5HODA

Structure of lhx4 transcription factor complexed with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
61
structure length
61
Chain Sequence
GAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords LIM/homeobox protein Lhx4
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5hodA00
1QRYA 5FKNA 2R0QC 2TRTA 1ZR2A 5M3FJ 3ZQHA 4JP0A 1ITYA 1IRZA 3LSGA 4HNVA 3GTQJ 1IDYA 1JTXA 5JLXA 1MSFC 3BG5A 3E7LA 1ZK8A 2OF7A 2XPWA 2LFBA 1E3OC 1TWCJ 2LTPA 5K7HA 1AHDP 5F04A 3W6VA 1B72A 3B6AA 5GPCA 5K7FA 5DTDA 2R7ZJ 3GTGJ 5FKKA 4A3CJ 1A5JA 1JKOC 2LR8A 1PUFA 3PO2J 1ETWA 2NOGA 4L5EA 1MBGA 4IHXA 2N8GA 5J1UA 4XIDA 3HOXJ 3OOUA 1IUFA 3TW7A 5IYCJ 3PM1A 3JRDA 1ENHA 1TC3C 3S15J 1RETA 3K7AJ 5EZGA 2ELKA 3IH4A 2RAEA 2O7OA 2DJNA 5EZHA 1UMQA 3RZOJ 3S2HJ 3LOCA 4A69C 3HM5A 2DMTA 2ECBA 2JWTA 2XPUA 2XGDA 4A3DJ 3WHBA 4MO7A 4Y52J 1UHSA 4EEFG 2LP0A 2ME6A 5E3NA 1JT6A 1RPWA 4B4CA 4AYBN 3FK6A 3JRIA 3BR5A 5EG0B 3TP0A 2K40A 1WI3A 4D7NA 3OSFA 1HCRA 1BW5A 2QCOA 4JYKA 3TW6A 5M3MJ 3A01A 2XB5A 4DZPA 3FK7A 3MVPA 2XB0X 2LK2A 4W1UA 1TWFJ 3ZQFA 4C3HJ 1LFBA 4M3GA 2GBYA 2ZB9A 2E2HJ 1R9TJ 1U8BA 2CJJA 2L7ZA 2XRLA 1AU7A 4IEJA 3HOZJ 3FISA 1AKHA 2JA7J 1JJ6C 3SFIA 2K9SA 4GFBA 3HOYJ 3K2AA 1QVUA 2Y2ZA 1LFUP 2OPTA 3ZQCA 1MBKA 3WHCA 2L9RA 3QQAA 9ANTA 2AHQA 4JX6A 4RBOA 1EF4A 4QIWN 1IJWC 5F0FA 1FTTA 4LOCA 4BXXJ 4M3DA 4AUXA 4I6ZA 5IPAA 2E2IJ 4A93J 2H8RA 2I10A 3BR6A 1DU6A 2JMWA 3OIOA 2B63J 3JR9A 3B6CA 1FTZA 5C44J 1I3QJ 5FJ8J 1I6HJ 1JT0A 3GTPJ 1K83J 3C2BA 3HEFA 2XGCA 4NDLA 1TWGJ 4W97A 1VI0A 5DS9A 4BY1J 2VI6A 5EGOB 2JA5J 2E1OA 2X48A 2Y30A 3ZOBA 3H0GJ 1FJLA 2W48A 4J19A 3S1NJ 3ZQLA 3F0CA 4B3AA 1U9NA 2EBIA 2LKXA 2WAQN 3Q0UA 4A3JJ 5J3LA 4IHWA 1HF0A 3CCYA 5GP9A 2Y9YA 2EZLA 5FKOA 5EF6A 2M9HA 1IC8A 3OSGA 4FE4A 1JUSA 2NVTJ 3S1MJ 1B8IB 2JN6A 1ZR4A 2JJ7A 2IBDA 2R5ZB 3VPRA 3BQZA 2DMNA 3TEDA 5EG0A 2CUEA 2VKEA 2YS9A 1X2NA 3TP3A 3QPSA 4C3JJ 3H3VK 1W0TA 2ID3A 2K9NA 3BG3A 3HGYA 2DMUA 1MH4A 4B1RA 2HQ5A 1WGXA 3G1LA 3JRHA 4UUSB 1JUMA 1T56A 1X58A 3SJMA 1A6IA 3BTIA 5FKMA 5HODA 4M3BA 1YRNA 5F08A 1NTCA 2EZIA 4I76A 5F1JA 3GTOJ 2O9LA 2K9QA 1QVTA 3IV5A 1IV6A 3RKQA 4FISA 2NVXJ 1OFCX 3BR2A 1ZTRA 3A02A 4XRSG 4DYQA 1CQTA 2R5YA 1Z77A 3GBGA 1H89C 2DA7A 1LE8B 4DYRA 2EZHA 5M5XJ 1SFOJ 2Y31A 2MW8A 1HLVA 2O8KA 5IYDJ 1WH7A 2CRGA 1I50J 2FJ1A 1H88C 2DA1A 3S16J 1GV2A 5EGOA 4CYCB 1OCPA 1QPIA 2EQRA 4IHYA 5IP6A 2H1KA 3M4OJ 2XSDC 2M2EA 1MBEA 1ETVA 4AC0A 2NS8A 3CDLA 3LNQA 4X6AJ 1VF9A 3HKZN 1S7EA 1ETXA 5J1RA 3IH2A 1D5YA 5EYRA 4Y7NJ 2R93J 3HB9A 4C3IJ 3CMYA 1IG7A 1JUPA 3UKGA 2EZKA 5FKLA 3ZQGA 2HOAA 3HBLA 4BBRJ 5IYBJ 3SDGA 2L7MP 5K7ZA 2VPRA 3BTJA 1PUFB 2VUMJ 1SANA 3IH3A 5E3LA 1K61A 1ETYA 4D7MA 1Q1VA 4C2MJ 4JX4A 2M34A 2ME0A 1ETOA 3BT9A 5FLVA 4MFEA 3MN2A 1ZGWA 1OJLA 3RZDJ 2DTZA 2LD5A 1U9OA 4UUSA 4V2GA 2VKVA 3Q0WA 1WH5A 2DA6A 5J1YA 4A3IJ 1BW6A 1O4XA 1APLC 1NK2P 2DA4A 4S0HB 3GTMJ 2G0EA 2HI3A 1JKRC 4MIMA 5IOYA 2KDZA 3BTLA 1ZKGA 2DA3A 1ETKA 4DZJA 1GUUA 2P81A 4DYCA 2L0KA 1OCTC 3QPLA 2X9DA 4D5CA 4M6VA 3HGGA 5JLWA 2JA6J 3JRFA 2CU7A 2E2JJ 1HDPA 3NARA 4DW6A 1MSEC 4M3EA 1BL0A 3BR1A 4G12A 5IP7J 1RESA 2QF7A 1GDTA 3O8GA 1DU0A 1JTYA 2YUSA 3GTKJ 1XG1A 1P7JA 5C4JJ 1TWAJ 4RDUA 2EH3A 4CYCA 3Q0VA 5BNGA 3I4NJ 2ECCA 3FIWA 1UG2A 3S1QJ 1RR7A 2IEKA 4XRSA 2NVQJ 4A3MJ 1NK3P 1MH3A 3L1PA 3S2DJ 2COBA 3Q3SA 3BR3A 2NVYJ 1BA5A 2DA2A 1Y1WJ 2HOSA 1F43A 2MG4A 3BQYA 2IAIA 1ZQ3P 5FLMJ 2GM4A 1G2HA 3M3YJ 3HOVJ 2L7FP 1U78A 1WPKA 2X6OA 5F0CA 4FTHA 3LSRA 3CQZJ 1P7IA 3S1RJ 1GVDA 4JX5A 1XC5A 3RQIA 1VNDA 1X2MA 4XICA 3ZQIA 1Z0XA 1FEXA 3S17J 2HOTA 2NS7A 1JJ8C 4FCYA 2HDDA 1HDDC 3GTLJ 2KT0A 3D1NI 3JRGA 1RKTA 2Y9ZA 1XS9A 1TWHJ 1W0UA 3G1MA 5EEAA 3DEWA 2FQ4A 1BJZA 2JA8J 3JRCA 3HDDA 2XPVA 2DMPA 2CUFA 2DMQA 3GTJJ 4BKXA 3NAUA 4QSHA 3S14J 4FE7A 5E3MA 1HOMA 2PMZN 4A3GJ 1F36A 2MGQA 1H8AC 2HXOA 4UUTA 1B72B 3BR0A 4XK4A 1B8IA 1ETQA 1WCMJ 3O8HA 2E19A 2FX0A 2R5ZA 2CQXA 4V2FA 3MKLA 3G1OA 2WV1A 2ID6A 3JRAA 5GPAA 4ABZA 2MSYA 2GLOA 1YRNB 2YU9J 1MNMC 3PO3J 1GV5A 3BTCA 3JRBA 1ORKA 1GT0C 4A3EJ 2DA5A 2Y0SN 2TCTA 1IDZA 2LVSA 2LLKA 3FKIJ 1VFCA 2CQQA 2DN0A 2M8GX 5C3EJ 4A3KJ 1IGNA 4MFDA 4XRMA 1FIAA 2R92J 3LSJA 4X1EA 1JGGA 1T33A 3DCFA 4A3LJ 4QTRA 2D5VA 2R5YB 4BY7J 3JREA 2WB1N 2XGEA 1JKQC 4M3FA 3LSPA 5E3OA 5M5WJ 1Y1VJ 5F0HA 3I4MJ 2HXIA 1FIPA 2JK3A 3BG9A 2LY9A 5M5YJ 5F27A 4IHVA 4D5FA 3HOWJ 5EDNA 1MBJA 3A01B 3A03A 1POGA 4A3BJ 2AO9A 1LE8A 2M0CA 1JKPC 4MLOA 3HOUJ 1MBHA 1RKWA 5IP9J 2HYJA 4A3FJ 4BBSJ 1MBFA 2FD5A 1AKHB 5IOZA 5C4XJ
chains in the Genus database with same CATH superfamily
5FKNA 3RTRA 2TRTA 2XF6A 1MJBA 4YEJA 2DAOA 4JP0A 3ZQHA 4HX7A 4EJTA 4CCNA 4TV7A 3CD6I 1E3PA 4RB3C 1JTXA 2VBWA 5JLXA 1MSFC 2OV7A 1U8RA 3BG5A 3E7LA 3RJPA 2OF7A 1KGSA 2LFBA 1G6NA 2O6GE 3W6JB 1BM9A 1S9HA 4B8XA 1ZG5A 1N75A 2R7ZJ 3C2GA 1XDSA 4LLNA 1A5JA 1JKOC 3DBLB 2A61A 5D5XB 1PUFA 1P4WA 2E1CA 2O8XA 1ETWA 3WG9A 3CP8A 4XKWA 3HOSA 4GRIA 5J1UA 4XIDA 2BY0A 3HOXJ 5B66C 1M1EB 1P6RA 3TW7A 1IUFA 5IYCJ 5B1AH 2F5VA 3PM1A 4G6TB 3JRDA 4OIQF 2HVRA 3O2PE 5ICGA 3GZNB 2WC2A 2MD5A 3IH4A 2BVLA 4RB0A 4ZDPA 2Z1DA 3OL4A 4IOAF 4A0ZA 5H6QA 4HZFA 2RAEA 3KPHA 3GFIA 1B9MA 3PIOF 2AS5F 2E34A 3RZOJ 1MKMA 3LOCA 2CQNA 4A69C 5KNLA 3HM5A 3DV8A 2DMTA 2OTLI 3WHBA 4NNJA 2K7LA 3DTIA 5E3NA 1RPWA 4MEXF 1LDKB 1TP4A 4G94A 3BP8A 1XX5A 2E5ZA 2VJ4A 1KA8A 5KAIC 1FOXA 3J7AO 2GOMA 2K40A 4BAYA 2V9VA 3DU5A 3OSFA 3K6GA 3SQNA 3TW6A 5M3MJ 1K6OA 2L2OA 1L3LA 2QYOA 1QHHD 1TWFJ 1O7FA 3RSNA 2ZXWH 2WADA 4U7DA 2GBYA 2ZB9A 4LGWA 2KQRA 3PFYA 4XBFA 1VQNI 3HOZJ 3FISA 3KLOA 4IRIA 2JA7J 1RR8C 3U21A 3ZP5A 4UVAA 3SFIA 1N77A 2BY1A 5DCMA 1LFUP 3KYLA 2HEOA 4YFKF 2L9RA 2EFNA 4RBOA 2VJ5A 2EV6A 3OYEA 1JXSA 2MC4A 4HYEA 3D5RC 4M3DA 4U7BA 1Z91A 2E2IJ 4IVNA 2H8RA 1VQ7I 2XF5A 3BLYA 2F48A 2DDAA 3BR6A 1TBXA 3HPHA 4OIPF 3C1DA 3CCLI 2EV5A 3OS0A 2O5RA 3M8FA 1FTZA 4MQVA 1I3QJ 4WCGA 3CZ6A 3FBNB 2L9SA 4JOMA 5DUKA 1JT0A 3C2BA 1KQ8A 3OYIA 3E6MA 3OYDA 1K6YA 5H20A 3CCRI 2JA5J 1SVOA 2E1OA 2M4GA 2X48A 4AM3A 5HS8A 5GAHJ 3H0GJ 2IGNA 2W48A 4O6JA 1ZYRF 2BHZA 3R4KA 1GLNA 1U9NA 4QPQA 2IXSA 3QU3A 4BACA 2LKXA 2EPFA 3FMRA 3Q0UA 2KMUA 3HXLA 1OPCA 4H4KC 3AG4H 1ZREA 2DPUA 2M5WA 2RNJA 4AVPA 2Y9YA 3G3ZA 5FKOA 5EF6A 3V7RA 2EIJH 3GFLA 3OSGA 1JUSA 4OINF 2NVTJ 5FFXA 1FP2A 2ZNZA 5B3SH 2A68F 3LSMA 1PDNC 2VIXA 1XMXA 2M30A 3VPRA 3TEDA 4HA8A 2YS9A 2FOKA 1W4MA 4A0XA 1X2NA 4I98B 3TP3A 2P5LC 4ETSA 4BH9A 4N9HA 1KZHA 3HGYA 5J47A 2HQ5A 1H0MA 5CVJA 1JUMA 1ON1A 2DOAA 1T56A 4ENJA 1AWCA 5FD6A 4M72A 1A6IA 3BTIA 5DV5A 4G6QA 3SJMA 2XAHA 2BHYA 3CCEI 3MAJA 4OOIA 2EA2A 2WWYA 2F4IA 3M1EA 4HSTA 2O9LA 2HWVA 1PUEE 2FOWA 5E20A 1G3YA 3D5SC 5B1BH 2KIQA 4FISA 2NVXJ 2W00A 4YIFA 2GA2A 2OCCH 3T1BA 2MABA 2COMA 3DF8A 3TO9A 1IAWA 3Q9SA 2VPLA 2AXLA 3GBGA 1WHUA 3K70D 2PBIA 2XAUA 3BOQA 3ONQA 1Y56A 3DTEA 2VONA 2MW8A 4UY8I 5DM7F 3ZN1A 1WH7A 3BCBA 2VXDA 2X85A 4ZJZA 3CJTB 1OCCH 1YIJI 4IHYA 2LY2A 2Y75A 1MMDA 3H1CA 1EH6A 1R23A 2XSDC 4XKVA 3B02A 4Q47A 2NS8A 2BE5F 4WXDA 4X6AJ 5J8CA 2OUMA 1S7EA 4BEHA 2GWRA 1R5ID 4ESFA 5HLGA 3CMYA 2ZJQF 3UKGA 3ZQGA 3L00A 5FKLA 4NBQA 4IHTA 2PQ8A 4AIKA 4EM2A 4LJZF 1PUFB 1HBXG 3IH3A 2IT0A 1ETYA 2HDWA 3AG1H 3CF5F 1Q1VA 5HDGA 5HS9A 3SYTA 2Z3YA 1ZRCA 1OYWA 2WV0A 4MFEA 4UVBA 1OJLA 2K02A 4WX9A 1TL8A 3K4BA 2EFOA 1K78A 2VKVA 3IL2A 1WH5A 3I54A 3GFJA 3KFWX 4A3IJ 4C9YA 4BGDA 1APLC 1RIOH 3GTMJ 4E7IA 3FXRA 5ICFA 3O3KA 2BW3B 3D0SA 4N9IA 1W7PD 2AXTC 2DLLA 3R60A 3OYAA 1R5GA 2D2WA 4Z2YA 1VQKI 1OKRA 1SMTA 2F5DA 3ZXSA 1ETKA 4DGWB 2V1NA 4DZJA 1IF1A 4PUSA 1D8JA 4KITB 3EUAA 3OYHA 1MMAA 4RAGA 3TDZC 3IRRA 3HGGA 3WTUC 3JSPA 2Q1ZB 2YU3A 1J2XA 3CESA 2UV1A 2CU7A 3EUHA 1HDPA 4IZZA 2E2JJ 1MSEC 4DW6A 1BL0A 3BR1A 5IP7J 2ZXHA 3H3UA 3S93A 1XG1A 3CUQC 5FD5A 3G73A 4RDUA 4Q4ZF 1ODDA 2EH3A 2R7WA 1D5VA 2K27A 4BQAA 1J9IA 1HSTA 2QBYA 2ECCA 4HDVA 4U0VA 1RR7A 2OZUA 4OAYA 3F23A 4OMZA 2VBZA 2FSWA 2LF7A 2ZFWA 3WG7H 1LB2A 2HTSA 4A3MJ 2W84A 1FWZA 3MZYA 2Q8KA 1OYYA 2BZTA 1A6QA 1LEAA 3C7JA 3Q3SA 3BR3A 2Z99A 4BHBA 2DODA 1PP7U 5LHGA 5LD2C 4RM2A 1KU2A 1Z7UA 2DA2A 4RAZA 3E1SA 4LITA 1Y1WJ 2JPBA 1F43A 3LQRA 3J80K 2GOXB 3LA2A 2GM4A 1O57A 1ZG1A 1MDMA 1WPKA 3IC7A 5AONA 2VKHA 2UZKA 3VSKA 2BYVE 3VFZA 2P8TA 3IAM2 1HKTA 3RQIA 1X2MA 2XDVA 4WXHA 1K4TA 3EYIA 4XSZF 3CUOA 3ASOH 1JE8A 2ZMEC 2RDPA 3FXOA 2HOTA 2LKSA 4X0GA 4F3QA 1JJ8C 2HDDA 3KYCB 3LSHA 3KYDB 3GTLJ 1BI0A 3K4KA 3OYFA 2R7QA 5J4VA 2XF7A 4MEYF 5K5QA 1MJAA 1RNLA 2R7SA 4XLAA 2HOEA 2HQAA 2Z9OA 2FQ4A 1BJZA 3DLAA 3OYJA 2DMPA 2CUFA 3RKYA 3OS1A 3GTJJ 3KLNA 2WAFA 1FMWA 4QSHA 1ONVA 3BCAA 2PMZN 1MD0A 1D1BA 2VBYA 5JR3A 2MGQA 1LQ1A 4WF2A 2HR3A 2E1MB 3BR0A 3DBHB 2RC4A 3OWTA 1B8IA 5JVGF 2QKLB 1BIAA 1WCMJ 2WA0A 4EQQA 3JAMK 4G7OF 4XRFA 1D1CA 2R5ZA 2CQXA 4KA4A 3MKLA 3M8EA 3JRAA 3N4MA 1FY7A 1HKQA 3NWSA 4HBLA 1DGWY 4MGRA 1TQPA 3HIFA 4CH7A 4IXAA 2XKPA 2W24A 1GV5A 3BTCA 1GHCA 1UHMA 4UHTA 3FZVA 4LIUA 4CCOA 3VDXA 3KZYA 2I8DA 2I5UA 2LVSA 4BQQA 1IDZA 2QA4I 1VFCA 2CQQA 2DN0A 3QPHA 2M8GX 5C3EJ 1UAAA 2E35A 4XRMA 1TW3A 2R92J 2QSGX 3TGNA 2X0LA 3HL2A 4A3LJ 2D5VA 4BY7J 5B5EC 2HGCA 5F64A 1FOWA 2W7NA 4IX7A 3JREA 2QQ9A 2WB1N 2XGEA 2Q0OA 4M74A 4M3FA 3V4GA 4LG0A 4L5JA 3JCUC 3I4MJ 1PJRA 1X3UA 3LAJA 2JK3A 3ECHA 2IGKA 1K79A 4U87A 3GZ6A 4PJLA 5M5YJ 4IHVA 3HOWJ 1MBJA 2ESHA 3F8NA 2XASA 4Z6YA 1UCRA 4FETA 3T8RA 2STTA 2M0CA 1JKPC 3CC7I 4Q5SF 3HOUJ 1RKWA 5IP9J 5HNHA 3BWGA 4BBSJ 2IGOA 3H0DA 2LBFB 2PMHA 1MBFA 1HKSA 2XAQA 2DK8A 2YPRA 4CUGA 1J09A 2R0QC 1IRFA 3KX2A 2IPQX 3LFUA 3EETA 4A5NA 3QODA 4Y3OA 2OU2A 3QYEA 1ITYA 2QLZA 3E5XA 5LHIA 1NH3A 1CF7B 1YX3A 1FSEA 1WJEA 3AFHA 4HNVA 4B43A 3OYBA 3NRVA 1YOVB 2XPWA 5DCFA 3T0YA 4L18B 1OISA 1E3OC 2CWEA 5K7HA 3W6VA 1B72A 3B6AA 1JGSA 5K7FA 2Z33A 3K1NA 3GTGJ 1V3FA 3H36A 3VYSB 4KDPA 2IA1A 2LR8A 1FPQA 2X4HA 3SZTA 2DDBA 2HDCA 3V7CA 1MBGA 1MNDA 1QO0D 2IVMA 1K78B 3K10A 4KUMA 1FSHA 2PG4A 4AWXB 2LOOA 4HV5A 3OOUA 1ENHA 3PSFA 5LEJA 5GAGJ 5E17F 5BMZA 3K7AJ 1UFMA 1I5ZA 2G9WA 5HLIA 2A6TA 3C3WA 3F3XA 1W5CC 1W5TA 1OR7C 2V7FA 2WAEA 4M9SA 4PGGA 1PP8F 1ZRDA 5E8GA 4OAZA 1XPXA 4NC7A 1T38A 3DFGA 2JWTA 2ECBA 2P6TA 4E7SA 3OY9A 3PQKA 1UHSA 4AD9A 2HQNA 4EEFG 1VQMI 3E97A 3H5NA 1XCVA 3K4NA 2P4WA 2A69F 3FM5A 3O6BB 4L9JA 3ZMTA 5HOOA 3F6OA 3ECOA 5CQEA 2PMUA 1WI3A 4CSWA 3C2HA 4NQWB 4P55A 2HU9A 2CG4A 2QBYB 1T2KA 2HNHA 2PFBA 3A01A 3FK7A 4E7ZA 3HUGB 1A31A 2XB0X 4M73A 1R58A 3ZMUA 4C3HJ 4KIBA 3AAFA 1N78A 4A5MA 1YS6A 5LGUA 6PAXA 1KU3A 3ZMDA 4CZCA 4FX4A 4N4NB 1HQCA 1W5SA 1T08B 4LMYA 4LK1F 5GAEJ 5L3CA 2XRLA 3H5RA 2HVSA 3LAPA 2OQGA 4DNCA 2K3PA 3TQNA 3CF2A 3RI4A 3ZMVA 3W3CA 3HOYJ 4GFBA 3I3LA 1U2WA 3K2AA 2Y2ZA 3KP3A 4II3A 3CO7C 4J01A 1G4DA 1Y8RB 4HDUA 2EIKH 5BOXA 2DTRA 3QQAA 1OMIA 3WGGA 3QPTA 3V8KA 1VQ4I 4ZH4F 4BXXJ 2QENA 4AUXA 3RQ4A 4I6ZA 1YHQI 3CO6C 1IN5A 4V19K 2XVCA 1XCBA 2R7RA 5D8KB 2JMWA 3OIOA 2EIMH 4OU0A 2VB6A 2HKXA 3JR9A 1R71A 2B63J 2DOFA 3VYTB 5FJ8J 4I0AA 1TNTA 5D5WB 2IW5A 2RNGA 2BY2A 3J81Z 3HHGA 4NDLA 4F91B 1T39A 1IV8A 3FMSA 3KE2A 2LYCA 1FZPB 1FJLA 1VQ9I 3F0CA 2KJBA 3KEOA 2EBIA 4IQ4A 5DUIA 4A3JJ 2HPIA 4RAFA 1J7KA 1HF0A 2JVHA 5BPIA 1S5LC 2ZC2A 2JPCA 2YSRA 4ENKA 3P9IA 3FXLA 4P9UA 4CCKA 2JRTA 1IC8A 3ZQQA 2C6YA 2M7AA 3MEXA 4I7HA 1B8IB 1BOAA 2JN6A 3PIPF 4FX0A 3FHNA 4F55A 4LD5A 5DYMA 1NG7A 4FQGA 2R5ZB 3F21A 4UV9A 3J7ZI 5FGMA 3COAC 5EG0A 2Z2SB 2QKMB 2LSOA 1S3JA 2OZ6A 2A6HF 3CMMA 1OCOH 1WGXA 3J81K 3JRHA 4UUSB 1B6AA 3AKZA 1USSA 1X58A 2PI0A 2PX9A 2H8WA 4IJAA 3MCZA 3SZGA 4LIVA 4AVZA 4I76A 2CSOA 2VOPA 1X4OA 2K9QA 3HRUA 1FBQA 1R49A 4HQMA 3RKQA 4LG0B 1YX5A 1U5TB 4AU7A 3G2BA 3IUOA 2MLGA 5L3DA 1O3RA 3A02A 4RLQA 5HLTA 1X1PA 4K2EA 4KJZA 3HHHA 4BE0A 1H89C 2WBMA 3SEQA 1I1SA 3DWLE 3ABUA 3JSOA 2A5WA 4JBAA 3M7GA 5M5XJ 1SFOJ 3MD2A 4I01A 2CRGA 1I50J 1VQ6I 4XN0A 3N05A 4R1HA 2BXYA 5EGOA 4CYCB 2BOLA 4G7ZF 5L3GA 1YW9A 4OIOF 5D6EA 1J59A 1JHHA 2M2EA 1MBEA 2VKDA 4BUPA 3ELKA 3LNQA 1D0ZA 3GW2A 1HXDA 3ZRGA 5GADJ 3L2WA 1NHAA 1TQIA 5TISC 3IH2A 3MMYB 4GYIA 4R8HA 4QWQA 2GIVA 3I5UA 3HB9A 2ZNYA 3K4LA 4Y7NJ 2VJIA 2R93J 3BG7A 1YTYA 1FLIA 1LUJB 2VN2A 1LNWA 2JVGA 4BBRJ 3UR3C 2KL4A 2Y0MA 2DQLA 1ZHFA 2VPRA 3DP7A 3HRTA 1ZLKA 2W1OA 5E3LA 1K61A 4I02A 2LNBA 3CLQA 3L7WA 2ME0A 2JRMA 3WU0A 1DUXC 2IRFG 5FLVA 5D5VB 1UELB 2P6SA 3QRFF 1XB4A 4EGYA 1ZGWA 2GA1A 4OIRF 1SD7A 2MD0A 1LEBA 3Q0WA 5ICCA 5J1YA 3CCMI 2V4JC 2V6CA 1WRJA 2DA4A 4S0HB 1LJ9A 2G0EA 5E1ZB 4EJWA 5J6XA 4XKBA 2EFWA 1DP7P 2HI3A 1EJ9A 4UXNA 2ZO4A 1DPUA 2X6YA 5IY5H 1RC9A 1ZKGA 2DA3A 3LQQA 4P1WA 3IKTA 5D6FA 1GUUA 4GYGA 1X19A 2FBIA 3H9GA 3KZIC 1G3SA 1UZCA 2L0KA 2DT6A 4D5CA 4M6VA 2E71A 1PVEA 2GXAA 2O03A 4M3EA 3EUKL 1FYLA 4M6XA 1QZYA 1IN6A 4G12A 3WTTC 4ENMA 3O8GA 2EILH 2LH9A 2YUSA 4XNFA 3OYCA 1XDUA 3H9QA 3GTKJ 1P7JA 1RI7A 1H9TA 2B7EA 4BNCA 4RM3A 3PUFA 1YO5C 2OTJI 1ACIA 4Y15A 5BNGA 2GQQA 4BXUA 3LA3A 4R79A 5GTIC 1UG2A 4EV0A 3S1QJ 2IEKA 3HRSA 4XRSA 3ABTA 2XROA 1GVJA 4BDYA 1MMSA 2CMPA 1MH3A 2CYYA 3L1PA 3V42A 2HYFA 2COBA 2XC7A 3EPZA 4RB1A 1A04A 4ZYAA 2NVYJ 3P9KA 4B47A 1XSXA 2Y0SA 1UB9A 3BQYA 3CJRB 1FOYA 3RCOA 2L7FP 1MNEA 4M71A 4EJOA 2X6OA 1U78A 4FTHA 2V6EA 2OC6A 5KVRA 5AIQA 1D0YA 1X3ZB 2EV0A 4JX5A 4P96A 4WXCA 2E1MC 4UB8C 3K9TA 1YYVA 3KEQA 4A2UA 4G6DA 1EH8A 1CGPA 5HDKA 2TDXA 3ZQIA 2FF4A 1VQPI 4KIFA 2VQCA 1BOBA 2VT2A 1EKEA 3I56I 3G1MA 3I59B 3DEWA 3KCCA 3GX4X 1SVLA 2IA2A 1Q1HA 3JRCA 3HDDA 2JA8J 2XPVA 3CTAA 1Y8QB 4I0BA 3A1YA 1Z21A 3M1CA 4BKXA 4F7ZA 3RYRA 1R7JA 2CQ7A 1WWXA 2XV4S 5CYVA 4RS8A 5D8LB 2LKPA 1F36A 4IPAA 5F6FA 1H8AC 1QA6A 4UUTA 4II2A 2QQAA 4KT6A 2KRCA 2NVUB 4PSXA 2HVQA 3DU6A 3G1OA 2ID6A 3GF2A 2MYSA 1EV7A 1V5FA 4CCLA 1VTNC 3I64A 4EATA 1G3TA 4N4OB 2MSYA 2GLOA 1KYWA 5ILUA 5ILSA 1R4NB 2W57A 1MNMC 2XAGA 4F93B 1I6XA 3JTGA 2OJED 2RREA 2L9NA 3JRBA 4A3EJ 4L5IA 1HA8A 2PEXA 2DA5A 3L09A 2Y0SN 3R0JA 5IT3A 2V1DA 4S04A 3LSTA 4BHCA 2X1DA 2L4AA 3P7NA 4HF0A 3VSLA 1FIAA 4FHTA 3LSJA 2HFHA 2FMLA 3I71A 1Z67A 4X1EA 2HKOA 1JGGA 3DCFA 3EYYA 1VQ8I 1O7LA 1W7PA 1JI8A 1USTA 2W4SA 4ZC3A 4XLFA 2GXGA 1HW2A 2DW4A 3LWFA 1ZH5A 3J80Z 4HW0A 4PCQA 5F0HA 3CUQA 2HXIA 2VBXA 4AIJA 2XIGA 3OYMA 1R4MB 2LY9A 1V5EA 2ZSHB 4DBRA 5EDNA 2CS3A 4PJJA 1KU9A 3FXJA 1POGA 2ICWG 3KP2A 5K5RA 4CICA 1WJDA 3OL3A 1SC7A 4GGGA 1LE8A 4E7KA 2L4MA 3ZCOA 1F5TA 2PMZA 3ROUA 2EA4A 1SVMA 3CC2I 1YIOA 3OYGA 4A3FJ 3SEZA 3S8PA 5LLQA 2KIMA 1R6RA 1QRYA 5IOZA 5C4XJ 2ZJPF 5DCMB 3OIQA 5M3FJ 2DFFA 1IRZA 3S3OA 4OMYA 3LSGA 1TTYA 1IXSB 3I55I 2RV8A 3GTQJ 1FT9A 2R7XA 2K4JA 4O5VA 2VLAA 1J5YA 3AG2H 1TWCJ 2LTPA 1YJNI 3LFKA 3LSKA 1YS7A 2ZSIB 4XORA 3EUHC 1QZEA 2VQLA 2ZMEA 1S7AA 1ULYA 3JAMZ 2NOGA 3WODF 4ZTFA 3PUBA 2R7DA 3FBIB 2LRDA 5L3FA 1Z9CA 1FBSA 3E6DA 4XLCA 4GDFA 3S15J 2V26A 3DPLC 4KMUX 2E7WA 2ELKA 1BI3A 3TL4X 1K7AA 3DKXA 2WB1A 4D9JA 4XL9A 3HSEA 2J5PA 3FF5A 1UMQA 4WWCA 4MQ9F 2K9LA 2CUJA 2L5QA 1YI2I 3H92A 4PJNA 4MTEA 1IXRC 2XGDA 5EEGA 1EH7A 4Y52J 3ASNH 1XGNA 4C30A 2RQPA 2BBYA 1OLTA 1QGPA 4P9FA 2ME6A 1JT6A 3ERMA 1ZRFA 4B4CA 4AYBN 3DLLF 2JA2A 2ZFUA 1O3QA 1BI2A 3BR5A 3BJ6A 2HTJA 4YIIA 1MMGA 4E7HA 1O3SA 2QUFA 1HCRA 1BW5A 2QCOA 2H94A 3ABLH 4XKCA 3CMAI 2XB5A 4BXFA 4DZPA 2X1CA 3WTSC 3MVPA 4W1UA 2K85A 5LBQA 3HSRA 4M3GA 1BJAA 3NQOA 2E2HJ 1R9TJ 2L7ZA 4XLEA 3X2QH 1AU7A 4U88A 4IEJA 1AKHA 1JJ6C 3HSFA 2M3AA 1QVUA 4B44A 2OCEA 4GO1A 1MBKA 3WTWC 1T0FA 3WHCA 3KZZA 4GXOA 4JX6A 4CA0A 1EF4A 4QIWN 5F0FA 4LOCA 4MNUA 3FXKA 2VXZA 2GIZA 2I10A 1DU6A 4Y4RA 4L9NA 1Z05A 1I27A 3L2UA 4XR6A 1I6HJ 4Y13A 2VOOA 3GTPJ 4S05A 1K83J 3BZCA 2XGCA 2AQFA 1VI0A 5DS9A 1SAUA 2NYXA 3K2ZA 3VOEA 4BJTA 3KETA 2V79A 3OR1C 3DPTA 3ZOBA 1IZ1A 3S1NJ 3ZQLA 3VEPA 4ZYGA 4KFCA 1LKXA 3L2RA 1MJ9A 2LMDA 1KYZA 3RYPA 4HX4A 2WAQN 2LDUA 2IA0A 5J3LA 4IHWA 1D8KA 5IT9Z 3WGIA 5FROA 3CCYA 3ABMH 2JSPA 5GP9A 4BEHB 5CVRA 3BDDA 1TW2A 1Z6TA 2QSFX 5DD8A 4PFPA 5K1YA 2A6EF 1B59A 2JJ7A 4XOPA 4CCMA 2YX7A 4BJ6C 3JW4A 3ULQB 2M1BA 3C18A 2BXZA 3BQZA 2DMNA 3L2CA 1R1TA 2DT7B 1U5TC 3G4SI 1L0OC 5HVQC 3AG3H 2CUEA 4C3JJ 3U2RA 2ID3A 4EVIA 3BG3A 1Z7LA 2DMUA 3E6CC 2E36A 1OR7A 3K0LA 4LFUA 1VQOI 4QPOA 3EDPA 5JHFA 1RUNA 2M0MA 4M3BA 2KRFA 5F08A 1IN7A 2EZIA 5F1JA 1VZ0A 1Y0NA 4UVCA 4ANJA 2XHKA 5IT9K 1P2FA 3HPGA 3IV5A 3I58A 4CO8A 2ADUA 3K1MA 4IRGA 2Z16A 4HAMA 3KP5A 3N97A 3V7SA 2DBBA 2NNNA 4XRSG 4I2OA 1Z3XA 3K69A 2VC0A 4RLFA 1Z77A 3FHZA 4LB5A 3DEUA 3PL8A 1WKMA 1D3YA 1LE8B 1WJ5A 4DYRA 2EZHA 2O8KA 2Y31A 4ZDLA 1HLVA 5IYDJ 5BPDA 1FX7A 5CKTA 2DA1A 4AIHA 4ZTJA 1OCPA 5GTHC 4PJ0C 4ZYEA 4KMFA 2A05A 2XKOA 3M4OJ 3PQJA 2ZCWA 3GZ5A 3GVAA 4RGRA 3CDLA 4AC0A 3F6VA 3DTKA 3GO5A 3GYHX 4XLHA 3IKVA 1ETXA 3IRQA 2DXIA 1MMNA 3MKWB 2UXXA 4FASD 2IP2A 5J1RA 2FNAA 5EYRA 3I4PA 2MH2A 1J0RA 2O0YA 4BL0B 1W36C 2HOAA 4HSRA 1IN4A 4ZYDA 3OYLA 2O61A 1SFUA 2L54A 3CDIA 3SDGA 5K7ZA 1IO2A 1TNSA 1RUOA 2CV0A 1YFHA 1MDMB 3EQLF 4I09A 1SANA 2Q2EA 4LG3A 2MFZA 1G3WA 4YELA 1LVAA 3ZMSA 4C2MJ 4JX4A 1ON2A 3MFKA 4KN4X 4E7LA 5E18F 3U1DA 3BC8A 3ZR8X 4XSXF 2FEZA 4N0BA 2FMYA 3RZDJ 1YITI 3K1PA 3V8JA 2FA5A 2L7KA 2EK5A 2NXNB 3GCMA 3RIRA 2BVMA 1O4XA 4NB5A 2XGXA 3H3ZA 1IRXA 2KDOA 1X4PA 2GAUA 3IHUA 3WE2A 1JKRC 1P4AA 2DOEA 3S32A 4MIMA 2HYGD 3FXQA 4BQNA 5IOYA 2DCEA 5L3BA 3GUDA 3BTLA 2KJCA 4RB2C 3ZN0A 1QHGA 3TKYA 3OYNA 1B9NA 4IRHA 2K5CA 2R7FA 1FC3A 5E1XA 2P81A 4H0EA 2QWWA 4UV8A 1ZELA 3QPLA 3MZ8A 3WE3A 2CH0A 5TJJA 3JRFA 3LSIA 3NARA 3G71I 5KCMA 1AA7A 5FLXK 4IQJA 1RESA 4UUVA 3GLXA 3KP6A 1JTYA 2JQ7A 1C0WA 3HJEA 3NEUA 1TWAJ 3HOTA 3KEYA 2YR2A 3Q0VA 3F8BA 4UB6C 4UNOA 1IUYA 3FIWA 1XN7A 2PN6A 1V5GA 4PK4A 3J7YJ 2JSCA 4PSWA 2HPMA 2A07F 2NVQJ 2DPDA 1KU7A 3MZHA 4G7HF 3S2DJ 3CP2A 3IWFA 2CGPA 2K4BA 5L3EA 1IW7F 1U3EM 2BEOA 3TO6A 2JUGA 1R1UA 4C2TA 1DDNA 3WU2C 5D5UB 2MG4A 2IAIA 2G7UA 3JTHA 4ASNA 3GEZA 5J40A 1G2HA 1N25A 3SZPA 3VODA 3M3YJ 2MLKA 2IS2A 4YIRX 3LSRA 3I9V2 3OOPA 1P7IA 3S1RJ 5CVVA 1QZZA 3DKWA 1XC5A 2LC2A 1DP3A 1VNDA 2VQGA 4RAYA 1Z0XA 5DM6F 1O3TA 3Q5FA 3V8LA 1E2XA 5LEKA 4L0ZB 5CLSA 2MC3A 1WVRA 1QNTA 2KT0A 3D1NI 2P0WA 3A4CA 1TWHJ 2OD5A 5EEAA 2JTVA 2NOJB 2B9SA 2DFHA 2FNPA 2BW3A 1ZGAA 4HF2A 1R1VA 3ZMZA 3BPVA 2DMQA 3LA7A 4M6YA 4F92B 1FYKA 1MIJA 3GFMA 2DFEA 3S14J 4FE7A 5E3MA 2HZDA 2E5NA 3I0TA 4XQFA 4ESJA 2HXOA 1PYVA 4LLGF 1B72B 2L3DA 2F5FA 3CJQB 2LREA 2ACJA 3H9JA 1ETQA 1IRGA 2E19A 2HZTA 2V9KA 1OYIA 2FX0A 2IS6A 2VJJA 1WJAA 3OV8A 4V2FA 4C2UA 5DDGA 2WV1A 5GPAA 1KQ9A 3QOPA 4PJMA 1I39A 2KIUA 2D45A 2OBPA 4L9VA 3RKXA 1KONA 2FBKA 5KK1A 4ZYHA 1GT0C 3BZ6A 2QQBA 1AOYA 3OMYA 2A3SA 3E6BA 2LLKA 5CVIA 4M9XA 1MGTA 4IOCF 1XTAA 3GLLA 1DQUA 1IGNA 1WJCA 2ELJA 5D4SA 2H6BA 4HG2A 3CCVI 4NHJA 2CO5A 2DI3A 4QTRA 1F1ZA 2R7TA 2DFIA 3FKJA 4RMNA 2X6XA 1X1DA 2PJRA 1JKQC 3LSPA 2KPMA 4KYWA 2EFQA 1S6LA 1Y1VJ 1YW8A 3TOAA 4HPQA 1FIPA 1BC8C 5F27A 5TRDA 2Y48A 4D5FA 5A2QZ 3AL0B 3A01B 2F5EA 3CLOA 3WTYC 3A03A 4KISA 1BR2A 4A3BJ 4HLXA 4HRIA 2L9VA 2KKOA 2KIFA 3M8JA 3CJNA 2M4KA 2DYRH 3KIOA 3QYFA 5LRSA 1SFXA 2RKHA 2VASA 3OS2A 2HYJA 1XGMA 2R7UA 2FD5A 4NUBA 5H2FC 1LPQA 2V1XA 1FOKA 4A6DA 4A0YA 2QEXI 1ZR2A 3TDUC 1T8IA 3ML6A 1V55H 3NWTA 5D4RA 4G8XA 3T8TA 3HTSB 3U1KA 1IDYA 2M7BA 2Q2EB 4Q48A 4XMYA 1V54H 1ZK8A 2CW7A 2XUBA 4YFXF 1AHDP 1J75A 2NAZA 5F04A 1WI9A 1BN5A 5GPCA 5DTDA 4Y17A 3A2KA 5FKKA 3PNTA 4A3CJ 1YQAA 2KISA 5E8IA 2QM3A 1GXQA 1GXPA 5BQTA 3CCQI 3PO2J 4L5EA 4ESBA 4IHXA 4MHGA 2N8GA 3CMEI 5LFAA 5A2QK 1TC3C 2R3SA 5JI6A 2Z5UA 4EMSA 1F9NA 1RETA 5EZGA 4ZZDA 2M87A 5KHDA 1SFKA 2KHMA 4Y33A 2FXAA 4WK8F 3F8FA 3S2WA 2O7OA 2DJNA 4KT5C 2BY3A 5EZHA 4CCJA 5JHUA 2VODA 3FWEA 1WSUA 2D1HA 2F5CA 2H09A 4GCVA 4EM1A 3S2HJ 3LMMA 4U0WA 4QLCU 2XPUA 4A3DJ 4MO7A 2ISZA 4CGZA 2LP0A 4PGHA 1XMAA 4HNTA 4HV6A 3K4MA 3ESWB 3FK6A 3DPUA 3JRIA 1E0EA 2ZXIA 5EG0B 3TP0A 3CDHA 1Y0UA 3F8MA 4D7NA 2P7VB 4XN3A 1R00A 2HS5A 4JYKA 4DOZA 5JVTA 3TOBA 3VYRB 3HYIA 5ICEA 2F4MB 2UWMA 3OIPA 2LK2A 3K70C 3GMEA 3ZQFA 2OQRA 4XONA 1LFBA 4IHSA 3WU1B 5HNFA 5FO5A 4E70A 1XD7A 2X1EA 1U8BA 2CJJA 3FM3A 1A36A 2MA3A 1P9QC 3Q9VA 2LBFA 2W85A 3MKZA 1BIBA 3I53A 3DQVC 3FX3A 1IXCA 2K9SA 2P7CB 2STWA 1I3AA 2H27A 1P4XA 2OPTA 5J4YA 2IGMA 1XGSA 4LLLA 5F1RA 4A12A 3ZQCA 1BC7C 2P5KA 2LG4A 1H9GA 5CVUA 2F6CA 1CF7A 2AHQA 9ANTA 2QZ8A 1X3WB 1IJWC 1RZ4A 1FTTA 4A93J 3CCUI 5IPAA 3RKWA 4KICA 1FMVA 1QPMA 1MW7A 3E5QA 4PFOA 5ED4A 3B6CA 3CC4I 5C44J 2JT1A 2G7HA 5LGNA 4E6KG 3OR2C 3TO7A 2JZYA 4KIGA 3HEFA 2FRHA 4RA2A 1TWGJ 3KP4A 2NNYA 4W97A 4BY1J 2VI6A 4L0YB 5EGOB 2F2EA 3BPXA 3HTUA 2Y30A 1U0JA 4CXFA 4L9TA 1Z3YA 4J19A 2M8EA 1LDJA 1V4RA 4ITVA 4B3AA 1S72I 2CFXA 4AYBA 3WTVC 5K5OA 2VT3A 3PSIA 2OAZA 2RQQA 3PJRA 4XOTA 4ON0A 1WZ2A 2EZLA 2R7OA 2ISYA 2M9HA 4M9ZA 2QVOA 1FBUA 2NRAC 2A5YB 5FB2A 2UXNA 4FE4A 1STZA 1YJ9I 1MZBA 4YFNF 3S1MJ 2KFDA 3WTXC 5DEQA 2WY7Q 1W1WE 1ZGJA 1BBYA 1XGOA 1ZR4A 4EJVA 2IBDA 1SD5A 2EWNA 3W2VA 3HKZA 2M45A 3QP5A 2QGUA 3CCSI 4BHPA 2HQRA 2RN7A 2WTEA 3QAHA 2VKEA 3QPSA 2DK5A 3E0JB 4NQWA 1WFXA 3H3VK 4U0YA 1W0TA 2K9NA 4E4HA 1MH4A 1S29A 1LVKA 1YW7A 4B1RA 3HUGA 2DU9A 3G1LA 5ERIA 4F52A 4HQEA 1ZAOA 3DBRB 1ZG3A 4LB6B 1SEUA 4B48A 5FKMA 1YRNA 5HODA 2Y69H 2B0LA 2K86A 3TMOA 1B4AA 1BI1A 1TT5B 1NTCA 3GTOJ 2ELHA 3FDYA 4BJ5C 1QVTA 2X51A 3GWZA 2ZJ2A 1WJFA 1IV6A 2QSHX 1ZN2A 4XLNF 4YG2F 2XRNA 1Z6RA 2PJRB 2BV6A 1OFCX 3HC7A 3ZGKA 1QQIA 3SDBA 4EGZA 3BR2A 1ZTRA 2EB7A 3QWLA 1HC8A 4DYQA 1CQTA 2R5YA 5CPRB 1SD4A 2WAQA 5LHHA 4BU2A 3H5AA 2ZXJA 4JK1X 4YRVA 1VQLI 5BS6A 2DA7A 3BJOA 4J00A 3REOA 4O3MA 3OYKA 2QQ8A 2X6WA 3H35A 2FJ1A 1H88C 3S16J 1GV2A 5JFRA 1F4KA 1QPIA 1U6GA 2EQRA 2WY8Q 5IP6A 4IF4A 2KP6A 3DKYA 3UNGC 3W6KB 2H1KA 4DQ2A 1R5HA 2ZKZA 1ETVA 1VF9A 3FMQA 2RVCA 3HKZN 1SFEA 4RGSA 1TZLA 4BS9A 4I99C 3ZPLA 3KP7A 1D5YA 3FXUA 1G59A 2MBFA 1IG7A 4C3IJ 1JUPA 2XAJA 3QYBA 2ZJRF 4BQOA 2EZKA 3K4CA 5FRNA 1YG2A 4XM3A 3HBLA 4CYDA 5IYBJ 2L7MP 3IWZA 4PZJA 3BTJA 3PFIA 1D0XA 3F8CA 1OQYA 1SD6A 2VUMJ 3IAS2 5E79C 1QU3A 3FXMA 3WGHA 2BGCA 4D7MA 2M34A 1XMKA 2KZVA 2CFOA 4FT8A 1ETOA 3SFZA 3BT9A 1DGRM 1FP1D 2VC1A 4NC6A 1E3HA 3MKYB 3P5JA 4BE1A 1FYMA 3TBIA 3MN2A 3MWMA 3J7AY 3HRMA 2DTZA 4P5OA 5TGTA 4CDGA 4HLYA 2LD5A 2ZBKA 1U9OA 4UUSA 1UJ8A 4V2GA 4A6EA 2DA6A 4IO9F 1BW6A 4NC8A 2EFPA 1NK2P 2H1LA 1LFPA 3A0HC 1ERDA 3R0AA 3BZKA 2F4OB 3L9FA 2DO7A 2JUCA 2FBHA 2KDZA 3R6SA 1E17A 5HLHA 2IS1A 5J8FA 2PLYA 1T0FC 3HZJA 1T95A 2ESNA 4AIDA 1Y39A 1U5TA 4DYCA 3VB2A 1OCTC 4PDKA 2YX4A 2X9DA 4HF1A 2JA6J 3W2WA 2E1NA 5JLWA 2CV1A 4E7JA 2D1VA 1A35A 3RPQA 1HW1A 2DYSH 1T98A 4IKFA 2XAFA 3R61A 3ABKH 5AIPA 3D5LA 3U9GA 1YE9A 2QF7A 1GDTA 1S7OA 1DU0A 1XSVA 3QOEA 5LRRA 5C4JJ 2V9PA 4CYCA 3QU6A 3I4NJ 1QBJA 3S3MA 2CV2A 3SXYA 1T6SA 3RPUD 2DQRA 4DJAA 3RPUA 1X1AA 1EA3A 1KQ0A 2GXBA 4OWRB 2H6CA 2K9MA 5CQGA 2EINH 1NK3P 3M9AA 1NG6A 2E60A 2O3FA 2R4GA 2FUG2 1JHFA 2OA4A 3BJAA 2KRHA 3G6EI 4D1QA 4ZDOA 3VYUB 4HX8A 3MQ0A 1W7PB 1BA5A 1ZLJA 4DBQA 2HOSA 5DD4A 5CJ9A 1ZQ3P 1HW5A 3F9KA 4RGXA 5FLMJ 1SAXA 3HOVJ 2VE8A 2AQEA 2FU4A 1UG0A 1X1BA 3CUQB 5F0CA 4B3XA 5HDNA 3S3NA 1REPC 3CQZJ 3CCJI 2V1UA 5FRMA 2ETHA 1OCRH 3ISPA 3L2QA 1GVDA 1DPRA 3E3VA 3K4JA 4KN7X 5LGTA 4XICA 2E7XA 3RDIA 1FEXA 4B09A 3S17J 1G8XA 2LY1A 1YJWI 2NS7A 4FCYA 1S8NA 3P9CA 1HDDC 4CHUA 1XSDA 2CW0F 2FQ3A 1ZARA 3JRGA 1RKTA 2Y9ZA 1XS9A 1W0UA 1W36D 2XSJC 1R36A 2PJPA 5HS7A 1Z1DA 1B1BA 1SMYF 2W82A 4IL6C 1FNNA 3NAUA 3ERED 1Y6IA 2L02A 1HSJA 1HOMA 1TLHB 3T5XA 4A3GJ 2VL8A 1YLFA 5KAFC 4XK4A 3F22A 4HNUA 3DEEA 2KLOA 3M07A 2ZMEB 3O8HA 5H6RA 3BG6A 2VQHA 5ILVA 2IS4A 1RRJA 2RGVA 5EEHA 5FLXZ 3BROA 1I1GA 3IP4B 3SHFA 4ABZA 3W2AA 1X1CA 1K4SA 2CW8A 1VQ5I 4EJUA 1YRNB 2YU9J 4DIQA 4EM0B 3PO3J 4HOBA 4JQFA 2MH9A 2P5VA 3AL0C 1ORKA 2J5OA 2IJLA 2TCTA 1LDDA 3FKIJ 4CZZA 4ENNA 2K3FA 2W25A 4BE2A 4BYYA 4A3KJ 4MFDA 1D1AA 4KNYA 1WQ2A 4ZZLA 3E5UA 2L01A 4HEA2 2DT5A 3WTZA 3ZQ7A 3DXJF 1T33A 1WJBA 2FE3A 4LK0F 1UHWA 5FFZA 1R22A 2R5YB 3GXOA 4RGUA 3VWBA 2CUZA 4G9YA 3PNYA 5EJCA 4D0PA 2DJIA 5E3OA 5M5WJ 2LF8A 1IN8A 1P92A 2NS0A 2R7VA 3BY6A 3HG9A 4BDZA 3BG9A 5E1WA 3A0BC 1BR1A 1BR4A 2KZGA 4XLPF 4MTDA 3L2VA 2EJRA 3B73A 3F72A 2AO9A 2CQKA 1OCZH 1TQMA 3PNVA 4MLOA 2VE9A 1MBHA 2UUZA 1TT0A 3QP6A 1AKHB 3LL7A 3I59A 2GZWA
chains in the Genus database with same CATH topology
1QRYA 5FKNA 2R0QC 2TRTA 1ZR2A 5M3FJ 3ZQHA 4JP0A 1ITYA 1IRZA 3LSGA 4HNVA 3GTQJ 1IDYA 1JTXA 5JLXA 1MSFC 3BG5A 3E7LA 1ZK8A 2OF7A 2XPWA 2LFBA 1E3OC 1TWCJ 2LTPA 5K7HA 1AHDP 5F04A 3W6VA 1B72A 3B6AA 5GPCA 5K7FA 5DTDA 2R7ZJ 3GTGJ 5FKKA 4A3CJ 1A5JA 1JKOC 2LR8A 1PUFA 3PO2J 1ETWA 2NOGA 4L5EA 1MBGA 4IHXA 2N8GA 5J1UA 4XIDA 3HOXJ 3OOUA 1IUFA 3TW7A 5IYCJ 3PM1A 3JRDA 1ENHA 1TC3C 3S15J 1RETA 3K7AJ 5EZGA 2ELKA 3IH4A 2RAEA 2O7OA 2DJNA 5EZHA 1UMQA 3RZOJ 3S2HJ 3LOCA 4A69C 3HM5A 2DMTA 2ECBA 2JWTA 2XPUA 2XGDA 4A3DJ 3WHBA 4MO7A 4Y52J 1UHSA 4EEFG 2LP0A 2ME6A 5E3NA 1JT6A 1RPWA 4B4CA 4AYBN 3FK6A 3JRIA 3BR5A 5EG0B 3TP0A 2K40A 1WI3A 4D7NA 3OSFA 1HCRA 1BW5A 2QCOA 4JYKA 3TW6A 5M3MJ 3A01A 2XB5A 4DZPA 3FK7A 3MVPA 2XB0X 2LK2A 4W1UA 1TWFJ 3ZQFA 4C3HJ 1LFBA 4M3GA 2GBYA 2ZB9A 2E2HJ 1R9TJ 1U8BA 2CJJA 2L7ZA 2XRLA 1AU7A 4IEJA 3HOZJ 3FISA 1AKHA 2JA7J 1JJ6C 3SFIA 2K9SA 4GFBA 3HOYJ 3K2AA 1QVUA 2Y2ZA 1LFUP 2OPTA 3ZQCA 1MBKA 3WHCA 2L9RA 3QQAA 9ANTA 2AHQA 4JX6A 4RBOA 1EF4A 4QIWN 1IJWC 5F0FA 1FTTA 4LOCA 4BXXJ 4M3DA 4AUXA 4I6ZA 5IPAA 2E2IJ 4A93J 2H8RA 2I10A 3BR6A 1DU6A 2JMWA 3OIOA 2B63J 3JR9A 3B6CA 1FTZA 5C44J 1I3QJ 5FJ8J 1I6HJ 1JT0A 3GTPJ 1K83J 3C2BA 3HEFA 2XGCA 4NDLA 1TWGJ 4W97A 1VI0A 5DS9A 4BY1J 2VI6A 5EGOB 2JA5J 2E1OA 2X48A 2Y30A 3ZOBA 3H0GJ 1FJLA 2W48A 4J19A 3S1NJ 3ZQLA 3F0CA 4B3AA 1U9NA 2EBIA 2LKXA 2WAQN 3Q0UA 4A3JJ 5J3LA 4IHWA 1HF0A 3CCYA 5GP9A 2Y9YA 2EZLA 5FKOA 5EF6A 2M9HA 1IC8A 3OSGA 4FE4A 1JUSA 2NVTJ 3S1MJ 1B8IB 2JN6A 1ZR4A 2JJ7A 2IBDA 2R5ZB 3VPRA 3BQZA 2DMNA 3TEDA 5EG0A 2CUEA 2VKEA 2YS9A 1X2NA 3TP3A 3QPSA 4C3JJ 3H3VK 1W0TA 2ID3A 2K9NA 3BG3A 3HGYA 2DMUA 1MH4A 4B1RA 2HQ5A 1WGXA 3G1LA 3JRHA 4UUSB 1JUMA 1T56A 1X58A 3SJMA 1A6IA 3BTIA 5FKMA 5HODA 4M3BA 1YRNA 5F08A 1NTCA 2EZIA 4I76A 5F1JA 3GTOJ 2O9LA 2K9QA 1QVTA 3IV5A 1IV6A 3RKQA 4FISA 2NVXJ 1OFCX 3BR2A 1ZTRA 3A02A 4XRSG 4DYQA 1CQTA 2R5YA 1Z77A 3GBGA 1H89C 2DA7A 1LE8B 4DYRA 2EZHA 5M5XJ 1SFOJ 2Y31A 2MW8A 1HLVA 2O8KA 5IYDJ 1WH7A 2CRGA 1I50J 2FJ1A 1H88C 2DA1A 3S16J 1GV2A 5EGOA 4CYCB 1OCPA 1QPIA 2EQRA 4IHYA 5IP6A 2H1KA 3M4OJ 2XSDC 2M2EA 1MBEA 1ETVA 4AC0A 2NS8A 3CDLA 3LNQA 4X6AJ 1VF9A 3HKZN 1S7EA 1ETXA 5J1RA 3IH2A 1D5YA 5EYRA 4Y7NJ 2R93J 3HB9A 4C3IJ 3CMYA 1IG7A 1JUPA 3UKGA 2EZKA 5FKLA 3ZQGA 2HOAA 3HBLA 4BBRJ 5IYBJ 3SDGA 2L7MP 5K7ZA 2VPRA 3BTJA 1PUFB 2VUMJ 1SANA 3IH3A 5E3LA 1K61A 1ETYA 4D7MA 1Q1VA 4C2MJ 4JX4A 2M34A 2ME0A 1ETOA 3BT9A 5FLVA 4MFEA 3MN2A 1ZGWA 1OJLA 3RZDJ 2DTZA 2LD5A 1U9OA 4UUSA 4V2GA 2VKVA 3Q0WA 1WH5A 2DA6A 5J1YA 4A3IJ 1BW6A 1O4XA 1APLC 1NK2P 2DA4A 4S0HB 3GTMJ 2G0EA 2HI3A 1JKRC 4MIMA 5IOYA 2KDZA 3BTLA 1ZKGA 2DA3A 1ETKA 4DZJA 1GUUA 2P81A 4DYCA 2L0KA 1OCTC 3QPLA 2X9DA 4D5CA 4M6VA 3HGGA 5JLWA 2JA6J 3JRFA 2CU7A 2E2JJ 1HDPA 3NARA 4DW6A 1MSEC 4M3EA 1BL0A 3BR1A 4G12A 5IP7J 1RESA 2QF7A 1GDTA 3O8GA 1DU0A 1JTYA 2YUSA 3GTKJ 1XG1A 1P7JA 5C4JJ 1TWAJ 4RDUA 2EH3A 4CYCA 3Q0VA 5BNGA 3I4NJ 2ECCA 3FIWA 1UG2A 3S1QJ 1RR7A 2IEKA 4XRSA 2NVQJ 4A3MJ 1NK3P 1MH3A 3L1PA 3S2DJ 2COBA 3Q3SA 3BR3A 2NVYJ 1BA5A 2DA2A 1Y1WJ 2HOSA 1F43A 2MG4A 3BQYA 2IAIA 1ZQ3P 5FLMJ 2GM4A 1G2HA 3M3YJ 3HOVJ 2L7FP 1U78A 1WPKA 2X6OA 5F0CA 4FTHA 3LSRA 3CQZJ 1P7IA 3S1RJ 1GVDA 4JX5A 1XC5A 3RQIA 1VNDA 1X2MA 4XICA 3ZQIA 1Z0XA 1FEXA 3S17J 2HOTA 2NS7A 1JJ8C 4FCYA 2HDDA 1HDDC 3GTLJ 2KT0A 3D1NI 3JRGA 1RKTA 2Y9ZA 1XS9A 1TWHJ 1W0UA 3G1MA 5EEAA 3DEWA 2FQ4A 1BJZA 2JA8J 3JRCA 3HDDA 2XPVA 2DMPA 2CUFA 2DMQA 3GTJJ 4BKXA 3NAUA 4QSHA 3S14J 4FE7A 5E3MA 1HOMA 2PMZN 4A3GJ 1F36A 2MGQA 1H8AC 2HXOA 4UUTA 1B72B 3BR0A 4XK4A 1B8IA 1ETQA 1WCMJ 3O8HA 2E19A 2FX0A 2R5ZA 2CQXA 4V2FA 3MKLA 3G1OA 2WV1A 2ID6A 3JRAA 5GPAA 4ABZA 2MSYA 2GLOA 1YRNB 2YU9J 1MNMC 3PO3J 1GV5A 3BTCA 3JRBA 1ORKA 1GT0C 4A3EJ 2DA5A 2Y0SN 2TCTA 1IDZA 2LVSA 2LLKA 3FKIJ 1VFCA 2CQQA 2DN0A 2M8GX 5C3EJ 4A3KJ 1IGNA 4MFDA 4XRMA 1FIAA 2R92J 3LSJA 4X1EA 1JGGA 1T33A 3DCFA 4A3LJ 4QTRA 2D5VA 2R5YB 4BY7J 3JREA 2WB1N 2XGEA 1JKQC 4M3FA 3LSPA 5E3OA 5M5WJ 1Y1VJ 5F0HA 3I4MJ 2HXIA 1FIPA 2JK3A 3BG9A 2LY9A 5M5YJ 5F27A 4IHVA 4D5FA 3HOWJ 5EDNA 1MBJA 3A01B 3A03A 1POGA 4A3BJ 2AO9A 1LE8A 2M0CA 1JKPC 4MLOA 3HOUJ 1MBHA 1RKWA 5IP9J 2HYJA 4A3FJ 4BBSJ 1MBFA 2FD5A 1AKHB 5IOZA 5C4XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRY A;  5FKN A;  2R0Q C;  2TRT A;  1ZR2 A;  5M3F J;  3ZQH A;  4JP0 A;  1ITY A;  1IRZ A;  3LSG A;  4HNV A;  3GTQ J;  1IDY A;  1JTX A;  5JLX A;  1MSF C;  3BG5 A;  3E7L A;  1ZK8 A;  2OF7 A;  2XPW A;  2LFB A;  1E3O C;  1TWC J;  2LTP A;  5K7H A;  1AHD P;  5F04 A;  3W6V A;  1B72 A;  3B6A A;  5GPC A;  5K7F A;  5DTD A;  2R7Z J;  3GTG J;  5FKK A;  4A3C J;  1A5J A;  1JKO C;  2LR8 A;  1PUF A;  3PO2 J;  1ETW A;  2NOG A;  4L5E A;  1MBG A;  4IHX A;  2N8G A;  5J1U A;  4XID A;  3HOX J;  3OOU A;  1IUF A;  3TW7 A;  5IYC J;  3PM1 A;  3JRD A;  1ENH A;  1TC3 C;  3S15 J;  1RET A;  3K7A J;  5EZG A;  2ELK A;  3IH4 A;  2RAE A;  2O7O A;  2DJN A;  5EZH A;  1UMQ A;  3RZO J;  3S2H J;  3LOC A;  4A69 C;  3HM5 A;  2DMT A;  2ECB A;  2JWT A;  2XPU A;  2XGD A;  4A3D J;  3WHB A;  4MO7 A;  4Y52 J;  1UHS A;  4EEF G;  2LP0 A;  2ME6 A;  5E3N A;  1JT6 A;  1RPW A;  4B4C A;  4AYB N;  3FK6 A;  3JRI A;  3BR5 A;  5EG0 B;  3TP0 A;  2K40 A;  1WI3 A;  4D7N A;  3OSF A;  1HCR A;  1BW5 A;  2QCO A;  4JYK A;  3TW6 A;  5M3M J;  3A01 A;  2XB5 A;  4DZP A;  3FK7 A;  3MVP A;  2XB0 X;  2LK2 A;  4W1U A;  1TWF J;  3ZQF A;  4C3H J;  1LFB A;  4M3G A;  2GBY A;  2ZB9 A;  2E2H J;  1R9T J;  1U8B A;  2CJJ A;  2L7Z A;  2XRL A;  1AU7 A;  4IEJ A;  3HOZ J;  3FIS A;  1AKH A;  2JA7 J;  1JJ6 C;  3SFI A;  2K9S A;  4GFB A;  3HOY J;  3K2A A;  1QVU A;  2Y2Z A;  1LFU P;  2OPT A;  3ZQC A;  1MBK A;  3WHC A;  2L9R A;  3QQA A;  9ANT A;  2AHQ A;  4JX6 A;  4RBO A;  1EF4 A;  4QIW N;  1IJW C;  5F0F A;  1FTT A;  4LOC A;  4BXX J;  4M3D A;  4AUX A;  4I6Z A;  5IPA A;  2E2I J;  4A93 J;  2H8R A;  2I10 A;  3BR6 A;  1DU6 A;  2JMW A;  3OIO A;  2B63 J;  3JR9 A;  3B6C A;  1FTZ A;  5C44 J;  1I3Q J;  5FJ8 J;  1I6H J;  1JT0 A;  3GTP J;  1K83 J;  3C2B A;  3HEF A;  2XGC A;  4NDL A;  1TWG J;  4W97 A;  1VI0 A;  5DS9 A;  4BY1 J;  2VI6 A;  5EGO B;  2JA5 J;  2E1O A;  2X48 A;  2Y30 A;  3ZOB A;  3H0G J;  1FJL A;  2W48 A;  4J19 A;  3S1N J;  3ZQL A;  3F0C A;  4B3A A;  1U9N A;  2EBI A;  2LKX A;  2WAQ N;  3Q0U A;  4A3J J;  5J3L A;  4IHW A;  1HF0 A;  3CCY A;  5GP9 A;  2Y9Y A;  2EZL A;  5FKO A;  5EF6 A;  2M9H A;  1IC8 A;  3OSG A;  4FE4 A;  1JUS A;  2NVT J;  3S1M J;  1B8I B;  2JN6 A;  1ZR4 A;  2JJ7 A;  2IBD A;  2R5Z B;  3VPR A;  3BQZ A;  2DMN A;  3TED A;  5EG0 A;  2CUE A;  2VKE A;  2YS9 A;  1X2N A;  3TP3 A;  3QPS A;  4C3J J;  3H3V K;  1W0T A;  2ID3 A;  2K9N A;  3BG3 A;  3HGY A;  2DMU A;  1MH4 A;  4B1R A;  2HQ5 A;  1WGX A;  3G1L A;  3JRH A;  4UUS B;  1JUM A;  1T56 A;  1X58 A;  3SJM A;  1A6I A;  3BTI A;  5FKM A;  5HOD A;  4M3B A;  1YRN A;  5F08 A;  1NTC A;  2EZI A;  4I76 A;  5F1J A;  3GTO J;  2O9L A;  2K9Q A;  1QVT A;  3IV5 A;  1IV6 A;  3RKQ A;  4FIS A;  2NVX J;  1OFC X;  3BR2 A;  1ZTR A;  3A02 A;  4XRS G;  4DYQ A;  1CQT A;  2R5Y A;  1Z77 A;  3GBG A;  1H89 C;  2DA7 A;  1LE8 B;  4DYR A;  2EZH A;  5M5X J;  1SFO J;  2Y31 A;  2MW8 A;  1HLV A;  2O8K A;  5IYD J;  1WH7 A;  2CRG A;  1I50 J;  2FJ1 A;  1H88 C;  2DA1 A;  3S16 J;  1GV2 A;  5EGO A;  4CYC B;  1OCP A;  1QPI A;  2EQR A;  4IHY A;  5IP6 A;  2H1K A;  3M4O J;  2XSD C;  2M2E A;  1MBE A;  1ETV A;  4AC0 A;  2NS8 A;  3CDL A;  3LNQ A;  4X6A J;  1VF9 A;  3HKZ N;  1S7E A;  1ETX A;  5J1R A;  3IH2 A;  1D5Y A;  5EYR A;  4Y7N J;  2R93 J;  3HB9 A;  4C3I J;  3CMY A;  1IG7 A;  1JUP A;  3UKG A;  2EZK A;  5FKL A;  3ZQG A;  2HOA A;  3HBL A;  4BBR J;  5IYB J;  3SDG A;  2L7M P;  5K7Z A;  2VPR A;  3BTJ A;  1PUF B;  2VUM J;  1SAN A;  3IH3 A;  5E3L A;  1K61 A;  1ETY A;  4D7M A;  1Q1V A;  4C2M J;  4JX4 A;  2M34 A;  2ME0 A;  1ETO A;  3BT9 A;  5FLV A;  4MFE A;  3MN2 A;  1ZGW A;  1OJL A;  3RZD J;  2DTZ A;  2LD5 A;  1U9O A;  4UUS A;  4V2G A;  2VKV A;  3Q0W A;  1WH5 A;  2DA6 A;  5J1Y A;  4A3I J;  1BW6 A;  1O4X A;  1APL C;  1NK2 P;  2DA4 A;  4S0H B;  3GTM J;  2G0E A;  2HI3 A;  1JKR C;  4MIM A;  5IOY A;  2KDZ A;  3BTL A;  1ZKG A;  2DA3 A;  1ETK A;  4DZJ A;  1GUU A;  2P81 A;  4DYC A;  2L0K A;  1OCT C;  3QPL A;  2X9D A;  4D5C A;  4M6V A;  3HGG A;  5JLW A;  2JA6 J;  3JRF A;  2CU7 A;  2E2J J;  1HDP A;  3NAR A;  4DW6 A;  1MSE C;  4M3E A;  1BL0 A;  3BR1 A;  4G12 A;  5IP7 J;  1RES A;  2QF7 A;  1GDT A;  3O8G A;  1DU0 A;  1JTY A;  2YUS A;  3GTK J;  1XG1 A;  1P7J A;  5C4J J;  1TWA J;  4RDU A;  2EH3 A;  4CYC A;  3Q0V A;  5BNG A;  3I4N J;  2ECC A;  3FIW A;  1UG2 A;  3S1Q J;  1RR7 A;  2IEK A;  4XRS A;  2NVQ J;  4A3M J;  1NK3 P;  1MH3 A;  3L1P A;  3S2D J;  2COB A;  3Q3S A;  3BR3 A;  2NVY J;  1BA5 A;  2DA2 A;  1Y1W J;  2HOS A;  1F43 A;  2MG4 A;  3BQY A;  2IAI A;  1ZQ3 P;  5FLM J;  2GM4 A;  1G2H A;  3M3Y J;  3HOV J;  2L7F P;  1U78 A;  1WPK A;  2X6O A;  5F0C A;  4FTH A;  3LSR A;  3CQZ J;  1P7I A;  3S1R J;  1GVD A;  4JX5 A;  1XC5 A;  3RQI A;  1VND A;  1X2M A;  4XIC A;  3ZQI A;  1Z0X A;  1FEX A;  3S17 J;  2HOT A;  2NS7 A;  1JJ8 C;  4FCY A;  2HDD A;  1HDD C;  3GTL J;  2KT0 A;  3D1N I;  3JRG A;  1RKT A;  2Y9Z A;  1XS9 A;  1TWH J;  1W0U A;  3G1M A;  5EEA A;  3DEW A;  2FQ4 A;  1BJZ A;  2JA8 J;  3JRC A;  3HDD A;  2XPV A;  2DMP A;  2CUF A;  2DMQ A;  3GTJ J;  4BKX A;  3NAU A;  4QSH A;  3S14 J;  4FE7 A;  5E3M A;  1HOM A;  2PMZ N;  4A3G J;  1F36 A;  2MGQ A;  1H8A C;  2HXO A;  4UUT A;  1B72 B;  3BR0 A;  4XK4 A;  1B8I A;  1ETQ A;  1WCM J;  3O8H A;  2E19 A;  2FX0 A;  2R5Z A;  2CQX A;  4V2F A;  3MKL A;  3G1O A;  2WV1 A;  2ID6 A;  3JRA A;  5GPA A;  4ABZ A;  2MSY A;  2GLO A;  1YRN B;  2YU9 J;  1MNM C;  3PO3 J;  1GV5 A;  3BTC A;  3JRB A;  1ORK A;  1GT0 C;  4A3E J;  2DA5 A;  2Y0S N;  2TCT A;  1IDZ A;  2LVS A;  2LLK A;  3FKI J;  1VFC A;  2CQQ A;  2DN0 A;  2M8G X;  5C3E J;  4A3K J;  1IGN A;  4MFD A;  4XRM A;  1FIA A;  2R92 J;  3LSJ A;  4X1E A;  1JGG A;  1T33 A;  3DCF A;  4A3L J;  4QTR A;  2D5V A;  2R5Y B;  4BY7 J;  3JRE A;  2WB1 N;  2XGE A;  1JKQ C;  4M3F A;  3LSP A;  5E3O A;  5M5W J;  1Y1V J;  5F0H A;  3I4M J;  2HXI A;  1FIP A;  2JK3 A;  3BG9 A;  2LY9 A;  5M5Y J;  5F27 A;  4IHV A;  4D5F A;  3HOW J;  5EDN A;  1MBJ A;  3A01 B;  3A03 A;  1POG A;  4A3B J;  2AO9 A;  1LE8 A;  2M0C A;  1JKP C;  4MLO A;  3HOU J;  1MBH A;  1RKW A;  5IP9 J;  2HYJ A;  4A3F J;  4BBS J;  1MBF A;  2FD5 A;  1AKH B;  5IOZ A;  5C4X J; 
#chains in the Genus database with same CATH topology
 5FKN A;  3RTR A;  2TRT A;  2XF6 A;  1MJB A;  4YEJ A;  2DAO A;  4JP0 A;  3ZQH A;  4HX7 A;  4EJT A;  4CCN A;  4TV7 A;  3CD6 I;  1E3P A;  4RB3 C;  1JTX A;  2VBW A;  5JLX A;  1MSF C;  2OV7 A;  1U8R A;  3BG5 A;  3E7L A;  3RJP A;  2OF7 A;  1KGS A;  2LFB A;  1G6N A;  2O6G E;  3W6J B;  1BM9 A;  1S9H A;  4B8X A;  1ZG5 A;  1N75 A;  2R7Z J;  3C2G A;  1XDS A;  4LLN A;  1A5J A;  1JKO C;  3DBL B;  2A61 A;  5D5X B;  1PUF A;  1P4W A;  2E1C A;  2O8X A;  1ETW A;  3WG9 A;  3CP8 A;  4XKW A;  3HOS A;  4GRI A;  5J1U A;  4XID A;  2BY0 A;  3HOX J;  5B66 C;  1M1E B;  1P6R A;  3TW7 A;  1IUF A;  5IYC J;  5B1A H;  2F5V A;  3PM1 A;  4G6T B;  3JRD A;  4OIQ F;  2HVR A;  3O2P E;  5ICG A;  3GZN B;  2WC2 A;  2MD5 A;  3IH4 A;  2BVL A;  4RB0 A;  4ZDP A;  2Z1D A;  3OL4 A;  4IOA F;  4A0Z A;  5H6Q A;  4HZF A;  2RAE A;  3KPH A;  3GFI A;  1B9M A;  3PIO F;  2AS5 F;  2E34 A;  3RZO J;  1MKM A;  3LOC A;  2CQN A;  4A69 C;  5KNL A;  3HM5 A;  3DV8 A;  2DMT A;  2OTL I;  3WHB A;  4NNJ A;  2K7L A;  3DTI A;  5E3N A;  1RPW A;  4MEX F;  1LDK B;  1TP4 A;  4G94 A;  3BP8 A;  1XX5 A;  2E5Z A;  2VJ4 A;  1KA8 A;  5KAI C;  1FOX A;  3J7A O;  2GOM A;  2K40 A;  4BAY A;  2V9V A;  3DU5 A;  3OSF A;  3K6G A;  3SQN A;  3TW6 A;  5M3M J;  1K6O A;  2L2O A;  1L3L A;  2QYO A;  1QHH D;  1TWF J;  1O7F A;  3RSN A;  2ZXW H;  2WAD A;  4U7D A;  2GBY A;  2ZB9 A;  4LGW A;  2KQR A;  3PFY A;  4XBF A;  1VQN I;  3HOZ J;  3FIS A;  3KLO A;  4IRI A;  2JA7 J;  1RR8 C;  3U21 A;  3ZP5 A;  4UVA A;  3SFI A;  1N77 A;  2BY1 A;  5DCM A;  1LFU P;  3KYL A;  2HEO A;  4YFK F;  2L9R A;  2EFN A;  4RBO A;  2VJ5 A;  2EV6 A;  3OYE A;  1JXS A;  2MC4 A;  4HYE A;  3D5R C;  4M3D A;  4U7B A;  1Z91 A;  2E2I J;  4IVN A;  2H8R A;  1VQ7 I;  2XF5 A;  3BLY A;  2F48 A;  2DDA A;  3BR6 A;  1TBX A;  3HPH A;  4OIP F;  3C1D A;  3CCL I;  2EV5 A;  3OS0 A;  2O5R A;  3M8F A;  1FTZ A;  4MQV A;  1I3Q J;  4WCG A;  3CZ6 A;  3FBN B;  2L9S A;  4JOM A;  5DUK A;  1JT0 A;  3C2B A;  1KQ8 A;  3OYI A;  3E6M A;  3OYD A;  1K6Y A;  5H20 A;  3CCR I;  2JA5 J;  1SVO A;  2E1O A;  2M4G A;  2X48 A;  4AM3 A;  5HS8 A;  5GAH J;  3H0G J;  2IGN A;  2W48 A;  4O6J A;  1ZYR F;  2BHZ A;  3R4K A;  1GLN A;  1U9N A;  4QPQ A;  2IXS A;  3QU3 A;  4BAC A;  2LKX A;  2EPF A;  3FMR A;  3Q0U A;  2KMU A;  3HXL A;  1OPC A;  4H4K C;  3AG4 H;  1ZRE A;  2DPU A;  2M5W A;  2RNJ A;  4AVP A;  2Y9Y A;  3G3Z A;  5FKO A;  5EF6 A;  3V7R A;  2EIJ H;  3GFL A;  3OSG A;  1JUS A;  4OIN F;  2NVT J;  5FFX A;  1FP2 A;  2ZNZ A;  5B3S H;  2A68 F;  3LSM A;  1PDN C;  2VIX A;  1XMX A;  2M30 A;  3VPR A;  3TED A;  4HA8 A;  2YS9 A;  2FOK A;  1W4M A;  4A0X A;  1X2N A;  4I98 B;  3TP3 A;  2P5L C;  4ETS A;  4BH9 A;  4N9H A;  1KZH A;  3HGY A;  5J47 A;  2HQ5 A;  1H0M A;  5CVJ A;  1JUM A;  1ON1 A;  2DOA A;  1T56 A;  4ENJ A;  1AWC A;  5FD6 A;  4M72 A;  1A6I A;  3BTI A;  5DV5 A;  4G6Q A;  3SJM A;  2XAH A;  2BHY A;  3CCE I;  3MAJ A;  4OOI A;  2EA2 A;  2WWY A;  2F4I A;  3M1E A;  4HST A;  2O9L A;  2HWV A;  1PUE E;  2FOW A;  5E20 A;  1G3Y A;  3D5S C;  5B1B H;  2KIQ A;  4FIS A;  2NVX J;  2W00 A;  4YIF A;  2GA2 A;  2OCC H;  3T1B A;  2MAB A;  2COM A;  3DF8 A;  3TO9 A;  1IAW A;  3Q9S A;  2VPL A;  2AXL A;  3GBG A;  1WHU A;  3K70 D;  2PBI A;  2XAU A;  3BOQ A;  3ONQ A;  1Y56 A;  3DTE A;  2VON A;  2MW8 A;  4UY8 I;  5DM7 F;  3ZN1 A;  1WH7 A;  3BCB A;  2VXD A;  2X85 A;  4ZJZ A;  3CJT B;  1OCC H;  1YIJ I;  4IHY A;  2LY2 A;  2Y75 A;  1MMD A;  3H1C A;  1EH6 A;  1R23 A;  2XSD C;  4XKV A;  3B02 A;  4Q47 A;  2NS8 A;  2BE5 F;  4WXD A;  4X6A J;  5J8C A;  2OUM A;  1S7E A;  4BEH A;  2GWR A;  1R5I D;  4ESF A;  5HLG A;  3CMY A;  2ZJQ F;  3UKG A;  3ZQG A;  3L00 A;  5FKL A;  4NBQ A;  4IHT A;  2PQ8 A;  4AIK A;  4EM2 A;  4LJZ F;  1PUF B;  1HBX G;  3IH3 A;  2IT0 A;  1ETY A;  2HDW A;  3AG1 H;  3CF5 F;  1Q1V A;  5HDG A;  5HS9 A;  3SYT A;  2Z3Y A;  1ZRC A;  1OYW A;  2WV0 A;  4MFE A;  4UVB A;  1OJL A;  2K02 A;  4WX9 A;  1TL8 A;  3K4B A;  2EFO A;  1K78 A;  2VKV A;  3IL2 A;  1WH5 A;  3I54 A;  3GFJ A;  3KFW X;  4A3I J;  4C9Y A;  4BGD A;  1APL C;  1RIO H;  3GTM J;  4E7I A;  3FXR A;  5ICF A;  3O3K A;  2BW3 B;  3D0S A;  4N9I A;  1W7P D;  2AXT C;  2DLL A;  3R60 A;  3OYA A;  1R5G A;  2D2W A;  4Z2Y A;  1VQK I;  1OKR A;  1SMT A;  2F5D A;  3ZXS A;  1ETK A;  4DGW B;  2V1N A;  4DZJ A;  1IF1 A;  4PUS A;  1D8J A;  4KIT B;  3EUA A;  3OYH A;  1MMA A;  4RAG A;  3TDZ C;  3IRR A;  3HGG A;  3WTU C;  3JSP A;  2Q1Z B;  2YU3 A;  1J2X A;  3CES A;  2UV1 A;  2CU7 A;  3EUH A;  1HDP A;  4IZZ A;  2E2J J;  1MSE C;  4DW6 A;  1BL0 A;  3BR1 A;  5IP7 J;  2ZXH A;  3H3U A;  3S93 A;  1XG1 A;  3CUQ C;  5FD5 A;  3G73 A;  4RDU A;  4Q4Z F;  1ODD A;  2EH3 A;  2R7W A;  1D5V A;  2K27 A;  4BQA A;  1J9I A;  1HST A;  2QBY A;  2ECC A;  4HDV A;  4U0V A;  1RR7 A;  2OZU A;  4OAY A;  3F23 A;  4OMZ A;  2VBZ A;  2FSW A;  2LF7 A;  2ZFW A;  3WG7 H;  1LB2 A;  2HTS A;  4A3M J;  2W84 A;  1FWZ A;  3MZY A;  2Q8K A;  1OYY A;  2BZT A;  1A6Q A;  1LEA A;  3C7J A;  3Q3S A;  3BR3 A;  2Z99 A;  4BHB A;  2DOD A;  1PP7 U;  5LHG A;  5LD2 C;  4RM2 A;  1KU2 A;  1Z7U A;  2DA2 A;  4RAZ A;  3E1S A;  4LIT A;  1Y1W J;  2JPB A;  1F43 A;  3LQR A;  3J80 K;  2GOX B;  3LA2 A;  2GM4 A;  1O57 A;  1ZG1 A;  1MDM A;  1WPK A;  3IC7 A;  5AON A;  2VKH A;  2UZK A;  3VSK A;  2BYV E;  3VFZ A;  2P8T A;  3IAM 2;  1HKT A;  3RQI A;  1X2M A;  2XDV A;  4WXH A;  1K4T A;  3EYI A;  4XSZ F;  3CUO A;  3ASO H;  1JE8 A;  2ZME C;  2RDP A;  3FXO A;  2HOT A;  2LKS A;  4X0G A;  4F3Q A;  1JJ8 C;  2HDD A;  3KYC B;  3LSH A;  3KYD B;  3GTL J;  1BI0 A;  3K4K A;  3OYF A;  2R7Q A;  5J4V A;  2XF7 A;  4MEY F;  5K5Q A;  1MJA A;  1RNL A;  2R7S A;  4XLA A;  2HOE A;  2HQA A;  2Z9O A;  2FQ4 A;  1BJZ A;  3DLA A;  3OYJ A;  2DMP A;  2CUF A;  3RKY A;  3OS1 A;  3GTJ J;  3KLN A;  2WAF A;  1FMW A;  4QSH A;  1ONV A;  3BCA A;  2PMZ N;  1MD0 A;  1D1B A;  2VBY A;  5JR3 A;  2MGQ A;  1LQ1 A;  4WF2 A;  2HR3 A;  2E1M B;  3BR0 A;  3DBH B;  2RC4 A;  3OWT A;  1B8I A;  5JVG F;  2QKL B;  1BIA A;  1WCM J;  2WA0 A;  4EQQ A;  3JAM K;  4G7O F;  4XRF A;  1D1C A;  2R5Z A;  2CQX A;  4KA4 A;  3MKL A;  3M8E A;  3JRA A;  3N4M A;  1FY7 A;  1HKQ A;  3NWS A;  4HBL A;  1DGW Y;  4MGR A;  1TQP A;  3HIF A;  4CH7 A;  4IXA A;  2XKP A;  2W24 A;  1GV5 A;  3BTC A;  1GHC A;  1UHM A;  4UHT A;  3FZV A;  4LIU A;  4CCO A;  3VDX A;  3KZY A;  2I8D A;  2I5U A;  2LVS A;  4BQQ A;  1IDZ A;  2QA4 I;  1VFC A;  2CQQ A;  2DN0 A;  3QPH A;  2M8G X;  5C3E J;  1UAA A;  2E35 A;  4XRM A;  1TW3 A;  2R92 J;  2QSG X;  3TGN A;  2X0L A;  3HL2 A;  4A3L J;  2D5V A;  4BY7 J;  5B5E C;  2HGC A;  5F64 A;  1FOW A;  2W7N A;  4IX7 A;  3JRE A;  2QQ9 A;  2WB1 N;  2XGE A;  2Q0O A;  4M74 A;  4M3F A;  3V4G A;  4LG0 A;  4L5J A;  3JCU C;  3I4M J;  1PJR A;  1X3U A;  3LAJ A;  2JK3 A;  3ECH A;  2IGK A;  1K79 A;  4U87 A;  3GZ6 A;  4PJL A;  5M5Y J;  4IHV A;  3HOW J;  1MBJ A;  2ESH A;  3F8N A;  2XAS A;  4Z6Y A;  1UCR A;  4FET A;  3T8R A;  2STT A;  2M0C A;  1JKP C;  3CC7 I;  4Q5S F;  3HOU J;  1RKW A;  5IP9 J;  5HNH A;  3BWG A;  4BBS J;  2IGO A;  3H0D A;  2LBF B;  2PMH A;  1MBF A;  1HKS A;  2XAQ A;  2DK8 A;  2YPR A;  4CUG A;  1J09 A;  2R0Q C;  1IRF A;  3KX2 A;  2IPQ X;  3LFU A;  3EET A;  4A5N A;  3QOD A;  4Y3O A;  2OU2 A;  3QYE A;  1ITY A;  2QLZ A;  3E5X A;  5LHI A;  1NH3 A;  1CF7 B;  1YX3 A;  1FSE A;  1WJE A;  3AFH A;  4HNV A;  4B43 A;  3OYB A;  3NRV A;  1YOV B;  2XPW A;  5DCF A;  3T0Y A;  4L18 B;  1OIS A;  1E3O C;  2CWE A;  5K7H A;  3W6V A;  1B72 A;  3B6A A;  1JGS A;  5K7F A;  2Z33 A;  3K1N A;  3GTG J;  1V3F A;  3H36 A;  3VYS B;  4KDP A;  2IA1 A;  2LR8 A;  1FPQ A;  2X4H A;  3SZT A;  2DDB A;  2HDC A;  3V7C A;  1MBG A;  1MND A;  1QO0 D;  2IVM A;  1K78 B;  3K10 A;  4KUM A;  1FSH A;  2PG4 A;  4AWX B;  2LOO A;  4HV5 A;  3OOU A;  1ENH A;  3PSF A;  5LEJ A;  5GAG J;  5E17 F;  5BMZ A;  3K7A J;  1UFM A;  1I5Z A;  2G9W A;  5HLI A;  2A6T A;  3C3W A;  3F3X A;  1W5C C;  1W5T A;  1OR7 C;  2V7F A;  2WAE A;  4M9S A;  4PGG A;  1PP8 F;  1ZRD A;  5E8G A;  4OAZ A;  1XPX A;  4NC7 A;  1T38 A;  3DFG A;  2JWT A;  2ECB A;  2P6T A;  4E7S A;  3OY9 A;  3PQK A;  1UHS A;  4AD9 A;  2HQN A;  4EEF G;  1VQM I;  3E97 A;  3H5N A;  1XCV A;  3K4N A;  2P4W A;  2A69 F;  3FM5 A;  3O6B B;  4L9J A;  3ZMT A;  5HOO A;  3F6O A;  3ECO A;  5CQE A;  2PMU A;  1WI3 A;  4CSW A;  3C2H A;  4NQW B;  4P55 A;  2HU9 A;  2CG4 A;  2QBY B;  1T2K A;  2HNH A;  2PFB A;  3A01 A;  3FK7 A;  4E7Z A;  3HUG B;  1A31 A;  2XB0 X;  4M73 A;  1R58 A;  3ZMU A;  4C3H J;  4KIB A;  3AAF A;  1N78 A;  4A5M A;  1YS6 A;  5LGU A;  6PAX A;  1KU3 A;  3ZMD A;  4CZC A;  4FX4 A;  4N4N B;  1HQC A;  1W5S A;  1T08 B;  4LMY A;  4LK1 F;  5GAE J;  5L3C A;  2XRL A;  3H5R A;  2HVS A;  3LAP A;  2OQG A;  4DNC A;  2K3P A;  3TQN A;  3CF2 A;  3RI4 A;  3ZMV A;  3W3C A;  3HOY J;  4GFB A;  3I3L A;  1U2W A;  3K2A A;  2Y2Z A;  3KP3 A;  4II3 A;  3CO7 C;  4J01 A;  1G4D A;  1Y8R B;  4HDU A;  2EIK H;  5BOX A;  2DTR A;  3QQA A;  1OMI A;  3WGG A;  3QPT A;  3V8K A;  1VQ4 I;  4ZH4 F;  4BXX J;  2QEN A;  4AUX A;  3RQ4 A;  4I6Z A;  1YHQ I;  3CO6 C;  1IN5 A;  4V19 K;  2XVC A;  1XCB A;  2R7R A;  5D8K B;  2JMW A;  3OIO A;  2EIM H;  4OU0 A;  2VB6 A;  2HKX A;  3JR9 A;  1R71 A;  2B63 J;  2DOF A;  3VYT B;  5FJ8 J;  4I0A A;  1TNT A;  5D5W B;  2IW5 A;  2RNG A;  2BY2 A;  3J81 Z;  3HHG A;  4NDL A;  4F91 B;  1T39 A;  1IV8 A;  3FMS A;  3KE2 A;  2LYC A;  1FZP B;  1FJL A;  1VQ9 I;  3F0C A;  2KJB A;  3KEO A;  2EBI A;  4IQ4 A;  5DUI A;  4A3J J;  2HPI A;  4RAF A;  1J7K A;  1HF0 A;  2JVH A;  5BPI A;  1S5L C;  2ZC2 A;  2JPC A;  2YSR A;  4ENK A;  3P9I A;  3FXL A;  4P9U A;  4CCK A;  2JRT A;  1IC8 A;  3ZQQ A;  2C6Y A;  2M7A A;  3MEX A;  4I7H A;  1B8I B;  1BOA A;  2JN6 A;  3PIP F;  4FX0 A;  3FHN A;  4F55 A;  4LD5 A;  5DYM A;  1NG7 A;  4FQG A;  2R5Z B;  3F21 A;  4UV9 A;  3J7Z I;  5FGM A;  3COA C;  5EG0 A;  2Z2S B;  2QKM B;  2LSO A;  1S3J A;  2OZ6 A;  2A6H F;  3CMM A;  1OCO H;  1WGX A;  3J81 K;  3JRH A;  4UUS B;  1B6A A;  3AKZ A;  1USS A;  1X58 A;  2PI0 A;  2PX9 A;  2H8W A;  4IJA A;  3MCZ A;  3SZG A;  4LIV A;  4AVZ A;  4I76 A;  2CSO A;  2VOP A;  1X4O A;  2K9Q A;  3HRU A;  1FBQ A;  1R49 A;  4HQM A;  3RKQ A;  4LG0 B;  1YX5 A;  1U5T B;  4AU7 A;  3G2B A;  3IUO A;  2MLG A;  5L3D A;  1O3R A;  3A02 A;  4RLQ A;  5HLT A;  1X1P A;  4K2E A;  4KJZ A;  3HHH A;  4BE0 A;  1H89 C;  2WBM A;  3SEQ A;  1I1S A;  3DWL E;  3ABU A;  3JSO A;  2A5W A;  4JBA A;  3M7G A;  5M5X J;  1SFO J;  3MD2 A;  4I01 A;  2CRG A;  1I50 J;  1VQ6 I;  4XN0 A;  3N05 A;  4R1H A;  2BXY A;  5EGO A;  4CYC B;  2BOL A;  4G7Z F;  5L3G A;  1YW9 A;  4OIO F;  5D6E A;  1J59 A;  1JHH A;  2M2E A;  1MBE A;  2VKD A;  4BUP A;  3ELK A;  3LNQ A;  1D0Z A;  3GW2 A;  1HXD A;  3ZRG A;  5GAD J;  3L2W A;  1NHA A;  1TQI A;  5TIS C;  3IH2 A;  3MMY B;  4GYI A;  4R8H A;  4QWQ A;  2GIV A;  3I5U A;  3HB9 A;  2ZNY A;  3K4L A;  4Y7N J;  2VJI A;  2R93 J;  3BG7 A;  1YTY A;  1FLI A;  1LUJ B;  2VN2 A;  1LNW A;  2JVG A;  4BBR J;  3UR3 C;  2KL4 A;  2Y0M A;  2DQL A;  1ZHF A;  2VPR A;  3DP7 A;  3HRT A;  1ZLK A;  2W1O A;  5E3L A;  1K61 A;  4I02 A;  2LNB A;  3CLQ A;  3L7W A;  2ME0 A;  2JRM A;  3WU0 A;  1DUX C;  2IRF G;  5FLV A;  5D5V B;  1UEL B;  2P6S A;  3QRF F;  1XB4 A;  4EGY A;  1ZGW A;  2GA1 A;  4OIR F;  1SD7 A;  2MD0 A;  1LEB A;  3Q0W A;  5ICC A;  5J1Y A;  3CCM I;  2V4J C;  2V6C A;  1WRJ A;  2DA4 A;  4S0H B;  1LJ9 A;  2G0E A;  5E1Z B;  4EJW A;  5J6X A;  4XKB A;  2EFW A;  1DP7 P;  2HI3 A;  1EJ9 A;  4UXN A;  2ZO4 A;  1DPU A;  2X6Y A;  5IY5 H;  1RC9 A;  1ZKG A;  2DA3 A;  3LQQ A;  4P1W A;  3IKT A;  5D6F A;  1GUU A;  4GYG A;  1X19 A;  2FBI A;  3H9G A;  3KZI C;  1G3S A;  1UZC A;  2L0K A;  2DT6 A;  4D5C A;  4M6V A;  2E71 A;  1PVE A;  2GXA A;  2O03 A;  4M3E A;  3EUK L;  1FYL A;  4M6X A;  1QZY A;  1IN6 A;  4G12 A;  3WTT C;  4ENM A;  3O8G A;  2EIL H;  2LH9 A;  2YUS A;  4XNF A;  3OYC A;  1XDU A;  3H9Q A;  3GTK J;  1P7J A;  1RI7 A;  1H9T A;  2B7E A;  4BNC A;  4RM3 A;  3PUF A;  1YO5 C;  2OTJ I;  1ACI A;  4Y15 A;  5BNG A;  2GQQ A;  4BXU A;  3LA3 A;  4R79 A;  5GTI C;  1UG2 A;  4EV0 A;  3S1Q J;  2IEK A;  3HRS A;  4XRS A;  3ABT A;  2XRO A;  1GVJ A;  4BDY A;  1MMS A;  2CMP A;  1MH3 A;  2CYY A;  3L1P A;  3V42 A;  2HYF A;  2COB A;  2XC7 A;  3EPZ A;  4RB1 A;  1A04 A;  4ZYA A;  2NVY J;  3P9K A;  4B47 A;  1XSX A;  2Y0S A;  1UB9 A;  3BQY A;  3CJR B;  1FOY A;  3RCO A;  2L7F P;  1MNE A;  4M71 A;  4EJO A;  2X6O A;  1U78 A;  4FTH A;  2V6E A;  2OC6 A;  5KVR A;  5AIQ A;  1D0Y A;  1X3Z B;  2EV0 A;  4JX5 A;  4P96 A;  4WXC A;  2E1M C;  4UB8 C;  3K9T A;  1YYV A;  3KEQ A;  4A2U A;  4G6D A;  1EH8 A;  1CGP A;  5HDK A;  2TDX A;  3ZQI A;  2FF4 A;  1VQP I;  4KIF A;  2VQC A;  1BOB A;  2VT2 A;  1EKE A;  3I56 I;  3G1M A;  3I59 B;  3DEW A;  3KCC A;  3GX4 X;  1SVL A;  2IA2 A;  1Q1H A;  3JRC A;  3HDD A;  2JA8 J;  2XPV A;  3CTA A;  1Y8Q B;  4I0B A;  3A1Y A;  1Z21 A;  3M1C A;  4BKX A;  4F7Z A;  3RYR A;  1R7J A;  2CQ7 A;  1WWX A;  2XV4 S;  5CYV A;  4RS8 A;  5D8L B;  2LKP A;  1F36 A;  4IPA A;  5F6F A;  1H8A C;  1QA6 A;  4UUT A;  4II2 A;  2QQA A;  4KT6 A;  2KRC A;  2NVU B;  4PSX A;  2HVQ A;  3DU6 A;  3G1O A;  2ID6 A;  3GF2 A;  2MYS A;  1EV7 A;  1V5F A;  4CCL A;  1VTN C;  3I64 A;  4EAT A;  1G3T A;  4N4O B;  2MSY A;  2GLO A;  1KYW A;  5ILU A;  5ILS A;  1R4N B;  2W57 A;  1MNM C;  2XAG A;  4F93 B;  1I6X A;  3JTG A;  2OJE D;  2RRE A;  2L9N A;  3JRB A;  4A3E J;  4L5I A;  1HA8 A;  2PEX A;  2DA5 A;  3L09 A;  2Y0S N;  3R0J A;  5IT3 A;  2V1D A;  4S04 A;  3LST A;  4BHC A;  2X1D A;  2L4A A;  3P7N A;  4HF0 A;  3VSL A;  1FIA A;  4FHT A;  3LSJ A;  2HFH A;  2FML A;  3I71 A;  1Z67 A;  4X1E A;  2HKO A;  1JGG A;  3DCF A;  3EYY A;  1VQ8 I;  1O7L A;  1W7P A;  1JI8 A;  1UST A;  2W4S A;  4ZC3 A;  4XLF A;  2GXG A;  1HW2 A;  2DW4 A;  3LWF A;  1ZH5 A;  3J80 Z;  4HW0 A;  4PCQ A;  5F0H A;  3CUQ A;  2HXI A;  2VBX A;  4AIJ A;  2XIG A;  3OYM A;  1R4M B;  2LY9 A;  1V5E A;  2ZSH B;  4DBR A;  5EDN A;  2CS3 A;  4PJJ A;  1KU9 A;  3FXJ A;  1POG A;  2ICW G;  3KP2 A;  5K5R A;  4CIC A;  1WJD A;  3OL3 A;  1SC7 A;  4GGG A;  1LE8 A;  4E7K A;  2L4M A;  3ZCO A;  1F5T A;  2PMZ A;  3ROU A;  2EA4 A;  1SVM A;  3CC2 I;  1YIO A;  3OYG A;  4A3F J;  3SEZ A;  3S8P A;  5LLQ A;  2KIM A;  1R6R A;  1QRY A;  5IOZ A;  5C4X J;  2ZJP F;  5DCM B;  3OIQ A;  5M3F J;  2DFF A;  1IRZ A;  3S3O A;  4OMY A;  3LSG A;  1TTY A;  1IXS B;  3I55 I;  2RV8 A;  3GTQ J;  1FT9 A;  2R7X A;  2K4J A;  4O5V A;  2VLA A;  1J5Y A;  3AG2 H;  1TWC J;  2LTP A;  1YJN I;  3LFK A;  3LSK A;  1YS7 A;  2ZSI B;  4XOR A;  3EUH C;  1QZE A;  2VQL A;  2ZME A;  1S7A A;  1ULY A;  3JAM Z;  2NOG A;  3WOD F;  4ZTF A;  3PUB A;  2R7D A;  3FBI B;  2LRD A;  5L3F A;  1Z9C A;  1FBS A;  3E6D A;  4XLC A;  4GDF A;  3S15 J;  2V26 A;  3DPL C;  4KMU X;  2E7W A;  2ELK A;  1BI3 A;  3TL4 X;  1K7A A;  3DKX A;  2WB1 A;  4D9J A;  4XL9 A;  3HSE A;  2J5P A;  3FF5 A;  1UMQ A;  4WWC A;  4MQ9 F;  2K9L A;  2CUJ A;  2L5Q A;  1YI2 I;  3H92 A;  4PJN A;  4MTE A;  1IXR C;  2XGD A;  5EEG A;  1EH7 A;  4Y52 J;  3ASN H;  1XGN A;  4C30 A;  2RQP A;  2BBY A;  1OLT A;  1QGP A;  4P9F A;  2ME6 A;  1JT6 A;  3ERM A;  1ZRF A;  4B4C A;  4AYB N;  3DLL F;  2JA2 A;  2ZFU A;  1O3Q A;  1BI2 A;  3BR5 A;  3BJ6 A;  2HTJ A;  4YII A;  1MMG A;  4E7H A;  1O3S A;  2QUF A;  1HCR A;  1BW5 A;  2QCO A;  2H94 A;  3ABL H;  4XKC A;  3CMA I;  2XB5 A;  4BXF A;  4DZP A;  2X1C A;  3WTS C;  3MVP A;  4W1U A;  2K85 A;  5LBQ A;  3HSR A;  4M3G A;  1BJA A;  3NQO A;  2E2H J;  1R9T J;  2L7Z A;  4XLE A;  3X2Q H;  1AU7 A;  4U88 A;  4IEJ A;  1AKH A;  1JJ6 C;  3HSF A;  2M3A A;  1QVU A;  4B44 A;  2OCE A;  4GO1 A;  1MBK A;  3WTW C;  1T0F A;  3WHC A;  3KZZ A;  4GXO A;  4JX6 A;  4CA0 A;  1EF4 A;  4QIW N;  5F0F A;  4LOC A;  4MNU A;  3FXK A;  2VXZ A;  2GIZ A;  2I10 A;  1DU6 A;  4Y4R A;  4L9N A;  1Z05 A;  1I27 A;  3L2U A;  4XR6 A;  1I6H J;  4Y13 A;  2VOO A;  3GTP J;  4S05 A;  1K83 J;  3BZC A;  2XGC A;  2AQF A;  1VI0 A;  5DS9 A;  1SAU A;  2NYX A;  3K2Z A;  3VOE A;  4BJT A;  3KET A;  2V79 A;  3OR1 C;  3DPT A;  3ZOB A;  1IZ1 A;  3S1N J;  3ZQL A;  3VEP A;  4ZYG A;  4KFC A;  1LKX A;  3L2R A;  1MJ9 A;  2LMD A;  1KYZ A;  3RYP A;  4HX4 A;  2WAQ N;  2LDU A;  2IA0 A;  5J3L A;  4IHW A;  1D8K A;  5IT9 Z;  3WGI A;  5FRO A;  3CCY A;  3ABM H;  2JSP A;  5GP9 A;  4BEH B;  5CVR A;  3BDD A;  1TW2 A;  1Z6T A;  2QSF X;  5DD8 A;  4PFP A;  5K1Y A;  2A6E F;  1B59 A;  2JJ7 A;  4XOP A;  4CCM A;  2YX7 A;  4BJ6 C;  3JW4 A;  3ULQ B;  2M1B A;  3C18 A;  2BXZ A;  3BQZ A;  2DMN A;  3L2C A;  1R1T A;  2DT7 B;  1U5T C;  3G4S I;  1L0O C;  5HVQ C;  3AG3 H;  2CUE A;  4C3J J;  3U2R A;  2ID3 A;  4EVI A;  3BG3 A;  1Z7L A;  2DMU A;  3E6C C;  2E36 A;  1OR7 A;  3K0L A;  4LFU A;  1VQO I;  4QPO A;  3EDP A;  5JHF A;  1RUN A;  2M0M A;  4M3B A;  2KRF A;  5F08 A;  1IN7 A;  2EZI A;  5F1J A;  1VZ0 A;  1Y0N A;  4UVC A;  4ANJ A;  2XHK A;  5IT9 K;  1P2F A;  3HPG A;  3IV5 A;  3I58 A;  4CO8 A;  2ADU A;  3K1M A;  4IRG A;  2Z16 A;  4HAM A;  3KP5 A;  3N97 A;  3V7S A;  2DBB A;  2NNN A;  4XRS G;  4I2O A;  1Z3X A;  3K69 A;  2VC0 A;  4RLF A;  1Z77 A;  3FHZ A;  4LB5 A;  3DEU A;  3PL8 A;  1WKM A;  1D3Y A;  1LE8 B;  1WJ5 A;  4DYR A;  2EZH A;  2O8K A;  2Y31 A;  4ZDL A;  1HLV A;  5IYD J;  5BPD A;  1FX7 A;  5CKT A;  2DA1 A;  4AIH A;  4ZTJ A;  1OCP A;  5GTH C;  4PJ0 C;  4ZYE A;  4KMF A;  2A05 A;  2XKO A;  3M4O J;  3PQJ A;  2ZCW A;  3GZ5 A;  3GVA A;  4RGR A;  3CDL A;  4AC0 A;  3F6V A;  3DTK A;  3GO5 A;  3GYH X;  4XLH A;  3IKV A;  1ETX A;  3IRQ A;  2DXI A;  1MMN A;  3MKW B;  2UXX A;  4FAS D;  2IP2 A;  5J1R A;  2FNA A;  5EYR A;  3I4P A;  2MH2 A;  1J0R A;  2O0Y A;  4BL0 B;  1W36 C;  2HOA A;  4HSR A;  1IN4 A;  4ZYD A;  3OYL A;  2O61 A;  1SFU A;  2L54 A;  3CDI A;  3SDG A;  5K7Z A;  1IO2 A;  1TNS A;  1RUO A;  2CV0 A;  1YFH A;  1MDM B;  3EQL F;  4I09 A;  1SAN A;  2Q2E A;  4LG3 A;  2MFZ A;  1G3W A;  4YEL A;  1LVA A;  3ZMS A;  4C2M J;  4JX4 A;  1ON2 A;  3MFK A;  4KN4 X;  4E7L A;  5E18 F;  3U1D A;  3BC8 A;  3ZR8 X;  4XSX F;  2FEZ A;  4N0B A;  2FMY A;  3RZD J;  1YIT I;  3K1P A;  3V8J A;  2FA5 A;  2L7K A;  2EK5 A;  2NXN B;  3GCM A;  3RIR A;  2BVM A;  1O4X A;  4NB5 A;  2XGX A;  3H3Z A;  1IRX A;  2KDO A;  1X4P A;  2GAU A;  3IHU A;  3WE2 A;  1JKR C;  1P4A A;  2DOE A;  3S32 A;  4MIM A;  2HYG D;  3FXQ A;  4BQN A;  5IOY A;  2DCE A;  5L3B A;  3GUD A;  3BTL A;  2KJC A;  4RB2 C;  3ZN0 A;  1QHG A;  3TKY A;  3OYN A;  1B9N A;  4IRH A;  2K5C A;  2R7F A;  1FC3 A;  5E1X A;  2P81 A;  4H0E A;  2QWW A;  4UV8 A;  1ZEL A;  3QPL A;  3MZ8 A;  3WE3 A;  2CH0 A;  5TJJ A;  3JRF A;  3LSI A;  3NAR A;  3G71 I;  5KCM A;  1AA7 A;  5FLX K;  4IQJ A;  1RES A;  4UUV A;  3GLX A;  3KP6 A;  1JTY A;  2JQ7 A;  1C0W A;  3HJE A;  3NEU A;  1TWA J;  3HOT A;  3KEY A;  2YR2 A;  3Q0V A;  3F8B A;  4UB6 C;  4UNO A;  1IUY A;  3FIW A;  1XN7 A;  2PN6 A;  1V5G A;  4PK4 A;  3J7Y J;  2JSC A;  4PSW A;  2HPM A;  2A07 F;  2NVQ J;  2DPD A;  1KU7 A;  3MZH A;  4G7H F;  3S2D J;  3CP2 A;  3IWF A;  2CGP A;  2K4B A;  5L3E A;  1IW7 F;  1U3E M;  2BEO A;  3TO6 A;  2JUG A;  1R1U A;  4C2T A;  1DDN A;  3WU2 C;  5D5U B;  2MG4 A;  2IAI A;  2G7U A;  3JTH A;  4ASN A;  3GEZ A;  5J40 A;  1G2H A;  1N25 A;  3SZP A;  3VOD A;  3M3Y J;  2MLK A;  2IS2 A;  4YIR X;  3LSR A;  3I9V 2;  3OOP A;  1P7I A;  3S1R J;  5CVV A;  1QZZ A;  3DKW A;  1XC5 A;  2LC2 A;  1DP3 A;  1VND A;  2VQG A;  4RAY A;  1Z0X A;  5DM6 F;  1O3T A;  3Q5F A;  3V8L A;  1E2X A;  5LEK A;  4L0Z B;  5CLS A;  2MC3 A;  1WVR A;  1QNT A;  2KT0 A;  3D1N I;  2P0W A;  3A4C A;  1TWH J;  2OD5 A;  5EEA A;  2JTV A;  2NOJ B;  2B9S A;  2DFH A;  2FNP A;  2BW3 A;  1ZGA A;  4HF2 A;  1R1V A;  3ZMZ A;  3BPV A;  2DMQ A;  3LA7 A;  4M6Y A;  4F92 B;  1FYK A;  1MIJ A;  3GFM A;  2DFE A;  3S14 J;  4FE7 A;  5E3M A;  2HZD A;  2E5N A;  3I0T A;  4XQF A;  4ESJ A;  2HXO A;  1PYV A;  4LLG F;  1B72 B;  2L3D A;  2F5F A;  3CJQ B;  2LRE A;  2ACJ A;  3H9J A;  1ETQ A;  1IRG A;  2E19 A;  2HZT A;  2V9K A;  1OYI A;  2FX0 A;  2IS6 A;  2VJJ A;  1WJA A;  3OV8 A;  4V2F A;  4C2U A;  5DDG A;  2WV1 A;  5GPA A;  1KQ9 A;  3QOP A;  4PJM A;  1I39 A;  2KIU A;  2D45 A;  2OBP A;  4L9V A;  3RKX A;  1KON A;  2FBK A;  5KK1 A;  4ZYH A;  1GT0 C;  3BZ6 A;  2QQB A;  1AOY A;  3OMY A;  2A3S A;  3E6B A;  2LLK A;  5CVI A;  4M9X A;  1MGT A;  4IOC F;  1XTA A;  3GLL A;  1DQU A;  1IGN A;  1WJC A;  2ELJ A;  5D4S A;  2H6B A;  4HG2 A;  3CCV I;  4NHJ A;  2CO5 A;  2DI3 A;  4QTR A;  1F1Z A;  2R7T A;  2DFI A;  3FKJ A;  4RMN A;  2X6X A;  1X1D A;  2PJR A;  1JKQ C;  3LSP A;  2KPM A;  4KYW A;  2EFQ A;  1S6L A;  1Y1V J;  1YW8 A;  3TOA A;  4HPQ A;  1FIP A;  1BC8 C;  5F27 A;  5TRD A;  2Y48 A;  4D5F A;  5A2Q Z;  3AL0 B;  3A01 B;  2F5E A;  3CLO A;  3WTY C;  3A03 A;  4KIS A;  1BR2 A;  4A3B J;  4HLX A;  4HRI A;  2L9V A;  2KKO A;  2KIF A;  3M8J A;  3CJN A;  2M4K A;  2DYR H;  3KIO A;  3QYF A;  5LRS A;  1SFX A;  2RKH A;  2VAS A;  3OS2 A;  2HYJ A;  1XGM A;  2R7U A;  2FD5 A;  4NUB A;  5H2F C;  1LPQ A;  2V1X A;  1FOK A;  4A6D A;  4A0Y A;  2QEX I;  1ZR2 A;  3TDU C;  1T8I A;  3ML6 A;  1V55 H;  3NWT A;  5D4R A;  4G8X A;  3T8T A;  3HTS B;  3U1K A;  1IDY A;  2M7B A;  2Q2E B;  4Q48 A;  4XMY A;  1V54 H;  1ZK8 A;  2CW7 A;  2XUB A;  4YFX F;  1AHD P;  1J75 A;  2NAZ A;  5F04 A;  1WI9 A;  1BN5 A;  5GPC A;  5DTD A;  4Y17 A;  3A2K A;  5FKK A;  3PNT A;  4A3C J;  1YQA A;  2KIS A;  5E8I A;  2QM3 A;  1GXQ A;  1GXP A;  5BQT A;  3CCQ I;  3PO2 J;  4L5E A;  4ESB A;  4IHX A;  4MHG A;  2N8G A;  3CME I;  5LFA A;  5A2Q K;  1TC3 C;  2R3S A;  5JI6 A;  2Z5U A;  4EMS A;  1F9N A;  1RET A;  5EZG A;  4ZZD A;  2M87 A;  5KHD A;  1SFK A;  2KHM A;  4Y33 A;  2FXA A;  4WK8 F;  3F8F A;  3S2W A;  2O7O A;  2DJN A;  4KT5 C;  2BY3 A;  5EZH A;  4CCJ A;  5JHU A;  2VOD A;  3FWE A;  1WSU A;  2D1H A;  2F5C A;  2H09 A;  4GCV A;  4EM1 A;  3S2H J;  3LMM A;  4U0W A;  4QLC U;  2XPU A;  4A3D J;  4MO7 A;  2ISZ A;  4CGZ A;  2LP0 A;  4PGH A;  1XMA A;  4HNT A;  4HV6 A;  3K4M A;  3ESW B;  3FK6 A;  3DPU A;  3JRI A;  1E0E A;  2ZXI A;  5EG0 B;  3TP0 A;  3CDH A;  1Y0U A;  3F8M A;  4D7N A;  2P7V B;  4XN3 A;  1R00 A;  2HS5 A;  4JYK A;  4DOZ A;  5JVT A;  3TOB A;  3VYR B;  3HYI A;  5ICE A;  2F4M B;  2UWM A;  3OIP A;  2LK2 A;  3K70 C;  3GME A;  3ZQF A;  2OQR A;  4XON A;  1LFB A;  4IHS A;  3WU1 B;  5HNF A;  5FO5 A;  4E70 A;  1XD7 A;  2X1E A;  1U8B A;  2CJJ A;  3FM3 A;  1A36 A;  2MA3 A;  1P9Q C;  3Q9V A;  2LBF A;  2W85 A;  3MKZ A;  1BIB A;  3I53 A;  3DQV C;  3FX3 A;  1IXC A;  2K9S A;  2P7C B;  2STW A;  1I3A A;  2H27 A;  1P4X A;  2OPT A;  5J4Y A;  2IGM A;  1XGS A;  4LLL A;  5F1R A;  4A12 A;  3ZQC A;  1BC7 C;  2P5K A;  2LG4 A;  1H9G A;  5CVU A;  2F6C A;  1CF7 A;  2AHQ A;  9ANT A;  2QZ8 A;  1X3W B;  1IJW C;  1RZ4 A;  1FTT A;  4A93 J;  3CCU I;  5IPA A;  3RKW A;  4KIC A;  1FMV A;  1QPM A;  1MW7 A;  3E5Q A;  4PFO A;  5ED4 A;  3B6C A;  3CC4 I;  5C44 J;  2JT1 A;  2G7H A;  5LGN A;  4E6K G;  3OR2 C;  3TO7 A;  2JZY A;  4KIG A;  3HEF A;  2FRH A;  4RA2 A;  1TWG J;  3KP4 A;  2NNY A;  4W97 A;  4BY1 J;  2VI6 A;  4L0Y B;  5EGO B;  2F2E A;  3BPX A;  3HTU A;  2Y30 A;  1U0J A;  4CXF A;  4L9T A;  1Z3Y A;  4J19 A;  2M8E A;  1LDJ A;  1V4R A;  4ITV A;  4B3A A;  1S72 I;  2CFX A;  4AYB A;  3WTV C;  5K5O A;  2VT3 A;  3PSI A;  2OAZ A;  2RQQ A;  3PJR A;  4XOT A;  4ON0 A;  1WZ2 A;  2EZL A;  2R7O A;  2ISY A;  2M9H A;  4M9Z A;  2QVO A;  1FBU A;  2NRA C;  2A5Y B;  5FB2 A;  2UXN A;  4FE4 A;  1STZ A;  1YJ9 I;  1MZB A;  4YFN F;  3S1M J;  2KFD A;  3WTX C;  5DEQ A;  2WY7 Q;  1W1W E;  1ZGJ A;  1BBY A;  1XGO A;  1ZR4 A;  4EJV A;  2IBD A;  1SD5 A;  2EWN A;  3W2V A;  3HKZ A;  2M45 A;  3QP5 A;  2QGU A;  3CCS I;  4BHP A;  2HQR A;  2RN7 A;  2WTE A;  3QAH A;  2VKE A;  3QPS A;  2DK5 A;  3E0J B;  4NQW A;  1WFX A;  3H3V K;  4U0Y A;  1W0T A;  2K9N A;  4E4H A;  1MH4 A;  1S29 A;  1LVK A;  1YW7 A;  4B1R A;  3HUG A;  2DU9 A;  3G1L A;  5ERI A;  4F52 A;  4HQE A;  1ZAO A;  3DBR B;  1ZG3 A;  4LB6 B;  1SEU A;  4B48 A;  5FKM A;  1YRN A;  5HOD A;  2Y69 H;  2B0L A;  2K86 A;  3TMO A;  1B4A A;  1BI1 A;  1TT5 B;  1NTC A;  3GTO J;  2ELH A;  3FDY A;  4BJ5 C;  1QVT A;  2X51 A;  3GWZ A;  2ZJ2 A;  1WJF A;  1IV6 A;  2QSH X;  1ZN2 A;  4XLN F;  4YG2 F;  2XRN A;  1Z6R A;  2PJR B;  2BV6 A;  1OFC X;  3HC7 A;  3ZGK A;  1QQI A;  3SDB A;  4EGZ A;  3BR2 A;  1ZTR A;  2EB7 A;  3QWL A;  1HC8 A;  4DYQ A;  1CQT A;  2R5Y A;  5CPR B;  1SD4 A;  2WAQ A;  5LHH A;  4BU2 A;  3H5A A;  2ZXJ A;  4JK1 X;  4YRV A;  1VQL I;  5BS6 A;  2DA7 A;  3BJO A;  4J00 A;  3REO A;  4O3M A;  3OYK A;  2QQ8 A;  2X6W A;  3H35 A;  2FJ1 A;  1H88 C;  3S16 J;  1GV2 A;  5JFR A;  1F4K A;  1QPI A;  1U6G A;  2EQR A;  2WY8 Q;  5IP6 A;  4IF4 A;  2KP6 A;  3DKY A;  3UNG C;  3W6K B;  2H1K A;  4DQ2 A;  1R5H A;  2ZKZ A;  1ETV A;  1VF9 A;  3FMQ A;  2RVC A;  3HKZ N;  1SFE A;  4RGS A;  1TZL A;  4BS9 A;  4I99 C;  3ZPL A;  3KP7 A;  1D5Y A;  3FXU A;  1G59 A;  2MBF A;  1IG7 A;  4C3I J;  1JUP A;  2XAJ A;  3QYB A;  2ZJR F;  4BQO A;  2EZK A;  3K4C A;  5FRN A;  1YG2 A;  4XM3 A;  3HBL A;  4CYD A;  5IYB J;  2L7M P;  3IWZ A;  4PZJ A;  3BTJ A;  3PFI A;  1D0X A;  3F8C A;  1OQY A;  1SD6 A;  2VUM J;  3IAS 2;  5E79 C;  1QU3 A;  3FXM A;  3WGH A;  2BGC A;  4D7M A;  2M34 A;  1XMK A;  2KZV A;  2CFO A;  4FT8 A;  1ETO A;  3SFZ A;  3BT9 A;  1DGR M;  1FP1 D;  2VC1 A;  4NC6 A;  1E3H A;  3MKY B;  3P5J A;  4BE1 A;  1FYM A;  3TBI A;  3MN2 A;  3MWM A;  3J7A Y;  3HRM A;  2DTZ A;  4P5O A;  5TGT A;  4CDG A;  4HLY A;  2LD5 A;  2ZBK A;  1U9O A;  4UUS A;  1UJ8 A;  4V2G A;  4A6E A;  2DA6 A;  4IO9 F;  1BW6 A;  4NC8 A;  2EFP A;  1NK2 P;  2H1L A;  1LFP A;  3A0H C;  1ERD A;  3R0A A;  3BZK A;  2F4O B;  3L9F A;  2DO7 A;  2JUC A;  2FBH A;  2KDZ A;  3R6S A;  1E17 A;  5HLH A;  2IS1 A;  5J8F A;  2PLY A;  1T0F C;  3HZJ A;  1T95 A;  2ESN A;  4AID A;  1Y39 A;  1U5T A;  4DYC A;  3VB2 A;  1OCT C;  4PDK A;  2YX4 A;  2X9D A;  4HF1 A;  2JA6 J;  3W2W A;  2E1N A;  5JLW A;  2CV1 A;  4E7J A;  2D1V A;  1A35 A;  3RPQ A;  1HW1 A;  2DYS H;  1T98 A;  4IKF A;  2XAF A;  3R61 A;  3ABK H;  5AIP A;  3D5L A;  3U9G A;  1YE9 A;  2QF7 A;  1GDT A;  1S7O A;  1DU0 A;  1XSV A;  3QOE A;  5LRR A;  5C4J J;  2V9P A;  4CYC A;  3QU6 A;  3I4N J;  1QBJ A;  3S3M A;  2CV2 A;  3SXY A;  1T6S A;  3RPU D;  2DQR A;  4DJA A;  3RPU A;  1X1A A;  1EA3 A;  1KQ0 A;  2GXB A;  4OWR B;  2H6C A;  2K9M A;  5CQG A;  2EIN H;  1NK3 P;  3M9A A;  1NG6 A;  2E60 A;  2O3F A;  2R4G A;  2FUG 2;  1JHF A;  2OA4 A;  3BJA A;  2KRH A;  3G6E I;  4D1Q A;  4ZDO A;  3VYU B;  4HX8 A;  3MQ0 A;  1W7P B;  1BA5 A;  1ZLJ A;  4DBQ A;  2HOS A;  5DD4 A;  5CJ9 A;  1ZQ3 P;  1HW5 A;  3F9K A;  4RGX A;  5FLM J;  1SAX A;  3HOV J;  2VE8 A;  2AQE A;  2FU4 A;  1UG0 A;  1X1B A;  3CUQ B;  5F0C A;  4B3X A;  5HDN A;  3S3N A;  1REP C;  3CQZ J;  3CCJ I;  2V1U A;  5FRM A;  2ETH A;  1OCR H;  3ISP A;  3L2Q A;  1GVD A;  1DPR A;  3E3V A;  3K4J A;  4KN7 X;  5LGT A;  4XIC A;  2E7X A;  3RDI A;  1FEX A;  4B09 A;  3S17 J;  1G8X A;  2LY1 A;  1YJW I;  2NS7 A;  4FCY A;  1S8N A;  3P9C A;  1HDD C;  4CHU A;  1XSD A;  2CW0 F;  2FQ3 A;  1ZAR A;  3JRG A;  1RKT A;  2Y9Z A;  1XS9 A;  1W0U A;  1W36 D;  2XSJ C;  1R36 A;  2PJP A;  5HS7 A;  1Z1D A;  1B1B A;  1SMY F;  2W82 A;  4IL6 C;  1FNN A;  3NAU A;  3ERE D;  1Y6I A;  2L02 A;  1HSJ A;  1HOM A;  1TLH B;  3T5X A;  4A3G J;  2VL8 A;  1YLF A;  5KAF C;  4XK4 A;  3F22 A;  4HNU A;  3DEE A;  2KLO A;  3M07 A;  2ZME B;  3O8H A;  5H6R A;  3BG6 A;  2VQH A;  5ILV A;  2IS4 A;  1RRJ A;  2RGV A;  5EEH A;  5FLX Z;  3BRO A;  1I1G A;  3IP4 B;  3SHF A;  4ABZ A;  3W2A A;  1X1C A;  1K4S A;  2CW8 A;  1VQ5 I;  4EJU A;  1YRN B;  2YU9 J;  4DIQ A;  4EM0 B;  3PO3 J;  4HOB A;  4JQF A;  2MH9 A;  2P5V A;  3AL0 C;  1ORK A;  2J5O A;  2IJL A;  2TCT A;  1LDD A;  3FKI J;  4CZZ A;  4ENN A;  2K3F A;  2W25 A;  4BE2 A;  4BYY A;  4A3K J;  4MFD A;  1D1A A;  4KNY A;  1WQ2 A;  4ZZL A;  3E5U A;  2L01 A;  4HEA 2;  2DT5 A;  3WTZ A;  3ZQ7 A;  3DXJ F;  1T33 A;  1WJB A;  2FE3 A;  4LK0 F;  1UHW A;  5FFZ A;  1R22 A;  2R5Y B;  3GXO A;  4RGU A;  3VWB A;  2CUZ A;  4G9Y A;  3PNY A;  5EJC A;  4D0P A;  2DJI A;  5E3O A;  5M5W J;  2LF8 A;  1IN8 A;  1P92 A;  2NS0 A;  2R7V A;  3BY6 A;  3HG9 A;  4BDZ A;  3BG9 A;  5E1W A;  3A0B C;  1BR1 A;  1BR4 A;  2KZG A;  4XLP F;  4MTD A;  3L2V A;  2EJR A;  3B73 A;  3F72 A;  2AO9 A;  2CQK A;  1OCZ H;  1TQM A;  3PNV A;  4MLO A;  2VE9 A;  1MBH A;  2UUZ A;  1TT0 A;  3QP6 A;  1AKH B;  3LL7 A;  3I59 A;  2GZW A; 
#chains in the Genus database with same CATH homology
 1QRY A;  5FKN A;  2R0Q C;  2TRT A;  1ZR2 A;  5M3F J;  3ZQH A;  4JP0 A;  1ITY A;  1IRZ A;  3LSG A;  4HNV A;  3GTQ J;  1IDY A;  1JTX A;  5JLX A;  1MSF C;  3BG5 A;  3E7L A;  1ZK8 A;  2OF7 A;  2XPW A;  2LFB A;  1E3O C;  1TWC J;  2LTP A;  5K7H A;  1AHD P;  5F04 A;  3W6V A;  1B72 A;  3B6A A;  5GPC A;  5K7F A;  5DTD A;  2R7Z J;  3GTG J;  5FKK A;  4A3C J;  1A5J A;  1JKO C;  2LR8 A;  1PUF A;  3PO2 J;  1ETW A;  2NOG A;  4L5E A;  1MBG A;  4IHX A;  2N8G A;  5J1U A;  4XID A;  3HOX J;  3OOU A;  1IUF A;  3TW7 A;  5IYC J;  3PM1 A;  3JRD A;  1ENH A;  1TC3 C;  3S15 J;  1RET A;  3K7A J;  5EZG A;  2ELK A;  3IH4 A;  2RAE A;  2O7O A;  2DJN A;  5EZH A;  1UMQ A;  3RZO J;  3S2H J;  3LOC A;  4A69 C;  3HM5 A;  2DMT A;  2ECB A;  2JWT A;  2XPU A;  2XGD A;  4A3D J;  3WHB A;  4MO7 A;  4Y52 J;  1UHS A;  4EEF G;  2LP0 A;  2ME6 A;  5E3N A;  1JT6 A;  1RPW A;  4B4C A;  4AYB N;  3FK6 A;  3JRI A;  3BR5 A;  5EG0 B;  3TP0 A;  2K40 A;  1WI3 A;  4D7N A;  3OSF A;  1HCR A;  1BW5 A;  2QCO A;  4JYK A;  3TW6 A;  5M3M J;  3A01 A;  2XB5 A;  4DZP A;  3FK7 A;  3MVP A;  2XB0 X;  2LK2 A;  4W1U A;  1TWF J;  3ZQF A;  4C3H J;  1LFB A;  4M3G A;  2GBY A;  2ZB9 A;  2E2H J;  1R9T J;  1U8B A;  2CJJ A;  2L7Z A;  2XRL A;  1AU7 A;  4IEJ A;  3HOZ J;  3FIS A;  1AKH A;  2JA7 J;  1JJ6 C;  3SFI A;  2K9S A;  4GFB A;  3HOY J;  3K2A A;  1QVU A;  2Y2Z A;  1LFU P;  2OPT A;  3ZQC A;  1MBK A;  3WHC A;  2L9R A;  3QQA A;  9ANT A;  2AHQ A;  4JX6 A;  4RBO A;  1EF4 A;  4QIW N;  1IJW C;  5F0F A;  1FTT A;  4LOC A;  4BXX J;  4M3D A;  4AUX A;  4I6Z A;  5IPA A;  2E2I J;  4A93 J;  2H8R A;  2I10 A;  3BR6 A;  1DU6 A;  2JMW A;  3OIO A;  2B63 J;  3JR9 A;  3B6C A;  1FTZ A;  5C44 J;  1I3Q J;  5FJ8 J;  1I6H J;  1JT0 A;  3GTP J;  1K83 J;  3C2B A;  3HEF A;  2XGC A;  4NDL A;  1TWG J;  4W97 A;  1VI0 A;  5DS9 A;  4BY1 J;  2VI6 A;  5EGO B;  2JA5 J;  2E1O A;  2X48 A;  2Y30 A;  3ZOB A;  3H0G J;  1FJL A;  2W48 A;  4J19 A;  3S1N J;  3ZQL A;  3F0C A;  4B3A A;  1U9N A;  2EBI A;  2LKX A;  2WAQ N;  3Q0U A;  4A3J J;  5J3L A;  4IHW A;  1HF0 A;  3CCY A;  5GP9 A;  2Y9Y A;  2EZL A;  5FKO A;  5EF6 A;  2M9H A;  1IC8 A;  3OSG A;  4FE4 A;  1JUS A;  2NVT J;  3S1M J;  1B8I B;  2JN6 A;  1ZR4 A;  2JJ7 A;  2IBD A;  2R5Z B;  3VPR A;  3BQZ A;  2DMN A;  3TED A;  5EG0 A;  2CUE A;  2VKE A;  2YS9 A;  1X2N A;  3TP3 A;  3QPS A;  4C3J J;  3H3V K;  1W0T A;  2ID3 A;  2K9N A;  3BG3 A;  3HGY A;  2DMU A;  1MH4 A;  4B1R A;  2HQ5 A;  1WGX A;  3G1L A;  3JRH A;  4UUS B;  1JUM A;  1T56 A;  1X58 A;  3SJM A;  1A6I A;  3BTI A;  5FKM A;  5HOD A;  4M3B A;  1YRN A;  5F08 A;  1NTC A;  2EZI A;  4I76 A;  5F1J A;  3GTO J;  2O9L A;  2K9Q A;  1QVT A;  3IV5 A;  1IV6 A;  3RKQ A;  4FIS A;  2NVX J;  1OFC X;  3BR2 A;  1ZTR A;  3A02 A;  4XRS G;  4DYQ A;  1CQT A;  2R5Y A;  1Z77 A;  3GBG A;  1H89 C;  2DA7 A;  1LE8 B;  4DYR A;  2EZH A;  5M5X J;  1SFO J;  2Y31 A;  2MW8 A;  1HLV A;  2O8K A;  5IYD J;  1WH7 A;  2CRG A;  1I50 J;  2FJ1 A;  1H88 C;  2DA1 A;  3S16 J;  1GV2 A;  5EGO A;  4CYC B;  1OCP A;  1QPI A;  2EQR A;  4IHY A;  5IP6 A;  2H1K A;  3M4O J;  2XSD C;  2M2E A;  1MBE A;  1ETV A;  4AC0 A;  2NS8 A;  3CDL A;  3LNQ A;  4X6A J;  1VF9 A;  3HKZ N;  1S7E A;  1ETX A;  5J1R A;  3IH2 A;  1D5Y A;  5EYR A;  4Y7N J;  2R93 J;  3HB9 A;  4C3I J;  3CMY A;  1IG7 A;  1JUP A;  3UKG A;  2EZK A;  5FKL A;  3ZQG A;  2HOA A;  3HBL A;  4BBR J;  5IYB J;  3SDG A;  2L7M P;  5K7Z A;  2VPR A;  3BTJ A;  1PUF B;  2VUM J;  1SAN A;  3IH3 A;  5E3L A;  1K61 A;  1ETY A;  4D7M A;  1Q1V A;  4C2M J;  4JX4 A;  2M34 A;  2ME0 A;  1ETO A;  3BT9 A;  5FLV A;  4MFE A;  3MN2 A;  1ZGW A;  1OJL A;  3RZD J;  2DTZ A;  2LD5 A;  1U9O A;  4UUS A;  4V2G A;  2VKV A;  3Q0W A;  1WH5 A;  2DA6 A;  5J1Y A;  4A3I J;  1BW6 A;  1O4X A;  1APL C;  1NK2 P;  2DA4 A;  4S0H B;  3GTM J;  2G0E A;  2HI3 A;  1JKR C;  4MIM A;  5IOY A;  2KDZ A;  3BTL A;  1ZKG A;  2DA3 A;  1ETK A;  4DZJ A;  1GUU A;  2P81 A;  4DYC A;  2L0K A;  1OCT C;  3QPL A;  2X9D A;  4D5C A;  4M6V A;  3HGG A;  5JLW A;  2JA6 J;  3JRF A;  2CU7 A;  2E2J J;  1HDP A;  3NAR A;  4DW6 A;  1MSE C;  4M3E A;  1BL0 A;  3BR1 A;  4G12 A;  5IP7 J;  1RES A;  2QF7 A;  1GDT A;  3O8G A;  1DU0 A;  1JTY A;  2YUS A;  3GTK J;  1XG1 A;  1P7J A;  5C4J J;  1TWA J;  4RDU A;  2EH3 A;  4CYC A;  3Q0V A;  5BNG A;  3I4N J;  2ECC A;  3FIW A;  1UG2 A;  3S1Q J;  1RR7 A;  2IEK A;  4XRS A;  2NVQ J;  4A3M J;  1NK3 P;  1MH3 A;  3L1P A;  3S2D J;  2COB A;  3Q3S A;  3BR3 A;  2NVY J;  1BA5 A;  2DA2 A;  1Y1W J;  2HOS A;  1F43 A;  2MG4 A;  3BQY A;  2IAI A;  1ZQ3 P;  5FLM J;  2GM4 A;  1G2H A;  3M3Y J;  3HOV J;  2L7F P;  1U78 A;  1WPK A;  2X6O A;  5F0C A;  4FTH A;  3LSR A;  3CQZ J;  1P7I A;  3S1R J;  1GVD A;  4JX5 A;  1XC5 A;  3RQI A;  1VND A;  1X2M A;  4XIC A;  3ZQI A;  1Z0X A;  1FEX A;  3S17 J;  2HOT A;  2NS7 A;  1JJ8 C;  4FCY A;  2HDD A;  1HDD C;  3GTL J;  2KT0 A;  3D1N I;  3JRG A;  1RKT A;  2Y9Z A;  1XS9 A;  1TWH J;  1W0U A;  3G1M A;  5EEA A;  3DEW A;  2FQ4 A;  1BJZ A;  2JA8 J;  3JRC A;  3HDD A;  2XPV A;  2DMP A;  2CUF A;  2DMQ A;  3GTJ J;  4BKX A;  3NAU A;  4QSH A;  3S14 J;  4FE7 A;  5E3M A;  1HOM A;  2PMZ N;  4A3G J;  1F36 A;  2MGQ A;  1H8A C;  2HXO A;  4UUT A;  1B72 B;  3BR0 A;  4XK4 A;  1B8I A;  1ETQ A;  1WCM J;  3O8H A;  2E19 A;  2FX0 A;  2R5Z A;  2CQX A;  4V2F A;  3MKL A;  3G1O A;  2WV1 A;  2ID6 A;  3JRA A;  5GPA A;  4ABZ A;  2MSY A;  2GLO A;  1YRN B;  2YU9 J;  1MNM C;  3PO3 J;  1GV5 A;  3BTC A;  3JRB A;  1ORK A;  1GT0 C;  4A3E J;  2DA5 A;  2Y0S N;  2TCT A;  1IDZ A;  2LVS A;  2LLK A;  3FKI J;  1VFC A;  2CQQ A;  2DN0 A;  2M8G X;  5C3E J;  4A3K J;  1IGN A;  4MFD A;  4XRM A;  1FIA A;  2R92 J;  3LSJ A;  4X1E A;  1JGG A;  1T33 A;  3DCF A;  4A3L J;  4QTR A;  2D5V A;  2R5Y B;  4BY7 J;  3JRE A;  2WB1 N;  2XGE A;  1JKQ C;  4M3F A;  3LSP A;  5E3O A;  5M5W J;  1Y1V J;  5F0H A;  3I4M J;  2HXI A;  1FIP A;  2JK3 A;  3BG9 A;  2LY9 A;  5M5Y J;  5F27 A;  4IHV A;  4D5F A;  3HOW J;  5EDN A;  1MBJ A;  3A01 B;  3A03 A;  1POG A;  4A3B J;  2AO9 A;  1LE8 A;  2M0C A;  1JKP C;  4MLO A;  3HOU J;  1MBH A;  1RKW A;  5IP9 J;  2HYJ A;  4A3F J;  4BBS J;  1MBF A;  2FD5 A;  1AKH B;  5IOZ A;  5C4X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...