1ETQA

The crystal structure of e. coli fis mutant r71y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
85
Chain Sequence
VLTVSTVNSQVTQKPLRDSVKQALKNYFAQLQDVNDLYELVLAEVEQPLLDMVMQYTYGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 26
structure length 85
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etqA00
1MH4A 2ME6A 4IHVA 3JRAA 2M8GX 2NS8A 3Q0UA 4C3IJ 4I76A 5C44J 1JKQC 1P7JA 4BBSJ 5F04A 2DA7A 2JA6J 4D5FA 1BA5A 1RR7A 4JYKA 3SFIA 3RKQA 3BT9A 4FE7A 1B8IB 2MGQA 1BL0A 5EZGA 1ETYA 1Z77A 4QIWN 2LLKA 5IPAA 1PUFA 1VI0A 2W48A 3MVPA 3JRFA 4MO7A 3OSFA 2DJNA 5K7ZA 5F0CA 3DCFA 2QF7A 5EZHA 5M5XJ 3A02A 2EZLA 1B72B 5J3LA 2WB1N 5FKKA 5JLXA 2XPVA 5K7HA 2RAEA 2L7MP 4MFDA 1MH3A 1IDYA 2GLOA 2LKXA 3MN2A 1VNDA 3FISA 1NTCA 2TCTA 4M3BA 1UG2A 5C4JJ 5F1JA 3LSJA 2NS7A 1EF4A 3SJMA 1MBGA 1HDDC 2KDZA 3FIWA 1GUUA 1GV5A 2JK3A 2DMNA 3BTIA 5DS9A 3ZQCA 2M2EA 2CJJA 1RPWA 4I6ZA 5C3EJ 1QPIA 3JRCA 3FK7A 5K7FA 2EZHA 2DN0A 5E3LA 2O7OA 4MLOA 5GP9A 2JMWA 5FJ8J 2DA3A 3LSGA 3I4MJ 1PUFB 3CDLA 2MG4A 1FTZA 3BQZA 2DMQA 2XSDC 1U9OA 2XPUA 4A3KJ 2R5ZA 2XGCA 3LSPA 1HLVA 3IV5A 1H88C 1HDPA 3CMYA 1U78A 1GVDA 1R9TJ 1ETWA 3A03A 2LFBA 4M3GA 2K9SA 1RESA 4A3LJ 1W0TA 3O8GA 1WGXA 2YUSA 3C2BA 2HOTA 1GV2A 4A3CJ 2VKVA 2DA4A 5JLWA 2EQRA 4V2FA 2HDDA 5FKNA 1HF0A 5IOZA 1OFCX 2R5YA 5M5YJ 3IH3A 1Y1WJ 4BXXJ 4QTRA 1JUPA 4UUTA 5HODA 1MBKA 1X2MA 1B72A 4D5CA 4ABZA 2HXOA 1I3QJ 4RBOA 2NVYJ 4XK4A 2EH3A 2EZIA 3PM1A 3TEDA 2E19A 4C3HJ 2ME0A 5FLVA 5IOYA 5GPAA 1LFBA 3PO3J 1Q1VA 1TWAJ 1P7IA 2ID6A 3GTKJ 2WV1A 2COBA 2D5VA 3K7AJ 4FISA 1CQTA 1WI3A 2ZB9A 1JGGA 1AU7A 2JA8J 1W0UA 5F0HA 5EG0A 1XC5A 2R5ZB 3BR1A 4MFEA 4M6VA 3FK6A 2X48A 1XG1A 5IP6A 2DMTA 2X9DA 2Y30A 2IEKA 4DW6A 2WAQN 2R7ZJ 3HKZN 5J1RA 1JT6A 3HOYJ 5FKMA 2DA6A 1U9NA 3HB9A 3S2HJ 3ZQLA 1WH5A 1X2NA 3TW7A 2R0QC 3G1MA 2N8GA 4JX6A 1JTXA 3G1LA 1ZTRA 1MSFC 2LTPA 3HM5A 4A3IJ 2R5YB 2K9QA 5FKOA 1ZR2A 2PMZN 1FTTA 3DEWA 2M34A 3JREA 4B4CA 4M3DA 3LNQA 1RETA 2I10A 2L7FP 2EZKA 1BJZA 5IYDJ 1UHSA 1WCMJ 1VFCA 3HOWJ 1QVTA 1S7EA 3GTOJ 1JTYA 1LE8A 2LVSA 4QSHA 4B3AA 2HQ5A 2O8KA 2B63J 5E3NA 1OCTC 1IJWC 3GBGA 2TRTA 2P81A 1Y1VJ 1IUFA 1F43A 1QRYA 5IYCJ 1ETXA 3BG5A 3G1OA 3MKLA 3NAUA 3S15J 4UUSB 5EG0B 3BTCA 1GT0C 1IG7A 2LR8A 5EF6A 3OSGA 1POGA 1A6IA 1BW5A 4BBRJ 1JJ8C 3JR9A 1WH7A 1FIPA 3BR3A 4JP0A 1MBHA 1ITYA 3JRHA 1T56A 1ZKGA 3GTPJ 5EGOA 3LSRA 3ZQIA 4A3DJ 2X6OA 2AO9A 2ECBA 3O8HA 3JRGA 3I4NJ 5EEAA 5F08A 2LD5A 2VUMJ 2DTZA 1G2HA 4M3FA 3PO2J 3A01A 2LY9A 1IRZA 1K83J 2CRGA 3TP0A 4J19A 3ZQFA 5BNGA 5E3MA 1MBEA 1T33A 1IC8A 2ECCA 1HOMA 3S1QJ 3HBLA 5IYBJ 2H8RA 5C4XJ 3BG3A 5DTDA 3B6AA 1LE8B 1VF9A 3B6CA 3S16J 4Y52J 3BQYA 4XRMA 4EEFG 3F0CA 1NK3P 3QPSA 3OOUA 2H1KA 2CQXA 1OCPA 3HGGA 3M4OJ 2E2IJ 2CUFA 2ID3A 1Z0XA 1ETVA 2NVXJ 4A3GJ 4FCYA 2MSYA 4XRSG 3HDDA 1JKOC 3VPRA 5EYRA 1RKWA 4A3EJ 3ZQGA 1ZQ3P 3S1MJ 1QVUA 2LK2A 3NARA 1ENHA 2JA7J 1AHDP 2XB5A 4A3MJ 5EGOB 4AYBN 5M3FJ 5J1YA 3JRIA 5M5WJ 4UUSA 1MNMC 4GFBA 1TWHJ 3BG9A 4DZJA 1ZK8A 4C2MJ 2Y31A 5FLMJ 2DMPA 3JRBA 1HCRA 1DU6A 3A01B 2EBIA 4M3EA 3GTMJ 3H3VK 4X6AJ 4Y7NJ 2DA1A 2Y2ZA 3Q0WA 4A3BJ 3Q3SA 2HXIA 1TWFJ 4NDLA 1I50J 1UMQA 4X1EA 3JRDA 4XICA 2VPRA 3FKIJ 2R93J 4A3FJ 1JKRC 4DYRA 1JKPC 3W6VA 3RZOJ 1FEXA 2VI6A 3HOVJ 3BR6A 4MIMA 4C3JJ 2M9HA 2L9RA 3HGYA 1JJ6C 2NVQJ 3TW6A 4W1UA 1MBJA 5J1UA 1JUMA 1SANA 2OPTA 3QPLA 2E1OA 2K9NA 4L5EA 5IP7J 4FTHA 5EDNA 3BR5A 2YS9A 2IBDA 2KT0A 3E7LA 3IH2A 1YRNB 2MW8A 1MBFA 4D7MA 1IV6A 1ETKA 3GTQJ 3RQIA 4RDUA 4HNVA 4IEJA 2HI3A 5F0FA 2E2HJ 2FJ1A 1FJLA 2JN6A 3GTJJ 2E2JJ 2HOSA 2JJ7A 3Q0VA 1DU0A 4JX5A 1IGNA 2NOGA 3M3YJ 3QQAA 2XB0X 1AKHA 4CYCA 3WHCA 3UKGA 1LFUP 3HOXJ 1H89C 4BY1J 2JWTA 1TWCJ 2XPWA 4IHYA 2Y0SN 4W97A 2Y9ZA 3TP3A 4D7NA 1GDTA 4A93J 1JT0A 2LP0A 4FE4A 4BY7J 4S0HB 1D5YA 1F36A 2GM4A 2CUEA 4JX4A 4IHXA 1APLC 3GTLJ 1E3OC 4DYCA 1H8AC 3BR0A 4XRSA 2FD5A 4LOCA 2Y9YA 1RKTA 2XGEA 1A5JA 1OJLA 2XRLA 1ETQA 2XGDA 3D1NI 3BTJA 1WPKA 2DA2A 4V2GA 2QCOA 1ZGWA 4IHWA 2DA5A 2R92J 3S1RJ 3S17J 2HYJA 2FX0A 2NVTJ 1ORKA 4G12A 2CQQA 2G0EA 1NK2P 3H0GJ 1B8IA 2JA5J 2OF7A 1O4XA 3S1NJ 3HEFA 2YU9J 3K2AA 9ANTA 3LOCA 1TWGJ 3RZDJ 1U8BA 3CCYA 4AC0A 4DYQA 3HOZJ 3SDGA 2DMUA 3ZQHA 4B1RA 4A69C 1AKHB 4CYCB 5GPCA 1SFOJ 3S14J 2L7ZA 2VKEA 1YRNA 1BW6A 2L0KA 3BTLA 4XIDA 5M3MJ 2GBYA 3WHBA 1ZR4A 1I6HJ 1XS9A 3L1PA 3GTGJ 2IAIA 2ELKA 5IP9J 2O9LA 2FQ4A 1MSEC 1IDZA 2K40A 1K61A 1FIAA 4BKXA 1ETOA 4AUXA 3S2DJ 3CQZJ 3OIOA 1TC3C 2HOAA 5E3OA 4A3JJ 1X58A 3HOUJ 2CU7A 5FKLA 3IH4A 4DZPA 5F27A 1JUSA 2AHQA 3ZOBA 3BR2A 2M0CA
chains in the Genus database with same CATH superfamily
2VQCA 2EJRA 3PSFA 1R58A 2E5NA 2JUCA 3OYKA 2PLYA 1HSJA 2RQQA 3LSIA 4WX9A 1IN4A 1I3AA 2IW5A 5C44J 5F04A 2DA7A 3RKWA 1BA5A 4JYKA 1T08B 3ISPA 5LBQA 1B8IB 1ZG3A 2R7XA 1IN7A 3HHGA 1R4MB 4HLXA 1BL0A 5EZGA 3SYTA 4BQAA 4QIWN 3CMEI 2W48A 4G6TB 2V4JC 1IRGA 2BGCA 3OSFA 2B7EA 2QKMB 4AIDA 2D1VA 3DCFA 4DGWB 1J09A 2EZLA 2XHKA 4YG2F 1J75A 3WE3A 1B72B 2VQHA 2WB1N 4XORA 5K7HA 3J7YJ 1XDUA 1MMNA 4HF1A 3OR1C 4BXUA 2A61A 1NTCA 1QGPA 3PIPF 3RSNA 5F1JA 2K27A 2VB6A 3LSJA 4PFOA 1SAUA 1YJ9I 3ELKA 4S05A 4LIVA 5L3BA 2XF6A 3FIWA 4WF2A 3T1BA 3DKWA 4OIOF 2A5WA 2JK3A 4E7LA 5ICFA 1RPWA 2BW3A 1QPIA 1FP1D 3FK7A 2BYVE 4UB6C 2DN0A 2CQKA 5E3LA 5GP9A 4IOAF 3J81Z 2FSWA 3LSGA 4FASD 3I4MJ 1W36D 3IRRA 2L4AA 4OMYA 1FTZA 2Q2EB 3GFMA 5JR3A 2XSDC 1U9OA 3GX4X 3COAC 5IY5H 2ACJA 2QBYA 2F5CA 2XGCA 5H6RA 1HLVA 4ENJA 1XCBA 3IV5A 5FRNA 1U78A 2CW0F 1U5TC 3FKJA 2LSOA 1QPMA 3GLLA 3AKZA 1ZARA 3A03A 1YI2I 4M3GA 2VOOA 2X85A 2KJCA 2UXNA 1LNWA 3HUGB 3O8GA 3C2BA 5FB2A 3S32A 1GV2A 1YO5C 2RQPA 5HDGA 4II3A 1TTYA 1Z21A 3KFWX 4EM0B 5JLWA 5E20A 5DM6F 4V2FA 2E1CA 5FKNA 5IOZA 1DPUA 2XKOA 3R61A 4QTRA 2MC3A 5HODA 4WK8F 1MBKA 4BDYA 1B72A 1IN6A 2A3SA 3LSKA 1JE8A 2HXOA 4KUMA 2DFFA 4A12A 5IT3A 1U0JA 4DJAA 4ASNA 2DT7B 3PM1A 4UV8A 5FD5A 2Z16A 4AD9A 4B43A 5D5UB 2ME0A 2BY0A 2X6XA 5FLVA 1PDNC 5GPAA 3PO3J 1Q1VA 4P5OA 1LJ9A 4LLLA 1BJAA 3SZGA 1STZA 3ZQQA 5BMZA 1CQTA 1Y8RB 3L2WA 4AIJA 4BACA 2F5DA 2NNYA 2GXAA 3I64A 5F0HA 2VJJA 4B48A 3BR1A 4M6VA 3FK6A 1W5CC 5KNLA 3K4LA 3H36A 2WAQA 2X9DA 2ZFUA 3HKZA 4R1HA 2DK8A 4XOPA 3ZCOA 3FXQA 4P9FA 2WAQN 4BHCA 3HKZN 4DW6A 1T2KA 3FX3A 3HOYJ 3FBIB 2V1NA 2DA6A 3FMRA 5HDNA 4Y3OA 1D1CA 1SFKA 3TW7A 1U5TB 1YJNI 3HTSB 3O2PE 1O7LA 1ZTRA 1HQCA 4N0BA 4C2UA 4N4OB 2K9QA 5FKOA 3HOSA 1IF1A 2PMZN 5E79C 3DEWA 3JREA 1O3QA 1QA6A 1RZ4A 4M3DA 3ZR8X 1B6AA 4H0EA 1QHHD 2PN6A 3HOWJ 3ABTA 3GTOJ 3EUKL 4CYDA 1LE8A 2L9NA 4QPQA 5BPDA 2EPFA 2O8KA 2VODA 2B63J 4IRIA 2V1XA 2YU3A 3OYEA 5ILSA 4FETA 4KMFA 1W7PA 4KIFA 1QRYA 3RIRA 4YFNF 1M1EB 2L54A 2DLLA 3G6EI 2GIZA 3WTVC 4EJVA 4HF0A 3KYCB 4UVCA 2V9PA 2Z2SB 3FBNB 1POGA 2BY2A 2CV2A 3OL3A 1JJ8C 3JR9A 3ZGKA 3H1CA 1WH7A 5E8GA 1PP8F 2P7VB 4PSXA 1ITYA 5IT9Z 5L3DA 1ZKGA 2M30A 4F91B 1Y8QB 5EGOA 3CP2A 2LYCA 3ZQIA 3P9KA 1VQKI 4I7HA 1D3YA 3WE2A 2X6OA 2OD5A 5HS9A 1S8NA 2M7AA 2M8EA 2ECBA 3WTTC 2KMUA 4X0GA 1OKRA 2A05A 1BR4A 3JRGA 3PO2J 2XV4S 1R71A 2ICWG 4HEA2 5HDKA 2BXYA 2DW4A 1T33A 2F5VA 3WTZA 1QZEA 3S8PA 2BE5F 1YLFA 3QPTA 5IYBJ 3I55I 3NRVA 2Z3YA 3CCQI 3OYAA 4ZH4F 4XOTA 4J01A 3DWLE 2OBPA 5B66C 1XB4A 4XRMA 5ILUA 1QQIA 3EUHC 2GXBA 3OOUA 2QQ8A 1HBXG 1OCPA 3BDDA 5K5OA 3M4OJ 3K10A 3G3ZA 2E2IJ 2ID3A 1IV8A 1ETVA 3T8RA 2NVXJ 4A3GJ 1SFEA 4GGGA 2XROA 2DK5A 4FCYA 3Q9SA 2O3FA 1BOAA 3T8TA 3HRSA 1D0ZA 1UFMA 4IPAA 3I4PA 4L5IA 4EM2A 4NB5A 4YIFA 4PUSA 4BQNA 3J7AY 3IKVA 5F1RA 2ZC2A 3ZQGA 2AXLA 2DFHA 2QEXI 2VT3A 5J6XA 3N97A 1ENHA 1R22A 3GZNB 4IO9F 3PJRA 4BQOA 4A3MJ 2ZFWA 1DGRM 4LMYA 3GO5A 3FDYA 3VEPA 1MNMC 4HA8A 3KX2A 3BG9A 4PSWA 3PQJA 3HZJA 4L5JA 5GADJ 1T6SA 4HAMA 2Y31A 4KT5C 3O6BB 3JRBA 2X1EA 1HCRA 1DU6A 3A01B 1XSXA 3HL2A 3O3KA 5E1ZB 3GTMJ 2L9SA 2DDAA 2IS1A 2RREA 3Q0WA 4HX7A 3TO9A 2FF4A 2STWA 4G7OF 3WTYC 1SFUA 2HXIA 4X1EA 3CCRI 3ZMSA 4OAYA 3FKIJ 1JKRC 3SEQA 3CESA 2VI6A 2EK5A 3BR6A 2JSCA 2XSJC 1BI3A 2Z99A 2L9RA 2NVQJ 3F72A 1MBJA 3DBHB 1QHGA 1X4OA 1LB2A 5DV5A 2M3AA 3QP6A 2E1OA 2DI3A 5EDNA 5CVRA 2IBDA 1YRNB 2MW8A 3VFZA 4IRGA 1KONA 1Y0UA 1TZLA 2UUZA 5LHGA 1XX5A 4ANJA 3V7CA 1UELB 2XAGA 3M8JA 1FYLA 3FM5A 2TDXA 2HOSA 3BG7A 4JX5A 5D5WB 2HTSA 4L9VA 1DU0A 1IGNA 2NOGA 3M3YJ 1FSHA 2F5EA 5D5VB 4NQWB 1AKHA 3WHCA 3ABUA 3UKGA 1LFUP 1MKMA 3AAFA 1NG6A 3R4KA 4BJ5C 3HSFA 3SXYA 4BY1J 1SD4A 4IHYA 3PNVA 2DPUA 3AL0B 3HPGA 4IX7A 4YFKF 2E35A 3MKZA 5A2QK 4I2OA 1KQ9A 5CJ9A 4BY7J 1T39A 5HS8A 4IHXA 1J9IA 1APLC 2HDCA 2D1HA 3JSOA 1MDMA 3LA3A 2DTRA 4DYCA 3SEZA 1FOYA 1OPCA 3MZYA 2Y9YA 2OV7A 3TO7A 2EFNA 4IRHA 3BC8A 1UG0A 3ZN1A 4EVIA 2XF5A 2X1CA 1YOVB 1V3FA 1MJAA 3RPUA 2XIGA 1ZGWA 5DCMB 2MFZA 4BDZA 4RM2A 1XGNA 2VT2A 3KEYA 2CV1A 3K70D 4BE0A 1F4KA 4KITB 1KA8A 3H92A 4HNUA 2QLZA 4G12A 2CQQA 3A1YA 1KZHA 2G0EA 1NK2P 2G9WA 1V5GA 3H0GJ 5ED4A 3FXLA 3CCLI 3EYYA 3HEFA 2YU9J 3EUHA 3E5XA 3F8BA 2GAUA 9ANTA 3ZMZA 1E0EA 3DP7A 2DOFA 3BJOA 5AONA 1U8BA 1ONVA 3NWTA 3QU6A 2OAZA 3ZQHA 3CJRB 3OOPA 3S14J 5J40A 5LGUA 3TGNA 3OYGA 2MH2A 3DTKA 1YRNA 1FOXA 2L0KA 4PFPA 1HW5A 4XLNF 2DO7A 1FZPB 3WODF 5FFZA 2JTVA 4OMZA 3WHBA 2KZGA 3OS1A 2LC2A 4LG0A 4AYBA 3FHZA 1R36A 3WTUC 2PQ8A 3CUQC 2LY1A 3MKYB 2QVOA 4RGUA 1XS9A 3BZ6A 3GTGJ 2IAIA 2O9LA 1GHCA 1IDZA 1K61A 2MC4A 3K4NA 1ETOA 3IL2A 5GAEJ 2HOAA 2X1DA 2CWEA 3HOUJ 2LOOA 1R1TA 4RB0A 5F27A 2K86A 2WY8Q 1BBYA 4PGHA 4Y15A 3FF5A 4F93B 2M0CA 3DTEA 1MH4A 4MEYF 3QYEA 1VQ7I 1LDKB 1YS7A 3JRAA 2P8TA 5DD4A 2NS8A 3Q0UA 2DJIA 4AU7A 1FBQA 4LITA 4AM3A 1A04A 1P7JA 4BBSJ 3C2HA 2LKPA 1L3LA 3SFIA 1SVOA 2FMYA 3BT9A 2R7FA 3VWBA 1MMAA 4GXOA 4I01A 2DFEA 4RB1A 2F4IA 4CHUA 3ABMH 2LLKA 2P5KA 1X1AA 1UZCA 5IPAA 1WJCA 1G3SA 3JRFA 3K1NA 2DJNA 5K7ZA 3ZRGA 4Q5SF 2QF7A 4BE1A 1P2FA 2DBBA 3OS2A 3LAPA 2AS5F 3A02A 1FMVA 2LH9A 1RIOH 3IAS2 3K1PA 4HBLA 1HKQA 5FKKA 2A69F 3V7RA 5JLXA 4CUGA 3X2QH 2L02A 2FBHA 2RAEA 3DPLC 2XUBA 3J7AO 2GLOA 3DV8A 4Z6YA 2DPDA 2LKXA 3MN2A 1R4NB 3I3LA 2NYXA 4WXHA 2KIUA 3D5SC 2L9VA 1Y39A 1EF4A 3SJMA 4PJLA 3GXOA 1MBGA 4ESJA 1HDDC 5JI6A 3F3XA 4JK1X 3CMMA 5A2QZ 3D0SA 2W7NA 2K9MA 4PJJA 2DCEA 3ZQCA 3H9QA 4M9SA 4Z2YA 4I6ZA 4KT6A 5DUIA 4RM3A 3CUOA 1WRJA 1A31A 3J81K 3DLAA 5K7FA 2O7OA 4MLOA 1QBJA 2IP2A 3GFJA 3EDPA 3F9KA 3HHHA 1OCZH 4U7BA 2MG4A 3I58A 5E17F 5K1YA 2ZNZA 2NXNB 3WU1B 2KJBA 1D1AA 2WV0A 2R5ZA 3LSPA 1ZG1A 4EJWA 4LG3A 1HDPA 1H88C 1GVDA 1R49A 3KYDB 1YW9A 2K9SA 1XD7A 1RESA 3P5JA 4EJOA 1S9HA 1K7AA 4A3LJ 4NC8A 3OYIA 2VKVA 5BS6A 4D1QA 3C1DA 2DA4A 4HYEA 1EV7A 4A2UA 5L3EA 1S29A 4J00A 4GYIA 1IW7F 2ELJA 2Y75A 5M5YJ 3W2VA 3IH3A 2VBWA 6PAXA 4BXXJ 1T95A 1IAWA 4L9NA 3MWMA 1I39A 2R3SA 3W3CA 4ABZA 4KMUX 2ZSIB 1I3QJ 4RGSA 4C30A 3WGIA 3WTWC 4BGDA 3FM3A 1IXRC 1W5TA 1WHUA 2EH3A 2EV6A 3LSMA 4MQ9F 5HLIA 3ZMUA 4C3HJ 3CUQA 2Q8KA 2BW3B 3FHNA 3TDZC 2VBXA 5IOYA 2FNPA 2K4BA 2QQAA 2VOPA 3IKTA 1P7IA 3TDUC 2L5QA 1R5HA 2ID6A 1TL8A 3CC7I 3GTKJ 1XGSA 2MLKA 3GYHX 2D5VA 3DPUA 4E7SA 5D6FA 4PJNA 1X3ZB 1WI3A 1IRXA 1P9QC 2L01A 4HSTA 4WXDA 3E3VA 3IAM2 4IXAA 4CCMA 2QBYB 3EPZA 1XC5A 2OU2A 1IN8A 3LFKA 4UVAA 3H9GA 1XG1A 5IP6A 4Q4ZF 2H1LA 2E7XA 2Y30A 5DYMA 4BUPA 3RJPA 1FLIA 3ASNH 2GQQA 2E1NA 1DP3A 2YSRA 5D4RA 2N8GA 3QAHA 1ZG5A 2DQLA 1PVEA 1MSFC 3P9CA 1T98A 2HDWA 3HM5A 3LQQA 4A3IJ 3E0JB 2V6EA 1FTTA 4F52A 2M34A 3EETA 5DUKA 3VOEA 3ZMDA 3IWZA 2WB1A 3I59A 2X6WA 4IHSA 4WXCA 2I10A 2R7UA 5IYDJ 3ML6A 1VFCA 2VBYA 5J4VA 4EJTA 1ACIA 1QVTA 1IXSB 1A35A 1S7EA 4CDGA 1SMYF 4A5NA 1G3TA 4CCJA 4B3AA 2ZJRF 2QZ8A 1FYKA 1IJWC 2O8XA 3ASOH 3U21A 1Y1VJ 2RNGA 3P7NA 1BN5A 1F43A 1HKSA 1WWXA 5TGTA 2KRCA 3MKLA 3S15J 1HKTA 4UUSB 2LF7A 2STTA 1Z6TA 3Q5FA 4FX4A 4ZTJA 1IG7A 2W24A 4HOBA 2LR8A 1B1BA 2HYFA 2JZYA 2QKLB 1A6IA 4I02A 3JTHA 5FGMA 1VTNC 2KIFA 4BBRJ 1BW5A 3MD2A 1Z6RA 5LLQA 5IT9K 1YW8A 4DIQA 3TKYA 1FC3A 1Z9CA 2EV5A 1N77A 1LDJA 2W85A 3TOBA 2PJPA 2VIXA 2K5CA 2AQEA 2NNNA 4BE2A 3IC7A 4XLAA 2BVMA 3T5XA 3W6JB 3A0BC 2HTJA 5ICGA 2WBMA 4IVNA 3DEUA 1DQUA 4MTDA 4M3FA 4C9YA 1IRZA 2LY9A 3U9GA 1HW2A 1K83J 2RVCA 1FPQA 3TP0A 2YX7A 1MBEA 1RR8C 1XGMA 2HFHA 2ZXWH 4CZCA 2FU4A 2OTLI 2OC6A 1ZRDA 2IA0A 1S3JA 5DTDA 3B6AA 3W2WA 1LE8B 1VF9A 1N75A 2CG4A 3OMYA 4AIKA 4EEFG 1NK3P 2ZJPF 3OYFA 1MD0A 1ON1A 2H1KA 3OYHA 1I27A 1OYIA 1W7PB 3HGGA 4HG2A 3HRMA 3OYBA 2RDPA 3E5UA 4L0YB 2EFWA 1BM9A 1U2WA 4NNJA 4FHTA 4XBFA 3SQNA 4XRSG 1HA8A 3HDDA 1EH7A 3VPRA 4IOCF 1K4TA 3ERMA 4XLFA 1YHQI 4B8XA 1WSUA 4NHJA 3S1MJ 2LK2A 3CCJI 3H5NA 4U87A 2X0LA 3CF2A 2XB5A 5EGOB 5M3FJ 3L9FA 4UUSA 2H8WA 4BJ6C 4XLPF 1PP7U 1KYZA 5F6FA 1W7PD 3BCAA 4CCLA 3PL8A 1TWHJ 4DZJA 1ZK8A 3DU5A 4C2MJ 3GF2A 4M73A 2L3DA 3DKYA 3F6VA 4L0ZB 1KQ0A 3OL4A 2ZKZA 5JVTA 2EBIA 2GOXB 2XAHA 3BY6A 4M3EA 2CFOA 3L09A 4X6AJ 2JVHA 4MEXF 2K4JA 4ESFA 5J8CA 3K4JA 3N4MA 4A3BJ 1Z7UA 3KE2A 1TWFJ 4NDLA 3F23A 5F64A 1FMWA 4KICA 2PMZA 3I56I 2W4SA 1BR2A 2VASA 3HOVJ 3WU0A 2L7KA 5TRDA 2GXGA 2LMDA 3TW6A 4W1UA 2VN2A 1BC7C 5LHIA 2R7OA 1SVLA 4G94A 4XONA 1F9NA 1JUMA 3CF5F 1SANA 2KKOA 3KYLA 3L2UA 4GO1A 4Y33A 2OPTA 3QPLA 3U1DA 2K9NA 3LMMA 4L5EA 3FWEA 1EJ9A 2JA2A 2R7SA 3KCCA 2GIVA 2KT0A 1D1BA 1MBFA 2QWWA 3FXKA 2CYYA 3HSRA 4JBAA 4D7MA 1LVAA 3CC2I 4MTEA 3ZPLA 4IEJA 3R60A 4XR6A 2E2HJ 2HYGD 2RN7A 4B44A 2ESHA 4RGRA 3Q0VA 1BR1A 2LRDA 2VKDA 2M4GA 2P5LC 3QQAA 1USTA 1UHWA 2XB0X 3ONQA 4CYCA 5FFXA 3ULQB 4LLNA 2OCEA 1TT5B 2QM3A 3G2BA 1Z7LA 2XPWA 1FOWA 2Y0SA 3PQKA 4EV0A 3CO7C 2Y0SN 2FOKA 4W97A 3MKWB 1GDTA 4A93J 2LP0A 4FE4A 4A0XA 3MZHA 1VQ5I 4JX4A 2HVSA 2G7HA 5B5EC 4EGYA 1E3OC 1B9MA 5CLSA 1B59A 2A6HF 2W1OA 2B0LA 2M5WA 4LOCA 1RKTA 1ZAOA 2R7QA 1OJLA 3M8FA 1ETQA 3M9AA 3TO6A 5GAHJ 3J80Z 4KNYA 1LQ1A 1Z05A 4BJTA 3BTJA 1S6LA 1YG2A 4BQQA 2M4KA 5J47A 5JHUA 4IHWA 1ZLJA 2FRHA 2DA5A 2FA5A 1FT9A 3E97A 2R92J 4RAFA 4PK4A 3G71I 1HC8A 4RLQA 2NVTJ 3RYPA 5H6QA 3OY9A 1ORKA 1S7OA 4YFXF 3OYNA 3D5RC 2JQ7A 1OLTA 1K6YA 1O4XA 3H3UA 3K9TA 3LOCA 4ZZDA 2ZMEC 1XPXA 2JPCA 3SDGA 1K6OA 2XRNA 2ELHA 4NC7A 5FROA 4A69C 1AKHB 4E7HA 2VPLA 3BPXA 5HS7A 3V42A 2QA4I 1XGOA 1U6GA 2K3PA 1ZN2A 3WTXC 4P1WA 2QSHX 2VQGA 2IS4A 2EFQA 4DQ2A 2GWRA 4ZYEA 2CH0A 1DUXC 3CDIA 4I98B 2BOLA 1RRJA 4YIIA 5IP9J 2ADUA 1O3SA 1YFHA 2W25A 2PEXA 4PDKA 1T0FC 1MDMB 4HQEA 1TC3C 2X4HA 2MBFA 2PX9A 3KP7A 3FXJA 3FXUA 1VQ4I 1X4PA 3G73A 2CU7A 2KL4A 4FT8A 1YIJI 1O7FA 3L00A 3RKYA 4A0YA 5DM7F 3KP2A 4HPQA 2K02A 2CW7A 1VQPI 3QOPA 2ME6A 4IHVA 3HJEA 2O0YA 3KEQA 1YW7A 4KN4X 4ETSA 4I76A 3F8CA 1P4WA 2ZJ2A 2HPMA 4GYGA 1OYWA 1AA7A 2D2WA 3E6CC 4XRFA 5H2FC 2JA6J 4D5FA 4LK0F 4LD5A 3G4SI 2Y48A 2P4WA 3RKQA 1V4RA 2GOMA 3OR2C 1FBUA 3RDIA 3OV8A 3WG7H 1ETYA 2EB7A 2ZNYA 1Z77A 1TQMA 1PUFA 3Q9VA 2Y69H 2PI0A 3OIPA 3MVPA 4RAZA 3CCEI 1QU3A 1UHMA 4KJZA 1VQ9I 4PJMA 1W4MA 5EZHA 3RPUD 2FBIA 4XLCA 2LBFA 3MEXA 4KN7X 5LEKA 4A5MA 1V55H 2F4OB 4LG0B 2LREA 2FOWA 2VJIA 2Z1DA 3ZQ7A 2WA0A 2XPVA 4H4KC 1O3RA 1AWCA 5D6EA 4ZC3A 4ZDPA 5KHDA 4MFDA 2UXXA 5GAGJ 3CJNA 2DOAA 1MH3A 2NVUB 1ZGAA 1B9NA 1FBSA 1OMIA 1XSVA 3WGGA 2XKPA 1VNDA 3FISA 2TCTA 4F3QA 1K78B 1UG2A 3PUBA 1ZYRF 3BG6A 1KQ8A 3F22A 3P9IA 4OIQF 3GCMA 3R0AA 2KDZA 2HVQA 1GUUA 2K3FA 3I0TA 4Y17A 2DMNA 1V54H 3NWSA 1R00A 2M2EA 2E1MC 2HS5A 2KIQA 1D0XA 1LVKA 2DU9A 3JRCA 1LFPA 1RI7A 4CA0A 4P96A 3LA2A 2HQNA 4ZJZA 5FJ8J 2XVCA 3VSKA 4ZTFA 2WWYA 3ECOA 2D45A 1D5VA 1ZLKA 2FUG2 2HWVA 3CDLA 4OIRF 3J7ZI 3BQZA 2DMQA 2I8DA 1YITI 4A3KJ 3CMYA 4NC6A 3I54A 1R9TJ 1ETWA 2LFBA 4HF2A 1W0TA 2VXZA 1WGXA 2YUSA 1V5EA 2JSPA 3N05A 4IKFA 1HXDA 3CCUI 1JGSA 2P6TA 2CV0A 2ISYA 2W82A 2FBKA 2QSFX 1IXCA 2DODA 1ZELA 1G4DA 3K4BA 4RAGA 3LA7A 1HF0A 1OFCX 2OQGA 2R5YA 1YJWI 1JUPA 2ZMEA 3H5RA 1H9TA 3GWZA 4BS9A 4E7ZA 4E7IA 1X2MA 4EMSA 2JRMA 2IT0A 4P9UA 1RNLA 2VE8A 4UV9A 1MMSA 1GXQA 1S72I 5HNFA 3TEDA 2E19A 3FMQA 3KP4A 2P0WA 3PFYA 3KZYA 1SMTA 2KRHA 1BOBA 1K78A 1ODDA 1AOYA 1OYYA 2XASA 3M7GA 2WV1A 3GZ6A 2COBA 1T0FA 3K7AJ 4FISA 1WZ2A 2ZXHA 5H20A 1V5FA 4HQMA 2H6BA 2ZB9A 5JFRA 3BJ6A 1AU7A 2JA8J 1W0UA 5EG0A 2W84A 4RAYA 2P5VA 2F2EA 3DBRB 2R5ZB 4MFEA 1PUEE 4ZDOA 5TJJA 3WGHA 2DQRA 2IEKA 3F6OA 1X3UA 3GMEA 3VYTB 5J1RA 1JT6A 5FKMA 2EIKH 3HB9A 1U9NA 2K7LA 3MQ0A 4XN0A 4IZZA 3ZQLA 1WH5A 2K9LA 3S2HJ 4F92B 3G1MA 3CTAA 2C6YA 2WAEA 3IP4B 1MGTA 4JX6A 3ZP5A 3G1LA 1FOKA 4BNCA 2LTPA 1D8KA 2V7FA 3ZN0A 2VE9A 2EINH 1DP7P 4B4CA 3LNQA 3BCBA 5CVJA 2L7FP 2BVLA 2EZKA 4G8XA 1UHSA 4BHBA 3V8JA 3CC4I 1WI9A 4UY8I 1J5YA 2KPMA 4RLFA 1SEUA 2OA4A 3DF8A 4JOMA 3CUQB 4QSHA 2DYSH 2HQ5A 1W1WE 1ZREA 2EIJH 1BIBA 1S7AA 2TRTA 3DTIA 2EFOA 3GBGA 4N9HA 1E17A 1IUFA 2GA2A 4E7KA 2ZXJA 1ETXA 2M0MA 2CGPA 3G1OA 3ROUA 3NAUA 1KU2A 4MQVA 2W57A 3GFLA 1GT0C 2DT5A 4RA2A 1HW1A 5EF6A 3CCVI 1D8JA 2CSOA 1XCVA 1J7KA 2IGMA 3BR3A 4UHTA 3RI4A 3HG9A 2OUMA 1T56A 4CH7A 3GTPJ 4U0YA 4LFUA 3LSRA 4A3DJ 3OYDA 1ZRFA 2AO9A 5L3GA 2CMPA 5E1XA 4G6QA 2PJRB 2ZXIA 3VODA 1ZH5A 5F08A 2VKHA 2DTZA 4S04A 3I59B 1KU3A 4ZDLA 2IA1A 4J19A 3ZQFA 5BNGA 5E3MA 4MGRA 2ECCA 1D0YA 3S1QJ 3HBLA 3VYUB 1BC8C 5C4XJ 3BZCA 2QENA 1I5ZA 2IGOA 4Y52J 3H35A 3BQYA 3F0CA 1VZ0A 2A6EF 3DLLF 3I9V2 2JVGA 2CQXA 2OJED 4DBRA 1FX7A 2CUFA 4QWQA 4E4HA 5DEQA 1Z0XA 5LRRA 2FNAA 4B3XA 2HVRA 2KIMA 2MSYA 1R5GA 2AXTC 3AG4H 1WJAA 2IGNA 4F55A 1JKOC 1RKWA 2DOEA 5K5RA 1EKEA 2O03A 4IL6C 2BY3A 1ZQ3P 4ITVA 1QVUA 1AHDP 3TOAA 1IUYA 2O61A 1W36C 1BI2A 4G9YA 3JRIA 5M5WJ 1I1GA 5KVRA 1TQPA 2DYRH 5ICEA 1ON2A 4HLYA 4GFBA 1Z67A 1P92A 3A4CA 1FNNA 5FLMJ 5FLXK 3FXOA 4XKWA 4AVZA 1S5LC 4O6JA 1VQMI 1EH8A 2DA1A 2HGCA 2Y2ZA 3ECHA 2MYSA 2F48A 1T8IA 4G7HF 3JRDA 1UMQA 1R5ID 2R93J 4LIUA 4DYRA 1JKPC 5J4YA 2CFXA 3V7SA 1LEAA 3VSLA 3RZOJ 3AFHA 3RYRA 2PJRA 1X3WB 1KYWA 4C3JJ 3HRTA 2M9HA 3OIQA 2XAFA 3HGYA 3PNTA 2A07F 3HXLA 3QOEA 1SVMA 1RUNA 3BP8A 4YRVA 4CO8A 3K4CA 2E5ZA 2Q0OA 1E3PA 2E7WA 2HZTA 5IP7J 4FTHA 4F7ZA 2YS9A 1USSA 3E7LA 3IH2A 2V1DA 4ZYAA 1MNDA 2V26A 1ERDA 3GTQJ 3RQIA 2EWNA 1YX3A 4HNVA 5HLGA 4RDUA 2HI3A 2GA1A 2FJ1A 1QZZA 3HPHA 1FJLA 3DPTA 2JN6A 3GTJJ 2E2JJ 3B73A 3I5UA 5ERIA 3RTRA 5LFAA 1SC7A 2UV1A 1FSEA 4N4NB 2PG4A 4HV5A 3EUAA 5D4SA 3CD6I 1R23A 3KZIC 1X1BA 1CF7A 1WFXA 2FXAA 4XL9A 5AIQA 2YR2A 4EM1A 3K1MA 3HTUA 4WCGA 1TWCJ 4AVPA 5KK1A 2Y9ZA 4D7NA 3OYLA 1D5YA 4S0HB 2BV6A 2LY2A 5JVGF 2WC2A 4BEHA 3JSPA 2CUEA 4HV6A 5CYVA 2RGVA 4XM3A 4B47A 1Q1HA 3LWFA 5B1AH 2WY7Q 3E6BA 3KP5A 3CDHA 4PGGA 2NAZA 3FZVA 1TQIA 5L3CA 2ISZA 3HSEA 5CQEA 3V4GA 4XRSA 3J80K 4YIRX 2XGEA 3F21A 2XRLA 1A5JA 4Y4RA 4QPOA 2XGDA 1Y56A 4EQQA 2RNJA 3D1NI 2IS2A 2MH9A 2XAJA 2E71A 2DA2A 3F8NA 1OQYA 3GLXA 3LAJA 3S1RJ 5FRMA 3MCZA 2HYJA 2NRAC 2J5OA 3S17J 3FXRA 2FX0A 3S3OA 2BBYA 3V8KA 4IQ4A 4BH9A 2HNHA 3REOA 3H5AA 4OU0A 5BPIA 2IRFG 4KFCA 5EEGA 2EFPA 1LDDA 2DFIA 3VB2A 1UCRA 2M1BA 3KIOA 5KAIC 1B8IA 2OF7A 3ESWB 1YX5A 2JA5J 2EILH 2FEZA 1YYVA 4O3MA 1TWGJ 3CCYA 3HOZJ 2DMUA 4L9TA 4B1RA 3K69A 4CYCB 2KLOA 3JCUC 3MMYB 2VKEA 1O3TA 4LB5A 4FX0A 3OYJA 4ENMA 1L0OC 5M3MJ 2GBYA 4I09A 4BXFA 4I99C 2EA2A 3M8EA 5HLTA 1R7JA 3L1PA 4A6DA 1GLNA 1WJ5A 2FQ4A 3TQNA 1MSEC 1FIAA 4BKXA 3KLNA 4YEJA 4E70A 1GXPA 5E3OA 2M87A 3DFGA 1X58A 1XMAA 2LDUA 4I0BA 4CXFA 3S3MA 1MMDA 4WWCA 1B4AA 3H9JA 3IH4A 5FLXZ 2WAFA 1JUSA 3ZOBA 3BR2A 3GEZA 4U0WA 4HX8A 2QSGX 5CPRB 3ERED 2XAQA 4MHGA 1X1PA 2M8GX 3ABKH 4OWRB 5DCFA 4IQJA 4C3IJ 4II2A 1SD6A 3W2AA 1HSTA 4HSRA 3WG9A 3CO6C 4BYYA 2HZDA 1JKQC 4RB3C 4M72A 5EJCA 5CKTA 1RR7A 3QYFA 4Q47A 2B9SA 4FE7A 1YE9A 5E1WA 2MGQA 1F5TA 3E5QA 5HLHA 2IS6A 2MD5A 4ON0A 1E3HA 2VXDA 4BHPA 1J59A 5E8IA 1VI0A 2E60A 4UVBA 2Q2EA 1LEBA 2F5FA 4MO7A 5LGTA 4EJUA 4XSXF 5F0CA 3E1SA 4IJAA 5LHHA 2LG4A 1JXSA 4FQGA 5M5XJ 5FD6A 1VQLI 5J3LA 2HU9A 2MA3A 3HUGA 2QUFA 2EIMH 4RMNA 2M7BA 3CJTB 1WKMA 4XSZF 1I1SA 2L7MP 4LK1F 1C0WA 1NG7A 1O57A 1IDYA 1UB9A 2JPBA 1WJBA 2CS3A 3BLYA 4M3BA 2IVMA 2UWMA 2VJ5A 4KYWA 1A36A 5C4JJ 3CLQA 2KISA 1KGSA 2NS7A 2EV0A 2PMHA 4L9JA 3CLOA 4XNFA 1OCCH 3RKXA 2IXSA 2CW8A 2R7DA 4ESBA 2RC4A 4CCOA 2HEOA 1GV5A 5LRSA 3BTIA 2BHYA 5CVUA 5DS9A 3CP8A 1TBXA 4HDUA 2CJJA 2JUGA 1K79A 5C3EJ 2KP6A 2HOEA 4Y13A 2R7TA 4ZYHA 1JI8A 3OYCA 3SZPA 2EZHA 1EH6A 2JMWA 4ZZLA 4NBQA 2DA3A 3KEOA 3SZTA 4ENKA 4E6KG 3MAJA 2NOJB 1PUFB 1A6QA 3PNYA 3HYIA 3QPHA 2H09A 3VYRB 1YTYA 3CCMI 2XPUA 5GTIC 4AWXB 3QP5A 3WU2C 4HNTA 2L4MA 4D0PA 3BWGA 1XMKA 4EGZA 4PJ0C 1YQAA 2J5PA 2LBFB 3DXJF 3DEEA 1BIAA 3LSHA 4UXNA 1LKXA 2MLGA 2HOTA 4A3CJ 1U5TA 1H0MA 4E7JA 2EQRA 1CGPA 3C2GA 2HDDA 1P4AA 1TT0A 2KRFA 3GVAA 3TBIA 5BQTA 3KPHA 3VDXA 1WJFA 1Y1WJ 1Y0NA 5GTHC 4UUTA 4CCKA 2VQLA 1LPQA 3SDBA 4XQFA 3I71A 4D5CA 1SFXA 3AG1H 1KU7A 4RBOA 1MJ9A 1G3WA 2NVYJ 2A5YB 4XK4A 3SHFA 4DNCA 2P7CB 2EZIA 2PFBA 3FXMA 2H94A 3IRQA 2R7RA 1LFBA 1TWAJ 2HQRA 3R0JA 5CVIA 2LKSA 4M9XA 4HW0A 3BPVA 4Q48A 5HOOA 2EA4A 1MZBA 2KQRA 1MJBA 2HKOA 3QU3A 1FP2A 1JGGA 2CQNA 1WVRA 2IPQX 1PJRA 3ZXSA 3ZMTA 3AL0C 2ZO4A 4O5VA 4RS8A 2HKXA 3W6KB 3K70C 2X48A 2DMTA 2R7ZJ 4R79A 4K2EA 3PIOF 5KAFC 3IWFA 2ESNA 5TISC 1ZHFA 1X2NA 2R0QC 3K0LA 4M9ZA 2XC7A 4HDVA 4NUBA 1WQ2A 1JTXA 3JW4A 2R5YB 4XKBA 1ZR2A 2CQ7A 4V19K 4HX4A 4LLGF 2XGXA 2GZWA 4CICA 1FY7A 2ZMEB 1X1DA 4XN3A 4LGWA 4KIBA 1FWZA 5K5QA 5LEJA 2M45A 1RETA 1IO2A 4M6XA 2ZJQF 3VYSB 1BJZA 1WCMJ 2V9KA 3DBLB 4KIGA 4XLEA 1GVJA 2ZSHB 4YELA 2YPRA 1N78A 1JTYA 1OR7C 3GW2A 3TMOA 3CZ6A 2COMA 1Z1DA 1P4XA 2LVSA 2OZ6A 2MABA 4TV7A 2VBZA 2XF7A 3M07A 5E3NA 3A2KA 2JT1A 1OCTC 3UR3C 3KP6A 2P81A 3A0HC 5KCMA 2H6CA 3RPQA 2OQRA 5B3SH 4GDFA 5IYCJ 3NQOA 3QWLA 4CGZA 3S2WA 3BG5A 4OINF 2R7WA 3U2RA 5EG0B 2QQBA 4XMYA 1SD5A 3BTCA 2UZKA 1SAXA 3OSGA 1IN5A 1VQ8I 3MFKA 4AIHA 2CO5A 2V6CA 1X1CA 1BI1A 1FIPA 4JP0A 1MMGA 1MBHA 4BAYA 3JRHA 2BZTA 1VQOI 4IHTA 3R6SA 1IZ1A 4L18B 5ICCA 4A6EA 1I6XA 2MD0A 2ETHA 3RQ4A 4OIPF 2JRTA 2WADA 3E6MA 2FQ3A 5L3FA 3O8HA 1TW2A 2Z9OA 3I4NJ 3BOQA 2E34A 5EEAA 4R8HA 3GFIA 4XKCA 2LD5A 2LNBA 3S3NA 2VC1A 2VUMJ 1G2HA 4OOIA 1G3YA 3A01A 1ZRCA 4UB8C 2X51A 2CRGA 3RCOA 5ILVA 1IC8A 2V1UA 5CVVA 1HOMA 2DDBA 1PYVA 2KFDA 2H8RA 3BG3A 1VQNI 1OCRH 1P6RA 2DXIA 3B6CA 2BY1A 3S16J 1U8RA 2I5UA 4HZFA 3S93A 3JAMK 5B1BH 3UNGC 3QPSA 3OYMA 2HR3A 3BROA 3GZ5A 4CSWA 1J0RA 4IF4A 2XAUA 3L2QA 2QYOA 4B09A 1JHFA 4PCQA 1TLHB 4U7DA 1G6NA 1R1UA 2IJLA 2PMUA 1X19A 5EYRA 3PSIA 3GUDA 4A3EJ 3B02A 3PUFA 4U0VA 2Z5UA 1JHHA 2O5RA 3U1KA 4CZZA 3NARA 1NHAA 1XDSA 2JA7J 2E1MB 3QYBA 2VLAA 4DOZA 3CMAI 4AYBN 3HRUA 5J1YA 1EA3A 2IA2A 3ABLH 3HC7A 3LSTA 1LUJB 3H0DA 2ZCWA 2CUJA 4M71A 4NQWA 4M6YA 3NEUA 2P6SA 3DQVC 4OAZA 2DMPA 2VONA 5E18F 2RV8A 4RGXA 3DU6A 1VQ6I 3H3VK 2BXZA 4D9JA 2LF8A 4Y7NJ 1DPRA 4XLHA 5CQGA 2F4MB 3Q3SA 3L2CA 2AQFA 1I50J 3KZZA 4XICA 2VPRA 2A6TA 2FE3A 2PBIA 5DD8A 3TL4X 2G7UA 4A3FJ 3W6VA 3DKXA 1Y6IA 1FEXA 3HIFA 4MIMA 2YX4A 3EQLF 1JJ6C 2K85A 1RUOA 3KP3A 1W5SA 2H27A 3E6DA 1FYMA 5J1UA 2Y0MA 2A68F 3EYIA 3K4KA 2OZUA 5EEHA 1QZYA 3I53A 4I0AA 5DCMA 3KLOA 3CCSI 1DGWY 2F6CA 3D5LA 3AG3H 3BR5A 2HQAA 1YS6A 3LQRA 4DBQA 1G59A 1UAAA 3C18A 4BU2A 4LB6B 1IV6A 1OCOH 3BZKA 1ETKA 3K4MA 1OR7A 5F0FA 1RC9A 3L2RA 1U3EM 3K2ZA 2ZBKA 1TP4A 5AIPA 1QO0D 2JJ7A 4ENNA 1G8XA 3WTSC 1MW7A 3KETA 3PFIA 2KZVA 4MNUA 2Q1ZB 3M1CA 1XMXA 1F1ZA 2XDVA 1TW3A 4KDPA 3QODA 4P55A 3L2VA 3HOXJ 4RB2C 1H89C 5D5XB 2JWTA 2KDOA 4A0ZA 2L2OA 3OS0A 1J2XA 3HOTA 2KHMA 3TP3A 1ULYA 1SD7A 5FO5A 1JT0A 3IUOA 1F36A 2GM4A 2X6YA 1WJDA 2IGKA 1T38A 3LFUA 3GTLJ 5LD2C 4GCVA 3BR0A 2CUZA 1H8AC 4G6DA 5LGNA 2FD5A 1Z91A 4XKVA 1R1VA 2DT6A 3SFZA 3H3ZA 1KU9A 1H9GA 4N9IA 5JHFA 2NS0A 1UJ8A 1K4SA 5D8KB 1XSDA 1WPKA 3F8MA 1OISA 3AG2H 3L7WA 2OCCH 2FMLA 4V2GA 2QCOA 2QGUA 4PZJA 5HVQC 4G7ZF 1ZGJA 1R6RA 2VJ4A 4CCNA 3C7JA 1IRFA 2RKHA 4ZYDA 2R4GA 4JQFA 5HNHA 2HPIA 4LJZF 2WTEA 3JAMZ 4M74A 5D8LB 3JTGA 2VC0A 5DDGA 5J8FA 3ZMVA 2QQ9A 3S1NJ 2W00A 1YIOA 3K2AA 4U88A 4KA4A 2DAOA 2Z33A 3RZDJ 1DDNA 4AC0A 1WJEA 2V79A 4DYQA 1CF7B 4EATA 1E2XA 2OTJI 1BI0A 5GPCA 1SFOJ 4UUVA 2L7ZA 1Z3YA 1BW6A 3BTLA 4XIDA 1NH3A 2V9VA 1MIJA 3FMSA 4UNOA 1MNEA 4ZYGA 2BHZA 1ZR4A 4BL0B 1I6HJ 3IHUA 4BEHB 1N25A 3QRFF 2ELKA 3CJQB 3V8LA 3MZ8A 5BOXA 2O6GE 4HRIA 1XTAA 2K40A 3K6GA 2VL8A 4GRIA 3T0YA 1REPC 4AUXA 1Z3XA 3M1EA 3S2DJ 3CQZJ 3OIOA 4QLCU 3F8FA 2R7VA 1TNTA 3BJAA 3OWTA 1QNTA 3C3WA 1TNSA 4A3JJ 2BEOA 4KISA 5FKLA 2E36A 3LL7A 4DZPA 4C2TA 2AHQA 1XN7A
chains in the Genus database with same CATH topology
1MH4A 2ME6A 4IHVA 3JRAA 2M8GX 2NS8A 3Q0UA 4C3IJ 4I76A 5C44J 1JKQC 1P7JA 4BBSJ 5F04A 2DA7A 2JA6J 4D5FA 1BA5A 1RR7A 4JYKA 3SFIA 3RKQA 3BT9A 4FE7A 1B8IB 2MGQA 1BL0A 5EZGA 1ETYA 1Z77A 4QIWN 2LLKA 5IPAA 1PUFA 1VI0A 2W48A 3MVPA 3JRFA 4MO7A 3OSFA 2DJNA 5K7ZA 5F0CA 3DCFA 2QF7A 5EZHA 5M5XJ 3A02A 2EZLA 1B72B 5J3LA 2WB1N 5FKKA 5JLXA 2XPVA 5K7HA 2RAEA 2L7MP 4MFDA 1MH3A 1IDYA 2GLOA 2LKXA 3MN2A 1VNDA 3FISA 1NTCA 2TCTA 4M3BA 1UG2A 5C4JJ 5F1JA 3LSJA 2NS7A 1EF4A 3SJMA 1MBGA 1HDDC 2KDZA 3FIWA 1GUUA 1GV5A 2JK3A 2DMNA 3BTIA 5DS9A 3ZQCA 2M2EA 2CJJA 1RPWA 4I6ZA 5C3EJ 1QPIA 3JRCA 3FK7A 5K7FA 2EZHA 2DN0A 5E3LA 2O7OA 4MLOA 5GP9A 2JMWA 5FJ8J 2DA3A 3LSGA 3I4MJ 1PUFB 3CDLA 2MG4A 1FTZA 3BQZA 2DMQA 2XSDC 1U9OA 2XPUA 4A3KJ 2R5ZA 2XGCA 3LSPA 1HLVA 3IV5A 1H88C 1HDPA 3CMYA 1U78A 1GVDA 1R9TJ 1ETWA 3A03A 2LFBA 4M3GA 2K9SA 1RESA 4A3LJ 1W0TA 3O8GA 1WGXA 2YUSA 3C2BA 2HOTA 1GV2A 4A3CJ 2VKVA 2DA4A 5JLWA 2EQRA 4V2FA 2HDDA 5FKNA 1HF0A 5IOZA 1OFCX 2R5YA 5M5YJ 3IH3A 1Y1WJ 4BXXJ 4QTRA 1JUPA 4UUTA 5HODA 1MBKA 1X2MA 1B72A 4D5CA 4ABZA 2HXOA 1I3QJ 4RBOA 2NVYJ 4XK4A 2EH3A 2EZIA 3PM1A 3TEDA 2E19A 4C3HJ 2ME0A 5FLVA 5IOYA 5GPAA 1LFBA 3PO3J 1Q1VA 1TWAJ 1P7IA 2ID6A 3GTKJ 2WV1A 2COBA 2D5VA 3K7AJ 4FISA 1CQTA 1WI3A 2ZB9A 1JGGA 1AU7A 2JA8J 1W0UA 5F0HA 5EG0A 1XC5A 2R5ZB 3BR1A 4MFEA 4M6VA 3FK6A 2X48A 1XG1A 5IP6A 2DMTA 2X9DA 2Y30A 2IEKA 4DW6A 2WAQN 2R7ZJ 3HKZN 5J1RA 1JT6A 3HOYJ 5FKMA 2DA6A 1U9NA 3HB9A 3S2HJ 3ZQLA 1WH5A 1X2NA 3TW7A 2R0QC 3G1MA 2N8GA 4JX6A 1JTXA 3G1LA 1ZTRA 1MSFC 2LTPA 3HM5A 4A3IJ 2R5YB 2K9QA 5FKOA 1ZR2A 2PMZN 1FTTA 3DEWA 2M34A 3JREA 4B4CA 4M3DA 3LNQA 1RETA 2I10A 2L7FP 2EZKA 1BJZA 5IYDJ 1UHSA 1WCMJ 1VFCA 3HOWJ 1QVTA 1S7EA 3GTOJ 1JTYA 1LE8A 2LVSA 4QSHA 4B3AA 2HQ5A 2O8KA 2B63J 5E3NA 1OCTC 1IJWC 3GBGA 2TRTA 2P81A 1Y1VJ 1IUFA 1F43A 1QRYA 5IYCJ 1ETXA 3BG5A 3G1OA 3MKLA 3NAUA 3S15J 4UUSB 5EG0B 3BTCA 1GT0C 1IG7A 2LR8A 5EF6A 3OSGA 1POGA 1A6IA 1BW5A 4BBRJ 1JJ8C 3JR9A 1WH7A 1FIPA 3BR3A 4JP0A 1MBHA 1ITYA 3JRHA 1T56A 1ZKGA 3GTPJ 5EGOA 3LSRA 3ZQIA 4A3DJ 2X6OA 2AO9A 2ECBA 3O8HA 3JRGA 3I4NJ 5EEAA 5F08A 2LD5A 2VUMJ 2DTZA 1G2HA 4M3FA 3PO2J 3A01A 2LY9A 1IRZA 1K83J 2CRGA 3TP0A 4J19A 3ZQFA 5BNGA 5E3MA 1MBEA 1T33A 1IC8A 2ECCA 1HOMA 3S1QJ 3HBLA 5IYBJ 2H8RA 5C4XJ 3BG3A 5DTDA 3B6AA 1LE8B 1VF9A 3B6CA 3S16J 4Y52J 3BQYA 4XRMA 4EEFG 3F0CA 1NK3P 3QPSA 3OOUA 2H1KA 2CQXA 1OCPA 3HGGA 3M4OJ 2E2IJ 2CUFA 2ID3A 1Z0XA 1ETVA 2NVXJ 4A3GJ 4FCYA 2MSYA 4XRSG 3HDDA 1JKOC 3VPRA 5EYRA 1RKWA 4A3EJ 3ZQGA 1ZQ3P 3S1MJ 1QVUA 2LK2A 3NARA 1ENHA 2JA7J 1AHDP 2XB5A 4A3MJ 5EGOB 4AYBN 5M3FJ 5J1YA 3JRIA 5M5WJ 4UUSA 1MNMC 4GFBA 1TWHJ 3BG9A 4DZJA 1ZK8A 4C2MJ 2Y31A 5FLMJ 2DMPA 3JRBA 1HCRA 1DU6A 3A01B 2EBIA 4M3EA 3GTMJ 3H3VK 4X6AJ 4Y7NJ 2DA1A 2Y2ZA 3Q0WA 4A3BJ 3Q3SA 2HXIA 1TWFJ 4NDLA 1I50J 1UMQA 4X1EA 3JRDA 4XICA 2VPRA 3FKIJ 2R93J 4A3FJ 1JKRC 4DYRA 1JKPC 3W6VA 3RZOJ 1FEXA 2VI6A 3HOVJ 3BR6A 4MIMA 4C3JJ 2M9HA 2L9RA 3HGYA 1JJ6C 2NVQJ 3TW6A 4W1UA 1MBJA 5J1UA 1JUMA 1SANA 2OPTA 3QPLA 2E1OA 2K9NA 4L5EA 5IP7J 4FTHA 5EDNA 3BR5A 2YS9A 2IBDA 2KT0A 3E7LA 3IH2A 1YRNB 2MW8A 1MBFA 4D7MA 1IV6A 1ETKA 3GTQJ 3RQIA 4RDUA 4HNVA 4IEJA 2HI3A 5F0FA 2E2HJ 2FJ1A 1FJLA 2JN6A 3GTJJ 2E2JJ 2HOSA 2JJ7A 3Q0VA 1DU0A 4JX5A 1IGNA 2NOGA 3M3YJ 3QQAA 2XB0X 1AKHA 4CYCA 3WHCA 3UKGA 1LFUP 3HOXJ 1H89C 4BY1J 2JWTA 1TWCJ 2XPWA 4IHYA 2Y0SN 4W97A 2Y9ZA 3TP3A 4D7NA 1GDTA 4A93J 1JT0A 2LP0A 4FE4A 4BY7J 4S0HB 1D5YA 1F36A 2GM4A 2CUEA 4JX4A 4IHXA 1APLC 3GTLJ 1E3OC 4DYCA 1H8AC 3BR0A 4XRSA 2FD5A 4LOCA 2Y9YA 1RKTA 2XGEA 1A5JA 1OJLA 2XRLA 1ETQA 2XGDA 3D1NI 3BTJA 1WPKA 2DA2A 4V2GA 2QCOA 1ZGWA 4IHWA 2DA5A 2R92J 3S1RJ 3S17J 2HYJA 2FX0A 2NVTJ 1ORKA 4G12A 2CQQA 2G0EA 1NK2P 3H0GJ 1B8IA 2JA5J 2OF7A 1O4XA 3S1NJ 3HEFA 2YU9J 3K2AA 9ANTA 3LOCA 1TWGJ 3RZDJ 1U8BA 3CCYA 4AC0A 4DYQA 3HOZJ 3SDGA 2DMUA 3ZQHA 4B1RA 4A69C 1AKHB 4CYCB 5GPCA 1SFOJ 3S14J 2L7ZA 2VKEA 1YRNA 1BW6A 2L0KA 3BTLA 4XIDA 5M3MJ 2GBYA 3WHBA 1ZR4A 1I6HJ 1XS9A 3L1PA 3GTGJ 2IAIA 2ELKA 5IP9J 2O9LA 2FQ4A 1MSEC 1IDZA 2K40A 1K61A 1FIAA 4BKXA 1ETOA 4AUXA 3S2DJ 3CQZJ 3OIOA 1TC3C 2HOAA 5E3OA 4A3JJ 1X58A 3HOUJ 2CU7A 5FKLA 3IH4A 4DZPA 5F27A 1JUSA 2AHQA 3ZOBA 3BR2A 2M0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH4 A;  2ME6 A;  4IHV A;  3JRA A;  2M8G X;  2NS8 A;  3Q0U A;  4C3I J;  4I76 A;  5C44 J;  1JKQ C;  1P7J A;  4BBS J;  5F04 A;  2DA7 A;  2JA6 J;  4D5F A;  1BA5 A;  1RR7 A;  4JYK A;  3SFI A;  3RKQ A;  3BT9 A;  4FE7 A;  1B8I B;  2MGQ A;  1BL0 A;  5EZG A;  1ETY A;  1Z77 A;  4QIW N;  2LLK A;  5IPA A;  1PUF A;  1VI0 A;  2W48 A;  3MVP A;  3JRF A;  4MO7 A;  3OSF A;  2DJN A;  5K7Z A;  5F0C A;  3DCF A;  2QF7 A;  5EZH A;  5M5X J;  3A02 A;  2EZL A;  1B72 B;  5J3L A;  2WB1 N;  5FKK A;  5JLX A;  2XPV A;  5K7H A;  2RAE A;  2L7M P;  4MFD A;  1MH3 A;  1IDY A;  2GLO A;  2LKX A;  3MN2 A;  1VND A;  3FIS A;  1NTC A;  2TCT A;  4M3B A;  1UG2 A;  5C4J J;  5F1J A;  3LSJ A;  2NS7 A;  1EF4 A;  3SJM A;  1MBG A;  1HDD C;  2KDZ A;  3FIW A;  1GUU A;  1GV5 A;  2JK3 A;  2DMN A;  3BTI A;  5DS9 A;  3ZQC A;  2M2E A;  2CJJ A;  1RPW A;  4I6Z A;  5C3E J;  1QPI A;  3JRC A;  3FK7 A;  5K7F A;  2EZH A;  2DN0 A;  5E3L A;  2O7O A;  4MLO A;  5GP9 A;  2JMW A;  5FJ8 J;  2DA3 A;  3LSG A;  3I4M J;  1PUF B;  3CDL A;  2MG4 A;  1FTZ A;  3BQZ A;  2DMQ A;  2XSD C;  1U9O A;  2XPU A;  4A3K J;  2R5Z A;  2XGC A;  3LSP A;  1HLV A;  3IV5 A;  1H88 C;  1HDP A;  3CMY A;  1U78 A;  1GVD A;  1R9T J;  1ETW A;  3A03 A;  2LFB A;  4M3G A;  2K9S A;  1RES A;  4A3L J;  1W0T A;  3O8G A;  1WGX A;  2YUS A;  3C2B A;  2HOT A;  1GV2 A;  4A3C J;  2VKV A;  2DA4 A;  5JLW A;  2EQR A;  4V2F A;  2HDD A;  5FKN A;  1HF0 A;  5IOZ A;  1OFC X;  2R5Y A;  5M5Y J;  3IH3 A;  1Y1W J;  4BXX J;  4QTR A;  1JUP A;  4UUT A;  5HOD A;  1MBK A;  1X2M A;  1B72 A;  4D5C A;  4ABZ A;  2HXO A;  1I3Q J;  4RBO A;  2NVY J;  4XK4 A;  2EH3 A;  2EZI A;  3PM1 A;  3TED A;  2E19 A;  4C3H J;  2ME0 A;  5FLV A;  5IOY A;  5GPA A;  1LFB A;  3PO3 J;  1Q1V A;  1TWA J;  1P7I A;  2ID6 A;  3GTK J;  2WV1 A;  2COB A;  2D5V A;  3K7A J;  4FIS A;  1CQT A;  1WI3 A;  2ZB9 A;  1JGG A;  1AU7 A;  2JA8 J;  1W0U A;  5F0H A;  5EG0 A;  1XC5 A;  2R5Z B;  3BR1 A;  4MFE A;  4M6V A;  3FK6 A;  2X48 A;  1XG1 A;  5IP6 A;  2DMT A;  2X9D A;  2Y30 A;  2IEK A;  4DW6 A;  2WAQ N;  2R7Z J;  3HKZ N;  5J1R A;  1JT6 A;  3HOY J;  5FKM A;  2DA6 A;  1U9N A;  3HB9 A;  3S2H J;  3ZQL A;  1WH5 A;  1X2N A;  3TW7 A;  2R0Q C;  3G1M A;  2N8G A;  4JX6 A;  1JTX A;  3G1L A;  1ZTR A;  1MSF C;  2LTP A;  3HM5 A;  4A3I J;  2R5Y B;  2K9Q A;  5FKO A;  1ZR2 A;  2PMZ N;  1FTT A;  3DEW A;  2M34 A;  3JRE A;  4B4C A;  4M3D A;  3LNQ A;  1RET A;  2I10 A;  2L7F P;  2EZK A;  1BJZ A;  5IYD J;  1UHS A;  1WCM J;  1VFC A;  3HOW J;  1QVT A;  1S7E A;  3GTO J;  1JTY A;  1LE8 A;  2LVS A;  4QSH A;  4B3A A;  2HQ5 A;  2O8K A;  2B63 J;  5E3N A;  1OCT C;  1IJW C;  3GBG A;  2TRT A;  2P81 A;  1Y1V J;  1IUF A;  1F43 A;  1QRY A;  5IYC J;  1ETX A;  3BG5 A;  3G1O A;  3MKL A;  3NAU A;  3S15 J;  4UUS B;  5EG0 B;  3BTC A;  1GT0 C;  1IG7 A;  2LR8 A;  5EF6 A;  3OSG A;  1POG A;  1A6I A;  1BW5 A;  4BBR J;  1JJ8 C;  3JR9 A;  1WH7 A;  1FIP A;  3BR3 A;  4JP0 A;  1MBH A;  1ITY A;  3JRH A;  1T56 A;  1ZKG A;  3GTP J;  5EGO A;  3LSR A;  3ZQI A;  4A3D J;  2X6O A;  2AO9 A;  2ECB A;  3O8H A;  3JRG A;  3I4N J;  5EEA A;  5F08 A;  2LD5 A;  2VUM J;  2DTZ A;  1G2H A;  4M3F A;  3PO2 J;  3A01 A;  2LY9 A;  1IRZ A;  1K83 J;  2CRG A;  3TP0 A;  4J19 A;  3ZQF A;  5BNG A;  5E3M A;  1MBE A;  1T33 A;  1IC8 A;  2ECC A;  1HOM A;  3S1Q J;  3HBL A;  5IYB J;  2H8R A;  5C4X J;  3BG3 A;  5DTD A;  3B6A A;  1LE8 B;  1VF9 A;  3B6C A;  3S16 J;  4Y52 J;  3BQY A;  4XRM A;  4EEF G;  3F0C A;  1NK3 P;  3QPS A;  3OOU A;  2H1K A;  2CQX A;  1OCP A;  3HGG A;  3M4O J;  2E2I J;  2CUF A;  2ID3 A;  1Z0X A;  1ETV A;  2NVX J;  4A3G J;  4FCY A;  2MSY A;  4XRS G;  3HDD A;  1JKO C;  3VPR A;  5EYR A;  1RKW A;  4A3E J;  3ZQG A;  1ZQ3 P;  3S1M J;  1QVU A;  2LK2 A;  3NAR A;  1ENH A;  2JA7 J;  1AHD P;  2XB5 A;  4A3M J;  5EGO B;  4AYB N;  5M3F J;  5J1Y A;  3JRI A;  5M5W J;  4UUS A;  1MNM C;  4GFB A;  1TWH J;  3BG9 A;  4DZJ A;  1ZK8 A;  4C2M J;  2Y31 A;  5FLM J;  2DMP A;  3JRB A;  1HCR A;  1DU6 A;  3A01 B;  2EBI A;  4M3E A;  3GTM J;  3H3V K;  4X6A J;  4Y7N J;  2DA1 A;  2Y2Z A;  3Q0W A;  4A3B J;  3Q3S A;  2HXI A;  1TWF J;  4NDL A;  1I50 J;  1UMQ A;  4X1E A;  3JRD A;  4XIC A;  2VPR A;  3FKI J;  2R93 J;  4A3F J;  1JKR C;  4DYR A;  1JKP C;  3W6V A;  3RZO J;  1FEX A;  2VI6 A;  3HOV J;  3BR6 A;  4MIM A;  4C3J J;  2M9H A;  2L9R A;  3HGY A;  1JJ6 C;  2NVQ J;  3TW6 A;  4W1U A;  1MBJ A;  5J1U A;  1JUM A;  1SAN A;  2OPT A;  3QPL A;  2E1O A;  2K9N A;  4L5E A;  5IP7 J;  4FTH A;  5EDN A;  3BR5 A;  2YS9 A;  2IBD A;  2KT0 A;  3E7L A;  3IH2 A;  1YRN B;  2MW8 A;  1MBF A;  4D7M A;  1IV6 A;  1ETK A;  3GTQ J;  3RQI A;  4RDU A;  4HNV A;  4IEJ A;  2HI3 A;  5F0F A;  2E2H J;  2FJ1 A;  1FJL A;  2JN6 A;  3GTJ J;  2E2J J;  2HOS A;  2JJ7 A;  3Q0V A;  1DU0 A;  4JX5 A;  1IGN A;  2NOG A;  3M3Y J;  3QQA A;  2XB0 X;  1AKH A;  4CYC A;  3WHC A;  3UKG A;  1LFU P;  3HOX J;  1H89 C;  4BY1 J;  2JWT A;  1TWC J;  2XPW A;  4IHY A;  2Y0S N;  4W97 A;  2Y9Z A;  3TP3 A;  4D7N A;  1GDT A;  4A93 J;  1JT0 A;  2LP0 A;  4FE4 A;  4BY7 J;  4S0H B;  1D5Y A;  1F36 A;  2GM4 A;  2CUE A;  4JX4 A;  4IHX A;  1APL C;  3GTL J;  1E3O C;  4DYC A;  1H8A C;  3BR0 A;  4XRS A;  2FD5 A;  4LOC A;  2Y9Y A;  1RKT A;  2XGE A;  1A5J A;  1OJL A;  2XRL A;  1ETQ A;  2XGD A;  3D1N I;  3BTJ A;  1WPK A;  2DA2 A;  4V2G A;  2QCO A;  1ZGW A;  4IHW A;  2DA5 A;  2R92 J;  3S1R J;  3S17 J;  2HYJ A;  2FX0 A;  2NVT J;  1ORK A;  4G12 A;  2CQQ A;  2G0E A;  1NK2 P;  3H0G J;  1B8I A;  2JA5 J;  2OF7 A;  1O4X A;  3S1N J;  3HEF A;  2YU9 J;  3K2A A;  9ANT A;  3LOC A;  1TWG J;  3RZD J;  1U8B A;  3CCY A;  4AC0 A;  4DYQ A;  3HOZ J;  3SDG A;  2DMU A;  3ZQH A;  4B1R A;  4A69 C;  1AKH B;  4CYC B;  5GPC A;  1SFO J;  3S14 J;  2L7Z A;  2VKE A;  1YRN A;  1BW6 A;  2L0K A;  3BTL A;  4XID A;  5M3M J;  2GBY A;  3WHB A;  1ZR4 A;  1I6H J;  1XS9 A;  3L1P A;  3GTG J;  2IAI A;  2ELK A;  5IP9 J;  2O9L A;  2FQ4 A;  1MSE C;  1IDZ A;  2K40 A;  1K61 A;  1FIA A;  4BKX A;  1ETO A;  4AUX A;  3S2D J;  3CQZ J;  3OIO A;  1TC3 C;  2HOA A;  5E3O A;  4A3J J;  1X58 A;  3HOU J;  2CU7 A;  5FKL A;  3IH4 A;  4DZP A;  5F27 A;  1JUS A;  2AHQ A;  3ZOB A;  3BR2 A;  2M0C A; 
#chains in the Genus database with same CATH topology
 2VQC A;  2EJR A;  3PSF A;  1R58 A;  2E5N A;  2JUC A;  3OYK A;  2PLY A;  1HSJ A;  2RQQ A;  3LSI A;  4WX9 A;  1IN4 A;  1I3A A;  2IW5 A;  5C44 J;  5F04 A;  2DA7 A;  3RKW A;  1BA5 A;  4JYK A;  1T08 B;  3ISP A;  5LBQ A;  1B8I B;  1ZG3 A;  2R7X A;  1IN7 A;  3HHG A;  1R4M B;  4HLX A;  1BL0 A;  5EZG A;  3SYT A;  4BQA A;  4QIW N;  3CME I;  2W48 A;  4G6T B;  2V4J C;  1IRG A;  2BGC A;  3OSF A;  2B7E A;  2QKM B;  4AID A;  2D1V A;  3DCF A;  4DGW B;  1J09 A;  2EZL A;  2XHK A;  4YG2 F;  1J75 A;  3WE3 A;  1B72 B;  2VQH A;  2WB1 N;  4XOR A;  5K7H A;  3J7Y J;  1XDU A;  1MMN A;  4HF1 A;  3OR1 C;  4BXU A;  2A61 A;  1NTC A;  1QGP A;  3PIP F;  3RSN A;  5F1J A;  2K27 A;  2VB6 A;  3LSJ A;  4PFO A;  1SAU A;  1YJ9 I;  3ELK A;  4S05 A;  4LIV A;  5L3B A;  2XF6 A;  3FIW A;  4WF2 A;  3T1B A;  3DKW A;  4OIO F;  2A5W A;  2JK3 A;  4E7L A;  5ICF A;  1RPW A;  2BW3 A;  1QPI A;  1FP1 D;  3FK7 A;  2BYV E;  4UB6 C;  2DN0 A;  2CQK A;  5E3L A;  5GP9 A;  4IOA F;  3J81 Z;  2FSW A;  3LSG A;  4FAS D;  3I4M J;  1W36 D;  3IRR A;  2L4A A;  4OMY A;  1FTZ A;  2Q2E B;  3GFM A;  5JR3 A;  2XSD C;  1U9O A;  3GX4 X;  3COA C;  5IY5 H;  2ACJ A;  2QBY A;  2F5C A;  2XGC A;  5H6R A;  1HLV A;  4ENJ A;  1XCB A;  3IV5 A;  5FRN A;  1U78 A;  2CW0 F;  1U5T C;  3FKJ A;  2LSO A;  1QPM A;  3GLL A;  3AKZ A;  1ZAR A;  3A03 A;  1YI2 I;  4M3G A;  2VOO A;  2X85 A;  2KJC A;  2UXN A;  1LNW A;  3HUG B;  3O8G A;  3C2B A;  5FB2 A;  3S32 A;  1GV2 A;  1YO5 C;  2RQP A;  5HDG A;  4II3 A;  1TTY A;  1Z21 A;  3KFW X;  4EM0 B;  5JLW A;  5E20 A;  5DM6 F;  4V2F A;  2E1C A;  5FKN A;  5IOZ A;  1DPU A;  2XKO A;  3R61 A;  4QTR A;  2MC3 A;  5HOD A;  4WK8 F;  1MBK A;  4BDY A;  1B72 A;  1IN6 A;  2A3S A;  3LSK A;  1JE8 A;  2HXO A;  4KUM A;  2DFF A;  4A12 A;  5IT3 A;  1U0J A;  4DJA A;  4ASN A;  2DT7 B;  3PM1 A;  4UV8 A;  5FD5 A;  2Z16 A;  4AD9 A;  4B43 A;  5D5U B;  2ME0 A;  2BY0 A;  2X6X A;  5FLV A;  1PDN C;  5GPA A;  3PO3 J;  1Q1V A;  4P5O A;  1LJ9 A;  4LLL A;  1BJA A;  3SZG A;  1STZ A;  3ZQQ A;  5BMZ A;  1CQT A;  1Y8R B;  3L2W A;  4AIJ A;  4BAC A;  2F5D A;  2NNY A;  2GXA A;  3I64 A;  5F0H A;  2VJJ A;  4B48 A;  3BR1 A;  4M6V A;  3FK6 A;  1W5C C;  5KNL A;  3K4L A;  3H36 A;  2WAQ A;  2X9D A;  2ZFU A;  3HKZ A;  4R1H A;  2DK8 A;  4XOP A;  3ZCO A;  3FXQ A;  4P9F A;  2WAQ N;  4BHC A;  3HKZ N;  4DW6 A;  1T2K A;  3FX3 A;  3HOY J;  3FBI B;  2V1N A;  2DA6 A;  3FMR A;  5HDN A;  4Y3O A;  1D1C A;  1SFK A;  3TW7 A;  1U5T B;  1YJN I;  3HTS B;  3O2P E;  1O7L A;  1ZTR A;  1HQC A;  4N0B A;  4C2U A;  4N4O B;  2K9Q A;  5FKO A;  3HOS A;  1IF1 A;  2PMZ N;  5E79 C;  3DEW A;  3JRE A;  1O3Q A;  1QA6 A;  1RZ4 A;  4M3D A;  3ZR8 X;  1B6A A;  4H0E A;  1QHH D;  2PN6 A;  3HOW J;  3ABT A;  3GTO J;  3EUK L;  4CYD A;  1LE8 A;  2L9N A;  4QPQ A;  5BPD A;  2EPF A;  2O8K A;  2VOD A;  2B63 J;  4IRI A;  2V1X A;  2YU3 A;  3OYE A;  5ILS A;  4FET A;  4KMF A;  1W7P A;  4KIF A;  1QRY A;  3RIR A;  4YFN F;  1M1E B;  2L54 A;  2DLL A;  3G6E I;  2GIZ A;  3WTV C;  4EJV A;  4HF0 A;  3KYC B;  4UVC A;  2V9P A;  2Z2S B;  3FBN B;  1POG A;  2BY2 A;  2CV2 A;  3OL3 A;  1JJ8 C;  3JR9 A;  3ZGK A;  3H1C A;  1WH7 A;  5E8G A;  1PP8 F;  2P7V B;  4PSX A;  1ITY A;  5IT9 Z;  5L3D A;  1ZKG A;  2M30 A;  4F91 B;  1Y8Q B;  5EGO A;  3CP2 A;  2LYC A;  3ZQI A;  3P9K A;  1VQK I;  4I7H A;  1D3Y A;  3WE2 A;  2X6O A;  2OD5 A;  5HS9 A;  1S8N A;  2M7A A;  2M8E A;  2ECB A;  3WTT C;  2KMU A;  4X0G A;  1OKR A;  2A05 A;  1BR4 A;  3JRG A;  3PO2 J;  2XV4 S;  1R71 A;  2ICW G;  4HEA 2;  5HDK A;  2BXY A;  2DW4 A;  1T33 A;  2F5V A;  3WTZ A;  1QZE A;  3S8P A;  2BE5 F;  1YLF A;  3QPT A;  5IYB J;  3I55 I;  3NRV A;  2Z3Y A;  3CCQ I;  3OYA A;  4ZH4 F;  4XOT A;  4J01 A;  3DWL E;  2OBP A;  5B66 C;  1XB4 A;  4XRM A;  5ILU A;  1QQI A;  3EUH C;  2GXB A;  3OOU A;  2QQ8 A;  1HBX G;  1OCP A;  3BDD A;  5K5O A;  3M4O J;  3K10 A;  3G3Z A;  2E2I J;  2ID3 A;  1IV8 A;  1ETV A;  3T8R A;  2NVX J;  4A3G J;  1SFE A;  4GGG A;  2XRO A;  2DK5 A;  4FCY A;  3Q9S A;  2O3F A;  1BOA A;  3T8T A;  3HRS A;  1D0Z A;  1UFM A;  4IPA A;  3I4P A;  4L5I A;  4EM2 A;  4NB5 A;  4YIF A;  4PUS A;  4BQN A;  3J7A Y;  3IKV A;  5F1R A;  2ZC2 A;  3ZQG A;  2AXL A;  2DFH A;  2QEX I;  2VT3 A;  5J6X A;  3N97 A;  1ENH A;  1R22 A;  3GZN B;  4IO9 F;  3PJR A;  4BQO A;  4A3M J;  2ZFW A;  1DGR M;  4LMY A;  3GO5 A;  3FDY A;  3VEP A;  1MNM C;  4HA8 A;  3KX2 A;  3BG9 A;  4PSW A;  3PQJ A;  3HZJ A;  4L5J A;  5GAD J;  1T6S A;  4HAM A;  2Y31 A;  4KT5 C;  3O6B B;  3JRB A;  2X1E A;  1HCR A;  1DU6 A;  3A01 B;  1XSX A;  3HL2 A;  3O3K A;  5E1Z B;  3GTM J;  2L9S A;  2DDA A;  2IS1 A;  2RRE A;  3Q0W A;  4HX7 A;  3TO9 A;  2FF4 A;  2STW A;  4G7O F;  3WTY C;  1SFU A;  2HXI A;  4X1E A;  3CCR I;  3ZMS A;  4OAY A;  3FKI J;  1JKR C;  3SEQ A;  3CES A;  2VI6 A;  2EK5 A;  3BR6 A;  2JSC A;  2XSJ C;  1BI3 A;  2Z99 A;  2L9R A;  2NVQ J;  3F72 A;  1MBJ A;  3DBH B;  1QHG A;  1X4O A;  1LB2 A;  5DV5 A;  2M3A A;  3QP6 A;  2E1O A;  2DI3 A;  5EDN A;  5CVR A;  2IBD A;  1YRN B;  2MW8 A;  3VFZ A;  4IRG A;  1KON A;  1Y0U A;  1TZL A;  2UUZ A;  5LHG A;  1XX5 A;  4ANJ A;  3V7C A;  1UEL B;  2XAG A;  3M8J A;  1FYL A;  3FM5 A;  2TDX A;  2HOS A;  3BG7 A;  4JX5 A;  5D5W B;  2HTS A;  4L9V A;  1DU0 A;  1IGN A;  2NOG A;  3M3Y J;  1FSH A;  2F5E A;  5D5V B;  4NQW B;  1AKH A;  3WHC A;  3ABU A;  3UKG A;  1LFU P;  1MKM A;  3AAF A;  1NG6 A;  3R4K A;  4BJ5 C;  3HSF A;  3SXY A;  4BY1 J;  1SD4 A;  4IHY A;  3PNV A;  2DPU A;  3AL0 B;  3HPG A;  4IX7 A;  4YFK F;  2E35 A;  3MKZ A;  5A2Q K;  4I2O A;  1KQ9 A;  5CJ9 A;  4BY7 J;  1T39 A;  5HS8 A;  4IHX A;  1J9I A;  1APL C;  2HDC A;  2D1H A;  3JSO A;  1MDM A;  3LA3 A;  2DTR A;  4DYC A;  3SEZ A;  1FOY A;  1OPC A;  3MZY A;  2Y9Y A;  2OV7 A;  3TO7 A;  2EFN A;  4IRH A;  3BC8 A;  1UG0 A;  3ZN1 A;  4EVI A;  2XF5 A;  2X1C A;  1YOV B;  1V3F A;  1MJA A;  3RPU A;  2XIG A;  1ZGW A;  5DCM B;  2MFZ A;  4BDZ A;  4RM2 A;  1XGN A;  2VT2 A;  3KEY A;  2CV1 A;  3K70 D;  4BE0 A;  1F4K A;  4KIT B;  1KA8 A;  3H92 A;  4HNU A;  2QLZ A;  4G12 A;  2CQQ A;  3A1Y A;  1KZH A;  2G0E A;  1NK2 P;  2G9W A;  1V5G A;  3H0G J;  5ED4 A;  3FXL A;  3CCL I;  3EYY A;  3HEF A;  2YU9 J;  3EUH A;  3E5X A;  3F8B A;  2GAU A;  9ANT A;  3ZMZ A;  1E0E A;  3DP7 A;  2DOF A;  3BJO A;  5AON A;  1U8B A;  1ONV A;  3NWT A;  3QU6 A;  2OAZ A;  3ZQH A;  3CJR B;  3OOP A;  3S14 J;  5J40 A;  5LGU A;  3TGN A;  3OYG A;  2MH2 A;  3DTK A;  1YRN A;  1FOX A;  2L0K A;  4PFP A;  1HW5 A;  4XLN F;  2DO7 A;  1FZP B;  3WOD F;  5FFZ A;  2JTV A;  4OMZ A;  3WHB A;  2KZG A;  3OS1 A;  2LC2 A;  4LG0 A;  4AYB A;  3FHZ A;  1R36 A;  3WTU C;  2PQ8 A;  3CUQ C;  2LY1 A;  3MKY B;  2QVO A;  4RGU A;  1XS9 A;  3BZ6 A;  3GTG J;  2IAI A;  2O9L A;  1GHC A;  1IDZ A;  1K61 A;  2MC4 A;  3K4N A;  1ETO A;  3IL2 A;  5GAE J;  2HOA A;  2X1D A;  2CWE A;  3HOU J;  2LOO A;  1R1T A;  4RB0 A;  5F27 A;  2K86 A;  2WY8 Q;  1BBY A;  4PGH A;  4Y15 A;  3FF5 A;  4F93 B;  2M0C A;  3DTE A;  1MH4 A;  4MEY F;  3QYE A;  1VQ7 I;  1LDK B;  1YS7 A;  3JRA A;  2P8T A;  5DD4 A;  2NS8 A;  3Q0U A;  2DJI A;  4AU7 A;  1FBQ A;  4LIT A;  4AM3 A;  1A04 A;  1P7J A;  4BBS J;  3C2H A;  2LKP A;  1L3L A;  3SFI A;  1SVO A;  2FMY A;  3BT9 A;  2R7F A;  3VWB A;  1MMA A;  4GXO A;  4I01 A;  2DFE A;  4RB1 A;  2F4I A;  4CHU A;  3ABM H;  2LLK A;  2P5K A;  1X1A A;  1UZC A;  5IPA A;  1WJC A;  1G3S A;  3JRF A;  3K1N A;  2DJN A;  5K7Z A;  3ZRG A;  4Q5S F;  2QF7 A;  4BE1 A;  1P2F A;  2DBB A;  3OS2 A;  3LAP A;  2AS5 F;  3A02 A;  1FMV A;  2LH9 A;  1RIO H;  3IAS 2;  3K1P A;  4HBL A;  1HKQ A;  5FKK A;  2A69 F;  3V7R A;  5JLX A;  4CUG A;  3X2Q H;  2L02 A;  2FBH A;  2RAE A;  3DPL C;  2XUB A;  3J7A O;  2GLO A;  3DV8 A;  4Z6Y A;  2DPD A;  2LKX A;  3MN2 A;  1R4N B;  3I3L A;  2NYX A;  4WXH A;  2KIU A;  3D5S C;  2L9V A;  1Y39 A;  1EF4 A;  3SJM A;  4PJL A;  3GXO A;  1MBG A;  4ESJ A;  1HDD C;  5JI6 A;  3F3X A;  4JK1 X;  3CMM A;  5A2Q Z;  3D0S A;  2W7N A;  2K9M A;  4PJJ A;  2DCE A;  3ZQC A;  3H9Q A;  4M9S A;  4Z2Y A;  4I6Z A;  4KT6 A;  5DUI A;  4RM3 A;  3CUO A;  1WRJ A;  1A31 A;  3J81 K;  3DLA A;  5K7F A;  2O7O A;  4MLO A;  1QBJ A;  2IP2 A;  3GFJ A;  3EDP A;  3F9K A;  3HHH A;  1OCZ H;  4U7B A;  2MG4 A;  3I58 A;  5E17 F;  5K1Y A;  2ZNZ A;  2NXN B;  3WU1 B;  2KJB A;  1D1A A;  2WV0 A;  2R5Z A;  3LSP A;  1ZG1 A;  4EJW A;  4LG3 A;  1HDP A;  1H88 C;  1GVD A;  1R49 A;  3KYD B;  1YW9 A;  2K9S A;  1XD7 A;  1RES A;  3P5J A;  4EJO A;  1S9H A;  1K7A A;  4A3L J;  4NC8 A;  3OYI A;  2VKV A;  5BS6 A;  4D1Q A;  3C1D A;  2DA4 A;  4HYE A;  1EV7 A;  4A2U A;  5L3E A;  1S29 A;  4J00 A;  4GYI A;  1IW7 F;  2ELJ A;  2Y75 A;  5M5Y J;  3W2V A;  3IH3 A;  2VBW A;  6PAX A;  4BXX J;  1T95 A;  1IAW A;  4L9N A;  3MWM A;  1I39 A;  2R3S A;  3W3C A;  4ABZ A;  4KMU X;  2ZSI B;  1I3Q J;  4RGS A;  4C30 A;  3WGI A;  3WTW C;  4BGD A;  3FM3 A;  1IXR C;  1W5T A;  1WHU A;  2EH3 A;  2EV6 A;  3LSM A;  4MQ9 F;  5HLI A;  3ZMU A;  4C3H J;  3CUQ A;  2Q8K A;  2BW3 B;  3FHN A;  3TDZ C;  2VBX A;  5IOY A;  2FNP A;  2K4B A;  2QQA A;  2VOP A;  3IKT A;  1P7I A;  3TDU C;  2L5Q A;  1R5H A;  2ID6 A;  1TL8 A;  3CC7 I;  3GTK J;  1XGS A;  2MLK A;  3GYH X;  2D5V A;  3DPU A;  4E7S A;  5D6F A;  4PJN A;  1X3Z B;  1WI3 A;  1IRX A;  1P9Q C;  2L01 A;  4HST A;  4WXD A;  3E3V A;  3IAM 2;  4IXA A;  4CCM A;  2QBY B;  3EPZ A;  1XC5 A;  2OU2 A;  1IN8 A;  3LFK A;  4UVA A;  3H9G A;  1XG1 A;  5IP6 A;  4Q4Z F;  2H1L A;  2E7X A;  2Y30 A;  5DYM A;  4BUP A;  3RJP A;  1FLI A;  3ASN H;  2GQQ A;  2E1N A;  1DP3 A;  2YSR A;  5D4R A;  2N8G A;  3QAH A;  1ZG5 A;  2DQL A;  1PVE A;  1MSF C;  3P9C A;  1T98 A;  2HDW A;  3HM5 A;  3LQQ A;  4A3I J;  3E0J B;  2V6E A;  1FTT A;  4F52 A;  2M34 A;  3EET A;  5DUK A;  3VOE A;  3ZMD A;  3IWZ A;  2WB1 A;  3I59 A;  2X6W A;  4IHS A;  4WXC A;  2I10 A;  2R7U A;  5IYD J;  3ML6 A;  1VFC A;  2VBY A;  5J4V A;  4EJT A;  1ACI A;  1QVT A;  1IXS B;  1A35 A;  1S7E A;  4CDG A;  1SMY F;  4A5N A;  1G3T A;  4CCJ A;  4B3A A;  2ZJR F;  2QZ8 A;  1FYK A;  1IJW C;  2O8X A;  3ASO H;  3U21 A;  1Y1V J;  2RNG A;  3P7N A;  1BN5 A;  1F43 A;  1HKS A;  1WWX A;  5TGT A;  2KRC A;  3MKL A;  3S15 J;  1HKT A;  4UUS B;  2LF7 A;  2STT A;  1Z6T A;  3Q5F A;  4FX4 A;  4ZTJ A;  1IG7 A;  2W24 A;  4HOB A;  2LR8 A;  1B1B A;  2HYF A;  2JZY A;  2QKL B;  1A6I A;  4I02 A;  3JTH A;  5FGM A;  1VTN C;  2KIF A;  4BBR J;  1BW5 A;  3MD2 A;  1Z6R A;  5LLQ A;  5IT9 K;  1YW8 A;  4DIQ A;  3TKY A;  1FC3 A;  1Z9C A;  2EV5 A;  1N77 A;  1LDJ A;  2W85 A;  3TOB A;  2PJP A;  2VIX A;  2K5C A;  2AQE A;  2NNN A;  4BE2 A;  3IC7 A;  4XLA A;  2BVM A;  3T5X A;  3W6J B;  3A0B C;  2HTJ A;  5ICG A;  2WBM A;  4IVN A;  3DEU A;  1DQU A;  4MTD A;  4M3F A;  4C9Y A;  1IRZ A;  2LY9 A;  3U9G A;  1HW2 A;  1K83 J;  2RVC A;  1FPQ A;  3TP0 A;  2YX7 A;  1MBE A;  1RR8 C;  1XGM A;  2HFH A;  2ZXW H;  4CZC A;  2FU4 A;  2OTL I;  2OC6 A;  1ZRD A;  2IA0 A;  1S3J A;  5DTD A;  3B6A A;  3W2W A;  1LE8 B;  1VF9 A;  1N75 A;  2CG4 A;  3OMY A;  4AIK A;  4EEF G;  1NK3 P;  2ZJP F;  3OYF A;  1MD0 A;  1ON1 A;  2H1K A;  3OYH A;  1I27 A;  1OYI A;  1W7P B;  3HGG A;  4HG2 A;  3HRM A;  3OYB A;  2RDP A;  3E5U A;  4L0Y B;  2EFW A;  1BM9 A;  1U2W A;  4NNJ A;  4FHT A;  4XBF A;  3SQN A;  4XRS G;  1HA8 A;  3HDD A;  1EH7 A;  3VPR A;  4IOC F;  1K4T A;  3ERM A;  4XLF A;  1YHQ I;  4B8X A;  1WSU A;  4NHJ A;  3S1M J;  2LK2 A;  3CCJ I;  3H5N A;  4U87 A;  2X0L A;  3CF2 A;  2XB5 A;  5EGO B;  5M3F J;  3L9F A;  4UUS A;  2H8W A;  4BJ6 C;  4XLP F;  1PP7 U;  1KYZ A;  5F6F A;  1W7P D;  3BCA A;  4CCL A;  3PL8 A;  1TWH J;  4DZJ A;  1ZK8 A;  3DU5 A;  4C2M J;  3GF2 A;  4M73 A;  2L3D A;  3DKY A;  3F6V A;  4L0Z B;  1KQ0 A;  3OL4 A;  2ZKZ A;  5JVT A;  2EBI A;  2GOX B;  2XAH A;  3BY6 A;  4M3E A;  2CFO A;  3L09 A;  4X6A J;  2JVH A;  4MEX F;  2K4J A;  4ESF A;  5J8C A;  3K4J A;  3N4M A;  4A3B J;  1Z7U A;  3KE2 A;  1TWF J;  4NDL A;  3F23 A;  5F64 A;  1FMW A;  4KIC A;  2PMZ A;  3I56 I;  2W4S A;  1BR2 A;  2VAS A;  3HOV J;  3WU0 A;  2L7K A;  5TRD A;  2GXG A;  2LMD A;  3TW6 A;  4W1U A;  2VN2 A;  1BC7 C;  5LHI A;  2R7O A;  1SVL A;  4G94 A;  4XON A;  1F9N A;  1JUM A;  3CF5 F;  1SAN A;  2KKO A;  3KYL A;  3L2U A;  4GO1 A;  4Y33 A;  2OPT A;  3QPL A;  3U1D A;  2K9N A;  3LMM A;  4L5E A;  3FWE A;  1EJ9 A;  2JA2 A;  2R7S A;  3KCC A;  2GIV A;  2KT0 A;  1D1B A;  1MBF A;  2QWW A;  3FXK A;  2CYY A;  3HSR A;  4JBA A;  4D7M A;  1LVA A;  3CC2 I;  4MTE A;  3ZPL A;  4IEJ A;  3R60 A;  4XR6 A;  2E2H J;  2HYG D;  2RN7 A;  4B44 A;  2ESH A;  4RGR A;  3Q0V A;  1BR1 A;  2LRD A;  2VKD A;  2M4G A;  2P5L C;  3QQA A;  1UST A;  1UHW A;  2XB0 X;  3ONQ A;  4CYC A;  5FFX A;  3ULQ B;  4LLN A;  2OCE A;  1TT5 B;  2QM3 A;  3G2B A;  1Z7L A;  2XPW A;  1FOW A;  2Y0S A;  3PQK A;  4EV0 A;  3CO7 C;  2Y0S N;  2FOK A;  4W97 A;  3MKW B;  1GDT A;  4A93 J;  2LP0 A;  4FE4 A;  4A0X A;  3MZH A;  1VQ5 I;  4JX4 A;  2HVS A;  2G7H A;  5B5E C;  4EGY A;  1E3O C;  1B9M A;  5CLS A;  1B59 A;  2A6H F;  2W1O A;  2B0L A;  2M5W A;  4LOC A;  1RKT A;  1ZAO A;  2R7Q A;  1OJL A;  3M8F A;  1ETQ A;  3M9A A;  3TO6 A;  5GAH J;  3J80 Z;  4KNY A;  1LQ1 A;  1Z05 A;  4BJT A;  3BTJ A;  1S6L A;  1YG2 A;  4BQQ A;  2M4K A;  5J47 A;  5JHU A;  4IHW A;  1ZLJ A;  2FRH A;  2DA5 A;  2FA5 A;  1FT9 A;  3E97 A;  2R92 J;  4RAF A;  4PK4 A;  3G71 I;  1HC8 A;  4RLQ A;  2NVT J;  3RYP A;  5H6Q A;  3OY9 A;  1ORK A;  1S7O A;  4YFX F;  3OYN A;  3D5R C;  2JQ7 A;  1OLT A;  1K6Y A;  1O4X A;  3H3U A;  3K9T A;  3LOC A;  4ZZD A;  2ZME C;  1XPX A;  2JPC A;  3SDG A;  1K6O A;  2XRN A;  2ELH A;  4NC7 A;  5FRO A;  4A69 C;  1AKH B;  4E7H A;  2VPL A;  3BPX A;  5HS7 A;  3V42 A;  2QA4 I;  1XGO A;  1U6G A;  2K3P A;  1ZN2 A;  3WTX C;  4P1W A;  2QSH X;  2VQG A;  2IS4 A;  2EFQ A;  4DQ2 A;  2GWR A;  4ZYE A;  2CH0 A;  1DUX C;  3CDI A;  4I98 B;  2BOL A;  1RRJ A;  4YII A;  5IP9 J;  2ADU A;  1O3S A;  1YFH A;  2W25 A;  2PEX A;  4PDK A;  1T0F C;  1MDM B;  4HQE A;  1TC3 C;  2X4H A;  2MBF A;  2PX9 A;  3KP7 A;  3FXJ A;  3FXU A;  1VQ4 I;  1X4P A;  3G73 A;  2CU7 A;  2KL4 A;  4FT8 A;  1YIJ I;  1O7F A;  3L00 A;  3RKY A;  4A0Y A;  5DM7 F;  3KP2 A;  4HPQ A;  2K02 A;  2CW7 A;  1VQP I;  3QOP A;  2ME6 A;  4IHV A;  3HJE A;  2O0Y A;  3KEQ A;  1YW7 A;  4KN4 X;  4ETS A;  4I76 A;  3F8C A;  1P4W A;  2ZJ2 A;  2HPM A;  4GYG A;  1OYW A;  1AA7 A;  2D2W A;  3E6C C;  4XRF A;  5H2F C;  2JA6 J;  4D5F A;  4LK0 F;  4LD5 A;  3G4S I;  2Y48 A;  2P4W A;  3RKQ A;  1V4R A;  2GOM A;  3OR2 C;  1FBU A;  3RDI A;  3OV8 A;  3WG7 H;  1ETY A;  2EB7 A;  2ZNY A;  1Z77 A;  1TQM A;  1PUF A;  3Q9V A;  2Y69 H;  2PI0 A;  3OIP A;  3MVP A;  4RAZ A;  3CCE I;  1QU3 A;  1UHM A;  4KJZ A;  1VQ9 I;  4PJM A;  1W4M A;  5EZH A;  3RPU D;  2FBI A;  4XLC A;  2LBF A;  3MEX A;  4KN7 X;  5LEK A;  4A5M A;  1V55 H;  2F4O B;  4LG0 B;  2LRE A;  2FOW A;  2VJI A;  2Z1D A;  3ZQ7 A;  2WA0 A;  2XPV A;  4H4K C;  1O3R A;  1AWC A;  5D6E A;  4ZC3 A;  4ZDP A;  5KHD A;  4MFD A;  2UXX A;  5GAG J;  3CJN A;  2DOA A;  1MH3 A;  2NVU B;  1ZGA A;  1B9N A;  1FBS A;  1OMI A;  1XSV A;  3WGG A;  2XKP A;  1VND A;  3FIS A;  2TCT A;  4F3Q A;  1K78 B;  1UG2 A;  3PUB A;  1ZYR F;  3BG6 A;  1KQ8 A;  3F22 A;  3P9I A;  4OIQ F;  3GCM A;  3R0A A;  2KDZ A;  2HVQ A;  1GUU A;  2K3F A;  3I0T A;  4Y17 A;  2DMN A;  1V54 H;  3NWS A;  1R00 A;  2M2E A;  2E1M C;  2HS5 A;  2KIQ A;  1D0X A;  1LVK A;  2DU9 A;  3JRC A;  1LFP A;  1RI7 A;  4CA0 A;  4P96 A;  3LA2 A;  2HQN A;  4ZJZ A;  5FJ8 J;  2XVC A;  3VSK A;  4ZTF A;  2WWY A;  3ECO A;  2D45 A;  1D5V A;  1ZLK A;  2FUG 2;  2HWV A;  3CDL A;  4OIR F;  3J7Z I;  3BQZ A;  2DMQ A;  2I8D A;  1YIT I;  4A3K J;  3CMY A;  4NC6 A;  3I54 A;  1R9T J;  1ETW A;  2LFB A;  4HF2 A;  1W0T A;  2VXZ A;  1WGX A;  2YUS A;  1V5E A;  2JSP A;  3N05 A;  4IKF A;  1HXD A;  3CCU I;  1JGS A;  2P6T A;  2CV0 A;  2ISY A;  2W82 A;  2FBK A;  2QSF X;  1IXC A;  2DOD A;  1ZEL A;  1G4D A;  3K4B A;  4RAG A;  3LA7 A;  1HF0 A;  1OFC X;  2OQG A;  2R5Y A;  1YJW I;  1JUP A;  2ZME A;  3H5R A;  1H9T A;  3GWZ A;  4BS9 A;  4E7Z A;  4E7I A;  1X2M A;  4EMS A;  2JRM A;  2IT0 A;  4P9U A;  1RNL A;  2VE8 A;  4UV9 A;  1MMS A;  1GXQ A;  1S72 I;  5HNF A;  3TED A;  2E19 A;  3FMQ A;  3KP4 A;  2P0W A;  3PFY A;  3KZY A;  1SMT A;  2KRH A;  1BOB A;  1K78 A;  1ODD A;  1AOY A;  1OYY A;  2XAS A;  3M7G A;  2WV1 A;  3GZ6 A;  2COB A;  1T0F A;  3K7A J;  4FIS A;  1WZ2 A;  2ZXH A;  5H20 A;  1V5F A;  4HQM A;  2H6B A;  2ZB9 A;  5JFR A;  3BJ6 A;  1AU7 A;  2JA8 J;  1W0U A;  5EG0 A;  2W84 A;  4RAY A;  2P5V A;  2F2E A;  3DBR B;  2R5Z B;  4MFE A;  1PUE E;  4ZDO A;  5TJJ A;  3WGH A;  2DQR A;  2IEK A;  3F6O A;  1X3U A;  3GME A;  3VYT B;  5J1R A;  1JT6 A;  5FKM A;  2EIK H;  3HB9 A;  1U9N A;  2K7L A;  3MQ0 A;  4XN0 A;  4IZZ A;  3ZQL A;  1WH5 A;  2K9L A;  3S2H J;  4F92 B;  3G1M A;  3CTA A;  2C6Y A;  2WAE A;  3IP4 B;  1MGT A;  4JX6 A;  3ZP5 A;  3G1L A;  1FOK A;  4BNC A;  2LTP A;  1D8K A;  2V7F A;  3ZN0 A;  2VE9 A;  2EIN H;  1DP7 P;  4B4C A;  3LNQ A;  3BCB A;  5CVJ A;  2L7F P;  2BVL A;  2EZK A;  4G8X A;  1UHS A;  4BHB A;  3V8J A;  3CC4 I;  1WI9 A;  4UY8 I;  1J5Y A;  2KPM A;  4RLF A;  1SEU A;  2OA4 A;  3DF8 A;  4JOM A;  3CUQ B;  4QSH A;  2DYS H;  2HQ5 A;  1W1W E;  1ZRE A;  2EIJ H;  1BIB A;  1S7A A;  2TRT A;  3DTI A;  2EFO A;  3GBG A;  4N9H A;  1E17 A;  1IUF A;  2GA2 A;  4E7K A;  2ZXJ A;  1ETX A;  2M0M A;  2CGP A;  3G1O A;  3ROU A;  3NAU A;  1KU2 A;  4MQV A;  2W57 A;  3GFL A;  1GT0 C;  2DT5 A;  4RA2 A;  1HW1 A;  5EF6 A;  3CCV I;  1D8J A;  2CSO A;  1XCV A;  1J7K A;  2IGM A;  3BR3 A;  4UHT A;  3RI4 A;  3HG9 A;  2OUM A;  1T56 A;  4CH7 A;  3GTP J;  4U0Y A;  4LFU A;  3LSR A;  4A3D J;  3OYD A;  1ZRF A;  2AO9 A;  5L3G A;  2CMP A;  5E1X A;  4G6Q A;  2PJR B;  2ZXI A;  3VOD A;  1ZH5 A;  5F08 A;  2VKH A;  2DTZ A;  4S04 A;  3I59 B;  1KU3 A;  4ZDL A;  2IA1 A;  4J19 A;  3ZQF A;  5BNG A;  5E3M A;  4MGR A;  2ECC A;  1D0Y A;  3S1Q J;  3HBL A;  3VYU B;  1BC8 C;  5C4X J;  3BZC A;  2QEN A;  1I5Z A;  2IGO A;  4Y52 J;  3H35 A;  3BQY A;  3F0C A;  1VZ0 A;  2A6E F;  3DLL F;  3I9V 2;  2JVG A;  2CQX A;  2OJE D;  4DBR A;  1FX7 A;  2CUF A;  4QWQ A;  4E4H A;  5DEQ A;  1Z0X A;  5LRR A;  2FNA A;  4B3X A;  2HVR A;  2KIM A;  2MSY A;  1R5G A;  2AXT C;  3AG4 H;  1WJA A;  2IGN A;  4F55 A;  1JKO C;  1RKW A;  2DOE A;  5K5R A;  1EKE A;  2O03 A;  4IL6 C;  2BY3 A;  1ZQ3 P;  4ITV A;  1QVU A;  1AHD P;  3TOA A;  1IUY A;  2O61 A;  1W36 C;  1BI2 A;  4G9Y A;  3JRI A;  5M5W J;  1I1G A;  5KVR A;  1TQP A;  2DYR H;  5ICE A;  1ON2 A;  4HLY A;  4GFB A;  1Z67 A;  1P92 A;  3A4C A;  1FNN A;  5FLM J;  5FLX K;  3FXO A;  4XKW A;  4AVZ A;  1S5L C;  4O6J A;  1VQM I;  1EH8 A;  2DA1 A;  2HGC A;  2Y2Z A;  3ECH A;  2MYS A;  2F48 A;  1T8I A;  4G7H F;  3JRD A;  1UMQ A;  1R5I D;  2R93 J;  4LIU A;  4DYR A;  1JKP C;  5J4Y A;  2CFX A;  3V7S A;  1LEA A;  3VSL A;  3RZO J;  3AFH A;  3RYR A;  2PJR A;  1X3W B;  1KYW A;  4C3J J;  3HRT A;  2M9H A;  3OIQ A;  2XAF A;  3HGY A;  3PNT A;  2A07 F;  3HXL A;  3QOE A;  1SVM A;  1RUN A;  3BP8 A;  4YRV A;  4CO8 A;  3K4C A;  2E5Z A;  2Q0O A;  1E3P A;  2E7W A;  2HZT A;  5IP7 J;  4FTH A;  4F7Z A;  2YS9 A;  1USS A;  3E7L A;  3IH2 A;  2V1D A;  4ZYA A;  1MND A;  2V26 A;  1ERD A;  3GTQ J;  3RQI A;  2EWN A;  1YX3 A;  4HNV A;  5HLG A;  4RDU A;  2HI3 A;  2GA1 A;  2FJ1 A;  1QZZ A;  3HPH A;  1FJL A;  3DPT A;  2JN6 A;  3GTJ J;  2E2J J;  3B73 A;  3I5U A;  5ERI A;  3RTR A;  5LFA A;  1SC7 A;  2UV1 A;  1FSE A;  4N4N B;  2PG4 A;  4HV5 A;  3EUA A;  5D4S A;  3CD6 I;  1R23 A;  3KZI C;  1X1B A;  1CF7 A;  1WFX A;  2FXA A;  4XL9 A;  5AIQ A;  2YR2 A;  4EM1 A;  3K1M A;  3HTU A;  4WCG A;  1TWC J;  4AVP A;  5KK1 A;  2Y9Z A;  4D7N A;  3OYL A;  1D5Y A;  4S0H B;  2BV6 A;  2LY2 A;  5JVG F;  2WC2 A;  4BEH A;  3JSP A;  2CUE A;  4HV6 A;  5CYV A;  2RGV A;  4XM3 A;  4B47 A;  1Q1H A;  3LWF A;  5B1A H;  2WY7 Q;  3E6B A;  3KP5 A;  3CDH A;  4PGG A;  2NAZ A;  3FZV A;  1TQI A;  5L3C A;  2ISZ A;  3HSE A;  5CQE A;  3V4G A;  4XRS A;  3J80 K;  4YIR X;  2XGE A;  3F21 A;  2XRL A;  1A5J A;  4Y4R A;  4QPO A;  2XGD A;  1Y56 A;  4EQQ A;  2RNJ A;  3D1N I;  2IS2 A;  2MH9 A;  2XAJ A;  2E71 A;  2DA2 A;  3F8N A;  1OQY A;  3GLX A;  3LAJ A;  3S1R J;  5FRM A;  3MCZ A;  2HYJ A;  2NRA C;  2J5O A;  3S17 J;  3FXR A;  2FX0 A;  3S3O A;  2BBY A;  3V8K A;  4IQ4 A;  4BH9 A;  2HNH A;  3REO A;  3H5A A;  4OU0 A;  5BPI A;  2IRF G;  4KFC A;  5EEG A;  2EFP A;  1LDD A;  2DFI A;  3VB2 A;  1UCR A;  2M1B A;  3KIO A;  5KAI C;  1B8I A;  2OF7 A;  3ESW B;  1YX5 A;  2JA5 J;  2EIL H;  2FEZ A;  1YYV A;  4O3M A;  1TWG J;  3CCY A;  3HOZ J;  2DMU A;  4L9T A;  4B1R A;  3K69 A;  4CYC B;  2KLO A;  3JCU C;  3MMY B;  2VKE A;  1O3T A;  4LB5 A;  4FX0 A;  3OYJ A;  4ENM A;  1L0O C;  5M3M J;  2GBY A;  4I09 A;  4BXF A;  4I99 C;  2EA2 A;  3M8E A;  5HLT A;  1R7J A;  3L1P A;  4A6D A;  1GLN A;  1WJ5 A;  2FQ4 A;  3TQN A;  1MSE C;  1FIA A;  4BKX A;  3KLN A;  4YEJ A;  4E70 A;  1GXP A;  5E3O A;  2M87 A;  3DFG A;  1X58 A;  1XMA A;  2LDU A;  4I0B A;  4CXF A;  3S3M A;  1MMD A;  4WWC A;  1B4A A;  3H9J A;  3IH4 A;  5FLX Z;  2WAF A;  1JUS A;  3ZOB A;  3BR2 A;  3GEZ A;  4U0W A;  4HX8 A;  2QSG X;  5CPR B;  3ERE D;  2XAQ A;  4MHG A;  1X1P A;  2M8G X;  3ABK H;  4OWR B;  5DCF A;  4IQJ A;  4C3I J;  4II2 A;  1SD6 A;  3W2A A;  1HST A;  4HSR A;  3WG9 A;  3CO6 C;  4BYY A;  2HZD A;  1JKQ C;  4RB3 C;  4M72 A;  5EJC A;  5CKT A;  1RR7 A;  3QYF A;  4Q47 A;  2B9S A;  4FE7 A;  1YE9 A;  5E1W A;  2MGQ A;  1F5T A;  3E5Q A;  5HLH A;  2IS6 A;  2MD5 A;  4ON0 A;  1E3H A;  2VXD A;  4BHP A;  1J59 A;  5E8I A;  1VI0 A;  2E60 A;  4UVB A;  2Q2E A;  1LEB A;  2F5F A;  4MO7 A;  5LGT A;  4EJU A;  4XSX F;  5F0C A;  3E1S A;  4IJA A;  5LHH A;  2LG4 A;  1JXS A;  4FQG A;  5M5X J;  5FD6 A;  1VQL I;  5J3L A;  2HU9 A;  2MA3 A;  3HUG A;  2QUF A;  2EIM H;  4RMN A;  2M7B A;  3CJT B;  1WKM A;  4XSZ F;  1I1S A;  2L7M P;  4LK1 F;  1C0W A;  1NG7 A;  1O57 A;  1IDY A;  1UB9 A;  2JPB A;  1WJB A;  2CS3 A;  3BLY A;  4M3B A;  2IVM A;  2UWM A;  2VJ5 A;  4KYW A;  1A36 A;  5C4J J;  3CLQ A;  2KIS A;  1KGS A;  2NS7 A;  2EV0 A;  2PMH A;  4L9J A;  3CLO A;  4XNF A;  1OCC H;  3RKX A;  2IXS A;  2CW8 A;  2R7D A;  4ESB A;  2RC4 A;  4CCO A;  2HEO A;  1GV5 A;  5LRS A;  3BTI A;  2BHY A;  5CVU A;  5DS9 A;  3CP8 A;  1TBX A;  4HDU A;  2CJJ A;  2JUG A;  1K79 A;  5C3E J;  2KP6 A;  2HOE A;  4Y13 A;  2R7T A;  4ZYH A;  1JI8 A;  3OYC A;  3SZP A;  2EZH A;  1EH6 A;  2JMW A;  4ZZL A;  4NBQ A;  2DA3 A;  3KEO A;  3SZT A;  4ENK A;  4E6K G;  3MAJ A;  2NOJ B;  1PUF B;  1A6Q A;  3PNY A;  3HYI A;  3QPH A;  2H09 A;  3VYR B;  1YTY A;  3CCM I;  2XPU A;  5GTI C;  4AWX B;  3QP5 A;  3WU2 C;  4HNT A;  2L4M A;  4D0P A;  3BWG A;  1XMK A;  4EGZ A;  4PJ0 C;  1YQA A;  2J5P A;  2LBF B;  3DXJ F;  3DEE A;  1BIA A;  3LSH A;  4UXN A;  1LKX A;  2MLG A;  2HOT A;  4A3C J;  1U5T A;  1H0M A;  4E7J A;  2EQR A;  1CGP A;  3C2G A;  2HDD A;  1P4A A;  1TT0 A;  2KRF A;  3GVA A;  3TBI A;  5BQT A;  3KPH A;  3VDX A;  1WJF A;  1Y1W J;  1Y0N A;  5GTH C;  4UUT A;  4CCK A;  2VQL A;  1LPQ A;  3SDB A;  4XQF A;  3I71 A;  4D5C A;  1SFX A;  3AG1 H;  1KU7 A;  4RBO A;  1MJ9 A;  1G3W A;  2NVY J;  2A5Y B;  4XK4 A;  3SHF A;  4DNC A;  2P7C B;  2EZI A;  2PFB A;  3FXM A;  2H94 A;  3IRQ A;  2R7R A;  1LFB A;  1TWA J;  2HQR A;  3R0J A;  5CVI A;  2LKS A;  4M9X A;  4HW0 A;  3BPV A;  4Q48 A;  5HOO A;  2EA4 A;  1MZB A;  2KQR A;  1MJB A;  2HKO A;  3QU3 A;  1FP2 A;  1JGG A;  2CQN A;  1WVR A;  2IPQ X;  1PJR A;  3ZXS A;  3ZMT A;  3AL0 C;  2ZO4 A;  4O5V A;  4RS8 A;  2HKX A;  3W6K B;  3K70 C;  2X48 A;  2DMT A;  2R7Z J;  4R79 A;  4K2E A;  3PIO F;  5KAF C;  3IWF A;  2ESN A;  5TIS C;  1ZHF A;  1X2N A;  2R0Q C;  3K0L A;  4M9Z A;  2XC7 A;  4HDV A;  4NUB A;  1WQ2 A;  1JTX A;  3JW4 A;  2R5Y B;  4XKB A;  1ZR2 A;  2CQ7 A;  4V19 K;  4HX4 A;  4LLG F;  2XGX A;  2GZW A;  4CIC A;  1FY7 A;  2ZME B;  1X1D A;  4XN3 A;  4LGW A;  4KIB A;  1FWZ A;  5K5Q A;  5LEJ A;  2M45 A;  1RET A;  1IO2 A;  4M6X A;  2ZJQ F;  3VYS B;  1BJZ A;  1WCM J;  2V9K A;  3DBL B;  4KIG A;  4XLE A;  1GVJ A;  2ZSH B;  4YEL A;  2YPR A;  1N78 A;  1JTY A;  1OR7 C;  3GW2 A;  3TMO A;  3CZ6 A;  2COM A;  1Z1D A;  1P4X A;  2LVS A;  2OZ6 A;  2MAB A;  4TV7 A;  2VBZ A;  2XF7 A;  3M07 A;  5E3N A;  3A2K A;  2JT1 A;  1OCT C;  3UR3 C;  3KP6 A;  2P81 A;  3A0H C;  5KCM A;  2H6C A;  3RPQ A;  2OQR A;  5B3S H;  4GDF A;  5IYC J;  3NQO A;  3QWL A;  4CGZ A;  3S2W A;  3BG5 A;  4OIN F;  2R7W A;  3U2R A;  5EG0 B;  2QQB A;  4XMY A;  1SD5 A;  3BTC A;  2UZK A;  1SAX A;  3OSG A;  1IN5 A;  1VQ8 I;  3MFK A;  4AIH A;  2CO5 A;  2V6C A;  1X1C A;  1BI1 A;  1FIP A;  4JP0 A;  1MMG A;  1MBH A;  4BAY A;  3JRH A;  2BZT A;  1VQO I;  4IHT A;  3R6S A;  1IZ1 A;  4L18 B;  5ICC A;  4A6E A;  1I6X A;  2MD0 A;  2ETH A;  3RQ4 A;  4OIP F;  2JRT A;  2WAD A;  3E6M A;  2FQ3 A;  5L3F A;  3O8H A;  1TW2 A;  2Z9O A;  3I4N J;  3BOQ A;  2E34 A;  5EEA A;  4R8H A;  3GFI A;  4XKC A;  2LD5 A;  2LNB A;  3S3N A;  2VC1 A;  2VUM J;  1G2H A;  4OOI A;  1G3Y A;  3A01 A;  1ZRC A;  4UB8 C;  2X51 A;  2CRG A;  3RCO A;  5ILV A;  1IC8 A;  2V1U A;  5CVV A;  1HOM A;  2DDB A;  1PYV A;  2KFD A;  2H8R A;  3BG3 A;  1VQN I;  1OCR H;  1P6R A;  2DXI A;  3B6C A;  2BY1 A;  3S16 J;  1U8R A;  2I5U A;  4HZF A;  3S93 A;  3JAM K;  5B1B H;  3UNG C;  3QPS A;  3OYM A;  2HR3 A;  3BRO A;  3GZ5 A;  4CSW A;  1J0R A;  4IF4 A;  2XAU A;  3L2Q A;  2QYO A;  4B09 A;  1JHF A;  4PCQ A;  1TLH B;  4U7D A;  1G6N A;  1R1U A;  2IJL A;  2PMU A;  1X19 A;  5EYR A;  3PSI A;  3GUD A;  4A3E J;  3B02 A;  3PUF A;  4U0V A;  2Z5U A;  1JHH A;  2O5R A;  3U1K A;  4CZZ A;  3NAR A;  1NHA A;  1XDS A;  2JA7 J;  2E1M B;  3QYB A;  2VLA A;  4DOZ A;  3CMA I;  4AYB N;  3HRU A;  5J1Y A;  1EA3 A;  2IA2 A;  3ABL H;  3HC7 A;  3LST A;  1LUJ B;  3H0D A;  2ZCW A;  2CUJ A;  4M71 A;  4NQW A;  4M6Y A;  3NEU A;  2P6S A;  3DQV C;  4OAZ A;  2DMP A;  2VON A;  5E18 F;  2RV8 A;  4RGX A;  3DU6 A;  1VQ6 I;  3H3V K;  2BXZ A;  4D9J A;  2LF8 A;  4Y7N J;  1DPR A;  4XLH A;  5CQG A;  2F4M B;  3Q3S A;  3L2C A;  2AQF A;  1I50 J;  3KZZ A;  4XIC A;  2VPR A;  2A6T A;  2FE3 A;  2PBI A;  5DD8 A;  3TL4 X;  2G7U A;  4A3F J;  3W6V A;  3DKX A;  1Y6I A;  1FEX A;  3HIF A;  4MIM A;  2YX4 A;  3EQL F;  1JJ6 C;  2K85 A;  1RUO A;  3KP3 A;  1W5S A;  2H27 A;  3E6D A;  1FYM A;  5J1U A;  2Y0M A;  2A68 F;  3EYI A;  3K4K A;  2OZU A;  5EEH A;  1QZY A;  3I53 A;  4I0A A;  5DCM A;  3KLO A;  3CCS I;  1DGW Y;  2F6C A;  3D5L A;  3AG3 H;  3BR5 A;  2HQA A;  1YS6 A;  3LQR A;  4DBQ A;  1G59 A;  1UAA A;  3C18 A;  4BU2 A;  4LB6 B;  1IV6 A;  1OCO H;  3BZK A;  1ETK A;  3K4M A;  1OR7 A;  5F0F A;  1RC9 A;  3L2R A;  1U3E M;  3K2Z A;  2ZBK A;  1TP4 A;  5AIP A;  1QO0 D;  2JJ7 A;  4ENN A;  1G8X A;  3WTS C;  1MW7 A;  3KET A;  3PFI A;  2KZV A;  4MNU A;  2Q1Z B;  3M1C A;  1XMX A;  1F1Z A;  2XDV A;  1TW3 A;  4KDP A;  3QOD A;  4P55 A;  3L2V A;  3HOX J;  4RB2 C;  1H89 C;  5D5X B;  2JWT A;  2KDO A;  4A0Z A;  2L2O A;  3OS0 A;  1J2X A;  3HOT A;  2KHM A;  3TP3 A;  1ULY A;  1SD7 A;  5FO5 A;  1JT0 A;  3IUO A;  1F36 A;  2GM4 A;  2X6Y A;  1WJD A;  2IGK A;  1T38 A;  3LFU A;  3GTL J;  5LD2 C;  4GCV A;  3BR0 A;  2CUZ A;  1H8A C;  4G6D A;  5LGN A;  2FD5 A;  1Z91 A;  4XKV A;  1R1V A;  2DT6 A;  3SFZ A;  3H3Z A;  1KU9 A;  1H9G A;  4N9I A;  5JHF A;  2NS0 A;  1UJ8 A;  1K4S A;  5D8K B;  1XSD A;  1WPK A;  3F8M A;  1OIS A;  3AG2 H;  3L7W A;  2OCC H;  2FML A;  4V2G A;  2QCO A;  2QGU A;  4PZJ A;  5HVQ C;  4G7Z F;  1ZGJ A;  1R6R A;  2VJ4 A;  4CCN A;  3C7J A;  1IRF A;  2RKH A;  4ZYD A;  2R4G A;  4JQF A;  5HNH A;  2HPI A;  4LJZ F;  2WTE A;  3JAM Z;  4M74 A;  5D8L B;  3JTG A;  2VC0 A;  5DDG A;  5J8F A;  3ZMV A;  2QQ9 A;  3S1N J;  2W00 A;  1YIO A;  3K2A A;  4U88 A;  4KA4 A;  2DAO A;  2Z33 A;  3RZD J;  1DDN A;  4AC0 A;  1WJE A;  2V79 A;  4DYQ A;  1CF7 B;  4EAT A;  1E2X A;  2OTJ I;  1BI0 A;  5GPC A;  1SFO J;  4UUV A;  2L7Z A;  1Z3Y A;  1BW6 A;  3BTL A;  4XID A;  1NH3 A;  2V9V A;  1MIJ A;  3FMS A;  4UNO A;  1MNE A;  4ZYG A;  2BHZ A;  1ZR4 A;  4BL0 B;  1I6H J;  3IHU A;  4BEH B;  1N25 A;  3QRF F;  2ELK A;  3CJQ B;  3V8L A;  3MZ8 A;  5BOX A;  2O6G E;  4HRI A;  1XTA A;  2K40 A;  3K6G A;  2VL8 A;  4GRI A;  3T0Y A;  1REP C;  4AUX A;  1Z3X A;  3M1E A;  3S2D J;  3CQZ J;  3OIO A;  4QLC U;  3F8F A;  2R7V A;  1TNT A;  3BJA A;  3OWT A;  1QNT A;  3C3W A;  1TNS A;  4A3J J;  2BEO A;  4KIS A;  5FKL A;  2E36 A;  3LL7 A;  4DZP A;  4C2T A;  2AHQ A;  1XN7 A; 
#chains in the Genus database with same CATH homology
 1MH4 A;  2ME6 A;  4IHV A;  3JRA A;  2M8G X;  2NS8 A;  3Q0U A;  4C3I J;  4I76 A;  5C44 J;  1JKQ C;  1P7J A;  4BBS J;  5F04 A;  2DA7 A;  2JA6 J;  4D5F A;  1BA5 A;  1RR7 A;  4JYK A;  3SFI A;  3RKQ A;  3BT9 A;  4FE7 A;  1B8I B;  2MGQ A;  1BL0 A;  5EZG A;  1ETY A;  1Z77 A;  4QIW N;  2LLK A;  5IPA A;  1PUF A;  1VI0 A;  2W48 A;  3MVP A;  3JRF A;  4MO7 A;  3OSF A;  2DJN A;  5K7Z A;  5F0C A;  3DCF A;  2QF7 A;  5EZH A;  5M5X J;  3A02 A;  2EZL A;  1B72 B;  5J3L A;  2WB1 N;  5FKK A;  5JLX A;  2XPV A;  5K7H A;  2RAE A;  2L7M P;  4MFD A;  1MH3 A;  1IDY A;  2GLO A;  2LKX A;  3MN2 A;  1VND A;  3FIS A;  1NTC A;  2TCT A;  4M3B A;  1UG2 A;  5C4J J;  5F1J A;  3LSJ A;  2NS7 A;  1EF4 A;  3SJM A;  1MBG A;  1HDD C;  2KDZ A;  3FIW A;  1GUU A;  1GV5 A;  2JK3 A;  2DMN A;  3BTI A;  5DS9 A;  3ZQC A;  2M2E A;  2CJJ A;  1RPW A;  4I6Z A;  5C3E J;  1QPI A;  3JRC A;  3FK7 A;  5K7F A;  2EZH A;  2DN0 A;  5E3L A;  2O7O A;  4MLO A;  5GP9 A;  2JMW A;  5FJ8 J;  2DA3 A;  3LSG A;  3I4M J;  1PUF B;  3CDL A;  2MG4 A;  1FTZ A;  3BQZ A;  2DMQ A;  2XSD C;  1U9O A;  2XPU A;  4A3K J;  2R5Z A;  2XGC A;  3LSP A;  1HLV A;  3IV5 A;  1H88 C;  1HDP A;  3CMY A;  1U78 A;  1GVD A;  1R9T J;  1ETW A;  3A03 A;  2LFB A;  4M3G A;  2K9S A;  1RES A;  4A3L J;  1W0T A;  3O8G A;  1WGX A;  2YUS A;  3C2B A;  2HOT A;  1GV2 A;  4A3C J;  2VKV A;  2DA4 A;  5JLW A;  2EQR A;  4V2F A;  2HDD A;  5FKN A;  1HF0 A;  5IOZ A;  1OFC X;  2R5Y A;  5M5Y J;  3IH3 A;  1Y1W J;  4BXX J;  4QTR A;  1JUP A;  4UUT A;  5HOD A;  1MBK A;  1X2M A;  1B72 A;  4D5C A;  4ABZ A;  2HXO A;  1I3Q J;  4RBO A;  2NVY J;  4XK4 A;  2EH3 A;  2EZI A;  3PM1 A;  3TED A;  2E19 A;  4C3H J;  2ME0 A;  5FLV A;  5IOY A;  5GPA A;  1LFB A;  3PO3 J;  1Q1V A;  1TWA J;  1P7I A;  2ID6 A;  3GTK J;  2WV1 A;  2COB A;  2D5V A;  3K7A J;  4FIS A;  1CQT A;  1WI3 A;  2ZB9 A;  1JGG A;  1AU7 A;  2JA8 J;  1W0U A;  5F0H A;  5EG0 A;  1XC5 A;  2R5Z B;  3BR1 A;  4MFE A;  4M6V A;  3FK6 A;  2X48 A;  1XG1 A;  5IP6 A;  2DMT A;  2X9D A;  2Y30 A;  2IEK A;  4DW6 A;  2WAQ N;  2R7Z J;  3HKZ N;  5J1R A;  1JT6 A;  3HOY J;  5FKM A;  2DA6 A;  1U9N A;  3HB9 A;  3S2H J;  3ZQL A;  1WH5 A;  1X2N A;  3TW7 A;  2R0Q C;  3G1M A;  2N8G A;  4JX6 A;  1JTX A;  3G1L A;  1ZTR A;  1MSF C;  2LTP A;  3HM5 A;  4A3I J;  2R5Y B;  2K9Q A;  5FKO A;  1ZR2 A;  2PMZ N;  1FTT A;  3DEW A;  2M34 A;  3JRE A;  4B4C A;  4M3D A;  3LNQ A;  1RET A;  2I10 A;  2L7F P;  2EZK A;  1BJZ A;  5IYD J;  1UHS A;  1WCM J;  1VFC A;  3HOW J;  1QVT A;  1S7E A;  3GTO J;  1JTY A;  1LE8 A;  2LVS A;  4QSH A;  4B3A A;  2HQ5 A;  2O8K A;  2B63 J;  5E3N A;  1OCT C;  1IJW C;  3GBG A;  2TRT A;  2P81 A;  1Y1V J;  1IUF A;  1F43 A;  1QRY A;  5IYC J;  1ETX A;  3BG5 A;  3G1O A;  3MKL A;  3NAU A;  3S15 J;  4UUS B;  5EG0 B;  3BTC A;  1GT0 C;  1IG7 A;  2LR8 A;  5EF6 A;  3OSG A;  1POG A;  1A6I A;  1BW5 A;  4BBR J;  1JJ8 C;  3JR9 A;  1WH7 A;  1FIP A;  3BR3 A;  4JP0 A;  1MBH A;  1ITY A;  3JRH A;  1T56 A;  1ZKG A;  3GTP J;  5EGO A;  3LSR A;  3ZQI A;  4A3D J;  2X6O A;  2AO9 A;  2ECB A;  3O8H A;  3JRG A;  3I4N J;  5EEA A;  5F08 A;  2LD5 A;  2VUM J;  2DTZ A;  1G2H A;  4M3F A;  3PO2 J;  3A01 A;  2LY9 A;  1IRZ A;  1K83 J;  2CRG A;  3TP0 A;  4J19 A;  3ZQF A;  5BNG A;  5E3M A;  1MBE A;  1T33 A;  1IC8 A;  2ECC A;  1HOM A;  3S1Q J;  3HBL A;  5IYB J;  2H8R A;  5C4X J;  3BG3 A;  5DTD A;  3B6A A;  1LE8 B;  1VF9 A;  3B6C A;  3S16 J;  4Y52 J;  3BQY A;  4XRM A;  4EEF G;  3F0C A;  1NK3 P;  3QPS A;  3OOU A;  2H1K A;  2CQX A;  1OCP A;  3HGG A;  3M4O J;  2E2I J;  2CUF A;  2ID3 A;  1Z0X A;  1ETV A;  2NVX J;  4A3G J;  4FCY A;  2MSY A;  4XRS G;  3HDD A;  1JKO C;  3VPR A;  5EYR A;  1RKW A;  4A3E J;  3ZQG A;  1ZQ3 P;  3S1M J;  1QVU A;  2LK2 A;  3NAR A;  1ENH A;  2JA7 J;  1AHD P;  2XB5 A;  4A3M J;  5EGO B;  4AYB N;  5M3F J;  5J1Y A;  3JRI A;  5M5W J;  4UUS A;  1MNM C;  4GFB A;  1TWH J;  3BG9 A;  4DZJ A;  1ZK8 A;  4C2M J;  2Y31 A;  5FLM J;  2DMP A;  3JRB A;  1HCR A;  1DU6 A;  3A01 B;  2EBI A;  4M3E A;  3GTM J;  3H3V K;  4X6A J;  4Y7N J;  2DA1 A;  2Y2Z A;  3Q0W A;  4A3B J;  3Q3S A;  2HXI A;  1TWF J;  4NDL A;  1I50 J;  1UMQ A;  4X1E A;  3JRD A;  4XIC A;  2VPR A;  3FKI J;  2R93 J;  4A3F J;  1JKR C;  4DYR A;  1JKP C;  3W6V A;  3RZO J;  1FEX A;  2VI6 A;  3HOV J;  3BR6 A;  4MIM A;  4C3J J;  2M9H A;  2L9R A;  3HGY A;  1JJ6 C;  2NVQ J;  3TW6 A;  4W1U A;  1MBJ A;  5J1U A;  1JUM A;  1SAN A;  2OPT A;  3QPL A;  2E1O A;  2K9N A;  4L5E A;  5IP7 J;  4FTH A;  5EDN A;  3BR5 A;  2YS9 A;  2IBD A;  2KT0 A;  3E7L A;  3IH2 A;  1YRN B;  2MW8 A;  1MBF A;  4D7M A;  1IV6 A;  1ETK A;  3GTQ J;  3RQI A;  4RDU A;  4HNV A;  4IEJ A;  2HI3 A;  5F0F A;  2E2H J;  2FJ1 A;  1FJL A;  2JN6 A;  3GTJ J;  2E2J J;  2HOS A;  2JJ7 A;  3Q0V A;  1DU0 A;  4JX5 A;  1IGN A;  2NOG A;  3M3Y J;  3QQA A;  2XB0 X;  1AKH A;  4CYC A;  3WHC A;  3UKG A;  1LFU P;  3HOX J;  1H89 C;  4BY1 J;  2JWT A;  1TWC J;  2XPW A;  4IHY A;  2Y0S N;  4W97 A;  2Y9Z A;  3TP3 A;  4D7N A;  1GDT A;  4A93 J;  1JT0 A;  2LP0 A;  4FE4 A;  4BY7 J;  4S0H B;  1D5Y A;  1F36 A;  2GM4 A;  2CUE A;  4JX4 A;  4IHX A;  1APL C;  3GTL J;  1E3O C;  4DYC A;  1H8A C;  3BR0 A;  4XRS A;  2FD5 A;  4LOC A;  2Y9Y A;  1RKT A;  2XGE A;  1A5J A;  1OJL A;  2XRL A;  1ETQ A;  2XGD A;  3D1N I;  3BTJ A;  1WPK A;  2DA2 A;  4V2G A;  2QCO A;  1ZGW A;  4IHW A;  2DA5 A;  2R92 J;  3S1R J;  3S17 J;  2HYJ A;  2FX0 A;  2NVT J;  1ORK A;  4G12 A;  2CQQ A;  2G0E A;  1NK2 P;  3H0G J;  1B8I A;  2JA5 J;  2OF7 A;  1O4X A;  3S1N J;  3HEF A;  2YU9 J;  3K2A A;  9ANT A;  3LOC A;  1TWG J;  3RZD J;  1U8B A;  3CCY A;  4AC0 A;  4DYQ A;  3HOZ J;  3SDG A;  2DMU A;  3ZQH A;  4B1R A;  4A69 C;  1AKH B;  4CYC B;  5GPC A;  1SFO J;  3S14 J;  2L7Z A;  2VKE A;  1YRN A;  1BW6 A;  2L0K A;  3BTL A;  4XID A;  5M3M J;  2GBY A;  3WHB A;  1ZR4 A;  1I6H J;  1XS9 A;  3L1P A;  3GTG J;  2IAI A;  2ELK A;  5IP9 J;  2O9L A;  2FQ4 A;  1MSE C;  1IDZ A;  2K40 A;  1K61 A;  1FIA A;  4BKX A;  1ETO A;  4AUX A;  3S2D J;  3CQZ J;  3OIO A;  1TC3 C;  2HOA A;  5E3O A;  4A3J J;  1X58 A;  3HOU J;  2CU7 A;  5FKL A;  3IH4 A;  4DZP A;  5F27 A;  1JUS A;  2AHQ A;  3ZOB A;  3BR2 A;  2M0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...