1ETQA

The crystal structure of e. coli fis mutant r71y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
85
Chain Sequence
VLTVSTVNSQVTQKPLRDSVKQALKNYFAQLQDVNDLYELVLAEVEQPLLDMVMQYTYGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
molecule keywords FACTOR FOR INVERSION STIMULATION
total genus 26
structure length 85
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etqA00
3LSJA 2OF7A 4W97A 4A3GJ 2XGEA 1U8BA 4BY1J 1JT6A 3LOCA 5EGOB 3HBLA 1ETQA 3IH3A 3BTIA 2QCOA 3JRAA 3BG9A 5IOZA 2X9DA 3HGYA 5IP9J 5K7HA 3S17J 3BTLA 2DMTA 2Y0SN 3BR3A 1GT0C 2CU7A 2ID6A 3GTPJ 1BL0A 1B72B 1FEXA 1JTYA 4CYCB 1X2MA 3VPRA 2ME6A 2Y2ZA 2GBYA 3S2HJ 3L1PA 1WH5A 4FE4A 1DU0A 1RESA 4DZJA 2W48A 5F0FA 1B8IA 5FJ8J 4I76A 1RKTA 1X2NA 9ANTA 2OPTA 3K2AA 2DMPA 3TP3A 4MIMA 4D7NA 4DZPA 2YUSA 2HXOA 1P7JA 1LFBA 1NK3P 3HOVJ 1H88C 4XICA 2XPVA 4DW6A 2O8KA 1IDZA 2TRTA 2LKXA 4A3MJ 3A01B 4BXXJ 1OJLA 2DA2A 3HOXJ 4QTRA 3JRDA 2DA3A 2JWTA 2L7FP 3I4MJ 1ZR4A 1CQTA 3ZOBA 3S1NJ 2R5YA 1VNDA 2VKVA 1MBHA 3HKZN 1JKRC 3GTQJ 3BR2A 1UG2A 2EZKA 1F36A 1MBEA 4C2MJ 3PO3J 2CQQA 2LR8A 1ETKA 3IH2A 3LSPA 2HOSA 2XSDC 3D1NI 5J1UA 2ZB9A 3BQZA 2WAQN 3FKIJ 5IOYA 1VF9A 2NS8A 4IHWA 4C3IJ 1JGGA 1WGXA 3Q0VA 4IHXA 2X6OA 4A3KJ 3QPSA 2M2EA 3HOZJ 2HYJA 4QIWN 2E19A 1IGNA 2I10A 5F08A 2JA5J 4BBSJ 1RPWA 2R5ZA 2G0EA 3S14J 2WV1A 4JX6A 5E3LA 4A3EJ 3W6VA 2QF7A 2DTZA 4ABZA 4D7MA 1OCPA 2FJ1A 3CCYA 2M8GX 1NK2P 3RKQA 1POGA 3DEWA 4B1RA 1FIAA 1JJ8C 2E2JJ 4B4CA 3RQIA 3RZDJ 4M3DA 5F04A 2LLKA 5EZHA 1LE8A 3S15J 2XRLA 3SDGA 4FISA 3RZOJ 3S2DJ 2ELKA 2R93J 2M0CA 5FKKA 1P7IA 1FTTA 4FE7A 2KT0A 2NOGA 3WHBA 5E3MA 5IYDJ 2HXIA 4X6AJ 4JX4A 4UUSB 1TWGJ 3JRIA 3JREA 1JTXA 4DYRA 3JRHA 3E7LA 4FTHA 2LVSA 2LK2A 2JA6J 3TW7A 1YRNB 5C4JJ 3JRFA 4D5CA 4J19A 2R5YB 4Y7NJ 1O4XA 1Y1VJ 2VI6A 3BG5A 2NVYJ 2MG4A 3BR6A 3A01A 4M3EA 3NAUA 4RDUA 5EEAA 1WI3A 2K9QA 3S1MJ 1ITYA 4UUSA 1ORKA 2L7ZA 5K7FA 2N8GA 3BQYA 2FD5A 2O9LA 5EG0B 1ZGWA 3UKGA 5F27A 2DA1A 1IUFA 1ETOA 1RR7A 1XC5A 1GV5A 3SFIA 1IJWC 1Q1VA 4AYBN 1Y1WJ 2X48A 2P81A 2XB0X 5DTDA 2O7OA 1IDYA 2CUEA 1JUSA 2Y31A 1H89C 1NTCA 3H3VK 3PM1A 1I3QJ 1WH7A 3HGGA 3HM5A 5GPCA 1HF0A 2CQXA 3CMYA 3MN2A 5IP7J 3BT9A 4M3BA 3ZQIA 4JP0A 3DCFA 1ENHA 2D5VA 2NVXJ 4A3DJ 3BTJA 2DA5A 1UHSA 3S16J 3JRGA 1MBGA 5C44J 2YU9J 5C4XJ 1AHDP 5FKLA 1W0UA 1ZK8A 5M5XJ 1MH3A 5E3OA 5M5WJ 2EBIA 3ZQHA 1IV6A 1F43A 5JLXA 5F0CA 4A3FJ 3HOYJ 1HDPA 4CYCA 4S0HB 3BR0A 3A02A 2JK3A 2DA7A 3S1QJ 3LNQA 2CJJA 3ZQFA 4V2GA 5M3FJ 2ECBA 1QVUA 2R7ZJ 2XB5A 2DMQA 2K9NA 2PMZN 3F0CA 3K7AJ 4QSHA 3JR9A 1U9NA 3WHCA 3PO2J 4Y52J 3GBGA 2DN0A 4L5EA 3SJMA 1GV2A 2Y9YA 4MO7A 2HDDA 3HOUJ 1TWCJ 4EEFG 1MBFA 1MSEC 3GTMJ 5BNGA 1QRYA 3OIOA 4XK4A 2M9HA 1FJLA 3MVPA 3GTGJ 1A6IA 1Z77A 1D5YA 2NVTJ 5FKMA 4AC0A 2E2HJ 2K9SA 2JA8J 2M34A 3G1OA 4IEJA 5DS9A 1TWHJ 5M5YJ 2Y30A 2XGDA 3ZQLA 1BW5A 3Q3SA 3B6AA 3BR1A 1JT0A 3TW6A 2R92J 5EG0A 1HDDC 1BA5A 5EDNA 2H1KA 1LE8B 2GM4A 1HCRA 1JKOC 4XRSG 1JKPC 5K7ZA 5F0HA 2HOTA 3MKLA 2EH3A 2EZHA 3CQZJ 2H8RA 2IAIA 2HOAA 3ZQGA 2AHQA 1H8AC 1JUPA 2L9RA 1ZQ3P 2E2IJ 1U78A 1SFOJ 3S1RJ 2EQRA 1MH4A 3BTCA 5JLWA 5C3EJ 1AU7A 1A5JA 1IRZA 1EF4A 5IP6A 1MBKA 1MNMC 4JYKA 5M3MJ 1OCTC 5GP9A 3TEDA 5F1JA 5EGOA 1PUFB 3FIWA 1ETVA 4RBOA 2JJ7A 1K61A 2RAEA 3G1LA 3Q0UA 4M3FA 3CDLA 4IHVA 1YRNA 1I50J 2DA4A 4LOCA 2DMNA 1R9TJ 4A3IJ 2Y9ZA 4A3CJ 1ETWA 1VFCA 1DU6A 1E3OC 3BR5A 1TWAJ 1HLVA 1QVTA 2IBDA 4D5FA 5FKOA 1GVDA 4M3GA 4FCYA 4X1EA 4JX5A 2XGCA 2DMUA 3JRCA 1GUUA 2ECCA 4MFEA 2JA7J 5J3LA 2E1OA 3FK7A 1WPKA 4UUTA 2COBA 3O8HA 2JMWA 1ZKGA 2TCTA 4C3HJ 1K83J 2XPUA 4MFDA 3OOUA 2B63J 2ME0A 2FX0A 3H0GJ 1TC3C 1BW6A 1PUFA 2MGQA 5FKNA 2EZIA 2R0QC 1TWFJ 4A3BJ 4GFBA 3B6CA 5IYCJ 1APLC 1JJ6C 2K40A 2KDZA 4W1UA 3GTJJ 1JUMA 1IG7A 2VUMJ 3GTLJ 1FIPA 1XS9A 3LSGA 1BJZA 1SANA 4IHYA 3M3YJ 1S7EA 3NARA 1LFUP 2NS7A 3ZQCA 3IV5A 4G12A 4XIDA 1AKHA 1XG1A 2ID3A 2AO9A 4NDLA 1G2HA 4A93J 2XPWA 2VPRA 3HB9A 3GTOJ 2CRGA 1ZTRA 2DJNA 4HNVA 1ETXA 5IPAA 1AKHB 3JRBA 1HOMA 3O8GA 1W0TA 2FQ4A 3HEFA 4AUXA 1FTZA 2EZLA 5E3NA 3A03A 1ETYA 4BBRJ 2CUFA 3QPLA 3I4NJ 4B3AA 2L0KA 1MBJA 3HOWJ 3C2BA 2GLOA 5J1YA 1T56A 3Q0WA 3OSGA 2MSYA 4BKXA 1JKQC 4A3LJ 1GDTA 4A3JJ 1OFCX 4M6VA 2DA6A 2LD5A 2LTPA 2NVQJ 2HQ5A 1I6HJ 1VI0A 1B8IB 5J1RA 3TP0A 1ZR2A 2VKEA 3GTKJ 4DYQA 4MLOA 3QQAA 4XRMA 3FISA 5EYRA 5GPAA 2LFBA 3G1MA 2LY9A 5EZGA 2JN6A 1UMQA 3BG3A 1X58A 1T33A 2MW8A 4DYCA 1WCMJ 2R5ZB 3OSFA 2L7MP 1B72A 1QPIA 5FLVA 1MSFC 4I6ZA 1U9OA 4C3JJ 3M4OJ 2LP0A 2YS9A 3IH4A 1Z0XA 4XRSA 5FLMJ 2WB1N 5EF6A 5IYBJ 3LSRA 2IEKA 4A69C 1RKWA 4BY7J 3FK6A 5HODA 1RETA 4V2FA 3HDDA 2HI3A 1IC8A
chains in the Genus database with same CATH superfamily
2OF7A 4ZDLA 4RAFA 3WTZA 4BY1J 4N9HA 1Z6RA 3HBLA 4HF0A 3IH3A 3BTIA 5GTHC 3DBRB 2OTJI 3VYRB 2IVMA 3I56I 2GWRA 3K4LA 3R6SA 5IP9J 2WAEA 2KQRA 3KP4A 1UCRA 3H0DA 2UXNA 4MHGA 3MD2A 2WC2A 4UVCA 1BIAA 4YIFA 3HTSB 3L2VA 1C0WA 2QKMB 2CV1A 1B72B 1FEXA 3CD6I 3WTYC 2PJPA 2Y2ZA 3WU2C 1WH5A 3FMQA 3I59B 3L1PA 1I1SA 1SD6A 3C18A 3W2VA 1HSJA 4G6QA 5FB2A 2CFOA 2F5VA 3ZMSA 2M1BA 3GCMA 2KPMA 3CTAA 3FXLA 1RIOH 2Y0SA 5FJ8J 1SVMA 2LG4A 2R7XA 5ICCA 3TDUC 1BC8C 2IT0A 2G7UA 2LKPA 3TP3A 2V26A 2XC7A 2VJJA 1STZA 2QQAA 3S93A 4GDFA 4EATA 2YUSA 3O6BB 3OR1C 1R1VA 1QO0D 2CSOA 1R22A 3LAPA 1IUYA 3M1CA 4XICA 4DW6A 2V1UA 3ZN0A 4DBRA 2TRTA 2LH9A 2LKXA 4A3MJ 4ASNA 3H5NA 2KRFA 1I5ZA 1D1BA 2DA3A 3U1DA 3J81K 2EFWA 1ODDA 4HG2A 1ZR4A 4UV9A 5HDNA 4IKFA 2VKVA 2V4JC 3HKZN 3BZKA 1SFKA 4RB0A 1K7AA 3D0SA 4RB3C 4KFCA 2EZKA 1RUOA 4KMFA 4C2MJ 2HVSA 1VQNI 3PO3J 3DPTA 3F6OA 4LLGF 4OIRF 2E5NA 2XVCA 3K0LA 3RKWA 4RGXA 3LSPA 1T0FC 2XSDC 2X51A 3BQZA 4E70A 1T39A 2X6XA 3ABMH 3PQKA 2GOMA 2WAQN 3BZCA 5DCMA 3H35A 3DFGA 4IHWA 1BI2A 3CUQC 2BY0A 4BJTA 1WGXA 1IN6A 3A1YA 4HBLA 4AWXB 4OMZA 1FYMA 4A3KJ 3PFIA 1OCZH 3HOZJ 4MGRA 1MJBA 2LRDA 2E1CA 1LVKA 3AL0C 1YJ9I 5HVQC 4ZC3A 2WV1A 4JX6A 5E3LA 3EUHA 4LK0F 2DQLA 1YQAA 3ONQA 1OCPA 1TNSA 4XR6A 1E0EA 1G8XA 2ZMEA 3OS1A 1J09A 2ZFWA 3DEWA 4B1RA 1FIAA 2XHKA 1JJ8C 4DJAA 2G9WA 4B4CA 3OYAA 3GFMA 2YPRA 4HYEA 2HZDA 1M1EB 4I7HA 3WTTC 4M3DA 3RZDJ 4E7IA 2ACJA 1YYVA 2X4HA 2IS2A 2ADUA 3E6BA 2A68F 4ZJZA 1QZYA 4AYBA 1SD5A 4FISA 2VBWA 1L3LA 4UY8I 3S2DJ 2ELKA 2ZMEC 2VB6A 3E5UA 3LAJA 3SXYA 1P7IA 4C9YA 2KT0A 3M8EA 3WHBA 4KYWA 1WZ2A 4KDPA 5IYDJ 2Z99A 3CC2I 3DKYA 4X6AJ 3E5QA 3JRIA 1YW7A 4DYRA 3E7LA 4FTHA 2P6SA 1X1AA 3K6GA 3OYIA 3TW7A 1YRNB 4BL0B 4D5CA 3TKYA 3V42A 4J19A 1O3RA 3G3ZA 5DUKA 4O6JA 3KEQA 1JHHA 5FRMA 4XOTA 3CUQA 2IS1A 4M3EA 3QU6A 3NAUA 4Z2YA 4RDUA 2HNHA 3HRSA 2F5DA 2KIQA 3U9GA 5EEAA 1WI3A 2K9QA 5ICGA 1ITYA 5K7FA 3CCMI 1T0FA 2ELHA 4HX8A 3ZRGA 2FBIA 1RC9A 1KU7A 1G3YA 1HSTA 4HSRA 1ZGWA 3U2RA 5F27A 1F4KA 3MQ0A 4Y4RA 2OCEA 4PCQA 1ETOA 1RR7A 3DLAA 1OCCH 4XSXF 2Z3YA 3I71A 2W7NA 1IJWC 2AXLA 2OTLI 2IW5A 2VQCA 1YJNI 1ZARA 2BXYA 2V9KA 3DV8A 3TO9A 5DTDA 4YRVA 2CUEA 2HQNA 1V5GA 3T8TA 1FOYA 4AU7A 4HX7A 1QGPA 4CH7A 4CCLA 1QNTA 3RPQA 5FLXK 2BY3A 5CQGA 5LBQA 1I3QJ 3TDZC 3V7CA 4FX4A 5BPDA 1WJBA 3HM5A 3T1BA 5HLGA 1HF0A 2YU3A 1QBJA 3U1KA 4UNOA 2HR3A 2P5LC 1YG2A 2QQ9A 1OR7A 5D6FA 3CCUI 2BEOA 2BZTA 2BBYA 5H6RA 1LDJA 2O61A 2FMYA 3JRGA 1VQ7I 5C44J 3VDXA 4R8HA 5FKLA 4A6DA 5M5XJ 4U0WA 2HTJA 5E3OA 2EBIA 4CGZA 4QPQA 4OU0A 3MEXA 5JLXA 3K1NA 5F0CA 2R7WA 2A5YB 4XLCA 5FO5A 2FQ3A 3BJAA 3BR0A 2KZVA 2E36A 2DA7A 1P4WA 2QKLB 4BHCA 4F92B 4HF2A 2CJJA 3ZQFA 4D9JA 1XSDA 1XSXA 5M3FJ 2V1NA 4YIRX 3LQQA 3H3UA 1FNNA 2FMLA 2K9NA 3JR9A 4ZH4F 1U9NA 1EH6A 1PP7U 4M6XA 4L5EA 3SJMA 1XN7A 2Y9YA 1CGPA 4MO7A 2HDDA 3O2PE 3DTKA 2HQAA 4YG2F 1MSEC 3FBIB 3BCBA 5E8GA 4YIIA 1UG0A 2E34A 3PNTA 4FHTA 1W1WE 3OIOA 3BP8A 2K9MA 4K2EA 2L02A 3QPTA 2GXGA 3G71I 4L5IA 4EJUA 4FETA 3L2QA 4S05A 2VPLA 1FLIA 4DQ2A 4GGGA 2LF7A 3EUHC 3IRQA 2DXIA 5DS9A 2HPMA 3V7SA 4ZDPA 1Y56A 2DK8A 3W6JB 3ZQLA 3UR3C 4I0AA 1UELB 2K7LA 3R60A 1WKMA 2OJED 5L3BA 2R92J 4ZDOA 3CMMA 4P1WA 1R23A 4PJNA 3KP3A 1A35A 2GM4A 1HCRA 1JKOC 2M45A 2PFBA 1YE9A 1X1PA 1WJCA 2ISYA 1MIJA 4WXHA 4BHBA 4ZTFA 1J0RA 2H1LA 2DT6A 3V7RA 2QBYA 2L9RA 1K79A 2A6EF 3MZHA 1SFOJ 2LBFA 2EQRA 3OWTA 3S1RJ 1A5JA 3CLQA 4BDYA 3HRUA 5J40A 4XLPF 1XMXA 1QA6A 4JYKA 1T95A 5BQTA 3TEDA 1X4PA 1IN7A 5EGOA 1P9QC 3EYIA 3DPLC 4N0BA 1IXSB 4AIJA 2FBKA 5ILVA 2WB1A 3I9V2 3TQNA 2L9SA 3CP2A 2DJIA 3KEOA 2DMNA 4EV0A 2KL4A 4A3IJ 2L9VA 1R9TJ 2BXZA 3W3CA 2BGCA 4B44A 2EFQA 2R7UA 1DU6A 1E3OC 3MZYA 1BOBA 1J2XA 3RYRA 1G3WA 1R6RA 4Y33A 1HLVA 3VYTB 1Z05A 1G3TA 3H9GA 1GVDA 3P9CA 4M3GA 3KZZA 1CF7B 1UB9A 4BXFA 3QYFA 4E6KG 5BMZA 4XLEA 4PSWA 2XGCA 3CLOA 2DT5A 4QPOA 3JRCA 4ESJA 3SDBA 5JI6A 2HVQA 1I1GA 2MABA 4Q5SF 3HUGB 2A6HF 2COBA 3ISPA 3O8HA 4B09A 4ZTJA 1W7PD 2XPUA 2E60A 3VYUB 1LFPA 4AVPA 2IA1A 3WTWC 4AM3A 3K1MA 3HUGA 2R7VA 2ME0A 2FX0A 4A12A 2QLZA 3PJRA 4IHSA 3HRMA 4OAYA 4Y13A 1PUFA 1S5LC 4Q47A 3PIOF 2L54A 2EZIA 4PFPA 3T8RA 2CV0A 4A3BJ 2XF6A 4GFBA 4F52A 2YSRA 4A5NA 3FX3A 4W1UA 2JVHA 3HTUA 1XDSA 2B7EA 3GTJJ 3F21A 2X6YA 4XMYA 1WVRA 3GF2A 1K6YA 5CPRB 1BJZA 3EQLF 4KT6A 3M3YJ 3CP8A 1X1BA 1LFUP 3RPUA 2OZUA 2ZKZA 4GYGA 2VIXA 1E2XA 2ID3A 1S7AA 5ED4A 2MYSA 2A05A 4EJOA 2RC4A 3GTOJ 1U0JA 5IPAA 3JRBA 1TQMA 1W0TA 5CKTA 3DF8A 5GAGJ 2EZLA 4WWCA 5DV5A 2IS4A 3IL2A 5DCFA 2RREA 2O03A 3I4NJ 3BC8A 4P55A 4B3AA 2L0KA 5LHGA 1QU3A 3HOWJ 2GLOA 2CFXA 5CJ9A 2VQLA 1MKMA 5LHHA 1ZREA 4IRIA 2K4BA 3B02A 4KUMA 3TMOA 2PQ8A 4HLXA 4L9NA 3GMEA 3LA7A 1DUXC 3SHFA 4HRIA 2HQ5A 4U0VA 3L7WA 3KETA 2JQ7A 1YS6A 1O3SA 5J1RA 1B8IB 2RDPA 1OCRH 1P4AA 4IHTA 2MD5A 3VYSB 4MLOA 3F23A 1IRXA 5DUIA 3CCRI 4L9JA 2LY1A 4U7BA 3J80Z 2A69F 5EZGA 5B3SH 2CGPA 3OSFA 4KICA 2EFNA 1H9TA 1H0MA 1B1BA 3OYLA 1L0OC 4C3JJ 2LP0A 3DBHB 3IH4A 1OISA 2NNYA 3QAHA 4EM0B 4IRGA 3E3VA 2QWWA 1MMDA 4MQ9F 1YIJI 4EJTA 2IEKA 1RKWA 4EGZA 1ZG3A 4XKVA 4OAZA 4E7JA 3HDDA 2LMDA 1IXCA 3ABUA 3LSJA 2RNGA 4A3GJ 2XGEA 1U8BA 2XSJC 4YFKF 2OCCH 3JRAA 3BG9A 5IOZA 2VE8A 1N77A 3HGYA 3MKZA 1R4NB 4OIPF 5J8CA 5K7HA 1DP3A 3H9QA 1RRJA 2C6YA 1WQ2A 4I2OA 2Y0SN 3BR3A 3ZGKA 2CU7A 2ID6A 2VASA 3BROA 3DP7A 3BJ6A 4Y3OA 1FMWA 3RJPA 1SD4A 2EIKH 3CF2A 1PUEE 2ME6A 3ZMTA 3S2HJ 5L3FA 1Z7LA 2E5ZA 3WE2A 1MDMA 5H2FC 1ZH5A 1RZ4A 3V8JA 4DZJA 2DYRH 2AS5F 1SEUA 1KGSA 1HBXG 1X2NA 3RQ4A 3F9KA 4E4HA 9ANTA 2NYXA 3K1PA 5KHDA 3K2AA 2ZJQF 2H8WA 2BVMA 3RYPA 4G6TB 2ZNZA 1UHWA 2ZBKA 1IO2A 3AG2H 2ZXJA 2KKOA 5ILSA 4HQEA 4R79A 1H88C 3HOVJ 2Y75A 3V4GA 1U5TB 2O8KA 3J7YJ 2MFZA 2QZ8A 3A01B 2DA2A 2COMA 3JRDA 4CCMA 2VOOA 3I4MJ 3O3KA 2XF5A 2X1CA 5FD5A 2R5YA 2DPDA 1VNDA 3RKXA 1MBHA 3MAJA 4A2UA 4BJ6C 2L9NA 2IPQX 3I4PA 3OIPA 3OYHA 4CCNA 4FASD 4MEYF 2B9SA 3WG9A 2L4AA 5FFXA 3CCJI 2HOSA 2MH9A 5D8LB 4G8XA 4XBFA 1IZ1A 3FKIJ 3RTRA 1XDUA 4L0YB 1VF9A 2NS8A 1ZN2A 2PMUA 2I8DA 2O5RA 1BJAA 3COAC 4Q4ZF 1JGGA 2NAZA 3Q0VA 1R58A 2E7WA 3H5AA 1U6GA 1Y39A 2W1OA 2DCEA 2OQGA 1MMNA 4P5OA 3E6CC 1U3EM 3HSEA 2JRTA 2JA5J 4BBSJ 4HV5A 1R4MB 3QPHA 1VZ0A 5L3DA 3SZGA 4XLHA 3AKZA 2R5ZA 3U21A 4XONA 4A3EJ 1TW3A 4RS8A 4G7ZF 2QF7A 2STTA 3OMYA 4ABZA 3FBNB 4OIOF 3OYNA 2EV6A 2FJ1A 4D0PA 5LEJA 2VONA 3CCYA 1MDMB 2P6TA 1RR8C 3RKQA 1QZEA 1MNDA 2Y0MA 5LD2C 3GLXA 6PAXA 1T8IA 1YW8A 4XSZF 3JCUC 5F04A 4CDGA 3L2RA 4O3MA 2M7AA 2OV7A 4DBQA 3RZOJ 1DPUA 5LRRA 2W82A 3QYEA 4Z6YA 4EJWA 2M0CA 2GIZA 1FX7A 1D0YA 2VBYA 5F64A 5FKKA 1FTTA 2QGUA 4FE7A 2NOGA 2FEZA 2O8XA 2VQGA 1OKRA 2E1NA 2I5UA 1JTXA 5DCMB 1ZG1A 2PJRA 2LK2A 2OBPA 1YW9A 5C4JJ 2ZJRF 3C2GA 1OPCA 1O4XA 4XKWA 2R7SA 5DEQA 3H1CA 3VEPA 3SYTA 1Y1VJ 2VI6A 4I09A 3BG5A 2NVYJ 1TT5B 2KMUA 4U0YA 1FSEA 1B9MA 3WU1B 1S8NA 5KAIC 2Z2SB 1TBXA 1IV8A 2XIGA 3TBIA 1VQ8I 2HTSA 3KCCA 4N4NB 1HW2A 2ZO4A 3OYDA 3QP6A 3A0HC 4DIQA 3UKGA 3KX2A 4BS9A 2A07F 2XAQA 4N9IA 1GV5A 4IOAF 3SFIA 3GX4X 2WADA 1Q1VA 4I01A 2X48A 1VQMI 4M6YA 3BZ6A 2F5CA 1VQ9I 3G73A 3CMEI 3E97A 2DBBA 1HQCA 4Q48A 3WU0A 3H5RA 2O7OA 3H3ZA 3PUFA 4YEJA 4CXFA 1JUSA 2Y31A 1H89C 1IN8A 2L2OA 3CCLI 3BDDA 1DPRA 3CJRB 3RCOA 3OY9A 3DLLF 1WH7A 2Z9OA 4NQWA 4QWQA 2CQXA 1B9NA 1TTYA 2HYFA 2DFFA 2Z16A 4KMUX 3L2CA 3BG7A 2KHMA 3MN2A 2DI3A 3ESWB 2GXAA 4M3BA 3CJTB 1R5ID 3RPUD 3BTJA 2IGKA 3PL8A 1Y6IA 3S16J 2ETHA 3KP7A 4G7HF 1W0UA 2FOWA 2ICWG 3ZQHA 1F43A 1JGSA 5B66C 1HDPA 2W85A 2EK5A 5D5VB 2H27A 4S0HB 1ONVA 3S2WA 1V5FA 2F6CA 2P0WA 2JK3A 3S1QJ 3LNQA 1FBSA 3DXJF 4V2GA 2HQRA 2VKDA 1AA7A 2PMZN 4GCVA 2RQPA 2IA0A 2JRMA 3WG7H 1F5TA 5A2QZ 3R61A 5K5OA 1FBUA 3GBGA 5HNFA 1Z9CA 4BXUA 4RGSA 1I39A 4EEFG 1E3PA 1TW2A 3GZ5A 3VODA 4R1HA 2P5KA 1QRYA 4XK4A 2M9HA 1FJLA 3GTGJ 1W5CC 5IT9Z 1A6QA 4AC0A 3KYLA 2F48A 4X0GA 1VQ4I 1Z3XA 2M34A 3G1OA 4BDZA 5CVUA 1TWHJ 5HNHA 2KJCA 2Y30A 1USTA 3Q3SA 2LKSA 3KP5A 3KYDB 3F3XA 3V8LA 3TW6A 1Z6TA 1GXPA 1OR7C 5EG0A 1OYYA 3IKTA 5H6QA 4XRSG 5HS8A 2GOXB 3JSOA 2B0LA 3P9KA 2HOTA 1Z3YA 1P2FA 4BAYA 5E1ZB 3HPGA 3IAM2 3MKLA 2R7DA 2EH3A 4WK8F 1Q1HA 4BH9A 3HG9A 3ZQGA 2H8RA 3R0JA 1JUPA 2CUJA 5CVIA 1U78A 2PX9A 3BTCA 2X1EA 3EETA 4FT8A 1IRZA 2EV5A 2Q0OA 1PVEA 5M3MJ 2ZCWA 5GP9A 1D8JA 2LC2A 3FIWA 1ETVA 4RBOA 1LB2A 2V6EA 1LDKB 2CUZA 2RAEA 2ZC2A 4M3FA 3GW2A 3WGHA 2FSWA 4LOCA 1BIBA 1KYZA 1O3TA 1K6OA 1VFCA 5DM6F 1D0ZA 3LSTA 4Y17A 3AAFA 5F1RA 1AWCA 1HW5A 3VSKA 5HS7A 1QVTA 2IBDA 4XORA 3K4NA 4IXAA 3VB2A 2QEXI 1QHHD 3LSMA 3IAS2 1Z67A 4XLNF 4X1EA 3JAMK 2DOAA 1O7LA 3KFWX 1XCVA 2DMUA 5B1AH 4KITB 1LDDA 3I5UA 4A6EA 1K4TA 1ZRDA 1EKEA 5L3CA 3ZPLA 4MFEA 5J3LA 1R1TA 1SFUA 2CS3A 4UUTA 2CYYA 2BE5F 1R1UA 2TCTA 5B1BH 1K83J 4C3HJ 5GADJ 4BACA 1MJ9A 4F91B 3DBLB 3IP4B 4EM1A 1B4AA 5ICEA 4B43A 2VE9A 1TC3C 3CCSI 4CUGA 3B73A 2MGQA 2UV1A 2Z1DA 5FKNA 2M5WA 2R0QC 4P9FA 3B6CA 3KIOA 1YIOA 5IYCJ 3WTUC 2BVLA 3DTEA 5DD8A 2KDZA 1T2KA 3I53A 2JZYA 2KIUA 3FWEA 2R7RA 3DU6A 3J80K 2LF8A 4A0XA 2KFDA 3L2UA 3R4KA 3IV5A 3AG3H 3IKVA 3HC7A 3M8JA 2AO9A 4PJLA 1A04A 4NDLA 2GZWA 4GYIA 4NHJA 4A93J 2FNPA 2VPRA 3HB9A 2PN6A 2ZSIB 2CRGA 2M4GA 2DJNA 2LSOA 3I54A 4HNVA 3P9IA 3K70D 2O0YA 3HEFA 3I58A 4RGUA 4AUXA 2UWMA 1FTZA 1XGNA 3A03A 1ETYA 3GZNB 1N78A 4RGRA 4BBRJ 2CUFA 2D1VA 4FX0A 1S3JA 2FE3A 5CVRA 4LG0B 5KK1A 3C2BA 2EIJH 5J1YA 2QSHX 2UZKA 4BKXA 1JKQC 4A3LJ 1ZRCA 4RB2C 1WWXA 3D5SC 3C2HA 4BJ5C 3LMMA 1O7FA 3DU5A 1R71A 1UFMA 3TP0A 4BUPA 1S72I 5LGUA 3OL3A 1YTYA 1ZR2A 2VOPA 1ZLKA 2H6BA 1SAXA 2PMHA 3LSHA 3HRTA 4H4KC 2ZXIA 2W24A 3QQAA 4I0BA 2GQQA 5FLXZ 5EYRA 4PZJA 3RIRA 5GPAA 2LY9A 2VJIA 2JN6A 4QLCU 2NVXJ 1T33A 4DYCA 5GAHJ 1WCMJ 5HDKA 2L7MP 2M7BA 4ETSA 3F72A 1KONA 4CICA 2BYVE 1R00A 2KDOA 2WBMA 2FA5A 5FLMJ 2WB1N 4E7HA 2DU9A 5IYBJ 2V6CA 1LKXA 1VQKI 3LL7A 1U2WA 4BY7J 3FK6A 3JTHA 1RETA 2X0LA 3FHZA 1TZLA 1IC8A 2DDAA 4M71A 4W97A 3OYGA 2P4WA 2Q1ZB 5IT9K 3LOCA 4C2UA 5EGOB 2W25A 4HSTA 5FRNA 4PSXA 2BHZA 2XAUA 3HL2A 1FOKA 3BPVA 3CUOA 4F7ZA 2DK5A 4KISA 4HEA2 5HLTA 1O57A 2WA0A 3TOAA 1J5YA 3J7AY 3L2WA 2K5CA 4ENJA 3S17J 1XB4A 2DMTA 3LSKA 4RAYA 4PK4A 4RM2A 1GT0C 3FZVA 1BL0A 2H09A 4RA2A 4CYCB 1X2MA 2HWVA 3CESA 5ICFA 3VPRA 2GBYA 1T98A 2XROA 4M73A 4FE4A 1DU0A 2DFHA 1RESA 4L9TA 2K85A 4KIBA 1HKTA 3AG1H 4II3A 2CQNA 3HIFA 4CA0A 2KIFA 3J7AO 4UXNA 4I76A 1VQ6I 1IXRC 4RLFA 3R0AA 4WF2A 2GA2A 1DP7P 4WXCA 1X1CA 2OPTA 3SFZA 4L0ZB 4P9UA 4MIMA 5KCMA 3NWSA 4CO8A 2K3PA 2A61A 3BG6A 4LLLA 2FXAA 1P7JA 3FMRA 1NK3P 3MZ8A 2UUZA 4CZZA 2RVCA 1OLTA 2XPVA 3OIQA 1F9NA 4LB5A 4P96A 4DOZA 3K4JA 1T38A 2D45A 4BXXJ 1OJLA 4QTRA 1G3SA 2JWTA 2L7FP 3T0YA 4PJ0C 1ZGAA 1CQTA 3ZOBA 1JI8A 3F8NA 1SFEA 1S6LA 4ZZDA 3GTQJ 1JKRC 4ESFA 3BR2A 3WGIA 4IJAA 1P6RA 1F36A 1LVAA 1MBEA 1D0XA 2NS0A 3LSIA 2CQQA 3CCEI 1ON2A 1JHFA 4CYDA 2QYOA 3PIPF 3IWFA 2GXBA 2YR2A 5J1UA 2ZB9A 3KE2A 2JSPA 2E35A 4PGHA 1U5TC 3JSPA 5JFRA 2PLYA 3RKYA 1UAAA 2DOFA 3IC7A 4LLNA 3L09A 3HPHA 3ERED 1EA3A 2VXDA 1RI7A 2VODA 3KZIC 3QPSA 1N25A 2V79A 2HYJA 4HQMA 1GLNA 5CVJA 1IGNA 4G7OF 1RPWA 4EM2A 4KIFA 2CWEA 1ULYA 2TDXA 3W6VA 5K5RA 3HOTA 4D7MA 1TLHB 2M8GX 3DPUA 2P7VB 5DDGA 4KNYA 2ZXHA 2ISZA 4XKBA 2W4SA 1V4RA 2XAHA 1GXQA 2DT7B 2PBIA 4EVIA 2HGCA 3RQIA 3TL4X 5EZHA 1LE8A 3ZR8X 2NOJB 1MJAA 3S15J 2ELJA 2XRLA 4C30A 2IGMA 4BE0A 2R93J 3GO5A 2K02A 4BEHA 2FOKA 2IJLA 5H20A 5A2QK 3QP5A 2HXIA 4JX4A 1DGRM 1TWGJ 4UHTA 3JREA 3AG4H 1FSHA 2CQ7A 4BU2A 5HOOA 4ZYGA 2JA6J 2M87A 1S29A 3JRFA 1W36C 4M9XA 2R5YB 5FGMA 2M4KA 1OYIA 2L01A 2DDBA 1BR2A 4JQFA 5TJJA 4AIDA 2MG4A 2CO5A 3BR6A 5DYMA 3A01A 1BI3A 3PNVA 3ZMDA 3A0BC 1HA8A 5AONA 3I64A 1YS7A 5TISC 4PFOA 1ORKA 2BY1A 2N8GA 1X3ZB 5JVGF 3H9JA 2FD5A 3IRRA 2GIVA 3FXRA 2DA1A 1IUFA 2F5FA 3SZTA 1N75A 1ZLJA 3CC7I 3HHGA 2QSGX 4AYBN 2A6TA 1FBQA 3DTIA 1MD0A 5LGNA 2RV8A 3QRFF 5J6XA 2XB0X 4L18B 4RMNA 2KP6A 3NRVA 2FRHA 4C2TA 2D2WA 1O3QA 1EV7A 1SMYF 3H3VK 3PM1A 3F6VA 2VLAA 1P92A 4ENNA 2HFHA 4XRFA 3HGGA 5GPCA 2EFPA 1LNWA 3P7NA 3CMYA 2IXSA 2MC3A 2A3SA 1J59A 1WFXA 1MGTA 5IP7J 3OR2C 1TNTA 4A3DJ 2DA5A 1UHSA 2QM3A 3EPZA 3OYKA 1MBGA 3ZQQA 3EDPA 2YU9J 2HZTA 1ZGJA 3OYEA 1BI0A 4ESBA 1ZK8A 2BW3A 1KQ0A 2EA2A 4HX4A 4LMYA 3CO7C 5M5WJ 3OYMA 1IV6A 3ERMA 1WJEA 3HOYJ 2F2EA 4E7SA 2L3DA 4WXDA 1FMVA 4O5VA 2OD5A 2DAOA 2ECBA 3CDHA 2HKXA 2R7ZJ 2XB5A 3EUAA 3OOPA 5J47A 1W7PA 2X85A 3I3LA 3FDYA 2XDVA 3ASOH 3HKZA 4QSHA 1D8KA 4Y52J 3IUOA 2DN0A 3NEUA 1PDNC 2PI0A 1GV2A 1USSA 2F4OB 2K4JA 2OZ6A 2WTEA 3RDIA 2X1DA 5AIQA 2FBHA 3D5RC 3UNGC 1BOAA 3H36A 5BNGA 2X6WA 3SZPA 3TO6A 2KISA 2W84A 5BPIA 3MVPA 2DPUA 5J4YA 1A6IA 4PDKA 2NVTJ 2P8TA 2KZGA 4ENKA 1K78A 1EH7A 3RI4A 2JA8J 5HLIA 3ROUA 3K4CA 3OL4A 4HAMA 4PGGA 1X3UA 3DEUA 5M5YJ 2K86A 2Q2EA 2XGDA 1K4SA 1ZRFA 4LK1F 1JT0A 4U87A 1MMSA 3I59A 1HDDC 4B8XA 4EGYA 3ULQB 5EDNA 2LY2A 2QVOA 3BOQA 1WJFA 2H94A 2L7KA 2VT2A 4IRHA 1S7OA 2L4MA 3ASNH 2VJ5A 3QODA 3LQRA 1YJWI 5IT3A 1U8RA 1SMTA 2H6CA 1Z7UA 2JA2A 2M0MA 4WX9A 2EZHA 1YFHA 2IAIA 2HOAA 2AHQA 3REOA 1H8AC 2HDCA 1LJ9A 2E2IJ 3HXLA 5E79C 2OU2A 4OMYA 2MD0A 3GEZA 4IL6C 1TT0A 1EF4A 5IP6A 1MBKA 3TGNA 4LITA 2L5QA 1G4DA 1PUFB 2RNJA 2MBFA 3DQVC 1K61A 3G1LA 2XV4S 2WV0A 2DA4A 1ZYRF 5D5XB 5DM7F 3KYCB 2PJRB 5KAFC 4J01A 2PMZA 1ETWA 1DGWY 2RGVA 5DD4A 4OINF 3K2ZA 4A0ZA 3BR5A 3SEZA 1LQ1A 1Y0UA 2Y48A 4YFXF 1HXDA 2LNBA 2KJBA 3ZMZA 5FKOA 4OOIA 5LFAA 3MKWB 4TV7A 1WHUA 2NNNA 5ERIA 3N97A 1D1AA 5EJCA 4BQAA 4JK1X 4XLAA 2ECCA 4WCGA 3FK7A 4FQGA 3ZCOA 1Z91A 3F22A 1WPKA 3LA3A 3M9AA 5EEHA 4KA4A 4HPQA 3FM5A 2EJRA 2HDWA 4I99C 3NWTA 5D4RA 1LUJB 1QHGA 5E17F 3MWMA 1PYVA 4YFNF 2DYSH 3H0GJ 2Z5UA 2CW7A 4UUVA 2MA3A 3S3NA 1TWFJ 1G6NA 2F5EA 2O3FA 1APLC 4G9YA 1JJ6C 3V8KA 2XRNA 5JR3A 1FYKA 1H9GA 1IG7A 3DEEA 2QA4I 3GTLJ 1XS9A 3LSGA 2DFIA 4KT5C 1SANA 2QBYB 1S7EA 2E1MC 3CZ6A 4RM3A 5GTIC 3JTGA 4G12A 4GO1A 2R7TA 2WAFA 3NQOA 3GFLA 2QSFX 2XAJA 2DQRA 2BOLA 1RNLA 3A4CA 1WI9A 1IF1A 1F1ZA 1ZTRA 1MNEA 1ETXA 1GVJA 2VBZA 1AKHB 4XN0A 1LPQA 3O8GA 2FQ4A 1B59A 4BNCA 3WE3A 1WJDA 3OYCA 3HOSA 1X1DA 1HC8A 2JUCA 1W4MA 1MBJA 5LHIA 4Y15A 3G2BA 1IN5A 2J5OA 4XKCA 1VTNC 1T56A 3Q0WA 3OSGA 2MSYA 1B6AA 4HW0A 1GDTA 4PUSA 3M7GA 1Z21A 2DLLA 5BS6A 2BY2A 2LD5A 3VSLA 3CCQI 4LJZF 2ESHA 2CH0A 1R49A 5J4VA 3SQNA 2Z33A 2AXTC 1QPMA 2XASA 3QYBA 2XF7A 4BQOA 2KRHA 3GYHX 4XM3A 3C1DA 3LFKA 4MEXF 3GTKJ 1ZG5A 2DOEA 1XSVA 1PP8F 3GLLA 4XRMA 2EILH 3K10A 2HEOA 4RAGA 2CG4A 2IGNA 2Q2EB 4NQWB 1W5SA 2LFBA 2R5ZB 1X58A 3GVAA 3BG3A 2MW8A 2WY8Q 5FLVA 2QENA 1MSFC 3IHUA 1K78B 2VBXA 3M4OJ 2YS9A 4NB5A 1A36A 3FF5A 5FFZA 4HDUA 4LFUA 2HPIA 5EF6A 1MMAA 2V1DA 3LSRA 2OA4A 5CYVA 3F8FA 3FXQA 3I0TA 1W7PB 5E1WA 3J7ZI 1KU2A 5HODA 1FP1D 5JHUA 2HI3A 1V54H 3ZMVA 3QU3A 4AD9A 4RB1A 4ITVA 1JT6A 1ETQA 2KIMA 3CF5F 4IOCF 1TQIA 2EV0A 2QCOA 2XGXA 1YOVB 3FXJA 2EINH 2X9DA 1J9IA 2MLKA 2CQKA 3OS0A 2IA2A 3QWLA 3ABLH 3BTLA 2BW3B 3GTPJ 1BM9A 1XMKA 3BPXA 1LEBA 1JTYA 5LGTA 3H92A 2FU4A 3CO6C 2R4GA 3GZ6A 2P5VA 1FPQA 2W48A 4IVNA 1Z1DA 2NRAC 3F8MA 5F0FA 1B8IA 1VQOI 1RKTA 5JHFA 4LG0A 2E71A 2K9LA 1CF7A 2DMPA 1KA8A 3WTVC 4HV6A 5E1XA 1V3FA 4D7NA 1FZPB 4DZPA 3E5XA 2HXOA 3L9FA 5KVRA 4E7ZA 1LFBA 4MQVA 2BHYA 3JW4A 3D5LA 4NC8A 2ESNA 2IS6A 1IDZA 2ZSHB 1I27A 2JSCA 3HOXJ 3OV8A 4YELA 2VQHA 3K70C 2EA4A 1NG7A 3FKJA 5ILUA 2JPBA 4OIQF 3F8BA 3S32A 3S1NJ 5AIPA 4IQ4A 5F6FA 3QOEA 5L3GA 2XAFA 4OWRB 1UG2A 5E18F 1EJ9A 3C7JA 4UVAA 5E20A 4V19K 4E7LA 1KQ8A 1ZELA 2VL8A 4B3XA 2HS5A 2LR8A 1ETKA 3IWZA 3CCVI 4HLYA 3IH2A 4HZFA 2MH2A 3K4KA 1SC7A 1UJ8A 2J5PA 2R7FA 1D5VA 3D1NI 3E0JB 4LG3A 1E3HA 2WY7Q 3OYFA 5D5WB 4M9ZA 5IOYA 1DQUA 5D5UB 1IAWA 2VT3A 4ON0A 4ANJA 4C3IJ 1WSUA 2LYCA 3VOEA 5TRDA 2DO7A 4IHXA 2X6OA 3PFYA 3WTXC 3F8CA 2M2EA 2BV6A 4QIWN 2E19A 4I98B 2I10A 2R7OA 5F08A 5JVTA 3W2AA 4KIGA 2G0EA 2HOEA 3BLYA 3S14J 4ZYEA 1Y8RB 2DTZA 3E6DA 4BEHB 4M74A 4ZYHA 4F55A 4AVZA 1NK2P 1POGA 4LD5A 4HDVA 3HSRA 1V5EA 4ZYAA 2E2JJ 1SVLA 2JT1A 1HKSA 1XMAA 3KPHA 2ZNYA 3FM3A 4NC6A 2M30A 3E1SA 2LLKA 4UB6C 4H0EA 3ZMUA 5TGTA 4MTEA 3BJOA 3P5JA 2W57A 3SDGA 1OCOH 3Q9VA 3OYJA 2K27A 3PQJA 2K3FA 3HHHA 3M07A 2OC6A 4DGWB 3LWFA 1ERDA 1YITI 2NXNB 3K4BA 5E3MA 3W6KB 4UUSB 1OQYA 3EUKL 5HLHA 3JRHA 1X4OA 1WRJA 2LVSA 4LB6B 3ABKH 3KEYA 5LEKA 4CCOA 4Y7NJ 4PJMA 3DKXA 1MZBA 3GFIA 1QQIA 1WJ5A 1J75A 4EQQA 5CQEA 1R5HA 3DWLE 2DODA 3S1MJ 3C3WA 1HKQA 1W36D 1FWZA 2L7ZA 4UUSA 3Q9SA 3LA2A 3CC4I 1QZZA 3BQYA 2O9LA 3BCAA 3TO7A 5EG0B 1BR4A 4XOPA 2A5WA 4N4OB 1T08B 4DNCA 1XC5A 3LFUA 3QOPA 5LRSA 2W00A 4GXOA 2XAGA 1ZHFA 2LREA 5J8FA 1Y1WJ 1FY7A 2P81A 2QUFA 3ECHA 3G4SI 1IDYA 4L5JA 4ENMA 4M9SA 1XD7A 2Y69H 4E7KA 2HU9A 3ZXSA 1NTCA 2HKOA 3CJQB 3TOBA 4CSWA 2V9VA 3OS2A 1TL8A 2FUG2 2RQQA 1SVOA 3HZJA 4JBAA 2OQRA 2AQFA 2V1XA 2Q8KA 1R36A 1A31A 3BT9A 1XGSA 3ZQIA 4JP0A 3DCFA 1ENHA 2D5VA 2ZFUA 2NVUB 3L00A 3GUDA 5C4XJ 1AHDP 1ON1A 3WODF 2STWA 4IF4A 1Y0NA 1MH3A 2ZJPF 3PSFA 4L9VA 5GAEJ 2EWNA 1UHMA 4A3FJ 2XKOA 5KNLA 4I02A 4XNFA 4CYCA 2P7CB 3OYBA 1Y8QB 3ECOA 3A02A 5K1YA 4UB8C 2ZXWH 4LIUA 2EPFA 2FF4A 1QVUA 5FROA 3G6EI 4S04A 2DMQA 3F0CA 3DKWA 4BE1A 3K7AJ 3Q5FA 2VJ4A 2IGOA 3CDIA 3WHCA 2EFOA 3PO2J 4LGWA 3M1EA 4RAZA 4BQNA 1R7JA 2PG4A 3PSIA 4M72A 3BWGA 3HOUJ 2DW4A 1TWCJ 3AFHA 3GXOA 2LBFB 4AIHA 3K4MA 3KZYA 5FD6A 1MBFA 2VN2A 4BGDA 1ACIA 3GTMJ 4F93B 2RN7A 3VFZA 2DFEA 2XKPA 2VC1A 4XLFA 4UV8A 1NG6A 1UZCA 5CLSA 2PEXA 1Z77A 3KP2A 4UVBA 1D5YA 5FKMA 2E2HJ 1FOXA 2K9SA 5E8IA 4ZZLA 2JTVA 2R7QA 1JXSA 1YI2I 4IEJA 3FXKA 3GWZA 3MFKA 1BW5A 2QQ8A 3B6AA 4KN4X 3BR1A 1TP4A 1KU3A 1P4XA 1KZHA 1BN5A 2ZMEB 2E7XA 4A0YA 1OYWA 2JUGA 1BA5A 3ML6A 2H1KA 3W2WA 4BYYA 1FOWA 1LE8B 1AOYA 2LDUA 1NHAA 1JKPC 5BOXA 2F4MB 5K7ZA 3N05A 5K5QA 5F0HA 4CZCA 2EIMH 4XL9A 1XGOA 3X2QH 1IW7F 3ZQ7A 2F4IA 2VXZA 3CQZJ 1XGMA 1E17A 1D1CA 1WJAA 5HS9A 1REPC 2WAQA 1BI1A 1ZQ3P 1ZAOA 2YX7A 1TQPA 3ELKA 1MH4A 5JLWA 2OAZA 5C3EJ 4IZZA 1AU7A 2QQBA 4D1QA 4HOBA 1D3YA 2KLOA 3FXUA 1MNMC 1YX5A 4HNUA 1OCTC 4EMSA 2ZJ2A 2CMPA 3CUQB 5F1JA 1KQ9A 1I6XA 2VKHA 4G6DA 2JJ7A 3FXMA 3Q0UA 3RSNA 3CDLA 3ZP5A 5CVVA 4IHVA 1YRNA 3J81Z 1I50J 3PUBA 4HA8A 4J00A 4BE2A 2Y9ZA 5D6EA 3AL0B 4A3CJ 4IQJA 2V7FA 1TWAJ 4D5FA 2R3SA 1HW1A 4RLQA 4CHUA 1BC7C 4FCYA 4JX5A 1FC3A 1J7KA 2CV2A 1I3AA 1GUUA 3K69A 2CW0F 2JA7J 2E1OA 4PJJA 4MTDA 3JAMZ 1OMIA 1XCBA 4CCKA 4IO9F 1KU9A 1YLFA 1YX3A 3HJEA 1YO5C 2JMWA 1ZKGA 2DTRA 4MNUA 2HYGD 4MFDA 3OOUA 1VQLI 2B63J 3VWBA 1XX5A 4LIVA 1DDNA 2AQEA 2XUBA 2UXXA 1BW6A 4KJZA 4XN3A 4CCJA 4II2A 1NH3A 2JVGA 3ZN1A 4HF1A 2K40A 3CMAI 1VQPI 4IPAA 3MMYB 1JUMA 4NUBA 1W5TA 5LLQA 2VUMJ 1FIPA 2M3AA 4JOMA 4IHYA 3NARA 5L3EA 4U7DA 4GRIA 1G59A 2NS7A 3PNYA 4KN7X 4B47A 3SEQA 3ZQCA 1XPXA 4BHPA 4XIDA 3WTSC 3EYYA 1AKHA 1XG1A 3HYIA 2WWYA 1G2HA 5D8KB 1JE8A 2XPWA 1U5TA 1FYLA 1VQ5I 4NBQA 2M8EA 2D1HA 1HOMA 3K9TA 4IX7A 3KLNA 2CW8A 2YX4A 4ZYDA 5E3NA 1RUNA 4B48A 1MMGA 1KYWA 5IY5H 1IRFA 2GA1A 3QPLA 4BQQA 1SAUA 4XQFA 3MCZA 3E6MA 3T5XA 3I55I 2LOOA 2E1MB 1FT9A 5HDGA 2O6GE 2IP2A 4HNTA 4A3JJ 4AIKA 1PJRA 1X3WB 1OFCX 3S3OA 3GFJA 4U88A 3A2KA 4M6VA 3WGGA 2DA6A 1X19A 2LTPA 4NNJA 2RKHA 1V55H 2NVQJ 4F3QA 1BBYA 1I6HJ 1VI0A 1SFXA 1YHQI 3KP6A 2HVRA 3HSFA 2IRFG 2OUMA 1R5GA 2VKEA 4EJVA 4DYQA 1XTAA 2MLGA 3M8FA 1EH8A 2JPCA 2KRCA 5EEGA 3FISA 3FMSA 1LEAA 1IRGA 1S9HA 1FP2A 3G1MA 2VC0A 5B5EC 1UMQA 1SD7A 1B72A 1T6SA 3N4MA 1IN4A 1QPIA 3BY6A 3FHNA 2MC4A 4I6ZA 1U9OA 4NC7A 2G7HA 3KLOA 1BR1A 5D4SA 1Z0XA 4XRSA 2FNAA 1MW7A 3S3MA 3ABTA 3FXOA 4A5MA 2GAUA 3S8PA 4G94A 4A69C 2EB7A 3MKYB 4V2FA 1GHCA 3CJNA 2V9PA
chains in the Genus database with same CATH topology
3LSJA 2OF7A 4W97A 4A3GJ 2XGEA 1U8BA 4BY1J 1JT6A 3LOCA 5EGOB 3HBLA 1ETQA 3IH3A 3BTIA 2QCOA 3JRAA 3BG9A 5IOZA 2X9DA 3HGYA 5IP9J 5K7HA 3S17J 3BTLA 2DMTA 2Y0SN 3BR3A 1GT0C 2CU7A 2ID6A 3GTPJ 1BL0A 1B72B 1FEXA 1JTYA 4CYCB 1X2MA 3VPRA 2ME6A 2Y2ZA 2GBYA 3S2HJ 3L1PA 1WH5A 4FE4A 1DU0A 1RESA 4DZJA 2W48A 5F0FA 1B8IA 5FJ8J 4I76A 1RKTA 1X2NA 9ANTA 2OPTA 3K2AA 2DMPA 3TP3A 4MIMA 4D7NA 4DZPA 2YUSA 2HXOA 1P7JA 1LFBA 1NK3P 3HOVJ 1H88C 4XICA 2XPVA 4DW6A 2O8KA 1IDZA 2TRTA 2LKXA 4A3MJ 3A01B 4BXXJ 1OJLA 2DA2A 3HOXJ 4QTRA 3JRDA 2DA3A 2JWTA 2L7FP 3I4MJ 1ZR4A 1CQTA 3ZOBA 3S1NJ 2R5YA 1VNDA 2VKVA 1MBHA 3HKZN 1JKRC 3GTQJ 3BR2A 1UG2A 2EZKA 1F36A 1MBEA 4C2MJ 3PO3J 2CQQA 2LR8A 1ETKA 3IH2A 3LSPA 2HOSA 2XSDC 3D1NI 5J1UA 2ZB9A 3BQZA 2WAQN 3FKIJ 5IOYA 1VF9A 2NS8A 4IHWA 4C3IJ 1JGGA 1WGXA 3Q0VA 4IHXA 2X6OA 4A3KJ 3QPSA 2M2EA 3HOZJ 2HYJA 4QIWN 2E19A 1IGNA 2I10A 5F08A 2JA5J 4BBSJ 1RPWA 2R5ZA 2G0EA 3S14J 2WV1A 4JX6A 5E3LA 4A3EJ 3W6VA 2QF7A 2DTZA 4ABZA 4D7MA 1OCPA 2FJ1A 3CCYA 2M8GX 1NK2P 3RKQA 1POGA 3DEWA 4B1RA 1FIAA 1JJ8C 2E2JJ 4B4CA 3RQIA 3RZDJ 4M3DA 5F04A 2LLKA 5EZHA 1LE8A 3S15J 2XRLA 3SDGA 4FISA 3RZOJ 3S2DJ 2ELKA 2R93J 2M0CA 5FKKA 1P7IA 1FTTA 4FE7A 2KT0A 2NOGA 3WHBA 5E3MA 5IYDJ 2HXIA 4X6AJ 4JX4A 4UUSB 1TWGJ 3JRIA 3JREA 1JTXA 4DYRA 3JRHA 3E7LA 4FTHA 2LVSA 2LK2A 2JA6J 3TW7A 1YRNB 5C4JJ 3JRFA 4D5CA 4J19A 2R5YB 4Y7NJ 1O4XA 1Y1VJ 2VI6A 3BG5A 2NVYJ 2MG4A 3BR6A 3A01A 4M3EA 3NAUA 4RDUA 5EEAA 1WI3A 2K9QA 3S1MJ 1ITYA 4UUSA 1ORKA 2L7ZA 5K7FA 2N8GA 3BQYA 2FD5A 2O9LA 5EG0B 1ZGWA 3UKGA 5F27A 2DA1A 1IUFA 1ETOA 1RR7A 1XC5A 1GV5A 3SFIA 1IJWC 1Q1VA 4AYBN 1Y1WJ 2X48A 2P81A 2XB0X 5DTDA 2O7OA 1IDYA 2CUEA 1JUSA 2Y31A 1H89C 1NTCA 3H3VK 3PM1A 1I3QJ 1WH7A 3HGGA 3HM5A 5GPCA 1HF0A 2CQXA 3CMYA 3MN2A 5IP7J 3BT9A 4M3BA 3ZQIA 4JP0A 3DCFA 1ENHA 2D5VA 2NVXJ 4A3DJ 3BTJA 2DA5A 1UHSA 3S16J 3JRGA 1MBGA 5C44J 2YU9J 5C4XJ 1AHDP 5FKLA 1W0UA 1ZK8A 5M5XJ 1MH3A 5E3OA 5M5WJ 2EBIA 3ZQHA 1IV6A 1F43A 5JLXA 5F0CA 4A3FJ 3HOYJ 1HDPA 4CYCA 4S0HB 3BR0A 3A02A 2JK3A 2DA7A 3S1QJ 3LNQA 2CJJA 3ZQFA 4V2GA 5M3FJ 2ECBA 1QVUA 2R7ZJ 2XB5A 2DMQA 2K9NA 2PMZN 3F0CA 3K7AJ 4QSHA 3JR9A 1U9NA 3WHCA 3PO2J 4Y52J 3GBGA 2DN0A 4L5EA 3SJMA 1GV2A 2Y9YA 4MO7A 2HDDA 3HOUJ 1TWCJ 4EEFG 1MBFA 1MSEC 3GTMJ 5BNGA 1QRYA 3OIOA 4XK4A 2M9HA 1FJLA 3MVPA 3GTGJ 1A6IA 1Z77A 1D5YA 2NVTJ 5FKMA 4AC0A 2E2HJ 2K9SA 2JA8J 2M34A 3G1OA 4IEJA 5DS9A 1TWHJ 5M5YJ 2Y30A 2XGDA 3ZQLA 1BW5A 3Q3SA 3B6AA 3BR1A 1JT0A 3TW6A 2R92J 5EG0A 1HDDC 1BA5A 5EDNA 2H1KA 1LE8B 2GM4A 1HCRA 1JKOC 4XRSG 1JKPC 5K7ZA 5F0HA 2HOTA 3MKLA 2EH3A 2EZHA 3CQZJ 2H8RA 2IAIA 2HOAA 3ZQGA 2AHQA 1H8AC 1JUPA 2L9RA 1ZQ3P 2E2IJ 1U78A 1SFOJ 3S1RJ 2EQRA 1MH4A 3BTCA 5JLWA 5C3EJ 1AU7A 1A5JA 1IRZA 1EF4A 5IP6A 1MBKA 1MNMC 4JYKA 5M3MJ 1OCTC 5GP9A 3TEDA 5F1JA 5EGOA 1PUFB 3FIWA 1ETVA 4RBOA 2JJ7A 1K61A 2RAEA 3G1LA 3Q0UA 4M3FA 3CDLA 4IHVA 1YRNA 1I50J 2DA4A 4LOCA 2DMNA 1R9TJ 4A3IJ 2Y9ZA 4A3CJ 1ETWA 1VFCA 1DU6A 1E3OC 3BR5A 1TWAJ 1HLVA 1QVTA 2IBDA 4D5FA 5FKOA 1GVDA 4M3GA 4FCYA 4X1EA 4JX5A 2XGCA 2DMUA 3JRCA 1GUUA 2ECCA 4MFEA 2JA7J 5J3LA 2E1OA 3FK7A 1WPKA 4UUTA 2COBA 3O8HA 2JMWA 1ZKGA 2TCTA 4C3HJ 1K83J 2XPUA 4MFDA 3OOUA 2B63J 2ME0A 2FX0A 3H0GJ 1TC3C 1BW6A 1PUFA 2MGQA 5FKNA 2EZIA 2R0QC 1TWFJ 4A3BJ 4GFBA 3B6CA 5IYCJ 1APLC 1JJ6C 2K40A 2KDZA 4W1UA 3GTJJ 1JUMA 1IG7A 2VUMJ 3GTLJ 1FIPA 1XS9A 3LSGA 1BJZA 1SANA 4IHYA 3M3YJ 1S7EA 3NARA 1LFUP 2NS7A 3ZQCA 3IV5A 4G12A 4XIDA 1AKHA 1XG1A 2ID3A 2AO9A 4NDLA 1G2HA 4A93J 2XPWA 2VPRA 3HB9A 3GTOJ 2CRGA 1ZTRA 2DJNA 4HNVA 1ETXA 5IPAA 1AKHB 3JRBA 1HOMA 3O8GA 1W0TA 2FQ4A 3HEFA 4AUXA 1FTZA 2EZLA 5E3NA 3A03A 1ETYA 4BBRJ 2CUFA 3QPLA 3I4NJ 4B3AA 2L0KA 1MBJA 3HOWJ 3C2BA 2GLOA 5J1YA 1T56A 3Q0WA 3OSGA 2MSYA 4BKXA 1JKQC 4A3LJ 1GDTA 4A3JJ 1OFCX 4M6VA 2DA6A 2LD5A 2LTPA 2NVQJ 2HQ5A 1I6HJ 1VI0A 1B8IB 5J1RA 3TP0A 1ZR2A 2VKEA 3GTKJ 4DYQA 4MLOA 3QQAA 4XRMA 3FISA 5EYRA 5GPAA 2LFBA 3G1MA 2LY9A 5EZGA 2JN6A 1UMQA 3BG3A 1X58A 1T33A 2MW8A 4DYCA 1WCMJ 2R5ZB 3OSFA 2L7MP 1B72A 1QPIA 5FLVA 1MSFC 4I6ZA 1U9OA 4C3JJ 3M4OJ 2LP0A 2YS9A 3IH4A 1Z0XA 4XRSA 5FLMJ 2WB1N 5EF6A 5IYBJ 3LSRA 2IEKA 4A69C 1RKWA 4BY7J 3FK6A 5HODA 1RETA 4V2FA 3HDDA 2HI3A 1IC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSJ A;  2OF7 A;  4W97 A;  4A3G J;  2XGE A;  1U8B A;  4BY1 J;  1JT6 A;  3LOC A;  5EGO B;  3HBL A;  1ETQ A;  3IH3 A;  3BTI A;  2QCO A;  3JRA A;  3BG9 A;  5IOZ A;  2X9D A;  3HGY A;  5IP9 J;  5K7H A;  3S17 J;  3BTL A;  2DMT A;  2Y0S N;  3BR3 A;  1GT0 C;  2CU7 A;  2ID6 A;  3GTP J;  1BL0 A;  1B72 B;  1FEX A;  1JTY A;  4CYC B;  1X2M A;  3VPR A;  2ME6 A;  2Y2Z A;  2GBY A;  3S2H J;  3L1P A;  1WH5 A;  4FE4 A;  1DU0 A;  1RES A;  4DZJ A;  2W48 A;  5F0F A;  1B8I A;  5FJ8 J;  4I76 A;  1RKT A;  1X2N A;  9ANT A;  2OPT A;  3K2A A;  2DMP A;  3TP3 A;  4MIM A;  4D7N A;  4DZP A;  2YUS A;  2HXO A;  1P7J A;  1LFB A;  1NK3 P;  3HOV J;  1H88 C;  4XIC A;  2XPV A;  4DW6 A;  2O8K A;  1IDZ A;  2TRT A;  2LKX A;  4A3M J;  3A01 B;  4BXX J;  1OJL A;  2DA2 A;  3HOX J;  4QTR A;  3JRD A;  2DA3 A;  2JWT A;  2L7F P;  3I4M J;  1ZR4 A;  1CQT A;  3ZOB A;  3S1N J;  2R5Y A;  1VND A;  2VKV A;  1MBH A;  3HKZ N;  1JKR C;  3GTQ J;  3BR2 A;  1UG2 A;  2EZK A;  1F36 A;  1MBE A;  4C2M J;  3PO3 J;  2CQQ A;  2LR8 A;  1ETK A;  3IH2 A;  3LSP A;  2HOS A;  2XSD C;  3D1N I;  5J1U A;  2ZB9 A;  3BQZ A;  2WAQ N;  3FKI J;  5IOY A;  1VF9 A;  2NS8 A;  4IHW A;  4C3I J;  1JGG A;  1WGX A;  3Q0V A;  4IHX A;  2X6O A;  4A3K J;  3QPS A;  2M2E A;  3HOZ J;  2HYJ A;  4QIW N;  2E19 A;  1IGN A;  2I10 A;  5F08 A;  2JA5 J;  4BBS J;  1RPW A;  2R5Z A;  2G0E A;  3S14 J;  2WV1 A;  4JX6 A;  5E3L A;  4A3E J;  3W6V A;  2QF7 A;  2DTZ A;  4ABZ A;  4D7M A;  1OCP A;  2FJ1 A;  3CCY A;  2M8G X;  1NK2 P;  3RKQ A;  1POG A;  3DEW A;  4B1R A;  1FIA A;  1JJ8 C;  2E2J J;  4B4C A;  3RQI A;  3RZD J;  4M3D A;  5F04 A;  2LLK A;  5EZH A;  1LE8 A;  3S15 J;  2XRL A;  3SDG A;  4FIS A;  3RZO J;  3S2D J;  2ELK A;  2R93 J;  2M0C A;  5FKK A;  1P7I A;  1FTT A;  4FE7 A;  2KT0 A;  2NOG A;  3WHB A;  5E3M A;  5IYD J;  2HXI A;  4X6A J;  4JX4 A;  4UUS B;  1TWG J;  3JRI A;  3JRE A;  1JTX A;  4DYR A;  3JRH A;  3E7L A;  4FTH A;  2LVS A;  2LK2 A;  2JA6 J;  3TW7 A;  1YRN B;  5C4J J;  3JRF A;  4D5C A;  4J19 A;  2R5Y B;  4Y7N J;  1O4X A;  1Y1V J;  2VI6 A;  3BG5 A;  2NVY J;  2MG4 A;  3BR6 A;  3A01 A;  4M3E A;  3NAU A;  4RDU A;  5EEA A;  1WI3 A;  2K9Q A;  3S1M J;  1ITY A;  4UUS A;  1ORK A;  2L7Z A;  5K7F A;  2N8G A;  3BQY A;  2FD5 A;  2O9L A;  5EG0 B;  1ZGW A;  3UKG A;  5F27 A;  2DA1 A;  1IUF A;  1ETO A;  1RR7 A;  1XC5 A;  1GV5 A;  3SFI A;  1IJW C;  1Q1V A;  4AYB N;  1Y1W J;  2X48 A;  2P81 A;  2XB0 X;  5DTD A;  2O7O A;  1IDY A;  2CUE A;  1JUS A;  2Y31 A;  1H89 C;  1NTC A;  3H3V K;  3PM1 A;  1I3Q J;  1WH7 A;  3HGG A;  3HM5 A;  5GPC A;  1HF0 A;  2CQX A;  3CMY A;  3MN2 A;  5IP7 J;  3BT9 A;  4M3B A;  3ZQI A;  4JP0 A;  3DCF A;  1ENH A;  2D5V A;  2NVX J;  4A3D J;  3BTJ A;  2DA5 A;  1UHS A;  3S16 J;  3JRG A;  1MBG A;  5C44 J;  2YU9 J;  5C4X J;  1AHD P;  5FKL A;  1W0U A;  1ZK8 A;  5M5X J;  1MH3 A;  5E3O A;  5M5W J;  2EBI A;  3ZQH A;  1IV6 A;  1F43 A;  5JLX A;  5F0C A;  4A3F J;  3HOY J;  1HDP A;  4CYC A;  4S0H B;  3BR0 A;  3A02 A;  2JK3 A;  2DA7 A;  3S1Q J;  3LNQ A;  2CJJ A;  3ZQF A;  4V2G A;  5M3F J;  2ECB A;  1QVU A;  2R7Z J;  2XB5 A;  2DMQ A;  2K9N A;  2PMZ N;  3F0C A;  3K7A J;  4QSH A;  3JR9 A;  1U9N A;  3WHC A;  3PO2 J;  4Y52 J;  3GBG A;  2DN0 A;  4L5E A;  3SJM A;  1GV2 A;  2Y9Y A;  4MO7 A;  2HDD A;  3HOU J;  1TWC J;  4EEF G;  1MBF A;  1MSE C;  3GTM J;  5BNG A;  1QRY A;  3OIO A;  4XK4 A;  2M9H A;  1FJL A;  3MVP A;  3GTG J;  1A6I A;  1Z77 A;  1D5Y A;  2NVT J;  5FKM A;  4AC0 A;  2E2H J;  2K9S A;  2JA8 J;  2M34 A;  3G1O A;  4IEJ A;  5DS9 A;  1TWH J;  5M5Y J;  2Y30 A;  2XGD A;  3ZQL A;  1BW5 A;  3Q3S A;  3B6A A;  3BR1 A;  1JT0 A;  3TW6 A;  2R92 J;  5EG0 A;  1HDD C;  1BA5 A;  5EDN A;  2H1K A;  1LE8 B;  2GM4 A;  1HCR A;  1JKO C;  4XRS G;  1JKP C;  5K7Z A;  5F0H A;  2HOT A;  3MKL A;  2EH3 A;  2EZH A;  3CQZ J;  2H8R A;  2IAI A;  2HOA A;  3ZQG A;  2AHQ A;  1H8A C;  1JUP A;  2L9R A;  1ZQ3 P;  2E2I J;  1U78 A;  1SFO J;  3S1R J;  2EQR A;  1MH4 A;  3BTC A;  5JLW A;  5C3E J;  1AU7 A;  1A5J A;  1IRZ A;  1EF4 A;  5IP6 A;  1MBK A;  1MNM C;  4JYK A;  5M3M J;  1OCT C;  5GP9 A;  3TED A;  5F1J A;  5EGO A;  1PUF B;  3FIW A;  1ETV A;  4RBO A;  2JJ7 A;  1K61 A;  2RAE A;  3G1L A;  3Q0U A;  4M3F A;  3CDL A;  4IHV A;  1YRN A;  1I50 J;  2DA4 A;  4LOC A;  2DMN A;  1R9T J;  4A3I J;  2Y9Z A;  4A3C J;  1ETW A;  1VFC A;  1DU6 A;  1E3O C;  3BR5 A;  1TWA J;  1HLV A;  1QVT A;  2IBD A;  4D5F A;  5FKO A;  1GVD A;  4M3G A;  4FCY A;  4X1E A;  4JX5 A;  2XGC A;  2DMU A;  3JRC A;  1GUU A;  2ECC A;  4MFE A;  2JA7 J;  5J3L A;  2E1O A;  3FK7 A;  1WPK A;  4UUT A;  2COB A;  3O8H A;  2JMW A;  1ZKG A;  2TCT A;  4C3H J;  1K83 J;  2XPU A;  4MFD A;  3OOU A;  2B63 J;  2ME0 A;  2FX0 A;  3H0G J;  1TC3 C;  1BW6 A;  1PUF A;  2MGQ A;  5FKN A;  2EZI A;  2R0Q C;  1TWF J;  4A3B J;  4GFB A;  3B6C A;  5IYC J;  1APL C;  1JJ6 C;  2K40 A;  2KDZ A;  4W1U A;  3GTJ J;  1JUM A;  1IG7 A;  2VUM J;  3GTL J;  1FIP A;  1XS9 A;  3LSG A;  1BJZ A;  1SAN A;  4IHY A;  3M3Y J;  1S7E A;  3NAR A;  1LFU P;  2NS7 A;  3ZQC A;  3IV5 A;  4G12 A;  4XID A;  1AKH A;  1XG1 A;  2ID3 A;  2AO9 A;  4NDL A;  1G2H A;  4A93 J;  2XPW A;  2VPR A;  3HB9 A;  3GTO J;  2CRG A;  1ZTR A;  2DJN A;  4HNV A;  1ETX A;  5IPA A;  1AKH B;  3JRB A;  1HOM A;  3O8G A;  1W0T A;  2FQ4 A;  3HEF A;  4AUX A;  1FTZ A;  2EZL A;  5E3N A;  3A03 A;  1ETY A;  4BBR J;  2CUF A;  3QPL A;  3I4N J;  4B3A A;  2L0K A;  1MBJ A;  3HOW J;  3C2B A;  2GLO A;  5J1Y A;  1T56 A;  3Q0W A;  3OSG A;  2MSY A;  4BKX A;  1JKQ C;  4A3L J;  1GDT A;  4A3J J;  1OFC X;  4M6V A;  2DA6 A;  2LD5 A;  2LTP A;  2NVQ J;  2HQ5 A;  1I6H J;  1VI0 A;  1B8I B;  5J1R A;  3TP0 A;  1ZR2 A;  2VKE A;  3GTK J;  4DYQ A;  4MLO A;  3QQA A;  4XRM A;  3FIS A;  5EYR A;  5GPA A;  2LFB A;  3G1M A;  2LY9 A;  5EZG A;  2JN6 A;  1UMQ A;  3BG3 A;  1X58 A;  1T33 A;  2MW8 A;  4DYC A;  1WCM J;  2R5Z B;  3OSF A;  2L7M P;  1B72 A;  1QPI A;  5FLV A;  1MSF C;  4I6Z A;  1U9O A;  4C3J J;  3M4O J;  2LP0 A;  2YS9 A;  3IH4 A;  1Z0X A;  4XRS A;  5FLM J;  2WB1 N;  5EF6 A;  5IYB J;  3LSR A;  2IEK A;  4A69 C;  1RKW A;  4BY7 J;  3FK6 A;  5HOD A;  1RET A;  4V2F A;  3HDD A;  2HI3 A;  1IC8 A; 
#chains in the Genus database with same CATH topology
 2OF7 A;  4ZDL A;  4RAF A;  3WTZ A;  4BY1 J;  4N9H A;  1Z6R A;  3HBL A;  4HF0 A;  3IH3 A;  3BTI A;  5GTH C;  3DBR B;  2OTJ I;  3VYR B;  2IVM A;  3I56 I;  2GWR A;  3K4L A;  3R6S A;  5IP9 J;  2WAE A;  2KQR A;  3KP4 A;  1UCR A;  3H0D A;  2UXN A;  4MHG A;  3MD2 A;  2WC2 A;  4UVC A;  1BIA A;  4YIF A;  3HTS B;  3L2V A;  1C0W A;  2QKM B;  2CV1 A;  1B72 B;  1FEX A;  3CD6 I;  3WTY C;  2PJP A;  2Y2Z A;  3WU2 C;  1WH5 A;  3FMQ A;  3I59 B;  3L1P A;  1I1S A;  1SD6 A;  3C18 A;  3W2V A;  1HSJ A;  4G6Q A;  5FB2 A;  2CFO A;  2F5V A;  3ZMS A;  2M1B A;  3GCM A;  2KPM A;  3CTA A;  3FXL A;  1RIO H;  2Y0S A;  5FJ8 J;  1SVM A;  2LG4 A;  2R7X A;  5ICC A;  3TDU C;  1BC8 C;  2IT0 A;  2G7U A;  2LKP A;  3TP3 A;  2V26 A;  2XC7 A;  2VJJ A;  1STZ A;  2QQA A;  3S93 A;  4GDF A;  4EAT A;  2YUS A;  3O6B B;  3OR1 C;  1R1V A;  1QO0 D;  2CSO A;  1R22 A;  3LAP A;  1IUY A;  3M1C A;  4XIC A;  4DW6 A;  2V1U A;  3ZN0 A;  4DBR A;  2TRT A;  2LH9 A;  2LKX A;  4A3M J;  4ASN A;  3H5N A;  2KRF A;  1I5Z A;  1D1B A;  2DA3 A;  3U1D A;  3J81 K;  2EFW A;  1ODD A;  4HG2 A;  1ZR4 A;  4UV9 A;  5HDN A;  4IKF A;  2VKV A;  2V4J C;  3HKZ N;  3BZK A;  1SFK A;  4RB0 A;  1K7A A;  3D0S A;  4RB3 C;  4KFC A;  2EZK A;  1RUO A;  4KMF A;  4C2M J;  2HVS A;  1VQN I;  3PO3 J;  3DPT A;  3F6O A;  4LLG F;  4OIR F;  2E5N A;  2XVC A;  3K0L A;  3RKW A;  4RGX A;  3LSP A;  1T0F C;  2XSD C;  2X51 A;  3BQZ A;  4E70 A;  1T39 A;  2X6X A;  3ABM H;  3PQK A;  2GOM A;  2WAQ N;  3BZC A;  5DCM A;  3H35 A;  3DFG A;  4IHW A;  1BI2 A;  3CUQ C;  2BY0 A;  4BJT A;  1WGX A;  1IN6 A;  3A1Y A;  4HBL A;  4AWX B;  4OMZ A;  1FYM A;  4A3K J;  3PFI A;  1OCZ H;  3HOZ J;  4MGR A;  1MJB A;  2LRD A;  2E1C A;  1LVK A;  3AL0 C;  1YJ9 I;  5HVQ C;  4ZC3 A;  2WV1 A;  4JX6 A;  5E3L A;  3EUH A;  4LK0 F;  2DQL A;  1YQA A;  3ONQ A;  1OCP A;  1TNS A;  4XR6 A;  1E0E A;  1G8X A;  2ZME A;  3OS1 A;  1J09 A;  2ZFW A;  3DEW A;  4B1R A;  1FIA A;  2XHK A;  1JJ8 C;  4DJA A;  2G9W A;  4B4C A;  3OYA A;  3GFM A;  2YPR A;  4HYE A;  2HZD A;  1M1E B;  4I7H A;  3WTT C;  4M3D A;  3RZD J;  4E7I A;  2ACJ A;  1YYV A;  2X4H A;  2IS2 A;  2ADU A;  3E6B A;  2A68 F;  4ZJZ A;  1QZY A;  4AYB A;  1SD5 A;  4FIS A;  2VBW A;  1L3L A;  4UY8 I;  3S2D J;  2ELK A;  2ZME C;  2VB6 A;  3E5U A;  3LAJ A;  3SXY A;  1P7I A;  4C9Y A;  2KT0 A;  3M8E A;  3WHB A;  4KYW A;  1WZ2 A;  4KDP A;  5IYD J;  2Z99 A;  3CC2 I;  3DKY A;  4X6A J;  3E5Q A;  3JRI A;  1YW7 A;  4DYR A;  3E7L A;  4FTH A;  2P6S A;  1X1A A;  3K6G A;  3OYI A;  3TW7 A;  1YRN B;  4BL0 B;  4D5C A;  3TKY A;  3V42 A;  4J19 A;  1O3R A;  3G3Z A;  5DUK A;  4O6J A;  3KEQ A;  1JHH A;  5FRM A;  4XOT A;  3CUQ A;  2IS1 A;  4M3E A;  3QU6 A;  3NAU A;  4Z2Y A;  4RDU A;  2HNH A;  3HRS A;  2F5D A;  2KIQ A;  3U9G A;  5EEA A;  1WI3 A;  2K9Q A;  5ICG A;  1ITY A;  5K7F A;  3CCM I;  1T0F A;  2ELH A;  4HX8 A;  3ZRG A;  2FBI A;  1RC9 A;  1KU7 A;  1G3Y A;  1HST A;  4HSR A;  1ZGW A;  3U2R A;  5F27 A;  1F4K A;  3MQ0 A;  4Y4R A;  2OCE A;  4PCQ A;  1ETO A;  1RR7 A;  3DLA A;  1OCC H;  4XSX F;  2Z3Y A;  3I71 A;  2W7N A;  1IJW C;  2AXL A;  2OTL I;  2IW5 A;  2VQC A;  1YJN I;  1ZAR A;  2BXY A;  2V9K A;  3DV8 A;  3TO9 A;  5DTD A;  4YRV A;  2CUE A;  2HQN A;  1V5G A;  3T8T A;  1FOY A;  4AU7 A;  4HX7 A;  1QGP A;  4CH7 A;  4CCL A;  1QNT A;  3RPQ A;  5FLX K;  2BY3 A;  5CQG A;  5LBQ A;  1I3Q J;  3TDZ C;  3V7C A;  4FX4 A;  5BPD A;  1WJB A;  3HM5 A;  3T1B A;  5HLG A;  1HF0 A;  2YU3 A;  1QBJ A;  3U1K A;  4UNO A;  2HR3 A;  2P5L C;  1YG2 A;  2QQ9 A;  1OR7 A;  5D6F A;  3CCU I;  2BEO A;  2BZT A;  2BBY A;  5H6R A;  1LDJ A;  2O61 A;  2FMY A;  3JRG A;  1VQ7 I;  5C44 J;  3VDX A;  4R8H A;  5FKL A;  4A6D A;  5M5X J;  4U0W A;  2HTJ A;  5E3O A;  2EBI A;  4CGZ A;  4QPQ A;  4OU0 A;  3MEX A;  5JLX A;  3K1N A;  5F0C A;  2R7W A;  2A5Y B;  4XLC A;  5FO5 A;  2FQ3 A;  3BJA A;  3BR0 A;  2KZV A;  2E36 A;  2DA7 A;  1P4W A;  2QKL B;  4BHC A;  4F92 B;  4HF2 A;  2CJJ A;  3ZQF A;  4D9J A;  1XSD A;  1XSX A;  5M3F J;  2V1N A;  4YIR X;  3LQQ A;  3H3U A;  1FNN A;  2FML A;  2K9N A;  3JR9 A;  4ZH4 F;  1U9N A;  1EH6 A;  1PP7 U;  4M6X A;  4L5E A;  3SJM A;  1XN7 A;  2Y9Y A;  1CGP A;  4MO7 A;  2HDD A;  3O2P E;  3DTK A;  2HQA A;  4YG2 F;  1MSE C;  3FBI B;  3BCB A;  5E8G A;  4YII A;  1UG0 A;  2E34 A;  3PNT A;  4FHT A;  1W1W E;  3OIO A;  3BP8 A;  2K9M A;  4K2E A;  2L02 A;  3QPT A;  2GXG A;  3G71 I;  4L5I A;  4EJU A;  4FET A;  3L2Q A;  4S05 A;  2VPL A;  1FLI A;  4DQ2 A;  4GGG A;  2LF7 A;  3EUH C;  3IRQ A;  2DXI A;  5DS9 A;  2HPM A;  3V7S A;  4ZDP A;  1Y56 A;  2DK8 A;  3W6J B;  3ZQL A;  3UR3 C;  4I0A A;  1UEL B;  2K7L A;  3R60 A;  1WKM A;  2OJE D;  5L3B A;  2R92 J;  4ZDO A;  3CMM A;  4P1W A;  1R23 A;  4PJN A;  3KP3 A;  1A35 A;  2GM4 A;  1HCR A;  1JKO C;  2M45 A;  2PFB A;  1YE9 A;  1X1P A;  1WJC A;  2ISY A;  1MIJ A;  4WXH A;  4BHB A;  4ZTF A;  1J0R A;  2H1L A;  2DT6 A;  3V7R A;  2QBY A;  2L9R A;  1K79 A;  2A6E F;  3MZH A;  1SFO J;  2LBF A;  2EQR A;  3OWT A;  3S1R J;  1A5J A;  3CLQ A;  4BDY A;  3HRU A;  5J40 A;  4XLP F;  1XMX A;  1QA6 A;  4JYK A;  1T95 A;  5BQT A;  3TED A;  1X4P A;  1IN7 A;  5EGO A;  1P9Q C;  3EYI A;  3DPL C;  4N0B A;  1IXS B;  4AIJ A;  2FBK A;  5ILV A;  2WB1 A;  3I9V 2;  3TQN A;  2L9S A;  3CP2 A;  2DJI A;  3KEO A;  2DMN A;  4EV0 A;  2KL4 A;  4A3I J;  2L9V A;  1R9T J;  2BXZ A;  3W3C A;  2BGC A;  4B44 A;  2EFQ A;  2R7U A;  1DU6 A;  1E3O C;  3MZY A;  1BOB A;  1J2X A;  3RYR A;  1G3W A;  1R6R A;  4Y33 A;  1HLV A;  3VYT B;  1Z05 A;  1G3T A;  3H9G A;  1GVD A;  3P9C A;  4M3G A;  3KZZ A;  1CF7 B;  1UB9 A;  4BXF A;  3QYF A;  4E6K G;  5BMZ A;  4XLE A;  4PSW A;  2XGC A;  3CLO A;  2DT5 A;  4QPO A;  3JRC A;  4ESJ A;  3SDB A;  5JI6 A;  2HVQ A;  1I1G A;  2MAB A;  4Q5S F;  3HUG B;  2A6H F;  2COB A;  3ISP A;  3O8H A;  4B09 A;  4ZTJ A;  1W7P D;  2XPU A;  2E60 A;  3VYU B;  1LFP A;  4AVP A;  2IA1 A;  3WTW C;  4AM3 A;  3K1M A;  3HUG A;  2R7V A;  2ME0 A;  2FX0 A;  4A12 A;  2QLZ A;  3PJR A;  4IHS A;  3HRM A;  4OAY A;  4Y13 A;  1PUF A;  1S5L C;  4Q47 A;  3PIO F;  2L54 A;  2EZI A;  4PFP A;  3T8R A;  2CV0 A;  4A3B J;  2XF6 A;  4GFB A;  4F52 A;  2YSR A;  4A5N A;  3FX3 A;  4W1U A;  2JVH A;  3HTU A;  1XDS A;  2B7E A;  3GTJ J;  3F21 A;  2X6Y A;  4XMY A;  1WVR A;  3GF2 A;  1K6Y A;  5CPR B;  1BJZ A;  3EQL F;  4KT6 A;  3M3Y J;  3CP8 A;  1X1B A;  1LFU P;  3RPU A;  2OZU A;  2ZKZ A;  4GYG A;  2VIX A;  1E2X A;  2ID3 A;  1S7A A;  5ED4 A;  2MYS A;  2A05 A;  4EJO A;  2RC4 A;  3GTO J;  1U0J A;  5IPA A;  3JRB A;  1TQM A;  1W0T A;  5CKT A;  3DF8 A;  5GAG J;  2EZL A;  4WWC A;  5DV5 A;  2IS4 A;  3IL2 A;  5DCF A;  2RRE A;  2O03 A;  3I4N J;  3BC8 A;  4P55 A;  4B3A A;  2L0K A;  5LHG A;  1QU3 A;  3HOW J;  2GLO A;  2CFX A;  5CJ9 A;  2VQL A;  1MKM A;  5LHH A;  1ZRE A;  4IRI A;  2K4B A;  3B02 A;  4KUM A;  3TMO A;  2PQ8 A;  4HLX A;  4L9N A;  3GME A;  3LA7 A;  1DUX C;  3SHF A;  4HRI A;  2HQ5 A;  4U0V A;  3L7W A;  3KET A;  2JQ7 A;  1YS6 A;  1O3S A;  5J1R A;  1B8I B;  2RDP A;  1OCR H;  1P4A A;  4IHT A;  2MD5 A;  3VYS B;  4MLO A;  3F23 A;  1IRX A;  5DUI A;  3CCR I;  4L9J A;  2LY1 A;  4U7B A;  3J80 Z;  2A69 F;  5EZG A;  5B3S H;  2CGP A;  3OSF A;  4KIC A;  2EFN A;  1H9T A;  1H0M A;  1B1B A;  3OYL A;  1L0O C;  4C3J J;  2LP0 A;  3DBH B;  3IH4 A;  1OIS A;  2NNY A;  3QAH A;  4EM0 B;  4IRG A;  3E3V A;  2QWW A;  1MMD A;  4MQ9 F;  1YIJ I;  4EJT A;  2IEK A;  1RKW A;  4EGZ A;  1ZG3 A;  4XKV A;  4OAZ A;  4E7J A;  3HDD A;  2LMD A;  1IXC A;  3ABU A;  3LSJ A;  2RNG A;  4A3G J;  2XGE A;  1U8B A;  2XSJ C;  4YFK F;  2OCC H;  3JRA A;  3BG9 A;  5IOZ A;  2VE8 A;  1N77 A;  3HGY A;  3MKZ A;  1R4N B;  4OIP F;  5J8C A;  5K7H A;  1DP3 A;  3H9Q A;  1RRJ A;  2C6Y A;  1WQ2 A;  4I2O A;  2Y0S N;  3BR3 A;  3ZGK A;  2CU7 A;  2ID6 A;  2VAS A;  3BRO A;  3DP7 A;  3BJ6 A;  4Y3O A;  1FMW A;  3RJP A;  1SD4 A;  2EIK H;  3CF2 A;  1PUE E;  2ME6 A;  3ZMT A;  3S2H J;  5L3F A;  1Z7L A;  2E5Z A;  3WE2 A;  1MDM A;  5H2F C;  1ZH5 A;  1RZ4 A;  3V8J A;  4DZJ A;  2DYR H;  2AS5 F;  1SEU A;  1KGS A;  1HBX G;  1X2N A;  3RQ4 A;  3F9K A;  4E4H A;  9ANT A;  2NYX A;  3K1P A;  5KHD A;  3K2A A;  2ZJQ F;  2H8W A;  2BVM A;  3RYP A;  4G6T B;  2ZNZ A;  1UHW A;  2ZBK A;  1IO2 A;  3AG2 H;  2ZXJ A;  2KKO A;  5ILS A;  4HQE A;  4R79 A;  1H88 C;  3HOV J;  2Y75 A;  3V4G A;  1U5T B;  2O8K A;  3J7Y J;  2MFZ A;  2QZ8 A;  3A01 B;  2DA2 A;  2COM A;  3JRD A;  4CCM A;  2VOO A;  3I4M J;  3O3K A;  2XF5 A;  2X1C A;  5FD5 A;  2R5Y A;  2DPD A;  1VND A;  3RKX A;  1MBH A;  3MAJ A;  4A2U A;  4BJ6 C;  2L9N A;  2IPQ X;  3I4P A;  3OIP A;  3OYH A;  4CCN A;  4FAS D;  4MEY F;  2B9S A;  3WG9 A;  2L4A A;  5FFX A;  3CCJ I;  2HOS A;  2MH9 A;  5D8L B;  4G8X A;  4XBF A;  1IZ1 A;  3FKI J;  3RTR A;  1XDU A;  4L0Y B;  1VF9 A;  2NS8 A;  1ZN2 A;  2PMU A;  2I8D A;  2O5R A;  1BJA A;  3COA C;  4Q4Z F;  1JGG A;  2NAZ A;  3Q0V A;  1R58 A;  2E7W A;  3H5A A;  1U6G A;  1Y39 A;  2W1O A;  2DCE A;  2OQG A;  1MMN A;  4P5O A;  3E6C C;  1U3E M;  3HSE A;  2JRT A;  2JA5 J;  4BBS J;  4HV5 A;  1R4M B;  3QPH A;  1VZ0 A;  5L3D A;  3SZG A;  4XLH A;  3AKZ A;  2R5Z A;  3U21 A;  4XON A;  4A3E J;  1TW3 A;  4RS8 A;  4G7Z F;  2QF7 A;  2STT A;  3OMY A;  4ABZ A;  3FBN B;  4OIO F;  3OYN A;  2EV6 A;  2FJ1 A;  4D0P A;  5LEJ A;  2VON A;  3CCY A;  1MDM B;  2P6T A;  1RR8 C;  3RKQ A;  1QZE A;  1MND A;  2Y0M A;  5LD2 C;  3GLX A;  6PAX A;  1T8I A;  1YW8 A;  4XSZ F;  3JCU C;  5F04 A;  4CDG A;  3L2R A;  4O3M A;  2M7A A;  2OV7 A;  4DBQ A;  3RZO J;  1DPU A;  5LRR A;  2W82 A;  3QYE A;  4Z6Y A;  4EJW A;  2M0C A;  2GIZ A;  1FX7 A;  1D0Y A;  2VBY A;  5F64 A;  5FKK A;  1FTT A;  2QGU A;  4FE7 A;  2NOG A;  2FEZ A;  2O8X A;  2VQG A;  1OKR A;  2E1N A;  2I5U A;  1JTX A;  5DCM B;  1ZG1 A;  2PJR A;  2LK2 A;  2OBP A;  1YW9 A;  5C4J J;  2ZJR F;  3C2G A;  1OPC A;  1O4X A;  4XKW A;  2R7S A;  5DEQ A;  3H1C A;  3VEP A;  3SYT A;  1Y1V J;  2VI6 A;  4I09 A;  3BG5 A;  2NVY J;  1TT5 B;  2KMU A;  4U0Y A;  1FSE A;  1B9M A;  3WU1 B;  1S8N A;  5KAI C;  2Z2S B;  1TBX A;  1IV8 A;  2XIG A;  3TBI A;  1VQ8 I;  2HTS A;  3KCC A;  4N4N B;  1HW2 A;  2ZO4 A;  3OYD A;  3QP6 A;  3A0H C;  4DIQ A;  3UKG A;  3KX2 A;  4BS9 A;  2A07 F;  2XAQ A;  4N9I A;  1GV5 A;  4IOA F;  3SFI A;  3GX4 X;  2WAD A;  1Q1V A;  4I01 A;  2X48 A;  1VQM I;  4M6Y A;  3BZ6 A;  2F5C A;  1VQ9 I;  3G73 A;  3CME I;  3E97 A;  2DBB A;  1HQC A;  4Q48 A;  3WU0 A;  3H5R A;  2O7O A;  3H3Z A;  3PUF A;  4YEJ A;  4CXF A;  1JUS A;  2Y31 A;  1H89 C;  1IN8 A;  2L2O A;  3CCL I;  3BDD A;  1DPR A;  3CJR B;  3RCO A;  3OY9 A;  3DLL F;  1WH7 A;  2Z9O A;  4NQW A;  4QWQ A;  2CQX A;  1B9N A;  1TTY A;  2HYF A;  2DFF A;  2Z16 A;  4KMU X;  3L2C A;  3BG7 A;  2KHM A;  3MN2 A;  2DI3 A;  3ESW B;  2GXA A;  4M3B A;  3CJT B;  1R5I D;  3RPU D;  3BTJ A;  2IGK A;  3PL8 A;  1Y6I A;  3S16 J;  2ETH A;  3KP7 A;  4G7H F;  1W0U A;  2FOW A;  2ICW G;  3ZQH A;  1F43 A;  1JGS A;  5B66 C;  1HDP A;  2W85 A;  2EK5 A;  5D5V B;  2H27 A;  4S0H B;  1ONV A;  3S2W A;  1V5F A;  2F6C A;  2P0W A;  2JK3 A;  3S1Q J;  3LNQ A;  1FBS A;  3DXJ F;  4V2G A;  2HQR A;  2VKD A;  1AA7 A;  2PMZ N;  4GCV A;  2RQP A;  2IA0 A;  2JRM A;  3WG7 H;  1F5T A;  5A2Q Z;  3R61 A;  5K5O A;  1FBU A;  3GBG A;  5HNF A;  1Z9C A;  4BXU A;  4RGS A;  1I39 A;  4EEF G;  1E3P A;  1TW2 A;  3GZ5 A;  3VOD A;  4R1H A;  2P5K A;  1QRY A;  4XK4 A;  2M9H A;  1FJL A;  3GTG J;  1W5C C;  5IT9 Z;  1A6Q A;  4AC0 A;  3KYL A;  2F48 A;  4X0G A;  1VQ4 I;  1Z3X A;  2M34 A;  3G1O A;  4BDZ A;  5CVU A;  1TWH J;  5HNH A;  2KJC A;  2Y30 A;  1UST A;  3Q3S A;  2LKS A;  3KP5 A;  3KYD B;  3F3X A;  3V8L A;  3TW6 A;  1Z6T A;  1GXP A;  1OR7 C;  5EG0 A;  1OYY A;  3IKT A;  5H6Q A;  4XRS G;  5HS8 A;  2GOX B;  3JSO A;  2B0L A;  3P9K A;  2HOT A;  1Z3Y A;  1P2F A;  4BAY A;  5E1Z B;  3HPG A;  3IAM 2;  3MKL A;  2R7D A;  2EH3 A;  4WK8 F;  1Q1H A;  4BH9 A;  3HG9 A;  3ZQG A;  2H8R A;  3R0J A;  1JUP A;  2CUJ A;  5CVI A;  1U78 A;  2PX9 A;  3BTC A;  2X1E A;  3EET A;  4FT8 A;  1IRZ A;  2EV5 A;  2Q0O A;  1PVE A;  5M3M J;  2ZCW A;  5GP9 A;  1D8J A;  2LC2 A;  3FIW A;  1ETV A;  4RBO A;  1LB2 A;  2V6E A;  1LDK B;  2CUZ A;  2RAE A;  2ZC2 A;  4M3F A;  3GW2 A;  3WGH A;  2FSW A;  4LOC A;  1BIB A;  1KYZ A;  1O3T A;  1K6O A;  1VFC A;  5DM6 F;  1D0Z A;  3LST A;  4Y17 A;  3AAF A;  5F1R A;  1AWC A;  1HW5 A;  3VSK A;  5HS7 A;  1QVT A;  2IBD A;  4XOR A;  3K4N A;  4IXA A;  3VB2 A;  2QEX I;  1QHH D;  3LSM A;  3IAS 2;  1Z67 A;  4XLN F;  4X1E A;  3JAM K;  2DOA A;  1O7L A;  3KFW X;  1XCV A;  2DMU A;  5B1A H;  4KIT B;  1LDD A;  3I5U A;  4A6E A;  1K4T A;  1ZRD A;  1EKE A;  5L3C A;  3ZPL A;  4MFE A;  5J3L A;  1R1T A;  1SFU A;  2CS3 A;  4UUT A;  2CYY A;  2BE5 F;  1R1U A;  2TCT A;  5B1B H;  1K83 J;  4C3H J;  5GAD J;  4BAC A;  1MJ9 A;  4F91 B;  3DBL B;  3IP4 B;  4EM1 A;  1B4A A;  5ICE A;  4B43 A;  2VE9 A;  1TC3 C;  3CCS I;  4CUG A;  3B73 A;  2MGQ A;  2UV1 A;  2Z1D A;  5FKN A;  2M5W A;  2R0Q C;  4P9F A;  3B6C A;  3KIO A;  1YIO A;  5IYC J;  3WTU C;  2BVL A;  3DTE A;  5DD8 A;  2KDZ A;  1T2K A;  3I53 A;  2JZY A;  2KIU A;  3FWE A;  2R7R A;  3DU6 A;  3J80 K;  2LF8 A;  4A0X A;  2KFD A;  3L2U A;  3R4K A;  3IV5 A;  3AG3 H;  3IKV A;  3HC7 A;  3M8J A;  2AO9 A;  4PJL A;  1A04 A;  4NDL A;  2GZW A;  4GYI A;  4NHJ A;  4A93 J;  2FNP A;  2VPR A;  3HB9 A;  2PN6 A;  2ZSI B;  2CRG A;  2M4G A;  2DJN A;  2LSO A;  3I54 A;  4HNV A;  3P9I A;  3K70 D;  2O0Y A;  3HEF A;  3I58 A;  4RGU A;  4AUX A;  2UWM A;  1FTZ A;  1XGN A;  3A03 A;  1ETY A;  3GZN B;  1N78 A;  4RGR A;  4BBR J;  2CUF A;  2D1V A;  4FX0 A;  1S3J A;  2FE3 A;  5CVR A;  4LG0 B;  5KK1 A;  3C2B A;  2EIJ H;  5J1Y A;  2QSH X;  2UZK A;  4BKX A;  1JKQ C;  4A3L J;  1ZRC A;  4RB2 C;  1WWX A;  3D5S C;  3C2H A;  4BJ5 C;  3LMM A;  1O7F A;  3DU5 A;  1R71 A;  1UFM A;  3TP0 A;  4BUP A;  1S72 I;  5LGU A;  3OL3 A;  1YTY A;  1ZR2 A;  2VOP A;  1ZLK A;  2H6B A;  1SAX A;  2PMH A;  3LSH A;  3HRT A;  4H4K C;  2ZXI A;  2W24 A;  3QQA A;  4I0B A;  2GQQ A;  5FLX Z;  5EYR A;  4PZJ A;  3RIR A;  5GPA A;  2LY9 A;  2VJI A;  2JN6 A;  4QLC U;  2NVX J;  1T33 A;  4DYC A;  5GAH J;  1WCM J;  5HDK A;  2L7M P;  2M7B A;  4ETS A;  3F72 A;  1KON A;  4CIC A;  2BYV E;  1R00 A;  2KDO A;  2WBM A;  2FA5 A;  5FLM J;  2WB1 N;  4E7H A;  2DU9 A;  5IYB J;  2V6C A;  1LKX A;  1VQK I;  3LL7 A;  1U2W A;  4BY7 J;  3FK6 A;  3JTH A;  1RET A;  2X0L A;  3FHZ A;  1TZL A;  1IC8 A;  2DDA A;  4M71 A;  4W97 A;  3OYG A;  2P4W A;  2Q1Z B;  5IT9 K;  3LOC A;  4C2U A;  5EGO B;  2W25 A;  4HST A;  5FRN A;  4PSX A;  2BHZ A;  2XAU A;  3HL2 A;  1FOK A;  3BPV A;  3CUO A;  4F7Z A;  2DK5 A;  4KIS A;  4HEA 2;  5HLT A;  1O57 A;  2WA0 A;  3TOA A;  1J5Y A;  3J7A Y;  3L2W A;  2K5C A;  4ENJ A;  3S17 J;  1XB4 A;  2DMT A;  3LSK A;  4RAY A;  4PK4 A;  4RM2 A;  1GT0 C;  3FZV A;  1BL0 A;  2H09 A;  4RA2 A;  4CYC B;  1X2M A;  2HWV A;  3CES A;  5ICF A;  3VPR A;  2GBY A;  1T98 A;  2XRO A;  4M73 A;  4FE4 A;  1DU0 A;  2DFH A;  1RES A;  4L9T A;  2K85 A;  4KIB A;  1HKT A;  3AG1 H;  4II3 A;  2CQN A;  3HIF A;  4CA0 A;  2KIF A;  3J7A O;  4UXN A;  4I76 A;  1VQ6 I;  1IXR C;  4RLF A;  3R0A A;  4WF2 A;  2GA2 A;  1DP7 P;  4WXC A;  1X1C A;  2OPT A;  3SFZ A;  4L0Z B;  4P9U A;  4MIM A;  5KCM A;  3NWS A;  4CO8 A;  2K3P A;  2A61 A;  3BG6 A;  4LLL A;  2FXA A;  1P7J A;  3FMR A;  1NK3 P;  3MZ8 A;  2UUZ A;  4CZZ A;  2RVC A;  1OLT A;  2XPV A;  3OIQ A;  1F9N A;  4LB5 A;  4P96 A;  4DOZ A;  3K4J A;  1T38 A;  2D45 A;  4BXX J;  1OJL A;  4QTR A;  1G3S A;  2JWT A;  2L7F P;  3T0Y A;  4PJ0 C;  1ZGA A;  1CQT A;  3ZOB A;  1JI8 A;  3F8N A;  1SFE A;  1S6L A;  4ZZD A;  3GTQ J;  1JKR C;  4ESF A;  3BR2 A;  3WGI A;  4IJA A;  1P6R A;  1F36 A;  1LVA A;  1MBE A;  1D0X A;  2NS0 A;  3LSI A;  2CQQ A;  3CCE I;  1ON2 A;  1JHF A;  4CYD A;  2QYO A;  3PIP F;  3IWF A;  2GXB A;  2YR2 A;  5J1U A;  2ZB9 A;  3KE2 A;  2JSP A;  2E35 A;  4PGH A;  1U5T C;  3JSP A;  5JFR A;  2PLY A;  3RKY A;  1UAA A;  2DOF A;  3IC7 A;  4LLN A;  3L09 A;  3HPH A;  3ERE D;  1EA3 A;  2VXD A;  1RI7 A;  2VOD A;  3KZI C;  3QPS A;  1N25 A;  2V79 A;  2HYJ A;  4HQM A;  1GLN A;  5CVJ A;  1IGN A;  4G7O F;  1RPW A;  4EM2 A;  4KIF A;  2CWE A;  1ULY A;  2TDX A;  3W6V A;  5K5R A;  3HOT A;  4D7M A;  1TLH B;  2M8G X;  3DPU A;  2P7V B;  5DDG A;  4KNY A;  2ZXH A;  2ISZ A;  4XKB A;  2W4S A;  1V4R A;  2XAH A;  1GXQ A;  2DT7 B;  2PBI A;  4EVI A;  2HGC A;  3RQI A;  3TL4 X;  5EZH A;  1LE8 A;  3ZR8 X;  2NOJ B;  1MJA A;  3S15 J;  2ELJ A;  2XRL A;  4C30 A;  2IGM A;  4BE0 A;  2R93 J;  3GO5 A;  2K02 A;  4BEH A;  2FOK A;  2IJL A;  5H20 A;  5A2Q K;  3QP5 A;  2HXI A;  4JX4 A;  1DGR M;  1TWG J;  4UHT A;  3JRE A;  3AG4 H;  1FSH A;  2CQ7 A;  4BU2 A;  5HOO A;  4ZYG A;  2JA6 J;  2M87 A;  1S29 A;  3JRF A;  1W36 C;  4M9X A;  2R5Y B;  5FGM A;  2M4K A;  1OYI A;  2L01 A;  2DDB A;  1BR2 A;  4JQF A;  5TJJ A;  4AID A;  2MG4 A;  2CO5 A;  3BR6 A;  5DYM A;  3A01 A;  1BI3 A;  3PNV A;  3ZMD A;  3A0B C;  1HA8 A;  5AON A;  3I64 A;  1YS7 A;  5TIS C;  4PFO A;  1ORK A;  2BY1 A;  2N8G A;  1X3Z B;  5JVG F;  3H9J A;  2FD5 A;  3IRR A;  2GIV A;  3FXR A;  2DA1 A;  1IUF A;  2F5F A;  3SZT A;  1N75 A;  1ZLJ A;  3CC7 I;  3HHG A;  2QSG X;  4AYB N;  2A6T A;  1FBQ A;  3DTI A;  1MD0 A;  5LGN A;  2RV8 A;  3QRF F;  5J6X A;  2XB0 X;  4L18 B;  4RMN A;  2KP6 A;  3NRV A;  2FRH A;  4C2T A;  2D2W A;  1O3Q A;  1EV7 A;  1SMY F;  3H3V K;  3PM1 A;  3F6V A;  2VLA A;  1P92 A;  4ENN A;  2HFH A;  4XRF A;  3HGG A;  5GPC A;  2EFP A;  1LNW A;  3P7N A;  3CMY A;  2IXS A;  2MC3 A;  2A3S A;  1J59 A;  1WFX A;  1MGT A;  5IP7 J;  3OR2 C;  1TNT A;  4A3D J;  2DA5 A;  1UHS A;  2QM3 A;  3EPZ A;  3OYK A;  1MBG A;  3ZQQ A;  3EDP A;  2YU9 J;  2HZT A;  1ZGJ A;  3OYE A;  1BI0 A;  4ESB A;  1ZK8 A;  2BW3 A;  1KQ0 A;  2EA2 A;  4HX4 A;  4LMY A;  3CO7 C;  5M5W J;  3OYM A;  1IV6 A;  3ERM A;  1WJE A;  3HOY J;  2F2E A;  4E7S A;  2L3D A;  4WXD A;  1FMV A;  4O5V A;  2OD5 A;  2DAO A;  2ECB A;  3CDH A;  2HKX A;  2R7Z J;  2XB5 A;  3EUA A;  3OOP A;  5J47 A;  1W7P A;  2X85 A;  3I3L A;  3FDY A;  2XDV A;  3ASO H;  3HKZ A;  4QSH A;  1D8K A;  4Y52 J;  3IUO A;  2DN0 A;  3NEU A;  1PDN C;  2PI0 A;  1GV2 A;  1USS A;  2F4O B;  2K4J A;  2OZ6 A;  2WTE A;  3RDI A;  2X1D A;  5AIQ A;  2FBH A;  3D5R C;  3UNG C;  1BOA A;  3H36 A;  5BNG A;  2X6W A;  3SZP A;  3TO6 A;  2KIS A;  2W84 A;  5BPI A;  3MVP A;  2DPU A;  5J4Y A;  1A6I A;  4PDK A;  2NVT J;  2P8T A;  2KZG A;  4ENK A;  1K78 A;  1EH7 A;  3RI4 A;  2JA8 J;  5HLI A;  3ROU A;  3K4C A;  3OL4 A;  4HAM A;  4PGG A;  1X3U A;  3DEU A;  5M5Y J;  2K86 A;  2Q2E A;  2XGD A;  1K4S A;  1ZRF A;  4LK1 F;  1JT0 A;  4U87 A;  1MMS A;  3I59 A;  1HDD C;  4B8X A;  4EGY A;  3ULQ B;  5EDN A;  2LY2 A;  2QVO A;  3BOQ A;  1WJF A;  2H94 A;  2L7K A;  2VT2 A;  4IRH A;  1S7O A;  2L4M A;  3ASN H;  2VJ5 A;  3QOD A;  3LQR A;  1YJW I;  5IT3 A;  1U8R A;  1SMT A;  2H6C A;  1Z7U A;  2JA2 A;  2M0M A;  4WX9 A;  2EZH A;  1YFH A;  2IAI A;  2HOA A;  2AHQ A;  3REO A;  1H8A C;  2HDC A;  1LJ9 A;  2E2I J;  3HXL A;  5E79 C;  2OU2 A;  4OMY A;  2MD0 A;  3GEZ A;  4IL6 C;  1TT0 A;  1EF4 A;  5IP6 A;  1MBK A;  3TGN A;  4LIT A;  2L5Q A;  1G4D A;  1PUF B;  2RNJ A;  2MBF A;  3DQV C;  1K61 A;  3G1L A;  2XV4 S;  2WV0 A;  2DA4 A;  1ZYR F;  5D5X B;  5DM7 F;  3KYC B;  2PJR B;  5KAF C;  4J01 A;  2PMZ A;  1ETW A;  1DGW Y;  2RGV A;  5DD4 A;  4OIN F;  3K2Z A;  4A0Z A;  3BR5 A;  3SEZ A;  1LQ1 A;  1Y0U A;  2Y48 A;  4YFX F;  1HXD A;  2LNB A;  2KJB A;  3ZMZ A;  5FKO A;  4OOI A;  5LFA A;  3MKW B;  4TV7 A;  1WHU A;  2NNN A;  5ERI A;  3N97 A;  1D1A A;  5EJC A;  4BQA A;  4JK1 X;  4XLA A;  2ECC A;  4WCG A;  3FK7 A;  4FQG A;  3ZCO A;  1Z91 A;  3F22 A;  1WPK A;  3LA3 A;  3M9A A;  5EEH A;  4KA4 A;  4HPQ A;  3FM5 A;  2EJR A;  2HDW A;  4I99 C;  3NWT A;  5D4R A;  1LUJ B;  1QHG A;  5E17 F;  3MWM A;  1PYV A;  4YFN F;  2DYS H;  3H0G J;  2Z5U A;  2CW7 A;  4UUV A;  2MA3 A;  3S3N A;  1TWF J;  1G6N A;  2F5E A;  2O3F A;  1APL C;  4G9Y A;  1JJ6 C;  3V8K A;  2XRN A;  5JR3 A;  1FYK A;  1H9G A;  1IG7 A;  3DEE A;  2QA4 I;  3GTL J;  1XS9 A;  3LSG A;  2DFI A;  4KT5 C;  1SAN A;  2QBY B;  1S7E A;  2E1M C;  3CZ6 A;  4RM3 A;  5GTI C;  3JTG A;  4G12 A;  4GO1 A;  2R7T A;  2WAF A;  3NQO A;  3GFL A;  2QSF X;  2XAJ A;  2DQR A;  2BOL A;  1RNL A;  3A4C A;  1WI9 A;  1IF1 A;  1F1Z A;  1ZTR A;  1MNE A;  1ETX A;  1GVJ A;  2VBZ A;  1AKH B;  4XN0 A;  1LPQ A;  3O8G A;  2FQ4 A;  1B59 A;  4BNC A;  3WE3 A;  1WJD A;  3OYC A;  3HOS A;  1X1D A;  1HC8 A;  2JUC A;  1W4M A;  1MBJ A;  5LHI A;  4Y15 A;  3G2B A;  1IN5 A;  2J5O A;  4XKC A;  1VTN C;  1T56 A;  3Q0W A;  3OSG A;  2MSY A;  1B6A A;  4HW0 A;  1GDT A;  4PUS A;  3M7G A;  1Z21 A;  2DLL A;  5BS6 A;  2BY2 A;  2LD5 A;  3VSL A;  3CCQ I;  4LJZ F;  2ESH A;  2CH0 A;  1R49 A;  5J4V A;  3SQN A;  2Z33 A;  2AXT C;  1QPM A;  2XAS A;  3QYB A;  2XF7 A;  4BQO A;  2KRH A;  3GYH X;  4XM3 A;  3C1D A;  3LFK A;  4MEX F;  3GTK J;  1ZG5 A;  2DOE A;  1XSV A;  1PP8 F;  3GLL A;  4XRM A;  2EIL H;  3K10 A;  2HEO A;  4RAG A;  2CG4 A;  2IGN A;  2Q2E B;  4NQW B;  1W5S A;  2LFB A;  2R5Z B;  1X58 A;  3GVA A;  3BG3 A;  2MW8 A;  2WY8 Q;  5FLV A;  2QEN A;  1MSF C;  3IHU A;  1K78 B;  2VBX A;  3M4O J;  2YS9 A;  4NB5 A;  1A36 A;  3FF5 A;  5FFZ A;  4HDU A;  4LFU A;  2HPI A;  5EF6 A;  1MMA A;  2V1D A;  3LSR A;  2OA4 A;  5CYV A;  3F8F A;  3FXQ A;  3I0T A;  1W7P B;  5E1W A;  3J7Z I;  1KU2 A;  5HOD A;  1FP1 D;  5JHU A;  2HI3 A;  1V54 H;  3ZMV A;  3QU3 A;  4AD9 A;  4RB1 A;  4ITV A;  1JT6 A;  1ETQ A;  2KIM A;  3CF5 F;  4IOC F;  1TQI A;  2EV0 A;  2QCO A;  2XGX A;  1YOV B;  3FXJ A;  2EIN H;  2X9D A;  1J9I A;  2MLK A;  2CQK A;  3OS0 A;  2IA2 A;  3QWL A;  3ABL H;  3BTL A;  2BW3 B;  3GTP J;  1BM9 A;  1XMK A;  3BPX A;  1LEB A;  1JTY A;  5LGT A;  3H92 A;  2FU4 A;  3CO6 C;  2R4G A;  3GZ6 A;  2P5V A;  1FPQ A;  2W48 A;  4IVN A;  1Z1D A;  2NRA C;  3F8M A;  5F0F A;  1B8I A;  1VQO I;  1RKT A;  5JHF A;  4LG0 A;  2E71 A;  2K9L A;  1CF7 A;  2DMP A;  1KA8 A;  3WTV C;  4HV6 A;  5E1X A;  1V3F A;  4D7N A;  1FZP B;  4DZP A;  3E5X A;  2HXO A;  3L9F A;  5KVR A;  4E7Z A;  1LFB A;  4MQV A;  2BHY A;  3JW4 A;  3D5L A;  4NC8 A;  2ESN A;  2IS6 A;  1IDZ A;  2ZSH B;  1I27 A;  2JSC A;  3HOX J;  3OV8 A;  4YEL A;  2VQH A;  3K70 C;  2EA4 A;  1NG7 A;  3FKJ A;  5ILU A;  2JPB A;  4OIQ F;  3F8B A;  3S32 A;  3S1N J;  5AIP A;  4IQ4 A;  5F6F A;  3QOE A;  5L3G A;  2XAF A;  4OWR B;  1UG2 A;  5E18 F;  1EJ9 A;  3C7J A;  4UVA A;  5E20 A;  4V19 K;  4E7L A;  1KQ8 A;  1ZEL A;  2VL8 A;  4B3X A;  2HS5 A;  2LR8 A;  1ETK A;  3IWZ A;  3CCV I;  4HLY A;  3IH2 A;  4HZF A;  2MH2 A;  3K4K A;  1SC7 A;  1UJ8 A;  2J5P A;  2R7F A;  1D5V A;  3D1N I;  3E0J B;  4LG3 A;  1E3H A;  2WY7 Q;  3OYF A;  5D5W B;  4M9Z A;  5IOY A;  1DQU A;  5D5U B;  1IAW A;  2VT3 A;  4ON0 A;  4ANJ A;  4C3I J;  1WSU A;  2LYC A;  3VOE A;  5TRD A;  2DO7 A;  4IHX A;  2X6O A;  3PFY A;  3WTX C;  3F8C A;  2M2E A;  2BV6 A;  4QIW N;  2E19 A;  4I98 B;  2I10 A;  2R7O A;  5F08 A;  5JVT A;  3W2A A;  4KIG A;  2G0E A;  2HOE A;  3BLY A;  3S14 J;  4ZYE A;  1Y8R B;  2DTZ A;  3E6D A;  4BEH B;  4M74 A;  4ZYH A;  4F55 A;  4AVZ A;  1NK2 P;  1POG A;  4LD5 A;  4HDV A;  3HSR A;  1V5E A;  4ZYA A;  2E2J J;  1SVL A;  2JT1 A;  1HKS A;  1XMA A;  3KPH A;  2ZNY A;  3FM3 A;  4NC6 A;  2M30 A;  3E1S A;  2LLK A;  4UB6 C;  4H0E A;  3ZMU A;  5TGT A;  4MTE A;  3BJO A;  3P5J A;  2W57 A;  3SDG A;  1OCO H;  3Q9V A;  3OYJ A;  2K27 A;  3PQJ A;  2K3F A;  3HHH A;  3M07 A;  2OC6 A;  4DGW B;  3LWF A;  1ERD A;  1YIT I;  2NXN B;  3K4B A;  5E3M A;  3W6K B;  4UUS B;  1OQY A;  3EUK L;  5HLH A;  3JRH A;  1X4O A;  1WRJ A;  2LVS A;  4LB6 B;  3ABK H;  3KEY A;  5LEK A;  4CCO A;  4Y7N J;  4PJM A;  3DKX A;  1MZB A;  3GFI A;  1QQI A;  1WJ5 A;  1J75 A;  4EQQ A;  5CQE A;  1R5H A;  3DWL E;  2DOD A;  3S1M J;  3C3W A;  1HKQ A;  1W36 D;  1FWZ A;  2L7Z A;  4UUS A;  3Q9S A;  3LA2 A;  3CC4 I;  1QZZ A;  3BQY A;  2O9L A;  3BCA A;  3TO7 A;  5EG0 B;  1BR4 A;  4XOP A;  2A5W A;  4N4O B;  1T08 B;  4DNC A;  1XC5 A;  3LFU A;  3QOP A;  5LRS A;  2W00 A;  4GXO A;  2XAG A;  1ZHF A;  2LRE A;  5J8F A;  1Y1W J;  1FY7 A;  2P81 A;  2QUF A;  3ECH A;  3G4S I;  1IDY A;  4L5J A;  4ENM A;  4M9S A;  1XD7 A;  2Y69 H;  4E7K A;  2HU9 A;  3ZXS A;  1NTC A;  2HKO A;  3CJQ B;  3TOB A;  4CSW A;  2V9V A;  3OS2 A;  1TL8 A;  2FUG 2;  2RQQ A;  1SVO A;  3HZJ A;  4JBA A;  2OQR A;  2AQF A;  2V1X A;  2Q8K A;  1R36 A;  1A31 A;  3BT9 A;  1XGS A;  3ZQI A;  4JP0 A;  3DCF A;  1ENH A;  2D5V A;  2ZFU A;  2NVU B;  3L00 A;  3GUD A;  5C4X J;  1AHD P;  1ON1 A;  3WOD F;  2STW A;  4IF4 A;  1Y0N A;  1MH3 A;  2ZJP F;  3PSF A;  4L9V A;  5GAE J;  2EWN A;  1UHM A;  4A3F J;  2XKO A;  5KNL A;  4I02 A;  4XNF A;  4CYC A;  2P7C B;  3OYB A;  1Y8Q B;  3ECO A;  3A02 A;  5K1Y A;  4UB8 C;  2ZXW H;  4LIU A;  2EPF A;  2FF4 A;  1QVU A;  5FRO A;  3G6E I;  4S04 A;  2DMQ A;  3F0C A;  3DKW A;  4BE1 A;  3K7A J;  3Q5F A;  2VJ4 A;  2IGO A;  3CDI A;  3WHC A;  2EFO A;  3PO2 J;  4LGW A;  3M1E A;  4RAZ A;  4BQN A;  1R7J A;  2PG4 A;  3PSI A;  4M72 A;  3BWG A;  3HOU J;  2DW4 A;  1TWC J;  3AFH A;  3GXO A;  2LBF B;  4AIH A;  3K4M A;  3KZY A;  5FD6 A;  1MBF A;  2VN2 A;  4BGD A;  1ACI A;  3GTM J;  4F93 B;  2RN7 A;  3VFZ A;  2DFE A;  2XKP A;  2VC1 A;  4XLF A;  4UV8 A;  1NG6 A;  1UZC A;  5CLS A;  2PEX A;  1Z77 A;  3KP2 A;  4UVB A;  1D5Y A;  5FKM A;  2E2H J;  1FOX A;  2K9S A;  5E8I A;  4ZZL A;  2JTV A;  2R7Q A;  1JXS A;  1YI2 I;  4IEJ A;  3FXK A;  3GWZ A;  3MFK A;  1BW5 A;  2QQ8 A;  3B6A A;  4KN4 X;  3BR1 A;  1TP4 A;  1KU3 A;  1P4X A;  1KZH A;  1BN5 A;  2ZME B;  2E7X A;  4A0Y A;  1OYW A;  2JUG A;  1BA5 A;  3ML6 A;  2H1K A;  3W2W A;  4BYY A;  1FOW A;  1LE8 B;  1AOY A;  2LDU A;  1NHA A;  1JKP C;  5BOX A;  2F4M B;  5K7Z A;  3N05 A;  5K5Q A;  5F0H A;  4CZC A;  2EIM H;  4XL9 A;  1XGO A;  3X2Q H;  1IW7 F;  3ZQ7 A;  2F4I A;  2VXZ A;  3CQZ J;  1XGM A;  1E17 A;  1D1C A;  1WJA A;  5HS9 A;  1REP C;  2WAQ A;  1BI1 A;  1ZQ3 P;  1ZAO A;  2YX7 A;  1TQP A;  3ELK A;  1MH4 A;  5JLW A;  2OAZ A;  5C3E J;  4IZZ A;  1AU7 A;  2QQB A;  4D1Q A;  4HOB A;  1D3Y A;  2KLO A;  3FXU A;  1MNM C;  1YX5 A;  4HNU A;  1OCT C;  4EMS A;  2ZJ2 A;  2CMP A;  3CUQ B;  5F1J A;  1KQ9 A;  1I6X A;  2VKH A;  4G6D A;  2JJ7 A;  3FXM A;  3Q0U A;  3RSN A;  3CDL A;  3ZP5 A;  5CVV A;  4IHV A;  1YRN A;  3J81 Z;  1I50 J;  3PUB A;  4HA8 A;  4J00 A;  4BE2 A;  2Y9Z A;  5D6E A;  3AL0 B;  4A3C J;  4IQJ A;  2V7F A;  1TWA J;  4D5F A;  2R3S A;  1HW1 A;  4RLQ A;  4CHU A;  1BC7 C;  4FCY A;  4JX5 A;  1FC3 A;  1J7K A;  2CV2 A;  1I3A A;  1GUU A;  3K69 A;  2CW0 F;  2JA7 J;  2E1O A;  4PJJ A;  4MTD A;  3JAM Z;  1OMI A;  1XCB A;  4CCK A;  4IO9 F;  1KU9 A;  1YLF A;  1YX3 A;  3HJE A;  1YO5 C;  2JMW A;  1ZKG A;  2DTR A;  4MNU A;  2HYG D;  4MFD A;  3OOU A;  1VQL I;  2B63 J;  3VWB A;  1XX5 A;  4LIV A;  1DDN A;  2AQE A;  2XUB A;  2UXX A;  1BW6 A;  4KJZ A;  4XN3 A;  4CCJ A;  4II2 A;  1NH3 A;  2JVG A;  3ZN1 A;  4HF1 A;  2K40 A;  3CMA I;  1VQP I;  4IPA A;  3MMY B;  1JUM A;  4NUB A;  1W5T A;  5LLQ A;  2VUM J;  1FIP A;  2M3A A;  4JOM A;  4IHY A;  3NAR A;  5L3E A;  4U7D A;  4GRI A;  1G59 A;  2NS7 A;  3PNY A;  4KN7 X;  4B47 A;  3SEQ A;  3ZQC A;  1XPX A;  4BHP A;  4XID A;  3WTS C;  3EYY A;  1AKH A;  1XG1 A;  3HYI A;  2WWY A;  1G2H A;  5D8K B;  1JE8 A;  2XPW A;  1U5T A;  1FYL A;  1VQ5 I;  4NBQ A;  2M8E A;  2D1H A;  1HOM A;  3K9T A;  4IX7 A;  3KLN A;  2CW8 A;  2YX4 A;  4ZYD A;  5E3N A;  1RUN A;  4B48 A;  1MMG A;  1KYW A;  5IY5 H;  1IRF A;  2GA1 A;  3QPL A;  4BQQ A;  1SAU A;  4XQF A;  3MCZ A;  3E6M A;  3T5X A;  3I55 I;  2LOO A;  2E1M B;  1FT9 A;  5HDG A;  2O6G E;  2IP2 A;  4HNT A;  4A3J J;  4AIK A;  1PJR A;  1X3W B;  1OFC X;  3S3O A;  3GFJ A;  4U88 A;  3A2K A;  4M6V A;  3WGG A;  2DA6 A;  1X19 A;  2LTP A;  4NNJ A;  2RKH A;  1V55 H;  2NVQ J;  4F3Q A;  1BBY A;  1I6H J;  1VI0 A;  1SFX A;  1YHQ I;  3KP6 A;  2HVR A;  3HSF A;  2IRF G;  2OUM A;  1R5G A;  2VKE A;  4EJV A;  4DYQ A;  1XTA A;  2MLG A;  3M8F A;  1EH8 A;  2JPC A;  2KRC A;  5EEG A;  3FIS A;  3FMS A;  1LEA A;  1IRG A;  1S9H A;  1FP2 A;  3G1M A;  2VC0 A;  5B5E C;  1UMQ A;  1SD7 A;  1B72 A;  1T6S A;  3N4M A;  1IN4 A;  1QPI A;  3BY6 A;  3FHN A;  2MC4 A;  4I6Z A;  1U9O A;  4NC7 A;  2G7H A;  3KLO A;  1BR1 A;  5D4S A;  1Z0X A;  4XRS A;  2FNA A;  1MW7 A;  3S3M A;  3ABT A;  3FXO A;  4A5M A;  2GAU A;  3S8P A;  4G94 A;  4A69 C;  2EB7 A;  3MKY B;  4V2F A;  1GHC A;  3CJN A;  2V9P A; 
#chains in the Genus database with same CATH homology
 3LSJ A;  2OF7 A;  4W97 A;  4A3G J;  2XGE A;  1U8B A;  4BY1 J;  1JT6 A;  3LOC A;  5EGO B;  3HBL A;  1ETQ A;  3IH3 A;  3BTI A;  2QCO A;  3JRA A;  3BG9 A;  5IOZ A;  2X9D A;  3HGY A;  5IP9 J;  5K7H A;  3S17 J;  3BTL A;  2DMT A;  2Y0S N;  3BR3 A;  1GT0 C;  2CU7 A;  2ID6 A;  3GTP J;  1BL0 A;  1B72 B;  1FEX A;  1JTY A;  4CYC B;  1X2M A;  3VPR A;  2ME6 A;  2Y2Z A;  2GBY A;  3S2H J;  3L1P A;  1WH5 A;  4FE4 A;  1DU0 A;  1RES A;  4DZJ A;  2W48 A;  5F0F A;  1B8I A;  5FJ8 J;  4I76 A;  1RKT A;  1X2N A;  9ANT A;  2OPT A;  3K2A A;  2DMP A;  3TP3 A;  4MIM A;  4D7N A;  4DZP A;  2YUS A;  2HXO A;  1P7J A;  1LFB A;  1NK3 P;  3HOV J;  1H88 C;  4XIC A;  2XPV A;  4DW6 A;  2O8K A;  1IDZ A;  2TRT A;  2LKX A;  4A3M J;  3A01 B;  4BXX J;  1OJL A;  2DA2 A;  3HOX J;  4QTR A;  3JRD A;  2DA3 A;  2JWT A;  2L7F P;  3I4M J;  1ZR4 A;  1CQT A;  3ZOB A;  3S1N J;  2R5Y A;  1VND A;  2VKV A;  1MBH A;  3HKZ N;  1JKR C;  3GTQ J;  3BR2 A;  1UG2 A;  2EZK A;  1F36 A;  1MBE A;  4C2M J;  3PO3 J;  2CQQ A;  2LR8 A;  1ETK A;  3IH2 A;  3LSP A;  2HOS A;  2XSD C;  3D1N I;  5J1U A;  2ZB9 A;  3BQZ A;  2WAQ N;  3FKI J;  5IOY A;  1VF9 A;  2NS8 A;  4IHW A;  4C3I J;  1JGG A;  1WGX A;  3Q0V A;  4IHX A;  2X6O A;  4A3K J;  3QPS A;  2M2E A;  3HOZ J;  2HYJ A;  4QIW N;  2E19 A;  1IGN A;  2I10 A;  5F08 A;  2JA5 J;  4BBS J;  1RPW A;  2R5Z A;  2G0E A;  3S14 J;  2WV1 A;  4JX6 A;  5E3L A;  4A3E J;  3W6V A;  2QF7 A;  2DTZ A;  4ABZ A;  4D7M A;  1OCP A;  2FJ1 A;  3CCY A;  2M8G X;  1NK2 P;  3RKQ A;  1POG A;  3DEW A;  4B1R A;  1FIA A;  1JJ8 C;  2E2J J;  4B4C A;  3RQI A;  3RZD J;  4M3D A;  5F04 A;  2LLK A;  5EZH A;  1LE8 A;  3S15 J;  2XRL A;  3SDG A;  4FIS A;  3RZO J;  3S2D J;  2ELK A;  2R93 J;  2M0C A;  5FKK A;  1P7I A;  1FTT A;  4FE7 A;  2KT0 A;  2NOG A;  3WHB A;  5E3M A;  5IYD J;  2HXI A;  4X6A J;  4JX4 A;  4UUS B;  1TWG J;  3JRI A;  3JRE A;  1JTX A;  4DYR A;  3JRH A;  3E7L A;  4FTH A;  2LVS A;  2LK2 A;  2JA6 J;  3TW7 A;  1YRN B;  5C4J J;  3JRF A;  4D5C A;  4J19 A;  2R5Y B;  4Y7N J;  1O4X A;  1Y1V J;  2VI6 A;  3BG5 A;  2NVY J;  2MG4 A;  3BR6 A;  3A01 A;  4M3E A;  3NAU A;  4RDU A;  5EEA A;  1WI3 A;  2K9Q A;  3S1M J;  1ITY A;  4UUS A;  1ORK A;  2L7Z A;  5K7F A;  2N8G A;  3BQY A;  2FD5 A;  2O9L A;  5EG0 B;  1ZGW A;  3UKG A;  5F27 A;  2DA1 A;  1IUF A;  1ETO A;  1RR7 A;  1XC5 A;  1GV5 A;  3SFI A;  1IJW C;  1Q1V A;  4AYB N;  1Y1W J;  2X48 A;  2P81 A;  2XB0 X;  5DTD A;  2O7O A;  1IDY A;  2CUE A;  1JUS A;  2Y31 A;  1H89 C;  1NTC A;  3H3V K;  3PM1 A;  1I3Q J;  1WH7 A;  3HGG A;  3HM5 A;  5GPC A;  1HF0 A;  2CQX A;  3CMY A;  3MN2 A;  5IP7 J;  3BT9 A;  4M3B A;  3ZQI A;  4JP0 A;  3DCF A;  1ENH A;  2D5V A;  2NVX J;  4A3D J;  3BTJ A;  2DA5 A;  1UHS A;  3S16 J;  3JRG A;  1MBG A;  5C44 J;  2YU9 J;  5C4X J;  1AHD P;  5FKL A;  1W0U A;  1ZK8 A;  5M5X J;  1MH3 A;  5E3O A;  5M5W J;  2EBI A;  3ZQH A;  1IV6 A;  1F43 A;  5JLX A;  5F0C A;  4A3F J;  3HOY J;  1HDP A;  4CYC A;  4S0H B;  3BR0 A;  3A02 A;  2JK3 A;  2DA7 A;  3S1Q J;  3LNQ A;  2CJJ A;  3ZQF A;  4V2G A;  5M3F J;  2ECB A;  1QVU A;  2R7Z J;  2XB5 A;  2DMQ A;  2K9N A;  2PMZ N;  3F0C A;  3K7A J;  4QSH A;  3JR9 A;  1U9N A;  3WHC A;  3PO2 J;  4Y52 J;  3GBG A;  2DN0 A;  4L5E A;  3SJM A;  1GV2 A;  2Y9Y A;  4MO7 A;  2HDD A;  3HOU J;  1TWC J;  4EEF G;  1MBF A;  1MSE C;  3GTM J;  5BNG A;  1QRY A;  3OIO A;  4XK4 A;  2M9H A;  1FJL A;  3MVP A;  3GTG J;  1A6I A;  1Z77 A;  1D5Y A;  2NVT J;  5FKM A;  4AC0 A;  2E2H J;  2K9S A;  2JA8 J;  2M34 A;  3G1O A;  4IEJ A;  5DS9 A;  1TWH J;  5M5Y J;  2Y30 A;  2XGD A;  3ZQL A;  1BW5 A;  3Q3S A;  3B6A A;  3BR1 A;  1JT0 A;  3TW6 A;  2R92 J;  5EG0 A;  1HDD C;  1BA5 A;  5EDN A;  2H1K A;  1LE8 B;  2GM4 A;  1HCR A;  1JKO C;  4XRS G;  1JKP C;  5K7Z A;  5F0H A;  2HOT A;  3MKL A;  2EH3 A;  2EZH A;  3CQZ J;  2H8R A;  2IAI A;  2HOA A;  3ZQG A;  2AHQ A;  1H8A C;  1JUP A;  2L9R A;  1ZQ3 P;  2E2I J;  1U78 A;  1SFO J;  3S1R J;  2EQR A;  1MH4 A;  3BTC A;  5JLW A;  5C3E J;  1AU7 A;  1A5J A;  1IRZ A;  1EF4 A;  5IP6 A;  1MBK A;  1MNM C;  4JYK A;  5M3M J;  1OCT C;  5GP9 A;  3TED A;  5F1J A;  5EGO A;  1PUF B;  3FIW A;  1ETV A;  4RBO A;  2JJ7 A;  1K61 A;  2RAE A;  3G1L A;  3Q0U A;  4M3F A;  3CDL A;  4IHV A;  1YRN A;  1I50 J;  2DA4 A;  4LOC A;  2DMN A;  1R9T J;  4A3I J;  2Y9Z A;  4A3C J;  1ETW A;  1VFC A;  1DU6 A;  1E3O C;  3BR5 A;  1TWA J;  1HLV A;  1QVT A;  2IBD A;  4D5F A;  5FKO A;  1GVD A;  4M3G A;  4FCY A;  4X1E A;  4JX5 A;  2XGC A;  2DMU A;  3JRC A;  1GUU A;  2ECC A;  4MFE A;  2JA7 J;  5J3L A;  2E1O A;  3FK7 A;  1WPK A;  4UUT A;  2COB A;  3O8H A;  2JMW A;  1ZKG A;  2TCT A;  4C3H J;  1K83 J;  2XPU A;  4MFD A;  3OOU A;  2B63 J;  2ME0 A;  2FX0 A;  3H0G J;  1TC3 C;  1BW6 A;  1PUF A;  2MGQ A;  5FKN A;  2EZI A;  2R0Q C;  1TWF J;  4A3B J;  4GFB A;  3B6C A;  5IYC J;  1APL C;  1JJ6 C;  2K40 A;  2KDZ A;  4W1U A;  3GTJ J;  1JUM A;  1IG7 A;  2VUM J;  3GTL J;  1FIP A;  1XS9 A;  3LSG A;  1BJZ A;  1SAN A;  4IHY A;  3M3Y J;  1S7E A;  3NAR A;  1LFU P;  2NS7 A;  3ZQC A;  3IV5 A;  4G12 A;  4XID A;  1AKH A;  1XG1 A;  2ID3 A;  2AO9 A;  4NDL A;  1G2H A;  4A93 J;  2XPW A;  2VPR A;  3HB9 A;  3GTO J;  2CRG A;  1ZTR A;  2DJN A;  4HNV A;  1ETX A;  5IPA A;  1AKH B;  3JRB A;  1HOM A;  3O8G A;  1W0T A;  2FQ4 A;  3HEF A;  4AUX A;  1FTZ A;  2EZL A;  5E3N A;  3A03 A;  1ETY A;  4BBR J;  2CUF A;  3QPL A;  3I4N J;  4B3A A;  2L0K A;  1MBJ A;  3HOW J;  3C2B A;  2GLO A;  5J1Y A;  1T56 A;  3Q0W A;  3OSG A;  2MSY A;  4BKX A;  1JKQ C;  4A3L J;  1GDT A;  4A3J J;  1OFC X;  4M6V A;  2DA6 A;  2LD5 A;  2LTP A;  2NVQ J;  2HQ5 A;  1I6H J;  1VI0 A;  1B8I B;  5J1R A;  3TP0 A;  1ZR2 A;  2VKE A;  3GTK J;  4DYQ A;  4MLO A;  3QQA A;  4XRM A;  3FIS A;  5EYR A;  5GPA A;  2LFB A;  3G1M A;  2LY9 A;  5EZG A;  2JN6 A;  1UMQ A;  3BG3 A;  1X58 A;  1T33 A;  2MW8 A;  4DYC A;  1WCM J;  2R5Z B;  3OSF A;  2L7M P;  1B72 A;  1QPI A;  5FLV A;  1MSF C;  4I6Z A;  1U9O A;  4C3J J;  3M4O J;  2LP0 A;  2YS9 A;  3IH4 A;  1Z0X A;  4XRS A;  5FLM J;  2WB1 N;  5EF6 A;  5IYB J;  3LSR A;  2IEK A;  4A69 C;  1RKW A;  4BY7 J;  3FK6 A;  5HOD A;  1RET A;  4V2F A;  3HDD A;  2HI3 A;  1IC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...