1AKHB

Mat a1/alpha2/dna ternary complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhB00
1H88C 5F04A 4A3JJ 2LFBA 2DA6A 3LOCA 4QSHA 2NVTJ 1X58A 1IDZA 1JKRC 4Y7NJ 4IHVA 1DU0A 5HODA 1GV2A 4A93J 5EF6A 1HDDC 1Z0XA 4BY7J 1RETA 2ME6A 1JKOC 4M6VA 4B4CA 4UUSB 1GT0C 5E3MA 4C2MJ 2GM4A 2E2JJ 2DA3A 1W0TA 5IP7J 1MBGA 3IH4A 3CCYA 1WGXA 4DYCA 1ZR2A 3W6VA 4W1UA 2O7OA 1BJZA 1Y1VJ 1MBJA 3ZQLA 3H3VK 4QIWN 4M3BA 2AHQA 3RKQA 2I10A 3ZQGA 2JA5J 2EZKA 2DMUA 1I50J 2K9SA 3G1LA 3Q0VA 1I6HJ 4XICA 2FD5A 3SDGA 1YRNB 2IEKA 3QPLA 2R0QC 3ZQIA 2Y2ZA 1TWCJ 5FKNA 2XPVA 1JKPC 1JUSA 3PO2J 1G2HA 1ZKGA 1ETKA 2MG4A 4A3IJ 1IG7A 1YRNA 2LTPA 2NOGA 1U9OA 2M8GX 5J1UA 3WHBA 3LSGA 2HXOA 1QPIA 1FTZA 3LNQA 3CQZJ 4DYRA 3S1QJ 4A3GJ 2CJJA 2N8GA 5C4XJ 2OF7A 1NK3P 1B8IB 2DA2A 2M9HA 1NK2P 2ID6A 4I76A 1H8AC 3MKLA 2LVSA 1B8IA 1ENHA 4MIMA 1OFCX 1XS9A 1WCMJ 5F08A 1ZGWA 3S15J 2K9NA 1IV6A 3I4NJ 3HDDA 4D5FA 1MBFA 2AO9A 3JRDA 3K2AA 2ME0A 3S16J 2DA7A 3HOYJ 1FJLA 2MSYA 4MFDA 1SANA 4XK4A 3A01A 4JX4A 3BQZA 5M3FJ 1APLC 1CQTA 5E3LA 5IOYA 1D5YA 3S2DJ 1ETYA 2MGQA 9ANTA 2CQQA 5C4JJ 2P81A 1ITYA 3TP0A 5E3OA 3GTJJ 5J3LA 4J19A 2E2HJ 4BY1J 2X48A 3BR3A 2CUFA 2JMWA 1TWAJ 5F0HA 1AHDP 1JGGA 1I3QJ 2VUMJ 1ETXA 4FE4A 4IEJA 2R93J 3Q0WA 4BKXA 3LSPA 4DZJA 4DYQA 5C44J 1JUMA 1IDYA 1U8BA 2XGDA 1WH5A 2DA5A 5EGOA 2XSDC 5M5WJ 1PUFB 2H8RA 1JT6A 4MLOA 1W0UA 2EZHA 2E19A 3QPSA 4MFEA 1OCTC 5EZHA 1JJ6C 5M5YJ 2TRTA 5F0CA 1K61A 4CYCB 1PUFA 2D5VA 2ZB9A 1MH4A 3NAUA 2Y9ZA 2DTZA 3HB9A 5GPAA 5K7FA 4FISA 2NVQJ 2R5ZB 4RDUA 2MW8A 4A3KJ 1IJWC 3RQIA 3BR0A 1FTTA 2CRGA 4QTRA 3HBLA 5EYRA 3FKIJ 3WHCA 2R5ZA 3GTQJ 2YS9A 4UUSA 3FISA 3BTIA 1T33A 4DZPA 2XB5A 1U78A 1GUUA 3S2HJ 2DMTA 5FKLA 2HOTA 3ZQCA 1LE8B 2X9DA 5DS9A 3ZQHA 4B1RA 2EBIA 4M3DA 1MBKA 3MVPA 1GVDA 2VKEA 3H0GJ 1ZR4A 3S14J 3S17J 5GP9A 1Q1VA 3K7AJ 3HOUJ 3GTKJ 4AC0A 1QVUA 1X2NA 1P7JA 3JRCA 2DA1A 4XRSA 3DEWA 2FX0A 2HOAA 2NS8A 1WI3A 2EH3A 3BTJA 3HOXJ 2M34A 3TP3A 1JKQC 4V2FA 2W48A 3JR9A 2DMPA 2L9RA 5EG0B 3A02A 4L5EA 4LOCA 4BXXJ 5EDNA 1AKHB 3IH3A 2DMNA 2XRLA 1NTCA 1OJLA 2PMZN 3BT9A 1MH3A 4JX5A 2R7ZJ 4ABZA 3JRAA 5EG0A 1LFBA 1VF9A 2ELKA 1RR7A 2DMQA 4BBRJ 2WAQN 2JA7J 1AU7A 4X1EA 3BR1A 4NDLA 2O8KA 2M2EA 4JYKA 1MBHA 3OOUA 1H89C 1XC5A 1TWFJ 3BR6A 2LP0A 1GDTA 4JX6A 2K40A 3PM1A 1ETOA 2NS7A 4M3GA 5FKOA 5IOZA 3NARA 2H1KA 1A6IA 4S0HB 3JRFA 3D1NI 3BG3A 2GBYA 3BQYA 1TWHJ 4MO7A 4HNVA 3HEFA 2XPUA 2HOSA 2L7MP 1E3OC 4XRMA 2JA8J 3RZOJ 1POGA 2FQ4A 1TC3C 2QCOA 2VPRA 4A3CJ 3IH2A 1FIPA 2CQXA 2EZIA 3CMYA 2XGCA 1Z77A 3TEDA 2LR8A 3JREA 3F0CA 5FLVA 3BG5A 5K7HA 3JRIA 2LLKA 3O8GA 1VNDA 3B6AA 2EZLA 5FLMJ 5IP6A 2JA6J 4IHYA 2LKXA 4A3DJ 2XPWA 3BR2A 2VKVA 3HGYA 1BW5A 2HQ5A 2L0KA 1FEXA 2L7FP 2B63J 4W97A 4D5CA 4I6ZA 3VPRA 1HOMA 4AYBN 1X2MA 5M3MJ 3GTMJ 3MN2A 3B6CA 1UG2A 2O9LA 2DN0A 3UKGA 1F36A 2HYJA 4IHXA 4C3HJ 1DU6A 2XB0X 4FE7A 1MSEC 2LK2A 5F1JA 2TCTA 3Q0UA 4A3FJ 3GTPJ 3M4OJ 4D7NA 1IC8A 3BTCA 3Q3SA 4V2GA 5F0FA 3ZOBA 3GTGJ 2LY9A 5EEAA 4DW6A 3C2BA 2FJ1A 3OSGA 4A3BJ 4GFBA 1QVTA 2OPTA 1S7EA 2QF7A 3I4MJ 5K7ZA 1ZK8A 4CYCA 4G12A 1HCRA 4UUTA 1LFUP 2Y0SN 4C3JJ 2COBA 3S1NJ 2JJ7A 5DTDA 3S1RJ 3LSRA 1JUPA 4XIDA 3JRBA 3HOZJ 1EF4A 1O4XA 1U9NA 4JP0A 2DJNA 1ETQA 2WB1N 1WPKA 3M3YJ 2L7ZA 4M3EA 2JWTA 5E3NA 4M3FA 3BR5A 2HI3A 2JK3A 1T56A 2RAEA 3LSJA 1LE8A 5JLWA 1R9TJ 5J1YA 4FTHA 2G0EA 3JRHA 1RKWA 3OIOA 2R5YB 1BA5A 5IPAA 5BNGA 4A3MJ 4A69C 1SFOJ 1B72B 3CDLA 2NVXJ 1RKTA 1IGNA 1Y1WJ 5FKKA 2R5YA 3TW7A 4FCYA 2YU9J 4XRSG 2R92J 1FIAA 1B72A 2JN6A 1RESA 3IV5A 2Y31A 4X6AJ 1IUFA 1AKHA 1ETWA 2VI6A 1VI0A 2XGEA 4RBOA 1JTYA 1QRYA 2HDDA 1ZTRA 3GBGA 3E7LA 3FK7A 3PO3J 3DCFA 1HDPA 2KDZA 3GTLJ 1UMQA 2WV1A 5FKMA 1JJ8C 3GTOJ 2ECBA 2EQRA 5J1RA 1IRZA 1UHSA 1P7IA 5C3EJ 3TW6A 3HM5A 2LD5A 2ECCA 5EZGA 1VFCA 3HGGA 5IYCJ 1OCPA 3QQAA 1WH7A 4C3IJ 3S1MJ 4Y52J 3A03A 1MBEA 1F43A 5M5XJ 3BG9A 1HLVA 3O8HA 5F27A 4EEFG 2DA4A 1K83J 2K9QA 2Y9YA 5IYDJ 1BW6A 2IAIA 1RPWA 3A01B 3FK6A 3OSFA 4D7MA 4A3EJ 2GLOA 2E1OA 1A5JA 3G1OA 1JT0A 3RZDJ 3HOVJ 3FIWA 1HF0A 5FJ8J 1JTXA 4B3AA 3HKZN 4BBSJ 2YUSA 1ORKA 2ID3A 3HOWJ 3ZQFA 1ETVA 5JLXA 2M0CA 1BL0A 1GV5A 2X6OA 2HXIA 4AUXA 3SFIA 2KT0A 5GPCA 2CUEA 4IHWA 2IBDA 3G1MA 4A3LJ 1MSFC 2CU7A 1TWGJ 3BTLA 5EGOB 3JRGA 2E2IJ 1XG1A 5IP9J 3SJMA 1MNMC 2NVYJ 2Y30A 1ZQ3P 5IYBJ 3L1PA
chains in the Genus database with same CATH superfamily
2K86A 2FBKA 4HZFA 1JGSA 3VWBA 2DA6A 1IXRC 2A6TA 3DPLC 2FNPA 2F5FA 4QSHA 5DV5A 3KX2A 5AIQA 1O7LA 1X58A 4XOTA 4LJZF 3SZPA 1R1TA 2RDPA 4L5IA 4M9ZA 5HODA 4BDZA 2K4BA 1Z05A 4MNUA 2QSGX 5GTHC 2NAZA 3MAJA 4A0YA 2OD5A 5ICEA 3BG6A 3CD6I 1SFEA 5HS7A 2FU4A 1B59A 3ELKA 2TDXA 2DW4A 4YIFA 3PUFA 4B4CA 4UV8A 2X6YA 5FB2A 3OYFA 2MLGA 2JRMA 3DBLB 4FX4A 5E3MA 4M71A 1J2XA 1E3PA 2E2JJ 5D5UB 2DA3A 3PNYA 3DQVC 3DFGA 3GCMA 4P96A 1V5FA 1MMSA 2FOKA 2OAZA 3CCYA 1IO2A 4DYCA 1ZR2A 1VQ8I 3I56I 3HL2A 1OYIA 1BJZA 2HVQA 3FF5A 1E0EA 4PZJA 2WY7Q 2GWRA 2L4AA 2VIXA 2PMZA 5E79C 4QIWN 1BI2A 3OMYA 2KKOA 2AHQA 1KU7A 2ZJQF 1SFXA 3VYUB 3F22A 1HSJA 2XAHA 1D1AA 2I10A 3HPGA 1SMTA 3OYJA 2JA5J 1BR4A 2FOWA 2FUG2 2VBXA 1I50J 3GZNB 3G1LA 5IT9K 2NOJB 4KT5C 2M3AA 5FROA 2H6CA 2V9KA 3R61A 5H20A 1S8NA 3OV8A 1YIJI 3OYKA 2VPLA 4DIQA 3HG9A 2A5YB 1PDNC 4YFNF 1JKPC 3LMMA 1MMAA 4R8HA 3KYDB 3SZTA 4B47A 2R7VA 1KQ8A 2MA3A 1BI3A 3I0TA 5L3BA 3WHBA 4G7HF 1Z6TA 3F9KA 3LSGA 2R7FA 3ZRGA 3ZXSA 1YJ9I 4HRIA 2UXNA 2OC6A 4A3GJ 2CJJA 5FLXZ 3D5LA 3MFKA 5C4XJ 4RAZA 1TZLA 5E1XA 5J4YA 1NK3P 1X19A 2BOLA 2HZTA 3A4CA 2LNBA 3EYYA 3TOBA 4I76A 2FBHA 4UHTA 2MABA 1ZLJA 1MZBA 2Y69H 3MWMA 3HUGB 1OFCX 1WCMJ 2KRFA 5F08A 3K4MA 3RI4A 1LKXA 2KZVA 3BROA 5IT3A 4D5FA 1MBFA 2AO9A 1V55H 3F6OA 3ML6A 1XDSA 1V4RA 2QEXI 1LB2A 3HOYJ 1FP1D 3JW4A 4UXNA 2MD0A 2QENA 2Z3YA 1U2WA 4XK4A 3A01A 2FRHA 2PJRB 3AFHA 3K4NA 4RB3C 1ON2A 3I59B 2COMA 5BQTA 3KEQA 3S2DJ 1AOYA 2MC4A 2VQCA 1I5ZA 3RTRA 2DK8A 2A6EF 4R1HA 2CQQA 4LIVA 3DKWA 3K4JA 3GX4X 2STTA 2IA1A 3TP0A 3GTJJ 4J19A 1FMWA 4XKCA 5K5QA 1YX3A 2X48A 3BR3A 4A2UA 2BBYA 2R7SA 1RUOA 3HJEA 1XPXA 4E70A 1JGGA 3DKXA 1I3QJ 1ETXA 4FE4A 4OAZA 2V6CA 3U1DA 3DWLE 2DFHA 1TL8A 2QQBA 2FA5A 2VBWA 3KFWX 4DYQA 4G6DA 4RAFA 1U8BA 2XGDA 3EUHC 2XSDC 1V5GA 5M5WJ 1PUFB 4MLOA 1W0UA 3E6CC 2CUZA 1OCTC 2QQ8A 3D0SA 3IWZA 4RGUA 1Z3YA 2TRTA 3M8EA 5F0CA 1WJCA 3E97A 3GZ5A 3F8MA 1G3YA 5BMZA 2O3FA 1TT5B 3PSIA 1MH4A 2IPQX 3NAUA 2Y9ZA 3K1MA 3HB9A 5GPAA 1AWCA 4OIPF 1DUXC 2MW8A 2K4JA 4GYGA 3RQIA 3ZN1A 3JCUC 3IKVA 4KICA 1MDMA 1MD0A 1LVAA 3X2QH 4D1QA 5EYRA 3HIFA 2R5ZA 3GTQJ 4NNJA 1XSXA 2YS9A 3V7CA 2YX7A 4UUSA 2BVLA 1T33A 4DNCA 5ICGA 1BOBA 3A1YA 3IC7A 1LE8B 1MW7A 2EPFA 3IRRA 3QODA 5DS9A 2MYSA 4HPQA 4HQEA 2ELJA 2BY2A 4UVAA 3FMRA 4N9IA 4IPAA 2IGMA 3S14J 2VODA 5GP9A 3CCEI 2OTJI 3LFUA 1P6RA 4NC8A 1VQ4I 1YE9A 4AC0A 1QVUA 3T8TA 4XRSA 5FLXK 4EJWA 2EINH 3I5UA 2EH3A 4A0ZA 1JKQC 2UWMA 1QGPA 3TP3A 1ON1A 4V2FA 1GXQA 3JR9A 4HX7A 1VQOI 1R5GA 2DMPA 1CF7A 3N4MA 1XCVA 3CF2A 2X1CA 2Q8KA 2VJ4A 3J81Z 5J47A 2XROA 1YHQI 4V19K 2E35A 1KU9A 2DMNA 4IXAA 3RDIA 1QBJA 3BT9A 1Q1HA 4A12A 1XMAA 3DV8A 1N25A 3K69A 1LFBA 3P7NA 1S3JA 1RR7A 2M0MA 3N05A 2JTVA 4LB5A 2O8KA 4LK1F 2IA2A 2Q2EB 4WXDA 1N77A 4JYKA 2HKOA 1H89C 3SHFA 1T6SA 2ZFUA 3QPTA 2BYVE 4CGZA 3RKXA 2O0YA 3PM1A 2NS7A 4M3GA 2H1KA 3RCOA 2PMUA 4ZDPA 4PUSA 3JRFA 1VQNI 2GBYA 3BQYA 1TWHJ 5L3GA 2X6WA 3PIOF 2DDBA 3HEFA 4KN4X 4KYWA 3ZR8X 2M1BA 2JA8J 3RQ4A 3RZOJ 3BJAA 3I54A 3KLOA 4LITA 1WKMA 2QCOA 1C0WA 3CMMA 2VPRA 4YIIA 2VOPA 4A3CJ 2F4MB 2EZIA 2G9WA 3PQKA 2E60A 1FBQA 4F93B 3L2WA 4FETA 1S5LC 2GAUA 3GZ6A 3F0CA 2LY1A 4QPQA 3U2RA 3OR2C 3PSFA 5D4SA 3B6AA 1YS7A 4F91B 3DTIA 2QA4I 1VQPI 3C7JA 2LSOA 3T8RA 1FT9A 3IP4B 3ERMA 4HQMA 3J7AO 1H0MA 1UAAA 5D4RA 2B63J 4D5CA 4M9SA 3L2UA 1HOMA 1B1BA 3S3MA 2X1DA 5E8IA 3MN2A 1FYMA 3H35A 2DN0A 4LB6B 1AA7A 1YG2A 4KIBA 4C3HJ 1MKMA 2XB0X 3PL8A 5KAFC 3BY6A 5LEKA 3ABUA 4CCOA 4HW0A 4NQWA 4A3FJ 3GTPJ 4PCQA 3GYHX 2XF7A 3FXMA 4C9YA 4EVIA 5JVGF 2XKOA 5B1BH 4IOAF 1ZHFA 4EATA 1NG6A 4WXHA 5J40A 3TO7A 1S7EA 4D0PA 3AL0B 3AG2H 3RPQA 2ZO4A 2DT7B 3KLNA 2HDCA 3R60A 3R0AA 4C3JJ 5HOOA 3S1RJ 4Q47A 5IY5H 1DGRM 4ZYHA 3JRBA 1OR7C 3HOZJ 3ABLH 3C18A 1SVOA 1VQMI 3OYDA 3H5AA 3R0JA 4E7LA 4GO1A 1O4XA 4JP0A 1GHCA 1ETQA 3GFMA 3ZQQA 3OYIA 2K9MA 3WGGA 2JWTA 2D1HA 4BNCA 3MKWB 3BR5A 2HFHA 4U87A 3FHNA 3J81K 2X0LA 2P8TA 3JTHA 1T56A 2KIFA 5J1YA 2QBYA 2LRDA 2E5ZA 2G0EA 2A05A 3I9V2 4ZYGA 2R5YB 4QWQA 4E7IA 1BA5A 2PBIA 4CCMA 5IPAA 1T38A 3GFJA 1ZAOA 2HS5A 1WRJA 4U0YA 1SFOJ 2DJIA 2G7UA 1YOVB 5J4VA 2QYOA 3TQNA 1RNLA 3HTUA 4Y13A 4U88A 2OV7A 2BXYA 2YU9J 4XRSG 5KK1A 2LYCA 1B72A 1R22A 1XB4A 2JN6A 4N9HA 1UFMA 4CA0A 3IV5A 1LJ9A 3C2HA 3V7SA 4HSTA 4LIUA 4P1WA 5D8LB 1VQ6I 1VI0A 2XGEA 4LFUA 5CLSA 1HW1A 4G9YA 1QRYA 3GBGA 2CW0F 4C2UA 4GGGA 3PFIA 3DCFA 4XN0A 3KE2A 4Q48A 2CSOA 1HDPA 5LBQA 2R7XA 2WV1A 3WODF 4ASNA 1O3QA 3GTOJ 4CICA 5J1RA 2DBBA 2GQQA 3LWFA 1BM9A 5K1YA 1F9NA 5C3EJ 3L00A 2W25A 2LD5A 2ECCA 5EZGA 4PK4A 3QQAA 3OYNA 1WH7A 2OQRA 2RGVA 3FMQA 4XMYA 2YR2A 1F43A 5M5XJ 2H1LA 2BZTA 4AVPA 1HLVA 2R7DA 2ZMEA 3BZCA 2JQ7A 3O8HA 5F27A 4KA4A 4EEFG 1HXDA 3ABMH 1S9HA 2LMDA 4G6QA 3W6JB 2HVRA 3MMYB 4IHTA 2CH0A 5LHGA 4KUMA 2UUZA 4Z2YA 4A5NA 2GLOA 2IGNA 2R4GA 2KRCA 2FE3A 3WTXC 4HNUA 3RZDJ 1WFXA 3LA3A 4B3AA 4OMYA 2IS2A 5CVIA 2YUSA 2CYYA 4PJJA 2V1NA 4I02A 4BAYA 5LGTA 3HOWJ 1ZGAA 2M0CA 3IAM2 3K4CA 3ONQA 1KYZA 3DBRB 4NC7A 2ZXJA 4DOZA 3F72A 4XKWA 4HX4A 2KT0A 1OMIA 1WJEA 1DQUA 2PN6A 2IBDA 1NHAA 2JUCA 3G1MA 5D8KB 4UUVA 4LLNA 2NVUB 2HPIA 2CFOA 1YIOA 2IXSA 1ZG5A 4YEJA 2WADA 3SJMA 1QNTA 1ZQ3P 5HVQC 1Z67A 1XSVA 1EA3A 2P5KA 1WJBA 4KIFA 1H88C 1R4MB 1G4DA 4A3JJ 1SVMA 1J0RA 2EIMH 2K3PA 3JSOA 3ZCOA 4IO9F 2WTEA 1IDZA 1ZELA 5DM7F 3IAS2 1DU0A 2DPDA 1GV2A 1HKQA 3CCVI 3TOAA 4UB8C 1R36A 1RETA 4LLLA 3CUQB 1A35A 2QVOA 1IN8A 3MCZA 1LEBA 3F3XA 1QZYA 1GT0C 4BEHA 3UR3C 3S3OA 2IRFG 3U21A 1T0FC 5GADJ 1W0TA 5DYMA 2IS6A 1A31A 2BY1A 5BS6A 3JTGA 3O6BB 1WGXA 1USTA 3ISPA 2ZXIA 3KEYA 2V6EA 4DBQA 1XMXA 1Y0NA 1Y1VJ 5AIPA 5HDKA 2FMLA 2IS1A 3V8LA 3H3VK 1W7PA 4HLYA 3CTAA 4EMSA 4P9UA 5B5EC 2E1CA 4RM2A 1BN5A 3RYRA 4BQOA 2EFWA 2DMUA 4Y4RA 5HNHA 4ZTFA 1R23A 2XAGA 2PFBA 3Q0VA 5D5XB 3H9QA 4N4OB 3HXLA 1YRNB 1YW7A 3OIQA 2P0WA 2DQLA 2P5LC 3KP2A 2ZBKA 2Y2ZA 3O2PE 4HDUA 3R6SA 2CGPA 2B7EA 1I27A 5J8FA 2D45A 1OCRH 2VE8A 2RV8A 3PO2J 1G2HA 1FOXA 4XLPF 1ETKA 2P7CB 1D0ZA 1SD7A 2NNYA 4YELA 2VOOA 5CVVA 4F3QA 4XRFA 2VLAA 1BIBA 3CJQB 3WU2C 2PQ8A 1NH3A 2KIQA 3LNQA 2RN7A 1FX7A 2OF7A 2L7KA 1B8IB 2V9VA 2F6CA 3IHUA 4I99C 4IQJA 2ESNA 2L01A 3TO9A 2XHKA 1FBUA 1R1UA 2WA0A 4IHSA 2JSPA 1WJ5A 5FO5A 2LVSA 2ZC2A 4MIMA 2AXLA 1FPQA 3DEEA 1ZGWA 1RI7A 1TW3A 2K9NA 3KP4A 4IF4A 4RB2C 1QHGA 2K3FA 1ZGJA 3S16J 3ABTA 3TBIA 1FJLA 2MSYA 4MFDA 3HUGA 3CO7C 2JA2A 1Z21A 4JX4A 1L3LA 4BHBA 1T98A 4IX7A 3B02A 2WY8Q 2ICWG 3E3VA 1WJDA 2VT2A 5E3LA 5IOYA 5M3FJ 1APLC 1CQTA 2MD5A 4QPOA 5LFAA 4XLHA 2XRNA 9ANTA 1KQ9A 1MNEA 2P81A 2PJRA 1S7OA 3I59A 1XD7A 2E2HJ 2PLYA 4BY1J 1PJRA 3G73A 2YU3A 1K79A 2FMYA 2CUFA 2JMWA 3OY9A 1TWAJ 3L2CA 3VSLA 1A36A 2W84A 1MNDA 1U5TB 2OBPA 3WU0A 2R93J 3Q0WA 4Y3OA 4BKXA 3LSPA 3CC4I 2M45A 1JUMA 4BJ5C 2EIKH 3FZVA 2DA5A 2ZFWA 3N97A 2H8RA 3PIPF 2E19A 4C2TA 3ULQB 1FZPB 4ESJA 3CLQA 1X1CA 3NWTA 3BC8A 4CYCB 2VN2A 1PUFA 3M8JA 1FP2A 1PUEE 4OINF 2KZGA 3CC7I 4QLCU 3EETA 4CXFA 1IJWC 2RKHA 4E7KA 4U7BA 2CRGA 1T08B 3HBLA 3LA7A 4HBLA 1HW2A 2QUFA 1BIAA 2HYFA 2EILH 2QZ8A 3BTIA 3WE2A 5DUIA 2A3SA 4EJVA 1U78A 2F4OB 4IJAA 2DMTA 5LEJA 4Y17A 1IXSB 4UB6C 1K4TA 1MGTA 2HOTA 3CJRB 5D5VB 1BC8C 2L4MA 2E1MB 2R7UA 4M3DA 2DDAA 1MBKA 1V5EA 3MVPA 1QU3A 3CCLI 2EV6A 1X4OA 2EFNA 2CS3A 4XSXF 2Z33A 3CJNA 4OIRF 1G8XA 4R79A 3GTKJ 4PFOA 1X2NA 4EGZA 2MFZA 1P7JA 4XLFA 1XMKA 2M7AA 1YJNI 3ECHA 2EIJH 3DEWA 5ILSA 1IUYA 4E4HA 4ZZDA 2W48A 4K2EA 1STZA 2LBFB 1W5CC 4L5EA 1V54H 4II3A 2DT5A 3WGHA 1XGOA 1AKHB 3FXRA 3IH3A 2PEXA 3QYEA 1OJLA 4IL6C 2R7ZJ 1LUJB 1Y8QB 3CP2A 4JX5A 4OOIA 4ABZA 5E18F 3V8KA 3OYHA 3DLLF 1K4SA 3S3NA 2MH2A 4CUGA 4IKFA 4BBRJ 2WAQN 1FC3A 2CV0A 3E5XA 5HS8A 4RAGA 4HF0A 1AU7A 4OIQF 2E7WA 1ZYRF 3TMOA 1MBHA 4AWXB 4RAYA 2LP0A 4JX6A 5FKOA 1ETOA 5DDGA 2L54A 3ZMUA 5JFRA 4A6DA 2LH9A 1A6IA 2DT6A 4OU0A 3D1NI 1IN4A 4MO7A 4HNVA 5B1AH 3S2WA 5FRMA 2XPUA 2X4HA 3O3KA 1R6RA 4EM0B 3QRFF 3HRSA 4F92B 1POGA 2FQ4A 1TC3C 1Z7LA 3L9FA 4BJTA 5JHUA 1UHWA 2V4JC 4BXFA 3F8NA 1YO5C 3KP3A 4RGRA 4MEXF 1ZRDA 3BPVA 4E7JA 2X51A 3VOEA 5FLVA 3DPUA 1R58A 5K7HA 3JRIA 3PJRA 1TW2A 2CW8A 1LDDA 1U6GA 3ZMDA 2JA6J 3VODA 4A3DJ 2MH9A 2XPWA 4KITB 4FX0A 2DI3A 5FRNA 1ZRFA 2DCEA 4ITVA 3SFZA 4S05A 2IS4A 3VPRA 2W57A 1X2MA 5M3MJ 1PYVA 3AL0C 1B9NA 2Q1ZB 5D6EA 1ERDA 4EM2A 2LF8A 4FE7A 4GYIA 4KDPA 5K5RA 3WTUC 1HKTA 1TLHB 2LK2A 3KZZA 2B0LA 3Q0UA 1TQPA 4X0GA 3V8JA 4U7DA 2ZJ2A 3BTCA 1G3WA 3ZOBA 2CUJA 2KJCA 2A5WA 5EEAA 1IN7A 1E3HA 2FJ1A 2WC2A 3H9JA 3U9GA 3OSGA 2OPTA 4CO8A 4OWRB 2XUBA 2QF7A 3I4MJ 2XAUA 1HCRA 1IAWA 1MJAA 2G7HA 4XKBA 2Y0SN 2COBA 3S1NJ 3ZPLA 1JUPA 4XLAA 2EFOA 3F8BA 2C6YA 1EF4A 1O7FA 3LL7A 3EUHA 3COAC 1D1BA 3SEZA 3V4GA 1U9NA 2P5VA 5KAIC 4UVBA 2Z9OA 2DJNA 2VQLA 1FBSA 4ESBA 1WPKA 2BW3B 3RKWA 1HC8A 2A61A 3FMSA 3WTWC 4I2OA 4KIGA 2JSCA 2WAFA 4M3FA 2RQQA 1VQKI 1TNSA 3LFKA 2JK3A 1BBYA 4XNFA 3LSJA 1R71A 1JE8A 5JLWA 1R9TJ 3Q9VA 3W6KB 3J7ZI 3PNTA 1RKWA 2P7VB 1YI2I 2E34A 4A3MJ 2P6TA 4XSZF 1D0XA 2J5OA 1W5TA 3CC2I 1EH8A 1RKTA 3QYBA 4WK8F 2R5YA 2HU9A 5FD5A 3QWLA 3LSIA 3RPUA 2XIGA 1ACIA 3M7GA 4OIOF 1IUFA 1P2FA 1ETWA 2LC2A 3SXYA 1UB9A 2XSJC 2FNAA 1ZTRA 3HOTA 3E7LA 3FK7A 3PO3J 2HOEA 3I53A 5LHIA 3GLXA 2KDZA 2DTRA 3CUOA 3FXUA 5DD4A 5FKMA 4L5JA 2ZCWA 4OMZA 4PSXA 5KHDA 1IN6A 5ICFA 2ECBA 4B8XA 1DPRA 1JHFA 1X3WB 2KISA 1X1AA 2IA0A 3TW6A 3G71I 3HM5A 4BE1A 2F5CA 3HGGA 5IYCJ 4UY8I 3S1MJ 1MBEA 3BG9A 4CHUA 5JR3A 4KN7X 1KU3A 1K78B 3Q9SA 4MTDA 2Y9YA 1N75A 1QZZA 2NXNB 5IYDJ 2IAIA 4I01A 1RPWA 4MHGA 3A01B 1W1WE 3FK6A 3OSFA 4A3EJ 1Y39A 5CKTA 1FOKA 4KFCA 4BDYA 1Z3XA 3FIWA 5LLQA 5LHHA 3HKZN 2BEOA 1SVLA 1ORKA 2XF5A 4HG2A 2O61A 1MJBA 1ETVA 3RIRA 1YW9A 4CH7A 1R1VA 1ZARA 1B4AA 5GPCA 4LGWA 1F5TA 4IQ4A 5J6XA 4IHWA 1S7AA 2KPMA 4A3LJ 1MSFC 1TP4A 3CMEI 3E6BA 1TWGJ 2KLOA 5E1WA 3CF5F 2V1XA 5IP9J 1MNMC 2ZNZA 2EFPA 2R7RA 3LSMA 3CUQC 1UG0A 3L1PA 3KPHA 5F04A 2HR3A 4XLEA 2LFBA 2DPUA 4LG3A 4MTEA 3D5SC 3LOCA 2YPRA 2NVTJ 4JQFA 1XN7A 2BE5F 1JKRC 4Y7NJ 4IHVA 2XAFA 4DQ2A 2OJED 3KZIC 4BQQA 4G6TB 3AG3H 4S04A 5EF6A 4RGSA 1Z0XA 3W2VA 2R7OA 4M6VA 5F64A 4UUSB 2B9SA 1USSA 4IOCF 1YJWI 1HBXG 2XV4S 4N0BA 2NRAC 1J09A 4LLGF 3KP7A 2GM4A 5H6RA 4EQQA 3OS1A 4EV0A 2QWWA 4H0EA 5IP7J 2NYXA 2OCEA 4M6XA 1MBGA 4B48A 1RZ4A 3I55I 2HQRA 1Z1DA 3QPHA 3IH4A 4FQGA 1O3RA 3V7RA 1D3YA 2LY2A 2EV5A 3MKZA 3FXKA 4W1UA 3AKZA 2O7OA 2OTLI 1J5YA 3FBIB 1FNNA 2L5QA 3ZQLA 2RVCA 4BE2A 1OR7A 2VT3A 2VJJA 3DP7A 5DCMB 2WAQA 3RSNA 1LPQA 2H6BA 1ZN2A 2K9SA 3W2WA 4ZZLA 2MC3A 1I6HJ 2EB7A 4XICA 4KT6A 1CF7B 3SDGA 3M8FA 2K9LA 3SQNA 3QPLA 3ZQIA 1TWCJ 3F8FA 3K10A 4A0XA 5FKNA 3LQRA 1YITI 2MG4A 1IG7A 1ZRCA 1YRNA 2LDUA 2LTPA 4M72A 1U3EM 3CCRI 1QZEA 4HV5A 6PAXA 1RIOH 1J59A 4I98B 3S1QJ 1WJFA 5B3SH 2N8GA 5CYVA 4AU7A 2EFQA 3CZ6A 2DA2A 3P9CA 1NK2P 1T2KA 3I71A 3S93A 1OQYA 2HYGD 2KJBA 1H8AC 4LD5A 2EK5A 1UHMA 3MKLA 2VASA 3M1EA 5CQGA 1B8IA 1ENHA 3CESA 1E2XA 4P5OA 2DO7A 5L3FA 1FYLA 1VQLI 1XS9A 2XGXA 5ILUA 3S15J 1IV6A 5CVUA 3JAMZ 3HDDA 4NHJA 1P9QC 3JRDA 2PJPA 3K2AA 1DP7P 4XL9A 1WJAA 1SANA 3BG7A 4AIKA 2OUMA 4KNYA 3R4KA 4L18B 4G8XA 1U5TC 1KYWA 2HQNA 1D5YA 4L0YB 3VFZA 2BHYA 4ZC3A 3WTSC 3PUBA 4XLNF 1XX5A 3OYGA 4L9TA 1FWZA 1OYYA 2DLLA 4CZZA 1ITYA 2LOOA 2DU9A 3DLAA 3H5NA 4EJOA 1LVKA 1SAXA 1P92A 5HDGA 1L0OC 1W36D 3E5QA 4TV7A 5F0HA 1G59A 1AHDP 5FD6A 2DFIA 3FKJA 2Y0SA 4DJAA 2OZ6A 1YLFA 4BGDA 4NQWB 1TTYA 4IVNA 1WH5A 5HDNA 5EGOA 1MMNA 1U5TA 1JT6A 2I5UA 3K1NA 2OQGA 1X4PA 2EZHA 3C2GA 3QPSA 1QA6A 5EZHA 3LQQA 1JJ6C 2K85A 4HF2A 1BR2A 5M5YJ 3ABKH 3MEXA 3IL2A 3TKYA 2HTJA 2W7NA 1H9GA 4L9NA 4JK1X 1HA8A 1TQIA 4ZH4F 2VXZA 2ISYA 3K6GA 3VB2A 1DP3A 2DTZA 4D9JA 3K70D 1JI8A 3GO5A 3WTTC 3I4PA 4A3KJ 2E1MC 3K2ZA 3BR0A 3REOA 4A5MA 1E17A 2R7QA 3HC7A 1FTTA 4PJNA 4QTRA 1XGSA 3H3ZA 1IRXA 3CO6C 4YG2F 3CCQI 5ERIA 3VYTB 3FKIJ 3WHCA 2LREA 3K9TA 3IUOA 3T0YA 3BJ6A 3DU6A 1T95A 3BWGA 4ZYAA 1WQ2A 3FISA 3WG7H 4DZPA 2BHZA 1FOYA 1J7KA 3S2HJ 3ASOH 2X9DA 3CLOA 3AG1H 2JRTA 2M7BA 3ZQHA 5HLTA 1XTAA 2QBYB 1S72I 2EBIA 1D5VA 2W24A 4A6EA 3MKYB 2VKEA 2IW5A 3QOEA 3S17J 3HRMA 2VBYA 4RGXA 1JHHA 3KIOA 4I7HA 5KCMA 1DGWY 2IVMA 1XSDA 1M1EB 2PMHA 2FX0A 3BTJA 3BPXA 3HOXJ 2M34A 4BHPA 5K5OA 3T1BA 1VZ0A 1T0FA 4HV6A 3RKYA 2F5EA 3A2KA 5EG0B 5L3EA 3A02A 3FXOA 1ONVA 2HWVA 2FXAA 1ZG3A 5F1RA 1MH3A 4KMFA 2LBFA 3JAMK 1T8IA 3G4SI 1VF9A 2VQHA 2ELKA 4BQAA 5CQEA 3J80Z 4YIRX 1D0YA 1UELB 1Y6IA 4JOMA 2FEZA 2JA7J 3OYBA 4X1EA 2J5PA 4NDLA 4ZTJA 2VC1A 3P5JA 3MZYA 2DOFA 2F2EA 3OOUA 1PP7U 4AVZA 1GDTA 3HKZA 5IOZA 1Z6RA 3OWTA 1TT0A 4Y15A 2ZMEB 4S0HB 4EM1A 3BG3A 4Q4ZF 3HSRA 4KJZA 4HEA2 4XR6A 3UNGC 2OU2A 2DYSH 3M07A 1W5SA 1OYWA 2HOSA 1I1GA 3LA2A 2K7LA 1E3OC 1SEUA 4XRMA 3L7WA 4E7SA 3L2RA 3T5XA 3P9IA 2M4KA 2Z2SB 1BI0A 2CQXA 3CMYA 4WCGA 4ZDLA 3U1KA 3JREA 5CPRB 1K6OA 4I0AA 3GF2A 2LLKA 2VB6A 3O8GA 4AD9A 3CCSI 2H94A 1VNDA 3GWZA 3F21A 2EZLA 3OYMA 4Y33A 2LKXA 4FHTA 4ZYDA 3H3UA 3ERED 3TGNA 2DQRA 4CCLA 3BR2A 3HGYA 2HQ5A 3ZMTA 1UCRA 4HYEA 4W97A 4I6ZA 1FSEA 2A68F 2HTSA 2RNJA 4AYBN 4RB1A 2KIMA 2HPMA 3B6CA 1UG2A 1F36A 5FFXA 2HYJA 3DBHB 2H27A 2GIZA 2X85A 1DU6A 3MD2A 1YTYA 2Q0OA 1MSEC 4DBRA 2TCTA 4XONA 4L9VA 1FYKA 4GDFA 3ZGKA 1IC8A 3M4OJ 3Q3SA 2M4GA 4HSRA 4BL0B 3OS0A 2LY9A 4BQNA 4DW6A 5D5WB 1O3SA 4A3BJ 2F48A 1IF1A 4KISA 5K7ZA 1ZK8A 4G7OF 3S8PA 3OL4A 4UUTA 4E7ZA 1KQ0A 1J9IA 4F52A 2DXIA 1A6QA 2FF4A 2Z16A 4BEHB 3H0DA 5GAGJ 4BE0A 4B44A 2VKDA 3FM5A 3GFLA 1HSTA 2WB1N 3E0JB 3M3YJ 2L7ZA 4RLQA 5LD2C 2EA2A 5E3NA 4PGHA 1SFKA 3H1CA 1FOWA 1HKSA 5TISC 1FSHA 2BW3A 1LE8A 2H09A 1I6XA 4BACA 3SZGA 1W7PB 2LG4A 3L09A 4FTHA 3JRHA 1F1ZA 3J80K 3OIOA 2QGUA 4N4NB 4WF2A 3W3CA 3TDUC 3K4BA 3FWEA 3ZMSA 1YW8A 2WV0A 2M87A 2O8XA 3CDLA 2BV6A 5JI6A 3AAFA 4AIHA 5BOXA 1OCOH 1IGNA 3HTSB 5FKKA 3OIPA 4IRHA 2ZJPF 4MQ9F 3FM3A 5TRDA 2R92J 1S29A 1FIAA 5B66C 1RESA 2Y31A 4X6AJ 3KYCB 3E5UA 3GVAA 2JT1A 2VI6A 3DTEA 2Z5UA 4XOPA 2CV1A 4RBOA 1WSUA 1JTYA 2QSFX 1SD6A 1Z91A 3K0LA 2LKPA 1J75A 3GTLJ 5JHFA 1W4MA 1UMQA 5DUKA 5HNFA 5TGTA 1JJ8C 1I39A 3KZYA 5CVJA 2EQRA 3EYIA 2R7TA 2Q2EA 1UHSA 1P7IA 2CMPA 3QP6A 4LK0F 4HNTA 2QKMB 5EEHA 3OYLA 2IT0A 1OCPA 1FY7A 3VYSB 4Y52J 2DOEA 3A03A 3FDYA 2KFDA 2A69F 2VJ5A 3DPTA 4LG0B 2DA4A 2VONA 1GXPA 1EV7A 2KL4A 1BW6A 2GA2A 2I8DA 1ULYA 2BY0A 4EJTA 3A0BC 1W7PD 1K78A 3HOVJ 1GVJA 5FJ8J 1JTXA 2PX9A 2OA4A 3WTZA 2K02A 4PDKA 3ZQFA 1O3TA 1ZLKA 5JLXA 3CCJI 3WTYC 1R7JA 2RQPA 2BVMA 4HA8A 1LEAA 3HZJA 1BL0A 2ZXWH 1BOAA 2X6OA 5E8GA 2HXIA 4WX9A 4U0WA 2P4WA 2CUEA 5LGUA 4GXOA 4BH9A 2F4IA 3DKYA 2ELHA 4RLFA 5TJJA 2DOAA 2ZXHA 3ZMVA 2EA4A 4I0BA 1LDJA 3F23A 2JPBA 2E2IJ 1XG1A 2CQKA 2NVYJ 3L2VA 1MJ9A 3HHHA 3SDBA 1ZG1A 2XC7A 2W4SA 2ACJA 3KCCA 1LNWA 4M9XA 2IP2A 2HEOA 1U8RA 3BOQA 4J00A 2E7XA 2LF7A 3QP5A 3KP5A 3NQOA 3FXJA 3OS2A 1LFPA 2L2OA 1QHHD 3ZP5A 1KGSA 3IRQA 4A93J 3BP8A 4WXCA 5BPDA 1HDDC 1S6LA 4BY7J 2ME6A 1JKOC 4F55A 3BZKA 1R5ID 1Z9CA 2VQGA 3D5RC 2GXGA 2FBIA 3ZQ7A 4XQFA 3FXQA 3ESWB 3GFIA 3LSTA 4C2MJ 1BI1A 2GXAA 1KA8A 2V1DA 4O5VA 1D1CA 3PNVA 2IJLA 1W36C 3HHGA 1REPC 3W6VA 3QU3A 4MQVA 1WHUA 4AM3A 4XLCA 1DPUA 1MBJA 4YRVA 2IGOA 2M8EA 4M3BA 1TQMA 5ILVA 1LDKB 3RKQA 1FLIA 3ZQGA 1IRFA 2EZKA 1EJ9A 2L3DA 2JZYA 2KRHA 4B43A 1X3UA 2KP6A 5KVRA 2Y48A 2FD5A 4HX8A 3EQLF 1SD4A 1XCBA 5E1ZB 1ZREA 3BCBA 2IEKA 3J7YJ 1X3ZB 5EEGA 2CQNA 3GUDA 2GIVA 2R0QC 3J7AY 1YX5A 5DCMA 1P4XA 2XF6A 4Q5SF 2XPVA 1JUSA 1RC9A 2Z1DA 1ZKGA 5E17F 3K70C 4A3IJ 1LQ1A 3JSPA 3TO6A 2NOGA 1U9OA 2M8GX 2O5RA 4CYDA 3WE3A 2V26A 5J1UA 5AONA 2HXOA 1QPIA 2EV0A 3VDXA 1FTZA 3CQZJ 4DYRA 5FGMA 2PI0A 4MEYF 3I58A 1PP8F 4DGWB 2M9HA 1RRJA 1NG7A 4NBQA 2ID6A 3MZ8A 4ENNA 2CWEA 1OCCH 2W82A 3OR1C 4RB0A 2LKSA 1WZ2A 1D8KA 4HF1A 2ZSIB 4CCJA 4ESFA 5HLHA 3I4NJ 1QPMA 4XN3A 2BGCA 4AYBA 2ME0A 2DA7A 4BXUA 2UZKA 4GRIA 1Y56A 1XDUA 2E5NA 3BQZA 2CV2A 5BPIA 1MIJA 2FQ3A 3E6MA 3H92A 5EJCA 2VE9A 1ETYA 2MGQA 1TBXA 2BY3A 3CDIA 1KONA 3RJPA 2UXXA 3VSKA 2XAJA 3FHZA 2BXZA 3B73A 4FT8A 4M73A 5C4JJ 5E3OA 5LRRA 5J3LA 4L9JA 4II2A 5HLIA 3CP8A 2MLKA 4YFKF 1OKRA 4WWCA 1UZCA 1OLTA 2PG4A 2ZNYA 2VUMJ 2M30A 3CMAI 4IEJA 4DZJA 1SFUA 5C44J 2GA1A 1IDYA 4M6YA 3L2QA 2JVGA 2CO5A 1K7AA 2QSHX 4MFEA 2FSWA 1HQCA 2WB1A 3ZN0A 3G6EI 4F7ZA 2KMUA 3OYAA 1T39A 4IZZA 2XVCA 3MQ0A 1K61A 5KNLA 1MDMB 2JPCA 1Y8RB 4CSWA 2D5VA 2DFEA 2ZB9A 3TDZC 1H9TA 2AQEA 4E7HA 2W85A 2QQAA 3FX3A 5K7FA 1U0JA 4FISA 3WGIA 3RYPA 4RDUA 2R5ZB 2NVQJ 3M9AA 1WVRA 1X1DA 1G6NA 4BJ6C 5GTIC 2VJIA 3CUQA 4C30A 3HOSA 3SEQA 2V1UA 3PFYA 2EWNA 2HKXA 3DXJF 2XASA 3OYCA 2XB5A 1GUUA 3EDPA 5FKLA 3LAJA 3ZQCA 4NB5A 4Z6YA 1ZH5A 3K4KA 3BLYA 3IWFA 4RM3A 2ESHA 5DEQA 4RS8A 2ZJRF 4B1RA 2STWA 4L0ZB 1R5HA 4XKVA 1GVDA 3TL4X 3H0GJ 4XORA 4GCVA 1ZR4A 3EUAA 2CFXA 1Q1VA 1IN5A 1QO0D 3K7AJ 4G94A 1P4AA 3HOUJ 1XGMA 1UJ8A 4IRIA 2WBMA 3JRCA 2DA1A 3E1SA 4B3XA 2HOAA 2NS8A 4PSWA 1WI3A 3NEUA 1P4WA 2Y75A 1PVEA 1SMYF 1FMVA 4U0VA 2L9RA 2ADUA 4M74A 4LOCA 3HRUA 4BXXJ 2AS5F 1TNTA 2XAQA 5EDNA 1Z7UA 4ANJA 2XRLA 2GOMA 1NTCA 2ZMEC 3HPHA 5E20A 3S32A 2PMZN 2HVSA 4MGRA 3JRAA 5EG0A 4CDGA 1HW5A 1SD5A 2DMQA 2M5WA 1SC7A 3LSKA 3KYLA 3BR1A 5GAHJ 1OCZH 2CQ7A 2M2EA 2OCCH 4CZCA 1XC5A 2HZDA 1N78A 1TWFJ 3BR6A 2O6GE 2K40A 3MZHA 5A2QZ 4AIJA 3NARA 1F4KA 3VYRB 4ZYEA 4E6KG 2JUGA 1G3TA 5ICCA 2L9VA 3H9GA 2V9PA 2KHMA 2L7MP 4NUBA 3PQJA 3HSEA 3ASNH 5CJ9A 5FFZA 1D8JA 2QLZA 2W1OA 3IH2A 1FIPA 2XKPA 3I3LA 2XGCA 1Z77A 5GAEJ 3CCUI 3TEDA 1QQIA 2LR8A 3BJOA 3BG5A 2AXTC 3QOPA 1ODDA 3DF8A 2DAOA 4NC6A 2Z99A 4EJUA 5FLMJ 3WU1B 2JVHA 2X6XA 5D6FA 5IP6A 4J01A 2OZUA 4IHYA 1EKEA 2QM3A 2R3SA 4PFPA 2E71A 3DTKA 2WAEA 4B09A 1GLNA 2VKVA 3EPZA 2V7FA 4PJMA 1BW5A 2V79A 1IW7F 1XGNA 2L0KA 1FEXA 1WWXA 4LMYA 1OISA 2L7FP 3RPUD 2F5VA 3QYFA 2YSRA 3GTMJ 1IXCA 2O9LA 3UKGA 1Y0UA 1K6YA 3WTVC 3KETA 1IZ1A 4IHXA 3KP6A 3HRTA 5HLGA 4HOBA 2H8WA 2VKHA 4YFXF 2HGCA 2NS0A 3F6VA 1RUNA 4AIDA 5F1JA 2L9NA 1KU2A 4OAYA 3P9KA 3BDDA 4D7NA 4V2GA 4HAMA 2NNNA 2F5DA 5F0FA 5DM6F 3ECOA 3HSFA 5HS9A 2K27A 3EUKL 3GTGJ 2VL8A 2VXDA 2P6SA 2ISZA 3C2BA 5F6FA 4EGYA 4HDVA 4GFBA 1QVTA 2DFFA 2ZSHB 2RNGA 2K5CA 1B6AA 2EJRA 1I3AA 2ZKZA 4CYCA 4G12A 2QQ9A 3A0HC 1LFUP 1IRGA 2JJ7A 1X1PA 4UVCA 5DTDA 3LSRA 5H2FC 2L9SA 2E1NA 2GZWA 4XIDA 1OPCA 3E6DA 2L02A 4P55A 1G3SA 1IV8A 2A07F 4UV9A 4JBAA 3M1CA 4M3EA 1RR8C 1YFHA 3NRVA 1A04A 3V42A 3CJTB 1YS6A 2RC4A 1R4NB 2HI3A 4RMNA 1DDNA 2QKLB 3OL3A 2RAEA 3G3ZA 2R7WA 4UNOA 3QAHA 1MMGA 3GMEA 5JVTA 2MBFA 3GEZA 3GXOA 2GOXB 1X1BA 4ENJA 1KZHA 5L3CA 3LSHA 4CCNA 1BC7C 5BNGA 4A69C 2O03A 2D2WA 1SAUA 1B72B 5CVRA 4ZDOA 3NWSA 1EH7A 2NVXJ 2HDWA 1Y1WJ 3GLLA 5A2QK 5ED4A 3H5RA 3TW7A 1BJAA 4FCYA 3VEPA 1R49A 4IRGA 4ON0A 3FBNB 1VTNC 5DCFA 2CG4A 3ZMZA 4CCKA 2WWYA 1AKHA 4ENMA 2W00A 2KQRA 2HDDA 1JXSA 1BR1A 3FXLA 3K4LA 2DODA 3CDHA 4PJLA 2A6HF 2DK5A 4XBFA 3ROUA 3W2AA 5IT9Z 1R00A 3BCAA 4PJ0C 1IRZA 4P9FA 2AQFA 2YX4A 3IKTA 2DYRH 4FASD 1VFCA 4ZJZA 4C3IJ 2HQAA 4HLXA 4BUPA 2HNHA 2D1VA 5LRSA 5J8CA 2CW7A 3Q5FA 1K83J 2VC0A 2K9QA 4BHCA 1CGPA 3K1PA 4KMUX 5DD8A 4D7MA 2GXBA 2E1OA 3OYEA 3I64A 1A5JA 4LG0A 2KDOA 4RA2A 1VQ7I 3G1OA 1JT0A 1HF0A 2VBZA 1B9MA 1MMDA 3BZ6A 1V3FA 3KEOA 3H36A 4BBSJ 2ID3A 1VQ9I 5H6QA 3DEUA 4ENKA 3SYTA 3WG9A 3GW2A 1GV5A 2UV1A 3C1DA 2IGKA 3DU5A 3G2BA 2Y0MA 3OOPA 4BS9A 3LAPA 3F8CA 2X1EA 2XDVA 4I09A 3SFIA 4AUXA 1VQ5I 1WI9A 4O6JA 4PGGA 4BYYA 5LGNA 4H4KC 3CCMI 1O57A 2CU7A 4BU2A 4XM3A 1YYVA 4O3MA 5L3DA 3BTLA 1EH6A 2E36A 3AG4H 3HYIA 3C3WA 2RREA 5EGOB 3JRGA 4G7ZF 1I1SA 2KIUA 4ETSA 2Y30A 1YQAA 5IYBJ 3QU6A 2ETHA
chains in the Genus database with same CATH topology
1H88C 5F04A 4A3JJ 2LFBA 2DA6A 3LOCA 4QSHA 2NVTJ 1X58A 1IDZA 1JKRC 4Y7NJ 4IHVA 1DU0A 5HODA 1GV2A 4A93J 5EF6A 1HDDC 1Z0XA 4BY7J 1RETA 2ME6A 1JKOC 4M6VA 4B4CA 4UUSB 1GT0C 5E3MA 4C2MJ 2GM4A 2E2JJ 2DA3A 1W0TA 5IP7J 1MBGA 3IH4A 3CCYA 1WGXA 4DYCA 1ZR2A 3W6VA 4W1UA 2O7OA 1BJZA 1Y1VJ 1MBJA 3ZQLA 3H3VK 4QIWN 4M3BA 2AHQA 3RKQA 2I10A 3ZQGA 2JA5J 2EZKA 2DMUA 1I50J 2K9SA 3G1LA 3Q0VA 1I6HJ 4XICA 2FD5A 3SDGA 1YRNB 2IEKA 3QPLA 2R0QC 3ZQIA 2Y2ZA 1TWCJ 5FKNA 2XPVA 1JKPC 1JUSA 3PO2J 1G2HA 1ZKGA 1ETKA 2MG4A 4A3IJ 1IG7A 1YRNA 2LTPA 2NOGA 1U9OA 2M8GX 5J1UA 3WHBA 3LSGA 2HXOA 1QPIA 1FTZA 3LNQA 3CQZJ 4DYRA 3S1QJ 4A3GJ 2CJJA 2N8GA 5C4XJ 2OF7A 1NK3P 1B8IB 2DA2A 2M9HA 1NK2P 2ID6A 4I76A 1H8AC 3MKLA 2LVSA 1B8IA 1ENHA 4MIMA 1OFCX 1XS9A 1WCMJ 5F08A 1ZGWA 3S15J 2K9NA 1IV6A 3I4NJ 3HDDA 4D5FA 1MBFA 2AO9A 3JRDA 3K2AA 2ME0A 3S16J 2DA7A 3HOYJ 1FJLA 2MSYA 4MFDA 1SANA 4XK4A 3A01A 4JX4A 3BQZA 5M3FJ 1APLC 1CQTA 5E3LA 5IOYA 1D5YA 3S2DJ 1ETYA 2MGQA 9ANTA 2CQQA 5C4JJ 2P81A 1ITYA 3TP0A 5E3OA 3GTJJ 5J3LA 4J19A 2E2HJ 4BY1J 2X48A 3BR3A 2CUFA 2JMWA 1TWAJ 5F0HA 1AHDP 1JGGA 1I3QJ 2VUMJ 1ETXA 4FE4A 4IEJA 2R93J 3Q0WA 4BKXA 3LSPA 4DZJA 4DYQA 5C44J 1JUMA 1IDYA 1U8BA 2XGDA 1WH5A 2DA5A 5EGOA 2XSDC 5M5WJ 1PUFB 2H8RA 1JT6A 4MLOA 1W0UA 2EZHA 2E19A 3QPSA 4MFEA 1OCTC 5EZHA 1JJ6C 5M5YJ 2TRTA 5F0CA 1K61A 4CYCB 1PUFA 2D5VA 2ZB9A 1MH4A 3NAUA 2Y9ZA 2DTZA 3HB9A 5GPAA 5K7FA 4FISA 2NVQJ 2R5ZB 4RDUA 2MW8A 4A3KJ 1IJWC 3RQIA 3BR0A 1FTTA 2CRGA 4QTRA 3HBLA 5EYRA 3FKIJ 3WHCA 2R5ZA 3GTQJ 2YS9A 4UUSA 3FISA 3BTIA 1T33A 4DZPA 2XB5A 1U78A 1GUUA 3S2HJ 2DMTA 5FKLA 2HOTA 3ZQCA 1LE8B 2X9DA 5DS9A 3ZQHA 4B1RA 2EBIA 4M3DA 1MBKA 3MVPA 1GVDA 2VKEA 3H0GJ 1ZR4A 3S14J 3S17J 5GP9A 1Q1VA 3K7AJ 3HOUJ 3GTKJ 4AC0A 1QVUA 1X2NA 1P7JA 3JRCA 2DA1A 4XRSA 3DEWA 2FX0A 2HOAA 2NS8A 1WI3A 2EH3A 3BTJA 3HOXJ 2M34A 3TP3A 1JKQC 4V2FA 2W48A 3JR9A 2DMPA 2L9RA 5EG0B 3A02A 4L5EA 4LOCA 4BXXJ 5EDNA 1AKHB 3IH3A 2DMNA 2XRLA 1NTCA 1OJLA 2PMZN 3BT9A 1MH3A 4JX5A 2R7ZJ 4ABZA 3JRAA 5EG0A 1LFBA 1VF9A 2ELKA 1RR7A 2DMQA 4BBRJ 2WAQN 2JA7J 1AU7A 4X1EA 3BR1A 4NDLA 2O8KA 2M2EA 4JYKA 1MBHA 3OOUA 1H89C 1XC5A 1TWFJ 3BR6A 2LP0A 1GDTA 4JX6A 2K40A 3PM1A 1ETOA 2NS7A 4M3GA 5FKOA 5IOZA 3NARA 2H1KA 1A6IA 4S0HB 3JRFA 3D1NI 3BG3A 2GBYA 3BQYA 1TWHJ 4MO7A 4HNVA 3HEFA 2XPUA 2HOSA 2L7MP 1E3OC 4XRMA 2JA8J 3RZOJ 1POGA 2FQ4A 1TC3C 2QCOA 2VPRA 4A3CJ 3IH2A 1FIPA 2CQXA 2EZIA 3CMYA 2XGCA 1Z77A 3TEDA 2LR8A 3JREA 3F0CA 5FLVA 3BG5A 5K7HA 3JRIA 2LLKA 3O8GA 1VNDA 3B6AA 2EZLA 5FLMJ 5IP6A 2JA6J 4IHYA 2LKXA 4A3DJ 2XPWA 3BR2A 2VKVA 3HGYA 1BW5A 2HQ5A 2L0KA 1FEXA 2L7FP 2B63J 4W97A 4D5CA 4I6ZA 3VPRA 1HOMA 4AYBN 1X2MA 5M3MJ 3GTMJ 3MN2A 3B6CA 1UG2A 2O9LA 2DN0A 3UKGA 1F36A 2HYJA 4IHXA 4C3HJ 1DU6A 2XB0X 4FE7A 1MSEC 2LK2A 5F1JA 2TCTA 3Q0UA 4A3FJ 3GTPJ 3M4OJ 4D7NA 1IC8A 3BTCA 3Q3SA 4V2GA 5F0FA 3ZOBA 3GTGJ 2LY9A 5EEAA 4DW6A 3C2BA 2FJ1A 3OSGA 4A3BJ 4GFBA 1QVTA 2OPTA 1S7EA 2QF7A 3I4MJ 5K7ZA 1ZK8A 4CYCA 4G12A 1HCRA 4UUTA 1LFUP 2Y0SN 4C3JJ 2COBA 3S1NJ 2JJ7A 5DTDA 3S1RJ 3LSRA 1JUPA 4XIDA 3JRBA 3HOZJ 1EF4A 1O4XA 1U9NA 4JP0A 2DJNA 1ETQA 2WB1N 1WPKA 3M3YJ 2L7ZA 4M3EA 2JWTA 5E3NA 4M3FA 3BR5A 2HI3A 2JK3A 1T56A 2RAEA 3LSJA 1LE8A 5JLWA 1R9TJ 5J1YA 4FTHA 2G0EA 3JRHA 1RKWA 3OIOA 2R5YB 1BA5A 5IPAA 5BNGA 4A3MJ 4A69C 1SFOJ 1B72B 3CDLA 2NVXJ 1RKTA 1IGNA 1Y1WJ 5FKKA 2R5YA 3TW7A 4FCYA 2YU9J 4XRSG 2R92J 1FIAA 1B72A 2JN6A 1RESA 3IV5A 2Y31A 4X6AJ 1IUFA 1AKHA 1ETWA 2VI6A 1VI0A 2XGEA 4RBOA 1JTYA 1QRYA 2HDDA 1ZTRA 3GBGA 3E7LA 3FK7A 3PO3J 3DCFA 1HDPA 2KDZA 3GTLJ 1UMQA 2WV1A 5FKMA 1JJ8C 3GTOJ 2ECBA 2EQRA 5J1RA 1IRZA 1UHSA 1P7IA 5C3EJ 3TW6A 3HM5A 2LD5A 2ECCA 5EZGA 1VFCA 3HGGA 5IYCJ 1OCPA 3QQAA 1WH7A 4C3IJ 3S1MJ 4Y52J 3A03A 1MBEA 1F43A 5M5XJ 3BG9A 1HLVA 3O8HA 5F27A 4EEFG 2DA4A 1K83J 2K9QA 2Y9YA 5IYDJ 1BW6A 2IAIA 1RPWA 3A01B 3FK6A 3OSFA 4D7MA 4A3EJ 2GLOA 2E1OA 1A5JA 3G1OA 1JT0A 3RZDJ 3HOVJ 3FIWA 1HF0A 5FJ8J 1JTXA 4B3AA 3HKZN 4BBSJ 2YUSA 1ORKA 2ID3A 3HOWJ 3ZQFA 1ETVA 5JLXA 2M0CA 1BL0A 1GV5A 2X6OA 2HXIA 4AUXA 3SFIA 2KT0A 5GPCA 2CUEA 4IHWA 2IBDA 3G1MA 4A3LJ 1MSFC 2CU7A 1TWGJ 3BTLA 5EGOB 3JRGA 2E2IJ 1XG1A 5IP9J 3SJMA 1MNMC 2NVYJ 2Y30A 1ZQ3P 5IYBJ 3L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H88 C;  5F04 A;  4A3J J;  2LFB A;  2DA6 A;  3LOC A;  4QSH A;  2NVT J;  1X58 A;  1IDZ A;  1JKR C;  4Y7N J;  4IHV A;  1DU0 A;  5HOD A;  1GV2 A;  4A93 J;  5EF6 A;  1HDD C;  1Z0X A;  4BY7 J;  1RET A;  2ME6 A;  1JKO C;  4M6V A;  4B4C A;  4UUS B;  1GT0 C;  5E3M A;  4C2M J;  2GM4 A;  2E2J J;  2DA3 A;  1W0T A;  5IP7 J;  1MBG A;  3IH4 A;  3CCY A;  1WGX A;  4DYC A;  1ZR2 A;  3W6V A;  4W1U A;  2O7O A;  1BJZ A;  1Y1V J;  1MBJ A;  3ZQL A;  3H3V K;  4QIW N;  4M3B A;  2AHQ A;  3RKQ A;  2I10 A;  3ZQG A;  2JA5 J;  2EZK A;  2DMU A;  1I50 J;  2K9S A;  3G1L A;  3Q0V A;  1I6H J;  4XIC A;  2FD5 A;  3SDG A;  1YRN B;  2IEK A;  3QPL A;  2R0Q C;  3ZQI A;  2Y2Z A;  1TWC J;  5FKN A;  2XPV A;  1JKP C;  1JUS A;  3PO2 J;  1G2H A;  1ZKG A;  1ETK A;  2MG4 A;  4A3I J;  1IG7 A;  1YRN A;  2LTP A;  2NOG A;  1U9O A;  2M8G X;  5J1U A;  3WHB A;  3LSG A;  2HXO A;  1QPI A;  1FTZ A;  3LNQ A;  3CQZ J;  4DYR A;  3S1Q J;  4A3G J;  2CJJ A;  2N8G A;  5C4X J;  2OF7 A;  1NK3 P;  1B8I B;  2DA2 A;  2M9H A;  1NK2 P;  2ID6 A;  4I76 A;  1H8A C;  3MKL A;  2LVS A;  1B8I A;  1ENH A;  4MIM A;  1OFC X;  1XS9 A;  1WCM J;  5F08 A;  1ZGW A;  3S15 J;  2K9N A;  1IV6 A;  3I4N J;  3HDD A;  4D5F A;  1MBF A;  2AO9 A;  3JRD A;  3K2A A;  2ME0 A;  3S16 J;  2DA7 A;  3HOY J;  1FJL A;  2MSY A;  4MFD A;  1SAN A;  4XK4 A;  3A01 A;  4JX4 A;  3BQZ A;  5M3F J;  1APL C;  1CQT A;  5E3L A;  5IOY A;  1D5Y A;  3S2D J;  1ETY A;  2MGQ A;  9ANT A;  2CQQ A;  5C4J J;  2P81 A;  1ITY A;  3TP0 A;  5E3O A;  3GTJ J;  5J3L A;  4J19 A;  2E2H J;  4BY1 J;  2X48 A;  3BR3 A;  2CUF A;  2JMW A;  1TWA J;  5F0H A;  1AHD P;  1JGG A;  1I3Q J;  2VUM J;  1ETX A;  4FE4 A;  4IEJ A;  2R93 J;  3Q0W A;  4BKX A;  3LSP A;  4DZJ A;  4DYQ A;  5C44 J;  1JUM A;  1IDY A;  1U8B A;  2XGD A;  1WH5 A;  2DA5 A;  5EGO A;  2XSD C;  5M5W J;  1PUF B;  2H8R A;  1JT6 A;  4MLO A;  1W0U A;  2EZH A;  2E19 A;  3QPS A;  4MFE A;  1OCT C;  5EZH A;  1JJ6 C;  5M5Y J;  2TRT A;  5F0C A;  1K61 A;  4CYC B;  1PUF A;  2D5V A;  2ZB9 A;  1MH4 A;  3NAU A;  2Y9Z A;  2DTZ A;  3HB9 A;  5GPA A;  5K7F A;  4FIS A;  2NVQ J;  2R5Z B;  4RDU A;  2MW8 A;  4A3K J;  1IJW C;  3RQI A;  3BR0 A;  1FTT A;  2CRG A;  4QTR A;  3HBL A;  5EYR A;  3FKI J;  3WHC A;  2R5Z A;  3GTQ J;  2YS9 A;  4UUS A;  3FIS A;  3BTI A;  1T33 A;  4DZP A;  2XB5 A;  1U78 A;  1GUU A;  3S2H J;  2DMT A;  5FKL A;  2HOT A;  3ZQC A;  1LE8 B;  2X9D A;  5DS9 A;  3ZQH A;  4B1R A;  2EBI A;  4M3D A;  1MBK A;  3MVP A;  1GVD A;  2VKE A;  3H0G J;  1ZR4 A;  3S14 J;  3S17 J;  5GP9 A;  1Q1V A;  3K7A J;  3HOU J;  3GTK J;  4AC0 A;  1QVU A;  1X2N A;  1P7J A;  3JRC A;  2DA1 A;  4XRS A;  3DEW A;  2FX0 A;  2HOA A;  2NS8 A;  1WI3 A;  2EH3 A;  3BTJ A;  3HOX J;  2M34 A;  3TP3 A;  1JKQ C;  4V2F A;  2W48 A;  3JR9 A;  2DMP A;  2L9R A;  5EG0 B;  3A02 A;  4L5E A;  4LOC A;  4BXX J;  5EDN A;  1AKH B;  3IH3 A;  2DMN A;  2XRL A;  1NTC A;  1OJL A;  2PMZ N;  3BT9 A;  1MH3 A;  4JX5 A;  2R7Z J;  4ABZ A;  3JRA A;  5EG0 A;  1LFB A;  1VF9 A;  2ELK A;  1RR7 A;  2DMQ A;  4BBR J;  2WAQ N;  2JA7 J;  1AU7 A;  4X1E A;  3BR1 A;  4NDL A;  2O8K A;  2M2E A;  4JYK A;  1MBH A;  3OOU A;  1H89 C;  1XC5 A;  1TWF J;  3BR6 A;  2LP0 A;  1GDT A;  4JX6 A;  2K40 A;  3PM1 A;  1ETO A;  2NS7 A;  4M3G A;  5FKO A;  5IOZ A;  3NAR A;  2H1K A;  1A6I A;  4S0H B;  3JRF A;  3D1N I;  3BG3 A;  2GBY A;  3BQY A;  1TWH J;  4MO7 A;  4HNV A;  3HEF A;  2XPU A;  2HOS A;  2L7M P;  1E3O C;  4XRM A;  2JA8 J;  3RZO J;  1POG A;  2FQ4 A;  1TC3 C;  2QCO A;  2VPR A;  4A3C J;  3IH2 A;  1FIP A;  2CQX A;  2EZI A;  3CMY A;  2XGC A;  1Z77 A;  3TED A;  2LR8 A;  3JRE A;  3F0C A;  5FLV A;  3BG5 A;  5K7H A;  3JRI A;  2LLK A;  3O8G A;  1VND A;  3B6A A;  2EZL A;  5FLM J;  5IP6 A;  2JA6 J;  4IHY A;  2LKX A;  4A3D J;  2XPW A;  3BR2 A;  2VKV A;  3HGY A;  1BW5 A;  2HQ5 A;  2L0K A;  1FEX A;  2L7F P;  2B63 J;  4W97 A;  4D5C A;  4I6Z A;  3VPR A;  1HOM A;  4AYB N;  1X2M A;  5M3M J;  3GTM J;  3MN2 A;  3B6C A;  1UG2 A;  2O9L A;  2DN0 A;  3UKG A;  1F36 A;  2HYJ A;  4IHX A;  4C3H J;  1DU6 A;  2XB0 X;  4FE7 A;  1MSE C;  2LK2 A;  5F1J A;  2TCT A;  3Q0U A;  4A3F J;  3GTP J;  3M4O J;  4D7N A;  1IC8 A;  3BTC A;  3Q3S A;  4V2G A;  5F0F A;  3ZOB A;  3GTG J;  2LY9 A;  5EEA A;  4DW6 A;  3C2B A;  2FJ1 A;  3OSG A;  4A3B J;  4GFB A;  1QVT A;  2OPT A;  1S7E A;  2QF7 A;  3I4M J;  5K7Z A;  1ZK8 A;  4CYC A;  4G12 A;  1HCR A;  4UUT A;  1LFU P;  2Y0S N;  4C3J J;  2COB A;  3S1N J;  2JJ7 A;  5DTD A;  3S1R J;  3LSR A;  1JUP A;  4XID A;  3JRB A;  3HOZ J;  1EF4 A;  1O4X A;  1U9N A;  4JP0 A;  2DJN A;  1ETQ A;  2WB1 N;  1WPK A;  3M3Y J;  2L7Z A;  4M3E A;  2JWT A;  5E3N A;  4M3F A;  3BR5 A;  2HI3 A;  2JK3 A;  1T56 A;  2RAE A;  3LSJ A;  1LE8 A;  5JLW A;  1R9T J;  5J1Y A;  4FTH A;  2G0E A;  3JRH A;  1RKW A;  3OIO A;  2R5Y B;  1BA5 A;  5IPA A;  5BNG A;  4A3M J;  4A69 C;  1SFO J;  1B72 B;  3CDL A;  2NVX J;  1RKT A;  1IGN A;  1Y1W J;  5FKK A;  2R5Y A;  3TW7 A;  4FCY A;  2YU9 J;  4XRS G;  2R92 J;  1FIA A;  1B72 A;  2JN6 A;  1RES A;  3IV5 A;  2Y31 A;  4X6A J;  1IUF A;  1AKH A;  1ETW A;  2VI6 A;  1VI0 A;  2XGE A;  4RBO A;  1JTY A;  1QRY A;  2HDD A;  1ZTR A;  3GBG A;  3E7L A;  3FK7 A;  3PO3 J;  3DCF A;  1HDP A;  2KDZ A;  3GTL J;  1UMQ A;  2WV1 A;  5FKM A;  1JJ8 C;  3GTO J;  2ECB A;  2EQR A;  5J1R A;  1IRZ A;  1UHS A;  1P7I A;  5C3E J;  3TW6 A;  3HM5 A;  2LD5 A;  2ECC A;  5EZG A;  1VFC A;  3HGG A;  5IYC J;  1OCP A;  3QQA A;  1WH7 A;  4C3I J;  3S1M J;  4Y52 J;  3A03 A;  1MBE A;  1F43 A;  5M5X J;  3BG9 A;  1HLV A;  3O8H A;  5F27 A;  4EEF G;  2DA4 A;  1K83 J;  2K9Q A;  2Y9Y A;  5IYD J;  1BW6 A;  2IAI A;  1RPW A;  3A01 B;  3FK6 A;  3OSF A;  4D7M A;  4A3E J;  2GLO A;  2E1O A;  1A5J A;  3G1O A;  1JT0 A;  3RZD J;  3HOV J;  3FIW A;  1HF0 A;  5FJ8 J;  1JTX A;  4B3A A;  3HKZ N;  4BBS J;  2YUS A;  1ORK A;  2ID3 A;  3HOW J;  3ZQF A;  1ETV A;  5JLX A;  2M0C A;  1BL0 A;  1GV5 A;  2X6O A;  2HXI A;  4AUX A;  3SFI A;  2KT0 A;  5GPC A;  2CUE A;  4IHW A;  2IBD A;  3G1M A;  4A3L J;  1MSF C;  2CU7 A;  1TWG J;  3BTL A;  5EGO B;  3JRG A;  2E2I J;  1XG1 A;  5IP9 J;  3SJM A;  1MNM C;  2NVY J;  2Y30 A;  1ZQ3 P;  5IYB J;  3L1P A; 
#chains in the Genus database with same CATH topology
 2K86 A;  2FBK A;  4HZF A;  1JGS A;  3VWB A;  2DA6 A;  1IXR C;  2A6T A;  3DPL C;  2FNP A;  2F5F A;  4QSH A;  5DV5 A;  3KX2 A;  5AIQ A;  1O7L A;  1X58 A;  4XOT A;  4LJZ F;  3SZP A;  1R1T A;  2RDP A;  4L5I A;  4M9Z A;  5HOD A;  4BDZ A;  2K4B A;  1Z05 A;  4MNU A;  2QSG X;  5GTH C;  2NAZ A;  3MAJ A;  4A0Y A;  2OD5 A;  5ICE A;  3BG6 A;  3CD6 I;  1SFE A;  5HS7 A;  2FU4 A;  1B59 A;  3ELK A;  2TDX A;  2DW4 A;  4YIF A;  3PUF A;  4B4C A;  4UV8 A;  2X6Y A;  5FB2 A;  3OYF A;  2MLG A;  2JRM A;  3DBL B;  4FX4 A;  5E3M A;  4M71 A;  1J2X A;  1E3P A;  2E2J J;  5D5U B;  2DA3 A;  3PNY A;  3DQV C;  3DFG A;  3GCM A;  4P96 A;  1V5F A;  1MMS A;  2FOK A;  2OAZ A;  3CCY A;  1IO2 A;  4DYC A;  1ZR2 A;  1VQ8 I;  3I56 I;  3HL2 A;  1OYI A;  1BJZ A;  2HVQ A;  3FF5 A;  1E0E A;  4PZJ A;  2WY7 Q;  2GWR A;  2L4A A;  2VIX A;  2PMZ A;  5E79 C;  4QIW N;  1BI2 A;  3OMY A;  2KKO A;  2AHQ A;  1KU7 A;  2ZJQ F;  1SFX A;  3VYU B;  3F22 A;  1HSJ A;  2XAH A;  1D1A A;  2I10 A;  3HPG A;  1SMT A;  3OYJ A;  2JA5 J;  1BR4 A;  2FOW A;  2FUG 2;  2VBX A;  1I50 J;  3GZN B;  3G1L A;  5IT9 K;  2NOJ B;  4KT5 C;  2M3A A;  5FRO A;  2H6C A;  2V9K A;  3R61 A;  5H20 A;  1S8N A;  3OV8 A;  1YIJ I;  3OYK A;  2VPL A;  4DIQ A;  3HG9 A;  2A5Y B;  1PDN C;  4YFN F;  1JKP C;  3LMM A;  1MMA A;  4R8H A;  3KYD B;  3SZT A;  4B47 A;  2R7V A;  1KQ8 A;  2MA3 A;  1BI3 A;  3I0T A;  5L3B A;  3WHB A;  4G7H F;  1Z6T A;  3F9K A;  3LSG A;  2R7F A;  3ZRG A;  3ZXS A;  1YJ9 I;  4HRI A;  2UXN A;  2OC6 A;  4A3G J;  2CJJ A;  5FLX Z;  3D5L A;  3MFK A;  5C4X J;  4RAZ A;  1TZL A;  5E1X A;  5J4Y A;  1NK3 P;  1X19 A;  2BOL A;  2HZT A;  3A4C A;  2LNB A;  3EYY A;  3TOB A;  4I76 A;  2FBH A;  4UHT A;  2MAB A;  1ZLJ A;  1MZB A;  2Y69 H;  3MWM A;  3HUG B;  1OFC X;  1WCM J;  2KRF A;  5F08 A;  3K4M A;  3RI4 A;  1LKX A;  2KZV A;  3BRO A;  5IT3 A;  4D5F A;  1MBF A;  2AO9 A;  1V55 H;  3F6O A;  3ML6 A;  1XDS A;  1V4R A;  2QEX I;  1LB2 A;  3HOY J;  1FP1 D;  3JW4 A;  4UXN A;  2MD0 A;  2QEN A;  2Z3Y A;  1U2W A;  4XK4 A;  3A01 A;  2FRH A;  2PJR B;  3AFH A;  3K4N A;  4RB3 C;  1ON2 A;  3I59 B;  2COM A;  5BQT A;  3KEQ A;  3S2D J;  1AOY A;  2MC4 A;  2VQC A;  1I5Z A;  3RTR A;  2DK8 A;  2A6E F;  4R1H A;  2CQQ A;  4LIV A;  3DKW A;  3K4J A;  3GX4 X;  2STT A;  2IA1 A;  3TP0 A;  3GTJ J;  4J19 A;  1FMW A;  4XKC A;  5K5Q A;  1YX3 A;  2X48 A;  3BR3 A;  4A2U A;  2BBY A;  2R7S A;  1RUO A;  3HJE A;  1XPX A;  4E70 A;  1JGG A;  3DKX A;  1I3Q J;  1ETX A;  4FE4 A;  4OAZ A;  2V6C A;  3U1D A;  3DWL E;  2DFH A;  1TL8 A;  2QQB A;  2FA5 A;  2VBW A;  3KFW X;  4DYQ A;  4G6D A;  4RAF A;  1U8B A;  2XGD A;  3EUH C;  2XSD C;  1V5G A;  5M5W J;  1PUF B;  4MLO A;  1W0U A;  3E6C C;  2CUZ A;  1OCT C;  2QQ8 A;  3D0S A;  3IWZ A;  4RGU A;  1Z3Y A;  2TRT A;  3M8E A;  5F0C A;  1WJC A;  3E97 A;  3GZ5 A;  3F8M A;  1G3Y A;  5BMZ A;  2O3F A;  1TT5 B;  3PSI A;  1MH4 A;  2IPQ X;  3NAU A;  2Y9Z A;  3K1M A;  3HB9 A;  5GPA A;  1AWC A;  4OIP F;  1DUX C;  2MW8 A;  2K4J A;  4GYG A;  3RQI A;  3ZN1 A;  3JCU C;  3IKV A;  4KIC A;  1MDM A;  1MD0 A;  1LVA A;  3X2Q H;  4D1Q A;  5EYR A;  3HIF A;  2R5Z A;  3GTQ J;  4NNJ A;  1XSX A;  2YS9 A;  3V7C A;  2YX7 A;  4UUS A;  2BVL A;  1T33 A;  4DNC A;  5ICG A;  1BOB A;  3A1Y A;  3IC7 A;  1LE8 B;  1MW7 A;  2EPF A;  3IRR A;  3QOD A;  5DS9 A;  2MYS A;  4HPQ A;  4HQE A;  2ELJ A;  2BY2 A;  4UVA A;  3FMR A;  4N9I A;  4IPA A;  2IGM A;  3S14 J;  2VOD A;  5GP9 A;  3CCE I;  2OTJ I;  3LFU A;  1P6R A;  4NC8 A;  1VQ4 I;  1YE9 A;  4AC0 A;  1QVU A;  3T8T A;  4XRS A;  5FLX K;  4EJW A;  2EIN H;  3I5U A;  2EH3 A;  4A0Z A;  1JKQ C;  2UWM A;  1QGP A;  3TP3 A;  1ON1 A;  4V2F A;  1GXQ A;  3JR9 A;  4HX7 A;  1VQO I;  1R5G A;  2DMP A;  1CF7 A;  3N4M A;  1XCV A;  3CF2 A;  2X1C A;  2Q8K A;  2VJ4 A;  3J81 Z;  5J47 A;  2XRO A;  1YHQ I;  4V19 K;  2E35 A;  1KU9 A;  2DMN A;  4IXA A;  3RDI A;  1QBJ A;  3BT9 A;  1Q1H A;  4A12 A;  1XMA A;  3DV8 A;  1N25 A;  3K69 A;  1LFB A;  3P7N A;  1S3J A;  1RR7 A;  2M0M A;  3N05 A;  2JTV A;  4LB5 A;  2O8K A;  4LK1 F;  2IA2 A;  2Q2E B;  4WXD A;  1N77 A;  4JYK A;  2HKO A;  1H89 C;  3SHF A;  1T6S A;  2ZFU A;  3QPT A;  2BYV E;  4CGZ A;  3RKX A;  2O0Y A;  3PM1 A;  2NS7 A;  4M3G A;  2H1K A;  3RCO A;  2PMU A;  4ZDP A;  4PUS A;  3JRF A;  1VQN I;  2GBY A;  3BQY A;  1TWH J;  5L3G A;  2X6W A;  3PIO F;  2DDB A;  3HEF A;  4KN4 X;  4KYW A;  3ZR8 X;  2M1B A;  2JA8 J;  3RQ4 A;  3RZO J;  3BJA A;  3I54 A;  3KLO A;  4LIT A;  1WKM A;  2QCO A;  1C0W A;  3CMM A;  2VPR A;  4YII A;  2VOP A;  4A3C J;  2F4M B;  2EZI A;  2G9W A;  3PQK A;  2E60 A;  1FBQ A;  4F93 B;  3L2W A;  4FET A;  1S5L C;  2GAU A;  3GZ6 A;  3F0C A;  2LY1 A;  4QPQ A;  3U2R A;  3OR2 C;  3PSF A;  5D4S A;  3B6A A;  1YS7 A;  4F91 B;  3DTI A;  2QA4 I;  1VQP I;  3C7J A;  2LSO A;  3T8R A;  1FT9 A;  3IP4 B;  3ERM A;  4HQM A;  3J7A O;  1H0M A;  1UAA A;  5D4R A;  2B63 J;  4D5C A;  4M9S A;  3L2U A;  1HOM A;  1B1B A;  3S3M A;  2X1D A;  5E8I A;  3MN2 A;  1FYM A;  3H35 A;  2DN0 A;  4LB6 B;  1AA7 A;  1YG2 A;  4KIB A;  4C3H J;  1MKM A;  2XB0 X;  3PL8 A;  5KAF C;  3BY6 A;  5LEK A;  3ABU A;  4CCO A;  4HW0 A;  4NQW A;  4A3F J;  3GTP J;  4PCQ A;  3GYH X;  2XF7 A;  3FXM A;  4C9Y A;  4EVI A;  5JVG F;  2XKO A;  5B1B H;  4IOA F;  1ZHF A;  4EAT A;  1NG6 A;  4WXH A;  5J40 A;  3TO7 A;  1S7E A;  4D0P A;  3AL0 B;  3AG2 H;  3RPQ A;  2ZO4 A;  2DT7 B;  3KLN A;  2HDC A;  3R60 A;  3R0A A;  4C3J J;  5HOO A;  3S1R J;  4Q47 A;  5IY5 H;  1DGR M;  4ZYH A;  3JRB A;  1OR7 C;  3HOZ J;  3ABL H;  3C18 A;  1SVO A;  1VQM I;  3OYD A;  3H5A A;  3R0J A;  4E7L A;  4GO1 A;  1O4X A;  4JP0 A;  1GHC A;  1ETQ A;  3GFM A;  3ZQQ A;  3OYI A;  2K9M A;  3WGG A;  2JWT A;  2D1H A;  4BNC A;  3MKW B;  3BR5 A;  2HFH A;  4U87 A;  3FHN A;  3J81 K;  2X0L A;  2P8T A;  3JTH A;  1T56 A;  2KIF A;  5J1Y A;  2QBY A;  2LRD A;  2E5Z A;  2G0E A;  2A05 A;  3I9V 2;  4ZYG A;  2R5Y B;  4QWQ A;  4E7I A;  1BA5 A;  2PBI A;  4CCM A;  5IPA A;  1T38 A;  3GFJ A;  1ZAO A;  2HS5 A;  1WRJ A;  4U0Y A;  1SFO J;  2DJI A;  2G7U A;  1YOV B;  5J4V A;  2QYO A;  3TQN A;  1RNL A;  3HTU A;  4Y13 A;  4U88 A;  2OV7 A;  2BXY A;  2YU9 J;  4XRS G;  5KK1 A;  2LYC A;  1B72 A;  1R22 A;  1XB4 A;  2JN6 A;  4N9H A;  1UFM A;  4CA0 A;  3IV5 A;  1LJ9 A;  3C2H A;  3V7S A;  4HST A;  4LIU A;  4P1W A;  5D8L B;  1VQ6 I;  1VI0 A;  2XGE A;  4LFU A;  5CLS A;  1HW1 A;  4G9Y A;  1QRY A;  3GBG A;  2CW0 F;  4C2U A;  4GGG A;  3PFI A;  3DCF A;  4XN0 A;  3KE2 A;  4Q48 A;  2CSO A;  1HDP A;  5LBQ A;  2R7X A;  2WV1 A;  3WOD F;  4ASN A;  1O3Q A;  3GTO J;  4CIC A;  5J1R A;  2DBB A;  2GQQ A;  3LWF A;  1BM9 A;  5K1Y A;  1F9N A;  5C3E J;  3L00 A;  2W25 A;  2LD5 A;  2ECC A;  5EZG A;  4PK4 A;  3QQA A;  3OYN A;  1WH7 A;  2OQR A;  2RGV A;  3FMQ A;  4XMY A;  2YR2 A;  1F43 A;  5M5X J;  2H1L A;  2BZT A;  4AVP A;  1HLV A;  2R7D A;  2ZME A;  3BZC A;  2JQ7 A;  3O8H A;  5F27 A;  4KA4 A;  4EEF G;  1HXD A;  3ABM H;  1S9H A;  2LMD A;  4G6Q A;  3W6J B;  2HVR A;  3MMY B;  4IHT A;  2CH0 A;  5LHG A;  4KUM A;  2UUZ A;  4Z2Y A;  4A5N A;  2GLO A;  2IGN A;  2R4G A;  2KRC A;  2FE3 A;  3WTX C;  4HNU A;  3RZD J;  1WFX A;  3LA3 A;  4B3A A;  4OMY A;  2IS2 A;  5CVI A;  2YUS A;  2CYY A;  4PJJ A;  2V1N A;  4I02 A;  4BAY A;  5LGT A;  3HOW J;  1ZGA A;  2M0C A;  3IAM 2;  3K4C A;  3ONQ A;  1KYZ A;  3DBR B;  4NC7 A;  2ZXJ A;  4DOZ A;  3F72 A;  4XKW A;  4HX4 A;  2KT0 A;  1OMI A;  1WJE A;  1DQU A;  2PN6 A;  2IBD A;  1NHA A;  2JUC A;  3G1M A;  5D8K B;  4UUV A;  4LLN A;  2NVU B;  2HPI A;  2CFO A;  1YIO A;  2IXS A;  1ZG5 A;  4YEJ A;  2WAD A;  3SJM A;  1QNT A;  1ZQ3 P;  5HVQ C;  1Z67 A;  1XSV A;  1EA3 A;  2P5K A;  1WJB A;  4KIF A;  1H88 C;  1R4M B;  1G4D A;  4A3J J;  1SVM A;  1J0R A;  2EIM H;  2K3P A;  3JSO A;  3ZCO A;  4IO9 F;  2WTE A;  1IDZ A;  1ZEL A;  5DM7 F;  3IAS 2;  1DU0 A;  2DPD A;  1GV2 A;  1HKQ A;  3CCV I;  3TOA A;  4UB8 C;  1R36 A;  1RET A;  4LLL A;  3CUQ B;  1A35 A;  2QVO A;  1IN8 A;  3MCZ A;  1LEB A;  3F3X A;  1QZY A;  1GT0 C;  4BEH A;  3UR3 C;  3S3O A;  2IRF G;  3U21 A;  1T0F C;  5GAD J;  1W0T A;  5DYM A;  2IS6 A;  1A31 A;  2BY1 A;  5BS6 A;  3JTG A;  3O6B B;  1WGX A;  1UST A;  3ISP A;  2ZXI A;  3KEY A;  2V6E A;  4DBQ A;  1XMX A;  1Y0N A;  1Y1V J;  5AIP A;  5HDK A;  2FML A;  2IS1 A;  3V8L A;  3H3V K;  1W7P A;  4HLY A;  3CTA A;  4EMS A;  4P9U A;  5B5E C;  2E1C A;  4RM2 A;  1BN5 A;  3RYR A;  4BQO A;  2EFW A;  2DMU A;  4Y4R A;  5HNH A;  4ZTF A;  1R23 A;  2XAG A;  2PFB A;  3Q0V A;  5D5X B;  3H9Q A;  4N4O B;  3HXL A;  1YRN B;  1YW7 A;  3OIQ A;  2P0W A;  2DQL A;  2P5L C;  3KP2 A;  2ZBK A;  2Y2Z A;  3O2P E;  4HDU A;  3R6S A;  2CGP A;  2B7E A;  1I27 A;  5J8F A;  2D45 A;  1OCR H;  2VE8 A;  2RV8 A;  3PO2 J;  1G2H A;  1FOX A;  4XLP F;  1ETK A;  2P7C B;  1D0Z A;  1SD7 A;  2NNY A;  4YEL A;  2VOO A;  5CVV A;  4F3Q A;  4XRF A;  2VLA A;  1BIB A;  3CJQ B;  3WU2 C;  2PQ8 A;  1NH3 A;  2KIQ A;  3LNQ A;  2RN7 A;  1FX7 A;  2OF7 A;  2L7K A;  1B8I B;  2V9V A;  2F6C A;  3IHU A;  4I99 C;  4IQJ A;  2ESN A;  2L01 A;  3TO9 A;  2XHK A;  1FBU A;  1R1U A;  2WA0 A;  4IHS A;  2JSP A;  1WJ5 A;  5FO5 A;  2LVS A;  2ZC2 A;  4MIM A;  2AXL A;  1FPQ A;  3DEE A;  1ZGW A;  1RI7 A;  1TW3 A;  2K9N A;  3KP4 A;  4IF4 A;  4RB2 C;  1QHG A;  2K3F A;  1ZGJ A;  3S16 J;  3ABT A;  3TBI A;  1FJL A;  2MSY A;  4MFD A;  3HUG A;  3CO7 C;  2JA2 A;  1Z21 A;  4JX4 A;  1L3L A;  4BHB A;  1T98 A;  4IX7 A;  3B02 A;  2WY8 Q;  2ICW G;  3E3V A;  1WJD A;  2VT2 A;  5E3L A;  5IOY A;  5M3F J;  1APL C;  1CQT A;  2MD5 A;  4QPO A;  5LFA A;  4XLH A;  2XRN A;  9ANT A;  1KQ9 A;  1MNE A;  2P81 A;  2PJR A;  1S7O A;  3I59 A;  1XD7 A;  2E2H J;  2PLY A;  4BY1 J;  1PJR A;  3G73 A;  2YU3 A;  1K79 A;  2FMY A;  2CUF A;  2JMW A;  3OY9 A;  1TWA J;  3L2C A;  3VSL A;  1A36 A;  2W84 A;  1MND A;  1U5T B;  2OBP A;  3WU0 A;  2R93 J;  3Q0W A;  4Y3O A;  4BKX A;  3LSP A;  3CC4 I;  2M45 A;  1JUM A;  4BJ5 C;  2EIK H;  3FZV A;  2DA5 A;  2ZFW A;  3N97 A;  2H8R A;  3PIP F;  2E19 A;  4C2T A;  3ULQ B;  1FZP B;  4ESJ A;  3CLQ A;  1X1C A;  3NWT A;  3BC8 A;  4CYC B;  2VN2 A;  1PUF A;  3M8J A;  1FP2 A;  1PUE E;  4OIN F;  2KZG A;  3CC7 I;  4QLC U;  3EET A;  4CXF A;  1IJW C;  2RKH A;  4E7K A;  4U7B A;  2CRG A;  1T08 B;  3HBL A;  3LA7 A;  4HBL A;  1HW2 A;  2QUF A;  1BIA A;  2HYF A;  2EIL H;  2QZ8 A;  3BTI A;  3WE2 A;  5DUI A;  2A3S A;  4EJV A;  1U78 A;  2F4O B;  4IJA A;  2DMT A;  5LEJ A;  4Y17 A;  1IXS B;  4UB6 C;  1K4T A;  1MGT A;  2HOT A;  3CJR B;  5D5V B;  1BC8 C;  2L4M A;  2E1M B;  2R7U A;  4M3D A;  2DDA A;  1MBK A;  1V5E A;  3MVP A;  1QU3 A;  3CCL I;  2EV6 A;  1X4O A;  2EFN A;  2CS3 A;  4XSX F;  2Z33 A;  3CJN A;  4OIR F;  1G8X A;  4R79 A;  3GTK J;  4PFO A;  1X2N A;  4EGZ A;  2MFZ A;  1P7J A;  4XLF A;  1XMK A;  2M7A A;  1YJN I;  3ECH A;  2EIJ H;  3DEW A;  5ILS A;  1IUY A;  4E4H A;  4ZZD A;  2W48 A;  4K2E A;  1STZ A;  2LBF B;  1W5C C;  4L5E A;  1V54 H;  4II3 A;  2DT5 A;  3WGH A;  1XGO A;  1AKH B;  3FXR A;  3IH3 A;  2PEX A;  3QYE A;  1OJL A;  4IL6 C;  2R7Z J;  1LUJ B;  1Y8Q B;  3CP2 A;  4JX5 A;  4OOI A;  4ABZ A;  5E18 F;  3V8K A;  3OYH A;  3DLL F;  1K4S A;  3S3N A;  2MH2 A;  4CUG A;  4IKF A;  4BBR J;  2WAQ N;  1FC3 A;  2CV0 A;  3E5X A;  5HS8 A;  4RAG A;  4HF0 A;  1AU7 A;  4OIQ F;  2E7W A;  1ZYR F;  3TMO A;  1MBH A;  4AWX B;  4RAY A;  2LP0 A;  4JX6 A;  5FKO A;  1ETO A;  5DDG A;  2L54 A;  3ZMU A;  5JFR A;  4A6D A;  2LH9 A;  1A6I A;  2DT6 A;  4OU0 A;  3D1N I;  1IN4 A;  4MO7 A;  4HNV A;  5B1A H;  3S2W A;  5FRM A;  2XPU A;  2X4H A;  3O3K A;  1R6R A;  4EM0 B;  3QRF F;  3HRS A;  4F92 B;  1POG A;  2FQ4 A;  1TC3 C;  1Z7L A;  3L9F A;  4BJT A;  5JHU A;  1UHW A;  2V4J C;  4BXF A;  3F8N A;  1YO5 C;  3KP3 A;  4RGR A;  4MEX F;  1ZRD A;  3BPV A;  4E7J A;  2X51 A;  3VOE A;  5FLV A;  3DPU A;  1R58 A;  5K7H A;  3JRI A;  3PJR A;  1TW2 A;  2CW8 A;  1LDD A;  1U6G A;  3ZMD A;  2JA6 J;  3VOD A;  4A3D J;  2MH9 A;  2XPW A;  4KIT B;  4FX0 A;  2DI3 A;  5FRN A;  1ZRF A;  2DCE A;  4ITV A;  3SFZ A;  4S05 A;  2IS4 A;  3VPR A;  2W57 A;  1X2M A;  5M3M J;  1PYV A;  3AL0 C;  1B9N A;  2Q1Z B;  5D6E A;  1ERD A;  4EM2 A;  2LF8 A;  4FE7 A;  4GYI A;  4KDP A;  5K5R A;  3WTU C;  1HKT A;  1TLH B;  2LK2 A;  3KZZ A;  2B0L A;  3Q0U A;  1TQP A;  4X0G A;  3V8J A;  4U7D A;  2ZJ2 A;  3BTC A;  1G3W A;  3ZOB A;  2CUJ A;  2KJC A;  2A5W A;  5EEA A;  1IN7 A;  1E3H A;  2FJ1 A;  2WC2 A;  3H9J A;  3U9G A;  3OSG A;  2OPT A;  4CO8 A;  4OWR B;  2XUB A;  2QF7 A;  3I4M J;  2XAU A;  1HCR A;  1IAW A;  1MJA A;  2G7H A;  4XKB A;  2Y0S N;  2COB A;  3S1N J;  3ZPL A;  1JUP A;  4XLA A;  2EFO A;  3F8B A;  2C6Y A;  1EF4 A;  1O7F A;  3LL7 A;  3EUH A;  3COA C;  1D1B A;  3SEZ A;  3V4G A;  1U9N A;  2P5V A;  5KAI C;  4UVB A;  2Z9O A;  2DJN A;  2VQL A;  1FBS A;  4ESB A;  1WPK A;  2BW3 B;  3RKW A;  1HC8 A;  2A61 A;  3FMS A;  3WTW C;  4I2O A;  4KIG A;  2JSC A;  2WAF A;  4M3F A;  2RQQ A;  1VQK I;  1TNS A;  3LFK A;  2JK3 A;  1BBY A;  4XNF A;  3LSJ A;  1R71 A;  1JE8 A;  5JLW A;  1R9T J;  3Q9V A;  3W6K B;  3J7Z I;  3PNT A;  1RKW A;  2P7V B;  1YI2 I;  2E34 A;  4A3M J;  2P6T A;  4XSZ F;  1D0X A;  2J5O A;  1W5T A;  3CC2 I;  1EH8 A;  1RKT A;  3QYB A;  4WK8 F;  2R5Y A;  2HU9 A;  5FD5 A;  3QWL A;  3LSI A;  3RPU A;  2XIG A;  1ACI A;  3M7G A;  4OIO F;  1IUF A;  1P2F A;  1ETW A;  2LC2 A;  3SXY A;  1UB9 A;  2XSJ C;  2FNA A;  1ZTR A;  3HOT A;  3E7L A;  3FK7 A;  3PO3 J;  2HOE A;  3I53 A;  5LHI A;  3GLX A;  2KDZ A;  2DTR A;  3CUO A;  3FXU A;  5DD4 A;  5FKM A;  4L5J A;  2ZCW A;  4OMZ A;  4PSX A;  5KHD A;  1IN6 A;  5ICF A;  2ECB A;  4B8X A;  1DPR A;  1JHF A;  1X3W B;  2KIS A;  1X1A A;  2IA0 A;  3TW6 A;  3G71 I;  3HM5 A;  4BE1 A;  2F5C A;  3HGG A;  5IYC J;  4UY8 I;  3S1M J;  1MBE A;  3BG9 A;  4CHU A;  5JR3 A;  4KN7 X;  1KU3 A;  1K78 B;  3Q9S A;  4MTD A;  2Y9Y A;  1N75 A;  1QZZ A;  2NXN B;  5IYD J;  2IAI A;  4I01 A;  1RPW A;  4MHG A;  3A01 B;  1W1W E;  3FK6 A;  3OSF A;  4A3E J;  1Y39 A;  5CKT A;  1FOK A;  4KFC A;  4BDY A;  1Z3X A;  3FIW A;  5LLQ A;  5LHH A;  3HKZ N;  2BEO A;  1SVL A;  1ORK A;  2XF5 A;  4HG2 A;  2O61 A;  1MJB A;  1ETV A;  3RIR A;  1YW9 A;  4CH7 A;  1R1V A;  1ZAR A;  1B4A A;  5GPC A;  4LGW A;  1F5T A;  4IQ4 A;  5J6X A;  4IHW A;  1S7A A;  2KPM A;  4A3L J;  1MSF C;  1TP4 A;  3CME I;  3E6B A;  1TWG J;  2KLO A;  5E1W A;  3CF5 F;  2V1X A;  5IP9 J;  1MNM C;  2ZNZ A;  2EFP A;  2R7R A;  3LSM A;  3CUQ C;  1UG0 A;  3L1P A;  3KPH A;  5F04 A;  2HR3 A;  4XLE A;  2LFB A;  2DPU A;  4LG3 A;  4MTE A;  3D5S C;  3LOC A;  2YPR A;  2NVT J;  4JQF A;  1XN7 A;  2BE5 F;  1JKR C;  4Y7N J;  4IHV A;  2XAF A;  4DQ2 A;  2OJE D;  3KZI C;  4BQQ A;  4G6T B;  3AG3 H;  4S04 A;  5EF6 A;  4RGS A;  1Z0X A;  3W2V A;  2R7O A;  4M6V A;  5F64 A;  4UUS B;  2B9S A;  1USS A;  4IOC F;  1YJW I;  1HBX G;  2XV4 S;  4N0B A;  2NRA C;  1J09 A;  4LLG F;  3KP7 A;  2GM4 A;  5H6R A;  4EQQ A;  3OS1 A;  4EV0 A;  2QWW A;  4H0E A;  5IP7 J;  2NYX A;  2OCE A;  4M6X A;  1MBG A;  4B48 A;  1RZ4 A;  3I55 I;  2HQR A;  1Z1D A;  3QPH A;  3IH4 A;  4FQG A;  1O3R A;  3V7R A;  1D3Y A;  2LY2 A;  2EV5 A;  3MKZ A;  3FXK A;  4W1U A;  3AKZ A;  2O7O A;  2OTL I;  1J5Y A;  3FBI B;  1FNN A;  2L5Q A;  3ZQL A;  2RVC A;  4BE2 A;  1OR7 A;  2VT3 A;  2VJJ A;  3DP7 A;  5DCM B;  2WAQ A;  3RSN A;  1LPQ A;  2H6B A;  1ZN2 A;  2K9S A;  3W2W A;  4ZZL A;  2MC3 A;  1I6H J;  2EB7 A;  4XIC A;  4KT6 A;  1CF7 B;  3SDG A;  3M8F A;  2K9L A;  3SQN A;  3QPL A;  3ZQI A;  1TWC J;  3F8F A;  3K10 A;  4A0X A;  5FKN A;  3LQR A;  1YIT I;  2MG4 A;  1IG7 A;  1ZRC A;  1YRN A;  2LDU A;  2LTP A;  4M72 A;  1U3E M;  3CCR I;  1QZE A;  4HV5 A;  6PAX A;  1RIO H;  1J59 A;  4I98 B;  3S1Q J;  1WJF A;  5B3S H;  2N8G A;  5CYV A;  4AU7 A;  2EFQ A;  3CZ6 A;  2DA2 A;  3P9C A;  1NK2 P;  1T2K A;  3I71 A;  3S93 A;  1OQY A;  2HYG D;  2KJB A;  1H8A C;  4LD5 A;  2EK5 A;  1UHM A;  3MKL A;  2VAS A;  3M1E A;  5CQG A;  1B8I A;  1ENH A;  3CES A;  1E2X A;  4P5O A;  2DO7 A;  5L3F A;  1FYL A;  1VQL I;  1XS9 A;  2XGX A;  5ILU A;  3S15 J;  1IV6 A;  5CVU A;  3JAM Z;  3HDD A;  4NHJ A;  1P9Q C;  3JRD A;  2PJP A;  3K2A A;  1DP7 P;  4XL9 A;  1WJA A;  1SAN A;  3BG7 A;  4AIK A;  2OUM A;  4KNY A;  3R4K A;  4L18 B;  4G8X A;  1U5T C;  1KYW A;  2HQN A;  1D5Y A;  4L0Y B;  3VFZ A;  2BHY A;  4ZC3 A;  3WTS C;  3PUB A;  4XLN F;  1XX5 A;  3OYG A;  4L9T A;  1FWZ A;  1OYY A;  2DLL A;  4CZZ A;  1ITY A;  2LOO A;  2DU9 A;  3DLA A;  3H5N A;  4EJO A;  1LVK A;  1SAX A;  1P92 A;  5HDG A;  1L0O C;  1W36 D;  3E5Q A;  4TV7 A;  5F0H A;  1G59 A;  1AHD P;  5FD6 A;  2DFI A;  3FKJ A;  2Y0S A;  4DJA A;  2OZ6 A;  1YLF A;  4BGD A;  4NQW B;  1TTY A;  4IVN A;  1WH5 A;  5HDN A;  5EGO A;  1MMN A;  1U5T A;  1JT6 A;  2I5U A;  3K1N A;  2OQG A;  1X4P A;  2EZH A;  3C2G A;  3QPS A;  1QA6 A;  5EZH A;  3LQQ A;  1JJ6 C;  2K85 A;  4HF2 A;  1BR2 A;  5M5Y J;  3ABK H;  3MEX A;  3IL2 A;  3TKY A;  2HTJ A;  2W7N A;  1H9G A;  4L9N A;  4JK1 X;  1HA8 A;  1TQI A;  4ZH4 F;  2VXZ A;  2ISY A;  3K6G A;  3VB2 A;  1DP3 A;  2DTZ A;  4D9J A;  3K70 D;  1JI8 A;  3GO5 A;  3WTT C;  3I4P A;  4A3K J;  2E1M C;  3K2Z A;  3BR0 A;  3REO A;  4A5M A;  1E17 A;  2R7Q A;  3HC7 A;  1FTT A;  4PJN A;  4QTR A;  1XGS A;  3H3Z A;  1IRX A;  3CO6 C;  4YG2 F;  3CCQ I;  5ERI A;  3VYT B;  3FKI J;  3WHC A;  2LRE A;  3K9T A;  3IUO A;  3T0Y A;  3BJ6 A;  3DU6 A;  1T95 A;  3BWG A;  4ZYA A;  1WQ2 A;  3FIS A;  3WG7 H;  4DZP A;  2BHZ A;  1FOY A;  1J7K A;  3S2H J;  3ASO H;  2X9D A;  3CLO A;  3AG1 H;  2JRT A;  2M7B A;  3ZQH A;  5HLT A;  1XTA A;  2QBY B;  1S72 I;  2EBI A;  1D5V A;  2W24 A;  4A6E A;  3MKY B;  2VKE A;  2IW5 A;  3QOE A;  3S17 J;  3HRM A;  2VBY A;  4RGX A;  1JHH A;  3KIO A;  4I7H A;  5KCM A;  1DGW Y;  2IVM A;  1XSD A;  1M1E B;  2PMH A;  2FX0 A;  3BTJ A;  3BPX A;  3HOX J;  2M34 A;  4BHP A;  5K5O A;  3T1B A;  1VZ0 A;  1T0F A;  4HV6 A;  3RKY A;  2F5E A;  3A2K A;  5EG0 B;  5L3E A;  3A02 A;  3FXO A;  1ONV A;  2HWV A;  2FXA A;  1ZG3 A;  5F1R A;  1MH3 A;  4KMF A;  2LBF A;  3JAM K;  1T8I A;  3G4S I;  1VF9 A;  2VQH A;  2ELK A;  4BQA A;  5CQE A;  3J80 Z;  4YIR X;  1D0Y A;  1UEL B;  1Y6I A;  4JOM A;  2FEZ A;  2JA7 J;  3OYB A;  4X1E A;  2J5P A;  4NDL A;  4ZTJ A;  2VC1 A;  3P5J A;  3MZY A;  2DOF A;  2F2E A;  3OOU A;  1PP7 U;  4AVZ A;  1GDT A;  3HKZ A;  5IOZ A;  1Z6R A;  3OWT A;  1TT0 A;  4Y15 A;  2ZME B;  4S0H B;  4EM1 A;  3BG3 A;  4Q4Z F;  3HSR A;  4KJZ A;  4HEA 2;  4XR6 A;  3UNG C;  2OU2 A;  2DYS H;  3M07 A;  1W5S A;  1OYW A;  2HOS A;  1I1G A;  3LA2 A;  2K7L A;  1E3O C;  1SEU A;  4XRM A;  3L7W A;  4E7S A;  3L2R A;  3T5X A;  3P9I A;  2M4K A;  2Z2S B;  1BI0 A;  2CQX A;  3CMY A;  4WCG A;  4ZDL A;  3U1K A;  3JRE A;  5CPR B;  1K6O A;  4I0A A;  3GF2 A;  2LLK A;  2VB6 A;  3O8G A;  4AD9 A;  3CCS I;  2H94 A;  1VND A;  3GWZ A;  3F21 A;  2EZL A;  3OYM A;  4Y33 A;  2LKX A;  4FHT A;  4ZYD A;  3H3U A;  3ERE D;  3TGN A;  2DQR A;  4CCL A;  3BR2 A;  3HGY A;  2HQ5 A;  3ZMT A;  1UCR A;  4HYE A;  4W97 A;  4I6Z A;  1FSE A;  2A68 F;  2HTS A;  2RNJ A;  4AYB N;  4RB1 A;  2KIM A;  2HPM A;  3B6C A;  1UG2 A;  1F36 A;  5FFX A;  2HYJ A;  3DBH B;  2H27 A;  2GIZ A;  2X85 A;  1DU6 A;  3MD2 A;  1YTY A;  2Q0O A;  1MSE C;  4DBR A;  2TCT A;  4XON A;  4L9V A;  1FYK A;  4GDF A;  3ZGK A;  1IC8 A;  3M4O J;  3Q3S A;  2M4G A;  4HSR A;  4BL0 B;  3OS0 A;  2LY9 A;  4BQN A;  4DW6 A;  5D5W B;  1O3S A;  4A3B J;  2F48 A;  1IF1 A;  4KIS A;  5K7Z A;  1ZK8 A;  4G7O F;  3S8P A;  3OL4 A;  4UUT A;  4E7Z A;  1KQ0 A;  1J9I A;  4F52 A;  2DXI A;  1A6Q A;  2FF4 A;  2Z16 A;  4BEH B;  3H0D A;  5GAG J;  4BE0 A;  4B44 A;  2VKD A;  3FM5 A;  3GFL A;  1HST A;  2WB1 N;  3E0J B;  3M3Y J;  2L7Z A;  4RLQ A;  5LD2 C;  2EA2 A;  5E3N A;  4PGH A;  1SFK A;  3H1C A;  1FOW A;  1HKS A;  5TIS C;  1FSH A;  2BW3 A;  1LE8 A;  2H09 A;  1I6X A;  4BAC A;  3SZG A;  1W7P B;  2LG4 A;  3L09 A;  4FTH A;  3JRH A;  1F1Z A;  3J80 K;  3OIO A;  2QGU A;  4N4N B;  4WF2 A;  3W3C A;  3TDU C;  3K4B A;  3FWE A;  3ZMS A;  1YW8 A;  2WV0 A;  2M87 A;  2O8X A;  3CDL A;  2BV6 A;  5JI6 A;  3AAF A;  4AIH A;  5BOX A;  1OCO H;  1IGN A;  3HTS B;  5FKK A;  3OIP A;  4IRH A;  2ZJP F;  4MQ9 F;  3FM3 A;  5TRD A;  2R92 J;  1S29 A;  1FIA A;  5B66 C;  1RES A;  2Y31 A;  4X6A J;  3KYC B;  3E5U A;  3GVA A;  2JT1 A;  2VI6 A;  3DTE A;  2Z5U A;  4XOP A;  2CV1 A;  4RBO A;  1WSU A;  1JTY A;  2QSF X;  1SD6 A;  1Z91 A;  3K0L A;  2LKP A;  1J75 A;  3GTL J;  5JHF A;  1W4M A;  1UMQ A;  5DUK A;  5HNF A;  5TGT A;  1JJ8 C;  1I39 A;  3KZY A;  5CVJ A;  2EQR A;  3EYI A;  2R7T A;  2Q2E A;  1UHS A;  1P7I A;  2CMP A;  3QP6 A;  4LK0 F;  4HNT A;  2QKM B;  5EEH A;  3OYL A;  2IT0 A;  1OCP A;  1FY7 A;  3VYS B;  4Y52 J;  2DOE A;  3A03 A;  3FDY A;  2KFD A;  2A69 F;  2VJ5 A;  3DPT A;  4LG0 B;  2DA4 A;  2VON A;  1GXP A;  1EV7 A;  2KL4 A;  1BW6 A;  2GA2 A;  2I8D A;  1ULY A;  2BY0 A;  4EJT A;  3A0B C;  1W7P D;  1K78 A;  3HOV J;  1GVJ A;  5FJ8 J;  1JTX A;  2PX9 A;  2OA4 A;  3WTZ A;  2K02 A;  4PDK A;  3ZQF A;  1O3T A;  1ZLK A;  5JLX A;  3CCJ I;  3WTY C;  1R7J A;  2RQP A;  2BVM A;  4HA8 A;  1LEA A;  3HZJ A;  1BL0 A;  2ZXW H;  1BOA A;  2X6O A;  5E8G A;  2HXI A;  4WX9 A;  4U0W A;  2P4W A;  2CUE A;  5LGU A;  4GXO A;  4BH9 A;  2F4I A;  3DKY A;  2ELH A;  4RLF A;  5TJJ A;  2DOA A;  2ZXH A;  3ZMV A;  2EA4 A;  4I0B A;  1LDJ A;  3F23 A;  2JPB A;  2E2I J;  1XG1 A;  2CQK A;  2NVY J;  3L2V A;  1MJ9 A;  3HHH A;  3SDB A;  1ZG1 A;  2XC7 A;  2W4S A;  2ACJ A;  3KCC A;  1LNW A;  4M9X A;  2IP2 A;  2HEO A;  1U8R A;  3BOQ A;  4J00 A;  2E7X A;  2LF7 A;  3QP5 A;  3KP5 A;  3NQO A;  3FXJ A;  3OS2 A;  1LFP A;  2L2O A;  1QHH D;  3ZP5 A;  1KGS A;  3IRQ A;  4A93 J;  3BP8 A;  4WXC A;  5BPD A;  1HDD C;  1S6L A;  4BY7 J;  2ME6 A;  1JKO C;  4F55 A;  3BZK A;  1R5I D;  1Z9C A;  2VQG A;  3D5R C;  2GXG A;  2FBI A;  3ZQ7 A;  4XQF A;  3FXQ A;  3ESW B;  3GFI A;  3LST A;  4C2M J;  1BI1 A;  2GXA A;  1KA8 A;  2V1D A;  4O5V A;  1D1C A;  3PNV A;  2IJL A;  1W36 C;  3HHG A;  1REP C;  3W6V A;  3QU3 A;  4MQV A;  1WHU A;  4AM3 A;  4XLC A;  1DPU A;  1MBJ A;  4YRV A;  2IGO A;  2M8E A;  4M3B A;  1TQM A;  5ILV A;  1LDK B;  3RKQ A;  1FLI A;  3ZQG A;  1IRF A;  2EZK A;  1EJ9 A;  2L3D A;  2JZY A;  2KRH A;  4B43 A;  1X3U A;  2KP6 A;  5KVR A;  2Y48 A;  2FD5 A;  4HX8 A;  3EQL F;  1SD4 A;  1XCB A;  5E1Z B;  1ZRE A;  3BCB A;  2IEK A;  3J7Y J;  1X3Z B;  5EEG A;  2CQN A;  3GUD A;  2GIV A;  2R0Q C;  3J7A Y;  1YX5 A;  5DCM A;  1P4X A;  2XF6 A;  4Q5S F;  2XPV A;  1JUS A;  1RC9 A;  2Z1D A;  1ZKG A;  5E17 F;  3K70 C;  4A3I J;  1LQ1 A;  3JSP A;  3TO6 A;  2NOG A;  1U9O A;  2M8G X;  2O5R A;  4CYD A;  3WE3 A;  2V26 A;  5J1U A;  5AON A;  2HXO A;  1QPI A;  2EV0 A;  3VDX A;  1FTZ A;  3CQZ J;  4DYR A;  5FGM A;  2PI0 A;  4MEY F;  3I58 A;  1PP8 F;  4DGW B;  2M9H A;  1RRJ A;  1NG7 A;  4NBQ A;  2ID6 A;  3MZ8 A;  4ENN A;  2CWE A;  1OCC H;  2W82 A;  3OR1 C;  4RB0 A;  2LKS A;  1WZ2 A;  1D8K A;  4HF1 A;  2ZSI B;  4CCJ A;  4ESF A;  5HLH A;  3I4N J;  1QPM A;  4XN3 A;  2BGC A;  4AYB A;  2ME0 A;  2DA7 A;  4BXU A;  2UZK A;  4GRI A;  1Y56 A;  1XDU A;  2E5N A;  3BQZ A;  2CV2 A;  5BPI A;  1MIJ A;  2FQ3 A;  3E6M A;  3H92 A;  5EJC A;  2VE9 A;  1ETY A;  2MGQ A;  1TBX A;  2BY3 A;  3CDI A;  1KON A;  3RJP A;  2UXX A;  3VSK A;  2XAJ A;  3FHZ A;  2BXZ A;  3B73 A;  4FT8 A;  4M73 A;  5C4J J;  5E3O A;  5LRR A;  5J3L A;  4L9J A;  4II2 A;  5HLI A;  3CP8 A;  2MLK A;  4YFK F;  1OKR A;  4WWC A;  1UZC A;  1OLT A;  2PG4 A;  2ZNY A;  2VUM J;  2M30 A;  3CMA I;  4IEJ A;  4DZJ A;  1SFU A;  5C44 J;  2GA1 A;  1IDY A;  4M6Y A;  3L2Q A;  2JVG A;  2CO5 A;  1K7A A;  2QSH X;  4MFE A;  2FSW A;  1HQC A;  2WB1 A;  3ZN0 A;  3G6E I;  4F7Z A;  2KMU A;  3OYA A;  1T39 A;  4IZZ A;  2XVC A;  3MQ0 A;  1K61 A;  5KNL A;  1MDM B;  2JPC A;  1Y8R B;  4CSW A;  2D5V A;  2DFE A;  2ZB9 A;  3TDZ C;  1H9T A;  2AQE A;  4E7H A;  2W85 A;  2QQA A;  3FX3 A;  5K7F A;  1U0J A;  4FIS A;  3WGI A;  3RYP A;  4RDU A;  2R5Z B;  2NVQ J;  3M9A A;  1WVR A;  1X1D A;  1G6N A;  4BJ6 C;  5GTI C;  2VJI A;  3CUQ A;  4C30 A;  3HOS A;  3SEQ A;  2V1U A;  3PFY A;  2EWN A;  2HKX A;  3DXJ F;  2XAS A;  3OYC A;  2XB5 A;  1GUU A;  3EDP A;  5FKL A;  3LAJ A;  3ZQC A;  4NB5 A;  4Z6Y A;  1ZH5 A;  3K4K A;  3BLY A;  3IWF A;  4RM3 A;  2ESH A;  5DEQ A;  4RS8 A;  2ZJR F;  4B1R A;  2STW A;  4L0Z B;  1R5H A;  4XKV A;  1GVD A;  3TL4 X;  3H0G J;  4XOR A;  4GCV A;  1ZR4 A;  3EUA A;  2CFX A;  1Q1V A;  1IN5 A;  1QO0 D;  3K7A J;  4G94 A;  1P4A A;  3HOU J;  1XGM A;  1UJ8 A;  4IRI A;  2WBM A;  3JRC A;  2DA1 A;  3E1S A;  4B3X A;  2HOA A;  2NS8 A;  4PSW A;  1WI3 A;  3NEU A;  1P4W A;  2Y75 A;  1PVE A;  1SMY F;  1FMV A;  4U0V A;  2L9R A;  2ADU A;  4M74 A;  4LOC A;  3HRU A;  4BXX J;  2AS5 F;  1TNT A;  2XAQ A;  5EDN A;  1Z7U A;  4ANJ A;  2XRL A;  2GOM A;  1NTC A;  2ZME C;  3HPH A;  5E20 A;  3S32 A;  2PMZ N;  2HVS A;  4MGR A;  3JRA A;  5EG0 A;  4CDG A;  1HW5 A;  1SD5 A;  2DMQ A;  2M5W A;  1SC7 A;  3LSK A;  3KYL A;  3BR1 A;  5GAH J;  1OCZ H;  2CQ7 A;  2M2E A;  2OCC H;  4CZC A;  1XC5 A;  2HZD A;  1N78 A;  1TWF J;  3BR6 A;  2O6G E;  2K40 A;  3MZH A;  5A2Q Z;  4AIJ A;  3NAR A;  1F4K A;  3VYR B;  4ZYE A;  4E6K G;  2JUG A;  1G3T A;  5ICC A;  2L9V A;  3H9G A;  2V9P A;  2KHM A;  2L7M P;  4NUB A;  3PQJ A;  3HSE A;  3ASN H;  5CJ9 A;  5FFZ A;  1D8J A;  2QLZ A;  2W1O A;  3IH2 A;  1FIP A;  2XKP A;  3I3L A;  2XGC A;  1Z77 A;  5GAE J;  3CCU I;  3TED A;  1QQI A;  2LR8 A;  3BJO A;  3BG5 A;  2AXT C;  3QOP A;  1ODD A;  3DF8 A;  2DAO A;  4NC6 A;  2Z99 A;  4EJU A;  5FLM J;  3WU1 B;  2JVH A;  2X6X A;  5D6F A;  5IP6 A;  4J01 A;  2OZU A;  4IHY A;  1EKE A;  2QM3 A;  2R3S A;  4PFP A;  2E71 A;  3DTK A;  2WAE A;  4B09 A;  1GLN A;  2VKV A;  3EPZ A;  2V7F A;  4PJM A;  1BW5 A;  2V79 A;  1IW7 F;  1XGN A;  2L0K A;  1FEX A;  1WWX A;  4LMY A;  1OIS A;  2L7F P;  3RPU D;  2F5V A;  3QYF A;  2YSR A;  3GTM J;  1IXC A;  2O9L A;  3UKG A;  1Y0U A;  1K6Y A;  3WTV C;  3KET A;  1IZ1 A;  4IHX A;  3KP6 A;  3HRT A;  5HLG A;  4HOB A;  2H8W A;  2VKH A;  4YFX F;  2HGC A;  2NS0 A;  3F6V A;  1RUN A;  4AID A;  5F1J A;  2L9N A;  1KU2 A;  4OAY A;  3P9K A;  3BDD A;  4D7N A;  4V2G A;  4HAM A;  2NNN A;  2F5D A;  5F0F A;  5DM6 F;  3ECO A;  3HSF A;  5HS9 A;  2K27 A;  3EUK L;  3GTG J;  2VL8 A;  2VXD A;  2P6S A;  2ISZ A;  3C2B A;  5F6F A;  4EGY A;  4HDV A;  4GFB A;  1QVT A;  2DFF A;  2ZSH B;  2RNG A;  2K5C A;  1B6A A;  2EJR A;  1I3A A;  2ZKZ A;  4CYC A;  4G12 A;  2QQ9 A;  3A0H C;  1LFU P;  1IRG A;  2JJ7 A;  1X1P A;  4UVC A;  5DTD A;  3LSR A;  5H2F C;  2L9S A;  2E1N A;  2GZW A;  4XID A;  1OPC A;  3E6D A;  2L02 A;  4P55 A;  1G3S A;  1IV8 A;  2A07 F;  4UV9 A;  4JBA A;  3M1C A;  4M3E A;  1RR8 C;  1YFH A;  3NRV A;  1A04 A;  3V42 A;  3CJT B;  1YS6 A;  2RC4 A;  1R4N B;  2HI3 A;  4RMN A;  1DDN A;  2QKL B;  3OL3 A;  2RAE A;  3G3Z A;  2R7W A;  4UNO A;  3QAH A;  1MMG A;  3GME A;  5JVT A;  2MBF A;  3GEZ A;  3GXO A;  2GOX B;  1X1B A;  4ENJ A;  1KZH A;  5L3C A;  3LSH A;  4CCN A;  1BC7 C;  5BNG A;  4A69 C;  2O03 A;  2D2W A;  1SAU A;  1B72 B;  5CVR A;  4ZDO A;  3NWS A;  1EH7 A;  2NVX J;  2HDW A;  1Y1W J;  3GLL A;  5A2Q K;  5ED4 A;  3H5R A;  3TW7 A;  1BJA A;  4FCY A;  3VEP A;  1R49 A;  4IRG A;  4ON0 A;  3FBN B;  1VTN C;  5DCF A;  2CG4 A;  3ZMZ A;  4CCK A;  2WWY A;  1AKH A;  4ENM A;  2W00 A;  2KQR A;  2HDD A;  1JXS A;  1BR1 A;  3FXL A;  3K4L A;  2DOD A;  3CDH A;  4PJL A;  2A6H F;  2DK5 A;  4XBF A;  3ROU A;  3W2A A;  5IT9 Z;  1R00 A;  3BCA A;  4PJ0 C;  1IRZ A;  4P9F A;  2AQF A;  2YX4 A;  3IKT A;  2DYR H;  4FAS D;  1VFC A;  4ZJZ A;  4C3I J;  2HQA A;  4HLX A;  4BUP A;  2HNH A;  2D1V A;  5LRS A;  5J8C A;  2CW7 A;  3Q5F A;  1K83 J;  2VC0 A;  2K9Q A;  4BHC A;  1CGP A;  3K1P A;  4KMU X;  5DD8 A;  4D7M A;  2GXB A;  2E1O A;  3OYE A;  3I64 A;  1A5J A;  4LG0 A;  2KDO A;  4RA2 A;  1VQ7 I;  3G1O A;  1JT0 A;  1HF0 A;  2VBZ A;  1B9M A;  1MMD A;  3BZ6 A;  1V3F A;  3KEO A;  3H36 A;  4BBS J;  2ID3 A;  1VQ9 I;  5H6Q A;  3DEU A;  4ENK A;  3SYT A;  3WG9 A;  3GW2 A;  1GV5 A;  2UV1 A;  3C1D A;  2IGK A;  3DU5 A;  3G2B A;  2Y0M A;  3OOP A;  4BS9 A;  3LAP A;  3F8C A;  2X1E A;  2XDV A;  4I09 A;  3SFI A;  4AUX A;  1VQ5 I;  1WI9 A;  4O6J A;  4PGG A;  4BYY A;  5LGN A;  4H4K C;  3CCM I;  1O57 A;  2CU7 A;  4BU2 A;  4XM3 A;  1YYV A;  4O3M A;  5L3D A;  3BTL A;  1EH6 A;  2E36 A;  3AG4 H;  3HYI A;  3C3W A;  2RRE A;  5EGO B;  3JRG A;  4G7Z F;  1I1S A;  2KIU A;  4ETS A;  2Y30 A;  1YQA A;  5IYB J;  3QU6 A;  2ETH A; 
#chains in the Genus database with same CATH homology
 1H88 C;  5F04 A;  4A3J J;  2LFB A;  2DA6 A;  3LOC A;  4QSH A;  2NVT J;  1X58 A;  1IDZ A;  1JKR C;  4Y7N J;  4IHV A;  1DU0 A;  5HOD A;  1GV2 A;  4A93 J;  5EF6 A;  1HDD C;  1Z0X A;  4BY7 J;  1RET A;  2ME6 A;  1JKO C;  4M6V A;  4B4C A;  4UUS B;  1GT0 C;  5E3M A;  4C2M J;  2GM4 A;  2E2J J;  2DA3 A;  1W0T A;  5IP7 J;  1MBG A;  3IH4 A;  3CCY A;  1WGX A;  4DYC A;  1ZR2 A;  3W6V A;  4W1U A;  2O7O A;  1BJZ A;  1Y1V J;  1MBJ A;  3ZQL A;  3H3V K;  4QIW N;  4M3B A;  2AHQ A;  3RKQ A;  2I10 A;  3ZQG A;  2JA5 J;  2EZK A;  2DMU A;  1I50 J;  2K9S A;  3G1L A;  3Q0V A;  1I6H J;  4XIC A;  2FD5 A;  3SDG A;  1YRN B;  2IEK A;  3QPL A;  2R0Q C;  3ZQI A;  2Y2Z A;  1TWC J;  5FKN A;  2XPV A;  1JKP C;  1JUS A;  3PO2 J;  1G2H A;  1ZKG A;  1ETK A;  2MG4 A;  4A3I J;  1IG7 A;  1YRN A;  2LTP A;  2NOG A;  1U9O A;  2M8G X;  5J1U A;  3WHB A;  3LSG A;  2HXO A;  1QPI A;  1FTZ A;  3LNQ A;  3CQZ J;  4DYR A;  3S1Q J;  4A3G J;  2CJJ A;  2N8G A;  5C4X J;  2OF7 A;  1NK3 P;  1B8I B;  2DA2 A;  2M9H A;  1NK2 P;  2ID6 A;  4I76 A;  1H8A C;  3MKL A;  2LVS A;  1B8I A;  1ENH A;  4MIM A;  1OFC X;  1XS9 A;  1WCM J;  5F08 A;  1ZGW A;  3S15 J;  2K9N A;  1IV6 A;  3I4N J;  3HDD A;  4D5F A;  1MBF A;  2AO9 A;  3JRD A;  3K2A A;  2ME0 A;  3S16 J;  2DA7 A;  3HOY J;  1FJL A;  2MSY A;  4MFD A;  1SAN A;  4XK4 A;  3A01 A;  4JX4 A;  3BQZ A;  5M3F J;  1APL C;  1CQT A;  5E3L A;  5IOY A;  1D5Y A;  3S2D J;  1ETY A;  2MGQ A;  9ANT A;  2CQQ A;  5C4J J;  2P81 A;  1ITY A;  3TP0 A;  5E3O A;  3GTJ J;  5J3L A;  4J19 A;  2E2H J;  4BY1 J;  2X48 A;  3BR3 A;  2CUF A;  2JMW A;  1TWA J;  5F0H A;  1AHD P;  1JGG A;  1I3Q J;  2VUM J;  1ETX A;  4FE4 A;  4IEJ A;  2R93 J;  3Q0W A;  4BKX A;  3LSP A;  4DZJ A;  4DYQ A;  5C44 J;  1JUM A;  1IDY A;  1U8B A;  2XGD A;  1WH5 A;  2DA5 A;  5EGO A;  2XSD C;  5M5W J;  1PUF B;  2H8R A;  1JT6 A;  4MLO A;  1W0U A;  2EZH A;  2E19 A;  3QPS A;  4MFE A;  1OCT C;  5EZH A;  1JJ6 C;  5M5Y J;  2TRT A;  5F0C A;  1K61 A;  4CYC B;  1PUF A;  2D5V A;  2ZB9 A;  1MH4 A;  3NAU A;  2Y9Z A;  2DTZ A;  3HB9 A;  5GPA A;  5K7F A;  4FIS A;  2NVQ J;  2R5Z B;  4RDU A;  2MW8 A;  4A3K J;  1IJW C;  3RQI A;  3BR0 A;  1FTT A;  2CRG A;  4QTR A;  3HBL A;  5EYR A;  3FKI J;  3WHC A;  2R5Z A;  3GTQ J;  2YS9 A;  4UUS A;  3FIS A;  3BTI A;  1T33 A;  4DZP A;  2XB5 A;  1U78 A;  1GUU A;  3S2H J;  2DMT A;  5FKL A;  2HOT A;  3ZQC A;  1LE8 B;  2X9D A;  5DS9 A;  3ZQH A;  4B1R A;  2EBI A;  4M3D A;  1MBK A;  3MVP A;  1GVD A;  2VKE A;  3H0G J;  1ZR4 A;  3S14 J;  3S17 J;  5GP9 A;  1Q1V A;  3K7A J;  3HOU J;  3GTK J;  4AC0 A;  1QVU A;  1X2N A;  1P7J A;  3JRC A;  2DA1 A;  4XRS A;  3DEW A;  2FX0 A;  2HOA A;  2NS8 A;  1WI3 A;  2EH3 A;  3BTJ A;  3HOX J;  2M34 A;  3TP3 A;  1JKQ C;  4V2F A;  2W48 A;  3JR9 A;  2DMP A;  2L9R A;  5EG0 B;  3A02 A;  4L5E A;  4LOC A;  4BXX J;  5EDN A;  1AKH B;  3IH3 A;  2DMN A;  2XRL A;  1NTC A;  1OJL A;  2PMZ N;  3BT9 A;  1MH3 A;  4JX5 A;  2R7Z J;  4ABZ A;  3JRA A;  5EG0 A;  1LFB A;  1VF9 A;  2ELK A;  1RR7 A;  2DMQ A;  4BBR J;  2WAQ N;  2JA7 J;  1AU7 A;  4X1E A;  3BR1 A;  4NDL A;  2O8K A;  2M2E A;  4JYK A;  1MBH A;  3OOU A;  1H89 C;  1XC5 A;  1TWF J;  3BR6 A;  2LP0 A;  1GDT A;  4JX6 A;  2K40 A;  3PM1 A;  1ETO A;  2NS7 A;  4M3G A;  5FKO A;  5IOZ A;  3NAR A;  2H1K A;  1A6I A;  4S0H B;  3JRF A;  3D1N I;  3BG3 A;  2GBY A;  3BQY A;  1TWH J;  4MO7 A;  4HNV A;  3HEF A;  2XPU A;  2HOS A;  2L7M P;  1E3O C;  4XRM A;  2JA8 J;  3RZO J;  1POG A;  2FQ4 A;  1TC3 C;  2QCO A;  2VPR A;  4A3C J;  3IH2 A;  1FIP A;  2CQX A;  2EZI A;  3CMY A;  2XGC A;  1Z77 A;  3TED A;  2LR8 A;  3JRE A;  3F0C A;  5FLV A;  3BG5 A;  5K7H A;  3JRI A;  2LLK A;  3O8G A;  1VND A;  3B6A A;  2EZL A;  5FLM J;  5IP6 A;  2JA6 J;  4IHY A;  2LKX A;  4A3D J;  2XPW A;  3BR2 A;  2VKV A;  3HGY A;  1BW5 A;  2HQ5 A;  2L0K A;  1FEX A;  2L7F P;  2B63 J;  4W97 A;  4D5C A;  4I6Z A;  3VPR A;  1HOM A;  4AYB N;  1X2M A;  5M3M J;  3GTM J;  3MN2 A;  3B6C A;  1UG2 A;  2O9L A;  2DN0 A;  3UKG A;  1F36 A;  2HYJ A;  4IHX A;  4C3H J;  1DU6 A;  2XB0 X;  4FE7 A;  1MSE C;  2LK2 A;  5F1J A;  2TCT A;  3Q0U A;  4A3F J;  3GTP J;  3M4O J;  4D7N A;  1IC8 A;  3BTC A;  3Q3S A;  4V2G A;  5F0F A;  3ZOB A;  3GTG J;  2LY9 A;  5EEA A;  4DW6 A;  3C2B A;  2FJ1 A;  3OSG A;  4A3B J;  4GFB A;  1QVT A;  2OPT A;  1S7E A;  2QF7 A;  3I4M J;  5K7Z A;  1ZK8 A;  4CYC A;  4G12 A;  1HCR A;  4UUT A;  1LFU P;  2Y0S N;  4C3J J;  2COB A;  3S1N J;  2JJ7 A;  5DTD A;  3S1R J;  3LSR A;  1JUP A;  4XID A;  3JRB A;  3HOZ J;  1EF4 A;  1O4X A;  1U9N A;  4JP0 A;  2DJN A;  1ETQ A;  2WB1 N;  1WPK A;  3M3Y J;  2L7Z A;  4M3E A;  2JWT A;  5E3N A;  4M3F A;  3BR5 A;  2HI3 A;  2JK3 A;  1T56 A;  2RAE A;  3LSJ A;  1LE8 A;  5JLW A;  1R9T J;  5J1Y A;  4FTH A;  2G0E A;  3JRH A;  1RKW A;  3OIO A;  2R5Y B;  1BA5 A;  5IPA A;  5BNG A;  4A3M J;  4A69 C;  1SFO J;  1B72 B;  3CDL A;  2NVX J;  1RKT A;  1IGN A;  1Y1W J;  5FKK A;  2R5Y A;  3TW7 A;  4FCY A;  2YU9 J;  4XRS G;  2R92 J;  1FIA A;  1B72 A;  2JN6 A;  1RES A;  3IV5 A;  2Y31 A;  4X6A J;  1IUF A;  1AKH A;  1ETW A;  2VI6 A;  1VI0 A;  2XGE A;  4RBO A;  1JTY A;  1QRY A;  2HDD A;  1ZTR A;  3GBG A;  3E7L A;  3FK7 A;  3PO3 J;  3DCF A;  1HDP A;  2KDZ A;  3GTL J;  1UMQ A;  2WV1 A;  5FKM A;  1JJ8 C;  3GTO J;  2ECB A;  2EQR A;  5J1R A;  1IRZ A;  1UHS A;  1P7I A;  5C3E J;  3TW6 A;  3HM5 A;  2LD5 A;  2ECC A;  5EZG A;  1VFC A;  3HGG A;  5IYC J;  1OCP A;  3QQA A;  1WH7 A;  4C3I J;  3S1M J;  4Y52 J;  3A03 A;  1MBE A;  1F43 A;  5M5X J;  3BG9 A;  1HLV A;  3O8H A;  5F27 A;  4EEF G;  2DA4 A;  1K83 J;  2K9Q A;  2Y9Y A;  5IYD J;  1BW6 A;  2IAI A;  1RPW A;  3A01 B;  3FK6 A;  3OSF A;  4D7M A;  4A3E J;  2GLO A;  2E1O A;  1A5J A;  3G1O A;  1JT0 A;  3RZD J;  3HOV J;  3FIW A;  1HF0 A;  5FJ8 J;  1JTX A;  4B3A A;  3HKZ N;  4BBS J;  2YUS A;  1ORK A;  2ID3 A;  3HOW J;  3ZQF A;  1ETV A;  5JLX A;  2M0C A;  1BL0 A;  1GV5 A;  2X6O A;  2HXI A;  4AUX A;  3SFI A;  2KT0 A;  5GPC A;  2CUE A;  4IHW A;  2IBD A;  3G1M A;  4A3L J;  1MSF C;  2CU7 A;  1TWG J;  3BTL A;  5EGO B;  3JRG A;  2E2I J;  1XG1 A;  5IP9 J;  3SJM A;  1MNM C;  2NVY J;  2Y30 A;  1ZQ3 P;  5IYB J;  3L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...