1ETQA

The crystal structure of e. coli fis mutant r71y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
85
Chain Sequence
VLTVSTVNSQVTQKPLRDSVKQALKNYFAQLQDVNDLYELVLAEVEQPLLDMVMQYTYGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
total genus 26
structure length 85
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etqA00
2XB5A 3I4MJ 2XPVA 3E7LA 5K7HA 1W0TA 2FJ1A 2EZKA 3HOUJ 4V2GA 2K40A 1X58A 1E3OC 3S1RJ 3GTLJ 5M5WJ 4FE4A 4M3EA 5EGOB 2JA5J 1OCPA 2O9LA 2IEKA 1JKOC 1MBKA 1ORKA 1MBGA 3ZOBA 1QVUA 3ZQIA 5EF6A 2VPRA 3C2BA 3FK6A 4QSHA 1JUSA 3TEDA 2Y2ZA 2R5YB 1K61A 3JR9A 4M3BA 3IH2A 1MBFA 1S7EA 5E3LA 2DMUA 3BQYA 1AKHA 2LK2A 4BBSJ 3ZQLA 1TWFJ 4QIWN 1UG2A 1BA5A 2LKXA 1GVDA 4DYCA 3GTMJ 1G2HA 3LSRA 5M3FJ 3JRHA 3Q0VA 4CYCB 2HOAA 2E2HJ 1D5YA 1FTZA 4IHYA 1HCRA 1LFUP 2VI6A 5C44J 1ENHA 2ELKA 1WCMJ 4JX6A 1AHDP 1IUFA 5DTDA 4I76A 4X6AJ 3DEWA 2H1KA 3S2DJ 5J3LA 3BG9A 2NS8A 3K2AA 1Z77A 3O8HA 4XRSA 4FISA 2DMPA 4W1UA 5E3MA 4A3EJ 2XGEA 5F04A 3BR0A 4DYQA 4Y7NJ 3B6CA 2DMNA 2HOTA 3CMYA 3HGYA 1NK3P 4QTRA 5FKLA 2EQRA 2EBIA 1ZTRA 2MG4A 3F0CA 2Y31A 2LY9A 4BXXJ 3MKLA 1VFCA 3JRGA 2DA2A 2QCOA 3GTPJ 3OSFA 2COBA 1RKTA 2LTPA 1AU7A 2X6OA 1H8AC 1RPWA 1PUFB 4CYCA 3RZDJ 4DW6A 3NARA 1O4XA 3BQZA 5GP9A 1Q1VA 2FQ4A 1ETXA 1MBJA 2R92J 2P81A 1RKWA 1IDZA 4MFDA 2OPTA 3B6AA 4IHXA 3A03A 4XRSG 1YRNB 1ETWA 4BY1J 2DTZA 3BR6A 4XIDA 2LVSA 3QPLA 5F0CA 2JA8J 3BG3A 1SFOJ 2DA4A 3GTJJ 3HOYJ 1OCTC 4ABZA 5F0HA 1IGNA 1GV5A 5JLXA 4MFEA 4J19A 3GTQJ 2WAQN 2PMZN 3HDDA 3JRAA 2DA3A 1ETVA 2CQQA 1RR7A 1GV2A 3NAUA 2TRTA 5F27A 5F1JA 4FCYA 5EGOA 3WHBA 2HXIA 3BR5A 5EG0B 1TWCJ 1XG1A 2CUFA 1DU6A 1ZQ3P 1TWAJ 2L9RA 3BR2A 1Y1VJ 2XPWA 2JK3A 5GPAA 3HOVJ 1B8IB 5C4XJ 4JYKA 2AO9A 1QRYA 5FKMA 1MBEA 5K7ZA 4X1EA 3OSGA 1JKQC 2XGDA 4FE7A 5IP6A 1R9TJ 4B4CA 3WHCA 1LE8B 2M2EA 1SANA 1TC3C 1FJLA 2M34A 5J1YA 1POGA 4A3BJ 2O7OA 3A02A 4JX5A 4Y52J 1P7IA 3JRDA 1JUPA 1OFCX 3BTCA 2E1OA 2Y0SN 1FTTA 3S2HJ 1I50J 1HLVA 4C2MJ 3RZOJ 1WGXA 1U9NA 5FKKA 1F36A 2JJ7A 3TP0A 4S0HB 2GM4A 2I10A 5EEAA 3LOCA 4IEJA 1BL0A 3L1PA 2HXOA 3SFIA 4V2FA 2JN6A 2R5ZB 2NOGA 4MO7A 4GFBA 4A3KJ 4MIMA 1BJZA 2LR8A 2L7FP 2EZHA 5EYRA 4DYRA 1MSEC 1H89C 4XRMA 2TCTA 1RETA 4JP0A 1QVTA 1JTXA 4M3DA 2IAIA 1F43A 4RDUA 4IHWA 2ECBA 3JRBA 3TW6A 2R93J 3HOWJ 3DCFA 2L7MP 1T56A 2HI3A 2ZB9A 3HEFA 4AYBN 4A3FJ 1JUMA 1UMQA 2EZLA 3S1QJ 3PM1A 3HKZN 3RQIA 3ZQFA 5GPCA 2B63J 3MN2A 1QPIA 3O8GA 4C3JJ 1VF9A 3TP3A 2ME0A 2KDZA 3D1NI 2NVYJ 5C4JJ 1ETQA 4D7NA 4RBOA 5F0FA 2OF7A 3IV5A 3FKIJ 2H8RA 4B1RA 4D5CA 2QF7A 5IP7J 3LNQA 1GDTA 4AC0A 1BW6A 1ZR2A 1NTCA 2NS7A 1WI3A 3Q0WA 3IH3A 3JREA 4A3DJ 2LP0A 1B72A 5DS9A 3I4NJ 2JMWA 3HGGA 2HQ5A 2JWTA 5M5XJ 5IOZA 2K9NA 1B8IA 5BNGA 1NK2P 1JTYA 4NDLA 4LOCA 2MW8A 3JRIA 3RKQA 3SDGA 1T33A 3S14J 2Y9ZA 3CQZJ 2ID6A 4UUTA 2CU7A 1ETOA 4BBRJ 2R0QC 2X48A 1BW5A 1ZKGA 2N8GA 2W48A 5C3EJ 3ZQCA 2Y9YA 5EZHA 5IYBJ 1Z0XA 2D5VA 2CQXA 2E19A 2CRGA 9ANTA 2NVTJ 2HYJA 1APLC 2M9HA 4XICA 2LFBA 2NVXJ 3HM5A 3SJMA 3FIWA 1ZGWA 1JKPC 1PUFA 1IRZA 1K83J 4XK4A 1JJ8C 1X2MA 4BY7J 3Q0UA 4UUSA 2AHQA 3S17J 4A3LJ 1UHSA 5IYCJ 5FLMJ 5IP9J 4M6VA 3ZQGA 2IBDA 5IOYA 2XGCA 1VI0A 1CQTA 3OIOA 3BT9A 4AUXA 2LLKA 1U8BA 1IC8A 1HOMA 1JKRC 2YU9J 5F08A 1LFBA 2MGQA 1IG7A 3BTLA 1JJ6C 2EH3A 1U78A 3G1LA 3GBGA 2GLOA 3BTJA 3S1MJ 1XS9A 2VKVA 1I3QJ 2DA5A 2ECCA 4G12A 1Y1WJ 4BKXA 2FX0A 1JGGA 1WPKA 1ZK8A 3HBLA 2L7ZA 2JA6J 2ID3A 1MSFC 3QPSA 2XPUA 3BG5A 5E3OA 1A6IA 2KT0A 2YS9A 1DU0A 4A69C 4HNVA 1VNDA 1P7JA 3JRFA 2HOSA 4MLOA 2O8KA 1FIPA 2XB0X 3GTOJ 2XRLA 5EZGA 3FISA 2LD5A 4A3IJ 4I6ZA 1W0UA 4UUSB 3H3VK 5IYDJ 1GT0C 1WH5A 3CCYA 1OJLA 4A3CJ 2WV1A 2Y30A 2HDDA 3S15J 2WB1N 2FD5A 3ZQHA 3G1OA 3BTIA 5JLWA 1U9OA 1MH3A 2M0CA 2YUSA 1X2NA 3PO3J 5E3NA 2DA7A 5IPAA 2CJJA 4A3GJ 1TWHJ 1YRNA 4C3HJ 1HDDC 1ETYA 4JX4A 5M5YJ 5FLVA 2G0EA 2CUEA 4L5EA 2DJNA 5J1RA 1H88C 1IDYA 4A3JJ 3OOUA 3LSGA 2DMTA 1MNMC 3MVPA 3FK7A 3A01B 3GTKJ 4W97A 4EEFG 2M8GX 2E2IJ 3IH4A 1A5JA 5EDNA 5FKNA 4A93J 1TWGJ 1B72B 3HOXJ 2NVQJ 4IHVA 3GTGJ 1I6HJ 4D5FA 1XC5A 3HOZJ 3JRCA 1JT6A 3S1NJ 3LSPA 1ZR4A 3CDLA 5FKOA 1HDPA 4A3MJ 2L0KA 3UKGA 1MH4A 1ETKA 2MSYA 5M3MJ 2E2JJ 3LSJA 2K9QA 2VUMJ 2GBYA 5K7FA 4DZPA 3A01A 5J1UA 5FJ8J 1IV6A 2VKEA 1WH7A 4DZJA 2DN0A 3HB9A 1FIAA 3TW7A 1JT0A 3BR1A 3PO2J 1ITYA 4B3AA 3K7AJ 2RAEA 3M4OJ 2R5ZA 3W6VA 3QQAA 5HODA 2K9SA 2X9DA 3M3YJ 2EZIA 5EG0A 4C3IJ 4M3FA 2ME6A 1IJWC 1FEXA 1AKHB 2DA1A 2DMQA 3H0GJ 3G1MA 1HF0A 2JA7J 1LE8A 3VPRA 1MBHA 2R7ZJ 1RESA 3Q3SA 3BR3A 2R5YA 3S16J 1GUUA 4M3GA 1EF4A 2DA6A 4D7MA 2XSDC 4FTHA
chains in the Genus database with same CATH superfamily
3I4MJ 1SD7A 3L2WA 1Y0UA 2EZKA 5E17F 1HKQA 4LG0A 2BHYA 2AQEA 2NXNB 1Z7LA 4OWRB 1XSXA 3P9CA 1E3OC 4FE4A 2XSJC 4CO8A 2R7DA 2O9LA 1TP4A 2Z33A 3LSIA 1J7KA 3HHGA 4G94A 3U2RA 2Z5UA 5EF6A 1X4PA 3C2BA 1SFUA 2P5LC 2R5YB 4U7BA 4E7KA 3B02A 3CCUI 4BJ5C 4RLQA 4P96A 3WU0A 3ERMA 4EJUA 2WAEA 4RLFA 2VL8A 3CDHA 3BQYA 3KP7A 2LK2A 2ZFUA 4PCQA 4ZYHA 1S29A 2GIZA 3DTEA 3E3VA 2KFDA 1YJ9I 1UG2A 3R6SA 2Z3YA 3PFIA 1D1CA 3E6CC 2CV1A 2RVCA 2LKXA 2EIKH 1GVDA 3SZTA 2XRNA 2PQ8A 2FBKA 1JXSA 3JRHA 2E2HJ 4KA4A 1D5YA 2VC1A 1HCRA 2A05A 1ONVA 4G8XA 1G59A 2DOFA 1V5FA 2L9VA 3FZVA 3GLXA 4E7LA 5LGTA 1FOKA 5DTDA 5FFXA 2UUZA 4I76A 1IXCA 3R61A 4U0YA 1XMKA 3DV8A 3QYEA 1HW5A 3G4SI 5J4VA 3PIPF 1AWCA 4WX9A 4FASD 3SZPA 4FISA 2LC2A 2XGEA 3D0SA 3BR0A 3FXJA 1LKXA 5ICGA 1VQKI 4ZTFA 2HOTA 2W1OA 1NK3P 3OYEA 3KLOA 3DTIA 1WJAA 1F1ZA 3F0CA 4BXXJ 3I0TA 2CW7A 2DA2A 2VC0A 2W85A 1P4XA 2X6WA 2LTPA 2E1MC 2BW3B 1ZARA 2MYSA 1FX7A 5DYMA 2KHMA 2O3FA 4BAYA 1RPWA 1TNTA 4EGZA 5LGUA 1PUFB 1X19A 2OAZA 3RZDJ 4XSZF 2ZMEB 5HLHA 1O4XA 3FMRA 4K2EA 5GP9A 2FQ4A 4PFOA 2RQQA 1MW7A 3V4GA 1IDZA 1PP8F 1BOAA 2FUG2 3F8BA 1YTYA 5BS6A 2DTZA 3BR6A 3GZ6A 2EFPA 4HV5A 1B4AA 1MMGA 4G6QA 5L3CA 2P7CB 3QPLA 3K70D 2JPCA 1SFOJ 3PQJA 4YELA 3GTJJ 4G7OF 4HDUA 1OCTC 4ABZA 2VBWA 5F0HA 2XASA 3K4LA 2PMZN 2VJ4A 2RC4A 3JRAA 2CW0F 3PFYA 4NB5A 3L7WA 4RGUA 3S3OA 2TRTA 1T95A 4YFKF 4F3QA 1K6OA 4XN0A 3RJPA 2K4BA 1BR4A 1XSVA 3E5UA 2Z99A 5LHHA 4EATA 2VN2A 3PSFA 2OQGA 1DU6A 1TLHB 1TWAJ 2UZKA 1ZAOA 2DPDA 2JK3A 3HOVJ 4HQMA 4MQVA 1B8IB 2AO9A 5BPDA 2G9WA 1MBEA 3ULQB 2EPFA 3SXYA 2XGDA 1MD0A 3GEZA 2WB1A 2RKHA 4CCKA 1W7PB 2E60A 3G73A 1F4KA 4G6DA 1LE8B 3HRSA 2AS5F 3GO5A 2M4KA 5TISC 5DUKA 4KUMA 2LNBA 3AL0B 4NC6A 3A02A 2ZJ2A 4HX8A 2L4MA 2XDVA 5ILVA 1OFCX 2Y0SN 2LH9A 3HC7A 2KRCA 2EWNA 4ESBA 1VQ7I 2YX4A 1HLVA 3OYKA 1TQMA 2JRMA 2PBIA 1A35A 1HKSA 1F36A 2JJ7A 1QA6A 1VQLI 1NG7A 4HSTA 2MABA 1RRJA 3LOCA 3CLQA 1BL0A 3QOEA 3L1PA 3V8LA 2HDCA 2NOGA 4KISA 2JSPA 4D9JA 3F6OA 3DU5A 2M30A 1S72I 2F5CA 5ICFA 2WTEA 2EZHA 3M9AA 1MGTA 5EYRA 3RCOA 4DYRA 3WU1B 5LD2C 1MSEC 2JPBA 1JTXA 3K4JA 4NC7A 3KX2A 3RKWA 3KLNA 2RDPA 2ZC2A 3TW6A 1DP7P 2Z16A 1T56A 3DEUA 3L2UA 1USSA 4A3FJ 1R5HA 3ECHA 3HKZN 3ZQFA 1XMAA 1G3WA 4LLGF 2HQNA 3LFUA 1RIOH 4A12A 2KDZA 3D1NI 1LQ1A 1S7AA 1MJBA 5JHUA 2BY1A 2NRAC 1CF7A 3OV8A 2E7WA 5F0FA 2EIMH 5BMZA 4HF1A 3UR3C 1C0WA 4LG0B 5D8LB 2ZXHA 1Z67A 4H0EA 3C2HA 3CUQB 4Q5SF 2AQFA 2MBFA 2JTVA 3H5AA 4A3DJ 3CC7I 2LP0A 2XIGA 1B72A 1ZGAA 4OMYA 5DS9A 1K4SA 2H6CA 3EUHC 3OIPA 5M5XJ 3HPHA 2LKSA 5EEHA 1LDJA 2L9SA 1NK2P 3GLLA 4LOCA 1BI0A 2K3PA 3SDGA 4CUGA 2FE3A 4XQFA 1XB4A 1Y56A 3DXJF 1ETOA 1BM9A 1KU2A 2D45A 1HC8A 1NG6A 2EINH 3WGIA 2HVRA 4OIOF 3ZQCA 2Y9YA 2VXDA 3K4CA 5IYBJ 2F5DA 3DBRB 3GFIA 3VODA 5LHGA 1D3YA 4KMFA 2OCEA 2QSHX 2NVTJ 2HYJA 3D5LA 3E1SA 2NVXJ 2O03A 1Z7UA 4XK4A 4UUSA 3S17J 2H6BA 4IHTA 2IBDA 1IN6A 2VQGA 3OWTA 5IOYA 1VI0A 3BT9A 3RKXA 2KMUA 5CQEA 2X1CA 3SHFA 3CCSI 1R1VA 1JKRC 2QM3A 5JR3A 1XTAA 2EIJH 4BH9A 5F08A 1IG7A 3FXOA 4WK8F 5EEGA 3CLOA 3G1LA 1XSDA 3GYHX 3S1MJ 3BDDA 2DO7A 2XC7A 2OTLI 3C1DA 3NWTA 1ON1A 3NRVA 1K78B 4EV0A 2ZFWA 4PUSA 2PG4A 4LMYA 2ZXWH 3B73A 4G12A 3VFZA 2L7KA 2HNHA 2L7ZA 3C7JA 2ICWG 3W6KB 1O3SA 2JA6J 3ML6A 3QPSA 5LEJA 1S3JA 4BL0B 3EYIA 5DEQA 4NHJA 4I98B 1ZN2A 4ENNA 3K6GA 2KT0A 2YS9A 1IN8A 2OZ6A 2DYSH 4RB3C 1SVMA 1YS6A 1YX5A 4XKBA 1Y0NA 1YI2I 4GYIA 5DDGA 4M6XA 2KRHA 1FIPA 2XB0X 2DQRA 3GWZA 4A3IJ 3KCCA 2MLGA 2VJIA 3MEXA 1I6XA 4C2UA 4KICA 3BG6A 1WH5A 2IP2A 1GT0C 4IQJA 1XX5A 3IHUA 3LAPA 1D1BA 3G1OA 3BTIA 5CVIA 5K5RA 1FYKA 5JLWA 2V79A 2PX9A 3PIOF 1B59A 2V1DA 2XAJA 3BJ6A 3EDPA 2HS5A 3I64A 2KQRA 2BYVE 3GFJA 4A3GJ 2ZMEC 2FRHA 1R5ID 1VQ6I 4I01A 4MQ9F 1RI7A 5FO5A 4DGWB 1HDDC 5GTIC 4JX4A 3M1EA 5M5YJ 3IUOA 5HOOA 4XM3A 2G0EA 2E7XA 1YOVB 4KDPA 3SQNA 3FMQA 1MJ9A 3WTXC 1IDYA 3ABUA 1O3QA 3IAS2 3WTTC 3OL3A 4W97A 4EM0B 5JVTA 1BC8C 3V7RA 1ZG1A 4NBQA 4A93J 3ZMSA 1R71A 3MQ0A 1ODDA 3HOXJ 2NVQJ 2KZGA 2IGNA 2L5QA 2OUMA 3S2WA 1T08B 4IZZA 1MMSA 2QENA 2V9PA 2A3SA 1ZH5A 5FRNA 1WSUA 4U7DA 1Z3YA 3S1NJ 1Y6IA 1BOBA 5H6QA 5H2FC 1ZR4A 1IV8A 3OYIA 3HOSA 2DFIA 1H9GA 3OY9A 3GMEA 2E2JJ 3H5NA 2HVSA 2VUMJ 4DZPA 3A01A 5FJ8J 1WJEA 5K1YA 2DN0A 3EPZA 2XROA 3LSHA 3CCQI 3I58A 3TW7A 3PO2J 4Q4ZF 4GO1A 3AG4H 2X1DA 3K7AJ 4UV8A 4KFCA 1ITYA 1UAAA 3F8MA 1G4DA 3M4OJ 2X4HA 2PN6A 4LJZF 4ZDLA 1O7LA 1W5SA 2LRDA 5HODA 3WTWC 2K9SA 4LK1F 2ME6A 3H0DA 4IRHA 2ZCWA 3ZR8X 1AKHB 3CCMI 3VYUB 3J81Z 3H0GJ 2DDAA 2CQ7A 3BY6A 3EUAA 3IKTA 2JA7J 1V55H 1LE8A 5E1XA 1IRXA 3CZ6A 2R7ZJ 1M1EB 1RESA 2EB7A 2L2OA 3BR3A 3Q3SA 4OOIA 3AG2H 5E79C 4M3GA 5B1BH 2HDWA 2ELHA 1W5TA 4RAYA 4FTHA 2XPVA 3E7LA 2FJ1A 2HKXA 2CW8A 1IRFA 2Q2EB 4V2GA 1T38A 4D1QA 3S1RJ 2L4AA 5EGOB 1R5GA 3G6EI 1OCPA 2OTJI 2IEKA 1J5YA 2EV0A 1JKOC 2FNAA 5D6FA 3ZQIA 1SAXA 3OR2C 2IS6A 4JBAA 2JVHA 1A36A 1XDUA 3LA2A 2CG4A 4AWXB 1USTA 4LFUA 1K61A 4E6KG 1UJ8A 2ESNA 2ZJQF 2P0WA 5HLIA 5TGTA 1S7EA 5E3LA 2B9SA 1AKHA 3LWFA 1ZGJA 4HZFA 4BBSJ 3ZQLA 1TNSA 4OU0A 3ESWB 1TBXA 3OS0A 1O7FA 4HAMA 4EJWA 1W36D 1J0RA 3S3MA 1BA5A 4N4OB 2VQHA 3GTMJ 1G2HA 4HG2A 3P7NA 2KJBA 2F2EA 2ZKZA 3ROUA 2HEOA 3V7CA 4IHYA 4ASNA 1ZHFA 1LFUP 2XAUA 1VTNC 5AIQA 1EJ9A 2PLYA 4CDGA 3M7GA 2ELKA 1VQ5I 4GDFA 3CJTB 3HZJA 1GVJA 1IUFA 2NYXA 2H1KA 3DFGA 4I0BA 2COMA 2DI3A 5D5XB 2NS8A 3O8HA 4XRSA 3F23A 2M45A 3M07A 1CGPA 1YJNI 3ZPLA 2AXLA 2XKOA 4UUVA 2ACJA 5E3MA 4W1UA 4A3EJ 2IT0A 3F21A 1U0JA 1W5CC 5HS9A 5HS8A 4IXAA 1I1SA 1W7PD 2DMNA 3P9IA 1FP1D 3CMYA 1MDMB 4BJTA 1Y39A 2EBIA 2FSWA 2M1BA 4BE0A 4U0WA 1ZTRA 4F55A 2Y31A 1B1BA 3JCUC 1VFCA 2CWEA 2XAQA 2D1VA 5J4YA 1R23A 3GTPJ 1FT9A 1HQCA 2COBA 1AU7A 4DQ2A 2X6OA 5F1RA 1H8AC 2F4OB 3RPUA 4DW6A 2EA4A 3NARA 2CS3A 2QQBA 3DTKA 2GXAA 4GCVA 1ETXA 3BZ6A 2R92J 2P81A 2XUBA 4LIUA 1LUJB 4HEA2 1RKWA 3K70C 1V3FA 2MFZA 2OPTA 3L09A 3OYJA 3CCRI 1YRNB 4Z2YA 1ETWA 4BY1J 3TOBA 4CZZA 4YFXF 1W1WE 4FX4A 1FYMA 2X6XA 1PVEA 1T0FA 2DT6A 5F0CA 2JA8J 1P4AA 4HYEA 2B0LA 3HOYJ 3GZ5A 3KP4A 2E36A 1PJRA 4IOCF 2QEXI 1GV5A 5JLXA 3HKZA 3OYCA 4J19A 2WAQN 4Y4RA 1SVLA 3ONQA 1OPCA 2R7VA 2DA3A 1OR7A 2CQQA 3M8JA 2GOXB 3NAUA 2MA3A 4M9XA 2Y75A 2W24A 2VOOA 3CC4I 2IA1A 5FROA 3WHBA 4ZYGA 1VQ4I 4F7ZA 3N05A 5EG0B 2R7WA 1TWCJ 2VONA 5KAIC 2ZXIA 1Y1VJ 5J8CA 2K02A 2O8XA 2ZNYA 2ZO4A 2QKLB 3DKYA 4GGGA 3RSNA 5D5VB 2V4JC 2DQLA 3WG7H 2LMDA 2CGPA 5C4XJ 3HL2A 5FKMA 3ZMUA 3I55I 1H0MA 4LB6B 2HQAA 4YRVA 1XGSA 2F5EA 4HX4A 3MCZA 5IP6A 1R9TJ 3LSTA 1D8JA 1FSEA 1P2FA 1PUEE 1LJ9A 3DQVC 1O57A 4PSXA 3F22A 4AVZA 3GUDA 3IL2A 1SANA 3SZGA 4J01A 3X2QH 3ECOA 3L2RA 3DEEA 1ACIA 2VE8A 4PK4A 4MNUA 2L01A 2HTJA 2O7OA 3TMOA 4Y52J 1E17A 1P7IA 1HBXG 2VIXA 3JRDA 4I2OA 2CFOA 1T0FC 3BTCA 5CVVA 3CP2A 1U5TA 1I50J 3FWEA 4A5MA 3ZMDA 2JA2A 1EKEA 2DYRH 1WGXA 2H8WA 3HTSB 4YIIA 3TP0A 4S0HB 4CHUA 2GM4A 4IEJA 1KONA 1WJ5A 2HXOA 2VBYA 3RKYA 2DCEA 2VBZA 3KZZA 5B66C 1QZYA 2R5ZB 3OYHA 5J6XA 4GFBA 1WWXA 4AU7A 1Z6RA 2L7FP 2QZ8A 4IX7A 1OLTA 3DPTA 3T0YA 1F9NA 1VQ8I 1T39A 4O6JA 2W00A 2CUJA 3DKWA 3GZNB 5HDKA 2E5NA 3KIOA 2TCTA 1H89C 3IAM2 1RETA 4JP0A 3H1CA 1BC7C 2O6GE 2IAIA 4RDUA 3S8PA 3RYRA 1ON2A 1YYVA 2D2WA 2P8TA 3K1PA 4JQFA 4Q48A 2R93J 3J7AY 3WGGA 4OAYA 4NNJA 2LG4A 4ZYDA 3WU2C 2F48A 1K4TA 1JHFA 2R7TA 2ZB9A 4AYBN 1UMQA 2EZLA 2XGXA 3S1QJ 4NQWA 2HWVA 3PM1A 4WXDA 2ZJPF 2MC3A 2QUFA 3K69A 1YW8A 1IN4A 3K9TA 2B63J 3MN2A 1UZCA 2BHZA 4C3JJ 2XF5A 5D4RA 2ME0A 4XMYA 2STTA 4A5NA 5DUIA 3RTRA 3OYLA 1X3UA 4HA8A 3J80K 3A4CA 2OF7A 4EJVA 2CUZA 2WY8Q 4B1RA 3LNQA 2F5VA 2DLLA 4AC0A 3TDZC 4FT8A 1BW6A 3WG9A 1ZR2A 2XKPA 5FLXZ 3E97A 1R00A 2IGOA 2RNGA 3IRQA 3GCMA 4MEXF 1WI3A 3VOEA 1YO5C 1Z21A 4DIQA 1JI8A 2KPMA 3IH3A 2BXZA 5LRSA 2XV4S 3OL4A 3QWLA 2JMWA 2JWTA 4LLLA 3MFKA 3S32A 2V9VA 4ZTJA 4B44A 1B8IA 4KIFA 2R7OA 2R7XA 3KP3A 3HOTA 4NDLA 2Q2EA 1WJBA 2MW8A 6PAXA 2HKOA 4LIVA 3S14J 1BI1A 4FQGA 4Z6YA 3G71I 2ISZA 4EJTA 4I0AA 3VSKA 1S9HA 2KIQA 2N8GA 5C3EJ 4AVPA 2QLZA 2IGKA 2BVLA 2YU3A 3WTYC 3CUOA 2CQXA 2CRGA 4LB5A 4BEHB 2JQ7A 3EETA 2A61A 3ELKA 1XCVA 2GWRA 3DLAA 2WADA 2A6EF 4CZCA 3PJRA 1D0ZA 2MC4A 3SJMA 3L2VA 1ZGWA 1JKPC 4IQ4A 2E35A 1K83J 1FBUA 1HW1A 5HVQC 2AHQA 2FBIA 3R4KA 1BIBA 4A3LJ 3RQ4A 3KEOA 2PJRA 1QZZA 2FF4A 4IPAA 1MKMA 2LLKA 1U8BA 1IC8A 1HOMA 2NOJB 5KHDA 4DJAA 1TT5B 1LFBA 3CJRB 3BTLA 3QOPA 2PMUA 2EH3A 1GXPA 4XN3A 3GBGA 5JHFA 5E1WA 1U78A 2K9LA 3BTJA 1U5TC 1ZREA 4KIGA 3VYRB 1I3QJ 4I02A 5CVRA 3MZHA 2G7HA 2R3SA 1JGGA 1WPKA 1ZK8A 1YW9A 5AIPA 4PFPA 2ID3A 4M73A 1P9QC 3CCVI 2Z9OA 3WODF 1MMDA 4II2A 3KYLA 1EA3A 5AONA 4NUBA 1HSTA 3RPUD 3ZRGA 1VNDA 2M4GA 3JRFA 3E5XA 2HGCA 5D4SA 3GTOJ 5FFZA 2XRLA 2IA2A 2KLOA 3FDYA 4XOTA 1W0UA 3I53A 1WI9A 3ZGKA 3JSOA 5BQTA 3CJNA 4UUSB 5IYDJ 4XBFA 3BJAA 3CCYA 3T1BA 4BE2A 1XGNA 3A0HC 1OJLA 3KP2A 4C2TA 2Y30A 3PNTA 2HDDA 3S15J 2WB1N 3TO6A 3GF2A 2FOKA 4XLCA 2FD5A 1BR1A 2VT2A 1A31A 4U0VA 4F52A 4DBRA 1S8NA 1I5ZA 2P7VB 2ZMEA 5H20A 1DDNA 1ZRDA 5E3NA 3LQQA 3CTAA 2W84A 4F93B 2WV0A 4EM1A 3MKWB 5IPAA 2Y69H 4ZJZA 1OR7C 1TL8A 1TTYA 1ZELA 3IP4B 4RS8A 4OMZA 4RGXA 1QGPA 4ENKA 2EFQA 3FF5A 3FXRA 2M7BA 4RGRA 3CJQB 4II3A 4XL9A 1OCRH 1J59A 1MNMC 3MVPA 4RAGA 5A2QK 4EEFG 4QLCU 2B7EA 2M8GX 1YQAA 4XLFA 4V19K 4ON0A 1A5JA 1N75A 5FKNA 1AOYA 2IS2A 1FOWA 1E2XA 3HRUA 1V5EA 3QODA 2D1HA 3TL4X 3ZMZA 3SEQA 4D5FA 4R79A 1XC5A 1L0OC 5D5WB 4HV6A 3K0LA 4IHSA 2IS1A 3I4PA 3HOZJ 3NWSA 2DTRA 5JFRA 3KE2A 5CVJA 3HSEA 1HDPA 1IN5A 3QYFA 2KIUA 2MLKA 1ULYA 4KIBA 5J8FA 3DWLE 4E70A 1HSJA 2GBYA 4N0BA 3VYSB 1S6LA 5KK1A 5K5QA 4HRIA 5JVGF 4DZJA 1SAUA 4YEJA 1BBYA 3HB9A 3TO9A 5ICCA 4PJMA 2BW3A 4PJLA 3GFLA 3V8JA 2R5ZA 3AG1H 1OCOH 4N9HA 3WTUC 1F5TA 1FP2A 2KJCA 2RQPA 2VJ5A 2QVOA 4YIRX 2F4MB 1IJWC 1FEXA 2FQ3A 2DMQA 3QAHA 2M87A 1O3TA 5HDGA 3VPRA 2BVMA 2L9NA 4KJZA 1EH8A 3TDUC 5DCMA 5HNFA 3FBNB 1J2XA 3OOPA 4CCJA 2OCCH 3HOUJ 2UWMA 1BIAA 4A6DA 3CDIA 2K40A 4OIQF 1X58A 3J7ZI 1V54H 4TV7A 3GTLJ 3ZN0A 5M5WJ 3CCJI 2K7LA 2K85A 1UCRA 4M3EA 1LEBA 5LBQA 2W7NA 2LOOA 1ORKA 1MBGA 4IF4A 3CC2I 1WFXA 3ZOBA 1QVUA 4ZZLA 3CD6I 4Y13A 1QHHD 1ZLJA 2GA2A 2KZVA 3FK6A 3BP8A 4QSHA 1JUSA 3I3LA 2IPQX 2Y2ZA 5H6RA 3TEDA 4PGHA 3ZQQA 2VT3A 2BY0A 3JR9A 3FXUA 2M0MA 4M3BA 4UV9A 1SD5A 4EVIA 1HW2A 3OYNA 2F4IA 3IKVA 3EUHA 2VJJA 2DT5A 3QP6A 2QA4I 3FMSA 3W2AA 4B48A 4BXFA 2MD0A 1KU3A 2V1XA 4XRFA 1P6RA 3Q9SA 4DYCA 3FKJA 2E5ZA 3LSRA 3Q0VA 1UHWA 2HOAA 5J40A 5EJCA 3K4KA 1FTZA 4F92B 1CF7B 2VI6A 2KIFA 5C44J 2FU4A 2DXIA 1N78A 5DM6F 3MWMA 4JX6A 2L54A 5L3BA 5ILUA 3DEWA 4KNYA 2MH9A 4BEHA 3BG9A 2XAGA 3OIQA 3K2AA 3CESA 3KP5A 3KPHA 4ENJA 1IRGA 2Z1DA 4EM2A 5TJJA 3KZYA 4DBQA 5F04A 3Q9VA 4DYQA 3VDXA 4Y7NJ 3B6CA 4ZDPA 4GYGA 2X6YA 3E6DA 3HGYA 1SVOA 1R36A 5FKLA 2PMHA 2DDBA 2EQRA 2LY9A 1IZ1A 3MKLA 2OJED 3KEYA 5FD5A 2RN7A 3JAMK 3OYMA 2LBFA 2QCOA 5DM7F 5IY5H 1X1AA 4XLPF 1KYZA 3AFHA 1MMAA 1QQIA 3FXLA 2NAZA 4U88A 4IOAF 2HPMA 2M3AA 1JE8A 1Q1VA 3RYPA 2ZXJA 1MBJA 1MMNA 2LSOA 4HNUA 3CF2A 1DGWY 3B6AA 1BI2A 2LY1A 2KIMA 3H3ZA 3A03A 3ABTA 5GADJ 4XRSG 3ASNH 4PJ0C 5HLGA 4L5JA 1D0YA 4WXHA 2VPLA 2F6CA 4M6YA 5LRRA 2CFXA 4BUPA 3TBIA 4XIDA 2KP6A 4PSWA 2LVSA 2GZWA 5DV5A 4QPQA 3W3CA 1W36C 4HSRA 4L5IA 2DA4A 3J81K 5GTHC 4CSWA 2HU9A 3HDDA 1ETVA 2QGUA 1RR7A 2V7FA 5F1JA 2Q1ZB 2HXIA 3L00A 2DT7B 4OAZA 4PGGA 1X1BA 5L3FA 3BR5A 3T8RA 2E34A 4IRIA 1KU9A 2CUFA 4BQQA 1ZQ3P 2EV6A 2GAUA 2L9RA 3ISPA 4XKCA 4B43A 2FMLA 2X1EA 2XPWA 4BE1A 1SFKA 2E1MB 2XHKA 2EV5A 2HYGD 1X1DA 1Y8QB 1FY7A 4AIKA 3BPVA 1D8KA 1FBSA 1LDKB 5HS7A 3OSGA 2EILH 3K4NA 4FHTA 2DFHA 4B4CA 3WHCA 5F6FA 1MNDA 2J5OA 1VQPI 2ZSIB 1EH6A 1XGMA 4P1WA 3TO7A 5J1YA 1POGA 3GX4X 3MZYA 4A3BJ 4JX5A 4BHCA 1UB9A 1OYIA 1YITI 4JK1X 4RAFA 3QP5A 4WCGA 1JUPA 4PZJA 1BJAA 5FLXK 4G7HF 4HLXA 2GXBA 1Y8RB 2ADUA 4CCNA 2E1OA 4R1HA 5KAFC 1FTTA 3S2HJ 1D0XA 2PFBA 3E6BA 3EUKL 1SFXA 4C2MJ 3RZOJ 3H9JA 4KN7X 4XKVA 4BQAA 1U9NA 4O5VA 4IO9F 5L3DA 1TZLA 1B6AA 2HVQA 4CH7A 2I10A 5EEAA 4JOMA 2VQLA 4ETSA 1T2KA 3L2CA 1R4NB 2FOWA 1XDSA 2VASA 4S04A 3E0JB 2IXSA 2KISA 3I71A 4MO7A 2BGCA 4BACA 4A3KJ 1E3PA 1BJZA 2LR8A 4I7HA 4MIMA 1N25A 3I9V2 1IUYA 2LF7A 1R7JA 5LFAA 5FGMA 4NC8A 4C30A 1R49A 1N77A 4XRMA 2VBXA 4E7JA 1ZG5A 1YG2A 1RC9A 4A0YA 3LA3A 2VQCA 4M3DA 1WQ2A 3LA7A 4IHWA 3I54A 2A68F 4Y15A 1LNWA 3JRBA 3HOWJ 3DCFA 1LPQA 4UY8I 3RDIA 2AXTC 2WAFA 4GXOA 2A07F 2DOAA 3PUFA 1DP3A 1Z91A 3GW2A 3RQIA 2LREA 4MEYF 4N4NB 5FB2A 4EQQA 2FXAA 1SD6A 2L02A 3O8GA 4XSXF 3DP7A 3MAJA 1YE9A 2IW5A 2VXZA 2NVYJ 4YFNF 2ELJA 2OZUA 5C4JJ 4D7NA 1G3TA 4BXUA 4RBOA 2CV0A 1YS7A 3FKIJ 5ILSA 2H8RA 4Q47A 2QF7A 3JSPA 3MKYB 2OD5A 1GDTA 2RNJA 3C18A 2MH2A 4L9NA 1BR2A 3H92A 2H94A 1NTCA 2NS7A 2RREA 3COAC 3Q0WA 2OU2A 1X1PA 3JREA 4NQWB 2P5KA 3I4NJ 3V42A 2R7QA 2KRFA 3HGGA 2HQ5A 4BDYA 3DBHB 4XLEA 5IOZA 4BQNA 2XAHA 2KL4A 4KT5C 5FD6A 3CMEI 1KU7A 5CQGA 5F64A 1YLFA 1QPMA 1MZBA 1T33A 3T5XA 3V8KA 2W4SA 2VE9A 3CQZJ 3LFKA 1OYYA 4G6TB 2ID6A 2QQ8A 2CU7A 4UUTA 3RPQA 4C9YA 4RAZA 4BBRJ 5IT3A 2R0QC 1ZKGA 2BY2A 2V6EA 2W48A 4ZZDA 2QKMB 2A6HF 3TGNA 1Z0XA 3D5RC 1FOYA 1APLC 1XPXA 4RB1A 2CV2A 3A2KA 2LFBA 1FSHA 3FIWA 3JAMZ 1PP7U 5LGNA 3K4BA 1JJ8C 3E5QA 4UNOA 5A2QZ 2M8EA 3OS1A 1HXDA 1PDNC 5FLMJ 2NVUB 2XGCA 3ZQ7A 4P9UA 1CQTA 4AUXA 4XLHA 1MNEA 3C3WA 3DPLC 3CUQC 4UHTA 4UB6C 3V7SA 2YU9J 5DD8A 2X0LA 1DUXC 2MGQA 2GLOA 1P92A 3UNGC 3VB2A 2IA0A 2VKVA 4KITB 3SEZA 1L3LA 2ECCA 2QWWA 5BPIA 3L9FA 1HA8A 2FX0A 4UXNA 2CH0A 4AYBA 1TQPA 2OA4A 2PI0A 1MSFC 2XPUA 3J7YJ 5E3OA 1A6IA 4ZH4F 2BBYA 3G2BA 4A69C 4A2UA 5FRMA 4LK0F 1DPUA 3I5UA 4MHGA 2WY7Q 3M8EA 4MLOA 2O8KA 4FETA 1FPQA 3I59B 4OIPF 5EZGA 3FISA 5D5UB 2UXXA 2LD5A 1IXSB 3U9GA 4G7ZF 2LYCA 2UV1A 3H3VK 3K1MA 2ESHA 4UVCA 3AL0C 2WV1A 4EMSA 1NHAA 3F8NA 4XOPA 2HTSA 3VEPA 1U9OA 2M0CA 2YUSA 2ZNZA 3CMAI 3NQOA 2BOLA 3MKZA 4QWQA 2DA7A 1G6NA 5LHIA 4MGRA 1Z05A 1WHUA 2CJJA 2JT1A 5ICEA 1OCZH 2P6TA 1TWHJ 1YRNA 2EFOA 1KQ9A 3REOA 3CCLI 1RR8C 2K5CA 3FBIB 3PQKA 3DBLB 2FBHA 4Y33A 1RUNA 2M7AA 4ITVA 4S05A 5FLVA 1LEAA 3ZMTA 2CUEA 2DJNA 1YX3A 5J1RA 4IVNA 1H88C 2R7RA 2EFWA 3FK7A 2E2IJ 2JZYA 1YW7A 3IH4A 3CUQA 3K1NA 3M1CA 5EDNA 3KYCB 1B72B 2UXNA 3HRMA 4X0GA 3GTGJ 3H5RA 4IHVA 1I6HJ 3BJOA 2CQNA 2O0YA 3DPUA 2HZTA 1MDMA 1X3WB 4CGZA 3VSLA 4CCOA 1U8RA 4A0XA 5GAHJ 4YIFA 2OV7A 3WE2A 3CDLA 3PL8A 1MH4A 1ETKA 5KNLA 1I1GA 3LMMA 4RB2C 4BDZA 1SD4A 1H9TA 4LD5A 3LSJA 4XR6A 1QNTA 5K7FA 1EH7A 2GA1A 2H1LA 1IV6A 2ZBKA 2VKEA 2Q8KA 4PJNA 1T98A 1FIAA 2IVMA 1JT0A 3BR1A 1R4MB 4HLYA 4YG2F 1IO2A 3CO7C 3R60A 2PMZA 4HF2A 2WAQA 3U1KA 3MZ8A 3QQAA 1HKTA 2X9DA 3CF5F 1K78A 2P5VA 3M3YJ 5EG0A 4M3FA 2R7FA 1IF1A 2XF6A 4AD9A 4ANJA 3CCEI 2FA5A 2FEZA 4M9ZA 3Q5FA 1UG0A 4LGWA 4QPOA 4LITA 2O61A 4BJ6C 4L18B 2FMYA 3OYAA 3W2VA 4CXFA 2R5YA 3S16J 1VQMI 1GUUA 1V4RA 2NNYA 4B8XA 2XSDC 1Z1DA 2XB5A 3H36A 1OYWA 2DJIA 3W6JB 1ZLKA 5K7HA 1W0TA 2DBBA 3F6VA 3KFWX 1FBQA 1FC3A 3FXQA 1ZG3A 4A0ZA 1D1AA 2V26A 4I09A 2JA5J 3ABLH 2CYYA 1MBKA 2K27A 4XLNF 2EFNA 2P4WA 2VPRA 4BYYA 4OIRF 5LLQA 3FHZA 3U1DA 5DCFA 3DKXA 2VODA 3IH2A 1MBFA 2OBPA 1SEUA 1U5TB 2JRTA 2DMUA 2OC6A 3HPGA 2VOPA 4F91B 2E71A 3HXLA 4N9IA 4BNCA 4CA0A 1TWFJ 3QPTA 4QIWN 2NS0A 3LL7A 2DFEA 2HR3A 1I3AA 1YFHA 3ABKH 4OINF 4E7ZA 1VQNI 5GAGJ 5M3FJ 4CYCB 1G3YA 3EYYA 2H09A 3WTVC 2BY3A 1ENHA 4CCLA 3PNVA 5HLTA 1WCMJ 1I39A 4ZDOA 1AHDP 3HSFA 2CO5A 4X6AJ 2W82A 3S2DJ 3HUGA 3QYBA 5J3LA 3S93A 1Z77A 2K3FA 2YR2A 1QZEA 3FXMA 1VQOI 2LF8A 2DMPA 1KGSA 1B9NA 4HW0A 2LDUA 4M9SA 1GLNA 3KEQA 3PNYA 4QTRA 1GXQA 2MG4A 4B47A 2BE5F 3JRGA 2ISYA 5GAEJ 1RNLA 4G9YA 2LKPA 2EJRA 3OSFA 1RKTA 5CPRB 3SDBA 2DFFA 1XN7A 4CYCA 4ENMA 3BROA 3ZCOA 2NNNA 3BQZA 2W25A 1K7AA 3H9QA 1NH3A 2YSRA 2K4JA 2V9KA 4HX7A 2P6SA 4MFDA 4IHXA 3JTGA 4P55A 3AKZA 3R0AA 5JI6A 1WZ2A 4EGYA 3J80Z 1XCBA 2DAOA 1ZRFA 4MTDA 2LBFB 1STZA 3ZMVA 1FZPB 3GXOA 4EJOA 3BG3A 2I5UA 4MTEA 2A6TA 1IGNA 4UVAA 4MFEA 2KDOA 3GTQJ 1UFMA 4KN4X 3OYGA 1MIJA 4PJJA 3OYFA 1XGOA 1J9IA 1KYWA 2WA0A 1GV2A 1FYLA 1Z3XA 2EK5A 3FM5A 5F27A 1LVKA 1LB2A 4FCYA 1OISA 5EGOA 2X85A 5TRDA 2A5YB 5E18F 4XNFA 3HRTA 3NEUA 2C6YA 2GOMA 1QBJA 2KKOA 3H3UA 1XG1A 3N97A 3BR2A 2HPIA 1EV7A 5GPAA 1SMYF 3HIFA 5E20A 2R7UA 3CMMA 4UVBA 2QQAA 4JYKA 3TQNA 3BC8A 1QRYA 1JGSA 3OYBA 3I59A 1K79A 1WVRA 2QBYA 5K7ZA 2F5FA 4X1EA 2DPUA 1JKQC 2CMPA 4FE7A 4KMUX 3SFZA 1R1TA 1P4WA 4IL6C 2DU9A 2QBYB 2M2EA 3O3KA 1RZ4A 5D8KB 1TC3C 1FJLA 4AM3A 2M34A 1QHGA 2XAFA 5L3EA 3ASOH 2TDXA 3ZP5A 2XF7A 2IJLA 3H9GA 3P9KA 1DPRA 3WTSC 1Z6TA 1R58A 3K4MA 2BEOA 4B09A 1Q1HA 3F8CA 4AIDA 3GFMA 3QU3A 1YIOA 4H4KC 1J09A 2PJRB 3TOAA 5CKTA 5L3GA 5FKKA 4FX0A 2WC2A 2DOEA 1R6RA 2V1NA 1FMWA 3LAJA 3SFIA 3PUBA 4V2FA 2JN6A 2V1UA 4ESJA 2EA2A 2CSOA 4UB8C 5B3SH 2K86A 4BS9A 3PSIA 1SMTA 4HOBA 3VYTB 2ZJRF 3IC7A 4O3MA 3WGHA 2Q0OA 2HFHA 2QSGX 1QVTA 5CVUA 1F43A 4XONA 3AAFA 2R7SA 1XMXA 2JUCA 3OMYA 2ECBA 1FLIA 3R0JA 2DW4A 4L9VA 2L7MP 2PJPA 3WTZA 2HI3A 4RGSA 4GRIA 3IWZA 3HEFA 4ZC3A 3F3XA 1JUMA 1ZYRF 1OMIA 1R22A 4E7IA 2VB6A 5GPCA 1QPIA 2BV6A 1IXRC 1VF9A 3K2ZA 3TP3A 1U3EM 4RMNA 4CYDA 4L9JA 1BN5A 1ETQA 3F9KA 3QPHA 2CQKA 3IV5A 4D0PA 4D5CA 5IP7J 3JW4A 2ZSHB 3O2PE 4AIHA 5K5OA 3L2QA 2IRFG 3M8FA 2QSFX 4XKWA 3ABMH 4WF2A 4IJAA 3RI4A 3C2GA 2IGMA 4ZYEA 1IW7F 2RGVA 3HTUA 1WJDA 4BQOA 3E6MA 3TKYA 2K9NA 3LSMA 4ZYAA 5BNGA 4DOZA 1IAWA 2QQ9A 1JTYA 4P5OA 1FWZA 3BPXA 3JRIA 4M74A 3RKQA 5DD4A 1OKRA 3A1YA 3FM3A 3HG9A 4BGDA 4HBLA 4AIJA 2HQRA 2Y9ZA 4J00A 2V6CA 3BLYA 2LY2A 3RIRA 1BW5A 2X48A 3DF8A 4KT6A 5HDNA 1X3ZB 4HDVA 5EZHA 2WWYA 1T6SA 1VQ9I 2D5VA 2E19A 2I8DA 5LEKA 1B9MA 9ANTA 4CICA 3KYDB 2W57A 3QRFF 1AA7A 2M9HA 4XICA 1A6QA 1J75A 1K6YA 1REPC 3HM5A 2VKHA 3BCBA 4RM3A 3QU6A 5ED4A 1PUFA 1XD7A 2STWA 1IRZA 4XLAA 1X2MA 4PDKA 3Q0UA 4BY7J 3CO6C 4LG3A 1I27A 1UHSA 2X51A 3U21A 4HF0A 5IP9J 4M6VA 5IYCJ 4I99C 3ZQGA 1YHQI 3KP6A 3MD2A 4E4HA 1KA8A 1V5GA 3OR1C 1X4OA 3OIOA 1WJCA 1U6GA 1Z9CA 3KETA 2RV8A 1DGRM 3P5JA 3N4MA 2A5WA 2GXGA 1D5VA 2JVGA 2Y0MA 2H27A 1JJ6C 2DODA 5HNHA 4ESFA 4LLNA 3BG7A 4B3XA 2MD5A 1XS9A 3HUGB 1LVAA 3BWGA 3IWFA 3LQRA 1GHCA 1FOXA 2DA5A 3ZN1A 1LDDA 4HQEA 5KCMA 1Y1WJ 4BKXA 3HBLA 1T8IA 2K9MA 1X1CA 3DLLF 2VLAA 5CLSA 4BHBA 1KQ0A 3BG5A 2E1NA 3T8TA 2BXYA 3HJEA 3MMYB 5CYVA 4E7HA 1DU0A 2Y48A 4HNVA 3ERED 3EQLF 1MJAA 1SFEA 1P7JA 2HOSA 1ERDA 3SYTA 3JTHA 4BU2A 2O5RA 1E0EA 3I56I 4I6ZA 1OCCH 1A04A 1TW3A 3BZKA 4M72A 5E8GA 5ERIA 1S5LC 2WBMA 4U87A 3WE3A 2R4GA 1R1UA 1WKMA 4DNCA 3H35A 1W7PA 5BOXA 4L0YB 2JUGA 4A3CJ 3FHNA 5DCMB 3IRRA 3S3NA 3ZQHA 4Y17A 4XORA 2YX7A 2GIVA 3W2WA 5J47A 5B1AH 1UELB 1MH3A 1ZRCA 3ZXSA 4L9TA 1X2NA 3VWBA 3PO3J 1SC7A 2FNPA 3K10A 4R8HA 3A0BC 4RB0A 4RM2A 2IS4A 1YJWI 2Y0SA 4C3HJ 4IRGA 4L0ZB 3LSKA 1ETYA 4A6EA 2L3DA 1YIJI 1PYVA 1U2WA 2VKDA 5IT9Z 4WWCA 2DK8A 1IN7A 4L5EA 1FMVA 3FX3A 4RA2A 3HSRA 2XVCA 3KZIC 2J5PA 3OOUA 1DQUA 4A3JJ 2PEXA 1FNNA 3LSGA 2DMTA 3HYIA 3CP8A 3A01B 3GTKJ 1OQYA 3BOQA 3F8FA 2G7UA 1TWGJ 5CJ9A 4BHPA 1QO0D 1TQIA 3J7AO 1KQ8A 2OQRA 3OS2A 1LFPA 3HHHA 2HYFA 5IT9K 3JRCA 2GQQA 4P9FA 1JT6A 1E3HA 3D5SC 5B5EC 4HNTA 3LSPA 1WRJA 2HZDA 4Y3OA 4E7SA 5FKOA 4A3MJ 2A69F 2ETHA 2L0KA 1G8XA 3UKGA 2MSYA 1UHMA 5M3MJ 1VZ0A 4HPQA 2K9QA 4M71A 1TW2A 5E1ZB 3BZCA 5J1UA 2E1CA 1WH7A 3FXKA 4KYWA 5E8IA 2YPRA 5KVRA 2BZTA 2Z2SB 3DU6A 2HOEA 1S7OA 2M5WA 3F72A 4B3AA 2RAEA 1O3RA 5D6EA 1G3SA 1WJFA 3W6VA 3OYDA 2JSCA 1JHHA 2QYOA 2EZIA 4C3IJ 1TT0A 2DA1A 2DK5A 3G1MA 1HF0A 3BCAA 3GVAA 1RUOA 1KZHA 3AG3H 4WXCA 4IKFA 1MBHA 3G3ZA 3O6BB 4CCMA 1W4MA 1QU3A 1EF4A 2DA6A 4D7MA 1BI3A
chains in the Genus database with same CATH topology
2XB5A 3I4MJ 2XPVA 3E7LA 5K7HA 1W0TA 2FJ1A 2EZKA 3HOUJ 4V2GA 2K40A 1X58A 1E3OC 3S1RJ 3GTLJ 5M5WJ 4FE4A 4M3EA 5EGOB 2JA5J 1OCPA 2O9LA 2IEKA 1JKOC 1MBKA 1ORKA 1MBGA 3ZOBA 1QVUA 3ZQIA 5EF6A 2VPRA 3C2BA 3FK6A 4QSHA 1JUSA 3TEDA 2Y2ZA 2R5YB 1K61A 3JR9A 4M3BA 3IH2A 1MBFA 1S7EA 5E3LA 2DMUA 3BQYA 1AKHA 2LK2A 4BBSJ 3ZQLA 1TWFJ 4QIWN 1UG2A 1BA5A 2LKXA 1GVDA 4DYCA 3GTMJ 1G2HA 3LSRA 5M3FJ 3JRHA 3Q0VA 4CYCB 2HOAA 2E2HJ 1D5YA 1FTZA 4IHYA 1HCRA 1LFUP 2VI6A 5C44J 1ENHA 2ELKA 1WCMJ 4JX6A 1AHDP 1IUFA 5DTDA 4I76A 4X6AJ 3DEWA 2H1KA 3S2DJ 5J3LA 3BG9A 2NS8A 3K2AA 1Z77A 3O8HA 4XRSA 4FISA 2DMPA 4W1UA 5E3MA 4A3EJ 2XGEA 5F04A 3BR0A 4DYQA 4Y7NJ 3B6CA 2DMNA 2HOTA 3CMYA 3HGYA 1NK3P 4QTRA 5FKLA 2EQRA 2EBIA 1ZTRA 2MG4A 3F0CA 2Y31A 2LY9A 4BXXJ 3MKLA 1VFCA 3JRGA 2DA2A 2QCOA 3GTPJ 3OSFA 2COBA 1RKTA 2LTPA 1AU7A 2X6OA 1H8AC 1RPWA 1PUFB 4CYCA 3RZDJ 4DW6A 3NARA 1O4XA 3BQZA 5GP9A 1Q1VA 2FQ4A 1ETXA 1MBJA 2R92J 2P81A 1RKWA 1IDZA 4MFDA 2OPTA 3B6AA 4IHXA 3A03A 4XRSG 1YRNB 1ETWA 4BY1J 2DTZA 3BR6A 4XIDA 2LVSA 3QPLA 5F0CA 2JA8J 3BG3A 1SFOJ 2DA4A 3GTJJ 3HOYJ 1OCTC 4ABZA 5F0HA 1IGNA 1GV5A 5JLXA 4MFEA 4J19A 3GTQJ 2WAQN 2PMZN 3HDDA 3JRAA 2DA3A 1ETVA 2CQQA 1RR7A 1GV2A 3NAUA 2TRTA 5F27A 5F1JA 4FCYA 5EGOA 3WHBA 2HXIA 3BR5A 5EG0B 1TWCJ 1XG1A 2CUFA 1DU6A 1ZQ3P 1TWAJ 2L9RA 3BR2A 1Y1VJ 2XPWA 2JK3A 5GPAA 3HOVJ 1B8IB 5C4XJ 4JYKA 2AO9A 1QRYA 5FKMA 1MBEA 5K7ZA 4X1EA 3OSGA 1JKQC 2XGDA 4FE7A 5IP6A 1R9TJ 4B4CA 3WHCA 1LE8B 2M2EA 1SANA 1TC3C 1FJLA 2M34A 5J1YA 1POGA 4A3BJ 2O7OA 3A02A 4JX5A 4Y52J 1P7IA 3JRDA 1JUPA 1OFCX 3BTCA 2E1OA 2Y0SN 1FTTA 3S2HJ 1I50J 1HLVA 4C2MJ 3RZOJ 1WGXA 1U9NA 5FKKA 1F36A 2JJ7A 3TP0A 4S0HB 2GM4A 2I10A 5EEAA 3LOCA 4IEJA 1BL0A 3L1PA 2HXOA 3SFIA 4V2FA 2JN6A 2R5ZB 2NOGA 4MO7A 4GFBA 4A3KJ 4MIMA 1BJZA 2LR8A 2L7FP 2EZHA 5EYRA 4DYRA 1MSEC 1H89C 4XRMA 2TCTA 1RETA 4JP0A 1QVTA 1JTXA 4M3DA 2IAIA 1F43A 4RDUA 4IHWA 2ECBA 3JRBA 3TW6A 2R93J 3HOWJ 3DCFA 2L7MP 1T56A 2HI3A 2ZB9A 3HEFA 4AYBN 4A3FJ 1JUMA 1UMQA 2EZLA 3S1QJ 3PM1A 3HKZN 3RQIA 3ZQFA 5GPCA 2B63J 3MN2A 1QPIA 3O8GA 4C3JJ 1VF9A 3TP3A 2ME0A 2KDZA 3D1NI 2NVYJ 5C4JJ 1ETQA 4D7NA 4RBOA 5F0FA 2OF7A 3IV5A 3FKIJ 2H8RA 4B1RA 4D5CA 2QF7A 5IP7J 3LNQA 1GDTA 4AC0A 1BW6A 1ZR2A 1NTCA 2NS7A 1WI3A 3Q0WA 3IH3A 3JREA 4A3DJ 2LP0A 1B72A 5DS9A 3I4NJ 2JMWA 3HGGA 2HQ5A 2JWTA 5M5XJ 5IOZA 2K9NA 1B8IA 5BNGA 1NK2P 1JTYA 4NDLA 4LOCA 2MW8A 3JRIA 3RKQA 3SDGA 1T33A 3S14J 2Y9ZA 3CQZJ 2ID6A 4UUTA 2CU7A 1ETOA 4BBRJ 2R0QC 2X48A 1BW5A 1ZKGA 2N8GA 2W48A 5C3EJ 3ZQCA 2Y9YA 5EZHA 5IYBJ 1Z0XA 2D5VA 2CQXA 2E19A 2CRGA 9ANTA 2NVTJ 2HYJA 1APLC 2M9HA 4XICA 2LFBA 2NVXJ 3HM5A 3SJMA 3FIWA 1ZGWA 1JKPC 1PUFA 1IRZA 1K83J 4XK4A 1JJ8C 1X2MA 4BY7J 3Q0UA 4UUSA 2AHQA 3S17J 4A3LJ 1UHSA 5IYCJ 5FLMJ 5IP9J 4M6VA 3ZQGA 2IBDA 5IOYA 2XGCA 1VI0A 1CQTA 3OIOA 3BT9A 4AUXA 2LLKA 1U8BA 1IC8A 1HOMA 1JKRC 2YU9J 5F08A 1LFBA 2MGQA 1IG7A 3BTLA 1JJ6C 2EH3A 1U78A 3G1LA 3GBGA 2GLOA 3BTJA 3S1MJ 1XS9A 2VKVA 1I3QJ 2DA5A 2ECCA 4G12A 1Y1WJ 4BKXA 2FX0A 1JGGA 1WPKA 1ZK8A 3HBLA 2L7ZA 2JA6J 2ID3A 1MSFC 3QPSA 2XPUA 3BG5A 5E3OA 1A6IA 2KT0A 2YS9A 1DU0A 4A69C 4HNVA 1VNDA 1P7JA 3JRFA 2HOSA 4MLOA 2O8KA 1FIPA 2XB0X 3GTOJ 2XRLA 5EZGA 3FISA 2LD5A 4A3IJ 4I6ZA 1W0UA 4UUSB 3H3VK 5IYDJ 1GT0C 1WH5A 3CCYA 1OJLA 4A3CJ 2WV1A 2Y30A 2HDDA 3S15J 2WB1N 2FD5A 3ZQHA 3G1OA 3BTIA 5JLWA 1U9OA 1MH3A 2M0CA 2YUSA 1X2NA 3PO3J 5E3NA 2DA7A 5IPAA 2CJJA 4A3GJ 1TWHJ 1YRNA 4C3HJ 1HDDC 1ETYA 4JX4A 5M5YJ 5FLVA 2G0EA 2CUEA 4L5EA 2DJNA 5J1RA 1H88C 1IDYA 4A3JJ 3OOUA 3LSGA 2DMTA 1MNMC 3MVPA 3FK7A 3A01B 3GTKJ 4W97A 4EEFG 2M8GX 2E2IJ 3IH4A 1A5JA 5EDNA 5FKNA 4A93J 1TWGJ 1B72B 3HOXJ 2NVQJ 4IHVA 3GTGJ 1I6HJ 4D5FA 1XC5A 3HOZJ 3JRCA 1JT6A 3S1NJ 3LSPA 1ZR4A 3CDLA 5FKOA 1HDPA 4A3MJ 2L0KA 3UKGA 1MH4A 1ETKA 2MSYA 5M3MJ 2E2JJ 3LSJA 2K9QA 2VUMJ 2GBYA 5K7FA 4DZPA 3A01A 5J1UA 5FJ8J 1IV6A 2VKEA 1WH7A 4DZJA 2DN0A 3HB9A 1FIAA 3TW7A 1JT0A 3BR1A 3PO2J 1ITYA 4B3AA 3K7AJ 2RAEA 3M4OJ 2R5ZA 3W6VA 3QQAA 5HODA 2K9SA 2X9DA 3M3YJ 2EZIA 5EG0A 4C3IJ 4M3FA 2ME6A 1IJWC 1FEXA 1AKHB 2DA1A 2DMQA 3H0GJ 3G1MA 1HF0A 2JA7J 1LE8A 3VPRA 1MBHA 2R7ZJ 1RESA 3Q3SA 3BR3A 2R5YA 3S16J 1GUUA 4M3GA 1EF4A 2DA6A 4D7MA 2XSDC 4FTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB5 A;  3I4M J;  2XPV A;  3E7L A;  5K7H A;  1W0T A;  2FJ1 A;  2EZK A;  3HOU J;  4V2G A;  2K40 A;  1X58 A;  1E3O C;  3S1R J;  3GTL J;  5M5W J;  4FE4 A;  4M3E A;  5EGO B;  2JA5 J;  1OCP A;  2O9L A;  2IEK A;  1JKO C;  1MBK A;  1ORK A;  1MBG A;  3ZOB A;  1QVU A;  3ZQI A;  5EF6 A;  2VPR A;  3C2B A;  3FK6 A;  4QSH A;  1JUS A;  3TED A;  2Y2Z A;  2R5Y B;  1K61 A;  3JR9 A;  4M3B A;  3IH2 A;  1MBF A;  1S7E A;  5E3L A;  2DMU A;  3BQY A;  1AKH A;  2LK2 A;  4BBS J;  3ZQL A;  1TWF J;  4QIW N;  1UG2 A;  1BA5 A;  2LKX A;  1GVD A;  4DYC A;  3GTM J;  1G2H A;  3LSR A;  5M3F J;  3JRH A;  3Q0V A;  4CYC B;  2HOA A;  2E2H J;  1D5Y A;  1FTZ A;  4IHY A;  1HCR A;  1LFU P;  2VI6 A;  5C44 J;  1ENH A;  2ELK A;  1WCM J;  4JX6 A;  1AHD P;  1IUF A;  5DTD A;  4I76 A;  4X6A J;  3DEW A;  2H1K A;  3S2D J;  5J3L A;  3BG9 A;  2NS8 A;  3K2A A;  1Z77 A;  3O8H A;  4XRS A;  4FIS A;  2DMP A;  4W1U A;  5E3M A;  4A3E J;  2XGE A;  5F04 A;  3BR0 A;  4DYQ A;  4Y7N J;  3B6C A;  2DMN A;  2HOT A;  3CMY A;  3HGY A;  1NK3 P;  4QTR A;  5FKL A;  2EQR A;  2EBI A;  1ZTR A;  2MG4 A;  3F0C A;  2Y31 A;  2LY9 A;  4BXX J;  3MKL A;  1VFC A;  3JRG A;  2DA2 A;  2QCO A;  3GTP J;  3OSF A;  2COB A;  1RKT A;  2LTP A;  1AU7 A;  2X6O A;  1H8A C;  1RPW A;  1PUF B;  4CYC A;  3RZD J;  4DW6 A;  3NAR A;  1O4X A;  3BQZ A;  5GP9 A;  1Q1V A;  2FQ4 A;  1ETX A;  1MBJ A;  2R92 J;  2P81 A;  1RKW A;  1IDZ A;  4MFD A;  2OPT A;  3B6A A;  4IHX A;  3A03 A;  4XRS G;  1YRN B;  1ETW A;  4BY1 J;  2DTZ A;  3BR6 A;  4XID A;  2LVS A;  3QPL A;  5F0C A;  2JA8 J;  3BG3 A;  1SFO J;  2DA4 A;  3GTJ J;  3HOY J;  1OCT C;  4ABZ A;  5F0H A;  1IGN A;  1GV5 A;  5JLX A;  4MFE A;  4J19 A;  3GTQ J;  2WAQ N;  2PMZ N;  3HDD A;  3JRA A;  2DA3 A;  1ETV A;  2CQQ A;  1RR7 A;  1GV2 A;  3NAU A;  2TRT A;  5F27 A;  5F1J A;  4FCY A;  5EGO A;  3WHB A;  2HXI A;  3BR5 A;  5EG0 B;  1TWC J;  1XG1 A;  2CUF A;  1DU6 A;  1ZQ3 P;  1TWA J;  2L9R A;  3BR2 A;  1Y1V J;  2XPW A;  2JK3 A;  5GPA A;  3HOV J;  1B8I B;  5C4X J;  4JYK A;  2AO9 A;  1QRY A;  5FKM A;  1MBE A;  5K7Z A;  4X1E A;  3OSG A;  1JKQ C;  2XGD A;  4FE7 A;  5IP6 A;  1R9T J;  4B4C A;  3WHC A;  1LE8 B;  2M2E A;  1SAN A;  1TC3 C;  1FJL A;  2M34 A;  5J1Y A;  1POG A;  4A3B J;  2O7O A;  3A02 A;  4JX5 A;  4Y52 J;  1P7I A;  3JRD A;  1JUP A;  1OFC X;  3BTC A;  2E1O A;  2Y0S N;  1FTT A;  3S2H J;  1I50 J;  1HLV A;  4C2M J;  3RZO J;  1WGX A;  1U9N A;  5FKK A;  1F36 A;  2JJ7 A;  3TP0 A;  4S0H B;  2GM4 A;  2I10 A;  5EEA A;  3LOC A;  4IEJ A;  1BL0 A;  3L1P A;  2HXO A;  3SFI A;  4V2F A;  2JN6 A;  2R5Z B;  2NOG A;  4MO7 A;  4GFB A;  4A3K J;  4MIM A;  1BJZ A;  2LR8 A;  2L7F P;  2EZH A;  5EYR A;  4DYR A;  1MSE C;  1H89 C;  4XRM A;  2TCT A;  1RET A;  4JP0 A;  1QVT A;  1JTX A;  4M3D A;  2IAI A;  1F43 A;  4RDU A;  4IHW A;  2ECB A;  3JRB A;  3TW6 A;  2R93 J;  3HOW J;  3DCF A;  2L7M P;  1T56 A;  2HI3 A;  2ZB9 A;  3HEF A;  4AYB N;  4A3F J;  1JUM A;  1UMQ A;  2EZL A;  3S1Q J;  3PM1 A;  3HKZ N;  3RQI A;  3ZQF A;  5GPC A;  2B63 J;  3MN2 A;  1QPI A;  3O8G A;  4C3J J;  1VF9 A;  3TP3 A;  2ME0 A;  2KDZ A;  3D1N I;  2NVY J;  5C4J J;  1ETQ A;  4D7N A;  4RBO A;  5F0F A;  2OF7 A;  3IV5 A;  3FKI J;  2H8R A;  4B1R A;  4D5C A;  2QF7 A;  5IP7 J;  3LNQ A;  1GDT A;  4AC0 A;  1BW6 A;  1ZR2 A;  1NTC A;  2NS7 A;  1WI3 A;  3Q0W A;  3IH3 A;  3JRE A;  4A3D J;  2LP0 A;  1B72 A;  5DS9 A;  3I4N J;  2JMW A;  3HGG A;  2HQ5 A;  2JWT A;  5M5X J;  5IOZ A;  2K9N A;  1B8I A;  5BNG A;  1NK2 P;  1JTY A;  4NDL A;  4LOC A;  2MW8 A;  3JRI A;  3RKQ A;  3SDG A;  1T33 A;  3S14 J;  2Y9Z A;  3CQZ J;  2ID6 A;  4UUT A;  2CU7 A;  1ETO A;  4BBR J;  2R0Q C;  2X48 A;  1BW5 A;  1ZKG A;  2N8G A;  2W48 A;  5C3E J;  3ZQC A;  2Y9Y A;  5EZH A;  5IYB J;  1Z0X A;  2D5V A;  2CQX A;  2E19 A;  2CRG A;  9ANT A;  2NVT J;  2HYJ A;  1APL C;  2M9H A;  4XIC A;  2LFB A;  2NVX J;  3HM5 A;  3SJM A;  3FIW A;  1ZGW A;  1JKP C;  1PUF A;  1IRZ A;  1K83 J;  4XK4 A;  1JJ8 C;  1X2M A;  4BY7 J;  3Q0U A;  4UUS A;  2AHQ A;  3S17 J;  4A3L J;  1UHS A;  5IYC J;  5FLM J;  5IP9 J;  4M6V A;  3ZQG A;  2IBD A;  5IOY A;  2XGC A;  1VI0 A;  1CQT A;  3OIO A;  3BT9 A;  4AUX A;  2LLK A;  1U8B A;  1IC8 A;  1HOM A;  1JKR C;  2YU9 J;  5F08 A;  1LFB A;  2MGQ A;  1IG7 A;  3BTL A;  1JJ6 C;  2EH3 A;  1U78 A;  3G1L A;  3GBG A;  2GLO A;  3BTJ A;  3S1M J;  1XS9 A;  2VKV A;  1I3Q J;  2DA5 A;  2ECC A;  4G12 A;  1Y1W J;  4BKX A;  2FX0 A;  1JGG A;  1WPK A;  1ZK8 A;  3HBL A;  2L7Z A;  2JA6 J;  2ID3 A;  1MSF C;  3QPS A;  2XPU A;  3BG5 A;  5E3O A;  1A6I A;  2KT0 A;  2YS9 A;  1DU0 A;  4A69 C;  4HNV A;  1VND A;  1P7J A;  3JRF A;  2HOS A;  4MLO A;  2O8K A;  1FIP A;  2XB0 X;  3GTO J;  2XRL A;  5EZG A;  3FIS A;  2LD5 A;  4A3I J;  4I6Z A;  1W0U A;  4UUS B;  3H3V K;  5IYD J;  1GT0 C;  1WH5 A;  3CCY A;  1OJL A;  4A3C J;  2WV1 A;  2Y30 A;  2HDD A;  3S15 J;  2WB1 N;  2FD5 A;  3ZQH A;  3G1O A;  3BTI A;  5JLW A;  1U9O A;  1MH3 A;  2M0C A;  2YUS A;  1X2N A;  3PO3 J;  5E3N A;  2DA7 A;  5IPA A;  2CJJ A;  4A3G J;  1TWH J;  1YRN A;  4C3H J;  1HDD C;  1ETY A;  4JX4 A;  5M5Y J;  5FLV A;  2G0E A;  2CUE A;  4L5E A;  2DJN A;  5J1R A;  1H88 C;  1IDY A;  4A3J J;  3OOU A;  3LSG A;  2DMT A;  1MNM C;  3MVP A;  3FK7 A;  3A01 B;  3GTK J;  4W97 A;  4EEF G;  2M8G X;  2E2I J;  3IH4 A;  1A5J A;  5EDN A;  5FKN A;  4A93 J;  1TWG J;  1B72 B;  3HOX J;  2NVQ J;  4IHV A;  3GTG J;  1I6H J;  4D5F A;  1XC5 A;  3HOZ J;  3JRC A;  1JT6 A;  3S1N J;  3LSP A;  1ZR4 A;  3CDL A;  5FKO A;  1HDP A;  4A3M J;  2L0K A;  3UKG A;  1MH4 A;  1ETK A;  2MSY A;  5M3M J;  2E2J J;  3LSJ A;  2K9Q A;  2VUM J;  2GBY A;  5K7F A;  4DZP A;  3A01 A;  5J1U A;  5FJ8 J;  1IV6 A;  2VKE A;  1WH7 A;  4DZJ A;  2DN0 A;  3HB9 A;  1FIA A;  3TW7 A;  1JT0 A;  3BR1 A;  3PO2 J;  1ITY A;  4B3A A;  3K7A J;  2RAE A;  3M4O J;  2R5Z A;  3W6V A;  3QQA A;  5HOD A;  2K9S A;  2X9D A;  3M3Y J;  2EZI A;  5EG0 A;  4C3I J;  4M3F A;  2ME6 A;  1IJW C;  1FEX A;  1AKH B;  2DA1 A;  2DMQ A;  3H0G J;  3G1M A;  1HF0 A;  2JA7 J;  1LE8 A;  3VPR A;  1MBH A;  2R7Z J;  1RES A;  3Q3S A;  3BR3 A;  2R5Y A;  3S16 J;  1GUU A;  4M3G A;  1EF4 A;  2DA6 A;  4D7M A;  2XSD C;  4FTH A; 
#chains in the Genus database with same CATH topology
 3I4M J;  1SD7 A;  3L2W A;  1Y0U A;  2EZK A;  5E17 F;  1HKQ A;  4LG0 A;  2BHY A;  2AQE A;  2NXN B;  1Z7L A;  4OWR B;  1XSX A;  3P9C A;  1E3O C;  4FE4 A;  2XSJ C;  4CO8 A;  2R7D A;  2O9L A;  1TP4 A;  2Z33 A;  3LSI A;  1J7K A;  3HHG A;  4G94 A;  3U2R A;  2Z5U A;  5EF6 A;  1X4P A;  3C2B A;  1SFU A;  2P5L C;  2R5Y B;  4U7B A;  4E7K A;  3B02 A;  3CCU I;  4BJ5 C;  4RLQ A;  4P96 A;  3WU0 A;  3ERM A;  4EJU A;  2WAE A;  4RLF A;  2VL8 A;  3CDH A;  3BQY A;  3KP7 A;  2LK2 A;  2ZFU A;  4PCQ A;  4ZYH A;  1S29 A;  2GIZ A;  3DTE A;  3E3V A;  2KFD A;  1YJ9 I;  1UG2 A;  3R6S A;  2Z3Y A;  3PFI A;  1D1C A;  3E6C C;  2CV1 A;  2RVC A;  2LKX A;  2EIK H;  1GVD A;  3SZT A;  2XRN A;  2PQ8 A;  2FBK A;  1JXS A;  3JRH A;  2E2H J;  4KA4 A;  1D5Y A;  2VC1 A;  1HCR A;  2A05 A;  1ONV A;  4G8X A;  1G59 A;  2DOF A;  1V5F A;  2L9V A;  3FZV A;  3GLX A;  4E7L A;  5LGT A;  1FOK A;  5DTD A;  5FFX A;  2UUZ A;  4I76 A;  1IXC A;  3R61 A;  4U0Y A;  1XMK A;  3DV8 A;  3QYE A;  1HW5 A;  3G4S I;  5J4V A;  3PIP F;  1AWC A;  4WX9 A;  4FAS D;  3SZP A;  4FIS A;  2LC2 A;  2XGE A;  3D0S A;  3BR0 A;  3FXJ A;  1LKX A;  5ICG A;  1VQK I;  4ZTF A;  2HOT A;  2W1O A;  1NK3 P;  3OYE A;  3KLO A;  3DTI A;  1WJA A;  1F1Z A;  3F0C A;  4BXX J;  3I0T A;  2CW7 A;  2DA2 A;  2VC0 A;  2W85 A;  1P4X A;  2X6W A;  2LTP A;  2E1M C;  2BW3 B;  1ZAR A;  2MYS A;  1FX7 A;  5DYM A;  2KHM A;  2O3F A;  4BAY A;  1RPW A;  1TNT A;  4EGZ A;  5LGU A;  1PUF B;  1X19 A;  2OAZ A;  3RZD J;  4XSZ F;  2ZME B;  5HLH A;  1O4X A;  3FMR A;  4K2E A;  5GP9 A;  2FQ4 A;  4PFO A;  2RQQ A;  1MW7 A;  3V4G A;  1IDZ A;  1PP8 F;  1BOA A;  2FUG 2;  3F8B A;  1YTY A;  5BS6 A;  2DTZ A;  3BR6 A;  3GZ6 A;  2EFP A;  4HV5 A;  1B4A A;  1MMG A;  4G6Q A;  5L3C A;  2P7C B;  3QPL A;  3K70 D;  2JPC A;  1SFO J;  3PQJ A;  4YEL A;  3GTJ J;  4G7O F;  4HDU A;  1OCT C;  4ABZ A;  2VBW A;  5F0H A;  2XAS A;  3K4L A;  2PMZ N;  2VJ4 A;  2RC4 A;  3JRA A;  2CW0 F;  3PFY A;  4NB5 A;  3L7W A;  4RGU A;  3S3O A;  2TRT A;  1T95 A;  4YFK F;  4F3Q A;  1K6O A;  4XN0 A;  3RJP A;  2K4B A;  1BR4 A;  1XSV A;  3E5U A;  2Z99 A;  5LHH A;  4EAT A;  2VN2 A;  3PSF A;  2OQG A;  1DU6 A;  1TLH B;  1TWA J;  2UZK A;  1ZAO A;  2DPD A;  2JK3 A;  3HOV J;  4HQM A;  4MQV A;  1B8I B;  2AO9 A;  5BPD A;  2G9W A;  1MBE A;  3ULQ B;  2EPF A;  3SXY A;  2XGD A;  1MD0 A;  3GEZ A;  2WB1 A;  2RKH A;  4CCK A;  1W7P B;  2E60 A;  3G73 A;  1F4K A;  4G6D A;  1LE8 B;  3HRS A;  2AS5 F;  3GO5 A;  2M4K A;  5TIS C;  5DUK A;  4KUM A;  2LNB A;  3AL0 B;  4NC6 A;  3A02 A;  2ZJ2 A;  4HX8 A;  2L4M A;  2XDV A;  5ILV A;  1OFC X;  2Y0S N;  2LH9 A;  3HC7 A;  2KRC A;  2EWN A;  4ESB A;  1VQ7 I;  2YX4 A;  1HLV A;  3OYK A;  1TQM A;  2JRM A;  2PBI A;  1A35 A;  1HKS A;  1F36 A;  2JJ7 A;  1QA6 A;  1VQL I;  1NG7 A;  4HST A;  2MAB A;  1RRJ A;  3LOC A;  3CLQ A;  1BL0 A;  3QOE A;  3L1P A;  3V8L A;  2HDC A;  2NOG A;  4KIS A;  2JSP A;  4D9J A;  3F6O A;  3DU5 A;  2M30 A;  1S72 I;  2F5C A;  5ICF A;  2WTE A;  2EZH A;  3M9A A;  1MGT A;  5EYR A;  3RCO A;  4DYR A;  3WU1 B;  5LD2 C;  1MSE C;  2JPB A;  1JTX A;  3K4J A;  4NC7 A;  3KX2 A;  3RKW A;  3KLN A;  2RDP A;  2ZC2 A;  3TW6 A;  1DP7 P;  2Z16 A;  1T56 A;  3DEU A;  3L2U A;  1USS A;  4A3F J;  1R5H A;  3ECH A;  3HKZ N;  3ZQF A;  1XMA A;  1G3W A;  4LLG F;  2HQN A;  3LFU A;  1RIO H;  4A12 A;  2KDZ A;  3D1N I;  1LQ1 A;  1S7A A;  1MJB A;  5JHU A;  2BY1 A;  2NRA C;  1CF7 A;  3OV8 A;  2E7W A;  5F0F A;  2EIM H;  5BMZ A;  4HF1 A;  3UR3 C;  1C0W A;  4LG0 B;  5D8L B;  2ZXH A;  1Z67 A;  4H0E A;  3C2H A;  3CUQ B;  4Q5S F;  2AQF A;  2MBF A;  2JTV A;  3H5A A;  4A3D J;  3CC7 I;  2LP0 A;  2XIG A;  1B72 A;  1ZGA A;  4OMY A;  5DS9 A;  1K4S A;  2H6C A;  3EUH C;  3OIP A;  5M5X J;  3HPH A;  2LKS A;  5EEH A;  1LDJ A;  2L9S A;  1NK2 P;  3GLL A;  4LOC A;  1BI0 A;  2K3P A;  3SDG A;  4CUG A;  2FE3 A;  4XQF A;  1XB4 A;  1Y56 A;  3DXJ F;  1ETO A;  1BM9 A;  1KU2 A;  2D45 A;  1HC8 A;  1NG6 A;  2EIN H;  3WGI A;  2HVR A;  4OIO F;  3ZQC A;  2Y9Y A;  2VXD A;  3K4C A;  5IYB J;  2F5D A;  3DBR B;  3GFI A;  3VOD A;  5LHG A;  1D3Y A;  4KMF A;  2OCE A;  2QSH X;  2NVT J;  2HYJ A;  3D5L A;  3E1S A;  2NVX J;  2O03 A;  1Z7U A;  4XK4 A;  4UUS A;  3S17 J;  2H6B A;  4IHT A;  2IBD A;  1IN6 A;  2VQG A;  3OWT A;  5IOY A;  1VI0 A;  3BT9 A;  3RKX A;  2KMU A;  5CQE A;  2X1C A;  3SHF A;  3CCS I;  1R1V A;  1JKR C;  2QM3 A;  5JR3 A;  1XTA A;  2EIJ H;  4BH9 A;  5F08 A;  1IG7 A;  3FXO A;  4WK8 F;  5EEG A;  3CLO A;  3G1L A;  1XSD A;  3GYH X;  3S1M J;  3BDD A;  2DO7 A;  2XC7 A;  2OTL I;  3C1D A;  3NWT A;  1ON1 A;  3NRV A;  1K78 B;  4EV0 A;  2ZFW A;  4PUS A;  2PG4 A;  4LMY A;  2ZXW H;  3B73 A;  4G12 A;  3VFZ A;  2L7K A;  2HNH A;  2L7Z A;  3C7J A;  2ICW G;  3W6K B;  1O3S A;  2JA6 J;  3ML6 A;  3QPS A;  5LEJ A;  1S3J A;  4BL0 B;  3EYI A;  5DEQ A;  4NHJ A;  4I98 B;  1ZN2 A;  4ENN A;  3K6G A;  2KT0 A;  2YS9 A;  1IN8 A;  2OZ6 A;  2DYS H;  4RB3 C;  1SVM A;  1YS6 A;  1YX5 A;  4XKB A;  1Y0N A;  1YI2 I;  4GYI A;  5DDG A;  4M6X A;  2KRH A;  1FIP A;  2XB0 X;  2DQR A;  3GWZ A;  4A3I J;  3KCC A;  2MLG A;  2VJI A;  3MEX A;  1I6X A;  4C2U A;  4KIC A;  3BG6 A;  1WH5 A;  2IP2 A;  1GT0 C;  4IQJ A;  1XX5 A;  3IHU A;  3LAP A;  1D1B A;  3G1O A;  3BTI A;  5CVI A;  5K5R A;  1FYK A;  5JLW A;  2V79 A;  2PX9 A;  3PIO F;  1B59 A;  2V1D A;  2XAJ A;  3BJ6 A;  3EDP A;  2HS5 A;  3I64 A;  2KQR A;  2BYV E;  3GFJ A;  4A3G J;  2ZME C;  2FRH A;  1R5I D;  1VQ6 I;  4I01 A;  4MQ9 F;  1RI7 A;  5FO5 A;  4DGW B;  1HDD C;  5GTI C;  4JX4 A;  3M1E A;  5M5Y J;  3IUO A;  5HOO A;  4XM3 A;  2G0E A;  2E7X A;  1YOV B;  4KDP A;  3SQN A;  3FMQ A;  1MJ9 A;  3WTX C;  1IDY A;  3ABU A;  1O3Q A;  3IAS 2;  3WTT C;  3OL3 A;  4W97 A;  4EM0 B;  5JVT A;  1BC8 C;  3V7R A;  1ZG1 A;  4NBQ A;  4A93 J;  3ZMS A;  1R71 A;  3MQ0 A;  1ODD A;  3HOX J;  2NVQ J;  2KZG A;  2IGN A;  2L5Q A;  2OUM A;  3S2W A;  1T08 B;  4IZZ A;  1MMS A;  2QEN A;  2V9P A;  2A3S A;  1ZH5 A;  5FRN A;  1WSU A;  4U7D A;  1Z3Y A;  3S1N J;  1Y6I A;  1BOB A;  5H6Q A;  5H2F C;  1ZR4 A;  1IV8 A;  3OYI A;  3HOS A;  2DFI A;  1H9G A;  3OY9 A;  3GME A;  2E2J J;  3H5N A;  2HVS A;  2VUM J;  4DZP A;  3A01 A;  5FJ8 J;  1WJE A;  5K1Y A;  2DN0 A;  3EPZ A;  2XRO A;  3LSH A;  3CCQ I;  3I58 A;  3TW7 A;  3PO2 J;  4Q4Z F;  4GO1 A;  3AG4 H;  2X1D A;  3K7A J;  4UV8 A;  4KFC A;  1ITY A;  1UAA A;  3F8M A;  1G4D A;  3M4O J;  2X4H A;  2PN6 A;  4LJZ F;  4ZDL A;  1O7L A;  1W5S A;  2LRD A;  5HOD A;  3WTW C;  2K9S A;  4LK1 F;  2ME6 A;  3H0D A;  4IRH A;  2ZCW A;  3ZR8 X;  1AKH B;  3CCM I;  3VYU B;  3J81 Z;  3H0G J;  2DDA A;  2CQ7 A;  3BY6 A;  3EUA A;  3IKT A;  2JA7 J;  1V55 H;  1LE8 A;  5E1X A;  1IRX A;  3CZ6 A;  2R7Z J;  1M1E B;  1RES A;  2EB7 A;  2L2O A;  3BR3 A;  3Q3S A;  4OOI A;  3AG2 H;  5E79 C;  4M3G A;  5B1B H;  2HDW A;  2ELH A;  1W5T A;  4RAY A;  4FTH A;  2XPV A;  3E7L A;  2FJ1 A;  2HKX A;  2CW8 A;  1IRF A;  2Q2E B;  4V2G A;  1T38 A;  4D1Q A;  3S1R J;  2L4A A;  5EGO B;  1R5G A;  3G6E I;  1OCP A;  2OTJ I;  2IEK A;  1J5Y A;  2EV0 A;  1JKO C;  2FNA A;  5D6F A;  3ZQI A;  1SAX A;  3OR2 C;  2IS6 A;  4JBA A;  2JVH A;  1A36 A;  1XDU A;  3LA2 A;  2CG4 A;  4AWX B;  1UST A;  4LFU A;  1K61 A;  4E6K G;  1UJ8 A;  2ESN A;  2ZJQ F;  2P0W A;  5HLI A;  5TGT A;  1S7E A;  5E3L A;  2B9S A;  1AKH A;  3LWF A;  1ZGJ A;  4HZF A;  4BBS J;  3ZQL A;  1TNS A;  4OU0 A;  3ESW B;  1TBX A;  3OS0 A;  1O7F A;  4HAM A;  4EJW A;  1W36 D;  1J0R A;  3S3M A;  1BA5 A;  4N4O B;  2VQH A;  3GTM J;  1G2H A;  4HG2 A;  3P7N A;  2KJB A;  2F2E A;  2ZKZ A;  3ROU A;  2HEO A;  3V7C A;  4IHY A;  4ASN A;  1ZHF A;  1LFU P;  2XAU A;  1VTN C;  5AIQ A;  1EJ9 A;  2PLY A;  4CDG A;  3M7G A;  2ELK A;  1VQ5 I;  4GDF A;  3CJT B;  3HZJ A;  1GVJ A;  1IUF A;  2NYX A;  2H1K A;  3DFG A;  4I0B A;  2COM A;  2DI3 A;  5D5X B;  2NS8 A;  3O8H A;  4XRS A;  3F23 A;  2M45 A;  3M07 A;  1CGP A;  1YJN I;  3ZPL A;  2AXL A;  2XKO A;  4UUV A;  2ACJ A;  5E3M A;  4W1U A;  4A3E J;  2IT0 A;  3F21 A;  1U0J A;  1W5C C;  5HS9 A;  5HS8 A;  4IXA A;  1I1S A;  1W7P D;  2DMN A;  3P9I A;  1FP1 D;  3CMY A;  1MDM B;  4BJT A;  1Y39 A;  2EBI A;  2FSW A;  2M1B A;  4BE0 A;  4U0W A;  1ZTR A;  4F55 A;  2Y31 A;  1B1B A;  3JCU C;  1VFC A;  2CWE A;  2XAQ A;  2D1V A;  5J4Y A;  1R23 A;  3GTP J;  1FT9 A;  1HQC A;  2COB A;  1AU7 A;  4DQ2 A;  2X6O A;  5F1R A;  1H8A C;  2F4O B;  3RPU A;  4DW6 A;  2EA4 A;  3NAR A;  2CS3 A;  2QQB A;  3DTK A;  2GXA A;  4GCV A;  1ETX A;  3BZ6 A;  2R92 J;  2P81 A;  2XUB A;  4LIU A;  1LUJ B;  4HEA 2;  1RKW A;  3K70 C;  1V3F A;  2MFZ A;  2OPT A;  3L09 A;  3OYJ A;  3CCR I;  1YRN B;  4Z2Y A;  1ETW A;  4BY1 J;  3TOB A;  4CZZ A;  4YFX F;  1W1W E;  4FX4 A;  1FYM A;  2X6X A;  1PVE A;  1T0F A;  2DT6 A;  5F0C A;  2JA8 J;  1P4A A;  4HYE A;  2B0L A;  3HOY J;  3GZ5 A;  3KP4 A;  2E36 A;  1PJR A;  4IOC F;  2QEX I;  1GV5 A;  5JLX A;  3HKZ A;  3OYC A;  4J19 A;  2WAQ N;  4Y4R A;  1SVL A;  3ONQ A;  1OPC A;  2R7V A;  2DA3 A;  1OR7 A;  2CQQ A;  3M8J A;  2GOX B;  3NAU A;  2MA3 A;  4M9X A;  2Y75 A;  2W24 A;  2VOO A;  3CC4 I;  2IA1 A;  5FRO A;  3WHB A;  4ZYG A;  1VQ4 I;  4F7Z A;  3N05 A;  5EG0 B;  2R7W A;  1TWC J;  2VON A;  5KAI C;  2ZXI A;  1Y1V J;  5J8C A;  2K02 A;  2O8X A;  2ZNY A;  2ZO4 A;  2QKL B;  3DKY A;  4GGG A;  3RSN A;  5D5V B;  2V4J C;  2DQL A;  3WG7 H;  2LMD A;  2CGP A;  5C4X J;  3HL2 A;  5FKM A;  3ZMU A;  3I55 I;  1H0M A;  4LB6 B;  2HQA A;  4YRV A;  1XGS A;  2F5E A;  4HX4 A;  3MCZ A;  5IP6 A;  1R9T J;  3LST A;  1D8J A;  1FSE A;  1P2F A;  1PUE E;  1LJ9 A;  3DQV C;  1O57 A;  4PSX A;  3F22 A;  4AVZ A;  3GUD A;  3IL2 A;  1SAN A;  3SZG A;  4J01 A;  3X2Q H;  3ECO A;  3L2R A;  3DEE A;  1ACI A;  2VE8 A;  4PK4 A;  4MNU A;  2L01 A;  2HTJ A;  2O7O A;  3TMO A;  4Y52 J;  1E17 A;  1P7I A;  1HBX G;  2VIX A;  3JRD A;  4I2O A;  2CFO A;  1T0F C;  3BTC A;  5CVV A;  3CP2 A;  1U5T A;  1I50 J;  3FWE A;  4A5M A;  3ZMD A;  2JA2 A;  1EKE A;  2DYR H;  1WGX A;  2H8W A;  3HTS B;  4YII A;  3TP0 A;  4S0H B;  4CHU A;  2GM4 A;  4IEJ A;  1KON A;  1WJ5 A;  2HXO A;  2VBY A;  3RKY A;  2DCE A;  2VBZ A;  3KZZ A;  5B66 C;  1QZY A;  2R5Z B;  3OYH A;  5J6X A;  4GFB A;  1WWX A;  4AU7 A;  1Z6R A;  2L7F P;  2QZ8 A;  4IX7 A;  1OLT A;  3DPT A;  3T0Y A;  1F9N A;  1VQ8 I;  1T39 A;  4O6J A;  2W00 A;  2CUJ A;  3DKW A;  3GZN B;  5HDK A;  2E5N A;  3KIO A;  2TCT A;  1H89 C;  3IAM 2;  1RET A;  4JP0 A;  3H1C A;  1BC7 C;  2O6G E;  2IAI A;  4RDU A;  3S8P A;  3RYR A;  1ON2 A;  1YYV A;  2D2W A;  2P8T A;  3K1P A;  4JQF A;  4Q48 A;  2R93 J;  3J7A Y;  3WGG A;  4OAY A;  4NNJ A;  2LG4 A;  4ZYD A;  3WU2 C;  2F48 A;  1K4T A;  1JHF A;  2R7T A;  2ZB9 A;  4AYB N;  1UMQ A;  2EZL A;  2XGX A;  3S1Q J;  4NQW A;  2HWV A;  3PM1 A;  4WXD A;  2ZJP F;  2MC3 A;  2QUF A;  3K69 A;  1YW8 A;  1IN4 A;  3K9T A;  2B63 J;  3MN2 A;  1UZC A;  2BHZ A;  4C3J J;  2XF5 A;  5D4R A;  2ME0 A;  4XMY A;  2STT A;  4A5N A;  5DUI A;  3RTR A;  3OYL A;  1X3U A;  4HA8 A;  3J80 K;  3A4C A;  2OF7 A;  4EJV A;  2CUZ A;  2WY8 Q;  4B1R A;  3LNQ A;  2F5V A;  2DLL A;  4AC0 A;  3TDZ C;  4FT8 A;  1BW6 A;  3WG9 A;  1ZR2 A;  2XKP A;  5FLX Z;  3E97 A;  1R00 A;  2IGO A;  2RNG A;  3IRQ A;  3GCM A;  4MEX F;  1WI3 A;  3VOE A;  1YO5 C;  1Z21 A;  4DIQ A;  1JI8 A;  2KPM A;  3IH3 A;  2BXZ A;  5LRS A;  2XV4 S;  3OL4 A;  3QWL A;  2JMW A;  2JWT A;  4LLL A;  3MFK A;  3S32 A;  2V9V A;  4ZTJ A;  4B44 A;  1B8I A;  4KIF A;  2R7O A;  2R7X A;  3KP3 A;  3HOT A;  4NDL A;  2Q2E A;  1WJB A;  2MW8 A;  6PAX A;  2HKO A;  4LIV A;  3S14 J;  1BI1 A;  4FQG A;  4Z6Y A;  3G71 I;  2ISZ A;  4EJT A;  4I0A A;  3VSK A;  1S9H A;  2KIQ A;  2N8G A;  5C3E J;  4AVP A;  2QLZ A;  2IGK A;  2BVL A;  2YU3 A;  3WTY C;  3CUO A;  2CQX A;  2CRG A;  4LB5 A;  4BEH B;  2JQ7 A;  3EET A;  2A61 A;  3ELK A;  1XCV A;  2GWR A;  3DLA A;  2WAD A;  2A6E F;  4CZC A;  3PJR A;  1D0Z A;  2MC4 A;  3SJM A;  3L2V A;  1ZGW A;  1JKP C;  4IQ4 A;  2E35 A;  1K83 J;  1FBU A;  1HW1 A;  5HVQ C;  2AHQ A;  2FBI A;  3R4K A;  1BIB A;  4A3L J;  3RQ4 A;  3KEO A;  2PJR A;  1QZZ A;  2FF4 A;  4IPA A;  1MKM A;  2LLK A;  1U8B A;  1IC8 A;  1HOM A;  2NOJ B;  5KHD A;  4DJA A;  1TT5 B;  1LFB A;  3CJR B;  3BTL A;  3QOP A;  2PMU A;  2EH3 A;  1GXP A;  4XN3 A;  3GBG A;  5JHF A;  5E1W A;  1U78 A;  2K9L A;  3BTJ A;  1U5T C;  1ZRE A;  4KIG A;  3VYR B;  1I3Q J;  4I02 A;  5CVR A;  3MZH A;  2G7H A;  2R3S A;  1JGG A;  1WPK A;  1ZK8 A;  1YW9 A;  5AIP A;  4PFP A;  2ID3 A;  4M73 A;  1P9Q C;  3CCV I;  2Z9O A;  3WOD F;  1MMD A;  4II2 A;  3KYL A;  1EA3 A;  5AON A;  4NUB A;  1HST A;  3RPU D;  3ZRG A;  1VND A;  2M4G A;  3JRF A;  3E5X A;  2HGC A;  5D4S A;  3GTO J;  5FFZ A;  2XRL A;  2IA2 A;  2KLO A;  3FDY A;  4XOT A;  1W0U A;  3I53 A;  1WI9 A;  3ZGK A;  3JSO A;  5BQT A;  3CJN A;  4UUS B;  5IYD J;  4XBF A;  3BJA A;  3CCY A;  3T1B A;  4BE2 A;  1XGN A;  3A0H C;  1OJL A;  3KP2 A;  4C2T A;  2Y30 A;  3PNT A;  2HDD A;  3S15 J;  2WB1 N;  3TO6 A;  3GF2 A;  2FOK A;  4XLC A;  2FD5 A;  1BR1 A;  2VT2 A;  1A31 A;  4U0V A;  4F52 A;  4DBR A;  1S8N A;  1I5Z A;  2P7V B;  2ZME A;  5H20 A;  1DDN A;  1ZRD A;  5E3N A;  3LQQ A;  3CTA A;  2W84 A;  4F93 B;  2WV0 A;  4EM1 A;  3MKW B;  5IPA A;  2Y69 H;  4ZJZ A;  1OR7 C;  1TL8 A;  1TTY A;  1ZEL A;  3IP4 B;  4RS8 A;  4OMZ A;  4RGX A;  1QGP A;  4ENK A;  2EFQ A;  3FF5 A;  3FXR A;  2M7B A;  4RGR A;  3CJQ B;  4II3 A;  4XL9 A;  1OCR H;  1J59 A;  1MNM C;  3MVP A;  4RAG A;  5A2Q K;  4EEF G;  4QLC U;  2B7E A;  2M8G X;  1YQA A;  4XLF A;  4V19 K;  4ON0 A;  1A5J A;  1N75 A;  5FKN A;  1AOY A;  2IS2 A;  1FOW A;  1E2X A;  3HRU A;  1V5E A;  3QOD A;  2D1H A;  3TL4 X;  3ZMZ A;  3SEQ A;  4D5F A;  4R79 A;  1XC5 A;  1L0O C;  5D5W B;  4HV6 A;  3K0L A;  4IHS A;  2IS1 A;  3I4P A;  3HOZ J;  3NWS A;  2DTR A;  5JFR A;  3KE2 A;  5CVJ A;  3HSE A;  1HDP A;  1IN5 A;  3QYF A;  2KIU A;  2MLK A;  1ULY A;  4KIB A;  5J8F A;  3DWL E;  4E70 A;  1HSJ A;  2GBY A;  4N0B A;  3VYS B;  1S6L A;  5KK1 A;  5K5Q A;  4HRI A;  5JVG F;  4DZJ A;  1SAU A;  4YEJ A;  1BBY A;  3HB9 A;  3TO9 A;  5ICC A;  4PJM A;  2BW3 A;  4PJL A;  3GFL A;  3V8J A;  2R5Z A;  3AG1 H;  1OCO H;  4N9H A;  3WTU C;  1F5T A;  1FP2 A;  2KJC A;  2RQP A;  2VJ5 A;  2QVO A;  4YIR X;  2F4M B;  1IJW C;  1FEX A;  2FQ3 A;  2DMQ A;  3QAH A;  2M87 A;  1O3T A;  5HDG A;  3VPR A;  2BVM A;  2L9N A;  4KJZ A;  1EH8 A;  3TDU C;  5DCM A;  5HNF A;  3FBN B;  1J2X A;  3OOP A;  4CCJ A;  2OCC H;  3HOU J;  2UWM A;  1BIA A;  4A6D A;  3CDI A;  2K40 A;  4OIQ F;  1X58 A;  3J7Z I;  1V54 H;  4TV7 A;  3GTL J;  3ZN0 A;  5M5W J;  3CCJ I;  2K7L A;  2K85 A;  1UCR A;  4M3E A;  1LEB A;  5LBQ A;  2W7N A;  2LOO A;  1ORK A;  1MBG A;  4IF4 A;  3CC2 I;  1WFX A;  3ZOB A;  1QVU A;  4ZZL A;  3CD6 I;  4Y13 A;  1QHH D;  1ZLJ A;  2GA2 A;  2KZV A;  3FK6 A;  3BP8 A;  4QSH A;  1JUS A;  3I3L A;  2IPQ X;  2Y2Z A;  5H6R A;  3TED A;  4PGH A;  3ZQQ A;  2VT3 A;  2BY0 A;  3JR9 A;  3FXU A;  2M0M A;  4M3B A;  4UV9 A;  1SD5 A;  4EVI A;  1HW2 A;  3OYN A;  2F4I A;  3IKV A;  3EUH A;  2VJJ A;  2DT5 A;  3QP6 A;  2QA4 I;  3FMS A;  3W2A A;  4B48 A;  4BXF A;  2MD0 A;  1KU3 A;  2V1X A;  4XRF A;  1P6R A;  3Q9S A;  4DYC A;  3FKJ A;  2E5Z A;  3LSR A;  3Q0V A;  1UHW A;  2HOA A;  5J40 A;  5EJC A;  3K4K A;  1FTZ A;  4F92 B;  1CF7 B;  2VI6 A;  2KIF A;  5C44 J;  2FU4 A;  2DXI A;  1N78 A;  5DM6 F;  3MWM A;  4JX6 A;  2L54 A;  5L3B A;  5ILU A;  3DEW A;  4KNY A;  2MH9 A;  4BEH A;  3BG9 A;  2XAG A;  3OIQ A;  3K2A A;  3CES A;  3KP5 A;  3KPH A;  4ENJ A;  1IRG A;  2Z1D A;  4EM2 A;  5TJJ A;  3KZY A;  4DBQ A;  5F04 A;  3Q9V A;  4DYQ A;  3VDX A;  4Y7N J;  3B6C A;  4ZDP A;  4GYG A;  2X6Y A;  3E6D A;  3HGY A;  1SVO A;  1R36 A;  5FKL A;  2PMH A;  2DDB A;  2EQR A;  2LY9 A;  1IZ1 A;  3MKL A;  2OJE D;  3KEY A;  5FD5 A;  2RN7 A;  3JAM K;  3OYM A;  2LBF A;  2QCO A;  5DM7 F;  5IY5 H;  1X1A A;  4XLP F;  1KYZ A;  3AFH A;  1MMA A;  1QQI A;  3FXL A;  2NAZ A;  4U88 A;  4IOA F;  2HPM A;  2M3A A;  1JE8 A;  1Q1V A;  3RYP A;  2ZXJ A;  1MBJ A;  1MMN A;  2LSO A;  4HNU A;  3CF2 A;  1DGW Y;  3B6A A;  1BI2 A;  2LY1 A;  2KIM A;  3H3Z A;  3A03 A;  3ABT A;  5GAD J;  4XRS G;  3ASN H;  4PJ0 C;  5HLG A;  4L5J A;  1D0Y A;  4WXH A;  2VPL A;  2F6C A;  4M6Y A;  5LRR A;  2CFX A;  4BUP A;  3TBI A;  4XID A;  2KP6 A;  4PSW A;  2LVS A;  2GZW A;  5DV5 A;  4QPQ A;  3W3C A;  1W36 C;  4HSR A;  4L5I A;  2DA4 A;  3J81 K;  5GTH C;  4CSW A;  2HU9 A;  3HDD A;  1ETV A;  2QGU A;  1RR7 A;  2V7F A;  5F1J A;  2Q1Z B;  2HXI A;  3L00 A;  2DT7 B;  4OAZ A;  4PGG A;  1X1B A;  5L3F A;  3BR5 A;  3T8R A;  2E34 A;  4IRI A;  1KU9 A;  2CUF A;  4BQQ A;  1ZQ3 P;  2EV6 A;  2GAU A;  2L9R A;  3ISP A;  4XKC A;  4B43 A;  2FML A;  2X1E A;  2XPW A;  4BE1 A;  1SFK A;  2E1M B;  2XHK A;  2EV5 A;  2HYG D;  1X1D A;  1Y8Q B;  1FY7 A;  4AIK A;  3BPV A;  1D8K A;  1FBS A;  1LDK B;  5HS7 A;  3OSG A;  2EIL H;  3K4N A;  4FHT A;  2DFH A;  4B4C A;  3WHC A;  5F6F A;  1MND A;  2J5O A;  1VQP I;  2ZSI B;  1EH6 A;  1XGM A;  4P1W A;  3TO7 A;  5J1Y A;  1POG A;  3GX4 X;  3MZY A;  4A3B J;  4JX5 A;  4BHC A;  1UB9 A;  1OYI A;  1YIT I;  4JK1 X;  4RAF A;  3QP5 A;  4WCG A;  1JUP A;  4PZJ A;  1BJA A;  5FLX K;  4G7H F;  4HLX A;  2GXB A;  1Y8R B;  2ADU A;  4CCN A;  2E1O A;  4R1H A;  5KAF C;  1FTT A;  3S2H J;  1D0X A;  2PFB A;  3E6B A;  3EUK L;  1SFX A;  4C2M J;  3RZO J;  3H9J A;  4KN7 X;  4XKV A;  4BQA A;  1U9N A;  4O5V A;  4IO9 F;  5L3D A;  1TZL A;  1B6A A;  2HVQ A;  4CH7 A;  2I10 A;  5EEA A;  4JOM A;  2VQL A;  4ETS A;  1T2K A;  3L2C A;  1R4N B;  2FOW A;  1XDS A;  2VAS A;  4S04 A;  3E0J B;  2IXS A;  2KIS A;  3I71 A;  4MO7 A;  2BGC A;  4BAC A;  4A3K J;  1E3P A;  1BJZ A;  2LR8 A;  4I7H A;  4MIM A;  1N25 A;  3I9V 2;  1IUY A;  2LF7 A;  1R7J A;  5LFA A;  5FGM A;  4NC8 A;  4C30 A;  1R49 A;  1N77 A;  4XRM A;  2VBX A;  4E7J A;  1ZG5 A;  1YG2 A;  1RC9 A;  4A0Y A;  3LA3 A;  2VQC A;  4M3D A;  1WQ2 A;  3LA7 A;  4IHW A;  3I54 A;  2A68 F;  4Y15 A;  1LNW A;  3JRB A;  3HOW J;  3DCF A;  1LPQ A;  4UY8 I;  3RDI A;  2AXT C;  2WAF A;  4GXO A;  2A07 F;  2DOA A;  3PUF A;  1DP3 A;  1Z91 A;  3GW2 A;  3RQI A;  2LRE A;  4MEY F;  4N4N B;  5FB2 A;  4EQQ A;  2FXA A;  1SD6 A;  2L02 A;  3O8G A;  4XSX F;  3DP7 A;  3MAJ A;  1YE9 A;  2IW5 A;  2VXZ A;  2NVY J;  4YFN F;  2ELJ A;  2OZU A;  5C4J J;  4D7N A;  1G3T A;  4BXU A;  4RBO A;  2CV0 A;  1YS7 A;  3FKI J;  5ILS A;  2H8R A;  4Q47 A;  2QF7 A;  3JSP A;  3MKY B;  2OD5 A;  1GDT A;  2RNJ A;  3C18 A;  2MH2 A;  4L9N A;  1BR2 A;  3H92 A;  2H94 A;  1NTC A;  2NS7 A;  2RRE A;  3COA C;  3Q0W A;  2OU2 A;  1X1P A;  3JRE A;  4NQW B;  2P5K A;  3I4N J;  3V42 A;  2R7Q A;  2KRF A;  3HGG A;  2HQ5 A;  4BDY A;  3DBH B;  4XLE A;  5IOZ A;  4BQN A;  2XAH A;  2KL4 A;  4KT5 C;  5FD6 A;  3CME I;  1KU7 A;  5CQG A;  5F64 A;  1YLF A;  1QPM A;  1MZB A;  1T33 A;  3T5X A;  3V8K A;  2W4S A;  2VE9 A;  3CQZ J;  3LFK A;  1OYY A;  4G6T B;  2ID6 A;  2QQ8 A;  2CU7 A;  4UUT A;  3RPQ A;  4C9Y A;  4RAZ A;  4BBR J;  5IT3 A;  2R0Q C;  1ZKG A;  2BY2 A;  2V6E A;  2W48 A;  4ZZD A;  2QKM B;  2A6H F;  3TGN A;  1Z0X A;  3D5R C;  1FOY A;  1APL C;  1XPX A;  4RB1 A;  2CV2 A;  3A2K A;  2LFB A;  1FSH A;  3FIW A;  3JAM Z;  1PP7 U;  5LGN A;  3K4B A;  1JJ8 C;  3E5Q A;  4UNO A;  5A2Q Z;  2M8E A;  3OS1 A;  1HXD A;  1PDN C;  5FLM J;  2NVU B;  2XGC A;  3ZQ7 A;  4P9U A;  1CQT A;  4AUX A;  4XLH A;  1MNE A;  3C3W A;  3DPL C;  3CUQ C;  4UHT A;  4UB6 C;  3V7S A;  2YU9 J;  5DD8 A;  2X0L A;  1DUX C;  2MGQ A;  2GLO A;  1P92 A;  3UNG C;  3VB2 A;  2IA0 A;  2VKV A;  4KIT B;  3SEZ A;  1L3L A;  2ECC A;  2QWW A;  5BPI A;  3L9F A;  1HA8 A;  2FX0 A;  4UXN A;  2CH0 A;  4AYB A;  1TQP A;  2OA4 A;  2PI0 A;  1MSF C;  2XPU A;  3J7Y J;  5E3O A;  1A6I A;  4ZH4 F;  2BBY A;  3G2B A;  4A69 C;  4A2U A;  5FRM A;  4LK0 F;  1DPU A;  3I5U A;  4MHG A;  2WY7 Q;  3M8E A;  4MLO A;  2O8K A;  4FET A;  1FPQ A;  3I59 B;  4OIP F;  5EZG A;  3FIS A;  5D5U B;  2UXX A;  2LD5 A;  1IXS B;  3U9G A;  4G7Z F;  2LYC A;  2UV1 A;  3H3V K;  3K1M A;  2ESH A;  4UVC A;  3AL0 C;  2WV1 A;  4EMS A;  1NHA A;  3F8N A;  4XOP A;  2HTS A;  3VEP A;  1U9O A;  2M0C A;  2YUS A;  2ZNZ A;  3CMA I;  3NQO A;  2BOL A;  3MKZ A;  4QWQ A;  2DA7 A;  1G6N A;  5LHI A;  4MGR A;  1Z05 A;  1WHU A;  2CJJ A;  2JT1 A;  5ICE A;  1OCZ H;  2P6T A;  1TWH J;  1YRN A;  2EFO A;  1KQ9 A;  3REO A;  3CCL I;  1RR8 C;  2K5C A;  3FBI B;  3PQK A;  3DBL B;  2FBH A;  4Y33 A;  1RUN A;  2M7A A;  4ITV A;  4S05 A;  5FLV A;  1LEA A;  3ZMT A;  2CUE A;  2DJN A;  1YX3 A;  5J1R A;  4IVN A;  1H88 C;  2R7R A;  2EFW A;  3FK7 A;  2E2I J;  2JZY A;  1YW7 A;  3IH4 A;  3CUQ A;  3K1N A;  3M1C A;  5EDN A;  3KYC B;  1B72 B;  2UXN A;  3HRM A;  4X0G A;  3GTG J;  3H5R A;  4IHV A;  1I6H J;  3BJO A;  2CQN A;  2O0Y A;  3DPU A;  2HZT A;  1MDM A;  1X3W B;  4CGZ A;  3VSL A;  4CCO A;  1U8R A;  4A0X A;  5GAH J;  4YIF A;  2OV7 A;  3WE2 A;  3CDL A;  3PL8 A;  1MH4 A;  1ETK A;  5KNL A;  1I1G A;  3LMM A;  4RB2 C;  4BDZ A;  1SD4 A;  1H9T A;  4LD5 A;  3LSJ A;  4XR6 A;  1QNT A;  5K7F A;  1EH7 A;  2GA1 A;  2H1L A;  1IV6 A;  2ZBK A;  2VKE A;  2Q8K A;  4PJN A;  1T98 A;  1FIA A;  2IVM A;  1JT0 A;  3BR1 A;  1R4M B;  4HLY A;  4YG2 F;  1IO2 A;  3CO7 C;  3R60 A;  2PMZ A;  4HF2 A;  2WAQ A;  3U1K A;  3MZ8 A;  3QQA A;  1HKT A;  2X9D A;  3CF5 F;  1K78 A;  2P5V A;  3M3Y J;  5EG0 A;  4M3F A;  2R7F A;  1IF1 A;  2XF6 A;  4AD9 A;  4ANJ A;  3CCE I;  2FA5 A;  2FEZ A;  4M9Z A;  3Q5F A;  1UG0 A;  4LGW A;  4QPO A;  4LIT A;  2O61 A;  4BJ6 C;  4L18 B;  2FMY A;  3OYA A;  3W2V A;  4CXF A;  2R5Y A;  3S16 J;  1VQM I;  1GUU A;  1V4R A;  2NNY A;  4B8X A;  2XSD C;  1Z1D A;  2XB5 A;  3H36 A;  1OYW A;  2DJI A;  3W6J B;  1ZLK A;  5K7H A;  1W0T A;  2DBB A;  3F6V A;  3KFW X;  1FBQ A;  1FC3 A;  3FXQ A;  1ZG3 A;  4A0Z A;  1D1A A;  2V26 A;  4I09 A;  2JA5 J;  3ABL H;  2CYY A;  1MBK A;  2K27 A;  4XLN F;  2EFN A;  2P4W A;  2VPR A;  4BYY A;  4OIR F;  5LLQ A;  3FHZ A;  3U1D A;  5DCF A;  3DKX A;  2VOD A;  3IH2 A;  1MBF A;  2OBP A;  1SEU A;  1U5T B;  2JRT A;  2DMU A;  2OC6 A;  3HPG A;  2VOP A;  4F91 B;  2E71 A;  3HXL A;  4N9I A;  4BNC A;  4CA0 A;  1TWF J;  3QPT A;  4QIW N;  2NS0 A;  3LL7 A;  2DFE A;  2HR3 A;  1I3A A;  1YFH A;  3ABK H;  4OIN F;  4E7Z A;  1VQN I;  5GAG J;  5M3F J;  4CYC B;  1G3Y A;  3EYY A;  2H09 A;  3WTV C;  2BY3 A;  1ENH A;  4CCL A;  3PNV A;  5HLT A;  1WCM J;  1I39 A;  4ZDO A;  1AHD P;  3HSF A;  2CO5 A;  4X6A J;  2W82 A;  3S2D J;  3HUG A;  3QYB A;  5J3L A;  3S93 A;  1Z77 A;  2K3F A;  2YR2 A;  1QZE A;  3FXM A;  1VQO I;  2LF8 A;  2DMP A;  1KGS A;  1B9N A;  4HW0 A;  2LDU A;  4M9S A;  1GLN A;  3KEQ A;  3PNY A;  4QTR A;  1GXQ A;  2MG4 A;  4B47 A;  2BE5 F;  3JRG A;  2ISY A;  5GAE J;  1RNL A;  4G9Y A;  2LKP A;  2EJR A;  3OSF A;  1RKT A;  5CPR B;  3SDB A;  2DFF A;  1XN7 A;  4CYC A;  4ENM A;  3BRO A;  3ZCO A;  2NNN A;  3BQZ A;  2W25 A;  1K7A A;  3H9Q A;  1NH3 A;  2YSR A;  2K4J A;  2V9K A;  4HX7 A;  2P6S A;  4MFD A;  4IHX A;  3JTG A;  4P55 A;  3AKZ A;  3R0A A;  5JI6 A;  1WZ2 A;  4EGY A;  3J80 Z;  1XCB A;  2DAO A;  1ZRF A;  4MTD A;  2LBF B;  1STZ A;  3ZMV A;  1FZP B;  3GXO A;  4EJO A;  3BG3 A;  2I5U A;  4MTE A;  2A6T A;  1IGN A;  4UVA A;  4MFE A;  2KDO A;  3GTQ J;  1UFM A;  4KN4 X;  3OYG A;  1MIJ A;  4PJJ A;  3OYF A;  1XGO A;  1J9I A;  1KYW A;  2WA0 A;  1GV2 A;  1FYL A;  1Z3X A;  2EK5 A;  3FM5 A;  5F27 A;  1LVK A;  1LB2 A;  4FCY A;  1OIS A;  5EGO A;  2X85 A;  5TRD A;  2A5Y B;  5E18 F;  4XNF A;  3HRT A;  3NEU A;  2C6Y A;  2GOM A;  1QBJ A;  2KKO A;  3H3U A;  1XG1 A;  3N97 A;  3BR2 A;  2HPI A;  1EV7 A;  5GPA A;  1SMY F;  3HIF A;  5E20 A;  2R7U A;  3CMM A;  4UVB A;  2QQA A;  4JYK A;  3TQN A;  3BC8 A;  1QRY A;  1JGS A;  3OYB A;  3I59 A;  1K79 A;  1WVR A;  2QBY A;  5K7Z A;  2F5F A;  4X1E A;  2DPU A;  1JKQ C;  2CMP A;  4FE7 A;  4KMU X;  3SFZ A;  1R1T A;  1P4W A;  4IL6 C;  2DU9 A;  2QBY B;  2M2E A;  3O3K A;  1RZ4 A;  5D8K B;  1TC3 C;  1FJL A;  4AM3 A;  2M34 A;  1QHG A;  2XAF A;  5L3E A;  3ASO H;  2TDX A;  3ZP5 A;  2XF7 A;  2IJL A;  3H9G A;  3P9K A;  1DPR A;  3WTS C;  1Z6T A;  1R58 A;  3K4M A;  2BEO A;  4B09 A;  1Q1H A;  3F8C A;  4AID A;  3GFM A;  3QU3 A;  1YIO A;  4H4K C;  1J09 A;  2PJR B;  3TOA A;  5CKT A;  5L3G A;  5FKK A;  4FX0 A;  2WC2 A;  2DOE A;  1R6R A;  2V1N A;  1FMW A;  3LAJ A;  3SFI A;  3PUB A;  4V2F A;  2JN6 A;  2V1U A;  4ESJ A;  2EA2 A;  2CSO A;  4UB8 C;  5B3S H;  2K86 A;  4BS9 A;  3PSI A;  1SMT A;  4HOB A;  3VYT B;  2ZJR F;  3IC7 A;  4O3M A;  3WGH A;  2Q0O A;  2HFH A;  2QSG X;  1QVT A;  5CVU A;  1F43 A;  4XON A;  3AAF A;  2R7S A;  1XMX A;  2JUC A;  3OMY A;  2ECB A;  1FLI A;  3R0J A;  2DW4 A;  4L9V A;  2L7M P;  2PJP A;  3WTZ A;  2HI3 A;  4RGS A;  4GRI A;  3IWZ A;  3HEF A;  4ZC3 A;  3F3X A;  1JUM A;  1ZYR F;  1OMI A;  1R22 A;  4E7I A;  2VB6 A;  5GPC A;  1QPI A;  2BV6 A;  1IXR C;  1VF9 A;  3K2Z A;  3TP3 A;  1U3E M;  4RMN A;  4CYD A;  4L9J A;  1BN5 A;  1ETQ A;  3F9K A;  3QPH A;  2CQK A;  3IV5 A;  4D0P A;  4D5C A;  5IP7 J;  3JW4 A;  2ZSH B;  3O2P E;  4AIH A;  5K5O A;  3L2Q A;  2IRF G;  3M8F A;  2QSF X;  4XKW A;  3ABM H;  4WF2 A;  4IJA A;  3RI4 A;  3C2G A;  2IGM A;  4ZYE A;  1IW7 F;  2RGV A;  3HTU A;  1WJD A;  4BQO A;  3E6M A;  3TKY A;  2K9N A;  3LSM A;  4ZYA A;  5BNG A;  4DOZ A;  1IAW A;  2QQ9 A;  1JTY A;  4P5O A;  1FWZ A;  3BPX A;  3JRI A;  4M74 A;  3RKQ A;  5DD4 A;  1OKR A;  3A1Y A;  3FM3 A;  3HG9 A;  4BGD A;  4HBL A;  4AIJ A;  2HQR A;  2Y9Z A;  4J00 A;  2V6C A;  3BLY A;  2LY2 A;  3RIR A;  1BW5 A;  2X48 A;  3DF8 A;  4KT6 A;  5HDN A;  1X3Z B;  4HDV A;  5EZH A;  2WWY A;  1T6S A;  1VQ9 I;  2D5V A;  2E19 A;  2I8D A;  5LEK A;  1B9M A;  9ANT A;  4CIC A;  3KYD B;  2W57 A;  3QRF F;  1AA7 A;  2M9H A;  4XIC A;  1A6Q A;  1J75 A;  1K6Y A;  1REP C;  3HM5 A;  2VKH A;  3BCB A;  4RM3 A;  3QU6 A;  5ED4 A;  1PUF A;  1XD7 A;  2STW A;  1IRZ A;  4XLA A;  1X2M A;  4PDK A;  3Q0U A;  4BY7 J;  3CO6 C;  4LG3 A;  1I27 A;  1UHS A;  2X51 A;  3U21 A;  4HF0 A;  5IP9 J;  4M6V A;  5IYC J;  4I99 C;  3ZQG A;  1YHQ I;  3KP6 A;  3MD2 A;  4E4H A;  1KA8 A;  1V5G A;  3OR1 C;  1X4O A;  3OIO A;  1WJC A;  1U6G A;  1Z9C A;  3KET A;  2RV8 A;  1DGR M;  3P5J A;  3N4M A;  2A5W A;  2GXG A;  1D5V A;  2JVG A;  2Y0M A;  2H27 A;  1JJ6 C;  2DOD A;  5HNH A;  4ESF A;  4LLN A;  3BG7 A;  4B3X A;  2MD5 A;  1XS9 A;  3HUG B;  1LVA A;  3BWG A;  3IWF A;  3LQR A;  1GHC A;  1FOX A;  2DA5 A;  3ZN1 A;  1LDD A;  4HQE A;  5KCM A;  1Y1W J;  4BKX A;  3HBL A;  1T8I A;  2K9M A;  1X1C A;  3DLL F;  2VLA A;  5CLS A;  4BHB A;  1KQ0 A;  3BG5 A;  2E1N A;  3T8T A;  2BXY A;  3HJE A;  3MMY B;  5CYV A;  4E7H A;  1DU0 A;  2Y48 A;  4HNV A;  3ERE D;  3EQL F;  1MJA A;  1SFE A;  1P7J A;  2HOS A;  1ERD A;  3SYT A;  3JTH A;  4BU2 A;  2O5R A;  1E0E A;  3I56 I;  4I6Z A;  1OCC H;  1A04 A;  1TW3 A;  3BZK A;  4M72 A;  5E8G A;  5ERI A;  1S5L C;  2WBM A;  4U87 A;  3WE3 A;  2R4G A;  1R1U A;  1WKM A;  4DNC A;  3H35 A;  1W7P A;  5BOX A;  4L0Y B;  2JUG A;  4A3C J;  3FHN A;  5DCM B;  3IRR A;  3S3N A;  3ZQH A;  4Y17 A;  4XOR A;  2YX7 A;  2GIV A;  3W2W A;  5J47 A;  5B1A H;  1UEL B;  1MH3 A;  1ZRC A;  3ZXS A;  4L9T A;  1X2N A;  3VWB A;  3PO3 J;  1SC7 A;  2FNP A;  3K10 A;  4R8H A;  3A0B C;  4RB0 A;  4RM2 A;  2IS4 A;  1YJW I;  2Y0S A;  4C3H J;  4IRG A;  4L0Z B;  3LSK A;  1ETY A;  4A6E A;  2L3D A;  1YIJ I;  1PYV A;  1U2W A;  2VKD A;  5IT9 Z;  4WWC A;  2DK8 A;  1IN7 A;  4L5E A;  1FMV A;  3FX3 A;  4RA2 A;  3HSR A;  2XVC A;  3KZI C;  2J5P A;  3OOU A;  1DQU A;  4A3J J;  2PEX A;  1FNN A;  3LSG A;  2DMT A;  3HYI A;  3CP8 A;  3A01 B;  3GTK J;  1OQY A;  3BOQ A;  3F8F A;  2G7U A;  1TWG J;  5CJ9 A;  4BHP A;  1QO0 D;  1TQI A;  3J7A O;  1KQ8 A;  2OQR A;  3OS2 A;  1LFP A;  3HHH A;  2HYF A;  5IT9 K;  3JRC A;  2GQQ A;  4P9F A;  1JT6 A;  1E3H A;  3D5S C;  5B5E C;  4HNT A;  3LSP A;  1WRJ A;  2HZD A;  4Y3O A;  4E7S A;  5FKO A;  4A3M J;  2A69 F;  2ETH A;  2L0K A;  1G8X A;  3UKG A;  2MSY A;  1UHM A;  5M3M J;  1VZ0 A;  4HPQ A;  2K9Q A;  4M71 A;  1TW2 A;  5E1Z B;  3BZC A;  5J1U A;  2E1C A;  1WH7 A;  3FXK A;  4KYW A;  5E8I A;  2YPR A;  5KVR A;  2BZT A;  2Z2S B;  3DU6 A;  2HOE A;  1S7O A;  2M5W A;  3F72 A;  4B3A A;  2RAE A;  1O3R A;  5D6E A;  1G3S A;  1WJF A;  3W6V A;  3OYD A;  2JSC A;  1JHH A;  2QYO A;  2EZI A;  4C3I J;  1TT0 A;  2DA1 A;  2DK5 A;  3G1M A;  1HF0 A;  3BCA A;  3GVA A;  1RUO A;  1KZH A;  3AG3 H;  4WXC A;  4IKF A;  1MBH A;  3G3Z A;  3O6B B;  4CCM A;  1W4M A;  1QU3 A;  1EF4 A;  2DA6 A;  4D7M A;  1BI3 A; 
#chains in the Genus database with same CATH homology
 2XB5 A;  3I4M J;  2XPV A;  3E7L A;  5K7H A;  1W0T A;  2FJ1 A;  2EZK A;  3HOU J;  4V2G A;  2K40 A;  1X58 A;  1E3O C;  3S1R J;  3GTL J;  5M5W J;  4FE4 A;  4M3E A;  5EGO B;  2JA5 J;  1OCP A;  2O9L A;  2IEK A;  1JKO C;  1MBK A;  1ORK A;  1MBG A;  3ZOB A;  1QVU A;  3ZQI A;  5EF6 A;  2VPR A;  3C2B A;  3FK6 A;  4QSH A;  1JUS A;  3TED A;  2Y2Z A;  2R5Y B;  1K61 A;  3JR9 A;  4M3B A;  3IH2 A;  1MBF A;  1S7E A;  5E3L A;  2DMU A;  3BQY A;  1AKH A;  2LK2 A;  4BBS J;  3ZQL A;  1TWF J;  4QIW N;  1UG2 A;  1BA5 A;  2LKX A;  1GVD A;  4DYC A;  3GTM J;  1G2H A;  3LSR A;  5M3F J;  3JRH A;  3Q0V A;  4CYC B;  2HOA A;  2E2H J;  1D5Y A;  1FTZ A;  4IHY A;  1HCR A;  1LFU P;  2VI6 A;  5C44 J;  1ENH A;  2ELK A;  1WCM J;  4JX6 A;  1AHD P;  1IUF A;  5DTD A;  4I76 A;  4X6A J;  3DEW A;  2H1K A;  3S2D J;  5J3L A;  3BG9 A;  2NS8 A;  3K2A A;  1Z77 A;  3O8H A;  4XRS A;  4FIS A;  2DMP A;  4W1U A;  5E3M A;  4A3E J;  2XGE A;  5F04 A;  3BR0 A;  4DYQ A;  4Y7N J;  3B6C A;  2DMN A;  2HOT A;  3CMY A;  3HGY A;  1NK3 P;  4QTR A;  5FKL A;  2EQR A;  2EBI A;  1ZTR A;  2MG4 A;  3F0C A;  2Y31 A;  2LY9 A;  4BXX J;  3MKL A;  1VFC A;  3JRG A;  2DA2 A;  2QCO A;  3GTP J;  3OSF A;  2COB A;  1RKT A;  2LTP A;  1AU7 A;  2X6O A;  1H8A C;  1RPW A;  1PUF B;  4CYC A;  3RZD J;  4DW6 A;  3NAR A;  1O4X A;  3BQZ A;  5GP9 A;  1Q1V A;  2FQ4 A;  1ETX A;  1MBJ A;  2R92 J;  2P81 A;  1RKW A;  1IDZ A;  4MFD A;  2OPT A;  3B6A A;  4IHX A;  3A03 A;  4XRS G;  1YRN B;  1ETW A;  4BY1 J;  2DTZ A;  3BR6 A;  4XID A;  2LVS A;  3QPL A;  5F0C A;  2JA8 J;  3BG3 A;  1SFO J;  2DA4 A;  3GTJ J;  3HOY J;  1OCT C;  4ABZ A;  5F0H A;  1IGN A;  1GV5 A;  5JLX A;  4MFE A;  4J19 A;  3GTQ J;  2WAQ N;  2PMZ N;  3HDD A;  3JRA A;  2DA3 A;  1ETV A;  2CQQ A;  1RR7 A;  1GV2 A;  3NAU A;  2TRT A;  5F27 A;  5F1J A;  4FCY A;  5EGO A;  3WHB A;  2HXI A;  3BR5 A;  5EG0 B;  1TWC J;  1XG1 A;  2CUF A;  1DU6 A;  1ZQ3 P;  1TWA J;  2L9R A;  3BR2 A;  1Y1V J;  2XPW A;  2JK3 A;  5GPA A;  3HOV J;  1B8I B;  5C4X J;  4JYK A;  2AO9 A;  1QRY A;  5FKM A;  1MBE A;  5K7Z A;  4X1E A;  3OSG A;  1JKQ C;  2XGD A;  4FE7 A;  5IP6 A;  1R9T J;  4B4C A;  3WHC A;  1LE8 B;  2M2E A;  1SAN A;  1TC3 C;  1FJL A;  2M34 A;  5J1Y A;  1POG A;  4A3B J;  2O7O A;  3A02 A;  4JX5 A;  4Y52 J;  1P7I A;  3JRD A;  1JUP A;  1OFC X;  3BTC A;  2E1O A;  2Y0S N;  1FTT A;  3S2H J;  1I50 J;  1HLV A;  4C2M J;  3RZO J;  1WGX A;  1U9N A;  5FKK A;  1F36 A;  2JJ7 A;  3TP0 A;  4S0H B;  2GM4 A;  2I10 A;  5EEA A;  3LOC A;  4IEJ A;  1BL0 A;  3L1P A;  2HXO A;  3SFI A;  4V2F A;  2JN6 A;  2R5Z B;  2NOG A;  4MO7 A;  4GFB A;  4A3K J;  4MIM A;  1BJZ A;  2LR8 A;  2L7F P;  2EZH A;  5EYR A;  4DYR A;  1MSE C;  1H89 C;  4XRM A;  2TCT A;  1RET A;  4JP0 A;  1QVT A;  1JTX A;  4M3D A;  2IAI A;  1F43 A;  4RDU A;  4IHW A;  2ECB A;  3JRB A;  3TW6 A;  2R93 J;  3HOW J;  3DCF A;  2L7M P;  1T56 A;  2HI3 A;  2ZB9 A;  3HEF A;  4AYB N;  4A3F J;  1JUM A;  1UMQ A;  2EZL A;  3S1Q J;  3PM1 A;  3HKZ N;  3RQI A;  3ZQF A;  5GPC A;  2B63 J;  3MN2 A;  1QPI A;  3O8G A;  4C3J J;  1VF9 A;  3TP3 A;  2ME0 A;  2KDZ A;  3D1N I;  2NVY J;  5C4J J;  1ETQ A;  4D7N A;  4RBO A;  5F0F A;  2OF7 A;  3IV5 A;  3FKI J;  2H8R A;  4B1R A;  4D5C A;  2QF7 A;  5IP7 J;  3LNQ A;  1GDT A;  4AC0 A;  1BW6 A;  1ZR2 A;  1NTC A;  2NS7 A;  1WI3 A;  3Q0W A;  3IH3 A;  3JRE A;  4A3D J;  2LP0 A;  1B72 A;  5DS9 A;  3I4N J;  2JMW A;  3HGG A;  2HQ5 A;  2JWT A;  5M5X J;  5IOZ A;  2K9N A;  1B8I A;  5BNG A;  1NK2 P;  1JTY A;  4NDL A;  4LOC A;  2MW8 A;  3JRI A;  3RKQ A;  3SDG A;  1T33 A;  3S14 J;  2Y9Z A;  3CQZ J;  2ID6 A;  4UUT A;  2CU7 A;  1ETO A;  4BBR J;  2R0Q C;  2X48 A;  1BW5 A;  1ZKG A;  2N8G A;  2W48 A;  5C3E J;  3ZQC A;  2Y9Y A;  5EZH A;  5IYB J;  1Z0X A;  2D5V A;  2CQX A;  2E19 A;  2CRG A;  9ANT A;  2NVT J;  2HYJ A;  1APL C;  2M9H A;  4XIC A;  2LFB A;  2NVX J;  3HM5 A;  3SJM A;  3FIW A;  1ZGW A;  1JKP C;  1PUF A;  1IRZ A;  1K83 J;  4XK4 A;  1JJ8 C;  1X2M A;  4BY7 J;  3Q0U A;  4UUS A;  2AHQ A;  3S17 J;  4A3L J;  1UHS A;  5IYC J;  5FLM J;  5IP9 J;  4M6V A;  3ZQG A;  2IBD A;  5IOY A;  2XGC A;  1VI0 A;  1CQT A;  3OIO A;  3BT9 A;  4AUX A;  2LLK A;  1U8B A;  1IC8 A;  1HOM A;  1JKR C;  2YU9 J;  5F08 A;  1LFB A;  2MGQ A;  1IG7 A;  3BTL A;  1JJ6 C;  2EH3 A;  1U78 A;  3G1L A;  3GBG A;  2GLO A;  3BTJ A;  3S1M J;  1XS9 A;  2VKV A;  1I3Q J;  2DA5 A;  2ECC A;  4G12 A;  1Y1W J;  4BKX A;  2FX0 A;  1JGG A;  1WPK A;  1ZK8 A;  3HBL A;  2L7Z A;  2JA6 J;  2ID3 A;  1MSF C;  3QPS A;  2XPU A;  3BG5 A;  5E3O A;  1A6I A;  2KT0 A;  2YS9 A;  1DU0 A;  4A69 C;  4HNV A;  1VND A;  1P7J A;  3JRF A;  2HOS A;  4MLO A;  2O8K A;  1FIP A;  2XB0 X;  3GTO J;  2XRL A;  5EZG A;  3FIS A;  2LD5 A;  4A3I J;  4I6Z A;  1W0U A;  4UUS B;  3H3V K;  5IYD J;  1GT0 C;  1WH5 A;  3CCY A;  1OJL A;  4A3C J;  2WV1 A;  2Y30 A;  2HDD A;  3S15 J;  2WB1 N;  2FD5 A;  3ZQH A;  3G1O A;  3BTI A;  5JLW A;  1U9O A;  1MH3 A;  2M0C A;  2YUS A;  1X2N A;  3PO3 J;  5E3N A;  2DA7 A;  5IPA A;  2CJJ A;  4A3G J;  1TWH J;  1YRN A;  4C3H J;  1HDD C;  1ETY A;  4JX4 A;  5M5Y J;  5FLV A;  2G0E A;  2CUE A;  4L5E A;  2DJN A;  5J1R A;  1H88 C;  1IDY A;  4A3J J;  3OOU A;  3LSG A;  2DMT A;  1MNM C;  3MVP A;  3FK7 A;  3A01 B;  3GTK J;  4W97 A;  4EEF G;  2M8G X;  2E2I J;  3IH4 A;  1A5J A;  5EDN A;  5FKN A;  4A93 J;  1TWG J;  1B72 B;  3HOX J;  2NVQ J;  4IHV A;  3GTG J;  1I6H J;  4D5F A;  1XC5 A;  3HOZ J;  3JRC A;  1JT6 A;  3S1N J;  3LSP A;  1ZR4 A;  3CDL A;  5FKO A;  1HDP A;  4A3M J;  2L0K A;  3UKG A;  1MH4 A;  1ETK A;  2MSY A;  5M3M J;  2E2J J;  3LSJ A;  2K9Q A;  2VUM J;  2GBY A;  5K7F A;  4DZP A;  3A01 A;  5J1U A;  5FJ8 J;  1IV6 A;  2VKE A;  1WH7 A;  4DZJ A;  2DN0 A;  3HB9 A;  1FIA A;  3TW7 A;  1JT0 A;  3BR1 A;  3PO2 J;  1ITY A;  4B3A A;  3K7A J;  2RAE A;  3M4O J;  2R5Z A;  3W6V A;  3QQA A;  5HOD A;  2K9S A;  2X9D A;  3M3Y J;  2EZI A;  5EG0 A;  4C3I J;  4M3F A;  2ME6 A;  1IJW C;  1FEX A;  1AKH B;  2DA1 A;  2DMQ A;  3H0G J;  3G1M A;  1HF0 A;  2JA7 J;  1LE8 A;  3VPR A;  1MBH A;  2R7Z J;  1RES A;  3Q3S A;  3BR3 A;  2R5Y A;  3S16 J;  1GUU A;  4M3G A;  1EF4 A;  2DA6 A;  4D7M A;  2XSD C;  4FTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...