2R5ZB

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zB00
2QF7A 1OCTC 1U78A 1MBEA 3BTCA 2HOSA 5FLMJ 5DS9A 1APLC 2HDDA 2DA6A 4JX4A 3S2HJ 2EH3A 2EQRA 2LP0A 4DYCA 5K7HA 2LD5A 1JTXA 1WCMJ 5JLXA 2JA6J 2DMTA 1FJLA 3JR9A 1TWCJ 2DA7A 1Q1VA 3HOZJ 3LSRA 3GTLJ 1U9OA 4V2GA 3TP3A 4A3MJ 4MIMA 3HGGA 4ABZA 3S1NJ 3JRGA 3RKQA 1UHSA 2XSDC 3DCFA 4BY1J 1W0TA 3E7LA 3WHCA 4DW6A 3S15J 1DU6A 3Q0WA 1MSFC 4J19A 1JKRC 2FD5A 3ZOBA 5HODA 5BNGA 1IRZA 2JMWA 3I4NJ 3JRFA 2K9QA 5K7ZA 3BR0A 1LFBA 1WGXA 1EF4A 2R5YA 2XGEA 1IC8A 1JUMA 2X6OA 3QPSA 5IYDJ 4C3IJ 3TW7A 3B6AA 2HOTA 1MBFA 1U8BA 3GTGJ 4A3EJ 2MSYA 2MG4A 4FTHA 1UMQA 2AO9A 2HYJA 3GTPJ 1ZTRA 3MVPA 1XG1A 3HEFA 2Y2ZA 1JT0A 1A5JA 2R92J 1OJLA 1GDTA 3A01B 5F08A 4AC0A 5IP6A 5IYCJ 2ECBA 2ELKA 1OFCX 2WV1A 3OSGA 2FJ1A 3BTIA 4AYBN 1TWFJ 1UG2A 2WAQN 1AKHB 1WI3A 5GPCA 2E2IJ 2YU9J 3JREA 2NS7A 4C2MJ 1YRNB 3I4MJ 2LTPA 2W48A 3A01A 2ID6A 2N8GA 2ID3A 1HF0A 5EYRA 1RPWA 1ETXA 3ZQLA 3LSPA 2JA5J 3F0CA 1NTCA 4XIDA 4HNVA 4A3JJ 1JJ6C 4UUTA 2FQ4A 2M9HA 3Q3SA 3BR1A 4XRMA 1AKHA 3LNQA 4CYCB 4A3BJ 2QCOA 4BBSJ 2FX0A 3OSFA 4C3HJ 2G0EA 2Y30A 1YRNA 2NVQJ 3O8HA 2COBA 4XK4A 2O8KA 2R93J 4A3KJ 4MFEA 2EZLA 2DN0A 3BQZA 3JRIA 5FKOA 1IDYA 2LFBA 5DTDA 2XPUA 3FK6A 2JWTA 1IJWC 4V2FA 1S7EA 2DA4A 3HB9A 3A02A 4CYCA 1ETYA 4A3DJ 4LOCA 1PUFB 4G12A 1OCPA 4D5FA 1IDZA 1AHDP 1X2MA 1NK2P 2X48A 1F43A 3BR5A 1IG7A 3S2DJ 3HOYJ 1R9TJ 3ZQGA 2NVYJ 4I6ZA 1BW5A 1Y1VJ 2JA7J 1FIAA 1MBJA 2M8GX 2GM4A 4MO7A 3BR2A 2CJJA 2XB5A 2L7FP 3S16J 2R5YB 5EDNA 2B63J 2O9LA 2M0CA 1ETKA 5E3NA 1LFUP 1PUFA 2L7ZA 2Y9YA 1ORKA 5F1JA 4XRSG 3QQAA 3BT9A 1JTYA 1I3QJ 4XRSA 2XGCA 4DZPA 2VKVA 3GTQJ 2CUFA 1QRYA 1HCRA 4A3LJ 4A3FJ 2YS9A 3JRDA 2DA2A 2TCTA 1H8AC 2EZHA 1ZKGA 2M34A 5C4JJ 4UUSB 3FK7A 3CCYA 1WH5A 3GTOJ 1POGA 2AHQA 5IYBJ 3MN2A 4AUXA 4FE4A 1ENHA 2ECCA 1TWAJ 2LY9A 3HKZN 4FISA 2NVTJ 3H0GJ 3BR3A 1FIPA 3D1NI 1XC5A 4FCYA 4XICA 2CQQA 2L9RA 2WB1N 1ZK8A 2DA5A 3HOVJ 4M3DA 3CDLA 3NARA 1GUUA 5M3MJ 4BBRJ 1HDDC 5E3MA 4UUSA 2JK3A 4I76A 4X1EA 1HLVA 3M4OJ 1BJZA 1IUFA 4JYKA 4S0HB 5GPAA 3HOUJ 1F36A 1X58A 5M5YJ 5EEAA 1MBKA 4B3AA 2LKXA 2CQXA 1W0UA 1JT6A 2RAEA 4W97A 3W6VA 1RR7A 5IPAA 4BKXA 2VPRA 1JKOC 1MBHA 2ME0A 4JX5A 4D5CA 5J1RA 3QPLA 2D5VA 1FEXA 3SFIA 5K7FA 1HDPA 1SANA 4MLOA 2OF7A 1ETQA 1XS9A 1QVTA 2ZB9A 4JP0A 1CQTA 4IEJA 4EEFG 1A6IA 3L1PA 3HDDA 4C3JJ 4X6AJ 1K83J 5C4XJ 3O8GA 5FKLA 3OOUA 5EG0A 5F0CA 5IP7J 3IV5A 3FIWA 2K9NA 3HGYA 1LE8A 2IAIA 3M3YJ 1VF9A 2R5ZB 2HI3A 1JUPA 4MFDA 5FLVA 4M3FA 5J1UA 2XGDA 5FKKA 1ZR2A 1P7IA 3LOCA 3JRHA 4M3BA 5GP9A 1BL0A 1TWHJ 2CU7A 2DMQA 1GV5A 1RESA 1ETOA 3BG3A 2YUSA 2OPTA 1GT0C 4IHYA 4A69C 2XB0X 1JKPC 1IGNA 2EBIA 2PMZN 3DEWA 4DYRA 3HOXJ 2IEKA 4B1RA 2R5ZA 3RZOJ 3LSGA 4Y52J 2XPWA 2TRTA 1JGGA 3HM5A 4FE7A 3ZQHA 3BQYA 3HBLA 1ETWA 3BG5A 3SJMA 5C3EJ 2DMUA 2GLOA 1JJ8C 3G1OA 1B72B 1B8IA 5F0FA 2GBYA 3MKLA 3JRBA 3ZQFA 3S14J 2Y31A 3S1RJ 2E2JJ 1E3OC 5F04A 1ETVA 3BG9A 1MSEC 1RKTA 1T56A 1QPIA 1TC3C 1GVDA 3S1QJ 4D7NA 2L7MP 4QIWN 1ITYA 2E1OA 2NS8A 4JX6A 1WPKA 3RZDJ 1H88C 1B72A 2P81A 2H1KA 3H3VK 3Q0VA 3TEDA 5EZGA 1HOMA 3ZQIA 4M6VA 5C44J 1QVUA 5EZHA 5E3OA 3HOWJ 1I50J 1Y1WJ 2L0KA 1D5YA 3VPRA 1BA5A 2I10A 1TWGJ 3PM1A 2HXIA 4M3GA 3SDGA 3JRAA 1X2NA 1MNMC 4A3GJ 5JLWA 1GV2A 4QSHA 5FJ8J 2VUMJ 1P7JA 2JA8J 1WH7A 3ZQCA 3RQIA 5E3LA 3GTJJ 2VKEA 4QTRA 1DU0A 2DMPA 1VI0A 3S1MJ 2DA3A 1SFOJ 3K7AJ 2E19A 4L5EA 2LLKA 4D7MA 3GTKJ 3Q0UA 4A3IJ 1FTTA 1ZR4A 2DJNA 3FISA 2X9DA 1U9NA 2KT0A 9ANTA 2CUEA 5EG0B 5J1YA 1RKWA 4DYQA 2E2HJ 1O4XA 3CMYA 2H8RA 1IV6A 5F0HA 2DA1A 1T33A 2Y0SN 3C2BA 2DMNA 1LE8B 3B6CA 1RETA 3G1LA 1FTZA 2MGQA 2XRLA 3NAUA 1VNDA 5EGOB 2EZIA 1JKQC 3TW6A 4IHXA 3OIOA 3BR6A 2JN6A 1G2HA 5IP9J 3FKIJ 5M5WJ 2HXOA 3IH4A 2KDZA 2R0QC 3UKGA 2XPVA 3K2AA 3PO3J 2R7ZJ 2LK2A 4RDUA 2DTZA 2NVXJ 1K61A 3BTLA 4IHWA 1Z77A 3A03A 2O7OA 5IOZA 4M3EA 2VI6A 4B4CA 2HOAA 5F27A 3GTMJ 4DZJA 4A3CJ 4A93J 5J3LA 2K9SA 4W1UA 3WHBA 1H89C 5EGOA 1BW6A 1B8IB 5M3FJ 2ME6A 4BY7J 1VFCA 3TP0A 1AU7A 4GFBA 5M5XJ 4Y7NJ 3PO2J 1JUSA 2LVSA 5EF6A 1MH3A 2M2EA 1ZGWA 2HQ5A 1I6HJ 1NK3P 2MW8A 4BXXJ 4RBOA 1ZQ3P 4NDLA 2CRGA 2EZKA 3GBGA 3IH2A 1MH4A 5FKNA 2Y9ZA 5FKMA 2IBDA 2NOGA 3G1MA 4IHVA 1Z0XA 3JRCA 2JJ7A 1MBGA 3CQZJ 3BTJA 5IOYA 2K40A 3IH3A 3S17J 2LR8A 3LSJA
chains in the Genus database with same CATH superfamily
2LREA 2QF7A 3K4KA 5CQEA 2AXTC 5D8LB 2A6EF 1MBEA 2V1UA 2EJRA 4HDVA 2E7WA 5J4YA 3I64A 1W7PA 2VODA 2D2WA 3F9KA 2RQPA 3SEZA 1VQKI 3CCMI 3QRFF 4ESBA 5B1AH 2R7QA 2JTVA 2LD5A 4RLFA 3PUBA 5K7HA 1JTXA 1WCMJ 1R23A 3TOBA 1XD7A 1QNTA 4CHUA 2DMTA 4IQ4A 4BXUA 2IS1A 3JR9A 3EYYA 1TWCJ 2CQ7A 1Q1VA 3M7GA 4P1WA 2X1CA 3HRMA 3LSIA 3GTLJ 1TW2A 3KP2A 1VQ8I 4A3MJ 3HGGA 4ABZA 3A0HC 2V1XA 4BY1J 4I02A 3CD6I 2O61A 4LFUA 1D1AA 3H92A 2ZSIB 3J80Z 3I71A 4DW6A 3J80K 3Q0WA 1BOAA 1YIJI 2HYGD 1XMAA 2PMHA 1WZ2A 1PDNC 3I54A 2Z16A 1OR7C 2K9QA 2RC4A 3G3ZA 3A1YA 3U9GA 4BE1A 1K6OA 1EF4A 4XR6A 2QQAA 1JUMA 5IYDJ 2E5ZA 2Y69H 2M4GA 2L4AA 5ICFA 3V8JA 4UHTA 1VQOI 1FYKA 2QKMB 1BI2A 2DCEA 4BEHA 5DUIA 2LDUA 3BP8A 2MG4A 1HBXG 1UMQA 2Z9OA 4NBQA 3OYCA 3E0JB 2ZCWA 2EFQA 1XG1A 2QZ8A 4UUVA 1D8KA 2X1DA 3KZZA 4B8XA 5LGNA 5FROA 4BS9A 1M1EB 1LVAA 4XONA 1VQ7I 1WFXA 5E8GA 3GMEA 2EV5A 5L3FA 4HSTA 1OISA 1XCBA 2KHMA 3L09A 1WSUA 1I5ZA 4M74A 4XLAA 4OWRB 4ON0A 3T0YA 4IHTA 5K5OA 3AL0C 4A6DA 1TWFJ 3F8MA 1S29A 1SC7A 4ENNA 5HDGA 2ZMEA 3HOSA 1BN5A 5GPCA 2E2IJ 3CMMA 3JREA 2NS7A 4J00A 2OUMA 2YR2A 1VQ4I 2IVMA 4C2MJ 2W48A 3A01A 1EV7A 2PJPA 4YELA 3R0JA 2GXGA 1FMWA 4KJZA 2L9NA 4NC8A 5FLXK 1LJ9A 2HKXA 1RPWA 2LBFB 2B7EA 3ZXSA 1MMSA 3IRRA 3KP4A 3CCEI 4HOBA 3CUQB 4UUTA 3Q3SA 3F8CA 3SXYA 2FMLA 1BJAA 1G3TA 2Q2EA 2XUBA 2FX0A 4BBSJ 4U7BA 3ABKH 2Y30A 1YS7A 1FSEA 4HPQA 4CICA 2CO5A 4BHCA 3BQZA 5K5RA 3JRIA 1U3EM 2A07F 2LFBA 3DEEA 4D1QA 2EV0A 1ZGJA 4IPAA 4CSWA 2X51A 3HB9A 5FB2A 1R5ID 4JBAA 5TJJA 4L18B 1ETYA 4LOCA 3M8JA 4Y13A 2ZFWA 3VSKA 2DK8A 1AHDP 4CCOA 1NK2P 2X48A 1F43A 2HVRA 3BY6A 4HW0A 1Z7UA 1ZG5A 2JA7J 5B5EC 1S3JA 2M8GX 4HF0A 4MO7A 1YX3A 5BMZA 2XB5A 3JTHA 3S16J 1ETKA 3OS0A 1PUFA 2L7ZA 2EIJH 4HNTA 1HSTA 3EETA 3TBIA 3KP6A 4GO1A 3FF5A 3IUOA 5KNLA 3BLYA 1H9TA 4RB1A 2M30A 1FYLA 4A3LJ 2A68F 2YS9A 4B47A 3QU3A 5ILSA 1J2XA 2TCTA 1SVMA 5J8CA 4LMYA 1ZREA 2QBYA 2XKOA 4BE2A 3CP8A 1R00A 4NNJA 1T98A 1ZKGA 2M34A 5DDGA 4UUSB 4NHJA 1J0RA 2DT5A 2XAGA 4RB0A 3SZPA 2C6YA 1IXRC 3FXMA 4IX7A 2AHQA 1ONVA 5IYBJ 2Z1DA 2JSPA 2K9LA 1T38A 2F5CA 5GTIC 2ECCA 2ISYA 3NQOA 3RDIA 2FQ3A 3HKZN 3JW4A 4FISA 3H0GJ 2MH2A 1FX7A 1SEUA 2CQQA 2DXIA 2M0MA 4XL9A 1XB4A 2DA5A 1FT9A 3AG3H 1E2XA 3NARA 1K79A 1KA8A 3GLXA 5DEQA 4BBRJ 1R1VA 3VYRB 3EYIA 2BGCA 4I76A 2F5VA 4X1EA 3M8FA 3WTWC 2HDCA 1ZH5A 1AOYA 3HOUJ 3GEZA 1F36A 5M5YJ 5EEAA 1MBKA 3IRQA 2QGUA 3GFLA 4W97A 2RAEA 4RMNA 2WB1A 3G71I 2IGMA 1JKOC 2ME0A 4ZYAA 2V9PA 4D5CA 2D5VA 3VB2A 3IKTA 1P6RA 5K7FA 2QENA 3K69A 3SZTA 5ICCA 2OF7A 2HTSA 1DGWY 2D45A 1RC9A 1X19A 4JP0A 2CW7A 4IEJA 2IXSA 3L2WA 3RIRA 3ECHA 3V4GA 3HDDA 2A69F 2AS5F 4WCGA 2FOWA 3AFHA 1F1ZA 1PP8F 4HBLA 2K3FA 3DKXA 1LE8A 1VF9A 2R5ZB 1XSVA 3H36A 4MTEA 4HYEA 4D0PA 5FKKA 5ICGA 1P7IA 1I6XA 2M87A 2A61A 1B9MA 4XN3A 5GP9A 3H9QA 1B59A 1GV5A 1FY7A 2M1BA 1UHMA 3OS1A 1Q1HA 1H9GA 3LQQA 2K3PA 1GT0C 2R7DA 2Z3YA 4UB6C 2XB0X 2EBIA 1GXQA 2ZC2A 4DYRA 4MEXF 3HOXJ 2GIZA 3E3VA 4Y52J 3A4CA 2R7WA 4EM0B 4P96A 3BQYA 1ETWA 3SJMA 4Z2YA 2DMUA 3H5NA 3MZYA 1B8IA 1WI9A 5F0FA 3DBRB 1YW9A 3MKLA 4NB5A 3JRBA 1EKEA 4CGZA 1Z7LA 4PCQA 4XORA 5F04A 2FNPA 1KQ9A 2FSWA 1T56A 2V9KA 1K78B 1QPIA 1GVDA 3WGHA 1XDSA 5D5VB 2WA0A 4D7NA 4BAYA 4ENMA 3TGNA 4QIWN 1TT0A 2RV8A 5KCMA 2R7XA 2X6YA 1MNEA 1ITYA 5D4RA 1WPKA 2IW5A 2FE3A 1A04A 4M72A 5LLQA 2GZWA 3KP3A 3H3VK 3GZ6A 5L3EA 1P4WA 1N77A 2R7UA 5EZGA 1HOMA 3ZQIA 5LFAA 4KFCA 1QVUA 2ZBKA 2A5WA 2DK5A 2DFEA 1HSJA 5E3OA 1I50J 5H2FC 3OYAA 4MGRA 2VT2A 1K7AA 3LSHA 2HWVA 3HXLA 2UXXA 3VPRA 1TWGJ 3HIFA 3GWZA 2HXIA 2V4JC 1K4TA 3KLNA 3OL3A 4XKWA 1BR2A 2CYYA 4K2EA 3FXLA 4A0YA 5JLWA 4LG0B 1R4NB 2W24A 4O5VA 1UAAA 1B6AA 1BM9A 3G73A 3V7SA 3CC7I 1IRXA 1I27A 1P7JA 1WH7A 2H09A 3F3XA 3WG9A 5EEGA 4BUPA 4KYWA 2A6HF 4P5OA 4RGSA 4EMSA 2CUZA 2ESNA 2VKHA 2PJRB 3E97A 2DA3A 1SFOJ 2OC6A 3K7AJ 3WU2C 2LLKA 2HR3A 4D7MA 1IZ1A 3Q0UA 1QQIA 1FTTA 4OIPF 1WJ5A 1N25A 3ONQA 4LIVA 1HW5A 2AQEA 5J6XA 2CUEA 1FBUA 2ADUA 3ELKA 2D1VA 4BXFA 5CVIA 3GX4X 1RZ4A 4XLFA 1HQCA 1YS6A 2DFIA 3E5UA 3D5LA 2R7OA 3GXOA 2NAZA 3B6CA 3FMQA 3G1LA 4KICA 1FTZA 3FXOA 3X2QH 4XBFA 2EZIA 5BPDA 1JKQC 1QHHD 3TW6A 1MJ9A 3BR6A 1Z1DA 3E6BA 3LSTA 2JN6A 3B02A 1G2HA 1XGNA 4NQWA 2A5YB 2PN6A 2EFNA 3K4NA 2QVOA 4UB8C 4L9NA 1JI8A 3K2AA 4EM2A 1IXSB 2LK2A 4RDUA 1K61A 3BTLA 4RM3A 3WTYC 2IGKA 3S93A 4XNFA 4EGZA 5IT3A 2VI6A 4IZZA 2HOAA 5F27A 3U21A 2VJ5A 4DZJA 4I01A 4OINF 2XF6A 4F55A 2O8XA 4DIQA 1H89C 5DYMA 3QYFA 1WJFA 1FNNA 3KCCA 2BXZA 5M3FJ 2XDVA 4BY7J 1XTAA 1AU7A 3TKYA 5EEHA 4TV7A 2R7FA 4UNOA 1JUSA 2P5VA 2Z5UA 1CGPA 1I6HJ 1IV8A 2LF8A 1X1CA 4BXXJ 1ZQ3P 1TNSA 4YEJA 1W7PB 3GBGA 3NRVA 2IBDA 5CVRA 4CCKA 3TO6A 3D0SA 3DTKA 3LSKA 4PSXA 3JRCA 3HSRA 1MBGA 2RNJA 2BW3B 2LR8A 2UXNA 1YG2A 1XN7A 4YFXF 4JQFA 3R0AA 4WWCA 1U78A 3BCBA 2DQLA 3NEUA 5CPRB 2VASA 1Z3YA 3J7AO 3C1DA 4FQGA 1QA6A 2OTLI 1MIJA 5LEJA 2F2EA 1UCRA 2EH3A 2GA2A 3FMRA 1LDJA 1E3HA 2JA6J 3OYIA 3BZCA 2HOEA 4XMYA 4ZZDA 1IN5A 2LG4A 3LSRA 2VONA 3V7CA 1YYVA 1ZRDA 2V1DA 3TP3A 2LKPA 3R6SA 2HKOA 2IJLA 1YFHA 2V9VA 3RPUA 1PVEA 2CUJA 2VBZA 4LG3A 2R3SA 3FX3A 4HX4A 1W36C 4BEHB 1IUYA 3WHCA 2EA2A 2HDWA 2VLAA 2IP2A 4L0YB 1MJAA 4O3MA 2F4MB 5TGTA 1J59A 2FD5A 2M7BA 2WBMA 3GFJA 3OR2C 1SD6A 5BNGA 1IRZA 1ZELA 4RS8A 1A6QA 5ICEA 3O2PE 2R5YA 1XGMA 4ZZLA 3VODA 3EUAA 3OYEA 3RTRA 2RKHA 2IT0A 4CO8A 4C3IJ 3TW7A 1KONA 4B48A 4Q5SF 4AIHA 5LBQA 3LAJA 2CSOA 3ZMDA 3GTGJ 3JCUC 2HTJA 1YOVB 1ZLKA 1RI7A 3RQ4A 3ZN1A 2VN2A 1SD7A 4BYYA 1LUJB 2E34A 3FXKA 4YFNF 4QLCU 1LPQA 1BIBA 3HSFA 2Y2ZA 1JT0A 1A35A 2DOEA 4BQOA 2EB7A 5D4SA 1RUNA 1GDTA 3A01B 2P6SA 5IP6A 2PQ8A 2ECBA 2ELKA 5LHHA 2WV1A 2VJJA 2O5RA 3SZGA 3OSGA 3DPTA 2V7FA 2KIQA 3H5RA 3OYJA 2IRFG 2OTJI 3CCUI 1X1DA 4AYBN 1QGPA 1UG2A 2W57A 2ZSHB 4NUBA 1OKRA 1OPCA 1WI3A 1WKMA 3M07A 2ELJA 2Q2EB 2I5UA 3CDIA 3H3UA 3LFKA 4N9HA 1R1UA 2ID6A 3CLOA 4Y15A 3IAS2 5L3GA 5A2QK 1E0EA 3K2ZA 3MZ8A 2BBYA 1HF0A 4OOIA 3S3MA 4CUGA 1TQMA 1ZG3A 5DCFA 1MD0A 3ZQLA 2H27A 3LSPA 2WWYA 1YIOA 1FOYA 3BPVA 2WAQA 4XIDA 2IS6A 2HQRA 4HNVA 4A3JJ 3KIOA 2E36A 3S3OA 1YI2I 3AL0B 3CF5F 3LNQA 1G4DA 2JVHA 4A3BJ 3CP2A 2ZXJA 4C3HJ 2H6CA 4HX8A 2G0EA 3PIPF 1O3RA 3W2WA 2IA1A 4EM1A 4IO9F 2E7XA 4A3KJ 5H6QA 2E1CA 1V54H 2R93J 2DN0A 2XIGA 3P9CA 3QP6A 1U0JA 4M71A 5BQTA 4QPOA 1Z67A 1K4SA 2PI0A 1BI3A 1LDDA 3FK6A 2DA4A 4PJ0C 5JHFA 2HVSA 1S7OA 4RGRA 4CYCA 4PK4A 4A3DJ 1PUFB 4G7HF 4G12A 1H0MA 2BV6A 3L00A 4D5FA 2JQ7A 1X2MA 3OMYA 4EJVA 1IG7A 4I98B 3TOAA 1YQAA 4C9YA 1BW5A 1Y1VJ 1FIAA 1MBJA 4GDFA 5DD8A 4G8XA 2PMUA 1YW8A 3L2VA 5E1XA 5EDNA 2B63J 4ASNA 2M0CA 4FETA 1IXCA 1T2KA 1LFUP 4F92B 3I59B 1XMKA 1ORKA 3CJTB 5F1JA 1QPMA 2DOFA 4H0EA 3EUHA 3BT9A 4PUSA 1JTYA 1I3QJ 4XRSA 5HDNA 3F23A 3J7AY 2L5QA 1TP4A 3CZ6A 1LFPA 2ZMEC 1Y0NA 2VE8A 4P9FA 5FO5A 3RI4A 5FD5A 4BJTA 2DA2A 3BZ6A 4YG2F 3JRDA 2JUGA 1J7KA 3SQNA 1SMTA 2EZHA 4A5MA 3FK7A 3T8RA 1O7FA 1WH5A 1F4KA 4Q48A 1O3QA 1LEAA 1POGA 2DI3A 1YHQI 1EA3A 3OWTA 1TWAJ 3K70C 1YW7A 5LHGA 1R58A 3HUGA 2NVTJ 2XHKA 3BR3A 1FIPA 1XC5A 4FCYA 3BG6A 2DO7A 1HA8A 1S6LA 4UXNA 1DP7P 1XX5A 1MZBA 1QZYA 1ZK8A 2DFFA 2QSGX 5HLGA 3ABUA 2E35A 3DWLE 3K1MA 4U0YA 3KP7A 4J01A 2F4IA 5E3MA 4HQMA 4M6YA 2FBKA 3U1DA 3GO5A 3O6BB 3M4OJ 2BZTA 2IPQX 3UNGC 2IA0A 4S04A 4GXOA 4LB5A 4JYKA 4DQ2A 2RVCA 2LKXA 4UV8A 1OCCH 2CQXA 1W0UA 4U0VA 5BOXA 4BKXA 2BYVE 4WXDA 3PL8A 1W36D 5J1RA 3QPLA 2F48A 3I58A 3MKZA 3F8BA 4A5NA 3K4MA 1SANA 1ZLJA 2M3AA 3IC7A 3CF2A 1R5HA 1ETQA 2HZDA 3H9JA 5HS9A 5FLXZ 2EFOA 2ZB9A 1BI0A 3ZGKA 3RKXA 1LB2A 1A6IA 3ZPLA 1JE8A 3BG7A 1LNWA 4OAYA 2R7VA 4C3JJ 4KA4A 4MTDA 1SAUA 3O8GA 2DPDA 3K0LA 4KT5C 4U87A 5F0CA 5EG0A 4ZTFA 3CO6C 1IRGA 3DPUA 1MMGA 3ABMH 3SHFA 1B1BA 3M1EA 4AM3A 1U5TC 2K9NA 5HOOA 1SMYF 1XMXA 3M3YJ 3N97A 1ZGAA 3T1BA 2FOKA 2HI3A 3T5XA 1PJRA 4MFDA 1OLTA 3RKYA 5J1UA 2OD5A 3LOCA 2L01A 3CDHA 1BL0A 1WJEA 2ZKZA 2CU7A 2DMQA 4I7HA 3S2WA 5ILVA 4RAYA 1KZHA 2OZUA 3OYMA 3BG3A 2YUSA 1Y56A 2OPTA 1QZEA 4A69C 5B66C 1JKPC 1ON2A 5E18F 4RGUA 5KAIC 2Z99A 3DEWA 4RB2C 3G4SI 2CGPA 3Q9VA 2K85A 3LSGA 3WODF 1I1GA 1YE9A 4EV0A 1MDMA 2V6EA 2TRTA 1W7PD 5D6EA 1K6YA 2XGXA 3OYLA 1JJ8C 4C2UA 2MYSA 1D5VA 1X4OA 3S14J 4XLNF 3ZQFA 3WTXC 4HLYA 2VJ4A 3WTSC 3DPLC 2E2JJ 2PMZA 1W1WE 1ETVA 1JHFA 4IXAA 1MSEC 3H9GA 3BJ6A 3Q9SA 1WJDA 4N4NB 2QLZA 4LK0F 1U5TA 1LDKB 2QQBA 2CQKA 3OYDA 1R7JA 5FGMA 1G6NA 1YITI 2E1OA 4JX6A 1P4XA 2V1NA 1E17A 3V8LA 3W6KB 1H88C 1ZHFA 4FT8A 5B1BH 3VOEA 2HU9A 4EJWA 5GAHJ 1TT5B 4XLEA 4M6VA 5C44J 5EZHA 3HOWJ 3CJRB 1Y1WJ 4HEA2 3ESWB 1RNLA 4E6KG 1FC3A 5HLIA 5DV5A 3KETA 4PFOA 3SDGA 3KEYA 4A12A 2B9SA 2W4SA 2LMDA 1GV2A 3L9FA 1FMVA 2P5KA 5E3LA 2VQGA 1Z6TA 4H4KC 3GTJJ 2QM3A 4QTRA 4KDPA 3ABTA 5F64A 3FHNA 4ENJA 5CLSA 5CKTA 5HNFA 4G6TB 2E19A 1WVRA 3P9KA 1VQ6I 2CQNA 2VXDA 1ZR4A 3FISA 2K4JA 1U9NA 9ANTA 2H94A 2AQFA 1TQIA 4NC7A 3HHHA 4NQWB 5D6FA 5J1YA 1FOXA 2NXNB 3C2GA 2XAHA 3KYCB 1RRJA 3CMYA 2H8RA 4IOAF 1D1BA 2JPCA 3AG4H 5F0HA 2Y0SN 3C2BA 1D3YA 4AIJA 2DMNA 4FHTA 4CCJA 2MA3A 1I1SA 3ABLH 3WTVC 4Y17A 4LLGF 4HV5A 4MEYF 1RETA 2MGQA 2QWWA 3K9TA 2A05A 3ZMVA 4LITA 2NS0A 3OIOA 2VQCA 4CA0A 2E1NA 4IRGA 5M5WJ 5K5QA 4CZZA 2CFOA 4E7ZA 1GLNA 2EA4A 3IH4A 2MBFA 1ON1A 1CF7B 2X0LA 3PO3J 2CMPA 3JAMZ 1TLHB 1F9NA 3WTUC 3JAMK 4BH9A 3K70D 2O7OA 3QP5A 5HLHA 5JVGF 3ZMSA 2Y0MA 3GTMJ 1XGOA 2DODA 4HG2A 4A3CJ 4A93J 3BC8A 3VSLA 5EGOA 2ACJA 4AVPA 4G6QA 2LOOA 3ZQ7A 2DU9A 2W85A 2X85A 3I56I 2CG4A 2X6XA 5DUKA 4DNCA 2CV1A 3ECOA 3M9AA 5CYVA 2FXAA 2B0LA 2HQ5A 1ZGWA 2MW8A 2VL8A 4RBOA 4CYDA 3BPXA 3M1CA 1SFXA 3KPHA 2CRGA 3K1PA 4U0WA 3ZP5A 4OIQF 4E7JA 2GOMA 2LY1A 2VOOA 2KL4A 3BJAA 2NOGA 2LBFA 1LQ1A 4KMUX 4IHVA 1X3ZB 2MH9A 3RKWA 3S3NA 2CV2A 2KLOA 3WGGA 2FBIA 3CQZJ 5IOYA 2K40A 2W1OA 3CUQA 3S17J 2L3DA 4LB6B 2YPRA 3LSJA 2LC2A 1OCTC 4KISA 2FEZA 2M4KA 2UV1A 3H0DA 2K86A 3BTCA 2HOSA 3MKWB 3L2RA 5LD2C 4G94A 2ICWG 3F22A 5DS9A 3I4PA 4Z6YA 4LGWA 2DA6A 2ZXWH 4JX4A 1J9IA 1XDUA 1Y0UA 2LP0A 3L7WA 4B44A 1ZARA 1ZRFA 4HSRA 5D5XB 2X1EA 2RQQA 5CJ9A 3DBLB 4RGXA 4AU7A 1FJLA 4U7DA 2DA7A 2XASA 2IS2A 1ZN2A 2GIVA 3FMSA 1FOKA 3DV8A 4R79A 3ASOH 3RKQA 1UHSA 2XSDC 4I2OA 3L2UA 3DCFA 1V5EA 5D5UB 1B9NA 3FKJA 3S15J 1DU6A 2VBYA 2UUZA 1G3WA 2H8WA 4PGGA 2JT1A 5HODA 4HA8A 3I4NJ 3JRFA 3DU5A 5K7ZA 4HV6A 3JTGA 1WGXA 4BQAA 2DTRA 3ZCOA 2XGEA 1IC8A 2X6OA 2ZJQF 3DTEA 3B6AA 2LH9A 2H6BA 2HOTA 2ZNZA 3L2QA 5E1WA 3E6DA 4A3EJ 3K4CA 3DU6A 1UG0A 3AG1H 3KEOA 3OYNA 4WK8F 3P7NA 4I09A 4IOCF 4FTHA 4BHPA 2VC1A 2LYCA 2HYJA 1TTYA 2E5NA 3GTPJ 1ZTRA 5GAGJ 3I3LA 4LLNA 3HEFA 3CJQB 5JI6A 4F52A 3CMEI 2QA4I 3QYEA 1OJLA 2OV7A 1EJ9A 4ZYHA 1E3PA 2O03A 2P4WA 2MABA 5IYCJ 1KQ8A 5IT9K 3IL2A 1OFCX 3GF2A 5FRNA 2A6TA 3C18A 4AVZA 2FJ1A 2JA2A 2NNYA 5FD6A 1R6RA 4I99C 2BOLA 5D8KB 3GW2A 3MMYB 1X1BA 3WTZA 1QBJA 2YU9J 4KMFA 3VFZA 3QYBA 3I4MJ 2WY8Q 4HZFA 4BJ6C 1U2WA 2EPFA 3C3WA 3DF8A 2QSHX 5EYRA 2LNBA 3AAFA 1ETXA 4ZC3A 2JPBA 3F0CA 2L4MA 3M8EA 3F8NA 1JJ6C 4RB3C 1X1PA 3CCLI 3MD2A 3CCSI 4XRMA 3BR1A 1AKHA 4CYCB 2A3SA 1VZ0A 1BR4A 1T8IA 3MQ0A 2KDOA 3CO7C 1YRNA 3O3KA 1V5GA 3F6VA 2DYRH 4XK4A 2O8KA 3OIPA 4ZYEA 2PBIA 3ZMTA 5HDKA 5F1RA 2F4OB 3EQLF 4M9XA 2K7LA 5FKOA 1IDYA 3J7YJ 4WX9A 3V42A 1RUOA 2XPUA 3LQRA 1IJWC 4V2FA 5HS7A 2FUG2 3GFIA 2OAZA 1O3SA 3CMAI 1D0XA 3LFUA 1OCPA 2X4HA 4KIGA 1TQPA 2QQ8A 4R8HA 4AIDA 1NHAA 2PLYA 2L02A 4YIIA 2ZJRF 1ZAOA 3S2DJ 4KNYA 3ZQGA 2Q1ZB 4BL0B 2VIXA 4I6ZA 2VT3A 2CJJA 3IAM2 1EH7A 1KGSA 3FZVA 1C0WA 2HNHA 4XN0A 1P92A 1N75A 2BXYA 3OL4A 4I0BA 4YRVA 3F8FA 3QODA 4OIOF 4MQ9F 4ESJA 4PJMA 5E3NA 1HKQA 5LGTA 3FM3A 3HRUA 3DBHB 4XRSG 3QQAA 1XSXA 3VEPA 2EILH 1YJ9I 2KP6A 4AWXB 1LKXA 1Z6RA 3MFKA 2XGCA 3HUGB 4DZPA 3GTQJ 1PYVA 4EQQA 1DGRM 2JRMA 4PJNA 4A3FJ 4V19K 3J7ZI 1BI1A 3FBNB 1H8AC 4MQVA 2L9VA 4JOMA 4BNCA 1YLFA 1K78A 1RIOH 2ZO4A 3GTOJ 1JGSA 2STWA 2V6CA 2OBPA 3MN2A 2ESHA 4AUXA 4FE4A 1ULYA 4ZH4F 4A6EA 5H6RA 1ENHA 3G2BA 1T6SA 3HTUA 3J81K 3R60A 1MNDA 3K4LA 4RA2A 5HVQC 3D1NI 2FNAA 3WE2A 5E8IA 1WQ2A 2L9RA 2WB1N 2DYSH 2BVLA 2KRCA 2OJED 3HOVJ 2ZMEB 4M3DA 5LEKA 3CDLA 3HOTA 2HEOA 2P6TA 2KKOA 1XGSA 3E6CC 1X4PA 2JK3A 2LY2A 1WJCA 2OA4A 2QQ9A 3IHUA 1HLVA 1BJZA 2QSFX 3C7JA 4QPQA 1UJ8A 4E7IA 2JRTA 3GVAA 5GPAA 1KU2A 1X58A 3HKZA 3RPQA 4F93B 4B3AA 1YO5C 1OQYA 4Q4ZF 4XLCA 1JT6A 5KVRA 5IPAA 2VPRA 1MBHA 4JX5A 2KMUA 2KRHA 4YFKF 3DQVC 3PNYA 4G7OF 4L9TA 3CLQA 3SFIA 3L2CA 1HDPA 3OYGA 4ZJZA 1MMNA 2P8TA 5A2QZ 4MLOA 1UHWA 4ZYDA 4HQEA 1T0FA 5E17F 2VQHA 2VKDA 1OCZH 4M9SA 4EEFG 2K27A 4KN7X 3FXJA 3L1PA 4F3QA 3ERMA 5FKLA 1IN6A 3KZYA 3OOUA 4B09A 2D1HA 5IP7J 4RM2A 3PNTA 3IV5A 1EH6A 3FIWA 2L7KA 3EUHC 3TO9A 3VDXA 1JUPA 1BIAA 4E4HA 3CTAA 1T39A 3AG2H 4M3FA 2GA1A 3QWLA 4ANJA 4M3BA 4IJAA 1TWHJ 2BE5F 4UVCA 4XKBA 3I55I 2ELHA 1ETOA 2XSJC 1MW7A 2MC3A 4Y4RA 4KITB 3KP5A 1QZZA 5L3CA 4WXHA 4DOZA 1MKMA 1HXDA 1IGNA 4XSZF 3ZMUA 3ASNH 4KIBA 1V55H 1Z3XA 3DFGA 4II2A 1HKSA 2IEKA 1A36A 1D8JA 3WGIA 1U5TB 3WE3A 2XPWA 4L0ZB 3ERED 3HM5A 5GAEJ 3HBLA 2NVUB 2F5EA 3KE2A 3SDBA 5C3EJ 2NOJB 2GOXB 3QAHA 3W2VA 3HPHA 4LK1F 2XC7A 2GBYA 3GYHX 3CCQI 2W84A 2Y31A 3S1RJ 3I5UA 3AKZA 1E3OC 1WJBA 2QBYB 3ISPA 2J5OA 3SYTA 2MLKA 2I8DA 2P5LC 3LAPA 2KIMA 4LIUA 3KEQA 3MKYB 3QU6A 2IGOA 4GCVA 3RPUD 4XQFA 1REPC 2NS8A 2H1LA 4UVBA 2WC2A 1EH8A 1B72A 2P81A 4X0GA 4IVNA 3RYRA 3K10A 4GYGA 2WTEA 5JVTA 2M5WA 2BHYA 2BW3A 5AIQA 2L0KA 2DFHA 2QYOA 3E5QA 1D5YA 1B4AA 3EPZA 2I10A 3OYBA 2FU4A 3PM1A 5H20A 3DKYA 3BDDA 3FBIB 5E79C 2OQGA 3JRAA 1X2NA 5IY5H 1ERDA 4A3GJ 1KQ0A 2WAFA 5LRSA 4QSHA 2VOPA 4IHSA 1TBXA 2E60A 5L3DA 4RAFA 3OYKA 4Y33A 4IL6C 2VKEA 1DU0A 2DMPA 3HJEA 2JUCA 2O3FA 2XAUA 3S1MJ 2GXBA 1YTYA 5GTHC 4BGDA 4L5EA 2WADA 3SFZA 1G59A 3H5AA 1SD5A 1SFUA 3GTKJ 2M8EA 3LL7A 3OOPA 4A3IJ 1O3TA 2DJNA 1QU3A 4BQNA 2X9DA 2KT0A 3PQKA 2DPUA 2JZYA 2W82A 2DT6A 5J8FA 3CCRI 2KFDA 1RKWA 3PJRA 3PSFA 1O4XA 3QPHA 1IV6A 2G9WA 2DA1A 3GCMA 1S8NA 2DT7B 2XVCA 2YX4A 1Z21A 1LE8B 1ODDA 1FBQA 3PNVA 3R61A 2DW4A 4ZDLA 2E1MC 4XLHA 1VQ9I 2XAQA 1BR1A 5GADJ 2COMA 3NAUA 5EGOB 3P9IA 4O6JA 2VB6A 1A31A 3COAC 5KAFC 3PQJA 5IP9J 3FKIJ 3I9V2 1DDNA 3EDPA 2HXOA 2KDZA 2R0QC 3UKGA 2XPVA 3HL2A 2R7ZJ 2NVXJ 4OAZA 5IOZA 2Y75A 1OR7A 4U88A 4UV9A 2ZXHA 4Q47A 3ML6A 2LSOA 4D9JA 4EJTA 5J3LA 4MNUA 2KZVA 4W1UA 2FF4A 2XAFA 3E1SA 1GXPA 1B8IB 2R7SA 3GZ5A 4RAZA 2ZXIA 1VFCA 2ZJ2A 5LGUA 2HFHA 5M5XJ 3PO2J 5FFXA 2MLGA 2KJBA 5EF6A 1MH3A 3CC2I 3TO7A 2M2EA 2XF5A 4IRIA 4YIRX 4BHBA 2P7CB 1WHUA 2M7AA 3QOEA 4NDLA 1WJAA 3F6OA 1FYMA 2EZKA 3PSIA 1YJWI 4LD5A 3IH2A 4HAMA 4OMYA 5FKNA 1QO0D 3MCZA 5CQGA 5FKMA 5DCMA 2VPLA 2V79A 1IF1A 3CJNA 2CW8A 5AONA 3G1MA 4P55A 1Z0XA 1R1TA 3ULQB 3RSNA 5ILUA 2JJ7A 1MGTA 2KIUA 4II3A 1VTNC 2BHZA 3IH3A 1VQMI 2TDXA 2W00A 5BS6A 2CW0F 2QKLB 3HSEA 2WY7Q 1R5GA 2DDBA 2JSCA 4RLQA 1HKTA 1UB9A 2Q0OA 1HC8A 5FLMJ 2VE9A 3JSPA 1APLC 2HDDA 1OCRH 3CCVI 5EJCA 3S2HJ 1MMAA 4LJZF 4XSXF 4E7KA 2EQRA 4DYCA 3W3CA 4QWQA 4CCNA 4L5IA 5JLXA 2KRFA 4C2TA 3ROUA 4PDKA 2P7VB 1FLIA 4GYIA 2FRHA 4F7ZA 1FOWA 3HOZJ 1KYWA 1R22A 1D0YA 4G7ZF 3N05A 4B3XA 1U9OA 1KU7A 3OIQA 4V2GA 1YX5A 4MIMA 2KISA 3S1NJ 3JRGA 2QEXI 3BCAA 5JR3A 1YJNI 3OR1C 2YSRA 4KT6A 3E7LA 5E1ZB 1W0TA 5E20A 4CXFA 4J19A 1MSFC 1JKRC 3VYTB 2MD0A 3ZMZA 3ZOBA 1W5CC 2QUFA 2JMWA 3GLLA 3F72A 3GZNB 3BR0A 3N4MA 3HTSB 1LFBA 4PJLA 5JFRA 1USSA 2HGCA 1STZA 2EWNA 1R71A 3QPSA 3OS2A 4OU0A 1Y39A 3I59A 3TMOA 3D5RC 1P4AA 2KJCA 2DBBA 1MBFA 3IKVA 1U8BA 3FM5A 2MSYA 1ZRCA 2AO9A 2MC4A 2BVMA 3OV8A 3MVPA 2G7UA 1J75A 1W4MA 1IN4A 2Z33A 2HZTA 1SVLA 1A5JA 4ETSA 5DM7F 1SAXA 2ZJPF 2R92J 1G8XA 4XOPA 3ZN0A 3H35A 4KIFA 5F08A 4AC0A 1UELB 2GWRA 3S32A 4ESFA 2R7RA 3KLOA 1XSDA 2VBXA 2DDAA 2R4GA 3VWBA 3LA3A 4FX4A 2VJIA 4XKVA 3CCJI 3CUQC 3P5JA 4S05A 2XAJA 3BTIA 3TL4X 4N4OB 3DXJF 3HRSA 3MAJA 4B43A 2WAQN 1AKHB 2GXAA 3B73A 1AWCA 1JXSA 4DGWB 4XKCA 4M6XA 1YRNB 1IN7A 2LTPA 2J5PA 5HNHA 4XLPF 2N8GA 2ID3A 2BY0A 4IKFA 2EFPA 2HYFA 1BC8C 2YX7A 2L9SA 5KHDA 1XPXA 2IS4A 4P9UA 3K1NA 2PX9A 4AYBA 2W25A 2JA5J 1LEBA 5ERIA 2ZNYA 3GFMA 3TQNA 1NTCA 4L9JA 4IF4A 2FQ4A 2M9HA 1TNTA 4F91B 2QCOA 2MD5A 3K4BA 1SFEA 3OSFA 5BPIA 2OZ6A 5FFZA 3A0BC 3UR3C 2NVQJ 2VC0A 3O8HA 2COBA 1JHHA 1OCOH 3KX2A 4MFEA 2EZLA 2LF7A 5F6FA 1DP3A 3ZQQA 2Z2SB 3HZJA 1J09A 2PEXA 2RNGA 2XV4S 5DTDA 2EIMH 4RAGA 3JSOA 3WU0A 4ZTJA 1Y6IA 2JWTA 1S7EA 3A02A 1G3YA 1ZYRF 2DQRA 2KIFA 1RR8C 1DUXC 2P0WA 1T08B 4HF2A 1L3LA 1OMIA 4E7SA 3EUKL 4M9ZA 2NYXA 2F5FA 1U6GA 2DAOA 4KUMA 1DPUA 1FBSA 1IDZA 1Y8QB 2DLLA 3BR5A 3HOYJ 3I53A 1R9TJ 2NVYJ 4PGHA 3FDYA 1SFKA 1MJBA 5KK1A 3Q5FA 2GM4A 3BR2A 3HYIA 1KU3A 2L7FP 3IWZA 2XKPA 1DQUA 3FHZA 3FXUA 3C2HA 2R5YB 4GRIA 2ISZA 2O9LA 1VQ5I 3VYUB 2Y9YA 4UVAA 1BC7C 1IAWA 3IWFA 2Q8KA 2CV0A 5LRRA 3OY9A 2DOAA 5LHIA 4A2UA 2VKVA 1D1CA 2KQRA 1FP2A 1XCVA 2CUFA 2EINH 2RGVA 2UZKA 1QRYA 1GHCA 1HCRA 1HW2A 4CDGA 1AA7A 2EV6A 3HPGA 4L5JA 1Z9CA 4AD9A 1ZG1A 2W7NA 3MZHA 1S5LC 5C4JJ 1DPRA 3LSMA 3CCYA 4N0BA 3LA7A 1GVJA 2X6WA 2VQLA 2K5CA 5FRMA 2LY9A 3A2KA 5DD4A 1OYYA 2HPIA 1G3SA 4XICA 2ETHA 4XOTA 3RJPA 5TISC 2OQRA 4E70A 1GUUA 4WF2A 5M3MJ 1HDDC 4UUSA 2ZFUA 4HNUA 4HX7A 5IT9Z 1IUFA 1ACIA 1O57A 4HF1A 4S0HB 1SVOA 1SD4A 5B3SH 2K4BA 3NWSA 3FWEA 4BDZA 1L0OC 3W6VA 1RR7A 5HLTA 2FMYA 1KYZA 3F21A 1IW7F 2HS5A 2HQNA 1NG6A 3DTIA 3DLLF 1FEXA 1FP1D 3G6EI 4IQJA 2EIKH 1V5FA 3VYSB 4FX0A 3QPTA 1XS9A 5D5WB 2EK5A 1QVTA 1TZLA 2IGNA 4OMZA 3V8KA 1CQTA 2L2OA 2O0YA 4EJUA 4X6AJ 1K83J 3DEUA 5C4XJ 3HHGA 3QOPA 4KN4X 4CZCA 2PFBA 1BBYA 1S9HA 4EVIA 2KZGA 2G7HA 3S8PA 2OCCH 1FSHA 3HGYA 2IAIA 4AIKA 1Z91A 3KZIC 1WRJA 2YU3A 3PFIA 1LVKA 1R49A 3MWMA 4R1HA 2LKSA 4XRFA 3WU1B 2OCEA 5FLVA 4JK1X 2XGDA 1IN8A 1ZR2A 1TW3A 3NWTA 3JRHA 1QHGA 3HC7A 2F6CA 1X1AA 1RESA 4FASD 5JHUA 1VQLI 4IHYA 1CF7A 2IA2A 2NRAC 2OU2A 3T8TA 3OYHA 2PMZN 4HLXA 1O7LA 3K4JA 4PJJA 1NH3A 3RZOJ 4B1RA 3W6JB 2R5ZA 5J40A 3PFYA 2NNNA 4PSWA 5J4VA 1JGGA 1Y8RB 4FE7A 3ZQHA 3BG5A 1OYIA 1T95A 1MMDA 3U1KA 2GLOA 4G9YA 3G1OA 1B72B 4N9IA 1PP7U 1X3UA 2M45A 4XM3A 4ZDOA 4EATA 4EJOA 1Z05A 4E7HA 2RDPA 3BG9A 2VBWA 1RKTA 1W5TA 4OIRF 1TC3C 2RREA 3S1QJ 2VXZA 2L7MP 1VQPI 2R7TA 1N78A 2BY3A 3V7RA 3KYLA 2CWEA 2HPMA 2XF7A 1IRFA 3U2RA 2CFXA 3RZDJ 4EGYA 3HRTA 4BQQA 3PIOF 2H1KA 2BY2A 3Q0VA 3TEDA 3BJOA 3IP4B 4HRIA 4WXCA 1I3AA 5CVJA 3R4KA 4MHGA 3H1CA 3TDUC 1T0FC 1BA5A 1HW1A 1WWXA 4CCMA 4M3GA 3SEQA 2E71A 4A0XA 2STTA 4CH7A 1VQNI 2HVQA 4PZJA 4ENKA 1MNMC 1U8RA 2XROA 2FA5A 3J81Z 4HDUA 3E6MA 5FJ8J 2JA8J 2VUMJ 3ZQCA 3BROA 3GUDA 2LRDA 3RQIA 1PUEE 3OYFA 4UY8I 2XRNA 2V26A 1F5TA 1VI0A 1IO2A 1R36A 2FBHA 5TRDA 5L3BA 5K1YA 1R4MB 3LA2A 3FXQA 4DBRA 5J47A 2WV0A 6PAXA 5HS8A 1FWZA 1USTA 3WTTC 1D0ZA 1P9QC 2RN7A 3KFWX 4BE0A 4LG0A 4YIFA 2O6GE 1KU9A 5EG0B 2E2HJ 4DYQA 2L54A 4BU2A 1UFMA 4Y3OA 4CCLA 1FZPB 3E5XA 1OYWA 1T33A 4C30A 1X3WB 2PJRA 3FXRA 2MFZA 1S72I 2GAUA 2XRLA 4GGGA 1VNDA 3DKWA 3I0TA 4IHXA 4NC6A 2DJIA 2K9MA 4M73A 2UWMA 3W2AA 2CH0A 4IRHA 4L9VA 4DBQA 3CUOA 3BWGA 4BJ5C 3RCOA 3REOA 2PG4A 2Y0SA 2Y48A 4ZYGA 1P2FA 2DTZA 2WAEA 4IHWA 5ED4A 1Z77A 4G6DA 3A03A 2BY1A 3KYDB 4M3EA 3DP7A 3DLAA 4B4CA 2HQAA 1V4RA 2F5DA 3RYPA 1MDMB 4PFPA 5DCMB 1J5YA 2K9SA 3WHBA 2AXLA 1BW6A 2E1MB 2ME6A 3D5SC 3ZR8X 3TP0A 3H3ZA 4A0ZA 1W5SA 2BEOA 4GFBA 3HG9A 3K6GA 5CVUA 4Y7NJ 1I39A 2LVSA 1BOBA 5CVVA 3WG7H 1V3FA 4DJAA 3LWFA 1S7AA 1NK3P 1UZCA 3ZRGA 2CS3A 4LLLA 3CC4I 4I0AA 3TDZC 1TL8A 2GQQA 4ZDPA 1MH4A 1NG7A 3BZKA 3MEXA 2EFWA 2Y9ZA 3BOQA 3PUFA 2JVGA 1FPQA 2K02A 4BDYA 4E7LA 3LMMA 5DM6F 3CESA 4ITVA 3BTJA 2KPMA 4BACA 5AIPA
chains in the Genus database with same CATH topology
2QF7A 1OCTC 1U78A 1MBEA 3BTCA 2HOSA 5FLMJ 5DS9A 1APLC 2HDDA 2DA6A 4JX4A 3S2HJ 2EH3A 2EQRA 2LP0A 4DYCA 5K7HA 2LD5A 1JTXA 1WCMJ 5JLXA 2JA6J 2DMTA 1FJLA 3JR9A 1TWCJ 2DA7A 1Q1VA 3HOZJ 3LSRA 3GTLJ 1U9OA 4V2GA 3TP3A 4A3MJ 4MIMA 3HGGA 4ABZA 3S1NJ 3JRGA 3RKQA 1UHSA 2XSDC 3DCFA 4BY1J 1W0TA 3E7LA 3WHCA 4DW6A 3S15J 1DU6A 3Q0WA 1MSFC 4J19A 1JKRC 2FD5A 3ZOBA 5HODA 5BNGA 1IRZA 2JMWA 3I4NJ 3JRFA 2K9QA 5K7ZA 3BR0A 1LFBA 1WGXA 1EF4A 2R5YA 2XGEA 1IC8A 1JUMA 2X6OA 3QPSA 5IYDJ 4C3IJ 3TW7A 3B6AA 2HOTA 1MBFA 1U8BA 3GTGJ 4A3EJ 2MSYA 2MG4A 4FTHA 1UMQA 2AO9A 2HYJA 3GTPJ 1ZTRA 3MVPA 1XG1A 3HEFA 2Y2ZA 1JT0A 1A5JA 2R92J 1OJLA 1GDTA 3A01B 5F08A 4AC0A 5IP6A 5IYCJ 2ECBA 2ELKA 1OFCX 2WV1A 3OSGA 2FJ1A 3BTIA 4AYBN 1TWFJ 1UG2A 2WAQN 1AKHB 1WI3A 5GPCA 2E2IJ 2YU9J 3JREA 2NS7A 4C2MJ 1YRNB 3I4MJ 2LTPA 2W48A 3A01A 2ID6A 2N8GA 2ID3A 1HF0A 5EYRA 1RPWA 1ETXA 3ZQLA 3LSPA 2JA5J 3F0CA 1NTCA 4XIDA 4HNVA 4A3JJ 1JJ6C 4UUTA 2FQ4A 2M9HA 3Q3SA 3BR1A 4XRMA 1AKHA 3LNQA 4CYCB 4A3BJ 2QCOA 4BBSJ 2FX0A 3OSFA 4C3HJ 2G0EA 2Y30A 1YRNA 2NVQJ 3O8HA 2COBA 4XK4A 2O8KA 2R93J 4A3KJ 4MFEA 2EZLA 2DN0A 3BQZA 3JRIA 5FKOA 1IDYA 2LFBA 5DTDA 2XPUA 3FK6A 2JWTA 1IJWC 4V2FA 1S7EA 2DA4A 3HB9A 3A02A 4CYCA 1ETYA 4A3DJ 4LOCA 1PUFB 4G12A 1OCPA 4D5FA 1IDZA 1AHDP 1X2MA 1NK2P 2X48A 1F43A 3BR5A 1IG7A 3S2DJ 3HOYJ 1R9TJ 3ZQGA 2NVYJ 4I6ZA 1BW5A 1Y1VJ 2JA7J 1FIAA 1MBJA 2M8GX 2GM4A 4MO7A 3BR2A 2CJJA 2XB5A 2L7FP 3S16J 2R5YB 5EDNA 2B63J 2O9LA 2M0CA 1ETKA 5E3NA 1LFUP 1PUFA 2L7ZA 2Y9YA 1ORKA 5F1JA 4XRSG 3QQAA 3BT9A 1JTYA 1I3QJ 4XRSA 2XGCA 4DZPA 2VKVA 3GTQJ 2CUFA 1QRYA 1HCRA 4A3LJ 4A3FJ 2YS9A 3JRDA 2DA2A 2TCTA 1H8AC 2EZHA 1ZKGA 2M34A 5C4JJ 4UUSB 3FK7A 3CCYA 1WH5A 3GTOJ 1POGA 2AHQA 5IYBJ 3MN2A 4AUXA 4FE4A 1ENHA 2ECCA 1TWAJ 2LY9A 3HKZN 4FISA 2NVTJ 3H0GJ 3BR3A 1FIPA 3D1NI 1XC5A 4FCYA 4XICA 2CQQA 2L9RA 2WB1N 1ZK8A 2DA5A 3HOVJ 4M3DA 3CDLA 3NARA 1GUUA 5M3MJ 4BBRJ 1HDDC 5E3MA 4UUSA 2JK3A 4I76A 4X1EA 1HLVA 3M4OJ 1BJZA 1IUFA 4JYKA 4S0HB 5GPAA 3HOUJ 1F36A 1X58A 5M5YJ 5EEAA 1MBKA 4B3AA 2LKXA 2CQXA 1W0UA 1JT6A 2RAEA 4W97A 3W6VA 1RR7A 5IPAA 4BKXA 2VPRA 1JKOC 1MBHA 2ME0A 4JX5A 4D5CA 5J1RA 3QPLA 2D5VA 1FEXA 3SFIA 5K7FA 1HDPA 1SANA 4MLOA 2OF7A 1ETQA 1XS9A 1QVTA 2ZB9A 4JP0A 1CQTA 4IEJA 4EEFG 1A6IA 3L1PA 3HDDA 4C3JJ 4X6AJ 1K83J 5C4XJ 3O8GA 5FKLA 3OOUA 5EG0A 5F0CA 5IP7J 3IV5A 3FIWA 2K9NA 3HGYA 1LE8A 2IAIA 3M3YJ 1VF9A 2R5ZB 2HI3A 1JUPA 4MFDA 5FLVA 4M3FA 5J1UA 2XGDA 5FKKA 1ZR2A 1P7IA 3LOCA 3JRHA 4M3BA 5GP9A 1BL0A 1TWHJ 2CU7A 2DMQA 1GV5A 1RESA 1ETOA 3BG3A 2YUSA 2OPTA 1GT0C 4IHYA 4A69C 2XB0X 1JKPC 1IGNA 2EBIA 2PMZN 3DEWA 4DYRA 3HOXJ 2IEKA 4B1RA 2R5ZA 3RZOJ 3LSGA 4Y52J 2XPWA 2TRTA 1JGGA 3HM5A 4FE7A 3ZQHA 3BQYA 3HBLA 1ETWA 3BG5A 3SJMA 5C3EJ 2DMUA 2GLOA 1JJ8C 3G1OA 1B72B 1B8IA 5F0FA 2GBYA 3MKLA 3JRBA 3ZQFA 3S14J 2Y31A 3S1RJ 2E2JJ 1E3OC 5F04A 1ETVA 3BG9A 1MSEC 1RKTA 1T56A 1QPIA 1TC3C 1GVDA 3S1QJ 4D7NA 2L7MP 4QIWN 1ITYA 2E1OA 2NS8A 4JX6A 1WPKA 3RZDJ 1H88C 1B72A 2P81A 2H1KA 3H3VK 3Q0VA 3TEDA 5EZGA 1HOMA 3ZQIA 4M6VA 5C44J 1QVUA 5EZHA 5E3OA 3HOWJ 1I50J 1Y1WJ 2L0KA 1D5YA 3VPRA 1BA5A 2I10A 1TWGJ 3PM1A 2HXIA 4M3GA 3SDGA 3JRAA 1X2NA 1MNMC 4A3GJ 5JLWA 1GV2A 4QSHA 5FJ8J 2VUMJ 1P7JA 2JA8J 1WH7A 3ZQCA 3RQIA 5E3LA 3GTJJ 2VKEA 4QTRA 1DU0A 2DMPA 1VI0A 3S1MJ 2DA3A 1SFOJ 3K7AJ 2E19A 4L5EA 2LLKA 4D7MA 3GTKJ 3Q0UA 4A3IJ 1FTTA 1ZR4A 2DJNA 3FISA 2X9DA 1U9NA 2KT0A 9ANTA 2CUEA 5EG0B 5J1YA 1RKWA 4DYQA 2E2HJ 1O4XA 3CMYA 2H8RA 1IV6A 5F0HA 2DA1A 1T33A 2Y0SN 3C2BA 2DMNA 1LE8B 3B6CA 1RETA 3G1LA 1FTZA 2MGQA 2XRLA 3NAUA 1VNDA 5EGOB 2EZIA 1JKQC 3TW6A 4IHXA 3OIOA 3BR6A 2JN6A 1G2HA 5IP9J 3FKIJ 5M5WJ 2HXOA 3IH4A 2KDZA 2R0QC 3UKGA 2XPVA 3K2AA 3PO3J 2R7ZJ 2LK2A 4RDUA 2DTZA 2NVXJ 1K61A 3BTLA 4IHWA 1Z77A 3A03A 2O7OA 5IOZA 4M3EA 2VI6A 4B4CA 2HOAA 5F27A 3GTMJ 4DZJA 4A3CJ 4A93J 5J3LA 2K9SA 4W1UA 3WHBA 1H89C 5EGOA 1BW6A 1B8IB 5M3FJ 2ME6A 4BY7J 1VFCA 3TP0A 1AU7A 4GFBA 5M5XJ 4Y7NJ 3PO2J 1JUSA 2LVSA 5EF6A 1MH3A 2M2EA 1ZGWA 2HQ5A 1I6HJ 1NK3P 2MW8A 4BXXJ 4RBOA 1ZQ3P 4NDLA 2CRGA 2EZKA 3GBGA 3IH2A 1MH4A 5FKNA 2Y9ZA 5FKMA 2IBDA 2NOGA 3G1MA 4IHVA 1Z0XA 3JRCA 2JJ7A 1MBGA 3CQZJ 3BTJA 5IOYA 2K40A 3IH3A 3S17J 2LR8A 3LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QF7 A;  1OCT C;  1U78 A;  1MBE A;  3BTC A;  2HOS A;  5FLM J;  5DS9 A;  1APL C;  2HDD A;  2DA6 A;  4JX4 A;  3S2H J;  2EH3 A;  2EQR A;  2LP0 A;  4DYC A;  5K7H A;  2LD5 A;  1JTX A;  1WCM J;  5JLX A;  2JA6 J;  2DMT A;  1FJL A;  3JR9 A;  1TWC J;  2DA7 A;  1Q1V A;  3HOZ J;  3LSR A;  3GTL J;  1U9O A;  4V2G A;  3TP3 A;  4A3M J;  4MIM A;  3HGG A;  4ABZ A;  3S1N J;  3JRG A;  3RKQ A;  1UHS A;  2XSD C;  3DCF A;  4BY1 J;  1W0T A;  3E7L A;  3WHC A;  4DW6 A;  3S15 J;  1DU6 A;  3Q0W A;  1MSF C;  4J19 A;  1JKR C;  2FD5 A;  3ZOB A;  5HOD A;  5BNG A;  1IRZ A;  2JMW A;  3I4N J;  3JRF A;  2K9Q A;  5K7Z A;  3BR0 A;  1LFB A;  1WGX A;  1EF4 A;  2R5Y A;  2XGE A;  1IC8 A;  1JUM A;  2X6O A;  3QPS A;  5IYD J;  4C3I J;  3TW7 A;  3B6A A;  2HOT A;  1MBF A;  1U8B A;  3GTG J;  4A3E J;  2MSY A;  2MG4 A;  4FTH A;  1UMQ A;  2AO9 A;  2HYJ A;  3GTP J;  1ZTR A;  3MVP A;  1XG1 A;  3HEF A;  2Y2Z A;  1JT0 A;  1A5J A;  2R92 J;  1OJL A;  1GDT A;  3A01 B;  5F08 A;  4AC0 A;  5IP6 A;  5IYC J;  2ECB A;  2ELK A;  1OFC X;  2WV1 A;  3OSG A;  2FJ1 A;  3BTI A;  4AYB N;  1TWF J;  1UG2 A;  2WAQ N;  1AKH B;  1WI3 A;  5GPC A;  2E2I J;  2YU9 J;  3JRE A;  2NS7 A;  4C2M J;  1YRN B;  3I4M J;  2LTP A;  2W48 A;  3A01 A;  2ID6 A;  2N8G A;  2ID3 A;  1HF0 A;  5EYR A;  1RPW A;  1ETX A;  3ZQL A;  3LSP A;  2JA5 J;  3F0C A;  1NTC A;  4XID A;  4HNV A;  4A3J J;  1JJ6 C;  4UUT A;  2FQ4 A;  2M9H A;  3Q3S A;  3BR1 A;  4XRM A;  1AKH A;  3LNQ A;  4CYC B;  4A3B J;  2QCO A;  4BBS J;  2FX0 A;  3OSF A;  4C3H J;  2G0E A;  2Y30 A;  1YRN A;  2NVQ J;  3O8H A;  2COB A;  4XK4 A;  2O8K A;  2R93 J;  4A3K J;  4MFE A;  2EZL A;  2DN0 A;  3BQZ A;  3JRI A;  5FKO A;  1IDY A;  2LFB A;  5DTD A;  2XPU A;  3FK6 A;  2JWT A;  1IJW C;  4V2F A;  1S7E A;  2DA4 A;  3HB9 A;  3A02 A;  4CYC A;  1ETY A;  4A3D J;  4LOC A;  1PUF B;  4G12 A;  1OCP A;  4D5F A;  1IDZ A;  1AHD P;  1X2M A;  1NK2 P;  2X48 A;  1F43 A;  3BR5 A;  1IG7 A;  3S2D J;  3HOY J;  1R9T J;  3ZQG A;  2NVY J;  4I6Z A;  1BW5 A;  1Y1V J;  2JA7 J;  1FIA A;  1MBJ A;  2M8G X;  2GM4 A;  4MO7 A;  3BR2 A;  2CJJ A;  2XB5 A;  2L7F P;  3S16 J;  2R5Y B;  5EDN A;  2B63 J;  2O9L A;  2M0C A;  1ETK A;  5E3N A;  1LFU P;  1PUF A;  2L7Z A;  2Y9Y A;  1ORK A;  5F1J A;  4XRS G;  3QQA A;  3BT9 A;  1JTY A;  1I3Q J;  4XRS A;  2XGC A;  4DZP A;  2VKV A;  3GTQ J;  2CUF A;  1QRY A;  1HCR A;  4A3L J;  4A3F J;  2YS9 A;  3JRD A;  2DA2 A;  2TCT A;  1H8A C;  2EZH A;  1ZKG A;  2M34 A;  5C4J J;  4UUS B;  3FK7 A;  3CCY A;  1WH5 A;  3GTO J;  1POG A;  2AHQ A;  5IYB J;  3MN2 A;  4AUX A;  4FE4 A;  1ENH A;  2ECC A;  1TWA J;  2LY9 A;  3HKZ N;  4FIS A;  2NVT J;  3H0G J;  3BR3 A;  1FIP A;  3D1N I;  1XC5 A;  4FCY A;  4XIC A;  2CQQ A;  2L9R A;  2WB1 N;  1ZK8 A;  2DA5 A;  3HOV J;  4M3D A;  3CDL A;  3NAR A;  1GUU A;  5M3M J;  4BBR J;  1HDD C;  5E3M A;  4UUS A;  2JK3 A;  4I76 A;  4X1E A;  1HLV A;  3M4O J;  1BJZ A;  1IUF A;  4JYK A;  4S0H B;  5GPA A;  3HOU J;  1F36 A;  1X58 A;  5M5Y J;  5EEA A;  1MBK A;  4B3A A;  2LKX A;  2CQX A;  1W0U A;  1JT6 A;  2RAE A;  4W97 A;  3W6V A;  1RR7 A;  5IPA A;  4BKX A;  2VPR A;  1JKO C;  1MBH A;  2ME0 A;  4JX5 A;  4D5C A;  5J1R A;  3QPL A;  2D5V A;  1FEX A;  3SFI A;  5K7F A;  1HDP A;  1SAN A;  4MLO A;  2OF7 A;  1ETQ A;  1XS9 A;  1QVT A;  2ZB9 A;  4JP0 A;  1CQT A;  4IEJ A;  4EEF G;  1A6I A;  3L1P A;  3HDD A;  4C3J J;  4X6A J;  1K83 J;  5C4X J;  3O8G A;  5FKL A;  3OOU A;  5EG0 A;  5F0C A;  5IP7 J;  3IV5 A;  3FIW A;  2K9N A;  3HGY A;  1LE8 A;  2IAI A;  3M3Y J;  1VF9 A;  2R5Z B;  2HI3 A;  1JUP A;  4MFD A;  5FLV A;  4M3F A;  5J1U A;  2XGD A;  5FKK A;  1ZR2 A;  1P7I A;  3LOC A;  3JRH A;  4M3B A;  5GP9 A;  1BL0 A;  1TWH J;  2CU7 A;  2DMQ A;  1GV5 A;  1RES A;  1ETO A;  3BG3 A;  2YUS A;  2OPT A;  1GT0 C;  4IHY A;  4A69 C;  2XB0 X;  1JKP C;  1IGN A;  2EBI A;  2PMZ N;  3DEW A;  4DYR A;  3HOX J;  2IEK A;  4B1R A;  2R5Z A;  3RZO J;  3LSG A;  4Y52 J;  2XPW A;  2TRT A;  1JGG A;  3HM5 A;  4FE7 A;  3ZQH A;  3BQY A;  3HBL A;  1ETW A;  3BG5 A;  3SJM A;  5C3E J;  2DMU A;  2GLO A;  1JJ8 C;  3G1O A;  1B72 B;  1B8I A;  5F0F A;  2GBY A;  3MKL A;  3JRB A;  3ZQF A;  3S14 J;  2Y31 A;  3S1R J;  2E2J J;  1E3O C;  5F04 A;  1ETV A;  3BG9 A;  1MSE C;  1RKT A;  1T56 A;  1QPI A;  1TC3 C;  1GVD A;  3S1Q J;  4D7N A;  2L7M P;  4QIW N;  1ITY A;  2E1O A;  2NS8 A;  4JX6 A;  1WPK A;  3RZD J;  1H88 C;  1B72 A;  2P81 A;  2H1K A;  3H3V K;  3Q0V A;  3TED A;  5EZG A;  1HOM A;  3ZQI A;  4M6V A;  5C44 J;  1QVU A;  5EZH A;  5E3O A;  3HOW J;  1I50 J;  1Y1W J;  2L0K A;  1D5Y A;  3VPR A;  1BA5 A;  2I10 A;  1TWG J;  3PM1 A;  2HXI A;  4M3G A;  3SDG A;  3JRA A;  1X2N A;  1MNM C;  4A3G J;  5JLW A;  1GV2 A;  4QSH A;  5FJ8 J;  2VUM J;  1P7J A;  2JA8 J;  1WH7 A;  3ZQC A;  3RQI A;  5E3L A;  3GTJ J;  2VKE A;  4QTR A;  1DU0 A;  2DMP A;  1VI0 A;  3S1M J;  2DA3 A;  1SFO J;  3K7A J;  2E19 A;  4L5E A;  2LLK A;  4D7M A;  3GTK J;  3Q0U A;  4A3I J;  1FTT A;  1ZR4 A;  2DJN A;  3FIS A;  2X9D A;  1U9N A;  2KT0 A;  9ANT A;  2CUE A;  5EG0 B;  5J1Y A;  1RKW A;  4DYQ A;  2E2H J;  1O4X A;  3CMY A;  2H8R A;  1IV6 A;  5F0H A;  2DA1 A;  1T33 A;  2Y0S N;  3C2B A;  2DMN A;  1LE8 B;  3B6C A;  1RET A;  3G1L A;  1FTZ A;  2MGQ A;  2XRL A;  3NAU A;  1VND A;  5EGO B;  2EZI A;  1JKQ C;  3TW6 A;  4IHX A;  3OIO A;  3BR6 A;  2JN6 A;  1G2H A;  5IP9 J;  3FKI J;  5M5W J;  2HXO A;  3IH4 A;  2KDZ A;  2R0Q C;  3UKG A;  2XPV A;  3K2A A;  3PO3 J;  2R7Z J;  2LK2 A;  4RDU A;  2DTZ A;  2NVX J;  1K61 A;  3BTL A;  4IHW A;  1Z77 A;  3A03 A;  2O7O A;  5IOZ A;  4M3E A;  2VI6 A;  4B4C A;  2HOA A;  5F27 A;  3GTM J;  4DZJ A;  4A3C J;  4A93 J;  5J3L A;  2K9S A;  4W1U A;  3WHB A;  1H89 C;  5EGO A;  1BW6 A;  1B8I B;  5M3F J;  2ME6 A;  4BY7 J;  1VFC A;  3TP0 A;  1AU7 A;  4GFB A;  5M5X J;  4Y7N J;  3PO2 J;  1JUS A;  2LVS A;  5EF6 A;  1MH3 A;  2M2E A;  1ZGW A;  2HQ5 A;  1I6H J;  1NK3 P;  2MW8 A;  4BXX J;  4RBO A;  1ZQ3 P;  4NDL A;  2CRG A;  2EZK A;  3GBG A;  3IH2 A;  1MH4 A;  5FKN A;  2Y9Z A;  5FKM A;  2IBD A;  2NOG A;  3G1M A;  4IHV A;  1Z0X A;  3JRC A;  2JJ7 A;  1MBG A;  3CQZ J;  3BTJ A;  5IOY A;  2K40 A;  3IH3 A;  3S17 J;  2LR8 A;  3LSJ A; 
#chains in the Genus database with same CATH topology
 2LRE A;  2QF7 A;  3K4K A;  5CQE A;  2AXT C;  5D8L B;  2A6E F;  1MBE A;  2V1U A;  2EJR A;  4HDV A;  2E7W A;  5J4Y A;  3I64 A;  1W7P A;  2VOD A;  2D2W A;  3F9K A;  2RQP A;  3SEZ A;  1VQK I;  3CCM I;  3QRF F;  4ESB A;  5B1A H;  2R7Q A;  2JTV A;  2LD5 A;  4RLF A;  3PUB A;  5K7H A;  1JTX A;  1WCM J;  1R23 A;  3TOB A;  1XD7 A;  1QNT A;  4CHU A;  2DMT A;  4IQ4 A;  4BXU A;  2IS1 A;  3JR9 A;  3EYY A;  1TWC J;  2CQ7 A;  1Q1V A;  3M7G A;  4P1W A;  2X1C A;  3HRM A;  3LSI A;  3GTL J;  1TW2 A;  3KP2 A;  1VQ8 I;  4A3M J;  3HGG A;  4ABZ A;  3A0H C;  2V1X A;  4BY1 J;  4I02 A;  3CD6 I;  2O61 A;  4LFU A;  1D1A A;  3H92 A;  2ZSI B;  3J80 Z;  3I71 A;  4DW6 A;  3J80 K;  3Q0W A;  1BOA A;  1YIJ I;  2HYG D;  1XMA A;  2PMH A;  1WZ2 A;  1PDN C;  3I54 A;  2Z16 A;  1OR7 C;  2K9Q A;  2RC4 A;  3G3Z A;  3A1Y A;  3U9G A;  4BE1 A;  1K6O A;  1EF4 A;  4XR6 A;  2QQA A;  1JUM A;  5IYD J;  2E5Z A;  2Y69 H;  2M4G A;  2L4A A;  5ICF A;  3V8J A;  4UHT A;  1VQO I;  1FYK A;  2QKM B;  1BI2 A;  2DCE A;  4BEH A;  5DUI A;  2LDU A;  3BP8 A;  2MG4 A;  1HBX G;  1UMQ A;  2Z9O A;  4NBQ A;  3OYC A;  3E0J B;  2ZCW A;  2EFQ A;  1XG1 A;  2QZ8 A;  4UUV A;  1D8K A;  2X1D A;  3KZZ A;  4B8X A;  5LGN A;  5FRO A;  4BS9 A;  1M1E B;  1LVA A;  4XON A;  1VQ7 I;  1WFX A;  5E8G A;  3GME A;  2EV5 A;  5L3F A;  4HST A;  1OIS A;  1XCB A;  2KHM A;  3L09 A;  1WSU A;  1I5Z A;  4M74 A;  4XLA A;  4OWR B;  4ON0 A;  3T0Y A;  4IHT A;  5K5O A;  3AL0 C;  4A6D A;  1TWF J;  3F8M A;  1S29 A;  1SC7 A;  4ENN A;  5HDG A;  2ZME A;  3HOS A;  1BN5 A;  5GPC A;  2E2I J;  3CMM A;  3JRE A;  2NS7 A;  4J00 A;  2OUM A;  2YR2 A;  1VQ4 I;  2IVM A;  4C2M J;  2W48 A;  3A01 A;  1EV7 A;  2PJP A;  4YEL A;  3R0J A;  2GXG A;  1FMW A;  4KJZ A;  2L9N A;  4NC8 A;  5FLX K;  1LJ9 A;  2HKX A;  1RPW A;  2LBF B;  2B7E A;  3ZXS A;  1MMS A;  3IRR A;  3KP4 A;  3CCE I;  4HOB A;  3CUQ B;  4UUT A;  3Q3S A;  3F8C A;  3SXY A;  2FML A;  1BJA A;  1G3T A;  2Q2E A;  2XUB A;  2FX0 A;  4BBS J;  4U7B A;  3ABK H;  2Y30 A;  1YS7 A;  1FSE A;  4HPQ A;  4CIC A;  2CO5 A;  4BHC A;  3BQZ A;  5K5R A;  3JRI A;  1U3E M;  2A07 F;  2LFB A;  3DEE A;  4D1Q A;  2EV0 A;  1ZGJ A;  4IPA A;  4CSW A;  2X51 A;  3HB9 A;  5FB2 A;  1R5I D;  4JBA A;  5TJJ A;  4L18 B;  1ETY A;  4LOC A;  3M8J A;  4Y13 A;  2ZFW A;  3VSK A;  2DK8 A;  1AHD P;  4CCO A;  1NK2 P;  2X48 A;  1F43 A;  2HVR A;  3BY6 A;  4HW0 A;  1Z7U A;  1ZG5 A;  2JA7 J;  5B5E C;  1S3J A;  2M8G X;  4HF0 A;  4MO7 A;  1YX3 A;  5BMZ A;  2XB5 A;  3JTH A;  3S16 J;  1ETK A;  3OS0 A;  1PUF A;  2L7Z A;  2EIJ H;  4HNT A;  1HST A;  3EET A;  3TBI A;  3KP6 A;  4GO1 A;  3FF5 A;  3IUO A;  5KNL A;  3BLY A;  1H9T A;  4RB1 A;  2M30 A;  1FYL A;  4A3L J;  2A68 F;  2YS9 A;  4B47 A;  3QU3 A;  5ILS A;  1J2X A;  2TCT A;  1SVM A;  5J8C A;  4LMY A;  1ZRE A;  2QBY A;  2XKO A;  4BE2 A;  3CP8 A;  1R00 A;  4NNJ A;  1T98 A;  1ZKG A;  2M34 A;  5DDG A;  4UUS B;  4NHJ A;  1J0R A;  2DT5 A;  2XAG A;  4RB0 A;  3SZP A;  2C6Y A;  1IXR C;  3FXM A;  4IX7 A;  2AHQ A;  1ONV A;  5IYB J;  2Z1D A;  2JSP A;  2K9L A;  1T38 A;  2F5C A;  5GTI C;  2ECC A;  2ISY A;  3NQO A;  3RDI A;  2FQ3 A;  3HKZ N;  3JW4 A;  4FIS A;  3H0G J;  2MH2 A;  1FX7 A;  1SEU A;  2CQQ A;  2DXI A;  2M0M A;  4XL9 A;  1XB4 A;  2DA5 A;  1FT9 A;  3AG3 H;  1E2X A;  3NAR A;  1K79 A;  1KA8 A;  3GLX A;  5DEQ A;  4BBR J;  1R1V A;  3VYR B;  3EYI A;  2BGC A;  4I76 A;  2F5V A;  4X1E A;  3M8F A;  3WTW C;  2HDC A;  1ZH5 A;  1AOY A;  3HOU J;  3GEZ A;  1F36 A;  5M5Y J;  5EEA A;  1MBK A;  3IRQ A;  2QGU A;  3GFL A;  4W97 A;  2RAE A;  4RMN A;  2WB1 A;  3G71 I;  2IGM A;  1JKO C;  2ME0 A;  4ZYA A;  2V9P A;  4D5C A;  2D5V A;  3VB2 A;  3IKT A;  1P6R A;  5K7F A;  2QEN A;  3K69 A;  3SZT A;  5ICC A;  2OF7 A;  2HTS A;  1DGW Y;  2D45 A;  1RC9 A;  1X19 A;  4JP0 A;  2CW7 A;  4IEJ A;  2IXS A;  3L2W A;  3RIR A;  3ECH A;  3V4G A;  3HDD A;  2A69 F;  2AS5 F;  4WCG A;  2FOW A;  3AFH A;  1F1Z A;  1PP8 F;  4HBL A;  2K3F A;  3DKX A;  1LE8 A;  1VF9 A;  2R5Z B;  1XSV A;  3H36 A;  4MTE A;  4HYE A;  4D0P A;  5FKK A;  5ICG A;  1P7I A;  1I6X A;  2M87 A;  2A61 A;  1B9M A;  4XN3 A;  5GP9 A;  3H9Q A;  1B59 A;  1GV5 A;  1FY7 A;  2M1B A;  1UHM A;  3OS1 A;  1Q1H A;  1H9G A;  3LQQ A;  2K3P A;  1GT0 C;  2R7D A;  2Z3Y A;  4UB6 C;  2XB0 X;  2EBI A;  1GXQ A;  2ZC2 A;  4DYR A;  4MEX F;  3HOX J;  2GIZ A;  3E3V A;  4Y52 J;  3A4C A;  2R7W A;  4EM0 B;  4P96 A;  3BQY A;  1ETW A;  3SJM A;  4Z2Y A;  2DMU A;  3H5N A;  3MZY A;  1B8I A;  1WI9 A;  5F0F A;  3DBR B;  1YW9 A;  3MKL A;  4NB5 A;  3JRB A;  1EKE A;  4CGZ A;  1Z7L A;  4PCQ A;  4XOR A;  5F04 A;  2FNP A;  1KQ9 A;  2FSW A;  1T56 A;  2V9K A;  1K78 B;  1QPI A;  1GVD A;  3WGH A;  1XDS A;  5D5V B;  2WA0 A;  4D7N A;  4BAY A;  4ENM A;  3TGN A;  4QIW N;  1TT0 A;  2RV8 A;  5KCM A;  2R7X A;  2X6Y A;  1MNE A;  1ITY A;  5D4R A;  1WPK A;  2IW5 A;  2FE3 A;  1A04 A;  4M72 A;  5LLQ A;  2GZW A;  3KP3 A;  3H3V K;  3GZ6 A;  5L3E A;  1P4W A;  1N77 A;  2R7U A;  5EZG A;  1HOM A;  3ZQI A;  5LFA A;  4KFC A;  1QVU A;  2ZBK A;  2A5W A;  2DK5 A;  2DFE A;  1HSJ A;  5E3O A;  1I50 J;  5H2F C;  3OYA A;  4MGR A;  2VT2 A;  1K7A A;  3LSH A;  2HWV A;  3HXL A;  2UXX A;  3VPR A;  1TWG J;  3HIF A;  3GWZ A;  2HXI A;  2V4J C;  1K4T A;  3KLN A;  3OL3 A;  4XKW A;  1BR2 A;  2CYY A;  4K2E A;  3FXL A;  4A0Y A;  5JLW A;  4LG0 B;  1R4N B;  2W24 A;  4O5V A;  1UAA A;  1B6A A;  1BM9 A;  3G73 A;  3V7S A;  3CC7 I;  1IRX A;  1I27 A;  1P7J A;  1WH7 A;  2H09 A;  3F3X A;  3WG9 A;  5EEG A;  4BUP A;  4KYW A;  2A6H F;  4P5O A;  4RGS A;  4EMS A;  2CUZ A;  2ESN A;  2VKH A;  2PJR B;  3E97 A;  2DA3 A;  1SFO J;  2OC6 A;  3K7A J;  3WU2 C;  2LLK A;  2HR3 A;  4D7M A;  1IZ1 A;  3Q0U A;  1QQI A;  1FTT A;  4OIP F;  1WJ5 A;  1N25 A;  3ONQ A;  4LIV A;  1HW5 A;  2AQE A;  5J6X A;  2CUE A;  1FBU A;  2ADU A;  3ELK A;  2D1V A;  4BXF A;  5CVI A;  3GX4 X;  1RZ4 A;  4XLF A;  1HQC A;  1YS6 A;  2DFI A;  3E5U A;  3D5L A;  2R7O A;  3GXO A;  2NAZ A;  3B6C A;  3FMQ A;  3G1L A;  4KIC A;  1FTZ A;  3FXO A;  3X2Q H;  4XBF A;  2EZI A;  5BPD A;  1JKQ C;  1QHH D;  3TW6 A;  1MJ9 A;  3BR6 A;  1Z1D A;  3E6B A;  3LST A;  2JN6 A;  3B02 A;  1G2H A;  1XGN A;  4NQW A;  2A5Y B;  2PN6 A;  2EFN A;  3K4N A;  2QVO A;  4UB8 C;  4L9N A;  1JI8 A;  3K2A A;  4EM2 A;  1IXS B;  2LK2 A;  4RDU A;  1K61 A;  3BTL A;  4RM3 A;  3WTY C;  2IGK A;  3S93 A;  4XNF A;  4EGZ A;  5IT3 A;  2VI6 A;  4IZZ A;  2HOA A;  5F27 A;  3U21 A;  2VJ5 A;  4DZJ A;  4I01 A;  4OIN F;  2XF6 A;  4F55 A;  2O8X A;  4DIQ A;  1H89 C;  5DYM A;  3QYF A;  1WJF A;  1FNN A;  3KCC A;  2BXZ A;  5M3F J;  2XDV A;  4BY7 J;  1XTA A;  1AU7 A;  3TKY A;  5EEH A;  4TV7 A;  2R7F A;  4UNO A;  1JUS A;  2P5V A;  2Z5U A;  1CGP A;  1I6H J;  1IV8 A;  2LF8 A;  1X1C A;  4BXX J;  1ZQ3 P;  1TNS A;  4YEJ A;  1W7P B;  3GBG A;  3NRV A;  2IBD A;  5CVR A;  4CCK A;  3TO6 A;  3D0S A;  3DTK A;  3LSK A;  4PSX A;  3JRC A;  3HSR A;  1MBG A;  2RNJ A;  2BW3 B;  2LR8 A;  2UXN A;  1YG2 A;  1XN7 A;  4YFX F;  4JQF A;  3R0A A;  4WWC A;  1U78 A;  3BCB A;  2DQL A;  3NEU A;  5CPR B;  2VAS A;  1Z3Y A;  3J7A O;  3C1D A;  4FQG A;  1QA6 A;  2OTL I;  1MIJ A;  5LEJ A;  2F2E A;  1UCR A;  2EH3 A;  2GA2 A;  3FMR A;  1LDJ A;  1E3H A;  2JA6 J;  3OYI A;  3BZC A;  2HOE A;  4XMY A;  4ZZD A;  1IN5 A;  2LG4 A;  3LSR A;  2VON A;  3V7C A;  1YYV A;  1ZRD A;  2V1D A;  3TP3 A;  2LKP A;  3R6S A;  2HKO A;  2IJL A;  1YFH A;  2V9V A;  3RPU A;  1PVE A;  2CUJ A;  2VBZ A;  4LG3 A;  2R3S A;  3FX3 A;  4HX4 A;  1W36 C;  4BEH B;  1IUY A;  3WHC A;  2EA2 A;  2HDW A;  2VLA A;  2IP2 A;  4L0Y B;  1MJA A;  4O3M A;  2F4M B;  5TGT A;  1J59 A;  2FD5 A;  2M7B A;  2WBM A;  3GFJ A;  3OR2 C;  1SD6 A;  5BNG A;  1IRZ A;  1ZEL A;  4RS8 A;  1A6Q A;  5ICE A;  3O2P E;  2R5Y A;  1XGM A;  4ZZL A;  3VOD A;  3EUA A;  3OYE A;  3RTR A;  2RKH A;  2IT0 A;  4CO8 A;  4C3I J;  3TW7 A;  1KON A;  4B48 A;  4Q5S F;  4AIH A;  5LBQ A;  3LAJ A;  2CSO A;  3ZMD A;  3GTG J;  3JCU C;  2HTJ A;  1YOV B;  1ZLK A;  1RI7 A;  3RQ4 A;  3ZN1 A;  2VN2 A;  1SD7 A;  4BYY A;  1LUJ B;  2E34 A;  3FXK A;  4YFN F;  4QLC U;  1LPQ A;  1BIB A;  3HSF A;  2Y2Z A;  1JT0 A;  1A35 A;  2DOE A;  4BQO A;  2EB7 A;  5D4S A;  1RUN A;  1GDT A;  3A01 B;  2P6S A;  5IP6 A;  2PQ8 A;  2ECB A;  2ELK A;  5LHH A;  2WV1 A;  2VJJ A;  2O5R A;  3SZG A;  3OSG A;  3DPT A;  2V7F A;  2KIQ A;  3H5R A;  3OYJ A;  2IRF G;  2OTJ I;  3CCU I;  1X1D A;  4AYB N;  1QGP A;  1UG2 A;  2W57 A;  2ZSH B;  4NUB A;  1OKR A;  1OPC A;  1WI3 A;  1WKM A;  3M07 A;  2ELJ A;  2Q2E B;  2I5U A;  3CDI A;  3H3U A;  3LFK A;  4N9H A;  1R1U A;  2ID6 A;  3CLO A;  4Y15 A;  3IAS 2;  5L3G A;  5A2Q K;  1E0E A;  3K2Z A;  3MZ8 A;  2BBY A;  1HF0 A;  4OOI A;  3S3M A;  4CUG A;  1TQM A;  1ZG3 A;  5DCF A;  1MD0 A;  3ZQL A;  2H27 A;  3LSP A;  2WWY A;  1YIO A;  1FOY A;  3BPV A;  2WAQ A;  4XID A;  2IS6 A;  2HQR A;  4HNV A;  4A3J J;  3KIO A;  2E36 A;  3S3O A;  1YI2 I;  3AL0 B;  3CF5 F;  3LNQ A;  1G4D A;  2JVH A;  4A3B J;  3CP2 A;  2ZXJ A;  4C3H J;  2H6C A;  4HX8 A;  2G0E A;  3PIP F;  1O3R A;  3W2W A;  2IA1 A;  4EM1 A;  4IO9 F;  2E7X A;  4A3K J;  5H6Q A;  2E1C A;  1V54 H;  2R93 J;  2DN0 A;  2XIG A;  3P9C A;  3QP6 A;  1U0J A;  4M71 A;  5BQT A;  4QPO A;  1Z67 A;  1K4S A;  2PI0 A;  1BI3 A;  1LDD A;  3FK6 A;  2DA4 A;  4PJ0 C;  5JHF A;  2HVS A;  1S7O A;  4RGR A;  4CYC A;  4PK4 A;  4A3D J;  1PUF B;  4G7H F;  4G12 A;  1H0M A;  2BV6 A;  3L00 A;  4D5F A;  2JQ7 A;  1X2M A;  3OMY A;  4EJV A;  1IG7 A;  4I98 B;  3TOA A;  1YQA A;  4C9Y A;  1BW5 A;  1Y1V J;  1FIA A;  1MBJ A;  4GDF A;  5DD8 A;  4G8X A;  2PMU A;  1YW8 A;  3L2V A;  5E1X A;  5EDN A;  2B63 J;  4ASN A;  2M0C A;  4FET A;  1IXC A;  1T2K A;  1LFU P;  4F92 B;  3I59 B;  1XMK A;  1ORK A;  3CJT B;  5F1J A;  1QPM A;  2DOF A;  4H0E A;  3EUH A;  3BT9 A;  4PUS A;  1JTY A;  1I3Q J;  4XRS A;  5HDN A;  3F23 A;  3J7A Y;  2L5Q A;  1TP4 A;  3CZ6 A;  1LFP A;  2ZME C;  1Y0N A;  2VE8 A;  4P9F A;  5FO5 A;  3RI4 A;  5FD5 A;  4BJT A;  2DA2 A;  3BZ6 A;  4YG2 F;  3JRD A;  2JUG A;  1J7K A;  3SQN A;  1SMT A;  2EZH A;  4A5M A;  3FK7 A;  3T8R A;  1O7F A;  1WH5 A;  1F4K A;  4Q48 A;  1O3Q A;  1LEA A;  1POG A;  2DI3 A;  1YHQ I;  1EA3 A;  3OWT A;  1TWA J;  3K70 C;  1YW7 A;  5LHG A;  1R58 A;  3HUG A;  2NVT J;  2XHK A;  3BR3 A;  1FIP A;  1XC5 A;  4FCY A;  3BG6 A;  2DO7 A;  1HA8 A;  1S6L A;  4UXN A;  1DP7 P;  1XX5 A;  1MZB A;  1QZY A;  1ZK8 A;  2DFF A;  2QSG X;  5HLG A;  3ABU A;  2E35 A;  3DWL E;  3K1M A;  4U0Y A;  3KP7 A;  4J01 A;  2F4I A;  5E3M A;  4HQM A;  4M6Y A;  2FBK A;  3U1D A;  3GO5 A;  3O6B B;  3M4O J;  2BZT A;  2IPQ X;  3UNG C;  2IA0 A;  4S04 A;  4GXO A;  4LB5 A;  4JYK A;  4DQ2 A;  2RVC A;  2LKX A;  4UV8 A;  1OCC H;  2CQX A;  1W0U A;  4U0V A;  5BOX A;  4BKX A;  2BYV E;  4WXD A;  3PL8 A;  1W36 D;  5J1R A;  3QPL A;  2F48 A;  3I58 A;  3MKZ A;  3F8B A;  4A5N A;  3K4M A;  1SAN A;  1ZLJ A;  2M3A A;  3IC7 A;  3CF2 A;  1R5H A;  1ETQ A;  2HZD A;  3H9J A;  5HS9 A;  5FLX Z;  2EFO A;  2ZB9 A;  1BI0 A;  3ZGK A;  3RKX A;  1LB2 A;  1A6I A;  3ZPL A;  1JE8 A;  3BG7 A;  1LNW A;  4OAY A;  2R7V A;  4C3J J;  4KA4 A;  4MTD A;  1SAU A;  3O8G A;  2DPD A;  3K0L A;  4KT5 C;  4U87 A;  5F0C A;  5EG0 A;  4ZTF A;  3CO6 C;  1IRG A;  3DPU A;  1MMG A;  3ABM H;  3SHF A;  1B1B A;  3M1E A;  4AM3 A;  1U5T C;  2K9N A;  5HOO A;  1SMY F;  1XMX A;  3M3Y J;  3N97 A;  1ZGA A;  3T1B A;  2FOK A;  2HI3 A;  3T5X A;  1PJR A;  4MFD A;  1OLT A;  3RKY A;  5J1U A;  2OD5 A;  3LOC A;  2L01 A;  3CDH A;  1BL0 A;  1WJE A;  2ZKZ A;  2CU7 A;  2DMQ A;  4I7H A;  3S2W A;  5ILV A;  4RAY A;  1KZH A;  2OZU A;  3OYM A;  3BG3 A;  2YUS A;  1Y56 A;  2OPT A;  1QZE A;  4A69 C;  5B66 C;  1JKP C;  1ON2 A;  5E18 F;  4RGU A;  5KAI C;  2Z99 A;  3DEW A;  4RB2 C;  3G4S I;  2CGP A;  3Q9V A;  2K85 A;  3LSG A;  3WOD F;  1I1G A;  1YE9 A;  4EV0 A;  1MDM A;  2V6E A;  2TRT A;  1W7P D;  5D6E A;  1K6Y A;  2XGX A;  3OYL A;  1JJ8 C;  4C2U A;  2MYS A;  1D5V A;  1X4O A;  3S14 J;  4XLN F;  3ZQF A;  3WTX C;  4HLY A;  2VJ4 A;  3WTS C;  3DPL C;  2E2J J;  2PMZ A;  1W1W E;  1ETV A;  1JHF A;  4IXA A;  1MSE C;  3H9G A;  3BJ6 A;  3Q9S A;  1WJD A;  4N4N B;  2QLZ A;  4LK0 F;  1U5T A;  1LDK B;  2QQB A;  2CQK A;  3OYD A;  1R7J A;  5FGM A;  1G6N A;  1YIT I;  2E1O A;  4JX6 A;  1P4X A;  2V1N A;  1E17 A;  3V8L A;  3W6K B;  1H88 C;  1ZHF A;  4FT8 A;  5B1B H;  3VOE A;  2HU9 A;  4EJW A;  5GAH J;  1TT5 B;  4XLE A;  4M6V A;  5C44 J;  5EZH A;  3HOW J;  3CJR B;  1Y1W J;  4HEA 2;  3ESW B;  1RNL A;  4E6K G;  1FC3 A;  5HLI A;  5DV5 A;  3KET A;  4PFO A;  3SDG A;  3KEY A;  4A12 A;  2B9S A;  2W4S A;  2LMD A;  1GV2 A;  3L9F A;  1FMV A;  2P5K A;  5E3L A;  2VQG A;  1Z6T A;  4H4K C;  3GTJ J;  2QM3 A;  4QTR A;  4KDP A;  3ABT A;  5F64 A;  3FHN A;  4ENJ A;  5CLS A;  5CKT A;  5HNF A;  4G6T B;  2E19 A;  1WVR A;  3P9K A;  1VQ6 I;  2CQN A;  2VXD A;  1ZR4 A;  3FIS A;  2K4J A;  1U9N A;  9ANT A;  2H94 A;  2AQF A;  1TQI A;  4NC7 A;  3HHH A;  4NQW B;  5D6F A;  5J1Y A;  1FOX A;  2NXN B;  3C2G A;  2XAH A;  3KYC B;  1RRJ A;  3CMY A;  2H8R A;  4IOA F;  1D1B A;  2JPC A;  3AG4 H;  5F0H A;  2Y0S N;  3C2B A;  1D3Y A;  4AIJ A;  2DMN A;  4FHT A;  4CCJ A;  2MA3 A;  1I1S A;  3ABL H;  3WTV C;  4Y17 A;  4LLG F;  4HV5 A;  4MEY F;  1RET A;  2MGQ A;  2QWW A;  3K9T A;  2A05 A;  3ZMV A;  4LIT A;  2NS0 A;  3OIO A;  2VQC A;  4CA0 A;  2E1N A;  4IRG A;  5M5W J;  5K5Q A;  4CZZ A;  2CFO A;  4E7Z A;  1GLN A;  2EA4 A;  3IH4 A;  2MBF A;  1ON1 A;  1CF7 B;  2X0L A;  3PO3 J;  2CMP A;  3JAM Z;  1TLH B;  1F9N A;  3WTU C;  3JAM K;  4BH9 A;  3K70 D;  2O7O A;  3QP5 A;  5HLH A;  5JVG F;  3ZMS A;  2Y0M A;  3GTM J;  1XGO A;  2DOD A;  4HG2 A;  4A3C J;  4A93 J;  3BC8 A;  3VSL A;  5EGO A;  2ACJ A;  4AVP A;  4G6Q A;  2LOO A;  3ZQ7 A;  2DU9 A;  2W85 A;  2X85 A;  3I56 I;  2CG4 A;  2X6X A;  5DUK A;  4DNC A;  2CV1 A;  3ECO A;  3M9A A;  5CYV A;  2FXA A;  2B0L A;  2HQ5 A;  1ZGW A;  2MW8 A;  2VL8 A;  4RBO A;  4CYD A;  3BPX A;  3M1C A;  1SFX A;  3KPH A;  2CRG A;  3K1P A;  4U0W A;  3ZP5 A;  4OIQ F;  4E7J A;  2GOM A;  2LY1 A;  2VOO A;  2KL4 A;  3BJA A;  2NOG A;  2LBF A;  1LQ1 A;  4KMU X;  4IHV A;  1X3Z B;  2MH9 A;  3RKW A;  3S3N A;  2CV2 A;  2KLO A;  3WGG A;  2FBI A;  3CQZ J;  5IOY A;  2K40 A;  2W1O A;  3CUQ A;  3S17 J;  2L3D A;  4LB6 B;  2YPR A;  3LSJ A;  2LC2 A;  1OCT C;  4KIS A;  2FEZ A;  2M4K A;  2UV1 A;  3H0D A;  2K86 A;  3BTC A;  2HOS A;  3MKW B;  3L2R A;  5LD2 C;  4G94 A;  2ICW G;  3F22 A;  5DS9 A;  3I4P A;  4Z6Y A;  4LGW A;  2DA6 A;  2ZXW H;  4JX4 A;  1J9I A;  1XDU A;  1Y0U A;  2LP0 A;  3L7W A;  4B44 A;  1ZAR A;  1ZRF A;  4HSR A;  5D5X B;  2X1E A;  2RQQ A;  5CJ9 A;  3DBL B;  4RGX A;  4AU7 A;  1FJL A;  4U7D A;  2DA7 A;  2XAS A;  2IS2 A;  1ZN2 A;  2GIV A;  3FMS A;  1FOK A;  3DV8 A;  4R79 A;  3ASO H;  3RKQ A;  1UHS A;  2XSD C;  4I2O A;  3L2U A;  3DCF A;  1V5E A;  5D5U B;  1B9N A;  3FKJ A;  3S15 J;  1DU6 A;  2VBY A;  2UUZ A;  1G3W A;  2H8W A;  4PGG A;  2JT1 A;  5HOD A;  4HA8 A;  3I4N J;  3JRF A;  3DU5 A;  5K7Z A;  4HV6 A;  3JTG A;  1WGX A;  4BQA A;  2DTR A;  3ZCO A;  2XGE A;  1IC8 A;  2X6O A;  2ZJQ F;  3DTE A;  3B6A A;  2LH9 A;  2H6B A;  2HOT A;  2ZNZ A;  3L2Q A;  5E1W A;  3E6D A;  4A3E J;  3K4C A;  3DU6 A;  1UG0 A;  3AG1 H;  3KEO A;  3OYN A;  4WK8 F;  3P7N A;  4I09 A;  4IOC F;  4FTH A;  4BHP A;  2VC1 A;  2LYC A;  2HYJ A;  1TTY A;  2E5N A;  3GTP J;  1ZTR A;  5GAG J;  3I3L A;  4LLN A;  3HEF A;  3CJQ B;  5JI6 A;  4F52 A;  3CME I;  2QA4 I;  3QYE A;  1OJL A;  2OV7 A;  1EJ9 A;  4ZYH A;  1E3P A;  2O03 A;  2P4W A;  2MAB A;  5IYC J;  1KQ8 A;  5IT9 K;  3IL2 A;  1OFC X;  3GF2 A;  5FRN A;  2A6T A;  3C18 A;  4AVZ A;  2FJ1 A;  2JA2 A;  2NNY A;  5FD6 A;  1R6R A;  4I99 C;  2BOL A;  5D8K B;  3GW2 A;  3MMY B;  1X1B A;  3WTZ A;  1QBJ A;  2YU9 J;  4KMF A;  3VFZ A;  3QYB A;  3I4M J;  2WY8 Q;  4HZF A;  4BJ6 C;  1U2W A;  2EPF A;  3C3W A;  3DF8 A;  2QSH X;  5EYR A;  2LNB A;  3AAF A;  1ETX A;  4ZC3 A;  2JPB A;  3F0C A;  2L4M A;  3M8E A;  3F8N A;  1JJ6 C;  4RB3 C;  1X1P A;  3CCL I;  3MD2 A;  3CCS I;  4XRM A;  3BR1 A;  1AKH A;  4CYC B;  2A3S A;  1VZ0 A;  1BR4 A;  1T8I A;  3MQ0 A;  2KDO A;  3CO7 C;  1YRN A;  3O3K A;  1V5G A;  3F6V A;  2DYR H;  4XK4 A;  2O8K A;  3OIP A;  4ZYE A;  2PBI A;  3ZMT A;  5HDK A;  5F1R A;  2F4O B;  3EQL F;  4M9X A;  2K7L A;  5FKO A;  1IDY A;  3J7Y J;  4WX9 A;  3V42 A;  1RUO A;  2XPU A;  3LQR A;  1IJW C;  4V2F A;  5HS7 A;  2FUG 2;  3GFI A;  2OAZ A;  1O3S A;  3CMA I;  1D0X A;  3LFU A;  1OCP A;  2X4H A;  4KIG A;  1TQP A;  2QQ8 A;  4R8H A;  4AID A;  1NHA A;  2PLY A;  2L02 A;  4YII A;  2ZJR F;  1ZAO A;  3S2D J;  4KNY A;  3ZQG A;  2Q1Z B;  4BL0 B;  2VIX A;  4I6Z A;  2VT3 A;  2CJJ A;  3IAM 2;  1EH7 A;  1KGS A;  3FZV A;  1C0W A;  2HNH A;  4XN0 A;  1P92 A;  1N75 A;  2BXY A;  3OL4 A;  4I0B A;  4YRV A;  3F8F A;  3QOD A;  4OIO F;  4MQ9 F;  4ESJ A;  4PJM A;  5E3N A;  1HKQ A;  5LGT A;  3FM3 A;  3HRU A;  3DBH B;  4XRS G;  3QQA A;  1XSX A;  3VEP A;  2EIL H;  1YJ9 I;  2KP6 A;  4AWX B;  1LKX A;  1Z6R A;  3MFK A;  2XGC A;  3HUG B;  4DZP A;  3GTQ J;  1PYV A;  4EQQ A;  1DGR M;  2JRM A;  4PJN A;  4A3F J;  4V19 K;  3J7Z I;  1BI1 A;  3FBN B;  1H8A C;  4MQV A;  2L9V A;  4JOM A;  4BNC A;  1YLF A;  1K78 A;  1RIO H;  2ZO4 A;  3GTO J;  1JGS A;  2STW A;  2V6C A;  2OBP A;  3MN2 A;  2ESH A;  4AUX A;  4FE4 A;  1ULY A;  4ZH4 F;  4A6E A;  5H6R A;  1ENH A;  3G2B A;  1T6S A;  3HTU A;  3J81 K;  3R60 A;  1MND A;  3K4L A;  4RA2 A;  5HVQ C;  3D1N I;  2FNA A;  3WE2 A;  5E8I A;  1WQ2 A;  2L9R A;  2WB1 N;  2DYS H;  2BVL A;  2KRC A;  2OJE D;  3HOV J;  2ZME B;  4M3D A;  5LEK A;  3CDL A;  3HOT A;  2HEO A;  2P6T A;  2KKO A;  1XGS A;  3E6C C;  1X4P A;  2JK3 A;  2LY2 A;  1WJC A;  2OA4 A;  2QQ9 A;  3IHU A;  1HLV A;  1BJZ A;  2QSF X;  3C7J A;  4QPQ A;  1UJ8 A;  4E7I A;  2JRT A;  3GVA A;  5GPA A;  1KU2 A;  1X58 A;  3HKZ A;  3RPQ A;  4F93 B;  4B3A A;  1YO5 C;  1OQY A;  4Q4Z F;  4XLC A;  1JT6 A;  5KVR A;  5IPA A;  2VPR A;  1MBH A;  4JX5 A;  2KMU A;  2KRH A;  4YFK F;  3DQV C;  3PNY A;  4G7O F;  4L9T A;  3CLQ A;  3SFI A;  3L2C A;  1HDP A;  3OYG A;  4ZJZ A;  1MMN A;  2P8T A;  5A2Q Z;  4MLO A;  1UHW A;  4ZYD A;  4HQE A;  1T0F A;  5E17 F;  2VQH A;  2VKD A;  1OCZ H;  4M9S A;  4EEF G;  2K27 A;  4KN7 X;  3FXJ A;  3L1P A;  4F3Q A;  3ERM A;  5FKL A;  1IN6 A;  3KZY A;  3OOU A;  4B09 A;  2D1H A;  5IP7 J;  4RM2 A;  3PNT A;  3IV5 A;  1EH6 A;  3FIW A;  2L7K A;  3EUH C;  3TO9 A;  3VDX A;  1JUP A;  1BIA A;  4E4H A;  3CTA A;  1T39 A;  3AG2 H;  4M3F A;  2GA1 A;  3QWL A;  4ANJ A;  4M3B A;  4IJA A;  1TWH J;  2BE5 F;  4UVC A;  4XKB A;  3I55 I;  2ELH A;  1ETO A;  2XSJ C;  1MW7 A;  2MC3 A;  4Y4R A;  4KIT B;  3KP5 A;  1QZZ A;  5L3C A;  4WXH A;  4DOZ A;  1MKM A;  1HXD A;  1IGN A;  4XSZ F;  3ZMU A;  3ASN H;  4KIB A;  1V55 H;  1Z3X A;  3DFG A;  4II2 A;  1HKS A;  2IEK A;  1A36 A;  1D8J A;  3WGI A;  1U5T B;  3WE3 A;  2XPW A;  4L0Z B;  3ERE D;  3HM5 A;  5GAE J;  3HBL A;  2NVU B;  2F5E A;  3KE2 A;  3SDB A;  5C3E J;  2NOJ B;  2GOX B;  3QAH A;  3W2V A;  3HPH A;  4LK1 F;  2XC7 A;  2GBY A;  3GYH X;  3CCQ I;  2W84 A;  2Y31 A;  3S1R J;  3I5U A;  3AKZ A;  1E3O C;  1WJB A;  2QBY B;  3ISP A;  2J5O A;  3SYT A;  2MLK A;  2I8D A;  2P5L C;  3LAP A;  2KIM A;  4LIU A;  3KEQ A;  3MKY B;  3QU6 A;  2IGO A;  4GCV A;  3RPU D;  4XQF A;  1REP C;  2NS8 A;  2H1L A;  4UVB A;  2WC2 A;  1EH8 A;  1B72 A;  2P81 A;  4X0G A;  4IVN A;  3RYR A;  3K10 A;  4GYG A;  2WTE A;  5JVT A;  2M5W A;  2BHY A;  2BW3 A;  5AIQ A;  2L0K A;  2DFH A;  2QYO A;  3E5Q A;  1D5Y A;  1B4A A;  3EPZ A;  2I10 A;  3OYB A;  2FU4 A;  3PM1 A;  5H20 A;  3DKY A;  3BDD A;  3FBI B;  5E79 C;  2OQG A;  3JRA A;  1X2N A;  5IY5 H;  1ERD A;  4A3G J;  1KQ0 A;  2WAF A;  5LRS A;  4QSH A;  2VOP A;  4IHS A;  1TBX A;  2E60 A;  5L3D A;  4RAF A;  3OYK A;  4Y33 A;  4IL6 C;  2VKE A;  1DU0 A;  2DMP A;  3HJE A;  2JUC A;  2O3F A;  2XAU A;  3S1M J;  2GXB A;  1YTY A;  5GTH C;  4BGD A;  4L5E A;  2WAD A;  3SFZ A;  1G59 A;  3H5A A;  1SD5 A;  1SFU A;  3GTK J;  2M8E A;  3LL7 A;  3OOP A;  4A3I J;  1O3T A;  2DJN A;  1QU3 A;  4BQN A;  2X9D A;  2KT0 A;  3PQK A;  2DPU A;  2JZY A;  2W82 A;  2DT6 A;  5J8F A;  3CCR I;  2KFD A;  1RKW A;  3PJR A;  3PSF A;  1O4X A;  3QPH A;  1IV6 A;  2G9W A;  2DA1 A;  3GCM A;  1S8N A;  2DT7 B;  2XVC A;  2YX4 A;  1Z21 A;  1LE8 B;  1ODD A;  1FBQ A;  3PNV A;  3R61 A;  2DW4 A;  4ZDL A;  2E1M C;  4XLH A;  1VQ9 I;  2XAQ A;  1BR1 A;  5GAD J;  2COM A;  3NAU A;  5EGO B;  3P9I A;  4O6J A;  2VB6 A;  1A31 A;  3COA C;  5KAF C;  3PQJ A;  5IP9 J;  3FKI J;  3I9V 2;  1DDN A;  3EDP A;  2HXO A;  2KDZ A;  2R0Q C;  3UKG A;  2XPV A;  3HL2 A;  2R7Z J;  2NVX J;  4OAZ A;  5IOZ A;  2Y75 A;  1OR7 A;  4U88 A;  4UV9 A;  2ZXH A;  4Q47 A;  3ML6 A;  2LSO A;  4D9J A;  4EJT A;  5J3L A;  4MNU A;  2KZV A;  4W1U A;  2FF4 A;  2XAF A;  3E1S A;  1GXP A;  1B8I B;  2R7S A;  3GZ5 A;  4RAZ A;  2ZXI A;  1VFC A;  2ZJ2 A;  5LGU A;  2HFH A;  5M5X J;  3PO2 J;  5FFX A;  2MLG A;  2KJB A;  5EF6 A;  1MH3 A;  3CC2 I;  3TO7 A;  2M2E A;  2XF5 A;  4IRI A;  4YIR X;  4BHB A;  2P7C B;  1WHU A;  2M7A A;  3QOE A;  4NDL A;  1WJA A;  3F6O A;  1FYM A;  2EZK A;  3PSI A;  1YJW I;  4LD5 A;  3IH2 A;  4HAM A;  4OMY A;  5FKN A;  1QO0 D;  3MCZ A;  5CQG A;  5FKM A;  5DCM A;  2VPL A;  2V79 A;  1IF1 A;  3CJN A;  2CW8 A;  5AON A;  3G1M A;  4P55 A;  1Z0X A;  1R1T A;  3ULQ B;  3RSN A;  5ILU A;  2JJ7 A;  1MGT A;  2KIU A;  4II3 A;  1VTN C;  2BHZ A;  3IH3 A;  1VQM I;  2TDX A;  2W00 A;  5BS6 A;  2CW0 F;  2QKL B;  3HSE A;  2WY7 Q;  1R5G A;  2DDB A;  2JSC A;  4RLQ A;  1HKT A;  1UB9 A;  2Q0O A;  1HC8 A;  5FLM J;  2VE9 A;  3JSP A;  1APL C;  2HDD A;  1OCR H;  3CCV I;  5EJC A;  3S2H J;  1MMA A;  4LJZ F;  4XSX F;  4E7K A;  2EQR A;  4DYC A;  3W3C A;  4QWQ A;  4CCN A;  4L5I A;  5JLX A;  2KRF A;  4C2T A;  3ROU A;  4PDK A;  2P7V B;  1FLI A;  4GYI A;  2FRH A;  4F7Z A;  1FOW A;  3HOZ J;  1KYW A;  1R22 A;  1D0Y A;  4G7Z F;  3N05 A;  4B3X A;  1U9O A;  1KU7 A;  3OIQ A;  4V2G A;  1YX5 A;  4MIM A;  2KIS A;  3S1N J;  3JRG A;  2QEX I;  3BCA A;  5JR3 A;  1YJN I;  3OR1 C;  2YSR A;  4KT6 A;  3E7L A;  5E1Z B;  1W0T A;  5E20 A;  4CXF A;  4J19 A;  1MSF C;  1JKR C;  3VYT B;  2MD0 A;  3ZMZ A;  3ZOB A;  1W5C C;  2QUF A;  2JMW A;  3GLL A;  3F72 A;  3GZN B;  3BR0 A;  3N4M A;  3HTS B;  1LFB A;  4PJL A;  5JFR A;  1USS A;  2HGC A;  1STZ A;  2EWN A;  1R71 A;  3QPS A;  3OS2 A;  4OU0 A;  1Y39 A;  3I59 A;  3TMO A;  3D5R C;  1P4A A;  2KJC A;  2DBB A;  1MBF A;  3IKV A;  1U8B A;  3FM5 A;  2MSY A;  1ZRC A;  2AO9 A;  2MC4 A;  2BVM A;  3OV8 A;  3MVP A;  2G7U A;  1J75 A;  1W4M A;  1IN4 A;  2Z33 A;  2HZT A;  1SVL A;  1A5J A;  4ETS A;  5DM7 F;  1SAX A;  2ZJP F;  2R92 J;  1G8X A;  4XOP A;  3ZN0 A;  3H35 A;  4KIF A;  5F08 A;  4AC0 A;  1UEL B;  2GWR A;  3S32 A;  4ESF A;  2R7R A;  3KLO A;  1XSD A;  2VBX A;  2DDA A;  2R4G A;  3VWB A;  3LA3 A;  4FX4 A;  2VJI A;  4XKV A;  3CCJ I;  3CUQ C;  3P5J A;  4S05 A;  2XAJ A;  3BTI A;  3TL4 X;  4N4O B;  3DXJ F;  3HRS A;  3MAJ A;  4B43 A;  2WAQ N;  1AKH B;  2GXA A;  3B73 A;  1AWC A;  1JXS A;  4DGW B;  4XKC A;  4M6X A;  1YRN B;  1IN7 A;  2LTP A;  2J5P A;  5HNH A;  4XLP F;  2N8G A;  2ID3 A;  2BY0 A;  4IKF A;  2EFP A;  2HYF A;  1BC8 C;  2YX7 A;  2L9S A;  5KHD A;  1XPX A;  2IS4 A;  4P9U A;  3K1N A;  2PX9 A;  4AYB A;  2W25 A;  2JA5 J;  1LEB A;  5ERI A;  2ZNY A;  3GFM A;  3TQN A;  1NTC A;  4L9J A;  4IF4 A;  2FQ4 A;  2M9H A;  1TNT A;  4F91 B;  2QCO A;  2MD5 A;  3K4B A;  1SFE A;  3OSF A;  5BPI A;  2OZ6 A;  5FFZ A;  3A0B C;  3UR3 C;  2NVQ J;  2VC0 A;  3O8H A;  2COB A;  1JHH A;  1OCO H;  3KX2 A;  4MFE A;  2EZL A;  2LF7 A;  5F6F A;  1DP3 A;  3ZQQ A;  2Z2S B;  3HZJ A;  1J09 A;  2PEX A;  2RNG A;  2XV4 S;  5DTD A;  2EIM H;  4RAG A;  3JSO A;  3WU0 A;  4ZTJ A;  1Y6I A;  2JWT A;  1S7E A;  3A02 A;  1G3Y A;  1ZYR F;  2DQR A;  2KIF A;  1RR8 C;  1DUX C;  2P0W A;  1T08 B;  4HF2 A;  1L3L A;  1OMI A;  4E7S A;  3EUK L;  4M9Z A;  2NYX A;  2F5F A;  1U6G A;  2DAO A;  4KUM A;  1DPU A;  1FBS A;  1IDZ A;  1Y8Q B;  2DLL A;  3BR5 A;  3HOY J;  3I53 A;  1R9T J;  2NVY J;  4PGH A;  3FDY A;  1SFK A;  1MJB A;  5KK1 A;  3Q5F A;  2GM4 A;  3BR2 A;  3HYI A;  1KU3 A;  2L7F P;  3IWZ A;  2XKP A;  1DQU A;  3FHZ A;  3FXU A;  3C2H A;  2R5Y B;  4GRI A;  2ISZ A;  2O9L A;  1VQ5 I;  3VYU B;  2Y9Y A;  4UVA A;  1BC7 C;  1IAW A;  3IWF A;  2Q8K A;  2CV0 A;  5LRR A;  3OY9 A;  2DOA A;  5LHI A;  4A2U A;  2VKV A;  1D1C A;  2KQR A;  1FP2 A;  1XCV A;  2CUF A;  2EIN H;  2RGV A;  2UZK A;  1QRY A;  1GHC A;  1HCR A;  1HW2 A;  4CDG A;  1AA7 A;  2EV6 A;  3HPG A;  4L5J A;  1Z9C A;  4AD9 A;  1ZG1 A;  2W7N A;  3MZH A;  1S5L C;  5C4J J;  1DPR A;  3LSM A;  3CCY A;  4N0B A;  3LA7 A;  1GVJ A;  2X6W A;  2VQL A;  2K5C A;  5FRM A;  2LY9 A;  3A2K A;  5DD4 A;  1OYY A;  2HPI A;  1G3S A;  4XIC A;  2ETH A;  4XOT A;  3RJP A;  5TIS C;  2OQR A;  4E70 A;  1GUU A;  4WF2 A;  5M3M J;  1HDD C;  4UUS A;  2ZFU A;  4HNU A;  4HX7 A;  5IT9 Z;  1IUF A;  1ACI A;  1O57 A;  4HF1 A;  4S0H B;  1SVO A;  1SD4 A;  5B3S H;  2K4B A;  3NWS A;  3FWE A;  4BDZ A;  1L0O C;  3W6V A;  1RR7 A;  5HLT A;  2FMY A;  1KYZ A;  3F21 A;  1IW7 F;  2HS5 A;  2HQN A;  1NG6 A;  3DTI A;  3DLL F;  1FEX A;  1FP1 D;  3G6E I;  4IQJ A;  2EIK H;  1V5F A;  3VYS B;  4FX0 A;  3QPT A;  1XS9 A;  5D5W B;  2EK5 A;  1QVT A;  1TZL A;  2IGN A;  4OMZ A;  3V8K A;  1CQT A;  2L2O A;  2O0Y A;  4EJU A;  4X6A J;  1K83 J;  3DEU A;  5C4X J;  3HHG A;  3QOP A;  4KN4 X;  4CZC A;  2PFB A;  1BBY A;  1S9H A;  4EVI A;  2KZG A;  2G7H A;  3S8P A;  2OCC H;  1FSH A;  3HGY A;  2IAI A;  4AIK A;  1Z91 A;  3KZI C;  1WRJ A;  2YU3 A;  3PFI A;  1LVK A;  1R49 A;  3MWM A;  4R1H A;  2LKS A;  4XRF A;  3WU1 B;  2OCE A;  5FLV A;  4JK1 X;  2XGD A;  1IN8 A;  1ZR2 A;  1TW3 A;  3NWT A;  3JRH A;  1QHG A;  3HC7 A;  2F6C A;  1X1A A;  1RES A;  4FAS D;  5JHU A;  1VQL I;  4IHY A;  1CF7 A;  2IA2 A;  2NRA C;  2OU2 A;  3T8T A;  3OYH A;  2PMZ N;  4HLX A;  1O7L A;  3K4J A;  4PJJ A;  1NH3 A;  3RZO J;  4B1R A;  3W6J B;  2R5Z A;  5J40 A;  3PFY A;  2NNN A;  4PSW A;  5J4V A;  1JGG A;  1Y8R B;  4FE7 A;  3ZQH A;  3BG5 A;  1OYI A;  1T95 A;  1MMD A;  3U1K A;  2GLO A;  4G9Y A;  3G1O A;  1B72 B;  4N9I A;  1PP7 U;  1X3U A;  2M45 A;  4XM3 A;  4ZDO A;  4EAT A;  4EJO A;  1Z05 A;  4E7H A;  2RDP A;  3BG9 A;  2VBW A;  1RKT A;  1W5T A;  4OIR F;  1TC3 C;  2RRE A;  3S1Q J;  2VXZ A;  2L7M P;  1VQP I;  2R7T A;  1N78 A;  2BY3 A;  3V7R A;  3KYL A;  2CWE A;  2HPM A;  2XF7 A;  1IRF A;  3U2R A;  2CFX A;  3RZD J;  4EGY A;  3HRT A;  4BQQ A;  3PIO F;  2H1K A;  2BY2 A;  3Q0V A;  3TED A;  3BJO A;  3IP4 B;  4HRI A;  4WXC A;  1I3A A;  5CVJ A;  3R4K A;  4MHG A;  3H1C A;  3TDU C;  1T0F C;  1BA5 A;  1HW1 A;  1WWX A;  4CCM A;  4M3G A;  3SEQ A;  2E71 A;  4A0X A;  2STT A;  4CH7 A;  1VQN I;  2HVQ A;  4PZJ A;  4ENK A;  1MNM C;  1U8R A;  2XRO A;  2FA5 A;  3J81 Z;  4HDU A;  3E6M A;  5FJ8 J;  2JA8 J;  2VUM J;  3ZQC A;  3BRO A;  3GUD A;  2LRD A;  3RQI A;  1PUE E;  3OYF A;  4UY8 I;  2XRN A;  2V26 A;  1F5T A;  1VI0 A;  1IO2 A;  1R36 A;  2FBH A;  5TRD A;  5L3B A;  5K1Y A;  1R4M B;  3LA2 A;  3FXQ A;  4DBR A;  5J47 A;  2WV0 A;  6PAX A;  5HS8 A;  1FWZ A;  1UST A;  3WTT C;  1D0Z A;  1P9Q C;  2RN7 A;  3KFW X;  4BE0 A;  4LG0 A;  4YIF A;  2O6G E;  1KU9 A;  5EG0 B;  2E2H J;  4DYQ A;  2L54 A;  4BU2 A;  1UFM A;  4Y3O A;  4CCL A;  1FZP B;  3E5X A;  1OYW A;  1T33 A;  4C30 A;  1X3W B;  2PJR A;  3FXR A;  2MFZ A;  1S72 I;  2GAU A;  2XRL A;  4GGG A;  1VND A;  3DKW A;  3I0T A;  4IHX A;  4NC6 A;  2DJI A;  2K9M A;  4M73 A;  2UWM A;  3W2A A;  2CH0 A;  4IRH A;  4L9V A;  4DBQ A;  3CUO A;  3BWG A;  4BJ5 C;  3RCO A;  3REO A;  2PG4 A;  2Y0S A;  2Y48 A;  4ZYG A;  1P2F A;  2DTZ A;  2WAE A;  4IHW A;  5ED4 A;  1Z77 A;  4G6D A;  3A03 A;  2BY1 A;  3KYD B;  4M3E A;  3DP7 A;  3DLA A;  4B4C A;  2HQA A;  1V4R A;  2F5D A;  3RYP A;  1MDM B;  4PFP A;  5DCM B;  1J5Y A;  2K9S A;  3WHB A;  2AXL A;  1BW6 A;  2E1M B;  2ME6 A;  3D5S C;  3ZR8 X;  3TP0 A;  3H3Z A;  4A0Z A;  1W5S A;  2BEO A;  4GFB A;  3HG9 A;  3K6G A;  5CVU A;  4Y7N J;  1I39 A;  2LVS A;  1BOB A;  5CVV A;  3WG7 H;  1V3F A;  4DJA A;  3LWF A;  1S7A A;  1NK3 P;  1UZC A;  3ZRG A;  2CS3 A;  4LLL A;  3CC4 I;  4I0A A;  3TDZ C;  1TL8 A;  2GQQ A;  4ZDP A;  1MH4 A;  1NG7 A;  3BZK A;  3MEX A;  2EFW A;  2Y9Z A;  3BOQ A;  3PUF A;  2JVG A;  1FPQ A;  2K02 A;  4BDY A;  4E7L A;  3LMM A;  5DM6 F;  3CES A;  4ITV A;  3BTJ A;  2KPM A;  4BAC A;  5AIP A; 
#chains in the Genus database with same CATH homology
 2QF7 A;  1OCT C;  1U78 A;  1MBE A;  3BTC A;  2HOS A;  5FLM J;  5DS9 A;  1APL C;  2HDD A;  2DA6 A;  4JX4 A;  3S2H J;  2EH3 A;  2EQR A;  2LP0 A;  4DYC A;  5K7H A;  2LD5 A;  1JTX A;  1WCM J;  5JLX A;  2JA6 J;  2DMT A;  1FJL A;  3JR9 A;  1TWC J;  2DA7 A;  1Q1V A;  3HOZ J;  3LSR A;  3GTL J;  1U9O A;  4V2G A;  3TP3 A;  4A3M J;  4MIM A;  3HGG A;  4ABZ A;  3S1N J;  3JRG A;  3RKQ A;  1UHS A;  2XSD C;  3DCF A;  4BY1 J;  1W0T A;  3E7L A;  3WHC A;  4DW6 A;  3S15 J;  1DU6 A;  3Q0W A;  1MSF C;  4J19 A;  1JKR C;  2FD5 A;  3ZOB A;  5HOD A;  5BNG A;  1IRZ A;  2JMW A;  3I4N J;  3JRF A;  2K9Q A;  5K7Z A;  3BR0 A;  1LFB A;  1WGX A;  1EF4 A;  2R5Y A;  2XGE A;  1IC8 A;  1JUM A;  2X6O A;  3QPS A;  5IYD J;  4C3I J;  3TW7 A;  3B6A A;  2HOT A;  1MBF A;  1U8B A;  3GTG J;  4A3E J;  2MSY A;  2MG4 A;  4FTH A;  1UMQ A;  2AO9 A;  2HYJ A;  3GTP J;  1ZTR A;  3MVP A;  1XG1 A;  3HEF A;  2Y2Z A;  1JT0 A;  1A5J A;  2R92 J;  1OJL A;  1GDT A;  3A01 B;  5F08 A;  4AC0 A;  5IP6 A;  5IYC J;  2ECB A;  2ELK A;  1OFC X;  2WV1 A;  3OSG A;  2FJ1 A;  3BTI A;  4AYB N;  1TWF J;  1UG2 A;  2WAQ N;  1AKH B;  1WI3 A;  5GPC A;  2E2I J;  2YU9 J;  3JRE A;  2NS7 A;  4C2M J;  1YRN B;  3I4M J;  2LTP A;  2W48 A;  3A01 A;  2ID6 A;  2N8G A;  2ID3 A;  1HF0 A;  5EYR A;  1RPW A;  1ETX A;  3ZQL A;  3LSP A;  2JA5 J;  3F0C A;  1NTC A;  4XID A;  4HNV A;  4A3J J;  1JJ6 C;  4UUT A;  2FQ4 A;  2M9H A;  3Q3S A;  3BR1 A;  4XRM A;  1AKH A;  3LNQ A;  4CYC B;  4A3B J;  2QCO A;  4BBS J;  2FX0 A;  3OSF A;  4C3H J;  2G0E A;  2Y30 A;  1YRN A;  2NVQ J;  3O8H A;  2COB A;  4XK4 A;  2O8K A;  2R93 J;  4A3K J;  4MFE A;  2EZL A;  2DN0 A;  3BQZ A;  3JRI A;  5FKO A;  1IDY A;  2LFB A;  5DTD A;  2XPU A;  3FK6 A;  2JWT A;  1IJW C;  4V2F A;  1S7E A;  2DA4 A;  3HB9 A;  3A02 A;  4CYC A;  1ETY A;  4A3D J;  4LOC A;  1PUF B;  4G12 A;  1OCP A;  4D5F A;  1IDZ A;  1AHD P;  1X2M A;  1NK2 P;  2X48 A;  1F43 A;  3BR5 A;  1IG7 A;  3S2D J;  3HOY J;  1R9T J;  3ZQG A;  2NVY J;  4I6Z A;  1BW5 A;  1Y1V J;  2JA7 J;  1FIA A;  1MBJ A;  2M8G X;  2GM4 A;  4MO7 A;  3BR2 A;  2CJJ A;  2XB5 A;  2L7F P;  3S16 J;  2R5Y B;  5EDN A;  2B63 J;  2O9L A;  2M0C A;  1ETK A;  5E3N A;  1LFU P;  1PUF A;  2L7Z A;  2Y9Y A;  1ORK A;  5F1J A;  4XRS G;  3QQA A;  3BT9 A;  1JTY A;  1I3Q J;  4XRS A;  2XGC A;  4DZP A;  2VKV A;  3GTQ J;  2CUF A;  1QRY A;  1HCR A;  4A3L J;  4A3F J;  2YS9 A;  3JRD A;  2DA2 A;  2TCT A;  1H8A C;  2EZH A;  1ZKG A;  2M34 A;  5C4J J;  4UUS B;  3FK7 A;  3CCY A;  1WH5 A;  3GTO J;  1POG A;  2AHQ A;  5IYB J;  3MN2 A;  4AUX A;  4FE4 A;  1ENH A;  2ECC A;  1TWA J;  2LY9 A;  3HKZ N;  4FIS A;  2NVT J;  3H0G J;  3BR3 A;  1FIP A;  3D1N I;  1XC5 A;  4FCY A;  4XIC A;  2CQQ A;  2L9R A;  2WB1 N;  1ZK8 A;  2DA5 A;  3HOV J;  4M3D A;  3CDL A;  3NAR A;  1GUU A;  5M3M J;  4BBR J;  1HDD C;  5E3M A;  4UUS A;  2JK3 A;  4I76 A;  4X1E A;  1HLV A;  3M4O J;  1BJZ A;  1IUF A;  4JYK A;  4S0H B;  5GPA A;  3HOU J;  1F36 A;  1X58 A;  5M5Y J;  5EEA A;  1MBK A;  4B3A A;  2LKX A;  2CQX A;  1W0U A;  1JT6 A;  2RAE A;  4W97 A;  3W6V A;  1RR7 A;  5IPA A;  4BKX A;  2VPR A;  1JKO C;  1MBH A;  2ME0 A;  4JX5 A;  4D5C A;  5J1R A;  3QPL A;  2D5V A;  1FEX A;  3SFI A;  5K7F A;  1HDP A;  1SAN A;  4MLO A;  2OF7 A;  1ETQ A;  1XS9 A;  1QVT A;  2ZB9 A;  4JP0 A;  1CQT A;  4IEJ A;  4EEF G;  1A6I A;  3L1P A;  3HDD A;  4C3J J;  4X6A J;  1K83 J;  5C4X J;  3O8G A;  5FKL A;  3OOU A;  5EG0 A;  5F0C A;  5IP7 J;  3IV5 A;  3FIW A;  2K9N A;  3HGY A;  1LE8 A;  2IAI A;  3M3Y J;  1VF9 A;  2R5Z B;  2HI3 A;  1JUP A;  4MFD A;  5FLV A;  4M3F A;  5J1U A;  2XGD A;  5FKK A;  1ZR2 A;  1P7I A;  3LOC A;  3JRH A;  4M3B A;  5GP9 A;  1BL0 A;  1TWH J;  2CU7 A;  2DMQ A;  1GV5 A;  1RES A;  1ETO A;  3BG3 A;  2YUS A;  2OPT A;  1GT0 C;  4IHY A;  4A69 C;  2XB0 X;  1JKP C;  1IGN A;  2EBI A;  2PMZ N;  3DEW A;  4DYR A;  3HOX J;  2IEK A;  4B1R A;  2R5Z A;  3RZO J;  3LSG A;  4Y52 J;  2XPW A;  2TRT A;  1JGG A;  3HM5 A;  4FE7 A;  3ZQH A;  3BQY A;  3HBL A;  1ETW A;  3BG5 A;  3SJM A;  5C3E J;  2DMU A;  2GLO A;  1JJ8 C;  3G1O A;  1B72 B;  1B8I A;  5F0F A;  2GBY A;  3MKL A;  3JRB A;  3ZQF A;  3S14 J;  2Y31 A;  3S1R J;  2E2J J;  1E3O C;  5F04 A;  1ETV A;  3BG9 A;  1MSE C;  1RKT A;  1T56 A;  1QPI A;  1TC3 C;  1GVD A;  3S1Q J;  4D7N A;  2L7M P;  4QIW N;  1ITY A;  2E1O A;  2NS8 A;  4JX6 A;  1WPK A;  3RZD J;  1H88 C;  1B72 A;  2P81 A;  2H1K A;  3H3V K;  3Q0V A;  3TED A;  5EZG A;  1HOM A;  3ZQI A;  4M6V A;  5C44 J;  1QVU A;  5EZH A;  5E3O A;  3HOW J;  1I50 J;  1Y1W J;  2L0K A;  1D5Y A;  3VPR A;  1BA5 A;  2I10 A;  1TWG J;  3PM1 A;  2HXI A;  4M3G A;  3SDG A;  3JRA A;  1X2N A;  1MNM C;  4A3G J;  5JLW A;  1GV2 A;  4QSH A;  5FJ8 J;  2VUM J;  1P7J A;  2JA8 J;  1WH7 A;  3ZQC A;  3RQI A;  5E3L A;  3GTJ J;  2VKE A;  4QTR A;  1DU0 A;  2DMP A;  1VI0 A;  3S1M J;  2DA3 A;  1SFO J;  3K7A J;  2E19 A;  4L5E A;  2LLK A;  4D7M A;  3GTK J;  3Q0U A;  4A3I J;  1FTT A;  1ZR4 A;  2DJN A;  3FIS A;  2X9D A;  1U9N A;  2KT0 A;  9ANT A;  2CUE A;  5EG0 B;  5J1Y A;  1RKW A;  4DYQ A;  2E2H J;  1O4X A;  3CMY A;  2H8R A;  1IV6 A;  5F0H A;  2DA1 A;  1T33 A;  2Y0S N;  3C2B A;  2DMN A;  1LE8 B;  3B6C A;  1RET A;  3G1L A;  1FTZ A;  2MGQ A;  2XRL A;  3NAU A;  1VND A;  5EGO B;  2EZI A;  1JKQ C;  3TW6 A;  4IHX A;  3OIO A;  3BR6 A;  2JN6 A;  1G2H A;  5IP9 J;  3FKI J;  5M5W J;  2HXO A;  3IH4 A;  2KDZ A;  2R0Q C;  3UKG A;  2XPV A;  3K2A A;  3PO3 J;  2R7Z J;  2LK2 A;  4RDU A;  2DTZ A;  2NVX J;  1K61 A;  3BTL A;  4IHW A;  1Z77 A;  3A03 A;  2O7O A;  5IOZ A;  4M3E A;  2VI6 A;  4B4C A;  2HOA A;  5F27 A;  3GTM J;  4DZJ A;  4A3C J;  4A93 J;  5J3L A;  2K9S A;  4W1U A;  3WHB A;  1H89 C;  5EGO A;  1BW6 A;  1B8I B;  5M3F J;  2ME6 A;  4BY7 J;  1VFC A;  3TP0 A;  1AU7 A;  4GFB A;  5M5X J;  4Y7N J;  3PO2 J;  1JUS A;  2LVS A;  5EF6 A;  1MH3 A;  2M2E A;  1ZGW A;  2HQ5 A;  1I6H J;  1NK3 P;  2MW8 A;  4BXX J;  4RBO A;  1ZQ3 P;  4NDL A;  2CRG A;  2EZK A;  3GBG A;  3IH2 A;  1MH4 A;  5FKN A;  2Y9Z A;  5FKM A;  2IBD A;  2NOG A;  3G1M A;  4IHV A;  1Z0X A;  3JRC A;  2JJ7 A;  1MBG A;  3CQZ J;  3BTJ A;  5IOY A;  2K40 A;  3IH3 A;  3S17 J;  2LR8 A;  3LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...