1ETQA

The crystal structure of e. coli fis mutant r71y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
85
Chain Sequence
b'VLTVSTVNSQVTQKPLRDSVKQALKNYFAQLQDVNDLYELVLAEVEQPLLDMVMQYTYGNQTRAALMMGINRGTLRKKLKKYGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION
publication title Structural analysis of the transcriptional activation on Fis: crystal structures of six Fis mutants with different activation properties.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 26
structure length 85
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1etqA00
2JK3A 2MW8A 1ZR4A 3S14J 2HDDA 1WGXA 1IDYA 5J1UA 3Q0UA 1NTCA 3LSRA 1BJZA 3S2HJ 3JRDA 3BTIA 5IP6A 1K61A 2O9LA 2CU7A 3QPLA 1QPIA 3RZOJ 5HODA 3BTLA 3BR3A 3BG3A 2R5ZB 2WB1N 3WHCA 1ETQA 1UG2A 3GBGA 4NDLA 2DMNA 5EEAA 4UUSA 3G1OA 2K9SA 3HOUJ 3ZOBA 3HOZJ 4M3EA 3OSGA 3BR5A 4QIWN 1OJLA 2GBYA 2HQ5A 5EG0B 2JA6J 5F04A 2XGDA 3OIOA 1WCMJ 2LY9A 4MO7A 1X2MA 3ZQHA 3S1MJ 5FKMA 4DYCA 2NOGA 9ANTA 2IEKA 2LR8A 3CCYA 2EH3A 3QPSA 1NK2P 2TRTA 3DCFA 2W48A 2XSDC 1ETXA 2DA3A 5C4XJ 4UUTA 2Y30A 3PO3J 3HDDA 1TWGJ 2CJJA 2DTZA 1JGGA 4C3IJ 2MSYA 2DA5A 1A6IA 4A3CJ 3IH3A 4AC0A 1U9OA 5FKNA 1U78A 2DA1A 4A3DJ 1MNMC 3LOCA 2R7ZJ 2NVTJ 2EZKA 3HOVJ 2XB0X 5K7HA 1IV6A 2R92J 1K83J 4QSHA 3BQZA 3CDLA 2FX0A 4RDUA 5FLVA 3PM1A 5J3LA 2EZIA 2COBA 1TWFJ 2Y2ZA 2LKXA 3D1NI 5EZGA 2IBDA 3FISA 3SDGA 3DEWA 2YS9A 2DMPA 2O7OA 2YUSA 2HXOA 3GTQJ 4BBSJ 1QVUA 3CQZJ 1I6HJ 1ZR2A 1JT0A 1FIPA 2M2EA 2N8GA 1JKQC 3GTLJ 1IG7A 3FK7A 1VNDA 3GTKJ 1NK3P 2B63J 4A93J 1BW6A 1P7JA 3A02A 3JRAA 2ECCA 5DTDA 3IH4A 3FK6A 1WPKA 1HOMA 2JMWA 4XRSA 1AHDP 4A3MJ 2NS7A 4FISA 2CUFA 3ZQLA 1EF4A 4IHXA 2Y31A 4JX5A 1QVTA 5J1RA 1MBHA 4IHVA 3OSFA 1MBKA 2E2JJ 1IRZA 4XRMA 3LSPA 4D7NA 3C2BA 2YU9J 4G12A 1W0UA 3BR6A 5GP9A 3GTJJ 5EDNA 4IEJA 3TW7A 3HOYJ 2HYJA 4XICA 1WI3A 4B3AA 1JUSA 4B4CA 5EF6A 1RPWA 3MVPA 2X6OA 2G0EA 4X1EA 5F0HA 2DA4A 2E1OA 4C3HJ 3ZQGA 2VKVA 4AYBN 2OPTA 1JUPA 2DA2A 4DZPA 3GTOJ 4W1UA 1ETYA 1YRNA 4D7MA 2X9DA 2JA7J 4B1RA 4Y52J 1JTYA 4A3GJ 2XGCA 2FD5A 2M8GX 2K9NA 3TP3A 1A5JA 3F0CA 1UHSA 1ZKGA 1ZTRA 3BG9A 1TC3C 1AU7A 1Y1VJ 1B8IB 1F43A 4A3IJ 2CQQA 2EBIA 3TP0A 3BR2A 2WAQN 1DU0A 3JRIA 2R5YA 1HF0A 5EYRA 3M3YJ 1FIAA 1XC5A 2JN6A 1T56A 3O8HA 3JR9A 1JKPC 2H8RA 3HBLA 4C3JJ 3ZQCA 3H3VK 2P81A 5GPCA 1VI0A 1ITYA 1IDZA 1ZQ3P 1ZK8A 3G1LA 4V2FA 4BKXA 2I10A 3B6AA 3IH2A 5GPAA 3VPRA 1JJ6C 1BL0A 4FCYA 5F0CA 1OFCX 4XRSG 1APLC 4S0HB 1ENHA 2E19A 5M3FJ 4UUSB 4XIDA 2XRLA 2CRGA 5EZHA 3HOWJ 5M5YJ 1F36A 4BXXJ 1SFOJ 2ME0A 3BTCA 3IV5A 4A3FJ 4BY1J 1HDDC 5FKLA 5E3LA 2DMUA 5JLWA 2ID6A 1G2HA 3H0GJ 5E3OA 1QRYA 3TEDA 1GDTA 3JRGA 3UKGA 1MBGA 3ZQFA 1R9TJ 5IYBJ 3A03A 4MFDA 2KDZA 3OOUA 1GT0C 2NVYJ 2L7FP 3LNQA 3GTGJ 2JA8J 1U9NA 1SANA 1U8BA 3TW6A 1JJ8C 4IHYA 5FLMJ 3PO2J 2FJ1A 3MN2A 4DYRA 1LE8A 1IUFA 1VFCA 3JRFA 3NAUA 1GVDA 1POGA 2LK2A 3K2AA 4JX4A 2DN0A 2GM4A 3JRHA 2LFBA 1O4XA 3S1NJ 4MLOA 1PUFA 2R93J 3A01A 1UMQA 5IOZA 1I50J 3HEFA 3GTMJ 3HM5A 4AUXA 2HOTA 5EGOA 3BT9A 5C44J 4A69C 3FIWA 4QTRA 3MKLA 4CYCA 3JRBA 3FKIJ 2O8KA 4RBOA 2AHQA 2JA5J 4FE4A 4W97A 4ABZA 5M3MJ 1E3OC 2ECBA 3S1RJ 3S16J 1Q1VA 5F1JA 2XB5A 1HLVA 2XGEA 4M6VA 2NVXJ 1T33A 3QQAA 1IC8A 1RKWA 2CUEA 1JT6A 4A3LJ 2R0QC 1S7EA 2LLKA 2VI6A 2IAIA 2VPRA 4M3GA 4A3KJ 1MSEC 4IHWA 1ETOA 4FTHA 1XG1A 1FTTA 5FJ8J 2MG4A 2VUMJ 3BQYA 5EG0A 1FJLA 5F08A 2CQXA 3G1MA 2JWTA 3HKZN 3BG5A 2LTPA 4D5FA 2L0KA 4JX6A 2XPWA 2EQRA 4V2GA 5IP7J 5E3NA 2H1KA 2LD5A 4GFBA 4LOCA 1JTXA 1GUUA 1GV2A 2AO9A 1ETVA 4I76A 1P7IA 3S2DJ 2DMQA 3S17J 1MH3A 2Y0SN 2HOSA 4M3BA 2ME6A 1B72A 1JKOC 1W0TA 1JKRC 1OCTC 4MIMA 1H8AC 4Y7NJ 2ZB9A 3S15J 2LVSA 1TWHJ 5C4JJ 2D5VA 1Y1WJ 1MBJA 4A3EJ 5FKKA 1WH7A 2FQ4A 1MSFC 1TWAJ 1HCRA 1GV5A 3NARA 4M3FA 2EZLA 3RKQA 4A3BJ 1HDPA 1YRNB 5JLXA 5F27A 2E2IJ 2QF7A 2DA6A 3B6CA 1BW5A 1FTZA 1MBFA 3SFIA 2GLOA 1LFBA 4XK4A 4FE7A 2M9HA 5FKOA 5K7ZA 1AKHA 3I4NJ 5IP9J 3LSJA 5DS9A 2L7ZA 3RQIA 4MFEA 3BR1A 2VKEA 3Q3SA 3CMYA 1RKTA 3BTJA 4X6AJ 5IYCJ 2HXIA 2Y9YA 3HOXJ 3L1PA 2R5YB 1VF9A 1X2NA 2DJNA 3K7AJ 5F0FA 3RZDJ 1D5YA 1B72B 2ID3A 1WH5A 4DYQA 1JUMA 2NS8A 5IYDJ 4JP0A 3JREA 1DU6A 1IJWC 1H88C 4M3DA 3HB9A 1TWCJ 2PMZN 1RESA 4DZJA 4BY7J 2LP0A 4HNVA 2L7MP 4C2MJ 1FEXA 5C3EJ 1CQTA 3E7LA 2XPVA 3I4MJ 1RETA 2L9RA 3BR0A 4BBRJ 2M0CA 1RR7A 4D5CA 4EEFG 1ETKA 1MBEA 3Q0VA 1AKHB 3HGGA 5K7FA 4J19A 3GTPJ 2K9QA 1LFUP 2E2HJ 3WHBA 2Y9ZA 3JRCA 5IPAA 2XPUA 2NVQJ 1MH4A 2OF7A 2QCOA 3O8GA 1Z77A 2DA7A 2HI3A 2JJ7A 1OCPA 1Z0XA 2EZHA 3M4OJ 2HOAA 1H89C 2MGQA 3S1QJ 2M34A 1LE8B 1ETWA 5E3MA 4I6ZA 3ZQIA 2R5ZA 1I3QJ 2X48A 1IGNA 3SJMA 2ELKA 1BA5A 2DMTA 1PUFB 3A01B 4L5EA 5IOYA 2TCTA 3LSGA 4DW6A 1B8IA 5J1YA 1ORKA 2KT0A 5EGOB 4JYKA 2RAEA 1XS9A 3W6VA 1ZGWA 2WV1A 3Q0WA 5M5WJ 2K40A 4CYCB 4A3JJ 1X58A 3HGYA 5BNGA 5M5XJ
chains in the Genus database with same CATH superfamily
3ZMDA 2K85A 2Q1ZB 1WKMA 2Z9OA 3S14J 3HUGA 2HDDA 1TT0A 2GA1A 2R7SA 3HTSB 1J2XA 5DUKA 5IP6A 3FM3A 1MJBA 4IHSA 4PFOA 2O9LA 5LEJA 1QPIA 3RZOJ 3ZCOA 5HODA 4AIDA 2FRHA 2HR3A 2WADA 1IXRC 4RAFA 3GBGA 2H94A 1RZ4A 4XOTA 1Z7LA 1XGMA 5EEAA 2QENA 2K9SA 3EETA 3ZOBA 4M3EA 2QVOA 3ZMVA 2HQ5A 3L00A 1QZZA 2JA6J 2W1OA 4HF1A 2COMA 2V6EA 1WCMJ 2LY9A 3ZQHA 2MA3A 3CCRI 2KHMA 3VODA 2Z99A 2LREA 4EJVA 4DYCA 2VODA 4XONA 4XLCA 3CCYA 5E1ZB 1LUJB 2EH3A 3SZPA 1NK2P 4XLFA 1V54H 3DCFA 4M6XA 3L09A 1MJAA 1R1TA 3ABTA 3CCSI 1ETXA 4XLEA 2K86A 2FBIA 2ZSHB 3MZYA 5FB2A 3VFZA 4A0YA 1TWGJ 2CJJA 2ZJ2A 1K78A 2MSYA 3MEXA 4HPQA 4A3CJ 4IXAA 3L7WA 4AC0A 4DJAA 4MQ9F 1U9OA 2MLGA 2HDCA 1D1AA 2RGVA 1U78A 2DA1A 3KE2A 2A5WA 2B0LA 4A3DJ 5J47A 4C30A 2FOKA 4J00A 4OMYA 3IRRA 3H3UA 3D5LA 1MMAA 2L01A 1Y0UA 2QKMB 2EZKA 5KK1A 2NVTJ 3HOVJ 4BNCA 3WTSC 3OYFA 3QU6A 2BY3A 3HOSA 2ZXHA 1SEUA 1LVAA 3CDLA 4RDUA 4EQQA 1R6RA 2OTLI 1W5SA 4MHGA 2KFDA 2COBA 3GFLA 1XX5A 4HLYA 1TWFJ 2OA4A 4CH7A 5BPDA 1YITI 5EZGA 3RTRA 4BJTA 5B1AH 3P7NA 1IXCA 3G3ZA 2O7OA 2YUSA 3KYCB 2F48A 2VKHA 3VYTB 3RJPA 3W2VA 2M2EA 2N8GA 3KP2A 3CCEI 4CO8A 1JKQC 2R7FA 1IG7A 2QUFA 3E6BA 1VNDA 1ZRFA 2CQNA 2YSRA 2B63J 3VYSB 2RN7A 4A93J 1YG2A 3OV8A 3H9QA 3ABLH 3ML6A 3JRAA 5HDKA 4RGSA 4CUGA 3LA3A 3FK6A 1WPKA 2QQ9A 1B1BA 4XN3A 2JMWA 4B8XA 2Q2EA 4XRSA 2LC2A 1U8RA 4OAZA 1CF7B 3WE3A 4HSTA 2P6SA 4BU2A 1ON2A 3DEEA 4EGZA 2Y31A 2X85A 2EWNA 3NEUA 5A2QZ 2FEZA 4AYBA 1QQIA 4ZDLA 3HHHA 2IVMA 2OUMA 3LSPA 4D7NA 3J7AY 4ESFA 4G12A 4Y15A 1W0UA 2OU2A 2K7LA 2XAJA 3I54A 2M5WA 2E1CA 2P5VA 1A04A 1PYVA 1JUSA 3I58A 2Z2SB 1FSEA 1YYVA 3S32A 3O3KA 2XAQA 2X6OA 5HNHA 2BHYA 2XF7A 2E1OA 4WXCA 2IRFG 3K1NA 3BG7A 4AYBN 2OPTA 4E7SA 1JUPA 1X3WB 3GTOJ 4W1UA 4CYDA 1ETYA 3F3XA 5H6RA 1Z21A 3CJNA 5L3GA 2XGCA 2XAHA 3TDZC 1A5JA 1UHSA 2ZC2A 1LEAA 1TC3C 1U0JA 3BJAA 1YTYA 1AU7A 5HDGA 1Y1VJ 2K5CA 1T39A 3EUKL 1B8IB 4A0ZA 2NNNA 5CLSA 2JVHA 1J9IA 1DU0A 1MKMA 3A2KA 3F6VA 2W7NA 1LPQA 1G3SA 2DFFA 3K2ZA 4B09A 1XC5A 5K5OA 3O8HA 4Y17A 3DF8A 2H8RA 3HBLA 4KMFA 4HOBA 4YFKF 1LJ9A 4EM0B 3WG9A 3DV8A 3TOAA 2G7UA 4FX4A 1WI9A 4PDKA 1ITYA 3E5XA 1ZQ3P 3C2GA 2EINH 1BM9A 4QPQA 1ZK8A 3BG6A 2IXSA 1D5VA 1MMGA 3COAC 1MJ9A 3IH2A 2WTEA 3B6AA 5CYVA 1VQ8I 1BL0A 3L2QA 2VBZA 5EEGA 2KZVA 2XKPA 4B47A 4Z6YA 4M71A 4IZZA 4XNFA 4WWCA 2CMPA 1D0YA 2GIVA 3HHGA 2XRLA 1HKSA 5J4VA 4R79A 3E1SA 3RQ4A 5B66C 5JVGF 5M5YJ 4AIKA 2DO7A 3FWEA 4BXUA 1SFOJ 4E7LA 3HSEA 2PJRA 3BTCA 3SXYA 3IV5A 4A3FJ 3I0TA 2OCEA 3AG3H 5JI6A 3K69A 4RB2C 1VTNC 1GDTA 1MBGA 5IYBJ 2H1LA 3MZ8A 3A03A 2KDZA 2Z33A 3OOUA 1VQMI 1GT0C 1LB2A 2L7FP 4X0GA 2QYOA 4YFNF 2X1EA 3W2WA 2DCEA 3FXJA 1JJ8C 2GXAA 5DV5A 1IF1A 2BGCA 5GADJ 1W36C 4HF2A 1VQ7I 2QA4I 1X19A 2FJ1A 4DYRA 1LE8A 2DK8A 4IOCF 1X3UA 5KVRA 3WTZA 2G7HA 1POGA 4P5OA 3JSPA 5K5QA 4AIHA 1VQ6I 3JSOA 1DPRA 4CCMA 3QOPA 2XDVA 4BHPA 1SAUA 2OQGA 1KYWA 5AIQA 3QPTA 1GVJA 4ZTJA 1TZLA 1I50J 1PP8F 1D3YA 3DXJF 2ZMEB 4OAYA 3PNVA 3CC2I 4AUXA 3RYPA 3CJQB 3CCQI 5EGOA 3BT9A 2GXBA 3FIWA 3AAFA 4CYCA 4O5VA 1K4TA 1X4PA 1MDMA 1FBQA 4KJZA 2O8KA 4RBOA 2AHQA 3CUQC 3F8MA 3BPXA 1UHWA 3AKZA 1SD6A 4A6EA 4ENNA 1Q1VA 5F1JA 2XB5A 2EA2A 1Z3YA 1KGSA 5JR3A 4M6VA 3ZQ7A 2NVXJ 2X1DA 1R49A 4BE0A 3M7GA 1BIBA 3F22A 5J8FA 3HYIA 2LSOA 2PX9A 3HC7A 3EUHA 1USTA 3VYRB 2VPRA 1OCOH 1XG1A 4F7ZA 2LF7A 1KONA 1BR4A 2E1MC 2FMYA 4PK4A 2Y0SA 1HKQA 1FJLA 2AXLA 1P6RA 3KEOA 3KP4A 3GZ6A 2FMLA 3DBRB 5F08A 2CQXA 1N25A 4IVNA 5CQGA 3C7JA 5GTHC 1D1CA 3BLYA 4OIQF 4IX7A 1Y56A 1Z6RA 2DYRH 2XPWA 2STTA 1ZG3A 2FE3A 2NYXA 2JVGA 4WCGA 2H1KA 4BAYA 3CCUI 3N05A 2R7VA 1BR2A 2HOEA 4RM3A 4HRIA 2DFHA 2PMHA 2AO9A 3UNGC 1DPUA 3S2DJ 2Y0SN 1B72A 5L3FA 3LSMA 4H4KC 3UR3C 4PJLA 2VASA 4HDVA 2O6GE 2R7QA 4MEYF 5FKKA 5KCMA 4F91B 3OYKA 1MSFC 3AFHA 2QSHX 4LLLA 2UV1A 1YRNB 5JLXA 2QBYA 2QF7A 1OQYA 2AQFA 1UB9A 3A1YA 2R7UA 1UHMA 2V9KA 2BZTA 3H9JA 2M9HA 5FKOA 5K7ZA 4DQ2A 2G9WA 2QEXI 4BACA 3BOQA 5FRMA 2L7ZA 2W00A 4U7DA 1T8IA 2GIZA 2CV2A 3DQVC 2CV0A 3ZMZA 5FLXK 2ISYA 3CMYA 4X6AJ 1UFMA 1LDDA 5IYCJ 2HXIA 3HOXJ 3K4KA 1YFHA 4OOIA 4RS8A 3IHUA 5J40A 3L1PA 2R5YB 2D45A 2CW7A 2E1MB 2LF8A 1TP4A 2R7TA 1T0FC 4YRVA 3I64A 3GZ5A 2ID3A 3TL4X 5ED4A 1PJRA 1DU6A 1IRFA 1H88C 3HB9A 1TTYA 1HXDA 1RESA 5FGMA 4BY7J 3PIOF 2JT1A 5DEQA 3IKVA 2FU4A 4XORA 2H09A 1FEXA 2IA2A 5DD8A 3E7LA 2XPVA 3DFGA 2LBFB 3PJRA 3I4MJ 3KCCA 3V7SA 3BR0A 4FETA 3QP5A 4UXNA 1RC9A 3H1CA 1ONVA 4A12A 3KP5A 3QPHA 4XOPA 4EEFG 3CP2A 1AKHB 3M07A 4EATA 1YLFA 2E2HJ 3WHBA 5FFXA 2ZXJA 3ZGKA 2ZJPF 5IPAA 1FMWA 1VQPI 3F8FA 1R4MB 1MH4A 4O6JA 2QCOA 3CJTB 2XASA 4KIGA 3OWTA 1RUNA 2E34A 2WY7Q 3ROUA 4KYWA 1Z77A 2DA7A 2HI3A 3QWLA 2LG4A 2V1UA 1Z0XA 3S2WA 3J80Z 5FFZA 4BL0B 2F4OB 5DUIA 3ONQA 4II3A 3OYNA 5DCMB 1FNNA 1TT5B 1JI8A 4GRIA 4HNUA 3MKYB 3A0HC 2R5ZA 2EIJH 4KIBA 4DOZA 1IGNA 1LQ1A 3HSRA 1BA5A 2K3FA 1HQCA 1KU9A 1PUFB 3A01B 2MABA 2XHKA 4L5EA 5IOYA 2ZO4A 1IRXA 1XMXA 1EH6A 1GHCA 1W7PB 3FX3A 2IGKA 1VQ9I 4JYKA 2RAEA 1XS9A 1G3TA 2KJCA 5M5WJ 4UVCA 4A3JJ 1X58A 2JRMA 4F55A 3M1CA 1TL8A 5M5XJ 3RPUD 1ZR4A 2LKSA 3KETA 3CO6C 3Q0UA 3G73A 1YQAA 2B7EA 2I5UA 3BTIA 2KIFA 1W7PD 1ZARA 4WXHA 3CMAI 1XSXA 3BTLA 3HRSA 2CSOA 3GFMA 4BDZA 4NDLA 4CGZA 1I3AA 3VSKA 3S3OA 3G1OA 2AXTC 2DODA 2GZWA 3EYYA 1S7OA 3IKTA 4BEHB 5HLGA 2LYCA 3OSGA 2A3SA 5EG0B 3ASNH 2HQNA 4XBFA 3SZTA 4GGGA 1SVOA 2XF6A 3E6MA 2V1NA 2HVRA 3FBNB 4KT6A 2V7FA 5FKMA 3OMYA 2DYSH 4LFUA 3H0DA 1JE8A 3NWTA 3GYHX 2LR8A 3HUGB 3QPSA 4LG0A 2TRTA 2XF5A 1R00A 2RNGA 4S05A 3CMMA 2UZKA 2XSDC 2DLLA 2DA3A 5C4XJ 3ZRGA 4L0YB 3ECHA 3R61A 4HW0A 4UUTA 4AWXB 2ACJA 3GF2A 3PO3J 3HDDA 4A6DA 4C3IJ 5FD5A 1RI7A 4JOMA 2KIUA 1IXSB 2R3SA 5ILVA 3KZIC 2KKOA 2BW3A 2L3DA 3VEPA 4L0ZB 1A6QA 2I8DA 3CCVI 2JTVA 4F93B 5LRSA 2ZNZA 3WTWC 1PUEE 3PFIA 2JPCA 3TGNA 5TISC 5K7HA 1IRGA 1K83J 1YX3A 3BQZA 1X4OA 3RYRA 2D1VA 3CDIA 3U1DA 1QHHD 4ZZLA 2CW0F 2L9VA 2XSJC 4KA4A 4CA0A 3CCJI 5FLVA 2A69F 3PM1A 2EZIA 4DBQA 2M30A 1QZEA 4HEA2 5CVVA 2LKXA 3KX2A 2Z5UA 1SMYF 3FM5A 3KYLA 4BJ6C 3OYCA 3OL4A 1LEBA 3Q5FA 2J5OA 3DEWA 2YS9A 2ICWG 1BOAA 2DMPA 1VQOI 2YX4A 2KRHA 2LKPA 3V8KA 4F3QA 4BBSJ 1QVUA 2VL8A 4M6YA 2RREA 2D1HA 3WTYC 3S93A 3GTLJ 3H36A 1OYIA 1OYWA 1NK3P 1PDNC 2EK5A 4EJWA 2EB7A 4XKVA 2HFHA 4CCKA 1ULYA 4MNUA 2HNHA 4CHUA 4AVZA 4N4NB 5TGTA 3O6BB 3T1BA 3OYMA 1AHDP 3ZQLA 2CUFA 5KNLA 3J7YJ 3E97A 1EF4A 2HYGD 4RAZA 3PUFA 1QVTA 3SHFA 1KU2A 4LLGF 1I5ZA 4XLAA 1IRZA 3TO7A 5B3SH 1QBJA 4DIQA 4HNTA 5LRRA 2RC4A 4ZTFA 3C2BA 4A2UA 4HDUA 4D0PA 2VQLA 5F64A 2LY1A 5GP9A 2DOAA 3CF5F 1WJCA 3WGGA 4Q4ZF 1P4WA 3DP7A 2PG4A 2UWMA 1FY7A 3F21A 4CZZA 1SFUA 3BPVA 4XR6A 4XICA 5EF6A 1E3HA 1RPWA 2WAQA 4ITVA 4EM2A 4LB6B 3BY6A 2DA4A 4C3HJ 1XD7A 3RKXA 2VKVA 5BMZA 2LDUA 3CZ6A 3IL2A 1G3WA 1MZBA 1P4AA 2F5FA 1A36A 2X9DA 2JA7J 1JTYA 1BOBA 1KQ8A 5A2QK 3WTXC 2K9NA 3TP3A 1WQ2A 2EJRA 1SFXA 2JRTA 3F0CA 3W6JB 4ZYAA 3E3VA 2CFXA 3OYHA 4A3IJ 1FYMA 3ESWB 3BR2A 2WAQN 3FXLA 1YHQI 1LFPA 3G6EI 4IHTA 3HPHA 2IA1A 2A6HF 5EYRA 1T56A 3JAMZ 3SEQA 1R22A 1ZHFA 4C3JJ 5E1WA 3H3VK 5GPCA 2ZJQF 1W1WE 3NRVA 2NS0A 2CO5A 3G1LA 3LL7A 4GXOA 4KFCA 4BKXA 2I10A 4UY8I 3IAS2 5GPAA 1FLIA 4FCYA 2FXAA 2MC4A 4QWQA 2DT6A 3AL0B 3E5UA 3JCUC 2E19A 2K02A 4G6DA 2V4JC 5DCFA 2VJ5A 3ULQB 4UUSB 2ZJRF 2X1CA 1F5TA 3PNTA 3OYAA 4L5IA 2ME0A 2QZ8A 3HZJA 3K4JA 4BY1J 5GTIC 1HDDC 3KZYA 5FKLA 2DMUA 2ID6A 1G2HA 3H0GJ 1S6LA 3I59B 1AA7A 3LSTA 4RGXA 5E3OA 1QRYA 3TEDA 4UUVA 4UV9A 3ZQFA 2XIGA 1R9TJ 4MFDA 1Z05A 2O61A 3K10A 1A35A 4LB5A 2UXXA 3GTGJ 4G7ZF 1QO0D 1UCRA 4P96A 1U8BA 1GXQA 4ZZDA 1K4SA 4PGHA 3FF5A 5LLQA 3E5QA 1WFXA 2FA5A 4F92B 4OU0A 1R36A 3PO2J 4E7KA 1U5TA 3NAUA 1GVDA 3K2AA 4JX4A 2DN0A 1ZH5A 3JRHA 4UNOA 4RB1A 2RV8A 4FX0A 1ZG5A 2JZYA 2L02A 5ILUA 4MLOA 4PUSA 1L3LA 4QPOA 1UMQA 2DQLA 2VOOA 4JQFA 4EJOA 5BOXA 2NVUB 2HOTA 1FX7A 2EPFA 4P1WA 3E0JB 3RKWA 5BQTA 3WGIA 3F23A 2A61A 2QM3A 3H5NA 1U2WA 3EUHC 3MCZA 5KAFC 4GO1A 4JBAA 3U21A 3ABKH 4HV6A 1TW2A 1FOYA 3BJ6A 4W97A 2BXYA 2QQ8A 5EJCA 5AIPA 3OYBA 3S1RJ 1WZ2A 3S16J 2OCCH 1W5CC 1HSTA 2ZXIA 1HLVA 2ZNYA 4XM3A 5LGNA 1RKWA 1Y0NA 2A6EF 4LD5A 3DBHB 2XROA 1JT6A 1SVMA 1J59A 5CQEA 4HQEA 2DBBA 4A3KJ 3JTGA 1ETOA 2L4MA 3M8FA 2MD5A 4IF4A 1X3ZB 3BCBA 1FTTA 2MG4A 1X1DA 2VUMJ 2F5VA 1BN5A 3QYBA 4XL9A 4B44A 5D5VB 4HZFA 3BG5A 4HG2A 1ZLJA 3TO9A 4BQAA 3I9V2 2NOJB 3TBIA 3HSFA 2P6TA 1E0EA 3BP8A 4HX8A 4V2GA 4CCNA 5LBQA 2CUJA 2L7KA 5E18F 2LD5A 1G3YA 1G8XA 2K4JA 1OLTA 1P92A 2ZXWH 2F6CA 1UAAA 2DK5A 1ETVA 4I76A 1LKXA 1MH3A 2HOSA 1JKOC 2EA4A 3LAJA 2WV0A 4MIMA 4Y7NJ 2ZFUA 3S15J 4P9UA 1TWHJ 2ZCWA 4HX4A 1I1GA 1MBJA 2VQHA 3S3NA 1HCRA 4CSWA 3G2BA 2W25A 3LQRA 3NARA 3RKQA 2KZGA 1H0MA 2CQKA 5HOOA 1QZYA 5D4SA 2E2IJ 1BW5A 3K1MA 4I98B 4RA2A 3S3MA 1MBFA 3H9GA 4UHTA 3K4BA 3SFIA 2GLOA 1LFBA 4XK4A 5E17F 3HG9A 3IP4B 3WU2C 1V4RA 4RAYA 2CGPA 3PSIA 1BC7C 4NC6A 5IP9J 5DS9A 1MMDA 2VC1A 3CTAA 4OMZA 2HTSA 3Q3SA 2X6YA 3GVAA 4CCLA 1ERDA 4BQOA 5CVIA 4ANJA 2DOFA 1AOYA 2XC7A 1VF9A 1X2NA 2DJNA 4YG2F 4NNJA 3RI4A 3KP6A 2FSWA 2VN2A 1B72B 3H3ZA 1VQLI 4DYQA 2NS8A 5IYDJ 4JP0A 4BDYA 2L54A 4DZJA 2HKOA 1VQ4I 2LP0A 5BPIA 4ENMA 3PFYA 2L7MP 1AWCA 5GAHJ 3OYDA 3LQQA 1B9MA 1HSJA 2FF4A 1CQTA 4E4HA 3MKWB 3WTUC 1RIOH 1CF7A 2Y69H 4C2UA 1R7JA 4Y33A 1O3TA 5HLHA 3L2UA 4D9JA 3QRFF 5LHGA 3Q0VA 5K7FA 5JVTA 2IS4A 3ZMTA 1E3PA 5DD4A 3C1DA 2Y9ZA 1XB4A 1ZELA 1Z7UA 4LIUA 2OF7A 2V26A 2V1XA 1IAWA 2K27A 2OJED 4LLNA 2CG4A 3NWSA 3V7CA 1OCPA 3M8JA 2VBWA 4NQWB 2HVSA 2F4MB 1VZ0A 4XKBA 1B59A 3W2AA 2HOAA 1BC8C 3U1KA 2BEOA 2MGQA 2X6WA 1FP1D 1EV7A 3QOEA 4DBRA 1BR1A 4I6ZA 1MNDA 2BOLA 1PVEA 3QODA 2X51A 1I3QJ 2ELJA 2PN6A 2VJIA 3WGHA 2X48A 1E2XA 2DMTA 3LA7A 4HBLA 5FO5A 4RMNA 1B8IA 4GYGA 2C6YA 1VQKI 3O2PE 1O3RA 3W6VA 4Z2YA 2WC2A 2WB1A 4BQQA 2VQCA 3U2RA 1FZPB 3HTUA 3W6KB 3HGYA 1Z67A 2HGCA 5E8GA 3T8RA 4KMUX 3J80K 2JK3A 1ZAOA 2MW8A 4EJTA 4GDFA 1WGXA 1IN6A 2DDAA 1IDYA 3A0BC 2XUBA 2YR2A 1DGRM 1YO5C 2VONA 1NTCA 3LSRA 4E7ZA 1JHHA 3S2HJ 2DFIA 1F4KA 2WAFA 4G8XA 1K61A 3D5RC 2LNBA 1F9NA 1K79A 1W36D 1O3SA 2R4GA 3BG3A 4ON0A 2AS5F 2R5ZB 2DT5A 2WB1N 1X1BA 3WHCA 1ETQA 1UG2A 2NAZA 2DMNA 3FHZA 3ZN0A 1FOXA 4DNCA 3AG4H 3HOUJ 1SC7A 3CUQB 1KQ9A 1S5LC 2GBYA 2LH9A 2DPUA 2DTRA 3WODF 4R8HA 4BHCA 2XGDA 4MO7A 1UZCA 1QGPA 4IKFA 4YFXF 5D8KB 2VT3A 4V19K 3TQNA 2IS2A 2DU9A 2ZBKA 2KP6A 3B73A 5HLIA 4MEXF 2VQGA 4I02A 2KDOA 4PSWA 1OYYA 1TNTA 2IGOA 5LD2C 1XN7A 1N77A 2QGUA 1NH3A 1ZGJA 2DTZA 2IS1A 1JGGA 1U6GA 3D5SC 2LRDA 1XMAA 2DA5A 3IH3A 3KZZA 4XKWA 1YS6A 3C2HA 4A0XA 1GXPA 1MNMC 3OS2A 2CW8A 4CICA 3MZHA 3A4CA 3K70C 2LOOA 4FT8A 1SVLA 3TO6A 4XRFA 3J7AO 2XAUA 4OWRB 3R4KA 3CCMI 1IV6A 1D0XA 1P2FA 3RPQA 3KP3A 3ZXSA 3H92A 3GLLA 4M9ZA 4LG0B 2JQ7A 2IPQX 4AIJA 4M72A 2VE9A 2QQAA 1HW5A 3PIPF 1ZG1A 4Q47A 4XN0A 3MKZA 2M4GA 3D1NI 3SDGA 3FISA 5HLTA 1HC8A 5ICEA 1MGTA 2VJJA 3EDPA 3QYEA 2GAUA 2IS6A 3CQZJ 3K0LA 1I6HJ 1XTAA 1ZR2A 1JT0A 1FIPA 1ZREA 2MH9A 3GZNB 2A07F 4L9NA 1LNWA 3FK7A 2EV0A 5D6FA 1W4MA 3GTKJ 1ZRCA 3FXUA 2M0MA 2XAGA 2ZFWA 1FOWA 5E20A 1T98A 1OCCH 3A02A 3SFZA 5DTDA 3IH4A 5GAEJ 3OS0A 4MTDA 3WU1B 4IO9F 4XLNF 3RIRA 3H5RA 2NS7A 4BXFA 1S29A 3CJRB 3R0JA 2M7BA 3QU3A 1V3FA 4A5MA 4BE1A 4PGGA 2A5YB 5J1RA 1MBHA 1B6AA 4IHVA 5HDNA 3OSFA 4E6KG 1MIJA 4ENJA 4BUPA 3BWGA 2YPRA 2WA0A 4L9TA 4ESBA 2HZDA 2YU9J 5BS6A 3K4NA 4KITB 3GTJJ 1IZ1A 3R60A 5DM7F 3HOYJ 4IEJA 3TW7A 1Y8QB 4PSXA 4UVBA 4B3AA 2M1BA 1OMIA 4U88A 5K5RA 3OS1A 1G4DA 2VKDA 5F0HA 1IN8A 4HA8A 4BE2A 3ZQGA 4EJUA 4OIRF 1YRNA 2X6XA 2XGXA 3SDBA 2RKHA 4B43A 1H9TA 4ETSA 1T08B 4A3GJ 4E7JA 4PJ0C 1TQIA 2M8GX 2E7XA 4L5JA 1FOKA 1ZKGA 2BXZA 1ZTRA 1BBYA 1F43A 1YW8A 2EBIA 4M9XA 3TP0A 1S7AA 2VE8A 1RNLA 2DOEA 1QA6A 2Z3YA 3X2QH 1Z3XA 4CCJA 3HL2A 2R5YA 1HF0A 3DBLB 4CCOA 2P8TA 1Y8RB 4WK8F 3M3YJ 1S3JA 1FIAA 1ZLKA 2JN6A 3FDYA 3KEYA 3CC7I 3MMYB 2GQQA 2E35A 1VI0A 2JSPA 3AG1H 4GYIA 4GCVA 1NHAA 4V2FA 5HS7A 1D0ZA 2M8EA 3VDXA 3V4GA 3VPRA 1JJ6C 1BI3A 4G9YA 4U7BA 3CCLI 5F0CA 4G7OF 2L9NA 1ENHA 5M3FJ 1O57A 4IL6C 3FXOA 5KHDA 4XIDA 5CVRA 2JPBA 4Q5SF 3GW2A 2CRGA 1HW2A 1FSHA 1F36A 2HVQA 1Z1DA 3S8PA 1R23A 1U5TC 3P9KA 3F8BA 1J5YA 1ACIA 4LITA 3CC4I 5JLWA 2OZ6A 3L2CA 3KFWX 3JAMK 3KLNA 1USSA 3UKGA 3HXLA 3OYLA 1Y39A 1NG6A 4LGWA 2WWYA 2NVYJ 5E8IA 2H27A 2JA8J 2PLYA 1FPQA 2KQRA 3TW6A 3BZCA 4LK1F 1T38A 1WHUA 4AM3A 3DU5A 4IHYA 1KA8A 4G6TB 3SZGA 3FXMA 2XAFA 4BJ5C 5FLMJ 4S04A 5D5WB 5DCMA 4IOAF 3MN2A 1K6OA 3DTKA 4HSRA 3CESA 1K78B 3GMEA 2LK2A 4EM1A 5LHHA 2GM4A 2R7RA 5HVQC 1D8JA 4WX9A 1HW1A 2LFBA 2VB6A 3S1NJ 2BHZA 1PUFA 3PNYA 2GXGA 3A01A 2DXIA 2HKXA 3P5JA 3TDUC 5IOZA 5CVJA 5D6EA 1B9NA 3HM5A 2EIKH 1W7PA 2VJ4A 5HNFA 1T6SA 2VC0A 2IA0A 1U3EM 2FNAA 4HLXA 3OYIA 2GA2A 1HBXG 2L5QA 2UUZA 3MKLA 2JUCA 5E79C 3FKIJ 3U9GA 4ZDOA 4EMSA 1YS7A 5TJJA 4FE4A 4XLHA 2D2WA 4HV5A 2K4BA 4ABZA 1E3OC 4F52A 2Y75A 3HRMA 2ECBA 4XSXF 4RB3C 4NB5A 2L2OA 3DU6A 3M1EA 1CGPA 1R4NB 2P0WA 2XGEA 1T33A 4LK0F 1TLHB 2EFWA 2MYSA 1IC8A 3OR1C 1QNTA 4PZJA 1F1ZA 1ON1A 3CP8A 2R0QC 2YU3A 1KU3A 1IN7A 1S7EA 2L9SA 2LLKA 2VI6A 4UB8C 4IHWA 1XMKA 3BZ6A 3K4CA 2JA2A 3ZPLA 5L3CA 1JGSA 5CVUA 2V6CA 5H6QA 3BQYA 4KICA 5EG0A 2Q2EB 3GUDA 4U0WA 5ILSA 2LTPA 1EJ9A 5ICFA 2ISZA 3HRTA 3GWZA 2X0LA 2EQRA 2GOMA 5IP7J 5E3NA 2ETHA 2STWA 4GFBA 4G6QA 4LOCA 1FBSA 1GUUA 1GV2A 3DTIA 1P7IA 3S17J 2P7VB 2V79A 4H0EA 4M3BA 2ME6A 3RSNA 1JKRC 1OCTC 1YW7A 2RQPA 3KPHA 2XKOA 3ZQQA 4B48A 1H8AC 2ZB9A 1R5GA 2LVSA 2D5VA 2Y0MA 2FQ3A 1Y1WJ 3IWZA 1WH7A 3DPTA 3QYFA 2P4WA 2ESHA 2DJIA 2PI0A 1HDPA 2R7DA 2KIQA 5F27A 1R5HA 2QQBA 3K6GA 1FTZA 1BJAA 3L9FA 5H20A 4P9FA 4B3XA 1TQMA 1PP7U 2PMZA 2ADUA 1Y6IA 1E17A 2IGNA 3LWFA 3V8LA 2QLZA 3I4NJ 1Z9CA 3IWFA 2VLAA 3RQIA 4MFEA 3BR1A 3DKYA 2KMUA 2O3FA 2Y9YA 4N9HA 1HKTA 4ZYHA 2MBFA 3RCOA 3K7AJ 5L3DA 1D5YA 3G71I 3LFKA 2FUG2 4Y4RA 1WH5A 1JUMA 1LVKA 3N97A 2CV1A 5CJ9A 4C9YA 3JREA 3GLXA 1IN5A 4ZYDA 1EH7A 5LHIA 2CH0A 4D1QA 1TWCJ 3LAPA 2PMZN 3E6DA 2RNJA 1WJEA 1YJWI 2VPLA 1L0OC 1OR7C 3V8JA 4KN4X 4C2MJ 5C3EJ 1FYKA 4OIPF 4M73A 3LSIA 1REPC 1UJ8A 2BBYA 3VB2A 1RETA 2L9RA 2BYVE 1O7FA 2P5KA 3V42A 2DI3A 1JXSA 1RR7A 1MBEA 2EILH 2IP2A 5LEKA 3BCAA 3HGGA 3GTPJ 1G6NA 2VT2A 1LFUP 2IT0A 2PJRB 2CUZA 2K9MA 1Q1HA 2W24A 3JRCA 2XPUA 2NVQJ 4XMYA 4ZH4F 1J7KA 2V1DA 2Q8KA 4JK1X 4IQJA 1TBXA 1JHFA 2JJ7A 1X1PA 2H6BA 3H35A 3PSFA 3FXRA 1NG7A 5L3EA 2EZHA 5AONA 4U87A 4FQGA 4BS9A 5FD6A 3M4OJ 2ESNA 2EV5A 2IJLA 1BI0A 3FKJA 3S1QJ 1VQ5I 3CD6I 2R7XA 1LE8B 2OV7A 5E3MA 3EYIA 3ZQIA 1V5GA 1WVRA 3SEZA 1SD5A 1YI2I 2P5LC 2CQ7A 2HTJA 5HS9A 2KRCA 3ECOA 4HF0A 2ELKA 1FT9A 1LDJA 2HZTA 3K4LA 4KUMA 4PCQA 3KEQA 1XDUA 4L18B 4CXFA 2BVLA 4IQ4A 5J1YA 3FBIB 2UXNA 1ORKA 3D0SA 2V9VA 4M9SA 5HS8A 5EGOB 3ZMUA 2W57A 5H2FC 1ZGWA 2WV1A 3DKWA 3Q0WA 1HA8A 5DM6F 4CYCB 1IV8A 3MD2A 4KNYA 1MDMB 2MC3A 1K6YA 3GX4X 5J1UA 2KPMA 1BJZA 3JRDA 4R1HA 5D5XB 4IRGA 2CU7A 2OAZA 3QPLA 2M87A 1FMVA 3BR3A 4N4OB 1STZA 3LSHA 3E6CC 3P9IA 4UUSA 2F5DA 3FXQA 3OIPA 3T5XA 1O3QA 3CO7C 1EH8A 3WTVC 2FNPA 2QSFX 3HOZJ 6PAXA 4XSZF 1YE9A 3BR5A 4QIWN 1OJLA 3FMSA 2BE5F 3FXKA 2EFOA 5F04A 3RDIA 3HIFA 1S8NA 3OIOA 3I59A 3S1MJ 1X2MA 3LFUA 2M4KA 4O3MA 2KLOA 2F5EA 4L9VA 3GFJA 2NOGA 3VSLA 2IEKA 4EV0A 9ANTA 4NBQA 3CMEI 5JFRA 2ZMEC 4M74A 2NRAC 2W48A 4TV7A 4E7HA 3MFKA 4N0BA 3C3WA 3IAM2 4UV8A 2Y30A 3I55I 2IGMA 3HJEA 3PQKA 2DQRA 2A68F 1V5EA 3DPUA 4ESJA 2FOWA 1A6IA 4OINF 5FKNA 2Y48A 5J8CA 1FP2A 3ZP5A 3BJOA 4NC7A 1BIAA 2MLKA 1WWXA 3LOCA 2E5NA 1D8KA 2L4AA 4MTEA 1RRJA 2PQ8A 2R7ZJ 2QBYB 2XB0X 3OYEA 4YEJA 4BQNA 3R0AA 3C18A 4QSHA 2R92J 4RB0A 4Y13A 5LFAA 2FX0A 3OIQA 1KQ0A 3P9CA 3J81K 4E7IA 4LJZF 5J3LA 5D4RA 1TQPA 3QP6A 4ZC3A 3DWLE 2WBMA 2DPDA 1EKEA 3GEZA 2O8XA 2Y2ZA 2KJBA 2Q0OA 2IBDA 1SD7A 3WU0A 1OR7A 1X1AA 3MWMA 4RLQA 2NNYA 3HPGA 2P7CB 3QAHA 3G4SI 2AQEA 2HXOA 2HEOA 3I4PA 4KIFA 2VXZA 2LY2A 3IRQA 3GTQJ 3J7ZI 1KZHA 1GLNA 2NXNB 3WG7H 4BYYA 1TW3A 4U0VA 2JSCA 3ABUA 3BROA 3PQJA 1WJBA 1MD0A 1BW6A 1P7JA 5IY5H 4N9IA 5IT9K 1ZRDA 4ZJZA 3BZKA 2ECCA 1B4AA 3F9KA 3K4MA 3T8TA 4KISA 1HOMA 4CDGA 4XKCA 2BVMA 2F2EA 3DKXA 4A3MJ 4FISA 3EQLF 1UG0A 2HYFA 5EEHA 4IHXA 2ZKZA 3ASOH 4JX5A 3I71A 1XPXA 1N75A 3I5UA 4IJAA 1YX5A 5KAIC 1WJDA 2B9SA 1MBKA 2E36A 4I09A 3KIOA 4WXDA 2E2JJ 1IW7F 4Q48A 4XRMA 1YOVB 4I0AA 2E5ZA 3REOA 1DP7P 2E7WA 2HS5A 3BR6A 1OCRH 1OKRA 3TKYA 5EDNA 5LGUA 2HYJA 1WI3A 1T2KA 4B4CA 2J5PA 3MVPA 3SQNA 3R6SA 2G0EA 4HAMA 4X1EA 3CUOA 3CLQA 4HYEA 4YELA 2DA2A 4PJNA 4DZPA 4C2TA 1D1BA 1YIOA 4D7MA 3B02A 4B1RA 2GWRA 4Y52J 1J75A 2FD5A 1ZN2A 4UVAA 3BG9A 5J6XA 2W82A 3KLOA 4DGWB 1DQUA 3EPZA 3TOBA 1R5ID 4EGYA 2CQQA 4ZYGA 2EFPA 5ERIA 2HPMA 3IC7A 3OL3A 3JRIA 2GOXB 2CYYA 2PJPA 3SYTA 1W5TA 3JR9A 1JKPC 2DAOA 1KYZA 3ZQCA 2P81A 3FHNA 3J81Z 4MGRA 5JHFA 1ZYRF 1IDZA 3ABMH 4RGRA 1TNSA 4A5NA 3ZN1A 5CKTA 1SAXA 1XCVA 2E1NA 3DTEA 3FZVA 5FROA 1WRJA 2VIXA 1OFCX 4FHTA 4XRSG 4KN7X 4S0HB 1APLC 1ODDA 3LSKA 1RUOA 4LIVA 3DLAA 2HU9A 2CFOA 1XGSA 5EZHA 2RDPA 1X1CA 2BV6A 1V55H 4LG3A 3HOWJ 4BXXJ 2ZMEA 3M8EA 4RM2A 2W4SA 2EFNA 1R1UA 5E3LA 2LMDA 3BDDA 1N78A 5IT9Z 3F72A 5JHUA 3JRGA 1XDSA 3I3LA 1OISA 4E70A 1V5FA 3MAJA 3LNQA 2VBXA 4IRIA 4NQWA 1U9NA 1KU7A 1SANA 1IN4A 2ZSIB 3DLLF 1LDKB 4PFPA 1FBUA 2R7WA 3MQ0A 2KRFA 2IW5A 3OR2C 2EIMH 1IUFA 2A05A 3H5AA 4YIFA 3L2VA 3JRFA 1IO2A 4QLCU 1VFCA 2KIMA 2PBIA 1R71A 3RKYA 5GAGJ 2BW3B 5F1RA 1O4XA 2R93J 1J0RA 4YIIA 2VBYA 3HEFA 3GTMJ 1O7LA 2YX7A 4RGUA 4IPAA 3WE2A 4AD9A 4ZDPA 4G7HF 1A31A 1G59A 3V7RA 2W84A 4Y3OA 4NUBA 5C44J 3JTHA 4A69C 1R58A 2BY1A 4QTRA 1MMSA 3WTTC 4RLFA 1QU3A 4CZCA 2EFQA 2VOPA 3DPLC 2FBHA 3JRBA 2MH2A 1FYLA 3K9TA 3ERMA 2JA5J 1WJAA 5M3MJ 3I53A 3GCMA 2F4IA 4YIRX 2Z1DA 1YIJI 1WSUA 3CDHA 1M1EB 1QHGA 2HQRA 5L3BA 3N4MA 3HKZA 1RR8C 2QWWA 3QQAA 5F6FA 1SD4A 1Z6TA 4G94A 1QPMA 1DGWY 3PUBA 4BH9A 2CUEA 4KDPA 1MMNA 2RQQA 3F8CA 4A3LJ 2PEXA 3FMQA 4L9JA 4K2EA 1WJFA 4ENKA 4M3GA 2IAIA 2EV6A 1MSEC 1BI1A 4FTHA 2DT7B 1YW9A 4I0BA 3OYJA 4KT5C 3CUQA 5FJ8J 2X4HA 3LA2A 1C0WA 3BC8A 3I56I 4P55A 2QKLB 1S9HA 2VXDA 4FASD 2H8WA 2WAEA 3K70D 3G1MA 2JWTA 3ZMSA 4XLPF 2KISA 3HKZN 1T95A 5DDGA 4D5FA 5LGTA 2L0KA 2DFEA 4AU7A 2QSGX 1R1VA 4JX6A 3ELKA 1XGOA 1ZGAA 2F5CA 3FMRA 1DDNA 2O5RA 4XQFA 1J09A 2XRNA 2W85A 5FLXZ 5B5EC 1EA3A 1JTXA 3TMOA 4I2OA 2DW4A 2WY8Q 4HX7A 2DMQA 1MNEA 3CF2A 1W0TA 3KP7A 2HDWA 3K1PA 3KYDB 5C4JJ 2OC6A 2TDXA 4EVIA 4A3EJ 2FQ4A 1TWAJ 5ICCA 1GV5A 4M3FA 4ZYEA 2EZLA 4A3BJ 2HPIA 2XVCA 3JW4A 5K1YA 2MFZA 3B6CA 1SFEA 2DA6A 2Z16A 2LBFA 1VQNI 3M9AA 2BY0A 4U0YA 1IUYA 2KL4A 3ZR8X 2R7OA 5B1BH 4HQMA 4PJJA 3NQOA 4FE7A 2V9PA 1S72I 3VWBA 3ISPA 1OCZH 3LMMA 1AKHA 2K9LA 3LSJA 3T0YA 2M3AA 3OYGA 2VKEA 1RKTA 1BI2A 3BTJA 5E1XA 1XSDA 1XSVA 1FWZA 3AG2H 1H9GA 5F0FA 2OBPA 3RZDJ 3W3CA 3OY9A 3Q9SA 3DEUA 3HOTA 5TRDA 2BY2A 3F8NA 4MQVA 1IJWC 1I1SA 4M3DA 3GO5A 4AVPA 5DYMA 4HNVA 1P4XA 4NC8A 2A6TA 5CPRB 1WJ5A 3RPUA 4BBRJ 1T0FA 4OIOF 1I39A 2M0CA 4D5CA 2JUGA 1YJ9I 1ETKA 5IT3A 1UELB 4J19A 4RAGA 2K9QA 2M7AA 4J01A 2PFBA 1SFKA 1XCBA 4BHBA 1K7AA 1I27A 2O0YA 4II2A 1DUXC 3HRUA 2E71A 2DDBA 2OQRA 2FBKA 4ASNA 1OPCA 2CS3A 4PJMA 3PL8A 3L2RA 3O8GA 5D5UB 2M45A 1XGNA 2MD0A 3OOPA 3F6OA 2XV4S 1DP3A 2HQAA 2OTJI 1H89C 4NHJA 4I99C 3GXOA 2CWEA 2M34A 2OD5A 5D8LB 5ICGA 1ETWA 3ERED 4I7HA 1U5TB 2E60A 4WF2A 3CLOA 1MW7A 1SMTA 2HWVA 3SJMA 3IUOA 2K3PA 4IRHA 3EUAA 1YJNI 1P9QC 1I6XA 2O03A 2ELHA 2RVCA 3Q9VA 3GFIA 3VOEA 1FC3A 2TCTA 5J4YA 3LSGA 2H6CA 4BEHA 4DW6A 5FRNA 3L2WA 2KT0A 4LMYA 4UB6C 1Z91A 2PMUA 4I01A 3VYUB 3AL0C 2K40A 4BGDA 5BNGA 2OZUA
chains in the Genus database with same CATH topology
2JK3A 2MW8A 1ZR4A 3S14J 2HDDA 1WGXA 1IDYA 5J1UA 3Q0UA 1NTCA 3LSRA 1BJZA 3S2HJ 3JRDA 3BTIA 5IP6A 1K61A 2O9LA 2CU7A 3QPLA 1QPIA 3RZOJ 5HODA 3BTLA 3BR3A 3BG3A 2R5ZB 2WB1N 3WHCA 1ETQA 1UG2A 3GBGA 4NDLA 2DMNA 5EEAA 4UUSA 3G1OA 2K9SA 3HOUJ 3ZOBA 3HOZJ 4M3EA 3OSGA 3BR5A 4QIWN 1OJLA 2GBYA 2HQ5A 5EG0B 2JA6J 5F04A 2XGDA 3OIOA 1WCMJ 2LY9A 4MO7A 1X2MA 3ZQHA 3S1MJ 5FKMA 4DYCA 2NOGA 9ANTA 2IEKA 2LR8A 3CCYA 2EH3A 3QPSA 1NK2P 2TRTA 3DCFA 2W48A 2XSDC 1ETXA 2DA3A 5C4XJ 4UUTA 2Y30A 3PO3J 3HDDA 1TWGJ 2CJJA 2DTZA 1JGGA 4C3IJ 2MSYA 2DA5A 1A6IA 4A3CJ 3IH3A 4AC0A 1U9OA 5FKNA 1U78A 2DA1A 4A3DJ 1MNMC 3LOCA 2R7ZJ 2NVTJ 2EZKA 3HOVJ 2XB0X 5K7HA 1IV6A 2R92J 1K83J 4QSHA 3BQZA 3CDLA 2FX0A 4RDUA 5FLVA 3PM1A 5J3LA 2EZIA 2COBA 1TWFJ 2Y2ZA 2LKXA 3D1NI 5EZGA 2IBDA 3FISA 3SDGA 3DEWA 2YS9A 2DMPA 2O7OA 2YUSA 2HXOA 3GTQJ 4BBSJ 1QVUA 3CQZJ 1I6HJ 1ZR2A 1JT0A 1FIPA 2M2EA 2N8GA 1JKQC 3GTLJ 1IG7A 3FK7A 1VNDA 3GTKJ 1NK3P 2B63J 4A93J 1BW6A 1P7JA 3A02A 3JRAA 2ECCA 5DTDA 3IH4A 3FK6A 1WPKA 1HOMA 2JMWA 4XRSA 1AHDP 4A3MJ 2NS7A 4FISA 2CUFA 3ZQLA 1EF4A 4IHXA 2Y31A 4JX5A 1QVTA 5J1RA 1MBHA 4IHVA 3OSFA 1MBKA 2E2JJ 1IRZA 4XRMA 3LSPA 4D7NA 3C2BA 2YU9J 4G12A 1W0UA 3BR6A 5GP9A 3GTJJ 5EDNA 4IEJA 3TW7A 3HOYJ 2HYJA 4XICA 1WI3A 4B3AA 1JUSA 4B4CA 5EF6A 1RPWA 3MVPA 2X6OA 2G0EA 4X1EA 5F0HA 2DA4A 2E1OA 4C3HJ 3ZQGA 2VKVA 4AYBN 2OPTA 1JUPA 2DA2A 4DZPA 3GTOJ 4W1UA 1ETYA 1YRNA 4D7MA 2X9DA 2JA7J 4B1RA 4Y52J 1JTYA 4A3GJ 2XGCA 2FD5A 2M8GX 2K9NA 3TP3A 1A5JA 3F0CA 1UHSA 1ZKGA 1ZTRA 3BG9A 1TC3C 1AU7A 1Y1VJ 1B8IB 1F43A 4A3IJ 2CQQA 2EBIA 3TP0A 3BR2A 2WAQN 1DU0A 3JRIA 2R5YA 1HF0A 5EYRA 3M3YJ 1FIAA 1XC5A 2JN6A 1T56A 3O8HA 3JR9A 1JKPC 2H8RA 3HBLA 4C3JJ 3ZQCA 3H3VK 2P81A 5GPCA 1VI0A 1ITYA 1IDZA 1ZQ3P 1ZK8A 3G1LA 4V2FA 4BKXA 2I10A 3B6AA 3IH2A 5GPAA 3VPRA 1JJ6C 1BL0A 4FCYA 5F0CA 1OFCX 4XRSG 1APLC 4S0HB 1ENHA 2E19A 5M3FJ 4UUSB 4XIDA 2XRLA 2CRGA 5EZHA 3HOWJ 5M5YJ 1F36A 4BXXJ 1SFOJ 2ME0A 3BTCA 3IV5A 4A3FJ 4BY1J 1HDDC 5FKLA 5E3LA 2DMUA 5JLWA 2ID6A 1G2HA 3H0GJ 5E3OA 1QRYA 3TEDA 1GDTA 3JRGA 3UKGA 1MBGA 3ZQFA 1R9TJ 5IYBJ 3A03A 4MFDA 2KDZA 3OOUA 1GT0C 2NVYJ 2L7FP 3LNQA 3GTGJ 2JA8J 1U9NA 1SANA 1U8BA 3TW6A 1JJ8C 4IHYA 5FLMJ 3PO2J 2FJ1A 3MN2A 4DYRA 1LE8A 1IUFA 1VFCA 3JRFA 3NAUA 1GVDA 1POGA 2LK2A 3K2AA 4JX4A 2DN0A 2GM4A 3JRHA 2LFBA 1O4XA 3S1NJ 4MLOA 1PUFA 2R93J 3A01A 1UMQA 5IOZA 1I50J 3HEFA 3GTMJ 3HM5A 4AUXA 2HOTA 5EGOA 3BT9A 5C44J 4A69C 3FIWA 4QTRA 3MKLA 4CYCA 3JRBA 3FKIJ 2O8KA 4RBOA 2AHQA 2JA5J 4FE4A 4W97A 4ABZA 5M3MJ 1E3OC 2ECBA 3S1RJ 3S16J 1Q1VA 5F1JA 2XB5A 1HLVA 2XGEA 4M6VA 2NVXJ 1T33A 3QQAA 1IC8A 1RKWA 2CUEA 1JT6A 4A3LJ 2R0QC 1S7EA 2LLKA 2VI6A 2IAIA 2VPRA 4M3GA 4A3KJ 1MSEC 4IHWA 1ETOA 4FTHA 1XG1A 1FTTA 5FJ8J 2MG4A 2VUMJ 3BQYA 5EG0A 1FJLA 5F08A 2CQXA 3G1MA 2JWTA 3HKZN 3BG5A 2LTPA 4D5FA 2L0KA 4JX6A 2XPWA 2EQRA 4V2GA 5IP7J 5E3NA 2H1KA 2LD5A 4GFBA 4LOCA 1JTXA 1GUUA 1GV2A 2AO9A 1ETVA 4I76A 1P7IA 3S2DJ 2DMQA 3S17J 1MH3A 2Y0SN 2HOSA 4M3BA 2ME6A 1B72A 1JKOC 1W0TA 1JKRC 1OCTC 4MIMA 1H8AC 4Y7NJ 2ZB9A 3S15J 2LVSA 1TWHJ 5C4JJ 2D5VA 1Y1WJ 1MBJA 4A3EJ 5FKKA 1WH7A 2FQ4A 1MSFC 1TWAJ 1HCRA 1GV5A 3NARA 4M3FA 2EZLA 3RKQA 4A3BJ 1HDPA 1YRNB 5JLXA 5F27A 2E2IJ 2QF7A 2DA6A 3B6CA 1BW5A 1FTZA 1MBFA 3SFIA 2GLOA 1LFBA 4XK4A 4FE7A 2M9HA 5FKOA 5K7ZA 1AKHA 3I4NJ 5IP9J 3LSJA 5DS9A 2L7ZA 3RQIA 4MFEA 3BR1A 2VKEA 3Q3SA 3CMYA 1RKTA 3BTJA 4X6AJ 5IYCJ 2HXIA 2Y9YA 3HOXJ 3L1PA 2R5YB 1VF9A 1X2NA 2DJNA 3K7AJ 5F0FA 3RZDJ 1D5YA 1B72B 2ID3A 1WH5A 4DYQA 1JUMA 2NS8A 5IYDJ 4JP0A 3JREA 1DU6A 1IJWC 1H88C 4M3DA 3HB9A 1TWCJ 2PMZN 1RESA 4DZJA 4BY7J 2LP0A 4HNVA 2L7MP 4C2MJ 1FEXA 5C3EJ 1CQTA 3E7LA 2XPVA 3I4MJ 1RETA 2L9RA 3BR0A 4BBRJ 2M0CA 1RR7A 4D5CA 4EEFG 1ETKA 1MBEA 3Q0VA 1AKHB 3HGGA 5K7FA 4J19A 3GTPJ 2K9QA 1LFUP 2E2HJ 3WHBA 2Y9ZA 3JRCA 5IPAA 2XPUA 2NVQJ 1MH4A 2OF7A 2QCOA 3O8GA 1Z77A 2DA7A 2HI3A 2JJ7A 1OCPA 1Z0XA 2EZHA 3M4OJ 2HOAA 1H89C 2MGQA 3S1QJ 2M34A 1LE8B 1ETWA 5E3MA 4I6ZA 3ZQIA 2R5ZA 1I3QJ 2X48A 1IGNA 3SJMA 2ELKA 1BA5A 2DMTA 1PUFB 3A01B 4L5EA 5IOYA 2TCTA 3LSGA 4DW6A 1B8IA 5J1YA 1ORKA 2KT0A 5EGOB 4JYKA 2RAEA 1XS9A 3W6VA 1ZGWA 2WV1A 3Q0WA 5M5WJ 2K40A 4CYCB 4A3JJ 1X58A 3HGYA 5BNGA 5M5XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK3 A;  2MW8 A;  1ZR4 A;  3S14 J;  2HDD A;  1WGX A;  1IDY A;  5J1U A;  3Q0U A;  1NTC A;  3LSR A;  1BJZ A;  3S2H J;  3JRD A;  3BTI A;  5IP6 A;  1K61 A;  2O9L A;  2CU7 A;  3QPL A;  1QPI A;  3RZO J;  5HOD A;  3BTL A;  3BR3 A;  3BG3 A;  2R5Z B;  2WB1 N;  3WHC A;  1ETQ A;  1UG2 A;  3GBG A;  4NDL A;  2DMN A;  5EEA A;  4UUS A;  3G1O A;  2K9S A;  3HOU J;  3ZOB A;  3HOZ J;  4M3E A;  3OSG A;  3BR5 A;  4QIW N;  1OJL A;  2GBY A;  2HQ5 A;  5EG0 B;  2JA6 J;  5F04 A;  2XGD A;  3OIO A;  1WCM J;  2LY9 A;  4MO7 A;  1X2M A;  3ZQH A;  3S1M J;  5FKM A;  4DYC A;  2NOG A;  9ANT A;  2IEK A;  2LR8 A;  3CCY A;  2EH3 A;  3QPS A;  1NK2 P;  2TRT A;  3DCF A;  2W48 A;  2XSD C;  1ETX A;  2DA3 A;  5C4X J;  4UUT A;  2Y30 A;  3PO3 J;  3HDD A;  1TWG J;  2CJJ A;  2DTZ A;  1JGG A;  4C3I J;  2MSY A;  2DA5 A;  1A6I A;  4A3C J;  3IH3 A;  4AC0 A;  1U9O A;  5FKN A;  1U78 A;  2DA1 A;  4A3D J;  1MNM C;  3LOC A;  2R7Z J;  2NVT J;  2EZK A;  3HOV J;  2XB0 X;  5K7H A;  1IV6 A;  2R92 J;  1K83 J;  4QSH A;  3BQZ A;  3CDL A;  2FX0 A;  4RDU A;  5FLV A;  3PM1 A;  5J3L A;  2EZI A;  2COB A;  1TWF J;  2Y2Z A;  2LKX A;  3D1N I;  5EZG A;  2IBD A;  3FIS A;  3SDG A;  3DEW A;  2YS9 A;  2DMP A;  2O7O A;  2YUS A;  2HXO A;  3GTQ J;  4BBS J;  1QVU A;  3CQZ J;  1I6H J;  1ZR2 A;  1JT0 A;  1FIP A;  2M2E A;  2N8G A;  1JKQ C;  3GTL J;  1IG7 A;  3FK7 A;  1VND A;  3GTK J;  1NK3 P;  2B63 J;  4A93 J;  1BW6 A;  1P7J A;  3A02 A;  3JRA A;  2ECC A;  5DTD A;  3IH4 A;  3FK6 A;  1WPK A;  1HOM A;  2JMW A;  4XRS A;  1AHD P;  4A3M J;  2NS7 A;  4FIS A;  2CUF A;  3ZQL A;  1EF4 A;  4IHX A;  2Y31 A;  4JX5 A;  1QVT A;  5J1R A;  1MBH A;  4IHV A;  3OSF A;  1MBK A;  2E2J J;  1IRZ A;  4XRM A;  3LSP A;  4D7N A;  3C2B A;  2YU9 J;  4G12 A;  1W0U A;  3BR6 A;  5GP9 A;  3GTJ J;  5EDN A;  4IEJ A;  3TW7 A;  3HOY J;  2HYJ A;  4XIC A;  1WI3 A;  4B3A A;  1JUS A;  4B4C A;  5EF6 A;  1RPW A;  3MVP A;  2X6O A;  2G0E A;  4X1E A;  5F0H A;  2DA4 A;  2E1O A;  4C3H J;  3ZQG A;  2VKV A;  4AYB N;  2OPT A;  1JUP A;  2DA2 A;  4DZP A;  3GTO J;  4W1U A;  1ETY A;  1YRN A;  4D7M A;  2X9D A;  2JA7 J;  4B1R A;  4Y52 J;  1JTY A;  4A3G J;  2XGC A;  2FD5 A;  2M8G X;  2K9N A;  3TP3 A;  1A5J A;  3F0C A;  1UHS A;  1ZKG A;  1ZTR A;  3BG9 A;  1TC3 C;  1AU7 A;  1Y1V J;  1B8I B;  1F43 A;  4A3I J;  2CQQ A;  2EBI A;  3TP0 A;  3BR2 A;  2WAQ N;  1DU0 A;  3JRI A;  2R5Y A;  1HF0 A;  5EYR A;  3M3Y J;  1FIA A;  1XC5 A;  2JN6 A;  1T56 A;  3O8H A;  3JR9 A;  1JKP C;  2H8R A;  3HBL A;  4C3J J;  3ZQC A;  3H3V K;  2P81 A;  5GPC A;  1VI0 A;  1ITY A;  1IDZ A;  1ZQ3 P;  1ZK8 A;  3G1L A;  4V2F A;  4BKX A;  2I10 A;  3B6A A;  3IH2 A;  5GPA A;  3VPR A;  1JJ6 C;  1BL0 A;  4FCY A;  5F0C A;  1OFC X;  4XRS G;  1APL C;  4S0H B;  1ENH A;  2E19 A;  5M3F J;  4UUS B;  4XID A;  2XRL A;  2CRG A;  5EZH A;  3HOW J;  5M5Y J;  1F36 A;  4BXX J;  1SFO J;  2ME0 A;  3BTC A;  3IV5 A;  4A3F J;  4BY1 J;  1HDD C;  5FKL A;  5E3L A;  2DMU A;  5JLW A;  2ID6 A;  1G2H A;  3H0G J;  5E3O A;  1QRY A;  3TED A;  1GDT A;  3JRG A;  3UKG A;  1MBG A;  3ZQF A;  1R9T J;  5IYB J;  3A03 A;  4MFD A;  2KDZ A;  3OOU A;  1GT0 C;  2NVY J;  2L7F P;  3LNQ A;  3GTG J;  2JA8 J;  1U9N A;  1SAN A;  1U8B A;  3TW6 A;  1JJ8 C;  4IHY A;  5FLM J;  3PO2 J;  2FJ1 A;  3MN2 A;  4DYR A;  1LE8 A;  1IUF A;  1VFC A;  3JRF A;  3NAU A;  1GVD A;  1POG A;  2LK2 A;  3K2A A;  4JX4 A;  2DN0 A;  2GM4 A;  3JRH A;  2LFB A;  1O4X A;  3S1N J;  4MLO A;  1PUF A;  2R93 J;  3A01 A;  1UMQ A;  5IOZ A;  1I50 J;  3HEF A;  3GTM J;  3HM5 A;  4AUX A;  2HOT A;  5EGO A;  3BT9 A;  5C44 J;  4A69 C;  3FIW A;  4QTR A;  3MKL A;  4CYC A;  3JRB A;  3FKI J;  2O8K A;  4RBO A;  2AHQ A;  2JA5 J;  4FE4 A;  4W97 A;  4ABZ A;  5M3M J;  1E3O C;  2ECB A;  3S1R J;  3S16 J;  1Q1V A;  5F1J A;  2XB5 A;  1HLV A;  2XGE A;  4M6V A;  2NVX J;  1T33 A;  3QQA A;  1IC8 A;  1RKW A;  2CUE A;  1JT6 A;  4A3L J;  2R0Q C;  1S7E A;  2LLK A;  2VI6 A;  2IAI A;  2VPR A;  4M3G A;  4A3K J;  1MSE C;  4IHW A;  1ETO A;  4FTH A;  1XG1 A;  1FTT A;  5FJ8 J;  2MG4 A;  2VUM J;  3BQY A;  5EG0 A;  1FJL A;  5F08 A;  2CQX A;  3G1M A;  2JWT A;  3HKZ N;  3BG5 A;  2LTP A;  4D5F A;  2L0K A;  4JX6 A;  2XPW A;  2EQR A;  4V2G A;  5IP7 J;  5E3N A;  2H1K A;  2LD5 A;  4GFB A;  4LOC A;  1JTX A;  1GUU A;  1GV2 A;  2AO9 A;  1ETV A;  4I76 A;  1P7I A;  3S2D J;  2DMQ A;  3S17 J;  1MH3 A;  2Y0S N;  2HOS A;  4M3B A;  2ME6 A;  1B72 A;  1JKO C;  1W0T A;  1JKR C;  1OCT C;  4MIM A;  1H8A C;  4Y7N J;  2ZB9 A;  3S15 J;  2LVS A;  1TWH J;  5C4J J;  2D5V A;  1Y1W J;  1MBJ A;  4A3E J;  5FKK A;  1WH7 A;  2FQ4 A;  1MSF C;  1TWA J;  1HCR A;  1GV5 A;  3NAR A;  4M3F A;  2EZL A;  3RKQ A;  4A3B J;  1HDP A;  1YRN B;  5JLX A;  5F27 A;  2E2I J;  2QF7 A;  2DA6 A;  3B6C A;  1BW5 A;  1FTZ A;  1MBF A;  3SFI A;  2GLO A;  1LFB A;  4XK4 A;  4FE7 A;  2M9H A;  5FKO A;  5K7Z A;  1AKH A;  3I4N J;  5IP9 J;  3LSJ A;  5DS9 A;  2L7Z A;  3RQI A;  4MFE A;  3BR1 A;  2VKE A;  3Q3S A;  3CMY A;  1RKT A;  3BTJ A;  4X6A J;  5IYC J;  2HXI A;  2Y9Y A;  3HOX J;  3L1P A;  2R5Y B;  1VF9 A;  1X2N A;  2DJN A;  3K7A J;  5F0F A;  3RZD J;  1D5Y A;  1B72 B;  2ID3 A;  1WH5 A;  4DYQ A;  1JUM A;  2NS8 A;  5IYD J;  4JP0 A;  3JRE A;  1DU6 A;  1IJW C;  1H88 C;  4M3D A;  3HB9 A;  1TWC J;  2PMZ N;  1RES A;  4DZJ A;  4BY7 J;  2LP0 A;  4HNV A;  2L7M P;  4C2M J;  1FEX A;  5C3E J;  1CQT A;  3E7L A;  2XPV A;  3I4M J;  1RET A;  2L9R A;  3BR0 A;  4BBR J;  2M0C A;  1RR7 A;  4D5C A;  4EEF G;  1ETK A;  1MBE A;  3Q0V A;  1AKH B;  3HGG A;  5K7F A;  4J19 A;  3GTP J;  2K9Q A;  1LFU P;  2E2H J;  3WHB A;  2Y9Z A;  3JRC A;  5IPA A;  2XPU A;  2NVQ J;  1MH4 A;  2OF7 A;  2QCO A;  3O8G A;  1Z77 A;  2DA7 A;  2HI3 A;  2JJ7 A;  1OCP A;  1Z0X A;  2EZH A;  3M4O J;  2HOA A;  1H89 C;  2MGQ A;  3S1Q J;  2M34 A;  1LE8 B;  1ETW A;  5E3M A;  4I6Z A;  3ZQI A;  2R5Z A;  1I3Q J;  2X48 A;  1IGN A;  3SJM A;  2ELK A;  1BA5 A;  2DMT A;  1PUF B;  3A01 B;  4L5E A;  5IOY A;  2TCT A;  3LSG A;  4DW6 A;  1B8I A;  5J1Y A;  1ORK A;  2KT0 A;  5EGO B;  4JYK A;  2RAE A;  1XS9 A;  3W6V A;  1ZGW A;  2WV1 A;  3Q0W A;  5M5W J;  2K40 A;  4CYC B;  4A3J J;  1X58 A;  3HGY A;  5BNG A;  5M5X J; 
#chains in the Genus database with same CATH topology
 3ZMD A;  2K85 A;  2Q1Z B;  1WKM A;  2Z9O A;  3S14 J;  3HUG A;  2HDD A;  1TT0 A;  2GA1 A;  2R7S A;  3HTS B;  1J2X A;  5DUK A;  5IP6 A;  3FM3 A;  1MJB A;  4IHS A;  4PFO A;  2O9L A;  5LEJ A;  1QPI A;  3RZO J;  3ZCO A;  5HOD A;  4AID A;  2FRH A;  2HR3 A;  2WAD A;  1IXR C;  4RAF A;  3GBG A;  2H94 A;  1RZ4 A;  4XOT A;  1Z7L A;  1XGM A;  5EEA A;  2QEN A;  2K9S A;  3EET A;  3ZOB A;  4M3E A;  2QVO A;  3ZMV A;  2HQ5 A;  3L00 A;  1QZZ A;  2JA6 J;  2W1O A;  4HF1 A;  2COM A;  2V6E A;  1WCM J;  2LY9 A;  3ZQH A;  2MA3 A;  3CCR I;  2KHM A;  3VOD A;  2Z99 A;  2LRE A;  4EJV A;  4DYC A;  2VOD A;  4XON A;  4XLC A;  3CCY A;  5E1Z B;  1LUJ B;  2EH3 A;  3SZP A;  1NK2 P;  4XLF A;  1V54 H;  3DCF A;  4M6X A;  3L09 A;  1MJA A;  1R1T A;  3ABT A;  3CCS I;  1ETX A;  4XLE A;  2K86 A;  2FBI A;  2ZSH B;  3MZY A;  5FB2 A;  3VFZ A;  4A0Y A;  1TWG J;  2CJJ A;  2ZJ2 A;  1K78 A;  2MSY A;  3MEX A;  4HPQ A;  4A3C J;  4IXA A;  3L7W A;  4AC0 A;  4DJA A;  4MQ9 F;  1U9O A;  2MLG A;  2HDC A;  1D1A A;  2RGV A;  1U78 A;  2DA1 A;  3KE2 A;  2A5W A;  2B0L A;  4A3D J;  5J47 A;  4C30 A;  2FOK A;  4J00 A;  4OMY A;  3IRR A;  3H3U A;  3D5L A;  1MMA A;  2L01 A;  1Y0U A;  2QKM B;  2EZK A;  5KK1 A;  2NVT J;  3HOV J;  4BNC A;  3WTS C;  3OYF A;  3QU6 A;  2BY3 A;  3HOS A;  2ZXH A;  1SEU A;  1LVA A;  3CDL A;  4RDU A;  4EQQ A;  1R6R A;  2OTL I;  1W5S A;  4MHG A;  2KFD A;  2COB A;  3GFL A;  1XX5 A;  4HLY A;  1TWF J;  2OA4 A;  4CH7 A;  5BPD A;  1YIT I;  5EZG A;  3RTR A;  4BJT A;  5B1A H;  3P7N A;  1IXC A;  3G3Z A;  2O7O A;  2YUS A;  3KYC B;  2F48 A;  2VKH A;  3VYT B;  3RJP A;  3W2V A;  2M2E A;  2N8G A;  3KP2 A;  3CCE I;  4CO8 A;  1JKQ C;  2R7F A;  1IG7 A;  2QUF A;  3E6B A;  1VND A;  1ZRF A;  2CQN A;  2YSR A;  2B63 J;  3VYS B;  2RN7 A;  4A93 J;  1YG2 A;  3OV8 A;  3H9Q A;  3ABL H;  3ML6 A;  3JRA A;  5HDK A;  4RGS A;  4CUG A;  3LA3 A;  3FK6 A;  1WPK A;  2QQ9 A;  1B1B A;  4XN3 A;  2JMW A;  4B8X A;  2Q2E A;  4XRS A;  2LC2 A;  1U8R A;  4OAZ A;  1CF7 B;  3WE3 A;  4HST A;  2P6S A;  4BU2 A;  1ON2 A;  3DEE A;  4EGZ A;  2Y31 A;  2X85 A;  2EWN A;  3NEU A;  5A2Q Z;  2FEZ A;  4AYB A;  1QQI A;  4ZDL A;  3HHH A;  2IVM A;  2OUM A;  3LSP A;  4D7N A;  3J7A Y;  4ESF A;  4G12 A;  4Y15 A;  1W0U A;  2OU2 A;  2K7L A;  2XAJ A;  3I54 A;  2M5W A;  2E1C A;  2P5V A;  1A04 A;  1PYV A;  1JUS A;  3I58 A;  2Z2S B;  1FSE A;  1YYV A;  3S32 A;  3O3K A;  2XAQ A;  2X6O A;  5HNH A;  2BHY A;  2XF7 A;  2E1O A;  4WXC A;  2IRF G;  3K1N A;  3BG7 A;  4AYB N;  2OPT A;  4E7S A;  1JUP A;  1X3W B;  3GTO J;  4W1U A;  4CYD A;  1ETY A;  3F3X A;  5H6R A;  1Z21 A;  3CJN A;  5L3G A;  2XGC A;  2XAH A;  3TDZ C;  1A5J A;  1UHS A;  2ZC2 A;  1LEA A;  1TC3 C;  1U0J A;  3BJA A;  1YTY A;  1AU7 A;  5HDG A;  1Y1V J;  2K5C A;  1T39 A;  3EUK L;  1B8I B;  4A0Z A;  2NNN A;  5CLS A;  2JVH A;  1J9I A;  1DU0 A;  1MKM A;  3A2K A;  3F6V A;  2W7N A;  1LPQ A;  1G3S A;  2DFF A;  3K2Z A;  4B09 A;  1XC5 A;  5K5O A;  3O8H A;  4Y17 A;  3DF8 A;  2H8R A;  3HBL A;  4KMF A;  4HOB A;  4YFK F;  1LJ9 A;  4EM0 B;  3WG9 A;  3DV8 A;  3TOA A;  2G7U A;  4FX4 A;  1WI9 A;  4PDK A;  1ITY A;  3E5X A;  1ZQ3 P;  3C2G A;  2EIN H;  1BM9 A;  4QPQ A;  1ZK8 A;  3BG6 A;  2IXS A;  1D5V A;  1MMG A;  3COA C;  1MJ9 A;  3IH2 A;  2WTE A;  3B6A A;  5CYV A;  1VQ8 I;  1BL0 A;  3L2Q A;  2VBZ A;  5EEG A;  2KZV A;  2XKP A;  4B47 A;  4Z6Y A;  4M71 A;  4IZZ A;  4XNF A;  4WWC A;  2CMP A;  1D0Y A;  2GIV A;  3HHG A;  2XRL A;  1HKS A;  5J4V A;  4R79 A;  3E1S A;  3RQ4 A;  5B66 C;  5JVG F;  5M5Y J;  4AIK A;  2DO7 A;  3FWE A;  4BXU A;  1SFO J;  4E7L A;  3HSE A;  2PJR A;  3BTC A;  3SXY A;  3IV5 A;  4A3F J;  3I0T A;  2OCE A;  3AG3 H;  5JI6 A;  3K69 A;  4RB2 C;  1VTN C;  1GDT A;  1MBG A;  5IYB J;  2H1L A;  3MZ8 A;  3A03 A;  2KDZ A;  2Z33 A;  3OOU A;  1VQM I;  1GT0 C;  1LB2 A;  2L7F P;  4X0G A;  2QYO A;  4YFN F;  2X1E A;  3W2W A;  2DCE A;  3FXJ A;  1JJ8 C;  2GXA A;  5DV5 A;  1IF1 A;  2BGC A;  5GAD J;  1W36 C;  4HF2 A;  1VQ7 I;  2QA4 I;  1X19 A;  2FJ1 A;  4DYR A;  1LE8 A;  2DK8 A;  4IOC F;  1X3U A;  5KVR A;  3WTZ A;  2G7H A;  1POG A;  4P5O A;  3JSP A;  5K5Q A;  4AIH A;  1VQ6 I;  3JSO A;  1DPR A;  4CCM A;  3QOP A;  2XDV A;  4BHP A;  1SAU A;  2OQG A;  1KYW A;  5AIQ A;  3QPT A;  1GVJ A;  4ZTJ A;  1TZL A;  1I50 J;  1PP8 F;  1D3Y A;  3DXJ F;  2ZME B;  4OAY A;  3PNV A;  3CC2 I;  4AUX A;  3RYP A;  3CJQ B;  3CCQ I;  5EGO A;  3BT9 A;  2GXB A;  3FIW A;  3AAF A;  4CYC A;  4O5V A;  1K4T A;  1X4P A;  1MDM A;  1FBQ A;  4KJZ A;  2O8K A;  4RBO A;  2AHQ A;  3CUQ C;  3F8M A;  3BPX A;  1UHW A;  3AKZ A;  1SD6 A;  4A6E A;  4ENN A;  1Q1V A;  5F1J A;  2XB5 A;  2EA2 A;  1Z3Y A;  1KGS A;  5JR3 A;  4M6V A;  3ZQ7 A;  2NVX J;  2X1D A;  1R49 A;  4BE0 A;  3M7G A;  1BIB A;  3F22 A;  5J8F A;  3HYI A;  2LSO A;  2PX9 A;  3HC7 A;  3EUH A;  1UST A;  3VYR B;  2VPR A;  1OCO H;  1XG1 A;  4F7Z A;  2LF7 A;  1KON A;  1BR4 A;  2E1M C;  2FMY A;  4PK4 A;  2Y0S A;  1HKQ A;  1FJL A;  2AXL A;  1P6R A;  3KEO A;  3KP4 A;  3GZ6 A;  2FML A;  3DBR B;  5F08 A;  2CQX A;  1N25 A;  4IVN A;  5CQG A;  3C7J A;  5GTH C;  1D1C A;  3BLY A;  4OIQ F;  4IX7 A;  1Y56 A;  1Z6R A;  2DYR H;  2XPW A;  2STT A;  1ZG3 A;  2FE3 A;  2NYX A;  2JVG A;  4WCG A;  2H1K A;  4BAY A;  3CCU I;  3N05 A;  2R7V A;  1BR2 A;  2HOE A;  4RM3 A;  4HRI A;  2DFH A;  2PMH A;  2AO9 A;  3UNG C;  1DPU A;  3S2D J;  2Y0S N;  1B72 A;  5L3F A;  3LSM A;  4H4K C;  3UR3 C;  4PJL A;  2VAS A;  4HDV A;  2O6G E;  2R7Q A;  4MEY F;  5FKK A;  5KCM A;  4F91 B;  3OYK A;  1MSF C;  3AFH A;  2QSH X;  4LLL A;  2UV1 A;  1YRN B;  5JLX A;  2QBY A;  2QF7 A;  1OQY A;  2AQF A;  1UB9 A;  3A1Y A;  2R7U A;  1UHM A;  2V9K A;  2BZT A;  3H9J A;  2M9H A;  5FKO A;  5K7Z A;  4DQ2 A;  2G9W A;  2QEX I;  4BAC A;  3BOQ A;  5FRM A;  2L7Z A;  2W00 A;  4U7D A;  1T8I A;  2GIZ A;  2CV2 A;  3DQV C;  2CV0 A;  3ZMZ A;  5FLX K;  2ISY A;  3CMY A;  4X6A J;  1UFM A;  1LDD A;  5IYC J;  2HXI A;  3HOX J;  3K4K A;  1YFH A;  4OOI A;  4RS8 A;  3IHU A;  5J40 A;  3L1P A;  2R5Y B;  2D45 A;  2CW7 A;  2E1M B;  2LF8 A;  1TP4 A;  2R7T A;  1T0F C;  4YRV A;  3I64 A;  3GZ5 A;  2ID3 A;  3TL4 X;  5ED4 A;  1PJR A;  1DU6 A;  1IRF A;  1H88 C;  3HB9 A;  1TTY A;  1HXD A;  1RES A;  5FGM A;  4BY7 J;  3PIO F;  2JT1 A;  5DEQ A;  3IKV A;  2FU4 A;  4XOR A;  2H09 A;  1FEX A;  2IA2 A;  5DD8 A;  3E7L A;  2XPV A;  3DFG A;  2LBF B;  3PJR A;  3I4M J;  3KCC A;  3V7S A;  3BR0 A;  4FET A;  3QP5 A;  4UXN A;  1RC9 A;  3H1C A;  1ONV A;  4A12 A;  3KP5 A;  3QPH A;  4XOP A;  4EEF G;  3CP2 A;  1AKH B;  3M07 A;  4EAT A;  1YLF A;  2E2H J;  3WHB A;  5FFX A;  2ZXJ A;  3ZGK A;  2ZJP F;  5IPA A;  1FMW A;  1VQP I;  3F8F A;  1R4M B;  1MH4 A;  4O6J A;  2QCO A;  3CJT B;  2XAS A;  4KIG A;  3OWT A;  1RUN A;  2E34 A;  2WY7 Q;  3ROU A;  4KYW A;  1Z77 A;  2DA7 A;  2HI3 A;  3QWL A;  2LG4 A;  2V1U A;  1Z0X A;  3S2W A;  3J80 Z;  5FFZ A;  4BL0 B;  2F4O B;  5DUI A;  3ONQ A;  4II3 A;  3OYN A;  5DCM B;  1FNN A;  1TT5 B;  1JI8 A;  4GRI A;  4HNU A;  3MKY B;  3A0H C;  2R5Z A;  2EIJ H;  4KIB A;  4DOZ A;  1IGN A;  1LQ1 A;  3HSR A;  1BA5 A;  2K3F A;  1HQC A;  1KU9 A;  1PUF B;  3A01 B;  2MAB A;  2XHK A;  4L5E A;  5IOY A;  2ZO4 A;  1IRX A;  1XMX A;  1EH6 A;  1GHC A;  1W7P B;  3FX3 A;  2IGK A;  1VQ9 I;  4JYK A;  2RAE A;  1XS9 A;  1G3T A;  2KJC A;  5M5W J;  4UVC A;  4A3J J;  1X58 A;  2JRM A;  4F55 A;  3M1C A;  1TL8 A;  5M5X J;  3RPU D;  1ZR4 A;  2LKS A;  3KET A;  3CO6 C;  3Q0U A;  3G73 A;  1YQA A;  2B7E A;  2I5U A;  3BTI A;  2KIF A;  1W7P D;  1ZAR A;  4WXH A;  3CMA I;  1XSX A;  3BTL A;  3HRS A;  2CSO A;  3GFM A;  4BDZ A;  4NDL A;  4CGZ A;  1I3A A;  3VSK A;  3S3O A;  3G1O A;  2AXT C;  2DOD A;  2GZW A;  3EYY A;  1S7O A;  3IKT A;  4BEH B;  5HLG A;  2LYC A;  3OSG A;  2A3S A;  5EG0 B;  3ASN H;  2HQN A;  4XBF A;  3SZT A;  4GGG A;  1SVO A;  2XF6 A;  3E6M A;  2V1N A;  2HVR A;  3FBN B;  4KT6 A;  2V7F A;  5FKM A;  3OMY A;  2DYS H;  4LFU A;  3H0D A;  1JE8 A;  3NWT A;  3GYH X;  2LR8 A;  3HUG B;  3QPS A;  4LG0 A;  2TRT A;  2XF5 A;  1R00 A;  2RNG A;  4S05 A;  3CMM A;  2UZK A;  2XSD C;  2DLL A;  2DA3 A;  5C4X J;  3ZRG A;  4L0Y B;  3ECH A;  3R61 A;  4HW0 A;  4UUT A;  4AWX B;  2ACJ A;  3GF2 A;  3PO3 J;  3HDD A;  4A6D A;  4C3I J;  5FD5 A;  1RI7 A;  4JOM A;  2KIU A;  1IXS B;  2R3S A;  5ILV A;  3KZI C;  2KKO A;  2BW3 A;  2L3D A;  3VEP A;  4L0Z B;  1A6Q A;  2I8D A;  3CCV I;  2JTV A;  4F93 B;  5LRS A;  2ZNZ A;  3WTW C;  1PUE E;  3PFI A;  2JPC A;  3TGN A;  5TIS C;  5K7H A;  1IRG A;  1K83 J;  1YX3 A;  3BQZ A;  1X4O A;  3RYR A;  2D1V A;  3CDI A;  3U1D A;  1QHH D;  4ZZL A;  2CW0 F;  2L9V A;  2XSJ C;  4KA4 A;  4CA0 A;  3CCJ I;  5FLV A;  2A69 F;  3PM1 A;  2EZI A;  4DBQ A;  2M30 A;  1QZE A;  4HEA 2;  5CVV A;  2LKX A;  3KX2 A;  2Z5U A;  1SMY F;  3FM5 A;  3KYL A;  4BJ6 C;  3OYC A;  3OL4 A;  1LEB A;  3Q5F A;  2J5O A;  3DEW A;  2YS9 A;  2ICW G;  1BOA A;  2DMP A;  1VQO I;  2YX4 A;  2KRH A;  2LKP A;  3V8K A;  4F3Q A;  4BBS J;  1QVU A;  2VL8 A;  4M6Y A;  2RRE A;  2D1H A;  3WTY C;  3S93 A;  3GTL J;  3H36 A;  1OYI A;  1OYW A;  1NK3 P;  1PDN C;  2EK5 A;  4EJW A;  2EB7 A;  4XKV A;  2HFH A;  4CCK A;  1ULY A;  4MNU A;  2HNH A;  4CHU A;  4AVZ A;  4N4N B;  5TGT A;  3O6B B;  3T1B A;  3OYM A;  1AHD P;  3ZQL A;  2CUF A;  5KNL A;  3J7Y J;  3E97 A;  1EF4 A;  2HYG D;  4RAZ A;  3PUF A;  1QVT A;  3SHF A;  1KU2 A;  4LLG F;  1I5Z A;  4XLA A;  1IRZ A;  3TO7 A;  5B3S H;  1QBJ A;  4DIQ A;  4HNT A;  5LRR A;  2RC4 A;  4ZTF A;  3C2B A;  4A2U A;  4HDU A;  4D0P A;  2VQL A;  5F64 A;  2LY1 A;  5GP9 A;  2DOA A;  3CF5 F;  1WJC A;  3WGG A;  4Q4Z F;  1P4W A;  3DP7 A;  2PG4 A;  2UWM A;  1FY7 A;  3F21 A;  4CZZ A;  1SFU A;  3BPV A;  4XR6 A;  4XIC A;  5EF6 A;  1E3H A;  1RPW A;  2WAQ A;  4ITV A;  4EM2 A;  4LB6 B;  3BY6 A;  2DA4 A;  4C3H J;  1XD7 A;  3RKX A;  2VKV A;  5BMZ A;  2LDU A;  3CZ6 A;  3IL2 A;  1G3W A;  1MZB A;  1P4A A;  2F5F A;  1A36 A;  2X9D A;  2JA7 J;  1JTY A;  1BOB A;  1KQ8 A;  5A2Q K;  3WTX C;  2K9N A;  3TP3 A;  1WQ2 A;  2EJR A;  1SFX A;  2JRT A;  3F0C A;  3W6J B;  4ZYA A;  3E3V A;  2CFX A;  3OYH A;  4A3I J;  1FYM A;  3ESW B;  3BR2 A;  2WAQ N;  3FXL A;  1YHQ I;  1LFP A;  3G6E I;  4IHT A;  3HPH A;  2IA1 A;  2A6H F;  5EYR A;  1T56 A;  3JAM Z;  3SEQ A;  1R22 A;  1ZHF A;  4C3J J;  5E1W A;  3H3V K;  5GPC A;  2ZJQ F;  1W1W E;  3NRV A;  2NS0 A;  2CO5 A;  3G1L A;  3LL7 A;  4GXO A;  4KFC A;  4BKX A;  2I10 A;  4UY8 I;  3IAS 2;  5GPA A;  1FLI A;  4FCY A;  2FXA A;  2MC4 A;  4QWQ A;  2DT6 A;  3AL0 B;  3E5U A;  3JCU C;  2E19 A;  2K02 A;  4G6D A;  2V4J C;  5DCF A;  2VJ5 A;  3ULQ B;  4UUS B;  2ZJR F;  2X1C A;  1F5T A;  3PNT A;  3OYA A;  4L5I A;  2ME0 A;  2QZ8 A;  3HZJ A;  3K4J A;  4BY1 J;  5GTI C;  1HDD C;  3KZY A;  5FKL A;  2DMU A;  2ID6 A;  1G2H A;  3H0G J;  1S6L A;  3I59 B;  1AA7 A;  3LST A;  4RGX A;  5E3O A;  1QRY A;  3TED A;  4UUV A;  4UV9 A;  3ZQF A;  2XIG A;  1R9T J;  4MFD A;  1Z05 A;  2O61 A;  3K10 A;  1A35 A;  4LB5 A;  2UXX A;  3GTG J;  4G7Z F;  1QO0 D;  1UCR A;  4P96 A;  1U8B A;  1GXQ A;  4ZZD A;  1K4S A;  4PGH A;  3FF5 A;  5LLQ A;  3E5Q A;  1WFX A;  2FA5 A;  4F92 B;  4OU0 A;  1R36 A;  3PO2 J;  4E7K A;  1U5T A;  3NAU A;  1GVD A;  3K2A A;  4JX4 A;  2DN0 A;  1ZH5 A;  3JRH A;  4UNO A;  4RB1 A;  2RV8 A;  4FX0 A;  1ZG5 A;  2JZY A;  2L02 A;  5ILU A;  4MLO A;  4PUS A;  1L3L A;  4QPO A;  1UMQ A;  2DQL A;  2VOO A;  4JQF A;  4EJO A;  5BOX A;  2NVU B;  2HOT A;  1FX7 A;  2EPF A;  4P1W A;  3E0J B;  3RKW A;  5BQT A;  3WGI A;  3F23 A;  2A61 A;  2QM3 A;  3H5N A;  1U2W A;  3EUH C;  3MCZ A;  5KAF C;  4GO1 A;  4JBA A;  3U21 A;  3ABK H;  4HV6 A;  1TW2 A;  1FOY A;  3BJ6 A;  4W97 A;  2BXY A;  2QQ8 A;  5EJC A;  5AIP A;  3OYB A;  3S1R J;  1WZ2 A;  3S16 J;  2OCC H;  1W5C C;  1HST A;  2ZXI A;  1HLV A;  2ZNY A;  4XM3 A;  5LGN A;  1RKW A;  1Y0N A;  2A6E F;  4LD5 A;  3DBH B;  2XRO A;  1JT6 A;  1SVM A;  1J59 A;  5CQE A;  4HQE A;  2DBB A;  4A3K J;  3JTG A;  1ETO A;  2L4M A;  3M8F A;  2MD5 A;  4IF4 A;  1X3Z B;  3BCB A;  1FTT A;  2MG4 A;  1X1D A;  2VUM J;  2F5V A;  1BN5 A;  3QYB A;  4XL9 A;  4B44 A;  5D5V B;  4HZF A;  3BG5 A;  4HG2 A;  1ZLJ A;  3TO9 A;  4BQA A;  3I9V 2;  2NOJ B;  3TBI A;  3HSF A;  2P6T A;  1E0E A;  3BP8 A;  4HX8 A;  4V2G A;  4CCN A;  5LBQ A;  2CUJ A;  2L7K A;  5E18 F;  2LD5 A;  1G3Y A;  1G8X A;  2K4J A;  1OLT A;  1P92 A;  2ZXW H;  2F6C A;  1UAA A;  2DK5 A;  1ETV A;  4I76 A;  1LKX A;  1MH3 A;  2HOS A;  1JKO C;  2EA4 A;  3LAJ A;  2WV0 A;  4MIM A;  4Y7N J;  2ZFU A;  3S15 J;  4P9U A;  1TWH J;  2ZCW A;  4HX4 A;  1I1G A;  1MBJ A;  2VQH A;  3S3N A;  1HCR A;  4CSW A;  3G2B A;  2W25 A;  3LQR A;  3NAR A;  3RKQ A;  2KZG A;  1H0M A;  2CQK A;  5HOO A;  1QZY A;  5D4S A;  2E2I J;  1BW5 A;  3K1M A;  4I98 B;  4RA2 A;  3S3M A;  1MBF A;  3H9G A;  4UHT A;  3K4B A;  3SFI A;  2GLO A;  1LFB A;  4XK4 A;  5E17 F;  3HG9 A;  3IP4 B;  3WU2 C;  1V4R A;  4RAY A;  2CGP A;  3PSI A;  1BC7 C;  4NC6 A;  5IP9 J;  5DS9 A;  1MMD A;  2VC1 A;  3CTA A;  4OMZ A;  2HTS A;  3Q3S A;  2X6Y A;  3GVA A;  4CCL A;  1ERD A;  4BQO A;  5CVI A;  4ANJ A;  2DOF A;  1AOY A;  2XC7 A;  1VF9 A;  1X2N A;  2DJN A;  4YG2 F;  4NNJ A;  3RI4 A;  3KP6 A;  2FSW A;  2VN2 A;  1B72 B;  3H3Z A;  1VQL I;  4DYQ A;  2NS8 A;  5IYD J;  4JP0 A;  4BDY A;  2L54 A;  4DZJ A;  2HKO A;  1VQ4 I;  2LP0 A;  5BPI A;  4ENM A;  3PFY A;  2L7M P;  1AWC A;  5GAH J;  3OYD A;  3LQQ A;  1B9M A;  1HSJ A;  2FF4 A;  1CQT A;  4E4H A;  3MKW B;  3WTU C;  1RIO H;  1CF7 A;  2Y69 H;  4C2U A;  1R7J A;  4Y33 A;  1O3T A;  5HLH A;  3L2U A;  4D9J A;  3QRF F;  5LHG A;  3Q0V A;  5K7F A;  5JVT A;  2IS4 A;  3ZMT A;  1E3P A;  5DD4 A;  3C1D A;  2Y9Z A;  1XB4 A;  1ZEL A;  1Z7U A;  4LIU A;  2OF7 A;  2V26 A;  2V1X A;  1IAW A;  2K27 A;  2OJE D;  4LLN A;  2CG4 A;  3NWS A;  3V7C A;  1OCP A;  3M8J A;  2VBW A;  4NQW B;  2HVS A;  2F4M B;  1VZ0 A;  4XKB A;  1B59 A;  3W2A A;  2HOA A;  1BC8 C;  3U1K A;  2BEO A;  2MGQ A;  2X6W A;  1FP1 D;  1EV7 A;  3QOE A;  4DBR A;  1BR1 A;  4I6Z A;  1MND A;  2BOL A;  1PVE A;  3QOD A;  2X51 A;  1I3Q J;  2ELJ A;  2PN6 A;  2VJI A;  3WGH A;  2X48 A;  1E2X A;  2DMT A;  3LA7 A;  4HBL A;  5FO5 A;  4RMN A;  1B8I A;  4GYG A;  2C6Y A;  1VQK I;  3O2P E;  1O3R A;  3W6V A;  4Z2Y A;  2WC2 A;  2WB1 A;  4BQQ A;  2VQC A;  3U2R A;  1FZP B;  3HTU A;  3W6K B;  3HGY A;  1Z67 A;  2HGC A;  5E8G A;  3T8R A;  4KMU X;  3J80 K;  2JK3 A;  1ZAO A;  2MW8 A;  4EJT A;  4GDF A;  1WGX A;  1IN6 A;  2DDA A;  1IDY A;  3A0B C;  2XUB A;  2YR2 A;  1DGR M;  1YO5 C;  2VON A;  1NTC A;  3LSR A;  4E7Z A;  1JHH A;  3S2H J;  2DFI A;  1F4K A;  2WAF A;  4G8X A;  1K61 A;  3D5R C;  2LNB A;  1F9N A;  1K79 A;  1W36 D;  1O3S A;  2R4G A;  3BG3 A;  4ON0 A;  2AS5 F;  2R5Z B;  2DT5 A;  2WB1 N;  1X1B A;  3WHC A;  1ETQ A;  1UG2 A;  2NAZ A;  2DMN A;  3FHZ A;  3ZN0 A;  1FOX A;  4DNC A;  3AG4 H;  3HOU J;  1SC7 A;  3CUQ B;  1KQ9 A;  1S5L C;  2GBY A;  2LH9 A;  2DPU A;  2DTR A;  3WOD F;  4R8H A;  4BHC A;  2XGD A;  4MO7 A;  1UZC A;  1QGP A;  4IKF A;  4YFX F;  5D8K B;  2VT3 A;  4V19 K;  3TQN A;  2IS2 A;  2DU9 A;  2ZBK A;  2KP6 A;  3B73 A;  5HLI A;  4MEX F;  2VQG A;  4I02 A;  2KDO A;  4PSW A;  1OYY A;  1TNT A;  2IGO A;  5LD2 C;  1XN7 A;  1N77 A;  2QGU A;  1NH3 A;  1ZGJ A;  2DTZ A;  2IS1 A;  1JGG A;  1U6G A;  3D5S C;  2LRD A;  1XMA A;  2DA5 A;  3IH3 A;  3KZZ A;  4XKW A;  1YS6 A;  3C2H A;  4A0X A;  1GXP A;  1MNM C;  3OS2 A;  2CW8 A;  4CIC A;  3MZH A;  3A4C A;  3K70 C;  2LOO A;  4FT8 A;  1SVL A;  3TO6 A;  4XRF A;  3J7A O;  2XAU A;  4OWR B;  3R4K A;  3CCM I;  1IV6 A;  1D0X A;  1P2F A;  3RPQ A;  3KP3 A;  3ZXS A;  3H92 A;  3GLL A;  4M9Z A;  4LG0 B;  2JQ7 A;  2IPQ X;  4AIJ A;  4M72 A;  2VE9 A;  2QQA A;  1HW5 A;  3PIP F;  1ZG1 A;  4Q47 A;  4XN0 A;  3MKZ A;  2M4G A;  3D1N I;  3SDG A;  3FIS A;  5HLT A;  1HC8 A;  5ICE A;  1MGT A;  2VJJ A;  3EDP A;  3QYE A;  2GAU A;  2IS6 A;  3CQZ J;  3K0L A;  1I6H J;  1XTA A;  1ZR2 A;  1JT0 A;  1FIP A;  1ZRE A;  2MH9 A;  3GZN B;  2A07 F;  4L9N A;  1LNW A;  3FK7 A;  2EV0 A;  5D6F A;  1W4M A;  3GTK J;  1ZRC A;  3FXU A;  2M0M A;  2XAG A;  2ZFW A;  1FOW A;  5E20 A;  1T98 A;  1OCC H;  3A02 A;  3SFZ A;  5DTD A;  3IH4 A;  5GAE J;  3OS0 A;  4MTD A;  3WU1 B;  4IO9 F;  4XLN F;  3RIR A;  3H5R A;  2NS7 A;  4BXF A;  1S29 A;  3CJR B;  3R0J A;  2M7B A;  3QU3 A;  1V3F A;  4A5M A;  4BE1 A;  4PGG A;  2A5Y B;  5J1R A;  1MBH A;  1B6A A;  4IHV A;  5HDN A;  3OSF A;  4E6K G;  1MIJ A;  4ENJ A;  4BUP A;  3BWG A;  2YPR A;  2WA0 A;  4L9T A;  4ESB A;  2HZD A;  2YU9 J;  5BS6 A;  3K4N A;  4KIT B;  3GTJ J;  1IZ1 A;  3R60 A;  5DM7 F;  3HOY J;  4IEJ A;  3TW7 A;  1Y8Q B;  4PSX A;  4UVB A;  4B3A A;  2M1B A;  1OMI A;  4U88 A;  5K5R A;  3OS1 A;  1G4D A;  2VKD A;  5F0H A;  1IN8 A;  4HA8 A;  4BE2 A;  3ZQG A;  4EJU A;  4OIR F;  1YRN A;  2X6X A;  2XGX A;  3SDB A;  2RKH A;  4B43 A;  1H9T A;  4ETS A;  1T08 B;  4A3G J;  4E7J A;  4PJ0 C;  1TQI A;  2M8G X;  2E7X A;  4L5J A;  1FOK A;  1ZKG A;  2BXZ A;  1ZTR A;  1BBY A;  1F43 A;  1YW8 A;  2EBI A;  4M9X A;  3TP0 A;  1S7A A;  2VE8 A;  1RNL A;  2DOE A;  1QA6 A;  2Z3Y A;  3X2Q H;  1Z3X A;  4CCJ A;  3HL2 A;  2R5Y A;  1HF0 A;  3DBL B;  4CCO A;  2P8T A;  1Y8R B;  4WK8 F;  3M3Y J;  1S3J A;  1FIA A;  1ZLK A;  2JN6 A;  3FDY A;  3KEY A;  3CC7 I;  3MMY B;  2GQQ A;  2E35 A;  1VI0 A;  2JSP A;  3AG1 H;  4GYI A;  4GCV A;  1NHA A;  4V2F A;  5HS7 A;  1D0Z A;  2M8E A;  3VDX A;  3V4G A;  3VPR A;  1JJ6 C;  1BI3 A;  4G9Y A;  4U7B A;  3CCL I;  5F0C A;  4G7O F;  2L9N A;  1ENH A;  5M3F J;  1O57 A;  4IL6 C;  3FXO A;  5KHD A;  4XID A;  5CVR A;  2JPB A;  4Q5S F;  3GW2 A;  2CRG A;  1HW2 A;  1FSH A;  1F36 A;  2HVQ A;  1Z1D A;  3S8P A;  1R23 A;  1U5T C;  3P9K A;  3F8B A;  1J5Y A;  1ACI A;  4LIT A;  3CC4 I;  5JLW A;  2OZ6 A;  3L2C A;  3KFW X;  3JAM K;  3KLN A;  1USS A;  3UKG A;  3HXL A;  3OYL A;  1Y39 A;  1NG6 A;  4LGW A;  2WWY A;  2NVY J;  5E8I A;  2H27 A;  2JA8 J;  2PLY A;  1FPQ A;  2KQR A;  3TW6 A;  3BZC A;  4LK1 F;  1T38 A;  1WHU A;  4AM3 A;  3DU5 A;  4IHY A;  1KA8 A;  4G6T B;  3SZG A;  3FXM A;  2XAF A;  4BJ5 C;  5FLM J;  4S04 A;  5D5W B;  5DCM A;  4IOA F;  3MN2 A;  1K6O A;  3DTK A;  4HSR A;  3CES A;  1K78 B;  3GME A;  2LK2 A;  4EM1 A;  5LHH A;  2GM4 A;  2R7R A;  5HVQ C;  1D8J A;  4WX9 A;  1HW1 A;  2LFB A;  2VB6 A;  3S1N J;  2BHZ A;  1PUF A;  3PNY A;  2GXG A;  3A01 A;  2DXI A;  2HKX A;  3P5J A;  3TDU C;  5IOZ A;  5CVJ A;  5D6E A;  1B9N A;  3HM5 A;  2EIK H;  1W7P A;  2VJ4 A;  5HNF A;  1T6S A;  2VC0 A;  2IA0 A;  1U3E M;  2FNA A;  4HLX A;  3OYI A;  2GA2 A;  1HBX G;  2L5Q A;  2UUZ A;  3MKL A;  2JUC A;  5E79 C;  3FKI J;  3U9G A;  4ZDO A;  4EMS A;  1YS7 A;  5TJJ A;  4FE4 A;  4XLH A;  2D2W A;  4HV5 A;  2K4B A;  4ABZ A;  1E3O C;  4F52 A;  2Y75 A;  3HRM A;  2ECB A;  4XSX F;  4RB3 C;  4NB5 A;  2L2O A;  3DU6 A;  3M1E A;  1CGP A;  1R4N B;  2P0W A;  2XGE A;  1T33 A;  4LK0 F;  1TLH B;  2EFW A;  2MYS A;  1IC8 A;  3OR1 C;  1QNT A;  4PZJ A;  1F1Z A;  1ON1 A;  3CP8 A;  2R0Q C;  2YU3 A;  1KU3 A;  1IN7 A;  1S7E A;  2L9S A;  2LLK A;  2VI6 A;  4UB8 C;  4IHW A;  1XMK A;  3BZ6 A;  3K4C A;  2JA2 A;  3ZPL A;  5L3C A;  1JGS A;  5CVU A;  2V6C A;  5H6Q A;  3BQY A;  4KIC A;  5EG0 A;  2Q2E B;  3GUD A;  4U0W A;  5ILS A;  2LTP A;  1EJ9 A;  5ICF A;  2ISZ A;  3HRT A;  3GWZ A;  2X0L A;  2EQR A;  2GOM A;  5IP7 J;  5E3N A;  2ETH A;  2STW A;  4GFB A;  4G6Q A;  4LOC A;  1FBS A;  1GUU A;  1GV2 A;  3DTI A;  1P7I A;  3S17 J;  2P7V B;  2V79 A;  4H0E A;  4M3B A;  2ME6 A;  3RSN A;  1JKR C;  1OCT C;  1YW7 A;  2RQP A;  3KPH A;  2XKO A;  3ZQQ A;  4B48 A;  1H8A C;  2ZB9 A;  1R5G A;  2LVS A;  2D5V A;  2Y0M A;  2FQ3 A;  1Y1W J;  3IWZ A;  1WH7 A;  3DPT A;  3QYF A;  2P4W A;  2ESH A;  2DJI A;  2PI0 A;  1HDP A;  2R7D A;  2KIQ A;  5F27 A;  1R5H A;  2QQB A;  3K6G A;  1FTZ A;  1BJA A;  3L9F A;  5H20 A;  4P9F A;  4B3X A;  1TQM A;  1PP7 U;  2PMZ A;  2ADU A;  1Y6I A;  1E17 A;  2IGN A;  3LWF A;  3V8L A;  2QLZ A;  3I4N J;  1Z9C A;  3IWF A;  2VLA A;  3RQI A;  4MFE A;  3BR1 A;  3DKY A;  2KMU A;  2O3F A;  2Y9Y A;  4N9H A;  1HKT A;  4ZYH A;  2MBF A;  3RCO A;  3K7A J;  5L3D A;  1D5Y A;  3G71 I;  3LFK A;  2FUG 2;  4Y4R A;  1WH5 A;  1JUM A;  1LVK A;  3N97 A;  2CV1 A;  5CJ9 A;  4C9Y A;  3JRE A;  3GLX A;  1IN5 A;  4ZYD A;  1EH7 A;  5LHI A;  2CH0 A;  4D1Q A;  1TWC J;  3LAP A;  2PMZ N;  3E6D A;  2RNJ A;  1WJE A;  1YJW I;  2VPL A;  1L0O C;  1OR7 C;  3V8J A;  4KN4 X;  4C2M J;  5C3E J;  1FYK A;  4OIP F;  4M73 A;  3LSI A;  1REP C;  1UJ8 A;  2BBY A;  3VB2 A;  1RET A;  2L9R A;  2BYV E;  1O7F A;  2P5K A;  3V42 A;  2DI3 A;  1JXS A;  1RR7 A;  1MBE A;  2EIL H;  2IP2 A;  5LEK A;  3BCA A;  3HGG A;  3GTP J;  1G6N A;  2VT2 A;  1LFU P;  2IT0 A;  2PJR B;  2CUZ A;  2K9M A;  1Q1H A;  2W24 A;  3JRC A;  2XPU A;  2NVQ J;  4XMY A;  4ZH4 F;  1J7K A;  2V1D A;  2Q8K A;  4JK1 X;  4IQJ A;  1TBX A;  1JHF A;  2JJ7 A;  1X1P A;  2H6B A;  3H35 A;  3PSF A;  3FXR A;  1NG7 A;  5L3E A;  2EZH A;  5AON A;  4U87 A;  4FQG A;  4BS9 A;  5FD6 A;  3M4O J;  2ESN A;  2EV5 A;  2IJL A;  1BI0 A;  3FKJ A;  3S1Q J;  1VQ5 I;  3CD6 I;  2R7X A;  1LE8 B;  2OV7 A;  5E3M A;  3EYI A;  3ZQI A;  1V5G A;  1WVR A;  3SEZ A;  1SD5 A;  1YI2 I;  2P5L C;  2CQ7 A;  2HTJ A;  5HS9 A;  2KRC A;  3ECO A;  4HF0 A;  2ELK A;  1FT9 A;  1LDJ A;  2HZT A;  3K4L A;  4KUM A;  4PCQ A;  3KEQ A;  1XDU A;  4L18 B;  4CXF A;  2BVL A;  4IQ4 A;  5J1Y A;  3FBI B;  2UXN A;  1ORK A;  3D0S A;  2V9V A;  4M9S A;  5HS8 A;  5EGO B;  3ZMU A;  2W57 A;  5H2F C;  1ZGW A;  2WV1 A;  3DKW A;  3Q0W A;  1HA8 A;  5DM6 F;  4CYC B;  1IV8 A;  3MD2 A;  4KNY A;  1MDM B;  2MC3 A;  1K6Y A;  3GX4 X;  5J1U A;  2KPM A;  1BJZ A;  3JRD A;  4R1H A;  5D5X B;  4IRG A;  2CU7 A;  2OAZ A;  3QPL A;  2M87 A;  1FMV A;  3BR3 A;  4N4O B;  1STZ A;  3LSH A;  3E6C C;  3P9I A;  4UUS A;  2F5D A;  3FXQ A;  3OIP A;  3T5X A;  1O3Q A;  3CO7 C;  1EH8 A;  3WTV C;  2FNP A;  2QSF X;  3HOZ J;  6PAX A;  4XSZ F;  1YE9 A;  3BR5 A;  4QIW N;  1OJL A;  3FMS A;  2BE5 F;  3FXK A;  2EFO A;  5F04 A;  3RDI A;  3HIF A;  1S8N A;  3OIO A;  3I59 A;  3S1M J;  1X2M A;  3LFU A;  2M4K A;  4O3M A;  2KLO A;  2F5E A;  4L9V A;  3GFJ A;  2NOG A;  3VSL A;  2IEK A;  4EV0 A;  9ANT A;  4NBQ A;  3CME I;  5JFR A;  2ZME C;  4M74 A;  2NRA C;  2W48 A;  4TV7 A;  4E7H A;  3MFK A;  4N0B A;  3C3W A;  3IAM 2;  4UV8 A;  2Y30 A;  3I55 I;  2IGM A;  3HJE A;  3PQK A;  2DQR A;  2A68 F;  1V5E A;  3DPU A;  4ESJ A;  2FOW A;  1A6I A;  4OIN F;  5FKN A;  2Y48 A;  5J8C A;  1FP2 A;  3ZP5 A;  3BJO A;  4NC7 A;  1BIA A;  2MLK A;  1WWX A;  3LOC A;  2E5N A;  1D8K A;  2L4A A;  4MTE A;  1RRJ A;  2PQ8 A;  2R7Z J;  2QBY B;  2XB0 X;  3OYE A;  4YEJ A;  4BQN A;  3R0A A;  3C18 A;  4QSH A;  2R92 J;  4RB0 A;  4Y13 A;  5LFA A;  2FX0 A;  3OIQ A;  1KQ0 A;  3P9C A;  3J81 K;  4E7I A;  4LJZ F;  5J3L A;  5D4R A;  1TQP A;  3QP6 A;  4ZC3 A;  3DWL E;  2WBM A;  2DPD A;  1EKE A;  3GEZ A;  2O8X A;  2Y2Z A;  2KJB A;  2Q0O A;  2IBD A;  1SD7 A;  3WU0 A;  1OR7 A;  1X1A A;  3MWM A;  4RLQ A;  2NNY A;  3HPG A;  2P7C B;  3QAH A;  3G4S I;  2AQE A;  2HXO A;  2HEO A;  3I4P A;  4KIF A;  2VXZ A;  2LY2 A;  3IRQ A;  3GTQ J;  3J7Z I;  1KZH A;  1GLN A;  2NXN B;  3WG7 H;  4BYY A;  1TW3 A;  4U0V A;  2JSC A;  3ABU A;  3BRO A;  3PQJ A;  1WJB A;  1MD0 A;  1BW6 A;  1P7J A;  5IY5 H;  4N9I A;  5IT9 K;  1ZRD A;  4ZJZ A;  3BZK A;  2ECC A;  1B4A A;  3F9K A;  3K4M A;  3T8T A;  4KIS A;  1HOM A;  4CDG A;  4XKC A;  2BVM A;  2F2E A;  3DKX A;  4A3M J;  4FIS A;  3EQL F;  1UG0 A;  2HYF A;  5EEH A;  4IHX A;  2ZKZ A;  3ASO H;  4JX5 A;  3I71 A;  1XPX A;  1N75 A;  3I5U A;  4IJA A;  1YX5 A;  5KAI C;  1WJD A;  2B9S A;  1MBK A;  2E36 A;  4I09 A;  3KIO A;  4WXD A;  2E2J J;  1IW7 F;  4Q48 A;  4XRM A;  1YOV B;  4I0A A;  2E5Z A;  3REO A;  1DP7 P;  2E7W A;  2HS5 A;  3BR6 A;  1OCR H;  1OKR A;  3TKY A;  5EDN A;  5LGU A;  2HYJ A;  1WI3 A;  1T2K A;  4B4C A;  2J5P A;  3MVP A;  3SQN A;  3R6S A;  2G0E A;  4HAM A;  4X1E A;  3CUO A;  3CLQ A;  4HYE A;  4YEL A;  2DA2 A;  4PJN A;  4DZP A;  4C2T A;  1D1B A;  1YIO A;  4D7M A;  3B02 A;  4B1R A;  2GWR A;  4Y52 J;  1J75 A;  2FD5 A;  1ZN2 A;  4UVA A;  3BG9 A;  5J6X A;  2W82 A;  3KLO A;  4DGW B;  1DQU A;  3EPZ A;  3TOB A;  1R5I D;  4EGY A;  2CQQ A;  4ZYG A;  2EFP A;  5ERI A;  2HPM A;  3IC7 A;  3OL3 A;  3JRI A;  2GOX B;  2CYY A;  2PJP A;  3SYT A;  1W5T A;  3JR9 A;  1JKP C;  2DAO A;  1KYZ A;  3ZQC A;  2P81 A;  3FHN A;  3J81 Z;  4MGR A;  5JHF A;  1ZYR F;  1IDZ A;  3ABM H;  4RGR A;  1TNS A;  4A5N A;  3ZN1 A;  5CKT A;  1SAX A;  1XCV A;  2E1N A;  3DTE A;  3FZV A;  5FRO A;  1WRJ A;  2VIX A;  1OFC X;  4FHT A;  4XRS G;  4KN7 X;  4S0H B;  1APL C;  1ODD A;  3LSK A;  1RUO A;  4LIV A;  3DLA A;  2HU9 A;  2CFO A;  1XGS A;  5EZH A;  2RDP A;  1X1C A;  2BV6 A;  1V55 H;  4LG3 A;  3HOW J;  4BXX J;  2ZME A;  3M8E A;  4RM2 A;  2W4S A;  2EFN A;  1R1U A;  5E3L A;  2LMD A;  3BDD A;  1N78 A;  5IT9 Z;  3F72 A;  5JHU A;  3JRG A;  1XDS A;  3I3L A;  1OIS A;  4E70 A;  1V5F A;  3MAJ A;  3LNQ A;  2VBX A;  4IRI A;  4NQW A;  1U9N A;  1KU7 A;  1SAN A;  1IN4 A;  2ZSI B;  3DLL F;  1LDK B;  4PFP A;  1FBU A;  2R7W A;  3MQ0 A;  2KRF A;  2IW5 A;  3OR2 C;  2EIM H;  1IUF A;  2A05 A;  3H5A A;  4YIF A;  3L2V A;  3JRF A;  1IO2 A;  4QLC U;  1VFC A;  2KIM A;  2PBI A;  1R71 A;  3RKY A;  5GAG J;  2BW3 B;  5F1R A;  1O4X A;  2R93 J;  1J0R A;  4YII A;  2VBY A;  3HEF A;  3GTM J;  1O7L A;  2YX7 A;  4RGU A;  4IPA A;  3WE2 A;  4AD9 A;  4ZDP A;  4G7H F;  1A31 A;  1G59 A;  3V7R A;  2W84 A;  4Y3O A;  4NUB A;  5C44 J;  3JTH A;  4A69 C;  1R58 A;  2BY1 A;  4QTR A;  1MMS A;  3WTT C;  4RLF A;  1QU3 A;  4CZC A;  2EFQ A;  2VOP A;  3DPL C;  2FBH A;  3JRB A;  2MH2 A;  1FYL A;  3K9T A;  3ERM A;  2JA5 J;  1WJA A;  5M3M J;  3I53 A;  3GCM A;  2F4I A;  4YIR X;  2Z1D A;  1YIJ I;  1WSU A;  3CDH A;  1M1E B;  1QHG A;  2HQR A;  5L3B A;  3N4M A;  3HKZ A;  1RR8 C;  2QWW A;  3QQA A;  5F6F A;  1SD4 A;  1Z6T A;  4G94 A;  1QPM A;  1DGW Y;  3PUB A;  4BH9 A;  2CUE A;  4KDP A;  1MMN A;  2RQQ A;  3F8C A;  4A3L J;  2PEX A;  3FMQ A;  4L9J A;  4K2E A;  1WJF A;  4ENK A;  4M3G A;  2IAI A;  2EV6 A;  1MSE C;  1BI1 A;  4FTH A;  2DT7 B;  1YW9 A;  4I0B A;  3OYJ A;  4KT5 C;  3CUQ A;  5FJ8 J;  2X4H A;  3LA2 A;  1C0W A;  3BC8 A;  3I56 I;  4P55 A;  2QKL B;  1S9H A;  2VXD A;  4FAS D;  2H8W A;  2WAE A;  3K70 D;  3G1M A;  2JWT A;  3ZMS A;  4XLP F;  2KIS A;  3HKZ N;  1T95 A;  5DDG A;  4D5F A;  5LGT A;  2L0K A;  2DFE A;  4AU7 A;  2QSG X;  1R1V A;  4JX6 A;  3ELK A;  1XGO A;  1ZGA A;  2F5C A;  3FMR A;  1DDN A;  2O5R A;  4XQF A;  1J09 A;  2XRN A;  2W85 A;  5FLX Z;  5B5E C;  1EA3 A;  1JTX A;  3TMO A;  4I2O A;  2DW4 A;  2WY8 Q;  4HX7 A;  2DMQ A;  1MNE A;  3CF2 A;  1W0T A;  3KP7 A;  2HDW A;  3K1P A;  3KYD B;  5C4J J;  2OC6 A;  2TDX A;  4EVI A;  4A3E J;  2FQ4 A;  1TWA J;  5ICC A;  1GV5 A;  4M3F A;  4ZYE A;  2EZL A;  4A3B J;  2HPI A;  2XVC A;  3JW4 A;  5K1Y A;  2MFZ A;  3B6C A;  1SFE A;  2DA6 A;  2Z16 A;  2LBF A;  1VQN I;  3M9A A;  2BY0 A;  4U0Y A;  1IUY A;  2KL4 A;  3ZR8 X;  2R7O A;  5B1B H;  4HQM A;  4PJJ A;  3NQO A;  4FE7 A;  2V9P A;  1S72 I;  3VWB A;  3ISP A;  1OCZ H;  3LMM A;  1AKH A;  2K9L A;  3LSJ A;  3T0Y A;  2M3A A;  3OYG A;  2VKE A;  1RKT A;  1BI2 A;  3BTJ A;  5E1X A;  1XSD A;  1XSV A;  1FWZ A;  3AG2 H;  1H9G A;  5F0F A;  2OBP A;  3RZD J;  3W3C A;  3OY9 A;  3Q9S A;  3DEU A;  3HOT A;  5TRD A;  2BY2 A;  3F8N A;  4MQV A;  1IJW C;  1I1S A;  4M3D A;  3GO5 A;  4AVP A;  5DYM A;  4HNV A;  1P4X A;  4NC8 A;  2A6T A;  5CPR B;  1WJ5 A;  3RPU A;  4BBR J;  1T0F A;  4OIO F;  1I39 A;  2M0C A;  4D5C A;  2JUG A;  1YJ9 I;  1ETK A;  5IT3 A;  1UEL B;  4J19 A;  4RAG A;  2K9Q A;  2M7A A;  4J01 A;  2PFB A;  1SFK A;  1XCB A;  4BHB A;  1K7A A;  1I27 A;  2O0Y A;  4II2 A;  1DUX C;  3HRU A;  2E71 A;  2DDB A;  2OQR A;  2FBK A;  4ASN A;  1OPC A;  2CS3 A;  4PJM A;  3PL8 A;  3L2R A;  3O8G A;  5D5U B;  2M45 A;  1XGN A;  2MD0 A;  3OOP A;  3F6O A;  2XV4 S;  1DP3 A;  2HQA A;  2OTJ I;  1H89 C;  4NHJ A;  4I99 C;  3GXO A;  2CWE A;  2M34 A;  2OD5 A;  5D8L B;  5ICG A;  1ETW A;  3ERE D;  4I7H A;  1U5T B;  2E60 A;  4WF2 A;  3CLO A;  1MW7 A;  1SMT A;  2HWV A;  3SJM A;  3IUO A;  2K3P A;  4IRH A;  3EUA A;  1YJN I;  1P9Q C;  1I6X A;  2O03 A;  2ELH A;  2RVC A;  3Q9V A;  3GFI A;  3VOE A;  1FC3 A;  2TCT A;  5J4Y A;  3LSG A;  2H6C A;  4BEH A;  4DW6 A;  5FRN A;  3L2W A;  2KT0 A;  4LMY A;  4UB6 C;  1Z91 A;  2PMU A;  4I01 A;  3VYU B;  3AL0 C;  2K40 A;  4BGD A;  5BNG A;  2OZU A; 
#chains in the Genus database with same CATH homology
 2JK3 A;  2MW8 A;  1ZR4 A;  3S14 J;  2HDD A;  1WGX A;  1IDY A;  5J1U A;  3Q0U A;  1NTC A;  3LSR A;  1BJZ A;  3S2H J;  3JRD A;  3BTI A;  5IP6 A;  1K61 A;  2O9L A;  2CU7 A;  3QPL A;  1QPI A;  3RZO J;  5HOD A;  3BTL A;  3BR3 A;  3BG3 A;  2R5Z B;  2WB1 N;  3WHC A;  1ETQ A;  1UG2 A;  3GBG A;  4NDL A;  2DMN A;  5EEA A;  4UUS A;  3G1O A;  2K9S A;  3HOU J;  3ZOB A;  3HOZ J;  4M3E A;  3OSG A;  3BR5 A;  4QIW N;  1OJL A;  2GBY A;  2HQ5 A;  5EG0 B;  2JA6 J;  5F04 A;  2XGD A;  3OIO A;  1WCM J;  2LY9 A;  4MO7 A;  1X2M A;  3ZQH A;  3S1M J;  5FKM A;  4DYC A;  2NOG A;  9ANT A;  2IEK A;  2LR8 A;  3CCY A;  2EH3 A;  3QPS A;  1NK2 P;  2TRT A;  3DCF A;  2W48 A;  2XSD C;  1ETX A;  2DA3 A;  5C4X J;  4UUT A;  2Y30 A;  3PO3 J;  3HDD A;  1TWG J;  2CJJ A;  2DTZ A;  1JGG A;  4C3I J;  2MSY A;  2DA5 A;  1A6I A;  4A3C J;  3IH3 A;  4AC0 A;  1U9O A;  5FKN A;  1U78 A;  2DA1 A;  4A3D J;  1MNM C;  3LOC A;  2R7Z J;  2NVT J;  2EZK A;  3HOV J;  2XB0 X;  5K7H A;  1IV6 A;  2R92 J;  1K83 J;  4QSH A;  3BQZ A;  3CDL A;  2FX0 A;  4RDU A;  5FLV A;  3PM1 A;  5J3L A;  2EZI A;  2COB A;  1TWF J;  2Y2Z A;  2LKX A;  3D1N I;  5EZG A;  2IBD A;  3FIS A;  3SDG A;  3DEW A;  2YS9 A;  2DMP A;  2O7O A;  2YUS A;  2HXO A;  3GTQ J;  4BBS J;  1QVU A;  3CQZ J;  1I6H J;  1ZR2 A;  1JT0 A;  1FIP A;  2M2E A;  2N8G A;  1JKQ C;  3GTL J;  1IG7 A;  3FK7 A;  1VND A;  3GTK J;  1NK3 P;  2B63 J;  4A93 J;  1BW6 A;  1P7J A;  3A02 A;  3JRA A;  2ECC A;  5DTD A;  3IH4 A;  3FK6 A;  1WPK A;  1HOM A;  2JMW A;  4XRS A;  1AHD P;  4A3M J;  2NS7 A;  4FIS A;  2CUF A;  3ZQL A;  1EF4 A;  4IHX A;  2Y31 A;  4JX5 A;  1QVT A;  5J1R A;  1MBH A;  4IHV A;  3OSF A;  1MBK A;  2E2J J;  1IRZ A;  4XRM A;  3LSP A;  4D7N A;  3C2B A;  2YU9 J;  4G12 A;  1W0U A;  3BR6 A;  5GP9 A;  3GTJ J;  5EDN A;  4IEJ A;  3TW7 A;  3HOY J;  2HYJ A;  4XIC A;  1WI3 A;  4B3A A;  1JUS A;  4B4C A;  5EF6 A;  1RPW A;  3MVP A;  2X6O A;  2G0E A;  4X1E A;  5F0H A;  2DA4 A;  2E1O A;  4C3H J;  3ZQG A;  2VKV A;  4AYB N;  2OPT A;  1JUP A;  2DA2 A;  4DZP A;  3GTO J;  4W1U A;  1ETY A;  1YRN A;  4D7M A;  2X9D A;  2JA7 J;  4B1R A;  4Y52 J;  1JTY A;  4A3G J;  2XGC A;  2FD5 A;  2M8G X;  2K9N A;  3TP3 A;  1A5J A;  3F0C A;  1UHS A;  1ZKG A;  1ZTR A;  3BG9 A;  1TC3 C;  1AU7 A;  1Y1V J;  1B8I B;  1F43 A;  4A3I J;  2CQQ A;  2EBI A;  3TP0 A;  3BR2 A;  2WAQ N;  1DU0 A;  3JRI A;  2R5Y A;  1HF0 A;  5EYR A;  3M3Y J;  1FIA A;  1XC5 A;  2JN6 A;  1T56 A;  3O8H A;  3JR9 A;  1JKP C;  2H8R A;  3HBL A;  4C3J J;  3ZQC A;  3H3V K;  2P81 A;  5GPC A;  1VI0 A;  1ITY A;  1IDZ A;  1ZQ3 P;  1ZK8 A;  3G1L A;  4V2F A;  4BKX A;  2I10 A;  3B6A A;  3IH2 A;  5GPA A;  3VPR A;  1JJ6 C;  1BL0 A;  4FCY A;  5F0C A;  1OFC X;  4XRS G;  1APL C;  4S0H B;  1ENH A;  2E19 A;  5M3F J;  4UUS B;  4XID A;  2XRL A;  2CRG A;  5EZH A;  3HOW J;  5M5Y J;  1F36 A;  4BXX J;  1SFO J;  2ME0 A;  3BTC A;  3IV5 A;  4A3F J;  4BY1 J;  1HDD C;  5FKL A;  5E3L A;  2DMU A;  5JLW A;  2ID6 A;  1G2H A;  3H0G J;  5E3O A;  1QRY A;  3TED A;  1GDT A;  3JRG A;  3UKG A;  1MBG A;  3ZQF A;  1R9T J;  5IYB J;  3A03 A;  4MFD A;  2KDZ A;  3OOU A;  1GT0 C;  2NVY J;  2L7F P;  3LNQ A;  3GTG J;  2JA8 J;  1U9N A;  1SAN A;  1U8B A;  3TW6 A;  1JJ8 C;  4IHY A;  5FLM J;  3PO2 J;  2FJ1 A;  3MN2 A;  4DYR A;  1LE8 A;  1IUF A;  1VFC A;  3JRF A;  3NAU A;  1GVD A;  1POG A;  2LK2 A;  3K2A A;  4JX4 A;  2DN0 A;  2GM4 A;  3JRH A;  2LFB A;  1O4X A;  3S1N J;  4MLO A;  1PUF A;  2R93 J;  3A01 A;  1UMQ A;  5IOZ A;  1I50 J;  3HEF A;  3GTM J;  3HM5 A;  4AUX A;  2HOT A;  5EGO A;  3BT9 A;  5C44 J;  4A69 C;  3FIW A;  4QTR A;  3MKL A;  4CYC A;  3JRB A;  3FKI J;  2O8K A;  4RBO A;  2AHQ A;  2JA5 J;  4FE4 A;  4W97 A;  4ABZ A;  5M3M J;  1E3O C;  2ECB A;  3S1R J;  3S16 J;  1Q1V A;  5F1J A;  2XB5 A;  1HLV A;  2XGE A;  4M6V A;  2NVX J;  1T33 A;  3QQA A;  1IC8 A;  1RKW A;  2CUE A;  1JT6 A;  4A3L J;  2R0Q C;  1S7E A;  2LLK A;  2VI6 A;  2IAI A;  2VPR A;  4M3G A;  4A3K J;  1MSE C;  4IHW A;  1ETO A;  4FTH A;  1XG1 A;  1FTT A;  5FJ8 J;  2MG4 A;  2VUM J;  3BQY A;  5EG0 A;  1FJL A;  5F08 A;  2CQX A;  3G1M A;  2JWT A;  3HKZ N;  3BG5 A;  2LTP A;  4D5F A;  2L0K A;  4JX6 A;  2XPW A;  2EQR A;  4V2G A;  5IP7 J;  5E3N A;  2H1K A;  2LD5 A;  4GFB A;  4LOC A;  1JTX A;  1GUU A;  1GV2 A;  2AO9 A;  1ETV A;  4I76 A;  1P7I A;  3S2D J;  2DMQ A;  3S17 J;  1MH3 A;  2Y0S N;  2HOS A;  4M3B A;  2ME6 A;  1B72 A;  1JKO C;  1W0T A;  1JKR C;  1OCT C;  4MIM A;  1H8A C;  4Y7N J;  2ZB9 A;  3S15 J;  2LVS A;  1TWH J;  5C4J J;  2D5V A;  1Y1W J;  1MBJ A;  4A3E J;  5FKK A;  1WH7 A;  2FQ4 A;  1MSF C;  1TWA J;  1HCR A;  1GV5 A;  3NAR A;  4M3F A;  2EZL A;  3RKQ A;  4A3B J;  1HDP A;  1YRN B;  5JLX A;  5F27 A;  2E2I J;  2QF7 A;  2DA6 A;  3B6C A;  1BW5 A;  1FTZ A;  1MBF A;  3SFI A;  2GLO A;  1LFB A;  4XK4 A;  4FE7 A;  2M9H A;  5FKO A;  5K7Z A;  1AKH A;  3I4N J;  5IP9 J;  3LSJ A;  5DS9 A;  2L7Z A;  3RQI A;  4MFE A;  3BR1 A;  2VKE A;  3Q3S A;  3CMY A;  1RKT A;  3BTJ A;  4X6A J;  5IYC J;  2HXI A;  2Y9Y A;  3HOX J;  3L1P A;  2R5Y B;  1VF9 A;  1X2N A;  2DJN A;  3K7A J;  5F0F A;  3RZD J;  1D5Y A;  1B72 B;  2ID3 A;  1WH5 A;  4DYQ A;  1JUM A;  2NS8 A;  5IYD J;  4JP0 A;  3JRE A;  1DU6 A;  1IJW C;  1H88 C;  4M3D A;  3HB9 A;  1TWC J;  2PMZ N;  1RES A;  4DZJ A;  4BY7 J;  2LP0 A;  4HNV A;  2L7M P;  4C2M J;  1FEX A;  5C3E J;  1CQT A;  3E7L A;  2XPV A;  3I4M J;  1RET A;  2L9R A;  3BR0 A;  4BBR J;  2M0C A;  1RR7 A;  4D5C A;  4EEF G;  1ETK A;  1MBE A;  3Q0V A;  1AKH B;  3HGG A;  5K7F A;  4J19 A;  3GTP J;  2K9Q A;  1LFU P;  2E2H J;  3WHB A;  2Y9Z A;  3JRC A;  5IPA A;  2XPU A;  2NVQ J;  1MH4 A;  2OF7 A;  2QCO A;  3O8G A;  1Z77 A;  2DA7 A;  2HI3 A;  2JJ7 A;  1OCP A;  1Z0X A;  2EZH A;  3M4O J;  2HOA A;  1H89 C;  2MGQ A;  3S1Q J;  2M34 A;  1LE8 B;  1ETW A;  5E3M A;  4I6Z A;  3ZQI A;  2R5Z A;  1I3Q J;  2X48 A;  1IGN A;  3SJM A;  2ELK A;  1BA5 A;  2DMT A;  1PUF B;  3A01 B;  4L5E A;  5IOY A;  2TCT A;  3LSG A;  4DW6 A;  1B8I A;  5J1Y A;  1ORK A;  2KT0 A;  5EGO B;  4JYK A;  2RAE A;  1XS9 A;  3W6V A;  1ZGW A;  2WV1 A;  3Q0W A;  5M5W J;  2K40 A;  4CYC B;  4A3J J;  1X58 A;  3HGY A;  5BNG A;  5M5X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...