1W0TA

Htrf1 dna-binding domain in complex with telomeric dna.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords TELOMERIC REPEAT BINDING FACTOR 1
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1w0tA00
1HDPA 1GT0C 4IHVA 2YUSA 1HOMA 4QIWN 5M5YJ 1VFCA 4XK4A 4EEFG 1ZR2A 2IEKA 5K7FA 3O8HA 3BTIA 3SFIA 4X6AJ 1JGGA 4JYKA 1NK3P 1MBFA 5IYCJ 4M3GA 1GDTA 5K7HA 3LSRA 3FK6A 3I4NJ 2VPRA 2XGEA 2R93J 2AO9A 1RKWA 3I4MJ 3MVPA 4NDLA 3BG9A 1WI3A 2ECCA 1BL0A 3HEFA 2HXIA 3Q3SA 2DA4A 4M3BA 4IHWA 1P7IA 2DMPA 3BT9A 2DMQA 5J1YA 1YRNA 1RETA 2COBA 4FE7A 5EEAA 1R9TJ 1EF4A 3JRBA 5FLVA 2JA6J 3JRGA 4V2GA 4JX5A 2D5VA 2WV1A 1UG2A 2Y30A 3S1NJ 3DCFA 3ZQGA 1NK2P 4JP0A 3JREA 3RZDJ 2ID6A 3IV5A 5GPAA 1ETQA 3Q0WA 1VNDA 1TWHJ 2XSDC 2NS8A 2NVTJ 3GTOJ 2B63J 1LFBA 4FTHA 4ABZA 4A69C 3W6VA 5F08A 2CUEA 3BQYA 2OF7A 2XPVA 4W1UA 2DA5A 1MBJA 1TWCJ 1XS9A 1MSFC 1G2HA 1BW6A 4A3CJ 1X2MA 1QPIA 2RAEA 1OJLA 4XRMA 3BR0A 3IH2A 1PUFB 1T33A 3H0GJ 1B72B 4A3LJ 4MIMA 2I10A 3OSFA 3RKQA 3Q0UA 5GP9A 3ZQIA 1JKPC 3HDDA 4C3HJ 2L9RA 1JT6A 5DS9A 2K9QA 2TCTA 2MGQA 3HGYA 4MO7A 1VI0A 1Y1WJ 3BR1A 1ZTRA 3MN2A 2FX0A 3JRAA 5IYDJ 2E2IJ 1H89C 2ME6A 2E1OA 3C2BA 3E7LA 2L7FP 2X48A 3SJMA 2DTZA 2LR8A 3GBGA 3LSJA 5IP9J 2HXOA 1ETOA 3A02A 3LSGA 4DYQA 1ETYA 5E3OA 4Y52J 1MNMC 1GUUA 4D7NA 2HI3A 1ZK8A 4D5CA 2E2HJ 2JK3A 1WGXA 4M3DA 1JT0A 5EGOA 3K2AA 1B8IB 1DU6A 1IDZA 3GTGJ 2GM4A 4D5FA 1UMQA 3A01B 2XB0X 5EYRA 2LTPA 1JUMA 5F0HA 1ENHA 3OSGA 5EDNA 1HF0A 5C44J 3Q0VA 1JJ8C 4M3EA 2DN0A 4XRSA 3HOXJ 1JKOC 2CRGA 4A3KJ 2LY9A 1D5YA 2R5ZA 2JA8J 4DZPA 4A3DJ 4AC0A 4BBRJ 5IP6A 1VF9A 4UUTA 4GFBA 2EBIA 1FEXA 5EZHA 1BA5A 4RDUA 1AU7A 3GTQJ 2LD5A 1AKHB 3GTKJ 1IC8A 5F1JA 1FJLA 4CYCA 4XIDA 5J1RA 3F0CA 4M3FA 1O4XA 3HGGA 4C3JJ 3QPLA 1IG7A 3BTJA 2DMUA 5M5WJ 2R0QC 1F43A 1ETVA 1HCRA 3SDGA 1TWFJ 3HBLA 1AKHA 1WH5A 1Y1VJ 4Y7NJ 2MSYA 3JRHA 2KDZA 2NVQJ 3TP0A 4A3MJ 1WPKA 5EG0A 4IHXA 4BXXJ 3NARA 3QQAA 5FLMJ 4XRSG 1IJWC 1FIPA 3HB9A 1POGA 5IOYA 4JX4A 3HOZJ 3B6CA 1OCPA 3TEDA 1LE8B 1TC3C 5M5XJ 2VKVA 2EH3A 2DA3A 2Y2ZA 3TP3A 5FKLA 3ZQLA 4MLOA 4BKXA 1QRYA 3LNQA 4DZJA 4A3GJ 2HYJA 5E3NA 5E3LA 2R92J 4J19A 3VPRA 1JKQC 5GPCA 3BTLA 1AHDP 3G1MA 3H3VK 1A6IA 2L7MP 1HDDC 2XGDA 1IV6A 4C3IJ 3BG5A 1OCTC 2CQXA 2YS9A 1QVTA 4C2MJ 2HOSA 4MFDA 1LE8A 1JUPA 2GLOA 2HOTA 4A93J 2XPUA 1S7EA 3MKLA 5DTDA 4A3IJ 5FJ8J 1H88C 4IHYA 1XG1A 2JA7J 3FISA 5C4JJ 3GTLJ 1MSEC 5EG0B 4FE4A 3CMYA 1W0TA 1PUFA 2EZHA 2EZIA 4FISA 1U78A 2ID3A 3LSPA 3HOYJ 3S17J 4AUXA 4A3FJ 2EZLA 3S1QJ 2R5YA 2DA2A 2K9NA 9ANTA 1JTXA 4HNVA 2JA5J 3QPSA 2M9HA 1WH7A 3JR9A 1SFOJ 2CUFA 5IPAA 5M3MJ 4IEJA 1HLVA 1IDYA 2E2JJ 2DJNA 4XICA 3ZQHA 2NVXJ 3HOVJ 5F0FA 2CQQA 1T56A 3TW6A 2KT0A 2YU9J 1MH3A 5FKOA 3PM1A 2GBYA 1GVDA 1X58A 1K61A 3S15J 2XGCA 2AHQA 1BW5A 5JLWA 3FKIJ 4A3BJ 2FJ1A 3M4OJ 3A03A 1ETXA 4AYBN 5K7ZA 3FIWA 2IAIA 3BR5A 5IOZA 2LKXA 5EGOB 3S16J 2X9DA 1Z77A 4UUSB 4FCYA 2MW8A 4V2FA 3M3YJ 4BBSJ 1JJ6C 3PO2J 4QTRA 3HKZN 1MH4A 1FTZA 1QVUA 3S1MJ 3GTPJ 1B8IA 2R5YB 2LVSA 1IUFA 1A5JA 3RQIA 2WB1N 5IP7J 2H8RA 2VKEA 2DA1A 3LOCA 3GTJJ 4DYCA 2XRLA 4B1RA 4W97A 1RKTA 5F27A 5FKMA 2IBDA 2PMZN 4QSHA 3HOUJ 4I76A 5C4XJ 3IH3A 1ETKA 4LOCA 1U8BA 5BNGA 3ZQFA 2JMWA 3HOWJ 1E3OC 4L5EA 3CDLA 5JLXA 1FTTA 1RPWA 2ECBA 4UUSA 3JRFA 2DA7A 3ZOBA 1OFCX 2M8GX 3JRIA 1P7JA 1RR7A 3DEWA 1JTYA 5M3FJ 2NOGA 4JX6A 2NS7A 3S14J 4M6VA 2ZB9A 1B72A 5J1UA 1BJZA 5E3MA 1W0UA 4BY1J 1WCMJ 1FIAA 2G0EA 5HODA 5EZGA 1NTCA 2QCOA 3OIOA 2O7OA 3D1NI 2VI6A 1I6HJ 5J3LA 3BR3A 1APLC 1DU0A 1U9OA 2M34A 3JRDA 2L7ZA 1Z0XA 2HDDA 1ORKA 3ZQCA 2ELKA 1ZR4A 2EQRA 3WHCA 2LFBA 4B4CA 2E19A 2X6OA 2P81A 1ITYA 2FD5A 2NVYJ 2XPWA 1Q1VA 2FQ4A 2W48A 3TW7A 4CYCB 1U9NA 2CU7A 2XB5A 5F0CA 3S2DJ 3IH4A 2Y9YA 2K9SA 3BR2A 3S1RJ 3CQZJ 1TWAJ 4RBOA 5IYBJ 3JRCA 2MG4A 5C3EJ 1IGNA 2QF7A 4MFEA 2JN6A 4A3JJ 1MBEA 4DYRA 2TRTA 2M2EA 3G1LA 1MBGA 3RZOJ 3UKGA 2OPTA 2N8GA 2L0KA 1ETWA 2DMTA 4G12A 4DW6A 2JJ7A 3GTMJ 2DA6A 3B6AA 5F04A 5FKKA 1I50J 1MBKA 3L1PA 2JWTA 4D7MA 3BTCA 2R5ZB 3G1OA 2EZKA 1UHSA 1SANA 2H1KA 3BG3A 1H8AC 1I3QJ 3OOUA 1RESA 5EF6A 1X2NA 5FKNA 1LFUP 2LK2A 3A01A 1XC5A 1F36A 3S2HJ 1ZGWA 2R7ZJ 2WAQN 3K7AJ 2O9LA 3NAUA 2Y31A 4I6ZA 2ME0A 1CQTA 2CJJA 2LP0A 1JUSA 3PO3J 1ZKGA 1K83J 1YRNB 2DMNA 1TWGJ 2O8KA 1GV2A 2HQ5A 3WHBA 4A3EJ 2Y0SN 1IRZA 2M0CA 3O8GA 1JKRC 4BY7J 3HM5A 3BQZA 4X1EA 4B3AA 1GV5A 4S0HB 2VUMJ 3FK7A 2K40A 3BR6A 2LLKA 1MBHA 2HOAA 2Y9ZA 1ZQ3P 3CCYA
chains in the Genus database with same CATH superfamily
3V8JA 4WXDA 3I5UA 2CQNA 4BXUA 2FRHA 1WZ2A 4XK4A 4EEFG 1B9MA 4BE0A 1RNLA 3ABKH 2WB1A 5CJ9A 3O8HA 2IPQX 3SFIA 1MNDA 3GFLA 5LGUA 1VQMI 4X6AJ 2DODA 1HW1A 3KP5A 4JYKA 2DPUA 2KRCA 3OYEA 1VQ5I 1OCCH 5LRSA 1WJEA 2L01A 2HWVA 1KZHA 1KA8A 3U1KA 2Y0SA 2OA4A 3DU5A 3WGHA 4AVZA 2EIMH 1O57A 3NWTA 3QWLA 4BJTA 2ECCA 2HXIA 4CSWA 4DIQA 3VEPA 4L9VA 4IHWA 1MNEA 1P7IA 2DMQA 3LA7A 3DF8A 2COBA 3QYEA 5CKTA 3IL2A 4XLHA 4WF2A 2VQLA 4JX5A 2RQQA 2WV1A 4KYWA 1YS6A 3I64A 4XM3A 3OYMA 4G7ZF 2Z9OA 2WTEA 2M5WA 1XGMA 4EJOA 3JREA 2IP2A 1FNNA 1S7AA 5GPAA 1R58A 2H09A 1ETQA 3MKZA 1SVMA 3I59B 3SXYA 1MMAA 1VNDA 4DBRA 3ECHA 2JRTA 1S72I 1TWHJ 1J75A 1SVLA 2Q2EB 1U5TA 2FMLA 2KJCA 4S04A 3GZNB 4JQFA 4IHSA 2Y48A 3C2GA 2GAUA 2LBFB 4FTHA 2NNNA 1BBYA 3CESA 2RN7A 2QA4I 4WWCA 3OS2A 2K4BA 2CUEA 3RJPA 5FLXZ 3CMEI 5HDKA 2F5FA 1TWCJ 1XS9A 1MSFC 5BS6A 4KN7X 1FPQA 5CVIA 3K6GA 4CCOA 5GTHC 3VB2A 1ACIA 4A3CJ 1V4RA 3BP8A 3IWZA 4OIOF 2UWMA 5JHFA 3BR0A 1PUFB 1T33A 3H0GJ 1DUXC 2DO7A 4KIBA 4MIMA 3AKZA 1BR1A 3WG9A 2EILH 1IRGA 1ZG3A 3Q0UA 2HOEA 1IZ1A 4II3A 1JKPC 3L2WA 4L9TA 2KL4A 5AIPA 4C3HJ 2L9RA 2M1BA 2K9QA 5DS9A 2MGQA 3SEZA 1VI0A 1FZPB 3BR1A 4A5NA 4NC7A 5GADJ 3MAJA 2XUBA 3F9KA 2NS0A 1ON2A 4YEJA 5J47A 1K79A 1LKXA 4IPAA 1OQYA 3DFGA 4HNUA 3C2BA 3E7LA 3OL4A 3JW4A 5D4RA 2X48A 3SJMA 2DTZA 4FX4A 2LR8A 2BGCA 1J2XA 2A69F 4UXNA 2QQ9A 3RPUD 1R7JA 2DFHA 4LG0A 4DYQA 2V6CA 2HTSA 5E3OA 1RUNA 4HNTA 1GUUA 1MNMC 3OYDA 4D5CA 1B59A 3D0SA 3I71A 1WGXA 2BVLA 1JT0A 5EGOA 1B8IB 2UXNA 3GEZA 2RV8A 3CC4I 4M6XA 4BYYA 2FA5A 1IXRC 3S3MA 2E7XA 3FF5A 5F0HA 1G3WA 5E20A 2STWA 5EDNA 1HF0A 3HC7A 3HOTA 3ABUA 3CO6C 4M3EA 2DN0A 4XRSA 4A3KJ 2LY9A 5BPIA 4ENNA 1UG0A 1Z91A 4AC0A 2QBYA 4GFBA 2IA0A 2CH0A 1BA5A 1W5SA 2Z16A 4CO8A 2ACJA 3E5QA 2OUMA 4K2EA 2DYSH 3TL4X 1X3WB 4L9JA 4CYCA 3QAHA 2XSJC 2FMYA 2CUZA 4HW0A 2M7AA 5ILVA 1MMGA 4LMYA 2KIQA 3HZJA 3MKWB 5LD2C 4Z2YA 3BWGA 3K70C 2CGPA 2M3AA 1ETVA 2XIGA 4QPOA 2UZKA 2PJRB 4RB2C 3HPHA 3CF5F 2XAJA 3Q9SA 3HBLA 1AKHA 5EJCA 2XASA 4Y7NJ 4V19K 2O03A 1V54H 3HSRA 4BJ6C 3TP0A 1ZRCA 4A3MJ 3VYSB 1VQLI 5EG0A 1R49A 4IHXA 2RNGA 1Z21A 2PMHA 5DCMB 2IGMA 2DBBA 4B44A 3KYLA 3IRQA 1IJWC 2Z3YA 3CCSI 3BG6A 4ZYAA 2GOXB 3L7WA 1FYMA 3FBNB 3B6CA 4G9YA 1LE8B 3GFMA 5DYMA 4OINF 1X1CA 3BY6A 1HC8A 1QHHD 4XOPA 3LNQA 3CUOA 1WQ2A 4DZJA 3MZ8A 4A3GJ 2HYJA 1FYLA 4YFNF 2R92J 3QP5A 3VPRA 1JKQC 3H3UA 3JSPA 2DFIA 1Z3XA 2CQKA 3M1EA 2NRAC 1RIOH 2DPDA 4M72A 4ENKA 1R36A 2DK5A 4AM3A 2XGXA 5LHGA 1IXCA 4MFDA 4OOIA 1MMSA 1VQNI 2DLLA 1BI0A 4E7ZA 3IC7A 4I2OA 3HG9A 5B5EC 1OLTA 2DFEA 3OS0A 1S7EA 4A3IJ 2EFNA 4N0BA 1V5EA 5IT3A 1D8JA 2DDAA 3GTLJ 2LDUA 3SYTA 4ZDLA 4FE4A 5BOXA 1PUFA 1U78A 4FISA 2CFOA 4IHTA 1J09A 3GLXA 3S17J 4O5VA 4CH7A 4C30A 2HR3A 1HXDA 4G94A 9ANTA 1JTXA 1R22A 5K5RA 1KU2A 3JR9A 1WH7A 3OYNA 2E1NA 1WJCA 3FXMA 4ANJA 4MEYF 4ITVA 4Y15A 2DJNA 5LLQA 4XICA 2H94A 2QSGX 3KCCA 4RAGA 2G7HA 4XN3A 1T56A 2DQLA 1L0OC 1MH3A 4N4OB 1X4OA 4IKFA 2GBYA 1W4MA 2BZTA 1D1BA 1K61A 2AHQA 1TW3A 5DUKA 5JLWA 4A3BJ 5CYVA 1VQPI 2L54A 1BOBA 1FYKA 3H5RA 3EUKL 3LA2A 3E6CC 2NOJB 3I9V2 3WODF 1TQPA 3FIWA 2IAIA 5E1XA 2LKXA 3BZ6A 3R4KA 3TDUC 2X9DA 1Y6IA 1FWZA 1F1ZA 1QZZA 3CDIA 3NEUA 4V2FA 4KITB 3DV8A 3HRUA 3PO2J 1O3RA 3WTSC 3EETA 1YS7A 3C2HA 1QVUA 1FTZA 1I27A 1F5TA 2CO5A 4M9XA 1MZBA 3N4MA 4I7HA 3GTPJ 1DP3A 2EB7A 4GYIA 2R5YB 1YTYA 2LF8A 3K4NA 4P5OA 4I01A 2J5PA 1HSJA 2MH9A 2FEZA 4HYEA 2QSHX 3GFIA 1D1CA 4DYCA 4PZJA 2YPRA 2R7OA 2D1VA 2JZYA 4KMUX 5F27A 1V3FA 5FKMA 3GZ6A 1LFPA 1FY7A 4I76A 3ZMSA 4BNCA 2KIMA 1U8BA 2PLYA 2QVOA 3BJ6A 3FDYA 1LDJA 1M1EB 3L2RA 3CD6I 5JLXA 1FTTA 1W1WE 2ZKZA 3JRFA 3BDDA 3DTIA 2AS5F 3DQVC 3KP2A 3KEYA 1C0WA 3DEWA 3A2KA 3CCUI 3AG1H 3K2ZA 4HZFA 1B72A 1J9IA 1FIAA 2G0EA 1RR8C 1TW2A 4L0YB 1JHFA 1ON1A 4LB6B 3D1NI 2ZJRF 3G3ZA 1QPMA 3H1CA 4OIRF 3FMSA 1DU0A 1TLHB 1U9OA 4E7LA 3W6JB 2ZC2A 2MYSA 1Z0XA 4IQJA 1O3QA 3HHHA 5HLIA 1ORKA 2HNHA 3E6MA 2O3FA 2MC3A 3GXOA 1YO5C 2BY0A 2LFBA 1OCOH 2IVMA 1DP7P 3LQQA 2LY1A 1VZ0A 2W85A 2F5DA 3ZPLA 1CF7A 5AIQA 2W25A 1MKMA 3AFHA 4CCKA 4BEHA 1TNTA 2K02A 3DLAA 3H9GA 1N25A 1FP1D 1OCRH 3BR2A 3W3CA 2XROA 4PGGA 2DT6A 3VFZA 1AWCA 3IAM2 3CQZJ 1TWAJ 3ML6A 2IA1A 3WTYC 3VODA 4RBOA 3JRCA 5ICEA 1E3HA 2QF7A 4MFEA 1WJAA 2JVHA 4IF4A 5IT9Z 2TRTA 4LB5A 1MBGA 2OPTA 2FF4A 3CLOA 3CJQB 2HS5A 4DW6A 3HUGB 3FBIB 4X0GA 1ZRDA 4OIPF 3GTMJ 4J00A 5E8IA 5F04A 3IP4B 1YJWI 1ZREA 5DD8A 1SC7A 3KETA 2STTA 3G1OA 4P96A 3ZMUA 1YFHA 2JUGA 2OD5A 1SANA 1OPCA 3GZ5A 4EJVA 2H1KA 1EH7A 5DV5A 2W4SA 2KIFA 3R61A 5ED4A 5EF6A 5FKNA 2ZXIA 5CQEA 2VT2A 3HSEA 1PJRA 2CV1A 3I54A 4HX4A 2O6GE 4OAYA 3NAUA 1P9QC 3BC8A 2PMZA 2K5CA 1NHAA 4HAMA 2DT5A 3CP8A 5HOOA 2R7XA 2Y0SN 3QYFA 1OYIA 3G4SI 4PFPA 3O8GA 1JKRC 4BY7J 2F4OB 2L9SA 2PJRA 2VC0A 1SEUA 1YOVB 3HM5A 3TOBA 4U0YA 1UAAA 4KISA 2IT0A 4QPQA 3LFKA 3H35A 4WXCA 3KP7A 5GAEJ 2YU3A 2GIVA 2KISA 2HQNA 1V5GA 3QYBA 4OIQF 4PJNA 1GT0C 3K4JA 3PNVA 3L2UA 2YUSA 4IHVA 1HOMA 4UB6C 2KHMA 5M5YJ 3QU6A 1VFCA 4TV7A 4F7ZA 2IEKA 5LGTA 1QZEA 3N05A 2R7VA 4R8HA 1LDDA 1XDSA 1ZYRF 1MIJA 2LYCA 2FQ3A 3E5UA 5K7HA 4AWXB 2ISZA 3CC2I 4KUMA 3L9FA 3I4NJ 3DKYA 2L02A 2AO9A 2O61A 3CCMI 1RKWA 1V5FA 2XV4S 3SDBA 4N9HA 3DWLE 4UB8C 3EYIA 4NDLA 1R4MB 3BG9A 3HEFA 1IN8A 1DDNA 2DA4A 4M3BA 5J1YA 2DMPA 2IS2A 2QKMB 1RETA 5L3FA 2XAQA 4CHUA 4FE7A 5EEAA 1R9TJ 2X6XA 1EF4A 3JRBA 2H8WA 5E18F 4MTDA 1W7PA 2A6TA 1TZLA 4ZH4F 1UG2A 2M30A 4CUGA 3CUQC 1LVAA 1NK2P 1N78A 1S9HA 5F64A 2XAGA 4NB5A 1YW8A 4JP0A 1BR2A 2ID6A 4JOMA 3IV5A 2LC2A 3H36A 4HSRA 3E0JB 1KYWA 3Q5FA 3DLLF 2VLAA 4XORA 4YIFA 3GTOJ 1P4XA 3RIRA 5JHUA 4AIJA 1ZGAA 3NRVA 5F08A 3BQYA 4G6DA 4LIUA 2ZJPF 4W1UA 2BE5F 3SQNA 1MBJA 4EGYA 2X1CA 4YFXF 2B7EA 4CZZA 4NHJA 1VQKI 2VE9A 2VODA 2F4IA 2VBXA 1RRJA 5HLHA 4XRMA 2HU9A 1MMDA 5ICGA 3I58A 3IAS2 5ICCA 3EUAA 5BMZA 1YX5A 3KX2A 5H6QA 3KLNA 1UFMA 3G6EI 2WWYA 4UVAA 2OTJI 1D5VA 4PCQA 1I39A 1T95A 4R79A 3WGIA 3HGYA 1G8XA 3E97A 3MN2A 3F23A 4FQGA 3WU0A 4PJ0C 1T98A 2UXXA 2CV2A 4KT5C 2E2IJ 2CQ7A 2CWEA 3HRMA 5EEGA 5FRMA 5FB2A 4KDPA 2ME6A 3OYHA 1U5TC 2K7LA 1T2KA 1I3AA 3GBGA 4IVNA 2P8TA 4OMZA 4B3XA 4CCNA 1Y0UA 4WCGA 3A02A 2OTLI 3LSHA 3ERMA 2A5WA 3COAC 3ASNH 5L3EA 2NYXA 1HKSA 2BXYA 2E2HJ 3K2AA 3A4CA 2P6SA 1BOAA 1DU6A 1IDZA 2GM4A 3P5JA 2QSFX 1UMQA 4BQNA 1T39A 4BDZA 4BQQA 2VKHA 2XB0X 5LRRA 2ELHA 2IGOA 3K9TA 3OSGA 2EA2A 2I8DA 1Y8RB 1FLIA 3KPHA 4MTEA 2V9KA 2XVCA 3OR2C 4A3DJ 2X1EA 1AOYA 3BLYA 3DU6A 4BBRJ 2JSPA 2V79A 2EBIA 1X1BA 3E6DA 2J5OA 3QOPA 1I1SA 2BXZA 4PSXA 4RDUA 1AU7A 3GTQJ 2LD5A 1AKHB 3J7YJ 1NH3A 3GTKJ 2JT1A 4U0VA 5F1JA 2QENA 4HLXA 1JI8A 5H20A 3FHNA 1IRFA 1PVEA 4YELA 5JVTA 3DBLB 3PUBA 4EMSA 3HGGA 4C3JJ 3LFUA 2PEXA 2MH2A 2PMUA 1OKRA 5M5WJ 2GIZA 1QGPA 3FXJA 3F6OA 2GOMA 2M4GA 4F91B 3L00A 2K4JA 4M73A 2MSYA 3JRHA 2KZGA 3KEQA 1ULYA 2EV6A 5JI6A 1WSUA 2NVQJ 2FXAA 4I99C 3GCMA 3ZMVA 1RC9A 3OYFA 4XKCA 2KRHA 3QQAA 1WVRA 4CA0A 4XRSG 2HGCA 3E1SA 1FIPA 3HB9A 5J4VA 5FO5A 4XLNF 2ICWG 3JAMZ 5E8GA 3WTZA 5IOYA 3W6KB 3HOZJ 4M74A 3TEDA 1S7OA 2Y2ZA 2CW7A 3DPUA 3OYBA 4ZDOA 3ZQLA 4NNJA 1S3JA 2EFWA 5E3LA 2DU9A 1B4AA 2VBZA 2L7KA 4LK0F 5GPCA 1D1AA 2JVGA 5HNFA 4IQ4A 3JSOA 3GX4X 3SEQA 3R6SA 2L7MP 1JHHA 4C3IJ 3BG5A 1EKEA 2LG4A 5D5WB 3JCUC 1PYVA 3ZGKA 3U2RA 4C2MJ 2VJ5A 4C2UA 1JUPA 2XPUA 4WK8F 1PP8F 4PSWA 5DTDA 4E7KA 3RTRA 1YIJI 1E0EA 3FISA 2DJIA 1B6AA 5C4JJ 2V6EA 1MJBA 2GXGA 1XMXA 1W0TA 3OS1A 2GA1A 1MJ9A 2EZLA 3SFZA 2H1LA 1SAUA 4GGGA 4FT8A 3K70D 2UV1A 1SFOJ 3IKVA 5D5XB 5DUIA 3I0TA 4IEJA 1IDYA 4II2A 5DDGA 2E2JJ 4L5IA 1LEAA 4KJZA 3H92A 2MFZA 5FLXK 2YU9J 1ZLJA 1GXQA 2KJBA 2V4JC 2K9LA 3L2CA 2LBFA 3DP7A 1PUEE 2E5ZA 4HA8A 4RGUA 1YW7A 3A03A 4RLFA 1X1DA 3WU1B 1E17A 2E1CA 2D1HA 2F5VA 4AIDA 5K7ZA 2LREA 2YX4A 2EIKH 4BL0B 3BCAA 3CCJI 5E17F 2ELJA 2Q2EA 4BS9A 2VJIA 2BYVE 4HQEA 3I59A 1O7LA 3N97A 1JJ6C 3SHFA 3HKZN 2X6YA 1XCVA 1Y0NA 1RUOA 3J81K 3R0JA 2AXTC 1IN5A 2LVSA 2ZMEB 1IUFA 3CJNA 1A5JA 3RQIA 3K4MA 3ZMTA 2ZCWA 5IP7J 1S8NA 2VKEA 3LOCA 2ZMEC 3WTVC 3GTJJ 3BZCA 2IGNA 4W97A 1RKTA 3VWBA 3W2VA 2W24A 4UNOA 4EJUA 4M6YA 4LJZF 1G3YA 3HOUJ 1ETKA 1U6GA 3QU3A 1XSVA 2CSOA 3VYRB 2HTJA 2DXIA 5K5QA 1BM9A 1U0JA 2E1MC 3CDLA 2JSCA 4G8XA 1RPWA 1H0MA 4UUSA 4XLCA 1SFUA 1NG7A 2DA7A 3JRIA 2M8GX 3FXRA 4NUBA 1HW2A 1ZLKA 4DNCA 2V1XA 2ZFWA 3K0LA 3IRRA 5M3FJ 3F21A 4BGDA 2V26A 1WRJA 3PNYA 3KFWX 1OMIA 5IT9K 2NS7A 3LQRA 4M6VA 4XLEA 2HZDA 5KVRA 5J1UA 1BJZA 2XRNA 4A0XA 5HODA 2VL8A 4PJMA 1R1TA 4BUPA 3GYHX 1YI2I 2O7OA 3SZTA 1R4NB 1YX3A 3BR3A 2PX9A 3M07A 4E7HA 1HSTA 4Q4ZF 1FOWA 4BE1A 2HDDA 3CDHA 4DQ2A 1FX7A 4IOAF 2M0MA 5CQGA 2VKDA 3ZQCA 5BQTA 1W36C 2X51A 1SD6A 2EWNA 5JFRA 1XPXA 1XX5A 3HKZA 1D3YA 3U21A 4RGXA 4B4CA 2HVRA 4GRIA 3F8BA 3FMRA 1ITYA 2XPWA 1IO2A 1Q1VA 4YRVA 3ROUA 1U9NA 2QM3A 3J80K 2CU7A 3CLQA 5F0CA 3IH4A 5A2QZ 2O5RA 2HVSA 2K9SA 4AIHA 4XLAA 2CS3A 1R71A 4P55A 2HZTA 3OV8A 4XLFA 2MG4A 2V7FA 3F8NA 5C3EJ 1ZAOA 1YE9A 3H0DA 2JN6A 4DJAA 3DBHB 4UV9A 1DPRA 3HHGA 1WFXA 1QO0D 2Q1ZB 2WAFA 4NQWA 5B66C 1A35A 4IRIA 2L0KA 3KZZA 2V1UA 5GAGJ 1Z7UA 2LF7A 3BCBA 1T0FC 2HQAA 1I50J 4PJJA 5FKKA 3GW2A 2JWTA 1HQCA 2JPBA 4D7MA 2R5ZB 2MC4A 4RM3A 2EZKA 1UHSA 5J6XA 4A0YA 3EYYA 1H8AC 2VE8A 2R7DA 2MABA 1STZA 2DQRA 2EA4A 5ERIA 3C18A 2M8EA 3A01A 1XC5A 1F36A 5GAHJ 3J81Z 3PIOF 2ESNA 2BW3B 3BJAA 1ZGWA 4XSXF 2XDVA 3IWFA 1WKMA 2CJJA 2X4HA 5ICFA 3V4GA 5FD6A 2VIXA 2FE3A 2KFDA 3ZMZA 4XLPF 1F9NA 2GQQA 1OYWA 3B02A 3SZGA 4AYBA 2OQRA 4A3EJ 4GO1A 4XSZF 1T38A 5CVJA 3HRTA 4CICA 4EATA 3BQZA 4X1EA 4B3AA 2FNAA 2RVCA 3CCLI 2K40A 2EK5A 4RAYA 4OAZA 4ESBA 5D4SA 1UJ8A 2A6HF 3FX3A 1ZQ3P 1O7FA 4HOBA 2A68F 2HDCA 4ASNA 1Z3YA 1U5TB 4B47A 1FOYA 2WADA 2ZJ2A 2VC1A 3T8TA 2CUJA 1ZR2A 1QZYA 3FHZA 2NXNB 2L9NA 1VQ7I 1ODDA 1MGTA 1X3ZB 1JGGA 2RDPA 3FM3A 2VOOA 1IXSB 5FD5A 1MBFA 3VSLA 5IYCJ 2E34A 3HUGA 3RSNA 3CO7C 4M3GA 1GDTA 4HF0A 1R5ID 1K4TA 2F4MB 1SD4A 2JPCA 3O3KA 3MVPA 3K10A 4KNYA 1SD7A 1WI3A 2K3FA 1BL0A 3QP6A 3S2WA 3Q3SA 2P6TA 2QBYB 1Z7LA 1H9TA 4NQWB 2XAHA 3IHUA 4HPQA 5FLVA 2JA6J 3JRGA 2EFOA 3BROA 3FXQA 4V2GA 3NQOA 3ZMDA 2Y30A 2ZXWH 3FXLA 4ZZLA 1N75A 3S1NJ 1CF7B 2Z5UA 2EFPA 2FSWA 2P5VA 3VDXA 3ZQGA 2W84A 4JK1X 2BHYA 3RZDJ 1WJFA 3GVAA 2E7WA 2MLGA 4ON0A 4F52A 3AL0C 3T8RA 1BC8C 4M9SA 4L18B 4C2TA 3F3XA 1W36D 3GMEA 4KT6A 3K4KA 2NS8A 2XAFA 1YLFA 2NVTJ 3AL0B 2B63J 3S32A 4Y17A 4ABZA 4LK1F 4M9ZA 4XMYA 3RCOA 1YHQI 3P9CA 3W6VA 3OOPA 2K3PA 3BG7A 1IUYA 4HSTA 4LGWA 4RGRA 1XD7A 2Q8KA 5KK1A 1YYVA 3H9JA 1BI2A 1G2HA 4XQFA 2E35A 5IY5H 1QPIA 1Z6RA 2BBYA 3C1DA 1OJLA 2ZXJA 1YG2A 2B9SA 2RNJA 3WE2A 3MMYB 3CMMA 2Y69H 3U9GA 2EV0A 2LMDA 3RKQA 3MZYA 2F5CA 2OAZA 1I6XA 4XN0A 2CMPA 2HVQA 3ZRGA 3HDDA 2OV7A 2VONA 5J40A 1Y39A 1Y1WJ 2ADUA 5K1YA 5F6FA 2DW4A 1RI7A 5IYDJ 1T8IA 2G7UA 4FETA 3HRSA 1H89C 3PQKA 5D6FA 1Y56A 2OCCH 2PBIA 4EM2A 2ZFUA 3A0HC 4Z6YA 2L7FP 2CV0A 2ESHA 5IP9J 5D5VB 1OR7A 2JA2A 2QYOA 1ETOA 4XL9A 3DBRB 3LSGA 4EVIA 1SFXA 3PIPF 1ETYA 3MKYB 4OMYA 4RGSA 4D7NA 2DT7B 2W82A 4M3DA 1REPC 4BDYA 3TO6A 1XMKA 1K4SA 2H27A 3GTGJ 3UNGC 3A01B 3C7JA 2ZSIB 5EYRA 2LTPA 1JUMA 1IN6A 2M7BA 4ESJA 1SVOA 1JKOC 2A07F 1DPUA 2VASA 1FC3A 2HQRA 2R5ZA 4UVBA 2FUG2 1D0ZA 1D0YA 4AD9A 1X1PA 2A3SA 3G71I 1UHWA 5L3BA 3ISPA 1FEXA 3OL3A 1P2FA 1Z05A 4LLLA 1XMAA 1BC7C 2OU2A 3BPVA 1IC8A 4RS8A 2V1NA 3PSIA 5E1ZB 5LHHA 1IF1A 4L0ZB 2RGVA 1VTNC 1W7PD 2WV0A 4XIDA 1B9NA 5CLSA 4M3FA 1O4XA 3LL7A 4EGZA 4A2UA 3CJRB 4PGHA 3BOQA 2R0QC 1SAXA 3LA3A 2Z1DA 4KIFA 1HCRA 2M87A 4I02A 1KQ0A 1TWFJ 2ZXHA 2X1DA 1LDKB 3VYUB 4MNUA 2VQHA 3ECOA 3REOA 2P7CB 4ZYHA 1QA6A 2QQBA 1A31A 1WPKA 2R7FA 4LFUA 4I0BA 4R1HA 4UHTA 4BXXJ 2FNPA 3NARA 3OYCA 2IJLA 4WX9A 3MEXA 3FXKA 4HV5A 4Q5SF 5B1BH 2K9MA 1TC3C 4F3QA 2VKVA 4BJ5C 3I3LA 4XKBA 2P5KA 2ZO4A 5M5XJ 3OYJA 4YFKF 1TL8A 2EFQA 1FMWA 1VQOI 2DFFA 2ZBKA 5FKLA 1XGSA 4MLOA 4CGZA 5E1WA 1QRYA 1W7PB 2KKOA 2D45A 4PDKA 5LEJA 5H2FC 1EA3A 1QNTA 4J19A 3T5XA 3KP4A 1ZARA 3H3VK 3G73A 1A6IA 3ZQQA 1WHUA 2H6BA 2H6CA 2X85A 3PJRA 1T6SA 5J4YA 4HDVA 2DTRA 2LRDA 4P9FA 1OCTC 2YS9A 4Y3OA 6PAXA 3R0AA 2Z33A 1QBJA 2K27A 4M71A 4U88A 2V9PA 2HOSA 4IL6C 1FMVA 3TO9A 3MZHA 2GLOA 3E5XA 2HOTA 1SD5A 4A93J 4I98B 5E79C 4FX0A 2WBMA 3MKLA 5FJ8J 1BI1A 1H88C 4E6KG 4IHYA 1XG1A 2RKHA 3QODA 3PFYA 4BQAA 2DK8A 1B1BA 3IUOA 2EZIA 1J0RA 3KYCB 2ID3A 3KZIC 4AUXA 3BPXA 4ZTFA 2DOFA 1HKQA 3EPZA 2VQCA 4H4KC 1GHCA 4HNVA 4OWRB 1LUJB 2CUFA 4J01A 5IPAA 2Z2SB 1HLVA 2BEOA 5J8FA 4EQQA 3HXLA 2DI3A 5LHIA 1X1AA 4HQMA 5F0FA 3O6BB 2CQQA 3CCEI 3TW6A 4DGWB 2KT0A 4A5MA 2FU4A 3PM1A 2IS4A 1VQ8I 4YIRX 2FBKA 1IN4A 2L4AA 3J7AY 1GVDA 1X58A 4KICA 3GO5A 2XGCA 2EJRA 3ERED 3FKIJ 1ZELA 1TQIA 2EV5A 3ULQB 3ZR8X 2VB6A 5FRNA 3M8JA 4B43A 3BR5A 5IOZA 5EGOB 3ZP5A 3S16J 1X3UA 3LWFA 3LAJA 4FCYA 2GXAA 2MW8A 3M3YJ 1UB9A 1N77A 4BBSJ 2QWWA 1T08B 3KE2A 2BV6A 4QTRA 1X4PA 4B09A 1IV8A 4EJTA 4HX7A 3M1CA 3H5AA 5DEQA 2W7NA 1USTA 4QWQA 4ESFA 2H8RA 3RYRA 3HPGA 1R5HA 3UR3C 3VYTB 1ERDA 2XRLA 2F2EA 2IBDA 5KAFC 3F6VA 1YIOA 4QSHA 3L2QA 4BH9A 4CCMA 3HL2A 3WTWC 4LOCA 3LSTA 5BNGA 4U7BA 3KIOA 4XOTA 2KLOA 3ZQFA 3HOWJ 1J59A 3VSKA 4BU2A 2A05A 4L5EA 3ELKA 2XF6A 3W2AA 3ZOBA 3OYLA 2W57A 4PFOA 1BIBA 1K6YA 1RR7A 5H6RA 3RKYA 2XF7A 3DKWA 2FOKA 2NOGA 4BEHB 4JX6A 4LLNA 1P4AA 3S14J 2ZB9A 1W0UA 1W5TA 2IA2A 1WCMJ 4RMNA 4BY1J 2QQAA 1NTCA 3E6BA 4RAZA 4MEXF 5KAIC 1R1UA 1VQ9I 3OIOA 1LQ1A 3OYAA 1APLC 2M34A 4U0WA 3J7ZI 2DOEA 3JRDA 4XRFA 3FZVA 2L7ZA 4XR6A 4HF2A 3LSKA 5LFAA 3CZ6A 3KEOA 5CVRA 2A61A 1CGPA 4Q47A 2EQRA 3WHCA 2W1OA 2KPMA 3QPTA 5L3DA 4KIGA 5DCFA 2E19A 3WGGA 3CUQB 3LSIA 4PJLA 3SZPA 3DEEA 3RPUA 3EQLF 4HEA2 2CW8A 1VQ6I 4CYCB 2FQ4A 4ENJA 4GXOA 2VBYA 1UCRA 3BZKA 2XB5A 2HYFA 4I09A 2UUZA 1TBXA 2Y9YA 3RDIA 4D0PA 1ZHFA 1P4WA 3DPTA 3S1RJ 2HYGD 1TQMA 4CCLA 1UHMA 3FWEA 3TDZC 2OCEA 3M7GA 3S8PA 5HLGA 1PP7U 3MD2A 2XKOA 2DDBA 2VQGA 4A3JJ 4U87A 1MBEA 3G1LA 2R7RA 4IZZA 1ZG5A 2N8GA 1E2XA 1ETWA 1TTYA 4G12A 1EH8A 2DOAA 4UVCA 1FOKA 2JJ7A 5LEKA 3B73A 1MBKA 3ABMH 4B8XA 2EPFA 2WC2A 3HYIA 4ZDPA 1YITI 1LNWA 2R4GA 3BTCA 3V7RA 1WJDA 2AQFA 3JTHA 4AIKA 1S6LA 3BG3A 2GXBA 4P9UA 3D5RC 5HVQC 4LD5A 2OBPA 1SFKA 1XB4A 1JXSA 2A6EF 1P92A 1RESA 1I5ZA 4PUSA 1G59A 4F93B 3U1DA 3JTGA 3S2HJ 4EV0A 5KCMA 2WAQN 3K7AJ 2WAQA 1R6RA 2P0WA 3FXOA 5D5UB 2O9LA 2Y31A 1CQTA 2LP0A 2HEOA 1JUSA 1ZKGA 3RI4A 2HKOA 1GXPA 1ZN2A 1K83J 1YRNB 4LLGF 4WXHA 2DMNA 5F1RA 3F8CA 2O8KA 4FHTA 4IO9F 2HQ5A 3AG3H 5L3CA 4G7HF 2M0CA 4IRGA 5D6EA 3S93A 4UUVA 5LGNA 3R60A 2RQPA 3OYGA 3A0BC 1GV5A 4S0HB 3OY9A 4MQVA 1O3TA 3CJTB 3H9QA 1ZH5A 3BR6A 2R7WA 1XGOA 2LLKA 2KIUA 2HPMA 1MBHA 2OZ6A 3PSFA 2R7QA 1HDPA 5ILUA 3TMOA 4G7OF 5FFZA 4QIWN 4KMFA 3K4CA 1XDUA 3FXUA 2NVUB 4ZC3A 5K7FA 1XTAA 3P7NA 1TT0A 3BTIA 4O3MA 2ZJQF 2C6YA 3PFIA 2BVMA 4KN4X 4N9IA 1NK3P 1BI3A 3V8LA 4CCJA 2F6CA 1S29A 3FK6A 1Q1HA 3QPHA 2VPRA 2XGEA 4HV6A 4JBAA 3LSRA 2R93J 1WJBA 1E3PA 4HF1A 3I4MJ 2MD0A 2MLKA 4XKVA 3MFKA 1G3TA 2IXSA 4IXAA 3E3VA 3HSFA 2HKXA 3BT9A 1YRNA 2WY8Q 3L2VA 3PUFA 5HS7A 2XF5A 1RZ4A 4IOCF 3AG4H 5D8KB 2D5VA 2M45A 2QLZA 1R5GA 3HJEA 1DQUA 4HX8A 5CVUA 3DCFA 1QU3A 1OISA 2AXLA 1QQIA 2VOPA 2O0YA 3Q0WA 2VN2A 1KU7A 4IJAA 2XSDC 4H0EA 1MMNA 5TRDA 3OR1C 1LFBA 2EINH 5DM6F 3A1YA 2KP6A 4A69C 5HDNA 4E7JA 5DCMA 1QHGA 2R7TA 2OF7A 3CTAA 2XPVA 3ZCOA 3EUHA 2DA5A 3LMMA 3I56I 1UELB 2Z99A 2IRFG 2ZNZA 2IS1A 1BW6A 1X2MA 4AVPA 1P6RA 1FBSA 3ABLH 2RAEA 1D8KA 3D5SC 4E70A 4EJWA 3IH2A 4N4NB 3RKXA 3TGNA 3WG7H 3W2WA 1B72B 4A3LJ 2I10A 1EH6A 4HLYA 3OSFA 1IN7A 4A0ZA 2MBFA 2DCEA 3HIFA 2WAEA 3F8MA 5GP9A 3ZQIA 4UV8A 1OR7C 4GYGA 1JT6A 3CUQA 5B1AH 2TCTA 4NC6A 4MO7A 2XC7A 1ZTRA 1MD0A 2FX0A 3GFJA 3K1NA 4HDUA 2PFBA 5DM7F 3OIPA 3JRAA 1ZGJA 4HBLA 1OYYA 5AONA 2JQ7A 3PL8A 2PG4A 2G9WA 1GVJA 3CF2A 2E1OA 2WY7Q 4IRHA 4PK4A 2P5LC 2X0LA 5CPRB 4BHBA 4E7SA 3LSJA 2HXOA 4EM0B 4GCVA 2F5EA 1U8RA 1IAWA 3CMAI 4Y52J 2E71A 2HI3A 5DD4A 1ZK8A 4C9YA 2JK3A 3OWTA 3TBIA 4LITA 2WA0A 2P4WA 5KHDA 4D5FA 4G6QA 1ZG1A 1ONVA 3LSMA 3WU2C 4YG2F 5HLTA 5HS9A 1ENHA 4KFCA 2IGKA 5C44J 1LJ9A 2LSOA 3C3WA 3Q0VA 2CW0F 2E60A 2PQ8A 3HOXJ 1JJ8C 5B3SH 2CRGA 2MD5A 2MA3A 1D5YA 2LOOA 2JA8J 1XN7A 3ABTA 4DZPA 4EM1A 2QKLB 2V1DA 2OQGA 1USSA 5IP6A 1VF9A 4UUTA 4ZYDA 2OC6A 1BN5A 5EZHA 3DXJF 5ILSA 2Y75A 4YIIA 1SFEA 4E7IA 4G6TB 1FBQA 1FJLA 3OMYA 2L4MA 5J1RA 3F0CA 4HRIA 4ZJZA 3DTEA 4ZZDA 3QPLA 2OZUA 3O2PE 1IG7A 1PDNC 4RB1A 2DYRH 3BTJA 3G2BA 2DMUA 3TKYA 1YQAA 3Q9VA 3F72A 5J8CA 1Z6TA 4ENMA 2I5UA 4A6DA 3K4BA 3WTUC 1F43A 5JVGF 4NC8A 1D0XA 3SDGA 1FSHA 1WH5A 1Y1VJ 4BXFA 4DOZA 2XHKA 1KQ9A 2KDZA 1W5CC 1KONA 2ETHA 2L5QA 1NG6A 4UY8I 1MJAA 3M8EA 4HG2A 1BIAA 4D1QA 3D5LA 5FLMJ 3OIQA 4AU7A 3HOSA 1ZRFA 2ZMEA 1POGA 3OYKA 4JX4A 4BQOA 1WWXA 5L3GA 4CDGA 1OCPA 2EH3A 2DA3A 2RC4A 2R7UA 3TP3A 1AA7A 3VOEA 4BKXA 2B0LA 1G6NA 1LB2A 5E3NA 1I1GA 3V8KA 4XKWA 2L2OA 1TP4A 3J7AO 5CVVA 3JAMK 3BTLA 1AHDP 5HDGA 2GWRA 3G1MA 4FASD 2VXDA 3PNTA 4L9NA 1HDDC 2XGDA 1DGRM 2BHZA 1IV6A 2VJ4A 1FOXA 2CQXA 5TGTA 4D9JA 1S5LC 1JGSA 1QVTA 2QEXI 3V7SA 1LE8A 5TISC 4E4HA 2LKPA 2KQRA 2Y0MA 2YR2A 3KZYA 2YSRA 2JA7J 2A5YB 2QGUA 2TDXA 3F8FA 4ZTJA 1MSEC 5EG0B 2E5NA 3CMYA 1FP2A 2EZHA 4MGRA 3LSPA 3HOYJ 2D2WA 4BACA 2KZVA 4A3FJ 3S1QJ 2R5YA 2DA2A 2K9NA 2JA5J 2KRFA 3QPSA 2M9HA 3P9IA 4O6JA 5M3MJ 1YJ9I 1XSXA 1A36A 4F55A 1HW5A 4RB3C 1Z9CA 4GDFA 3L09A 3ZQHA 2NVXJ 3HOVJ 4KA4A 1WJ5A 2QQ8A 3K4LA 1LPQA 1UZCA 4RM2A 4Q48A 5FKOA 2ZNYA 1FT9A 3DTKA 1R23A 4MQ9F 3S15J 2XKPA 2BY1A 1BW5A 3AG2H 1JE8A 2FJ1A 5FROA 3DPLC 3M4OJ 2K86A 2L9VA 2COMA 5TJJA 1F4KA 1ETXA 4OU0A 4AYBN 3WTXC 3CP2A 1G3SA 4I0AA 1DGWY 4DBQA 3V7CA 1K78B 1KQ8A 1Z77A 4UUSB 3TOAA 2JRMA 1TNSA 4CYDA 1J5YA 1G4DA 1MH4A 2W00A 5D8LB 2L3DA 3S1MJ 1TT5B 2QZ8A 4BE2A 5GTIC 3EUHC 3ZQ7A 1EV7A 4QLCU 1B8IA 1BR4A 4IX7A 4RA2A 3QRFF 2WB1N 1O3SA 1J7KA 2PN6A 4ETSA 1VQ4I 4P1WA 2HPIA 2DA1A 3NWSA 1IRXA 1A04A 4XBFA 4B1RA 2DAOA 3K1PA 3KLOA 3MQ0A 3ZXSA 2PMZN 3I53A 3OYIA 3HTUA 3MCZA 5C4XJ 5FGMA 3IH3A 2R3SA 3KP3A 2E1MB 1XCBA 2ZSHB 4BAYA 3GLLA 2JMWA 2ISYA 2O8XA 2QUFA 5HNHA 2VT3A 1E3OC 3ZN0A 1R1VA 2JTVA 3RKWA 1MDMA 3F22A 1GLNA 3HTSB 1OCZH 1R00A 2ECBA 2JUCA 3FKJA 1OFCX 3M8FA 1P7JA 2NAZA 1K6OA 4L5JA 1IW7F 3TQNA 4MHGA 1JTYA 1KGSA 3PQJA 3V42A 2LH9A 2BOLA 4A12A 4XNFA 5E3MA 3T1BA 3DEUA 2VBWA 1KYZA 5EZGA 4BHPA 4XONA 3QOEA 3GWZA 2QCOA 2EIJH 3CCRI 1MW7A 1T0FA 2VI6A 5J3LA 1I6HJ 3FMQA 3WE3A 3AAFA 4LG3A 1Z1DA 2M4KA 2OJED 1YJNI 5K5OA 2Q0OA 1KU9A 3H3ZA 4CZCA 4A6EA 3P9KA 2GZWA 3S3OA 4RB0A 1BJAA 2HFHA 3J80Z 1V55H 2FOWA 2ELKA 5FFXA 1ZR4A 1U3EM 3K69A 2X6WA 2BW3A 2X6OA 3CC7I 1FSEA 2VPLA 2P81A 5LBQA 2FD5A 2NVYJ 3I4PA 4LIVA 2W48A 1SMTA 3TW7A 3MWMA 4F92B 2LY2A 2V9VA 3ASOH 3TO7A 4Y13A 3S2DJ 3M9AA 4ZYGA 3EDPA 1U2WA 2CG4A 3KP6A 2VJJA 3DKXA 3T0YA 3GUDA 2K85A 1MDMB 5KNLA 1LVKA 2IW5A 5IYBJ 4U7DA 3GF2A 3I55I 1IGNA 3RQ4A 3ZN1A 1A6QA 3H5NA 2R7SA 4DYRA 1EJ9A 2M2EA 3ESWB 5A2QK 3S3NA 2BY3A 3UKGA 3RZOJ 3RYPA 3LAPA 2KDOA 4RAFA 2DMTA 2AQEA 2IS6A 2FBHA 1HKTA 2DA6A 1Z67A 3B6AA 5JR3A 3L1PA 1HBXG 3RPQA 2P7VB 3ONQA 1K7AA 1HA8A 2CYYA 3X2QH 3BJOA 1X19A 3IKTA 1I3QJ 3OOUA 1L3LA 4BHCA 2KMUA 4S05A 1X2NA 1LFUP 1WI9A 2LK2A 3FM5A 1K78A 4B48A 3K1MA 2XAUA 2HDWA 2CFXA 4ZYEA 3CCQI 2R7ZJ 3CCVI 2GA2A 1XGNA 4I6ZA 2ME0A 1SMYF 4RLQA 3KYDB 2E36A 2FBIA 5EEHA 3PO3J 2BY2A 4CXFA 1FBUA 4LG0B 3WTTC 5HS8A 1TWGJ 2RREA 1GV2A 5BPDA 3WHBA 1LEBA 4Y33A 4Y4RA 1IRZA 2YX7A 2PI0A 1H9GA 2LKSA 1Y8QB 4NBQA 2VUMJ 3FK7A 1KU3A 2LNBA 2PJPA 2NNYA 2F48A 1YW9A 1XSDA 2HOAA 2Y9ZA 3CCYA 2VXZA
chains in the Genus database with same CATH topology
1HDPA 1GT0C 4IHVA 2YUSA 1HOMA 4QIWN 5M5YJ 1VFCA 4XK4A 4EEFG 1ZR2A 2IEKA 5K7FA 3O8HA 3BTIA 3SFIA 4X6AJ 1JGGA 4JYKA 1NK3P 1MBFA 5IYCJ 4M3GA 1GDTA 5K7HA 3LSRA 3FK6A 3I4NJ 2VPRA 2XGEA 2R93J 2AO9A 1RKWA 3I4MJ 3MVPA 4NDLA 3BG9A 1WI3A 2ECCA 1BL0A 3HEFA 2HXIA 3Q3SA 2DA4A 4M3BA 4IHWA 1P7IA 2DMPA 3BT9A 2DMQA 5J1YA 1YRNA 1RETA 2COBA 4FE7A 5EEAA 1R9TJ 1EF4A 3JRBA 5FLVA 2JA6J 3JRGA 4V2GA 4JX5A 2D5VA 2WV1A 1UG2A 2Y30A 3S1NJ 3DCFA 3ZQGA 1NK2P 4JP0A 3JREA 3RZDJ 2ID6A 3IV5A 5GPAA 1ETQA 3Q0WA 1VNDA 1TWHJ 2XSDC 2NS8A 2NVTJ 3GTOJ 2B63J 1LFBA 4FTHA 4ABZA 4A69C 3W6VA 5F08A 2CUEA 3BQYA 2OF7A 2XPVA 4W1UA 2DA5A 1MBJA 1TWCJ 1XS9A 1MSFC 1G2HA 1BW6A 4A3CJ 1X2MA 1QPIA 2RAEA 1OJLA 4XRMA 3BR0A 3IH2A 1PUFB 1T33A 3H0GJ 1B72B 4A3LJ 4MIMA 2I10A 3OSFA 3RKQA 3Q0UA 5GP9A 3ZQIA 1JKPC 3HDDA 4C3HJ 2L9RA 1JT6A 5DS9A 2K9QA 2TCTA 2MGQA 3HGYA 4MO7A 1VI0A 1Y1WJ 3BR1A 1ZTRA 3MN2A 2FX0A 3JRAA 5IYDJ 2E2IJ 1H89C 2ME6A 2E1OA 3C2BA 3E7LA 2L7FP 2X48A 3SJMA 2DTZA 2LR8A 3GBGA 3LSJA 5IP9J 2HXOA 1ETOA 3A02A 3LSGA 4DYQA 1ETYA 5E3OA 4Y52J 1MNMC 1GUUA 4D7NA 2HI3A 1ZK8A 4D5CA 2E2HJ 2JK3A 1WGXA 4M3DA 1JT0A 5EGOA 3K2AA 1B8IB 1DU6A 1IDZA 3GTGJ 2GM4A 4D5FA 1UMQA 3A01B 2XB0X 5EYRA 2LTPA 1JUMA 5F0HA 1ENHA 3OSGA 5EDNA 1HF0A 5C44J 3Q0VA 1JJ8C 4M3EA 2DN0A 4XRSA 3HOXJ 1JKOC 2CRGA 4A3KJ 2LY9A 1D5YA 2R5ZA 2JA8J 4DZPA 4A3DJ 4AC0A 4BBRJ 5IP6A 1VF9A 4UUTA 4GFBA 2EBIA 1FEXA 5EZHA 1BA5A 4RDUA 1AU7A 3GTQJ 2LD5A 1AKHB 3GTKJ 1IC8A 5F1JA 1FJLA 4CYCA 4XIDA 5J1RA 3F0CA 4M3FA 1O4XA 3HGGA 4C3JJ 3QPLA 1IG7A 3BTJA 2DMUA 5M5WJ 2R0QC 1F43A 1ETVA 1HCRA 3SDGA 1TWFJ 3HBLA 1AKHA 1WH5A 1Y1VJ 4Y7NJ 2MSYA 3JRHA 2KDZA 2NVQJ 3TP0A 4A3MJ 1WPKA 5EG0A 4IHXA 4BXXJ 3NARA 3QQAA 5FLMJ 4XRSG 1IJWC 1FIPA 3HB9A 1POGA 5IOYA 4JX4A 3HOZJ 3B6CA 1OCPA 3TEDA 1LE8B 1TC3C 5M5XJ 2VKVA 2EH3A 2DA3A 2Y2ZA 3TP3A 5FKLA 3ZQLA 4MLOA 4BKXA 1QRYA 3LNQA 4DZJA 4A3GJ 2HYJA 5E3NA 5E3LA 2R92J 4J19A 3VPRA 1JKQC 5GPCA 3BTLA 1AHDP 3G1MA 3H3VK 1A6IA 2L7MP 1HDDC 2XGDA 1IV6A 4C3IJ 3BG5A 1OCTC 2CQXA 2YS9A 1QVTA 4C2MJ 2HOSA 4MFDA 1LE8A 1JUPA 2GLOA 2HOTA 4A93J 2XPUA 1S7EA 3MKLA 5DTDA 4A3IJ 5FJ8J 1H88C 4IHYA 1XG1A 2JA7J 3FISA 5C4JJ 3GTLJ 1MSEC 5EG0B 4FE4A 3CMYA 1W0TA 1PUFA 2EZHA 2EZIA 4FISA 1U78A 2ID3A 3LSPA 3HOYJ 3S17J 4AUXA 4A3FJ 2EZLA 3S1QJ 2R5YA 2DA2A 2K9NA 9ANTA 1JTXA 4HNVA 2JA5J 3QPSA 2M9HA 1WH7A 3JR9A 1SFOJ 2CUFA 5IPAA 5M3MJ 4IEJA 1HLVA 1IDYA 2E2JJ 2DJNA 4XICA 3ZQHA 2NVXJ 3HOVJ 5F0FA 2CQQA 1T56A 3TW6A 2KT0A 2YU9J 1MH3A 5FKOA 3PM1A 2GBYA 1GVDA 1X58A 1K61A 3S15J 2XGCA 2AHQA 1BW5A 5JLWA 3FKIJ 4A3BJ 2FJ1A 3M4OJ 3A03A 1ETXA 4AYBN 5K7ZA 3FIWA 2IAIA 3BR5A 5IOZA 2LKXA 5EGOB 3S16J 2X9DA 1Z77A 4UUSB 4FCYA 2MW8A 4V2FA 3M3YJ 4BBSJ 1JJ6C 3PO2J 4QTRA 3HKZN 1MH4A 1FTZA 1QVUA 3S1MJ 3GTPJ 1B8IA 2R5YB 2LVSA 1IUFA 1A5JA 3RQIA 2WB1N 5IP7J 2H8RA 2VKEA 2DA1A 3LOCA 3GTJJ 4DYCA 2XRLA 4B1RA 4W97A 1RKTA 5F27A 5FKMA 2IBDA 2PMZN 4QSHA 3HOUJ 4I76A 5C4XJ 3IH3A 1ETKA 4LOCA 1U8BA 5BNGA 3ZQFA 2JMWA 3HOWJ 1E3OC 4L5EA 3CDLA 5JLXA 1FTTA 1RPWA 2ECBA 4UUSA 3JRFA 2DA7A 3ZOBA 1OFCX 2M8GX 3JRIA 1P7JA 1RR7A 3DEWA 1JTYA 5M3FJ 2NOGA 4JX6A 2NS7A 3S14J 4M6VA 2ZB9A 1B72A 5J1UA 1BJZA 5E3MA 1W0UA 4BY1J 1WCMJ 1FIAA 2G0EA 5HODA 5EZGA 1NTCA 2QCOA 3OIOA 2O7OA 3D1NI 2VI6A 1I6HJ 5J3LA 3BR3A 1APLC 1DU0A 1U9OA 2M34A 3JRDA 2L7ZA 1Z0XA 2HDDA 1ORKA 3ZQCA 2ELKA 1ZR4A 2EQRA 3WHCA 2LFBA 4B4CA 2E19A 2X6OA 2P81A 1ITYA 2FD5A 2NVYJ 2XPWA 1Q1VA 2FQ4A 2W48A 3TW7A 4CYCB 1U9NA 2CU7A 2XB5A 5F0CA 3S2DJ 3IH4A 2Y9YA 2K9SA 3BR2A 3S1RJ 3CQZJ 1TWAJ 4RBOA 5IYBJ 3JRCA 2MG4A 5C3EJ 1IGNA 2QF7A 4MFEA 2JN6A 4A3JJ 1MBEA 4DYRA 2TRTA 2M2EA 3G1LA 1MBGA 3RZOJ 3UKGA 2OPTA 2N8GA 2L0KA 1ETWA 2DMTA 4G12A 4DW6A 2JJ7A 3GTMJ 2DA6A 3B6AA 5F04A 5FKKA 1I50J 1MBKA 3L1PA 2JWTA 4D7MA 3BTCA 2R5ZB 3G1OA 2EZKA 1UHSA 1SANA 2H1KA 3BG3A 1H8AC 1I3QJ 3OOUA 1RESA 5EF6A 1X2NA 5FKNA 1LFUP 2LK2A 3A01A 1XC5A 1F36A 3S2HJ 1ZGWA 2R7ZJ 2WAQN 3K7AJ 2O9LA 3NAUA 2Y31A 4I6ZA 2ME0A 1CQTA 2CJJA 2LP0A 1JUSA 3PO3J 1ZKGA 1K83J 1YRNB 2DMNA 1TWGJ 2O8KA 1GV2A 2HQ5A 3WHBA 4A3EJ 2Y0SN 1IRZA 2M0CA 3O8GA 1JKRC 4BY7J 3HM5A 3BQZA 4X1EA 4B3AA 1GV5A 4S0HB 2VUMJ 3FK7A 2K40A 3BR6A 2LLKA 1MBHA 2HOAA 2Y9ZA 1ZQ3P 3CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDP A;  1GT0 C;  4IHV A;  2YUS A;  1HOM A;  4QIW N;  5M5Y J;  1VFC A;  4XK4 A;  4EEF G;  1ZR2 A;  2IEK A;  5K7F A;  3O8H A;  3BTI A;  3SFI A;  4X6A J;  1JGG A;  4JYK A;  1NK3 P;  1MBF A;  5IYC J;  4M3G A;  1GDT A;  5K7H A;  3LSR A;  3FK6 A;  3I4N J;  2VPR A;  2XGE A;  2R93 J;  2AO9 A;  1RKW A;  3I4M J;  3MVP A;  4NDL A;  3BG9 A;  1WI3 A;  2ECC A;  1BL0 A;  3HEF A;  2HXI A;  3Q3S A;  2DA4 A;  4M3B A;  4IHW A;  1P7I A;  2DMP A;  3BT9 A;  2DMQ A;  5J1Y A;  1YRN A;  1RET A;  2COB A;  4FE7 A;  5EEA A;  1R9T J;  1EF4 A;  3JRB A;  5FLV A;  2JA6 J;  3JRG A;  4V2G A;  4JX5 A;  2D5V A;  2WV1 A;  1UG2 A;  2Y30 A;  3S1N J;  3DCF A;  3ZQG A;  1NK2 P;  4JP0 A;  3JRE A;  3RZD J;  2ID6 A;  3IV5 A;  5GPA A;  1ETQ A;  3Q0W A;  1VND A;  1TWH J;  2XSD C;  2NS8 A;  2NVT J;  3GTO J;  2B63 J;  1LFB A;  4FTH A;  4ABZ A;  4A69 C;  3W6V A;  5F08 A;  2CUE A;  3BQY A;  2OF7 A;  2XPV A;  4W1U A;  2DA5 A;  1MBJ A;  1TWC J;  1XS9 A;  1MSF C;  1G2H A;  1BW6 A;  4A3C J;  1X2M A;  1QPI A;  2RAE A;  1OJL A;  4XRM A;  3BR0 A;  3IH2 A;  1PUF B;  1T33 A;  3H0G J;  1B72 B;  4A3L J;  4MIM A;  2I10 A;  3OSF A;  3RKQ A;  3Q0U A;  5GP9 A;  3ZQI A;  1JKP C;  3HDD A;  4C3H J;  2L9R A;  1JT6 A;  5DS9 A;  2K9Q A;  2TCT A;  2MGQ A;  3HGY A;  4MO7 A;  1VI0 A;  1Y1W J;  3BR1 A;  1ZTR A;  3MN2 A;  2FX0 A;  3JRA A;  5IYD J;  2E2I J;  1H89 C;  2ME6 A;  2E1O A;  3C2B A;  3E7L A;  2L7F P;  2X48 A;  3SJM A;  2DTZ A;  2LR8 A;  3GBG A;  3LSJ A;  5IP9 J;  2HXO A;  1ETO A;  3A02 A;  3LSG A;  4DYQ A;  1ETY A;  5E3O A;  4Y52 J;  1MNM C;  1GUU A;  4D7N A;  2HI3 A;  1ZK8 A;  4D5C A;  2E2H J;  2JK3 A;  1WGX A;  4M3D A;  1JT0 A;  5EGO A;  3K2A A;  1B8I B;  1DU6 A;  1IDZ A;  3GTG J;  2GM4 A;  4D5F A;  1UMQ A;  3A01 B;  2XB0 X;  5EYR A;  2LTP A;  1JUM A;  5F0H A;  1ENH A;  3OSG A;  5EDN A;  1HF0 A;  5C44 J;  3Q0V A;  1JJ8 C;  4M3E A;  2DN0 A;  4XRS A;  3HOX J;  1JKO C;  2CRG A;  4A3K J;  2LY9 A;  1D5Y A;  2R5Z A;  2JA8 J;  4DZP A;  4A3D J;  4AC0 A;  4BBR J;  5IP6 A;  1VF9 A;  4UUT A;  4GFB A;  2EBI A;  1FEX A;  5EZH A;  1BA5 A;  4RDU A;  1AU7 A;  3GTQ J;  2LD5 A;  1AKH B;  3GTK J;  1IC8 A;  5F1J A;  1FJL A;  4CYC A;  4XID A;  5J1R A;  3F0C A;  4M3F A;  1O4X A;  3HGG A;  4C3J J;  3QPL A;  1IG7 A;  3BTJ A;  2DMU A;  5M5W J;  2R0Q C;  1F43 A;  1ETV A;  1HCR A;  3SDG A;  1TWF J;  3HBL A;  1AKH A;  1WH5 A;  1Y1V J;  4Y7N J;  2MSY A;  3JRH A;  2KDZ A;  2NVQ J;  3TP0 A;  4A3M J;  1WPK A;  5EG0 A;  4IHX A;  4BXX J;  3NAR A;  3QQA A;  5FLM J;  4XRS G;  1IJW C;  1FIP A;  3HB9 A;  1POG A;  5IOY A;  4JX4 A;  3HOZ J;  3B6C A;  1OCP A;  3TED A;  1LE8 B;  1TC3 C;  5M5X J;  2VKV A;  2EH3 A;  2DA3 A;  2Y2Z A;  3TP3 A;  5FKL A;  3ZQL A;  4MLO A;  4BKX A;  1QRY A;  3LNQ A;  4DZJ A;  4A3G J;  2HYJ A;  5E3N A;  5E3L A;  2R92 J;  4J19 A;  3VPR A;  1JKQ C;  5GPC A;  3BTL A;  1AHD P;  3G1M A;  3H3V K;  1A6I A;  2L7M P;  1HDD C;  2XGD A;  1IV6 A;  4C3I J;  3BG5 A;  1OCT C;  2CQX A;  2YS9 A;  1QVT A;  4C2M J;  2HOS A;  4MFD A;  1LE8 A;  1JUP A;  2GLO A;  2HOT A;  4A93 J;  2XPU A;  1S7E A;  3MKL A;  5DTD A;  4A3I J;  5FJ8 J;  1H88 C;  4IHY A;  1XG1 A;  2JA7 J;  3FIS A;  5C4J J;  3GTL J;  1MSE C;  5EG0 B;  4FE4 A;  3CMY A;  1W0T A;  1PUF A;  2EZH A;  2EZI A;  4FIS A;  1U78 A;  2ID3 A;  3LSP A;  3HOY J;  3S17 J;  4AUX A;  4A3F J;  2EZL A;  3S1Q J;  2R5Y A;  2DA2 A;  2K9N A;  9ANT A;  1JTX A;  4HNV A;  2JA5 J;  3QPS A;  2M9H A;  1WH7 A;  3JR9 A;  1SFO J;  2CUF A;  5IPA A;  5M3M J;  4IEJ A;  1HLV A;  1IDY A;  2E2J J;  2DJN A;  4XIC A;  3ZQH A;  2NVX J;  3HOV J;  5F0F A;  2CQQ A;  1T56 A;  3TW6 A;  2KT0 A;  2YU9 J;  1MH3 A;  5FKO A;  3PM1 A;  2GBY A;  1GVD A;  1X58 A;  1K61 A;  3S15 J;  2XGC A;  2AHQ A;  1BW5 A;  5JLW A;  3FKI J;  4A3B J;  2FJ1 A;  3M4O J;  3A03 A;  1ETX A;  4AYB N;  5K7Z A;  3FIW A;  2IAI A;  3BR5 A;  5IOZ A;  2LKX A;  5EGO B;  3S16 J;  2X9D A;  1Z77 A;  4UUS B;  4FCY A;  2MW8 A;  4V2F A;  3M3Y J;  4BBS J;  1JJ6 C;  3PO2 J;  4QTR A;  3HKZ N;  1MH4 A;  1FTZ A;  1QVU A;  3S1M J;  3GTP J;  1B8I A;  2R5Y B;  2LVS A;  1IUF A;  1A5J A;  3RQI A;  2WB1 N;  5IP7 J;  2H8R A;  2VKE A;  2DA1 A;  3LOC A;  3GTJ J;  4DYC A;  2XRL A;  4B1R A;  4W97 A;  1RKT A;  5F27 A;  5FKM A;  2IBD A;  2PMZ N;  4QSH A;  3HOU J;  4I76 A;  5C4X J;  3IH3 A;  1ETK A;  4LOC A;  1U8B A;  5BNG A;  3ZQF A;  2JMW A;  3HOW J;  1E3O C;  4L5E A;  3CDL A;  5JLX A;  1FTT A;  1RPW A;  2ECB A;  4UUS A;  3JRF A;  2DA7 A;  3ZOB A;  1OFC X;  2M8G X;  3JRI A;  1P7J A;  1RR7 A;  3DEW A;  1JTY A;  5M3F J;  2NOG A;  4JX6 A;  2NS7 A;  3S14 J;  4M6V A;  2ZB9 A;  1B72 A;  5J1U A;  1BJZ A;  5E3M A;  1W0U A;  4BY1 J;  1WCM J;  1FIA A;  2G0E A;  5HOD A;  5EZG A;  1NTC A;  2QCO A;  3OIO A;  2O7O A;  3D1N I;  2VI6 A;  1I6H J;  5J3L A;  3BR3 A;  1APL C;  1DU0 A;  1U9O A;  2M34 A;  3JRD A;  2L7Z A;  1Z0X A;  2HDD A;  1ORK A;  3ZQC A;  2ELK A;  1ZR4 A;  2EQR A;  3WHC A;  2LFB A;  4B4C A;  2E19 A;  2X6O A;  2P81 A;  1ITY A;  2FD5 A;  2NVY J;  2XPW A;  1Q1V A;  2FQ4 A;  2W48 A;  3TW7 A;  4CYC B;  1U9N A;  2CU7 A;  2XB5 A;  5F0C A;  3S2D J;  3IH4 A;  2Y9Y A;  2K9S A;  3BR2 A;  3S1R J;  3CQZ J;  1TWA J;  4RBO A;  5IYB J;  3JRC A;  2MG4 A;  5C3E J;  1IGN A;  2QF7 A;  4MFE A;  2JN6 A;  4A3J J;  1MBE A;  4DYR A;  2TRT A;  2M2E A;  3G1L A;  1MBG A;  3RZO J;  3UKG A;  2OPT A;  2N8G A;  2L0K A;  1ETW A;  2DMT A;  4G12 A;  4DW6 A;  2JJ7 A;  3GTM J;  2DA6 A;  3B6A A;  5F04 A;  5FKK A;  1I50 J;  1MBK A;  3L1P A;  2JWT A;  4D7M A;  3BTC A;  2R5Z B;  3G1O A;  2EZK A;  1UHS A;  1SAN A;  2H1K A;  3BG3 A;  1H8A C;  1I3Q J;  3OOU A;  1RES A;  5EF6 A;  1X2N A;  5FKN A;  1LFU P;  2LK2 A;  3A01 A;  1XC5 A;  1F36 A;  3S2H J;  1ZGW A;  2R7Z J;  2WAQ N;  3K7A J;  2O9L A;  3NAU A;  2Y31 A;  4I6Z A;  2ME0 A;  1CQT A;  2CJJ A;  2LP0 A;  1JUS A;  3PO3 J;  1ZKG A;  1K83 J;  1YRN B;  2DMN A;  1TWG J;  2O8K A;  1GV2 A;  2HQ5 A;  3WHB A;  4A3E J;  2Y0S N;  1IRZ A;  2M0C A;  3O8G A;  1JKR C;  4BY7 J;  3HM5 A;  3BQZ A;  4X1E A;  4B3A A;  1GV5 A;  4S0H B;  2VUM J;  3FK7 A;  2K40 A;  3BR6 A;  2LLK A;  1MBH A;  2HOA A;  2Y9Z A;  1ZQ3 P;  3CCY A; 
#chains in the Genus database with same CATH topology
 3V8J A;  4WXD A;  3I5U A;  2CQN A;  4BXU A;  2FRH A;  1WZ2 A;  4XK4 A;  4EEF G;  1B9M A;  4BE0 A;  1RNL A;  3ABK H;  2WB1 A;  5CJ9 A;  3O8H A;  2IPQ X;  3SFI A;  1MND A;  3GFL A;  5LGU A;  1VQM I;  4X6A J;  2DOD A;  1HW1 A;  3KP5 A;  4JYK A;  2DPU A;  2KRC A;  3OYE A;  1VQ5 I;  1OCC H;  5LRS A;  1WJE A;  2L01 A;  2HWV A;  1KZH A;  1KA8 A;  3U1K A;  2Y0S A;  2OA4 A;  3DU5 A;  3WGH A;  4AVZ A;  2EIM H;  1O57 A;  3NWT A;  3QWL A;  4BJT A;  2ECC A;  2HXI A;  4CSW A;  4DIQ A;  3VEP A;  4L9V A;  4IHW A;  1MNE A;  1P7I A;  2DMQ A;  3LA7 A;  3DF8 A;  2COB A;  3QYE A;  5CKT A;  3IL2 A;  4XLH A;  4WF2 A;  2VQL A;  4JX5 A;  2RQQ A;  2WV1 A;  4KYW A;  1YS6 A;  3I64 A;  4XM3 A;  3OYM A;  4G7Z F;  2Z9O A;  2WTE A;  2M5W A;  1XGM A;  4EJO A;  3JRE A;  2IP2 A;  1FNN A;  1S7A A;  5GPA A;  1R58 A;  2H09 A;  1ETQ A;  3MKZ A;  1SVM A;  3I59 B;  3SXY A;  1MMA A;  1VND A;  4DBR A;  3ECH A;  2JRT A;  1S72 I;  1TWH J;  1J75 A;  1SVL A;  2Q2E B;  1U5T A;  2FML A;  2KJC A;  4S04 A;  3GZN B;  4JQF A;  4IHS A;  2Y48 A;  3C2G A;  2GAU A;  2LBF B;  4FTH A;  2NNN A;  1BBY A;  3CES A;  2RN7 A;  2QA4 I;  4WWC A;  3OS2 A;  2K4B A;  2CUE A;  3RJP A;  5FLX Z;  3CME I;  5HDK A;  2F5F A;  1TWC J;  1XS9 A;  1MSF C;  5BS6 A;  4KN7 X;  1FPQ A;  5CVI A;  3K6G A;  4CCO A;  5GTH C;  3VB2 A;  1ACI A;  4A3C J;  1V4R A;  3BP8 A;  3IWZ A;  4OIO F;  2UWM A;  5JHF A;  3BR0 A;  1PUF B;  1T33 A;  3H0G J;  1DUX C;  2DO7 A;  4KIB A;  4MIM A;  3AKZ A;  1BR1 A;  3WG9 A;  2EIL H;  1IRG A;  1ZG3 A;  3Q0U A;  2HOE A;  1IZ1 A;  4II3 A;  1JKP C;  3L2W A;  4L9T A;  2KL4 A;  5AIP A;  4C3H J;  2L9R A;  2M1B A;  2K9Q A;  5DS9 A;  2MGQ A;  3SEZ A;  1VI0 A;  1FZP B;  3BR1 A;  4A5N A;  4NC7 A;  5GAD J;  3MAJ A;  2XUB A;  3F9K A;  2NS0 A;  1ON2 A;  4YEJ A;  5J47 A;  1K79 A;  1LKX A;  4IPA A;  1OQY A;  3DFG A;  4HNU A;  3C2B A;  3E7L A;  3OL4 A;  3JW4 A;  5D4R A;  2X48 A;  3SJM A;  2DTZ A;  4FX4 A;  2LR8 A;  2BGC A;  1J2X A;  2A69 F;  4UXN A;  2QQ9 A;  3RPU D;  1R7J A;  2DFH A;  4LG0 A;  4DYQ A;  2V6C A;  2HTS A;  5E3O A;  1RUN A;  4HNT A;  1GUU A;  1MNM C;  3OYD A;  4D5C A;  1B59 A;  3D0S A;  3I71 A;  1WGX A;  2BVL A;  1JT0 A;  5EGO A;  1B8I B;  2UXN A;  3GEZ A;  2RV8 A;  3CC4 I;  4M6X A;  4BYY A;  2FA5 A;  1IXR C;  3S3M A;  2E7X A;  3FF5 A;  5F0H A;  1G3W A;  5E20 A;  2STW A;  5EDN A;  1HF0 A;  3HC7 A;  3HOT A;  3ABU A;  3CO6 C;  4M3E A;  2DN0 A;  4XRS A;  4A3K J;  2LY9 A;  5BPI A;  4ENN A;  1UG0 A;  1Z91 A;  4AC0 A;  2QBY A;  4GFB A;  2IA0 A;  2CH0 A;  1BA5 A;  1W5S A;  2Z16 A;  4CO8 A;  2ACJ A;  3E5Q A;  2OUM A;  4K2E A;  2DYS H;  3TL4 X;  1X3W B;  4L9J A;  4CYC A;  3QAH A;  2XSJ C;  2FMY A;  2CUZ A;  4HW0 A;  2M7A A;  5ILV A;  1MMG A;  4LMY A;  2KIQ A;  3HZJ A;  3MKW B;  5LD2 C;  4Z2Y A;  3BWG A;  3K70 C;  2CGP A;  2M3A A;  1ETV A;  2XIG A;  4QPO A;  2UZK A;  2PJR B;  4RB2 C;  3HPH A;  3CF5 F;  2XAJ A;  3Q9S A;  3HBL A;  1AKH A;  5EJC A;  2XAS A;  4Y7N J;  4V19 K;  2O03 A;  1V54 H;  3HSR A;  4BJ6 C;  3TP0 A;  1ZRC A;  4A3M J;  3VYS B;  1VQL I;  5EG0 A;  1R49 A;  4IHX A;  2RNG A;  1Z21 A;  2PMH A;  5DCM B;  2IGM A;  2DBB A;  4B44 A;  3KYL A;  3IRQ A;  1IJW C;  2Z3Y A;  3CCS I;  3BG6 A;  4ZYA A;  2GOX B;  3L7W A;  1FYM A;  3FBN B;  3B6C A;  4G9Y A;  1LE8 B;  3GFM A;  5DYM A;  4OIN F;  1X1C A;  3BY6 A;  1HC8 A;  1QHH D;  4XOP A;  3LNQ A;  3CUO A;  1WQ2 A;  4DZJ A;  3MZ8 A;  4A3G J;  2HYJ A;  1FYL A;  4YFN F;  2R92 J;  3QP5 A;  3VPR A;  1JKQ C;  3H3U A;  3JSP A;  2DFI A;  1Z3X A;  2CQK A;  3M1E A;  2NRA C;  1RIO H;  2DPD A;  4M72 A;  4ENK A;  1R36 A;  2DK5 A;  4AM3 A;  2XGX A;  5LHG A;  1IXC A;  4MFD A;  4OOI A;  1MMS A;  1VQN I;  2DLL A;  1BI0 A;  4E7Z A;  3IC7 A;  4I2O A;  3HG9 A;  5B5E C;  1OLT A;  2DFE A;  3OS0 A;  1S7E A;  4A3I J;  2EFN A;  4N0B A;  1V5E A;  5IT3 A;  1D8J A;  2DDA A;  3GTL J;  2LDU A;  3SYT A;  4ZDL A;  4FE4 A;  5BOX A;  1PUF A;  1U78 A;  4FIS A;  2CFO A;  4IHT A;  1J09 A;  3GLX A;  3S17 J;  4O5V A;  4CH7 A;  4C30 A;  2HR3 A;  1HXD A;  4G94 A;  9ANT A;  1JTX A;  1R22 A;  5K5R A;  1KU2 A;  3JR9 A;  1WH7 A;  3OYN A;  2E1N A;  1WJC A;  3FXM A;  4ANJ A;  4MEY F;  4ITV A;  4Y15 A;  2DJN A;  5LLQ A;  4XIC A;  2H94 A;  2QSG X;  3KCC A;  4RAG A;  2G7H A;  4XN3 A;  1T56 A;  2DQL A;  1L0O C;  1MH3 A;  4N4O B;  1X4O A;  4IKF A;  2GBY A;  1W4M A;  2BZT A;  1D1B A;  1K61 A;  2AHQ A;  1TW3 A;  5DUK A;  5JLW A;  4A3B J;  5CYV A;  1VQP I;  2L54 A;  1BOB A;  1FYK A;  3H5R A;  3EUK L;  3LA2 A;  3E6C C;  2NOJ B;  3I9V 2;  3WOD F;  1TQP A;  3FIW A;  2IAI A;  5E1X A;  2LKX A;  3BZ6 A;  3R4K A;  3TDU C;  2X9D A;  1Y6I A;  1FWZ A;  1F1Z A;  1QZZ A;  3CDI A;  3NEU A;  4V2F A;  4KIT B;  3DV8 A;  3HRU A;  3PO2 J;  1O3R A;  3WTS C;  3EET A;  1YS7 A;  3C2H A;  1QVU A;  1FTZ A;  1I27 A;  1F5T A;  2CO5 A;  4M9X A;  1MZB A;  3N4M A;  4I7H A;  3GTP J;  1DP3 A;  2EB7 A;  4GYI A;  2R5Y B;  1YTY A;  2LF8 A;  3K4N A;  4P5O A;  4I01 A;  2J5P A;  1HSJ A;  2MH9 A;  2FEZ A;  4HYE A;  2QSH X;  3GFI A;  1D1C A;  4DYC A;  4PZJ A;  2YPR A;  2R7O A;  2D1V A;  2JZY A;  4KMU X;  5F27 A;  1V3F A;  5FKM A;  3GZ6 A;  1LFP A;  1FY7 A;  4I76 A;  3ZMS A;  4BNC A;  2KIM A;  1U8B A;  2PLY A;  2QVO A;  3BJ6 A;  3FDY A;  1LDJ A;  1M1E B;  3L2R A;  3CD6 I;  5JLX A;  1FTT A;  1W1W E;  2ZKZ A;  3JRF A;  3BDD A;  3DTI A;  2AS5 F;  3DQV C;  3KP2 A;  3KEY A;  1C0W A;  3DEW A;  3A2K A;  3CCU I;  3AG1 H;  3K2Z A;  4HZF A;  1B72 A;  1J9I A;  1FIA A;  2G0E A;  1RR8 C;  1TW2 A;  4L0Y B;  1JHF A;  1ON1 A;  4LB6 B;  3D1N I;  2ZJR F;  3G3Z A;  1QPM A;  3H1C A;  4OIR F;  3FMS A;  1DU0 A;  1TLH B;  1U9O A;  4E7L A;  3W6J B;  2ZC2 A;  2MYS A;  1Z0X A;  4IQJ A;  1O3Q A;  3HHH A;  5HLI A;  1ORK A;  2HNH A;  3E6M A;  2O3F A;  2MC3 A;  3GXO A;  1YO5 C;  2BY0 A;  2LFB A;  1OCO H;  2IVM A;  1DP7 P;  3LQQ A;  2LY1 A;  1VZ0 A;  2W85 A;  2F5D A;  3ZPL A;  1CF7 A;  5AIQ A;  2W25 A;  1MKM A;  3AFH A;  4CCK A;  4BEH A;  1TNT A;  2K02 A;  3DLA A;  3H9G A;  1N25 A;  1FP1 D;  1OCR H;  3BR2 A;  3W3C A;  2XRO A;  4PGG A;  2DT6 A;  3VFZ A;  1AWC A;  3IAM 2;  3CQZ J;  1TWA J;  3ML6 A;  2IA1 A;  3WTY C;  3VOD A;  4RBO A;  3JRC A;  5ICE A;  1E3H A;  2QF7 A;  4MFE A;  1WJA A;  2JVH A;  4IF4 A;  5IT9 Z;  2TRT A;  4LB5 A;  1MBG A;  2OPT A;  2FF4 A;  3CLO A;  3CJQ B;  2HS5 A;  4DW6 A;  3HUG B;  3FBI B;  4X0G A;  1ZRD A;  4OIP F;  3GTM J;  4J00 A;  5E8I A;  5F04 A;  3IP4 B;  1YJW I;  1ZRE A;  5DD8 A;  1SC7 A;  3KET A;  2STT A;  3G1O A;  4P96 A;  3ZMU A;  1YFH A;  2JUG A;  2OD5 A;  1SAN A;  1OPC A;  3GZ5 A;  4EJV A;  2H1K A;  1EH7 A;  5DV5 A;  2W4S A;  2KIF A;  3R61 A;  5ED4 A;  5EF6 A;  5FKN A;  2ZXI A;  5CQE A;  2VT2 A;  3HSE A;  1PJR A;  2CV1 A;  3I54 A;  4HX4 A;  2O6G E;  4OAY A;  3NAU A;  1P9Q C;  3BC8 A;  2PMZ A;  2K5C A;  1NHA A;  4HAM A;  2DT5 A;  3CP8 A;  5HOO A;  2R7X A;  2Y0S N;  3QYF A;  1OYI A;  3G4S I;  4PFP A;  3O8G A;  1JKR C;  4BY7 J;  2F4O B;  2L9S A;  2PJR A;  2VC0 A;  1SEU A;  1YOV B;  3HM5 A;  3TOB A;  4U0Y A;  1UAA A;  4KIS A;  2IT0 A;  4QPQ A;  3LFK A;  3H35 A;  4WXC A;  3KP7 A;  5GAE J;  2YU3 A;  2GIV A;  2KIS A;  2HQN A;  1V5G A;  3QYB A;  4OIQ F;  4PJN A;  1GT0 C;  3K4J A;  3PNV A;  3L2U A;  2YUS A;  4IHV A;  1HOM A;  4UB6 C;  2KHM A;  5M5Y J;  3QU6 A;  1VFC A;  4TV7 A;  4F7Z A;  2IEK A;  5LGT A;  1QZE A;  3N05 A;  2R7V A;  4R8H A;  1LDD A;  1XDS A;  1ZYR F;  1MIJ A;  2LYC A;  2FQ3 A;  3E5U A;  5K7H A;  4AWX B;  2ISZ A;  3CC2 I;  4KUM A;  3L9F A;  3I4N J;  3DKY A;  2L02 A;  2AO9 A;  2O61 A;  3CCM I;  1RKW A;  1V5F A;  2XV4 S;  3SDB A;  4N9H A;  3DWL E;  4UB8 C;  3EYI A;  4NDL A;  1R4M B;  3BG9 A;  3HEF A;  1IN8 A;  1DDN A;  2DA4 A;  4M3B A;  5J1Y A;  2DMP A;  2IS2 A;  2QKM B;  1RET A;  5L3F A;  2XAQ A;  4CHU A;  4FE7 A;  5EEA A;  1R9T J;  2X6X A;  1EF4 A;  3JRB A;  2H8W A;  5E18 F;  4MTD A;  1W7P A;  2A6T A;  1TZL A;  4ZH4 F;  1UG2 A;  2M30 A;  4CUG A;  3CUQ C;  1LVA A;  1NK2 P;  1N78 A;  1S9H A;  5F64 A;  2XAG A;  4NB5 A;  1YW8 A;  4JP0 A;  1BR2 A;  2ID6 A;  4JOM A;  3IV5 A;  2LC2 A;  3H36 A;  4HSR A;  3E0J B;  1KYW A;  3Q5F A;  3DLL F;  2VLA A;  4XOR A;  4YIF A;  3GTO J;  1P4X A;  3RIR A;  5JHU A;  4AIJ A;  1ZGA A;  3NRV A;  5F08 A;  3BQY A;  4G6D A;  4LIU A;  2ZJP F;  4W1U A;  2BE5 F;  3SQN A;  1MBJ A;  4EGY A;  2X1C A;  4YFX F;  2B7E A;  4CZZ A;  4NHJ A;  1VQK I;  2VE9 A;  2VOD A;  2F4I A;  2VBX A;  1RRJ A;  5HLH A;  4XRM A;  2HU9 A;  1MMD A;  5ICG A;  3I58 A;  3IAS 2;  5ICC A;  3EUA A;  5BMZ A;  1YX5 A;  3KX2 A;  5H6Q A;  3KLN A;  1UFM A;  3G6E I;  2WWY A;  4UVA A;  2OTJ I;  1D5V A;  4PCQ A;  1I39 A;  1T95 A;  4R79 A;  3WGI A;  3HGY A;  1G8X A;  3E97 A;  3MN2 A;  3F23 A;  4FQG A;  3WU0 A;  4PJ0 C;  1T98 A;  2UXX A;  2CV2 A;  4KT5 C;  2E2I J;  2CQ7 A;  2CWE A;  3HRM A;  5EEG A;  5FRM A;  5FB2 A;  4KDP A;  2ME6 A;  3OYH A;  1U5T C;  2K7L A;  1T2K A;  1I3A A;  3GBG A;  4IVN A;  2P8T A;  4OMZ A;  4B3X A;  4CCN A;  1Y0U A;  4WCG A;  3A02 A;  2OTL I;  3LSH A;  3ERM A;  2A5W A;  3COA C;  3ASN H;  5L3E A;  2NYX A;  1HKS A;  2BXY A;  2E2H J;  3K2A A;  3A4C A;  2P6S A;  1BOA A;  1DU6 A;  1IDZ A;  2GM4 A;  3P5J A;  2QSF X;  1UMQ A;  4BQN A;  1T39 A;  4BDZ A;  4BQQ A;  2VKH A;  2XB0 X;  5LRR A;  2ELH A;  2IGO A;  3K9T A;  3OSG A;  2EA2 A;  2I8D A;  1Y8R B;  1FLI A;  3KPH A;  4MTE A;  2V9K A;  2XVC A;  3OR2 C;  4A3D J;  2X1E A;  1AOY A;  3BLY A;  3DU6 A;  4BBR J;  2JSP A;  2V79 A;  2EBI A;  1X1B A;  3E6D A;  2J5O A;  3QOP A;  1I1S A;  2BXZ A;  4PSX A;  4RDU A;  1AU7 A;  3GTQ J;  2LD5 A;  1AKH B;  3J7Y J;  1NH3 A;  3GTK J;  2JT1 A;  4U0V A;  5F1J A;  2QEN A;  4HLX A;  1JI8 A;  5H20 A;  3FHN A;  1IRF A;  1PVE A;  4YEL A;  5JVT A;  3DBL B;  3PUB A;  4EMS A;  3HGG A;  4C3J J;  3LFU A;  2PEX A;  2MH2 A;  2PMU A;  1OKR A;  5M5W J;  2GIZ A;  1QGP A;  3FXJ A;  3F6O A;  2GOM A;  2M4G A;  4F91 B;  3L00 A;  2K4J A;  4M73 A;  2MSY A;  3JRH A;  2KZG A;  3KEQ A;  1ULY A;  2EV6 A;  5JI6 A;  1WSU A;  2NVQ J;  2FXA A;  4I99 C;  3GCM A;  3ZMV A;  1RC9 A;  3OYF A;  4XKC A;  2KRH A;  3QQA A;  1WVR A;  4CA0 A;  4XRS G;  2HGC A;  3E1S A;  1FIP A;  3HB9 A;  5J4V A;  5FO5 A;  4XLN F;  2ICW G;  3JAM Z;  5E8G A;  3WTZ A;  5IOY A;  3W6K B;  3HOZ J;  4M74 A;  3TED A;  1S7O A;  2Y2Z A;  2CW7 A;  3DPU A;  3OYB A;  4ZDO A;  3ZQL A;  4NNJ A;  1S3J A;  2EFW A;  5E3L A;  2DU9 A;  1B4A A;  2VBZ A;  2L7K A;  4LK0 F;  5GPC A;  1D1A A;  2JVG A;  5HNF A;  4IQ4 A;  3JSO A;  3GX4 X;  3SEQ A;  3R6S A;  2L7M P;  1JHH A;  4C3I J;  3BG5 A;  1EKE A;  2LG4 A;  5D5W B;  3JCU C;  1PYV A;  3ZGK A;  3U2R A;  4C2M J;  2VJ5 A;  4C2U A;  1JUP A;  2XPU A;  4WK8 F;  1PP8 F;  4PSW A;  5DTD A;  4E7K A;  3RTR A;  1YIJ I;  1E0E A;  3FIS A;  2DJI A;  1B6A A;  5C4J J;  2V6E A;  1MJB A;  2GXG A;  1XMX A;  1W0T A;  3OS1 A;  2GA1 A;  1MJ9 A;  2EZL A;  3SFZ A;  2H1L A;  1SAU A;  4GGG A;  4FT8 A;  3K70 D;  2UV1 A;  1SFO J;  3IKV A;  5D5X B;  5DUI A;  3I0T A;  4IEJ A;  1IDY A;  4II2 A;  5DDG A;  2E2J J;  4L5I A;  1LEA A;  4KJZ A;  3H92 A;  2MFZ A;  5FLX K;  2YU9 J;  1ZLJ A;  1GXQ A;  2KJB A;  2V4J C;  2K9L A;  3L2C A;  2LBF A;  3DP7 A;  1PUE E;  2E5Z A;  4HA8 A;  4RGU A;  1YW7 A;  3A03 A;  4RLF A;  1X1D A;  3WU1 B;  1E17 A;  2E1C A;  2D1H A;  2F5V A;  4AID A;  5K7Z A;  2LRE A;  2YX4 A;  2EIK H;  4BL0 B;  3BCA A;  3CCJ I;  5E17 F;  2ELJ A;  2Q2E A;  4BS9 A;  2VJI A;  2BYV E;  4HQE A;  3I59 A;  1O7L A;  3N97 A;  1JJ6 C;  3SHF A;  3HKZ N;  2X6Y A;  1XCV A;  1Y0N A;  1RUO A;  3J81 K;  3R0J A;  2AXT C;  1IN5 A;  2LVS A;  2ZME B;  1IUF A;  3CJN A;  1A5J A;  3RQI A;  3K4M A;  3ZMT A;  2ZCW A;  5IP7 J;  1S8N A;  2VKE A;  3LOC A;  2ZME C;  3WTV C;  3GTJ J;  3BZC A;  2IGN A;  4W97 A;  1RKT A;  3VWB A;  3W2V A;  2W24 A;  4UNO A;  4EJU A;  4M6Y A;  4LJZ F;  1G3Y A;  3HOU J;  1ETK A;  1U6G A;  3QU3 A;  1XSV A;  2CSO A;  3VYR B;  2HTJ A;  2DXI A;  5K5Q A;  1BM9 A;  1U0J A;  2E1M C;  3CDL A;  2JSC A;  4G8X A;  1RPW A;  1H0M A;  4UUS A;  4XLC A;  1SFU A;  1NG7 A;  2DA7 A;  3JRI A;  2M8G X;  3FXR A;  4NUB A;  1HW2 A;  1ZLK A;  4DNC A;  2V1X A;  2ZFW A;  3K0L A;  3IRR A;  5M3F J;  3F21 A;  4BGD A;  2V26 A;  1WRJ A;  3PNY A;  3KFW X;  1OMI A;  5IT9 K;  2NS7 A;  3LQR A;  4M6V A;  4XLE A;  2HZD A;  5KVR A;  5J1U A;  1BJZ A;  2XRN A;  4A0X A;  5HOD A;  2VL8 A;  4PJM A;  1R1T A;  4BUP A;  3GYH X;  1YI2 I;  2O7O A;  3SZT A;  1R4N B;  1YX3 A;  3BR3 A;  2PX9 A;  3M07 A;  4E7H A;  1HST A;  4Q4Z F;  1FOW A;  4BE1 A;  2HDD A;  3CDH A;  4DQ2 A;  1FX7 A;  4IOA F;  2M0M A;  5CQG A;  2VKD A;  3ZQC A;  5BQT A;  1W36 C;  2X51 A;  1SD6 A;  2EWN A;  5JFR A;  1XPX A;  1XX5 A;  3HKZ A;  1D3Y A;  3U21 A;  4RGX A;  4B4C A;  2HVR A;  4GRI A;  3F8B A;  3FMR A;  1ITY A;  2XPW A;  1IO2 A;  1Q1V A;  4YRV A;  3ROU A;  1U9N A;  2QM3 A;  3J80 K;  2CU7 A;  3CLQ A;  5F0C A;  3IH4 A;  5A2Q Z;  2O5R A;  2HVS A;  2K9S A;  4AIH A;  4XLA A;  2CS3 A;  1R71 A;  4P55 A;  2HZT A;  3OV8 A;  4XLF A;  2MG4 A;  2V7F A;  3F8N A;  5C3E J;  1ZAO A;  1YE9 A;  3H0D A;  2JN6 A;  4DJA A;  3DBH B;  4UV9 A;  1DPR A;  3HHG A;  1WFX A;  1QO0 D;  2Q1Z B;  2WAF A;  4NQW A;  5B66 C;  1A35 A;  4IRI A;  2L0K A;  3KZZ A;  2V1U A;  5GAG J;  1Z7U A;  2LF7 A;  3BCB A;  1T0F C;  2HQA A;  1I50 J;  4PJJ A;  5FKK A;  3GW2 A;  2JWT A;  1HQC A;  2JPB A;  4D7M A;  2R5Z B;  2MC4 A;  4RM3 A;  2EZK A;  1UHS A;  5J6X A;  4A0Y A;  3EYY A;  1H8A C;  2VE8 A;  2R7D A;  2MAB A;  1STZ A;  2DQR A;  2EA4 A;  5ERI A;  3C18 A;  2M8E A;  3A01 A;  1XC5 A;  1F36 A;  5GAH J;  3J81 Z;  3PIO F;  2ESN A;  2BW3 B;  3BJA A;  1ZGW A;  4XSX F;  2XDV A;  3IWF A;  1WKM A;  2CJJ A;  2X4H A;  5ICF A;  3V4G A;  5FD6 A;  2VIX A;  2FE3 A;  2KFD A;  3ZMZ A;  4XLP F;  1F9N A;  2GQQ A;  1OYW A;  3B02 A;  3SZG A;  4AYB A;  2OQR A;  4A3E J;  4GO1 A;  4XSZ F;  1T38 A;  5CVJ A;  3HRT A;  4CIC A;  4EAT A;  3BQZ A;  4X1E A;  4B3A A;  2FNA A;  2RVC A;  3CCL I;  2K40 A;  2EK5 A;  4RAY A;  4OAZ A;  4ESB A;  5D4S A;  1UJ8 A;  2A6H F;  3FX3 A;  1ZQ3 P;  1O7F A;  4HOB A;  2A68 F;  2HDC A;  4ASN A;  1Z3Y A;  1U5T B;  4B47 A;  1FOY A;  2WAD A;  2ZJ2 A;  2VC1 A;  3T8T A;  2CUJ A;  1ZR2 A;  1QZY A;  3FHZ A;  2NXN B;  2L9N A;  1VQ7 I;  1ODD A;  1MGT A;  1X3Z B;  1JGG A;  2RDP A;  3FM3 A;  2VOO A;  1IXS B;  5FD5 A;  1MBF A;  3VSL A;  5IYC J;  2E34 A;  3HUG A;  3RSN A;  3CO7 C;  4M3G A;  1GDT A;  4HF0 A;  1R5I D;  1K4T A;  2F4M B;  1SD4 A;  2JPC A;  3O3K A;  3MVP A;  3K10 A;  4KNY A;  1SD7 A;  1WI3 A;  2K3F A;  1BL0 A;  3QP6 A;  3S2W A;  3Q3S A;  2P6T A;  2QBY B;  1Z7L A;  1H9T A;  4NQW B;  2XAH A;  3IHU A;  4HPQ A;  5FLV A;  2JA6 J;  3JRG A;  2EFO A;  3BRO A;  3FXQ A;  4V2G A;  3NQO A;  3ZMD A;  2Y30 A;  2ZXW H;  3FXL A;  4ZZL A;  1N75 A;  3S1N J;  1CF7 B;  2Z5U A;  2EFP A;  2FSW A;  2P5V A;  3VDX A;  3ZQG A;  2W84 A;  4JK1 X;  2BHY A;  3RZD J;  1WJF A;  3GVA A;  2E7W A;  2MLG A;  4ON0 A;  4F52 A;  3AL0 C;  3T8R A;  1BC8 C;  4M9S A;  4L18 B;  4C2T A;  3F3X A;  1W36 D;  3GME A;  4KT6 A;  3K4K A;  2NS8 A;  2XAF A;  1YLF A;  2NVT J;  3AL0 B;  2B63 J;  3S32 A;  4Y17 A;  4ABZ A;  4LK1 F;  4M9Z A;  4XMY A;  3RCO A;  1YHQ I;  3P9C A;  3W6V A;  3OOP A;  2K3P A;  3BG7 A;  1IUY A;  4HST A;  4LGW A;  4RGR A;  1XD7 A;  2Q8K A;  5KK1 A;  1YYV A;  3H9J A;  1BI2 A;  1G2H A;  4XQF A;  2E35 A;  5IY5 H;  1QPI A;  1Z6R A;  2BBY A;  3C1D A;  1OJL A;  2ZXJ A;  1YG2 A;  2B9S A;  2RNJ A;  3WE2 A;  3MMY B;  3CMM A;  2Y69 H;  3U9G A;  2EV0 A;  2LMD A;  3RKQ A;  3MZY A;  2F5C A;  2OAZ A;  1I6X A;  4XN0 A;  2CMP A;  2HVQ A;  3ZRG A;  3HDD A;  2OV7 A;  2VON A;  5J40 A;  1Y39 A;  1Y1W J;  2ADU A;  5K1Y A;  5F6F A;  2DW4 A;  1RI7 A;  5IYD J;  1T8I A;  2G7U A;  4FET A;  3HRS A;  1H89 C;  3PQK A;  5D6F A;  1Y56 A;  2OCC H;  2PBI A;  4EM2 A;  2ZFU A;  3A0H C;  4Z6Y A;  2L7F P;  2CV0 A;  2ESH A;  5IP9 J;  5D5V B;  1OR7 A;  2JA2 A;  2QYO A;  1ETO A;  4XL9 A;  3DBR B;  3LSG A;  4EVI A;  1SFX A;  3PIP F;  1ETY A;  3MKY B;  4OMY A;  4RGS A;  4D7N A;  2DT7 B;  2W82 A;  4M3D A;  1REP C;  4BDY A;  3TO6 A;  1XMK A;  1K4S A;  2H27 A;  3GTG J;  3UNG C;  3A01 B;  3C7J A;  2ZSI B;  5EYR A;  2LTP A;  1JUM A;  1IN6 A;  2M7B A;  4ESJ A;  1SVO A;  1JKO C;  2A07 F;  1DPU A;  2VAS A;  1FC3 A;  2HQR A;  2R5Z A;  4UVB A;  2FUG 2;  1D0Z A;  1D0Y A;  4AD9 A;  1X1P A;  2A3S A;  3G71 I;  1UHW A;  5L3B A;  3ISP A;  1FEX A;  3OL3 A;  1P2F A;  1Z05 A;  4LLL A;  1XMA A;  1BC7 C;  2OU2 A;  3BPV A;  1IC8 A;  4RS8 A;  2V1N A;  3PSI A;  5E1Z B;  5LHH A;  1IF1 A;  4L0Z B;  2RGV A;  1VTN C;  1W7P D;  2WV0 A;  4XID A;  1B9N A;  5CLS A;  4M3F A;  1O4X A;  3LL7 A;  4EGZ A;  4A2U A;  3CJR B;  4PGH A;  3BOQ A;  2R0Q C;  1SAX A;  3LA3 A;  2Z1D A;  4KIF A;  1HCR A;  2M87 A;  4I02 A;  1KQ0 A;  1TWF J;  2ZXH A;  2X1D A;  1LDK B;  3VYU B;  4MNU A;  2VQH A;  3ECO A;  3REO A;  2P7C B;  4ZYH A;  1QA6 A;  2QQB A;  1A31 A;  1WPK A;  2R7F A;  4LFU A;  4I0B A;  4R1H A;  4UHT A;  4BXX J;  2FNP A;  3NAR A;  3OYC A;  2IJL A;  4WX9 A;  3MEX A;  3FXK A;  4HV5 A;  4Q5S F;  5B1B H;  2K9M A;  1TC3 C;  4F3Q A;  2VKV A;  4BJ5 C;  3I3L A;  4XKB A;  2P5K A;  2ZO4 A;  5M5X J;  3OYJ A;  4YFK F;  1TL8 A;  2EFQ A;  1FMW A;  1VQO I;  2DFF A;  2ZBK A;  5FKL A;  1XGS A;  4MLO A;  4CGZ A;  5E1W A;  1QRY A;  1W7P B;  2KKO A;  2D45 A;  4PDK A;  5LEJ A;  5H2F C;  1EA3 A;  1QNT A;  4J19 A;  3T5X A;  3KP4 A;  1ZAR A;  3H3V K;  3G73 A;  1A6I A;  3ZQQ A;  1WHU A;  2H6B A;  2H6C A;  2X85 A;  3PJR A;  1T6S A;  5J4Y A;  4HDV A;  2DTR A;  2LRD A;  4P9F A;  1OCT C;  2YS9 A;  4Y3O A;  6PAX A;  3R0A A;  2Z33 A;  1QBJ A;  2K27 A;  4M71 A;  4U88 A;  2V9P A;  2HOS A;  4IL6 C;  1FMV A;  3TO9 A;  3MZH A;  2GLO A;  3E5X A;  2HOT A;  1SD5 A;  4A93 J;  4I98 B;  5E79 C;  4FX0 A;  2WBM A;  3MKL A;  5FJ8 J;  1BI1 A;  1H88 C;  4E6K G;  4IHY A;  1XG1 A;  2RKH A;  3QOD A;  3PFY A;  4BQA A;  2DK8 A;  1B1B A;  3IUO A;  2EZI A;  1J0R A;  3KYC B;  2ID3 A;  3KZI C;  4AUX A;  3BPX A;  4ZTF A;  2DOF A;  1HKQ A;  3EPZ A;  2VQC A;  4H4K C;  1GHC A;  4HNV A;  4OWR B;  1LUJ B;  2CUF A;  4J01 A;  5IPA A;  2Z2S B;  1HLV A;  2BEO A;  5J8F A;  4EQQ A;  3HXL A;  2DI3 A;  5LHI A;  1X1A A;  4HQM A;  5F0F A;  3O6B B;  2CQQ A;  3CCE I;  3TW6 A;  4DGW B;  2KT0 A;  4A5M A;  2FU4 A;  3PM1 A;  2IS4 A;  1VQ8 I;  4YIR X;  2FBK A;  1IN4 A;  2L4A A;  3J7A Y;  1GVD A;  1X58 A;  4KIC A;  3GO5 A;  2XGC A;  2EJR A;  3ERE D;  3FKI J;  1ZEL A;  1TQI A;  2EV5 A;  3ULQ B;  3ZR8 X;  2VB6 A;  5FRN A;  3M8J A;  4B43 A;  3BR5 A;  5IOZ A;  5EGO B;  3ZP5 A;  3S16 J;  1X3U A;  3LWF A;  3LAJ A;  4FCY A;  2GXA A;  2MW8 A;  3M3Y J;  1UB9 A;  1N77 A;  4BBS J;  2QWW A;  1T08 B;  3KE2 A;  2BV6 A;  4QTR A;  1X4P A;  4B09 A;  1IV8 A;  4EJT A;  4HX7 A;  3M1C A;  3H5A A;  5DEQ A;  2W7N A;  1UST A;  4QWQ A;  4ESF A;  2H8R A;  3RYR A;  3HPG A;  1R5H A;  3UR3 C;  3VYT B;  1ERD A;  2XRL A;  2F2E A;  2IBD A;  5KAF C;  3F6V A;  1YIO A;  4QSH A;  3L2Q A;  4BH9 A;  4CCM A;  3HL2 A;  3WTW C;  4LOC A;  3LST A;  5BNG A;  4U7B A;  3KIO A;  4XOT A;  2KLO A;  3ZQF A;  3HOW J;  1J59 A;  3VSK A;  4BU2 A;  2A05 A;  4L5E A;  3ELK A;  2XF6 A;  3W2A A;  3ZOB A;  3OYL A;  2W57 A;  4PFO A;  1BIB A;  1K6Y A;  1RR7 A;  5H6R A;  3RKY A;  2XF7 A;  3DKW A;  2FOK A;  2NOG A;  4BEH B;  4JX6 A;  4LLN A;  1P4A A;  3S14 J;  2ZB9 A;  1W0U A;  1W5T A;  2IA2 A;  1WCM J;  4RMN A;  4BY1 J;  2QQA A;  1NTC A;  3E6B A;  4RAZ A;  4MEX F;  5KAI C;  1R1U A;  1VQ9 I;  3OIO A;  1LQ1 A;  3OYA A;  1APL C;  2M34 A;  4U0W A;  3J7Z I;  2DOE A;  3JRD A;  4XRF A;  3FZV A;  2L7Z A;  4XR6 A;  4HF2 A;  3LSK A;  5LFA A;  3CZ6 A;  3KEO A;  5CVR A;  2A61 A;  1CGP A;  4Q47 A;  2EQR A;  3WHC A;  2W1O A;  2KPM A;  3QPT A;  5L3D A;  4KIG A;  5DCF A;  2E19 A;  3WGG A;  3CUQ B;  3LSI A;  4PJL A;  3SZP A;  3DEE A;  3RPU A;  3EQL F;  4HEA 2;  2CW8 A;  1VQ6 I;  4CYC B;  2FQ4 A;  4ENJ A;  4GXO A;  2VBY A;  1UCR A;  3BZK A;  2XB5 A;  2HYF A;  4I09 A;  2UUZ A;  1TBX A;  2Y9Y A;  3RDI A;  4D0P A;  1ZHF A;  1P4W A;  3DPT A;  3S1R J;  2HYG D;  1TQM A;  4CCL A;  1UHM A;  3FWE A;  3TDZ C;  2OCE A;  3M7G A;  3S8P A;  5HLG A;  1PP7 U;  3MD2 A;  2XKO A;  2DDB A;  2VQG A;  4A3J J;  4U87 A;  1MBE A;  3G1L A;  2R7R A;  4IZZ A;  1ZG5 A;  2N8G A;  1E2X A;  1ETW A;  1TTY A;  4G12 A;  1EH8 A;  2DOA A;  4UVC A;  1FOK A;  2JJ7 A;  5LEK A;  3B73 A;  1MBK A;  3ABM H;  4B8X A;  2EPF A;  2WC2 A;  3HYI A;  4ZDP A;  1YIT I;  1LNW A;  2R4G A;  3BTC A;  3V7R A;  1WJD A;  2AQF A;  3JTH A;  4AIK A;  1S6L A;  3BG3 A;  2GXB A;  4P9U A;  3D5R C;  5HVQ C;  4LD5 A;  2OBP A;  1SFK A;  1XB4 A;  1JXS A;  2A6E F;  1P92 A;  1RES A;  1I5Z A;  4PUS A;  1G59 A;  4F93 B;  3U1D A;  3JTG A;  3S2H J;  4EV0 A;  5KCM A;  2WAQ N;  3K7A J;  2WAQ A;  1R6R A;  2P0W A;  3FXO A;  5D5U B;  2O9L A;  2Y31 A;  1CQT A;  2LP0 A;  2HEO A;  1JUS A;  1ZKG A;  3RI4 A;  2HKO A;  1GXP A;  1ZN2 A;  1K83 J;  1YRN B;  4LLG F;  4WXH A;  2DMN A;  5F1R A;  3F8C A;  2O8K A;  4FHT A;  4IO9 F;  2HQ5 A;  3AG3 H;  5L3C A;  4G7H F;  2M0C A;  4IRG A;  5D6E A;  3S93 A;  4UUV A;  5LGN A;  3R60 A;  2RQP A;  3OYG A;  3A0B C;  1GV5 A;  4S0H B;  3OY9 A;  4MQV A;  1O3T A;  3CJT B;  3H9Q A;  1ZH5 A;  3BR6 A;  2R7W A;  1XGO A;  2LLK A;  2KIU A;  2HPM A;  1MBH A;  2OZ6 A;  3PSF A;  2R7Q A;  1HDP A;  5ILU A;  3TMO A;  4G7O F;  5FFZ A;  4QIW N;  4KMF A;  3K4C A;  1XDU A;  3FXU A;  2NVU B;  4ZC3 A;  5K7F A;  1XTA A;  3P7N A;  1TT0 A;  3BTI A;  4O3M A;  2ZJQ F;  2C6Y A;  3PFI A;  2BVM A;  4KN4 X;  4N9I A;  1NK3 P;  1BI3 A;  3V8L A;  4CCJ A;  2F6C A;  1S29 A;  3FK6 A;  1Q1H A;  3QPH A;  2VPR A;  2XGE A;  4HV6 A;  4JBA A;  3LSR A;  2R93 J;  1WJB A;  1E3P A;  4HF1 A;  3I4M J;  2MD0 A;  2MLK A;  4XKV A;  3MFK A;  1G3T A;  2IXS A;  4IXA A;  3E3V A;  3HSF A;  2HKX A;  3BT9 A;  1YRN A;  2WY8 Q;  3L2V A;  3PUF A;  5HS7 A;  2XF5 A;  1RZ4 A;  4IOC F;  3AG4 H;  5D8K B;  2D5V A;  2M45 A;  2QLZ A;  1R5G A;  3HJE A;  1DQU A;  4HX8 A;  5CVU A;  3DCF A;  1QU3 A;  1OIS A;  2AXL A;  1QQI A;  2VOP A;  2O0Y A;  3Q0W A;  2VN2 A;  1KU7 A;  4IJA A;  2XSD C;  4H0E A;  1MMN A;  5TRD A;  3OR1 C;  1LFB A;  2EIN H;  5DM6 F;  3A1Y A;  2KP6 A;  4A69 C;  5HDN A;  4E7J A;  5DCM A;  1QHG A;  2R7T A;  2OF7 A;  3CTA A;  2XPV A;  3ZCO A;  3EUH A;  2DA5 A;  3LMM A;  3I56 I;  1UEL B;  2Z99 A;  2IRF G;  2ZNZ A;  2IS1 A;  1BW6 A;  1X2M A;  4AVP A;  1P6R A;  1FBS A;  3ABL H;  2RAE A;  1D8K A;  3D5S C;  4E70 A;  4EJW A;  3IH2 A;  4N4N B;  3RKX A;  3TGN A;  3WG7 H;  3W2W A;  1B72 B;  4A3L J;  2I10 A;  1EH6 A;  4HLY A;  3OSF A;  1IN7 A;  4A0Z A;  2MBF A;  2DCE A;  3HIF A;  2WAE A;  3F8M A;  5GP9 A;  3ZQI A;  4UV8 A;  1OR7 C;  4GYG A;  1JT6 A;  3CUQ A;  5B1A H;  2TCT A;  4NC6 A;  4MO7 A;  2XC7 A;  1ZTR A;  1MD0 A;  2FX0 A;  3GFJ A;  3K1N A;  4HDU A;  2PFB A;  5DM7 F;  3OIP A;  3JRA A;  1ZGJ A;  4HBL A;  1OYY A;  5AON A;  2JQ7 A;  3PL8 A;  2PG4 A;  2G9W A;  1GVJ A;  3CF2 A;  2E1O A;  2WY7 Q;  4IRH A;  4PK4 A;  2P5L C;  2X0L A;  5CPR B;  4BHB A;  4E7S A;  3LSJ A;  2HXO A;  4EM0 B;  4GCV A;  2F5E A;  1U8R A;  1IAW A;  3CMA I;  4Y52 J;  2E71 A;  2HI3 A;  5DD4 A;  1ZK8 A;  4C9Y A;  2JK3 A;  3OWT A;  3TBI A;  4LIT A;  2WA0 A;  2P4W A;  5KHD A;  4D5F A;  4G6Q A;  1ZG1 A;  1ONV A;  3LSM A;  3WU2 C;  4YG2 F;  5HLT A;  5HS9 A;  1ENH A;  4KFC A;  2IGK A;  5C44 J;  1LJ9 A;  2LSO A;  3C3W A;  3Q0V A;  2CW0 F;  2E60 A;  2PQ8 A;  3HOX J;  1JJ8 C;  5B3S H;  2CRG A;  2MD5 A;  2MA3 A;  1D5Y A;  2LOO A;  2JA8 J;  1XN7 A;  3ABT A;  4DZP A;  4EM1 A;  2QKL B;  2V1D A;  2OQG A;  1USS A;  5IP6 A;  1VF9 A;  4UUT A;  4ZYD A;  2OC6 A;  1BN5 A;  5EZH A;  3DXJ F;  5ILS A;  2Y75 A;  4YII A;  1SFE A;  4E7I A;  4G6T B;  1FBQ A;  1FJL A;  3OMY A;  2L4M A;  5J1R A;  3F0C A;  4HRI A;  4ZJZ A;  3DTE A;  4ZZD A;  3QPL A;  2OZU A;  3O2P E;  1IG7 A;  1PDN C;  4RB1 A;  2DYR H;  3BTJ A;  3G2B A;  2DMU A;  3TKY A;  1YQA A;  3Q9V A;  3F72 A;  5J8C A;  1Z6T A;  4ENM A;  2I5U A;  4A6D A;  3K4B A;  3WTU C;  1F43 A;  5JVG F;  4NC8 A;  1D0X A;  3SDG A;  1FSH A;  1WH5 A;  1Y1V J;  4BXF A;  4DOZ A;  2XHK A;  1KQ9 A;  2KDZ A;  1W5C C;  1KON A;  2ETH A;  2L5Q A;  1NG6 A;  4UY8 I;  1MJA A;  3M8E A;  4HG2 A;  1BIA A;  4D1Q A;  3D5L A;  5FLM J;  3OIQ A;  4AU7 A;  3HOS A;  1ZRF A;  2ZME A;  1POG A;  3OYK A;  4JX4 A;  4BQO A;  1WWX A;  5L3G A;  4CDG A;  1OCP A;  2EH3 A;  2DA3 A;  2RC4 A;  2R7U A;  3TP3 A;  1AA7 A;  3VOE A;  4BKX A;  2B0L A;  1G6N A;  1LB2 A;  5E3N A;  1I1G A;  3V8K A;  4XKW A;  2L2O A;  1TP4 A;  3J7A O;  5CVV A;  3JAM K;  3BTL A;  1AHD P;  5HDG A;  2GWR A;  3G1M A;  4FAS D;  2VXD A;  3PNT A;  4L9N A;  1HDD C;  2XGD A;  1DGR M;  2BHZ A;  1IV6 A;  2VJ4 A;  1FOX A;  2CQX A;  5TGT A;  4D9J A;  1S5L C;  1JGS A;  1QVT A;  2QEX I;  3V7S A;  1LE8 A;  5TIS C;  4E4H A;  2LKP A;  2KQR A;  2Y0M A;  2YR2 A;  3KZY A;  2YSR A;  2JA7 J;  2A5Y B;  2QGU A;  2TDX A;  3F8F A;  4ZTJ A;  1MSE C;  5EG0 B;  2E5N A;  3CMY A;  1FP2 A;  2EZH A;  4MGR A;  3LSP A;  3HOY J;  2D2W A;  4BAC A;  2KZV A;  4A3F J;  3S1Q J;  2R5Y A;  2DA2 A;  2K9N A;  2JA5 J;  2KRF A;  3QPS A;  2M9H A;  3P9I A;  4O6J A;  5M3M J;  1YJ9 I;  1XSX A;  1A36 A;  4F55 A;  1HW5 A;  4RB3 C;  1Z9C A;  4GDF A;  3L09 A;  3ZQH A;  2NVX J;  3HOV J;  4KA4 A;  1WJ5 A;  2QQ8 A;  3K4L A;  1LPQ A;  1UZC A;  4RM2 A;  4Q48 A;  5FKO A;  2ZNY A;  1FT9 A;  3DTK A;  1R23 A;  4MQ9 F;  3S15 J;  2XKP A;  2BY1 A;  1BW5 A;  3AG2 H;  1JE8 A;  2FJ1 A;  5FRO A;  3DPL C;  3M4O J;  2K86 A;  2L9V A;  2COM A;  5TJJ A;  1F4K A;  1ETX A;  4OU0 A;  4AYB N;  3WTX C;  3CP2 A;  1G3S A;  4I0A A;  1DGW Y;  4DBQ A;  3V7C A;  1K78 B;  1KQ8 A;  1Z77 A;  4UUS B;  3TOA A;  2JRM A;  1TNS A;  4CYD A;  1J5Y A;  1G4D A;  1MH4 A;  2W00 A;  5D8L B;  2L3D A;  3S1M J;  1TT5 B;  2QZ8 A;  4BE2 A;  5GTI C;  3EUH C;  3ZQ7 A;  1EV7 A;  4QLC U;  1B8I A;  1BR4 A;  4IX7 A;  4RA2 A;  3QRF F;  2WB1 N;  1O3S A;  1J7K A;  2PN6 A;  4ETS A;  1VQ4 I;  4P1W A;  2HPI A;  2DA1 A;  3NWS A;  1IRX A;  1A04 A;  4XBF A;  4B1R A;  2DAO A;  3K1P A;  3KLO A;  3MQ0 A;  3ZXS A;  2PMZ N;  3I53 A;  3OYI A;  3HTU A;  3MCZ A;  5C4X J;  5FGM A;  3IH3 A;  2R3S A;  3KP3 A;  2E1M B;  1XCB A;  2ZSH B;  4BAY A;  3GLL A;  2JMW A;  2ISY A;  2O8X A;  2QUF A;  5HNH A;  2VT3 A;  1E3O C;  3ZN0 A;  1R1V A;  2JTV A;  3RKW A;  1MDM A;  3F22 A;  1GLN A;  3HTS B;  1OCZ H;  1R00 A;  2ECB A;  2JUC A;  3FKJ A;  1OFC X;  3M8F A;  1P7J A;  2NAZ A;  1K6O A;  4L5J A;  1IW7 F;  3TQN A;  4MHG A;  1JTY A;  1KGS A;  3PQJ A;  3V42 A;  2LH9 A;  2BOL A;  4A12 A;  4XNF A;  5E3M A;  3T1B A;  3DEU A;  2VBW A;  1KYZ A;  5EZG A;  4BHP A;  4XON A;  3QOE A;  3GWZ A;  2QCO A;  2EIJ H;  3CCR I;  1MW7 A;  1T0F A;  2VI6 A;  5J3L A;  1I6H J;  3FMQ A;  3WE3 A;  3AAF A;  4LG3 A;  1Z1D A;  2M4K A;  2OJE D;  1YJN I;  5K5O A;  2Q0O A;  1KU9 A;  3H3Z A;  4CZC A;  4A6E A;  3P9K A;  2GZW A;  3S3O A;  4RB0 A;  1BJA A;  2HFH A;  3J80 Z;  1V55 H;  2FOW A;  2ELK A;  5FFX A;  1ZR4 A;  1U3E M;  3K69 A;  2X6W A;  2BW3 A;  2X6O A;  3CC7 I;  1FSE A;  2VPL A;  2P81 A;  5LBQ A;  2FD5 A;  2NVY J;  3I4P A;  4LIV A;  2W48 A;  1SMT A;  3TW7 A;  3MWM A;  4F92 B;  2LY2 A;  2V9V A;  3ASO H;  3TO7 A;  4Y13 A;  3S2D J;  3M9A A;  4ZYG A;  3EDP A;  1U2W A;  2CG4 A;  3KP6 A;  2VJJ A;  3DKX A;  3T0Y A;  3GUD A;  2K85 A;  1MDM B;  5KNL A;  1LVK A;  2IW5 A;  5IYB J;  4U7D A;  3GF2 A;  3I55 I;  1IGN A;  3RQ4 A;  3ZN1 A;  1A6Q A;  3H5N A;  2R7S A;  4DYR A;  1EJ9 A;  2M2E A;  3ESW B;  5A2Q K;  3S3N A;  2BY3 A;  3UKG A;  3RZO J;  3RYP A;  3LAP A;  2KDO A;  4RAF A;  2DMT A;  2AQE A;  2IS6 A;  2FBH A;  1HKT A;  2DA6 A;  1Z67 A;  3B6A A;  5JR3 A;  3L1P A;  1HBX G;  3RPQ A;  2P7V B;  3ONQ A;  1K7A A;  1HA8 A;  2CYY A;  3X2Q H;  3BJO A;  1X19 A;  3IKT A;  1I3Q J;  3OOU A;  1L3L A;  4BHC A;  2KMU A;  4S05 A;  1X2N A;  1LFU P;  1WI9 A;  2LK2 A;  3FM5 A;  1K78 A;  4B48 A;  3K1M A;  2XAU A;  2HDW A;  2CFX A;  4ZYE A;  3CCQ I;  2R7Z J;  3CCV I;  2GA2 A;  1XGN A;  4I6Z A;  2ME0 A;  1SMY F;  4RLQ A;  3KYD B;  2E36 A;  2FBI A;  5EEH A;  3PO3 J;  2BY2 A;  4CXF A;  1FBU A;  4LG0 B;  3WTT C;  5HS8 A;  1TWG J;  2RRE A;  1GV2 A;  5BPD A;  3WHB A;  1LEB A;  4Y33 A;  4Y4R A;  1IRZ A;  2YX7 A;  2PI0 A;  1H9G A;  2LKS A;  1Y8Q B;  4NBQ A;  2VUM J;  3FK7 A;  1KU3 A;  2LNB A;  2PJP A;  2NNY A;  2F48 A;  1YW9 A;  1XSD A;  2HOA A;  2Y9Z A;  3CCY A;  2VXZ A; 
#chains in the Genus database with same CATH homology
 1HDP A;  1GT0 C;  4IHV A;  2YUS A;  1HOM A;  4QIW N;  5M5Y J;  1VFC A;  4XK4 A;  4EEF G;  1ZR2 A;  2IEK A;  5K7F A;  3O8H A;  3BTI A;  3SFI A;  4X6A J;  1JGG A;  4JYK A;  1NK3 P;  1MBF A;  5IYC J;  4M3G A;  1GDT A;  5K7H A;  3LSR A;  3FK6 A;  3I4N J;  2VPR A;  2XGE A;  2R93 J;  2AO9 A;  1RKW A;  3I4M J;  3MVP A;  4NDL A;  3BG9 A;  1WI3 A;  2ECC A;  1BL0 A;  3HEF A;  2HXI A;  3Q3S A;  2DA4 A;  4M3B A;  4IHW A;  1P7I A;  2DMP A;  3BT9 A;  2DMQ A;  5J1Y A;  1YRN A;  1RET A;  2COB A;  4FE7 A;  5EEA A;  1R9T J;  1EF4 A;  3JRB A;  5FLV A;  2JA6 J;  3JRG A;  4V2G A;  4JX5 A;  2D5V A;  2WV1 A;  1UG2 A;  2Y30 A;  3S1N J;  3DCF A;  3ZQG A;  1NK2 P;  4JP0 A;  3JRE A;  3RZD J;  2ID6 A;  3IV5 A;  5GPA A;  1ETQ A;  3Q0W A;  1VND A;  1TWH J;  2XSD C;  2NS8 A;  2NVT J;  3GTO J;  2B63 J;  1LFB A;  4FTH A;  4ABZ A;  4A69 C;  3W6V A;  5F08 A;  2CUE A;  3BQY A;  2OF7 A;  2XPV A;  4W1U A;  2DA5 A;  1MBJ A;  1TWC J;  1XS9 A;  1MSF C;  1G2H A;  1BW6 A;  4A3C J;  1X2M A;  1QPI A;  2RAE A;  1OJL A;  4XRM A;  3BR0 A;  3IH2 A;  1PUF B;  1T33 A;  3H0G J;  1B72 B;  4A3L J;  4MIM A;  2I10 A;  3OSF A;  3RKQ A;  3Q0U A;  5GP9 A;  3ZQI A;  1JKP C;  3HDD A;  4C3H J;  2L9R A;  1JT6 A;  5DS9 A;  2K9Q A;  2TCT A;  2MGQ A;  3HGY A;  4MO7 A;  1VI0 A;  1Y1W J;  3BR1 A;  1ZTR A;  3MN2 A;  2FX0 A;  3JRA A;  5IYD J;  2E2I J;  1H89 C;  2ME6 A;  2E1O A;  3C2B A;  3E7L A;  2L7F P;  2X48 A;  3SJM A;  2DTZ A;  2LR8 A;  3GBG A;  3LSJ A;  5IP9 J;  2HXO A;  1ETO A;  3A02 A;  3LSG A;  4DYQ A;  1ETY A;  5E3O A;  4Y52 J;  1MNM C;  1GUU A;  4D7N A;  2HI3 A;  1ZK8 A;  4D5C A;  2E2H J;  2JK3 A;  1WGX A;  4M3D A;  1JT0 A;  5EGO A;  3K2A A;  1B8I B;  1DU6 A;  1IDZ A;  3GTG J;  2GM4 A;  4D5F A;  1UMQ A;  3A01 B;  2XB0 X;  5EYR A;  2LTP A;  1JUM A;  5F0H A;  1ENH A;  3OSG A;  5EDN A;  1HF0 A;  5C44 J;  3Q0V A;  1JJ8 C;  4M3E A;  2DN0 A;  4XRS A;  3HOX J;  1JKO C;  2CRG A;  4A3K J;  2LY9 A;  1D5Y A;  2R5Z A;  2JA8 J;  4DZP A;  4A3D J;  4AC0 A;  4BBR J;  5IP6 A;  1VF9 A;  4UUT A;  4GFB A;  2EBI A;  1FEX A;  5EZH A;  1BA5 A;  4RDU A;  1AU7 A;  3GTQ J;  2LD5 A;  1AKH B;  3GTK J;  1IC8 A;  5F1J A;  1FJL A;  4CYC A;  4XID A;  5J1R A;  3F0C A;  4M3F A;  1O4X A;  3HGG A;  4C3J J;  3QPL A;  1IG7 A;  3BTJ A;  2DMU A;  5M5W J;  2R0Q C;  1F43 A;  1ETV A;  1HCR A;  3SDG A;  1TWF J;  3HBL A;  1AKH A;  1WH5 A;  1Y1V J;  4Y7N J;  2MSY A;  3JRH A;  2KDZ A;  2NVQ J;  3TP0 A;  4A3M J;  1WPK A;  5EG0 A;  4IHX A;  4BXX J;  3NAR A;  3QQA A;  5FLM J;  4XRS G;  1IJW C;  1FIP A;  3HB9 A;  1POG A;  5IOY A;  4JX4 A;  3HOZ J;  3B6C A;  1OCP A;  3TED A;  1LE8 B;  1TC3 C;  5M5X J;  2VKV A;  2EH3 A;  2DA3 A;  2Y2Z A;  3TP3 A;  5FKL A;  3ZQL A;  4MLO A;  4BKX A;  1QRY A;  3LNQ A;  4DZJ A;  4A3G J;  2HYJ A;  5E3N A;  5E3L A;  2R92 J;  4J19 A;  3VPR A;  1JKQ C;  5GPC A;  3BTL A;  1AHD P;  3G1M A;  3H3V K;  1A6I A;  2L7M P;  1HDD C;  2XGD A;  1IV6 A;  4C3I J;  3BG5 A;  1OCT C;  2CQX A;  2YS9 A;  1QVT A;  4C2M J;  2HOS A;  4MFD A;  1LE8 A;  1JUP A;  2GLO A;  2HOT A;  4A93 J;  2XPU A;  1S7E A;  3MKL A;  5DTD A;  4A3I J;  5FJ8 J;  1H88 C;  4IHY A;  1XG1 A;  2JA7 J;  3FIS A;  5C4J J;  3GTL J;  1MSE C;  5EG0 B;  4FE4 A;  3CMY A;  1W0T A;  1PUF A;  2EZH A;  2EZI A;  4FIS A;  1U78 A;  2ID3 A;  3LSP A;  3HOY J;  3S17 J;  4AUX A;  4A3F J;  2EZL A;  3S1Q J;  2R5Y A;  2DA2 A;  2K9N A;  9ANT A;  1JTX A;  4HNV A;  2JA5 J;  3QPS A;  2M9H A;  1WH7 A;  3JR9 A;  1SFO J;  2CUF A;  5IPA A;  5M3M J;  4IEJ A;  1HLV A;  1IDY A;  2E2J J;  2DJN A;  4XIC A;  3ZQH A;  2NVX J;  3HOV J;  5F0F A;  2CQQ A;  1T56 A;  3TW6 A;  2KT0 A;  2YU9 J;  1MH3 A;  5FKO A;  3PM1 A;  2GBY A;  1GVD A;  1X58 A;  1K61 A;  3S15 J;  2XGC A;  2AHQ A;  1BW5 A;  5JLW A;  3FKI J;  4A3B J;  2FJ1 A;  3M4O J;  3A03 A;  1ETX A;  4AYB N;  5K7Z A;  3FIW A;  2IAI A;  3BR5 A;  5IOZ A;  2LKX A;  5EGO B;  3S16 J;  2X9D A;  1Z77 A;  4UUS B;  4FCY A;  2MW8 A;  4V2F A;  3M3Y J;  4BBS J;  1JJ6 C;  3PO2 J;  4QTR A;  3HKZ N;  1MH4 A;  1FTZ A;  1QVU A;  3S1M J;  3GTP J;  1B8I A;  2R5Y B;  2LVS A;  1IUF A;  1A5J A;  3RQI A;  2WB1 N;  5IP7 J;  2H8R A;  2VKE A;  2DA1 A;  3LOC A;  3GTJ J;  4DYC A;  2XRL A;  4B1R A;  4W97 A;  1RKT A;  5F27 A;  5FKM A;  2IBD A;  2PMZ N;  4QSH A;  3HOU J;  4I76 A;  5C4X J;  3IH3 A;  1ETK A;  4LOC A;  1U8B A;  5BNG A;  3ZQF A;  2JMW A;  3HOW J;  1E3O C;  4L5E A;  3CDL A;  5JLX A;  1FTT A;  1RPW A;  2ECB A;  4UUS A;  3JRF A;  2DA7 A;  3ZOB A;  1OFC X;  2M8G X;  3JRI A;  1P7J A;  1RR7 A;  3DEW A;  1JTY A;  5M3F J;  2NOG A;  4JX6 A;  2NS7 A;  3S14 J;  4M6V A;  2ZB9 A;  1B72 A;  5J1U A;  1BJZ A;  5E3M A;  1W0U A;  4BY1 J;  1WCM J;  1FIA A;  2G0E A;  5HOD A;  5EZG A;  1NTC A;  2QCO A;  3OIO A;  2O7O A;  3D1N I;  2VI6 A;  1I6H J;  5J3L A;  3BR3 A;  1APL C;  1DU0 A;  1U9O A;  2M34 A;  3JRD A;  2L7Z A;  1Z0X A;  2HDD A;  1ORK A;  3ZQC A;  2ELK A;  1ZR4 A;  2EQR A;  3WHC A;  2LFB A;  4B4C A;  2E19 A;  2X6O A;  2P81 A;  1ITY A;  2FD5 A;  2NVY J;  2XPW A;  1Q1V A;  2FQ4 A;  2W48 A;  3TW7 A;  4CYC B;  1U9N A;  2CU7 A;  2XB5 A;  5F0C A;  3S2D J;  3IH4 A;  2Y9Y A;  2K9S A;  3BR2 A;  3S1R J;  3CQZ J;  1TWA J;  4RBO A;  5IYB J;  3JRC A;  2MG4 A;  5C3E J;  1IGN A;  2QF7 A;  4MFE A;  2JN6 A;  4A3J J;  1MBE A;  4DYR A;  2TRT A;  2M2E A;  3G1L A;  1MBG A;  3RZO J;  3UKG A;  2OPT A;  2N8G A;  2L0K A;  1ETW A;  2DMT A;  4G12 A;  4DW6 A;  2JJ7 A;  3GTM J;  2DA6 A;  3B6A A;  5F04 A;  5FKK A;  1I50 J;  1MBK A;  3L1P A;  2JWT A;  4D7M A;  3BTC A;  2R5Z B;  3G1O A;  2EZK A;  1UHS A;  1SAN A;  2H1K A;  3BG3 A;  1H8A C;  1I3Q J;  3OOU A;  1RES A;  5EF6 A;  1X2N A;  5FKN A;  1LFU P;  2LK2 A;  3A01 A;  1XC5 A;  1F36 A;  3S2H J;  1ZGW A;  2R7Z J;  2WAQ N;  3K7A J;  2O9L A;  3NAU A;  2Y31 A;  4I6Z A;  2ME0 A;  1CQT A;  2CJJ A;  2LP0 A;  1JUS A;  3PO3 J;  1ZKG A;  1K83 J;  1YRN B;  2DMN A;  1TWG J;  2O8K A;  1GV2 A;  2HQ5 A;  3WHB A;  4A3E J;  2Y0S N;  1IRZ A;  2M0C A;  3O8G A;  1JKR C;  4BY7 J;  3HM5 A;  3BQZ A;  4X1E A;  4B3A A;  1GV5 A;  4S0H B;  2VUM J;  3FK7 A;  2K40 A;  3BR6 A;  2LLK A;  1MBH A;  2HOA A;  2Y9Z A;  1ZQ3 P;  3CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...