1W0TA

Htrf1 dna-binding domain in complex with telomeric dna.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords TELOMERIC REPEAT BINDING FACTOR 1
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1w0tA00
1OCPA 5IP9J 3BTLA 3JRGA 2PMZN 3O8HA 1MH4A 2EZHA 2XPVA 3S14J 1GVDA 4MFDA 1JUSA 2JK3A 2K9SA 5J1RA 2GLOA 3TP3A 1FTZA 3RZDJ 2MG4A 4IHYA 2CUEA 3BR2A 4AC0A 4G12A 1YRNA 4DYRA 2DN0A 3GTGJ 2CU7A 2DA4A 2FQ4A 3JRDA 2DMNA 2LY9A 1VI0A 2ECBA 4A3DJ 2KT0A 3LOCA 5E3MA 1SANA 1RKWA 1MBJA 3JRHA 1XS9A 5EZHA 4C2MJ 2B63J 4DYQA 2ELKA 3BT9A 3DEWA 4M3GA 5IYDJ 3MN2A 3GTKJ 1JT0A 4DZJA 1ZK8A 2HXOA 5IP6A 1Q1VA 2VPRA 2LP0A 4DYCA 5J1YA 1RESA 3HDDA 1QVUA 1MBKA 5F0HA 4BKXA 3TW7A 3HGGA 3G1OA 4MLOA 5J1UA 3ZQFA 5BNGA 4C3HJ 3TP0A 4FTHA 3GTMJ 2EH3A 3O8GA 9ANTA 4CYCB 2RAEA 4DZPA 2AHQA 4M6VA 1HF0A 1EF4A 1BW5A 4MIMA 1PUFA 2W48A 5IOYA 4A3JJ 4LOCA 3S16J 2DA1A 3K7AJ 1FIPA 1X2MA 4I76A 2LVSA 2R5YB 4V2FA 3A01B 5IYBJ 2XGDA 2L0KA 4BY1J 1MSEC 1NTCA 5IP7J 1DU0A 4BXXJ 5IOZA 1QVTA 1K83J 3GTPJ 2YUSA 1GV5A 2X48A 5EEAA 1BA5A 2G0EA 2CUFA 2TRTA 3ZQHA 2X6OA 2FX0A 2EQRA 1IC8A 2GM4A 2LK2A 2EZLA 2FD5A 5E3OA 1TC3C 5EF6A 1JKPC 1GDTA 4A3EJ 3I4MJ 5K7FA 1MBEA 4C3JJ 4IHXA 4FISA 3BR0A 1IRZA 3HM5A 2Y31A 1G2HA 1MBFA 5FKOA 4BBSJ 5EDNA 4MFEA 1JGGA 2R5ZA 2CJJA 1XC5A 4V2GA 1NK3P 1MSFC 5EGOB 1B72A 5EYRA 3QPSA 1RETA 3ZQIA 2JA5J 1FIAA 1ETVA 3JRBA 5GP9A 4C3IJ 3JRCA 2IBDA 2NVTJ 1ZQ3P 1GUUA 3RZOJ 3M4OJ 3S1MJ 4CYCA 1ZGWA 5GPCA 3SJMA 5F1JA 2Y30A 1JKQC 1HDPA 3MKLA 1I3QJ 1VFCA 1HDDC 2MGQA 1Z77A 3BQZA 5FLMJ 4QTRA 3S15J 1FTTA 1K61A 3B6AA 3HOUJ 3Q0VA 4W1UA 1ITYA 2E2JJ 1UG2A 1B72B 3Q0UA 4IHWA 5JLXA 1MNMC 1IUFA 4GFBA 3QPLA 1X58A 5F27A 2E2IJ 4JP0A 1W0TA 3JRIA 1VF9A 2MSYA 2JMWA 2NS8A 3JR9A 5DS9A 2NOGA 1H89C 5M3FJ 3LSJA 3BG9A 3SDGA 2HXIA 3BG5A 1E3OC 1RPWA 4D7MA 1GV2A 3HKZN 2O9LA 5F08A 1NK2P 3RQIA 2R93J 1JJ8C 4FE4A 4L5EA 3SFIA 4B3AA 1GT0C 3S1QJ 2ME0A 5FKLA 1JKRC 1OCTC 5M3MJ 2M9HA 3S1RJ 1MBGA 2MW8A 2QF7A 1BW6A 1ENHA 5FKMA 3OOUA 2L9RA 5EGOA 3S2HJ 1JUMA 2XB0X 4X6AJ 2CQQA 3GTQJ 1JT6A 2CRGA 1WPKA 2DA2A 2JWTA 4IEJA 3HOWJ 3PM1A 1PUFB 5F0FA 2Y0SN 1TWCJ 3CMYA 4EEFG 2DMQA 3DCFA 5C4JJ 2EZIA 1IDZA 1BJZA 2JJ7A 3WHBA 2Y2ZA 1QRYA 3IH2A 2YS9A 2IEKA 2NVXJ 1TWGJ 3M3YJ 2O8KA 1LE8A 4RBOA 1MH3A 1F43A 1JJ6C 2P81A 3BTCA 4Y52J 3K2AA 2N8GA 1UMQA 1WCMJ 1RKTA 2R5YA 1XG1A 5J3LA 4S0HB 5M5WJ 3TEDA 1ZR2A 3GTLJ 3BTJA 1UHSA 3CDLA 1HOMA 4NDLA 1WI3A 2I10A 5F0CA 1Y1VJ 3ZQGA 5M5YJ 2DA7A 4MO7A 2ID3A 5F04A 1ZTRA 2K9NA 3TW6A 1JKOC 4XRSG 1R9TJ 4XICA 4A3BJ 2XSDC 1DU6A 3D1NI 2VUMJ 2DA3A 5E3LA 1OJLA 2DA6A 3HOXJ 3B6CA 1JUPA 3FISA 2NVYJ 1JTXA 1IG7A 2O7OA 1VNDA 1A5JA 3G1MA 1AKHA 1U8BA 2OPTA 3PO3J 2M0CA 1TWHJ 1YRNB 3OIOA 3H0GJ 3IV5A 2Y9ZA 3UKGA 2DA5A 5EZGA 2HOTA 3GTOJ 3IH4A 3OSGA 3LSPA 1MBHA 5FKNA 3JRFA 4AYBN 5GPAA 3OSFA 2ECCA 3S17J 2HQ5A 2L7ZA 1U9OA 3BR5A 5IPAA 1JTYA 2HDDA 4M3EA 4D7NA 1QPIA 4BY7J 5JLWA 5C44J 1AHDP 1ETOA 2ME6A 4JX5A 5EG0A 1IJWC 1A6IA 5K7ZA 1ETYA 1T56A 1ORKA 4Y7NJ 2LR8A 5K7HA 3ZQCA 2TCTA 3E7LA 1WH7A 3HOYJ 1B8IA 3H3VK 4B4CA 2ID6A 2XGEA 4A3LJ 1ETQA 2JA6J 4DW6A 2HOSA 1FEXA 2WB1N 3A01A 4W97A 3BG3A 2HOAA 4XRMA 2LTPA 3BTIA 3HGYA 3GTJJ 1Y1WJ 4A69C 1IDYA 1S7EA 2M2EA 3FK6A 3W6VA 2EBIA 2LFBA 3RKQA 1APLC 3F0CA 5C3EJ 2QCOA 4A3CJ 2HYJA 4RDUA 3HOZJ 5E3NA 4JYKA 4HNVA 1FJLA 1SFOJ 1F36A 4XK4A 1BL0A 2OF7A 3IH3A 2L7FP 4M3FA 2K9QA 1T33A 2H1KA 2EZKA 3FIWA 1Z0XA 2VI6A 1IGNA 1X2NA 1LFBA 3Q3SA 3LNQA 4JX4A 1AU7A 1LFUP 2E19A 1ETXA 2DJNA 2XPUA 2JA8J 3HOVJ 2IAIA 2FJ1A 3C2BA 3PO2J 4D5FA 1H8AC 3JREA 4XRSA 3FKIJ 1I6HJ 1HLVA 2XB5A 5FJ8J 1P7IA 3A03A 4D5CA 1U78A 2CQXA 1AKHB 1RR7A 3BR1A 5HODA 2XGCA 2E1OA 4J19A 1ETWA 4X1EA 1POGA 2L7MP 1ZKGA 2GBYA 3BR6A 2HI3A 3Q0WA 3S2DJ 3CQZJ 2DMTA 1TWAJ 3LSGA 3ZQLA 4A3MJ 3I4NJ 1WGXA 2JN6A 2M8GX 1TWFJ 2D5VA 3NAUA 2R7ZJ 1ZR4A 2WAQN 2JA7J 2XPWA 1HCRA 1WH5A 2H8RA 3NARA 5FLVA 3HB9A 3LSRA 4BBRJ 2WV1A 1B8IB 2AO9A 1U9NA 2R0QC 3FK7A 2DMUA 4IHVA 2KDZA 1D5YA 2YU9J 2R5ZB 2X9DA 4I6ZA 2COBA 4UUTA 3HEFA 4FE7A 1IV6A 4A3KJ 2ZB9A 3ZOBA 4ABZA 4FCYA 2LD5A 3S1NJ 3JRAA 5FKKA 2DMPA 3A02A 4XIDA 3MVPA 2XRLA 3QQAA 2M34A 5DTDA 4UUSA 2LLKA 1H88C 2VKEA 3GBGA 3VPRA 2NS7A 5M5XJ 3L1PA 5IYCJ 1LE8B 4A93J 4A3IJ 4AUXA 1O4XA 4M3BA 3WHCA 1W0UA 2LKXA 3BQYA 3HBLA 4B1RA 1P7JA 1CQTA 3CCYA 4JX6A 4M3DA 4A3GJ 4QIWN 3G1LA 4A3FJ 4QSHA 5EG0B 2NVQJ 1ETKA 4UUSB 2DTZA 2VKVA 3BR3A 5C4XJ 1OFCX 1I50J 2K40A 2E2HJ 2R92J 2Y9YA
chains in the Genus database with same CATH superfamily
2P7CB 4S05A 2K7LA 2HVSA 1GVDA 5GADJ 4MFDA 1V4RA 5GTHC 2X1CA 3DXJF 1YS7A 2K9SA 2AQEA 2O5RA 4HV5A 4M74A 2FUG2 1LJ9A 2GXGA 2GLOA 1FTZA 2MG4A 4I2OA 3BR2A 2RVCA 2HOEA 2PX9A 1X1PA 3GTGJ 2ZXHA 3D5SC 4M71A 2DA4A 3CUQA 2FQ4A 1TQPA 1BI3A 2JPBA 4UNOA 3ZXSA 2DK5A 1P6RA 5TRDA 2JPCA 3IKVA 2C6YA 2ECBA 2KFDA 3RKWA 4EGZA 2M7AA 1ZAOA 1X1CA 4KICA 3V7SA 3LOCA 3MKZA 1RI7A 5DM7F 4YELA 1XCVA 1DGRM 2E1NA 4QPOA 4BE2A 1XS9A 2E7XA 2B63J 3J80K 3BT9A 2W25A 3ZMDA 1E3HA 1HW5A 3GLXA 3RDIA 1FC3A 2FQ3A 2DFHA 3MN2A 5L3CA 1JT0A 1MGTA 4DZJA 1ZK8A 5D5VB 1OMIA 3FXOA 4FT8A 2K4BA 1J9IA 1HXDA 2MD0A 4BYYA 1D1AA 1XMKA 5J1YA 4B44A 5LBQA 2HZDA 1QVUA 1MBKA 4DGWB 3LFKA 3WTSC 3TOBA 3S93A 3K0LA 4QLCU 3TP0A 4KFCA 2EFOA 2EINH 3EETA 4EMSA 3K9TA 2PMZA 3BC8A 2AHQA 4D9JA 4MIMA 1K4SA 2W48A 4BS9A 2KL4A 1ZHFA 1NHAA 4BE0A 2VN2A 1S7OA 3KEQA 4LOCA 4CCLA 4HG2A 2DA1A 4ZC3A 3A01B 2ZJRF 4L9TA 3OYJA 3SZTA 3OYEA 3H0DA 1K83J 3GTPJ 2OA4A 2F4IA 2X48A 1BI1A 3RI4A 5J40A 4IHSA 3JW4A 3K4KA 3ASNH 2HEOA 3GFJA 2QKMB 1R5ID 3CDIA 4FX4A 2WY7Q 1F9NA 4BQNA 1L3LA 2JSCA 2HS5A 4IHXA 1VQNI 1O7FA 4HX8A 2K02A 3BR0A 1OR7C 1IRZA 4AVPA 1YS6A 2DOAA 4LLLA 1Z3XA 2JVHA 1KONA 2Y31A 3OV8A 4MQ9F 2AXTC 1D1CA 5EDNA 2LKSA 4MFEA 2XAGA 3WTUC 2AQFA 2GZWA 1XC5A 2DDBA 5E79C 3TO6A 1I27A 3MKWB 4A0YA 1G8XA 2BHZA 3BCAA 4I99C 4B48A 3QPSA 1X19A 3ZQIA 5LHIA 2JA5J 3F21A 4RGUA 1ETVA 4C3IJ 2ZKZA 1UHMA 2NVTJ 5E1XA 2L02A 3E5QA 4CYCA 4U7DA 4E7IA 1ZGWA 2MFZA 5GPCA 1B59A 4HYEA 2CUZA 5JFRA 1VZ0A 2WA0A 1I3QJ 4IXAA 1YIJI 2MYSA 3H9GA 2QEXI 3J7AY 1Z77A 3BQZA 3R0AA 3REOA 3S15J 3HYIA 3B6AA 3GLLA 3C2HA 1TW3A 2VBXA 4JQFA 1FOWA 1UG2A 3LSTA 4RM2A 2VE9A 1MNMC 3QPLA 1Y0NA 4CSWA 1EKEA 4JP0A 5BQTA 1WQ2A 1VF9A 3DLAA 3H9QA 5FGMA 2MSYA 2CQ7A 3JR9A 1IV8A 3OS2A 3LSJA 5TISC 3BG9A 1TW2A 4G8XA 3HOSA 1GV2A 3GF2A 5CLSA 4UVCA 1TL8A 3CMAI 3LWFA 4BAYA 5BPDA 4L5EA 2WB1A 1K6OA 2CUJA 3SFIA 3WTWC 2MLGA 4BHCA 1TZLA 2BOLA 2WWYA 1Z91A 3BP8A 1REPC 2EPFA 2V1UA 3J81Z 2MW8A 2QF7A 3L00A 4A6EA 1ZG5A 3CP2A 4DQ2A 2F6CA 5FKMA 1JHHA 2QGUA 4X6AJ 1V5GA 4LD5A 2RDPA 2Z5UA 2HVQA 1WPKA 4B43A 3AG2H 2JWTA 4HF0A 1YW7A 3L2VA 2L4AA 3QAHA 5F0FA 1TWCJ 3DCFA 3FZVA 4NBQA 5HLGA 3TDUC 1YTYA 2EZIA 1OYYA 4MNUA 5ICGA 2B7EA 5B1AH 3FM3A 3SHFA 1YLFA 2NXNB 1P4XA 2F5EA 1L0OC 2K5CA 5HDKA 2HU9A 3KZIC 3M3YJ 2O8KA 1X4PA 4LG3A 3MWMA 4HDUA 5HS7A 1WHUA 3EUAA 3BDDA 3KYLA 2Q0OA 2VC1A 1JJ6C 4LGWA 3AG1H 2IP2A 1UMQA 5JVGF 1TT5B 4CCNA 1XG1A 5J3LA 4RB2C 3V42A 4GGGA 1FOYA 3HUGA 5E8IA 1HOMA 4FHTA 4N0BA 1NH3A 1DP7P 1KU9A 1WI3A 2I10A 2Q8KA 1T0FA 3S2WA 4LK0F 4MO7A 4BEHA 4BH9A 5L3GA 5BOXA 2FNPA 4E7JA 3P7NA 5F04A 1ZTRA 2Y0SA 3CD6I 4PGGA 4CHUA 4OAZA 3F23A 2CV0A 3IAS2 4AVZA 3R6SA 3WE2A 2MLKA 2DA6A 4MHGA 3CUQB 1JTXA 1IG7A 2O7OA 1VNDA 4L0YB 4GRIA 1AKHA 1X3WB 3PO3J 2XASA 4ON0A 1XB4A 1FYLA 1W4MA 2DA5A 5CVUA 2K9MA 2VQGA 1Y8RB 3DTIA 5FKNA 1BC7C 2QYOA 3GX4X 1OYWA 5ICCA 1G3YA 2ZNZA 1D0YA 1ACIA 1YHQI 3RSNA 2R7FA 2E35A 3DP7A 4D7NA 3C2GA 1ETOA 5EG0A 4JX5A 1A6IA 4KISA 4CXFA 3F9KA 2HWVA 4Y7NJ 1A04A 2TCTA 3E7LA 4ETSA 2DPUA 5CVJA 3HOYJ 1SMYF 1S3JA 2BXZA 3ZQQA 4XLPF 3H1CA 3SEZA 3PNTA 2E5ZA 1JHFA 2KISA 2ZXIA 3FMRA 1ETQA 4DW6A 2BZTA 2BVLA 3IAM2 1WJEA 2WB1N 3MCZA 1FEXA 1RC9A 3BG3A 1J2XA 4ITVA 3WGHA 2LTPA 5D5XB 4U88A 2OBPA 4A69C 3I64A 2OU2A 4CO8A 5J8FA 1CF7A 2M2EA 2VC0A 2BXYA 4NQWB 3T0YA 4ASNA 3W6VA 3DEUA 3FM5A 4ESJA 1MNDA 1APLC 1HC8A 2DOFA 2V1DA 5C3EJ 1UB9A 2G9WA 3TOAA 2IS2A 3I54A 2HPIA 1SMTA 2DJIA 3TBIA 5E3NA 5D5WB 4HPQA 1SFOJ 4XK4A 2P6SA 3VYSB 1BL0A 2OF7A 2L7FP 2UXNA 4M3FA 1T33A 5E1ZB 3AL0C 4EM1A 1XMXA 4A5NA 3E5UA 1T2KA 2F5DA 4PCQA 3BY6A 3GCMA 2ESHA 3I59B 2DT5A 2ZMEB 4JX4A 2X51A 3ABKH 3GZ6A 1LFUP 4BU2A 4RGSA 2WBMA 3BWGA 5CKTA 2XPUA 2PFBA 3D5LA 2LBFA 3HOVJ 2FJ1A 3WU2C 5L3DA 2K27A 4MQVA 3HKZA 2LY1A 4XRSA 4F52A 3HTSB 4L18B 4OWRB 3F8CA 1I6HJ 4EJWA 4MEXF 3ZP5A 4L9JA 1W36C 2W24A 4D5CA 1BBYA 2P5VA 4B8XA 1Z6TA 5FFXA 2ZJQF 3TL4X 1TNTA 2XGCA 1YQAA 2E1OA 2ZC2A 4R8HA 1SFUA 1ETWA 4IOCF 4OIOF 4X1EA 5AIQA 1ZKGA 3PNYA 3U1KA 3RCOA 3OY9A 2HI3A 2B9SA 3S2DJ 1YYVA 3CQZJ 3WE3A 2DMTA 2FBHA 3C18A 3TKYA 1Y8QB 2IGOA 4N4OB 4BE1A 3JSOA 4A3MJ 4HV6A 3CUQC 2M8GX 3NAUA 4LITA 1NG7A 4KNYA 1E2XA 2JA7J 1QU3A 4BL0B 1Y56A 4CUGA 3FXMA 1WH5A 4F93B 2EK5A 2JUGA 5FLVA 3HIFA 2ZJPF 2F48A 3LSRA 4F55A 2L9SA 4GO1A 4PJMA 3CJQB 3PUBA 4EV0A 4KT5C 3K2ZA 4ZTJA 4KJZA 5FFZA 2LNBA 4DNCA 4Z2YA 2DMUA 3OYNA 4X0GA 4RGXA 4XNFA 2LF8A 1QZZA 2OJED 5K1YA 2COBA 4UUTA 1P9QC 3HEFA 4I6ZA 4AIKA 5IT9Z 4FCYA 4ABZA 1ODDA 2E7WA 3F6VA 1FLIA 4F7ZA 3M7GA 1Z67A 3L7WA 4DBRA 3I5UA 5ILUA 5AONA 3SYTA 2VKEA 3M9AA 3VPRA 1BIAA 3SDBA 5M5XJ 4HQMA 1ZRDA 3WHCA 1W0UA 3LSHA 5ERIA 2DBBA 3BQYA 4B1RA 1P7JA 2XSJC 1HKTA 2GOMA 4IQ4A 2KLOA 4Z6YA 1X4OA 3G1LA 1BM9A 3CTAA 4KN7X 4A3FJ 3F3XA 2EIMH 2QLZA 4QSHA 1S5LC 2GIZA 2ZCWA 3BR3A 4UUSB 4I0BA 4PZJA 1TQMA 2G7UA 1QNTA 5BS6A 2VJ4A 2K40A 2D45A 4I09A 4L9NA 1UFMA 2RC4A 2PMZN 4ZTFA 1AWCA 2EZHA 1STZA 2XPVA 4HDVA 3OWTA 2KPMA 4V19K 4U87A 1JUSA 1U5TC 2JK3A 5ICEA 5J1RA 4HLXA 5KAIC 3TP3A 3RZDJ 2E71A 5B66C 1YRNA 3O6BB 1X1AA 1ZGJA 4DYRA 3JTGA 5DV5A 2KZGA 1XTAA 3I59A 3RJPA 3HHHA 3KEOA 3C3WA 1KU3A 2DMNA 2H6BA 3OYDA 1VI0A 3QYBA 3G4SI 4AU7A 2FEZA 2XROA 2NS0A 3KYDB 3CCMI 4A3DJ 1YFHA 2EFNA 2KT0A 3DV8A 3VODA 5E3MA 1SANA 1RKWA 1EA3A 4CCMA 4BACA 2IRFG 2IPQX 1YE9A 2W1OA 3F22A 1EV7A 4L9VA 1KU2A 3TQNA 5IT9K 2W57A 4G7OF 2CSOA 5IYDJ 3HPHA 3RYPA 3ZQ7A 4R1HA 3QU3A 4NC6A 1YW8A 3GO5A 2R7SA 2YX7A 4XOPA 1YJ9I 3GTKJ 4P1WA 1ON1A 1K79A 1BC8C 1Q1VA 3T1BA 2LP0A 3KE2A 3TDZC 3WG7H 1RESA 4PSWA 3HDDA 4BKXA 4KMUX 4KMFA 3IHUA 3HGGA 2P5LC 2FA5A 4S04A 2JA2A 2VXDA 4UVBA 5BNGA 5TJJA 4C3HJ 3GTMJ 2ZSIB 1Z3YA 1SFKA 2EB7A 3S32A 3VEPA 1IN6A 1MMAA 2HTJA 2EV5A 1SVMA 4M6VA 4ANJA 1HF0A 2QQAA 1PUFA 4NC8A 3K4LA 5IOYA 2O61A 4HNTA 2PLYA 5J4VA 5AIPA 4A3JJ 4XLHA 1XDSA 3S16J 4CA0A 2QENA 1IO2A 3KX2A 2R5YB 4BY1J 2Y69H 1MSEC 1DU0A 4ZH4F 4BXXJ 1J0RA 3HC7A 2P0WA 2MABA 4EVIA 2OCEA 4O6JA 3T5XA 2G0EA 3OYIA 3MFKA 3ZQHA 2M30A 3EQLF 2QSFX 3PFYA 5JHFA 2O6GE 3LAPA 2FX0A 3MEXA 1ZYRF 3BJ6A 1GDTA 4A3EJ 1K7AA 4Q48A 2ZSHB 1MBEA 2HQRA 1AA7A 1JI8A 1OCOH 2R3SA 4HX7A 4BQOA 1QHGA 3OYCA 5FKOA 3JCUC 2QBYB 1JXSA 2VXZA 4WXDA 4U7BA 3CC7I 3QYFA 1KZHA 4XSZF 1B72A 4NB5A 5EYRA 2RNGA 5GAGJ 3QP5A 2WAQA 4B47A 4IZZA 1FIAA 1Y39A 5CVIA 3JRBA 3HJEA 5GP9A 3JRCA 1O3QA 2IBDA 5HLTA 3SXYA 1ZQ3P 1GUUA 2ELHA 4JBAA 1WJCA 5CVVA 3S1MJ 4Q5SF 5LD2C 3J7YJ 5F1JA 1HBXG 4L5JA 1N78A 4JK1X 1HDPA 3K69A 1O3SA 2X1EA 4QTRA 2VQCA 3FXUA 2BY1A 2CO5A 3Q0VA 3HOUJ 3G73A 2E5NA 3NRVA 4M6XA 4B09A 1F1ZA 4XL9A 2YR2A 2E34A 1I5ZA 5JLXA 4GFBA 4P96A 5F27A 2PJPA 4ENNA 3DF8A 4KUMA 1W5SA 3JRIA 3GMEA 3CC2I 1BOBA 2NS8A 1YJWI 3ZRGA 3CO7C 1EH7A 1H89C 5K5OA 5E17F 2L9VA 4UV9A 3MQ0A 3RQ4A 1MDMB 2O9LA 1U8RA 2Z2SB 3FBNB 3ZMTA 2L5QA 4FE4A 4KIFA 3CCUI 1JJ8C 3AFHA 4B3AA 3G6EI 1GT0C 2ME0A 5FLXZ 3LL7A 3HL2A 5HDNA 4E7HA 2OQRA 2F4OB 1OCTC 1WVRA 2L3DA 3MZ8A 5FRMA 1MBGA 3CCRI 1KQ8A 4AIDA 1QZYA 1ENHA 2BW3B 5GAHJ 3OOUA 3CJRB 4WK8F 2HZTA 5EGOA 3FXRA 1G3WA 2DLLA 3G71I 3GTQJ 4TV7A 3HRUA 3RKYA 2XVCA 4HF2A 3LFUA 2DQLA 1IZ1A 3V8JA 4EQQA 3Q9VA 3CF2A 4PSXA 3GZ5A 1PUFB 3DTEA 2DMQA 1R1TA 3ASOH 1VQ7I 2GIVA 3F8FA 1BJZA 1MMNA 2E1MC 1IN7A 3HRTA 3ZMVA 2YS9A 4I01A 1PP7U 4C30A 4HOBA 1TWGJ 4PJNA 2JQ7A 4PJJA 1DDNA 4E7LA 3VYUB 4RBOA 2CGPA 4OMYA 4XM3A 3K1NA 2IS4A 2N8GA 5F64A 2KRFA 3WODF 1DGWY 3TO7A 1RKTA 2LMDA 3I0TA 2R5YA 1I1SA 2DODA 2Z1DA 1VQ9I 4XORA 5HNFA 3DBLB 2DFFA 3ZPLA 3CDLA 2L7KA 5HLHA 4NDLA 4RAGA 1SAXA 5M5YJ 1Y1VJ 3ZQGA 2PEXA 2DA7A 2OAZA 2VKDA 4IRGA 2GAUA 3ERMA 2M7BA 2OTJI 3TW6A 1JKOC 1S9HA 1R9TJ 4XR6A 1Q1HA 4XICA 2XSDC 2M4KA 5LRRA 3D1NI 3ML6A 2DT6A 1R00A 4IPAA 3GVAA 5E3LA 4D1QA 2HKXA 1JUPA 1IW7F 2NVYJ 3O3KA 1VTNC 2Q2EA 1A5JA 3G1MA 2IGMA 2M0CA 1YRNB 2Y48A 4WX9A 3OS0A 2Y9ZA 2JVGA 4BJ5C 5H2FC 5H6RA 3UKGA 5EZGA 1YW9A 3OSGA 2BVMA 3LSPA 1MBHA 3TO9A 2LC2A 3WTVC 2DO7A 2ECCA 3L2RA 3WU0A 2GXBA 2A61A 1U9OA 1WI9A 5IPAA 1XN7A 2VE8A 4M3EA 4EM2A 1QPIA 3OR2C 4AIHA 3R61A 1Z9CA 1AHDP 3V7CA 1ETYA 1T56A 4OIRF 1B9NA 2R7UA 1VQKI 2XAFA 1ORKA 3ZQCA 3HSEA 1WH7A 3QODA 2IXSA 1B8IA 2R7RA 3CCJI 1OLTA 3U21A 1FSEA 3GW2A 5DUIA 1Z7UA 3KZYA 1BOAA 4ENJA 1LDJA 3FKJA 3A01A 1OYIA 1QBJA 2EFWA 1OISA 2E1MB 2HDCA 3HGYA 3GTJJ 1RR8C 4RB0A 2K3FA 1B4AA 1S7EA 1PJRA 2KDOA 3OYFA 5EJCA 2M4GA 2V4JC 3T8TA 2V79A 1R4MB 3HHGA 1GXPA 2QCOA 2A07F 1S6LA 2OZ6A 4RDUA 2XAJA 2FOKA 3M1EA 4HNVA 4UUVA 1UAAA 1F36A 5DDGA 3H92A 1T0FC 2K9QA 2M8EA 4WWCA 4RAZA 3KP6A 1IGNA 4HRIA 5E20A 1ZLKA 4HSRA 2STWA 3VWBA 1LFBA 4FX0A 4YG2F 1MDMA 1A36A 2E19A 5FROA 1OCZH 2IA2A 4BDYA 5GTIC 1Y0UA 3CUOA 2DYSH 2VT2A 3JREA 3JSPA 4RGRA 2Z16A 2JT1A 5FO5A 5FJ8J 1R22A 2F5CA 2UV1A 2CQXA 1AKHB 3R4KA 1VQ4I 1IN4A 1MNEA 3GFIA 4J19A 3QOEA 1UCRA 3RKXA 2A6TA 5A2QK 2LRDA 4IHTA 5DD8A 2BY2A 2JZYA 2L7MP 2OCCH 4CDGA 2WTEA 2MD5A 4AM3A 5LRSA 3K70C 2EV6A 1BIBA 4I98B 5CQEA 3LSGA 2X6WA 4PK4A 3IP4B 4R79A 4A12A 2EWNA 2Y75A 1TTYA 4RS8A 1XCBA 3Q5FA 1O7LA 1TWFJ 3KPHA 2D5VA 2R7ZJ 1R58A 3RPQA 1R1VA 1FYMA 2F2EA 2XPWA 1HCRA 2ISYA 2FNAA 1OR7A 3HB9A 2OZUA 3OYAA 4N4NB 2R7WA 1RIOH 3BZ6A 1BI0A 2IGKA 3EDPA 2ISZA 2DAOA 3WTZA 3KYCB 3MZHA 1I6XA 3FK7A 1SFXA 4HZFA 4U0YA 3DBHB 1D8JA 2KDZA 1Z05A 3R60A 2LG4A 3KP2A 1YI2I 1IN5A 4RB3C 1IV6A 5EEHA 1RZ4A 4A5MA 2LD5A 2A3SA 1WWXA 1H0MA 3K4MA 3W2VA 2JUCA 4P5OA 3JRAA 3ZGKA 2IS6A 3EUHA 3OYBA 1MZBA 2M34A 2M45A 4RM3A 3U1DA 4UUSA 3L2CA 5FLXK 2BBYA 3E6MA 4I0AA 5DCFA 3L1PA 5IYCJ 1LE8B 4F3QA 1O4XA 1T38A 4EATA 2DT7B 1WRJA 2LKXA 2R7OA 1CQTA 3TGNA 1U5TB 4QIWN 1HSJA 2RKHA 3DPLC 2WAEA 3KCCA 2KRHA 5DEQA 5DD4A 1ETKA 1HA8A 5FD6A 5C4XJ 3I4PA 1OFCX 3FF5A 3LA7A 3ECHA 3BROA 2E2HJ 2R92J 1OCPA 2K4JA 3BTLA 3O8HA 1MH4A 2YU3A 3S14J 1LDKB 2X0LA 4P9FA 3E5XA 4XBFA 1H9TA 4HNUA 3LA3A 3KFWX 4QPQA 3CESA 1YITI 4ZJZA 4IHYA 3DPTA 2CUEA 5CJ9A 2IVMA 1EH6A 4G12A 4H0EA 2KP6A 3G3ZA 2CV2A 3MZYA 4EM0B 4M9ZA 2VASA 2LF7A 3JRDA 4BQAA 3KP4A 1MJAA 2LY9A 1Y6IA 2ZXWH 3LSIA 1ERDA 2BHYA 1U0JA 3BG7A 4HF1A 3CLQA 4E7SA 3NWTA 4KITB 1K6YA 3COAC 2X6XA 3VB2A 5EZHA 4C2MJ 2V9PA 1ZH5A 3K4JA 4DYQA 3OIQA 3SQNA 3DEWA 1FBUA 2XF7A 2RQQA 3U9GA 1K4TA 5E8GA 3FXJA 2G7HA 3GUDA 1O3RA 1B9MA 4ESBA 5LLQA 3L9FA 1WJDA 3PQJA 5IP6A 5J8CA 5LGUA 2VPRA 2HKOA 2HYFA 1I3AA 4DYCA 1V5FA 2A05A 3BZKA 1Z21A 2DK8A 3E6CC 3TW7A 4J00A 1BR2A 3G1OA 4MLOA 4NHJA 4PGHA 3HSFA 4FTHA 1SVOA 3BJOA 2EH3A 2F5FA 2GA2A 2UWMA 1USTA 1LFPA 2QA4I 1SD4A 1BW5A 2X6YA 2VPLA 5H6QA 1BR4A 2XDVA 3K10A 2ELJA 4EJVA 5K5RA 3X2QH 5L3FA 2QWWA 1GLNA 3K7AJ 5CQGA 1FIPA 1X2MA 3EUHC 1IAWA 3MD2A 4I76A 2H1LA 4OAYA 3JTHA 1UG0A 2XGDA 5IYBJ 4XSXF 2LDUA 4OOIA 4ZYHA 5IP7J 5IOZA 4LLNA 1WJFA 2KIFA 3WGIA 1TLHB 2UXXA 1LKXA 5DM6F 3OYHA 5HNHA 3C7JA 2OTLI 2TRTA 2HQAA 2XAQA 2FSWA 2X6OA 3VFZA 3OYLA 2EQRA 1IC8A 1YOVB 2LK2A 2LREA 1KA8A 2EZLA 5E3OA 4KIBA 4II2A 4AWXB 3A2KA 1T39A 1JKPC 2NOJB 4LMYA 2QVOA 4EJOA 3WTTC 3L2UA 3HG9A 5K7FA 1WZ2A 4Q4ZF 2QSHX 4C3JJ 4FISA 3CMEI 1PUEE 2Z33A 1F4KA 3C1DA 2Q2EB 2DI3A 3HM5A 3V8KA 1FT9A 1MBFA 1YIOA 1PP8F 1VQLI 3V7RA 5FB2A 1JGGA 2J5PA 2XKPA 2X1DA 5J47A 1UJ8A 4V2GA 2LY2A 1NK3P 1MSFC 1LUJB 3I9V2 2P4WA 5LGTA 2TDXA 4LG0B 2PI0A 1ZARA 2CW0F 5JVTA 1RETA 2QQ8A 1VQ6I 3I3LA 1ZLJA 3RPUA 1FOKA 3KLOA 3RZOJ 3M4OJ 1H9GA 3IKTA 2FOWA 1M1EB 2P5KA 3DEEA 1DPUA 3SJMA 4FASD 3WGGA 4RA2A 2Y30A 1JKQC 3A0BC 3PFIA 3PQKA 3KLNA 3WTYC 2VBYA 1VFCA 2MGQA 3S3OA 3ZN1A 4O5VA 5E18F 1I39A 5B1BH 3DLLF 1FP1D 1TP4A 2QKLB 3ESWB 3PSFA 1F5TA 2GXAA 2B0LA 2GA1A 3Q0UA 1VQPI 4IHWA 4CH7A 1MKMA 3CMMA 1WSUA 4PFOA 1QO0D 2Z9OA 1R7JA 3K4NA 3SFZA 2E2IJ 2EILH 1UZCA 1W0TA 1G4DA 3M8JA 2M0MA 4RLQA 2JTVA 2R7DA 3VSLA 2ZJ2A 1MMSA 4OU0A 2WC2A 3SDGA 2HXIA 3BG5A 5LHGA 2GOXB 1RPWA 2QSGX 2DOEA 2ZMEA 4XLCA 3ROUA 3FXQA 5D5UB 1KYZA 3FHZA 2V6EA 1WJAA 5JI6A 3I55I 1EJ9A 1DQUA 2FE3A 3J7ZI 3GEZA 1JKRC 1PDNC 2ADUA 5LEJA 2HTSA 2M9HA 2WADA 3S1RJ 1UELB 4BNCA 4XLNF 3N97A 5DYMA 2IA1A 2DQRA 1TNSA 3I53A 3I58A 1E3PA 1JUMA 2XB0X 4PJ0C 4PUSA 2CQQA 2NVUB 2DW4A 5D4RA 2CS3A 4G7ZF 4UXNA 2CRGA 3BZCA 4CYDA 3GZNB 4CICA 2DA2A 4HW0A 3HOWJ 2EFPA 2HYGD 3PM1A 2E36A 2Y0SN 3A1YA 4EEFG 2VKHA 3ZN0A 2NRAC 2CG4A 2LYCA 3OYKA 3I56I 2WV0A 3WHBA 2A5YB 3FXKA 4UHTA 3GWZA 1U2WA 3IRQA 3OR1C 3E3VA 5D4SA 2NVXJ 2UZKA 3MKYB 4BXUA 3CF5F 3QP6A 4E7KA 4KA4A 3QRFF 2JSPA 2KZVA 1FSHA 1N77A 1BN5A 1FY7A 3QWLA 3K2AA 2E60A 2XIGA 1ZREA 1R4NB 4ENKA 1D0ZA 1P4WA 1T6SA 2R4GA 3PUFA 4LJZF 4S0HB 5M5WJ 3TEDA 1ZR2A 3GTLJ 2R7VA 2ICWG 3CCVI 1UHSA 4HAMA 2BYVE 2XKOA 5F0CA 1SFEA 2ID3A 1ONVA 3CCQI 5IY5H 2F5VA 3CP8A 2AS5F 4A3BJ 4B3XA 4U0VA 4A0XA 1KU7A 3Q9SA 1X3ZB 3P9CA 2HPMA 3LSMA 4LIUA 4CCJA 2A6EF 4P55A 1U5TA 1RUNA 3CCEI 2BGCA 2H6CA 1U8BA 4KIGA 3OIOA 3H0GJ 3IV5A 2M87A 1V5EA 3FDYA 3CJTB 2IGNA 1FBQA 2ZO4A 3V8LA 1XSDA 2W4SA 3JRFA 3KP5A 4AYBN 2QBYA 5GPAA 3GYHX 3S17J 2VT3A 3ZMSA 3P9IA 2HQ5A 1MMDA 4OIPF 1FWZA 2NYXA 2XF5A 2BY0A 2OV7A 2HDDA 4ESFA 5C44J 1NG6A 4G94A 4XN3A 3HTUA 3A4CA 2KQRA 2LR8A 2FMYA 1O57A 2H8WA 2M5WA 4WCGA 2CW8A 3OS1A 3S8PA 1W36D 3H3VK 2IS1A 2ID6A 3W3CA 4GYGA 4A3LJ 5HVQC 3ZR8X 1IRGA 1WJ5A 2JA6J 1IRFA 2EIKH 4W97A 3CLOA 3PIOF 2HOAA 1LVKA 5L3EA 1Y1WJ 2XRNA 5F6FA 1IDYA 3MAJA 2K3PA 3FK6A 4M9SA 2EV0A 1ULYA 5D6EA 3RKQA 4MTEA 2L54A 2HYJA 2IJLA 2KHMA 3HOZJ 3F72A 1XD7A 4JYKA 4C2UA 3KETA 4LLGF 4XKCA 3IH3A 2CW7A 2EZKA 4G9YA 1Z0XA 5BPIA 4GDFA 1ZGAA 2QM3A 4BGDA 1VQ8I 1T98A 5KCMA 3IWZA 4N9HA 3E1SA 3RYRA 1ZN2A 4WXHA 2DFIA 1X2NA 3R0JA 1W7PB 4ZYGA 2H09A 1AU7A 1XGMA 3VSKA 4C2TA 1ETXA 2DJNA 2JA8J 1XPXA 4UVAA 3FMSA 1H8AC 3KP3A 3V4GA 2KIUA 3FKIJ 4BUPA 4Q47A 1FPQA 3OL3A 5F1RA 2QZ8A 3DU5A 4IOAF 3L2WA 2XB5A 2A68F 1P7IA 3WTXC 1T8IA 3JAMZ 4RB1A 3B02A 1Z1DA 1RR7A 3BR1A 4CZCA 5HODA 2FBIA 3DTKA 2XV4S 2IT0A 2FU4A 4LB5A 2RN7A 2KIMA 3GFMA 3VOEA 3BR6A 5FD5A 1QQIA 1MIJA 1TBXA 2DU9A 3EYYA 4MEYF 4PFPA 2MBFA 4H4KC 3AKZA 1TWAJ 3S3NA 3ZQLA 5HLIA 5D6FA 3TMOA 4NNJA 4IO9F 3BG6A 3I4NJ 2ESNA 2JN6A 2WAFA 2OD5A 4NC7A 1ZR4A 3FBIB 3RPUD 2BY3A 1PYVA 4YFKF 2H8RA 4XONA 3E6DA 1KQ9A 3LAJA 2A6HF 4BBRJ 4LB6B 2GWRA 4I7HA 3J7AO 2WV1A 1B8IB 4Y33A 4F92B 1S8NA 1U9NA 3CCLI 5L3BA 4OINF 2R0QC 3OMYA 1HKQA 2EIJH 2FBKA 2O3FA 2MA3A 4IHVA 2RQPA 5LHHA 2PJRA 4YIRX 5KVRA 2DFEA 5B3SH 2X9DA 4BJTA 2R5ZB 4YEJA 2H94A 3CJNA 1ZRFA 3ULQB 1FMVA 1J75A 4HX4A 3KP7A 4CZZA 2DMPA 4WF2A 3A02A 2A5WA 3MVPA 3K6GA 2VQHA 4L0ZB 5DTDA 3A0HC 2GQQA 3MMYB 2YSRA 3BPVA 1OCCH 2LLKA 1HQCA 2W85A 2DDAA 1RUOA 1D0XA 1XDUA 4AUXA 4RAYA 5EEGA 1SEUA 1LVAA 2R7XA 3PL8A 2ACJA 3HBLA 1P2FA 4KYWA 3CCYA 2PG4A 2Z99A 3EUKL 5H20A 1GHCA 1QGPA 2V9VA 2JRTA 4PJLA 4XLFA 1LNWA 1R71A 4M9XA 2DTZA 4UB6C 4HLYA 1LEAA 4JOMA 2M3AA 2HNHA 3EPZA 1DP3A 4IVNA 5IP9J 4ZDLA 2VQLA 3JRGA 3P9KA 5KAFC 2RREA 3W6KB 3ELKA 5LGNA 2LBFB 2O0YA 2COMA 4M72A 1S29A 4AC0A 2HR3A 2DN0A 1HKSA 2RGVA 1B6AA 1W7PA 3HZJA 4ZZDA 2AXLA 2CU7A 3H9JA 3CC4I 3M07A 4M73A 4E7ZA 2DPDA 1HW1A 4F91B 2J5OA 1MMGA 1T08B 2NNNA 3GXOA 3LMMA 1LEBA 1A6QA 1FX7A 2VJJA 2W84A 4IRHA 2LSOA 4ZZLA 1WJBA 5FRNA 2QQ9A 1YO5C 1OKRA 1MBJA 3JRHA 3EYIA 5HS9A 5HOOA 2MH2A 1J5YA 2ELKA 1FYKA 3FHNA 1G3TA 1ZG1A 4M3GA 4XKWA 4NQWA 3H35A 4AIJA 1JGSA 5DCMB 1SAUA 1BJAA 3LSKA 4UV8A 4II3A 2KKOA 2HXOA 1D5VA 3DBRB 3O2PE 3PSIA 3M1CA 2EA2A 3K1MA 4I02A 4N9IA 2HVRA 5B5EC 5HDGA 5F0HA 1K78B 3ZQFA 4MTDA 5J1UA 1XX5A 2LOOA 2OQGA 3ISPA 3DKXA 2V1XA 3O8GA 4UY8I 9ANTA 4CYCB 1P92A 3IUOA 2RAEA 1N25A 4DZPA 1EF4A 3OYGA 3CCSI 1EH8A 4QWQA 4DOZA 2XAUA 1LPQA 2CFXA 2ZFWA 4K2EA 4Y3OA 5E1WA 4DIQA 2K9LA 4FQGA 3CDHA 3ABMH 3DU6A 3ABUA 1X3UA 3M8EA 1FMWA 2LVSA 1XSVA 4V2FA 2W7NA 3KZZA 2BV6A 2L0KA 2VJIA 1NTCA 2BW3A 4YIFA 4C9YA 1QVTA 1TT0A 2MC4A 2YUSA 1GV5A 5IT3A 2EA4A 5EEAA 2XHKA 4A0ZA 1BA5A 1PVEA 5KNLA 2CUFA 4KDPA 3PNVA 4LG0A 2ZNYA 3HSRA 4LIVA 2GM4A 2HGCA 1MW7A 3NQOA 2V6CA 4XLEA 2FD5A 2ETHA 1TC3C 1FZPB 5EF6A 4XKVA 1KQ0A 4G6DA 3U2RA 1FBSA 3I4MJ 2XUBA 3N05A 1USSA 2CQKA 3UR3C 2Z3YA 1G2HA 3ERED 4FETA 2VOOA 4BBSJ 2R7QA 2IA0A 1QHHD 3OOPA 1O3TA 1W5CC 2PN6A 3DKWA 2R5ZA 2CJJA 3HUGB 1WFXA 3BCBA 4CCKA 5HS8A 2ZXJA 3LQQA 2DXIA 5EGOB 1SD5A 5ILSA 3E97A 1IF1A 3E0JB 2MH9A 3DWLE 4PDKA 4E6KG 4BJ6C 3I71A 3ABTA 2XC7A 1R5GA 2D2WA 3F8NA 1X1DA 4XN0A 1SD6A 1YX3A 3MKLA 4AD9A 3F8MA 2DCEA 4IF4A 1DPRA 3WG9A 3L09A 3ECOA 4BEHB 1HDDC 3K70D 4BHPA 5FLMJ 3DPUA 3IRRA 1FTTA 1K61A 2CWEA 3HRMA 4W1UA 2OC6A 3QPHA 1ITYA 1IXRC 3SEQA 4P9UA 3RIRA 4BHBA 4J01A 4ENMA 1B72B 3OIPA 2E2JJ 1D8KA 1WKMA 2RV8A 2WY8Q 1IUFA 2F4MB 1X58A 3IWFA 2CH0A 2V9KA 4EGYA 2EJRA 2XAHA 5JR3A 1ON2A 1FNNA 3B73A 3HXLA 2JMWA 4ZDPA 3BOQA 5DS9A 2O03A 2NOGA 4YRVA 5M3FJ 3WU1B 2NAZA 1E3OC 4IKFA 2EFQA 4D7MA 1FOXA 1V3FA 3HKZN 2DTRA 2QUFA 5F08A 3LA2A 1OPCA 1NK2P 3RQIA 2R93J 2FRHA 1DUXC 2IW5A 1JE8A 3ONQA 1LB2A 3PJRA 3S1QJ 5FKLA 4BXFA 2A69F 2W00A 3QPTA 5M3MJ 3BLYA 1BW6A 4E70A 1ZG3A 1J59A 2L01A 2L9RA 3S2HJ 3AG3H 4RMNA 5J6XA 1R5HA 3FXLA 3QOPA 1IXSB 1JT6A 5CYVA 5ILVA 2X4HA 1BR1A 4IEJA 4YFXF 5D8KB 2P8TA 3N4MA 2FMLA 4XQFA 2KRCA 3ABLH 5CPRB 5K5QA 1UHWA 3CMYA 3IL2A 3W6JB 3F6OA 3H5AA 5C4JJ 1CF7B 2YX4A 1KGSA 5KK1A 1VQMI 1IDZA 2VONA 4YFNF 2JJ7A 2Y2ZA 1ZRCA 1QRYA 1P4AA 2BEOA 3IH2A 3UNGC 2IEKA 4BDZA 2VL8A 2PJRB 2KIQA 1RRJA 3CO6C 4G7HF 1J7KA 1LE8A 1VQOI 1MH3A 1XGOA 4Y13A 1F43A 2D1HA 3DQVC 1SC7A 5TGTA 2P81A 1FP2A 3BTCA 4Y52J 4O3MA 2W82A 1WCMJ 3HPGA 4D0PA 3H3UA 1KYWA 1LQ1A 4DBQA 2VOPA 1G3SA 2HQNA 3H3ZA 4A6DA 3J80Z 3BTJA 3KEYA 2QQBA 4BQQA 3F8BA 3W2WA 1A31A 3DKYA 4EJUA 2VB6A 3JAMK 1W5TA 1QPMA 2D1VA 2K9NA 4XRSG 1R6RA 1HSTA 1DU6A 1MD0A 1U3EM 3GFLA 5A2QZ 2P6TA 1U6GA 2DA3A 2X85A 2VUMJ 1XSXA 3BJAA 2R7TA 1OJLA 3D0SA 3HOXJ 3B6CA 5LEKA 3FISA 1T95A 1R49A 1MJ9A 2ZMEC 1Z6RA 2VJ5A 3AG4H 4ZYDA 2OPTA 1TWHJ 1B1BA 1R23A 1I1GA 2KJBA 4YIIA 2HOTA 1R1UA 3GTOJ 2BE5F 3QYEA 3IH4A 1MJBA 4XOTA 3OSFA 2PQ8A 5J4YA 1W7PD 1Z7LA 2L7ZA 3BR5A 4RAFA 2H27A 1JTYA 3VYTB 4IQJA 4BY7J 1OQYA 4HBLA 5JLWA 1E0EA 2ME6A 1IJWC 5K7ZA 2OUMA 1A35A 5KHDA 1OCRH 4HSTA 3CZ6A 5K7HA 3HOTA 1G6NA 6PAXA 2M1BA 5ED4A 1XGNA 2HDWA 3H5NA 3K4BA 4B4CA 3FX3A 4XRFA 3AAFA 2XGEA 4U0WA 2NNYA 3KIOA 3T8RA 2L9NA 4HEA2 3H36A 1SVLA 4UB8C 4E4HA 1N75A 3J81K 2HOSA 1E17A 3HRSA 3VYRB 1V54H 4XRMA 3BTIA 1CGPA 3IC7A 4AYBA 2XF6A 1VQ5I 2EBIA 1YG2A 2LFBA 3F0CA 4A3CJ 1IN8A 5ICFA 2PBIA 5JHUA 4ZDOA 1IXCA 4ZYAA 3FMQA 1C0WA 1FJLA 1IRXA 4GYIA 1YX5A 1D3YA 2LKPA 4CGZA 2H1KA 3FIWA 1W1WE 5D8LB 2VI6A 2P7VB 3E6BA 3QU6A 4DJAA 3S3MA 2KMUA 3BPXA 3Q3SA 3LNQA 1YJNI 4G6TB 4M6YA 3ZMZA 4L5IA 1RNLA 1GVJA 2E1CA 4XMYA 3PO2J 2DYRH 2IAIA 3C2BA 4D5FA 4KT6A 3LQRA 2VIXA 2Y0MA 3ZMUA 3D5RC 2V26A 4G6QA 2V7FA 1XMAA 2VBZA 1HLVA 3A03A 5DUKA 1U78A 4KN4X 2XGXA 3NEUA 2I8DA 2JRMA 4GCVA 5LFAA 4MGRA 2PMHA 1POGA 4RLFA 4EJTA 3OL4A 4GXOA 1ZELA 2L2OA 2GBYA 1D1BA 3NWSA 3Q0WA 2V1NA 4WXCA 4IRIA 3K1PA 4IX7A 1J09A 2CQNA 4XLAA 1WGXA 4A2UA 1TQIA 2CMPA 2WAQN 1X1BA 2KJCA 1XGSA 5CVRA 2RNJA 5BMZA 4OMZA 3PIPF 2CYYA 4ZYEA 3NARA 2LH9A 3DFGA 4XKBA 4CCOA 2CFOA 2FXAA 2Q1ZB 2PMUA 2STTA 2K85A 3OYMA 1QZEA 3RTRA 2HFHA 5GAEJ 1R36A 2AO9A 2CV1A 1BI2A 2I5UA 4OIQF 3G2BA 1IUYA 1D5YA 2YU9J 2YPRA 2VLAA 4FE7A 2VBWA 4A3KJ 2ZB9A 3ZOBA 4Y17A 3FWEA 3ZCOA 3AL0B 4Y15A 2MC3A 3S1NJ 5FKKA 3W2AA 4XIDA 3M8FA 2XRLA 3QQAA 1G59A 4LFUA 3P5JA 4Y4RA 1SD7A 2ZBKA 4IL6C 1H88C 3GBGA 1K78A 2NS7A 2UUZA 4HA8A 4A93J 2K86A 4A3IJ 3L2QA 4M3BA 2FF4A 2ZFUA 2O8XA 1V55H 3K4CA 3SZGA 1HW2A 4JX6A 1S72I 4IJAA 1S7AA 4M3DA 4A3GJ 3VDXA 5EG0B 1AOYA 3H5RA 5DCMA 2NVQJ 4HQEA 2L4MA 2VKVA 4LK1F 3SZPA 2VODA 1GXQA 1LDDA 1QA6A 4NUBA 1I50J 2Y9YA
chains in the Genus database with same CATH topology
1OCPA 5IP9J 3BTLA 3JRGA 2PMZN 3O8HA 1MH4A 2EZHA 2XPVA 3S14J 1GVDA 4MFDA 1JUSA 2JK3A 2K9SA 5J1RA 2GLOA 3TP3A 1FTZA 3RZDJ 2MG4A 4IHYA 2CUEA 3BR2A 4AC0A 4G12A 1YRNA 4DYRA 2DN0A 3GTGJ 2CU7A 2DA4A 2FQ4A 3JRDA 2DMNA 2LY9A 1VI0A 2ECBA 4A3DJ 2KT0A 3LOCA 5E3MA 1SANA 1RKWA 1MBJA 3JRHA 1XS9A 5EZHA 4C2MJ 2B63J 4DYQA 2ELKA 3BT9A 3DEWA 4M3GA 5IYDJ 3MN2A 3GTKJ 1JT0A 4DZJA 1ZK8A 2HXOA 5IP6A 1Q1VA 2VPRA 2LP0A 4DYCA 5J1YA 1RESA 3HDDA 1QVUA 1MBKA 5F0HA 4BKXA 3TW7A 3HGGA 3G1OA 4MLOA 5J1UA 3ZQFA 5BNGA 4C3HJ 3TP0A 4FTHA 3GTMJ 2EH3A 3O8GA 9ANTA 4CYCB 2RAEA 4DZPA 2AHQA 4M6VA 1HF0A 1EF4A 1BW5A 4MIMA 1PUFA 2W48A 5IOYA 4A3JJ 4LOCA 3S16J 2DA1A 3K7AJ 1FIPA 1X2MA 4I76A 2LVSA 2R5YB 4V2FA 3A01B 5IYBJ 2XGDA 2L0KA 4BY1J 1MSEC 1NTCA 5IP7J 1DU0A 4BXXJ 5IOZA 1QVTA 1K83J 3GTPJ 2YUSA 1GV5A 2X48A 5EEAA 1BA5A 2G0EA 2CUFA 2TRTA 3ZQHA 2X6OA 2FX0A 2EQRA 1IC8A 2GM4A 2LK2A 2EZLA 2FD5A 5E3OA 1TC3C 5EF6A 1JKPC 1GDTA 4A3EJ 3I4MJ 5K7FA 1MBEA 4C3JJ 4IHXA 4FISA 3BR0A 1IRZA 3HM5A 2Y31A 1G2HA 1MBFA 5FKOA 4BBSJ 5EDNA 4MFEA 1JGGA 2R5ZA 2CJJA 1XC5A 4V2GA 1NK3P 1MSFC 5EGOB 1B72A 5EYRA 3QPSA 1RETA 3ZQIA 2JA5J 1FIAA 1ETVA 3JRBA 5GP9A 4C3IJ 3JRCA 2IBDA 2NVTJ 1ZQ3P 1GUUA 3RZOJ 3M4OJ 3S1MJ 4CYCA 1ZGWA 5GPCA 3SJMA 5F1JA 2Y30A 1JKQC 1HDPA 3MKLA 1I3QJ 1VFCA 1HDDC 2MGQA 1Z77A 3BQZA 5FLMJ 4QTRA 3S15J 1FTTA 1K61A 3B6AA 3HOUJ 3Q0VA 4W1UA 1ITYA 2E2JJ 1UG2A 1B72B 3Q0UA 4IHWA 5JLXA 1MNMC 1IUFA 4GFBA 3QPLA 1X58A 5F27A 2E2IJ 4JP0A 1W0TA 3JRIA 1VF9A 2MSYA 2JMWA 2NS8A 3JR9A 5DS9A 2NOGA 1H89C 5M3FJ 3LSJA 3BG9A 3SDGA 2HXIA 3BG5A 1E3OC 1RPWA 4D7MA 1GV2A 3HKZN 2O9LA 5F08A 1NK2P 3RQIA 2R93J 1JJ8C 4FE4A 4L5EA 3SFIA 4B3AA 1GT0C 3S1QJ 2ME0A 5FKLA 1JKRC 1OCTC 5M3MJ 2M9HA 3S1RJ 1MBGA 2MW8A 2QF7A 1BW6A 1ENHA 5FKMA 3OOUA 2L9RA 5EGOA 3S2HJ 1JUMA 2XB0X 4X6AJ 2CQQA 3GTQJ 1JT6A 2CRGA 1WPKA 2DA2A 2JWTA 4IEJA 3HOWJ 3PM1A 1PUFB 5F0FA 2Y0SN 1TWCJ 3CMYA 4EEFG 2DMQA 3DCFA 5C4JJ 2EZIA 1IDZA 1BJZA 2JJ7A 3WHBA 2Y2ZA 1QRYA 3IH2A 2YS9A 2IEKA 2NVXJ 1TWGJ 3M3YJ 2O8KA 1LE8A 4RBOA 1MH3A 1F43A 1JJ6C 2P81A 3BTCA 4Y52J 3K2AA 2N8GA 1UMQA 1WCMJ 1RKTA 2R5YA 1XG1A 5J3LA 4S0HB 5M5WJ 3TEDA 1ZR2A 3GTLJ 3BTJA 1UHSA 3CDLA 1HOMA 4NDLA 1WI3A 2I10A 5F0CA 1Y1VJ 3ZQGA 5M5YJ 2DA7A 4MO7A 2ID3A 5F04A 1ZTRA 2K9NA 3TW6A 1JKOC 4XRSG 1R9TJ 4XICA 4A3BJ 2XSDC 1DU6A 3D1NI 2VUMJ 2DA3A 5E3LA 1OJLA 2DA6A 3HOXJ 3B6CA 1JUPA 3FISA 2NVYJ 1JTXA 1IG7A 2O7OA 1VNDA 1A5JA 3G1MA 1AKHA 1U8BA 2OPTA 3PO3J 2M0CA 1TWHJ 1YRNB 3OIOA 3H0GJ 3IV5A 2Y9ZA 3UKGA 2DA5A 5EZGA 2HOTA 3GTOJ 3IH4A 3OSGA 3LSPA 1MBHA 5FKNA 3JRFA 4AYBN 5GPAA 3OSFA 2ECCA 3S17J 2HQ5A 2L7ZA 1U9OA 3BR5A 5IPAA 1JTYA 2HDDA 4M3EA 4D7NA 1QPIA 4BY7J 5JLWA 5C44J 1AHDP 1ETOA 2ME6A 4JX5A 5EG0A 1IJWC 1A6IA 5K7ZA 1ETYA 1T56A 1ORKA 4Y7NJ 2LR8A 5K7HA 3ZQCA 2TCTA 3E7LA 1WH7A 3HOYJ 1B8IA 3H3VK 4B4CA 2ID6A 2XGEA 4A3LJ 1ETQA 2JA6J 4DW6A 2HOSA 1FEXA 2WB1N 3A01A 4W97A 3BG3A 2HOAA 4XRMA 2LTPA 3BTIA 3HGYA 3GTJJ 1Y1WJ 4A69C 1IDYA 1S7EA 2M2EA 3FK6A 3W6VA 2EBIA 2LFBA 3RKQA 1APLC 3F0CA 5C3EJ 2QCOA 4A3CJ 2HYJA 4RDUA 3HOZJ 5E3NA 4JYKA 4HNVA 1FJLA 1SFOJ 1F36A 4XK4A 1BL0A 2OF7A 3IH3A 2L7FP 4M3FA 2K9QA 1T33A 2H1KA 2EZKA 3FIWA 1Z0XA 2VI6A 1IGNA 1X2NA 1LFBA 3Q3SA 3LNQA 4JX4A 1AU7A 1LFUP 2E19A 1ETXA 2DJNA 2XPUA 2JA8J 3HOVJ 2IAIA 2FJ1A 3C2BA 3PO2J 4D5FA 1H8AC 3JREA 4XRSA 3FKIJ 1I6HJ 1HLVA 2XB5A 5FJ8J 1P7IA 3A03A 4D5CA 1U78A 2CQXA 1AKHB 1RR7A 3BR1A 5HODA 2XGCA 2E1OA 4J19A 1ETWA 4X1EA 1POGA 2L7MP 1ZKGA 2GBYA 3BR6A 2HI3A 3Q0WA 3S2DJ 3CQZJ 2DMTA 1TWAJ 3LSGA 3ZQLA 4A3MJ 3I4NJ 1WGXA 2JN6A 2M8GX 1TWFJ 2D5VA 3NAUA 2R7ZJ 1ZR4A 2WAQN 2JA7J 2XPWA 1HCRA 1WH5A 2H8RA 3NARA 5FLVA 3HB9A 3LSRA 4BBRJ 2WV1A 1B8IB 2AO9A 1U9NA 2R0QC 3FK7A 2DMUA 4IHVA 2KDZA 1D5YA 2YU9J 2R5ZB 2X9DA 4I6ZA 2COBA 4UUTA 3HEFA 4FE7A 1IV6A 4A3KJ 2ZB9A 3ZOBA 4ABZA 4FCYA 2LD5A 3S1NJ 3JRAA 5FKKA 2DMPA 3A02A 4XIDA 3MVPA 2XRLA 3QQAA 2M34A 5DTDA 4UUSA 2LLKA 1H88C 2VKEA 3GBGA 3VPRA 2NS7A 5M5XJ 3L1PA 5IYCJ 1LE8B 4A93J 4A3IJ 4AUXA 1O4XA 4M3BA 3WHCA 1W0UA 2LKXA 3BQYA 3HBLA 4B1RA 1P7JA 1CQTA 3CCYA 4JX6A 4M3DA 4A3GJ 4QIWN 3G1LA 4A3FJ 4QSHA 5EG0B 2NVQJ 1ETKA 4UUSB 2DTZA 2VKVA 3BR3A 5C4XJ 1OFCX 1I50J 2K40A 2E2HJ 2R92J 2Y9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCP A;  5IP9 J;  3BTL A;  3JRG A;  2PMZ N;  3O8H A;  1MH4 A;  2EZH A;  2XPV A;  3S14 J;  1GVD A;  4MFD A;  1JUS A;  2JK3 A;  2K9S A;  5J1R A;  2GLO A;  3TP3 A;  1FTZ A;  3RZD J;  2MG4 A;  4IHY A;  2CUE A;  3BR2 A;  4AC0 A;  4G12 A;  1YRN A;  4DYR A;  2DN0 A;  3GTG J;  2CU7 A;  2DA4 A;  2FQ4 A;  3JRD A;  2DMN A;  2LY9 A;  1VI0 A;  2ECB A;  4A3D J;  2KT0 A;  3LOC A;  5E3M A;  1SAN A;  1RKW A;  1MBJ A;  3JRH A;  1XS9 A;  5EZH A;  4C2M J;  2B63 J;  4DYQ A;  2ELK A;  3BT9 A;  3DEW A;  4M3G A;  5IYD J;  3MN2 A;  3GTK J;  1JT0 A;  4DZJ A;  1ZK8 A;  2HXO A;  5IP6 A;  1Q1V A;  2VPR A;  2LP0 A;  4DYC A;  5J1Y A;  1RES A;  3HDD A;  1QVU A;  1MBK A;  5F0H A;  4BKX A;  3TW7 A;  3HGG A;  3G1O A;  4MLO A;  5J1U A;  3ZQF A;  5BNG A;  4C3H J;  3TP0 A;  4FTH A;  3GTM J;  2EH3 A;  3O8G A;  9ANT A;  4CYC B;  2RAE A;  4DZP A;  2AHQ A;  4M6V A;  1HF0 A;  1EF4 A;  1BW5 A;  4MIM A;  1PUF A;  2W48 A;  5IOY A;  4A3J J;  4LOC A;  3S16 J;  2DA1 A;  3K7A J;  1FIP A;  1X2M A;  4I76 A;  2LVS A;  2R5Y B;  4V2F A;  3A01 B;  5IYB J;  2XGD A;  2L0K A;  4BY1 J;  1MSE C;  1NTC A;  5IP7 J;  1DU0 A;  4BXX J;  5IOZ A;  1QVT A;  1K83 J;  3GTP J;  2YUS A;  1GV5 A;  2X48 A;  5EEA A;  1BA5 A;  2G0E A;  2CUF A;  2TRT A;  3ZQH A;  2X6O A;  2FX0 A;  2EQR A;  1IC8 A;  2GM4 A;  2LK2 A;  2EZL A;  2FD5 A;  5E3O A;  1TC3 C;  5EF6 A;  1JKP C;  1GDT A;  4A3E J;  3I4M J;  5K7F A;  1MBE A;  4C3J J;  4IHX A;  4FIS A;  3BR0 A;  1IRZ A;  3HM5 A;  2Y31 A;  1G2H A;  1MBF A;  5FKO A;  4BBS J;  5EDN A;  4MFE A;  1JGG A;  2R5Z A;  2CJJ A;  1XC5 A;  4V2G A;  1NK3 P;  1MSF C;  5EGO B;  1B72 A;  5EYR A;  3QPS A;  1RET A;  3ZQI A;  2JA5 J;  1FIA A;  1ETV A;  3JRB A;  5GP9 A;  4C3I J;  3JRC A;  2IBD A;  2NVT J;  1ZQ3 P;  1GUU A;  3RZO J;  3M4O J;  3S1M J;  4CYC A;  1ZGW A;  5GPC A;  3SJM A;  5F1J A;  2Y30 A;  1JKQ C;  1HDP A;  3MKL A;  1I3Q J;  1VFC A;  1HDD C;  2MGQ A;  1Z77 A;  3BQZ A;  5FLM J;  4QTR A;  3S15 J;  1FTT A;  1K61 A;  3B6A A;  3HOU J;  3Q0V A;  4W1U A;  1ITY A;  2E2J J;  1UG2 A;  1B72 B;  3Q0U A;  4IHW A;  5JLX A;  1MNM C;  1IUF A;  4GFB A;  3QPL A;  1X58 A;  5F27 A;  2E2I J;  4JP0 A;  1W0T A;  3JRI A;  1VF9 A;  2MSY A;  2JMW A;  2NS8 A;  3JR9 A;  5DS9 A;  2NOG A;  1H89 C;  5M3F J;  3LSJ A;  3BG9 A;  3SDG A;  2HXI A;  3BG5 A;  1E3O C;  1RPW A;  4D7M A;  1GV2 A;  3HKZ N;  2O9L A;  5F08 A;  1NK2 P;  3RQI A;  2R93 J;  1JJ8 C;  4FE4 A;  4L5E A;  3SFI A;  4B3A A;  1GT0 C;  3S1Q J;  2ME0 A;  5FKL A;  1JKR C;  1OCT C;  5M3M J;  2M9H A;  3S1R J;  1MBG A;  2MW8 A;  2QF7 A;  1BW6 A;  1ENH A;  5FKM A;  3OOU A;  2L9R A;  5EGO A;  3S2H J;  1JUM A;  2XB0 X;  4X6A J;  2CQQ A;  3GTQ J;  1JT6 A;  2CRG A;  1WPK A;  2DA2 A;  2JWT A;  4IEJ A;  3HOW J;  3PM1 A;  1PUF B;  5F0F A;  2Y0S N;  1TWC J;  3CMY A;  4EEF G;  2DMQ A;  3DCF A;  5C4J J;  2EZI A;  1IDZ A;  1BJZ A;  2JJ7 A;  3WHB A;  2Y2Z A;  1QRY A;  3IH2 A;  2YS9 A;  2IEK A;  2NVX J;  1TWG J;  3M3Y J;  2O8K A;  1LE8 A;  4RBO A;  1MH3 A;  1F43 A;  1JJ6 C;  2P81 A;  3BTC A;  4Y52 J;  3K2A A;  2N8G A;  1UMQ A;  1WCM J;  1RKT A;  2R5Y A;  1XG1 A;  5J3L A;  4S0H B;  5M5W J;  3TED A;  1ZR2 A;  3GTL J;  3BTJ A;  1UHS A;  3CDL A;  1HOM A;  4NDL A;  1WI3 A;  2I10 A;  5F0C A;  1Y1V J;  3ZQG A;  5M5Y J;  2DA7 A;  4MO7 A;  2ID3 A;  5F04 A;  1ZTR A;  2K9N A;  3TW6 A;  1JKO C;  4XRS G;  1R9T J;  4XIC A;  4A3B J;  2XSD C;  1DU6 A;  3D1N I;  2VUM J;  2DA3 A;  5E3L A;  1OJL A;  2DA6 A;  3HOX J;  3B6C A;  1JUP A;  3FIS A;  2NVY J;  1JTX A;  1IG7 A;  2O7O A;  1VND A;  1A5J A;  3G1M A;  1AKH A;  1U8B A;  2OPT A;  3PO3 J;  2M0C A;  1TWH J;  1YRN B;  3OIO A;  3H0G J;  3IV5 A;  2Y9Z A;  3UKG A;  2DA5 A;  5EZG A;  2HOT A;  3GTO J;  3IH4 A;  3OSG A;  3LSP A;  1MBH A;  5FKN A;  3JRF A;  4AYB N;  5GPA A;  3OSF A;  2ECC A;  3S17 J;  2HQ5 A;  2L7Z A;  1U9O A;  3BR5 A;  5IPA A;  1JTY A;  2HDD A;  4M3E A;  4D7N A;  1QPI A;  4BY7 J;  5JLW A;  5C44 J;  1AHD P;  1ETO A;  2ME6 A;  4JX5 A;  5EG0 A;  1IJW C;  1A6I A;  5K7Z A;  1ETY A;  1T56 A;  1ORK A;  4Y7N J;  2LR8 A;  5K7H A;  3ZQC A;  2TCT A;  3E7L A;  1WH7 A;  3HOY J;  1B8I A;  3H3V K;  4B4C A;  2ID6 A;  2XGE A;  4A3L J;  1ETQ A;  2JA6 J;  4DW6 A;  2HOS A;  1FEX A;  2WB1 N;  3A01 A;  4W97 A;  3BG3 A;  2HOA A;  4XRM A;  2LTP A;  3BTI A;  3HGY A;  3GTJ J;  1Y1W J;  4A69 C;  1IDY A;  1S7E A;  2M2E A;  3FK6 A;  3W6V A;  2EBI A;  2LFB A;  3RKQ A;  1APL C;  3F0C A;  5C3E J;  2QCO A;  4A3C J;  2HYJ A;  4RDU A;  3HOZ J;  5E3N A;  4JYK A;  4HNV A;  1FJL A;  1SFO J;  1F36 A;  4XK4 A;  1BL0 A;  2OF7 A;  3IH3 A;  2L7F P;  4M3F A;  2K9Q A;  1T33 A;  2H1K A;  2EZK A;  3FIW A;  1Z0X A;  2VI6 A;  1IGN A;  1X2N A;  1LFB A;  3Q3S A;  3LNQ A;  4JX4 A;  1AU7 A;  1LFU P;  2E19 A;  1ETX A;  2DJN A;  2XPU A;  2JA8 J;  3HOV J;  2IAI A;  2FJ1 A;  3C2B A;  3PO2 J;  4D5F A;  1H8A C;  3JRE A;  4XRS A;  3FKI J;  1I6H J;  1HLV A;  2XB5 A;  5FJ8 J;  1P7I A;  3A03 A;  4D5C A;  1U78 A;  2CQX A;  1AKH B;  1RR7 A;  3BR1 A;  5HOD A;  2XGC A;  2E1O A;  4J19 A;  1ETW A;  4X1E A;  1POG A;  2L7M P;  1ZKG A;  2GBY A;  3BR6 A;  2HI3 A;  3Q0W A;  3S2D J;  3CQZ J;  2DMT A;  1TWA J;  3LSG A;  3ZQL A;  4A3M J;  3I4N J;  1WGX A;  2JN6 A;  2M8G X;  1TWF J;  2D5V A;  3NAU A;  2R7Z J;  1ZR4 A;  2WAQ N;  2JA7 J;  2XPW A;  1HCR A;  1WH5 A;  2H8R A;  3NAR A;  5FLV A;  3HB9 A;  3LSR A;  4BBR J;  2WV1 A;  1B8I B;  2AO9 A;  1U9N A;  2R0Q C;  3FK7 A;  2DMU A;  4IHV A;  2KDZ A;  1D5Y A;  2YU9 J;  2R5Z B;  2X9D A;  4I6Z A;  2COB A;  4UUT A;  3HEF A;  4FE7 A;  1IV6 A;  4A3K J;  2ZB9 A;  3ZOB A;  4ABZ A;  4FCY A;  2LD5 A;  3S1N J;  3JRA A;  5FKK A;  2DMP A;  3A02 A;  4XID A;  3MVP A;  2XRL A;  3QQA A;  2M34 A;  5DTD A;  4UUS A;  2LLK A;  1H88 C;  2VKE A;  3GBG A;  3VPR A;  2NS7 A;  5M5X J;  3L1P A;  5IYC J;  1LE8 B;  4A93 J;  4A3I J;  4AUX A;  1O4X A;  4M3B A;  3WHC A;  1W0U A;  2LKX A;  3BQY A;  3HBL A;  4B1R A;  1P7J A;  1CQT A;  3CCY A;  4JX6 A;  4M3D A;  4A3G J;  4QIW N;  3G1L A;  4A3F J;  4QSH A;  5EG0 B;  2NVQ J;  1ETK A;  4UUS B;  2DTZ A;  2VKV A;  3BR3 A;  5C4X J;  1OFC X;  1I50 J;  2K40 A;  2E2H J;  2R92 J;  2Y9Y A; 
#chains in the Genus database with same CATH topology
 2P7C B;  4S05 A;  2K7L A;  2HVS A;  1GVD A;  5GAD J;  4MFD A;  1V4R A;  5GTH C;  2X1C A;  3DXJ F;  1YS7 A;  2K9S A;  2AQE A;  2O5R A;  4HV5 A;  4M74 A;  2FUG 2;  1LJ9 A;  2GXG A;  2GLO A;  1FTZ A;  2MG4 A;  4I2O A;  3BR2 A;  2RVC A;  2HOE A;  2PX9 A;  1X1P A;  3GTG J;  2ZXH A;  3D5S C;  4M71 A;  2DA4 A;  3CUQ A;  2FQ4 A;  1TQP A;  1BI3 A;  2JPB A;  4UNO A;  3ZXS A;  2DK5 A;  1P6R A;  5TRD A;  2JPC A;  3IKV A;  2C6Y A;  2ECB A;  2KFD A;  3RKW A;  4EGZ A;  2M7A A;  1ZAO A;  1X1C A;  4KIC A;  3V7S A;  3LOC A;  3MKZ A;  1RI7 A;  5DM7 F;  4YEL A;  1XCV A;  1DGR M;  2E1N A;  4QPO A;  4BE2 A;  1XS9 A;  2E7X A;  2B63 J;  3J80 K;  3BT9 A;  2W25 A;  3ZMD A;  1E3H A;  1HW5 A;  3GLX A;  3RDI A;  1FC3 A;  2FQ3 A;  2DFH A;  3MN2 A;  5L3C A;  1JT0 A;  1MGT A;  4DZJ A;  1ZK8 A;  5D5V B;  1OMI A;  3FXO A;  4FT8 A;  2K4B A;  1J9I A;  1HXD A;  2MD0 A;  4BYY A;  1D1A A;  1XMK A;  5J1Y A;  4B44 A;  5LBQ A;  2HZD A;  1QVU A;  1MBK A;  4DGW B;  3LFK A;  3WTS C;  3TOB A;  3S93 A;  3K0L A;  4QLC U;  3TP0 A;  4KFC A;  2EFO A;  2EIN H;  3EET A;  4EMS A;  3K9T A;  2PMZ A;  3BC8 A;  2AHQ A;  4D9J A;  4MIM A;  1K4S A;  2W48 A;  4BS9 A;  2KL4 A;  1ZHF A;  1NHA A;  4BE0 A;  2VN2 A;  1S7O A;  3KEQ A;  4LOC A;  4CCL A;  4HG2 A;  2DA1 A;  4ZC3 A;  3A01 B;  2ZJR F;  4L9T A;  3OYJ A;  3SZT A;  3OYE A;  3H0D A;  1K83 J;  3GTP J;  2OA4 A;  2F4I A;  2X48 A;  1BI1 A;  3RI4 A;  5J40 A;  4IHS A;  3JW4 A;  3K4K A;  3ASN H;  2HEO A;  3GFJ A;  2QKM B;  1R5I D;  3CDI A;  4FX4 A;  2WY7 Q;  1F9N A;  4BQN A;  1L3L A;  2JSC A;  2HS5 A;  4IHX A;  1VQN I;  1O7F A;  4HX8 A;  2K02 A;  3BR0 A;  1OR7 C;  1IRZ A;  4AVP A;  1YS6 A;  2DOA A;  4LLL A;  1Z3X A;  2JVH A;  1KON A;  2Y31 A;  3OV8 A;  4MQ9 F;  2AXT C;  1D1C A;  5EDN A;  2LKS A;  4MFE A;  2XAG A;  3WTU C;  2AQF A;  2GZW A;  1XC5 A;  2DDB A;  5E79 C;  3TO6 A;  1I27 A;  3MKW B;  4A0Y A;  1G8X A;  2BHZ A;  3BCA A;  4I99 C;  4B48 A;  3QPS A;  1X19 A;  3ZQI A;  5LHI A;  2JA5 J;  3F21 A;  4RGU A;  1ETV A;  4C3I J;  2ZKZ A;  1UHM A;  2NVT J;  5E1X A;  2L02 A;  3E5Q A;  4CYC A;  4U7D A;  4E7I A;  1ZGW A;  2MFZ A;  5GPC A;  1B59 A;  4HYE A;  2CUZ A;  5JFR A;  1VZ0 A;  2WA0 A;  1I3Q J;  4IXA A;  1YIJ I;  2MYS A;  3H9G A;  2QEX I;  3J7A Y;  1Z77 A;  3BQZ A;  3R0A A;  3REO A;  3S15 J;  3HYI A;  3B6A A;  3GLL A;  3C2H A;  1TW3 A;  2VBX A;  4JQF A;  1FOW A;  1UG2 A;  3LST A;  4RM2 A;  2VE9 A;  1MNM C;  3QPL A;  1Y0N A;  4CSW A;  1EKE A;  4JP0 A;  5BQT A;  1WQ2 A;  1VF9 A;  3DLA A;  3H9Q A;  5FGM A;  2MSY A;  2CQ7 A;  3JR9 A;  1IV8 A;  3OS2 A;  3LSJ A;  5TIS C;  3BG9 A;  1TW2 A;  4G8X A;  3HOS A;  1GV2 A;  3GF2 A;  5CLS A;  4UVC A;  1TL8 A;  3CMA I;  3LWF A;  4BAY A;  5BPD A;  4L5E A;  2WB1 A;  1K6O A;  2CUJ A;  3SFI A;  3WTW C;  2MLG A;  4BHC A;  1TZL A;  2BOL A;  2WWY A;  1Z91 A;  3BP8 A;  1REP C;  2EPF A;  2V1U A;  3J81 Z;  2MW8 A;  2QF7 A;  3L00 A;  4A6E A;  1ZG5 A;  3CP2 A;  4DQ2 A;  2F6C A;  5FKM A;  1JHH A;  2QGU A;  4X6A J;  1V5G A;  4LD5 A;  2RDP A;  2Z5U A;  2HVQ A;  1WPK A;  4B43 A;  3AG2 H;  2JWT A;  4HF0 A;  1YW7 A;  3L2V A;  2L4A A;  3QAH A;  5F0F A;  1TWC J;  3DCF A;  3FZV A;  4NBQ A;  5HLG A;  3TDU C;  1YTY A;  2EZI A;  1OYY A;  4MNU A;  5ICG A;  2B7E A;  5B1A H;  3FM3 A;  3SHF A;  1YLF A;  2NXN B;  1P4X A;  2F5E A;  1L0O C;  2K5C A;  5HDK A;  2HU9 A;  3KZI C;  3M3Y J;  2O8K A;  1X4P A;  4LG3 A;  3MWM A;  4HDU A;  5HS7 A;  1WHU A;  3EUA A;  3BDD A;  3KYL A;  2Q0O A;  2VC1 A;  1JJ6 C;  4LGW A;  3AG1 H;  2IP2 A;  1UMQ A;  5JVG F;  1TT5 B;  4CCN A;  1XG1 A;  5J3L A;  4RB2 C;  3V42 A;  4GGG A;  1FOY A;  3HUG A;  5E8I A;  1HOM A;  4FHT A;  4N0B A;  1NH3 A;  1DP7 P;  1KU9 A;  1WI3 A;  2I10 A;  2Q8K A;  1T0F A;  3S2W A;  4LK0 F;  4MO7 A;  4BEH A;  4BH9 A;  5L3G A;  5BOX A;  2FNP A;  4E7J A;  3P7N A;  5F04 A;  1ZTR A;  2Y0S A;  3CD6 I;  4PGG A;  4CHU A;  4OAZ A;  3F23 A;  2CV0 A;  3IAS 2;  4AVZ A;  3R6S A;  3WE2 A;  2MLK A;  2DA6 A;  4MHG A;  3CUQ B;  1JTX A;  1IG7 A;  2O7O A;  1VND A;  4L0Y B;  4GRI A;  1AKH A;  1X3W B;  3PO3 J;  2XAS A;  4ON0 A;  1XB4 A;  1FYL A;  1W4M A;  2DA5 A;  5CVU A;  2K9M A;  2VQG A;  1Y8R B;  3DTI A;  5FKN A;  1BC7 C;  2QYO A;  3GX4 X;  1OYW A;  5ICC A;  1G3Y A;  2ZNZ A;  1D0Y A;  1ACI A;  1YHQ I;  3RSN A;  2R7F A;  2E35 A;  3DP7 A;  4D7N A;  3C2G A;  1ETO A;  5EG0 A;  4JX5 A;  1A6I A;  4KIS A;  4CXF A;  3F9K A;  2HWV A;  4Y7N J;  1A04 A;  2TCT A;  3E7L A;  4ETS A;  2DPU A;  5CVJ A;  3HOY J;  1SMY F;  1S3J A;  2BXZ A;  3ZQQ A;  4XLP F;  3H1C A;  3SEZ A;  3PNT A;  2E5Z A;  1JHF A;  2KIS A;  2ZXI A;  3FMR A;  1ETQ A;  4DW6 A;  2BZT A;  2BVL A;  3IAM 2;  1WJE A;  2WB1 N;  3MCZ A;  1FEX A;  1RC9 A;  3BG3 A;  1J2X A;  4ITV A;  3WGH A;  2LTP A;  5D5X B;  4U88 A;  2OBP A;  4A69 C;  3I64 A;  2OU2 A;  4CO8 A;  5J8F A;  1CF7 A;  2M2E A;  2VC0 A;  2BXY A;  4NQW B;  3T0Y A;  4ASN A;  3W6V A;  3DEU A;  3FM5 A;  4ESJ A;  1MND A;  1APL C;  1HC8 A;  2DOF A;  2V1D A;  5C3E J;  1UB9 A;  2G9W A;  3TOA A;  2IS2 A;  3I54 A;  2HPI A;  1SMT A;  2DJI A;  3TBI A;  5E3N A;  5D5W B;  4HPQ A;  1SFO J;  4XK4 A;  2P6S A;  3VYS B;  1BL0 A;  2OF7 A;  2L7F P;  2UXN A;  4M3F A;  1T33 A;  5E1Z B;  3AL0 C;  4EM1 A;  1XMX A;  4A5N A;  3E5U A;  1T2K A;  2F5D A;  4PCQ A;  3BY6 A;  3GCM A;  2ESH A;  3I59 B;  2DT5 A;  2ZME B;  4JX4 A;  2X51 A;  3ABK H;  3GZ6 A;  1LFU P;  4BU2 A;  4RGS A;  2WBM A;  3BWG A;  5CKT A;  2XPU A;  2PFB A;  3D5L A;  2LBF A;  3HOV J;  2FJ1 A;  3WU2 C;  5L3D A;  2K27 A;  4MQV A;  3HKZ A;  2LY1 A;  4XRS A;  4F52 A;  3HTS B;  4L18 B;  4OWR B;  3F8C A;  1I6H J;  4EJW A;  4MEX F;  3ZP5 A;  4L9J A;  1W36 C;  2W24 A;  4D5C A;  1BBY A;  2P5V A;  4B8X A;  1Z6T A;  5FFX A;  2ZJQ F;  3TL4 X;  1TNT A;  2XGC A;  1YQA A;  2E1O A;  2ZC2 A;  4R8H A;  1SFU A;  1ETW A;  4IOC F;  4OIO F;  4X1E A;  5AIQ A;  1ZKG A;  3PNY A;  3U1K A;  3RCO A;  3OY9 A;  2HI3 A;  2B9S A;  3S2D J;  1YYV A;  3CQZ J;  3WE3 A;  2DMT A;  2FBH A;  3C18 A;  3TKY A;  1Y8Q B;  2IGO A;  4N4O B;  4BE1 A;  3JSO A;  4A3M J;  4HV6 A;  3CUQ C;  2M8G X;  3NAU A;  4LIT A;  1NG7 A;  4KNY A;  1E2X A;  2JA7 J;  1QU3 A;  4BL0 B;  1Y56 A;  4CUG A;  3FXM A;  1WH5 A;  4F93 B;  2EK5 A;  2JUG A;  5FLV A;  3HIF A;  2ZJP F;  2F48 A;  3LSR A;  4F55 A;  2L9S A;  4GO1 A;  4PJM A;  3CJQ B;  3PUB A;  4EV0 A;  4KT5 C;  3K2Z A;  4ZTJ A;  4KJZ A;  5FFZ A;  2LNB A;  4DNC A;  4Z2Y A;  2DMU A;  3OYN A;  4X0G A;  4RGX A;  4XNF A;  2LF8 A;  1QZZ A;  2OJE D;  5K1Y A;  2COB A;  4UUT A;  1P9Q C;  3HEF A;  4I6Z A;  4AIK A;  5IT9 Z;  4FCY A;  4ABZ A;  1ODD A;  2E7W A;  3F6V A;  1FLI A;  4F7Z A;  3M7G A;  1Z67 A;  3L7W A;  4DBR A;  3I5U A;  5ILU A;  5AON A;  3SYT A;  2VKE A;  3M9A A;  3VPR A;  1BIA A;  3SDB A;  5M5X J;  4HQM A;  1ZRD A;  3WHC A;  1W0U A;  3LSH A;  5ERI A;  2DBB A;  3BQY A;  4B1R A;  1P7J A;  2XSJ C;  1HKT A;  2GOM A;  4IQ4 A;  2KLO A;  4Z6Y A;  1X4O A;  3G1L A;  1BM9 A;  3CTA A;  4KN7 X;  4A3F J;  3F3X A;  2EIM H;  2QLZ A;  4QSH A;  1S5L C;  2GIZ A;  2ZCW A;  3BR3 A;  4UUS B;  4I0B A;  4PZJ A;  1TQM A;  2G7U A;  1QNT A;  5BS6 A;  2VJ4 A;  2K40 A;  2D45 A;  4I09 A;  4L9N A;  1UFM A;  2RC4 A;  2PMZ N;  4ZTF A;  1AWC A;  2EZH A;  1STZ A;  2XPV A;  4HDV A;  3OWT A;  2KPM A;  4V19 K;  4U87 A;  1JUS A;  1U5T C;  2JK3 A;  5ICE A;  5J1R A;  4HLX A;  5KAI C;  3TP3 A;  3RZD J;  2E71 A;  5B66 C;  1YRN A;  3O6B B;  1X1A A;  1ZGJ A;  4DYR A;  3JTG A;  5DV5 A;  2KZG A;  1XTA A;  3I59 A;  3RJP A;  3HHH A;  3KEO A;  3C3W A;  1KU3 A;  2DMN A;  2H6B A;  3OYD A;  1VI0 A;  3QYB A;  3G4S I;  4AU7 A;  2FEZ A;  2XRO A;  2NS0 A;  3KYD B;  3CCM I;  4A3D J;  1YFH A;  2EFN A;  2KT0 A;  3DV8 A;  3VOD A;  5E3M A;  1SAN A;  1RKW A;  1EA3 A;  4CCM A;  4BAC A;  2IRF G;  2IPQ X;  1YE9 A;  2W1O A;  3F22 A;  1EV7 A;  4L9V A;  1KU2 A;  3TQN A;  5IT9 K;  2W57 A;  4G7O F;  2CSO A;  5IYD J;  3HPH A;  3RYP A;  3ZQ7 A;  4R1H A;  3QU3 A;  4NC6 A;  1YW8 A;  3GO5 A;  2R7S A;  2YX7 A;  4XOP A;  1YJ9 I;  3GTK J;  4P1W A;  1ON1 A;  1K79 A;  1BC8 C;  1Q1V A;  3T1B A;  2LP0 A;  3KE2 A;  3TDZ C;  3WG7 H;  1RES A;  4PSW A;  3HDD A;  4BKX A;  4KMU X;  4KMF A;  3IHU A;  3HGG A;  2P5L C;  2FA5 A;  4S04 A;  2JA2 A;  2VXD A;  4UVB A;  5BNG A;  5TJJ A;  4C3H J;  3GTM J;  2ZSI B;  1Z3Y A;  1SFK A;  2EB7 A;  3S32 A;  3VEP A;  1IN6 A;  1MMA A;  2HTJ A;  2EV5 A;  1SVM A;  4M6V A;  4ANJ A;  1HF0 A;  2QQA A;  1PUF A;  4NC8 A;  3K4L A;  5IOY A;  2O61 A;  4HNT A;  2PLY A;  5J4V A;  5AIP A;  4A3J J;  4XLH A;  1XDS A;  3S16 J;  4CA0 A;  2QEN A;  1IO2 A;  3KX2 A;  2R5Y B;  4BY1 J;  2Y69 H;  1MSE C;  1DU0 A;  4ZH4 F;  4BXX J;  1J0R A;  3HC7 A;  2P0W A;  2MAB A;  4EVI A;  2OCE A;  4O6J A;  3T5X A;  2G0E A;  3OYI A;  3MFK A;  3ZQH A;  2M30 A;  3EQL F;  2QSF X;  3PFY A;  5JHF A;  2O6G E;  3LAP A;  2FX0 A;  3MEX A;  1ZYR F;  3BJ6 A;  1GDT A;  4A3E J;  1K7A A;  4Q48 A;  2ZSH B;  1MBE A;  2HQR A;  1AA7 A;  1JI8 A;  1OCO H;  2R3S A;  4HX7 A;  4BQO A;  1QHG A;  3OYC A;  5FKO A;  3JCU C;  2QBY B;  1JXS A;  2VXZ A;  4WXD A;  4U7B A;  3CC7 I;  3QYF A;  1KZH A;  4XSZ F;  1B72 A;  4NB5 A;  5EYR A;  2RNG A;  5GAG J;  3QP5 A;  2WAQ A;  4B47 A;  4IZZ A;  1FIA A;  1Y39 A;  5CVI A;  3JRB A;  3HJE A;  5GP9 A;  3JRC A;  1O3Q A;  2IBD A;  5HLT A;  3SXY A;  1ZQ3 P;  1GUU A;  2ELH A;  4JBA A;  1WJC A;  5CVV A;  3S1M J;  4Q5S F;  5LD2 C;  3J7Y J;  5F1J A;  1HBX G;  4L5J A;  1N78 A;  4JK1 X;  1HDP A;  3K69 A;  1O3S A;  2X1E A;  4QTR A;  2VQC A;  3FXU A;  2BY1 A;  2CO5 A;  3Q0V A;  3HOU J;  3G73 A;  2E5N A;  3NRV A;  4M6X A;  4B09 A;  1F1Z A;  4XL9 A;  2YR2 A;  2E34 A;  1I5Z A;  5JLX A;  4GFB A;  4P96 A;  5F27 A;  2PJP A;  4ENN A;  3DF8 A;  4KUM A;  1W5S A;  3JRI A;  3GME A;  3CC2 I;  1BOB A;  2NS8 A;  1YJW I;  3ZRG A;  3CO7 C;  1EH7 A;  1H89 C;  5K5O A;  5E17 F;  2L9V A;  4UV9 A;  3MQ0 A;  3RQ4 A;  1MDM B;  2O9L A;  1U8R A;  2Z2S B;  3FBN B;  3ZMT A;  2L5Q A;  4FE4 A;  4KIF A;  3CCU I;  1JJ8 C;  3AFH A;  4B3A A;  3G6E I;  1GT0 C;  2ME0 A;  5FLX Z;  3LL7 A;  3HL2 A;  5HDN A;  4E7H A;  2OQR A;  2F4O B;  1OCT C;  1WVR A;  2L3D A;  3MZ8 A;  5FRM A;  1MBG A;  3CCR I;  1KQ8 A;  4AID A;  1QZY A;  1ENH A;  2BW3 B;  5GAH J;  3OOU A;  3CJR B;  4WK8 F;  2HZT A;  5EGO A;  3FXR A;  1G3W A;  2DLL A;  3G71 I;  3GTQ J;  4TV7 A;  3HRU A;  3RKY A;  2XVC A;  4HF2 A;  3LFU A;  2DQL A;  1IZ1 A;  3V8J A;  4EQQ A;  3Q9V A;  3CF2 A;  4PSX A;  3GZ5 A;  1PUF B;  3DTE A;  2DMQ A;  1R1T A;  3ASO H;  1VQ7 I;  2GIV A;  3F8F A;  1BJZ A;  1MMN A;  2E1M C;  1IN7 A;  3HRT A;  3ZMV A;  2YS9 A;  4I01 A;  1PP7 U;  4C30 A;  4HOB A;  1TWG J;  4PJN A;  2JQ7 A;  4PJJ A;  1DDN A;  4E7L A;  3VYU B;  4RBO A;  2CGP A;  4OMY A;  4XM3 A;  3K1N A;  2IS4 A;  2N8G A;  5F64 A;  2KRF A;  3WOD F;  1DGW Y;  3TO7 A;  1RKT A;  2LMD A;  3I0T A;  2R5Y A;  1I1S A;  2DOD A;  2Z1D A;  1VQ9 I;  4XOR A;  5HNF A;  3DBL B;  2DFF A;  3ZPL A;  3CDL A;  2L7K A;  5HLH A;  4NDL A;  4RAG A;  1SAX A;  5M5Y J;  1Y1V J;  3ZQG A;  2PEX A;  2DA7 A;  2OAZ A;  2VKD A;  4IRG A;  2GAU A;  3ERM A;  2M7B A;  2OTJ I;  3TW6 A;  1JKO C;  1S9H A;  1R9T J;  4XR6 A;  1Q1H A;  4XIC A;  2XSD C;  2M4K A;  5LRR A;  3D1N I;  3ML6 A;  2DT6 A;  1R00 A;  4IPA A;  3GVA A;  5E3L A;  4D1Q A;  2HKX A;  1JUP A;  1IW7 F;  2NVY J;  3O3K A;  1VTN C;  2Q2E A;  1A5J A;  3G1M A;  2IGM A;  2M0C A;  1YRN B;  2Y48 A;  4WX9 A;  3OS0 A;  2Y9Z A;  2JVG A;  4BJ5 C;  5H2F C;  5H6R A;  3UKG A;  5EZG A;  1YW9 A;  3OSG A;  2BVM A;  3LSP A;  1MBH A;  3TO9 A;  2LC2 A;  3WTV C;  2DO7 A;  2ECC A;  3L2R A;  3WU0 A;  2GXB A;  2A61 A;  1U9O A;  1WI9 A;  5IPA A;  1XN7 A;  2VE8 A;  4M3E A;  4EM2 A;  1QPI A;  3OR2 C;  4AIH A;  3R61 A;  1Z9C A;  1AHD P;  3V7C A;  1ETY A;  1T56 A;  4OIR F;  1B9N A;  2R7U A;  1VQK I;  2XAF A;  1ORK A;  3ZQC A;  3HSE A;  1WH7 A;  3QOD A;  2IXS A;  1B8I A;  2R7R A;  3CCJ I;  1OLT A;  3U21 A;  1FSE A;  3GW2 A;  5DUI A;  1Z7U A;  3KZY A;  1BOA A;  4ENJ A;  1LDJ A;  3FKJ A;  3A01 A;  1OYI A;  1QBJ A;  2EFW A;  1OIS A;  2E1M B;  2HDC A;  3HGY A;  3GTJ J;  1RR8 C;  4RB0 A;  2K3F A;  1B4A A;  1S7E A;  1PJR A;  2KDO A;  3OYF A;  5EJC A;  2M4G A;  2V4J C;  3T8T A;  2V79 A;  1R4M B;  3HHG A;  1GXP A;  2QCO A;  2A07 F;  1S6L A;  2OZ6 A;  4RDU A;  2XAJ A;  2FOK A;  3M1E A;  4HNV A;  4UUV A;  1UAA A;  1F36 A;  5DDG A;  3H92 A;  1T0F C;  2K9Q A;  2M8E A;  4WWC A;  4RAZ A;  3KP6 A;  1IGN A;  4HRI A;  5E20 A;  1ZLK A;  4HSR A;  2STW A;  3VWB A;  1LFB A;  4FX0 A;  4YG2 F;  1MDM A;  1A36 A;  2E19 A;  5FRO A;  1OCZ H;  2IA2 A;  4BDY A;  5GTI C;  1Y0U A;  3CUO A;  2DYS H;  2VT2 A;  3JRE A;  3JSP A;  4RGR A;  2Z16 A;  2JT1 A;  5FO5 A;  5FJ8 J;  1R22 A;  2F5C A;  2UV1 A;  2CQX A;  1AKH B;  3R4K A;  1VQ4 I;  1IN4 A;  1MNE A;  3GFI A;  4J19 A;  3QOE A;  1UCR A;  3RKX A;  2A6T A;  5A2Q K;  2LRD A;  4IHT A;  5DD8 A;  2BY2 A;  2JZY A;  2L7M P;  2OCC H;  4CDG A;  2WTE A;  2MD5 A;  4AM3 A;  5LRS A;  3K70 C;  2EV6 A;  1BIB A;  4I98 B;  5CQE A;  3LSG A;  2X6W A;  4PK4 A;  3IP4 B;  4R79 A;  4A12 A;  2EWN A;  2Y75 A;  1TTY A;  4RS8 A;  1XCB A;  3Q5F A;  1O7L A;  1TWF J;  3KPH A;  2D5V A;  2R7Z J;  1R58 A;  3RPQ A;  1R1V A;  1FYM A;  2F2E A;  2XPW A;  1HCR A;  2ISY A;  2FNA A;  1OR7 A;  3HB9 A;  2OZU A;  3OYA A;  4N4N B;  2R7W A;  1RIO H;  3BZ6 A;  1BI0 A;  2IGK A;  3EDP A;  2ISZ A;  2DAO A;  3WTZ A;  3KYC B;  3MZH A;  1I6X A;  3FK7 A;  1SFX A;  4HZF A;  4U0Y A;  3DBH B;  1D8J A;  2KDZ A;  1Z05 A;  3R60 A;  2LG4 A;  3KP2 A;  1YI2 I;  1IN5 A;  4RB3 C;  1IV6 A;  5EEH A;  1RZ4 A;  4A5M A;  2LD5 A;  2A3S A;  1WWX A;  1H0M A;  3K4M A;  3W2V A;  2JUC A;  4P5O A;  3JRA A;  3ZGK A;  2IS6 A;  3EUH A;  3OYB A;  1MZB A;  2M34 A;  2M45 A;  4RM3 A;  3U1D A;  4UUS A;  3L2C A;  5FLX K;  2BBY A;  3E6M A;  4I0A A;  5DCF A;  3L1P A;  5IYC J;  1LE8 B;  4F3Q A;  1O4X A;  1T38 A;  4EAT A;  2DT7 B;  1WRJ A;  2LKX A;  2R7O A;  1CQT A;  3TGN A;  1U5T B;  4QIW N;  1HSJ A;  2RKH A;  3DPL C;  2WAE A;  3KCC A;  2KRH A;  5DEQ A;  5DD4 A;  1ETK A;  1HA8 A;  5FD6 A;  5C4X J;  3I4P A;  1OFC X;  3FF5 A;  3LA7 A;  3ECH A;  3BRO A;  2E2H J;  2R92 J;  1OCP A;  2K4J A;  3BTL A;  3O8H A;  1MH4 A;  2YU3 A;  3S14 J;  1LDK B;  2X0L A;  4P9F A;  3E5X A;  4XBF A;  1H9T A;  4HNU A;  3LA3 A;  3KFW X;  4QPQ A;  3CES A;  1YIT I;  4ZJZ A;  4IHY A;  3DPT A;  2CUE A;  5CJ9 A;  2IVM A;  1EH6 A;  4G12 A;  4H0E A;  2KP6 A;  3G3Z A;  2CV2 A;  3MZY A;  4EM0 B;  4M9Z A;  2VAS A;  2LF7 A;  3JRD A;  4BQA A;  3KP4 A;  1MJA A;  2LY9 A;  1Y6I A;  2ZXW H;  3LSI A;  1ERD A;  2BHY A;  1U0J A;  3BG7 A;  4HF1 A;  3CLQ A;  4E7S A;  3NWT A;  4KIT B;  1K6Y A;  3COA C;  2X6X A;  3VB2 A;  5EZH A;  4C2M J;  2V9P A;  1ZH5 A;  3K4J A;  4DYQ A;  3OIQ A;  3SQN A;  3DEW A;  1FBU A;  2XF7 A;  2RQQ A;  3U9G A;  1K4T A;  5E8G A;  3FXJ A;  2G7H A;  3GUD A;  1O3R A;  1B9M A;  4ESB A;  5LLQ A;  3L9F A;  1WJD A;  3PQJ A;  5IP6 A;  5J8C A;  5LGU A;  2VPR A;  2HKO A;  2HYF A;  1I3A A;  4DYC A;  1V5F A;  2A05 A;  3BZK A;  1Z21 A;  2DK8 A;  3E6C C;  3TW7 A;  4J00 A;  1BR2 A;  3G1O A;  4MLO A;  4NHJ A;  4PGH A;  3HSF A;  4FTH A;  1SVO A;  3BJO A;  2EH3 A;  2F5F A;  2GA2 A;  2UWM A;  1UST A;  1LFP A;  2QA4 I;  1SD4 A;  1BW5 A;  2X6Y A;  2VPL A;  5H6Q A;  1BR4 A;  2XDV A;  3K10 A;  2ELJ A;  4EJV A;  5K5R A;  3X2Q H;  5L3F A;  2QWW A;  1GLN A;  3K7A J;  5CQG A;  1FIP A;  1X2M A;  3EUH C;  1IAW A;  3MD2 A;  4I76 A;  2H1L A;  4OAY A;  3JTH A;  1UG0 A;  2XGD A;  5IYB J;  4XSX F;  2LDU A;  4OOI A;  4ZYH A;  5IP7 J;  5IOZ A;  4LLN A;  1WJF A;  2KIF A;  3WGI A;  1TLH B;  2UXX A;  1LKX A;  5DM6 F;  3OYH A;  5HNH A;  3C7J A;  2OTL I;  2TRT A;  2HQA A;  2XAQ A;  2FSW A;  2X6O A;  3VFZ A;  3OYL A;  2EQR A;  1IC8 A;  1YOV B;  2LK2 A;  2LRE A;  1KA8 A;  2EZL A;  5E3O A;  4KIB A;  4II2 A;  4AWX B;  3A2K A;  1T39 A;  1JKP C;  2NOJ B;  4LMY A;  2QVO A;  4EJO A;  3WTT C;  3L2U A;  3HG9 A;  5K7F A;  1WZ2 A;  4Q4Z F;  2QSH X;  4C3J J;  4FIS A;  3CME I;  1PUE E;  2Z33 A;  1F4K A;  3C1D A;  2Q2E B;  2DI3 A;  3HM5 A;  3V8K A;  1FT9 A;  1MBF A;  1YIO A;  1PP8 F;  1VQL I;  3V7R A;  5FB2 A;  1JGG A;  2J5P A;  2XKP A;  2X1D A;  5J47 A;  1UJ8 A;  4V2G A;  2LY2 A;  1NK3 P;  1MSF C;  1LUJ B;  3I9V 2;  2P4W A;  5LGT A;  2TDX A;  4LG0 B;  2PI0 A;  1ZAR A;  2CW0 F;  5JVT A;  1RET A;  2QQ8 A;  1VQ6 I;  3I3L A;  1ZLJ A;  3RPU A;  1FOK A;  3KLO A;  3RZO J;  3M4O J;  1H9G A;  3IKT A;  2FOW A;  1M1E B;  2P5K A;  3DEE A;  1DPU A;  3SJM A;  4FAS D;  3WGG A;  4RA2 A;  2Y30 A;  1JKQ C;  3A0B C;  3PFI A;  3PQK A;  3KLN A;  3WTY C;  2VBY A;  1VFC A;  2MGQ A;  3S3O A;  3ZN1 A;  4O5V A;  5E18 F;  1I39 A;  5B1B H;  3DLL F;  1FP1 D;  1TP4 A;  2QKL B;  3ESW B;  3PSF A;  1F5T A;  2GXA A;  2B0L A;  2GA1 A;  3Q0U A;  1VQP I;  4IHW A;  4CH7 A;  1MKM A;  3CMM A;  1WSU A;  4PFO A;  1QO0 D;  2Z9O A;  1R7J A;  3K4N A;  3SFZ A;  2E2I J;  2EIL H;  1UZC A;  1W0T A;  1G4D A;  3M8J A;  2M0M A;  4RLQ A;  2JTV A;  2R7D A;  3VSL A;  2ZJ2 A;  1MMS A;  4OU0 A;  2WC2 A;  3SDG A;  2HXI A;  3BG5 A;  5LHG A;  2GOX B;  1RPW A;  2QSG X;  2DOE A;  2ZME A;  4XLC A;  3ROU A;  3FXQ A;  5D5U B;  1KYZ A;  3FHZ A;  2V6E A;  1WJA A;  5JI6 A;  3I55 I;  1EJ9 A;  1DQU A;  2FE3 A;  3J7Z I;  3GEZ A;  1JKR C;  1PDN C;  2ADU A;  5LEJ A;  2HTS A;  2M9H A;  2WAD A;  3S1R J;  1UEL B;  4BNC A;  4XLN F;  3N97 A;  5DYM A;  2IA1 A;  2DQR A;  1TNS A;  3I53 A;  3I58 A;  1E3P A;  1JUM A;  2XB0 X;  4PJ0 C;  4PUS A;  2CQQ A;  2NVU B;  2DW4 A;  5D4R A;  2CS3 A;  4G7Z F;  4UXN A;  2CRG A;  3BZC A;  4CYD A;  3GZN B;  4CIC A;  2DA2 A;  4HW0 A;  3HOW J;  2EFP A;  2HYG D;  3PM1 A;  2E36 A;  2Y0S N;  3A1Y A;  4EEF G;  2VKH A;  3ZN0 A;  2NRA C;  2CG4 A;  2LYC A;  3OYK A;  3I56 I;  2WV0 A;  3WHB A;  2A5Y B;  3FXK A;  4UHT A;  3GWZ A;  1U2W A;  3IRQ A;  3OR1 C;  3E3V A;  5D4S A;  2NVX J;  2UZK A;  3MKY B;  4BXU A;  3CF5 F;  3QP6 A;  4E7K A;  4KA4 A;  3QRF F;  2JSP A;  2KZV A;  1FSH A;  1N77 A;  1BN5 A;  1FY7 A;  3QWL A;  3K2A A;  2E60 A;  2XIG A;  1ZRE A;  1R4N B;  4ENK A;  1D0Z A;  1P4W A;  1T6S A;  2R4G A;  3PUF A;  4LJZ F;  4S0H B;  5M5W J;  3TED A;  1ZR2 A;  3GTL J;  2R7V A;  2ICW G;  3CCV I;  1UHS A;  4HAM A;  2BYV E;  2XKO A;  5F0C A;  1SFE A;  2ID3 A;  1ONV A;  3CCQ I;  5IY5 H;  2F5V A;  3CP8 A;  2AS5 F;  4A3B J;  4B3X A;  4U0V A;  4A0X A;  1KU7 A;  3Q9S A;  1X3Z B;  3P9C A;  2HPM A;  3LSM A;  4LIU A;  4CCJ A;  2A6E F;  4P55 A;  1U5T A;  1RUN A;  3CCE I;  2BGC A;  2H6C A;  1U8B A;  4KIG A;  3OIO A;  3H0G J;  3IV5 A;  2M87 A;  1V5E A;  3FDY A;  3CJT B;  2IGN A;  1FBQ A;  2ZO4 A;  3V8L A;  1XSD A;  2W4S A;  3JRF A;  3KP5 A;  4AYB N;  2QBY A;  5GPA A;  3GYH X;  3S17 J;  2VT3 A;  3ZMS A;  3P9I A;  2HQ5 A;  1MMD A;  4OIP F;  1FWZ A;  2NYX A;  2XF5 A;  2BY0 A;  2OV7 A;  2HDD A;  4ESF A;  5C44 J;  1NG6 A;  4G94 A;  4XN3 A;  3HTU A;  3A4C A;  2KQR A;  2LR8 A;  2FMY A;  1O57 A;  2H8W A;  2M5W A;  4WCG A;  2CW8 A;  3OS1 A;  3S8P A;  1W36 D;  3H3V K;  2IS1 A;  2ID6 A;  3W3C A;  4GYG A;  4A3L J;  5HVQ C;  3ZR8 X;  1IRG A;  1WJ5 A;  2JA6 J;  1IRF A;  2EIK H;  4W97 A;  3CLO A;  3PIO F;  2HOA A;  1LVK A;  5L3E A;  1Y1W J;  2XRN A;  5F6F A;  1IDY A;  3MAJ A;  2K3P A;  3FK6 A;  4M9S A;  2EV0 A;  1ULY A;  5D6E A;  3RKQ A;  4MTE A;  2L54 A;  2HYJ A;  2IJL A;  2KHM A;  3HOZ J;  3F72 A;  1XD7 A;  4JYK A;  4C2U A;  3KET A;  4LLG F;  4XKC A;  3IH3 A;  2CW7 A;  2EZK A;  4G9Y A;  1Z0X A;  5BPI A;  4GDF A;  1ZGA A;  2QM3 A;  4BGD A;  1VQ8 I;  1T98 A;  5KCM A;  3IWZ A;  4N9H A;  3E1S A;  3RYR A;  1ZN2 A;  4WXH A;  2DFI A;  1X2N A;  3R0J A;  1W7P B;  4ZYG A;  2H09 A;  1AU7 A;  1XGM A;  3VSK A;  4C2T A;  1ETX A;  2DJN A;  2JA8 J;  1XPX A;  4UVA A;  3FMS A;  1H8A C;  3KP3 A;  3V4G A;  2KIU A;  3FKI J;  4BUP A;  4Q47 A;  1FPQ A;  3OL3 A;  5F1R A;  2QZ8 A;  3DU5 A;  4IOA F;  3L2W A;  2XB5 A;  2A68 F;  1P7I A;  3WTX C;  1T8I A;  3JAM Z;  4RB1 A;  3B02 A;  1Z1D A;  1RR7 A;  3BR1 A;  4CZC A;  5HOD A;  2FBI A;  3DTK A;  2XV4 S;  2IT0 A;  2FU4 A;  4LB5 A;  2RN7 A;  2KIM A;  3GFM A;  3VOE A;  3BR6 A;  5FD5 A;  1QQI A;  1MIJ A;  1TBX A;  2DU9 A;  3EYY A;  4MEY F;  4PFP A;  2MBF A;  4H4K C;  3AKZ A;  1TWA J;  3S3N A;  3ZQL A;  5HLI A;  5D6F A;  3TMO A;  4NNJ A;  4IO9 F;  3BG6 A;  3I4N J;  2ESN A;  2JN6 A;  2WAF A;  2OD5 A;  4NC7 A;  1ZR4 A;  3FBI B;  3RPU D;  2BY3 A;  1PYV A;  4YFK F;  2H8R A;  4XON A;  3E6D A;  1KQ9 A;  3LAJ A;  2A6H F;  4BBR J;  4LB6 B;  2GWR A;  4I7H A;  3J7A O;  2WV1 A;  1B8I B;  4Y33 A;  4F92 B;  1S8N A;  1U9N A;  3CCL I;  5L3B A;  4OIN F;  2R0Q C;  3OMY A;  1HKQ A;  2EIJ H;  2FBK A;  2O3F A;  2MA3 A;  4IHV A;  2RQP A;  5LHH A;  2PJR A;  4YIR X;  5KVR A;  2DFE A;  5B3S H;  2X9D A;  4BJT A;  2R5Z B;  4YEJ A;  2H94 A;  3CJN A;  1ZRF A;  3ULQ B;  1FMV A;  1J75 A;  4HX4 A;  3KP7 A;  4CZZ A;  2DMP A;  4WF2 A;  3A02 A;  2A5W A;  3MVP A;  3K6G A;  2VQH A;  4L0Z B;  5DTD A;  3A0H C;  2GQQ A;  3MMY B;  2YSR A;  3BPV A;  1OCC H;  2LLK A;  1HQC A;  2W85 A;  2DDA A;  1RUO A;  1D0X A;  1XDU A;  4AUX A;  4RAY A;  5EEG A;  1SEU A;  1LVA A;  2R7X A;  3PL8 A;  2ACJ A;  3HBL A;  1P2F A;  4KYW A;  3CCY A;  2PG4 A;  2Z99 A;  3EUK L;  5H20 A;  1GHC A;  1QGP A;  2V9V A;  2JRT A;  4PJL A;  4XLF A;  1LNW A;  1R71 A;  4M9X A;  2DTZ A;  4UB6 C;  4HLY A;  1LEA A;  4JOM A;  2M3A A;  2HNH A;  3EPZ A;  1DP3 A;  4IVN A;  5IP9 J;  4ZDL A;  2VQL A;  3JRG A;  3P9K A;  5KAF C;  2RRE A;  3W6K B;  3ELK A;  5LGN A;  2LBF B;  2O0Y A;  2COM A;  4M72 A;  1S29 A;  4AC0 A;  2HR3 A;  2DN0 A;  1HKS A;  2RGV A;  1B6A A;  1W7P A;  3HZJ A;  4ZZD A;  2AXL A;  2CU7 A;  3H9J A;  3CC4 I;  3M07 A;  4M73 A;  4E7Z A;  2DPD A;  1HW1 A;  4F91 B;  2J5O A;  1MMG A;  1T08 B;  2NNN A;  3GXO A;  3LMM A;  1LEB A;  1A6Q A;  1FX7 A;  2VJJ A;  2W84 A;  4IRH A;  2LSO A;  4ZZL A;  1WJB A;  5FRN A;  2QQ9 A;  1YO5 C;  1OKR A;  1MBJ A;  3JRH A;  3EYI A;  5HS9 A;  5HOO A;  2MH2 A;  1J5Y A;  2ELK A;  1FYK A;  3FHN A;  1G3T A;  1ZG1 A;  4M3G A;  4XKW A;  4NQW A;  3H35 A;  4AIJ A;  1JGS A;  5DCM B;  1SAU A;  1BJA A;  3LSK A;  4UV8 A;  4II3 A;  2KKO A;  2HXO A;  1D5V A;  3DBR B;  3O2P E;  3PSI A;  3M1C A;  2EA2 A;  3K1M A;  4I02 A;  4N9I A;  2HVR A;  5B5E C;  5HDG A;  5F0H A;  1K78 B;  3ZQF A;  4MTD A;  5J1U A;  1XX5 A;  2LOO A;  2OQG A;  3ISP A;  3DKX A;  2V1X A;  3O8G A;  4UY8 I;  9ANT A;  4CYC B;  1P92 A;  3IUO A;  2RAE A;  1N25 A;  4DZP A;  1EF4 A;  3OYG A;  3CCS I;  1EH8 A;  4QWQ A;  4DOZ A;  2XAU A;  1LPQ A;  2CFX A;  2ZFW A;  4K2E A;  4Y3O A;  5E1W A;  4DIQ A;  2K9L A;  4FQG A;  3CDH A;  3ABM H;  3DU6 A;  3ABU A;  1X3U A;  3M8E A;  1FMW A;  2LVS A;  1XSV A;  4V2F A;  2W7N A;  3KZZ A;  2BV6 A;  2L0K A;  2VJI A;  1NTC A;  2BW3 A;  4YIF A;  4C9Y A;  1QVT A;  1TT0 A;  2MC4 A;  2YUS A;  1GV5 A;  5IT3 A;  2EA4 A;  5EEA A;  2XHK A;  4A0Z A;  1BA5 A;  1PVE A;  5KNL A;  2CUF A;  4KDP A;  3PNV A;  4LG0 A;  2ZNY A;  3HSR A;  4LIV A;  2GM4 A;  2HGC A;  1MW7 A;  3NQO A;  2V6C A;  4XLE A;  2FD5 A;  2ETH A;  1TC3 C;  1FZP B;  5EF6 A;  4XKV A;  1KQ0 A;  4G6D A;  3U2R A;  1FBS A;  3I4M J;  2XUB A;  3N05 A;  1USS A;  2CQK A;  3UR3 C;  2Z3Y A;  1G2H A;  3ERE D;  4FET A;  2VOO A;  4BBS J;  2R7Q A;  2IA0 A;  1QHH D;  3OOP A;  1O3T A;  1W5C C;  2PN6 A;  3DKW A;  2R5Z A;  2CJJ A;  3HUG B;  1WFX A;  3BCB A;  4CCK A;  5HS8 A;  2ZXJ A;  3LQQ A;  2DXI A;  5EGO B;  1SD5 A;  5ILS A;  3E97 A;  1IF1 A;  3E0J B;  2MH9 A;  3DWL E;  4PDK A;  4E6K G;  4BJ6 C;  3I71 A;  3ABT A;  2XC7 A;  1R5G A;  2D2W A;  3F8N A;  1X1D A;  4XN0 A;  1SD6 A;  1YX3 A;  3MKL A;  4AD9 A;  3F8M A;  2DCE A;  4IF4 A;  1DPR A;  3WG9 A;  3L09 A;  3ECO A;  4BEH B;  1HDD C;  3K70 D;  4BHP A;  5FLM J;  3DPU A;  3IRR A;  1FTT A;  1K61 A;  2CWE A;  3HRM A;  4W1U A;  2OC6 A;  3QPH A;  1ITY A;  1IXR C;  3SEQ A;  4P9U A;  3RIR A;  4BHB A;  4J01 A;  4ENM A;  1B72 B;  3OIP A;  2E2J J;  1D8K A;  1WKM A;  2RV8 A;  2WY8 Q;  1IUF A;  2F4M B;  1X58 A;  3IWF A;  2CH0 A;  2V9K A;  4EGY A;  2EJR A;  2XAH A;  5JR3 A;  1ON2 A;  1FNN A;  3B73 A;  3HXL A;  2JMW A;  4ZDP A;  3BOQ A;  5DS9 A;  2O03 A;  2NOG A;  4YRV A;  5M3F J;  3WU1 B;  2NAZ A;  1E3O C;  4IKF A;  2EFQ A;  4D7M A;  1FOX A;  1V3F A;  3HKZ N;  2DTR A;  2QUF A;  5F08 A;  3LA2 A;  1OPC A;  1NK2 P;  3RQI A;  2R93 J;  2FRH A;  1DUX C;  2IW5 A;  1JE8 A;  3ONQ A;  1LB2 A;  3PJR A;  3S1Q J;  5FKL A;  4BXF A;  2A69 F;  2W00 A;  3QPT A;  5M3M J;  3BLY A;  1BW6 A;  4E70 A;  1ZG3 A;  1J59 A;  2L01 A;  2L9R A;  3S2H J;  3AG3 H;  4RMN A;  5J6X A;  1R5H A;  3FXL A;  3QOP A;  1IXS B;  1JT6 A;  5CYV A;  5ILV A;  2X4H A;  1BR1 A;  4IEJ A;  4YFX F;  5D8K B;  2P8T A;  3N4M A;  2FML A;  4XQF A;  2KRC A;  3ABL H;  5CPR B;  5K5Q A;  1UHW A;  3CMY A;  3IL2 A;  3W6J B;  3F6O A;  3H5A A;  5C4J J;  1CF7 B;  2YX4 A;  1KGS A;  5KK1 A;  1VQM I;  1IDZ A;  2VON A;  4YFN F;  2JJ7 A;  2Y2Z A;  1ZRC A;  1QRY A;  1P4A A;  2BEO A;  3IH2 A;  3UNG C;  2IEK A;  4BDZ A;  2VL8 A;  2PJR B;  2KIQ A;  1RRJ A;  3CO6 C;  4G7H F;  1J7K A;  1LE8 A;  1VQO I;  1MH3 A;  1XGO A;  4Y13 A;  1F43 A;  2D1H A;  3DQV C;  1SC7 A;  5TGT A;  2P81 A;  1FP2 A;  3BTC A;  4Y52 J;  4O3M A;  2W82 A;  1WCM J;  3HPG A;  4D0P A;  3H3U A;  1KYW A;  1LQ1 A;  4DBQ A;  2VOP A;  1G3S A;  2HQN A;  3H3Z A;  4A6D A;  3J80 Z;  3BTJ A;  3KEY A;  2QQB A;  4BQQ A;  3F8B A;  3W2W A;  1A31 A;  3DKY A;  4EJU A;  2VB6 A;  3JAM K;  1W5T A;  1QPM A;  2D1V A;  2K9N A;  4XRS G;  1R6R A;  1HST A;  1DU6 A;  1MD0 A;  1U3E M;  3GFL A;  5A2Q Z;  2P6T A;  1U6G A;  2DA3 A;  2X85 A;  2VUM J;  1XSX A;  3BJA A;  2R7T A;  1OJL A;  3D0S A;  3HOX J;  3B6C A;  5LEK A;  3FIS A;  1T95 A;  1R49 A;  1MJ9 A;  2ZME C;  1Z6R A;  2VJ5 A;  3AG4 H;  4ZYD A;  2OPT A;  1TWH J;  1B1B A;  1R23 A;  1I1G A;  2KJB A;  4YII A;  2HOT A;  1R1U A;  3GTO J;  2BE5 F;  3QYE A;  3IH4 A;  1MJB A;  4XOT A;  3OSF A;  2PQ8 A;  5J4Y A;  1W7P D;  1Z7L A;  2L7Z A;  3BR5 A;  4RAF A;  2H27 A;  1JTY A;  3VYT B;  4IQJ A;  4BY7 J;  1OQY A;  4HBL A;  5JLW A;  1E0E A;  2ME6 A;  1IJW C;  5K7Z A;  2OUM A;  1A35 A;  5KHD A;  1OCR H;  4HST A;  3CZ6 A;  5K7H A;  3HOT A;  1G6N A;  6PAX A;  2M1B A;  5ED4 A;  1XGN A;  2HDW A;  3H5N A;  3K4B A;  4B4C A;  3FX3 A;  4XRF A;  3AAF A;  2XGE A;  4U0W A;  2NNY A;  3KIO A;  3T8R A;  2L9N A;  4HEA 2;  3H36 A;  1SVL A;  4UB8 C;  4E4H A;  1N75 A;  3J81 K;  2HOS A;  1E17 A;  3HRS A;  3VYR B;  1V54 H;  4XRM A;  3BTI A;  1CGP A;  3IC7 A;  4AYB A;  2XF6 A;  1VQ5 I;  2EBI A;  1YG2 A;  2LFB A;  3F0C A;  4A3C J;  1IN8 A;  5ICF A;  2PBI A;  5JHU A;  4ZDO A;  1IXC A;  4ZYA A;  3FMQ A;  1C0W A;  1FJL A;  1IRX A;  4GYI A;  1YX5 A;  1D3Y A;  2LKP A;  4CGZ A;  2H1K A;  3FIW A;  1W1W E;  5D8L B;  2VI6 A;  2P7V B;  3E6B A;  3QU6 A;  4DJA A;  3S3M A;  2KMU A;  3BPX A;  3Q3S A;  3LNQ A;  1YJN I;  4G6T B;  4M6Y A;  3ZMZ A;  4L5I A;  1RNL A;  1GVJ A;  2E1C A;  4XMY A;  3PO2 J;  2DYR H;  2IAI A;  3C2B A;  4D5F A;  4KT6 A;  3LQR A;  2VIX A;  2Y0M A;  3ZMU A;  3D5R C;  2V26 A;  4G6Q A;  2V7F A;  1XMA A;  2VBZ A;  1HLV A;  3A03 A;  5DUK A;  1U78 A;  4KN4 X;  2XGX A;  3NEU A;  2I8D A;  2JRM A;  4GCV A;  5LFA A;  4MGR A;  2PMH A;  1POG A;  4RLF A;  4EJT A;  3OL4 A;  4GXO A;  1ZEL A;  2L2O A;  2GBY A;  1D1B A;  3NWS A;  3Q0W A;  2V1N A;  4WXC A;  4IRI A;  3K1P A;  4IX7 A;  1J09 A;  2CQN A;  4XLA A;  1WGX A;  4A2U A;  1TQI A;  2CMP A;  2WAQ N;  1X1B A;  2KJC A;  1XGS A;  5CVR A;  2RNJ A;  5BMZ A;  4OMZ A;  3PIP F;  2CYY A;  4ZYE A;  3NAR A;  2LH9 A;  3DFG A;  4XKB A;  4CCO A;  2CFO A;  2FXA A;  2Q1Z B;  2PMU A;  2STT A;  2K85 A;  3OYM A;  1QZE A;  3RTR A;  2HFH A;  5GAE J;  1R36 A;  2AO9 A;  2CV1 A;  1BI2 A;  2I5U A;  4OIQ F;  3G2B A;  1IUY A;  1D5Y A;  2YU9 J;  2YPR A;  2VLA A;  4FE7 A;  2VBW A;  4A3K J;  2ZB9 A;  3ZOB A;  4Y17 A;  3FWE A;  3ZCO A;  3AL0 B;  4Y15 A;  2MC3 A;  3S1N J;  5FKK A;  3W2A A;  4XID A;  3M8F A;  2XRL A;  3QQA A;  1G59 A;  4LFU A;  3P5J A;  4Y4R A;  1SD7 A;  2ZBK A;  4IL6 C;  1H88 C;  3GBG A;  1K78 A;  2NS7 A;  2UUZ A;  4HA8 A;  4A93 J;  2K86 A;  4A3I J;  3L2Q A;  4M3B A;  2FF4 A;  2ZFU A;  2O8X A;  1V55 H;  3K4C A;  3SZG A;  1HW2 A;  4JX6 A;  1S72 I;  4IJA A;  1S7A A;  4M3D A;  4A3G J;  3VDX A;  5EG0 B;  1AOY A;  3H5R A;  5DCM A;  2NVQ J;  4HQE A;  2L4M A;  2VKV A;  4LK1 F;  3SZP A;  2VOD A;  1GXQ A;  1LDD A;  1QA6 A;  4NUB A;  1I50 J;  2Y9Y A; 
#chains in the Genus database with same CATH homology
 1OCP A;  5IP9 J;  3BTL A;  3JRG A;  2PMZ N;  3O8H A;  1MH4 A;  2EZH A;  2XPV A;  3S14 J;  1GVD A;  4MFD A;  1JUS A;  2JK3 A;  2K9S A;  5J1R A;  2GLO A;  3TP3 A;  1FTZ A;  3RZD J;  2MG4 A;  4IHY A;  2CUE A;  3BR2 A;  4AC0 A;  4G12 A;  1YRN A;  4DYR A;  2DN0 A;  3GTG J;  2CU7 A;  2DA4 A;  2FQ4 A;  3JRD A;  2DMN A;  2LY9 A;  1VI0 A;  2ECB A;  4A3D J;  2KT0 A;  3LOC A;  5E3M A;  1SAN A;  1RKW A;  1MBJ A;  3JRH A;  1XS9 A;  5EZH A;  4C2M J;  2B63 J;  4DYQ A;  2ELK A;  3BT9 A;  3DEW A;  4M3G A;  5IYD J;  3MN2 A;  3GTK J;  1JT0 A;  4DZJ A;  1ZK8 A;  2HXO A;  5IP6 A;  1Q1V A;  2VPR A;  2LP0 A;  4DYC A;  5J1Y A;  1RES A;  3HDD A;  1QVU A;  1MBK A;  5F0H A;  4BKX A;  3TW7 A;  3HGG A;  3G1O A;  4MLO A;  5J1U A;  3ZQF A;  5BNG A;  4C3H J;  3TP0 A;  4FTH A;  3GTM J;  2EH3 A;  3O8G A;  9ANT A;  4CYC B;  2RAE A;  4DZP A;  2AHQ A;  4M6V A;  1HF0 A;  1EF4 A;  1BW5 A;  4MIM A;  1PUF A;  2W48 A;  5IOY A;  4A3J J;  4LOC A;  3S16 J;  2DA1 A;  3K7A J;  1FIP A;  1X2M A;  4I76 A;  2LVS A;  2R5Y B;  4V2F A;  3A01 B;  5IYB J;  2XGD A;  2L0K A;  4BY1 J;  1MSE C;  1NTC A;  5IP7 J;  1DU0 A;  4BXX J;  5IOZ A;  1QVT A;  1K83 J;  3GTP J;  2YUS A;  1GV5 A;  2X48 A;  5EEA A;  1BA5 A;  2G0E A;  2CUF A;  2TRT A;  3ZQH A;  2X6O A;  2FX0 A;  2EQR A;  1IC8 A;  2GM4 A;  2LK2 A;  2EZL A;  2FD5 A;  5E3O A;  1TC3 C;  5EF6 A;  1JKP C;  1GDT A;  4A3E J;  3I4M J;  5K7F A;  1MBE A;  4C3J J;  4IHX A;  4FIS A;  3BR0 A;  1IRZ A;  3HM5 A;  2Y31 A;  1G2H A;  1MBF A;  5FKO A;  4BBS J;  5EDN A;  4MFE A;  1JGG A;  2R5Z A;  2CJJ A;  1XC5 A;  4V2G A;  1NK3 P;  1MSF C;  5EGO B;  1B72 A;  5EYR A;  3QPS A;  1RET A;  3ZQI A;  2JA5 J;  1FIA A;  1ETV A;  3JRB A;  5GP9 A;  4C3I J;  3JRC A;  2IBD A;  2NVT J;  1ZQ3 P;  1GUU A;  3RZO J;  3M4O J;  3S1M J;  4CYC A;  1ZGW A;  5GPC A;  3SJM A;  5F1J A;  2Y30 A;  1JKQ C;  1HDP A;  3MKL A;  1I3Q J;  1VFC A;  1HDD C;  2MGQ A;  1Z77 A;  3BQZ A;  5FLM J;  4QTR A;  3S15 J;  1FTT A;  1K61 A;  3B6A A;  3HOU J;  3Q0V A;  4W1U A;  1ITY A;  2E2J J;  1UG2 A;  1B72 B;  3Q0U A;  4IHW A;  5JLX A;  1MNM C;  1IUF A;  4GFB A;  3QPL A;  1X58 A;  5F27 A;  2E2I J;  4JP0 A;  1W0T A;  3JRI A;  1VF9 A;  2MSY A;  2JMW A;  2NS8 A;  3JR9 A;  5DS9 A;  2NOG A;  1H89 C;  5M3F J;  3LSJ A;  3BG9 A;  3SDG A;  2HXI A;  3BG5 A;  1E3O C;  1RPW A;  4D7M A;  1GV2 A;  3HKZ N;  2O9L A;  5F08 A;  1NK2 P;  3RQI A;  2R93 J;  1JJ8 C;  4FE4 A;  4L5E A;  3SFI A;  4B3A A;  1GT0 C;  3S1Q J;  2ME0 A;  5FKL A;  1JKR C;  1OCT C;  5M3M J;  2M9H A;  3S1R J;  1MBG A;  2MW8 A;  2QF7 A;  1BW6 A;  1ENH A;  5FKM A;  3OOU A;  2L9R A;  5EGO A;  3S2H J;  1JUM A;  2XB0 X;  4X6A J;  2CQQ A;  3GTQ J;  1JT6 A;  2CRG A;  1WPK A;  2DA2 A;  2JWT A;  4IEJ A;  3HOW J;  3PM1 A;  1PUF B;  5F0F A;  2Y0S N;  1TWC J;  3CMY A;  4EEF G;  2DMQ A;  3DCF A;  5C4J J;  2EZI A;  1IDZ A;  1BJZ A;  2JJ7 A;  3WHB A;  2Y2Z A;  1QRY A;  3IH2 A;  2YS9 A;  2IEK A;  2NVX J;  1TWG J;  3M3Y J;  2O8K A;  1LE8 A;  4RBO A;  1MH3 A;  1F43 A;  1JJ6 C;  2P81 A;  3BTC A;  4Y52 J;  3K2A A;  2N8G A;  1UMQ A;  1WCM J;  1RKT A;  2R5Y A;  1XG1 A;  5J3L A;  4S0H B;  5M5W J;  3TED A;  1ZR2 A;  3GTL J;  3BTJ A;  1UHS A;  3CDL A;  1HOM A;  4NDL A;  1WI3 A;  2I10 A;  5F0C A;  1Y1V J;  3ZQG A;  5M5Y J;  2DA7 A;  4MO7 A;  2ID3 A;  5F04 A;  1ZTR A;  2K9N A;  3TW6 A;  1JKO C;  4XRS G;  1R9T J;  4XIC A;  4A3B J;  2XSD C;  1DU6 A;  3D1N I;  2VUM J;  2DA3 A;  5E3L A;  1OJL A;  2DA6 A;  3HOX J;  3B6C A;  1JUP A;  3FIS A;  2NVY J;  1JTX A;  1IG7 A;  2O7O A;  1VND A;  1A5J A;  3G1M A;  1AKH A;  1U8B A;  2OPT A;  3PO3 J;  2M0C A;  1TWH J;  1YRN B;  3OIO A;  3H0G J;  3IV5 A;  2Y9Z A;  3UKG A;  2DA5 A;  5EZG A;  2HOT A;  3GTO J;  3IH4 A;  3OSG A;  3LSP A;  1MBH A;  5FKN A;  3JRF A;  4AYB N;  5GPA A;  3OSF A;  2ECC A;  3S17 J;  2HQ5 A;  2L7Z A;  1U9O A;  3BR5 A;  5IPA A;  1JTY A;  2HDD A;  4M3E A;  4D7N A;  1QPI A;  4BY7 J;  5JLW A;  5C44 J;  1AHD P;  1ETO A;  2ME6 A;  4JX5 A;  5EG0 A;  1IJW C;  1A6I A;  5K7Z A;  1ETY A;  1T56 A;  1ORK A;  4Y7N J;  2LR8 A;  5K7H A;  3ZQC A;  2TCT A;  3E7L A;  1WH7 A;  3HOY J;  1B8I A;  3H3V K;  4B4C A;  2ID6 A;  2XGE A;  4A3L J;  1ETQ A;  2JA6 J;  4DW6 A;  2HOS A;  1FEX A;  2WB1 N;  3A01 A;  4W97 A;  3BG3 A;  2HOA A;  4XRM A;  2LTP A;  3BTI A;  3HGY A;  3GTJ J;  1Y1W J;  4A69 C;  1IDY A;  1S7E A;  2M2E A;  3FK6 A;  3W6V A;  2EBI A;  2LFB A;  3RKQ A;  1APL C;  3F0C A;  5C3E J;  2QCO A;  4A3C J;  2HYJ A;  4RDU A;  3HOZ J;  5E3N A;  4JYK A;  4HNV A;  1FJL A;  1SFO J;  1F36 A;  4XK4 A;  1BL0 A;  2OF7 A;  3IH3 A;  2L7F P;  4M3F A;  2K9Q A;  1T33 A;  2H1K A;  2EZK A;  3FIW A;  1Z0X A;  2VI6 A;  1IGN A;  1X2N A;  1LFB A;  3Q3S A;  3LNQ A;  4JX4 A;  1AU7 A;  1LFU P;  2E19 A;  1ETX A;  2DJN A;  2XPU A;  2JA8 J;  3HOV J;  2IAI A;  2FJ1 A;  3C2B A;  3PO2 J;  4D5F A;  1H8A C;  3JRE A;  4XRS A;  3FKI J;  1I6H J;  1HLV A;  2XB5 A;  5FJ8 J;  1P7I A;  3A03 A;  4D5C A;  1U78 A;  2CQX A;  1AKH B;  1RR7 A;  3BR1 A;  5HOD A;  2XGC A;  2E1O A;  4J19 A;  1ETW A;  4X1E A;  1POG A;  2L7M P;  1ZKG A;  2GBY A;  3BR6 A;  2HI3 A;  3Q0W A;  3S2D J;  3CQZ J;  2DMT A;  1TWA J;  3LSG A;  3ZQL A;  4A3M J;  3I4N J;  1WGX A;  2JN6 A;  2M8G X;  1TWF J;  2D5V A;  3NAU A;  2R7Z J;  1ZR4 A;  2WAQ N;  2JA7 J;  2XPW A;  1HCR A;  1WH5 A;  2H8R A;  3NAR A;  5FLV A;  3HB9 A;  3LSR A;  4BBR J;  2WV1 A;  1B8I B;  2AO9 A;  1U9N A;  2R0Q C;  3FK7 A;  2DMU A;  4IHV A;  2KDZ A;  1D5Y A;  2YU9 J;  2R5Z B;  2X9D A;  4I6Z A;  2COB A;  4UUT A;  3HEF A;  4FE7 A;  1IV6 A;  4A3K J;  2ZB9 A;  3ZOB A;  4ABZ A;  4FCY A;  2LD5 A;  3S1N J;  3JRA A;  5FKK A;  2DMP A;  3A02 A;  4XID A;  3MVP A;  2XRL A;  3QQA A;  2M34 A;  5DTD A;  4UUS A;  2LLK A;  1H88 C;  2VKE A;  3GBG A;  3VPR A;  2NS7 A;  5M5X J;  3L1P A;  5IYC J;  1LE8 B;  4A93 J;  4A3I J;  4AUX A;  1O4X A;  4M3B A;  3WHC A;  1W0U A;  2LKX A;  3BQY A;  3HBL A;  4B1R A;  1P7J A;  1CQT A;  3CCY A;  4JX6 A;  4M3D A;  4A3G J;  4QIW N;  3G1L A;  4A3F J;  4QSH A;  5EG0 B;  2NVQ J;  1ETK A;  4UUS B;  2DTZ A;  2VKV A;  3BR3 A;  5C4X J;  1OFC X;  1I50 J;  2K40 A;  2E2H J;  2R92 J;  2Y9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...