1FTZ A;  1HDD C;  2CRG A;  2D5V A;  2X9D A;  4FIS A;  1ZKG A;  2XGE A;  3BG3 A;  1AHD P;  1VND A;  2GLO A;  2M8G X;  3CCY A;  5DS9 A;  2WB1 N;  4QTR A;  2EQR A;  5J1R A;  3K7A J;  4M3G A;  1LFB A;  1FIP A;  1NK2 P;  1I50 J;  3UKG A;  3LSG A;  1GUU A;  3A02 A;  4A3I J;  3BR3 A;  1JUS A;  1JUP A;  4A3L J;  2IEK A;  3S15 J;  5FKN A;  1BA5 A;  1SAN A;  3HGY A;  5JLX A;  3S1M J;  2Y9Z A;  1ETW A;  3HOY J;  3LSR A;  4C3H J;  3S1R J;  3JRF A;  4V2F A;  4I6Z A;  3IV5 A;  1IC8 A;  3F0C A;  4BXX J;  1IV6 A;  1FIA A;  2Y31 A;  1H88 C;  2VKV A;  2K9S A;  1ETV A;  1POG A;  4J19 A;  4W1U A;  3JR9 A;  5EZG A;  4B3A A;  5F1J A;  5C4J J;  1RET A;  3GTL J;  1IGN A;  3BTJ A;  1SFO J;  3BT9 A;  2M34 A;  2DMT A;  4IHX A;  4MO7 A;  3FK6 A;  3IH3 A;  1ETY A;  2XGC A;  4C2M J;  2E19 A;  2I10 A;  1OFC X;  2EH3 A;  3G1O A;  2R5Z B;  3BTC A;  3BR6 A;  1CQT A;  3WHB A;  3A01 A;  1JGG A;  5E3N A;  3CDL A;  2EZH A;  2HOS A;  3ZQH A;  1WI3 A;  2MG4 A;  2DA4 A;  2AHQ A;  3RZO J;  4JX4 A;  5J3L A;  1RR7 A;  2XPV A;  1W0U A;  5C4X J;  3HBL A;  1DU6 A;  2WV1 A;  1ZQ3 P;  3VPR A;  3TW6 A;  4MIM A;  2G0E A;  2NVX J;  3ZQF A;  2R7Z J;  4BY1 J;  3Q0V A;  4M3B A;  3JRG A;  2XSD C;  5EDN A;  3CMY A;  1GV5 A;  2IAI A;  1UMQ A;  1TWC J;  4MFD A;  2L7M P;  5GPA A;  1XC5 A;  5F0C A;  1QVT A;  3WHC A;  1I6H J;  2OF7 A;  3PO3 J;  3G1M A;  4FE4 A;  1TWG J;  3TW7 A;  4JX6 A;  3BQY A;  1VF9 A;  2HI3 A;  2ID3 A;  2L0K A;  3FK7 A;  4BBR J;  4DYC A;  5FKO A;  4FE7 A;  1TC3 C;  2ECC A;  3TP0 A;  1PUF A;  1MNM C;  2ZB9 A;  4AYB N;  2X6O A;  3JRA A;  2KT0 A;  1RKW A;  3ZQC A;  4C3I J;  3RKQ A;  2LP0 A;  2DA6 A;  4EEF G;  1T56 A;  3M4O J;  2FD5 A;  2CQQ A;  2DMP A;  4L5E A;  1Z77 A;  5J1U A;  1S7E A;  1HF0 A;  1MSE C;  5J1Y A;  3HOW J;  1BW5 A;  4D7M A;  3BR5 A;  1OCP A;  1RPW A;  3Q0W A;  3S14 J;  1B72 B;  2MGQ A;  3HEF A;  2LTP A;  3IH2 A;  5EZH A;  1JT0 A;  4XRS A;  5IPA A;  1BL0 A;  5E3O A;  2O8K A;  4A3G J;  1ETK A;  4DYR A;  1QPI A;  2DJN A;  2XRL A;  3GTJ J;  1U9N A;  2KDZ A;  1HDP A;  5EYR A;  2L9R A;  1HLV A;  1JTX A;  1ZR2 A;  1A5J A;  3QPL A;  4DZP A;  4B4C A;  1AU7 A;  4M3D A;  2HOT A;  1FTT A;  1TWA J;  1JKQ C;  3GBG A;  1H89 C;  4D5C A;  1BW6 A;  1U9O A;  5M5Y J;  4W97 A;  2DA2 A;  3M3Y J;  2COB A;  3SJM A;  3RQI A;  2LK2 A;  4JX5 A;  1MBF A;  4XID A;  1IRZ A;  4G12 A;  3JRC A;  3A01 B;  4D5F A;  3BQZ A;  3BR1 A;  2ECB A;  3BTI A;  2YU9 J;  1MBG A;  2HXO A;  2VPR A;  1AKH B;  3HOV J;  1LFU P;  2E1O A;  1BJZ A;  2DA7 A;  2VI6 A;  4LOC A;  3CQZ J;  4IHW A;  2NS7 A;  3O8G A;  3OSF A;  2N8G A;  1MBJ A;  4X6A J;  5EGO B;  1OCT C;  3GTG J;  2M0C A;  1ETX A;  4AUX A;  2GM4 A;  1TWF J;  2JWT A;  2JA6 J;  2MSY A;  2JA5 J;  2YS9 A;  3DEW A;  1IDY A;  5F0H A;  3O8H A;  4BKX A;  1UHS A;  1W0T A;  5HOD A;  2LD5 A;  2JJ7 A;  2M2E A;  2H8R A;  4RBO A;  1HOM A;  5F04 A;  4ABZ A;  3ZOB A;  3PM1 A;  4IEJ A;  2R92 J;  4M3E A;  1VFC A;  2CUE A;  2PMZ N;  1XG1 A;  3HGG A;  4IHY A;  1F36 A;  1APL C;  1MBE A;  1XS9 A;  1WGX A;  1WPK A;  2XPU A;  1MBK A;  3QPS A;  2FJ1 A;  3E7L A;  1UG2 A;  2ELK A;  2K40 A;  1RES A;  5IP9 J;  1D5Y A;  3FIW A;  1A6I A;  2R0Q C;  3ZQI A;  5IP7 J;  2IBD A;  2CU7 A;  4S0H B;  1P7J A;  3HM5 A;  2B63 J;  4NDL A;  2NOG A;  3S1N J;  1GVD A;  3Q0U A;  5FLM J;  4I76 A;  1LE8 A;  2E2H J;  2E2I J;  2DA5 A;  4QSH A;  2R5Y A;  3GTQ J;  3LNQ A;  3HOZ J;  4MLO A;  1I3Q J;  2X48 A;  1E3O C;  3L1P A;  2TCT A;  3JRB A;  4Y52 J;  3S1Q J;  1MBH A;  2FQ4 A;  3FKI J;  2QF7 A;  2CUF A;  2R93 J;  1Y1V J;  2JA8 J;  3HKZ N;  1JKO C;  2ID6 A;  2QCO A;  2MW8 A;  1MSF C;  2E2J J;  1IUF A;  3TP3 A;  3QQA A;  4XK4 A;  3NAR A;  1IJW C;  5M5W J;  4Y7N J;  4UUS B;  2EZI A;  2Y9Y A;  4A3F J;  1ZK8 A;  3MVP A;  1QRY A;  4BY7 J;  5FLV A;  3Q3S A;  1G2H A;  1GT0 C;  1AKH A;  3BR0 A;  3LSP A;  1B8I A;  3GTP J;  1EF4 A;  1P7I A;  3IH4 A;  5JLW A;  1NK3 P;  4A3C J;  2JN6 A;  3S2H J;  2Y2Z A;  2CJJ A;  5EG0 B;  1JKR C;  5M5X J;  4D7N A;  5F0F A;  3K2A A;  1LE8 B;  3H3V K;  1F43 A;  4X1E A;  3BG5 A;  4CYC A;  1GV2 A;  2RAE A;  2JMW A;  5K7Z A;  5EEA A;  1YRN B;  5IOZ A;  3NAU A;  1JKP C;  2LVS A;  1GDT A;  3B6A A;  1ORK A;  2XB5 A;  4B1R A;  2LFB A;  5FKL A;  4RDU A;  3HOX J;  3LSJ A;  5EG0 A;  2CQX A;  1U78 A;  2OPT A;  1U8B A;  2AO9 A;  1ZTR A;  2EBI A;  4XRM A;  2LKX A;  4IHV A;  2JA7 J;  4A3M J;  5IYB J;  1ETQ A;  4DW6 A;  1B8I B;  3GTM J;  1ENH A;  1WH5 A;  4JYK A;  1JTY A;  5E3L A;  2XGD A;  3LOC A;  5C3E J;  3HB9 A;  1NTC A;  2TRT A;  1X58 A;  3B6C A;  3DCF A;  2YUS A;  4XIC A;  2JK3 A;  2O7O A;  5K7F A;  3SFI A;  1YRN A;  3PO2 J;  4A3J J;  3BR2 A;  2HYJ A;  5M3M J;  3OOU A;  3BTL A;  2Y30 A;  1MH3 A;  2K9N A;  1WCM J;  3OSG A;  3TED A;  2ME6 A;  3S17 J;  1MH4 A;  1R9T J;  4A93 J;  2P81 A;  2R5Y B;  3GTK J;  2DN0 A;  3JRI A;  3JRE A;  3MN2 A;  1JUM A;  3HDD A;  2K9Q A;  3I4M J;  2HXI A;  4C3J J;  2Y0S N;  1FEX A;  2FX0 A;  5GP9 A;  4A69 C;  2DMQ A;  3ZQG A;  1H8A C;  4A3K J;  1JJ8 C;  2HQ5 A;  1HCR A;  1Z0X A;  1DU0 A;  3W6V A;  2EZL A;  5EGO A;  5M3F J;  1VI0 A;  3RZD J;  2LLK A;  1JJ6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...