1AKHB

Mat a1/alpha2/dna ternary complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhB00
4XRMA 3LOCA 3OSFA 3H3VK 2JWTA 2O9LA 1TWCJ 1ZR4A 5EGOA 5C44J 2D5VA 2VKEA 5E3LA 5K7FA 2GLOA 4MFEA 1IJWC 3IH2A 4A69C 4C3HJ 3GTJJ 4B1RA 3S16J 4DZJA 2I10A 3ZOBA 4B4CA 3HOZJ 2LR8A 2HXIA 2ECCA 5J1UA 2Y31A 4M3EA 4AC0A 2CUFA 3RQIA 5FLMJ 2JJ7A 1RESA 4V2FA 2CU7A 2XGEA 3HKZN 1FTZA 3FISA 5C3EJ 5F27A 5GPAA 5DS9A 2L7FP 3BR3A 4XRSG 2MSYA 3S1QJ 2M2EA 1NK2P 1ENHA 1AKHB 2Y0SN 5DTDA 1EF4A 2K40A 2PMZN 1Z77A 1RKWA 4IHWA 3S14J 4A3DJ 1JUMA 3BG5A 4NDLA 1MBJA 1TWFJ 2OF7A 4BBRJ 2TRTA 1TWGJ 1IC8A 1HLVA 2EBIA 1RR7A 1U8BA 1JGGA 1U9NA 4C2MJ 4EEFG 4BY1J 4MFDA 3GTQJ 2N8GA 2DMUA 2NS7A 4A3CJ 1O4XA 3A03A 4XIDA 4UUTA 2KDZA 1B72B 1ETYA 5EG0A 3A01A 2JK3A 2R93J 2DMTA 3LSPA 1H89C 1BL0A 2Y9YA 2DMPA 2JA7J 1W0UA 1POGA 4AYBN 2HI3A 3ZQIA 3HOXJ 1MBHA 2QCOA 2XPUA 2XGCA 5M3FJ 2JA8J 5M5WJ 1APLC 5FKNA 3Q3SA 2MG4A 3GTPJ 4D5CA 1X2MA 5FKOA 2YUSA 1VF9A 2DA3A 5EZGA 3FIWA 2P81A 2NVTJ 5K7HA 2LP0A 3BT9A 4FE7A 2K9NA 3CMYA 1GV5A 4C3IJ 5HODA 5E3OA 5K7ZA 5EGOB 1OJLA 4BBSJ 5C4XJ 2HQ5A 1WI3A 2DA7A 3MKLA 1S7EA 2GBYA 1FIPA 4BY7J 4JX4A 1T56A 4DZPA 1T33A 3WHBA 4UUSB 1A5JA 4M3BA 4XICA 1U9OA 1JTXA 1FEXA 1WH5A 2JA5J 2X9DA 1B8IA 5IYDJ 5EDNA 4IHVA 4A3FJ 3MN2A 2HXOA 1P7IA 3PM1A 3TP3A 1UHSA 1H88C 3VPRA 4JP0A 3DEWA 4M3DA 2AHQA 2CUEA 2R7ZJ 2HOTA 2IBDA 3S1MJ 2DA1A 2WB1N 2AO9A 4JX6A 3FKIJ 4W1UA 1ZTRA 5IP6A 3W6VA 2CQXA 2OPTA 3K7AJ 1X58A 4FCYA 5C4JJ 1ETOA 1Y1VJ 1W0TA 3L1PA 3BTCA 3JRFA 2NVXJ 3Q0UA 3HB9A 1OFCX 1RKTA 4X1EA 1JT0A 4FISA 1MNMC 2E2HJ 1K61A 3HOVJ 3G1LA 5FJ8J 3BTIA 5IOYA 4XRSA 2YU9J 2Y2ZA 4B3AA 1PUFA 3I4NJ 5IYBJ 4A3IJ 4M6VA 1AU7A 3A02A 1TC3C 1Z0XA 1R9TJ 2HDDA 3TW7A 2L0KA 3C2BA 3LSRA 3BTLA 2LLKA 1P7JA 3D1NI 2L9RA 3HGYA 1NK3P 5IYCJ 3OOUA 4S0HB 3JRHA 3S17J 1BA5A 5JLWA 5J1RA 1ZGWA 2EZHA 2Y30A 2JMWA 3OSGA 2EZIA 2LD5A 1ETWA 2JN6A 4CYCB 4A3EJ 2KT0A 1IRZA 1BJZA 2XSDC 1DU6A 2R5YA 2XB5A 1IV6A 5EF6A 5EEAA 4QTRA 1RETA 1IG7A 4HNVA 4C3JJ 2DA6A 3MVPA 4A3BJ 3BG3A 1MBEA 3S2HJ 3GBGA 3JRIA 3ZQGA 1AHDP 3BTJA 1MSFC 3TEDA 2JA6J 1B8IB 1JKPC 4IHYA 3LSJA 5M5XJ 3GTGJ 1F43A 3HOYJ 2ME6A 4X6AJ 3BR6A 3IV5A 2QF7A 4Y52J 3PO3J 1SANA 2HYJA 1BW5A 3LSGA 5J1YA 2FQ4A 4BXXJ 4GFBA 2DA4A 2FX0A 1JUSA 2M0CA 3RKQA 1IDZA 1ZK8A 1F36A 1I50J 1YRNA 5IP9J 3CCYA 3B6AA 2FJ1A 2M8GX 4J19A 3K2AA 2EZLA 5M5YJ 1VFCA 4QSHA 1LFUP 3SDGA 3PO2J 1LFBA 3Q0VA 2XPWA 2NVQJ 3TP0A 4JYKA 5F1JA 2VUMJ 5EZHA 1ZR2A 1ETXA 4G12A 1FIAA 3JRGA 2W48A 2XB0X 1ZKGA 1JUPA 1ETVA 1WH7A 1XG1A 1HDPA 2RAEA 4A3MJ 1MBFA 3GTMJ 5J3LA 2L7ZA 3F0CA 1A6IA 3QPLA 2ID3A 3S15J 2MGQA 5E3MA 2LKXA 3QPSA 3FK6A 2DA5A 1MBKA 3S2DJ 3ZQCA 1XS9A 2ME0A 4XK4A 1H8AC 2DN0A 3Q0WA 1B72A 1LE8A 1FJLA 2K9SA 1CQTA 4RDUA 1JTYA 3E7LA 4M3FA 1OCTC 1E3OC 3S1NJ 3I4MJ 1GV2A 2VI6A 4DYCA 3UKGA 1UG2A 9ANTA 2ZB9A 3CDLA 4L5EA 4A93J 1IUFA 1DU0A 1TWHJ 2EQRA 5GP9A 3CQZJ 4W97A 4RBOA 2XGDA 1ZQ3P 1QRYA 2K9QA 2L7MP 2DA2A 2CJJA 2LVSA 1HDDC 3HEFA 4MIMA 5JLXA 2O8KA 2R92J 2EZKA 4D7NA 2ECBA 1WGXA 4FTHA 1Y1WJ 2M9HA 3HOWJ 3HOUJ 5EG0B 1WCMJ 3A01B 1JKQC 3HGGA 4JX5A 2R5ZA 1UMQA 1MH4A 4M3GA 5M3MJ 2COBA 4Y7NJ 3JRAA 1QVTA 1QVUA 4UUSA 5IP7J 2NVYJ 2CRGA 4AUXA 2IEKA 4LOCA 3JR9A 1JT6A 2WV1A 3BQZA 3H0GJ 5F0HA 4A3JJ 3O8GA 1OCPA 3B6CA 1QPIA 2E19A 3BG9A 2NS8A 3IH4A 2R0QC 3WHCA 4I76A 3G1OA 1VNDA 1RPWA 2LY9A 2ID6A 1MSEC 3G1MA 2HOSA 4ABZA 1XC5A 5BNGA 2LTPA 1YRNB 3HDDA 2DJNA 4A3KJ 2TCTA 1JJ8C 1GUUA 5F08A 3GTOJ 3M4OJ 2H8RA 2H1KA 3RZOJ 2CQQA 3M3YJ 2IAIA 4V2GA 1IDYA 1IGNA 1GDTA 3BR0A 1I6HJ 4IEJA 3QQAA 1X2NA 2WAQN 3FK7A 2LFBA 3O8HA 4D7MA 1HF0A 1BW6A 4IHXA 2B63J 1D5YA 2M34A 3SFIA 3GTLJ 3BR5A 1HCRA 5FKKA 5IOZA 5FKMA 3OIOA 1MH3A 4DYQA 2VKVA 2DMNA 5F0CA 2FD5A 1ETQA 3RZDJ 2E1OA 2GM4A 1Q1VA 1U78A 1FTTA 3JRBA 1LE8B 5IPAA 2EH3A 3HM5A 3BQYA 5F04A 1TWAJ 3GTKJ 4A3GJ 3IH3A 2YS9A 1VI0A 2ELKA 5FLVA 1GVDA 1ITYA 1AKHA 1ORKA 4BKXA 4I6ZA 2O7OA 5E3NA 1GT0C 5GPCA 1G2HA 4CYCA 3JRCA 1PUFB 4A3LJ 3JRDA 3BR1A 3SJMA 1K83J 1JJ6C 1ETKA 2E2JJ 2E2IJ 4D5FA 1NTCA 2X6OA 2NOGA 2DTZA 2LK2A 1WPKA 2XRLA 2R5ZB 3TW6A 2G0EA 3JREA 2XPVA 2DMQA 4QIWN 4MO7A 3LNQA 3ZQFA 1MBGA 1I3QJ 3HBLA 4FE4A 5FKLA 3ZQLA 3BR2A 3DCFA 2MW8A 3NAUA 2HOAA 2VPRA 2X48A 3NARA 3ZQHA 1HOMA 2R5YB 1JKRC 1SFOJ 2Y9ZA 4MLOA 4DW6A 1JKOC 4DYRA 3S1RJ 5F0FA 5EYRA
chains in the Genus database with same CATH superfamily
4XRMA 3OSFA 1HSJA 2JRTA 3DU5A 1S7AA 1OKRA 5K7FA 2GLOA 3H3ZA 1EH7A 3K70D 4E7KA 2VBXA 3EPZA 3GTJJ 4CA0A 3WE2A 3D5LA 1SAXA 5H20A 2LDUA 3CTAA 2DYRH 4M3EA 4M73A 4PJ0C 2EJRA 1XMXA 3I53A 3R0AA 3I71A 4WF2A 5FLMJ 2A6HF 3HKZN 5FFXA 2CFOA 4XLAA 2PI0A 2E1CA 2AXLA 5C3EJ 2A69F 2RREA 3PSIA 1B9NA 2PMHA 5D5UB 1X1AA 3BR3A 2CS3A 2E5ZA 4KT5C 4XRSG 3PFIA 5J6XA 5LLQA 5DTDA 4WXHA 2F4IA 3MFKA 3BDDA 4IHWA 2COMA 1AOYA 4R1HA 1XSVA 4G6DA 3DF8A 1T2KA 2EPFA 3OIPA 1PP7U 3A4CA 4BBRJ 2IXSA 2TRTA 2MD5A 2F2EA 1R5HA 3ERED 4NC7A 4LG3A 1BC8C 1JGGA 2KRCA 3D5RC 3QU6A 1EJ9A 1FOYA 3V7SA 1R49A 2ZO4A 3A03A 2MABA 4UUTA 4DJAA 2PJRA 4ESFA 5EG0A 1QA6A 3OYIA 1ZHFA 2WAQA 1WJAA 2MC3A 4U0WA 3TBIA 1TT0A 2RGVA 1PP8F 2R93J 3LSPA 1H89C 2Y75A 1BL0A 2VKHA 3CUOA 2ZJQF 5DD4A 1W0UA 2X6YA 4AYBN 2HI3A 1K7AA 4BQAA 2Q8KA 4XONA 3GEZA 2ISYA 1D8JA 1Z21A 2GOMA 4P9UA 5M5WJ 3IRRA 3EUAA 3I0TA 3SQNA 1X2MA 5TISC 3ZMUA 3DXJF 1YX5A 2DA3A 3ZMSA 3VYTB 3KEOA 4LD5A 3MKZA 4I2OA 2NVTJ 4FE7A 3HG9A 1GV5A 5E3OA 5K7ZA 5EGOB 1OJLA 3G6EI 4A6DA 1FIPA 3S3MA 1O3RA 2UWMA 2W25A 3X2QH 4EATA 5DV5A 2EIKH 3TGNA 4NHJA 1IZ1A 1U9OA 1FEXA 1WH5A 2W4SA 5DUIA 1B8IA 4ON0A 1IN4A 2KRHA 4IHVA 4A3FJ 4E70A 1P7IA 3LL7A 3S2WA 2FOWA 2IGKA 1XGOA 4EJOA 4ASNA 5DCMB 2X1EA 3OYBA 4MTDA 1XPXA 3AFHA 5FLXZ 4L5JA 3LAJA 4RAYA 3FM5A 5IP6A 1ZTRA 3W6VA 2D45A 3FBIB 2KJBA 1PVEA 2CQXA 3K7AJ 5KK1A 2NAZA 2HDWA 3KFWX 1LEBA 2K4BA 2KP6A 5C4JJ 2DO7A 2VOOA 4UV9A 2HQRA 2P8TA 3NRVA 2P0WA 2ZJ2A 3ULQB 4P1WA 3JRFA 2NVXJ 3HB9A 2E2HJ 4CO8A 5BPIA 2PG4A 2B7EA 4LG0B 3HPHA 1XGMA 4WCGA 3BTIA 1E3HA 1OYIA 1ONVA 4LLLA 4XRSA 1OPCA 4XOPA 2E7XA 1O3TA 1FC3A 1KU2A 4IQ4A 4RLQA 2EA2A 3W6KB 1S8NA 4A3IJ 4Z2YA 3VYUB 2VXZA 4M6VA 2CGPA 1ZAOA 4A0YA 2RNJA 1RRJA 1E2XA 3TW7A 3AL0C 2L0KA 1R22A 2A07F 3LSRA 4AIJA 3BP8A 5HS7A 1HA8A 2AXTC 2L9RA 1NK3P 2V1DA 5KCMA 3HOTA 3DKYA 1DPUA 3K4CA 4IF4A 4E7ZA 4EM0B 3CC2I 1EKEA 1ZGWA 1YYVA 3ERMA 3EYIA 2XAHA 3GYHX 3CCSI 5CVUA 2JMWA 1X3ZB 3QRFF 1VQ8I 3K10A 3GFJA 2BYVE 1TZLA 4A0XA 1Z3YA 2BHZA 2KT0A 2K3FA 3CDHA 1IRZA 2R5YA 4F92B 5KVRA 1JI8A 2CWEA 1ON2A 1IRXA 3L2QA 3ZGKA 2VODA 3K9TA 1D1CA 2P7CB 5CJ9A 3FHZA 1MBEA 3CJNA 3S2HJ 3GBGA 2O3FA 4YIRX 1KU7A 2GIVA 2CV0A 1Z9CA 4A0ZA 2VQGA 3S8PA 4KUMA 4OMZA 4RGXA 5CQGA 2IW5A 4HDVA 1X3WB 1F43A 3JTGA 3ABUA 4A6EA 2A3SA 4LMYA 1N75A 3ASOH 3BROA 3WTSC 4X6AJ 1R4NB 2MLGA 5J8CA 3M1CA 3IV5A 1UELB 4Y52J 3CZ6A 4WXCA 1D3YA 4E7IA 2ELJA 3VDXA 5J1YA 1DP7P 2FQ4A 4RM3A 5D5XB 1LEAA 1IV8A 2CW8A 3PNYA 1MMAA 4ENJA 3DKXA 5IP9J 3PUFA 1Z1DA 2VJ5A 2GXBA 5M5YJ 2XAUA 4RB2C 1Y39A 2XIGA 3QU3A 4QSHA 3CLOA 1ODDA 3PO2J 3Q0VA 4B09A 1H9GA 4GXOA 4BU2A 2NVQJ 2LG4A 2NYXA 2LKSA 2GAUA 5ILSA 3OYDA 1ETXA 2JSPA 4II2A 2Z16A 2E35A 1MMNA 3CC4I 3F8NA 4KISA 5E79C 1WH7A 3G73A 1BM9A 1HQCA 1Z3XA 2XASA 2XSJC 3K1MA 4U7DA 4A3MJ 3GTMJ 3ECHA 5JHUA 2NNNA 2L7ZA 2ZCWA 3UNGC 4BAYA 4KT6A 3QPLA 1J09A 5E3MA 4KMUX 3WODF 2DA5A 1MBKA 1HKQA 3S2DJ 1F5TA 4HEA2 2EFQA 2CV2A 1K4SA 1R71A 2H94A 4YIIA 1E3OC 4L9NA 1VQ4I 2IS6A 2ZB9A 4CGZA 2M7AA 3OYMA 5ED4A 4A93J 5LGTA 1IUFA 1F9NA 1U5TB 4ZH4F 3C2GA 1W36C 1KONA 2V9PA 5GP9A 4S04A 1QZYA 1DGWY 4UUVA 4PSWA 2K9QA 3WU2C 2LVSA 2DA2A 2OTJI 2XUBA 3TO9A 2E1MC 4MIMA 5CVIA 5JLXA 4E4HA 2R92J 3W2WA 3HRTA 4MQVA 4Z6YA 3CMEI 1Y1WJ 1BIBA 3ML6A 4RAZA 2RNGA 2XHKA 4OIQF 3H1CA 2XAGA 3AG2H 4ZZDA 3ZMZA 3CO6C 2KIQA 1JKQC 5K1YA 4JX5A 2R5ZA 4PFOA 3OYGA 4Y7NJ 3VWBA 2FNAA 3IL2A 2IRFG 1Z91A 1E3PA 2ZMEC 2IEKA 1XMKA 3FXQA 3SFZA 1JT6A 2WV1A 2JUGA 3H0GJ 1MJAA 1KGSA 4HNUA 1OCPA 2M0MA 1QPIA 1KU9A 1FYLA 1T8IA 3HTSB 4EGZA 2IA2A 2R0QC 3RYPA 3WHCA 3G1OA 5DCMA 3V8KA 4L9JA 4ABZA 2R7DA 1E0EA 1GUUA 5L3CA 3LMMA 3M8JA 5A2QZ 3GTOJ 3M4OJ 1P4XA 2W85A 2H8RA 2Y0SA 4KICA 4V2GA 1IDYA 3SDBA 3F8BA 1FSEA 4BQNA 4N4NB 1FOWA 1X3UA 2LFBA 4LG0A 3C3WA 4D7MA 1HF0A 3HYIA 4II3A 4DBQA 4XLCA 2B63J 3FXLA 3SFIA 2C6YA 1G4DA 3E1SA 3BG7A 4LIUA 2KIUA 5E8GA 2XF6A 2WY8Q 1OQYA 1W4MA 4DYQA 2EWNA 3E6CC 1FOXA 5ILVA 2DMNA 4HW0A 5F0CA 4BDZA 4S05A 1ETQA 3DLLF 2E1OA 2GM4A 1U78A 3QODA 2EH3A 3HM5A 3BQYA 2B9SA 3IHUA 4BHBA 4JK1X 2DT5A 4M74A 3GW2A 1EV7A 1GVDA 1X1CA 3BWGA 1MJ9A 1SFUA 1S29A 3KX2A 4XLEA 1NHAA 1J5YA 1G6NA 2UUZA 4HNTA 5E17F 2E71A 3M07A 4M72A 4ZTJA 1UZCA 5HOOA 5IT3A 2V7FA 5FD5A 2EV0A 2CQKA 5HDGA 2R4GA 5D4SA 2HVQA 2DQLA 2E2IJ 2WC2A 3ABMH 1A31A 2LK2A 1BR2A 2UXXA 1TP4A 1R1TA 4G6TB 1LB2A 1OISA 2M30A 1LDJA 4ZDOA 3JCUC 2O03A 2DK5A 2ZSIB 2GXGA 3GWZA 1NG6A 2H8WA 2DFIA 2VXDA 1LUJB 2XGXA 2V9KA 5CYVA 2BVMA 3QOEA 4HQEA 4IHTA 5IT9K 4DGWB 2X6XA 1I3QJ 4BJ5C 4FE4A 1TQPA 5FKLA 3G3ZA 3E5UA 4UY8I 3DPUA 2OCCH 3NAUA 2Y0MA 3H3UA 3NARA 3SYTA 2EA4A 5TGTA 2Y9ZA 2PX9A 5B5EC 2LMDA 4HF0A 3P7NA 1JKOC 3S1RJ 3BCAA 1XTAA 2Y69H 1TT5B 4CSWA 2PMUA 2BE5F 3J80Z 4KDPA 2CW0F 1BI2A 1TW3A 1R6RA 4I09A 5HS8A 4AM3A 1VQ7I 2K27A 3K2ZA 5FD6A 1IJWC 3IH2A 4C3HJ 3H9QA 4E6KG 3MMYB 4HF1A 4KN7X 5IY5H 2D1HA 4DZJA 3KETA 4XLFA 5LGUA 3RTRA 2BGCA 2FU4A 2I10A 4YIFA 3G4SI 3OIQA 3IAS2 1O7LA 3HOZJ 2HXIA 2ECCA 5J1UA 3KYLA 2E60A 2L02A 3E3VA 2DK8A 2K3PA 1ZYRF 4V2FA 2CU7A 4L18B 2DYSH 2IP2A 3OYEA 1F4KA 1U6GA 5F27A 5DS9A 2X1DA 3CCEI 3O6BB 2QYOA 2HTSA 1LVKA 4AWXB 1GHCA 4I99C 1AKHB 3FXRA 4HYEA 2LNBA 2K40A 2PMZN 3ZN0A 1Y56A 1SEUA 4A3DJ 2QQBA 1QZEA 3T8TA 3R61A 1RC9A 1MBJA 4NDLA 4PUSA 1SFXA 4HX4A 1U5TA 2VL8A 2I8DA 1WRJA 1DPRA 3K4NA 4I02A 2DTRA 4LK0F 4LFUA 5L3GA 4PCQA 4A5MA 1HLVA 4ZYGA 2EBIA 2OBPA 3DBHB 3RKXA 4LB6B 4C2MJ 4M6YA 5E1XA 3HSFA 2DMUA 4A3CJ 4P5OA 4P9FA 2KDZA 1B72B 3MZ8A 2L7KA 4FASD 2DMTA 4LB5A 3ZXSA 3OS1A 3K1NA 1POGA 2ZXJA 2XKPA 5HLHA 2Z1DA 2EFOA 4PDKA 1OR7A 1LKXA 3ZQIA 2JPCA 3HOXJ 4E7JA 2QCOA 5TRDA 1K78B 1IRFA 2XGCA 4NNJA 1FWZA 3HPGA 5L3BA 3J7ZI 1APLC 4CCOA 3L2VA 1CF7B 1SAUA 1HW2A 3FBNB 3DPTA 1VF9A 2GA1A 5EZGA 2OAZA 2X85A 4J00A 1U3EM 1P2FA 5K7HA 1R1VA 5DD8A 3MKYB 1BOBA 4G9YA 4DNCA 1S7EA 5H2FC 2GBYA 4PZJA 3F8MA 1YOVB 2HZTA 4DZPA 3WHBA 3QPHA 4OAZA 1A5JA 2MC4A 1RIOH 1J9IA 5J4YA 2DPUA 3KZIC 5HS9A 1W7PB 2JA5J 3R6SA 2X9DA 5EDNA 3U2RA 2IGNA 1QHGA 2HXOA 1J2XA 2KL4A 4NC6A 1B4AA 4C30A 1S72I 2KQRA 1BBYA 4CICA 3I4PA 3PNVA 2BOLA 3PSFA 2R7ZJ 1J59A 3RDIA 2HOTA 1BN5A 1RUOA 4HZFA 4RS8A 2RVCA 4FCYA 2WY7Q 1S7OA 3I59B 3P9KA 3E0JB 3WU1B 1WJBA 2JRMA 1W0TA 4M6XA 2LY1A 1JHFA 1QHHD 1I1GA 4MEYF 4M9SA 1J75A 3OYAA 1RKTA 1MNMC 4C2UA 1K61A 2NS0A 4KN4X 3WTTC 3KP3A 2JPBA 1TQIA 4EJWA 1HKTA 1RNLA 2Y2ZA 2DPDA 5DM7F 3BY6A 1VQNI 2CFXA 3DV8A 3I4NJ 1YX3A 2JVGA 2FUG2 5IYBJ 2MD0A 2FA5A 1P9QC 2M45A 3KIOA 3EDPA 1IXSB 1AU7A 2DAOA 3A02A 3KE2A 2ACJA 3WTVC 2HDDA 1Z0XA 1R9TJ 2PFBA 3VEPA 1WJFA 2ELHA 3FDYA 3GMEA 2VIXA 5IYCJ 3U1KA 3CF5F 4CH7A 1BA5A 3R60A 2RQPA 3JAMZ 3OMYA 5F64A 1J7KA 1KYWA 3H5RA 1MZBA 4OIPF 3T8RA 4A12A 4CYCB 1ZREA 1SVLA 2WAFA 4K2EA 1K6YA 1X4OA 5E1WA 2XSDC 3TO6A 1FMVA 1IV6A 1PDNC 3J7AO 2NVUB 2PJPA 1SD7A 3OR2C 1ON1A 4G8XA 1W5SA 1WFXA 2HKXA 2JZYA 4C3JJ 1ZG1A 2CUJA 4F55A 3KYDB 1X19A 2BBYA 3ZQGA 1Y6IA 1DQUA 1BR4A 3HSRA 3N05A 4BL0B 5HDKA 4BGDA 4L0ZB 4BJ6C 4IHYA 3LSJA 2CQNA 4D0PA 2FNPA 3DU6A 5D8LB 3EUKL 3VODA 4IRGA 5GTHC 2BHYA 3RIRA 2QF7A 2HYJA 2F5FA 5CLSA 2P6TA 4I0BA 4RGUA 3LA3A 3AG1H 3TOBA 1D5VA 4ZDPA 4R79A 4GFBA 3CCVI 2DA4A 2LSOA 2FX0A 2M0CA 3OYHA 4KA4A 1IDZA 3GLLA 4M9ZA 1SC7A 2X1CA 1V55H 2VASA 1YRNA 4PK4A 5LHHA 4AVZA 1FBQA 2H6BA 2M8GX 4RA2A 2EZLA 1MNEA 3BOQA 2EK5A 5DDGA 2E1MB 4NQWB 1LFUP 3SDGA 4ENNA 4P96A 3K69A 4R8HA 3NWTA 4MNUA 3BZCA 5F1JA 1ZR2A 1HW1A 2DCEA 2JVHA 2A05A 1FIAA 1XCBA 5B66C 4BE0A 2P5VA 1XG1A 1MMGA 4U0VA 3ZR8X 1XSXA 5J3LA 1A6IA 1OYYA 3S15J 2ZMEB 2CW7A 4BS9A 2XRNA 3ZQCA 1W5TA 1BR1A 1H8AC 4XK4A 4YRVA 3Q0WA 3PNTA 1B72A 1B9MA 1LE8A 5E1ZB 2K9SA 3FXMA 3CMMA 4RDUA 4QPOA 2VQCA 3CP8A 2UXNA 1OCTC 3C1DA 2R7SA 3S1NJ 3I4MJ 2ZNZA 3FXOA 2OCEA 2VE9A 1YJNI 2HOEA 2EFPA 2BV6A 4GGGA 1UCRA 5DCFA 2FOKA 3DKWA 1VQPI 2EQRA 4FETA 3IRQA 4HQMA 1QGPA 3C18A 1P92A 2M87A 3OR1C 1Y0NA 4W97A 2DQRA 3BLYA 1P4WA 1N25A 2WADA 3LSTA 1CF7A 1FMWA 1YHQI 2PQ8A 1ZQ3P 1QRYA 1HDDC 2JUCA 1EH6A 1R7JA 4XKCA 2ISZA 4XN3A 4DIQA 2O8KA 4OINF 1FOKA 1AA7A 3NQOA 4FTHA 3G2BA 1L0OC 3HOUJ 1H9TA 3FXJA 1BI3A 3MD2A 1XB4A 4MHGA 5GAHJ 3H36A 2PLYA 3K0LA 1D1AA 2VJJA 3OYCA 3A01B 2HQNA 2Z33A 2MLKA 3LA7A 3FXKA 1YFHA 2A5WA 3F6VA 3ZMDA 1DDNA 4XOTA 1MMDA 3LQRA 5D6EA 3JRAA 1NG7A 4O6JA 1A35A 1QVUA 2KMUA 3CCUI 4AUXA 3JR9A 3BQZA 1W7PA 3MEXA 4ENKA 1MDMB 5F0HA 4A3JJ 3IWFA 2E34A 3V7RA 5CVJA 3EUHC 1WJEA 1I39A 4OMYA 3IAM2 3BG9A 2IS2A 2NS8A 3HKZA 2R3SA 3WU0A 3QYBA 3OYFA 1VNDA 4I76A 2G7UA 2LY9A 2TDXA 3FX3A 1MSEC 4HPQA 2V6CA 3E5QA 3G1MA 4HV5A 1P4AA 1XC5A 4WX9A 2TCTA 1JJ8C 2R7TA 1XCVA 4XLHA 4UHTA 2H1KA 4F93B 4YEJA 1LVAA 2IAIA 5DEQA 4MEXF 4PJMA 3Q9SA 3L7WA 3K6GA 1GDTA 2AQEA 1DUXC 4EJUA 1TNTA 4BE2A 4IO9F 3FK7A 2R7RA 2BY2A 5DYMA 1AWCA 2DOAA 5KAIC 2D1VA 5B3SH 3NEUA 2DT6A 3OIOA 4ITVA 5F6FA 3DEUA 4HA8A 2FD5A 5ICEA 1FX7A 3DTIA 4ENMA 3HL2A 3LFUA 3JRBA 2QSGX 4M9XA 3DBLB 1QPMA 3KLOA 1IUYA 1TWAJ 2UZKA 3RPQA 1HBXG 2ZSHB 1G8XA 2YS9A 4B43A 4B47A 2ELKA 5FLVA 1XN7A 4AYBA 2Z5UA 1YITI 5D5WB 2KHMA 1HXDA 1XMAA 2O7OA 4E7LA 3QP6A 3KLNA 1GT0C 2DFHA 2E5NA 4CXFA 4CYCA 2VC0A 3HIFA 1ULYA 3JRCA 4A3LJ 3F8FA 2X6WA 3BR1A 1TLHB 3DTKA 3SJMA 1MKMA 2R7XA 2WBMA 3H0DA 1KQ8A 1NTCA 2X6OA 2LF7A 2NOGA 1FYMA 2DTZA 1WPKA 2M1BA 5J8FA 1I3AA 1SD5A 2IGMA 3H5NA 3L00A 3RKWA 4KYWA 1XX5A 1VQKI 1R00A 2FE3A 2Z3YA 2DDAA 2QKLB 5FFZA 2R7QA 4PFPA 3F8CA 2R7WA 1OCZH 1XDUA 4WXDA 2Z9OA 2WV0A 1OYWA 2UV1A 2VPRA 3L2WA 2LREA 3ZQHA 3HRMA 1HOMA 2F48A 3U21A 1S5LC 4MLOA 4XL9A 2OJED 2O61A 4YFNF 1B59A 2V6EA 3N4MA 1USSA 4Q47A 5F0FA 2WWYA 1QBJA 4ZJZA 3H3VK 2JWTA 1JXSA 3QYEA 3CJRB 2ICWG 1HW5A 1ZR4A 5EGOA 5C44J 2FF4A 2VKEA 5E3LA 2OD5A 4NQWA 1H0MA 1P6RA 4HOBA 4A5NA 4HRIA 3KEYA 2IA0A 4HAMA 4CDGA 2OUMA 3HTUA 2F5EA 2FQ3A 2J5PA 2LR8A 2VBWA 2ESHA 4GRIA 4X0GA 2OZUA 2X4HA 4AC0A 1J0RA 2CUFA 2QGUA 2VE8A 3RQIA 3V8LA 3F23A 2JJ7A 2LC2A 4Y33A 2VBYA 3M8FA 4I7HA 2FEZA 2ZMEA 3RJPA 4GCVA 1T95A 3PIPF 4EJTA 1DGRM 2KZVA 4D1QA 2L7FP 5AIQA 4LLNA 4EJVA 2JTVA 1VQ6I 2MSYA 3S1QJ 5KNLA 2M2EA 5GTIC 1ENHA 1EF4A 5FLXK 3H9JA 1SMTA 3S14J 4YFXF 3LWFA 2ZJRF 2M3AA 1WVRA 5EJCA 1DP3A 3HOSA 2E36A 2OF7A 5BS6A 1X1PA 3GLXA 1TWGJ 1IC8A 4BHPA 1RR7A 1ZARA 3GF2A 2H09A 3CUQC 4CZCA 1O3QA 3C7JA 1K4TA 2YR2A 3J81K 1LDDA 3FMQA 4PSXA 1W7PD 2NS7A 2V9VA 1PYVA 1O4XA 5LFAA 1S3JA 2HS5A 1ETYA 4MGRA 3TQNA 3A01A 2MA3A 2OTLI 3ASNH 1K6OA 4B3XA 3I55I 4N9IA 5F1RA 2Y9YA 5J40A 3J7AY 1STZA 4FHTA 1MDMA 1MBHA 2YSRA 3RKYA 3E6DA 2OZ6A 4I01A 2XPUA 1IN6A 2VC1A 4NC8A 5FKNA 2MBFA 3VFZA 2MG4A 3BJAA 4D5CA 2HR3A 3U1DA 3LA2A 3BZ6A 2YUSA 1WJ5A 4AD9A 2K9LA 2P81A 1YIJI 1KA8A 2LP0A 1TNSA 4PGHA 3LSHA 4H4KC 1YG2A 4C3IJ 5HODA 1RUNA 2ZXIA 1SVMA 1WI3A 2DA7A 1KQ0A 1T56A 3FM3A 2KFDA 2XROA 4TV7A 4UUSB 3MZHA 4BE1A 3K70C 1Z6TA 4XICA 1JTXA 4CHUA 3CCLI 3GZNB 1FP1D 2DW4A 4ZC3A 3PQKA 3FXUA 2QM3A 2EIJH 3VYRB 3QOPA 2XF5A 2DFFA 2P6SA 3MN2A 3ZMTA 2XDVA 4BXUA 3TP3A 1UHSA 1NH3A 2AS5F 1H88C 4JP0A 2QQ9A 3DEWA 5FRMA 3WG9A 1SFKA 4HBLA 3M8EA 3A2KA 4AVPA 2YX4A 2K9MA 2IBDA 4ZYHA 3S1MJ 2RC4A 2WB1N 3OYNA 4IVNA 5E8IA 4JX6A 3FKIJ 3M7GA 1D0ZA 2OPTA 2HGCA 1X58A 4XN0A 3HSEA 1ZH5A 3BJOA 2W82A 4XLNF 2LF8A 1Y1VJ 3U9GA 3L1PA 3BTCA 1YW8A 3Q0UA 2F4MB 1OFCX 4X1EA 2XAJA 1JT0A 3HOVJ 1LNWA 4E7HA 5IOYA 2HTJA 2V26A 2YU9J 2EB7A 3HUGB 1GXPA 4RGRA 1X1DA 3BG6A 1YW9A 4U0YA 4DBRA 4Y15A 4IRHA 3ECOA 4RB1A 1WI9A 2PJRB 4O3MA 4H0EA 4N4OB 1P7JA 3D1NI 1R5GA 4XR6A 2RKHA 4HSRA 2XAFA 3OOUA 4UXNA 4S0HB 3JRHA 2GZWA 3FMSA 5J1RA 2KLOA 5KAFC 3QYFA 3KEQA 2EZHA 3WTUC 3KP2A 3OSGA 2A6TA 1ZRDA 4M71A 1TBXA 1W36D 1ETWA 1WKMA 2P4WA 3CC7I 2DT7B 2QSFX 4FQGA 1V4RA 2L54A 3ZCOA 2XAQA 1RETA 4LLGF 2W7NA 3LQQA 3KP5A 3SEZA 3OYJA 2DA6A 2QQAA 2E1NA 5H6QA 3LAPA 3FWEA 2CYYA 3WG7H 3BG3A 1G3YA 2R7FA 1FSHA 1AHDP 3JRIA 3ROUA 3K4MA 1ZG5A 3BTJA 1FP2A 2A6EF 2V1UA 1Y8RB 1T98A 4U87A 1B8IB 2JQ7A 1JKPC 3OL3A 2J5OA 5M5XJ 4ZYAA 2BW3B 2Z2SB 2ME6A 3CCQI 2L01A 5JVGF 3KZYA 4IHSA 2ADUA 3LSGA 4IPAA 1ERDA 2FBHA 4BXXJ 4EGYA 4XSXF 3ISPA 4YG2F 3P9IA 1S9HA 3MQ0A 4RLFA 5KHDA 1F36A 4F7ZA 2M8EA 1BIAA 5D8KB 3SXYA 4NB5A 5L3EA 1A04A 4I0AA 2HQAA 2FJ1A 4EM1A 1XGSA 4J19A 4LK1F 3OYKA 3A1YA 4HSTA 2M5WA 3E6MA 4NBQA 1GVJA 1G3TA 3I58A 1Z67A 1LFBA 2XPWA 2FBKA 2QA4I 2HYGD 4JYKA 4XSZF 1REPC 5EZHA 1KYZA 4G12A 4IKFA 1YO5C 1R23A 1ETVA 3SZPA 4CZZA 1HDPA 2RAEA 3B73A 5CKTA 1MBFA 3VYSB 1FPQA 1T0FC 2ETHA 4L0YB 3F0CA 2M4GA 2KPMA 3SZGA 2ID3A 2MGQA 2PN6A 3QPSA 4P55A 2EV5A 3DFGA 5K5QA 2LKXA 4UB6C 1UG0A 2R7UA 1FY7A 3CD6I 5AIPA 5LRSA 4L5IA 1OCRH 2CG4A 2EV6A 2VT2A 4EVIA 1TTYA 3TL4X 3JSOA 1FJLA 3E7LA 4LIVA 5B1BH 5FB2A 4M3FA 2QBYB 2V1NA 4FX4A 4DYCA 4BACA 1UG2A 2CSOA 2JA2A 9ANTA 3J7YJ 1SMYF 3HRSA 1LQ1A 1USTA 4ETSA 2G9WA 1DU0A 1TWHJ 2EFWA 2QWWA 2HZDA 4RBOA 2XGDA 3P5JA 3OV8A 2L7MP 4XMYA 2CJJA 2O0YA 4RB0A 2W57A 1LFPA 3TMOA 4DOZA 2EZKA 2ECBA 1WGXA 4PGGA 1LJ9A 1T38A 1Z6RA 2HKOA 2QSHX 2FRHA 1WCMJ 2KKOA 3HGGA 4HV6A 4M3GA 3PFYA 5M3MJ 4HDUA 1IAWA 3TOAA 4XQFA 4UUSA 4GO1A 5EEGA 1FZPB 2CRGA 4LOCA 5FGMA 1V5EA 3O8GA 3B6CA 2F5VA 1VQ5I 1ZELA 4ZYDA 4WK8F 3F72A 2P5KA 4UB8C 2ZFUA 1KU3A 3IH4A 3KCCA 1RPWA 3P9CA 4G7OF 2FMLA 1UHWA 3V8JA 4BXFA 4Y17A 2HPMA 1ACIA 1IN7A 3ABLH 1I6XA 2JSCA 3HHHA 2CQQA 5ICFA 3H35A 1ZN2A 1N78A 1IGNA 1WJCA 2L9SA 2PMZA 3KP6A 2IJLA 4U7BA 4PJJA 1YIOA 2A5YB 3BR0A 1I6HJ 3QQAA 1X2NA 3E5XA 2DOFA 4Q5SF 1XD7A 5ERIA 2KJCA 3WGHA 1IO2A 3J80K 1L3LA 1VQ9I 2KRFA 3FMRA 3GTLJ 2K02A 2K4JA 3BR5A 4XLPF 1HCRA 5FKKA 2OA4A 3HUGA 3L9FA 5FKMA 1R5ID 4CYDA 4IQJA 3TKYA 2ZC2A 3GUDA 3ONQA 5FRNA 1JE8A 3OS2A 2HEOA 3UR3C 3E97A 4XM3A 4EM2A 3CP2A 3EQLF 5IPAA 1MJBA 4OIOF 4G7ZF 4AIDA 1KZHA 1GLNA 5BQTA 3A0BC 1BI0A 3IH3A 4UVCA 3CCJI 2W24A 4QPQA 2VB6A 1IXRC 3EETA 1ITYA 5JFRA 1AKHA 1C0WA 6PAXA 2RV8A 3QP5A 4BKXA 4I6ZA 1GXQA 2MH9A 3VSKA 4JOMA 3H5AA 2MH2A 3GXOA 5LGNA 5GPCA 1G2HA 3FHNA 1W1WE 1G3WA 3KP4A 5LHIA 5CQEA 3SZTA 1PUFB 5LHGA 2ZKZA 2FSWA 3QWLA 3SHFA 1MNDA 2BEOA 1K83J 1JJ6C 2H6CA 1ETKA 5LBQA 5LEJA 4D5FA 3WTYC 4C9YA 5BMZA 3VB2A 1VZ0A 3GO5A 2LYCA 1PUEE 1IN5A 2R5ZB 3TW6A 2G0EA 3JREA 2XPVA 2ZNYA 1V54H 3AKZA 1VQOI 4HLYA 2DMQA 3HJEA 4QIWN 5HDNA 1MMSA 3NWSA 5B1AH 3ZQFA 4BEHB 5FROA 4IX7A 1I27A 5BPDA 1MBGA 4UVBA 4UVAA 1EH8A 3L2RA 3HBLA 3LSIA 2BW3A 2ESNA 3ZQLA 2BY1A 2K86A 2MW8A 5HNFA 2X48A 2V1XA 4I98B 1JKRC 1K78A 3W6JB 3I5UA 1FBUA 1UAAA 1Z05A 3OY9A 1X1BA 2KDOA 2HU9A 4Q48A 5M3FJ 2IPQX 3M1EA 4EV0A 5EYRA 3L2UA 3LOCA 1U8RA 1YTYA 5EEHA 3LFKA 2O9LA 1TWCJ 3CUQB 2D5VA 2IVMA 3J81Z 4MFEA 1TL8A 2L5QA 2H27A 4A69C 2ZFWA 4BUPA 4B1RA 3S16J 2ZXWH 5TJJA 2F6CA 2YX7A 2BY0A 4RMNA 3ZOBA 4B4CA 3OS0A 1ZRCA 4KIBA 2VPLA 5HNHA 1UFMA 1OMIA 2Y31A 3KP7A 4AU7A 3DP7A 2A61A 5HVQC 2K85A 3HHGA 2KZGA 1RESA 2DODA 2XGEA 1FTZA 1PJRA 3FISA 3F22A 4OOIA 1WZ2A 2BXYA 2XV4S 5J47A 3EUHA 1U0JA 5GPAA 4F52A 3FKJA 1IRGA 3CF2A 2CQ7A 1SVOA 5E18F 1NK2P 3I59A 2QBYA 2AQFA 2Y0SN 1I5ZA 4ESBA 3CESA 3KPHA 1Z77A 1RKWA 2L9NA 1JUMA 3BG5A 2VONA 3CCRI 1Z7LA 1TWFJ 2LH9A 1BI1A 3WE3A 4XRFA 1T39A 1KQ9A 2DOEA 2KIFA 2VBZA 1XGNA 1U8BA 3PUBA 2B0LA 3AG3H 1U9NA 4LJZF 4BY1J 4EEFG 4XNFA 4Q4ZF 5IT9Z 4MFDA 2IGOA 3GFIA 4U88A 3GTQJ 2N8GA 1YJWI 3IC7A 1SD6A 1K79A 5LRRA 4XIDA 1ZLJA 1E17A 1Q1HA 1FLIA 2QQ8A 2JK3A 4YELA 1FYKA 2BXZA 3MCZA 2HVRA 4QLCU 1IW7F 2CMPA 2DMPA 2E7WA 2JA7J 4ZYEA 1D0YA 2Y48A 3COAC 1WQ2A 2XVCA 4OU0A 2JA8J 4IXAA 1F1ZA 3Q3SA 4JBAA 3FZVA 3GTPJ 1B1BA 3RSNA 1IXCA 2BY3A 3JAMK 2X0LA 5FKOA 3CCMI 1YLFA 4L9VA 4LITA 3CJQB 3FIWA 3ZN1A 3BT9A 2K9NA 3CMYA 2FBIA 2RDPA 4AIKA 4BBSJ 5C4XJ 2HQ5A 3MKLA 1V5GA 2FMYA 4BY7J 1T6SA 3O3KA 4JX4A 1YE9A 2DBBA 4Y13A 5DM6F 1T33A 1SFEA 4LGWA 1MD0A 4M3BA 4OAYA 3CJTB 2OU2A 5IYDJ 3WTZA 2F4OB 4L9TA 3WTXC 3S93A 2VLAA 1D0XA 2Z99A 3PM1A 3SEQA 1YW7A 1RZ4A 3QAHA 1V5FA 1ZGAA 3DTEA 3GCMA 3VPRA 3BPXA 3I64A 4F3QA 4M3DA 2QZ8A 4Y3OA 2AHQA 2HNHA 2CUEA 2VKDA 4GYGA 2DA1A 2AO9A 4W1UA 2A68F 1ETOA 1YS6A 3BPVA 3REOA 5D6FA 3K4JA 4CCKA 1YI2I 3OYLA 5GAEJ 1X4PA 3R0JA 3DLAA 4GDFA 3PL8A 4FISA 2LY2A 1MGTA 1N77A 3IUOA 3G1LA 3JW4A 4HG2A 5FJ8J 2L9VA 2IT0A 2PEXA 4OIRF 3E6BA 3OL4A 1MW7A 1VQMI 3TO7A 2L4AA 4B3AA 4BJTA 5D4RA 2ZBKA 1PUFA 1QU3A 3GZ6A 3H92A 3GFMA 1HSTA 3O2PE 4GYIA 1FBSA 2GIZA 1TC3C 2CO5A 3OOPA 4BYYA 2LRDA 3C2BA 3RCOA 2VQHA 3MAJA 3BTLA 2LLKA 3R4KA 3HGYA 2DLLA 3A0HC 1EA3A 3ZMVA 1CGPA 3I9V2 4BDYA 3S17J 2HPIA 5JLWA 3RPUA 4BEHA 5D5VB 4F91B 3TDUC 1ZG3A 1RR8C 3QPTA 1HC8A 2D2WA 2Y30A 1UJ8A 2CUZA 2VT3A 4XKWA 2EZIA 2LD5A 5HLGA 3T5XA 4N9HA 1JGSA 1G3SA 2JN6A 2WAEA 4A3EJ 2QUFA 1BJZA 1DU6A 3V7CA 3Q5FA 2OQGA 1ZRFA 2XB5A 4BNCA 2EFNA 3T0YA 3RQ4A 5EF6A 2G7HA 3JTHA 5AONA 2O5RA 1RI7A 2QEXI 5EEAA 4QTRA 1IG7A 4HNVA 2P5LC 2CV1A 3IKTA 2WTEA 2X51A 2IS4A 3MVPA 2LBFB 4A3BJ 5HLTA 2I5UA 5E20A 2HFHA 4FT8A 2GA2A 3I54A 3CUQA 3IWZA 2L3DA 1MSFC 2VJIA 3TEDA 3WTWC 1R4MB 2JA6J 4G7HF 3D0SA 4N0BA 2DU9A 3GTGJ 4ZTFA 2Q2EB 4QWQA 4WWCA 2MYSA 3HOYJ 1QO0D 4IL6C 3BR6A 4HX7A 4ANJA 3KZZA 3PO3J 1SANA 2IA1A 2O6GE 1W5CC 1YJ9I 4KJZA 1BW5A 3ZP5A 3GVAA 2YPRA 1WHUA 3JSPA 5K5OA 4J01A 2L4MA 4RM2A 4D9JA 4ZZLA 4XKBA 4PJLA 4RAFA 3RKQA 1JUSA 1XDSA 3S32A 3AAFA 1ZK8A 2OV7A 5GADJ 1O7FA 5HLIA 2QVOA 1YQAA 1I50J 1Z7UA 4RGSA 1G59A 4RAGA 4B48A 3CCYA 1WSUA 4YFKF 3CDIA 3B6AA 2WA0A 4HX8A 2ZJPF 3K2AA 1VFCA 2NOJB 4EMSA 1BOAA 3TP0A 5LD2C 2KIMA 3S3OA 2HDCA 1JHHA 2DJIA 3GX4X 2VUMJ 1D8KA 3ZQ7A 2KISA 3WGIA 3JRGA 2R7VA 2W48A 2XB0X 5L3FA 1ZKGA 1JUPA 4NUBA 4CCMA 1HKSA 3AG4H 4IOCF 3W3CA 3RYRA 3DWLE 3MKWB 1XSDA 2HYFA 3PQJA 3F9KA 3FK6A 5LEKA 3HXLA 2XC7A 5DUKA 1XS9A 2ME0A 2DN0A 4MQ9F 2K7LA 4MTEA 1CQTA 1JTYA 4E7SA 2HVSA 5JI6A 1IF1A 2NRAC 1GV2A 2VI6A 3UKGA 1OCCH 2EILH 2NXNB 2GOXB 4O5VA 3CDLA 4IOAF 1O3SA 4L5EA 2H1LA 1A36A 3CQZJ 4KITB 1LDKB 3HZJA 2STWA 3W2AA 4IZZA 5K5RA 3HEFA 2O8XA 3V42A 4D7NA 4CUGA 2VN2A 3LSKA 2M9HA 3HOWJ 2VQLA 2L2OA 5EG0B 3KYCB 3K4BA 4XKVA 3HRUA 3BC8A 1Y0UA 1UMQA 4ESJA 1MH4A 3K1PA 2GQQA 1QQIA 2COBA 1QVTA 3DEEA 3N97A 2QLZA 3ABKH 5IP7J 5L3DA 2NVYJ 2RQQA 3C2HA 5ICGA 2OC6A 2GXAA 2HWVA 1I1SA 4B44A 3BCBA 2DDBA 3G71I 4IJAA 2E19A 2ZXHA 4G94A 4A2UA 1ZLKA 5J4VA 3CLQA 2DI3A 2W1OA 2ID6A 3DBRB 3D5SC 2QENA 3H9GA 1SD4A 2HOSA 1QNTA 2LOOA 2NNYA 5JVTA 5BNGA 2LTPA 3WGGA 1YRNB 3HDDA 2DJNA 3RI4A 4A3KJ 4KNYA 3BJ6A 2DFEA 2EIMH 3I56I 5F08A 1U5TC 3VSLA 1V3FA 3FF5A 3RZOJ 4KIGA 3M3YJ 4CCLA 2V79A 4Y4RA 5CPRB 3F3XA 2K5CA 4AIHA 4XBFA 4CCJA 4B8XA 3PJRA 4IEJA 4G6QA 4ZDLA 4JQFA 1WWXA 2WAQN 4EQQA 3ZPLA 2PBIA 4RB3C 2GWRA 5BOXA 2BVLA 3O8HA 2M4KA 1BW6A 1MIJA 4IHXA 1D5YA 2M34A 3L2CA 4IRIA 3K4LA 5IOZA 2EINH 3PIOF 4UNOA 4DQ2A 3V4GA 1MH3A 4HLXA 2CH0A 3RPUD 3CMAI 2VKVA 2R7OA 1M1EB 1QZZA 1U2WA 3RZDJ 3EYYA 1VQLI 2FXAA 1R58A 1Q1VA 5JHFA 4KIFA 2BZTA 1LE8B 2STTA 2VOPA 1OR7C 1FTTA 5ICCA 1FT9A 2VJ4A 1LPQA 2MFZA 5F04A 3IP4B 5FO5A 3OWTA 4BQQA 3GTKJ 4A3GJ 4UV8A 3DPLC 1Y8QB 2DXIA 1VI0A 3CO7C 4V19K 3ELKA 3GFLA 4PJNA 3ZRGA 4KFCA 3BZKA 1ORKA 1WJDA 5ILUA 5E3NA 3K4KA 5CVVA 2F5CA 3ESWB 3TDZC 5A2QK 2M7BA 2W84A 1VTNC 2IS1A 3JRDA 5CVRA 4CCNA 1OLTA 4BH9A 1IN8A 3S3NA 2XKOA 1FNNA 5GAGJ 2E2JJ 2RN7A 2Q1ZB 2OQRA 1T08B 2LKPA 1BC7C 1UHMA 1UB9A 3L09A 4BQOA 2XRLA 3IKVA 1O57A 1BJAA 1R36A 1S6LA 2V4JC 3HC7A 3I3LA 5JR3A 1D1BA 4BHCA 2LBFA 1TW2A 2XF7A 4FX0A 4MO7A 4HF2A 4KMFA 3VOEA 1T0FA 3LNQA 3W2VA 3LSMA 3Q9VA 3AL0B 3F21A 5H6RA 4OWRB 3T1BA 3ZQQA 2Q2EA 3BR2A 3DCFA 2Q0OA 1ZGJA 2HOAA 1R1UA 4XORA 1YS7A 1OCOH 2JT1A 2R5YB 1SFOJ 1A6QA 3ABTA 2YU3A 2WB1A 3MZYA 1TQMA 4DW6A 3F6OA 2W00A 3B02A 2QKMB 4DYRA 2F5DA 3MWMA 4C2TA 2P7VB 1B6AA 3GZ5A 3DQVC 3M9AA
chains in the Genus database with same CATH topology
4XRMA 3LOCA 3OSFA 3H3VK 2JWTA 2O9LA 1TWCJ 1ZR4A 5EGOA 5C44J 2D5VA 2VKEA 5E3LA 5K7FA 2GLOA 4MFEA 1IJWC 3IH2A 4A69C 4C3HJ 3GTJJ 4B1RA 3S16J 4DZJA 2I10A 3ZOBA 4B4CA 3HOZJ 2LR8A 2HXIA 2ECCA 5J1UA 2Y31A 4M3EA 4AC0A 2CUFA 3RQIA 5FLMJ 2JJ7A 1RESA 4V2FA 2CU7A 2XGEA 3HKZN 1FTZA 3FISA 5C3EJ 5F27A 5GPAA 5DS9A 2L7FP 3BR3A 4XRSG 2MSYA 3S1QJ 2M2EA 1NK2P 1ENHA 1AKHB 2Y0SN 5DTDA 1EF4A 2K40A 2PMZN 1Z77A 1RKWA 4IHWA 3S14J 4A3DJ 1JUMA 3BG5A 4NDLA 1MBJA 1TWFJ 2OF7A 4BBRJ 2TRTA 1TWGJ 1IC8A 1HLVA 2EBIA 1RR7A 1U8BA 1JGGA 1U9NA 4C2MJ 4EEFG 4BY1J 4MFDA 3GTQJ 2N8GA 2DMUA 2NS7A 4A3CJ 1O4XA 3A03A 4XIDA 4UUTA 2KDZA 1B72B 1ETYA 5EG0A 3A01A 2JK3A 2R93J 2DMTA 3LSPA 1H89C 1BL0A 2Y9YA 2DMPA 2JA7J 1W0UA 1POGA 4AYBN 2HI3A 3ZQIA 3HOXJ 1MBHA 2QCOA 2XPUA 2XGCA 5M3FJ 2JA8J 5M5WJ 1APLC 5FKNA 3Q3SA 2MG4A 3GTPJ 4D5CA 1X2MA 5FKOA 2YUSA 1VF9A 2DA3A 5EZGA 3FIWA 2P81A 2NVTJ 5K7HA 2LP0A 3BT9A 4FE7A 2K9NA 3CMYA 1GV5A 4C3IJ 5HODA 5E3OA 5K7ZA 5EGOB 1OJLA 4BBSJ 5C4XJ 2HQ5A 1WI3A 2DA7A 3MKLA 1S7EA 2GBYA 1FIPA 4BY7J 4JX4A 1T56A 4DZPA 1T33A 3WHBA 4UUSB 1A5JA 4M3BA 4XICA 1U9OA 1JTXA 1FEXA 1WH5A 2JA5J 2X9DA 1B8IA 5IYDJ 5EDNA 4IHVA 4A3FJ 3MN2A 2HXOA 1P7IA 3PM1A 3TP3A 1UHSA 1H88C 3VPRA 4JP0A 3DEWA 4M3DA 2AHQA 2CUEA 2R7ZJ 2HOTA 2IBDA 3S1MJ 2DA1A 2WB1N 2AO9A 4JX6A 3FKIJ 4W1UA 1ZTRA 5IP6A 3W6VA 2CQXA 2OPTA 3K7AJ 1X58A 4FCYA 5C4JJ 1ETOA 1Y1VJ 1W0TA 3L1PA 3BTCA 3JRFA 2NVXJ 3Q0UA 3HB9A 1OFCX 1RKTA 4X1EA 1JT0A 4FISA 1MNMC 2E2HJ 1K61A 3HOVJ 3G1LA 5FJ8J 3BTIA 5IOYA 4XRSA 2YU9J 2Y2ZA 4B3AA 1PUFA 3I4NJ 5IYBJ 4A3IJ 4M6VA 1AU7A 3A02A 1TC3C 1Z0XA 1R9TJ 2HDDA 3TW7A 2L0KA 3C2BA 3LSRA 3BTLA 2LLKA 1P7JA 3D1NI 2L9RA 3HGYA 1NK3P 5IYCJ 3OOUA 4S0HB 3JRHA 3S17J 1BA5A 5JLWA 5J1RA 1ZGWA 2EZHA 2Y30A 2JMWA 3OSGA 2EZIA 2LD5A 1ETWA 2JN6A 4CYCB 4A3EJ 2KT0A 1IRZA 1BJZA 2XSDC 1DU6A 2R5YA 2XB5A 1IV6A 5EF6A 5EEAA 4QTRA 1RETA 1IG7A 4HNVA 4C3JJ 2DA6A 3MVPA 4A3BJ 3BG3A 1MBEA 3S2HJ 3GBGA 3JRIA 3ZQGA 1AHDP 3BTJA 1MSFC 3TEDA 2JA6J 1B8IB 1JKPC 4IHYA 3LSJA 5M5XJ 3GTGJ 1F43A 3HOYJ 2ME6A 4X6AJ 3BR6A 3IV5A 2QF7A 4Y52J 3PO3J 1SANA 2HYJA 1BW5A 3LSGA 5J1YA 2FQ4A 4BXXJ 4GFBA 2DA4A 2FX0A 1JUSA 2M0CA 3RKQA 1IDZA 1ZK8A 1F36A 1I50J 1YRNA 5IP9J 3CCYA 3B6AA 2FJ1A 2M8GX 4J19A 3K2AA 2EZLA 5M5YJ 1VFCA 4QSHA 1LFUP 3SDGA 3PO2J 1LFBA 3Q0VA 2XPWA 2NVQJ 3TP0A 4JYKA 5F1JA 2VUMJ 5EZHA 1ZR2A 1ETXA 4G12A 1FIAA 3JRGA 2W48A 2XB0X 1ZKGA 1JUPA 1ETVA 1WH7A 1XG1A 1HDPA 2RAEA 4A3MJ 1MBFA 3GTMJ 5J3LA 2L7ZA 3F0CA 1A6IA 3QPLA 2ID3A 3S15J 2MGQA 5E3MA 2LKXA 3QPSA 3FK6A 2DA5A 1MBKA 3S2DJ 3ZQCA 1XS9A 2ME0A 4XK4A 1H8AC 2DN0A 3Q0WA 1B72A 1LE8A 1FJLA 2K9SA 1CQTA 4RDUA 1JTYA 3E7LA 4M3FA 1OCTC 1E3OC 3S1NJ 3I4MJ 1GV2A 2VI6A 4DYCA 3UKGA 1UG2A 9ANTA 2ZB9A 3CDLA 4L5EA 4A93J 1IUFA 1DU0A 1TWHJ 2EQRA 5GP9A 3CQZJ 4W97A 4RBOA 2XGDA 1ZQ3P 1QRYA 2K9QA 2L7MP 2DA2A 2CJJA 2LVSA 1HDDC 3HEFA 4MIMA 5JLXA 2O8KA 2R92J 2EZKA 4D7NA 2ECBA 1WGXA 4FTHA 1Y1WJ 2M9HA 3HOWJ 3HOUJ 5EG0B 1WCMJ 3A01B 1JKQC 3HGGA 4JX5A 2R5ZA 1UMQA 1MH4A 4M3GA 5M3MJ 2COBA 4Y7NJ 3JRAA 1QVTA 1QVUA 4UUSA 5IP7J 2NVYJ 2CRGA 4AUXA 2IEKA 4LOCA 3JR9A 1JT6A 2WV1A 3BQZA 3H0GJ 5F0HA 4A3JJ 3O8GA 1OCPA 3B6CA 1QPIA 2E19A 3BG9A 2NS8A 3IH4A 2R0QC 3WHCA 4I76A 3G1OA 1VNDA 1RPWA 2LY9A 2ID6A 1MSEC 3G1MA 2HOSA 4ABZA 1XC5A 5BNGA 2LTPA 1YRNB 3HDDA 2DJNA 4A3KJ 2TCTA 1JJ8C 1GUUA 5F08A 3GTOJ 3M4OJ 2H8RA 2H1KA 3RZOJ 2CQQA 3M3YJ 2IAIA 4V2GA 1IDYA 1IGNA 1GDTA 3BR0A 1I6HJ 4IEJA 3QQAA 1X2NA 2WAQN 3FK7A 2LFBA 3O8HA 4D7MA 1HF0A 1BW6A 4IHXA 2B63J 1D5YA 2M34A 3SFIA 3GTLJ 3BR5A 1HCRA 5FKKA 5IOZA 5FKMA 3OIOA 1MH3A 4DYQA 2VKVA 2DMNA 5F0CA 2FD5A 1ETQA 3RZDJ 2E1OA 2GM4A 1Q1VA 1U78A 1FTTA 3JRBA 1LE8B 5IPAA 2EH3A 3HM5A 3BQYA 5F04A 1TWAJ 3GTKJ 4A3GJ 3IH3A 2YS9A 1VI0A 2ELKA 5FLVA 1GVDA 1ITYA 1AKHA 1ORKA 4BKXA 4I6ZA 2O7OA 5E3NA 1GT0C 5GPCA 1G2HA 4CYCA 3JRCA 1PUFB 4A3LJ 3JRDA 3BR1A 3SJMA 1K83J 1JJ6C 1ETKA 2E2JJ 2E2IJ 4D5FA 1NTCA 2X6OA 2NOGA 2DTZA 2LK2A 1WPKA 2XRLA 2R5ZB 3TW6A 2G0EA 3JREA 2XPVA 2DMQA 4QIWN 4MO7A 3LNQA 3ZQFA 1MBGA 1I3QJ 3HBLA 4FE4A 5FKLA 3ZQLA 3BR2A 3DCFA 2MW8A 3NAUA 2HOAA 2VPRA 2X48A 3NARA 3ZQHA 1HOMA 2R5YB 1JKRC 1SFOJ 2Y9ZA 4MLOA 4DW6A 1JKOC 4DYRA 3S1RJ 5F0FA 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRM A;  3LOC A;  3OSF A;  3H3V K;  2JWT A;  2O9L A;  1TWC J;  1ZR4 A;  5EGO A;  5C44 J;  2D5V A;  2VKE A;  5E3L A;  5K7F A;  2GLO A;  4MFE A;  1IJW C;  3IH2 A;  4A69 C;  4C3H J;  3GTJ J;  4B1R A;  3S16 J;  4DZJ A;  2I10 A;  3ZOB A;  4B4C A;  3HOZ J;  2LR8 A;  2HXI A;  2ECC A;  5J1U A;  2Y31 A;  4M3E A;  4AC0 A;  2CUF A;  3RQI A;  5FLM J;  2JJ7 A;  1RES A;  4V2F A;  2CU7 A;  2XGE A;  3HKZ N;  1FTZ A;  3FIS A;  5C3E J;  5F27 A;  5GPA A;  5DS9 A;  2L7F P;  3BR3 A;  4XRS G;  2MSY A;  3S1Q J;  2M2E A;  1NK2 P;  1ENH A;  1AKH B;  2Y0S N;  5DTD A;  1EF4 A;  2K40 A;  2PMZ N;  1Z77 A;  1RKW A;  4IHW A;  3S14 J;  4A3D J;  1JUM A;  3BG5 A;  4NDL A;  1MBJ A;  1TWF J;  2OF7 A;  4BBR J;  2TRT A;  1TWG J;  1IC8 A;  1HLV A;  2EBI A;  1RR7 A;  1U8B A;  1JGG A;  1U9N A;  4C2M J;  4EEF G;  4BY1 J;  4MFD A;  3GTQ J;  2N8G A;  2DMU A;  2NS7 A;  4A3C J;  1O4X A;  3A03 A;  4XID A;  4UUT A;  2KDZ A;  1B72 B;  1ETY A;  5EG0 A;  3A01 A;  2JK3 A;  2R93 J;  2DMT A;  3LSP A;  1H89 C;  1BL0 A;  2Y9Y A;  2DMP A;  2JA7 J;  1W0U A;  1POG A;  4AYB N;  2HI3 A;  3ZQI A;  3HOX J;  1MBH A;  2QCO A;  2XPU A;  2XGC A;  5M3F J;  2JA8 J;  5M5W J;  1APL C;  5FKN A;  3Q3S A;  2MG4 A;  3GTP J;  4D5C A;  1X2M A;  5FKO A;  2YUS A;  1VF9 A;  2DA3 A;  5EZG A;  3FIW A;  2P81 A;  2NVT J;  5K7H A;  2LP0 A;  3BT9 A;  4FE7 A;  2K9N A;  3CMY A;  1GV5 A;  4C3I J;  5HOD A;  5E3O A;  5K7Z A;  5EGO B;  1OJL A;  4BBS J;  5C4X J;  2HQ5 A;  1WI3 A;  2DA7 A;  3MKL A;  1S7E A;  2GBY A;  1FIP A;  4BY7 J;  4JX4 A;  1T56 A;  4DZP A;  1T33 A;  3WHB A;  4UUS B;  1A5J A;  4M3B A;  4XIC A;  1U9O A;  1JTX A;  1FEX A;  1WH5 A;  2JA5 J;  2X9D A;  1B8I A;  5IYD J;  5EDN A;  4IHV A;  4A3F J;  3MN2 A;  2HXO A;  1P7I A;  3PM1 A;  3TP3 A;  1UHS A;  1H88 C;  3VPR A;  4JP0 A;  3DEW A;  4M3D A;  2AHQ A;  2CUE A;  2R7Z J;  2HOT A;  2IBD A;  3S1M J;  2DA1 A;  2WB1 N;  2AO9 A;  4JX6 A;  3FKI J;  4W1U A;  1ZTR A;  5IP6 A;  3W6V A;  2CQX A;  2OPT A;  3K7A J;  1X58 A;  4FCY A;  5C4J J;  1ETO A;  1Y1V J;  1W0T A;  3L1P A;  3BTC A;  3JRF A;  2NVX J;  3Q0U A;  3HB9 A;  1OFC X;  1RKT A;  4X1E A;  1JT0 A;  4FIS A;  1MNM C;  2E2H J;  1K61 A;  3HOV J;  3G1L A;  5FJ8 J;  3BTI A;  5IOY A;  4XRS A;  2YU9 J;  2Y2Z A;  4B3A A;  1PUF A;  3I4N J;  5IYB J;  4A3I J;  4M6V A;  1AU7 A;  3A02 A;  1TC3 C;  1Z0X A;  1R9T J;  2HDD A;  3TW7 A;  2L0K A;  3C2B A;  3LSR A;  3BTL A;  2LLK A;  1P7J A;  3D1N I;  2L9R A;  3HGY A;  1NK3 P;  5IYC J;  3OOU A;  4S0H B;  3JRH A;  3S17 J;  1BA5 A;  5JLW A;  5J1R A;  1ZGW A;  2EZH A;  2Y30 A;  2JMW A;  3OSG A;  2EZI A;  2LD5 A;  1ETW A;  2JN6 A;  4CYC B;  4A3E J;  2KT0 A;  1IRZ A;  1BJZ A;  2XSD C;  1DU6 A;  2R5Y A;  2XB5 A;  1IV6 A;  5EF6 A;  5EEA A;  4QTR A;  1RET A;  1IG7 A;  4HNV A;  4C3J J;  2DA6 A;  3MVP A;  4A3B J;  3BG3 A;  1MBE A;  3S2H J;  3GBG A;  3JRI A;  3ZQG A;  1AHD P;  3BTJ A;  1MSF C;  3TED A;  2JA6 J;  1B8I B;  1JKP C;  4IHY A;  3LSJ A;  5M5X J;  3GTG J;  1F43 A;  3HOY J;  2ME6 A;  4X6A J;  3BR6 A;  3IV5 A;  2QF7 A;  4Y52 J;  3PO3 J;  1SAN A;  2HYJ A;  1BW5 A;  3LSG A;  5J1Y A;  2FQ4 A;  4BXX J;  4GFB A;  2DA4 A;  2FX0 A;  1JUS A;  2M0C A;  3RKQ A;  1IDZ A;  1ZK8 A;  1F36 A;  1I50 J;  1YRN A;  5IP9 J;  3CCY A;  3B6A A;  2FJ1 A;  2M8G X;  4J19 A;  3K2A A;  2EZL A;  5M5Y J;  1VFC A;  4QSH A;  1LFU P;  3SDG A;  3PO2 J;  1LFB A;  3Q0V A;  2XPW A;  2NVQ J;  3TP0 A;  4JYK A;  5F1J A;  2VUM J;  5EZH A;  1ZR2 A;  1ETX A;  4G12 A;  1FIA A;  3JRG A;  2W48 A;  2XB0 X;  1ZKG A;  1JUP A;  1ETV A;  1WH7 A;  1XG1 A;  1HDP A;  2RAE A;  4A3M J;  1MBF A;  3GTM J;  5J3L A;  2L7Z A;  3F0C A;  1A6I A;  3QPL A;  2ID3 A;  3S15 J;  2MGQ A;  5E3M A;  2LKX A;  3QPS A;  3FK6 A;  2DA5 A;  1MBK A;  3S2D J;  3ZQC A;  1XS9 A;  2ME0 A;  4XK4 A;  1H8A C;  2DN0 A;  3Q0W A;  1B72 A;  1LE8 A;  1FJL A;  2K9S A;  1CQT A;  4RDU A;  1JTY A;  3E7L A;  4M3F A;  1OCT C;  1E3O C;  3S1N J;  3I4M J;  1GV2 A;  2VI6 A;  4DYC A;  3UKG A;  1UG2 A;  9ANT A;  2ZB9 A;  3CDL A;  4L5E A;  4A93 J;  1IUF A;  1DU0 A;  1TWH J;  2EQR A;  5GP9 A;  3CQZ J;  4W97 A;  4RBO A;  2XGD A;  1ZQ3 P;  1QRY A;  2K9Q A;  2L7M P;  2DA2 A;  2CJJ A;  2LVS A;  1HDD C;  3HEF A;  4MIM A;  5JLX A;  2O8K A;  2R92 J;  2EZK A;  4D7N A;  2ECB A;  1WGX A;  4FTH A;  1Y1W J;  2M9H A;  3HOW J;  3HOU J;  5EG0 B;  1WCM J;  3A01 B;  1JKQ C;  3HGG A;  4JX5 A;  2R5Z A;  1UMQ A;  1MH4 A;  4M3G A;  5M3M J;  2COB A;  4Y7N J;  3JRA A;  1QVT A;  1QVU A;  4UUS A;  5IP7 J;  2NVY J;  2CRG A;  4AUX A;  2IEK A;  4LOC A;  3JR9 A;  1JT6 A;  2WV1 A;  3BQZ A;  3H0G J;  5F0H A;  4A3J J;  3O8G A;  1OCP A;  3B6C A;  1QPI A;  2E19 A;  3BG9 A;  2NS8 A;  3IH4 A;  2R0Q C;  3WHC A;  4I76 A;  3G1O A;  1VND A;  1RPW A;  2LY9 A;  2ID6 A;  1MSE C;  3G1M A;  2HOS A;  4ABZ A;  1XC5 A;  5BNG A;  2LTP A;  1YRN B;  3HDD A;  2DJN A;  4A3K J;  2TCT A;  1JJ8 C;  1GUU A;  5F08 A;  3GTO J;  3M4O J;  2H8R A;  2H1K A;  3RZO J;  2CQQ A;  3M3Y J;  2IAI A;  4V2G A;  1IDY A;  1IGN A;  1GDT A;  3BR0 A;  1I6H J;  4IEJ A;  3QQA A;  1X2N A;  2WAQ N;  3FK7 A;  2LFB A;  3O8H A;  4D7M A;  1HF0 A;  1BW6 A;  4IHX A;  2B63 J;  1D5Y A;  2M34 A;  3SFI A;  3GTL J;  3BR5 A;  1HCR A;  5FKK A;  5IOZ A;  5FKM A;  3OIO A;  1MH3 A;  4DYQ A;  2VKV A;  2DMN A;  5F0C A;  2FD5 A;  1ETQ A;  3RZD J;  2E1O A;  2GM4 A;  1Q1V A;  1U78 A;  1FTT A;  3JRB A;  1LE8 B;  5IPA A;  2EH3 A;  3HM5 A;  3BQY A;  5F04 A;  1TWA J;  3GTK J;  4A3G J;  3IH3 A;  2YS9 A;  1VI0 A;  2ELK A;  5FLV A;  1GVD A;  1ITY A;  1AKH A;  1ORK A;  4BKX A;  4I6Z A;  2O7O A;  5E3N A;  1GT0 C;  5GPC A;  1G2H A;  4CYC A;  3JRC A;  1PUF B;  4A3L J;  3JRD A;  3BR1 A;  3SJM A;  1K83 J;  1JJ6 C;  1ETK A;  2E2J J;  2E2I J;  4D5F A;  1NTC A;  2X6O A;  2NOG A;  2DTZ A;  2LK2 A;  1WPK A;  2XRL A;  2R5Z B;  3TW6 A;  2G0E A;  3JRE A;  2XPV A;  2DMQ A;  4QIW N;  4MO7 A;  3LNQ A;  3ZQF A;  1MBG A;  1I3Q J;  3HBL A;  4FE4 A;  5FKL A;  3ZQL A;  3BR2 A;  3DCF A;  2MW8 A;  3NAU A;  2HOA A;  2VPR A;  2X48 A;  3NAR A;  3ZQH A;  1HOM A;  2R5Y B;  1JKR C;  1SFO J;  2Y9Z A;  4MLO A;  4DW6 A;  1JKO C;  4DYR A;  3S1R J;  5F0F A;  5EYR A; 
#chains in the Genus database with same CATH topology
 4XRM A;  3OSF A;  1HSJ A;  2JRT A;  3DU5 A;  1S7A A;  1OKR A;  5K7F A;  2GLO A;  3H3Z A;  1EH7 A;  3K70 D;  4E7K A;  2VBX A;  3EPZ A;  3GTJ J;  4CA0 A;  3WE2 A;  3D5L A;  1SAX A;  5H20 A;  2LDU A;  3CTA A;  2DYR H;  4M3E A;  4M73 A;  4PJ0 C;  2EJR A;  1XMX A;  3I53 A;  3R0A A;  3I71 A;  4WF2 A;  5FLM J;  2A6H F;  3HKZ N;  5FFX A;  2CFO A;  4XLA A;  2PI0 A;  2E1C A;  2AXL A;  5C3E J;  2A69 F;  2RRE A;  3PSI A;  1B9N A;  2PMH A;  5D5U B;  1X1A A;  3BR3 A;  2CS3 A;  2E5Z A;  4KT5 C;  4XRS G;  3PFI A;  5J6X A;  5LLQ A;  5DTD A;  4WXH A;  2F4I A;  3MFK A;  3BDD A;  4IHW A;  2COM A;  1AOY A;  4R1H A;  1XSV A;  4G6D A;  3DF8 A;  1T2K A;  2EPF A;  3OIP A;  1PP7 U;  3A4C A;  4BBR J;  2IXS A;  2TRT A;  2MD5 A;  2F2E A;  1R5H A;  3ERE D;  4NC7 A;  4LG3 A;  1BC8 C;  1JGG A;  2KRC A;  3D5R C;  3QU6 A;  1EJ9 A;  1FOY A;  3V7S A;  1R49 A;  2ZO4 A;  3A03 A;  2MAB A;  4UUT A;  4DJA A;  2PJR A;  4ESF A;  5EG0 A;  1QA6 A;  3OYI A;  1ZHF A;  2WAQ A;  1WJA A;  2MC3 A;  4U0W A;  3TBI A;  1TT0 A;  2RGV A;  1PP8 F;  2R93 J;  3LSP A;  1H89 C;  2Y75 A;  1BL0 A;  2VKH A;  3CUO A;  2ZJQ F;  5DD4 A;  1W0U A;  2X6Y A;  4AYB N;  2HI3 A;  1K7A A;  4BQA A;  2Q8K A;  4XON A;  3GEZ A;  2ISY A;  1D8J A;  1Z21 A;  2GOM A;  4P9U A;  5M5W J;  3IRR A;  3EUA A;  3I0T A;  3SQN A;  1X2M A;  5TIS C;  3ZMU A;  3DXJ F;  1YX5 A;  2DA3 A;  3ZMS A;  3VYT B;  3KEO A;  4LD5 A;  3MKZ A;  4I2O A;  2NVT J;  4FE7 A;  3HG9 A;  1GV5 A;  5E3O A;  5K7Z A;  5EGO B;  1OJL A;  3G6E I;  4A6D A;  1FIP A;  3S3M A;  1O3R A;  2UWM A;  2W25 A;  3X2Q H;  4EAT A;  5DV5 A;  2EIK H;  3TGN A;  4NHJ A;  1IZ1 A;  1U9O A;  1FEX A;  1WH5 A;  2W4S A;  5DUI A;  1B8I A;  4ON0 A;  1IN4 A;  2KRH A;  4IHV A;  4A3F J;  4E70 A;  1P7I A;  3LL7 A;  3S2W A;  2FOW A;  2IGK A;  1XGO A;  4EJO A;  4ASN A;  5DCM B;  2X1E A;  3OYB A;  4MTD A;  1XPX A;  3AFH A;  5FLX Z;  4L5J A;  3LAJ A;  4RAY A;  3FM5 A;  5IP6 A;  1ZTR A;  3W6V A;  2D45 A;  3FBI B;  2KJB A;  1PVE A;  2CQX A;  3K7A J;  5KK1 A;  2NAZ A;  2HDW A;  3KFW X;  1LEB A;  2K4B A;  2KP6 A;  5C4J J;  2DO7 A;  2VOO A;  4UV9 A;  2HQR A;  2P8T A;  3NRV A;  2P0W A;  2ZJ2 A;  3ULQ B;  4P1W A;  3JRF A;  2NVX J;  3HB9 A;  2E2H J;  4CO8 A;  5BPI A;  2PG4 A;  2B7E A;  4LG0 B;  3HPH A;  1XGM A;  4WCG A;  3BTI A;  1E3H A;  1OYI A;  1ONV A;  4LLL A;  4XRS A;  1OPC A;  4XOP A;  2E7X A;  1O3T A;  1FC3 A;  1KU2 A;  4IQ4 A;  4RLQ A;  2EA2 A;  3W6K B;  1S8N A;  4A3I J;  4Z2Y A;  3VYU B;  2VXZ A;  4M6V A;  2CGP A;  1ZAO A;  4A0Y A;  2RNJ A;  1RRJ A;  1E2X A;  3TW7 A;  3AL0 C;  2L0K A;  1R22 A;  2A07 F;  3LSR A;  4AIJ A;  3BP8 A;  5HS7 A;  1HA8 A;  2AXT C;  2L9R A;  1NK3 P;  2V1D A;  5KCM A;  3HOT A;  3DKY A;  1DPU A;  3K4C A;  4IF4 A;  4E7Z A;  4EM0 B;  3CC2 I;  1EKE A;  1ZGW A;  1YYV A;  3ERM A;  3EYI A;  2XAH A;  3GYH X;  3CCS I;  5CVU A;  2JMW A;  1X3Z B;  3QRF F;  1VQ8 I;  3K10 A;  3GFJ A;  2BYV E;  1TZL A;  4A0X A;  1Z3Y A;  2BHZ A;  2KT0 A;  2K3F A;  3CDH A;  1IRZ A;  2R5Y A;  4F92 B;  5KVR A;  1JI8 A;  2CWE A;  1ON2 A;  1IRX A;  3L2Q A;  3ZGK A;  2VOD A;  3K9T A;  1D1C A;  2P7C B;  5CJ9 A;  3FHZ A;  1MBE A;  3CJN A;  3S2H J;  3GBG A;  2O3F A;  4YIR X;  1KU7 A;  2GIV A;  2CV0 A;  1Z9C A;  4A0Z A;  2VQG A;  3S8P A;  4KUM A;  4OMZ A;  4RGX A;  5CQG A;  2IW5 A;  4HDV A;  1X3W B;  1F43 A;  3JTG A;  3ABU A;  4A6E A;  2A3S A;  4LMY A;  1N75 A;  3ASO H;  3BRO A;  3WTS C;  4X6A J;  1R4N B;  2MLG A;  5J8C A;  3M1C A;  3IV5 A;  1UEL B;  4Y52 J;  3CZ6 A;  4WXC A;  1D3Y A;  4E7I A;  2ELJ A;  3VDX A;  5J1Y A;  1DP7 P;  2FQ4 A;  4RM3 A;  5D5X B;  1LEA A;  1IV8 A;  2CW8 A;  3PNY A;  1MMA A;  4ENJ A;  3DKX A;  5IP9 J;  3PUF A;  1Z1D A;  2VJ5 A;  2GXB A;  5M5Y J;  2XAU A;  4RB2 C;  1Y39 A;  2XIG A;  3QU3 A;  4QSH A;  3CLO A;  1ODD A;  3PO2 J;  3Q0V A;  4B09 A;  1H9G A;  4GXO A;  4BU2 A;  2NVQ J;  2LG4 A;  2NYX A;  2LKS A;  2GAU A;  5ILS A;  3OYD A;  1ETX A;  2JSP A;  4II2 A;  2Z16 A;  2E35 A;  1MMN A;  3CC4 I;  3F8N A;  4KIS A;  5E79 C;  1WH7 A;  3G73 A;  1BM9 A;  1HQC A;  1Z3X A;  2XAS A;  2XSJ C;  3K1M A;  4U7D A;  4A3M J;  3GTM J;  3ECH A;  5JHU A;  2NNN A;  2L7Z A;  2ZCW A;  3UNG C;  4BAY A;  4KT6 A;  3QPL A;  1J09 A;  5E3M A;  4KMU X;  3WOD F;  2DA5 A;  1MBK A;  1HKQ A;  3S2D J;  1F5T A;  4HEA 2;  2EFQ A;  2CV2 A;  1K4S A;  1R71 A;  2H94 A;  4YII A;  1E3O C;  4L9N A;  1VQ4 I;  2IS6 A;  2ZB9 A;  4CGZ A;  2M7A A;  3OYM A;  5ED4 A;  4A93 J;  5LGT A;  1IUF A;  1F9N A;  1U5T B;  4ZH4 F;  3C2G A;  1W36 C;  1KON A;  2V9P A;  5GP9 A;  4S04 A;  1QZY A;  1DGW Y;  4UUV A;  4PSW A;  2K9Q A;  3WU2 C;  2LVS A;  2DA2 A;  2OTJ I;  2XUB A;  3TO9 A;  2E1M C;  4MIM A;  5CVI A;  5JLX A;  4E4H A;  2R92 J;  3W2W A;  3HRT A;  4MQV A;  4Z6Y A;  3CME I;  1Y1W J;  1BIB A;  3ML6 A;  4RAZ A;  2RNG A;  2XHK A;  4OIQ F;  3H1C A;  2XAG A;  3AG2 H;  4ZZD A;  3ZMZ A;  3CO6 C;  2KIQ A;  1JKQ C;  5K1Y A;  4JX5 A;  2R5Z A;  4PFO A;  3OYG A;  4Y7N J;  3VWB A;  2FNA A;  3IL2 A;  2IRF G;  1Z91 A;  1E3P A;  2ZME C;  2IEK A;  1XMK A;  3FXQ A;  3SFZ A;  1JT6 A;  2WV1 A;  2JUG A;  3H0G J;  1MJA A;  1KGS A;  4HNU A;  1OCP A;  2M0M A;  1QPI A;  1KU9 A;  1FYL A;  1T8I A;  3HTS B;  4EGZ A;  2IA2 A;  2R0Q C;  3RYP A;  3WHC A;  3G1O A;  5DCM A;  3V8K A;  4L9J A;  4ABZ A;  2R7D A;  1E0E A;  1GUU A;  5L3C A;  3LMM A;  3M8J A;  5A2Q Z;  3GTO J;  3M4O J;  1P4X A;  2W85 A;  2H8R A;  2Y0S A;  4KIC A;  4V2G A;  1IDY A;  3SDB A;  3F8B A;  1FSE A;  4BQN A;  4N4N B;  1FOW A;  1X3U A;  2LFB A;  4LG0 A;  3C3W A;  4D7M A;  1HF0 A;  3HYI A;  4II3 A;  4DBQ A;  4XLC A;  2B63 J;  3FXL A;  3SFI A;  2C6Y A;  1G4D A;  3E1S A;  3BG7 A;  4LIU A;  2KIU A;  5E8G A;  2XF6 A;  2WY8 Q;  1OQY A;  1W4M A;  4DYQ A;  2EWN A;  3E6C C;  1FOX A;  5ILV A;  2DMN A;  4HW0 A;  5F0C A;  4BDZ A;  4S05 A;  1ETQ A;  3DLL F;  2E1O A;  2GM4 A;  1U78 A;  3QOD A;  2EH3 A;  3HM5 A;  3BQY A;  2B9S A;  3IHU A;  4BHB A;  4JK1 X;  2DT5 A;  4M74 A;  3GW2 A;  1EV7 A;  1GVD A;  1X1C A;  3BWG A;  1MJ9 A;  1SFU A;  1S29 A;  3KX2 A;  4XLE A;  1NHA A;  1J5Y A;  1G6N A;  2UUZ A;  4HNT A;  5E17 F;  2E71 A;  3M07 A;  4M72 A;  4ZTJ A;  1UZC A;  5HOO A;  5IT3 A;  2V7F A;  5FD5 A;  2EV0 A;  2CQK A;  5HDG A;  2R4G A;  5D4S A;  2HVQ A;  2DQL A;  2E2I J;  2WC2 A;  3ABM H;  1A31 A;  2LK2 A;  1BR2 A;  2UXX A;  1TP4 A;  1R1T A;  4G6T B;  1LB2 A;  1OIS A;  2M30 A;  1LDJ A;  4ZDO A;  3JCU C;  2O03 A;  2DK5 A;  2ZSI B;  2GXG A;  3GWZ A;  1NG6 A;  2H8W A;  2DFI A;  2VXD A;  1LUJ B;  2XGX A;  2V9K A;  5CYV A;  2BVM A;  3QOE A;  4HQE A;  4IHT A;  5IT9 K;  4DGW B;  2X6X A;  1I3Q J;  4BJ5 C;  4FE4 A;  1TQP A;  5FKL A;  3G3Z A;  3E5U A;  4UY8 I;  3DPU A;  2OCC H;  3NAU A;  2Y0M A;  3H3U A;  3NAR A;  3SYT A;  2EA4 A;  5TGT A;  2Y9Z A;  2PX9 A;  5B5E C;  2LMD A;  4HF0 A;  3P7N A;  1JKO C;  3S1R J;  3BCA A;  1XTA A;  2Y69 H;  1TT5 B;  4CSW A;  2PMU A;  2BE5 F;  3J80 Z;  4KDP A;  2CW0 F;  1BI2 A;  1TW3 A;  1R6R A;  4I09 A;  5HS8 A;  4AM3 A;  1VQ7 I;  2K27 A;  3K2Z A;  5FD6 A;  1IJW C;  3IH2 A;  4C3H J;  3H9Q A;  4E6K G;  3MMY B;  4HF1 A;  4KN7 X;  5IY5 H;  2D1H A;  4DZJ A;  3KET A;  4XLF A;  5LGU A;  3RTR A;  2BGC A;  2FU4 A;  2I10 A;  4YIF A;  3G4S I;  3OIQ A;  3IAS 2;  1O7L A;  3HOZ J;  2HXI A;  2ECC A;  5J1U A;  3KYL A;  2E60 A;  2L02 A;  3E3V A;  2DK8 A;  2K3P A;  1ZYR F;  4V2F A;  2CU7 A;  4L18 B;  2DYS H;  2IP2 A;  3OYE A;  1F4K A;  1U6G A;  5F27 A;  5DS9 A;  2X1D A;  3CCE I;  3O6B B;  2QYO A;  2HTS A;  1LVK A;  4AWX B;  1GHC A;  4I99 C;  1AKH B;  3FXR A;  4HYE A;  2LNB A;  2K40 A;  2PMZ N;  3ZN0 A;  1Y56 A;  1SEU A;  4A3D J;  2QQB A;  1QZE A;  3T8T A;  3R61 A;  1RC9 A;  1MBJ A;  4NDL A;  4PUS A;  1SFX A;  4HX4 A;  1U5T A;  2VL8 A;  2I8D A;  1WRJ A;  1DPR A;  3K4N A;  4I02 A;  2DTR A;  4LK0 F;  4LFU A;  5L3G A;  4PCQ A;  4A5M A;  1HLV A;  4ZYG A;  2EBI A;  2OBP A;  3DBH B;  3RKX A;  4LB6 B;  4C2M J;  4M6Y A;  5E1X A;  3HSF A;  2DMU A;  4A3C J;  4P5O A;  4P9F A;  2KDZ A;  1B72 B;  3MZ8 A;  2L7K A;  4FAS D;  2DMT A;  4LB5 A;  3ZXS A;  3OS1 A;  3K1N A;  1POG A;  2ZXJ A;  2XKP A;  5HLH A;  2Z1D A;  2EFO A;  4PDK A;  1OR7 A;  1LKX A;  3ZQI A;  2JPC A;  3HOX J;  4E7J A;  2QCO A;  5TRD A;  1K78 B;  1IRF A;  2XGC A;  4NNJ A;  1FWZ A;  3HPG A;  5L3B A;  3J7Z I;  1APL C;  4CCO A;  3L2V A;  1CF7 B;  1SAU A;  1HW2 A;  3FBN B;  3DPT A;  1VF9 A;  2GA1 A;  5EZG A;  2OAZ A;  2X85 A;  4J00 A;  1U3E M;  1P2F A;  5K7H A;  1R1V A;  5DD8 A;  3MKY B;  1BOB A;  4G9Y A;  4DNC A;  1S7E A;  5H2F C;  2GBY A;  4PZJ A;  3F8M A;  1YOV B;  2HZT A;  4DZP A;  3WHB A;  3QPH A;  4OAZ A;  1A5J A;  2MC4 A;  1RIO H;  1J9I A;  5J4Y A;  2DPU A;  3KZI C;  5HS9 A;  1W7P B;  2JA5 J;  3R6S A;  2X9D A;  5EDN A;  3U2R A;  2IGN A;  1QHG A;  2HXO A;  1J2X A;  2KL4 A;  4NC6 A;  1B4A A;  4C30 A;  1S72 I;  2KQR A;  1BBY A;  4CIC A;  3I4P A;  3PNV A;  2BOL A;  3PSF A;  2R7Z J;  1J59 A;  3RDI A;  2HOT A;  1BN5 A;  1RUO A;  4HZF A;  4RS8 A;  2RVC A;  4FCY A;  2WY7 Q;  1S7O A;  3I59 B;  3P9K A;  3E0J B;  3WU1 B;  1WJB A;  2JRM A;  1W0T A;  4M6X A;  2LY1 A;  1JHF A;  1QHH D;  1I1G A;  4MEY F;  4M9S A;  1J75 A;  3OYA A;  1RKT A;  1MNM C;  4C2U A;  1K61 A;  2NS0 A;  4KN4 X;  3WTT C;  3KP3 A;  2JPB A;  1TQI A;  4EJW A;  1HKT A;  1RNL A;  2Y2Z A;  2DPD A;  5DM7 F;  3BY6 A;  1VQN I;  2CFX A;  3DV8 A;  3I4N J;  1YX3 A;  2JVG A;  2FUG 2;  5IYB J;  2MD0 A;  2FA5 A;  1P9Q C;  2M45 A;  3KIO A;  3EDP A;  1IXS B;  1AU7 A;  2DAO A;  3A02 A;  3KE2 A;  2ACJ A;  3WTV C;  2HDD A;  1Z0X A;  1R9T J;  2PFB A;  3VEP A;  1WJF A;  2ELH A;  3FDY A;  3GME A;  2VIX A;  5IYC J;  3U1K A;  3CF5 F;  4CH7 A;  1BA5 A;  3R60 A;  2RQP A;  3JAM Z;  3OMY A;  5F64 A;  1J7K A;  1KYW A;  3H5R A;  1MZB A;  4OIP F;  3T8R A;  4A12 A;  4CYC B;  1ZRE A;  1SVL A;  2WAF A;  4K2E A;  1K6Y A;  1X4O A;  5E1W A;  2XSD C;  3TO6 A;  1FMV A;  1IV6 A;  1PDN C;  3J7A O;  2NVU B;  2PJP A;  1SD7 A;  3OR2 C;  1ON1 A;  4G8X A;  1W5S A;  1WFX A;  2HKX A;  2JZY A;  4C3J J;  1ZG1 A;  2CUJ A;  4F55 A;  3KYD B;  1X19 A;  2BBY A;  3ZQG A;  1Y6I A;  1DQU A;  1BR4 A;  3HSR A;  3N05 A;  4BL0 B;  5HDK A;  4BGD A;  4L0Z B;  4BJ6 C;  4IHY A;  3LSJ A;  2CQN A;  4D0P A;  2FNP A;  3DU6 A;  5D8L B;  3EUK L;  3VOD A;  4IRG A;  5GTH C;  2BHY A;  3RIR A;  2QF7 A;  2HYJ A;  2F5F A;  5CLS A;  2P6T A;  4I0B A;  4RGU A;  3LA3 A;  3AG1 H;  3TOB A;  1D5V A;  4ZDP A;  4R79 A;  4GFB A;  3CCV I;  2DA4 A;  2LSO A;  2FX0 A;  2M0C A;  3OYH A;  4KA4 A;  1IDZ A;  3GLL A;  4M9Z A;  1SC7 A;  2X1C A;  1V55 H;  2VAS A;  1YRN A;  4PK4 A;  5LHH A;  4AVZ A;  1FBQ A;  2H6B A;  2M8G X;  4RA2 A;  2EZL A;  1MNE A;  3BOQ A;  2EK5 A;  5DDG A;  2E1M B;  4NQW B;  1LFU P;  3SDG A;  4ENN A;  4P96 A;  3K69 A;  4R8H A;  3NWT A;  4MNU A;  3BZC A;  5F1J A;  1ZR2 A;  1HW1 A;  2DCE A;  2JVH A;  2A05 A;  1FIA A;  1XCB A;  5B66 C;  4BE0 A;  2P5V A;  1XG1 A;  1MMG A;  4U0V A;  3ZR8 X;  1XSX A;  5J3L A;  1A6I A;  1OYY A;  3S15 J;  2ZME B;  2CW7 A;  4BS9 A;  2XRN A;  3ZQC A;  1W5T A;  1BR1 A;  1H8A C;  4XK4 A;  4YRV A;  3Q0W A;  3PNT A;  1B72 A;  1B9M A;  1LE8 A;  5E1Z B;  2K9S A;  3FXM A;  3CMM A;  4RDU A;  4QPO A;  2VQC A;  3CP8 A;  2UXN A;  1OCT C;  3C1D A;  2R7S A;  3S1N J;  3I4M J;  2ZNZ A;  3FXO A;  2OCE A;  2VE9 A;  1YJN I;  2HOE A;  2EFP A;  2BV6 A;  4GGG A;  1UCR A;  5DCF A;  2FOK A;  3DKW A;  1VQP I;  2EQR A;  4FET A;  3IRQ A;  4HQM A;  1QGP A;  3C18 A;  1P92 A;  2M87 A;  3OR1 C;  1Y0N A;  4W97 A;  2DQR A;  3BLY A;  1P4W A;  1N25 A;  2WAD A;  3LST A;  1CF7 A;  1FMW A;  1YHQ I;  2PQ8 A;  1ZQ3 P;  1QRY A;  1HDD C;  2JUC A;  1EH6 A;  1R7J A;  4XKC A;  2ISZ A;  4XN3 A;  4DIQ A;  2O8K A;  4OIN F;  1FOK A;  1AA7 A;  3NQO A;  4FTH A;  3G2B A;  1L0O C;  3HOU J;  1H9T A;  3FXJ A;  1BI3 A;  3MD2 A;  1XB4 A;  4MHG A;  5GAH J;  3H36 A;  2PLY A;  3K0L A;  1D1A A;  2VJJ A;  3OYC A;  3A01 B;  2HQN A;  2Z33 A;  2MLK A;  3LA7 A;  3FXK A;  1YFH A;  2A5W A;  3F6V A;  3ZMD A;  1DDN A;  4XOT A;  1MMD A;  3LQR A;  5D6E A;  3JRA A;  1NG7 A;  4O6J A;  1A35 A;  1QVU A;  2KMU A;  3CCU I;  4AUX A;  3JR9 A;  3BQZ A;  1W7P A;  3MEX A;  4ENK A;  1MDM B;  5F0H A;  4A3J J;  3IWF A;  2E34 A;  3V7R A;  5CVJ A;  3EUH C;  1WJE A;  1I39 A;  4OMY A;  3IAM 2;  3BG9 A;  2IS2 A;  2NS8 A;  3HKZ A;  2R3S A;  3WU0 A;  3QYB A;  3OYF A;  1VND A;  4I76 A;  2G7U A;  2LY9 A;  2TDX A;  3FX3 A;  1MSE C;  4HPQ A;  2V6C A;  3E5Q A;  3G1M A;  4HV5 A;  1P4A A;  1XC5 A;  4WX9 A;  2TCT A;  1JJ8 C;  2R7T A;  1XCV A;  4XLH A;  4UHT A;  2H1K A;  4F93 B;  4YEJ A;  1LVA A;  2IAI A;  5DEQ A;  4MEX F;  4PJM A;  3Q9S A;  3L7W A;  3K6G A;  1GDT A;  2AQE A;  1DUX C;  4EJU A;  1TNT A;  4BE2 A;  4IO9 F;  3FK7 A;  2R7R A;  2BY2 A;  5DYM A;  1AWC A;  2DOA A;  5KAI C;  2D1V A;  5B3S H;  3NEU A;  2DT6 A;  3OIO A;  4ITV A;  5F6F A;  3DEU A;  4HA8 A;  2FD5 A;  5ICE A;  1FX7 A;  3DTI A;  4ENM A;  3HL2 A;  3LFU A;  3JRB A;  2QSG X;  4M9X A;  3DBL B;  1QPM A;  3KLO A;  1IUY A;  1TWA J;  2UZK A;  3RPQ A;  1HBX G;  2ZSH B;  1G8X A;  2YS9 A;  4B43 A;  4B47 A;  2ELK A;  5FLV A;  1XN7 A;  4AYB A;  2Z5U A;  1YIT I;  5D5W B;  2KHM A;  1HXD A;  1XMA A;  2O7O A;  4E7L A;  3QP6 A;  3KLN A;  1GT0 C;  2DFH A;  2E5N A;  4CXF A;  4CYC A;  2VC0 A;  3HIF A;  1ULY A;  3JRC A;  4A3L J;  3F8F A;  2X6W A;  3BR1 A;  1TLH B;  3DTK A;  3SJM A;  1MKM A;  2R7X A;  2WBM A;  3H0D A;  1KQ8 A;  1NTC A;  2X6O A;  2LF7 A;  2NOG A;  1FYM A;  2DTZ A;  1WPK A;  2M1B A;  5J8F A;  1I3A A;  1SD5 A;  2IGM A;  3H5N A;  3L00 A;  3RKW A;  4KYW A;  1XX5 A;  1VQK I;  1R00 A;  2FE3 A;  2Z3Y A;  2DDA A;  2QKL B;  5FFZ A;  2R7Q A;  4PFP A;  3F8C A;  2R7W A;  1OCZ H;  1XDU A;  4WXD A;  2Z9O A;  2WV0 A;  1OYW A;  2UV1 A;  2VPR A;  3L2W A;  2LRE A;  3ZQH A;  3HRM A;  1HOM A;  2F48 A;  3U21 A;  1S5L C;  4MLO A;  4XL9 A;  2OJE D;  2O61 A;  4YFN F;  1B59 A;  2V6E A;  3N4M A;  1USS A;  4Q47 A;  5F0F A;  2WWY A;  1QBJ A;  4ZJZ A;  3H3V K;  2JWT A;  1JXS A;  3QYE A;  3CJR B;  2ICW G;  1HW5 A;  1ZR4 A;  5EGO A;  5C44 J;  2FF4 A;  2VKE A;  5E3L A;  2OD5 A;  4NQW A;  1H0M A;  1P6R A;  4HOB A;  4A5N A;  4HRI A;  3KEY A;  2IA0 A;  4HAM A;  4CDG A;  2OUM A;  3HTU A;  2F5E A;  2FQ3 A;  2J5P A;  2LR8 A;  2VBW A;  2ESH A;  4GRI A;  4X0G A;  2OZU A;  2X4H A;  4AC0 A;  1J0R A;  2CUF A;  2QGU A;  2VE8 A;  3RQI A;  3V8L A;  3F23 A;  2JJ7 A;  2LC2 A;  4Y33 A;  2VBY A;  3M8F A;  4I7H A;  2FEZ A;  2ZME A;  3RJP A;  4GCV A;  1T95 A;  3PIP F;  4EJT A;  1DGR M;  2KZV A;  4D1Q A;  2L7F P;  5AIQ A;  4LLN A;  4EJV A;  2JTV A;  1VQ6 I;  2MSY A;  3S1Q J;  5KNL A;  2M2E A;  5GTI C;  1ENH A;  1EF4 A;  5FLX K;  3H9J A;  1SMT A;  3S14 J;  4YFX F;  3LWF A;  2ZJR F;  2M3A A;  1WVR A;  5EJC A;  1DP3 A;  3HOS A;  2E36 A;  2OF7 A;  5BS6 A;  1X1P A;  3GLX A;  1TWG J;  1IC8 A;  4BHP A;  1RR7 A;  1ZAR A;  3GF2 A;  2H09 A;  3CUQ C;  4CZC A;  1O3Q A;  3C7J A;  1K4T A;  2YR2 A;  3J81 K;  1LDD A;  3FMQ A;  4PSX A;  1W7P D;  2NS7 A;  2V9V A;  1PYV A;  1O4X A;  5LFA A;  1S3J A;  2HS5 A;  1ETY A;  4MGR A;  3TQN A;  3A01 A;  2MA3 A;  2OTL I;  3ASN H;  1K6O A;  4B3X A;  3I55 I;  4N9I A;  5F1R A;  2Y9Y A;  5J40 A;  3J7A Y;  1STZ A;  4FHT A;  1MDM A;  1MBH A;  2YSR A;  3RKY A;  3E6D A;  2OZ6 A;  4I01 A;  2XPU A;  1IN6 A;  2VC1 A;  4NC8 A;  5FKN A;  2MBF A;  3VFZ A;  2MG4 A;  3BJA A;  4D5C A;  2HR3 A;  3U1D A;  3LA2 A;  3BZ6 A;  2YUS A;  1WJ5 A;  4AD9 A;  2K9L A;  2P81 A;  1YIJ I;  1KA8 A;  2LP0 A;  1TNS A;  4PGH A;  3LSH A;  4H4K C;  1YG2 A;  4C3I J;  5HOD A;  1RUN A;  2ZXI A;  1SVM A;  1WI3 A;  2DA7 A;  1KQ0 A;  1T56 A;  3FM3 A;  2KFD A;  2XRO A;  4TV7 A;  4UUS B;  3MZH A;  4BE1 A;  3K70 C;  1Z6T A;  4XIC A;  1JTX A;  4CHU A;  3CCL I;  3GZN B;  1FP1 D;  2DW4 A;  4ZC3 A;  3PQK A;  3FXU A;  2QM3 A;  2EIJ H;  3VYR B;  3QOP A;  2XF5 A;  2DFF A;  2P6S A;  3MN2 A;  3ZMT A;  2XDV A;  4BXU A;  3TP3 A;  1UHS A;  1NH3 A;  2AS5 F;  1H88 C;  4JP0 A;  2QQ9 A;  3DEW A;  5FRM A;  3WG9 A;  1SFK A;  4HBL A;  3M8E A;  3A2K A;  4AVP A;  2YX4 A;  2K9M A;  2IBD A;  4ZYH A;  3S1M J;  2RC4 A;  2WB1 N;  3OYN A;  4IVN A;  5E8I A;  4JX6 A;  3FKI J;  3M7G A;  1D0Z A;  2OPT A;  2HGC A;  1X58 A;  4XN0 A;  3HSE A;  1ZH5 A;  3BJO A;  2W82 A;  4XLN F;  2LF8 A;  1Y1V J;  3U9G A;  3L1P A;  3BTC A;  1YW8 A;  3Q0U A;  2F4M B;  1OFC X;  4X1E A;  2XAJ A;  1JT0 A;  3HOV J;  1LNW A;  4E7H A;  5IOY A;  2HTJ A;  2V26 A;  2YU9 J;  2EB7 A;  3HUG B;  1GXP A;  4RGR A;  1X1D A;  3BG6 A;  1YW9 A;  4U0Y A;  4DBR A;  4Y15 A;  4IRH A;  3ECO A;  4RB1 A;  1WI9 A;  2PJR B;  4O3M A;  4H0E A;  4N4O B;  1P7J A;  3D1N I;  1R5G A;  4XR6 A;  2RKH A;  4HSR A;  2XAF A;  3OOU A;  4UXN A;  4S0H B;  3JRH A;  2GZW A;  3FMS A;  5J1R A;  2KLO A;  5KAF C;  3QYF A;  3KEQ A;  2EZH A;  3WTU C;  3KP2 A;  3OSG A;  2A6T A;  1ZRD A;  4M71 A;  1TBX A;  1W36 D;  1ETW A;  1WKM A;  2P4W A;  3CC7 I;  2DT7 B;  2QSF X;  4FQG A;  1V4R A;  2L54 A;  3ZCO A;  2XAQ A;  1RET A;  4LLG F;  2W7N A;  3LQQ A;  3KP5 A;  3SEZ A;  3OYJ A;  2DA6 A;  2QQA A;  2E1N A;  5H6Q A;  3LAP A;  3FWE A;  2CYY A;  3WG7 H;  3BG3 A;  1G3Y A;  2R7F A;  1FSH A;  1AHD P;  3JRI A;  3ROU A;  3K4M A;  1ZG5 A;  3BTJ A;  1FP2 A;  2A6E F;  2V1U A;  1Y8R B;  1T98 A;  4U87 A;  1B8I B;  2JQ7 A;  1JKP C;  3OL3 A;  2J5O A;  5M5X J;  4ZYA A;  2BW3 B;  2Z2S B;  2ME6 A;  3CCQ I;  2L01 A;  5JVG F;  3KZY A;  4IHS A;  2ADU A;  3LSG A;  4IPA A;  1ERD A;  2FBH A;  4BXX J;  4EGY A;  4XSX F;  3ISP A;  4YG2 F;  3P9I A;  1S9H A;  3MQ0 A;  4RLF A;  5KHD A;  1F36 A;  4F7Z A;  2M8E A;  1BIA A;  5D8K B;  3SXY A;  4NB5 A;  5L3E A;  1A04 A;  4I0A A;  2HQA A;  2FJ1 A;  4EM1 A;  1XGS A;  4J19 A;  4LK1 F;  3OYK A;  3A1Y A;  4HST A;  2M5W A;  3E6M A;  4NBQ A;  1GVJ A;  1G3T A;  3I58 A;  1Z67 A;  1LFB A;  2XPW A;  2FBK A;  2QA4 I;  2HYG D;  4JYK A;  4XSZ F;  1REP C;  5EZH A;  1KYZ A;  4G12 A;  4IKF A;  1YO5 C;  1R23 A;  1ETV A;  3SZP A;  4CZZ A;  1HDP A;  2RAE A;  3B73 A;  5CKT A;  1MBF A;  3VYS B;  1FPQ A;  1T0F C;  2ETH A;  4L0Y B;  3F0C A;  2M4G A;  2KPM A;  3SZG A;  2ID3 A;  2MGQ A;  2PN6 A;  3QPS A;  4P55 A;  2EV5 A;  3DFG A;  5K5Q A;  2LKX A;  4UB6 C;  1UG0 A;  2R7U A;  1FY7 A;  3CD6 I;  5AIP A;  5LRS A;  4L5I A;  1OCR H;  2CG4 A;  2EV6 A;  2VT2 A;  4EVI A;  1TTY A;  3TL4 X;  3JSO A;  1FJL A;  3E7L A;  4LIV A;  5B1B H;  5FB2 A;  4M3F A;  2QBY B;  2V1N A;  4FX4 A;  4DYC A;  4BAC A;  1UG2 A;  2CSO A;  2JA2 A;  9ANT A;  3J7Y J;  1SMY F;  3HRS A;  1LQ1 A;  1UST A;  4ETS A;  2G9W A;  1DU0 A;  1TWH J;  2EFW A;  2QWW A;  2HZD A;  4RBO A;  2XGD A;  3P5J A;  3OV8 A;  2L7M P;  4XMY A;  2CJJ A;  2O0Y A;  4RB0 A;  2W57 A;  1LFP A;  3TMO A;  4DOZ A;  2EZK A;  2ECB A;  1WGX A;  4PGG A;  1LJ9 A;  1T38 A;  1Z6R A;  2HKO A;  2QSH X;  2FRH A;  1WCM J;  2KKO A;  3HGG A;  4HV6 A;  4M3G A;  3PFY A;  5M3M J;  4HDU A;  1IAW A;  3TOA A;  4XQF A;  4UUS A;  4GO1 A;  5EEG A;  1FZP B;  2CRG A;  4LOC A;  5FGM A;  1V5E A;  3O8G A;  3B6C A;  2F5V A;  1VQ5 I;  1ZEL A;  4ZYD A;  4WK8 F;  3F72 A;  2P5K A;  4UB8 C;  2ZFU A;  1KU3 A;  3IH4 A;  3KCC A;  1RPW A;  3P9C A;  4G7O F;  2FML A;  1UHW A;  3V8J A;  4BXF A;  4Y17 A;  2HPM A;  1ACI A;  1IN7 A;  3ABL H;  1I6X A;  2JSC A;  3HHH A;  2CQQ A;  5ICF A;  3H35 A;  1ZN2 A;  1N78 A;  1IGN A;  1WJC A;  2L9S A;  2PMZ A;  3KP6 A;  2IJL A;  4U7B A;  4PJJ A;  1YIO A;  2A5Y B;  3BR0 A;  1I6H J;  3QQA A;  1X2N A;  3E5X A;  2DOF A;  4Q5S F;  1XD7 A;  5ERI A;  2KJC A;  3WGH A;  1IO2 A;  3J80 K;  1L3L A;  1VQ9 I;  2KRF A;  3FMR A;  3GTL J;  2K02 A;  2K4J A;  3BR5 A;  4XLP F;  1HCR A;  5FKK A;  2OA4 A;  3HUG A;  3L9F A;  5FKM A;  1R5I D;  4CYD A;  4IQJ A;  3TKY A;  2ZC2 A;  3GUD A;  3ONQ A;  5FRN A;  1JE8 A;  3OS2 A;  2HEO A;  3UR3 C;  3E97 A;  4XM3 A;  4EM2 A;  3CP2 A;  3EQL F;  5IPA A;  1MJB A;  4OIO F;  4G7Z F;  4AID A;  1KZH A;  1GLN A;  5BQT A;  3A0B C;  1BI0 A;  3IH3 A;  4UVC A;  3CCJ I;  2W24 A;  4QPQ A;  2VB6 A;  1IXR C;  3EET A;  1ITY A;  5JFR A;  1AKH A;  1C0W A;  6PAX A;  2RV8 A;  3QP5 A;  4BKX A;  4I6Z A;  1GXQ A;  2MH9 A;  3VSK A;  4JOM A;  3H5A A;  2MH2 A;  3GXO A;  5LGN A;  5GPC A;  1G2H A;  3FHN A;  1W1W E;  1G3W A;  3KP4 A;  5LHI A;  5CQE A;  3SZT A;  1PUF B;  5LHG A;  2ZKZ A;  2FSW A;  3QWL A;  3SHF A;  1MND A;  2BEO A;  1K83 J;  1JJ6 C;  2H6C A;  1ETK A;  5LBQ A;  5LEJ A;  4D5F A;  3WTY C;  4C9Y A;  5BMZ A;  3VB2 A;  1VZ0 A;  3GO5 A;  2LYC A;  1PUE E;  1IN5 A;  2R5Z B;  3TW6 A;  2G0E A;  3JRE A;  2XPV A;  2ZNY A;  1V54 H;  3AKZ A;  1VQO I;  4HLY A;  2DMQ A;  3HJE A;  4QIW N;  5HDN A;  1MMS A;  3NWS A;  5B1A H;  3ZQF A;  4BEH B;  5FRO A;  4IX7 A;  1I27 A;  5BPD A;  1MBG A;  4UVB A;  4UVA A;  1EH8 A;  3L2R A;  3HBL A;  3LSI A;  2BW3 A;  2ESN A;  3ZQL A;  2BY1 A;  2K86 A;  2MW8 A;  5HNF A;  2X48 A;  2V1X A;  4I98 B;  1JKR C;  1K78 A;  3W6J B;  3I5U A;  1FBU A;  1UAA A;  1Z05 A;  3OY9 A;  1X1B A;  2KDO A;  2HU9 A;  4Q48 A;  5M3F J;  2IPQ X;  3M1E A;  4EV0 A;  5EYR A;  3L2U A;  3LOC A;  1U8R A;  1YTY A;  5EEH A;  3LFK A;  2O9L A;  1TWC J;  3CUQ B;  2D5V A;  2IVM A;  3J81 Z;  4MFE A;  1TL8 A;  2L5Q A;  2H27 A;  4A69 C;  2ZFW A;  4BUP A;  4B1R A;  3S16 J;  2ZXW H;  5TJJ A;  2F6C A;  2YX7 A;  2BY0 A;  4RMN A;  3ZOB A;  4B4C A;  3OS0 A;  1ZRC A;  4KIB A;  2VPL A;  5HNH A;  1UFM A;  1OMI A;  2Y31 A;  3KP7 A;  4AU7 A;  3DP7 A;  2A61 A;  5HVQ C;  2K85 A;  3HHG A;  2KZG A;  1RES A;  2DOD A;  2XGE A;  1FTZ A;  1PJR A;  3FIS A;  3F22 A;  4OOI A;  1WZ2 A;  2BXY A;  2XV4 S;  5J47 A;  3EUH A;  1U0J A;  5GPA A;  4F52 A;  3FKJ A;  1IRG A;  3CF2 A;  2CQ7 A;  1SVO A;  5E18 F;  1NK2 P;  3I59 A;  2QBY A;  2AQF A;  2Y0S N;  1I5Z A;  4ESB A;  3CES A;  3KPH A;  1Z77 A;  1RKW A;  2L9N A;  1JUM A;  3BG5 A;  2VON A;  3CCR I;  1Z7L A;  1TWF J;  2LH9 A;  1BI1 A;  3WE3 A;  4XRF A;  1T39 A;  1KQ9 A;  2DOE A;  2KIF A;  2VBZ A;  1XGN A;  1U8B A;  3PUB A;  2B0L A;  3AG3 H;  1U9N A;  4LJZ F;  4BY1 J;  4EEF G;  4XNF A;  4Q4Z F;  5IT9 Z;  4MFD A;  2IGO A;  3GFI A;  4U88 A;  3GTQ J;  2N8G A;  1YJW I;  3IC7 A;  1SD6 A;  1K79 A;  5LRR A;  4XID A;  1ZLJ A;  1E17 A;  1Q1H A;  1FLI A;  2QQ8 A;  2JK3 A;  4YEL A;  1FYK A;  2BXZ A;  3MCZ A;  2HVR A;  4QLC U;  1IW7 F;  2CMP A;  2DMP A;  2E7W A;  2JA7 J;  4ZYE A;  1D0Y A;  2Y48 A;  3COA C;  1WQ2 A;  2XVC A;  4OU0 A;  2JA8 J;  4IXA A;  1F1Z A;  3Q3S A;  4JBA A;  3FZV A;  3GTP J;  1B1B A;  3RSN A;  1IXC A;  2BY3 A;  3JAM K;  2X0L A;  5FKO A;  3CCM I;  1YLF A;  4L9V A;  4LIT A;  3CJQ B;  3FIW A;  3ZN1 A;  3BT9 A;  2K9N A;  3CMY A;  2FBI A;  2RDP A;  4AIK A;  4BBS J;  5C4X J;  2HQ5 A;  3MKL A;  1V5G A;  2FMY A;  4BY7 J;  1T6S A;  3O3K A;  4JX4 A;  1YE9 A;  2DBB A;  4Y13 A;  5DM6 F;  1T33 A;  1SFE A;  4LGW A;  1MD0 A;  4M3B A;  4OAY A;  3CJT B;  2OU2 A;  5IYD J;  3WTZ A;  2F4O B;  4L9T A;  3WTX C;  3S93 A;  2VLA A;  1D0X A;  2Z99 A;  3PM1 A;  3SEQ A;  1YW7 A;  1RZ4 A;  3QAH A;  1V5F A;  1ZGA A;  3DTE A;  3GCM A;  3VPR A;  3BPX A;  3I64 A;  4F3Q A;  4M3D A;  2QZ8 A;  4Y3O A;  2AHQ A;  2HNH A;  2CUE A;  2VKD A;  4GYG A;  2DA1 A;  2AO9 A;  4W1U A;  2A68 F;  1ETO A;  1YS6 A;  3BPV A;  3REO A;  5D6F A;  3K4J A;  4CCK A;  1YI2 I;  3OYL A;  5GAE J;  1X4P A;  3R0J A;  3DLA A;  4GDF A;  3PL8 A;  4FIS A;  2LY2 A;  1MGT A;  1N77 A;  3IUO A;  3G1L A;  3JW4 A;  4HG2 A;  5FJ8 J;  2L9V A;  2IT0 A;  2PEX A;  4OIR F;  3E6B A;  3OL4 A;  1MW7 A;  1VQM I;  3TO7 A;  2L4A A;  4B3A A;  4BJT A;  5D4R A;  2ZBK A;  1PUF A;  1QU3 A;  3GZ6 A;  3H92 A;  3GFM A;  1HST A;  3O2P E;  4GYI A;  1FBS A;  2GIZ A;  1TC3 C;  2CO5 A;  3OOP A;  4BYY A;  2LRD A;  3C2B A;  3RCO A;  2VQH A;  3MAJ A;  3BTL A;  2LLK A;  3R4K A;  3HGY A;  2DLL A;  3A0H C;  1EA3 A;  3ZMV A;  1CGP A;  3I9V 2;  4BDY A;  3S17 J;  2HPI A;  5JLW A;  3RPU A;  4BEH A;  5D5V B;  4F91 B;  3TDU C;  1ZG3 A;  1RR8 C;  3QPT A;  1HC8 A;  2D2W A;  2Y30 A;  1UJ8 A;  2CUZ A;  2VT3 A;  4XKW A;  2EZI A;  2LD5 A;  5HLG A;  3T5X A;  4N9H A;  1JGS A;  1G3S A;  2JN6 A;  2WAE A;  4A3E J;  2QUF A;  1BJZ A;  1DU6 A;  3V7C A;  3Q5F A;  2OQG A;  1ZRF A;  2XB5 A;  4BNC A;  2EFN A;  3T0Y A;  3RQ4 A;  5EF6 A;  2G7H A;  3JTH A;  5AON A;  2O5R A;  1RI7 A;  2QEX I;  5EEA A;  4QTR A;  1IG7 A;  4HNV A;  2P5L C;  2CV1 A;  3IKT A;  2WTE A;  2X51 A;  2IS4 A;  3MVP A;  2LBF B;  4A3B J;  5HLT A;  2I5U A;  5E20 A;  2HFH A;  4FT8 A;  2GA2 A;  3I54 A;  3CUQ A;  3IWZ A;  2L3D A;  1MSF C;  2VJI A;  3TED A;  3WTW C;  1R4M B;  2JA6 J;  4G7H F;  3D0S A;  4N0B A;  2DU9 A;  3GTG J;  4ZTF A;  2Q2E B;  4QWQ A;  4WWC A;  2MYS A;  3HOY J;  1QO0 D;  4IL6 C;  3BR6 A;  4HX7 A;  4ANJ A;  3KZZ A;  3PO3 J;  1SAN A;  2IA1 A;  2O6G E;  1W5C C;  1YJ9 I;  4KJZ A;  1BW5 A;  3ZP5 A;  3GVA A;  2YPR A;  1WHU A;  3JSP A;  5K5O A;  4J01 A;  2L4M A;  4RM2 A;  4D9J A;  4ZZL A;  4XKB A;  4PJL A;  4RAF A;  3RKQ A;  1JUS A;  1XDS A;  3S32 A;  3AAF A;  1ZK8 A;  2OV7 A;  5GAD J;  1O7F A;  5HLI A;  2QVO A;  1YQA A;  1I50 J;  1Z7U A;  4RGS A;  1G59 A;  4RAG A;  4B48 A;  3CCY A;  1WSU A;  4YFK F;  3CDI A;  3B6A A;  2WA0 A;  4HX8 A;  2ZJP F;  3K2A A;  1VFC A;  2NOJ B;  4EMS A;  1BOA A;  3TP0 A;  5LD2 C;  2KIM A;  3S3O A;  2HDC A;  1JHH A;  2DJI A;  3GX4 X;  2VUM J;  1D8K A;  3ZQ7 A;  2KIS A;  3WGI A;  3JRG A;  2R7V A;  2W48 A;  2XB0 X;  5L3F A;  1ZKG A;  1JUP A;  4NUB A;  4CCM A;  1HKS A;  3AG4 H;  4IOC F;  3W3C A;  3RYR A;  3DWL E;  3MKW B;  1XSD A;  2HYF A;  3PQJ A;  3F9K A;  3FK6 A;  5LEK A;  3HXL A;  2XC7 A;  5DUK A;  1XS9 A;  2ME0 A;  2DN0 A;  4MQ9 F;  2K7L A;  4MTE A;  1CQT A;  1JTY A;  4E7S A;  2HVS A;  5JI6 A;  1IF1 A;  2NRA C;  1GV2 A;  2VI6 A;  3UKG A;  1OCC H;  2EIL H;  2NXN B;  2GOX B;  4O5V A;  3CDL A;  4IOA F;  1O3S A;  4L5E A;  2H1L A;  1A36 A;  3CQZ J;  4KIT B;  1LDK B;  3HZJ A;  2STW A;  3W2A A;  4IZZ A;  5K5R A;  3HEF A;  2O8X A;  3V42 A;  4D7N A;  4CUG A;  2VN2 A;  3LSK A;  2M9H A;  3HOW J;  2VQL A;  2L2O A;  5EG0 B;  3KYC B;  3K4B A;  4XKV A;  3HRU A;  3BC8 A;  1Y0U A;  1UMQ A;  4ESJ A;  1MH4 A;  3K1P A;  2GQQ A;  1QQI A;  2COB A;  1QVT A;  3DEE A;  3N97 A;  2QLZ A;  3ABK H;  5IP7 J;  5L3D A;  2NVY J;  2RQQ A;  3C2H A;  5ICG A;  2OC6 A;  2GXA A;  2HWV A;  1I1S A;  4B44 A;  3BCB A;  2DDB A;  3G71 I;  4IJA A;  2E19 A;  2ZXH A;  4G94 A;  4A2U A;  1ZLK A;  5J4V A;  3CLQ A;  2DI3 A;  2W1O A;  2ID6 A;  3DBR B;  3D5S C;  2QEN A;  3H9G A;  1SD4 A;  2HOS A;  1QNT A;  2LOO A;  2NNY A;  5JVT A;  5BNG A;  2LTP A;  3WGG A;  1YRN B;  3HDD A;  2DJN A;  3RI4 A;  4A3K J;  4KNY A;  3BJ6 A;  2DFE A;  2EIM H;  3I56 I;  5F08 A;  1U5T C;  3VSL A;  1V3F A;  3FF5 A;  3RZO J;  4KIG A;  3M3Y J;  4CCL A;  2V79 A;  4Y4R A;  5CPR B;  3F3X A;  2K5C A;  4AIH A;  4XBF A;  4CCJ A;  4B8X A;  3PJR A;  4IEJ A;  4G6Q A;  4ZDL A;  4JQF A;  1WWX A;  2WAQ N;  4EQQ A;  3ZPL A;  2PBI A;  4RB3 C;  2GWR A;  5BOX A;  2BVL A;  3O8H A;  2M4K A;  1BW6 A;  1MIJ A;  4IHX A;  1D5Y A;  2M34 A;  3L2C A;  4IRI A;  3K4L A;  5IOZ A;  2EIN H;  3PIO F;  4UNO A;  4DQ2 A;  3V4G A;  1MH3 A;  4HLX A;  2CH0 A;  3RPU D;  3CMA I;  2VKV A;  2R7O A;  1M1E B;  1QZZ A;  1U2W A;  3RZD J;  3EYY A;  1VQL I;  2FXA A;  1R58 A;  1Q1V A;  5JHF A;  4KIF A;  2BZT A;  1LE8 B;  2STT A;  2VOP A;  1OR7 C;  1FTT A;  5ICC A;  1FT9 A;  2VJ4 A;  1LPQ A;  2MFZ A;  5F04 A;  3IP4 B;  5FO5 A;  3OWT A;  4BQQ A;  3GTK J;  4A3G J;  4UV8 A;  3DPL C;  1Y8Q B;  2DXI A;  1VI0 A;  3CO7 C;  4V19 K;  3ELK A;  3GFL A;  4PJN A;  3ZRG A;  4KFC A;  3BZK A;  1ORK A;  1WJD A;  5ILU A;  5E3N A;  3K4K A;  5CVV A;  2F5C A;  3ESW B;  3TDZ C;  5A2Q K;  2M7B A;  2W84 A;  1VTN C;  2IS1 A;  3JRD A;  5CVR A;  4CCN A;  1OLT A;  4BH9 A;  1IN8 A;  3S3N A;  2XKO A;  1FNN A;  5GAG J;  2E2J J;  2RN7 A;  2Q1Z B;  2OQR A;  1T08 B;  2LKP A;  1BC7 C;  1UHM A;  1UB9 A;  3L09 A;  4BQO A;  2XRL A;  3IKV A;  1O57 A;  1BJA A;  1R36 A;  1S6L A;  2V4J C;  3HC7 A;  3I3L A;  5JR3 A;  1D1B A;  4BHC A;  2LBF A;  1TW2 A;  2XF7 A;  4FX0 A;  4MO7 A;  4HF2 A;  4KMF A;  3VOE A;  1T0F A;  3LNQ A;  3W2V A;  3LSM A;  3Q9V A;  3AL0 B;  3F21 A;  5H6R A;  4OWR B;  3T1B A;  3ZQQ A;  2Q2E A;  3BR2 A;  3DCF A;  2Q0O A;  1ZGJ A;  2HOA A;  1R1U A;  4XOR A;  1YS7 A;  1OCO H;  2JT1 A;  2R5Y B;  1SFO J;  1A6Q A;  3ABT A;  2YU3 A;  2WB1 A;  3MZY A;  1TQM A;  4DW6 A;  3F6O A;  2W00 A;  3B02 A;  2QKM B;  4DYR A;  2F5D A;  3MWM A;  4C2T A;  2P7V B;  1B6A A;  3GZ5 A;  3DQV C;  3M9A A; 
#chains in the Genus database with same CATH homology
 4XRM A;  3LOC A;  3OSF A;  3H3V K;  2JWT A;  2O9L A;  1TWC J;  1ZR4 A;  5EGO A;  5C44 J;  2D5V A;  2VKE A;  5E3L A;  5K7F A;  2GLO A;  4MFE A;  1IJW C;  3IH2 A;  4A69 C;  4C3H J;  3GTJ J;  4B1R A;  3S16 J;  4DZJ A;  2I10 A;  3ZOB A;  4B4C A;  3HOZ J;  2LR8 A;  2HXI A;  2ECC A;  5J1U A;  2Y31 A;  4M3E A;  4AC0 A;  2CUF A;  3RQI A;  5FLM J;  2JJ7 A;  1RES A;  4V2F A;  2CU7 A;  2XGE A;  3HKZ N;  1FTZ A;  3FIS A;  5C3E J;  5F27 A;  5GPA A;  5DS9 A;  2L7F P;  3BR3 A;  4XRS G;  2MSY A;  3S1Q J;  2M2E A;  1NK2 P;  1ENH A;  1AKH B;  2Y0S N;  5DTD A;  1EF4 A;  2K40 A;  2PMZ N;  1Z77 A;  1RKW A;  4IHW A;  3S14 J;  4A3D J;  1JUM A;  3BG5 A;  4NDL A;  1MBJ A;  1TWF J;  2OF7 A;  4BBR J;  2TRT A;  1TWG J;  1IC8 A;  1HLV A;  2EBI A;  1RR7 A;  1U8B A;  1JGG A;  1U9N A;  4C2M J;  4EEF G;  4BY1 J;  4MFD A;  3GTQ J;  2N8G A;  2DMU A;  2NS7 A;  4A3C J;  1O4X A;  3A03 A;  4XID A;  4UUT A;  2KDZ A;  1B72 B;  1ETY A;  5EG0 A;  3A01 A;  2JK3 A;  2R93 J;  2DMT A;  3LSP A;  1H89 C;  1BL0 A;  2Y9Y A;  2DMP A;  2JA7 J;  1W0U A;  1POG A;  4AYB N;  2HI3 A;  3ZQI A;  3HOX J;  1MBH A;  2QCO A;  2XPU A;  2XGC A;  5M3F J;  2JA8 J;  5M5W J;  1APL C;  5FKN A;  3Q3S A;  2MG4 A;  3GTP J;  4D5C A;  1X2M A;  5FKO A;  2YUS A;  1VF9 A;  2DA3 A;  5EZG A;  3FIW A;  2P81 A;  2NVT J;  5K7H A;  2LP0 A;  3BT9 A;  4FE7 A;  2K9N A;  3CMY A;  1GV5 A;  4C3I J;  5HOD A;  5E3O A;  5K7Z A;  5EGO B;  1OJL A;  4BBS J;  5C4X J;  2HQ5 A;  1WI3 A;  2DA7 A;  3MKL A;  1S7E A;  2GBY A;  1FIP A;  4BY7 J;  4JX4 A;  1T56 A;  4DZP A;  1T33 A;  3WHB A;  4UUS B;  1A5J A;  4M3B A;  4XIC A;  1U9O A;  1JTX A;  1FEX A;  1WH5 A;  2JA5 J;  2X9D A;  1B8I A;  5IYD J;  5EDN A;  4IHV A;  4A3F J;  3MN2 A;  2HXO A;  1P7I A;  3PM1 A;  3TP3 A;  1UHS A;  1H88 C;  3VPR A;  4JP0 A;  3DEW A;  4M3D A;  2AHQ A;  2CUE A;  2R7Z J;  2HOT A;  2IBD A;  3S1M J;  2DA1 A;  2WB1 N;  2AO9 A;  4JX6 A;  3FKI J;  4W1U A;  1ZTR A;  5IP6 A;  3W6V A;  2CQX A;  2OPT A;  3K7A J;  1X58 A;  4FCY A;  5C4J J;  1ETO A;  1Y1V J;  1W0T A;  3L1P A;  3BTC A;  3JRF A;  2NVX J;  3Q0U A;  3HB9 A;  1OFC X;  1RKT A;  4X1E A;  1JT0 A;  4FIS A;  1MNM C;  2E2H J;  1K61 A;  3HOV J;  3G1L A;  5FJ8 J;  3BTI A;  5IOY A;  4XRS A;  2YU9 J;  2Y2Z A;  4B3A A;  1PUF A;  3I4N J;  5IYB J;  4A3I J;  4M6V A;  1AU7 A;  3A02 A;  1TC3 C;  1Z0X A;  1R9T J;  2HDD A;  3TW7 A;  2L0K A;  3C2B A;  3LSR A;  3BTL A;  2LLK A;  1P7J A;  3D1N I;  2L9R A;  3HGY A;  1NK3 P;  5IYC J;  3OOU A;  4S0H B;  3JRH A;  3S17 J;  1BA5 A;  5JLW A;  5J1R A;  1ZGW A;  2EZH A;  2Y30 A;  2JMW A;  3OSG A;  2EZI A;  2LD5 A;  1ETW A;  2JN6 A;  4CYC B;  4A3E J;  2KT0 A;  1IRZ A;  1BJZ A;  2XSD C;  1DU6 A;  2R5Y A;  2XB5 A;  1IV6 A;  5EF6 A;  5EEA A;  4QTR A;  1RET A;  1IG7 A;  4HNV A;  4C3J J;  2DA6 A;  3MVP A;  4A3B J;  3BG3 A;  1MBE A;  3S2H J;  3GBG A;  3JRI A;  3ZQG A;  1AHD P;  3BTJ A;  1MSF C;  3TED A;  2JA6 J;  1B8I B;  1JKP C;  4IHY A;  3LSJ A;  5M5X J;  3GTG J;  1F43 A;  3HOY J;  2ME6 A;  4X6A J;  3BR6 A;  3IV5 A;  2QF7 A;  4Y52 J;  3PO3 J;  1SAN A;  2HYJ A;  1BW5 A;  3LSG A;  5J1Y A;  2FQ4 A;  4BXX J;  4GFB A;  2DA4 A;  2FX0 A;  1JUS A;  2M0C A;  3RKQ A;  1IDZ A;  1ZK8 A;  1F36 A;  1I50 J;  1YRN A;  5IP9 J;  3CCY A;  3B6A A;  2FJ1 A;  2M8G X;  4J19 A;  3K2A A;  2EZL A;  5M5Y J;  1VFC A;  4QSH A;  1LFU P;  3SDG A;  3PO2 J;  1LFB A;  3Q0V A;  2XPW A;  2NVQ J;  3TP0 A;  4JYK A;  5F1J A;  2VUM J;  5EZH A;  1ZR2 A;  1ETX A;  4G12 A;  1FIA A;  3JRG A;  2W48 A;  2XB0 X;  1ZKG A;  1JUP A;  1ETV A;  1WH7 A;  1XG1 A;  1HDP A;  2RAE A;  4A3M J;  1MBF A;  3GTM J;  5J3L A;  2L7Z A;  3F0C A;  1A6I A;  3QPL A;  2ID3 A;  3S15 J;  2MGQ A;  5E3M A;  2LKX A;  3QPS A;  3FK6 A;  2DA5 A;  1MBK A;  3S2D J;  3ZQC A;  1XS9 A;  2ME0 A;  4XK4 A;  1H8A C;  2DN0 A;  3Q0W A;  1B72 A;  1LE8 A;  1FJL A;  2K9S A;  1CQT A;  4RDU A;  1JTY A;  3E7L A;  4M3F A;  1OCT C;  1E3O C;  3S1N J;  3I4M J;  1GV2 A;  2VI6 A;  4DYC A;  3UKG A;  1UG2 A;  9ANT A;  2ZB9 A;  3CDL A;  4L5E A;  4A93 J;  1IUF A;  1DU0 A;  1TWH J;  2EQR A;  5GP9 A;  3CQZ J;  4W97 A;  4RBO A;  2XGD A;  1ZQ3 P;  1QRY A;  2K9Q A;  2L7M P;  2DA2 A;  2CJJ A;  2LVS A;  1HDD C;  3HEF A;  4MIM A;  5JLX A;  2O8K A;  2R92 J;  2EZK A;  4D7N A;  2ECB A;  1WGX A;  4FTH A;  1Y1W J;  2M9H A;  3HOW J;  3HOU J;  5EG0 B;  1WCM J;  3A01 B;  1JKQ C;  3HGG A;  4JX5 A;  2R5Z A;  1UMQ A;  1MH4 A;  4M3G A;  5M3M J;  2COB A;  4Y7N J;  3JRA A;  1QVT A;  1QVU A;  4UUS A;  5IP7 J;  2NVY J;  2CRG A;  4AUX A;  2IEK A;  4LOC A;  3JR9 A;  1JT6 A;  2WV1 A;  3BQZ A;  3H0G J;  5F0H A;  4A3J J;  3O8G A;  1OCP A;  3B6C A;  1QPI A;  2E19 A;  3BG9 A;  2NS8 A;  3IH4 A;  2R0Q C;  3WHC A;  4I76 A;  3G1O A;  1VND A;  1RPW A;  2LY9 A;  2ID6 A;  1MSE C;  3G1M A;  2HOS A;  4ABZ A;  1XC5 A;  5BNG A;  2LTP A;  1YRN B;  3HDD A;  2DJN A;  4A3K J;  2TCT A;  1JJ8 C;  1GUU A;  5F08 A;  3GTO J;  3M4O J;  2H8R A;  2H1K A;  3RZO J;  2CQQ A;  3M3Y J;  2IAI A;  4V2G A;  1IDY A;  1IGN A;  1GDT A;  3BR0 A;  1I6H J;  4IEJ A;  3QQA A;  1X2N A;  2WAQ N;  3FK7 A;  2LFB A;  3O8H A;  4D7M A;  1HF0 A;  1BW6 A;  4IHX A;  2B63 J;  1D5Y A;  2M34 A;  3SFI A;  3GTL J;  3BR5 A;  1HCR A;  5FKK A;  5IOZ A;  5FKM A;  3OIO A;  1MH3 A;  4DYQ A;  2VKV A;  2DMN A;  5F0C A;  2FD5 A;  1ETQ A;  3RZD J;  2E1O A;  2GM4 A;  1Q1V A;  1U78 A;  1FTT A;  3JRB A;  1LE8 B;  5IPA A;  2EH3 A;  3HM5 A;  3BQY A;  5F04 A;  1TWA J;  3GTK J;  4A3G J;  3IH3 A;  2YS9 A;  1VI0 A;  2ELK A;  5FLV A;  1GVD A;  1ITY A;  1AKH A;  1ORK A;  4BKX A;  4I6Z A;  2O7O A;  5E3N A;  1GT0 C;  5GPC A;  1G2H A;  4CYC A;  3JRC A;  1PUF B;  4A3L J;  3JRD A;  3BR1 A;  3SJM A;  1K83 J;  1JJ6 C;  1ETK A;  2E2J J;  2E2I J;  4D5F A;  1NTC A;  2X6O A;  2NOG A;  2DTZ A;  2LK2 A;  1WPK A;  2XRL A;  2R5Z B;  3TW6 A;  2G0E A;  3JRE A;  2XPV A;  2DMQ A;  4QIW N;  4MO7 A;  3LNQ A;  3ZQF A;  1MBG A;  1I3Q J;  3HBL A;  4FE4 A;  5FKL A;  3ZQL A;  3BR2 A;  3DCF A;  2MW8 A;  3NAU A;  2HOA A;  2VPR A;  2X48 A;  3NAR A;  3ZQH A;  1HOM A;  2R5Y B;  1JKR C;  1SFO J;  2Y9Z A;  4MLO A;  4DW6 A;  1JKO C;  4DYR A;  3S1R J;  5F0F A;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...