3RZDJ

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rzdJ00
4MLOA 1JT0A 2G0EA 1RESA 2CQQA 1IGNA 1JJ8C 3FIWA 1ETWA 1SFOJ 2HOSA 2AO9A 2EZIA 1FEXA 5FKMA 1OCTC 5IOYA 3CDLA 1X58A 3BG5A 2LKXA 3Q3SA 2Y9ZA 1QVUA 1IV6A 1RKWA 1OJLA 3OSGA 5K7FA 1WCMJ 1WGXA 2DA3A 1ZKGA 3BT9A 3G1LA 4CYCB 5EF6A 5HODA 1W0UA 1B72A 5M5YJ 2JN6A 4D5CA 4M3FA 3ZQIA 3K2AA 1NTCA 2NVQJ 2DTZA 3GTLJ 1QPIA 2R5ZA 3HOUJ 4DZPA 1W0TA 3S1RJ 4A3IJ 3ZOBA 1JKQC 1POGA 4M3EA 5C4XJ 5DTDA 3IH2A 2JMWA 5M3FJ 2ME6A 1H89C 4AC0A 1ZR4A 3GTGJ 5FLMJ 1UHSA 1MBKA 3OOUA 2D5VA 2NS7A 3LOCA 4I6ZA 1RETA 2DMQA 2NOGA 2Y31A 2L7MP 5IP6A 2M9HA 2XRLA 5EGOB 3FISA 3SDGA 1QRYA 1H88C 3HKZN 2VI6A 5GP9A 3S2HJ 4BBSJ 1MBEA 3BR2A 2DMNA 3MN2A 1WI3A 3S14J 1MH3A 2CJJA 3BR1A 1U78A 4IHXA 2HOAA 1JGGA 1MH4A 1X2NA 3PO3J 2XB5A 2HYJA 2NS8A 1ETVA 1K83J 4BBRJ 5J1UA 2LP0A 3ZQCA 1GV5A 1MBGA 1ETKA 2CUEA 5J3LA 3Q0VA 3TW7A 4A3FJ 3M3YJ 2FJ1A 3JRBA 1FTZA 4B3AA 4Y52J 1UG2A 5K7HA 1BW5A 2XPWA 3I4NJ 2E2IJ 1DU0A 4CYCA 4W1UA 1T33A 4MIMA 3Q0UA 1RPWA 3GTKJ 4JX4A 1BW6A 4A3KJ 2XPUA 3JRDA 2DMPA 1R9TJ 3JRAA 4XIDA 3H0GJ 4IHWA 3SFIA 5J1YA 2EZKA 3DCFA 2VUMJ 2K9QA 2OPTA 1ZQ3P 2RAEA 1BL0A 2DA6A 4M3BA 3JRHA 2QCOA 5E3OA 1HCRA 5IP9J 4XRSG 5F08A 4C3HJ 1NK2P 5GPAA 1ETXA 1JUSA 4DYCA 3HBLA 2EH3A 4MO7A 3E7LA 2R0QC 5IPAA 1IUFA 3O8HA 4FE4A 2Y0SN 4UUSB 4BXXJ 5EGOA 1E3OC 4MFEA 4A3GJ 3BR0A 1TWGJ 1GDTA 3G1OA 3G1MA 1MSEC 4M6VA 2JJ7A 3D1NI 3HOZJ 4DW6A 4IHYA 3HM5A 4AYBN 1YRNB 1JKRC 3LNQA 5JLXA 3BQZA 4IHVA 4XRSA 2GLOA 2ZB9A 2R93J 3BG3A 2R5YB 5F0CA 4X1EA 1A6IA 1JTXA 2CQXA 2LK2A 4DYRA 5JLWA 1UMQA 5K7ZA 1IDYA 2LD5A 3W6VA 4L5EA 2NVYJ 3VPRA 1PUFB 2ELKA 1EF4A 2R7ZJ 1U9NA 4J19A 2MG4A 1GUUA 1ENHA 4JX5A 2PMZN 2Y9YA 4ABZA 5FLVA 1VNDA 1F36A 1JUMA 2DJNA 1OCPA 4JYKA 2E1OA 2K9NA 5F1JA 3LSJA 3MKLA 4JX6A 2OF7A 3CQZJ 5C44J 4M3DA 5FKNA 1ZGWA 1GT0C 1IC8A 3OSFA 1TWCJ 4V2GA 2EBIA 4C3IJ 5DS9A 2MSYA 2JA6J 2XB0X 4MFDA 2JWTA 2FQ4A 5M3MJ 2H8RA 1H8AC 4FTHA 2YU9J 1JKPC 1U8BA 4FE7A 2WAQN 1ZTRA 2DA4A 1IRZA 1CQTA 2R92J 5IYCJ 1P7JA 2ECBA 5EYRA 1BA5A 1I50J 3IH3A 4QIWN 1FIPA 3WHBA 3Q0WA 1D5YA 1RKTA 1B8IB 5FKKA 2O8KA 5C4JJ 1ZR2A 2L0KA 2B63J 2LFBA 2TRTA 1APLC 4X6AJ 4UUSA 1RR7A 4A3LJ 1VI0A 1LE8B 1ETOA 3MVPA 3JR9A 3ZQFA 2X9DA 1XG1A 3ZQHA 4D5FA 5FKOA 2COBA 1Q1VA 2EZHA 1I6HJ 2NVTJ 3HDDA 1MBJA 3S1QJ 1WH5A 2O7OA 4NDLA 1GVDA 2FX0A 4D7MA 4Y7NJ 2E2JJ 4XRMA 1LFBA 2Y2ZA 1AU7A 3BQYA 1ITYA 1IJWC 1FIAA 2R5YA 5M5WJ 1XS9A 3ZQLA 2M8GX 2E2HJ 3CCYA 2YS9A 2HOTA 1MSFC 3NAUA 2TCTA 2WV1A 2GBYA 2XGDA 2LR8A 1PUFA 1TWAJ 3JRGA 1JKOC 3BTJA 3F0CA 1VFCA 4C3JJ 1DU6A 2IBDA 2EQRA 4A3EJ 1AKHB 2M0CA 3PM1A 4B4CA 2Y30A 2M2EA 3C2BA 5EZGA 2JK3A 1MBFA 3HOWJ 2JA7J 3I4MJ 2WB1N 3B6AA 1X2MA 5IOZA 1ORKA 2VPRA 3K7AJ 4UUTA 2CUFA 2VKVA 1K61A 2L7FP 3HOYJ 4GFBA 3HEFA 2MGQA 2LTPA 3DEWA 5FJ8J 1FJLA 3NARA 3IV5A 1WPKA 2E19A 2QF7A 2XPVA 4M3GA 2I10A 2FD5A 3GTPJ 3H3VK 3UKGA 2DA2A 2CRGA 3BR5A 4G12A 3PO2J 4W97A 1WH7A 1B8IA 1JTYA 1A5JA 3RQIA 3RZDJ 4XK4A 3TP3A 1MNMC 4JP0A 1S7EA 2IAIA 1TC3C 2X48A 2ID6A 1Y1WJ 2W48A 3JREA 3CMYA 1LE8A 2YUSA 3OIOA 4FISA 5F27A 1HF0A 5F0FA 3A01B 4XICA 2O9LA 4A3MJ 4A69C 5BNGA 2K9SA 3GTJJ 1GV2A 1HOMA 2DMUA 2DA5A 3BTIA 2KT0A 1ETQA 2L7ZA 2LY9A 3HOXJ 4A3BJ 1T56A 3JRFA 3HGGA 1JT6A 5EG0B 3L1PA 4QSHA 3BTLA 3TP0A 5EEAA 2HQ5A 2IEKA 4DZJA 4RBOA 4BY7J 5J1RA 1Y1VJ 1BJZA 3B6CA 4LOCA 5E3MA 1P7IA 4B1RA 1HDPA 2KDZA 2ECCA 1ETYA 3RKQA 1LFUP 1NK3P 1IG7A 3GTMJ 1AKHA 3A03A 2JA8J 1JUPA 2HXOA 5FKLA 5EZHA 4HNVA 3A02A 3JRCA 3TW6A 2M34A 2DN0A 3GTQJ 4I76A 2HDDA 3QPSA 2K40A 5F04A 2N8GA 1JJ6C 4A3JJ 3LSPA 4S0HB 5F0HA 5IYDJ 2XSDC 5E3NA 3SJMA 1B72B 3S2DJ 1TWHJ 2H1KA 1SANA 4FCYA 1QVTA 4RDUA 1ZK8A 2DA1A 1HLVA 3GTOJ 2LVSA 2XGEA 5IYBJ 3QPLA 3S1MJ 4D7NA 4C2MJ 1VF9A 2MW8A 1YRNA 3LSRA 2ME0A 5GPCA 3BG9A 2NVXJ 3IH4A 2XGCA 3QQAA 5M5XJ 3S15J 2R5ZB 3BR6A 3WHCA 2EZLA 3HB9A 3TEDA 3FKIJ 2DMTA 1Z0XA 3HGYA 5C3EJ 1IDZA 2HXIA 3S17J 4V2FA 2L9RA 1Z77A 2CU7A 3ZQGA 4BKXA 4A93J 5EDNA 2AHQA 2VKEA 3FK7A 3HOVJ 1OFCX 3A01A 4A3CJ 3O8GA 4DYQA 2JA5J 1U9OA 4AUXA 3M4OJ 3GBGA 2HI3A 1HDDC 1F43A 1TWFJ 1FTTA 2ID3A 4EEFG 1G2HA 3RZOJ 3S16J 9ANTA 5IP7J 1I3QJ 5EG0A 4IEJA 4A3DJ 3BR3A 1XC5A 3JRIA 2X6OA 5E3LA 3FK6A 1MBHA 4BY1J 2DA7A 3S1NJ 4QTRA 3LSGA 2GM4A 2LLKA 2P81A 1O4XA 3BTCA 1AHDP
chains in the Genus database with same CATH superfamily
4MLOA 4XN3A 1FT9A 3OY9A 5L3BA 2F4MB 4RAZA 2KIFA 1JJ8C 1NHAA 1ETWA 3FIWA 5DYMA 1SFOJ 2HOSA 2EZIA 4ZYEA 1ZG3A 3WTUC 5IOYA 2HQRA 2Q0OA 1X58A 2LKXA 3Q3SA 1QVUA 1IV6A 1RKWA 3GYHX 4PJMA 2NRAC 2FQ3A 1ZKGA 1Z1DA 3LWFA 5EF6A 1KGSA 4N4NB 5M5YJ 2E1MC 2H6CA 5ICGA 4UY8I 2JN6A 2Z2SB 3L9FA 2OD5A 3K2AA 5ERIA 2FMYA 1YW9A 2XF7A 4UXNA 5CQEA 3TOBA 2E7WA 1R4MB 1LDKB 3OYHA 1XSVA 4CCKA 3RIRA 4QLCU 4DZPA 1W0TA 1I1SA 5LHIA 1OMIA 1QNTA 3E5QA 1JKQC 4M3EA 3P9KA 4KIBA 4C2UA 4YFXF 5M3FJ 3S32A 2ME6A 3MKWB 2EINH 4O5VA 4I09A 1KU9A 3K4NA 1O3QA 2D5VA 2JVHA 1X4PA 4UV8A 1U3EM 1OKRA 2NOGA 5HDNA 4BYYA 3HUGB 2M9HA 4QPOA 4U0YA 1TZLA 3EUHA 1YJ9I 4B8XA 2LNBA 1TW2A 2QA4I 3HKZN 2VI6A 2KQRA 1DPRA 1OCCH 5E18F 3H9JA 5GAGJ 2STTA 2ZJQF 2L01A 4OIOF 5LHHA 3K9TA 3OYAA 3QP6A 1OYYA 1IRGA 1FOWA 3CJRB 3IWFA 2K27A 1MH4A 2V26A 5CVVA 1X2NA 4Z2YA 2PJRB 4E6KG 1YTYA 1ETVA 1K83J 4KIGA 2R4GA 3K70D 1YE9A 2JT1A 4M9XA 4LB5A 3ZQCA 1U0JA 4RGXA 1VQPI 1GV5A 4BAYA 4OIQF 2R7VA 1E3PA 3PIPF 5CJ9A 2L2OA 2ADUA 4LGWA 4OWRB 4QWQA 4AM3A 4Y52J 1LPQA 3DLAA 4RMNA 3W2AA 3AKZA 1DU0A 1WJFA 2FUG2 4W1UA 1SEUA 4MTEA 4Z6YA 4CSWA 2L4AA 3DXJF 3OL4A 2KHMA 4YELA 1J9IA 4L9JA 2K3PA 5L3GA 1R9TJ 4A6EA 4RB1A 4FETA 3JRAA 4ENMA 4BNCA 3COAC 2NNYA 3H9QA 4IXAA 3BJOA 3X2QH 2HDCA 3DKWA 2LG4A 3RKYA 2VUMJ 3OL3A 3EQLF 3KYLA 1IN5A 5LGTA 5GAHJ 1SMTA 1TL8A 4L0ZB 1DP3A 3JTGA 1GXQA 5GPAA 1YX5A 2EH3A 2BY3A 3E7LA 2R0QC 1JI8A 1W5CC 3MMYB 2VKDA 4YG2F 3BG6A 3HUGA 3QU3A 2ZO4A 4O3MA 2M45A 4MFEA 2RGVA 1QU3A 4RGSA 4M6VA 2VE9A 3HOZJ 5KAFC 4BL0B 2WAEA 2R7OA 1G3SA 4RB3C 2P6SA 2C6YA 3WTVC 3F8CA 2DTRA 1D0ZA 1X3ZB 2GLOA 2CQ7A 3MEXA 2R93J 3IP4B 2WB1A 4EJTA 2PJRA 4AVPA 2HGCA 5JLWA 3OMYA 1MMDA 3MCZA 3VB2A 4BHBA 1HW2A 2NVYJ 4KMFA 2PMHA 2ZXIA 5HLGA 2GZWA 4BJTA 2ELKA 2L3DA 2R7ZJ 1QA6A 2LY1A 1U9NA 3JAMZ 2O6GE 2CW8A 3FBNB 1ENHA 4EGZA 5IT9Z 2DO7A 3BP8A 1ZLJA 2L02A 2PMZN 4KIFA 4ABZA 4CCLA 4L9NA 4CCOA 1LVKA 2HYFA 2VT2A 1VZ0A 5E17F 1PJRA 3MKLA 4E7SA 4JX6A 4LB6B 3GWZA 1GT0C 3IAM2 1IC8A 3HOSA 3MZ8A 4C3IJ 5DS9A 5D8LB 2HYGD 3IWZA 3H3UA 2JWTA 1LEBA 2BYVE 3HZJA 2H8RA 3OYFA 1H8AC 4KNYA 1U8BA 1SVLA 1F9NA 2DA4A 1IRZA 1CQTA 3BG7A 3ZMUA 2W1OA 3A2KA 4TV7A 3SZTA 5LFAA 2EWNA 3H36A 4QIWN 4PCQA 1MMNA 2FBHA 3OYJA 1FIPA 3HSFA 4XL9A 3WHBA 1XD7A 1XMAA 4GYGA 1D5YA 2DDAA 4HDVA 4I0BA 4EJWA 2CFOA 3KLNA 2XAFA 1S9HA 2B63J 3IRQA 2TRTA 4X6AJ 3K4MA 3G73A 1A36A 1B9MA 2GIZA 3OYMA 2L9SA 1V5EA 2EV0A 3RYPA 3DEUA 2VBYA 4MHGA 4FX0A 3JR9A 1SAUA 3ZQHA 3CCVI 4D5FA 5FKOA 1Q1VA 2BVLA 2NVTJ 3S1QJ 1OCRH 1UELB 4CUGA 4NDLA 1NH3A 5JI6A 5CLSA 1GVDA 2FX0A 3S8PA 2XC7A 1USSA 2XROA 3TOAA 1T08B 1GLNA 4PSXA 3M07A 2EFPA 1KQ0A 2VQGA 2DFHA 4ESBA 1VFCA 3E6MA 2OQGA 4BQNA 4IJAA 2VASA 5K5OA 4B48A 5DUIA 4ETSA 3GUDA 4B4CA 5EZGA 4G7OF 1MBFA 3HOWJ 2JA7J 1LDJA 4IF4A 1BR4A 1Y6IA 2HEOA 2W85A 1X2MA 1D1BA 1WFXA 2W7NA 1XX5A 4UB6C 1BJAA 2LF7A 4HF1A 4E7KA 2L7FP 2KRHA 4GXOA 5KNLA 3BC8A 4GFBA 4IHSA 1HW1A 3FXLA 5IY5H 2B7EA 1J59A 4P96A 5FFXA 2LTPA 3DEWA 1JHFA 4YFKF 3NARA 3I5UA 1WPKA 4DNCA 2VXZA 4HA8A 5HS8A 2UZKA 2XPVA 1CGPA 4RAFA 1FYKA 4G8XA 3TO9A 5CPRB 2CRGA 1BC7C 3BR5A 1UFMA 2FNAA 1I1GA 2QEXI 1WH7A 2BY1A 2PEXA 5JVGF 3CC2I 3E0JB 3SDBA 2MC4A 3F23A 3BZCA 2X48A 1ZARA 2QVOA 4HRIA 3J7AY 3IAS2 1QHGA 3H5RA 4CICA 3CMYA 4HAMA 3OIOA 4FISA 2NNNA 2L7KA 1U5TB 5F0FA 2AQFA 2Z99A 4A3MJ 3VFZA 4WXHA 2VLAA 2HU9A 1WSUA 4CGZA 2QWWA 2ZJPF 1HXDA 2DMUA 2KT0A 4HDUA 1ETQA 2L7ZA 2VQHA 3AG4H 4PGGA 4XRFA 3ZN0A 3CCEI 3JRFA 5EG0B 5BMZA 5L3DA 3BTLA 3LA2A 3GLLA 2CFXA 3A0BC 2IEKA 4AWXB 1IZ1A 1F5TA 4BY7J 2MLKA 1D0XA 5HDKA 4I02A 2E1MB 2QZ8A 4XBFA 2ISZA 2BVMA 1B9NA 1Y1VJ 5E3MA 1P7IA 1GHCA 3DBRB 2KDZA 1VQ8I 3F8NA 3MD2A 2F5DA 4L18B 2HDWA 2HKXA 1W4MA 3ABUA 3F8BA 1IG7A 1JUPA 2HXOA 1LUJB 1J5YA 3N97A 3KEQA 3JRCA 2M7AA 2DN0A 3ZMVA 3E5UA 4LLGF 4PDKA 1ZRCA 2ELHA 2HDDA 2K40A 2N8GA 4RGUA 4A3JJ 2RREA 2V9KA 3CLOA 4A6DA 4S0HB 3WTTC 5TRDA 2F5VA 3T8TA 1O57A 3SJMA 1MGTA 1KZHA 3TO7A 1TWHJ 3S2DJ 4U0VA 2KL4A 3OYCA 1ZK8A 5IYBJ 3S1MJ 1ZG1A 1VF9A 4D0PA 1YRNA 4U0WA 2I5UA 2IRFG 4CHUA 2RDPA 3LSRA 2KPMA 4R8HA 3L2UA 3BG9A 3IH4A 3L2QA 3E5XA 2OCCH 3MKYB 4ZDLA 3BOQA 2E34A 2V9PA 1Z0XA 3HGYA 1ZRFA 3CC7I 2IA1A 1XPXA 2DOAA 1SMYF 4PJLA 2HXIA 2RVCA 4A93J 4BKXA 1LKXA 1T39A 1P4AA 2RKHA 3KEYA 3KZYA 4GCVA 1YG2A 1U5TA 5LGUA 2QM3A 4BQOA 5IT3A 3J81Z 3IKVA 3CLQA 4NC6A 1OLTA 1WHUA 3DU6A 1W36C 4E4HA 1F43A 1TWFJ 1TLHB 1KQ9A 3V4GA 3S16J 1YLFA 1I3QJ 1YIOA 2M30A 5EG0A 2UXXA 3DPLC 4M74A 4A2UA 1JXSA 4BY1J 2R7RA 3CJTB 4Y17A 4U7BA 3ULQB 2V6CA 5CVRA 2GM4A 4IX7A 3K2ZA 4CZZA 4FASD 4CZCA 3CDIA 3HTSB 2K85A 1EH8A 3WGIA 1R1UA 2ZJRF 4BGDA 1AHDP 1IXRC 1K6YA 4DBRA 4WX9A 1BOAA 2IJLA 3KYCB 3S3MA 2Y0MA 1IGNA 3OWTA 1Z6TA 4M71A 1YFHA 4HEA2 1XMKA 1H0MA 2VC0A 2ZKZA 2A5WA 2QUFA 3PSFA 3K1NA 1T2KA 2H6BA 3BG5A 1OJLA 4RAYA 5EEHA 1WCMJ 5K7FA 2DA3A 4CYCB 3G1LA 3QYFA 4IRHA 4DOZA 1SFKA 5LRRA 3TBIA 5HODA 1W0UA 1LQ1A 1XGNA 2CG4A 3ERED 4D5CA 5FRMA 3ZQIA 3CO7C 5JVTA 2L54A 3QAHA 4ZYDA 3JCUC 3PSIA 2OCEA 4OINF 5H6RA 4PZJA 3VYUB 5L3FA 2EFQA 3GFJA 5DCMB 2CYYA 5HS7A 1CF7B 4OIPF 2G7UA 2CUJA 1Z91A 2EA4A 1FYMA 1S6LA 4XKVA 3GTGJ 5FLMJ 3OOUA 1Y8RB 2F48A 3SEQA 4I6ZA 1SC7A 1RETA 3DF8A 2Y31A 2JRMA 1XCBA 5IP6A 2WBMA 2XRLA 5JHFA 3FISA 3SDGA 2OTJI 1IXSB 2HQNA 1T95A 2W57A 5GP9A 1UHWA 1MBEA 3FKJA 3R4KA 3QRFF 5DV5A 1DP7P 2KFDA 1PDNC 1WI3A 4CCJA 2CJJA 3BR1A 1G8XA 5ILSA 3PUBA 2E7XA 5FRNA 3ZN1A 3LSHA 5DM6F 5KVRA 3H5AA 1PP7U 4XORA 4IVNA 2F2EA 4MTDA 4IHXA 1IN8A 2DU9A 3JW4A 3D5SC 2L5QA 3K10A 3FMSA 2E71A 4RM2A 4ZDPA 3RPQA 3ROUA 5B1AH 5J8FA 2CW0F 4F92B 5CVUA 2H8WA 3CP8A 1VQ6I 1PVEA 2E36A 1ON1A 5LLQA 2OZUA 2J5OA 4LK0F 3TW7A 2MYSA 2GOXB 2FJ1A 3JRBA 2DODA 4LMYA 1Y8QB 5CKTA 3WGGA 4B47A 3LAPA 1FZPB 5TGTA 4UHTA 3SQNA 2OV7A 3I4NJ 4UVBA 2Z1DA 1TQPA 4CYCA 1PUEE 1R23A 1VQ9I 4MIMA 4H4KC 4KFCA 3Q0UA 1RPWA 4LG0A 5B66C 1I3AA 4RLQA 3GO5A 4MEYF 4RM3A 1RI7A 2XPUA 3KP7A 1KONA 2DMPA 3SZGA 4XIDA 2ESHA 4M72A 2BXYA 1G6NA 2WA0A 3DCFA 2IS4A 3MFKA 3OOPA 3R61A 5HVQC 2K9QA 2HVQA 5E79C 1CF7A 1BL0A 3K1MA 1HCRA 4RA2A 4EM1A 1ZN2A 4C3HJ 4LJZF 1EV7A 4II3A 1FNNA 1ETXA 1JUSA 3HHHA 1H9GA 3HBLA 4MO7A 1X1BA 1ZGAA 5IPAA 1LFPA 3O8HA 3ABTA 2Y0SN 3LA3A 3NRVA 1HSJA 2H1LA 4BXXJ 4AD9A 2M1BA 4F52A 4OIRF 3F9KA 4HSTA 4L5IA 2O8XA 1GDTA 3G1MA 2RQQA 5DCFA 3LFKA 4PFOA 3BPXA 3WTWC 4LLLA 4IHYA 5TISC 2M4GA 5BQTA 4XKWA 4L9VA 1WJDA 4LD5A 4AYBN 5A2QZ 2X6WA 1JKRC 3ZXSA 2HVSA 3BQZA 1Q1HA 2EK5A 2KIMA 3GF2A 4G7ZF 2X6YA 2ZB9A 1LNWA 4N9HA 1XSDA 1P9QC 1A6IA 4P1WA 3GZ5A 4I01A 4DYRA 2GXAA 2HTJA 4WK8F 4YRVA 3M7GA 1IDYA 2LD5A 1C0WA 4L5EA 2KJCA 4XLAA 2ZXWH 1PUFB 1MMGA 3I53A 3I54A 3QYBA 4XNFA 4HQEA 1EF4A 4OMZA 4J19A 1IUYA 2MG4A 1GUUA 4WXDA 1KU7A 2M4KA 4JX5A 2Y9YA 4CDGA 1F36A 3K70C 1JUMA 2M3AA 4JYKA 4CH7A 4QPQA 5F1JA 1S7OA 3CF2A 3LSJA 2LKPA 4C30A 3CO6C 2OF7A 2DT7B 3CQZJ 1HSTA 3IKTA 2E5NA 3BROA 3GX4X 4BS9A 3TGNA 3S3OA 2ZC2A 3H9GA 3B02A 4OOIA 2CV1A 2KZVA 4F93B 2BBYA 3LL7A 3RPUA 3FXJA 2F4IA 4HQMA 3OYIA 2KMUA 2XB0X 1USTA 1ZYRF 2EPFA 1JHHA 2DI3A 4BH9A 2FQ4A 4DJAA 2YU9J 1O3SA 1JKPC 3L09A 1B6AA 3FM5A 1RNLA 3T5XA 4R1HA 4ZH4F 1BA5A 5IYCJ 2VBWA 3LQQA 5D5XB 4R79A 3T8RA 4ZYAA 2ICWG 2JZYA 3OYGA 3NWTA 3Q0WA 1SFXA 3AG2H 1RKTA 5FKKA 1WJEA 2NYXA 3FM3A 4A5NA 3C7JA 1E2XA 3EUKL 3FXMA 3JSPA 4KYWA 2F5FA 1RUNA 1QO0D 3CJQB 3CDHA 1VI0A 2DYRH 4G94A 1GXPA 1HC8A 3PJRA 1SVMA 3I3LA 3W6KB 4FX4A 2L9VA 2X9DA 2R7XA 1XG1A 1ZHFA 2WAQA 4LITA 2RQPA 2K9LA 3EDPA 1G59A 1WH5A 2ZJ2A 5D5VB 2A61A 1VQ5I 2QQBA 3V7CA 4D7MA 2E2JJ 1AU7A 1W7PB 2HKOA 3I0TA 5M5WJ 1XS9A 2ZFWA 3ZQLA 1ZELA 3ESWB 3UNGC 1Z9CA 2E2HJ 2BHYA 3FXUA 3CCYA 4XQFA 3IC7A 2G9WA 3HIFA 2ZSIB 2R7UA 1BI3A 2XUBA 4II2A 1PUFA 2F4OB 3SFZA 3ABLH 1YS6A 3R6SA 4C3JJ 3DBLB 1S8NA 1EA3A 2IBDA 3KP6A 2HQAA 2OAZA 4A3EJ 4U87A 2CV2A 4OMYA 3RQ4A 2M2EA 3FBIB 1R1TA 2JK3A 3BLYA 3DTIA 4S04A 3I58A 4BQQA 3IUOA 2MA3A 3ERMA 1Y39A 4UUTA 2VKVA 1K61A 2DPUA 2FOKA 3ZPLA 4U88A 3EYIA 3HOYJ 3HEFA 1KU3A 5CVIA 4HLYA 2JVGA 2IXSA 2MGQA 5HLTA 1ZG5A 3H1CA 1Z67A 3NQOA 5FJ8J 3Q5FA 3WTXC 2R7SA 2QSHX 4ENJA 2QF7A 2VPLA 3M1EA 2X1EA 3KETA 2L4MA 5JFRA 3UKGA 2DA2A 4PFPA 4NC8A 1OCOH 3VWBA 2P5LC 1W1WE 1A5JA 3RQIA 3JAMK 2VQLA 3RZDJ 1MNMC 4JP0A 4O6JA 4XLPF 5IT9K 1M1EB 2IAIA 3KEOA 1TC3C 2K7LA 1YW8A 1Y1WJ 1FY7A 5LD2C 1X1AA 1EJ9A 3F6VA 3ZMTA 2JPCA 2EILH 2YUSA 4LFUA 4BDYA 4G7HF 2X4HA 1A35A 2O9LA 3GZNB 2BGCA 5BNGA 2XHKA 1Z3YA 2K9SA 2QLZA 3KIOA 2EIKH 3GTJJ 1GV2A 3AL0C 1WJ5A 2YR2A 3DBHB 1W7PA 4A0YA 2LMDA 2OZ6A 1T56A 2NXNB 4KDPA 1JT6A 3TDZC 3L1PA 3M8FA 2IT0A 2HQ5A 1KU2A 4DZJA 1U6GA 2PX9A 2VJJA 5DD8A 1ZRDA 3PNVA 4MNUA 1LVAA 2W00A 5L3EA 1ETYA 3RKQA 1FBUA 1NK3P 3GTMJ 3U9GA 3CESA 3WU2C 3FMRA 5FKLA 2QKLB 2DLLA 5EZHA 1ZGJA 3ISPA 4XKCA 3GZ6A 3GMEA 4I76A 4JQFA 4ESFA 2NS0A 1T8IA 1JE8A 1FX7A 2VL8A 1K78B 3G6EI 2MFZA 4KITB 1JJ6C 3D0SA 1V5GA 2DDBA 4IO9F 2DBBA 1HKTA 2A6TA 2XSDC 3O2PE 1UG0A 1U8RA 2H1KA 4G6DA 1SANA 3LMMA 4B3XA 1HLVA 2LVSA 2XGEA 1YJWI 1W5TA 1P2FA 2MW8A 3BDDA 2R7TA 1MKMA 1Z3XA 2KLOA 2R7QA 1VQLI 5E1WA 3Q9SA 5M5XJ 3CMEI 2R5ZB 4E7LA 3HKZA 3FZVA 3WHCA 5H2FC 2EZLA 2YU3A 2X6XA 3WU1B 2RV8A 3TEDA 2OTLI 2DMTA 3JTHA 1TNTA 1ONVA 4X0GA 4LG3A 4NB5A 3S17J 4OU0A 2MH2A 2A69F 1ZAOA 2BOLA 2L9RA 3QWLA 3ZQGA 3CCRI 5EDNA 2AHQA 2NAZA 4C2TA 3HOVJ 5D4RA 4HG2A 4I0AA 1ERDA 3O8GA 4PJJA 2K9MA 2LSOA 3HRTA 3FDYA 3GBGA 2HI3A 1HDDC 2E1CA 4KMUX 3D5RC 2O5RA 2VBZA 4EEFG 1X3UA 1G2HA 3RZOJ 5AIQA 1R00A 3GW2A 2EA2A 1G3YA 2XGXA 4UB8C 3RKXA 3PNTA 3D5LA 1E0EA 3HG9A 2E5ZA 4ZYHA 4BQAA 5E3LA 2W24A 2WY7Q 3FK6A 2DQRA 2H09A 2BE5F 2DA7A 1V4RA 4QTRA 5LBQA 5AIPA 1T0FA 3LSGA 3S1NJ 3RPUD 3CCLI 2P81A 2K86A 4AU7A 4HW0A 3FHZA 4HX8A 3ABMH 4E7HA 1FOXA 5D6EA 4ZZDA 5D8KB 3B73A 1SD5A 1JT0A 2G0EA 1X1CA 3M1CA 1D8KA 2HPIA 2AO9A 4YFNF 3CZ6A 1FEXA 2HVRA 3CCSI 1OR7A 3CDLA 2Y9ZA 1K78A 1J09A 2GWRA 4BJ5C 5J6XA 3BT9A 1RR8C 2M87A 4BE0A 1MNDA 1FC3A 4HX7A 3KE2A 1ZH5A 1MZBA 5BS6A 4M3FA 1G4DA 3L2CA 1HA8A 2MABA 3OYEA 1NTCA 1G3TA 3CTAA 4WF2A 3QPTA 2DTZA 3H5NA 3V8LA 4S05A 4N0BA 1A04A 1L0OC 3VYSB 4EV0A 1J2XA 1SD6A 1MNEA 5E8IA 1VQMI 4A0XA 2R5ZA 4I99C 2D1VA 5J47A 1XGMA 2X85A 4BE1A 5C4XJ 2ZSHB 4NQWB 4PGHA 5LEJA 3IH2A 3N05A 3WE2A 1FMWA 3FF5A 3VOEA 3RTRA 1H89C 2CWEA 2MLGA 3KX2A 3ZR8X 1K79A 1R71A 4RLFA 2YX4A 2DMQA 4IZZA 3O6BB 3HRMA 2PN6A 5EGOB 2BW3B 2DK5A 2P8TA 3ZQ7A 1TNSA 5B1BH 3BR2A 1EKEA 2DMNA 1N78A 4F55A 3MN2A 5HNHA 1MH3A 4D9JA 2MH9A 3DV8A 1P4XA 5J8CA 3V42A 3BY6A 1S3JA 2HNHA 2PFBA 4LIVA 1U78A 2W25A 2Z9OA 2QBYB 4AVZA 1JGGA 2DXIA 1IRFA 2IP2A 4N4OB 2HYJA 2NS8A 3PNYA 4BBRJ 5HLIA 2ZXJA 4M6XA 2LP0A 3CD6I 4EMSA 1ETKA 2KRCA 3AFHA 2A3SA 3Q0VA 3M3YJ 2VOOA 1FTZA 1WKMA 2AXLA 5J4VA 3E6DA 5BPIA 2Z5UA 5CQGA 5K7HA 1BW5A 4IQ4A 1QPMA 3KP4A 3J81K 2E2IJ 3P9CA 3ZP5A 3HTUA 1TT0A 2EFOA 2QSFX 1T33A 2EFNA 1VQOI 2D45A 1BW6A 2LBFB 2E35A 3JRDA 3DWLE 4NUBA 3H0GJ 5D6FA 3SFIA 5J1YA 5GTHC 2EZKA 3G2BA 2ZMEC 2KP6A 3K4KA 4G9YA 3WTYC 2RAEA 4BJ6C 2DA6A 1IN7A 1V55H 2BHZA 4M3BA 2QCOA 5E3OA 3JRHA 3DU5A 4NQWA 2AQEA 5IP9J 1QZZA 4XRSG 3CF5F 1O3RA 1S72I 3CCUI 1QQIA 3QP5A 4PSWA 1K6OA 4GYIA 1XGSA 3ZRGA 1TP4A 4WCGA 2LH9A 1IUFA 3K4JA 4ON0A 5F64A 5FFZA 1RC9A 4UUSB 2P5VA 1XDSA 1VQNI 5EGOA 2DFIA 2VT3A 3EETA 2BW3A 2BY2A 1IW7F 2PJPA 4A3GJ 5D4SA 2VONA 2EB7A 5ED4A 3L2WA 4A12A 1MSEC 2JJ7A 3HXLA 3D1NI 3GXOA 2A07F 4DW6A 2AS5F 1BM9A 1J0RA 2FXAA 1X3WB 1X1PA 1YIJI 3LNQA 5JLXA 3K1PA 2R7DA 1QHHD 2V6EA 3GFLA 3GCMA 2QBYA 4XRSA 1YX3A 2A6HF 5DD4A 3BG3A 3TO6A 5J4YA 5FO5A 4X1EA 3KPHA 1JTXA 3HYIA 3V7SA 2VE8A 4KT5C 2CQXA 2LK2A 3TDUC 5K7ZA 1OQYA 3PFYA 2GOMA 4FT8A 3W6VA 2JRTA 1IXCA 1PYVA 2B0LA 3CC4I 2DT6A 2XAJA 3A0HC 3VPRA 3TKYA 4KT6A 3L2VA 3AG3H 4LLNA 3AAFA 2GA2A 4KICA 1E3HA 2R3SA 3A4CA 3W2VA 3WG9A 4CA0A 3JSOA 2VBXA 3OIQA 2WC2A 1VNDA 5FLVA 4HPQA 3ASNH 5F6FA 1KYZA 5AONA 2GXGA 2E1OA 2K9NA 3CUQC 1BR2A 2AXTC 3RJPA 1FP1D 2RN7A 3A1YA 5C44J 3U1DA 1BIBA 3OSFA 5ICCA 4V2GA 2EBIA 3I71A 5FD6A 3I4PA 1R22A 2JA6J 1X19A 2CQNA 1B4AA 2VB6A 3E6BA 4FTHA 3M8JA 2X0LA 5LEKA 3AL0B 1MDMB 2WAQN 4XLHA 2DPDA 4Y3OA 2XAQA 2R92J 1P7JA 5EYRA 3V8JA 4IOAF 4ESJA 1XMXA 5GTIC 3IH3A 3HSRA 1T38A 3SYTA 3LAJA 4XM3A 2DYSH 1MD0A 1B8IB 1ZR2A 2L0KA 2XDVA 3HSEA 4F3QA 4UUSA 1D8JA 3RCOA 3BCBA 1YO5C 5DUKA 2DCEA 5HS9A 1ETOA 1Z6RA 4IOCF 3MVPA 4UVAA 4A5MA 1FSHA 3ZQFA 2FSWA 2DT5A 2WAFA 4NBQA 2EZHA 1I6HJ 2LOOA 4YEJA 3MZYA 4NHJA 4P55A 1LB2A 4HV5A 1LFBA 2Y2ZA 3BQYA 1IJWC 5FLXZ 1FIAA 4EQQA 2JPBA 4Q47A 1Y56A 3K4LA 2QQAA 4IHTA 2YS9A 5D5WB 2HOTA 3NAUA 2JSCA 2GBYA 2XGDA 2IS2A 2LR8A 1TWAJ 3JRGA 1JKOC 1UCRA 2IGMA 3EYYA 5DCMA 2EV6A 3ONQA 2CQKA 3DFGA 3P7NA 5HNFA 4EJUA 4HV6A 1VQKI 5ICEA 2MC3A 2LRDA 2P0WA 3W6JB 3M8EA 4HNUA 4WXCA 3GFIA 2OUMA 2WB1N 3ML6A 4MQ9F 5B3SH 3PUFA 2WV0A 4NNJA 1NG7A 2KIQA 2X1CA 1ORKA 5IOZA 1R6RA 2RNJA 1WJAA 4ANJA 4GGGA 2DAOA 1MMAA 2CW7A 1Z7LA 1R49A 1DDNA 2JSPA 2D1HA 3UR3C 5E20A 2DFFA 5A2QK 4HYEA 1MJBA 2JQ7A 3R60A 3QOPA 2KRFA 2O3FA 4BDZA 1YI2I 3PQJA 3IV5A 4E7JA 2E19A 1MDMA 3BWGA 1ODDA 4Y15A 2CO5A 4XMYA 3IL2A 3ECHA 1J7KA 4M3GA 2FD5A 3H3VK 2R7WA 2P5KA 3OYLA 1F4KA 1R5HA 1U5TC 4K2EA 4BXFA 3OYNA 3J80Z 2Q1ZB 4B44A 4BHCA 1YOVB 2ESNA 2PBIA 1B8IA 1O3TA 3WE3A 3TP3A 2FEZA 1I27A 2JUCA 1S7EA 3TL4X 2NVUB 4HSRA 1S5LC 3C2HA 2W48A 3LQRA 3P9IA 5ICFA 2IS1A 3OIPA 3E6CC 5HDGA 2FRHA 1FOYA 5TJJA 4BE2A 1HF0A 4XLCA 2R7FA 5LRSA 1MMSA 1TW3A 1HKQA 4BXUA 2GXBA 2LDUA 1D0YA 5BPDA 4FHTA 3IRRA 1HOMA 2DA5A 1KYWA 2LY9A 3HOXJ 2VQCA 4A3BJ 3BPVA 1R5ID 5K5QA 1ULYA 2X51A 3HHGA 4F7ZA 5E1XA 4RB2C 4QSHA 5ILUA 4V19K 5EEAA 3KFWX 1BIAA 4RBOA 3EUAA 2W4SA 3I9V2 3R0JA 1A6QA 3W2WA 4RB0A 3VYRB 4M9ZA 4B1RA 4EGYA 1HDPA 2A05A 2LKSA 4BEHB 1UAAA 1DGRM 1LFUP 2FBIA 3SEZA 1R58A 3A03A 4I98B 1UJ8A 2V1XA 3C3WA 2CMPA 1X4OA 4HNVA 1GVJA 4ZC3A 1K7AA 2M34A 3RDIA 2W82A 2XV4S 4ZJZA 5KCMA 3GTQJ 1I5ZA 2KKOA 3NEUA 3RKWA 3QPSA 3E97A 5GADJ 5F04A 3FHNA 2DOEA 1NG6A 5F0HA 5KK1A 1B72B 4LK1F 1QVTA 3GTOJ 2H27A 2ZFUA 3PL8A 3V7RA 3OV8A 3QPLA 2UV1A 3HPHA 4HF0A 2VJ4A 3J7AO 1S7AA 2YPRA 1BN5A 4F91B 3S93A 5GPCA 3CMMA 2VODA 2NVXJ 3QQAA 1LJ9A 3L00A 3BZKA 4Y4RA 4HLXA 2HZTA 2KDOA 3RYRA 1ACIA 3GFMA 1BI0A 3HB9A 3CUOA 1Y0NA 3FKIJ 3SZPA 5C3EJ 1P92A 5JHUA 1VQ4I 4DIQA 4V2FA 2V1UA 3ZMSA 1Z77A 2CU7A 1R36A 2XF6A 5GAEJ 2YX7A 3I55I 4HZFA 2IGOA 2VKEA 3F8FA 1W5SA 2QYOA 1OFCX 5HOOA 4AIHA 1WQ2A 1QBJA 2O61A 1S29A 4AUXA 4CYDA 4UNOA 3FXKA 3M4OJ 3KP3A 4YIIA 3DLLF 1FTTA 2CGPA 4GRIA 3SHFA 3RI4A 9ANTA 3DTEA 4YIRX 1XGOA 4A3DJ 3BR3A 3M9AA 2X6OA 2YSRA 4CO8A 3JRIA 3ZGKA 4KN4X 1N77A 2Q8KA 1SFUA 5D5UB 1MBHA 2JUGA 2XKPA 2VJ5A 2P6TA 3F21A 2FOWA 3I64A 2LLKA 1O4XA 3BTCA 4BEHA 3QU6A 2WTEA 3ZMDA 2FBKA 2OJED 4EM0B 1WZ2A 3CCJI 1HBXG 2ZMEB 1RESA 2DOFA 2CQQA 1SD4A 3OYDA 4B43A 5FKMA 1PP8F 1OCTC 4IPAA 4UV9A 3OS1A 2P7CB 4UVCA 3VYTB 2PMUA 2VIXA 1FBQA 3OSGA 2DW4A 2CUZA 3BJ6A 1WGXA 3L2RA 1FWZA 1K4SA 1Z05A 1B72A 1N75A 4OAZA 1D5VA 3WTSC 2K5CA 3N4MA 2DFEA 1U2WA 2Q2EB 1TQIA 3DTKA 2NVQJ 4CCNA 2Y0SA 3GTLJ 3BCAA 3DP7A 3U2RA 4MEXF 2UXNA 1QPIA 2OBPA 2Y48A 3KLOA 2P4WA 3HOUJ 1HW5A 3WODF 5L3CA 4H0EA 2KISA 1ON2A 4DQ2A 3S1RJ 1WWXA 4A3IJ 1TQMA 2FE3A 5H20A 3ZOBA 5HLHA 1POGA 3I59B 4Q4ZF 5DTDA 3HL2A 4M9SA 2JMWA 4EATA 1BI2A 1IN6A 3C2GA 1QGPA 4AYBA 4AC0A 2HPMA 1OYIA 1WRJA 3F22A 1ZR4A 3KYDB 4XOTA 1UHSA 1MBKA 3HRUA 3FXRA 3WU0A 1T98A 2NS7A 3LOCA 3T1BA 3CMAI 2ACJA 4RS8A 1YHQI 4DGWB 1OISA 1E17A 2L7MP 2W84A 3F6OA 1IF1A 2HR3A 2QKMB 5BOXA 1K4TA 5E8GA 1QRYA 3ASOH 1H88C 5FB2A 3CJNA 5H6QA 1VQ7I 3S2HJ 5CVJA 4BBSJ 3ELKA 2A68F 4BACA 4YIFA 1V54H 3ZCOA 2O03A 2HS5A 2FF4A 3S14J 3CUQB 2CV0A 2TDXA 2IA2A 2QQ8A 2HOEA 4G6TB 2FA5A 1FLIA 2XF5A 2HOAA 3CCQI 1VTNC 2F6CA 2FNPA 3PO3J 2XB5A 2DQLA 3C1DA 2XAHA 1RIOH 3GVAA 5J1UA 2V7FA 1BOBA 6PAXA 1RRJA 1XDUA 3E3VA 1DGWY 2QGUA 1Y0UA 2ZMEA 1SFEA 2PG4A 2FU4A 1MBGA 3DPTA 3DQVC 2XRNA 3EUHC 2Z16A 1D1AA 2BXZA 2CUEA 5J3LA 2VN2A 4A3FJ 4XN0A 4PK4A 2ISYA 3HJEA 5ILVA 4B3AA 3QPHA 4FQGA 2OA4A 1UG2A 1YW7A 2V4JC 4HF2A 3TQNA 5B5EC 2XPWA 2ETHA 3J7ZI 1KQ8A 2VOPA 5KAIC 2VKHA 1MJ9A 4XLNF 3LSMA 2EIMH 2K3FA 5LHGA 2ZNZA 3GTKJ 4JX4A 4IRIA 2Q2EA 4A3KJ 1V5FA 2GQQA 3T0YA 1UHMA 4HBLA 1FBSA 3HPGA 3PFIA 4KISA 4IHWA 4P9UA 1DPUA 1UZCA 2OC6A 2K02A 2OPTA 1ZQ3P 3EPZA 3I59A 5E1ZB 2IA0A 1I6XA 2ZXHA 3H3ZA 3TMOA 1EH6A 5F08A 1NK2P 4DYCA 2STWA 4IQJA 1DQUA 3G3ZA 4FE4A 3CP2A 1BC8C 3WGHA 2GIVA 2DK8A 1E3OC 2KZGA 2K4BA 1JGSA 1TWGJ 2V1DA 3BR0A 2WWYA 1TTYA 2M8EA 2QENA 5CYVA 2EFWA 3G1OA 2H94A 3BZ6A 1RZ4A 1Z21A 3LSKA 3OYBA 1ZREA 3G71I 3CUQA 3HM5A 3VODA 3OYKA 1YRNB 2RC4A 3IHUA 2GA1A 4Y13A 2IS6A 1OCZH 4XR6A 4IHVA 1SVOA 4JK1X 3FXOA 2R5YB 5F0CA 2M0MA 1AWCA 2ZNYA 1YITI 1UMQA 1STZA 2OQRA 4IRGA 1ZLKA 4Q5SF 2ZCWA 1XTAA 1OPCA 3KCCA 1H9TA 3LSTA 3K4CA 2EJRA 4EVIA 2RNGA 4Q48A 2DJNA 1OCPA 5K5RA 1TT5B 3L7WA 2I8DA 4RAGA 4E70A 5JR3A 3J7YJ 4M3DA 5FKNA 4NC7A 3HOTA 1ZGWA 5KHDA 1DUXC 1FYLA 1G3WA 1TWCJ 3OR1C 2GAUA 2MSYA 3G4SI 4MFDA 4ASNA 2V1NA 1KA8A 4B09A 4CXFA 4E7IA 3FMQA 1TBXA 3F8MA 2LYCA 5M3MJ 2PLYA 3U21A 2Z3YA 2NOJB 4FE7A 2PMZA 3FWEA 1ZTRA 5FGMA 2ECBA 2LF8A 3REOA 1HQCA 4HOBA 1I50J 4CCMA 4PUSA 2CSOA 1OYWA 3LA7A 5LGNA 5K1YA 2V79A 3H92A 3DKXA 2IVMA 2O8KA 5C4JJ 2BEOA 3DKYA 2LFBA 3OS2A 1APLC 1YYVA 4IL6C 4UUVA 2K4JA 1UB9A 1RR7A 2EIJH 4N9IA 4A3LJ 3ECOA 1LE8B 2VXDA 2ZBKA 3H0DA 2PI0A 1F1ZA 1WI9A 2COBA 3HC7A 4KA4A 3HDDA 3GEZA 1MBJA 2QQ9A 3MAJA 2O7OA 4WWCA 4Y7NJ 4XRMA 2CS3A 1ITYA 3V8KA 3OR2C 2R5YA 2XIGA 1P6RA 1BR1A 2M8GX 2MBFA 1R7JA 2M5WA 1MSFC 4KJZA 1BI1A 2TCTA 2MD5A 2KIUA 2WV1A 4G6QA 4XLEA 3S2WA 3QODA 4HNTA 4JBAA 4E7ZA 3WTZA 5EJCA 2XSJC 3BTJA 3F0CA 3RSNA 1W7PD 2LY2A 4PJ0C 1DU6A 2EQRA 1AKHB 5EEGA 2M0CA 3PM1A 2Y30A 3C2BA 1V3FA 2IW5A 1QZEA 4M6YA 3I4MJ 1SD7A 5DM7F 4J01A 2BY0A 3B6AA 3KP2A 4KN7X 1IN4A 4L9TA 4XLFA 3GLXA 1RUOA 1FOKA 2VPRA 2UUZA 3K7AJ 3K69A 1B59A 4DBQA 3ABKH 2CUFA 4ITVA 1AOYA 4ZDOA 3K0LA 5F1RA 3SXYA 3K4BA 4EJVA 2B9SA 5FD5A 3MZHA 4U7DA 1FJLA 2EV5A 2QSGX 3LFUA 2G7HA 3DPUA 3W3CA 3OS0A 2I10A 3GTPJ 4G12A 1QZYA 3PO2J 4W97A 1JTYA 3F72A 2Y75A 4D1QA 4XSXF 4XK4A 4XKBA 4GO1A 1J75A 2ID6A 1W36D 2FMLA 3JREA 2IGNA 2M7BA 2WY8Q 1LE8A 3U1KA 1WJCA 1D3YA 1XCVA 4XOPA 5F27A 3A01B 4XICA 4LG0B 1LDDA 1FMVA 4A69C 2V9VA 4I2OA 2COMA 1T0FC 1B1BA 3WG7H 2PQ8A 2XAUA 1YS7A 3BTIA 4GDFA 2XKOA 2IPQX 4ZYGA 4XONA 4ZZLA 2LBFA 3HGGA 2HFHA 1R4NB 4KUMA 1N25A 4IKFA 2O0YA 4MGRA 3BJAA 4L5JA 3TP0A 1O7LA 2VC1A 2JA2A 2VJIA 1P4WA 1REPC 2P7VB 3NWSA 1T6SA 5J1RA 1OR7C 1D1CA 1FSEA 3R0AA 1BJZA 3B6CA 2F5EA 4LOCA 1O7FA 2L9NA 3QOEA 2ECCA 2HWVA 3S3NA 1IO2A 1AKHA 5FROA 4HX4A 1XSXA 3VEPA 2JTVA 2JA8J 3FXQA 2ELJA 4ENNA 4EJOA 3AG1H 3P5JA 4AIKA 3A02A 1R1VA 4I7HA 1I39A 3TW6A 1SAXA 3ZMZA 2MD0A 1BBYA 1FP2A 3KZIC 4A0ZA 2UWMA 2E60A 3MQ0A 1EH7A 2LC2A 4LIUA 1X1DA 4ENKA 3F3XA 1YQAA 4BU2A 2IGKA 4XSZF 3LSPA 3K6GA 2LREA 3O3KA 5IYDJ 4BHPA 5E3NA 1LEAA 5DEQA 4FCYA 3KP5A 4RDUA 1HKSA 2DA1A 2E1NA 3C18A 3ZQQA 5FLXK 3E1SA 4D7NA 4BUPA 2BZTA 2OU2A 4C2MJ 3H35A 3MWMA 3KZZA 3PIOF 1IV8A 2ME0A 4OAYA 2CH0A 4ZTFA 2XGCA 2J5PA 3S15J 2F5CA 2HZDA 3BR6A 3Q9VA 2BV6A 2A5YB 3LSIA 4MQVA 4P5OA 1IDZA 1MJAA 2DJIA 2HTSA 1MIJA 2KJBA 4M73A 3VDXA 4RGRA 4C9YA 3FK7A 1WVRA 2X1DA 2Z33A 4Y33A 1IRXA 3A01A 3PQKA 4AIDA 4A3CJ 3QYEA 4DYQA 2JA5J 4EM2A 1U9OA 3CCMI 2XAGA 1WJBA 2Y69H 2WADA 1A31A 2ID3A 5J40A 1YJNI 1MW7A 5IP7J 2XVCA 4IEJA 1XB4A 1XC5A 4L0YB 1Z7UA 3VSLA 4J00A 1L3LA 3VSKA 1IAWA 3MKZA 3DEEA 5DDGA 4AIJA 2D2WA 3HRSA 1AA7A 1XN7A 4PJNA 3J80K 3FX3A 2XASA 3I56I 2A6EF 4JOMA 1FPQA 1R5GA 4P9FA 4ZTJA
chains in the Genus database with same CATH topology
4MLOA 1JT0A 2G0EA 1RESA 2CQQA 1IGNA 1JJ8C 3FIWA 1ETWA 1SFOJ 2HOSA 2AO9A 2EZIA 1FEXA 5FKMA 1OCTC 5IOYA 3CDLA 1X58A 3BG5A 2LKXA 3Q3SA 2Y9ZA 1QVUA 1IV6A 1RKWA 1OJLA 3OSGA 5K7FA 1WCMJ 1WGXA 2DA3A 1ZKGA 3BT9A 3G1LA 4CYCB 5EF6A 5HODA 1W0UA 1B72A 5M5YJ 2JN6A 4D5CA 4M3FA 3ZQIA 3K2AA 1NTCA 2NVQJ 2DTZA 3GTLJ 1QPIA 2R5ZA 3HOUJ 4DZPA 1W0TA 3S1RJ 4A3IJ 3ZOBA 1JKQC 1POGA 4M3EA 5C4XJ 5DTDA 3IH2A 2JMWA 5M3FJ 2ME6A 1H89C 4AC0A 1ZR4A 3GTGJ 5FLMJ 1UHSA 1MBKA 3OOUA 2D5VA 2NS7A 3LOCA 4I6ZA 1RETA 2DMQA 2NOGA 2Y31A 2L7MP 5IP6A 2M9HA 2XRLA 5EGOB 3FISA 3SDGA 1QRYA 1H88C 3HKZN 2VI6A 5GP9A 3S2HJ 4BBSJ 1MBEA 3BR2A 2DMNA 3MN2A 1WI3A 3S14J 1MH3A 2CJJA 3BR1A 1U78A 4IHXA 2HOAA 1JGGA 1MH4A 1X2NA 3PO3J 2XB5A 2HYJA 2NS8A 1ETVA 1K83J 4BBRJ 5J1UA 2LP0A 3ZQCA 1GV5A 1MBGA 1ETKA 2CUEA 5J3LA 3Q0VA 3TW7A 4A3FJ 3M3YJ 2FJ1A 3JRBA 1FTZA 4B3AA 4Y52J 1UG2A 5K7HA 1BW5A 2XPWA 3I4NJ 2E2IJ 1DU0A 4CYCA 4W1UA 1T33A 4MIMA 3Q0UA 1RPWA 3GTKJ 4JX4A 1BW6A 4A3KJ 2XPUA 3JRDA 2DMPA 1R9TJ 3JRAA 4XIDA 3H0GJ 4IHWA 3SFIA 5J1YA 2EZKA 3DCFA 2VUMJ 2K9QA 2OPTA 1ZQ3P 2RAEA 1BL0A 2DA6A 4M3BA 3JRHA 2QCOA 5E3OA 1HCRA 5IP9J 4XRSG 5F08A 4C3HJ 1NK2P 5GPAA 1ETXA 1JUSA 4DYCA 3HBLA 2EH3A 4MO7A 3E7LA 2R0QC 5IPAA 1IUFA 3O8HA 4FE4A 2Y0SN 4UUSB 4BXXJ 5EGOA 1E3OC 4MFEA 4A3GJ 3BR0A 1TWGJ 1GDTA 3G1OA 3G1MA 1MSEC 4M6VA 2JJ7A 3D1NI 3HOZJ 4DW6A 4IHYA 3HM5A 4AYBN 1YRNB 1JKRC 3LNQA 5JLXA 3BQZA 4IHVA 4XRSA 2GLOA 2ZB9A 2R93J 3BG3A 2R5YB 5F0CA 4X1EA 1A6IA 1JTXA 2CQXA 2LK2A 4DYRA 5JLWA 1UMQA 5K7ZA 1IDYA 2LD5A 3W6VA 4L5EA 2NVYJ 3VPRA 1PUFB 2ELKA 1EF4A 2R7ZJ 1U9NA 4J19A 2MG4A 1GUUA 1ENHA 4JX5A 2PMZN 2Y9YA 4ABZA 5FLVA 1VNDA 1F36A 1JUMA 2DJNA 1OCPA 4JYKA 2E1OA 2K9NA 5F1JA 3LSJA 3MKLA 4JX6A 2OF7A 3CQZJ 5C44J 4M3DA 5FKNA 1ZGWA 1GT0C 1IC8A 3OSFA 1TWCJ 4V2GA 2EBIA 4C3IJ 5DS9A 2MSYA 2JA6J 2XB0X 4MFDA 2JWTA 2FQ4A 5M3MJ 2H8RA 1H8AC 4FTHA 2YU9J 1JKPC 1U8BA 4FE7A 2WAQN 1ZTRA 2DA4A 1IRZA 1CQTA 2R92J 5IYCJ 1P7JA 2ECBA 5EYRA 1BA5A 1I50J 3IH3A 4QIWN 1FIPA 3WHBA 3Q0WA 1D5YA 1RKTA 1B8IB 5FKKA 2O8KA 5C4JJ 1ZR2A 2L0KA 2B63J 2LFBA 2TRTA 1APLC 4X6AJ 4UUSA 1RR7A 4A3LJ 1VI0A 1LE8B 1ETOA 3MVPA 3JR9A 3ZQFA 2X9DA 1XG1A 3ZQHA 4D5FA 5FKOA 2COBA 1Q1VA 2EZHA 1I6HJ 2NVTJ 3HDDA 1MBJA 3S1QJ 1WH5A 2O7OA 4NDLA 1GVDA 2FX0A 4D7MA 4Y7NJ 2E2JJ 4XRMA 1LFBA 2Y2ZA 1AU7A 3BQYA 1ITYA 1IJWC 1FIAA 2R5YA 5M5WJ 1XS9A 3ZQLA 2M8GX 2E2HJ 3CCYA 2YS9A 2HOTA 1MSFC 3NAUA 2TCTA 2WV1A 2GBYA 2XGDA 2LR8A 1PUFA 1TWAJ 3JRGA 1JKOC 3BTJA 3F0CA 1VFCA 4C3JJ 1DU6A 2IBDA 2EQRA 4A3EJ 1AKHB 2M0CA 3PM1A 4B4CA 2Y30A 2M2EA 3C2BA 5EZGA 2JK3A 1MBFA 3HOWJ 2JA7J 3I4MJ 2WB1N 3B6AA 1X2MA 5IOZA 1ORKA 2VPRA 3K7AJ 4UUTA 2CUFA 2VKVA 1K61A 2L7FP 3HOYJ 4GFBA 3HEFA 2MGQA 2LTPA 3DEWA 5FJ8J 1FJLA 3NARA 3IV5A 1WPKA 2E19A 2QF7A 2XPVA 4M3GA 2I10A 2FD5A 3GTPJ 3H3VK 3UKGA 2DA2A 2CRGA 3BR5A 4G12A 3PO2J 4W97A 1WH7A 1B8IA 1JTYA 1A5JA 3RQIA 3RZDJ 4XK4A 3TP3A 1MNMC 4JP0A 1S7EA 2IAIA 1TC3C 2X48A 2ID6A 1Y1WJ 2W48A 3JREA 3CMYA 1LE8A 2YUSA 3OIOA 4FISA 5F27A 1HF0A 5F0FA 3A01B 4XICA 2O9LA 4A3MJ 4A69C 5BNGA 2K9SA 3GTJJ 1GV2A 1HOMA 2DMUA 2DA5A 3BTIA 2KT0A 1ETQA 2L7ZA 2LY9A 3HOXJ 4A3BJ 1T56A 3JRFA 3HGGA 1JT6A 5EG0B 3L1PA 4QSHA 3BTLA 3TP0A 5EEAA 2HQ5A 2IEKA 4DZJA 4RBOA 4BY7J 5J1RA 1Y1VJ 1BJZA 3B6CA 4LOCA 5E3MA 1P7IA 4B1RA 1HDPA 2KDZA 2ECCA 1ETYA 3RKQA 1LFUP 1NK3P 1IG7A 3GTMJ 1AKHA 3A03A 2JA8J 1JUPA 2HXOA 5FKLA 5EZHA 4HNVA 3A02A 3JRCA 3TW6A 2M34A 2DN0A 3GTQJ 4I76A 2HDDA 3QPSA 2K40A 5F04A 2N8GA 1JJ6C 4A3JJ 3LSPA 4S0HB 5F0HA 5IYDJ 2XSDC 5E3NA 3SJMA 1B72B 3S2DJ 1TWHJ 2H1KA 1SANA 4FCYA 1QVTA 4RDUA 1ZK8A 2DA1A 1HLVA 3GTOJ 2LVSA 2XGEA 5IYBJ 3QPLA 3S1MJ 4D7NA 4C2MJ 1VF9A 2MW8A 1YRNA 3LSRA 2ME0A 5GPCA 3BG9A 2NVXJ 3IH4A 2XGCA 3QQAA 5M5XJ 3S15J 2R5ZB 3BR6A 3WHCA 2EZLA 3HB9A 3TEDA 3FKIJ 2DMTA 1Z0XA 3HGYA 5C3EJ 1IDZA 2HXIA 3S17J 4V2FA 2L9RA 1Z77A 2CU7A 3ZQGA 4BKXA 4A93J 5EDNA 2AHQA 2VKEA 3FK7A 3HOVJ 1OFCX 3A01A 4A3CJ 3O8GA 4DYQA 2JA5J 1U9OA 4AUXA 3M4OJ 3GBGA 2HI3A 1HDDC 1F43A 1TWFJ 1FTTA 2ID3A 4EEFG 1G2HA 3RZOJ 3S16J 9ANTA 5IP7J 1I3QJ 5EG0A 4IEJA 4A3DJ 3BR3A 1XC5A 3JRIA 2X6OA 5E3LA 3FK6A 1MBHA 4BY1J 2DA7A 3S1NJ 4QTRA 3LSGA 2GM4A 2LLKA 2P81A 1O4XA 3BTCA 1AHDP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLO A;  1JT0 A;  2G0E A;  1RES A;  2CQQ A;  1IGN A;  1JJ8 C;  3FIW A;  1ETW A;  1SFO J;  2HOS A;  2AO9 A;  2EZI A;  1FEX A;  5FKM A;  1OCT C;  5IOY A;  3CDL A;  1X58 A;  3BG5 A;  2LKX A;  3Q3S A;  2Y9Z A;  1QVU A;  1IV6 A;  1RKW A;  1OJL A;  3OSG A;  5K7F A;  1WCM J;  1WGX A;  2DA3 A;  1ZKG A;  3BT9 A;  3G1L A;  4CYC B;  5EF6 A;  5HOD A;  1W0U A;  1B72 A;  5M5Y J;  2JN6 A;  4D5C A;  4M3F A;  3ZQI A;  3K2A A;  1NTC A;  2NVQ J;  2DTZ A;  3GTL J;  1QPI A;  2R5Z A;  3HOU J;  4DZP A;  1W0T A;  3S1R J;  4A3I J;  3ZOB A;  1JKQ C;  1POG A;  4M3E A;  5C4X J;  5DTD A;  3IH2 A;  2JMW A;  5M3F J;  2ME6 A;  1H89 C;  4AC0 A;  1ZR4 A;  3GTG J;  5FLM J;  1UHS A;  1MBK A;  3OOU A;  2D5V A;  2NS7 A;  3LOC A;  4I6Z A;  1RET A;  2DMQ A;  2NOG A;  2Y31 A;  2L7M P;  5IP6 A;  2M9H A;  2XRL A;  5EGO B;  3FIS A;  3SDG A;  1QRY A;  1H88 C;  3HKZ N;  2VI6 A;  5GP9 A;  3S2H J;  4BBS J;  1MBE A;  3BR2 A;  2DMN A;  3MN2 A;  1WI3 A;  3S14 J;  1MH3 A;  2CJJ A;  3BR1 A;  1U78 A;  4IHX A;  2HOA A;  1JGG A;  1MH4 A;  1X2N A;  3PO3 J;  2XB5 A;  2HYJ A;  2NS8 A;  1ETV A;  1K83 J;  4BBR J;  5J1U A;  2LP0 A;  3ZQC A;  1GV5 A;  1MBG A;  1ETK A;  2CUE A;  5J3L A;  3Q0V A;  3TW7 A;  4A3F J;  3M3Y J;  2FJ1 A;  3JRB A;  1FTZ A;  4B3A A;  4Y52 J;  1UG2 A;  5K7H A;  1BW5 A;  2XPW A;  3I4N J;  2E2I J;  1DU0 A;  4CYC A;  4W1U A;  1T33 A;  4MIM A;  3Q0U A;  1RPW A;  3GTK J;  4JX4 A;  1BW6 A;  4A3K J;  2XPU A;  3JRD A;  2DMP A;  1R9T J;  3JRA A;  4XID A;  3H0G J;  4IHW A;  3SFI A;  5J1Y A;  2EZK A;  3DCF A;  2VUM J;  2K9Q A;  2OPT A;  1ZQ3 P;  2RAE A;  1BL0 A;  2DA6 A;  4M3B A;  3JRH A;  2QCO A;  5E3O A;  1HCR A;  5IP9 J;  4XRS G;  5F08 A;  4C3H J;  1NK2 P;  5GPA A;  1ETX A;  1JUS A;  4DYC A;  3HBL A;  2EH3 A;  4MO7 A;  3E7L A;  2R0Q C;  5IPA A;  1IUF A;  3O8H A;  4FE4 A;  2Y0S N;  4UUS B;  4BXX J;  5EGO A;  1E3O C;  4MFE A;  4A3G J;  3BR0 A;  1TWG J;  1GDT A;  3G1O A;  3G1M A;  1MSE C;  4M6V A;  2JJ7 A;  3D1N I;  3HOZ J;  4DW6 A;  4IHY A;  3HM5 A;  4AYB N;  1YRN B;  1JKR C;  3LNQ A;  5JLX A;  3BQZ A;  4IHV A;  4XRS A;  2GLO A;  2ZB9 A;  2R93 J;  3BG3 A;  2R5Y B;  5F0C A;  4X1E A;  1A6I A;  1JTX A;  2CQX A;  2LK2 A;  4DYR A;  5JLW A;  1UMQ A;  5K7Z A;  1IDY A;  2LD5 A;  3W6V A;  4L5E A;  2NVY J;  3VPR A;  1PUF B;  2ELK A;  1EF4 A;  2R7Z J;  1U9N A;  4J19 A;  2MG4 A;  1GUU A;  1ENH A;  4JX5 A;  2PMZ N;  2Y9Y A;  4ABZ A;  5FLV A;  1VND A;  1F36 A;  1JUM A;  2DJN A;  1OCP A;  4JYK A;  2E1O A;  2K9N A;  5F1J A;  3LSJ A;  3MKL A;  4JX6 A;  2OF7 A;  3CQZ J;  5C44 J;  4M3D A;  5FKN A;  1ZGW A;  1GT0 C;  1IC8 A;  3OSF A;  1TWC J;  4V2G A;  2EBI A;  4C3I J;  5DS9 A;  2MSY A;  2JA6 J;  2XB0 X;  4MFD A;  2JWT A;  2FQ4 A;  5M3M J;  2H8R A;  1H8A C;  4FTH A;  2YU9 J;  1JKP C;  1U8B A;  4FE7 A;  2WAQ N;  1ZTR A;  2DA4 A;  1IRZ A;  1CQT A;  2R92 J;  5IYC J;  1P7J A;  2ECB A;  5EYR A;  1BA5 A;  1I50 J;  3IH3 A;  4QIW N;  1FIP A;  3WHB A;  3Q0W A;  1D5Y A;  1RKT A;  1B8I B;  5FKK A;  2O8K A;  5C4J J;  1ZR2 A;  2L0K A;  2B63 J;  2LFB A;  2TRT A;  1APL C;  4X6A J;  4UUS A;  1RR7 A;  4A3L J;  1VI0 A;  1LE8 B;  1ETO A;  3MVP A;  3JR9 A;  3ZQF A;  2X9D A;  1XG1 A;  3ZQH A;  4D5F A;  5FKO A;  2COB A;  1Q1V A;  2EZH A;  1I6H J;  2NVT J;  3HDD A;  1MBJ A;  3S1Q J;  1WH5 A;  2O7O A;  4NDL A;  1GVD A;  2FX0 A;  4D7M A;  4Y7N J;  2E2J J;  4XRM A;  1LFB A;  2Y2Z A;  1AU7 A;  3BQY A;  1ITY A;  1IJW C;  1FIA A;  2R5Y A;  5M5W J;  1XS9 A;  3ZQL A;  2M8G X;  2E2H J;  3CCY A;  2YS9 A;  2HOT A;  1MSF C;  3NAU A;  2TCT A;  2WV1 A;  2GBY A;  2XGD A;  2LR8 A;  1PUF A;  1TWA J;  3JRG A;  1JKO C;  3BTJ A;  3F0C A;  1VFC A;  4C3J J;  1DU6 A;  2IBD A;  2EQR A;  4A3E J;  1AKH B;  2M0C A;  3PM1 A;  4B4C A;  2Y30 A;  2M2E A;  3C2B A;  5EZG A;  2JK3 A;  1MBF A;  3HOW J;  2JA7 J;  3I4M J;  2WB1 N;  3B6A A;  1X2M A;  5IOZ A;  1ORK A;  2VPR A;  3K7A J;  4UUT A;  2CUF A;  2VKV A;  1K61 A;  2L7F P;  3HOY J;  4GFB A;  3HEF A;  2MGQ A;  2LTP A;  3DEW A;  5FJ8 J;  1FJL A;  3NAR A;  3IV5 A;  1WPK A;  2E19 A;  2QF7 A;  2XPV A;  4M3G A;  2I10 A;  2FD5 A;  3GTP J;  3H3V K;  3UKG A;  2DA2 A;  2CRG A;  3BR5 A;  4G12 A;  3PO2 J;  4W97 A;  1WH7 A;  1B8I A;  1JTY A;  1A5J A;  3RQI A;  3RZD J;  4XK4 A;  3TP3 A;  1MNM C;  4JP0 A;  1S7E A;  2IAI A;  1TC3 C;  2X48 A;  2ID6 A;  1Y1W J;  2W48 A;  3JRE A;  3CMY A;  1LE8 A;  2YUS A;  3OIO A;  4FIS A;  5F27 A;  1HF0 A;  5F0F A;  3A01 B;  4XIC A;  2O9L A;  4A3M J;  4A69 C;  5BNG A;  2K9S A;  3GTJ J;  1GV2 A;  1HOM A;  2DMU A;  2DA5 A;  3BTI A;  2KT0 A;  1ETQ A;  2L7Z A;  2LY9 A;  3HOX J;  4A3B J;  1T56 A;  3JRF A;  3HGG A;  1JT6 A;  5EG0 B;  3L1P A;  4QSH A;  3BTL A;  3TP0 A;  5EEA A;  2HQ5 A;  2IEK A;  4DZJ A;  4RBO A;  4BY7 J;  5J1R A;  1Y1V J;  1BJZ A;  3B6C A;  4LOC A;  5E3M A;  1P7I A;  4B1R A;  1HDP A;  2KDZ A;  2ECC A;  1ETY A;  3RKQ A;  1LFU P;  1NK3 P;  1IG7 A;  3GTM J;  1AKH A;  3A03 A;  2JA8 J;  1JUP A;  2HXO A;  5FKL A;  5EZH A;  4HNV A;  3A02 A;  3JRC A;  3TW6 A;  2M34 A;  2DN0 A;  3GTQ J;  4I76 A;  2HDD A;  3QPS A;  2K40 A;  5F04 A;  2N8G A;  1JJ6 C;  4A3J J;  3LSP A;  4S0H B;  5F0H A;  5IYD J;  2XSD C;  5E3N A;  3SJM A;  1B72 B;  3S2D J;  1TWH J;  2H1K A;  1SAN A;  4FCY A;  1QVT A;  4RDU A;  1ZK8 A;  2DA1 A;  1HLV A;  3GTO J;  2LVS A;  2XGE A;  5IYB J;  3QPL A;  3S1M J;  4D7N A;  4C2M J;  1VF9 A;  2MW8 A;  1YRN A;  3LSR A;  2ME0 A;  5GPC A;  3BG9 A;  2NVX J;  3IH4 A;  2XGC A;  3QQA A;  5M5X J;  3S15 J;  2R5Z B;  3BR6 A;  3WHC A;  2EZL A;  3HB9 A;  3TED A;  3FKI J;  2DMT A;  1Z0X A;  3HGY A;  5C3E J;  1IDZ A;  2HXI A;  3S17 J;  4V2F A;  2L9R A;  1Z77 A;  2CU7 A;  3ZQG A;  4BKX A;  4A93 J;  5EDN A;  2AHQ A;  2VKE A;  3FK7 A;  3HOV J;  1OFC X;  3A01 A;  4A3C J;  3O8G A;  4DYQ A;  2JA5 J;  1U9O A;  4AUX A;  3M4O J;  3GBG A;  2HI3 A;  1HDD C;  1F43 A;  1TWF J;  1FTT A;  2ID3 A;  4EEF G;  1G2H A;  3RZO J;  3S16 J;  9ANT A;  5IP7 J;  1I3Q J;  5EG0 A;  4IEJ A;  4A3D J;  3BR3 A;  1XC5 A;  3JRI A;  2X6O A;  5E3L A;  3FK6 A;  1MBH A;  4BY1 J;  2DA7 A;  3S1N J;  4QTR A;  3LSG A;  2GM4 A;  2LLK A;  2P81 A;  1O4X A;  3BTC A;  1AHD P; 
#chains in the Genus database with same CATH topology
 4MLO A;  4XN3 A;  1FT9 A;  3OY9 A;  5L3B A;  2F4M B;  4RAZ A;  2KIF A;  1JJ8 C;  1NHA A;  1ETW A;  3FIW A;  5DYM A;  1SFO J;  2HOS A;  2EZI A;  4ZYE A;  1ZG3 A;  3WTU C;  5IOY A;  2HQR A;  2Q0O A;  1X58 A;  2LKX A;  3Q3S A;  1QVU A;  1IV6 A;  1RKW A;  3GYH X;  4PJM A;  2NRA C;  2FQ3 A;  1ZKG A;  1Z1D A;  3LWF A;  5EF6 A;  1KGS A;  4N4N B;  5M5Y J;  2E1M C;  2H6C A;  5ICG A;  4UY8 I;  2JN6 A;  2Z2S B;  3L9F A;  2OD5 A;  3K2A A;  5ERI A;  2FMY A;  1YW9 A;  2XF7 A;  4UXN A;  5CQE A;  3TOB A;  2E7W A;  1R4M B;  1LDK B;  3OYH A;  1XSV A;  4CCK A;  3RIR A;  4QLC U;  4DZP A;  1W0T A;  1I1S A;  5LHI A;  1OMI A;  1QNT A;  3E5Q A;  1JKQ C;  4M3E A;  3P9K A;  4KIB A;  4C2U A;  4YFX F;  5M3F J;  3S32 A;  2ME6 A;  3MKW B;  2EIN H;  4O5V A;  4I09 A;  1KU9 A;  3K4N A;  1O3Q A;  2D5V A;  2JVH A;  1X4P A;  4UV8 A;  1U3E M;  1OKR A;  2NOG A;  5HDN A;  4BYY A;  3HUG B;  2M9H A;  4QPO A;  4U0Y A;  1TZL A;  3EUH A;  1YJ9 I;  4B8X A;  2LNB A;  1TW2 A;  2QA4 I;  3HKZ N;  2VI6 A;  2KQR A;  1DPR A;  1OCC H;  5E18 F;  3H9J A;  5GAG J;  2STT A;  2ZJQ F;  2L01 A;  4OIO F;  5LHH A;  3K9T A;  3OYA A;  3QP6 A;  1OYY A;  1IRG A;  1FOW A;  3CJR B;  3IWF A;  2K27 A;  1MH4 A;  2V26 A;  5CVV A;  1X2N A;  4Z2Y A;  2PJR B;  4E6K G;  1YTY A;  1ETV A;  1K83 J;  4KIG A;  2R4G A;  3K70 D;  1YE9 A;  2JT1 A;  4M9X A;  4LB5 A;  3ZQC A;  1U0J A;  4RGX A;  1VQP I;  1GV5 A;  4BAY A;  4OIQ F;  2R7V A;  1E3P A;  3PIP F;  5CJ9 A;  2L2O A;  2ADU A;  4LGW A;  4OWR B;  4QWQ A;  4AM3 A;  4Y52 J;  1LPQ A;  3DLA A;  4RMN A;  3W2A A;  3AKZ A;  1DU0 A;  1WJF A;  2FUG 2;  4W1U A;  1SEU A;  4MTE A;  4Z6Y A;  4CSW A;  2L4A A;  3DXJ F;  3OL4 A;  2KHM A;  4YEL A;  1J9I A;  4L9J A;  2K3P A;  5L3G A;  1R9T J;  4A6E A;  4RB1 A;  4FET A;  3JRA A;  4ENM A;  4BNC A;  3COA C;  2NNY A;  3H9Q A;  4IXA A;  3BJO A;  3X2Q H;  2HDC A;  3DKW A;  2LG4 A;  3RKY A;  2VUM J;  3OL3 A;  3EQL F;  3KYL A;  1IN5 A;  5LGT A;  5GAH J;  1SMT A;  1TL8 A;  4L0Z B;  1DP3 A;  3JTG A;  1GXQ A;  5GPA A;  1YX5 A;  2EH3 A;  2BY3 A;  3E7L A;  2R0Q C;  1JI8 A;  1W5C C;  3MMY B;  2VKD A;  4YG2 F;  3BG6 A;  3HUG A;  3QU3 A;  2ZO4 A;  4O3M A;  2M45 A;  4MFE A;  2RGV A;  1QU3 A;  4RGS A;  4M6V A;  2VE9 A;  3HOZ J;  5KAF C;  4BL0 B;  2WAE A;  2R7O A;  1G3S A;  4RB3 C;  2P6S A;  2C6Y A;  3WTV C;  3F8C A;  2DTR A;  1D0Z A;  1X3Z B;  2GLO A;  2CQ7 A;  3MEX A;  2R93 J;  3IP4 B;  2WB1 A;  4EJT A;  2PJR A;  4AVP A;  2HGC A;  5JLW A;  3OMY A;  1MMD A;  3MCZ A;  3VB2 A;  4BHB A;  1HW2 A;  2NVY J;  4KMF A;  2PMH A;  2ZXI A;  5HLG A;  2GZW A;  4BJT A;  2ELK A;  2L3D A;  2R7Z J;  1QA6 A;  2LY1 A;  1U9N A;  3JAM Z;  2O6G E;  2CW8 A;  3FBN B;  1ENH A;  4EGZ A;  5IT9 Z;  2DO7 A;  3BP8 A;  1ZLJ A;  2L02 A;  2PMZ N;  4KIF A;  4ABZ A;  4CCL A;  4L9N A;  4CCO A;  1LVK A;  2HYF A;  2VT2 A;  1VZ0 A;  5E17 F;  1PJR A;  3MKL A;  4E7S A;  4JX6 A;  4LB6 B;  3GWZ A;  1GT0 C;  3IAM 2;  1IC8 A;  3HOS A;  3MZ8 A;  4C3I J;  5DS9 A;  5D8L B;  2HYG D;  3IWZ A;  3H3U A;  2JWT A;  1LEB A;  2BYV E;  3HZJ A;  2H8R A;  3OYF A;  1H8A C;  4KNY A;  1U8B A;  1SVL A;  1F9N A;  2DA4 A;  1IRZ A;  1CQT A;  3BG7 A;  3ZMU A;  2W1O A;  3A2K A;  4TV7 A;  3SZT A;  5LFA A;  2EWN A;  3H36 A;  4QIW N;  4PCQ A;  1MMN A;  2FBH A;  3OYJ A;  1FIP A;  3HSF A;  4XL9 A;  3WHB A;  1XD7 A;  1XMA A;  4GYG A;  1D5Y A;  2DDA A;  4HDV A;  4I0B A;  4EJW A;  2CFO A;  3KLN A;  2XAF A;  1S9H A;  2B63 J;  3IRQ A;  2TRT A;  4X6A J;  3K4M A;  3G73 A;  1A36 A;  1B9M A;  2GIZ A;  3OYM A;  2L9S A;  1V5E A;  2EV0 A;  3RYP A;  3DEU A;  2VBY A;  4MHG A;  4FX0 A;  3JR9 A;  1SAU A;  3ZQH A;  3CCV I;  4D5F A;  5FKO A;  1Q1V A;  2BVL A;  2NVT J;  3S1Q J;  1OCR H;  1UEL B;  4CUG A;  4NDL A;  1NH3 A;  5JI6 A;  5CLS A;  1GVD A;  2FX0 A;  3S8P A;  2XC7 A;  1USS A;  2XRO A;  3TOA A;  1T08 B;  1GLN A;  4PSX A;  3M07 A;  2EFP A;  1KQ0 A;  2VQG A;  2DFH A;  4ESB A;  1VFC A;  3E6M A;  2OQG A;  4BQN A;  4IJA A;  2VAS A;  5K5O A;  4B48 A;  5DUI A;  4ETS A;  3GUD A;  4B4C A;  5EZG A;  4G7O F;  1MBF A;  3HOW J;  2JA7 J;  1LDJ A;  4IF4 A;  1BR4 A;  1Y6I A;  2HEO A;  2W85 A;  1X2M A;  1D1B A;  1WFX A;  2W7N A;  1XX5 A;  4UB6 C;  1BJA A;  2LF7 A;  4HF1 A;  4E7K A;  2L7F P;  2KRH A;  4GXO A;  5KNL A;  3BC8 A;  4GFB A;  4IHS A;  1HW1 A;  3FXL A;  5IY5 H;  2B7E A;  1J59 A;  4P96 A;  5FFX A;  2LTP A;  3DEW A;  1JHF A;  4YFK F;  3NAR A;  3I5U A;  1WPK A;  4DNC A;  2VXZ A;  4HA8 A;  5HS8 A;  2UZK A;  2XPV A;  1CGP A;  4RAF A;  1FYK A;  4G8X A;  3TO9 A;  5CPR B;  2CRG A;  1BC7 C;  3BR5 A;  1UFM A;  2FNA A;  1I1G A;  2QEX I;  1WH7 A;  2BY1 A;  2PEX A;  5JVG F;  3CC2 I;  3E0J B;  3SDB A;  2MC4 A;  3F23 A;  3BZC A;  2X48 A;  1ZAR A;  2QVO A;  4HRI A;  3J7A Y;  3IAS 2;  1QHG A;  3H5R A;  4CIC A;  3CMY A;  4HAM A;  3OIO A;  4FIS A;  2NNN A;  2L7K A;  1U5T B;  5F0F A;  2AQF A;  2Z99 A;  4A3M J;  3VFZ A;  4WXH A;  2VLA A;  2HU9 A;  1WSU A;  4CGZ A;  2QWW A;  2ZJP F;  1HXD A;  2DMU A;  2KT0 A;  4HDU A;  1ETQ A;  2L7Z A;  2VQH A;  3AG4 H;  4PGG A;  4XRF A;  3ZN0 A;  3CCE I;  3JRF A;  5EG0 B;  5BMZ A;  5L3D A;  3BTL A;  3LA2 A;  3GLL A;  2CFX A;  3A0B C;  2IEK A;  4AWX B;  1IZ1 A;  1F5T A;  4BY7 J;  2MLK A;  1D0X A;  5HDK A;  4I02 A;  2E1M B;  2QZ8 A;  4XBF A;  2ISZ A;  2BVM A;  1B9N A;  1Y1V J;  5E3M A;  1P7I A;  1GHC A;  3DBR B;  2KDZ A;  1VQ8 I;  3F8N A;  3MD2 A;  2F5D A;  4L18 B;  2HDW A;  2HKX A;  1W4M A;  3ABU A;  3F8B A;  1IG7 A;  1JUP A;  2HXO A;  1LUJ B;  1J5Y A;  3N97 A;  3KEQ A;  3JRC A;  2M7A A;  2DN0 A;  3ZMV A;  3E5U A;  4LLG F;  4PDK A;  1ZRC A;  2ELH A;  2HDD A;  2K40 A;  2N8G A;  4RGU A;  4A3J J;  2RRE A;  2V9K A;  3CLO A;  4A6D A;  4S0H B;  3WTT C;  5TRD A;  2F5V A;  3T8T A;  1O57 A;  3SJM A;  1MGT A;  1KZH A;  3TO7 A;  1TWH J;  3S2D J;  4U0V A;  2KL4 A;  3OYC A;  1ZK8 A;  5IYB J;  3S1M J;  1ZG1 A;  1VF9 A;  4D0P A;  1YRN A;  4U0W A;  2I5U A;  2IRF G;  4CHU A;  2RDP A;  3LSR A;  2KPM A;  4R8H A;  3L2U A;  3BG9 A;  3IH4 A;  3L2Q A;  3E5X A;  2OCC H;  3MKY B;  4ZDL A;  3BOQ A;  2E34 A;  2V9P A;  1Z0X A;  3HGY A;  1ZRF A;  3CC7 I;  2IA1 A;  1XPX A;  2DOA A;  1SMY F;  4PJL A;  2HXI A;  2RVC A;  4A93 J;  4BKX A;  1LKX A;  1T39 A;  1P4A A;  2RKH A;  3KEY A;  3KZY A;  4GCV A;  1YG2 A;  1U5T A;  5LGU A;  2QM3 A;  4BQO A;  5IT3 A;  3J81 Z;  3IKV A;  3CLQ A;  4NC6 A;  1OLT A;  1WHU A;  3DU6 A;  1W36 C;  4E4H A;  1F43 A;  1TWF J;  1TLH B;  1KQ9 A;  3V4G A;  3S16 J;  1YLF A;  1I3Q J;  1YIO A;  2M30 A;  5EG0 A;  2UXX A;  3DPL C;  4M74 A;  4A2U A;  1JXS A;  4BY1 J;  2R7R A;  3CJT B;  4Y17 A;  4U7B A;  3ULQ B;  2V6C A;  5CVR A;  2GM4 A;  4IX7 A;  3K2Z A;  4CZZ A;  4FAS D;  4CZC A;  3CDI A;  3HTS B;  2K85 A;  1EH8 A;  3WGI A;  1R1U A;  2ZJR F;  4BGD A;  1AHD P;  1IXR C;  1K6Y A;  4DBR A;  4WX9 A;  1BOA A;  2IJL A;  3KYC B;  3S3M A;  2Y0M A;  1IGN A;  3OWT A;  1Z6T A;  4M71 A;  1YFH A;  4HEA 2;  1XMK A;  1H0M A;  2VC0 A;  2ZKZ A;  2A5W A;  2QUF A;  3PSF A;  3K1N A;  1T2K A;  2H6B A;  3BG5 A;  1OJL A;  4RAY A;  5EEH A;  1WCM J;  5K7F A;  2DA3 A;  4CYC B;  3G1L A;  3QYF A;  4IRH A;  4DOZ A;  1SFK A;  5LRR A;  3TBI A;  5HOD A;  1W0U A;  1LQ1 A;  1XGN A;  2CG4 A;  3ERE D;  4D5C A;  5FRM A;  3ZQI A;  3CO7 C;  5JVT A;  2L54 A;  3QAH A;  4ZYD A;  3JCU C;  3PSI A;  2OCE A;  4OIN F;  5H6R A;  4PZJ A;  3VYU B;  5L3F A;  2EFQ A;  3GFJ A;  5DCM B;  2CYY A;  5HS7 A;  1CF7 B;  4OIP F;  2G7U A;  2CUJ A;  1Z91 A;  2EA4 A;  1FYM A;  1S6L A;  4XKV A;  3GTG J;  5FLM J;  3OOU A;  1Y8R B;  2F48 A;  3SEQ A;  4I6Z A;  1SC7 A;  1RET A;  3DF8 A;  2Y31 A;  2JRM A;  1XCB A;  5IP6 A;  2WBM A;  2XRL A;  5JHF A;  3FIS A;  3SDG A;  2OTJ I;  1IXS B;  2HQN A;  1T95 A;  2W57 A;  5GP9 A;  1UHW A;  1MBE A;  3FKJ A;  3R4K A;  3QRF F;  5DV5 A;  1DP7 P;  2KFD A;  1PDN C;  1WI3 A;  4CCJ A;  2CJJ A;  3BR1 A;  1G8X A;  5ILS A;  3PUB A;  2E7X A;  5FRN A;  3ZN1 A;  3LSH A;  5DM6 F;  5KVR A;  3H5A A;  1PP7 U;  4XOR A;  4IVN A;  2F2E A;  4MTD A;  4IHX A;  1IN8 A;  2DU9 A;  3JW4 A;  3D5S C;  2L5Q A;  3K10 A;  3FMS A;  2E71 A;  4RM2 A;  4ZDP A;  3RPQ A;  3ROU A;  5B1A H;  5J8F A;  2CW0 F;  4F92 B;  5CVU A;  2H8W A;  3CP8 A;  1VQ6 I;  1PVE A;  2E36 A;  1ON1 A;  5LLQ A;  2OZU A;  2J5O A;  4LK0 F;  3TW7 A;  2MYS A;  2GOX B;  2FJ1 A;  3JRB A;  2DOD A;  4LMY A;  1Y8Q B;  5CKT A;  3WGG A;  4B47 A;  3LAP A;  1FZP B;  5TGT A;  4UHT A;  3SQN A;  2OV7 A;  3I4N J;  4UVB A;  2Z1D A;  1TQP A;  4CYC A;  1PUE E;  1R23 A;  1VQ9 I;  4MIM A;  4H4K C;  4KFC A;  3Q0U A;  1RPW A;  4LG0 A;  5B66 C;  1I3A A;  4RLQ A;  3GO5 A;  4MEY F;  4RM3 A;  1RI7 A;  2XPU A;  3KP7 A;  1KON A;  2DMP A;  3SZG A;  4XID A;  2ESH A;  4M72 A;  2BXY A;  1G6N A;  2WA0 A;  3DCF A;  2IS4 A;  3MFK A;  3OOP A;  3R61 A;  5HVQ C;  2K9Q A;  2HVQ A;  5E79 C;  1CF7 A;  1BL0 A;  3K1M A;  1HCR A;  4RA2 A;  4EM1 A;  1ZN2 A;  4C3H J;  4LJZ F;  1EV7 A;  4II3 A;  1FNN A;  1ETX A;  1JUS A;  3HHH A;  1H9G A;  3HBL A;  4MO7 A;  1X1B A;  1ZGA A;  5IPA A;  1LFP A;  3O8H A;  3ABT A;  2Y0S N;  3LA3 A;  3NRV A;  1HSJ A;  2H1L A;  4BXX J;  4AD9 A;  2M1B A;  4F52 A;  4OIR F;  3F9K A;  4HST A;  4L5I A;  2O8X A;  1GDT A;  3G1M A;  2RQQ A;  5DCF A;  3LFK A;  4PFO A;  3BPX A;  3WTW C;  4LLL A;  4IHY A;  5TIS C;  2M4G A;  5BQT A;  4XKW A;  4L9V A;  1WJD A;  4LD5 A;  4AYB N;  5A2Q Z;  2X6W A;  1JKR C;  3ZXS A;  2HVS A;  3BQZ A;  1Q1H A;  2EK5 A;  2KIM A;  3GF2 A;  4G7Z F;  2X6Y A;  2ZB9 A;  1LNW A;  4N9H A;  1XSD A;  1P9Q C;  1A6I A;  4P1W A;  3GZ5 A;  4I01 A;  4DYR A;  2GXA A;  2HTJ A;  4WK8 F;  4YRV A;  3M7G A;  1IDY A;  2LD5 A;  1C0W A;  4L5E A;  2KJC A;  4XLA A;  2ZXW H;  1PUF B;  1MMG A;  3I53 A;  3I54 A;  3QYB A;  4XNF A;  4HQE A;  1EF4 A;  4OMZ A;  4J19 A;  1IUY A;  2MG4 A;  1GUU A;  4WXD A;  1KU7 A;  2M4K A;  4JX5 A;  2Y9Y A;  4CDG A;  1F36 A;  3K70 C;  1JUM A;  2M3A A;  4JYK A;  4CH7 A;  4QPQ A;  5F1J A;  1S7O A;  3CF2 A;  3LSJ A;  2LKP A;  4C30 A;  3CO6 C;  2OF7 A;  2DT7 B;  3CQZ J;  1HST A;  3IKT A;  2E5N A;  3BRO A;  3GX4 X;  4BS9 A;  3TGN A;  3S3O A;  2ZC2 A;  3H9G A;  3B02 A;  4OOI A;  2CV1 A;  2KZV A;  4F93 B;  2BBY A;  3LL7 A;  3RPU A;  3FXJ A;  2F4I A;  4HQM A;  3OYI A;  2KMU A;  2XB0 X;  1UST A;  1ZYR F;  2EPF A;  1JHH A;  2DI3 A;  4BH9 A;  2FQ4 A;  4DJA A;  2YU9 J;  1O3S A;  1JKP C;  3L09 A;  1B6A A;  3FM5 A;  1RNL A;  3T5X A;  4R1H A;  4ZH4 F;  1BA5 A;  5IYC J;  2VBW A;  3LQQ A;  5D5X B;  4R79 A;  3T8R A;  4ZYA A;  2ICW G;  2JZY A;  3OYG A;  3NWT A;  3Q0W A;  1SFX A;  3AG2 H;  1RKT A;  5FKK A;  1WJE A;  2NYX A;  3FM3 A;  4A5N A;  3C7J A;  1E2X A;  3EUK L;  3FXM A;  3JSP A;  4KYW A;  2F5F A;  1RUN A;  1QO0 D;  3CJQ B;  3CDH A;  1VI0 A;  2DYR H;  4G94 A;  1GXP A;  1HC8 A;  3PJR A;  1SVM A;  3I3L A;  3W6K B;  4FX4 A;  2L9V A;  2X9D A;  2R7X A;  1XG1 A;  1ZHF A;  2WAQ A;  4LIT A;  2RQP A;  2K9L A;  3EDP A;  1G59 A;  1WH5 A;  2ZJ2 A;  5D5V B;  2A61 A;  1VQ5 I;  2QQB A;  3V7C A;  4D7M A;  2E2J J;  1AU7 A;  1W7P B;  2HKO A;  3I0T A;  5M5W J;  1XS9 A;  2ZFW A;  3ZQL A;  1ZEL A;  3ESW B;  3UNG C;  1Z9C A;  2E2H J;  2BHY A;  3FXU A;  3CCY A;  4XQF A;  3IC7 A;  2G9W A;  3HIF A;  2ZSI B;  2R7U A;  1BI3 A;  2XUB A;  4II2 A;  1PUF A;  2F4O B;  3SFZ A;  3ABL H;  1YS6 A;  3R6S A;  4C3J J;  3DBL B;  1S8N A;  1EA3 A;  2IBD A;  3KP6 A;  2HQA A;  2OAZ A;  4A3E J;  4U87 A;  2CV2 A;  4OMY A;  3RQ4 A;  2M2E A;  3FBI B;  1R1T A;  2JK3 A;  3BLY A;  3DTI A;  4S04 A;  3I58 A;  4BQQ A;  3IUO A;  2MA3 A;  3ERM A;  1Y39 A;  4UUT A;  2VKV A;  1K61 A;  2DPU A;  2FOK A;  3ZPL A;  4U88 A;  3EYI A;  3HOY J;  3HEF A;  1KU3 A;  5CVI A;  4HLY A;  2JVG A;  2IXS A;  2MGQ A;  5HLT A;  1ZG5 A;  3H1C A;  1Z67 A;  3NQO A;  5FJ8 J;  3Q5F A;  3WTX C;  2R7S A;  2QSH X;  4ENJ A;  2QF7 A;  2VPL A;  3M1E A;  2X1E A;  3KET A;  2L4M A;  5JFR A;  3UKG A;  2DA2 A;  4PFP A;  4NC8 A;  1OCO H;  3VWB A;  2P5L C;  1W1W E;  1A5J A;  3RQI A;  3JAM K;  2VQL A;  3RZD J;  1MNM C;  4JP0 A;  4O6J A;  4XLP F;  5IT9 K;  1M1E B;  2IAI A;  3KEO A;  1TC3 C;  2K7L A;  1YW8 A;  1Y1W J;  1FY7 A;  5LD2 C;  1X1A A;  1EJ9 A;  3F6V A;  3ZMT A;  2JPC A;  2EIL H;  2YUS A;  4LFU A;  4BDY A;  4G7H F;  2X4H A;  1A35 A;  2O9L A;  3GZN B;  2BGC A;  5BNG A;  2XHK A;  1Z3Y A;  2K9S A;  2QLZ A;  3KIO A;  2EIK H;  3GTJ J;  1GV2 A;  3AL0 C;  1WJ5 A;  2YR2 A;  3DBH B;  1W7P A;  4A0Y A;  2LMD A;  2OZ6 A;  1T56 A;  2NXN B;  4KDP A;  1JT6 A;  3TDZ C;  3L1P A;  3M8F A;  2IT0 A;  2HQ5 A;  1KU2 A;  4DZJ A;  1U6G A;  2PX9 A;  2VJJ A;  5DD8 A;  1ZRD A;  3PNV A;  4MNU A;  1LVA A;  2W00 A;  5L3E A;  1ETY A;  3RKQ A;  1FBU A;  1NK3 P;  3GTM J;  3U9G A;  3CES A;  3WU2 C;  3FMR A;  5FKL A;  2QKL B;  2DLL A;  5EZH A;  1ZGJ A;  3ISP A;  4XKC A;  3GZ6 A;  3GME A;  4I76 A;  4JQF A;  4ESF A;  2NS0 A;  1T8I A;  1JE8 A;  1FX7 A;  2VL8 A;  1K78 B;  3G6E I;  2MFZ A;  4KIT B;  1JJ6 C;  3D0S A;  1V5G A;  2DDB A;  4IO9 F;  2DBB A;  1HKT A;  2A6T A;  2XSD C;  3O2P E;  1UG0 A;  1U8R A;  2H1K A;  4G6D A;  1SAN A;  3LMM A;  4B3X A;  1HLV A;  2LVS A;  2XGE A;  1YJW I;  1W5T A;  1P2F A;  2MW8 A;  3BDD A;  2R7T A;  1MKM A;  1Z3X A;  2KLO A;  2R7Q A;  1VQL I;  5E1W A;  3Q9S A;  5M5X J;  3CME I;  2R5Z B;  4E7L A;  3HKZ A;  3FZV A;  3WHC A;  5H2F C;  2EZL A;  2YU3 A;  2X6X A;  3WU1 B;  2RV8 A;  3TED A;  2OTL I;  2DMT A;  3JTH A;  1TNT A;  1ONV A;  4X0G A;  4LG3 A;  4NB5 A;  3S17 J;  4OU0 A;  2MH2 A;  2A69 F;  1ZAO A;  2BOL A;  2L9R A;  3QWL A;  3ZQG A;  3CCR I;  5EDN A;  2AHQ A;  2NAZ A;  4C2T A;  3HOV J;  5D4R A;  4HG2 A;  4I0A A;  1ERD A;  3O8G A;  4PJJ A;  2K9M A;  2LSO A;  3HRT A;  3FDY A;  3GBG A;  2HI3 A;  1HDD C;  2E1C A;  4KMU X;  3D5R C;  2O5R A;  2VBZ A;  4EEF G;  1X3U A;  1G2H A;  3RZO J;  5AIQ A;  1R00 A;  3GW2 A;  2EA2 A;  1G3Y A;  2XGX A;  4UB8 C;  3RKX A;  3PNT A;  3D5L A;  1E0E A;  3HG9 A;  2E5Z A;  4ZYH A;  4BQA A;  5E3L A;  2W24 A;  2WY7 Q;  3FK6 A;  2DQR A;  2H09 A;  2BE5 F;  2DA7 A;  1V4R A;  4QTR A;  5LBQ A;  5AIP A;  1T0F A;  3LSG A;  3S1N J;  3RPU D;  3CCL I;  2P81 A;  2K86 A;  4AU7 A;  4HW0 A;  3FHZ A;  4HX8 A;  3ABM H;  4E7H A;  1FOX A;  5D6E A;  4ZZD A;  5D8K B;  3B73 A;  1SD5 A;  1JT0 A;  2G0E A;  1X1C A;  3M1C A;  1D8K A;  2HPI A;  2AO9 A;  4YFN F;  3CZ6 A;  1FEX A;  2HVR A;  3CCS I;  1OR7 A;  3CDL A;  2Y9Z A;  1K78 A;  1J09 A;  2GWR A;  4BJ5 C;  5J6X A;  3BT9 A;  1RR8 C;  2M87 A;  4BE0 A;  1MND A;  1FC3 A;  4HX7 A;  3KE2 A;  1ZH5 A;  1MZB A;  5BS6 A;  4M3F A;  1G4D A;  3L2C A;  1HA8 A;  2MAB A;  3OYE A;  1NTC A;  1G3T A;  3CTA A;  4WF2 A;  3QPT A;  2DTZ A;  3H5N A;  3V8L A;  4S05 A;  4N0B A;  1A04 A;  1L0O C;  3VYS B;  4EV0 A;  1J2X A;  1SD6 A;  1MNE A;  5E8I A;  1VQM I;  4A0X A;  2R5Z A;  4I99 C;  2D1V A;  5J47 A;  1XGM A;  2X85 A;  4BE1 A;  5C4X J;  2ZSH B;  4NQW B;  4PGH A;  5LEJ A;  3IH2 A;  3N05 A;  3WE2 A;  1FMW A;  3FF5 A;  3VOE A;  3RTR A;  1H89 C;  2CWE A;  2MLG A;  3KX2 A;  3ZR8 X;  1K79 A;  1R71 A;  4RLF A;  2YX4 A;  2DMQ A;  4IZZ A;  3O6B B;  3HRM A;  2PN6 A;  5EGO B;  2BW3 B;  2DK5 A;  2P8T A;  3ZQ7 A;  1TNS A;  5B1B H;  3BR2 A;  1EKE A;  2DMN A;  1N78 A;  4F55 A;  3MN2 A;  5HNH A;  1MH3 A;  4D9J A;  2MH9 A;  3DV8 A;  1P4X A;  5J8C A;  3V42 A;  3BY6 A;  1S3J A;  2HNH A;  2PFB A;  4LIV A;  1U78 A;  2W25 A;  2Z9O A;  2QBY B;  4AVZ A;  1JGG A;  2DXI A;  1IRF A;  2IP2 A;  4N4O B;  2HYJ A;  2NS8 A;  3PNY A;  4BBR J;  5HLI A;  2ZXJ A;  4M6X A;  2LP0 A;  3CD6 I;  4EMS A;  1ETK A;  2KRC A;  3AFH A;  2A3S A;  3Q0V A;  3M3Y J;  2VOO A;  1FTZ A;  1WKM A;  2AXL A;  5J4V A;  3E6D A;  5BPI A;  2Z5U A;  5CQG A;  5K7H A;  1BW5 A;  4IQ4 A;  1QPM A;  3KP4 A;  3J81 K;  2E2I J;  3P9C A;  3ZP5 A;  3HTU A;  1TT0 A;  2EFO A;  2QSF X;  1T33 A;  2EFN A;  1VQO I;  2D45 A;  1BW6 A;  2LBF B;  2E35 A;  3JRD A;  3DWL E;  4NUB A;  3H0G J;  5D6F A;  3SFI A;  5J1Y A;  5GTH C;  2EZK A;  3G2B A;  2ZME C;  2KP6 A;  3K4K A;  4G9Y A;  3WTY C;  2RAE A;  4BJ6 C;  2DA6 A;  1IN7 A;  1V55 H;  2BHZ A;  4M3B A;  2QCO A;  5E3O A;  3JRH A;  3DU5 A;  4NQW A;  2AQE A;  5IP9 J;  1QZZ A;  4XRS G;  3CF5 F;  1O3R A;  1S72 I;  3CCU I;  1QQI A;  3QP5 A;  4PSW A;  1K6O A;  4GYI A;  1XGS A;  3ZRG A;  1TP4 A;  4WCG A;  2LH9 A;  1IUF A;  3K4J A;  4ON0 A;  5F64 A;  5FFZ A;  1RC9 A;  4UUS B;  2P5V A;  1XDS A;  1VQN I;  5EGO A;  2DFI A;  2VT3 A;  3EET A;  2BW3 A;  2BY2 A;  1IW7 F;  2PJP A;  4A3G J;  5D4S A;  2VON A;  2EB7 A;  5ED4 A;  3L2W A;  4A12 A;  1MSE C;  2JJ7 A;  3HXL A;  3D1N I;  3GXO A;  2A07 F;  4DW6 A;  2AS5 F;  1BM9 A;  1J0R A;  2FXA A;  1X3W B;  1X1P A;  1YIJ I;  3LNQ A;  5JLX A;  3K1P A;  2R7D A;  1QHH D;  2V6E A;  3GFL A;  3GCM A;  2QBY A;  4XRS A;  1YX3 A;  2A6H F;  5DD4 A;  3BG3 A;  3TO6 A;  5J4Y A;  5FO5 A;  4X1E A;  3KPH A;  1JTX A;  3HYI A;  3V7S A;  2VE8 A;  4KT5 C;  2CQX A;  2LK2 A;  3TDU C;  5K7Z A;  1OQY A;  3PFY A;  2GOM A;  4FT8 A;  3W6V A;  2JRT A;  1IXC A;  1PYV A;  2B0L A;  3CC4 I;  2DT6 A;  2XAJ A;  3A0H C;  3VPR A;  3TKY A;  4KT6 A;  3L2V A;  3AG3 H;  4LLN A;  3AAF A;  2GA2 A;  4KIC A;  1E3H A;  2R3S A;  3A4C A;  3W2V A;  3WG9 A;  4CA0 A;  3JSO A;  2VBX A;  3OIQ A;  2WC2 A;  1VND A;  5FLV A;  4HPQ A;  3ASN H;  5F6F A;  1KYZ A;  5AON A;  2GXG A;  2E1O A;  2K9N A;  3CUQ C;  1BR2 A;  2AXT C;  3RJP A;  1FP1 D;  2RN7 A;  3A1Y A;  5C44 J;  3U1D A;  1BIB A;  3OSF A;  5ICC A;  4V2G A;  2EBI A;  3I71 A;  5FD6 A;  3I4P A;  1R22 A;  2JA6 J;  1X19 A;  2CQN A;  1B4A A;  2VB6 A;  3E6B A;  4FTH A;  3M8J A;  2X0L A;  5LEK A;  3AL0 B;  1MDM B;  2WAQ N;  4XLH A;  2DPD A;  4Y3O A;  2XAQ A;  2R92 J;  1P7J A;  5EYR A;  3V8J A;  4IOA F;  4ESJ A;  1XMX A;  5GTI C;  3IH3 A;  3HSR A;  1T38 A;  3SYT A;  3LAJ A;  4XM3 A;  2DYS H;  1MD0 A;  1B8I B;  1ZR2 A;  2L0K A;  2XDV A;  3HSE A;  4F3Q A;  4UUS A;  1D8J A;  3RCO A;  3BCB A;  1YO5 C;  5DUK A;  2DCE A;  5HS9 A;  1ETO A;  1Z6R A;  4IOC F;  3MVP A;  4UVA A;  4A5M A;  1FSH A;  3ZQF A;  2FSW A;  2DT5 A;  2WAF A;  4NBQ A;  2EZH A;  1I6H J;  2LOO A;  4YEJ A;  3MZY A;  4NHJ A;  4P55 A;  1LB2 A;  4HV5 A;  1LFB A;  2Y2Z A;  3BQY A;  1IJW C;  5FLX Z;  1FIA A;  4EQQ A;  2JPB A;  4Q47 A;  1Y56 A;  3K4L A;  2QQA A;  4IHT A;  2YS9 A;  5D5W B;  2HOT A;  3NAU A;  2JSC A;  2GBY A;  2XGD A;  2IS2 A;  2LR8 A;  1TWA J;  3JRG A;  1JKO C;  1UCR A;  2IGM A;  3EYY A;  5DCM A;  2EV6 A;  3ONQ A;  2CQK A;  3DFG A;  3P7N A;  5HNF A;  4EJU A;  4HV6 A;  1VQK I;  5ICE A;  2MC3 A;  2LRD A;  2P0W A;  3W6J B;  3M8E A;  4HNU A;  4WXC A;  3GFI A;  2OUM A;  2WB1 N;  3ML6 A;  4MQ9 F;  5B3S H;  3PUF A;  2WV0 A;  4NNJ A;  1NG7 A;  2KIQ A;  2X1C A;  1ORK A;  5IOZ A;  1R6R A;  2RNJ A;  1WJA A;  4ANJ A;  4GGG A;  2DAO A;  1MMA A;  2CW7 A;  1Z7L A;  1R49 A;  1DDN A;  2JSP A;  2D1H A;  3UR3 C;  5E20 A;  2DFF A;  5A2Q K;  4HYE A;  1MJB A;  2JQ7 A;  3R60 A;  3QOP A;  2KRF A;  2O3F A;  4BDZ A;  1YI2 I;  3PQJ A;  3IV5 A;  4E7J A;  2E19 A;  1MDM A;  3BWG A;  1ODD A;  4Y15 A;  2CO5 A;  4XMY A;  3IL2 A;  3ECH A;  1J7K A;  4M3G A;  2FD5 A;  3H3V K;  2R7W A;  2P5K A;  3OYL A;  1F4K A;  1R5H A;  1U5T C;  4K2E A;  4BXF A;  3OYN A;  3J80 Z;  2Q1Z B;  4B44 A;  4BHC A;  1YOV B;  2ESN A;  2PBI A;  1B8I A;  1O3T A;  3WE3 A;  3TP3 A;  2FEZ A;  1I27 A;  2JUC A;  1S7E A;  3TL4 X;  2NVU B;  4HSR A;  1S5L C;  3C2H A;  2W48 A;  3LQR A;  3P9I A;  5ICF A;  2IS1 A;  3OIP A;  3E6C C;  5HDG A;  2FRH A;  1FOY A;  5TJJ A;  4BE2 A;  1HF0 A;  4XLC A;  2R7F A;  5LRS A;  1MMS A;  1TW3 A;  1HKQ A;  4BXU A;  2GXB A;  2LDU A;  1D0Y A;  5BPD A;  4FHT A;  3IRR A;  1HOM A;  2DA5 A;  1KYW A;  2LY9 A;  3HOX J;  2VQC A;  4A3B J;  3BPV A;  1R5I D;  5K5Q A;  1ULY A;  2X51 A;  3HHG A;  4F7Z A;  5E1X A;  4RB2 C;  4QSH A;  5ILU A;  4V19 K;  5EEA A;  3KFW X;  1BIA A;  4RBO A;  3EUA A;  2W4S A;  3I9V 2;  3R0J A;  1A6Q A;  3W2W A;  4RB0 A;  3VYR B;  4M9Z A;  4B1R A;  4EGY A;  1HDP A;  2A05 A;  2LKS A;  4BEH B;  1UAA A;  1DGR M;  1LFU P;  2FBI A;  3SEZ A;  1R58 A;  3A03 A;  4I98 B;  1UJ8 A;  2V1X A;  3C3W A;  2CMP A;  1X4O A;  4HNV A;  1GVJ A;  4ZC3 A;  1K7A A;  2M34 A;  3RDI A;  2W82 A;  2XV4 S;  4ZJZ A;  5KCM A;  3GTQ J;  1I5Z A;  2KKO A;  3NEU A;  3RKW A;  3QPS A;  3E97 A;  5GAD J;  5F04 A;  3FHN A;  2DOE A;  1NG6 A;  5F0H A;  5KK1 A;  1B72 B;  4LK1 F;  1QVT A;  3GTO J;  2H27 A;  2ZFU A;  3PL8 A;  3V7R A;  3OV8 A;  3QPL A;  2UV1 A;  3HPH A;  4HF0 A;  2VJ4 A;  3J7A O;  1S7A A;  2YPR A;  1BN5 A;  4F91 B;  3S93 A;  5GPC A;  3CMM A;  2VOD A;  2NVX J;  3QQA A;  1LJ9 A;  3L00 A;  3BZK A;  4Y4R A;  4HLX A;  2HZT A;  2KDO A;  3RYR A;  1ACI A;  3GFM A;  1BI0 A;  3HB9 A;  3CUO A;  1Y0N A;  3FKI J;  3SZP A;  5C3E J;  1P92 A;  5JHU A;  1VQ4 I;  4DIQ A;  4V2F A;  2V1U A;  3ZMS A;  1Z77 A;  2CU7 A;  1R36 A;  2XF6 A;  5GAE J;  2YX7 A;  3I55 I;  4HZF A;  2IGO A;  2VKE A;  3F8F A;  1W5S A;  2QYO A;  1OFC X;  5HOO A;  4AIH A;  1WQ2 A;  1QBJ A;  2O61 A;  1S29 A;  4AUX A;  4CYD A;  4UNO A;  3FXK A;  3M4O J;  3KP3 A;  4YII A;  3DLL F;  1FTT A;  2CGP A;  4GRI A;  3SHF A;  3RI4 A;  9ANT A;  3DTE A;  4YIR X;  1XGO A;  4A3D J;  3BR3 A;  3M9A A;  2X6O A;  2YSR A;  4CO8 A;  3JRI A;  3ZGK A;  4KN4 X;  1N77 A;  2Q8K A;  1SFU A;  5D5U B;  1MBH A;  2JUG A;  2XKP A;  2VJ5 A;  2P6T A;  3F21 A;  2FOW A;  3I64 A;  2LLK A;  1O4X A;  3BTC A;  4BEH A;  3QU6 A;  2WTE A;  3ZMD A;  2FBK A;  2OJE D;  4EM0 B;  1WZ2 A;  3CCJ I;  1HBX G;  2ZME B;  1RES A;  2DOF A;  2CQQ A;  1SD4 A;  3OYD A;  4B43 A;  5FKM A;  1PP8 F;  1OCT C;  4IPA A;  4UV9 A;  3OS1 A;  2P7C B;  4UVC A;  3VYT B;  2PMU A;  2VIX A;  1FBQ A;  3OSG A;  2DW4 A;  2CUZ A;  3BJ6 A;  1WGX A;  3L2R A;  1FWZ A;  1K4S A;  1Z05 A;  1B72 A;  1N75 A;  4OAZ A;  1D5V A;  3WTS C;  2K5C A;  3N4M A;  2DFE A;  1U2W A;  2Q2E B;  1TQI A;  3DTK A;  2NVQ J;  4CCN A;  2Y0S A;  3GTL J;  3BCA A;  3DP7 A;  3U2R A;  4MEX F;  2UXN A;  1QPI A;  2OBP A;  2Y48 A;  3KLO A;  2P4W A;  3HOU J;  1HW5 A;  3WOD F;  5L3C A;  4H0E A;  2KIS A;  1ON2 A;  4DQ2 A;  3S1R J;  1WWX A;  4A3I J;  1TQM A;  2FE3 A;  5H20 A;  3ZOB A;  5HLH A;  1POG A;  3I59 B;  4Q4Z F;  5DTD A;  3HL2 A;  4M9S A;  2JMW A;  4EAT A;  1BI2 A;  1IN6 A;  3C2G A;  1QGP A;  4AYB A;  4AC0 A;  2HPM A;  1OYI A;  1WRJ A;  3F22 A;  1ZR4 A;  3KYD B;  4XOT A;  1UHS A;  1MBK A;  3HRU A;  3FXR A;  3WU0 A;  1T98 A;  2NS7 A;  3LOC A;  3T1B A;  3CMA I;  2ACJ A;  4RS8 A;  1YHQ I;  4DGW B;  1OIS A;  1E17 A;  2L7M P;  2W84 A;  3F6O A;  1IF1 A;  2HR3 A;  2QKM B;  5BOX A;  1K4T A;  5E8G A;  1QRY A;  3ASO H;  1H88 C;  5FB2 A;  3CJN A;  5H6Q A;  1VQ7 I;  3S2H J;  5CVJ A;  4BBS J;  3ELK A;  2A68 F;  4BAC A;  4YIF A;  1V54 H;  3ZCO A;  2O03 A;  2HS5 A;  2FF4 A;  3S14 J;  3CUQ B;  2CV0 A;  2TDX A;  2IA2 A;  2QQ8 A;  2HOE A;  4G6T B;  2FA5 A;  1FLI A;  2XF5 A;  2HOA A;  3CCQ I;  1VTN C;  2F6C A;  2FNP A;  3PO3 J;  2XB5 A;  2DQL A;  3C1D A;  2XAH A;  1RIO H;  3GVA A;  5J1U A;  2V7F A;  1BOB A;  6PAX A;  1RRJ A;  1XDU A;  3E3V A;  1DGW Y;  2QGU A;  1Y0U A;  2ZME A;  1SFE A;  2PG4 A;  2FU4 A;  1MBG A;  3DPT A;  3DQV C;  2XRN A;  3EUH C;  2Z16 A;  1D1A A;  2BXZ A;  2CUE A;  5J3L A;  2VN2 A;  4A3F J;  4XN0 A;  4PK4 A;  2ISY A;  3HJE A;  5ILV A;  4B3A A;  3QPH A;  4FQG A;  2OA4 A;  1UG2 A;  1YW7 A;  2V4J C;  4HF2 A;  3TQN A;  5B5E C;  2XPW A;  2ETH A;  3J7Z I;  1KQ8 A;  2VOP A;  5KAI C;  2VKH A;  1MJ9 A;  4XLN F;  3LSM A;  2EIM H;  2K3F A;  5LHG A;  2ZNZ A;  3GTK J;  4JX4 A;  4IRI A;  2Q2E A;  4A3K J;  1V5F A;  2GQQ A;  3T0Y A;  1UHM A;  4HBL A;  1FBS A;  3HPG A;  3PFI A;  4KIS A;  4IHW A;  4P9U A;  1DPU A;  1UZC A;  2OC6 A;  2K02 A;  2OPT A;  1ZQ3 P;  3EPZ A;  3I59 A;  5E1Z B;  2IA0 A;  1I6X A;  2ZXH A;  3H3Z A;  3TMO A;  1EH6 A;  5F08 A;  1NK2 P;  4DYC A;  2STW A;  4IQJ A;  1DQU A;  3G3Z A;  4FE4 A;  3CP2 A;  1BC8 C;  3WGH A;  2GIV A;  2DK8 A;  1E3O C;  2KZG A;  2K4B A;  1JGS A;  1TWG J;  2V1D A;  3BR0 A;  2WWY A;  1TTY A;  2M8E A;  2QEN A;  5CYV A;  2EFW A;  3G1O A;  2H94 A;  3BZ6 A;  1RZ4 A;  1Z21 A;  3LSK A;  3OYB A;  1ZRE A;  3G71 I;  3CUQ A;  3HM5 A;  3VOD A;  3OYK A;  1YRN B;  2RC4 A;  3IHU A;  2GA1 A;  4Y13 A;  2IS6 A;  1OCZ H;  4XR6 A;  4IHV A;  1SVO A;  4JK1 X;  3FXO A;  2R5Y B;  5F0C A;  2M0M A;  1AWC A;  2ZNY A;  1YIT I;  1UMQ A;  1STZ A;  2OQR A;  4IRG A;  1ZLK A;  4Q5S F;  2ZCW A;  1XTA A;  1OPC A;  3KCC A;  1H9T A;  3LST A;  3K4C A;  2EJR A;  4EVI A;  2RNG A;  4Q48 A;  2DJN A;  1OCP A;  5K5R A;  1TT5 B;  3L7W A;  2I8D A;  4RAG A;  4E70 A;  5JR3 A;  3J7Y J;  4M3D A;  5FKN A;  4NC7 A;  3HOT A;  1ZGW A;  5KHD A;  1DUX C;  1FYL A;  1G3W A;  1TWC J;  3OR1 C;  2GAU A;  2MSY A;  3G4S I;  4MFD A;  4ASN A;  2V1N A;  1KA8 A;  4B09 A;  4CXF A;  4E7I A;  3FMQ A;  1TBX A;  3F8M A;  2LYC A;  5M3M J;  2PLY A;  3U21 A;  2Z3Y A;  2NOJ B;  4FE7 A;  2PMZ A;  3FWE A;  1ZTR A;  5FGM A;  2ECB A;  2LF8 A;  3REO A;  1HQC A;  4HOB A;  1I50 J;  4CCM A;  4PUS A;  2CSO A;  1OYW A;  3LA7 A;  5LGN A;  5K1Y A;  2V79 A;  3H92 A;  3DKX A;  2IVM A;  2O8K A;  5C4J J;  2BEO A;  3DKY A;  2LFB A;  3OS2 A;  1APL C;  1YYV A;  4IL6 C;  4UUV A;  2K4J A;  1UB9 A;  1RR7 A;  2EIJ H;  4N9I A;  4A3L J;  3ECO A;  1LE8 B;  2VXD A;  2ZBK A;  3H0D A;  2PI0 A;  1F1Z A;  1WI9 A;  2COB A;  3HC7 A;  4KA4 A;  3HDD A;  3GEZ A;  1MBJ A;  2QQ9 A;  3MAJ A;  2O7O A;  4WWC A;  4Y7N J;  4XRM A;  2CS3 A;  1ITY A;  3V8K A;  3OR2 C;  2R5Y A;  2XIG A;  1P6R A;  1BR1 A;  2M8G X;  2MBF A;  1R7J A;  2M5W A;  1MSF C;  4KJZ A;  1BI1 A;  2TCT A;  2MD5 A;  2KIU A;  2WV1 A;  4G6Q A;  4XLE A;  3S2W A;  3QOD A;  4HNT A;  4JBA A;  4E7Z A;  3WTZ A;  5EJC A;  2XSJ C;  3BTJ A;  3F0C A;  3RSN A;  1W7P D;  2LY2 A;  4PJ0 C;  1DU6 A;  2EQR A;  1AKH B;  5EEG A;  2M0C A;  3PM1 A;  2Y30 A;  3C2B A;  1V3F A;  2IW5 A;  1QZE A;  4M6Y A;  3I4M J;  1SD7 A;  5DM7 F;  4J01 A;  2BY0 A;  3B6A A;  3KP2 A;  4KN7 X;  1IN4 A;  4L9T A;  4XLF A;  3GLX A;  1RUO A;  1FOK A;  2VPR A;  2UUZ A;  3K7A J;  3K69 A;  1B59 A;  4DBQ A;  3ABK H;  2CUF A;  4ITV A;  1AOY A;  4ZDO A;  3K0L A;  5F1R A;  3SXY A;  3K4B A;  4EJV A;  2B9S A;  5FD5 A;  3MZH A;  4U7D A;  1FJL A;  2EV5 A;  2QSG X;  3LFU A;  2G7H A;  3DPU A;  3W3C A;  3OS0 A;  2I10 A;  3GTP J;  4G12 A;  1QZY A;  3PO2 J;  4W97 A;  1JTY A;  3F72 A;  2Y75 A;  4D1Q A;  4XSX F;  4XK4 A;  4XKB A;  4GO1 A;  1J75 A;  2ID6 A;  1W36 D;  2FML A;  3JRE A;  2IGN A;  2M7B A;  2WY8 Q;  1LE8 A;  3U1K A;  1WJC A;  1D3Y A;  1XCV A;  4XOP A;  5F27 A;  3A01 B;  4XIC A;  4LG0 B;  1LDD A;  1FMV A;  4A69 C;  2V9V A;  4I2O A;  2COM A;  1T0F C;  1B1B A;  3WG7 H;  2PQ8 A;  2XAU A;  1YS7 A;  3BTI A;  4GDF A;  2XKO A;  2IPQ X;  4ZYG A;  4XON A;  4ZZL A;  2LBF A;  3HGG A;  2HFH A;  1R4N B;  4KUM A;  1N25 A;  4IKF A;  2O0Y A;  4MGR A;  3BJA A;  4L5J A;  3TP0 A;  1O7L A;  2VC1 A;  2JA2 A;  2VJI A;  1P4W A;  1REP C;  2P7V B;  3NWS A;  1T6S A;  5J1R A;  1OR7 C;  1D1C A;  1FSE A;  3R0A A;  1BJZ A;  3B6C A;  2F5E A;  4LOC A;  1O7F A;  2L9N A;  3QOE A;  2ECC A;  2HWV A;  3S3N A;  1IO2 A;  1AKH A;  5FRO A;  4HX4 A;  1XSX A;  3VEP A;  2JTV A;  2JA8 J;  3FXQ A;  2ELJ A;  4ENN A;  4EJO A;  3AG1 H;  3P5J A;  4AIK A;  3A02 A;  1R1V A;  4I7H A;  1I39 A;  3TW6 A;  1SAX A;  3ZMZ A;  2MD0 A;  1BBY A;  1FP2 A;  3KZI C;  4A0Z A;  2UWM A;  2E60 A;  3MQ0 A;  1EH7 A;  2LC2 A;  4LIU A;  1X1D A;  4ENK A;  3F3X A;  1YQA A;  4BU2 A;  2IGK A;  4XSZ F;  3LSP A;  3K6G A;  2LRE A;  3O3K A;  5IYD J;  4BHP A;  5E3N A;  1LEA A;  5DEQ A;  4FCY A;  3KP5 A;  4RDU A;  1HKS A;  2DA1 A;  2E1N A;  3C18 A;  3ZQQ A;  5FLX K;  3E1S A;  4D7N A;  4BUP A;  2BZT A;  2OU2 A;  4C2M J;  3H35 A;  3MWM A;  3KZZ A;  3PIO F;  1IV8 A;  2ME0 A;  4OAY A;  2CH0 A;  4ZTF A;  2XGC A;  2J5P A;  3S15 J;  2F5C A;  2HZD A;  3BR6 A;  3Q9V A;  2BV6 A;  2A5Y B;  3LSI A;  4MQV A;  4P5O A;  1IDZ A;  1MJA A;  2DJI A;  2HTS A;  1MIJ A;  2KJB A;  4M73 A;  3VDX A;  4RGR A;  4C9Y A;  3FK7 A;  1WVR A;  2X1D A;  2Z33 A;  4Y33 A;  1IRX A;  3A01 A;  3PQK A;  4AID A;  4A3C J;  3QYE A;  4DYQ A;  2JA5 J;  4EM2 A;  1U9O A;  3CCM I;  2XAG A;  1WJB A;  2Y69 H;  2WAD A;  1A31 A;  2ID3 A;  5J40 A;  1YJN I;  1MW7 A;  5IP7 J;  2XVC A;  4IEJ A;  1XB4 A;  1XC5 A;  4L0Y B;  1Z7U A;  3VSL A;  4J00 A;  1L3L A;  3VSK A;  1IAW A;  3MKZ A;  3DEE A;  5DDG A;  4AIJ A;  2D2W A;  3HRS A;  1AA7 A;  1XN7 A;  4PJN A;  3J80 K;  3FX3 A;  2XAS A;  3I56 I;  2A6E F;  4JOM A;  1FPQ A;  1R5G A;  4P9F A;  4ZTJ A; 
#chains in the Genus database with same CATH homology
 4MLO A;  1JT0 A;  2G0E A;  1RES A;  2CQQ A;  1IGN A;  1JJ8 C;  3FIW A;  1ETW A;  1SFO J;  2HOS A;  2AO9 A;  2EZI A;  1FEX A;  5FKM A;  1OCT C;  5IOY A;  3CDL A;  1X58 A;  3BG5 A;  2LKX A;  3Q3S A;  2Y9Z A;  1QVU A;  1IV6 A;  1RKW A;  1OJL A;  3OSG A;  5K7F A;  1WCM J;  1WGX A;  2DA3 A;  1ZKG A;  3BT9 A;  3G1L A;  4CYC B;  5EF6 A;  5HOD A;  1W0U A;  1B72 A;  5M5Y J;  2JN6 A;  4D5C A;  4M3F A;  3ZQI A;  3K2A A;  1NTC A;  2NVQ J;  2DTZ A;  3GTL J;  1QPI A;  2R5Z A;  3HOU J;  4DZP A;  1W0T A;  3S1R J;  4A3I J;  3ZOB A;  1JKQ C;  1POG A;  4M3E A;  5C4X J;  5DTD A;  3IH2 A;  2JMW A;  5M3F J;  2ME6 A;  1H89 C;  4AC0 A;  1ZR4 A;  3GTG J;  5FLM J;  1UHS A;  1MBK A;  3OOU A;  2D5V A;  2NS7 A;  3LOC A;  4I6Z A;  1RET A;  2DMQ A;  2NOG A;  2Y31 A;  2L7M P;  5IP6 A;  2M9H A;  2XRL A;  5EGO B;  3FIS A;  3SDG A;  1QRY A;  1H88 C;  3HKZ N;  2VI6 A;  5GP9 A;  3S2H J;  4BBS J;  1MBE A;  3BR2 A;  2DMN A;  3MN2 A;  1WI3 A;  3S14 J;  1MH3 A;  2CJJ A;  3BR1 A;  1U78 A;  4IHX A;  2HOA A;  1JGG A;  1MH4 A;  1X2N A;  3PO3 J;  2XB5 A;  2HYJ A;  2NS8 A;  1ETV A;  1K83 J;  4BBR J;  5J1U A;  2LP0 A;  3ZQC A;  1GV5 A;  1MBG A;  1ETK A;  2CUE A;  5J3L A;  3Q0V A;  3TW7 A;  4A3F J;  3M3Y J;  2FJ1 A;  3JRB A;  1FTZ A;  4B3A A;  4Y52 J;  1UG2 A;  5K7H A;  1BW5 A;  2XPW A;  3I4N J;  2E2I J;  1DU0 A;  4CYC A;  4W1U A;  1T33 A;  4MIM A;  3Q0U A;  1RPW A;  3GTK J;  4JX4 A;  1BW6 A;  4A3K J;  2XPU A;  3JRD A;  2DMP A;  1R9T J;  3JRA A;  4XID A;  3H0G J;  4IHW A;  3SFI A;  5J1Y A;  2EZK A;  3DCF A;  2VUM J;  2K9Q A;  2OPT A;  1ZQ3 P;  2RAE A;  1BL0 A;  2DA6 A;  4M3B A;  3JRH A;  2QCO A;  5E3O A;  1HCR A;  5IP9 J;  4XRS G;  5F08 A;  4C3H J;  1NK2 P;  5GPA A;  1ETX A;  1JUS A;  4DYC A;  3HBL A;  2EH3 A;  4MO7 A;  3E7L A;  2R0Q C;  5IPA A;  1IUF A;  3O8H A;  4FE4 A;  2Y0S N;  4UUS B;  4BXX J;  5EGO A;  1E3O C;  4MFE A;  4A3G J;  3BR0 A;  1TWG J;  1GDT A;  3G1O A;  3G1M A;  1MSE C;  4M6V A;  2JJ7 A;  3D1N I;  3HOZ J;  4DW6 A;  4IHY A;  3HM5 A;  4AYB N;  1YRN B;  1JKR C;  3LNQ A;  5JLX A;  3BQZ A;  4IHV A;  4XRS A;  2GLO A;  2ZB9 A;  2R93 J;  3BG3 A;  2R5Y B;  5F0C A;  4X1E A;  1A6I A;  1JTX A;  2CQX A;  2LK2 A;  4DYR A;  5JLW A;  1UMQ A;  5K7Z A;  1IDY A;  2LD5 A;  3W6V A;  4L5E A;  2NVY J;  3VPR A;  1PUF B;  2ELK A;  1EF4 A;  2R7Z J;  1U9N A;  4J19 A;  2MG4 A;  1GUU A;  1ENH A;  4JX5 A;  2PMZ N;  2Y9Y A;  4ABZ A;  5FLV A;  1VND A;  1F36 A;  1JUM A;  2DJN A;  1OCP A;  4JYK A;  2E1O A;  2K9N A;  5F1J A;  3LSJ A;  3MKL A;  4JX6 A;  2OF7 A;  3CQZ J;  5C44 J;  4M3D A;  5FKN A;  1ZGW A;  1GT0 C;  1IC8 A;  3OSF A;  1TWC J;  4V2G A;  2EBI A;  4C3I J;  5DS9 A;  2MSY A;  2JA6 J;  2XB0 X;  4MFD A;  2JWT A;  2FQ4 A;  5M3M J;  2H8R A;  1H8A C;  4FTH A;  2YU9 J;  1JKP C;  1U8B A;  4FE7 A;  2WAQ N;  1ZTR A;  2DA4 A;  1IRZ A;  1CQT A;  2R92 J;  5IYC J;  1P7J A;  2ECB A;  5EYR A;  1BA5 A;  1I50 J;  3IH3 A;  4QIW N;  1FIP A;  3WHB A;  3Q0W A;  1D5Y A;  1RKT A;  1B8I B;  5FKK A;  2O8K A;  5C4J J;  1ZR2 A;  2L0K A;  2B63 J;  2LFB A;  2TRT A;  1APL C;  4X6A J;  4UUS A;  1RR7 A;  4A3L J;  1VI0 A;  1LE8 B;  1ETO A;  3MVP A;  3JR9 A;  3ZQF A;  2X9D A;  1XG1 A;  3ZQH A;  4D5F A;  5FKO A;  2COB A;  1Q1V A;  2EZH A;  1I6H J;  2NVT J;  3HDD A;  1MBJ A;  3S1Q J;  1WH5 A;  2O7O A;  4NDL A;  1GVD A;  2FX0 A;  4D7M A;  4Y7N J;  2E2J J;  4XRM A;  1LFB A;  2Y2Z A;  1AU7 A;  3BQY A;  1ITY A;  1IJW C;  1FIA A;  2R5Y A;  5M5W J;  1XS9 A;  3ZQL A;  2M8G X;  2E2H J;  3CCY A;  2YS9 A;  2HOT A;  1MSF C;  3NAU A;  2TCT A;  2WV1 A;  2GBY A;  2XGD A;  2LR8 A;  1PUF A;  1TWA J;  3JRG A;  1JKO C;  3BTJ A;  3F0C A;  1VFC A;  4C3J J;  1DU6 A;  2IBD A;  2EQR A;  4A3E J;  1AKH B;  2M0C A;  3PM1 A;  4B4C A;  2Y30 A;  2M2E A;  3C2B A;  5EZG A;  2JK3 A;  1MBF A;  3HOW J;  2JA7 J;  3I4M J;  2WB1 N;  3B6A A;  1X2M A;  5IOZ A;  1ORK A;  2VPR A;  3K7A J;  4UUT A;  2CUF A;  2VKV A;  1K61 A;  2L7F P;  3HOY J;  4GFB A;  3HEF A;  2MGQ A;  2LTP A;  3DEW A;  5FJ8 J;  1FJL A;  3NAR A;  3IV5 A;  1WPK A;  2E19 A;  2QF7 A;  2XPV A;  4M3G A;  2I10 A;  2FD5 A;  3GTP J;  3H3V K;  3UKG A;  2DA2 A;  2CRG A;  3BR5 A;  4G12 A;  3PO2 J;  4W97 A;  1WH7 A;  1B8I A;  1JTY A;  1A5J A;  3RQI A;  3RZD J;  4XK4 A;  3TP3 A;  1MNM C;  4JP0 A;  1S7E A;  2IAI A;  1TC3 C;  2X48 A;  2ID6 A;  1Y1W J;  2W48 A;  3JRE A;  3CMY A;  1LE8 A;  2YUS A;  3OIO A;  4FIS A;  5F27 A;  1HF0 A;  5F0F A;  3A01 B;  4XIC A;  2O9L A;  4A3M J;  4A69 C;  5BNG A;  2K9S A;  3GTJ J;  1GV2 A;  1HOM A;  2DMU A;  2DA5 A;  3BTI A;  2KT0 A;  1ETQ A;  2L7Z A;  2LY9 A;  3HOX J;  4A3B J;  1T56 A;  3JRF A;  3HGG A;  1JT6 A;  5EG0 B;  3L1P A;  4QSH A;  3BTL A;  3TP0 A;  5EEA A;  2HQ5 A;  2IEK A;  4DZJ A;  4RBO A;  4BY7 J;  5J1R A;  1Y1V J;  1BJZ A;  3B6C A;  4LOC A;  5E3M A;  1P7I A;  4B1R A;  1HDP A;  2KDZ A;  2ECC A;  1ETY A;  3RKQ A;  1LFU P;  1NK3 P;  1IG7 A;  3GTM J;  1AKH A;  3A03 A;  2JA8 J;  1JUP A;  2HXO A;  5FKL A;  5EZH A;  4HNV A;  3A02 A;  3JRC A;  3TW6 A;  2M34 A;  2DN0 A;  3GTQ J;  4I76 A;  2HDD A;  3QPS A;  2K40 A;  5F04 A;  2N8G A;  1JJ6 C;  4A3J J;  3LSP A;  4S0H B;  5F0H A;  5IYD J;  2XSD C;  5E3N A;  3SJM A;  1B72 B;  3S2D J;  1TWH J;  2H1K A;  1SAN A;  4FCY A;  1QVT A;  4RDU A;  1ZK8 A;  2DA1 A;  1HLV A;  3GTO J;  2LVS A;  2XGE A;  5IYB J;  3QPL A;  3S1M J;  4D7N A;  4C2M J;  1VF9 A;  2MW8 A;  1YRN A;  3LSR A;  2ME0 A;  5GPC A;  3BG9 A;  2NVX J;  3IH4 A;  2XGC A;  3QQA A;  5M5X J;  3S15 J;  2R5Z B;  3BR6 A;  3WHC A;  2EZL A;  3HB9 A;  3TED A;  3FKI J;  2DMT A;  1Z0X A;  3HGY A;  5C3E J;  1IDZ A;  2HXI A;  3S17 J;  4V2F A;  2L9R A;  1Z77 A;  2CU7 A;  3ZQG A;  4BKX A;  4A93 J;  5EDN A;  2AHQ A;  2VKE A;  3FK7 A;  3HOV J;  1OFC X;  3A01 A;  4A3C J;  3O8G A;  4DYQ A;  2JA5 J;  1U9O A;  4AUX A;  3M4O J;  3GBG A;  2HI3 A;  1HDD C;  1F43 A;  1TWF J;  1FTT A;  2ID3 A;  4EEF G;  1G2H A;  3RZO J;  3S16 J;  9ANT A;  5IP7 J;  1I3Q J;  5EG0 A;  4IEJ A;  4A3D J;  3BR3 A;  1XC5 A;  3JRI A;  2X6O A;  5E3L A;  3FK6 A;  1MBH A;  4BY1 J;  2DA7 A;  3S1N J;  4QTR A;  3LSG A;  2GM4 A;  2LLK A;  2P81 A;  1O4X A;  3BTC A;  1AHD P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...