2R5ZB

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zB00
1Z0XA 3S14J 4FE4A 4JP0A 3S1RJ 4A3EJ 5DS9A 3S17J 2XSDC 3IV5A 5K7ZA 5M5WJ 3JRIA 3LSRA 1FTZA 1ZK8A 2M2EA 2CUEA 4A3CJ 2P81A 3JRDA 2XB0X 3FISA 4XK4A 1X58A 1ETKA 2ECBA 4M3DA 4DZJA 5F27A 2RAEA 4A3MJ 5M5XJ 4A3IJ 3HM5A 5J3LA 3O8HA 1HOMA 5F04A 2Y31A 3RQIA 2IAIA 5FLVA 2LVSA 2EZHA 3H0GJ 1JTXA 2DA3A 1H89C 1MBKA 1OJLA 2XRLA 3PO2J 4S0HB 3TEDA 1AKHB 2AHQA 3A02A 1ETYA 1ZR4A 2R5YB 2DA1A 4IHXA 4XRMA 3S15J 1B72B 1IG7A 3FIWA 3ZQCA 4XIDA 3K7AJ 3HEFA 2MGQA 2JJ7A 1IRZA 2NVXJ 1TWAJ 2DMNA 3ZQIA 5E3OA 2MW8A 3MN2A 5F1JA 3Q3SA 1MH3A 3BR6A 1JKPC 3C2BA 3FK7A 1BJZA 2XPVA 1UG2A 1RKTA 2EZLA 4EEFG 3BTJA 2JN6A 1FIAA 2DJNA 2CJJA 1NK3P 1ENHA 3DCFA 1ETVA 2E19A 2DA5A 4B4CA 3RKQA 3F0CA 3HB9A 3WHCA 4QIWN 2GLOA 3IH2A 4Y52J 3HOXJ 1U9OA 2XPWA 1ETXA 2JA5J 4L5EA 3HOYJ 2VI6A 5FKNA 1MNMC 5EDNA 1IUFA 3I4MJ 1WH7A 1ZR2A 1H8AC 1F43A 1Y1VJ 3L1PA 1RESA 3NAUA 1WCMJ 4D5FA 3GTMJ 3S16J 3GTGJ 2E1OA 1ZKGA 4JX6A 2OF7A 3G1LA 3ZQHA 3JRGA 1PUFA 4I6ZA 3O8GA 5HODA 1MBJA 4FCYA 1I3QJ 4JX5A 3TW6A 2K9QA 4M3BA 4QSHA 4A3LJ 2XB5A 3MVPA 1MBFA 2M34A 4BY7J 3BR5A 2ECCA 2FX0A 5J1YA 1WPKA 2R92J 3NARA 5E3NA 2N8GA 2EH3A 4X1EA 2VPRA 2DN0A 2CUFA 1BW6A 4A3GJ 3Q0VA 4M6VA 2VUMJ 3VPRA 4M3FA 1GUUA 2R5YA 1W0UA 2FD5A 2I10A 2LR8A 4D7MA 3M3YJ 1TWGJ 3JRBA 1XG1A 2YS9A 5IYDJ 1G2HA 1ITYA 1A5JA 3JRFA 4FTHA 3JRHA 3SJMA 5C3EJ 1ETOA 1K61A 1AU7A 1JUPA 1JJ6C 1BL0A 4XRSG 2JMWA 3S1NJ 3FK6A 4IEJA 2E2IJ 2EZKA 3ZQGA 2L7FP 2XGCA 5K7HA 5IP7J 4C3HJ 1B8IB 3OSGA 2R0QC 5EGOB 5C44J 4D7NA 2VKVA 4JYKA 2Y9YA 1MBGA 3BR3A 2HOTA 2DA6A 2ME6A 2PMZN 2HOAA 1GV2A 1LE8A 2NOGA 2LTPA 5EG0A 4BXXJ 5IP6A 1T56A 1R9TJ 1JTYA 1QVUA 4W1UA 4B1RA 4A3JJ 1VI0A 1A6IA 4M3EA 4Y7NJ 2COBA 1MSEC 1OCPA 5IYCJ 3HOWJ 2HDDA 4MIMA 3ZOBA 2DMTA 1ORKA 2LKXA 2CU7A 1ZQ3P 1LFUP 1JUSA 1OCTC 1X2NA 2R7ZJ 4IHWA 3S2HJ 2K40A 1RPWA 2KDZA 2AO9A 3BQZA 4MLOA 2W48A 3M4OJ 3BT9A 3TW7A 2JWTA 1B8IA 2JA7J 5EEAA 2NVYJ 4UUTA 3LOCA 5IOYA 3Q0WA 4MFDA 1W0TA 1ETQA 1FEXA 3B6CA 2Y9ZA 3A03A 2ELKA 2ID6A 3TP3A 1D5YA 1GVDA 1IDYA 3LSPA 1EF4A 1HLVA 3QQAA 4AYBN 1U8BA 1MBHA 1WI3A 5EZGA 5C4XJ 2M9HA 5EYRA 3BTLA 4NDLA 2XPUA 2ME0A 3S2DJ 3OOUA 4DYCA 3BR0A 1WH5A 1IJWC 5F0HA 1MBEA 4C3JJ 3GTJJ 3ZQFA 2B63J 5J1RA 1AHDP 2ZB9A 5F0FA 2X48A 1F36A 1HDDC 3JRCA 5IOZA 1TWHJ 3IH3A 2DA7A 1OFCX 3B6AA 3ZQLA 2LP0A 4FE7A 2YU9J 1RKWA 1H88C 2EBIA 3RZDJ 2O8KA 2M8GX 3BTIA 5M3MJ 4B3AA 4GFBA 3E7LA 1HF0A 2DTZA 1JT6A 3CMYA 1JJ8C 1FIPA 2L9RA 2HYJA 3FKIJ 2HQ5A 3OSFA 1VF9A 3BR2A 1U78A 1FTTA 3HBLA 1QPIA 1RETA 2LY9A 4CYCA 1QRYA 2E2HJ 4XICA 2HXOA 3GTLJ 2HOSA 3JREA 2H1KA 1DU0A 1O4XA 2X9DA 1CQTA 2HI3A 2IBDA 1FJLA 3OIOA 5F0CA 1SFOJ 2LK2A 2LD5A 2GM4A 3GTOJ 1VNDA 4DYQA 2XGEA 2NS7A 2MG4A 4CYCB 2EQRA 1TC3C 2TCTA 4XRSA 3Q0UA 5C4JJ 2LLKA 2R5ZB 2DMQA 3PO3J 4C2MJ 4AUXA 5FJ8J 1I6HJ 1P7IA 5K7FA 1GDTA 1Q1VA 1NTCA 1IGNA 3BG5A 3H3VK 5EF6A 2Y30A 1HDPA 1XC5A 3GTQJ 3G1MA 4A3BJ 2CQXA 2L0KA 4RBOA 4MO7A 1NK2P 3SFIA 2TRTA 1S7EA 1IC8A 1I50J 3QPSA 3HOUJ 4X6AJ 3W6VA 1XS9A 3K2AA 1K83J 1Z77A 4A69C 4IHVA 3CDLA 2R5ZA 4BBRJ 1UHSA 5IPAA 2R93J 4A3KJ 2IEKA 2ID3A 4V2FA 1POGA 2EZIA 1B72A 5GP9A 2L7ZA 1Y1WJ 1ETWA 1T33A 2NVQJ 5M5YJ 2JA6J 3GBGA 4LOCA 3LNQA 1ZTRA 4A3DJ 1BA5A 1DU6A 3TP0A 2KT0A 1WGXA 3DEWA 4FISA 4DYRA 1HCRA 5E3LA 1PUFB 1P7JA 3LSGA 2DMPA 1RR7A 3BQYA 2VKEA 3JRAA 2YUSA 3SDGA 1IDZA 5EG0B 2H8RA 1MSFC 3LSJA 2D5VA 5FKLA 1YRNB 2WB1N 5IP9J 4BKXA 1JUMA 2NVTJ 2WAQN 4A93J 5FKOA 5BNGA 2Y0SN 5EZHA 3A01A 1BW5A 1X2MA 3CCYA 1LFBA 2G0EA 4UUSA 2GBYA 3G1OA 2HXIA 2NS8A 5GPAA 2QF7A 2O9LA 2MSYA 4D5CA 3JR9A 5JLXA 5FLMJ 3UKGA 5F08A 3QPLA 3HOVJ 3HDDA 4UUSB 3HOZJ 1QVTA 4QTRA 4C3IJ 3S1QJ 3D1NI 4ABZA 1IV6A 2DMUA 4W97A 5M3FJ 1AKHA 1VFCA 4RDUA 5EGOA 1UMQA 2L7MP 3BG3A 3BTCA 3I4NJ 4DZPA 4J19A 3PM1A 4HNVA 1E3OC 3GTPJ 2M0CA 5IYBJ 4M3GA 5FKMA 3HGYA 1YRNA 1JKOC 4A3FJ 3CQZJ 3MKLA 3BR1A 4MFEA 3RZOJ 1GT0C 2X6OA 1MH4A 2K9NA 2Y2ZA 3BG9A 1APLC 2FJ1A 2E2JJ 2O7OA 2QCOA 5E3MA 1TWCJ 5JLWA 5FKKA 4G12A 4BY1J 4BBSJ 3GTKJ 3WHBA 4V2GA 5J1UA 1ZGWA 4IHYA 1SANA 5DTDA 4AC0A 2JA8J 2DA4A 4DW6A 2CQQA 9ANTA 3HKZN 5GPCA 3S1MJ 1TWFJ 4JX4A 1U9NA 2XGDA 3IH4A 1JT0A 2WV1A 2DA2A 2K9SA 1JGGA 1JKRC 2JK3A 4I76A 3HGGA 1GV5A 3A01B 1LE8B 2OPTA 2FQ4A 2CRGA 1JKQC 2LFBA
chains in the Genus database with same CATH superfamily
1A04A 3S14J 1KU2A 1OQYA 3I54A 4A3EJ 2HPMA 5CLSA 3IV5A 2K86A 4PJ0C 1Y8RB 3CCRI 1FTZA 1ZK8A 3WODF 4A3CJ 2XAQA 3K4BA 2BY2A 2E1NA 1UAAA 4XK4A 4ZYHA 4NB5A 5F27A 1W36C 5H2FC 2RAEA 5E17F 2M30A 2VBYA 2F2EA 2X1EA 3HM5A 1G3WA 1HOMA 3WE2A 2K7LA 5DCFA 3FMQA 1FLIA 4A6EA 3H0GJ 3ISPA 2DA3A 2X51A 3LQQA 4OAYA 1H89C 4F52A 1OJLA 4XQFA 1YYVA 1IXCA 4MEXF 1FSHA 4S0HB 3BY6A 5F64A 4LJZF 1ETYA 3WGIA 4RB0A 3CCJI 2R5YB 4EMSA 5BMZA 2QA4I 3GO5A 3S15J 2VE8A 1B72B 3SYTA 3FIWA 2UXNA 4PK4A 1IG7A 1VQ8I 4LLGF 2FOKA 1TTYA 2MGQA 4AD9A 4PJJA 1VQNI 3RI4A 2E71A 1FSEA 5E3OA 2VXDA 5KAIC 4V19K 3TDUC 3TO7A 1UG2A 2FBKA 1VQ4I 4EEFG 3KLOA 2R7SA 1VTNC 2ZJ2A 1RR8C 1RI7A 3EYIA 4ZYEA 1Z3YA 1BBYA 3DCFA 3GZNB 3I3LA 3NEUA 1MGTA 1X1DA 4E7HA 3K10A 2X4HA 2GA2A 3M8EA 3IH2A 1R49A 2CV0A 2JA2A 4Y52J 4ESJA 5L3FA 1ETXA 2DTRA 2STWA 2EA4A 4L5EA 2IA2A 3FXLA 3QYBA 2HVQA 2VI6A 3GF2A 1ZG5A 1BR4A 3WU1B 3CCUI 5HDNA 3BC8A 4AIJA 4D0PA 2ZO4A 1ZR2A 3OL4A 1FT9A 1R1UA 3DQVC 2P5LC 3ZXSA 4YFKF 3WTTC 1CF7B 3L1PA 5GAGJ 2MC4A 3S16J 1WCMJ 4LG3A 1Z6RA 1KQ8A 2LKPA 3JRGA 1PUFA 1DUXC 5DEQA 5HODA 3G71I 2BZTA 1SD6A 1I3QJ 2K9QA 3MVPA 3JTGA 1SAXA 1RUOA 3ZMVA 4BY7J 3BR5A 2FX0A 5J1YA 2HPIA 2F5EA 1WPKA 2NS0A 4P96A 3DBRB 1W5TA 4IQ4A 1B1BA 3BZCA 1XGOA 2N8GA 4X1EA 4A3GJ 4M6VA 4XKVA 2VUMJ 1LFPA 1OR7A 1LDKB 2PMUA 1FX7A 1F9NA 1EV7A 2FD5A 4GXOA 1ZGAA 2LR8A 2KP6A 4HDUA 4N9IA 2VBZA 1YS7A 4BEHA 1C0WA 2PG4A 1VQPI 4EJWA 1DQUA 4NBQA 3OWTA 4DGWB 3GFMA 1JXSA 4J01A 1HW5A 1LDJA 3ABLH 1BC8C 4XRSG 3WTSC 3H9QA 1ZHFA 3HOTA 2F48A 2V6CA 2EZKA 3ULQB 1O7LA 4KIGA 3K4NA 2RQPA 5EGOB 3U1DA 3GFIA 2ME6A 1OCRH 3LA2A 1ON2A 4NQWB 4RM3A 1VQ9I 3K1NA 1T56A 1JTYA 2ZNYA 1QHHD 5E8IA 3OYBA 1ACIA 1KU3A 1KU9A 1VI0A 1ZRFA 1WRJA 5J47A 3KYDB 2COBA 3PFYA 5D8LB 2DBBA 1T6SA 2MLGA 4PSWA 1W36D 2F5FA 2HDDA 4MIMA 2CGPA 1P9QC 3HHHA 1J9IA 4GO1A 2BY1A 4UVBA 4RLQA 1ORKA 2LKXA 3QU3A 2R7FA 2GOMA 2AQFA 3OYFA 3W2WA 4WX9A 3FXMA 3DXJF 3HRTA 1K78B 1X2NA 2IJLA 1U2WA 2BXYA 3EQLF 2KZVA 3S2HJ 1RPWA 5JHFA 2VJJA 1J59A 2EV6A 3B02A 2E1MC 4E7SA 2HZTA 3P9KA 1JI8A 5IT3A 4IRGA 1B8IA 1XPXA 2E34A 1MJBA 4EQQA 3F8MA 3E1SA 5EEAA 4EM2A 1R23A 2NVYJ 3PIOF 1YTYA 1QGPA 3ERMA 3TMOA 1S7OA 3R61A 3F6OA 3KP5A 1W0TA 1V5FA 3B6CA 4DJAA 2DOEA 2ELKA 2ID6A 3ZMUA 1D5YA 2NOJB 2MYSA 2R7TA 1YJ9I 3LSPA 2NRAC 3QQAA 2V1DA 4A0XA 2IRFG 2JTVA 2EV5A 3M8JA 5EYRA 3KIOA 3SFZA 3K70D 3ECOA 3OS2A 2UUZA 3IWZA 4PJLA 3KP6A 2YPRA 4NDLA 2MD0A 3QOPA 4ESFA 1N77A 2QKMB 4XLFA 1SAUA 1SFEA 5EEGA 4KIFA 4ETSA 3R6SA 2ZB9A 5KCMA 1AHDP 3DKYA 4ZDLA 5LHIA 1X4OA 1R6RA 4L0YB 4UV9A 2M45A 1YHQI 2HOEA 2FOWA 4FE7A 4KA4A 1D8JA 2ETHA 2L9SA 2M8GX 2O8KA 4IPAA 2ZXJA 3E6DA 1K79A 2WBMA 2P7CB 1FIPA 3ZN1A 4XL9A 2HYJA 4ZTJA 1UCRA 2B9SA 1VF9A 3BR2A 3FDYA 5DCMB 2GXBA 4RM2A 1RETA 4CYCA 4OWRB 3JSOA 3FMRA 5HS8A 3E5UA 3NWTA 3JREA 1BI1A 1DU0A 3CP2A 2X9DA 2OAZA 2HI3A 3DU5A 2IBDA 3LSTA 3OIOA 2GM4A 1V55H 2P4WA 3WGHA 2XGXA 4PGGA 3VOEA 2GXGA 4BQOA 1WJAA 4KN4X 2NYXA 2TCTA 2Z9OA 5C4JJ 1HBXG 2LLKA 2QUFA 3JW4A 4D1QA 2WAQA 3FM5A 3PO3J 2EFWA 1IN5A 1QA6A 4FQGA 3MFKA 2XKOA 1ONVA 5A2QZ 3H5NA 2QQ9A 2YSRA 5HS9A 3VDXA 3GTQJ 1WZ2A 2KIUA 4P9UA 3RKYA 4OIQF 1MIJA 2L0KA 1NK2P 4GCVA 4ESBA 1V5GA 2YU3A 2R7XA 2ELJA 5ICCA 3OYAA 1S7EA 1I50J 2KKOA 4D9JA 4EV0A 4WWCA 3HG9A 3QPHA 3WTXC 3KYCB 3QPSA 3MD2A 3HSFA 3OY9A 2D2WA 3RYRA 5TISC 2K27A 1HKSA 3T8TA 2H8WA 1XS9A 3TGNA 4A69C 2EK5A 3PQJA 1QU3A 4XKWA 4O3MA 2R5ZA 5LGNA 4HQEA 1X1BA 3LSIA 4A3KJ 2IEKA 2L4MA 2ZJQF 1HC8A 1V5EA 3BCAA 2DYRH 2IT0A 1I39A 2L7ZA 1SD4A 1ETWA 3AG4H 5GP9A 3GFJA 2NVQJ 4UB8C 2VKHA 3H92A 4AVPA 3AG2H 5AIQA 3P9IA 4B43A 3DEWA 3M9AA 2IP2A 5B5EC 2ZXWH 4BQAA 1HCRA 3GYHX 3C18A 3R0AA 1P7JA 3KFWX 1ZG3A 1FMVA 3MCZA 5HLHA 5DM6F 1O57A 1R5ID 1RR7A 3LSMA 2M7AA 3FM3A 4K2EA 2P6SA 4MQ9F 4E7KA 3F72A 3FBIB 3F21A 2D5VA 2DPUA 5FB2A 2NVTJ 3O2PE 4OU0A 5D5UB 3S93A 3HYIA 1D1CA 2HQAA 1BW5A 4CCNA 1TT5B 1ZYRF 3SDBA 4A6DA 3CCYA 2R7DA 2HXIA 2NS8A 3C2HA 2ELHA 1D0YA 3GW2A 5GPAA 3M07A 1BI3A 1WI9A 2PQ8A 1HSTA 1HA8A 4RGXA 5LLQA 4EJVA 1YI2I 4JQFA 5F08A 4L0ZB 4BAYA 2B7EA 1OR7C 3HDDA 2A5WA 1VQ6I 2VONA 1WSUA 4C3IJ 2BY0A 5CYVA 4EVIA 1FPQA 3ERED 2ISZA 4ZH4F 4Q5SF 3K9TA 2W00A 3IWFA 4AU7A 2KIMA 1SFKA 2CW8A 1UMQA 2QZ8A 5FFXA 4C2TA 3VYSB 2M8EA 4DZPA 4M72A 2CQ7A 3KEOA 4ZZLA 4YIIA 4J00A 4HNVA 1S7AA 1Y56A 5LHGA 4M3GA 3HGYA 3K6GA 1L3LA 5HOOA 1JKOC 3GXOA 3CQZJ 5LGTA 4IVNA 3RZOJ 3K4KA 1GT0C 2QM3A 1APLC 2F5DA 2R3SA 3K2ZA 4LFUA 3BJOA 3QYFA 4Q4ZF 4PJNA 2CQKA 3GZ6A 5E3MA 1IN7A 1SD7A 5FKKA 2HKOA 1YJNI 3WTWC 4MGRA 3CF2A 2O3FA 2E7XA 2CG4A 3WHBA 2BVLA 2G7HA 2J5OA 2CH0A 2GIZA 2HGCA 3MWMA 3NQOA 5CVUA 2ESNA 1XN7A 1SANA 2Q2EB 4AWXB 1ZGWA 1RUNA 4IHYA 4WXCA 4AC0A 4XOTA 1D1BA 2PJRB 1T39A 2CQQA 4A2UA 3S1MJ 1TWFJ 4JX4A 4XN0A 2WV1A 3S3OA 2OCCH 2XAHA 3HGGA 1TLHB 4KISA 1KYZA 1YJWI 3P7NA 3BZKA 2JUCA 1LVKA 4WF2A 1JKQC 3BP8A 1Z0XA 1YW7A 3EUKL 4FETA 3S1RJ 4HV5A 1UG0A 4JP0A 2FEZA 3S17J 4IOAF 2XSDC 2V7FA 2HTSA 1U6GA 5BPIA 4B3XA 4LLNA 4HBLA 4R1HA 3PUFA 4EATA 4HPQA 4RB1A 1X58A 3DP7A 1TQPA 1UJ8A 5D5XB 3LFKA 3KEYA 2EIMH 1R71A 2MLKA 5M5XJ 4A3IJ 3DLLF 4HOBA 1FBQA 1WJBA 2JUGA 5F04A 2Y31A 1ZARA 3RQIA 4OMZA 1JTXA 3IRRA 3PO2J 1FOXA 4EM1A 2FSWA 2K4BA 4MQVA 4PSXA 1R4MB 3BWGA 4DNCA 5AONA 1ZR4A 2BEOA 3CCQI 3ZQCA 5B1BH 3K7AJ 4KITB 3V7RA 1I3AA 2P5KA 3FXJA 2HDCA 3A0HC 5K5OA 4RB2C 4OIPF 1JGSA 3V42A 2VKDA 2DMNA 1J09A 3ZQIA 4G6DA 2KIQA 4F55A 3ZCOA 5F1JA 3Q3SA 3KP2A 2R7UA 3C2BA 3DPLC 2A61A 1RKTA 4UNOA 1YOVB 3KLNA 3BTJA 4XLHA 5ED4A 3D5SC 2GOXB 3ROUA 1FIAA 2DJNA 1O3TA 1R5HA 1ENHA 3SZPA 4RA2A 4HF1A 2FF4A 3UR3C 3M8FA 3CJTB 3F0CA 5HS7A 4B47A 3HB9A 3WHCA 4IXAA 3V7SA 1U9OA 1W7PA 1XD7A 4HF2A 3K69A 1FBSA 4A0ZA 2BHZA 2DDBA 1OPCA 4L9VA 2K3FA 5FKNA 4EM0B 2R7RA 3S3NA 5EDNA 2ACJA 1ULYA 1TT0A 2V1UA 1WH7A 2W24A 3BOQA 4FX4A 2CO5A 2X85A 2E1CA 1D3YA 1RESA 3NAUA 4U88A 4D5FA 4YRVA 2DLLA 3GTMJ 2V1NA 4HSRA 2E1OA 4IOCF 1Y8QB 5LGUA 4I6ZA 3EYYA 3HTUA 4CGZA 4JX5A 4IF4A 2M4KA 2CV2A 1EH7A 2LMDA 1Q1HA 3DV8A 1HXDA 2ZKZA 3QP5A 2M34A 4OINF 5JR3A 2OA4A 4OOIA 3OYNA 5LEKA 2DJIA 3IAS2 3CP8A 1S3JA 2KISA 2QWWA 3NARA 3TQNA 1GHCA 3HHGA 2DN0A 3Q0VA 4KFCA 4G6TB 2IA0A 2R5YA 2XRNA 1HKQA 3FBNB 1WFXA 4L18B 3M3YJ 2A3SA 3JRBA 1WWXA 5DUKA 4U0VA 2H27A 4G7OF 1A5JA 2A6TA 1ITYA 3H3ZA 1W7PB 1JHFA 1AWCA 3SJMA 1R36A 3ML6A 3ZMSA 1IW7F 2H1LA 1XTAA 1K61A 4H0EA 1SVLA 1BL0A 3J7AO 3S1NJ 1R00A 5HLGA 1KU7A 4WK8F 2JSPA 2MBFA 4ENNA 4L9NA 2L7FP 2XGCA 3DPTA 1LEAA 3MKWB 3ZR8X 2COMA 4PDKA 5JI6A 3BJAA 1YIJI 2GXAA 2AXLA 3FXUA 4BL0B 2HFHA 1IAWA 1MBGA 1LPQA 1ZREA 2HOTA 2PMZN 2A68F 2HOAA 1WJFA 1FWZA 5K1YA 1GXPA 1LE8A 2LTPA 1I27A 2LF8A 1QVUA 2QKLB 4B1RA 4A3JJ 1W5SA 4F3QA 3FMSA 2LSOA 1U8RA 3H5RA 1IN8A 3GLXA 5CPRB 1D0XA 1VQKI 1IN6A 4UXNA 5L3CA 5KNLA 2A6EF 3ABKH 2X1CA 3ECHA 2LKSA 3VEPA 4G7HF 3ZOBA 2EV0A 2D45A 4Z6YA 1W4MA 2QBYA 4X0GA 2XAJA 2XV4S 1G3YA 1Z7UA 3QPTA 4BXFA 5LRSA 5EEHA 4AM3A 2EILH 1E3PA 4EJUA 1WJ5A 1Y0NA 1MW7A 2F4IA 1JUSA 4B48A 1R4NB 3FXRA 2Z1DA 3HPGA 4YIFA 4Y3OA 4IHWA 2PFBA 2QSHX 4XKBA 4C30A 2AO9A 3CC4I 4XNFA 4G9YA 1YW8A 4XLCA 2VASA 3HRMA 1TP4A 2JA7J 2V79A 2GZWA 2OV7A 4UUTA 3WG7H 1QNTA 4ZYDA 1P6RA 4MFDA 2GQQA 3BPXA 3MZ8A 4CCLA 1IXSB 3P9CA 1FEXA 1D1AA 5TGTA 2DAOA 2Y9ZA 2E5NA 2LY1A 1GVDA 3RKXA 1IDYA 1PVEA 2A07F 1HLVA 1MBHA 2I8DA 3VB2A 5EZGA 2DO7A 3SEQA 2M87A 2M9HA 3WU2C 1Y6IA 3W3CA 2FUG2 4CUGA 3C1DA 3HUGA 4AIKA 2BVMA 5J6XA 3S2DJ 3OOUA 4DYCA 2M7BA 3BR0A 2UZKA 4CCJA 3BJ6A 3ZQFA 2GIVA 3FXKA 5F0FA 1A35A 1F36A 5L3DA 1HDDC 3LA7A 3R4KA 1QO0D 3IH3A 4GDFA 1G8XA 2V1XA 3D5LA 4P55A 4LB5A 2H6CA 4I98B 2EFQA 3EUAA 4G8XA 3GFLA 4B3AA 4GFBA 2W4SA 4XN3A 1WQ2A 1EA3A 2LH9A 4IRIA 2AS5F 1O7FA 4BYYA 2L9RA 2EFPA 2Z99A 2QSFX 3OSFA 2L9VA 4HQMA 3HBLA 4RGSA 3BCBA 3K1PA 1QPIA 4M74A 1QRYA 2E2HJ 1O3RA 4XR6A 4A5NA 3GTLJ 4LMYA 3QOEA 1O4XA 3GZ5A 4WXHA 4OAZA 4F91B 1CGPA 5F0CA 1MJAA 2EB7A 5FLXK 1VNDA 3IAM2 2OBPA 5CVVA 2MG4A 3EUHA 2EQRA 4XRSA 3AL0C 2LF7A 4GYIA 1S9HA 4A12A 1RNLA 2QVOA 4AUXA 1XDUA 5FJ8J 5GADJ 1CF7A 1GDTA 4XORA 4HG2A 2VT2A 2CV1A 1NTCA 1IGNA 3OV8A 4Y4RA 5EF6A 2Y30A 2HU9A 1HDPA 1NG6A 3KETA 1Z9CA 2DU9A 3G1MA 2JVGA 5HLTA 1BIAA 2CQNA 5FD5A 3J81K 4RBOA 4MO7A 5CKTA 1MMDA 1LQ1A 1P4WA 3OS1A 4AIDA 4C9YA 4XLNF 3TO6A 2RNGA 2Y0SA 4M6YA 1QHGA 2EFNA 4OIRF 4Q47A 3S3MA 5KVRA 3OR2C 2HKXA 2R4GA 2NAZA 1LVAA 1IF1A 1K83J 1PP7U 2FBHA 3LWFA 4IHVA 1Z05A 5J4YA 2UWMA 3I71A 4XOPA 2O0YA 2QEXI 1YLFA 2QQ8A 5IY5H 3OR1C 4V2FA 3HRUA 2IPQX 3GLLA 1W1WE 1YFHA 3CUQC 2VOPA 2EA2A 5B66C 5FD6A 1X3ZB 3CCLI 2VN2A 4IZZA 1J7KA 1STZA 1ODDA 4HX8A 1ZRDA 1BM9A 2P6TA 2ZSHB 2A05A 3TP0A 2KT0A 3LFUA 3HJEA 4RS8A 1QZEA 3TOAA 4FISA 3W6KB 5E3LA 2CMPA 1PUFB 1TNTA 4N4OB 3RJPA 2MA3A 5TJJA 2HZDA 3L2QA 2P8TA 1JE8A 3K4JA 4ZZDA 1MSFC 3DU6A 3WU0A 1YRNB 3CCEI 4CXFA 2WB1N 3FHZA 1UZCA 4BKXA 2DFFA 2VC0A 1TW3A 2STTA 2R7QA 2Y0SN 5EZHA 2CFXA 1A36A 1T98A 2VBXA 4EGZA 1EH6A 4Y17A 4E7LA 3KZIC 1RZ4A 2QF7A 4C2UA 2RC4A 3PFIA 3G4SI 2M4GA 3JAMZ 2PJRA 1W5CC 1ON1A 2VJ4A 3PUBA 2AXTC 2G9WA 4UUSB 5E20A 3HC7A 4EGYA 3LMMA 3V7CA 4S04A 4FASD 3D1NI 4QPQA 1SFUA 3VYUB 2Q2EA 4PUSA 5M3FJ 2PMHA 3BPVA 2RQQA 3CMEI 3CJRB 4RDUA 5EGOA 2DYSH 1DGWY 3TBIA 2HEOA 2NNNA 4HLXA 2XROA 2MH9A 5J4VA 2OZ6A 3PM1A 2M0CA 2L54A 1MMAA 2VBWA 2PEXA 3F9KA 4A3FJ 3L00A 2K9LA 3TO9A 1WKMA 4MFEA 2WADA 1MH4A 2K9NA 2Y2ZA 2JPCA 3FF5A 3ZQ7A 2IA1A 2E2JJ 2R7OA 3SQNA 5E1WA 2QCOA 1TWCJ 5JLWA 3O6BB 4BY1J 3GWZA 3AFHA 1VQOI 3NWSA 2XC7A 3I58A 2ADUA 4BJTA 1M1EB 2JA8J 3AL0B 3T8RA 4YIRX 1U5TA 2OQRA 1ZH5A 3ZRGA 4DW6A 2AQEA 3CLOA 3HKZN 1SD5A 1U9NA 1BIBA 3LQRA 4CO8A 3J7ZI 2JK3A 2WV0A 1NH3A 2PLYA 2JVHA 2DFHA 5LBQA 1R1TA 2CRGA 2LFBA 5DD8A 3V8LA 3RCOA 4FE4A 5DS9A 5M5WJ 5K7ZA 5HNHA 3E6CC 4P5OA 2W57A 5ICFA 3SXYA 3CTAA 1E17A 4RLFA 3JRDA 4E7IA 1YQAA 2XSJC 4RGRA 2XB0X 3FISA 1J5YA 2X1DA 1ETKA 1UELB 2HQNA 4A3MJ 3CJNA 5J3LA 4Z2YA 1FP2A 3R0JA 5FLVA 3G2BA 3HIFA 3OL3A 4KUMA 1MBKA 2XRLA 1AKHB 2AHQA 4KMFA 3A02A 1Z6TA 2DA1A 3BZ6A 4I7HA 3F22A 4IHXA 3K4LA 3F8CA 1OISA 5BS6A 1Z7LA 1ZAOA 2MABA 2RN7A 4XIDA 3A2KA 3H5AA 3PNYA 5D5WB 3F23A 3HEFA 1Y0UA 3OYGA 2EIKH 1IRZA 2NVXJ 3R60A 1TWAJ 3L2UA 1NG7A 3IP4B 2LG4A 2Y48A 1XSVA 3SZTA 3HKZA 3Q9VA 3JSPA 2VOOA 3MQ0A 3X2QH 5HVQC 1TQMA 3DFGA 1MH3A 3BR6A 2L02A 2VQGA 3G3ZA 4HDVA 3IRQA 3VYRB 3DTIA 2EFOA 2OC6A 2ZCWA 3CUQA 2X6XA 1R7JA 2FRHA 2KIFA 2L2OA 2VT3A 4QPOA 1NK3P 2HVRA 2KL4A 2F5VA 4ITVA 3PJRA 3COAC 2E19A 4HSTA 3F8FA 4B4CA 3RKQA 3A1YA 1OKRA 2M1BA 5JVTA 2XPWA 4XKCA 2JA5J 1B9MA 3L09A 1F1ZA 3GUDA 5CVRA 3CUQB 2I5UA 1MNMC 2Z33A 2DFEA 5LFAA 2KDOA 3J80Z 4KJZA 2DW4A 3J80K 4IX7A 4ENJA 5J8FA 1ZGJA 3I4MJ 3L2WA 1YO5C 3ZPLA 2LRDA 3MKZA 2QQAA 1F4KA 1FZPB 1F43A 2FU4A 3H9JA 3CCSI 1ZKGA 3ZQHA 2OF7A 3G1LA 4E7JA 1X19A 3O8GA 3PQKA 4U7DA 1SFXA 3F6VA 2VE9A 4M3BA 5CVJA 3H35A 4QSHA 3U2RA 4A3LJ 2XB5A 1IO2A 2ZMEC 1MBFA 3GVAA 1MDMA 2Z3YA 3D5RC 1R58A 3LL7A 3LSKA 2YX7A 2R92J 4HV6A 1IXRC 2Z2SB 2EH3A 3KZYA 5D6EA 1BW6A 5ILSA 3AG1H 3DEEA 5HDKA 2M0MA 1GUUA 4M3FA 3EETA 3PIPF 4WCGA 2VQLA 3AAFA 2I10A 1I5ZA 2YS9A 1YX5A 2K9MA 4CZZA 1H9TA 5IYDJ 1Y39A 4B09A 3JRFA 2KFDA 1HQCA 1XDSA 2W25A 2DFIA 1UHMA 1D5VA 3RYPA 1JUPA 1AU7A 2M3AA 1T0FC 3IUOA 1J75A 3N4MA 4IEJA 2HNHA 4N9HA 5JFRA 4HX7A 1EH8A 2KJBA 3KP4A 4A0YA 4N0BA 5IP7J 4C3HJ 3OYMA 3ASNH 2R0QC 4D7NA 2VKVA 3CZ6A 4NC7A 2TDXA 4BJ5C 4JYKA 2WWYA 2Y9YA 3BR3A 2BW3A 2IXSA 2VXZA 4NC6A 3G73A 3H9GA 2GWRA 2NOGA 4AYBA 4BXXJ 3RSNA 1B9NA 4HX4A 4U87A 2IGOA 5DCMA 4LITA 1R9TJ 3REOA 2XUBA 3VSLA 4KNYA 1RRJA 4G6QA 4LK1F 1TW2A 1A6IA 4M3EA 4O6JA 2H6BA 1MNDA 3A0BC 4HEA2 2KRCA 3SHFA 1MNEA 3DPUA 1RIOH 3S8PA 3H1CA 4UVAA 1KZHA 1EJ9A 1OCPA 3MZHA 3HPHA 3TOBA 3F8BA 1TBXA 1HKTA 5CQEA 5D4SA 4IRHA 2XAFA 2KHMA 2QLZA 4Y15A 3WE3A 2YR2A 2CU7A 1ZQ3P 2DK8A 4P1WA 1OCTC 3VODA 2ZXHA 3QP6A 4CICA 2K40A 5HNFA 2KDZA 3BQZA 4MLOA 2RV8A 2W48A 3Q5FA 1Z67A 3BT9A 1XCBA 3M4OJ 3TW7A 2H09A 5D5VB 4XBFA 1NHAA 3LOCA 1K78A 2ESHA 1ETQA 1B4AA 3A03A 2R7WA 5GTIC 3ZMDA 1E3HA 4NUBA 3DF8A 2R7VA 4AYBN 2VPLA 1WI3A 3PSIA 4ENMA 3FZVA 4F92B 3FWEA 5C4XJ 4YELA 1W7PD 2K02A 2L5QA 3VFZA 2XPUA 3NRVA 6PAXA 1WH5A 1IJWC 5F0HA 1MBEA 2B63J 2WAFA 3V8KA 5J1RA 2X48A 2W1OA 2DXIA 1TWHJ 2DA7A 1I6XA 1X1PA 1R22A 3ZQLA 2JRMA 1U0JA 2LP0A 2WA0A 5B3SH 2NXNB 1H88C 1IRFA 3E5XA 1FY7A 3BTIA 3HSEA 2ISYA 2HS5A 3HZJA 4S05A 2L9NA 3IL2A 4M6XA 1UFMA 2GA1A 2VL8A 5CQGA 2DTZA 3CMYA 1G4DA 2ZJRF 1K6YA 1YG2A 2EWNA 2WY7Q 2RKHA 1U78A 4GGGA 2XVCA 1X1CA 1S6LA 2Y75A 1OCOH 1FOYA 2CS3A 5D6FA 2GAUA 3CC2I 1PDNC 1H0MA 1CQTA 2L3DA 1IRXA 5E79C 4FX0A 2QQBA 1KQ0A 1K4SA 2ZC2A 4HNTA 3QWLA 4IHSA 3GEZA 4ASNA 3A4CA 5A2QK 1FYLA 3GCMA 3ZQQA 1I1SA 2KRFA 2XGEA 1MJ9A 5L3BA 2DQLA 4LD5A 4CYCB 2WB1A 1TL8A 3Q0UA 3V8JA 1USTA 2DMQA 2XAUA 3T0YA 3U9GA 2VLAA 1ZLJA 2DODA 2MD5A 1I6HJ 1OYYA 1TQIA 2RVCA 5K7FA 1Q1VA 2FXAA 4GYGA 4MTEA 3H3VK 2BXZA 2QGUA 5GAEJ 3IKVA 4UY8I 1SEUA 4L5JA 2ZJPF 4A3BJ 2K3PA 1FNNA 1MZBA 2CQXA 2E35A 5DD4A 1ZLKA 4MEYF 3SFIA 1LJ9A 1IC8A 3JAMK 1UB9A 2FMYA 1S72I 3UNGC 3E6BA 5J40A 1MMGA 4YFXF 5H20A 1B6AA 3DEUA 2VODA 4X6AJ 1OLTA 2V9KA 1T08B 3K2AA 1E0EA 1BC7C 1Z77A 2PMZA 1V54H 4ON0A 1ZN2A 1D8KA 3MZYA 4QWQA 1UHSA 1P4XA 4XM3A 2R93J 2IGKA 1AOYA 2L7KA 4BS9A 5B1AH 3T5XA 1DPRA 5DUIA 4FT8A 1POGA 2L4AA 1Y1WJ 1B72A 1T33A 2O61A 2E7WA 3KP3A 3GBGA 1ZTRA 4A3DJ 5GAHJ 1T2KA 2Z16A 1F5TA 1WGXA 3JCUC 4U0YA 4CSWA 2KQRA 3PSFA 2P7VB 3KP7A 4BDZA 3LSGA 2DCEA 5K5QA 5BPDA 2DMPA 3L7WA 2VKEA 1LUJB 3JRAA 2YUSA 3SDGA 4LIUA 3FXOA 3LSJA 5FKLA 3H36A 4A5MA 5IP9J 1JUMA 2W82A 4MNUA 4TV7A 5LD2C 2LC2A 5BNGA 3A01A 3H0DA 3OYHA 4BE2A 2F4MB 2DK5A 4UUSA 1LFBA 2G0EA 3AG3H 1DP7P 3I5UA 5DYMA 3QU6A 5HLIA 3FXQA 2O6GE 4CHUA 4KYWA 1U3EM 3K4MA 1BN5A 3OIPA 3CMAI 2BGCA 2BV6A 3KEQA 3JR9A 4XMYA 5JLXA 5FLMJ 3UKGA 3RIRA 3KCCA 4CYDA 2PI0A 2ZMEB 1N25A 3DBLB 3CMMA 3QPLA 3PL8A 4ZDPA 2EPFA 3CLQA 3HOZJ 1FMWA 4BQQA 4NNJA 4QTRA 2B0LA 4XLEA 3K0LA 4CDGA 3S1QJ 1J0RA 4ABZA 1IV6A 3TDZC 1XGNA 3CC7I 4RAZA 2FA5A 1AKHA 4BHCA 2VQHA 1BR2A 2EIJH 5IT9K 3HXLA 5ILUA 1S5LC 1UHWA 3BTCA 3DLAA 4KDPA 3I4NJ 4KN7X 4F93B 4J19A 4KIBA 3GTPJ 3OYCA 4I02A 2L01A 1YRNA 1IZ1A 1FBUA 3CUOA 4WXDA 5KHDA 1QZYA 4M71A 3BR1A 2F6CA 3BG9A 1LKXA 3I0TA 4CA0A 1G3SA 3MMYB 1V4RA 3ABTA 1KA8A 2V6EA 3E6MA 3CO7C 2JSCA 4G12A 4M9SA 5K5RA 4BBSJ 3GTKJ 5F1RA 3VWBA 1GXQA 1IV8A 2RGVA 4B8XA 4PZJA 2JRTA 4ZC3A 5J1UA 3RDIA 1S29A 4EJOA 2ICWG 1GVJA 2LBFB 2DA4A 3D0SA 3EPZA 3L2CA 3CD6I 9ANTA 4KT6A 1K6OA 2CUJA 3IH4A 1JT0A 3W2VA 2DA2A 2K9SA 2QSGX 2CUZA 4M9XA 4FHTA 2W85A 1GV5A 3A01B 4DIQA 5L3EA 2OPTA 3MAJA 4KT5C 3C7JA 5L3GA 4ENKA 3JTHA 4LIVA 3JRIA 4Y33A 3S2WA 4G94A 3LSRA 2M2EA 2CUEA 4N4NB 1A31A 2P81A 2IW5A 3DKXA 2MH2A 2ECBA 4M3DA 5F6FA 1KONA 4DZJA 3HRSA 1OCCH 3F3XA 4NC8A 1PUEE 4XSZF 1OYWA 3O8HA 5FO5A 2IAIA 1G3TA 2LVSA 4XSXF 4JK1X 2EZHA 1FC3A 1B59A 4EJTA 1IUYA 1L0OC 4UV8A 2XKPA 2BE5F 5D8KB 3TEDA 3BDDA 1DDNA 2C6YA 2OTJI 4R8HA 3IC7A 1P4AA 4MHGA 4XRMA 1ZRCA 2VQCA 4XLAA 2E5ZA 2WTEA 3CO6C 1N75A 1Z91A 2JJ7A 3SZGA 3L9FA 4KMUX 5JVGF 1E2XA 2MW8A 3MN2A 3P5JA 3QRFF 2V26A 1XGSA 1JKPC 3HTSB 3FK7A 1BJZA 2DT5A 2XPVA 1YS6A 4II2A 2WC2A 2EZLA 4PGHA 2J5PA 2JN6A 3K1MA 1VQLI 4NQWA 3WTVC 2CJJA 1FYMA 2KLOA 1U5TC 1ETVA 2CSOA 2BBYA 4E6KG 2DA5A 5FGMA 4OIOF 1K4TA 4HF0A 1XSXA 2IVMA 4QIWN 2GLOA 3ZMTA 1QBJA 1ZELA 2HDWA 1LDDA 1BJAA 3HOXJ 5FRNA 1HW1A 3IKTA 4IKFA 3CCMI 3HOYJ 2IS1A 2DI3A 4LK0F 3ZGKA 2XASA 3G6EI 1D0ZA 4O5VA 2BOLA 1IUFA 1USSA 2X6WA 2Y0MA 1T0FA 4LGWA 1H8AC 2PX9A 1Y1VJ 1TNSA 5JHUA 3GTGJ 4JX6A 2W84A 1MMSA 1MBJA 2YX4A 3I53A 3IHUA 4FCYA 3TW6A 3W6JB 1G59A 4ZDOA 1MMNA 4BUPA 2X6YA 5IT9Z 2ECCA 2K4JA 4PCQA 3K70C 3J81Z 1IRGA 1DP3A 1REPC 3B73A 3I64A 3M7GA 1PJRA 5E3NA 4BXUA 2HTJA 3EDPA 4HW0A 3OYDA 2CUFA 1BI0A 1FP1D 2VPRA 3E5QA 2E60A 3VPRA 5ERIA 2QBYB 4CH7A 2FBIA 2V4JC 2BY3A 2DQRA 2A69F 1W0UA 1XMKA 4D7MA 4G7ZF 1TWGJ 1OCZH 1XG1A 5EJCA 4IO9F 1G2HA 3WG9A 4FTHA 4BDYA 3JRHA 3TL4X 3U1KA 4CCKA 4HA8A 3J7YJ 5C3EJ 1ETOA 3SEZA 3OYKA 1JJ6C 4E7ZA 5J8CA 1TZLA 2JMWA 5D4RA 4QLCU 3FK6A 1ZG1A 1XX5A 5CJ9A 2E2IJ 2OJED 1BR1A 4KICA 2ZNZA 1FOWA 4Y13A 2PJPA 3QAHA 3ZQGA 5ICGA 4UB6C 5DDGA 5ICEA 5K7HA 1WJDA 1B8IB 3OSGA 1OYIA 3QODA 1BI2A 5C44J 2CW0F 2O03A 3KX2A 5DV5A 2DOFA 2LNBA 5E1ZB 2LOOA 2BHYA 2DA6A 1P92A 2LDUA 4RMNA 3RPUA 4HRIA 1GV2A 2KMUA 3HOSA 2OCEA 2CW7A 2OQGA 5EG0A 1QPMA 5IP6A 2HYGD 4U0WA 4W1UA 2VIXA 2HYFA 3C3WA 1KGSA 3BG7A 4Y7NJ 3F8NA 3OIQA 5GTHC 3KZZA 1YE9A 3OMYA 1QZZA 1QQIA 1DPUA 2HQRA 1XSDA 5IYCJ 1MSEC 3HOWJ 4F7ZA 4BE0A 4CZCA 2DMTA 3WTUC 3OYJA 1WJEA 2LYCA 1PP8F 5FFZA 2UXXA 1LFUP 2W7NA 2JZYA 2F5CA 2XF5A 4HYEA 2R7ZJ 2Q0OA 3V4GA 1XCVA 1T8IA 3VSKA 2P5VA 2FNAA 2JWTA 2O8XA 2JT1A 4II3A 4RGUA 3E0JB 5ILVA 4BE1A 1XB4A 2ZFWA 5IOYA 3Q0WA 2HWVA 3DTKA 3RTRA 5HDGA 1X4PA 1Z1DA 3TP3A 4LLLA 1LB2A 1EKEA 3AKZA 2OTLI 4AIHA 1EF4A 2KJCA 3I59A 1U8BA 3BROA 5DM7F 3ELKA 3PNTA 4U7BA 3ESWB 4DOZA 2HR3A 4BEHB 3BTLA 1YITI 2ME0A 2PBIA 1SC7A 3N05A 3KYLA 4BNCA 2V9PA 4C3JJ 3GTJJ 4BH9A 1XGMA 3JRCA 4LG0A 5IOZA 1KYWA 3B6AA 1OFCX 3U21A 2HVSA 2XHKA 4Q48A 4BQNA 3L2RA 2QYOA 2YU9J 1RKWA 1I1GA 3LAJA 1OMIA 2EBIA 3RZDJ 1YX3A 5M3MJ 3M1EA 1YIOA 3E7LA 5LHHA 3RKWA 2BW3B 4OMYA 1HF0A 1RC9A 1JT6A 1JJ8C 1WVRA 4RAYA 3FKIJ 5KAFC 3FKJA 2HQ5A 3Q9SA 3VYTB 3W2AA 3J7AY 1FTTA 3PNVA 2A5YB 2LY9A 1ERDA 1MDMB 5H6QA 2HXOA 3ABMH 4XICA 2O5RA 3QYEA 1H9GA 4ZTFA 2H1KA 2HOSA 2XIGA 2VC1A 1BOBA 3ZP5A 1FJLA 1SFOJ 2LK2A 2LD5A 3GTOJ 5H6RA 3DTEA 3ASOH 2MFZA 3OYLA 4DYQA 1KQ9A 2P0WA 1VZ0A 2H94A 4LB6B 4BU2A 2NS7A 3OS0A 1TC3C 3K4CA 4MTDA 3LSHA 3TKYA 3OOPA 2R5ZB 2IGNA 1K7AA 3KE2A 3ONQA 1GLNA 3LA3A 5AIPA 2DOAA 3I9V2 4P9FA 4PFOA 4C2MJ 1U5TB 3MKYB 2LREA 4JOMA 4BHPA 5E18F 1P7IA 2ZMEA 4ZYGA 2UV1A 3BG5A 1X3WB 3L2VA 1DGRM 4HAMA 1XC5A 3WTYC 1X1AA 2IGMA 2EJRA 3I59B 1HW2A 1PYVA 4I01A 1YW9A 2Q8KA 2TRTA 3ZMZA 5FLXZ 3OYEA 2ZBKA 2ZXIA 3RQ4A 2RREA 5FROA 3HOUJ 2KRHA 5E1XA 2K85A 2K5CA 4R79A 4CCOA 1Z3XA 3W6VA 4I2OA 2LY2A 2JPBA 4PJMA 1LNWA 5KK1A 3CDLA 3E97A 3O3KA 3LAPA 1FYKA 1XMAA 4BBRJ 3WGGA 1VQ7I 4IL6C 3RPUD 5IPAA 2VB6A 3I56I 1R5GA 2ID3A 1N78A 2ZSIB 3T1BA 3CDHA 1WHUA 1IN4A 3GX4X 2EZIA 4IQJA 2Q1ZB 2F4OB 4M73A 3HL2A 2OZUA 5M5YJ 2VJ5A 4XLPF 4UVCA 2JA6J 4LOCA 1MD0A 2BYVE 3RPQA 3LNQA 1BA5A 4BGDA 1SMYF 2CWEA 1DU6A 1AA7A 2Y69H 3M1CA 1XMXA 3S32A 2A6HF 4L9JA 4DYRA 4XONA 2NNYA 4I09A 4ANJA 3N97A 4M9ZA 4ZJZA 3FHNA 1T38A 4YFNF 3BLYA 2IS2A 1MKMA 4E4HA 3C2GA 2FNPA 3BQYA 4PFPA 2LBFA 1IDZA 5EG0B 2H8RA 4HZFA 3BG6A 2IS4A 1JHHA 4L5IA 3KPHA 2XAGA 1J2XA 2CYYA 2WAEA 3I4PA 2RNJA 2WAQN 2XF6A 4A93J 3DKWA 3MEXA 5FKOA 4BACA 2ZFUA 1X2MA 4DQ2A 4I0AA 4I0BA 1V3FA 2DT6A 4GRIA 3FX3A 2FE3A 1FOKA 2GBYA 3G1OA 2D1VA 2Z5UA 1VQMI 2DDAA 3HUGB 2OD5A 1A6QA 4IJAA 5LEJA 1SVMA 2M5WA 2O9LA 2MSYA 2OU2A 4B44A 4D5CA 1S8NA 2E1MB 2G7UA 4XRFA 2RDPA 4RAFA 2DT7B 3HOVJ 1SMTA 4RB3C 1BOAA 1QVTA 4CCMA 4IHTA 4LG0B 2WY8Q 1P2FA 4HNUA 4HLYA 2KPMA 2DMUA 2XDVA 1Z21A 4W97A 3I55I 2KZGA 4UHTA 4YG2F 5CVIA 3EUHC 5BOXA 1VFCA 3CDIA 3ZN0A 2L7MP 2JQ7A 4I99C 5BQTA 3BG3A 5E8GA 3WTZA 3DBHB 1E3OC 2FMLA 3E3VA 5IYBJ 2PN6A 2XF7A 5FKMA 4AVZA 4H4KC 1LEBA 4YEJA 1HSJA 3CF5F 2E36A 2EINH 3MKLA 4NHJA 4E70A 2X6OA 4UUVA 3CESA 3CJQB 1SVOA 5TRDA 2CFOA 4RAGA 2FJ1A 3CCVI 2O7OA 2IS6A 3OYIA 2VJIA 4JBAA 4L9TA 1WJCA 1G6NA 1O3QA 5FRMA 5LRRA 3HSRA 4DBQA 1O3SA 3H3UA 4V2GA 2QENA 5DTDA 1X3UA 2V9VA 4ZYAA 3GMEA 1R1VA 4DBRA 1T95A 5GPCA 1VQ5I 2XGDA 3ABUA 2FQ3A 2OUMA 1JGGA 4BHBA 1JKRC 2MC3A 4I76A 4BJ6C 2D1HA 2DPDA 1LE8B 3DWLE 2NVUB 2FQ4A 2X0LA
chains in the Genus database with same CATH topology
1Z0XA 3S14J 4FE4A 4JP0A 3S1RJ 4A3EJ 5DS9A 3S17J 2XSDC 3IV5A 5K7ZA 5M5WJ 3JRIA 3LSRA 1FTZA 1ZK8A 2M2EA 2CUEA 4A3CJ 2P81A 3JRDA 2XB0X 3FISA 4XK4A 1X58A 1ETKA 2ECBA 4M3DA 4DZJA 5F27A 2RAEA 4A3MJ 5M5XJ 4A3IJ 3HM5A 5J3LA 3O8HA 1HOMA 5F04A 2Y31A 3RQIA 2IAIA 5FLVA 2LVSA 2EZHA 3H0GJ 1JTXA 2DA3A 1H89C 1MBKA 1OJLA 2XRLA 3PO2J 4S0HB 3TEDA 1AKHB 2AHQA 3A02A 1ETYA 1ZR4A 2R5YB 2DA1A 4IHXA 4XRMA 3S15J 1B72B 1IG7A 3FIWA 3ZQCA 4XIDA 3K7AJ 3HEFA 2MGQA 2JJ7A 1IRZA 2NVXJ 1TWAJ 2DMNA 3ZQIA 5E3OA 2MW8A 3MN2A 5F1JA 3Q3SA 1MH3A 3BR6A 1JKPC 3C2BA 3FK7A 1BJZA 2XPVA 1UG2A 1RKTA 2EZLA 4EEFG 3BTJA 2JN6A 1FIAA 2DJNA 2CJJA 1NK3P 1ENHA 3DCFA 1ETVA 2E19A 2DA5A 4B4CA 3RKQA 3F0CA 3HB9A 3WHCA 4QIWN 2GLOA 3IH2A 4Y52J 3HOXJ 1U9OA 2XPWA 1ETXA 2JA5J 4L5EA 3HOYJ 2VI6A 5FKNA 1MNMC 5EDNA 1IUFA 3I4MJ 1WH7A 1ZR2A 1H8AC 1F43A 1Y1VJ 3L1PA 1RESA 3NAUA 1WCMJ 4D5FA 3GTMJ 3S16J 3GTGJ 2E1OA 1ZKGA 4JX6A 2OF7A 3G1LA 3ZQHA 3JRGA 1PUFA 4I6ZA 3O8GA 5HODA 1MBJA 4FCYA 1I3QJ 4JX5A 3TW6A 2K9QA 4M3BA 4QSHA 4A3LJ 2XB5A 3MVPA 1MBFA 2M34A 4BY7J 3BR5A 2ECCA 2FX0A 5J1YA 1WPKA 2R92J 3NARA 5E3NA 2N8GA 2EH3A 4X1EA 2VPRA 2DN0A 2CUFA 1BW6A 4A3GJ 3Q0VA 4M6VA 2VUMJ 3VPRA 4M3FA 1GUUA 2R5YA 1W0UA 2FD5A 2I10A 2LR8A 4D7MA 3M3YJ 1TWGJ 3JRBA 1XG1A 2YS9A 5IYDJ 1G2HA 1ITYA 1A5JA 3JRFA 4FTHA 3JRHA 3SJMA 5C3EJ 1ETOA 1K61A 1AU7A 1JUPA 1JJ6C 1BL0A 4XRSG 2JMWA 3S1NJ 3FK6A 4IEJA 2E2IJ 2EZKA 3ZQGA 2L7FP 2XGCA 5K7HA 5IP7J 4C3HJ 1B8IB 3OSGA 2R0QC 5EGOB 5C44J 4D7NA 2VKVA 4JYKA 2Y9YA 1MBGA 3BR3A 2HOTA 2DA6A 2ME6A 2PMZN 2HOAA 1GV2A 1LE8A 2NOGA 2LTPA 5EG0A 4BXXJ 5IP6A 1T56A 1R9TJ 1JTYA 1QVUA 4W1UA 4B1RA 4A3JJ 1VI0A 1A6IA 4M3EA 4Y7NJ 2COBA 1MSEC 1OCPA 5IYCJ 3HOWJ 2HDDA 4MIMA 3ZOBA 2DMTA 1ORKA 2LKXA 2CU7A 1ZQ3P 1LFUP 1JUSA 1OCTC 1X2NA 2R7ZJ 4IHWA 3S2HJ 2K40A 1RPWA 2KDZA 2AO9A 3BQZA 4MLOA 2W48A 3M4OJ 3BT9A 3TW7A 2JWTA 1B8IA 2JA7J 5EEAA 2NVYJ 4UUTA 3LOCA 5IOYA 3Q0WA 4MFDA 1W0TA 1ETQA 1FEXA 3B6CA 2Y9ZA 3A03A 2ELKA 2ID6A 3TP3A 1D5YA 1GVDA 1IDYA 3LSPA 1EF4A 1HLVA 3QQAA 4AYBN 1U8BA 1MBHA 1WI3A 5EZGA 5C4XJ 2M9HA 5EYRA 3BTLA 4NDLA 2XPUA 2ME0A 3S2DJ 3OOUA 4DYCA 3BR0A 1WH5A 1IJWC 5F0HA 1MBEA 4C3JJ 3GTJJ 3ZQFA 2B63J 5J1RA 1AHDP 2ZB9A 5F0FA 2X48A 1F36A 1HDDC 3JRCA 5IOZA 1TWHJ 3IH3A 2DA7A 1OFCX 3B6AA 3ZQLA 2LP0A 4FE7A 2YU9J 1RKWA 1H88C 2EBIA 3RZDJ 2O8KA 2M8GX 3BTIA 5M3MJ 4B3AA 4GFBA 3E7LA 1HF0A 2DTZA 1JT6A 3CMYA 1JJ8C 1FIPA 2L9RA 2HYJA 3FKIJ 2HQ5A 3OSFA 1VF9A 3BR2A 1U78A 1FTTA 3HBLA 1QPIA 1RETA 2LY9A 4CYCA 1QRYA 2E2HJ 4XICA 2HXOA 3GTLJ 2HOSA 3JREA 2H1KA 1DU0A 1O4XA 2X9DA 1CQTA 2HI3A 2IBDA 1FJLA 3OIOA 5F0CA 1SFOJ 2LK2A 2LD5A 2GM4A 3GTOJ 1VNDA 4DYQA 2XGEA 2NS7A 2MG4A 4CYCB 2EQRA 1TC3C 2TCTA 4XRSA 3Q0UA 5C4JJ 2LLKA 2R5ZB 2DMQA 3PO3J 4C2MJ 4AUXA 5FJ8J 1I6HJ 1P7IA 5K7FA 1GDTA 1Q1VA 1NTCA 1IGNA 3BG5A 3H3VK 5EF6A 2Y30A 1HDPA 1XC5A 3GTQJ 3G1MA 4A3BJ 2CQXA 2L0KA 4RBOA 4MO7A 1NK2P 3SFIA 2TRTA 1S7EA 1IC8A 1I50J 3QPSA 3HOUJ 4X6AJ 3W6VA 1XS9A 3K2AA 1K83J 1Z77A 4A69C 4IHVA 3CDLA 2R5ZA 4BBRJ 1UHSA 5IPAA 2R93J 4A3KJ 2IEKA 2ID3A 4V2FA 1POGA 2EZIA 1B72A 5GP9A 2L7ZA 1Y1WJ 1ETWA 1T33A 2NVQJ 5M5YJ 2JA6J 3GBGA 4LOCA 3LNQA 1ZTRA 4A3DJ 1BA5A 1DU6A 3TP0A 2KT0A 1WGXA 3DEWA 4FISA 4DYRA 1HCRA 5E3LA 1PUFB 1P7JA 3LSGA 2DMPA 1RR7A 3BQYA 2VKEA 3JRAA 2YUSA 3SDGA 1IDZA 5EG0B 2H8RA 1MSFC 3LSJA 2D5VA 5FKLA 1YRNB 2WB1N 5IP9J 4BKXA 1JUMA 2NVTJ 2WAQN 4A93J 5FKOA 5BNGA 2Y0SN 5EZHA 3A01A 1BW5A 1X2MA 3CCYA 1LFBA 2G0EA 4UUSA 2GBYA 3G1OA 2HXIA 2NS8A 5GPAA 2QF7A 2O9LA 2MSYA 4D5CA 3JR9A 5JLXA 5FLMJ 3UKGA 5F08A 3QPLA 3HOVJ 3HDDA 4UUSB 3HOZJ 1QVTA 4QTRA 4C3IJ 3S1QJ 3D1NI 4ABZA 1IV6A 2DMUA 4W97A 5M3FJ 1AKHA 1VFCA 4RDUA 5EGOA 1UMQA 2L7MP 3BG3A 3BTCA 3I4NJ 4DZPA 4J19A 3PM1A 4HNVA 1E3OC 3GTPJ 2M0CA 5IYBJ 4M3GA 5FKMA 3HGYA 1YRNA 1JKOC 4A3FJ 3CQZJ 3MKLA 3BR1A 4MFEA 3RZOJ 1GT0C 2X6OA 1MH4A 2K9NA 2Y2ZA 3BG9A 1APLC 2FJ1A 2E2JJ 2O7OA 2QCOA 5E3MA 1TWCJ 5JLWA 5FKKA 4G12A 4BY1J 4BBSJ 3GTKJ 3WHBA 4V2GA 5J1UA 1ZGWA 4IHYA 1SANA 5DTDA 4AC0A 2JA8J 2DA4A 4DW6A 2CQQA 9ANTA 3HKZN 5GPCA 3S1MJ 1TWFJ 4JX4A 1U9NA 2XGDA 3IH4A 1JT0A 2WV1A 2DA2A 2K9SA 1JGGA 1JKRC 2JK3A 4I76A 3HGGA 1GV5A 3A01B 1LE8B 2OPTA 2FQ4A 2CRGA 1JKQC 2LFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0X A;  3S14 J;  4FE4 A;  4JP0 A;  3S1R J;  4A3E J;  5DS9 A;  3S17 J;  2XSD C;  3IV5 A;  5K7Z A;  5M5W J;  3JRI A;  3LSR A;  1FTZ A;  1ZK8 A;  2M2E A;  2CUE A;  4A3C J;  2P81 A;  3JRD A;  2XB0 X;  3FIS A;  4XK4 A;  1X58 A;  1ETK A;  2ECB A;  4M3D A;  4DZJ A;  5F27 A;  2RAE A;  4A3M J;  5M5X J;  4A3I J;  3HM5 A;  5J3L A;  3O8H A;  1HOM A;  5F04 A;  2Y31 A;  3RQI A;  2IAI A;  5FLV A;  2LVS A;  2EZH A;  3H0G J;  1JTX A;  2DA3 A;  1H89 C;  1MBK A;  1OJL A;  2XRL A;  3PO2 J;  4S0H B;  3TED A;  1AKH B;  2AHQ A;  3A02 A;  1ETY A;  1ZR4 A;  2R5Y B;  2DA1 A;  4IHX A;  4XRM A;  3S15 J;  1B72 B;  1IG7 A;  3FIW A;  3ZQC A;  4XID A;  3K7A J;  3HEF A;  2MGQ A;  2JJ7 A;  1IRZ A;  2NVX J;  1TWA J;  2DMN A;  3ZQI A;  5E3O A;  2MW8 A;  3MN2 A;  5F1J A;  3Q3S A;  1MH3 A;  3BR6 A;  1JKP C;  3C2B A;  3FK7 A;  1BJZ A;  2XPV A;  1UG2 A;  1RKT A;  2EZL A;  4EEF G;  3BTJ A;  2JN6 A;  1FIA A;  2DJN A;  2CJJ A;  1NK3 P;  1ENH A;  3DCF A;  1ETV A;  2E19 A;  2DA5 A;  4B4C A;  3RKQ A;  3F0C A;  3HB9 A;  3WHC A;  4QIW N;  2GLO A;  3IH2 A;  4Y52 J;  3HOX J;  1U9O A;  2XPW A;  1ETX A;  2JA5 J;  4L5E A;  3HOY J;  2VI6 A;  5FKN A;  1MNM C;  5EDN A;  1IUF A;  3I4M J;  1WH7 A;  1ZR2 A;  1H8A C;  1F43 A;  1Y1V J;  3L1P A;  1RES A;  3NAU A;  1WCM J;  4D5F A;  3GTM J;  3S16 J;  3GTG J;  2E1O A;  1ZKG A;  4JX6 A;  2OF7 A;  3G1L A;  3ZQH A;  3JRG A;  1PUF A;  4I6Z A;  3O8G A;  5HOD A;  1MBJ A;  4FCY A;  1I3Q J;  4JX5 A;  3TW6 A;  2K9Q A;  4M3B A;  4QSH A;  4A3L J;  2XB5 A;  3MVP A;  1MBF A;  2M34 A;  4BY7 J;  3BR5 A;  2ECC A;  2FX0 A;  5J1Y A;  1WPK A;  2R92 J;  3NAR A;  5E3N A;  2N8G A;  2EH3 A;  4X1E A;  2VPR A;  2DN0 A;  2CUF A;  1BW6 A;  4A3G J;  3Q0V A;  4M6V A;  2VUM J;  3VPR A;  4M3F A;  1GUU A;  2R5Y A;  1W0U A;  2FD5 A;  2I10 A;  2LR8 A;  4D7M A;  3M3Y J;  1TWG J;  3JRB A;  1XG1 A;  2YS9 A;  5IYD J;  1G2H A;  1ITY A;  1A5J A;  3JRF A;  4FTH A;  3JRH A;  3SJM A;  5C3E J;  1ETO A;  1K61 A;  1AU7 A;  1JUP A;  1JJ6 C;  1BL0 A;  4XRS G;  2JMW A;  3S1N J;  3FK6 A;  4IEJ A;  2E2I J;  2EZK A;  3ZQG A;  2L7F P;  2XGC A;  5K7H A;  5IP7 J;  4C3H J;  1B8I B;  3OSG A;  2R0Q C;  5EGO B;  5C44 J;  4D7N A;  2VKV A;  4JYK A;  2Y9Y A;  1MBG A;  3BR3 A;  2HOT A;  2DA6 A;  2ME6 A;  2PMZ N;  2HOA A;  1GV2 A;  1LE8 A;  2NOG A;  2LTP A;  5EG0 A;  4BXX J;  5IP6 A;  1T56 A;  1R9T J;  1JTY A;  1QVU A;  4W1U A;  4B1R A;  4A3J J;  1VI0 A;  1A6I A;  4M3E A;  4Y7N J;  2COB A;  1MSE C;  1OCP A;  5IYC J;  3HOW J;  2HDD A;  4MIM A;  3ZOB A;  2DMT A;  1ORK A;  2LKX A;  2CU7 A;  1ZQ3 P;  1LFU P;  1JUS A;  1OCT C;  1X2N A;  2R7Z J;  4IHW A;  3S2H J;  2K40 A;  1RPW A;  2KDZ A;  2AO9 A;  3BQZ A;  4MLO A;  2W48 A;  3M4O J;  3BT9 A;  3TW7 A;  2JWT A;  1B8I A;  2JA7 J;  5EEA A;  2NVY J;  4UUT A;  3LOC A;  5IOY A;  3Q0W A;  4MFD A;  1W0T A;  1ETQ A;  1FEX A;  3B6C A;  2Y9Z A;  3A03 A;  2ELK A;  2ID6 A;  3TP3 A;  1D5Y A;  1GVD A;  1IDY A;  3LSP A;  1EF4 A;  1HLV A;  3QQA A;  4AYB N;  1U8B A;  1MBH A;  1WI3 A;  5EZG A;  5C4X J;  2M9H A;  5EYR A;  3BTL A;  4NDL A;  2XPU A;  2ME0 A;  3S2D J;  3OOU A;  4DYC A;  3BR0 A;  1WH5 A;  1IJW C;  5F0H A;  1MBE A;  4C3J J;  3GTJ J;  3ZQF A;  2B63 J;  5J1R A;  1AHD P;  2ZB9 A;  5F0F A;  2X48 A;  1F36 A;  1HDD C;  3JRC A;  5IOZ A;  1TWH J;  3IH3 A;  2DA7 A;  1OFC X;  3B6A A;  3ZQL A;  2LP0 A;  4FE7 A;  2YU9 J;  1RKW A;  1H88 C;  2EBI A;  3RZD J;  2O8K A;  2M8G X;  3BTI A;  5M3M J;  4B3A A;  4GFB A;  3E7L A;  1HF0 A;  2DTZ A;  1JT6 A;  3CMY A;  1JJ8 C;  1FIP A;  2L9R A;  2HYJ A;  3FKI J;  2HQ5 A;  3OSF A;  1VF9 A;  3BR2 A;  1U78 A;  1FTT A;  3HBL A;  1QPI A;  1RET A;  2LY9 A;  4CYC A;  1QRY A;  2E2H J;  4XIC A;  2HXO A;  3GTL J;  2HOS A;  3JRE A;  2H1K A;  1DU0 A;  1O4X A;  2X9D A;  1CQT A;  2HI3 A;  2IBD A;  1FJL A;  3OIO A;  5F0C A;  1SFO J;  2LK2 A;  2LD5 A;  2GM4 A;  3GTO J;  1VND A;  4DYQ A;  2XGE A;  2NS7 A;  2MG4 A;  4CYC B;  2EQR A;  1TC3 C;  2TCT A;  4XRS A;  3Q0U A;  5C4J J;  2LLK A;  2R5Z B;  2DMQ A;  3PO3 J;  4C2M J;  4AUX A;  5FJ8 J;  1I6H J;  1P7I A;  5K7F A;  1GDT A;  1Q1V A;  1NTC A;  1IGN A;  3BG5 A;  3H3V K;  5EF6 A;  2Y30 A;  1HDP A;  1XC5 A;  3GTQ J;  3G1M A;  4A3B J;  2CQX A;  2L0K A;  4RBO A;  4MO7 A;  1NK2 P;  3SFI A;  2TRT A;  1S7E A;  1IC8 A;  1I50 J;  3QPS A;  3HOU J;  4X6A J;  3W6V A;  1XS9 A;  3K2A A;  1K83 J;  1Z77 A;  4A69 C;  4IHV A;  3CDL A;  2R5Z A;  4BBR J;  1UHS A;  5IPA A;  2R93 J;  4A3K J;  2IEK A;  2ID3 A;  4V2F A;  1POG A;  2EZI A;  1B72 A;  5GP9 A;  2L7Z A;  1Y1W J;  1ETW A;  1T33 A;  2NVQ J;  5M5Y J;  2JA6 J;  3GBG A;  4LOC A;  3LNQ A;  1ZTR A;  4A3D J;  1BA5 A;  1DU6 A;  3TP0 A;  2KT0 A;  1WGX A;  3DEW A;  4FIS A;  4DYR A;  1HCR A;  5E3L A;  1PUF B;  1P7J A;  3LSG A;  2DMP A;  1RR7 A;  3BQY A;  2VKE A;  3JRA A;  2YUS A;  3SDG A;  1IDZ A;  5EG0 B;  2H8R A;  1MSF C;  3LSJ A;  2D5V A;  5FKL A;  1YRN B;  2WB1 N;  5IP9 J;  4BKX A;  1JUM A;  2NVT J;  2WAQ N;  4A93 J;  5FKO A;  5BNG A;  2Y0S N;  5EZH A;  3A01 A;  1BW5 A;  1X2M A;  3CCY A;  1LFB A;  2G0E A;  4UUS A;  2GBY A;  3G1O A;  2HXI A;  2NS8 A;  5GPA A;  2QF7 A;  2O9L A;  2MSY A;  4D5C A;  3JR9 A;  5JLX A;  5FLM J;  3UKG A;  5F08 A;  3QPL A;  3HOV J;  3HDD A;  4UUS B;  3HOZ J;  1QVT A;  4QTR A;  4C3I J;  3S1Q J;  3D1N I;  4ABZ A;  1IV6 A;  2DMU A;  4W97 A;  5M3F J;  1AKH A;  1VFC A;  4RDU A;  5EGO A;  1UMQ A;  2L7M P;  3BG3 A;  3BTC A;  3I4N J;  4DZP A;  4J19 A;  3PM1 A;  4HNV A;  1E3O C;  3GTP J;  2M0C A;  5IYB J;  4M3G A;  5FKM A;  3HGY A;  1YRN A;  1JKO C;  4A3F J;  3CQZ J;  3MKL A;  3BR1 A;  4MFE A;  3RZO J;  1GT0 C;  2X6O A;  1MH4 A;  2K9N A;  2Y2Z A;  3BG9 A;  1APL C;  2FJ1 A;  2E2J J;  2O7O A;  2QCO A;  5E3M A;  1TWC J;  5JLW A;  5FKK A;  4G12 A;  4BY1 J;  4BBS J;  3GTK J;  3WHB A;  4V2G A;  5J1U A;  1ZGW A;  4IHY A;  1SAN A;  5DTD A;  4AC0 A;  2JA8 J;  2DA4 A;  4DW6 A;  2CQQ A;  9ANT A;  3HKZ N;  5GPC A;  3S1M J;  1TWF J;  4JX4 A;  1U9N A;  2XGD A;  3IH4 A;  1JT0 A;  2WV1 A;  2DA2 A;  2K9S A;  1JGG A;  1JKR C;  2JK3 A;  4I76 A;  3HGG A;  1GV5 A;  3A01 B;  1LE8 B;  2OPT A;  2FQ4 A;  2CRG A;  1JKQ C;  2LFB A; 
#chains in the Genus database with same CATH topology
 1A04 A;  3S14 J;  1KU2 A;  1OQY A;  3I54 A;  4A3E J;  2HPM A;  5CLS A;  3IV5 A;  2K86 A;  4PJ0 C;  1Y8R B;  3CCR I;  1FTZ A;  1ZK8 A;  3WOD F;  4A3C J;  2XAQ A;  3K4B A;  2BY2 A;  2E1N A;  1UAA A;  4XK4 A;  4ZYH A;  4NB5 A;  5F27 A;  1W36 C;  5H2F C;  2RAE A;  5E17 F;  2M30 A;  2VBY A;  2F2E A;  2X1E A;  3HM5 A;  1G3W A;  1HOM A;  3WE2 A;  2K7L A;  5DCF A;  3FMQ A;  1FLI A;  4A6E A;  3H0G J;  3ISP A;  2DA3 A;  2X51 A;  3LQQ A;  4OAY A;  1H89 C;  4F52 A;  1OJL A;  4XQF A;  1YYV A;  1IXC A;  4MEX F;  1FSH A;  4S0H B;  3BY6 A;  5F64 A;  4LJZ F;  1ETY A;  3WGI A;  4RB0 A;  3CCJ I;  2R5Y B;  4EMS A;  5BMZ A;  2QA4 I;  3GO5 A;  3S15 J;  2VE8 A;  1B72 B;  3SYT A;  3FIW A;  2UXN A;  4PK4 A;  1IG7 A;  1VQ8 I;  4LLG F;  2FOK A;  1TTY A;  2MGQ A;  4AD9 A;  4PJJ A;  1VQN I;  3RI4 A;  2E71 A;  1FSE A;  5E3O A;  2VXD A;  5KAI C;  4V19 K;  3TDU C;  3TO7 A;  1UG2 A;  2FBK A;  1VQ4 I;  4EEF G;  3KLO A;  2R7S A;  1VTN C;  2ZJ2 A;  1RR8 C;  1RI7 A;  3EYI A;  4ZYE A;  1Z3Y A;  1BBY A;  3DCF A;  3GZN B;  3I3L A;  3NEU A;  1MGT A;  1X1D A;  4E7H A;  3K10 A;  2X4H A;  2GA2 A;  3M8E A;  3IH2 A;  1R49 A;  2CV0 A;  2JA2 A;  4Y52 J;  4ESJ A;  5L3F A;  1ETX A;  2DTR A;  2STW A;  2EA4 A;  4L5E A;  2IA2 A;  3FXL A;  3QYB A;  2HVQ A;  2VI6 A;  3GF2 A;  1ZG5 A;  1BR4 A;  3WU1 B;  3CCU I;  5HDN A;  3BC8 A;  4AIJ A;  4D0P A;  2ZO4 A;  1ZR2 A;  3OL4 A;  1FT9 A;  1R1U A;  3DQV C;  2P5L C;  3ZXS A;  4YFK F;  3WTT C;  1CF7 B;  3L1P A;  5GAG J;  2MC4 A;  3S16 J;  1WCM J;  4LG3 A;  1Z6R A;  1KQ8 A;  2LKP A;  3JRG A;  1PUF A;  1DUX C;  5DEQ A;  5HOD A;  3G71 I;  2BZT A;  1SD6 A;  1I3Q J;  2K9Q A;  3MVP A;  3JTG A;  1SAX A;  1RUO A;  3ZMV A;  4BY7 J;  3BR5 A;  2FX0 A;  5J1Y A;  2HPI A;  2F5E A;  1WPK A;  2NS0 A;  4P96 A;  3DBR B;  1W5T A;  4IQ4 A;  1B1B A;  3BZC A;  1XGO A;  2N8G A;  4X1E A;  4A3G J;  4M6V A;  4XKV A;  2VUM J;  1LFP A;  1OR7 A;  1LDK B;  2PMU A;  1FX7 A;  1F9N A;  1EV7 A;  2FD5 A;  4GXO A;  1ZGA A;  2LR8 A;  2KP6 A;  4HDU A;  4N9I A;  2VBZ A;  1YS7 A;  4BEH A;  1C0W A;  2PG4 A;  1VQP I;  4EJW A;  1DQU A;  4NBQ A;  3OWT A;  4DGW B;  3GFM A;  1JXS A;  4J01 A;  1HW5 A;  1LDJ A;  3ABL H;  1BC8 C;  4XRS G;  3WTS C;  3H9Q A;  1ZHF A;  3HOT A;  2F48 A;  2V6C A;  2EZK A;  3ULQ B;  1O7L A;  4KIG A;  3K4N A;  2RQP A;  5EGO B;  3U1D A;  3GFI A;  2ME6 A;  1OCR H;  3LA2 A;  1ON2 A;  4NQW B;  4RM3 A;  1VQ9 I;  3K1N A;  1T56 A;  1JTY A;  2ZNY A;  1QHH D;  5E8I A;  3OYB A;  1ACI A;  1KU3 A;  1KU9 A;  1VI0 A;  1ZRF A;  1WRJ A;  5J47 A;  3KYD B;  2COB A;  3PFY A;  5D8L B;  2DBB A;  1T6S A;  2MLG A;  4PSW A;  1W36 D;  2F5F A;  2HDD A;  4MIM A;  2CGP A;  1P9Q C;  3HHH A;  1J9I A;  4GO1 A;  2BY1 A;  4UVB A;  4RLQ A;  1ORK A;  2LKX A;  3QU3 A;  2R7F A;  2GOM A;  2AQF A;  3OYF A;  3W2W A;  4WX9 A;  3FXM A;  3DXJ F;  3HRT A;  1K78 B;  1X2N A;  2IJL A;  1U2W A;  2BXY A;  3EQL F;  2KZV A;  3S2H J;  1RPW A;  5JHF A;  2VJJ A;  1J59 A;  2EV6 A;  3B02 A;  2E1M C;  4E7S A;  2HZT A;  3P9K A;  1JI8 A;  5IT3 A;  4IRG A;  1B8I A;  1XPX A;  2E34 A;  1MJB A;  4EQQ A;  3F8M A;  3E1S A;  5EEA A;  4EM2 A;  1R23 A;  2NVY J;  3PIO F;  1YTY A;  1QGP A;  3ERM A;  3TMO A;  1S7O A;  3R61 A;  3F6O A;  3KP5 A;  1W0T A;  1V5F A;  3B6C A;  4DJA A;  2DOE A;  2ELK A;  2ID6 A;  3ZMU A;  1D5Y A;  2NOJ B;  2MYS A;  2R7T A;  1YJ9 I;  3LSP A;  2NRA C;  3QQA A;  2V1D A;  4A0X A;  2IRF G;  2JTV A;  2EV5 A;  3M8J A;  5EYR A;  3KIO A;  3SFZ A;  3K70 D;  3ECO A;  3OS2 A;  2UUZ A;  3IWZ A;  4PJL A;  3KP6 A;  2YPR A;  4NDL A;  2MD0 A;  3QOP A;  4ESF A;  1N77 A;  2QKM B;  4XLF A;  1SAU A;  1SFE A;  5EEG A;  4KIF A;  4ETS A;  3R6S A;  2ZB9 A;  5KCM A;  1AHD P;  3DKY A;  4ZDL A;  5LHI A;  1X4O A;  1R6R A;  4L0Y B;  4UV9 A;  2M45 A;  1YHQ I;  2HOE A;  2FOW A;  4FE7 A;  4KA4 A;  1D8J A;  2ETH A;  2L9S A;  2M8G X;  2O8K A;  4IPA A;  2ZXJ A;  3E6D A;  1K79 A;  2WBM A;  2P7C B;  1FIP A;  3ZN1 A;  4XL9 A;  2HYJ A;  4ZTJ A;  1UCR A;  2B9S A;  1VF9 A;  3BR2 A;  3FDY A;  5DCM B;  2GXB A;  4RM2 A;  1RET A;  4CYC A;  4OWR B;  3JSO A;  3FMR A;  5HS8 A;  3E5U A;  3NWT A;  3JRE A;  1BI1 A;  1DU0 A;  3CP2 A;  2X9D A;  2OAZ A;  2HI3 A;  3DU5 A;  2IBD A;  3LST A;  3OIO A;  2GM4 A;  1V55 H;  2P4W A;  3WGH A;  2XGX A;  4PGG A;  3VOE A;  2GXG A;  4BQO A;  1WJA A;  4KN4 X;  2NYX A;  2TCT A;  2Z9O A;  5C4J J;  1HBX G;  2LLK A;  2QUF A;  3JW4 A;  4D1Q A;  2WAQ A;  3FM5 A;  3PO3 J;  2EFW A;  1IN5 A;  1QA6 A;  4FQG A;  3MFK A;  2XKO A;  1ONV A;  5A2Q Z;  3H5N A;  2QQ9 A;  2YSR A;  5HS9 A;  3VDX A;  3GTQ J;  1WZ2 A;  2KIU A;  4P9U A;  3RKY A;  4OIQ F;  1MIJ A;  2L0K A;  1NK2 P;  4GCV A;  4ESB A;  1V5G A;  2YU3 A;  2R7X A;  2ELJ A;  5ICC A;  3OYA A;  1S7E A;  1I50 J;  2KKO A;  4D9J A;  4EV0 A;  4WWC A;  3HG9 A;  3QPH A;  3WTX C;  3KYC B;  3QPS A;  3MD2 A;  3HSF A;  3OY9 A;  2D2W A;  3RYR A;  5TIS C;  2K27 A;  1HKS A;  3T8T A;  2H8W A;  1XS9 A;  3TGN A;  4A69 C;  2EK5 A;  3PQJ A;  1QU3 A;  4XKW A;  4O3M A;  2R5Z A;  5LGN A;  4HQE A;  1X1B A;  3LSI A;  4A3K J;  2IEK A;  2L4M A;  2ZJQ F;  1HC8 A;  1V5E A;  3BCA A;  2DYR H;  2IT0 A;  1I39 A;  2L7Z A;  1SD4 A;  1ETW A;  3AG4 H;  5GP9 A;  3GFJ A;  2NVQ J;  4UB8 C;  2VKH A;  3H92 A;  4AVP A;  3AG2 H;  5AIQ A;  3P9I A;  4B43 A;  3DEW A;  3M9A A;  2IP2 A;  5B5E C;  2ZXW H;  4BQA A;  1HCR A;  3GYH X;  3C18 A;  3R0A A;  1P7J A;  3KFW X;  1ZG3 A;  1FMV A;  3MCZ A;  5HLH A;  5DM6 F;  1O57 A;  1R5I D;  1RR7 A;  3LSM A;  2M7A A;  3FM3 A;  4K2E A;  2P6S A;  4MQ9 F;  4E7K A;  3F72 A;  3FBI B;  3F21 A;  2D5V A;  2DPU A;  5FB2 A;  2NVT J;  3O2P E;  4OU0 A;  5D5U B;  3S93 A;  3HYI A;  1D1C A;  2HQA A;  1BW5 A;  4CCN A;  1TT5 B;  1ZYR F;  3SDB A;  4A6D A;  3CCY A;  2R7D A;  2HXI A;  2NS8 A;  3C2H A;  2ELH A;  1D0Y A;  3GW2 A;  5GPA A;  3M07 A;  1BI3 A;  1WI9 A;  2PQ8 A;  1HST A;  1HA8 A;  4RGX A;  5LLQ A;  4EJV A;  1YI2 I;  4JQF A;  5F08 A;  4L0Z B;  4BAY A;  2B7E A;  1OR7 C;  3HDD A;  2A5W A;  1VQ6 I;  2VON A;  1WSU A;  4C3I J;  2BY0 A;  5CYV A;  4EVI A;  1FPQ A;  3ERE D;  2ISZ A;  4ZH4 F;  4Q5S F;  3K9T A;  2W00 A;  3IWF A;  4AU7 A;  2KIM A;  1SFK A;  2CW8 A;  1UMQ A;  2QZ8 A;  5FFX A;  4C2T A;  3VYS B;  2M8E A;  4DZP A;  4M72 A;  2CQ7 A;  3KEO A;  4ZZL A;  4YII A;  4J00 A;  4HNV A;  1S7A A;  1Y56 A;  5LHG A;  4M3G A;  3HGY A;  3K6G A;  1L3L A;  5HOO A;  1JKO C;  3GXO A;  3CQZ J;  5LGT A;  4IVN A;  3RZO J;  3K4K A;  1GT0 C;  2QM3 A;  1APL C;  2F5D A;  2R3S A;  3K2Z A;  4LFU A;  3BJO A;  3QYF A;  4Q4Z F;  4PJN A;  2CQK A;  3GZ6 A;  5E3M A;  1IN7 A;  1SD7 A;  5FKK A;  2HKO A;  1YJN I;  3WTW C;  4MGR A;  3CF2 A;  2O3F A;  2E7X A;  2CG4 A;  3WHB A;  2BVL A;  2G7H A;  2J5O A;  2CH0 A;  2GIZ A;  2HGC A;  3MWM A;  3NQO A;  5CVU A;  2ESN A;  1XN7 A;  1SAN A;  2Q2E B;  4AWX B;  1ZGW A;  1RUN A;  4IHY A;  4WXC A;  4AC0 A;  4XOT A;  1D1B A;  2PJR B;  1T39 A;  2CQQ A;  4A2U A;  3S1M J;  1TWF J;  4JX4 A;  4XN0 A;  2WV1 A;  3S3O A;  2OCC H;  2XAH A;  3HGG A;  1TLH B;  4KIS A;  1KYZ A;  1YJW I;  3P7N A;  3BZK A;  2JUC A;  1LVK A;  4WF2 A;  1JKQ C;  3BP8 A;  1Z0X A;  1YW7 A;  3EUK L;  4FET A;  3S1R J;  4HV5 A;  1UG0 A;  4JP0 A;  2FEZ A;  3S17 J;  4IOA F;  2XSD C;  2V7F A;  2HTS A;  1U6G A;  5BPI A;  4B3X A;  4LLN A;  4HBL A;  4R1H A;  3PUF A;  4EAT A;  4HPQ A;  4RB1 A;  1X58 A;  3DP7 A;  1TQP A;  1UJ8 A;  5D5X B;  3LFK A;  3KEY A;  2EIM H;  1R71 A;  2MLK A;  5M5X J;  4A3I J;  3DLL F;  4HOB A;  1FBQ A;  1WJB A;  2JUG A;  5F04 A;  2Y31 A;  1ZAR A;  3RQI A;  4OMZ A;  1JTX A;  3IRR A;  3PO2 J;  1FOX A;  4EM1 A;  2FSW A;  2K4B A;  4MQV A;  4PSX A;  1R4M B;  3BWG A;  4DNC A;  5AON A;  1ZR4 A;  2BEO A;  3CCQ I;  3ZQC A;  5B1B H;  3K7A J;  4KIT B;  3V7R A;  1I3A A;  2P5K A;  3FXJ A;  2HDC A;  3A0H C;  5K5O A;  4RB2 C;  4OIP F;  1JGS A;  3V42 A;  2VKD A;  2DMN A;  1J09 A;  3ZQI A;  4G6D A;  2KIQ A;  4F55 A;  3ZCO A;  5F1J A;  3Q3S A;  3KP2 A;  2R7U A;  3C2B A;  3DPL C;  2A61 A;  1RKT A;  4UNO A;  1YOV B;  3KLN A;  3BTJ A;  4XLH A;  5ED4 A;  3D5S C;  2GOX B;  3ROU A;  1FIA A;  2DJN A;  1O3T A;  1R5H A;  1ENH A;  3SZP A;  4RA2 A;  4HF1 A;  2FF4 A;  3UR3 C;  3M8F A;  3CJT B;  3F0C A;  5HS7 A;  4B47 A;  3HB9 A;  3WHC A;  4IXA A;  3V7S A;  1U9O A;  1W7P A;  1XD7 A;  4HF2 A;  3K69 A;  1FBS A;  4A0Z A;  2BHZ A;  2DDB A;  1OPC A;  4L9V A;  2K3F A;  5FKN A;  4EM0 B;  2R7R A;  3S3N A;  5EDN A;  2ACJ A;  1ULY A;  1TT0 A;  2V1U A;  1WH7 A;  2W24 A;  3BOQ A;  4FX4 A;  2CO5 A;  2X85 A;  2E1C A;  1D3Y A;  1RES A;  3NAU A;  4U88 A;  4D5F A;  4YRV A;  2DLL A;  3GTM J;  2V1N A;  4HSR A;  2E1O A;  4IOC F;  1Y8Q B;  5LGU A;  4I6Z A;  3EYY A;  3HTU A;  4CGZ A;  4JX5 A;  4IF4 A;  2M4K A;  2CV2 A;  1EH7 A;  2LMD A;  1Q1H A;  3DV8 A;  1HXD A;  2ZKZ A;  3QP5 A;  2M34 A;  4OIN F;  5JR3 A;  2OA4 A;  4OOI A;  3OYN A;  5LEK A;  2DJI A;  3IAS 2;  3CP8 A;  1S3J A;  2KIS A;  2QWW A;  3NAR A;  3TQN A;  1GHC A;  3HHG A;  2DN0 A;  3Q0V A;  4KFC A;  4G6T B;  2IA0 A;  2R5Y A;  2XRN A;  1HKQ A;  3FBN B;  1WFX A;  4L18 B;  3M3Y J;  2A3S A;  3JRB A;  1WWX A;  5DUK A;  4U0V A;  2H27 A;  4G7O F;  1A5J A;  2A6T A;  1ITY A;  3H3Z A;  1W7P B;  1JHF A;  1AWC A;  3SJM A;  1R36 A;  3ML6 A;  3ZMS A;  1IW7 F;  2H1L A;  1XTA A;  1K61 A;  4H0E A;  1SVL A;  1BL0 A;  3J7A O;  3S1N J;  1R00 A;  5HLG A;  1KU7 A;  4WK8 F;  2JSP A;  2MBF A;  4ENN A;  4L9N A;  2L7F P;  2XGC A;  3DPT A;  1LEA A;  3MKW B;  3ZR8 X;  2COM A;  4PDK A;  5JI6 A;  3BJA A;  1YIJ I;  2GXA A;  2AXL A;  3FXU A;  4BL0 B;  2HFH A;  1IAW A;  1MBG A;  1LPQ A;  1ZRE A;  2HOT A;  2PMZ N;  2A68 F;  2HOA A;  1WJF A;  1FWZ A;  5K1Y A;  1GXP A;  1LE8 A;  2LTP A;  1I27 A;  2LF8 A;  1QVU A;  2QKL B;  4B1R A;  4A3J J;  1W5S A;  4F3Q A;  3FMS A;  2LSO A;  1U8R A;  3H5R A;  1IN8 A;  3GLX A;  5CPR B;  1D0X A;  1VQK I;  1IN6 A;  4UXN A;  5L3C A;  5KNL A;  2A6E F;  3ABK H;  2X1C A;  3ECH A;  2LKS A;  3VEP A;  4G7H F;  3ZOB A;  2EV0 A;  2D45 A;  4Z6Y A;  1W4M A;  2QBY A;  4X0G A;  2XAJ A;  2XV4 S;  1G3Y A;  1Z7U A;  3QPT A;  4BXF A;  5LRS A;  5EEH A;  4AM3 A;  2EIL H;  1E3P A;  4EJU A;  1WJ5 A;  1Y0N A;  1MW7 A;  2F4I A;  1JUS A;  4B48 A;  1R4N B;  3FXR A;  2Z1D A;  3HPG A;  4YIF A;  4Y3O A;  4IHW A;  2PFB A;  2QSH X;  4XKB A;  4C30 A;  2AO9 A;  3CC4 I;  4XNF A;  4G9Y A;  1YW8 A;  4XLC A;  2VAS A;  3HRM A;  1TP4 A;  2JA7 J;  2V79 A;  2GZW A;  2OV7 A;  4UUT A;  3WG7 H;  1QNT A;  4ZYD A;  1P6R A;  4MFD A;  2GQQ A;  3BPX A;  3MZ8 A;  4CCL A;  1IXS B;  3P9C A;  1FEX A;  1D1A A;  5TGT A;  2DAO A;  2Y9Z A;  2E5N A;  2LY1 A;  1GVD A;  3RKX A;  1IDY A;  1PVE A;  2A07 F;  1HLV A;  1MBH A;  2I8D A;  3VB2 A;  5EZG A;  2DO7 A;  3SEQ A;  2M87 A;  2M9H A;  3WU2 C;  1Y6I A;  3W3C A;  2FUG 2;  4CUG A;  3C1D A;  3HUG A;  4AIK A;  2BVM A;  5J6X A;  3S2D J;  3OOU A;  4DYC A;  2M7B A;  3BR0 A;  2UZK A;  4CCJ A;  3BJ6 A;  3ZQF A;  2GIV A;  3FXK A;  5F0F A;  1A35 A;  1F36 A;  5L3D A;  1HDD C;  3LA7 A;  3R4K A;  1QO0 D;  3IH3 A;  4GDF A;  1G8X A;  2V1X A;  3D5L A;  4P55 A;  4LB5 A;  2H6C A;  4I98 B;  2EFQ A;  3EUA A;  4G8X A;  3GFL A;  4B3A A;  4GFB A;  2W4S A;  4XN3 A;  1WQ2 A;  1EA3 A;  2LH9 A;  4IRI A;  2AS5 F;  1O7F A;  4BYY A;  2L9R A;  2EFP A;  2Z99 A;  2QSF X;  3OSF A;  2L9V A;  4HQM A;  3HBL A;  4RGS A;  3BCB A;  3K1P A;  1QPI A;  4M74 A;  1QRY A;  2E2H J;  1O3R A;  4XR6 A;  4A5N A;  3GTL J;  4LMY A;  3QOE A;  1O4X A;  3GZ5 A;  4WXH A;  4OAZ A;  4F91 B;  1CGP A;  5F0C A;  1MJA A;  2EB7 A;  5FLX K;  1VND A;  3IAM 2;  2OBP A;  5CVV A;  2MG4 A;  3EUH A;  2EQR A;  4XRS A;  3AL0 C;  2LF7 A;  4GYI A;  1S9H A;  4A12 A;  1RNL A;  2QVO A;  4AUX A;  1XDU A;  5FJ8 J;  5GAD J;  1CF7 A;  1GDT A;  4XOR A;  4HG2 A;  2VT2 A;  2CV1 A;  1NTC A;  1IGN A;  3OV8 A;  4Y4R A;  5EF6 A;  2Y30 A;  2HU9 A;  1HDP A;  1NG6 A;  3KET A;  1Z9C A;  2DU9 A;  3G1M A;  2JVG A;  5HLT A;  1BIA A;  2CQN A;  5FD5 A;  3J81 K;  4RBO A;  4MO7 A;  5CKT A;  1MMD A;  1LQ1 A;  1P4W A;  3OS1 A;  4AID A;  4C9Y A;  4XLN F;  3TO6 A;  2RNG A;  2Y0S A;  4M6Y A;  1QHG A;  2EFN A;  4OIR F;  4Q47 A;  3S3M A;  5KVR A;  3OR2 C;  2HKX A;  2R4G A;  2NAZ A;  1LVA A;  1IF1 A;  1K83 J;  1PP7 U;  2FBH A;  3LWF A;  4IHV A;  1Z05 A;  5J4Y A;  2UWM A;  3I71 A;  4XOP A;  2O0Y A;  2QEX I;  1YLF A;  2QQ8 A;  5IY5 H;  3OR1 C;  4V2F A;  3HRU A;  2IPQ X;  3GLL A;  1W1W E;  1YFH A;  3CUQ C;  2VOP A;  2EA2 A;  5B66 C;  5FD6 A;  1X3Z B;  3CCL I;  2VN2 A;  4IZZ A;  1J7K A;  1STZ A;  1ODD A;  4HX8 A;  1ZRD A;  1BM9 A;  2P6T A;  2ZSH B;  2A05 A;  3TP0 A;  2KT0 A;  3LFU A;  3HJE A;  4RS8 A;  1QZE A;  3TOA A;  4FIS A;  3W6K B;  5E3L A;  2CMP A;  1PUF B;  1TNT A;  4N4O B;  3RJP A;  2MA3 A;  5TJJ A;  2HZD A;  3L2Q A;  2P8T A;  1JE8 A;  3K4J A;  4ZZD A;  1MSF C;  3DU6 A;  3WU0 A;  1YRN B;  3CCE I;  4CXF A;  2WB1 N;  3FHZ A;  1UZC A;  4BKX A;  2DFF A;  2VC0 A;  1TW3 A;  2STT A;  2R7Q A;  2Y0S N;  5EZH A;  2CFX A;  1A36 A;  1T98 A;  2VBX A;  4EGZ A;  1EH6 A;  4Y17 A;  4E7L A;  3KZI C;  1RZ4 A;  2QF7 A;  4C2U A;  2RC4 A;  3PFI A;  3G4S I;  2M4G A;  3JAM Z;  2PJR A;  1W5C C;  1ON1 A;  2VJ4 A;  3PUB A;  2AXT C;  2G9W A;  4UUS B;  5E20 A;  3HC7 A;  4EGY A;  3LMM A;  3V7C A;  4S04 A;  4FAS D;  3D1N I;  4QPQ A;  1SFU A;  3VYU B;  2Q2E A;  4PUS A;  5M3F J;  2PMH A;  3BPV A;  2RQQ A;  3CME I;  3CJR B;  4RDU A;  5EGO A;  2DYS H;  1DGW Y;  3TBI A;  2HEO A;  2NNN A;  4HLX A;  2XRO A;  2MH9 A;  5J4V A;  2OZ6 A;  3PM1 A;  2M0C A;  2L54 A;  1MMA A;  2VBW A;  2PEX A;  3F9K A;  4A3F J;  3L00 A;  2K9L A;  3TO9 A;  1WKM A;  4MFE A;  2WAD A;  1MH4 A;  2K9N A;  2Y2Z A;  2JPC A;  3FF5 A;  3ZQ7 A;  2IA1 A;  2E2J J;  2R7O A;  3SQN A;  5E1W A;  2QCO A;  1TWC J;  5JLW A;  3O6B B;  4BY1 J;  3GWZ A;  3AFH A;  1VQO I;  3NWS A;  2XC7 A;  3I58 A;  2ADU A;  4BJT A;  1M1E B;  2JA8 J;  3AL0 B;  3T8R A;  4YIR X;  1U5T A;  2OQR A;  1ZH5 A;  3ZRG A;  4DW6 A;  2AQE A;  3CLO A;  3HKZ N;  1SD5 A;  1U9N A;  1BIB A;  3LQR A;  4CO8 A;  3J7Z I;  2JK3 A;  2WV0 A;  1NH3 A;  2PLY A;  2JVH A;  2DFH A;  5LBQ A;  1R1T A;  2CRG A;  2LFB A;  5DD8 A;  3V8L A;  3RCO A;  4FE4 A;  5DS9 A;  5M5W J;  5K7Z A;  5HNH A;  3E6C C;  4P5O A;  2W57 A;  5ICF A;  3SXY A;  3CTA A;  1E17 A;  4RLF A;  3JRD A;  4E7I A;  1YQA A;  2XSJ C;  4RGR A;  2XB0 X;  3FIS A;  1J5Y A;  2X1D A;  1ETK A;  1UEL B;  2HQN A;  4A3M J;  3CJN A;  5J3L A;  4Z2Y A;  1FP2 A;  3R0J A;  5FLV A;  3G2B A;  3HIF A;  3OL3 A;  4KUM A;  1MBK A;  2XRL A;  1AKH B;  2AHQ A;  4KMF A;  3A02 A;  1Z6T A;  2DA1 A;  3BZ6 A;  4I7H A;  3F22 A;  4IHX A;  3K4L A;  3F8C A;  1OIS A;  5BS6 A;  1Z7L A;  1ZAO A;  2MAB A;  2RN7 A;  4XID A;  3A2K A;  3H5A A;  3PNY A;  5D5W B;  3F23 A;  3HEF A;  1Y0U A;  3OYG A;  2EIK H;  1IRZ A;  2NVX J;  3R60 A;  1TWA J;  3L2U A;  1NG7 A;  3IP4 B;  2LG4 A;  2Y48 A;  1XSV A;  3SZT A;  3HKZ A;  3Q9V A;  3JSP A;  2VOO A;  3MQ0 A;  3X2Q H;  5HVQ C;  1TQM A;  3DFG A;  1MH3 A;  3BR6 A;  2L02 A;  2VQG A;  3G3Z A;  4HDV A;  3IRQ A;  3VYR B;  3DTI A;  2EFO A;  2OC6 A;  2ZCW A;  3CUQ A;  2X6X A;  1R7J A;  2FRH A;  2KIF A;  2L2O A;  2VT3 A;  4QPO A;  1NK3 P;  2HVR A;  2KL4 A;  2F5V A;  4ITV A;  3PJR A;  3COA C;  2E19 A;  4HST A;  3F8F A;  4B4C A;  3RKQ A;  3A1Y A;  1OKR A;  2M1B A;  5JVT A;  2XPW A;  4XKC A;  2JA5 J;  1B9M A;  3L09 A;  1F1Z A;  3GUD A;  5CVR A;  3CUQ B;  2I5U A;  1MNM C;  2Z33 A;  2DFE A;  5LFA A;  2KDO A;  3J80 Z;  4KJZ A;  2DW4 A;  3J80 K;  4IX7 A;  4ENJ A;  5J8F A;  1ZGJ A;  3I4M J;  3L2W A;  1YO5 C;  3ZPL A;  2LRD A;  3MKZ A;  2QQA A;  1F4K A;  1FZP B;  1F43 A;  2FU4 A;  3H9J A;  3CCS I;  1ZKG A;  3ZQH A;  2OF7 A;  3G1L A;  4E7J A;  1X19 A;  3O8G A;  3PQK A;  4U7D A;  1SFX A;  3F6V A;  2VE9 A;  4M3B A;  5CVJ A;  3H35 A;  4QSH A;  3U2R A;  4A3L J;  2XB5 A;  1IO2 A;  2ZME C;  1MBF A;  3GVA A;  1MDM A;  2Z3Y A;  3D5R C;  1R58 A;  3LL7 A;  3LSK A;  2YX7 A;  2R92 J;  4HV6 A;  1IXR C;  2Z2S B;  2EH3 A;  3KZY A;  5D6E A;  1BW6 A;  5ILS A;  3AG1 H;  3DEE A;  5HDK A;  2M0M A;  1GUU A;  4M3F A;  3EET A;  3PIP F;  4WCG A;  2VQL A;  3AAF A;  2I10 A;  1I5Z A;  2YS9 A;  1YX5 A;  2K9M A;  4CZZ A;  1H9T A;  5IYD J;  1Y39 A;  4B09 A;  3JRF A;  2KFD A;  1HQC A;  1XDS A;  2W25 A;  2DFI A;  1UHM A;  1D5V A;  3RYP A;  1JUP A;  1AU7 A;  2M3A A;  1T0F C;  3IUO A;  1J75 A;  3N4M A;  4IEJ A;  2HNH A;  4N9H A;  5JFR A;  4HX7 A;  1EH8 A;  2KJB A;  3KP4 A;  4A0Y A;  4N0B A;  5IP7 J;  4C3H J;  3OYM A;  3ASN H;  2R0Q C;  4D7N A;  2VKV A;  3CZ6 A;  4NC7 A;  2TDX A;  4BJ5 C;  4JYK A;  2WWY A;  2Y9Y A;  3BR3 A;  2BW3 A;  2IXS A;  2VXZ A;  4NC6 A;  3G73 A;  3H9G A;  2GWR A;  2NOG A;  4AYB A;  4BXX J;  3RSN A;  1B9N A;  4HX4 A;  4U87 A;  2IGO A;  5DCM A;  4LIT A;  1R9T J;  3REO A;  2XUB A;  3VSL A;  4KNY A;  1RRJ A;  4G6Q A;  4LK1 F;  1TW2 A;  1A6I A;  4M3E A;  4O6J A;  2H6B A;  1MND A;  3A0B C;  4HEA 2;  2KRC A;  3SHF A;  1MNE A;  3DPU A;  1RIO H;  3S8P A;  3H1C A;  4UVA A;  1KZH A;  1EJ9 A;  1OCP A;  3MZH A;  3HPH A;  3TOB A;  3F8B A;  1TBX A;  1HKT A;  5CQE A;  5D4S A;  4IRH A;  2XAF A;  2KHM A;  2QLZ A;  4Y15 A;  3WE3 A;  2YR2 A;  2CU7 A;  1ZQ3 P;  2DK8 A;  4P1W A;  1OCT C;  3VOD A;  2ZXH A;  3QP6 A;  4CIC A;  2K40 A;  5HNF A;  2KDZ A;  3BQZ A;  4MLO A;  2RV8 A;  2W48 A;  3Q5F A;  1Z67 A;  3BT9 A;  1XCB A;  3M4O J;  3TW7 A;  2H09 A;  5D5V B;  4XBF A;  1NHA A;  3LOC A;  1K78 A;  2ESH A;  1ETQ A;  1B4A A;  3A03 A;  2R7W A;  5GTI C;  3ZMD A;  1E3H A;  4NUB A;  3DF8 A;  2R7V A;  4AYB N;  2VPL A;  1WI3 A;  3PSI A;  4ENM A;  3FZV A;  4F92 B;  3FWE A;  5C4X J;  4YEL A;  1W7P D;  2K02 A;  2L5Q A;  3VFZ A;  2XPU A;  3NRV A;  6PAX A;  1WH5 A;  1IJW C;  5F0H A;  1MBE A;  2B63 J;  2WAF A;  3V8K A;  5J1R A;  2X48 A;  2W1O A;  2DXI A;  1TWH J;  2DA7 A;  1I6X A;  1X1P A;  1R22 A;  3ZQL A;  2JRM A;  1U0J A;  2LP0 A;  2WA0 A;  5B3S H;  2NXN B;  1H88 C;  1IRF A;  3E5X A;  1FY7 A;  3BTI A;  3HSE A;  2ISY A;  2HS5 A;  3HZJ A;  4S05 A;  2L9N A;  3IL2 A;  4M6X A;  1UFM A;  2GA1 A;  2VL8 A;  5CQG A;  2DTZ A;  3CMY A;  1G4D A;  2ZJR F;  1K6Y A;  1YG2 A;  2EWN A;  2WY7 Q;  2RKH A;  1U78 A;  4GGG A;  2XVC A;  1X1C A;  1S6L A;  2Y75 A;  1OCO H;  1FOY A;  2CS3 A;  5D6F A;  2GAU A;  3CC2 I;  1PDN C;  1H0M A;  1CQT A;  2L3D A;  1IRX A;  5E79 C;  4FX0 A;  2QQB A;  1KQ0 A;  1K4S A;  2ZC2 A;  4HNT A;  3QWL A;  4IHS A;  3GEZ A;  4ASN A;  3A4C A;  5A2Q K;  1FYL A;  3GCM A;  3ZQQ A;  1I1S A;  2KRF A;  2XGE A;  1MJ9 A;  5L3B A;  2DQL A;  4LD5 A;  4CYC B;  2WB1 A;  1TL8 A;  3Q0U A;  3V8J A;  1UST A;  2DMQ A;  2XAU A;  3T0Y A;  3U9G A;  2VLA A;  1ZLJ A;  2DOD A;  2MD5 A;  1I6H J;  1OYY A;  1TQI A;  2RVC A;  5K7F A;  1Q1V A;  2FXA A;  4GYG A;  4MTE A;  3H3V K;  2BXZ A;  2QGU A;  5GAE J;  3IKV A;  4UY8 I;  1SEU A;  4L5J A;  2ZJP F;  4A3B J;  2K3P A;  1FNN A;  1MZB A;  2CQX A;  2E35 A;  5DD4 A;  1ZLK A;  4MEY F;  3SFI A;  1LJ9 A;  1IC8 A;  3JAM K;  1UB9 A;  2FMY A;  1S72 I;  3UNG C;  3E6B A;  5J40 A;  1MMG A;  4YFX F;  5H20 A;  1B6A A;  3DEU A;  2VOD A;  4X6A J;  1OLT A;  2V9K A;  1T08 B;  3K2A A;  1E0E A;  1BC7 C;  1Z77 A;  2PMZ A;  1V54 H;  4ON0 A;  1ZN2 A;  1D8K A;  3MZY A;  4QWQ A;  1UHS A;  1P4X A;  4XM3 A;  2R93 J;  2IGK A;  1AOY A;  2L7K A;  4BS9 A;  5B1A H;  3T5X A;  1DPR A;  5DUI A;  4FT8 A;  1POG A;  2L4A A;  1Y1W J;  1B72 A;  1T33 A;  2O61 A;  2E7W A;  3KP3 A;  3GBG A;  1ZTR A;  4A3D J;  5GAH J;  1T2K A;  2Z16 A;  1F5T A;  1WGX A;  3JCU C;  4U0Y A;  4CSW A;  2KQR A;  3PSF A;  2P7V B;  3KP7 A;  4BDZ A;  3LSG A;  2DCE A;  5K5Q A;  5BPD A;  2DMP A;  3L7W A;  2VKE A;  1LUJ B;  3JRA A;  2YUS A;  3SDG A;  4LIU A;  3FXO A;  3LSJ A;  5FKL A;  3H36 A;  4A5M A;  5IP9 J;  1JUM A;  2W82 A;  4MNU A;  4TV7 A;  5LD2 C;  2LC2 A;  5BNG A;  3A01 A;  3H0D A;  3OYH A;  4BE2 A;  2F4M B;  2DK5 A;  4UUS A;  1LFB A;  2G0E A;  3AG3 H;  1DP7 P;  3I5U A;  5DYM A;  3QU6 A;  5HLI A;  3FXQ A;  2O6G E;  4CHU A;  4KYW A;  1U3E M;  3K4M A;  1BN5 A;  3OIP A;  3CMA I;  2BGC A;  2BV6 A;  3KEQ A;  3JR9 A;  4XMY A;  5JLX A;  5FLM J;  3UKG A;  3RIR A;  3KCC A;  4CYD A;  2PI0 A;  2ZME B;  1N25 A;  3DBL B;  3CMM A;  3QPL A;  3PL8 A;  4ZDP A;  2EPF A;  3CLQ A;  3HOZ J;  1FMW A;  4BQQ A;  4NNJ A;  4QTR A;  2B0L A;  4XLE A;  3K0L A;  4CDG A;  3S1Q J;  1J0R A;  4ABZ A;  1IV6 A;  3TDZ C;  1XGN A;  3CC7 I;  4RAZ A;  2FA5 A;  1AKH A;  4BHC A;  2VQH A;  1BR2 A;  2EIJ H;  5IT9 K;  3HXL A;  5ILU A;  1S5L C;  1UHW A;  3BTC A;  3DLA A;  4KDP A;  3I4N J;  4KN7 X;  4F93 B;  4J19 A;  4KIB A;  3GTP J;  3OYC A;  4I02 A;  2L01 A;  1YRN A;  1IZ1 A;  1FBU A;  3CUO A;  4WXD A;  5KHD A;  1QZY A;  4M71 A;  3BR1 A;  2F6C A;  3BG9 A;  1LKX A;  3I0T A;  4CA0 A;  1G3S A;  3MMY B;  1V4R A;  3ABT A;  1KA8 A;  2V6E A;  3E6M A;  3CO7 C;  2JSC A;  4G12 A;  4M9S A;  5K5R A;  4BBS J;  3GTK J;  5F1R A;  3VWB A;  1GXQ A;  1IV8 A;  2RGV A;  4B8X A;  4PZJ A;  2JRT A;  4ZC3 A;  5J1U A;  3RDI A;  1S29 A;  4EJO A;  2ICW G;  1GVJ A;  2LBF B;  2DA4 A;  3D0S A;  3EPZ A;  3L2C A;  3CD6 I;  9ANT A;  4KT6 A;  1K6O A;  2CUJ A;  3IH4 A;  1JT0 A;  3W2V A;  2DA2 A;  2K9S A;  2QSG X;  2CUZ A;  4M9X A;  4FHT A;  2W85 A;  1GV5 A;  3A01 B;  4DIQ A;  5L3E A;  2OPT A;  3MAJ A;  4KT5 C;  3C7J A;  5L3G A;  4ENK A;  3JTH A;  4LIV A;  3JRI A;  4Y33 A;  3S2W A;  4G94 A;  3LSR A;  2M2E A;  2CUE A;  4N4N B;  1A31 A;  2P81 A;  2IW5 A;  3DKX A;  2MH2 A;  2ECB A;  4M3D A;  5F6F A;  1KON A;  4DZJ A;  3HRS A;  1OCC H;  3F3X A;  4NC8 A;  1PUE E;  4XSZ F;  1OYW A;  3O8H A;  5FO5 A;  2IAI A;  1G3T A;  2LVS A;  4XSX F;  4JK1 X;  2EZH A;  1FC3 A;  1B59 A;  4EJT A;  1IUY A;  1L0O C;  4UV8 A;  2XKP A;  2BE5 F;  5D8K B;  3TED A;  3BDD A;  1DDN A;  2C6Y A;  2OTJ I;  4R8H A;  3IC7 A;  1P4A A;  4MHG A;  4XRM A;  1ZRC A;  2VQC A;  4XLA A;  2E5Z A;  2WTE A;  3CO6 C;  1N75 A;  1Z91 A;  2JJ7 A;  3SZG A;  3L9F A;  4KMU X;  5JVG F;  1E2X A;  2MW8 A;  3MN2 A;  3P5J A;  3QRF F;  2V26 A;  1XGS A;  1JKP C;  3HTS B;  3FK7 A;  1BJZ A;  2DT5 A;  2XPV A;  1YS6 A;  4II2 A;  2WC2 A;  2EZL A;  4PGH A;  2J5P A;  2JN6 A;  3K1M A;  1VQL I;  4NQW A;  3WTV C;  2CJJ A;  1FYM A;  2KLO A;  1U5T C;  1ETV A;  2CSO A;  2BBY A;  4E6K G;  2DA5 A;  5FGM A;  4OIO F;  1K4T A;  4HF0 A;  1XSX A;  2IVM A;  4QIW N;  2GLO A;  3ZMT A;  1QBJ A;  1ZEL A;  2HDW A;  1LDD A;  1BJA A;  3HOX J;  5FRN A;  1HW1 A;  3IKT A;  4IKF A;  3CCM I;  3HOY J;  2IS1 A;  2DI3 A;  4LK0 F;  3ZGK A;  2XAS A;  3G6E I;  1D0Z A;  4O5V A;  2BOL A;  1IUF A;  1USS A;  2X6W A;  2Y0M A;  1T0F A;  4LGW A;  1H8A C;  2PX9 A;  1Y1V J;  1TNS A;  5JHU A;  3GTG J;  4JX6 A;  2W84 A;  1MMS A;  1MBJ A;  2YX4 A;  3I53 A;  3IHU A;  4FCY A;  3TW6 A;  3W6J B;  1G59 A;  4ZDO A;  1MMN A;  4BUP A;  2X6Y A;  5IT9 Z;  2ECC A;  2K4J A;  4PCQ A;  3K70 C;  3J81 Z;  1IRG A;  1DP3 A;  1REP C;  3B73 A;  3I64 A;  3M7G A;  1PJR A;  5E3N A;  4BXU A;  2HTJ A;  3EDP A;  4HW0 A;  3OYD A;  2CUF A;  1BI0 A;  1FP1 D;  2VPR A;  3E5Q A;  2E60 A;  3VPR A;  5ERI A;  2QBY B;  4CH7 A;  2FBI A;  2V4J C;  2BY3 A;  2DQR A;  2A69 F;  1W0U A;  1XMK A;  4D7M A;  4G7Z F;  1TWG J;  1OCZ H;  1XG1 A;  5EJC A;  4IO9 F;  1G2H A;  3WG9 A;  4FTH A;  4BDY A;  3JRH A;  3TL4 X;  3U1K A;  4CCK A;  4HA8 A;  3J7Y J;  5C3E J;  1ETO A;  3SEZ A;  3OYK A;  1JJ6 C;  4E7Z A;  5J8C A;  1TZL A;  2JMW A;  5D4R A;  4QLC U;  3FK6 A;  1ZG1 A;  1XX5 A;  5CJ9 A;  2E2I J;  2OJE D;  1BR1 A;  4KIC A;  2ZNZ A;  1FOW A;  4Y13 A;  2PJP A;  3QAH A;  3ZQG A;  5ICG A;  4UB6 C;  5DDG A;  5ICE A;  5K7H A;  1WJD A;  1B8I B;  3OSG A;  1OYI A;  3QOD A;  1BI2 A;  5C44 J;  2CW0 F;  2O03 A;  3KX2 A;  5DV5 A;  2DOF A;  2LNB A;  5E1Z B;  2LOO A;  2BHY A;  2DA6 A;  1P92 A;  2LDU A;  4RMN A;  3RPU A;  4HRI A;  1GV2 A;  2KMU A;  3HOS A;  2OCE A;  2CW7 A;  2OQG A;  5EG0 A;  1QPM A;  5IP6 A;  2HYG D;  4U0W A;  4W1U A;  2VIX A;  2HYF A;  3C3W A;  1KGS A;  3BG7 A;  4Y7N J;  3F8N A;  3OIQ A;  5GTH C;  3KZZ A;  1YE9 A;  3OMY A;  1QZZ A;  1QQI A;  1DPU A;  2HQR A;  1XSD A;  5IYC J;  1MSE C;  3HOW J;  4F7Z A;  4BE0 A;  4CZC A;  2DMT A;  3WTU C;  3OYJ A;  1WJE A;  2LYC A;  1PP8 F;  5FFZ A;  2UXX A;  1LFU P;  2W7N A;  2JZY A;  2F5C A;  2XF5 A;  4HYE A;  2R7Z J;  2Q0O A;  3V4G A;  1XCV A;  1T8I A;  3VSK A;  2P5V A;  2FNA A;  2JWT A;  2O8X A;  2JT1 A;  4II3 A;  4RGU A;  3E0J B;  5ILV A;  4BE1 A;  1XB4 A;  2ZFW A;  5IOY A;  3Q0W A;  2HWV A;  3DTK A;  3RTR A;  5HDG A;  1X4P A;  1Z1D A;  3TP3 A;  4LLL A;  1LB2 A;  1EKE A;  3AKZ A;  2OTL I;  4AIH A;  1EF4 A;  2KJC A;  3I59 A;  1U8B A;  3BRO A;  5DM7 F;  3ELK A;  3PNT A;  4U7B A;  3ESW B;  4DOZ A;  2HR3 A;  4BEH B;  3BTL A;  1YIT I;  2ME0 A;  2PBI A;  1SC7 A;  3N05 A;  3KYL A;  4BNC A;  2V9P A;  4C3J J;  3GTJ J;  4BH9 A;  1XGM A;  3JRC A;  4LG0 A;  5IOZ A;  1KYW A;  3B6A A;  1OFC X;  3U21 A;  2HVS A;  2XHK A;  4Q48 A;  4BQN A;  3L2R A;  2QYO A;  2YU9 J;  1RKW A;  1I1G A;  3LAJ A;  1OMI A;  2EBI A;  3RZD J;  1YX3 A;  5M3M J;  3M1E A;  1YIO A;  3E7L A;  5LHH A;  3RKW A;  2BW3 B;  4OMY A;  1HF0 A;  1RC9 A;  1JT6 A;  1JJ8 C;  1WVR A;  4RAY A;  3FKI J;  5KAF C;  3FKJ A;  2HQ5 A;  3Q9S A;  3VYT B;  3W2A A;  3J7A Y;  1FTT A;  3PNV A;  2A5Y B;  2LY9 A;  1ERD A;  1MDM B;  5H6Q A;  2HXO A;  3ABM H;  4XIC A;  2O5R A;  3QYE A;  1H9G A;  4ZTF A;  2H1K A;  2HOS A;  2XIG A;  2VC1 A;  1BOB A;  3ZP5 A;  1FJL A;  1SFO J;  2LK2 A;  2LD5 A;  3GTO J;  5H6R A;  3DTE A;  3ASO H;  2MFZ A;  3OYL A;  4DYQ A;  1KQ9 A;  2P0W A;  1VZ0 A;  2H94 A;  4LB6 B;  4BU2 A;  2NS7 A;  3OS0 A;  1TC3 C;  3K4C A;  4MTD A;  3LSH A;  3TKY A;  3OOP A;  2R5Z B;  2IGN A;  1K7A A;  3KE2 A;  3ONQ A;  1GLN A;  3LA3 A;  5AIP A;  2DOA A;  3I9V 2;  4P9F A;  4PFO A;  4C2M J;  1U5T B;  3MKY B;  2LRE A;  4JOM A;  4BHP A;  5E18 F;  1P7I A;  2ZME A;  4ZYG A;  2UV1 A;  3BG5 A;  1X3W B;  3L2V A;  1DGR M;  4HAM A;  1XC5 A;  3WTY C;  1X1A A;  2IGM A;  2EJR A;  3I59 B;  1HW2 A;  1PYV A;  4I01 A;  1YW9 A;  2Q8K A;  2TRT A;  3ZMZ A;  5FLX Z;  3OYE A;  2ZBK A;  2ZXI A;  3RQ4 A;  2RRE A;  5FRO A;  3HOU J;  2KRH A;  5E1X A;  2K85 A;  2K5C A;  4R79 A;  4CCO A;  1Z3X A;  3W6V A;  4I2O A;  2LY2 A;  2JPB A;  4PJM A;  1LNW A;  5KK1 A;  3CDL A;  3E97 A;  3O3K A;  3LAP A;  1FYK A;  1XMA A;  4BBR J;  3WGG A;  1VQ7 I;  4IL6 C;  3RPU D;  5IPA A;  2VB6 A;  3I56 I;  1R5G A;  2ID3 A;  1N78 A;  2ZSI B;  3T1B A;  3CDH A;  1WHU A;  1IN4 A;  3GX4 X;  2EZI A;  4IQJ A;  2Q1Z B;  2F4O B;  4M73 A;  3HL2 A;  2OZU A;  5M5Y J;  2VJ5 A;  4XLP F;  4UVC A;  2JA6 J;  4LOC A;  1MD0 A;  2BYV E;  3RPQ A;  3LNQ A;  1BA5 A;  4BGD A;  1SMY F;  2CWE A;  1DU6 A;  1AA7 A;  2Y69 H;  3M1C A;  1XMX A;  3S32 A;  2A6H F;  4L9J A;  4DYR A;  4XON A;  2NNY A;  4I09 A;  4ANJ A;  3N97 A;  4M9Z A;  4ZJZ A;  3FHN A;  1T38 A;  4YFN F;  3BLY A;  2IS2 A;  1MKM A;  4E4H A;  3C2G A;  2FNP A;  3BQY A;  4PFP A;  2LBF A;  1IDZ A;  5EG0 B;  2H8R A;  4HZF A;  3BG6 A;  2IS4 A;  1JHH A;  4L5I A;  3KPH A;  2XAG A;  1J2X A;  2CYY A;  2WAE A;  3I4P A;  2RNJ A;  2WAQ N;  2XF6 A;  4A93 J;  3DKW A;  3MEX A;  5FKO A;  4BAC A;  2ZFU A;  1X2M A;  4DQ2 A;  4I0A A;  4I0B A;  1V3F A;  2DT6 A;  4GRI A;  3FX3 A;  2FE3 A;  1FOK A;  2GBY A;  3G1O A;  2D1V A;  2Z5U A;  1VQM I;  2DDA A;  3HUG B;  2OD5 A;  1A6Q A;  4IJA A;  5LEJ A;  1SVM A;  2M5W A;  2O9L A;  2MSY A;  2OU2 A;  4B44 A;  4D5C A;  1S8N A;  2E1M B;  2G7U A;  4XRF A;  2RDP A;  4RAF A;  2DT7 B;  3HOV J;  1SMT A;  4RB3 C;  1BOA A;  1QVT A;  4CCM A;  4IHT A;  4LG0 B;  2WY8 Q;  1P2F A;  4HNU A;  4HLY A;  2KPM A;  2DMU A;  2XDV A;  1Z21 A;  4W97 A;  3I55 I;  2KZG A;  4UHT A;  4YG2 F;  5CVI A;  3EUH C;  5BOX A;  1VFC A;  3CDI A;  3ZN0 A;  2L7M P;  2JQ7 A;  4I99 C;  5BQT A;  3BG3 A;  5E8G A;  3WTZ A;  3DBH B;  1E3O C;  2FML A;  3E3V A;  5IYB J;  2PN6 A;  2XF7 A;  5FKM A;  4AVZ A;  4H4K C;  1LEB A;  4YEJ A;  1HSJ A;  3CF5 F;  2E36 A;  2EIN H;  3MKL A;  4NHJ A;  4E70 A;  2X6O A;  4UUV A;  3CES A;  3CJQ B;  1SVO A;  5TRD A;  2CFO A;  4RAG A;  2FJ1 A;  3CCV I;  2O7O A;  2IS6 A;  3OYI A;  2VJI A;  4JBA A;  4L9T A;  1WJC A;  1G6N A;  1O3Q A;  5FRM A;  5LRR A;  3HSR A;  4DBQ A;  1O3S A;  3H3U A;  4V2G A;  2QEN A;  5DTD A;  1X3U A;  2V9V A;  4ZYA A;  3GME A;  1R1V A;  4DBR A;  1T95 A;  5GPC A;  1VQ5 I;  2XGD A;  3ABU A;  2FQ3 A;  2OUM A;  1JGG A;  4BHB A;  1JKR C;  2MC3 A;  4I76 A;  4BJ6 C;  2D1H A;  2DPD A;  1LE8 B;  3DWL E;  2NVU B;  2FQ4 A;  2X0L A; 
#chains in the Genus database with same CATH homology
 1Z0X A;  3S14 J;  4FE4 A;  4JP0 A;  3S1R J;  4A3E J;  5DS9 A;  3S17 J;  2XSD C;  3IV5 A;  5K7Z A;  5M5W J;  3JRI A;  3LSR A;  1FTZ A;  1ZK8 A;  2M2E A;  2CUE A;  4A3C J;  2P81 A;  3JRD A;  2XB0 X;  3FIS A;  4XK4 A;  1X58 A;  1ETK A;  2ECB A;  4M3D A;  4DZJ A;  5F27 A;  2RAE A;  4A3M J;  5M5X J;  4A3I J;  3HM5 A;  5J3L A;  3O8H A;  1HOM A;  5F04 A;  2Y31 A;  3RQI A;  2IAI A;  5FLV A;  2LVS A;  2EZH A;  3H0G J;  1JTX A;  2DA3 A;  1H89 C;  1MBK A;  1OJL A;  2XRL A;  3PO2 J;  4S0H B;  3TED A;  1AKH B;  2AHQ A;  3A02 A;  1ETY A;  1ZR4 A;  2R5Y B;  2DA1 A;  4IHX A;  4XRM A;  3S15 J;  1B72 B;  1IG7 A;  3FIW A;  3ZQC A;  4XID A;  3K7A J;  3HEF A;  2MGQ A;  2JJ7 A;  1IRZ A;  2NVX J;  1TWA J;  2DMN A;  3ZQI A;  5E3O A;  2MW8 A;  3MN2 A;  5F1J A;  3Q3S A;  1MH3 A;  3BR6 A;  1JKP C;  3C2B A;  3FK7 A;  1BJZ A;  2XPV A;  1UG2 A;  1RKT A;  2EZL A;  4EEF G;  3BTJ A;  2JN6 A;  1FIA A;  2DJN A;  2CJJ A;  1NK3 P;  1ENH A;  3DCF A;  1ETV A;  2E19 A;  2DA5 A;  4B4C A;  3RKQ A;  3F0C A;  3HB9 A;  3WHC A;  4QIW N;  2GLO A;  3IH2 A;  4Y52 J;  3HOX J;  1U9O A;  2XPW A;  1ETX A;  2JA5 J;  4L5E A;  3HOY J;  2VI6 A;  5FKN A;  1MNM C;  5EDN A;  1IUF A;  3I4M J;  1WH7 A;  1ZR2 A;  1H8A C;  1F43 A;  1Y1V J;  3L1P A;  1RES A;  3NAU A;  1WCM J;  4D5F A;  3GTM J;  3S16 J;  3GTG J;  2E1O A;  1ZKG A;  4JX6 A;  2OF7 A;  3G1L A;  3ZQH A;  3JRG A;  1PUF A;  4I6Z A;  3O8G A;  5HOD A;  1MBJ A;  4FCY A;  1I3Q J;  4JX5 A;  3TW6 A;  2K9Q A;  4M3B A;  4QSH A;  4A3L J;  2XB5 A;  3MVP A;  1MBF A;  2M34 A;  4BY7 J;  3BR5 A;  2ECC A;  2FX0 A;  5J1Y A;  1WPK A;  2R92 J;  3NAR A;  5E3N A;  2N8G A;  2EH3 A;  4X1E A;  2VPR A;  2DN0 A;  2CUF A;  1BW6 A;  4A3G J;  3Q0V A;  4M6V A;  2VUM J;  3VPR A;  4M3F A;  1GUU A;  2R5Y A;  1W0U A;  2FD5 A;  2I10 A;  2LR8 A;  4D7M A;  3M3Y J;  1TWG J;  3JRB A;  1XG1 A;  2YS9 A;  5IYD J;  1G2H A;  1ITY A;  1A5J A;  3JRF A;  4FTH A;  3JRH A;  3SJM A;  5C3E J;  1ETO A;  1K61 A;  1AU7 A;  1JUP A;  1JJ6 C;  1BL0 A;  4XRS G;  2JMW A;  3S1N J;  3FK6 A;  4IEJ A;  2E2I J;  2EZK A;  3ZQG A;  2L7F P;  2XGC A;  5K7H A;  5IP7 J;  4C3H J;  1B8I B;  3OSG A;  2R0Q C;  5EGO B;  5C44 J;  4D7N A;  2VKV A;  4JYK A;  2Y9Y A;  1MBG A;  3BR3 A;  2HOT A;  2DA6 A;  2ME6 A;  2PMZ N;  2HOA A;  1GV2 A;  1LE8 A;  2NOG A;  2LTP A;  5EG0 A;  4BXX J;  5IP6 A;  1T56 A;  1R9T J;  1JTY A;  1QVU A;  4W1U A;  4B1R A;  4A3J J;  1VI0 A;  1A6I A;  4M3E A;  4Y7N J;  2COB A;  1MSE C;  1OCP A;  5IYC J;  3HOW J;  2HDD A;  4MIM A;  3ZOB A;  2DMT A;  1ORK A;  2LKX A;  2CU7 A;  1ZQ3 P;  1LFU P;  1JUS A;  1OCT C;  1X2N A;  2R7Z J;  4IHW A;  3S2H J;  2K40 A;  1RPW A;  2KDZ A;  2AO9 A;  3BQZ A;  4MLO A;  2W48 A;  3M4O J;  3BT9 A;  3TW7 A;  2JWT A;  1B8I A;  2JA7 J;  5EEA A;  2NVY J;  4UUT A;  3LOC A;  5IOY A;  3Q0W A;  4MFD A;  1W0T A;  1ETQ A;  1FEX A;  3B6C A;  2Y9Z A;  3A03 A;  2ELK A;  2ID6 A;  3TP3 A;  1D5Y A;  1GVD A;  1IDY A;  3LSP A;  1EF4 A;  1HLV A;  3QQA A;  4AYB N;  1U8B A;  1MBH A;  1WI3 A;  5EZG A;  5C4X J;  2M9H A;  5EYR A;  3BTL A;  4NDL A;  2XPU A;  2ME0 A;  3S2D J;  3OOU A;  4DYC A;  3BR0 A;  1WH5 A;  1IJW C;  5F0H A;  1MBE A;  4C3J J;  3GTJ J;  3ZQF A;  2B63 J;  5J1R A;  1AHD P;  2ZB9 A;  5F0F A;  2X48 A;  1F36 A;  1HDD C;  3JRC A;  5IOZ A;  1TWH J;  3IH3 A;  2DA7 A;  1OFC X;  3B6A A;  3ZQL A;  2LP0 A;  4FE7 A;  2YU9 J;  1RKW A;  1H88 C;  2EBI A;  3RZD J;  2O8K A;  2M8G X;  3BTI A;  5M3M J;  4B3A A;  4GFB A;  3E7L A;  1HF0 A;  2DTZ A;  1JT6 A;  3CMY A;  1JJ8 C;  1FIP A;  2L9R A;  2HYJ A;  3FKI J;  2HQ5 A;  3OSF A;  1VF9 A;  3BR2 A;  1U78 A;  1FTT A;  3HBL A;  1QPI A;  1RET A;  2LY9 A;  4CYC A;  1QRY A;  2E2H J;  4XIC A;  2HXO A;  3GTL J;  2HOS A;  3JRE A;  2H1K A;  1DU0 A;  1O4X A;  2X9D A;  1CQT A;  2HI3 A;  2IBD A;  1FJL A;  3OIO A;  5F0C A;  1SFO J;  2LK2 A;  2LD5 A;  2GM4 A;  3GTO J;  1VND A;  4DYQ A;  2XGE A;  2NS7 A;  2MG4 A;  4CYC B;  2EQR A;  1TC3 C;  2TCT A;  4XRS A;  3Q0U A;  5C4J J;  2LLK A;  2R5Z B;  2DMQ A;  3PO3 J;  4C2M J;  4AUX A;  5FJ8 J;  1I6H J;  1P7I A;  5K7F A;  1GDT A;  1Q1V A;  1NTC A;  1IGN A;  3BG5 A;  3H3V K;  5EF6 A;  2Y30 A;  1HDP A;  1XC5 A;  3GTQ J;  3G1M A;  4A3B J;  2CQX A;  2L0K A;  4RBO A;  4MO7 A;  1NK2 P;  3SFI A;  2TRT A;  1S7E A;  1IC8 A;  1I50 J;  3QPS A;  3HOU J;  4X6A J;  3W6V A;  1XS9 A;  3K2A A;  1K83 J;  1Z77 A;  4A69 C;  4IHV A;  3CDL A;  2R5Z A;  4BBR J;  1UHS A;  5IPA A;  2R93 J;  4A3K J;  2IEK A;  2ID3 A;  4V2F A;  1POG A;  2EZI A;  1B72 A;  5GP9 A;  2L7Z A;  1Y1W J;  1ETW A;  1T33 A;  2NVQ J;  5M5Y J;  2JA6 J;  3GBG A;  4LOC A;  3LNQ A;  1ZTR A;  4A3D J;  1BA5 A;  1DU6 A;  3TP0 A;  2KT0 A;  1WGX A;  3DEW A;  4FIS A;  4DYR A;  1HCR A;  5E3L A;  1PUF B;  1P7J A;  3LSG A;  2DMP A;  1RR7 A;  3BQY A;  2VKE A;  3JRA A;  2YUS A;  3SDG A;  1IDZ A;  5EG0 B;  2H8R A;  1MSF C;  3LSJ A;  2D5V A;  5FKL A;  1YRN B;  2WB1 N;  5IP9 J;  4BKX A;  1JUM A;  2NVT J;  2WAQ N;  4A93 J;  5FKO A;  5BNG A;  2Y0S N;  5EZH A;  3A01 A;  1BW5 A;  1X2M A;  3CCY A;  1LFB A;  2G0E A;  4UUS A;  2GBY A;  3G1O A;  2HXI A;  2NS8 A;  5GPA A;  2QF7 A;  2O9L A;  2MSY A;  4D5C A;  3JR9 A;  5JLX A;  5FLM J;  3UKG A;  5F08 A;  3QPL A;  3HOV J;  3HDD A;  4UUS B;  3HOZ J;  1QVT A;  4QTR A;  4C3I J;  3S1Q J;  3D1N I;  4ABZ A;  1IV6 A;  2DMU A;  4W97 A;  5M3F J;  1AKH A;  1VFC A;  4RDU A;  5EGO A;  1UMQ A;  2L7M P;  3BG3 A;  3BTC A;  3I4N J;  4DZP A;  4J19 A;  3PM1 A;  4HNV A;  1E3O C;  3GTP J;  2M0C A;  5IYB J;  4M3G A;  5FKM A;  3HGY A;  1YRN A;  1JKO C;  4A3F J;  3CQZ J;  3MKL A;  3BR1 A;  4MFE A;  3RZO J;  1GT0 C;  2X6O A;  1MH4 A;  2K9N A;  2Y2Z A;  3BG9 A;  1APL C;  2FJ1 A;  2E2J J;  2O7O A;  2QCO A;  5E3M A;  1TWC J;  5JLW A;  5FKK A;  4G12 A;  4BY1 J;  4BBS J;  3GTK J;  3WHB A;  4V2G A;  5J1U A;  1ZGW A;  4IHY A;  1SAN A;  5DTD A;  4AC0 A;  2JA8 J;  2DA4 A;  4DW6 A;  2CQQ A;  9ANT A;  3HKZ N;  5GPC A;  3S1M J;  1TWF J;  4JX4 A;  1U9N A;  2XGD A;  3IH4 A;  1JT0 A;  2WV1 A;  2DA2 A;  2K9S A;  1JGG A;  1JKR C;  2JK3 A;  4I76 A;  3HGG A;  1GV5 A;  3A01 B;  1LE8 B;  2OPT A;  2FQ4 A;  2CRG A;  1JKQ C;  2LFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...