3RZDJ

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rzdJ00
5K7FA 1ZGWA 3SDGA 1E3OC 3JRGA 1U9OA 2TRTA 5BNGA 2GM4A 4AUXA 5JLXA 2DTZA 5IP7J 2HI3A 2COBA 2ZB9A 3C2BA 2XGDA 4DYQA 1JGGA 1ZR2A 3LSPA 1MSFC 3ZQLA 3GBGA 3FK7A 3HGGA 1OCTC 1QVUA 2CQQA 4D5FA 1YRNA 4A3FJ 3HGYA 2B63J 3BQYA 3G1OA 4QSHA 3ZQHA 3OSGA 4D7NA 2Y31A 3OOUA 1YRNB 2VKEA 3S1NJ 1BW5A 1ETWA 3CQZJ 1ETVA 5C4JJ 2IAIA 3PM1A 2R7ZJ 2DA2A 4G12A 5DTDA 5FKOA 2HOTA 4L5EA 1LFUP 4DW6A 5M5XJ 2CUEA 1APLC 4BY1J 3GTQJ 1IUFA 2QCOA 2R93J 1W0UA 4V2FA 1I6HJ 3CDLA 2VUMJ 2K9NA 1RESA 2Y30A 5IYBJ 3FK6A 3FISA 2NOGA 1UHSA 2DN0A 3I4MJ 1NK3P 1ETKA 1D5YA 9ANTA 1W0TA 5C3EJ 2DA3A 2LVSA 1HDPA 3NAUA 4FCYA 5C44J 4HNVA 2CJJA 4A3BJ 3BR0A 3BR1A 2DMQA 3TP0A 3RZDJ 5M3FJ 2DMPA 2K9QA 1JKQC 1HDDC 4I76A 4JX4A 5FKNA 5F08A 2W48A 3H0GJ 3OSFA 3IH3A 4MIMA 5GP9A 3HOVJ 1I50J 3K7AJ 4M3BA 3ZQFA 3GTKJ 2LK2A 1NK2P 2X48A 3HBLA 2E2JJ 4FISA 2DMUA 1JTYA 5GPAA 4RDUA 1BJZA 4B4CA 4DYCA 2XGEA 2M8GX 2DMNA 1HLVA 1FJLA 4NDLA 5EDNA 2D5VA 2DA1A 2FX0A 3CMYA 1GV2A 2EBIA 4M3GA 1JUSA 3HDDA 1MBHA 2VKVA 3BR5A 3BR2A 3BTLA 4MLOA 3MN2A 4MFDA 2GBYA 2ID6A 5FKLA 5EYRA 3LSJA 1JKRC 2R0QC 1T56A 2E1OA 1TWCJ 3HOZJ 1I3QJ 5IYCJ 2HDDA 2XB0X 2LP0A 2XRLA 4JX6A 1Z0XA 5E3OA 4BXXJ 4GFBA 1JT6A 1AKHA 2JA6J 1EF4A 2N8GA 1S7EA 1MBFA 3BQZA 5K7HA 1QRYA 4QTRA 1BW6A 3W6VA 1TWGJ 1AKHB 4M3DA 5IPAA 5EG0A 2CQXA 1K61A 4AYBN 4Y7NJ 2JWTA 2KT0A 4XIDA 3SJMA 3A02A 5EG0B 2VI6A 1IJWC 2DJNA 1VI0A 4FE4A 1WGXA 2K9SA 3OIOA 1U8BA 2HOAA 1X2MA 1VF9A 2Y0SN 5J1RA 2R5YB 3Q3SA 2FQ4A 5F27A 2LD5A 5FKKA 1QVTA 5F04A 5EZGA 4M6VA 5DS9A 3PO2J 4IHWA 5IP6A 5FLMJ 1BL0A 2NS7A 4A3JJ 3WHBA 3TP3A 5IYDJ 3S1MJ 1T33A 3JRBA 1ZR4A 4M3EA 1FTZA 3BTJA 3MVPA 1TWAJ 1TWFJ 5FKMA 3IV5A 3JRIA 4BY7J 2FD5A 1JT0A 3G1MA 4X6AJ 1GVDA 2NVYJ 1R9TJ 5GPCA 1X58A 5FJ8J 4JYKA 2OPTA 2L7ZA 1ENHA 2WV1A 4X1EA 5EF6A 3FKIJ 5M5WJ 4UUTA 2NVTJ 4JX5A 2EZKA 5F0FA 1MH4A 4IHVA 2JJ7A 4DZJA 1U9NA 2P81A 3B6CA 2E2HJ 1GV5A 3Q0WA 2M34A 2M2EA 4DYRA 4BBSJ 3ZQGA 3FIWA 4QIWN 3GTOJ 2PMZN 3JREA 1MH3A 5J3LA 3HOWJ 2LLKA 5M5YJ 2XB5A 1JKPC 1H8AC 1ZQ3P 3LOCA 1B72A 2LKXA 1UG2A 1OCPA 1POGA 1P7IA 1FEXA 2O9LA 1B72B 2X9DA 4FTHA 3BTCA 3IH2A 3ZOBA 3LSRA 4V2GA 1MBGA 3JRHA 2ID3A 3A03A 1WCMJ 3SFIA 3S1QJ 1GUUA 1HF0A 1RR7A 2MG4A 2ECCA 4J19A 1ETQA 3BTIA 1MBJA 2JK3A 2LFBA 1ETOA 1TWHJ 5M3MJ 4MO7A 2JMWA 2MGQA 2RAEA 4W97A 2XPVA 1BA5A 2LTPA 1WH7A 1RETA 1DU0A 1Q1VA 2DA7A 1AHDP 1VFCA 2R92J 5EZHA 1IG7A 1DU6A 3TW7A 3JRFA 1JJ6C 5IP9J 2DA6A 3O8GA 1IRZA 1IV6A 4D7MA 3IH4A 4C3IJ 5JLWA 4Y52J 1MSEC 4EEFG 1K83J 1XC5A 3F0CA 3RQIA 3S14J 4A3DJ 3UKGA 1F36A 1VNDA 3L1PA 3S17J 4FE7A 3BR6A 4XICA 3WHCA 4IEJA 3ZQIA 1MBEA 2AHQA 1NTCA 2HQ5A 1RKWA 4XRSA 3QQAA 2MSYA 5F1JA 2R5YA 3GTGJ 4A3KJ 1ZK8A 3ZQCA 2Y9ZA 3S2HJ 1RKTA 3D1NI 3NARA 2EH3A 5IOYA 3PO3J 2HYJA 2DA5A 1XG1A 1U78A 4A3CJ 1G2HA 1IGNA 1QPIA 1A5JA 1ORKA 2JN6A 2X6OA 3CCYA 4C3HJ 1B8IA 1H89C 5J1YA 1SFOJ 1B8IB 1JTXA 5K7ZA 1P7JA 3E7LA 2WAQN 3Q0VA 5E3LA 2TCTA 5F0HA 2YU9J 2VPRA 2XPWA 1FIAA 2I10A 2E19A 2NVXJ 3BR3A 5HODA 1ITYA 1IC8A 1OJLA 1GDTA 4A69C 5EEAA 4A3LJ 2EZHA 4RBOA 2OF7A 4BBRJ 1TC3C 2H1KA 2GLOA 2ME0A 1JUPA 4A3EJ 2JA5J 1MNMC 2R5ZA 4XRMA 2EZIA 2M9HA 1XS9A 3A01A 4LOCA 3GTLJ 3I4NJ 2R5ZB 5EGOA 1SANA 1ETXA 3S1RJ 1LE8A 2XGCA 1FIPA 1X2NA 2XPUA 3A01B 4A3MJ 3HM5A 3LNQA 5C4XJ 1HOMA 1LE8B 5EGOB 4A3GJ 1JKOC 3RKQA 2Y9YA 5E3MA 3TW6A 4B1RA 4C3JJ 4XK4A 2E2IJ 1MBKA 5F0CA 3JR9A 3BG5A 4BKXA 3GTPJ 4D5CA 3B6AA 2L9RA 4A93J 3LSGA 3BG3A 1ZKGA 4IHYA 4UUSA 2EZLA 3HOXJ 3S15J 4AC0A 4C2MJ 2ME6A 4UUSB 2YS9A 1LFBA 2K40A 3Q0UA 4IHXA 2IEKA 3M3YJ 4A3IJ 2LY9A 4JP0A 4ABZA 2ECBA 1O4XA 2NVQJ 3JRAA 1H88C 4S0HB 3GTMJ 2IBDA 2DMTA 3S16J 2QF7A 1Y1WJ 4DZPA 2HXIA 2DA4A 3DEWA 1IDYA 5FLVA 3H3VK 2JA7J 2Y2ZA 2LR8A 1AU7A 2L7MP 2CU7A 2HOSA 3HEFA 3HB9A 4I6ZA 3MKLA 3HOYJ 3M4OJ 2NS8A 1A6IA 3G1LA 1JJ8C 2M0CA 1ETYA 3O8HA 1UMQA 1Z77A 1HCRA 2JA8J 1RPWA 2WB1N 3DCFA 2FJ1A 2EQRA 4B3AA 3HKZN 2H8RA 3VPRA 2HXOA 2L0KA 2AO9A 3BG9A 5J1UA 3BT9A 3HOUJ 4W1UA 1WPKA 1WH5A 4M3FA 2G0EA 2KDZA 2O8KA 2L7FP 2ELKA 4CYCA 1OFCX 3QPSA 3JRDA 1IDZA 2O7OA 3TEDA 2MW8A 1PUFA 1WI3A 2CUFA 3QPLA 4CYCB 1GT0C 5IOZA 2XSDC 1PUFB 1CQTA 5E3NA 1FTTA 1ZTRA 1Y1VJ 2YUSA 1JUMA 3JRCA 3GTJJ 4MFEA 4XRSG 3RZOJ 3S2DJ 2CRGA 1F43A 3K2AA
chains in the Genus database with same CATH superfamily
1S6LA 1ZGWA 4Y15A 1VQ9I 2ZMEB 3C3WA 3BCBA 4RM3A 1HKSA 2COBA 4KUMA 1BI0A 3C2BA 2F5DA 2K5CA 5D6FA 4ASNA 1ZR2A 1ON2A 3ZQLA 4BJ6C 2HVRA 4N9HA 5DD4A 5DCFA 2ZJQF 2CQQA 2FRHA 4HDVA 4PJNA 3VWBA 1ONVA 5HLHA 1SVLA 1YRNA 4KFCA 4A3FJ 2NOJB 3JAMZ 3HGYA 3G1OA 3VOEA 3OSGA 4GDFA 4D7NA 1U0JA 2Y31A 4Z2YA 3G71I 2VKEA 2VBWA 4PSXA 3S1NJ 3V8KA 1ETVA 3GEZA 2K86A 2IAIA 5C4JJ 2R7ZJ 4ZYHA 4G12A 2VXZA 2GOMA 1D1BA 4M9SA 2QCOA 2R93J 3PQJA 4XOPA 4BJTA 4YFXF 3ELKA 4V2FA 4HLXA 2DFEA 2VUMJ 2Y30A 2R7OA 2WAEA 2CW7A 5IYBJ 1UHSA 4E7ZA 2L54A 4BEHA 5BS6A 1ETKA 1YOVB 3OS2A 4HEA2 3RTRA 3F22A 9ANTA 3QPHA 5C3EJ 2DA3A 3AKZA 1F4KA 3CCSI 1BN5A 1R6RA 4Y3OA 2EIJH 5C44J 4MNUA 2ACJA 3BR0A 2VJJA 3BR1A 2DMQA 2MC4A 3CZ6A 1YLFA 2O03A 2FU4A 3S3NA 1JKQC 4DQ2A 4I2OA 4JQFA 1R23A 4M3BA 3GTKJ 2ZFWA 3ZQFA 5FLXZ 4XOTA 2E2JJ 4FISA 3KLOA 3AG1H 3WTXC 1XMKA 3NWTA 3DTKA 4E70A 1GHCA 1R71A 5CVRA 1LPQA 2DMNA 1WWXA 1FJLA 2PFBA 2P0WA 4GO1A 3K4CA 5L3BA 5EDNA 2D5VA 2QKLB 3CESA 2EBIA 4M3GA 4OIOF 3BR2A 1W5SA 3M1CA 4WXCA 5D6EA 1EH8A 1XD7A 4WX9A 3LL7A 1ULYA 1B9MA 4HF0A 5FKLA 1Q1HA 2HNHA 3CC7I 2B7EA 5B3SH 1WI9A 4OINF 1JKRC 2IVMA 4R8HA 4AM3A 3VYTB 1YX3A 1IRGA 1MKMA 2OQRA 4MHGA 1NG6A 2HDDA 4HBLA 2BY2A 2GA2A 1FSHA 3W2AA 1LDDA 5HS7A 5E3OA 1JT6A 3WTWC 1X1PA 4Q47A 4Z6YA 1VQ8I 2LY1A 1TWGJ 3B02A 3OYCA 2JQ7A 3FBNB 3HUGA 2JRMA 2Y0MA 4F52A 2JWTA 3W6JB 3HOTA 1YG2A 1S7OA 2K3FA 2WBMA 2R7TA 5EG0B 2E7XA 2VI6A 3BROA 4OAYA 3RQ4A 2UXNA 4BQQA 1GLNA 4AU7A 1R4NB 3KLNA 4P55A 5B66C 1BJAA 3ABLH 1VQMI 2GOXB 4PCQA 4AWXB 5HNFA 2V9VA 5J1RA 4P9UA 5L3CA 3MKWB 2WAFA 2XC7A 3BJAA 1PDNC 1IXCA 5KVRA 5IY5H 1NG7A 5F27A 2EJRA 1LQ1A 2E1MB 4WCGA 4CCJA 3A2KA 3GFJA 4IHWA 5TGTA 2Y48A 3E6MA 1ERDA 5HS8A 5DEQA 3HRUA 2QQ9A 3JRBA 1FOWA 4M3EA 3MVPA 1R5HA 2M45A 3E5UA 4A0YA 3IV5A 4DJAA 4E7JA 4BU2A 2P6SA 4BY7J 2DT7B 2HYGD 2K4BA 3OOPA 4GYIA 1EV7A 5HOOA 3BJOA 4MTEA 1R9TJ 2QSGX 2GXAA 4XSZF 1ACIA 1IV8A 2WV1A 5E1ZB 1LVAA 4X1EA 3BLYA 1RNLA 3H92A 5GTIC 2HOEA 4RA2A 3EETA 1K78B 3RYRA 4DBRA 3ISPA 4UUTA 3MD2A 4U0WA 2OAZA 3ZQ7A 5DDGA 5F0FA 4L0YB 4XONA 1U9NA 2DQLA 4XQFA 4UB6C 2RNJA 2E2HJ 1T95A 3L09A 3L7WA 2M34A 2X51A 2ZNYA 4BBSJ 2ZC2A 4QIWN 4M9XA 1ZLKA 2VL8A 1PUEE 4M6XA 3MMYB 5M5YJ 1JKPC 2I5UA 2OTJI 3Q9VA 3BWGA 3LOCA 3R60A 3MKYB 3GVAA 5F64A 1OCPA 5HDNA 3OYAA 1FEXA 4HX4A 2OUMA 3IH2A 2RNGA 1KU9A 3LSRA 4XLAA 1P4WA 3VSLA 3FHZA 1GUUA 2MG4A 2XAGA 2XAJA 3SZGA 4RAYA 1FMWA 4BH9A 2CH0A 1KGSA 2DPUA 3KP5A 3BTIA 1MBJA 4U0VA 2JK3A 3FMQA 1YJ9I 4UV9A 3WE3A 4S04A 4C30A 2QBYB 3WTTC 2BY0A 4AD9A 4JK1X 2JMWA 2CV0A 2RAEA 2LTPA 3DU5A 2IRFG 5K5OA 5L3DA 2M4KA 3KCCA 1XDUA 2R7FA 1Q1VA 2DA7A 2KL4A 4HQMA 3I59A 3ROUA 2R92J 1XCBA 4XKWA 4ZJZA 3L2CA 1J7KA 2XAUA 1FOYA 1W5TA 4YRVA 3CDHA 5J6XA 4YELA 1N77A 4BE2A 2V1NA 4Q48A 4ZH4F 1FYKA 3H9GA 2L01A 1IV6A 5BMZA 1TT0A 3IH4A 2IGKA 4XKBA 2BGCA 1X1AA 3UNGC 1J09A 1UELB 1XC5A 3JW4A 3L2RA 4AIDA 1OR7C 4A3DJ 4P5OA 2FNPA 5CVJA 2KIQA 3SZTA 2DBBA 1KZHA 1VNDA 4BGDA 3MKZA 4FE7A 3S17J 1ZARA 4IEJA 1MBEA 1SFUA 3KP4A 1NTCA 4HOBA 5E1WA 1HA8A 1HSTA 4F92B 2F4IA 3DBRB 1RKWA 4ZDOA 3R0AA 4FX0A 5F1JA 2IS4A 4A3KJ 3ZQCA 4I0BA 3HRMA 2E7WA 3D1NI 3OYMA 2CGPA 3CLQA 4II3A 3PO3J 3FDYA 2E5ZA 1XG1A 2KIFA 4A3CJ 1CF7A 1G2HA 1V4RA 1QPIA 3KYLA 3Q5FA 3OR1C 2XAFA 1XTAA 1I27A 1H89C 5J1YA 5HLTA 2ZJ2A 3MCZA 1B8IB 5K7ZA 3Q9SA 5HVQC 2TCTA 2CV1A 2M5WA 2XPWA 2H6BA 3PL8A 3W3CA 3C1DA 3FXQA 4YIRX 3HIFA 4LG3A 2VQCA 1R4MB 4ON0A 4CCOA 2IW5A 1OJLA 4I0AA 4A69C 3K4KA 4H4KC 2EZHA 3GWZA 5B5EC 1XGMA 1G4DA 3PNYA 2PX9A 4XNFA 1U3EM 2PLYA 1TZLA 4A12A 4I09A 2KISA 4CCKA 2CSOA 2BYVE 1XS9A 4LOCA 2Q2EA 3G6EI 2R5ZB 5EGOA 1ETXA 3TMOA 1T2KA 1X2NA 3WGIA 4A3MJ 5C4XJ 1X1DA 3LNQA 1YIJI 1LE8B 3E97A 1BR2A 3LSTA 3QAHA 4A3GJ 1B4AA 3KZIC 3TW6A 4C3JJ 4XK4A 2EFNA 3HJEA 5CVVA 3JR9A 1YI2I 2VJ5A 2DYSH 2KMUA 2WB1A 3LAPA 4IQ4A 2M1BA 3I53A 4I7HA 4RAGA 2ZJRF 4O5VA 2NNYA 4C2MJ 4A2UA 4UUSB 1A04A 1UG0A 1LFBA 2KRHA 4M71A 1A36A 3Q0UA 1IN5A 3O6BB 3CO6C 3M3YJ 1OYYA 1LEAA 2LY9A 4A5NA 4JP0A 3P5JA 2IJLA 1IN6A 1FP1D 3D5RC 1FC3A 1Y1WJ 1SFXA 4ZYGA 2V9PA 2DA4A 3ZMSA 5FLVA 1X4PA 3V8LA 1T8IA 1S9HA 1LJ9A 2BOLA 2DXIA 5LHGA 2DW4A 2K3PA 2K85A 3HB9A 4HAMA 4I6ZA 2KKOA 3OYFA 2DJIA 1PYVA 1TQMA 4LB6B 5E18F 2V26A 1E3HA 3A0HC 4EJOA 3DU6A 3TDUC 1QZEA 2O5RA 5DCMB 2DI3A 3HOYJ 3F8BA 1AA7A 1PP8F 3G1LA 3CO7C 1S3JA 1R00A 3ZRGA 1V5GA 1HCRA 2DTRA 4CSWA 3I9V2 3RKYA 3RPUA 1DPRA 5CYVA 4LIVA 3F9KA 2BY3A 4K2EA 3VPRA 1OCZH 2VBYA 5E20A 5FO5A 5J1UA 3ZMTA 3KZZA 3HOUJ 3LSIA 3IAM2 2CQ7A 4FHTA 2G0EA 2O8KA 2LC2A 5ED4A 1JHFA 2BW3A 4CO8A 3MWMA 1R5ID 2RREA 1Z05A 3N4MA 1WI3A 3ZXSA 1GT0C 2ZXWH 3WTSC 1K7AA 3ZMVA 4LLGF 4FQGA 3P9IA 1PUFB 3GLLA 4YEJA 3HTUA 2MABA 1F9NA 2M3AA 2VJ4A 5L3FA 3JRCA 3IUOA 4XRSG 5D8KB 2G7HA 3S2DJ 1F43A 3ZP5A 3PSIA 2E71A 2LOOA 2P8TA 1E3OC 4HX8A 2DOAA 2CG4A 5BNGA 3SEZA 2GM4A 1EA3A 3ASOH 2KZVA 1RIOH 4HX7A 3S2WA 4PGGA 3QU6A 2XRNA 4DYQA 1YW8A 1JGGA 3GBGA 1FYLA 3OYGA 4LK1F 3OY9A 3RKXA 1OCTC 4KMUX 3A4CA 1FBQA 5LGTA 2L9VA 4ZTJA 3EYIA 2X6WA 2ETHA 4D5FA 2B63J 4PJJA 4LLLA 1SMTA 4XLCA 1T08B 1HXDA 2HR3A 3N05A 4O6JA 4CA0A 2IXSA 2LREA 2VQHA 2JVGA 2X4HA 1IW7F 3CQZJ 4M72A 3DBLB 4P96A 2W1OA 3I4PA 4WWCA 3CCMI 1LFUP 3GTQJ 1FLIA 4AVPA 1APLC 4BY1J 1IUFA 1IZ1A 3AFHA 4CCLA 1I6HJ 3FK6A 3KP2A 4D9JA 3CMEI 4XN3A 2WWYA 2VLAA 1BC8C 3BG7A 1QHHD 2K7LA 4RLQA 1G3TA 3NEUA 4Y4RA 1HDPA 1V5EA 2LF8A 2JUGA 2CJJA 4BE0A 1BOBA 2P5VA 1ZN2A 3E5XA 2F48A 4DNCA 1EH6A 4UVCA 3BCAA 3FM5A 3ASNH 5M3FJ 1YHQI 4I76A 5F08A 2XSJC 1G3YA 4OWRB 1MNEA 3OSFA 2OU2A 5ICGA 1SAXA 3I0TA 1FWZA 4UNOA 4KNYA 5GPAA 1W7PD 1YQAA 2FBIA 2CV2A 4YFKF 3LMMA 1UCRA 2XGEA 2HS5A 3CCEI 5LBQA 2Z1DA 2FX0A 4PGHA 5KAFC 3HDDA 1JUSA 4HLYA 1J59A 2LYCA 1MBHA 3H1CA 2VKVA 4XKCA 3FHNA 2JPBA 5KHDA 3ZPLA 2ICWG 2FEZA 2YR2A 1YW9A 4UY8I 2ZSHB 2KLOA 2YPRA 5CPRB 5EYRA 3LSJA 2QEXI 4PJMA 4EM0B 2WTEA 1JXSA 3DEUA 1T56A 4XSXF 3FMSA 3HOZJ 4NC8A 2XB0X 3C18A 4OU0A 4BQNA 4A5MA 1FY7A 1TW3A 1UZCA 2VBXA 2X0LA 2YX7A 3GZ5A 3ZMUA 3ZGKA 2PMUA 3RSNA 4PFPA 1EF4A 2N8GA 2MLGA 3BQZA 5LFAA 4QTRA 2E1NA 2O8XA 1TW2A 3TQNA 1AKHB 4BYYA 4EJUA 2JUCA 5IT3A 1I3AA 5EG0A 3R4KA 3A0BC 4AYBN 4CICA 2KT0A 2VC0A 1BC7C 1G3SA 3EDPA 4H0EA 2Z9OA 3WE2A 1R1TA 2A61A 2WADA 2E1MC 3KPHA 1IJWC 2DJNA 3OYKA 1D0YA 1WGXA 4LGWA 3ABMH 2HOAA 1X2MA 1VF9A 4HG2A 5HDKA 2MA3A 5LLQA 1MJAA 2STWA 2RQQA 3FXJA 1REPC 4E7IA 4OOIA 4OMZA 3U1DA 2DCEA 2R5YB 3Q3SA 2H1LA 4HRIA 3WU1B 1QVTA 1P92A 4UVAA 5F04A 1L3LA 4M6VA 3EYYA 3HRTA 5TRDA 4A3JJ 1Z6TA 1RC9A 5ICFA 3TP3A 4EM2A 1STZA 3S1MJ 2D2WA 1TP4A 2XIGA 1ZR4A 2HPIA 4YIIA 1FTZA 2Z3YA 3BTJA 1DGWY 3ULQB 1TWAJ 2VKHA 1LEBA 5FKMA 2Z2SB 4N4OB 3JRIA 1J5YA 2X85A 2ZSIB 3O2PE 1ZGAA 2VB6A 4MQVA 2FD5A 5JFRA 1MMAA 4HQEA 4RMNA 2QWWA 4KT5C 3TOBA 1OCOH 5E17F 5GPCA 6PAXA 2HTJA 5TISC 1SD6A 1K78A 4JYKA 2X1CA 3N97A 4II2A 2Q1ZB 2DFIA 5M5WJ 4N0BA 2CQNA 4P9FA 4JX5A 2A07F 3DQVC 5J8CA 4KDPA 2XROA 3TKYA 5LRRA 1MH4A 4IHVA 2HZTA 5KCMA 1WJCA 3J80K 3Q0WA 5H2FC 4EM1A 2IS1A 3SHFA 2V4JC 3GTOJ 2PMZN 1I6XA 1MH3A 5IT9K 3BZ6A 5E8IA 3K4JA 2R3SA 4LG0B 2LKXA 4HZFA 1P7IA 3C2GA 4DBQA 3OYHA 2O9LA 2IA2A 4M9ZA 1EJ9A 3P9KA 1B72B 3CC2I 3F8CA 3D5SC 1TNSA 4ZYEA 1MBGA 1MMGA 3A03A 3P9CA 4F55A 1IXSB 1R58A 1ETQA 2QBYA 3DPUA 5HLIA 1H0MA 3H5NA 1TWHJ 4XL9A 3V7RA 3FXOA 1OCRH 5M3MJ 5LHIA 2VOPA 1BA5A 4MEYF 2QSHX 1WH7A 1KYWA 2PMHA 4PJLA 3IRQA 3K70D 1EKEA 1NHAA 2FUG2 3X2QH 3AG2H 2L4AA 3PQKA 5LHHA 3J7AY 2G9WA 2EV5A 1AHDP 1B1BA 4U0YA 4I98B 1VFCA 5EZHA 1JGSA 4A6DA 3SDBA 3TW7A 2DK8A 3M9AA 4MQ9F 3TL4X 5IP9J 1YX5A 4QPOA 4YIFA 3L2WA 1H9GA 4C3IJ 5JLWA 4OMYA 2MD5A 5D5XB 1SEUA 2FOKA 5GTHC 4EEFG 5CKTA 3TGNA 3RQIA 5J4YA 3S14J 3CJTB 1K6OA 5E8GA 1XMXA 1LFPA 1W1WE 3FWEA 1F36A 3DFGA 2QSFX 4Q5SF 4XICA 1N78A 3WHCA 2GQQA 4NC6A 3ZQIA 3T8RA 4EV0A 3CUOA 2HQ5A 5ILUA 2COMA 4XRSA 2UV1A 5DYMA 3C7JA 1T39A 3GTGJ 4RB1A 3PNVA 2O3FA 3CJQB 5CQEA 2HYJA 2DA5A 1RR8C 2JPCA 2VOOA 2QENA 3SEQA 1FMVA 3DWLE 3H5AA 3QRFF 1IGNA 3KEOA 2I8DA 2JN6A 2W84A 2X6OA 3CCYA 3LQRA 1B8IA 4PZJA 1SFOJ 4KIGA 3MFKA 4A6EA 3E7LA 4ENKA 3Q0VA 5ILSA 2A5WA 2ZXHA 3K9TA 2OTLI 2QQAA 2YU9J 1IO2A 2NVXJ 3BR3A 4HA8A 4IL6C 5HODA 1O3SA 3L2VA 3LA7A 3LFUA 1LDJA 3GFMA 1S7AA 2JRTA 3DBHB 3I5UA 2FA5A 4A3LJ 3G73A 2PG4A 5EJCA 2OF7A 2X1EA 4BBRJ 3GMEA 1R1VA 1W36D 4CUGA 3VODA 4DIQA 3HL2A 1UHWA 2JA2A 2JSCA 1TC3C 3R61A 4IJAA 3BY6A 1MNMC 2R5ZA 4XRMA 1TQIA 1IN8A 5B1AH 2HVSA 2EZIA 2CQKA 2M9HA 4Y33A 1K79A 3GTLJ 3KETA 4E7LA 1LE8A 3JAMK 3S1RJ 3QP5A 1J0RA 2PEXA 3RKWA 2MD0A 2ZNZA 3DTIA 2BY1A 5J47A 2VQGA 2E2IJ 3LA3A 3BZCA 4I01A 3WG7H 5GAHJ 4DOZA 3B6AA 3ECHA 5FB2A 3F8MA 1R1UA 4IHYA 4UUSA 3L2QA 2QZ8A 2M0MA 2YS9A 5FRNA 1T0FC 3K69A 4BXFA 1ON1A 4XLEA 3PNTA 1WSUA 1SFKA 3TBIA 1QPMA 1SFEA 3V8JA 4XRFA 2RKHA 3KP6A 1O4XA 2NVQJ 3JRAA 4S0HB 3GTMJ 2IBDA 3VB2A 1U5TC 4KN7X 1LDKB 1T0FA 3H3VK 2HEOA 5FLXK 3PFIA 2ZCWA 2Y2ZA 4LFUA 2L7MP 1BOAA 2HOSA 3ZN1A 2Z5UA 3SYTA 5AIQA 2RDPA 1U5TA 2A68F 4CXFA 2X1DA 5DCMA 2EK5A 1ZGJA 3E5QA 4HSRA 2NS8A 5JHFA 3KP7A 3L9FA 3CJNA 3JCUC 1XSDA 1ETYA 2NVUB 1OCCH 4KIBA 1UMQA 1Z77A 4NUBA 3GX4X 3J7AO 3DEEA 2L5QA 3F72A 2CUZA 2FXAA 3DCFA 2EQRA 3HKZN 3S32A 5CJ9A 1ZRFA 2VONA 3I3LA 3JTHA 5L3GA 2EFWA 1P9QC 2AO9A 1VQ7I 4NBQA 4XR6A 1WPKA 1OR7A 4ZTFA 4BNCA 2FBKA 3G2BA 2L7FP 3AG3H 2QUFA 3M8EA 3REOA 2ELKA 1OFCX 2AQEA 3QPSA 3COAC 1PUFA 2MW8A 5IOZA 5JVGF 2P7VB 3K4MA 2XSDC 3OYLA 2UXXA 3I71A 2BE5F 3S93A 3V7CA 1MW7A 1QBJA 1Y56A 1MMNA 2GXBA 4MFEA 3I56I 1Z91A 4L9JA 1IXRC 2I10A 3OMYA 1YITI 3TO9A 4OAZA 1O7FA 2OBPA 4ZZLA 2PMZA 3JRGA 2TRTA 2G7UA 1G59A 3RYPA 2DTZA 2P5KA 5IP7J 3BDDA 2HI3A 1U6GA 2CYYA 2CO5A 3CCJI 1OQYA 1XSXA 1BIAA 3CLOA 3M07A 3LSPA 1MSFC 1FNNA 1TLHB 4FX4A 1S8NA 3E6DA 2RGVA 5AIPA 1QVUA 2EV6A 1FOXA 4KT6A 3RIRA 2CUJA 2OD5A 2H09A 3ZQHA 2JT1A 4BS9A 2DLLA 3OOUA 5FROA 4CHUA 1QNTA 2QQ8A 3NQOA 1BW5A 1ETWA 1HBXG 4NNJA 1DP7P 3SFZA 1VQNI 3PM1A 2DA2A 2WA0A 3KIOA 4L5EA 3HHHA 4DW6A 5M5XJ 3PUFA 4L9VA 2OCEA 1WJEA 2EFPA 5KK1A 4EJWA 2E1CA 1W0UA 3KX2A 3M8FA 3W2VA 1HW2A 3CDLA 1B9NA 4IQJA 3ZMDA 1XCVA 2K9NA 1RESA 3FISA 2NOGA 4O3MA 2W82A 3FXRA 1S72I 2DN0A 3WU2C 2LG4A 1HKQA 3ZMZA 2LVSA 4HNUA 4BHCA 2Q0OA 1P6RA 4EMSA 3VYSB 4HNVA 4B47A 3SZPA 3TOAA 3TP0A 2DMPA 2DYRH 3LFKA 1HDDC 3CP8A 5FKNA 3CMAI 1ZG5A 2W48A 1YTYA 2E36A 3H0GJ 3IH3A 4MIMA 3HOVJ 1I50J 3DV8A 3KEYA 2OQGA 1NK2P 2X48A 2DMUA 1JTYA 3HG9A 3J81Z 2L3DA 2KIUA 5H20A 1D8KA 2VASA 2XKPA 5DD8A 3ERED 2M8GX 4ENMA 3I54A 1HLVA 1DGRM 2DA1A 1BM9A 2W00A 3CMYA 1GV2A 4AIJA 3J7YJ 2MLKA 3BR5A 1UB9A 1H9TA 4IHSA 4MLOA 2GXGA 3IRRA 3OYNA 3MN2A 4GYGA 3S8PA 3V42A 3DF8A 4MFDA 3BOQA 2ID6A 1DP3A 2FNAA 2E35A 5HNHA 4I99C 1RRJA 1FBUA 2R0QC 2E1OA 1FPQA 1TWCJ 2Z16A 4NQWA 2Y69H 3S3OA 5HLGA 1RUNA 1UAAA 2EINH 4KA4A 4JX6A 2DT5A 2QGUA 3GLXA 3HC7A 4HV5A 4XLNF 1DPUA 1Z0XA 4GCVA 1ZRDA 4BXXJ 4GFBA 1ZH5A 1AKHA 3JTGA 2OA4A 4G8XA 5JHUA 1TL8A 1S7EA 1BI2A 2QLZA 1QRYA 2VXDA 2FOWA 2R7DA 3E0JB 4UUVA 3MQ0A 1BR4A 4JOMA 1W5CC 4HW0A 4LK0F 5IPAA 2O61A 2LNBA 2ZMEC 3GZNB 3CUQB 2DFHA 3KZYA 3HZJA 4U88A 1X3WB 2CQXA 1TBXA 4BL0B 4XIDA 2VPLA 3VYUB 2LH9A 2FE3A 3SJMA 4G7HF 3MZ8A 4GRIA 1O3QA 3F8FA 3OV8A 1VI0A 2H8WA 2K9SA 2KZGA 2A6TA 1MNDA 1Y8QB 1XB4A 4CCMA 2IA1A 2ZMEA 1W7PB 2O6GE 2QKMB 1HW1A 1WVRA 3ONQA 3RCOA 4XN0A 1IN4A 3CF5F 5EZGA 4AIHA 5J4VA 5FRMA 5DS9A 3AG4H 3PO2J 5FLMJ 2NS7A 4EVIA 4BHBA 3WHBA 1JE8A 3TO6A 2XV4S 5IYDJ 1W4MA 2FMLA 5H6QA 4IRIA 1T38A 1X1CA 3IL2A 1TWFJ 2CW0F 5LEJA 4N9IA 4BQAA 4TV7A 3QYFA 3ABUA 1X19A 1BI1A 3HSRA 2DPDA 4X6AJ 2JTVA 2IA0A 4F3QA 2AXLA 1AOYA 4RB0A 1JI8A 1X58A 4E7HA 1Z3XA 5FJ8J 3ABTA 2YSRA 1I39A 4YG2F 2D45A 2UUZA 2BEOA 3KEQA 4RB2C 3CCVI 1T98A 2R4GA 1VQKI 2DT6A 3IKVA 5EF6A 3FKIJ 3CF2A 2NVTJ 2RC4A 1Z7UA 3U1KA 3DKYA 4LITA 1VTNC 1IN7A 2CW8A 3K4BA 1FT9A 4DZJA 4ESBA 1WJDA 2F4OB 2P81A 3K2ZA 2RQPA 1GV5A 2M2EA 1MJBA 2Q2EB 3FIWA 3OYIA 3T8TA 3JREA 1P4XA 5J3LA 2LLKA 3KE2A 2XB5A 1H8AC 4LG0A 1DDNA 1VQ5I 3OL4A 5DV5A 1Z3YA 1R7JA 2V1DA 4BACA 1B72A 3CCUI 1FYMA 1POGA 3HSFA 2FBHA 1WJFA 2P7CB 3ZOBA 2K9LA 4LD5A 3JRHA 2ID3A 2LDUA 1WCMJ 3VEPA 2E5NA 1D1AA 3SFIA 3S1QJ 1VQ6I 1HF0A 1RR7A 2XF6A 4J19A 2J5OA 2FQ3A 1Z21A 1Z67A 4IRHA 4RGSA 5F6FA 1YJWI 4AIKA 1EH7A 2ELJA 1QU3A 3HPGA 4MO7A 4G9YA 5D4SA 5E79C 2XPVA 4KYWA 1RETA 3J7ZI 1ZHFA 4GGGA 3GFLA 5L3EA 3FXUA 5K5QA 5BOXA 2VN2A 1DQUA 3J81K 4G94A 4S05A 5ICCA 2DFFA 3E3VA 3F23A 4M6YA 1Y0NA 1JJ6C 3HSEA 3EQLF 2DAOA 1MD0A 3OIPA 2L9SA 3ABKH 5AONA 1IRZA 3H5RA 2PJRB 2F2EA 3PFYA 2IT0A 3K6GA 1SVOA 2AQFA 3SQNA 1U2WA 4C2TA 2WV0A 3UKGA 3R6SA 3IKTA 1L0OC 4D0PA 1ZYRF 2HKOA 3F21A 3BR6A 2F5CA 4F91B 5LD2C 2STTA 2VKDA 4IVNA 2PBIA 3RI4A 2L9NA 4OIRF 3QQAA 3UR3C 4FASD 3QP6A 2MSYA 3P7NA 2V9KA 2L7KA 2D1VA 1KYZA 2Y9ZA 1QGPA 1RKTA 3GZ6A 3LWFA 1K4SA 2EH3A 5IOYA 4B43A 3I64A 4XMYA 1MDMB 3D5LA 1LUJB 1Y0UA 1OISA 3VSKA 1A5JA 2OJED 2BHZA 3WU0A 4C3HJ 4ESFA 1MJ9A 1ZREA 1JTXA 1P7JA 2WAQN 5E3LA 4E7SA 3EUKL 3C2HA 3PIOF 3FZVA 3WTVC 2BHYA 1FIAA 1R5GA 4YFNF 2VODA 3PSFA 3OYBA 1WJAA 4QLCU 1B6AA 3H35A 1O7LA 4E4HA 1GDTA 3FM3A 5EEAA 4RBOA 1A31A 4RB3C 3FX3A 1DUXC 4B3XA 2XKOA 1KA8A 5D8LB 2B9SA 2H1KA 1RUOA 1TTYA 1JUPA 2D1HA 2JA5J 1S5LC 2X6XA 1YJNI 1BBYA 2XGXA 1QZYA 3WTUC 1PP7U 4NHJA 3H9JA 2XGCA 1FIPA 3ML6A 2XPUA 1VZ0A 1HSJA 3A01B 2IS2A 1HOMA 2HQNA 3GF2A 2ISYA 3DXJF 4UXNA 1JKOC 1OLTA 1SVMA 5E3MA 3RPUD 2F5EA 4IRGA 1QO0D 1MBKA 2DU9A 5F0CA 4M74A 2BBYA 2R7XA 3CCLI 1TT5B 1P2FA 3WGHA 4BKXA 3GTPJ 4HF1A 4D5CA 4IKFA 4A93J 3LSGA 3BG3A 2EZLA 2QA4I 2ESNA 4J01A 3S15J 1WJ5A 4IXAA 4AC0A 1D8JA 3G3ZA 2ME6A 1A35A 4OIPF 3E1SA 4IF4A 2IEKA 2IP2A 2VC1A 4A3IJ 4JBAA 3HPHA 3AL0B 1KQ8A 3EUAA 2X6YA 3IP4B 2MH9A 5A2QZ 4G6QA 4PFOA 1E2XA 4IZZA 2GIZA 3K4LA 1P4AA 4DZPA 3LQQA 2JA7J 2UWMA 1AU7A 2CU7A 2Z99A 3BPVA 3HEFA 3WG9A 3HOSA 3DPLC 3F8NA 2V1UA 1Z6RA 5J8FA 2DO7A 2JVHA 5BQTA 4XBFA 1X3UA 3HTSB 4HNTA 3W6KB 3U21A 2NNNA 4BQOA 5FGMA 4QWQA 3ZN0A 1D1CA 1C0WA 1R36A 3MZHA 3K0LA 3HRSA 4IX7A 2R7UA 3QYEA 2MYSA 2M0CA 1GXPA 2QQBA 3FXLA 3O8HA 2JA8J 3K1NA 3ZR8X 4KICA 1RPWA 4ZYAA 2W57A 1FZPB 2WB1N 2HDCA 5F1RA 3WODF 2H8RA 1YO5C 4EJTA 2A3SA 2HXOA 3L2UA 4EATA 3BG9A 4HPQA 3BT9A 1MMDA 4W1UA 1WH5A 2EWNA 2ELHA 1V55H 1ZAOA 2LBFB 1F5TA 2KDZA 3R0JA 2K9MA 2ZXJA 5CVIA 1Z7LA 1F1ZA 2CS3A 2YX4A 2KRCA 1IDZA 2FF4A 2O7OA 3BZKA 4A0XA 3TEDA 2CUFA 3QPLA 3MAJA 4CYCB 3WTZA 3DLLF 4KISA 5E3NA 4KMFA 1FTTA 4BAYA 2CWEA 1ZTRA 1XGNA 4OIQF 1G3WA 1IRFA 1V3FA 2M4GA 3GTJJ 1G6NA 4G7OF 3RZOJ 1BR1A 4BJ5C 3F6OA 4BHPA 2HGCA 3K2AA 5K7FA 3SDGA 3BC8A 1U9OA 2FSWA 4P1WA 1ODDA 5K1YA 2EFOA 4CDGA 4AUXA 4ZZDA 5JLXA 2UZKA 2HQAA 4AVZA 5FFXA 1WZ2A 1SAUA 2ZB9A 2XGDA 2EIMH 2DQRA 3VYRB 3FK7A 4L9NA 3U2RA 3HGGA 4ZYDA 1FBSA 4G7ZF 4KITB 2W4SA 3FMRA 4BE1A 5D5UB 2GIVA 3DKXA 4LJZF 2HKXA 2XAQA 1O3RA 3BQYA 4QSHA 2IGOA 3QU3A 4KIFA 1YRNB 4PUSA 5D5WB 2PQ8A 2QM3A 2ZFUA 3M1EA 4UVBA 5D4RA 4MEXF 2KFDA 2A05A 1QZZA 2KP6A 5DTDA 4ENNA 1Y8RB 5FKOA 2HOTA 2CUEA 2Q8KA 3GUDA 2R7RA 1MMSA 1O57A 1XMAA 4C2UA 2MBFA 1FSEA 2EIKH 3ESWB 2AXTC 5LEKA 4IOCF 3I4MJ 1WQ2A 2XF7A 1NK3P 1D5YA 2LF7A 3HYIA 2HPMA 4HV6A 2F4MB 2JZYA 1W0TA 2AS5F 3KYDB 4BEHB 3NAUA 4XLFA 4FCYA 3VDXA 1UFMA 2OC6A 4RAZA 3LAJA 4A3BJ 1SMYF 3RZDJ 1NH3A 4NB5A 1I1SA 2K9QA 3QYBA 3KYCB 1XGSA 3OIQA 4JX4A 3K4NA 5GP9A 3GFIA 3K7AJ 4WXHA 5LRSA 2F6CA 2LK2A 1VQOI 5TJJA 3HBLA 2VIXA 4AYBA 3U9GA 4RDUA 1BJZA 4RGUA 4B4CA 2DDAA 4R1HA 1FOKA 4DYCA 1GVJA 2V6CA 1MGTA 4NDLA 1VQ4I 1IF1A 1G8XA 1KU2A 2EB7A 5ERIA 2KPMA 4LMYA 4G6DA 2H6CA 3BTLA 2LRDA 3H3ZA 2JSPA 1V54H 2BXZA 1LNWA 2V1XA 2VBZA 3B73A 4ENJA 2GBYA 2DDBA 1SD7A 1WHUA 5DUIA 2OCCH 1MIJA 1XGOA 2GA1A 2WY8Q 5LGNA 5A2QK 5GADJ 4A0ZA 2V6EA 5BPDA 1SC7A 2HYFA 1O3TA 2H27A 3CUQC 3BG6A 1I3QJ 2BXYA 2WAQA 3OR2C 3ZQQA 5IYCJ 4X0GA 1VQLI 2LP0A 5JVTA 1LVKA 3CDIA 3H9QA 2XRLA 4PJ0C 1LKXA 2K4JA 2ESHA 2HU9A 2JA6J 3CD6I 2O0YA 1IRXA 3SXYA 2V79A 2HVQA 1MBFA 4M73A 5K7HA 2H94A 1KQ9A 3CUQA 1BW6A 1X4OA 4WF2A 4M3DA 3V4GA 2B0LA 3W6VA 2Z33A 4LIUA 4L5JA 1HQCA 1X1BA 4U7BA 4PDKA 1E3PA 3DPTA 1K61A 5GAGJ 4Y7NJ 3HUGB 3GYHX 1XDSA 3A02A 1TQPA 3BJ6A 2LY2A 4GXOA 3OYEA 3KP3A 1Z9CA 2VQLA 4FE4A 3OIOA 4ETSA 1U8BA 3CC4I 5FD5A 1USTA 1B59A 1W7PA 2L4MA 2Y0SN 3QOEA 1I5ZA 2YU3A 2K27A 4ANJA 2ZJPF 1AWCA 2IS6A 3W2WA 1A6QA 3F6VA 3H3UA 4ZC3A 3O3KA 2LSOA 2XHKA 3JSOA 4FT8A 3IWFA 5FD6A 2KRFA 2XUBA 2FQ4A 4D1QA 1JHHA 1V5FA 2P4WA 2EILH 2LD5A 5FKKA 4HF2A 1QA6A 3E6BA 2M8EA 3PIPF 4IOAF 2XDVA 5IP6A 3PUBA 1BL0A 2NRAC 2W25A 2IGNA 4BUPA 1T33A 2EA4A 3QPTA 4R79A 3F3XA 1GXQA 2QVOA 3VFZA 1D3YA 4G6TB 2KDOA 2IPQX 2LKPA 1JT0A 3G1MA 2A6EF 3A1YA 1KONA 5ILVA 5D5VB 5E1XA 1GVDA 2NVYJ 4HYEA 3LSHA 2ZBKA 2OPTA 2L7ZA 1ENHA 3JSPA 1U8RA 2F5FA 1UHMA 3NWSA 5CLSA 3IC7A 2EZKA 1D0XA 4BDYA 4RGXA 2R7QA 1MZBA 2JJ7A 3I55I 3B6CA 1QHGA 2MC3A 3IWZA 4DYRA 2OZ6A 3ZQGA 3AAFA 1USSA 4MGRA 3HOWJ 1CGPA 1ZQ3P 4CH7A 2HTSA 4UV8A 4HSTA 5CVUA 2XASA 1UG2A 5B1BH 4RLFA 3QWLA 2NYXA 2X9DA 4FTHA 3BTCA 2C6YA 3H0DA 2W7NA 1ZLJA 4PSWA 4V2GA 2R7SA 2VT2A 4CZZA 4J00A 2E34A 3S3MA 2EPFA 5H6RA 2ECCA 3PJRA 2OZUA 3IHUA 3DP7A 3G4SI 2LFBA 1ETOA 3EUHC 5HDGA 2DK5A 5KAIC 1OMIA 2W24A 2MGQA 4L9TA 3HXLA 2ADUA 4W97A 5CQGA 4B8XA 2OV7A 4F93B 3QODA 1BIBA 5LGUA 3ERMA 2PJPA 5JR3A 1DU0A 2NAZA 3EUHA 5J40A 1IG7A 1OYIA 1YW7A 1DU6A 2LMDA 2XF5A 3GO5A 3I59B 3JRFA 1QQIA 2E60A 4E6KG 1LB2A 2PJRA 4NC7A 5FFZA 2P6TA 2DA6A 1ZRCA 3O8GA 1OPCA 1U5TB 2LKSA 2VE8A 4CYDA 4D7MA 1FX7A 1Y39A 1MSEC 4Y52J 2KQRA 1K83J 3OS0A 3F0CA 2VE9A 4B48A 1R49A 2HWVA 3EPZA 4I02A 4L5IA 2ZO4A 2Y75A 3IAS2 2CFXA 2XVCA 3L1PA 1XX5A 3CCQI 3TDZC 2AHQA 2M30A 5DM6F 5ICEA 5EEHA 3RPQA 4Q4ZF 4IO9F 2NS0A 2R5YA 1MDMA 1ZK8A 2ZKZA 3S2HJ 3OWTA 1RI7A 3NARA 3K70C 2K02A 4ZDLA 4CCNA 1U78A 2MFZA 4LLNA 1ORKA 4EQQA 1KU3A 1KQ0A 5GAEJ 1CF7B 3NRVA 1WJBA 4UHTA 1IUYA 5KNLA 2EA2A 4QPQA 3HHGA 3OS1A 3V7SA 2BVLA 3I58A 4RAFA 5F0HA 1KU7A 2VPRA 1XPXA 2E19A 4IPAA 1K4TA 1YYVA 1YFHA 4F7ZA 1YIOA 1T6SA 2KHMA 4XKVA 2WY7Q 1TNTA 1VQPI 1ITYA 1XSVA 1IC8A 1PJRA 2PN6A 4PK4A 3H36A 1R22A 3ECOA 2GAUA 3GW2A 4U7DA 4ESJA 2HZDA 3FXMA 3BP8A 4HDUA 2V7FA 4KJZA 3OYJA 4CGZA 2ZXIA 1K6YA 3CMMA 4WK8F 3CJRB 2BV6A 4BXUA 2GLOA 3MZYA 3J80Z 2ME0A 4A3EJ 3LA2A 3DLAA 3OL3A 1D5VA 1S29A 4EGYA 3A01A 2P5LC 5HS9A 1YS6A 2M7BA 3I4NJ 1SANA 2MH2A 4XORA 5IT9Z 3ZCOA 1HW5A 1E17A 5EEGA 2NXNB 3HM5A 4XLPF 5EGOB 3QOPA 2IGMA 2QYOA 3M7GA 3RKQA 2HDWA 2Y9YA 4B1RA 2M87A 5DM7F 3BG5A 4C9YA 3RDIA 3AL0C 2A5YB 3GXOA 3LSMA 1RZ4A 3L00A 4LB5A 1X3ZB 1XN7A 3BPXA 3WGGA 2L9RA 1ZKGA 3HKZA 2R7VA 4CZCA 3HOXJ 4U87A 4E7KA 2KJCA 3FF5A 2VJIA 2EV0A 4Y17A 2J5PA 4L18B 2K40A 1WRJA 4MTDA 4IHXA 2DOEA 1J2XA 1SD5A 4BDZA 2DOFA 1PVEA 2A69F 2GZWA 2L2OA 4ABZA 2ECBA 1W36C 1H88C 3OYDA 4RS8A 3RJPA 2RN7A 2DMTA 2DODA 3S16J 3TO7A 2M7AA 2QF7A 1IAWA 2ISZA 1YS7A 4Y13A 2HXIA 3DEWA 1IDYA 2GWRA 1J9IA 2LR8A 4WXDA 2FMYA 4KN4X 2BZTA 2Y0SA 1WFXA 3DTEA 5BPIA 3K10A 4EJVA 4ITVA 1OYWA 1ZG3A 1OKRA 1BI3A 3T0YA 2KJBA 1FP2A 2R7WA 2HFHA 4L0ZB 4B44A 4RGRA 2BVMA 2KIMA 3MKLA 3M4OJ 1A6IA 4RM2A 1N25A 2VT3A 1Y6IA 4XM3A 1JJ8C 1HKTA 1M1EB 3WTYC 2L02A 4ZDPA 4FETA 3T1BA 2HQRA 1J75A 3FBIB 1YE9A 2F5VA 4V19K 2W85A 3KFWX 1Z1DA 2FJ1A 4B3AA 1SD4A 3CTAA 1WKMA 4UB8C 5DUKA 2CMPA 2XAHA 2L0KA 4NQWB 1UJ8A 3E6CC 3DKWA 3GCMA 2LBFA 2CFOA 2WC2A 1E0EA 1D0ZA 2RV8A 4M3FA 1N75A 2RVCA 4XLHA 4IHTA 1HC8A 3K1PA 3CCRI 2EFQA 5JI6A 4CYCA 4N4NB 1ZELA 3M8JA 3JRDA 4EGZA 2PI0A 2BW3B 2TDXA 3FKJA 3D0SA 3FXKA 3K1MA 4B09A 1CQTA 1I1GA 3T5XA 4DGWB 5K5RA 2YUSA 1Y1VJ 3LSKA 3MEXA 1JUMA 2A6HF 3CP2A 2CRGA 1ZG1A
chains in the Genus database with same CATH topology
5K7FA 1ZGWA 3SDGA 1E3OC 3JRGA 1U9OA 2TRTA 5BNGA 2GM4A 4AUXA 5JLXA 2DTZA 5IP7J 2HI3A 2COBA 2ZB9A 3C2BA 2XGDA 4DYQA 1JGGA 1ZR2A 3LSPA 1MSFC 3ZQLA 3GBGA 3FK7A 3HGGA 1OCTC 1QVUA 2CQQA 4D5FA 1YRNA 4A3FJ 3HGYA 2B63J 3BQYA 3G1OA 4QSHA 3ZQHA 3OSGA 4D7NA 2Y31A 3OOUA 1YRNB 2VKEA 3S1NJ 1BW5A 1ETWA 3CQZJ 1ETVA 5C4JJ 2IAIA 3PM1A 2R7ZJ 2DA2A 4G12A 5DTDA 5FKOA 2HOTA 4L5EA 1LFUP 4DW6A 5M5XJ 2CUEA 1APLC 4BY1J 3GTQJ 1IUFA 2QCOA 2R93J 1W0UA 4V2FA 1I6HJ 3CDLA 2VUMJ 2K9NA 1RESA 2Y30A 5IYBJ 3FK6A 3FISA 2NOGA 1UHSA 2DN0A 3I4MJ 1NK3P 1ETKA 1D5YA 9ANTA 1W0TA 5C3EJ 2DA3A 2LVSA 1HDPA 3NAUA 4FCYA 5C44J 4HNVA 2CJJA 4A3BJ 3BR0A 3BR1A 2DMQA 3TP0A 3RZDJ 5M3FJ 2DMPA 2K9QA 1JKQC 1HDDC 4I76A 4JX4A 5FKNA 5F08A 2W48A 3H0GJ 3OSFA 3IH3A 4MIMA 5GP9A 3HOVJ 1I50J 3K7AJ 4M3BA 3ZQFA 3GTKJ 2LK2A 1NK2P 2X48A 3HBLA 2E2JJ 4FISA 2DMUA 1JTYA 5GPAA 4RDUA 1BJZA 4B4CA 4DYCA 2XGEA 2M8GX 2DMNA 1HLVA 1FJLA 4NDLA 5EDNA 2D5VA 2DA1A 2FX0A 3CMYA 1GV2A 2EBIA 4M3GA 1JUSA 3HDDA 1MBHA 2VKVA 3BR5A 3BR2A 3BTLA 4MLOA 3MN2A 4MFDA 2GBYA 2ID6A 5FKLA 5EYRA 3LSJA 1JKRC 2R0QC 1T56A 2E1OA 1TWCJ 3HOZJ 1I3QJ 5IYCJ 2HDDA 2XB0X 2LP0A 2XRLA 4JX6A 1Z0XA 5E3OA 4BXXJ 4GFBA 1JT6A 1AKHA 2JA6J 1EF4A 2N8GA 1S7EA 1MBFA 3BQZA 5K7HA 1QRYA 4QTRA 1BW6A 3W6VA 1TWGJ 1AKHB 4M3DA 5IPAA 5EG0A 2CQXA 1K61A 4AYBN 4Y7NJ 2JWTA 2KT0A 4XIDA 3SJMA 3A02A 5EG0B 2VI6A 1IJWC 2DJNA 1VI0A 4FE4A 1WGXA 2K9SA 3OIOA 1U8BA 2HOAA 1X2MA 1VF9A 2Y0SN 5J1RA 2R5YB 3Q3SA 2FQ4A 5F27A 2LD5A 5FKKA 1QVTA 5F04A 5EZGA 4M6VA 5DS9A 3PO2J 4IHWA 5IP6A 5FLMJ 1BL0A 2NS7A 4A3JJ 3WHBA 3TP3A 5IYDJ 3S1MJ 1T33A 3JRBA 1ZR4A 4M3EA 1FTZA 3BTJA 3MVPA 1TWAJ 1TWFJ 5FKMA 3IV5A 3JRIA 4BY7J 2FD5A 1JT0A 3G1MA 4X6AJ 1GVDA 2NVYJ 1R9TJ 5GPCA 1X58A 5FJ8J 4JYKA 2OPTA 2L7ZA 1ENHA 2WV1A 4X1EA 5EF6A 3FKIJ 5M5WJ 4UUTA 2NVTJ 4JX5A 2EZKA 5F0FA 1MH4A 4IHVA 2JJ7A 4DZJA 1U9NA 2P81A 3B6CA 2E2HJ 1GV5A 3Q0WA 2M34A 2M2EA 4DYRA 4BBSJ 3ZQGA 3FIWA 4QIWN 3GTOJ 2PMZN 3JREA 1MH3A 5J3LA 3HOWJ 2LLKA 5M5YJ 2XB5A 1JKPC 1H8AC 1ZQ3P 3LOCA 1B72A 2LKXA 1UG2A 1OCPA 1POGA 1P7IA 1FEXA 2O9LA 1B72B 2X9DA 4FTHA 3BTCA 3IH2A 3ZOBA 3LSRA 4V2GA 1MBGA 3JRHA 2ID3A 3A03A 1WCMJ 3SFIA 3S1QJ 1GUUA 1HF0A 1RR7A 2MG4A 2ECCA 4J19A 1ETQA 3BTIA 1MBJA 2JK3A 2LFBA 1ETOA 1TWHJ 5M3MJ 4MO7A 2JMWA 2MGQA 2RAEA 4W97A 2XPVA 1BA5A 2LTPA 1WH7A 1RETA 1DU0A 1Q1VA 2DA7A 1AHDP 1VFCA 2R92J 5EZHA 1IG7A 1DU6A 3TW7A 3JRFA 1JJ6C 5IP9J 2DA6A 3O8GA 1IRZA 1IV6A 4D7MA 3IH4A 4C3IJ 5JLWA 4Y52J 1MSEC 4EEFG 1K83J 1XC5A 3F0CA 3RQIA 3S14J 4A3DJ 3UKGA 1F36A 1VNDA 3L1PA 3S17J 4FE7A 3BR6A 4XICA 3WHCA 4IEJA 3ZQIA 1MBEA 2AHQA 1NTCA 2HQ5A 1RKWA 4XRSA 3QQAA 2MSYA 5F1JA 2R5YA 3GTGJ 4A3KJ 1ZK8A 3ZQCA 2Y9ZA 3S2HJ 1RKTA 3D1NI 3NARA 2EH3A 5IOYA 3PO3J 2HYJA 2DA5A 1XG1A 1U78A 4A3CJ 1G2HA 1IGNA 1QPIA 1A5JA 1ORKA 2JN6A 2X6OA 3CCYA 4C3HJ 1B8IA 1H89C 5J1YA 1SFOJ 1B8IB 1JTXA 5K7ZA 1P7JA 3E7LA 2WAQN 3Q0VA 5E3LA 2TCTA 5F0HA 2YU9J 2VPRA 2XPWA 1FIAA 2I10A 2E19A 2NVXJ 3BR3A 5HODA 1ITYA 1IC8A 1OJLA 1GDTA 4A69C 5EEAA 4A3LJ 2EZHA 4RBOA 2OF7A 4BBRJ 1TC3C 2H1KA 2GLOA 2ME0A 1JUPA 4A3EJ 2JA5J 1MNMC 2R5ZA 4XRMA 2EZIA 2M9HA 1XS9A 3A01A 4LOCA 3GTLJ 3I4NJ 2R5ZB 5EGOA 1SANA 1ETXA 3S1RJ 1LE8A 2XGCA 1FIPA 1X2NA 2XPUA 3A01B 4A3MJ 3HM5A 3LNQA 5C4XJ 1HOMA 1LE8B 5EGOB 4A3GJ 1JKOC 3RKQA 2Y9YA 5E3MA 3TW6A 4B1RA 4C3JJ 4XK4A 2E2IJ 1MBKA 5F0CA 3JR9A 3BG5A 4BKXA 3GTPJ 4D5CA 3B6AA 2L9RA 4A93J 3LSGA 3BG3A 1ZKGA 4IHYA 4UUSA 2EZLA 3HOXJ 3S15J 4AC0A 4C2MJ 2ME6A 4UUSB 2YS9A 1LFBA 2K40A 3Q0UA 4IHXA 2IEKA 3M3YJ 4A3IJ 2LY9A 4JP0A 4ABZA 2ECBA 1O4XA 2NVQJ 3JRAA 1H88C 4S0HB 3GTMJ 2IBDA 2DMTA 3S16J 2QF7A 1Y1WJ 4DZPA 2HXIA 2DA4A 3DEWA 1IDYA 5FLVA 3H3VK 2JA7J 2Y2ZA 2LR8A 1AU7A 2L7MP 2CU7A 2HOSA 3HEFA 3HB9A 4I6ZA 3MKLA 3HOYJ 3M4OJ 2NS8A 1A6IA 3G1LA 1JJ8C 2M0CA 1ETYA 3O8HA 1UMQA 1Z77A 1HCRA 2JA8J 1RPWA 2WB1N 3DCFA 2FJ1A 2EQRA 4B3AA 3HKZN 2H8RA 3VPRA 2HXOA 2L0KA 2AO9A 3BG9A 5J1UA 3BT9A 3HOUJ 4W1UA 1WPKA 1WH5A 4M3FA 2G0EA 2KDZA 2O8KA 2L7FP 2ELKA 4CYCA 1OFCX 3QPSA 3JRDA 1IDZA 2O7OA 3TEDA 2MW8A 1PUFA 1WI3A 2CUFA 3QPLA 4CYCB 1GT0C 5IOZA 2XSDC 1PUFB 1CQTA 5E3NA 1FTTA 1ZTRA 1Y1VJ 2YUSA 1JUMA 3JRCA 3GTJJ 4MFEA 4XRSG 3RZOJ 3S2DJ 2CRGA 1F43A 3K2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7F A;  1ZGW A;  3SDG A;  1E3O C;  3JRG A;  1U9O A;  2TRT A;  5BNG A;  2GM4 A;  4AUX A;  5JLX A;  2DTZ A;  5IP7 J;  2HI3 A;  2COB A;  2ZB9 A;  3C2B A;  2XGD A;  4DYQ A;  1JGG A;  1ZR2 A;  3LSP A;  1MSF C;  3ZQL A;  3GBG A;  3FK7 A;  3HGG A;  1OCT C;  1QVU A;  2CQQ A;  4D5F A;  1YRN A;  4A3F J;  3HGY A;  2B63 J;  3BQY A;  3G1O A;  4QSH A;  3ZQH A;  3OSG A;  4D7N A;  2Y31 A;  3OOU A;  1YRN B;  2VKE A;  3S1N J;  1BW5 A;  1ETW A;  3CQZ J;  1ETV A;  5C4J J;  2IAI A;  3PM1 A;  2R7Z J;  2DA2 A;  4G12 A;  5DTD A;  5FKO A;  2HOT A;  4L5E A;  1LFU P;  4DW6 A;  5M5X J;  2CUE A;  1APL C;  4BY1 J;  3GTQ J;  1IUF A;  2QCO A;  2R93 J;  1W0U A;  4V2F A;  1I6H J;  3CDL A;  2VUM J;  2K9N A;  1RES A;  2Y30 A;  5IYB J;  3FK6 A;  3FIS A;  2NOG A;  1UHS A;  2DN0 A;  3I4M J;  1NK3 P;  1ETK A;  1D5Y A;  9ANT A;  1W0T A;  5C3E J;  2DA3 A;  2LVS A;  1HDP A;  3NAU A;  4FCY A;  5C44 J;  4HNV A;  2CJJ A;  4A3B J;  3BR0 A;  3BR1 A;  2DMQ A;  3TP0 A;  3RZD J;  5M3F J;  2DMP A;  2K9Q A;  1JKQ C;  1HDD C;  4I76 A;  4JX4 A;  5FKN A;  5F08 A;  2W48 A;  3H0G J;  3OSF A;  3IH3 A;  4MIM A;  5GP9 A;  3HOV J;  1I50 J;  3K7A J;  4M3B A;  3ZQF A;  3GTK J;  2LK2 A;  1NK2 P;  2X48 A;  3HBL A;  2E2J J;  4FIS A;  2DMU A;  1JTY A;  5GPA A;  4RDU A;  1BJZ A;  4B4C A;  4DYC A;  2XGE A;  2M8G X;  2DMN A;  1HLV A;  1FJL A;  4NDL A;  5EDN A;  2D5V A;  2DA1 A;  2FX0 A;  3CMY A;  1GV2 A;  2EBI A;  4M3G A;  1JUS A;  3HDD A;  1MBH A;  2VKV A;  3BR5 A;  3BR2 A;  3BTL A;  4MLO A;  3MN2 A;  4MFD A;  2GBY A;  2ID6 A;  5FKL A;  5EYR A;  3LSJ A;  1JKR C;  2R0Q C;  1T56 A;  2E1O A;  1TWC J;  3HOZ J;  1I3Q J;  5IYC J;  2HDD A;  2XB0 X;  2LP0 A;  2XRL A;  4JX6 A;  1Z0X A;  5E3O A;  4BXX J;  4GFB A;  1JT6 A;  1AKH A;  2JA6 J;  1EF4 A;  2N8G A;  1S7E A;  1MBF A;  3BQZ A;  5K7H A;  1QRY A;  4QTR A;  1BW6 A;  3W6V A;  1TWG J;  1AKH B;  4M3D A;  5IPA A;  5EG0 A;  2CQX A;  1K61 A;  4AYB N;  4Y7N J;  2JWT A;  2KT0 A;  4XID A;  3SJM A;  3A02 A;  5EG0 B;  2VI6 A;  1IJW C;  2DJN A;  1VI0 A;  4FE4 A;  1WGX A;  2K9S A;  3OIO A;  1U8B A;  2HOA A;  1X2M A;  1VF9 A;  2Y0S N;  5J1R A;  2R5Y B;  3Q3S A;  2FQ4 A;  5F27 A;  2LD5 A;  5FKK A;  1QVT A;  5F04 A;  5EZG A;  4M6V A;  5DS9 A;  3PO2 J;  4IHW A;  5IP6 A;  5FLM J;  1BL0 A;  2NS7 A;  4A3J J;  3WHB A;  3TP3 A;  5IYD J;  3S1M J;  1T33 A;  3JRB A;  1ZR4 A;  4M3E A;  1FTZ A;  3BTJ A;  3MVP A;  1TWA J;  1TWF J;  5FKM A;  3IV5 A;  3JRI A;  4BY7 J;  2FD5 A;  1JT0 A;  3G1M A;  4X6A J;  1GVD A;  2NVY J;  1R9T J;  5GPC A;  1X58 A;  5FJ8 J;  4JYK A;  2OPT A;  2L7Z A;  1ENH A;  2WV1 A;  4X1E A;  5EF6 A;  3FKI J;  5M5W J;  4UUT A;  2NVT J;  4JX5 A;  2EZK A;  5F0F A;  1MH4 A;  4IHV A;  2JJ7 A;  4DZJ A;  1U9N A;  2P81 A;  3B6C A;  2E2H J;  1GV5 A;  3Q0W A;  2M34 A;  2M2E A;  4DYR A;  4BBS J;  3ZQG A;  3FIW A;  4QIW N;  3GTO J;  2PMZ N;  3JRE A;  1MH3 A;  5J3L A;  3HOW J;  2LLK A;  5M5Y J;  2XB5 A;  1JKP C;  1H8A C;  1ZQ3 P;  3LOC A;  1B72 A;  2LKX A;  1UG2 A;  1OCP A;  1POG A;  1P7I A;  1FEX A;  2O9L A;  1B72 B;  2X9D A;  4FTH A;  3BTC A;  3IH2 A;  3ZOB A;  3LSR A;  4V2G A;  1MBG A;  3JRH A;  2ID3 A;  3A03 A;  1WCM J;  3SFI A;  3S1Q J;  1GUU A;  1HF0 A;  1RR7 A;  2MG4 A;  2ECC A;  4J19 A;  1ETQ A;  3BTI A;  1MBJ A;  2JK3 A;  2LFB A;  1ETO A;  1TWH J;  5M3M J;  4MO7 A;  2JMW A;  2MGQ A;  2RAE A;  4W97 A;  2XPV A;  1BA5 A;  2LTP A;  1WH7 A;  1RET A;  1DU0 A;  1Q1V A;  2DA7 A;  1AHD P;  1VFC A;  2R92 J;  5EZH A;  1IG7 A;  1DU6 A;  3TW7 A;  3JRF A;  1JJ6 C;  5IP9 J;  2DA6 A;  3O8G A;  1IRZ A;  1IV6 A;  4D7M A;  3IH4 A;  4C3I J;  5JLW A;  4Y52 J;  1MSE C;  4EEF G;  1K83 J;  1XC5 A;  3F0C A;  3RQI A;  3S14 J;  4A3D J;  3UKG A;  1F36 A;  1VND A;  3L1P A;  3S17 J;  4FE7 A;  3BR6 A;  4XIC A;  3WHC A;  4IEJ A;  3ZQI A;  1MBE A;  2AHQ A;  1NTC A;  2HQ5 A;  1RKW A;  4XRS A;  3QQA A;  2MSY A;  5F1J A;  2R5Y A;  3GTG J;  4A3K J;  1ZK8 A;  3ZQC A;  2Y9Z A;  3S2H J;  1RKT A;  3D1N I;  3NAR A;  2EH3 A;  5IOY A;  3PO3 J;  2HYJ A;  2DA5 A;  1XG1 A;  1U78 A;  4A3C J;  1G2H A;  1IGN A;  1QPI A;  1A5J A;  1ORK A;  2JN6 A;  2X6O A;  3CCY A;  4C3H J;  1B8I A;  1H89 C;  5J1Y A;  1SFO J;  1B8I B;  1JTX A;  5K7Z A;  1P7J A;  3E7L A;  2WAQ N;  3Q0V A;  5E3L A;  2TCT A;  5F0H A;  2YU9 J;  2VPR A;  2XPW A;  1FIA A;  2I10 A;  2E19 A;  2NVX J;  3BR3 A;  5HOD A;  1ITY A;  1IC8 A;  1OJL A;  1GDT A;  4A69 C;  5EEA A;  4A3L J;  2EZH A;  4RBO A;  2OF7 A;  4BBR J;  1TC3 C;  2H1K A;  2GLO A;  2ME0 A;  1JUP A;  4A3E J;  2JA5 J;  1MNM C;  2R5Z A;  4XRM A;  2EZI A;  2M9H A;  1XS9 A;  3A01 A;  4LOC A;  3GTL J;  3I4N J;  2R5Z B;  5EGO A;  1SAN A;  1ETX A;  3S1R J;  1LE8 A;  2XGC A;  1FIP A;  1X2N A;  2XPU A;  3A01 B;  4A3M J;  3HM5 A;  3LNQ A;  5C4X J;  1HOM A;  1LE8 B;  5EGO B;  4A3G J;  1JKO C;  3RKQ A;  2Y9Y A;  5E3M A;  3TW6 A;  4B1R A;  4C3J J;  4XK4 A;  2E2I J;  1MBK A;  5F0C A;  3JR9 A;  3BG5 A;  4BKX A;  3GTP J;  4D5C A;  3B6A A;  2L9R A;  4A93 J;  3LSG A;  3BG3 A;  1ZKG A;  4IHY A;  4UUS A;  2EZL A;  3HOX J;  3S15 J;  4AC0 A;  4C2M J;  2ME6 A;  4UUS B;  2YS9 A;  1LFB A;  2K40 A;  3Q0U A;  4IHX A;  2IEK A;  3M3Y J;  4A3I J;  2LY9 A;  4JP0 A;  4ABZ A;  2ECB A;  1O4X A;  2NVQ J;  3JRA A;  1H88 C;  4S0H B;  3GTM J;  2IBD A;  2DMT A;  3S16 J;  2QF7 A;  1Y1W J;  4DZP A;  2HXI A;  2DA4 A;  3DEW A;  1IDY A;  5FLV A;  3H3V K;  2JA7 J;  2Y2Z A;  2LR8 A;  1AU7 A;  2L7M P;  2CU7 A;  2HOS A;  3HEF A;  3HB9 A;  4I6Z A;  3MKL A;  3HOY J;  3M4O J;  2NS8 A;  1A6I A;  3G1L A;  1JJ8 C;  2M0C A;  1ETY A;  3O8H A;  1UMQ A;  1Z77 A;  1HCR A;  2JA8 J;  1RPW A;  2WB1 N;  3DCF A;  2FJ1 A;  2EQR A;  4B3A A;  3HKZ N;  2H8R A;  3VPR A;  2HXO A;  2L0K A;  2AO9 A;  3BG9 A;  5J1U A;  3BT9 A;  3HOU J;  4W1U A;  1WPK A;  1WH5 A;  4M3F A;  2G0E A;  2KDZ A;  2O8K A;  2L7F P;  2ELK A;  4CYC A;  1OFC X;  3QPS A;  3JRD A;  1IDZ A;  2O7O A;  3TED A;  2MW8 A;  1PUF A;  1WI3 A;  2CUF A;  3QPL A;  4CYC B;  1GT0 C;  5IOZ A;  2XSD C;  1PUF B;  1CQT A;  5E3N A;  1FTT A;  1ZTR A;  1Y1V J;  2YUS A;  1JUM A;  3JRC A;  3GTJ J;  4MFE A;  4XRS G;  3RZO J;  3S2D J;  2CRG A;  1F43 A;  3K2A A; 
#chains in the Genus database with same CATH topology
 1S6L A;  1ZGW A;  4Y15 A;  1VQ9 I;  2ZME B;  3C3W A;  3BCB A;  4RM3 A;  1HKS A;  2COB A;  4KUM A;  1BI0 A;  3C2B A;  2F5D A;  2K5C A;  5D6F A;  4ASN A;  1ZR2 A;  1ON2 A;  3ZQL A;  4BJ6 C;  2HVR A;  4N9H A;  5DD4 A;  5DCF A;  2ZJQ F;  2CQQ A;  2FRH A;  4HDV A;  4PJN A;  3VWB A;  1ONV A;  5HLH A;  1SVL A;  1YRN A;  4KFC A;  4A3F J;  2NOJ B;  3JAM Z;  3HGY A;  3G1O A;  3VOE A;  3OSG A;  4GDF A;  4D7N A;  1U0J A;  2Y31 A;  4Z2Y A;  3G71 I;  2VKE A;  2VBW A;  4PSX A;  3S1N J;  3V8K A;  1ETV A;  3GEZ A;  2K86 A;  2IAI A;  5C4J J;  2R7Z J;  4ZYH A;  4G12 A;  2VXZ A;  2GOM A;  1D1B A;  4M9S A;  2QCO A;  2R93 J;  3PQJ A;  4XOP A;  4BJT A;  4YFX F;  3ELK A;  4V2F A;  4HLX A;  2DFE A;  2VUM J;  2Y30 A;  2R7O A;  2WAE A;  2CW7 A;  5IYB J;  1UHS A;  4E7Z A;  2L54 A;  4BEH A;  5BS6 A;  1ETK A;  1YOV B;  3OS2 A;  4HEA 2;  3RTR A;  3F22 A;  9ANT A;  3QPH A;  5C3E J;  2DA3 A;  3AKZ A;  1F4K A;  3CCS I;  1BN5 A;  1R6R A;  4Y3O A;  2EIJ H;  5C44 J;  4MNU A;  2ACJ A;  3BR0 A;  2VJJ A;  3BR1 A;  2DMQ A;  2MC4 A;  3CZ6 A;  1YLF A;  2O03 A;  2FU4 A;  3S3N A;  1JKQ C;  4DQ2 A;  4I2O A;  4JQF A;  1R23 A;  4M3B A;  3GTK J;  2ZFW A;  3ZQF A;  5FLX Z;  4XOT A;  2E2J J;  4FIS A;  3KLO A;  3AG1 H;  3WTX C;  1XMK A;  3NWT A;  3DTK A;  4E70 A;  1GHC A;  1R71 A;  5CVR A;  1LPQ A;  2DMN A;  1WWX A;  1FJL A;  2PFB A;  2P0W A;  4GO1 A;  3K4C A;  5L3B A;  5EDN A;  2D5V A;  2QKL B;  3CES A;  2EBI A;  4M3G A;  4OIO F;  3BR2 A;  1W5S A;  3M1C A;  4WXC A;  5D6E A;  1EH8 A;  1XD7 A;  4WX9 A;  3LL7 A;  1ULY A;  1B9M A;  4HF0 A;  5FKL A;  1Q1H A;  2HNH A;  3CC7 I;  2B7E A;  5B3S H;  1WI9 A;  4OIN F;  1JKR C;  2IVM A;  4R8H A;  4AM3 A;  3VYT B;  1YX3 A;  1IRG A;  1MKM A;  2OQR A;  4MHG A;  1NG6 A;  2HDD A;  4HBL A;  2BY2 A;  2GA2 A;  1FSH A;  3W2A A;  1LDD A;  5HS7 A;  5E3O A;  1JT6 A;  3WTW C;  1X1P A;  4Q47 A;  4Z6Y A;  1VQ8 I;  2LY1 A;  1TWG J;  3B02 A;  3OYC A;  2JQ7 A;  3FBN B;  3HUG A;  2JRM A;  2Y0M A;  4F52 A;  2JWT A;  3W6J B;  3HOT A;  1YG2 A;  1S7O A;  2K3F A;  2WBM A;  2R7T A;  5EG0 B;  2E7X A;  2VI6 A;  3BRO A;  4OAY A;  3RQ4 A;  2UXN A;  4BQQ A;  1GLN A;  4AU7 A;  1R4N B;  3KLN A;  4P55 A;  5B66 C;  1BJA A;  3ABL H;  1VQM I;  2GOX B;  4PCQ A;  4AWX B;  5HNF A;  2V9V A;  5J1R A;  4P9U A;  5L3C A;  3MKW B;  2WAF A;  2XC7 A;  3BJA A;  1PDN C;  1IXC A;  5KVR A;  5IY5 H;  1NG7 A;  5F27 A;  2EJR A;  1LQ1 A;  2E1M B;  4WCG A;  4CCJ A;  3A2K A;  3GFJ A;  4IHW A;  5TGT A;  2Y48 A;  3E6M A;  1ERD A;  5HS8 A;  5DEQ A;  3HRU A;  2QQ9 A;  3JRB A;  1FOW A;  4M3E A;  3MVP A;  1R5H A;  2M45 A;  3E5U A;  4A0Y A;  3IV5 A;  4DJA A;  4E7J A;  4BU2 A;  2P6S A;  4BY7 J;  2DT7 B;  2HYG D;  2K4B A;  3OOP A;  4GYI A;  1EV7 A;  5HOO A;  3BJO A;  4MTE A;  1R9T J;  2QSG X;  2GXA A;  4XSZ F;  1ACI A;  1IV8 A;  2WV1 A;  5E1Z B;  1LVA A;  4X1E A;  3BLY A;  1RNL A;  3H92 A;  5GTI C;  2HOE A;  4RA2 A;  3EET A;  1K78 B;  3RYR A;  4DBR A;  3ISP A;  4UUT A;  3MD2 A;  4U0W A;  2OAZ A;  3ZQ7 A;  5DDG A;  5F0F A;  4L0Y B;  4XON A;  1U9N A;  2DQL A;  4XQF A;  4UB6 C;  2RNJ A;  2E2H J;  1T95 A;  3L09 A;  3L7W A;  2M34 A;  2X51 A;  2ZNY A;  4BBS J;  2ZC2 A;  4QIW N;  4M9X A;  1ZLK A;  2VL8 A;  1PUE E;  4M6X A;  3MMY B;  5M5Y J;  1JKP C;  2I5U A;  2OTJ I;  3Q9V A;  3BWG A;  3LOC A;  3R60 A;  3MKY B;  3GVA A;  5F64 A;  1OCP A;  5HDN A;  3OYA A;  1FEX A;  4HX4 A;  2OUM A;  3IH2 A;  2RNG A;  1KU9 A;  3LSR A;  4XLA A;  1P4W A;  3VSL A;  3FHZ A;  1GUU A;  2MG4 A;  2XAG A;  2XAJ A;  3SZG A;  4RAY A;  1FMW A;  4BH9 A;  2CH0 A;  1KGS A;  2DPU A;  3KP5 A;  3BTI A;  1MBJ A;  4U0V A;  2JK3 A;  3FMQ A;  1YJ9 I;  4UV9 A;  3WE3 A;  4S04 A;  4C30 A;  2QBY B;  3WTT C;  2BY0 A;  4AD9 A;  4JK1 X;  2JMW A;  2CV0 A;  2RAE A;  2LTP A;  3DU5 A;  2IRF G;  5K5O A;  5L3D A;  2M4K A;  3KCC A;  1XDU A;  2R7F A;  1Q1V A;  2DA7 A;  2KL4 A;  4HQM A;  3I59 A;  3ROU A;  2R92 J;  1XCB A;  4XKW A;  4ZJZ A;  3L2C A;  1J7K A;  2XAU A;  1FOY A;  1W5T A;  4YRV A;  3CDH A;  5J6X A;  4YEL A;  1N77 A;  4BE2 A;  2V1N A;  4Q48 A;  4ZH4 F;  1FYK A;  3H9G A;  2L01 A;  1IV6 A;  5BMZ A;  1TT0 A;  3IH4 A;  2IGK A;  4XKB A;  2BGC A;  1X1A A;  3UNG C;  1J09 A;  1UEL B;  1XC5 A;  3JW4 A;  3L2R A;  4AID A;  1OR7 C;  4A3D J;  4P5O A;  2FNP A;  5CVJ A;  2KIQ A;  3SZT A;  2DBB A;  1KZH A;  1VND A;  4BGD A;  3MKZ A;  4FE7 A;  3S17 J;  1ZAR A;  4IEJ A;  1MBE A;  1SFU A;  3KP4 A;  1NTC A;  4HOB A;  5E1W A;  1HA8 A;  1HST A;  4F92 B;  2F4I A;  3DBR B;  1RKW A;  4ZDO A;  3R0A A;  4FX0 A;  5F1J A;  2IS4 A;  4A3K J;  3ZQC A;  4I0B A;  3HRM A;  2E7W A;  3D1N I;  3OYM A;  2CGP A;  3CLQ A;  4II3 A;  3PO3 J;  3FDY A;  2E5Z A;  1XG1 A;  2KIF A;  4A3C J;  1CF7 A;  1G2H A;  1V4R A;  1QPI A;  3KYL A;  3Q5F A;  3OR1 C;  2XAF A;  1XTA A;  1I27 A;  1H89 C;  5J1Y A;  5HLT A;  2ZJ2 A;  3MCZ A;  1B8I B;  5K7Z A;  3Q9S A;  5HVQ C;  2TCT A;  2CV1 A;  2M5W A;  2XPW A;  2H6B A;  3PL8 A;  3W3C A;  3C1D A;  3FXQ A;  4YIR X;  3HIF A;  4LG3 A;  2VQC A;  1R4M B;  4ON0 A;  4CCO A;  2IW5 A;  1OJL A;  4I0A A;  4A69 C;  3K4K A;  4H4K C;  2EZH A;  3GWZ A;  5B5E C;  1XGM A;  1G4D A;  3PNY A;  2PX9 A;  4XNF A;  1U3E M;  2PLY A;  1TZL A;  4A12 A;  4I09 A;  2KIS A;  4CCK A;  2CSO A;  2BYV E;  1XS9 A;  4LOC A;  2Q2E A;  3G6E I;  2R5Z B;  5EGO A;  1ETX A;  3TMO A;  1T2K A;  1X2N A;  3WGI A;  4A3M J;  5C4X J;  1X1D A;  3LNQ A;  1YIJ I;  1LE8 B;  3E97 A;  1BR2 A;  3LST A;  3QAH A;  4A3G J;  1B4A A;  3KZI C;  3TW6 A;  4C3J J;  4XK4 A;  2EFN A;  3HJE A;  5CVV A;  3JR9 A;  1YI2 I;  2VJ5 A;  2DYS H;  2KMU A;  2WB1 A;  3LAP A;  4IQ4 A;  2M1B A;  3I53 A;  4I7H A;  4RAG A;  2ZJR F;  4O5V A;  2NNY A;  4C2M J;  4A2U A;  4UUS B;  1A04 A;  1UG0 A;  1LFB A;  2KRH A;  4M71 A;  1A36 A;  3Q0U A;  1IN5 A;  3O6B B;  3CO6 C;  3M3Y J;  1OYY A;  1LEA A;  2LY9 A;  4A5N A;  4JP0 A;  3P5J A;  2IJL A;  1IN6 A;  1FP1 D;  3D5R C;  1FC3 A;  1Y1W J;  1SFX A;  4ZYG A;  2V9P A;  2DA4 A;  3ZMS A;  5FLV A;  1X4P A;  3V8L A;  1T8I A;  1S9H A;  1LJ9 A;  2BOL A;  2DXI A;  5LHG A;  2DW4 A;  2K3P A;  2K85 A;  3HB9 A;  4HAM A;  4I6Z A;  2KKO A;  3OYF A;  2DJI A;  1PYV A;  1TQM A;  4LB6 B;  5E18 F;  2V26 A;  1E3H A;  3A0H C;  4EJO A;  3DU6 A;  3TDU C;  1QZE A;  2O5R A;  5DCM B;  2DI3 A;  3HOY J;  3F8B A;  1AA7 A;  1PP8 F;  3G1L A;  3CO7 C;  1S3J A;  1R00 A;  3ZRG A;  1V5G A;  1HCR A;  2DTR A;  4CSW A;  3I9V 2;  3RKY A;  3RPU A;  1DPR A;  5CYV A;  4LIV A;  3F9K A;  2BY3 A;  4K2E A;  3VPR A;  1OCZ H;  2VBY A;  5E20 A;  5FO5 A;  5J1U A;  3ZMT A;  3KZZ A;  3HOU J;  3LSI A;  3IAM 2;  2CQ7 A;  4FHT A;  2G0E A;  2O8K A;  2LC2 A;  5ED4 A;  1JHF A;  2BW3 A;  4CO8 A;  3MWM A;  1R5I D;  2RRE A;  1Z05 A;  3N4M A;  1WI3 A;  3ZXS A;  1GT0 C;  2ZXW H;  3WTS C;  1K7A A;  3ZMV A;  4LLG F;  4FQG A;  3P9I A;  1PUF B;  3GLL A;  4YEJ A;  3HTU A;  2MAB A;  1F9N A;  2M3A A;  2VJ4 A;  5L3F A;  3JRC A;  3IUO A;  4XRS G;  5D8K B;  2G7H A;  3S2D J;  1F43 A;  3ZP5 A;  3PSI A;  2E71 A;  2LOO A;  2P8T A;  1E3O C;  4HX8 A;  2DOA A;  2CG4 A;  5BNG A;  3SEZ A;  2GM4 A;  1EA3 A;  3ASO H;  2KZV A;  1RIO H;  4HX7 A;  3S2W A;  4PGG A;  3QU6 A;  2XRN A;  4DYQ A;  1YW8 A;  1JGG A;  3GBG A;  1FYL A;  3OYG A;  4LK1 F;  3OY9 A;  3RKX A;  1OCT C;  4KMU X;  3A4C A;  1FBQ A;  5LGT A;  2L9V A;  4ZTJ A;  3EYI A;  2X6W A;  2ETH A;  4D5F A;  2B63 J;  4PJJ A;  4LLL A;  1SMT A;  4XLC A;  1T08 B;  1HXD A;  2HR3 A;  3N05 A;  4O6J A;  4CA0 A;  2IXS A;  2LRE A;  2VQH A;  2JVG A;  2X4H A;  1IW7 F;  3CQZ J;  4M72 A;  3DBL B;  4P96 A;  2W1O A;  3I4P A;  4WWC A;  3CCM I;  1LFU P;  3GTQ J;  1FLI A;  4AVP A;  1APL C;  4BY1 J;  1IUF A;  1IZ1 A;  3AFH A;  4CCL A;  1I6H J;  3FK6 A;  3KP2 A;  4D9J A;  3CME I;  4XN3 A;  2WWY A;  2VLA A;  1BC8 C;  3BG7 A;  1QHH D;  2K7L A;  4RLQ A;  1G3T A;  3NEU A;  4Y4R A;  1HDP A;  1V5E A;  2LF8 A;  2JUG A;  2CJJ A;  4BE0 A;  1BOB A;  2P5V A;  1ZN2 A;  3E5X A;  2F48 A;  4DNC A;  1EH6 A;  4UVC A;  3BCA A;  3FM5 A;  3ASN H;  5M3F J;  1YHQ I;  4I76 A;  5F08 A;  2XSJ C;  1G3Y A;  4OWR B;  1MNE A;  3OSF A;  2OU2 A;  5ICG A;  1SAX A;  3I0T A;  1FWZ A;  4UNO A;  4KNY A;  5GPA A;  1W7P D;  1YQA A;  2FBI A;  2CV2 A;  4YFK F;  3LMM A;  1UCR A;  2XGE A;  2HS5 A;  3CCE I;  5LBQ A;  2Z1D A;  2FX0 A;  4PGH A;  5KAF C;  3HDD A;  1JUS A;  4HLY A;  1J59 A;  2LYC A;  1MBH A;  3H1C A;  2VKV A;  4XKC A;  3FHN A;  2JPB A;  5KHD A;  3ZPL A;  2ICW G;  2FEZ A;  2YR2 A;  1YW9 A;  4UY8 I;  2ZSH B;  2KLO A;  2YPR A;  5CPR B;  5EYR A;  3LSJ A;  2QEX I;  4PJM A;  4EM0 B;  2WTE A;  1JXS A;  3DEU A;  1T56 A;  4XSX F;  3FMS A;  3HOZ J;  4NC8 A;  2XB0 X;  3C18 A;  4OU0 A;  4BQN A;  4A5M A;  1FY7 A;  1TW3 A;  1UZC A;  2VBX A;  2X0L A;  2YX7 A;  3GZ5 A;  3ZMU A;  3ZGK A;  2PMU A;  3RSN A;  4PFP A;  1EF4 A;  2N8G A;  2MLG A;  3BQZ A;  5LFA A;  4QTR A;  2E1N A;  2O8X A;  1TW2 A;  3TQN A;  1AKH B;  4BYY A;  4EJU A;  2JUC A;  5IT3 A;  1I3A A;  5EG0 A;  3R4K A;  3A0B C;  4AYB N;  4CIC A;  2KT0 A;  2VC0 A;  1BC7 C;  1G3S A;  3EDP A;  4H0E A;  2Z9O A;  3WE2 A;  1R1T A;  2A61 A;  2WAD A;  2E1M C;  3KPH A;  1IJW C;  2DJN A;  3OYK A;  1D0Y A;  1WGX A;  4LGW A;  3ABM H;  2HOA A;  1X2M A;  1VF9 A;  4HG2 A;  5HDK A;  2MA3 A;  5LLQ A;  1MJA A;  2STW A;  2RQQ A;  3FXJ A;  1REP C;  4E7I A;  4OOI A;  4OMZ A;  3U1D A;  2DCE A;  2R5Y B;  3Q3S A;  2H1L A;  4HRI A;  3WU1 B;  1QVT A;  1P92 A;  4UVA A;  5F04 A;  1L3L A;  4M6V A;  3EYY A;  3HRT A;  5TRD A;  4A3J J;  1Z6T A;  1RC9 A;  5ICF A;  3TP3 A;  4EM2 A;  1STZ A;  3S1M J;  2D2W A;  1TP4 A;  2XIG A;  1ZR4 A;  2HPI A;  4YII A;  1FTZ A;  2Z3Y A;  3BTJ A;  1DGW Y;  3ULQ B;  1TWA J;  2VKH A;  1LEB A;  5FKM A;  2Z2S B;  4N4O B;  3JRI A;  1J5Y A;  2X85 A;  2ZSI B;  3O2P E;  1ZGA A;  2VB6 A;  4MQV A;  2FD5 A;  5JFR A;  1MMA A;  4HQE A;  4RMN A;  2QWW A;  4KT5 C;  3TOB A;  1OCO H;  5E17 F;  5GPC A;  6PAX A;  2HTJ A;  5TIS C;  1SD6 A;  1K78 A;  4JYK A;  2X1C A;  3N97 A;  4II2 A;  2Q1Z B;  2DFI A;  5M5W J;  4N0B A;  2CQN A;  4P9F A;  4JX5 A;  2A07 F;  3DQV C;  5J8C A;  4KDP A;  2XRO A;  3TKY A;  5LRR A;  1MH4 A;  4IHV A;  2HZT A;  5KCM A;  1WJC A;  3J80 K;  3Q0W A;  5H2F C;  4EM1 A;  2IS1 A;  3SHF A;  2V4J C;  3GTO J;  2PMZ N;  1I6X A;  1MH3 A;  5IT9 K;  3BZ6 A;  5E8I A;  3K4J A;  2R3S A;  4LG0 B;  2LKX A;  4HZF A;  1P7I A;  3C2G A;  4DBQ A;  3OYH A;  2O9L A;  2IA2 A;  4M9Z A;  1EJ9 A;  3P9K A;  1B72 B;  3CC2 I;  3F8C A;  3D5S C;  1TNS A;  4ZYE A;  1MBG A;  1MMG A;  3A03 A;  3P9C A;  4F55 A;  1IXS B;  1R58 A;  1ETQ A;  2QBY A;  3DPU A;  5HLI A;  1H0M A;  3H5N A;  1TWH J;  4XL9 A;  3V7R A;  3FXO A;  1OCR H;  5M3M J;  5LHI A;  2VOP A;  1BA5 A;  4MEY F;  2QSH X;  1WH7 A;  1KYW A;  2PMH A;  4PJL A;  3IRQ A;  3K70 D;  1EKE A;  1NHA A;  2FUG 2;  3X2Q H;  3AG2 H;  2L4A A;  3PQK A;  5LHH A;  3J7A Y;  2G9W A;  2EV5 A;  1AHD P;  1B1B A;  4U0Y A;  4I98 B;  1VFC A;  5EZH A;  1JGS A;  4A6D A;  3SDB A;  3TW7 A;  2DK8 A;  3M9A A;  4MQ9 F;  3TL4 X;  5IP9 J;  1YX5 A;  4QPO A;  4YIF A;  3L2W A;  1H9G A;  4C3I J;  5JLW A;  4OMY A;  2MD5 A;  5D5X B;  1SEU A;  2FOK A;  5GTH C;  4EEF G;  5CKT A;  3TGN A;  3RQI A;  5J4Y A;  3S14 J;  3CJT B;  1K6O A;  5E8G A;  1XMX A;  1LFP A;  1W1W E;  3FWE A;  1F36 A;  3DFG A;  2QSF X;  4Q5S F;  4XIC A;  1N78 A;  3WHC A;  2GQQ A;  4NC6 A;  3ZQI A;  3T8R A;  4EV0 A;  3CUO A;  2HQ5 A;  5ILU A;  2COM A;  4XRS A;  2UV1 A;  5DYM A;  3C7J A;  1T39 A;  3GTG J;  4RB1 A;  3PNV A;  2O3F A;  3CJQ B;  5CQE A;  2HYJ A;  2DA5 A;  1RR8 C;  2JPC A;  2VOO A;  2QEN A;  3SEQ A;  1FMV A;  3DWL E;  3H5A A;  3QRF F;  1IGN A;  3KEO A;  2I8D A;  2JN6 A;  2W84 A;  2X6O A;  3CCY A;  3LQR A;  1B8I A;  4PZJ A;  1SFO J;  4KIG A;  3MFK A;  4A6E A;  3E7L A;  4ENK A;  3Q0V A;  5ILS A;  2A5W A;  2ZXH A;  3K9T A;  2OTL I;  2QQA A;  2YU9 J;  1IO2 A;  2NVX J;  3BR3 A;  4HA8 A;  4IL6 C;  5HOD A;  1O3S A;  3L2V A;  3LA7 A;  3LFU A;  1LDJ A;  3GFM A;  1S7A A;  2JRT A;  3DBH B;  3I5U A;  2FA5 A;  4A3L J;  3G73 A;  2PG4 A;  5EJC A;  2OF7 A;  2X1E A;  4BBR J;  3GME A;  1R1V A;  1W36 D;  4CUG A;  3VOD A;  4DIQ A;  3HL2 A;  1UHW A;  2JA2 A;  2JSC A;  1TC3 C;  3R61 A;  4IJA A;  3BY6 A;  1MNM C;  2R5Z A;  4XRM A;  1TQI A;  1IN8 A;  5B1A H;  2HVS A;  2EZI A;  2CQK A;  2M9H A;  4Y33 A;  1K79 A;  3GTL J;  3KET A;  4E7L A;  1LE8 A;  3JAM K;  3S1R J;  3QP5 A;  1J0R A;  2PEX A;  3RKW A;  2MD0 A;  2ZNZ A;  3DTI A;  2BY1 A;  5J47 A;  2VQG A;  2E2I J;  3LA3 A;  3BZC A;  4I01 A;  3WG7 H;  5GAH J;  4DOZ A;  3B6A A;  3ECH A;  5FB2 A;  3F8M A;  1R1U A;  4IHY A;  4UUS A;  3L2Q A;  2QZ8 A;  2M0M A;  2YS9 A;  5FRN A;  1T0F C;  3K69 A;  4BXF A;  1ON1 A;  4XLE A;  3PNT A;  1WSU A;  1SFK A;  3TBI A;  1QPM A;  1SFE A;  3V8J A;  4XRF A;  2RKH A;  3KP6 A;  1O4X A;  2NVQ J;  3JRA A;  4S0H B;  3GTM J;  2IBD A;  3VB2 A;  1U5T C;  4KN7 X;  1LDK B;  1T0F A;  3H3V K;  2HEO A;  5FLX K;  3PFI A;  2ZCW A;  2Y2Z A;  4LFU A;  2L7M P;  1BOA A;  2HOS A;  3ZN1 A;  2Z5U A;  3SYT A;  5AIQ A;  2RDP A;  1U5T A;  2A68 F;  4CXF A;  2X1D A;  5DCM A;  2EK5 A;  1ZGJ A;  3E5Q A;  4HSR A;  2NS8 A;  5JHF A;  3KP7 A;  3L9F A;  3CJN A;  3JCU C;  1XSD A;  1ETY A;  2NVU B;  1OCC H;  4KIB A;  1UMQ A;  1Z77 A;  4NUB A;  3GX4 X;  3J7A O;  3DEE A;  2L5Q A;  3F72 A;  2CUZ A;  2FXA A;  3DCF A;  2EQR A;  3HKZ N;  3S32 A;  5CJ9 A;  1ZRF A;  2VON A;  3I3L A;  3JTH A;  5L3G A;  2EFW A;  1P9Q C;  2AO9 A;  1VQ7 I;  4NBQ A;  4XR6 A;  1WPK A;  1OR7 A;  4ZTF A;  4BNC A;  2FBK A;  3G2B A;  2L7F P;  3AG3 H;  2QUF A;  3M8E A;  3REO A;  2ELK A;  1OFC X;  2AQE A;  3QPS A;  3COA C;  1PUF A;  2MW8 A;  5IOZ A;  5JVG F;  2P7V B;  3K4M A;  2XSD C;  3OYL A;  2UXX A;  3I71 A;  2BE5 F;  3S93 A;  3V7C A;  1MW7 A;  1QBJ A;  1Y56 A;  1MMN A;  2GXB A;  4MFE A;  3I56 I;  1Z91 A;  4L9J A;  1IXR C;  2I10 A;  3OMY A;  1YIT I;  3TO9 A;  4OAZ A;  1O7F A;  2OBP A;  4ZZL A;  2PMZ A;  3JRG A;  2TRT A;  2G7U A;  1G59 A;  3RYP A;  2DTZ A;  2P5K A;  5IP7 J;  3BDD A;  2HI3 A;  1U6G A;  2CYY A;  2CO5 A;  3CCJ I;  1OQY A;  1XSX A;  1BIA A;  3CLO A;  3M07 A;  3LSP A;  1MSF C;  1FNN A;  1TLH B;  4FX4 A;  1S8N A;  3E6D A;  2RGV A;  5AIP A;  1QVU A;  2EV6 A;  1FOX A;  4KT6 A;  3RIR A;  2CUJ A;  2OD5 A;  2H09 A;  3ZQH A;  2JT1 A;  4BS9 A;  2DLL A;  3OOU A;  5FRO A;  4CHU A;  1QNT A;  2QQ8 A;  3NQO A;  1BW5 A;  1ETW A;  1HBX G;  4NNJ A;  1DP7 P;  3SFZ A;  1VQN I;  3PM1 A;  2DA2 A;  2WA0 A;  3KIO A;  4L5E A;  3HHH A;  4DW6 A;  5M5X J;  3PUF A;  4L9V A;  2OCE A;  1WJE A;  2EFP A;  5KK1 A;  4EJW A;  2E1C A;  1W0U A;  3KX2 A;  3M8F A;  3W2V A;  1HW2 A;  3CDL A;  1B9N A;  4IQJ A;  3ZMD A;  1XCV A;  2K9N A;  1RES A;  3FIS A;  2NOG A;  4O3M A;  2W82 A;  3FXR A;  1S72 I;  2DN0 A;  3WU2 C;  2LG4 A;  1HKQ A;  3ZMZ A;  2LVS A;  4HNU A;  4BHC A;  2Q0O A;  1P6R A;  4EMS A;  3VYS B;  4HNV A;  4B47 A;  3SZP A;  3TOA A;  3TP0 A;  2DMP A;  2DYR H;  3LFK A;  1HDD C;  3CP8 A;  5FKN A;  3CMA I;  1ZG5 A;  2W48 A;  1YTY A;  2E36 A;  3H0G J;  3IH3 A;  4MIM A;  3HOV J;  1I50 J;  3DV8 A;  3KEY A;  2OQG A;  1NK2 P;  2X48 A;  2DMU A;  1JTY A;  3HG9 A;  3J81 Z;  2L3D A;  2KIU A;  5H20 A;  1D8K A;  2VAS A;  2XKP A;  5DD8 A;  3ERE D;  2M8G X;  4ENM A;  3I54 A;  1HLV A;  1DGR M;  2DA1 A;  1BM9 A;  2W00 A;  3CMY A;  1GV2 A;  4AIJ A;  3J7Y J;  2MLK A;  3BR5 A;  1UB9 A;  1H9T A;  4IHS A;  4MLO A;  2GXG A;  3IRR A;  3OYN A;  3MN2 A;  4GYG A;  3S8P A;  3V42 A;  3DF8 A;  4MFD A;  3BOQ A;  2ID6 A;  1DP3 A;  2FNA A;  2E35 A;  5HNH A;  4I99 C;  1RRJ A;  1FBU A;  2R0Q C;  2E1O A;  1FPQ A;  1TWC J;  2Z16 A;  4NQW A;  2Y69 H;  3S3O A;  5HLG A;  1RUN A;  1UAA A;  2EIN H;  4KA4 A;  4JX6 A;  2DT5 A;  2QGU A;  3GLX A;  3HC7 A;  4HV5 A;  4XLN F;  1DPU A;  1Z0X A;  4GCV A;  1ZRD A;  4BXX J;  4GFB A;  1ZH5 A;  1AKH A;  3JTG A;  2OA4 A;  4G8X A;  5JHU A;  1TL8 A;  1S7E A;  1BI2 A;  2QLZ A;  1QRY A;  2VXD A;  2FOW A;  2R7D A;  3E0J B;  4UUV A;  3MQ0 A;  1BR4 A;  4JOM A;  1W5C C;  4HW0 A;  4LK0 F;  5IPA A;  2O61 A;  2LNB A;  2ZME C;  3GZN B;  3CUQ B;  2DFH A;  3KZY A;  3HZJ A;  4U88 A;  1X3W B;  2CQX A;  1TBX A;  4BL0 B;  4XID A;  2VPL A;  3VYU B;  2LH9 A;  2FE3 A;  3SJM A;  4G7H F;  3MZ8 A;  4GRI A;  1O3Q A;  3F8F A;  3OV8 A;  1VI0 A;  2H8W A;  2K9S A;  2KZG A;  2A6T A;  1MND A;  1Y8Q B;  1XB4 A;  4CCM A;  2IA1 A;  2ZME A;  1W7P B;  2O6G E;  2QKM B;  1HW1 A;  1WVR A;  3ONQ A;  3RCO A;  4XN0 A;  1IN4 A;  3CF5 F;  5EZG A;  4AIH A;  5J4V A;  5FRM A;  5DS9 A;  3AG4 H;  3PO2 J;  5FLM J;  2NS7 A;  4EVI A;  4BHB A;  3WHB A;  1JE8 A;  3TO6 A;  2XV4 S;  5IYD J;  1W4M A;  2FML A;  5H6Q A;  4IRI A;  1T38 A;  1X1C A;  3IL2 A;  1TWF J;  2CW0 F;  5LEJ A;  4N9I A;  4BQA A;  4TV7 A;  3QYF A;  3ABU A;  1X19 A;  1BI1 A;  3HSR A;  2DPD A;  4X6A J;  2JTV A;  2IA0 A;  4F3Q A;  2AXL A;  1AOY A;  4RB0 A;  1JI8 A;  1X58 A;  4E7H A;  1Z3X A;  5FJ8 J;  3ABT A;  2YSR A;  1I39 A;  4YG2 F;  2D45 A;  2UUZ A;  2BEO A;  3KEQ A;  4RB2 C;  3CCV I;  1T98 A;  2R4G A;  1VQK I;  2DT6 A;  3IKV A;  5EF6 A;  3FKI J;  3CF2 A;  2NVT J;  2RC4 A;  1Z7U A;  3U1K A;  3DKY A;  4LIT A;  1VTN C;  1IN7 A;  2CW8 A;  3K4B A;  1FT9 A;  4DZJ A;  4ESB A;  1WJD A;  2F4O B;  2P81 A;  3K2Z A;  2RQP A;  1GV5 A;  2M2E A;  1MJB A;  2Q2E B;  3FIW A;  3OYI A;  3T8T A;  3JRE A;  1P4X A;  5J3L A;  2LLK A;  3KE2 A;  2XB5 A;  1H8A C;  4LG0 A;  1DDN A;  1VQ5 I;  3OL4 A;  5DV5 A;  1Z3Y A;  1R7J A;  2V1D A;  4BAC A;  1B72 A;  3CCU I;  1FYM A;  1POG A;  3HSF A;  2FBH A;  1WJF A;  2P7C B;  3ZOB A;  2K9L A;  4LD5 A;  3JRH A;  2ID3 A;  2LDU A;  1WCM J;  3VEP A;  2E5N A;  1D1A A;  3SFI A;  3S1Q J;  1VQ6 I;  1HF0 A;  1RR7 A;  2XF6 A;  4J19 A;  2J5O A;  2FQ3 A;  1Z21 A;  1Z67 A;  4IRH A;  4RGS A;  5F6F A;  1YJW I;  4AIK A;  1EH7 A;  2ELJ A;  1QU3 A;  3HPG A;  4MO7 A;  4G9Y A;  5D4S A;  5E79 C;  2XPV A;  4KYW A;  1RET A;  3J7Z I;  1ZHF A;  4GGG A;  3GFL A;  5L3E A;  3FXU A;  5K5Q A;  5BOX A;  2VN2 A;  1DQU A;  3J81 K;  4G94 A;  4S05 A;  5ICC A;  2DFF A;  3E3V A;  3F23 A;  4M6Y A;  1Y0N A;  1JJ6 C;  3HSE A;  3EQL F;  2DAO A;  1MD0 A;  3OIP A;  2L9S A;  3ABK H;  5AON A;  1IRZ A;  3H5R A;  2PJR B;  2F2E A;  3PFY A;  2IT0 A;  3K6G A;  1SVO A;  2AQF A;  3SQN A;  1U2W A;  4C2T A;  2WV0 A;  3UKG A;  3R6S A;  3IKT A;  1L0O C;  4D0P A;  1ZYR F;  2HKO A;  3F21 A;  3BR6 A;  2F5C A;  4F91 B;  5LD2 C;  2STT A;  2VKD A;  4IVN A;  2PBI A;  3RI4 A;  2L9N A;  4OIR F;  3QQA A;  3UR3 C;  4FAS D;  3QP6 A;  2MSY A;  3P7N A;  2V9K A;  2L7K A;  2D1V A;  1KYZ A;  2Y9Z A;  1QGP A;  1RKT A;  3GZ6 A;  3LWF A;  1K4S A;  2EH3 A;  5IOY A;  4B43 A;  3I64 A;  4XMY A;  1MDM B;  3D5L A;  1LUJ B;  1Y0U A;  1OIS A;  3VSK A;  1A5J A;  2OJE D;  2BHZ A;  3WU0 A;  4C3H J;  4ESF A;  1MJ9 A;  1ZRE A;  1JTX A;  1P7J A;  2WAQ N;  5E3L A;  4E7S A;  3EUK L;  3C2H A;  3PIO F;  3FZV A;  3WTV C;  2BHY A;  1FIA A;  1R5G A;  4YFN F;  2VOD A;  3PSF A;  3OYB A;  1WJA A;  4QLC U;  1B6A A;  3H35 A;  1O7L A;  4E4H A;  1GDT A;  3FM3 A;  5EEA A;  4RBO A;  1A31 A;  4RB3 C;  3FX3 A;  1DUX C;  4B3X A;  2XKO A;  1KA8 A;  5D8L B;  2B9S A;  2H1K A;  1RUO A;  1TTY A;  1JUP A;  2D1H A;  2JA5 J;  1S5L C;  2X6X A;  1YJN I;  1BBY A;  2XGX A;  1QZY A;  3WTU C;  1PP7 U;  4NHJ A;  3H9J A;  2XGC A;  1FIP A;  3ML6 A;  2XPU A;  1VZ0 A;  1HSJ A;  3A01 B;  2IS2 A;  1HOM A;  2HQN A;  3GF2 A;  2ISY A;  3DXJ F;  4UXN A;  1JKO C;  1OLT A;  1SVM A;  5E3M A;  3RPU D;  2F5E A;  4IRG A;  1QO0 D;  1MBK A;  2DU9 A;  5F0C A;  4M74 A;  2BBY A;  2R7X A;  3CCL I;  1TT5 B;  1P2F A;  3WGH A;  4BKX A;  3GTP J;  4HF1 A;  4D5C A;  4IKF A;  4A93 J;  3LSG A;  3BG3 A;  2EZL A;  2QA4 I;  2ESN A;  4J01 A;  3S15 J;  1WJ5 A;  4IXA A;  4AC0 A;  1D8J A;  3G3Z A;  2ME6 A;  1A35 A;  4OIP F;  3E1S A;  4IF4 A;  2IEK A;  2IP2 A;  2VC1 A;  4A3I J;  4JBA A;  3HPH A;  3AL0 B;  1KQ8 A;  3EUA A;  2X6Y A;  3IP4 B;  2MH9 A;  5A2Q Z;  4G6Q A;  4PFO A;  1E2X A;  4IZZ A;  2GIZ A;  3K4L A;  1P4A A;  4DZP A;  3LQQ A;  2JA7 J;  2UWM A;  1AU7 A;  2CU7 A;  2Z99 A;  3BPV A;  3HEF A;  3WG9 A;  3HOS A;  3DPL C;  3F8N A;  2V1U A;  1Z6R A;  5J8F A;  2DO7 A;  2JVH A;  5BQT A;  4XBF A;  1X3U A;  3HTS B;  4HNT A;  3W6K B;  3U21 A;  2NNN A;  4BQO A;  5FGM A;  4QWQ A;  3ZN0 A;  1D1C A;  1C0W A;  1R36 A;  3MZH A;  3K0L A;  3HRS A;  4IX7 A;  2R7U A;  3QYE A;  2MYS A;  2M0C A;  1GXP A;  2QQB A;  3FXL A;  3O8H A;  2JA8 J;  3K1N A;  3ZR8 X;  4KIC A;  1RPW A;  4ZYA A;  2W57 A;  1FZP B;  2WB1 N;  2HDC A;  5F1R A;  3WOD F;  2H8R A;  1YO5 C;  4EJT A;  2A3S A;  2HXO A;  3L2U A;  4EAT A;  3BG9 A;  4HPQ A;  3BT9 A;  1MMD A;  4W1U A;  1WH5 A;  2EWN A;  2ELH A;  1V55 H;  1ZAO A;  2LBF B;  1F5T A;  2KDZ A;  3R0J A;  2K9M A;  2ZXJ A;  5CVI A;  1Z7L A;  1F1Z A;  2CS3 A;  2YX4 A;  2KRC A;  1IDZ A;  2FF4 A;  2O7O A;  3BZK A;  4A0X A;  3TED A;  2CUF A;  3QPL A;  3MAJ A;  4CYC B;  3WTZ A;  3DLL F;  4KIS A;  5E3N A;  4KMF A;  1FTT A;  4BAY A;  2CWE A;  1ZTR A;  1XGN A;  4OIQ F;  1G3W A;  1IRF A;  1V3F A;  2M4G A;  3GTJ J;  1G6N A;  4G7O F;  3RZO J;  1BR1 A;  4BJ5 C;  3F6O A;  4BHP A;  2HGC A;  3K2A A;  5K7F A;  3SDG A;  3BC8 A;  1U9O A;  2FSW A;  4P1W A;  1ODD A;  5K1Y A;  2EFO A;  4CDG A;  4AUX A;  4ZZD A;  5JLX A;  2UZK A;  2HQA A;  4AVZ A;  5FFX A;  1WZ2 A;  1SAU A;  2ZB9 A;  2XGD A;  2EIM H;  2DQR A;  3VYR B;  3FK7 A;  4L9N A;  3U2R A;  3HGG A;  4ZYD A;  1FBS A;  4G7Z F;  4KIT B;  2W4S A;  3FMR A;  4BE1 A;  5D5U B;  2GIV A;  3DKX A;  4LJZ F;  2HKX A;  2XAQ A;  1O3R A;  3BQY A;  4QSH A;  2IGO A;  3QU3 A;  4KIF A;  1YRN B;  4PUS A;  5D5W B;  2PQ8 A;  2QM3 A;  2ZFU A;  3M1E A;  4UVB A;  5D4R A;  4MEX F;  2KFD A;  2A05 A;  1QZZ A;  2KP6 A;  5DTD A;  4ENN A;  1Y8R B;  5FKO A;  2HOT A;  2CUE A;  2Q8K A;  3GUD A;  2R7R A;  1MMS A;  1O57 A;  1XMA A;  4C2U A;  2MBF A;  1FSE A;  2EIK H;  3ESW B;  2AXT C;  5LEK A;  4IOC F;  3I4M J;  1WQ2 A;  2XF7 A;  1NK3 P;  1D5Y A;  2LF7 A;  3HYI A;  2HPM A;  4HV6 A;  2F4M B;  2JZY A;  1W0T A;  2AS5 F;  3KYD B;  4BEH B;  3NAU A;  4XLF A;  4FCY A;  3VDX A;  1UFM A;  2OC6 A;  4RAZ A;  3LAJ A;  4A3B J;  1SMY F;  3RZD J;  1NH3 A;  4NB5 A;  1I1S A;  2K9Q A;  3QYB A;  3KYC B;  1XGS A;  3OIQ A;  4JX4 A;  3K4N A;  5GP9 A;  3GFI A;  3K7A J;  4WXH A;  5LRS A;  2F6C A;  2LK2 A;  1VQO I;  5TJJ A;  3HBL A;  2VIX A;  4AYB A;  3U9G A;  4RDU A;  1BJZ A;  4RGU A;  4B4C A;  2DDA A;  4R1H A;  1FOK A;  4DYC A;  1GVJ A;  2V6C A;  1MGT A;  4NDL A;  1VQ4 I;  1IF1 A;  1G8X A;  1KU2 A;  2EB7 A;  5ERI A;  2KPM A;  4LMY A;  4G6D A;  2H6C A;  3BTL A;  2LRD A;  3H3Z A;  2JSP A;  1V54 H;  2BXZ A;  1LNW A;  2V1X A;  2VBZ A;  3B73 A;  4ENJ A;  2GBY A;  2DDB A;  1SD7 A;  1WHU A;  5DUI A;  2OCC H;  1MIJ A;  1XGO A;  2GA1 A;  2WY8 Q;  5LGN A;  5A2Q K;  5GAD J;  4A0Z A;  2V6E A;  5BPD A;  1SC7 A;  2HYF A;  1O3T A;  2H27 A;  3CUQ C;  3BG6 A;  1I3Q J;  2BXY A;  2WAQ A;  3OR2 C;  3ZQQ A;  5IYC J;  4X0G A;  1VQL I;  2LP0 A;  5JVT A;  1LVK A;  3CDI A;  3H9Q A;  2XRL A;  4PJ0 C;  1LKX A;  2K4J A;  2ESH A;  2HU9 A;  2JA6 J;  3CD6 I;  2O0Y A;  1IRX A;  3SXY A;  2V79 A;  2HVQ A;  1MBF A;  4M73 A;  5K7H A;  2H94 A;  1KQ9 A;  3CUQ A;  1BW6 A;  1X4O A;  4WF2 A;  4M3D A;  3V4G A;  2B0L A;  3W6V A;  2Z33 A;  4LIU A;  4L5J A;  1HQC A;  1X1B A;  4U7B A;  4PDK A;  1E3P A;  3DPT A;  1K61 A;  5GAG J;  4Y7N J;  3HUG B;  3GYH X;  1XDS A;  3A02 A;  1TQP A;  3BJ6 A;  2LY2 A;  4GXO A;  3OYE A;  3KP3 A;  1Z9C A;  2VQL A;  4FE4 A;  3OIO A;  4ETS A;  1U8B A;  3CC4 I;  5FD5 A;  1UST A;  1B59 A;  1W7P A;  2L4M A;  2Y0S N;  3QOE A;  1I5Z A;  2YU3 A;  2K27 A;  4ANJ A;  2ZJP F;  1AWC A;  2IS6 A;  3W2W A;  1A6Q A;  3F6V A;  3H3U A;  4ZC3 A;  3O3K A;  2LSO A;  2XHK A;  3JSO A;  4FT8 A;  3IWF A;  5FD6 A;  2KRF A;  2XUB A;  2FQ4 A;  4D1Q A;  1JHH A;  1V5F A;  2P4W A;  2EIL H;  2LD5 A;  5FKK A;  4HF2 A;  1QA6 A;  3E6B A;  2M8E A;  3PIP F;  4IOA F;  2XDV A;  5IP6 A;  3PUB A;  1BL0 A;  2NRA C;  2W25 A;  2IGN A;  4BUP A;  1T33 A;  2EA4 A;  3QPT A;  4R79 A;  3F3X A;  1GXQ A;  2QVO A;  3VFZ A;  1D3Y A;  4G6T B;  2KDO A;  2IPQ X;  2LKP A;  1JT0 A;  3G1M A;  2A6E F;  3A1Y A;  1KON A;  5ILV A;  5D5V B;  5E1X A;  1GVD A;  2NVY J;  4HYE A;  3LSH A;  2ZBK A;  2OPT A;  2L7Z A;  1ENH A;  3JSP A;  1U8R A;  2F5F A;  1UHM A;  3NWS A;  5CLS A;  3IC7 A;  2EZK A;  1D0X A;  4BDY A;  4RGX A;  2R7Q A;  1MZB A;  2JJ7 A;  3I55 I;  3B6C A;  1QHG A;  2MC3 A;  3IWZ A;  4DYR A;  2OZ6 A;  3ZQG A;  3AAF A;  1USS A;  4MGR A;  3HOW J;  1CGP A;  1ZQ3 P;  4CH7 A;  2HTS A;  4UV8 A;  4HST A;  5CVU A;  2XAS A;  1UG2 A;  5B1B H;  4RLF A;  3QWL A;  2NYX A;  2X9D A;  4FTH A;  3BTC A;  2C6Y A;  3H0D A;  2W7N A;  1ZLJ A;  4PSW A;  4V2G A;  2R7S A;  2VT2 A;  4CZZ A;  4J00 A;  2E34 A;  3S3M A;  2EPF A;  5H6R A;  2ECC A;  3PJR A;  2OZU A;  3IHU A;  3DP7 A;  3G4S I;  2LFB A;  1ETO A;  3EUH C;  5HDG A;  2DK5 A;  5KAI C;  1OMI A;  2W24 A;  2MGQ A;  4L9T A;  3HXL A;  2ADU A;  4W97 A;  5CQG A;  4B8X A;  2OV7 A;  4F93 B;  3QOD A;  1BIB A;  5LGU A;  3ERM A;  2PJP A;  5JR3 A;  1DU0 A;  2NAZ A;  3EUH A;  5J40 A;  1IG7 A;  1OYI A;  1YW7 A;  1DU6 A;  2LMD A;  2XF5 A;  3GO5 A;  3I59 B;  3JRF A;  1QQI A;  2E60 A;  4E6K G;  1LB2 A;  2PJR A;  4NC7 A;  5FFZ A;  2P6T A;  2DA6 A;  1ZRC A;  3O8G A;  1OPC A;  1U5T B;  2LKS A;  2VE8 A;  4CYD A;  4D7M A;  1FX7 A;  1Y39 A;  1MSE C;  4Y52 J;  2KQR A;  1K83 J;  3OS0 A;  3F0C A;  2VE9 A;  4B48 A;  1R49 A;  2HWV A;  3EPZ A;  4I02 A;  4L5I A;  2ZO4 A;  2Y75 A;  3IAS 2;  2CFX A;  2XVC A;  3L1P A;  1XX5 A;  3CCQ I;  3TDZ C;  2AHQ A;  2M30 A;  5DM6 F;  5ICE A;  5EEH A;  3RPQ A;  4Q4Z F;  4IO9 F;  2NS0 A;  2R5Y A;  1MDM A;  1ZK8 A;  2ZKZ A;  3S2H J;  3OWT A;  1RI7 A;  3NAR A;  3K70 C;  2K02 A;  4ZDL A;  4CCN A;  1U78 A;  2MFZ A;  4LLN A;  1ORK A;  4EQQ A;  1KU3 A;  1KQ0 A;  5GAE J;  1CF7 B;  3NRV A;  1WJB A;  4UHT A;  1IUY A;  5KNL A;  2EA2 A;  4QPQ A;  3HHG A;  3OS1 A;  3V7S A;  2BVL A;  3I58 A;  4RAF A;  5F0H A;  1KU7 A;  2VPR A;  1XPX A;  2E19 A;  4IPA A;  1K4T A;  1YYV A;  1YFH A;  4F7Z A;  1YIO A;  1T6S A;  2KHM A;  4XKV A;  2WY7 Q;  1TNT A;  1VQP I;  1ITY A;  1XSV A;  1IC8 A;  1PJR A;  2PN6 A;  4PK4 A;  3H36 A;  1R22 A;  3ECO A;  2GAU A;  3GW2 A;  4U7D A;  4ESJ A;  2HZD A;  3FXM A;  3BP8 A;  4HDU A;  2V7F A;  4KJZ A;  3OYJ A;  4CGZ A;  2ZXI A;  1K6Y A;  3CMM A;  4WK8 F;  3CJR B;  2BV6 A;  4BXU A;  2GLO A;  3MZY A;  3J80 Z;  2ME0 A;  4A3E J;  3LA2 A;  3DLA A;  3OL3 A;  1D5V A;  1S29 A;  4EGY A;  3A01 A;  2P5L C;  5HS9 A;  1YS6 A;  2M7B A;  3I4N J;  1SAN A;  2MH2 A;  4XOR A;  5IT9 Z;  3ZCO A;  1HW5 A;  1E17 A;  5EEG A;  2NXN B;  3HM5 A;  4XLP F;  5EGO B;  3QOP A;  2IGM A;  2QYO A;  3M7G A;  3RKQ A;  2HDW A;  2Y9Y A;  4B1R A;  2M87 A;  5DM7 F;  3BG5 A;  4C9Y A;  3RDI A;  3AL0 C;  2A5Y B;  3GXO A;  3LSM A;  1RZ4 A;  3L00 A;  4LB5 A;  1X3Z B;  1XN7 A;  3BPX A;  3WGG A;  2L9R A;  1ZKG A;  3HKZ A;  2R7V A;  4CZC A;  3HOX J;  4U87 A;  4E7K A;  2KJC A;  3FF5 A;  2VJI A;  2EV0 A;  4Y17 A;  2J5P A;  4L18 B;  2K40 A;  1WRJ A;  4MTD A;  4IHX A;  2DOE A;  1J2X A;  1SD5 A;  4BDZ A;  2DOF A;  1PVE A;  2A69 F;  2GZW A;  2L2O A;  4ABZ A;  2ECB A;  1W36 C;  1H88 C;  3OYD A;  4RS8 A;  3RJP A;  2RN7 A;  2DMT A;  2DOD A;  3S16 J;  3TO7 A;  2M7A A;  2QF7 A;  1IAW A;  2ISZ A;  1YS7 A;  4Y13 A;  2HXI A;  3DEW A;  1IDY A;  2GWR A;  1J9I A;  2LR8 A;  4WXD A;  2FMY A;  4KN4 X;  2BZT A;  2Y0S A;  1WFX A;  3DTE A;  5BPI A;  3K10 A;  4EJV A;  4ITV A;  1OYW A;  1ZG3 A;  1OKR A;  1BI3 A;  3T0Y A;  2KJB A;  1FP2 A;  2R7W A;  2HFH A;  4L0Z B;  4B44 A;  4RGR A;  2BVM A;  2KIM A;  3MKL A;  3M4O J;  1A6I A;  4RM2 A;  1N25 A;  2VT3 A;  1Y6I A;  4XM3 A;  1JJ8 C;  1HKT A;  1M1E B;  3WTY C;  2L02 A;  4ZDP A;  4FET A;  3T1B A;  2HQR A;  1J75 A;  3FBI B;  1YE9 A;  2F5V A;  4V19 K;  2W85 A;  3KFW X;  1Z1D A;  2FJ1 A;  4B3A A;  1SD4 A;  3CTA A;  1WKM A;  4UB8 C;  5DUK A;  2CMP A;  2XAH A;  2L0K A;  4NQW B;  1UJ8 A;  3E6C C;  3DKW A;  3GCM A;  2LBF A;  2CFO A;  2WC2 A;  1E0E A;  1D0Z A;  2RV8 A;  4M3F A;  1N75 A;  2RVC A;  4XLH A;  4IHT A;  1HC8 A;  3K1P A;  3CCR I;  2EFQ A;  5JI6 A;  4CYC A;  4N4N B;  1ZEL A;  3M8J A;  3JRD A;  4EGZ A;  2PI0 A;  2BW3 B;  2TDX A;  3FKJ A;  3D0S A;  3FXK A;  3K1M A;  4B09 A;  1CQT A;  1I1G A;  3T5X A;  4DGW B;  5K5R A;  2YUS A;  1Y1V J;  3LSK A;  3MEX A;  1JUM A;  2A6H F;  3CP2 A;  2CRG A;  1ZG1 A; 
#chains in the Genus database with same CATH homology
 5K7F A;  1ZGW A;  3SDG A;  1E3O C;  3JRG A;  1U9O A;  2TRT A;  5BNG A;  2GM4 A;  4AUX A;  5JLX A;  2DTZ A;  5IP7 J;  2HI3 A;  2COB A;  2ZB9 A;  3C2B A;  2XGD A;  4DYQ A;  1JGG A;  1ZR2 A;  3LSP A;  1MSF C;  3ZQL A;  3GBG A;  3FK7 A;  3HGG A;  1OCT C;  1QVU A;  2CQQ A;  4D5F A;  1YRN A;  4A3F J;  3HGY A;  2B63 J;  3BQY A;  3G1O A;  4QSH A;  3ZQH A;  3OSG A;  4D7N A;  2Y31 A;  3OOU A;  1YRN B;  2VKE A;  3S1N J;  1BW5 A;  1ETW A;  3CQZ J;  1ETV A;  5C4J J;  2IAI A;  3PM1 A;  2R7Z J;  2DA2 A;  4G12 A;  5DTD A;  5FKO A;  2HOT A;  4L5E A;  1LFU P;  4DW6 A;  5M5X J;  2CUE A;  1APL C;  4BY1 J;  3GTQ J;  1IUF A;  2QCO A;  2R93 J;  1W0U A;  4V2F A;  1I6H J;  3CDL A;  2VUM J;  2K9N A;  1RES A;  2Y30 A;  5IYB J;  3FK6 A;  3FIS A;  2NOG A;  1UHS A;  2DN0 A;  3I4M J;  1NK3 P;  1ETK A;  1D5Y A;  9ANT A;  1W0T A;  5C3E J;  2DA3 A;  2LVS A;  1HDP A;  3NAU A;  4FCY A;  5C44 J;  4HNV A;  2CJJ A;  4A3B J;  3BR0 A;  3BR1 A;  2DMQ A;  3TP0 A;  3RZD J;  5M3F J;  2DMP A;  2K9Q A;  1JKQ C;  1HDD C;  4I76 A;  4JX4 A;  5FKN A;  5F08 A;  2W48 A;  3H0G J;  3OSF A;  3IH3 A;  4MIM A;  5GP9 A;  3HOV J;  1I50 J;  3K7A J;  4M3B A;  3ZQF A;  3GTK J;  2LK2 A;  1NK2 P;  2X48 A;  3HBL A;  2E2J J;  4FIS A;  2DMU A;  1JTY A;  5GPA A;  4RDU A;  1BJZ A;  4B4C A;  4DYC A;  2XGE A;  2M8G X;  2DMN A;  1HLV A;  1FJL A;  4NDL A;  5EDN A;  2D5V A;  2DA1 A;  2FX0 A;  3CMY A;  1GV2 A;  2EBI A;  4M3G A;  1JUS A;  3HDD A;  1MBH A;  2VKV A;  3BR5 A;  3BR2 A;  3BTL A;  4MLO A;  3MN2 A;  4MFD A;  2GBY A;  2ID6 A;  5FKL A;  5EYR A;  3LSJ A;  1JKR C;  2R0Q C;  1T56 A;  2E1O A;  1TWC J;  3HOZ J;  1I3Q J;  5IYC J;  2HDD A;  2XB0 X;  2LP0 A;  2XRL A;  4JX6 A;  1Z0X A;  5E3O A;  4BXX J;  4GFB A;  1JT6 A;  1AKH A;  2JA6 J;  1EF4 A;  2N8G A;  1S7E A;  1MBF A;  3BQZ A;  5K7H A;  1QRY A;  4QTR A;  1BW6 A;  3W6V A;  1TWG J;  1AKH B;  4M3D A;  5IPA A;  5EG0 A;  2CQX A;  1K61 A;  4AYB N;  4Y7N J;  2JWT A;  2KT0 A;  4XID A;  3SJM A;  3A02 A;  5EG0 B;  2VI6 A;  1IJW C;  2DJN A;  1VI0 A;  4FE4 A;  1WGX A;  2K9S A;  3OIO A;  1U8B A;  2HOA A;  1X2M A;  1VF9 A;  2Y0S N;  5J1R A;  2R5Y B;  3Q3S A;  2FQ4 A;  5F27 A;  2LD5 A;  5FKK A;  1QVT A;  5F04 A;  5EZG A;  4M6V A;  5DS9 A;  3PO2 J;  4IHW A;  5IP6 A;  5FLM J;  1BL0 A;  2NS7 A;  4A3J J;  3WHB A;  3TP3 A;  5IYD J;  3S1M J;  1T33 A;  3JRB A;  1ZR4 A;  4M3E A;  1FTZ A;  3BTJ A;  3MVP A;  1TWA J;  1TWF J;  5FKM A;  3IV5 A;  3JRI A;  4BY7 J;  2FD5 A;  1JT0 A;  3G1M A;  4X6A J;  1GVD A;  2NVY J;  1R9T J;  5GPC A;  1X58 A;  5FJ8 J;  4JYK A;  2OPT A;  2L7Z A;  1ENH A;  2WV1 A;  4X1E A;  5EF6 A;  3FKI J;  5M5W J;  4UUT A;  2NVT J;  4JX5 A;  2EZK A;  5F0F A;  1MH4 A;  4IHV A;  2JJ7 A;  4DZJ A;  1U9N A;  2P81 A;  3B6C A;  2E2H J;  1GV5 A;  3Q0W A;  2M34 A;  2M2E A;  4DYR A;  4BBS J;  3ZQG A;  3FIW A;  4QIW N;  3GTO J;  2PMZ N;  3JRE A;  1MH3 A;  5J3L A;  3HOW J;  2LLK A;  5M5Y J;  2XB5 A;  1JKP C;  1H8A C;  1ZQ3 P;  3LOC A;  1B72 A;  2LKX A;  1UG2 A;  1OCP A;  1POG A;  1P7I A;  1FEX A;  2O9L A;  1B72 B;  2X9D A;  4FTH A;  3BTC A;  3IH2 A;  3ZOB A;  3LSR A;  4V2G A;  1MBG A;  3JRH A;  2ID3 A;  3A03 A;  1WCM J;  3SFI A;  3S1Q J;  1GUU A;  1HF0 A;  1RR7 A;  2MG4 A;  2ECC A;  4J19 A;  1ETQ A;  3BTI A;  1MBJ A;  2JK3 A;  2LFB A;  1ETO A;  1TWH J;  5M3M J;  4MO7 A;  2JMW A;  2MGQ A;  2RAE A;  4W97 A;  2XPV A;  1BA5 A;  2LTP A;  1WH7 A;  1RET A;  1DU0 A;  1Q1V A;  2DA7 A;  1AHD P;  1VFC A;  2R92 J;  5EZH A;  1IG7 A;  1DU6 A;  3TW7 A;  3JRF A;  1JJ6 C;  5IP9 J;  2DA6 A;  3O8G A;  1IRZ A;  1IV6 A;  4D7M A;  3IH4 A;  4C3I J;  5JLW A;  4Y52 J;  1MSE C;  4EEF G;  1K83 J;  1XC5 A;  3F0C A;  3RQI A;  3S14 J;  4A3D J;  3UKG A;  1F36 A;  1VND A;  3L1P A;  3S17 J;  4FE7 A;  3BR6 A;  4XIC A;  3WHC A;  4IEJ A;  3ZQI A;  1MBE A;  2AHQ A;  1NTC A;  2HQ5 A;  1RKW A;  4XRS A;  3QQA A;  2MSY A;  5F1J A;  2R5Y A;  3GTG J;  4A3K J;  1ZK8 A;  3ZQC A;  2Y9Z A;  3S2H J;  1RKT A;  3D1N I;  3NAR A;  2EH3 A;  5IOY A;  3PO3 J;  2HYJ A;  2DA5 A;  1XG1 A;  1U78 A;  4A3C J;  1G2H A;  1IGN A;  1QPI A;  1A5J A;  1ORK A;  2JN6 A;  2X6O A;  3CCY A;  4C3H J;  1B8I A;  1H89 C;  5J1Y A;  1SFO J;  1B8I B;  1JTX A;  5K7Z A;  1P7J A;  3E7L A;  2WAQ N;  3Q0V A;  5E3L A;  2TCT A;  5F0H A;  2YU9 J;  2VPR A;  2XPW A;  1FIA A;  2I10 A;  2E19 A;  2NVX J;  3BR3 A;  5HOD A;  1ITY A;  1IC8 A;  1OJL A;  1GDT A;  4A69 C;  5EEA A;  4A3L J;  2EZH A;  4RBO A;  2OF7 A;  4BBR J;  1TC3 C;  2H1K A;  2GLO A;  2ME0 A;  1JUP A;  4A3E J;  2JA5 J;  1MNM C;  2R5Z A;  4XRM A;  2EZI A;  2M9H A;  1XS9 A;  3A01 A;  4LOC A;  3GTL J;  3I4N J;  2R5Z B;  5EGO A;  1SAN A;  1ETX A;  3S1R J;  1LE8 A;  2XGC A;  1FIP A;  1X2N A;  2XPU A;  3A01 B;  4A3M J;  3HM5 A;  3LNQ A;  5C4X J;  1HOM A;  1LE8 B;  5EGO B;  4A3G J;  1JKO C;  3RKQ A;  2Y9Y A;  5E3M A;  3TW6 A;  4B1R A;  4C3J J;  4XK4 A;  2E2I J;  1MBK A;  5F0C A;  3JR9 A;  3BG5 A;  4BKX A;  3GTP J;  4D5C A;  3B6A A;  2L9R A;  4A93 J;  3LSG A;  3BG3 A;  1ZKG A;  4IHY A;  4UUS A;  2EZL A;  3HOX J;  3S15 J;  4AC0 A;  4C2M J;  2ME6 A;  4UUS B;  2YS9 A;  1LFB A;  2K40 A;  3Q0U A;  4IHX A;  2IEK A;  3M3Y J;  4A3I J;  2LY9 A;  4JP0 A;  4ABZ A;  2ECB A;  1O4X A;  2NVQ J;  3JRA A;  1H88 C;  4S0H B;  3GTM J;  2IBD A;  2DMT A;  3S16 J;  2QF7 A;  1Y1W J;  4DZP A;  2HXI A;  2DA4 A;  3DEW A;  1IDY A;  5FLV A;  3H3V K;  2JA7 J;  2Y2Z A;  2LR8 A;  1AU7 A;  2L7M P;  2CU7 A;  2HOS A;  3HEF A;  3HB9 A;  4I6Z A;  3MKL A;  3HOY J;  3M4O J;  2NS8 A;  1A6I A;  3G1L A;  1JJ8 C;  2M0C A;  1ETY A;  3O8H A;  1UMQ A;  1Z77 A;  1HCR A;  2JA8 J;  1RPW A;  2WB1 N;  3DCF A;  2FJ1 A;  2EQR A;  4B3A A;  3HKZ N;  2H8R A;  3VPR A;  2HXO A;  2L0K A;  2AO9 A;  3BG9 A;  5J1U A;  3BT9 A;  3HOU J;  4W1U A;  1WPK A;  1WH5 A;  4M3F A;  2G0E A;  2KDZ A;  2O8K A;  2L7F P;  2ELK A;  4CYC A;  1OFC X;  3QPS A;  3JRD A;  1IDZ A;  2O7O A;  3TED A;  2MW8 A;  1PUF A;  1WI3 A;  2CUF A;  3QPL A;  4CYC B;  1GT0 C;  5IOZ A;  2XSD C;  1PUF B;  1CQT A;  5E3N A;  1FTT A;  1ZTR A;  1Y1V J;  2YUS A;  1JUM A;  3JRC A;  3GTJ J;  4MFE A;  4XRS G;  3RZO J;  3S2D J;  2CRG A;  1F43 A;  3K2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...