1W0TA

Htrf1 dna-binding domain in complex with telomeric dna.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords TELOMERIC REPEAT BINDING FACTOR 1
publication title How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1w0tA00
1H89C 1JGGA 1AKHA 2R5ZB 2CU7A 2XB5A 5J3LA 2O8KA 5IOZA 2HDDA 3H3VK 1CQTA 4M3EA 3TW7A 1DU0A 5F27A 2HI3A 2XGCA 5K7FA 4M3GA 2XGEA 3FKIJ 3ZQGA 4S0HB 2XSDC 1JJ6C 1Q1VA 1MH4A 4D5FA 3OSFA 3SJMA 5IOYA 3IV5A 4D7NA 2AO9A 2N8GA 4MIMA 2XB0X 2H8RA 1RR7A 2R7ZJ 4UUSA 5F04A 1P7IA 1MSFC 2M9HA 4CYCB 2TRTA 2GM4A 3FK7A 4M6VA 1Y1WJ 4DYRA 1U78A 1PUFB 2O7OA 3G1OA 1QVTA 1XC5A 2L7MP 4GFBA 2B63J 3S1QJ 2DJNA 4A69C 1HDPA 5EGOB 2HQ5A 2DA6A 2ECBA 4DZPA 1WH5A 3IH3A 2JA7J 3TW6A 5EZGA 1ETXA 2LK2A 2LP0A 3QPLA 1MH3A 2I10A 1JKRC 2CJJA 1B8IB 5M5YJ 4M3FA 2E2JJ 2EH3A 2WB1N 4HNVA 2NS7A 3MN2A 4C2MJ 3BR1A 2K9SA 3Q3SA 4DYQA 4XRSG 2EBIA 1GT0C 1X58A 2MG4A 1HOMA 1MBEA 4RDUA 1JUSA 2X6OA 2E2IJ 3K2AA 1A5JA 3ZOBA 3CQZJ 1U9NA 1X2MA 4QSHA 3RZDJ 1UHSA 2PMZN 5IYDJ 5EEAA 4C3IJ 1BW6A 3CCYA 3JRAA 3G1MA 1MBKA 2GBYA 4D5CA 2D5VA 4J19A 4DW6A 1JTYA 3JRCA 5E3LA 5M5XJ 4XICA 1ZTRA 2DA3A 1POGA 1QRYA 1LE8B 5C4XJ 2DN0A 3DEWA 3JREA 3I4NJ 1IRZA 1BL0A 1FTTA 3E7LA 1GV5A 3BTJA 2NOGA 1IDYA 3HOXJ 5FKNA 1MNMC 3GTGJ 1I50J 2DMNA 3QQAA 3RKQA 5DTDA 3SFIA 2O9LA 2K9QA 2NS8A 3BR0A 4MO7A 5K7ZA 3W6VA 1F43A 2OF7A 4RBOA 2R5YB 1TWHJ 3S1MJ 2W48A 3GTPJ 5BNGA 3ZQIA 4MLOA 2L9RA 2LTPA 2FJ1A 2FQ4A 2OPTA 4QIWN 5FJ8J 3JRDA 3D1NI 5IPAA 5JLWA 3MKLA 3S14J 3S2DJ 5FLVA 1HCRA 1RKTA 1ETYA 5GPCA 1VF9A 3RQIA 5HODA 2EZHA 2Y9YA 3LSRA 1TWGJ 4A3EJ 1HDDC 2DA4A 5IP9J 2LFBA 3VPRA 1FEXA 2ELKA 4XRSA 1ZR2A 2M0CA 2HOAA 4A3KJ 1APLC 3HEFA 4JYKA 1FJLA 2DMQA 4I76A 1ETKA 3A01A 2Y9ZA 4DYCA 4BBSJ 1ETWA 2E19A 4A3IJ 3HGGA 5F0FA 2VKVA 3ZQFA 4A3LJ 1SANA 3O8GA 1IJWC 3Q0VA 2FD5A 5IP6A 5EGOA 5C3EJ 2JMWA 1RPWA 3C2BA 2LR8A 2K9NA 2VI6A 3H0GJ 2KT0A 3MVPA 1IDZA 1Z77A 3BTCA 5E3MA 3BQYA 5FKKA 1ZGWA 1U9OA 2WV1A 2MW8A 4G12A 5EF6A 3HOYJ 1B72B 3HOZJ 3F0CA 4A3FJ 1XG1A 1I3QJ 1T56A 3S1NJ 2YU9J 4UUTA 2AHQA 5JLXA 1JT0A 3HGYA 4D7MA 2HYJA 3GBGA 2ME6A 1S7EA 4C3HJ 3BG5A 2VKEA 4IHVA 1JKPC 1GUUA 1QPIA 1A6IA 3JRGA 4BXXJ 9ANTA 1TC3C 2P81A 3FISA 2H1KA 5FKOA 2MGQA 1W0TA 2JA6J 2HOTA 1IV6A 1IUFA 2R92J 2CUEA 2EZLA 1GDTA 1OFCX 5E3OA 4LOCA 2E2HJ 3GTLJ 2DA5A 2Y2ZA 5C44J 5F1JA 3JRIA 1NK2P 4L5EA 5F0HA 1IC8A 3S1RJ 1O4XA 1R9TJ 2ID6A 1F36A 2ECCA 1BJZA 5DS9A 1LE8A 2DMPA 1E3OC 2R93J 5F0CA 4EEFG 4AUXA 5E3NA 3BR3A 1FTZA 3LOCA 1JTXA 4X1EA 3RZOJ 3S17J 1JUPA 1LFUP 5GP9A 2M34A 3HKZN 1OJLA 3OOUA 5FKLA 4B1RA 3TP3A 3WHCA 4JP0A 2CUFA 2TCTA 2R5YA 3GTMJ 5EG0A 1DU6A 4X6AJ 1H88C 1OCPA 2JWTA 1IG7A 1YRNA 2G0EA 1X2NA 1VFCA 3DCFA 2QCOA 1ORKA 3UKGA 3B6AA 4B3AA 1OCTC 1XS9A 4IEJA 3GTOJ 5EZHA 1JKOC 1MBJA 2R5ZA 1VNDA 3NAUA 3K7AJ 3JRHA 2NVYJ 3BR5A 2HOSA 2JK3A 3WHBA 1ZR4A 2DA1A 4DZJA 4XRMA 2MSYA 2Y30A 3A03A 1IGNA 4IHXA 1ETVA 3O8HA 4A93J 2ID3A 4A3GJ 5FKMA 2M2EA 2YS9A 3ZQLA 3M3YJ 4NDLA 1NTCA 1BW5A 5J1YA 1MSEC 3B6CA 5FLMJ 4CYCA 3S16J 1Z0XA 4JX5A 3Q0WA 1RESA 1WH7A 2JN6A 1PUFA 2Y31A 1JJ8C 4V2FA 4XIDA 3BR2A 3LSGA 4W1UA 1ETQA 4FE7A 2NVQJ 1JT6A 2XPVA 1ZQ3P 3G1LA 2WAQN 3IH2A 1ETOA 2EQRA 2LD5A 4A3JJ 4BY1J 1WCMJ 4IHWA 4Y7NJ 1U8BA 2L7ZA 2CQQA 1B72A 1NK3P 3GTQJ 2FX0A 2L0KA 2YUSA 1K83J 3CMYA 1AKHB 4A3MJ 1MBHA 5IYBJ 1ITYA 2IBDA 5M3FJ 3HOVJ 1B8IA 1TWCJ 4I6ZA 1LFBA 1UG2A 3NARA 4V2GA 1G2HA 3BQZA 3BTIA 3JRBA 3BG9A 5C4JJ 2EZIA 4FE4A 2NVXJ 2XGDA 1QVUA 1ZK8A 2HXOA 3Q0UA 1SFOJ 4JX6A 4M3DA 2JA8J 2XPWA 5GPAA 3A01B 3HDDA 3S15J 4JX4A 5EDNA 3HM5A 1EF4A 2XRLA 3JR9A 4UUSB 2DMTA 2L7FP 4BY7J 4AC0A 2DTZA 1ZKGA 2CQXA 2NVTJ 2X48A 2LVSA 4FTHA 5IYCJ 2IEKA 5M5WJ 1AHDP 1TWFJ 4XK4A 3PO2J 1AU7A 2Y0SN 3GTJJ 3BG3A 2GLOA 2RAEA 1K61A 5J1RA 3HOWJ 4BKXA 4C3JJ 4M3BA 3OSGA 1HLVA 3TP0A 3I4MJ 4Y52J 3FIWA 1WGXA 1FIAA 1GVDA 5M3MJ 1RETA 3CDLA 4AYBN 4IHYA 4W97A 1FIPA 2VUMJ 1HF0A 2VPRA 3BTLA 1BA5A 4MFDA 3ZQHA 1W0UA 2JA5J 1GV2A 3GTKJ 1RKWA 3BT9A 2EZKA 3SDGA 4A3CJ 3QPSA 2DMUA 5EYRA 5K7HA 3M4OJ 3LSPA 3A02A 3LSJA 4FCYA 3TEDA 3BR6A 3PM1A 1ENHA 1P7JA 2X9DA 1MBGA 1Y1VJ 2LKXA 4B4CA 2ZB9A 2IAIA 2LLKA 2KDZA 3ZQCA 1VI0A 1WPKA 1TWAJ 2JJ7A 1MBFA 1WI3A 4A3DJ 4MFEA 2DA2A 2M8GX 3LNQA 3PO3J 4ABZA 2ME0A 3L1PA 2CRGA 1JUMA 4FISA 3HB9A 5IP7J 3FK6A 1I6HJ 3JRFA 2E1OA 3HBLA 5F08A 1JKQC 1H8AC 2COBA 3IH4A 5EG0B 3S2HJ 2XPUA 1UMQA 4BBRJ 4A3BJ 2HXIA 2DA7A 1YRNB 1D5YA 2LY9A 1T33A 3OIOA 2K40A 2QF7A 2R0QC 3HOUJ 5J1UA 4QTRA
chains in the Genus database with same CATH superfamily
5CVRA 1O57A 2DOFA 2UZKA 1DPRA 2FBHA 3HRMA 2QSGX 3N97A 2R5ZB 4BXFA 2LC2A 2W85A 2Z33A 4IHTA 3GZ6A 1LPQA 1IRXA 2KQRA 2O8KA 4HQMA 2K27A 1CQTA 2RDPA 1WJDA 2GXBA 1PVEA 4M3EA 3TW7A 5JVTA 5F27A 4FETA 4FASD 1JJ6C 3U2RA 2XSDC 5FLXZ 2CO5A 3FMSA 1N75A 2RV8A 1QHHD 3CCLI 3SJMA 2YPRA 1OPCA 2ZO4A 4HYEA 4E7LA 3IV5A 1S29A 4HRIA 1KA8A 2ESHA 5F04A 3LSKA 2M9HA 1O7LA 1Y1WJ 3OYLA 1TNSA 1MNDA 2O7OA 4XONA 5LD2C 2IW5A 5E1WA 2LRDA 2K5CA 1LEBA 5DYMA 3SHFA 1PYVA 5LHIA 4RB0A 1QVTA 5FFXA 4QPQA 4Y13A 2UWMA 1IXSB 3ECHA 3K1MA 5F6FA 4E7KA 3RSNA 1XSVA 5KAFC 4EJWA 3OR1C 4XN0A 1VQ9I 5EZGA 2E34A 2LK2A 2PBIA 1ZGAA 4D9JA 3QPLA 1IF1A 2Z9OA 5L3FA 2BE5F 1RC9A 4A5MA 1OMIA 4HNVA 4CO8A 5FO5A 2XF7A 3MKYB 3MN2A 2X4HA 1HXDA 1Z67A 3TBIA 1P92A 3Q3SA 2RQQA 4ANJA 3DKWA 2E1MC 4XRSG 1F9NA 5DD4A 5D6EA 3L2WA 2RKHA 3HL2A 4HX7A 5JVGF 1J0RA 1P4AA 1JUSA 2BVLA 2X6OA 3C2GA 2D2WA 2W84A 3SZPA 5BQTA 3ZMUA 1Z9CA 4FHTA 4OOIA 3CQZJ 1STZA 2ZXHA 2VE9A 3J7AO 4OMZA 4IKFA 1X2MA 1MMAA 4ZDOA 3A2KA 1G4DA 1K78A 5E17F 1ZLJA 5IYDJ 5EEAA 4RGRA 2Z5UA 4UVBA 4C3IJ 3H5RA 1JGSA 3X2QH 4HOBA 4UY8I 3QRFF 3K4JA 1Z7LA 2D5VA 1EJ9A 3HRTA 4ZH4F 2UXNA 1ZG3A 4I01A 4AYBA 3M8EA 5C4XJ 2EIJH 1FP2A 4Y3OA 2V26A 2PJRA 1YS7A 3AG4H 3I4NJ 3PUFA 3HPGA 3BLYA 2R4GA 2W57A 4WCGA 4P1WA 5DUKA 2VQCA 1BL0A 3E7LA 1IV8A 3BTJA 3K4MA 2NOGA 2IJLA 3HOXJ 3FXLA 2DMNA 5AIPA 2A6EF 1TBXA 2QQBA 3HTSB 3ZGKA 2NS8A 3DLAA 1GXQA 1U0JA 2YX7A 2FSWA 2V6EA 2DYSH 4RBOA 3E6CC 1R00A 1TQMA 1TWHJ 2H8WA 2KIUA 2V1DA 2DPDA 5JI6A 2DTRA 2PN6A 4Q5SF 2D1VA 4HZFA 3GTPJ 4KIFA 1WSUA 3F8CA 2H1LA 4PZJA 3VEPA 4MLOA 1D0XA 5JHFA 1V3FA 4C2TA 3MZ8A 2NYXA 1HQCA 4ZYGA 3D1NI 1R58A 3QWLA 1K7AA 3ABLH 2ZSIB 1Z6RA 3BOQA 2K9LA 3O2PE 3CZ6A 4HDUA 1A35A 1MJ9A 1VF9A 5HNHA 1ZLKA 1K6YA 1O3TA 5H2FC 1YHQI 1TWGJ 2DK8A 1Z91A 2RC4A 1W7PA 3ZMZA 4CCLA 1D1AA 3U9GA 4BGDA 1D3YA 4CHUA 1ZR2A 1TW3A 4EJOA 2HOAA 3CCQI 1V54H 1OCCH 1MIJA 3KPHA 4JYKA 2DMQA 3EUHC 3H3UA 3A01A 3BZKA 3HOTA 1ETWA 2F48A 2E19A 3CUQA 2IGMA 2VQGA 3NRVA 4I7HA 2VKVA 1XGNA 3GZNB 4U0VA 5LEJA 4A3IJ 2ELJA 3ZQ7A 5ICEA 4OIQF 1SAUA 1UELB 4G8XA 1NG7A 4CCOA 1FNNA 1IN6A 2Y75A 2VBZA 2LR8A 1YOVB 2K9NA 2VI6A 3BCBA 4AD9A 2F5EA 5A2QK 2XAGA 4HBLA 3BTCA 3ZMDA 5D5UB 1UZCA 1WQ2A 5E3MA 1I39A 1ZGWA 2WV1A 4KN4X 4BUPA 3HOYJ 3PNTA 4I02A 3FXUA 2MABA 3S3OA 3F0CA 2PLYA 1I3QJ 2V9PA 3OL3A 1F4KA 1O7FA 2JA2A 2YU9J 3GLXA 2R7XA 3J7ZI 3RKWA 4P9UA 1S7EA 1IN8A 2VKEA 4C30A 3JCUC 4RGXA 1LDKB 3COAC 1Y39A 3H9JA 2KL4A 3E3VA 4XOTA 3RPQA 4XKBA 2MGQA 3OYHA 4I99C 4HEA2 3CC2I 1YI2I 2HVSA 2L54A 3BROA 2VBYA 2L4MA 4PGHA 4V19K 2MYSA 4N0BA 4EJUA 3NQOA 3JAMK 3F8MA 2CUEA 1OFCX 5HLHA 2VB6A 3J7AY 1I1SA 2OAZA 3GTLJ 5F1JA 4XN3A 4G7ZF 4IX7A 3I58A 4XLPF 2EA4A 3S1RJ 2QYOA 1ZARA 2Y0MA 3G3ZA 1O4XA 2ID6A 2ECCA 1BJZA 1XDSA 2LMDA 2ZMEC 3WODF 3L00A 1QBJA 2EB7A 5E3NA 4AIKA 1XD7A 1OR7A 2LREA 1JTXA 2PG4A 4X1EA 2ZJ2A 1YTYA 2Q8KA 1LFUP 5GP9A 2RREA 3OMYA 4XLNF 1OJLA 1SMYF 1SD6A 3V4GA 5DCMA 3WU0A 2HVQA 3RI4A 1M1EB 4JP0A 2E1MB 1QGPA 3VYUB 2I8DA 3I3LA 1DU6A 1TW2A 1KZHA 2HDCA 1YRNA 1DP3A 4PJLA 1X2NA 2EFOA 1TT5B 3H35A 4RA2A 2LOOA 2P0WA 5GAEJ 1YW7A 5E18F 1XPXA 2JSCA 5ICCA 2W4SA 3HUGB 1ORKA 2K3FA 5LRSA 4B3AA 1FOXA 5J4VA 3LAJA 1OISA 1L3LA 1MBJA 3RQ4A 3J81K 3SYTA 3HSEA 1X1DA 2E7XA 3KP6A 3CC4I 2I5UA 3K7AJ 5HS9A 3KYDB 3CJQB 3QPTA 1Y8QB 2KIFA 4IO9F 1EA3A 1XCBA 1J75A 2JK3A 2DA1A 2MSYA 3A03A 4HDVA 3VFZA 1IAWA 2GZWA 1ETVA 4BQOA 3O8HA 3F8NA 2HQAA 4IOAF 4XNFA 5FKMA 4YIRX 3ZQLA 2DU9A 2LNBA 1GXPA 1E2XA 4NDLA 3ZPLA 4HA8A 1NTCA 1T38A 1LDDA 1BW5A 3RKYA 2GIVA 3B6CA 4E7HA 4CYCA 2DFEA 3KYLA 2Z1DA 1RESA 1XMXA 3ISPA 5ICGA 4S04A 4XIDA 1BM9A 3WTTC 2L7KA 4FE7A 2HKOA 2JVGA 2XPVA 4PSWA 2LF8A 1ZQ3P 1OQYA 4OIPF 3I56I 1Z21A 1HW5A 3P9IA 4Y7NJ 1U8BA 4LMYA 1W7PD 2QQ9A 3H5NA 3D5LA 4BEHB 2M8EA 3CO7C 2WAFA 2E5ZA 3WTSC 4HPQA 2HTSA 4I6ZA 4E7ZA 4BHBA 4RAGA 2CMPA 3PFYA 1J2XA 3FM3A 2MC4A 1TTYA 1D8JA 3JRBA 1LDJA 2P7CB 5C4JJ 1IXCA 1MKMA 1R6RA 5A2QZ 1LB2A 1YW9A 2NVXJ 1YLFA 4F93B 1QVUA 2F2EA 1XGSA 2HYFA 4N4OB 3OYNA 1FC3A 1FBSA 5EDNA 4NQWB 5AIQA 1R1VA 2O8XA 1BI1A 2B0LA 1SC7A 1R49A 2LYCA 4ZZDA 3KZIC 4F55A 4G9YA 2MA3A 4BAYA 4JK1X 2HKXA 2GLOA 2XSJC 3JAMZ 3LFKA 2EPFA 2OA4A 1EH6A 3KCCA 1K4SA 3CJRB 3RJPA 4Y52J 4HV6A 3QP6A 1XMKA 4KT5C 5J40A 4AYBN 5DEQA 4W97A 1ZG1A 1FIPA 4IXAA 1D5VA 4E6KG 3OWTA 2VUMJ 1HF0A 4BE2A 1SVOA 2JA5J 1GV2A 3GTKJ 1QHGA 2XHKA 2EZKA 3SDGA 2IS1A 4YELA 3T8RA 4CZCA 2FBIA 3BR6A 1YX5A 5D4RA 4LB6B 1ENHA 4HF0A 1MBGA 1Y1VJ 3BZ6A 4B4CA 3KE2A 4CCMA 2IAIA 2KDZA 2V1NA 1WVRA 1QZZA 3ZQCA 3H0DA 1G3TA 2EINH 5EEGA 4AIDA 1W5TA 5K5RA 1WI3A 3ULQB 2QUFA 3HKZA 2XKPA 4A3DJ 1IW7F 2IA1A 4N9IA 2F5VA 2MH9A 2ZMEB 4BE0A 2ME0A 2K3PA 4LJZF 1ERDA 3QU6A 2PMHA 2QQAA 3FXJA 2CQNA 4LFUA 4OU0A 4R8HA 5DCFA 3PL8A 5IP7J 3GWZA 3J81Z 3FK6A 1I6HJ 3CO6C 3JRFA 3CD6I 3CCEI 2FNPA 4A2UA 1UMQA 2CW7A 3WE3A 4RAZA 1D5YA 2GA2A 4EGYA 1CGPA 2QF7A 3HOUJ 4A0XA 1BI2A 2FOWA 2HOEA 1NHAA 4EJVA 3G4SI 4LB5A 3L2UA 3TO6A 4ZYEA 4UB6C 1H89C 1KQ0A 2BW3A 5ED4A 1BC7C 3A0HC 4KN7X 2YX4A 3FM5A 4RB1A 5E79C 1QO0D 4GRIA 2CU7A 2ADUA 2BXYA 3OYAA 2XV4S 1YQAA 3REOA 3F21A 4M6XA 2CW8A 5CQEA 5LBQA 4M9SA 2XGCA 2ZKZA 4WK8F 1B9NA 3DLLF 1GLNA 3ZQGA 2R7UA 4KITB 2O5RA 4D5FA 4KIGA 3PFIA 3OSFA 2W1OA 3HJEA 1D0ZA 2KRHA 1BI0A 1I3AA 4MIMA 4EV0A 1VQLI 2ZXJA 2H8RA 2EFQA 3BDDA 3BG7A 2TRTA 4B43A 4XORA 1X1AA 4DYRA 1WJ5A 1U78A 2MLGA 3T0YA 1ZREA 2IGOA 5KAIC 4L5IA 2GAUA 4CH7A 4YIFA 4GFBA 3KP3A 5E1XA 2NVUB 3KP2A 2PEXA 2ECBA 2IA0A 3W6KB 4DZPA 1WH5A 2JA7J 3P5JA 4OWRB 4ZTJA 2F4MB 3I5UA 3SDBA 2LP0A 1YIJI 1FBQA 1I1GA 4D1QA 4IRIA 1B8IB 3QOEA 4ZC3A 5LFAA 3FXKA 1XGMA 3VYSB 2TDXA 2ZXWH 4B3XA 3BR1A 3HXLA 1IUYA 4I98B 4DYQA 3KYCB 2RNGA 1R1UA 2K02A 4YRVA 1KQ8A 4HF1A 3DTIA 5ILVA 1GT0C 3D5RC 1HOMA 1Z3YA 2FRHA 3RPUA 1H9TA 4RDUA 3RYRA 3KX2A 3K70C 1GHCA 1G8XA 1XB4A 1VQOI 5BPDA 2KRCA 3QP5A 1W36D 3HTUA 4I09A 1Z7UA 4HLYA 5DDGA 3RZDJ 3W6JB 2ETHA 1BC8C 2QLZA 4PJNA 3KEYA 3CCYA 2F4IA 4NB5A 4D5CA 3EUKL 3R0AA 2V1XA 3OS0A 2B7EA 2L9VA 4XICA 4F7ZA 1ZTRA 1DUXC 4U0YA 3VYTB 4U0WA 4IJAA 3M07A 1YE9A 3O3KA 4MEXF 3W2VA 4DGWB 5CVIA 1U2WA 5LGTA 1FTTA 1GV5A 2EV0A 3LQRA 3DP7A 1MNMC 4CCNA 3GTGJ 5H6QA 2CYYA 4ZZLA 1UCRA 5DTDA 5F1RA 3E6DA 2K9QA 5LHGA 1LKXA 2A3SA 1F43A 3O6BB 2OF7A 3OYMA 1P4WA 5D4SA 1A6QA 3S1MJ 4M6YA 5D5VB 1ON2A 2DXIA 2ESNA 2W48A 3I71A 3EQLF 5BNGA 1OYWA 4CCJA 2KJBA 4KMUX 2LTPA 2FOKA 4OMYA 3K4KA 2FQ4A 4QIWN 1I5ZA 5JFRA 3JRDA 5IPAA 3J80K 4UUVA 5GADJ 3BWGA 4L18B 2FQ3A 4MTEA 5H20A 1LQ1A 4I0BA 3CP8A 1KU9A 2EZHA 2ZNYA 2LG4A 2ISZA 3PUBA 2EK5A 1T0FA 1HDDC 2DA4A 2F4OB 5IP9J 3VPRA 2FNAA 4XLHA 1G59A 2HR3A 1JHHA 2DPUA 1KU7A 4BDYA 4A3KJ 4KMFA 3I0TA 1RI7A 2DW4A 3ZCOA 4M72A 3JW4A 3F8BA 3P9CA 3ZQFA 3ZN1A 1SANA 3CESA 4Q47A 4HX8A 5FRNA 2FD5A 5IP6A 1B9MA 5C3EJ 4HSTA 5KK1A 1YJ9I 3DWLE 3H0GJ 1QQIA 1MNEA 1Z77A 4IQJA 3GLLA 5EJCA 2VN2A 1BIBA 3SXYA 1X3UA 3K4LA 1WJAA 3RIRA 3BP8A 3IRRA 1B72B 5HDGA 4F92B 2IP2A 2EFNA 3DPUA 3K9TA 2JT1A 3CP2A 3MZYA 1E3PA 2CV0A 3GBGA 4G6QA 2HYGD 2PI0A 3V7CA 3BG5A 1GUUA 4ZYDA 1R4MB 2KISA 3L2RA 4M9XA 2JPBA 1TC3C 2P81A 3FISA 5FB2A 3FMQA 1RZ4A 3ZN0A 2GXGA 3LFUA 3R0JA 3MMYB 5BPIA 3LAPA 1IUFA 1FPQA 2EZLA 2OC6A 1GDTA 4PJJA 3LSHA 1SMTA 4XR6A 2E2HJ 5LGNA 2HU9A 1FX7A 2M30A 3JRIA 1NK2P 1U5TA 1QNTA 2BYVE 3TGNA 2VKHA 2E7WA 1B59A 5L3DA 2CV2A 2ZFUA 1R7JA 2WB1A 3GFJA 2DMPA 1E3OC 2R93J 2OCEA 2DK5A 3I59B 5F0CA 3PNYA 4M9ZA 4EEFG 4AUXA 4LD5A 1FTZA 3VOEA 4ZDPA 1HW1A 3RPUD 3S17J 2G7HA 2M7BA 3L2CA 3HKZN 1IRGA 4H0EA 1O3QA 3AL0C 2H6BA 1YW8A 4M73A 4BH9A 5FKLA 4HLXA 5CVUA 3DBLB 1KGSA 2CUFA 2CUZA 3FMRA 2BOLA 1J5YA 3CJTB 3R6SA 1DQUA 2JWTA 1IG7A 2VT3A 2ZC2A 2OZ6A 1DGRM 3A4CA 1R23A 2DQLA 3AG3H 2DBBA 4LIUA 4XL9A 3QAHA 2R7WA 3UKGA 3B6AA 4A12A 3CCJI 3GTOJ 2H6CA 5EZHA 3F3XA 2R5ZA 4MEYF 2HQRA 1SFUA 3L2QA 1WZ2A 2V9KA 3NAUA 1HKTA 3CF5F 4NBQA 3JRHA 2NVYJ 3TL4X 4I2OA 2HOSA 3H9QA 4B09A 4MGRA 4XKCA 3I9V2 4WXCA 4BJ6C 3WHBA 3PQKA 2EWNA 3L7WA 1W4MA 5GTIC 4Q48A 2XKOA 2P8TA 2G9WA 4BJ5C 4P55A 2KDOA 3OS1A 5GTHC 4Z6YA 2WTEA 3IAS2 1USTA 4CCKA 4PUSA 3J80Z 1P9QC 1MSEC 1UHMA 3K1PA 2M45A 3OY9A 5FLMJ 2LY1A 3MWMA 4JX5A 5KNLA 4ENMA 3HZJA 5DUIA 5JR3A 1BR2A 4BACA 3F9KA 2Y31A 4V2FA 2IS4A 2BGCA 3BR2A 3K4CA 2CG4A 3LSGA 4BQQA 1JT6A 2Q2EB 4XSXF 2Z99A 4E70A 4IHWA 2VXZA 1B72A 1MJAA 1HA8A 4DNCA 4LLLA 3GUDA 2L0KA 1S7OA 2CUJA 4C2UA 2NRAC 2OTJI 1HC8A 4AM3A 1X3WB 2X85A 4II2A 3HOVJ 2VBWA 3TKYA 1TWCJ 1LFBA 2P5LC 3RTRA 3ZMSA 3NARA 1I27A 1OCRH 3OYCA 4ITVA 1BN5A 2WY7Q 3G6EI 3U1DA 5LHHA 2E5NA 2EZIA 2QBYB 4FE4A 3M1CA 4E7JA 4A6EA 1ZK8A 1MJBA 1SFOJ 4JX6A 3Q5FA 1OCZH 1UAAA 1WWXA 4RLQA 4ENNA 1EF4A 3JR9A 1V5GA 4BY7J 5TJJA 3IP4B 2DTZA 4UVCA 5K5OA 4P96A 1BJAA 1SFKA 4XRFA 4IL6C 2CQXA 3HHGA 3FKJA 2LVSA 2RN7A 2ZSHB 3BZCA 4RMNA 5M5WJ 2MC3A 4FQGA 3DQVC 2DI3A 3FX3A 2R7OA 3E5UA 4XK4A 3KZYA 3G2BA 4KA4A 2RAEA 5GAHJ 1WJBA 4BHCA 5J1RA 3FHZA 3FXRA 2MBFA 5CYVA 4CICA 1XGOA 2XAHA 2ISYA 2CSOA 3OSGA 1HLVA 3TP0A 4BQAA 1LNWA 1S5LC 3E5XA 3FIWA 3KEQA 4DJAA 4M71A 5M3MJ 2VXDA 3AG1H 1VQKI 4EM2A 1S7AA 2VJJA 4B44A 3BTLA 5IT9K 2FF4A 2P5VA 3LWFA 4MFDA 4K2EA 2XIGA 2E36A 1FLIA 1X1CA 3ZQHA 1JE8A 4DBQA 3WTYC 3IKVA 2DMUA 1V5FA 2BV6A 3LSPA 2KP6A 3LSJA 4FCYA 3ZRGA 4EATA 1P7JA 4BJTA 2GQQA 2LKXA 3EDPA 2EA2A 5DD8A 3C1DA 2UV1A 2JRMA 2WAEA 1ZAOA 2LLKA 4MHGA 4CSWA 3DBHB 2OJED 2NXNB 1P6RA 1WPKA 5HLTA 2JJ7A 4KUMA 4EJTA 3E1SA 4NC8A 1VQ4I 2M8GX 3V8KA 3LNQA 4PFPA 4ABZA 4BU2A 3WU2C 5L3BA 2R7VA 3MEXA 2NS0A 1TQPA 4FISA 3HOSA 2QA4I 4XKVA 1FMVA 1X1PA 1UB9A 3UNGC 1G3WA 3AL0B 4ESFA 4Y33A 1Y0NA 2IXSA 3DPTA 1XX5A 1EH8A 2OUMA 3IH4A 4RM2A 5AONA 1U8RA 5EG0B 2ZFWA 4BQNA 2HXIA 2QENA 3WGIA 4RM3A 2LY9A 3H9GA 4IQ4A 2K40A 3F23A 3HYIA 1VQ7I 3JSPA 2E60A 4II3A 1CF7B 4U7DA 2JQ7A 5HNFA 3NWTA 1JGGA 1TT0A 1W1WE 2VT2A 4J00A 1VQ6I 1AOYA 1KONA 1S9HA 1RUOA 5LEKA 5CLSA 1WHUA 3T5XA 2P6TA 3FXQA 4G6TB 2DJIA 2HDDA 3H3VK 1PUEE 3GVAA 3PJRA 2OCCH 2HI3A 2P6SA 5K7FA 1F1ZA 4M3GA 2QBYA 3FKIJ 4YEJA 4S0HB 4HNUA 2VE8A 1MH4A 1OYYA 3WTUC 3M8FA 2HTJA 2J5PA 5CJ9A 2LSOA 1BIAA 2FBKA 3ASNH 1KYWA 3D5SC 4D7NA 4E7IA 3SZGA 3CMMA 3GCMA 1RR7A 2KRFA 3W2WA 1SD5A 4Y17A 3U1KA 2H27A 1ZRDA 1P7IA 2H09A 3ABUA 1MSFC 2OZUA 4S05A 3A0BC 2GM4A 1RUNA 1YYVA 3FK7A 5E20A 2A05A 4M6VA 4ENKA 3FZVA 4LIVA 2ZXIA 1PUFB 2IT0A 3DPLC 4YFKF 2HDWA 3D0SA 1VQMI 2L7MP 3ASOH 1RIOH 3K6GA 5CVVA 5L3EA 2B63J 2XRNA 5ERIA 2BHZA 3S1QJ 5J8CA 2DFIA 3GX4X 1KQ9A 2KPMA 2LH9A 2HQ5A 4IPAA 4JBAA 3TW6A 3QODA 1WJFA 2MD5A 3F6VA 2X6XA 1SD7A 2I10A 1JKRC 2A5WA 2CJJA 2V9VA 1IN5A 4M3FA 3LSIA 1HKSA 2EH3A 2E2JJ 2WB1N 2DFFA 1Y56A 4C2MJ 3TQNA 2VQHA 2LBFB 4BHPA 3BJ6A 4L0YB 3FDYA 4XM3A 3WU1B 4ASNA 1X58A 5J47A 2M1BA 4L0ZB 4ZYAA 1V55H 3LMMA 4LK1F 3UR3C 3CCSI 1W5SA 4EM0B 4G7OF 4WXHA 2E2IJ 4IF4A 1A5JA 3N4MA 2BEOA 4TV7A 3HUGA 4ZTFA 2VL8A 5DM6F 4QSHA 1UHSA 3PNVA 5IT9Z 2HS5A 3K0LA 2GA1A 4HAMA 1WI9A 1MBKA 3G1MA 2GBYA 1BOBA 3CJNA 4A0ZA 4DW6A 4WXDA 1Y8RB 4IOCF 3LL7A 3JRCA 4XSZF 4KT6A 4IHSA 2DA3A 3IRQA 1QRYA 1LE8B 1IRFA 1D0YA 2DN0A 4I0AA 3EETA 5IT3A 2ZBKA 3AG2H 2L5QA 1IDYA 3F6OA 5FKNA 1J09A 4MTDA 3EYIA 5E1ZB 1Z6TA 3QQAA 3RKQA 4MQVA 3SFIA 3BR0A 5K7ZA 3SZTA 1SAXA 3W6VA 2UXXA 2V79A 2VJIA 2WWYA 2R5YB 4R1HA 4LK0F 2CW0F 3ZQIA 3RDIA 2L9RA 3LSTA 4BYYA 3S93A 2FJ1A 5FJ8J 2WC2A 3MKLA 4BEHA 5JLWA 5FLVA 1HCRA 1RKTA 4XLAA 3E5QA 5D6FA 2M87A 1ETYA 1ZRFA 5GPCA 3E6MA 3RQIA 5HODA 4P5OA 4F52A 1PDNC 2X51A 2K86A 4FT8A 3LSRA 2R3SA 1E0EA 2LFBA 3KP4A 4XRSA 1KU3A 1EH7A 1N78A 2DDBA 3BG6A 2M0CA 1SVLA 2F5CA 4AWXB 1APLC 1R4NB 1UG0A 3ZXSA 3HEFA 1FJLA 3TDUC 1DPUA 4I76A 1ETKA 3EUHA 2K4JA 2L3DA 3CUQC 4DYCA 2JZYA 3HGGA 5F0FA 4A3LJ 1HSJA 4NQWA 4DBRA 4M74A 3Q0VA 1FBUA 2JPCA 2VIXA 2JMWA 1RPWA 3CDIA 1OLTA 3C2BA 2Q0OA 3K69A 4BL0B 1OYIA 2BY3A 2DT7B 4XOPA 4UVAA 5FKKA 1VTNC 1JXSA 1U9OA 1R36A 4G12A 5EF6A 5BMZA 2QM3A 2AQEA 3LSMA 1YFHA 3BC8A 2AXLA 5KHDA 4R79A 4J01A 1U6GA 4HQEA 1XG1A 2R7DA 1T56A 2LBFA 2WA0A 2AHQA 1WKMA 3HIFA 3NEUA 2VASA 3KP7A 2HYJA 4UXNA 2ME6A 3V8JA 4CZZA 2LKSA 5FRMA 3ONQA 2XF6A 1YS6A 2Z3YA 1JKPC 1J9IA 9ANTA 3IWZA 1UFMA 1NH3A 5FKOA 2XROA 2JA6J 4BDZA 3S3NA 5L3GA 2GXAA 2KZVA 2DQRA 3OYFA 3OYJA 1YG2A 2DA5A 2Y2ZA 3GO5A 5FD6A 3W2AA 3M9AA 3CLOA 4L5EA 3JSOA 4EMSA 2L01A 1BOAA 2PMUA 1Z05A 3ZMVA 4RGSA 2XF5A 1T8IA 4HNTA 5DS9A 2YU3A 3OL4A 1LE8A 1TZLA 5B5EC 2O6GE 2XGXA 2ZMEA 1QZEA 3BR3A 1OR7C 2KFDA 5DM7F 3BY6A 1JUPA 4NHJA 2M34A 3R4KA 3ABMH 3FWEA 3OOUA 4B1RA 4IRHA 1BR4A 2FXAA 1G3YA 3WHCA 2EJRA 4O3MA 4HW0A 2R5YA 1B1BA 2RGVA 4OAYA 3S3MA 3FBNB 1H88C 1OCPA 3KIOA 3RCOA 3GEZA 3MZHA 1ODDA 2V4JC 1VFCA 2PMZA 4RAFA 4UHTA 2YR2A 1FY7A 4HX4A 2KJCA 4PDKA 4XQFA 3NWSA 1OCTC 1XS9A 1REPC 1JKOC 1K78B 2KIMA 4RLFA 4XBFA 3HG9A 3I4PA 1ULYA 3BR5A 5KCMA 4RB2C 3OIPA 2BY1A 1YIOA 2V6CA 1MGTA 2JSPA 1ZR4A 1XSXA 4DZJA 4XRMA 4P9FA 2X6YA 1VQ8I 3TDZC 2HFHA 2PJRB 3CLQA 4IHXA 4YIIA 3OYDA 4QLCU 3RKXA 2KLOA 4A93J 5HLGA 2PX9A 4A3GJ 2M2EA 1R71A 1Y0UA 4LGWA 2P4WA 4ZDLA 5J1YA 2EILH 5ICFA 3F72A 5E8GA 1RNLA 1SFXA 1LJ9A 3V8LA 4ESBA 1ZG5A 1WH7A 4BE1A 1WFXA 5CVJA 2IS2A 1IO2A 4A6DA 2QZ8A 1ETQA 3FXMA 2C6YA 2R7FA 2DO7A 3E6BA 2HPMA 2NVQJ 2WV0A 4KICA 3IUOA 3IH2A 1ETOA 1R1TA 5J4YA 2EQRA 2LD5A 4A3JJ 4BY1J 1NK3P 2CQQA 4OINF 3GTQJ 4MQ9F 1T98A 2FX0A 1K83J 3CMYA 3T1BA 2PFBA 2FE3A 2Y48A 2BY0A 1AKHB 1Q1HA 2CFXA 3G71I 2L02A 5IYBJ 5HOOA 5M3FJ 5D8KB 1B8IA 5TGTA 2A6HF 4V2GA 2KIQA 1EKEA 3IKTA 1W7PB 3BQZA 2BHYA 3WGHA 2BBYA 3BG9A 5H6RA 3F8FA 2V1UA 4KDPA 4Y4RA 3TOBA 2VJ5A 2E35A 2JA8J 2Y69H 2XPWA 4U88A 3A01B 1ZELA 2MD0A 4AIJA 5FGMA 3HDDA 2A68F 3CUQB 2BZTA 3KETA 3K1NA 4UNOA 4UUSB 2DMTA 2Z2SB 1XSDA 4BXUA 1R5HA 2HWVA 2DYRH 2X48A 1ONVA 1PP8F 4FTHA 4BS9A 5IYCJ 2WY8Q 4WWCA 1E17A 1AU7A 3GTJJ 2A6TA 3BG3A 1TQIA 3R61A 1K61A 1FMWA 3ERMA 1W36C 4GYIA 4RB3C 3H1CA 4BKXA 3U21A 4C3JJ 2A61A 1K79A 1QPMA 5J6XA 1SFEA 4GGGA 1WGXA 1FIAA 3KEOA 1RETA 2D45A 3GFLA 3RYPA 4IHYA 1D8KA 2VPRA 1BA5A 1S72I 4A0YA 3IHUA 5HS7A 1PP7U 3GMEA 1C0WA 1W0UA 3JTGA 3ZMTA 3P7NA 5EYRA 3QU3A 2OTLI 3M4OJ 3MQ0A 1IN7A 3CCUI 1J59A 2VPLA 2GOMA 3TEDA 3VDXA 2XAJA 2X9DA 2RQPA 3AKZA 3K2ZA 2D1HA 2M4GA 1X1BA 1LVKA 5GAGJ 1MD0A 1WJCA 2X1DA 3H5AA 2LY2A 2RVCA 5BOXA 4HG2A 1BBYA 5EEHA 4MNUA 3FF5A 1XDUA 4MFEA 1JI8A 2DA2A 3FBIB 3HHHA 3PO3J 4L5JA 3L1PA 4QWQA 3DKXA 1D1CA 3ABKH 4HSRA 3GYHX 1U3EM 3FHNA 3CC7I 4RAYA 3LA3A 1T95A 1FZPB 5HDKA 2QSFX 3WTZA 4XMYA 5DCMB 5J8FA 2R7QA 3T8TA 2STTA 1H8AC 2HEOA 3DBRB 1QU3A 2WADA 4GYGA 4E7SA 3S8PA 4IVNA 2XPUA 3WE2A 3H3ZA 4A3BJ 3DFGA 3GXOA 4B47A 1H0MA 4OIOF 2DA7A 1YRNB 3CTAA 5D5WB 4OIRF 3OIOA 3ELKA 4CDGA 4QTRA 2LDUA 5B1AH 3WG7H 4Q4ZF 3GF2A 1ZRCA 4G94A 1HSTA 2OQGA 1AKHA 2IGNA 2IS6A 2VONA 1F5TA 2XB5A 2CS3A 1BI3A 5J3LA 4RGUA 2HZDA 4EGZA 5IOZA 2F5FA 2EV6A 3VB2A 1X4PA 1FT9A 1DU0A 1MW7A 3TOAA 1P2FA 1R5GA 1X3ZB 2YSRA 4PJMA 2BVMA 2DODA 2XGEA 1IXRC 3SEQA 1Q1VA 2CWEA 4WF2A 2R7TA 2OQRA 1MMGA 2CGPA 2F6CA 5IOYA 2AO9A 3WTWC 1EV7A 2N8GA 4ENJA 2DT6A 2XB0X 2ZCWA 3OR2C 4UV9A 2R7ZJ 4UUSA 2W24A 1RRJA 1FOYA 1YX3A 3BJOA 3L09A 4ETSA 4CYCB 3OV8A 4PCQA 2WAQA 3BPXA 3L2VA 2DOAA 4PFOA 3SQNA 3OYBA 2ZJRF 4G6DA 1TLHB 4KYWA 1FYLA 3G1OA 5CPRB 3ZR8X 3ECOA 1XC5A 3C2HA 2OBPA 2W25A 2JVHA 4CUGA 4U87A 5DV5A 4ESJA 3VODA 2DJNA 3CF2A 4IZZA 4A69C 4NNJA 1HDPA 5EGOB 2OD5A 2DA6A 4EQQA 1ZGJA 3IH3A 1DDNA 1D1BA 1ETXA 3F22A 5TRDA 3I59A 4N9HA 4GCVA 5K1YA 5E8IA 3I53A 1MH3A 1VQ5I 1SD4A 1XMAA 3E97A 5M5YJ 1X4OA 1FYKA 3PSIA 1KYZA 2NS7A 3TO9A 1T39A 1ACIA 2GOXB 3Q9SA 5LRRA 3QOPA 4LLGF 2K9SA 4X0GA 4DQ2A 3ESWB 3K4BA 4WX9A 1J7KA 2EBIA 2MG4A 1ZH5A 1MBEA 2F5DA 4UB8C 3BJAA 3WGGA 2JUCA 4LITA 3K2AA 4AVZA 3ZOBA 4D0PA 5FD5A 2Y0SA 2A5YB 3ZP5A 1H9GA 1U9NA 1OCOH 5LLQA 5B1BH 2QVOA 2E71A 2PMZN 3HSRA 4OAZA 1BW6A 3I54A 3I64A 3JRAA 1I6XA 2X0LA 4J19A 1JTYA 5E3LA 5M5XJ 4G7HF 2E1CA 1POGA 1ON1A 3QYFA 2HQNA 3CCMI 3DEWA 1O3RA 3JREA 1K4TA 2DOEA 1MMSA 3DU6A 4CXFA 1IRZA 4BNCA 1HBXG 2EV5A 4Y15A 2VC0A 1V4RA 1G6NA 3K4NA 3MFKA 2JUGA 1TL8A 1I50J 3OYKA 2M7AA 4XLFA 4CGZA 5BS6A 1KU2A 3L9FA 4CYDA 2O9LA 4LG0B 2K7LA 1SEUA 4MO7A 2ELHA 3HSFA 1IZ1A 4E4HA 2PQ8A 4ZJZA 1R5ID 5CKTA 3PSFA 3LA7A 2Q2EA 1WRJA 1QZYA 4FX0A 2DLLA 2CFOA 2MH2A 2OPTA 3ROUA 2RNJA 2W00A 3VSKA 3S2DJ 3S14J 3IAM2 1T6SA 4AIHA 2EIKH 5LGUA 2J5OA 4C9YA 3QPHA 2Y9YA 1T0FC 4A3EJ 1JHFA 2ZJPF 3PIOF 1N77A 2E1NA 1FEXA 1A04A 2ELKA 3Q9VA 3I55I 5ILUA 2HNHA 3DEEA 2GWRA 2ACJA 4O6JA 1W5CC 2DAOA 2Q1ZB 2W7NA 3PIPF 3E0JB 2Y9ZA 1XN7A 4PGGA 2FU4A 2NNNA 1FWZA 2WBMA 5D8LB 2VOOA 3ML6A 4HV5A 2DT5A 4BBSJ 1MMNA 3O8GA 4JOMA 3OYEA 1IJWC 2VBXA 4Z2YA 3P9KA 3TMOA 1O3SA 3HC7A 3N05A 2MFZA 5EGOA 2MLKA 2KMUA 1NG6A 4H4KC 1DGWY 2BW3B 4NC6A 1S8NA 1B4AA 2KT0A 3QYBA 3MVPA 4NUBA 2K9MA 2ICWG 1IDZA 3BQYA 3MKWB 2O61A 1TP4A 2MW8A 3ZQQA 2EIMH 4GDFA 3QYEA 3HOZJ 4YFXF 1N25A 4A3FJ 2FMYA 1HW2A 3S1NJ 2VODA 4UUTA 5JLXA 1JT0A 3HGYA 2M3AA 4D7MA 5D5XB 4C3HJ 2W82A 2HZTA 3DKYA 1V5EA 4IHVA 1QPIA 1A6IA 3AFHA 3JRGA 4BXXJ 3HPHA 2H1KA 1W0TA 3LA2A 2VOPA 2HOTA 1BR1A 1IV6A 2QSHX 5B3SH 4IRGA 4XLCA 2R92J 4PSXA 5TISC 2NAZA 2QEXI 2M0MA 4LOCA 2L2OA 5E3OA 1DP7P 1VQPI 2K4BA 5C44J 1U5TC 3VSLA 5F0HA 3KLNA 4KIBA 1IC8A 4UV8A 2CQKA 1GVJA 3DTEA 3KZZA 2R7RA 2M4KA 1R9TJ 1F36A 2DFHA 2M5WA 3FXOA 2VKDA 1UHWA 2HPIA 3MCZA 4B8XA 1YJWI 4KISA 5ILSA 2IA2A 3LOCA 3RZOJ 3GZ5A 3OS2A 5JHUA 1YO5C 4LG0A 2STWA 2COMA 3K70D 2DDAA 3TP3A 2AXTC 3EYYA 2L9SA 2TCTA 3DV8A 3GTMJ 5EG0A 2JTVA 3MAJA 3GFIA 3CCRI 2CV1A 2KHMA 3OIQA 4X6AJ 2IGKA 4L9TA 1Z3XA 2G0EA 4KNYA 1MDMB 1HKQA 3IL2A 1S6LA 5K5QA 4DIQA 2AQFA 3DCFA 1ZN2A 2QCOA 5FFZA 2X1CA 3KLOA 1CF7A 3CDHA 3CMEI 4O5VA 3S2WA 1FYMA 4IEJA 4RS8A 3H36A 1VNDA 4EVIA 3BPVA 1T08B 1MZBA 2XASA 3M8JA 3KP5A 2A07F 2Y30A 1T2KA 1IGNA 1X19A 1FOKA 2UUZA 4B48A 2DCEA 2ID3A 2P7VB 2QQ8A 5HVQC 3IC7A 2X6WA 2YS9A 3M3YJ 1LUJB 3J7YJ 5B66C 2LF7A 2KZGA 2EFPA 5CQGA 3S16J 1XCVA 1Z0XA 2X1EA 3Q0WA 2JN6A 4A5NA 3M1EA 5L3CA 2H94A 1PUFA 1JJ8C 3MKZA 4W1UA 1LFPA 2XAUA 3EPZA 2R7SA 5FLXK 3G1LA 2WAQN 4NC7A 1WCMJ 1XTAA 2L4AA 2L7ZA 2BXZA 2FUG2 2QWWA 2QKLB 2V7FA 3DEUA 2FA5A 3LQQA 2YUSA 4L9NA 4XKWA 2XDVA 4A3MJ 3VYRB 1MBHA 2FMLA 1ITYA 2IBDA 4YFNF 2XVCA 1UG2A 1G2HA 4KFCA 1ZHFA 2B9SA 3BTIA 2XUBA 1LEAA 2OU2A 3HRUA 1FP1D 1MMDA 2OV7A 2XGDA 3C7JA 4JQFA 1VZ0A 3CMAI 3ERED 2A69F 2HXOA 3Q0UA 3GFMA 5HLIA 4M3DA 2BY2A 3B02A 5GPAA 3S15J 3VWBA 1RR8C 3PQJA 4JX4A 3HM5A 2XRLA 3WTVC 4LG3A 2L7FP 2VLAA 4AC0A 3WG9A 3DF8A 1ZKGA 4GO1A 5IY5H 4N4NB 3IWFA 3OOPA 3G73A 1A36A 2NVTJ 2PJPA 3C18A 3KFWX 2O03A 2IEKA 1AHDP 1TWFJ 2IPQX 3DXJF 1B6AA 5FROA 3PO2J 2Y0SN 3SEZA 2LKPA 3DTKA 3S32A 3OYGA 3HOWJ 2VC1A 1VQNI 3M7GA 3V7RA 3WTXC 1QA6A 4M3BA 3EUAA 1UJ8A 3I4MJ 2HVRA 1FOWA 2CQ7A 2ZNZA 4CA0A 1G3SA 2JRTA 1GVDA 1FSHA 4L9JA 1P4XA 1ZYRF 2O3FA 3CDLA 5KVRA 2XC7A 4YG2F 1R22A 1USSA 4QPOA 1FSEA 4ZYHA 4U7BA 1L0OC 1E3HA 4PK4A 2KKOA 1LVAA 1MDMA 3ABTA 4GXOA 2XAQA 5HS8A 2IVMA 6PAXA 3BCAA 2P5KA 1RKWA 3BT9A 2NNYA 4A3CJ 5HDNA 3QPSA 4HF2A 3C3WA 2IRFG 5K7HA 2EFWA 3B73A 3A02A 1PJRA 3A1YA 4AVPA 1IN4A 3PM1A 3DU5A 3W3CA 4AU7A 1OKRA 1YJNI 2G7UA 2VJ4A 2ZB9A 2HGCA 1TNTA 5F64A 1U5TB 2XAFA 1VI0A 2FEZA 4XLEA 4L9VA 2ZJQF 1AA7A 3CUOA 1SVMA 2Z16A 1TWAJ 1Y6IA 3SFZA 4DOZA 1MBFA 3GW2A 4F3QA 3TO7A 4F91B 2GIZA 1A31A 3K10A 3JTHA 3H92A 4KJZA 2QGUA 3HRSA 2CRGA 1S3JA 3OYIA 2CH0A 1JUMA 1YITI 3HB9A 2O0YA 1Z1DA 4PJ0C 4ON0A 2K85A 4LLNA 2E1OA 3HBLA 5F08A 2L9NA 1JKQC 2COBA 3V42A 1WJEA 4EM1A 1K6OA 2AS5F 4FX4A 3S2HJ 2NOJB 3V7SA 4BBRJ 3MD2A 2QKMB 3R60A 3CCVI 1T33A 2VQLA 3AAFA 2R0QC 1AWCA 5J1UA
chains in the Genus database with same CATH topology
1H89C 1JGGA 1AKHA 2R5ZB 2CU7A 2XB5A 5J3LA 2O8KA 5IOZA 2HDDA 3H3VK 1CQTA 4M3EA 3TW7A 1DU0A 5F27A 2HI3A 2XGCA 5K7FA 4M3GA 2XGEA 3FKIJ 3ZQGA 4S0HB 2XSDC 1JJ6C 1Q1VA 1MH4A 4D5FA 3OSFA 3SJMA 5IOYA 3IV5A 4D7NA 2AO9A 2N8GA 4MIMA 2XB0X 2H8RA 1RR7A 2R7ZJ 4UUSA 5F04A 1P7IA 1MSFC 2M9HA 4CYCB 2TRTA 2GM4A 3FK7A 4M6VA 1Y1WJ 4DYRA 1U78A 1PUFB 2O7OA 3G1OA 1QVTA 1XC5A 2L7MP 4GFBA 2B63J 3S1QJ 2DJNA 4A69C 1HDPA 5EGOB 2HQ5A 2DA6A 2ECBA 4DZPA 1WH5A 3IH3A 2JA7J 3TW6A 5EZGA 1ETXA 2LK2A 2LP0A 3QPLA 1MH3A 2I10A 1JKRC 2CJJA 1B8IB 5M5YJ 4M3FA 2E2JJ 2EH3A 2WB1N 4HNVA 2NS7A 3MN2A 4C2MJ 3BR1A 2K9SA 3Q3SA 4DYQA 4XRSG 2EBIA 1GT0C 1X58A 2MG4A 1HOMA 1MBEA 4RDUA 1JUSA 2X6OA 2E2IJ 3K2AA 1A5JA 3ZOBA 3CQZJ 1U9NA 1X2MA 4QSHA 3RZDJ 1UHSA 2PMZN 5IYDJ 5EEAA 4C3IJ 1BW6A 3CCYA 3JRAA 3G1MA 1MBKA 2GBYA 4D5CA 2D5VA 4J19A 4DW6A 1JTYA 3JRCA 5E3LA 5M5XJ 4XICA 1ZTRA 2DA3A 1POGA 1QRYA 1LE8B 5C4XJ 2DN0A 3DEWA 3JREA 3I4NJ 1IRZA 1BL0A 1FTTA 3E7LA 1GV5A 3BTJA 2NOGA 1IDYA 3HOXJ 5FKNA 1MNMC 3GTGJ 1I50J 2DMNA 3QQAA 3RKQA 5DTDA 3SFIA 2O9LA 2K9QA 2NS8A 3BR0A 4MO7A 5K7ZA 3W6VA 1F43A 2OF7A 4RBOA 2R5YB 1TWHJ 3S1MJ 2W48A 3GTPJ 5BNGA 3ZQIA 4MLOA 2L9RA 2LTPA 2FJ1A 2FQ4A 2OPTA 4QIWN 5FJ8J 3JRDA 3D1NI 5IPAA 5JLWA 3MKLA 3S14J 3S2DJ 5FLVA 1HCRA 1RKTA 1ETYA 5GPCA 1VF9A 3RQIA 5HODA 2EZHA 2Y9YA 3LSRA 1TWGJ 4A3EJ 1HDDC 2DA4A 5IP9J 2LFBA 3VPRA 1FEXA 2ELKA 4XRSA 1ZR2A 2M0CA 2HOAA 4A3KJ 1APLC 3HEFA 4JYKA 1FJLA 2DMQA 4I76A 1ETKA 3A01A 2Y9ZA 4DYCA 4BBSJ 1ETWA 2E19A 4A3IJ 3HGGA 5F0FA 2VKVA 3ZQFA 4A3LJ 1SANA 3O8GA 1IJWC 3Q0VA 2FD5A 5IP6A 5EGOA 5C3EJ 2JMWA 1RPWA 3C2BA 2LR8A 2K9NA 2VI6A 3H0GJ 2KT0A 3MVPA 1IDZA 1Z77A 3BTCA 5E3MA 3BQYA 5FKKA 1ZGWA 1U9OA 2WV1A 2MW8A 4G12A 5EF6A 3HOYJ 1B72B 3HOZJ 3F0CA 4A3FJ 1XG1A 1I3QJ 1T56A 3S1NJ 2YU9J 4UUTA 2AHQA 5JLXA 1JT0A 3HGYA 4D7MA 2HYJA 3GBGA 2ME6A 1S7EA 4C3HJ 3BG5A 2VKEA 4IHVA 1JKPC 1GUUA 1QPIA 1A6IA 3JRGA 4BXXJ 9ANTA 1TC3C 2P81A 3FISA 2H1KA 5FKOA 2MGQA 1W0TA 2JA6J 2HOTA 1IV6A 1IUFA 2R92J 2CUEA 2EZLA 1GDTA 1OFCX 5E3OA 4LOCA 2E2HJ 3GTLJ 2DA5A 2Y2ZA 5C44J 5F1JA 3JRIA 1NK2P 4L5EA 5F0HA 1IC8A 3S1RJ 1O4XA 1R9TJ 2ID6A 1F36A 2ECCA 1BJZA 5DS9A 1LE8A 2DMPA 1E3OC 2R93J 5F0CA 4EEFG 4AUXA 5E3NA 3BR3A 1FTZA 3LOCA 1JTXA 4X1EA 3RZOJ 3S17J 1JUPA 1LFUP 5GP9A 2M34A 3HKZN 1OJLA 3OOUA 5FKLA 4B1RA 3TP3A 3WHCA 4JP0A 2CUFA 2TCTA 2R5YA 3GTMJ 5EG0A 1DU6A 4X6AJ 1H88C 1OCPA 2JWTA 1IG7A 1YRNA 2G0EA 1X2NA 1VFCA 3DCFA 2QCOA 1ORKA 3UKGA 3B6AA 4B3AA 1OCTC 1XS9A 4IEJA 3GTOJ 5EZHA 1JKOC 1MBJA 2R5ZA 1VNDA 3NAUA 3K7AJ 3JRHA 2NVYJ 3BR5A 2HOSA 2JK3A 3WHBA 1ZR4A 2DA1A 4DZJA 4XRMA 2MSYA 2Y30A 3A03A 1IGNA 4IHXA 1ETVA 3O8HA 4A93J 2ID3A 4A3GJ 5FKMA 2M2EA 2YS9A 3ZQLA 3M3YJ 4NDLA 1NTCA 1BW5A 5J1YA 1MSEC 3B6CA 5FLMJ 4CYCA 3S16J 1Z0XA 4JX5A 3Q0WA 1RESA 1WH7A 2JN6A 1PUFA 2Y31A 1JJ8C 4V2FA 4XIDA 3BR2A 3LSGA 4W1UA 1ETQA 4FE7A 2NVQJ 1JT6A 2XPVA 1ZQ3P 3G1LA 2WAQN 3IH2A 1ETOA 2EQRA 2LD5A 4A3JJ 4BY1J 1WCMJ 4IHWA 4Y7NJ 1U8BA 2L7ZA 2CQQA 1B72A 1NK3P 3GTQJ 2FX0A 2L0KA 2YUSA 1K83J 3CMYA 1AKHB 4A3MJ 1MBHA 5IYBJ 1ITYA 2IBDA 5M3FJ 3HOVJ 1B8IA 1TWCJ 4I6ZA 1LFBA 1UG2A 3NARA 4V2GA 1G2HA 3BQZA 3BTIA 3JRBA 3BG9A 5C4JJ 2EZIA 4FE4A 2NVXJ 2XGDA 1QVUA 1ZK8A 2HXOA 3Q0UA 1SFOJ 4JX6A 4M3DA 2JA8J 2XPWA 5GPAA 3A01B 3HDDA 3S15J 4JX4A 5EDNA 3HM5A 1EF4A 2XRLA 3JR9A 4UUSB 2DMTA 2L7FP 4BY7J 4AC0A 2DTZA 1ZKGA 2CQXA 2NVTJ 2X48A 2LVSA 4FTHA 5IYCJ 2IEKA 5M5WJ 1AHDP 1TWFJ 4XK4A 3PO2J 1AU7A 2Y0SN 3GTJJ 3BG3A 2GLOA 2RAEA 1K61A 5J1RA 3HOWJ 4BKXA 4C3JJ 4M3BA 3OSGA 1HLVA 3TP0A 3I4MJ 4Y52J 3FIWA 1WGXA 1FIAA 1GVDA 5M3MJ 1RETA 3CDLA 4AYBN 4IHYA 4W97A 1FIPA 2VUMJ 1HF0A 2VPRA 3BTLA 1BA5A 4MFDA 3ZQHA 1W0UA 2JA5J 1GV2A 3GTKJ 1RKWA 3BT9A 2EZKA 3SDGA 4A3CJ 3QPSA 2DMUA 5EYRA 5K7HA 3M4OJ 3LSPA 3A02A 3LSJA 4FCYA 3TEDA 3BR6A 3PM1A 1ENHA 1P7JA 2X9DA 1MBGA 1Y1VJ 2LKXA 4B4CA 2ZB9A 2IAIA 2LLKA 2KDZA 3ZQCA 1VI0A 1WPKA 1TWAJ 2JJ7A 1MBFA 1WI3A 4A3DJ 4MFEA 2DA2A 2M8GX 3LNQA 3PO3J 4ABZA 2ME0A 3L1PA 2CRGA 1JUMA 4FISA 3HB9A 5IP7J 3FK6A 1I6HJ 3JRFA 2E1OA 3HBLA 5F08A 1JKQC 1H8AC 2COBA 3IH4A 5EG0B 3S2HJ 2XPUA 1UMQA 4BBRJ 4A3BJ 2HXIA 2DA7A 1YRNB 1D5YA 2LY9A 1T33A 3OIOA 2K40A 2QF7A 2R0QC 3HOUJ 5J1UA 4QTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H89 C;  1JGG A;  1AKH A;  2R5Z B;  2CU7 A;  2XB5 A;  5J3L A;  2O8K A;  5IOZ A;  2HDD A;  3H3V K;  1CQT A;  4M3E A;  3TW7 A;  1DU0 A;  5F27 A;  2HI3 A;  2XGC A;  5K7F A;  4M3G A;  2XGE A;  3FKI J;  3ZQG A;  4S0H B;  2XSD C;  1JJ6 C;  1Q1V A;  1MH4 A;  4D5F A;  3OSF A;  3SJM A;  5IOY A;  3IV5 A;  4D7N A;  2AO9 A;  2N8G A;  4MIM A;  2XB0 X;  2H8R A;  1RR7 A;  2R7Z J;  4UUS A;  5F04 A;  1P7I A;  1MSF C;  2M9H A;  4CYC B;  2TRT A;  2GM4 A;  3FK7 A;  4M6V A;  1Y1W J;  4DYR A;  1U78 A;  1PUF B;  2O7O A;  3G1O A;  1QVT A;  1XC5 A;  2L7M P;  4GFB A;  2B63 J;  3S1Q J;  2DJN A;  4A69 C;  1HDP A;  5EGO B;  2HQ5 A;  2DA6 A;  2ECB A;  4DZP A;  1WH5 A;  3IH3 A;  2JA7 J;  3TW6 A;  5EZG A;  1ETX A;  2LK2 A;  2LP0 A;  3QPL A;  1MH3 A;  2I10 A;  1JKR C;  2CJJ A;  1B8I B;  5M5Y J;  4M3F A;  2E2J J;  2EH3 A;  2WB1 N;  4HNV A;  2NS7 A;  3MN2 A;  4C2M J;  3BR1 A;  2K9S A;  3Q3S A;  4DYQ A;  4XRS G;  2EBI A;  1GT0 C;  1X58 A;  2MG4 A;  1HOM A;  1MBE A;  4RDU A;  1JUS A;  2X6O A;  2E2I J;  3K2A A;  1A5J A;  3ZOB A;  3CQZ J;  1U9N A;  1X2M A;  4QSH A;  3RZD J;  1UHS A;  2PMZ N;  5IYD J;  5EEA A;  4C3I J;  1BW6 A;  3CCY A;  3JRA A;  3G1M A;  1MBK A;  2GBY A;  4D5C A;  2D5V A;  4J19 A;  4DW6 A;  1JTY A;  3JRC A;  5E3L A;  5M5X J;  4XIC A;  1ZTR A;  2DA3 A;  1POG A;  1QRY A;  1LE8 B;  5C4X J;  2DN0 A;  3DEW A;  3JRE A;  3I4N J;  1IRZ A;  1BL0 A;  1FTT A;  3E7L A;  1GV5 A;  3BTJ A;  2NOG A;  1IDY A;  3HOX J;  5FKN A;  1MNM C;  3GTG J;  1I50 J;  2DMN A;  3QQA A;  3RKQ A;  5DTD A;  3SFI A;  2O9L A;  2K9Q A;  2NS8 A;  3BR0 A;  4MO7 A;  5K7Z A;  3W6V A;  1F43 A;  2OF7 A;  4RBO A;  2R5Y B;  1TWH J;  3S1M J;  2W48 A;  3GTP J;  5BNG A;  3ZQI A;  4MLO A;  2L9R A;  2LTP A;  2FJ1 A;  2FQ4 A;  2OPT A;  4QIW N;  5FJ8 J;  3JRD A;  3D1N I;  5IPA A;  5JLW A;  3MKL A;  3S14 J;  3S2D J;  5FLV A;  1HCR A;  1RKT A;  1ETY A;  5GPC A;  1VF9 A;  3RQI A;  5HOD A;  2EZH A;  2Y9Y A;  3LSR A;  1TWG J;  4A3E J;  1HDD C;  2DA4 A;  5IP9 J;  2LFB A;  3VPR A;  1FEX A;  2ELK A;  4XRS A;  1ZR2 A;  2M0C A;  2HOA A;  4A3K J;  1APL C;  3HEF A;  4JYK A;  1FJL A;  2DMQ A;  4I76 A;  1ETK A;  3A01 A;  2Y9Z A;  4DYC A;  4BBS J;  1ETW A;  2E19 A;  4A3I J;  3HGG A;  5F0F A;  2VKV A;  3ZQF A;  4A3L J;  1SAN A;  3O8G A;  1IJW C;  3Q0V A;  2FD5 A;  5IP6 A;  5EGO A;  5C3E J;  2JMW A;  1RPW A;  3C2B A;  2LR8 A;  2K9N A;  2VI6 A;  3H0G J;  2KT0 A;  3MVP A;  1IDZ A;  1Z77 A;  3BTC A;  5E3M A;  3BQY A;  5FKK A;  1ZGW A;  1U9O A;  2WV1 A;  2MW8 A;  4G12 A;  5EF6 A;  3HOY J;  1B72 B;  3HOZ J;  3F0C A;  4A3F J;  1XG1 A;  1I3Q J;  1T56 A;  3S1N J;  2YU9 J;  4UUT A;  2AHQ A;  5JLX A;  1JT0 A;  3HGY A;  4D7M A;  2HYJ A;  3GBG A;  2ME6 A;  1S7E A;  4C3H J;  3BG5 A;  2VKE A;  4IHV A;  1JKP C;  1GUU A;  1QPI A;  1A6I A;  3JRG A;  4BXX J;  9ANT A;  1TC3 C;  2P81 A;  3FIS A;  2H1K A;  5FKO A;  2MGQ A;  1W0T A;  2JA6 J;  2HOT A;  1IV6 A;  1IUF A;  2R92 J;  2CUE A;  2EZL A;  1GDT A;  1OFC X;  5E3O A;  4LOC A;  2E2H J;  3GTL J;  2DA5 A;  2Y2Z A;  5C44 J;  5F1J A;  3JRI A;  1NK2 P;  4L5E A;  5F0H A;  1IC8 A;  3S1R J;  1O4X A;  1R9T J;  2ID6 A;  1F36 A;  2ECC A;  1BJZ A;  5DS9 A;  1LE8 A;  2DMP A;  1E3O C;  2R93 J;  5F0C A;  4EEF G;  4AUX A;  5E3N A;  3BR3 A;  1FTZ A;  3LOC A;  1JTX A;  4X1E A;  3RZO J;  3S17 J;  1JUP A;  1LFU P;  5GP9 A;  2M34 A;  3HKZ N;  1OJL A;  3OOU A;  5FKL A;  4B1R A;  3TP3 A;  3WHC A;  4JP0 A;  2CUF A;  2TCT A;  2R5Y A;  3GTM J;  5EG0 A;  1DU6 A;  4X6A J;  1H88 C;  1OCP A;  2JWT A;  1IG7 A;  1YRN A;  2G0E A;  1X2N A;  1VFC A;  3DCF A;  2QCO A;  1ORK A;  3UKG A;  3B6A A;  4B3A A;  1OCT C;  1XS9 A;  4IEJ A;  3GTO J;  5EZH A;  1JKO C;  1MBJ A;  2R5Z A;  1VND A;  3NAU A;  3K7A J;  3JRH A;  2NVY J;  3BR5 A;  2HOS A;  2JK3 A;  3WHB A;  1ZR4 A;  2DA1 A;  4DZJ A;  4XRM A;  2MSY A;  2Y30 A;  3A03 A;  1IGN A;  4IHX A;  1ETV A;  3O8H A;  4A93 J;  2ID3 A;  4A3G J;  5FKM A;  2M2E A;  2YS9 A;  3ZQL A;  3M3Y J;  4NDL A;  1NTC A;  1BW5 A;  5J1Y A;  1MSE C;  3B6C A;  5FLM J;  4CYC A;  3S16 J;  1Z0X A;  4JX5 A;  3Q0W A;  1RES A;  1WH7 A;  2JN6 A;  1PUF A;  2Y31 A;  1JJ8 C;  4V2F A;  4XID A;  3BR2 A;  3LSG A;  4W1U A;  1ETQ A;  4FE7 A;  2NVQ J;  1JT6 A;  2XPV A;  1ZQ3 P;  3G1L A;  2WAQ N;  3IH2 A;  1ETO A;  2EQR A;  2LD5 A;  4A3J J;  4BY1 J;  1WCM J;  4IHW A;  4Y7N J;  1U8B A;  2L7Z A;  2CQQ A;  1B72 A;  1NK3 P;  3GTQ J;  2FX0 A;  2L0K A;  2YUS A;  1K83 J;  3CMY A;  1AKH B;  4A3M J;  1MBH A;  5IYB J;  1ITY A;  2IBD A;  5M3F J;  3HOV J;  1B8I A;  1TWC J;  4I6Z A;  1LFB A;  1UG2 A;  3NAR A;  4V2G A;  1G2H A;  3BQZ A;  3BTI A;  3JRB A;  3BG9 A;  5C4J J;  2EZI A;  4FE4 A;  2NVX J;  2XGD A;  1QVU A;  1ZK8 A;  2HXO A;  3Q0U A;  1SFO J;  4JX6 A;  4M3D A;  2JA8 J;  2XPW A;  5GPA A;  3A01 B;  3HDD A;  3S15 J;  4JX4 A;  5EDN A;  3HM5 A;  1EF4 A;  2XRL A;  3JR9 A;  4UUS B;  2DMT A;  2L7F P;  4BY7 J;  4AC0 A;  2DTZ A;  1ZKG A;  2CQX A;  2NVT J;  2X48 A;  2LVS A;  4FTH A;  5IYC J;  2IEK A;  5M5W J;  1AHD P;  1TWF J;  4XK4 A;  3PO2 J;  1AU7 A;  2Y0S N;  3GTJ J;  3BG3 A;  2GLO A;  2RAE A;  1K61 A;  5J1R A;  3HOW J;  4BKX A;  4C3J J;  4M3B A;  3OSG A;  1HLV A;  3TP0 A;  3I4M J;  4Y52 J;  3FIW A;  1WGX A;  1FIA A;  1GVD A;  5M3M J;  1RET A;  3CDL A;  4AYB N;  4IHY A;  4W97 A;  1FIP A;  2VUM J;  1HF0 A;  2VPR A;  3BTL A;  1BA5 A;  4MFD A;  3ZQH A;  1W0U A;  2JA5 J;  1GV2 A;  3GTK J;  1RKW A;  3BT9 A;  2EZK A;  3SDG A;  4A3C J;  3QPS A;  2DMU A;  5EYR A;  5K7H A;  3M4O J;  3LSP A;  3A02 A;  3LSJ A;  4FCY A;  3TED A;  3BR6 A;  3PM1 A;  1ENH A;  1P7J A;  2X9D A;  1MBG A;  1Y1V J;  2LKX A;  4B4C A;  2ZB9 A;  2IAI A;  2LLK A;  2KDZ A;  3ZQC A;  1VI0 A;  1WPK A;  1TWA J;  2JJ7 A;  1MBF A;  1WI3 A;  4A3D J;  4MFE A;  2DA2 A;  2M8G X;  3LNQ A;  3PO3 J;  4ABZ A;  2ME0 A;  3L1P A;  2CRG A;  1JUM A;  4FIS A;  3HB9 A;  5IP7 J;  3FK6 A;  1I6H J;  3JRF A;  2E1O A;  3HBL A;  5F08 A;  1JKQ C;  1H8A C;  2COB A;  3IH4 A;  5EG0 B;  3S2H J;  2XPU A;  1UMQ A;  4BBR J;  4A3B J;  2HXI A;  2DA7 A;  1YRN B;  1D5Y A;  2LY9 A;  1T33 A;  3OIO A;  2K40 A;  2QF7 A;  2R0Q C;  3HOU J;  5J1U A;  4QTR A; 
#chains in the Genus database with same CATH topology
 5CVR A;  1O57 A;  2DOF A;  2UZK A;  1DPR A;  2FBH A;  3HRM A;  2QSG X;  3N97 A;  2R5Z B;  4BXF A;  2LC2 A;  2W85 A;  2Z33 A;  4IHT A;  3GZ6 A;  1LPQ A;  1IRX A;  2KQR A;  2O8K A;  4HQM A;  2K27 A;  1CQT A;  2RDP A;  1WJD A;  2GXB A;  1PVE A;  4M3E A;  3TW7 A;  5JVT A;  5F27 A;  4FET A;  4FAS D;  1JJ6 C;  3U2R A;  2XSD C;  5FLX Z;  2CO5 A;  3FMS A;  1N75 A;  2RV8 A;  1QHH D;  3CCL I;  3SJM A;  2YPR A;  1OPC A;  2ZO4 A;  4HYE A;  4E7L A;  3IV5 A;  1S29 A;  4HRI A;  1KA8 A;  2ESH A;  5F04 A;  3LSK A;  2M9H A;  1O7L A;  1Y1W J;  3OYL A;  1TNS A;  1MND A;  2O7O A;  4XON A;  5LD2 C;  2IW5 A;  5E1W A;  2LRD A;  2K5C A;  1LEB A;  5DYM A;  3SHF A;  1PYV A;  5LHI A;  4RB0 A;  1QVT A;  5FFX A;  4QPQ A;  4Y13 A;  2UWM A;  1IXS B;  3ECH A;  3K1M A;  5F6F A;  4E7K A;  3RSN A;  1XSV A;  5KAF C;  4EJW A;  3OR1 C;  4XN0 A;  1VQ9 I;  5EZG A;  2E34 A;  2LK2 A;  2PBI A;  1ZGA A;  4D9J A;  3QPL A;  1IF1 A;  2Z9O A;  5L3F A;  2BE5 F;  1RC9 A;  4A5M A;  1OMI A;  4HNV A;  4CO8 A;  5FO5 A;  2XF7 A;  3MKY B;  3MN2 A;  2X4H A;  1HXD A;  1Z67 A;  3TBI A;  1P92 A;  3Q3S A;  2RQQ A;  4ANJ A;  3DKW A;  2E1M C;  4XRS G;  1F9N A;  5DD4 A;  5D6E A;  3L2W A;  2RKH A;  3HL2 A;  4HX7 A;  5JVG F;  1J0R A;  1P4A A;  1JUS A;  2BVL A;  2X6O A;  3C2G A;  2D2W A;  2W84 A;  3SZP A;  5BQT A;  3ZMU A;  1Z9C A;  4FHT A;  4OOI A;  3CQZ J;  1STZ A;  2ZXH A;  2VE9 A;  3J7A O;  4OMZ A;  4IKF A;  1X2M A;  1MMA A;  4ZDO A;  3A2K A;  1G4D A;  1K78 A;  5E17 F;  1ZLJ A;  5IYD J;  5EEA A;  4RGR A;  2Z5U A;  4UVB A;  4C3I J;  3H5R A;  1JGS A;  3X2Q H;  4HOB A;  4UY8 I;  3QRF F;  3K4J A;  1Z7L A;  2D5V A;  1EJ9 A;  3HRT A;  4ZH4 F;  2UXN A;  1ZG3 A;  4I01 A;  4AYB A;  3M8E A;  5C4X J;  2EIJ H;  1FP2 A;  4Y3O A;  2V26 A;  2PJR A;  1YS7 A;  3AG4 H;  3I4N J;  3PUF A;  3HPG A;  3BLY A;  2R4G A;  2W57 A;  4WCG A;  4P1W A;  5DUK A;  2VQC A;  1BL0 A;  3E7L A;  1IV8 A;  3BTJ A;  3K4M A;  2NOG A;  2IJL A;  3HOX J;  3FXL A;  2DMN A;  5AIP A;  2A6E F;  1TBX A;  2QQB A;  3HTS B;  3ZGK A;  2NS8 A;  3DLA A;  1GXQ A;  1U0J A;  2YX7 A;  2FSW A;  2V6E A;  2DYS H;  4RBO A;  3E6C C;  1R00 A;  1TQM A;  1TWH J;  2H8W A;  2KIU A;  2V1D A;  2DPD A;  5JI6 A;  2DTR A;  2PN6 A;  4Q5S F;  2D1V A;  4HZF A;  3GTP J;  4KIF A;  1WSU A;  3F8C A;  2H1L A;  4PZJ A;  3VEP A;  4MLO A;  1D0X A;  5JHF A;  1V3F A;  4C2T A;  3MZ8 A;  2NYX A;  1HQC A;  4ZYG A;  3D1N I;  1R58 A;  3QWL A;  1K7A A;  3ABL H;  2ZSI B;  1Z6R A;  3BOQ A;  2K9L A;  3O2P E;  3CZ6 A;  4HDU A;  1A35 A;  1MJ9 A;  1VF9 A;  5HNH A;  1ZLK A;  1K6Y A;  1O3T A;  5H2F C;  1YHQ I;  1TWG J;  2DK8 A;  1Z91 A;  2RC4 A;  1W7P A;  3ZMZ A;  4CCL A;  1D1A A;  3U9G A;  4BGD A;  1D3Y A;  4CHU A;  1ZR2 A;  1TW3 A;  4EJO A;  2HOA A;  3CCQ I;  1V54 H;  1OCC H;  1MIJ A;  3KPH A;  4JYK A;  2DMQ A;  3EUH C;  3H3U A;  3A01 A;  3BZK A;  3HOT A;  1ETW A;  2F48 A;  2E19 A;  3CUQ A;  2IGM A;  2VQG A;  3NRV A;  4I7H A;  2VKV A;  1XGN A;  3GZN B;  4U0V A;  5LEJ A;  4A3I J;  2ELJ A;  3ZQ7 A;  5ICE A;  4OIQ F;  1SAU A;  1UEL B;  4G8X A;  1NG7 A;  4CCO A;  1FNN A;  1IN6 A;  2Y75 A;  2VBZ A;  2LR8 A;  1YOV B;  2K9N A;  2VI6 A;  3BCB A;  4AD9 A;  2F5E A;  5A2Q K;  2XAG A;  4HBL A;  3BTC A;  3ZMD A;  5D5U B;  1UZC A;  1WQ2 A;  5E3M A;  1I39 A;  1ZGW A;  2WV1 A;  4KN4 X;  4BUP A;  3HOY J;  3PNT A;  4I02 A;  3FXU A;  2MAB A;  3S3O A;  3F0C A;  2PLY A;  1I3Q J;  2V9P A;  3OL3 A;  1F4K A;  1O7F A;  2JA2 A;  2YU9 J;  3GLX A;  2R7X A;  3J7Z I;  3RKW A;  4P9U A;  1S7E A;  1IN8 A;  2VKE A;  4C30 A;  3JCU C;  4RGX A;  1LDK B;  3COA C;  1Y39 A;  3H9J A;  2KL4 A;  3E3V A;  4XOT A;  3RPQ A;  4XKB A;  2MGQ A;  3OYH A;  4I99 C;  4HEA 2;  3CC2 I;  1YI2 I;  2HVS A;  2L54 A;  3BRO A;  2VBY A;  2L4M A;  4PGH A;  4V19 K;  2MYS A;  4N0B A;  4EJU A;  3NQO A;  3JAM K;  3F8M A;  2CUE A;  1OFC X;  5HLH A;  2VB6 A;  3J7A Y;  1I1S A;  2OAZ A;  3GTL J;  5F1J A;  4XN3 A;  4G7Z F;  4IX7 A;  3I58 A;  4XLP F;  2EA4 A;  3S1R J;  2QYO A;  1ZAR A;  2Y0M A;  3G3Z A;  1O4X A;  2ID6 A;  2ECC A;  1BJZ A;  1XDS A;  2LMD A;  2ZME C;  3WOD F;  3L00 A;  1QBJ A;  2EB7 A;  5E3N A;  4AIK A;  1XD7 A;  1OR7 A;  2LRE A;  1JTX A;  2PG4 A;  4X1E A;  2ZJ2 A;  1YTY A;  2Q8K A;  1LFU P;  5GP9 A;  2RRE A;  3OMY A;  4XLN F;  1OJL A;  1SMY F;  1SD6 A;  3V4G A;  5DCM A;  3WU0 A;  2HVQ A;  3RI4 A;  1M1E B;  4JP0 A;  2E1M B;  1QGP A;  3VYU B;  2I8D A;  3I3L A;  1DU6 A;  1TW2 A;  1KZH A;  2HDC A;  1YRN A;  1DP3 A;  4PJL A;  1X2N A;  2EFO A;  1TT5 B;  3H35 A;  4RA2 A;  2LOO A;  2P0W A;  5GAE J;  1YW7 A;  5E18 F;  1XPX A;  2JSC A;  5ICC A;  2W4S A;  3HUG B;  1ORK A;  2K3F A;  5LRS A;  4B3A A;  1FOX A;  5J4V A;  3LAJ A;  1OIS A;  1L3L A;  1MBJ A;  3RQ4 A;  3J81 K;  3SYT A;  3HSE A;  1X1D A;  2E7X A;  3KP6 A;  3CC4 I;  2I5U A;  3K7A J;  5HS9 A;  3KYD B;  3CJQ B;  3QPT A;  1Y8Q B;  2KIF A;  4IO9 F;  1EA3 A;  1XCB A;  1J75 A;  2JK3 A;  2DA1 A;  2MSY A;  3A03 A;  4HDV A;  3VFZ A;  1IAW A;  2GZW A;  1ETV A;  4BQO A;  3O8H A;  3F8N A;  2HQA A;  4IOA F;  4XNF A;  5FKM A;  4YIR X;  3ZQL A;  2DU9 A;  2LNB A;  1GXP A;  1E2X A;  4NDL A;  3ZPL A;  4HA8 A;  1NTC A;  1T38 A;  1LDD A;  1BW5 A;  3RKY A;  2GIV A;  3B6C A;  4E7H A;  4CYC A;  2DFE A;  3KYL A;  2Z1D A;  1RES A;  1XMX A;  3ISP A;  5ICG A;  4S04 A;  4XID A;  1BM9 A;  3WTT C;  2L7K A;  4FE7 A;  2HKO A;  2JVG A;  2XPV A;  4PSW A;  2LF8 A;  1ZQ3 P;  1OQY A;  4OIP F;  3I56 I;  1Z21 A;  1HW5 A;  3P9I A;  4Y7N J;  1U8B A;  4LMY A;  1W7P D;  2QQ9 A;  3H5N A;  3D5L A;  4BEH B;  2M8E A;  3CO7 C;  2WAF A;  2E5Z A;  3WTS C;  4HPQ A;  2HTS A;  4I6Z A;  4E7Z A;  4BHB A;  4RAG A;  2CMP A;  3PFY A;  1J2X A;  3FM3 A;  2MC4 A;  1TTY A;  1D8J A;  3JRB A;  1LDJ A;  2P7C B;  5C4J J;  1IXC A;  1MKM A;  1R6R A;  5A2Q Z;  1LB2 A;  1YW9 A;  2NVX J;  1YLF A;  4F93 B;  1QVU A;  2F2E A;  1XGS A;  2HYF A;  4N4O B;  3OYN A;  1FC3 A;  1FBS A;  5EDN A;  4NQW B;  5AIQ A;  1R1V A;  2O8X A;  1BI1 A;  2B0L A;  1SC7 A;  1R49 A;  2LYC A;  4ZZD A;  3KZI C;  4F55 A;  4G9Y A;  2MA3 A;  4BAY A;  4JK1 X;  2HKX A;  2GLO A;  2XSJ C;  3JAM Z;  3LFK A;  2EPF A;  2OA4 A;  1EH6 A;  3KCC A;  1K4S A;  3CJR B;  3RJP A;  4Y52 J;  4HV6 A;  3QP6 A;  1XMK A;  4KT5 C;  5J40 A;  4AYB N;  5DEQ A;  4W97 A;  1ZG1 A;  1FIP A;  4IXA A;  1D5V A;  4E6K G;  3OWT A;  2VUM J;  1HF0 A;  4BE2 A;  1SVO A;  2JA5 J;  1GV2 A;  3GTK J;  1QHG A;  2XHK A;  2EZK A;  3SDG A;  2IS1 A;  4YEL A;  3T8R A;  4CZC A;  2FBI A;  3BR6 A;  1YX5 A;  5D4R A;  4LB6 B;  1ENH A;  4HF0 A;  1MBG A;  1Y1V J;  3BZ6 A;  4B4C A;  3KE2 A;  4CCM A;  2IAI A;  2KDZ A;  2V1N A;  1WVR A;  1QZZ A;  3ZQC A;  3H0D A;  1G3T A;  2EIN H;  5EEG A;  4AID A;  1W5T A;  5K5R A;  1WI3 A;  3ULQ B;  2QUF A;  3HKZ A;  2XKP A;  4A3D J;  1IW7 F;  2IA1 A;  4N9I A;  2F5V A;  2MH9 A;  2ZME B;  4BE0 A;  2ME0 A;  2K3P A;  4LJZ F;  1ERD A;  3QU6 A;  2PMH A;  2QQA A;  3FXJ A;  2CQN A;  4LFU A;  4OU0 A;  4R8H A;  5DCF A;  3PL8 A;  5IP7 J;  3GWZ A;  3J81 Z;  3FK6 A;  1I6H J;  3CO6 C;  3JRF A;  3CD6 I;  3CCE I;  2FNP A;  4A2U A;  1UMQ A;  2CW7 A;  3WE3 A;  4RAZ A;  1D5Y A;  2GA2 A;  4EGY A;  1CGP A;  2QF7 A;  3HOU J;  4A0X A;  1BI2 A;  2FOW A;  2HOE A;  1NHA A;  4EJV A;  3G4S I;  4LB5 A;  3L2U A;  3TO6 A;  4ZYE A;  4UB6 C;  1H89 C;  1KQ0 A;  2BW3 A;  5ED4 A;  1BC7 C;  3A0H C;  4KN7 X;  2YX4 A;  3FM5 A;  4RB1 A;  5E79 C;  1QO0 D;  4GRI A;  2CU7 A;  2ADU A;  2BXY A;  3OYA A;  2XV4 S;  1YQA A;  3REO A;  3F21 A;  4M6X A;  2CW8 A;  5CQE A;  5LBQ A;  4M9S A;  2XGC A;  2ZKZ A;  4WK8 F;  1B9N A;  3DLL F;  1GLN A;  3ZQG A;  2R7U A;  4KIT B;  2O5R A;  4D5F A;  4KIG A;  3PFI A;  3OSF A;  2W1O A;  3HJE A;  1D0Z A;  2KRH A;  1BI0 A;  1I3A A;  4MIM A;  4EV0 A;  1VQL I;  2ZXJ A;  2H8R A;  2EFQ A;  3BDD A;  3BG7 A;  2TRT A;  4B43 A;  4XOR A;  1X1A A;  4DYR A;  1WJ5 A;  1U78 A;  2MLG A;  3T0Y A;  1ZRE A;  2IGO A;  5KAI C;  4L5I A;  2GAU A;  4CH7 A;  4YIF A;  4GFB A;  3KP3 A;  5E1X A;  2NVU B;  3KP2 A;  2PEX A;  2ECB A;  2IA0 A;  3W6K B;  4DZP A;  1WH5 A;  2JA7 J;  3P5J A;  4OWR B;  4ZTJ A;  2F4M B;  3I5U A;  3SDB A;  2LP0 A;  1YIJ I;  1FBQ A;  1I1G A;  4D1Q A;  4IRI A;  1B8I B;  3QOE A;  4ZC3 A;  5LFA A;  3FXK A;  1XGM A;  3VYS B;  2TDX A;  2ZXW H;  4B3X A;  3BR1 A;  3HXL A;  1IUY A;  4I98 B;  4DYQ A;  3KYC B;  2RNG A;  1R1U A;  2K02 A;  4YRV A;  1KQ8 A;  4HF1 A;  3DTI A;  5ILV A;  1GT0 C;  3D5R C;  1HOM A;  1Z3Y A;  2FRH A;  3RPU A;  1H9T A;  4RDU A;  3RYR A;  3KX2 A;  3K70 C;  1GHC A;  1G8X A;  1XB4 A;  1VQO I;  5BPD A;  2KRC A;  3QP5 A;  1W36 D;  3HTU A;  4I09 A;  1Z7U A;  4HLY A;  5DDG A;  3RZD J;  3W6J B;  2ETH A;  1BC8 C;  2QLZ A;  4PJN A;  3KEY A;  3CCY A;  2F4I A;  4NB5 A;  4D5C A;  3EUK L;  3R0A A;  2V1X A;  3OS0 A;  2B7E A;  2L9V A;  4XIC A;  4F7Z A;  1ZTR A;  1DUX C;  4U0Y A;  3VYT B;  4U0W A;  4IJA A;  3M07 A;  1YE9 A;  3O3K A;  4MEX F;  3W2V A;  4DGW B;  5CVI A;  1U2W A;  5LGT A;  1FTT A;  1GV5 A;  2EV0 A;  3LQR A;  3DP7 A;  1MNM C;  4CCN A;  3GTG J;  5H6Q A;  2CYY A;  4ZZL A;  1UCR A;  5DTD A;  5F1R A;  3E6D A;  2K9Q A;  5LHG A;  1LKX A;  2A3S A;  1F43 A;  3O6B B;  2OF7 A;  3OYM A;  1P4W A;  5D4S A;  1A6Q A;  3S1M J;  4M6Y A;  5D5V B;  1ON2 A;  2DXI A;  2ESN A;  2W48 A;  3I71 A;  3EQL F;  5BNG A;  1OYW A;  4CCJ A;  2KJB A;  4KMU X;  2LTP A;  2FOK A;  4OMY A;  3K4K A;  2FQ4 A;  4QIW N;  1I5Z A;  5JFR A;  3JRD A;  5IPA A;  3J80 K;  4UUV A;  5GAD J;  3BWG A;  4L18 B;  2FQ3 A;  4MTE A;  5H20 A;  1LQ1 A;  4I0B A;  3CP8 A;  1KU9 A;  2EZH A;  2ZNY A;  2LG4 A;  2ISZ A;  3PUB A;  2EK5 A;  1T0F A;  1HDD C;  2DA4 A;  2F4O B;  5IP9 J;  3VPR A;  2FNA A;  4XLH A;  1G59 A;  2HR3 A;  1JHH A;  2DPU A;  1KU7 A;  4BDY A;  4A3K J;  4KMF A;  3I0T A;  1RI7 A;  2DW4 A;  3ZCO A;  4M72 A;  3JW4 A;  3F8B A;  3P9C A;  3ZQF A;  3ZN1 A;  1SAN A;  3CES A;  4Q47 A;  4HX8 A;  5FRN A;  2FD5 A;  5IP6 A;  1B9M A;  5C3E J;  4HST A;  5KK1 A;  1YJ9 I;  3DWL E;  3H0G J;  1QQI A;  1MNE A;  1Z77 A;  4IQJ A;  3GLL A;  5EJC A;  2VN2 A;  1BIB A;  3SXY A;  1X3U A;  3K4L A;  1WJA A;  3RIR A;  3BP8 A;  3IRR A;  1B72 B;  5HDG A;  4F92 B;  2IP2 A;  2EFN A;  3DPU A;  3K9T A;  2JT1 A;  3CP2 A;  3MZY A;  1E3P A;  2CV0 A;  3GBG A;  4G6Q A;  2HYG D;  2PI0 A;  3V7C A;  3BG5 A;  1GUU A;  4ZYD A;  1R4M B;  2KIS A;  3L2R A;  4M9X A;  2JPB A;  1TC3 C;  2P81 A;  3FIS A;  5FB2 A;  3FMQ A;  1RZ4 A;  3ZN0 A;  2GXG A;  3LFU A;  3R0J A;  3MMY B;  5BPI A;  3LAP A;  1IUF A;  1FPQ A;  2EZL A;  2OC6 A;  1GDT A;  4PJJ A;  3LSH A;  1SMT A;  4XR6 A;  2E2H J;  5LGN A;  2HU9 A;  1FX7 A;  2M30 A;  3JRI A;  1NK2 P;  1U5T A;  1QNT A;  2BYV E;  3TGN A;  2VKH A;  2E7W A;  1B59 A;  5L3D A;  2CV2 A;  2ZFU A;  1R7J A;  2WB1 A;  3GFJ A;  2DMP A;  1E3O C;  2R93 J;  2OCE A;  2DK5 A;  3I59 B;  5F0C A;  3PNY A;  4M9Z A;  4EEF G;  4AUX A;  4LD5 A;  1FTZ A;  3VOE A;  4ZDP A;  1HW1 A;  3RPU D;  3S17 J;  2G7H A;  2M7B A;  3L2C A;  3HKZ N;  1IRG A;  4H0E A;  1O3Q A;  3AL0 C;  2H6B A;  1YW8 A;  4M73 A;  4BH9 A;  5FKL A;  4HLX A;  5CVU A;  3DBL B;  1KGS A;  2CUF A;  2CUZ A;  3FMR A;  2BOL A;  1J5Y A;  3CJT B;  3R6S A;  1DQU A;  2JWT A;  1IG7 A;  2VT3 A;  2ZC2 A;  2OZ6 A;  1DGR M;  3A4C A;  1R23 A;  2DQL A;  3AG3 H;  2DBB A;  4LIU A;  4XL9 A;  3QAH A;  2R7W A;  3UKG A;  3B6A A;  4A12 A;  3CCJ I;  3GTO J;  2H6C A;  5EZH A;  3F3X A;  2R5Z A;  4MEY F;  2HQR A;  1SFU A;  3L2Q A;  1WZ2 A;  2V9K A;  3NAU A;  1HKT A;  3CF5 F;  4NBQ A;  3JRH A;  2NVY J;  3TL4 X;  4I2O A;  2HOS A;  3H9Q A;  4B09 A;  4MGR A;  4XKC A;  3I9V 2;  4WXC A;  4BJ6 C;  3WHB A;  3PQK A;  2EWN A;  3L7W A;  1W4M A;  5GTI C;  4Q48 A;  2XKO A;  2P8T A;  2G9W A;  4BJ5 C;  4P55 A;  2KDO A;  3OS1 A;  5GTH C;  4Z6Y A;  2WTE A;  3IAS 2;  1UST A;  4CCK A;  4PUS A;  3J80 Z;  1P9Q C;  1MSE C;  1UHM A;  3K1P A;  2M45 A;  3OY9 A;  5FLM J;  2LY1 A;  3MWM A;  4JX5 A;  5KNL A;  4ENM A;  3HZJ A;  5DUI A;  5JR3 A;  1BR2 A;  4BAC A;  3F9K A;  2Y31 A;  4V2F A;  2IS4 A;  2BGC A;  3BR2 A;  3K4C A;  2CG4 A;  3LSG A;  4BQQ A;  1JT6 A;  2Q2E B;  4XSX F;  2Z99 A;  4E70 A;  4IHW A;  2VXZ A;  1B72 A;  1MJA A;  1HA8 A;  4DNC A;  4LLL A;  3GUD A;  2L0K A;  1S7O A;  2CUJ A;  4C2U A;  2NRA C;  2OTJ I;  1HC8 A;  4AM3 A;  1X3W B;  2X85 A;  4II2 A;  3HOV J;  2VBW A;  3TKY A;  1TWC J;  1LFB A;  2P5L C;  3RTR A;  3ZMS A;  3NAR A;  1I27 A;  1OCR H;  3OYC A;  4ITV A;  1BN5 A;  2WY7 Q;  3G6E I;  3U1D A;  5LHH A;  2E5N A;  2EZI A;  2QBY B;  4FE4 A;  3M1C A;  4E7J A;  4A6E A;  1ZK8 A;  1MJB A;  1SFO J;  4JX6 A;  3Q5F A;  1OCZ H;  1UAA A;  1WWX A;  4RLQ A;  4ENN A;  1EF4 A;  3JR9 A;  1V5G A;  4BY7 J;  5TJJ A;  3IP4 B;  2DTZ A;  4UVC A;  5K5O A;  4P96 A;  1BJA A;  1SFK A;  4XRF A;  4IL6 C;  2CQX A;  3HHG A;  3FKJ A;  2LVS A;  2RN7 A;  2ZSH B;  3BZC A;  4RMN A;  5M5W J;  2MC3 A;  4FQG A;  3DQV C;  2DI3 A;  3FX3 A;  2R7O A;  3E5U A;  4XK4 A;  3KZY A;  3G2B A;  4KA4 A;  2RAE A;  5GAH J;  1WJB A;  4BHC A;  5J1R A;  3FHZ A;  3FXR A;  2MBF A;  5CYV A;  4CIC A;  1XGO A;  2XAH A;  2ISY A;  2CSO A;  3OSG A;  1HLV A;  3TP0 A;  4BQA A;  1LNW A;  1S5L C;  3E5X A;  3FIW A;  3KEQ A;  4DJA A;  4M71 A;  5M3M J;  2VXD A;  3AG1 H;  1VQK I;  4EM2 A;  1S7A A;  2VJJ A;  4B44 A;  3BTL A;  5IT9 K;  2FF4 A;  2P5V A;  3LWF A;  4MFD A;  4K2E A;  2XIG A;  2E36 A;  1FLI A;  1X1C A;  3ZQH A;  1JE8 A;  4DBQ A;  3WTY C;  3IKV A;  2DMU A;  1V5F A;  2BV6 A;  3LSP A;  2KP6 A;  3LSJ A;  4FCY A;  3ZRG A;  4EAT A;  1P7J A;  4BJT A;  2GQQ A;  2LKX A;  3EDP A;  2EA2 A;  5DD8 A;  3C1D A;  2UV1 A;  2JRM A;  2WAE A;  1ZAO A;  2LLK A;  4MHG A;  4CSW A;  3DBH B;  2OJE D;  2NXN B;  1P6R A;  1WPK A;  5HLT A;  2JJ7 A;  4KUM A;  4EJT A;  3E1S A;  4NC8 A;  1VQ4 I;  2M8G X;  3V8K A;  3LNQ A;  4PFP A;  4ABZ A;  4BU2 A;  3WU2 C;  5L3B A;  2R7V A;  3MEX A;  2NS0 A;  1TQP A;  4FIS A;  3HOS A;  2QA4 I;  4XKV A;  1FMV A;  1X1P A;  1UB9 A;  3UNG C;  1G3W A;  3AL0 B;  4ESF A;  4Y33 A;  1Y0N A;  2IXS A;  3DPT A;  1XX5 A;  1EH8 A;  2OUM A;  3IH4 A;  4RM2 A;  5AON A;  1U8R A;  5EG0 B;  2ZFW A;  4BQN A;  2HXI A;  2QEN A;  3WGI A;  4RM3 A;  2LY9 A;  3H9G A;  4IQ4 A;  2K40 A;  3F23 A;  3HYI A;  1VQ7 I;  3JSP A;  2E60 A;  4II3 A;  1CF7 B;  4U7D A;  2JQ7 A;  5HNF A;  3NWT A;  1JGG A;  1TT0 A;  1W1W E;  2VT2 A;  4J00 A;  1VQ6 I;  1AOY A;  1KON A;  1S9H A;  1RUO A;  5LEK A;  5CLS A;  1WHU A;  3T5X A;  2P6T A;  3FXQ A;  4G6T B;  2DJI A;  2HDD A;  3H3V K;  1PUE E;  3GVA A;  3PJR A;  2OCC H;  2HI3 A;  2P6S A;  5K7F A;  1F1Z A;  4M3G A;  2QBY A;  3FKI J;  4YEJ A;  4S0H B;  4HNU A;  2VE8 A;  1MH4 A;  1OYY A;  3WTU C;  3M8F A;  2HTJ A;  2J5P A;  5CJ9 A;  2LSO A;  1BIA A;  2FBK A;  3ASN H;  1KYW A;  3D5S C;  4D7N A;  4E7I A;  3SZG A;  3CMM A;  3GCM A;  1RR7 A;  2KRF A;  3W2W A;  1SD5 A;  4Y17 A;  3U1K A;  2H27 A;  1ZRD A;  1P7I A;  2H09 A;  3ABU A;  1MSF C;  2OZU A;  4S05 A;  3A0B C;  2GM4 A;  1RUN A;  1YYV A;  3FK7 A;  5E20 A;  2A05 A;  4M6V A;  4ENK A;  3FZV A;  4LIV A;  2ZXI A;  1PUF B;  2IT0 A;  3DPL C;  4YFK F;  2HDW A;  3D0S A;  1VQM I;  2L7M P;  3ASO H;  1RIO H;  3K6G A;  5CVV A;  5L3E A;  2B63 J;  2XRN A;  5ERI A;  2BHZ A;  3S1Q J;  5J8C A;  2DFI A;  3GX4 X;  1KQ9 A;  2KPM A;  2LH9 A;  2HQ5 A;  4IPA A;  4JBA A;  3TW6 A;  3QOD A;  1WJF A;  2MD5 A;  3F6V A;  2X6X A;  1SD7 A;  2I10 A;  1JKR C;  2A5W A;  2CJJ A;  2V9V A;  1IN5 A;  4M3F A;  3LSI A;  1HKS A;  2EH3 A;  2E2J J;  2WB1 N;  2DFF A;  1Y56 A;  4C2M J;  3TQN A;  2VQH A;  2LBF B;  4BHP A;  3BJ6 A;  4L0Y B;  3FDY A;  4XM3 A;  3WU1 B;  4ASN A;  1X58 A;  5J47 A;  2M1B A;  4L0Z B;  4ZYA A;  1V55 H;  3LMM A;  4LK1 F;  3UR3 C;  3CCS I;  1W5S A;  4EM0 B;  4G7O F;  4WXH A;  2E2I J;  4IF4 A;  1A5J A;  3N4M A;  2BEO A;  4TV7 A;  3HUG A;  4ZTF A;  2VL8 A;  5DM6 F;  4QSH A;  1UHS A;  3PNV A;  5IT9 Z;  2HS5 A;  3K0L A;  2GA1 A;  4HAM A;  1WI9 A;  1MBK A;  3G1M A;  2GBY A;  1BOB A;  3CJN A;  4A0Z A;  4DW6 A;  4WXD A;  1Y8R B;  4IOC F;  3LL7 A;  3JRC A;  4XSZ F;  4KT6 A;  4IHS A;  2DA3 A;  3IRQ A;  1QRY A;  1LE8 B;  1IRF A;  1D0Y A;  2DN0 A;  4I0A A;  3EET A;  5IT3 A;  2ZBK A;  3AG2 H;  2L5Q A;  1IDY A;  3F6O A;  5FKN A;  1J09 A;  4MTD A;  3EYI A;  5E1Z B;  1Z6T A;  3QQA A;  3RKQ A;  4MQV A;  3SFI A;  3BR0 A;  5K7Z A;  3SZT A;  1SAX A;  3W6V A;  2UXX A;  2V79 A;  2VJI A;  2WWY A;  2R5Y B;  4R1H A;  4LK0 F;  2CW0 F;  3ZQI A;  3RDI A;  2L9R A;  3LST A;  4BYY A;  3S93 A;  2FJ1 A;  5FJ8 J;  2WC2 A;  3MKL A;  4BEH A;  5JLW A;  5FLV A;  1HCR A;  1RKT A;  4XLA A;  3E5Q A;  5D6F A;  2M87 A;  1ETY A;  1ZRF A;  5GPC A;  3E6M A;  3RQI A;  5HOD A;  4P5O A;  4F52 A;  1PDN C;  2X51 A;  2K86 A;  4FT8 A;  3LSR A;  2R3S A;  1E0E A;  2LFB A;  3KP4 A;  4XRS A;  1KU3 A;  1EH7 A;  1N78 A;  2DDB A;  3BG6 A;  2M0C A;  1SVL A;  2F5C A;  4AWX B;  1APL C;  1R4N B;  1UG0 A;  3ZXS A;  3HEF A;  1FJL A;  3TDU C;  1DPU A;  4I76 A;  1ETK A;  3EUH A;  2K4J A;  2L3D A;  3CUQ C;  4DYC A;  2JZY A;  3HGG A;  5F0F A;  4A3L J;  1HSJ A;  4NQW A;  4DBR A;  4M74 A;  3Q0V A;  1FBU A;  2JPC A;  2VIX A;  2JMW A;  1RPW A;  3CDI A;  1OLT A;  3C2B A;  2Q0O A;  3K69 A;  4BL0 B;  1OYI A;  2BY3 A;  2DT7 B;  4XOP A;  4UVA A;  5FKK A;  1VTN C;  1JXS A;  1U9O A;  1R36 A;  4G12 A;  5EF6 A;  5BMZ A;  2QM3 A;  2AQE A;  3LSM A;  1YFH A;  3BC8 A;  2AXL A;  5KHD A;  4R79 A;  4J01 A;  1U6G A;  4HQE A;  1XG1 A;  2R7D A;  1T56 A;  2LBF A;  2WA0 A;  2AHQ A;  1WKM A;  3HIF A;  3NEU A;  2VAS A;  3KP7 A;  2HYJ A;  4UXN A;  2ME6 A;  3V8J A;  4CZZ A;  2LKS A;  5FRM A;  3ONQ A;  2XF6 A;  1YS6 A;  2Z3Y A;  1JKP C;  1J9I A;  9ANT A;  3IWZ A;  1UFM A;  1NH3 A;  5FKO A;  2XRO A;  2JA6 J;  4BDZ A;  3S3N A;  5L3G A;  2GXA A;  2KZV A;  2DQR A;  3OYF A;  3OYJ A;  1YG2 A;  2DA5 A;  2Y2Z A;  3GO5 A;  5FD6 A;  3W2A A;  3M9A A;  3CLO A;  4L5E A;  3JSO A;  4EMS A;  2L01 A;  1BOA A;  2PMU A;  1Z05 A;  3ZMV A;  4RGS A;  2XF5 A;  1T8I A;  4HNT A;  5DS9 A;  2YU3 A;  3OL4 A;  1LE8 A;  1TZL A;  5B5E C;  2O6G E;  2XGX A;  2ZME A;  1QZE A;  3BR3 A;  1OR7 C;  2KFD A;  5DM7 F;  3BY6 A;  1JUP A;  4NHJ A;  2M34 A;  3R4K A;  3ABM H;  3FWE A;  3OOU A;  4B1R A;  4IRH A;  1BR4 A;  2FXA A;  1G3Y A;  3WHC A;  2EJR A;  4O3M A;  4HW0 A;  2R5Y A;  1B1B A;  2RGV A;  4OAY A;  3S3M A;  3FBN B;  1H88 C;  1OCP A;  3KIO A;  3RCO A;  3GEZ A;  3MZH A;  1ODD A;  2V4J C;  1VFC A;  2PMZ A;  4RAF A;  4UHT A;  2YR2 A;  1FY7 A;  4HX4 A;  2KJC A;  4PDK A;  4XQF A;  3NWS A;  1OCT C;  1XS9 A;  1REP C;  1JKO C;  1K78 B;  2KIM A;  4RLF A;  4XBF A;  3HG9 A;  3I4P A;  1ULY A;  3BR5 A;  5KCM A;  4RB2 C;  3OIP A;  2BY1 A;  1YIO A;  2V6C A;  1MGT A;  2JSP A;  1ZR4 A;  1XSX A;  4DZJ A;  4XRM A;  4P9F A;  2X6Y A;  1VQ8 I;  3TDZ C;  2HFH A;  2PJR B;  3CLQ A;  4IHX A;  4YII A;  3OYD A;  4QLC U;  3RKX A;  2KLO A;  4A93 J;  5HLG A;  2PX9 A;  4A3G J;  2M2E A;  1R71 A;  1Y0U A;  4LGW A;  2P4W A;  4ZDL A;  5J1Y A;  2EIL H;  5ICF A;  3F72 A;  5E8G A;  1RNL A;  1SFX A;  1LJ9 A;  3V8L A;  4ESB A;  1ZG5 A;  1WH7 A;  4BE1 A;  1WFX A;  5CVJ A;  2IS2 A;  1IO2 A;  4A6D A;  2QZ8 A;  1ETQ A;  3FXM A;  2C6Y A;  2R7F A;  2DO7 A;  3E6B A;  2HPM A;  2NVQ J;  2WV0 A;  4KIC A;  3IUO A;  3IH2 A;  1ETO A;  1R1T A;  5J4Y A;  2EQR A;  2LD5 A;  4A3J J;  4BY1 J;  1NK3 P;  2CQQ A;  4OIN F;  3GTQ J;  4MQ9 F;  1T98 A;  2FX0 A;  1K83 J;  3CMY A;  3T1B A;  2PFB A;  2FE3 A;  2Y48 A;  2BY0 A;  1AKH B;  1Q1H A;  2CFX A;  3G71 I;  2L02 A;  5IYB J;  5HOO A;  5M3F J;  5D8K B;  1B8I A;  5TGT A;  2A6H F;  4V2G A;  2KIQ A;  1EKE A;  3IKT A;  1W7P B;  3BQZ A;  2BHY A;  3WGH A;  2BBY A;  3BG9 A;  5H6R A;  3F8F A;  2V1U A;  4KDP A;  4Y4R A;  3TOB A;  2VJ5 A;  2E35 A;  2JA8 J;  2Y69 H;  2XPW A;  4U88 A;  3A01 B;  1ZEL A;  2MD0 A;  4AIJ A;  5FGM A;  3HDD A;  2A68 F;  3CUQ B;  2BZT A;  3KET A;  3K1N A;  4UNO A;  4UUS B;  2DMT A;  2Z2S B;  1XSD A;  4BXU A;  1R5H A;  2HWV A;  2DYR H;  2X48 A;  1ONV A;  1PP8 F;  4FTH A;  4BS9 A;  5IYC J;  2WY8 Q;  4WWC A;  1E17 A;  1AU7 A;  3GTJ J;  2A6T A;  3BG3 A;  1TQI A;  3R61 A;  1K61 A;  1FMW A;  3ERM A;  1W36 C;  4GYI A;  4RB3 C;  3H1C A;  4BKX A;  3U21 A;  4C3J J;  2A61 A;  1K79 A;  1QPM A;  5J6X A;  1SFE A;  4GGG A;  1WGX A;  1FIA A;  3KEO A;  1RET A;  2D45 A;  3GFL A;  3RYP A;  4IHY A;  1D8K A;  2VPR A;  1BA5 A;  1S72 I;  4A0Y A;  3IHU A;  5HS7 A;  1PP7 U;  3GME A;  1C0W A;  1W0U A;  3JTG A;  3ZMT A;  3P7N A;  5EYR A;  3QU3 A;  2OTL I;  3M4O J;  3MQ0 A;  1IN7 A;  3CCU I;  1J59 A;  2VPL A;  2GOM A;  3TED A;  3VDX A;  2XAJ A;  2X9D A;  2RQP A;  3AKZ A;  3K2Z A;  2D1H A;  2M4G A;  1X1B A;  1LVK A;  5GAG J;  1MD0 A;  1WJC A;  2X1D A;  3H5A A;  2LY2 A;  2RVC A;  5BOX A;  4HG2 A;  1BBY A;  5EEH A;  4MNU A;  3FF5 A;  1XDU A;  4MFE A;  1JI8 A;  2DA2 A;  3FBI B;  3HHH A;  3PO3 J;  4L5J A;  3L1P A;  4QWQ A;  3DKX A;  1D1C A;  3ABK H;  4HSR A;  3GYH X;  1U3E M;  3FHN A;  3CC7 I;  4RAY A;  3LA3 A;  1T95 A;  1FZP B;  5HDK A;  2QSF X;  3WTZ A;  4XMY A;  5DCM B;  5J8F A;  2R7Q A;  3T8T A;  2STT A;  1H8A C;  2HEO A;  3DBR B;  1QU3 A;  2WAD A;  4GYG A;  4E7S A;  3S8P A;  4IVN A;  2XPU A;  3WE2 A;  3H3Z A;  4A3B J;  3DFG A;  3GXO A;  4B47 A;  1H0M A;  4OIO F;  2DA7 A;  1YRN B;  3CTA A;  5D5W B;  4OIR F;  3OIO A;  3ELK A;  4CDG A;  4QTR A;  2LDU A;  5B1A H;  3WG7 H;  4Q4Z F;  3GF2 A;  1ZRC A;  4G94 A;  1HST A;  2OQG A;  1AKH A;  2IGN A;  2IS6 A;  2VON A;  1F5T A;  2XB5 A;  2CS3 A;  1BI3 A;  5J3L A;  4RGU A;  2HZD A;  4EGZ A;  5IOZ A;  2F5F A;  2EV6 A;  3VB2 A;  1X4P A;  1FT9 A;  1DU0 A;  1MW7 A;  3TOA A;  1P2F A;  1R5G A;  1X3Z B;  2YSR A;  4PJM A;  2BVM A;  2DOD A;  2XGE A;  1IXR C;  3SEQ A;  1Q1V A;  2CWE A;  4WF2 A;  2R7T A;  2OQR A;  1MMG A;  2CGP A;  2F6C A;  5IOY A;  2AO9 A;  3WTW C;  1EV7 A;  2N8G A;  4ENJ A;  2DT6 A;  2XB0 X;  2ZCW A;  3OR2 C;  4UV9 A;  2R7Z J;  4UUS A;  2W24 A;  1RRJ A;  1FOY A;  1YX3 A;  3BJO A;  3L09 A;  4ETS A;  4CYC B;  3OV8 A;  4PCQ A;  2WAQ A;  3BPX A;  3L2V A;  2DOA A;  4PFO A;  3SQN A;  3OYB A;  2ZJR F;  4G6D A;  1TLH B;  4KYW A;  1FYL A;  3G1O A;  5CPR B;  3ZR8 X;  3ECO A;  1XC5 A;  3C2H A;  2OBP A;  2W25 A;  2JVH A;  4CUG A;  4U87 A;  5DV5 A;  4ESJ A;  3VOD A;  2DJN A;  3CF2 A;  4IZZ A;  4A69 C;  4NNJ A;  1HDP A;  5EGO B;  2OD5 A;  2DA6 A;  4EQQ A;  1ZGJ A;  3IH3 A;  1DDN A;  1D1B A;  1ETX A;  3F22 A;  5TRD A;  3I59 A;  4N9H A;  4GCV A;  5K1Y A;  5E8I A;  3I53 A;  1MH3 A;  1VQ5 I;  1SD4 A;  1XMA A;  3E97 A;  5M5Y J;  1X4O A;  1FYK A;  3PSI A;  1KYZ A;  2NS7 A;  3TO9 A;  1T39 A;  1ACI A;  2GOX B;  3Q9S A;  5LRR A;  3QOP A;  4LLG F;  2K9S A;  4X0G A;  4DQ2 A;  3ESW B;  3K4B A;  4WX9 A;  1J7K A;  2EBI A;  2MG4 A;  1ZH5 A;  1MBE A;  2F5D A;  4UB8 C;  3BJA A;  3WGG A;  2JUC A;  4LIT A;  3K2A A;  4AVZ A;  3ZOB A;  4D0P A;  5FD5 A;  2Y0S A;  2A5Y B;  3ZP5 A;  1H9G A;  1U9N A;  1OCO H;  5LLQ A;  5B1B H;  2QVO A;  2E71 A;  2PMZ N;  3HSR A;  4OAZ A;  1BW6 A;  3I54 A;  3I64 A;  3JRA A;  1I6X A;  2X0L A;  4J19 A;  1JTY A;  5E3L A;  5M5X J;  4G7H F;  2E1C A;  1POG A;  1ON1 A;  3QYF A;  2HQN A;  3CCM I;  3DEW A;  1O3R A;  3JRE A;  1K4T A;  2DOE A;  1MMS A;  3DU6 A;  4CXF A;  1IRZ A;  4BNC A;  1HBX G;  2EV5 A;  4Y15 A;  2VC0 A;  1V4R A;  1G6N A;  3K4N A;  3MFK A;  2JUG A;  1TL8 A;  1I50 J;  3OYK A;  2M7A A;  4XLF A;  4CGZ A;  5BS6 A;  1KU2 A;  3L9F A;  4CYD A;  2O9L A;  4LG0 B;  2K7L A;  1SEU A;  4MO7 A;  2ELH A;  3HSF A;  1IZ1 A;  4E4H A;  2PQ8 A;  4ZJZ A;  1R5I D;  5CKT A;  3PSF A;  3LA7 A;  2Q2E A;  1WRJ A;  1QZY A;  4FX0 A;  2DLL A;  2CFO A;  2MH2 A;  2OPT A;  3ROU A;  2RNJ A;  2W00 A;  3VSK A;  3S2D J;  3S14 J;  3IAM 2;  1T6S A;  4AIH A;  2EIK H;  5LGU A;  2J5O A;  4C9Y A;  3QPH A;  2Y9Y A;  1T0F C;  4A3E J;  1JHF A;  2ZJP F;  3PIO F;  1N77 A;  2E1N A;  1FEX A;  1A04 A;  2ELK A;  3Q9V A;  3I55 I;  5ILU A;  2HNH A;  3DEE A;  2GWR A;  2ACJ A;  4O6J A;  1W5C C;  2DAO A;  2Q1Z B;  2W7N A;  3PIP F;  3E0J B;  2Y9Z A;  1XN7 A;  4PGG A;  2FU4 A;  2NNN A;  1FWZ A;  2WBM A;  5D8L B;  2VOO A;  3ML6 A;  4HV5 A;  2DT5 A;  4BBS J;  1MMN A;  3O8G A;  4JOM A;  3OYE A;  1IJW C;  2VBX A;  4Z2Y A;  3P9K A;  3TMO A;  1O3S A;  3HC7 A;  3N05 A;  2MFZ A;  5EGO A;  2MLK A;  2KMU A;  1NG6 A;  4H4K C;  1DGW Y;  2BW3 B;  4NC6 A;  1S8N A;  1B4A A;  2KT0 A;  3QYB A;  3MVP A;  4NUB A;  2K9M A;  2ICW G;  1IDZ A;  3BQY A;  3MKW B;  2O61 A;  1TP4 A;  2MW8 A;  3ZQQ A;  2EIM H;  4GDF A;  3QYE A;  3HOZ J;  4YFX F;  1N25 A;  4A3F J;  2FMY A;  1HW2 A;  3S1N J;  2VOD A;  4UUT A;  5JLX A;  1JT0 A;  3HGY A;  2M3A A;  4D7M A;  5D5X B;  4C3H J;  2W82 A;  2HZT A;  3DKY A;  1V5E A;  4IHV A;  1QPI A;  1A6I A;  3AFH A;  3JRG A;  4BXX J;  3HPH A;  2H1K A;  1W0T A;  3LA2 A;  2VOP A;  2HOT A;  1BR1 A;  1IV6 A;  2QSH X;  5B3S H;  4IRG A;  4XLC A;  2R92 J;  4PSX A;  5TIS C;  2NAZ A;  2QEX I;  2M0M A;  4LOC A;  2L2O A;  5E3O A;  1DP7 P;  1VQP I;  2K4B A;  5C44 J;  1U5T C;  3VSL A;  5F0H A;  3KLN A;  4KIB A;  1IC8 A;  4UV8 A;  2CQK A;  1GVJ A;  3DTE A;  3KZZ A;  2R7R A;  2M4K A;  1R9T J;  1F36 A;  2DFH A;  2M5W A;  3FXO A;  2VKD A;  1UHW A;  2HPI A;  3MCZ A;  4B8X A;  1YJW I;  4KIS A;  5ILS A;  2IA2 A;  3LOC A;  3RZO J;  3GZ5 A;  3OS2 A;  5JHU A;  1YO5 C;  4LG0 A;  2STW A;  2COM A;  3K70 D;  2DDA A;  3TP3 A;  2AXT C;  3EYY A;  2L9S A;  2TCT A;  3DV8 A;  3GTM J;  5EG0 A;  2JTV A;  3MAJ A;  3GFI A;  3CCR I;  2CV1 A;  2KHM A;  3OIQ A;  4X6A J;  2IGK A;  4L9T A;  1Z3X A;  2G0E A;  4KNY A;  1MDM B;  1HKQ A;  3IL2 A;  1S6L A;  5K5Q A;  4DIQ A;  2AQF A;  3DCF A;  1ZN2 A;  2QCO A;  5FFZ A;  2X1C A;  3KLO A;  1CF7 A;  3CDH A;  3CME I;  4O5V A;  3S2W A;  1FYM A;  4IEJ A;  4RS8 A;  3H36 A;  1VND A;  4EVI A;  3BPV A;  1T08 B;  1MZB A;  2XAS A;  3M8J A;  3KP5 A;  2A07 F;  2Y30 A;  1T2K A;  1IGN A;  1X19 A;  1FOK A;  2UUZ A;  4B48 A;  2DCE A;  2ID3 A;  2P7V B;  2QQ8 A;  5HVQ C;  3IC7 A;  2X6W A;  2YS9 A;  3M3Y J;  1LUJ B;  3J7Y J;  5B66 C;  2LF7 A;  2KZG A;  2EFP A;  5CQG A;  3S16 J;  1XCV A;  1Z0X A;  2X1E A;  3Q0W A;  2JN6 A;  4A5N A;  3M1E A;  5L3C A;  2H94 A;  1PUF A;  1JJ8 C;  3MKZ A;  4W1U A;  1LFP A;  2XAU A;  3EPZ A;  2R7S A;  5FLX K;  3G1L A;  2WAQ N;  4NC7 A;  1WCM J;  1XTA A;  2L4A A;  2L7Z A;  2BXZ A;  2FUG 2;  2QWW A;  2QKL B;  2V7F A;  3DEU A;  2FA5 A;  3LQQ A;  2YUS A;  4L9N A;  4XKW A;  2XDV A;  4A3M J;  3VYR B;  1MBH A;  2FML A;  1ITY A;  2IBD A;  4YFN F;  2XVC A;  1UG2 A;  1G2H A;  4KFC A;  1ZHF A;  2B9S A;  3BTI A;  2XUB A;  1LEA A;  2OU2 A;  3HRU A;  1FP1 D;  1MMD A;  2OV7 A;  2XGD A;  3C7J A;  4JQF A;  1VZ0 A;  3CMA I;  3ERE D;  2A69 F;  2HXO A;  3Q0U A;  3GFM A;  5HLI A;  4M3D A;  2BY2 A;  3B02 A;  5GPA A;  3S15 J;  3VWB A;  1RR8 C;  3PQJ A;  4JX4 A;  3HM5 A;  2XRL A;  3WTV C;  4LG3 A;  2L7F P;  2VLA A;  4AC0 A;  3WG9 A;  3DF8 A;  1ZKG A;  4GO1 A;  5IY5 H;  4N4N B;  3IWF A;  3OOP A;  3G73 A;  1A36 A;  2NVT J;  2PJP A;  3C18 A;  3KFW X;  2O03 A;  2IEK A;  1AHD P;  1TWF J;  2IPQ X;  3DXJ F;  1B6A A;  5FRO A;  3PO2 J;  2Y0S N;  3SEZ A;  2LKP A;  3DTK A;  3S32 A;  3OYG A;  3HOW J;  2VC1 A;  1VQN I;  3M7G A;  3V7R A;  3WTX C;  1QA6 A;  4M3B A;  3EUA A;  1UJ8 A;  3I4M J;  2HVR A;  1FOW A;  2CQ7 A;  2ZNZ A;  4CA0 A;  1G3S A;  2JRT A;  1GVD A;  1FSH A;  4L9J A;  1P4X A;  1ZYR F;  2O3F A;  3CDL A;  5KVR A;  2XC7 A;  4YG2 F;  1R22 A;  1USS A;  4QPO A;  1FSE A;  4ZYH A;  4U7B A;  1L0O C;  1E3H A;  4PK4 A;  2KKO A;  1LVA A;  1MDM A;  3ABT A;  4GXO A;  2XAQ A;  5HS8 A;  2IVM A;  6PAX A;  3BCA A;  2P5K A;  1RKW A;  3BT9 A;  2NNY A;  4A3C J;  5HDN A;  3QPS A;  4HF2 A;  3C3W A;  2IRF G;  5K7H A;  2EFW A;  3B73 A;  3A02 A;  1PJR A;  3A1Y A;  4AVP A;  1IN4 A;  3PM1 A;  3DU5 A;  3W3C A;  4AU7 A;  1OKR A;  1YJN I;  2G7U A;  2VJ4 A;  2ZB9 A;  2HGC A;  1TNT A;  5F64 A;  1U5T B;  2XAF A;  1VI0 A;  2FEZ A;  4XLE A;  4L9V A;  2ZJQ F;  1AA7 A;  3CUO A;  1SVM A;  2Z16 A;  1TWA J;  1Y6I A;  3SFZ A;  4DOZ A;  1MBF A;  3GW2 A;  4F3Q A;  3TO7 A;  4F91 B;  2GIZ A;  1A31 A;  3K10 A;  3JTH A;  3H92 A;  4KJZ A;  2QGU A;  3HRS A;  2CRG A;  1S3J A;  3OYI A;  2CH0 A;  1JUM A;  1YIT I;  3HB9 A;  2O0Y A;  1Z1D A;  4PJ0 C;  4ON0 A;  2K85 A;  4LLN A;  2E1O A;  3HBL A;  5F08 A;  2L9N A;  1JKQ C;  2COB A;  3V42 A;  1WJE A;  4EM1 A;  1K6O A;  2AS5 F;  4FX4 A;  3S2H J;  2NOJ B;  3V7S A;  4BBR J;  3MD2 A;  2QKM B;  3R60 A;  3CCV I;  1T33 A;  2VQL A;  3AAF A;  2R0Q C;  1AWC A;  5J1U A; 
#chains in the Genus database with same CATH homology
 1H89 C;  1JGG A;  1AKH A;  2R5Z B;  2CU7 A;  2XB5 A;  5J3L A;  2O8K A;  5IOZ A;  2HDD A;  3H3V K;  1CQT A;  4M3E A;  3TW7 A;  1DU0 A;  5F27 A;  2HI3 A;  2XGC A;  5K7F A;  4M3G A;  2XGE A;  3FKI J;  3ZQG A;  4S0H B;  2XSD C;  1JJ6 C;  1Q1V A;  1MH4 A;  4D5F A;  3OSF A;  3SJM A;  5IOY A;  3IV5 A;  4D7N A;  2AO9 A;  2N8G A;  4MIM A;  2XB0 X;  2H8R A;  1RR7 A;  2R7Z J;  4UUS A;  5F04 A;  1P7I A;  1MSF C;  2M9H A;  4CYC B;  2TRT A;  2GM4 A;  3FK7 A;  4M6V A;  1Y1W J;  4DYR A;  1U78 A;  1PUF B;  2O7O A;  3G1O A;  1QVT A;  1XC5 A;  2L7M P;  4GFB A;  2B63 J;  3S1Q J;  2DJN A;  4A69 C;  1HDP A;  5EGO B;  2HQ5 A;  2DA6 A;  2ECB A;  4DZP A;  1WH5 A;  3IH3 A;  2JA7 J;  3TW6 A;  5EZG A;  1ETX A;  2LK2 A;  2LP0 A;  3QPL A;  1MH3 A;  2I10 A;  1JKR C;  2CJJ A;  1B8I B;  5M5Y J;  4M3F A;  2E2J J;  2EH3 A;  2WB1 N;  4HNV A;  2NS7 A;  3MN2 A;  4C2M J;  3BR1 A;  2K9S A;  3Q3S A;  4DYQ A;  4XRS G;  2EBI A;  1GT0 C;  1X58 A;  2MG4 A;  1HOM A;  1MBE A;  4RDU A;  1JUS A;  2X6O A;  2E2I J;  3K2A A;  1A5J A;  3ZOB A;  3CQZ J;  1U9N A;  1X2M A;  4QSH A;  3RZD J;  1UHS A;  2PMZ N;  5IYD J;  5EEA A;  4C3I J;  1BW6 A;  3CCY A;  3JRA A;  3G1M A;  1MBK A;  2GBY A;  4D5C A;  2D5V A;  4J19 A;  4DW6 A;  1JTY A;  3JRC A;  5E3L A;  5M5X J;  4XIC A;  1ZTR A;  2DA3 A;  1POG A;  1QRY A;  1LE8 B;  5C4X J;  2DN0 A;  3DEW A;  3JRE A;  3I4N J;  1IRZ A;  1BL0 A;  1FTT A;  3E7L A;  1GV5 A;  3BTJ A;  2NOG A;  1IDY A;  3HOX J;  5FKN A;  1MNM C;  3GTG J;  1I50 J;  2DMN A;  3QQA A;  3RKQ A;  5DTD A;  3SFI A;  2O9L A;  2K9Q A;  2NS8 A;  3BR0 A;  4MO7 A;  5K7Z A;  3W6V A;  1F43 A;  2OF7 A;  4RBO A;  2R5Y B;  1TWH J;  3S1M J;  2W48 A;  3GTP J;  5BNG A;  3ZQI A;  4MLO A;  2L9R A;  2LTP A;  2FJ1 A;  2FQ4 A;  2OPT A;  4QIW N;  5FJ8 J;  3JRD A;  3D1N I;  5IPA A;  5JLW A;  3MKL A;  3S14 J;  3S2D J;  5FLV A;  1HCR A;  1RKT A;  1ETY A;  5GPC A;  1VF9 A;  3RQI A;  5HOD A;  2EZH A;  2Y9Y A;  3LSR A;  1TWG J;  4A3E J;  1HDD C;  2DA4 A;  5IP9 J;  2LFB A;  3VPR A;  1FEX A;  2ELK A;  4XRS A;  1ZR2 A;  2M0C A;  2HOA A;  4A3K J;  1APL C;  3HEF A;  4JYK A;  1FJL A;  2DMQ A;  4I76 A;  1ETK A;  3A01 A;  2Y9Z A;  4DYC A;  4BBS J;  1ETW A;  2E19 A;  4A3I J;  3HGG A;  5F0F A;  2VKV A;  3ZQF A;  4A3L J;  1SAN A;  3O8G A;  1IJW C;  3Q0V A;  2FD5 A;  5IP6 A;  5EGO A;  5C3E J;  2JMW A;  1RPW A;  3C2B A;  2LR8 A;  2K9N A;  2VI6 A;  3H0G J;  2KT0 A;  3MVP A;  1IDZ A;  1Z77 A;  3BTC A;  5E3M A;  3BQY A;  5FKK A;  1ZGW A;  1U9O A;  2WV1 A;  2MW8 A;  4G12 A;  5EF6 A;  3HOY J;  1B72 B;  3HOZ J;  3F0C A;  4A3F J;  1XG1 A;  1I3Q J;  1T56 A;  3S1N J;  2YU9 J;  4UUT A;  2AHQ A;  5JLX A;  1JT0 A;  3HGY A;  4D7M A;  2HYJ A;  3GBG A;  2ME6 A;  1S7E A;  4C3H J;  3BG5 A;  2VKE A;  4IHV A;  1JKP C;  1GUU A;  1QPI A;  1A6I A;  3JRG A;  4BXX J;  9ANT A;  1TC3 C;  2P81 A;  3FIS A;  2H1K A;  5FKO A;  2MGQ A;  1W0T A;  2JA6 J;  2HOT A;  1IV6 A;  1IUF A;  2R92 J;  2CUE A;  2EZL A;  1GDT A;  1OFC X;  5E3O A;  4LOC A;  2E2H J;  3GTL J;  2DA5 A;  2Y2Z A;  5C44 J;  5F1J A;  3JRI A;  1NK2 P;  4L5E A;  5F0H A;  1IC8 A;  3S1R J;  1O4X A;  1R9T J;  2ID6 A;  1F36 A;  2ECC A;  1BJZ A;  5DS9 A;  1LE8 A;  2DMP A;  1E3O C;  2R93 J;  5F0C A;  4EEF G;  4AUX A;  5E3N A;  3BR3 A;  1FTZ A;  3LOC A;  1JTX A;  4X1E A;  3RZO J;  3S17 J;  1JUP A;  1LFU P;  5GP9 A;  2M34 A;  3HKZ N;  1OJL A;  3OOU A;  5FKL A;  4B1R A;  3TP3 A;  3WHC A;  4JP0 A;  2CUF A;  2TCT A;  2R5Y A;  3GTM J;  5EG0 A;  1DU6 A;  4X6A J;  1H88 C;  1OCP A;  2JWT A;  1IG7 A;  1YRN A;  2G0E A;  1X2N A;  1VFC A;  3DCF A;  2QCO A;  1ORK A;  3UKG A;  3B6A A;  4B3A A;  1OCT C;  1XS9 A;  4IEJ A;  3GTO J;  5EZH A;  1JKO C;  1MBJ A;  2R5Z A;  1VND A;  3NAU A;  3K7A J;  3JRH A;  2NVY J;  3BR5 A;  2HOS A;  2JK3 A;  3WHB A;  1ZR4 A;  2DA1 A;  4DZJ A;  4XRM A;  2MSY A;  2Y30 A;  3A03 A;  1IGN A;  4IHX A;  1ETV A;  3O8H A;  4A93 J;  2ID3 A;  4A3G J;  5FKM A;  2M2E A;  2YS9 A;  3ZQL A;  3M3Y J;  4NDL A;  1NTC A;  1BW5 A;  5J1Y A;  1MSE C;  3B6C A;  5FLM J;  4CYC A;  3S16 J;  1Z0X A;  4JX5 A;  3Q0W A;  1RES A;  1WH7 A;  2JN6 A;  1PUF A;  2Y31 A;  1JJ8 C;  4V2F A;  4XID A;  3BR2 A;  3LSG A;  4W1U A;  1ETQ A;  4FE7 A;  2NVQ J;  1JT6 A;  2XPV A;  1ZQ3 P;  3G1L A;  2WAQ N;  3IH2 A;  1ETO A;  2EQR A;  2LD5 A;  4A3J J;  4BY1 J;  1WCM J;  4IHW A;  4Y7N J;  1U8B A;  2L7Z A;  2CQQ A;  1B72 A;  1NK3 P;  3GTQ J;  2FX0 A;  2L0K A;  2YUS A;  1K83 J;  3CMY A;  1AKH B;  4A3M J;  1MBH A;  5IYB J;  1ITY A;  2IBD A;  5M3F J;  3HOV J;  1B8I A;  1TWC J;  4I6Z A;  1LFB A;  1UG2 A;  3NAR A;  4V2G A;  1G2H A;  3BQZ A;  3BTI A;  3JRB A;  3BG9 A;  5C4J J;  2EZI A;  4FE4 A;  2NVX J;  2XGD A;  1QVU A;  1ZK8 A;  2HXO A;  3Q0U A;  1SFO J;  4JX6 A;  4M3D A;  2JA8 J;  2XPW A;  5GPA A;  3A01 B;  3HDD A;  3S15 J;  4JX4 A;  5EDN A;  3HM5 A;  1EF4 A;  2XRL A;  3JR9 A;  4UUS B;  2DMT A;  2L7F P;  4BY7 J;  4AC0 A;  2DTZ A;  1ZKG A;  2CQX A;  2NVT J;  2X48 A;  2LVS A;  4FTH A;  5IYC J;  2IEK A;  5M5W J;  1AHD P;  1TWF J;  4XK4 A;  3PO2 J;  1AU7 A;  2Y0S N;  3GTJ J;  3BG3 A;  2GLO A;  2RAE A;  1K61 A;  5J1R A;  3HOW J;  4BKX A;  4C3J J;  4M3B A;  3OSG A;  1HLV A;  3TP0 A;  3I4M J;  4Y52 J;  3FIW A;  1WGX A;  1FIA A;  1GVD A;  5M3M J;  1RET A;  3CDL A;  4AYB N;  4IHY A;  4W97 A;  1FIP A;  2VUM J;  1HF0 A;  2VPR A;  3BTL A;  1BA5 A;  4MFD A;  3ZQH A;  1W0U A;  2JA5 J;  1GV2 A;  3GTK J;  1RKW A;  3BT9 A;  2EZK A;  3SDG A;  4A3C J;  3QPS A;  2DMU A;  5EYR A;  5K7H A;  3M4O J;  3LSP A;  3A02 A;  3LSJ A;  4FCY A;  3TED A;  3BR6 A;  3PM1 A;  1ENH A;  1P7J A;  2X9D A;  1MBG A;  1Y1V J;  2LKX A;  4B4C A;  2ZB9 A;  2IAI A;  2LLK A;  2KDZ A;  3ZQC A;  1VI0 A;  1WPK A;  1TWA J;  2JJ7 A;  1MBF A;  1WI3 A;  4A3D J;  4MFE A;  2DA2 A;  2M8G X;  3LNQ A;  3PO3 J;  4ABZ A;  2ME0 A;  3L1P A;  2CRG A;  1JUM A;  4FIS A;  3HB9 A;  5IP7 J;  3FK6 A;  1I6H J;  3JRF A;  2E1O A;  3HBL A;  5F08 A;  1JKQ C;  1H8A C;  2COB A;  3IH4 A;  5EG0 B;  3S2H J;  2XPU A;  1UMQ A;  4BBR J;  4A3B J;  2HXI A;  2DA7 A;  1YRN B;  1D5Y A;  2LY9 A;  1T33 A;  3OIO A;  2K40 A;  2QF7 A;  2R0Q C;  3HOU J;  5J1U A;  4QTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...