1IUYA

Solution structure of the cullin-3 homologue
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
MAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cullin-3 homologue
publication title Solution structure of the cullin-3 homologue
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 20
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1iuyA00
1YW8A 3ZMVA 1QNTA 5JFRA 2DK5A 1O3TA 2CWEA 1RUNA 1BJAA 1HXDA 1LDKB 1J59A 1D5VA 1ZGAA 2DT5A 3BJOA 3F3XA 3E5QA 3WTTC 4O6JA 2HYGD 2HS5A 2LKPA 4M6YA 4PDKA 2FOKA 3RJPA 4LG0A 4O3MA 3M1EA 4HF2A 3MWMA 1W7PA 3IKTA 1ZAOA 1DPRA 2EWNA 3ZN0A 4LG0B 3SZPA 2VBYA 4KN4X 3ZMTA 2HR3A 5ICGA 3BY6A 4HOBA 4P96A 1IF1A 4XLNF 1HW2A 5HLGA 4WWCA 3MEXA 2GXBA 2FSWA 3ECHA 1GVJA 5BS6A 2HYFA 2K02A 1D3YA 2IRFG 1FC3A 4ENNA 5AIQA 4EVIA 3TDZC 5IT9K 3KP5A 1W4MA 2G9WA 1IN4A 5D8KB 1PP7U 4U7DA 3BPVA 1TTYA 2OD5A 1YLFA 4DQ2A 1UHMA 4ZH4F 4RB2C 1VTNC 2VONA 1O3SA 1J5YA 1W5SA 2HZTA 4UVBA 1IUYA 3BOQA 4MEYF 4A12A 4HV6A 5L3CA 2OQRA 1XCBA 3G73A 1CF7B 3R6SA 1YW9A 2J5PA 2RVCA 2P5KA 1KU9A 4M9XA 2V6CA 4RGRA 3ML6A 3DEUA 5D5XB 1V4RA 2XAHA 3FWEA 3F8NA 1O7FA 1O57A 4AIHA 1R23A 2DW4A 4I98B 4I2OA 3LQRA 1J7KA 1FBUA 4UV9A 1P4AA 4LB5A 3Q9SA 3TO6A 1B4AA 5D8LB 4I7HA 4I09A 4S04A 4P5OA 5J6XA 1F5TA 1XMKA 3P9IA 5HDGA 1R1VA 1E17A 3F8BA 1J0RA 1W5TA 1TBXA 1F4KA 2RDPA 3GF2A 3HSFA 4ETSA 3GFLA 1OPCA 2NAZA 4A0XA 4HX7A 1I1SA 5A2QK 2IP2A 1UB9A 4H0EA 3CUOA 4HBLA 2E1NA 4G94A 4FX4A 4BXUA 2ZCWA 3JTGA 1AWCA 3K1NA 2V1DA 3RKWA 4RGXA 1HBXG 1IN5A 2RQPA 4OIPF 1LEAA 1Z91A 3BPXA 3IL2A 1KYZA 1FYMA 3KP3A 3V8JA 2H94A 1BIAA 3HUGA 4LJZF 4KICA 1ZREA 3E6DA 1XD7A 2IJLA 3IC7A 1U8RA 1FP2A 2P8TA 5J8CA 3WU1B 4KUMA 3WE3A 4ESFA 3D0SA 3HYIA 5F64A 1QBJA 1SFUA 1R22A 2H6BA 1FBSA 5HDNA 1YS6A 2PBIA 2XGXA 2HKOA 1QZZA 3EUHA 4ON0A 4D0PA 3VEPA 2DBBA 1FSHA 1WI9A 4R1HA 2W24A 1R5HA 4A5NA 2RN7A 2EFPA 1SD4A 3MZHA 4HLYA 4RB0A 2DPUA 3WGIA 1ZG3A 3LA3A 1SMTA 2L4AA 2ZNZA 4JBAA 5BMZA 3J7AO 1KU7A 4CHUA 1G3WA 4AIJA 4BNCA 2DAOA 3FHZA 3T1BA 4ASNA 2ZMEA 3GZ6A 1FWZA 4HDVA 5CVVA 4IRGA 3KFWX 3MAJA 2ZMEB 2OZUA 5HS7A 4S05A 1V3FA 2VT3A 4G9YA 4LLGF 2VBXA 3K1MA 5EEHA 4M71A 1IW7F 1B59A 3PQKA 1JXSA 2O61A 4M73A 3L7WA 3F8FA 2BGCA 5FFXA 4LGWA 1HKTA 4L9NA 3I54A 5H20A 4KMUX 3ZMUA 1T2KA 2QYOA 4Q48A 3Q5FA 1Z1DA 5E17F 4JQFA 4GYGA 2ZBKA 1X3UA 3E97A 1YTYA 2FXAA 3N97A 2RC4A 3HSRA 5ICCA 1L0OC 2RV8A 4AD9A 4KT5C 5L3DA 2ZKZA 3C1DA 1E2XA 1XSXA 1OR7A 4EMSA 4XSZF 1DP7P 4EGZA 5K1YA 1OYYA 3FMRA 4I02A 5DCFA 3EETA 3RKXA 1IXSB 4ZYDA 3RDIA 1T39A 1RUOA 5CVUA 4B8XA 1UHWA 3QU3A 4XBFA 4HX8A 3V7SA 1STZA 3LQQA 1UCRA 2TDXA 3FXQA 1K79A 2VOOA 2WC2A 4A2UA 3LA2A 4AIKA 1XSVA 2QVOA 1LJ9A 3V8LA 2HQRA 4ZYEA 4I01A 3H3UA 2ESNA 3PQJA 5DCMA 2P7CB 4IPAA 3J81Z 3WU0A 4UUVA 4PGGA 1ZARA 3FXRA 5LGUA 2KIUA 3I53A 3WTYC 3E6CC 3ABTA 2BV6A 3WTZA 3FXUA 3JSOA 1P4XA 2K86A 4Y13A 2F5CA 2YX4A 4NHJA 4OIOF 2O0YA 2PQ8A 1Z7UA 2NYXA 4L0YB 1MDMB 2VT2A 5FGMA 5F1RA 3BP8A 5ERIA 4YFNF 3N4MA 2PG4A 4ZYHA 2JSCA 1BI0A 1FYLA 3E3VA 1HW5A 5FD5A 1ZLKA 3LWFA 2ZXJA 4GO1A 4L18B 2VN2A 2G7HA 3W6JB 4HZFA 2ACJA 1Q1HA 2F5EA 3ZP5A 2EV0A 4HX4A 1QQIA 3LFKA 4KN7X 2Z99A 3WGHA 1FYKA 1MZBA 2L01A 2O3FA 1R00A 3QPTA 3O6BB 2GZWA 3GO5A 4KFCA 2FMYA 5J8FA 3MQ0A 4Y17A 3F21A 1BI1A 1LDJA 3ECOA 2JRTA 5JI6A 1J9IA 3F23A 3TGNA 3GX4X 3M8EA 5FLXZ 3KZZA 3M8FA 5D5UB 3RKYA 1U78A 1HSJA 1D8JA 2W57A 2QQBA 2A61A 3DXJF 2RKHA 2STTA 1B6AA 4BH9A 1W7PB 2CYYA 1CGPA 3WODF 3CTAA 2STWA 3U2RA 4K2EA 2JZYA 2XKOA 4LK1F 3ABUA 2P6SA 2HWVA 5LEJA 2J5OA 5H6QA 1I1GA 4P9UA 3ZPLA 2COMA 1OKRA 4EJUA 1WKMA 1GXPA 4OINF 2LSOA 5ILSA 3ROUA 3P9KA 2X0LA 3EYYA 3TQNA 3ZMZA 4UXNA 2CG4A 3JW4A 3DV8A 3F22A 3JTHA 4MQ9F 5BQTA 4HF1A 3IRRA 1O7LA 3KCCA 4R79A 1G4DA 2A07F 1LQ1A 2XAFA 4IRHA 3HOTA 2VOPA 3JAMZ 2DI3A 2XAQA 2WWYA 4MGRA 4CYDA 2O6GE 5LHGA 2F5DA 3C3WA 3FMSA 4KMFA 1H0MA 2GA2A 1U5TC 2A6EF 1ZG1A 2HGCA 4MNUA 2ISZA 3C7JA 2FBKA 5AIPA 4N0BA 2WV0A 5E20A 2OQGA 1WWXA 2OA4A 2OBPA 2H09A 1F1ZA 3H3ZA 1SD6A 1SD7A 2YPRA 3CUQA 3J80Z 2NS0A 4UNOA 2OZ6A 3TOBA 5FD6A 5LHIA 2L3DA 1I27A 1FSEA 4U88A 3E5XA 3HHHA 3CUQB 4OIRF 3KLOA 4WK8F 3GFIA 1TW3A 4KDPA 3HRUA 5LBQA 3V7CA 3U9GA 3EQLF 3KP6A 5CVIA 3MCZA 4L9TA 3HRTA 2M1BA 2K4JA 3FF5A 1TQPA 4NB5A 1K6OA 4WCGA 1ZH5A 3V4GA 3FZVA 1YW7A 3HIFA 2NNNA 1ON1A 3V8KA 1XGNA 2FNAA 1P4WA 1KQ0A 4P55A 1XDSA 1YQAA 3O3KA 4HAMA 1I5ZA 1YS7A 2E7WA 2DO7A 4A5MA 4BYYA 2MBFA 4MHGA 3J81K 2ZO4A 2PLYA 5CYVA 1T6SA 3QAHA 1EV7A 1R1UA 2X4HA 3D5LA 3K69A 1P6RA 1G3YA 1WQ2A 2MH9A 3VOEA 4A0ZA 3M9AA 5L3BA 2VE9A 1REPC 2QM3A 3I0TA 5E8GA 4EM2A 3FX3A 4G7HF 2XHKA 3IWZA 4OMZA 5HVQC 3EDPA 3WTUC 1BC8C 1R7JA 5HLIA 3GVAA 1YFHA 4IVNA 3TO9A 1EH7A 2VBZA 3H92A 3HOSA 3CLOA 1J75A 2DU9A 3R0AA 4XSXF 3GW2A 4ZYGA 2QLZA 3PFIA 2OAZA 5BPDA 2JTVA 4PCQA 2L4MA 4CXFA 1IAWA 2ZJ2A 2MA3A 2GIVA 2CQKA 4N9HA 5HDKA 1Z05A 2M30A 1JHHA 1B9MA 1ZRCA 2C6YA 2V1XA 5D4SA 2FRHA 4M6XA 2A5YB 4N9IA 3HRSA 3LSTA 2VXZA 4Z2YA 3IWFA 2KJBA 3GUDA 2Z33A 4HQEA 1S29A 1XSDA 3NRVA 1TW2A 2HTJA 5KVRA 1DPUA 1PDNC 2Q0OA 4KYWA 2HDCA 1YG2A 3QRFF 3EYIA 1QPMA 3CO6C 5FLXK 4U0VA 2FNPA 3DPLC 3GFJA 1S8NA 1FY7A 4OMYA 3ZN1A 2FF4A 4XRFA 5IT9Z 4EJTA 2K4BA 2W25A 3C18A 2V79A 3GLXA 4PZJA 3KP7A 2YSRA 1MJBA 2FU4A 5DDGA 4ZZDA 2UWMA 4CICA 1ZN2A 1KQ8A 1IN8A 2MLGA 3K0LA 4NQWA 5IT3A 2MLKA 2P6TA 5HOOA 2AXLA 5K5RA 5LLQA 2IVMA 2O8XA 3NQOA 3GXOA 1C0WA 2Z3YA 2XRNA 3QP6A 3VB2A 1TNSA 3ZMSA 2K27A 1B9NA 4Q4ZF 1AOYA 2QQ9A 3M7GA 2XROA 2GXGA 1DDNA 5FB2A 4UVCA 3FM5A 3P9CA 1MGTA 2YR2A 2IPQX 4YG2F 2HOEA 3BJAA 1S7AA 1KA8A 1FLIA 2BYVE 2W85A 1KGSA 3T8TA 1HKSA 4U0YA 3JAMK 5E1WA 2XKPA 4EM0B 2R7DA 4O5VA 3SFZA 2Y0MA 1USSA 3TO7A 5ED4A 3NEUA 3GWZA 1IN7A 2M5WA 2E1CA 3E6BA 3G3ZA 2XVCA 4LB6B 1TQIA 1GHCA 3KZYA 2HEOA 2A69F 5HS9A 4YFXF 1PP8F 1BI2A 2EFWA 1R5GA 6PAXA 2AS5F 3I4PA 4UV8A 5CLSA 4IHSA 1Z6RA 3J80K 3KLNA 3IRQA 3GZ5A 1LDDA 4Q5SF 5DCMB 3ZMDA 2ETHA 1U6GA 3ERED 5E8IA 2EV5A 4MEXF 3DFGA 3I71A 1HW1A 2L02A 4LD5A 1O3QA 4CGZA 3E5UA 3BROA 2PMHA 4A6EA 1MKMA 4WF2A 3RTRA 1MJ9A 4U0WA 1RI7A 2R7FA 3BWGA 3T5XA 2ZFWA 1BIBA 1R1TA 2DQRA 3CO7C 2PEXA 4XLPF 4LLLA 1IZ1A 3B73A 1HQCA 3L2CA 2DK8A 3QP5A 2D1HA 3HSEA 4RB3C 2KIMA 3LA7A 1QO0D 1FPQA 2Q8KA 2EJRA 2RGVA 4I0AA 1NHAA 1U3EM 2ISYA 1XGSA 4CZZA 2DPDA 3DKWA 1BOAA 4BHCA 4M72A 4EJOA 4MTDA 4CDGA 1WSUA 3DPTA 5LGNA 2UXXA 1USTA 3SQNA 3R4KA 4BQAA 3DQVC 4RB1A 2CW0F 3CDHA 3F8CA 5D5WB 4FHTA 3E6MA 4L9JA 4ESJA 2M45A 4LK0F 2KRFA 4FX0A 5TRDA 4M9ZA 3MFKA 2NRAC 1LNWA 2IA2A 1G3TA 2D1VA 1B1BA 2HTSA 5D5VB 3TDUC 3QU6A 1MJAA 4ENMA 4HF0A 3W6KB 2CGPA 3F8MA 3LAPA 3ELKA 2MD5A 4KNYA 2LDUA 5FFZA 3T0YA 1ZYRF 3GEZA 1BC7C 4Y15A 1GXQA 1ZHFA 4MQVA 1EH8A 1F9NA 3F72A 3KP4A 4GYIA 2Z9OA 1XGOA 3RYPA 5DEQA 4EM1A 2EFNA 2H27A 1Y0UA 3SXYA 2QENA 4AWXB 1ZG5A 5JR3A 4LLNA 2A68F 5L3FA 4YIIA 4GCVA 2Z5UA 3K2ZA 4CO8A 1H9TA 3KP2A 1R36A 4A0YA 4RS8A 2P5VA 5K5QA 4AVPA 2P5LC 1QZYA 2F5FA 4MTEA 1WRJA 1PUEE 2IA0A 4ZZLA 2FMLA 3HRMA 1FP1D 2EK5A 4KA4A 5L3EA 2FE3A 2JT1A 4M74A 4FT8A 1FX7A 3LAJA 5HLHA 5BOXA 1A04A 2Y75A 2MC3A 3TKYA 2M8EA 2D45A 3I58A 1CF7A 4YFKF 2Q2EA 5TJJA 3ZQ7A 2BBYA 3TOAA 2GWRA 4IXAA 2EV6A 4HV5A 3WTVC 2QBYA 2R3SA 2PFBA 1SFEA 2GAUA 2W84A 2FEZA 2QBYB 2FBHA 2XAJA 1IXCA 4IHTA 3DF8A 4OOIA 4EGYA 3BJ6A 3WTSC 4UHTA 5CVRA 2UZKA 4WXDA 1W7PD 1FOKA 4QWQA 4HYEA 1P2FA 2V9VA 3SZTA 3GYHX 5CJ9A 3SHFA 3BZ6A 3L9FA 3ULQB 2P7VB 4G6DA 1MD0A 4ESBA 2QUFA 3T8RA 2VC1A 2HKXA 3IHUA 3K1PA 5D6EA 1OYWA 3RYRA 2XUBA 4L0ZB 3R61A 2FA5A 1J2XA 4RGUA 1FBQA 1ZLJA 1ON2A 3L09A 3GFMA 3KEOA 2YU3A 2ESHA 2EA2A 3B02A 1XN7A 3OV8A 3I59A 5LGTA 1SAXA 5LHHA 1LVAA 4YIFA 1P92A 2EA4A 3WTWC 3F6OA 4F7ZA 3KEQA 2BEOA 1XMAA 3I59B 1BN5A 5HS8A 3L00A 2QZ8A 3HHGA 2ZNYA 5DUKA 2O03A 3I64A 4WX9A 4L9VA 4ENJA 1TQMA 1OMIA 1QGPA 4IJAA 1ZGJA 2CFXA 5CVJA 4BHBA 5DD8A 1KYWA 4HW0A 1SFXA 1XDUA 5LRRA 2DFIA 2Y48A 2RNJA 3WG9A 2E7XA 1KU2A 4JK1X 3P7NA 1TNTA 4LFUA 1RIOH 4BAYA 2CO5A 1IRFA 2QQAA 1ODDA 3VFZA 1LB2A 4KIGA 3WE2A 5D4RA 4ENKA 4HQMA 3ISPA 1BI3A 1U2WA 2A6HF 2B0LA 3KETA 5JHUA 1K7AA 4KIFA 1UFMA 1O3RA 3RI4A 4R8HA 2PN6A 2VODA 3Q9VA 3VODA 1K78A 2MH2A 2IT0A 1Z6TA 1S3JA 4M9SA 2QWWA 2JPBA 1K78B 3I5UA 1T98A 2VC0A 1FNNA 2WTEA 4B09A 2VBWA 2ADUA 4E70A 1RZ4A 2M87A 5FO5A 3F6VA 3U1DA 2PMUA 4HLXA 1KU3A 2UXNA 4RAYA 2DLLA 1S7OA 4EJWA 4LMYA 1OYIA 1YYVA 3FM3A 4I0BA 3CUQC 4G7OF 5ICEA 1ZRDA 1BBYA 3V7RA 2GQQA 5DV5A 2BE5F 2LNBA 2XV4S 5ILVA 5EEGA 2FQ3A 4WXCA 3RIRA 4TV7A 3KE2A 3AAFA 2DQLA 1T0FA 1ULYA 2IA1A 5ILUA 5E18F 5D6FA 1BM9A 2K7LA 2GA1A 2KKOA 3JSPA 2EFQA 4UVAA 5K5OA 3O2PE 1ONVA 2D2WA 3S2WA 4U7BA 3WTXC 3R60A 4G7ZF 2F2EA 2V1UA 1JE8A 2OU2A 1XB4A 2PJPA 3QPHA 3DP7A 2IW5A 1YIOA 1HSTA 4DNCA 2LF8A 5E1ZB 1I6XA 4A6DA 1EH6A 3HTSB 2A3SA 4GGGA 4BHPA 1XGMA 2NNYA 1RNLA 2HFHA 5ICFA 5A2QZ 5AONA 1DUXC 1S6LA 2PI0A 1JHFA 3WGGA 4P9FA 1Z9CA 5L3GA 1FT9A 3QOPA 1JGSA 2L54A 4IRIA 1SD5A 1HKQA 2H6CA 4OU0A 1U5TA 5DUIA 1XCVA 3OOPA 4RAZA 4L5IA 4KIBA 1G6NA 3REOA 4HA8A 3FMQA 1U5TB 2G7UA 4G6QA 5E1XA 1YO5C 1H9GA 4IF4A 3RPQA 2ELHA 5BPIA 5F6FA 2CSOA 2P4WA 1SMYF 1TLHB 2LF7A 5H6RA 1MDMA 2KIFA 5JVTA 3HTUA 4WXHA 5DD4A 4HDUA 4EV0A 3IKVA 1IRGA 1D8KA 4QLCU 3R0JA 4G8XA 4GXOA 4OIQF 2HQNA 1FZPB 5LEKA 2JPCA 2VE8A 3CJNA 1IXRC 4EQQA 2DTRA 3BDDA 1G3SA 4PGHA 4L5JA 2XAGA 2XIGA 1T38A 4EJVA 2EFOA 5KK1A 5DYMA 4RGSA 1IN6A 3COAC 1ZRFA 4Q47A 3MZYA 1LEBA 1KQ9A 2FBIA 3RPUA 2XASA 2EB7A 2YX7A 5LRSA 2KJCA 1L3LA 3K9TA 1R58A
chains in the Genus database with same CATH superfamily
4P1WA 2R5ZA 3QQAA 3FBIB 1YW8A 3ZMVA 1QNTA 1Z3YA 2DK5A 5JFRA 1O3TA 2CWEA 1RUNA 2V9PA 2NVXJ 1BJAA 1HXDA 4CZCA 4XQFA 1LDKB 1J59A 1D5VA 2R5ZB 1ZGAA 2DT5A 2EZLA 4A3KJ 3BJOA 3F3XA 3E5QA 3WTTC 4O6JA 2HYGD 3O8GA 2HS5A 3HEFA 3H0DA 2LKPA 3BTIA 4M6YA 4PDKA 2FOKA 2UV1A 3H35A 3RJPA 3DCFA 3AG2H 4LG0A 4O3MA 1MBGA 3M1EA 4HF2A 4W1UA 3MWMA 1W7PA 3IKTA 1ZAOA 3SZGA 1DPRA 1ETVA 2EWNA 1QU3A 3GTPJ 3ZN0A 4W97A 4LG0B 3SZPA 2XPUA 2DFEA 3CDIA 2VBYA 1R9TJ 4KN4X 3RZOJ 2MC4A 1H8AC 1ETWA 3CCSI 3S2HJ 3L2RA 1UJ8A 1S7EA 1Z0XA 2LY1A 3A0HC 3CF2A 1HOMA 1ERDA 3ZMTA 2HR3A 2HVSA 5ICGA 3BY6A 2E1MB 5M5WJ 4HOBA 1YJNI 4ITVA 2N8GA 4P96A 1IF1A 1LFBA 4XLNF 1HW2A 2K9LA 1OR7C 2DMPA 5KAIC 5HLGA 4WWCA 2R7WA 4B3AA 5C44J 3CJRB 3MEXA 2Y9ZA 1ZR2A 2XGCA 2GXBA 2FSWA 1X3WB 3OS0A 3ECHA 1GVJA 3SFIA 5BS6A 3TP3A 2VKVA 2HYFA 3CJQB 2L7KA 3AG3H 2X9DA 2K02A 4A3EJ 1D3YA 2IRFG 3CC2I 1FC3A 1ETOA 4ENNA 3L1PA 5AIQA 2MSYA 1YX3A 4EVIA 2X1DA 2M9HA 3TDZC 5IT9K 3CZ6A 4KISA 4I6ZA 3KP5A 1W4MA 2G9WA 3ZQGA 1IN4A 3J7AY 5D8KB 4MIMA 3OS1A 1PP7U 4DYQA 4U7DA 3HM5A 3BPVA 3H1CA 4A3GJ 1MNDA 1R71A 2CJJA 1TTYA 2OD5A 1YLFA 4DQ2A 1UHMA 5GPAA 1XMXA 4ZH4F 4RB2C 4HG2A 2W00A 1VTNC 3HOXJ 2VPRA 2VONA 4ANJA 3GZNB 2P0WA 1O3SA 3MN2A 1I39A 1J5YA 4DZJA 3AFHA 1W5SA 5FKOA 1JTXA 2HZTA 4UVBA 1IUYA 3BOQA 4MEYF 1VQ9I 4A12A 4HV6A 5L3CA 4AM3A 3D5RC 2OQRA 1XCBA 3DLAA 3G73A 2DT7B 4DJAA 1CF7B 1BR4A 4A3FJ 2XPWA 3R6SA 1XS9A 3ZQIA 1YW9A 2J5PA 2RVCA 2P5KA 1KU9A 4M9XA 1ZK8A 1X4PA 2V6CA 4RGRA 3ML6A 3DEUA 3G4SI 5D5XB 1X1BA 5IYDJ 2ZXWH 3BR5A 1V4RA 1FTTA 2XAHA 4G12A 3FWEA 4D5CA 3F8NA 4U87A 2NVUB 2R7ZJ 1O7FA 4V2FA 1RR8C 2CS3A 3CC4I 3NWTA 1S5LC 1O57A 1K61A 4AIHA 1R23A 2DW4A 1LUJB 2LKSA 3SJMA 3CDLA 3DLLF 4I98B 3ZQHA 4I2OA 3LQRA 4IZZA 1J7KA 1FBUA 4UV9A 1P4AA 2GOXB 4LB5A 3M07A 3KYLA 1YI2I 1SAUA 3Q9SA 1X1CA 2JMWA 3PUFA 2AQFA 3TO6A 1BJZA 3LSRA 1B4AA 3FK6A 5D8LB 1HC8A 4I7HA 1RKWA 1SEUA 4I09A 4S04A 3ASOH 5E3MA 4M3BA 1R49A 1H88C 2R7VA 4P5OA 5J6XA 1F5TA 1ZTRA 1Z77A 1XMKA 4IX7A 1X3ZB 2XF5A 3P9IA 2JVGA 5F04A 4RA2A 5HDGA 1R1VA 1VFCA 2XPVA 1E17A 4X1EA 2ZFUA 2DA3A 3F8BA 2CUEA 1XTAA 1J0RA 2HXIA 4II2A 3MKLA 4BY1J 2CQNA 3LSHA 3EUAA 3IAM2 1W5TA 2R92J 1TBXA 3KIOA 3K4KA 1F4KA 2RDPA 3GF2A 3HSFA 1VQOI 4G6TB 4ETSA 2FD5A 3GFLA 1OPCA 2NAZA 4A0XA 4HX7A 1I1SA 3QWLA 5A2QK 2IP2A 5GAEJ 1UB9A 4FQGA 3CCJI 2YS9A 4H0EA 3CUOA 3OYDA 4HBLA 3RCOA 2E1NA 4G94A 1WFXA 4DW6A 4HNUA 4FX4A 1RC9A 1N75A 1V5GA 4BXUA 2VI6A 2ZCWA 3JTGA 1AWCA 2CV1A 5F08A 2JA7J 3K1NA 2V1DA 3RKWA 4C3JJ 4A3MJ 3CCUI 4RGXA 3OYIA 1HBXG 4KJZA 2FOWA 1BOBA 1IN5A 2PMZN 2RQPA 4OIPF 1IDYA 1LEAA 1Z91A 4F3QA 3BPXA 3IL2A 2YU9J 1KYZA 2VQGA 3OMYA 4JX4A 1FYMA 3KP3A 3V8JA 2H94A 1BIAA 4CSWA 2O8KA 4HPQA 3HUGA 5EF6A 2NOGA 4LJZF 4KICA 4XORA 1ZREA 4C9YA 3E6DA 1XD7A 2IJLA 3IC7A 1U8RA 1FP2A 2P8TA 5J8CA 2LD5A 1QPIA 3OYHA 4IHXA 1VNDA 2K3PA 4EATA 4CUGA 3HUGB 4NUBA 3X2QH 3MD2A 3WU1B 4KUMA 3WE3A 1FJLA 4ESFA 1VQ4I 3MKZA 3D0SA 3HYIA 5B66C 3TMOA 3AG1H 5F64A 3DTKA 1QBJA 4E7ZA 3PIOF 2XC7A 2KQRA 2WY8Q 2I8DA 2CQQA 3A02A 1JT6A 1SFUA 1R22A 2H6BA 1OJLA 1FBSA 5J47A 2L5QA 2PX9A 4BS9A 2XGDA 2E35A 5HDNA 1NTCA 1YHQI 1YS6A 2IEKA 2PBIA 2XGXA 4BY7J 4C30A 1ZQ3P 2HKOA 1QZZA 3EUHA 4ON0A 2QEXI 2Y9YA 1FTZA 3LSKA 4D0PA 3VEPA 2WAQN 4PJLA 2DBBA 1JGGA 1FSHA 4I99C 1WI9A 5KHDA 2M7BA 4R1HA 2W24A 1R5HA 3DEWA 4A5NA 1AKHA 1R4MB 2RN7A 2QSHX 2EFPA 1SD4A 5F0FA 3MZHA 1JJ8C 2OC6A 2KL4A 2LVSA 3E0JB 2B63J 3Q3SA 4HLYA 4RB0A 2DPUA 4XNFA 3F9KA 3WGIA 2R93J 1ZG3A 3LA3A 4YIRX 1SMTA 4BXXJ 1WJDA 1AKHB 2K5CA 1A5JA 2L4AA 3QYFA 2ZNZA 4JBAA 5BMZA 3J7AO 1KU7A 2HVRA 2NOJB 2XSJC 2L9RA 4CHUA 1U9NA 4J01A 1G3WA 2V9KA 4AIJA 1TWGJ 3H5RA 3OYGA 3CCQI 2DAOA 4BNCA 1EF4A 3FHZA 1YJ9I 3T1BA 4ASNA 2M0CA 2ZMEA 3GZ6A 1FWZA 4HDVA 5CVVA 4IRGA 2WV1A 3KFWX 3VWBA 5HNHA 3MAJA 1U0JA 3VSKA 2ZMEB 1I3AA 2ZC2A 2OZUA 2X51A 5HS7A 4XM3A 4S05A 2DA7A 1V3FA 2M7AA 2VT3A 1H89C 1JI8A 2QA4I 4G9YA 4LLGF 2MD0A 2VBXA 3K1MA 4AYBN 3ABKH 5EEHA 3PM1A 2F4MB 4M71A 3GLLA 2HQ5A 1IW7F 2IXSA 1B8IA 3U1KA 4ZDOA 3A01A 1B59A 2CRGA 3ABMH 3PQKA 1W1WE 1JXSA 2O61A 4M73A 3L7WA 3F8FA 2BGCA 5FFXA 4LGWA 1HKTA 3GTQJ 2ZXIA 4L9NA 3PO3J 1B8IB 1TL8A 3I54A 2BY3A 3AKZA 3A01B 5H20A 3VSLA 4KMUX 3ZMUA 4NDLA 1TWHJ 1T2KA 2QYOA 4II3A 1XX5A 3NARA 4Q48A 3Q5FA 3K4LA 5J1RA 4UY8I 1S9HA 1Z1DA 2DDBA 4KITB 5E17F 4JQFA 4GYGA 2KPMA 2ZBKA 4IQJA 4E4HA 3GBGA 1X3UA 2COBA 2CUZA 3E97A 1TT0A 4IO9F 2K9SA 5B3SH 3E1SA 2Z1DA 1YTYA 3JRGA 2FXAA 2NXNB 5EZGA 3N97A 1X19A 4CCKA 1WJEA 2RC4A 3HSRA 1PJRA 2IS2A 5ICCA 1L0OC 2RV8A 4AD9A 4KT5C 2TCTA 4XLFA 2XB0X 4BXFA 5L3DA 2ZKZA 5M3FJ 2R5YA 3C1DA 1E2XA 1XSXA 1OR7A 4EMSA 4XSZF 3MZ8A 1DP7P 3S17J 4EGZA 3QOEA 5K1YA 4IOAF 1OYYA 1I50J 2HQAA 3FMRA 3KZIC 2ICWG 2R7QA 4NNJA 3OYBA 2R5YB 2CMPA 3NAUA 4I02A 5DCFA 3FXOA 3EETA 3RKXA 3DWLE 1IXSB 4ZYDA 4E7JA 1UAAA 3RDIA 3GMEA 1T39A 4MLOA 1RUOA 1GVDA 5DTDA 5CVUA 4B8XA 4FISA 1UHWA 2M8GX 3QU3A 3S1MJ 1GUUA 3HOVJ 1IV6A 2GLOA 4XBFA 1WCMJ 1SFKA 4HX8A 3V7SA 4BJ5C 1STZA 1IJWC 1JUMA 3LQQA 3PNTA 1UCRA 2TDXA 3FXQA 1K79A 2VOOA 2WC2A 4A2UA 3LA2A 2ZB9A 4AIKA 4BACA 1LE8A 1TP4A 1XSVA 2QVOA 1LJ9A 1DGRM 4BQQA 3V8LA 2OUMA 2HQRA 4ZYEA 1EKEA 3FXLA 4I01A 5F1JA 3H3UA 3IAS2 2ESNA 2D5VA 1TWCJ 3PQJA 5DCMA 4IPAA 5J3LA 3J81Z 2P7CB 4Y7NJ 3WU0A 4UUVA 1ACIA 1MSFC 3BCAA 2JRMA 2F5VA 4PGGA 1TC3C 3BLYA 1ITYA 3OYNA 1ZARA 3FXRA 5LGUA 2KIUA 3I53A 4M3FA 3WTYC 4A69C 3WG7H 5M5YJ 3E6CC 3ABTA 1RETA 1ZR4A 2VASA 2BV6A 3WTZA 3PSFA 4ZDPA 2OTLI 3S8PA 3FXUA 3JSOA 3CF5F 1FIPA 1P4XA 3GTLJ 1WJCA 2K86A 4Y13A 2F5CA 1A35A 1BA5A 2KT0A 2YX4A 4NHJA 4OIOF 2KHMA 2O0YA 2E34A 2PQ8A 4B1RA 1Z7UA 2NYXA 4L0YB 3KYDB 1MDMB 2VT2A 5FGMA 5F1RA 3BP8A 5ERIA 4YFNF 1DQUA 3N4MA 2PG4A 4V19K 3P5JA 2DYSH 4ZYHA 2JSCA 2O9LA 1BI0A 1MNEA 4LITA 1FYLA 3E3VA 1M1EB 1HW5A 3H5AA 3J7YJ 1QA6A 1UG0A 2K40A 5FD5A 4UUSA 1ZLKA 3HL2A 3PL8A 2MYSA 3PIPF 2HOSA 1SVOA 4YEJA 3LWFA 2ZJRF 2ZXJA 4GO1A 4L18B 2VN2A 4CH7A 1ZGWA 2G7HA 3W6JB 4HZFA 3LFUA 4AIDA 1WH5A 1K6YA 3WHBA 1XG1A 2BHZA 2ACJA 2QF7A 1Q1HA 1W36D 1VQ6I 1JKQC 1IV8A 2F5EA 3ZP5A 2KP6A 2EV0A 4HX4A 1QQIA 3LFKA 4KN7X 2K9QA 2Z99A 3WGHA 5E3OA 1FYKA 1HCRA 1LFPA 1MZBA 4CCNA 2L01A 2BHYA 1PYVA 2O3FA 1R00A 3QPTA 1MW7A 3O6BB 2MABA 1UELB 2GZWA 3PO2J 3GO5A 4KFCA 1FOWA 2FMYA 5J8FA 4X6AJ 1F43A 2WAEA 1Q1VA 3MQ0A 2RQQA 3LMMA 4Y17A 3F21A 2R7SA 3ABLH 1J09A 1BI1A 1LDJA 3ECOA 4A3CJ 2JRTA 5JI6A 1J9IA 1QHHD 3BR2A 3F23A 2LYCA 3TGNA 5CKTA 4F52A 3GX4X 3M8EA 2NVYJ 3K4JA 1HF0A 5FLXZ 4IOCF 3KZZA 3M8FA 4A93J 4FETA 4NC6A 5GAGJ 5D5UB 4AVZA 1TT5B 3RKYA 1WZ2A 2LR8A 1U78A 1HSJA 3TP0A 1GT0C 1D8JA 2W57A 4UB8C 5TISC 2DA1A 2DFHA 2GBYA 2QQBA 2A61A 3F0CA 3DXJF 2RKHA 2XAUA 3ZQLA 2STTA 1B6AA 1ENHA 4BH9A 3KEYA 4E7HA 1W7PB 2CYYA 4HNVA 2V4JC 1CGPA 4UB6C 3WODF 2VLAA 3CTAA 2STWA 3U2RA 3OYLA 4K2EA 5KAFC 1VQKI 1JUPA 2JZYA 2XKOA 4LK1F 4I76A 4BGDA 3ABUA 2P6SA 4BQNA 2HWVA 3EUKL 5LEJA 1MBEA 4BDYA 2QKLB 1Y8RB 2J5OA 5H6QA 4D9JA 2NS8A 1I1GA 3CCYA 2E1OA 3BR1A 3LSMA 4P9UA 4MO7A 3ZPLA 1W36C 2COMA 1MBJA 1OKRA 3UNGC 4EJUA 3HKZA 5FRNA 5B1AH 1WKMA 1N77A 3CJTB 2K9NA 1GXPA 4OINF 2JSPA 4RBOA 5DS9A 3S3NA 4XONA 2LSOA 1PUFA 2LBFA 4JX6A 4A3BJ 2XGEA 3OYAA 2EIKH 5ILSA 5FLMJ 1FMVA 3ROUA 3P9KA 2X0LA 3EYYA 2M4KA 3TQNA 4UXNA 3ZMZA 2CG4A 3RQIA 2LBFB 1K4TA 3JW4A 4DYCA 2EINH 2HOAA 3CP2A 2V7FA 3DV8A 3F22A 3JTHA 2EH3A 1MBKA 4MQ9F 3ZGKA 2IGNA 1OCPA 2LRDA 5BQTA 4HF1A 3ZR8X 3IRRA 1O7LA 3KCCA 4R79A 1G4DA 5EJCA 2A07F 1LQ1A 3HZJA 2VPLA 2XAFA 4F92B 4IRHA 1OLTA 3HOTA 2X6WA 2VQLA 2VOPA 3JAMZ 3GTOJ 2X48A 2KZGA 2DI3A 3K4BA 2XAQA 2WWYA 4CA0A 4MGRA 4CYDA 2O6GE 2X85A 5LHGA 3DU6A 2F5DA 3C3WA 3FMSA 4KMFA 1H0MA 2BXZA 2DFFA 2GA2A 1U5TC 1YOVB 2A6EF 2B7EA 1ZG1A 2HGCA 2E2JJ 2DA6A 4MNUA 3RPUD 2ISZA 1YE9A 3C7JA 2FBKA 3M4OJ 5AIPA 4N0BA 2KDOA 2JN6A 2ID3A 5HODA 3FHNA 2WV0A 5LD2C 2X6XA 4Y52J 5E20A 1X58A 2BZTA 2OQGA 1WWXA 2OA4A 2OBPA 3HXLA 2H09A 1BL0A 2IS6A 1F1ZA 2LKXA 3H3ZA 1SD6A 1SD7A 2YPRA 3CUQA 3J80Z 2CQ7A 2NS0A 4UNOA 2OZ6A 3TOBA 5FD6A 5LHIA 2L3DA 1I27A 4DZPA 1FSEA 2BY0A 4U88A 3E5XA 1IRZA 3HHHA 3HJEA 3CUQB 3W2VA 2YUSA 4OIRF 3KLOA 4WK8F 3GFIA 4XR6A 2KDZA 1TW3A 4KDPA 3HRUA 5LBQA 3V7CA 3HG9A 3U9GA 5JVGF 2IGKA 2L7FP 3EQLF 4MFDA 2XDVA 3BG9A 3KP6A 5CVIA 2GXAA 3MCZA 4L9TA 1YJWI 1EA3A 1U9OA 2DMUA 3HRTA 2CW8A 2M1BA 4PSXA 1I3QJ 2K4JA 3FF5A 5JHFA 3G6EI 1TQPA 1X2MA 4NB5A 1K6OA 1A36A 1E3PA 4WCGA 5J4VA 2JQ7A 1ZH5A 3V4GA 3FZVA 1YW7A 3HIFA 4AC0A 2NNNA 1SFOJ 4CYCA 1ON1A 3V8KA 1XGNA 2FNAA 1P4WA 1KQ0A 4P55A 3BC8A 3RKQA 1XDSA 1ETKA 1YQAA 3O3KA 3CP8A 4HAMA 4BBRJ 1I5ZA 4X0GA 2L7ZA 1MNMC 1WPKA 5J40A 1IC8A 1YS7A 3G1LA 4QSHA 4CYCB 5E79C 1Z21A 2E7WA 2DO7A 4A5MA 4BYYA 3L2QA 2MBFA 3S2DJ 4BBSJ 4MHGA 3J81K 2ZXHA 2W48A 3OL4A 2ZO4A 5FKKA 2PLYA 5CYVA 1T6SA 2R7XA 3S14J 3QAHA 4M3DA 1W5CC 1EV7A 1R1UA 1CQTA 2X4HA 3D5LA 3W2AA 2BXYA 3M3YJ 3K69A 1P6RA 1N78A 1G3YA 2JWTA 4FE4A 1WQ2A 2DDAA 2MH9A 2DOEA 2QCOA 5EYRA 3VOEA 4A0ZA 3M9AA 2LLKA 5L3BA 2VE9A 1GLNA 1WGXA 1REPC 2AHQA 2QM3A 3QYEA 3TEDA 3I0TA 2L9NA 5E8GA 4FTHA 3S3OA 5J1UA 1POGA 4EM2A 3FX3A 4G7HF 1DU6A 2XHKA 2AQEA 3IWZA 4OMZA 5HVQC 3EDPA 3WTUC 1A6IA 1R7JA 2ID6A 2M4GA 1Y8QB 3OIQA 1BC8C 3FKJA 1TWFJ 5HLIA 3BG5A 3GVAA 3ASNH 1YFHA 5TGTA 4IVNA 2VIXA 3GCMA 3TO9A 1EH7A 2JUCA 3OWTA 1TZLA 2VBZA 4B48A 2W4SA 4E6KG 3H92A 3HOSA 1XC5A 3CLOA 1LVKA 2ELKA 1D1AA 1J75A 2DU9A 1ETQA 2E1MC 2XRLA 3R0AA 4XSXF 4OAZA 3GW2A 3OIOA 4ZYGA 2QLZA 3PFIA 2OAZA 3G71I 4DIQA 4B4CA 5BPDA 2JTVA 4PCQA 3IH2A 2L4MA 4CXFA 1RRJA 2F4IA 3IV5A 1IAWA 2ZJ2A 5FJ8J 2MA3A 1T95A 2NS7A 3BG7A 1D5YA 2QSGX 2G0EA 5IPAA 2GIVA 2CQKA 2OCEA 4N9HA 5HDKA 1OCCH 1Z05A 5FKNA 1OCOH 5F0CA 3AL0B 3JRFA 1BR2A 2M30A 1JHHA 2DMQA 1B9MA 1ZRCA 3ZOBA 1LKXA 2LTPA 4HSRA 2C6YA 2Y2ZA 2V1XA 5D4SA 3IH3A 3S32A 1VQNI 2FRHA 4M6XA 2DA4A 2A5YB 4N9IA 3HRSA 4F55A 3JRHA 3LSTA 2VXZA 4Z2YA 4M3GA 3IWFA 2KJBA 3GUDA 2Z33A 4HQEA 1S29A 2EBIA 2MFZA 1XSDA 3NRVA 1TW2A 5FLVA 4NBQA 4H4KC 2HU9A 2AO9A 1VQ8I 2VKDA 2HTJA 5KVRA 1DPUA 1PDNC 2Q0OA 1MH3A 3J7ZI 4KYWA 2HDCA 1YG2A 2CW7A 3QRFF 3EYIA 1QPMA 3CO6C 5FLXK 1DP3A 4YRVA 4U0VA 2FNPA 3DPLC 3CMEI 2DODA 3GFJA 1S8NA 4QPQA 3PJRA 2HDWA 5IYBJ 1FY7A 3CMMA 4OMYA 1X4OA 2IAIA 1O4XA 3ZN1A 4ZTFA 3OYCA 2FF4A 1T56A 4XRFA 3S93A 5IT9Z 4EJTA 2L0KA 1QVTA 2K4BA 1OISA 1P7JA 1WJ5A 2W25A 2LMDA 1WJBA 5C4XJ 1VQMI 5HNFA 2V1NA 3C18A 2V79A 3GLXA 3A2KA 2ECBA 4PZJA 5GTIC 3KP7A 1Y39A 2YSRA 2ZSHB 1MJBA 2B9SA 4AU7A 3ZQFA 2FU4A 5DDGA 4ZZDA 3A0BC 2UWMA 5C4JJ 3HGGA 4CICA 1ZN2A 1KQ8A 1I6HJ 1FOYA 2HOTA 3DBHB 1IN8A 2E5ZA 4ABZA 2V6EA 5JLXA 2MLGA 3K0LA 4NQWA 3HC7A 5IOZA 1SC7A 4J00A 4ZDLA 5IT3A 2MLKA 2P6TA 5K7FA 5HOOA 1AHDP 1D0YA 2AXLA 5K5RA 3OYKA 5LLQA 2IVMA 2O8XA 3LL7A 3NQOA 3GXOA 1C0WA 2EIJH 2RNGA 2W82A 3MVPA 2Z3YA 3D1NI 2XRNA 3KYCB 3QP6A 3VB2A 2IS4A 1TNSA 3W2WA 3ZMSA 2K27A 4PUSA 4Z6YA 1NK3P 1B9NA 4Q4ZF 1AOYA 2QQ9A 3M7GA 2XROA 2GXGA 2XF6A 3ZQCA 1DDNA 5FB2A 4UVCA 3FM5A 2DCEA 2BVMA 1JKOC 3P9CA 4DOZA 1K83J 1MGTA 2YR2A 3HB9A 5EDNA 1S72I 2VUMJ 1F36A 3VYTB 3TBIA 5FKMA 3L2WA 2IPQX 5F27A 3DBLB 1IDZA 4YG2F 2HOEA 3BJAA 1S7AA 1KA8A 4EEFG 3OYEA 1FLIA 2BYVE 2W85A 1KGSA 3BR0A 5IOYA 3T8TA 1HKSA 1U8BA 2EQRA 4U0YA 4RMNA 5FROA 4XLAA 3DTEA 4BJTA 3BCBA 3JAMK 4Y4RA 1QHGA 1MBHA 3Q0VA 1G59A 1Y56A 5E1WA 2XKPA 4EM0B 2R7DA 4CCLA 1BW5A 4O5VA 3SFZA 3OYFA 2Y0MA 1USSA 3A1YA 3TO7A 5ED4A 1FOXA 1WJAA 2UUZA 3NEUA 3GWZA 1IN7A 2M5WA 2E1CA 3E6BA 3G3ZA 3I9V2 2XVCA 3I4NJ 4B3XA 4LB6B 4QPOA 1TQIA 3JRCA 1GHCA 3KZYA 2HEOA 2A69F 5HS9A 4CCOA 4YFXF 1HA8A 2ZSIB 1PP8F 1BI2A 2EFWA 2EZIA 1R5GA 6PAXA 1DU0A 3VYRB 2AS5F 3I4PA 4UV8A 3OOUA 5CLSA 4IHSA 4XN0A 4C3HJ 1Z6RA 2KFDA 1OCRH 1LE8B 3FK7A 3J80K 3RQ4A 1T33A 3KLNA 2VKEA 3Q0WA 3SEZA 3IRQA 2RREA 4GFBA 2Y0SA 3GZ5A 1LDDA 4Q5SF 3JRDA 2DOAA 5DCMB 3TW7A 4IHWA 3ZMDA 4JP0A 2ETHA 5IY5H 1U6GA 3ERED 5E8IA 3NWSA 2CUFA 4BUPA 4RM2A 4D7MA 2EV5A 4MEXF 3LSIA 2F6CA 3DFGA 3I71A 1HW1A 5EG0A 2L02A 5K7ZA 4LD5A 4GRIA 3PNVA 1O3QA 4CGZA 3E5UA 2I5UA 3BROA 4HNTA 2HNHA 2CQXA 2OF7A 2PMHA 3U21A 4A6EA 1MKMA 4WF2A 1A31A 3RTRA 2IBDA 1PVEA 1OQYA 3VDXA 2ZJQF 5EG0B 1FEXA 1MJ9A 4U0WA 4RDUA 1RI7A 2R7FA 2KRHA 3BWGA 3T5XA 1SVLA 4DBQA 2ZFWA 1BIBA 1R1TA 2DQRA 1MMNA 2H1KA 1NG6A 3JRAA 3CO7C 4OWRB 2A5WA 1N25A 1APLC 2PEXA 4XLPF 1MMGA 4LLLA 1IG7A 1IZ1A 1RPWA 4NC7A 1YX5A 3B73A 1HQCA 3L2CA 2W7NA 2DK8A 2O7OA 2Z16A 2R7RA 3QP5A 2D1HA 3S1QJ 4Y3OA 2VL8A 3HSEA 4UUSB 4RB3C 2KIMA 1E3HA 3LA7A 1P9QC 1QO0D 1FPQA 2E19A 1IRXA 1DGWY 3M1CA 2EJRA 2RGVA 3N05A 4I0AA 2Q8KA 1NHAA 1U3EM 3BG6A 2ISYA 1XGSA 1ZKGA 4CZZA 2DPDA 2CV0A 3DKWA 1K4SA 1EJ9A 1BOAA 4BHCA 1T08B 4M72A 1Y6IA 2VQHA 4ZJZA 2JA2A 1Y1WJ 4EJOA 3DBRB 3LOCA 1SVMA 4DYRA 2HI3A 3K10A 4MTDA 4CDGA 3I55I 1WSUA 3DPTA 5LGNA 2UXXA 2ZMEC 2JA6J 1USTA 4JYKA 3H9QA 3I4MJ 3G2BA 3R4KA 3SQNA 2WB1A 4BQAA 2VJIA 2ECCA 3DQVC 1R5ID 4RB1A 1RR7A 2ZJPF 2CW0F 3G1OA 3CDHA 3F8CA 2KISA 5D5WB 4FHTA 3E6MA 3LSJA 3HKZN 3A4CA 2WY7Q 3CD6I 3CMAI 1FMWA 2OV7A 4L9JA 4ESJA 3CCLI 2M45A 4LK0F 2OTJI 2BY2A 2KRFA 4FX0A 5TRDA 1GV5A 4M9ZA 3MFKA 2NRAC 5CQGA 1LNWA 1VQLI 5FKLA 2IA2A 3CCVI 1G3TA 2D1VA 1B1BA 2GIZA 4JX5A 2HTSA 2MW8A 5D5VB 2DT6A 3TDUC 4A3IJ 2F4OB 3PUBA 3QU6A 1MJAA 4ENMA 4HF0A 3HOYJ 5H2FC 3W6KB 3OIPA 2CGPA 2F48A 1UMQA 3F8MA 3LAPA 3ELKA 2MD5A 3CLQA 5IP6A 4KNYA 2LDUA 4XOTA 1LFUP 5FFZA 3T0YA 1ZYRF 3GEZA 5BNGA 5CQEA 1BC7C 3ESWB 4Y15A 3ZXSA 4BU2A 1GXQA 1ZHFA 2LOOA 4MQVA 2WA0A 1EH8A 3BT9A 1F9NA 3F72A 4XRSG 3S1NJ 3KP4A 1GDTA 4GYIA 2Y31A 2Z9OA 1XGOA 3G1MA 3RYPA 5K7HA 2HPIA 1MMSA 5DEQA 4EM1A 2FUG2 2EFNA 2Y30A 2H27A 1T0FC 1Y0UA 3SXYA 2V26A 5GPCA 2QENA 2IS1A 4AWXB 3B6AA 3H36A 1ZG5A 3JRIA 5JR3A 4RM3A 4LLNA 2E36A 4BDZA 4A3LJ 2A68F 5L3FA 4YIIA 1AU7A 2QGUA 1ETYA 4GCVA 3UKGA 5GP9A 2Z5UA 3K2ZA 4CO8A 1H9TA 3KP2A 2DJNA 3H9JA 2E5NA 1MMDA 1PUFB 1R36A 3IP4B 3SYTA 4A0YA 3BTCA 1WJFA 3K7AJ 4RS8A 2EPFA 2P5VA 3FBNB 5K5QA 2HXOA 1V54H 2WAFA 4AVPA 2P5LC 1QZYA 4D5FA 2F5FA 4MTEA 1WRJA 1PUEE 3DU5A 2IA0A 3SDGA 4E7SA 4ZZLA 1OCZH 2FMLA 3HRMA 1FP1D 2EK5A 4KA4A 2DA2A 2M3AA 3PNYA 2FE3A 5L3EA 2JT1A 3L2UA 2L9VA 4CCJA 4DGWB 4M74A 3EPZA 2LG4A 4FT8A 1FX7A 4PFPA 1JJ6C 2E2IJ 3FKIJ 3RSNA 3LAJA 5HLHA 5BOXA 2TRTA 1A04A 2Y75A 3C2HA 3OY9A 2QQ8A 2LY9A 2MC3A 5GTHC 3TKYA 2M8EA 2D45A 3I58A 1CF7A 2XB5A 3MMYB 5IP9J 4L5EA 4YFKF 2Q2EA 5TJJA 3DEEA 3S16J 2DOFA 4IQ4A 2VJ5A 3ZQ7A 2BBYA 2X6OA 1D1BA 3TOAA 2GWRA 4IXAA 2BW3A 5DM6F 3HOUJ 2EV6A 4HV5A 3WTVC 2Q2EB 2R3SA 2QBYA 5J1YA 4LIVA 1OCTC 3OR1C 1RKTA 2PFBA 1SFEA 2GAUA 4DBRA 2BW3B 1HDDC 2ME6A 4FCYA 3QPSA 2W84A 1RESA 2FEZA 4XRMA 2R4GA 2QBYB 2FBHA 3ERMA 4UUTA 3DPUA 2XAJA 4RAGA 1IXCA 4IHTA 3DF8A 4PJMA 2CV2A 4MFEA 3QPLA 4OOIA 4EGYA 3BJ6A 4LIUA 3V42A 3WTSC 3BTLA 4UHTA 5CVRA 4BKXA 2UZKA 4WXDA 1W7PD 2MG4A 1FOKA 2FX0A 3CCEI 1QVUA 1Z3XA 1IGNA 4QWQA 4HYEA 1NG7A 1V5EA 1IO2A 1X1AA 3K4CA 5IP7J 4OAYA 2FJ1A 1Z67A 1P2FA 2XSDC 1HLVA 2V9VA 4IHYA 3SZTA 4IL6C 3GYHX 5CJ9A 1MMAA 3SHFA 1JUSA 3BZ6A 4GDFA 3HOWJ 4S0HB 3L9FA 3PSIA 2P7VB 3ULQB 2DTZA 4G6DA 1MD0A 4JOMA 3ZQQA 1QZEA 4ESBA 5FRMA 2EZHA 2QUFA 3KPHA 4XK4A 2ME0A 3T8RA 2VC1A 3ZRGA 4PJ0C 1VZ0A 2HKXA 3IHUA 3BG3A 3K1PA 1JT0A 5D6EA 1OYWA 3RYRA 2XUBA 4E7LA 4L0ZB 2QSFX 1JKRC 3R61A 2FA5A 2HPMA 1J2XA 4RGUA 2KLOA 1FBQA 1ZLJA 1ON2A 5EEAA 4AUXA 2KIQA 3L09A 2JJ7A 3GFMA 3KEOA 2YU3A 4FASD 5B5EC 2ESHA 3K4MA 2EA2A 3B02A 3TL4X 1XN7A 2L7MP 3DKYA 3OV8A 2CFOA 2QKMB 3FXMA 3I59A 3IH4A 5LGTA 1X1DA 2DJIA 2OCCH 1SAXA 5LHHA 1LVAA 4YIFA 1P92A 5M5XJ 2EA4A 3WTWC 3F6OA 4F7ZA 3KEQA 2BEOA 3HDDA 1XMAA 3I59B 1BN5A 3GTJJ 5HS8A 4RLQA 3L00A 3K4NA 3MKYB 2QZ8A 4QTRA 3HHGA 3W6VA 2ZNYA 5DUKA 2O03A 2E71A 3I64A 4WX9A 4L9VA 4XLEA 4ENJA 1TQMA 2XF7A 1OMIA 1QGPA 4C2UA 2R7TA 4IJAA 1ZGJA 2WBMA 2CFXA 5CVJA 4BHBA 2W1OA 1WHUA 4XLHA 1D1CA 5DD8A 1BW6A 3H0GJ 2GOMA 3QYBA 4PFOA 2IGOA 3FIWA 1KYWA 4HW0A 2CH0A 4N4NB 1SFXA 1XDUA 5LRRA 2DFIA 1UG2A 1QRYA 2LFBA 1UZCA 2Y48A 2RNJA 3WG9A 2E7XA 3KX2A 5GAHJ 1Y0NA 2DMNA 1KU2A 4PK4A 4JK1X 3OL3A 3BTJA 2M0MA 3P7NA 4C2MJ 1TNTA 4LFUA 2DMTA 4XKBA 4XMYA 1VQPI 2A05A 1RIOH 1VQ5I 4BE0A 4BAYA 3H3VK 4BE1A 3HGYA 2CO5A 1IRFA 2QQAA 2Q1ZB 1ODDA 2AXTC 3VFZA 1LB2A 2I10A 4KIGA 3WE2A 4KT6A 1G2HA 2OJED 2MGQA 2R7UA 1KONA 5D4RA 3BZCA 4M6VA 2LK2A 3WHCA 3S3MA 4ENKA 2VJ4A 4HQMA 2M34A 3DKXA 3JRBA 3ISPA 2OPTA 2GM4A 1BI3A 1U2WA 4LG3A 2FQ4A 2PMZA 4J19A 4D7NA 3DTIA 4PJNA 3PFYA 2A6HF 1XPXA 1LPQA 2B0LA 3KETA 5JHUA 4PSWA 1K7AA 4KIFA 2A6TA 1UFMA 1O3RA 3C2GA 2H8RA 3RI4A 1GV2A 2HDDA 4R8HA 1NK2P 3CCRI 4ZC3A 3BQZA 4XL9A 2PN6A 2R7OA 4ZTJA 2VODA 3Q9VA 4RAFA 3BR3A 2IGMA 2JVHA 3VODA 1WI3A 1K78A 1VI0A 2MH2A 5HLTA 3JR9A 2IT0A 1OFCX 4RLFA 1Z6TA 5M3MJ 4A3DJ 4IHVA 1MSEC 2DYRH 2Y69H 1S3JA 4M9SA 2KMUA 2EZKA 2QWWA 3I3LA 2JPBA 4C3IJ 1K78B 3I5UA 1T98A 2VC0A 1FNNA 2H8WA 2WTEA 2LH9A 2LC2A 4B09A 2VBWA 1D0XA 2ADUA 3RZDJ 4E70A 2CUJA 1RZ4A 3GTKJ 2M87A 5FO5A 2DA5A 3F6VA 2PMUA 3U1DA 3VYUB 4HLXA 5J4YA 1KU3A 2UXNA 4RAYA 4QIWN 2DLLA 2WAQA 3CQZJ 1S7OA 3HPHA 3K6GA 4EJWA 1YIJI 4LMYA 3K70D 1OYIA 2VQCA 2X1CA 3OYJA 2L9SA 3I56I 1YYVA 3AG4H 5KCMA 3QODA 3FM3A 4I0BA 1TWAJ 1V55H 3CUQC 4G7OF 1W0TA 5E3LA 1Y1VJ 5ICEA 1ZRDA 2M2EA 1SANA 1BBYA 2EILH 1IUFA 2K85A 2KZVA 3V7RA 4XIDA 4XICA 2HYJA 3ZCOA 2GQQA 3D5SC 5DV5A 1KZHA 2BE5F 4NQWB 1W0UA 2LNBA 2X6YA 2XV4S 5ILVA 2BOLA 5EEGA 4YELA 1T8IA 3W3CA 1ZELA 3CCMI 1MIJA 2VB6A 4XOPA 2FQ3A 2E60A 4B43A 4ZYAA 4WXCA 2Z2SB 3RIRA 4TV7A 3KE2A 3AAFA 2DQLA 1T0FA 1ULYA 2IA1A 2O5RA 5GADJ 3GTMJ 3LSPA 1VF9A 4BQOA 5ILUA 3IUOA 3LNQA 2ELJA 2Y0SN 3OYMA 1YITI 2DXIA 3CC7I 5E18F 5D6FA 1BM9A 2K7LA 3OS2A 2GA1A 4AYBA 2HZDA 3BQYA 3FDYA 2LP0A 2KKOA 3JSPA 4PJJA 2EFQA 4UVAA 3C2BA 5E3NA 5K5OA 3O2PE 4XN3A 1ONVA 4BJ6C 2D2WA 4LOCA 4XLCA 3OR2C 5EZHA 3R60A 3S2WA 4U7BA 1P7IA 3WTXC 2F2EA 4G7ZF 3GTGJ 2V1UA 1JE8A 2RAEA 3UR3C 2OU2A 2BVLA 1XB4A 4V2GA 2PJPA 4HRIA 3QPHA 3DP7A 4IEJA 5C3EJ 4BEHA 2IW5A 1YIOA 3FXJA 1HSTA 4DNCA 1NH3A 2NVTJ 4XKCA 2LF8A 5E1ZB 1I6XA 1UHSA 4A6DA 3K70C 1EH6A 4B44A 2X1EA 3HTSB 4HSTA 2A3SA 4GGGA 4BEHB 1X1PA 2DN0A 1JTYA 1V5FA 4BHPA 3A03A 2JUGA 3JREA 1XGMA 2L2OA 2NNYA 1E3OC 1RNLA 2HFHA 5ICFA 5A2QZ 5LFAA 2R0QC 3TW6A 5AONA 4A3JJ 3VYSB 1G8XA 1WH7A 2K3FA 3OSFA 1DUXC 1S6LA 1WVRA 2PI0A 1JHFA 3WGGA 4P9FA 2HVQA 1Z9CA 5L3GA 1FT9A 3QOPA 1JGSA 2L54A 4BL0B 4IRIA 1HDPA 1SD5A 1HKQA 2H6CA 2VXDA 3Q0UA 4OU0A 1U5TA 1A6QA 4FE7A 5DUIA 4E7KA 1XCVA 4IKFA 3OOPA 4RAZA 4Y33A 4L5IA 4KIBA 1G6NA 3REOA 4HA8A 3L2VA 2JA5J 2WADA 3FMQA 1U5TB 2G7UA 3VPRA 1YRNA 3K2AA 2CU7A 4G6QA 4CCMA 5E1XA 1YO5C 2BY1A 1H9GA 5EGOA 4IF4A 3RPQA 2ELHA 5DM7F 5BPIA 3MKWB 3HOZJ 3WU2C 9ANTA 5F6FA 1B72A 2CSOA 3B6CA 2P4WA 1MH4A 1YRNB 1JKPC 1R4NB 1SMYF 1TLHB 2WB1N 5EGOB 5CPRB 3SEQA 5F0HA 2VKHA 3H9GA 3M8JA 3JCUC 3HBLA 2LF7A 3AL0C 1FIAA 5H6RA 1MDMA 2KIFA 1B72B 5JVTA 3HTUA 4WXHA 3EUHC 5DD4A 4HDUA 4EV0A 3IKVA 1IRGA 4XRSA 1D8KA 2KRCA 4QLCU 1BR1A 1Z7LA 3R0JA 2H1LA 4G8XA 4GXOA 4OIQF 3HPGA 2HQNA 3FISA 5IYCJ 1FZPB 4D1QA 5LEKA 2JPCA 4XKWA 2LREA 1VQ7I 2VE8A 3BZKA 3CESA 3CJNA 4M3EA 2JA8J 1X2NA 1IXRC 4EQQA 4HEA2 4BE2A 3SDBA 3E7LA 4E7IA 2EIMH 3FXKA 5KNLA 3H5NA 2PJRA 1ORKA 1R6RA 3ONQA 2VJJA 2DTRA 3BDDA 1G3SA 4PGHA 4L5JA 2XAGA 2JK3A 3BR6A 2E2HJ 4NC8A 2XIGA 1T38A 3S1RJ 2PJRB 2NVQJ 4N4OB 5B1BH 1D0ZA 5JLWA 3CMYA 1AA7A 4EJVA 3OSGA 4C2TA 2EFOA 4F91B 5KK1A 3S15J 5DYMA 4RGSA 1IN6A 3COAC 2P81A 1ZRFA 4Q47A 3O8HA 1MBFA 3MZYA 1LEBA 4B47A 4F93B 1KQ9A 2FBIA 2K9MA 1ETXA 3RPUA 2XASA 1E0EA 2EB7A 2LY2A 2YX7A 5LRSA 2KJCA 1L3LA 3LSGA 3K9TA 1R58A 4XKVA
chains in the Genus database with same CATH topology
1YW8A 3ZMVA 1QNTA 5JFRA 2DK5A 1O3TA 2CWEA 1RUNA 1BJAA 1HXDA 1LDKB 1J59A 1D5VA 1ZGAA 2DT5A 3BJOA 3F3XA 3E5QA 3WTTC 4O6JA 2HYGD 2HS5A 2LKPA 4M6YA 4PDKA 2FOKA 3RJPA 4LG0A 4O3MA 3M1EA 4HF2A 3MWMA 1W7PA 3IKTA 1ZAOA 1DPRA 2EWNA 3ZN0A 4LG0B 3SZPA 2VBYA 4KN4X 3ZMTA 2HR3A 5ICGA 3BY6A 4HOBA 4P96A 1IF1A 4XLNF 1HW2A 5HLGA 4WWCA 3MEXA 2GXBA 2FSWA 3ECHA 1GVJA 5BS6A 2HYFA 2K02A 1D3YA 2IRFG 1FC3A 4ENNA 5AIQA 4EVIA 3TDZC 5IT9K 3KP5A 1W4MA 2G9WA 1IN4A 5D8KB 1PP7U 4U7DA 3BPVA 1TTYA 2OD5A 1YLFA 4DQ2A 1UHMA 4ZH4F 4RB2C 1VTNC 2VONA 1O3SA 1J5YA 1W5SA 2HZTA 4UVBA 1IUYA 3BOQA 4MEYF 4A12A 4HV6A 5L3CA 2OQRA 1XCBA 3G73A 1CF7B 3R6SA 1YW9A 2J5PA 2RVCA 2P5KA 1KU9A 4M9XA 2V6CA 4RGRA 3ML6A 3DEUA 5D5XB 1V4RA 2XAHA 3FWEA 3F8NA 1O7FA 1O57A 4AIHA 1R23A 2DW4A 4I98B 4I2OA 3LQRA 1J7KA 1FBUA 4UV9A 1P4AA 4LB5A 3Q9SA 3TO6A 1B4AA 5D8LB 4I7HA 4I09A 4S04A 4P5OA 5J6XA 1F5TA 1XMKA 3P9IA 5HDGA 1R1VA 1E17A 3F8BA 1J0RA 1W5TA 1TBXA 1F4KA 2RDPA 3GF2A 3HSFA 4ETSA 3GFLA 1OPCA 2NAZA 4A0XA 4HX7A 1I1SA 5A2QK 2IP2A 1UB9A 4H0EA 3CUOA 4HBLA 2E1NA 4G94A 4FX4A 4BXUA 2ZCWA 3JTGA 1AWCA 3K1NA 2V1DA 3RKWA 4RGXA 1HBXG 1IN5A 2RQPA 4OIPF 1LEAA 1Z91A 3BPXA 3IL2A 1KYZA 1FYMA 3KP3A 3V8JA 2H94A 1BIAA 3HUGA 4LJZF 4KICA 1ZREA 3E6DA 1XD7A 2IJLA 3IC7A 1U8RA 1FP2A 2P8TA 5J8CA 3WU1B 4KUMA 3WE3A 4ESFA 3D0SA 3HYIA 5F64A 1QBJA 1SFUA 1R22A 2H6BA 1FBSA 5HDNA 1YS6A 2PBIA 2XGXA 2HKOA 1QZZA 3EUHA 4ON0A 4D0PA 3VEPA 2DBBA 1FSHA 1WI9A 4R1HA 2W24A 1R5HA 4A5NA 2RN7A 2EFPA 1SD4A 3MZHA 4HLYA 4RB0A 2DPUA 3WGIA 1ZG3A 3LA3A 1SMTA 2L4AA 2ZNZA 4JBAA 5BMZA 3J7AO 1KU7A 4CHUA 1G3WA 4AIJA 4BNCA 2DAOA 3FHZA 3T1BA 4ASNA 2ZMEA 3GZ6A 1FWZA 4HDVA 5CVVA 4IRGA 3KFWX 3MAJA 2ZMEB 2OZUA 5HS7A 4S05A 1V3FA 2VT3A 4G9YA 4LLGF 2VBXA 3K1MA 5EEHA 4M71A 1IW7F 1B59A 3PQKA 1JXSA 2O61A 4M73A 3L7WA 3F8FA 2BGCA 5FFXA 4LGWA 1HKTA 4L9NA 3I54A 5H20A 4KMUX 3ZMUA 1T2KA 2QYOA 4Q48A 3Q5FA 1Z1DA 5E17F 4JQFA 4GYGA 2ZBKA 1X3UA 3E97A 1YTYA 2FXAA 3N97A 2RC4A 3HSRA 5ICCA 1L0OC 2RV8A 4AD9A 4KT5C 5L3DA 2ZKZA 3C1DA 1E2XA 1XSXA 1OR7A 4EMSA 4XSZF 1DP7P 4EGZA 5K1YA 1OYYA 3FMRA 4I02A 5DCFA 3EETA 3RKXA 1IXSB 4ZYDA 3RDIA 1T39A 1RUOA 5CVUA 4B8XA 1UHWA 3QU3A 4XBFA 4HX8A 3V7SA 1STZA 3LQQA 1UCRA 2TDXA 3FXQA 1K79A 2VOOA 2WC2A 4A2UA 3LA2A 4AIKA 1XSVA 2QVOA 1LJ9A 3V8LA 2HQRA 4ZYEA 4I01A 3H3UA 2ESNA 3PQJA 5DCMA 2P7CB 4IPAA 3J81Z 3WU0A 4UUVA 4PGGA 1ZARA 3FXRA 5LGUA 2KIUA 3I53A 3WTYC 3E6CC 3ABTA 2BV6A 3WTZA 3FXUA 3JSOA 1P4XA 2K86A 4Y13A 2F5CA 2YX4A 4NHJA 4OIOF 2O0YA 2PQ8A 1Z7UA 2NYXA 4L0YB 1MDMB 2VT2A 5FGMA 5F1RA 3BP8A 5ERIA 4YFNF 3N4MA 2PG4A 4ZYHA 2JSCA 1BI0A 1FYLA 3E3VA 1HW5A 5FD5A 1ZLKA 3LWFA 2ZXJA 4GO1A 4L18B 2VN2A 2G7HA 3W6JB 4HZFA 2ACJA 1Q1HA 2F5EA 3ZP5A 2EV0A 4HX4A 1QQIA 3LFKA 4KN7X 2Z99A 3WGHA 1FYKA 1MZBA 2L01A 2O3FA 1R00A 3QPTA 3O6BB 2GZWA 3GO5A 4KFCA 2FMYA 5J8FA 3MQ0A 4Y17A 3F21A 1BI1A 1LDJA 3ECOA 2JRTA 5JI6A 1J9IA 3F23A 3TGNA 3GX4X 3M8EA 5FLXZ 3KZZA 3M8FA 5D5UB 3RKYA 1U78A 1HSJA 1D8JA 2W57A 2QQBA 2A61A 3DXJF 2RKHA 2STTA 1B6AA 4BH9A 1W7PB 2CYYA 1CGPA 3WODF 3CTAA 2STWA 3U2RA 4K2EA 2JZYA 2XKOA 4LK1F 3ABUA 2P6SA 2HWVA 5LEJA 2J5OA 5H6QA 1I1GA 4P9UA 3ZPLA 2COMA 1OKRA 4EJUA 1WKMA 1GXPA 4OINF 2LSOA 5ILSA 3ROUA 3P9KA 2X0LA 3EYYA 3TQNA 3ZMZA 4UXNA 2CG4A 3JW4A 3DV8A 3F22A 3JTHA 4MQ9F 5BQTA 4HF1A 3IRRA 1O7LA 3KCCA 4R79A 1G4DA 2A07F 1LQ1A 2XAFA 4IRHA 3HOTA 2VOPA 3JAMZ 2DI3A 2XAQA 2WWYA 4MGRA 4CYDA 2O6GE 5LHGA 2F5DA 3C3WA 3FMSA 4KMFA 1H0MA 2GA2A 1U5TC 2A6EF 1ZG1A 2HGCA 4MNUA 2ISZA 3C7JA 2FBKA 5AIPA 4N0BA 2WV0A 5E20A 2OQGA 1WWXA 2OA4A 2OBPA 2H09A 1F1ZA 3H3ZA 1SD6A 1SD7A 2YPRA 3CUQA 3J80Z 2NS0A 4UNOA 2OZ6A 3TOBA 5FD6A 5LHIA 2L3DA 1I27A 1FSEA 4U88A 3E5XA 3HHHA 3CUQB 4OIRF 3KLOA 4WK8F 3GFIA 1TW3A 4KDPA 3HRUA 5LBQA 3V7CA 3U9GA 3EQLF 3KP6A 5CVIA 3MCZA 4L9TA 3HRTA 2M1BA 2K4JA 3FF5A 1TQPA 4NB5A 1K6OA 4WCGA 1ZH5A 3V4GA 3FZVA 1YW7A 3HIFA 2NNNA 1ON1A 3V8KA 1XGNA 2FNAA 1P4WA 1KQ0A 4P55A 1XDSA 1YQAA 3O3KA 4HAMA 1I5ZA 1YS7A 2E7WA 2DO7A 4A5MA 4BYYA 2MBFA 4MHGA 3J81K 2ZO4A 2PLYA 5CYVA 1T6SA 3QAHA 1EV7A 1R1UA 2X4HA 3D5LA 3K69A 1P6RA 1G3YA 1WQ2A 2MH9A 3VOEA 4A0ZA 3M9AA 5L3BA 2VE9A 1REPC 2QM3A 3I0TA 5E8GA 4EM2A 3FX3A 4G7HF 2XHKA 3IWZA 4OMZA 5HVQC 3EDPA 3WTUC 1BC8C 1R7JA 5HLIA 3GVAA 1YFHA 4IVNA 3TO9A 1EH7A 2VBZA 3H92A 3HOSA 3CLOA 1J75A 2DU9A 3R0AA 4XSXF 3GW2A 4ZYGA 2QLZA 3PFIA 2OAZA 5BPDA 2JTVA 4PCQA 2L4MA 4CXFA 1IAWA 2ZJ2A 2MA3A 2GIVA 2CQKA 4N9HA 5HDKA 1Z05A 2M30A 1JHHA 1B9MA 1ZRCA 2C6YA 2V1XA 5D4SA 2FRHA 4M6XA 2A5YB 4N9IA 3HRSA 3LSTA 2VXZA 4Z2YA 3IWFA 2KJBA 3GUDA 2Z33A 4HQEA 1S29A 1XSDA 3NRVA 1TW2A 2HTJA 5KVRA 1DPUA 1PDNC 2Q0OA 4KYWA 2HDCA 1YG2A 3QRFF 3EYIA 1QPMA 3CO6C 5FLXK 4U0VA 2FNPA 3DPLC 3GFJA 1S8NA 1FY7A 4OMYA 3ZN1A 2FF4A 4XRFA 5IT9Z 4EJTA 2K4BA 2W25A 3C18A 2V79A 3GLXA 4PZJA 3KP7A 2YSRA 1MJBA 2FU4A 5DDGA 4ZZDA 2UWMA 4CICA 1ZN2A 1KQ8A 1IN8A 2MLGA 3K0LA 4NQWA 5IT3A 2MLKA 2P6TA 5HOOA 2AXLA 5K5RA 5LLQA 2IVMA 2O8XA 3NQOA 3GXOA 1C0WA 2Z3YA 2XRNA 3QP6A 3VB2A 1TNSA 3ZMSA 2K27A 1B9NA 4Q4ZF 1AOYA 2QQ9A 3M7GA 2XROA 2GXGA 1DDNA 5FB2A 4UVCA 3FM5A 3P9CA 1MGTA 2YR2A 2IPQX 4YG2F 2HOEA 3BJAA 1S7AA 1KA8A 1FLIA 2BYVE 2W85A 1KGSA 3T8TA 1HKSA 4U0YA 3JAMK 5E1WA 2XKPA 4EM0B 2R7DA 4O5VA 3SFZA 2Y0MA 1USSA 3TO7A 5ED4A 3NEUA 3GWZA 1IN7A 2M5WA 2E1CA 3E6BA 3G3ZA 2XVCA 4LB6B 1TQIA 1GHCA 3KZYA 2HEOA 2A69F 5HS9A 4YFXF 1PP8F 1BI2A 2EFWA 1R5GA 6PAXA 2AS5F 3I4PA 4UV8A 5CLSA 4IHSA 1Z6RA 3J80K 3KLNA 3IRQA 3GZ5A 1LDDA 4Q5SF 5DCMB 3ZMDA 2ETHA 1U6GA 3ERED 5E8IA 2EV5A 4MEXF 3DFGA 3I71A 1HW1A 2L02A 4LD5A 1O3QA 4CGZA 3E5UA 3BROA 2PMHA 4A6EA 1MKMA 4WF2A 3RTRA 1MJ9A 4U0WA 1RI7A 2R7FA 3BWGA 3T5XA 2ZFWA 1BIBA 1R1TA 2DQRA 3CO7C 2PEXA 4XLPF 4LLLA 1IZ1A 3B73A 1HQCA 3L2CA 2DK8A 3QP5A 2D1HA 3HSEA 4RB3C 2KIMA 3LA7A 1QO0D 1FPQA 2Q8KA 2EJRA 2RGVA 4I0AA 1NHAA 1U3EM 2ISYA 1XGSA 4CZZA 2DPDA 3DKWA 1BOAA 4BHCA 4M72A 4EJOA 4MTDA 4CDGA 1WSUA 3DPTA 5LGNA 2UXXA 1USTA 3SQNA 3R4KA 4BQAA 3DQVC 4RB1A 2CW0F 3CDHA 3F8CA 5D5WB 4FHTA 3E6MA 4L9JA 4ESJA 2M45A 4LK0F 2KRFA 4FX0A 5TRDA 4M9ZA 3MFKA 2NRAC 1LNWA 2IA2A 1G3TA 2D1VA 1B1BA 2HTSA 5D5VB 3TDUC 3QU6A 1MJAA 4ENMA 4HF0A 3W6KB 2CGPA 3F8MA 3LAPA 3ELKA 2MD5A 4KNYA 2LDUA 5FFZA 3T0YA 1ZYRF 3GEZA 1BC7C 4Y15A 1GXQA 1ZHFA 4MQVA 1EH8A 1F9NA 3F72A 3KP4A 4GYIA 2Z9OA 1XGOA 3RYPA 5DEQA 4EM1A 2EFNA 2H27A 1Y0UA 3SXYA 2QENA 4AWXB 1ZG5A 5JR3A 4LLNA 2A68F 5L3FA 4YIIA 4GCVA 2Z5UA 3K2ZA 4CO8A 1H9TA 3KP2A 1R36A 4A0YA 4RS8A 2P5VA 5K5QA 4AVPA 2P5LC 1QZYA 2F5FA 4MTEA 1WRJA 1PUEE 2IA0A 4ZZLA 2FMLA 3HRMA 1FP1D 2EK5A 4KA4A 5L3EA 2FE3A 2JT1A 4M74A 4FT8A 1FX7A 3LAJA 5HLHA 5BOXA 1A04A 2Y75A 2MC3A 3TKYA 2M8EA 2D45A 3I58A 1CF7A 4YFKF 2Q2EA 5TJJA 3ZQ7A 2BBYA 3TOAA 2GWRA 4IXAA 2EV6A 4HV5A 3WTVC 2QBYA 2R3SA 2PFBA 1SFEA 2GAUA 2W84A 2FEZA 2QBYB 2FBHA 2XAJA 1IXCA 4IHTA 3DF8A 4OOIA 4EGYA 3BJ6A 3WTSC 4UHTA 5CVRA 2UZKA 4WXDA 1W7PD 1FOKA 4QWQA 4HYEA 1P2FA 2V9VA 3SZTA 3GYHX 5CJ9A 3SHFA 3BZ6A 3L9FA 3ULQB 2P7VB 4G6DA 1MD0A 4ESBA 2QUFA 3T8RA 2VC1A 2HKXA 3IHUA 3K1PA 5D6EA 1OYWA 3RYRA 2XUBA 4L0ZB 3R61A 2FA5A 1J2XA 4RGUA 1FBQA 1ZLJA 1ON2A 3L09A 3GFMA 3KEOA 2YU3A 2ESHA 2EA2A 3B02A 1XN7A 3OV8A 3I59A 5LGTA 1SAXA 5LHHA 1LVAA 4YIFA 1P92A 2EA4A 3WTWC 3F6OA 4F7ZA 3KEQA 2BEOA 1XMAA 3I59B 1BN5A 5HS8A 3L00A 2QZ8A 3HHGA 2ZNYA 5DUKA 2O03A 3I64A 4WX9A 4L9VA 4ENJA 1TQMA 1OMIA 1QGPA 4IJAA 1ZGJA 2CFXA 5CVJA 4BHBA 5DD8A 1KYWA 4HW0A 1SFXA 1XDUA 5LRRA 2DFIA 2Y48A 2RNJA 3WG9A 2E7XA 1KU2A 4JK1X 3P7NA 1TNTA 4LFUA 1RIOH 4BAYA 2CO5A 1IRFA 2QQAA 1ODDA 3VFZA 1LB2A 4KIGA 3WE2A 5D4RA 4ENKA 4HQMA 3ISPA 1BI3A 1U2WA 2A6HF 2B0LA 3KETA 5JHUA 1K7AA 4KIFA 1UFMA 1O3RA 3RI4A 4R8HA 2PN6A 2VODA 3Q9VA 3VODA 1K78A 2MH2A 2IT0A 1Z6TA 1S3JA 4M9SA 2QWWA 2JPBA 1K78B 3I5UA 1T98A 2VC0A 1FNNA 2WTEA 4B09A 2VBWA 2ADUA 4E70A 1RZ4A 2M87A 5FO5A 3F6VA 3U1DA 2PMUA 4HLXA 1KU3A 2UXNA 4RAYA 2DLLA 1S7OA 4EJWA 4LMYA 1OYIA 1YYVA 3FM3A 4I0BA 3CUQC 4G7OF 5ICEA 1ZRDA 1BBYA 3V7RA 2GQQA 5DV5A 2BE5F 2LNBA 2XV4S 5ILVA 5EEGA 2FQ3A 4WXCA 3RIRA 4TV7A 3KE2A 3AAFA 2DQLA 1T0FA 1ULYA 2IA1A 5ILUA 5E18F 5D6FA 1BM9A 2K7LA 2GA1A 2KKOA 3JSPA 2EFQA 4UVAA 5K5OA 3O2PE 1ONVA 2D2WA 3S2WA 4U7BA 3WTXC 3R60A 4G7ZF 2F2EA 2V1UA 1JE8A 2OU2A 1XB4A 2PJPA 3QPHA 3DP7A 2IW5A 1YIOA 1HSTA 4DNCA 2LF8A 5E1ZB 1I6XA 4A6DA 1EH6A 3HTSB 2A3SA 4GGGA 4BHPA 1XGMA 2NNYA 1RNLA 2HFHA 5ICFA 5A2QZ 5AONA 1DUXC 1S6LA 2PI0A 1JHFA 3WGGA 4P9FA 1Z9CA 5L3GA 1FT9A 3QOPA 1JGSA 2L54A 4IRIA 1SD5A 1HKQA 2H6CA 4OU0A 1U5TA 5DUIA 1XCVA 3OOPA 4RAZA 4L5IA 4KIBA 1G6NA 3REOA 4HA8A 3FMQA 1U5TB 2G7UA 4G6QA 5E1XA 1YO5C 1H9GA 4IF4A 3RPQA 2ELHA 5BPIA 5F6FA 2CSOA 2P4WA 1SMYF 1TLHB 2LF7A 5H6RA 1MDMA 2KIFA 5JVTA 3HTUA 4WXHA 5DD4A 4HDUA 4EV0A 3IKVA 1IRGA 1D8KA 4QLCU 3R0JA 4G8XA 4GXOA 4OIQF 2HQNA 1FZPB 5LEKA 2JPCA 2VE8A 3CJNA 1IXRC 4EQQA 2DTRA 3BDDA 1G3SA 4PGHA 4L5JA 2XAGA 2XIGA 1T38A 4EJVA 2EFOA 5KK1A 5DYMA 4RGSA 1IN6A 3COAC 1ZRFA 4Q47A 3MZYA 1LEBA 1KQ9A 2FBIA 3RPUA 2XASA 2EB7A 2YX7A 5LRSA 2KJCA 1L3LA 3K9TA 1R58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW8 A;  3ZMV A;  1QNT A;  5JFR A;  2DK5 A;  1O3T A;  2CWE A;  1RUN A;  1BJA A;  1HXD A;  1LDK B;  1J59 A;  1D5V A;  1ZGA A;  2DT5 A;  3BJO A;  3F3X A;  3E5Q A;  3WTT C;  4O6J A;  2HYG D;  2HS5 A;  2LKP A;  4M6Y A;  4PDK A;  2FOK A;  3RJP A;  4LG0 A;  4O3M A;  3M1E A;  4HF2 A;  3MWM A;  1W7P A;  3IKT A;  1ZAO A;  1DPR A;  2EWN A;  3ZN0 A;  4LG0 B;  3SZP A;  2VBY A;  4KN4 X;  3ZMT A;  2HR3 A;  5ICG A;  3BY6 A;  4HOB A;  4P96 A;  1IF1 A;  4XLN F;  1HW2 A;  5HLG A;  4WWC A;  3MEX A;  2GXB A;  2FSW A;  3ECH A;  1GVJ A;  5BS6 A;  2HYF A;  2K02 A;  1D3Y A;  2IRF G;  1FC3 A;  4ENN A;  5AIQ A;  4EVI A;  3TDZ C;  5IT9 K;  3KP5 A;  1W4M A;  2G9W A;  1IN4 A;  5D8K B;  1PP7 U;  4U7D A;  3BPV A;  1TTY A;  2OD5 A;  1YLF A;  4DQ2 A;  1UHM A;  4ZH4 F;  4RB2 C;  1VTN C;  2VON A;  1O3S A;  1J5Y A;  1W5S A;  2HZT A;  4UVB A;  1IUY A;  3BOQ A;  4MEY F;  4A12 A;  4HV6 A;  5L3C A;  2OQR A;  1XCB A;  3G73 A;  1CF7 B;  3R6S A;  1YW9 A;  2J5P A;  2RVC A;  2P5K A;  1KU9 A;  4M9X A;  2V6C A;  4RGR A;  3ML6 A;  3DEU A;  5D5X B;  1V4R A;  2XAH A;  3FWE A;  3F8N A;  1O7F A;  1O57 A;  4AIH A;  1R23 A;  2DW4 A;  4I98 B;  4I2O A;  3LQR A;  1J7K A;  1FBU A;  4UV9 A;  1P4A A;  4LB5 A;  3Q9S A;  3TO6 A;  1B4A A;  5D8L B;  4I7H A;  4I09 A;  4S04 A;  4P5O A;  5J6X A;  1F5T A;  1XMK A;  3P9I A;  5HDG A;  1R1V A;  1E17 A;  3F8B A;  1J0R A;  1W5T A;  1TBX A;  1F4K A;  2RDP A;  3GF2 A;  3HSF A;  4ETS A;  3GFL A;  1OPC A;  2NAZ A;  4A0X A;  4HX7 A;  1I1S A;  5A2Q K;  2IP2 A;  1UB9 A;  4H0E A;  3CUO A;  4HBL A;  2E1N A;  4G94 A;  4FX4 A;  4BXU A;  2ZCW A;  3JTG A;  1AWC A;  3K1N A;  2V1D A;  3RKW A;  4RGX A;  1HBX G;  1IN5 A;  2RQP A;  4OIP F;  1LEA A;  1Z91 A;  3BPX A;  3IL2 A;  1KYZ A;  1FYM A;  3KP3 A;  3V8J A;  2H94 A;  1BIA A;  3HUG A;  4LJZ F;  4KIC A;  1ZRE A;  3E6D A;  1XD7 A;  2IJL A;  3IC7 A;  1U8R A;  1FP2 A;  2P8T A;  5J8C A;  3WU1 B;  4KUM A;  3WE3 A;  4ESF A;  3D0S A;  3HYI A;  5F64 A;  1QBJ A;  1SFU A;  1R22 A;  2H6B A;  1FBS A;  5HDN A;  1YS6 A;  2PBI A;  2XGX A;  2HKO A;  1QZZ A;  3EUH A;  4ON0 A;  4D0P A;  3VEP A;  2DBB A;  1FSH A;  1WI9 A;  4R1H A;  2W24 A;  1R5H A;  4A5N A;  2RN7 A;  2EFP A;  1SD4 A;  3MZH A;  4HLY A;  4RB0 A;  2DPU A;  3WGI A;  1ZG3 A;  3LA3 A;  1SMT A;  2L4A A;  2ZNZ A;  4JBA A;  5BMZ A;  3J7A O;  1KU7 A;  4CHU A;  1G3W A;  4AIJ A;  4BNC A;  2DAO A;  3FHZ A;  3T1B A;  4ASN A;  2ZME A;  3GZ6 A;  1FWZ A;  4HDV A;  5CVV A;  4IRG A;  3KFW X;  3MAJ A;  2ZME B;  2OZU A;  5HS7 A;  4S05 A;  1V3F A;  2VT3 A;  4G9Y A;  4LLG F;  2VBX A;  3K1M A;  5EEH A;  4M71 A;  1IW7 F;  1B59 A;  3PQK A;  1JXS A;  2O61 A;  4M73 A;  3L7W A;  3F8F A;  2BGC A;  5FFX A;  4LGW A;  1HKT A;  4L9N A;  3I54 A;  5H20 A;  4KMU X;  3ZMU A;  1T2K A;  2QYO A;  4Q48 A;  3Q5F A;  1Z1D A;  5E17 F;  4JQF A;  4GYG A;  2ZBK A;  1X3U A;  3E97 A;  1YTY A;  2FXA A;  3N97 A;  2RC4 A;  3HSR A;  5ICC A;  1L0O C;  2RV8 A;  4AD9 A;  4KT5 C;  5L3D A;  2ZKZ A;  3C1D A;  1E2X A;  1XSX A;  1OR7 A;  4EMS A;  4XSZ F;  1DP7 P;  4EGZ A;  5K1Y A;  1OYY A;  3FMR A;  4I02 A;  5DCF A;  3EET A;  3RKX A;  1IXS B;  4ZYD A;  3RDI A;  1T39 A;  1RUO A;  5CVU A;  4B8X A;  1UHW A;  3QU3 A;  4XBF A;  4HX8 A;  3V7S A;  1STZ A;  3LQQ A;  1UCR A;  2TDX A;  3FXQ A;  1K79 A;  2VOO A;  2WC2 A;  4A2U A;  3LA2 A;  4AIK A;  1XSV A;  2QVO A;  1LJ9 A;  3V8L A;  2HQR A;  4ZYE A;  4I01 A;  3H3U A;  2ESN A;  3PQJ A;  5DCM A;  2P7C B;  4IPA A;  3J81 Z;  3WU0 A;  4UUV A;  4PGG A;  1ZAR A;  3FXR A;  5LGU A;  2KIU A;  3I53 A;  3WTY C;  3E6C C;  3ABT A;  2BV6 A;  3WTZ A;  3FXU A;  3JSO A;  1P4X A;  2K86 A;  4Y13 A;  2F5C A;  2YX4 A;  4NHJ A;  4OIO F;  2O0Y A;  2PQ8 A;  1Z7U A;  2NYX A;  4L0Y B;  1MDM B;  2VT2 A;  5FGM A;  5F1R A;  3BP8 A;  5ERI A;  4YFN F;  3N4M A;  2PG4 A;  4ZYH A;  2JSC A;  1BI0 A;  1FYL A;  3E3V A;  1HW5 A;  5FD5 A;  1ZLK A;  3LWF A;  2ZXJ A;  4GO1 A;  4L18 B;  2VN2 A;  2G7H A;  3W6J B;  4HZF A;  2ACJ A;  1Q1H A;  2F5E A;  3ZP5 A;  2EV0 A;  4HX4 A;  1QQI A;  3LFK A;  4KN7 X;  2Z99 A;  3WGH A;  1FYK A;  1MZB A;  2L01 A;  2O3F A;  1R00 A;  3QPT A;  3O6B B;  2GZW A;  3GO5 A;  4KFC A;  2FMY A;  5J8F A;  3MQ0 A;  4Y17 A;  3F21 A;  1BI1 A;  1LDJ A;  3ECO A;  2JRT A;  5JI6 A;  1J9I A;  3F23 A;  3TGN A;  3GX4 X;  3M8E A;  5FLX Z;  3KZZ A;  3M8F A;  5D5U B;  3RKY A;  1U78 A;  1HSJ A;  1D8J A;  2W57 A;  2QQB A;  2A61 A;  3DXJ F;  2RKH A;  2STT A;  1B6A A;  4BH9 A;  1W7P B;  2CYY A;  1CGP A;  3WOD F;  3CTA A;  2STW A;  3U2R A;  4K2E A;  2JZY A;  2XKO A;  4LK1 F;  3ABU A;  2P6S A;  2HWV A;  5LEJ A;  2J5O A;  5H6Q A;  1I1G A;  4P9U A;  3ZPL A;  2COM A;  1OKR A;  4EJU A;  1WKM A;  1GXP A;  4OIN F;  2LSO A;  5ILS A;  3ROU A;  3P9K A;  2X0L A;  3EYY A;  3TQN A;  3ZMZ A;  4UXN A;  2CG4 A;  3JW4 A;  3DV8 A;  3F22 A;  3JTH A;  4MQ9 F;  5BQT A;  4HF1 A;  3IRR A;  1O7L A;  3KCC A;  4R79 A;  1G4D A;  2A07 F;  1LQ1 A;  2XAF A;  4IRH A;  3HOT A;  2VOP A;  3JAM Z;  2DI3 A;  2XAQ A;  2WWY A;  4MGR A;  4CYD A;  2O6G E;  5LHG A;  2F5D A;  3C3W A;  3FMS A;  4KMF A;  1H0M A;  2GA2 A;  1U5T C;  2A6E F;  1ZG1 A;  2HGC A;  4MNU A;  2ISZ A;  3C7J A;  2FBK A;  5AIP A;  4N0B A;  2WV0 A;  5E20 A;  2OQG A;  1WWX A;  2OA4 A;  2OBP A;  2H09 A;  1F1Z A;  3H3Z A;  1SD6 A;  1SD7 A;  2YPR A;  3CUQ A;  3J80 Z;  2NS0 A;  4UNO A;  2OZ6 A;  3TOB A;  5FD6 A;  5LHI A;  2L3D A;  1I27 A;  1FSE A;  4U88 A;  3E5X A;  3HHH A;  3CUQ B;  4OIR F;  3KLO A;  4WK8 F;  3GFI A;  1TW3 A;  4KDP A;  3HRU A;  5LBQ A;  3V7C A;  3U9G A;  3EQL F;  3KP6 A;  5CVI A;  3MCZ A;  4L9T A;  3HRT A;  2M1B A;  2K4J A;  3FF5 A;  1TQP A;  4NB5 A;  1K6O A;  4WCG A;  1ZH5 A;  3V4G A;  3FZV A;  1YW7 A;  3HIF A;  2NNN A;  1ON1 A;  3V8K A;  1XGN A;  2FNA A;  1P4W A;  1KQ0 A;  4P55 A;  1XDS A;  1YQA A;  3O3K A;  4HAM A;  1I5Z A;  1YS7 A;  2E7W A;  2DO7 A;  4A5M A;  4BYY A;  2MBF A;  4MHG A;  3J81 K;  2ZO4 A;  2PLY A;  5CYV A;  1T6S A;  3QAH A;  1EV7 A;  1R1U A;  2X4H A;  3D5L A;  3K69 A;  1P6R A;  1G3Y A;  1WQ2 A;  2MH9 A;  3VOE A;  4A0Z A;  3M9A A;  5L3B A;  2VE9 A;  1REP C;  2QM3 A;  3I0T A;  5E8G A;  4EM2 A;  3FX3 A;  4G7H F;  2XHK A;  3IWZ A;  4OMZ A;  5HVQ C;  3EDP A;  3WTU C;  1BC8 C;  1R7J A;  5HLI A;  3GVA A;  1YFH A;  4IVN A;  3TO9 A;  1EH7 A;  2VBZ A;  3H92 A;  3HOS A;  3CLO A;  1J75 A;  2DU9 A;  3R0A A;  4XSX F;  3GW2 A;  4ZYG A;  2QLZ A;  3PFI A;  2OAZ A;  5BPD A;  2JTV A;  4PCQ A;  2L4M A;  4CXF A;  1IAW A;  2ZJ2 A;  2MA3 A;  2GIV A;  2CQK A;  4N9H A;  5HDK A;  1Z05 A;  2M30 A;  1JHH A;  1B9M A;  1ZRC A;  2C6Y A;  2V1X A;  5D4S A;  2FRH A;  4M6X A;  2A5Y B;  4N9I A;  3HRS A;  3LST A;  2VXZ A;  4Z2Y A;  3IWF A;  2KJB A;  3GUD A;  2Z33 A;  4HQE A;  1S29 A;  1XSD A;  3NRV A;  1TW2 A;  2HTJ A;  5KVR A;  1DPU A;  1PDN C;  2Q0O A;  4KYW A;  2HDC A;  1YG2 A;  3QRF F;  3EYI A;  1QPM A;  3CO6 C;  5FLX K;  4U0V A;  2FNP A;  3DPL C;  3GFJ A;  1S8N A;  1FY7 A;  4OMY A;  3ZN1 A;  2FF4 A;  4XRF A;  5IT9 Z;  4EJT A;  2K4B A;  2W25 A;  3C18 A;  2V79 A;  3GLX A;  4PZJ A;  3KP7 A;  2YSR A;  1MJB A;  2FU4 A;  5DDG A;  4ZZD A;  2UWM A;  4CIC A;  1ZN2 A;  1KQ8 A;  1IN8 A;  2MLG A;  3K0L A;  4NQW A;  5IT3 A;  2MLK A;  2P6T A;  5HOO A;  2AXL A;  5K5R A;  5LLQ A;  2IVM A;  2O8X A;  3NQO A;  3GXO A;  1C0W A;  2Z3Y A;  2XRN A;  3QP6 A;  3VB2 A;  1TNS A;  3ZMS A;  2K27 A;  1B9N A;  4Q4Z F;  1AOY A;  2QQ9 A;  3M7G A;  2XRO A;  2GXG A;  1DDN A;  5FB2 A;  4UVC A;  3FM5 A;  3P9C A;  1MGT A;  2YR2 A;  2IPQ X;  4YG2 F;  2HOE A;  3BJA A;  1S7A A;  1KA8 A;  1FLI A;  2BYV E;  2W85 A;  1KGS A;  3T8T A;  1HKS A;  4U0Y A;  3JAM K;  5E1W A;  2XKP A;  4EM0 B;  2R7D A;  4O5V A;  3SFZ A;  2Y0M A;  1USS A;  3TO7 A;  5ED4 A;  3NEU A;  3GWZ A;  1IN7 A;  2M5W A;  2E1C A;  3E6B A;  3G3Z A;  2XVC A;  4LB6 B;  1TQI A;  1GHC A;  3KZY A;  2HEO A;  2A69 F;  5HS9 A;  4YFX F;  1PP8 F;  1BI2 A;  2EFW A;  1R5G A;  6PAX A;  2AS5 F;  3I4P A;  4UV8 A;  5CLS A;  4IHS A;  1Z6R A;  3J80 K;  3KLN A;  3IRQ A;  3GZ5 A;  1LDD A;  4Q5S F;  5DCM B;  3ZMD A;  2ETH A;  1U6G A;  3ERE D;  5E8I A;  2EV5 A;  4MEX F;  3DFG A;  3I71 A;  1HW1 A;  2L02 A;  4LD5 A;  1O3Q A;  4CGZ A;  3E5U A;  3BRO A;  2PMH A;  4A6E A;  1MKM A;  4WF2 A;  3RTR A;  1MJ9 A;  4U0W A;  1RI7 A;  2R7F A;  3BWG A;  3T5X A;  2ZFW A;  1BIB A;  1R1T A;  2DQR A;  3CO7 C;  2PEX A;  4XLP F;  4LLL A;  1IZ1 A;  3B73 A;  1HQC A;  3L2C A;  2DK8 A;  3QP5 A;  2D1H A;  3HSE A;  4RB3 C;  2KIM A;  3LA7 A;  1QO0 D;  1FPQ A;  2Q8K A;  2EJR A;  2RGV A;  4I0A A;  1NHA A;  1U3E M;  2ISY A;  1XGS A;  4CZZ A;  2DPD A;  3DKW A;  1BOA A;  4BHC A;  4M72 A;  4EJO A;  4MTD A;  4CDG A;  1WSU A;  3DPT A;  5LGN A;  2UXX A;  1UST A;  3SQN A;  3R4K A;  4BQA A;  3DQV C;  4RB1 A;  2CW0 F;  3CDH A;  3F8C A;  5D5W B;  4FHT A;  3E6M A;  4L9J A;  4ESJ A;  2M45 A;  4LK0 F;  2KRF A;  4FX0 A;  5TRD A;  4M9Z A;  3MFK A;  2NRA C;  1LNW A;  2IA2 A;  1G3T A;  2D1V A;  1B1B A;  2HTS A;  5D5V B;  3TDU C;  3QU6 A;  1MJA A;  4ENM A;  4HF0 A;  3W6K B;  2CGP A;  3F8M A;  3LAP A;  3ELK A;  2MD5 A;  4KNY A;  2LDU A;  5FFZ A;  3T0Y A;  1ZYR F;  3GEZ A;  1BC7 C;  4Y15 A;  1GXQ A;  1ZHF A;  4MQV A;  1EH8 A;  1F9N A;  3F72 A;  3KP4 A;  4GYI A;  2Z9O A;  1XGO A;  3RYP A;  5DEQ A;  4EM1 A;  2EFN A;  2H27 A;  1Y0U A;  3SXY A;  2QEN A;  4AWX B;  1ZG5 A;  5JR3 A;  4LLN A;  2A68 F;  5L3F A;  4YII A;  4GCV A;  2Z5U A;  3K2Z A;  4CO8 A;  1H9T A;  3KP2 A;  1R36 A;  4A0Y A;  4RS8 A;  2P5V A;  5K5Q A;  4AVP A;  2P5L C;  1QZY A;  2F5F A;  4MTE A;  1WRJ A;  1PUE E;  2IA0 A;  4ZZL A;  2FML A;  3HRM A;  1FP1 D;  2EK5 A;  4KA4 A;  5L3E A;  2FE3 A;  2JT1 A;  4M74 A;  4FT8 A;  1FX7 A;  3LAJ A;  5HLH A;  5BOX A;  1A04 A;  2Y75 A;  2MC3 A;  3TKY A;  2M8E A;  2D45 A;  3I58 A;  1CF7 A;  4YFK F;  2Q2E A;  5TJJ A;  3ZQ7 A;  2BBY A;  3TOA A;  2GWR A;  4IXA A;  2EV6 A;  4HV5 A;  3WTV C;  2QBY A;  2R3S A;  2PFB A;  1SFE A;  2GAU A;  2W84 A;  2FEZ A;  2QBY B;  2FBH A;  2XAJ A;  1IXC A;  4IHT A;  3DF8 A;  4OOI A;  4EGY A;  3BJ6 A;  3WTS C;  4UHT A;  5CVR A;  2UZK A;  4WXD A;  1W7P D;  1FOK A;  4QWQ A;  4HYE A;  1P2F A;  2V9V A;  3SZT A;  3GYH X;  5CJ9 A;  3SHF A;  3BZ6 A;  3L9F A;  3ULQ B;  2P7V B;  4G6D A;  1MD0 A;  4ESB A;  2QUF A;  3T8R A;  2VC1 A;  2HKX A;  3IHU A;  3K1P A;  5D6E A;  1OYW A;  3RYR A;  2XUB A;  4L0Z B;  3R61 A;  2FA5 A;  1J2X A;  4RGU A;  1FBQ A;  1ZLJ A;  1ON2 A;  3L09 A;  3GFM A;  3KEO A;  2YU3 A;  2ESH A;  2EA2 A;  3B02 A;  1XN7 A;  3OV8 A;  3I59 A;  5LGT A;  1SAX A;  5LHH A;  1LVA A;  4YIF A;  1P92 A;  2EA4 A;  3WTW C;  3F6O A;  4F7Z A;  3KEQ A;  2BEO A;  1XMA A;  3I59 B;  1BN5 A;  5HS8 A;  3L00 A;  2QZ8 A;  3HHG A;  2ZNY A;  5DUK A;  2O03 A;  3I64 A;  4WX9 A;  4L9V A;  4ENJ A;  1TQM A;  1OMI A;  1QGP A;  4IJA A;  1ZGJ A;  2CFX A;  5CVJ A;  4BHB A;  5DD8 A;  1KYW A;  4HW0 A;  1SFX A;  1XDU A;  5LRR A;  2DFI A;  2Y48 A;  2RNJ A;  3WG9 A;  2E7X A;  1KU2 A;  4JK1 X;  3P7N A;  1TNT A;  4LFU A;  1RIO H;  4BAY A;  2CO5 A;  1IRF A;  2QQA A;  1ODD A;  3VFZ A;  1LB2 A;  4KIG A;  3WE2 A;  5D4R A;  4ENK A;  4HQM A;  3ISP A;  1BI3 A;  1U2W A;  2A6H F;  2B0L A;  3KET A;  5JHU A;  1K7A A;  4KIF A;  1UFM A;  1O3R A;  3RI4 A;  4R8H A;  2PN6 A;  2VOD A;  3Q9V A;  3VOD A;  1K78 A;  2MH2 A;  2IT0 A;  1Z6T A;  1S3J A;  4M9S A;  2QWW A;  2JPB A;  1K78 B;  3I5U A;  1T98 A;  2VC0 A;  1FNN A;  2WTE A;  4B09 A;  2VBW A;  2ADU A;  4E70 A;  1RZ4 A;  2M87 A;  5FO5 A;  3F6V A;  3U1D A;  2PMU A;  4HLX A;  1KU3 A;  2UXN A;  4RAY A;  2DLL A;  1S7O A;  4EJW A;  4LMY A;  1OYI A;  1YYV A;  3FM3 A;  4I0B A;  3CUQ C;  4G7O F;  5ICE A;  1ZRD A;  1BBY A;  3V7R A;  2GQQ A;  5DV5 A;  2BE5 F;  2LNB A;  2XV4 S;  5ILV A;  5EEG A;  2FQ3 A;  4WXC A;  3RIR A;  4TV7 A;  3KE2 A;  3AAF A;  2DQL A;  1T0F A;  1ULY A;  2IA1 A;  5ILU A;  5E18 F;  5D6F A;  1BM9 A;  2K7L A;  2GA1 A;  2KKO A;  3JSP A;  2EFQ A;  4UVA A;  5K5O A;  3O2P E;  1ONV A;  2D2W A;  3S2W A;  4U7B A;  3WTX C;  3R60 A;  4G7Z F;  2F2E A;  2V1U A;  1JE8 A;  2OU2 A;  1XB4 A;  2PJP A;  3QPH A;  3DP7 A;  2IW5 A;  1YIO A;  1HST A;  4DNC A;  2LF8 A;  5E1Z B;  1I6X A;  4A6D A;  1EH6 A;  3HTS B;  2A3S A;  4GGG A;  4BHP A;  1XGM A;  2NNY A;  1RNL A;  2HFH A;  5ICF A;  5A2Q Z;  5AON A;  1DUX C;  1S6L A;  2PI0 A;  1JHF A;  3WGG A;  4P9F A;  1Z9C A;  5L3G A;  1FT9 A;  3QOP A;  1JGS A;  2L54 A;  4IRI A;  1SD5 A;  1HKQ A;  2H6C A;  4OU0 A;  1U5T A;  5DUI A;  1XCV A;  3OOP A;  4RAZ A;  4L5I A;  4KIB A;  1G6N A;  3REO A;  4HA8 A;  3FMQ A;  1U5T B;  2G7U A;  4G6Q A;  5E1X A;  1YO5 C;  1H9G A;  4IF4 A;  3RPQ A;  2ELH A;  5BPI A;  5F6F A;  2CSO A;  2P4W A;  1SMY F;  1TLH B;  2LF7 A;  5H6R A;  1MDM A;  2KIF A;  5JVT A;  3HTU A;  4WXH A;  5DD4 A;  4HDU A;  4EV0 A;  3IKV A;  1IRG A;  1D8K A;  4QLC U;  3R0J A;  4G8X A;  4GXO A;  4OIQ F;  2HQN A;  1FZP B;  5LEK A;  2JPC A;  2VE8 A;  3CJN A;  1IXR C;  4EQQ A;  2DTR A;  3BDD A;  1G3S A;  4PGH A;  4L5J A;  2XAG A;  2XIG A;  1T38 A;  4EJV A;  2EFO A;  5KK1 A;  5DYM A;  4RGS A;  1IN6 A;  3COA C;  1ZRF A;  4Q47 A;  3MZY A;  1LEB A;  1KQ9 A;  2FBI A;  3RPU A;  2XAS A;  2EB7 A;  2YX7 A;  5LRS A;  2KJC A;  1L3L A;  3K9T A;  1R58 A; 
#chains in the Genus database with same CATH topology
 4P1W A;  2R5Z A;  3QQA A;  3FBI B;  1YW8 A;  3ZMV A;  1QNT A;  1Z3Y A;  2DK5 A;  5JFR A;  1O3T A;  2CWE A;  1RUN A;  2V9P A;  2NVX J;  1BJA A;  1HXD A;  4CZC A;  4XQF A;  1LDK B;  1J59 A;  1D5V A;  2R5Z B;  1ZGA A;  2DT5 A;  2EZL A;  4A3K J;  3BJO A;  3F3X A;  3E5Q A;  3WTT C;  4O6J A;  2HYG D;  3O8G A;  2HS5 A;  3HEF A;  3H0D A;  2LKP A;  3BTI A;  4M6Y A;  4PDK A;  2FOK A;  2UV1 A;  3H35 A;  3RJP A;  3DCF A;  3AG2 H;  4LG0 A;  4O3M A;  1MBG A;  3M1E A;  4HF2 A;  4W1U A;  3MWM A;  1W7P A;  3IKT A;  1ZAO A;  3SZG A;  1DPR A;  1ETV A;  2EWN A;  1QU3 A;  3GTP J;  3ZN0 A;  4W97 A;  4LG0 B;  3SZP A;  2XPU A;  2DFE A;  3CDI A;  2VBY A;  1R9T J;  4KN4 X;  3RZO J;  2MC4 A;  1H8A C;  1ETW A;  3CCS I;  3S2H J;  3L2R A;  1UJ8 A;  1S7E A;  1Z0X A;  2LY1 A;  3A0H C;  3CF2 A;  1HOM A;  1ERD A;  3ZMT A;  2HR3 A;  2HVS A;  5ICG A;  3BY6 A;  2E1M B;  5M5W J;  4HOB A;  1YJN I;  4ITV A;  2N8G A;  4P96 A;  1IF1 A;  1LFB A;  4XLN F;  1HW2 A;  2K9L A;  1OR7 C;  2DMP A;  5KAI C;  5HLG A;  4WWC A;  2R7W A;  4B3A A;  5C44 J;  3CJR B;  3MEX A;  2Y9Z A;  1ZR2 A;  2XGC A;  2GXB A;  2FSW A;  1X3W B;  3OS0 A;  3ECH A;  1GVJ A;  3SFI A;  5BS6 A;  3TP3 A;  2VKV A;  2HYF A;  3CJQ B;  2L7K A;  3AG3 H;  2X9D A;  2K02 A;  4A3E J;  1D3Y A;  2IRF G;  3CC2 I;  1FC3 A;  1ETO A;  4ENN A;  3L1P A;  5AIQ A;  2MSY A;  1YX3 A;  4EVI A;  2X1D A;  2M9H A;  3TDZ C;  5IT9 K;  3CZ6 A;  4KIS A;  4I6Z A;  3KP5 A;  1W4M A;  2G9W A;  3ZQG A;  1IN4 A;  3J7A Y;  5D8K B;  4MIM A;  3OS1 A;  1PP7 U;  4DYQ A;  4U7D A;  3HM5 A;  3BPV A;  3H1C A;  4A3G J;  1MND A;  1R71 A;  2CJJ A;  1TTY A;  2OD5 A;  1YLF A;  4DQ2 A;  1UHM A;  5GPA A;  1XMX A;  4ZH4 F;  4RB2 C;  4HG2 A;  2W00 A;  1VTN C;  3HOX J;  2VPR A;  2VON A;  4ANJ A;  3GZN B;  2P0W A;  1O3S A;  3MN2 A;  1I39 A;  1J5Y A;  4DZJ A;  3AFH A;  1W5S A;  5FKO A;  1JTX A;  2HZT A;  4UVB A;  1IUY A;  3BOQ A;  4MEY F;  1VQ9 I;  4A12 A;  4HV6 A;  5L3C A;  4AM3 A;  3D5R C;  2OQR A;  1XCB A;  3DLA A;  3G73 A;  2DT7 B;  4DJA A;  1CF7 B;  1BR4 A;  4A3F J;  2XPW A;  3R6S A;  1XS9 A;  3ZQI A;  1YW9 A;  2J5P A;  2RVC A;  2P5K A;  1KU9 A;  4M9X A;  1ZK8 A;  1X4P A;  2V6C A;  4RGR A;  3ML6 A;  3DEU A;  3G4S I;  5D5X B;  1X1B A;  5IYD J;  2ZXW H;  3BR5 A;  1V4R A;  1FTT A;  2XAH A;  4G12 A;  3FWE A;  4D5C A;  3F8N A;  4U87 A;  2NVU B;  2R7Z J;  1O7F A;  4V2F A;  1RR8 C;  2CS3 A;  3CC4 I;  3NWT A;  1S5L C;  1O57 A;  1K61 A;  4AIH A;  1R23 A;  2DW4 A;  1LUJ B;  2LKS A;  3SJM A;  3CDL A;  3DLL F;  4I98 B;  3ZQH A;  4I2O A;  3LQR A;  4IZZ A;  1J7K A;  1FBU A;  4UV9 A;  1P4A A;  2GOX B;  4LB5 A;  3M07 A;  3KYL A;  1YI2 I;  1SAU A;  3Q9S A;  1X1C A;  2JMW A;  3PUF A;  2AQF A;  3TO6 A;  1BJZ A;  3LSR A;  1B4A A;  3FK6 A;  5D8L B;  1HC8 A;  4I7H A;  1RKW A;  1SEU A;  4I09 A;  4S04 A;  3ASO H;  5E3M A;  4M3B A;  1R49 A;  1H88 C;  2R7V A;  4P5O A;  5J6X A;  1F5T A;  1ZTR A;  1Z77 A;  1XMK A;  4IX7 A;  1X3Z B;  2XF5 A;  3P9I A;  2JVG A;  5F04 A;  4RA2 A;  5HDG A;  1R1V A;  1VFC A;  2XPV A;  1E17 A;  4X1E A;  2ZFU A;  2DA3 A;  3F8B A;  2CUE A;  1XTA A;  1J0R A;  2HXI A;  4II2 A;  3MKL A;  4BY1 J;  2CQN A;  3LSH A;  3EUA A;  3IAM 2;  1W5T A;  2R92 J;  1TBX A;  3KIO A;  3K4K A;  1F4K A;  2RDP A;  3GF2 A;  3HSF A;  1VQO I;  4G6T B;  4ETS A;  2FD5 A;  3GFL A;  1OPC A;  2NAZ A;  4A0X A;  4HX7 A;  1I1S A;  3QWL A;  5A2Q K;  2IP2 A;  5GAE J;  1UB9 A;  4FQG A;  3CCJ I;  2YS9 A;  4H0E A;  3CUO A;  3OYD A;  4HBL A;  3RCO A;  2E1N A;  4G94 A;  1WFX A;  4DW6 A;  4HNU A;  4FX4 A;  1RC9 A;  1N75 A;  1V5G A;  4BXU A;  2VI6 A;  2ZCW A;  3JTG A;  1AWC A;  2CV1 A;  5F08 A;  2JA7 J;  3K1N A;  2V1D A;  3RKW A;  4C3J J;  4A3M J;  3CCU I;  4RGX A;  3OYI A;  1HBX G;  4KJZ A;  2FOW A;  1BOB A;  1IN5 A;  2PMZ N;  2RQP A;  4OIP F;  1IDY A;  1LEA A;  1Z91 A;  4F3Q A;  3BPX A;  3IL2 A;  2YU9 J;  1KYZ A;  2VQG A;  3OMY A;  4JX4 A;  1FYM A;  3KP3 A;  3V8J A;  2H94 A;  1BIA A;  4CSW A;  2O8K A;  4HPQ A;  3HUG A;  5EF6 A;  2NOG A;  4LJZ F;  4KIC A;  4XOR A;  1ZRE A;  4C9Y A;  3E6D A;  1XD7 A;  2IJL A;  3IC7 A;  1U8R A;  1FP2 A;  2P8T A;  5J8C A;  2LD5 A;  1QPI A;  3OYH A;  4IHX A;  1VND A;  2K3P A;  4EAT A;  4CUG A;  3HUG B;  4NUB A;  3X2Q H;  3MD2 A;  3WU1 B;  4KUM A;  3WE3 A;  1FJL A;  4ESF A;  1VQ4 I;  3MKZ A;  3D0S A;  3HYI A;  5B66 C;  3TMO A;  3AG1 H;  5F64 A;  3DTK A;  1QBJ A;  4E7Z A;  3PIO F;  2XC7 A;  2KQR A;  2WY8 Q;  2I8D A;  2CQQ A;  3A02 A;  1JT6 A;  1SFU A;  1R22 A;  2H6B A;  1OJL A;  1FBS A;  5J47 A;  2L5Q A;  2PX9 A;  4BS9 A;  2XGD A;  2E35 A;  5HDN A;  1NTC A;  1YHQ I;  1YS6 A;  2IEK A;  2PBI A;  2XGX A;  4BY7 J;  4C30 A;  1ZQ3 P;  2HKO A;  1QZZ A;  3EUH A;  4ON0 A;  2QEX I;  2Y9Y A;  1FTZ A;  3LSK A;  4D0P A;  3VEP A;  2WAQ N;  4PJL A;  2DBB A;  1JGG A;  1FSH A;  4I99 C;  1WI9 A;  5KHD A;  2M7B A;  4R1H A;  2W24 A;  1R5H A;  3DEW A;  4A5N A;  1AKH A;  1R4M B;  2RN7 A;  2QSH X;  2EFP A;  1SD4 A;  5F0F A;  3MZH A;  1JJ8 C;  2OC6 A;  2KL4 A;  2LVS A;  3E0J B;  2B63 J;  3Q3S A;  4HLY A;  4RB0 A;  2DPU A;  4XNF A;  3F9K A;  3WGI A;  2R93 J;  1ZG3 A;  3LA3 A;  4YIR X;  1SMT A;  4BXX J;  1WJD A;  1AKH B;  2K5C A;  1A5J A;  2L4A A;  3QYF A;  2ZNZ A;  4JBA A;  5BMZ A;  3J7A O;  1KU7 A;  2HVR A;  2NOJ B;  2XSJ C;  2L9R A;  4CHU A;  1U9N A;  4J01 A;  1G3W A;  2V9K A;  4AIJ A;  1TWG J;  3H5R A;  3OYG A;  3CCQ I;  2DAO A;  4BNC A;  1EF4 A;  3FHZ A;  1YJ9 I;  3T1B A;  4ASN A;  2M0C A;  2ZME A;  3GZ6 A;  1FWZ A;  4HDV A;  5CVV A;  4IRG A;  2WV1 A;  3KFW X;  3VWB A;  5HNH A;  3MAJ A;  1U0J A;  3VSK A;  2ZME B;  1I3A A;  2ZC2 A;  2OZU A;  2X51 A;  5HS7 A;  4XM3 A;  4S05 A;  2DA7 A;  1V3F A;  2M7A A;  2VT3 A;  1H89 C;  1JI8 A;  2QA4 I;  4G9Y A;  4LLG F;  2MD0 A;  2VBX A;  3K1M A;  4AYB N;  3ABK H;  5EEH A;  3PM1 A;  2F4M B;  4M71 A;  3GLL A;  2HQ5 A;  1IW7 F;  2IXS A;  1B8I A;  3U1K A;  4ZDO A;  3A01 A;  1B59 A;  2CRG A;  3ABM H;  3PQK A;  1W1W E;  1JXS A;  2O61 A;  4M73 A;  3L7W A;  3F8F A;  2BGC A;  5FFX A;  4LGW A;  1HKT A;  3GTQ J;  2ZXI A;  4L9N A;  3PO3 J;  1B8I B;  1TL8 A;  3I54 A;  2BY3 A;  3AKZ A;  3A01 B;  5H20 A;  3VSL A;  4KMU X;  3ZMU A;  4NDL A;  1TWH J;  1T2K A;  2QYO A;  4II3 A;  1XX5 A;  3NAR A;  4Q48 A;  3Q5F A;  3K4L A;  5J1R A;  4UY8 I;  1S9H A;  1Z1D A;  2DDB A;  4KIT B;  5E17 F;  4JQF A;  4GYG A;  2KPM A;  2ZBK A;  4IQJ A;  4E4H A;  3GBG A;  1X3U A;  2COB A;  2CUZ A;  3E97 A;  1TT0 A;  4IO9 F;  2K9S A;  5B3S H;  3E1S A;  2Z1D A;  1YTY A;  3JRG A;  2FXA A;  2NXN B;  5EZG A;  3N97 A;  1X19 A;  4CCK A;  1WJE A;  2RC4 A;  3HSR A;  1PJR A;  2IS2 A;  5ICC A;  1L0O C;  2RV8 A;  4AD9 A;  4KT5 C;  2TCT A;  4XLF A;  2XB0 X;  4BXF A;  5L3D A;  2ZKZ A;  5M3F J;  2R5Y A;  3C1D A;  1E2X A;  1XSX A;  1OR7 A;  4EMS A;  4XSZ F;  3MZ8 A;  1DP7 P;  3S17 J;  4EGZ A;  3QOE A;  5K1Y A;  4IOA F;  1OYY A;  1I50 J;  2HQA A;  3FMR A;  3KZI C;  2ICW G;  2R7Q A;  4NNJ A;  3OYB A;  2R5Y B;  2CMP A;  3NAU A;  4I02 A;  5DCF A;  3FXO A;  3EET A;  3RKX A;  3DWL E;  1IXS B;  4ZYD A;  4E7J A;  1UAA A;  3RDI A;  3GME A;  1T39 A;  4MLO A;  1RUO A;  1GVD A;  5DTD A;  5CVU A;  4B8X A;  4FIS A;  1UHW A;  2M8G X;  3QU3 A;  3S1M J;  1GUU A;  3HOV J;  1IV6 A;  2GLO A;  4XBF A;  1WCM J;  1SFK A;  4HX8 A;  3V7S A;  4BJ5 C;  1STZ A;  1IJW C;  1JUM A;  3LQQ A;  3PNT A;  1UCR A;  2TDX A;  3FXQ A;  1K79 A;  2VOO A;  2WC2 A;  4A2U A;  3LA2 A;  2ZB9 A;  4AIK A;  4BAC A;  1LE8 A;  1TP4 A;  1XSV A;  2QVO A;  1LJ9 A;  1DGR M;  4BQQ A;  3V8L A;  2OUM A;  2HQR A;  4ZYE A;  1EKE A;  3FXL A;  4I01 A;  5F1J A;  3H3U A;  3IAS 2;  2ESN A;  2D5V A;  1TWC J;  3PQJ A;  5DCM A;  4IPA A;  5J3L A;  3J81 Z;  2P7C B;  4Y7N J;  3WU0 A;  4UUV A;  1ACI A;  1MSF C;  3BCA A;  2JRM A;  2F5V A;  4PGG A;  1TC3 C;  3BLY A;  1ITY A;  3OYN A;  1ZAR A;  3FXR A;  5LGU A;  2KIU A;  3I53 A;  4M3F A;  3WTY C;  4A69 C;  3WG7 H;  5M5Y J;  3E6C C;  3ABT A;  1RET A;  1ZR4 A;  2VAS A;  2BV6 A;  3WTZ A;  3PSF A;  4ZDP A;  2OTL I;  3S8P A;  3FXU A;  3JSO A;  3CF5 F;  1FIP A;  1P4X A;  3GTL J;  1WJC A;  2K86 A;  4Y13 A;  2F5C A;  1A35 A;  1BA5 A;  2KT0 A;  2YX4 A;  4NHJ A;  4OIO F;  2KHM A;  2O0Y A;  2E34 A;  2PQ8 A;  4B1R A;  1Z7U A;  2NYX A;  4L0Y B;  3KYD B;  1MDM B;  2VT2 A;  5FGM A;  5F1R A;  3BP8 A;  5ERI A;  4YFN F;  1DQU A;  3N4M A;  2PG4 A;  4V19 K;  3P5J A;  2DYS H;  4ZYH A;  2JSC A;  2O9L A;  1BI0 A;  1MNE A;  4LIT A;  1FYL A;  3E3V A;  1M1E B;  1HW5 A;  3H5A A;  3J7Y J;  1QA6 A;  1UG0 A;  2K40 A;  5FD5 A;  4UUS A;  1ZLK A;  3HL2 A;  3PL8 A;  2MYS A;  3PIP F;  2HOS A;  1SVO A;  4YEJ A;  3LWF A;  2ZJR F;  2ZXJ A;  4GO1 A;  4L18 B;  2VN2 A;  4CH7 A;  1ZGW A;  2G7H A;  3W6J B;  4HZF A;  3LFU A;  4AID A;  1WH5 A;  1K6Y A;  3WHB A;  1XG1 A;  2BHZ A;  2ACJ A;  2QF7 A;  1Q1H A;  1W36 D;  1VQ6 I;  1JKQ C;  1IV8 A;  2F5E A;  3ZP5 A;  2KP6 A;  2EV0 A;  4HX4 A;  1QQI A;  3LFK A;  4KN7 X;  2K9Q A;  2Z99 A;  3WGH A;  5E3O A;  1FYK A;  1HCR A;  1LFP A;  1MZB A;  4CCN A;  2L01 A;  2BHY A;  1PYV A;  2O3F A;  1R00 A;  3QPT A;  1MW7 A;  3O6B B;  2MAB A;  1UEL B;  2GZW A;  3PO2 J;  3GO5 A;  4KFC A;  1FOW A;  2FMY A;  5J8F A;  4X6A J;  1F43 A;  2WAE A;  1Q1V A;  3MQ0 A;  2RQQ A;  3LMM A;  4Y17 A;  3F21 A;  2R7S A;  3ABL H;  1J09 A;  1BI1 A;  1LDJ A;  3ECO A;  4A3C J;  2JRT A;  5JI6 A;  1J9I A;  1QHH D;  3BR2 A;  3F23 A;  2LYC A;  3TGN A;  5CKT A;  4F52 A;  3GX4 X;  3M8E A;  2NVY J;  3K4J A;  1HF0 A;  5FLX Z;  4IOC F;  3KZZ A;  3M8F A;  4A93 J;  4FET A;  4NC6 A;  5GAG J;  5D5U B;  4AVZ A;  1TT5 B;  3RKY A;  1WZ2 A;  2LR8 A;  1U78 A;  1HSJ A;  3TP0 A;  1GT0 C;  1D8J A;  2W57 A;  4UB8 C;  5TIS C;  2DA1 A;  2DFH A;  2GBY A;  2QQB A;  2A61 A;  3F0C A;  3DXJ F;  2RKH A;  2XAU A;  3ZQL A;  2STT A;  1B6A A;  1ENH A;  4BH9 A;  3KEY A;  4E7H A;  1W7P B;  2CYY A;  4HNV A;  2V4J C;  1CGP A;  4UB6 C;  3WOD F;  2VLA A;  3CTA A;  2STW A;  3U2R A;  3OYL A;  4K2E A;  5KAF C;  1VQK I;  1JUP A;  2JZY A;  2XKO A;  4LK1 F;  4I76 A;  4BGD A;  3ABU A;  2P6S A;  4BQN A;  2HWV A;  3EUK L;  5LEJ A;  1MBE A;  4BDY A;  2QKL B;  1Y8R B;  2J5O A;  5H6Q A;  4D9J A;  2NS8 A;  1I1G A;  3CCY A;  2E1O A;  3BR1 A;  3LSM A;  4P9U A;  4MO7 A;  3ZPL A;  1W36 C;  2COM A;  1MBJ A;  1OKR A;  3UNG C;  4EJU A;  3HKZ A;  5FRN A;  5B1A H;  1WKM A;  1N77 A;  3CJT B;  2K9N A;  1GXP A;  4OIN F;  2JSP A;  4RBO A;  5DS9 A;  3S3N A;  4XON A;  2LSO A;  1PUF A;  2LBF A;  4JX6 A;  4A3B J;  2XGE A;  3OYA A;  2EIK H;  5ILS A;  5FLM J;  1FMV A;  3ROU A;  3P9K A;  2X0L A;  3EYY A;  2M4K A;  3TQN A;  4UXN A;  3ZMZ A;  2CG4 A;  3RQI A;  2LBF B;  1K4T A;  3JW4 A;  4DYC A;  2EIN H;  2HOA A;  3CP2 A;  2V7F A;  3DV8 A;  3F22 A;  3JTH A;  2EH3 A;  1MBK A;  4MQ9 F;  3ZGK A;  2IGN A;  1OCP A;  2LRD A;  5BQT A;  4HF1 A;  3ZR8 X;  3IRR A;  1O7L A;  3KCC A;  4R79 A;  1G4D A;  5EJC A;  2A07 F;  1LQ1 A;  3HZJ A;  2VPL A;  2XAF A;  4F92 B;  4IRH A;  1OLT A;  3HOT A;  2X6W A;  2VQL A;  2VOP A;  3JAM Z;  3GTO J;  2X48 A;  2KZG A;  2DI3 A;  3K4B A;  2XAQ A;  2WWY A;  4CA0 A;  4MGR A;  4CYD A;  2O6G E;  2X85 A;  5LHG A;  3DU6 A;  2F5D A;  3C3W A;  3FMS A;  4KMF A;  1H0M A;  2BXZ A;  2DFF A;  2GA2 A;  1U5T C;  1YOV B;  2A6E F;  2B7E A;  1ZG1 A;  2HGC A;  2E2J J;  2DA6 A;  4MNU A;  3RPU D;  2ISZ A;  1YE9 A;  3C7J A;  2FBK A;  3M4O J;  5AIP A;  4N0B A;  2KDO A;  2JN6 A;  2ID3 A;  5HOD A;  3FHN A;  2WV0 A;  5LD2 C;  2X6X A;  4Y52 J;  5E20 A;  1X58 A;  2BZT A;  2OQG A;  1WWX A;  2OA4 A;  2OBP A;  3HXL A;  2H09 A;  1BL0 A;  2IS6 A;  1F1Z A;  2LKX A;  3H3Z A;  1SD6 A;  1SD7 A;  2YPR A;  3CUQ A;  3J80 Z;  2CQ7 A;  2NS0 A;  4UNO A;  2OZ6 A;  3TOB A;  5FD6 A;  5LHI A;  2L3D A;  1I27 A;  4DZP A;  1FSE A;  2BY0 A;  4U88 A;  3E5X A;  1IRZ A;  3HHH A;  3HJE A;  3CUQ B;  3W2V A;  2YUS A;  4OIR F;  3KLO A;  4WK8 F;  3GFI A;  4XR6 A;  2KDZ A;  1TW3 A;  4KDP A;  3HRU A;  5LBQ A;  3V7C A;  3HG9 A;  3U9G A;  5JVG F;  2IGK A;  2L7F P;  3EQL F;  4MFD A;  2XDV A;  3BG9 A;  3KP6 A;  5CVI A;  2GXA A;  3MCZ A;  4L9T A;  1YJW I;  1EA3 A;  1U9O A;  2DMU A;  3HRT A;  2CW8 A;  2M1B A;  4PSX A;  1I3Q J;  2K4J A;  3FF5 A;  5JHF A;  3G6E I;  1TQP A;  1X2M A;  4NB5 A;  1K6O A;  1A36 A;  1E3P A;  4WCG A;  5J4V A;  2JQ7 A;  1ZH5 A;  3V4G A;  3FZV A;  1YW7 A;  3HIF A;  4AC0 A;  2NNN A;  1SFO J;  4CYC A;  1ON1 A;  3V8K A;  1XGN A;  2FNA A;  1P4W A;  1KQ0 A;  4P55 A;  3BC8 A;  3RKQ A;  1XDS A;  1ETK A;  1YQA A;  3O3K A;  3CP8 A;  4HAM A;  4BBR J;  1I5Z A;  4X0G A;  2L7Z A;  1MNM C;  1WPK A;  5J40 A;  1IC8 A;  1YS7 A;  3G1L A;  4QSH A;  4CYC B;  5E79 C;  1Z21 A;  2E7W A;  2DO7 A;  4A5M A;  4BYY A;  3L2Q A;  2MBF A;  3S2D J;  4BBS J;  4MHG A;  3J81 K;  2ZXH A;  2W48 A;  3OL4 A;  2ZO4 A;  5FKK A;  2PLY A;  5CYV A;  1T6S A;  2R7X A;  3S14 J;  3QAH A;  4M3D A;  1W5C C;  1EV7 A;  1R1U A;  1CQT A;  2X4H A;  3D5L A;  3W2A A;  2BXY A;  3M3Y J;  3K69 A;  1P6R A;  1N78 A;  1G3Y A;  2JWT A;  4FE4 A;  1WQ2 A;  2DDA A;  2MH9 A;  2DOE A;  2QCO A;  5EYR A;  3VOE A;  4A0Z A;  3M9A A;  2LLK A;  5L3B A;  2VE9 A;  1GLN A;  1WGX A;  1REP C;  2AHQ A;  2QM3 A;  3QYE A;  3TED A;  3I0T A;  2L9N A;  5E8G A;  4FTH A;  3S3O A;  5J1U A;  1POG A;  4EM2 A;  3FX3 A;  4G7H F;  1DU6 A;  2XHK A;  2AQE A;  3IWZ A;  4OMZ A;  5HVQ C;  3EDP A;  3WTU C;  1A6I A;  1R7J A;  2ID6 A;  2M4G A;  1Y8Q B;  3OIQ A;  1BC8 C;  3FKJ A;  1TWF J;  5HLI A;  3BG5 A;  3GVA A;  3ASN H;  1YFH A;  5TGT A;  4IVN A;  2VIX A;  3GCM A;  3TO9 A;  1EH7 A;  2JUC A;  3OWT A;  1TZL A;  2VBZ A;  4B48 A;  2W4S A;  4E6K G;  3H92 A;  3HOS A;  1XC5 A;  3CLO A;  1LVK A;  2ELK A;  1D1A A;  1J75 A;  2DU9 A;  1ETQ A;  2E1M C;  2XRL A;  3R0A A;  4XSX F;  4OAZ A;  3GW2 A;  3OIO A;  4ZYG A;  2QLZ A;  3PFI A;  2OAZ A;  3G71 I;  4DIQ A;  4B4C A;  5BPD A;  2JTV A;  4PCQ A;  3IH2 A;  2L4M A;  4CXF A;  1RRJ A;  2F4I A;  3IV5 A;  1IAW A;  2ZJ2 A;  5FJ8 J;  2MA3 A;  1T95 A;  2NS7 A;  3BG7 A;  1D5Y A;  2QSG X;  2G0E A;  5IPA A;  2GIV A;  2CQK A;  2OCE A;  4N9H A;  5HDK A;  1OCC H;  1Z05 A;  5FKN A;  1OCO H;  5F0C A;  3AL0 B;  3JRF A;  1BR2 A;  2M30 A;  1JHH A;  2DMQ A;  1B9M A;  1ZRC A;  3ZOB A;  1LKX A;  2LTP A;  4HSR A;  2C6Y A;  2Y2Z A;  2V1X A;  5D4S A;  3IH3 A;  3S32 A;  1VQN I;  2FRH A;  4M6X A;  2DA4 A;  2A5Y B;  4N9I A;  3HRS A;  4F55 A;  3JRH A;  3LST A;  2VXZ A;  4Z2Y A;  4M3G A;  3IWF A;  2KJB A;  3GUD A;  2Z33 A;  4HQE A;  1S29 A;  2EBI A;  2MFZ A;  1XSD A;  3NRV A;  1TW2 A;  5FLV A;  4NBQ A;  4H4K C;  2HU9 A;  2AO9 A;  1VQ8 I;  2VKD A;  2HTJ A;  5KVR A;  1DPU A;  1PDN C;  2Q0O A;  1MH3 A;  3J7Z I;  4KYW A;  2HDC A;  1YG2 A;  2CW7 A;  3QRF F;  3EYI A;  1QPM A;  3CO6 C;  5FLX K;  1DP3 A;  4YRV A;  4U0V A;  2FNP A;  3DPL C;  3CME I;  2DOD A;  3GFJ A;  1S8N A;  4QPQ A;  3PJR A;  2HDW A;  5IYB J;  1FY7 A;  3CMM A;  4OMY A;  1X4O A;  2IAI A;  1O4X A;  3ZN1 A;  4ZTF A;  3OYC A;  2FF4 A;  1T56 A;  4XRF A;  3S93 A;  5IT9 Z;  4EJT A;  2L0K A;  1QVT A;  2K4B A;  1OIS A;  1P7J A;  1WJ5 A;  2W25 A;  2LMD A;  1WJB A;  5C4X J;  1VQM I;  5HNF A;  2V1N A;  3C18 A;  2V79 A;  3GLX A;  3A2K A;  2ECB A;  4PZJ A;  5GTI C;  3KP7 A;  1Y39 A;  2YSR A;  2ZSH B;  1MJB A;  2B9S A;  4AU7 A;  3ZQF A;  2FU4 A;  5DDG A;  4ZZD A;  3A0B C;  2UWM A;  5C4J J;  3HGG A;  4CIC A;  1ZN2 A;  1KQ8 A;  1I6H J;  1FOY A;  2HOT A;  3DBH B;  1IN8 A;  2E5Z A;  4ABZ A;  2V6E A;  5JLX A;  2MLG A;  3K0L A;  4NQW A;  3HC7 A;  5IOZ A;  1SC7 A;  4J00 A;  4ZDL A;  5IT3 A;  2MLK A;  2P6T A;  5K7F A;  5HOO A;  1AHD P;  1D0Y A;  2AXL A;  5K5R A;  3OYK A;  5LLQ A;  2IVM A;  2O8X A;  3LL7 A;  3NQO A;  3GXO A;  1C0W A;  2EIJ H;  2RNG A;  2W82 A;  3MVP A;  2Z3Y A;  3D1N I;  2XRN A;  3KYC B;  3QP6 A;  3VB2 A;  2IS4 A;  1TNS A;  3W2W A;  3ZMS A;  2K27 A;  4PUS A;  4Z6Y A;  1NK3 P;  1B9N A;  4Q4Z F;  1AOY A;  2QQ9 A;  3M7G A;  2XRO A;  2GXG A;  2XF6 A;  3ZQC A;  1DDN A;  5FB2 A;  4UVC A;  3FM5 A;  2DCE A;  2BVM A;  1JKO C;  3P9C A;  4DOZ A;  1K83 J;  1MGT A;  2YR2 A;  3HB9 A;  5EDN A;  1S72 I;  2VUM J;  1F36 A;  3VYT B;  3TBI A;  5FKM A;  3L2W A;  2IPQ X;  5F27 A;  3DBL B;  1IDZ A;  4YG2 F;  2HOE A;  3BJA A;  1S7A A;  1KA8 A;  4EEF G;  3OYE A;  1FLI A;  2BYV E;  2W85 A;  1KGS A;  3BR0 A;  5IOY A;  3T8T A;  1HKS A;  1U8B A;  2EQR A;  4U0Y A;  4RMN A;  5FRO A;  4XLA A;  3DTE A;  4BJT A;  3BCB A;  3JAM K;  4Y4R A;  1QHG A;  1MBH A;  3Q0V A;  1G59 A;  1Y56 A;  5E1W A;  2XKP A;  4EM0 B;  2R7D A;  4CCL A;  1BW5 A;  4O5V A;  3SFZ A;  3OYF A;  2Y0M A;  1USS A;  3A1Y A;  3TO7 A;  5ED4 A;  1FOX A;  1WJA A;  2UUZ A;  3NEU A;  3GWZ A;  1IN7 A;  2M5W A;  2E1C A;  3E6B A;  3G3Z A;  3I9V 2;  2XVC A;  3I4N J;  4B3X A;  4LB6 B;  4QPO A;  1TQI A;  3JRC A;  1GHC A;  3KZY A;  2HEO A;  2A69 F;  5HS9 A;  4CCO A;  4YFX F;  1HA8 A;  2ZSI B;  1PP8 F;  1BI2 A;  2EFW A;  2EZI A;  1R5G A;  6PAX A;  1DU0 A;  3VYR B;  2AS5 F;  3I4P A;  4UV8 A;  3OOU A;  5CLS A;  4IHS A;  4XN0 A;  4C3H J;  1Z6R A;  2KFD A;  1OCR H;  1LE8 B;  3FK7 A;  3J80 K;  3RQ4 A;  1T33 A;  3KLN A;  2VKE A;  3Q0W A;  3SEZ A;  3IRQ A;  2RRE A;  4GFB A;  2Y0S A;  3GZ5 A;  1LDD A;  4Q5S F;  3JRD A;  2DOA A;  5DCM B;  3TW7 A;  4IHW A;  3ZMD A;  4JP0 A;  2ETH A;  5IY5 H;  1U6G A;  3ERE D;  5E8I A;  3NWS A;  2CUF A;  4BUP A;  4RM2 A;  4D7M A;  2EV5 A;  4MEX F;  3LSI A;  2F6C A;  3DFG A;  3I71 A;  1HW1 A;  5EG0 A;  2L02 A;  5K7Z A;  4LD5 A;  4GRI A;  3PNV A;  1O3Q A;  4CGZ A;  3E5U A;  2I5U A;  3BRO A;  4HNT A;  2HNH A;  2CQX A;  2OF7 A;  2PMH A;  3U21 A;  4A6E A;  1MKM A;  4WF2 A;  1A31 A;  3RTR A;  2IBD A;  1PVE A;  1OQY A;  3VDX A;  2ZJQ F;  5EG0 B;  1FEX A;  1MJ9 A;  4U0W A;  4RDU A;  1RI7 A;  2R7F A;  2KRH A;  3BWG A;  3T5X A;  1SVL A;  4DBQ A;  2ZFW A;  1BIB A;  1R1T A;  2DQR A;  1MMN A;  2H1K A;  1NG6 A;  3JRA A;  3CO7 C;  4OWR B;  2A5W A;  1N25 A;  1APL C;  2PEX A;  4XLP F;  1MMG A;  4LLL A;  1IG7 A;  1IZ1 A;  1RPW A;  4NC7 A;  1YX5 A;  3B73 A;  1HQC A;  3L2C A;  2W7N A;  2DK8 A;  2O7O A;  2Z16 A;  2R7R A;  3QP5 A;  2D1H A;  3S1Q J;  4Y3O A;  2VL8 A;  3HSE A;  4UUS B;  4RB3 C;  2KIM A;  1E3H A;  3LA7 A;  1P9Q C;  1QO0 D;  1FPQ A;  2E19 A;  1IRX A;  1DGW Y;  3M1C A;  2EJR A;  2RGV A;  3N05 A;  4I0A A;  2Q8K A;  1NHA A;  1U3E M;  3BG6 A;  2ISY A;  1XGS A;  1ZKG A;  4CZZ A;  2DPD A;  2CV0 A;  3DKW A;  1K4S A;  1EJ9 A;  1BOA A;  4BHC A;  1T08 B;  4M72 A;  1Y6I A;  2VQH A;  4ZJZ A;  2JA2 A;  1Y1W J;  4EJO A;  3DBR B;  3LOC A;  1SVM A;  4DYR A;  2HI3 A;  3K10 A;  4MTD A;  4CDG A;  3I55 I;  1WSU A;  3DPT A;  5LGN A;  2UXX A;  2ZME C;  2JA6 J;  1UST A;  4JYK A;  3H9Q A;  3I4M J;  3G2B A;  3R4K A;  3SQN A;  2WB1 A;  4BQA A;  2VJI A;  2ECC A;  3DQV C;  1R5I D;  4RB1 A;  1RR7 A;  2ZJP F;  2CW0 F;  3G1O A;  3CDH A;  3F8C A;  2KIS A;  5D5W B;  4FHT A;  3E6M A;  3LSJ A;  3HKZ N;  3A4C A;  2WY7 Q;  3CD6 I;  3CMA I;  1FMW A;  2OV7 A;  4L9J A;  4ESJ A;  3CCL I;  2M45 A;  4LK0 F;  2OTJ I;  2BY2 A;  2KRF A;  4FX0 A;  5TRD A;  1GV5 A;  4M9Z A;  3MFK A;  2NRA C;  5CQG A;  1LNW A;  1VQL I;  5FKL A;  2IA2 A;  3CCV I;  1G3T A;  2D1V A;  1B1B A;  2GIZ A;  4JX5 A;  2HTS A;  2MW8 A;  5D5V B;  2DT6 A;  3TDU C;  4A3I J;  2F4O B;  3PUB A;  3QU6 A;  1MJA A;  4ENM A;  4HF0 A;  3HOY J;  5H2F C;  3W6K B;  3OIP A;  2CGP A;  2F48 A;  1UMQ A;  3F8M A;  3LAP A;  3ELK A;  2MD5 A;  3CLQ A;  5IP6 A;  4KNY A;  2LDU A;  4XOT A;  1LFU P;  5FFZ A;  3T0Y A;  1ZYR F;  3GEZ A;  5BNG A;  5CQE A;  1BC7 C;  3ESW B;  4Y15 A;  3ZXS A;  4BU2 A;  1GXQ A;  1ZHF A;  2LOO A;  4MQV A;  2WA0 A;  1EH8 A;  3BT9 A;  1F9N A;  3F72 A;  4XRS G;  3S1N J;  3KP4 A;  1GDT A;  4GYI A;  2Y31 A;  2Z9O A;  1XGO A;  3G1M A;  3RYP A;  5K7H A;  2HPI A;  1MMS A;  5DEQ A;  4EM1 A;  2FUG 2;  2EFN A;  2Y30 A;  2H27 A;  1T0F C;  1Y0U A;  3SXY A;  2V26 A;  5GPC A;  2QEN A;  2IS1 A;  4AWX B;  3B6A A;  3H36 A;  1ZG5 A;  3JRI A;  5JR3 A;  4RM3 A;  4LLN A;  2E36 A;  4BDZ A;  4A3L J;  2A68 F;  5L3F A;  4YII A;  1AU7 A;  2QGU A;  1ETY A;  4GCV A;  3UKG A;  5GP9 A;  2Z5U A;  3K2Z A;  4CO8 A;  1H9T A;  3KP2 A;  2DJN A;  3H9J A;  2E5N A;  1MMD A;  1PUF B;  1R36 A;  3IP4 B;  3SYT A;  4A0Y A;  3BTC A;  1WJF A;  3K7A J;  4RS8 A;  2EPF A;  2P5V A;  3FBN B;  5K5Q A;  2HXO A;  1V54 H;  2WAF A;  4AVP A;  2P5L C;  1QZY A;  4D5F A;  2F5F A;  4MTE A;  1WRJ A;  1PUE E;  3DU5 A;  2IA0 A;  3SDG A;  4E7S A;  4ZZL A;  1OCZ H;  2FML A;  3HRM A;  1FP1 D;  2EK5 A;  4KA4 A;  2DA2 A;  2M3A A;  3PNY A;  2FE3 A;  5L3E A;  2JT1 A;  3L2U A;  2L9V A;  4CCJ A;  4DGW B;  4M74 A;  3EPZ A;  2LG4 A;  4FT8 A;  1FX7 A;  4PFP A;  1JJ6 C;  2E2I J;  3FKI J;  3RSN A;  3LAJ A;  5HLH A;  5BOX A;  2TRT A;  1A04 A;  2Y75 A;  3C2H A;  3OY9 A;  2QQ8 A;  2LY9 A;  2MC3 A;  5GTH C;  3TKY A;  2M8E A;  2D45 A;  3I58 A;  1CF7 A;  2XB5 A;  3MMY B;  5IP9 J;  4L5E A;  4YFK F;  2Q2E A;  5TJJ A;  3DEE A;  3S16 J;  2DOF A;  4IQ4 A;  2VJ5 A;  3ZQ7 A;  2BBY A;  2X6O A;  1D1B A;  3TOA A;  2GWR A;  4IXA A;  2BW3 A;  5DM6 F;  3HOU J;  2EV6 A;  4HV5 A;  3WTV C;  2Q2E B;  2R3S A;  2QBY A;  5J1Y A;  4LIV A;  1OCT C;  3OR1 C;  1RKT A;  2PFB A;  1SFE A;  2GAU A;  4DBR A;  2BW3 B;  1HDD C;  2ME6 A;  4FCY A;  3QPS A;  2W84 A;  1RES A;  2FEZ A;  4XRM A;  2R4G A;  2QBY B;  2FBH A;  3ERM A;  4UUT A;  3DPU A;  2XAJ A;  4RAG A;  1IXC A;  4IHT A;  3DF8 A;  4PJM A;  2CV2 A;  4MFE A;  3QPL A;  4OOI A;  4EGY A;  3BJ6 A;  4LIU A;  3V42 A;  3WTS C;  3BTL A;  4UHT A;  5CVR A;  4BKX A;  2UZK A;  4WXD A;  1W7P D;  2MG4 A;  1FOK A;  2FX0 A;  3CCE I;  1QVU A;  1Z3X A;  1IGN A;  4QWQ A;  4HYE A;  1NG7 A;  1V5E A;  1IO2 A;  1X1A A;  3K4C A;  5IP7 J;  4OAY A;  2FJ1 A;  1Z67 A;  1P2F A;  2XSD C;  1HLV A;  2V9V A;  4IHY A;  3SZT A;  4IL6 C;  3GYH X;  5CJ9 A;  1MMA A;  3SHF A;  1JUS A;  3BZ6 A;  4GDF A;  3HOW J;  4S0H B;  3L9F A;  3PSI A;  2P7V B;  3ULQ B;  2DTZ A;  4G6D A;  1MD0 A;  4JOM A;  3ZQQ A;  1QZE A;  4ESB A;  5FRM A;  2EZH A;  2QUF A;  3KPH A;  4XK4 A;  2ME0 A;  3T8R A;  2VC1 A;  3ZRG A;  4PJ0 C;  1VZ0 A;  2HKX A;  3IHU A;  3BG3 A;  3K1P A;  1JT0 A;  5D6E A;  1OYW A;  3RYR A;  2XUB A;  4E7L A;  4L0Z B;  2QSF X;  1JKR C;  3R61 A;  2FA5 A;  2HPM A;  1J2X A;  4RGU A;  2KLO A;  1FBQ A;  1ZLJ A;  1ON2 A;  5EEA A;  4AUX A;  2KIQ A;  3L09 A;  2JJ7 A;  3GFM A;  3KEO A;  2YU3 A;  4FAS D;  5B5E C;  2ESH A;  3K4M A;  2EA2 A;  3B02 A;  3TL4 X;  1XN7 A;  2L7M P;  3DKY A;  3OV8 A;  2CFO A;  2QKM B;  3FXM A;  3I59 A;  3IH4 A;  5LGT A;  1X1D A;  2DJI A;  2OCC H;  1SAX A;  5LHH A;  1LVA A;  4YIF A;  1P92 A;  5M5X J;  2EA4 A;  3WTW C;  3F6O A;  4F7Z A;  3KEQ A;  2BEO A;  3HDD A;  1XMA A;  3I59 B;  1BN5 A;  3GTJ J;  5HS8 A;  4RLQ A;  3L00 A;  3K4N A;  3MKY B;  2QZ8 A;  4QTR A;  3HHG A;  3W6V A;  2ZNY A;  5DUK A;  2O03 A;  2E71 A;  3I64 A;  4WX9 A;  4L9V A;  4XLE A;  4ENJ A;  1TQM A;  2XF7 A;  1OMI A;  1QGP A;  4C2U A;  2R7T A;  4IJA A;  1ZGJ A;  2WBM A;  2CFX A;  5CVJ A;  4BHB A;  2W1O A;  1WHU A;  4XLH A;  1D1C A;  5DD8 A;  1BW6 A;  3H0G J;  2GOM A;  3QYB A;  4PFO A;  2IGO A;  3FIW A;  1KYW A;  4HW0 A;  2CH0 A;  4N4N B;  1SFX A;  1XDU A;  5LRR A;  2DFI A;  1UG2 A;  1QRY A;  2LFB A;  1UZC A;  2Y48 A;  2RNJ A;  3WG9 A;  2E7X A;  3KX2 A;  5GAH J;  1Y0N A;  2DMN A;  1KU2 A;  4PK4 A;  4JK1 X;  3OL3 A;  3BTJ A;  2M0M A;  3P7N A;  4C2M J;  1TNT A;  4LFU A;  2DMT A;  4XKB A;  4XMY A;  1VQP I;  2A05 A;  1RIO H;  1VQ5 I;  4BE0 A;  4BAY A;  3H3V K;  4BE1 A;  3HGY A;  2CO5 A;  1IRF A;  2QQA A;  2Q1Z B;  1ODD A;  2AXT C;  3VFZ A;  1LB2 A;  2I10 A;  4KIG A;  3WE2 A;  4KT6 A;  1G2H A;  2OJE D;  2MGQ A;  2R7U A;  1KON A;  5D4R A;  3BZC A;  4M6V A;  2LK2 A;  3WHC A;  3S3M A;  4ENK A;  2VJ4 A;  4HQM A;  2M34 A;  3DKX A;  3JRB A;  3ISP A;  2OPT A;  2GM4 A;  1BI3 A;  1U2W A;  4LG3 A;  2FQ4 A;  2PMZ A;  4J19 A;  4D7N A;  3DTI A;  4PJN A;  3PFY A;  2A6H F;  1XPX A;  1LPQ A;  2B0L A;  3KET A;  5JHU A;  4PSW A;  1K7A A;  4KIF A;  2A6T A;  1UFM A;  1O3R A;  3C2G A;  2H8R A;  3RI4 A;  1GV2 A;  2HDD A;  4R8H A;  1NK2 P;  3CCR I;  4ZC3 A;  3BQZ A;  4XL9 A;  2PN6 A;  2R7O A;  4ZTJ A;  2VOD A;  3Q9V A;  4RAF A;  3BR3 A;  2IGM A;  2JVH A;  3VOD A;  1WI3 A;  1K78 A;  1VI0 A;  2MH2 A;  5HLT A;  3JR9 A;  2IT0 A;  1OFC X;  4RLF A;  1Z6T A;  5M3M J;  4A3D J;  4IHV A;  1MSE C;  2DYR H;  2Y69 H;  1S3J A;  4M9S A;  2KMU A;  2EZK A;  2QWW A;  3I3L A;  2JPB A;  4C3I J;  1K78 B;  3I5U A;  1T98 A;  2VC0 A;  1FNN A;  2H8W A;  2WTE A;  2LH9 A;  2LC2 A;  4B09 A;  2VBW A;  1D0X A;  2ADU A;  3RZD J;  4E70 A;  2CUJ A;  1RZ4 A;  3GTK J;  2M87 A;  5FO5 A;  2DA5 A;  3F6V A;  2PMU A;  3U1D A;  3VYU B;  4HLX A;  5J4Y A;  1KU3 A;  2UXN A;  4RAY A;  4QIW N;  2DLL A;  2WAQ A;  3CQZ J;  1S7O A;  3HPH A;  3K6G A;  4EJW A;  1YIJ I;  4LMY A;  3K70 D;  1OYI A;  2VQC A;  2X1C A;  3OYJ A;  2L9S A;  3I56 I;  1YYV A;  3AG4 H;  5KCM A;  3QOD A;  3FM3 A;  4I0B A;  1TWA J;  1V55 H;  3CUQ C;  4G7O F;  1W0T A;  5E3L A;  1Y1V J;  5ICE A;  1ZRD A;  2M2E A;  1SAN A;  1BBY A;  2EIL H;  1IUF A;  2K85 A;  2KZV A;  3V7R A;  4XID A;  4XIC A;  2HYJ A;  3ZCO A;  2GQQ A;  3D5S C;  5DV5 A;  1KZH A;  2BE5 F;  4NQW B;  1W0U A;  2LNB A;  2X6Y A;  2XV4 S;  5ILV A;  2BOL A;  5EEG A;  4YEL A;  1T8I A;  3W3C A;  1ZEL A;  3CCM I;  1MIJ A;  2VB6 A;  4XOP A;  2FQ3 A;  2E60 A;  4B43 A;  4ZYA A;  4WXC A;  2Z2S B;  3RIR A;  4TV7 A;  3KE2 A;  3AAF A;  2DQL A;  1T0F A;  1ULY A;  2IA1 A;  2O5R A;  5GAD J;  3GTM J;  3LSP A;  1VF9 A;  4BQO A;  5ILU A;  3IUO A;  3LNQ A;  2ELJ A;  2Y0S N;  3OYM A;  1YIT I;  2DXI A;  3CC7 I;  5E18 F;  5D6F A;  1BM9 A;  2K7L A;  3OS2 A;  2GA1 A;  4AYB A;  2HZD A;  3BQY A;  3FDY A;  2LP0 A;  2KKO A;  3JSP A;  4PJJ A;  2EFQ A;  4UVA A;  3C2B A;  5E3N A;  5K5O A;  3O2P E;  4XN3 A;  1ONV A;  4BJ6 C;  2D2W A;  4LOC A;  4XLC A;  3OR2 C;  5EZH A;  3R60 A;  3S2W A;  4U7B A;  1P7I A;  3WTX C;  2F2E A;  4G7Z F;  3GTG J;  2V1U A;  1JE8 A;  2RAE A;  3UR3 C;  2OU2 A;  2BVL A;  1XB4 A;  4V2G A;  2PJP A;  4HRI A;  3QPH A;  3DP7 A;  4IEJ A;  5C3E J;  4BEH A;  2IW5 A;  1YIO A;  3FXJ A;  1HST A;  4DNC A;  1NH3 A;  2NVT J;  4XKC A;  2LF8 A;  5E1Z B;  1I6X A;  1UHS A;  4A6D A;  3K70 C;  1EH6 A;  4B44 A;  2X1E A;  3HTS B;  4HST A;  2A3S A;  4GGG A;  4BEH B;  1X1P A;  2DN0 A;  1JTY A;  1V5F A;  4BHP A;  3A03 A;  2JUG A;  3JRE A;  1XGM A;  2L2O A;  2NNY A;  1E3O C;  1RNL A;  2HFH A;  5ICF A;  5A2Q Z;  5LFA A;  2R0Q C;  3TW6 A;  5AON A;  4A3J J;  3VYS B;  1G8X A;  1WH7 A;  2K3F A;  3OSF A;  1DUX C;  1S6L A;  1WVR A;  2PI0 A;  1JHF A;  3WGG A;  4P9F A;  2HVQ A;  1Z9C A;  5L3G A;  1FT9 A;  3QOP A;  1JGS A;  2L54 A;  4BL0 B;  4IRI A;  1HDP A;  1SD5 A;  1HKQ A;  2H6C A;  2VXD A;  3Q0U A;  4OU0 A;  1U5T A;  1A6Q A;  4FE7 A;  5DUI A;  4E7K A;  1XCV A;  4IKF A;  3OOP A;  4RAZ A;  4Y33 A;  4L5I A;  4KIB A;  1G6N A;  3REO A;  4HA8 A;  3L2V A;  2JA5 J;  2WAD A;  3FMQ A;  1U5T B;  2G7U A;  3VPR A;  1YRN A;  3K2A A;  2CU7 A;  4G6Q A;  4CCM A;  5E1X A;  1YO5 C;  2BY1 A;  1H9G A;  5EGO A;  4IF4 A;  3RPQ A;  2ELH A;  5DM7 F;  5BPI A;  3MKW B;  3HOZ J;  3WU2 C;  9ANT A;  5F6F A;  1B72 A;  2CSO A;  3B6C A;  2P4W A;  1MH4 A;  1YRN B;  1JKP C;  1R4N B;  1SMY F;  1TLH B;  2WB1 N;  5EGO B;  5CPR B;  3SEQ A;  5F0H A;  2VKH A;  3H9G A;  3M8J A;  3JCU C;  3HBL A;  2LF7 A;  3AL0 C;  1FIA A;  5H6R A;  1MDM A;  2KIF A;  1B72 B;  5JVT A;  3HTU A;  4WXH A;  3EUH C;  5DD4 A;  4HDU A;  4EV0 A;  3IKV A;  1IRG A;  4XRS A;  1D8K A;  2KRC A;  4QLC U;  1BR1 A;  1Z7L A;  3R0J A;  2H1L A;  4G8X A;  4GXO A;  4OIQ F;  3HPG A;  2HQN A;  3FIS A;  5IYC J;  1FZP B;  4D1Q A;  5LEK A;  2JPC A;  4XKW A;  2LRE A;  1VQ7 I;  2VE8 A;  3BZK A;  3CES A;  3CJN A;  4M3E A;  2JA8 J;  1X2N A;  1IXR C;  4EQQ A;  4HEA 2;  4BE2 A;  3SDB A;  3E7L A;  4E7I A;  2EIM H;  3FXK A;  5KNL A;  3H5N A;  2PJR A;  1ORK A;  1R6R A;  3ONQ A;  2VJJ A;  2DTR A;  3BDD A;  1G3S A;  4PGH A;  4L5J A;  2XAG A;  2JK3 A;  3BR6 A;  2E2H J;  4NC8 A;  2XIG A;  1T38 A;  3S1R J;  2PJR B;  2NVQ J;  4N4O B;  5B1B H;  1D0Z A;  5JLW A;  3CMY A;  1AA7 A;  4EJV A;  3OSG A;  4C2T A;  2EFO A;  4F91 B;  5KK1 A;  3S15 J;  5DYM A;  4RGS A;  1IN6 A;  3COA C;  2P81 A;  1ZRF A;  4Q47 A;  3O8H A;  1MBF A;  3MZY A;  1LEB A;  4B47 A;  4F93 B;  1KQ9 A;  2FBI A;  2K9M A;  1ETX A;  3RPU A;  2XAS A;  1E0E A;  2EB7 A;  2LY2 A;  2YX7 A;  5LRS A;  2KJC A;  1L3L A;  3LSG A;  3K9T A;  1R58 A;  4XKV A; 
#chains in the Genus database with same CATH homology
 1YW8 A;  3ZMV A;  1QNT A;  5JFR A;  2DK5 A;  1O3T A;  2CWE A;  1RUN A;  1BJA A;  1HXD A;  1LDK B;  1J59 A;  1D5V A;  1ZGA A;  2DT5 A;  3BJO A;  3F3X A;  3E5Q A;  3WTT C;  4O6J A;  2HYG D;  2HS5 A;  2LKP A;  4M6Y A;  4PDK A;  2FOK A;  3RJP A;  4LG0 A;  4O3M A;  3M1E A;  4HF2 A;  3MWM A;  1W7P A;  3IKT A;  1ZAO A;  1DPR A;  2EWN A;  3ZN0 A;  4LG0 B;  3SZP A;  2VBY A;  4KN4 X;  3ZMT A;  2HR3 A;  5ICG A;  3BY6 A;  4HOB A;  4P96 A;  1IF1 A;  4XLN F;  1HW2 A;  5HLG A;  4WWC A;  3MEX A;  2GXB A;  2FSW A;  3ECH A;  1GVJ A;  5BS6 A;  2HYF A;  2K02 A;  1D3Y A;  2IRF G;  1FC3 A;  4ENN A;  5AIQ A;  4EVI A;  3TDZ C;  5IT9 K;  3KP5 A;  1W4M A;  2G9W A;  1IN4 A;  5D8K B;  1PP7 U;  4U7D A;  3BPV A;  1TTY A;  2OD5 A;  1YLF A;  4DQ2 A;  1UHM A;  4ZH4 F;  4RB2 C;  1VTN C;  2VON A;  1O3S A;  1J5Y A;  1W5S A;  2HZT A;  4UVB A;  1IUY A;  3BOQ A;  4MEY F;  4A12 A;  4HV6 A;  5L3C A;  2OQR A;  1XCB A;  3G73 A;  1CF7 B;  3R6S A;  1YW9 A;  2J5P A;  2RVC A;  2P5K A;  1KU9 A;  4M9X A;  2V6C A;  4RGR A;  3ML6 A;  3DEU A;  5D5X B;  1V4R A;  2XAH A;  3FWE A;  3F8N A;  1O7F A;  1O57 A;  4AIH A;  1R23 A;  2DW4 A;  4I98 B;  4I2O A;  3LQR A;  1J7K A;  1FBU A;  4UV9 A;  1P4A A;  4LB5 A;  3Q9S A;  3TO6 A;  1B4A A;  5D8L B;  4I7H A;  4I09 A;  4S04 A;  4P5O A;  5J6X A;  1F5T A;  1XMK A;  3P9I A;  5HDG A;  1R1V A;  1E17 A;  3F8B A;  1J0R A;  1W5T A;  1TBX A;  1F4K A;  2RDP A;  3GF2 A;  3HSF A;  4ETS A;  3GFL A;  1OPC A;  2NAZ A;  4A0X A;  4HX7 A;  1I1S A;  5A2Q K;  2IP2 A;  1UB9 A;  4H0E A;  3CUO A;  4HBL A;  2E1N A;  4G94 A;  4FX4 A;  4BXU A;  2ZCW A;  3JTG A;  1AWC A;  3K1N A;  2V1D A;  3RKW A;  4RGX A;  1HBX G;  1IN5 A;  2RQP A;  4OIP F;  1LEA A;  1Z91 A;  3BPX A;  3IL2 A;  1KYZ A;  1FYM A;  3KP3 A;  3V8J A;  2H94 A;  1BIA A;  3HUG A;  4LJZ F;  4KIC A;  1ZRE A;  3E6D A;  1XD7 A;  2IJL A;  3IC7 A;  1U8R A;  1FP2 A;  2P8T A;  5J8C A;  3WU1 B;  4KUM A;  3WE3 A;  4ESF A;  3D0S A;  3HYI A;  5F64 A;  1QBJ A;  1SFU A;  1R22 A;  2H6B A;  1FBS A;  5HDN A;  1YS6 A;  2PBI A;  2XGX A;  2HKO A;  1QZZ A;  3EUH A;  4ON0 A;  4D0P A;  3VEP A;  2DBB A;  1FSH A;  1WI9 A;  4R1H A;  2W24 A;  1R5H A;  4A5N A;  2RN7 A;  2EFP A;  1SD4 A;  3MZH A;  4HLY A;  4RB0 A;  2DPU A;  3WGI A;  1ZG3 A;  3LA3 A;  1SMT A;  2L4A A;  2ZNZ A;  4JBA A;  5BMZ A;  3J7A O;  1KU7 A;  4CHU A;  1G3W A;  4AIJ A;  4BNC A;  2DAO A;  3FHZ A;  3T1B A;  4ASN A;  2ZME A;  3GZ6 A;  1FWZ A;  4HDV A;  5CVV A;  4IRG A;  3KFW X;  3MAJ A;  2ZME B;  2OZU A;  5HS7 A;  4S05 A;  1V3F A;  2VT3 A;  4G9Y A;  4LLG F;  2VBX A;  3K1M A;  5EEH A;  4M71 A;  1IW7 F;  1B59 A;  3PQK A;  1JXS A;  2O61 A;  4M73 A;  3L7W A;  3F8F A;  2BGC A;  5FFX A;  4LGW A;  1HKT A;  4L9N A;  3I54 A;  5H20 A;  4KMU X;  3ZMU A;  1T2K A;  2QYO A;  4Q48 A;  3Q5F A;  1Z1D A;  5E17 F;  4JQF A;  4GYG A;  2ZBK A;  1X3U A;  3E97 A;  1YTY A;  2FXA A;  3N97 A;  2RC4 A;  3HSR A;  5ICC A;  1L0O C;  2RV8 A;  4AD9 A;  4KT5 C;  5L3D A;  2ZKZ A;  3C1D A;  1E2X A;  1XSX A;  1OR7 A;  4EMS A;  4XSZ F;  1DP7 P;  4EGZ A;  5K1Y A;  1OYY A;  3FMR A;  4I02 A;  5DCF A;  3EET A;  3RKX A;  1IXS B;  4ZYD A;  3RDI A;  1T39 A;  1RUO A;  5CVU A;  4B8X A;  1UHW A;  3QU3 A;  4XBF A;  4HX8 A;  3V7S A;  1STZ A;  3LQQ A;  1UCR A;  2TDX A;  3FXQ A;  1K79 A;  2VOO A;  2WC2 A;  4A2U A;  3LA2 A;  4AIK A;  1XSV A;  2QVO A;  1LJ9 A;  3V8L A;  2HQR A;  4ZYE A;  4I01 A;  3H3U A;  2ESN A;  3PQJ A;  5DCM A;  2P7C B;  4IPA A;  3J81 Z;  3WU0 A;  4UUV A;  4PGG A;  1ZAR A;  3FXR A;  5LGU A;  2KIU A;  3I53 A;  3WTY C;  3E6C C;  3ABT A;  2BV6 A;  3WTZ A;  3FXU A;  3JSO A;  1P4X A;  2K86 A;  4Y13 A;  2F5C A;  2YX4 A;  4NHJ A;  4OIO F;  2O0Y A;  2PQ8 A;  1Z7U A;  2NYX A;  4L0Y B;  1MDM B;  2VT2 A;  5FGM A;  5F1R A;  3BP8 A;  5ERI A;  4YFN F;  3N4M A;  2PG4 A;  4ZYH A;  2JSC A;  1BI0 A;  1FYL A;  3E3V A;  1HW5 A;  5FD5 A;  1ZLK A;  3LWF A;  2ZXJ A;  4GO1 A;  4L18 B;  2VN2 A;  2G7H A;  3W6J B;  4HZF A;  2ACJ A;  1Q1H A;  2F5E A;  3ZP5 A;  2EV0 A;  4HX4 A;  1QQI A;  3LFK A;  4KN7 X;  2Z99 A;  3WGH A;  1FYK A;  1MZB A;  2L01 A;  2O3F A;  1R00 A;  3QPT A;  3O6B B;  2GZW A;  3GO5 A;  4KFC A;  2FMY A;  5J8F A;  3MQ0 A;  4Y17 A;  3F21 A;  1BI1 A;  1LDJ A;  3ECO A;  2JRT A;  5JI6 A;  1J9I A;  3F23 A;  3TGN A;  3GX4 X;  3M8E A;  5FLX Z;  3KZZ A;  3M8F A;  5D5U B;  3RKY A;  1U78 A;  1HSJ A;  1D8J A;  2W57 A;  2QQB A;  2A61 A;  3DXJ F;  2RKH A;  2STT A;  1B6A A;  4BH9 A;  1W7P B;  2CYY A;  1CGP A;  3WOD F;  3CTA A;  2STW A;  3U2R A;  4K2E A;  2JZY A;  2XKO A;  4LK1 F;  3ABU A;  2P6S A;  2HWV A;  5LEJ A;  2J5O A;  5H6Q A;  1I1G A;  4P9U A;  3ZPL A;  2COM A;  1OKR A;  4EJU A;  1WKM A;  1GXP A;  4OIN F;  2LSO A;  5ILS A;  3ROU A;  3P9K A;  2X0L A;  3EYY A;  3TQN A;  3ZMZ A;  4UXN A;  2CG4 A;  3JW4 A;  3DV8 A;  3F22 A;  3JTH A;  4MQ9 F;  5BQT A;  4HF1 A;  3IRR A;  1O7L A;  3KCC A;  4R79 A;  1G4D A;  2A07 F;  1LQ1 A;  2XAF A;  4IRH A;  3HOT A;  2VOP A;  3JAM Z;  2DI3 A;  2XAQ A;  2WWY A;  4MGR A;  4CYD A;  2O6G E;  5LHG A;  2F5D A;  3C3W A;  3FMS A;  4KMF A;  1H0M A;  2GA2 A;  1U5T C;  2A6E F;  1ZG1 A;  2HGC A;  4MNU A;  2ISZ A;  3C7J A;  2FBK A;  5AIP A;  4N0B A;  2WV0 A;  5E20 A;  2OQG A;  1WWX A;  2OA4 A;  2OBP A;  2H09 A;  1F1Z A;  3H3Z A;  1SD6 A;  1SD7 A;  2YPR A;  3CUQ A;  3J80 Z;  2NS0 A;  4UNO A;  2OZ6 A;  3TOB A;  5FD6 A;  5LHI A;  2L3D A;  1I27 A;  1FSE A;  4U88 A;  3E5X A;  3HHH A;  3CUQ B;  4OIR F;  3KLO A;  4WK8 F;  3GFI A;  1TW3 A;  4KDP A;  3HRU A;  5LBQ A;  3V7C A;  3U9G A;  3EQL F;  3KP6 A;  5CVI A;  3MCZ A;  4L9T A;  3HRT A;  2M1B A;  2K4J A;  3FF5 A;  1TQP A;  4NB5 A;  1K6O A;  4WCG A;  1ZH5 A;  3V4G A;  3FZV A;  1YW7 A;  3HIF A;  2NNN A;  1ON1 A;  3V8K A;  1XGN A;  2FNA A;  1P4W A;  1KQ0 A;  4P55 A;  1XDS A;  1YQA A;  3O3K A;  4HAM A;  1I5Z A;  1YS7 A;  2E7W A;  2DO7 A;  4A5M A;  4BYY A;  2MBF A;  4MHG A;  3J81 K;  2ZO4 A;  2PLY A;  5CYV A;  1T6S A;  3QAH A;  1EV7 A;  1R1U A;  2X4H A;  3D5L A;  3K69 A;  1P6R A;  1G3Y A;  1WQ2 A;  2MH9 A;  3VOE A;  4A0Z A;  3M9A A;  5L3B A;  2VE9 A;  1REP C;  2QM3 A;  3I0T A;  5E8G A;  4EM2 A;  3FX3 A;  4G7H F;  2XHK A;  3IWZ A;  4OMZ A;  5HVQ C;  3EDP A;  3WTU C;  1BC8 C;  1R7J A;  5HLI A;  3GVA A;  1YFH A;  4IVN A;  3TO9 A;  1EH7 A;  2VBZ A;  3H92 A;  3HOS A;  3CLO A;  1J75 A;  2DU9 A;  3R0A A;  4XSX F;  3GW2 A;  4ZYG A;  2QLZ A;  3PFI A;  2OAZ A;  5BPD A;  2JTV A;  4PCQ A;  2L4M A;  4CXF A;  1IAW A;  2ZJ2 A;  2MA3 A;  2GIV A;  2CQK A;  4N9H A;  5HDK A;  1Z05 A;  2M30 A;  1JHH A;  1B9M A;  1ZRC A;  2C6Y A;  2V1X A;  5D4S A;  2FRH A;  4M6X A;  2A5Y B;  4N9I A;  3HRS A;  3LST A;  2VXZ A;  4Z2Y A;  3IWF A;  2KJB A;  3GUD A;  2Z33 A;  4HQE A;  1S29 A;  1XSD A;  3NRV A;  1TW2 A;  2HTJ A;  5KVR A;  1DPU A;  1PDN C;  2Q0O A;  4KYW A;  2HDC A;  1YG2 A;  3QRF F;  3EYI A;  1QPM A;  3CO6 C;  5FLX K;  4U0V A;  2FNP A;  3DPL C;  3GFJ A;  1S8N A;  1FY7 A;  4OMY A;  3ZN1 A;  2FF4 A;  4XRF A;  5IT9 Z;  4EJT A;  2K4B A;  2W25 A;  3C18 A;  2V79 A;  3GLX A;  4PZJ A;  3KP7 A;  2YSR A;  1MJB A;  2FU4 A;  5DDG A;  4ZZD A;  2UWM A;  4CIC A;  1ZN2 A;  1KQ8 A;  1IN8 A;  2MLG A;  3K0L A;  4NQW A;  5IT3 A;  2MLK A;  2P6T A;  5HOO A;  2AXL A;  5K5R A;  5LLQ A;  2IVM A;  2O8X A;  3NQO A;  3GXO A;  1C0W A;  2Z3Y A;  2XRN A;  3QP6 A;  3VB2 A;  1TNS A;  3ZMS A;  2K27 A;  1B9N A;  4Q4Z F;  1AOY A;  2QQ9 A;  3M7G A;  2XRO A;  2GXG A;  1DDN A;  5FB2 A;  4UVC A;  3FM5 A;  3P9C A;  1MGT A;  2YR2 A;  2IPQ X;  4YG2 F;  2HOE A;  3BJA A;  1S7A A;  1KA8 A;  1FLI A;  2BYV E;  2W85 A;  1KGS A;  3T8T A;  1HKS A;  4U0Y A;  3JAM K;  5E1W A;  2XKP A;  4EM0 B;  2R7D A;  4O5V A;  3SFZ A;  2Y0M A;  1USS A;  3TO7 A;  5ED4 A;  3NEU A;  3GWZ A;  1IN7 A;  2M5W A;  2E1C A;  3E6B A;  3G3Z A;  2XVC A;  4LB6 B;  1TQI A;  1GHC A;  3KZY A;  2HEO A;  2A69 F;  5HS9 A;  4YFX F;  1PP8 F;  1BI2 A;  2EFW A;  1R5G A;  6PAX A;  2AS5 F;  3I4P A;  4UV8 A;  5CLS A;  4IHS A;  1Z6R A;  3J80 K;  3KLN A;  3IRQ A;  3GZ5 A;  1LDD A;  4Q5S F;  5DCM B;  3ZMD A;  2ETH A;  1U6G A;  3ERE D;  5E8I A;  2EV5 A;  4MEX F;  3DFG A;  3I71 A;  1HW1 A;  2L02 A;  4LD5 A;  1O3Q A;  4CGZ A;  3E5U A;  3BRO A;  2PMH A;  4A6E A;  1MKM A;  4WF2 A;  3RTR A;  1MJ9 A;  4U0W A;  1RI7 A;  2R7F A;  3BWG A;  3T5X A;  2ZFW A;  1BIB A;  1R1T A;  2DQR A;  3CO7 C;  2PEX A;  4XLP F;  4LLL A;  1IZ1 A;  3B73 A;  1HQC A;  3L2C A;  2DK8 A;  3QP5 A;  2D1H A;  3HSE A;  4RB3 C;  2KIM A;  3LA7 A;  1QO0 D;  1FPQ A;  2Q8K A;  2EJR A;  2RGV A;  4I0A A;  1NHA A;  1U3E M;  2ISY A;  1XGS A;  4CZZ A;  2DPD A;  3DKW A;  1BOA A;  4BHC A;  4M72 A;  4EJO A;  4MTD A;  4CDG A;  1WSU A;  3DPT A;  5LGN A;  2UXX A;  1UST A;  3SQN A;  3R4K A;  4BQA A;  3DQV C;  4RB1 A;  2CW0 F;  3CDH A;  3F8C A;  5D5W B;  4FHT A;  3E6M A;  4L9J A;  4ESJ A;  2M45 A;  4LK0 F;  2KRF A;  4FX0 A;  5TRD A;  4M9Z A;  3MFK A;  2NRA C;  1LNW A;  2IA2 A;  1G3T A;  2D1V A;  1B1B A;  2HTS A;  5D5V B;  3TDU C;  3QU6 A;  1MJA A;  4ENM A;  4HF0 A;  3W6K B;  2CGP A;  3F8M A;  3LAP A;  3ELK A;  2MD5 A;  4KNY A;  2LDU A;  5FFZ A;  3T0Y A;  1ZYR F;  3GEZ A;  1BC7 C;  4Y15 A;  1GXQ A;  1ZHF A;  4MQV A;  1EH8 A;  1F9N A;  3F72 A;  3KP4 A;  4GYI A;  2Z9O A;  1XGO A;  3RYP A;  5DEQ A;  4EM1 A;  2EFN A;  2H27 A;  1Y0U A;  3SXY A;  2QEN A;  4AWX B;  1ZG5 A;  5JR3 A;  4LLN A;  2A68 F;  5L3F A;  4YII A;  4GCV A;  2Z5U A;  3K2Z A;  4CO8 A;  1H9T A;  3KP2 A;  1R36 A;  4A0Y A;  4RS8 A;  2P5V A;  5K5Q A;  4AVP A;  2P5L C;  1QZY A;  2F5F A;  4MTE A;  1WRJ A;  1PUE E;  2IA0 A;  4ZZL A;  2FML A;  3HRM A;  1FP1 D;  2EK5 A;  4KA4 A;  5L3E A;  2FE3 A;  2JT1 A;  4M74 A;  4FT8 A;  1FX7 A;  3LAJ A;  5HLH A;  5BOX A;  1A04 A;  2Y75 A;  2MC3 A;  3TKY A;  2M8E A;  2D45 A;  3I58 A;  1CF7 A;  4YFK F;  2Q2E A;  5TJJ A;  3ZQ7 A;  2BBY A;  3TOA A;  2GWR A;  4IXA A;  2EV6 A;  4HV5 A;  3WTV C;  2QBY A;  2R3S A;  2PFB A;  1SFE A;  2GAU A;  2W84 A;  2FEZ A;  2QBY B;  2FBH A;  2XAJ A;  1IXC A;  4IHT A;  3DF8 A;  4OOI A;  4EGY A;  3BJ6 A;  3WTS C;  4UHT A;  5CVR A;  2UZK A;  4WXD A;  1W7P D;  1FOK A;  4QWQ A;  4HYE A;  1P2F A;  2V9V A;  3SZT A;  3GYH X;  5CJ9 A;  3SHF A;  3BZ6 A;  3L9F A;  3ULQ B;  2P7V B;  4G6D A;  1MD0 A;  4ESB A;  2QUF A;  3T8R A;  2VC1 A;  2HKX A;  3IHU A;  3K1P A;  5D6E A;  1OYW A;  3RYR A;  2XUB A;  4L0Z B;  3R61 A;  2FA5 A;  1J2X A;  4RGU A;  1FBQ A;  1ZLJ A;  1ON2 A;  3L09 A;  3GFM A;  3KEO A;  2YU3 A;  2ESH A;  2EA2 A;  3B02 A;  1XN7 A;  3OV8 A;  3I59 A;  5LGT A;  1SAX A;  5LHH A;  1LVA A;  4YIF A;  1P92 A;  2EA4 A;  3WTW C;  3F6O A;  4F7Z A;  3KEQ A;  2BEO A;  1XMA A;  3I59 B;  1BN5 A;  5HS8 A;  3L00 A;  2QZ8 A;  3HHG A;  2ZNY A;  5DUK A;  2O03 A;  3I64 A;  4WX9 A;  4L9V A;  4ENJ A;  1TQM A;  1OMI A;  1QGP A;  4IJA A;  1ZGJ A;  2CFX A;  5CVJ A;  4BHB A;  5DD8 A;  1KYW A;  4HW0 A;  1SFX A;  1XDU A;  5LRR A;  2DFI A;  2Y48 A;  2RNJ A;  3WG9 A;  2E7X A;  1KU2 A;  4JK1 X;  3P7N A;  1TNT A;  4LFU A;  1RIO H;  4BAY A;  2CO5 A;  1IRF A;  2QQA A;  1ODD A;  3VFZ A;  1LB2 A;  4KIG A;  3WE2 A;  5D4R A;  4ENK A;  4HQM A;  3ISP A;  1BI3 A;  1U2W A;  2A6H F;  2B0L A;  3KET A;  5JHU A;  1K7A A;  4KIF A;  1UFM A;  1O3R A;  3RI4 A;  4R8H A;  2PN6 A;  2VOD A;  3Q9V A;  3VOD A;  1K78 A;  2MH2 A;  2IT0 A;  1Z6T A;  1S3J A;  4M9S A;  2QWW A;  2JPB A;  1K78 B;  3I5U A;  1T98 A;  2VC0 A;  1FNN A;  2WTE A;  4B09 A;  2VBW A;  2ADU A;  4E70 A;  1RZ4 A;  2M87 A;  5FO5 A;  3F6V A;  3U1D A;  2PMU A;  4HLX A;  1KU3 A;  2UXN A;  4RAY A;  2DLL A;  1S7O A;  4EJW A;  4LMY A;  1OYI A;  1YYV A;  3FM3 A;  4I0B A;  3CUQ C;  4G7O F;  5ICE A;  1ZRD A;  1BBY A;  3V7R A;  2GQQ A;  5DV5 A;  2BE5 F;  2LNB A;  2XV4 S;  5ILV A;  5EEG A;  2FQ3 A;  4WXC A;  3RIR A;  4TV7 A;  3KE2 A;  3AAF A;  2DQL A;  1T0F A;  1ULY A;  2IA1 A;  5ILU A;  5E18 F;  5D6F A;  1BM9 A;  2K7L A;  2GA1 A;  2KKO A;  3JSP A;  2EFQ A;  4UVA A;  5K5O A;  3O2P E;  1ONV A;  2D2W A;  3S2W A;  4U7B A;  3WTX C;  3R60 A;  4G7Z F;  2F2E A;  2V1U A;  1JE8 A;  2OU2 A;  1XB4 A;  2PJP A;  3QPH A;  3DP7 A;  2IW5 A;  1YIO A;  1HST A;  4DNC A;  2LF8 A;  5E1Z B;  1I6X A;  4A6D A;  1EH6 A;  3HTS B;  2A3S A;  4GGG A;  4BHP A;  1XGM A;  2NNY A;  1RNL A;  2HFH A;  5ICF A;  5A2Q Z;  5AON A;  1DUX C;  1S6L A;  2PI0 A;  1JHF A;  3WGG A;  4P9F A;  1Z9C A;  5L3G A;  1FT9 A;  3QOP A;  1JGS A;  2L54 A;  4IRI A;  1SD5 A;  1HKQ A;  2H6C A;  4OU0 A;  1U5T A;  5DUI A;  1XCV A;  3OOP A;  4RAZ A;  4L5I A;  4KIB A;  1G6N A;  3REO A;  4HA8 A;  3FMQ A;  1U5T B;  2G7U A;  4G6Q A;  5E1X A;  1YO5 C;  1H9G A;  4IF4 A;  3RPQ A;  2ELH A;  5BPI A;  5F6F A;  2CSO A;  2P4W A;  1SMY F;  1TLH B;  2LF7 A;  5H6R A;  1MDM A;  2KIF A;  5JVT A;  3HTU A;  4WXH A;  5DD4 A;  4HDU A;  4EV0 A;  3IKV A;  1IRG A;  1D8K A;  4QLC U;  3R0J A;  4G8X A;  4GXO A;  4OIQ F;  2HQN A;  1FZP B;  5LEK A;  2JPC A;  2VE8 A;  3CJN A;  1IXR C;  4EQQ A;  2DTR A;  3BDD A;  1G3S A;  4PGH A;  4L5J A;  2XAG A;  2XIG A;  1T38 A;  4EJV A;  2EFO A;  5KK1 A;  5DYM A;  4RGS A;  1IN6 A;  3COA C;  1ZRF A;  4Q47 A;  3MZY A;  1LEB A;  1KQ9 A;  2FBI A;  3RPU A;  2XAS A;  2EB7 A;  2YX7 A;  5LRS A;  2KJC A;  1L3L A;  3K9T A;  1R58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...