1ETQA

The crystal structure of e. coli fis mutant r71y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
85
Chain Sequence
VLTVSTVNSQVTQKPLRDSVKQALKNYFAQLQDVNDLYELVLAEVEQPLLDMVMQYTYGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
total genus 26
structure length 85
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etqA00
3ZQLA 2NVXJ 3HGGA 5M5WJ 2HOAA 1MSEC 3RQIA 1F43A 4X1EA 4IEJA 1TWHJ 3BG5A 4CYCB 1SFOJ 5HODA 4A3DJ 2EH3A 2L7MP 3B6AA 2DTZA 2X9DA 1JKRC 4W97A 2E1OA 1VNDA 2NVYJ 2WAQN 4B3AA 2ZB9A 3CDLA 2E2JJ 5EGOB 2Y2ZA 1BW5A 5E3NA 3OSGA 2FD5A 3CCYA 3M3YJ 5GPCA 4XK4A 4C3JJ 1X2NA 1ZR2A 4X6AJ 4JP0A 3HEFA 1R9TJ 1HOMA 2XGCA 2X6OA 2LY9A 3HGYA 1ETVA 1MBEA 3S16J 2R5YA 1LE8A 3HDDA 3E7LA 1I6HJ 3I4NJ 1JKPC 4JYKA 1AHDP 1X58A 3Q0UA 4M3DA 3GTPJ 3LOCA 1ITYA 4RBOA 2LFBA 1H88C 3CQZJ 2XPUA 3HOXJ 1MH4A 3BG3A 1UMQA 1XG1A 4V2FA 4IHYA 1B72A 3Q0WA 2JA8J 4MFEA 2EZLA 5FKLA 3ZQCA 3G1MA 3CMYA 2D5VA 4A3IJ 3IH2A 1K83J 1NTCA 1UHSA 5EDNA 1HLVA 2NS7A 4BXXJ 3RZDJ 1ETKA 3MKLA 2L7FP 3JRHA 1QVUA 1RETA 2HXIA 2ELKA 1A5JA 1OCPA 1GDTA 4C3HJ 4FE7A 1Z0XA 2IBDA 3TP0A 2VKEA 4M3FA 4XIDA 2EZKA 3BR0A 2M2EA 1W0UA 4XICA 1ETWA 1Y1WJ 5FJ8J 3M4OJ 1EF4A 4FE4A 3BG9A 2XPWA 2JJ7A 1S7EA 3OIOA 3DCFA 5EEAA 4D7MA 2O7OA 2ME6A 1BW6A 3O8HA 4C2MJ 3JR9A 2CQQA 1T56A 2JMWA 1TWGJ 1X2MA 4Y52J 2AO9A 5JLXA 2XB0X 3GTJJ 4EEFG 3O8GA 4BBSJ 3WHBA 1IGNA 2XGDA 2DJNA 2QCOA 5IOZA 1HCRA 2I10A 1MBKA 1SANA 2VKVA 2XRLA 2AHQA 2R7ZJ 5GPAA 1P7IA 1FTZA 2GBYA 5F1JA 3SFIA 1P7JA 3JRIA 5IPAA 3S1MJ 1QVTA 3PO2J 4A3JJ 5C4XJ 2DA5A 4M3EA 1IC8A 2HXOA 1POGA 2R5ZB 2R0QC 3GBGA 2HQ5A 3S2HJ 3NAUA 1TC3C 1MBGA 2LVSA 3GTLJ 1ZGWA 1JUSA 2LP0A 3LSRA 1ZQ3P 1Q1VA 3BR1A 1FTTA 3BR6A 3HBLA 3LSJA 1OJLA 5IYBJ 5K7FA 3JRFA 1IRZA 3JREA 1WI3A 2VPRA 1ETOA 2LR8A 3HM5A 1U9OA 2JA7J 5F0CA 3UKGA 1AU7A 5C3EJ 4BBRJ 1PUFB 3S2DJ 2Y9ZA 2FQ4A 3MVPA 5C4JJ 2LD5A 1ETQA 2JA6J 1AKHA 3DEWA 4FCYA 3TW6A 1T33A 3PO3J 1FEXA 3FKIJ 1B8IB 4JX4A 3W6VA 4B1RA 2K9SA 2K9QA 4UUSA 2H1KA 3JRDA 2KDZA 1XC5A 5E3OA 5EGOA 4NDLA 1U78A 2H8RA 1B72B 3D1NI 2R5ZA 1FIPA 4RDUA 4B4CA 4A3FJ 2ID6A 3BTCA 4QTRA 1U8BA 3S15J 2O9LA 2DA7A 5J1UA 3B6CA 4AYBN 4IHXA 3K7AJ 3H3VK 2DA4A 3LNQA 1QRYA 3LSGA 3GTKJ 1QPIA 2E19A 3QPLA 1H8AC 5EYRA 3S17J 5M5YJ 1VI0A 4QIWN 1JUPA 4MIMA 1OFCX 5IYCJ 4BY7J 2RAEA 5FKNA 4DW6A 4IHWA 1JJ6C 2DA2A 1RKTA 2OF7A 5K7HA 1PUFA 4A3CJ 2EZHA 2XB5A 3LSPA 2M9HA 2WV1A 2MGQA 5F04A 5FLVA 1F36A 1MBJA 2DA6A 3BR3A 5IP6A 4Y7NJ 4L5EA 4AC0A 2JK3A 4DZJA 5EF6A 5BNGA 2NVQJ 4CYCA 3K2AA 1WH7A 3JRBA 3BTIA 2GLOA 4DZPA 3OOUA 2CRGA 2N8GA 2LLKA 4A69C 3GTQJ 1OCTC 4QSHA 5K7ZA 5FKKA 4XRMA 4A3EJ 1HDDC 3BR5A 2MSYA 2E2IJ 2K40A 1WH5A 3NARA 3A01B 2WB1N 3HOZJ 4BY1J 4I6ZA 3TEDA 1I50J 1MBFA 5EZGA 1FJLA 2ECBA 2M34A 1JTYA 4DYCA 1FIAA 5DTDA 4FISA 1ZK8A 2CQXA 2EBIA 4D5CA 2XPVA 2LKXA 1Z77A 2IEKA 2NOGA 2DMNA 2JWTA 4DYRA 3FIWA 3SDGA 5J1RA 5JLWA 1K61A 3ZQHA 2DMQA 2VI6A 3BQYA 2K9NA 2ME0A 2DMUA 4JX5A 2YU9J 3FISA 1BA5A 1JKQC 5IYDJ 2Y9YA 4A3BJ 2X48A 4XRSA 1IG7A 5EG0B 4D7NA 4J19A 1ZR4A 2HI3A 3S1NJ 4A3GJ 4HNVA 2COBA 2LTPA 2MW8A 2GM4A 2KT0A 5J1YA 2E2HJ 1IV6A 3HOYJ 4A3MJ 2O8KA 3S14J 2YS9A 4MLOA 4BKXA 5C44J 3IH4A 5IP9J 3RKQA 4S0HB 1LFUP 1LFBA 1WCMJ 3HB9A 2P81A 1GV2A 1B8IA 1APLC 1MNMC 2LK2A 4UUSB 1WPKA 4MFDA 1O4XA 1TWCJ 3F0CA 1JT0A 5F27A 1HF0A 2TRTA 4A93J 1JTXA 1HDPA 2Y0SN 3RZOJ 1W0TA 1ENHA 2R92J 4M6VA 5GP9A 5M3FJ 1XS9A 3G1OA 1ETXA 3H0GJ 1MH3A 4UUTA 2HOSA 5FKOA 3ZQGA 2ECCA 2VUMJ 3JRGA 4C3IJ 1CQTA 2YUSA 3HOUJ 4GFBA 3A02A 3S1QJ 1MBHA 5E3LA 3BR2A 5F0HA 2TCTA 3GTMJ 3HOVJ 2EZIA 2CJJA 3Q3SA 3MN2A 2FX0A 1UG2A 2XGEA 1A6IA 1IUFA 2QF7A 3WHCA 3ZQIA 2MG4A 1NK2P 1DU6A 1GUUA 3GTOJ 2B63J 2DA3A 3G1LA 3Q0VA 1Y1VJ 4M3BA 3SJMA 1GV5A 1IDYA 2L0KA 2ID3A 4G12A 1GT0C 2CUEA 2DMPA 3HKZN 3ZOBA 2DA1A 3QPSA 2W48A 1ETYA 4MO7A 3PM1A 4W1UA 5F08A 1RESA 3TW7A 3BQZA 1VF9A 3I4MJ 5EG0A 2M0CA 1VFCA 1JUMA 1JGGA 1BJZA 1IDZA 3ZQFA 2L7ZA 1E3OC 4IHVA 5M3MJ 1NK3P 2FJ1A 3JRAA 5EZHA 4DYQA 3BTLA 5FKMA 2HYJA 4JX6A 5E3MA 2Y30A 5J3LA 1H89C 1JT6A 4V2GA 4A3KJ 1DU0A 4D5FA 1RR7A 2CUFA 1JKOC 4I76A 1AKHB 1ORKA 2M8GX 2OPTA 5M5XJ 3A01A 1U9NA 5DS9A 1YRNB 4XRSG 3JRCA 1WGXA 2R5YB 1LE8B 2CU7A 2DN0A 4AUXA 5IP7J 2HDDA 1IJWC 2NS8A 5FLMJ 3IV5A 1RKWA 3FK6A 3IH3A 4M3GA 4A3LJ 1RPWA 1TWFJ 2HOTA 2PMZN 5F0FA 4LOCA 3VPRA 2XSDC 2DMTA 1JJ8C 1BL0A 2NVTJ 3HOWJ 1YRNA 1TWAJ 3A03A 2IAIA 2R93J 5IOYA 3FK7A 1I3QJ 2Y31A 3GTGJ 3L1PA 1D5YA 2JN6A 3BT9A 3C2BA 2G0EA 4ABZA 4FTHA 1MSFC 2JA5J 3BTJA 3TP3A 1GVDA 3QQAA 3OSFA 2EQRA 2L9RA 1ZTRA 9ANTA 3S1RJ 1ZKGA 1G2HA
chains in the Genus database with same CATH superfamily
4OMZA 1T0FC 5F1RA 1SAUA 5LHHA 2DFIA 3F6VA 2UV1A 3LSKA 3HGGA 5M5WJ 3K4NA 1FOXA 3J7ZI 1B59A 3K1PA 3PIOF 4OAZA 2ESHA 4TV7A 3QPHA 4X1EA 4LITA 3ZQQA 4ASNA 1TWHJ 3BG5A 1Z3XA 2V1XA 4RAFA 4CYCB 3W2WA 2L5QA 2XF5A 1JKRC 4W97A 2VASA 3REOA 4M6XA 4ZYAA 3EDPA 1G59A 2FU4A 4HDVA 2E2JJ 1DPUA 2HVRA 2DDAA 2RDPA 3VYTB 2E35A 2W57A 2VE8A 3SXYA 3M3YJ 1IAWA 2WC2A 4M9ZA 3L2CA 1ZR2A 4JP0A 2C6YA 4H4KC 1R9TJ 3VB2A 1HSTA 1NG6A 3ABTA 1HOMA 2XGCA 4ZDPA 3R6SA 3CF2A 1ETVA 2CV2A 1XGOA 1OR7A 1Z6RA 2XVCA 2R5YA 1LE8A 1SD7A 2NXNB 3JTHA 3HDDA 3K9TA 3R60A 1JKPC 3H1CA 1IN8A 1X58A 2HQRA 2EA2A 2KDOA 2X6WA 4M3DA 3GYHX 2L9SA 4IZZA 1ITYA 3OYMA 4RBOA 2XRNA 3BY6A 2FOKA 2CW7A 1S29A 3HOXJ 3WTXC 2KIMA 2E34A 5D8KB 1B72A 4MFEA 2JPBA 4ENJA 3G1MA 5CYVA 3EQLF 3IH2A 3PNYA 2KP6A 2XIGA 4RGUA 3CUQC 3G4SI 4UNOA 3MKLA 1VQ8I 2BY0A 1ZLJA 1I39A 3KZZA 4FT8A 4HSRA 4NBQA 5DUIA 1FC3A 3HSFA 2MH9A 1DQUA 1OCPA 1YQAA 1LEBA 3KYDB 1Z0XA 2IBDA 2PG4A 4EJVA 2PJPA 2QKMB 5E8IA 4CCNA 5LEJA 3B73A 2MD5A 1W0UA 1S6LA 1ETWA 5D4SA 4OMYA 4FE4A 4EGZA 1IN5A 4O6JA 1VQOI 1S7EA 4MEXF 4RB2C 4MGRA 5HLTA 2EWNA 4I98B 2X1CA 2WAEA 1T56A 2JMWA 3JR9A 2AO9A 1X1CA 4KN4X 1SFUA 4E7JA 5D8LB 4HPQA 3OMYA 3M1EA 3GLXA 4HG2A 4QPQA 4BBSJ 2DJNA 1ZGAA 2Z33A 3KEYA 3U9GA 4XN0A 3WTUC 1SANA 2XRLA 2VQGA 2HEOA 2HYGD 4ENKA 2JVHA 4C2TA 3DPTA 1P7IA 3RPUA 1FTZA 4HQEA 2EFWA 3JAMK 1ODDA 1VQ6I 5GAHJ 4ZDOA 3ABUA 3JRIA 3OYEA 1MNEA 3PQKA 1PUEE 1R00A 2IXSA 4M3EA 2HXOA 2RKHA 2FRHA 1O3RA 1PVEA 2QBYB 2HQ5A 3PNTA 3CC7I 5HS9A 2EV0A 1TC3C 1HKTA 3IRRA 1MBGA 2ZFUA 1JUSA 2LP0A 3K4CA 3BJ6A 4LLGF 4HSTA 1F4KA 1OCOH 1FTTA 3PNVA 3BR6A 1C0WA 1OJLA 5IYBJ 2KMUA 2VPRA 2JA7J 3E5XA 3UKGA 1YTYA 1AU7A 2HQNA 1K78A 3OIPA 1PP7U 1TW3A 3KETA 1A35A 3S2DJ 3GLLA 2E1CA 1LQ1A 2DT6A 4R8HA 3ECHA 4PJJA 5C4JJ 2OZ6A 5ICGA 1RI7A 4AIJA 2JA6J 4YFNF 3DEWA 3N97A 3DF8A 3TW6A 1T33A 1T98A 3E97A 3PL8A 1XX5A 3FKIJ 4JX4A 2X4HA 5TISC 4GCVA 1D8JA 1Y0UA 5DUKA 5DEQA 4NC8A 3C7JA 2X6XA 3QAHA 2H1KA 2KKOA 2BBYA 2V1UA 2QYOA 1Z05A 1TLHB 1U78A 4PJLA 1BC7C 2HKXA 4RDUA 5GTIC 2ID6A 2Y0SA 3G3ZA 1LVAA 3U2RA 3FXKA 3BCBA 3I64A 4N4OB 3M8JA 1V54H 2ICWG 3MKYB 2V1NA 2O0YA 1FY7A 2J5OA 5J1UA 4AYBN 4U0YA 3CDIA 3K4LA 2G7UA 1IN7A 4IJAA 3LSGA 2W00A 4KFCA 2QSFX 3QPLA 4YFKF 4BNCA 1QPMA 1K78B 3WTWC 1CF7A 3F9KA 5EYRA 1MMSA 2QBYA 3S17J 5M5YJ 1VI0A 2ELJA 5A2QZ 4N0BA 4YIRX 1X19A 1W36C 4BY7J 5FKNA 1R23A 4DW6A 1SVMA 1YIOA 1WQ2A 4PCQA 1N25A 2DA2A 2RC4A 4RAGA 5FD6A 2XB5A 3KP3A 1WJBA 1ONVA 5FLVA 1F36A 2DA6A 1J59A 3GVAA 4L5EA 4HA8A 4UVAA 4XOPA 3T8TA 4AC0A 2DPUA 3LFKA 3ZQ7A 2EJRA 2PFBA 4CYCA 1G3YA 5L3CA 3JRBA 1I1GA 5D6EA 4G7OF 1N78A 2VKHA 4I99C 1JE8A 1A6QA 4DZPA 1D1AA 2DJIA 2ETHA 1OISA 5F6FA 1Q1HA 5JVTA 3OYLA 3TGNA 2MH2A 3BJAA 4EQQA 4A69C 3GTQJ 1OCTC 3COAC 5FKKA 1MJAA 2WB1A 4CICA 1YI2I 4CZCA 2ZO4A 2MSYA 4GYIA 1R58A 1BJAA 5FO5A 2BE5F 3PSIA 4FQGA 2BHZA 1EKEA 3BDDA 1JHHA 2BHYA 4Y17A 1AA7A 5EZGA 1A31A 1X3WB 2QQAA 1I3AA 5B66C 4RB0A 3FMSA 3FXQA 2VKDA 3SZPA 3ZN1A 2JZYA 1ZK8A 4ENMA 3QP5A 4D5CA 3I9V2 3S93A 3MFKA 2JUGA 4EV0A 4XR6A 5KHDA 4BE1A 3ABKH 4Y3OA 1IZ1A 4BXUA 1K61A 2VI6A 3BQYA 4JX5A 3KEOA 3CP2A 5HS7A 2YU9J 2VT2A 4R1HA 3IL2A 1JKQC 1L3LA 3QU3A 1P4WA 4XRSA 4J19A 2H6CA 3S1NJ 1WJAA 4D9JA 3HYIA 4HNVA 2COBA 1T2KA 4O3MA 1IV6A 2QVOA 1S7AA 4HV6A 5J6XA 1CGPA 1WJFA 2YS9A 3N4MA 4I0AA 4Y13A 3I71A 3E6DA 1LFUP 1LFBA 1MMNA 4O5VA 3OS0A 2VLAA 1APLC 2VBWA 2NNNA 1I6XA 2LK2A 1OCCH 4E7KA 2Y75A 3TL4X 1JT0A 1HF0A 4IQ4A 2WY8Q 3VSKA 4A93J 3OR2C 3SYTA 1VQ7I 4WXDA 1W0TA 2BEOA 1SFKA 2AQEA 3BJOA 2FE3A 2CV0A 3BWGA 3G1OA 5E17F 5KNLA 4QPOA 2NAZA 1LNWA 4KITB 4C2UA 1XCBA 5FKOA 3ZQGA 3JSOA 3CZ6A 3QYEA 2ECCA 2FBIA 1BC8C 4XLCA 5DCMB 2YUSA 3H5RA 3A02A 3GCMA 4GFBA 4DGWB 3BR2A 2YX7A 5F0HA 1F1ZA 2O5RA 4PDKA 4F3QA 4A12A 2HFHA 1SEUA 3IAM2 1UG2A 2M0MA 2XGEA 1A6IA 1IUFA 2DQLA 2IA0A 2QF7A 3HRUA 2MG4A 1NK2P 1IN6A 1DU6A 1B6AA 1HW1A 3CCEI 2FA5A 2EV6A 3G1LA 3Q0VA 3X2QH 1W5SA 3SJMA 3WODF 4AIDA 2L0KA 2ID3A 4G12A 4BE2A 1GT0C 1MDMB 2V7FA 1OYWA 2IJLA 4HAMA 2R7RA 1A36A 5LHIA 1P4XA 1QZYA 3VYSB 3HG9A 1P6RA 1W7PA 3ERED 5F08A 2RQQA 2KZVA 2A5YB 1MIJA 4OIRF 5EG0A 1Z21A 1VFCA 2BZTA 2MA3A 1WRJA 2BGCA 1MJBA 2IGOA 4PGHA 4WK8F 3Q5FA 3L2RA 2BVMA 1E3OC 1NK3P 2FJ1A 2RNGA 3CCMI 1DGWY 3WE2A 3VWBA 2HYJA 2JSPA 1ZHFA 2B0LA 2Y69H 3OYAA 4YELA 1REPC 4NNJA 4A3KJ 2LKPA 3RCOA 3M8FA 1JKOC 2QEXI 4HV5A 4A0YA 2LNBA 3JRCA 1WGXA 2CU7A 3IWFA 1Y0NA 1HW2A 2HDDA 2IS1A 2EILH 2DBBA 2NS8A 3KLNA 1XCVA 3SFZA 1RKWA 2ZJ2A 2HU9A 3FK6A 3IH3A 3LSIA 4M3GA 4F7ZA 3RYRA 2CQNA 3CJRB 1Z7UA 2XAUA 4LOCA 2DMTA 5GTHC 3K1NA 1TWAJ 4CGZA 4IO9F 3K6GA 2K9MA 3L2UA 5IOYA 2FMYA 2H6BA 3OYHA 4RAZA 1D5YA 3GTGJ 2JN6A 2Q8KA 4IHTA 2G0EA 2NOJB 2P5KA 5ICFA 2JA5J 2IW5A 1Y39A 4K2EA 4ESBA 5FFZA 1VQLI 3V4GA 5ILVA 2EQRA 3I4PA 3S1RJ 1ZKGA 2CW0F 1G2HA 1DGRM 2NVXJ 2ISYA 1E3HA 2B7EA 2L9VA 3I56I 1XGNA 4JK1X 3BOQA 2STTA 3RQIA 3IKVA 3NWSA 1S9HA 2IS4A 4A3DJ 5HODA 2EH3A 5FROA 2CS3A 2KPMA 2HPIA 3B6AA 1OYYA 2E1OA 4F92B 2WAQN 4B3AA 1YHQI 2ZB9A 3CDLA 3HZJA 5EGOB 2NS0A 1BW5A 3F6OA 2FD5A 2JVGA 1UAAA 1KU3A 3CCYA 2FNPA 2R7TA 4JQFA 4HNTA 4C3JJ 2QGUA 4X6AJ 2ESNA 4E7HA 2IPQX 2WADA 1AOYA 1WHUA 1SVLA 2Q2EA 2XAFA 2L54A 1WKMA 4XM3A 2I8DA 4BEHB 2CFOA 2NRAC 4BGDA 1F9NA 5DD8A 3EUHA 3K70D 4BHCA 3GTPJ 3WU2C 3R0AA 3F72A 1H88C 3H3ZA 3KCCA 3C18A 4Q5SF 1XTAA 4CCLA 1MH4A 4UUVA 4HDUA 1X3UA 1ZRDA 3H92A 3ZMVA 2JA8J 2EZLA 1S5LC 1FT9A 5FKLA 3WG7H 2VIXA 2ZXIA 3NRVA 3HKZA 1K83J 1NTCA 3I59A 2NS7A 2L9NA 3E6BA 4II2A 1SD6A 2G9WA 4ZYDA 3ABMH 2LOOA 3C1DA 2DXIA 2HXIA 2HS5A 5TJJA 2V6EA 3OV8A 3F8BA 4Q47A 4C3HJ 4E4HA 3M7GA 4OU0A 3CJQB 4I0BA 4XLFA 3BR0A 3H5NA 4IHSA 5CLSA 2BY2A 3ZMDA 1EA3A 1TT5B 4OIQF 1EF4A 3CMAI 3OIOA 2O6GE 4LGWA 5EEAA 3C3WA 4U0VA 3UNGC 4R79A 4WCGA 2IS2A 1YJ9I 4Y52J 1QGPA 5LBQA 2COMA 3I53A 1T38A 3DU5A 3MKWB 3WU1B 1K7AA 2MD0A 3DFGA 4LB6B 3WHBA 5HNHA 2XGDA 2DODA 1TQMA 1LFPA 2E1MC 5IOZA 1HCRA 1SMTA 3BLYA 4IKFA 2VKVA 2DYSH 5D5UB 4KICA 2AHQA 1UFMA 1OR7C 2J5PA 1G3WA 5GPAA 2XASA 4JBAA 3DEEA 3R61A 2GBYA 3K4MA 3O3KA 5FRMA 2KJCA 4A0ZA 1BOBA 4U88A 2QUFA 4ZDLA 3SFIA 3OYBA 4A6EA 1J75A 3S1MJ 3ZCOA 4A3JJ 1YX3A 1IXSB 2DA5A 3L00A 1IC8A 3M9AA 5C4XJ 1POGA 2R5ZB 4EJTA 2R0QC 1QA6A 2DTRA 4E7LA 1R36A 3GBGA 3FDYA 3FXUA 3I59B 2GZWA 5FGMA 2AS5F 2OTJI 3BZKA 4CUGA 3LAPA 2M87A 5IT9Z 2LVSA 2CGPA 2V9KA 3GTLJ 3V7CA 1Q1VA 4UV9A 1D5VA 2HR3A 3HIFA 1Z7LA 2P6TA 4EJUA 3HBLA 1W7PB 5K7FA 1IRZA 3ULQB 3LWFA 1WI3A 1ETOA 2EV5A 3HM5A 1F5TA 1BR4A 5F0CA 1J9IA 3FXJA 3BZCA 4Y15A 4BYYA 5HDNA 2Z3YA 3O2PE 5DM7F 4U7DA 2YX4A 1DDNA 3RPUD 2QZ8A 3HHHA 4BDYA 3K70C 2IS6A 2IGKA 2OV7A 3F3XA 5L3FA 3RTRA 1OMIA 2FBKA 1FEXA 4E7IA 1ZAOA 3RYPA 4CCKA 4AVZA 2BW3A 4B1RA 2WWYA 4C9YA 1K4SA 2K9QA 1LJ9A 4XSXF 3JRDA 3BZ6A 3I55I 4I2OA 1FP2A 5CVJA 1XSDA 2QKLB 2K3PA 1B72B 2R5ZA 2VXDA 4G6QA 1IW7F 4B4CA 1HC8A 1MGTA 1ZG1A 2VE9A 2D45A 1MNDA 3BTCA 1ZYRF 1WI9A 4B43A 2ZNZA 3TQNA 5J4YA 3GZ6A 1U8BA 2DCEA 5E8GA 2NVUB 1LUJB 4DOZA 2K3FA 2EFPA 2OTLI 2DA7A 3UR3C 3W6JB 3ZR8X 4IHXA 3H3VK 4F52A 1R49A 2VBYA 2DFEA 3MKZA 2BXZA 5BS6A 2V9PA 1TNTA 4QIWN 3KP6A 3H0DA 5TGTA 1B1BA 2MFZA 1OFCX 4YG2F 2LF8A 4JOMA 3JAMZ 2KISA 5HVQC 2RAEA 2W7NA 3SHFA 4KN7X 3KP4A 3EUAA 3VEPA 1JJ6C 2OF7A 1T8IA 1QHGA 4A3CJ 2EZHA 2MLGA 3LSPA 1XSVA 2OZUA 4UB6C 4ZYHA 4ZJZA 1X4PA 2DOFA 1TL8A 3HTSB 3GXOA 3GW2A 1KYZA 4U87A 1HXDA 2NVQJ 4YFXF 3K2AA 4KT6A 4Q4ZF 4L0YB 2GLOA 1WSUA 4HW0A 3CCLI 2DT7B 4IPAA 2H8WA 4HYEA 3OL4A 3OOUA 4UVBA 3PJRA 2VC1A 5LGNA 1ZH5A 1MMDA 4KMFA 2V4JC 3E5UA 4GO1A 4QSHA 4XRMA 2KIUA 1YG2A 2DI3A 2V6CA 3ESWB 2H94A 5CVVA 1WH5A 4ZTFA 3JW4A 3LMMA 2F6CA 1J5YA 3HOZJ 2HDWA 1IRFA 3AG1H 3TKYA 2R7SA 4LD5A 3WTZA 3TEDA 3RKWA 1MBFA 4PJ0C 1RR8C 2BOLA 1USTA 2ECBA 1YYVA 1YLFA 2M34A 2UZKA 1QZEA 4GGGA 1U2WA 3CCVI 3H35A 1ACIA 5DTDA 2H09A 3GEZA 2EBIA 4RM2A 2XPVA 3C2HA 3ZP5A 1Z77A 2IEKA 1R5ID 3WTYC 1OYIA 3G73A 2LDUA 1H9GA 2E36A 1KGSA 2JWTA 3D5SC 3FIWA 3CLQA 4MTEA 4DYRA 3BG6A 3ZQHA 2W25A 1QBJA 2VODA 2XAGA 3P9KA 1BA5A 1PJRA 4MQ9F 3CCJI 2P7CB 2Q1ZB 5EG0B 1JHFA 4GRIA 5E18F 1U6GA 4P1WA 2DK8A 2PX9A 1NH3A 3FXOA 2MW8A 2GM4A 2Z1DA 2WY7Q 1R71A 1SVOA 3ZMTA 4PJNA 4A3MJ 3CMMA 5D5XB 1K6YA 2WA0A 3LSHA 1YE9A 5IY5H 3TDUC 3IH4A 5IP9J 3AAFA 1VZ0A 2CFXA 4LIUA 2F5VA 1MNMC 1W5CC 1YFHA 1FX7A 1G3SA 4UUSB 1WPKA 5HLHA 1B9NA 3KX2A 2L01A 1ZLKA 1SFEA 4MFDA 3ABLH 4BACA 4H0EA 3BG7A 1FP1D 2TRTA 4BAYA 4RMNA 3QOPA 1YJNI 3S8PA 2DLLA 1ENHA 4KISA 2R92J 4I7HA 3VSLA 1RZ4A 2R7WA 1RUNA 2W24A 3G6EI 1KU7A 1ETXA 2KRHA 1N77A 3GFMA 3H0GJ 1MH3A 3I54A 1OCZH 1U8RA 2HDCA 1ZARA 3CCRI 1K79A 3TOBA 5CVIA 1RUOA 3K4KA 3LSTA 4WF2A 3G2BA 2VUMJ 3JRGA 3MZ8A 4C3IJ 5DDGA 3OIQA 2F5CA 2ZJPF 2FQ3A 1MKMA 1MBHA 2H1LA 4XLAA 5E3LA 3J80K 3WTTC 2KFDA 3S1QJ 1WJDA 2MYSA 2TCTA 5FRNA 2RVCA 2IGNA 2R7OA 5IT9K 3HUGB 2HVSA 1HQCA 1Y56A 3ZQIA 5E20A 1RRJA 4M3BA 1Y1VJ 2X51A 5D4RA 4IOCF 2V26A 2E60A 2K85A 3Q9SA 1TNSA 3DBHB 2DMPA 5LGTA 2QQBA 1D0YA 4LMYA 3FXRA 3ZOBA 4PK4A 2A07F 1ZREA 3L7WA 2HPMA 2ZFWA 4PGGA 4MO7A 2I5UA 4W1UA 1RESA 3BQZA 2KRCA 3IUOA 3PUBA 1XMAA 1JUMA 4KIGA 5CJ9A 2FXAA 1RC9A 2E71A 4A5NA 2JPCA 4YEJA 2L7ZA 4IHVA 5M3MJ 2GXBA 4KIFA 3JRAA 2WAFA 1ON2A 4RM3A 4DYQA 1L0OC 4B48A 5FKMA 3EYIA 5KAIC 1DP7P 2VQCA 1TTYA 1EH7A 1W4MA 5FB2A 3TO6A 3ERMA 1RR7A 2CUFA 2KRFA 4IX7A 3O6BB 3K4BA 3A01A 3J80Z 2FNAA 1X1AA 2Z9OA 2OCEA 4BDZA 2F5DA 2DN0A 3BPXA 4XONA 3JTGA 5H20A 3DU6A 4KT5C 3ZMZA 3DEUA 4BQOA 1TWFJ 3WE3A 2HOTA 2RGVA 2PMZN 2NVTJ 1UHWA 1MZBA 1YRNA 1BIBA 1JXSA 1U0JA 2QA4I 3A03A 4IRHA 4WXHA 4EMSA 4G6DA 3OYNA 3I0TA 5F64A 2XROA 1AWCA 3C2BA 4HX7A 1JGSA 4B44A 5HLGA 1YITI 3CP8A 3P7NA 2X1DA 1QQIA 2NYXA 2Z16A 3U1KA 3AKZA 4U7BA 5K5OA 4QLCU 2GOMA 5B3SH 3MAJA 3RKYA 1Z1DA 5BPDA 1FYKA 1T95A 2HOAA 3E3VA 1MSEC 2VJJA 4A6DA 4ETSA 1H9TA 2LG4A 3DTIA 2JT1A 2HWVA 4NC7A 1T08B 4IEJA 2L7MP 4YRVA 4L0ZB 5DCMA 3RPQA 2X9DA 2V9VA 3U1DA 3M1CA 4AM3A 2NVYJ 3OYDA 1X1BA 4G7HF 5FLXK 1IRXA 5FD5A 4BE0A 5E3NA 4LFUA 3OSGA 2HZTA 2LREA 3P5JA 3FX3A 4L9NA 4RAYA 5CPRB 2ZKZA 4XK4A 5AONA 4DBRA 5GPCA 5ILSA 5GADJ 5KVRA 4CYDA 2CH0A 2HNHA 1I27A 5JFRA 3VYUB 2X6OA 2LY9A 1P4AA 4XSZF 1MBEA 2A69F 3FBNB 4N9HA 1RNLA 1J7KA 2W84A 4EJWA 5HOOA 3QYFA 4F91B 3I4NJ 3H36A 4HZFA 2UWMA 1AHDP 3J7AY 3FM5A 5HLIA 2TDXA 1Z91A 5B1BH 1FBUA 4FX4A 2FUG2 2LFBA 1J0RA 2XPUA 2BY1A 3CO7C 2VONA 2PQ8A 1UMQA 3BG3A 3HC7A 2DPDA 4KNYA 4V2FA 3GMEA 4IHYA 5LD2C 1U5TB 4BU2A 4XNFA 3ZQCA 3CMYA 3V7SA 2D5VA 2VL8A 1E2XA 1KQ8A 4P5OA 2WAQA 2L02A 2CQ7A 1UHSA 2OU2A 1X4OA 5FFXA 1UCRA 4HLYA 1LPQA 3RZDJ 4BXXJ 1ETKA 1E0EA 2K27A 2A68F 3GFIA 3FM3A 2BV6A 1QO0D 1TBXA 3CUOA 2M8EA 1V3FA 2DO7A 3FWEA 2M45A 4B8XA 1XMXA 1YO5C 2F4OB 3TP0A 3HXLA 2OA4A 4M3FA 5J40A 1W5TA 2M4KA 3CESA 2OD5A 2R7XA 1R22A 2M2EA 3OY9A 4XICA 3M4OJ 5K5RA 3JCUC 4ZZLA 2XPWA 2JJ7A 2XAQA 4LG0A 4D7MA 2ZXJA 2ME6A 3S3OA 3D5RC 3LSMA 4RGSA 1TWGJ 5KK1A 1LB2A 4BQAA 5JLXA 1XDSA 2QLZA 4ON0A 3GTJJ 4PZJA 3J81Z 1ZG5A 5KCMA 1X1PA 2XGXA 5HNFA 4MTDA 2VOPA 4Y4RA 1USSA 1KQ9A 3EUHC 3GX4X 2MLKA 3VOEA 2QCOA 2QM3A 1G8XA 1ZELA 4DBQA 1GXPA 1JI8A 2G7HA 1UB9A 3ONQA 1YIJI 1S72I 1U5TA 2XDVA 2IGMA 2R7ZJ 3AFHA 3AG4H 4OINF 1G3TA 1UJ8A 3QRFF 1BR1A 2RV8A 3T5XA 3H9JA 4CHUA 3ECOA 3CC4I 3CCUI 4P96A 4RGXA 5J8CA 1TW2A 3KZIC 2L2OA 3DPUA 4Z2YA 3NAUA 4XLEA 3S2HJ 3PSFA 1DP3A 3LSRA 3RQ4A 1R5GA 1W1WE 4ANJA 2BVLA 5B5EC 4CH7A 3R0JA 3JRFA 2DU9A 2DAOA 2HTJA 3GFLA 1IO2A 2FOWA 5J4VA 3V42A 4BUPA 2LRDA 3P9CA 3WGHA 1PUFB 1R6RA 1VQNI 1R1UA 3MVPA 3CMEI 4IOAF 2LD5A 1ETQA 3A1YA 2VC0A 1YS6A 4FCYA 1AKHA 3CTAA 4AWXB 3CCQI 3H9GA 1VQPI 1HBXG 4KYWA 1B8IB 5K1YA 5K5QA 2ZMEA 3W6VA 3F23A 2K9SA 4XBFA 4Z6YA 3BROA 1H0MA 3DXJF 4GYGA 1XC5A 4L9VA 2AQFA 2LC2A 3D1NI 3J7YJ 3F22A 2PMUA 2A5WA 4A3FJ 2XF7A 2A6TA 2RQPA 3AG3H 4B09A 1GLNA 2K4JA 4LIVA 4QTRA 4LB5A 3DKXA 3RSNA 2PMHA 3ZXSA 2O9LA 3GFJA 1D1CA 3K7AJ 1OPCA 1KU9A 3ISPA 3LNQA 1QRYA 3OYKA 2Z99A 3RI4A 1LEAA 1QPIA 5LLQA 3HSEA 1P92A 4HF0A 2K4BA 3SZGA 2IRFG 3LFUA 1FOKA 1FYMA 1GHCA 3QWLA 4M6YA 3RDIA 4KDPA 2V79A 5H6QA 1YW7A 3IRQA 1FBQA 2DQRA 2PN6A 3KYCB 4C30A 2M3AA 4L9TA 5LRRA 1FOWA 1BI0A 1O7LA 1TP4A 1RKTA 2PEXA 5K7HA 1PUFA 2DW4A 3EUKL 2MC4A 5F04A 2OAZA 1MBJA 3KYLA 1FZPB 3BR3A 4EVIA 4L9JA 3W2VA 5IP6A 3ASOH 1MW7A 4HNUA 1YS7A 4DZJA 1NHAA 5BNGA 1UZCA 4M72A 2XAHA 3M8EA 3PQJA 1FYLA 1WH7A 4E7ZA 1EH8A 3BTIA 5GAEJ 5B1AH 2LSOA 4LLNA 2CRGA 2ZMEB 3PFYA 4UB8C 2DOAA 2GIZA 4HLXA 1BN5A 2LLKA 1PP8F 3IP4B 5K7ZA 4A3EJ 3CJNA 4G8XA 1HDDC 2X6YA 3BR5A 2K40A 3NARA 1EV7A 1U5TC 3T8RA 3IWZA 1VQMI 2DFHA 4I6ZA 1T39A 1EJ9A 1FJLA 1Z67A 4MNUA 1MMAA 1JTYA 2ELHA 3S32A 1D1BA 4IVNA 3F8FA 4DYCA 1FIAA 4CCJA 2CWEA 1BIAA 1LDDA 2UUZA 4I02A 2P6SA 2CQXA 5LRSA 1OCRH 3FZVA 2LKXA 2NOGA 2A6EF 2HGCA 2RN7A 3SDGA 1IN4A 1IRGA 1V5FA 5JLWA 1K4TA 3FXLA 2DMQA 1K6OA 2K9NA 2ME0A 3DBLB 3IAS2 4BJTA 3CDHA 2YU3A 3CLOA 4RLFA 1IUYA 5H2FC 5JI6A 4G9YA 4D7NA 4YIFA 2HI3A 1YX5A 3NEUA 2E5ZA 3N05A 3QU6A 5L3GA 4IF4A 4B3XA 2E2HJ 2VXZA 3HOYJ 5E1ZB 5LGUA 4BKXA 1V5GA 2XKOA 3DPLC 5C44J 4LK1F 5EEGA 5DM6F 2JUCA 3RKQA 4S0HB 2MBFA 1WCMJ 2KIQA 5L3BA 4AD9A 4HF2A 4A5MA 4NQWA 1TQPA 4RS8A 1O4XA 4V19K 1TWCJ 2A6HF 4II3A 4PFOA 2CSOA 5F27A 3OYGA 3CC2I 1JTXA 2LY1A 2ZJQF 1HDPA 2Q0OA 3ZN0A 5A2QK 3WU0A 4M6VA 2FBHA 5GP9A 3NWTA 2UXNA 3WG9A 1VTNC 2F4IA 3HOSA 2R3SA 1XS9A 1ERDA 1M1EB 3RJPA 1BI1A 2ZXWH 2R7VA 1FLIA 2EFOA 3I5UA 3W2AA 3GO5A 2M4GA 2VBZA 4EM1A 5J8FA 3HOUJ 1KONA 1CF7B 2B9SA 4XQFA 1IF1A 3GTMJ 4P55A 1KU2A 2BY3A 3H9QA 2K86A 3OR1C 2LMDA 3HRMA 1SMYF 4OWRB 1SC7A 3AL0C 3HUGA 1YJWI 2W1OA 1TT0A 2DA3A 5HDGA 3F8NA 3TO9A 1FPQA 4S04A 1IDYA 4QWQA 2Y0MA 2K7LA 2CUEA 3HTUA 2E5NA 2KZGA 3FMQA 2IP2A 5LEKA 3HPGA 3V8JA 1B9MA 3K4JA 2RNJA 4NHJA 3DWLE 3QPSA 1RIOH 2W48A 2E1MB 2YPRA 3PM1A 1YOVB 3DKYA 4XKBA 3TW7A 1O3QA 5DCFA 1VF9A 3I4MJ 5DV5A 2P7VB 5BMZA 1X1DA 1IV8A 2KQRA 4NQWB 1LVKA 1O3SA 3WTVC 1X3ZB 2GWRA 4G7ZF 1FBSA 1B4AA 2L4AA 3L09A 4LG3A 4BHPA 3ZQFA 2M1BA 1HKQA 1QZZA 4X0GA 5EZHA 2GOXB 3ZMSA 3LA3A 1WVRA 3ML6A 3V8KA 1T6SA 4IQJA 4ZTJA 4D5FA 1AKHB 1ORKA 2OPTA 3J7AO 5M5XJ 1U9NA 5DS9A 4E7SA 1MJ9A 3I3LA 4XRSG 3WTSC 2R5YB 1VQ9I 1LE8B 5IP7J 3TMOA 4HOBA 2VJIA 3S3MA 4XLNF 3IV5A 3I58A 3RKXA 4DNCA 4A3LJ 4P9FA 1RPWA 5ERIA 3CCSI 4AVPA 5F0FA 2CG4A 2XSDC 4XOTA 1BL0A 2ZSIB 4MQVA 1WWXA 2R4GA 5CVUA 3GWZA 3LQRA 3B02A 3TOAA 3L2VA 3FK7A 5BQTA 1I3QJ 2Y31A 4EJOA 3IC7A 1MSFC 1A04A 3SEQA 5E1XA 5ED4A 3BTJA 3TP3A 3DV8A 3SDBA 2QQ8A 3ZMUA 4GDFA 2F5FA 2GA2A 3RIRA 1GVDA 3J81K 4ZZDA 1MD0A 5TRDA 1SFXA 1WJCA 5EJCA 3LL7A 2BYVE 4D1QA 1XPXA 1PYVA 4ENNA 3ZQLA 2OQRA 2VN2A 2R7UA 1VQ5I 3OYCA 4J01A 3DKWA 1WJ5A 3DP7A 3H3UA 5ICEA 3HHGA 1F43A 4BL0B 1NG7A 1GVJA 2JRTA 2ZBKA 3AG2H 4Q48A 4A2UA 1SFOJ 3ZPLA 2LBFB 2DTZA 3OOPA 4BH9A 3DLLF 1VNDA 3LA7A 4OOIA 1PDNC 4BJ6C 2ZCWA 2Y2ZA 2K5CA 2FF4A 3U21A 5D6FA 2HZDA 2XSJC 1BBYA 4XRFA 4P9UA 1MMGA 1R1VA 1E17A 2DYRH 4WWCA 1X2NA 3HSRA 4L5JA 1UELB 2EPFA 3HEFA 4PUSA 1XD7A 2KLOA 3GZ5A 1KZHA 2GXGA 3HGYA 1SD5A 3TBIA 1Z3YA 3OYJA 4BXFA 3BPVA 4LLLA 5CQGA 5HS8A 2EINH 3E7LA 5IT3A 1I6HJ 3KP2A 4JYKA 3EYYA 3ZRGA 3DTEA 3Q0UA 2DT5A 3KPHA 3LOCA 4BHBA 1QU3A 4PSXA 4FX0A 4FETA 4AIHA 2A3SA 2EFQA 3CQZJ 1LDKB 1XG1A 2VQLA 2ACJA 4WX9A 3Q0WA 2YSRA 4BQQA 1STZA 2OJED 1G6NA 3A0BC 4A3IJ 4UXNA 3K69A 4Y33A 2EIJH 5EDNA 1HLVA 1WZ2A 1QNTA 5J47A 2L7FP 3JRHA 2LF7A 1QVUA 2M7AA 4BQNA 1RETA 3VODA 2DK5A 3QOEA 2ELKA 1A5JA 3DLAA 5L3DA 1GDTA 4FE7A 2VKEA 3MCZA 1FNNA 1U3EM 4XIDA 1LKXA 2EZKA 2H27A 1ZGJA 2LBFA 1Y1WJ 5FJ8J 1Z9CA 2W85A 3BG9A 4OIPF 2W4SA 3DCFA 1LDJA 2O7OA 1BW6A 3O8HA 2P4WA 4C2MJ 1V55H 4AU7A 2CQQA 4ZYEA 4XLPF 3AL0B 3MQ0A 1X2MA 3CJTB 2ADUA 2CMPA 2XB0X 3E5QA 4NC6A 5H6RA 4EEFG 2IT0A 2FMLA 3O8GA 1FMVA 4GXOA 1DPRA 4M9XA 4D0PA 4EATA 1IGNA 3SQNA 2I10A 2UXXA 1MBKA 1WFXA 2M30A 5CVRA 4FHTA 5DYMA 1FSEA 2JTVA 3BCAA 3QP6A 4DIQA 2P5VA 4E6KG 3V7RA 2CUZA 4RB1A 3K2ZA 4XMYA 5F1JA 5ILUA 3PIPF 3TO7A 5CQEA 5JR3A 1P7JA 2CQKA 5IPAA 1QVTA 1XB4A 3PO2J 3KEQA 5CKTA 1I1SA 5FLXZ 3R4KA 3ASNH 1ULYA 2VJ5A 4XKVA 2FSWA 2GIVA 2R7DA 1TQIA 1VQ4I 1ZGWA 5ICCA 1KQ0A 4OAYA 3OYFA 1ZQ3P 3CD6I 2EB7A 2F2EA 3WGIA 3BR1A 4LJZF 3VFZA 3LSJA 4L5IA 3OYIA 3E6MA 3JREA 2XUBA 1R1TA 2GAUA 5JHFA 2LR8A 1U9OA 3DBRB 5C3EJ 4BBRJ 2JA2A 3K1MA 4AIKA 2FQ4A 2Y9ZA 1UHMA 1ON1A 2HYFA 2VQHA 3A4CA 1IXRC 2XV4S 2Z5UA 1BI2A 2CV1A 2VOOA 3PO3J 3HPHA 2VB6A 2DOEA 3GF2A 2AXLA 2KIFA 4ZYGA 4BJ5C 3KFWX 2P8TA 3FMRA 4RB3C 1HSJA 2YR2A 4F55A 4XL9A 2JQ7A 4L18B 2GQQA 3VDXA 4XKWA 2K9LA 3V8LA 3HRSA 4UUSA 4CCMA 1WJEA 4F93B 2KDZA 5E3OA 2EA4A 2EFNA 2OUMA 4M74A 5EGOA 3MZHA 4NDLA 1IXCA 4NUBA 5L3EA 3M07A 3PFIA 3QYBA 2H8RA 1VQKI 4HX8A 1FIPA 6PAXA 2IVMA 2L4MA 3E6CC 4B47A 3ZGKA 2HOEA 4PSWA 1MDMA 3S15J 3LA2A 4BEHA 3B6CA 1FMWA 3T0YA 4RLQA 5DD4A 4CO8A 2DA4A 2PBIA 3OWTA 3GTKJ 2KHMA 2XAJA 4CCOA 1P2FA 2E19A 3OL3A 4N9IA 1H8AC 3ROUA 2HTSA 3BP8A 3MMYB 1JUPA 1S7OA 4MIMA 1S3JA 5IYCJ 1N75A 4IHWA 1D0ZA 4UHTA 2A05A 2M9HA 2WV1A 2MGQA 4FASD 2X85A 1XGSA 2XC7A 3MZYA 2PJRB 5KAFC 4Y7NJ 1UG0A 3QPTA 2JK3A 2V1DA 1FOYA 3FXMA 4CZZA 5EF6A 2O8XA 1D8KA 3E1SA 4KUMA 4J00A 2E1NA 4AYBA 1J2XA 4XKCA 3W3CA 2O61A 1P9QC 3K0LA 3VYRB 2N8GA 5GAGJ 3L2QA 2IA1A 1S8NA 5AIPA 1YW8A 3GZNB 2WV0A 4CDGA 1Y8RB 4M71A 3S3NA 3L9FA 3KZYA 4XLHA 2L3DA 4PFPA 2XHKA 1O7FA 1W7PD 2HKOA 2LH9A 2VT3A 2R7QA 4RGRA 1KYWA 2E2IJ 2A61A 4XN3A 3EETA 3A01B 2WB1N 3G71I 2MABA 4BY1J 1E3PA 2K02A 4MEYF 3T1BA 1I50J 1Y8QB 3DQVC 1QHHD 5E1WA 4IRGA 3W6KB 2PI0A 4RA2A 2Y48A 2IA2A 4FISA 4KMUX 2ZMEC 2ISZA 2CYYA 2OBPA 1EH6A 1V4RA 4LK0F 3KP7A 2EK5A 2DMNA 2WTEA 3L2WA 3E0JB 2Z2SB 1OKRA 5J1RA 4BS9A 5BPIA 2E7WA 2W82A 2DMUA 3F8CA 3FISA 5LHGA 4YIIA 5IYDJ 2Y9YA 1XMKA 3KP5A 2X48A 4ESJA 1IG7A 1ZR4A 3FBIB 4UY8I 1FWZA 4A3BJ 2E7XA 3HOTA 4A3GJ 4N4NB 1R7JA 4UV8A 2F48A 3FHNA 4EM0B 2LTPA 1BR2A 1BM9A 4HQMA 2KT0A 1OQYA 4WXCA 5J1YA 3MD2A 2O8KA 4G94A 4S05A 3S14J 2X0LA 4MLOA 2RREA 4CSWA 3IHUA 2DFFA 1D0XA 4UVCA 1ZRCA 1BI3A 1FSHA 3HB9A 2HVQA 2P81A 1GV2A 5E79C 4DJAA 1B8IA 2QSHX 4HX4A 1V5EA 2L7KA 2FEZA 3F0CA 4IXAA 2BW3B 4A0XA 5D5VB 2EIMH 3FHZA 2Y0SN 5JVGF 3P9IA 3IKTA 3RZOJ 1O3TA 4DQ2A 2QWWA 3NQOA 1XGMA 5M3FJ 5BOXA 3CUQA 3HRTA 4HRIA 2HQAA 2XKPA 2PJRA 2BXYA 3CO6C 1XDUA 5EEHA 2KJBA 3F8MA 3SZTA 4HBLA 2OCCH 4UUTA 3D5LA 2HOSA 1SD4A 3HL2A 2X1EA 2ZSHB 4PJMA 5D5WB 4OIOF 2LKSA 1Z6TA 1CQTA 3MWMA 1G4DA 2Q2EB 2O3FA 1TZLA 4EM2A 5HDKA 4U0WA 2OC6A 4NB5A 3HOVJ 2EZIA 4G6TB 2CJJA 3Q3SA 3KLOA 3MN2A 2LY2A 2CW8A 2OQGA 2FX0A 4CXFA 2O03A 3SEZA 4I01A 3WHCA 2M5WA 1J09A 3FF5A 4KA4A 2P0WA 1GUUA 4I09A 3GTOJ 2GXAA 2VJ4A 2EIKH 2PMZA 3LAJA 2B63J 3K10A 3PUFA 1GV5A 3A2KA 3EPZA 1GXQA 3HKZN 1DUXC 2DA1A 2KL4A 3S2WA 2F5EA 1Y6IA 4EGYA 1ETYA 2VPLA 4ITVA 1HA8A 4KIBA 1ZN2A 2CO5A 4ZH4F 3CUQB 2M0CA 2M7BA 1I5ZA 2ZXHA 1JGGA 1HW5A 4IL6C 4LG0B 1BJZA 1IDZA 4ZC3A 2QSGX 3CF5F 3BTLA 1W36D 1KA8A 4JX6A 2D1VA 3FKJA 2Y30A 4MHGA 5E3MA 3BC8A 3GUDA 5J3LA 1H89C 1JT6A 3LQQA 4V2GA 1DU0A 3TDZC 4I76A 3H5AA 2M8GX 2ZJRF 2WBMA 1YRNB 2LYCA 2R7FA 2MC3A 4CA0A 3KIOA 1OLTA 4AUXA 2GA1A 2QENA 3MEXA 1XSXA 5LFAA 5FLMJ 1IJWC 2JSCA 1D3YA 4IRIA 1BOAA 2ZNYA 3JSPA 2DDBA 2D2WA 2PLYA 2F4MB 1R4NB 5AIQA 3D0SA 2STWA 3VPRA 2NNYA 2QQ9A 1JJ8C 3HOWJ 4XORA 3KE2A 4HF1A 3DTKA 2CUJA 2IAIA 2VBXA 2R93J 4E70A 3A0HC 3HJEA 4ESFA 4M73A 3S16J 3L1PA 3BT9A 1R5HA 4ABZA 3F21A 4FTHA 2D1HA 2JRMA 3Q9VA 2ZC2A 3ELKA 1YW9A 3C2GA 5JHUA 1O57A 4KJZA 1SAXA 2XF6A 2P5LC 3QQAA 1ZRFA 3OS1A 3OSFA 4HEA2 2L9RA 1ZG3A 1HKSA 3WGGA 1XN7A 3OS2A 1ZTRA 9ANTA 2AXTC 1R4MB 3QODA 4M9SA 1T0FA
chains in the Genus database with same CATH topology
3ZQLA 2NVXJ 3HGGA 5M5WJ 2HOAA 1MSEC 3RQIA 1F43A 4X1EA 4IEJA 1TWHJ 3BG5A 4CYCB 1SFOJ 5HODA 4A3DJ 2EH3A 2L7MP 3B6AA 2DTZA 2X9DA 1JKRC 4W97A 2E1OA 1VNDA 2NVYJ 2WAQN 4B3AA 2ZB9A 3CDLA 2E2JJ 5EGOB 2Y2ZA 1BW5A 5E3NA 3OSGA 2FD5A 3CCYA 3M3YJ 5GPCA 4XK4A 4C3JJ 1X2NA 1ZR2A 4X6AJ 4JP0A 3HEFA 1R9TJ 1HOMA 2XGCA 2X6OA 2LY9A 3HGYA 1ETVA 1MBEA 3S16J 2R5YA 1LE8A 3HDDA 3E7LA 1I6HJ 3I4NJ 1JKPC 4JYKA 1AHDP 1X58A 3Q0UA 4M3DA 3GTPJ 3LOCA 1ITYA 4RBOA 2LFBA 1H88C 3CQZJ 2XPUA 3HOXJ 1MH4A 3BG3A 1UMQA 1XG1A 4V2FA 4IHYA 1B72A 3Q0WA 2JA8J 4MFEA 2EZLA 5FKLA 3ZQCA 3G1MA 3CMYA 2D5VA 4A3IJ 3IH2A 1K83J 1NTCA 1UHSA 5EDNA 1HLVA 2NS7A 4BXXJ 3RZDJ 1ETKA 3MKLA 2L7FP 3JRHA 1QVUA 1RETA 2HXIA 2ELKA 1A5JA 1OCPA 1GDTA 4C3HJ 4FE7A 1Z0XA 2IBDA 3TP0A 2VKEA 4M3FA 4XIDA 2EZKA 3BR0A 2M2EA 1W0UA 4XICA 1ETWA 1Y1WJ 5FJ8J 3M4OJ 1EF4A 4FE4A 3BG9A 2XPWA 2JJ7A 1S7EA 3OIOA 3DCFA 5EEAA 4D7MA 2O7OA 2ME6A 1BW6A 3O8HA 4C2MJ 3JR9A 2CQQA 1T56A 2JMWA 1TWGJ 1X2MA 4Y52J 2AO9A 5JLXA 2XB0X 3GTJJ 4EEFG 3O8GA 4BBSJ 3WHBA 1IGNA 2XGDA 2DJNA 2QCOA 5IOZA 1HCRA 2I10A 1MBKA 1SANA 2VKVA 2XRLA 2AHQA 2R7ZJ 5GPAA 1P7IA 1FTZA 2GBYA 5F1JA 3SFIA 1P7JA 3JRIA 5IPAA 3S1MJ 1QVTA 3PO2J 4A3JJ 5C4XJ 2DA5A 4M3EA 1IC8A 2HXOA 1POGA 2R5ZB 2R0QC 3GBGA 2HQ5A 3S2HJ 3NAUA 1TC3C 1MBGA 2LVSA 3GTLJ 1ZGWA 1JUSA 2LP0A 3LSRA 1ZQ3P 1Q1VA 3BR1A 1FTTA 3BR6A 3HBLA 3LSJA 1OJLA 5IYBJ 5K7FA 3JRFA 1IRZA 3JREA 1WI3A 2VPRA 1ETOA 2LR8A 3HM5A 1U9OA 2JA7J 5F0CA 3UKGA 1AU7A 5C3EJ 4BBRJ 1PUFB 3S2DJ 2Y9ZA 2FQ4A 3MVPA 5C4JJ 2LD5A 1ETQA 2JA6J 1AKHA 3DEWA 4FCYA 3TW6A 1T33A 3PO3J 1FEXA 3FKIJ 1B8IB 4JX4A 3W6VA 4B1RA 2K9SA 2K9QA 4UUSA 2H1KA 3JRDA 2KDZA 1XC5A 5E3OA 5EGOA 4NDLA 1U78A 2H8RA 1B72B 3D1NI 2R5ZA 1FIPA 4RDUA 4B4CA 4A3FJ 2ID6A 3BTCA 4QTRA 1U8BA 3S15J 2O9LA 2DA7A 5J1UA 3B6CA 4AYBN 4IHXA 3K7AJ 3H3VK 2DA4A 3LNQA 1QRYA 3LSGA 3GTKJ 1QPIA 2E19A 3QPLA 1H8AC 5EYRA 3S17J 5M5YJ 1VI0A 4QIWN 1JUPA 4MIMA 1OFCX 5IYCJ 4BY7J 2RAEA 5FKNA 4DW6A 4IHWA 1JJ6C 2DA2A 1RKTA 2OF7A 5K7HA 1PUFA 4A3CJ 2EZHA 2XB5A 3LSPA 2M9HA 2WV1A 2MGQA 5F04A 5FLVA 1F36A 1MBJA 2DA6A 3BR3A 5IP6A 4Y7NJ 4L5EA 4AC0A 2JK3A 4DZJA 5EF6A 5BNGA 2NVQJ 4CYCA 3K2AA 1WH7A 3JRBA 3BTIA 2GLOA 4DZPA 3OOUA 2CRGA 2N8GA 2LLKA 4A69C 3GTQJ 1OCTC 4QSHA 5K7ZA 5FKKA 4XRMA 4A3EJ 1HDDC 3BR5A 2MSYA 2E2IJ 2K40A 1WH5A 3NARA 3A01B 2WB1N 3HOZJ 4BY1J 4I6ZA 3TEDA 1I50J 1MBFA 5EZGA 1FJLA 2ECBA 2M34A 1JTYA 4DYCA 1FIAA 5DTDA 4FISA 1ZK8A 2CQXA 2EBIA 4D5CA 2XPVA 2LKXA 1Z77A 2IEKA 2NOGA 2DMNA 2JWTA 4DYRA 3FIWA 3SDGA 5J1RA 5JLWA 1K61A 3ZQHA 2DMQA 2VI6A 3BQYA 2K9NA 2ME0A 2DMUA 4JX5A 2YU9J 3FISA 1BA5A 1JKQC 5IYDJ 2Y9YA 4A3BJ 2X48A 4XRSA 1IG7A 5EG0B 4D7NA 4J19A 1ZR4A 2HI3A 3S1NJ 4A3GJ 4HNVA 2COBA 2LTPA 2MW8A 2GM4A 2KT0A 5J1YA 2E2HJ 1IV6A 3HOYJ 4A3MJ 2O8KA 3S14J 2YS9A 4MLOA 4BKXA 5C44J 3IH4A 5IP9J 3RKQA 4S0HB 1LFUP 1LFBA 1WCMJ 3HB9A 2P81A 1GV2A 1B8IA 1APLC 1MNMC 2LK2A 4UUSB 1WPKA 4MFDA 1O4XA 1TWCJ 3F0CA 1JT0A 5F27A 1HF0A 2TRTA 4A93J 1JTXA 1HDPA 2Y0SN 3RZOJ 1W0TA 1ENHA 2R92J 4M6VA 5GP9A 5M3FJ 1XS9A 3G1OA 1ETXA 3H0GJ 1MH3A 4UUTA 2HOSA 5FKOA 3ZQGA 2ECCA 2VUMJ 3JRGA 4C3IJ 1CQTA 2YUSA 3HOUJ 4GFBA 3A02A 3S1QJ 1MBHA 5E3LA 3BR2A 5F0HA 2TCTA 3GTMJ 3HOVJ 2EZIA 2CJJA 3Q3SA 3MN2A 2FX0A 1UG2A 2XGEA 1A6IA 1IUFA 2QF7A 3WHCA 3ZQIA 2MG4A 1NK2P 1DU6A 1GUUA 3GTOJ 2B63J 2DA3A 3G1LA 3Q0VA 1Y1VJ 4M3BA 3SJMA 1GV5A 1IDYA 2L0KA 2ID3A 4G12A 1GT0C 2CUEA 2DMPA 3HKZN 3ZOBA 2DA1A 3QPSA 2W48A 1ETYA 4MO7A 3PM1A 4W1UA 5F08A 1RESA 3TW7A 3BQZA 1VF9A 3I4MJ 5EG0A 2M0CA 1VFCA 1JUMA 1JGGA 1BJZA 1IDZA 3ZQFA 2L7ZA 1E3OC 4IHVA 5M3MJ 1NK3P 2FJ1A 3JRAA 5EZHA 4DYQA 3BTLA 5FKMA 2HYJA 4JX6A 5E3MA 2Y30A 5J3LA 1H89C 1JT6A 4V2GA 4A3KJ 1DU0A 4D5FA 1RR7A 2CUFA 1JKOC 4I76A 1AKHB 1ORKA 2M8GX 2OPTA 5M5XJ 3A01A 1U9NA 5DS9A 1YRNB 4XRSG 3JRCA 1WGXA 2R5YB 1LE8B 2CU7A 2DN0A 4AUXA 5IP7J 2HDDA 1IJWC 2NS8A 5FLMJ 3IV5A 1RKWA 3FK6A 3IH3A 4M3GA 4A3LJ 1RPWA 1TWFJ 2HOTA 2PMZN 5F0FA 4LOCA 3VPRA 2XSDC 2DMTA 1JJ8C 1BL0A 2NVTJ 3HOWJ 1YRNA 1TWAJ 3A03A 2IAIA 2R93J 5IOYA 3FK7A 1I3QJ 2Y31A 3GTGJ 3L1PA 1D5YA 2JN6A 3BT9A 3C2BA 2G0EA 4ABZA 4FTHA 1MSFC 2JA5J 3BTJA 3TP3A 1GVDA 3QQAA 3OSFA 2EQRA 2L9RA 1ZTRA 9ANTA 3S1RJ 1ZKGA 1G2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQL A;  2NVX J;  3HGG A;  5M5W J;  2HOA A;  1MSE C;  3RQI A;  1F43 A;  4X1E A;  4IEJ A;  1TWH J;  3BG5 A;  4CYC B;  1SFO J;  5HOD A;  4A3D J;  2EH3 A;  2L7M P;  3B6A A;  2DTZ A;  2X9D A;  1JKR C;  4W97 A;  2E1O A;  1VND A;  2NVY J;  2WAQ N;  4B3A A;  2ZB9 A;  3CDL A;  2E2J J;  5EGO B;  2Y2Z A;  1BW5 A;  5E3N A;  3OSG A;  2FD5 A;  3CCY A;  3M3Y J;  5GPC A;  4XK4 A;  4C3J J;  1X2N A;  1ZR2 A;  4X6A J;  4JP0 A;  3HEF A;  1R9T J;  1HOM A;  2XGC A;  2X6O A;  2LY9 A;  3HGY A;  1ETV A;  1MBE A;  3S16 J;  2R5Y A;  1LE8 A;  3HDD A;  3E7L A;  1I6H J;  3I4N J;  1JKP C;  4JYK A;  1AHD P;  1X58 A;  3Q0U A;  4M3D A;  3GTP J;  3LOC A;  1ITY A;  4RBO A;  2LFB A;  1H88 C;  3CQZ J;  2XPU A;  3HOX J;  1MH4 A;  3BG3 A;  1UMQ A;  1XG1 A;  4V2F A;  4IHY A;  1B72 A;  3Q0W A;  2JA8 J;  4MFE A;  2EZL A;  5FKL A;  3ZQC A;  3G1M A;  3CMY A;  2D5V A;  4A3I J;  3IH2 A;  1K83 J;  1NTC A;  1UHS A;  5EDN A;  1HLV A;  2NS7 A;  4BXX J;  3RZD J;  1ETK A;  3MKL A;  2L7F P;  3JRH A;  1QVU A;  1RET A;  2HXI A;  2ELK A;  1A5J A;  1OCP A;  1GDT A;  4C3H J;  4FE7 A;  1Z0X A;  2IBD A;  3TP0 A;  2VKE A;  4M3F A;  4XID A;  2EZK A;  3BR0 A;  2M2E A;  1W0U A;  4XIC A;  1ETW A;  1Y1W J;  5FJ8 J;  3M4O J;  1EF4 A;  4FE4 A;  3BG9 A;  2XPW A;  2JJ7 A;  1S7E A;  3OIO A;  3DCF A;  5EEA A;  4D7M A;  2O7O A;  2ME6 A;  1BW6 A;  3O8H A;  4C2M J;  3JR9 A;  2CQQ A;  1T56 A;  2JMW A;  1TWG J;  1X2M A;  4Y52 J;  2AO9 A;  5JLX A;  2XB0 X;  3GTJ J;  4EEF G;  3O8G A;  4BBS J;  3WHB A;  1IGN A;  2XGD A;  2DJN A;  2QCO A;  5IOZ A;  1HCR A;  2I10 A;  1MBK A;  1SAN A;  2VKV A;  2XRL A;  2AHQ A;  2R7Z J;  5GPA A;  1P7I A;  1FTZ A;  2GBY A;  5F1J A;  3SFI A;  1P7J A;  3JRI A;  5IPA A;  3S1M J;  1QVT A;  3PO2 J;  4A3J J;  5C4X J;  2DA5 A;  4M3E A;  1IC8 A;  2HXO A;  1POG A;  2R5Z B;  2R0Q C;  3GBG A;  2HQ5 A;  3S2H J;  3NAU A;  1TC3 C;  1MBG A;  2LVS A;  3GTL J;  1ZGW A;  1JUS A;  2LP0 A;  3LSR A;  1ZQ3 P;  1Q1V A;  3BR1 A;  1FTT A;  3BR6 A;  3HBL A;  3LSJ A;  1OJL A;  5IYB J;  5K7F A;  3JRF A;  1IRZ A;  3JRE A;  1WI3 A;  2VPR A;  1ETO A;  2LR8 A;  3HM5 A;  1U9O A;  2JA7 J;  5F0C A;  3UKG A;  1AU7 A;  5C3E J;  4BBR J;  1PUF B;  3S2D J;  2Y9Z A;  2FQ4 A;  3MVP A;  5C4J J;  2LD5 A;  1ETQ A;  2JA6 J;  1AKH A;  3DEW A;  4FCY A;  3TW6 A;  1T33 A;  3PO3 J;  1FEX A;  3FKI J;  1B8I B;  4JX4 A;  3W6V A;  4B1R A;  2K9S A;  2K9Q A;  4UUS A;  2H1K A;  3JRD A;  2KDZ A;  1XC5 A;  5E3O A;  5EGO A;  4NDL A;  1U78 A;  2H8R A;  1B72 B;  3D1N I;  2R5Z A;  1FIP A;  4RDU A;  4B4C A;  4A3F J;  2ID6 A;  3BTC A;  4QTR A;  1U8B A;  3S15 J;  2O9L A;  2DA7 A;  5J1U A;  3B6C A;  4AYB N;  4IHX A;  3K7A J;  3H3V K;  2DA4 A;  3LNQ A;  1QRY A;  3LSG A;  3GTK J;  1QPI A;  2E19 A;  3QPL A;  1H8A C;  5EYR A;  3S17 J;  5M5Y J;  1VI0 A;  4QIW N;  1JUP A;  4MIM A;  1OFC X;  5IYC J;  4BY7 J;  2RAE A;  5FKN A;  4DW6 A;  4IHW A;  1JJ6 C;  2DA2 A;  1RKT A;  2OF7 A;  5K7H A;  1PUF A;  4A3C J;  2EZH A;  2XB5 A;  3LSP A;  2M9H A;  2WV1 A;  2MGQ A;  5F04 A;  5FLV A;  1F36 A;  1MBJ A;  2DA6 A;  3BR3 A;  5IP6 A;  4Y7N J;  4L5E A;  4AC0 A;  2JK3 A;  4DZJ A;  5EF6 A;  5BNG A;  2NVQ J;  4CYC A;  3K2A A;  1WH7 A;  3JRB A;  3BTI A;  2GLO A;  4DZP A;  3OOU A;  2CRG A;  2N8G A;  2LLK A;  4A69 C;  3GTQ J;  1OCT C;  4QSH A;  5K7Z A;  5FKK A;  4XRM A;  4A3E J;  1HDD C;  3BR5 A;  2MSY A;  2E2I J;  2K40 A;  1WH5 A;  3NAR A;  3A01 B;  2WB1 N;  3HOZ J;  4BY1 J;  4I6Z A;  3TED A;  1I50 J;  1MBF A;  5EZG A;  1FJL A;  2ECB A;  2M34 A;  1JTY A;  4DYC A;  1FIA A;  5DTD A;  4FIS A;  1ZK8 A;  2CQX A;  2EBI A;  4D5C A;  2XPV A;  2LKX A;  1Z77 A;  2IEK A;  2NOG A;  2DMN A;  2JWT A;  4DYR A;  3FIW A;  3SDG A;  5J1R A;  5JLW A;  1K61 A;  3ZQH A;  2DMQ A;  2VI6 A;  3BQY A;  2K9N A;  2ME0 A;  2DMU A;  4JX5 A;  2YU9 J;  3FIS A;  1BA5 A;  1JKQ C;  5IYD J;  2Y9Y A;  4A3B J;  2X48 A;  4XRS A;  1IG7 A;  5EG0 B;  4D7N A;  4J19 A;  1ZR4 A;  2HI3 A;  3S1N J;  4A3G J;  4HNV A;  2COB A;  2LTP A;  2MW8 A;  2GM4 A;  2KT0 A;  5J1Y A;  2E2H J;  1IV6 A;  3HOY J;  4A3M J;  2O8K A;  3S14 J;  2YS9 A;  4MLO A;  4BKX A;  5C44 J;  3IH4 A;  5IP9 J;  3RKQ A;  4S0H B;  1LFU P;  1LFB A;  1WCM J;  3HB9 A;  2P81 A;  1GV2 A;  1B8I A;  1APL C;  1MNM C;  2LK2 A;  4UUS B;  1WPK A;  4MFD A;  1O4X A;  1TWC J;  3F0C A;  1JT0 A;  5F27 A;  1HF0 A;  2TRT A;  4A93 J;  1JTX A;  1HDP A;  2Y0S N;  3RZO J;  1W0T A;  1ENH A;  2R92 J;  4M6V A;  5GP9 A;  5M3F J;  1XS9 A;  3G1O A;  1ETX A;  3H0G J;  1MH3 A;  4UUT A;  2HOS A;  5FKO A;  3ZQG A;  2ECC A;  2VUM J;  3JRG A;  4C3I J;  1CQT A;  2YUS A;  3HOU J;  4GFB A;  3A02 A;  3S1Q J;  1MBH A;  5E3L A;  3BR2 A;  5F0H A;  2TCT A;  3GTM J;  3HOV J;  2EZI A;  2CJJ A;  3Q3S A;  3MN2 A;  2FX0 A;  1UG2 A;  2XGE A;  1A6I A;  1IUF A;  2QF7 A;  3WHC A;  3ZQI A;  2MG4 A;  1NK2 P;  1DU6 A;  1GUU A;  3GTO J;  2B63 J;  2DA3 A;  3G1L A;  3Q0V A;  1Y1V J;  4M3B A;  3SJM A;  1GV5 A;  1IDY A;  2L0K A;  2ID3 A;  4G12 A;  1GT0 C;  2CUE A;  2DMP A;  3HKZ N;  3ZOB A;  2DA1 A;  3QPS A;  2W48 A;  1ETY A;  4MO7 A;  3PM1 A;  4W1U A;  5F08 A;  1RES A;  3TW7 A;  3BQZ A;  1VF9 A;  3I4M J;  5EG0 A;  2M0C A;  1VFC A;  1JUM A;  1JGG A;  1BJZ A;  1IDZ A;  3ZQF A;  2L7Z A;  1E3O C;  4IHV A;  5M3M J;  1NK3 P;  2FJ1 A;  3JRA A;  5EZH A;  4DYQ A;  3BTL A;  5FKM A;  2HYJ A;  4JX6 A;  5E3M A;  2Y30 A;  5J3L A;  1H89 C;  1JT6 A;  4V2G A;  4A3K J;  1DU0 A;  4D5F A;  1RR7 A;  2CUF A;  1JKO C;  4I76 A;  1AKH B;  1ORK A;  2M8G X;  2OPT A;  5M5X J;  3A01 A;  1U9N A;  5DS9 A;  1YRN B;  4XRS G;  3JRC A;  1WGX A;  2R5Y B;  1LE8 B;  2CU7 A;  2DN0 A;  4AUX A;  5IP7 J;  2HDD A;  1IJW C;  2NS8 A;  5FLM J;  3IV5 A;  1RKW A;  3FK6 A;  3IH3 A;  4M3G A;  4A3L J;  1RPW A;  1TWF J;  2HOT A;  2PMZ N;  5F0F A;  4LOC A;  3VPR A;  2XSD C;  2DMT A;  1JJ8 C;  1BL0 A;  2NVT J;  3HOW J;  1YRN A;  1TWA J;  3A03 A;  2IAI A;  2R93 J;  5IOY A;  3FK7 A;  1I3Q J;  2Y31 A;  3GTG J;  3L1P A;  1D5Y A;  2JN6 A;  3BT9 A;  3C2B A;  2G0E A;  4ABZ A;  4FTH A;  1MSF C;  2JA5 J;  3BTJ A;  3TP3 A;  1GVD A;  3QQA A;  3OSF A;  2EQR A;  2L9R A;  1ZTR A;  9ANT A;  3S1R J;  1ZKG A;  1G2H A; 
#chains in the Genus database with same CATH topology
 4OMZ A;  1T0F C;  5F1R A;  1SAU A;  5LHH A;  2DFI A;  3F6V A;  2UV1 A;  3LSK A;  3HGG A;  5M5W J;  3K4N A;  1FOX A;  3J7Z I;  1B59 A;  3K1P A;  3PIO F;  4OAZ A;  2ESH A;  4TV7 A;  3QPH A;  4X1E A;  4LIT A;  3ZQQ A;  4ASN A;  1TWH J;  3BG5 A;  1Z3X A;  2V1X A;  4RAF A;  4CYC B;  3W2W A;  2L5Q A;  2XF5 A;  1JKR C;  4W97 A;  2VAS A;  3REO A;  4M6X A;  4ZYA A;  3EDP A;  1G59 A;  2FU4 A;  4HDV A;  2E2J J;  1DPU A;  2HVR A;  2DDA A;  2RDP A;  3VYT B;  2E35 A;  2W57 A;  2VE8 A;  3SXY A;  3M3Y J;  1IAW A;  2WC2 A;  4M9Z A;  3L2C A;  1ZR2 A;  4JP0 A;  2C6Y A;  4H4K C;  1R9T J;  3VB2 A;  1HST A;  1NG6 A;  3ABT A;  1HOM A;  2XGC A;  4ZDP A;  3R6S A;  3CF2 A;  1ETV A;  2CV2 A;  1XGO A;  1OR7 A;  1Z6R A;  2XVC A;  2R5Y A;  1LE8 A;  1SD7 A;  2NXN B;  3JTH A;  3HDD A;  3K9T A;  3R60 A;  1JKP C;  3H1C A;  1IN8 A;  1X58 A;  2HQR A;  2EA2 A;  2KDO A;  2X6W A;  4M3D A;  3GYH X;  2L9S A;  4IZZ A;  1ITY A;  3OYM A;  4RBO A;  2XRN A;  3BY6 A;  2FOK A;  2CW7 A;  1S29 A;  3HOX J;  3WTX C;  2KIM A;  2E34 A;  5D8K B;  1B72 A;  4MFE A;  2JPB A;  4ENJ A;  3G1M A;  5CYV A;  3EQL F;  3IH2 A;  3PNY A;  2KP6 A;  2XIG A;  4RGU A;  3CUQ C;  3G4S I;  4UNO A;  3MKL A;  1VQ8 I;  2BY0 A;  1ZLJ A;  1I39 A;  3KZZ A;  4FT8 A;  4HSR A;  4NBQ A;  5DUI A;  1FC3 A;  3HSF A;  2MH9 A;  1DQU A;  1OCP A;  1YQA A;  1LEB A;  3KYD B;  1Z0X A;  2IBD A;  2PG4 A;  4EJV A;  2PJP A;  2QKM B;  5E8I A;  4CCN A;  5LEJ A;  3B73 A;  2MD5 A;  1W0U A;  1S6L A;  1ETW A;  5D4S A;  4OMY A;  4FE4 A;  4EGZ A;  1IN5 A;  4O6J A;  1VQO I;  1S7E A;  4MEX F;  4RB2 C;  4MGR A;  5HLT A;  2EWN A;  4I98 B;  2X1C A;  2WAE A;  1T56 A;  2JMW A;  3JR9 A;  2AO9 A;  1X1C A;  4KN4 X;  1SFU A;  4E7J A;  5D8L B;  4HPQ A;  3OMY A;  3M1E A;  3GLX A;  4HG2 A;  4QPQ A;  4BBS J;  2DJN A;  1ZGA A;  2Z33 A;  3KEY A;  3U9G A;  4XN0 A;  3WTU C;  1SAN A;  2XRL A;  2VQG A;  2HEO A;  2HYG D;  4ENK A;  2JVH A;  4C2T A;  3DPT A;  1P7I A;  3RPU A;  1FTZ A;  4HQE A;  2EFW A;  3JAM K;  1ODD A;  1VQ6 I;  5GAH J;  4ZDO A;  3ABU A;  3JRI A;  3OYE A;  1MNE A;  3PQK A;  1PUE E;  1R00 A;  2IXS A;  4M3E A;  2HXO A;  2RKH A;  2FRH A;  1O3R A;  1PVE A;  2QBY B;  2HQ5 A;  3PNT A;  3CC7 I;  5HS9 A;  2EV0 A;  1TC3 C;  1HKT A;  3IRR A;  1MBG A;  2ZFU A;  1JUS A;  2LP0 A;  3K4C A;  3BJ6 A;  4LLG F;  4HST A;  1F4K A;  1OCO H;  1FTT A;  3PNV A;  3BR6 A;  1C0W A;  1OJL A;  5IYB J;  2KMU A;  2VPR A;  2JA7 J;  3E5X A;  3UKG A;  1YTY A;  1AU7 A;  2HQN A;  1K78 A;  3OIP A;  1PP7 U;  1TW3 A;  3KET A;  1A35 A;  3S2D J;  3GLL A;  2E1C A;  1LQ1 A;  2DT6 A;  4R8H A;  3ECH A;  4PJJ A;  5C4J J;  2OZ6 A;  5ICG A;  1RI7 A;  4AIJ A;  2JA6 J;  4YFN F;  3DEW A;  3N97 A;  3DF8 A;  3TW6 A;  1T33 A;  1T98 A;  3E97 A;  3PL8 A;  1XX5 A;  3FKI J;  4JX4 A;  2X4H A;  5TIS C;  4GCV A;  1D8J A;  1Y0U A;  5DUK A;  5DEQ A;  4NC8 A;  3C7J A;  2X6X A;  3QAH A;  2H1K A;  2KKO A;  2BBY A;  2V1U A;  2QYO A;  1Z05 A;  1TLH B;  1U78 A;  4PJL A;  1BC7 C;  2HKX A;  4RDU A;  5GTI C;  2ID6 A;  2Y0S A;  3G3Z A;  1LVA A;  3U2R A;  3FXK A;  3BCB A;  3I64 A;  4N4O B;  3M8J A;  1V54 H;  2ICW G;  3MKY B;  2V1N A;  2O0Y A;  1FY7 A;  2J5O A;  5J1U A;  4AYB N;  4U0Y A;  3CDI A;  3K4L A;  2G7U A;  1IN7 A;  4IJA A;  3LSG A;  2W00 A;  4KFC A;  2QSF X;  3QPL A;  4YFK F;  4BNC A;  1QPM A;  1K78 B;  3WTW C;  1CF7 A;  3F9K A;  5EYR A;  1MMS A;  2QBY A;  3S17 J;  5M5Y J;  1VI0 A;  2ELJ A;  5A2Q Z;  4N0B A;  4YIR X;  1X19 A;  1W36 C;  4BY7 J;  5FKN A;  1R23 A;  4DW6 A;  1SVM A;  1YIO A;  1WQ2 A;  4PCQ A;  1N25 A;  2DA2 A;  2RC4 A;  4RAG A;  5FD6 A;  2XB5 A;  3KP3 A;  1WJB A;  1ONV A;  5FLV A;  1F36 A;  2DA6 A;  1J59 A;  3GVA A;  4L5E A;  4HA8 A;  4UVA A;  4XOP A;  3T8T A;  4AC0 A;  2DPU A;  3LFK A;  3ZQ7 A;  2EJR A;  2PFB A;  4CYC A;  1G3Y A;  5L3C A;  3JRB A;  1I1G A;  5D6E A;  4G7O F;  1N78 A;  2VKH A;  4I99 C;  1JE8 A;  1A6Q A;  4DZP A;  1D1A A;  2DJI A;  2ETH A;  1OIS A;  5F6F A;  1Q1H A;  5JVT A;  3OYL A;  3TGN A;  2MH2 A;  3BJA A;  4EQQ A;  4A69 C;  3GTQ J;  1OCT C;  3COA C;  5FKK A;  1MJA A;  2WB1 A;  4CIC A;  1YI2 I;  4CZC A;  2ZO4 A;  2MSY A;  4GYI A;  1R58 A;  1BJA A;  5FO5 A;  2BE5 F;  3PSI A;  4FQG A;  2BHZ A;  1EKE A;  3BDD A;  1JHH A;  2BHY A;  4Y17 A;  1AA7 A;  5EZG A;  1A31 A;  1X3W B;  2QQA A;  1I3A A;  5B66 C;  4RB0 A;  3FMS A;  3FXQ A;  2VKD A;  3SZP A;  3ZN1 A;  2JZY A;  1ZK8 A;  4ENM A;  3QP5 A;  4D5C A;  3I9V 2;  3S93 A;  3MFK A;  2JUG A;  4EV0 A;  4XR6 A;  5KHD A;  4BE1 A;  3ABK H;  4Y3O A;  1IZ1 A;  4BXU A;  1K61 A;  2VI6 A;  3BQY A;  4JX5 A;  3KEO A;  3CP2 A;  5HS7 A;  2YU9 J;  2VT2 A;  4R1H A;  3IL2 A;  1JKQ C;  1L3L A;  3QU3 A;  1P4W A;  4XRS A;  4J19 A;  2H6C A;  3S1N J;  1WJA A;  4D9J A;  3HYI A;  4HNV A;  2COB A;  1T2K A;  4O3M A;  1IV6 A;  2QVO A;  1S7A A;  4HV6 A;  5J6X A;  1CGP A;  1WJF A;  2YS9 A;  3N4M A;  4I0A A;  4Y13 A;  3I71 A;  3E6D A;  1LFU P;  1LFB A;  1MMN A;  4O5V A;  3OS0 A;  2VLA A;  1APL C;  2VBW A;  2NNN A;  1I6X A;  2LK2 A;  1OCC H;  4E7K A;  2Y75 A;  3TL4 X;  1JT0 A;  1HF0 A;  4IQ4 A;  2WY8 Q;  3VSK A;  4A93 J;  3OR2 C;  3SYT A;  1VQ7 I;  4WXD A;  1W0T A;  2BEO A;  1SFK A;  2AQE A;  3BJO A;  2FE3 A;  2CV0 A;  3BWG A;  3G1O A;  5E17 F;  5KNL A;  4QPO A;  2NAZ A;  1LNW A;  4KIT B;  4C2U A;  1XCB A;  5FKO A;  3ZQG A;  3JSO A;  3CZ6 A;  3QYE A;  2ECC A;  2FBI A;  1BC8 C;  4XLC A;  5DCM B;  2YUS A;  3H5R A;  3A02 A;  3GCM A;  4GFB A;  4DGW B;  3BR2 A;  2YX7 A;  5F0H A;  1F1Z A;  2O5R A;  4PDK A;  4F3Q A;  4A12 A;  2HFH A;  1SEU A;  3IAM 2;  1UG2 A;  2M0M A;  2XGE A;  1A6I A;  1IUF A;  2DQL A;  2IA0 A;  2QF7 A;  3HRU A;  2MG4 A;  1NK2 P;  1IN6 A;  1DU6 A;  1B6A A;  1HW1 A;  3CCE I;  2FA5 A;  2EV6 A;  3G1L A;  3Q0V A;  3X2Q H;  1W5S A;  3SJM A;  3WOD F;  4AID A;  2L0K A;  2ID3 A;  4G12 A;  4BE2 A;  1GT0 C;  1MDM B;  2V7F A;  1OYW A;  2IJL A;  4HAM A;  2R7R A;  1A36 A;  5LHI A;  1P4X A;  1QZY A;  3VYS B;  3HG9 A;  1P6R A;  1W7P A;  3ERE D;  5F08 A;  2RQQ A;  2KZV A;  2A5Y B;  1MIJ A;  4OIR F;  5EG0 A;  1Z21 A;  1VFC A;  2BZT A;  2MA3 A;  1WRJ A;  2BGC A;  1MJB A;  2IGO A;  4PGH A;  4WK8 F;  3Q5F A;  3L2R A;  2BVM A;  1E3O C;  1NK3 P;  2FJ1 A;  2RNG A;  3CCM I;  1DGW Y;  3WE2 A;  3VWB A;  2HYJ A;  2JSP A;  1ZHF A;  2B0L A;  2Y69 H;  3OYA A;  4YEL A;  1REP C;  4NNJ A;  4A3K J;  2LKP A;  3RCO A;  3M8F A;  1JKO C;  2QEX I;  4HV5 A;  4A0Y A;  2LNB A;  3JRC A;  1WGX A;  2CU7 A;  3IWF A;  1Y0N A;  1HW2 A;  2HDD A;  2IS1 A;  2EIL H;  2DBB A;  2NS8 A;  3KLN A;  1XCV A;  3SFZ A;  1RKW A;  2ZJ2 A;  2HU9 A;  3FK6 A;  3IH3 A;  3LSI A;  4M3G A;  4F7Z A;  3RYR A;  2CQN A;  3CJR B;  1Z7U A;  2XAU A;  4LOC A;  2DMT A;  5GTH C;  3K1N A;  1TWA J;  4CGZ A;  4IO9 F;  3K6G A;  2K9M A;  3L2U A;  5IOY A;  2FMY A;  2H6B A;  3OYH A;  4RAZ A;  1D5Y A;  3GTG J;  2JN6 A;  2Q8K A;  4IHT A;  2G0E A;  2NOJ B;  2P5K A;  5ICF A;  2JA5 J;  2IW5 A;  1Y39 A;  4K2E A;  4ESB A;  5FFZ A;  1VQL I;  3V4G A;  5ILV A;  2EQR A;  3I4P A;  3S1R J;  1ZKG A;  2CW0 F;  1G2H A;  1DGR M;  2NVX J;  2ISY A;  1E3H A;  2B7E A;  2L9V A;  3I56 I;  1XGN A;  4JK1 X;  3BOQ A;  2STT A;  3RQI A;  3IKV A;  3NWS A;  1S9H A;  2IS4 A;  4A3D J;  5HOD A;  2EH3 A;  5FRO A;  2CS3 A;  2KPM A;  2HPI A;  3B6A A;  1OYY A;  2E1O A;  4F92 B;  2WAQ N;  4B3A A;  1YHQ I;  2ZB9 A;  3CDL A;  3HZJ A;  5EGO B;  2NS0 A;  1BW5 A;  3F6O A;  2FD5 A;  2JVG A;  1UAA A;  1KU3 A;  3CCY A;  2FNP A;  2R7T A;  4JQF A;  4HNT A;  4C3J J;  2QGU A;  4X6A J;  2ESN A;  4E7H A;  2IPQ X;  2WAD A;  1AOY A;  1WHU A;  1SVL A;  2Q2E A;  2XAF A;  2L54 A;  1WKM A;  4XM3 A;  2I8D A;  4BEH B;  2CFO A;  2NRA C;  4BGD A;  1F9N A;  5DD8 A;  3EUH A;  3K70 D;  4BHC A;  3GTP J;  3WU2 C;  3R0A A;  3F72 A;  1H88 C;  3H3Z A;  3KCC A;  3C18 A;  4Q5S F;  1XTA A;  4CCL A;  1MH4 A;  4UUV A;  4HDU A;  1X3U A;  1ZRD A;  3H92 A;  3ZMV A;  2JA8 J;  2EZL A;  1S5L C;  1FT9 A;  5FKL A;  3WG7 H;  2VIX A;  2ZXI A;  3NRV A;  3HKZ A;  1K83 J;  1NTC A;  3I59 A;  2NS7 A;  2L9N A;  3E6B A;  4II2 A;  1SD6 A;  2G9W A;  4ZYD A;  3ABM H;  2LOO A;  3C1D A;  2DXI A;  2HXI A;  2HS5 A;  5TJJ A;  2V6E A;  3OV8 A;  3F8B A;  4Q47 A;  4C3H J;  4E4H A;  3M7G A;  4OU0 A;  3CJQ B;  4I0B A;  4XLF A;  3BR0 A;  3H5N A;  4IHS A;  5CLS A;  2BY2 A;  3ZMD A;  1EA3 A;  1TT5 B;  4OIQ F;  1EF4 A;  3CMA I;  3OIO A;  2O6G E;  4LGW A;  5EEA A;  3C3W A;  4U0V A;  3UNG C;  4R79 A;  4WCG A;  2IS2 A;  1YJ9 I;  4Y52 J;  1QGP A;  5LBQ A;  2COM A;  3I53 A;  1T38 A;  3DU5 A;  3MKW B;  3WU1 B;  1K7A A;  2MD0 A;  3DFG A;  4LB6 B;  3WHB A;  5HNH A;  2XGD A;  2DOD A;  1TQM A;  1LFP A;  2E1M C;  5IOZ A;  1HCR A;  1SMT A;  3BLY A;  4IKF A;  2VKV A;  2DYS H;  5D5U B;  4KIC A;  2AHQ A;  1UFM A;  1OR7 C;  2J5P A;  1G3W A;  5GPA A;  2XAS A;  4JBA A;  3DEE A;  3R61 A;  2GBY A;  3K4M A;  3O3K A;  5FRM A;  2KJC A;  4A0Z A;  1BOB A;  4U88 A;  2QUF A;  4ZDL A;  3SFI A;  3OYB A;  4A6E A;  1J75 A;  3S1M J;  3ZCO A;  4A3J J;  1YX3 A;  1IXS B;  2DA5 A;  3L00 A;  1IC8 A;  3M9A A;  5C4X J;  1POG A;  2R5Z B;  4EJT A;  2R0Q C;  1QA6 A;  2DTR A;  4E7L A;  1R36 A;  3GBG A;  3FDY A;  3FXU A;  3I59 B;  2GZW A;  5FGM A;  2AS5 F;  2OTJ I;  3BZK A;  4CUG A;  3LAP A;  2M87 A;  5IT9 Z;  2LVS A;  2CGP A;  2V9K A;  3GTL J;  3V7C A;  1Q1V A;  4UV9 A;  1D5V A;  2HR3 A;  3HIF A;  1Z7L A;  2P6T A;  4EJU A;  3HBL A;  1W7P B;  5K7F A;  1IRZ A;  3ULQ B;  3LWF A;  1WI3 A;  1ETO A;  2EV5 A;  3HM5 A;  1F5T A;  1BR4 A;  5F0C A;  1J9I A;  3FXJ A;  3BZC A;  4Y15 A;  4BYY A;  5HDN A;  2Z3Y A;  3O2P E;  5DM7 F;  4U7D A;  2YX4 A;  1DDN A;  3RPU D;  2QZ8 A;  3HHH A;  4BDY A;  3K70 C;  2IS6 A;  2IGK A;  2OV7 A;  3F3X A;  5L3F A;  3RTR A;  1OMI A;  2FBK A;  1FEX A;  4E7I A;  1ZAO A;  3RYP A;  4CCK A;  4AVZ A;  2BW3 A;  4B1R A;  2WWY A;  4C9Y A;  1K4S A;  2K9Q A;  1LJ9 A;  4XSX F;  3JRD A;  3BZ6 A;  3I55 I;  4I2O A;  1FP2 A;  5CVJ A;  1XSD A;  2QKL B;  2K3P A;  1B72 B;  2R5Z A;  2VXD A;  4G6Q A;  1IW7 F;  4B4C A;  1HC8 A;  1MGT A;  1ZG1 A;  2VE9 A;  2D45 A;  1MND A;  3BTC A;  1ZYR F;  1WI9 A;  4B43 A;  2ZNZ A;  3TQN A;  5J4Y A;  3GZ6 A;  1U8B A;  2DCE A;  5E8G A;  2NVU B;  1LUJ B;  4DOZ A;  2K3F A;  2EFP A;  2OTL I;  2DA7 A;  3UR3 C;  3W6J B;  3ZR8 X;  4IHX A;  3H3V K;  4F52 A;  1R49 A;  2VBY A;  2DFE A;  3MKZ A;  2BXZ A;  5BS6 A;  2V9P A;  1TNT A;  4QIW N;  3KP6 A;  3H0D A;  5TGT A;  1B1B A;  2MFZ A;  1OFC X;  4YG2 F;  2LF8 A;  4JOM A;  3JAM Z;  2KIS A;  5HVQ C;  2RAE A;  2W7N A;  3SHF A;  4KN7 X;  3KP4 A;  3EUA A;  3VEP A;  1JJ6 C;  2OF7 A;  1T8I A;  1QHG A;  4A3C J;  2EZH A;  2MLG A;  3LSP A;  1XSV A;  2OZU A;  4UB6 C;  4ZYH A;  4ZJZ A;  1X4P A;  2DOF A;  1TL8 A;  3HTS B;  3GXO A;  3GW2 A;  1KYZ A;  4U87 A;  1HXD A;  2NVQ J;  4YFX F;  3K2A A;  4KT6 A;  4Q4Z F;  4L0Y B;  2GLO A;  1WSU A;  4HW0 A;  3CCL I;  2DT7 B;  4IPA A;  2H8W A;  4HYE A;  3OL4 A;  3OOU A;  4UVB A;  3PJR A;  2VC1 A;  5LGN A;  1ZH5 A;  1MMD A;  4KMF A;  2V4J C;  3E5U A;  4GO1 A;  4QSH A;  4XRM A;  2KIU A;  1YG2 A;  2DI3 A;  2V6C A;  3ESW B;  2H94 A;  5CVV A;  1WH5 A;  4ZTF A;  3JW4 A;  3LMM A;  2F6C A;  1J5Y A;  3HOZ J;  2HDW A;  1IRF A;  3AG1 H;  3TKY A;  2R7S A;  4LD5 A;  3WTZ A;  3TED A;  3RKW A;  1MBF A;  4PJ0 C;  1RR8 C;  2BOL A;  1UST A;  2ECB A;  1YYV A;  1YLF A;  2M34 A;  2UZK A;  1QZE A;  4GGG A;  1U2W A;  3CCV I;  3H35 A;  1ACI A;  5DTD A;  2H09 A;  3GEZ A;  2EBI A;  4RM2 A;  2XPV A;  3C2H A;  3ZP5 A;  1Z77 A;  2IEK A;  1R5I D;  3WTY C;  1OYI A;  3G73 A;  2LDU A;  1H9G A;  2E36 A;  1KGS A;  2JWT A;  3D5S C;  3FIW A;  3CLQ A;  4MTE A;  4DYR A;  3BG6 A;  3ZQH A;  2W25 A;  1QBJ A;  2VOD A;  2XAG A;  3P9K A;  1BA5 A;  1PJR A;  4MQ9 F;  3CCJ I;  2P7C B;  2Q1Z B;  5EG0 B;  1JHF A;  4GRI A;  5E18 F;  1U6G A;  4P1W A;  2DK8 A;  2PX9 A;  1NH3 A;  3FXO A;  2MW8 A;  2GM4 A;  2Z1D A;  2WY7 Q;  1R71 A;  1SVO A;  3ZMT A;  4PJN A;  4A3M J;  3CMM A;  5D5X B;  1K6Y A;  2WA0 A;  3LSH A;  1YE9 A;  5IY5 H;  3TDU C;  3IH4 A;  5IP9 J;  3AAF A;  1VZ0 A;  2CFX A;  4LIU A;  2F5V A;  1MNM C;  1W5C C;  1YFH A;  1FX7 A;  1G3S A;  4UUS B;  1WPK A;  5HLH A;  1B9N A;  3KX2 A;  2L01 A;  1ZLK A;  1SFE A;  4MFD A;  3ABL H;  4BAC A;  4H0E A;  3BG7 A;  1FP1 D;  2TRT A;  4BAY A;  4RMN A;  3QOP A;  1YJN I;  3S8P A;  2DLL A;  1ENH A;  4KIS A;  2R92 J;  4I7H A;  3VSL A;  1RZ4 A;  2R7W A;  1RUN A;  2W24 A;  3G6E I;  1KU7 A;  1ETX A;  2KRH A;  1N77 A;  3GFM A;  3H0G J;  1MH3 A;  3I54 A;  1OCZ H;  1U8R A;  2HDC A;  1ZAR A;  3CCR I;  1K79 A;  3TOB A;  5CVI A;  1RUO A;  3K4K A;  3LST A;  4WF2 A;  3G2B A;  2VUM J;  3JRG A;  3MZ8 A;  4C3I J;  5DDG A;  3OIQ A;  2F5C A;  2ZJP F;  2FQ3 A;  1MKM A;  1MBH A;  2H1L A;  4XLA A;  5E3L A;  3J80 K;  3WTT C;  2KFD A;  3S1Q J;  1WJD A;  2MYS A;  2TCT A;  5FRN A;  2RVC A;  2IGN A;  2R7O A;  5IT9 K;  3HUG B;  2HVS A;  1HQC A;  1Y56 A;  3ZQI A;  5E20 A;  1RRJ A;  4M3B A;  1Y1V J;  2X51 A;  5D4R A;  4IOC F;  2V26 A;  2E60 A;  2K85 A;  3Q9S A;  1TNS A;  3DBH B;  2DMP A;  5LGT A;  2QQB A;  1D0Y A;  4LMY A;  3FXR A;  3ZOB A;  4PK4 A;  2A07 F;  1ZRE A;  3L7W A;  2HPM A;  2ZFW A;  4PGG A;  4MO7 A;  2I5U A;  4W1U A;  1RES A;  3BQZ A;  2KRC A;  3IUO A;  3PUB A;  1XMA A;  1JUM A;  4KIG A;  5CJ9 A;  2FXA A;  1RC9 A;  2E71 A;  4A5N A;  2JPC A;  4YEJ A;  2L7Z A;  4IHV A;  5M3M J;  2GXB A;  4KIF A;  3JRA A;  2WAF A;  1ON2 A;  4RM3 A;  4DYQ A;  1L0O C;  4B48 A;  5FKM A;  3EYI A;  5KAI C;  1DP7 P;  2VQC A;  1TTY A;  1EH7 A;  1W4M A;  5FB2 A;  3TO6 A;  3ERM A;  1RR7 A;  2CUF A;  2KRF A;  4IX7 A;  3O6B B;  3K4B A;  3A01 A;  3J80 Z;  2FNA A;  1X1A A;  2Z9O A;  2OCE A;  4BDZ A;  2F5D A;  2DN0 A;  3BPX A;  4XON A;  3JTG A;  5H20 A;  3DU6 A;  4KT5 C;  3ZMZ A;  3DEU A;  4BQO A;  1TWF J;  3WE3 A;  2HOT A;  2RGV A;  2PMZ N;  2NVT J;  1UHW A;  1MZB A;  1YRN A;  1BIB A;  1JXS A;  1U0J A;  2QA4 I;  3A03 A;  4IRH A;  4WXH A;  4EMS A;  4G6D A;  3OYN A;  3I0T A;  5F64 A;  2XRO A;  1AWC A;  3C2B A;  4HX7 A;  1JGS A;  4B44 A;  5HLG A;  1YIT I;  3CP8 A;  3P7N A;  2X1D A;  1QQI A;  2NYX A;  2Z16 A;  3U1K A;  3AKZ A;  4U7B A;  5K5O A;  4QLC U;  2GOM A;  5B3S H;  3MAJ A;  3RKY A;  1Z1D A;  5BPD A;  1FYK A;  1T95 A;  2HOA A;  3E3V A;  1MSE C;  2VJJ A;  4A6D A;  4ETS A;  1H9T A;  2LG4 A;  3DTI A;  2JT1 A;  2HWV A;  4NC7 A;  1T08 B;  4IEJ A;  2L7M P;  4YRV A;  4L0Z B;  5DCM A;  3RPQ A;  2X9D A;  2V9V A;  3U1D A;  3M1C A;  4AM3 A;  2NVY J;  3OYD A;  1X1B A;  4G7H F;  5FLX K;  1IRX A;  5FD5 A;  4BE0 A;  5E3N A;  4LFU A;  3OSG A;  2HZT A;  2LRE A;  3P5J A;  3FX3 A;  4L9N A;  4RAY A;  5CPR B;  2ZKZ A;  4XK4 A;  5AON A;  4DBR A;  5GPC A;  5ILS A;  5GAD J;  5KVR A;  4CYD A;  2CH0 A;  2HNH A;  1I27 A;  5JFR A;  3VYU B;  2X6O A;  2LY9 A;  1P4A A;  4XSZ F;  1MBE A;  2A69 F;  3FBN B;  4N9H A;  1RNL A;  1J7K A;  2W84 A;  4EJW A;  5HOO A;  3QYF A;  4F91 B;  3I4N J;  3H36 A;  4HZF A;  2UWM A;  1AHD P;  3J7A Y;  3FM5 A;  5HLI A;  2TDX A;  1Z91 A;  5B1B H;  1FBU A;  4FX4 A;  2FUG 2;  2LFB A;  1J0R A;  2XPU A;  2BY1 A;  3CO7 C;  2VON A;  2PQ8 A;  1UMQ A;  3BG3 A;  3HC7 A;  2DPD A;  4KNY A;  4V2F A;  3GME A;  4IHY A;  5LD2 C;  1U5T B;  4BU2 A;  4XNF A;  3ZQC A;  3CMY A;  3V7S A;  2D5V A;  2VL8 A;  1E2X A;  1KQ8 A;  4P5O A;  2WAQ A;  2L02 A;  2CQ7 A;  1UHS A;  2OU2 A;  1X4O A;  5FFX A;  1UCR A;  4HLY A;  1LPQ A;  3RZD J;  4BXX J;  1ETK A;  1E0E A;  2K27 A;  2A68 F;  3GFI A;  3FM3 A;  2BV6 A;  1QO0 D;  1TBX A;  3CUO A;  2M8E A;  1V3F A;  2DO7 A;  3FWE A;  2M45 A;  4B8X A;  1XMX A;  1YO5 C;  2F4O B;  3TP0 A;  3HXL A;  2OA4 A;  4M3F A;  5J40 A;  1W5T A;  2M4K A;  3CES A;  2OD5 A;  2R7X A;  1R22 A;  2M2E A;  3OY9 A;  4XIC A;  3M4O J;  5K5R A;  3JCU C;  4ZZL A;  2XPW A;  2JJ7 A;  2XAQ A;  4LG0 A;  4D7M A;  2ZXJ A;  2ME6 A;  3S3O A;  3D5R C;  3LSM A;  4RGS A;  1TWG J;  5KK1 A;  1LB2 A;  4BQA A;  5JLX A;  1XDS A;  2QLZ A;  4ON0 A;  3GTJ J;  4PZJ A;  3J81 Z;  1ZG5 A;  5KCM A;  1X1P A;  2XGX A;  5HNF A;  4MTD A;  2VOP A;  4Y4R A;  1USS A;  1KQ9 A;  3EUH C;  3GX4 X;  2MLK A;  3VOE A;  2QCO A;  2QM3 A;  1G8X A;  1ZEL A;  4DBQ A;  1GXP A;  1JI8 A;  2G7H A;  1UB9 A;  3ONQ A;  1YIJ I;  1S72 I;  1U5T A;  2XDV A;  2IGM A;  2R7Z J;  3AFH A;  3AG4 H;  4OIN F;  1G3T A;  1UJ8 A;  3QRF F;  1BR1 A;  2RV8 A;  3T5X A;  3H9J A;  4CHU A;  3ECO A;  3CC4 I;  3CCU I;  4P96 A;  4RGX A;  5J8C A;  1TW2 A;  3KZI C;  2L2O A;  3DPU A;  4Z2Y A;  3NAU A;  4XLE A;  3S2H J;  3PSF A;  1DP3 A;  3LSR A;  3RQ4 A;  1R5G A;  1W1W E;  4ANJ A;  2BVL A;  5B5E C;  4CH7 A;  3R0J A;  3JRF A;  2DU9 A;  2DAO A;  2HTJ A;  3GFL A;  1IO2 A;  2FOW A;  5J4V A;  3V42 A;  4BUP A;  2LRD A;  3P9C A;  3WGH A;  1PUF B;  1R6R A;  1VQN I;  1R1U A;  3MVP A;  3CME I;  4IOA F;  2LD5 A;  1ETQ A;  3A1Y A;  2VC0 A;  1YS6 A;  4FCY A;  1AKH A;  3CTA A;  4AWX B;  3CCQ I;  3H9G A;  1VQP I;  1HBX G;  4KYW A;  1B8I B;  5K1Y A;  5K5Q A;  2ZME A;  3W6V A;  3F23 A;  2K9S A;  4XBF A;  4Z6Y A;  3BRO A;  1H0M A;  3DXJ F;  4GYG A;  1XC5 A;  4L9V A;  2AQF A;  2LC2 A;  3D1N I;  3J7Y J;  3F22 A;  2PMU A;  2A5W A;  4A3F J;  2XF7 A;  2A6T A;  2RQP A;  3AG3 H;  4B09 A;  1GLN A;  2K4J A;  4LIV A;  4QTR A;  4LB5 A;  3DKX A;  3RSN A;  2PMH A;  3ZXS A;  2O9L A;  3GFJ A;  1D1C A;  3K7A J;  1OPC A;  1KU9 A;  3ISP A;  3LNQ A;  1QRY A;  3OYK A;  2Z99 A;  3RI4 A;  1LEA A;  1QPI A;  5LLQ A;  3HSE A;  1P92 A;  4HF0 A;  2K4B A;  3SZG A;  2IRF G;  3LFU A;  1FOK A;  1FYM A;  1GHC A;  3QWL A;  4M6Y A;  3RDI A;  4KDP A;  2V79 A;  5H6Q A;  1YW7 A;  3IRQ A;  1FBQ A;  2DQR A;  2PN6 A;  3KYC B;  4C30 A;  2M3A A;  4L9T A;  5LRR A;  1FOW A;  1BI0 A;  1O7L A;  1TP4 A;  1RKT A;  2PEX A;  5K7H A;  1PUF A;  2DW4 A;  3EUK L;  2MC4 A;  5F04 A;  2OAZ A;  1MBJ A;  3KYL A;  1FZP B;  3BR3 A;  4EVI A;  4L9J A;  3W2V A;  5IP6 A;  3ASO H;  1MW7 A;  4HNU A;  1YS7 A;  4DZJ A;  1NHA A;  5BNG A;  1UZC A;  4M72 A;  2XAH A;  3M8E A;  3PQJ A;  1FYL A;  1WH7 A;  4E7Z A;  1EH8 A;  3BTI A;  5GAE J;  5B1A H;  2LSO A;  4LLN A;  2CRG A;  2ZME B;  3PFY A;  4UB8 C;  2DOA A;  2GIZ A;  4HLX A;  1BN5 A;  2LLK A;  1PP8 F;  3IP4 B;  5K7Z A;  4A3E J;  3CJN A;  4G8X A;  1HDD C;  2X6Y A;  3BR5 A;  2K40 A;  3NAR A;  1EV7 A;  1U5T C;  3T8R A;  3IWZ A;  1VQM I;  2DFH A;  4I6Z A;  1T39 A;  1EJ9 A;  1FJL A;  1Z67 A;  4MNU A;  1MMA A;  1JTY A;  2ELH A;  3S32 A;  1D1B A;  4IVN A;  3F8F A;  4DYC A;  1FIA A;  4CCJ A;  2CWE A;  1BIA A;  1LDD A;  2UUZ A;  4I02 A;  2P6S A;  2CQX A;  5LRS A;  1OCR H;  3FZV A;  2LKX A;  2NOG A;  2A6E F;  2HGC A;  2RN7 A;  3SDG A;  1IN4 A;  1IRG A;  1V5F A;  5JLW A;  1K4T A;  3FXL A;  2DMQ A;  1K6O A;  2K9N A;  2ME0 A;  3DBL B;  3IAS 2;  4BJT A;  3CDH A;  2YU3 A;  3CLO A;  4RLF A;  1IUY A;  5H2F C;  5JI6 A;  4G9Y A;  4D7N A;  4YIF A;  2HI3 A;  1YX5 A;  3NEU A;  2E5Z A;  3N05 A;  3QU6 A;  5L3G A;  4IF4 A;  4B3X A;  2E2H J;  2VXZ A;  3HOY J;  5E1Z B;  5LGU A;  4BKX A;  1V5G A;  2XKO A;  3DPL C;  5C44 J;  4LK1 F;  5EEG A;  5DM6 F;  2JUC A;  3RKQ A;  4S0H B;  2MBF A;  1WCM J;  2KIQ A;  5L3B A;  4AD9 A;  4HF2 A;  4A5M A;  4NQW A;  1TQP A;  4RS8 A;  1O4X A;  4V19 K;  1TWC J;  2A6H F;  4II3 A;  4PFO A;  2CSO A;  5F27 A;  3OYG A;  3CC2 I;  1JTX A;  2LY1 A;  2ZJQ F;  1HDP A;  2Q0O A;  3ZN0 A;  5A2Q K;  3WU0 A;  4M6V A;  2FBH A;  5GP9 A;  3NWT A;  2UXN A;  3WG9 A;  1VTN C;  2F4I A;  3HOS A;  2R3S A;  1XS9 A;  1ERD A;  1M1E B;  3RJP A;  1BI1 A;  2ZXW H;  2R7V A;  1FLI A;  2EFO A;  3I5U A;  3W2A A;  3GO5 A;  2M4G A;  2VBZ A;  4EM1 A;  5J8F A;  3HOU J;  1KON A;  1CF7 B;  2B9S A;  4XQF A;  1IF1 A;  3GTM J;  4P55 A;  1KU2 A;  2BY3 A;  3H9Q A;  2K86 A;  3OR1 C;  2LMD A;  3HRM A;  1SMY F;  4OWR B;  1SC7 A;  3AL0 C;  3HUG A;  1YJW I;  2W1O A;  1TT0 A;  2DA3 A;  5HDG A;  3F8N A;  3TO9 A;  1FPQ A;  4S04 A;  1IDY A;  4QWQ A;  2Y0M A;  2K7L A;  2CUE A;  3HTU A;  2E5N A;  2KZG A;  3FMQ A;  2IP2 A;  5LEK A;  3HPG A;  3V8J A;  1B9M A;  3K4J A;  2RNJ A;  4NHJ A;  3DWL E;  3QPS A;  1RIO H;  2W48 A;  2E1M B;  2YPR A;  3PM1 A;  1YOV B;  3DKY A;  4XKB A;  3TW7 A;  1O3Q A;  5DCF A;  1VF9 A;  3I4M J;  5DV5 A;  2P7V B;  5BMZ A;  1X1D A;  1IV8 A;  2KQR A;  4NQW B;  1LVK A;  1O3S A;  3WTV C;  1X3Z B;  2GWR A;  4G7Z F;  1FBS A;  1B4A A;  2L4A A;  3L09 A;  4LG3 A;  4BHP A;  3ZQF A;  2M1B A;  1HKQ A;  1QZZ A;  4X0G A;  5EZH A;  2GOX B;  3ZMS A;  3LA3 A;  1WVR A;  3ML6 A;  3V8K A;  1T6S A;  4IQJ A;  4ZTJ A;  4D5F A;  1AKH B;  1ORK A;  2OPT A;  3J7A O;  5M5X J;  1U9N A;  5DS9 A;  4E7S A;  1MJ9 A;  3I3L A;  4XRS G;  3WTS C;  2R5Y B;  1VQ9 I;  1LE8 B;  5IP7 J;  3TMO A;  4HOB A;  2VJI A;  3S3M A;  4XLN F;  3IV5 A;  3I58 A;  3RKX A;  4DNC A;  4A3L J;  4P9F A;  1RPW A;  5ERI A;  3CCS I;  4AVP A;  5F0F A;  2CG4 A;  2XSD C;  4XOT A;  1BL0 A;  2ZSI B;  4MQV A;  1WWX A;  2R4G A;  5CVU A;  3GWZ A;  3LQR A;  3B02 A;  3TOA A;  3L2V A;  3FK7 A;  5BQT A;  1I3Q J;  2Y31 A;  4EJO A;  3IC7 A;  1MSF C;  1A04 A;  3SEQ A;  5E1X A;  5ED4 A;  3BTJ A;  3TP3 A;  3DV8 A;  3SDB A;  2QQ8 A;  3ZMU A;  4GDF A;  2F5F A;  2GA2 A;  3RIR A;  1GVD A;  3J81 K;  4ZZD A;  1MD0 A;  5TRD A;  1SFX A;  1WJC A;  5EJC A;  3LL7 A;  2BYV E;  4D1Q A;  1XPX A;  1PYV A;  4ENN A;  3ZQL A;  2OQR A;  2VN2 A;  2R7U A;  1VQ5 I;  3OYC A;  4J01 A;  3DKW A;  1WJ5 A;  3DP7 A;  3H3U A;  5ICE A;  3HHG A;  1F43 A;  4BL0 B;  1NG7 A;  1GVJ A;  2JRT A;  2ZBK A;  3AG2 H;  4Q48 A;  4A2U A;  1SFO J;  3ZPL A;  2LBF B;  2DTZ A;  3OOP A;  4BH9 A;  3DLL F;  1VND A;  3LA7 A;  4OOI A;  1PDN C;  4BJ6 C;  2ZCW A;  2Y2Z A;  2K5C A;  2FF4 A;  3U21 A;  5D6F A;  2HZD A;  2XSJ C;  1BBY A;  4XRF A;  4P9U A;  1MMG A;  1R1V A;  1E17 A;  2DYR H;  4WWC A;  1X2N A;  3HSR A;  4L5J A;  1UEL B;  2EPF A;  3HEF A;  4PUS A;  1XD7 A;  2KLO A;  3GZ5 A;  1KZH A;  2GXG A;  3HGY A;  1SD5 A;  3TBI A;  1Z3Y A;  3OYJ A;  4BXF A;  3BPV A;  4LLL A;  5CQG A;  5HS8 A;  2EIN H;  3E7L A;  5IT3 A;  1I6H J;  3KP2 A;  4JYK A;  3EYY A;  3ZRG A;  3DTE A;  3Q0U A;  2DT5 A;  3KPH A;  3LOC A;  4BHB A;  1QU3 A;  4PSX A;  4FX0 A;  4FET A;  4AIH A;  2A3S A;  2EFQ A;  3CQZ J;  1LDK B;  1XG1 A;  2VQL A;  2ACJ A;  4WX9 A;  3Q0W A;  2YSR A;  4BQQ A;  1STZ A;  2OJE D;  1G6N A;  3A0B C;  4A3I J;  4UXN A;  3K69 A;  4Y33 A;  2EIJ H;  5EDN A;  1HLV A;  1WZ2 A;  1QNT A;  5J47 A;  2L7F P;  3JRH A;  2LF7 A;  1QVU A;  2M7A A;  4BQN A;  1RET A;  3VOD A;  2DK5 A;  3QOE A;  2ELK A;  1A5J A;  3DLA A;  5L3D A;  1GDT A;  4FE7 A;  2VKE A;  3MCZ A;  1FNN A;  1U3E M;  4XID A;  1LKX A;  2EZK A;  2H27 A;  1ZGJ A;  2LBF A;  1Y1W J;  5FJ8 J;  1Z9C A;  2W85 A;  3BG9 A;  4OIP F;  2W4S A;  3DCF A;  1LDJ A;  2O7O A;  1BW6 A;  3O8H A;  2P4W A;  4C2M J;  1V55 H;  4AU7 A;  2CQQ A;  4ZYE A;  4XLP F;  3AL0 B;  3MQ0 A;  1X2M A;  3CJT B;  2ADU A;  2CMP A;  2XB0 X;  3E5Q A;  4NC6 A;  5H6R A;  4EEF G;  2IT0 A;  2FML A;  3O8G A;  1FMV A;  4GXO A;  1DPR A;  4M9X A;  4D0P A;  4EAT A;  1IGN A;  3SQN A;  2I10 A;  2UXX A;  1MBK A;  1WFX A;  2M30 A;  5CVR A;  4FHT A;  5DYM A;  1FSE A;  2JTV A;  3BCA A;  3QP6 A;  4DIQ A;  2P5V A;  4E6K G;  3V7R A;  2CUZ A;  4RB1 A;  3K2Z A;  4XMY A;  5F1J A;  5ILU A;  3PIP F;  3TO7 A;  5CQE A;  5JR3 A;  1P7J A;  2CQK A;  5IPA A;  1QVT A;  1XB4 A;  3PO2 J;  3KEQ A;  5CKT A;  1I1S A;  5FLX Z;  3R4K A;  3ASN H;  1ULY A;  2VJ5 A;  4XKV A;  2FSW A;  2GIV A;  2R7D A;  1TQI A;  1VQ4 I;  1ZGW A;  5ICC A;  1KQ0 A;  4OAY A;  3OYF A;  1ZQ3 P;  3CD6 I;  2EB7 A;  2F2E A;  3WGI A;  3BR1 A;  4LJZ F;  3VFZ A;  3LSJ A;  4L5I A;  3OYI A;  3E6M A;  3JRE A;  2XUB A;  1R1T A;  2GAU A;  5JHF A;  2LR8 A;  1U9O A;  3DBR B;  5C3E J;  4BBR J;  2JA2 A;  3K1M A;  4AIK A;  2FQ4 A;  2Y9Z A;  1UHM A;  1ON1 A;  2HYF A;  2VQH A;  3A4C A;  1IXR C;  2XV4 S;  2Z5U A;  1BI2 A;  2CV1 A;  2VOO A;  3PO3 J;  3HPH A;  2VB6 A;  2DOE A;  3GF2 A;  2AXL A;  2KIF A;  4ZYG A;  4BJ5 C;  3KFW X;  2P8T A;  3FMR A;  4RB3 C;  1HSJ A;  2YR2 A;  4F55 A;  4XL9 A;  2JQ7 A;  4L18 B;  2GQQ A;  3VDX A;  4XKW A;  2K9L A;  3V8L A;  3HRS A;  4UUS A;  4CCM A;  1WJE A;  4F93 B;  2KDZ A;  5E3O A;  2EA4 A;  2EFN A;  2OUM A;  4M74 A;  5EGO A;  3MZH A;  4NDL A;  1IXC A;  4NUB A;  5L3E A;  3M07 A;  3PFI A;  3QYB A;  2H8R A;  1VQK I;  4HX8 A;  1FIP A;  6PAX A;  2IVM A;  2L4M A;  3E6C C;  4B47 A;  3ZGK A;  2HOE A;  4PSW A;  1MDM A;  3S15 J;  3LA2 A;  4BEH A;  3B6C A;  1FMW A;  3T0Y A;  4RLQ A;  5DD4 A;  4CO8 A;  2DA4 A;  2PBI A;  3OWT A;  3GTK J;  2KHM A;  2XAJ A;  4CCO A;  1P2F A;  2E19 A;  3OL3 A;  4N9I A;  1H8A C;  3ROU A;  2HTS A;  3BP8 A;  3MMY B;  1JUP A;  1S7O A;  4MIM A;  1S3J A;  5IYC J;  1N75 A;  4IHW A;  1D0Z A;  4UHT A;  2A05 A;  2M9H A;  2WV1 A;  2MGQ A;  4FAS D;  2X85 A;  1XGS A;  2XC7 A;  3MZY A;  2PJR B;  5KAF C;  4Y7N J;  1UG0 A;  3QPT A;  2JK3 A;  2V1D A;  1FOY A;  3FXM A;  4CZZ A;  5EF6 A;  2O8X A;  1D8K A;  3E1S A;  4KUM A;  4J00 A;  2E1N A;  4AYB A;  1J2X A;  4XKC A;  3W3C A;  2O61 A;  1P9Q C;  3K0L A;  3VYR B;  2N8G A;  5GAG J;  3L2Q A;  2IA1 A;  1S8N A;  5AIP A;  1YW8 A;  3GZN B;  2WV0 A;  4CDG A;  1Y8R B;  4M71 A;  3S3N A;  3L9F A;  3KZY A;  4XLH A;  2L3D A;  4PFP A;  2XHK A;  1O7F A;  1W7P D;  2HKO A;  2LH9 A;  2VT3 A;  2R7Q A;  4RGR A;  1KYW A;  2E2I J;  2A61 A;  4XN3 A;  3EET A;  3A01 B;  2WB1 N;  3G71 I;  2MAB A;  4BY1 J;  1E3P A;  2K02 A;  4MEY F;  3T1B A;  1I50 J;  1Y8Q B;  3DQV C;  1QHH D;  5E1W A;  4IRG A;  3W6K B;  2PI0 A;  4RA2 A;  2Y48 A;  2IA2 A;  4FIS A;  4KMU X;  2ZME C;  2ISZ A;  2CYY A;  2OBP A;  1EH6 A;  1V4R A;  4LK0 F;  3KP7 A;  2EK5 A;  2DMN A;  2WTE A;  3L2W A;  3E0J B;  2Z2S B;  1OKR A;  5J1R A;  4BS9 A;  5BPI A;  2E7W A;  2W82 A;  2DMU A;  3F8C A;  3FIS A;  5LHG A;  4YII A;  5IYD J;  2Y9Y A;  1XMK A;  3KP5 A;  2X48 A;  4ESJ A;  1IG7 A;  1ZR4 A;  3FBI B;  4UY8 I;  1FWZ A;  4A3B J;  2E7X A;  3HOT A;  4A3G J;  4N4N B;  1R7J A;  4UV8 A;  2F48 A;  3FHN A;  4EM0 B;  2LTP A;  1BR2 A;  1BM9 A;  4HQM A;  2KT0 A;  1OQY A;  4WXC A;  5J1Y A;  3MD2 A;  2O8K A;  4G94 A;  4S05 A;  3S14 J;  2X0L A;  4MLO A;  2RRE A;  4CSW A;  3IHU A;  2DFF A;  1D0X A;  4UVC A;  1ZRC A;  1BI3 A;  1FSH A;  3HB9 A;  2HVQ A;  2P81 A;  1GV2 A;  5E79 C;  4DJA A;  1B8I A;  2QSH X;  4HX4 A;  1V5E A;  2L7K A;  2FEZ A;  3F0C A;  4IXA A;  2BW3 B;  4A0X A;  5D5V B;  2EIM H;  3FHZ A;  2Y0S N;  5JVG F;  3P9I A;  3IKT A;  3RZO J;  1O3T A;  4DQ2 A;  2QWW A;  3NQO A;  1XGM A;  5M3F J;  5BOX A;  3CUQ A;  3HRT A;  4HRI A;  2HQA A;  2XKP A;  2PJR A;  2BXY A;  3CO6 C;  1XDU A;  5EEH A;  2KJB A;  3F8M A;  3SZT A;  4HBL A;  2OCC H;  4UUT A;  3D5L A;  2HOS A;  1SD4 A;  3HL2 A;  2X1E A;  2ZSH B;  4PJM A;  5D5W B;  4OIO F;  2LKS A;  1Z6T A;  1CQT A;  3MWM A;  1G4D A;  2Q2E B;  2O3F A;  1TZL A;  4EM2 A;  5HDK A;  4U0W A;  2OC6 A;  4NB5 A;  3HOV J;  2EZI A;  4G6T B;  2CJJ A;  3Q3S A;  3KLO A;  3MN2 A;  2LY2 A;  2CW8 A;  2OQG A;  2FX0 A;  4CXF A;  2O03 A;  3SEZ A;  4I01 A;  3WHC A;  2M5W A;  1J09 A;  3FF5 A;  4KA4 A;  2P0W A;  1GUU A;  4I09 A;  3GTO J;  2GXA A;  2VJ4 A;  2EIK H;  2PMZ A;  3LAJ A;  2B63 J;  3K10 A;  3PUF A;  1GV5 A;  3A2K A;  3EPZ A;  1GXQ A;  3HKZ N;  1DUX C;  2DA1 A;  2KL4 A;  3S2W A;  2F5E A;  1Y6I A;  4EGY A;  1ETY A;  2VPL A;  4ITV A;  1HA8 A;  4KIB A;  1ZN2 A;  2CO5 A;  4ZH4 F;  3CUQ B;  2M0C A;  2M7B A;  1I5Z A;  2ZXH A;  1JGG A;  1HW5 A;  4IL6 C;  4LG0 B;  1BJZ A;  1IDZ A;  4ZC3 A;  2QSG X;  3CF5 F;  3BTL A;  1W36 D;  1KA8 A;  4JX6 A;  2D1V A;  3FKJ A;  2Y30 A;  4MHG A;  5E3M A;  3BC8 A;  3GUD A;  5J3L A;  1H89 C;  1JT6 A;  3LQQ A;  4V2G A;  1DU0 A;  3TDZ C;  4I76 A;  3H5A A;  2M8G X;  2ZJR F;  2WBM A;  1YRN B;  2LYC A;  2R7F A;  2MC3 A;  4CA0 A;  3KIO A;  1OLT A;  4AUX A;  2GA1 A;  2QEN A;  3MEX A;  1XSX A;  5LFA A;  5FLM J;  1IJW C;  2JSC A;  1D3Y A;  4IRI A;  1BOA A;  2ZNY A;  3JSP A;  2DDB A;  2D2W A;  2PLY A;  2F4M B;  1R4N B;  5AIQ A;  3D0S A;  2STW A;  3VPR A;  2NNY A;  2QQ9 A;  1JJ8 C;  3HOW J;  4XOR A;  3KE2 A;  4HF1 A;  3DTK A;  2CUJ A;  2IAI A;  2VBX A;  2R93 J;  4E70 A;  3A0H C;  3HJE A;  4ESF A;  4M73 A;  3S16 J;  3L1P A;  3BT9 A;  1R5H A;  4ABZ A;  3F21 A;  4FTH A;  2D1H A;  2JRM A;  3Q9V A;  2ZC2 A;  3ELK A;  1YW9 A;  3C2G A;  5JHU A;  1O57 A;  4KJZ A;  1SAX A;  2XF6 A;  2P5L C;  3QQA A;  1ZRF A;  3OS1 A;  3OSF A;  4HEA 2;  2L9R A;  1ZG3 A;  1HKS A;  3WGG A;  1XN7 A;  3OS2 A;  1ZTR A;  9ANT A;  2AXT C;  1R4M B;  3QOD A;  4M9S A;  1T0F A; 
#chains in the Genus database with same CATH homology
 3ZQL A;  2NVX J;  3HGG A;  5M5W J;  2HOA A;  1MSE C;  3RQI A;  1F43 A;  4X1E A;  4IEJ A;  1TWH J;  3BG5 A;  4CYC B;  1SFO J;  5HOD A;  4A3D J;  2EH3 A;  2L7M P;  3B6A A;  2DTZ A;  2X9D A;  1JKR C;  4W97 A;  2E1O A;  1VND A;  2NVY J;  2WAQ N;  4B3A A;  2ZB9 A;  3CDL A;  2E2J J;  5EGO B;  2Y2Z A;  1BW5 A;  5E3N A;  3OSG A;  2FD5 A;  3CCY A;  3M3Y J;  5GPC A;  4XK4 A;  4C3J J;  1X2N A;  1ZR2 A;  4X6A J;  4JP0 A;  3HEF A;  1R9T J;  1HOM A;  2XGC A;  2X6O A;  2LY9 A;  3HGY A;  1ETV A;  1MBE A;  3S16 J;  2R5Y A;  1LE8 A;  3HDD A;  3E7L A;  1I6H J;  3I4N J;  1JKP C;  4JYK A;  1AHD P;  1X58 A;  3Q0U A;  4M3D A;  3GTP J;  3LOC A;  1ITY A;  4RBO A;  2LFB A;  1H88 C;  3CQZ J;  2XPU A;  3HOX J;  1MH4 A;  3BG3 A;  1UMQ A;  1XG1 A;  4V2F A;  4IHY A;  1B72 A;  3Q0W A;  2JA8 J;  4MFE A;  2EZL A;  5FKL A;  3ZQC A;  3G1M A;  3CMY A;  2D5V A;  4A3I J;  3IH2 A;  1K83 J;  1NTC A;  1UHS A;  5EDN A;  1HLV A;  2NS7 A;  4BXX J;  3RZD J;  1ETK A;  3MKL A;  2L7F P;  3JRH A;  1QVU A;  1RET A;  2HXI A;  2ELK A;  1A5J A;  1OCP A;  1GDT A;  4C3H J;  4FE7 A;  1Z0X A;  2IBD A;  3TP0 A;  2VKE A;  4M3F A;  4XID A;  2EZK A;  3BR0 A;  2M2E A;  1W0U A;  4XIC A;  1ETW A;  1Y1W J;  5FJ8 J;  3M4O J;  1EF4 A;  4FE4 A;  3BG9 A;  2XPW A;  2JJ7 A;  1S7E A;  3OIO A;  3DCF A;  5EEA A;  4D7M A;  2O7O A;  2ME6 A;  1BW6 A;  3O8H A;  4C2M J;  3JR9 A;  2CQQ A;  1T56 A;  2JMW A;  1TWG J;  1X2M A;  4Y52 J;  2AO9 A;  5JLX A;  2XB0 X;  3GTJ J;  4EEF G;  3O8G A;  4BBS J;  3WHB A;  1IGN A;  2XGD A;  2DJN A;  2QCO A;  5IOZ A;  1HCR A;  2I10 A;  1MBK A;  1SAN A;  2VKV A;  2XRL A;  2AHQ A;  2R7Z J;  5GPA A;  1P7I A;  1FTZ A;  2GBY A;  5F1J A;  3SFI A;  1P7J A;  3JRI A;  5IPA A;  3S1M J;  1QVT A;  3PO2 J;  4A3J J;  5C4X J;  2DA5 A;  4M3E A;  1IC8 A;  2HXO A;  1POG A;  2R5Z B;  2R0Q C;  3GBG A;  2HQ5 A;  3S2H J;  3NAU A;  1TC3 C;  1MBG A;  2LVS A;  3GTL J;  1ZGW A;  1JUS A;  2LP0 A;  3LSR A;  1ZQ3 P;  1Q1V A;  3BR1 A;  1FTT A;  3BR6 A;  3HBL A;  3LSJ A;  1OJL A;  5IYB J;  5K7F A;  3JRF A;  1IRZ A;  3JRE A;  1WI3 A;  2VPR A;  1ETO A;  2LR8 A;  3HM5 A;  1U9O A;  2JA7 J;  5F0C A;  3UKG A;  1AU7 A;  5C3E J;  4BBR J;  1PUF B;  3S2D J;  2Y9Z A;  2FQ4 A;  3MVP A;  5C4J J;  2LD5 A;  1ETQ A;  2JA6 J;  1AKH A;  3DEW A;  4FCY A;  3TW6 A;  1T33 A;  3PO3 J;  1FEX A;  3FKI J;  1B8I B;  4JX4 A;  3W6V A;  4B1R A;  2K9S A;  2K9Q A;  4UUS A;  2H1K A;  3JRD A;  2KDZ A;  1XC5 A;  5E3O A;  5EGO A;  4NDL A;  1U78 A;  2H8R A;  1B72 B;  3D1N I;  2R5Z A;  1FIP A;  4RDU A;  4B4C A;  4A3F J;  2ID6 A;  3BTC A;  4QTR A;  1U8B A;  3S15 J;  2O9L A;  2DA7 A;  5J1U A;  3B6C A;  4AYB N;  4IHX A;  3K7A J;  3H3V K;  2DA4 A;  3LNQ A;  1QRY A;  3LSG A;  3GTK J;  1QPI A;  2E19 A;  3QPL A;  1H8A C;  5EYR A;  3S17 J;  5M5Y J;  1VI0 A;  4QIW N;  1JUP A;  4MIM A;  1OFC X;  5IYC J;  4BY7 J;  2RAE A;  5FKN A;  4DW6 A;  4IHW A;  1JJ6 C;  2DA2 A;  1RKT A;  2OF7 A;  5K7H A;  1PUF A;  4A3C J;  2EZH A;  2XB5 A;  3LSP A;  2M9H A;  2WV1 A;  2MGQ A;  5F04 A;  5FLV A;  1F36 A;  1MBJ A;  2DA6 A;  3BR3 A;  5IP6 A;  4Y7N J;  4L5E A;  4AC0 A;  2JK3 A;  4DZJ A;  5EF6 A;  5BNG A;  2NVQ J;  4CYC A;  3K2A A;  1WH7 A;  3JRB A;  3BTI A;  2GLO A;  4DZP A;  3OOU A;  2CRG A;  2N8G A;  2LLK A;  4A69 C;  3GTQ J;  1OCT C;  4QSH A;  5K7Z A;  5FKK A;  4XRM A;  4A3E J;  1HDD C;  3BR5 A;  2MSY A;  2E2I J;  2K40 A;  1WH5 A;  3NAR A;  3A01 B;  2WB1 N;  3HOZ J;  4BY1 J;  4I6Z A;  3TED A;  1I50 J;  1MBF A;  5EZG A;  1FJL A;  2ECB A;  2M34 A;  1JTY A;  4DYC A;  1FIA A;  5DTD A;  4FIS A;  1ZK8 A;  2CQX A;  2EBI A;  4D5C A;  2XPV A;  2LKX A;  1Z77 A;  2IEK A;  2NOG A;  2DMN A;  2JWT A;  4DYR A;  3FIW A;  3SDG A;  5J1R A;  5JLW A;  1K61 A;  3ZQH A;  2DMQ A;  2VI6 A;  3BQY A;  2K9N A;  2ME0 A;  2DMU A;  4JX5 A;  2YU9 J;  3FIS A;  1BA5 A;  1JKQ C;  5IYD J;  2Y9Y A;  4A3B J;  2X48 A;  4XRS A;  1IG7 A;  5EG0 B;  4D7N A;  4J19 A;  1ZR4 A;  2HI3 A;  3S1N J;  4A3G J;  4HNV A;  2COB A;  2LTP A;  2MW8 A;  2GM4 A;  2KT0 A;  5J1Y A;  2E2H J;  1IV6 A;  3HOY J;  4A3M J;  2O8K A;  3S14 J;  2YS9 A;  4MLO A;  4BKX A;  5C44 J;  3IH4 A;  5IP9 J;  3RKQ A;  4S0H B;  1LFU P;  1LFB A;  1WCM J;  3HB9 A;  2P81 A;  1GV2 A;  1B8I A;  1APL C;  1MNM C;  2LK2 A;  4UUS B;  1WPK A;  4MFD A;  1O4X A;  1TWC J;  3F0C A;  1JT0 A;  5F27 A;  1HF0 A;  2TRT A;  4A93 J;  1JTX A;  1HDP A;  2Y0S N;  3RZO J;  1W0T A;  1ENH A;  2R92 J;  4M6V A;  5GP9 A;  5M3F J;  1XS9 A;  3G1O A;  1ETX A;  3H0G J;  1MH3 A;  4UUT A;  2HOS A;  5FKO A;  3ZQG A;  2ECC A;  2VUM J;  3JRG A;  4C3I J;  1CQT A;  2YUS A;  3HOU J;  4GFB A;  3A02 A;  3S1Q J;  1MBH A;  5E3L A;  3BR2 A;  5F0H A;  2TCT A;  3GTM J;  3HOV J;  2EZI A;  2CJJ A;  3Q3S A;  3MN2 A;  2FX0 A;  1UG2 A;  2XGE A;  1A6I A;  1IUF A;  2QF7 A;  3WHC A;  3ZQI A;  2MG4 A;  1NK2 P;  1DU6 A;  1GUU A;  3GTO J;  2B63 J;  2DA3 A;  3G1L A;  3Q0V A;  1Y1V J;  4M3B A;  3SJM A;  1GV5 A;  1IDY A;  2L0K A;  2ID3 A;  4G12 A;  1GT0 C;  2CUE A;  2DMP A;  3HKZ N;  3ZOB A;  2DA1 A;  3QPS A;  2W48 A;  1ETY A;  4MO7 A;  3PM1 A;  4W1U A;  5F08 A;  1RES A;  3TW7 A;  3BQZ A;  1VF9 A;  3I4M J;  5EG0 A;  2M0C A;  1VFC A;  1JUM A;  1JGG A;  1BJZ A;  1IDZ A;  3ZQF A;  2L7Z A;  1E3O C;  4IHV A;  5M3M J;  1NK3 P;  2FJ1 A;  3JRA A;  5EZH A;  4DYQ A;  3BTL A;  5FKM A;  2HYJ A;  4JX6 A;  5E3M A;  2Y30 A;  5J3L A;  1H89 C;  1JT6 A;  4V2G A;  4A3K J;  1DU0 A;  4D5F A;  1RR7 A;  2CUF A;  1JKO C;  4I76 A;  1AKH B;  1ORK A;  2M8G X;  2OPT A;  5M5X J;  3A01 A;  1U9N A;  5DS9 A;  1YRN B;  4XRS G;  3JRC A;  1WGX A;  2R5Y B;  1LE8 B;  2CU7 A;  2DN0 A;  4AUX A;  5IP7 J;  2HDD A;  1IJW C;  2NS8 A;  5FLM J;  3IV5 A;  1RKW A;  3FK6 A;  3IH3 A;  4M3G A;  4A3L J;  1RPW A;  1TWF J;  2HOT A;  2PMZ N;  5F0F A;  4LOC A;  3VPR A;  2XSD C;  2DMT A;  1JJ8 C;  1BL0 A;  2NVT J;  3HOW J;  1YRN A;  1TWA J;  3A03 A;  2IAI A;  2R93 J;  5IOY A;  3FK7 A;  1I3Q J;  2Y31 A;  3GTG J;  3L1P A;  1D5Y A;  2JN6 A;  3BT9 A;  3C2B A;  2G0E A;  4ABZ A;  4FTH A;  1MSF C;  2JA5 J;  3BTJ A;  3TP3 A;  1GVD A;  3QQA A;  3OSF A;  2EQR A;  2L9R A;  1ZTR A;  9ANT A;  3S1R J;  1ZKG A;  1G2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...