1ETQA

The crystal structure of e. coli fis mutant r71y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
85
Chain Sequence
VLTVSTVNSQVTQKPLRDSVKQALKNYFAQLQDVNDLYELVLAEVEQPLLDMVMQYTYGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 85
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etqA00
2DMNA 1BJZA 2DA4A 3ZOBA 1VFCA 2R5ZA 1A5JA 4V2GA 4UUSA 3UKGA 3S1QJ 2ELKA 1X2NA 4RBOA 2I10A 1ZR2A 1FJLA 4EEFG 2CUEA 4M3EA 4C3HJ 2X9DA 4M3GA 3HOZJ 2HYJA 2PMZN 3QPLA 2GLOA 1HF0A 1ETVA 2ME0A 4L5EA 5IYCJ 1W0UA 1AU7A 3H0GJ 3CDLA 1BA5A 2XSDC 1TWFJ 2JA6J 2ID6A 4B3AA 3S2HJ 1FIAA 1YRNA 4D5CA 3S14J 5EYRA 5F27A 2CJJA 1G2HA 3BTIA 2H8RA 3BQZA 3IH3A 2R5ZB 1I50J 1P7JA 2DA3A 2Y9YA 3TP3A 4MFEA 3JREA 2DMPA 2DMUA 3W6VA 3GTPJ 4C3JJ 1F43A 1NK3P 2EZKA 2JA8J 5F1JA 1HDPA 3MN2A 1IDYA 3FISA 4D5FA 3RZDJ 3HM5A 4A3FJ 2NVQJ 1ETYA 1WH7A 3BR5A 2MG4A 2DA5A 3JRAA 2LKXA 4MFDA 2K9QA 4Y7NJ 2R7ZJ 5HODA 2ME6A 2VUMJ 1YRNB 2VI6A 1XG1A 2LR8A 2XGEA 2Y2ZA 1P7IA 4BKXA 1O4XA 3ZQLA 3HOWJ 5C4JJ 3FIWA 3D1NI 2M8GX 2TRTA 1APLC 5IP9J 1MBFA 1TWCJ 1ZKGA 4CYCB 3S1MJ 3B6AA 5FKOA 2CQQA 2ECCA 2R92J 1Z0XA 2IBDA 3QPSA 1LE8B 4B4CA 1RETA 2E1OA 1ETXA 2DA1A 1JTXA 1ZK8A 1Z77A 1ENHA 3BR6A 3BR0A 3RKQA 2CU7A 3WHCA 3PM1A 1BW5A 2XPWA 1RPWA 2FJ1A 2QCOA 1JKRC 1GUUA 5EG0B 5F0FA 2JA5J 3JRDA 2VPRA 2TCTA 1JKPC 2EQRA 2X6OA 2CUFA 2HXOA 1EF4A 1SANA 3HGGA 3DEWA 4BY7J 1OJLA 1ITYA 5IOZA 1GV2A 2K9SA 3GTJJ 1UG2A 1IUFA 3TW7A 3B6CA 5E3OA 1JJ8C 1TWAJ 3BTCA 2G0EA 3A01A 4A3DJ 1ETQA 4A69C 1IG7A 4M3DA 3LSJA 5FKNA 1MBKA 3OSGA 1QVUA 1D5YA 2K9NA 3HB9A 1OFCX 3BTJA 4DW6A 2JA7J 5GPAA 4J19A 2LY9A 2B63J 2R5YB 3Q0VA 2WV1A 1PUFB 5M5YJ 2L7FP 2DA6A 5FKMA 4QTRA 2Y0SN 3A01B 2DA2A 2E19A 2HDDA 2EZLA 2EZIA 5F0HA 4A93J 1VNDA 1B72B 2FD5A 4LOCA 3S1NJ 2CRGA 2JWTA 1Y1WJ 2O8KA 4DZPA 3Q3SA 2DN0A 4A3EJ 1WI3A 1BL0A 1QVTA 2IAIA 2O7OA 4A3CJ 3IH4A 5F04A 1MBGA 3ZQGA 3ZQHA 3JRIA 3GTOJ 5C4XJ 4D7MA 4A3LJ 2GBYA 1XC5A 3IV5A 3HBLA 3ZQFA 1U9OA 4UUSB 1B8IA 1LFUP 1GDTA 3HOVJ 2MW8A 5FJ8J 3BG3A 1DU0A 3DCFA 3MVPA 3JR9A 4HNVA 1XS9A 3BR1A 3LSPA 1RR7A 3S2DJ 3A03A 4ABZA 5DS9A 1ZR4A 1NK2P 2XPVA 2LD5A 2XRLA 2COBA 4NDLA 1VI0A 5J1RA 1W0TA 1JKOC 2LVSA 4MO7A 5M3FJ 1IV6A 1UHSA 4C3IJ 1MSFC 1RESA 5J3LA 3Q0UA 1WPKA 4QIWN 3S17J 2FQ4A 1JUPA 1OCPA 2XGDA 3A02A 4AC0A 2K40A 5EGOA 3Q0WA 4XRSA 3IH2A 1JT6A 4A3BJ 3GTLJ 5K7FA 1I3QJ 1QPIA 1NTCA 3G1LA 1F36A 4BBSJ 4DYQA 1VF9A 2NOGA 4FISA 2E2HJ 3G1MA 4D7NA 1JUMA 3BT9A 5IOYA 5IP7J 1GVDA 2LTPA 1DU6A 5M3MJ 3OSFA 1SFOJ 3HOYJ 1RKWA 3BG5A 1CQTA 2Y30A 1FEXA 4BXXJ 1JTYA 4FE7A 3NARA 1S7EA 4W1UA 1ZTRA 2HOAA 2X48A 3HEFA 4XIDA 3I4NJ 2DA7A 4FE4A 5EGOB 3L1PA 2O9LA 4X6AJ 1JGGA 4A3GJ 5M5XJ 3PO2J 2L7MP 1WCMJ 2YS9A 5C44J 1T33A 2QF7A 1TC3C 4BY1J 1JT0A 3E7LA 1ETOA 2NVXJ 1MBEA 1WGXA 5E3LA 2JJ7A 2DJNA 3O8GA 1AKHA 3JRGA 3GTKJ 4DYCA 4JX5A 3S15J 2KT0A 2LP0A 3RQIA 2XB5A 2EH3A 4XICA 2JMWA 1IC8A 3GTMJ 3RZOJ 2LFBA 3JRBA 2YUSA 3HOUJ 4S0HB 1IDZA 4GFBA 3BR3A 1K61A 3I4MJ 2MSYA 2AHQA 2JN6A 2L0KA 3K2AA 1K83J 5EEAA 3M3YJ 1LFBA 2LK2A 4QSHA 3BTLA 3OOUA 9ANTA 4M3BA 3MKLA 1JUSA 3GTQJ 1MNMC 1ZGWA 2RAEA 2N8GA 3LOCA 2IEKA 4XK4A 3SJMA 4FTHA 4JYKA 2NS7A 3H3VK 1RKTA 5EDNA 2KDZA 4JX6A 4A3MJ 2WAQN 1MH4A 4IHXA 1TWGJ 2NVTJ 1HDDC 2H1KA 5IP6A 1MSEC 2D5VA 2OF7A 3S1RJ 1MBJA 3JRFA 5JLWA 3HDDA 2HXIA 4RDUA 1QRYA 5M5WJ 2CQXA 1FTTA 2DMQA 4X1EA 3JRCA 1FIPA 5FLVA 1R9TJ 5BNGA 1Y1VJ 3ZQCA 3VPRA 1OCTC 3FK6A 1MH3A 1X2MA 4I76A 1UMQA 5FKKA 5E3MA 4V2FA 1WH5A 3CMYA 5IYDJ 1H88C 4JX4A 4BBRJ 2ECBA 4JP0A 2Y31A 1IGNA 4IHWA 4A3KJ 4G12A 4MIMA 2W48A 1ORKA 1E3OC 3TEDA 3SFIA 3S16J 4A3IJ 3QQAA 4A3JJ 3NAUA 1FTZA 2NS8A 1MBHA 4CYCA 4Y52J 5E3NA 2WB1N 2EBIA 2EZHA 1U8BA 1GT0C 1LE8A 1X58A 3FKIJ 2OPTA 1B8IB 2VKEA 5DTDA 2LLKA 4XRSG 1IJWC 2R93J 2FX0A 2ZB9A 3G1OA 5JLXA 5EG0A 5IYBJ 4C2MJ 2XPUA 2L9RA 3F0CA 1POGA 2DTZA 1U78A 3GTGJ 4DZJA 1ZQ3P 4IEJA 3CCYA 1GV5A 5FKLA 1I6HJ 2XGCA 2XB0X 2E2IJ 2M34A 1JKQC 4AYBN 1HLVA 1IRZA 3HKZN 4FCYA 1HCRA 4XRMA 2AO9A 3M4OJ 3FK7A 4UUTA 2HQ5A 3LNQA 3BQYA 3K7AJ 2GM4A 1HOMA 1H8AC 5C3EJ 2P81A 3TP0A 1ETWA 3WHBA 1T56A 2R5YA 5K7ZA 5F08A 3HOXJ 4IHYA 1PUFA 3JRHA 2VKVA 3BR2A 5FLMJ 2MGQA 4M3FA 5EF6A 1TWHJ 1ETKA 5J1YA 3TW6A 3OIOA 2M9HA 1H89C 4I6ZA 3LSGA 2R0QC 3O8HA 3ZQIA 5GP9A 2HOTA 3PO3J 5K7HA 2M2EA 4AUXA 1B72A 3SDGA 2YU9J 2JK3A 5GPCA 2L7ZA 2DMTA 2ID3A 2HI3A 2Y9ZA 1Q1VA 3C2BA 5F0CA 5EZGA 2M0CA 3BG9A 1U9NA 2NVYJ 5J1UA 2HOSA 1JJ6C 1AKHB 2E2JJ 3GBGA 1A6IA 5EZHA 3CQZJ 3LSRA 4M6VA 4IHVA 3HGYA 4W97A 5IPAA 4B1RA 4DYRA 1AHDP 1BW6A 4MLOA
chains in the Genus database with same CATH superfamily
2R7SA 2Y0SA 2V4JC 5CVIA 2IGMA 5D8LB 2XGXA 4L5IA 4UUSA 2CSOA 1P4XA 2JZYA 4AVZA 2I10A 4XNFA 1FJLA 3BPXA 4WXCA 1LUJB 2VODA 2PBIA 3HOZJ 2PMZA 4U0YA 4FASD 5HLHA 2STTA 3U2RA 4TV7A 5IYCJ 4OWRB 1X3WB 1IN8A 3FM5A 1TL8A 2XSDC 1TWFJ 3FF5A 3GMEA 2JA6J 1SFEA 4KDPA 3GZNB 3S2HJ 4ZZDA 2VJ5A 2X85A 5EYRA 2BBYA 5JR3A 2VL8A 2CJJA 2DW4A 2X1EA 3BTIA 4HG2A 4E7LA 2XASA 4ZYEA 3G3ZA 1P7JA 1HSTA 2Y9YA 3TP3A 2VE8A 4MFEA 2DMUA 4C3JJ 2D1HA 2QKMB 2PLYA 2EZKA 5F1JA 3MN2A 1IDYA 2YU3A 2H27A 3MKWB 1ETYA 3BR5A 1BR4A 4RM3A 2LKXA 3KYCB 4MFDA 3ZMZA 2K9QA 1F9NA 1ZELA 2R7ZJ 2JRTA 4XN0A 1USTA 1BI1A 3CUQC 1HBXG 2Y2ZA 4XLEA 1QHGA 2GA2A 4CCNA 2HYFA 1HSJA 3HOWJ 2K7LA 1MBFA 2EK5A 1QBJA 1Y56A 3ERED 3SHFA 4XN3A 2HNHA 3L2QA 2IBDA 1LE8B 1TBXA 4B4CA 3FXKA 2E1CA 3WGGA 1UFMA 2HQRA 3BR6A 1ENHA 4XOPA 1WKMA 4IXAA 3REOA 2R4GA 1ZH5A 2F5EA 1T6SA 2CFXA 2G9WA 2OJED 4HF0A 4BUPA 5EG0B 3A0BC 4Q48A 1OYIA 2JA5J 3JRDA 2ZJ2A 3SZGA 1WVRA 1IN5A 2QSGX 2X6OA 2BY3A 2CUFA 1B1BA 5ILUA 3O3KA 2XAQA 4NBQA 5J6XA 3HGGA 1OJLA 3QAHA 2ISZA 2K86A 2VASA 5E17F 5KAIC 2OQGA 5IOZA 3IWFA 2BXYA 3LSKA 3N97A 1Z21A 3AG2H 2ETHA 2P0WA 3B6CA 1JJ8C 3CCLI 2XV4S 1TWAJ 1KU3A 1UJ8A 2AQFA 1IRXA 2WA0A 4A69C 3LL7A 1IG7A 2RN7A 2HVRA 1MBKA 3VWBA 1T98A 3OR1C 1UELB 1BIAA 3K6GA 5IT9Z 5GADJ 1B9NA 3F8NA 3BTJA 1P92A 2WADA 2EINH 3WTUC 5GPAA 3OYJA 2LY9A 4HSTA 2JRMA 4KIFA 5HDKA 2B63J 3K4CA 2FBHA 4C2UA 5CVRA 4HSRA 2UUZA 2KIFA 3DBLB 1MDMA 2M7AA 2W82A 4A0XA 1WJDA 3M8EA 1L0OC 2F6CA 3E6BA 1XPXA 2V79A 5LGNA 1RUNA 1OR7C 4XLCA 2EV5A 2KRFA 1QU3A 3K4BA 3SDBA 3ZMSA 1YFHA 1S3JA 3DTEA 1ZRFA 2EZIA 3I0TA 1IW7F 2BYVE 4AU7A 4LOCA 2CRGA 4Y17A 3NRVA 5KCMA 2EV0A 1V55H 2ZFUA 4I7HA 3QP6A 4JK1X 4DZPA 4XBFA 4GYIA 4A3EJ 2KIMA 4LG3A 4XLNF 2ESNA 3E6CC 4P9FA 4G94A 4B47A 1MMAA 4H4KC 3ABUA 4PJJA 5ILSA 3ZQGA 3ZQHA 3JRIA 1MDMB 3GTOJ 2A6EF 3OYKA 1MZBA 1K4TA 3GW2A 2FUG2 3HBLA 3O2PE 5L3BA 3ZQFA 5DUKA 1U9OA 3OIQA 1LDKB 2MW8A 2XF7A 2Z3YA 1DU0A 5J8CA 1YG2A 2Y75A 4HNVA 1PUEE 3G71I 1KU7A 3LSPA 4F52A 3KE2A 3QWLA 5ICEA 2DYSH 1RR8C 2XAUA 4ABZA 2V9VA 4QLCU 3HTUA 5FLXK 2OC6A 4Y3OA 1MMDA 5J1RA 3IRRA 5ILVA 4CZCA 2LVSA 4MO7A 3JTHA 1UHSA 4C3IJ 1RESA 4WX9A 5J3LA 3G2BA 1MW7A 5LGTA 1I6XA 1S9HA 3F6OA 1SC7A 2ELJA 2E60A 1LNWA 3A02A 4AC0A 4LD5A 3BCAA 2PI0A 1O7LA 2K4JA 1JT6A 4ZJZA 2O03A 4U7BA 1FPQA 1I3QJ 1QPIA 3M1EA 1NTCA 4PJMA 3G1LA 3ZMDA 3CCQI 2RKHA 3QOEA 2E2HJ 3G1MA 4GYGA 1JUMA 3BT9A 1HKTA 4OIOF 4YG2F 3ABTA 2ZMEC 2LTPA 1LFPA 1UB9A 3WODF 1KQ8A 2JPCA 1LB2A 2JSCA 2FOKA 1R49A 3TL4X 3BG5A 4PDKA 1HKQA 1Y0UA 2H09A 2P6TA 2HZDA 5CJ9A 4KFCA 4BXXJ 2EFWA 1JTYA 2GZWA 4CCMA 1S7EA 2O6GE 1ZTRA 2HOAA 4XIDA 1UHMA 2K27A 2QQBA 2DA7A 3H5AA 3L1PA 1RI7A 1JGGA 2LDUA 4HW0A 4MGRA 1VQPI 3H35A 1AA7A 4EM2A 5ED4A 2ZSHB 3OYNA 4UV8A 4FX4A 3J80K 1T33A 1TC3C 2IA1A 5HS8A 1JT0A 4G7ZF 3AAFA 2R7FA 2K3FA 3L2VA 3ZQQA 2VXZA 2E34A 5H6QA 1O3TA 1ZGJA 4BYYA 2EA2A 1R1VA 2E7WA 2JJ7A 3FXQA 2DJNA 3PSIA 3BC8A 2PX9A 3OYGA 2E1NA 1VQ8I 1D0YA 2FEZA 4BQNA 4KITB 3RQIA 2Q0OA 4XICA 2BXZA 3CZ6A 3GTMJ 1RIOH 2LFBA 2O61A 2ZXHA 4UVCA 2VE9A 1Y8RB 1PP8F 1LDDA 3OS0A 2DT6A 1SAUA 2E1MB 4P9UA 4E7KA 2VXDA 1U8RA 1IDZA 1HC8A 1K61A 3DTKA 2YR2A 1W4MA 2BY2A 4BE1A 2JVHA 2AHQA 2FNAA 1DQUA 4BQAA 3I59A 3CCMI 1H9TA 3BTLA 2DQRA 4M3BA 3MKLA 1SEUA 1JUSA 3WU1B 1ZGWA 3H9QA 1MNMC 2V1DA 1GXQA 3HUGA 5EDNA 1SAXA 1MH4A 4YIFA 2CS3A 3AG1H 4BJTA 1YW7A 1HDDC 2H1KA 1MSEC 5L3FA 3K1MA 4BEHA 3SEQA 1T08B 1MBJA 3KLOA 3LFKA 4RB3C 5M5WJ 2DT7B 2DMQA 2NNNA 4X1EA 3JRCA 4HLYA 1FIPA 5FLVA 2JVGA 5BNGA 2CFOA 3RIRA 3LA2A 2C6YA 3VPRA 1V5EA 3E3VA 4PGHA 2BY0A 2VC1A 2RGVA 3W6JB 4EMSA 4HX7A 4IVNA 4BBRJ 2VLAA 4A3KJ 1X3UA 4XLFA 1D1BA 5FRNA 1E3OC 3C2GA 2D2WA 2JT1A 1MBHA 2ICWG 3KYLA 2WB1A 3WTXC 1IXRC 2GXAA 2EZHA 3COAC 1X58A 4IOAF 2BHZA 4MTDA 4PFOA 3FKIJ 2F4MB 1QO0D 2ZKZA 3DKWA 1B8IB 4ENJA 1BI0A 4AWXB 2Z9OA 3L09A 3DLAA 4NC7A 4XRSG 2LY2A 3PQJA 1X1PA 5F1RA 4GXOA 2ZB9A 2ZNYA 5D8KB 1A04A 2QGUA 2L9RA 3F0CA 1POGA 2Y48A 3W2AA 3WTYC 1T0FC 2ZJRF 1X4PA 2CW0F 1KU9A 4IEJA 3FMSA 5D6EA 2H94A 2GIZA 3ISPA 1I6HJ 2KLOA 2W84A 3GFIA 4KA4A 4I0AA 5J47A 2M34A 4B43A 1JKQC 2DTRA 4AYBA 2O3FA 1Z6TA 3HSEA 1UG0A 4L0YB 4HLXA 2XSJC 4LIVA 3RPUA 2P5LC 2OTJI 1N77A 2DFIA 1R1TA 1G3WA 3G6EI 1ACIA 2DK8A 4A6EA 2K9LA 3GYHX 1HOMA 3VEPA 4Q5SF 1H8AC 2F4IA 3H9JA 3TP0A 5E1XA 1DP3A 4E7HA 1PDNC 4LIUA 1TT0A 2DXIA 1B9MA 3WHBA 2R7XA 2R5YA 5K7ZA 5BOXA 1ZN2A 2VB6A 2VKVA 3BR2A 4ESJA 1H0MA 1HQCA 4WCGA 2CGPA 3QYBA 1TWHJ 2DOFA 5J1YA 5E8GA 1EH6A 3K70D 2XAHA 1H89C 4I6ZA 1I39A 3L2UA 5CQEA 3O8HA 1WJEA 1ZRDA 2QENA 3F8BA 1FOWA 2LRDA 4HQMA 3MZHA 4AUXA 4LB5A 5CQGA 4FQGA 3SDGA 3BJAA 4ZZLA 3R0AA 2BVLA 4NQWB 3JAMZ 2FXAA 4PUSA 4KICA 2M4GA 2Y9ZA 1Q1VA 1U5TC 2J5PA 1U9NA 2LOOA 2NVYJ 4HF2A 1AKHB 4HF1A 1G59A 3CCJI 2XHKA 1PYVA 3GBGA 5EZHA 3CQZJ 2OBPA 3HSFA 3HGYA 4IHVA 5IPAA 4YIRX 2XUBA 1XX5A 4FETA 4MLOA 3M3YJ 2L9SA 2MH2A 4ZYGA 2DA4A 3FBIB 4FX0A 4FHTA 1IN6A 2KFDA 4PJ0C 2DBBA 4B09A 3UKGA 3S1QJ 4M9XA 1MKMA 1QHHD 2NYXA 2ADUA 4M3EA 4P55A 2X0LA 1IRFA 2WV0A 4CO8A 4M3GA 1XD7A 1ZG3A 3BY6A 3OYBA 2STWA 1IV8A 2E36A 5DM6F 2AS5F 1N75A 2MLGA 4N4NB 5B1BH 1G3SA 3KP4A 1J09A 1W7PA 5JHFA 1IO2A 2ID6A 3JTGA 1K78A 4ZTJA 3P7NA 4XOTA 4BXFA 4IRGA 3JW4A 3CC2I 3H0DA 3CCEI 5D5WB 5CPRB 3K9TA 5F27A 2DOEA 2RQPA 2ZO4A 3M7GA 1UAAA 3U9GA 4MQVA 1BI2A 2WAFA 1XSVA 1FMVA 3W6VA 4AIKA 3GTPJ 2QBYA 1DGWY 4BU2A 1HDPA 1I1SA 1P4WA 2L02A 3LSTA 5E1ZB 1WH7A 3JRAA 1T38A 2GXGA 4KMUX 3E97A 4F91B 1SD5A 1I1GA 1K6OA 3ZP5A 4Y7NJ 1RUOA 4U0WA 2LSOA 2HYGD 2V7FA 1P7IA 1YLFA 4AIDA 4BKXA 1VQ4I 3ZQLA 5C4JJ 4N0BA 2IJLA 3D1NI 4IO9F 4RAFA 3SYTA 2CQ7A 2R7OA 2OTLI 3B6AA 2NOJB 5FKOA 2CQQA 2R92J 1Z0XA 3I64A 4ESFA 4HNUA 2VQCA 1S72I 2BW3B 3K4KA 2BE5F 1TTYA 3DEEA 1FP2A 3BR0A 1Z77A 4ENKA 2OV7A 4ETSA 2CW7A 3I71A 3RKQA 2CU7A 2ZXJA 3PM1A 2XPWA 2FJ1A 2QQAA 2HOEA 1K7AA 4E7JA 2L4AA 3RJPA 1OCCH 2EQRA 4R8HA 3P9KA 5ICCA 3B73A 4KN4X 1SANA 3LA3A 5LHGA 2DJIA 2VBZA 3DTIA 4IF4A 4JQFA 5L3CA 5AIPA 1ITYA 1LQ1A 2UZKA 1V3FA 3VYSB 3GTJJ 3S3MA 5DYMA 1IUFA 4WXHA 3TW7A 5E3OA 3BWGA 4PZJA 4YELA 4KN7X 1S5LC 4XLAA 3CUQA 1L3LA 3JCUC 1UHWA 4CGZA 3VODA 3FHZA 1T39A 2XC7A 2VJ4A 1XSDA 4MHGA 1QVUA 4HYEA 4M6YA 3CP8A 4UUVA 1X1AA 1SFUA 5E20A 2CW8A 2IS6A 3Q0VA 2WV1A 5DDGA 2HKXA 3KP2A 3OR2C 3RKXA 5M5YJ 3F23A 3A4CA 4PSWA 3N05A 4UNOA 3CO7C 4BNCA 4LK1F 5GTIC 1EH8A 2M87A 2NAZA 3H3UA 4IX7A 4A93J 3L7WA 1VNDA 1B72B 2FD5A 5ICGA 4XM3A 3W3CA 4OAZA 5KAFC 3I5UA 3CMMA 2HWVA 3KEQA 2O8KA 3K2ZA 2LY1A 3CDHA 2YPRA 4U7DA 2IA0A 2KRHA 2DN0A 4GRIA 1TQMA 3ROUA 3ZPLA 2O7OA 5F64A 5H6RA 1AWCA 2DCEA 2EA4A 1BC7C 4MNUA 1R71A 1U2WA 3DKXA 5DCMA 1XC5A 3PFYA 1MMNA 1W36D 3BZCA 1SVLA 2L2OA 4UUSB 3AL0B 2VPLA 3EUKL 3F72A 2COMA 1LFUP 2WY7Q 3HOVJ 2P7VB 3DCFA 3H92A 4G8XA 2RVCA 1XS9A 3FWEA 2R7WA 4EJTA 2NVUB 1WFXA 4ZDLA 3S2DJ 2QLZA 4CUGA 4EJVA 5HNHA 3EYIA 2VONA 2HQNA 4XORA 4RGXA 4DNCA 5FLXZ 2OCCH 2XPVA 2HVSA 2DLLA 2HGCA 2LD5A 1OR7A 1J75A 1R7JA 1VI0A 3CUOA 1WHUA 1MSFC 2DODA 3GUDA 4IQJA 3FKJA 1DP7P 2X6WA 2ZXIA 3NWTA 3Q0UA 3IWZA 3WG9A 5DCMB 4QIWN 3S17J 3CCRI 4CHUA 1REPC 2K40A 4RS8A 5CVVA 3ZR8X 1O3RA 3DKYA 4YRVA 1T2KA 3TMOA 1QZZA 3Q9SA 4YFKF 2QWWA 2X4HA 4DJAA 4DYQA 2NOGA 4LLNA 5IOYA 4D7NA 4BDZA 1DUXC 4IQ4A 3D5LA 3EQLF 1EA3A 1GVDA 3WTZA 3D5SC 4KNYA 3M07A 2BVMA 3OSFA 2E35A 1LDJA 2A69F 2IA2A 2HPIA 3FXJA 5JI6A 3WU2C 4ZH4F 4L9NA 1TLHB 1R1UA 2WY8Q 4EJOA 1SVOA 2QVOA 4FE7A 3TDZC 1XDUA 5CVJA 2V6EA 2X6YA 2A61A 4HX4A 3HXLA 3HHGA 1T95A 1RNLA 3ZN1A 4AIJA 1Q1HA 2MD0A 5M5XJ 3J80Z 1QZYA 3PO2J 5EJCA 2YS9A 3KLNA 2HTSA 1YIOA 1MJAA 4N4OB 3J7ZI 1Z3XA 2QF7A 4BY1J 3IKVA 3ZGKA 3E6MA 4E7IA 1KQ0A 3A1YA 4RB0A 3OS1A 3BG6A 1XMAA 1WJ5A 1OCOH 3OL3A 3RTRA 4N9IA 1KONA 2VBYA 4ZYAA 4BAYA 4MQ9F 3J81K 4DYCA 3W2WA 3V7CA 2V6CA 3GFLA 3J7AO 2NRAC 2XVCA 2KT0A 1JXSA 4KT6A 2LP0A 4BS9A 2JMWA 1X1CA 1ZARA 1IC8A 1P2FA 2RC4A 3FX3A 4PFPA 4EM1A 3K1PA 4PGGA 3HOUJ 3ZCOA 2W00A 2VT2A 3KEYA 3QODA 2ZMEA 2X1DA 3VSKA 1I27A 2HTJA 3KCCA 2L7KA 2QYOA 3U1DA 3CCUI 2OU2A 3K4MA 4IJAA 1K83J 3S32A 4QSHA 9ANTA 1MMSA 2QKLB 3EYYA 4A6DA 2M1BA 4XLPF 1E2XA 4XK4A 4LITA 2HS5A 1J2XA 3H3VK 2F4OB 3RKWA 5J8FA 1V5FA 3RYPA 2KDZA 1DGRM 2WAQN 3KP7A 4AVPA 1GHCA 1TWGJ 2PN6A 2OF7A 2B0LA 2ESHA 5GTHC 1YIJI 5JLWA 5ICFA 1UZCA 4YEJA 3HDDA 1QGPA 4RDUA 1QRYA 2MC3A 3C18A 4P1WA 2R7QA 4KJZA 1R9TJ 4KIBA 1OCTC 1VQ6I 3MKYB 1X2MA 1XGOA 1UMQA 3U21A 5FKKA 5J4VA 4I99C 4V2FA 3GLLA 3CMYA 5IYDJ 2YSRA 4JX4A 4MTEA 2W57A 2QQ9A 4OAYA 4F55A 3H1CA 1S7AA 3K1NA 4IOCF 4QPOA 1YS6A 4A3IJ 4A3JJ 2KDOA 1BR1A 3DBHB 1P4AA 3BROA 5LEKA 4CYCA 5E3NA 3Q9VA 2VOPA 4LK0F 5LRSA 2HVQA 4I0BA 1TNSA 3QU6A 2BZTA 2F2EA 1FOYA 2RNGA 1WZ2A 2R93J 3HYIA 3HPGA 4OMYA 3L00A 5DM7F 3OYDA 5B66C 2XPUA 1FOXA 2BGCA 1P9QC 3OYLA 1DPRA 2DTZA 1XGSA 3R61A 2LG4A 1U78A 4BL0B 1FOKA 2OA4A 4DZJA 1GV5A 5FKLA 3B02A 1D0XA 2XGCA 2XB0X 3D0SA 4S05A 1LEAA 3VOEA 4NC8A 4A5MA 5L3DA 4XMYA 3HKZN 4XRMA 5IT3A 3M4OJ 4ZDPA 2JPBA 4UUTA 2HQ5A 5TRDA 3DPUA 3K7AJ 2GM4A 5C3EJ 2P81A 3W6KB 2JSPA 4LLGF 2F48A 5H20A 4OIQF 1BN5A 4IHYA 1TW2A 3CF2A 1PUFA 3JRHA 3R6SA 1ON2A 2R7DA 3HJEA 1QZEA 4ANJA 1MJBA 1OYYA 3ZMTA 3RI4A 3DU5A 5FO5A 1X19A 5LEJA 3QYFA 3LSGA 2R7UA 1FLIA 3HRTA 1HW2A 1SMYF 2IT0A 4HOBA 1ZLKA 3TBIA 1FBUA 1T0FA 2YU9J 2L7ZA 4GO1A 1MD0A 2A5YB 4CA0A 1PP7U 2EIKH 5EEGA 1YYVA 3EETA 2CWEA 4LG0A 1JJ6C 2M3AA 3HRSA 4II2A 3UR3C 2MBFA 4NC6A 1A6IA 2H6CA 2EJRA 2VKDA 2LC2A 1KA8A 1Y8QB 1BW6A 1RETA 2KRCA 3MMYB 1FYLA 4PK4A 4S04A 2CUJA 4I01A 2DMNA 4M72A 3GLXA 1FWZA 2R5ZA 1A5JA 4V2GA 2EFNA 2FA5A 3E6DA 2ELKA 5D4RA 1HKSA 3WGHA 1FT9A 1BJAA 2A3SA 2CUEA 2BHYA 2O0YA 3QPHA 3TKYA 4ITVA 2X9DA 3ASOH 5KK1A 2PMZN 3LQRA 3QPLA 4HEA2 3M8FA 4CH7A 1HF0A 1IN4A 4E6KG 2GLOA 1MGTA 2K5CA 3I59B 3HZJA 4L5EA 4CSWA 1W0UA 1QQIA 1O3QA 1R6RA 3H0GJ 3GVAA 4A0YA 3BZ6A 3DPLC 3OMYA 1WJBA 2DPDA 4HA8A 2F5FA 4Y4RA 4J00A 1YS7A 3HUGB 4G6QA 2P6SA 5LGUA 1XGNA 1R23A 1OLTA 3BOQA 4DBRA 2D45A 2H8RA 3BQZA 2DOAA 1U5TA 4BEHB 2R5ZB 1I50J 1SFKA 3CC4I 3ZQ7A 3MQ0A 3RQ4A 1O7FA 2DYRH 3DXJF 3KP6A 3R0JA 5L3EA 3PNYA 3I3LA 1XCVA 2LBFA 4OOIA 5DCFA 4A3FJ 1Z6RA 1KYWA 3U1KA 3DF8A 2MG4A 2DA5A 2V1XA 3RKYA 1Z05A 1XSXA 2IGOA 2IRFG 2PG4A 2E1MC 1WRJA 3OYFA 2CV2A 4IHTA 5HODA 3BJOA 1SVMA 2ME6A 2VUMJ 2VI6A 2MLKA 2LKPA 2LR8A 2CV0A 3BCBA 2KJCA 1FMWA 1VQ5I 3FIWA 2TRTA 4C30A 3R4KA 5IP9J 1XMXA 1ZKGA 2VC0A 3S1MJ 1ZG1A 1FBSA 1IRGA 3K70C 3QPSA 5FFZA 1K4SA 2DA1A 3L2CA 3L9FA 1JHHA 1ZK8A 2VJIA 3I4PA 3GFMA 3T8TA 2XIGA 2PJPA 1W5SA 2RV8A 3NEUA 3WHCA 1H9GA 5CVUA 5LFAA 2QCOA 1JKRC 1GUUA 2EPFA 3LA7A 3PFIA 1DPUA 2WWYA 1YW9A 5TISC 2KP6A 4EM0B 5KHDA 2QZ8A 4K2EA 2TCTA 3I58A 1LEBA 3CJTB 1JKPC 5LHHA 1LVAA 2HXOA 3TOAA 2CV1A 2EWNA 1SMTA 1XTAA 3UNGC 2QEXI 3DEWA 4BY7J 3HTSB 3S3NA 3GF2A 4WXDA 1FY7A 2DFHA 2KL4A 3AG4H 2K9SA 1YO5C 3OYMA 3F21A 1UG2A 2JTVA 5B5EC 5KVRA 2LYCA 2K85A 2A6TA 3BTCA 1XGMA 5DD8A 3ULQB 2G0EA 3A01A 1YJ9I 1CF7A 4QPQA 3V7RA 3CESA 4BJ6C 2W1OA 3LSJA 1BM9A 1OISA 5FKNA 2GXBA 2LKSA 3F22A 3OSGA 4EATA 4RAZA 5CYVA 2K9NA 2KHMA 3T1BA 2DAOA 2R5YB 1K79A 2QSHX 2VJJA 3K0LA 3RSNA 3JSOA 2L01A 2L7FP 4BGDA 3L2WA 2DA6A 5FKMA 2EB7A 4F92B 3A01B 3I56I 4MEXF 2EZLA 3PL8A 3MZ8A 4P5OA 2VQGA 2NNYA 4UY8I 4JOMA 2FF4A 4IPAA 1V54H 1S8NA 2ISYA 4BXUA 2ACJA 1O57A 1Y1WJ 3KYDB 2W7NA 2F5DA 3Q3SA 4XKCA 1WI3A 3H3ZA 1ZYRF 1BL0A 2WAQA 1OYWA 1XDSA 2K02A 2YX7A 4A3CJ 4HDVA 5J4YA 3IH4A 5F04A 2M8EA 4EGYA 1MBGA 4U87A 4O3MA 1VQNI 2IS4A 4A3LJ 2GBYA 4BDYA 5AONA 4HZFA 4AIHA 3IV5A 4F7ZA 2ELHA 3V42A 2XROA 1HW5A 4HBLA 1J7KA 2HR3A 1GDTA 5B1AH 3BG3A 3GFJA 2HPMA 2G7HA 3MVPA 3JR9A 1X4OA 2NS0A 2L9VA 2RREA 5GAHJ 2ZNZA 3A03A 5FD5A 2HDCA 1ZR4A 4M71A 4HAMA 1GVJA 1W7PB 1B6AA 2IXSA 3X2QH 1IAWA 1W0TA 5D5VB 1JKOC 1K78B 5M3FJ 1IV6A 1R4MB 3S8PA 2PJRA 2UV1A 3RYRA 4L9TA 4RB2C 3VB2A 1WPKA 5CKTA 1GXPA 4XQFA 1OKRA 2I5UA 2FQ4A 1JUPA 4WWCA 4RB1A 1OCPA 2XGDA 1Z3YA 3ZMVA 3OYAA 3Q0WA 1OCZH 5BMZA 5A2QK 2A68F 1DDNA 5EEHA 4ZC3A 2IPQX 2VBWA 2QBYB 1D1CA 3OWTA 4YIIA 3GTLJ 2KJBA 1V5GA 1BOBA 5FRMA 3FXLA 3S3OA 1B4AA 4LB6B 3TGNA 5LHIA 4BBSJ 2FNPA 2MABA 1VF9A 1E0EA 1RC9A 2KMUA 5IP7J 1P6RA 3RPUD 3KFWX 3ASNH 4ZTFA 1LPQA 3H36A 4I98B 3N4MA 3HIFA 5M3MJ 1SFOJ 3OYIA 3RDIA 5LD2C 1RKWA 2PJRB 1IN7A 2UXNA 4BHCA 3WTTC 2G7UA 2PMHA 2Y30A 4DGWB 3HG9A 3NARA 4XKVA 4DBQA 4B44A 3FXUA 3I4NJ 1J5YA 4X6AJ 4B8XA 1KU2A 4A3GJ 2HQAA 2WTEA 2B9SA 4EQQA 2HDWA 1WCMJ 4X0GA 3T8RA 2Q2EA 4Y33A 2BV6A 2MD5A 3CJNA 1NH3A 2NXNB 1I5ZA 1IUYA 1MBEA 2EFQA 4UVBA 1YE9A 5CLSA 3TOBA 2W24A 4E7SA 3EUHC 5HS9A 1PJRA 3J81Z 2DU9A 3JRGA 4N9HA 2KZGA 1MIJA 5BPDA 4YFXF 3S15J 1XCBA 2XB5A 4L9JA 3BJ6A 3DQVC 3RZOJ 1R5ID 5HLTA 3JRBA 2O8XA 4L5JA 4S0HB 3CMAI 3J7AY 2X6XA 1W36C 2VT3A 2V1NA 5JFRA 5J40A 1PVEA 3TDUC 2MSYA 4KIGA 3VYTB 1YW8A 3CUQB 2L0KA 3K2AA 3NWSA 4AD9A 2IGNA 5EEAA 1LFBA 5BS6A 2CQNA 4CYDA 2XKPA 3ZN0A 2RAEA 3R60A 2N8GA 3LOCA 1ZAOA 2IEKA 4U88A 2A07F 4JYKA 2NS7A 2MYSA 1RKTA 1ON1A 2J5OA 1J0RA 2O5RA 2XDVA 4I02A 4A3MJ 5BQTA 3J7YJ 5IP6A 4FT8A 2D5VA 2AQEA 1W7PD 4F93B 5D4SA 4M9ZA 4YFNF 1FYMA 3MWMA 3JRFA 2HXIA 3SFZA 3EPZA 3KETA 4DQ2A 3PNTA 1FTTA 3V8JA 5E8IA 4HX8A 4H0EA 5HS7A 1Y1VJ 3ZQCA 3PIOF 3OIPA 1MJ9A 1MH3A 4I76A 4BACA 2ZBKA 2VKHA 4LFUA 2PEXA 3SZTA 1WH5A 2KKOA 4G7HF 5D5UB 1G8XA 2HKOA 4I2OA 1IGNA 3HRUA 4KUMA 2L5QA 1R5GA 5FFXA 1TQIA 4HNTA 4MIMA 3MAJA 4IHWA 5HNFA 3TEDA 4RAYA 3IL2A 3DV8A 1BOAA 1YHQI 3S16J 3QQAA 3CD6I 5L3GA 2NS8A 4CZZA 1WQ2A 4XSZF 4IL6C 2WB1N 4UHTA 1LE8A 4L0ZB 4WK8F 3F6VA 3F8MA 2JQ7A 3P9IA 1ULYA 1FBQA 3ZRGA 2CG4A 2VKEA 2LLKA 3HSRA 1VTNC 1VQMI 1LVKA 2FMLA 2M45A 4R79A 2DK5A 2DI3A 2FX0A 3ZXSA 4KMFA 3G1OA 5EG0A 5IYBJ 4C2MJ 4GGGA 1J9IA 3GO5A 3M9AA 4NUBA 2VIXA 1VQ7I 3GTGJ 3ONQA 5JVTA 2W85A 1ZQ3P 1R36A 3DEUA 3A0HC 2E2IJ 3LFUA 2HU9A 2VQHA 3ESWB 4LLLA 1OQYA 2FBKA 3HHHA 4AYBN 1OCRH 1HLVA 1STZA 1IRZA 1YI2I 3KPHA 1NG7A 4GDFA 4FCYA 1KGSA 2AO9A 2I8DA 3FM3A 1U3EM 3FK7A 4XLHA 2JUGA 4BQQA 1U0JA 3IC7A 3LNQA 1IXSB 4EV0A 3BDDA 4OIPF 2B7EA 3E5UA 3AL0C 1ETWA 2H8WA 5K5RA 5F08A 3HOXJ 3RPQA 1YX5A 3CJRB 2X1CA 5FLMJ 1ONVA 2MGQA 3TO7A 1S6LA 3ABLH 2Y69H 4M3FA 5EF6A 2RDPA 1ETKA 3ECOA 3LSHA 3DPTA 3PQKA 4CCLA 3TW6A 3OIOA 2DO7A 3FZVA 4M6XA 5ERIA 4RGSA 1V4RA 2OUMA 1WJFA 1W5CC 2W4SA 5GP9A 3ZQIA 3PO3J 3PNVA 4B48A 2M2EA 2HZTA 1B59A 3VYRB 3KP3A 4HV6A 2DMTA 1ZGAA 3JSPA 2M0CA 3C7JA 1AOYA 2BEOA 2UXXA 5J1UA 2HOSA 3QPTA 1SD4A 2RQQA 3S93A 3NQOA 5F6FA 4M6VA 3K10A 1VZ0A 3VFZA 1A35A 4BE2A 1BI3A 1D8KA 3CLQA 2IVMA 2V1UA 1BJZA 4IRIA 3ZOBA 1VFCA 3PIPF 3QYEA 4L18B 2Z1DA 4XSXF 2P5KA 1FYKA 2XRNA 4BJ5C 1X2NA 4RBOA 1ZR2A 2ZMEB 4EEFG 5HLGA 5FD6A 4C3HJ 3L2RA 4CCKA 3K4NA 4Q4ZF 1D0ZA 2LMDA 3H9GA 2HYJA 4G6TB 1ETVA 2ME0A 4NNJA 3O6BB 4II3A 2Z33A 1AU7A 3M8JA 1TQPA 1A6QA 3CDLA 2PQ8A 1BA5A 2MH9A 3TQNA 1KZHA 3G4SI 3WTSC 2K9MA 4B3AA 1FIAA 2IGKA 1YRNA 3OOPA 4D5CA 4M73A 3OYHA 3S14J 1Y39A 1SD6A 3DLLF 4HRIA 3SEZA 1G2HA 4UB8C 1X3ZB 5GAEJ 2QUFA 1A31A 3IH3A 2DA3A 3FMQA 1TP4A 3EDPA 3JREA 2DMPA 3HOTA 1C0WA 5KNLA 2HEOA 2IS1A 4OINF 1F43A 1NK3P 2JA8J 2Y0MA 3FISA 4D5FA 3RZDJ 3HM5A 2NVQJ 4BHBA 2L54A 2Q1ZB 3MZYA 1X1DA 2FE3A 4G6DA 3PUBA 2OZUA 1YRNB 1XG1A 3MD2A 4RLQA 2M4KA 2XGEA 1R58A 4DIQA 5H2FC 1HXDA 2OD5A 4B3XA 5DD4A 3IRQA 1O4XA 2M8GX 1APLC 4G7OF 1TWCJ 1R22A 2GOMA 3MCZA 4KT5C 4ZYHA 4CYCB 4A12A 5E79C 2ECCA 1R00A 3WU0A 3Q5FA 1YJWI 2HFHA 1Y6IA 2F5CA 5HDGA 3SQNA 3E1SA 2E1OA 1ETXA 3CP2A 3WTWC 1JTXA 5HDNA 1A36A 3HC7A 3CTAA 1R4NB 1FX7A 1JHFA 4QWQA 4RMNA 4D1QA 1QA6A 1BW5A 1RPWA 2TDXA 2CYYA 4A5NA 5F0FA 4D0PA 1FSEA 4E4HA 4XKBA 3PUFA 4EJUA 2VPRA 2WAEA 2KZVA 1CGPA 3GCMA 1WSUA 1KYZA 4G9YA 5AIQA 4ENNA 1EF4A 1VQKI 2PMUA 1VQLI 3DP7A 2GAUA 4XRFA 2Z5UA 4L9VA 1GV2A 1Z91A 5LLQA 3HRMA 3GEZA 3V8KA 4HV5A 3FBNB 4ON0A 3BPVA 2FOWA 4A3DJ 2ZFWA 2R7TA 2P4WA 1ETQA 2JUCA 2H1LA 4M3DA 4CCOA 3KZYA 2M30A 5BPIA 5TGTA 4KYWA 3LMMA 2VBXA 2GQQA 1F4KA 2CMPA 4CICA 3FXOA 1D5YA 1F5TA 5IT9K 3LSIA 1WJCA 1OFCX 3HB9A 3MEXA 2V9KA 4DW6A 2DPUA 2JA7J 4J01A 3QRFF 4Y15A 1LJ9A 1OMIA 4JBAA 4J19A 4CXFA 4GCVA 3F9KA 2DT5A 2KPMA 1PUFB 1KQ9A 2FBIA 4ENMA 4PJNA 1XN7A 1YQAA 3BP8A 1VQ9I 3HOSA 3GZ5A 4QTRA 2EIJH 2OAZA 2Y0SN 3IKTA 2DDAA 5JHUA 2DA2A 1BIBA 2E19A 2HDDA 5F0HA 4A2UA 4Q47A 3H5RA 1TW3A 3LAPA 5FB2A 3S1NJ 2WC2A 2LF8A 3IUOA 1ZHFA 2GOXB 2CUZA 2JWTA 1UCRA 3F8CA 3SXYA 1ZLJA 4NB5A 3WG7H 2FSWA 2AXLA 2VOOA 1QVTA 2IAIA 3HPHA 4F3QA 4LG0B 3OYEA 3GX4X 2FQ3A 5D6FA 5C4XJ 4RLFA 4D7MA 5GAGJ 3BZKA 4C9YA 4E70A 4UXNA 3K4LA 4XL9A 1EJ9A 2LH9A 1ODDA 2FU4A 3AFHA 2L4MA 1B8IA 1BC8C 3K69A 2DQLA 4HPQA 5FJ8J 3OS2A 3MFKA 5LBQA 1JGSA 1E17A 2A05A 3BR1A 3ERMA 1RR7A 5DS9A 4UV9A 1D5VA 2PFBA 1NK2P 1FSHA 5HVQC 4BQOA 2BOLA 3EUAA 2XRLA 2COBA 4NDLA 2XF6A 2KQRA 3H5NA 2LNBA 4ZDOA 4O6JA 4I09A 4E7ZA 2MA3A 3D5RC 3CCSI 4LJZF 2IW5A 2DFEA 4UB6C 2EFPA 3I9V2 2OZ6A 1MNDA 2Q8KA 3C1DA 4R1HA 1YOVB 2P5VA 1U5TB 5EGOA 1N78A 5A2QZ 4XRSA 3IH2A 2CQKA 4A3BJ 1Z7UA 1S7OA 1OPCA 3WGIA 5K7FA 3OV8A 2KIUA 1F36A 3KEOA 2LBFB 1FZPB 2QM3A 4XKWA 4FISA 1HA8A 3VDXA 3I55I 3ABMH 1BR2A 3K4JA 3V8LA 3VSLA 4O5VA 2XAJA 3AG3H 1J59A 5DUIA 1Z1DA 3V4GA 5K5QA 1DU6A 5DEQA 5HLIA 3HOYJ 1ZREA 2Z16A 1CQTA 1FEXA 3CLOA 3I53A 3W2VA 2KIQA 4RGUA 1Z7LA 4W1UA 3WE2A 1E3PA 2A6HF 2X48A 3HEFA 4P96A 4FE4A 2UWMA 5EGOB 2O9LA 1YJNI 4EVIA 2LREA 2JA2A 2DDBA 2L7MP 1XMKA 1RRJA 5C44J 3VYUB 2K3PA 3SZPA 2E71A 3FXMA 4NQWA 3IAM2 3LQQA 3E7LA 1ETOA 3E5XA 2NVXJ 1WGXA 1X1BA 1WWXA 2BY1A 5E3LA 2L9NA 2OCEA 2EV6A 3O8GA 4DOZA 1AKHA 3E0JB 1M1EB 2Z99A 3QOPA 3GTKJ 3KP5A 4RGRA 3RCOA 1EV7A 3CCVI 2YX4A 3BLYA 2P7CB 3BG7A 4JX5A 2K4BA 3CC7I 2XKOA 3KX2A 4Z6YA 5HOOA 1S29A 5FROA 5FGMA 2EH3A 1YITI 3GZ6A 3DBRB 4BH9A 2YUSA 3T5XA 4LMYA 1USSA 2H6BA 4GFBA 3BR3A 3I4MJ 2CO5A 2QQ8A 1CF7B 1GLNA 2JN6A 2F5VA 1Y0NA 1W5TA 3OY9A 2LK2A 3OYCA 3OOUA 2LF7A 2EILH 3DU6A 2GIVA 3GTQJ 3LWFA 1SFXA 5LRRA 1Z67A 3PSFA 3SJMA 2VQLA 4HDUA 3PJRA 1G3TA 4FTHA 4RA2A 2V26A 4LGWA 2WBMA 3M1CA 4ESBA 1IXCA 3HL2A 1YTYA 1IZ1A 4JX6A 4PCQA 3ZMUA 1F1ZA 4IHXA 1LKXA 2NVTJ 1G4DA 1O3SA 3KIOA 4BE0A 2QSFX 2DFFA 4V19K 4C2TA 3S1RJ 1SD7A 3EUHA 4Z2YA 2VN2A 1XB4A 4PJLA 2CQXA 5JVGF 2FMYA 2CH0A 1D1AA 4MEYF 3LSMA 2XF5A 3FK6A 1VQOI 2E5ZA 2GWRA 3WTVC 3G73A 1NHAA 4CDGA 1I3AA 5E3MA 1H88C 1K6YA 2ECBA 2R7RA 4JP0A 2Y31A 3GWZA 2V9PA 1ERDA 4G12A 1ZG5A 2W48A 3CJQB 2RNJA 2R3SA 1ORKA 1Z9CA 3SFIA 3FHNA 3FXRA 3NAUA 1FTZA 4Y52J 1FC3A 1MNEA 2R7VA 2EBIA 1U8BA 1GT0C 1N25A 2BW3A 2OPTA 3P9CA 3GXOA 2ZJPF 4XR6A 5DTDA 1R5HA 2OQRA 4RAGA 3DWLE 2X51A 3CDIA 2XAFA 3TO6A 5IY5H 5E18F 1IJWC 3OL4A 2M7BA 3ECHA 1QPMA 3ELKA 4OU0A 5B3SH 3CF5F 3IHUA 3IAS2 5JLXA 1MMGA 1T8IA 4AM3A 4IRHA 1JI8A 3TO9A 2XAGA 1WI9A 4OIRF 1YX3A 3ML6A 3E5QA 2D1VA 4M74A 3S2WA 3CCYA 1FP1D 2Z2SB 2ZJQF 5DV5A 1RZ4A 2M5WA 1ZRCA 4U0VA 1E3HA 1BBYA 1IF1A 2E5NA 1EH7A 2ZCWA 1NG6A 4M9SA 4EGZA 3HKZA 4RM2A 3CO6C 1WJAA 1G6NA 3WE3A 1HCRA 2EFOA 2IS2A 1HW1A 3T0YA 1JE8A 6PAXA 5TJJA 4WF2A 3BQYA 5K5OA 2EIMH 2IP2A 3FDYA 4BHPA 1D3YA 4IKFA 3C3WA 5D5XB 3A2KA 3V7SA 1T56A 3I54A 2M0MA 2GA1A 1TT5B 1TNTA 4EJWA 1FNNA 2E7XA 3QU3A 2L3DA 3C2HA 3DFGA 4UVAA 2FRHA 2QA4I 2ZSIB 2M9HA 4PSXA 4ASNA 1G3YA 2R0QC 4ZYDA 2W25A 2HOTA 5E1WA 5K7HA 2ZXWH 4CCJA 5K1YA 2MFZA 3KZZA 3AKZA 4XONA 1B72A 2AXTC 3MKZA 4Y13A 2KISA 2Q2EB 1D8JA 4IHSA 2JK3A 5GPCA 3JAMK 3CMEI 3ABKH 4D9JA 2ID3A 2HI3A 2P8TA 1TZLA 3C2BA 5F0CA 5EZGA 3BG9A 2ZC2A 1W1WE 4NHJA 4HQEA 1U6GA 4IZZA 4OMZA 1EKEA 3F3XA 3IP4B 2E2JJ 4KISA 3LSRA 4A0ZA 1QNTA 3P5JA 4W97A 3QP5A 3LAJA 2A5WA 3KZIC 4B1RA 3F8FA 4DYRA 1AHDP 2MC4A 3FMRA
chains in the Genus database with same CATH topology
2DMNA 1BJZA 2DA4A 3ZOBA 1VFCA 2R5ZA 1A5JA 4V2GA 4UUSA 3UKGA 3S1QJ 2ELKA 1X2NA 4RBOA 2I10A 1ZR2A 1FJLA 4EEFG 2CUEA 4M3EA 4C3HJ 2X9DA 4M3GA 3HOZJ 2HYJA 2PMZN 3QPLA 2GLOA 1HF0A 1ETVA 2ME0A 4L5EA 5IYCJ 1W0UA 1AU7A 3H0GJ 3CDLA 1BA5A 2XSDC 1TWFJ 2JA6J 2ID6A 4B3AA 3S2HJ 1FIAA 1YRNA 4D5CA 3S14J 5EYRA 5F27A 2CJJA 1G2HA 3BTIA 2H8RA 3BQZA 3IH3A 2R5ZB 1I50J 1P7JA 2DA3A 2Y9YA 3TP3A 4MFEA 3JREA 2DMPA 2DMUA 3W6VA 3GTPJ 4C3JJ 1F43A 1NK3P 2EZKA 2JA8J 5F1JA 1HDPA 3MN2A 1IDYA 3FISA 4D5FA 3RZDJ 3HM5A 4A3FJ 2NVQJ 1ETYA 1WH7A 3BR5A 2MG4A 2DA5A 3JRAA 2LKXA 4MFDA 2K9QA 4Y7NJ 2R7ZJ 5HODA 2ME6A 2VUMJ 1YRNB 2VI6A 1XG1A 2LR8A 2XGEA 2Y2ZA 1P7IA 4BKXA 1O4XA 3ZQLA 3HOWJ 5C4JJ 3FIWA 3D1NI 2M8GX 2TRTA 1APLC 5IP9J 1MBFA 1TWCJ 1ZKGA 4CYCB 3S1MJ 3B6AA 5FKOA 2CQQA 2ECCA 2R92J 1Z0XA 2IBDA 3QPSA 1LE8B 4B4CA 1RETA 2E1OA 1ETXA 2DA1A 1JTXA 1ZK8A 1Z77A 1ENHA 3BR6A 3BR0A 3RKQA 2CU7A 3WHCA 3PM1A 1BW5A 2XPWA 1RPWA 2FJ1A 2QCOA 1JKRC 1GUUA 5EG0B 5F0FA 2JA5J 3JRDA 2VPRA 2TCTA 1JKPC 2EQRA 2X6OA 2CUFA 2HXOA 1EF4A 1SANA 3HGGA 3DEWA 4BY7J 1OJLA 1ITYA 5IOZA 1GV2A 2K9SA 3GTJJ 1UG2A 1IUFA 3TW7A 3B6CA 5E3OA 1JJ8C 1TWAJ 3BTCA 2G0EA 3A01A 4A3DJ 1ETQA 4A69C 1IG7A 4M3DA 3LSJA 5FKNA 1MBKA 3OSGA 1QVUA 1D5YA 2K9NA 3HB9A 1OFCX 3BTJA 4DW6A 2JA7J 5GPAA 4J19A 2LY9A 2B63J 2R5YB 3Q0VA 2WV1A 1PUFB 5M5YJ 2L7FP 2DA6A 5FKMA 4QTRA 2Y0SN 3A01B 2DA2A 2E19A 2HDDA 2EZLA 2EZIA 5F0HA 4A93J 1VNDA 1B72B 2FD5A 4LOCA 3S1NJ 2CRGA 2JWTA 1Y1WJ 2O8KA 4DZPA 3Q3SA 2DN0A 4A3EJ 1WI3A 1BL0A 1QVTA 2IAIA 2O7OA 4A3CJ 3IH4A 5F04A 1MBGA 3ZQGA 3ZQHA 3JRIA 3GTOJ 5C4XJ 4D7MA 4A3LJ 2GBYA 1XC5A 3IV5A 3HBLA 3ZQFA 1U9OA 4UUSB 1B8IA 1LFUP 1GDTA 3HOVJ 2MW8A 5FJ8J 3BG3A 1DU0A 3DCFA 3MVPA 3JR9A 4HNVA 1XS9A 3BR1A 3LSPA 1RR7A 3S2DJ 3A03A 4ABZA 5DS9A 1ZR4A 1NK2P 2XPVA 2LD5A 2XRLA 2COBA 4NDLA 1VI0A 5J1RA 1W0TA 1JKOC 2LVSA 4MO7A 5M3FJ 1IV6A 1UHSA 4C3IJ 1MSFC 1RESA 5J3LA 3Q0UA 1WPKA 4QIWN 3S17J 2FQ4A 1JUPA 1OCPA 2XGDA 3A02A 4AC0A 2K40A 5EGOA 3Q0WA 4XRSA 3IH2A 1JT6A 4A3BJ 3GTLJ 5K7FA 1I3QJ 1QPIA 1NTCA 3G1LA 1F36A 4BBSJ 4DYQA 1VF9A 2NOGA 4FISA 2E2HJ 3G1MA 4D7NA 1JUMA 3BT9A 5IOYA 5IP7J 1GVDA 2LTPA 1DU6A 5M3MJ 3OSFA 1SFOJ 3HOYJ 1RKWA 3BG5A 1CQTA 2Y30A 1FEXA 4BXXJ 1JTYA 4FE7A 3NARA 1S7EA 4W1UA 1ZTRA 2HOAA 2X48A 3HEFA 4XIDA 3I4NJ 2DA7A 4FE4A 5EGOB 3L1PA 2O9LA 4X6AJ 1JGGA 4A3GJ 5M5XJ 3PO2J 2L7MP 1WCMJ 2YS9A 5C44J 1T33A 2QF7A 1TC3C 4BY1J 1JT0A 3E7LA 1ETOA 2NVXJ 1MBEA 1WGXA 5E3LA 2JJ7A 2DJNA 3O8GA 1AKHA 3JRGA 3GTKJ 4DYCA 4JX5A 3S15J 2KT0A 2LP0A 3RQIA 2XB5A 2EH3A 4XICA 2JMWA 1IC8A 3GTMJ 3RZOJ 2LFBA 3JRBA 2YUSA 3HOUJ 4S0HB 1IDZA 4GFBA 3BR3A 1K61A 3I4MJ 2MSYA 2AHQA 2JN6A 2L0KA 3K2AA 1K83J 5EEAA 3M3YJ 1LFBA 2LK2A 4QSHA 3BTLA 3OOUA 9ANTA 4M3BA 3MKLA 1JUSA 3GTQJ 1MNMC 1ZGWA 2RAEA 2N8GA 3LOCA 2IEKA 4XK4A 3SJMA 4FTHA 4JYKA 2NS7A 3H3VK 1RKTA 5EDNA 2KDZA 4JX6A 4A3MJ 2WAQN 1MH4A 4IHXA 1TWGJ 2NVTJ 1HDDC 2H1KA 5IP6A 1MSEC 2D5VA 2OF7A 3S1RJ 1MBJA 3JRFA 5JLWA 3HDDA 2HXIA 4RDUA 1QRYA 5M5WJ 2CQXA 1FTTA 2DMQA 4X1EA 3JRCA 1FIPA 5FLVA 1R9TJ 5BNGA 1Y1VJ 3ZQCA 3VPRA 1OCTC 3FK6A 1MH3A 1X2MA 4I76A 1UMQA 5FKKA 5E3MA 4V2FA 1WH5A 3CMYA 5IYDJ 1H88C 4JX4A 4BBRJ 2ECBA 4JP0A 2Y31A 1IGNA 4IHWA 4A3KJ 4G12A 4MIMA 2W48A 1ORKA 1E3OC 3TEDA 3SFIA 3S16J 4A3IJ 3QQAA 4A3JJ 3NAUA 1FTZA 2NS8A 1MBHA 4CYCA 4Y52J 5E3NA 2WB1N 2EBIA 2EZHA 1U8BA 1GT0C 1LE8A 1X58A 3FKIJ 2OPTA 1B8IB 2VKEA 5DTDA 2LLKA 4XRSG 1IJWC 2R93J 2FX0A 2ZB9A 3G1OA 5JLXA 5EG0A 5IYBJ 4C2MJ 2XPUA 2L9RA 3F0CA 1POGA 2DTZA 1U78A 3GTGJ 4DZJA 1ZQ3P 4IEJA 3CCYA 1GV5A 5FKLA 1I6HJ 2XGCA 2XB0X 2E2IJ 2M34A 1JKQC 4AYBN 1HLVA 1IRZA 3HKZN 4FCYA 1HCRA 4XRMA 2AO9A 3M4OJ 3FK7A 4UUTA 2HQ5A 3LNQA 3BQYA 3K7AJ 2GM4A 1HOMA 1H8AC 5C3EJ 2P81A 3TP0A 1ETWA 3WHBA 1T56A 2R5YA 5K7ZA 5F08A 3HOXJ 4IHYA 1PUFA 3JRHA 2VKVA 3BR2A 5FLMJ 2MGQA 4M3FA 5EF6A 1TWHJ 1ETKA 5J1YA 3TW6A 3OIOA 2M9HA 1H89C 4I6ZA 3LSGA 2R0QC 3O8HA 3ZQIA 5GP9A 2HOTA 3PO3J 5K7HA 2M2EA 4AUXA 1B72A 3SDGA 2YU9J 2JK3A 5GPCA 2L7ZA 2DMTA 2ID3A 2HI3A 2Y9ZA 1Q1VA 3C2BA 5F0CA 5EZGA 2M0CA 3BG9A 1U9NA 2NVYJ 5J1UA 2HOSA 1JJ6C 1AKHB 2E2JJ 3GBGA 1A6IA 5EZHA 3CQZJ 3LSRA 4M6VA 4IHVA 3HGYA 4W97A 5IPAA 4B1RA 4DYRA 1AHDP 1BW6A 4MLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMN A;  1BJZ A;  2DA4 A;  3ZOB A;  1VFC A;  2R5Z A;  1A5J A;  4V2G A;  4UUS A;  3UKG A;  3S1Q J;  2ELK A;  1X2N A;  4RBO A;  2I10 A;  1ZR2 A;  1FJL A;  4EEF G;  2CUE A;  4M3E A;  4C3H J;  2X9D A;  4M3G A;  3HOZ J;  2HYJ A;  2PMZ N;  3QPL A;  2GLO A;  1HF0 A;  1ETV A;  2ME0 A;  4L5E A;  5IYC J;  1W0U A;  1AU7 A;  3H0G J;  3CDL A;  1BA5 A;  2XSD C;  1TWF J;  2JA6 J;  2ID6 A;  4B3A A;  3S2H J;  1FIA A;  1YRN A;  4D5C A;  3S14 J;  5EYR A;  5F27 A;  2CJJ A;  1G2H A;  3BTI A;  2H8R A;  3BQZ A;  3IH3 A;  2R5Z B;  1I50 J;  1P7J A;  2DA3 A;  2Y9Y A;  3TP3 A;  4MFE A;  3JRE A;  2DMP A;  2DMU A;  3W6V A;  3GTP J;  4C3J J;  1F43 A;  1NK3 P;  2EZK A;  2JA8 J;  5F1J A;  1HDP A;  3MN2 A;  1IDY A;  3FIS A;  4D5F A;  3RZD J;  3HM5 A;  4A3F J;  2NVQ J;  1ETY A;  1WH7 A;  3BR5 A;  2MG4 A;  2DA5 A;  3JRA A;  2LKX A;  4MFD A;  2K9Q A;  4Y7N J;  2R7Z J;  5HOD A;  2ME6 A;  2VUM J;  1YRN B;  2VI6 A;  1XG1 A;  2LR8 A;  2XGE A;  2Y2Z A;  1P7I A;  4BKX A;  1O4X A;  3ZQL A;  3HOW J;  5C4J J;  3FIW A;  3D1N I;  2M8G X;  2TRT A;  1APL C;  5IP9 J;  1MBF A;  1TWC J;  1ZKG A;  4CYC B;  3S1M J;  3B6A A;  5FKO A;  2CQQ A;  2ECC A;  2R92 J;  1Z0X A;  2IBD A;  3QPS A;  1LE8 B;  4B4C A;  1RET A;  2E1O A;  1ETX A;  2DA1 A;  1JTX A;  1ZK8 A;  1Z77 A;  1ENH A;  3BR6 A;  3BR0 A;  3RKQ A;  2CU7 A;  3WHC A;  3PM1 A;  1BW5 A;  2XPW A;  1RPW A;  2FJ1 A;  2QCO A;  1JKR C;  1GUU A;  5EG0 B;  5F0F A;  2JA5 J;  3JRD A;  2VPR A;  2TCT A;  1JKP C;  2EQR A;  2X6O A;  2CUF A;  2HXO A;  1EF4 A;  1SAN A;  3HGG A;  3DEW A;  4BY7 J;  1OJL A;  1ITY A;  5IOZ A;  1GV2 A;  2K9S A;  3GTJ J;  1UG2 A;  1IUF A;  3TW7 A;  3B6C A;  5E3O A;  1JJ8 C;  1TWA J;  3BTC A;  2G0E A;  3A01 A;  4A3D J;  1ETQ A;  4A69 C;  1IG7 A;  4M3D A;  3LSJ A;  5FKN A;  1MBK A;  3OSG A;  1QVU A;  1D5Y A;  2K9N A;  3HB9 A;  1OFC X;  3BTJ A;  4DW6 A;  2JA7 J;  5GPA A;  4J19 A;  2LY9 A;  2B63 J;  2R5Y B;  3Q0V A;  2WV1 A;  1PUF B;  5M5Y J;  2L7F P;  2DA6 A;  5FKM A;  4QTR A;  2Y0S N;  3A01 B;  2DA2 A;  2E19 A;  2HDD A;  2EZL A;  2EZI A;  5F0H A;  4A93 J;  1VND A;  1B72 B;  2FD5 A;  4LOC A;  3S1N J;  2CRG A;  2JWT A;  1Y1W J;  2O8K A;  4DZP A;  3Q3S A;  2DN0 A;  4A3E J;  1WI3 A;  1BL0 A;  1QVT A;  2IAI A;  2O7O A;  4A3C J;  3IH4 A;  5F04 A;  1MBG A;  3ZQG A;  3ZQH A;  3JRI A;  3GTO J;  5C4X J;  4D7M A;  4A3L J;  2GBY A;  1XC5 A;  3IV5 A;  3HBL A;  3ZQF A;  1U9O A;  4UUS B;  1B8I A;  1LFU P;  1GDT A;  3HOV J;  2MW8 A;  5FJ8 J;  3BG3 A;  1DU0 A;  3DCF A;  3MVP A;  3JR9 A;  4HNV A;  1XS9 A;  3BR1 A;  3LSP A;  1RR7 A;  3S2D J;  3A03 A;  4ABZ A;  5DS9 A;  1ZR4 A;  1NK2 P;  2XPV A;  2LD5 A;  2XRL A;  2COB A;  4NDL A;  1VI0 A;  5J1R A;  1W0T A;  1JKO C;  2LVS A;  4MO7 A;  5M3F J;  1IV6 A;  1UHS A;  4C3I J;  1MSF C;  1RES A;  5J3L A;  3Q0U A;  1WPK A;  4QIW N;  3S17 J;  2FQ4 A;  1JUP A;  1OCP A;  2XGD A;  3A02 A;  4AC0 A;  2K40 A;  5EGO A;  3Q0W A;  4XRS A;  3IH2 A;  1JT6 A;  4A3B J;  3GTL J;  5K7F A;  1I3Q J;  1QPI A;  1NTC A;  3G1L A;  1F36 A;  4BBS J;  4DYQ A;  1VF9 A;  2NOG A;  4FIS A;  2E2H J;  3G1M A;  4D7N A;  1JUM A;  3BT9 A;  5IOY A;  5IP7 J;  1GVD A;  2LTP A;  1DU6 A;  5M3M J;  3OSF A;  1SFO J;  3HOY J;  1RKW A;  3BG5 A;  1CQT A;  2Y30 A;  1FEX A;  4BXX J;  1JTY A;  4FE7 A;  3NAR A;  1S7E A;  4W1U A;  1ZTR A;  2HOA A;  2X48 A;  3HEF A;  4XID A;  3I4N J;  2DA7 A;  4FE4 A;  5EGO B;  3L1P A;  2O9L A;  4X6A J;  1JGG A;  4A3G J;  5M5X J;  3PO2 J;  2L7M P;  1WCM J;  2YS9 A;  5C44 J;  1T33 A;  2QF7 A;  1TC3 C;  4BY1 J;  1JT0 A;  3E7L A;  1ETO A;  2NVX J;  1MBE A;  1WGX A;  5E3L A;  2JJ7 A;  2DJN A;  3O8G A;  1AKH A;  3JRG A;  3GTK J;  4DYC A;  4JX5 A;  3S15 J;  2KT0 A;  2LP0 A;  3RQI A;  2XB5 A;  2EH3 A;  4XIC A;  2JMW A;  1IC8 A;  3GTM J;  3RZO J;  2LFB A;  3JRB A;  2YUS A;  3HOU J;  4S0H B;  1IDZ A;  4GFB A;  3BR3 A;  1K61 A;  3I4M J;  2MSY A;  2AHQ A;  2JN6 A;  2L0K A;  3K2A A;  1K83 J;  5EEA A;  3M3Y J;  1LFB A;  2LK2 A;  4QSH A;  3BTL A;  3OOU A;  9ANT A;  4M3B A;  3MKL A;  1JUS A;  3GTQ J;  1MNM C;  1ZGW A;  2RAE A;  2N8G A;  3LOC A;  2IEK A;  4XK4 A;  3SJM A;  4FTH A;  4JYK A;  2NS7 A;  3H3V K;  1RKT A;  5EDN A;  2KDZ A;  4JX6 A;  4A3M J;  2WAQ N;  1MH4 A;  4IHX A;  1TWG J;  2NVT J;  1HDD C;  2H1K A;  5IP6 A;  1MSE C;  2D5V A;  2OF7 A;  3S1R J;  1MBJ A;  3JRF A;  5JLW A;  3HDD A;  2HXI A;  4RDU A;  1QRY A;  5M5W J;  2CQX A;  1FTT A;  2DMQ A;  4X1E A;  3JRC A;  1FIP A;  5FLV A;  1R9T J;  5BNG A;  1Y1V J;  3ZQC A;  3VPR A;  1OCT C;  3FK6 A;  1MH3 A;  1X2M A;  4I76 A;  1UMQ A;  5FKK A;  5E3M A;  4V2F A;  1WH5 A;  3CMY A;  5IYD J;  1H88 C;  4JX4 A;  4BBR J;  2ECB A;  4JP0 A;  2Y31 A;  1IGN A;  4IHW A;  4A3K J;  4G12 A;  4MIM A;  2W48 A;  1ORK A;  1E3O C;  3TED A;  3SFI A;  3S16 J;  4A3I J;  3QQA A;  4A3J J;  3NAU A;  1FTZ A;  2NS8 A;  1MBH A;  4CYC A;  4Y52 J;  5E3N A;  2WB1 N;  2EBI A;  2EZH A;  1U8B A;  1GT0 C;  1LE8 A;  1X58 A;  3FKI J;  2OPT A;  1B8I B;  2VKE A;  5DTD A;  2LLK A;  4XRS G;  1IJW C;  2R93 J;  2FX0 A;  2ZB9 A;  3G1O A;  5JLX A;  5EG0 A;  5IYB J;  4C2M J;  2XPU A;  2L9R A;  3F0C A;  1POG A;  2DTZ A;  1U78 A;  3GTG J;  4DZJ A;  1ZQ3 P;  4IEJ A;  3CCY A;  1GV5 A;  5FKL A;  1I6H J;  2XGC A;  2XB0 X;  2E2I J;  2M34 A;  1JKQ C;  4AYB N;  1HLV A;  1IRZ A;  3HKZ N;  4FCY A;  1HCR A;  4XRM A;  2AO9 A;  3M4O J;  3FK7 A;  4UUT A;  2HQ5 A;  3LNQ A;  3BQY A;  3K7A J;  2GM4 A;  1HOM A;  1H8A C;  5C3E J;  2P81 A;  3TP0 A;  1ETW A;  3WHB A;  1T56 A;  2R5Y A;  5K7Z A;  5F08 A;  3HOX J;  4IHY A;  1PUF A;  3JRH A;  2VKV A;  3BR2 A;  5FLM J;  2MGQ A;  4M3F A;  5EF6 A;  1TWH J;  1ETK A;  5J1Y A;  3TW6 A;  3OIO A;  2M9H A;  1H89 C;  4I6Z A;  3LSG A;  2R0Q C;  3O8H A;  3ZQI A;  5GP9 A;  2HOT A;  3PO3 J;  5K7H A;  2M2E A;  4AUX A;  1B72 A;  3SDG A;  2YU9 J;  2JK3 A;  5GPC A;  2L7Z A;  2DMT A;  2ID3 A;  2HI3 A;  2Y9Z A;  1Q1V A;  3C2B A;  5F0C A;  5EZG A;  2M0C A;  3BG9 A;  1U9N A;  2NVY J;  5J1U A;  2HOS A;  1JJ6 C;  1AKH B;  2E2J J;  3GBG A;  1A6I A;  5EZH A;  3CQZ J;  3LSR A;  4M6V A;  4IHV A;  3HGY A;  4W97 A;  5IPA A;  4B1R A;  4DYR A;  1AHD P;  1BW6 A;  4MLO A; 
#chains in the Genus database with same CATH topology
 2R7S A;  2Y0S A;  2V4J C;  5CVI A;  2IGM A;  5D8L B;  2XGX A;  4L5I A;  4UUS A;  2CSO A;  1P4X A;  2JZY A;  4AVZ A;  2I10 A;  4XNF A;  1FJL A;  3BPX A;  4WXC A;  1LUJ B;  2VOD A;  2PBI A;  3HOZ J;  2PMZ A;  4U0Y A;  4FAS D;  5HLH A;  2STT A;  3U2R A;  4TV7 A;  5IYC J;  4OWR B;  1X3W B;  1IN8 A;  3FM5 A;  1TL8 A;  2XSD C;  1TWF J;  3FF5 A;  3GME A;  2JA6 J;  1SFE A;  4KDP A;  3GZN B;  3S2H J;  4ZZD A;  2VJ5 A;  2X85 A;  5EYR A;  2BBY A;  5JR3 A;  2VL8 A;  2CJJ A;  2DW4 A;  2X1E A;  3BTI A;  4HG2 A;  4E7L A;  2XAS A;  4ZYE A;  3G3Z A;  1P7J A;  1HST A;  2Y9Y A;  3TP3 A;  2VE8 A;  4MFE A;  2DMU A;  4C3J J;  2D1H A;  2QKM B;  2PLY A;  2EZK A;  5F1J A;  3MN2 A;  1IDY A;  2YU3 A;  2H27 A;  3MKW B;  1ETY A;  3BR5 A;  1BR4 A;  4RM3 A;  2LKX A;  3KYC B;  4MFD A;  3ZMZ A;  2K9Q A;  1F9N A;  1ZEL A;  2R7Z J;  2JRT A;  4XN0 A;  1UST A;  1BI1 A;  3CUQ C;  1HBX G;  2Y2Z A;  4XLE A;  1QHG A;  2GA2 A;  4CCN A;  2HYF A;  1HSJ A;  3HOW J;  2K7L A;  1MBF A;  2EK5 A;  1QBJ A;  1Y56 A;  3ERE D;  3SHF A;  4XN3 A;  2HNH A;  3L2Q A;  2IBD A;  1LE8 B;  1TBX A;  4B4C A;  3FXK A;  2E1C A;  3WGG A;  1UFM A;  2HQR A;  3BR6 A;  1ENH A;  4XOP A;  1WKM A;  4IXA A;  3REO A;  2R4G A;  1ZH5 A;  2F5E A;  1T6S A;  2CFX A;  2G9W A;  2OJE D;  4HF0 A;  4BUP A;  5EG0 B;  3A0B C;  4Q48 A;  1OYI A;  2JA5 J;  3JRD A;  2ZJ2 A;  3SZG A;  1WVR A;  1IN5 A;  2QSG X;  2X6O A;  2BY3 A;  2CUF A;  1B1B A;  5ILU A;  3O3K A;  2XAQ A;  4NBQ A;  5J6X A;  3HGG A;  1OJL A;  3QAH A;  2ISZ A;  2K86 A;  2VAS A;  5E17 F;  5KAI C;  2OQG A;  5IOZ A;  3IWF A;  2BXY A;  3LSK A;  3N97 A;  1Z21 A;  3AG2 H;  2ETH A;  2P0W A;  3B6C A;  1JJ8 C;  3CCL I;  2XV4 S;  1TWA J;  1KU3 A;  1UJ8 A;  2AQF A;  1IRX A;  2WA0 A;  4A69 C;  3LL7 A;  1IG7 A;  2RN7 A;  2HVR A;  1MBK A;  3VWB A;  1T98 A;  3OR1 C;  1UEL B;  1BIA A;  3K6G A;  5IT9 Z;  5GAD J;  1B9N A;  3F8N A;  3BTJ A;  1P92 A;  2WAD A;  2EIN H;  3WTU C;  5GPA A;  3OYJ A;  2LY9 A;  4HST A;  2JRM A;  4KIF A;  5HDK A;  2B63 J;  3K4C A;  2FBH A;  4C2U A;  5CVR A;  4HSR A;  2UUZ A;  2KIF A;  3DBL B;  1MDM A;  2M7A A;  2W82 A;  4A0X A;  1WJD A;  3M8E A;  1L0O C;  2F6C A;  3E6B A;  1XPX A;  2V79 A;  5LGN A;  1RUN A;  1OR7 C;  4XLC A;  2EV5 A;  2KRF A;  1QU3 A;  3K4B A;  3SDB A;  3ZMS A;  1YFH A;  1S3J A;  3DTE A;  1ZRF A;  2EZI A;  3I0T A;  1IW7 F;  2BYV E;  4AU7 A;  4LOC A;  2CRG A;  4Y17 A;  3NRV A;  5KCM A;  2EV0 A;  1V55 H;  2ZFU A;  4I7H A;  3QP6 A;  4JK1 X;  4DZP A;  4XBF A;  4GYI A;  4A3E J;  2KIM A;  4LG3 A;  4XLN F;  2ESN A;  3E6C C;  4P9F A;  4G94 A;  4B47 A;  1MMA A;  4H4K C;  3ABU A;  4PJJ A;  5ILS A;  3ZQG A;  3ZQH A;  3JRI A;  1MDM B;  3GTO J;  2A6E F;  3OYK A;  1MZB A;  1K4T A;  3GW2 A;  2FUG 2;  3HBL A;  3O2P E;  5L3B A;  3ZQF A;  5DUK A;  1U9O A;  3OIQ A;  1LDK B;  2MW8 A;  2XF7 A;  2Z3Y A;  1DU0 A;  5J8C A;  1YG2 A;  2Y75 A;  4HNV A;  1PUE E;  3G71 I;  1KU7 A;  3LSP A;  4F52 A;  3KE2 A;  3QWL A;  5ICE A;  2DYS H;  1RR8 C;  2XAU A;  4ABZ A;  2V9V A;  4QLC U;  3HTU A;  5FLX K;  2OC6 A;  4Y3O A;  1MMD A;  5J1R A;  3IRR A;  5ILV A;  4CZC A;  2LVS A;  4MO7 A;  3JTH A;  1UHS A;  4C3I J;  1RES A;  4WX9 A;  5J3L A;  3G2B A;  1MW7 A;  5LGT A;  1I6X A;  1S9H A;  3F6O A;  1SC7 A;  2ELJ A;  2E60 A;  1LNW A;  3A02 A;  4AC0 A;  4LD5 A;  3BCA A;  2PI0 A;  1O7L A;  2K4J A;  1JT6 A;  4ZJZ A;  2O03 A;  4U7B A;  1FPQ A;  1I3Q J;  1QPI A;  3M1E A;  1NTC A;  4PJM A;  3G1L A;  3ZMD A;  3CCQ I;  2RKH A;  3QOE A;  2E2H J;  3G1M A;  4GYG A;  1JUM A;  3BT9 A;  1HKT A;  4OIO F;  4YG2 F;  3ABT A;  2ZME C;  2LTP A;  1LFP A;  1UB9 A;  3WOD F;  1KQ8 A;  2JPC A;  1LB2 A;  2JSC A;  2FOK A;  1R49 A;  3TL4 X;  3BG5 A;  4PDK A;  1HKQ A;  1Y0U A;  2H09 A;  2P6T A;  2HZD A;  5CJ9 A;  4KFC A;  4BXX J;  2EFW A;  1JTY A;  2GZW A;  4CCM A;  1S7E A;  2O6G E;  1ZTR A;  2HOA A;  4XID A;  1UHM A;  2K27 A;  2QQB A;  2DA7 A;  3H5A A;  3L1P A;  1RI7 A;  1JGG A;  2LDU A;  4HW0 A;  4MGR A;  1VQP I;  3H35 A;  1AA7 A;  4EM2 A;  5ED4 A;  2ZSH B;  3OYN A;  4UV8 A;  4FX4 A;  3J80 K;  1T33 A;  1TC3 C;  2IA1 A;  5HS8 A;  1JT0 A;  4G7Z F;  3AAF A;  2R7F A;  2K3F A;  3L2V A;  3ZQQ A;  2VXZ A;  2E34 A;  5H6Q A;  1O3T A;  1ZGJ A;  4BYY A;  2EA2 A;  1R1V A;  2E7W A;  2JJ7 A;  3FXQ A;  2DJN A;  3PSI A;  3BC8 A;  2PX9 A;  3OYG A;  2E1N A;  1VQ8 I;  1D0Y A;  2FEZ A;  4BQN A;  4KIT B;  3RQI A;  2Q0O A;  4XIC A;  2BXZ A;  3CZ6 A;  3GTM J;  1RIO H;  2LFB A;  2O61 A;  2ZXH A;  4UVC A;  2VE9 A;  1Y8R B;  1PP8 F;  1LDD A;  3OS0 A;  2DT6 A;  1SAU A;  2E1M B;  4P9U A;  4E7K A;  2VXD A;  1U8R A;  1IDZ A;  1HC8 A;  1K61 A;  3DTK A;  2YR2 A;  1W4M A;  2BY2 A;  4BE1 A;  2JVH A;  2AHQ A;  2FNA A;  1DQU A;  4BQA A;  3I59 A;  3CCM I;  1H9T A;  3BTL A;  2DQR A;  4M3B A;  3MKL A;  1SEU A;  1JUS A;  3WU1 B;  1ZGW A;  3H9Q A;  1MNM C;  2V1D A;  1GXQ A;  3HUG A;  5EDN A;  1SAX A;  1MH4 A;  4YIF A;  2CS3 A;  3AG1 H;  4BJT A;  1YW7 A;  1HDD C;  2H1K A;  1MSE C;  5L3F A;  3K1M A;  4BEH A;  3SEQ A;  1T08 B;  1MBJ A;  3KLO A;  3LFK A;  4RB3 C;  5M5W J;  2DT7 B;  2DMQ A;  2NNN A;  4X1E A;  3JRC A;  4HLY A;  1FIP A;  5FLV A;  2JVG A;  5BNG A;  2CFO A;  3RIR A;  3LA2 A;  2C6Y A;  3VPR A;  1V5E A;  3E3V A;  4PGH A;  2BY0 A;  2VC1 A;  2RGV A;  3W6J B;  4EMS A;  4HX7 A;  4IVN A;  4BBR J;  2VLA A;  4A3K J;  1X3U A;  4XLF A;  1D1B A;  5FRN A;  1E3O C;  3C2G A;  2D2W A;  2JT1 A;  1MBH A;  2ICW G;  3KYL A;  2WB1 A;  3WTX C;  1IXR C;  2GXA A;  2EZH A;  3COA C;  1X58 A;  4IOA F;  2BHZ A;  4MTD A;  4PFO A;  3FKI J;  2F4M B;  1QO0 D;  2ZKZ A;  3DKW A;  1B8I B;  4ENJ A;  1BI0 A;  4AWX B;  2Z9O A;  3L09 A;  3DLA A;  4NC7 A;  4XRS G;  2LY2 A;  3PQJ A;  1X1P A;  5F1R A;  4GXO A;  2ZB9 A;  2ZNY A;  5D8K B;  1A04 A;  2QGU A;  2L9R A;  3F0C A;  1POG A;  2Y48 A;  3W2A A;  3WTY C;  1T0F C;  2ZJR F;  1X4P A;  2CW0 F;  1KU9 A;  4IEJ A;  3FMS A;  5D6E A;  2H94 A;  2GIZ A;  3ISP A;  1I6H J;  2KLO A;  2W84 A;  3GFI A;  4KA4 A;  4I0A A;  5J47 A;  2M34 A;  4B43 A;  1JKQ C;  2DTR A;  4AYB A;  2O3F A;  1Z6T A;  3HSE A;  1UG0 A;  4L0Y B;  4HLX A;  2XSJ C;  4LIV A;  3RPU A;  2P5L C;  2OTJ I;  1N77 A;  2DFI A;  1R1T A;  1G3W A;  3G6E I;  1ACI A;  2DK8 A;  4A6E A;  2K9L A;  3GYH X;  1HOM A;  3VEP A;  4Q5S F;  1H8A C;  2F4I A;  3H9J A;  3TP0 A;  5E1X A;  1DP3 A;  4E7H A;  1PDN C;  4LIU A;  1TT0 A;  2DXI A;  1B9M A;  3WHB A;  2R7X A;  2R5Y A;  5K7Z A;  5BOX A;  1ZN2 A;  2VB6 A;  2VKV A;  3BR2 A;  4ESJ A;  1H0M A;  1HQC A;  4WCG A;  2CGP A;  3QYB A;  1TWH J;  2DOF A;  5J1Y A;  5E8G A;  1EH6 A;  3K70 D;  2XAH A;  1H89 C;  4I6Z A;  1I39 A;  3L2U A;  5CQE A;  3O8H A;  1WJE A;  1ZRD A;  2QEN A;  3F8B A;  1FOW A;  2LRD A;  4HQM A;  3MZH A;  4AUX A;  4LB5 A;  5CQG A;  4FQG A;  3SDG A;  3BJA A;  4ZZL A;  3R0A A;  2BVL A;  4NQW B;  3JAM Z;  2FXA A;  4PUS A;  4KIC A;  2M4G A;  2Y9Z A;  1Q1V A;  1U5T C;  2J5P A;  1U9N A;  2LOO A;  2NVY J;  4HF2 A;  1AKH B;  4HF1 A;  1G59 A;  3CCJ I;  2XHK A;  1PYV A;  3GBG A;  5EZH A;  3CQZ J;  2OBP A;  3HSF A;  3HGY A;  4IHV A;  5IPA A;  4YIR X;  2XUB A;  1XX5 A;  4FET A;  4MLO A;  3M3Y J;  2L9S A;  2MH2 A;  4ZYG A;  2DA4 A;  3FBI B;  4FX0 A;  4FHT A;  1IN6 A;  2KFD A;  4PJ0 C;  2DBB A;  4B09 A;  3UKG A;  3S1Q J;  4M9X A;  1MKM A;  1QHH D;  2NYX A;  2ADU A;  4M3E A;  4P55 A;  2X0L A;  1IRF A;  2WV0 A;  4CO8 A;  4M3G A;  1XD7 A;  1ZG3 A;  3BY6 A;  3OYB A;  2STW A;  1IV8 A;  2E36 A;  5DM6 F;  2AS5 F;  1N75 A;  2MLG A;  4N4N B;  5B1B H;  1G3S A;  3KP4 A;  1J09 A;  1W7P A;  5JHF A;  1IO2 A;  2ID6 A;  3JTG A;  1K78 A;  4ZTJ A;  3P7N A;  4XOT A;  4BXF A;  4IRG A;  3JW4 A;  3CC2 I;  3H0D A;  3CCE I;  5D5W B;  5CPR B;  3K9T A;  5F27 A;  2DOE A;  2RQP A;  2ZO4 A;  3M7G A;  1UAA A;  3U9G A;  4MQV A;  1BI2 A;  2WAF A;  1XSV A;  1FMV A;  3W6V A;  4AIK A;  3GTP J;  2QBY A;  1DGW Y;  4BU2 A;  1HDP A;  1I1S A;  1P4W A;  2L02 A;  3LST A;  5E1Z B;  1WH7 A;  3JRA A;  1T38 A;  2GXG A;  4KMU X;  3E97 A;  4F91 B;  1SD5 A;  1I1G A;  1K6O A;  3ZP5 A;  4Y7N J;  1RUO A;  4U0W A;  2LSO A;  2HYG D;  2V7F A;  1P7I A;  1YLF A;  4AID A;  4BKX A;  1VQ4 I;  3ZQL A;  5C4J J;  4N0B A;  2IJL A;  3D1N I;  4IO9 F;  4RAF A;  3SYT A;  2CQ7 A;  2R7O A;  2OTL I;  3B6A A;  2NOJ B;  5FKO A;  2CQQ A;  2R92 J;  1Z0X A;  3I64 A;  4ESF A;  4HNU A;  2VQC A;  1S72 I;  2BW3 B;  3K4K A;  2BE5 F;  1TTY A;  3DEE A;  1FP2 A;  3BR0 A;  1Z77 A;  4ENK A;  2OV7 A;  4ETS A;  2CW7 A;  3I71 A;  3RKQ A;  2CU7 A;  2ZXJ A;  3PM1 A;  2XPW A;  2FJ1 A;  2QQA A;  2HOE A;  1K7A A;  4E7J A;  2L4A A;  3RJP A;  1OCC H;  2EQR A;  4R8H A;  3P9K A;  5ICC A;  3B73 A;  4KN4 X;  1SAN A;  3LA3 A;  5LHG A;  2DJI A;  2VBZ A;  3DTI A;  4IF4 A;  4JQF A;  5L3C A;  5AIP A;  1ITY A;  1LQ1 A;  2UZK A;  1V3F A;  3VYS B;  3GTJ J;  3S3M A;  5DYM A;  1IUF A;  4WXH A;  3TW7 A;  5E3O A;  3BWG A;  4PZJ A;  4YEL A;  4KN7 X;  1S5L C;  4XLA A;  3CUQ A;  1L3L A;  3JCU C;  1UHW A;  4CGZ A;  3VOD A;  3FHZ A;  1T39 A;  2XC7 A;  2VJ4 A;  1XSD A;  4MHG A;  1QVU A;  4HYE A;  4M6Y A;  3CP8 A;  4UUV A;  1X1A A;  1SFU A;  5E20 A;  2CW8 A;  2IS6 A;  3Q0V A;  2WV1 A;  5DDG A;  2HKX A;  3KP2 A;  3OR2 C;  3RKX A;  5M5Y J;  3F23 A;  3A4C A;  4PSW A;  3N05 A;  4UNO A;  3CO7 C;  4BNC A;  4LK1 F;  5GTI C;  1EH8 A;  2M87 A;  2NAZ A;  3H3U A;  4IX7 A;  4A93 J;  3L7W A;  1VND A;  1B72 B;  2FD5 A;  5ICG A;  4XM3 A;  3W3C A;  4OAZ A;  5KAF C;  3I5U A;  3CMM A;  2HWV A;  3KEQ A;  2O8K A;  3K2Z A;  2LY1 A;  3CDH A;  2YPR A;  4U7D A;  2IA0 A;  2KRH A;  2DN0 A;  4GRI A;  1TQM A;  3ROU A;  3ZPL A;  2O7O A;  5F64 A;  5H6R A;  1AWC A;  2DCE A;  2EA4 A;  1BC7 C;  4MNU A;  1R71 A;  1U2W A;  3DKX A;  5DCM A;  1XC5 A;  3PFY A;  1MMN A;  1W36 D;  3BZC A;  1SVL A;  2L2O A;  4UUS B;  3AL0 B;  2VPL A;  3EUK L;  3F72 A;  2COM A;  1LFU P;  2WY7 Q;  3HOV J;  2P7V B;  3DCF A;  3H92 A;  4G8X A;  2RVC A;  1XS9 A;  3FWE A;  2R7W A;  4EJT A;  2NVU B;  1WFX A;  4ZDL A;  3S2D J;  2QLZ A;  4CUG A;  4EJV A;  5HNH A;  3EYI A;  2VON A;  2HQN A;  4XOR A;  4RGX A;  4DNC A;  5FLX Z;  2OCC H;  2XPV A;  2HVS A;  2DLL A;  2HGC A;  2LD5 A;  1OR7 A;  1J75 A;  1R7J A;  1VI0 A;  3CUO A;  1WHU A;  1MSF C;  2DOD A;  3GUD A;  4IQJ A;  3FKJ A;  1DP7 P;  2X6W A;  2ZXI A;  3NWT A;  3Q0U A;  3IWZ A;  3WG9 A;  5DCM B;  4QIW N;  3S17 J;  3CCR I;  4CHU A;  1REP C;  2K40 A;  4RS8 A;  5CVV A;  3ZR8 X;  1O3R A;  3DKY A;  4YRV A;  1T2K A;  3TMO A;  1QZZ A;  3Q9S A;  4YFK F;  2QWW A;  2X4H A;  4DJA A;  4DYQ A;  2NOG A;  4LLN A;  5IOY A;  4D7N A;  4BDZ A;  1DUX C;  4IQ4 A;  3D5L A;  3EQL F;  1EA3 A;  1GVD A;  3WTZ A;  3D5S C;  4KNY A;  3M07 A;  2BVM A;  3OSF A;  2E35 A;  1LDJ A;  2A69 F;  2IA2 A;  2HPI A;  3FXJ A;  5JI6 A;  3WU2 C;  4ZH4 F;  4L9N A;  1TLH B;  1R1U A;  2WY8 Q;  4EJO A;  1SVO A;  2QVO A;  4FE7 A;  3TDZ C;  1XDU A;  5CVJ A;  2V6E A;  2X6Y A;  2A61 A;  4HX4 A;  3HXL A;  3HHG A;  1T95 A;  1RNL A;  3ZN1 A;  4AIJ A;  1Q1H A;  2MD0 A;  5M5X J;  3J80 Z;  1QZY A;  3PO2 J;  5EJC A;  2YS9 A;  3KLN A;  2HTS A;  1YIO A;  1MJA A;  4N4O B;  3J7Z I;  1Z3X A;  2QF7 A;  4BY1 J;  3IKV A;  3ZGK A;  3E6M A;  4E7I A;  1KQ0 A;  3A1Y A;  4RB0 A;  3OS1 A;  3BG6 A;  1XMA A;  1WJ5 A;  1OCO H;  3OL3 A;  3RTR A;  4N9I A;  1KON A;  2VBY A;  4ZYA A;  4BAY A;  4MQ9 F;  3J81 K;  4DYC A;  3W2W A;  3V7C A;  2V6C A;  3GFL A;  3J7A O;  2NRA C;  2XVC A;  2KT0 A;  1JXS A;  4KT6 A;  2LP0 A;  4BS9 A;  2JMW A;  1X1C A;  1ZAR A;  1IC8 A;  1P2F A;  2RC4 A;  3FX3 A;  4PFP A;  4EM1 A;  3K1P A;  4PGG A;  3HOU J;  3ZCO A;  2W00 A;  2VT2 A;  3KEY A;  3QOD A;  2ZME A;  2X1D A;  3VSK A;  1I27 A;  2HTJ A;  3KCC A;  2L7K A;  2QYO A;  3U1D A;  3CCU I;  2OU2 A;  3K4M A;  4IJA A;  1K83 J;  3S32 A;  4QSH A;  9ANT A;  1MMS A;  2QKL B;  3EYY A;  4A6D A;  2M1B A;  4XLP F;  1E2X A;  4XK4 A;  4LIT A;  2HS5 A;  1J2X A;  3H3V K;  2F4O B;  3RKW A;  5J8F A;  1V5F A;  3RYP A;  2KDZ A;  1DGR M;  2WAQ N;  3KP7 A;  4AVP A;  1GHC A;  1TWG J;  2PN6 A;  2OF7 A;  2B0L A;  2ESH A;  5GTH C;  1YIJ I;  5JLW A;  5ICF A;  1UZC A;  4YEJ A;  3HDD A;  1QGP A;  4RDU A;  1QRY A;  2MC3 A;  3C18 A;  4P1W A;  2R7Q A;  4KJZ A;  1R9T J;  4KIB A;  1OCT C;  1VQ6 I;  3MKY B;  1X2M A;  1XGO A;  1UMQ A;  3U21 A;  5FKK A;  5J4V A;  4I99 C;  4V2F A;  3GLL A;  3CMY A;  5IYD J;  2YSR A;  4JX4 A;  4MTE A;  2W57 A;  2QQ9 A;  4OAY A;  4F55 A;  3H1C A;  1S7A A;  3K1N A;  4IOC F;  4QPO A;  1YS6 A;  4A3I J;  4A3J J;  2KDO A;  1BR1 A;  3DBH B;  1P4A A;  3BRO A;  5LEK A;  4CYC A;  5E3N A;  3Q9V A;  2VOP A;  4LK0 F;  5LRS A;  2HVQ A;  4I0B A;  1TNS A;  3QU6 A;  2BZT A;  2F2E A;  1FOY A;  2RNG A;  1WZ2 A;  2R93 J;  3HYI A;  3HPG A;  4OMY A;  3L00 A;  5DM7 F;  3OYD A;  5B66 C;  2XPU A;  1FOX A;  2BGC A;  1P9Q C;  3OYL A;  1DPR A;  2DTZ A;  1XGS A;  3R61 A;  2LG4 A;  1U78 A;  4BL0 B;  1FOK A;  2OA4 A;  4DZJ A;  1GV5 A;  5FKL A;  3B02 A;  1D0X A;  2XGC A;  2XB0 X;  3D0S A;  4S05 A;  1LEA A;  3VOE A;  4NC8 A;  4A5M A;  5L3D A;  4XMY A;  3HKZ N;  4XRM A;  5IT3 A;  3M4O J;  4ZDP A;  2JPB A;  4UUT A;  2HQ5 A;  5TRD A;  3DPU A;  3K7A J;  2GM4 A;  5C3E J;  2P81 A;  3W6K B;  2JSP A;  4LLG F;  2F48 A;  5H20 A;  4OIQ F;  1BN5 A;  4IHY A;  1TW2 A;  3CF2 A;  1PUF A;  3JRH A;  3R6S A;  1ON2 A;  2R7D A;  3HJE A;  1QZE A;  4ANJ A;  1MJB A;  1OYY A;  3ZMT A;  3RI4 A;  3DU5 A;  5FO5 A;  1X19 A;  5LEJ A;  3QYF A;  3LSG A;  2R7U A;  1FLI A;  3HRT A;  1HW2 A;  1SMY F;  2IT0 A;  4HOB A;  1ZLK A;  3TBI A;  1FBU A;  1T0F A;  2YU9 J;  2L7Z A;  4GO1 A;  1MD0 A;  2A5Y B;  4CA0 A;  1PP7 U;  2EIK H;  5EEG A;  1YYV A;  3EET A;  2CWE A;  4LG0 A;  1JJ6 C;  2M3A A;  3HRS A;  4II2 A;  3UR3 C;  2MBF A;  4NC6 A;  1A6I A;  2H6C A;  2EJR A;  2VKD A;  2LC2 A;  1KA8 A;  1Y8Q B;  1BW6 A;  1RET A;  2KRC A;  3MMY B;  1FYL A;  4PK4 A;  4S04 A;  2CUJ A;  4I01 A;  2DMN A;  4M72 A;  3GLX A;  1FWZ A;  2R5Z A;  1A5J A;  4V2G A;  2EFN A;  2FA5 A;  3E6D A;  2ELK A;  5D4R A;  1HKS A;  3WGH A;  1FT9 A;  1BJA A;  2A3S A;  2CUE A;  2BHY A;  2O0Y A;  3QPH A;  3TKY A;  4ITV A;  2X9D A;  3ASO H;  5KK1 A;  2PMZ N;  3LQR A;  3QPL A;  4HEA 2;  3M8F A;  4CH7 A;  1HF0 A;  1IN4 A;  4E6K G;  2GLO A;  1MGT A;  2K5C A;  3I59 B;  3HZJ A;  4L5E A;  4CSW A;  1W0U A;  1QQI A;  1O3Q A;  1R6R A;  3H0G J;  3GVA A;  4A0Y A;  3BZ6 A;  3DPL C;  3OMY A;  1WJB A;  2DPD A;  4HA8 A;  2F5F A;  4Y4R A;  4J00 A;  1YS7 A;  3HUG B;  4G6Q A;  2P6S A;  5LGU A;  1XGN A;  1R23 A;  1OLT A;  3BOQ A;  4DBR A;  2D45 A;  2H8R A;  3BQZ A;  2DOA A;  1U5T A;  4BEH B;  2R5Z B;  1I50 J;  1SFK A;  3CC4 I;  3ZQ7 A;  3MQ0 A;  3RQ4 A;  1O7F A;  2DYR H;  3DXJ F;  3KP6 A;  3R0J A;  5L3E A;  3PNY A;  3I3L A;  1XCV A;  2LBF A;  4OOI A;  5DCF A;  4A3F J;  1Z6R A;  1KYW A;  3U1K A;  3DF8 A;  2MG4 A;  2DA5 A;  2V1X A;  3RKY A;  1Z05 A;  1XSX A;  2IGO A;  2IRF G;  2PG4 A;  2E1M C;  1WRJ A;  3OYF A;  2CV2 A;  4IHT A;  5HOD A;  3BJO A;  1SVM A;  2ME6 A;  2VUM J;  2VI6 A;  2MLK A;  2LKP A;  2LR8 A;  2CV0 A;  3BCB A;  2KJC A;  1FMW A;  1VQ5 I;  3FIW A;  2TRT A;  4C30 A;  3R4K A;  5IP9 J;  1XMX A;  1ZKG A;  2VC0 A;  3S1M J;  1ZG1 A;  1FBS A;  1IRG A;  3K70 C;  3QPS A;  5FFZ A;  1K4S A;  2DA1 A;  3L2C A;  3L9F A;  1JHH A;  1ZK8 A;  2VJI A;  3I4P A;  3GFM A;  3T8T A;  2XIG A;  2PJP A;  1W5S A;  2RV8 A;  3NEU A;  3WHC A;  1H9G A;  5CVU A;  5LFA A;  2QCO A;  1JKR C;  1GUU A;  2EPF A;  3LA7 A;  3PFI A;  1DPU A;  2WWY A;  1YW9 A;  5TIS C;  2KP6 A;  4EM0 B;  5KHD A;  2QZ8 A;  4K2E A;  2TCT A;  3I58 A;  1LEB A;  3CJT B;  1JKP C;  5LHH A;  1LVA A;  2HXO A;  3TOA A;  2CV1 A;  2EWN A;  1SMT A;  1XTA A;  3UNG C;  2QEX I;  3DEW A;  4BY7 J;  3HTS B;  3S3N A;  3GF2 A;  4WXD A;  1FY7 A;  2DFH A;  2KL4 A;  3AG4 H;  2K9S A;  1YO5 C;  3OYM A;  3F21 A;  1UG2 A;  2JTV A;  5B5E C;  5KVR A;  2LYC A;  2K85 A;  2A6T A;  3BTC A;  1XGM A;  5DD8 A;  3ULQ B;  2G0E A;  3A01 A;  1YJ9 I;  1CF7 A;  4QPQ A;  3V7R A;  3CES A;  4BJ6 C;  2W1O A;  3LSJ A;  1BM9 A;  1OIS A;  5FKN A;  2GXB A;  2LKS A;  3F22 A;  3OSG A;  4EAT A;  4RAZ A;  5CYV A;  2K9N A;  2KHM A;  3T1B A;  2DAO A;  2R5Y B;  1K79 A;  2QSH X;  2VJJ A;  3K0L A;  3RSN A;  3JSO A;  2L01 A;  2L7F P;  4BGD A;  3L2W A;  2DA6 A;  5FKM A;  2EB7 A;  4F92 B;  3A01 B;  3I56 I;  4MEX F;  2EZL A;  3PL8 A;  3MZ8 A;  4P5O A;  2VQG A;  2NNY A;  4UY8 I;  4JOM A;  2FF4 A;  4IPA A;  1V54 H;  1S8N A;  2ISY A;  4BXU A;  2ACJ A;  1O57 A;  1Y1W J;  3KYD B;  2W7N A;  2F5D A;  3Q3S A;  4XKC A;  1WI3 A;  3H3Z A;  1ZYR F;  1BL0 A;  2WAQ A;  1OYW A;  1XDS A;  2K02 A;  2YX7 A;  4A3C J;  4HDV A;  5J4Y A;  3IH4 A;  5F04 A;  2M8E A;  4EGY A;  1MBG A;  4U87 A;  4O3M A;  1VQN I;  2IS4 A;  4A3L J;  2GBY A;  4BDY A;  5AON A;  4HZF A;  4AIH A;  3IV5 A;  4F7Z A;  2ELH A;  3V42 A;  2XRO A;  1HW5 A;  4HBL A;  1J7K A;  2HR3 A;  1GDT A;  5B1A H;  3BG3 A;  3GFJ A;  2HPM A;  2G7H A;  3MVP A;  3JR9 A;  1X4O A;  2NS0 A;  2L9V A;  2RRE A;  5GAH J;  2ZNZ A;  3A03 A;  5FD5 A;  2HDC A;  1ZR4 A;  4M71 A;  4HAM A;  1GVJ A;  1W7P B;  1B6A A;  2IXS A;  3X2Q H;  1IAW A;  1W0T A;  5D5V B;  1JKO C;  1K78 B;  5M3F J;  1IV6 A;  1R4M B;  3S8P A;  2PJR A;  2UV1 A;  3RYR A;  4L9T A;  4RB2 C;  3VB2 A;  1WPK A;  5CKT A;  1GXP A;  4XQF A;  1OKR A;  2I5U A;  2FQ4 A;  1JUP A;  4WWC A;  4RB1 A;  1OCP A;  2XGD A;  1Z3Y A;  3ZMV A;  3OYA A;  3Q0W A;  1OCZ H;  5BMZ A;  5A2Q K;  2A68 F;  1DDN A;  5EEH A;  4ZC3 A;  2IPQ X;  2VBW A;  2QBY B;  1D1C A;  3OWT A;  4YII A;  3GTL J;  2KJB A;  1V5G A;  1BOB A;  5FRM A;  3FXL A;  3S3O A;  1B4A A;  4LB6 B;  3TGN A;  5LHI A;  4BBS J;  2FNP A;  2MAB A;  1VF9 A;  1E0E A;  1RC9 A;  2KMU A;  5IP7 J;  1P6R A;  3RPU D;  3KFW X;  3ASN H;  4ZTF A;  1LPQ A;  3H36 A;  4I98 B;  3N4M A;  3HIF A;  5M3M J;  1SFO J;  3OYI A;  3RDI A;  5LD2 C;  1RKW A;  2PJR B;  1IN7 A;  2UXN A;  4BHC A;  3WTT C;  2G7U A;  2PMH A;  2Y30 A;  4DGW B;  3HG9 A;  3NAR A;  4XKV A;  4DBQ A;  4B44 A;  3FXU A;  3I4N J;  1J5Y A;  4X6A J;  4B8X A;  1KU2 A;  4A3G J;  2HQA A;  2WTE A;  2B9S A;  4EQQ A;  2HDW A;  1WCM J;  4X0G A;  3T8R A;  2Q2E A;  4Y33 A;  2BV6 A;  2MD5 A;  3CJN A;  1NH3 A;  2NXN B;  1I5Z A;  1IUY A;  1MBE A;  2EFQ A;  4UVB A;  1YE9 A;  5CLS A;  3TOB A;  2W24 A;  4E7S A;  3EUH C;  5HS9 A;  1PJR A;  3J81 Z;  2DU9 A;  3JRG A;  4N9H A;  2KZG A;  1MIJ A;  5BPD A;  4YFX F;  3S15 J;  1XCB A;  2XB5 A;  4L9J A;  3BJ6 A;  3DQV C;  3RZO J;  1R5I D;  5HLT A;  3JRB A;  2O8X A;  4L5J A;  4S0H B;  3CMA I;  3J7A Y;  2X6X A;  1W36 C;  2VT3 A;  2V1N A;  5JFR A;  5J40 A;  1PVE A;  3TDU C;  2MSY A;  4KIG A;  3VYT B;  1YW8 A;  3CUQ B;  2L0K A;  3K2A A;  3NWS A;  4AD9 A;  2IGN A;  5EEA A;  1LFB A;  5BS6 A;  2CQN A;  4CYD A;  2XKP A;  3ZN0 A;  2RAE A;  3R60 A;  2N8G A;  3LOC A;  1ZAO A;  2IEK A;  4U88 A;  2A07 F;  4JYK A;  2NS7 A;  2MYS A;  1RKT A;  1ON1 A;  2J5O A;  1J0R A;  2O5R A;  2XDV A;  4I02 A;  4A3M J;  5BQT A;  3J7Y J;  5IP6 A;  4FT8 A;  2D5V A;  2AQE A;  1W7P D;  4F93 B;  5D4S A;  4M9Z A;  4YFN F;  1FYM A;  3MWM A;  3JRF A;  2HXI A;  3SFZ A;  3EPZ A;  3KET A;  4DQ2 A;  3PNT A;  1FTT A;  3V8J A;  5E8I A;  4HX8 A;  4H0E A;  5HS7 A;  1Y1V J;  3ZQC A;  3PIO F;  3OIP A;  1MJ9 A;  1MH3 A;  4I76 A;  4BAC A;  2ZBK A;  2VKH A;  4LFU A;  2PEX A;  3SZT A;  1WH5 A;  2KKO A;  4G7H F;  5D5U B;  1G8X A;  2HKO A;  4I2O A;  1IGN A;  3HRU A;  4KUM A;  2L5Q A;  1R5G A;  5FFX A;  1TQI A;  4HNT A;  4MIM A;  3MAJ A;  4IHW A;  5HNF A;  3TED A;  4RAY A;  3IL2 A;  3DV8 A;  1BOA A;  1YHQ I;  3S16 J;  3QQA A;  3CD6 I;  5L3G A;  2NS8 A;  4CZZ A;  1WQ2 A;  4XSZ F;  4IL6 C;  2WB1 N;  4UHT A;  1LE8 A;  4L0Z B;  4WK8 F;  3F6V A;  3F8M A;  2JQ7 A;  3P9I A;  1ULY A;  1FBQ A;  3ZRG A;  2CG4 A;  2VKE A;  2LLK A;  3HSR A;  1VTN C;  1VQM I;  1LVK A;  2FML A;  2M45 A;  4R79 A;  2DK5 A;  2DI3 A;  2FX0 A;  3ZXS A;  4KMF A;  3G1O A;  5EG0 A;  5IYB J;  4C2M J;  4GGG A;  1J9I A;  3GO5 A;  3M9A A;  4NUB A;  2VIX A;  1VQ7 I;  3GTG J;  3ONQ A;  5JVT A;  2W85 A;  1ZQ3 P;  1R36 A;  3DEU A;  3A0H C;  2E2I J;  3LFU A;  2HU9 A;  2VQH A;  3ESW B;  4LLL A;  1OQY A;  2FBK A;  3HHH A;  4AYB N;  1OCR H;  1HLV A;  1STZ A;  1IRZ A;  1YI2 I;  3KPH A;  1NG7 A;  4GDF A;  4FCY A;  1KGS A;  2AO9 A;  2I8D A;  3FM3 A;  1U3E M;  3FK7 A;  4XLH A;  2JUG A;  4BQQ A;  1U0J A;  3IC7 A;  3LNQ A;  1IXS B;  4EV0 A;  3BDD A;  4OIP F;  2B7E A;  3E5U A;  3AL0 C;  1ETW A;  2H8W A;  5K5R A;  5F08 A;  3HOX J;  3RPQ A;  1YX5 A;  3CJR B;  2X1C A;  5FLM J;  1ONV A;  2MGQ A;  3TO7 A;  1S6L A;  3ABL H;  2Y69 H;  4M3F A;  5EF6 A;  2RDP A;  1ETK A;  3ECO A;  3LSH A;  3DPT A;  3PQK A;  4CCL A;  3TW6 A;  3OIO A;  2DO7 A;  3FZV A;  4M6X A;  5ERI A;  4RGS A;  1V4R A;  2OUM A;  1WJF A;  1W5C C;  2W4S A;  5GP9 A;  3ZQI A;  3PO3 J;  3PNV A;  4B48 A;  2M2E A;  2HZT A;  1B59 A;  3VYR B;  3KP3 A;  4HV6 A;  2DMT A;  1ZGA A;  3JSP A;  2M0C A;  3C7J A;  1AOY A;  2BEO A;  2UXX A;  5J1U A;  2HOS A;  3QPT A;  1SD4 A;  2RQQ A;  3S93 A;  3NQO A;  5F6F A;  4M6V A;  3K10 A;  1VZ0 A;  3VFZ A;  1A35 A;  4BE2 A;  1BI3 A;  1D8K A;  3CLQ A;  2IVM A;  2V1U A;  1BJZ A;  4IRI A;  3ZOB A;  1VFC A;  3PIP F;  3QYE A;  4L18 B;  2Z1D A;  4XSX F;  2P5K A;  1FYK A;  2XRN A;  4BJ5 C;  1X2N A;  4RBO A;  1ZR2 A;  2ZME B;  4EEF G;  5HLG A;  5FD6 A;  4C3H J;  3L2R A;  4CCK A;  3K4N A;  4Q4Z F;  1D0Z A;  2LMD A;  3H9G A;  2HYJ A;  4G6T B;  1ETV A;  2ME0 A;  4NNJ A;  3O6B B;  4II3 A;  2Z33 A;  1AU7 A;  3M8J A;  1TQP A;  1A6Q A;  3CDL A;  2PQ8 A;  1BA5 A;  2MH9 A;  3TQN A;  1KZH A;  3G4S I;  3WTS C;  2K9M A;  4B3A A;  1FIA A;  2IGK A;  1YRN A;  3OOP A;  4D5C A;  4M73 A;  3OYH A;  3S14 J;  1Y39 A;  1SD6 A;  3DLL F;  4HRI A;  3SEZ A;  1G2H A;  4UB8 C;  1X3Z B;  5GAE J;  2QUF A;  1A31 A;  3IH3 A;  2DA3 A;  3FMQ A;  1TP4 A;  3EDP A;  3JRE A;  2DMP A;  3HOT A;  1C0W A;  5KNL A;  2HEO A;  2IS1 A;  4OIN F;  1F43 A;  1NK3 P;  2JA8 J;  2Y0M A;  3FIS A;  4D5F A;  3RZD J;  3HM5 A;  2NVQ J;  4BHB A;  2L54 A;  2Q1Z B;  3MZY A;  1X1D A;  2FE3 A;  4G6D A;  3PUB A;  2OZU A;  1YRN B;  1XG1 A;  3MD2 A;  4RLQ A;  2M4K A;  2XGE A;  1R58 A;  4DIQ A;  5H2F C;  1HXD A;  2OD5 A;  4B3X A;  5DD4 A;  3IRQ A;  1O4X A;  2M8G X;  1APL C;  4G7O F;  1TWC J;  1R22 A;  2GOM A;  3MCZ A;  4KT5 C;  4ZYH A;  4CYC B;  4A12 A;  5E79 C;  2ECC A;  1R00 A;  3WU0 A;  3Q5F A;  1YJW I;  2HFH A;  1Y6I A;  2F5C A;  5HDG A;  3SQN A;  3E1S A;  2E1O A;  1ETX A;  3CP2 A;  3WTW C;  1JTX A;  5HDN A;  1A36 A;  3HC7 A;  3CTA A;  1R4N B;  1FX7 A;  1JHF A;  4QWQ A;  4RMN A;  4D1Q A;  1QA6 A;  1BW5 A;  1RPW A;  2TDX A;  2CYY A;  4A5N A;  5F0F A;  4D0P A;  1FSE A;  4E4H A;  4XKB A;  3PUF A;  4EJU A;  2VPR A;  2WAE A;  2KZV A;  1CGP A;  3GCM A;  1WSU A;  1KYZ A;  4G9Y A;  5AIQ A;  4ENN A;  1EF4 A;  1VQK I;  2PMU A;  1VQL I;  3DP7 A;  2GAU A;  4XRF A;  2Z5U A;  4L9V A;  1GV2 A;  1Z91 A;  5LLQ A;  3HRM A;  3GEZ A;  3V8K A;  4HV5 A;  3FBN B;  4ON0 A;  3BPV A;  2FOW A;  4A3D J;  2ZFW A;  2R7T A;  2P4W A;  1ETQ A;  2JUC A;  2H1L A;  4M3D A;  4CCO A;  3KZY A;  2M30 A;  5BPI A;  5TGT A;  4KYW A;  3LMM A;  2VBX A;  2GQQ A;  1F4K A;  2CMP A;  4CIC A;  3FXO A;  1D5Y A;  1F5T A;  5IT9 K;  3LSI A;  1WJC A;  1OFC X;  3HB9 A;  3MEX A;  2V9K A;  4DW6 A;  2DPU A;  2JA7 J;  4J01 A;  3QRF F;  4Y15 A;  1LJ9 A;  1OMI A;  4JBA A;  4J19 A;  4CXF A;  4GCV A;  3F9K A;  2DT5 A;  2KPM A;  1PUF B;  1KQ9 A;  2FBI A;  4ENM A;  4PJN A;  1XN7 A;  1YQA A;  3BP8 A;  1VQ9 I;  3HOS A;  3GZ5 A;  4QTR A;  2EIJ H;  2OAZ A;  2Y0S N;  3IKT A;  2DDA A;  5JHU A;  2DA2 A;  1BIB A;  2E19 A;  2HDD A;  5F0H A;  4A2U A;  4Q47 A;  3H5R A;  1TW3 A;  3LAP A;  5FB2 A;  3S1N J;  2WC2 A;  2LF8 A;  3IUO A;  1ZHF A;  2GOX B;  2CUZ A;  2JWT A;  1UCR A;  3F8C A;  3SXY A;  1ZLJ A;  4NB5 A;  3WG7 H;  2FSW A;  2AXL A;  2VOO A;  1QVT A;  2IAI A;  3HPH A;  4F3Q A;  4LG0 B;  3OYE A;  3GX4 X;  2FQ3 A;  5D6F A;  5C4X J;  4RLF A;  4D7M A;  5GAG J;  3BZK A;  4C9Y A;  4E70 A;  4UXN A;  3K4L A;  4XL9 A;  1EJ9 A;  2LH9 A;  1ODD A;  2FU4 A;  3AFH A;  2L4M A;  1B8I A;  1BC8 C;  3K69 A;  2DQL A;  4HPQ A;  5FJ8 J;  3OS2 A;  3MFK A;  5LBQ A;  1JGS A;  1E17 A;  2A05 A;  3BR1 A;  3ERM A;  1RR7 A;  5DS9 A;  4UV9 A;  1D5V A;  2PFB A;  1NK2 P;  1FSH A;  5HVQ C;  4BQO A;  2BOL A;  3EUA A;  2XRL A;  2COB A;  4NDL A;  2XF6 A;  2KQR A;  3H5N A;  2LNB A;  4ZDO A;  4O6J A;  4I09 A;  4E7Z A;  2MA3 A;  3D5R C;  3CCS I;  4LJZ F;  2IW5 A;  2DFE A;  4UB6 C;  2EFP A;  3I9V 2;  2OZ6 A;  1MND A;  2Q8K A;  3C1D A;  4R1H A;  1YOV B;  2P5V A;  1U5T B;  5EGO A;  1N78 A;  5A2Q Z;  4XRS A;  3IH2 A;  2CQK A;  4A3B J;  1Z7U A;  1S7O A;  1OPC A;  3WGI A;  5K7F A;  3OV8 A;  2KIU A;  1F36 A;  3KEO A;  2LBF B;  1FZP B;  2QM3 A;  4XKW A;  4FIS A;  1HA8 A;  3VDX A;  3I55 I;  3ABM H;  1BR2 A;  3K4J A;  3V8L A;  3VSL A;  4O5V A;  2XAJ A;  3AG3 H;  1J59 A;  5DUI A;  1Z1D A;  3V4G A;  5K5Q A;  1DU6 A;  5DEQ A;  5HLI A;  3HOY J;  1ZRE A;  2Z16 A;  1CQT A;  1FEX A;  3CLO A;  3I53 A;  3W2V A;  2KIQ A;  4RGU A;  1Z7L A;  4W1U A;  3WE2 A;  1E3P A;  2A6H F;  2X48 A;  3HEF A;  4P96 A;  4FE4 A;  2UWM A;  5EGO B;  2O9L A;  1YJN I;  4EVI A;  2LRE A;  2JA2 A;  2DDB A;  2L7M P;  1XMK A;  1RRJ A;  5C44 J;  3VYU B;  2K3P A;  3SZP A;  2E71 A;  3FXM A;  4NQW A;  3IAM 2;  3LQQ A;  3E7L A;  1ETO A;  3E5X A;  2NVX J;  1WGX A;  1X1B A;  1WWX A;  2BY1 A;  5E3L A;  2L9N A;  2OCE A;  2EV6 A;  3O8G A;  4DOZ A;  1AKH A;  3E0J B;  1M1E B;  2Z99 A;  3QOP A;  3GTK J;  3KP5 A;  4RGR A;  3RCO A;  1EV7 A;  3CCV I;  2YX4 A;  3BLY A;  2P7C B;  3BG7 A;  4JX5 A;  2K4B A;  3CC7 I;  2XKO A;  3KX2 A;  4Z6Y A;  5HOO A;  1S29 A;  5FRO A;  5FGM A;  2EH3 A;  1YIT I;  3GZ6 A;  3DBR B;  4BH9 A;  2YUS A;  3T5X A;  4LMY A;  1USS A;  2H6B A;  4GFB A;  3BR3 A;  3I4M J;  2CO5 A;  2QQ8 A;  1CF7 B;  1GLN A;  2JN6 A;  2F5V A;  1Y0N A;  1W5T A;  3OY9 A;  2LK2 A;  3OYC A;  3OOU A;  2LF7 A;  2EIL H;  3DU6 A;  2GIV A;  3GTQ J;  3LWF A;  1SFX A;  5LRR A;  1Z67 A;  3PSF A;  3SJM A;  2VQL A;  4HDU A;  3PJR A;  1G3T A;  4FTH A;  4RA2 A;  2V26 A;  4LGW A;  2WBM A;  3M1C A;  4ESB A;  1IXC A;  3HL2 A;  1YTY A;  1IZ1 A;  4JX6 A;  4PCQ A;  3ZMU A;  1F1Z A;  4IHX A;  1LKX A;  2NVT J;  1G4D A;  1O3S A;  3KIO A;  4BE0 A;  2QSF X;  2DFF A;  4V19 K;  4C2T A;  3S1R J;  1SD7 A;  3EUH A;  4Z2Y A;  2VN2 A;  1XB4 A;  4PJL A;  2CQX A;  5JVG F;  2FMY A;  2CH0 A;  1D1A A;  4MEY F;  3LSM A;  2XF5 A;  3FK6 A;  1VQO I;  2E5Z A;  2GWR A;  3WTV C;  3G73 A;  1NHA A;  4CDG A;  1I3A A;  5E3M A;  1H88 C;  1K6Y A;  2ECB A;  2R7R A;  4JP0 A;  2Y31 A;  3GWZ A;  2V9P A;  1ERD A;  4G12 A;  1ZG5 A;  2W48 A;  3CJQ B;  2RNJ A;  2R3S A;  1ORK A;  1Z9C A;  3SFI A;  3FHN A;  3FXR A;  3NAU A;  1FTZ A;  4Y52 J;  1FC3 A;  1MNE A;  2R7V A;  2EBI A;  1U8B A;  1GT0 C;  1N25 A;  2BW3 A;  2OPT A;  3P9C A;  3GXO A;  2ZJP F;  4XR6 A;  5DTD A;  1R5H A;  2OQR A;  4RAG A;  3DWL E;  2X51 A;  3CDI A;  2XAF A;  3TO6 A;  5IY5 H;  5E18 F;  1IJW C;  3OL4 A;  2M7B A;  3ECH A;  1QPM A;  3ELK A;  4OU0 A;  5B3S H;  3CF5 F;  3IHU A;  3IAS 2;  5JLX A;  1MMG A;  1T8I A;  4AM3 A;  4IRH A;  1JI8 A;  3TO9 A;  2XAG A;  1WI9 A;  4OIR F;  1YX3 A;  3ML6 A;  3E5Q A;  2D1V A;  4M74 A;  3S2W A;  3CCY A;  1FP1 D;  2Z2S B;  2ZJQ F;  5DV5 A;  1RZ4 A;  2M5W A;  1ZRC A;  4U0V A;  1E3H A;  1BBY A;  1IF1 A;  2E5N A;  1EH7 A;  2ZCW A;  1NG6 A;  4M9S A;  4EGZ A;  3HKZ A;  4RM2 A;  3CO6 C;  1WJA A;  1G6N A;  3WE3 A;  1HCR A;  2EFO A;  2IS2 A;  1HW1 A;  3T0Y A;  1JE8 A;  6PAX A;  5TJJ A;  4WF2 A;  3BQY A;  5K5O A;  2EIM H;  2IP2 A;  3FDY A;  4BHP A;  1D3Y A;  4IKF A;  3C3W A;  5D5X B;  3A2K A;  3V7S A;  1T56 A;  3I54 A;  2M0M A;  2GA1 A;  1TT5 B;  1TNT A;  4EJW A;  1FNN A;  2E7X A;  3QU3 A;  2L3D A;  3C2H A;  3DFG A;  4UVA A;  2FRH A;  2QA4 I;  2ZSI B;  2M9H A;  4PSX A;  4ASN A;  1G3Y A;  2R0Q C;  4ZYD A;  2W25 A;  2HOT A;  5E1W A;  5K7H A;  2ZXW H;  4CCJ A;  5K1Y A;  2MFZ A;  3KZZ A;  3AKZ A;  4XON A;  1B72 A;  2AXT C;  3MKZ A;  4Y13 A;  2KIS A;  2Q2E B;  1D8J A;  4IHS A;  2JK3 A;  5GPC A;  3JAM K;  3CME I;  3ABK H;  4D9J A;  2ID3 A;  2HI3 A;  2P8T A;  1TZL A;  3C2B A;  5F0C A;  5EZG A;  3BG9 A;  2ZC2 A;  1W1W E;  4NHJ A;  4HQE A;  1U6G A;  4IZZ A;  4OMZ A;  1EKE A;  3F3X A;  3IP4 B;  2E2J J;  4KIS A;  3LSR A;  4A0Z A;  1QNT A;  3P5J A;  4W97 A;  3QP5 A;  3LAJ A;  2A5W A;  3KZI C;  4B1R A;  3F8F A;  4DYR A;  1AHD P;  2MC4 A;  3FMR A; 
#chains in the Genus database with same CATH homology
 2DMN A;  1BJZ A;  2DA4 A;  3ZOB A;  1VFC A;  2R5Z A;  1A5J A;  4V2G A;  4UUS A;  3UKG A;  3S1Q J;  2ELK A;  1X2N A;  4RBO A;  2I10 A;  1ZR2 A;  1FJL A;  4EEF G;  2CUE A;  4M3E A;  4C3H J;  2X9D A;  4M3G A;  3HOZ J;  2HYJ A;  2PMZ N;  3QPL A;  2GLO A;  1HF0 A;  1ETV A;  2ME0 A;  4L5E A;  5IYC J;  1W0U A;  1AU7 A;  3H0G J;  3CDL A;  1BA5 A;  2XSD C;  1TWF J;  2JA6 J;  2ID6 A;  4B3A A;  3S2H J;  1FIA A;  1YRN A;  4D5C A;  3S14 J;  5EYR A;  5F27 A;  2CJJ A;  1G2H A;  3BTI A;  2H8R A;  3BQZ A;  3IH3 A;  2R5Z B;  1I50 J;  1P7J A;  2DA3 A;  2Y9Y A;  3TP3 A;  4MFE A;  3JRE A;  2DMP A;  2DMU A;  3W6V A;  3GTP J;  4C3J J;  1F43 A;  1NK3 P;  2EZK A;  2JA8 J;  5F1J A;  1HDP A;  3MN2 A;  1IDY A;  3FIS A;  4D5F A;  3RZD J;  3HM5 A;  4A3F J;  2NVQ J;  1ETY A;  1WH7 A;  3BR5 A;  2MG4 A;  2DA5 A;  3JRA A;  2LKX A;  4MFD A;  2K9Q A;  4Y7N J;  2R7Z J;  5HOD A;  2ME6 A;  2VUM J;  1YRN B;  2VI6 A;  1XG1 A;  2LR8 A;  2XGE A;  2Y2Z A;  1P7I A;  4BKX A;  1O4X A;  3ZQL A;  3HOW J;  5C4J J;  3FIW A;  3D1N I;  2M8G X;  2TRT A;  1APL C;  5IP9 J;  1MBF A;  1TWC J;  1ZKG A;  4CYC B;  3S1M J;  3B6A A;  5FKO A;  2CQQ A;  2ECC A;  2R92 J;  1Z0X A;  2IBD A;  3QPS A;  1LE8 B;  4B4C A;  1RET A;  2E1O A;  1ETX A;  2DA1 A;  1JTX A;  1ZK8 A;  1Z77 A;  1ENH A;  3BR6 A;  3BR0 A;  3RKQ A;  2CU7 A;  3WHC A;  3PM1 A;  1BW5 A;  2XPW A;  1RPW A;  2FJ1 A;  2QCO A;  1JKR C;  1GUU A;  5EG0 B;  5F0F A;  2JA5 J;  3JRD A;  2VPR A;  2TCT A;  1JKP C;  2EQR A;  2X6O A;  2CUF A;  2HXO A;  1EF4 A;  1SAN A;  3HGG A;  3DEW A;  4BY7 J;  1OJL A;  1ITY A;  5IOZ A;  1GV2 A;  2K9S A;  3GTJ J;  1UG2 A;  1IUF A;  3TW7 A;  3B6C A;  5E3O A;  1JJ8 C;  1TWA J;  3BTC A;  2G0E A;  3A01 A;  4A3D J;  1ETQ A;  4A69 C;  1IG7 A;  4M3D A;  3LSJ A;  5FKN A;  1MBK A;  3OSG A;  1QVU A;  1D5Y A;  2K9N A;  3HB9 A;  1OFC X;  3BTJ A;  4DW6 A;  2JA7 J;  5GPA A;  4J19 A;  2LY9 A;  2B63 J;  2R5Y B;  3Q0V A;  2WV1 A;  1PUF B;  5M5Y J;  2L7F P;  2DA6 A;  5FKM A;  4QTR A;  2Y0S N;  3A01 B;  2DA2 A;  2E19 A;  2HDD A;  2EZL A;  2EZI A;  5F0H A;  4A93 J;  1VND A;  1B72 B;  2FD5 A;  4LOC A;  3S1N J;  2CRG A;  2JWT A;  1Y1W J;  2O8K A;  4DZP A;  3Q3S A;  2DN0 A;  4A3E J;  1WI3 A;  1BL0 A;  1QVT A;  2IAI A;  2O7O A;  4A3C J;  3IH4 A;  5F04 A;  1MBG A;  3ZQG A;  3ZQH A;  3JRI A;  3GTO J;  5C4X J;  4D7M A;  4A3L J;  2GBY A;  1XC5 A;  3IV5 A;  3HBL A;  3ZQF A;  1U9O A;  4UUS B;  1B8I A;  1LFU P;  1GDT A;  3HOV J;  2MW8 A;  5FJ8 J;  3BG3 A;  1DU0 A;  3DCF A;  3MVP A;  3JR9 A;  4HNV A;  1XS9 A;  3BR1 A;  3LSP A;  1RR7 A;  3S2D J;  3A03 A;  4ABZ A;  5DS9 A;  1ZR4 A;  1NK2 P;  2XPV A;  2LD5 A;  2XRL A;  2COB A;  4NDL A;  1VI0 A;  5J1R A;  1W0T A;  1JKO C;  2LVS A;  4MO7 A;  5M3F J;  1IV6 A;  1UHS A;  4C3I J;  1MSF C;  1RES A;  5J3L A;  3Q0U A;  1WPK A;  4QIW N;  3S17 J;  2FQ4 A;  1JUP A;  1OCP A;  2XGD A;  3A02 A;  4AC0 A;  2K40 A;  5EGO A;  3Q0W A;  4XRS A;  3IH2 A;  1JT6 A;  4A3B J;  3GTL J;  5K7F A;  1I3Q J;  1QPI A;  1NTC A;  3G1L A;  1F36 A;  4BBS J;  4DYQ A;  1VF9 A;  2NOG A;  4FIS A;  2E2H J;  3G1M A;  4D7N A;  1JUM A;  3BT9 A;  5IOY A;  5IP7 J;  1GVD A;  2LTP A;  1DU6 A;  5M3M J;  3OSF A;  1SFO J;  3HOY J;  1RKW A;  3BG5 A;  1CQT A;  2Y30 A;  1FEX A;  4BXX J;  1JTY A;  4FE7 A;  3NAR A;  1S7E A;  4W1U A;  1ZTR A;  2HOA A;  2X48 A;  3HEF A;  4XID A;  3I4N J;  2DA7 A;  4FE4 A;  5EGO B;  3L1P A;  2O9L A;  4X6A J;  1JGG A;  4A3G J;  5M5X J;  3PO2 J;  2L7M P;  1WCM J;  2YS9 A;  5C44 J;  1T33 A;  2QF7 A;  1TC3 C;  4BY1 J;  1JT0 A;  3E7L A;  1ETO A;  2NVX J;  1MBE A;  1WGX A;  5E3L A;  2JJ7 A;  2DJN A;  3O8G A;  1AKH A;  3JRG A;  3GTK J;  4DYC A;  4JX5 A;  3S15 J;  2KT0 A;  2LP0 A;  3RQI A;  2XB5 A;  2EH3 A;  4XIC A;  2JMW A;  1IC8 A;  3GTM J;  3RZO J;  2LFB A;  3JRB A;  2YUS A;  3HOU J;  4S0H B;  1IDZ A;  4GFB A;  3BR3 A;  1K61 A;  3I4M J;  2MSY A;  2AHQ A;  2JN6 A;  2L0K A;  3K2A A;  1K83 J;  5EEA A;  3M3Y J;  1LFB A;  2LK2 A;  4QSH A;  3BTL A;  3OOU A;  9ANT A;  4M3B A;  3MKL A;  1JUS A;  3GTQ J;  1MNM C;  1ZGW A;  2RAE A;  2N8G A;  3LOC A;  2IEK A;  4XK4 A;  3SJM A;  4FTH A;  4JYK A;  2NS7 A;  3H3V K;  1RKT A;  5EDN A;  2KDZ A;  4JX6 A;  4A3M J;  2WAQ N;  1MH4 A;  4IHX A;  1TWG J;  2NVT J;  1HDD C;  2H1K A;  5IP6 A;  1MSE C;  2D5V A;  2OF7 A;  3S1R J;  1MBJ A;  3JRF A;  5JLW A;  3HDD A;  2HXI A;  4RDU A;  1QRY A;  5M5W J;  2CQX A;  1FTT A;  2DMQ A;  4X1E A;  3JRC A;  1FIP A;  5FLV A;  1R9T J;  5BNG A;  1Y1V J;  3ZQC A;  3VPR A;  1OCT C;  3FK6 A;  1MH3 A;  1X2M A;  4I76 A;  1UMQ A;  5FKK A;  5E3M A;  4V2F A;  1WH5 A;  3CMY A;  5IYD J;  1H88 C;  4JX4 A;  4BBR J;  2ECB A;  4JP0 A;  2Y31 A;  1IGN A;  4IHW A;  4A3K J;  4G12 A;  4MIM A;  2W48 A;  1ORK A;  1E3O C;  3TED A;  3SFI A;  3S16 J;  4A3I J;  3QQA A;  4A3J J;  3NAU A;  1FTZ A;  2NS8 A;  1MBH A;  4CYC A;  4Y52 J;  5E3N A;  2WB1 N;  2EBI A;  2EZH A;  1U8B A;  1GT0 C;  1LE8 A;  1X58 A;  3FKI J;  2OPT A;  1B8I B;  2VKE A;  5DTD A;  2LLK A;  4XRS G;  1IJW C;  2R93 J;  2FX0 A;  2ZB9 A;  3G1O A;  5JLX A;  5EG0 A;  5IYB J;  4C2M J;  2XPU A;  2L9R A;  3F0C A;  1POG A;  2DTZ A;  1U78 A;  3GTG J;  4DZJ A;  1ZQ3 P;  4IEJ A;  3CCY A;  1GV5 A;  5FKL A;  1I6H J;  2XGC A;  2XB0 X;  2E2I J;  2M34 A;  1JKQ C;  4AYB N;  1HLV A;  1IRZ A;  3HKZ N;  4FCY A;  1HCR A;  4XRM A;  2AO9 A;  3M4O J;  3FK7 A;  4UUT A;  2HQ5 A;  3LNQ A;  3BQY A;  3K7A J;  2GM4 A;  1HOM A;  1H8A C;  5C3E J;  2P81 A;  3TP0 A;  1ETW A;  3WHB A;  1T56 A;  2R5Y A;  5K7Z A;  5F08 A;  3HOX J;  4IHY A;  1PUF A;  3JRH A;  2VKV A;  3BR2 A;  5FLM J;  2MGQ A;  4M3F A;  5EF6 A;  1TWH J;  1ETK A;  5J1Y A;  3TW6 A;  3OIO A;  2M9H A;  1H89 C;  4I6Z A;  3LSG A;  2R0Q C;  3O8H A;  3ZQI A;  5GP9 A;  2HOT A;  3PO3 J;  5K7H A;  2M2E A;  4AUX A;  1B72 A;  3SDG A;  2YU9 J;  2JK3 A;  5GPC A;  2L7Z A;  2DMT A;  2ID3 A;  2HI3 A;  2Y9Z A;  1Q1V A;  3C2B A;  5F0C A;  5EZG A;  2M0C A;  3BG9 A;  1U9N A;  2NVY J;  5J1U A;  2HOS A;  1JJ6 C;  1AKH B;  2E2J J;  3GBG A;  1A6I A;  5EZH A;  3CQZ J;  3LSR A;  4M6V A;  4IHV A;  3HGY A;  4W97 A;  5IPA A;  4B1R A;  4DYR A;  1AHD P;  1BW6 A;  4MLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...