1W0TA

Htrf1 dna-binding domain in complex with telomeric dna.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TELOMERIC REPEAT BINDING FACTOR 1
publication title How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1w0tA00
2DA1A 4XRSG 1ZTRA 2JJ7A 2ECCA 1ETQA 1UG2A 4UUSB 2LD5A 4A3DJ 2AHQA 3H3VK 1ETKA 1D5YA 3TW7A 2EZIA 1ZGWA 4BY1J 1G2HA 1K61A 1W0UA 2GBYA 3TW6A 5IOZA 2ID6A 3D1NI 1IG7A 2NS8A 3UKGA 2FQ4A 3Q0WA 2CQQA 3RKQA 3I4MJ 5J1UA 3OSGA 2COBA 1U8BA 2LR8A 4FTHA 2CRGA 1MBHA 2KDZA 3HKZN 3BTIA 1YRNB 2E2HJ 2HDDA 3Q0UA 9ANTA 4ABZA 2FX0A 3RZDJ 4B3AA 5IYBJ 4FE7A 3DCFA 5F0HA 1TWAJ 3JRGA 1JT0A 3HOWJ 3VPRA 2LY9A 3GTLJ 1MBGA 2I10A 2M9HA 1OCTC 3S1RJ 2W48A 3S2DJ 5DS9A 3C2BA 3A01B 1AKHA 1RESA 1S7EA 2JA7J 2DMTA 1VNDA 3O8HA 4UUTA 2XPVA 5FKLA 1IDZA 1A6IA 1BJZA 2R5YB 5J1RA 1IDYA 3CMYA 2XB5A 3O8GA 4CYCB 1AU7A 3HGGA 3BR1A 5BNGA 3HM5A 2X6OA 4D7MA 4D5FA 2DTZA 4FISA 4M3DA 1MBFA 1B8IA 1IC8A 4X6AJ 3PO2J 5JLWA 2L0KA 1BW5A 5M3MJ 1K83J 1T56A 1X58A 2VI6A 3HB9A 4FCYA 5JLXA 1E3OC 4IHXA 3S2HJ 2EQRA 3HDDA 5EEAA 2JK3A 5DTDA 4A3BJ 3HOXJ 1PUFB 1I50J 2WV1A 1JUMA 1HLVA 2IBDA 3S17J 1DU6A 2R5ZB 1BL0A 2R7ZJ 4QSHA 2XB0X 1JT6A 3CQZJ 2NVTJ 2DA7A 4M3EA 1ETOA 2CU7A 2Y9YA 2GLOA 2YUSA 3NARA 1ZR2A 4DYQA 2LK2A 4RDUA 3OIOA 3SJMA 3ZQHA 1GVDA 2EZLA 2MSYA 2EZHA 2R5YA 3A02A 3BR0A 3JR9A 4XIDA 2HQ5A 3GTKJ 4QTRA 4BY7J 4BBSJ 3RZOJ 2N8GA 5EDNA 2P81A 5F1JA 1W0TA 1NTCA 2HXIA 5IYCJ 4L5EA 1SFOJ 2Y31A 2G0EA 4FE4A 1TWCJ 1MSFC 2XPWA 1JTXA 2DJNA 5IP6A 4DYRA 1WH5A 5EG0A 3TP3A 2JN6A 5K7ZA 2DMQA 5EZHA 1MSEC 2GM4A 3GTOJ 3L1PA 3FIWA 1HDPA 3JRIA 4BBRJ 2K9SA 2JA5J 4B4CA 1T33A 4AC0A 2LLKA 5F08A 3FKIJ 1FTTA 4Y7NJ 1Z77A 1RKWA 2CJJA 1CQTA 4EEFG 2WB1N 4A3JJ 2JA6J 1U9OA 3IH2A 5FKMA 3BR6A 2DA4A 4QIWN 3ZQIA 2CUFA 4MFEA 3HOYJ 1Z0XA 3MN2A 1ETVA 2NOGA 3WHBA 3S16J 3TEDA 2VKEA 1Y1VJ 3ZQGA 3QPSA 1IUFA 1O4XA 3IV5A 5FKOA 2R92J 5GPCA 3RQIA 5IOYA 4AUXA 1AHDP 4S0HB 2VUMJ 4D7NA 4A3FJ 3GTPJ 4IHWA 5EGOA 1GUUA 3BG5A 5FLVA 2HOSA 3GTGJ 2OPTA 3K7AJ 2CQXA 4A3EJ 2YU9J 4GFBA 4M6VA 5M5WJ 5IP7J 4MO7A 3BTJA 3ZOBA 1EF4A 4DZJA 1VI0A 1HOMA 1WGXA 3JRFA 2VKVA 1LE8A 1MBKA 4NDLA 4JYKA 4M3GA 3LSPA 5C4JJ 4XK4A 3LSJA 2L9RA 3G1OA 1NK3P 2XGDA 4UUSA 4IHYA 3GBGA 2L7MP 3M4OJ 4A3IJ 3SFIA 3JRHA 4B1RA 4MLOA 3B6CA 3QPLA 3S14J 4G12A 4A3CJ 3BR2A 1I6HJ 2NVXJ 2HI3A 5F0FA 2Y9ZA 2TRTA 1APLC 2QF7A 1YRNA 2ELKA 3H0GJ 3MKLA 1HF0A 5F27A 1X2NA 1U9NA 1GV5A 2M2EA 2ME6A 3ZQCA 2EH3A 2ID3A 3G1MA 1QRYA 4XRMA 2CUEA 2DA3A 2JMWA 4A3MJ 3HGYA 4DZPA 2LKXA 1BA5A 4DW6A 3S1QJ 3SDGA 3A01A 3LOCA 2E1OA 2Y0SN 5FKKA 1WPKA 4C3HJ 2JWTA 1IGNA 4D5CA 5M5XJ 4A3LJ 2LFBA 3K2AA 3GTJJ 3BG9A 1JGGA 2FD5A 4RBOA 4CYCA 1FTZA 1QVTA 2Y30A 5C44J 1RPWA 1GV2A 3ZQLA 3JRDA 2M0CA 1BW6A 2LVSA 1WCMJ 5IPAA 4MFDA 1H8AC 1TWFJ 3S15J 5EZGA 2LP0A 5FKNA 2E2JJ 3LSGA 1ETWA 4IEJA 4C3IJ 1MBEA 2XRLA 3BT9A 3MVPA 3BR5A 3JRAA 2K40A 3BQYA 2L7ZA 5J1YA 3OOUA 1MH3A 2FJ1A 3A03A 2X48A 4JX5A 1VFCA 1PUFA 3QQAA 2ZB9A 1ZR4A 3M3YJ 2MW8A 3JREA 2R5ZA 2PMZN 2E2IJ 2XPUA 1XS9A 1AKHB 4M3FA 4MIMA 3LNQA 3OSFA 1TC3C 3HEFA 4XRSA 5GPAA 3WHCA 2NVYJ 3CDLA 3F0CA 1R9TJ 2O7OA 3Q3SA 2VPRA 2EZKA 3BQZA 4V2FA 1ZKGA 5GP9A 2JA8J 1FIPA 4C2MJ 2NS7A 1JKQC 4BKXA 1ZQ3P 4JX4A 4A69C 1JUPA 2MG4A 1A5JA 1B72B 1FIAA 2DMUA 3HOUJ 1GT0C 1H89C 1UHSA 1X2MA 4C3JJ 1OJLA 1RKTA 4I76A 2IEKA 1B8IB 2XGCA 2KT0A 2HOTA 1LFUP 4V2GA 4I6ZA 1POGA 1TWHJ 3TP0A 3HOZJ 4AYBN 2E19A 4W1UA 1Q1VA 2EBIA 3HBLA 2HYJA 4A3KJ 3S1NJ 3Q0VA 1JJ6C 3S1MJ 1QPIA 2O9LA 3BTCA 3IH4A 5E3MA 2Y2ZA 5F0CA 2DMPA 5E3OA 5C3EJ 1GDTA 3IH3A 3FK7A 2DN0A 5EYRA 2RAEA 4LOCA 3BR3A 1JKRC 3BG3A 1TWGJ 2DA5A 1MBJA 2QCOA 5F04A 2M34A 3BTLA 1QVUA 1HDDC 1VF9A 1ZK8A 1I3QJ 4M3BA 1UMQA 4HNVA 3LSRA 1B72A 5K7FA 5HODA 4W97A 2ME0A 1IV6A 1RETA 3E7LA 2HXOA 2D5VA 3JRBA 1ORKA 5EG0B 3HOVJ 2WAQN 5M5YJ 3ZQFA 1P7JA 5FJ8J 3CCYA 3FISA 5J3LA 5M3FJ 4A93J 2XGEA 2K9NA 1ENHA 2OF7A 4X1EA 3PO3J 1WH7A 2IAIA 2L7FP 1JUSA 2AO9A 4DYCA 1JKPC 2R93J 2H1KA 3FK6A 3W6VA 5EF6A 5IP9J 1SANA 3GTMJ 2M8GX 1F43A 4JX6A 1IRZA 1OCPA 3G1LA 2ECBA 1H88C 2NVQJ 1NK2P 2DMNA 3PM1A 2B63J 2H8RA 1LFBA 1RR7A 1WI3A 3B6AA 1FEXA 5E3NA 1JKOC 2YS9A 1HCRA 2X9DA 2HOAA 5K7HA 2DA2A 4JP0A 1P7IA 1FJLA 1MNMC 1MH4A 3JRCA 2MGQA 5EGOB 1IJWC 5C4XJ 4IHVA 1JJ8C 1ITYA 1F36A 1U78A 3I4NJ 1JTYA 4XICA 5E3LA 1Y1WJ 2DA6A 5FLMJ 4BXXJ 4J19A 1XG1A 1ETXA 2O8KA 2TCTA 2XSDC 3DEWA 1DU0A 5IYDJ 3GTQJ 2K9QA 1XC5A 1LE8B 2LTPA 4Y52J 2R0QC 1ETYA 4A3GJ 1OFCX 3NAUA
chains in the Genus database with same CATH superfamily
3K4CA 4XRSG 4KMUX 3D5SC 3LQRA 4LGWA 1ETQA 2LD5A 2HVRA 4A3DJ 2HPMA 4XLHA 2DK8A 2QGUA 2EZIA 5LD2C 1W0UA 4EGZA 3TW6A 4CCNA 2FQ4A 4E70A 2GIZA 3ZXSA 3CCLI 3RKQA 1MMSA 1V5GA 2HDDA 3KZYA 2IGNA 9ANTA 4ABZA 1XGOA 5KAFC 4B3AA 3DCFA 3F23A 3HRTA 1K4SA 3L00A 1TWAJ 1JT0A 2I5UA 4EATA 3GX4X 4BXUA 2JRTA 2FBKA 2LY9A 1IXSB 2XAHA 1MNDA 4KA4A 2M9HA 1OCTC 1D8KA 1O57A 5FD5A 5DS9A 3C2BA 3BY6A 4LMYA 3HOSA 4D0PA 2FF4A 1RRJA 4QPQA 4UUTA 2XPVA 2QWWA 1JI8A 1J9IA 1F4KA 2KHMA 4I2OA 5FROA 2NOJB 2L9SA 3P7NA 2R5YB 5ED4A 1LJ9A 2KRCA 5J1RA 4BE1A 3HGGA 1WJBA 1VQKI 3WTWC 1A36A 1IW7F 1RZ4A 2Z1DA 4G8XA 3EUKL 4JBAA 1XSVA 3HM5A 3FMQA 1E3PA 4D5FA 3FBIB 3LAPA 2DTZA 3DLAA 1S6LA 3MWMA 4U0VA 4XL9A 3BG6A 1MBFA 1YLFA 1ZREA 3VB2A 4XLEA 2VODA 3C1DA 2EFOA 4U87A 3ZN0A 1FBQA 2LC2A 4BNCA 5M3MJ 5CYVA 2VI6A 3HB9A 2LDUA 1E3OC 2VOPA 2VN2A 5EEAA 2MH9A 1ZELA 2H8WA 1T8IA 4LITA 1JUMA 3S17J 1DU6A 1BL0A 4DOZA 4QSHA 2IVMA 2DW4A 2XB0X 1JT6A 1RNLA 2DU9A 3PNTA 3G4SI 5AIQA 4F52A 2Q1ZB 1X1AA 2Y9YA 5F64A 2DFFA 1QU3A 5J4YA 2M8EA 2K3PA 2LMDA 2Y75A 1A6QA 2YUSA 3R61A 1IZ1A 4EMSA 1JE8A 1BOBA 1KU2A 4EGYA 2K3FA 4HQMA 1GVDA 5GTIC 2EZLA 3H92A 4N4OB 1C0WA 2DT6A 3BR0A 2PJRA 3SDBA 1X4OA 3GTKJ 2DPDA 5B66C 3J7AY 2N8GA 5D8LB 4J00A 4D9JA 4LG0B 2R7RA 2HXIA 2KZGA 4R79A 2Y31A 1XSDA 4RAZA 4TV7A 3EYYA 2F5VA 2O0YA 4XQFA 4F3QA 1MMNA 1SD5A 4RAFA 2CW8A 2VQLA 5IP6A 2ELHA 4B09A 4DYRA 1TZLA 2AXTC 2GQQA 1WH5A 2HZTA 3DU6A 5EG0A 1W36D 4F55A 1J59A 2BHYA 2JN6A 2WC2A 4IHTA 2ZNZA 2ELJA 4HRIA 3RYPA 3SEQA 3WG9A 5EZHA 3S93A 2GM4A 1S8NA 5GADJ 3L1PA 3G2BA 1HDPA 2QZ8A 2LY2A 3OWTA 4B4CA 1T33A 1S72I 2LLKA 3FKIJ 1FTTA 1J7KA 4Y7NJ 4E6KG 1OCRH 1RKWA 2CJJA 4BXFA 1CQTA 4EEFG 4BYYA 1S3JA 4ITVA 5KCMA 4A3JJ 5FKMA 2UWMA 4HV5A 3ZN1A 2Z2SB 4CCLA 1H0MA 1FSHA 3I54A 4J01A 3E5QA 1ETVA 2VKEA 1VQ9I 3ZQGA 1QZEA 3S3MA 2X85A 5B1AH 2A6EF 4OMYA 1XTAA 3L2CA 2EV6A 2E1CA 5GPCA 2R92J 3RQIA 3I58A 5IOYA 3LWFA 2V26A 3VYRB 1TL8A 4G6QA 2QKLB 5FLVA 3LSTA 3GTGJ 2DFEA 2OPTA 2CQXA 1VTNC 1SAXA 2D1VA 3SXYA 2CFOA 3KP2A 3I56I 4MO7A 3Q5FA 3BTJA 2V9VA 4XSZF 4NQWB 2WWYA 4BJ5C 1VQ8I 1OYIA 3KFWX 4HX7A 2FMYA 3PIPF 3C2GA 2DI3A 2HGCA 2KIQA 3LSJA 3G1OA 4YG2F 3KEQA 2XGDA 1NK3P 2F5EA 1HSTA 5HS7A 4PJLA 1KQ8A 1V5FA 3M4OJ 4UUVA 3F3XA 2OCCH 4Y15A 3OYLA 1F1ZA 1N77A 2BE5F 2M4GA 4MLOA 2WADA 3S14J 1X1BA 1W36C 1K6YA 4A3CJ 3QAHA 2G7UA 1FOXA 4YFKF 2QBYA 5F0FA 4P96A 4Q48A 2V9KA 2FBHA 2KIMA 2ESHA 1MMAA 4UVAA 3H0GJ 1BR2A 2ISZA 3QYEA 4CYDA 1HF0A 1X2NA 3ASNH 4L9TA 3MZYA 4NHJA 3ZQCA 3WG7H 1MJAA 1QRYA 1S9HA 3KP5A 2A68F 2CUEA 1WHUA 2JMWA 2RKHA 4KNYA 3OYEA 3TO9A 3S1QJ 5DUKA 1VQNI 2WB1A 3CCUI 4AIHA 2VJIA 3DLLF 2F2EA 3LOCA 3OYBA 1TT5B 5L3CA 4KDPA 2JWTA 3H9JA 4N4NB 3PFYA 2ZJ2A 2FD5A 1EJ9A 4CYCA 1HXDA 1RPWA 3HJEA 1GV2A 1Z7UA 3MZ8A 5D6FA 1QHGA 3K69A 3E6CC 2M0CA 3FMRA 1LKXA 4DJAA 5JHFA 3L9FA 3W6JB 3H9QA 4D1QA 2NNYA 1YYVA 5HLIA 2LP0A 5FKNA 3HOTA 2Z33A 4AM3A 2E2JJ 5CVIA 3S3NA 1FLIA 3HRMA 3A1YA 1G3TA 3MVPA 3GXOA 4BL0B 3V7CA 4P55A 2EFWA 3IWZA 5GAHJ 1OLTA 1MH3A 2FJ1A 1TNTA 3A03A 1QBJA 2WV0A 4UB6C 1KZHA 2L9NA 1ON2A 2QQ8A 3QQAA 4MEYF 5FLXZ 1XX5A 2PMZN 2XPUA 5E8GA 1XS9A 3HTSB 5L3BA 1P6RA 3RJPA 4B3XA 1Y8QB 1MMGA 3ERED 4ZDPA 2IT0A 2HZDA 2QKMB 3WHCA 5L3EA 3TOBA 2NVYJ 5BQTA 4E7JA 2O7OA 2DOAA 2LKSA 1ZG5A 2QQBA 4V2FA 5GP9A 5GAGJ 4XKBA 5J6XA 1FIPA 4BKXA 4CXFA 2ZXIA 1I3AA 1R6RA 1AOYA 2A5YB 3PNYA 2A07F 2MG4A 4K2EA 1HW2A 1B72B 1DPUA 2DMUA 1T6SA 4C2TA 1GT0C 1X2MA 2CMPA 1RKTA 3TQNA 4RAYA 2XGCA 3ZMUA 3S8PA 1STZA 1X3WB 1FBSA 4I6ZA 1BM9A 1ZG3A 1FNNA 1R23A 3HOZJ 4QWQA 5E8IA 3GFMA 4WWCA 1XSXA 1Q1VA 3WTSC 1EV7A 4HAMA 2OQGA 1MNEA 2VQHA 2W85A 2FU4A 4ZDLA 4II2A 3J81Z 3GLXA 1JJ6C 3S1MJ 2P8TA 4V19K 2W82A 4M6YA 1QPMA 3BTCA 1FP2A 3IH4A 4N0BA 2DMPA 3OYDA 3OYIA 4PK4A 5C3EJ 4BHBA 3CMMA 4RM3A 3IH3A 3E6BA 3COAC 1UCRA 4UVBA 2E7XA 5TISC 4ESJA 2RAEA 3DEEA 1KQ9A 2DYRH 5HDGA 4LOCA 5CKTA 2QA4I 4PDKA 1O3SA 5LBQA 2QCOA 2PJRB 2KP6A 3IC7A 2OC6A 1ZK8A 3E97A 4XORA 1WKMA 5FB2A 3D5RC 2OU2A 3K4JA 5GAEJ 1ERDA 4AWXB 2DK5A 3E3VA 4ZC3A 4XLPF 4PFOA 3JSOA 5DD8A 3QYBA 5EG0B 4CZCA 1VQ6I 2M0MA 3CCMI 1QA6A 3M8FA 3CCYA 2R7FA 1DGWY 3C7JA 3GMEA 3DBRB 3I0TA 2DLLA 3WE2A 3NWTA 3V8JA 3B73A 2OF7A 3PO3J 1L3LA 1JUSA 2R93J 4IOCF 1P4AA 3FK6A 4Q5SF 2Z3YA 1AWCA 1ZN2A 5BPDA 3FWEA 3OOPA 5LLQA 1WI9A 5IP9J 5H2FC 3F9KA 1IN7A 3G1LA 1K78A 2ZMEA 4CZZA 2J5OA 3FM3A 3NEUA 1TQIA 4PZJA 2DT7B 3OS1A 1UG0A 2DMNA 2X4HA 1U5TC 2XAQA 1R49A 3O6BB 3B6AA 2FSWA 1FEXA 4I02A 4AYBA 1REPC 2QSHX 1QQIA 1WJEA 2HTJA 3L7WA 5FO5A 4A12A 4XLNF 2EFNA 1HCRA 1ZYRF 2HOAA 2GOXB 2DA2A 1SFKA 2ZFUA 1P7IA 3CCVI 1MH4A 1R5ID 2MGQA 3KZIC 4PCQA 3N97A 3KX2A 3ZGKA 4BGDA 4U7DA 2IGMA 5FD6A 3OYFA 3U9GA 4HNTA 3I4NJ 4EVIA 5E3LA 4XICA 1Y1WJ 1PDNC 2VKDA 1LDJA 2R7DA 2RNGA 3DEWA 1KYWA 2IGOA 1G3YA 3GTQJ 2K9MA 4FX0A 3VSKA 4XN3A 3DQVC 3BWGA 3NQOA 2R0QC 1N75A 1ETYA 3EPZA 2Z5UA 5TJJA 3G3ZA 5DV5A 5EEGA 2DYSH 2K7LA 2ECCA 3T1BA 1QZZA 1YG2A 1Y0UA 2K02A 4MQVA 3CP8A 3ABMH 4RB3C 2PJPA 5HS9A 1Z6TA 1G4DA 1VQLI 5IOZA 1Y8RB 2ID6A 5EJCA 3D1NI 1IG7A 4Z2YA 3UKGA 3K4NA 1P2FA 3DTEA 5JFRA 2CQQA 5AONA 5HLGA 2L5QA 2WAQA 4KN4X 3I4MJ 3PIOF 4UNOA 2QBYB 3BP8A 3F8CA 2LR8A 4FTHA 2EINH 2KDZA 4L9VA 1D8JA 2NXNB 3BTIA 2F48A 1AA7A 4PGHA 2HTSA 2IW5A 3RZDJ 4FE7A 1XGMA 1ZH5A 2BXZA 5F0HA 4S05A 4EV0A 3JRGA 3HOWJ 1I27A 1LNWA 3GTLJ 2LBFA 3SZTA 3WE3A 2DCEA 2EV5A 2CUZA 2JTVA 3RYRA 3MQ0A 1S7EA 2JA7J 2DMTA 4Y17A 3BC8A 4RB1A 2H94A 1IDZA 3HSRA 2KLOA 3JSPA 1E2XA 3OR1C 1CF7A 1JXSA 2KISA 3WODF 1IDYA 3CMYA 1Z91A 2XB5A 3GWZA 3O8GA 4CYCB 2KZVA 2O8XA 1AU7A 3KYLA 2E1NA 4M9ZA 4WXHA 4PJNA 2XGXA 5BNGA 5ICGA 2X6OA 1YO5C 4OOIA 2YX4A 1USSA 4EJWA 2PG4A 3O3KA 5KVRA 3EYIA 2VBYA 1D0XA 3CDHA 1X3ZB 1B8IA 5K5QA 5LHGA 3OS0A 2MC3A 1IC8A 4WXCA 2L0KA 2ZSIB 1F9NA 1K83J 4FCYA 2YR2A 4JOMA 3S2HJ 5DM6F 2EQRA 3K4KA 2EFPA 3FXLA 1Y56A 3HOXJ 1I50J 4UY8I 1YI2I 2VL8A 1HLVA 2IRFG 3HZJA 1YFHA 1RUOA 3RPUA 1RIOH 1IF1A 3QU6A 4HLYA 1WRJA 3PFIA 2STWA 2XVCA 3CQZJ 2NVTJ 2E36A 3D5LA 3KP4A 3PSFA 4YIIA 1ZRDA 4HX4A 2E34A 3LA3A 2IPQX 1WQ2A 4DQ2A 1LPQA 4IVNA 4MQ9F 2LK2A 5E1WA 3ZQHA 2OAZA 1WVRA 5FFXA 3H3UA 5H6RA 4F92B 3CF2A 2EZHA 5CVRA 2Z99A 2L2OA 5E17F 2WY7Q 3GCMA 1T2KA 4BY7J 1LEAA 4JK1X 5EDNA 2P81A 5F1JA 1SD4A 1FBUA 1W0TA 5IYCJ 3OYMA 1SFOJ 3H9GA 3KP6A 1ZGAA 4R8HA 4KFCA 2DJNA 4P1WA 4RLFA 2VLAA 1XD7A 2IP2A 3CUQA 2DO7A 4ASNA 4G6TB 3TP3A 4JQFA 3CO6C 3GFJA 5K7ZA 3H1CA 2A6HF 3IWFA 4PSWA 2M7BA 1ZLJA 2HKXA 3FIWA 5TGTA 4KYWA 4BBRJ 3WTYC 3RQ4A 2VJ4A 1S7OA 2BY2A 4AC0A 1Z77A 1X4PA 2HU9A 3K9TA 3B02A 2JA6J 3QWLA 3IH2A 3BR6A 2DA4A 1VZ0A 1DPRA 1T0FC 2IGKA 2CUFA 3CO7C 3W3CA 3HOYJ 1Z0XA 3WHBA 2NOGA 1KYZA 4UB8C 3K1PA 4LK1F 2DODA 2FOWA 2P7VB 4WX9A 4HDVA 1IUFA 1YW7A 3E6MA 4MHGA 3IV5A 2PFBA 3C18A 2EIMH 3FXRA 1KONA 4OINF 4ENKA 1AHDP 4S0HB 2VUMJ 3KETA 4D7NA 4A3FJ 1FP1D 3DV8A 4C2UA 1Z67A 2Y0MA 4QLCU 2GXBA 1YX5A 1YHQI 4YEJA 2YU9J 4XRFA 5IP7J 4IQ4A 3BCAA 2ZFWA 2G7HA 3F72A 3ZOBA 2XKPA 3FXKA 1W1WE 1VI0A 3X2QH 1UFMA 3CJNA 4BE2A 1WGXA 2CQ7A 2VT3A 1RI7A 3JRFA 3TMOA 2GWRA 1LE8A 4NDLA 3DPLC 3HHGA 4M3GA 4Y3OA 3VDXA 3MKZA 1SC7A 3V8KA 4UUSA 3NRVA 1K78B 2CWEA 3GBGA 3SZGA 1QO0D 4HF1A 3CDIA 4B1RA 5KK1A 3BZCA 2STTA 4G12A 4IXAA 4M6XA 5ILUA 3BR2A 1I6HJ 3ABTA 4LIVA 3K0LA 3M8JA 1YIJI 2NYXA 1APLC 1YRNA 1V4RA 2FQ3A 5CLSA 2ZJQF 1Z05A 2JPCA 4BE0A 3MKLA 2O61A 3IKTA 3S2WA 4O5VA 1ZRFA 2CUJA 2ME6A 2EH3A 2ID3A 4XRMA 3L2RA 3OYJA 3HGYA 2LKXA 4PGGA 3K2ZA 3SDGA 5TRDA 2F4MB 2JUCA 3A01A 1R5HA 2LOOA 2ZCWA 2K85A 5E1XA 3FKJA 2CV0A 2Y0SN 4PJJA 5IT9Z 1WPKA 2D45A 1IGNA 2PN6A 2ZSHB 3W2VA 2VONA 3V42A 2R7TA 1IV8A 3BG9A 1FC3A 1JGGA 4A5MA 1QVTA 3R0AA 2IA2A 3JAMZ 3ZQLA 2LF7A 4B48A 4NNJA 1O3RA 1WCMJ 2XF7A 1BBYA 1TWFJ 3S15J 3I5UA 2VJ5A 4XSXF 5JVTA 4HZFA 3DTIA 1FWZA 1VQ7I 4M73A 3P5JA 4C3IJ 1N25A 2FNAA 1KGSA 4A2UA 4CO8A 4H4KC 2COMA 1I1SA 3PSIA 5JVGF 2K40A 3DF8A 4LJZF 1PYVA 2LSOA 4L5JA 3EQLF 2LYCA 1SFXA 2X48A 2E60A 3HL2A 2K9LA 2HWVA 1PUFA 3CCJI 3M3YJ 3I9V2 1BJAA 2A05A 2CGPA 2LBFB 1BC8C 2R5ZA 2E2IJ 1MZBA 4EJUA 4FHTA 4AIKA 1OPCA 2PI0A 2EILH 4E4HA 2P6SA 2ZC2A 1P4XA 1YX3A 4M3FA 2AQFA 3WTVC 2EA4A 2R7SA 3P9IA 1CF7B 3F0CA 3L2WA 1S5LC 2CW7A 4IRIA 4G7HF 1ZKGA 3I64A 3I3LA 1JKQC 2HFHA 2NS7A 4I99C 4A69C 2KIUA 1IXCA 3ZCOA 4CHUA 3IRRA 2CSOA 4NC6A 3RPQA 2LH9A 1EKEA 1K4TA 4O6JA 3ESWB 4XN0A 3E0JB 2E35A 5KHDA 4I76A 3GLLA 2XSJC 1B8IB 4L9NA 4LIUA 4Y33A 1T08B 1D0ZA 4I01A 4HNUA 4V2GA 4ENMA 5ICEA 1Z9CA 2RVCA 1POGA 1ACIA 3CCEI 4XLAA 3HSEA 1W5CC 2E19A 4DBQA 1Z3YA 2CH0A 5DD4A 3K4BA 3ASOH 2VE8A 5LGNA 2VQGA 2M4KA 2HYJA 3BJ6A 3HBLA 3S1NJ 1YJWI 2ADUA 2X6XA 2HKOA 4XBFA 1ODDA 1R4MB 2W24A 1GDTA 3RDIA 4GRIA 2MA3A 2EJRA 5DYMA 4UXNA 4LFUA 1QGPA 5HDNA 1TWGJ 3BG3A 1WJDA 4RLQA 5F04A 4G6DA 2A5WA 3BTLA 4NC8A 2KJCA 4G9YA 3L2UA 4AIDA 1UMQA 5KNLA 5DUIA 2A3SA 2CW0F 3ABLH 1KU3A 1FMVA 5K7FA 4IX7A 1XDUA 2CFXA 4F93B 2LNBA 1QNTA 2RNJA 3R4KA 1XCVA 1SD6A 1ZGJA 3E7LA 5ICCA 3K1MA 5B5EC 2PMZA 1U8RA 3I53A 3JRBA 1ORKA 3CUQB 3DBHB 4YIRX 3ZQFA 2PLYA 1R5GA 1P7JA 5HDKA 5FJ8J 3KLNA 2R7XA 4Z6YA 1IRXA 2CG4A 2K9NA 1G3SA 4ENJA 2IAIA 1U3EM 2AO9A 1S7AA 1OYWA 1R4NB 5J8CA 3WU2C 3W6VA 2QLZA 4EJTA 3MCZA 3HIFA 1OCCH 2M8GX 1F43A 1WJ5A 1IRZA 3IAS2 4CCMA 2DDBA 3V7SA 1XB4A 2ECBA 3IL2A 3PL8A 4BQNA 4N9IA 1H88C 4YFXF 3HXLA 1DP3A 1HQCA 2NVQJ 2P0WA 3KP3A 3F8BA 3U1DA 1V3FA 1W7PA 2Q2EA 2JSCA 1HC8A 2P6TA 1RR7A 1LDDA 3HHHA 3I59A 4EM1A 4CICA 3H5RA 4DBRA 1JKOC 3TOAA 3HKZA 4I7HA 4PJMA 3CJQB 5LFAA 1FYKA 3SQNA 5LRRA 3T5XA 1KU9A 1FJLA 1MNMC 1BI3A 1OQYA 2KRHA 3JRCA 3AG3H 3DU5A 3W2AA 3F21A 2KJBA 5C4XJ 4AD9A 3JTGA 1JTYA 2RV8A 1GLNA 3M1EA 3ZR8X 1UAAA 5DCMA 5FLMJ 4BXXJ 1DP7P 1WZ2A 1ETXA 2O8KA 2CQNA 3DBLB 2XSDC 5JI6A 3OR2C 5IYDJ 1HBXG 3HTUA 1HA8A 1LE8B 3K4MA 2WAEA 2Q8KA 2KQRA 3RCOA 1R1VA 4KIFA 2DA1A 1ZTRA 1I39A 2JJ7A 3GZ6A 4UUSB 1UG2A 4IOAF 4HA8A 1D5YA 3TW7A 2BV6A 2OUMA 3UNGC 3TO6A 1G2HA 2NRAC 1TW3A 1B9NA 1LVAA 2QVOA 3BPVA 3CP2A 3QP5A 3BOQA 2NS8A 2BVLA 4XKWA 3Q0WA 2IXSA 1MGTA 5IT3A 2VQCA 2XKOA 3OSGA 2M5WA 1U8BA 2CRGA 4BAYA 3GF2A 3H5NA 3HKZN 5JHUA 3WGIA 1YRNB 2A6TA 2F4OB 3Q0UA 4XOPA 5LGUA 2FX0A 5IYBJ 3BLYA 2KIFA 4LB6B 4RGUA 2JVHA 3CC4I 3OYGA 1MBGA 4WK8F 2I10A 3TDZC 4MTDA 4ZZLA 2W48A 3Q9VA 3V7RA 3A01B 4BJ6C 1RESA 1R1UA 3WGHA 4A6EA 4U7BA 1NH3A 2HQRA 3O8HA 5FKLA 2CQKA 3I4PA 3LA7A 1FOWA 3A2KA 3DP7A 4KIGA 1BJZA 2L02A 1Y39A 4PUSA 4BU2A 5BOXA 3BPXA 2X1CA 1SMTA 5HLTA 4L0ZB 3C2HA 5J40A 2R7UA 4XLFA 4FISA 3IP4B 1A35A 5LHHA 1ZG1A 2VIXA 2OTLI 1IRFA 5D6EA 5K5OA 1XN7A 3T8TA 2FA5A 3KYCB 1K79A 3LSHA 4X6AJ 3PO2J 5JLWA 1K7AA 2GOMA 1BW5A 1VQPI 1X58A 1YITI 1H9TA 3J80Z 5JLXA 1YIOA 3C3WA 2V1DA 1J2XA 2VXZA 2JK3A 3TKYA 2CV2A 5DTDA 4A3BJ 1PJRA 1PUFB 2WV1A 1H9GA 1LUJB 2HQAA 2IBDA 5HS8A 4RGSA 2R5ZB 5J4VA 1EA3A 4LB5A 3K70D 1LVKA 1WFXA 1BI0A 2DA7A 4M3EA 4BEHA 1ETOA 1M1EB 2CU7A 2Q0OA 1BR1A 1L0OC 4KUMA 1ZR2A 4I0BA 1HW1A 3OS2A 4RDUA 2VBZA 3W6KB 3SJMA 4HPQA 4WCGA 2F4IA 5D4RA 4FX4A 2R5YA 2V79A 4ZZDA 3J7ZI 2KDOA 3JR9A 2V1XA 4XIDA 3U21A 2HQ5A 1O7FA 3RZOJ 4RB0A 1MD0A 1XMAA 4AVZA 1TBXA 2V4JC 4RB2C 1OCZH 2HDWA 4A0YA 2QENA 2VASA 5ERIA 1YQAA 2G0EA 4FE4A 3EETA 4BDZA 1MSFC 1MKMA 2NAZA 2XPWA 2R7WA 4CCJA 3AL0C 4R1HA 2W7NA 2GXAA 2D2WA 2JVGA 3HPHA 4S04A 3A0HC 3VWBA 2KRFA 1UZCA 3DTKA 4Q47A 1SFUA 3HYIA 4ZYAA 4NUBA 2DMQA 1MSEC 3GTOJ 4E7ZA 2H6BA 1ZLKA 4HEA2 3JRIA 4GO1A 3OL3A 2H6CA 5FLXK 2K9SA 2HOEA 3VOEA 5E79C 2MABA 3LSMA 3ZMZA 2VBXA 1DQUA 2LY1A 3M9AA 4Y4RA 2MBFA 3WTTC 3KIOA 3DFGA 1BR4A 3R0JA 3QPTA 3ZQIA 4FQGA 5CVJA 1XCBA 2PX9A 2K86A 4EM0B 3TEDA 1TT0A 3G6EI 1Y1VJ 4P9FA 2YU3A 1VQOI 1LQ1A 3GZ5A 4B43A 1O4XA 2HDCA 1BI2A 1JHHA 3OYNA 2XF5A 5L3GA 1LB2A 2MD5A 3RKWA 4AUXA 5K5RA 1FSEA 4LG0A 3K70C 3QRFF 3GTPJ 3Q9SA 2E1MB 4IHWA 5EGOA 1PUEE 4QPOA 1X19A 1GUUA 3GUDA 2W25A 4BHPA 4ESFA 2HOSA 2L4MA 3HSFA 3MZHA 4A3EJ 4GFBA 2VOOA 1TQPA 3KZZA 3V8LA 1MDMA 1X1PA 4XKCA 3J81K 3JCUC 5LGTA 2FBIA 1OMIA 4RAGA 5D5XB 1MBKA 1MJBA 1T98A 2Y48A 2XDVA 2DPUA 2BYVE 3TDUC 2L3DA 3LFUA 1R36A 2FNPA 4BACA 3AL0B 4Y13A 2DFIA 2QSFX 2PBIA 2L7MP 3H3ZA 3ULQB 4A3IJ 3SFIA 3JRHA 2HYFA 2BBYA 2BEOA 4PSXA 1E0EA 3B6CA 3QPLA 1W7PB 2Q2EB 3UR3C 2ICWG 3I59B 4KITB 3AG2H 2O03A 2NVXJ 2RGVA 3KCCA 2QEXI 2MLKA 5IY5H 2QF7A 3O2PE 2ELKA 1EH7A 2HNHA 4E7HA 1FZPB 4Q4ZF 1P4WA 4GXOA 5F27A 2CV1A 1GV5A 3G1MA 1YTYA 2DA3A 4A3MJ 4DZPA 4CUGA 1UHWA 1BA5A 4DW6A 5DCMB 3ZRGA 2K5CA 2LKPA 1I5ZA 3N05A 4L5IA 4HF2A 4O3MA 5FKKA 4C3HJ 5E1ZB 4D5CA 1O3TA 4A3LJ 1Q1HA 2LFBA 5HNFA 2EPFA 3RTRA 1E17A 4RBOA 2OV7A 1IO2A 3VYTB 5D5VB 3MFKA 1FMWA 1B4AA 3ROUA 4EJOA 1BW6A 3WGGA 5IPAA 2G9WA 3F6VA 4MFDA 2OD5A 3S3OA 4XONA 2ZMEC 5EZGA 3CCSI 4ZJZA 2RQQA 3FM5A 3LSGA 4EJVA 4IEJA 2V6EA 3F22A 4C30A 3BT9A 3A0BC 3JRAA 1P92A 2O6GE 3BQYA 4HLXA 3ECOA 5CPRB 2L7ZA 3AFHA 5J1YA 3OOUA 4IHSA 1IN5A 4HOBA 4JX5A 4NB5A 3OYHA 3KEYA 2UXNA 3H35A 4H0EA 1PP8F 4MEXF 2MW8A 5GTHC 2MC4A 4XNFA 4MNUA 5L3DA 1ZRCA 2UUZA 3FHNA 2O3FA 3LNQA 3OSFA 3KE2A 2ZJPF 3OMYA 4XRSA 2KFDA 3OYKA 5J47A 1W5TA 2GXGA 2DQRA 3CJTB 1R9TJ 4B44A 2H27A 2OTJI 2VPLA 1O3QA 3IHUA 4DIQA 2JA8J 2PMUA 5KAIC 4ZDOA 1IN8A 4C2MJ 4IZZA 3GW2A 4G7OF 4CCKA 2RDPA 3ABUA 4ZTFA 1A5JA 3RPUD 1H89C 1UHSA 4CGZA 1OISA 4ZYDA 1WSUA 3FZVA 2RN7A 3PUBA 1KA8A 1VQ5I 3E5UA 3M07A 5CVVA 1LFUP 2TDXA 3JW4A 3TP0A 4A6DA 4B47A 2JQ7A 1TLHB 4FT8A 2X1DA 4W1UA 3U2RA 4WF2A 1NG7A 3CCQI 3M7GA 2Y0SA 4G94A 1X3UA 2NS0A 4A3KJ 3Q0VA 3ERMA 1HKTA 1SFEA 2LG4A 1LEBA 3QPHA 1QPIA 2O9LA 1EH6A 5E3MA 2W1OA 2Y2ZA 5CVUA 4BEHB 1YW8A 5E3OA 4IQJA 3ZMDA 3FXUA 3IKVA 4P9UA 2ZMEB 3ZMSA 1SVMA 1E3HA 1YOVB 3FK7A 2M7AA 2DN0A 4II3A 3E5XA 2UV1A 3RIRA 2UXXA 4HSTA 2P5LC 3SFZA 2LRDA 2B9SA 5FFZA 1TW2A 3BR3A 1JKRC 4CA0A 3N4MA 3WU1B 1RR8C 1R7JA 2IS2A 2W84A 2XRNA 2GZWA 4PJ0C 1HDDC 1VF9A 1U2WA 1I3QJ 4M3BA 1TQMA 4HNVA 3LSRA 4LK0F 2FMLA 4YIFA 1B72A 4W97A 2ME0A 3CTAA 3MAJA 4HDUA 2W57A 3CZ6A 4A5NA 1QZYA 1B9MA 4ZYGA 2HXOA 2IJLA 2D5VA 1R58A 3HOVJ 3JTHA 3GFLA 3LSIA 2V1UA 3FISA 2GAUA 3BDDA 1LFPA 1A04A 1J0RA 3AAFA 1ENHA 2EK5A 3OIPA 1V5EA 2KKOA 5LRSA 3V4GA 1R1TA 4DYCA 1TP4A 4OWRB 3OY9A 1YS7A 2H1KA 3H36A 2VT2A 2VB6A 5JR3A 3PNVA 3VODA 1OCPA 2K4JA 1T39A 2JT1A 3GZNB 1U6GA 2JPBA 2XAUA 3VYUB 1GXQA 3MKYB 1NK2P 3PM1A 2AXLA 4U0YA 2P4WA 3DEUA 3RKYA 2QYOA 4GDFA 3CJRB 1LFBA 1WI3A 1Z1DA 5HOOA 1Z6RA 5E3NA 3CC7I 3LSKA 2YX7A 5LEJA 4BDYA 2BW3A 2X9DA 5K7HA 2X6WA 3F8MA 2LREA 5EGOB 1D1BA 1U0JA 2MLGA 4ZTJA 3KP7A 3GFIA 4I98B 4IHVA 3LA2A 1JJ8C 1F36A 4EM2A 1ON1A 3LL7A 2HVQA 3IAM2 1VQMI 1UB9A 2DA6A 1MDMB 3CUQC 1UELB 1WJFA 3ONQA 2ETHA 4L9JA 4HQEA 2EIJH 2OCEA 5E20A 2K9QA 4YELA 1XC5A 3R6SA 2NNNA 2Z16A 3ML6A 3VYSB 1WJCA 2YPRA 4XKVA 2LTPA 2R7VA 1D1AA 1J75A 4KMFA 3FHZA 2ZNYA 1DGRM 2AHQA 3H3VK 1ETKA 1ZGWA 3HUGA 4BY1J 2VC1A 1K61A 5D4SA 2GBYA 4HYEA 3WTZA 3L2QA 2K4BA 1EH8A 1I6XA 2B7EA 2DFHA 1RUNA 2L4AA 5J1UA 2COBA 3K10A 1MBHA 1OKRA 2EWNA 2JA2A 4U0WA 2E71A 2E2HJ 2L01A 4XOTA 1NG6A 3PUFA 4BUPA 5L3FA 2MH2A 5ILSA 1G6NA 3VPRA 2E7WA 2FOKA 3KPHA 4IF4A 2M1BA 3S1RJ 2EA2A 4NBQA 4ZYEA 4F7ZA 2WA0A 3S2DJ 4M72A 1JGSA 1CGPA 1AKHA 4M74A 1VNDA 1XGSA 3BJAA 2MFZA 2X51A 4KJZA 1A6IA 2BXYA 2KPMA 3IUOA 4KISA 3ZMTA 2CO5A 3RSNA 2H09A 3PQKA 3VEPA 3FXOA 4KIBA 3BR1A 1SAUA 2VE9A 3KLOA 2BOLA 4D7MA 5A2QZ 1VQ4I 3FMSA 4M3DA 1Z21A 4BQQA 1Z7LA 3K1NA 3OYCA 4A0XA 3SYTA 3QOPA 1PP7U 1T56A 2M30A 1JHFA 1KQ0A 5DCFA 1XGNA 3TL4X 3DPUA 4IHXA 4IPAA 2FEZA 4NC7A 3HDDA 1NHAA 3HRUA 3QODA 1T95A 5ILVA 3U1KA 3HC7A 1BC7C 4UV9A 1OR7A 3MMYB 2R7ZJ 2BVMA 3AG4H 3OYAA 2GLOA 3OL4A 5D8KB 3VSLA 2DXIA 4OIPF 2HVSA 1D0YA 3NARA 5IT9K 4DYQA 1U5TA 3OIOA 4ANJA 6PAXA 3CMAI 4IJAA 1S29A 2ZO4A 3GO5A 2MSYA 2V7FA 3M8EA 5F6FA 1HW5A 2FUG2 3A02A 4XM3A 2Z9OA 2AQEA 1HKSA 3JAMK 2ZKZA 4QTRA 4BBSJ 3S32A 3F6OA 2GA2A 2R3SA 2H1LA 5LHIA 2L54A 2BZTA 5CQGA 4FETA 2VJJA 1NTCA 5EEHA 2M45A 5E18F 2IS6A 1IRGA 3CF5F 1UHMA 4L5EA 1Y6IA 2A69F 2R7QA 1MW7A 1TWCJ 1SVOA 1JTXA 3KYDB 1A31A 1R22A 4AVPA 4CH7A 3AG1H 3H0DA 2JZYA 1FT9A 1X1DA 1GHCA 2JA5J 2ISYA 5FRMA 1DDNA 1WWXA 4GYIA 2WTEA 5F08A 3P9CA 2LF8A 1J5YA 1LDKB 2OQRA 4I0AA 4WXDA 1MIJA 5D5WB 2E5NA 4LG3A 2WB1N 1PVEA 1U9OA 2DBBA 3MKWB 1XPXA 3G73A 1USTA 4QIWN 4RMNA 5CJ9A 3AKZA 1IUYA 3DXJF 4MFEA 3MN2A 5F1RA 2NVUB 3G71I 3S16J 4P5OA 4ZH4F 3QPSA 2Y69H 3QU3A 5LEKA 2EV0A 4M9SA 2F5DA 4OIQF 1WJAA 3F8NA 3FXMA 1R71A 2VXDA 5FKOA 1V55H 3LMMA 1XDSA 2K27A 2A61A 2KMUA 5B3SH 3BROA 2IS4A 4E7LA 2ZXWH 3OV8A 2DOEA 2WY8Q 4ENNA 3TGNA 4BS9A 3BG5A 2ZBKA 2FE3A 3E6DA 1W5SA 3K7AJ 2V6CA 4M6VA 5M5WJ 2DJIA 3CLOA 2WAFA 4E7IA 4HW0A 1W7PD 4OIRF 4MTEA 1EF4A 3EDPA 4DZJA 2F5FA 1F5TA 1HOMA 4KT6A 1SMYF 2HPIA 3T0YA 3ZQQA 2VKVA 2DAOA 4EQQA 4JYKA 2B0LA 4F91B 4XMYA 3LSPA 5C4JJ 2XV4S 4RGRA 3I71A 4XK4A 2L9RA 3DWLE 2ZJRF 1FYLA 4L0YB 4IHYA 4CDGA 2HR3A 4KN7X 1IAWA 2P5VA 3TBIA 3I55I 2XIGA 1V54H 2XAGA 2XROA 5AIPA 2OZUA 3LFKA 2KL4A 2OZ6A 5HLHA 1O7LA 2GIVA 5DEQA 3CESA 2DTRA 3QOEA 4UVCA 3K6GA 2HI3A 3BJOA 2BW3B 4BQOA 3EUHA 2HYGD 2TRTA 5A2QK 2Y9ZA 2VBWA 3ZPLA 2O5RA 1RC9A 3A4CA 1GVJA 3WU0A 4U88A 4ON0A 4KICA 1BIAA 1U9NA 2M2EA 2OA4A 4AU7A 2HQNA 2BGCA 2E1MC 2JSPA 4LLGF 2HEOA 3CUOA 4BQAA 2BHZA 4N9HA 3QYFA 2E1OA 4ESBA 4C9YA 3BCBA 1G8XA 2X1EA 5M5XJ 3BG7A 2FRHA 3K2AA 1ZARA 3GTJJ 1YJ9I 2RREA 2VKHA 3ISPA 2EIKH 1FTZA 1OR7C 2MD0A 2Y30A 5C44J 1FY7A 1KU7A 4LLLA 3JRDA 3HUGB 3PQJA 4UV8A 2L7KA 4L18B 2LVSA 4DNCA 3DKXA 4IRGA 4OMZA 1H8AC 3BZKA 4X0GA 4CSWA 2IA0A 4OU0A 1ZHFA 3E1SA 1YJNI 1D1CA 1ETWA 2XAJA 1MBEA 2XRLA 3HRSA 2J5PA 5D5UB 2W00A 2PEXA 3LQQA 3BR5A 1YS6A 2IA1A 3W2WA 4KT5C 3WTXC 1K6OA 4BH9A 3MD2A 5BPIA 2F5CA 4RS8A 5FGMA 3SHFA 2L9VA 3FXQA 1VFCA 1SEUA 1GXPA 3P9KA 1W4MA 3DPTA 3ELKA 2ZB9A 1ZR4A 1OCOH 1Y0NA 2V1NA 1YW9A 4ETSA 3JREA 5HVQC 2ACJA 2ZXJA 5J8FA 3CLQA 3MEXA 1BOAA 4M9XA 1AKHB 3NWSA 2M3AA 5HNHA 4MIMA 2DOFA 1TC3C 3HEFA 3BZ6A 1T0FA 3CD6I 5GPAA 3EUAA 5K1YA 3CDLA 3REOA 4E7SA 3R60A 4M71A 5FRNA 2ESNA 3ABKH 3Q3SA 2VPRA 2EZKA 3BQZA 1D5VA 2QQAA 2XASA 3ZMVA 1ONVA 2D1HA 1B6AA 1G59A 2R4GA 3ZQ7A 4HBLA 4JX4A 1ZQ3P 1UJ8A 5B1BH 5DM7F 1JUPA 4GCVA 3RKXA 1XMXA 4XR6A 2DT5A 1IXRC 1FIAA 3HOUJ 5BS6A 4C3JJ 1Z3XA 1OJLA 2IEKA 3J7AO 2KT0A 4HX8A 2HOTA 1X1CA 2WBMA 3HG9A 4RM2A 3OIQA 2QSGX 3DKWA 1FOYA 2XHKA 3DKYA 2P7CB 1TWHJ 3GEZA 2IS1A 3RI4A 1BIBA 3SEZA 4AYBN 2FXAA 4BHCA 4YFNF 3FX3A 1SD7A 3ECHA 2I8DA 2CYYA 1HSJA 1G3WA 3TO7A 2EBIA 2EFQA 3FDYA 1R00A 1BN5A 3GVAA 3T8RA 2XF6A 4B8XA 4RGXA 2BY0A 4OAZA 1J09A 5F0CA 1MMDA 1YE9A 1TNSA 2MYSA 1D3YA 2M87A 5EYRA 3CCRI 2CS3A 4MGRA 2JUGA 4IRHA 1U5TB 1QHHD 4HV6A 4HSRA 2QM3A 2BY1A 2DA5A 1MBJA 2DDAA 3ZP5A 4UHTA 2M34A 2X0LA 1SVLA 1QVUA 2RC4A 4E7KA 2V9PA 3D0SA 2X6YA 4LD5A 4CCOA 3IRQA 5ICFA 5HODA 1IV6A 3KEOA 4IKFA 1RETA 1ZAOA 1XMKA 1MJ9A 4FASD 5DDGA 2HS5A 1FPQA 4OAYA 2WAQN 4XLCA 5M5YJ 3J80K 3CMEI 1P9QC 2P5KA 4DGWB 4I09A 5J3LA 4HG2A 1FX7A 5M3FJ 3M1CA 4A93J 3L2VA 2XGEA 4X1EA 3EUHC 4NQWA 1WH7A 2L7FP 5CQEA 5BMZA 1JKPC 1N78A 3H5AA 1FOKA 4IO9F 5EF6A 1DUXC 1SANA 2YSRA 3GTMJ 3FF5A 3J7YJ 4PFPA 3QP6A 4JX6A 4A0ZA 1HKQA 4IL6C 3L09A 2UZKA 2C6YA 2XC7A 5H6QA 4OIOF 3HPGA 3FXJA 2B63J 2PMHA 2DQLA 2H8RA 4YRVA 1I1GA 2OBPA 2QUFA 4BJTA 2EB7A 2YS9A 3K4LA 2W4SA 1TTYA 2XUBA 2AS5F 4GGGA 3GYHX 4G7ZF 1IN6A 2RQPA 4JP0A 5H20A 2JRMA 3VFZA 1T38A 4RA2A 4LLNA 1IJWC 3SZPA 2F6CA 2PQ8A 2VC0A 3F8FA 2R7OA 1ITYA 1BI1A 2ZXHA 1OYYA 1U78A 1B1BA 1FYMA 3WTUC 2QQ9A 2GA1A 2XAFA 1ULYA 1IN4A 4J19A 1XG1A 4AIJA 2TCTA 3FBNB 1DU0A 3CC2I 2BY3A 3LAJA 4HF0A 4Y52J 3PJRA 4GYGA 2E5ZA 1B59A 4ZYHA 4A3GJ 1OFCX 3NAUA 2OJED
chains in the Genus database with same CATH topology
2DA1A 4XRSG 1ZTRA 2JJ7A 2ECCA 1ETQA 1UG2A 4UUSB 2LD5A 4A3DJ 2AHQA 3H3VK 1ETKA 1D5YA 3TW7A 2EZIA 1ZGWA 4BY1J 1G2HA 1K61A 1W0UA 2GBYA 3TW6A 5IOZA 2ID6A 3D1NI 1IG7A 2NS8A 3UKGA 2FQ4A 3Q0WA 2CQQA 3RKQA 3I4MJ 5J1UA 3OSGA 2COBA 1U8BA 2LR8A 4FTHA 2CRGA 1MBHA 2KDZA 3HKZN 3BTIA 1YRNB 2E2HJ 2HDDA 3Q0UA 9ANTA 4ABZA 2FX0A 3RZDJ 4B3AA 5IYBJ 4FE7A 3DCFA 5F0HA 1TWAJ 3JRGA 1JT0A 3HOWJ 3VPRA 2LY9A 3GTLJ 1MBGA 2I10A 2M9HA 1OCTC 3S1RJ 2W48A 3S2DJ 5DS9A 3C2BA 3A01B 1AKHA 1RESA 1S7EA 2JA7J 2DMTA 1VNDA 3O8HA 4UUTA 2XPVA 5FKLA 1IDZA 1A6IA 1BJZA 2R5YB 5J1RA 1IDYA 3CMYA 2XB5A 3O8GA 4CYCB 1AU7A 3HGGA 3BR1A 5BNGA 3HM5A 2X6OA 4D7MA 4D5FA 2DTZA 4FISA 4M3DA 1MBFA 1B8IA 1IC8A 4X6AJ 3PO2J 5JLWA 2L0KA 1BW5A 5M3MJ 1K83J 1T56A 1X58A 2VI6A 3HB9A 4FCYA 5JLXA 1E3OC 4IHXA 3S2HJ 2EQRA 3HDDA 5EEAA 2JK3A 5DTDA 4A3BJ 3HOXJ 1PUFB 1I50J 2WV1A 1JUMA 1HLVA 2IBDA 3S17J 1DU6A 2R5ZB 1BL0A 2R7ZJ 4QSHA 2XB0X 1JT6A 3CQZJ 2NVTJ 2DA7A 4M3EA 1ETOA 2CU7A 2Y9YA 2GLOA 2YUSA 3NARA 1ZR2A 4DYQA 2LK2A 4RDUA 3OIOA 3SJMA 3ZQHA 1GVDA 2EZLA 2MSYA 2EZHA 2R5YA 3A02A 3BR0A 3JR9A 4XIDA 2HQ5A 3GTKJ 4QTRA 4BY7J 4BBSJ 3RZOJ 2N8GA 5EDNA 2P81A 5F1JA 1W0TA 1NTCA 2HXIA 5IYCJ 4L5EA 1SFOJ 2Y31A 2G0EA 4FE4A 1TWCJ 1MSFC 2XPWA 1JTXA 2DJNA 5IP6A 4DYRA 1WH5A 5EG0A 3TP3A 2JN6A 5K7ZA 2DMQA 5EZHA 1MSEC 2GM4A 3GTOJ 3L1PA 3FIWA 1HDPA 3JRIA 4BBRJ 2K9SA 2JA5J 4B4CA 1T33A 4AC0A 2LLKA 5F08A 3FKIJ 1FTTA 4Y7NJ 1Z77A 1RKWA 2CJJA 1CQTA 4EEFG 2WB1N 4A3JJ 2JA6J 1U9OA 3IH2A 5FKMA 3BR6A 2DA4A 4QIWN 3ZQIA 2CUFA 4MFEA 3HOYJ 1Z0XA 3MN2A 1ETVA 2NOGA 3WHBA 3S16J 3TEDA 2VKEA 1Y1VJ 3ZQGA 3QPSA 1IUFA 1O4XA 3IV5A 5FKOA 2R92J 5GPCA 3RQIA 5IOYA 4AUXA 1AHDP 4S0HB 2VUMJ 4D7NA 4A3FJ 3GTPJ 4IHWA 5EGOA 1GUUA 3BG5A 5FLVA 2HOSA 3GTGJ 2OPTA 3K7AJ 2CQXA 4A3EJ 2YU9J 4GFBA 4M6VA 5M5WJ 5IP7J 4MO7A 3BTJA 3ZOBA 1EF4A 4DZJA 1VI0A 1HOMA 1WGXA 3JRFA 2VKVA 1LE8A 1MBKA 4NDLA 4JYKA 4M3GA 3LSPA 5C4JJ 4XK4A 3LSJA 2L9RA 3G1OA 1NK3P 2XGDA 4UUSA 4IHYA 3GBGA 2L7MP 3M4OJ 4A3IJ 3SFIA 3JRHA 4B1RA 4MLOA 3B6CA 3QPLA 3S14J 4G12A 4A3CJ 3BR2A 1I6HJ 2NVXJ 2HI3A 5F0FA 2Y9ZA 2TRTA 1APLC 2QF7A 1YRNA 2ELKA 3H0GJ 3MKLA 1HF0A 5F27A 1X2NA 1U9NA 1GV5A 2M2EA 2ME6A 3ZQCA 2EH3A 2ID3A 3G1MA 1QRYA 4XRMA 2CUEA 2DA3A 2JMWA 4A3MJ 3HGYA 4DZPA 2LKXA 1BA5A 4DW6A 3S1QJ 3SDGA 3A01A 3LOCA 2E1OA 2Y0SN 5FKKA 1WPKA 4C3HJ 2JWTA 1IGNA 4D5CA 5M5XJ 4A3LJ 2LFBA 3K2AA 3GTJJ 3BG9A 1JGGA 2FD5A 4RBOA 4CYCA 1FTZA 1QVTA 2Y30A 5C44J 1RPWA 1GV2A 3ZQLA 3JRDA 2M0CA 1BW6A 2LVSA 1WCMJ 5IPAA 4MFDA 1H8AC 1TWFJ 3S15J 5EZGA 2LP0A 5FKNA 2E2JJ 3LSGA 1ETWA 4IEJA 4C3IJ 1MBEA 2XRLA 3BT9A 3MVPA 3BR5A 3JRAA 2K40A 3BQYA 2L7ZA 5J1YA 3OOUA 1MH3A 2FJ1A 3A03A 2X48A 4JX5A 1VFCA 1PUFA 3QQAA 2ZB9A 1ZR4A 3M3YJ 2MW8A 3JREA 2R5ZA 2PMZN 2E2IJ 2XPUA 1XS9A 1AKHB 4M3FA 4MIMA 3LNQA 3OSFA 1TC3C 3HEFA 4XRSA 5GPAA 3WHCA 2NVYJ 3CDLA 3F0CA 1R9TJ 2O7OA 3Q3SA 2VPRA 2EZKA 3BQZA 4V2FA 1ZKGA 5GP9A 2JA8J 1FIPA 4C2MJ 2NS7A 1JKQC 4BKXA 1ZQ3P 4JX4A 4A69C 1JUPA 2MG4A 1A5JA 1B72B 1FIAA 2DMUA 3HOUJ 1GT0C 1H89C 1UHSA 1X2MA 4C3JJ 1OJLA 1RKTA 4I76A 2IEKA 1B8IB 2XGCA 2KT0A 2HOTA 1LFUP 4V2GA 4I6ZA 1POGA 1TWHJ 3TP0A 3HOZJ 4AYBN 2E19A 4W1UA 1Q1VA 2EBIA 3HBLA 2HYJA 4A3KJ 3S1NJ 3Q0VA 1JJ6C 3S1MJ 1QPIA 2O9LA 3BTCA 3IH4A 5E3MA 2Y2ZA 5F0CA 2DMPA 5E3OA 5C3EJ 1GDTA 3IH3A 3FK7A 2DN0A 5EYRA 2RAEA 4LOCA 3BR3A 1JKRC 3BG3A 1TWGJ 2DA5A 1MBJA 2QCOA 5F04A 2M34A 3BTLA 1QVUA 1HDDC 1VF9A 1ZK8A 1I3QJ 4M3BA 1UMQA 4HNVA 3LSRA 1B72A 5K7FA 5HODA 4W97A 2ME0A 1IV6A 1RETA 3E7LA 2HXOA 2D5VA 3JRBA 1ORKA 5EG0B 3HOVJ 2WAQN 5M5YJ 3ZQFA 1P7JA 5FJ8J 3CCYA 3FISA 5J3LA 5M3FJ 4A93J 2XGEA 2K9NA 1ENHA 2OF7A 4X1EA 3PO3J 1WH7A 2IAIA 2L7FP 1JUSA 2AO9A 4DYCA 1JKPC 2R93J 2H1KA 3FK6A 3W6VA 5EF6A 5IP9J 1SANA 3GTMJ 2M8GX 1F43A 4JX6A 1IRZA 1OCPA 3G1LA 2ECBA 1H88C 2NVQJ 1NK2P 2DMNA 3PM1A 2B63J 2H8RA 1LFBA 1RR7A 1WI3A 3B6AA 1FEXA 5E3NA 1JKOC 2YS9A 1HCRA 2X9DA 2HOAA 5K7HA 2DA2A 4JP0A 1P7IA 1FJLA 1MNMC 1MH4A 3JRCA 2MGQA 5EGOB 1IJWC 5C4XJ 4IHVA 1JJ8C 1ITYA 1F36A 1U78A 3I4NJ 1JTYA 4XICA 5E3LA 1Y1WJ 2DA6A 5FLMJ 4BXXJ 4J19A 1XG1A 1ETXA 2O8KA 2TCTA 2XSDC 3DEWA 1DU0A 5IYDJ 3GTQJ 2K9QA 1XC5A 1LE8B 2LTPA 4Y52J 2R0QC 1ETYA 4A3GJ 1OFCX 3NAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA1 A;  4XRS G;  1ZTR A;  2JJ7 A;  2ECC A;  1ETQ A;  1UG2 A;  4UUS B;  2LD5 A;  4A3D J;  2AHQ A;  3H3V K;  1ETK A;  1D5Y A;  3TW7 A;  2EZI A;  1ZGW A;  4BY1 J;  1G2H A;  1K61 A;  1W0U A;  2GBY A;  3TW6 A;  5IOZ A;  2ID6 A;  3D1N I;  1IG7 A;  2NS8 A;  3UKG A;  2FQ4 A;  3Q0W A;  2CQQ A;  3RKQ A;  3I4M J;  5J1U A;  3OSG A;  2COB A;  1U8B A;  2LR8 A;  4FTH A;  2CRG A;  1MBH A;  2KDZ A;  3HKZ N;  3BTI A;  1YRN B;  2E2H J;  2HDD A;  3Q0U A;  9ANT A;  4ABZ A;  2FX0 A;  3RZD J;  4B3A A;  5IYB J;  4FE7 A;  3DCF A;  5F0H A;  1TWA J;  3JRG A;  1JT0 A;  3HOW J;  3VPR A;  2LY9 A;  3GTL J;  1MBG A;  2I10 A;  2M9H A;  1OCT C;  3S1R J;  2W48 A;  3S2D J;  5DS9 A;  3C2B A;  3A01 B;  1AKH A;  1RES A;  1S7E A;  2JA7 J;  2DMT A;  1VND A;  3O8H A;  4UUT A;  2XPV A;  5FKL A;  1IDZ A;  1A6I A;  1BJZ A;  2R5Y B;  5J1R A;  1IDY A;  3CMY A;  2XB5 A;  3O8G A;  4CYC B;  1AU7 A;  3HGG A;  3BR1 A;  5BNG A;  3HM5 A;  2X6O A;  4D7M A;  4D5F A;  2DTZ A;  4FIS A;  4M3D A;  1MBF A;  1B8I A;  1IC8 A;  4X6A J;  3PO2 J;  5JLW A;  2L0K A;  1BW5 A;  5M3M J;  1K83 J;  1T56 A;  1X58 A;  2VI6 A;  3HB9 A;  4FCY A;  5JLX A;  1E3O C;  4IHX A;  3S2H J;  2EQR A;  3HDD A;  5EEA A;  2JK3 A;  5DTD A;  4A3B J;  3HOX J;  1PUF B;  1I50 J;  2WV1 A;  1JUM A;  1HLV A;  2IBD A;  3S17 J;  1DU6 A;  2R5Z B;  1BL0 A;  2R7Z J;  4QSH A;  2XB0 X;  1JT6 A;  3CQZ J;  2NVT J;  2DA7 A;  4M3E A;  1ETO A;  2CU7 A;  2Y9Y A;  2GLO A;  2YUS A;  3NAR A;  1ZR2 A;  4DYQ A;  2LK2 A;  4RDU A;  3OIO A;  3SJM A;  3ZQH A;  1GVD A;  2EZL A;  2MSY A;  2EZH A;  2R5Y A;  3A02 A;  3BR0 A;  3JR9 A;  4XID A;  2HQ5 A;  3GTK J;  4QTR A;  4BY7 J;  4BBS J;  3RZO J;  2N8G A;  5EDN A;  2P81 A;  5F1J A;  1W0T A;  1NTC A;  2HXI A;  5IYC J;  4L5E A;  1SFO J;  2Y31 A;  2G0E A;  4FE4 A;  1TWC J;  1MSF C;  2XPW A;  1JTX A;  2DJN A;  5IP6 A;  4DYR A;  1WH5 A;  5EG0 A;  3TP3 A;  2JN6 A;  5K7Z A;  2DMQ A;  5EZH A;  1MSE C;  2GM4 A;  3GTO J;  3L1P A;  3FIW A;  1HDP A;  3JRI A;  4BBR J;  2K9S A;  2JA5 J;  4B4C A;  1T33 A;  4AC0 A;  2LLK A;  5F08 A;  3FKI J;  1FTT A;  4Y7N J;  1Z77 A;  1RKW A;  2CJJ A;  1CQT A;  4EEF G;  2WB1 N;  4A3J J;  2JA6 J;  1U9O A;  3IH2 A;  5FKM A;  3BR6 A;  2DA4 A;  4QIW N;  3ZQI A;  2CUF A;  4MFE A;  3HOY J;  1Z0X A;  3MN2 A;  1ETV A;  2NOG A;  3WHB A;  3S16 J;  3TED A;  2VKE A;  1Y1V J;  3ZQG A;  3QPS A;  1IUF A;  1O4X A;  3IV5 A;  5FKO A;  2R92 J;  5GPC A;  3RQI A;  5IOY A;  4AUX A;  1AHD P;  4S0H B;  2VUM J;  4D7N A;  4A3F J;  3GTP J;  4IHW A;  5EGO A;  1GUU A;  3BG5 A;  5FLV A;  2HOS A;  3GTG J;  2OPT A;  3K7A J;  2CQX A;  4A3E J;  2YU9 J;  4GFB A;  4M6V A;  5M5W J;  5IP7 J;  4MO7 A;  3BTJ A;  3ZOB A;  1EF4 A;  4DZJ A;  1VI0 A;  1HOM A;  1WGX A;  3JRF A;  2VKV A;  1LE8 A;  1MBK A;  4NDL A;  4JYK A;  4M3G A;  3LSP A;  5C4J J;  4XK4 A;  3LSJ A;  2L9R A;  3G1O A;  1NK3 P;  2XGD A;  4UUS A;  4IHY A;  3GBG A;  2L7M P;  3M4O J;  4A3I J;  3SFI A;  3JRH A;  4B1R A;  4MLO A;  3B6C A;  3QPL A;  3S14 J;  4G12 A;  4A3C J;  3BR2 A;  1I6H J;  2NVX J;  2HI3 A;  5F0F A;  2Y9Z A;  2TRT A;  1APL C;  2QF7 A;  1YRN A;  2ELK A;  3H0G J;  3MKL A;  1HF0 A;  5F27 A;  1X2N A;  1U9N A;  1GV5 A;  2M2E A;  2ME6 A;  3ZQC A;  2EH3 A;  2ID3 A;  3G1M A;  1QRY A;  4XRM A;  2CUE A;  2DA3 A;  2JMW A;  4A3M J;  3HGY A;  4DZP A;  2LKX A;  1BA5 A;  4DW6 A;  3S1Q J;  3SDG A;  3A01 A;  3LOC A;  2E1O A;  2Y0S N;  5FKK A;  1WPK A;  4C3H J;  2JWT A;  1IGN A;  4D5C A;  5M5X J;  4A3L J;  2LFB A;  3K2A A;  3GTJ J;  3BG9 A;  1JGG A;  2FD5 A;  4RBO A;  4CYC A;  1FTZ A;  1QVT A;  2Y30 A;  5C44 J;  1RPW A;  1GV2 A;  3ZQL A;  3JRD A;  2M0C A;  1BW6 A;  2LVS A;  1WCM J;  5IPA A;  4MFD A;  1H8A C;  1TWF J;  3S15 J;  5EZG A;  2LP0 A;  5FKN A;  2E2J J;  3LSG A;  1ETW A;  4IEJ A;  4C3I J;  1MBE A;  2XRL A;  3BT9 A;  3MVP A;  3BR5 A;  3JRA A;  2K40 A;  3BQY A;  2L7Z A;  5J1Y A;  3OOU A;  1MH3 A;  2FJ1 A;  3A03 A;  2X48 A;  4JX5 A;  1VFC A;  1PUF A;  3QQA A;  2ZB9 A;  1ZR4 A;  3M3Y J;  2MW8 A;  3JRE A;  2R5Z A;  2PMZ N;  2E2I J;  2XPU A;  1XS9 A;  1AKH B;  4M3F A;  4MIM A;  3LNQ A;  3OSF A;  1TC3 C;  3HEF A;  4XRS A;  5GPA A;  3WHC A;  2NVY J;  3CDL A;  3F0C A;  1R9T J;  2O7O A;  3Q3S A;  2VPR A;  2EZK A;  3BQZ A;  4V2F A;  1ZKG A;  5GP9 A;  2JA8 J;  1FIP A;  4C2M J;  2NS7 A;  1JKQ C;  4BKX A;  1ZQ3 P;  4JX4 A;  4A69 C;  1JUP A;  2MG4 A;  1A5J A;  1B72 B;  1FIA A;  2DMU A;  3HOU J;  1GT0 C;  1H89 C;  1UHS A;  1X2M A;  4C3J J;  1OJL A;  1RKT A;  4I76 A;  2IEK A;  1B8I B;  2XGC A;  2KT0 A;  2HOT A;  1LFU P;  4V2G A;  4I6Z A;  1POG A;  1TWH J;  3TP0 A;  3HOZ J;  4AYB N;  2E19 A;  4W1U A;  1Q1V A;  2EBI A;  3HBL A;  2HYJ A;  4A3K J;  3S1N J;  3Q0V A;  1JJ6 C;  3S1M J;  1QPI A;  2O9L A;  3BTC A;  3IH4 A;  5E3M A;  2Y2Z A;  5F0C A;  2DMP A;  5E3O A;  5C3E J;  1GDT A;  3IH3 A;  3FK7 A;  2DN0 A;  5EYR A;  2RAE A;  4LOC A;  3BR3 A;  1JKR C;  3BG3 A;  1TWG J;  2DA5 A;  1MBJ A;  2QCO A;  5F04 A;  2M34 A;  3BTL A;  1QVU A;  1HDD C;  1VF9 A;  1ZK8 A;  1I3Q J;  4M3B A;  1UMQ A;  4HNV A;  3LSR A;  1B72 A;  5K7F A;  5HOD A;  4W97 A;  2ME0 A;  1IV6 A;  1RET A;  3E7L A;  2HXO A;  2D5V A;  3JRB A;  1ORK A;  5EG0 B;  3HOV J;  2WAQ N;  5M5Y J;  3ZQF A;  1P7J A;  5FJ8 J;  3CCY A;  3FIS A;  5J3L A;  5M3F J;  4A93 J;  2XGE A;  2K9N A;  1ENH A;  2OF7 A;  4X1E A;  3PO3 J;  1WH7 A;  2IAI A;  2L7F P;  1JUS A;  2AO9 A;  4DYC A;  1JKP C;  2R93 J;  2H1K A;  3FK6 A;  3W6V A;  5EF6 A;  5IP9 J;  1SAN A;  3GTM J;  2M8G X;  1F43 A;  4JX6 A;  1IRZ A;  1OCP A;  3G1L A;  2ECB A;  1H88 C;  2NVQ J;  1NK2 P;  2DMN A;  3PM1 A;  2B63 J;  2H8R A;  1LFB A;  1RR7 A;  1WI3 A;  3B6A A;  1FEX A;  5E3N A;  1JKO C;  2YS9 A;  1HCR A;  2X9D A;  2HOA A;  5K7H A;  2DA2 A;  4JP0 A;  1P7I A;  1FJL A;  1MNM C;  1MH4 A;  3JRC A;  2MGQ A;  5EGO B;  1IJW C;  5C4X J;  4IHV A;  1JJ8 C;  1ITY A;  1F36 A;  1U78 A;  3I4N J;  1JTY A;  4XIC A;  5E3L A;  1Y1W J;  2DA6 A;  5FLM J;  4BXX J;  4J19 A;  1XG1 A;  1ETX A;  2O8K A;  2TCT A;  2XSD C;  3DEW A;  1DU0 A;  5IYD J;  3GTQ J;  2K9Q A;  1XC5 A;  1LE8 B;  2LTP A;  4Y52 J;  2R0Q C;  1ETY A;  4A3G J;  1OFC X;  3NAU A; 
#chains in the Genus database with same CATH topology
 3K4C A;  4XRS G;  4KMU X;  3D5S C;  3LQR A;  4LGW A;  1ETQ A;  2LD5 A;  2HVR A;  4A3D J;  2HPM A;  4XLH A;  2DK8 A;  2QGU A;  2EZI A;  5LD2 C;  1W0U A;  4EGZ A;  3TW6 A;  4CCN A;  2FQ4 A;  4E70 A;  2GIZ A;  3ZXS A;  3CCL I;  3RKQ A;  1MMS A;  1V5G A;  2HDD A;  3KZY A;  2IGN A;  9ANT A;  4ABZ A;  1XGO A;  5KAF C;  4B3A A;  3DCF A;  3F23 A;  3HRT A;  1K4S A;  3L00 A;  1TWA J;  1JT0 A;  2I5U A;  4EAT A;  3GX4 X;  4BXU A;  2JRT A;  2FBK A;  2LY9 A;  1IXS B;  2XAH A;  1MND A;  4KA4 A;  2M9H A;  1OCT C;  1D8K A;  1O57 A;  5FD5 A;  5DS9 A;  3C2B A;  3BY6 A;  4LMY A;  3HOS A;  4D0P A;  2FF4 A;  1RRJ A;  4QPQ A;  4UUT A;  2XPV A;  2QWW A;  1JI8 A;  1J9I A;  1F4K A;  2KHM A;  4I2O A;  5FRO A;  2NOJ B;  2L9S A;  3P7N A;  2R5Y B;  5ED4 A;  1LJ9 A;  2KRC A;  5J1R A;  4BE1 A;  3HGG A;  1WJB A;  1VQK I;  3WTW C;  1A36 A;  1IW7 F;  1RZ4 A;  2Z1D A;  4G8X A;  3EUK L;  4JBA A;  1XSV A;  3HM5 A;  3FMQ A;  1E3P A;  4D5F A;  3FBI B;  3LAP A;  2DTZ A;  3DLA A;  1S6L A;  3MWM A;  4U0V A;  4XL9 A;  3BG6 A;  1MBF A;  1YLF A;  1ZRE A;  3VB2 A;  4XLE A;  2VOD A;  3C1D A;  2EFO A;  4U87 A;  3ZN0 A;  1FBQ A;  2LC2 A;  4BNC A;  5M3M J;  5CYV A;  2VI6 A;  3HB9 A;  2LDU A;  1E3O C;  2VOP A;  2VN2 A;  5EEA A;  2MH9 A;  1ZEL A;  2H8W A;  1T8I A;  4LIT A;  1JUM A;  3S17 J;  1DU6 A;  1BL0 A;  4DOZ A;  4QSH A;  2IVM A;  2DW4 A;  2XB0 X;  1JT6 A;  1RNL A;  2DU9 A;  3PNT A;  3G4S I;  5AIQ A;  4F52 A;  2Q1Z B;  1X1A A;  2Y9Y A;  5F64 A;  2DFF A;  1QU3 A;  5J4Y A;  2M8E A;  2K3P A;  2LMD A;  2Y75 A;  1A6Q A;  2YUS A;  3R61 A;  1IZ1 A;  4EMS A;  1JE8 A;  1BOB A;  1KU2 A;  4EGY A;  2K3F A;  4HQM A;  1GVD A;  5GTI C;  2EZL A;  3H92 A;  4N4O B;  1C0W A;  2DT6 A;  3BR0 A;  2PJR A;  3SDB A;  1X4O A;  3GTK J;  2DPD A;  5B66 C;  3J7A Y;  2N8G A;  5D8L B;  4J00 A;  4D9J A;  4LG0 B;  2R7R A;  2HXI A;  2KZG A;  4R79 A;  2Y31 A;  1XSD A;  4RAZ A;  4TV7 A;  3EYY A;  2F5V A;  2O0Y A;  4XQF A;  4F3Q A;  1MMN A;  1SD5 A;  4RAF A;  2CW8 A;  2VQL A;  5IP6 A;  2ELH A;  4B09 A;  4DYR A;  1TZL A;  2AXT C;  2GQQ A;  1WH5 A;  2HZT A;  3DU6 A;  5EG0 A;  1W36 D;  4F55 A;  1J59 A;  2BHY A;  2JN6 A;  2WC2 A;  4IHT A;  2ZNZ A;  2ELJ A;  4HRI A;  3RYP A;  3SEQ A;  3WG9 A;  5EZH A;  3S93 A;  2GM4 A;  1S8N A;  5GAD J;  3L1P A;  3G2B A;  1HDP A;  2QZ8 A;  2LY2 A;  3OWT A;  4B4C A;  1T33 A;  1S72 I;  2LLK A;  3FKI J;  1FTT A;  1J7K A;  4Y7N J;  4E6K G;  1OCR H;  1RKW A;  2CJJ A;  4BXF A;  1CQT A;  4EEF G;  4BYY A;  1S3J A;  4ITV A;  5KCM A;  4A3J J;  5FKM A;  2UWM A;  4HV5 A;  3ZN1 A;  2Z2S B;  4CCL A;  1H0M A;  1FSH A;  3I54 A;  4J01 A;  3E5Q A;  1ETV A;  2VKE A;  1VQ9 I;  3ZQG A;  1QZE A;  3S3M A;  2X85 A;  5B1A H;  2A6E F;  4OMY A;  1XTA A;  3L2C A;  2EV6 A;  2E1C A;  5GPC A;  2R92 J;  3RQI A;  3I58 A;  5IOY A;  3LWF A;  2V26 A;  3VYR B;  1TL8 A;  4G6Q A;  2QKL B;  5FLV A;  3LST A;  3GTG J;  2DFE A;  2OPT A;  2CQX A;  1VTN C;  1SAX A;  2D1V A;  3SXY A;  2CFO A;  3KP2 A;  3I56 I;  4MO7 A;  3Q5F A;  3BTJ A;  2V9V A;  4XSZ F;  4NQW B;  2WWY A;  4BJ5 C;  1VQ8 I;  1OYI A;  3KFW X;  4HX7 A;  2FMY A;  3PIP F;  3C2G A;  2DI3 A;  2HGC A;  2KIQ A;  3LSJ A;  3G1O A;  4YG2 F;  3KEQ A;  2XGD A;  1NK3 P;  2F5E A;  1HST A;  5HS7 A;  4PJL A;  1KQ8 A;  1V5F A;  3M4O J;  4UUV A;  3F3X A;  2OCC H;  4Y15 A;  3OYL A;  1F1Z A;  1N77 A;  2BE5 F;  2M4G A;  4MLO A;  2WAD A;  3S14 J;  1X1B A;  1W36 C;  1K6Y A;  4A3C J;  3QAH A;  2G7U A;  1FOX A;  4YFK F;  2QBY A;  5F0F A;  4P96 A;  4Q48 A;  2V9K A;  2FBH A;  2KIM A;  2ESH A;  1MMA A;  4UVA A;  3H0G J;  1BR2 A;  2ISZ A;  3QYE A;  4CYD A;  1HF0 A;  1X2N A;  3ASN H;  4L9T A;  3MZY A;  4NHJ A;  3ZQC A;  3WG7 H;  1MJA A;  1QRY A;  1S9H A;  3KP5 A;  2A68 F;  2CUE A;  1WHU A;  2JMW A;  2RKH A;  4KNY A;  3OYE A;  3TO9 A;  3S1Q J;  5DUK A;  1VQN I;  2WB1 A;  3CCU I;  4AIH A;  2VJI A;  3DLL F;  2F2E A;  3LOC A;  3OYB A;  1TT5 B;  5L3C A;  4KDP A;  2JWT A;  3H9J A;  4N4N B;  3PFY A;  2ZJ2 A;  2FD5 A;  1EJ9 A;  4CYC A;  1HXD A;  1RPW A;  3HJE A;  1GV2 A;  1Z7U A;  3MZ8 A;  5D6F A;  1QHG A;  3K69 A;  3E6C C;  2M0C A;  3FMR A;  1LKX A;  4DJA A;  5JHF A;  3L9F A;  3W6J B;  3H9Q A;  4D1Q A;  2NNY A;  1YYV A;  5HLI A;  2LP0 A;  5FKN A;  3HOT A;  2Z33 A;  4AM3 A;  2E2J J;  5CVI A;  3S3N A;  1FLI A;  3HRM A;  3A1Y A;  1G3T A;  3MVP A;  3GXO A;  4BL0 B;  3V7C A;  4P55 A;  2EFW A;  3IWZ A;  5GAH J;  1OLT A;  1MH3 A;  2FJ1 A;  1TNT A;  3A03 A;  1QBJ A;  2WV0 A;  4UB6 C;  1KZH A;  2L9N A;  1ON2 A;  2QQ8 A;  3QQA A;  4MEY F;  5FLX Z;  1XX5 A;  2PMZ N;  2XPU A;  5E8G A;  1XS9 A;  3HTS B;  5L3B A;  1P6R A;  3RJP A;  4B3X A;  1Y8Q B;  1MMG A;  3ERE D;  4ZDP A;  2IT0 A;  2HZD A;  2QKM B;  3WHC A;  5L3E A;  3TOB A;  2NVY J;  5BQT A;  4E7J A;  2O7O A;  2DOA A;  2LKS A;  1ZG5 A;  2QQB A;  4V2F A;  5GP9 A;  5GAG J;  4XKB A;  5J6X A;  1FIP A;  4BKX A;  4CXF A;  2ZXI A;  1I3A A;  1R6R A;  1AOY A;  2A5Y B;  3PNY A;  2A07 F;  2MG4 A;  4K2E A;  1HW2 A;  1B72 B;  1DPU A;  2DMU A;  1T6S A;  4C2T A;  1GT0 C;  1X2M A;  2CMP A;  1RKT A;  3TQN A;  4RAY A;  2XGC A;  3ZMU A;  3S8P A;  1STZ A;  1X3W B;  1FBS A;  4I6Z A;  1BM9 A;  1ZG3 A;  1FNN A;  1R23 A;  3HOZ J;  4QWQ A;  5E8I A;  3GFM A;  4WWC A;  1XSX A;  1Q1V A;  3WTS C;  1EV7 A;  4HAM A;  2OQG A;  1MNE A;  2VQH A;  2W85 A;  2FU4 A;  4ZDL A;  4II2 A;  3J81 Z;  3GLX A;  1JJ6 C;  3S1M J;  2P8T A;  4V19 K;  2W82 A;  4M6Y A;  1QPM A;  3BTC A;  1FP2 A;  3IH4 A;  4N0B A;  2DMP A;  3OYD A;  3OYI A;  4PK4 A;  5C3E J;  4BHB A;  3CMM A;  4RM3 A;  3IH3 A;  3E6B A;  3COA C;  1UCR A;  4UVB A;  2E7X A;  5TIS C;  4ESJ A;  2RAE A;  3DEE A;  1KQ9 A;  2DYR H;  5HDG A;  4LOC A;  5CKT A;  2QA4 I;  4PDK A;  1O3S A;  5LBQ A;  2QCO A;  2PJR B;  2KP6 A;  3IC7 A;  2OC6 A;  1ZK8 A;  3E97 A;  4XOR A;  1WKM A;  5FB2 A;  3D5R C;  2OU2 A;  3K4J A;  5GAE J;  1ERD A;  4AWX B;  2DK5 A;  3E3V A;  4ZC3 A;  4XLP F;  4PFO A;  3JSO A;  5DD8 A;  3QYB A;  5EG0 B;  4CZC A;  1VQ6 I;  2M0M A;  3CCM I;  1QA6 A;  3M8F A;  3CCY A;  2R7F A;  1DGW Y;  3C7J A;  3GME A;  3DBR B;  3I0T A;  2DLL A;  3WE2 A;  3NWT A;  3V8J A;  3B73 A;  2OF7 A;  3PO3 J;  1L3L A;  1JUS A;  2R93 J;  4IOC F;  1P4A A;  3FK6 A;  4Q5S F;  2Z3Y A;  1AWC A;  1ZN2 A;  5BPD A;  3FWE A;  3OOP A;  5LLQ A;  1WI9 A;  5IP9 J;  5H2F C;  3F9K A;  1IN7 A;  3G1L A;  1K78 A;  2ZME A;  4CZZ A;  2J5O A;  3FM3 A;  3NEU A;  1TQI A;  4PZJ A;  2DT7 B;  3OS1 A;  1UG0 A;  2DMN A;  2X4H A;  1U5T C;  2XAQ A;  1R49 A;  3O6B B;  3B6A A;  2FSW A;  1FEX A;  4I02 A;  4AYB A;  1REP C;  2QSH X;  1QQI A;  1WJE A;  2HTJ A;  3L7W A;  5FO5 A;  4A12 A;  4XLN F;  2EFN A;  1HCR A;  1ZYR F;  2HOA A;  2GOX B;  2DA2 A;  1SFK A;  2ZFU A;  1P7I A;  3CCV I;  1MH4 A;  1R5I D;  2MGQ A;  3KZI C;  4PCQ A;  3N97 A;  3KX2 A;  3ZGK A;  4BGD A;  4U7D A;  2IGM A;  5FD6 A;  3OYF A;  3U9G A;  4HNT A;  3I4N J;  4EVI A;  5E3L A;  4XIC A;  1Y1W J;  1PDN C;  2VKD A;  1LDJ A;  2R7D A;  2RNG A;  3DEW A;  1KYW A;  2IGO A;  1G3Y A;  3GTQ J;  2K9M A;  4FX0 A;  3VSK A;  4XN3 A;  3DQV C;  3BWG A;  3NQO A;  2R0Q C;  1N75 A;  1ETY A;  3EPZ A;  2Z5U A;  5TJJ A;  3G3Z A;  5DV5 A;  5EEG A;  2DYS H;  2K7L A;  2ECC A;  3T1B A;  1QZZ A;  1YG2 A;  1Y0U A;  2K02 A;  4MQV A;  3CP8 A;  3ABM H;  4RB3 C;  2PJP A;  5HS9 A;  1Z6T A;  1G4D A;  1VQL I;  5IOZ A;  1Y8R B;  2ID6 A;  5EJC A;  3D1N I;  1IG7 A;  4Z2Y A;  3UKG A;  3K4N A;  1P2F A;  3DTE A;  5JFR A;  2CQQ A;  5AON A;  5HLG A;  2L5Q A;  2WAQ A;  4KN4 X;  3I4M J;  3PIO F;  4UNO A;  2QBY B;  3BP8 A;  3F8C A;  2LR8 A;  4FTH A;  2EIN H;  2KDZ A;  4L9V A;  1D8J A;  2NXN B;  3BTI A;  2F48 A;  1AA7 A;  4PGH A;  2HTS A;  2IW5 A;  3RZD J;  4FE7 A;  1XGM A;  1ZH5 A;  2BXZ A;  5F0H A;  4S05 A;  4EV0 A;  3JRG A;  3HOW J;  1I27 A;  1LNW A;  3GTL J;  2LBF A;  3SZT A;  3WE3 A;  2DCE A;  2EV5 A;  2CUZ A;  2JTV A;  3RYR A;  3MQ0 A;  1S7E A;  2JA7 J;  2DMT A;  4Y17 A;  3BC8 A;  4RB1 A;  2H94 A;  1IDZ A;  3HSR A;  2KLO A;  3JSP A;  1E2X A;  3OR1 C;  1CF7 A;  1JXS A;  2KIS A;  3WOD F;  1IDY A;  3CMY A;  1Z91 A;  2XB5 A;  3GWZ A;  3O8G A;  4CYC B;  2KZV A;  2O8X A;  1AU7 A;  3KYL A;  2E1N A;  4M9Z A;  4WXH A;  4PJN A;  2XGX A;  5BNG A;  5ICG A;  2X6O A;  1YO5 C;  4OOI A;  2YX4 A;  1USS A;  4EJW A;  2PG4 A;  3O3K A;  5KVR A;  3EYI A;  2VBY A;  1D0X A;  3CDH A;  1X3Z B;  1B8I A;  5K5Q A;  5LHG A;  3OS0 A;  2MC3 A;  1IC8 A;  4WXC A;  2L0K A;  2ZSI B;  1F9N A;  1K83 J;  4FCY A;  2YR2 A;  4JOM A;  3S2H J;  5DM6 F;  2EQR A;  3K4K A;  2EFP A;  3FXL A;  1Y56 A;  3HOX J;  1I50 J;  4UY8 I;  1YI2 I;  2VL8 A;  1HLV A;  2IRF G;  3HZJ A;  1YFH A;  1RUO A;  3RPU A;  1RIO H;  1IF1 A;  3QU6 A;  4HLY A;  1WRJ A;  3PFI A;  2STW A;  2XVC A;  3CQZ J;  2NVT J;  2E36 A;  3D5L A;  3KP4 A;  3PSF A;  4YII A;  1ZRD A;  4HX4 A;  2E34 A;  3LA3 A;  2IPQ X;  1WQ2 A;  4DQ2 A;  1LPQ A;  4IVN A;  4MQ9 F;  2LK2 A;  5E1W A;  3ZQH A;  2OAZ A;  1WVR A;  5FFX A;  3H3U A;  5H6R A;  4F92 B;  3CF2 A;  2EZH A;  5CVR A;  2Z99 A;  2L2O A;  5E17 F;  2WY7 Q;  3GCM A;  1T2K A;  4BY7 J;  1LEA A;  4JK1 X;  5EDN A;  2P81 A;  5F1J A;  1SD4 A;  1FBU A;  1W0T A;  5IYC J;  3OYM A;  1SFO J;  3H9G A;  3KP6 A;  1ZGA A;  4R8H A;  4KFC A;  2DJN A;  4P1W A;  4RLF A;  2VLA A;  1XD7 A;  2IP2 A;  3CUQ A;  2DO7 A;  4ASN A;  4G6T B;  3TP3 A;  4JQF A;  3CO6 C;  3GFJ A;  5K7Z A;  3H1C A;  2A6H F;  3IWF A;  4PSW A;  2M7B A;  1ZLJ A;  2HKX A;  3FIW A;  5TGT A;  4KYW A;  4BBR J;  3WTY C;  3RQ4 A;  2VJ4 A;  1S7O A;  2BY2 A;  4AC0 A;  1Z77 A;  1X4P A;  2HU9 A;  3K9T A;  3B02 A;  2JA6 J;  3QWL A;  3IH2 A;  3BR6 A;  2DA4 A;  1VZ0 A;  1DPR A;  1T0F C;  2IGK A;  2CUF A;  3CO7 C;  3W3C A;  3HOY J;  1Z0X A;  3WHB A;  2NOG A;  1KYZ A;  4UB8 C;  3K1P A;  4LK1 F;  2DOD A;  2FOW A;  2P7V B;  4WX9 A;  4HDV A;  1IUF A;  1YW7 A;  3E6M A;  4MHG A;  3IV5 A;  2PFB A;  3C18 A;  2EIM H;  3FXR A;  1KON A;  4OIN F;  4ENK A;  1AHD P;  4S0H B;  2VUM J;  3KET A;  4D7N A;  4A3F J;  1FP1 D;  3DV8 A;  4C2U A;  1Z67 A;  2Y0M A;  4QLC U;  2GXB A;  1YX5 A;  1YHQ I;  4YEJ A;  2YU9 J;  4XRF A;  5IP7 J;  4IQ4 A;  3BCA A;  2ZFW A;  2G7H A;  3F72 A;  3ZOB A;  2XKP A;  3FXK A;  1W1W E;  1VI0 A;  3X2Q H;  1UFM A;  3CJN A;  4BE2 A;  1WGX A;  2CQ7 A;  2VT3 A;  1RI7 A;  3JRF A;  3TMO A;  2GWR A;  1LE8 A;  4NDL A;  3DPL C;  3HHG A;  4M3G A;  4Y3O A;  3VDX A;  3MKZ A;  1SC7 A;  3V8K A;  4UUS A;  3NRV A;  1K78 B;  2CWE A;  3GBG A;  3SZG A;  1QO0 D;  4HF1 A;  3CDI A;  4B1R A;  5KK1 A;  3BZC A;  2STT A;  4G12 A;  4IXA A;  4M6X A;  5ILU A;  3BR2 A;  1I6H J;  3ABT A;  4LIV A;  3K0L A;  3M8J A;  1YIJ I;  2NYX A;  1APL C;  1YRN A;  1V4R A;  2FQ3 A;  5CLS A;  2ZJQ F;  1Z05 A;  2JPC A;  4BE0 A;  3MKL A;  2O61 A;  3IKT A;  3S2W A;  4O5V A;  1ZRF A;  2CUJ A;  2ME6 A;  2EH3 A;  2ID3 A;  4XRM A;  3L2R A;  3OYJ A;  3HGY A;  2LKX A;  4PGG A;  3K2Z A;  3SDG A;  5TRD A;  2F4M B;  2JUC A;  3A01 A;  1R5H A;  2LOO A;  2ZCW A;  2K85 A;  5E1X A;  3FKJ A;  2CV0 A;  2Y0S N;  4PJJ A;  5IT9 Z;  1WPK A;  2D45 A;  1IGN A;  2PN6 A;  2ZSH B;  3W2V A;  2VON A;  3V42 A;  2R7T A;  1IV8 A;  3BG9 A;  1FC3 A;  1JGG A;  4A5M A;  1QVT A;  3R0A A;  2IA2 A;  3JAM Z;  3ZQL A;  2LF7 A;  4B48 A;  4NNJ A;  1O3R A;  1WCM J;  2XF7 A;  1BBY A;  1TWF J;  3S15 J;  3I5U A;  2VJ5 A;  4XSX F;  5JVT A;  4HZF A;  3DTI A;  1FWZ A;  1VQ7 I;  4M73 A;  3P5J A;  4C3I J;  1N25 A;  2FNA A;  1KGS A;  4A2U A;  4CO8 A;  4H4K C;  2COM A;  1I1S A;  3PSI A;  5JVG F;  2K40 A;  3DF8 A;  4LJZ F;  1PYV A;  2LSO A;  4L5J A;  3EQL F;  2LYC A;  1SFX A;  2X48 A;  2E60 A;  3HL2 A;  2K9L A;  2HWV A;  1PUF A;  3CCJ I;  3M3Y J;  3I9V 2;  1BJA A;  2A05 A;  2CGP A;  2LBF B;  1BC8 C;  2R5Z A;  2E2I J;  1MZB A;  4EJU A;  4FHT A;  4AIK A;  1OPC A;  2PI0 A;  2EIL H;  4E4H A;  2P6S A;  2ZC2 A;  1P4X A;  1YX3 A;  4M3F A;  2AQF A;  3WTV C;  2EA4 A;  2R7S A;  3P9I A;  1CF7 B;  3F0C A;  3L2W A;  1S5L C;  2CW7 A;  4IRI A;  4G7H F;  1ZKG A;  3I64 A;  3I3L A;  1JKQ C;  2HFH A;  2NS7 A;  4I99 C;  4A69 C;  2KIU A;  1IXC A;  3ZCO A;  4CHU A;  3IRR A;  2CSO A;  4NC6 A;  3RPQ A;  2LH9 A;  1EKE A;  1K4T A;  4O6J A;  3ESW B;  4XN0 A;  3E0J B;  2E35 A;  5KHD A;  4I76 A;  3GLL A;  2XSJ C;  1B8I B;  4L9N A;  4LIU A;  4Y33 A;  1T08 B;  1D0Z A;  4I01 A;  4HNU A;  4V2G A;  4ENM A;  5ICE A;  1Z9C A;  2RVC A;  1POG A;  1ACI A;  3CCE I;  4XLA A;  3HSE A;  1W5C C;  2E19 A;  4DBQ A;  1Z3Y A;  2CH0 A;  5DD4 A;  3K4B A;  3ASO H;  2VE8 A;  5LGN A;  2VQG A;  2M4K A;  2HYJ A;  3BJ6 A;  3HBL A;  3S1N J;  1YJW I;  2ADU A;  2X6X A;  2HKO A;  4XBF A;  1ODD A;  1R4M B;  2W24 A;  1GDT A;  3RDI A;  4GRI A;  2MA3 A;  2EJR A;  5DYM A;  4UXN A;  4LFU A;  1QGP A;  5HDN A;  1TWG J;  3BG3 A;  1WJD A;  4RLQ A;  5F04 A;  4G6D A;  2A5W A;  3BTL A;  4NC8 A;  2KJC A;  4G9Y A;  3L2U A;  4AID A;  1UMQ A;  5KNL A;  5DUI A;  2A3S A;  2CW0 F;  3ABL H;  1KU3 A;  1FMV A;  5K7F A;  4IX7 A;  1XDU A;  2CFX A;  4F93 B;  2LNB A;  1QNT A;  2RNJ A;  3R4K A;  1XCV A;  1SD6 A;  1ZGJ A;  3E7L A;  5ICC A;  3K1M A;  5B5E C;  2PMZ A;  1U8R A;  3I53 A;  3JRB A;  1ORK A;  3CUQ B;  3DBH B;  4YIR X;  3ZQF A;  2PLY A;  1R5G A;  1P7J A;  5HDK A;  5FJ8 J;  3KLN A;  2R7X A;  4Z6Y A;  1IRX A;  2CG4 A;  2K9N A;  1G3S A;  4ENJ A;  2IAI A;  1U3E M;  2AO9 A;  1S7A A;  1OYW A;  1R4N B;  5J8C A;  3WU2 C;  3W6V A;  2QLZ A;  4EJT A;  3MCZ A;  3HIF A;  1OCC H;  2M8G X;  1F43 A;  1WJ5 A;  1IRZ A;  3IAS 2;  4CCM A;  2DDB A;  3V7S A;  1XB4 A;  2ECB A;  3IL2 A;  3PL8 A;  4BQN A;  4N9I A;  1H88 C;  4YFX F;  3HXL A;  1DP3 A;  1HQC A;  2NVQ J;  2P0W A;  3KP3 A;  3F8B A;  3U1D A;  1V3F A;  1W7P A;  2Q2E A;  2JSC A;  1HC8 A;  2P6T A;  1RR7 A;  1LDD A;  3HHH A;  3I59 A;  4EM1 A;  4CIC A;  3H5R A;  4DBR A;  1JKO C;  3TOA A;  3HKZ A;  4I7H A;  4PJM A;  3CJQ B;  5LFA A;  1FYK A;  3SQN A;  5LRR A;  3T5X A;  1KU9 A;  1FJL A;  1MNM C;  1BI3 A;  1OQY A;  2KRH A;  3JRC A;  3AG3 H;  3DU5 A;  3W2A A;  3F21 A;  2KJB A;  5C4X J;  4AD9 A;  3JTG A;  1JTY A;  2RV8 A;  1GLN A;  3M1E A;  3ZR8 X;  1UAA A;  5DCM A;  5FLM J;  4BXX J;  1DP7 P;  1WZ2 A;  1ETX A;  2O8K A;  2CQN A;  3DBL B;  2XSD C;  5JI6 A;  3OR2 C;  5IYD J;  1HBX G;  3HTU A;  1HA8 A;  1LE8 B;  3K4M A;  2WAE A;  2Q8K A;  2KQR A;  3RCO A;  1R1V A;  4KIF A;  2DA1 A;  1ZTR A;  1I39 A;  2JJ7 A;  3GZ6 A;  4UUS B;  1UG2 A;  4IOA F;  4HA8 A;  1D5Y A;  3TW7 A;  2BV6 A;  2OUM A;  3UNG C;  3TO6 A;  1G2H A;  2NRA C;  1TW3 A;  1B9N A;  1LVA A;  2QVO A;  3BPV A;  3CP2 A;  3QP5 A;  3BOQ A;  2NS8 A;  2BVL A;  4XKW A;  3Q0W A;  2IXS A;  1MGT A;  5IT3 A;  2VQC A;  2XKO A;  3OSG A;  2M5W A;  1U8B A;  2CRG A;  4BAY A;  3GF2 A;  3H5N A;  3HKZ N;  5JHU A;  3WGI A;  1YRN B;  2A6T A;  2F4O B;  3Q0U A;  4XOP A;  5LGU A;  2FX0 A;  5IYB J;  3BLY A;  2KIF A;  4LB6 B;  4RGU A;  2JVH A;  3CC4 I;  3OYG A;  1MBG A;  4WK8 F;  2I10 A;  3TDZ C;  4MTD A;  4ZZL A;  2W48 A;  3Q9V A;  3V7R A;  3A01 B;  4BJ6 C;  1RES A;  1R1U A;  3WGH A;  4A6E A;  4U7B A;  1NH3 A;  2HQR A;  3O8H A;  5FKL A;  2CQK A;  3I4P A;  3LA7 A;  1FOW A;  3A2K A;  3DP7 A;  4KIG A;  1BJZ A;  2L02 A;  1Y39 A;  4PUS A;  4BU2 A;  5BOX A;  3BPX A;  2X1C A;  1SMT A;  5HLT A;  4L0Z B;  3C2H A;  5J40 A;  2R7U A;  4XLF A;  4FIS A;  3IP4 B;  1A35 A;  5LHH A;  1ZG1 A;  2VIX A;  2OTL I;  1IRF A;  5D6E A;  5K5O A;  1XN7 A;  3T8T A;  2FA5 A;  3KYC B;  1K79 A;  3LSH A;  4X6A J;  3PO2 J;  5JLW A;  1K7A A;  2GOM A;  1BW5 A;  1VQP I;  1X58 A;  1YIT I;  1H9T A;  3J80 Z;  5JLX A;  1YIO A;  3C3W A;  2V1D A;  1J2X A;  2VXZ A;  2JK3 A;  3TKY A;  2CV2 A;  5DTD A;  4A3B J;  1PJR A;  1PUF B;  2WV1 A;  1H9G A;  1LUJ B;  2HQA A;  2IBD A;  5HS8 A;  4RGS A;  2R5Z B;  5J4V A;  1EA3 A;  4LB5 A;  3K70 D;  1LVK A;  1WFX A;  1BI0 A;  2DA7 A;  4M3E A;  4BEH A;  1ETO A;  1M1E B;  2CU7 A;  2Q0O A;  1BR1 A;  1L0O C;  4KUM A;  1ZR2 A;  4I0B A;  1HW1 A;  3OS2 A;  4RDU A;  2VBZ A;  3W6K B;  3SJM A;  4HPQ A;  4WCG A;  2F4I A;  5D4R A;  4FX4 A;  2R5Y A;  2V79 A;  4ZZD A;  3J7Z I;  2KDO A;  3JR9 A;  2V1X A;  4XID A;  3U21 A;  2HQ5 A;  1O7F A;  3RZO J;  4RB0 A;  1MD0 A;  1XMA A;  4AVZ A;  1TBX A;  2V4J C;  4RB2 C;  1OCZ H;  2HDW A;  4A0Y A;  2QEN A;  2VAS A;  5ERI A;  1YQA A;  2G0E A;  4FE4 A;  3EET A;  4BDZ A;  1MSF C;  1MKM A;  2NAZ A;  2XPW A;  2R7W A;  4CCJ A;  3AL0 C;  4R1H A;  2W7N A;  2GXA A;  2D2W A;  2JVG A;  3HPH A;  4S04 A;  3A0H C;  3VWB A;  2KRF A;  1UZC A;  3DTK A;  4Q47 A;  1SFU A;  3HYI A;  4ZYA A;  4NUB A;  2DMQ A;  1MSE C;  3GTO J;  4E7Z A;  2H6B A;  1ZLK A;  4HEA 2;  3JRI A;  4GO1 A;  3OL3 A;  2H6C A;  5FLX K;  2K9S A;  2HOE A;  3VOE A;  5E79 C;  2MAB A;  3LSM A;  3ZMZ A;  2VBX A;  1DQU A;  2LY1 A;  3M9A A;  4Y4R A;  2MBF A;  3WTT C;  3KIO A;  3DFG A;  1BR4 A;  3R0J A;  3QPT A;  3ZQI A;  4FQG A;  5CVJ A;  1XCB A;  2PX9 A;  2K86 A;  4EM0 B;  3TED A;  1TT0 A;  3G6E I;  1Y1V J;  4P9F A;  2YU3 A;  1VQO I;  1LQ1 A;  3GZ5 A;  4B43 A;  1O4X A;  2HDC A;  1BI2 A;  1JHH A;  3OYN A;  2XF5 A;  5L3G A;  1LB2 A;  2MD5 A;  3RKW A;  4AUX A;  5K5R A;  1FSE A;  4LG0 A;  3K70 C;  3QRF F;  3GTP J;  3Q9S A;  2E1M B;  4IHW A;  5EGO A;  1PUE E;  4QPO A;  1X19 A;  1GUU A;  3GUD A;  2W25 A;  4BHP A;  4ESF A;  2HOS A;  2L4M A;  3HSF A;  3MZH A;  4A3E J;  4GFB A;  2VOO A;  1TQP A;  3KZZ A;  3V8L A;  1MDM A;  1X1P A;  4XKC A;  3J81 K;  3JCU C;  5LGT A;  2FBI A;  1OMI A;  4RAG A;  5D5X B;  1MBK A;  1MJB A;  1T98 A;  2Y48 A;  2XDV A;  2DPU A;  2BYV E;  3TDU C;  2L3D A;  3LFU A;  1R36 A;  2FNP A;  4BAC A;  3AL0 B;  4Y13 A;  2DFI A;  2QSF X;  2PBI A;  2L7M P;  3H3Z A;  3ULQ B;  4A3I J;  3SFI A;  3JRH A;  2HYF A;  2BBY A;  2BEO A;  4PSX A;  1E0E A;  3B6C A;  3QPL A;  1W7P B;  2Q2E B;  3UR3 C;  2ICW G;  3I59 B;  4KIT B;  3AG2 H;  2O03 A;  2NVX J;  2RGV A;  3KCC A;  2QEX I;  2MLK A;  5IY5 H;  2QF7 A;  3O2P E;  2ELK A;  1EH7 A;  2HNH A;  4E7H A;  1FZP B;  4Q4Z F;  1P4W A;  4GXO A;  5F27 A;  2CV1 A;  1GV5 A;  3G1M A;  1YTY A;  2DA3 A;  4A3M J;  4DZP A;  4CUG A;  1UHW A;  1BA5 A;  4DW6 A;  5DCM B;  3ZRG A;  2K5C A;  2LKP A;  1I5Z A;  3N05 A;  4L5I A;  4HF2 A;  4O3M A;  5FKK A;  4C3H J;  5E1Z B;  4D5C A;  1O3T A;  4A3L J;  1Q1H A;  2LFB A;  5HNF A;  2EPF A;  3RTR A;  1E17 A;  4RBO A;  2OV7 A;  1IO2 A;  3VYT B;  5D5V B;  3MFK A;  1FMW A;  1B4A A;  3ROU A;  4EJO A;  1BW6 A;  3WGG A;  5IPA A;  2G9W A;  3F6V A;  4MFD A;  2OD5 A;  3S3O A;  4XON A;  2ZME C;  5EZG A;  3CCS I;  4ZJZ A;  2RQQ A;  3FM5 A;  3LSG A;  4EJV A;  4IEJ A;  2V6E A;  3F22 A;  4C30 A;  3BT9 A;  3A0B C;  3JRA A;  1P92 A;  2O6G E;  3BQY A;  4HLX A;  3ECO A;  5CPR B;  2L7Z A;  3AFH A;  5J1Y A;  3OOU A;  4IHS A;  1IN5 A;  4HOB A;  4JX5 A;  4NB5 A;  3OYH A;  3KEY A;  2UXN A;  3H35 A;  4H0E A;  1PP8 F;  4MEX F;  2MW8 A;  5GTH C;  2MC4 A;  4XNF A;  4MNU A;  5L3D A;  1ZRC A;  2UUZ A;  3FHN A;  2O3F A;  3LNQ A;  3OSF A;  3KE2 A;  2ZJP F;  3OMY A;  4XRS A;  2KFD A;  3OYK A;  5J47 A;  1W5T A;  2GXG A;  2DQR A;  3CJT B;  1R9T J;  4B44 A;  2H27 A;  2OTJ I;  2VPL A;  1O3Q A;  3IHU A;  4DIQ A;  2JA8 J;  2PMU A;  5KAI C;  4ZDO A;  1IN8 A;  4C2M J;  4IZZ A;  3GW2 A;  4G7O F;  4CCK A;  2RDP A;  3ABU A;  4ZTF A;  1A5J A;  3RPU D;  1H89 C;  1UHS A;  4CGZ A;  1OIS A;  4ZYD A;  1WSU A;  3FZV A;  2RN7 A;  3PUB A;  1KA8 A;  1VQ5 I;  3E5U A;  3M07 A;  5CVV A;  1LFU P;  2TDX A;  3JW4 A;  3TP0 A;  4A6D A;  4B47 A;  2JQ7 A;  1TLH B;  4FT8 A;  2X1D A;  4W1U A;  3U2R A;  4WF2 A;  1NG7 A;  3CCQ I;  3M7G A;  2Y0S A;  4G94 A;  1X3U A;  2NS0 A;  4A3K J;  3Q0V A;  3ERM A;  1HKT A;  1SFE A;  2LG4 A;  1LEB A;  3QPH A;  1QPI A;  2O9L A;  1EH6 A;  5E3M A;  2W1O A;  2Y2Z A;  5CVU A;  4BEH B;  1YW8 A;  5E3O A;  4IQJ A;  3ZMD A;  3FXU A;  3IKV A;  4P9U A;  2ZME B;  3ZMS A;  1SVM A;  1E3H A;  1YOV B;  3FK7 A;  2M7A A;  2DN0 A;  4II3 A;  3E5X A;  2UV1 A;  3RIR A;  2UXX A;  4HST A;  2P5L C;  3SFZ A;  2LRD A;  2B9S A;  5FFZ A;  1TW2 A;  3BR3 A;  1JKR C;  4CA0 A;  3N4M A;  3WU1 B;  1RR8 C;  1R7J A;  2IS2 A;  2W84 A;  2XRN A;  2GZW A;  4PJ0 C;  1HDD C;  1VF9 A;  1U2W A;  1I3Q J;  4M3B A;  1TQM A;  4HNV A;  3LSR A;  4LK0 F;  2FML A;  4YIF A;  1B72 A;  4W97 A;  2ME0 A;  3CTA A;  3MAJ A;  4HDU A;  2W57 A;  3CZ6 A;  4A5N A;  1QZY A;  1B9M A;  4ZYG A;  2HXO A;  2IJL A;  2D5V A;  1R58 A;  3HOV J;  3JTH A;  3GFL A;  3LSI A;  2V1U A;  3FIS A;  2GAU A;  3BDD A;  1LFP A;  1A04 A;  1J0R A;  3AAF A;  1ENH A;  2EK5 A;  3OIP A;  1V5E A;  2KKO A;  5LRS A;  3V4G A;  1R1T A;  4DYC A;  1TP4 A;  4OWR B;  3OY9 A;  1YS7 A;  2H1K A;  3H36 A;  2VT2 A;  2VB6 A;  5JR3 A;  3PNV A;  3VOD A;  1OCP A;  2K4J A;  1T39 A;  2JT1 A;  3GZN B;  1U6G A;  2JPB A;  2XAU A;  3VYU B;  1GXQ A;  3MKY B;  1NK2 P;  3PM1 A;  2AXL A;  4U0Y A;  2P4W A;  3DEU A;  3RKY A;  2QYO A;  4GDF A;  3CJR B;  1LFB A;  1WI3 A;  1Z1D A;  5HOO A;  1Z6R A;  5E3N A;  3CC7 I;  3LSK A;  2YX7 A;  5LEJ A;  4BDY A;  2BW3 A;  2X9D A;  5K7H A;  2X6W A;  3F8M A;  2LRE A;  5EGO B;  1D1B A;  1U0J A;  2MLG A;  4ZTJ A;  3KP7 A;  3GFI A;  4I98 B;  4IHV A;  3LA2 A;  1JJ8 C;  1F36 A;  4EM2 A;  1ON1 A;  3LL7 A;  2HVQ A;  3IAM 2;  1VQM I;  1UB9 A;  2DA6 A;  1MDM B;  3CUQ C;  1UEL B;  1WJF A;  3ONQ A;  2ETH A;  4L9J A;  4HQE A;  2EIJ H;  2OCE A;  5E20 A;  2K9Q A;  4YEL A;  1XC5 A;  3R6S A;  2NNN A;  2Z16 A;  3ML6 A;  3VYS B;  1WJC A;  2YPR A;  4XKV A;  2LTP A;  2R7V A;  1D1A A;  1J75 A;  4KMF A;  3FHZ A;  2ZNY A;  1DGR M;  2AHQ A;  3H3V K;  1ETK A;  1ZGW A;  3HUG A;  4BY1 J;  2VC1 A;  1K61 A;  5D4S A;  2GBY A;  4HYE A;  3WTZ A;  3L2Q A;  2K4B A;  1EH8 A;  1I6X A;  2B7E A;  2DFH A;  1RUN A;  2L4A A;  5J1U A;  2COB A;  3K10 A;  1MBH A;  1OKR A;  2EWN A;  2JA2 A;  4U0W A;  2E71 A;  2E2H J;  2L01 A;  4XOT A;  1NG6 A;  3PUF A;  4BUP A;  5L3F A;  2MH2 A;  5ILS A;  1G6N A;  3VPR A;  2E7W A;  2FOK A;  3KPH A;  4IF4 A;  2M1B A;  3S1R J;  2EA2 A;  4NBQ A;  4ZYE A;  4F7Z A;  2WA0 A;  3S2D J;  4M72 A;  1JGS A;  1CGP A;  1AKH A;  4M74 A;  1VND A;  1XGS A;  3BJA A;  2MFZ A;  2X51 A;  4KJZ A;  1A6I A;  2BXY A;  2KPM A;  3IUO A;  4KIS A;  3ZMT A;  2CO5 A;  3RSN A;  2H09 A;  3PQK A;  3VEP A;  3FXO A;  4KIB A;  3BR1 A;  1SAU A;  2VE9 A;  3KLO A;  2BOL A;  4D7M A;  5A2Q Z;  1VQ4 I;  3FMS A;  4M3D A;  1Z21 A;  4BQQ A;  1Z7L A;  3K1N A;  3OYC A;  4A0X A;  3SYT A;  3QOP A;  1PP7 U;  1T56 A;  2M30 A;  1JHF A;  1KQ0 A;  5DCF A;  1XGN A;  3TL4 X;  3DPU A;  4IHX A;  4IPA A;  2FEZ A;  4NC7 A;  3HDD A;  1NHA A;  3HRU A;  3QOD A;  1T95 A;  5ILV A;  3U1K A;  3HC7 A;  1BC7 C;  4UV9 A;  1OR7 A;  3MMY B;  2R7Z J;  2BVM A;  3AG4 H;  3OYA A;  2GLO A;  3OL4 A;  5D8K B;  3VSL A;  2DXI A;  4OIP F;  2HVS A;  1D0Y A;  3NAR A;  5IT9 K;  4DYQ A;  1U5T A;  3OIO A;  4ANJ A;  6PAX A;  3CMA I;  4IJA A;  1S29 A;  2ZO4 A;  3GO5 A;  2MSY A;  2V7F A;  3M8E A;  5F6F A;  1HW5 A;  2FUG 2;  3A02 A;  4XM3 A;  2Z9O A;  2AQE A;  1HKS A;  3JAM K;  2ZKZ A;  4QTR A;  4BBS J;  3S32 A;  3F6O A;  2GA2 A;  2R3S A;  2H1L A;  5LHI A;  2L54 A;  2BZT A;  5CQG A;  4FET A;  2VJJ A;  1NTC A;  5EEH A;  2M45 A;  5E18 F;  2IS6 A;  1IRG A;  3CF5 F;  1UHM A;  4L5E A;  1Y6I A;  2A69 F;  2R7Q A;  1MW7 A;  1TWC J;  1SVO A;  1JTX A;  3KYD B;  1A31 A;  1R22 A;  4AVP A;  4CH7 A;  3AG1 H;  3H0D A;  2JZY A;  1FT9 A;  1X1D A;  1GHC A;  2JA5 J;  2ISY A;  5FRM A;  1DDN A;  1WWX A;  4GYI A;  2WTE A;  5F08 A;  3P9C A;  2LF8 A;  1J5Y A;  1LDK B;  2OQR A;  4I0A A;  4WXD A;  1MIJ A;  5D5W B;  2E5N A;  4LG3 A;  2WB1 N;  1PVE A;  1U9O A;  2DBB A;  3MKW B;  1XPX A;  3G73 A;  1UST A;  4QIW N;  4RMN A;  5CJ9 A;  3AKZ A;  1IUY A;  3DXJ F;  4MFE A;  3MN2 A;  5F1R A;  2NVU B;  3G71 I;  3S16 J;  4P5O A;  4ZH4 F;  3QPS A;  2Y69 H;  3QU3 A;  5LEK A;  2EV0 A;  4M9S A;  2F5D A;  4OIQ F;  1WJA A;  3F8N A;  3FXM A;  1R71 A;  2VXD A;  5FKO A;  1V55 H;  3LMM A;  1XDS A;  2K27 A;  2A61 A;  2KMU A;  5B3S H;  3BRO A;  2IS4 A;  4E7L A;  2ZXW H;  3OV8 A;  2DOE A;  2WY8 Q;  4ENN A;  3TGN A;  4BS9 A;  3BG5 A;  2ZBK A;  2FE3 A;  3E6D A;  1W5S A;  3K7A J;  2V6C A;  4M6V A;  5M5W J;  2DJI A;  3CLO A;  2WAF A;  4E7I A;  4HW0 A;  1W7P D;  4OIR F;  4MTE A;  1EF4 A;  3EDP A;  4DZJ A;  2F5F A;  1F5T A;  1HOM A;  4KT6 A;  1SMY F;  2HPI A;  3T0Y A;  3ZQQ A;  2VKV A;  2DAO A;  4EQQ A;  4JYK A;  2B0L A;  4F91 B;  4XMY A;  3LSP A;  5C4J J;  2XV4 S;  4RGR A;  3I71 A;  4XK4 A;  2L9R A;  3DWL E;  2ZJR F;  1FYL A;  4L0Y B;  4IHY A;  4CDG A;  2HR3 A;  4KN7 X;  1IAW A;  2P5V A;  3TBI A;  3I55 I;  2XIG A;  1V54 H;  2XAG A;  2XRO A;  5AIP A;  2OZU A;  3LFK A;  2KL4 A;  2OZ6 A;  5HLH A;  1O7L A;  2GIV A;  5DEQ A;  3CES A;  2DTR A;  3QOE A;  4UVC A;  3K6G A;  2HI3 A;  3BJO A;  2BW3 B;  4BQO A;  3EUH A;  2HYG D;  2TRT A;  5A2Q K;  2Y9Z A;  2VBW A;  3ZPL A;  2O5R A;  1RC9 A;  3A4C A;  1GVJ A;  3WU0 A;  4U88 A;  4ON0 A;  4KIC A;  1BIA A;  1U9N A;  2M2E A;  2OA4 A;  4AU7 A;  2HQN A;  2BGC A;  2E1M C;  2JSP A;  4LLG F;  2HEO A;  3CUO A;  4BQA A;  2BHZ A;  4N9H A;  3QYF A;  2E1O A;  4ESB A;  4C9Y A;  3BCB A;  1G8X A;  2X1E A;  5M5X J;  3BG7 A;  2FRH A;  3K2A A;  1ZAR A;  3GTJ J;  1YJ9 I;  2RRE A;  2VKH A;  3ISP A;  2EIK H;  1FTZ A;  1OR7 C;  2MD0 A;  2Y30 A;  5C44 J;  1FY7 A;  1KU7 A;  4LLL A;  3JRD A;  3HUG B;  3PQJ A;  4UV8 A;  2L7K A;  4L18 B;  2LVS A;  4DNC A;  3DKX A;  4IRG A;  4OMZ A;  1H8A C;  3BZK A;  4X0G A;  4CSW A;  2IA0 A;  4OU0 A;  1ZHF A;  3E1S A;  1YJN I;  1D1C A;  1ETW A;  2XAJ A;  1MBE A;  2XRL A;  3HRS A;  2J5P A;  5D5U B;  2W00 A;  2PEX A;  3LQQ A;  3BR5 A;  1YS6 A;  2IA1 A;  3W2W A;  4KT5 C;  3WTX C;  1K6O A;  4BH9 A;  3MD2 A;  5BPI A;  2F5C A;  4RS8 A;  5FGM A;  3SHF A;  2L9V A;  3FXQ A;  1VFC A;  1SEU A;  1GXP A;  3P9K A;  1W4M A;  3DPT A;  3ELK A;  2ZB9 A;  1ZR4 A;  1OCO H;  1Y0N A;  2V1N A;  1YW9 A;  4ETS A;  3JRE A;  5HVQ C;  2ACJ A;  2ZXJ A;  5J8F A;  3CLQ A;  3MEX A;  1BOA A;  4M9X A;  1AKH B;  3NWS A;  2M3A A;  5HNH A;  4MIM A;  2DOF A;  1TC3 C;  3HEF A;  3BZ6 A;  1T0F A;  3CD6 I;  5GPA A;  3EUA A;  5K1Y A;  3CDL A;  3REO A;  4E7S A;  3R60 A;  4M71 A;  5FRN A;  2ESN A;  3ABK H;  3Q3S A;  2VPR A;  2EZK A;  3BQZ A;  1D5V A;  2QQA A;  2XAS A;  3ZMV A;  1ONV A;  2D1H A;  1B6A A;  1G59 A;  2R4G A;  3ZQ7 A;  4HBL A;  4JX4 A;  1ZQ3 P;  1UJ8 A;  5B1B H;  5DM7 F;  1JUP A;  4GCV A;  3RKX A;  1XMX A;  4XR6 A;  2DT5 A;  1IXR C;  1FIA A;  3HOU J;  5BS6 A;  4C3J J;  1Z3X A;  1OJL A;  2IEK A;  3J7A O;  2KT0 A;  4HX8 A;  2HOT A;  1X1C A;  2WBM A;  3HG9 A;  4RM2 A;  3OIQ A;  2QSG X;  3DKW A;  1FOY A;  2XHK A;  3DKY A;  2P7C B;  1TWH J;  3GEZ A;  2IS1 A;  3RI4 A;  1BIB A;  3SEZ A;  4AYB N;  2FXA A;  4BHC A;  4YFN F;  3FX3 A;  1SD7 A;  3ECH A;  2I8D A;  2CYY A;  1HSJ A;  1G3W A;  3TO7 A;  2EBI A;  2EFQ A;  3FDY A;  1R00 A;  1BN5 A;  3GVA A;  3T8R A;  2XF6 A;  4B8X A;  4RGX A;  2BY0 A;  4OAZ A;  1J09 A;  5F0C A;  1MMD A;  1YE9 A;  1TNS A;  2MYS A;  1D3Y A;  2M87 A;  5EYR A;  3CCR I;  2CS3 A;  4MGR A;  2JUG A;  4IRH A;  1U5T B;  1QHH D;  4HV6 A;  4HSR A;  2QM3 A;  2BY1 A;  2DA5 A;  1MBJ A;  2DDA A;  3ZP5 A;  4UHT A;  2M34 A;  2X0L A;  1SVL A;  1QVU A;  2RC4 A;  4E7K A;  2V9P A;  3D0S A;  2X6Y A;  4LD5 A;  4CCO A;  3IRQ A;  5ICF A;  5HOD A;  1IV6 A;  3KEO A;  4IKF A;  1RET A;  1ZAO A;  1XMK A;  1MJ9 A;  4FAS D;  5DDG A;  2HS5 A;  1FPQ A;  4OAY A;  2WAQ N;  4XLC A;  5M5Y J;  3J80 K;  3CME I;  1P9Q C;  2P5K A;  4DGW B;  4I09 A;  5J3L A;  4HG2 A;  1FX7 A;  5M3F J;  3M1C A;  4A93 J;  3L2V A;  2XGE A;  4X1E A;  3EUH C;  4NQW A;  1WH7 A;  2L7F P;  5CQE A;  5BMZ A;  1JKP C;  1N78 A;  3H5A A;  1FOK A;  4IO9 F;  5EF6 A;  1DUX C;  1SAN A;  2YSR A;  3GTM J;  3FF5 A;  3J7Y J;  4PFP A;  3QP6 A;  4JX6 A;  4A0Z A;  1HKQ A;  4IL6 C;  3L09 A;  2UZK A;  2C6Y A;  2XC7 A;  5H6Q A;  4OIO F;  3HPG A;  3FXJ A;  2B63 J;  2PMH A;  2DQL A;  2H8R A;  4YRV A;  1I1G A;  2OBP A;  2QUF A;  4BJT A;  2EB7 A;  2YS9 A;  3K4L A;  2W4S A;  1TTY A;  2XUB A;  2AS5 F;  4GGG A;  3GYH X;  4G7Z F;  1IN6 A;  2RQP A;  4JP0 A;  5H20 A;  2JRM A;  3VFZ A;  1T38 A;  4RA2 A;  4LLN A;  1IJW C;  3SZP A;  2F6C A;  2PQ8 A;  2VC0 A;  3F8F A;  2R7O A;  1ITY A;  1BI1 A;  2ZXH A;  1OYY A;  1U78 A;  1B1B A;  1FYM A;  3WTU C;  2QQ9 A;  2GA1 A;  2XAF A;  1ULY A;  1IN4 A;  4J19 A;  1XG1 A;  4AIJ A;  2TCT A;  3FBN B;  1DU0 A;  3CC2 I;  2BY3 A;  3LAJ A;  4HF0 A;  4Y52 J;  3PJR A;  4GYG A;  2E5Z A;  1B59 A;  4ZYH A;  4A3G J;  1OFC X;  3NAU A;  2OJE D; 
#chains in the Genus database with same CATH homology
 2DA1 A;  4XRS G;  1ZTR A;  2JJ7 A;  2ECC A;  1ETQ A;  1UG2 A;  4UUS B;  2LD5 A;  4A3D J;  2AHQ A;  3H3V K;  1ETK A;  1D5Y A;  3TW7 A;  2EZI A;  1ZGW A;  4BY1 J;  1G2H A;  1K61 A;  1W0U A;  2GBY A;  3TW6 A;  5IOZ A;  2ID6 A;  3D1N I;  1IG7 A;  2NS8 A;  3UKG A;  2FQ4 A;  3Q0W A;  2CQQ A;  3RKQ A;  3I4M J;  5J1U A;  3OSG A;  2COB A;  1U8B A;  2LR8 A;  4FTH A;  2CRG A;  1MBH A;  2KDZ A;  3HKZ N;  3BTI A;  1YRN B;  2E2H J;  2HDD A;  3Q0U A;  9ANT A;  4ABZ A;  2FX0 A;  3RZD J;  4B3A A;  5IYB J;  4FE7 A;  3DCF A;  5F0H A;  1TWA J;  3JRG A;  1JT0 A;  3HOW J;  3VPR A;  2LY9 A;  3GTL J;  1MBG A;  2I10 A;  2M9H A;  1OCT C;  3S1R J;  2W48 A;  3S2D J;  5DS9 A;  3C2B A;  3A01 B;  1AKH A;  1RES A;  1S7E A;  2JA7 J;  2DMT A;  1VND A;  3O8H A;  4UUT A;  2XPV A;  5FKL A;  1IDZ A;  1A6I A;  1BJZ A;  2R5Y B;  5J1R A;  1IDY A;  3CMY A;  2XB5 A;  3O8G A;  4CYC B;  1AU7 A;  3HGG A;  3BR1 A;  5BNG A;  3HM5 A;  2X6O A;  4D7M A;  4D5F A;  2DTZ A;  4FIS A;  4M3D A;  1MBF A;  1B8I A;  1IC8 A;  4X6A J;  3PO2 J;  5JLW A;  2L0K A;  1BW5 A;  5M3M J;  1K83 J;  1T56 A;  1X58 A;  2VI6 A;  3HB9 A;  4FCY A;  5JLX A;  1E3O C;  4IHX A;  3S2H J;  2EQR A;  3HDD A;  5EEA A;  2JK3 A;  5DTD A;  4A3B J;  3HOX J;  1PUF B;  1I50 J;  2WV1 A;  1JUM A;  1HLV A;  2IBD A;  3S17 J;  1DU6 A;  2R5Z B;  1BL0 A;  2R7Z J;  4QSH A;  2XB0 X;  1JT6 A;  3CQZ J;  2NVT J;  2DA7 A;  4M3E A;  1ETO A;  2CU7 A;  2Y9Y A;  2GLO A;  2YUS A;  3NAR A;  1ZR2 A;  4DYQ A;  2LK2 A;  4RDU A;  3OIO A;  3SJM A;  3ZQH A;  1GVD A;  2EZL A;  2MSY A;  2EZH A;  2R5Y A;  3A02 A;  3BR0 A;  3JR9 A;  4XID A;  2HQ5 A;  3GTK J;  4QTR A;  4BY7 J;  4BBS J;  3RZO J;  2N8G A;  5EDN A;  2P81 A;  5F1J A;  1W0T A;  1NTC A;  2HXI A;  5IYC J;  4L5E A;  1SFO J;  2Y31 A;  2G0E A;  4FE4 A;  1TWC J;  1MSF C;  2XPW A;  1JTX A;  2DJN A;  5IP6 A;  4DYR A;  1WH5 A;  5EG0 A;  3TP3 A;  2JN6 A;  5K7Z A;  2DMQ A;  5EZH A;  1MSE C;  2GM4 A;  3GTO J;  3L1P A;  3FIW A;  1HDP A;  3JRI A;  4BBR J;  2K9S A;  2JA5 J;  4B4C A;  1T33 A;  4AC0 A;  2LLK A;  5F08 A;  3FKI J;  1FTT A;  4Y7N J;  1Z77 A;  1RKW A;  2CJJ A;  1CQT A;  4EEF G;  2WB1 N;  4A3J J;  2JA6 J;  1U9O A;  3IH2 A;  5FKM A;  3BR6 A;  2DA4 A;  4QIW N;  3ZQI A;  2CUF A;  4MFE A;  3HOY J;  1Z0X A;  3MN2 A;  1ETV A;  2NOG A;  3WHB A;  3S16 J;  3TED A;  2VKE A;  1Y1V J;  3ZQG A;  3QPS A;  1IUF A;  1O4X A;  3IV5 A;  5FKO A;  2R92 J;  5GPC A;  3RQI A;  5IOY A;  4AUX A;  1AHD P;  4S0H B;  2VUM J;  4D7N A;  4A3F J;  3GTP J;  4IHW A;  5EGO A;  1GUU A;  3BG5 A;  5FLV A;  2HOS A;  3GTG J;  2OPT A;  3K7A J;  2CQX A;  4A3E J;  2YU9 J;  4GFB A;  4M6V A;  5M5W J;  5IP7 J;  4MO7 A;  3BTJ A;  3ZOB A;  1EF4 A;  4DZJ A;  1VI0 A;  1HOM A;  1WGX A;  3JRF A;  2VKV A;  1LE8 A;  1MBK A;  4NDL A;  4JYK A;  4M3G A;  3LSP A;  5C4J J;  4XK4 A;  3LSJ A;  2L9R A;  3G1O A;  1NK3 P;  2XGD A;  4UUS A;  4IHY A;  3GBG A;  2L7M P;  3M4O J;  4A3I J;  3SFI A;  3JRH A;  4B1R A;  4MLO A;  3B6C A;  3QPL A;  3S14 J;  4G12 A;  4A3C J;  3BR2 A;  1I6H J;  2NVX J;  2HI3 A;  5F0F A;  2Y9Z A;  2TRT A;  1APL C;  2QF7 A;  1YRN A;  2ELK A;  3H0G J;  3MKL A;  1HF0 A;  5F27 A;  1X2N A;  1U9N A;  1GV5 A;  2M2E A;  2ME6 A;  3ZQC A;  2EH3 A;  2ID3 A;  3G1M A;  1QRY A;  4XRM A;  2CUE A;  2DA3 A;  2JMW A;  4A3M J;  3HGY A;  4DZP A;  2LKX A;  1BA5 A;  4DW6 A;  3S1Q J;  3SDG A;  3A01 A;  3LOC A;  2E1O A;  2Y0S N;  5FKK A;  1WPK A;  4C3H J;  2JWT A;  1IGN A;  4D5C A;  5M5X J;  4A3L J;  2LFB A;  3K2A A;  3GTJ J;  3BG9 A;  1JGG A;  2FD5 A;  4RBO A;  4CYC A;  1FTZ A;  1QVT A;  2Y30 A;  5C44 J;  1RPW A;  1GV2 A;  3ZQL A;  3JRD A;  2M0C A;  1BW6 A;  2LVS A;  1WCM J;  5IPA A;  4MFD A;  1H8A C;  1TWF J;  3S15 J;  5EZG A;  2LP0 A;  5FKN A;  2E2J J;  3LSG A;  1ETW A;  4IEJ A;  4C3I J;  1MBE A;  2XRL A;  3BT9 A;  3MVP A;  3BR5 A;  3JRA A;  2K40 A;  3BQY A;  2L7Z A;  5J1Y A;  3OOU A;  1MH3 A;  2FJ1 A;  3A03 A;  2X48 A;  4JX5 A;  1VFC A;  1PUF A;  3QQA A;  2ZB9 A;  1ZR4 A;  3M3Y J;  2MW8 A;  3JRE A;  2R5Z A;  2PMZ N;  2E2I J;  2XPU A;  1XS9 A;  1AKH B;  4M3F A;  4MIM A;  3LNQ A;  3OSF A;  1TC3 C;  3HEF A;  4XRS A;  5GPA A;  3WHC A;  2NVY J;  3CDL A;  3F0C A;  1R9T J;  2O7O A;  3Q3S A;  2VPR A;  2EZK A;  3BQZ A;  4V2F A;  1ZKG A;  5GP9 A;  2JA8 J;  1FIP A;  4C2M J;  2NS7 A;  1JKQ C;  4BKX A;  1ZQ3 P;  4JX4 A;  4A69 C;  1JUP A;  2MG4 A;  1A5J A;  1B72 B;  1FIA A;  2DMU A;  3HOU J;  1GT0 C;  1H89 C;  1UHS A;  1X2M A;  4C3J J;  1OJL A;  1RKT A;  4I76 A;  2IEK A;  1B8I B;  2XGC A;  2KT0 A;  2HOT A;  1LFU P;  4V2G A;  4I6Z A;  1POG A;  1TWH J;  3TP0 A;  3HOZ J;  4AYB N;  2E19 A;  4W1U A;  1Q1V A;  2EBI A;  3HBL A;  2HYJ A;  4A3K J;  3S1N J;  3Q0V A;  1JJ6 C;  3S1M J;  1QPI A;  2O9L A;  3BTC A;  3IH4 A;  5E3M A;  2Y2Z A;  5F0C A;  2DMP A;  5E3O A;  5C3E J;  1GDT A;  3IH3 A;  3FK7 A;  2DN0 A;  5EYR A;  2RAE A;  4LOC A;  3BR3 A;  1JKR C;  3BG3 A;  1TWG J;  2DA5 A;  1MBJ A;  2QCO A;  5F04 A;  2M34 A;  3BTL A;  1QVU A;  1HDD C;  1VF9 A;  1ZK8 A;  1I3Q J;  4M3B A;  1UMQ A;  4HNV A;  3LSR A;  1B72 A;  5K7F A;  5HOD A;  4W97 A;  2ME0 A;  1IV6 A;  1RET A;  3E7L A;  2HXO A;  2D5V A;  3JRB A;  1ORK A;  5EG0 B;  3HOV J;  2WAQ N;  5M5Y J;  3ZQF A;  1P7J A;  5FJ8 J;  3CCY A;  3FIS A;  5J3L A;  5M3F J;  4A93 J;  2XGE A;  2K9N A;  1ENH A;  2OF7 A;  4X1E A;  3PO3 J;  1WH7 A;  2IAI A;  2L7F P;  1JUS A;  2AO9 A;  4DYC A;  1JKP C;  2R93 J;  2H1K A;  3FK6 A;  3W6V A;  5EF6 A;  5IP9 J;  1SAN A;  3GTM J;  2M8G X;  1F43 A;  4JX6 A;  1IRZ A;  1OCP A;  3G1L A;  2ECB A;  1H88 C;  2NVQ J;  1NK2 P;  2DMN A;  3PM1 A;  2B63 J;  2H8R A;  1LFB A;  1RR7 A;  1WI3 A;  3B6A A;  1FEX A;  5E3N A;  1JKO C;  2YS9 A;  1HCR A;  2X9D A;  2HOA A;  5K7H A;  2DA2 A;  4JP0 A;  1P7I A;  1FJL A;  1MNM C;  1MH4 A;  3JRC A;  2MGQ A;  5EGO B;  1IJW C;  5C4X J;  4IHV A;  1JJ8 C;  1ITY A;  1F36 A;  1U78 A;  3I4N J;  1JTY A;  4XIC A;  5E3L A;  1Y1W J;  2DA6 A;  5FLM J;  4BXX J;  4J19 A;  1XG1 A;  1ETX A;  2O8K A;  2TCT A;  2XSD C;  3DEW A;  1DU0 A;  5IYD J;  3GTQ J;  2K9Q A;  1XC5 A;  1LE8 B;  2LTP A;  4Y52 J;  2R0Q C;  1ETY A;  4A3G J;  1OFC X;  3NAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...