2R5ZB

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
b'RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zB00
3BTLA 3K2AA 4FISA 5DS9A 4D7MA 2JA5J 4J19A 2LVSA 4C3HJ 2YU9J 1MBJA 4A3EJ 3BR2A 2XPVA 2R5YA 1GV2A 2EZHA 4BBRJ 1B8IB 2GM4A 4A3FJ 4I76A 2LKXA 3H0GJ 1BW6A 5M5WJ 2KT0A 4RDUA 1I50J 4AC0A 1K83J 1TWAJ 2ID3A 3ZQLA 1SANA 3D1NI 1WH5A 4C2MJ 4BBSJ 1XC5A 5J3LA 4A3KJ 4UUSA 2E2IJ 1T56A 2Y30A 4M3GA 1NK3P 2VUMJ 2WV1A 5FKLA 1VF9A 4A93J 3O8HA 3A01B 4M3EA 1A5JA 3CCYA 3MVPA 1HCRA 3A03A 3ZQCA 2VPRA 3JREA 2LTPA 1JUSA 1OFCX 2COBA 4BXXJ 2NOGA 1UMQA 3HBLA 5M3FJ 2MW8A 3ZQHA 3LNQA 5C3EJ 2HOTA 4M3FA 2E1OA 3Q3SA 5F27A 3E7LA 2OPTA 3BTCA 1MBEA 3LSJA 3ZQIA 1AHDP 1BJZA 1POGA 1X58A 1TWFJ 2EZIA 4A3IJ 2EBIA 2FX0A 1APLC 3M4OJ 5GPCA 4BKXA 2CQQA 5EDNA 1YRNA 3F0CA 1U9OA 1I3QJ 4X1EA 3O8GA 5IYDJ 4A69C 1HOMA 3QPSA 4Y7NJ 2YUSA 3DEWA 1W0UA 4DW6A 1B72B 3GTOJ 2HQ5A 1JJ8C 3W6VA 3JRCA 2R5YB 1FEXA 3BG5A 2M8GX 3TP3A 4X6AJ 1MSFC 1MNMC 3CDLA 1Y1VJ 5EZHA 2M2EA 3HDDA 5F08A 5IYBJ 2EH3A 2DTZA 3BTIA 3VPRA 2FQ4A 4B3AA 5E3MA 4HNVA 2K9SA 4FE7A 1DU0A 2LFBA 5FKKA 5GP9A 3TW7A 1UG2A 4UUSB 2DA4A 1ETQA 2XGEA 3JRHA 1H88C 2L9RA 4LOCA 1EF4A 5IP9J 4I6ZA 2DJNA 1PUFA 4XRSA 1ETYA 1ETVA 1H89C 5EEAA 1WPKA 3GTPJ 2ME0A 1IC8A 5IPAA 2XSDC 1OCPA 3LSGA 1F43A 3RZDJ 2G0EA 1FTTA 1JKQC 2HXIA 3PM1A 2MSYA 1FIPA 1A6IA 3S1QJ 2NVXJ 2MGQA 2HOAA 1AKHA 4FTHA 2JA8J 4Y52J 1ETXA 2ME6A 3BG3A 2W48A 3IH2A 1P7JA 4JX4A 3M3YJ 4UUTA 1JUMA 1YRNB 3RQIA 4A3CJ 1JKOC 4BY1J 1B72A 4D5CA 4A3BJ 4NDLA 1TWHJ 4IHYA 3S16J 4G12A 3MKLA 2B63J 2ZB9A 1ENHA 1RKWA 5E3OA 4XIDA 2RAEA 2ECBA 3HEFA 2DA2A 2L7FP 4C3JJ 2OF7A 4QTRA 3K7AJ 5FKNA 2HYJA 3BQYA 1MH3A 3IV5A 1IG7A 3I4NJ 1RPWA 4V2GA 3A02A 3BR3A 1VNDA 1WI3A 3WHBA 1IRZA 3I4MJ 1GVDA 3HM5A 1HLVA 5M3MJ 1ETOA 2LLKA 1TWCJ 4S0HB 2X9DA 5DTDA 3C2BA 3JRIA 3HKZN 4M6VA 4AUXA 4XRMA 2Y0SN 2XB0X 1PUFB 3FK7A 3FKIJ 4XK4A 2QCOA 4AYBN 3TW6A 4GFBA 2TCTA 1P7IA 1BL0A 2DA1A 2XPWA 1ETKA 3UKGA 1U78A 2CUEA 3S14J 1GV5A 3S2DJ 1OCTC 2O7OA 1IJWC 1BW5A 3BQZA 4M3DA 1AKHB 2YS9A 1G2HA 2E2HJ 1QPIA 2HXOA 5F1JA 2DMTA 3GTQJ 3OIOA 2K9QA 3MN2A 5IOZA 1D5YA 1BA5A 3GBGA 5FJ8J 3GTMJ 4C3IJ 2LR8A 2I10A 1ZQ3P 2NVQJ 1JT0A 2DMUA 5EF6A 3FIWA 3LSPA 9ANTA 3OSFA 3BR1A 2O8KA 4RBOA 1JTXA 2HOSA 3JRGA 2ECCA 1E3OC 2CRGA 2IAIA 3HGYA 3ZQFA 4W97A 4QIWN 5IP7J 2R93J 2JN6A 4A3DJ 3FK6A 1IDZA 2O9LA 4ABZA 5E3NA 3S15J 3Q0UA 5FKOA 4B4CA 2H8RA 3B6AA 2E2JJ 3LOCA 2NVYJ 1ORKA 1RR7A 2L7MP 2L7ZA 3GTGJ 1JKPC 2TRTA 2ELKA 1IV6A 1DU6A 1ZGWA 1UHSA 4A3GJ 3QPLA 1S7EA 1U9NA 2VKEA 2CUFA 1ITYA 2K9NA 1GUUA 5EGOA 2PMZN 3BG9A 1X2MA 1IGNA 2R5ZA 2DA6A 1TC3C 2XB5A 3PO3J 3RKQA 3HGGA 3S1NJ 2EZKA 3LSRA 2XGCA 2R0QC 5FLVA 3HOXJ 2NS8A 2M34A 2M0CA 5F0HA 5IOYA 3IH3A 5K7HA 1MBHA 3G1MA 4MIMA 1WCMJ 3B6CA 2K40A 1O4XA 2JK3A 1T33A 2LK2A 1MH4A 1ZKGA 4A3JJ 1Y1WJ 2XGDA 5IYCJ 3GTJJ 2DMNA 1LFUP 4IHWA 4D7NA 3DCFA 1RETA 5EYRA 2E19A 3TEDA 5EG0A 4DZJA 5C4JJ 1I6HJ 2DA7A 5HODA 3HOZJ 1HF0A 2HDDA 1U8BA 1RKTA 1Z0XA 2KDZA 4CYCA 1GT0C 4V2FA 1IUFA 2LD5A 1ZR4A 5J1UA 2L0KA 4JX5A 2JA6J 4IHVA 2LP0A 4B1RA 3CQZJ 3OSGA 2NS7A 1W0TA 3HOWJ 5K7FA 4EEFG 1QVUA 1OJLA 1Q1VA 4FE4A 5C4XJ 5F04A 3PO2J 1MSEC 1MBGA 2FD5A 1JKRC 1LE8A 1TWGJ 2R7ZJ 4JYKA 1JGGA 2WB1N 5EGOB 2R92J 4QSHA 5EZGA 3SFIA 2R5ZB 1Z77A 4M3BA 3HOVJ 4W1UA 2Y9YA 2MG4A 5J1RA 2CJJA 2LY9A 1FJLA 1X2NA 3BT9A 3WHCA 2Y2ZA 3BR0A 1MBFA 3JRFA 2DMPA 2CQXA 1K61A 1ZK8A 1R9TJ 2ID6A 2H1KA 3SJMA 2DN0A 1NTCA 4IHXA 3SDGA 2XRLA 3ZOBA 1JTYA 1ZTRA 1WH7A 5C44J 3S1RJ 2DA3A 1SFOJ 1ZR2A 5JLXA 5FLMJ 5EG0B 3HB9A 2GBYA 2WAQN 1QRYA 1GDTA 2AO9A 2DA5A 4DYQA 3Q0WA 4CYCB 3S17J 5BNGA 1NK2P 4DZPA 3RZOJ 1FIAA 3ZQGA 1VFCA 3TP0A 2HI3A 5IP6A 2NVTJ 3JRAA 1B8IA 3JRBA 1FTZA 4XRSG 4FCYA 4MFEA 1JUPA 2X48A 5F0FA 3H3VK 3IH4A 1H8AC 2JJ7A 3OOUA 5K7ZA 1LFBA 5M5XJ 3GTLJ 1RESA 3Q0VA 2M9HA 1HDPA 3BTJA 3NARA 1LE8B 4DYCA 1AU7A 2QF7A 4DYRA 2VI6A 4L5EA 4XICA 1VI0A 1ETWA 1XS9A 2X6OA 2D5VA 3CMYA 4JP0A 5M5YJ 2AHQA 3BR6A 2IEKA 3FISA 4A3MJ 5J1YA 3G1LA 4JX6A 1JJ6C 3G1OA 3A01A 2VKVA 1QVTA 4MO7A 1HDDC 3GTKJ 1CQTA 3BR5A 1F36A 1MBKA 2N8GA 3NAUA 2P81A 5FKMA 2CU7A 2JMWA 3JRDA 1XG1A 4BY7J 2GLOA 2JWTA 5JLWA 2XPUA 4D5FA 5E3LA 3S1MJ 4MLOA 4IEJA 2EQRA 2Y31A 2FJ1A 4MFDA 5GPAA 3HOYJ 2DMQA 3S2HJ 5F0CA 3JR9A 2Y9ZA 2IBDA 1WGXA 4A3LJ 2EZLA 1IDYA 2JA7J 1JT6A 3QQAA 3HOUJ 3L1PA
chains in the Genus database with same CATH superfamily
3FMQA 4FISA 2DPUA 1X3WB 3T1BA 1LNWA 1WHUA 4F52A 2YU9J 2Q0OA 1MBJA 4CYDA 3MCZA 3OR1C 4XBFA 3PNTA 2CFOA 2XF6A 4QPQA 2P0WA 1SFUA 1Y6IA 2I5UA 2V79A 3H0GJ 4L9JA 2V6EA 2PMHA 5ICEA 4AVZA 4AC0A 4CCNA 4P9UA 2QSGX 3QPTA 3OMYA 1VTNC 1SANA 1LFPA 1W5CC 5LRRA 4BAYA 1G4DA 2HVSA 2R7QA 1WH5A 4XL9A 2HTJA 1GXQA 1N25A 3FXUA 4A3KJ 3N05A 1HA8A 3N97A 1W36C 3QP6A 2Y30A 4M3GA 1NK3P 2VUMJ 2FSWA 4PK4A 3I5UA 2ZXJA 5KHDA 5DM7F 2Z99A 1VF9A 5CVVA 1Z3YA 2DAOA 3GFJA 2Y69H 1JI8A 1U5TA 3CMEI 2CQ7A 5JVGF 3A03A 4Y3OA 3F9KA 1HSJA 1JUSA 2WY8Q 4U0YA 1YO5C 5FRNA 2NOGA 3HBLA 4A0XA 3LNQA 5C3EJ 3PFIA 1Z9CA 1S7AA 4E7ZA 5FD6A 2DDBA 5EJCA 2MBFA 2PN6A 2L9VA 3A2KA 4BE0A 2OPTA 2KMUA 1D1BA 2QSFX 2NS0A 3ZQIA 2CV1A 1IUYA 1K78A 1POGA 1UJ8A 3P9IA 4UY8I 3DP7A 2EBIA 1J59A 2STWA 3M4OJ 5HLTA 1YS7A 5LBQA 3L7WA 5EDNA 2YX4A 5GTIC 4U7BA 1ZLJA 1I3QJ 3GWZA 4X1EA 3WE3A 3A1YA 5ED4A 2YUSA 2JPBA 2TDXA 2W00A 3TL4X 4DW6A 4MEXF 4R79A 3C1DA 1O7LA 3SDBA 3H92A 3E6DA 4PDKA 3BG5A 1SVMA 4B48A 1SC7A 3RYPA 1MSFC 2M7AA 5CPRB 3CDLA 5EZHA 2ETHA 2LNBA 3HDDA 3DBRB 1X3ZB 3VWBA 2P5KA 3V8KA 1UAAA 3JAMK 3BTIA 2FQ4A 4ZYEA 2MFZA 2O6GE 2EK5A 2IRFG 3TW7A 1H88C 2VQHA 3OYCA 1YI2I 4IRHA 4WK8F 1TQMA 4UB6C 4KJZA 4XRSA 4RAZA 3MKYB 4DNCA 1G3YA 5B66C 1P9QC 5LGTA 3WTSC 3QRFF 1H89C 3HG9A 3CCVI 1K6YA 3MD2A 1IF1A 4HOBA 1U5TB 2FBKA 2WB1A 5ILUA 1OCPA 3MFKA 3RZDJ 2G0EA 1JKQC 1SMYF 2D1VA 3PM1A 3ZMDA 2MSYA 2KIMA 2KIUA 4D9JA 3GXOA 4ESFA 5GAEJ 4AIKA 4QLCU 1XSVA 3CUOA 2MGQA 5JVTA 2HOAA 5J4YA 3OYLA 2J5OA 4FTHA 4XM3A 5LHGA 2XKOA 1STZA 3BG3A 3QOPA 2W48A 2GIZA 1P4XA 4JX4A 3ZCOA 2Z9OA 2MLKA 4EJTA 1V55H 1JUMA 2ZNYA 2R7RA 1XD7A 4RB3C 4HF2A 4NHJA 4A3CJ 5E8IA 1VQ8I 2COMA 2GWRA 4HBLA 2GA1A 3CF5F 1L0OC 4D5CA 1XGNA 4LFUA 3CC2I 3S16J 3EPZA 5AIQA 1DGWY 3FXKA 2XF5A 3MKLA 3R60A 4G9YA 3MWMA 3KIOA 2D1HA 4XKCA 4BJ5C 3FX3A 4LMYA 1TQPA 3LFUA 3HEFA 2L7FP 3M9AA 4C3JJ 3KFWX 4QTRA 1F4KA 2V1DA 1OQYA 3WTWC 4G7OF 4P1WA 3I4NJ 2FBHA 4V2GA 3F8NA 4BJTA 1P2FA 2OZUA 1WVRA 3A02A 4XLPF 1IRZA 3GCMA 3P9KA 2DYSH 2UXXA 2X6WA 4S0HB 1WRJA 2WAFA 5DTDA 5LHHA 3HKZN 2ZXIA 3K4KA 1BI0A 3U2RA 4KN4X 2XB0X 3BROA 2IW5A 3FK7A 4XK4A 4P96A 2QCOA 3EUAA 2IGOA 3DF8A 5ICCA 1B6AA 2HVQA 4IF4A 2V4JC 2M0MA 1P7IA 2EFWA 1BL0A 1U78A 2FRHA 2CUEA 2ZKZA 3S14J 3QYEA 1IJWC 2A69F 2M87A 3GEZA 1E2XA 2X0LA 1BIBA 2VKHA 1G2HA 1QPIA 1UELB 3K4LA 2NRAC 4Y17A 3W2AA 4CGZA 1WSUA 2IVMA 3QODA 3MN2A 2ZSIB 4DQ2A 1D5YA 4HRIA 2IA1A 4E7LA 3OYKA 2BYVE 2NVQJ 1TNTA 1EKEA 4F93B 2A6EF 3FMRA 3LSPA 2BY0A 5J6XA 3L2CA 5A2QZ 9ANTA 4LJZF 3ZQ7A 4IL6C 2GAUA 4N4NB 4RBOA 1JTXA 2ECCA 4NQWA 4LK0F 3BLYA 2CUZA 4L18B 1IDZA 2R93J 1D0YA 2KJBA 3F8CA 4YFKF 3QYFA 3Q0UA 1OKRA 3TDZC 3RSNA 3G71I 2GQQA 1ORKA 2B7EA 1ON1A 2XAQA 3W6KB 1MJBA 1XSXA 3GTGJ 1LDJA 4J01A 2W82A 4C9YA 4XLAA 1TP4A 1BI2A 2VE9A 1ZGWA 2CH0A 4BXUA 1U3EM 2QWWA 4WXHA 1U9NA 2VKEA 2OAZA 2CUFA 1BR4A 4AIHA 2F4MB 3BG9A 3K4MA 2CGPA 3PO3J 2AS5F 2VASA 4BU2A 2HFHA 3OOPA 3VYUB 3LSRA 2BW3A 2XGCA 1U5TC 2HQRA 2R0QC 4Y13A 2RNGA 4IQJA 4HQMA 5B1BH 1T39A 2KFDA 3KYCB 4PUSA 5F0HA 4KITB 3BWGA 5FGMA 2B9SA 4C30A 5FFXA 2K40A 2IGNA 3V7RA 5HOOA 1LVAA 2IA2A 3FHZA 3ISPA 2KJCA 1REPC 4NBQA 1ZRDA 1TNSA 3I0TA 1KZHA 4RAYA 1XN7A 1ON2A 1IAWA 1F5TA 2DMNA 4ZZLA 1VQ7I 3PQJA 2LY1A 3DCFA 2VKDA 5EYRA 3SXYA 3TEDA 5EG0A 3HHGA 3CCQI 3HJEA 2R7VA 2F4OB 1EV7A 3P9CA 1X19A 2KDZA 1S9HA 2XKPA 4M6XA 4MQ9F 3JTGA 4RLQA 4NQWB 4ENMA 1O7FA 1TT0A 1IN8A 1IUFA 2LD5A 2XAUA 3BG7A 3DLAA 1SD7A 3CJRB 2VC1A 1I5ZA 3RKWA 2W85A 2HVRA 2JA6J 4DIQA 4HQEA 3CZ6A 4EEFG 2DK8A 4FE4A 5C4XJ 1PP8F 2JQ7A 2CS3A 3BPXA 1XDSA 3PO2J 3JW4A 1LUJB 1JKRC 5GTHC 3UR3C 4TV7A 3Q9SA 1TWGJ 1SVOA 4OAYA 4KDPA 2R7ZJ 2QUFA 5E8GA 3R0AA 2OC6A 3DWLE 1LJ9A 3HOVJ 1J0RA 3U1DA 2DT7B 2BW3B 2ELHA 1RI7A 1YW8A 4XONA 2QQ9A 1MNDA 2VOOA 3LSTA 2PI0A 3F3XA 5L3EA 1ZK8A 3M07A 2ID6A 4RGUA 3ABUA 4HYEA 2FMYA 2K9MA 4XOPA 2E5ZA 3MZ8A 2OZ6A 3J7YJ 2L2OA 1Z05A 2XRLA 4ESBA 1ZTRA 4YG2F 5C44J 3EYYA 2DA3A 2L7KA 5F64A 5EG0B 4AVPA 1GXPA 1JXSA 2BHYA 1VZ0A 2ZFWA 3HB9A 2GBYA 2WAQN 3HXLA 1OYYA 2AO9A 2OQRA 2DA5A 4I01A 1FOYA 4B8XA 3K70D 1ZRFA 3LSHA 3DLLF 4M9XA 2P5LC 1YFHA 1FIAA 2HPIA 3ZQGA 3OS1A 2DBBA 2ZFUA 3TP0A 5HLGA 5CYVA 4PJLA 1G3SA 3JRAA 1TT5B 3E1SA 3V42A 4WWCA 3E6BA 1I1SA 2ZJRF 1MJAA 3TBIA 1G6NA 1Y8RB 4Y4RA 1H8AC 4XSZF 2X51A 5M5XJ 4H0EA 3BTJA 1YE9A 2QF7A 2E1NA 2LBFA 4KIBA 1ULYA 2W4SA 5H6RA 4LLLA 3AG4H 5CQEA 4CZZA 3CMYA 1QZZA 1WZ2A 5J8CA 4CICA 2CV2A 4MNUA 4BH9A 4KMUX 3BR6A 3J80K 3FISA 4A3MJ 1V5FA 2K7LA 2GA2A 4UVAA 1FMWA 1FSHA 2E7WA 5AIPA 1CQTA 1B9MA 1QO0D 3CLOA 3NAUA 2WC2A 5FKMA 2WA0A 4KFCA 1SFKA 2YSRA 3JSOA 5EEGA 5ILVA 4ZYHA 3IRRA 5E1XA 1G59A 5ICGA 3LAPA 2EQRA 3BDDA 5GPAA 2H6CA 1VQ9I 2K4BA 3S2HJ 1IW7F 3RDIA 5FB2A 4MGRA 2EZLA 1RIOH 1DPRA 4NUBA 3L1PA 1VQ5I 4XORA 1FYLA 3PIOF 2ACJA 4WX9A 2QKLB 2JA5J 2VJ5A 4AD9A 4A3EJ 2HTSA 3BR2A 2WWYA 2R5YA 4RAGA 2EZHA 3BC8A 2YX7A 2DI3A 1PDNC 3K69A 5DUKA 1K4SA 2XUBA 3IKTA 2LKXA 1USTA 2H8WA 2Y48A 2B0LA 3GZNB 2R7DA 3E5UA 4MEYF 3OYIA 2E1MB 4BQQA 1BN5A 1WJCA 2LBFB 5HLHA 4EJVA 3CJTB 4CO8A 4E7KA 2M4KA 3WU1B 3K1MA 3FM5A 4BBSJ 1YG2A 2HOEA 2H6BA 3K4BA 3VFZA 3REOA 1W7PA 1EH7A 4ENNA 3BP8A 4EJUA 3CJQB 1UB9A 4BQNA 1YJNI 2XAHA 4J00A 1A5JA 2JA2A 2VPRA 4NC6A 4XLFA 2ZJQF 2COBA 4PSXA 2KP6A 3MKWB 4WF2A 2EV0A 2MW8A 4CXFA 1TTYA 2M8EA 1S7OA 3I58A 1HKTA 2E1OA 3H36A 5F27A 3HPHA 2BZTA 2IGKA 1O3SA 3ONQA 1FBSA 1I6XA 3BTCA 3FXLA 4LB5A 3FXQA 5E17F 5CQGA 4MHGA 3ESWB 2IGMA 3H5AA 4N0BA 4JBAA 1TWFJ 2EZIA 3WU0A 4AWXB 2FX0A 1APLC 2CG4A 4BKXA 2CQQA 4OIRF 3MEXA 4BACA 2YR2A 4R8HA 1U9OA 1M1EB 4A69C 1XGMA 3ASNH 3K70C 3T8RA 1V54H 1X1BA 3E3VA 3H5RA 4YIFA 2DW4A 5JHUA 4IPAA 1D8KA 1HSTA 1KYZA 4YFNF 3HRSA 3W6VA 2K5CA 2R5YB 3F21A 3IL2A 5E1ZB 2M8GX 5F6FA 5D6FA 3EETA 3F72A 3L09A 5DD8A 3SEZA 3TO6A 3OS0A 1MNMC 2DFFA 1Y1VJ 5KNLA 2M2EA 3M1EA 2M30A 5F08A 3ML6A 5IYBJ 2EFQA 3H9GA 3E5QA 5F1RA 1WWXA 3ROUA 4B3AA 3A0HC 3WG9A 4F3QA 3RCOA 1ACIA 2DA4A 1ETQA 3JRHA 4JK1X 1ZGAA 4B43A 1VQLI 1IO2A 2L9RA 1W7PB 4EQQA 5CKTA 1X1DA 4E7SA 4OOIA 4HX8A 3IWZA 2Y0SA 1ETVA 5EEAA 1OPCA 3GTPJ 4UNOA 3HSFA 2ME0A 3G6EI 3NQOA 2DPDA 3FM3A 1F43A 3LSGA 4HF0A 2E7XA 1A6QA 1DDNA 2VJJA 2NNYA 3VOEA 1LDDA 3L2VA 3FXRA 3S1QJ 4L9VA 2HKOA 3FXMA 2OBPA 4NC8A 2OTLI 2JA8J 1TBXA 5LHIA 3NEUA 2RC4A 4A0ZA 2IS4A 1UFMA 5CVIA 4EM0B 4MTEA 5IT3A 1G3WA 3TKYA 4XSXF 3IRQA 1P7JA 3UNGC 1Z7UA 4A5MA 1QPMA 1XMXA 3DTIA 3V7CA 4IKFA 1TWHJ 4L0ZB 1XCVA 2XV4S 3FBIB 3WTYC 2B63J 4JQFA 1R71A 5IT9K 1FOXA 3HHHA 3AG1H 5LGNA 2HQNA 5ICFA 2I8DA 2L5QA 4XLNF 2OF7A 3OY9A 1FNNA 2FQ3A 2VN2A 3LA2A 3KEQA 4XLEA 2HGCA 4OINF 2E1MC 2LY2A 1X4PA 1SFXA 1WI9A 2PJPA 1X4OA 4AM3A 1HLVA 4F92B 2RV8A 2XRNA 2IP2A 2X9DA 3KP4A 1YW7A 3HTUA 2OCEA 1MIJA 4AUXA 2AQFA 1BJAA 4BE1A 3FKIJ 4H4KC 4GYIA 2H94A 2G7HA 2RNJA 1I39A 2PMZA 2QQ8A 2V9PA 2TCTA 2NYXA 2EIKH 4CH7A 2HKXA 4BJ6C 1RC9A 1S29A 2XPWA 5L3FA 2VC0A 3GUDA 1GV5A 3S2DJ 1K6OA 2MA3A 3CCSI 2HR3A 4FASD 2VXZA 1AA7A 1ZG1A 2A07F 3F23A 1QZEA 3KYDB 4II3A 3H5NA 4HZFA 4B44A 2DMTA 3BJAA 2K9QA 4LIUA 3SHFA 3JSPA 3GTMJ 2I10A 2W7NA 4LG0A 4A0YA 1ZAOA 1R1UA 3O2PE 3FIWA 4ZYDA 3KP7A 3TOAA 2O61A 2RDPA 4HDUA 5H6QA 2VBXA 2FUG2 1T08B 2IAIA 2JZYA 2QKMB 2VE8A 4W97A 3PIPF 3CD6I 1LQ1A 3FK6A 3IP4B 2BY3A 2O9LA 5E3NA 3S15J 2HNHA 1Z7LA 5FKOA 3B6AA 5K1YA 5DUIA 2NVYJ 2L7ZA 3V7SA 1A35A 4U88A 2F5DA 1R22A 1MZBA 1IV8A 3D0SA 1Z1DA 3GFLA 2DK5A 3IKVA 1IV6A 4CSWA 1UHSA 4A3GJ 5B3SH 2P5VA 1SAXA 4MTDA 2KPMA 1N75A 1ITYA 1U0JA 4HAMA 1D3YA 5EGOA 1FLIA 2OQGA 4CDGA 2STTA 1ZG3A 3RKQA 1MMAA 3S93A 2F5FA 3WODF 4LLNA 2XHKA 3F8FA 2KIFA 2E34A 3NWTA 3QP5A 2NS8A 2M34A 3LFKA 5K7HA 3IH3A 4XR6A 5L3BA 4MIMA 4KNYA 5FO5A 3Q9VA 4A5NA 1XTAA 3RKYA 1A04A 1R4MB 1FP1D 1T33A 2YU3A 5EEHA 3K9TA 3FWEA 2MC4A 3MAJA 1T38A 4A3JJ 4DBRA 4ZYGA 4DOZA 1UG0A 2WADA 3GTJJ 1LFUP 1EA3A 4NC7A 2H1LA 4LG0B 2GXBA 2WBMA 2BHZA 2P6SA 2CW0F 2ICWG 5C4JJ 5HODA 1E17A 1RKTA 5GAGJ 2VB6A 2V1NA 4LITA 3SZGA 3KZZA 4FHTA 4ZTJA 1B9NA 3I71A 4IRGA 4NNJA 1H9GA 4N9IA 1DUXC 3K1NA 3CDHA 1EJ9A 2M4GA 5HS9A 4PJMA 1FOWA 2FA5A 4EGYA 4B1RA 3QU3A 3OSGA 1W0TA 3VB2A 5K7FA 4G6DA 1OJLA 2HZDA 4EV0A 3C18A 4ZYAA 1Z6TA 2E36A 1MSEC 1MBGA 2FD5A 3HIFA 2UUZA 1VQ4I 1LE8A 1AWCA 2QENA 1TLHB 4GCVA 1JGGA 5LD2C 2DQRA 3G3ZA 3QU6A 5EGOB 4G8XA 2R92J 2L4MA 4QSHA 5EZGA 1J09A 2A68F 3ULQB 3DBHB 1L3LA 3H9JA 4W1UA 4ZTFA 2UXNA 3CCLI 1IN7A 2LY9A 1X2NA 3BT9A 3WHCA 1FJLA 2Y2ZA 2QA4I 3T8TA 1MBFA 2CQXA 1R7JA 3DU6A 1QZYA 1QBJA 1FYMA 1H0MA 3V4GA 2E5NA 2L3DA 3M7GA 3ZPLA 1QHHD 1BIAA 2PJRA 2XAFA 3BCBA 1DPUA 3CCJI 1NTCA 4IHXA 3VDXA 3I55I 3ZOBA 1JTYA 1WH7A 5DDGA 3PNYA 3EDPA 3S1RJ 2GOMA 1Z91A 3ECOA 5JLXA 2H09A 1QU3A 4RMNA 1F1ZA 1TQIA 3OIQA 4XKWA 4IX7A 3DTEA 1GDTA 3ZGKA 2WTEA 3SFZA 3WGGA 4ZDOA 5HS7A 4IXAA 3DKYA 2VLAA 1VQ6I 1HKSA 5D8KB 5CVJA 3KPHA 2EJRA 1FBUA 2HI3A 3H0DA 4UB8C 5IP6A 2NVTJ 3CCRI 5LFAA 2ZO4A 4N4OB 3MZHA 1B8IA 1UHMA 2E35A 2FOKA 3ABKH 1FTZA 2L01A 4MFEA 2X48A 2V1UA 3BZCA 3DKWA 3I9V2 5HDNA 3S3NA 2OUMA 1BI1A 3D5SC 4B3XA 4CA0A 3GZ6A 5D8LB 1HDPA 2FNAA 1LE8B 5FLXZ 4DYRA 2HU9A 4M6YA 3VSLA 3VODA 3RIRA 3T5XA 3MKZA 1ETWA 1USSA 1T6SA 2X6OA 4FX0A 4PSWA 2D5VA 3PNVA 1J5YA 2Z1DA 4JP0A 1YHQI 2AHQA 2LSOA 4WXCA 2IEKA 5JHFA 1YYVA 2L02A 3ZP5A 3G1LA 3RYRA 4MO7A 1QVTA 1OCZH 2XAGA 5KAFC 5HS8A 3GTKJ 4M71A 2N8GA 3W2VA 3EYIA 1ERDA 3M8JA 1A36A 2IJLA 3IAS2 1FT9A 4BY7J 2PJRB 3FDYA 5H20A 2LKSA 3S2WA 2GLOA 2JWTA 3AG3H 3RPUD 2XPUA 5JLWA 2R7WA 5E3LA 4MLOA 4IEJA 4A12A 2VPLA 1XB4A 1IRXA 2UWMA 2XASA 2M45A 4UXNA 4A3LJ 1FX7A 1IN6A 4XN0A 3K2ZA 4KMFA 4I2OA 3BTLA 4D7MA 4IRIA 4XMYA 5TISC 4J19A 2LVSA 3ZMVA 4C3HJ 1VQOI 2VODA 3HUGA 2AXTC 1PVEA 5BQTA 3QWLA 2XPVA 1WJAA 2DU9A 1GV2A 4BBRJ 1B8IB 1N78A 1X1AA 3HC7A 4BQOA 4KIFA 2QSHX 3HSRA 1T0FA 1Z3XA 1CF7A 1KU7A 4GO1A 5M5WJ 4RDUA 1A31A 3VYSB 2ID3A 3H9QA 3D1NI 5FD5A 1NG7A 1JHFA 1ZREA 5CLSA 1MKMA 5J3LA 4RGSA 2O5RA 4EJOA 1T56A 1WFXA 3BPVA 3OYDA 1X1PA 5HDGA 4A93J 3O8HA 3PL8A 1R1TA 1F9NA 2LC2A 1EH8A 4M3EA 4C2UA 2X6YA 3CCYA 3MVPA 2BXZA 3AL0B 2IT0A 3P7NA 2QBYA 2LTPA 1HW5A 3PJRA 4BXXJ 3K6GA 1UMQA 1OR7A 5M3FJ 4PJ0C 4O5VA 4KUMA 5LLQA 3AFHA 1ONVA 4HNTA 3KLOA 1OCCH 4HX4A 2M7BA 2QEXI 2HWVA 5DCFA 3ZN1A 3KETA 1AHDP 3L00A 1BJZA 3DBLB 3HSEA 2FF4A 4A3IJ 5BOXA 4ETSA 5GPCA 1OYWA 1YRNA 3X2QH 1U6GA 3F0CA 5A2QK 3KP3A 3GMEA 5D5XB 3WE2A 3DEWA 1MDMB 2BVLA 1W0UA 2VQGA 4LG3A 1O3TA 1K4TA 3HUGB 1B72B 3GTOJ 2JUCA 2BGCA 3CMMA 5DV5A 1MD0A 5FROA 3JRCA 3QAHA 4IHTA 1XX5A 3TP3A 3MQ0A 4KYWA 1CF7B 2HQAA 3CP2A 2EH3A 3RJPA 1XCBA 2DTZA 1SFEA 3VYTB 1JGSA 2FU4A 2XF7A 4EJWA 3DXJF 5D4SA 3DFGA 3WG7H 2MLGA 4HNVA 3WTVC 2K9SA 4FE7A 1DU0A 3EUHA 4QWQA 2DYRH 3BOQA 2D2WA 2K9LA 3H3ZA 1BR1A 1UHWA 4LOCA 1EF4A 3CLQA 3J81Z 2KRHA 3RPQA 1ETYA 2X85A 1TL8A 1RR8C 1S8NA 1WPKA 4PFPA 4CCMA 3FHNA 4AYBA 1R49A 5IPAA 4GXOA 3LAJA 3C2GA 2QBYB 3EQLF 1EH6A 2DOAA 3IHUA 4I99C 2HXIA 4R1HA 2VQLA 3K4CA 4BDYA 2NVXJ 2NXNB 2FNPA 1D0XA 1YQAA 4PGGA 4Y52J 1ETXA 2Y0MA 3C2HA 3FKJA 4G6TB 2Z5UA 2ZNZA 1XGSA 3CJNA 2HPMA 2OTJI 3IH2A 3M3YJ 4MQVA 3KEYA 1IXSB 1YRNB 5J47A 1JKOC 2FEZA 2BXYA 2PX9A 4BY1J 3JTHA 4NDLA 4IHYA 4A3BJ 1FY7A 1HXDA 1LDKB 1Z6RA 2A6HF 1RKWA 2R7FA 4BEHA 5E3OA 3TO9A 5LRSA 3G73A 3HOTA 3PQKA 2WAQA 4BYYA 2Z2SB 3KZIC 3OWTA 2ECBA 4ASNA 4PGHA 2O0YA 4EGZA 5FKNA 4ZDPA 4BNCA 4HLXA 1MJ9A 2RVCA 2VT2A 2F48A 2FBIA 1MH3A 4UV8A 1XSDA 1RPWA 4QPOA 3GVAA 1KQ8A 1VNDA 4YRVA 5D4RA 3I4MJ 3HM5A 1ZH5A 1Y39A 1ETOA 2LLKA 2BV6A 1FWZA 3R4KA 3C2BA 4Q48A 5D5VB 3TOBA 3OYBA 2O03A 4FETA 2LF8A 1HQCA 1YX5A 4I09A 3KP5A 4XRMA 2Y0SN 3J7AY 4A2UA 2RKHA 2W57A 1KGSA 1BBYA 1W36D 2FXAA 2LKPA 1SMTA 1E0EA 4HSRA 1IRGA 4G94A 2QLZA 2R7OA 4RB1A 3AL0C 3J7AO 3IWFA 1ETKA 1QQIA 1LEAA 3K4NA 4M73A 1HKQA 2O7OA 3MZYA 3BQZA 3ASOH 4V19K 2VONA 3E97A 1ZGJA 5IY5H 3LQQA 5F1JA 4P9FA 2CV0A 1BI3A 1NG6A 4M9SA 2BOLA 4HX7A 4M74A 3OIOA 3SEQA 3VSKA 1BA5A 1C0WA 1XMAA 4UVCA 2HZTA 3W2WA 1QGPA 1PJRA 4E7IA 3F8BA 1PP7U 1R4NB 5EF6A 2LDUA 5DD4A 2V9KA 5H2FC 3BR1A 1OYIA 1HW1A 3B02A 4BEHB 5JR3A 1DQUA 3JRGA 1E3OC 2HOSA 2CRGA 1BOBA 3E5XA 2IXSA 3T0YA 3C3WA 3QOEA 3WTUC 2JN6A 4RAFA 3ZMUA 1YJWI 1TW2A 2Z16A 1T0FC 3K4JA 1E3HA 4S05A 1Z67A 4RGXA 2E2JJ 3LOCA 2EFPA 2MYSA 2L7MP 2V1XA 1JKPC 2JT1A 1DP3A 2TRTA 1R6RA 2ELKA 3JAMZ 1GHCA 1DU6A 3D5RC 2R7XA 1S7EA 2GXGA 3L9FA 2R7TA 2LOOA 3CUQA 4IO9F 3QYBA 2JSCA 3KCCA 3N4MA 2K9NA 4LK1F 1GUUA 1Y56A 2P8TA 2PMZN 1IGNA 1TC3C 2DA6A 2IA0A 4YEJA 3R0JA 3NRVA 1U2WA 2M5WA 3HGGA 3WTZA 4EMSA 3S1NJ 4I0BA 2EZKA 3TQNA 5FLVA 2BVMA 4WXDA 1IXCA 2EFOA 3OIPA 4L9NA 2KRCA 2UV1A 4CCJA 3O3KA 2JVHA 4KICA 1MBHA 1OR7C 3G1MA 1ZARA 2V6CA 1O4XA 2JK3A 4G7ZF 4U0VA 1J9IA 2DLLA 1ZKGA 4JOMA 2A61A 3SZPA 4B09A 1Y1WJ 1ZELA 2IPQX 1KU3A 2W24A 3RQ4A 4IHWA 1RZ4A 4D7NA 2DFHA 2PEXA 1RETA 1PUEE 4DZJA 2JVGA 1I6HJ 2DA7A 2EV6A 1QHGA 2GIVA 3BJ6A 4L5JA 3OL4A 2ZMEA 5D5UB 3KP6A 3BY6A 1GT0C 2G9WA 3LSKA 4V2FA 4XKBA 5D5WB 2Q8KA 5JFRA 1R1VA 1GVJA 1ODDA 1ZR4A 5BS6A 4NB5A 5J1UA 2L0KA 2DFIA 3W3CA 2NAZA 3SYTA 4JX5A 4X0GA 2IS1A 3CQZJ 2DXIA 1ZG5A 2IS2A 3ZMZA 2HDCA 1R00A 3LMMA 2O8XA 3E6CC 1VQNI 2KL4A 4IZZA 5LGUA 2K02A 3EUHC 3CUQB 4EVIA 4GDFA 4I7HA 2WB1N 2AXLA 3GLLA 3ZMTA 1SVLA 1P92A 2DOFA 1RRJA 1NHAA 3BG6A 2ADUA 1P4WA 1FOKA 3I4PA 3KZYA 1X1CA 2Y9YA 1FPQA 3F6VA 2JRMA 1V5GA 3IC7A 3OR2C 4RB0A 1T2KA 3LSMA 2Z33A 1K61A 1MNEA 4PJJA 5KCMA 5HDKA 2GZWA 1IN4A 2QVOA 3OYFA 4XRFA 2FMLA 4ZDLA 5K5QA 3SJMA 2DN0A 2NVUB 3ECHA 2P4WA 2PQ8A 3WU2C 1FBQA 5CJ9A 2PG4A 3GFMA 2DOEA 1G8XA 1G3TA 1SFOJ 3GFIA 4E7JA 1R23A 1YX3A 2OCCH 1OISA 2LG4A 3HZJA 1QRYA 1YS6A 2ZMEB 3CESA 4AIDA 4DYQA 1ZN2A 3Q0WA 2XC7A 3S17J 1BR2A 3P5JA 1NK2P 3RZOJ 1AOYA 3IUOA 3OS2A 1E3PA 2YPRA 3GF2A 1IXRC 3M1CA 4UHTA 1VFCA 3VEPA 3KX2A 2KLOA 3FMSA 4Y15A 3U1KA 1WJ5A 2QYOA 5HLIA 3ABMH 4FCYA 3HYIA 5F0FA 3DTKA 3H3VK 3OOUA 3R61A 5K7ZA 1HBXG 1RESA 3Q0VA 3PSFA 3NARA 1I3AA 4DYCA 3GX4X 1AU7A 3CO7C 2VI6A 4L5EA 4XICA 3ELKA 5CVUA 1T98A 1VI0A 3OL3A 1XMKA 1OCOH 2DJIA 3LSIA 4OWRB 3W6JB 4CCOA 3I59A 2F6CA 4EATA 1B59A 1JHHA 3FXOA 3OYGA 3HOSA 2EV5A 4GYGA 4BS9A 5J1YA 2R7SA 4ZH4F 4JX6A 4KN7X 5B1AH 3A01A 2Q1ZB 2KQRA 2VKVA 1HDDC 2PBIA 3BR5A 3DEUA 1F36A 1MBKA 5GADJ 2H27A 2JPCA 2P81A 4XLHA 2CW7A 4G6QA 2LH9A 3HRUA 2F4IA 3DQVC 2CU7A 2ISYA 4N9HA 1KU2A 1XG1A 3FF5A 5K5OA 4Q47A 2GOXB 2JRTA 2K27A 4ANJA 4D5FA 3S1MJ 2VL8A 2Y31A 2FJ1A 2EILH 4MFDA 5L3DA 4DJAA 3HOYJ 2DMQA 2AQEA 2MH9A 5E1WA 3CO6C 2ZBKA 4GRIA 1KONA 2Y9ZA 2IBDA 1WGXA 2V7FA 4HV5A 3OV8A 1IDYA 2JA7J 1JT6A 5FFZA 2VJ4A 3QQAA 1K78B 3HOUJ 1T8IA 1XPXA 3K2AA 2L4AA 2KRFA 3B73A 2X1DA 5DS9A 2OJED 1V5EA 1I1GA 2MD0A 3LA3A 3AKZA 1HW2A 6PAXA 4CZCA 4A3FJ 4I76A 2GM4A 4O6JA 4Z2YA 3SZTA 2CFXA 1BW6A 3CCMI 1RUOA 2KT0A 3ZQQA 1I50J 1KQ9A 2CW8A 1K83J 1TWAJ 3ZQLA 2F2EA 2Y75A 3A0BC 3LL7A 4HG2A 3CUQC 2ELJA 4C2MJ 2FOWA 4DBQA 1XC5A 2HYGD 4XKVA 1FSEA 4RS8A 1KA8A 4UUSA 2E2IJ 3I59B 2V26A 4RM2A 3VYRB 3K10A 4IOCF 2WV1A 3CDIA 5FKLA 2EFNA 2Q2EA 3DPTA 1FZPB 2D45A 3D5LA 3HTSB 3GYHX 3A01B 2JSPA 4KT6A 5B5EC 2G7UA 1XGOA 1OCRH 4E70A 4HF1A 1HCRA 2KISA 3ZQCA 3JREA 1OFCX 2QQAA 2UZKA 3DPLC 3RPUA 4EM2A 2R7UA 4AU7A 3ZQHA 3PFYA 2E1CA 3TO7A 2HOTA 4M3FA 3Q3SA 1PYVA 2BY1A 3E7LA 2JTVA 1D8JA 2EWNA 3RKXA 1MBEA 1KYWA 4F7ZA 3LSJA 3WTXC 2O3FA 2V9VA 3RTRA 1X58A 4BUPA 1HC8A 2J5PA 2L9NA 4ON0A 2ZMEC 1S3JA 2DODA 3O8GA 4OIPF 5IYDJ 1HOMA 3QPSA 4Y7NJ 1VQPI 2OV7A 2F5CA 4UUVA 2A6TA 2XAJA 2M1BA 2HQ5A 3RI4A 1JJ8C 5L3GA 1FEXA 1H9TA 2DFEA 5BMZA 4X6AJ 3S8PA 3TDUC 2A5YB 2ZXHA 2XVCA 1KQ0A 2FE3A 4U7DA 2E71A 4A6EA 3OYJA 2KZGA 3EUKL 1D1AA 1R58A 3VPRA 1N77A 2HS5A 2LF7A 4YIIA 4BHPA 2BY2A 5E3MA 2DCEA 1ZRCA 4FT8A 2VBZA 2LFBA 5FKKA 5GP9A 1P6RA 1UG2A 4UUSB 2XGEA 1Y8QB 3HRTA 5J8FA 1OMIA 3DV8A 2Q2EB 2QM3A 3HKZA 4BHBA 5IP9J 2W84A 3ERED 4I6ZA 2DJNA 1PUFA 3OYNA 4IQ4A 3J80Z 2LRDA 2WY7Q 2RQPA 3E0JB 3S3OA 2EA2A 4UVBA 1IC8A 2XSDC 2ZJ2A 4WCGA 1SD5A 4BHCA 1VQKI 5HNFA 1FTTA 2OA4A 3I64A 4HLYA 3FZVA 1FIPA 1A6IA 3L2QA 2DDAA 1AKHA 4LLGF 1R36A 2W1OA 3K0LA 2ME6A 3J7ZI 4BL0B 3I56I 3JCUC 3H1CA 4UV9A 2KKOA 5BPIA 1RUNA 4BQAA 1D1CA 4LGWA 1R5GA 3ZRGA 2IS6A 5DYMA 4UUTA 4XLCA 3RQIA 1MDMA 1B72A 4YELA 2XDVA 2QZ8A 5ILSA 4E6KG 2P7CB 1SD6A 4G12A 3G2BA 1ZYRF 2ISZA 2KIQA 2ZB9A 1ENHA 1Q1HA 3IAM2 1S72I 4C2TA 2LREA 2CQKA 4XN3A 4FQGA 2RAEA 2EB7A 4XIDA 2VBWA 2DA2A 1V4RA 1D5VA 1FC3A 1TZLA 3K7AJ 1LPQA 2HYJA 5DEQA 2PLYA 3BQYA 2ESNA 3CP8A 2K4JA 1MW7A 4G7HF 5TRDA 1VQMI 1GLNA 5HNHA 3IV5A 1BC8C 1IG7A 2HDWA 2DO7A 2NOJB 3AAFA 3LA7A 3BR3A 1WI3A 2VIXA 3WHBA 2K3PA 1OLTA 5KVRA 1GVDA 4ITVA 5M3MJ 1SAUA 1TWCJ 2P6TA 4HNUA 5E20A 3JRIA 4IVNA 4Y33A 4B47A 1YLFA 2JUGA 5LEKA 4HV6A 4M6VA 4LB6B 2ZC2A 1X3UA 1PUFB 3GLXA 2VBYA 4KT5C 4AYBN 2XGXA 3TW6A 4GFBA 1SD4A 1YIJI 2DA1A 2XSJC 2CUJA 4KIGA 3UKGA 5DM6F 4P5OA 1S6LA 4CUGA 2PFBA 5TGTA 1WKMA 1OCTC 1B1BA 2KDOA 2W25A 3O6BB 3KYLA 1YIOA 1BW5A 4PJNA 2MC3A 4D1QA 5ERIA 4M3DA 1O3RA 2BBYA 2CYYA 4DGWB 4LD5A 5J4VA 2X1CA 2YS9A 1AKHB 4OMYA 2EIMH 1FYKA 1ZHFA 2KHMA 4PCQA 2E2HJ 2HXOA 1BC7C 2L54A 4IOAF 3OYMA 3BZKA 3L2UA 3GTQJ 3E6MA 4XNFA 5IOZA 2ESHA 2A5WA 2VQCA 3M8FA 3GBGA 5FJ8J 4HPQA 2LR8A 4C3IJ 1KU9A 2MABA 1ZQ3P 1JT0A 4GGGA 4F55A 2DMUA 4K2EA 4HEA2 2DQLA 4L5IA 4U87A 1YITI 3OSFA 2ZSHB 1R5HA 5KK1A 1W5SA 3OYAA 2CSOA 2O8KA 3CC7I 4HW0A 1RNLA 3HGYA 4QIWN 3ZQFA 1Y0UA 5IP7J 4A3DJ 3L2RA 2CO5A 4ABZA 5FRMA 3BZ6A 2OU2A 3I54A 4B4CA 2H8RA 4XOTA 5BPDA 1NH3A 1W4MA 1Y0NA 1WJFA 1LKXA 1P4AA 1RR7A 4HSTA 1QA6A 2X4HA 1J2XA 1WJEA 3OYHA 4EM1A 1O3QA 4ZZDA 5FLXK 3QPLA 2BEOA 4IJAA 4AIJA 5J40A 3ZN0A 1O57A 2DTRA 2CWEA 3M8EA 4BE2A 5KAIC 3NWSA 1XDUA 2MD5A 3L2WA 3OYEA 1X2MA 1B4AA 2R5ZA 3U9GA 2XB5A 4ENKA 1JE8A 2DT5A 2VXDA 2C6YA 3KLNA 3ZMSA 1W5TA 2PMUA 2WV0A 4BGDA 3HOXJ 3HRMA 3F8MA 2M0CA 4BXFA 5IOYA 4RM3A 3C7JA 2X6XA 1WCMJ 3B6CA 1J75A 2VOPA 1SEUA 4KISA 2CQNA 3CF2A 3BJOA 3SQNA 1Z21A 3I53A 4CCLA 5LEJA 2LK2A 1MH4A 1S5LC 1V3FA 3WTTC 3U21A 1BM9A 3LQRA 4YFXF 2XGDA 4PZJA 5E79C 3V8JA 5IYCJ 3PUFA 4YIRX 3Q5FA 2GXAA 5TJJA 2A05A 3LWFA 2E19A 1MGTA 2VT3A 4OMZA 3HOZJ 1HF0A 4FX4A 4I98B 2HDDA 4F91B 1U8BA 4RGRA 1Z0XA 4IHSA 3CTAA 4CYCA 3DEEA 5DCMA 4CHUA 4I0AA 2Z3YA 5IT9Z 4Q4ZF 1K7AA 3ZR8X 4HDVA 1I27A 4Q5SF 4IHVA 2LP0A 2NS7A 3HPGA 4S04A 3HOWJ 1QVUA 5HVQC 1Q1VA 1DGRM 5F04A 1BOAA 3KE2A 2WAEA 2K3FA 4RLFA 2DT6A 2EIJH 4P55A 1YOVB 2M3AA 4E4HA 3DPUA 4JYKA 3QPHA 1DP7P 1T95A 4CCKA 1MMSA 1FMVA 1J7KA 3ABLH 1FP2A 3PSIA 1Z77A 3SFIA 4M3BA 2R5ZB 3S3MA 2MG4A 3K1PA 5J1RA 2CJJA 4OAZA 5AONA 3V8LA 2L9SA 5GAHJ 5K5RA 2RGVA 3BR0A 4Z6YA 2HEOA 3JRFA 2DMPA 3DU5A 3WGIA 2XIGA 2QGUA 1WQ2A 1IZ1A 2K85A 2QQBA 1R9TJ 3I3LA 4PFOA 2H1KA 1U8RA 4ZC3A 2EA4A 3R6SA 2F5VA 4OU0A 1IRFA 4ENJA 1YTYA 2LMDA 4A6DA 3CC4I 3CCUI 3CMAI 1UCRA 4RB2C 2RN7A 3SDGA 1W1WE 4I02A 3GZ5A 4D0PA 4HA8A 4OIQF 1WJDA 1ZR2A 4BDZA 5FLMJ 1LVKA 2NNNA 4ZJZA 3H35A 2RQQA 3A4CA 4RA2A 3F6OA 2KZVA 3FBNB 4CYCB 3HL2A 3FXJA 3GO5A 5BNGA 1QNTA 5E18F 4DZPA 1R5ID 2ZXWH 5DCMB 5JI6A 1MMNA 4U0WA 2ZJPF 2RREA 4E7HA 3ABTA 3JRBA 3WGHA 4KA4A 4OIOF 2K86A 4XRSG 3PUBA 3CCEI 2BE5F 1JUPA 4ESJA 3MMYB 3IH4A 1D0ZA 4M9ZA 2JJ7A 3GTLJ 3ERMA 1LFBA 2E60A 3DKXA 2M9HA 3COAC 3TGNA 3KEOA 1YJ9I 2HYFA 1XS9A 2LYCA 2VJIA 3GW2A 3J81K 5M5YJ 4II2A 3F22A 1W7PD 4O3MA 2OD5A 1JJ6C 2F5EA 3G1OA 1K79A 1YW9A 3BCAA 2A3SA 2R3SA 5L3CA 1TW3A 2EINH 2JMWA 2R4GA 3JRDA 1LEBA 3AG2H 3S32A 3G4SI 1CGPA 3ZXSA 4L0YB 4LIVA 1MMDA 1IN5A 4L9TA 5D6EA 1MMGA 4M72A 5F0CA 3JR9A 5CVRA 2ZCWA 1WJBA 3TMOA 4XQFA 1ZLKA 2CMPA 3H3UA 1UZCA 2EPFA 2MH2A 2P7VB 2XROA 1LB2A 3KP2A 2X1EA
chains in the Genus database with same CATH topology
3BTLA 3K2AA 4FISA 5DS9A 4D7MA 2JA5J 4J19A 2LVSA 4C3HJ 2YU9J 1MBJA 4A3EJ 3BR2A 2XPVA 2R5YA 1GV2A 2EZHA 4BBRJ 1B8IB 2GM4A 4A3FJ 4I76A 2LKXA 3H0GJ 1BW6A 5M5WJ 2KT0A 4RDUA 1I50J 4AC0A 1K83J 1TWAJ 2ID3A 3ZQLA 1SANA 3D1NI 1WH5A 4C2MJ 4BBSJ 1XC5A 5J3LA 4A3KJ 4UUSA 2E2IJ 1T56A 2Y30A 4M3GA 1NK3P 2VUMJ 2WV1A 5FKLA 1VF9A 4A93J 3O8HA 3A01B 4M3EA 1A5JA 3CCYA 3MVPA 1HCRA 3A03A 3ZQCA 2VPRA 3JREA 2LTPA 1JUSA 1OFCX 2COBA 4BXXJ 2NOGA 1UMQA 3HBLA 5M3FJ 2MW8A 3ZQHA 3LNQA 5C3EJ 2HOTA 4M3FA 2E1OA 3Q3SA 5F27A 3E7LA 2OPTA 3BTCA 1MBEA 3LSJA 3ZQIA 1AHDP 1BJZA 1POGA 1X58A 1TWFJ 2EZIA 4A3IJ 2EBIA 2FX0A 1APLC 3M4OJ 5GPCA 4BKXA 2CQQA 5EDNA 1YRNA 3F0CA 1U9OA 1I3QJ 4X1EA 3O8GA 5IYDJ 4A69C 1HOMA 3QPSA 4Y7NJ 2YUSA 3DEWA 1W0UA 4DW6A 1B72B 3GTOJ 2HQ5A 1JJ8C 3W6VA 3JRCA 2R5YB 1FEXA 3BG5A 2M8GX 3TP3A 4X6AJ 1MSFC 1MNMC 3CDLA 1Y1VJ 5EZHA 2M2EA 3HDDA 5F08A 5IYBJ 2EH3A 2DTZA 3BTIA 3VPRA 2FQ4A 4B3AA 5E3MA 4HNVA 2K9SA 4FE7A 1DU0A 2LFBA 5FKKA 5GP9A 3TW7A 1UG2A 4UUSB 2DA4A 1ETQA 2XGEA 3JRHA 1H88C 2L9RA 4LOCA 1EF4A 5IP9J 4I6ZA 2DJNA 1PUFA 4XRSA 1ETYA 1ETVA 1H89C 5EEAA 1WPKA 3GTPJ 2ME0A 1IC8A 5IPAA 2XSDC 1OCPA 3LSGA 1F43A 3RZDJ 2G0EA 1FTTA 1JKQC 2HXIA 3PM1A 2MSYA 1FIPA 1A6IA 3S1QJ 2NVXJ 2MGQA 2HOAA 1AKHA 4FTHA 2JA8J 4Y52J 1ETXA 2ME6A 3BG3A 2W48A 3IH2A 1P7JA 4JX4A 3M3YJ 4UUTA 1JUMA 1YRNB 3RQIA 4A3CJ 1JKOC 4BY1J 1B72A 4D5CA 4A3BJ 4NDLA 1TWHJ 4IHYA 3S16J 4G12A 3MKLA 2B63J 2ZB9A 1ENHA 1RKWA 5E3OA 4XIDA 2RAEA 2ECBA 3HEFA 2DA2A 2L7FP 4C3JJ 2OF7A 4QTRA 3K7AJ 5FKNA 2HYJA 3BQYA 1MH3A 3IV5A 1IG7A 3I4NJ 1RPWA 4V2GA 3A02A 3BR3A 1VNDA 1WI3A 3WHBA 1IRZA 3I4MJ 1GVDA 3HM5A 1HLVA 5M3MJ 1ETOA 2LLKA 1TWCJ 4S0HB 2X9DA 5DTDA 3C2BA 3JRIA 3HKZN 4M6VA 4AUXA 4XRMA 2Y0SN 2XB0X 1PUFB 3FK7A 3FKIJ 4XK4A 2QCOA 4AYBN 3TW6A 4GFBA 2TCTA 1P7IA 1BL0A 2DA1A 2XPWA 1ETKA 3UKGA 1U78A 2CUEA 3S14J 1GV5A 3S2DJ 1OCTC 2O7OA 1IJWC 1BW5A 3BQZA 4M3DA 1AKHB 2YS9A 1G2HA 2E2HJ 1QPIA 2HXOA 5F1JA 2DMTA 3GTQJ 3OIOA 2K9QA 3MN2A 5IOZA 1D5YA 1BA5A 3GBGA 5FJ8J 3GTMJ 4C3IJ 2LR8A 2I10A 1ZQ3P 2NVQJ 1JT0A 2DMUA 5EF6A 3FIWA 3LSPA 9ANTA 3OSFA 3BR1A 2O8KA 4RBOA 1JTXA 2HOSA 3JRGA 2ECCA 1E3OC 2CRGA 2IAIA 3HGYA 3ZQFA 4W97A 4QIWN 5IP7J 2R93J 2JN6A 4A3DJ 3FK6A 1IDZA 2O9LA 4ABZA 5E3NA 3S15J 3Q0UA 5FKOA 4B4CA 2H8RA 3B6AA 2E2JJ 3LOCA 2NVYJ 1ORKA 1RR7A 2L7MP 2L7ZA 3GTGJ 1JKPC 2TRTA 2ELKA 1IV6A 1DU6A 1ZGWA 1UHSA 4A3GJ 3QPLA 1S7EA 1U9NA 2VKEA 2CUFA 1ITYA 2K9NA 1GUUA 5EGOA 2PMZN 3BG9A 1X2MA 1IGNA 2R5ZA 2DA6A 1TC3C 2XB5A 3PO3J 3RKQA 3HGGA 3S1NJ 2EZKA 3LSRA 2XGCA 2R0QC 5FLVA 3HOXJ 2NS8A 2M34A 2M0CA 5F0HA 5IOYA 3IH3A 5K7HA 1MBHA 3G1MA 4MIMA 1WCMJ 3B6CA 2K40A 1O4XA 2JK3A 1T33A 2LK2A 1MH4A 1ZKGA 4A3JJ 1Y1WJ 2XGDA 5IYCJ 3GTJJ 2DMNA 1LFUP 4IHWA 4D7NA 3DCFA 1RETA 5EYRA 2E19A 3TEDA 5EG0A 4DZJA 5C4JJ 1I6HJ 2DA7A 5HODA 3HOZJ 1HF0A 2HDDA 1U8BA 1RKTA 1Z0XA 2KDZA 4CYCA 1GT0C 4V2FA 1IUFA 2LD5A 1ZR4A 5J1UA 2L0KA 4JX5A 2JA6J 4IHVA 2LP0A 4B1RA 3CQZJ 3OSGA 2NS7A 1W0TA 3HOWJ 5K7FA 4EEFG 1QVUA 1OJLA 1Q1VA 4FE4A 5C4XJ 5F04A 3PO2J 1MSEC 1MBGA 2FD5A 1JKRC 1LE8A 1TWGJ 2R7ZJ 4JYKA 1JGGA 2WB1N 5EGOB 2R92J 4QSHA 5EZGA 3SFIA 2R5ZB 1Z77A 4M3BA 3HOVJ 4W1UA 2Y9YA 2MG4A 5J1RA 2CJJA 2LY9A 1FJLA 1X2NA 3BT9A 3WHCA 2Y2ZA 3BR0A 1MBFA 3JRFA 2DMPA 2CQXA 1K61A 1ZK8A 1R9TJ 2ID6A 2H1KA 3SJMA 2DN0A 1NTCA 4IHXA 3SDGA 2XRLA 3ZOBA 1JTYA 1ZTRA 1WH7A 5C44J 3S1RJ 2DA3A 1SFOJ 1ZR2A 5JLXA 5FLMJ 5EG0B 3HB9A 2GBYA 2WAQN 1QRYA 1GDTA 2AO9A 2DA5A 4DYQA 3Q0WA 4CYCB 3S17J 5BNGA 1NK2P 4DZPA 3RZOJ 1FIAA 3ZQGA 1VFCA 3TP0A 2HI3A 5IP6A 2NVTJ 3JRAA 1B8IA 3JRBA 1FTZA 4XRSG 4FCYA 4MFEA 1JUPA 2X48A 5F0FA 3H3VK 3IH4A 1H8AC 2JJ7A 3OOUA 5K7ZA 1LFBA 5M5XJ 3GTLJ 1RESA 3Q0VA 2M9HA 1HDPA 3BTJA 3NARA 1LE8B 4DYCA 1AU7A 2QF7A 4DYRA 2VI6A 4L5EA 4XICA 1VI0A 1ETWA 1XS9A 2X6OA 2D5VA 3CMYA 4JP0A 5M5YJ 2AHQA 3BR6A 2IEKA 3FISA 4A3MJ 5J1YA 3G1LA 4JX6A 1JJ6C 3G1OA 3A01A 2VKVA 1QVTA 4MO7A 1HDDC 3GTKJ 1CQTA 3BR5A 1F36A 1MBKA 2N8GA 3NAUA 2P81A 5FKMA 2CU7A 2JMWA 3JRDA 1XG1A 4BY7J 2GLOA 2JWTA 5JLWA 2XPUA 4D5FA 5E3LA 3S1MJ 4MLOA 4IEJA 2EQRA 2Y31A 2FJ1A 4MFDA 5GPAA 3HOYJ 2DMQA 3S2HJ 5F0CA 3JR9A 2Y9ZA 2IBDA 1WGXA 4A3LJ 2EZLA 1IDYA 2JA7J 1JT6A 3QQAA 3HOUJ 3L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTL A;  3K2A A;  4FIS A;  5DS9 A;  4D7M A;  2JA5 J;  4J19 A;  2LVS A;  4C3H J;  2YU9 J;  1MBJ A;  4A3E J;  3BR2 A;  2XPV A;  2R5Y A;  1GV2 A;  2EZH A;  4BBR J;  1B8I B;  2GM4 A;  4A3F J;  4I76 A;  2LKX A;  3H0G J;  1BW6 A;  5M5W J;  2KT0 A;  4RDU A;  1I50 J;  4AC0 A;  1K83 J;  1TWA J;  2ID3 A;  3ZQL A;  1SAN A;  3D1N I;  1WH5 A;  4C2M J;  4BBS J;  1XC5 A;  5J3L A;  4A3K J;  4UUS A;  2E2I J;  1T56 A;  2Y30 A;  4M3G A;  1NK3 P;  2VUM J;  2WV1 A;  5FKL A;  1VF9 A;  4A93 J;  3O8H A;  3A01 B;  4M3E A;  1A5J A;  3CCY A;  3MVP A;  1HCR A;  3A03 A;  3ZQC A;  2VPR A;  3JRE A;  2LTP A;  1JUS A;  1OFC X;  2COB A;  4BXX J;  2NOG A;  1UMQ A;  3HBL A;  5M3F J;  2MW8 A;  3ZQH A;  3LNQ A;  5C3E J;  2HOT A;  4M3F A;  2E1O A;  3Q3S A;  5F27 A;  3E7L A;  2OPT A;  3BTC A;  1MBE A;  3LSJ A;  3ZQI A;  1AHD P;  1BJZ A;  1POG A;  1X58 A;  1TWF J;  2EZI A;  4A3I J;  2EBI A;  2FX0 A;  1APL C;  3M4O J;  5GPC A;  4BKX A;  2CQQ A;  5EDN A;  1YRN A;  3F0C A;  1U9O A;  1I3Q J;  4X1E A;  3O8G A;  5IYD J;  4A69 C;  1HOM A;  3QPS A;  4Y7N J;  2YUS A;  3DEW A;  1W0U A;  4DW6 A;  1B72 B;  3GTO J;  2HQ5 A;  1JJ8 C;  3W6V A;  3JRC A;  2R5Y B;  1FEX A;  3BG5 A;  2M8G X;  3TP3 A;  4X6A J;  1MSF C;  1MNM C;  3CDL A;  1Y1V J;  5EZH A;  2M2E A;  3HDD A;  5F08 A;  5IYB J;  2EH3 A;  2DTZ A;  3BTI A;  3VPR A;  2FQ4 A;  4B3A A;  5E3M A;  4HNV A;  2K9S A;  4FE7 A;  1DU0 A;  2LFB A;  5FKK A;  5GP9 A;  3TW7 A;  1UG2 A;  4UUS B;  2DA4 A;  1ETQ A;  2XGE A;  3JRH A;  1H88 C;  2L9R A;  4LOC A;  1EF4 A;  5IP9 J;  4I6Z A;  2DJN A;  1PUF A;  4XRS A;  1ETY A;  1ETV A;  1H89 C;  5EEA A;  1WPK A;  3GTP J;  2ME0 A;  1IC8 A;  5IPA A;  2XSD C;  1OCP A;  3LSG A;  1F43 A;  3RZD J;  2G0E A;  1FTT A;  1JKQ C;  2HXI A;  3PM1 A;  2MSY A;  1FIP A;  1A6I A;  3S1Q J;  2NVX J;  2MGQ A;  2HOA A;  1AKH A;  4FTH A;  2JA8 J;  4Y52 J;  1ETX A;  2ME6 A;  3BG3 A;  2W48 A;  3IH2 A;  1P7J A;  4JX4 A;  3M3Y J;  4UUT A;  1JUM A;  1YRN B;  3RQI A;  4A3C J;  1JKO C;  4BY1 J;  1B72 A;  4D5C A;  4A3B J;  4NDL A;  1TWH J;  4IHY A;  3S16 J;  4G12 A;  3MKL A;  2B63 J;  2ZB9 A;  1ENH A;  1RKW A;  5E3O A;  4XID A;  2RAE A;  2ECB A;  3HEF A;  2DA2 A;  2L7F P;  4C3J J;  2OF7 A;  4QTR A;  3K7A J;  5FKN A;  2HYJ A;  3BQY A;  1MH3 A;  3IV5 A;  1IG7 A;  3I4N J;  1RPW A;  4V2G A;  3A02 A;  3BR3 A;  1VND A;  1WI3 A;  3WHB A;  1IRZ A;  3I4M J;  1GVD A;  3HM5 A;  1HLV A;  5M3M J;  1ETO A;  2LLK A;  1TWC J;  4S0H B;  2X9D A;  5DTD A;  3C2B A;  3JRI A;  3HKZ N;  4M6V A;  4AUX A;  4XRM A;  2Y0S N;  2XB0 X;  1PUF B;  3FK7 A;  3FKI J;  4XK4 A;  2QCO A;  4AYB N;  3TW6 A;  4GFB A;  2TCT A;  1P7I A;  1BL0 A;  2DA1 A;  2XPW A;  1ETK A;  3UKG A;  1U78 A;  2CUE A;  3S14 J;  1GV5 A;  3S2D J;  1OCT C;  2O7O A;  1IJW C;  1BW5 A;  3BQZ A;  4M3D A;  1AKH B;  2YS9 A;  1G2H A;  2E2H J;  1QPI A;  2HXO A;  5F1J A;  2DMT A;  3GTQ J;  3OIO A;  2K9Q A;  3MN2 A;  5IOZ A;  1D5Y A;  1BA5 A;  3GBG A;  5FJ8 J;  3GTM J;  4C3I J;  2LR8 A;  2I10 A;  1ZQ3 P;  2NVQ J;  1JT0 A;  2DMU A;  5EF6 A;  3FIW A;  3LSP A;  9ANT A;  3OSF A;  3BR1 A;  2O8K A;  4RBO A;  1JTX A;  2HOS A;  3JRG A;  2ECC A;  1E3O C;  2CRG A;  2IAI A;  3HGY A;  3ZQF A;  4W97 A;  4QIW N;  5IP7 J;  2R93 J;  2JN6 A;  4A3D J;  3FK6 A;  1IDZ A;  2O9L A;  4ABZ A;  5E3N A;  3S15 J;  3Q0U A;  5FKO A;  4B4C A;  2H8R A;  3B6A A;  2E2J J;  3LOC A;  2NVY J;  1ORK A;  1RR7 A;  2L7M P;  2L7Z A;  3GTG J;  1JKP C;  2TRT A;  2ELK A;  1IV6 A;  1DU6 A;  1ZGW A;  1UHS A;  4A3G J;  3QPL A;  1S7E A;  1U9N A;  2VKE A;  2CUF A;  1ITY A;  2K9N A;  1GUU A;  5EGO A;  2PMZ N;  3BG9 A;  1X2M A;  1IGN A;  2R5Z A;  2DA6 A;  1TC3 C;  2XB5 A;  3PO3 J;  3RKQ A;  3HGG A;  3S1N J;  2EZK A;  3LSR A;  2XGC A;  2R0Q C;  5FLV A;  3HOX J;  2NS8 A;  2M34 A;  2M0C A;  5F0H A;  5IOY A;  3IH3 A;  5K7H A;  1MBH A;  3G1M A;  4MIM A;  1WCM J;  3B6C A;  2K40 A;  1O4X A;  2JK3 A;  1T33 A;  2LK2 A;  1MH4 A;  1ZKG A;  4A3J J;  1Y1W J;  2XGD A;  5IYC J;  3GTJ J;  2DMN A;  1LFU P;  4IHW A;  4D7N A;  3DCF A;  1RET A;  5EYR A;  2E19 A;  3TED A;  5EG0 A;  4DZJ A;  5C4J J;  1I6H J;  2DA7 A;  5HOD A;  3HOZ J;  1HF0 A;  2HDD A;  1U8B A;  1RKT A;  1Z0X A;  2KDZ A;  4CYC A;  1GT0 C;  4V2F A;  1IUF A;  2LD5 A;  1ZR4 A;  5J1U A;  2L0K A;  4JX5 A;  2JA6 J;  4IHV A;  2LP0 A;  4B1R A;  3CQZ J;  3OSG A;  2NS7 A;  1W0T A;  3HOW J;  5K7F A;  4EEF G;  1QVU A;  1OJL A;  1Q1V A;  4FE4 A;  5C4X J;  5F04 A;  3PO2 J;  1MSE C;  1MBG A;  2FD5 A;  1JKR C;  1LE8 A;  1TWG J;  2R7Z J;  4JYK A;  1JGG A;  2WB1 N;  5EGO B;  2R92 J;  4QSH A;  5EZG A;  3SFI A;  2R5Z B;  1Z77 A;  4M3B A;  3HOV J;  4W1U A;  2Y9Y A;  2MG4 A;  5J1R A;  2CJJ A;  2LY9 A;  1FJL A;  1X2N A;  3BT9 A;  3WHC A;  2Y2Z A;  3BR0 A;  1MBF A;  3JRF A;  2DMP A;  2CQX A;  1K61 A;  1ZK8 A;  1R9T J;  2ID6 A;  2H1K A;  3SJM A;  2DN0 A;  1NTC A;  4IHX A;  3SDG A;  2XRL A;  3ZOB A;  1JTY A;  1ZTR A;  1WH7 A;  5C44 J;  3S1R J;  2DA3 A;  1SFO J;  1ZR2 A;  5JLX A;  5FLM J;  5EG0 B;  3HB9 A;  2GBY A;  2WAQ N;  1QRY A;  1GDT A;  2AO9 A;  2DA5 A;  4DYQ A;  3Q0W A;  4CYC B;  3S17 J;  5BNG A;  1NK2 P;  4DZP A;  3RZO J;  1FIA A;  3ZQG A;  1VFC A;  3TP0 A;  2HI3 A;  5IP6 A;  2NVT J;  3JRA A;  1B8I A;  3JRB A;  1FTZ A;  4XRS G;  4FCY A;  4MFE A;  1JUP A;  2X48 A;  5F0F A;  3H3V K;  3IH4 A;  1H8A C;  2JJ7 A;  3OOU A;  5K7Z A;  1LFB A;  5M5X J;  3GTL J;  1RES A;  3Q0V A;  2M9H A;  1HDP A;  3BTJ A;  3NAR A;  1LE8 B;  4DYC A;  1AU7 A;  2QF7 A;  4DYR A;  2VI6 A;  4L5E A;  4XIC A;  1VI0 A;  1ETW A;  1XS9 A;  2X6O A;  2D5V A;  3CMY A;  4JP0 A;  5M5Y J;  2AHQ A;  3BR6 A;  2IEK A;  3FIS A;  4A3M J;  5J1Y A;  3G1L A;  4JX6 A;  1JJ6 C;  3G1O A;  3A01 A;  2VKV A;  1QVT A;  4MO7 A;  1HDD C;  3GTK J;  1CQT A;  3BR5 A;  1F36 A;  1MBK A;  2N8G A;  3NAU A;  2P81 A;  5FKM A;  2CU7 A;  2JMW A;  3JRD A;  1XG1 A;  4BY7 J;  2GLO A;  2JWT A;  5JLW A;  2XPU A;  4D5F A;  5E3L A;  3S1M J;  4MLO A;  4IEJ A;  2EQR A;  2Y31 A;  2FJ1 A;  4MFD A;  5GPA A;  3HOY J;  2DMQ A;  3S2H J;  5F0C A;  3JR9 A;  2Y9Z A;  2IBD A;  1WGX A;  4A3L J;  2EZL A;  1IDY A;  2JA7 J;  1JT6 A;  3QQA A;  3HOU J;  3L1P A; 
#chains in the Genus database with same CATH topology
 3FMQ A;  4FIS A;  2DPU A;  1X3W B;  3T1B A;  1LNW A;  1WHU A;  4F52 A;  2YU9 J;  2Q0O A;  1MBJ A;  4CYD A;  3MCZ A;  3OR1 C;  4XBF A;  3PNT A;  2CFO A;  2XF6 A;  4QPQ A;  2P0W A;  1SFU A;  1Y6I A;  2I5U A;  2V79 A;  3H0G J;  4L9J A;  2V6E A;  2PMH A;  5ICE A;  4AVZ A;  4AC0 A;  4CCN A;  4P9U A;  2QSG X;  3QPT A;  3OMY A;  1VTN C;  1SAN A;  1LFP A;  1W5C C;  5LRR A;  4BAY A;  1G4D A;  2HVS A;  2R7Q A;  1WH5 A;  4XL9 A;  2HTJ A;  1GXQ A;  1N25 A;  3FXU A;  4A3K J;  3N05 A;  1HA8 A;  3N97 A;  1W36 C;  3QP6 A;  2Y30 A;  4M3G A;  1NK3 P;  2VUM J;  2FSW A;  4PK4 A;  3I5U A;  2ZXJ A;  5KHD A;  5DM7 F;  2Z99 A;  1VF9 A;  5CVV A;  1Z3Y A;  2DAO A;  3GFJ A;  2Y69 H;  1JI8 A;  1U5T A;  3CME I;  2CQ7 A;  5JVG F;  3A03 A;  4Y3O A;  3F9K A;  1HSJ A;  1JUS A;  2WY8 Q;  4U0Y A;  1YO5 C;  5FRN A;  2NOG A;  3HBL A;  4A0X A;  3LNQ A;  5C3E J;  3PFI A;  1Z9C A;  1S7A A;  4E7Z A;  5FD6 A;  2DDB A;  5EJC A;  2MBF A;  2PN6 A;  2L9V A;  3A2K A;  4BE0 A;  2OPT A;  2KMU A;  1D1B A;  2QSF X;  2NS0 A;  3ZQI A;  2CV1 A;  1IUY A;  1K78 A;  1POG A;  1UJ8 A;  3P9I A;  4UY8 I;  3DP7 A;  2EBI A;  1J59 A;  2STW A;  3M4O J;  5HLT A;  1YS7 A;  5LBQ A;  3L7W A;  5EDN A;  2YX4 A;  5GTI C;  4U7B A;  1ZLJ A;  1I3Q J;  3GWZ A;  4X1E A;  3WE3 A;  3A1Y A;  5ED4 A;  2YUS A;  2JPB A;  2TDX A;  2W00 A;  3TL4 X;  4DW6 A;  4MEX F;  4R79 A;  3C1D A;  1O7L A;  3SDB A;  3H92 A;  3E6D A;  4PDK A;  3BG5 A;  1SVM A;  4B48 A;  1SC7 A;  3RYP A;  1MSF C;  2M7A A;  5CPR B;  3CDL A;  5EZH A;  2ETH A;  2LNB A;  3HDD A;  3DBR B;  1X3Z B;  3VWB A;  2P5K A;  3V8K A;  1UAA A;  3JAM K;  3BTI A;  2FQ4 A;  4ZYE A;  2MFZ A;  2O6G E;  2EK5 A;  2IRF G;  3TW7 A;  1H88 C;  2VQH A;  3OYC A;  1YI2 I;  4IRH A;  4WK8 F;  1TQM A;  4UB6 C;  4KJZ A;  4XRS A;  4RAZ A;  3MKY B;  4DNC A;  1G3Y A;  5B66 C;  1P9Q C;  5LGT A;  3WTS C;  3QRF F;  1H89 C;  3HG9 A;  3CCV I;  1K6Y A;  3MD2 A;  1IF1 A;  4HOB A;  1U5T B;  2FBK A;  2WB1 A;  5ILU A;  1OCP A;  3MFK A;  3RZD J;  2G0E A;  1JKQ C;  1SMY F;  2D1V A;  3PM1 A;  3ZMD A;  2MSY A;  2KIM A;  2KIU A;  4D9J A;  3GXO A;  4ESF A;  5GAE J;  4AIK A;  4QLC U;  1XSV A;  3CUO A;  2MGQ A;  5JVT A;  2HOA A;  5J4Y A;  3OYL A;  2J5O A;  4FTH A;  4XM3 A;  5LHG A;  2XKO A;  1STZ A;  3BG3 A;  3QOP A;  2W48 A;  2GIZ A;  1P4X A;  4JX4 A;  3ZCO A;  2Z9O A;  2MLK A;  4EJT A;  1V55 H;  1JUM A;  2ZNY A;  2R7R A;  1XD7 A;  4RB3 C;  4HF2 A;  4NHJ A;  4A3C J;  5E8I A;  1VQ8 I;  2COM A;  2GWR A;  4HBL A;  2GA1 A;  3CF5 F;  1L0O C;  4D5C A;  1XGN A;  4LFU A;  3CC2 I;  3S16 J;  3EPZ A;  5AIQ A;  1DGW Y;  3FXK A;  2XF5 A;  3MKL A;  3R60 A;  4G9Y A;  3MWM A;  3KIO A;  2D1H A;  4XKC A;  4BJ5 C;  3FX3 A;  4LMY A;  1TQP A;  3LFU A;  3HEF A;  2L7F P;  3M9A A;  4C3J J;  3KFW X;  4QTR A;  1F4K A;  2V1D A;  1OQY A;  3WTW C;  4G7O F;  4P1W A;  3I4N J;  2FBH A;  4V2G A;  3F8N A;  4BJT A;  1P2F A;  2OZU A;  1WVR A;  3A02 A;  4XLP F;  1IRZ A;  3GCM A;  3P9K A;  2DYS H;  2UXX A;  2X6W A;  4S0H B;  1WRJ A;  2WAF A;  5DTD A;  5LHH A;  3HKZ N;  2ZXI A;  3K4K A;  1BI0 A;  3U2R A;  4KN4 X;  2XB0 X;  3BRO A;  2IW5 A;  3FK7 A;  4XK4 A;  4P96 A;  2QCO A;  3EUA A;  2IGO A;  3DF8 A;  5ICC A;  1B6A A;  2HVQ A;  4IF4 A;  2V4J C;  2M0M A;  1P7I A;  2EFW A;  1BL0 A;  1U78 A;  2FRH A;  2CUE A;  2ZKZ A;  3S14 J;  3QYE A;  1IJW C;  2A69 F;  2M87 A;  3GEZ A;  1E2X A;  2X0L A;  1BIB A;  2VKH A;  1G2H A;  1QPI A;  1UEL B;  3K4L A;  2NRA C;  4Y17 A;  3W2A A;  4CGZ A;  1WSU A;  2IVM A;  3QOD A;  3MN2 A;  2ZSI B;  4DQ2 A;  1D5Y A;  4HRI A;  2IA1 A;  4E7L A;  3OYK A;  2BYV E;  2NVQ J;  1TNT A;  1EKE A;  4F93 B;  2A6E F;  3FMR A;  3LSP A;  2BY0 A;  5J6X A;  3L2C A;  5A2Q Z;  9ANT A;  4LJZ F;  3ZQ7 A;  4IL6 C;  2GAU A;  4N4N B;  4RBO A;  1JTX A;  2ECC A;  4NQW A;  4LK0 F;  3BLY A;  2CUZ A;  4L18 B;  1IDZ A;  2R93 J;  1D0Y A;  2KJB A;  3F8C A;  4YFK F;  3QYF A;  3Q0U A;  1OKR A;  3TDZ C;  3RSN A;  3G71 I;  2GQQ A;  1ORK A;  2B7E A;  1ON1 A;  2XAQ A;  3W6K B;  1MJB A;  1XSX A;  3GTG J;  1LDJ A;  4J01 A;  2W82 A;  4C9Y A;  4XLA A;  1TP4 A;  1BI2 A;  2VE9 A;  1ZGW A;  2CH0 A;  4BXU A;  1U3E M;  2QWW A;  4WXH A;  1U9N A;  2VKE A;  2OAZ A;  2CUF A;  1BR4 A;  4AIH A;  2F4M B;  3BG9 A;  3K4M A;  2CGP A;  3PO3 J;  2AS5 F;  2VAS A;  4BU2 A;  2HFH A;  3OOP A;  3VYU B;  3LSR A;  2BW3 A;  2XGC A;  1U5T C;  2HQR A;  2R0Q C;  4Y13 A;  2RNG A;  4IQJ A;  4HQM A;  5B1B H;  1T39 A;  2KFD A;  3KYC B;  4PUS A;  5F0H A;  4KIT B;  3BWG A;  5FGM A;  2B9S A;  4C30 A;  5FFX A;  2K40 A;  2IGN A;  3V7R A;  5HOO A;  1LVA A;  2IA2 A;  3FHZ A;  3ISP A;  2KJC A;  1REP C;  4NBQ A;  1ZRD A;  1TNS A;  3I0T A;  1KZH A;  4RAY A;  1XN7 A;  1ON2 A;  1IAW A;  1F5T A;  2DMN A;  4ZZL A;  1VQ7 I;  3PQJ A;  2LY1 A;  3DCF A;  2VKD A;  5EYR A;  3SXY A;  3TED A;  5EG0 A;  3HHG A;  3CCQ I;  3HJE A;  2R7V A;  2F4O B;  1EV7 A;  3P9C A;  1X19 A;  2KDZ A;  1S9H A;  2XKP A;  4M6X A;  4MQ9 F;  3JTG A;  4RLQ A;  4NQW B;  4ENM A;  1O7F A;  1TT0 A;  1IN8 A;  1IUF A;  2LD5 A;  2XAU A;  3BG7 A;  3DLA A;  1SD7 A;  3CJR B;  2VC1 A;  1I5Z A;  3RKW A;  2W85 A;  2HVR A;  2JA6 J;  4DIQ A;  4HQE A;  3CZ6 A;  4EEF G;  2DK8 A;  4FE4 A;  5C4X J;  1PP8 F;  2JQ7 A;  2CS3 A;  3BPX A;  1XDS A;  3PO2 J;  3JW4 A;  1LUJ B;  1JKR C;  5GTH C;  3UR3 C;  4TV7 A;  3Q9S A;  1TWG J;  1SVO A;  4OAY A;  4KDP A;  2R7Z J;  2QUF A;  5E8G A;  3R0A A;  2OC6 A;  3DWL E;  1LJ9 A;  3HOV J;  1J0R A;  3U1D A;  2DT7 B;  2BW3 B;  2ELH A;  1RI7 A;  1YW8 A;  4XON A;  2QQ9 A;  1MND A;  2VOO A;  3LST A;  2PI0 A;  3F3X A;  5L3E A;  1ZK8 A;  3M07 A;  2ID6 A;  4RGU A;  3ABU A;  4HYE A;  2FMY A;  2K9M A;  4XOP A;  2E5Z A;  3MZ8 A;  2OZ6 A;  3J7Y J;  2L2O A;  1Z05 A;  2XRL A;  4ESB A;  1ZTR A;  4YG2 F;  5C44 J;  3EYY A;  2DA3 A;  2L7K A;  5F64 A;  5EG0 B;  4AVP A;  1GXP A;  1JXS A;  2BHY A;  1VZ0 A;  2ZFW A;  3HB9 A;  2GBY A;  2WAQ N;  3HXL A;  1OYY A;  2AO9 A;  2OQR A;  2DA5 A;  4I01 A;  1FOY A;  4B8X A;  3K70 D;  1ZRF A;  3LSH A;  3DLL F;  4M9X A;  2P5L C;  1YFH A;  1FIA A;  2HPI A;  3ZQG A;  3OS1 A;  2DBB A;  2ZFU A;  3TP0 A;  5HLG A;  5CYV A;  4PJL A;  1G3S A;  3JRA A;  1TT5 B;  3E1S A;  3V42 A;  4WWC A;  3E6B A;  1I1S A;  2ZJR F;  1MJA A;  3TBI A;  1G6N A;  1Y8R B;  4Y4R A;  1H8A C;  4XSZ F;  2X51 A;  5M5X J;  4H0E A;  3BTJ A;  1YE9 A;  2QF7 A;  2E1N A;  2LBF A;  4KIB A;  1ULY A;  2W4S A;  5H6R A;  4LLL A;  3AG4 H;  5CQE A;  4CZZ A;  3CMY A;  1QZZ A;  1WZ2 A;  5J8C A;  4CIC A;  2CV2 A;  4MNU A;  4BH9 A;  4KMU X;  3BR6 A;  3J80 K;  3FIS A;  4A3M J;  1V5F A;  2K7L A;  2GA2 A;  4UVA A;  1FMW A;  1FSH A;  2E7W A;  5AIP A;  1CQT A;  1B9M A;  1QO0 D;  3CLO A;  3NAU A;  2WC2 A;  5FKM A;  2WA0 A;  4KFC A;  1SFK A;  2YSR A;  3JSO A;  5EEG A;  5ILV A;  4ZYH A;  3IRR A;  5E1X A;  1G59 A;  5ICG A;  3LAP A;  2EQR A;  3BDD A;  5GPA A;  2H6C A;  1VQ9 I;  2K4B A;  3S2H J;  1IW7 F;  3RDI A;  5FB2 A;  4MGR A;  2EZL A;  1RIO H;  1DPR A;  4NUB A;  3L1P A;  1VQ5 I;  4XOR A;  1FYL A;  3PIO F;  2ACJ A;  4WX9 A;  2QKL B;  2JA5 J;  2VJ5 A;  4AD9 A;  4A3E J;  2HTS A;  3BR2 A;  2WWY A;  2R5Y A;  4RAG A;  2EZH A;  3BC8 A;  2YX7 A;  2DI3 A;  1PDN C;  3K69 A;  5DUK A;  1K4S A;  2XUB A;  3IKT A;  2LKX A;  1UST A;  2H8W A;  2Y48 A;  2B0L A;  3GZN B;  2R7D A;  3E5U A;  4MEY F;  3OYI A;  2E1M B;  4BQQ A;  1BN5 A;  1WJC A;  2LBF B;  5HLH A;  4EJV A;  3CJT B;  4CO8 A;  4E7K A;  2M4K A;  3WU1 B;  3K1M A;  3FM5 A;  4BBS J;  1YG2 A;  2HOE A;  2H6B A;  3K4B A;  3VFZ A;  3REO A;  1W7P A;  1EH7 A;  4ENN A;  3BP8 A;  4EJU A;  3CJQ B;  1UB9 A;  4BQN A;  1YJN I;  2XAH A;  4J00 A;  1A5J A;  2JA2 A;  2VPR A;  4NC6 A;  4XLF A;  2ZJQ F;  2COB A;  4PSX A;  2KP6 A;  3MKW B;  4WF2 A;  2EV0 A;  2MW8 A;  4CXF A;  1TTY A;  2M8E A;  1S7O A;  3I58 A;  1HKT A;  2E1O A;  3H36 A;  5F27 A;  3HPH A;  2BZT A;  2IGK A;  1O3S A;  3ONQ A;  1FBS A;  1I6X A;  3BTC A;  3FXL A;  4LB5 A;  3FXQ A;  5E17 F;  5CQG A;  4MHG A;  3ESW B;  2IGM A;  3H5A A;  4N0B A;  4JBA A;  1TWF J;  2EZI A;  3WU0 A;  4AWX B;  2FX0 A;  1APL C;  2CG4 A;  4BKX A;  2CQQ A;  4OIR F;  3MEX A;  4BAC A;  2YR2 A;  4R8H A;  1U9O A;  1M1E B;  4A69 C;  1XGM A;  3ASN H;  3K70 C;  3T8R A;  1V54 H;  1X1B A;  3E3V A;  3H5R A;  4YIF A;  2DW4 A;  5JHU A;  4IPA A;  1D8K A;  1HST A;  1KYZ A;  4YFN F;  3HRS A;  3W6V A;  2K5C A;  2R5Y B;  3F21 A;  3IL2 A;  5E1Z B;  2M8G X;  5F6F A;  5D6F A;  3EET A;  3F72 A;  3L09 A;  5DD8 A;  3SEZ A;  3TO6 A;  3OS0 A;  1MNM C;  2DFF A;  1Y1V J;  5KNL A;  2M2E A;  3M1E A;  2M30 A;  5F08 A;  3ML6 A;  5IYB J;  2EFQ A;  3H9G A;  3E5Q A;  5F1R A;  1WWX A;  3ROU A;  4B3A A;  3A0H C;  3WG9 A;  4F3Q A;  3RCO A;  1ACI A;  2DA4 A;  1ETQ A;  3JRH A;  4JK1 X;  1ZGA A;  4B43 A;  1VQL I;  1IO2 A;  2L9R A;  1W7P B;  4EQQ A;  5CKT A;  1X1D A;  4E7S A;  4OOI A;  4HX8 A;  3IWZ A;  2Y0S A;  1ETV A;  5EEA A;  1OPC A;  3GTP J;  4UNO A;  3HSF A;  2ME0 A;  3G6E I;  3NQO A;  2DPD A;  3FM3 A;  1F43 A;  3LSG A;  4HF0 A;  2E7X A;  1A6Q A;  1DDN A;  2VJJ A;  2NNY A;  3VOE A;  1LDD A;  3L2V A;  3FXR A;  3S1Q J;  4L9V A;  2HKO A;  3FXM A;  2OBP A;  4NC8 A;  2OTL I;  2JA8 J;  1TBX A;  5LHI A;  3NEU A;  2RC4 A;  4A0Z A;  2IS4 A;  1UFM A;  5CVI A;  4EM0 B;  4MTE A;  5IT3 A;  1G3W A;  3TKY A;  4XSX F;  3IRQ A;  1P7J A;  3UNG C;  1Z7U A;  4A5M A;  1QPM A;  1XMX A;  3DTI A;  3V7C A;  4IKF A;  1TWH J;  4L0Z B;  1XCV A;  2XV4 S;  3FBI B;  3WTY C;  2B63 J;  4JQF A;  1R71 A;  5IT9 K;  1FOX A;  3HHH A;  3AG1 H;  5LGN A;  2HQN A;  5ICF A;  2I8D A;  2L5Q A;  4XLN F;  2OF7 A;  3OY9 A;  1FNN A;  2FQ3 A;  2VN2 A;  3LA2 A;  3KEQ A;  4XLE A;  2HGC A;  4OIN F;  2E1M C;  2LY2 A;  1X4P A;  1SFX A;  1WI9 A;  2PJP A;  1X4O A;  4AM3 A;  1HLV A;  4F92 B;  2RV8 A;  2XRN A;  2IP2 A;  2X9D A;  3KP4 A;  1YW7 A;  3HTU A;  2OCE A;  1MIJ A;  4AUX A;  2AQF A;  1BJA A;  4BE1 A;  3FKI J;  4H4K C;  4GYI A;  2H94 A;  2G7H A;  2RNJ A;  1I39 A;  2PMZ A;  2QQ8 A;  2V9P A;  2TCT A;  2NYX A;  2EIK H;  4CH7 A;  2HKX A;  4BJ6 C;  1RC9 A;  1S29 A;  2XPW A;  5L3F A;  2VC0 A;  3GUD A;  1GV5 A;  3S2D J;  1K6O A;  2MA3 A;  3CCS I;  2HR3 A;  4FAS D;  2VXZ A;  1AA7 A;  1ZG1 A;  2A07 F;  3F23 A;  1QZE A;  3KYD B;  4II3 A;  3H5N A;  4HZF A;  4B44 A;  2DMT A;  3BJA A;  2K9Q A;  4LIU A;  3SHF A;  3JSP A;  3GTM J;  2I10 A;  2W7N A;  4LG0 A;  4A0Y A;  1ZAO A;  1R1U A;  3O2P E;  3FIW A;  4ZYD A;  3KP7 A;  3TOA A;  2O61 A;  2RDP A;  4HDU A;  5H6Q A;  2VBX A;  2FUG 2;  1T08 B;  2IAI A;  2JZY A;  2QKM B;  2VE8 A;  4W97 A;  3PIP F;  3CD6 I;  1LQ1 A;  3FK6 A;  3IP4 B;  2BY3 A;  2O9L A;  5E3N A;  3S15 J;  2HNH A;  1Z7L A;  5FKO A;  3B6A A;  5K1Y A;  5DUI A;  2NVY J;  2L7Z A;  3V7S A;  1A35 A;  4U88 A;  2F5D A;  1R22 A;  1MZB A;  1IV8 A;  3D0S A;  1Z1D A;  3GFL A;  2DK5 A;  3IKV A;  1IV6 A;  4CSW A;  1UHS A;  4A3G J;  5B3S H;  2P5V A;  1SAX A;  4MTD A;  2KPM A;  1N75 A;  1ITY A;  1U0J A;  4HAM A;  1D3Y A;  5EGO A;  1FLI A;  2OQG A;  4CDG A;  2STT A;  1ZG3 A;  3RKQ A;  1MMA A;  3S93 A;  2F5F A;  3WOD F;  4LLN A;  2XHK A;  3F8F A;  2KIF A;  2E34 A;  3NWT A;  3QP5 A;  2NS8 A;  2M34 A;  3LFK A;  5K7H A;  3IH3 A;  4XR6 A;  5L3B A;  4MIM A;  4KNY A;  5FO5 A;  3Q9V A;  4A5N A;  1XTA A;  3RKY A;  1A04 A;  1R4M B;  1FP1 D;  1T33 A;  2YU3 A;  5EEH A;  3K9T A;  3FWE A;  2MC4 A;  3MAJ A;  1T38 A;  4A3J J;  4DBR A;  4ZYG A;  4DOZ A;  1UG0 A;  2WAD A;  3GTJ J;  1LFU P;  1EA3 A;  4NC7 A;  2H1L A;  4LG0 B;  2GXB A;  2WBM A;  2BHZ A;  2P6S A;  2CW0 F;  2ICW G;  5C4J J;  5HOD A;  1E17 A;  1RKT A;  5GAG J;  2VB6 A;  2V1N A;  4LIT A;  3SZG A;  3KZZ A;  4FHT A;  4ZTJ A;  1B9N A;  3I71 A;  4IRG A;  4NNJ A;  1H9G A;  4N9I A;  1DUX C;  3K1N A;  3CDH A;  1EJ9 A;  2M4G A;  5HS9 A;  4PJM A;  1FOW A;  2FA5 A;  4EGY A;  4B1R A;  3QU3 A;  3OSG A;  1W0T A;  3VB2 A;  5K7F A;  4G6D A;  1OJL A;  2HZD A;  4EV0 A;  3C18 A;  4ZYA A;  1Z6T A;  2E36 A;  1MSE C;  1MBG A;  2FD5 A;  3HIF A;  2UUZ A;  1VQ4 I;  1LE8 A;  1AWC A;  2QEN A;  1TLH B;  4GCV A;  1JGG A;  5LD2 C;  2DQR A;  3G3Z A;  3QU6 A;  5EGO B;  4G8X A;  2R92 J;  2L4M A;  4QSH A;  5EZG A;  1J09 A;  2A68 F;  3ULQ B;  3DBH B;  1L3L A;  3H9J A;  4W1U A;  4ZTF A;  2UXN A;  3CCL I;  1IN7 A;  2LY9 A;  1X2N A;  3BT9 A;  3WHC A;  1FJL A;  2Y2Z A;  2QA4 I;  3T8T A;  1MBF A;  2CQX A;  1R7J A;  3DU6 A;  1QZY A;  1QBJ A;  1FYM A;  1H0M A;  3V4G A;  2E5N A;  2L3D A;  3M7G A;  3ZPL A;  1QHH D;  1BIA A;  2PJR A;  2XAF A;  3BCB A;  1DPU A;  3CCJ I;  1NTC A;  4IHX A;  3VDX A;  3I55 I;  3ZOB A;  1JTY A;  1WH7 A;  5DDG A;  3PNY A;  3EDP A;  3S1R J;  2GOM A;  1Z91 A;  3ECO A;  5JLX A;  2H09 A;  1QU3 A;  4RMN A;  1F1Z A;  1TQI A;  3OIQ A;  4XKW A;  4IX7 A;  3DTE A;  1GDT A;  3ZGK A;  2WTE A;  3SFZ A;  3WGG A;  4ZDO A;  5HS7 A;  4IXA A;  3DKY A;  2VLA A;  1VQ6 I;  1HKS A;  5D8K B;  5CVJ A;  3KPH A;  2EJR A;  1FBU A;  2HI3 A;  3H0D A;  4UB8 C;  5IP6 A;  2NVT J;  3CCR I;  5LFA A;  2ZO4 A;  4N4O B;  3MZH A;  1B8I A;  1UHM A;  2E35 A;  2FOK A;  3ABK H;  1FTZ A;  2L01 A;  4MFE A;  2X48 A;  2V1U A;  3BZC A;  3DKW A;  3I9V 2;  5HDN A;  3S3N A;  2OUM A;  1BI1 A;  3D5S C;  4B3X A;  4CA0 A;  3GZ6 A;  5D8L B;  1HDP A;  2FNA A;  1LE8 B;  5FLX Z;  4DYR A;  2HU9 A;  4M6Y A;  3VSL A;  3VOD A;  3RIR A;  3T5X A;  3MKZ A;  1ETW A;  1USS A;  1T6S A;  2X6O A;  4FX0 A;  4PSW A;  2D5V A;  3PNV A;  1J5Y A;  2Z1D A;  4JP0 A;  1YHQ I;  2AHQ A;  2LSO A;  4WXC A;  2IEK A;  5JHF A;  1YYV A;  2L02 A;  3ZP5 A;  3G1L A;  3RYR A;  4MO7 A;  1QVT A;  1OCZ H;  2XAG A;  5KAF C;  5HS8 A;  3GTK J;  4M71 A;  2N8G A;  3W2V A;  3EYI A;  1ERD A;  3M8J A;  1A36 A;  2IJL A;  3IAS 2;  1FT9 A;  4BY7 J;  2PJR B;  3FDY A;  5H20 A;  2LKS A;  3S2W A;  2GLO A;  2JWT A;  3AG3 H;  3RPU D;  2XPU A;  5JLW A;  2R7W A;  5E3L A;  4MLO A;  4IEJ A;  4A12 A;  2VPL A;  1XB4 A;  1IRX A;  2UWM A;  2XAS A;  2M45 A;  4UXN A;  4A3L J;  1FX7 A;  1IN6 A;  4XN0 A;  3K2Z A;  4KMF A;  4I2O A;  3BTL A;  4D7M A;  4IRI A;  4XMY A;  5TIS C;  4J19 A;  2LVS A;  3ZMV A;  4C3H J;  1VQO I;  2VOD A;  3HUG A;  2AXT C;  1PVE A;  5BQT A;  3QWL A;  2XPV A;  1WJA A;  2DU9 A;  1GV2 A;  4BBR J;  1B8I B;  1N78 A;  1X1A A;  3HC7 A;  4BQO A;  4KIF A;  2QSH X;  3HSR A;  1T0F A;  1Z3X A;  1CF7 A;  1KU7 A;  4GO1 A;  5M5W J;  4RDU A;  1A31 A;  3VYS B;  2ID3 A;  3H9Q A;  3D1N I;  5FD5 A;  1NG7 A;  1JHF A;  1ZRE A;  5CLS A;  1MKM A;  5J3L A;  4RGS A;  2O5R A;  4EJO A;  1T56 A;  1WFX A;  3BPV A;  3OYD A;  1X1P A;  5HDG A;  4A93 J;  3O8H A;  3PL8 A;  1R1T A;  1F9N A;  2LC2 A;  1EH8 A;  4M3E A;  4C2U A;  2X6Y A;  3CCY A;  3MVP A;  2BXZ A;  3AL0 B;  2IT0 A;  3P7N A;  2QBY A;  2LTP A;  1HW5 A;  3PJR A;  4BXX J;  3K6G A;  1UMQ A;  1OR7 A;  5M3F J;  4PJ0 C;  4O5V A;  4KUM A;  5LLQ A;  3AFH A;  1ONV A;  4HNT A;  3KLO A;  1OCC H;  4HX4 A;  2M7B A;  2QEX I;  2HWV A;  5DCF A;  3ZN1 A;  3KET A;  1AHD P;  3L00 A;  1BJZ A;  3DBL B;  3HSE A;  2FF4 A;  4A3I J;  5BOX A;  4ETS A;  5GPC A;  1OYW A;  1YRN A;  3X2Q H;  1U6G A;  3F0C A;  5A2Q K;  3KP3 A;  3GME A;  5D5X B;  3WE2 A;  3DEW A;  1MDM B;  2BVL A;  1W0U A;  2VQG A;  4LG3 A;  1O3T A;  1K4T A;  3HUG B;  1B72 B;  3GTO J;  2JUC A;  2BGC A;  3CMM A;  5DV5 A;  1MD0 A;  5FRO A;  3JRC A;  3QAH A;  4IHT A;  1XX5 A;  3TP3 A;  3MQ0 A;  4KYW A;  1CF7 B;  2HQA A;  3CP2 A;  2EH3 A;  3RJP A;  1XCB A;  2DTZ A;  1SFE A;  3VYT B;  1JGS A;  2FU4 A;  2XF7 A;  4EJW A;  3DXJ F;  5D4S A;  3DFG A;  3WG7 H;  2MLG A;  4HNV A;  3WTV C;  2K9S A;  4FE7 A;  1DU0 A;  3EUH A;  4QWQ A;  2DYR H;  3BOQ A;  2D2W A;  2K9L A;  3H3Z A;  1BR1 A;  1UHW A;  4LOC A;  1EF4 A;  3CLQ A;  3J81 Z;  2KRH A;  3RPQ A;  1ETY A;  2X85 A;  1TL8 A;  1RR8 C;  1S8N A;  1WPK A;  4PFP A;  4CCM A;  3FHN A;  4AYB A;  1R49 A;  5IPA A;  4GXO A;  3LAJ A;  3C2G A;  2QBY B;  3EQL F;  1EH6 A;  2DOA A;  3IHU A;  4I99 C;  2HXI A;  4R1H A;  2VQL A;  3K4C A;  4BDY A;  2NVX J;  2NXN B;  2FNP A;  1D0X A;  1YQA A;  4PGG A;  4Y52 J;  1ETX A;  2Y0M A;  3C2H A;  3FKJ A;  4G6T B;  2Z5U A;  2ZNZ A;  1XGS A;  3CJN A;  2HPM A;  2OTJ I;  3IH2 A;  3M3Y J;  4MQV A;  3KEY A;  1IXS B;  1YRN B;  5J47 A;  1JKO C;  2FEZ A;  2BXY A;  2PX9 A;  4BY1 J;  3JTH A;  4NDL A;  4IHY A;  4A3B J;  1FY7 A;  1HXD A;  1LDK B;  1Z6R A;  2A6H F;  1RKW A;  2R7F A;  4BEH A;  5E3O A;  3TO9 A;  5LRS A;  3G73 A;  3HOT A;  3PQK A;  2WAQ A;  4BYY A;  2Z2S B;  3KZI C;  3OWT A;  2ECB A;  4ASN A;  4PGH A;  2O0Y A;  4EGZ A;  5FKN A;  4ZDP A;  4BNC A;  4HLX A;  1MJ9 A;  2RVC A;  2VT2 A;  2F48 A;  2FBI A;  1MH3 A;  4UV8 A;  1XSD A;  1RPW A;  4QPO A;  3GVA A;  1KQ8 A;  1VND A;  4YRV A;  5D4R A;  3I4M J;  3HM5 A;  1ZH5 A;  1Y39 A;  1ETO A;  2LLK A;  2BV6 A;  1FWZ A;  3R4K A;  3C2B A;  4Q48 A;  5D5V B;  3TOB A;  3OYB A;  2O03 A;  4FET A;  2LF8 A;  1HQC A;  1YX5 A;  4I09 A;  3KP5 A;  4XRM A;  2Y0S N;  3J7A Y;  4A2U A;  2RKH A;  2W57 A;  1KGS A;  1BBY A;  1W36 D;  2FXA A;  2LKP A;  1SMT A;  1E0E A;  4HSR A;  1IRG A;  4G94 A;  2QLZ A;  2R7O A;  4RB1 A;  3AL0 C;  3J7A O;  3IWF A;  1ETK A;  1QQI A;  1LEA A;  3K4N A;  4M73 A;  1HKQ A;  2O7O A;  3MZY A;  3BQZ A;  3ASO H;  4V19 K;  2VON A;  3E97 A;  1ZGJ A;  5IY5 H;  3LQQ A;  5F1J A;  4P9F A;  2CV0 A;  1BI3 A;  1NG6 A;  4M9S A;  2BOL A;  4HX7 A;  4M74 A;  3OIO A;  3SEQ A;  3VSK A;  1BA5 A;  1C0W A;  1XMA A;  4UVC A;  2HZT A;  3W2W A;  1QGP A;  1PJR A;  4E7I A;  3F8B A;  1PP7 U;  1R4N B;  5EF6 A;  2LDU A;  5DD4 A;  2V9K A;  5H2F C;  3BR1 A;  1OYI A;  1HW1 A;  3B02 A;  4BEH B;  5JR3 A;  1DQU A;  3JRG A;  1E3O C;  2HOS A;  2CRG A;  1BOB A;  3E5X A;  2IXS A;  3T0Y A;  3C3W A;  3QOE A;  3WTU C;  2JN6 A;  4RAF A;  3ZMU A;  1YJW I;  1TW2 A;  2Z16 A;  1T0F C;  3K4J A;  1E3H A;  4S05 A;  1Z67 A;  4RGX A;  2E2J J;  3LOC A;  2EFP A;  2MYS A;  2L7M P;  2V1X A;  1JKP C;  2JT1 A;  1DP3 A;  2TRT A;  1R6R A;  2ELK A;  3JAM Z;  1GHC A;  1DU6 A;  3D5R C;  2R7X A;  1S7E A;  2GXG A;  3L9F A;  2R7T A;  2LOO A;  3CUQ A;  4IO9 F;  3QYB A;  2JSC A;  3KCC A;  3N4M A;  2K9N A;  4LK1 F;  1GUU A;  1Y56 A;  2P8T A;  2PMZ N;  1IGN A;  1TC3 C;  2DA6 A;  2IA0 A;  4YEJ A;  3R0J A;  3NRV A;  1U2W A;  2M5W A;  3HGG A;  3WTZ A;  4EMS A;  3S1N J;  4I0B A;  2EZK A;  3TQN A;  5FLV A;  2BVM A;  4WXD A;  1IXC A;  2EFO A;  3OIP A;  4L9N A;  2KRC A;  2UV1 A;  4CCJ A;  3O3K A;  2JVH A;  4KIC A;  1MBH A;  1OR7 C;  3G1M A;  1ZAR A;  2V6C A;  1O4X A;  2JK3 A;  4G7Z F;  4U0V A;  1J9I A;  2DLL A;  1ZKG A;  4JOM A;  2A61 A;  3SZP A;  4B09 A;  1Y1W J;  1ZEL A;  2IPQ X;  1KU3 A;  2W24 A;  3RQ4 A;  4IHW A;  1RZ4 A;  4D7N A;  2DFH A;  2PEX A;  1RET A;  1PUE E;  4DZJ A;  2JVG A;  1I6H J;  2DA7 A;  2EV6 A;  1QHG A;  2GIV A;  3BJ6 A;  4L5J A;  3OL4 A;  2ZME A;  5D5U B;  3KP6 A;  3BY6 A;  1GT0 C;  2G9W A;  3LSK A;  4V2F A;  4XKB A;  5D5W B;  2Q8K A;  5JFR A;  1R1V A;  1GVJ A;  1ODD A;  1ZR4 A;  5BS6 A;  4NB5 A;  5J1U A;  2L0K A;  2DFI A;  3W3C A;  2NAZ A;  3SYT A;  4JX5 A;  4X0G A;  2IS1 A;  3CQZ J;  2DXI A;  1ZG5 A;  2IS2 A;  3ZMZ A;  2HDC A;  1R00 A;  3LMM A;  2O8X A;  3E6C C;  1VQN I;  2KL4 A;  4IZZ A;  5LGU A;  2K02 A;  3EUH C;  3CUQ B;  4EVI A;  4GDF A;  4I7H A;  2WB1 N;  2AXL A;  3GLL A;  3ZMT A;  1SVL A;  1P92 A;  2DOF A;  1RRJ A;  1NHA A;  3BG6 A;  2ADU A;  1P4W A;  1FOK A;  3I4P A;  3KZY A;  1X1C A;  2Y9Y A;  1FPQ A;  3F6V A;  2JRM A;  1V5G A;  3IC7 A;  3OR2 C;  4RB0 A;  1T2K A;  3LSM A;  2Z33 A;  1K61 A;  1MNE A;  4PJJ A;  5KCM A;  5HDK A;  2GZW A;  1IN4 A;  2QVO A;  3OYF A;  4XRF A;  2FML A;  4ZDL A;  5K5Q A;  3SJM A;  2DN0 A;  2NVU B;  3ECH A;  2P4W A;  2PQ8 A;  3WU2 C;  1FBQ A;  5CJ9 A;  2PG4 A;  3GFM A;  2DOE A;  1G8X A;  1G3T A;  1SFO J;  3GFI A;  4E7J A;  1R23 A;  1YX3 A;  2OCC H;  1OIS A;  2LG4 A;  3HZJ A;  1QRY A;  1YS6 A;  2ZME B;  3CES A;  4AID A;  4DYQ A;  1ZN2 A;  3Q0W A;  2XC7 A;  3S17 J;  1BR2 A;  3P5J A;  1NK2 P;  3RZO J;  1AOY A;  3IUO A;  3OS2 A;  1E3P A;  2YPR A;  3GF2 A;  1IXR C;  3M1C A;  4UHT A;  1VFC A;  3VEP A;  3KX2 A;  2KLO A;  3FMS A;  4Y15 A;  3U1K A;  1WJ5 A;  2QYO A;  5HLI A;  3ABM H;  4FCY A;  3HYI A;  5F0F A;  3DTK A;  3H3V K;  3OOU A;  3R61 A;  5K7Z A;  1HBX G;  1RES A;  3Q0V A;  3PSF A;  3NAR A;  1I3A A;  4DYC A;  3GX4 X;  1AU7 A;  3CO7 C;  2VI6 A;  4L5E A;  4XIC A;  3ELK A;  5CVU A;  1T98 A;  1VI0 A;  3OL3 A;  1XMK A;  1OCO H;  2DJI A;  3LSI A;  4OWR B;  3W6J B;  4CCO A;  3I59 A;  2F6C A;  4EAT A;  1B59 A;  1JHH A;  3FXO A;  3OYG A;  3HOS A;  2EV5 A;  4GYG A;  4BS9 A;  5J1Y A;  2R7S A;  4ZH4 F;  4JX6 A;  4KN7 X;  5B1A H;  3A01 A;  2Q1Z B;  2KQR A;  2VKV A;  1HDD C;  2PBI A;  3BR5 A;  3DEU A;  1F36 A;  1MBK A;  5GAD J;  2H27 A;  2JPC A;  2P81 A;  4XLH A;  2CW7 A;  4G6Q A;  2LH9 A;  3HRU A;  2F4I A;  3DQV C;  2CU7 A;  2ISY A;  4N9H A;  1KU2 A;  1XG1 A;  3FF5 A;  5K5O A;  4Q47 A;  2GOX B;  2JRT A;  2K27 A;  4ANJ A;  4D5F A;  3S1M J;  2VL8 A;  2Y31 A;  2FJ1 A;  2EIL H;  4MFD A;  5L3D A;  4DJA A;  3HOY J;  2DMQ A;  2AQE A;  2MH9 A;  5E1W A;  3CO6 C;  2ZBK A;  4GRI A;  1KON A;  2Y9Z A;  2IBD A;  1WGX A;  2V7F A;  4HV5 A;  3OV8 A;  1IDY A;  2JA7 J;  1JT6 A;  5FFZ A;  2VJ4 A;  3QQA A;  1K78 B;  3HOU J;  1T8I A;  1XPX A;  3K2A A;  2L4A A;  2KRF A;  3B73 A;  2X1D A;  5DS9 A;  2OJE D;  1V5E A;  1I1G A;  2MD0 A;  3LA3 A;  3AKZ A;  1HW2 A;  6PAX A;  4CZC A;  4A3F J;  4I76 A;  2GM4 A;  4O6J A;  4Z2Y A;  3SZT A;  2CFX A;  1BW6 A;  3CCM I;  1RUO A;  2KT0 A;  3ZQQ A;  1I50 J;  1KQ9 A;  2CW8 A;  1K83 J;  1TWA J;  3ZQL A;  2F2E A;  2Y75 A;  3A0B C;  3LL7 A;  4HG2 A;  3CUQ C;  2ELJ A;  4C2M J;  2FOW A;  4DBQ A;  1XC5 A;  2HYG D;  4XKV A;  1FSE A;  4RS8 A;  1KA8 A;  4UUS A;  2E2I J;  3I59 B;  2V26 A;  4RM2 A;  3VYR B;  3K10 A;  4IOC F;  2WV1 A;  3CDI A;  5FKL A;  2EFN A;  2Q2E A;  3DPT A;  1FZP B;  2D45 A;  3D5L A;  3HTS B;  3GYH X;  3A01 B;  2JSP A;  4KT6 A;  5B5E C;  2G7U A;  1XGO A;  1OCR H;  4E70 A;  4HF1 A;  1HCR A;  2KIS A;  3ZQC A;  3JRE A;  1OFC X;  2QQA A;  2UZK A;  3DPL C;  3RPU A;  4EM2 A;  2R7U A;  4AU7 A;  3ZQH A;  3PFY A;  2E1C A;  3TO7 A;  2HOT A;  4M3F A;  3Q3S A;  1PYV A;  2BY1 A;  3E7L A;  2JTV A;  1D8J A;  2EWN A;  3RKX A;  1MBE A;  1KYW A;  4F7Z A;  3LSJ A;  3WTX C;  2O3F A;  2V9V A;  3RTR A;  1X58 A;  4BUP A;  1HC8 A;  2J5P A;  2L9N A;  4ON0 A;  2ZME C;  1S3J A;  2DOD A;  3O8G A;  4OIP F;  5IYD J;  1HOM A;  3QPS A;  4Y7N J;  1VQP I;  2OV7 A;  2F5C A;  4UUV A;  2A6T A;  2XAJ A;  2M1B A;  2HQ5 A;  3RI4 A;  1JJ8 C;  5L3G A;  1FEX A;  1H9T A;  2DFE A;  5BMZ A;  4X6A J;  3S8P A;  3TDU C;  2A5Y B;  2ZXH A;  2XVC A;  1KQ0 A;  2FE3 A;  4U7D A;  2E71 A;  4A6E A;  3OYJ A;  2KZG A;  3EUK L;  1D1A A;  1R58 A;  3VPR A;  1N77 A;  2HS5 A;  2LF7 A;  4YII A;  4BHP A;  2BY2 A;  5E3M A;  2DCE A;  1ZRC A;  4FT8 A;  2VBZ A;  2LFB A;  5FKK A;  5GP9 A;  1P6R A;  1UG2 A;  4UUS B;  2XGE A;  1Y8Q B;  3HRT A;  5J8F A;  1OMI A;  3DV8 A;  2Q2E B;  2QM3 A;  3HKZ A;  4BHB A;  5IP9 J;  2W84 A;  3ERE D;  4I6Z A;  2DJN A;  1PUF A;  3OYN A;  4IQ4 A;  3J80 Z;  2LRD A;  2WY7 Q;  2RQP A;  3E0J B;  3S3O A;  2EA2 A;  4UVB A;  1IC8 A;  2XSD C;  2ZJ2 A;  4WCG A;  1SD5 A;  4BHC A;  1VQK I;  5HNF A;  1FTT A;  2OA4 A;  3I64 A;  4HLY A;  3FZV A;  1FIP A;  1A6I A;  3L2Q A;  2DDA A;  1AKH A;  4LLG F;  1R36 A;  2W1O A;  3K0L A;  2ME6 A;  3J7Z I;  4BL0 B;  3I56 I;  3JCU C;  3H1C A;  4UV9 A;  2KKO A;  5BPI A;  1RUN A;  4BQA A;  1D1C A;  4LGW A;  1R5G A;  3ZRG A;  2IS6 A;  5DYM A;  4UUT A;  4XLC A;  3RQI A;  1MDM A;  1B72 A;  4YEL A;  2XDV A;  2QZ8 A;  5ILS A;  4E6K G;  2P7C B;  1SD6 A;  4G12 A;  3G2B A;  1ZYR F;  2ISZ A;  2KIQ A;  2ZB9 A;  1ENH A;  1Q1H A;  3IAM 2;  1S72 I;  4C2T A;  2LRE A;  2CQK A;  4XN3 A;  4FQG A;  2RAE A;  2EB7 A;  4XID A;  2VBW A;  2DA2 A;  1V4R A;  1D5V A;  1FC3 A;  1TZL A;  3K7A J;  1LPQ A;  2HYJ A;  5DEQ A;  2PLY A;  3BQY A;  2ESN A;  3CP8 A;  2K4J A;  1MW7 A;  4G7H F;  5TRD A;  1VQM I;  1GLN A;  5HNH A;  3IV5 A;  1BC8 C;  1IG7 A;  2HDW A;  2DO7 A;  2NOJ B;  3AAF A;  3LA7 A;  3BR3 A;  1WI3 A;  2VIX A;  3WHB A;  2K3P A;  1OLT A;  5KVR A;  1GVD A;  4ITV A;  5M3M J;  1SAU A;  1TWC J;  2P6T A;  4HNU A;  5E20 A;  3JRI A;  4IVN A;  4Y33 A;  4B47 A;  1YLF A;  2JUG A;  5LEK A;  4HV6 A;  4M6V A;  4LB6 B;  2ZC2 A;  1X3U A;  1PUF B;  3GLX A;  2VBY A;  4KT5 C;  4AYB N;  2XGX A;  3TW6 A;  4GFB A;  1SD4 A;  1YIJ I;  2DA1 A;  2XSJ C;  2CUJ A;  4KIG A;  3UKG A;  5DM6 F;  4P5O A;  1S6L A;  4CUG A;  2PFB A;  5TGT A;  1WKM A;  1OCT C;  1B1B A;  2KDO A;  2W25 A;  3O6B B;  3KYL A;  1YIO A;  1BW5 A;  4PJN A;  2MC3 A;  4D1Q A;  5ERI A;  4M3D A;  1O3R A;  2BBY A;  2CYY A;  4DGW B;  4LD5 A;  5J4V A;  2X1C A;  2YS9 A;  1AKH B;  4OMY A;  2EIM H;  1FYK A;  1ZHF A;  2KHM A;  4PCQ A;  2E2H J;  2HXO A;  1BC7 C;  2L54 A;  4IOA F;  3OYM A;  3BZK A;  3L2U A;  3GTQ J;  3E6M A;  4XNF A;  5IOZ A;  2ESH A;  2A5W A;  2VQC A;  3M8F A;  3GBG A;  5FJ8 J;  4HPQ A;  2LR8 A;  4C3I J;  1KU9 A;  2MAB A;  1ZQ3 P;  1JT0 A;  4GGG A;  4F55 A;  2DMU A;  4K2E A;  4HEA 2;  2DQL A;  4L5I A;  4U87 A;  1YIT I;  3OSF A;  2ZSH B;  1R5H A;  5KK1 A;  1W5S A;  3OYA A;  2CSO A;  2O8K A;  3CC7 I;  4HW0 A;  1RNL A;  3HGY A;  4QIW N;  3ZQF A;  1Y0U A;  5IP7 J;  4A3D J;  3L2R A;  2CO5 A;  4ABZ A;  5FRM A;  3BZ6 A;  2OU2 A;  3I54 A;  4B4C A;  2H8R A;  4XOT A;  5BPD A;  1NH3 A;  1W4M A;  1Y0N A;  1WJF A;  1LKX A;  1P4A A;  1RR7 A;  4HST A;  1QA6 A;  2X4H A;  1J2X A;  1WJE A;  3OYH A;  4EM1 A;  1O3Q A;  4ZZD A;  5FLX K;  3QPL A;  2BEO A;  4IJA A;  4AIJ A;  5J40 A;  3ZN0 A;  1O57 A;  2DTR A;  2CWE A;  3M8E A;  4BE2 A;  5KAI C;  3NWS A;  1XDU A;  2MD5 A;  3L2W A;  3OYE A;  1X2M A;  1B4A A;  2R5Z A;  3U9G A;  2XB5 A;  4ENK A;  1JE8 A;  2DT5 A;  2VXD A;  2C6Y A;  3KLN A;  3ZMS A;  1W5T A;  2PMU A;  2WV0 A;  4BGD A;  3HOX J;  3HRM A;  3F8M A;  2M0C A;  4BXF A;  5IOY A;  4RM3 A;  3C7J A;  2X6X A;  1WCM J;  3B6C A;  1J75 A;  2VOP A;  1SEU A;  4KIS A;  2CQN A;  3CF2 A;  3BJO A;  3SQN A;  1Z21 A;  3I53 A;  4CCL A;  5LEJ A;  2LK2 A;  1MH4 A;  1S5L C;  1V3F A;  3WTT C;  3U21 A;  1BM9 A;  3LQR A;  4YFX F;  2XGD A;  4PZJ A;  5E79 C;  3V8J A;  5IYC J;  3PUF A;  4YIR X;  3Q5F A;  2GXA A;  5TJJ A;  2A05 A;  3LWF A;  2E19 A;  1MGT A;  2VT3 A;  4OMZ A;  3HOZ J;  1HF0 A;  4FX4 A;  4I98 B;  2HDD A;  4F91 B;  1U8B A;  4RGR A;  1Z0X A;  4IHS A;  3CTA A;  4CYC A;  3DEE A;  5DCM A;  4CHU A;  4I0A A;  2Z3Y A;  5IT9 Z;  4Q4Z F;  1K7A A;  3ZR8 X;  4HDV A;  1I27 A;  4Q5S F;  4IHV A;  2LP0 A;  2NS7 A;  3HPG A;  4S04 A;  3HOW J;  1QVU A;  5HVQ C;  1Q1V A;  1DGR M;  5F04 A;  1BOA A;  3KE2 A;  2WAE A;  2K3F A;  4RLF A;  2DT6 A;  2EIJ H;  4P55 A;  1YOV B;  2M3A A;  4E4H A;  3DPU A;  4JYK A;  3QPH A;  1DP7 P;  1T95 A;  4CCK A;  1MMS A;  1FMV A;  1J7K A;  3ABL H;  1FP2 A;  3PSI A;  1Z77 A;  3SFI A;  4M3B A;  2R5Z B;  3S3M A;  2MG4 A;  3K1P A;  5J1R A;  2CJJ A;  4OAZ A;  5AON A;  3V8L A;  2L9S A;  5GAH J;  5K5R A;  2RGV A;  3BR0 A;  4Z6Y A;  2HEO A;  3JRF A;  2DMP A;  3DU5 A;  3WGI A;  2XIG A;  2QGU A;  1WQ2 A;  1IZ1 A;  2K85 A;  2QQB A;  1R9T J;  3I3L A;  4PFO A;  2H1K A;  1U8R A;  4ZC3 A;  2EA4 A;  3R6S A;  2F5V A;  4OU0 A;  1IRF A;  4ENJ A;  1YTY A;  2LMD A;  4A6D A;  3CC4 I;  3CCU I;  3CMA I;  1UCR A;  4RB2 C;  2RN7 A;  3SDG A;  1W1W E;  4I02 A;  3GZ5 A;  4D0P A;  4HA8 A;  4OIQ F;  1WJD A;  1ZR2 A;  4BDZ A;  5FLM J;  1LVK A;  2NNN A;  4ZJZ A;  3H35 A;  2RQQ A;  3A4C A;  4RA2 A;  3F6O A;  2KZV A;  3FBN B;  4CYC B;  3HL2 A;  3FXJ A;  3GO5 A;  5BNG A;  1QNT A;  5E18 F;  4DZP A;  1R5I D;  2ZXW H;  5DCM B;  5JI6 A;  1MMN A;  4U0W A;  2ZJP F;  2RRE A;  4E7H A;  3ABT A;  3JRB A;  3WGH A;  4KA4 A;  4OIO F;  2K86 A;  4XRS G;  3PUB A;  3CCE I;  2BE5 F;  1JUP A;  4ESJ A;  3MMY B;  3IH4 A;  1D0Z A;  4M9Z A;  2JJ7 A;  3GTL J;  3ERM A;  1LFB A;  2E60 A;  3DKX A;  2M9H A;  3COA C;  3TGN A;  3KEO A;  1YJ9 I;  2HYF A;  1XS9 A;  2LYC A;  2VJI A;  3GW2 A;  3J81 K;  5M5Y J;  4II2 A;  3F22 A;  1W7P D;  4O3M A;  2OD5 A;  1JJ6 C;  2F5E A;  3G1O A;  1K79 A;  1YW9 A;  3BCA A;  2A3S A;  2R3S A;  5L3C A;  1TW3 A;  2EIN H;  2JMW A;  2R4G A;  3JRD A;  1LEB A;  3AG2 H;  3S32 A;  3G4S I;  1CGP A;  3ZXS A;  4L0Y B;  4LIV A;  1MMD A;  1IN5 A;  4L9T A;  5D6E A;  1MMG A;  4M72 A;  5F0C A;  3JR9 A;  5CVR A;  2ZCW A;  1WJB A;  3TMO A;  4XQF A;  1ZLK A;  2CMP A;  3H3U A;  1UZC A;  2EPF A;  2MH2 A;  2P7V B;  2XRO A;  1LB2 A;  3KP2 A;  2X1E A; 
#chains in the Genus database with same CATH homology
 3BTL A;  3K2A A;  4FIS A;  5DS9 A;  4D7M A;  2JA5 J;  4J19 A;  2LVS A;  4C3H J;  2YU9 J;  1MBJ A;  4A3E J;  3BR2 A;  2XPV A;  2R5Y A;  1GV2 A;  2EZH A;  4BBR J;  1B8I B;  2GM4 A;  4A3F J;  4I76 A;  2LKX A;  3H0G J;  1BW6 A;  5M5W J;  2KT0 A;  4RDU A;  1I50 J;  4AC0 A;  1K83 J;  1TWA J;  2ID3 A;  3ZQL A;  1SAN A;  3D1N I;  1WH5 A;  4C2M J;  4BBS J;  1XC5 A;  5J3L A;  4A3K J;  4UUS A;  2E2I J;  1T56 A;  2Y30 A;  4M3G A;  1NK3 P;  2VUM J;  2WV1 A;  5FKL A;  1VF9 A;  4A93 J;  3O8H A;  3A01 B;  4M3E A;  1A5J A;  3CCY A;  3MVP A;  1HCR A;  3A03 A;  3ZQC A;  2VPR A;  3JRE A;  2LTP A;  1JUS A;  1OFC X;  2COB A;  4BXX J;  2NOG A;  1UMQ A;  3HBL A;  5M3F J;  2MW8 A;  3ZQH A;  3LNQ A;  5C3E J;  2HOT A;  4M3F A;  2E1O A;  3Q3S A;  5F27 A;  3E7L A;  2OPT A;  3BTC A;  1MBE A;  3LSJ A;  3ZQI A;  1AHD P;  1BJZ A;  1POG A;  1X58 A;  1TWF J;  2EZI A;  4A3I J;  2EBI A;  2FX0 A;  1APL C;  3M4O J;  5GPC A;  4BKX A;  2CQQ A;  5EDN A;  1YRN A;  3F0C A;  1U9O A;  1I3Q J;  4X1E A;  3O8G A;  5IYD J;  4A69 C;  1HOM A;  3QPS A;  4Y7N J;  2YUS A;  3DEW A;  1W0U A;  4DW6 A;  1B72 B;  3GTO J;  2HQ5 A;  1JJ8 C;  3W6V A;  3JRC A;  2R5Y B;  1FEX A;  3BG5 A;  2M8G X;  3TP3 A;  4X6A J;  1MSF C;  1MNM C;  3CDL A;  1Y1V J;  5EZH A;  2M2E A;  3HDD A;  5F08 A;  5IYB J;  2EH3 A;  2DTZ A;  3BTI A;  3VPR A;  2FQ4 A;  4B3A A;  5E3M A;  4HNV A;  2K9S A;  4FE7 A;  1DU0 A;  2LFB A;  5FKK A;  5GP9 A;  3TW7 A;  1UG2 A;  4UUS B;  2DA4 A;  1ETQ A;  2XGE A;  3JRH A;  1H88 C;  2L9R A;  4LOC A;  1EF4 A;  5IP9 J;  4I6Z A;  2DJN A;  1PUF A;  4XRS A;  1ETY A;  1ETV A;  1H89 C;  5EEA A;  1WPK A;  3GTP J;  2ME0 A;  1IC8 A;  5IPA A;  2XSD C;  1OCP A;  3LSG A;  1F43 A;  3RZD J;  2G0E A;  1FTT A;  1JKQ C;  2HXI A;  3PM1 A;  2MSY A;  1FIP A;  1A6I A;  3S1Q J;  2NVX J;  2MGQ A;  2HOA A;  1AKH A;  4FTH A;  2JA8 J;  4Y52 J;  1ETX A;  2ME6 A;  3BG3 A;  2W48 A;  3IH2 A;  1P7J A;  4JX4 A;  3M3Y J;  4UUT A;  1JUM A;  1YRN B;  3RQI A;  4A3C J;  1JKO C;  4BY1 J;  1B72 A;  4D5C A;  4A3B J;  4NDL A;  1TWH J;  4IHY A;  3S16 J;  4G12 A;  3MKL A;  2B63 J;  2ZB9 A;  1ENH A;  1RKW A;  5E3O A;  4XID A;  2RAE A;  2ECB A;  3HEF A;  2DA2 A;  2L7F P;  4C3J J;  2OF7 A;  4QTR A;  3K7A J;  5FKN A;  2HYJ A;  3BQY A;  1MH3 A;  3IV5 A;  1IG7 A;  3I4N J;  1RPW A;  4V2G A;  3A02 A;  3BR3 A;  1VND A;  1WI3 A;  3WHB A;  1IRZ A;  3I4M J;  1GVD A;  3HM5 A;  1HLV A;  5M3M J;  1ETO A;  2LLK A;  1TWC J;  4S0H B;  2X9D A;  5DTD A;  3C2B A;  3JRI A;  3HKZ N;  4M6V A;  4AUX A;  4XRM A;  2Y0S N;  2XB0 X;  1PUF B;  3FK7 A;  3FKI J;  4XK4 A;  2QCO A;  4AYB N;  3TW6 A;  4GFB A;  2TCT A;  1P7I A;  1BL0 A;  2DA1 A;  2XPW A;  1ETK A;  3UKG A;  1U78 A;  2CUE A;  3S14 J;  1GV5 A;  3S2D J;  1OCT C;  2O7O A;  1IJW C;  1BW5 A;  3BQZ A;  4M3D A;  1AKH B;  2YS9 A;  1G2H A;  2E2H J;  1QPI A;  2HXO A;  5F1J A;  2DMT A;  3GTQ J;  3OIO A;  2K9Q A;  3MN2 A;  5IOZ A;  1D5Y A;  1BA5 A;  3GBG A;  5FJ8 J;  3GTM J;  4C3I J;  2LR8 A;  2I10 A;  1ZQ3 P;  2NVQ J;  1JT0 A;  2DMU A;  5EF6 A;  3FIW A;  3LSP A;  9ANT A;  3OSF A;  3BR1 A;  2O8K A;  4RBO A;  1JTX A;  2HOS A;  3JRG A;  2ECC A;  1E3O C;  2CRG A;  2IAI A;  3HGY A;  3ZQF A;  4W97 A;  4QIW N;  5IP7 J;  2R93 J;  2JN6 A;  4A3D J;  3FK6 A;  1IDZ A;  2O9L A;  4ABZ A;  5E3N A;  3S15 J;  3Q0U A;  5FKO A;  4B4C A;  2H8R A;  3B6A A;  2E2J J;  3LOC A;  2NVY J;  1ORK A;  1RR7 A;  2L7M P;  2L7Z A;  3GTG J;  1JKP C;  2TRT A;  2ELK A;  1IV6 A;  1DU6 A;  1ZGW A;  1UHS A;  4A3G J;  3QPL A;  1S7E A;  1U9N A;  2VKE A;  2CUF A;  1ITY A;  2K9N A;  1GUU A;  5EGO A;  2PMZ N;  3BG9 A;  1X2M A;  1IGN A;  2R5Z A;  2DA6 A;  1TC3 C;  2XB5 A;  3PO3 J;  3RKQ A;  3HGG A;  3S1N J;  2EZK A;  3LSR A;  2XGC A;  2R0Q C;  5FLV A;  3HOX J;  2NS8 A;  2M34 A;  2M0C A;  5F0H A;  5IOY A;  3IH3 A;  5K7H A;  1MBH A;  3G1M A;  4MIM A;  1WCM J;  3B6C A;  2K40 A;  1O4X A;  2JK3 A;  1T33 A;  2LK2 A;  1MH4 A;  1ZKG A;  4A3J J;  1Y1W J;  2XGD A;  5IYC J;  3GTJ J;  2DMN A;  1LFU P;  4IHW A;  4D7N A;  3DCF A;  1RET A;  5EYR A;  2E19 A;  3TED A;  5EG0 A;  4DZJ A;  5C4J J;  1I6H J;  2DA7 A;  5HOD A;  3HOZ J;  1HF0 A;  2HDD A;  1U8B A;  1RKT A;  1Z0X A;  2KDZ A;  4CYC A;  1GT0 C;  4V2F A;  1IUF A;  2LD5 A;  1ZR4 A;  5J1U A;  2L0K A;  4JX5 A;  2JA6 J;  4IHV A;  2LP0 A;  4B1R A;  3CQZ J;  3OSG A;  2NS7 A;  1W0T A;  3HOW J;  5K7F A;  4EEF G;  1QVU A;  1OJL A;  1Q1V A;  4FE4 A;  5C4X J;  5F04 A;  3PO2 J;  1MSE C;  1MBG A;  2FD5 A;  1JKR C;  1LE8 A;  1TWG J;  2R7Z J;  4JYK A;  1JGG A;  2WB1 N;  5EGO B;  2R92 J;  4QSH A;  5EZG A;  3SFI A;  2R5Z B;  1Z77 A;  4M3B A;  3HOV J;  4W1U A;  2Y9Y A;  2MG4 A;  5J1R A;  2CJJ A;  2LY9 A;  1FJL A;  1X2N A;  3BT9 A;  3WHC A;  2Y2Z A;  3BR0 A;  1MBF A;  3JRF A;  2DMP A;  2CQX A;  1K61 A;  1ZK8 A;  1R9T J;  2ID6 A;  2H1K A;  3SJM A;  2DN0 A;  1NTC A;  4IHX A;  3SDG A;  2XRL A;  3ZOB A;  1JTY A;  1ZTR A;  1WH7 A;  5C44 J;  3S1R J;  2DA3 A;  1SFO J;  1ZR2 A;  5JLX A;  5FLM J;  5EG0 B;  3HB9 A;  2GBY A;  2WAQ N;  1QRY A;  1GDT A;  2AO9 A;  2DA5 A;  4DYQ A;  3Q0W A;  4CYC B;  3S17 J;  5BNG A;  1NK2 P;  4DZP A;  3RZO J;  1FIA A;  3ZQG A;  1VFC A;  3TP0 A;  2HI3 A;  5IP6 A;  2NVT J;  3JRA A;  1B8I A;  3JRB A;  1FTZ A;  4XRS G;  4FCY A;  4MFE A;  1JUP A;  2X48 A;  5F0F A;  3H3V K;  3IH4 A;  1H8A C;  2JJ7 A;  3OOU A;  5K7Z A;  1LFB A;  5M5X J;  3GTL J;  1RES A;  3Q0V A;  2M9H A;  1HDP A;  3BTJ A;  3NAR A;  1LE8 B;  4DYC A;  1AU7 A;  2QF7 A;  4DYR A;  2VI6 A;  4L5E A;  4XIC A;  1VI0 A;  1ETW A;  1XS9 A;  2X6O A;  2D5V A;  3CMY A;  4JP0 A;  5M5Y J;  2AHQ A;  3BR6 A;  2IEK A;  3FIS A;  4A3M J;  5J1Y A;  3G1L A;  4JX6 A;  1JJ6 C;  3G1O A;  3A01 A;  2VKV A;  1QVT A;  4MO7 A;  1HDD C;  3GTK J;  1CQT A;  3BR5 A;  1F36 A;  1MBK A;  2N8G A;  3NAU A;  2P81 A;  5FKM A;  2CU7 A;  2JMW A;  3JRD A;  1XG1 A;  4BY7 J;  2GLO A;  2JWT A;  5JLW A;  2XPU A;  4D5F A;  5E3L A;  3S1M J;  4MLO A;  4IEJ A;  2EQR A;  2Y31 A;  2FJ1 A;  4MFD A;  5GPA A;  3HOY J;  2DMQ A;  3S2H J;  5F0C A;  3JR9 A;  2Y9Z A;  2IBD A;  1WGX A;  4A3L J;  2EZL A;  1IDY A;  2JA7 J;  1JT6 A;  3QQA A;  3HOU J;  3L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...