1AKHB

Mat a1/alpha2/dna ternary complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhB00
1QRYA 1TWGJ 3SFIA 4B4CA 1IDYA 5GP9A 2R5ZA 2M9HA 4GFBA 1BA5A 1JGGA 2EBIA 3I4MJ 5GPCA 4A93J 2L9RA 1K61A 2HOAA 3MKLA 1WH7A 3HKZN 4JX6A 3OSGA 1ZR2A 5DS9A 1UMQA 1OJLA 3S14J 1ORKA 1ETYA 2Y9ZA 4LOCA 1ZTRA 4JX4A 3A01B 1FIAA 3RQIA 3O8GA 1X2NA 3HDDA 5F1JA 1POGA 1MSEC 1Y1WJ 1JKOC 2DTZA 1ZQ3P 3Q0VA 1WPKA 4A3DJ 4X6AJ 3Q0WA 4I6ZA 1GVDA 3S1MJ 2FD5A 5F04A 3BTJA 2XPVA 4C3IJ 1Z0XA 4DYQA 2LFBA 3CDLA 3FIWA 1TWFJ 2I10A 2KT0A 1SANA 3QPSA 4C3HJ 2E2IJ 3BTIA 3NARA 5F0CA 4UUSB 1FJLA 2GBYA 2XB0X 2XRLA 1ENHA 5C4XJ 3S2HJ 2ZB9A 5IYBJ 3HM5A 5K7HA 2R5YA 3GTOJ 5J1RA 1W0TA 2GLOA 1TWHJ 3OOUA 2JN6A 1S7EA 2CJJA 3DCFA 4M6VA 1JJ6C 1HDPA 1MBKA 3RZDJ 3JRHA 1U78A 1DU6A 1CQTA 3IH2A 2MGQA 5F0HA 1DU0A 2LKXA 2E19A 2L0KA 2ME0A 4IHVA 4MFDA 1ETVA 1GDTA 1T33A 3JRDA 4RDUA 2OPTA 3GTMJ 5M5YJ 3ZQFA 5J3LA 5EG0A 5DTDA 1ZGWA 2N8GA 3TW6A 3BR1A 1H8AC 1HLVA 3JRBA 3BR5A 3TP0A 2LLKA 5HODA 5FKKA 4FTHA 1U8BA 2M0CA 5GPAA 3S16J 2IAIA 5EGOA 2LP0A 1NK3P 2EZHA 3VPRA 3HOXJ 4Y52J 1AKHA 1MBJA 3Q0UA 1B72A 2VUMJ 2NS8A 3FKIJ 1Q1VA 1IG7A 4MO7A 4M3FA 3TEDA 1WI3A 2HOSA 3JREA 1LE8B 4L5EA 4IHYA 4A3EJ 1VF9A 1NK2P 4XICA 1GV5A 2LD5A 1HDDC 3H3VK 1ETOA 1MBFA 4D5FA 2RAEA 3S1NJ 1ETWA 4ABZA 2L7MP 3GTLJ 1LE8A 4IEJA 1LFBA 2QCOA 1XC5A 2XPWA 1JJ8C 3HEFA 1H88C 2EZLA 5EYRA 5FLVA 2XGDA 4G12A 4BXXJ 3BR3A 3G1MA 3UKGA 5M5WJ 2TRTA 2O9LA 2Y2ZA 2JK3A 3LSPA 1RKWA 1PUFB 1JTYA 2LK2A 1APLC 5IPAA 3CCYA 1GUUA 1QVTA 2IBDA 3PO3J 2X6OA 1XG1A 1ZK8A 3IH3A 1HOMA 2NS7A 1MBEA 3BG9A 4C2MJ 1XS9A 3A01A 2K9NA 2EH3A 2KDZA 4A3LJ 1X58A 4DZJA 3B6AA 2HYJA 4W97A 2X9DA 2ME6A 5K7ZA 3S15J 4D5CA 1MH3A 2DMUA 4DZPA 2HI3A 4A3IJ 1LFUP 5J1UA 2R93J 1JTXA 2OF7A 3ZQHA 1QVUA 4XIDA 4FCYA 2JA8J 5EZGA 3RKQA 4FE7A 2ID3A 1WGXA 3OIOA 4AC0A 4MFEA 4UUSA 1RESA 2VKVA 1ZR4A 4JX5A 2DMTA 1TWCJ 1JT6A 3HOYJ 3F0CA 3Q3SA 1SFOJ 2Y31A 1TC3C 1OFCX 1UHSA 4JYKA 2JA5J 4V2GA 2CQXA 2Y30A 2M34A 4UUTA 4DYCA 2DA7A 3JRIA 2YU9J 5FKLA 3LSJA 5K7FA 2M8GX 2D5VA 1VI0A 9ANTA 2TCTA 2JA7J 3HOWJ 5IOYA 2K9QA 2DA4A 1FTTA 5EZHA 2DN0A 2IEKA 2O7OA 5BNGA 5IP9J 2NOGA 3IV5A 5IOZA 2CRGA 3NAUA 3G1LA 4W1UA 3BG3A 4FE4A 2R0QC 2MG4A 5FKMA 3LNQA 1JKRC 1UG2A 1R9TJ 5JLXA 4DYRA 1AU7A 3SDGA 2NVTJ 4J19A 3S17J 2MSYA 3C2BA 1BL0A 2ECBA 3LSGA 3LSRA 1O4XA 3BR6A 4M3EA 2H1KA 1BW5A 2XB5A 4M3GA 4CYCB 1JKQC 4XRMA 2JWTA 3GTJJ 1W0UA 3K7AJ 2XPUA 3MN2A 3CQZJ 3B6CA 5IP7J 3CMYA 1JUPA 3QPLA 2E1OA 1BJZA 4BKXA 3M3YJ 1U9NA 3ZQIA 2WB1N 3GTQJ 4A3MJ 1HCRA 4AUXA 5M3FJ 1Z77A 2K40A 2Y9YA 1GT0C 3RZOJ 1A6IA 4CYCA 3E7LA 1FTZA 3TW7A 1RETA 3H0GJ 2CQQA 1ZKGA 1FEXA 2FQ4A 3BQYA 2AO9A 2VKEA 2P81A 2ECCA 1Y1VJ 1VNDA 2NVXJ 4JP0A 4QIWN 4XRSG 5F08A 5E3MA 2CUEA 5FKOA 3GTGJ 2DA3A 2DMPA 1K83J 3PM1A 2FX0A 1EF4A 2GM4A 2HOTA 1OCTC 1I3QJ 5FJ8J 1U9OA 4BBRJ 2CUFA 4B3AA 3HOZJ 2DJNA 5F0FA 5M5XJ 4BBSJ 5E3NA 1MBHA 4V2FA 4A3FJ 1MH4A 3BR2A 3ZQGA 5IYCJ 1IJWC 2DA6A 2H8RA 1IV6A 1X2MA 4BY7J 3A03A 4M3DA 2EZKA 5EDNA 1IRZA 1A5JA 1T56A 2G0EA 2QF7A 3BTLA 4IHWA 1PUFA 2DA1A 4MIMA 5FLMJ 3HGYA 2JJ7A 4HNVA 2YS9A 4XRSA 4A69C 3S2DJ 2ID6A 2W48A 2HQ5A 1F43A 4QTRA 1AHDP 3JR9A 1B8IB 1ETXA 3BT9A 2LTPA 5C44J 1IGNA 2E2HJ 2XSDC 3W6VA 3HB9A 2YUSA 2VPRA 2R5YB 5C4JJ 2LVSA 3G1OA 1P7JA 2NVYJ 1MNMC 2DA5A 3HGGA 3MVPA 3OSFA 4A3GJ 3HOUJ 3FK6A 5EF6A 3M4OJ 5E3LA 3QQAA 1B8IA 2FJ1A 1JUSA 5FKNA 3SJMA 1YRNB 1VFCA 4EEFG 3LOCA 3ZOBA 3JRFA 1IC8A 5C3EJ 3IH4A 2L7ZA 3GBGA 3HBLA 1QPIA 3BR0A 2XGEA 1I50J 1GV2A 4S0HB 4C3JJ 4A3JJ 5IYDJ 2LR8A 2LY9A 1IUFA 1OCPA 4IHXA 2MW8A 2NVQJ 4FISA 1TWAJ 2WV1A 1YRNA 5IP6A 1ETQA 4Y7NJ 4A3CJ 2E2JJ 2XGCA 4AYBN 1RR7A 2X48A 1ITYA 3S1QJ 1JKPC 3ZQLA 5EG0B 3HOVJ 3ZQCA 2L7FP 5M3MJ 2R7ZJ 2ELKA 2AHQA 3K2AA 4BY1J 1RPWA 5F27A 4A3BJ 5EGOB 2CU7A 1NTCA 3FK7A 1D5YA 4I76A 2EZIA 2JMWA 3WHBA 1MSFC 1P7IA 1AKHB 2O8KA 3PO2J 1MBGA 2M2EA 3FISA 4A3KJ 1B72B 3JRAA 3BTCA 4XK4A 3D1NI 1WH5A 4QSHA 1RKTA 1JT0A 1HF0A 4X1EA 1FIPA 2WAQN 2HDDA 4DW6A 4RBOA 1ETKA 4B1RA 2COBA 2DA2A 4NDLA 5JLWA 3DEWA 2K9SA 3JRCA 1JUMA 5EEAA 1G2HA 1H89C 2HXOA 2HXIA 2PMZN 4D7MA 2Y0SN 4MLOA 4D7NA 1IDZA 3GTPJ 5J1YA 3GTKJ 2JA6J 3A02A 3O8HA 3BQZA 5E3OA 3I4NJ 1I6HJ 2EQRA 2R5ZB 3S1RJ 4M3BA 3TP3A 1F36A 2R92J 3WHCA 2DMNA 1WCMJ 2DMQA 1E3OC 2B63J 2VI6A 3BG5A 1BW6A 3JRGA 3L1PA
chains in the Genus database with same CATH superfamily
1IN5A 1QRYA 1TWGJ 4NQWB 1OCOH 3SFIA 1IDYA 3TGNA 1KQ9A 4AD9A 4L9JA 3QODA 4XSZF 4RB1A 2JRMA 2VC1A 1SFKA 2ACJA 3H9QA 3SZGA 4P9UA 1ZR2A 1A04A 1WH7A 4JX6A 3OYIA 3OSGA 2LSOA 5J8CA 4E6KG 1OYWA 4BHBA 4CHUA 3S14J 2IPQX 3BP8A 2LF7A 1Y8RB 1FIAA 3O8GA 2QKMB 1POGA 3RPUD 4Y17A 3Q0VA 4A3DJ 4X6AJ 1FOYA 3I58A 3LQQA 3K70D 2EPFA 4I6ZA 1WJFA 2FD5A 4BHCA 1MDMB 1UFMA 2XPVA 1WKMA 4RMNA 4NC8A 2CW7A 1B6AA 2LFBA 3E6DA 3S3NA 1XMKA 4YG2F 1X3ZB 3G73A 2KT0A 1SANA 3PNTA 4QPOA 4EJWA 1GVJA 2MH9A 1O57A 2XRLA 3G3ZA 1ENHA 3S2HJ 2ZB9A 5K7HA 3N05A 1IAWA 3HIFA 3OYDA 4PGGA 3GTOJ 3OYCA 5F64A 3G4SI 2GLOA 4PJNA 1TWHJ 2V1XA 1HBXG 4L18B 3DCFA 1U2WA 4EGYA 3JRHA 3OR2C 4BQNA 1KU3A 1U5TA 4IRGA 2LOOA 3F8MA 4Y13A 5AONA 1CQTA 4EJTA 1WI9A 2M1BA 3CC2I 4BQQA 4I01A 2MABA 4R79A 4U7BA 2W7NA 1DU0A 5FFXA 2LKXA 3H3ZA 4A0XA 2RNGA 2VLAA 2L0KA 3CDIA 3R61A 5DCFA 2ME0A 2GQQA 4WK8F 4QPQA 4MEXF 5ICGA 4AM3A 2X51A 3WTTC 3GTMJ 3FDYA 4OINF 1EJ9A 1VQ5I 1I6XA 2DT5A 5GAEJ 3TW6A 3BR1A 5HOOA 2OQGA 1G3SA 1B59A 3TP0A 1XCVA 1E0EA 4YIIA 1N77A 4FTHA 1U8BA 2DYSH 1BR4A 1J5YA 2M45A 2OQRA 3ROUA 2O6GE 4P1WA 1EA3A 2P8TA 3WG9A 1LB2A 1LVAA 3F21A 3BPVA 1QHGA 4KNYA 2LF8A 1NK3P 4XN3A 2EZHA 4D1QA 1UELB 3CESA 3NRVA 2WY7Q 2I8DA 1MBJA 3Q0UA 5KVRA 2VUMJ 2YPRA 4WX9A 1WJEA 2NS8A 3TMOA 2CQ7A 1TW3A 4LLLA 1XN7A 1YW8A 3BPXA 4MO7A 2PLYA 4LG0B 2W84A 1Z05A 2RC4A 4L5EA 3C2GA 3QP5A 4IF4A 4PJJA 4LD5A 2VOPA 3GFLA 1HDDC 3I59A 3HRSA 2EFWA 1YO5C 3H3VK 3EYYA 2CFOA 4MEYF 3CCUI 2Y0MA 3BY6A 3S1NJ 4ZDOA 4OWRB 2A61A 3A1YA 3GTLJ 5DUKA 1TQIA 2VBYA 5B5EC 1LE8A 4EATA 5TISC 2QCOA 2CW8A 3MZ8A 1S7OA 3HEFA 3JSPA 1H88C 3DPLC 2VXZA 1TT5B 3M8FA 3BR3A 4YFNF 1R49A 3MZYA 3F23A 1REPC 3AG1H 5KNLA 1PUFB 1JTYA 3V42A 2LK2A 1Z1DA 5K5RA 4NQWA 1APLC 5IPAA 4XONA 4A5NA 4B47A 1KYWA 1QZZA 3K4BA 3TOAA 2V1DA 1H0MA 1KU7A 2VQHA 5LEJA 2DOFA 2W25A 1GUUA 2F5EA 2IBDA 1A36A 4ZH4F 3WE3A 1ULYA 4BJ5C 1ZK8A 1O3SA 3H3UA 1RRJA 3SZTA 1HOMA 2E1MB 4XKBA 4C2MJ 3SEZA 1YQAA 2CMPA 1K4SA 2VOOA 1X1AA 3O6BB 2E71A 3FMSA 4JOMA 5K5OA 2X9DA 4HLXA 4C2UA 3S15J 2WAFA 2DMUA 4CDGA 2YU3A 3EUAA 1MDMA 1J59A 5J1UA 2ZXIA 3ZQQA 1DP3A 3BLYA 4XIDA 2FMLA 5EZGA 2RKHA 2XAQA 1HQCA 1TLHB 4FE7A 4UV9A 1XGNA 3MKWB 5HLTA 2K4BA 2BHZA 3H5AA 3QAHA 4AC0A 1TP4A 4S04A 4FQGA 4EJOA 3HRMA 3T0YA 2VKVA 1ZR4A 4LLNA 3SQNA 2JSCA 3L7WA 4RGXA 4E7SA 1LDKB 3ABMH 3HOYJ 3Q3SA 1ZRCA 2JA2A 2Y31A 3WU1B 2V7FA 1L3LA 2JA5J 3WTVC 2YR2A 2M34A 2DFEA 3ABLH 1OR7C 3PIOF 5K7FA 5GAHJ 2D5VA 1VI0A 2JA7J 1XMAA 4RLQA 2H1LA 4HRIA 4M6YA 2IEKA 1TNSA 1P4XA 5IP9J 2JUCA 5HLHA 2K3PA 3R60A 1VTNC 4CA0A 3ZMDA 2R7UA 2MG4A 5H6QA 4BDYA 4IOCF 1MJAA 5LHGA 1UG2A 3KZZA 1R9TJ 3W2VA 3OIQA 2VBXA 3SDGA 2HFHA 4LJZF 2MSYA 1BL0A 2FSWA 3LSGA 3P9CA 3S3OA 3JW4A 2QQ9A 3DPTA 3F72A 1FYLA 2XB5A 4M3GA 2LBFB 1USSA 4YFXF 3CUQB 2XAHA 3GTJJ 1XMXA 3I4PA 1OCZH 5IP7J 1PP8F 1JUPA 1R58A 1YW9A 1D1BA 2XIGA 3ZMZA 4WWCA 1BR2A 4IHSA 1SEUA 1HCRA 5M3FJ 2IA2A 3VYTB 1J75A 1UCRA 4LFUA 3RZOJ 2ZXJA 3BZKA 4EMSA 1FTZA 2CH0A 4E7HA 4EM1A 2HEOA 2P81A 2TDXA 2R7OA 2ECCA 4M72A 4ZJZA 5HDKA 3K4CA 2PJRB 2OC6A 5CLSA 1Y1VJ 3CF2A 3Q9VA 4G6DA 5EJCA 2HQRA 4LG0A 3VDXA 1SD7A 2L4AA 4DBRA 2BVLA 5FKOA 1YLFA 4B8XA 3KP3A 2FX0A 1EF4A 2YSRA 2HOTA 3E0JB 2IRFG 1OCTC 1I3QJ 1RR8C 1P2FA 1U9OA 3GO5A 2P5LC 5LHIA 4I98B 5K1YA 3GFMA 1KA8A 2D1HA 5LRRA 3ECHA 1H9TA 3T1BA 3DEEA 2P4WA 3ELKA 4B3AA 3HOZJ 1R5HA 4I2OA 5J4YA 2VJ5A 5E3NA 1FP2A 2O3FA 1MBHA 2QZ8A 5DD8A 4IZZA 4A3FJ 1P9QC 4IQ4A 1MH4A 3BR2A 4XN0A 4BY7J 4BQOA 4HX8A 3CCQI 2QQ8A 1B9MA 2Z9OA 2P6SA 4IHWA 1R71A 1PUFA 4GXOA 4WXCA 5FLMJ 2VPLA 1SFUA 1TL8A 2JJ7A 2QENA 1FSHA 4A69C 3HTSB 5HDGA 2LG4A 2ZO4A 4CZZA 3EETA 4LITA 4XKWA 2HPMA 2FOKA 2HQ5A 2Y48A 1TW2A 4GDFA 1EH6A 1JHHA 1OKRA 3K4KA 3KPHA 3K69A 4RGUA 1B8IB 4IKFA 5C44J 1IGNA 4AIHA 3HB9A 3DP7A 4B09A 4N0BA 2HS5A 3CCMI 2LVSA 2A07F 2ICWG 1UAAA 4ZDLA 3JAMK 3OSFA 3HOTA 4PDKA 5JVGF 2J5PA 4OIRF 3M4OJ 5E3LA 4F91B 3BG6A 2H8WA 2DDBA 1JUSA 3H1CA 1RIOH 3SJMA 1V5FA 2R7XA 2WTEA 3LOCA 1K7AA 1Z6RA 3LFUA 3ZOBA 1T2KA 5ICFA 5HLIA 5C3EJ 3F8FA 3IH4A 1D3YA 1XSXA 2PX9A 3RPQA 2XROA 4NC6A 4S0HB 3COAC 4HF2A 4FHTA 3WU0A 2K02A 1TWAJ 2E35A 2WV1A 1FBQA 4FISA 3ZCOA 1ETQA 1LDJA 4Y7NJ 3OS0A 2XHKA 3QPTA 4A3CJ 1ON1A 1LDDA 4AYBN 1ITYA 1YITI 1P92A 1UJ8A 5IY5H 4M6XA 1V54H 3DV8A 3CP2A 4P9FA 4U0VA 4KIFA 2ADUA 2HWVA 3ZQCA 4XOPA 1VQ8I 2L7FP 5E18F 3QOPA 3CMEI 1DQUA 3RI4A 1CF7A 2PI0A 2M7AA 2QM3A 1O3RA 1JHFA 1X4PA 2MLKA 3DKWA 5JFRA 1LPQA 1SD6A 5D5UB 3SXYA 4A6EA 1YG2A 2RV8A 3QYEA 4BAYA 1R6RA 2HQAA 2EZIA 1MSFC 2O8KA 1A31A 1MBGA 1UHWA 3FISA 4CCJA 3H0DA 1A35A 2ZJRF 3SHFA 3BTCA 2K5CA 1WJCA 5H20A 4XK4A 3KETA 2DFIA 1Z7UA 3D1NI 2F5FA 4QSHA 2LBFA 4X1EA 4Z2YA 1FIPA 1P6RA 2EB7A 2HDDA 2V9VA 4B1RA 3O3KA 1F5TA 2K9LA 4NDLA 3B73A 2HZDA 4X0GA 3TDZC 3CCVI 4E7KA 1NHAA 4HX4A 4XMYA 2Y0SN 1R36A 4RLFA 5AIQA 1V55H 5J1YA 2KMUA 3DBLB 2BBYA 3O2PE 2EFPA 1K6YA 1WFXA 2AXLA 1QBJA 3A02A 3IWFA 3BQZA 2X4HA 2LY2A 1ZLKA 2QWWA 1F36A 3TP3A 2CS3A 1XSVA 3K4NA 3R4KA 2DMNA 1GXQA 1XGMA 4R1HA 1R7JA 1W1WE 5HS8A 2B63J 2RNJA 1BW6A 1WWXA 4CCNA 3E5UA 3I56I 4JBAA 2DQRA 4RAYA 5D6EA 2IA1A 2B9SA 3PUFA 5LGTA 1BI3A 3U1DA 2HOEA 2L9RA 1ZARA 2VKHA 3C18A 4AVZA 1K61A 3MKLA 1IN8A 2ZFUA 3VB2A 1WVRA 3I71A 5D4RA 4PUSA 4PK4A 4UB6C 3WU2C 5IT3A 2ISYA 5DCMB 4JX4A 4AIJA 3EUHA 1MIJA 3RQIA 3MWMA 2BY2A 3HDDA 3F8NA 1ZQ3P 3FMQA 1QHHD 2IXSA 1ZHFA 3CLQA 2L9SA 3ZMVA 2A5WA 5KCMA 2WV0A 4FASD 1OYYA 4DYQA 4CXFA 2OU2A 3VYUB 1X19A 3CDLA 5B66C 4XNFA 4Q4ZF 2HKXA 1TWFJ 2I10A 3Q9SA 4I99C 2W57A 2CGPA 5F0CA 2F48A 1G6NA 1GHCA 2EA4A 3ZN0A 3W2WA 2ZMEB 1Z9CA 5C4XJ 1OISA 2FNAA 3IKVA 1B9NA 4RGSA 4KFCA 4CO8A 1Z3YA 1W0TA 3KP4A 1BC7C 2ESHA 2JN6A 2BY1A 4IOAF 1JJ6C 1IRGA 2HNHA 3RZDJ 1CGPA 2WC2A 1IW7F 3FXOA 1PDNC 2DXIA 1FOWA 3H9JA 3I54A 5CQEA 2GA1A 2JVGA 4E7ZA 1ZAOA 1NH3A 3REOA 1S7AA 4E7IA 2CQNA 2EWNA 4N4NB 2VJIA 5F1RA 2E19A 1JI8A 2HVSA 4MTDA 3KYCB 1MMSA 3M8JA 2X1DA 3JSOA 3WTWC 2MFZA 3ZRGA 2W4SA 1AWCA 1GDTA 1T33A 2QSGX 5M5YJ 3RYRA 1G3YA 3FHNA 5B1BH 2MBFA 5DTDA 5L3EA 1U3EM 1R1UA 2KP6A 3BR5A 4MTEA 2M0CA 4HX7A 3S16J 3IP4B 3K0LA 1WRJA 2LKPA 2XV4S 2V9PA 3FM5A 1FMWA 2CV1A 5L3FA 3HOXJ 4Y52J 4B44A 2G7HA 3LSTA 3OMYA 3W3CA 1YOVB 1VQPI 3MAJA 2PQ8A 2LY1A 1HW2A 3W6JB 2JZYA 2PFBA 2KLOA 4AWXB 4O3MA 4M3FA 3WGIA 3FXRA 4ETSA 1LE8B 3PSFA 3WGGA 1VF9A 2DYRH 5FLXK 2VKDA 2CFXA 3D5RC 3OYJA 1GV5A 3IRRA 1IF1A 4UY8I 3DWLE 1ETOA 3ZMUA 1MBFA 3AFHA 3S3MA 1X1DA 2R7RA 1HKQA 3C2HA 1S6LA 2BXZA 4MGRA 3NQOA 4HF0A 5FROA 3HOSA 2HDCA 4YRVA 1F9NA 2UZKA 3IAS2 4BS9A 2QA4I 5GTHC 1XC5A 1Z3XA 2EZLA 2MH2A 2XGDA 1SMYF 3G71I 4A2UA 3UKGA 2O9LA 2C6YA 2X6YA 1I27A 2JK3A 3PFIA 4PJMA 4D9JA 5D5WB 3KP6A 3H5NA 2QVOA 1BI0A 2Z2SB 4PCQA 3CCYA 2KJCA 4CICA 2X6OA 1MMDA 2L5QA 4OIQF 5HS7A 5E8IA 4C2TA 2IS4A 5D5VB 3IH3A 4BE1A 1O3TA 1I5ZA 3BC8A 5DCMA 4HV5A 4NC7A 1XS9A 2YX4A 1HSTA 3KZYA 2EIMH 3H36A 2DI3A 1O3QA 5J40A 1LQ1A 1X58A 4DZJA 2ME6A 5K7ZA 3W2AA 4N9HA 3QYFA 2HI3A 4AU7A 1LFUP 3CC7I 2HYFA 2R93J 4Q48A 1DP7P 1JTXA 2OF7A 2OCEA 3KYDB 3CCRI 1HKSA 2VL8A 2W85A 3BCAA 4FCYA 2JA8J 1YX5A 3RKQA 3CO7C 3DFGA 3ONQA 1PVEA 3OIOA 4KT6A 1N25A 4L9TA 3BOQA 3LSKA 3GWZA 2KKOA 2FEZA 2EIKH 3F6OA 4UHTA 2ZMEA 3L9FA 2AS5F 1TWCJ 3F0CA 1FOXA 3RKYA 3ZXSA 2OV7A 3KFWX 4CCOA 1OFCX 4NNJA 1Y0UA 4V2GA 2Y30A 1TZLA 4DYCA 3JRIA 1Z6TA 2L2OA 2HTJA 1LJ9A 2M8GX 4B3XA 4BXUA 4LIVA 1BIAA 4GCVA 2GOXB 4BQAA 2P0WA 5IOYA 3DTKA 4KICA 2DN0A 3TOBA 3J7ZI 2ZNYA 3C3WA 5BNGA 2K4JA 2PMHA 2QLZA 4HA8A 3IV5A 2DBBA 5FKMA 3I5UA 3LNQA 1JKRC 3B02A 1ZG3A 2Y75A 5D5XB 3H35A 5JLXA 1K79A 4MQVA 3S93A 4IRHA 2M3AA 2E1MC 1FY7A 5GADJ 2L7KA 4PJ0C 2KJBA 1A6QA 3OWTA 1X1CA 2GIZA 3PSIA 4PGHA 4YIRX 4M3EA 1BW5A 1KGSA 4XR6A 4OU0A 2F5VA 1W0UA 3K7AJ 3MN2A 3CQZJ 3GUDA 4EM2A 1WJBA 3CMYA 1YJ9I 4ON0A 3QPLA 1BJZA 4BKXA 1R4NB 2FBHA 4RB2C 4LK1F 1U9NA 1BIBA 4HSTA 5CVRA 2KIUA 1Y6IA 5E1XA 4CYCA 1UZCA 4Q47A 2R4GA 3JTHA 2P7CB 3LSHA 3TW7A 1RETA 3H0GJ 4BE2A 2CQQA 1ZKGA 1FEXA 4KJZA 1XGSA 1FLIA 1KONA 4DJAA 3HKZA 3KEYA 4ITVA 3JAMZ 5D8LB 2F5CA 1SMTA 3K6GA 1R4MB 4BE0A 1VNDA 3IHUA 2NNYA 1YYVA 4JP0A 4C9YA 5E3MA 5F08A 2XRNA 2R7FA 3GTGJ 1NG6A 2DMPA 4XLCA 2CUJA 1D5VA 2M4GA 4PFOA 2DJIA 5FJ8J 2QGUA 5HDNA 3EPZA 2V26A 4CCLA 3D5SC 4KN4X 4Y15A 2CUFA 5EEGA 1V3FA 2KDOA 2KHMA 1EH7A 5F0FA 3K1NA 2XF7A 2IS6A 3CJQB 3DLAA 4BJ6C 2BXYA 2VBZA 3BROA 1YIOA 1RI7A 2PJPA 5DDGA 5BQTA 2EZKA 5EDNA 4YIFA 4ASNA 3IRQA 1IXSB 3BTLA 2DA1A 1D8KA 2VN2A 4MIMA 3DPUA 4LB5A 3CUQC 2Z1DA 4HNVA 4ZTJA 2V1UA 3L00A 4XRSA 4F93B 2GXAA 1LKXA 3S2DJ 2ID6A 1BOAA 4BU2A 3ZR8X 2GA2A 1TNTA 2BVMA 4KMUX 1AHDP 1SVOA 4F55A 4EJUA 2LNBA 3VEPA 2O61A 2QBYB 2IVMA 4HNTA 3BT9A 1HA8A 1IN4A 2XSDC 5CPRB 2E2HJ 3H92A 1I1SA 2CV2A 5E17F 2R5YB 4CGZA 2JSPA 2WADA 1NG7A 4XKCA 2ZBKA 3P7NA 1MNMC 3MVPA 3CC4I 1YRNA 3FK6A 5ERIA 1LEAA 3QQAA 1D1CA 3ULQB 3DTIA 4G7ZF 1ZG5A 1YRNB 4FETA 3GLXA 1I39A 5CVUA 1JE8A 2V6CA 2L7ZA 1T39A 3GBGA 1EH8A 1T0FA 2GIVA 1YS6A 4A6DA 3J81K 2HVRA 1HKTA 1FYMA 1Z7LA 3BJ6A 2LY9A 4F92B 1IUFA 2WAQA 1CF7B 1T38A 4IHXA 1U6GA 1QGPA 3HSRA 1STZA 4KDPA 4ZYAA 1XDSA 3DBRB 3T5XA 3PNYA 1IRFA 3DF8A 4HV6A 3EUHC 2CG4A 2ZJ2A 2R3SA 3FXUA 1M1EB 3KLOA 3ZQLA 2RQPA 5EG0B 3OYAA 2UXNA 3TBIA 2VXDA 4OAZA 2PMZA 1VQOI 1WZ2A 3CJNA 5M3MJ 1J0RA 5HS9A 5LFAA 2EINH 2UWMA 5F6FA 3E6BA 3K2AA 2ISZA 2ZNZA 4A3BJ 3ESWB 2CU7A 3LSIA 3E5QA 1NTCA 3FK7A 2DW4A 1MJBA 3WHBA 1VQKI 1P7IA 1O7LA 4CZCA 3J7AY 2M2EA 4A3KJ 1B72B 1N75A 2E1CA 1IO2A 2F4OB 3PQKA 4ZTFA 4HQEA 4XSXF 3V8LA 1S29A 3KP2A 2R7TA 3SZPA 5DEQA 5K5QA 1RKTA 3K4JA 3CDHA 1JT0A 2EFOA 2WAQN 5TRDA 3ML6A 3L2VA 4OMYA 2COBA 3CCJI 2DFFA 5JLWA 3E3VA 3BZCA 3DEWA 3JRCA 4DQ2A 2IGMA 1G2HA 2RGVA 2PG4A 2ZC2A 2PMZN 1KU2A 4MLOA 5KK1A 1IDZA 1SVLA 2IS2A 4JQFA 2BOLA 4PSXA 3GYHX 2JA6J 3O8HA 4IJAA 1Y56A 3FWEA 2W24A 4BEHA 2EQRA 3MZHA 4RB3C 2QQAA 2P7VB 3V8JA 1WCMJ 4IL6C 3DEUA 1ZG1A 2MYSA 1E3OC 4U7DA 2LYCA 3BG5A 2FOWA 1B4AA 3MMYB 3L1PA 5LBQA 4BNCA 4ENKA 4B4CA 1DGRM 3F9KA 2P5VA 2R5ZA 1ZYRF 1QNTA 3LSMA 2HTSA 1BA5A 3BWGA 2EBIA 3CCLI 3I4MJ 2A6EF 1JXSA 5GPCA 4A93J 2HOAA 4L5JA 2A68F 3EYIA 3RYPA 1W7PB 2GXBA 4XOTA 1X3UA 2MD0A 3HHHA 2DU9A 3FBNB 2DTRA 2D2WA 2D45A 5F1JA 1Y1WJ 3MFKA 1GVDA 3S1MJ 3HUGB 4HQMA 5F04A 3OY9A 3ERMA 1X3WB 1SC7A 2EJRA 4C3IJ 5L3DA 1K6OA 2DK8A 3E97A 3DU6A 5DD4A 4F3QA 3QPSA 4C3HJ 4OAYA 3WE2A 2QBYA 2GBYA 2XB0X 2K27A 1USTA 5IYBJ 3HM5A 2R5YA 4DOZA 3CF5F 1YFHA 1XD7A 1ON2A 2BY0A 3TO7A 2EFNA 5J1RA 2KFDA 3HRUA 2Q1ZB 3OOUA 4CUGA 3AAFA 2CJJA 4M6VA 5CVVA 2O0YA 3U2RA 2XF5A 3M8EA 5FLXZ 3M1EA 3FXQA 5ICEA 3IL2A 2CWEA 3L2UA 1U78A 1KYZA 3LA3A 1R1TA 2QYOA 3IH2A 3EDPA 1W4MA 2EA2A 4R8HA 3M7GA 4EGZA 2IP2A 2M4KA 1W5CC 2WB1A 2QEXI 1DUXC 4IHVA 3DKXA 4MFDA 2VQGA 1ETVA 1ZELA 4RM3A 4WCGA 3JRDA 1S5LC 1FOKA 4I0BA 2EV6A 4RDUA 2KRFA 2ZSIB 5EG0A 1ZGWA 2R7QA 2N8GA 2DOEA 1H8AC 1HLVA 3JRBA 2LLKA 5JVTA 3QOEA 2BE5F 4ANJA 2VT3A 4RAFA 2VB6A 3HSEA 1BN5A 3E5XA 5LRSA 3TQNA 3IKTA 4RM2A 3CJTB 3GZNB 2L9NA 1ERDA 4I02A 1X4OA 5KAIC 3A0BC 3VPRA 5L3GA 5HVQC 1PJRA 1V5EA 4XKVA 1B72A 2IW5A 2ZMEC 3SDBA 2EV0A 2ETHA 1ZN2A 1U5TC 3FKIJ 1S9HA 2QQBA 4ENNA 3OL4A 4GYGA 3SYTA 1RUOA 2A6TA 3C7JA 2STTA 2W00A 4ENMA 3M07A 3JREA 2P5KA 3QU6A 4IHYA 1T08B 1ODDA 1NK2P 1J09A 1FBSA 3J7YJ 1G4DA 2XSJC 2H09A 2E36A 2FU4A 1ETWA 2R7SA 4RAZA 1HXDA 2L7MP 1EKEA 2FBKA 5FO5A 1XGOA 1VQLI 4IEJA 1R23A 1LFBA 2PN6A 2ZCWA 3LAPA 1T8IA 2K7LA 4H4KC 2NNNA 5FB2A 5A2QK 3AG4H 2LKSA 4XLPF 5FLVA 1TQPA 1IV8A 1O7FA 4G12A 2DPUA 1W5TA 4BYYA 3G1MA 5M5WJ 2TRTA 3LSPA 4BL0B 4KMFA 1RKWA 3G2BA 2CQKA 4EQQA 2RVCA 2I5UA 2NVUB 3WTZA 3J80K 3AKZA 3BCBA 4M73A 2GOMA 4XLFA 5FFZA 3ABUA 2ELHA 2RQQA 1QVTA 4QWQA 3PO3J 3I3LA 1G3TA 1W7PA 5ED4A 1W5SA 1X1BA 1BJAA 4HEA2 2ZKZA 1MBEA 2FA5A 3BG9A 5GTIC 4HZFA 3PQJA 2F2EA 3PJRA 2K9NA 2ZFWA 2EH3A 2KDZA 1OMIA 2V9KA 3CTAA 2YX7A 4A3LJ 4HYEA 2DK5A 3VOEA 3AG3H 2BYVE 5E8GA 5H2FC 1BI1A 1FZPB 1YHQI 1SFXA 2PBIA 3HUGA 4DZPA 5LEKA 3HRTA 1E3PA 2O8XA 3CUOA 1LVKA 2STWA 3ZQHA 1QVUA 2ESNA 4XORA 2L9VA 2ID3A 3CMMA 3RKXA 3FZVA 1YJWI 4MFEA 4UXNA 3A2KA 3OS2A 4JX5A 3K4LA 6PAXA 1DPUA 2H94A 1D0XA 1JT6A 4I0AA 4XLNF 3RCOA 2M30A 4M9SA 4PZJA 1P4AA 2CQXA 2F4IA 4UUTA 2DA7A 3H5RA 1PUEE 2RREA 5FKLA 1XX5A 4I7HA 1G8XA 2DFHA 9ANTA 3DU5A 1LNWA 2KPMA 1FTTA 5EZHA 3VYRB 3AL0B 1QA6A 4J00A 1T95A 3CJRB 3JTGA 5L3CA 1QO0D 1WJAA 4D0PA 2CRGA 1MMNA 2EK5A 3G1LA 3BG3A 3H9GA 4FE4A 1MNDA 4E4HA 3CCSI 1AU7A 1OCRH 4G6QA 4J19A 2ZXWH 1QQIA 3CP8A 3L2RA 1F4KA 1J9IA 2ECBA 3X2QH 2VQCA 2CUZA 1FNNA 4XM3A 1O4XA 3BR6A 4XBFA 4CYCB 3QRFF 1SAUA 1JKQC 4XRMA 3RQ4A 3GFIA 2V4JC 2L02A 3GFJA 3FXKA 3GZ5A 1MMGA 3QPHA 1K78B 4G9YA 3ZQIA 3GTQJ 2CW0F 2OZ6A 3ASNH 4AUXA 1Z77A 2K40A 4N4OB 1GT0C 4S05A 1D8JA 4ZC3A 1A6IA 2X1EA 5LD2C 4RA2A 1T0FC 4HSRA 3TKYA 3ZMSA 3E7LA 4BGDA 4GRIA 1ACIA 5E1WA 4IHTA 3SEQA 2OCCH 4HG2A 1ZREA 1VQNI 2HQNA 4M9ZA 1RZ4A 3BQYA 1U8RA 2VKEA 2E5NA 2WAEA 4QIWN 2LRDA 3VYSB 2A69F 1K83J 1FSEA 5J47A 3OYKA 1QZYA 2D1VA 3FMRA 2VE8A 4BBRJ 3J81Z 5FD5A 1I3AA 3VWBA 4DIQA 2DJNA 5IT9K 5M5XJ 1BI2A 4BBSJ 1DPRA 5D8KB 4V2FA 1MW7A 5IYCJ 5DV5A 2DA6A 3HG9A 1X2MA 1J7KA 2JPBA 3DQVC 5ILUA 3VFZA 4NHJA 1PP7U 1IRZA 1A5JA 2H6CA 2G0EA 2XAUA 3K9TA 4ESBA 4RAGA 2XGXA 4P5OA 3RPUA 3K2ZA 2XAGA 2IGOA 2LH9A 3HGYA 3BJAA 3RKWA 4CH7A 4L5IA 5BPIA 4JK1X 3QYBA 2HDWA 1MZBA 3CD6I 4G7HF 3F22A 1HC8A 3HHGA 4QTRA 1MNEA 5CVIA 3HJEA 3JR9A 2ZJQF 1ETXA 1WJ5A 1FT9A 5CVJA 4IQJA 4ZZDA 2R7VA 2YUSA 2DLLA 3LFKA 4UB8C 2CYYA 2ELJA 2FF4A 3R0JA 3QU3A 5C4JJ 5DUIA 1YS7A 5H6RA 4LB6B 3G1OA 3CO6C 1YX3A 2HZTA 3HGGA 3L2QA 1VQ9I 2VT2A 4A3GJ 3HOUJ 3ZGKA 4BUPA 5EF6A 2EIJH 2X6WA 1LUJB 3RJPA 5HNHA 1YTYA 1IUYA 2Z5UA 3BZ6A 1XTAA 3FM3A 4OOIA 3QWLA 3TO9A 2L01A 4G6TB 3A4CA 3ZPLA 1QPIA 1T6SA 3BR0A 4WXHA 1I50J 2KRHA 3OS1A 4M71A 1GV2A 4C3JJ 5IYDJ 3N97A 1OCPA 1XPXA 2BGCA 3R0AA 1HW5A 2HR3A 5LHHA 2DO7A 3CCEI 3UR3C 2E2JJ 2XGCA 4LG3A 1RR7A 2X48A 2IA0A 3DTEA 4I09A 4CCMA 4KISA 3S1QJ 3JCUC 2MC3A 4IPAA 2EV5A 3TDUC 4ENJA 4KA4A 4CSWA 3FKJA 3J7AO 1C0WA 1FX7A 2Y69H 4L9NA 2J5OA 1MD0A 5BOXA 4U87A 3VSKA 4DNCA 2AHQA 4BY1J 5EGOB 1QU3A 1ZLJA 1D5YA 2MA3A 2KZVA 3P9KA 1K4TA 3OYNA 5D4SA 1AKHB 3PO2J 4Y4RA 3EQLF 3HL2A 4UVCA 5HNFA 3RDIA 1Z91A 4ZYHA 4DBQA 2GAUA 3HTUA 3I64A 4L0YB 1WH5A 2Z16A 2W82A 1P4WA 3ZMTA 2HPIA 4DW6A 1ETKA 3KYLA 1TT0A 3WTYC 1K78A 3LAJA 4BEHB 5L3BA 4FT8A 3NEUA 3U21A 1OQYA 1H89C 2HXOA 2XF6A 2GXGA 2HXIA 1E3HA 2MC4A 4XRFA 4D7NA 2VODA 3GTPJ 4XQFA 4EV0A 3GTKJ 4HBLA 5E3OA 4B48A 1IZ1A 5J8FA 2R5ZB 2IGKA 4G8XA 3S1RJ 1J2XA 1YW7A 4M3BA 2E5ZA 5KHDA 4L0ZB 2R92J 1MMAA 2FRHA 4LLGF 2DT7B 4CYDA 1WJDA 2E7XA 2OA4A 1D0YA 5HLGA 2OZUA 2ZXHA 2XUBA 1S3JA 1AA7A 2JRTA 3IUOA 4BH9A 5GP9A 4KITB 2M9HA 4NUBA 3PIPF 4GFBA 2WBMA 2V79A 1SFEA 1JGGA 2BV6A 4ZYDA 1W36C 3KEQA 2X85A 4F52A 3HKZN 3V4GA 4UUVA 3OYFA 3I55I 4XLAA 2WA0A 5DS9A 4B43A 1UMQA 3DKYA 1OJLA 2FBIA 4PJLA 1ORKA 1ETYA 2Y9ZA 4LOCA 2GZWA 3E6MA 2X0LA 1ZTRA 3RTRA 3A01B 4U0YA 2K9MA 3BJOA 1Q1HA 5FRNA 1X2NA 2COMA 3F8BA 1MSEC 1JKOC 2DTZA 1WPKA 2KISA 3D5LA 4LGWA 4AVPA 3WTSC 3Q0WA 4E7JA 3OL3A 3I9V2 3TL4X 4M74A 1ZH5A 4HLYA 2HKOA 3K1PA 4HPQA 3BTJA 2IT0A 1Z0XA 1HSJA 4IO9F 2F4MB 3WTUC 3FIWA 2OBPA 1UG0A 4ZYEA 1BBYA 3BTIA 2E2IJ 3NARA 1WSUA 3HC7A 4UUSB 1FJLA 5FRMA 1FWZA 3U9GA 1VQ6I 3KP5A 1FPQA 1Y8QB 2W1OA 2EILH 1FP1D 1FBUA 2VQLA 2PMUA 2VE9A 4E70A 1IN6A 1S7EA 1HDPA 1MBKA 2OJED 5E20A 1AOYA 3S32A 2QSFX 2OTJI 1TTYA 4HDUA 4LK0F 4HF1A 2MD5A 2NYXA 4PFPA 2KIFA 2UXXA 3KLNA 1DU6A 3D0SA 5TGTA 2QSHX 1LFPA 1XDUA 2MGQA 5F0HA 5FGMA 3ECOA 2XDVA 4NBQA 4LMYA 2JPCA 3GMEA 4HNUA 5A2QZ 3CLOA 1QZEA 5ILVA 2P6TA 3MQ0A 4AIDA 2OPTA 5AIPA 1D0ZA 3V8KA 3K1MA 3ZQFA 5J3LA 3K10A 3MD2A 5JHUA 2E7WA 2BY3A 2VJ4A 3IAM2 5HODA 3J80Z 5FKKA 5CKTA 5GPAA 3IWZA 2A05A 2KRCA 3ISPA 3GVAA 4RS8A 3OR1C 2IAIA 4V19K 2HU9A 4IXAA 2V6EA 5EGOA 3NWTA 4O5VA 2LP0A 2BW3B 3E1SA 4ZYGA 5DM6F 2ZSHB 1V4RA 2KL4A 3PUBA 1EV7A 1AKHA 1VQ7I 3GF2A 5DYMA 2H6BA 3EUKL 5D6FA 4XL9A 1Q1VA 1MKMA 3CMAI 1IG7A 3HSFA 1R22A 3KCCA 2LDUA 3V7RA 3TEDA 3LA7A 4WXDA 1WI3A 4ZDPA 2HOSA 2XAFA 1SAXA 4A3EJ 3W6KB 3VODA 1GXPA 3M9AA 3SFZA 4XICA 4UVBA 2LD5A 4E7LA 5EEHA 4J01A 3DBHB 4D5FA 2RAEA 4KN7X 2KIQA 2DCEA 2MLGA 3FHZA 3A0HC 1ONVA 4ABZA 3DXJF 3GX4X 1ZRDA 2LC2A 2WWYA 3F8CA 3DLLF 2DDAA 3GCMA 2XPWA 3LQRA 1JJ8C 1WHUA 1UHMA 4BDZA 5EYRA 1G59A 4BXXJ 4TV7A 2Q8KA 2Y2ZA 4YEJA 2JQ7A 1T98A 1WQ2A 3IC7A 4WF2A 3LWFA 1VQ4I 3FXMA 2DT6A 3CZ6A 3OV8A 2Q2EB 2X6XA 3M1CA 4MQ9F 2UUZA 5CQGA 2LREA 1FC3A 4II3A 2RN7A 4U0WA 4AIKA 1XG1A 3KZIC 3NWSA 3TO6A 3MKYB 3KEOA 2NS7A 3OYHA 1E2XA 3KE2A 4MNUA 3AG2H 3A01A 3FF5A 5LGNA 2VIXA 1S8NA 3L2CA 1RUNA 1KQ0A 2QKLB 3Q5FA 3B6AA 2HYJA 4W97A 3F3XA 1SVMA 4D5CA 1MH3A 4AYBA 3V7CA 4A3IJ 3PNVA 2FE3A 1Z21A 1TQMA 3WGHA 1R00A 4IVNA 1WGXA 2BEOA 4Y33A 2XAJA 4II2A 4UUSA 1RESA 4N9IA 4YFKF 2DMTA 4PSWA 3OYLA 4H0EA 1SFOJ 5GAGJ 2RDPA 1TC3C 2F6CA 2FXAA 1UHSA 3F6VA 4C30A 4JYKA 2HVQA 2H27A 1KQ8A 3L09A 5LLQA 2YU9J 2EFQA 3ABTA 3GLLA 5LGUA 3HPGA 3LSJA 2WY8Q 3L2WA 3OYGA 2TCTA 1XB4A 1IXRC 3HOWJ 2K9QA 2DA4A 3UNGC 2O5RA 3K70C 3I0TA 2O7OA 2VBWA 2OAZA 2NOGA 1JGSA 5IOZA 3NAUA 2R0QC 1QPMA 4W1UA 2F5DA 4RGRA 4NB5A 5IT9Z 2R7DA 2NRAC 3R6SA 3FXLA 3PFYA 4GGGA 4DYRA 1G3WA 1IXCA 2NVTJ 4GYIA 3ZQ7A 2Y0SA 1XSDA 3S17J 3C2BA 1OLTA 1YIJI 5FD6A 3LSRA 3HXLA 2G7UA 2KIMA 2PEXA 2H1KA 3RIRA 2JWTA 1Y39A 4MHGA 1VZ0A 3K4MA 2XASA 2XPUA 3B6CA 4F7ZA 3V7SA 2G9WA 3U1KA 1W36D 3M3YJ 1FYKA 2E1OA 2K86A 5B1AH 1S72I 2WB1N 4G94A 4A3MJ 4HOBA 3HZJA 2Y9YA 3ZN1A 2BW3A 4CCKA 2VONA 4KUMA 1Z67A 3CUQA 2M87A 4BXFA 4A12A 3P9IA 1GLNA 2FQ4A 3ERED 1XCBA 2AO9A 4Z6YA 1BM9A 1L0OC 4EVIA 3KP7A 3OYEA 1U0JA 4ESFA 4IX7A 2OTLI 2BZTA 2NVXJ 2HYGD 1B1BA 3S8PA 1HW1A 1KZHA 4XRSG 2CUEA 5E1ZB 2DA3A 3PM1A 4Y3OA 1I1GA 2A6HF 5CJ9A 2O03A 4G7OF 2K85A 2GM4A 1SD4A 1RC9A 1R5GA 2XVCA 3AL0C 4YELA 3KX2A 2LMDA 5B3SH 2PJRA 5JHFA 4HW0A 2Z3YA 5BS6A 3QP6A 5TJJA 4BHPA 4IRIA 4GO1A 3MEXA 2A3SA 3ZQGA 1E17A 1IJWC 2E34A 1OR7A 2H8RA 1R5ID 1IV6A 2X1CA 5BPDA 3A03A 4M3DA 3FX3A 4XLHA 4XLEA 1T56A 4L9VA 2QF7A 3E6CC 3T8RA 1YE9A 3HPHA 4OIOF 4UVAA 1BR1A 2VASA 4KIBA 5ILSA 4QLCU 3WTXC 2YS9A 2Z99A 3FXJA 4FX4A 2Q2EA 3PL8A 2IJLA 1ZGJA 3LMMA 2W48A 5BMZA 3LA2A 4P96A 3ABKH 2R7WA 1RNLA 3P5JA 3GXOA 1OCCH 4ESJA 5KAFC 3OYMA 1F43A 3LL7A 2XKOA 2AQFA 1W7PD 2AQEA 5E79C 2M8EA 2LTPA 2VJJA 1X1PA 4ZZLA 1F1ZA 3W6VA 5J4VA 2VPRA 3GW2A 2L54A 1YI2I 1P7JA 2XC7A 2NVYJ 2DA5A 4HDVA 1DDNA 1SD5A 3OYBA 2HGCA 2M0MA 4A5MA 4A0ZA 1B8IA 2FJ1A 5FKNA 2ZJPF 1VFCA 4EEFG 2M5WA 3JRFA 3N4MA 1BOBA 1U5TB 1PYVA 3MCZA 1IC8A 4RB0A 4EM0B 4O6JA 3HBLA 3ZP5A 2NOJB 2XGEA 2QUFA 5CYVA 2DPDA 4BJTA 4UV8A 4A3JJ 2LR8A 2B0LA 1FMVA 3T8TA 3BDDA 2DOAA 2MW8A 2NVQJ 5IP6A 2NXNB 4OMZA 2JUGA 2L3DA 5JI6A 1KU9A 2OD5A 3MKZA 2XKPA 2NS0A 1JKPC 3FBIB 4P55A 3GEZA 3HOVJ 1DGWY 1UB9A 1N78A 2R7ZJ 2KZGA 3WG7H 2FQ3A 2ELKA 4UNOA 1RPWA 5F27A 2E60A 1V5GA 2CSOA 3HYIA 3RSNA 1R1VA 2OUMA 4DGWB 3I53A 1IN7A 2GWRA 4U88A 4I76A 2JMWA 4HAMA 2Q0OA 2V1NA 1MGTA 2JTVA 2FNPA 2DODA 1IRXA 1ZGAA 2CO5A 2JVHA 3OOPA 4K2EA 1YJNI 3JRAA 2FMYA 2B7EA 2UV1A 4KYWA 1OYIA 4KT5C 4KIGA 3ASOH 4OIPF 1HF0A 2BHYA 4FX0A 1ZRFA 3BG7A 4RBOA 5DM7F 2CV0A 1LEBA 3VSLA 2FUG2 5J6XA 5ICCA 2DA2A 3OIPA 2DAOA 2K9SA 1JUMA 2M7BA 5EEAA 2Z33A 4EJVA 4M9XA 3I59B 2JT1A 2KQRA 2NAZA 4A0YA 2DQLA 1D1AA 3GZ6A 1H9GA 2IGNA 4D7MA 3WODF 2A5YB 3S2WA 4Q5SF 2VC0A 3C1DA 1I6HJ 4BACA 3I4NJ 1MJ9A 1VQMI 2L4MA 2AXTC 4LIUA 1Y0NA 3WHCA 5JR3A 1BC8C 2E1NA 2DMQA 3G6EI 2IS1A 1OPCA 2VI6A 2K3FA 3JRGA 3KIOA 1TBXA
chains in the Genus database with same CATH topology
1QRYA 1TWGJ 3SFIA 4B4CA 1IDYA 5GP9A 2R5ZA 2M9HA 4GFBA 1BA5A 1JGGA 2EBIA 3I4MJ 5GPCA 4A93J 2L9RA 1K61A 2HOAA 3MKLA 1WH7A 3HKZN 4JX6A 3OSGA 1ZR2A 5DS9A 1UMQA 1OJLA 3S14J 1ORKA 1ETYA 2Y9ZA 4LOCA 1ZTRA 4JX4A 3A01B 1FIAA 3RQIA 3O8GA 1X2NA 3HDDA 5F1JA 1POGA 1MSEC 1Y1WJ 1JKOC 2DTZA 1ZQ3P 3Q0VA 1WPKA 4A3DJ 4X6AJ 3Q0WA 4I6ZA 1GVDA 3S1MJ 2FD5A 5F04A 3BTJA 2XPVA 4C3IJ 1Z0XA 4DYQA 2LFBA 3CDLA 3FIWA 1TWFJ 2I10A 2KT0A 1SANA 3QPSA 4C3HJ 2E2IJ 3BTIA 3NARA 5F0CA 4UUSB 1FJLA 2GBYA 2XB0X 2XRLA 1ENHA 5C4XJ 3S2HJ 2ZB9A 5IYBJ 3HM5A 5K7HA 2R5YA 3GTOJ 5J1RA 1W0TA 2GLOA 1TWHJ 3OOUA 2JN6A 1S7EA 2CJJA 3DCFA 4M6VA 1JJ6C 1HDPA 1MBKA 3RZDJ 3JRHA 1U78A 1DU6A 1CQTA 3IH2A 2MGQA 5F0HA 1DU0A 2LKXA 2E19A 2L0KA 2ME0A 4IHVA 4MFDA 1ETVA 1GDTA 1T33A 3JRDA 4RDUA 2OPTA 3GTMJ 5M5YJ 3ZQFA 5J3LA 5EG0A 5DTDA 1ZGWA 2N8GA 3TW6A 3BR1A 1H8AC 1HLVA 3JRBA 3BR5A 3TP0A 2LLKA 5HODA 5FKKA 4FTHA 1U8BA 2M0CA 5GPAA 3S16J 2IAIA 5EGOA 2LP0A 1NK3P 2EZHA 3VPRA 3HOXJ 4Y52J 1AKHA 1MBJA 3Q0UA 1B72A 2VUMJ 2NS8A 3FKIJ 1Q1VA 1IG7A 4MO7A 4M3FA 3TEDA 1WI3A 2HOSA 3JREA 1LE8B 4L5EA 4IHYA 4A3EJ 1VF9A 1NK2P 4XICA 1GV5A 2LD5A 1HDDC 3H3VK 1ETOA 1MBFA 4D5FA 2RAEA 3S1NJ 1ETWA 4ABZA 2L7MP 3GTLJ 1LE8A 4IEJA 1LFBA 2QCOA 1XC5A 2XPWA 1JJ8C 3HEFA 1H88C 2EZLA 5EYRA 5FLVA 2XGDA 4G12A 4BXXJ 3BR3A 3G1MA 3UKGA 5M5WJ 2TRTA 2O9LA 2Y2ZA 2JK3A 3LSPA 1RKWA 1PUFB 1JTYA 2LK2A 1APLC 5IPAA 3CCYA 1GUUA 1QVTA 2IBDA 3PO3J 2X6OA 1XG1A 1ZK8A 3IH3A 1HOMA 2NS7A 1MBEA 3BG9A 4C2MJ 1XS9A 3A01A 2K9NA 2EH3A 2KDZA 4A3LJ 1X58A 4DZJA 3B6AA 2HYJA 4W97A 2X9DA 2ME6A 5K7ZA 3S15J 4D5CA 1MH3A 2DMUA 4DZPA 2HI3A 4A3IJ 1LFUP 5J1UA 2R93J 1JTXA 2OF7A 3ZQHA 1QVUA 4XIDA 4FCYA 2JA8J 5EZGA 3RKQA 4FE7A 2ID3A 1WGXA 3OIOA 4AC0A 4MFEA 4UUSA 1RESA 2VKVA 1ZR4A 4JX5A 2DMTA 1TWCJ 1JT6A 3HOYJ 3F0CA 3Q3SA 1SFOJ 2Y31A 1TC3C 1OFCX 1UHSA 4JYKA 2JA5J 4V2GA 2CQXA 2Y30A 2M34A 4UUTA 4DYCA 2DA7A 3JRIA 2YU9J 5FKLA 3LSJA 5K7FA 2M8GX 2D5VA 1VI0A 9ANTA 2TCTA 2JA7J 3HOWJ 5IOYA 2K9QA 2DA4A 1FTTA 5EZHA 2DN0A 2IEKA 2O7OA 5BNGA 5IP9J 2NOGA 3IV5A 5IOZA 2CRGA 3NAUA 3G1LA 4W1UA 3BG3A 4FE4A 2R0QC 2MG4A 5FKMA 3LNQA 1JKRC 1UG2A 1R9TJ 5JLXA 4DYRA 1AU7A 3SDGA 2NVTJ 4J19A 3S17J 2MSYA 3C2BA 1BL0A 2ECBA 3LSGA 3LSRA 1O4XA 3BR6A 4M3EA 2H1KA 1BW5A 2XB5A 4M3GA 4CYCB 1JKQC 4XRMA 2JWTA 3GTJJ 1W0UA 3K7AJ 2XPUA 3MN2A 3CQZJ 3B6CA 5IP7J 3CMYA 1JUPA 3QPLA 2E1OA 1BJZA 4BKXA 3M3YJ 1U9NA 3ZQIA 2WB1N 3GTQJ 4A3MJ 1HCRA 4AUXA 5M3FJ 1Z77A 2K40A 2Y9YA 1GT0C 3RZOJ 1A6IA 4CYCA 3E7LA 1FTZA 3TW7A 1RETA 3H0GJ 2CQQA 1ZKGA 1FEXA 2FQ4A 3BQYA 2AO9A 2VKEA 2P81A 2ECCA 1Y1VJ 1VNDA 2NVXJ 4JP0A 4QIWN 4XRSG 5F08A 5E3MA 2CUEA 5FKOA 3GTGJ 2DA3A 2DMPA 1K83J 3PM1A 2FX0A 1EF4A 2GM4A 2HOTA 1OCTC 1I3QJ 5FJ8J 1U9OA 4BBRJ 2CUFA 4B3AA 3HOZJ 2DJNA 5F0FA 5M5XJ 4BBSJ 5E3NA 1MBHA 4V2FA 4A3FJ 1MH4A 3BR2A 3ZQGA 5IYCJ 1IJWC 2DA6A 2H8RA 1IV6A 1X2MA 4BY7J 3A03A 4M3DA 2EZKA 5EDNA 1IRZA 1A5JA 1T56A 2G0EA 2QF7A 3BTLA 4IHWA 1PUFA 2DA1A 4MIMA 5FLMJ 3HGYA 2JJ7A 4HNVA 2YS9A 4XRSA 4A69C 3S2DJ 2ID6A 2W48A 2HQ5A 1F43A 4QTRA 1AHDP 3JR9A 1B8IB 1ETXA 3BT9A 2LTPA 5C44J 1IGNA 2E2HJ 2XSDC 3W6VA 3HB9A 2YUSA 2VPRA 2R5YB 5C4JJ 2LVSA 3G1OA 1P7JA 2NVYJ 1MNMC 2DA5A 3HGGA 3MVPA 3OSFA 4A3GJ 3HOUJ 3FK6A 5EF6A 3M4OJ 5E3LA 3QQAA 1B8IA 2FJ1A 1JUSA 5FKNA 3SJMA 1YRNB 1VFCA 4EEFG 3LOCA 3ZOBA 3JRFA 1IC8A 5C3EJ 3IH4A 2L7ZA 3GBGA 3HBLA 1QPIA 3BR0A 2XGEA 1I50J 1GV2A 4S0HB 4C3JJ 4A3JJ 5IYDJ 2LR8A 2LY9A 1IUFA 1OCPA 4IHXA 2MW8A 2NVQJ 4FISA 1TWAJ 2WV1A 1YRNA 5IP6A 1ETQA 4Y7NJ 4A3CJ 2E2JJ 2XGCA 4AYBN 1RR7A 2X48A 1ITYA 3S1QJ 1JKPC 3ZQLA 5EG0B 3HOVJ 3ZQCA 2L7FP 5M3MJ 2R7ZJ 2ELKA 2AHQA 3K2AA 4BY1J 1RPWA 5F27A 4A3BJ 5EGOB 2CU7A 1NTCA 3FK7A 1D5YA 4I76A 2EZIA 2JMWA 3WHBA 1MSFC 1P7IA 1AKHB 2O8KA 3PO2J 1MBGA 2M2EA 3FISA 4A3KJ 1B72B 3JRAA 3BTCA 4XK4A 3D1NI 1WH5A 4QSHA 1RKTA 1JT0A 1HF0A 4X1EA 1FIPA 2WAQN 2HDDA 4DW6A 4RBOA 1ETKA 4B1RA 2COBA 2DA2A 4NDLA 5JLWA 3DEWA 2K9SA 3JRCA 1JUMA 5EEAA 1G2HA 1H89C 2HXOA 2HXIA 2PMZN 4D7MA 2Y0SN 4MLOA 4D7NA 1IDZA 3GTPJ 5J1YA 3GTKJ 2JA6J 3A02A 3O8HA 3BQZA 5E3OA 3I4NJ 1I6HJ 2EQRA 2R5ZB 3S1RJ 4M3BA 3TP3A 1F36A 2R92J 3WHCA 2DMNA 1WCMJ 2DMQA 1E3OC 2B63J 2VI6A 3BG5A 1BW6A 3JRGA 3L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRY A;  1TWG J;  3SFI A;  4B4C A;  1IDY A;  5GP9 A;  2R5Z A;  2M9H A;  4GFB A;  1BA5 A;  1JGG A;  2EBI A;  3I4M J;  5GPC A;  4A93 J;  2L9R A;  1K61 A;  2HOA A;  3MKL A;  1WH7 A;  3HKZ N;  4JX6 A;  3OSG A;  1ZR2 A;  5DS9 A;  1UMQ A;  1OJL A;  3S14 J;  1ORK A;  1ETY A;  2Y9Z A;  4LOC A;  1ZTR A;  4JX4 A;  3A01 B;  1FIA A;  3RQI A;  3O8G A;  1X2N A;  3HDD A;  5F1J A;  1POG A;  1MSE C;  1Y1W J;  1JKO C;  2DTZ A;  1ZQ3 P;  3Q0V A;  1WPK A;  4A3D J;  4X6A J;  3Q0W A;  4I6Z A;  1GVD A;  3S1M J;  2FD5 A;  5F04 A;  3BTJ A;  2XPV A;  4C3I J;  1Z0X A;  4DYQ A;  2LFB A;  3CDL A;  3FIW A;  1TWF J;  2I10 A;  2KT0 A;  1SAN A;  3QPS A;  4C3H J;  2E2I J;  3BTI A;  3NAR A;  5F0C A;  4UUS B;  1FJL A;  2GBY A;  2XB0 X;  2XRL A;  1ENH A;  5C4X J;  3S2H J;  2ZB9 A;  5IYB J;  3HM5 A;  5K7H A;  2R5Y A;  3GTO J;  5J1R A;  1W0T A;  2GLO A;  1TWH J;  3OOU A;  2JN6 A;  1S7E A;  2CJJ A;  3DCF A;  4M6V A;  1JJ6 C;  1HDP A;  1MBK A;  3RZD J;  3JRH A;  1U78 A;  1DU6 A;  1CQT A;  3IH2 A;  2MGQ A;  5F0H A;  1DU0 A;  2LKX A;  2E19 A;  2L0K A;  2ME0 A;  4IHV A;  4MFD A;  1ETV A;  1GDT A;  1T33 A;  3JRD A;  4RDU A;  2OPT A;  3GTM J;  5M5Y J;  3ZQF A;  5J3L A;  5EG0 A;  5DTD A;  1ZGW A;  2N8G A;  3TW6 A;  3BR1 A;  1H8A C;  1HLV A;  3JRB A;  3BR5 A;  3TP0 A;  2LLK A;  5HOD A;  5FKK A;  4FTH A;  1U8B A;  2M0C A;  5GPA A;  3S16 J;  2IAI A;  5EGO A;  2LP0 A;  1NK3 P;  2EZH A;  3VPR A;  3HOX J;  4Y52 J;  1AKH A;  1MBJ A;  3Q0U A;  1B72 A;  2VUM J;  2NS8 A;  3FKI J;  1Q1V A;  1IG7 A;  4MO7 A;  4M3F A;  3TED A;  1WI3 A;  2HOS A;  3JRE A;  1LE8 B;  4L5E A;  4IHY A;  4A3E J;  1VF9 A;  1NK2 P;  4XIC A;  1GV5 A;  2LD5 A;  1HDD C;  3H3V K;  1ETO A;  1MBF A;  4D5F A;  2RAE A;  3S1N J;  1ETW A;  4ABZ A;  2L7M P;  3GTL J;  1LE8 A;  4IEJ A;  1LFB A;  2QCO A;  1XC5 A;  2XPW A;  1JJ8 C;  3HEF A;  1H88 C;  2EZL A;  5EYR A;  5FLV A;  2XGD A;  4G12 A;  4BXX J;  3BR3 A;  3G1M A;  3UKG A;  5M5W J;  2TRT A;  2O9L A;  2Y2Z A;  2JK3 A;  3LSP A;  1RKW A;  1PUF B;  1JTY A;  2LK2 A;  1APL C;  5IPA A;  3CCY A;  1GUU A;  1QVT A;  2IBD A;  3PO3 J;  2X6O A;  1XG1 A;  1ZK8 A;  3IH3 A;  1HOM A;  2NS7 A;  1MBE A;  3BG9 A;  4C2M J;  1XS9 A;  3A01 A;  2K9N A;  2EH3 A;  2KDZ A;  4A3L J;  1X58 A;  4DZJ A;  3B6A A;  2HYJ A;  4W97 A;  2X9D A;  2ME6 A;  5K7Z A;  3S15 J;  4D5C A;  1MH3 A;  2DMU A;  4DZP A;  2HI3 A;  4A3I J;  1LFU P;  5J1U A;  2R93 J;  1JTX A;  2OF7 A;  3ZQH A;  1QVU A;  4XID A;  4FCY A;  2JA8 J;  5EZG A;  3RKQ A;  4FE7 A;  2ID3 A;  1WGX A;  3OIO A;  4AC0 A;  4MFE A;  4UUS A;  1RES A;  2VKV A;  1ZR4 A;  4JX5 A;  2DMT A;  1TWC J;  1JT6 A;  3HOY J;  3F0C A;  3Q3S A;  1SFO J;  2Y31 A;  1TC3 C;  1OFC X;  1UHS A;  4JYK A;  2JA5 J;  4V2G A;  2CQX A;  2Y30 A;  2M34 A;  4UUT A;  4DYC A;  2DA7 A;  3JRI A;  2YU9 J;  5FKL A;  3LSJ A;  5K7F A;  2M8G X;  2D5V A;  1VI0 A;  9ANT A;  2TCT A;  2JA7 J;  3HOW J;  5IOY A;  2K9Q A;  2DA4 A;  1FTT A;  5EZH A;  2DN0 A;  2IEK A;  2O7O A;  5BNG A;  5IP9 J;  2NOG A;  3IV5 A;  5IOZ A;  2CRG A;  3NAU A;  3G1L A;  4W1U A;  3BG3 A;  4FE4 A;  2R0Q C;  2MG4 A;  5FKM A;  3LNQ A;  1JKR C;  1UG2 A;  1R9T J;  5JLX A;  4DYR A;  1AU7 A;  3SDG A;  2NVT J;  4J19 A;  3S17 J;  2MSY A;  3C2B A;  1BL0 A;  2ECB A;  3LSG A;  3LSR A;  1O4X A;  3BR6 A;  4M3E A;  2H1K A;  1BW5 A;  2XB5 A;  4M3G A;  4CYC B;  1JKQ C;  4XRM A;  2JWT A;  3GTJ J;  1W0U A;  3K7A J;  2XPU A;  3MN2 A;  3CQZ J;  3B6C A;  5IP7 J;  3CMY A;  1JUP A;  3QPL A;  2E1O A;  1BJZ A;  4BKX A;  3M3Y J;  1U9N A;  3ZQI A;  2WB1 N;  3GTQ J;  4A3M J;  1HCR A;  4AUX A;  5M3F J;  1Z77 A;  2K40 A;  2Y9Y A;  1GT0 C;  3RZO J;  1A6I A;  4CYC A;  3E7L A;  1FTZ A;  3TW7 A;  1RET A;  3H0G J;  2CQQ A;  1ZKG A;  1FEX A;  2FQ4 A;  3BQY A;  2AO9 A;  2VKE A;  2P81 A;  2ECC A;  1Y1V J;  1VND A;  2NVX J;  4JP0 A;  4QIW N;  4XRS G;  5F08 A;  5E3M A;  2CUE A;  5FKO A;  3GTG J;  2DA3 A;  2DMP A;  1K83 J;  3PM1 A;  2FX0 A;  1EF4 A;  2GM4 A;  2HOT A;  1OCT C;  1I3Q J;  5FJ8 J;  1U9O A;  4BBR J;  2CUF A;  4B3A A;  3HOZ J;  2DJN A;  5F0F A;  5M5X J;  4BBS J;  5E3N A;  1MBH A;  4V2F A;  4A3F J;  1MH4 A;  3BR2 A;  3ZQG A;  5IYC J;  1IJW C;  2DA6 A;  2H8R A;  1IV6 A;  1X2M A;  4BY7 J;  3A03 A;  4M3D A;  2EZK A;  5EDN A;  1IRZ A;  1A5J A;  1T56 A;  2G0E A;  2QF7 A;  3BTL A;  4IHW A;  1PUF A;  2DA1 A;  4MIM A;  5FLM J;  3HGY A;  2JJ7 A;  4HNV A;  2YS9 A;  4XRS A;  4A69 C;  3S2D J;  2ID6 A;  2W48 A;  2HQ5 A;  1F43 A;  4QTR A;  1AHD P;  3JR9 A;  1B8I B;  1ETX A;  3BT9 A;  2LTP A;  5C44 J;  1IGN A;  2E2H J;  2XSD C;  3W6V A;  3HB9 A;  2YUS A;  2VPR A;  2R5Y B;  5C4J J;  2LVS A;  3G1O A;  1P7J A;  2NVY J;  1MNM C;  2DA5 A;  3HGG A;  3MVP A;  3OSF A;  4A3G J;  3HOU J;  3FK6 A;  5EF6 A;  3M4O J;  5E3L A;  3QQA A;  1B8I A;  2FJ1 A;  1JUS A;  5FKN A;  3SJM A;  1YRN B;  1VFC A;  4EEF G;  3LOC A;  3ZOB A;  3JRF A;  1IC8 A;  5C3E J;  3IH4 A;  2L7Z A;  3GBG A;  3HBL A;  1QPI A;  3BR0 A;  2XGE A;  1I50 J;  1GV2 A;  4S0H B;  4C3J J;  4A3J J;  5IYD J;  2LR8 A;  2LY9 A;  1IUF A;  1OCP A;  4IHX A;  2MW8 A;  2NVQ J;  4FIS A;  1TWA J;  2WV1 A;  1YRN A;  5IP6 A;  1ETQ A;  4Y7N J;  4A3C J;  2E2J J;  2XGC A;  4AYB N;  1RR7 A;  2X48 A;  1ITY A;  3S1Q J;  1JKP C;  3ZQL A;  5EG0 B;  3HOV J;  3ZQC A;  2L7F P;  5M3M J;  2R7Z J;  2ELK A;  2AHQ A;  3K2A A;  4BY1 J;  1RPW A;  5F27 A;  4A3B J;  5EGO B;  2CU7 A;  1NTC A;  3FK7 A;  1D5Y A;  4I76 A;  2EZI A;  2JMW A;  3WHB A;  1MSF C;  1P7I A;  1AKH B;  2O8K A;  3PO2 J;  1MBG A;  2M2E A;  3FIS A;  4A3K J;  1B72 B;  3JRA A;  3BTC A;  4XK4 A;  3D1N I;  1WH5 A;  4QSH A;  1RKT A;  1JT0 A;  1HF0 A;  4X1E A;  1FIP A;  2WAQ N;  2HDD A;  4DW6 A;  4RBO A;  1ETK A;  4B1R A;  2COB A;  2DA2 A;  4NDL A;  5JLW A;  3DEW A;  2K9S A;  3JRC A;  1JUM A;  5EEA A;  1G2H A;  1H89 C;  2HXO A;  2HXI A;  2PMZ N;  4D7M A;  2Y0S N;  4MLO A;  4D7N A;  1IDZ A;  3GTP J;  5J1Y A;  3GTK J;  2JA6 J;  3A02 A;  3O8H A;  3BQZ A;  5E3O A;  3I4N J;  1I6H J;  2EQR A;  2R5Z B;  3S1R J;  4M3B A;  3TP3 A;  1F36 A;  2R92 J;  3WHC A;  2DMN A;  1WCM J;  2DMQ A;  1E3O C;  2B63 J;  2VI6 A;  3BG5 A;  1BW6 A;  3JRG A;  3L1P A; 
#chains in the Genus database with same CATH topology
 1IN5 A;  1QRY A;  1TWG J;  4NQW B;  1OCO H;  3SFI A;  1IDY A;  3TGN A;  1KQ9 A;  4AD9 A;  4L9J A;  3QOD A;  4XSZ F;  4RB1 A;  2JRM A;  2VC1 A;  1SFK A;  2ACJ A;  3H9Q A;  3SZG A;  4P9U A;  1ZR2 A;  1A04 A;  1WH7 A;  4JX6 A;  3OYI A;  3OSG A;  2LSO A;  5J8C A;  4E6K G;  1OYW A;  4BHB A;  4CHU A;  3S14 J;  2IPQ X;  3BP8 A;  2LF7 A;  1Y8R B;  1FIA A;  3O8G A;  2QKM B;  1POG A;  3RPU D;  4Y17 A;  3Q0V A;  4A3D J;  4X6A J;  1FOY A;  3I58 A;  3LQQ A;  3K70 D;  2EPF A;  4I6Z A;  1WJF A;  2FD5 A;  4BHC A;  1MDM B;  1UFM A;  2XPV A;  1WKM A;  4RMN A;  4NC8 A;  2CW7 A;  1B6A A;  2LFB A;  3E6D A;  3S3N A;  1XMK A;  4YG2 F;  1X3Z B;  3G73 A;  2KT0 A;  1SAN A;  3PNT A;  4QPO A;  4EJW A;  1GVJ A;  2MH9 A;  1O57 A;  2XRL A;  3G3Z A;  1ENH A;  3S2H J;  2ZB9 A;  5K7H A;  3N05 A;  1IAW A;  3HIF A;  3OYD A;  4PGG A;  3GTO J;  3OYC A;  5F64 A;  3G4S I;  2GLO A;  4PJN A;  1TWH J;  2V1X A;  1HBX G;  4L18 B;  3DCF A;  1U2W A;  4EGY A;  3JRH A;  3OR2 C;  4BQN A;  1KU3 A;  1U5T A;  4IRG A;  2LOO A;  3F8M A;  4Y13 A;  5AON A;  1CQT A;  4EJT A;  1WI9 A;  2M1B A;  3CC2 I;  4BQQ A;  4I01 A;  2MAB A;  4R79 A;  4U7B A;  2W7N A;  1DU0 A;  5FFX A;  2LKX A;  3H3Z A;  4A0X A;  2RNG A;  2VLA A;  2L0K A;  3CDI A;  3R61 A;  5DCF A;  2ME0 A;  2GQQ A;  4WK8 F;  4QPQ A;  4MEX F;  5ICG A;  4AM3 A;  2X51 A;  3WTT C;  3GTM J;  3FDY A;  4OIN F;  1EJ9 A;  1VQ5 I;  1I6X A;  2DT5 A;  5GAE J;  3TW6 A;  3BR1 A;  5HOO A;  2OQG A;  1G3S A;  1B59 A;  3TP0 A;  1XCV A;  1E0E A;  4YII A;  1N77 A;  4FTH A;  1U8B A;  2DYS H;  1BR4 A;  1J5Y A;  2M45 A;  2OQR A;  3ROU A;  2O6G E;  4P1W A;  1EA3 A;  2P8T A;  3WG9 A;  1LB2 A;  1LVA A;  3F21 A;  3BPV A;  1QHG A;  4KNY A;  2LF8 A;  1NK3 P;  4XN3 A;  2EZH A;  4D1Q A;  1UEL B;  3CES A;  3NRV A;  2WY7 Q;  2I8D A;  1MBJ A;  3Q0U A;  5KVR A;  2VUM J;  2YPR A;  4WX9 A;  1WJE A;  2NS8 A;  3TMO A;  2CQ7 A;  1TW3 A;  4LLL A;  1XN7 A;  1YW8 A;  3BPX A;  4MO7 A;  2PLY A;  4LG0 B;  2W84 A;  1Z05 A;  2RC4 A;  4L5E A;  3C2G A;  3QP5 A;  4IF4 A;  4PJJ A;  4LD5 A;  2VOP A;  3GFL A;  1HDD C;  3I59 A;  3HRS A;  2EFW A;  1YO5 C;  3H3V K;  3EYY A;  2CFO A;  4MEY F;  3CCU I;  2Y0M A;  3BY6 A;  3S1N J;  4ZDO A;  4OWR B;  2A61 A;  3A1Y A;  3GTL J;  5DUK A;  1TQI A;  2VBY A;  5B5E C;  1LE8 A;  4EAT A;  5TIS C;  2QCO A;  2CW8 A;  3MZ8 A;  1S7O A;  3HEF A;  3JSP A;  1H88 C;  3DPL C;  2VXZ A;  1TT5 B;  3M8F A;  3BR3 A;  4YFN F;  1R49 A;  3MZY A;  3F23 A;  1REP C;  3AG1 H;  5KNL A;  1PUF B;  1JTY A;  3V42 A;  2LK2 A;  1Z1D A;  5K5R A;  4NQW A;  1APL C;  5IPA A;  4XON A;  4A5N A;  4B47 A;  1KYW A;  1QZZ A;  3K4B A;  3TOA A;  2V1D A;  1H0M A;  1KU7 A;  2VQH A;  5LEJ A;  2DOF A;  2W25 A;  1GUU A;  2F5E A;  2IBD A;  1A36 A;  4ZH4 F;  3WE3 A;  1ULY A;  4BJ5 C;  1ZK8 A;  1O3S A;  3H3U A;  1RRJ A;  3SZT A;  1HOM A;  2E1M B;  4XKB A;  4C2M J;  3SEZ A;  1YQA A;  2CMP A;  1K4S A;  2VOO A;  1X1A A;  3O6B B;  2E71 A;  3FMS A;  4JOM A;  5K5O A;  2X9D A;  4HLX A;  4C2U A;  3S15 J;  2WAF A;  2DMU A;  4CDG A;  2YU3 A;  3EUA A;  1MDM A;  1J59 A;  5J1U A;  2ZXI A;  3ZQQ A;  1DP3 A;  3BLY A;  4XID A;  2FML A;  5EZG A;  2RKH A;  2XAQ A;  1HQC A;  1TLH B;  4FE7 A;  4UV9 A;  1XGN A;  3MKW B;  5HLT A;  2K4B A;  2BHZ A;  3H5A A;  3QAH A;  4AC0 A;  1TP4 A;  4S04 A;  4FQG A;  4EJO A;  3HRM A;  3T0Y A;  2VKV A;  1ZR4 A;  4LLN A;  3SQN A;  2JSC A;  3L7W A;  4RGX A;  4E7S A;  1LDK B;  3ABM H;  3HOY J;  3Q3S A;  1ZRC A;  2JA2 A;  2Y31 A;  3WU1 B;  2V7F A;  1L3L A;  2JA5 J;  3WTV C;  2YR2 A;  2M34 A;  2DFE A;  3ABL H;  1OR7 C;  3PIO F;  5K7F A;  5GAH J;  2D5V A;  1VI0 A;  2JA7 J;  1XMA A;  4RLQ A;  2H1L A;  4HRI A;  4M6Y A;  2IEK A;  1TNS A;  1P4X A;  5IP9 J;  2JUC A;  5HLH A;  2K3P A;  3R60 A;  1VTN C;  4CA0 A;  3ZMD A;  2R7U A;  2MG4 A;  5H6Q A;  4BDY A;  4IOC F;  1MJA A;  5LHG A;  1UG2 A;  3KZZ A;  1R9T J;  3W2V A;  3OIQ A;  2VBX A;  3SDG A;  2HFH A;  4LJZ F;  2MSY A;  1BL0 A;  2FSW A;  3LSG A;  3P9C A;  3S3O A;  3JW4 A;  2QQ9 A;  3DPT A;  3F72 A;  1FYL A;  2XB5 A;  4M3G A;  2LBF B;  1USS A;  4YFX F;  3CUQ B;  2XAH A;  3GTJ J;  1XMX A;  3I4P A;  1OCZ H;  5IP7 J;  1PP8 F;  1JUP A;  1R58 A;  1YW9 A;  1D1B A;  2XIG A;  3ZMZ A;  4WWC A;  1BR2 A;  4IHS A;  1SEU A;  1HCR A;  5M3F J;  2IA2 A;  3VYT B;  1J75 A;  1UCR A;  4LFU A;  3RZO J;  2ZXJ A;  3BZK A;  4EMS A;  1FTZ A;  2CH0 A;  4E7H A;  4EM1 A;  2HEO A;  2P81 A;  2TDX A;  2R7O A;  2ECC A;  4M72 A;  4ZJZ A;  5HDK A;  3K4C A;  2PJR B;  2OC6 A;  5CLS A;  1Y1V J;  3CF2 A;  3Q9V A;  4G6D A;  5EJC A;  2HQR A;  4LG0 A;  3VDX A;  1SD7 A;  2L4A A;  4DBR A;  2BVL A;  5FKO A;  1YLF A;  4B8X A;  3KP3 A;  2FX0 A;  1EF4 A;  2YSR A;  2HOT A;  3E0J B;  2IRF G;  1OCT C;  1I3Q J;  1RR8 C;  1P2F A;  1U9O A;  3GO5 A;  2P5L C;  5LHI A;  4I98 B;  5K1Y A;  3GFM A;  1KA8 A;  2D1H A;  5LRR A;  3ECH A;  1H9T A;  3T1B A;  3DEE A;  2P4W A;  3ELK A;  4B3A A;  3HOZ J;  1R5H A;  4I2O A;  5J4Y A;  2VJ5 A;  5E3N A;  1FP2 A;  2O3F A;  1MBH A;  2QZ8 A;  5DD8 A;  4IZZ A;  4A3F J;  1P9Q C;  4IQ4 A;  1MH4 A;  3BR2 A;  4XN0 A;  4BY7 J;  4BQO A;  4HX8 A;  3CCQ I;  2QQ8 A;  1B9M A;  2Z9O A;  2P6S A;  4IHW A;  1R71 A;  1PUF A;  4GXO A;  4WXC A;  5FLM J;  2VPL A;  1SFU A;  1TL8 A;  2JJ7 A;  2QEN A;  1FSH A;  4A69 C;  3HTS B;  5HDG A;  2LG4 A;  2ZO4 A;  4CZZ A;  3EET A;  4LIT A;  4XKW A;  2HPM A;  2FOK A;  2HQ5 A;  2Y48 A;  1TW2 A;  4GDF A;  1EH6 A;  1JHH A;  1OKR A;  3K4K A;  3KPH A;  3K69 A;  4RGU A;  1B8I B;  4IKF A;  5C44 J;  1IGN A;  4AIH A;  3HB9 A;  3DP7 A;  4B09 A;  4N0B A;  2HS5 A;  3CCM I;  2LVS A;  2A07 F;  2ICW G;  1UAA A;  4ZDL A;  3JAM K;  3OSF A;  3HOT A;  4PDK A;  5JVG F;  2J5P A;  4OIR F;  3M4O J;  5E3L A;  4F91 B;  3BG6 A;  2H8W A;  2DDB A;  1JUS A;  3H1C A;  1RIO H;  3SJM A;  1V5F A;  2R7X A;  2WTE A;  3LOC A;  1K7A A;  1Z6R A;  3LFU A;  3ZOB A;  1T2K A;  5ICF A;  5HLI A;  5C3E J;  3F8F A;  3IH4 A;  1D3Y A;  1XSX A;  2PX9 A;  3RPQ A;  2XRO A;  4NC6 A;  4S0H B;  3COA C;  4HF2 A;  4FHT A;  3WU0 A;  2K02 A;  1TWA J;  2E35 A;  2WV1 A;  1FBQ A;  4FIS A;  3ZCO A;  1ETQ A;  1LDJ A;  4Y7N J;  3OS0 A;  2XHK A;  3QPT A;  4A3C J;  1ON1 A;  1LDD A;  4AYB N;  1ITY A;  1YIT I;  1P92 A;  1UJ8 A;  5IY5 H;  4M6X A;  1V54 H;  3DV8 A;  3CP2 A;  4P9F A;  4U0V A;  4KIF A;  2ADU A;  2HWV A;  3ZQC A;  4XOP A;  1VQ8 I;  2L7F P;  5E18 F;  3QOP A;  3CME I;  1DQU A;  3RI4 A;  1CF7 A;  2PI0 A;  2M7A A;  2QM3 A;  1O3R A;  1JHF A;  1X4P A;  2MLK A;  3DKW A;  5JFR A;  1LPQ A;  1SD6 A;  5D5U B;  3SXY A;  4A6E A;  1YG2 A;  2RV8 A;  3QYE A;  4BAY A;  1R6R A;  2HQA A;  2EZI A;  1MSF C;  2O8K A;  1A31 A;  1MBG A;  1UHW A;  3FIS A;  4CCJ A;  3H0D A;  1A35 A;  2ZJR F;  3SHF A;  3BTC A;  2K5C A;  1WJC A;  5H20 A;  4XK4 A;  3KET A;  2DFI A;  1Z7U A;  3D1N I;  2F5F A;  4QSH A;  2LBF A;  4X1E A;  4Z2Y A;  1FIP A;  1P6R A;  2EB7 A;  2HDD A;  2V9V A;  4B1R A;  3O3K A;  1F5T A;  2K9L A;  4NDL A;  3B73 A;  2HZD A;  4X0G A;  3TDZ C;  3CCV I;  4E7K A;  1NHA A;  4HX4 A;  4XMY A;  2Y0S N;  1R36 A;  4RLF A;  5AIQ A;  1V55 H;  5J1Y A;  2KMU A;  3DBL B;  2BBY A;  3O2P E;  2EFP A;  1K6Y A;  1WFX A;  2AXL A;  1QBJ A;  3A02 A;  3IWF A;  3BQZ A;  2X4H A;  2LY2 A;  1ZLK A;  2QWW A;  1F36 A;  3TP3 A;  2CS3 A;  1XSV A;  3K4N A;  3R4K A;  2DMN A;  1GXQ A;  1XGM A;  4R1H A;  1R7J A;  1W1W E;  5HS8 A;  2B63 J;  2RNJ A;  1BW6 A;  1WWX A;  4CCN A;  3E5U A;  3I56 I;  4JBA A;  2DQR A;  4RAY A;  5D6E A;  2IA1 A;  2B9S A;  3PUF A;  5LGT A;  1BI3 A;  3U1D A;  2HOE A;  2L9R A;  1ZAR A;  2VKH A;  3C18 A;  4AVZ A;  1K61 A;  3MKL A;  1IN8 A;  2ZFU A;  3VB2 A;  1WVR A;  3I71 A;  5D4R A;  4PUS A;  4PK4 A;  4UB6 C;  3WU2 C;  5IT3 A;  2ISY A;  5DCM B;  4JX4 A;  4AIJ A;  3EUH A;  1MIJ A;  3RQI A;  3MWM A;  2BY2 A;  3HDD A;  3F8N A;  1ZQ3 P;  3FMQ A;  1QHH D;  2IXS A;  1ZHF A;  3CLQ A;  2L9S A;  3ZMV A;  2A5W A;  5KCM A;  2WV0 A;  4FAS D;  1OYY A;  4DYQ A;  4CXF A;  2OU2 A;  3VYU B;  1X19 A;  3CDL A;  5B66 C;  4XNF A;  4Q4Z F;  2HKX A;  1TWF J;  2I10 A;  3Q9S A;  4I99 C;  2W57 A;  2CGP A;  5F0C A;  2F48 A;  1G6N A;  1GHC A;  2EA4 A;  3ZN0 A;  3W2W A;  2ZME B;  1Z9C A;  5C4X J;  1OIS A;  2FNA A;  3IKV A;  1B9N A;  4RGS A;  4KFC A;  4CO8 A;  1Z3Y A;  1W0T A;  3KP4 A;  1BC7 C;  2ESH A;  2JN6 A;  2BY1 A;  4IOA F;  1JJ6 C;  1IRG A;  2HNH A;  3RZD J;  1CGP A;  2WC2 A;  1IW7 F;  3FXO A;  1PDN C;  2DXI A;  1FOW A;  3H9J A;  3I54 A;  5CQE A;  2GA1 A;  2JVG A;  4E7Z A;  1ZAO A;  1NH3 A;  3REO A;  1S7A A;  4E7I A;  2CQN A;  2EWN A;  4N4N B;  2VJI A;  5F1R A;  2E19 A;  1JI8 A;  2HVS A;  4MTD A;  3KYC B;  1MMS A;  3M8J A;  2X1D A;  3JSO A;  3WTW C;  2MFZ A;  3ZRG A;  2W4S A;  1AWC A;  1GDT A;  1T33 A;  2QSG X;  5M5Y J;  3RYR A;  1G3Y A;  3FHN A;  5B1B H;  2MBF A;  5DTD A;  5L3E A;  1U3E M;  1R1U A;  2KP6 A;  3BR5 A;  4MTE A;  2M0C A;  4HX7 A;  3S16 J;  3IP4 B;  3K0L A;  1WRJ A;  2LKP A;  2XV4 S;  2V9P A;  3FM5 A;  1FMW A;  2CV1 A;  5L3F A;  3HOX J;  4Y52 J;  4B44 A;  2G7H A;  3LST A;  3OMY A;  3W3C A;  1YOV B;  1VQP I;  3MAJ A;  2PQ8 A;  2LY1 A;  1HW2 A;  3W6J B;  2JZY A;  2PFB A;  2KLO A;  4AWX B;  4O3M A;  4M3F A;  3WGI A;  3FXR A;  4ETS A;  1LE8 B;  3PSF A;  3WGG A;  1VF9 A;  2DYR H;  5FLX K;  2VKD A;  2CFX A;  3D5R C;  3OYJ A;  1GV5 A;  3IRR A;  1IF1 A;  4UY8 I;  3DWL E;  1ETO A;  3ZMU A;  1MBF A;  3AFH A;  3S3M A;  1X1D A;  2R7R A;  1HKQ A;  3C2H A;  1S6L A;  2BXZ A;  4MGR A;  3NQO A;  4HF0 A;  5FRO A;  3HOS A;  2HDC A;  4YRV A;  1F9N A;  2UZK A;  3IAS 2;  4BS9 A;  2QA4 I;  5GTH C;  1XC5 A;  1Z3X A;  2EZL A;  2MH2 A;  2XGD A;  1SMY F;  3G71 I;  4A2U A;  3UKG A;  2O9L A;  2C6Y A;  2X6Y A;  1I27 A;  2JK3 A;  3PFI A;  4PJM A;  4D9J A;  5D5W B;  3KP6 A;  3H5N A;  2QVO A;  1BI0 A;  2Z2S B;  4PCQ A;  3CCY A;  2KJC A;  4CIC A;  2X6O A;  1MMD A;  2L5Q A;  4OIQ F;  5HS7 A;  5E8I A;  4C2T A;  2IS4 A;  5D5V B;  3IH3 A;  4BE1 A;  1O3T A;  1I5Z A;  3BC8 A;  5DCM A;  4HV5 A;  4NC7 A;  1XS9 A;  2YX4 A;  1HST A;  3KZY A;  2EIM H;  3H36 A;  2DI3 A;  1O3Q A;  5J40 A;  1LQ1 A;  1X58 A;  4DZJ A;  2ME6 A;  5K7Z A;  3W2A A;  4N9H A;  3QYF A;  2HI3 A;  4AU7 A;  1LFU P;  3CC7 I;  2HYF A;  2R93 J;  4Q48 A;  1DP7 P;  1JTX A;  2OF7 A;  2OCE A;  3KYD B;  3CCR I;  1HKS A;  2VL8 A;  2W85 A;  3BCA A;  4FCY A;  2JA8 J;  1YX5 A;  3RKQ A;  3CO7 C;  3DFG A;  3ONQ A;  1PVE A;  3OIO A;  4KT6 A;  1N25 A;  4L9T A;  3BOQ A;  3LSK A;  3GWZ A;  2KKO A;  2FEZ A;  2EIK H;  3F6O A;  4UHT A;  2ZME A;  3L9F A;  2AS5 F;  1TWC J;  3F0C A;  1FOX A;  3RKY A;  3ZXS A;  2OV7 A;  3KFW X;  4CCO A;  1OFC X;  4NNJ A;  1Y0U A;  4V2G A;  2Y30 A;  1TZL A;  4DYC A;  3JRI A;  1Z6T A;  2L2O A;  2HTJ A;  1LJ9 A;  2M8G X;  4B3X A;  4BXU A;  4LIV A;  1BIA A;  4GCV A;  2GOX B;  4BQA A;  2P0W A;  5IOY A;  3DTK A;  4KIC A;  2DN0 A;  3TOB A;  3J7Z I;  2ZNY A;  3C3W A;  5BNG A;  2K4J A;  2PMH A;  2QLZ A;  4HA8 A;  3IV5 A;  2DBB A;  5FKM A;  3I5U A;  3LNQ A;  1JKR C;  3B02 A;  1ZG3 A;  2Y75 A;  5D5X B;  3H35 A;  5JLX A;  1K79 A;  4MQV A;  3S93 A;  4IRH A;  2M3A A;  2E1M C;  1FY7 A;  5GAD J;  2L7K A;  4PJ0 C;  2KJB A;  1A6Q A;  3OWT A;  1X1C A;  2GIZ A;  3PSI A;  4PGH A;  4YIR X;  4M3E A;  1BW5 A;  1KGS A;  4XR6 A;  4OU0 A;  2F5V A;  1W0U A;  3K7A J;  3MN2 A;  3CQZ J;  3GUD A;  4EM2 A;  1WJB A;  3CMY A;  1YJ9 I;  4ON0 A;  3QPL A;  1BJZ A;  4BKX A;  1R4N B;  2FBH A;  4RB2 C;  4LK1 F;  1U9N A;  1BIB A;  4HST A;  5CVR A;  2KIU A;  1Y6I A;  5E1X A;  4CYC A;  1UZC A;  4Q47 A;  2R4G A;  3JTH A;  2P7C B;  3LSH A;  3TW7 A;  1RET A;  3H0G J;  4BE2 A;  2CQQ A;  1ZKG A;  1FEX A;  4KJZ A;  1XGS A;  1FLI A;  1KON A;  4DJA A;  3HKZ A;  3KEY A;  4ITV A;  3JAM Z;  5D8L B;  2F5C A;  1SMT A;  3K6G A;  1R4M B;  4BE0 A;  1VND A;  3IHU A;  2NNY A;  1YYV A;  4JP0 A;  4C9Y A;  5E3M A;  5F08 A;  2XRN A;  2R7F A;  3GTG J;  1NG6 A;  2DMP A;  4XLC A;  2CUJ A;  1D5V A;  2M4G A;  4PFO A;  2DJI A;  5FJ8 J;  2QGU A;  5HDN A;  3EPZ A;  2V26 A;  4CCL A;  3D5S C;  4KN4 X;  4Y15 A;  2CUF A;  5EEG A;  1V3F A;  2KDO A;  2KHM A;  1EH7 A;  5F0F A;  3K1N A;  2XF7 A;  2IS6 A;  3CJQ B;  3DLA A;  4BJ6 C;  2BXY A;  2VBZ A;  3BRO A;  1YIO A;  1RI7 A;  2PJP A;  5DDG A;  5BQT A;  2EZK A;  5EDN A;  4YIF A;  4ASN A;  3IRQ A;  1IXS B;  3BTL A;  2DA1 A;  1D8K A;  2VN2 A;  4MIM A;  3DPU A;  4LB5 A;  3CUQ C;  2Z1D A;  4HNV A;  4ZTJ A;  2V1U A;  3L00 A;  4XRS A;  4F93 B;  2GXA A;  1LKX A;  3S2D J;  2ID6 A;  1BOA A;  4BU2 A;  3ZR8 X;  2GA2 A;  1TNT A;  2BVM A;  4KMU X;  1AHD P;  1SVO A;  4F55 A;  4EJU A;  2LNB A;  3VEP A;  2O61 A;  2QBY B;  2IVM A;  4HNT A;  3BT9 A;  1HA8 A;  1IN4 A;  2XSD C;  5CPR B;  2E2H J;  3H92 A;  1I1S A;  2CV2 A;  5E17 F;  2R5Y B;  4CGZ A;  2JSP A;  2WAD A;  1NG7 A;  4XKC A;  2ZBK A;  3P7N A;  1MNM C;  3MVP A;  3CC4 I;  1YRN A;  3FK6 A;  5ERI A;  1LEA A;  3QQA A;  1D1C A;  3ULQ B;  3DTI A;  4G7Z F;  1ZG5 A;  1YRN B;  4FET A;  3GLX A;  1I39 A;  5CVU A;  1JE8 A;  2V6C A;  2L7Z A;  1T39 A;  3GBG A;  1EH8 A;  1T0F A;  2GIV A;  1YS6 A;  4A6D A;  3J81 K;  2HVR A;  1HKT A;  1FYM A;  1Z7L A;  3BJ6 A;  2LY9 A;  4F92 B;  1IUF A;  2WAQ A;  1CF7 B;  1T38 A;  4IHX A;  1U6G A;  1QGP A;  3HSR A;  1STZ A;  4KDP A;  4ZYA A;  1XDS A;  3DBR B;  3T5X A;  3PNY A;  1IRF A;  3DF8 A;  4HV6 A;  3EUH C;  2CG4 A;  2ZJ2 A;  2R3S A;  3FXU A;  1M1E B;  3KLO A;  3ZQL A;  2RQP A;  5EG0 B;  3OYA A;  2UXN A;  3TBI A;  2VXD A;  4OAZ A;  2PMZ A;  1VQO I;  1WZ2 A;  3CJN A;  5M3M J;  1J0R A;  5HS9 A;  5LFA A;  2EIN H;  2UWM A;  5F6F A;  3E6B A;  3K2A A;  2ISZ A;  2ZNZ A;  4A3B J;  3ESW B;  2CU7 A;  3LSI A;  3E5Q A;  1NTC A;  3FK7 A;  2DW4 A;  1MJB A;  3WHB A;  1VQK I;  1P7I A;  1O7L A;  4CZC A;  3J7A Y;  2M2E A;  4A3K J;  1B72 B;  1N75 A;  2E1C A;  1IO2 A;  2F4O B;  3PQK A;  4ZTF A;  4HQE A;  4XSX F;  3V8L A;  1S29 A;  3KP2 A;  2R7T A;  3SZP A;  5DEQ A;  5K5Q A;  1RKT A;  3K4J A;  3CDH A;  1JT0 A;  2EFO A;  2WAQ N;  5TRD A;  3ML6 A;  3L2V A;  4OMY A;  2COB A;  3CCJ I;  2DFF A;  5JLW A;  3E3V A;  3BZC A;  3DEW A;  3JRC A;  4DQ2 A;  2IGM A;  1G2H A;  2RGV A;  2PG4 A;  2ZC2 A;  2PMZ N;  1KU2 A;  4MLO A;  5KK1 A;  1IDZ A;  1SVL A;  2IS2 A;  4JQF A;  2BOL A;  4PSX A;  3GYH X;  2JA6 J;  3O8H A;  4IJA A;  1Y56 A;  3FWE A;  2W24 A;  4BEH A;  2EQR A;  3MZH A;  4RB3 C;  2QQA A;  2P7V B;  3V8J A;  1WCM J;  4IL6 C;  3DEU A;  1ZG1 A;  2MYS A;  1E3O C;  4U7D A;  2LYC A;  3BG5 A;  2FOW A;  1B4A A;  3MMY B;  3L1P A;  5LBQ A;  4BNC A;  4ENK A;  4B4C A;  1DGR M;  3F9K A;  2P5V A;  2R5Z A;  1ZYR F;  1QNT A;  3LSM A;  2HTS A;  1BA5 A;  3BWG A;  2EBI A;  3CCL I;  3I4M J;  2A6E F;  1JXS A;  5GPC A;  4A93 J;  2HOA A;  4L5J A;  2A68 F;  3EYI A;  3RYP A;  1W7P B;  2GXB A;  4XOT A;  1X3U A;  2MD0 A;  3HHH A;  2DU9 A;  3FBN B;  2DTR A;  2D2W A;  2D45 A;  5F1J A;  1Y1W J;  3MFK A;  1GVD A;  3S1M J;  3HUG B;  4HQM A;  5F04 A;  3OY9 A;  3ERM A;  1X3W B;  1SC7 A;  2EJR A;  4C3I J;  5L3D A;  1K6O A;  2DK8 A;  3E97 A;  3DU6 A;  5DD4 A;  4F3Q A;  3QPS A;  4C3H J;  4OAY A;  3WE2 A;  2QBY A;  2GBY A;  2XB0 X;  2K27 A;  1UST A;  5IYB J;  3HM5 A;  2R5Y A;  4DOZ A;  3CF5 F;  1YFH A;  1XD7 A;  1ON2 A;  2BY0 A;  3TO7 A;  2EFN A;  5J1R A;  2KFD A;  3HRU A;  2Q1Z B;  3OOU A;  4CUG A;  3AAF A;  2CJJ A;  4M6V A;  5CVV A;  2O0Y A;  3U2R A;  2XF5 A;  3M8E A;  5FLX Z;  3M1E A;  3FXQ A;  5ICE A;  3IL2 A;  2CWE A;  3L2U A;  1U78 A;  1KYZ A;  3LA3 A;  1R1T A;  2QYO A;  3IH2 A;  3EDP A;  1W4M A;  2EA2 A;  4R8H A;  3M7G A;  4EGZ A;  2IP2 A;  2M4K A;  1W5C C;  2WB1 A;  2QEX I;  1DUX C;  4IHV A;  3DKX A;  4MFD A;  2VQG A;  1ETV A;  1ZEL A;  4RM3 A;  4WCG A;  3JRD A;  1S5L C;  1FOK A;  4I0B A;  2EV6 A;  4RDU A;  2KRF A;  2ZSI B;  5EG0 A;  1ZGW A;  2R7Q A;  2N8G A;  2DOE A;  1H8A C;  1HLV A;  3JRB A;  2LLK A;  5JVT A;  3QOE A;  2BE5 F;  4ANJ A;  2VT3 A;  4RAF A;  2VB6 A;  3HSE A;  1BN5 A;  3E5X A;  5LRS A;  3TQN A;  3IKT A;  4RM2 A;  3CJT B;  3GZN B;  2L9N A;  1ERD A;  4I02 A;  1X4O A;  5KAI C;  3A0B C;  3VPR A;  5L3G A;  5HVQ C;  1PJR A;  1V5E A;  4XKV A;  1B72 A;  2IW5 A;  2ZME C;  3SDB A;  2EV0 A;  2ETH A;  1ZN2 A;  1U5T C;  3FKI J;  1S9H A;  2QQB A;  4ENN A;  3OL4 A;  4GYG A;  3SYT A;  1RUO A;  2A6T A;  3C7J A;  2STT A;  2W00 A;  4ENM A;  3M07 A;  3JRE A;  2P5K A;  3QU6 A;  4IHY A;  1T08 B;  1ODD A;  1NK2 P;  1J09 A;  1FBS A;  3J7Y J;  1G4D A;  2XSJ C;  2H09 A;  2E36 A;  2FU4 A;  1ETW A;  2R7S A;  4RAZ A;  1HXD A;  2L7M P;  1EKE A;  2FBK A;  5FO5 A;  1XGO A;  1VQL I;  4IEJ A;  1R23 A;  1LFB A;  2PN6 A;  2ZCW A;  3LAP A;  1T8I A;  2K7L A;  4H4K C;  2NNN A;  5FB2 A;  5A2Q K;  3AG4 H;  2LKS A;  4XLP F;  5FLV A;  1TQP A;  1IV8 A;  1O7F A;  4G12 A;  2DPU A;  1W5T A;  4BYY A;  3G1M A;  5M5W J;  2TRT A;  3LSP A;  4BL0 B;  4KMF A;  1RKW A;  3G2B A;  2CQK A;  4EQQ A;  2RVC A;  2I5U A;  2NVU B;  3WTZ A;  3J80 K;  3AKZ A;  3BCB A;  4M73 A;  2GOM A;  4XLF A;  5FFZ A;  3ABU A;  2ELH A;  2RQQ A;  1QVT A;  4QWQ A;  3PO3 J;  3I3L A;  1G3T A;  1W7P A;  5ED4 A;  1W5S A;  1X1B A;  1BJA A;  4HEA 2;  2ZKZ A;  1MBE A;  2FA5 A;  3BG9 A;  5GTI C;  4HZF A;  3PQJ A;  2F2E A;  3PJR A;  2K9N A;  2ZFW A;  2EH3 A;  2KDZ A;  1OMI A;  2V9K A;  3CTA A;  2YX7 A;  4A3L J;  4HYE A;  2DK5 A;  3VOE A;  3AG3 H;  2BYV E;  5E8G A;  5H2F C;  1BI1 A;  1FZP B;  1YHQ I;  1SFX A;  2PBI A;  3HUG A;  4DZP A;  5LEK A;  3HRT A;  1E3P A;  2O8X A;  3CUO A;  1LVK A;  2STW A;  3ZQH A;  1QVU A;  2ESN A;  4XOR A;  2L9V A;  2ID3 A;  3CMM A;  3RKX A;  3FZV A;  1YJW I;  4MFE A;  4UXN A;  3A2K A;  3OS2 A;  4JX5 A;  3K4L A;  6PAX A;  1DPU A;  2H94 A;  1D0X A;  1JT6 A;  4I0A A;  4XLN F;  3RCO A;  2M30 A;  4M9S A;  4PZJ A;  1P4A A;  2CQX A;  2F4I A;  4UUT A;  2DA7 A;  3H5R A;  1PUE E;  2RRE A;  5FKL A;  1XX5 A;  4I7H A;  1G8X A;  2DFH A;  9ANT A;  3DU5 A;  1LNW A;  2KPM A;  1FTT A;  5EZH A;  3VYR B;  3AL0 B;  1QA6 A;  4J00 A;  1T95 A;  3CJR B;  3JTG A;  5L3C A;  1QO0 D;  1WJA A;  4D0P A;  2CRG A;  1MMN A;  2EK5 A;  3G1L A;  3BG3 A;  3H9G A;  4FE4 A;  1MND A;  4E4H A;  3CCS I;  1AU7 A;  1OCR H;  4G6Q A;  4J19 A;  2ZXW H;  1QQI A;  3CP8 A;  3L2R A;  1F4K A;  1J9I A;  2ECB A;  3X2Q H;  2VQC A;  2CUZ A;  1FNN A;  4XM3 A;  1O4X A;  3BR6 A;  4XBF A;  4CYC B;  3QRF F;  1SAU A;  1JKQ C;  4XRM A;  3RQ4 A;  3GFI A;  2V4J C;  2L02 A;  3GFJ A;  3FXK A;  3GZ5 A;  1MMG A;  3QPH A;  1K78 B;  4G9Y A;  3ZQI A;  3GTQ J;  2CW0 F;  2OZ6 A;  3ASN H;  4AUX A;  1Z77 A;  2K40 A;  4N4O B;  1GT0 C;  4S05 A;  1D8J A;  4ZC3 A;  1A6I A;  2X1E A;  5LD2 C;  4RA2 A;  1T0F C;  4HSR A;  3TKY A;  3ZMS A;  3E7L A;  4BGD A;  4GRI A;  1ACI A;  5E1W A;  4IHT A;  3SEQ A;  2OCC H;  4HG2 A;  1ZRE A;  1VQN I;  2HQN A;  4M9Z A;  1RZ4 A;  3BQY A;  1U8R A;  2VKE A;  2E5N A;  2WAE A;  4QIW N;  2LRD A;  3VYS B;  2A69 F;  1K83 J;  1FSE A;  5J47 A;  3OYK A;  1QZY A;  2D1V A;  3FMR A;  2VE8 A;  4BBR J;  3J81 Z;  5FD5 A;  1I3A A;  3VWB A;  4DIQ A;  2DJN A;  5IT9 K;  5M5X J;  1BI2 A;  4BBS J;  1DPR A;  5D8K B;  4V2F A;  1MW7 A;  5IYC J;  5DV5 A;  2DA6 A;  3HG9 A;  1X2M A;  1J7K A;  2JPB A;  3DQV C;  5ILU A;  3VFZ A;  4NHJ A;  1PP7 U;  1IRZ A;  1A5J A;  2H6C A;  2G0E A;  2XAU A;  3K9T A;  4ESB A;  4RAG A;  2XGX A;  4P5O A;  3RPU A;  3K2Z A;  2XAG A;  2IGO A;  2LH9 A;  3HGY A;  3BJA A;  3RKW A;  4CH7 A;  4L5I A;  5BPI A;  4JK1 X;  3QYB A;  2HDW A;  1MZB A;  3CD6 I;  4G7H F;  3F22 A;  1HC8 A;  3HHG A;  4QTR A;  1MNE A;  5CVI A;  3HJE A;  3JR9 A;  2ZJQ F;  1ETX A;  1WJ5 A;  1FT9 A;  5CVJ A;  4IQJ A;  4ZZD A;  2R7V A;  2YUS A;  2DLL A;  3LFK A;  4UB8 C;  2CYY A;  2ELJ A;  2FF4 A;  3R0J A;  3QU3 A;  5C4J J;  5DUI A;  1YS7 A;  5H6R A;  4LB6 B;  3G1O A;  3CO6 C;  1YX3 A;  2HZT A;  3HGG A;  3L2Q A;  1VQ9 I;  2VT2 A;  4A3G J;  3HOU J;  3ZGK A;  4BUP A;  5EF6 A;  2EIJ H;  2X6W A;  1LUJ B;  3RJP A;  5HNH A;  1YTY A;  1IUY A;  2Z5U A;  3BZ6 A;  1XTA A;  3FM3 A;  4OOI A;  3QWL A;  3TO9 A;  2L01 A;  4G6T B;  3A4C A;  3ZPL A;  1QPI A;  1T6S A;  3BR0 A;  4WXH A;  1I50 J;  2KRH A;  3OS1 A;  4M71 A;  1GV2 A;  4C3J J;  5IYD J;  3N97 A;  1OCP A;  1XPX A;  2BGC A;  3R0A A;  1HW5 A;  2HR3 A;  5LHH A;  2DO7 A;  3CCE I;  3UR3 C;  2E2J J;  2XGC A;  4LG3 A;  1RR7 A;  2X48 A;  2IA0 A;  3DTE A;  4I09 A;  4CCM A;  4KIS A;  3S1Q J;  3JCU C;  2MC3 A;  4IPA A;  2EV5 A;  3TDU C;  4ENJ A;  4KA4 A;  4CSW A;  3FKJ A;  3J7A O;  1C0W A;  1FX7 A;  2Y69 H;  4L9N A;  2J5O A;  1MD0 A;  5BOX A;  4U87 A;  3VSK A;  4DNC A;  2AHQ A;  4BY1 J;  5EGO B;  1QU3 A;  1ZLJ A;  1D5Y A;  2MA3 A;  2KZV A;  3P9K A;  1K4T A;  3OYN A;  5D4S A;  1AKH B;  3PO2 J;  4Y4R A;  3EQL F;  3HL2 A;  4UVC A;  5HNF A;  3RDI A;  1Z91 A;  4ZYH A;  4DBQ A;  2GAU A;  3HTU A;  3I64 A;  4L0Y B;  1WH5 A;  2Z16 A;  2W82 A;  1P4W A;  3ZMT A;  2HPI A;  4DW6 A;  1ETK A;  3KYL A;  1TT0 A;  3WTY C;  1K78 A;  3LAJ A;  4BEH B;  5L3B A;  4FT8 A;  3NEU A;  3U21 A;  1OQY A;  1H89 C;  2HXO A;  2XF6 A;  2GXG A;  2HXI A;  1E3H A;  2MC4 A;  4XRF A;  4D7N A;  2VOD A;  3GTP J;  4XQF A;  4EV0 A;  3GTK J;  4HBL A;  5E3O A;  4B48 A;  1IZ1 A;  5J8F A;  2R5Z B;  2IGK A;  4G8X A;  3S1R J;  1J2X A;  1YW7 A;  4M3B A;  2E5Z A;  5KHD A;  4L0Z B;  2R92 J;  1MMA A;  2FRH A;  4LLG F;  2DT7 B;  4CYD A;  1WJD A;  2E7X A;  2OA4 A;  1D0Y A;  5HLG A;  2OZU A;  2ZXH A;  2XUB A;  1S3J A;  1AA7 A;  2JRT A;  3IUO A;  4BH9 A;  5GP9 A;  4KIT B;  2M9H A;  4NUB A;  3PIP F;  4GFB A;  2WBM A;  2V79 A;  1SFE A;  1JGG A;  2BV6 A;  4ZYD A;  1W36 C;  3KEQ A;  2X85 A;  4F52 A;  3HKZ N;  3V4G A;  4UUV A;  3OYF A;  3I55 I;  4XLA A;  2WA0 A;  5DS9 A;  4B43 A;  1UMQ A;  3DKY A;  1OJL A;  2FBI A;  4PJL A;  1ORK A;  1ETY A;  2Y9Z A;  4LOC A;  2GZW A;  3E6M A;  2X0L A;  1ZTR A;  3RTR A;  3A01 B;  4U0Y A;  2K9M A;  3BJO A;  1Q1H A;  5FRN A;  1X2N A;  2COM A;  3F8B A;  1MSE C;  1JKO C;  2DTZ A;  1WPK A;  2KIS A;  3D5L A;  4LGW A;  4AVP A;  3WTS C;  3Q0W A;  4E7J A;  3OL3 A;  3I9V 2;  3TL4 X;  4M74 A;  1ZH5 A;  4HLY A;  2HKO A;  3K1P A;  4HPQ A;  3BTJ A;  2IT0 A;  1Z0X A;  1HSJ A;  4IO9 F;  2F4M B;  3WTU C;  3FIW A;  2OBP A;  1UG0 A;  4ZYE A;  1BBY A;  3BTI A;  2E2I J;  3NAR A;  1WSU A;  3HC7 A;  4UUS B;  1FJL A;  5FRM A;  1FWZ A;  3U9G A;  1VQ6 I;  3KP5 A;  1FPQ A;  1Y8Q B;  2W1O A;  2EIL H;  1FP1 D;  1FBU A;  2VQL A;  2PMU A;  2VE9 A;  4E70 A;  1IN6 A;  1S7E A;  1HDP A;  1MBK A;  2OJE D;  5E20 A;  1AOY A;  3S32 A;  2QSF X;  2OTJ I;  1TTY A;  4HDU A;  4LK0 F;  4HF1 A;  2MD5 A;  2NYX A;  4PFP A;  2KIF A;  2UXX A;  3KLN A;  1DU6 A;  3D0S A;  5TGT A;  2QSH X;  1LFP A;  1XDU A;  2MGQ A;  5F0H A;  5FGM A;  3ECO A;  2XDV A;  4NBQ A;  4LMY A;  2JPC A;  3GME A;  4HNU A;  5A2Q Z;  3CLO A;  1QZE A;  5ILV A;  2P6T A;  3MQ0 A;  4AID A;  2OPT A;  5AIP A;  1D0Z A;  3V8K A;  3K1M A;  3ZQF A;  5J3L A;  3K10 A;  3MD2 A;  5JHU A;  2E7W A;  2BY3 A;  2VJ4 A;  3IAM 2;  5HOD A;  3J80 Z;  5FKK A;  5CKT A;  5GPA A;  3IWZ A;  2A05 A;  2KRC A;  3ISP A;  3GVA A;  4RS8 A;  3OR1 C;  2IAI A;  4V19 K;  2HU9 A;  4IXA A;  2V6E A;  5EGO A;  3NWT A;  4O5V A;  2LP0 A;  2BW3 B;  3E1S A;  4ZYG A;  5DM6 F;  2ZSH B;  1V4R A;  2KL4 A;  3PUB A;  1EV7 A;  1AKH A;  1VQ7 I;  3GF2 A;  5DYM A;  2H6B A;  3EUK L;  5D6F A;  4XL9 A;  1Q1V A;  1MKM A;  3CMA I;  1IG7 A;  3HSF A;  1R22 A;  3KCC A;  2LDU A;  3V7R A;  3TED A;  3LA7 A;  4WXD A;  1WI3 A;  4ZDP A;  2HOS A;  2XAF A;  1SAX A;  4A3E J;  3W6K B;  3VOD A;  1GXP A;  3M9A A;  3SFZ A;  4XIC A;  4UVB A;  2LD5 A;  4E7L A;  5EEH A;  4J01 A;  3DBH B;  4D5F A;  2RAE A;  4KN7 X;  2KIQ A;  2DCE A;  2MLG A;  3FHZ A;  3A0H C;  1ONV A;  4ABZ A;  3DXJ F;  3GX4 X;  1ZRD A;  2LC2 A;  2WWY A;  3F8C A;  3DLL F;  2DDA A;  3GCM A;  2XPW A;  3LQR A;  1JJ8 C;  1WHU A;  1UHM A;  4BDZ A;  5EYR A;  1G59 A;  4BXX J;  4TV7 A;  2Q8K A;  2Y2Z A;  4YEJ A;  2JQ7 A;  1T98 A;  1WQ2 A;  3IC7 A;  4WF2 A;  3LWF A;  1VQ4 I;  3FXM A;  2DT6 A;  3CZ6 A;  3OV8 A;  2Q2E B;  2X6X A;  3M1C A;  4MQ9 F;  2UUZ A;  5CQG A;  2LRE A;  1FC3 A;  4II3 A;  2RN7 A;  4U0W A;  4AIK A;  1XG1 A;  3KZI C;  3NWS A;  3TO6 A;  3MKY B;  3KEO A;  2NS7 A;  3OYH A;  1E2X A;  3KE2 A;  4MNU A;  3AG2 H;  3A01 A;  3FF5 A;  5LGN A;  2VIX A;  1S8N A;  3L2C A;  1RUN A;  1KQ0 A;  2QKL B;  3Q5F A;  3B6A A;  2HYJ A;  4W97 A;  3F3X A;  1SVM A;  4D5C A;  1MH3 A;  4AYB A;  3V7C A;  4A3I J;  3PNV A;  2FE3 A;  1Z21 A;  1TQM A;  3WGH A;  1R00 A;  4IVN A;  1WGX A;  2BEO A;  4Y33 A;  2XAJ A;  4II2 A;  4UUS A;  1RES A;  4N9I A;  4YFK F;  2DMT A;  4PSW A;  3OYL A;  4H0E A;  1SFO J;  5GAG J;  2RDP A;  1TC3 C;  2F6C A;  2FXA A;  1UHS A;  3F6V A;  4C30 A;  4JYK A;  2HVQ A;  2H27 A;  1KQ8 A;  3L09 A;  5LLQ A;  2YU9 J;  2EFQ A;  3ABT A;  3GLL A;  5LGU A;  3HPG A;  3LSJ A;  2WY8 Q;  3L2W A;  3OYG A;  2TCT A;  1XB4 A;  1IXR C;  3HOW J;  2K9Q A;  2DA4 A;  3UNG C;  2O5R A;  3K70 C;  3I0T A;  2O7O A;  2VBW A;  2OAZ A;  2NOG A;  1JGS A;  5IOZ A;  3NAU A;  2R0Q C;  1QPM A;  4W1U A;  2F5D A;  4RGR A;  4NB5 A;  5IT9 Z;  2R7D A;  2NRA C;  3R6S A;  3FXL A;  3PFY A;  4GGG A;  4DYR A;  1G3W A;  1IXC A;  2NVT J;  4GYI A;  3ZQ7 A;  2Y0S A;  1XSD A;  3S17 J;  3C2B A;  1OLT A;  1YIJ I;  5FD6 A;  3LSR A;  3HXL A;  2G7U A;  2KIM A;  2PEX A;  2H1K A;  3RIR A;  2JWT A;  1Y39 A;  4MHG A;  1VZ0 A;  3K4M A;  2XAS A;  2XPU A;  3B6C A;  4F7Z A;  3V7S A;  2G9W A;  3U1K A;  1W36 D;  3M3Y J;  1FYK A;  2E1O A;  2K86 A;  5B1A H;  1S72 I;  2WB1 N;  4G94 A;  4A3M J;  4HOB A;  3HZJ A;  2Y9Y A;  3ZN1 A;  2BW3 A;  4CCK A;  2VON A;  4KUM A;  1Z67 A;  3CUQ A;  2M87 A;  4BXF A;  4A12 A;  3P9I A;  1GLN A;  2FQ4 A;  3ERE D;  1XCB A;  2AO9 A;  4Z6Y A;  1BM9 A;  1L0O C;  4EVI A;  3KP7 A;  3OYE A;  1U0J A;  4ESF A;  4IX7 A;  2OTL I;  2BZT A;  2NVX J;  2HYG D;  1B1B A;  3S8P A;  1HW1 A;  1KZH A;  4XRS G;  2CUE A;  5E1Z B;  2DA3 A;  3PM1 A;  4Y3O A;  1I1G A;  2A6H F;  5CJ9 A;  2O03 A;  4G7O F;  2K85 A;  2GM4 A;  1SD4 A;  1RC9 A;  1R5G A;  2XVC A;  3AL0 C;  4YEL A;  3KX2 A;  2LMD A;  5B3S H;  2PJR A;  5JHF A;  4HW0 A;  2Z3Y A;  5BS6 A;  3QP6 A;  5TJJ A;  4BHP A;  4IRI A;  4GO1 A;  3MEX A;  2A3S A;  3ZQG A;  1E17 A;  1IJW C;  2E34 A;  1OR7 A;  2H8R A;  1R5I D;  1IV6 A;  2X1C A;  5BPD A;  3A03 A;  4M3D A;  3FX3 A;  4XLH A;  4XLE A;  1T56 A;  4L9V A;  2QF7 A;  3E6C C;  3T8R A;  1YE9 A;  3HPH A;  4OIO F;  4UVA A;  1BR1 A;  2VAS A;  4KIB A;  5ILS A;  4QLC U;  3WTX C;  2YS9 A;  2Z99 A;  3FXJ A;  4FX4 A;  2Q2E A;  3PL8 A;  2IJL A;  1ZGJ A;  3LMM A;  2W48 A;  5BMZ A;  3LA2 A;  4P96 A;  3ABK H;  2R7W A;  1RNL A;  3P5J A;  3GXO A;  1OCC H;  4ESJ A;  5KAF C;  3OYM A;  1F43 A;  3LL7 A;  2XKO A;  2AQF A;  1W7P D;  2AQE A;  5E79 C;  2M8E A;  2LTP A;  2VJJ A;  1X1P A;  4ZZL A;  1F1Z A;  3W6V A;  5J4V A;  2VPR A;  3GW2 A;  2L54 A;  1YI2 I;  1P7J A;  2XC7 A;  2NVY J;  2DA5 A;  4HDV A;  1DDN A;  1SD5 A;  3OYB A;  2HGC A;  2M0M A;  4A5M A;  4A0Z A;  1B8I A;  2FJ1 A;  5FKN A;  2ZJP F;  1VFC A;  4EEF G;  2M5W A;  3JRF A;  3N4M A;  1BOB A;  1U5T B;  1PYV A;  3MCZ A;  1IC8 A;  4RB0 A;  4EM0 B;  4O6J A;  3HBL A;  3ZP5 A;  2NOJ B;  2XGE A;  2QUF A;  5CYV A;  2DPD A;  4BJT A;  4UV8 A;  4A3J J;  2LR8 A;  2B0L A;  1FMV A;  3T8T A;  3BDD A;  2DOA A;  2MW8 A;  2NVQ J;  5IP6 A;  2NXN B;  4OMZ A;  2JUG A;  2L3D A;  5JI6 A;  1KU9 A;  2OD5 A;  3MKZ A;  2XKP A;  2NS0 A;  1JKP C;  3FBI B;  4P55 A;  3GEZ A;  3HOV J;  1DGW Y;  1UB9 A;  1N78 A;  2R7Z J;  2KZG A;  3WG7 H;  2FQ3 A;  2ELK A;  4UNO A;  1RPW A;  5F27 A;  2E60 A;  1V5G A;  2CSO A;  3HYI A;  3RSN A;  1R1V A;  2OUM A;  4DGW B;  3I53 A;  1IN7 A;  2GWR A;  4U88 A;  4I76 A;  2JMW A;  4HAM A;  2Q0O A;  2V1N A;  1MGT A;  2JTV A;  2FNP A;  2DOD A;  1IRX A;  1ZGA A;  2CO5 A;  2JVH A;  3OOP A;  4K2E A;  1YJN I;  3JRA A;  2FMY A;  2B7E A;  2UV1 A;  4KYW A;  1OYI A;  4KT5 C;  4KIG A;  3ASO H;  4OIP F;  1HF0 A;  2BHY A;  4FX0 A;  1ZRF A;  3BG7 A;  4RBO A;  5DM7 F;  2CV0 A;  1LEB A;  3VSL A;  2FUG 2;  5J6X A;  5ICC A;  2DA2 A;  3OIP A;  2DAO A;  2K9S A;  1JUM A;  2M7B A;  5EEA A;  2Z33 A;  4EJV A;  4M9X A;  3I59 B;  2JT1 A;  2KQR A;  2NAZ A;  4A0Y A;  2DQL A;  1D1A A;  3GZ6 A;  1H9G A;  2IGN A;  4D7M A;  3WOD F;  2A5Y B;  3S2W A;  4Q5S F;  2VC0 A;  3C1D A;  1I6H J;  4BAC A;  3I4N J;  1MJ9 A;  1VQM I;  2L4M A;  2AXT C;  4LIU A;  1Y0N A;  3WHC A;  5JR3 A;  1BC8 C;  2E1N A;  2DMQ A;  3G6E I;  2IS1 A;  1OPC A;  2VI6 A;  2K3F A;  3JRG A;  3KIO A;  1TBX A; 
#chains in the Genus database with same CATH homology
 1QRY A;  1TWG J;  3SFI A;  4B4C A;  1IDY A;  5GP9 A;  2R5Z A;  2M9H A;  4GFB A;  1BA5 A;  1JGG A;  2EBI A;  3I4M J;  5GPC A;  4A93 J;  2L9R A;  1K61 A;  2HOA A;  3MKL A;  1WH7 A;  3HKZ N;  4JX6 A;  3OSG A;  1ZR2 A;  5DS9 A;  1UMQ A;  1OJL A;  3S14 J;  1ORK A;  1ETY A;  2Y9Z A;  4LOC A;  1ZTR A;  4JX4 A;  3A01 B;  1FIA A;  3RQI A;  3O8G A;  1X2N A;  3HDD A;  5F1J A;  1POG A;  1MSE C;  1Y1W J;  1JKO C;  2DTZ A;  1ZQ3 P;  3Q0V A;  1WPK A;  4A3D J;  4X6A J;  3Q0W A;  4I6Z A;  1GVD A;  3S1M J;  2FD5 A;  5F04 A;  3BTJ A;  2XPV A;  4C3I J;  1Z0X A;  4DYQ A;  2LFB A;  3CDL A;  3FIW A;  1TWF J;  2I10 A;  2KT0 A;  1SAN A;  3QPS A;  4C3H J;  2E2I J;  3BTI A;  3NAR A;  5F0C A;  4UUS B;  1FJL A;  2GBY A;  2XB0 X;  2XRL A;  1ENH A;  5C4X J;  3S2H J;  2ZB9 A;  5IYB J;  3HM5 A;  5K7H A;  2R5Y A;  3GTO J;  5J1R A;  1W0T A;  2GLO A;  1TWH J;  3OOU A;  2JN6 A;  1S7E A;  2CJJ A;  3DCF A;  4M6V A;  1JJ6 C;  1HDP A;  1MBK A;  3RZD J;  3JRH A;  1U78 A;  1DU6 A;  1CQT A;  3IH2 A;  2MGQ A;  5F0H A;  1DU0 A;  2LKX A;  2E19 A;  2L0K A;  2ME0 A;  4IHV A;  4MFD A;  1ETV A;  1GDT A;  1T33 A;  3JRD A;  4RDU A;  2OPT A;  3GTM J;  5M5Y J;  3ZQF A;  5J3L A;  5EG0 A;  5DTD A;  1ZGW A;  2N8G A;  3TW6 A;  3BR1 A;  1H8A C;  1HLV A;  3JRB A;  3BR5 A;  3TP0 A;  2LLK A;  5HOD A;  5FKK A;  4FTH A;  1U8B A;  2M0C A;  5GPA A;  3S16 J;  2IAI A;  5EGO A;  2LP0 A;  1NK3 P;  2EZH A;  3VPR A;  3HOX J;  4Y52 J;  1AKH A;  1MBJ A;  3Q0U A;  1B72 A;  2VUM J;  2NS8 A;  3FKI J;  1Q1V A;  1IG7 A;  4MO7 A;  4M3F A;  3TED A;  1WI3 A;  2HOS A;  3JRE A;  1LE8 B;  4L5E A;  4IHY A;  4A3E J;  1VF9 A;  1NK2 P;  4XIC A;  1GV5 A;  2LD5 A;  1HDD C;  3H3V K;  1ETO A;  1MBF A;  4D5F A;  2RAE A;  3S1N J;  1ETW A;  4ABZ A;  2L7M P;  3GTL J;  1LE8 A;  4IEJ A;  1LFB A;  2QCO A;  1XC5 A;  2XPW A;  1JJ8 C;  3HEF A;  1H88 C;  2EZL A;  5EYR A;  5FLV A;  2XGD A;  4G12 A;  4BXX J;  3BR3 A;  3G1M A;  3UKG A;  5M5W J;  2TRT A;  2O9L A;  2Y2Z A;  2JK3 A;  3LSP A;  1RKW A;  1PUF B;  1JTY A;  2LK2 A;  1APL C;  5IPA A;  3CCY A;  1GUU A;  1QVT A;  2IBD A;  3PO3 J;  2X6O A;  1XG1 A;  1ZK8 A;  3IH3 A;  1HOM A;  2NS7 A;  1MBE A;  3BG9 A;  4C2M J;  1XS9 A;  3A01 A;  2K9N A;  2EH3 A;  2KDZ A;  4A3L J;  1X58 A;  4DZJ A;  3B6A A;  2HYJ A;  4W97 A;  2X9D A;  2ME6 A;  5K7Z A;  3S15 J;  4D5C A;  1MH3 A;  2DMU A;  4DZP A;  2HI3 A;  4A3I J;  1LFU P;  5J1U A;  2R93 J;  1JTX A;  2OF7 A;  3ZQH A;  1QVU A;  4XID A;  4FCY A;  2JA8 J;  5EZG A;  3RKQ A;  4FE7 A;  2ID3 A;  1WGX A;  3OIO A;  4AC0 A;  4MFE A;  4UUS A;  1RES A;  2VKV A;  1ZR4 A;  4JX5 A;  2DMT A;  1TWC J;  1JT6 A;  3HOY J;  3F0C A;  3Q3S A;  1SFO J;  2Y31 A;  1TC3 C;  1OFC X;  1UHS A;  4JYK A;  2JA5 J;  4V2G A;  2CQX A;  2Y30 A;  2M34 A;  4UUT A;  4DYC A;  2DA7 A;  3JRI A;  2YU9 J;  5FKL A;  3LSJ A;  5K7F A;  2M8G X;  2D5V A;  1VI0 A;  9ANT A;  2TCT A;  2JA7 J;  3HOW J;  5IOY A;  2K9Q A;  2DA4 A;  1FTT A;  5EZH A;  2DN0 A;  2IEK A;  2O7O A;  5BNG A;  5IP9 J;  2NOG A;  3IV5 A;  5IOZ A;  2CRG A;  3NAU A;  3G1L A;  4W1U A;  3BG3 A;  4FE4 A;  2R0Q C;  2MG4 A;  5FKM A;  3LNQ A;  1JKR C;  1UG2 A;  1R9T J;  5JLX A;  4DYR A;  1AU7 A;  3SDG A;  2NVT J;  4J19 A;  3S17 J;  2MSY A;  3C2B A;  1BL0 A;  2ECB A;  3LSG A;  3LSR A;  1O4X A;  3BR6 A;  4M3E A;  2H1K A;  1BW5 A;  2XB5 A;  4M3G A;  4CYC B;  1JKQ C;  4XRM A;  2JWT A;  3GTJ J;  1W0U A;  3K7A J;  2XPU A;  3MN2 A;  3CQZ J;  3B6C A;  5IP7 J;  3CMY A;  1JUP A;  3QPL A;  2E1O A;  1BJZ A;  4BKX A;  3M3Y J;  1U9N A;  3ZQI A;  2WB1 N;  3GTQ J;  4A3M J;  1HCR A;  4AUX A;  5M3F J;  1Z77 A;  2K40 A;  2Y9Y A;  1GT0 C;  3RZO J;  1A6I A;  4CYC A;  3E7L A;  1FTZ A;  3TW7 A;  1RET A;  3H0G J;  2CQQ A;  1ZKG A;  1FEX A;  2FQ4 A;  3BQY A;  2AO9 A;  2VKE A;  2P81 A;  2ECC A;  1Y1V J;  1VND A;  2NVX J;  4JP0 A;  4QIW N;  4XRS G;  5F08 A;  5E3M A;  2CUE A;  5FKO A;  3GTG J;  2DA3 A;  2DMP A;  1K83 J;  3PM1 A;  2FX0 A;  1EF4 A;  2GM4 A;  2HOT A;  1OCT C;  1I3Q J;  5FJ8 J;  1U9O A;  4BBR J;  2CUF A;  4B3A A;  3HOZ J;  2DJN A;  5F0F A;  5M5X J;  4BBS J;  5E3N A;  1MBH A;  4V2F A;  4A3F J;  1MH4 A;  3BR2 A;  3ZQG A;  5IYC J;  1IJW C;  2DA6 A;  2H8R A;  1IV6 A;  1X2M A;  4BY7 J;  3A03 A;  4M3D A;  2EZK A;  5EDN A;  1IRZ A;  1A5J A;  1T56 A;  2G0E A;  2QF7 A;  3BTL A;  4IHW A;  1PUF A;  2DA1 A;  4MIM A;  5FLM J;  3HGY A;  2JJ7 A;  4HNV A;  2YS9 A;  4XRS A;  4A69 C;  3S2D J;  2ID6 A;  2W48 A;  2HQ5 A;  1F43 A;  4QTR A;  1AHD P;  3JR9 A;  1B8I B;  1ETX A;  3BT9 A;  2LTP A;  5C44 J;  1IGN A;  2E2H J;  2XSD C;  3W6V A;  3HB9 A;  2YUS A;  2VPR A;  2R5Y B;  5C4J J;  2LVS A;  3G1O A;  1P7J A;  2NVY J;  1MNM C;  2DA5 A;  3HGG A;  3MVP A;  3OSF A;  4A3G J;  3HOU J;  3FK6 A;  5EF6 A;  3M4O J;  5E3L A;  3QQA A;  1B8I A;  2FJ1 A;  1JUS A;  5FKN A;  3SJM A;  1YRN B;  1VFC A;  4EEF G;  3LOC A;  3ZOB A;  3JRF A;  1IC8 A;  5C3E J;  3IH4 A;  2L7Z A;  3GBG A;  3HBL A;  1QPI A;  3BR0 A;  2XGE A;  1I50 J;  1GV2 A;  4S0H B;  4C3J J;  4A3J J;  5IYD J;  2LR8 A;  2LY9 A;  1IUF A;  1OCP A;  4IHX A;  2MW8 A;  2NVQ J;  4FIS A;  1TWA J;  2WV1 A;  1YRN A;  5IP6 A;  1ETQ A;  4Y7N J;  4A3C J;  2E2J J;  2XGC A;  4AYB N;  1RR7 A;  2X48 A;  1ITY A;  3S1Q J;  1JKP C;  3ZQL A;  5EG0 B;  3HOV J;  3ZQC A;  2L7F P;  5M3M J;  2R7Z J;  2ELK A;  2AHQ A;  3K2A A;  4BY1 J;  1RPW A;  5F27 A;  4A3B J;  5EGO B;  2CU7 A;  1NTC A;  3FK7 A;  1D5Y A;  4I76 A;  2EZI A;  2JMW A;  3WHB A;  1MSF C;  1P7I A;  1AKH B;  2O8K A;  3PO2 J;  1MBG A;  2M2E A;  3FIS A;  4A3K J;  1B72 B;  3JRA A;  3BTC A;  4XK4 A;  3D1N I;  1WH5 A;  4QSH A;  1RKT A;  1JT0 A;  1HF0 A;  4X1E A;  1FIP A;  2WAQ N;  2HDD A;  4DW6 A;  4RBO A;  1ETK A;  4B1R A;  2COB A;  2DA2 A;  4NDL A;  5JLW A;  3DEW A;  2K9S A;  3JRC A;  1JUM A;  5EEA A;  1G2H A;  1H89 C;  2HXO A;  2HXI A;  2PMZ N;  4D7M A;  2Y0S N;  4MLO A;  4D7N A;  1IDZ A;  3GTP J;  5J1Y A;  3GTK J;  2JA6 J;  3A02 A;  3O8H A;  3BQZ A;  5E3O A;  3I4N J;  1I6H J;  2EQR A;  2R5Z B;  3S1R J;  4M3B A;  3TP3 A;  1F36 A;  2R92 J;  3WHC A;  2DMN A;  1WCM J;  2DMQ A;  1E3O C;  2B63 J;  2VI6 A;  3BG5 A;  1BW6 A;  3JRG A;  3L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...