2R5ZB

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zB00
2K9NA 1WGXA 2ID6A 4X6AJ 1RKWA 2VPRA 1MBHA 2CQQA 4B1RA 3RQIA 3LNQA 4QSHA 4D5CA 2PMZN 3WHCA 2LD5A 2XSDC 3A01B 5EGOA 1RESA 2HOTA 3HB9A 2D5VA 2FD5A 2Y30A 3BR2A 4A3GJ 4BXXJ 2CQXA 3Q0UA 2ECCA 4C3IJ 3SJMA 2K9QA 1TC3C 2G0EA 4S0HB 3S15J 2CU7A 1D5YA 3UKGA 1OCTC 2XGDA 2OPTA 2HQ5A 1FIAA 1APLC 4D5FA 4BBSJ 1X2NA 4W1UA 2HXOA 3OOUA 1JKRC 1WH7A 1SFOJ 5IYBJ 1Z77A 4QIWN 5EG0A 3BR6A 1H88C 2TRTA 4QTRA 2NVQJ 1ETQA 4DZPA 2R0QC 1TWFJ 1CQTA 1UMQA 3WHBA 5IPAA 1JJ8C 2W48A 1VF9A 3GTJJ 3BTIA 3FKIJ 1NK2P 1FTZA 1XG1A 3ZQLA 1GV5A 1O4XA 1POGA 5IOZA 2Y9ZA 4ABZA 5FKOA 1IRZA 3JRBA 1QRYA 3BG3A 2CUEA 2IBDA 2R5ZA 1WI3A 2K40A 3TP0A 3HOWJ 2NVTJ 5E3LA 2JWTA 1I50J 4MIMA 3GTGJ 2EZHA 2B63J 3CMYA 4G12A 2LK2A 2WB1N 3HOYJ 4JX4A 5FKLA 3LSRA 1AHDP 1ETOA 2FQ4A 2XPVA 1XC5A 1TWAJ 1IC8A 4A93J 1HDPA 2NVXJ 2NOGA 3HGYA 2RAEA 3M3YJ 4MO7A 5FKMA 3TP3A 3VPRA 2OF7A 2O7OA 1FTTA 1B72B 2L0KA 3A02A 3LSGA 4M3DA 2ME0A 1H89C 1FJLA 4RBOA 3ZQHA 3G1MA 1JKPC 1MBKA 3IH3A 2WV1A 3I4MJ 1QVUA 2DMUA 4XK4A 2CUFA 4IHYA 2L7MP 4L5EA 1YRNB 3BG5A 1MH4A 3JRIA 2YS9A 1H8AC 2JJ7A 3CCYA 1YRNA 4UUTA 1U9NA 2XB0X 3W6VA 3S16J 4DYCA 2EZIA 2YUSA 1Y1WJ 1PUFA 5M3FJ 2ELKA 3IH4A 5IP7J 3QQAA 3MN2A 5IOYA 5K7ZA 4UUSA 2JA8J 1RPWA 1P7IA 1HCRA 1GUUA 2AHQA 5M3MJ 4AUXA 2XGCA 4C2MJ 3TW6A 1NK3P 1T33A 3MVPA 5FKNA 3HEFA 5FLMJ 3F0CA 5JLXA 2R7ZJ 1GT0C 3I4NJ 9ANTA 2IAIA 3Q0WA 1E3OC 3K2AA 1G2HA 2DA5A 4AC0A 2K9SA 3DEWA 2E19A 2NS7A 4A3KJ 3GTPJ 3IH2A 5J1RA 2Y31A 1AU7A 1A6IA 2R5ZB 4MLOA 2M34A 2M2EA 3JR9A 3S2HJ 5M5YJ 1JKQC 4M6VA 1ETXA 5FLVA 2TCTA 1B72A 1IV6A 2H8RA 3RZDJ 2DMPA 1WCMJ 2R93J 5JLWA 1JTXA 2E2JJ 2JK3A 3OSFA 5J1YA 2Y9YA 1HDDC 2X6OA 1OCPA 3QPSA 4XRMA 2M9HA 3LSPA 4MFDA 3HKZN 3HOUJ 4GFBA 1RETA 1JT6A 5EGOB 2ZB9A 4B4CA 2LR8A 3GTOJ 1ZK8A 1JUSA 3S14J 2QCOA 2FJ1A 4JX6A 2DA6A 5C3EJ 3BQZA 4A3FJ 1IGNA 2E2IJ 2DA4A 2P81A 5C44J 2JMWA 1UG2A 1Y1VJ 2QF7A 3HM5A 3S1RJ 3JRFA 2M0CA 2DA2A 2GBYA 2NS8A 3ZQFA 1GV2A 3NAUA 3S2DJ 2JN6A 5F27A 3Q3SA 5FJ8J 1WPKA 3S1MJ 2HI3A 2AO9A 3GBGA 4DYRA 2DTZA 5IP9J 2LLKA 2DN0A 4A3CJ 4A69C 3RZOJ 5EZGA 3A03A 5EYRA 3BQYA 3C2BA 3ZQIA 1QPIA 4W97A 2VKEA 4X1EA 2HOAA 3JRGA 2Y2ZA 4UUSB 1MNMC 1OJLA 2I10A 5DTDA 2VUMJ 5GPCA 1F36A 3BT9A 2LKXA 4Y7NJ 2O9LA 1MBEA 5IYCJ 2E2HJ 3BR5A 4A3MJ 1BW6A 1RR7A 2MW8A 4I76A 3LOCA 3JRCA 4MFEA 2H1KA 3GTLJ 3LSJA 4EEFG 1VFCA 2DA1A 2MSYA 2KT0A 1F43A 1MH3A 4CYCB 5GPAA 1LE8B 2ME6A 3S1NJ 1ETKA 4JYKA 1HOMA 3HBLA 5EF6A 3HOXJ 1S7EA 5J3LA 5E3OA 3Q0VA 1FEXA 1U9OA 2HYJA 2CRGA 4V2FA 2L9RA 1MBGA 2IEKA 3B6AA 2VKVA 3FK7A 2M8GX 3O8HA 5M5XJ 1W0TA 1BJZA 1Z0XA 3IV5A 1ORKA 5F0CA 5DS9A 2HOSA 4BY7J 2XGEA 3G1LA 4XICA 4D7NA 1GDTA 1AKHA 1B8IB 3GTQJ 3G1OA 3HGGA 1W0UA 1AKHB 1ETWA 1LFUP 5GP9A 1IG7A 2EH3A 5F0FA 1HF0A 4IHVA 1ETVA 1MBFA 2MGQA 3JRDA 2Y0SN 4IHWA 2DMTA 2E1OA 3BTCA 5F0HA 4IHXA 2WAQN 1DU0A 1TWCJ 4IEJA 5EG0B 2MG4A 3BTJA 1X58A 3ZOBA 1ETYA 1QVTA 2DMNA 3RKQA 3D1NI 1FIPA 3FISA 1PUFB 1OFCX 5F08A 1IUFA 4AYBN 1JKOC 4M3FA 2EQRA 1IDYA 4J19A 3M4OJ 1RKTA 1TWHJ 3JRAA 1I3QJ 3TEDA 3PO2J 2DA7A 2EZKA 1ZGWA 2LFBA 4A3EJ 3E7LA 5M5WJ 3QPLA 1MBJA 4D7MA 2EZLA 1WH5A 1HLVA 3SFIA 4M3BA 4JX5A 3HOZJ 4CYCA 4FTHA 4FCYA 1TWGJ 2R92J 3GTMJ 1X2MA 2DJNA 2DMQA 4FISA 2LP0A 1ZR4A 3JREA 4DYQA 1JUMA 3ZQGA 2COBA 2ECBA 5J1UA 5C4JJ 1XS9A 4DZJA 4M3EA 5F1JA 1BW5A 3CQZJ 3GTKJ 1MSFC 5IP6A 4B3AA 5FKKA 1LE8A 3K7AJ 2N8GA 4FE7A 2R5YA 2XPUA 2ID3A 4A3LJ 1JJ6C 3BR0A 3FIWA 4A3DJ 2LTPA 4A3BJ 3PO3J 2FX0A 2LVSA 1ZR2A 4DW6A 4XRSG 2O8KA 4M3GA 3ZQCA 3H3VK 3FK6A 1B8IA 2JA5J 4BBRJ 4BKXA 2XPWA 1BA5A 1JUPA 1JTYA 3MKLA 3A01A 4LOCA 1JGGA 2L7FP 1P7JA 1ZKGA 3B6CA 1GVDA 3JRHA 3NARA 1ZQ3P 4Y52J 2LY9A 3S17J 2JA6J 3OIOA 3OSGA 5E3MA 1Q1VA 4NDLA 2X48A 2HDDA 4C3HJ 3O8GA 5EEAA 1JT0A 3HDDA 5HODA 2EBIA 2L7ZA 5K7HA 1BL0A 3TW7A 1ITYA 1SANA 1MSEC 4JP0A 4HNVA 4A3JJ 2XRLA 2YU9J 1R9TJ 1VI0A 3BR1A 4I6ZA 3L1PA 1EF4A 1ZTRA 2DA3A 3DCFA 4FE4A 1NTCA 5K7FA 3HOVJ 1A5JA 2GM4A 4A3IJ 3H0GJ 1U8BA 3S1QJ 2HXIA 1UHSA 4V2GA 5BNGA 3SDGA 3BG9A 2CJJA 5EZHA 1IJWC 4RDUA 1ENHA 1K61A 3BTLA 2X9DA 3CDLA 3PM1A 2VI6A 5IYDJ 2NVYJ 1K83J 1DU6A 1T56A 4XIDA 1VNDA 2JA7J 5C4XJ 1LFBA 4BY1J 2XB5A 4C3JJ 5EDNA 2R5YB 1U78A 2GLOA 5F04A 3BR3A 2KDZA 5E3NA 1IDZA 4XRSA 1I6HJ
chains in the Genus database with same CATH superfamily
2K9NA 4BXUA 4MEXF 4KICA 4IHTA 3EYYA 2H6BA 1RKWA 4X6AJ 2ZFWA 1MBHA 2CQQA 2CYYA 3U2RA 2K02A 1YX3A 3JAMZ 4II2A 4G7OF 3C7JA 1REPC 2HNHA 2PMZN 1DP3A 1V5EA 4L5JA 2CUZA 1ZARA 3BJ6A 2WA0A 3A01B 4B44A 1IXSB 1G4DA 2HOTA 3WU2C 3BCBA 3HB9A 2D5VA 1ZHFA 2Y30A 1J7KA 2DBBA 4EMSA 3Q0UA 4L18B 2OCCH 3GX4X 2Q2EA 2GIZA 5ICGA 3FX3A 1WHUA 5LHIA 1FIAA 3DU5A 4BEHA 1X2NA 5DCMB 3L00A 3KE2A 1JKRC 1WH7A 5IYBJ 5EG0A 4QIWN 1XSDA 1YFHA 1ZG5A 1H88C 5L3EA 4O3MA 2BXYA 1FBUA 1MJ9A 3HRUA 1FYMA 4Y33A 3WU1B 1TWFJ 2IS6A 3WHBA 3HRMA 1MJBA 2GOMA 4NQWB 4HRIA 2E5NA 4UY8I 2E1MC 1G3TA 2CFXA 1JJ8C 1KU7A 4LGWA 1NK2P 1XG1A 4RGSA 3TO7A 4CCLA 2DLLA 1MIJA 3CDHA 2DPDA 3T5XA 2HVQA 4ABZA 2CW0F 2ETHA 5FKOA 2R3SA 2HTJA 3BG3A 3H9JA 1BR1A 2K40A 2KKOA 3FMRA 1D3YA 2NVTJ 2LBFA 3HOWJ 2IGMA 4CCKA 4BXFA 1P4AA 1T95A 4MIMA 5J8CA 1T98A 1Z6TA 2EZHA 3K1MA 1LVAA 3A0BC 2UXNA 2DCEA 3DF8A 4HPQA 2K3FA 2P5LC 2VBZA 1SFXA 2X6WA 3KZYA 4CXFA 1ETOA 1ONVA 2ZNYA 1XC5A 1V5FA 1GLNA 2BYVE 1LKXA 2H94A 3M3YJ 1LUJB 3QWLA 2Z3YA 2FMYA 4CSWA 3OYMA 2QSFX 1MGTA 2OF7A 5BPDA 1XDUA 3GEZA 4HSRA 5LEJA 2L0KA 1VQ5I 3A02A 2GOXB 1GXQA 2ME0A 3GMEA 4PJNA 2JSPA 2TDXA 4ZDLA 2K4JA 3OYFA 1JKPC 1M1EB 4G7HF 3I4MJ 5GAEJ 2GAUA 2VC0A 1X4OA 2CUFA 2XUBA 4IHYA 2L7MP 2LKPA 4YIFA 3BG5A 4HQMA 3JRIA 1YQAA 1X1PA 4ENKA 1U5TB 2ZMEC 3CO7C 1EH7A 1IF1A 1QU3A 3T8TA 4BJ6C 4UB6C 3PSIA 5CVJA 5HLTA 1WJAA 4XOPA 3IH4A 3PUBA 4N9IA 3MN2A 1SMYF 5IOYA 3DPLC 4UUSA 1PP8F 1P7IA 4DGWB 2AHQA 3DV8A 4IL6C 1JI8A 3SEQA 4QWQA 1F5TA 1UCRA 2ZSIB 1W5SA 2JVHA 5FKNA 2UWMA 4H4KC 2VPLA 5L3CA 2BVLA 3Q0WA 2CH0A 3FM5A 2GQQA 1R5ID 2DA5A 4AC0A 2K9SA 1DPRA 1D0ZA 2A05A 3CJNA 3BZ6A 4G6DA 3GTPJ 3CLOA 2OBPA 2Y31A 1VQLI 1AU7A 1YJ9I 1IAWA 2LC2A 3KP6A 1J59A 1K78B 5FLXK 1JKQC 2VIXA 1HA8A 3CCLI 3GZNB 3HYIA 5F64A 3WTZA 1WKMA 1ETXA 3M7GA 2V1DA 5FLVA 3C18A 2TCTA 2M1BA 3ISPA 1B72A 3BY6A 1W1WE 4OINF 1IV6A 4P55A 3ML6A 2H8RA 3RZDJ 2VN2A 5BQTA 2KL4A 1WCMJ 3H9QA 4A0ZA 1ZG1A 2DYRH 1HDDC 2Y9YA 3VOEA 2X6OA 3NWSA 3TBIA 4XRMA 2EV5A 4UXNA 3CCSI 2M9HA 2C6YA 3Q9VA 3LSPA 4ZDPA 3HOUJ 1WJ5A 4GFBA 1RETA 4IXAA 3W2VA 2OCEA 3K10A 1TW2A 2KQRA 1STZA 2LR8A 3GTOJ 3S14J 3HKZA 2DA6A 5CLSA 3ZRGA 3BQZA 5C3EJ 1VQMI 1IGNA 1IUYA 2KIUA 2ICWG 1W7PD 3MD2A 2LSOA 3SXYA 3E0JB 1I39A 1A31A 2K9LA 4OIPF 3FDYA 3TMOA 5LGNA 1GV2A 5DCMA 4BNCA 1G8XA 2EILH 5TISC 5FJ8J 2QA4I 1E3HA 2HI3A 2AO9A 4XLFA 1W36D 5IP9J 3VSKA 2DN0A 4A69C 1JHHA 2FEZA 3BPXA 3C1DA 1RRJA 5EZGA 2DXIA 3HSFA 1Z7LA 4YELA 3L2CA 1P4XA 2QSHX 3FXQA 4X1EA 1YS7A 3WTXC 4RGRA 1I5ZA 2HOAA 1U2WA 1YIJI 4U7DA 3IKTA 3FF5A 5GPCA 2Y0MA 2O9LA 1MBEA 4XL9A 4EM1A 1F9NA 3P9KA 2E2HJ 2MLKA 1FMWA 4A0YA 1XGSA 1OR7A 3QODA 1B1BA 4OWRB 2DA1A 4OU0A 2MSYA 5JR3A 1RUNA 2KT0A 4RA2A 2WADA 1MH3A 3CF2A 3TOBA 3LL7A 3LFKA 3ZP5A 2ME6A 4QLCU 3CDIA 2B9SA 3RTRA 4NUBA 4JYKA 4HDUA 4CCNA 5J3LA 1XMKA 3I59A 1LDKB 2O5RA 2CRGA 2EIKH 2W85A 1XGMA 1FMVA 2M8GX 1SAUA 4X0GA 3M8FA 3VDXA 4M6YA 1HSTA 2NNNA 5FLXZ 2QQAA 2DK8A 4RB1A 1B8IB 4K2EA 1W0UA 2LG4A 2QQ8A 2V1NA 3V8KA 1UHMA 2IA1A 4GCVA 3U9GA 2KISA 1HF0A 5F0FA 3M07A 2YSRA 1R1VA 2A61A 3MAJA 5KAFC 2Y0SN 4IHWA 2P7CB 2DMTA 3CUQB 2E1OA 4Q48A 2K7LA 2PJRB 2VJ4A 3FM3A 2WAQN 1FC3A 3KETA 1O57A 5D5VB 2HGCA 3FHZA 1Q1HA 2EFPA 1E3PA 3BZCA 3ABTA 4V19K 1JGSA 3ASNH 3FISA 1PUFB 1D1BA 1ZREA 3CF5F 1Z9CA 3RI4A 1JKOC 1C0WA 2O6GE 4KFCA 2FA5A 5LD2C 3IC7A 1B4AA 1RKTA 1TWHJ 3IWZA 3JSPA 3MKWB 1UAAA 3TEDA 3J80K 2DA7A 2LFBA 1FPQA 5M5WJ 2FNAA 2QUFA 2MYSA 4HV6A 2K4BA 1MBJA 2EZLA 3GW2A 1WH5A 3G6EI 1FBSA 3O3KA 2QEXI 3CLQA 4FTHA 3CESA 1V5GA 2EIMH 3E3VA 1YOVB 3HHHA 3PQKA 5FFZA 1TWGJ 2ESNA 2V1XA 1OR7C 3G4SI 3GTMJ 2DOFA 4JBAA 1X2MA 3AL0B 2E71A 2CMPA 4G9YA 3ONQA 3AG4H 4S05A 2F5EA 3NQOA 1Z6RA 4C30A 5C4JJ 4DZJA 2CUJA 1R71A 3GTKJ 2PJPA 1QZEA 2M45A 4HV5A 5KHDA 4FE7A 1YTYA 1R00A 4ZH4F 2R5YA 2AQFA 4ZZDA 4A3LJ 1FX7A 1JJ6C 2CV2A 2FOKA 3AG2H 4II3A 2DDAA 4CCJA 1OCCH 2NOJB 2H8WA 4A3BJ 3N97A 1L0OC 3K0LA 1P6RA 2LVSA 2M30A 1ZR2A 3QAHA 4DW6A 5IT9Z 3ZMDA 2NS0A 1A04A 4M3GA 2IGOA 5HLIA 2MD0A 3U1DA 1X1AA 4U0WA 2WBMA 4RGXA 1JUPA 2IW5A 4XNFA 4LOCA 4BUPA 1P7JA 2XAUA 2BY2A 3CCUI 5E8IA 1EV7A 1T39A 2F5CA 1ZQ3P 2HFHA 3FXKA 2L3DA 3S17J 3OOPA 1BBYA 3E6DA 3I55I 3OSGA 2OU2A 2Q2EB 3VEPA 4F55A 4ZYGA 3I3LA 4IQJA 2ZMEA 4U0YA 2X48A 2HDDA 1XMAA 1FOYA 1N25A 3DKYA 3GLLA 1XD7A 1JT0A 1TT5B 2PI0A 2W57A 2JRTA 2IGKA 2RDPA 2L7ZA 2XAHA 3TL4X 5K7HA 3KLOA 1O7LA 1SANA 1U0JA 2VQCA 4IQ4A 3LSTA 2NRAC 1XGOA 1UFMA 3L1PA 2DA3A 1FLIA 4LG0B 3A1YA 2GM4A 4M9SA 4A3IJ 1PDNC 1O3SA 2L5QA 4AIDA 4AIKA 2DAOA 1ZYRF 4O6JA 3BG9A 3FHNA 1E0EA 4RDUA 2VC1A 5CQEA 1ENHA 2FSWA 1K61A 2ZFUA 3BTLA 2X9DA 3CDLA 2K27A 2LH9A 2NVYJ 2CW8A 1K83J 3I0TA 1T56A 3KYCB 4XIDA 1FYLA 1GXPA 1VNDA 2LY1A 3TGNA 4ITVA 1K6YA 3RSNA 4BY1J 1I3AA 2OD5A 2V26A 4IOCF 5EDNA 3B02A 4ZYAA 4LB6B 3K70D 3H35A 4PZJA 1Y0NA 3BR3A 5HNHA 1BIAA 2KDZA 2A69F 3FMQA 2FUG2 5H2FC 2MLGA 4I2OA 4ZDOA 3VB2A 1WGXA 3V8LA 2ID6A 2L2OA 2XKPA 4GGGA 4P96A 1LVKA 3RQIA 1S5LC 3CP8A 4BL0B 3OYNA 3PSFA 4QSHA 4YFKF 4LLLA 2L01A 1YLFA 4E7SA 3DPTA 1J0RA 1OPCA 2LD5A 3J7ZI 4KIBA 2R7WA 2W24A 4PDKA 5ILUA 5EGOA 1J2XA 3JSOA 2RC4A 2L4MA 1TBXA 4RLQA 2PQ8A 3IHUA 1N78A 4BXXJ 2IPQX 2ECCA 3OR1C 3WU0A 3ERED 2BOLA 2K9QA 5LHHA 2G0EA 2M4GA 2W84A 4PCQA 4FX0A 3UKGA 3OYLA 1OCTC 4UVCA 1LEBA 4E6KG 1FT9A 2HQ5A 1QZYA 2HU9A 1VQ9I 4ESBA 2QM3A 4BQQA 4BBSJ 4W1UA 1YX5A 3HPGA 3HJEA 1SFOJ 4UVAA 1Z77A 4BQOA 3BR6A 2KZGA 1Z91A 2M3AA 2OV7A 4BYYA 2EJRA 1A36A 2YU3A 2NVQJ 4CICA 3OYCA 5HDGA 3HUGB 2NYXA 1UMQA 3SZTA 3F72A 3IRRA 4M72A 4EQQA 2IT0A 3V7CA 3GTJJ 3RKXA 1P92A 3OIQA 2OQRA 1D8JA 4GRIA 4LG0A 3QYEA 3G3ZA 1O4XA 2Y9ZA 5IOZA 4HBLA 1MMSA 1IRZA 4BGDA 2FNPA 4KT6A 4CYDA 4BQAA 5L3DA 4CDGA 2KIQA 4AD9A 3K6GA 1BI3A 5CVUA 3TP0A 2MA3A 3AG3H 2DO7A 1DQUA 1P9QC 1T08B 4G12A 2LF8A 4E4HA 4M6XA 2WB1N 3HOYJ 3HPHA 3QU3A 3RYPA 3DU6A 5FKLA 2BY0A 2F5VA 2X6YA 3LSRA 1TNSA 2XPVA 3HC7A 1YYVA 2BV6A 3UR3C 3ZMZA 2XC7A 1TWAJ 2LNBA 4WWCA 1IC8A 4AVZA 2NVXJ 1G3YA 2CQ7A 2V4JC 4E7IA 3R60A 1X3WB 1HXDA 3VSLA 5FKMA 3TP3A 2PLYA 3I9V2 3LSGA 1E2XA 3E5QA 2CWEA 4M3DA 1H89C 3GLXA 3ZQHA 1S6LA 1MBKA 2XAQA 3KPHA 1RI7A 1HSJA 4DIQA 4P1WA 1SD4A 1QVUA 3C3WA 1O3QA 4XK4A 2R7UA 1FOKA 3HTSB 5D5XB 2HR3A 3ULQB 1YRNB 2ZXWH 1F4KA 1MH4A 1VQ6I 4XRFA 2YS9A 3C2GA 4ENNA 2JJ7A 4HYEA 4N4NB 2XB0X 3W6VA 2GA1A 1FWZA 5HNFA 4WCGA 1TQIA 2Q0OA 2EA2A 2GXAA 3PJRA 1QBJA 2LYCA 2GXBA 2VONA 1W7PB 1KONA 2W4SA 2ELKA 1OYIA 1S7AA 2XAGA 5M3FJ 1BOBA 3RYRA 3QQAA 3HUGA 4Y15A 4F91B 1GUUA 3W2AA 1MD0A 3OYAA 4C2MJ 4PGGA 1NK3P 1T33A 3WGGA 2FRHA 4XLCA 1Y0UA 1PYVA 5JLXA 3V4GA 3N4MA 3I4NJ 1X4PA 3O6BB 1B59A 1G2HA 3D5RC 3SYTA 1OMIA 3DEWA 3ABLH 4AVPA 2E19A 3GF2A 4A3KJ 3IH2A 2OJED 4HEA2 1A6IA 1ZRDA 2R5ZB 3KLNA 2ZJRF 1Z05A 2DT6A 3FBIB 2M2EA 4UHTA 2UV1A 3GVAA 1LJ9A 3P9IA 4PFPA 1KYWA 3F22A 1FP1D 5CVVA 3GWZA 4M6VA 3E5UA 1DGWY 4XLEA 2EV6A 4KA4A 4HLXA 1T2KA 4B3XA 4ZJZA 3CJTB 4M71A 4R8HA 4BHPA 3CC2I 2L7KA 4WF2A 3KEOA 1IXRC 2R93J 3G2BA 1MNDA 4CHUA 4F92B 2Q8KA 3H3ZA 5DCFA 1NG6A 1TP4A 5J1YA 3OYKA 3QPSA 2VL8A 3AG1H 3CZ6A 5B1BH 2JT1A 2XF6A 3F9KA 2UUZA 2CW7A 4HX4A 2BVMA 1JT6A 2XASA 2ZB9A 5EJCA 5J8FA 5EGOB 1T38A 4WX9A 4CZZA 2R7ZJ 4KJZA 3V7RA 1JUSA 1S29A 2FJ1A 2FOWA 3E6MA 4A3FJ 2HPMA 5HDKA 5BS6A 2E2IJ 3QPTA 2P81A 4LIUA 1U3EM 1W5TA 1PUEE 5ILVA 1UG2A 2DODA 2O03A 1Y1VJ 1YW7A 2F5FA 4CA0A 2MH9A 5KVRA 2OC6A 3TKYA 3OYBA 4FX4A 3ZQFA 3B73A 3S2DJ 1SFKA 2J5OA 3BG7A 2M5WA 1LEAA 3Q3SA 4XKVA 4AWXB 2M87A 2A6HF 2W25A 1FSHA 5EYRA 3DLAA 3L2QA 3QPHA 4EGYA 2ZXIA 4KN4X 3ZQIA 2ZBKA 1TLHB 3R61A 2P6SA 4W97A 2IS1A 5ICEA 5JVTA 5A2QZ 5JHUA 1TL8A 2F4MB 2I10A 5DTDA 4HF2A 4XMYA 2EA4A 4BE1A 4RB2C 4A3MJ 3IL2A 3PIOF 3DTIA 1V54H 4IJAA 1W4MA 3LOCA 3JRCA 1K78A 3ESWB 4ASNA 3GCMA 2Z33A 3EYIA 3GTLJ 3LSJA 4EEFG 2W00A 3H92A 1D0XA 4KYWA 1F43A 4TV7A 1WI9A 1UZCA 3HSEA 1IO2A 1OLTA 1H0MA 1LE8B 1BIBA 1BM9A 3QOPA 3L2RA 5CYVA 4N0BA 5K5OA 3S3MA 4JOMA 1YITI 3S1NJ 2E7WA 2QKMB 3CUQC 3HBLA 2O61A 3VYUB 1HOMA 2VQGA 1S7EA 4HW0A 1R36A 2VODA 1BN5A 3DLLF 1ODDA 3OYHA 2CV1A 2A68F 2XV4S 2L9RA 4V2FA 1F1ZA 3H36A 4LIVA 4HA8A 1OYWA 1ACIA 4KNYA 2L9NA 1W0TA 1BJZA 2XAJA 5DS9A 4E7LA 2DTRA 1XCBA 3G1LA 4D7NA 1GDTA 1AKHA 4NC8A 3GTQJ 3G1OA 3HGGA 4D9JA 1EH6A 1G3WA 4UV9A 2D45A 4KISA 2EV0A 2M8EA 1LDDA 1HKQA 2ZJ2A 4F7ZA 3OS1A 3IAS2 1O3TA 3ZN0A 2Z9OA 4M73A 4CH7A 1MBFA 2L54A 1Y39A 2MH2A 1X1CA 2X6XA 2YX4A 1RR8C 2ESHA 4IHXA 3SZPA 3LSHA 1NH3A 5DYMA 4IEJA 2PN6A 1IN7A 1ON2A 3MQ0A 3HSRA 2DMNA 4PJLA 3WE3A 1DP7P 3D1NI 2WAQA 5F08A 1WVRA 3CC4I 2Z16A 4AYBN 1WWXA 1KGSA 4WXHA 3IWFA 1USTA 2O3FA 2XIGA 1LB2A 4ZTFA 4RB0A 3K4JA 5CQGA 3LA7A 5FO5A 2M0MA 5CKTA 2VB6A 5CVRA 2HKOA 1ZGWA 3I54A 2VJ5A 1DUXC 5ICCA 2DQRA 1FP2A 3HL2A 2E1NA 1S9HA 1HKTA 1HLVA 2K86A 1D0YA 4L0ZB 4BE0A 5KAIC 2BW3A 3W6JB 3DTEA 3H1CA 2R7QA 1XDSA 4IF4A 2R7RA 4IX7A 2RQQA 3QP6A 2EB7A 2VE9A 2E7XA 3OYDA 2DMQA 5A2QK 3KYLA 4FISA 2K3PA 1ZR4A 3JREA 3JCUC 3M8EA 4DQ2A 1V3FA 3ZCOA 5K5QA 3SQNA 4EJTA 1SFUA 3CQZJ 5IP6A 4B3AA 1LE8A 2UXXA 2FMLA 2CGPA 4HF0A 4BACA 2XPUA 2ID3A 2KRCA 1S8NA 5DUIA 2CSOA 3BR0A 3MKYB 2O8XA 3TDZC 1J09A 1OCOH 3PO3J 4OOIA 1GVJA 3R6SA 4XRSG 2O8KA 4U0VA 3N05A 5DV5A 2WTEA 3FK6A 2JA5J 4Z6YA 1ZAOA 4L9NA 4BBRJ 4BKXA 1YJWI 2PJRA 3ZPLA 5E1WA 3KEQA 2HDCA 5AIQA 1MMGA 4BJ5C 2B0LA 2BBYA 4IPAA 4OAYA 4BEHB 3B6CA 1DPUA 2Y48A 1BI0A 1Z3XA 2CFOA 4XN0A 4Q5SF 4FQGA 4Y52J 2LY9A 2ZXHA 2ZKZA 3BOQA 4HZFA 4AYBA 3OS2A 2JA6J 2W7NA 4NDLA 3VODA 3WGIA 2CQKA 4KIFA 1Z1DA 4C3HJ 3O8GA 2STWA 1TW3A 2AXLA 2VBXA 5HODA 2EBIA 3CUOA 4ZYEA 3TW7A 4N4OB 4JP0A 4HNVA 2YU9J 2KLOA 1R9TJ 3KZIC 1VI0A 2EFQA 3GFJA 3CJRB 3DCFA 1NTCA 2V6CA 4IOAF 2K85A 2LKSA 3ROUA 5L3FA 1W36C 3H0GJ 1RIOH 3S1QJ 2HXIA 2XF7A 4HQEA 2QYOA 3Q5FA 4DOZA 1SC7A 1UHSA 2KPMA 4V2GA 4I0AA 4ZC3A 4XKBA 2CJJA 3RDIA 5EZHA 1IJWC 1YIOA 2GWRA 1DU6A 3E97A 1EJ9A 5LBQA 3IP4B 4ESJA 4PJ0C 1R49A 1U78A 2VKHA 2RQPA 5F04A 5K5RA 4QPOA 4G7ZF 2F5DA 1I6HJ 3SHFA 2PMZA 3RQ4A 3OYJA 5JI6A 3ABKH 4B1RA 4EGZA 2XKOA 4U88A 3LNQA 2CS3A 1IW7F 3WHCA 1MZBA 1U6GA 4UV8A 1SMTA 3S2WA 1A6QA 3HIFA 3K4BA 3BR2A 4A3GJ 2CQNA 2VQLA 4MGRA 1R5HA 1MKMA 1HW5A 3IRQA 1TC3C 4S0HB 3S15J 5FFXA 2CU7A 1GHCA 1FBQA 1D5YA 4Q4ZF 1J5YA 4A5NA 1R4NB 1Y8RB 2XGDA 4B47A 1APLC 4D5FA 4R1HA 2ELJA 4GXOA 2VT3A 2HXOA 3JAMK 1MDMA 4M9XA 3I5UA 4MNUA 3ZMSA 2RGVA 4ANJA 4F52A 4LK1F 3OWTA 3CCVI 5F6FA 1FYKA 4L5IA 3MZ8A 2KIMA 3FWEA 4Y3OA 3T0YA 1B9MA 3S3OA 2R7SA 2R0QC 4OMZA 4XQFA 1CQTA 1ZELA 3H5RA 4C9YA 5IPAA 2WAEA 2W48A 1VF9A 3P5JA 5AIPA 1WFXA 3A2KA 3BLYA 1FTZA 4HNTA 3WTWC 3H0DA 1GV5A 1T6SA 4RAZA 4EV0A 2PG4A 5K1YA 2F48A 2P5VA 1DDNA 3LSKA 1XPXA 1XSVA 4RMNA 3JRBA 4BQNA 4E7KA 1QRYA 2NAZA 4LLNA 1WI3A 3KP4A 4BU2A 2HQAA 2JWTA 1YJNI 3ZMTA 3GTGJ 3TO9A 2R4GA 5DM6F 4MQVA 4IKFA 5GADJ 3CMYA 3ZR8X 2DQLA 2F2EA 5ILSA 2P8TA 5KCMA 1R7JA 1VQKI 4E7JA 2AXTC 1NG7A 2X1DA 2WB1A 3BDDA 4A93J 2DK5A 3I56I 4DBQA 1Y8QB 5GAHJ 4JK1X 1WJDA 2KP6A 1TT0A 3F8CA 2KHMA 4RS8A 4BH9A 2O7OA 4A6DA 1AWCA 1FTTA 1ULYA 2JUCA 1Z67A 4PSXA 1RNLA 1KU9A 2J5PA 2XROA 4PFOA 2ELHA 4I02A 1OQYA 2WAFA 5HS9A 3G1MA 2I5UA 3M1EA 4ZYHA 3IH3A 2VASA 5ERIA 2L4AA 5EEHA 5J6XA 2BGCA 5LRSA 1TNTA 4L5EA 2Y69H 1FSEA 1W5CC 3OY9A 4BJTA 4ESFA 2JPCA 3DTKA 2WWYA 1TQMA 3BJAA 3V7SA 1H8AC 3SEZA 1YRNA 3V42A 1U9NA 2B7EA 3S16J 3E6CC 3J7AO 1SVOA 2HYFA 3WODF 3WTSC 3ABMH 1YW8A 5FROA 4GDFA 1Y1WJ 1QZZA 1PUFA 2XDVA 3P7NA 1T8IA 4KT5C 2XSJC 1JE8A 3LAJA 1T0FC 2Z1DA 5K7ZA 2D1VA 3RJPA 3WTYC 1QNTA 2BHZA 3FBNB 4BAYA 5M3MJ 1HCRA 4AUXA 1KQ0A 4LJZF 2XGCA 2DW4A 4J01A 3MVPA 2X1CA 2ADUA 3ZMVA 2R7DA 3F0CA 1GT0C 9ANTA 2IAIA 2MFZA 1SD6A 3C2HA 3FXJA 4OIRF 4NNJA 1TZLA 1E3OC 1WZ2A 1FZPB 2CG4A 2HZTA 5TRDA 4LG3A 1HC8A 2HTSA 2NS7A 5J1RA 3HG9A 3BJOA 3KEYA 2H1LA 3LSIA 4Q47A 1HW2A 2V1UA 3DPUA 2OZ6A 2F6CA 4MLOA 5BPIA 4YIRX 4L9JA 2M34A 3R0AA 2QENA 2V7FA 3JR9A 3S2HJ 2BHYA 1XMXA 3HXLA 1IN8A 4CUGA 2WY7Q 3VYRB 5TJJA 2EK5A 3EUHC 2L02A 3AFHA 4EM0B 5DM7F 2DMPA 4L9VA 2NXNB 3F8MA 2MC4A 2E2JJ 2JK3A 2VJJA 3FMSA 1TQPA 2G7HA 3LA2A 3QYBA 2QBYB 2VBYA 1FOWA 3AAFA 5HS7A 3ZQ7A 3LSMA 4BHCA 1LFPA 3RKWA 4B4CA 3CMAI 3X2QH 2VOOA 3EDPA 2KRHA 2VLAA 2AS5F 2DA4A 2GA2A 4PGHA 2IP2A 4HAMA 2R7TA 2JVGA 3HM5A 3LQQA 2X4HA 3JRFA 4HOBA 2HS5A 5D6FA 2DA2A 2GBYA 2NS8A 2OQGA 4XOTA 3H3UA 1W7PA 4WK8F 3OYEA 3NEUA 3ELKA 2DDBA 2XRNA 3IKVA 5DD4A 1MDMB 1UB9A 1MMNA 3S1MJ 3MFKA 4CCOA 4DYRA 2LLKA 4I7HA 3K4LA 1KU3A 2JA2A 2LF7A 2OA4A 4KMUX 2DT5A 2P7VB 3C2BA 5B1AH 5CJ9A 1QA6A 1D1AA 5LHGA 2VKEA 3QP5A 3WE2A 2VQHA 1J75A 3JRGA 5LGTA 4ZYDA 4UUSB 2WC2A 3BT9A 1KYZA 2Z99A 3GXOA 1R58A 2LY2A 4YIIA 2LKXA 3PFIA 3EUAA 3BR5A 3L2VA 1VQ4I 1BW6A 2Z5UA 2ZCWA 2MW8A 4I76A 4PJJA 3FXMA 2E35A 5FB2A 3PQJA 3RKYA 4EJWA 1JXSA 4MFEA 5J4YA 3LA3A 2LBFB 3F23A 1VFCA 4LD5A 3K70C 3J7AY 2G7UA 3DWLE 3I53A 1XN7A 1OCRH 3OR2C 2OTLI 4CYCB 3DBRB 1UELB 5GPAA 4WXCA 4BHBA 4HF1A 2KRFA 4XLNF 2DFHA 3Q0VA 1FEXA 3KP2A 3CCEI 4YFNF 1MBGA 4MTDA 2BY3A 4EJUA 1IN6A 1VQNI 2VKVA 3FK7A 2FBHA 1ERDA 1U8RA 2GZWA 3RPUA 1WJEA 4NHJA 3DFGA 1Z0XA 4YEJA 1ORKA 3KCCA 5JVGF 1EKEA 3KYDB 3OL4A 5GTHC 2D1HA 2JRMA 6PAXA 2XGEA 1MW7A 2QBYA 3FXUA 2A6TA 3BPVA 2KDOA 2W82A 2JTVA 1AKHB 3KP3A 3QYFA 5GAGJ 5B3SH 1QHGA 1IG7A 2EH3A 2Y75A 4IHVA 3J80Z 2MGQA 3MEXA 3JRDA 3EETA 2FBKA 4D1QA 3EPZA 3ASOH 3L7WA 4MTEA 3CO6C 3ERMA 3HRTA 4XM3A 1IZ1A 2GXGA 3KZZA 2DT7B 1DU0A 1TWCJ 2Y0SA 2PMHA 1U5TA 2KJBA 1ZLJA 2YX7A 2EFNA 3T8RA 1VZ0A 4UB8C 3PNVA 2V6EA 1OFCX 4BE2A 4RLFA 3K4KA 2RVCA 3DXJF 4J19A 1J9IA 3F6OA 3BC8A 3ZXSA 4A12A 2QSGX 4N9HA 1BI1A 1BOAA 3JRAA 1YE9A 2CV0A 3BCAA 3PO2J 2EZKA 5GTIC 4A3EJ 4PK4A 1WJFA 4AIHA 3S3NA 4NB5A 2R7OA 4XSXF 5FD6A 1P2FA 4M3BA 1BR2A 2A3SA 2PBIA 1BC7C 3HOZJ 4RAFA 1AA7A 3CCJI 4FCYA 1VQOI 3WG7H 3K1PA 3CP2A 4E70A 2FF4A 1USSA 3PFYA 3MKZA 4O5VA 4XN3A 3JTGA 2H09A 2HPIA 2JUGA 4YFXF 1IN5A 1OYYA 4DYQA 1JUMA 2QKLB 2COBA 2P6TA 1QQIA 1BW5A 3SFZA 1MSFC 2A6EF 4P5OA 5HLGA 3GFLA 2BXZA 3EUHA 4UNOA 3K7AJ 3L9FA 2N8GA 2IS4A 1LNWA 3Q9SA 2F4IA 5DEQA 3BZKA 2VE8A 3CCMI 1L3LA 4A3DJ 3L2WA 4IRHA 2LTPA 2PFBA 3DEEA 2FU4A 2VJIA 2LRDA 1Z7UA 4IO9F 5IY5H 1XGNA 1IXCA 4DNCA 2G9WA 3DKWA 5ED4A 3J7YJ 2A07F 3ZQCA 4BDZA 3ZN1A 1B8IA 3HOSA 2XPWA 3VYTB 2WY8Q 2PEXA 1BA5A 2DOEA 3K1NA 1XX5A 3DBLB 3A01A 3RPQA 1JGGA 3TDUC 4M9ZA 1GVDA 1PP7U 1CGPA 2CO5A 3NARA 4LFUA 3CD6I 3OIOA 5E3MA 4ENJA 1QPMA 4M74A 1Q1VA 3CUQA 5D4SA 4DBRA 3OYIA 1K4SA 2DU9A 4IRIA 3GFMA 3KP7A 4C2UA 1KU2A 2COMA 2ACJA 2HQNA 2M7BA 4A3JJ 1OISA 3QRFF 4Y4RA 5B66C 1CF7A 4I98B 1ZTRA 5K7FA 2NVUB 3LWFA 2BW3B 4F93B 1UHWA 1K4TA 2OUMA 2V9VA 3P9CA 4XKCA 2XAFA 4B43A 3IAM2 3I58A 4B8XA 2X1EA 4CZCA 3KX2A 4I99C 4KUMA 4XSZF 2ZNZA 2VI6A 3PM1A 5IYDJ 4CGZA 5E79C 1HBXG 2M4KA 4HNUA 5LGUA 2IA2A 3LMMA 2FE3A 2JA7J 2JPBA 4HX7A 4A6EA 2X51A 3F8FA 2DOAA 4C3JJ 3I71A 2GLOA 2IRFG 3F8NA 4HDVA 5E18F 3GFIA 3PNTA 3ZMUA 2EIJH 3GO5A 1IDZA 5D6EA 3F3XA 3I59B 2RREA 4G6TB 2L9VA 2VPRA 3ECHA 1ON1A 1XTAA 2LDUA 3E1SA 2LREA 4ENMA 4EATA 4D5CA 3H9GA 5D5WB 2DJIA 3DEUA 3UNGC 5E8GA 2I8DA 4F3QA 4RAGA 2XSDC 2DFEA 1YG2A 2HWVA 2HEOA 3FKJA 3K4NA 1RESA 2KMUA 4UVBA 1V55H 2FD5A 3QOEA 4E7HA 2CQXA 3RIRA 4C3IJ 1MMDA 4FETA 3SJMA 2VXDA 2RNJA 3HHGA 2A5WA 1OCZH 2OPTA 2ZXJA 4AIJA 3AKZA 3OOUA 4MEYF 3BG6A 1NHAA 2TRTA 4QTRA 2A5YB 5D8LB 4KN7X 1ETQA 1Y56A 2JSCA 2PX9A 4DZPA 1I27A 3HOTA 1QO0D 3K4MA 5E17F 2ZO4A 2XGXA 3BTIA 3FKIJ 2D2WA 4CO8A 2ZSHB 4A0XA 3ZQLA 2IA0A 2BEOA 1PVEA 2RNGA 1QHHD 3OMYA 5J4VA 5L3GA 4IHSA 3D0SA 1POGA 1X1BA 1WJCA 5L3BA 5BMZA 3QU6A 2CUEA 2IBDA 1G59A 2R5ZA 4XLPF 2JQ7A 5FGMA 1LDJA 5E3LA 1I50J 1X1DA 2IGNA 5JHFA 2B63J 2HZDA 2LK2A 1R1TA 2EPFA 3OYGA 1S7OA 3IUOA 2EWNA 4JX4A 4ON0A 2QZ8A 3MZHA 2MD5A 3JTHA 1AHDP 2FQ4A 2P0WA 2L9SA 3D5SC 1IRFA 5TGTA 1HDPA 3S93A 2NOGA 4LK0F 5IT3A 1K7AA 3HGYA 2RAEA 2MC3A 3DP7A 3HRSA 4MO7A 2KJCA 4GYIA 3VPRA 5E20A 1FY7A 3LQRA 4FT8A 2FXAA 1B72B 1R23A 1G6NA 3REOA 1X19A 2P4WA 4RM2A 3J81Z 2KZVA 4UUVA 1BI2A 1FJLA 1RC9A 1R22A 2VXZA 2W1OA 4RGUA 4RBOA 3HTUA 2Z2SB 1P4WA 3SDBA 5LLQA 2WV1A 3OIPA 3K9TA 5FD5A 2WV0A 4J00A 2DMUA 3L2UA 5LRRA 1H9GA 2K5CA 1KZHA 3LFUA 2MBFA 2R7FA 3WG9A 3DBHB 1O7FA 2ISYA 3CCYA 2QVOA 4UUTA 3MZYA 5HVQC 4NQWA 2DFIA 2EZIA 4DYCA 3BWGA 1YO5C 3K4CA 3FXLA 5D5UB 2RN7A 2YUSA 3CMEI 5BOXA 2HVSA 1WRJA 2DI3A 2HYGD 2QWWA 3TOAA 5IP7J 3U1KA 2JZYA 4B09A 2JA8J 1RPWA 2O0YA 3PIPF 4RB3C 3OL3A 3FXOA 3H5AA 4S04A 3TW6A 4G8XA 1IN4A 4U7BA 3OS0A 3ABUA 2DPUA 3HEFA 2IJLA 3CMMA 1DGRM 2HDWA 3VFZA 2PMUA 4BS9A 5FLMJ 3CCQI 1K6OA 1V4RA 3K2AA 4XR6A 1HKSA 2BZTA 4OAZA 5IT9K 2M7AA 5LFAA 1R6RA 3K2ZA 5FRMA 3CC7I 4XLHA 1FOXA 1A35A 3R0JA 5M5YJ 3PUFA 1R1UA 2E36A 4HG2A 3PL8A 1BR4A 3NWTA 4QPQA 5EEGA 2YPRA 4Y17A 1Y6IA 3FXRA 5FRNA 5JLWA 1JTXA 2LOOA 3GZ6A 3OSFA 4KDPA 1KQ9A 1OCPA 1K79A 3M9AA 4FHTA 4MFDA 3HKZN 1SVMA 4HSTA 2R7VA 2VBWA 5H6RA 4JQFA 3S32A 4MHGA 4KIGA 3I64A 1LQ1A 1D8KA 1ZH5A 1I1SA 1ZK8A 2QCOA 2QQ9A 4JX6A 2HOEA 3RPUD 5C44J 2JMWA 2X85A 2VKDA 2QF7A 2BY1A 2H6CA 3S1RJ 1VQPI 4A2UA 4Y13A 2M0CA 4PSWA 5CVIA 1YS6A 3KFWX 2DYSH 3V8JA 1B9NA 2K9MA 3J81K 3NAUA 2JN6A 2XHKA 5F27A 1TTYA 4OMYA 1H9TA 3HZJA 4RAYA 2ZJPF 2NNYA 1WPKA 1I6XA 4ETSA 1SD5A 1MJAA 3GBGA 1ZRCA 2DTZA 1MMAA 4A3CJ 3RZOJ 4IZZA 2V79A 3A03A 3EQLF 1IRGA 3BQYA 5HS8A 1QPIA 3COAC 2Y2ZA 1MNMC 1OJLA 4RM3A 2VUMJ 4XBFA 1F36A 1ZRFA 2KFDA 4Y7NJ 5IYCJ 1XSXA 3OV8A 4P9UA 1SEUA 2QQBA 1RR7A 3DKXA 1WQ2A 1IV8A 3E5XA 2H1KA 1UJ8A 2E34A 1EH8A 3A0HC 2STTA 4G6QA 1YHQI 2EINH 4HX8A 3MMYB 4NC6A 5H20A 3SZGA 4LMYA 3GUDA 2XVCA 5E1XA 3W2WA 1D5VA 4YG2F 1ETKA 2MABA 5EF6A 3H5NA 3M8JA 3HOXJ 1X3ZB 2XF5A 5E3OA 1VQ7I 2YR2A 4I09A 1T0FA 4XORA 1WJBA 2EFWA 1U9OA 2HYJA 5F1RA 4EVIA 5J40A 2IEKA 3B6AA 3EUKL 3O8HA 5M5XJ 1KQ8A 4PUSA 4KMFA 3IV5A 2HOSA 5F0CA 5HOOA 3WTUC 3U21A 4BY7J 4EM2A 4XICA 1ZLKA 2RKHA 1AOYA 1YW9A 3BP8A 3NRVA 4EJVA 1ZGAA 5KK1A 2LMDA 2X0LA 4U87A 1ETWA 1LFUP 2R7XA 4R79A 5GP9A 2VOPA 2AQEA 2E60A 4XONA 1ETVA 4B48A 4OIQF 2VT2A 4KITB 1YI2I 2F4OB 2ZC2A 3BTCA 4CCMA 5F0HA 4D0PA 3S8PA 4G94A 4L9TA 4AM3A 3VWBA 5EG0B 2MG4A 3BTJA 1X58A 3ZOBA 3CTAA 1ETYA 2FQ3A 1QVTA 2E1MB 3RKQA 1FIPA 4I0BA 4LLGF 3R4KA 3CJQB 1IUFA 4PJMA 3GYHX 3ECOA 2EQRA 1IDYA 4M3FA 3M4OJ 4YRVA 1VQ8I 1IRXA 1BJAA 2DFFA 4C2TA 2V9PA 1I3QJ 2BE5F 4DJAA 1FNNA 4XKWA 2IXSA 2IVMA 3E7LA 4WXDA 3QPLA 4MQ9F 2OZUA 4D7MA 1Z3YA 3W6KB 4P9FA 1CF7B 5J47A 3SFIA 3G71I 4OIOF 4JX5A 4CYCA 3LAPA 1R5GA 3W3CA 4HLYA 1HW1A 1S3JA 1XCVA 1Z21A 3F6VA 1S72I 2R92J 1SD7A 3MCZA 1BC8C 2DJNA 2LP0A 3VYSB 5JFRA 3ZQGA 2ECBA 3DQVC 5J1UA 1XS9A 2OTJI 2OAZA 4M3EA 5F1JA 2ZJQF 5LEKA 1I1GA 4GO1A 3WTVC 1E17A 3FZVA 2ISZA 5FKKA 3G73A 1RUOA 2E5ZA 2FBIA 2EFOA 2KIFA 3FIWA 2QGUA 3WTTC 1X3UA 1OKRA 3ZQQA 4H0EA 2HQRA 1R4MB 2FX0A 5HDNA 5D4RA 3PNYA 5AONA 4L0YB 4LITA 1PJRA 3H3VK 5H6QA 1G3SA 5B5EC 2UZKA 4I01A 5E1ZB 1D1CA 1EA3A 3K69A 1JTYA 3MKLA 1HQCA 3JW4A 4ZTJA 2L7FP 3WGHA 5ICFA 1ZKGA 3JRHA 4A5MA 2GIVA 4GYGA 4LB5A 3GZ5A 1RZ4A 4Z2YA 1ZGJA 2RV8A 3D5LA 2QLZA 5EEAA 3HDDA 1N77A 1N75A 1B6AA 1KA8A 1U5TC 2ZMEB 3I4PA 5D8KB 3BROA 1BL0A 1ITYA 1MSEC 3ZGKA 1ZG3A 2XRLA 3E6BA 1UG0A 3CCRI 3BR1A 1VTNC 5DUKA 4I6ZA 1EF4A 2H27A 4FE4A 1SFEA 2HVRA 3HOVJ 2IS2A 1A5JA 3F21A 2Q1ZB 1MNEA 4EJOA 1XB4A 5KNLA 2P5KA 4FASD 1U8BA 3L09A 3RCOA 2E1CA 5BNGA 3KP5A 4IRGA 4NBQA 3SDGA 3T1BA 1WSUA 1JHFA 1ZN2A 5DDGA 5HLHA 4ZZLA 3F8BA 1SAXA 5CPRB 3A4CA 3MWMA 3O2PE 3TO6A 5DD8A 3KIOA 3AL0C 5C4XJ 1LFBA 1LPQA 2XB5A 1QGPA 1O3RA 4AU7A 2R5YB 3M1CA 4BDYA 2V9KA 1SVLA 2HKXA 4E7ZA 5E3NA 4XLAA 3TQNA 4NC7A 4IVNA 4XRSA
chains in the Genus database with same CATH topology
2K9NA 1WGXA 2ID6A 4X6AJ 1RKWA 2VPRA 1MBHA 2CQQA 4B1RA 3RQIA 3LNQA 4QSHA 4D5CA 2PMZN 3WHCA 2LD5A 2XSDC 3A01B 5EGOA 1RESA 2HOTA 3HB9A 2D5VA 2FD5A 2Y30A 3BR2A 4A3GJ 4BXXJ 2CQXA 3Q0UA 2ECCA 4C3IJ 3SJMA 2K9QA 1TC3C 2G0EA 4S0HB 3S15J 2CU7A 1D5YA 3UKGA 1OCTC 2XGDA 2OPTA 2HQ5A 1FIAA 1APLC 4D5FA 4BBSJ 1X2NA 4W1UA 2HXOA 3OOUA 1JKRC 1WH7A 1SFOJ 5IYBJ 1Z77A 4QIWN 5EG0A 3BR6A 1H88C 2TRTA 4QTRA 2NVQJ 1ETQA 4DZPA 2R0QC 1TWFJ 1CQTA 1UMQA 3WHBA 5IPAA 1JJ8C 2W48A 1VF9A 3GTJJ 3BTIA 3FKIJ 1NK2P 1FTZA 1XG1A 3ZQLA 1GV5A 1O4XA 1POGA 5IOZA 2Y9ZA 4ABZA 5FKOA 1IRZA 3JRBA 1QRYA 3BG3A 2CUEA 2IBDA 2R5ZA 1WI3A 2K40A 3TP0A 3HOWJ 2NVTJ 5E3LA 2JWTA 1I50J 4MIMA 3GTGJ 2EZHA 2B63J 3CMYA 4G12A 2LK2A 2WB1N 3HOYJ 4JX4A 5FKLA 3LSRA 1AHDP 1ETOA 2FQ4A 2XPVA 1XC5A 1TWAJ 1IC8A 4A93J 1HDPA 2NVXJ 2NOGA 3HGYA 2RAEA 3M3YJ 4MO7A 5FKMA 3TP3A 3VPRA 2OF7A 2O7OA 1FTTA 1B72B 2L0KA 3A02A 3LSGA 4M3DA 2ME0A 1H89C 1FJLA 4RBOA 3ZQHA 3G1MA 1JKPC 1MBKA 3IH3A 2WV1A 3I4MJ 1QVUA 2DMUA 4XK4A 2CUFA 4IHYA 2L7MP 4L5EA 1YRNB 3BG5A 1MH4A 3JRIA 2YS9A 1H8AC 2JJ7A 3CCYA 1YRNA 4UUTA 1U9NA 2XB0X 3W6VA 3S16J 4DYCA 2EZIA 2YUSA 1Y1WJ 1PUFA 5M3FJ 2ELKA 3IH4A 5IP7J 3QQAA 3MN2A 5IOYA 5K7ZA 4UUSA 2JA8J 1RPWA 1P7IA 1HCRA 1GUUA 2AHQA 5M3MJ 4AUXA 2XGCA 4C2MJ 3TW6A 1NK3P 1T33A 3MVPA 5FKNA 3HEFA 5FLMJ 3F0CA 5JLXA 2R7ZJ 1GT0C 3I4NJ 9ANTA 2IAIA 3Q0WA 1E3OC 3K2AA 1G2HA 2DA5A 4AC0A 2K9SA 3DEWA 2E19A 2NS7A 4A3KJ 3GTPJ 3IH2A 5J1RA 2Y31A 1AU7A 1A6IA 2R5ZB 4MLOA 2M34A 2M2EA 3JR9A 3S2HJ 5M5YJ 1JKQC 4M6VA 1ETXA 5FLVA 2TCTA 1B72A 1IV6A 2H8RA 3RZDJ 2DMPA 1WCMJ 2R93J 5JLWA 1JTXA 2E2JJ 2JK3A 3OSFA 5J1YA 2Y9YA 1HDDC 2X6OA 1OCPA 3QPSA 4XRMA 2M9HA 3LSPA 4MFDA 3HKZN 3HOUJ 4GFBA 1RETA 1JT6A 5EGOB 2ZB9A 4B4CA 2LR8A 3GTOJ 1ZK8A 1JUSA 3S14J 2QCOA 2FJ1A 4JX6A 2DA6A 5C3EJ 3BQZA 4A3FJ 1IGNA 2E2IJ 2DA4A 2P81A 5C44J 2JMWA 1UG2A 1Y1VJ 2QF7A 3HM5A 3S1RJ 3JRFA 2M0CA 2DA2A 2GBYA 2NS8A 3ZQFA 1GV2A 3NAUA 3S2DJ 2JN6A 5F27A 3Q3SA 5FJ8J 1WPKA 3S1MJ 2HI3A 2AO9A 3GBGA 4DYRA 2DTZA 5IP9J 2LLKA 2DN0A 4A3CJ 4A69C 3RZOJ 5EZGA 3A03A 5EYRA 3BQYA 3C2BA 3ZQIA 1QPIA 4W97A 2VKEA 4X1EA 2HOAA 3JRGA 2Y2ZA 4UUSB 1MNMC 1OJLA 2I10A 5DTDA 2VUMJ 5GPCA 1F36A 3BT9A 2LKXA 4Y7NJ 2O9LA 1MBEA 5IYCJ 2E2HJ 3BR5A 4A3MJ 1BW6A 1RR7A 2MW8A 4I76A 3LOCA 3JRCA 4MFEA 2H1KA 3GTLJ 3LSJA 4EEFG 1VFCA 2DA1A 2MSYA 2KT0A 1F43A 1MH3A 4CYCB 5GPAA 1LE8B 2ME6A 3S1NJ 1ETKA 4JYKA 1HOMA 3HBLA 5EF6A 3HOXJ 1S7EA 5J3LA 5E3OA 3Q0VA 1FEXA 1U9OA 2HYJA 2CRGA 4V2FA 2L9RA 1MBGA 2IEKA 3B6AA 2VKVA 3FK7A 2M8GX 3O8HA 5M5XJ 1W0TA 1BJZA 1Z0XA 3IV5A 1ORKA 5F0CA 5DS9A 2HOSA 4BY7J 2XGEA 3G1LA 4XICA 4D7NA 1GDTA 1AKHA 1B8IB 3GTQJ 3G1OA 3HGGA 1W0UA 1AKHB 1ETWA 1LFUP 5GP9A 1IG7A 2EH3A 5F0FA 1HF0A 4IHVA 1ETVA 1MBFA 2MGQA 3JRDA 2Y0SN 4IHWA 2DMTA 2E1OA 3BTCA 5F0HA 4IHXA 2WAQN 1DU0A 1TWCJ 4IEJA 5EG0B 2MG4A 3BTJA 1X58A 3ZOBA 1ETYA 1QVTA 2DMNA 3RKQA 3D1NI 1FIPA 3FISA 1PUFB 1OFCX 5F08A 1IUFA 4AYBN 1JKOC 4M3FA 2EQRA 1IDYA 4J19A 3M4OJ 1RKTA 1TWHJ 3JRAA 1I3QJ 3TEDA 3PO2J 2DA7A 2EZKA 1ZGWA 2LFBA 4A3EJ 3E7LA 5M5WJ 3QPLA 1MBJA 4D7MA 2EZLA 1WH5A 1HLVA 3SFIA 4M3BA 4JX5A 3HOZJ 4CYCA 4FTHA 4FCYA 1TWGJ 2R92J 3GTMJ 1X2MA 2DJNA 2DMQA 4FISA 2LP0A 1ZR4A 3JREA 4DYQA 1JUMA 3ZQGA 2COBA 2ECBA 5J1UA 5C4JJ 1XS9A 4DZJA 4M3EA 5F1JA 1BW5A 3CQZJ 3GTKJ 1MSFC 5IP6A 4B3AA 5FKKA 1LE8A 3K7AJ 2N8GA 4FE7A 2R5YA 2XPUA 2ID3A 4A3LJ 1JJ6C 3BR0A 3FIWA 4A3DJ 2LTPA 4A3BJ 3PO3J 2FX0A 2LVSA 1ZR2A 4DW6A 4XRSG 2O8KA 4M3GA 3ZQCA 3H3VK 3FK6A 1B8IA 2JA5J 4BBRJ 4BKXA 2XPWA 1BA5A 1JUPA 1JTYA 3MKLA 3A01A 4LOCA 1JGGA 2L7FP 1P7JA 1ZKGA 3B6CA 1GVDA 3JRHA 3NARA 1ZQ3P 4Y52J 2LY9A 3S17J 2JA6J 3OIOA 3OSGA 5E3MA 1Q1VA 4NDLA 2X48A 2HDDA 4C3HJ 3O8GA 5EEAA 1JT0A 3HDDA 5HODA 2EBIA 2L7ZA 5K7HA 1BL0A 3TW7A 1ITYA 1SANA 1MSEC 4JP0A 4HNVA 4A3JJ 2XRLA 2YU9J 1R9TJ 1VI0A 3BR1A 4I6ZA 3L1PA 1EF4A 1ZTRA 2DA3A 3DCFA 4FE4A 1NTCA 5K7FA 3HOVJ 1A5JA 2GM4A 4A3IJ 3H0GJ 1U8BA 3S1QJ 2HXIA 1UHSA 4V2GA 5BNGA 3SDGA 3BG9A 2CJJA 5EZHA 1IJWC 4RDUA 1ENHA 1K61A 3BTLA 2X9DA 3CDLA 3PM1A 2VI6A 5IYDJ 2NVYJ 1K83J 1DU6A 1T56A 4XIDA 1VNDA 2JA7J 5C4XJ 1LFBA 4BY1J 2XB5A 4C3JJ 5EDNA 2R5YB 1U78A 2GLOA 5F04A 3BR3A 2KDZA 5E3NA 1IDZA 4XRSA 1I6HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9N A;  1WGX A;  2ID6 A;  4X6A J;  1RKW A;  2VPR A;  1MBH A;  2CQQ A;  4B1R A;  3RQI A;  3LNQ A;  4QSH A;  4D5C A;  2PMZ N;  3WHC A;  2LD5 A;  2XSD C;  3A01 B;  5EGO A;  1RES A;  2HOT A;  3HB9 A;  2D5V A;  2FD5 A;  2Y30 A;  3BR2 A;  4A3G J;  4BXX J;  2CQX A;  3Q0U A;  2ECC A;  4C3I J;  3SJM A;  2K9Q A;  1TC3 C;  2G0E A;  4S0H B;  3S15 J;  2CU7 A;  1D5Y A;  3UKG A;  1OCT C;  2XGD A;  2OPT A;  2HQ5 A;  1FIA A;  1APL C;  4D5F A;  4BBS J;  1X2N A;  4W1U A;  2HXO A;  3OOU A;  1JKR C;  1WH7 A;  1SFO J;  5IYB J;  1Z77 A;  4QIW N;  5EG0 A;  3BR6 A;  1H88 C;  2TRT A;  4QTR A;  2NVQ J;  1ETQ A;  4DZP A;  2R0Q C;  1TWF J;  1CQT A;  1UMQ A;  3WHB A;  5IPA A;  1JJ8 C;  2W48 A;  1VF9 A;  3GTJ J;  3BTI A;  3FKI J;  1NK2 P;  1FTZ A;  1XG1 A;  3ZQL A;  1GV5 A;  1O4X A;  1POG A;  5IOZ A;  2Y9Z A;  4ABZ A;  5FKO A;  1IRZ A;  3JRB A;  1QRY A;  3BG3 A;  2CUE A;  2IBD A;  2R5Z A;  1WI3 A;  2K40 A;  3TP0 A;  3HOW J;  2NVT J;  5E3L A;  2JWT A;  1I50 J;  4MIM A;  3GTG J;  2EZH A;  2B63 J;  3CMY A;  4G12 A;  2LK2 A;  2WB1 N;  3HOY J;  4JX4 A;  5FKL A;  3LSR A;  1AHD P;  1ETO A;  2FQ4 A;  2XPV A;  1XC5 A;  1TWA J;  1IC8 A;  4A93 J;  1HDP A;  2NVX J;  2NOG A;  3HGY A;  2RAE A;  3M3Y J;  4MO7 A;  5FKM A;  3TP3 A;  3VPR A;  2OF7 A;  2O7O A;  1FTT A;  1B72 B;  2L0K A;  3A02 A;  3LSG A;  4M3D A;  2ME0 A;  1H89 C;  1FJL A;  4RBO A;  3ZQH A;  3G1M A;  1JKP C;  1MBK A;  3IH3 A;  2WV1 A;  3I4M J;  1QVU A;  2DMU A;  4XK4 A;  2CUF A;  4IHY A;  2L7M P;  4L5E A;  1YRN B;  3BG5 A;  1MH4 A;  3JRI A;  2YS9 A;  1H8A C;  2JJ7 A;  3CCY A;  1YRN A;  4UUT A;  1U9N A;  2XB0 X;  3W6V A;  3S16 J;  4DYC A;  2EZI A;  2YUS A;  1Y1W J;  1PUF A;  5M3F J;  2ELK A;  3IH4 A;  5IP7 J;  3QQA A;  3MN2 A;  5IOY A;  5K7Z A;  4UUS A;  2JA8 J;  1RPW A;  1P7I A;  1HCR A;  1GUU A;  2AHQ A;  5M3M J;  4AUX A;  2XGC A;  4C2M J;  3TW6 A;  1NK3 P;  1T33 A;  3MVP A;  5FKN A;  3HEF A;  5FLM J;  3F0C A;  5JLX A;  2R7Z J;  1GT0 C;  3I4N J;  9ANT A;  2IAI A;  3Q0W A;  1E3O C;  3K2A A;  1G2H A;  2DA5 A;  4AC0 A;  2K9S A;  3DEW A;  2E19 A;  2NS7 A;  4A3K J;  3GTP J;  3IH2 A;  5J1R A;  2Y31 A;  1AU7 A;  1A6I A;  2R5Z B;  4MLO A;  2M34 A;  2M2E A;  3JR9 A;  3S2H J;  5M5Y J;  1JKQ C;  4M6V A;  1ETX A;  5FLV A;  2TCT A;  1B72 A;  1IV6 A;  2H8R A;  3RZD J;  2DMP A;  1WCM J;  2R93 J;  5JLW A;  1JTX A;  2E2J J;  2JK3 A;  3OSF A;  5J1Y A;  2Y9Y A;  1HDD C;  2X6O A;  1OCP A;  3QPS A;  4XRM A;  2M9H A;  3LSP A;  4MFD A;  3HKZ N;  3HOU J;  4GFB A;  1RET A;  1JT6 A;  5EGO B;  2ZB9 A;  4B4C A;  2LR8 A;  3GTO J;  1ZK8 A;  1JUS A;  3S14 J;  2QCO A;  2FJ1 A;  4JX6 A;  2DA6 A;  5C3E J;  3BQZ A;  4A3F J;  1IGN A;  2E2I J;  2DA4 A;  2P81 A;  5C44 J;  2JMW A;  1UG2 A;  1Y1V J;  2QF7 A;  3HM5 A;  3S1R J;  3JRF A;  2M0C A;  2DA2 A;  2GBY A;  2NS8 A;  3ZQF A;  1GV2 A;  3NAU A;  3S2D J;  2JN6 A;  5F27 A;  3Q3S A;  5FJ8 J;  1WPK A;  3S1M J;  2HI3 A;  2AO9 A;  3GBG A;  4DYR A;  2DTZ A;  5IP9 J;  2LLK A;  2DN0 A;  4A3C J;  4A69 C;  3RZO J;  5EZG A;  3A03 A;  5EYR A;  3BQY A;  3C2B A;  3ZQI A;  1QPI A;  4W97 A;  2VKE A;  4X1E A;  2HOA A;  3JRG A;  2Y2Z A;  4UUS B;  1MNM C;  1OJL A;  2I10 A;  5DTD A;  2VUM J;  5GPC A;  1F36 A;  3BT9 A;  2LKX A;  4Y7N J;  2O9L A;  1MBE A;  5IYC J;  2E2H J;  3BR5 A;  4A3M J;  1BW6 A;  1RR7 A;  2MW8 A;  4I76 A;  3LOC A;  3JRC A;  4MFE A;  2H1K A;  3GTL J;  3LSJ A;  4EEF G;  1VFC A;  2DA1 A;  2MSY A;  2KT0 A;  1F43 A;  1MH3 A;  4CYC B;  5GPA A;  1LE8 B;  2ME6 A;  3S1N J;  1ETK A;  4JYK A;  1HOM A;  3HBL A;  5EF6 A;  3HOX J;  1S7E A;  5J3L A;  5E3O A;  3Q0V A;  1FEX A;  1U9O A;  2HYJ A;  2CRG A;  4V2F A;  2L9R A;  1MBG A;  2IEK A;  3B6A A;  2VKV A;  3FK7 A;  2M8G X;  3O8H A;  5M5X J;  1W0T A;  1BJZ A;  1Z0X A;  3IV5 A;  1ORK A;  5F0C A;  5DS9 A;  2HOS A;  4BY7 J;  2XGE A;  3G1L A;  4XIC A;  4D7N A;  1GDT A;  1AKH A;  1B8I B;  3GTQ J;  3G1O A;  3HGG A;  1W0U A;  1AKH B;  1ETW A;  1LFU P;  5GP9 A;  1IG7 A;  2EH3 A;  5F0F A;  1HF0 A;  4IHV A;  1ETV A;  1MBF A;  2MGQ A;  3JRD A;  2Y0S N;  4IHW A;  2DMT A;  2E1O A;  3BTC A;  5F0H A;  4IHX A;  2WAQ N;  1DU0 A;  1TWC J;  4IEJ A;  5EG0 B;  2MG4 A;  3BTJ A;  1X58 A;  3ZOB A;  1ETY A;  1QVT A;  2DMN A;  3RKQ A;  3D1N I;  1FIP A;  3FIS A;  1PUF B;  1OFC X;  5F08 A;  1IUF A;  4AYB N;  1JKO C;  4M3F A;  2EQR A;  1IDY A;  4J19 A;  3M4O J;  1RKT A;  1TWH J;  3JRA A;  1I3Q J;  3TED A;  3PO2 J;  2DA7 A;  2EZK A;  1ZGW A;  2LFB A;  4A3E J;  3E7L A;  5M5W J;  3QPL A;  1MBJ A;  4D7M A;  2EZL A;  1WH5 A;  1HLV A;  3SFI A;  4M3B A;  4JX5 A;  3HOZ J;  4CYC A;  4FTH A;  4FCY A;  1TWG J;  2R92 J;  3GTM J;  1X2M A;  2DJN A;  2DMQ A;  4FIS A;  2LP0 A;  1ZR4 A;  3JRE A;  4DYQ A;  1JUM A;  3ZQG A;  2COB A;  2ECB A;  5J1U A;  5C4J J;  1XS9 A;  4DZJ A;  4M3E A;  5F1J A;  1BW5 A;  3CQZ J;  3GTK J;  1MSF C;  5IP6 A;  4B3A A;  5FKK A;  1LE8 A;  3K7A J;  2N8G A;  4FE7 A;  2R5Y A;  2XPU A;  2ID3 A;  4A3L J;  1JJ6 C;  3BR0 A;  3FIW A;  4A3D J;  2LTP A;  4A3B J;  3PO3 J;  2FX0 A;  2LVS A;  1ZR2 A;  4DW6 A;  4XRS G;  2O8K A;  4M3G A;  3ZQC A;  3H3V K;  3FK6 A;  1B8I A;  2JA5 J;  4BBR J;  4BKX A;  2XPW A;  1BA5 A;  1JUP A;  1JTY A;  3MKL A;  3A01 A;  4LOC A;  1JGG A;  2L7F P;  1P7J A;  1ZKG A;  3B6C A;  1GVD A;  3JRH A;  3NAR A;  1ZQ3 P;  4Y52 J;  2LY9 A;  3S17 J;  2JA6 J;  3OIO A;  3OSG A;  5E3M A;  1Q1V A;  4NDL A;  2X48 A;  2HDD A;  4C3H J;  3O8G A;  5EEA A;  1JT0 A;  3HDD A;  5HOD A;  2EBI A;  2L7Z A;  5K7H A;  1BL0 A;  3TW7 A;  1ITY A;  1SAN A;  1MSE C;  4JP0 A;  4HNV A;  4A3J J;  2XRL A;  2YU9 J;  1R9T J;  1VI0 A;  3BR1 A;  4I6Z A;  3L1P A;  1EF4 A;  1ZTR A;  2DA3 A;  3DCF A;  4FE4 A;  1NTC A;  5K7F A;  3HOV J;  1A5J A;  2GM4 A;  4A3I J;  3H0G J;  1U8B A;  3S1Q J;  2HXI A;  1UHS A;  4V2G A;  5BNG A;  3SDG A;  3BG9 A;  2CJJ A;  5EZH A;  1IJW C;  4RDU A;  1ENH A;  1K61 A;  3BTL A;  2X9D A;  3CDL A;  3PM1 A;  2VI6 A;  5IYD J;  2NVY J;  1K83 J;  1DU6 A;  1T56 A;  4XID A;  1VND A;  2JA7 J;  5C4X J;  1LFB A;  4BY1 J;  2XB5 A;  4C3J J;  5EDN A;  2R5Y B;  1U78 A;  2GLO A;  5F04 A;  3BR3 A;  2KDZ A;  5E3N A;  1IDZ A;  4XRS A;  1I6H J; 
#chains in the Genus database with same CATH topology
 2K9N A;  4BXU A;  4MEX F;  4KIC A;  4IHT A;  3EYY A;  2H6B A;  1RKW A;  4X6A J;  2ZFW A;  1MBH A;  2CQQ A;  2CYY A;  3U2R A;  2K02 A;  1YX3 A;  3JAM Z;  4II2 A;  4G7O F;  3C7J A;  1REP C;  2HNH A;  2PMZ N;  1DP3 A;  1V5E A;  4L5J A;  2CUZ A;  1ZAR A;  3BJ6 A;  2WA0 A;  3A01 B;  4B44 A;  1IXS B;  1G4D A;  2HOT A;  3WU2 C;  3BCB A;  3HB9 A;  2D5V A;  1ZHF A;  2Y30 A;  1J7K A;  2DBB A;  4EMS A;  3Q0U A;  4L18 B;  2OCC H;  3GX4 X;  2Q2E A;  2GIZ A;  5ICG A;  3FX3 A;  1WHU A;  5LHI A;  1FIA A;  3DU5 A;  4BEH A;  1X2N A;  5DCM B;  3L00 A;  3KE2 A;  1JKR C;  1WH7 A;  5IYB J;  5EG0 A;  4QIW N;  1XSD A;  1YFH A;  1ZG5 A;  1H88 C;  5L3E A;  4O3M A;  2BXY A;  1FBU A;  1MJ9 A;  3HRU A;  1FYM A;  4Y33 A;  3WU1 B;  1TWF J;  2IS6 A;  3WHB A;  3HRM A;  1MJB A;  2GOM A;  4NQW B;  4HRI A;  2E5N A;  4UY8 I;  2E1M C;  1G3T A;  2CFX A;  1JJ8 C;  1KU7 A;  4LGW A;  1NK2 P;  1XG1 A;  4RGS A;  3TO7 A;  4CCL A;  2DLL A;  1MIJ A;  3CDH A;  2DPD A;  3T5X A;  2HVQ A;  4ABZ A;  2CW0 F;  2ETH A;  5FKO A;  2R3S A;  2HTJ A;  3BG3 A;  3H9J A;  1BR1 A;  2K40 A;  2KKO A;  3FMR A;  1D3Y A;  2NVT J;  2LBF A;  3HOW J;  2IGM A;  4CCK A;  4BXF A;  1P4A A;  1T95 A;  4MIM A;  5J8C A;  1T98 A;  1Z6T A;  2EZH A;  3K1M A;  1LVA A;  3A0B C;  2UXN A;  2DCE A;  3DF8 A;  4HPQ A;  2K3F A;  2P5L C;  2VBZ A;  1SFX A;  2X6W A;  3KZY A;  4CXF A;  1ETO A;  1ONV A;  2ZNY A;  1XC5 A;  1V5F A;  1GLN A;  2BYV E;  1LKX A;  2H94 A;  3M3Y J;  1LUJ B;  3QWL A;  2Z3Y A;  2FMY A;  4CSW A;  3OYM A;  2QSF X;  1MGT A;  2OF7 A;  5BPD A;  1XDU A;  3GEZ A;  4HSR A;  5LEJ A;  2L0K A;  1VQ5 I;  3A02 A;  2GOX B;  1GXQ A;  2ME0 A;  3GME A;  4PJN A;  2JSP A;  2TDX A;  4ZDL A;  2K4J A;  3OYF A;  1JKP C;  1M1E B;  4G7H F;  3I4M J;  5GAE J;  2GAU A;  2VC0 A;  1X4O A;  2CUF A;  2XUB A;  4IHY A;  2L7M P;  2LKP A;  4YIF A;  3BG5 A;  4HQM A;  3JRI A;  1YQA A;  1X1P A;  4ENK A;  1U5T B;  2ZME C;  3CO7 C;  1EH7 A;  1IF1 A;  1QU3 A;  3T8T A;  4BJ6 C;  4UB6 C;  3PSI A;  5CVJ A;  5HLT A;  1WJA A;  4XOP A;  3IH4 A;  3PUB A;  4N9I A;  3MN2 A;  1SMY F;  5IOY A;  3DPL C;  4UUS A;  1PP8 F;  1P7I A;  4DGW B;  2AHQ A;  3DV8 A;  4IL6 C;  1JI8 A;  3SEQ A;  4QWQ A;  1F5T A;  1UCR A;  2ZSI B;  1W5S A;  2JVH A;  5FKN A;  2UWM A;  4H4K C;  2VPL A;  5L3C A;  2BVL A;  3Q0W A;  2CH0 A;  3FM5 A;  2GQQ A;  1R5I D;  2DA5 A;  4AC0 A;  2K9S A;  1DPR A;  1D0Z A;  2A05 A;  3CJN A;  3BZ6 A;  4G6D A;  3GTP J;  3CLO A;  2OBP A;  2Y31 A;  1VQL I;  1AU7 A;  1YJ9 I;  1IAW A;  2LC2 A;  3KP6 A;  1J59 A;  1K78 B;  5FLX K;  1JKQ C;  2VIX A;  1HA8 A;  3CCL I;  3GZN B;  3HYI A;  5F64 A;  3WTZ A;  1WKM A;  1ETX A;  3M7G A;  2V1D A;  5FLV A;  3C18 A;  2TCT A;  2M1B A;  3ISP A;  1B72 A;  3BY6 A;  1W1W E;  4OIN F;  1IV6 A;  4P55 A;  3ML6 A;  2H8R A;  3RZD J;  2VN2 A;  5BQT A;  2KL4 A;  1WCM J;  3H9Q A;  4A0Z A;  1ZG1 A;  2DYR H;  1HDD C;  2Y9Y A;  3VOE A;  2X6O A;  3NWS A;  3TBI A;  4XRM A;  2EV5 A;  4UXN A;  3CCS I;  2M9H A;  2C6Y A;  3Q9V A;  3LSP A;  4ZDP A;  3HOU J;  1WJ5 A;  4GFB A;  1RET A;  4IXA A;  3W2V A;  2OCE A;  3K10 A;  1TW2 A;  2KQR A;  1STZ A;  2LR8 A;  3GTO J;  3S14 J;  3HKZ A;  2DA6 A;  5CLS A;  3ZRG A;  3BQZ A;  5C3E J;  1VQM I;  1IGN A;  1IUY A;  2KIU A;  2ICW G;  1W7P D;  3MD2 A;  2LSO A;  3SXY A;  3E0J B;  1I39 A;  1A31 A;  2K9L A;  4OIP F;  3FDY A;  3TMO A;  5LGN A;  1GV2 A;  5DCM A;  4BNC A;  1G8X A;  2EIL H;  5TIS C;  5FJ8 J;  2QA4 I;  1E3H A;  2HI3 A;  2AO9 A;  4XLF A;  1W36 D;  5IP9 J;  3VSK A;  2DN0 A;  4A69 C;  1JHH A;  2FEZ A;  3BPX A;  3C1D A;  1RRJ A;  5EZG A;  2DXI A;  3HSF A;  1Z7L A;  4YEL A;  3L2C A;  1P4X A;  2QSH X;  3FXQ A;  4X1E A;  1YS7 A;  3WTX C;  4RGR A;  1I5Z A;  2HOA A;  1U2W A;  1YIJ I;  4U7D A;  3IKT A;  3FF5 A;  5GPC A;  2Y0M A;  2O9L A;  1MBE A;  4XL9 A;  4EM1 A;  1F9N A;  3P9K A;  2E2H J;  2MLK A;  1FMW A;  4A0Y A;  1XGS A;  1OR7 A;  3QOD A;  1B1B A;  4OWR B;  2DA1 A;  4OU0 A;  2MSY A;  5JR3 A;  1RUN A;  2KT0 A;  4RA2 A;  2WAD A;  1MH3 A;  3CF2 A;  3TOB A;  3LL7 A;  3LFK A;  3ZP5 A;  2ME6 A;  4QLC U;  3CDI A;  2B9S A;  3RTR A;  4NUB A;  4JYK A;  4HDU A;  4CCN A;  5J3L A;  1XMK A;  3I59 A;  1LDK B;  2O5R A;  2CRG A;  2EIK H;  2W85 A;  1XGM A;  1FMV A;  2M8G X;  1SAU A;  4X0G A;  3M8F A;  3VDX A;  4M6Y A;  1HST A;  2NNN A;  5FLX Z;  2QQA A;  2DK8 A;  4RB1 A;  1B8I B;  4K2E A;  1W0U A;  2LG4 A;  2QQ8 A;  2V1N A;  3V8K A;  1UHM A;  2IA1 A;  4GCV A;  3U9G A;  2KIS A;  1HF0 A;  5F0F A;  3M07 A;  2YSR A;  1R1V A;  2A61 A;  3MAJ A;  5KAF C;  2Y0S N;  4IHW A;  2P7C B;  2DMT A;  3CUQ B;  2E1O A;  4Q48 A;  2K7L A;  2PJR B;  2VJ4 A;  3FM3 A;  2WAQ N;  1FC3 A;  3KET A;  1O57 A;  5D5V B;  2HGC A;  3FHZ A;  1Q1H A;  2EFP A;  1E3P A;  3BZC A;  3ABT A;  4V19 K;  1JGS A;  3ASN H;  3FIS A;  1PUF B;  1D1B A;  1ZRE A;  3CF5 F;  1Z9C A;  3RI4 A;  1JKO C;  1C0W A;  2O6G E;  4KFC A;  2FA5 A;  5LD2 C;  3IC7 A;  1B4A A;  1RKT A;  1TWH J;  3IWZ A;  3JSP A;  3MKW B;  1UAA A;  3TED A;  3J80 K;  2DA7 A;  2LFB A;  1FPQ A;  5M5W J;  2FNA A;  2QUF A;  2MYS A;  4HV6 A;  2K4B A;  1MBJ A;  2EZL A;  3GW2 A;  1WH5 A;  3G6E I;  1FBS A;  3O3K A;  2QEX I;  3CLQ A;  4FTH A;  3CES A;  1V5G A;  2EIM H;  3E3V A;  1YOV B;  3HHH A;  3PQK A;  5FFZ A;  1TWG J;  2ESN A;  2V1X A;  1OR7 C;  3G4S I;  3GTM J;  2DOF A;  4JBA A;  1X2M A;  3AL0 B;  2E71 A;  2CMP A;  4G9Y A;  3ONQ A;  3AG4 H;  4S05 A;  2F5E A;  3NQO A;  1Z6R A;  4C30 A;  5C4J J;  4DZJ A;  2CUJ A;  1R71 A;  3GTK J;  2PJP A;  1QZE A;  2M45 A;  4HV5 A;  5KHD A;  4FE7 A;  1YTY A;  1R00 A;  4ZH4 F;  2R5Y A;  2AQF A;  4ZZD A;  4A3L J;  1FX7 A;  1JJ6 C;  2CV2 A;  2FOK A;  3AG2 H;  4II3 A;  2DDA A;  4CCJ A;  1OCC H;  2NOJ B;  2H8W A;  4A3B J;  3N97 A;  1L0O C;  3K0L A;  1P6R A;  2LVS A;  2M30 A;  1ZR2 A;  3QAH A;  4DW6 A;  5IT9 Z;  3ZMD A;  2NS0 A;  1A04 A;  4M3G A;  2IGO A;  5HLI A;  2MD0 A;  3U1D A;  1X1A A;  4U0W A;  2WBM A;  4RGX A;  1JUP A;  2IW5 A;  4XNF A;  4LOC A;  4BUP A;  1P7J A;  2XAU A;  2BY2 A;  3CCU I;  5E8I A;  1EV7 A;  1T39 A;  2F5C A;  1ZQ3 P;  2HFH A;  3FXK A;  2L3D A;  3S17 J;  3OOP A;  1BBY A;  3E6D A;  3I55 I;  3OSG A;  2OU2 A;  2Q2E B;  3VEP A;  4F55 A;  4ZYG A;  3I3L A;  4IQJ A;  2ZME A;  4U0Y A;  2X48 A;  2HDD A;  1XMA A;  1FOY A;  1N25 A;  3DKY A;  3GLL A;  1XD7 A;  1JT0 A;  1TT5 B;  2PI0 A;  2W57 A;  2JRT A;  2IGK A;  2RDP A;  2L7Z A;  2XAH A;  3TL4 X;  5K7H A;  3KLO A;  1O7L A;  1SAN A;  1U0J A;  2VQC A;  4IQ4 A;  3LST A;  2NRA C;  1XGO A;  1UFM A;  3L1P A;  2DA3 A;  1FLI A;  4LG0 B;  3A1Y A;  2GM4 A;  4M9S A;  4A3I J;  1PDN C;  1O3S A;  2L5Q A;  4AID A;  4AIK A;  2DAO A;  1ZYR F;  4O6J A;  3BG9 A;  3FHN A;  1E0E A;  4RDU A;  2VC1 A;  5CQE A;  1ENH A;  2FSW A;  1K61 A;  2ZFU A;  3BTL A;  2X9D A;  3CDL A;  2K27 A;  2LH9 A;  2NVY J;  2CW8 A;  1K83 J;  3I0T A;  1T56 A;  3KYC B;  4XID A;  1FYL A;  1GXP A;  1VND A;  2LY1 A;  3TGN A;  4ITV A;  1K6Y A;  3RSN A;  4BY1 J;  1I3A A;  2OD5 A;  2V26 A;  4IOC F;  5EDN A;  3B02 A;  4ZYA A;  4LB6 B;  3K70 D;  3H35 A;  4PZJ A;  1Y0N A;  3BR3 A;  5HNH A;  1BIA A;  2KDZ A;  2A69 F;  3FMQ A;  2FUG 2;  5H2F C;  2MLG A;  4I2O A;  4ZDO A;  3VB2 A;  1WGX A;  3V8L A;  2ID6 A;  2L2O A;  2XKP A;  4GGG A;  4P96 A;  1LVK A;  3RQI A;  1S5L C;  3CP8 A;  4BL0 B;  3OYN A;  3PSF A;  4QSH A;  4YFK F;  4LLL A;  2L01 A;  1YLF A;  4E7S A;  3DPT A;  1J0R A;  1OPC A;  2LD5 A;  3J7Z I;  4KIB A;  2R7W A;  2W24 A;  4PDK A;  5ILU A;  5EGO A;  1J2X A;  3JSO A;  2RC4 A;  2L4M A;  1TBX A;  4RLQ A;  2PQ8 A;  3IHU A;  1N78 A;  4BXX J;  2IPQ X;  2ECC A;  3OR1 C;  3WU0 A;  3ERE D;  2BOL A;  2K9Q A;  5LHH A;  2G0E A;  2M4G A;  2W84 A;  4PCQ A;  4FX0 A;  3UKG A;  3OYL A;  1OCT C;  4UVC A;  1LEB A;  4E6K G;  1FT9 A;  2HQ5 A;  1QZY A;  2HU9 A;  1VQ9 I;  4ESB A;  2QM3 A;  4BQQ A;  4BBS J;  4W1U A;  1YX5 A;  3HPG A;  3HJE A;  1SFO J;  4UVA A;  1Z77 A;  4BQO A;  3BR6 A;  2KZG A;  1Z91 A;  2M3A A;  2OV7 A;  4BYY A;  2EJR A;  1A36 A;  2YU3 A;  2NVQ J;  4CIC A;  3OYC A;  5HDG A;  3HUG B;  2NYX A;  1UMQ A;  3SZT A;  3F72 A;  3IRR A;  4M72 A;  4EQQ A;  2IT0 A;  3V7C A;  3GTJ J;  3RKX A;  1P92 A;  3OIQ A;  2OQR A;  1D8J A;  4GRI A;  4LG0 A;  3QYE A;  3G3Z A;  1O4X A;  2Y9Z A;  5IOZ A;  4HBL A;  1MMS A;  1IRZ A;  4BGD A;  2FNP A;  4KT6 A;  4CYD A;  4BQA A;  5L3D A;  4CDG A;  2KIQ A;  4AD9 A;  3K6G A;  1BI3 A;  5CVU A;  3TP0 A;  2MA3 A;  3AG3 H;  2DO7 A;  1DQU A;  1P9Q C;  1T08 B;  4G12 A;  2LF8 A;  4E4H A;  4M6X A;  2WB1 N;  3HOY J;  3HPH A;  3QU3 A;  3RYP A;  3DU6 A;  5FKL A;  2BY0 A;  2F5V A;  2X6Y A;  3LSR A;  1TNS A;  2XPV A;  3HC7 A;  1YYV A;  2BV6 A;  3UR3 C;  3ZMZ A;  2XC7 A;  1TWA J;  2LNB A;  4WWC A;  1IC8 A;  4AVZ A;  2NVX J;  1G3Y A;  2CQ7 A;  2V4J C;  4E7I A;  3R60 A;  1X3W B;  1HXD A;  3VSL A;  5FKM A;  3TP3 A;  2PLY A;  3I9V 2;  3LSG A;  1E2X A;  3E5Q A;  2CWE A;  4M3D A;  1H89 C;  3GLX A;  3ZQH A;  1S6L A;  1MBK A;  2XAQ A;  3KPH A;  1RI7 A;  1HSJ A;  4DIQ A;  4P1W A;  1SD4 A;  1QVU A;  3C3W A;  1O3Q A;  4XK4 A;  2R7U A;  1FOK A;  3HTS B;  5D5X B;  2HR3 A;  3ULQ B;  1YRN B;  2ZXW H;  1F4K A;  1MH4 A;  1VQ6 I;  4XRF A;  2YS9 A;  3C2G A;  4ENN A;  2JJ7 A;  4HYE A;  4N4N B;  2XB0 X;  3W6V A;  2GA1 A;  1FWZ A;  5HNF A;  4WCG A;  1TQI A;  2Q0O A;  2EA2 A;  2GXA A;  3PJR A;  1QBJ A;  2LYC A;  2GXB A;  2VON A;  1W7P B;  1KON A;  2W4S A;  2ELK A;  1OYI A;  1S7A A;  2XAG A;  5M3F J;  1BOB A;  3RYR A;  3QQA A;  3HUG A;  4Y15 A;  4F91 B;  1GUU A;  3W2A A;  1MD0 A;  3OYA A;  4C2M J;  4PGG A;  1NK3 P;  1T33 A;  3WGG A;  2FRH A;  4XLC A;  1Y0U A;  1PYV A;  5JLX A;  3V4G A;  3N4M A;  3I4N J;  1X4P A;  3O6B B;  1B59 A;  1G2H A;  3D5R C;  3SYT A;  1OMI A;  3DEW A;  3ABL H;  4AVP A;  2E19 A;  3GF2 A;  4A3K J;  3IH2 A;  2OJE D;  4HEA 2;  1A6I A;  1ZRD A;  2R5Z B;  3KLN A;  2ZJR F;  1Z05 A;  2DT6 A;  3FBI B;  2M2E A;  4UHT A;  2UV1 A;  3GVA A;  1LJ9 A;  3P9I A;  4PFP A;  1KYW A;  3F22 A;  1FP1 D;  5CVV A;  3GWZ A;  4M6V A;  3E5U A;  1DGW Y;  4XLE A;  2EV6 A;  4KA4 A;  4HLX A;  1T2K A;  4B3X A;  4ZJZ A;  3CJT B;  4M71 A;  4R8H A;  4BHP A;  3CC2 I;  2L7K A;  4WF2 A;  3KEO A;  1IXR C;  2R93 J;  3G2B A;  1MND A;  4CHU A;  4F92 B;  2Q8K A;  3H3Z A;  5DCF A;  1NG6 A;  1TP4 A;  5J1Y A;  3OYK A;  3QPS A;  2VL8 A;  3AG1 H;  3CZ6 A;  5B1B H;  2JT1 A;  2XF6 A;  3F9K A;  2UUZ A;  2CW7 A;  4HX4 A;  2BVM A;  1JT6 A;  2XAS A;  2ZB9 A;  5EJC A;  5J8F A;  5EGO B;  1T38 A;  4WX9 A;  4CZZ A;  2R7Z J;  4KJZ A;  3V7R A;  1JUS A;  1S29 A;  2FJ1 A;  2FOW A;  3E6M A;  4A3F J;  2HPM A;  5HDK A;  5BS6 A;  2E2I J;  3QPT A;  2P81 A;  4LIU A;  1U3E M;  1W5T A;  1PUE E;  5ILV A;  1UG2 A;  2DOD A;  2O03 A;  1Y1V J;  1YW7 A;  2F5F A;  4CA0 A;  2MH9 A;  5KVR A;  2OC6 A;  3TKY A;  3OYB A;  4FX4 A;  3ZQF A;  3B73 A;  3S2D J;  1SFK A;  2J5O A;  3BG7 A;  2M5W A;  1LEA A;  3Q3S A;  4XKV A;  4AWX B;  2M87 A;  2A6H F;  2W25 A;  1FSH A;  5EYR A;  3DLA A;  3L2Q A;  3QPH A;  4EGY A;  2ZXI A;  4KN4 X;  3ZQI A;  2ZBK A;  1TLH B;  3R61 A;  2P6S A;  4W97 A;  2IS1 A;  5ICE A;  5JVT A;  5A2Q Z;  5JHU A;  1TL8 A;  2F4M B;  2I10 A;  5DTD A;  4HF2 A;  4XMY A;  2EA4 A;  4BE1 A;  4RB2 C;  4A3M J;  3IL2 A;  3PIO F;  3DTI A;  1V54 H;  4IJA A;  1W4M A;  3LOC A;  3JRC A;  1K78 A;  3ESW B;  4ASN A;  3GCM A;  2Z33 A;  3EYI A;  3GTL J;  3LSJ A;  4EEF G;  2W00 A;  3H92 A;  1D0X A;  4KYW A;  1F43 A;  4TV7 A;  1WI9 A;  1UZC A;  3HSE A;  1IO2 A;  1OLT A;  1H0M A;  1LE8 B;  1BIB A;  1BM9 A;  3QOP A;  3L2R A;  5CYV A;  4N0B A;  5K5O A;  3S3M A;  4JOM A;  1YIT I;  3S1N J;  2E7W A;  2QKM B;  3CUQ C;  3HBL A;  2O61 A;  3VYU B;  1HOM A;  2VQG A;  1S7E A;  4HW0 A;  1R36 A;  2VOD A;  1BN5 A;  3DLL F;  1ODD A;  3OYH A;  2CV1 A;  2A68 F;  2XV4 S;  2L9R A;  4V2F A;  1F1Z A;  3H36 A;  4LIV A;  4HA8 A;  1OYW A;  1ACI A;  4KNY A;  2L9N A;  1W0T A;  1BJZ A;  2XAJ A;  5DS9 A;  4E7L A;  2DTR A;  1XCB A;  3G1L A;  4D7N A;  1GDT A;  1AKH A;  4NC8 A;  3GTQ J;  3G1O A;  3HGG A;  4D9J A;  1EH6 A;  1G3W A;  4UV9 A;  2D45 A;  4KIS A;  2EV0 A;  2M8E A;  1LDD A;  1HKQ A;  2ZJ2 A;  4F7Z A;  3OS1 A;  3IAS 2;  1O3T A;  3ZN0 A;  2Z9O A;  4M73 A;  4CH7 A;  1MBF A;  2L54 A;  1Y39 A;  2MH2 A;  1X1C A;  2X6X A;  2YX4 A;  1RR8 C;  2ESH A;  4IHX A;  3SZP A;  3LSH A;  1NH3 A;  5DYM A;  4IEJ A;  2PN6 A;  1IN7 A;  1ON2 A;  3MQ0 A;  3HSR A;  2DMN A;  4PJL A;  3WE3 A;  1DP7 P;  3D1N I;  2WAQ A;  5F08 A;  1WVR A;  3CC4 I;  2Z16 A;  4AYB N;  1WWX A;  1KGS A;  4WXH A;  3IWF A;  1UST A;  2O3F A;  2XIG A;  1LB2 A;  4ZTF A;  4RB0 A;  3K4J A;  5CQG A;  3LA7 A;  5FO5 A;  2M0M A;  5CKT A;  2VB6 A;  5CVR A;  2HKO A;  1ZGW A;  3I54 A;  2VJ5 A;  1DUX C;  5ICC A;  2DQR A;  1FP2 A;  3HL2 A;  2E1N A;  1S9H A;  1HKT A;  1HLV A;  2K86 A;  1D0Y A;  4L0Z B;  4BE0 A;  5KAI C;  2BW3 A;  3W6J B;  3DTE A;  3H1C A;  2R7Q A;  1XDS A;  4IF4 A;  2R7R A;  4IX7 A;  2RQQ A;  3QP6 A;  2EB7 A;  2VE9 A;  2E7X A;  3OYD A;  2DMQ A;  5A2Q K;  3KYL A;  4FIS A;  2K3P A;  1ZR4 A;  3JRE A;  3JCU C;  3M8E A;  4DQ2 A;  1V3F A;  3ZCO A;  5K5Q A;  3SQN A;  4EJT A;  1SFU A;  3CQZ J;  5IP6 A;  4B3A A;  1LE8 A;  2UXX A;  2FML A;  2CGP A;  4HF0 A;  4BAC A;  2XPU A;  2ID3 A;  2KRC A;  1S8N A;  5DUI A;  2CSO A;  3BR0 A;  3MKY B;  2O8X A;  3TDZ C;  1J09 A;  1OCO H;  3PO3 J;  4OOI A;  1GVJ A;  3R6S A;  4XRS G;  2O8K A;  4U0V A;  3N05 A;  5DV5 A;  2WTE A;  3FK6 A;  2JA5 J;  4Z6Y A;  1ZAO A;  4L9N A;  4BBR J;  4BKX A;  1YJW I;  2PJR A;  3ZPL A;  5E1W A;  3KEQ A;  2HDC A;  5AIQ A;  1MMG A;  4BJ5 C;  2B0L A;  2BBY A;  4IPA A;  4OAY A;  4BEH B;  3B6C A;  1DPU A;  2Y48 A;  1BI0 A;  1Z3X A;  2CFO A;  4XN0 A;  4Q5S F;  4FQG A;  4Y52 J;  2LY9 A;  2ZXH A;  2ZKZ A;  3BOQ A;  4HZF A;  4AYB A;  3OS2 A;  2JA6 J;  2W7N A;  4NDL A;  3VOD A;  3WGI A;  2CQK A;  4KIF A;  1Z1D A;  4C3H J;  3O8G A;  2STW A;  1TW3 A;  2AXL A;  2VBX A;  5HOD A;  2EBI A;  3CUO A;  4ZYE A;  3TW7 A;  4N4O B;  4JP0 A;  4HNV A;  2YU9 J;  2KLO A;  1R9T J;  3KZI C;  1VI0 A;  2EFQ A;  3GFJ A;  3CJR B;  3DCF A;  1NTC A;  2V6C A;  4IOA F;  2K85 A;  2LKS A;  3ROU A;  5L3F A;  1W36 C;  3H0G J;  1RIO H;  3S1Q J;  2HXI A;  2XF7 A;  4HQE A;  2QYO A;  3Q5F A;  4DOZ A;  1SC7 A;  1UHS A;  2KPM A;  4V2G A;  4I0A A;  4ZC3 A;  4XKB A;  2CJJ A;  3RDI A;  5EZH A;  1IJW C;  1YIO A;  2GWR A;  1DU6 A;  3E97 A;  1EJ9 A;  5LBQ A;  3IP4 B;  4ESJ A;  4PJ0 C;  1R49 A;  1U78 A;  2VKH A;  2RQP A;  5F04 A;  5K5R A;  4QPO A;  4G7Z F;  2F5D A;  1I6H J;  3SHF A;  2PMZ A;  3RQ4 A;  3OYJ A;  5JI6 A;  3ABK H;  4B1R A;  4EGZ A;  2XKO A;  4U88 A;  3LNQ A;  2CS3 A;  1IW7 F;  3WHC A;  1MZB A;  1U6G A;  4UV8 A;  1SMT A;  3S2W A;  1A6Q A;  3HIF A;  3K4B A;  3BR2 A;  4A3G J;  2CQN A;  2VQL A;  4MGR A;  1R5H A;  1MKM A;  1HW5 A;  3IRQ A;  1TC3 C;  4S0H B;  3S15 J;  5FFX A;  2CU7 A;  1GHC A;  1FBQ A;  1D5Y A;  4Q4Z F;  1J5Y A;  4A5N A;  1R4N B;  1Y8R B;  2XGD A;  4B47 A;  1APL C;  4D5F A;  4R1H A;  2ELJ A;  4GXO A;  2VT3 A;  2HXO A;  3JAM K;  1MDM A;  4M9X A;  3I5U A;  4MNU A;  3ZMS A;  2RGV A;  4ANJ A;  4F52 A;  4LK1 F;  3OWT A;  3CCV I;  5F6F A;  1FYK A;  4L5I A;  3MZ8 A;  2KIM A;  3FWE A;  4Y3O A;  3T0Y A;  1B9M A;  3S3O A;  2R7S A;  2R0Q C;  4OMZ A;  4XQF A;  1CQT A;  1ZEL A;  3H5R A;  4C9Y A;  5IPA A;  2WAE A;  2W48 A;  1VF9 A;  3P5J A;  5AIP A;  1WFX A;  3A2K A;  3BLY A;  1FTZ A;  4HNT A;  3WTW C;  3H0D A;  1GV5 A;  1T6S A;  4RAZ A;  4EV0 A;  2PG4 A;  5K1Y A;  2F48 A;  2P5V A;  1DDN A;  3LSK A;  1XPX A;  1XSV A;  4RMN A;  3JRB A;  4BQN A;  4E7K A;  1QRY A;  2NAZ A;  4LLN A;  1WI3 A;  3KP4 A;  4BU2 A;  2HQA A;  2JWT A;  1YJN I;  3ZMT A;  3GTG J;  3TO9 A;  2R4G A;  5DM6 F;  4MQV A;  4IKF A;  5GAD J;  3CMY A;  3ZR8 X;  2DQL A;  2F2E A;  5ILS A;  2P8T A;  5KCM A;  1R7J A;  1VQK I;  4E7J A;  2AXT C;  1NG7 A;  2X1D A;  2WB1 A;  3BDD A;  4A93 J;  2DK5 A;  3I56 I;  4DBQ A;  1Y8Q B;  5GAH J;  4JK1 X;  1WJD A;  2KP6 A;  1TT0 A;  3F8C A;  2KHM A;  4RS8 A;  4BH9 A;  2O7O A;  4A6D A;  1AWC A;  1FTT A;  1ULY A;  2JUC A;  1Z67 A;  4PSX A;  1RNL A;  1KU9 A;  2J5P A;  2XRO A;  4PFO A;  2ELH A;  4I02 A;  1OQY A;  2WAF A;  5HS9 A;  3G1M A;  2I5U A;  3M1E A;  4ZYH A;  3IH3 A;  2VAS A;  5ERI A;  2L4A A;  5EEH A;  5J6X A;  2BGC A;  5LRS A;  1TNT A;  4L5E A;  2Y69 H;  1FSE A;  1W5C C;  3OY9 A;  4BJT A;  4ESF A;  2JPC A;  3DTK A;  2WWY A;  1TQM A;  3BJA A;  3V7S A;  1H8A C;  3SEZ A;  1YRN A;  3V42 A;  1U9N A;  2B7E A;  3S16 J;  3E6C C;  3J7A O;  1SVO A;  2HYF A;  3WOD F;  3WTS C;  3ABM H;  1YW8 A;  5FRO A;  4GDF A;  1Y1W J;  1QZZ A;  1PUF A;  2XDV A;  3P7N A;  1T8I A;  4KT5 C;  2XSJ C;  1JE8 A;  3LAJ A;  1T0F C;  2Z1D A;  5K7Z A;  2D1V A;  3RJP A;  3WTY C;  1QNT A;  2BHZ A;  3FBN B;  4BAY A;  5M3M J;  1HCR A;  4AUX A;  1KQ0 A;  4LJZ F;  2XGC A;  2DW4 A;  4J01 A;  3MVP A;  2X1C A;  2ADU A;  3ZMV A;  2R7D A;  3F0C A;  1GT0 C;  9ANT A;  2IAI A;  2MFZ A;  1SD6 A;  3C2H A;  3FXJ A;  4OIR F;  4NNJ A;  1TZL A;  1E3O C;  1WZ2 A;  1FZP B;  2CG4 A;  2HZT A;  5TRD A;  4LG3 A;  1HC8 A;  2HTS A;  2NS7 A;  5J1R A;  3HG9 A;  3BJO A;  3KEY A;  2H1L A;  3LSI A;  4Q47 A;  1HW2 A;  2V1U A;  3DPU A;  2OZ6 A;  2F6C A;  4MLO A;  5BPI A;  4YIR X;  4L9J A;  2M34 A;  3R0A A;  2QEN A;  2V7F A;  3JR9 A;  3S2H J;  2BHY A;  1XMX A;  3HXL A;  1IN8 A;  4CUG A;  2WY7 Q;  3VYR B;  5TJJ A;  2EK5 A;  3EUH C;  2L02 A;  3AFH A;  4EM0 B;  5DM7 F;  2DMP A;  4L9V A;  2NXN B;  3F8M A;  2MC4 A;  2E2J J;  2JK3 A;  2VJJ A;  3FMS A;  1TQP A;  2G7H A;  3LA2 A;  3QYB A;  2QBY B;  2VBY A;  1FOW A;  3AAF A;  5HS7 A;  3ZQ7 A;  3LSM A;  4BHC A;  1LFP A;  3RKW A;  4B4C A;  3CMA I;  3X2Q H;  2VOO A;  3EDP A;  2KRH A;  2VLA A;  2AS5 F;  2DA4 A;  2GA2 A;  4PGH A;  2IP2 A;  4HAM A;  2R7T A;  2JVG A;  3HM5 A;  3LQQ A;  2X4H A;  3JRF A;  4HOB A;  2HS5 A;  5D6F A;  2DA2 A;  2GBY A;  2NS8 A;  2OQG A;  4XOT A;  3H3U A;  1W7P A;  4WK8 F;  3OYE A;  3NEU A;  3ELK A;  2DDB A;  2XRN A;  3IKV A;  5DD4 A;  1MDM B;  1UB9 A;  1MMN A;  3S1M J;  3MFK A;  4CCO A;  4DYR A;  2LLK A;  4I7H A;  3K4L A;  1KU3 A;  2JA2 A;  2LF7 A;  2OA4 A;  4KMU X;  2DT5 A;  2P7V B;  3C2B A;  5B1A H;  5CJ9 A;  1QA6 A;  1D1A A;  5LHG A;  2VKE A;  3QP5 A;  3WE2 A;  2VQH A;  1J75 A;  3JRG A;  5LGT A;  4ZYD A;  4UUS B;  2WC2 A;  3BT9 A;  1KYZ A;  2Z99 A;  3GXO A;  1R58 A;  2LY2 A;  4YII A;  2LKX A;  3PFI A;  3EUA A;  3BR5 A;  3L2V A;  1VQ4 I;  1BW6 A;  2Z5U A;  2ZCW A;  2MW8 A;  4I76 A;  4PJJ A;  3FXM A;  2E35 A;  5FB2 A;  3PQJ A;  3RKY A;  4EJW A;  1JXS A;  4MFE A;  5J4Y A;  3LA3 A;  2LBF B;  3F23 A;  1VFC A;  4LD5 A;  3K70 C;  3J7A Y;  2G7U A;  3DWL E;  3I53 A;  1XN7 A;  1OCR H;  3OR2 C;  2OTL I;  4CYC B;  3DBR B;  1UEL B;  5GPA A;  4WXC A;  4BHB A;  4HF1 A;  2KRF A;  4XLN F;  2DFH A;  3Q0V A;  1FEX A;  3KP2 A;  3CCE I;  4YFN F;  1MBG A;  4MTD A;  2BY3 A;  4EJU A;  1IN6 A;  1VQN I;  2VKV A;  3FK7 A;  2FBH A;  1ERD A;  1U8R A;  2GZW A;  3RPU A;  1WJE A;  4NHJ A;  3DFG A;  1Z0X A;  4YEJ A;  1ORK A;  3KCC A;  5JVG F;  1EKE A;  3KYD B;  3OL4 A;  5GTH C;  2D1H A;  2JRM A;  6PAX A;  2XGE A;  1MW7 A;  2QBY A;  3FXU A;  2A6T A;  3BPV A;  2KDO A;  2W82 A;  2JTV A;  1AKH B;  3KP3 A;  3QYF A;  5GAG J;  5B3S H;  1QHG A;  1IG7 A;  2EH3 A;  2Y75 A;  4IHV A;  3J80 Z;  2MGQ A;  3MEX A;  3JRD A;  3EET A;  2FBK A;  4D1Q A;  3EPZ A;  3ASO H;  3L7W A;  4MTE A;  3CO6 C;  3ERM A;  3HRT A;  4XM3 A;  1IZ1 A;  2GXG A;  3KZZ A;  2DT7 B;  1DU0 A;  1TWC J;  2Y0S A;  2PMH A;  1U5T A;  2KJB A;  1ZLJ A;  2YX7 A;  2EFN A;  3T8R A;  1VZ0 A;  4UB8 C;  3PNV A;  2V6E A;  1OFC X;  4BE2 A;  4RLF A;  3K4K A;  2RVC A;  3DXJ F;  4J19 A;  1J9I A;  3F6O A;  3BC8 A;  3ZXS A;  4A12 A;  2QSG X;  4N9H A;  1BI1 A;  1BOA A;  3JRA A;  1YE9 A;  2CV0 A;  3BCA A;  3PO2 J;  2EZK A;  5GTI C;  4A3E J;  4PK4 A;  1WJF A;  4AIH A;  3S3N A;  4NB5 A;  2R7O A;  4XSX F;  5FD6 A;  1P2F A;  4M3B A;  1BR2 A;  2A3S A;  2PBI A;  1BC7 C;  3HOZ J;  4RAF A;  1AA7 A;  3CCJ I;  4FCY A;  1VQO I;  3WG7 H;  3K1P A;  3CP2 A;  4E70 A;  2FF4 A;  1USS A;  3PFY A;  3MKZ A;  4O5V A;  4XN3 A;  3JTG A;  2H09 A;  2HPI A;  2JUG A;  4YFX F;  1IN5 A;  1OYY A;  4DYQ A;  1JUM A;  2QKL B;  2COB A;  2P6T A;  1QQI A;  1BW5 A;  3SFZ A;  1MSF C;  2A6E F;  4P5O A;  5HLG A;  3GFL A;  2BXZ A;  3EUH A;  4UNO A;  3K7A J;  3L9F A;  2N8G A;  2IS4 A;  1LNW A;  3Q9S A;  2F4I A;  5DEQ A;  3BZK A;  2VE8 A;  3CCM I;  1L3L A;  4A3D J;  3L2W A;  4IRH A;  2LTP A;  2PFB A;  3DEE A;  2FU4 A;  2VJI A;  2LRD A;  1Z7U A;  4IO9 F;  5IY5 H;  1XGN A;  1IXC A;  4DNC A;  2G9W A;  3DKW A;  5ED4 A;  3J7Y J;  2A07 F;  3ZQC A;  4BDZ A;  3ZN1 A;  1B8I A;  3HOS A;  2XPW A;  3VYT B;  2WY8 Q;  2PEX A;  1BA5 A;  2DOE A;  3K1N A;  1XX5 A;  3DBL B;  3A01 A;  3RPQ A;  1JGG A;  3TDU C;  4M9Z A;  1GVD A;  1PP7 U;  1CGP A;  2CO5 A;  3NAR A;  4LFU A;  3CD6 I;  3OIO A;  5E3M A;  4ENJ A;  1QPM A;  4M74 A;  1Q1V A;  3CUQ A;  5D4S A;  4DBR A;  3OYI A;  1K4S A;  2DU9 A;  4IRI A;  3GFM A;  3KP7 A;  4C2U A;  1KU2 A;  2COM A;  2ACJ A;  2HQN A;  2M7B A;  4A3J J;  1OIS A;  3QRF F;  4Y4R A;  5B66 C;  1CF7 A;  4I98 B;  1ZTR A;  5K7F A;  2NVU B;  3LWF A;  2BW3 B;  4F93 B;  1UHW A;  1K4T A;  2OUM A;  2V9V A;  3P9C A;  4XKC A;  2XAF A;  4B43 A;  3IAM 2;  3I58 A;  4B8X A;  2X1E A;  4CZC A;  3KX2 A;  4I99 C;  4KUM A;  4XSZ F;  2ZNZ A;  2VI6 A;  3PM1 A;  5IYD J;  4CGZ A;  5E79 C;  1HBX G;  2M4K A;  4HNU A;  5LGU A;  2IA2 A;  3LMM A;  2FE3 A;  2JA7 J;  2JPB A;  4HX7 A;  4A6E A;  2X51 A;  3F8F A;  2DOA A;  4C3J J;  3I71 A;  2GLO A;  2IRF G;  3F8N A;  4HDV A;  5E18 F;  3GFI A;  3PNT A;  3ZMU A;  2EIJ H;  3GO5 A;  1IDZ A;  5D6E A;  3F3X A;  3I59 B;  2RRE A;  4G6T B;  2L9V A;  2VPR A;  3ECH A;  1ON1 A;  1XTA A;  2LDU A;  3E1S A;  2LRE A;  4ENM A;  4EAT A;  4D5C A;  3H9G A;  5D5W B;  2DJI A;  3DEU A;  3UNG C;  5E8G A;  2I8D A;  4F3Q A;  4RAG A;  2XSD C;  2DFE A;  1YG2 A;  2HWV A;  2HEO A;  3FKJ A;  3K4N A;  1RES A;  2KMU A;  4UVB A;  1V55 H;  2FD5 A;  3QOE A;  4E7H A;  2CQX A;  3RIR A;  4C3I J;  1MMD A;  4FET A;  3SJM A;  2VXD A;  2RNJ A;  3HHG A;  2A5W A;  1OCZ H;  2OPT A;  2ZXJ A;  4AIJ A;  3AKZ A;  3OOU A;  4MEY F;  3BG6 A;  1NHA A;  2TRT A;  4QTR A;  2A5Y B;  5D8L B;  4KN7 X;  1ETQ A;  1Y56 A;  2JSC A;  2PX9 A;  4DZP A;  1I27 A;  3HOT A;  1QO0 D;  3K4M A;  5E17 F;  2ZO4 A;  2XGX A;  3BTI A;  3FKI J;  2D2W A;  4CO8 A;  2ZSH B;  4A0X A;  3ZQL A;  2IA0 A;  2BEO A;  1PVE A;  2RNG A;  1QHH D;  3OMY A;  5J4V A;  5L3G A;  4IHS A;  3D0S A;  1POG A;  1X1B A;  1WJC A;  5L3B A;  5BMZ A;  3QU6 A;  2CUE A;  2IBD A;  1G59 A;  2R5Z A;  4XLP F;  2JQ7 A;  5FGM A;  1LDJ A;  5E3L A;  1I50 J;  1X1D A;  2IGN A;  5JHF A;  2B63 J;  2HZD A;  2LK2 A;  1R1T A;  2EPF A;  3OYG A;  1S7O A;  3IUO A;  2EWN A;  4JX4 A;  4ON0 A;  2QZ8 A;  3MZH A;  2MD5 A;  3JTH A;  1AHD P;  2FQ4 A;  2P0W A;  2L9S A;  3D5S C;  1IRF A;  5TGT A;  1HDP A;  3S93 A;  2NOG A;  4LK0 F;  5IT3 A;  1K7A A;  3HGY A;  2RAE A;  2MC3 A;  3DP7 A;  3HRS A;  4MO7 A;  2KJC A;  4GYI A;  3VPR A;  5E20 A;  1FY7 A;  3LQR A;  4FT8 A;  2FXA A;  1B72 B;  1R23 A;  1G6N A;  3REO A;  1X19 A;  2P4W A;  4RM2 A;  3J81 Z;  2KZV A;  4UUV A;  1BI2 A;  1FJL A;  1RC9 A;  1R22 A;  2VXZ A;  2W1O A;  4RGU A;  4RBO A;  3HTU A;  2Z2S B;  1P4W A;  3SDB A;  5LLQ A;  2WV1 A;  3OIP A;  3K9T A;  5FD5 A;  2WV0 A;  4J00 A;  2DMU A;  3L2U A;  5LRR A;  1H9G A;  2K5C A;  1KZH A;  3LFU A;  2MBF A;  2R7F A;  3WG9 A;  3DBH B;  1O7F A;  2ISY A;  3CCY A;  2QVO A;  4UUT A;  3MZY A;  5HVQ C;  4NQW A;  2DFI A;  2EZI A;  4DYC A;  3BWG A;  1YO5 C;  3K4C A;  3FXL A;  5D5U B;  2RN7 A;  2YUS A;  3CME I;  5BOX A;  2HVS A;  1WRJ A;  2DI3 A;  2HYG D;  2QWW A;  3TOA A;  5IP7 J;  3U1K A;  2JZY A;  4B09 A;  2JA8 J;  1RPW A;  2O0Y A;  3PIP F;  4RB3 C;  3OL3 A;  3FXO A;  3H5A A;  4S04 A;  3TW6 A;  4G8X A;  1IN4 A;  4U7B A;  3OS0 A;  3ABU A;  2DPU A;  3HEF A;  2IJL A;  3CMM A;  1DGR M;  2HDW A;  3VFZ A;  2PMU A;  4BS9 A;  5FLM J;  3CCQ I;  1K6O A;  1V4R A;  3K2A A;  4XR6 A;  1HKS A;  2BZT A;  4OAZ A;  5IT9 K;  2M7A A;  5LFA A;  1R6R A;  3K2Z A;  5FRM A;  3CC7 I;  4XLH A;  1FOX A;  1A35 A;  3R0J A;  5M5Y J;  3PUF A;  1R1U A;  2E36 A;  4HG2 A;  3PL8 A;  1BR4 A;  3NWT A;  4QPQ A;  5EEG A;  2YPR A;  4Y17 A;  1Y6I A;  3FXR A;  5FRN A;  5JLW A;  1JTX A;  2LOO A;  3GZ6 A;  3OSF A;  4KDP A;  1KQ9 A;  1OCP A;  1K79 A;  3M9A A;  4FHT A;  4MFD A;  3HKZ N;  1SVM A;  4HST A;  2R7V A;  2VBW A;  5H6R A;  4JQF A;  3S32 A;  4MHG A;  4KIG A;  3I64 A;  1LQ1 A;  1D8K A;  1ZH5 A;  1I1S A;  1ZK8 A;  2QCO A;  2QQ9 A;  4JX6 A;  2HOE A;  3RPU D;  5C44 J;  2JMW A;  2X85 A;  2VKD A;  2QF7 A;  2BY1 A;  2H6C A;  3S1R J;  1VQP I;  4A2U A;  4Y13 A;  2M0C A;  4PSW A;  5CVI A;  1YS6 A;  3KFW X;  2DYS H;  3V8J A;  1B9N A;  2K9M A;  3J81 K;  3NAU A;  2JN6 A;  2XHK A;  5F27 A;  1TTY A;  4OMY A;  1H9T A;  3HZJ A;  4RAY A;  2ZJP F;  2NNY A;  1WPK A;  1I6X A;  4ETS A;  1SD5 A;  1MJA A;  3GBG A;  1ZRC A;  2DTZ A;  1MMA A;  4A3C J;  3RZO J;  4IZZ A;  2V79 A;  3A03 A;  3EQL F;  1IRG A;  3BQY A;  5HS8 A;  1QPI A;  3COA C;  2Y2Z A;  1MNM C;  1OJL A;  4RM3 A;  2VUM J;  4XBF A;  1F36 A;  1ZRF A;  2KFD A;  4Y7N J;  5IYC J;  1XSX A;  3OV8 A;  4P9U A;  1SEU A;  2QQB A;  1RR7 A;  3DKX A;  1WQ2 A;  1IV8 A;  3E5X A;  2H1K A;  1UJ8 A;  2E34 A;  1EH8 A;  3A0H C;  2STT A;  4G6Q A;  1YHQ I;  2EIN H;  4HX8 A;  3MMY B;  4NC6 A;  5H20 A;  3SZG A;  4LMY A;  3GUD A;  2XVC A;  5E1X A;  3W2W A;  1D5V A;  4YG2 F;  1ETK A;  2MAB A;  5EF6 A;  3H5N A;  3M8J A;  3HOX J;  1X3Z B;  2XF5 A;  5E3O A;  1VQ7 I;  2YR2 A;  4I09 A;  1T0F A;  4XOR A;  1WJB A;  2EFW A;  1U9O A;  2HYJ A;  5F1R A;  4EVI A;  5J40 A;  2IEK A;  3B6A A;  3EUK L;  3O8H A;  5M5X J;  1KQ8 A;  4PUS A;  4KMF A;  3IV5 A;  2HOS A;  5F0C A;  5HOO A;  3WTU C;  3U21 A;  4BY7 J;  4EM2 A;  4XIC A;  1ZLK A;  2RKH A;  1AOY A;  1YW9 A;  3BP8 A;  3NRV A;  4EJV A;  1ZGA A;  5KK1 A;  2LMD A;  2X0L A;  4U87 A;  1ETW A;  1LFU P;  2R7X A;  4R79 A;  5GP9 A;  2VOP A;  2AQE A;  2E60 A;  4XON A;  1ETV A;  4B48 A;  4OIQ F;  2VT2 A;  4KIT B;  1YI2 I;  2F4O B;  2ZC2 A;  3BTC A;  4CCM A;  5F0H A;  4D0P A;  3S8P A;  4G94 A;  4L9T A;  4AM3 A;  3VWB A;  5EG0 B;  2MG4 A;  3BTJ A;  1X58 A;  3ZOB A;  3CTA A;  1ETY A;  2FQ3 A;  1QVT A;  2E1M B;  3RKQ A;  1FIP A;  4I0B A;  4LLG F;  3R4K A;  3CJQ B;  1IUF A;  4PJM A;  3GYH X;  3ECO A;  2EQR A;  1IDY A;  4M3F A;  3M4O J;  4YRV A;  1VQ8 I;  1IRX A;  1BJA A;  2DFF A;  4C2T A;  2V9P A;  1I3Q J;  2BE5 F;  4DJA A;  1FNN A;  4XKW A;  2IXS A;  2IVM A;  3E7L A;  4WXD A;  3QPL A;  4MQ9 F;  2OZU A;  4D7M A;  1Z3Y A;  3W6K B;  4P9F A;  1CF7 B;  5J47 A;  3SFI A;  3G71 I;  4OIO F;  4JX5 A;  4CYC A;  3LAP A;  1R5G A;  3W3C A;  4HLY A;  1HW1 A;  1S3J A;  1XCV A;  1Z21 A;  3F6V A;  1S72 I;  2R92 J;  1SD7 A;  3MCZ A;  1BC8 C;  2DJN A;  2LP0 A;  3VYS B;  5JFR A;  3ZQG A;  2ECB A;  3DQV C;  5J1U A;  1XS9 A;  2OTJ I;  2OAZ A;  4M3E A;  5F1J A;  2ZJQ F;  5LEK A;  1I1G A;  4GO1 A;  3WTV C;  1E17 A;  3FZV A;  2ISZ A;  5FKK A;  3G73 A;  1RUO A;  2E5Z A;  2FBI A;  2EFO A;  2KIF A;  3FIW A;  2QGU A;  3WTT C;  1X3U A;  1OKR A;  3ZQQ A;  4H0E A;  2HQR A;  1R4M B;  2FX0 A;  5HDN A;  5D4R A;  3PNY A;  5AON A;  4L0Y B;  4LIT A;  1PJR A;  3H3V K;  5H6Q A;  1G3S A;  5B5E C;  2UZK A;  4I01 A;  5E1Z B;  1D1C A;  1EA3 A;  3K69 A;  1JTY A;  3MKL A;  1HQC A;  3JW4 A;  4ZTJ A;  2L7F P;  3WGH A;  5ICF A;  1ZKG A;  3JRH A;  4A5M A;  2GIV A;  4GYG A;  4LB5 A;  3GZ5 A;  1RZ4 A;  4Z2Y A;  1ZGJ A;  2RV8 A;  3D5L A;  2QLZ A;  5EEA A;  3HDD A;  1N77 A;  1N75 A;  1B6A A;  1KA8 A;  1U5T C;  2ZME B;  3I4P A;  5D8K B;  3BRO A;  1BL0 A;  1ITY A;  1MSE C;  3ZGK A;  1ZG3 A;  2XRL A;  3E6B A;  1UG0 A;  3CCR I;  3BR1 A;  1VTN C;  5DUK A;  4I6Z A;  1EF4 A;  2H27 A;  4FE4 A;  1SFE A;  2HVR A;  3HOV J;  2IS2 A;  1A5J A;  3F21 A;  2Q1Z B;  1MNE A;  4EJO A;  1XB4 A;  5KNL A;  2P5K A;  4FAS D;  1U8B A;  3L09 A;  3RCO A;  2E1C A;  5BNG A;  3KP5 A;  4IRG A;  4NBQ A;  3SDG A;  3T1B A;  1WSU A;  1JHF A;  1ZN2 A;  5DDG A;  5HLH A;  4ZZL A;  3F8B A;  1SAX A;  5CPR B;  3A4C A;  3MWM A;  3O2P E;  3TO6 A;  5DD8 A;  3KIO A;  3AL0 C;  5C4X J;  1LFB A;  1LPQ A;  2XB5 A;  1QGP A;  1O3R A;  4AU7 A;  2R5Y B;  3M1C A;  4BDY A;  2V9K A;  1SVL A;  2HKX A;  4E7Z A;  5E3N A;  4XLA A;  3TQN A;  4NC7 A;  4IVN A;  4XRS A; 
#chains in the Genus database with same CATH homology
 2K9N A;  1WGX A;  2ID6 A;  4X6A J;  1RKW A;  2VPR A;  1MBH A;  2CQQ A;  4B1R A;  3RQI A;  3LNQ A;  4QSH A;  4D5C A;  2PMZ N;  3WHC A;  2LD5 A;  2XSD C;  3A01 B;  5EGO A;  1RES A;  2HOT A;  3HB9 A;  2D5V A;  2FD5 A;  2Y30 A;  3BR2 A;  4A3G J;  4BXX J;  2CQX A;  3Q0U A;  2ECC A;  4C3I J;  3SJM A;  2K9Q A;  1TC3 C;  2G0E A;  4S0H B;  3S15 J;  2CU7 A;  1D5Y A;  3UKG A;  1OCT C;  2XGD A;  2OPT A;  2HQ5 A;  1FIA A;  1APL C;  4D5F A;  4BBS J;  1X2N A;  4W1U A;  2HXO A;  3OOU A;  1JKR C;  1WH7 A;  1SFO J;  5IYB J;  1Z77 A;  4QIW N;  5EG0 A;  3BR6 A;  1H88 C;  2TRT A;  4QTR A;  2NVQ J;  1ETQ A;  4DZP A;  2R0Q C;  1TWF J;  1CQT A;  1UMQ A;  3WHB A;  5IPA A;  1JJ8 C;  2W48 A;  1VF9 A;  3GTJ J;  3BTI A;  3FKI J;  1NK2 P;  1FTZ A;  1XG1 A;  3ZQL A;  1GV5 A;  1O4X A;  1POG A;  5IOZ A;  2Y9Z A;  4ABZ A;  5FKO A;  1IRZ A;  3JRB A;  1QRY A;  3BG3 A;  2CUE A;  2IBD A;  2R5Z A;  1WI3 A;  2K40 A;  3TP0 A;  3HOW J;  2NVT J;  5E3L A;  2JWT A;  1I50 J;  4MIM A;  3GTG J;  2EZH A;  2B63 J;  3CMY A;  4G12 A;  2LK2 A;  2WB1 N;  3HOY J;  4JX4 A;  5FKL A;  3LSR A;  1AHD P;  1ETO A;  2FQ4 A;  2XPV A;  1XC5 A;  1TWA J;  1IC8 A;  4A93 J;  1HDP A;  2NVX J;  2NOG A;  3HGY A;  2RAE A;  3M3Y J;  4MO7 A;  5FKM A;  3TP3 A;  3VPR A;  2OF7 A;  2O7O A;  1FTT A;  1B72 B;  2L0K A;  3A02 A;  3LSG A;  4M3D A;  2ME0 A;  1H89 C;  1FJL A;  4RBO A;  3ZQH A;  3G1M A;  1JKP C;  1MBK A;  3IH3 A;  2WV1 A;  3I4M J;  1QVU A;  2DMU A;  4XK4 A;  2CUF A;  4IHY A;  2L7M P;  4L5E A;  1YRN B;  3BG5 A;  1MH4 A;  3JRI A;  2YS9 A;  1H8A C;  2JJ7 A;  3CCY A;  1YRN A;  4UUT A;  1U9N A;  2XB0 X;  3W6V A;  3S16 J;  4DYC A;  2EZI A;  2YUS A;  1Y1W J;  1PUF A;  5M3F J;  2ELK A;  3IH4 A;  5IP7 J;  3QQA A;  3MN2 A;  5IOY A;  5K7Z A;  4UUS A;  2JA8 J;  1RPW A;  1P7I A;  1HCR A;  1GUU A;  2AHQ A;  5M3M J;  4AUX A;  2XGC A;  4C2M J;  3TW6 A;  1NK3 P;  1T33 A;  3MVP A;  5FKN A;  3HEF A;  5FLM J;  3F0C A;  5JLX A;  2R7Z J;  1GT0 C;  3I4N J;  9ANT A;  2IAI A;  3Q0W A;  1E3O C;  3K2A A;  1G2H A;  2DA5 A;  4AC0 A;  2K9S A;  3DEW A;  2E19 A;  2NS7 A;  4A3K J;  3GTP J;  3IH2 A;  5J1R A;  2Y31 A;  1AU7 A;  1A6I A;  2R5Z B;  4MLO A;  2M34 A;  2M2E A;  3JR9 A;  3S2H J;  5M5Y J;  1JKQ C;  4M6V A;  1ETX A;  5FLV A;  2TCT A;  1B72 A;  1IV6 A;  2H8R A;  3RZD J;  2DMP A;  1WCM J;  2R93 J;  5JLW A;  1JTX A;  2E2J J;  2JK3 A;  3OSF A;  5J1Y A;  2Y9Y A;  1HDD C;  2X6O A;  1OCP A;  3QPS A;  4XRM A;  2M9H A;  3LSP A;  4MFD A;  3HKZ N;  3HOU J;  4GFB A;  1RET A;  1JT6 A;  5EGO B;  2ZB9 A;  4B4C A;  2LR8 A;  3GTO J;  1ZK8 A;  1JUS A;  3S14 J;  2QCO A;  2FJ1 A;  4JX6 A;  2DA6 A;  5C3E J;  3BQZ A;  4A3F J;  1IGN A;  2E2I J;  2DA4 A;  2P81 A;  5C44 J;  2JMW A;  1UG2 A;  1Y1V J;  2QF7 A;  3HM5 A;  3S1R J;  3JRF A;  2M0C A;  2DA2 A;  2GBY A;  2NS8 A;  3ZQF A;  1GV2 A;  3NAU A;  3S2D J;  2JN6 A;  5F27 A;  3Q3S A;  5FJ8 J;  1WPK A;  3S1M J;  2HI3 A;  2AO9 A;  3GBG A;  4DYR A;  2DTZ A;  5IP9 J;  2LLK A;  2DN0 A;  4A3C J;  4A69 C;  3RZO J;  5EZG A;  3A03 A;  5EYR A;  3BQY A;  3C2B A;  3ZQI A;  1QPI A;  4W97 A;  2VKE A;  4X1E A;  2HOA A;  3JRG A;  2Y2Z A;  4UUS B;  1MNM C;  1OJL A;  2I10 A;  5DTD A;  2VUM J;  5GPC A;  1F36 A;  3BT9 A;  2LKX A;  4Y7N J;  2O9L A;  1MBE A;  5IYC J;  2E2H J;  3BR5 A;  4A3M J;  1BW6 A;  1RR7 A;  2MW8 A;  4I76 A;  3LOC A;  3JRC A;  4MFE A;  2H1K A;  3GTL J;  3LSJ A;  4EEF G;  1VFC A;  2DA1 A;  2MSY A;  2KT0 A;  1F43 A;  1MH3 A;  4CYC B;  5GPA A;  1LE8 B;  2ME6 A;  3S1N J;  1ETK A;  4JYK A;  1HOM A;  3HBL A;  5EF6 A;  3HOX J;  1S7E A;  5J3L A;  5E3O A;  3Q0V A;  1FEX A;  1U9O A;  2HYJ A;  2CRG A;  4V2F A;  2L9R A;  1MBG A;  2IEK A;  3B6A A;  2VKV A;  3FK7 A;  2M8G X;  3O8H A;  5M5X J;  1W0T A;  1BJZ A;  1Z0X A;  3IV5 A;  1ORK A;  5F0C A;  5DS9 A;  2HOS A;  4BY7 J;  2XGE A;  3G1L A;  4XIC A;  4D7N A;  1GDT A;  1AKH A;  1B8I B;  3GTQ J;  3G1O A;  3HGG A;  1W0U A;  1AKH B;  1ETW A;  1LFU P;  5GP9 A;  1IG7 A;  2EH3 A;  5F0F A;  1HF0 A;  4IHV A;  1ETV A;  1MBF A;  2MGQ A;  3JRD A;  2Y0S N;  4IHW A;  2DMT A;  2E1O A;  3BTC A;  5F0H A;  4IHX A;  2WAQ N;  1DU0 A;  1TWC J;  4IEJ A;  5EG0 B;  2MG4 A;  3BTJ A;  1X58 A;  3ZOB A;  1ETY A;  1QVT A;  2DMN A;  3RKQ A;  3D1N I;  1FIP A;  3FIS A;  1PUF B;  1OFC X;  5F08 A;  1IUF A;  4AYB N;  1JKO C;  4M3F A;  2EQR A;  1IDY A;  4J19 A;  3M4O J;  1RKT A;  1TWH J;  3JRA A;  1I3Q J;  3TED A;  3PO2 J;  2DA7 A;  2EZK A;  1ZGW A;  2LFB A;  4A3E J;  3E7L A;  5M5W J;  3QPL A;  1MBJ A;  4D7M A;  2EZL A;  1WH5 A;  1HLV A;  3SFI A;  4M3B A;  4JX5 A;  3HOZ J;  4CYC A;  4FTH A;  4FCY A;  1TWG J;  2R92 J;  3GTM J;  1X2M A;  2DJN A;  2DMQ A;  4FIS A;  2LP0 A;  1ZR4 A;  3JRE A;  4DYQ A;  1JUM A;  3ZQG A;  2COB A;  2ECB A;  5J1U A;  5C4J J;  1XS9 A;  4DZJ A;  4M3E A;  5F1J A;  1BW5 A;  3CQZ J;  3GTK J;  1MSF C;  5IP6 A;  4B3A A;  5FKK A;  1LE8 A;  3K7A J;  2N8G A;  4FE7 A;  2R5Y A;  2XPU A;  2ID3 A;  4A3L J;  1JJ6 C;  3BR0 A;  3FIW A;  4A3D J;  2LTP A;  4A3B J;  3PO3 J;  2FX0 A;  2LVS A;  1ZR2 A;  4DW6 A;  4XRS G;  2O8K A;  4M3G A;  3ZQC A;  3H3V K;  3FK6 A;  1B8I A;  2JA5 J;  4BBR J;  4BKX A;  2XPW A;  1BA5 A;  1JUP A;  1JTY A;  3MKL A;  3A01 A;  4LOC A;  1JGG A;  2L7F P;  1P7J A;  1ZKG A;  3B6C A;  1GVD A;  3JRH A;  3NAR A;  1ZQ3 P;  4Y52 J;  2LY9 A;  3S17 J;  2JA6 J;  3OIO A;  3OSG A;  5E3M A;  1Q1V A;  4NDL A;  2X48 A;  2HDD A;  4C3H J;  3O8G A;  5EEA A;  1JT0 A;  3HDD A;  5HOD A;  2EBI A;  2L7Z A;  5K7H A;  1BL0 A;  3TW7 A;  1ITY A;  1SAN A;  1MSE C;  4JP0 A;  4HNV A;  4A3J J;  2XRL A;  2YU9 J;  1R9T J;  1VI0 A;  3BR1 A;  4I6Z A;  3L1P A;  1EF4 A;  1ZTR A;  2DA3 A;  3DCF A;  4FE4 A;  1NTC A;  5K7F A;  3HOV J;  1A5J A;  2GM4 A;  4A3I J;  3H0G J;  1U8B A;  3S1Q J;  2HXI A;  1UHS A;  4V2G A;  5BNG A;  3SDG A;  3BG9 A;  2CJJ A;  5EZH A;  1IJW C;  4RDU A;  1ENH A;  1K61 A;  3BTL A;  2X9D A;  3CDL A;  3PM1 A;  2VI6 A;  5IYD J;  2NVY J;  1K83 J;  1DU6 A;  1T56 A;  4XID A;  1VND A;  2JA7 J;  5C4X J;  1LFB A;  4BY1 J;  2XB5 A;  4C3J J;  5EDN A;  2R5Y B;  1U78 A;  2GLO A;  5F04 A;  3BR3 A;  2KDZ A;  5E3N A;  1IDZ A;  4XRS A;  1I6H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...