2MD0A

Solution structure of shk-like immunomodulatory peptide from ancylostoma caninum (hookworm)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
NDIRTAADMEHCADEKNFDCRRSLRNGDCDNDDKLLEMGYYCPVTCGFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AcK1
publication title Kv1.3 channel-blocking immunomodulatory peptides from parasitic worms: implications for autoimmune diseases.
pubmed doi rcsb
source organism Ancylostoma caninum
molecule tags Immune system
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01549 ShK ShK domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1940 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2md0A00
2MD0A
chains in the Genus database with same CATH superfamily
2V9PA 3F0CA 4LLLA 4UUSB 3V7SA 2OF7A 4KIGA 2VBZA 1T38A 3LWFA 3CCJI 2AQFA 3G4SI 4EJWA 5IOZA 1IUYA 2JUGA 3DEUA 3DWLE 3NWSA 4WCGA 4ZTJA 2XF7A 2F5VA 1P7JA 1DPRA 3GZ5A 2P4WA 4MTDA 5L3BA 4D9JA 4HF0A 5LFAA 3T5XA 4PK4A 1B59A 3GLXA 3PUBA 1POGA 3OYLA 4A3FJ 3QPHA 4BDZA 5FLXK 5EEAA 3F23A 3R60A 5DDGA 3DU6A 2GOMA 2CRGA 2HOAA 2L4MA 2XASA 2NVUB 4RGSA 4DBRA 3S2WA 1X3ZB 2BYVE 4RLQA 2L7ZA 4PSWA 1DGRM 2VODA 3AG1H 3S1NJ 2XAGA 3IH2A 4HX8A 2XAHA 3CUQC 4NNJA 1O57A 3RKWA 3K1MA 1HF0A 1JGGA 2FXAA 4CCKA 1U5TB 2OA4A 2PQ8A 2CQQA 2ZKZA 1U9OA 1MGTA 4Q4ZF 3IKVA 4DZJA 4AIHA 2V6EA 1OLTA 2VL8A 2HZDA 1SVMA 4NUBA 1JUMA 5ICEA 1MH3A 3MD2A 3SDGA 1P7IA 3KP2A 4N0BA 1ZGWA 5GPCA 4OAYA 5F0FA 2E1MC 3C18A 5DYMA 1W7PA 4CZCA 3LSKA 3OOUA 3CDLA 3BR0A 5B3SH 1MNMC 3HJEA 3OOPA 4UB8C 1G8XA 2ZXHA 2ELKA 5FLVA 4I01A 2WB1A 5M5XJ 4LLNA 1M1EB 3OYJA 3M9AA 4E7JA 4GGGA 4ENKA 4HLXA 4IRGA 1HKQA 4M6VA 4WXCA 2A6HF 1Z67A 5KVRA 2BEOA 3QU3A 5K5RA 3RQ4A 1WJDA 2LG4A 3OS2A 3NARA 2VJ5A 2GQQA 3KE2A 3TP3A 3J7ZI 5C44J 3FKJA 4RAGA 2JZYA 2ZMEA 2ZXWH 3ASOH 4RGXA 1GHCA 4D1QA 1S5LC 2PMUA 4CCMA 2JSCA 3VDXA 3P5JA 1G6NA 5HLHA 2GIZA 4G7ZF 3BROA 5JFRA 2CFXA 2X1EA 1CQTA 2KZVA 1UHWA 2HR3A 1WKMA 2COBA 1D3YA 1ZLJA 2EZIA 1X1BA 2NNNA 2JRMA 3NWTA 2F48A 5IY5H 5FD6A 2PJPA 1YW7A 4CCJA 3JSPA 1VQMI 4QWQA 3EUAA 3DU5A 1N75A 2XDVA 1EKEA 1ZREA 1NG7A 3W3CA 1XX5A 3R61A 4HF1A 3CJNA 3BTIA 3WGIA 2CQ7A 3OSGA 3CCVI 4FTHA 4GO1A 3OYFA 2WBMA 3TO7A 2VBYA 1FC3A 5E3LA 2IXSA 4OAZA 2OZUA 3FMQA 1MJ9A 1QPIA 4IJAA 3C2GA 3PQKA 4MGRA 3TMOA 1VF9A 2FA5A 1XSDA 4WF2A 2E2IJ 2NVXJ 1D1AA 1FTZA 3P7NA 3SZTA 3I71A 3D5RC 3F8CA 4P9UA 3PJRA 1VQNI 4FT8A 2XF6A 2LSOA 1TT5B 3ZN0A 1L0OC 2GWRA 3QYFA 4PJ0C 1KQ9A 1O7LA 2QENA 4DYRA 3P9IA 2DODA 2JVGA 1ETQA 2LRDA 2VXDA 1E3OC 5IYDJ 2R7OA 3IRQA 2P5VA 1XDSA 4M6XA 2XRLA 4L5EA 2OQGA 4C3JJ 2XC7A 1Q1VA 2DMNA 1IDYA 3A4CA 3BJ6A 1B72A 3JW4A 1ZGJA 4A3JJ 4PJNA 1OQYA 4XOTA 3TO9A 5K1YA 3L2WA 3CF5F 3SDBA 3KLOA 1ZHFA 2DMPA 2K7LA 2UXNA 3IHUA 1QA6A 1AA7A 3PIOF 4M74A 3R0AA 4B4CA 3OL3A 3K4MA 2FNAA 2JPBA 2DDAA 1J5YA 2JA8J 1R00A 1W7PB 3K7AJ 3K4CA 4YFXF 1G3SA 3JRIA 1K4TA 2K9MA 4EM0B 1XCBA 2IA1A 2O5RA 3I59B 4XKCA 5CVRA 1KU3A 4IOCF 2JPCA 2O8XA 5JHFA 3JRHA 4A3BJ 1BI2A 2R7UA 1JKPC 4L0ZB 2EA2A 2XGXA 2MBFA 5HLIA 4NC6A 2D1VA 3I4NJ 1X1AA 3CUOA 4RAZA 2PG4A 5BS6A 1UFMA 2EK5A 2MG4A 4LB5A 3BTJA 1HW5A 3E5QA 1Y0NA 1Z91A 2PLYA 4O5VA 1Z3YA 4C30A 1K4SA 3GTKJ 5C4JJ 4BQAA 1V54H 3HSRA 2ZMEB 3KEOA 1FYLA 3TW7A 1R49A 3IP4B 2BW3B 2ZO4A 1RI7A 1HOMA 3OS0A 1RNLA 1KQ8A 4KDPA 3RIRA 3CCRI 3HOZJ 2HGCA 1IO2A 2XB0X 1RR8C 1IXSB 2OBPA 4FCYA 3ISPA 3VYSB 4JBAA 2WADA 3TOAA 2CFOA 2Q0OA 5CVVA 2DT7B 4V19K 3MAJA 1D5YA 4HZFA 2LYCA 5J1RA 4V2GA 1B9NA 1IV8A 4BUPA 2VI6A 1SD6A 3LL7A 1U9NA 1O3TA 3LQRA 3HEFA 2HDDA 2HYFA 3RPUA 1TNSA 2R5ZB 2W25A 1PJRA 1TQPA 3CO7C 3AG4H 4ZDLA 4DW6A 1QPMA 2M8EA 2KJCA 1U0JA 2XSDC 4GCVA 1S72I 1GXPA 2A68F 3FXOA 1IDZA 1T8IA 2NS7A 1X1CA 2EWNA 3OYIA 3DTKA 1OR7A 3WTTC 2W57A 2PFBA 2BVLA 2IS1A 1LKXA 2ID3A 2M9HA 3F8FA 1UCRA 1SFUA 1J9IA 1FYMA 4KMFA 3GEZA 3PUFA 1BOAA 1B72B 2L9NA 2XRNA 2CV1A 3OIOA 4MHGA 5L3FA 3K1PA 2ZNYA 3ABKH 2BHZA 3I4MJ 3MKYB 5D6EA 4AU7A 3RYPA 3TP0A 3E6MA 4HV5A 3ZOBA 4XORA 4MQ9F 3HTUA 2DBBA 2IGMA 2IBDA 3KX2A 5J1UA 3HOSA 1MJBA 2I8DA 1WJ5A 1IV6A 5E8IA 1DQUA 1E3PA 4U7BA 5EF6A 1OCOH 5A2QZ 4A3MJ 3FBNB 5J6XA 1IN5A 4M9ZA 4WX9A 2ZSHB 5TISC 1T98A 2FNPA 1ZRCA 2JA5J 2FSWA 4UNOA 2E60A 2FEZA 3GW2A 1TP4A 2L9VA 3W2WA 1BR2A 1LVAA 4E7HA 1NH3A 5M5YJ 1YRNB 4EJTA 3BG3A 5HOOA 1YITI 4L5IA 1G59A 2R7VA 1YS7A 3IAM2 3R0JA 1MBFA 5LEJA 1JHHA 3I58A 2V79A 3EUHC 4A69C 5J8FA 1I1SA 1D8JA 3W2AA 3KFWX 3SZGA 2LDUA 2DTZA 3ZXSA 4IHVA 2R4GA 1MMAA 4LG3A 5FKOA 3JRAA 4BHPA 1WJFA 3ZQHA 3HKZN 3OYBA 2Q8KA 2LR8A 1A6IA 2F4OB 1V4RA 3BQZA 5AIPA 4C3IJ 4BYYA 1NTCA 2FBHA 4EV0A 1ZG5A 1TWHJ 1MSFC 2D2WA 3CDHA 2OQRA 1JUSA 3FISA 3ABLH 1KYZA 5FD5A 4ANJA 3L2UA 1LFUP 5CVIA 3I5UA 4XKBA 2CQKA 5LHGA 2ZC2A 4LOCA 5BNGA 3A1YA 2M0MA 2LD5A 1RUNA 3S16J 4B3AA 1YS6A 4JQFA 4LG0B 2BE5F 3M4OJ 3WTXC 5CKTA 4M3BA 4R79A 2OPTA 5J4VA 1WJBA 3EETA 3FZVA 4HQMA 1YJWI 5H6RA 3WG9A 1YW8A 3HOVJ 5B1BH 1FMVA 3VSKA 2XIGA 2DFIA 4JX6A 1B9MA 4TV7A 2GAUA 2P0WA 5KNLA 1FSHA 3IV5A 2IGKA 4KT5C 2O3FA 1IG7A 1P92A 2XAJA 4B3XA 5HDNA 1RRJA 4NQWA 4EMSA 3IH3A 1ZG1A 4IHXA 1VTNC 4YG2F 2XPWA 3BPXA 5DD4A 2LKSA 4BJ6C 4A93J 3H9GA 1ZKGA 3K2AA 4IF4A 4A6DA 1WVRA 1R5HA 4F91B 5LLQA 3WTVC 3FWEA 3HHHA 3JAMK 5K7HA 2EQRA 3CMYA 2E1NA 1MKMA 2FE3A 3PL8A 1BJZA 1TTYA 2R3SA 2STTA 2CG4A 3CCYA 5FRMA 2H27A 1ZK8A 3JSOA 2G9WA 4OMZA 4Y3OA 4CSWA 1ZG3A 4F92B 3SXYA 1T0FC 1HCRA 4L0YB 3MWMA 5HLGA 1PUFA 4CA0A 2PMZA 4BY1J 3J80K 2O0YA 3OIQA 4JOMA 1Y56A 2E7XA 1FWZA 5FKKA 4BS9A 2ADUA 1MDMA 5LHHA 4HPQA 4U87A 5DCFA 1KU2A 1UHMA 1JT6A 5D5UB 4P96A 3F8NA 1IXCA 3LOCA 4A3GJ 5KK1A 2HDWA 2KRHA 1U78A 2KRFA 1WQ2A 2P6SA 2XGCA 1FP2A 4IL6C 1WI9A 2G7UA 1VQPI 4EM1A 3UNGC 1FIPA 2PJRB 4A3IJ 2EB7A 1NK2P 1P4WA 2R92J 1E17A 2HVRA 2M7AA 3LA7A 1J59A 1VI0A 4BBRJ 4DJAA 3CC2I 4LK1F 2VQCA 4YIIA 2OCCH 1S7OA 3BR2A 3DKWA 1F4KA 4C3HJ 2DA1A 4P55A 3V7RA 2ESNA 3CUQB 5F1RA 2D5VA 3HSFA 3OYDA 4ZH4F 1WI3A 2Z3YA 3QRFF 2E71A 4AVPA 1QZYA 3BZKA 2V1DA 3ZMTA 2E35A 4DIQA 2K9QA 4XKWA 1U8RA 1OCZH 4Q47A 4UXNA 3E6DA 3K10A 2HQ5A 3WHBA 2F5CA 2R7WA 2VE8A 2JA7J 3ZRGA 3CJTB 2VT3A 4G7OF 2OAZA 3N97A 1O3SA 2H8WA 4CCOA 1K61A 1IN4A 4GXOA 1WJAA 2O9LA 1FPQA 2CGPA 2L7KA 2MABA 3FK6A 2E1MB 1HW2A 5JLXA 1BC7C 3CZ6A 3LA2A 2DJNA 3A03A 1F5TA 2Z99A 4LGWA 3WTWC 2A5WA 2VBWA 2L7FP 2DLLA 3GFMA 1LFBA 5F04A 1YIOA 2XGEA 3W6JB 1WJCA 5M3MJ 2GXGA 3F8MA 1KONA 4IZZA 1LEBA 2X85A 5HS9A 2R7TA 5J40A 3G73A 3ZR8X 1FBUA 2HOTA 4LK0F 5ILVA 2CH0A 4OWRB 1JHFA 1SD4A 1H0MA 3ECOA 2OU2A 2CS3A 2HI3A 4HOBA 2N8GA 4AIDA 2LLKA 1A31A 3OIPA 1FYKA 2H6BA 1J7KA 3LSMA 1YX3A 2BY3A 1XMKA 5DEQA 4ZYEA 3IAS2 1CGPA 5D8LB 2NVYJ 3RDIA 1U5TA 3F72A 2XKPA 2JJ7A 3QOEA 4AYBN 5DCMB 3ECHA 3B73A 1QVUA 3I54A 1XDUA 5DS9A 2M7BA 4HYEA 2E7WA 2K40A 3W6KB 4S04A 4Y52J 1R23A 2M3AA 2HXIA 3G71I 1ETVA 2OTLI 4CHUA 3OL4A 1FBSA 1OYIA 3JAMZ 4HG2A 5CVUA 2XPVA 3TOBA 1PUFB 4RB3C 4XR6A 4KJZA 5IYBJ 1UHSA 1YHQI 4FASD 5GADJ 1EA3A 2MGQA 2CV0A 4I98B 4KYWA 3IKTA 2EFWA 4G94A 2HWVA 2DQRA 1VQLI 2DPUA 3WTZA 1IN8A 1QVTA 3JRBA 2A6EF 1XC5A 4I02A 3RPUD 1X3WB 5F6FA 5ICCA 3M8JA 2UZKA 4IRHA 1Z1DA 3CLQA 3QPSA 2IJLA 3SQNA 4XQFA 1BR4A 3FXLA 2DOFA 2XF5A 1N25A 3PSFA 1WHUA 1MMSA 3OYGA 1TWAJ 1W0UA 3K0LA 3GMEA 4W1UA 4DBQA 3B6CA 4PUSA 4BQNA 2IGOA 3FMSA 4MIMA 1XPXA 2FOKA 4DZPA 1IZ1A 3S1MJ 1IAWA 3MFKA 3CCSI 3NRVA 4KITB 2HEOA 3DPLC 4N9IA 5FB2A 3HRTA 4BXFA 1F36A 1FY7A 3GTJJ 1BC8C 4XONA 3LSJA 1HDDC 4A3KJ 4UUVA 3BLYA 2V9VA 4EGZA 2UXXA 4U0WA 1HSJA 5EEGA 3BJOA 3V8JA 4X0GA 1APLC 4G6DA 1YE9A 3B6AA 2LTPA 3WE3A 4LFUA 3P9CA 4G12A 5HODA 3IH4A 3OMYA 4HDVA 1UZCA 3OYNA 1VQKI 2Z1DA 2KRCA 4XLPF 3RZDJ 2X1CA 2Z9OA 1TW3A 3GYHX 2QBYA 3HXLA 1IN6A 2R7QA 1X3UA 3OYHA 2FBIA 3FM3A 1RIOH 2L54A 1OCRH 4A5NA 1R4NB 1BR1A 4BL0B 2ZFWA 2VOOA 3FHZA 3VWBA 3GTOJ 3H92A 4PCQA 4CH7A 4L5JA 4G7HF 3OS1A 3K4JA 2K5CA 2MLKA 3CF2A 3GF2A 1Y1VJ 1TW2A 2EFOA 2YR2A 2H6CA 4M9SA 4QPQA 5K5OA 3S2DJ 4B09A 3O6BB 3MEXA 2D1HA 1DP7P 1LVKA 2KIQA 3K4LA 4L9NA 4G6TB 2EFQA 2P8TA 1X2MA 4JX5A 5E20A 4HNUA 2M1BA 2MFZA 2E2HJ 1BIBA 3H0GJ 3WU0A 5LRRA 1MBGA 2HYJA 1HKTA 1WWXA 4MFDA 1TQMA 3CCUI 5CLSA 9ANTA 2ESHA 3PNYA 2QKMB 4YEJA 3HTSB 2EJRA 1Z3XA 2GA1A 4LMYA 4RA2A 4BH9A 1R36A 3S93A 2DOAA 2HXOA 4D5FA 2A5YB 3BZCA 2CW0F 2E1OA 3IRRA 3K69A 2K9LA 1O3QA 4BJ5C 3MN2A 4IQJA 1XMAA 2GIVA 3N4MA 4XRSA 2HOSA 3I59A 1Z0XA 3ML6A 3MKZA 6PAXA 5EGOA 4C9YA 3CCMI 4KIFA 1GV5A 3BG6A 5FKMA 2DPDA 4P5OA 1SVLA 1WPKA 2DQLA 3FXMA 2VUMJ 2VQHA 4XNFA 5F27A 3QU6A 5LGNA 4EJVA 2WTEA 3L00A 3A2KA 4I2OA 2QQBA 4BE1A 1IF1A 4QSHA 1YOVB 1AKHA 5H20A 2YU3A 1LDDA 5L3DA 3BT9A 1H88C 3K4NA 3RKQA 4FX0A 1AWCA 1VZ0A 2BW3A 1V5EA 5J3LA 3UKGA 4BU2A 5J8CA 3LFKA 3R6SA 4XK4A 3RCOA 5IT9Z 2EA4A 3RJPA 3L2CA 4EVIA 1SAUA 5KCMA 2QF7A 1FT9A 1XGMA 2WC2A 4PGGA 2HQRA 1P4AA 4GFBA 2XAFA 2KT0A 5DTDA 3E0JB 1G3YA 2BGCA 1QZEA 2VASA 3V4GA 4HDUA 1IUFA 2WV1A 4WWCA 4ON0A 4RB0A 4UHTA 1VQ5I 2HYGD 3FK7A 1K79A 2YX7A 2IPQX 3CJQB 4U0YA 1DU6A 2CW7A 2YS9A 1T0FA 2O7OA 2QBYB 1OCPA 1TZLA 2DMUA 1P6RA 2Y31A 4LLGF 4ZJZA 1BN5A 3I55I 2M0CA 3ZMUA 2R5ZA 3GTPJ 3OR1C 4R8HA 1TLHB 2HQAA 2GXBA 4E6KG 1O4XA 4UV9A 1RUOA 1LFPA 2NS0A 2MA3A 2WAQA 4HBLA 3I3LA 1ZRFA 1UJ8A 2JA2A 4BJTA 1YFHA 3HOTA 1I5ZA 2NYXA 4GYGA 3ASNH 2RDPA 1NK3P 3TDUC 1STZA 3M1EA 5H6QA 1SEUA 3DV8A 3LSTA 4LD5A 2GOXB 2JTVA 4S05A 3DBHB 2CSOA 3TBIA 2NS8A 4J01A 2P5KA 3VFZA 3SEZA 1DPUA 2VC0A 1R1UA 1W0TA 1FLIA 3G1OA 1YQAA 4KNYA 2ZJPF 2QM3A 3DXJF 4P9FA 1EH6A 2K3PA 3REOA 1JJ8C 1LDJA 2L4AA 1LUJB 1G4DA 1YIJI 3SYTA 5A2QK 1JKQC 3LMMA 4ENMA 2LOOA 2FX0A 1YYVA 1OYYA 5L3CA 4M72A 3DCFA 4BBSJ 1Q1HA 2CYYA 3K9TA 5E79C 1YJ9I 4DOZA 1S6LA 2C6YA 2VKVA 2Y0SA 3ZMZA 1FOWA 2P7VB 4F3QA 5EGOB 2MD5A 1XMXA 1MD0A 3TL4X 5IOYA 2HNHA 5F0CA 3ULQB 5HLTA 2Z33A 3DPUA 1OYWA 1JGSA 1RETA 3E97A 5FO5A 3K4KA 2IS6A 3KEQA 3WE2A 3BJAA 5TJJA 3WU2C 2IGNA 3CP8A 4BACA 2BXYA 1UG2A 1K7AA 3CLOA 3AFHA 4QPOA 1YRNA 1AKHB 1MBHA 3BR6A 2VXZA 4FQGA 4MNUA 2K85A 1QHGA 4OU0A 5CPRB 1EJ9A 1YO5C 5HNFA 5B5EC 3HGYA 1BA5A 5F1JA 1ITYA 1FOXA 3DKYA 3S8PA 4UVAA 3GFLA 1ZN2A 5LEKA 3BG5A 2WAEA 2HFHA 3EUKL 4IRIA 2EILH 5D4SA 1TL8A 2YUSA 2DW4A 1S3JA 4E7LA 2RNJA 1DDNA 1FP1D 4J19A 4RM3A 3JRDA 3OSFA 2VIXA 5IP7J 4I6ZA 1ZLKA 2XB5A 4D7MA 5F0HA 2R0QC 3S17J 2FF4A 3KZZA 2ELHA 4A12A 3OV8A 2XUBA 4A3EJ 3AG2H 4LG0A 1Z21A 2NRAC 1R7JA 3OYCA 1SANA 1WFXA 4B8XA 2HPMA 2EIKH 1KGSA 1G3WA 1O7FA 2OC6A 3CDIA 2FBKA 2Y9YA 3GWZA 3M8FA 2JK3A 3IWFA 5GTHC 4BNCA 2VE9A 5C3EJ 5JVGF 2BV6A 3M1CA 1ZGAA 1NHAA 1Z7UA 2LK2A 4A0ZA 3X2QH 2LBFB 3U1KA 4YFKF 3F6VA 2P7CB 3CO6C 3DEWA 4D7NA 1FNNA 3BR1A 4PDKA 1MH4A 4KN7X 1T39A 1TC3C 4UY8I 1ZELA 1L3LA 3BCBA 3A01A 2ZJQF 1A35A 1VQOI 1LJ9A 2FMLA 2VPRA 1I50J 2HTSA 3Q0WA 5BMZA 1TWGJ 3HYIA 2DT5A 1O3RA 5E8GA 1S8NA 2O61A 1MBEA 4RGRA 4ZDOA 1B4AA 1SD7A 3V8KA 4V2FA 4EEFG 2R93J 2XGDA 3MMYB 4OOIA 3BG9A 2X6XA 2OUMA 3I53A 4PZJA 3IC7A 3EQLF 5TRDA 2DFHA 2VJ4A 2J5PA 5ERIA 4G8XA 1HBXG 1ZRDA 1LNWA 4CYCB 2FRHA 4B1RA 1SD5A 3EYIA 3L2VA 1JT0A 3LNQA 3TDZC 3J81Z 3U2RA 5K7ZA 2PJRA 2UV1A 3ZQGA 2QYOA 4JX4A 2V1NA 2DJIA 4MTEA 3ZGKA 1RKWA 1ZTRA 2AHQA 2NOGA 4Y15A 5D5WB 3FF5A 1R22A 2IS4A 2R7RA 2A69F 3D5LA 2COMA 1JJ6C 4OINF 3H1CA 3ESWB 3SHFA 1FSEA 1WH5A 2CJJA 4F7ZA 1P9QC 3CUQA 4UVCA 5J47A 4ETSA 2Q1ZB 3LFUA 4EJUA 4BQOA 2CUJA 2EV6A 4WXDA 3V8LA 3A02A 5LGUA 3I56I 3IUOA 3OWTA 5JI6A 4MO7A 1VFCA 2OZ6A 1N77A 3PFIA 4CXFA 3AAFA 4Y33A 1Y0UA 4GRIA 3HIFA 4DYCA 4M3DA 2IT0A 2V9KA 3BTCA 4MFEA 4E7KA 2DN0A 4ENNA 2DMQA 1W7PD 3W2VA 1K78A 4EATA 4U7DA 1Z7LA 2FU4A 4GYIA 2H1KA 2FQ3A 3HGGA 2MD0A 4YIRX 1R1TA 4RMNA 1GVJA 2E1CA 1BL0A 3HL2A 1KQ0A 3FXJA 3I4PA 1Y1WJ 2E19A 2PI0A 3PFYA 2EV5A 3GFIA 3GO5A 4B44A 1K6OA 2WB1N 1H8AC 4XM3A 4L9VA 4DYQA 5EJCA 3KZIC 4IX7A 1QO0D 3HBLA 3KP5A 3P9KA 4XSZF 4CCLA 4Y7NJ 3A01B 5BOXA 5DCMA 4PJLA 3WODF 1TNTA 5AONA 1Y6IA 3CJRB 1GV2A 1YW9A 2ZXJA 4MLOA 4FX4A 3BDDA 3H36A 4ZYHA 1OMIA 2BY0A 2KJBA 4XLFA 3C2HA 4XKVA 3GTLJ 2R5YB 2JUCA 3VEPA 3TEDA 2TDXA 3UR3C 4RBOA 2Q2EA 2H1LA 3KYDB 4J00A 3M7GA 4EQQA 1R9TJ 2B0LA 1XG1A 2W1OA 2LKPA 3S14J 2LMDA 4IVNA 2BY2A 2ISYA 3KEYA 3GVAA 4ENJA 4AVZA 3W6VA 1R1VA 3VYRB 4EM2A 2V26A 3Q9SA 5FRNA 2TRTA 4X1EA 5CQGA 2Y75A 1Z6TA 1I3AA 2Z5UA 5D5XB 3I0TA 1VQ7I 2R7ZJ 4I76A 2NOJB 3FXQA 4ZDPA 4B47A 2HQNA 1HA8A 1ONVA 3G6EI 1J75A 5F64A 1EF4A 2LY1A 3LA3A 2M5WA 2GBYA 2HOEA 3KIOA 3ZQFA 1W36D 2K27A 1ZQ3P 2Y9ZA 2BBYA 2F5FA 2VONA 2M30A 2OJED 2H8RA 3OYAA 3U21A 3ZPLA 3OR2C 4ZYGA 2FMYA 1QNTA 1BI3A 1FBQA 4XSXF 2MH2A 3IWZA 2VN2A 4PFPA 4IHYA 2ZJRF 1B6AA 3TQNA 2BVMA 2KL4A 3KYCB 2CV2A 2QUFA 3GX4X 4M71A 1FX7A 1OCTC 1JTYA 4RB2C 1WCMJ 2WY8Q 3K1NA 3KETA 2F5EA 3D1NI 2PX9A 3K70D 1K78B 2HU9A 1K83J 1Z77A 2M2EA 4DQ2A 3D0SA 3TW6A 1D1CA 2P81A 4ESJA 1NG6A 2BZTA 3KP7A 1PP8F 1J09A 2KIUA 4HF2A 5M5WJ 2DFEA 4MEYF 1VQ8I 1AOYA 1REPC 2L7MP 3BZ6A 2JQ7A 2K86A 4KISA 3A0BC 1U2WA 3AL0C 2K3FA 3WGHA 4HX4A 1LE8A 2H09A 3JRCA 2NVQJ 3U9GA 1D5VA 4Q5SF 2I5UA 1J0RA 2STWA 2DA5A 3ZQIA 5GTIC 4NBQA 2P5LC 2VPLA 2OV7A 2RVCA 5E3OA 2LY2A 1KYWA 2DA2A 1ORKA 3RSNA 3FXRA 3HRSA 2ISZA 4XLCA 5FFZA 4ITVA 1UG0A 4HA8A 3GUDA 1KZHA 5LHIA 3GZNB 4S0HB 3BY6A 1B8IA 3ZQ7A 3LAPA 3BCAA 2DYSH 1TWCJ 2Q2EB 2W4SA 1IRZA 3ZQLA 2GM4A 4NB5A 1I6HJ 1TWFJ 2Y69H 2WA0A 2QSFX 1WJEA 2RC4A 1H9GA 1F1ZA 3OYKA 3VODA 2QWWA 3J7YJ 2NVTJ 4HQEA 2PMHA 1UB9A 2ME0A 3HDDA 3L1PA 5CYVA 2BHYA 5E1ZB 1U6GA 1XB4A 2L2OA 1OFCX 1R5GA 3BR3A 3RKXA 1T95A 2UWMA 3H3VK 1FEXA 5IT9K 2HZTA 4BXUA 3JTGA 4IO9F 3E6CC 4OIPF 4N4NB 1DGWY 1T08B 3FX3A 3F22A 1TQIA 5ICFA 2V1XA 4A3DJ 3J7AO 1ZH5A 1IRGA 1W5CC 4RAYA 2AXTC 1XGOA 3GFJA 1BBYA 3GBGA 3QPTA 1FZPB 1VQ9I 2QQ9A 2LF8A 2O8KA 3ONQA 4CYDA 1EV7A 2XV4S 5EEHA 4UB6C 2MLGA 5GP9A 3PO3J 2VOPA 3CMMA 3S1QJ 1W5SA 3H3ZA 3ABUA 4QLCU 3RPQA 1XD7A 3BQYA 2K9NA 1VQ6I 3IL2A 4HRIA 1MMDA 4KMUX 4L9JA 4U88A 4DNCA 3QQAA 1OJLA 2B7EA 1OCCH 2ID6A 2IP2A 2WY7Q 3DF8A 1S29A 3LSRA 3A0HC 4A5MA 1H9TA 3L7WA 1J2XA 3DFGA 4I99C 2RNGA 2RQQA 2DK5A 1GXQA 4CDGA 1W1WE 1PYVA 2XVCA 1ETKA 2DAOA 3HPHA 1LE8B 1BI1A 1Z05A 3CC4I 3MZYA 2X48A 2Y0MA 5DUKA 5GAEJ 1KU9A 2RQPA 4B43A 5EDNA 3EUHA 2AQEA 4HAMA 3HKZA 1Y8QB 4MEXF 4BAYA 3NEUA 5L3GA 2AO9A 1H89C 4DGWB 4I0BA 4ZYDA 4C2UA 3HC7A 3K4BA 1IN7A 4I09A 4KN4X 3EYYA 4FE4A 5HS8A 3M8EA 2G7HA 3DLAA 5D4RA 1B8IB 3LSHA 1WZ2A 3ZP5A 1BW6A 1CF7A 3WU1B 2YSRA 4M3EA 4IKFA 5BPDA 2NXNB 2ZFUA 3JTHA 4AIKA 3QOPA 4JYKA 2XAUA 5ILUA 1YX5A 2GZWA 3GTQJ 3E5XA 1ETOA 2VKHA 4XLNF 3T1BA 3VOEA 2KHMA 5B66C 3WTUC 1QZZA 1T6SA 2X6YA 3J7AY 3ZCOA 4KT6A 1IW7F 4LB6B 3E7LA 3O3KA 4BHCA 4HLYA 4ESBA 1GDTA 3QP6A 2IRFG 2B63J 2DTRA 1IRFA 1MMNA 1HW1A 5DV5A 4Z2YA 2XPUA 5K5QA 2F4IA 4G9YA 4UV8A 1WGXA 1N78A 3N05A 1G2HA 1XTAA 4I0AA 2QA4I 2AXLA 4IEJA 4C2MJ 1IC8A 1V5FA 2CUFA 4Y13A 3GZ6A 3HOUJ 1ETWA 4EJOA 3L2RA 2JWTA 2MH9A 4RS8A 4UVBA 2W24A 1GT0C 2QSHX 2LNBA 3QP5A 4G6QA 3BPVA 3H9JA 1I27A 1YG2A 4L9TA 5IT3A 3PO2J 2FD5A 1I6XA 3KYLA 1MJAA 3M07A 3HHGA 2KDOA 4WXHA 1D1BA 1JUPA 1YLFA 3PNTA 4LJZF 4NC8A 1X4PA 3E3VA 3H0DA 2QEXI 1UMQA 2B9SA 5JLWA 1HC8A 1U3EM 4II3A 4E4HA 3DTEA 4FETA 3T8TA 2CWEA 2JSPA 3VYTB 5BQTA 2DA7A 1LB2A 1XS9A 4K2EA 1DUXC 2Y30A 1XN7A 2I10A 3QWLA 3ZMSA 4YFNF 2EINH 1X1DA 2WAFA 3HSEA 4D5CA 2PBIA 1YJNI 3ZMDA 1GUUA 2LY9A 3DPTA 4CCNA 5HVQC 1T2KA 1R71A 1Z6RA 1D0ZA 2JMWA 4OIRF 2PMZN 2IA0A 1R6RA 2EFNA 3GCMA 2DA6A 5E17F 4PFOA 2G0EA 3MZ8A 2ZBKA 2M34A 2X9DA 1QRYA 3MCZA 4GDFA 2A6TA 4IQ4A 3JRGA 2GXAA 4E70A 2LBFA 2X1DA 2DDBA 1EH7A 1K6YA 4AD9A 1HXDA 3ELKA 1A36A 2MYSA 3PNVA 2W48A 1KU7A 2EPFA 5GAGJ 1XSVA 2MW8A 4FHTA 4JK1X 2RV8A 2CW8A 4OIQF 5FLXZ 4N4OB 1I39A 2K9SA 2A05A 1JKOC 1CF7B 5E18F 3Q5FA 1EH8A 4ZC3A 3OYMA 3QPLA 2H94A 1RKTA 3BTLA 3CESA 4NC7A 3RYRA 2R7SA 2EBIA 3J81K 3HM5A 1XCVA 2E36A 3F3XA 1ZR2A 2QSGX 3CD6I 3E6BA 3O8HA 2RAEA 1USTA 4ZYAA 4CYCA 1IRXA 5JHUA 4I7HA 2K4BA 5IYCJ 4M6YA 1LEAA 1E2XA 2CMPA 2JA6J 4C2TA 4BKXA 2KQRA 1BI0A 2LP0A 1LPQA 1IGNA 1A6QA 2WWYA 2IAIA 4YRVA 2E34A 3LAJA 5JVTA 5JR3A 1B1BA 3NQOA 2DI3A 2L3DA 3S3MA 1C0WA 1RZ4A 2EIMH 2XHKA 3BG7A 5HS7A 1HSTA 5L3EA 3TGNA 3F21A 4LIVA 2EZLA 4RGUA 1I3QJ 2NAZA 3DTIA 4NDLA 1ERDA 4ABZA 4AYBA 1P4XA 4XLEA 1AU7A 2HPIA 4R1HA 2KLOA 1UELB 3V42A 2DMTA 2W82A 5EZHA 3C2BA 2DFFA 2IEKA 2ZJ2A 4IXAA 4HNTA 3JREA 4EGYA 2EZHA 1I1GA 1R5ID 1U5TC 3CCQI 2ETHA 1PP7U 3DLLF 3H9QA 5DUIA 1X19A 3QYBA 4OIOF 2DA3A 2M87A 3HRUA 2R7FA 1SFEA 1PDNC 4CO8A 2M45A 3CC7I 1YI2I 1OISA 2Z2SB 4CUGA 2DXIA 2X6OA 4ZZLA 3LSGA 1FTTA 1XSXA 2V7FA 4ESFA 4IPAA 2VC1A 4KA4A 5E1XA 1F9NA 1IXRC 4HV6A 3DEEA 5IPAA 3D5SC 2P6TA 2IW5A 2HDCA 2KPMA 2UUZA 3V7CA 1HLVA 4FE7A 5KAFC 2QQ8A 3HG9A 2DYRH 5CVJA 4M73A 4ASNA 4X6AJ 4A0XA 3HPGA 1FIAA 2KIMA 1JXSA 4BGDA 2X6WA 3FDYA 2XSJC 5FGMA 2YU9J 3B02A 1SAXA 3E1SA 5E3NA 4XBFA 3L09A 1BM9A 3ZQCA 1S7EA 3CCEI 2JT1A 4XN0A 2M8GX 3MKLA 4XRSG 4KUMA 5FJ8J 5GAHJ 4WK8F 3T0YA 4F93B 2KIFA 2ACJA 2PN6A 1ON2A 2VKDA 1RESA 3PM1A 5B1AH 4Q48A 2KMUA 3BR5A 3PQJA 3RZOJ 3HRMA 3DBLB 2QGUA 3Q9VA 2RGVA 4M3GA 2L0KA 2XROA 3FBIB 2BXZA 1HQCA 2HVSA 2XKOA 1IJWC 5HDKA 2R5YA 3H5RA 5BPIA 4CICA 5HDGA 5LBQA 1ZR4A 4CZZA 4BE0A 2IS2A 1MMGA 2ICWG 3O2PE 5ED4A 1XGSA 2MC3A 3SEQA 4F55A 1V5GA 2ZB9A 3GTMJ 2XAQA 4D0PA 5D5VB 4XICA 2DU9A 3ZMVA 5LGTA 2FQ4A 2RKHA 2ZCWA 3H5AA 4RDUA 1T33A 3RQIA 2X4HA 5HNHA 1BIAA 3VPRA 3BC8A 1MW7A 3LSIA 1ACIA 1XGNA 2LVSA 2L5QA 2JRTA 2KISA 4PJMA 1HKSA 3L2QA 2EZKA 2YX4A 3KZYA 5FROA 2A61A 2VQLA 3PSIA 4IHWA 3FMRA 2L9RA 3GLLA 3RTRA 3U1DA 1V3FA 2CO5A 3AL0B 4AM3A 1MIJA 1TT0A 3K2ZA 2JN6A 2LF7A 3MVPA 4Y4RA 2ELJA 1QHHD 3KP6A 2AS5F 4HSTA 2KZGA 4NHJA 4XRMA 4XMYA 4IOAF 1KA8A 2GA2A 2ZSIB 1T56A 4BEHA 1DP3A 2RREA 1UAAA 5KAIC 3JCUC 3K6GA 4XN3A 2X0LA 2A07F 4LIUA 4A6EA 1WH7A 2HKXA 2CQXA 1X2NA 1FJLA 3HOWJ 1FOYA 1ZYRF 1MNEA 2W7NA 2YPRA 5M3FJ 2D45A 5J1YA 2Y2ZA 3VYUB 2BOLA 1D8KA 3H3UA 3BP8A 4AWXB 3G1MA 5LRSA 2FOWA 2DCEA 2KDZA 2QQAA 1JI8A 5CQEA 1R58A 4JP0A 4BXXJ 2ME6A 4RM2A 2HKOA 2PEXA 3C3WA 1JKRC 3WGGA 1LQ1A 3O8GA 4AC0A 4MQVA 2KP6A 3VSLA 3S1RJ 2QLZA 3I9V2 2LC2A 3SFZA 2Z16A 3GTGJ 2R7XA 2LREA 4XOPA 4PSXA 1G3TA 5ILSA 2ZMEC 4N9HA 1S7AA 2CUZA 2HVQA 2EIJH 3CP2A 4ZZDA 3S2HJ 2A3SA 1MBKA 3ZQQA 2EV0A 2J5OA 1FOKA 3OY9A 4BDYA 2E2JJ 3Q0VA 4HX7A 3H35A 2F4MB 4L18B 3FHNA 3KCCA 2EH3A 3ERED 1F43A 4E7IA 4IHSA 1ZAOA 2K4JA 3F9KA 3C7JA 4OMYA 1HDPA 2F6CA 3DQVC 4M9XA 5EG0A 2DO7A 3Q0UA 3F8BA 4A3CJ 2OTJI 1OPCA 3QODA 3KPHA 4XIDA 3G3ZA 3FXKA 2IVMA 1LDKB 3AG3H 5ICGA 4ZTFA 1RR7A 3F6OA 3M3YJ 2FUG2 3FXUA 1GVDA 4FISA 3RI4A 2VKEA 2QZ8A 2DA4A 2L02A 4O3MA 3RKYA 3E5UA 1DU0A 1RC9A 3CTAA 3TO6A 1JTXA 2CU7A 1ETYA 1VNDA 1A5JA 4PGHA 2VBXA 1ETXA 3H5NA 4UUTA 3HUGA 5FFXA 1Y39A 3ABTA 3KP3A 3ROUA 3AKZA 3S32A 3BOQA 1QQIA 1JE8A 1MBJA 3MKWB 2ECBA 3G1LA 3MQ0A 1PVEA 2KFDA 4A2UA 4YIFA 1W36C 1MSEC 3C1DA 2WAQN 2O03A 3DBRB 3HOXJ 1X58A 2ECCA 2M4GA 3FKIJ 4BEHB 2Y48A 2E5ZA 4M3FA 5E1WA 1MNDA 1ODDA 3CCLI 3S15J 2QCOA 2IA2A 4BHBA 3FM5A 4HNVA 3ERMA 5FKLA 5EZGA 1SMTA 4HW0A 4BE2A 4AUXA 3I64A 2VLAA 3S3NA 2MSYA 4QTRA 4KIBA 5EYRA 3QAHA 4HSRA 4A3LJ 1W4MA 2LKXA 4KICA 5K7FA 3K70C 4UUSA 3QYEA 1WRJA 2HTJA 1GLNA 4Y17A 3NAUA 2QVOA 2V1UA 2V6CA 1TBXA 1E0EA 2M4KA 3KP4A 5DM7F 3T8RA 2W00A 1AHDP 4RB1A 4E7SA 4IHTA 4CGZA 2TCTA 2Y0SN 3HB9A 1ON1A 5F08A 2QKLB 4RLFA 1BJAA 4XLAA 5J4YA 1VQ4I 2VJIA 2OCEA 3BWGA 5IP9J 1SC7A 4O6JA 3L9FA 3GXOA 5IP6A 1E3HA 2VT2A 2CUEA 4LITA 1PUEE 1ENHA 3MZHA 3COAC 3FIWA 3WTSC 3WTYC 3HZJA 3R4KA 1SVOA 3LQQA 4XLHA 4NQWB 5AIQA 2VB6A 3CQZJ 4A0YA 4QIWN 2EFPA 4PJJA 3EPZA 3CMAI 2BY1A 5GPAA 1FMWA 5E3MA 1SMYF 3ABMH 4W97A 1D0XA 5H2FC 5CJ9A 4H4KC 2L01A 3KLNA 1P2FA 4H0EA 3VB2A 5EG0B 3S3OA 5D8KB 3HOYJ 5D6FA 4B48A 2LFBA 2VQGA 3Q3SA 2W84A 5KHDA 2MC4A 4XL9A 4Z6YA 3G2BA 1BW5A 1YTYA 1ZARA 4F52A 5FLMJ 2F2EA 2DK8A 3PIPF 5C4XJ 1USSA 2L9SA 2O6GE 2VJJA 5LD2C 5TGTA 1SFXA 2ZNZA 1S9HA 1ULYA 3EDPA 3JRFA 4II2A 1QU3A 4U0VA 1A04A 1SFKA 3LSPA 1MDMB 5DD8A 2NNYA 1R4MB 2WV0A 2E5NA 3DP7A 2KKOA 3HUGB 1SFOJ 3CMEI 3SFIA 2CQNA 4HEA2 2HS5A 2W85A 3DKXA 3J80Z 5DM6F 2FJ1A 1V55H 2DOEA 1U8BA 2JVHA 1D0YA 1OKRA 1OR7C 2OD5A 2LH9A 4YELA 1Y8RB 1BOBA 3SJMA 4P1WA 2ZXIA 1X1PA 2GLOA 1RPWA 4XRFA 2X51A 4RAFA 1X4OA 4BQQA 2R7DA 1WSUA 1QBJA 3WG7H 2F5DA 2K02A 1QGPA 5FKNA 2DT6A 4BY7J 4KFCA 3TKYA 1MZBA 2RN7A 1Z9CA 3ZN1A 3SZPA 4AIJA 4E7ZA 1W5TA 2V4JC 3WHCA 3JR9A 3OYEA
chains in the Genus database with same CATH topology
2LBFA 2X1DA 2X6XA 4DJAA 1K6YA 2OUMA 2VQCA 2MYSA 3PNVA 2VJ4A 2AQFA 2HVRA 3DWLE 2JUGA 2CW8A 3NWSA 4N4OB 4ZTJA 2XF7A 2F5VA 3OYDA 3L2VA 4D9JA 5LFAA 4PK4A 2PJRA 2UV1A 3PUBA 3OYLA 4ZC3A 4DIQA 3OYMA 2V1NA 2DJIA 4XKWA 3ZGKA 4BDZA 3K10A 3CESA 4NC7A 3DU6A 2R7SA 2IS4A 2GOMA 2R7WA 3ZRGA 2R7RA 3D5LA 4DBRA 4CCOA 4RLQA 4ZYAA 1IRXA 1P9QC 1WJAA 4PSWA 1DGRM 2CMPA 2L7KA 2MABA 4C2TA 2E1MB 4NNJA 2KQRA 3CZ6A 2Q1ZB 3LFUA 4BQOA 2CUJA 4YRVA 2A5WA 4CCKA 3IUOA 3OWTA 1WJCA 1KONA 4IZZA 3S3MA 1N77A 2X85A 3BG7A 4Y33A 2R7TA 3ZR8X 4GRIA 2V6EA 4LIVA 1OLTA 2CH0A 2VL8A 3DTIA 4OWRB 2HZDA 1ERDA 4AYBA 4NUBA 2CS3A 4XLEA 2V9KA 2HPIA 4E7KA 3MD2A 2KLOA 3OIPA 1UELB 3V42A 2W82A 3LSMA 1YX3A 4OAYA 2E1MC 3W2VA 4HNTA 3IAS2 4EATA 3LSKA 4CZCA 1Z7LA 3OOUA 3QOEA 1G8XA 2ZXHA 2MD0A 3H9QA 2M7BA 1X19A 4RMNA 2WB1A 3OYJA 3QYBA 3HL2A 4E7JA 2M3AA 3OL4A 4HG2A 3PFYA 2Z2SB 4CUGA 3RQ4A 2DXIA 4XR6A 1WJDA 2LG4A 4KJZA 3OS2A 3LSGA 2VJ5A 4B44A 2V7FA 4XM3A 4FASD 3FKJA 4IX7A 1EA3A 4CCLA 2CV0A 3DEEA 3D5SC 4D1QA 4PJLA 4CCMA 2KPMA 2UUZA 1Y6IA 3VDXA 3CJRB 3RPUD 3M8JA 3HG9A 4MLOA 4XQFA 2X1EA 3HPGA 2KZVA 1BR4A 4BGDA 2X6WA 3FDYA 2XSJC 2XF5A 4XKVA 4XLFA 3C2HA 3E1SA 3PSFA 3OYGA 3NWTA 1X1BA 3UR3C 4XN0A 4CCJA 4J00A 4DBQA 3EUAA 3DU5A 4PUSA 2W1OA 1N75A 2XDVA 4BQNA 2IGOA 1NG7A 3W3CA 4F93B 3KEYA 2VKDA 3OYFA 4AVZA 2WBMA 4KITB 3DPLC 2KMUA 3VYRB 2V26A 2IXSA 4OAZA 5FRNA 5CQGA 4BXFA 3FBIB 3C2GA 2HVSA 4XONA 3H5RA 3TMOA 3BLYA 2NOJB 4ZDPA 4BE0A 2IS2A 1MMGA 4B47A 1D1AA 3SEQA 1HA8A 4X0GA 4F55A 3D5RC 1V5GA 1YE9A 3PJRA 2LY1A 2XF6A 3QYFA 1W36D 3OMYA 3OYNA 3H5AA 2Z1DA 2KRCA 2X1CA 5HNHA 2JVGA 3HXLA 3BC8A 1MW7A 2R7QA 3LSIA 3OR2C 2LRDA 3U21A 3OYAA 3OYHA 2VXDA 2L5QA 2R7OA 1BR1A 4PJMA 4BL0B 3L2QA 4PFPA 3VWBA 2XC7A 5FROA 2BVMA 2VQLA 3PSIA 2KL4A 3A4CA 2CV2A 4CH7A 4PJNA 4XOTA 3OS1A 3K4JA 3RTRA 2K5CA 3CF2A 3L2WA 3AL0B 3SDBA 1TT0A 1AA7A 2WY8Q 2ELJA 4Y4RA 4QPQA 1QHHD 3OL3A 3K4MA 4HSTA 3K70D 1LVKA 2HU9A 3K4CA 3K4LA 4XMYA 2K9MA 4G6TB 2ZSIB 4BEHA 4HNUA 1DP3A 2O5RA 2RREA 1D1CA 4XKCA 2MFZA 1UAAA 3K6GA 4XN3A 5JHFA 2R7UA 1NG6A 4LIUA 1J09A 3PNYA 2QKMB 4YEJA 1Z3XA 1X1AA 3S93A 2DOAA 4KISA 3AL0C 2K9LA 1MNEA 2W7NA 1Z3YA 4C30A 4BJ5C 4IQJA 3VYUB 2BOLA 3IP4B 2BW3B 2VPLA 3MKZA 2OV7A 3OS0A 4C9YA 2LY2A 3BG6A 2DCEA 3RSNA 1JI8A 4P5OA 4XLCA 5CQEA 4ITVA 1UG0A 4RM2A 3VYSB 2VQHA 4XNFA 3BCAA 2WADA 2CFOA 3A2KA 2KP6A 2Q2EB 2W4SA 3VSLA 3I9V2 2DT7B 4BE1A 2LC2A 2Z16A 2R7XA 2LREA 2LYCA 4XOPA 4PSXA 3K4NA 2HVQA 2CUZA 1VZ0A 2WA0A 3CP2A 2BW3A 4BUPA 1V5EA 1WJEA 3ZQQA 3LL7A 3OY9A 4BU2A 3MMYB 3OYKA 4BDYA 3H35A 3FHNA 3RCOA 4E7IA 1PJRA 1SAUA 3F9KA 4ZDLA 5KCMA 2F6CA 3DQVC 1U0JA 2L2OA 3E0JB 2VASA 1T95A 2UWMA 3QODA 1LDKB 1X1CA 4N4NB 4ZTFA 3CJQB 3OYIA 2FUG2 3DTKA 1DGWY 2CW7A 1TZLA 2BVLA 4ZJZA 2IS1A 1LKXA 3OR1C 2HQAA 4E6KG 1LFPA 3GBGA 3H5NA 2WAQA 3ONQA 2L9NA 3I3LA 2CV1A 2JA2A 4BJTA 3HOTA 3AKZA 3CMMA 3S32A 3MKYB 3MKWB 4AU7A 1W36C 4XORA 2IGMA 3KX2A 3HOSA 2M4GA 2I8DA 2GOXB 1WJ5A 4BEHB 3TBIA 1DQUA 2E5ZA 4U7BA 4J01A 4HRIA 1MMDA 3SEZA 3FBNB 1MNDA 2ZSHB 2WY7Q 4BE2A 2K3PA 2RNGA 2RQQA 2VLAA 3S3NA 3SYTA 2E60A 1PYVA 3LMMA 2LOOA 3HPHA 3W2WA 1BR2A 4HSRA 4E7HA 5HOOA 1G59A 2R7VA 4DOZA 3K70C 4B43A 3IAM2 2Y0SA 3QYEA 4F3QA 2AQEA 1GLNA 3HKZA 3EUHC 3TL4X 1E0EA 2HNHA 3W2AA 3SZGA 2M4KA 4DGWB 2W00A 5HLTA 4C2UA 3HC7A 3K4BA 3ZXSA 3DPUA 2R4GA 1MMAA 4LG3A 4E7SA 3DLAA 3LSHA 3K4KA 2IS6A 1WJFA 2QKLB 4RLFA 2IGNA 3CP8A 4XLAA 4BACA 2VJIA 4IKFA 4QPOA 3AFHA 3OYBA 2ZFUA 2VXZA 2XAUA 1YX5A 4LITA 1QHGA 5CPRB 4ANJA 3L2UA 2VKHA 4XKBA 3J7AY 2KHMA 5HNFA 2X6YA 4XLHA 4NQWB 3A1YA 2M0MA 2VB6A 4KT6A 3ZCOA 3DKYA 4PJJA 3S8PA 3EPZA 4JQFA 5CKTA 2WAEA 3EUKL 1FMWA 4R79A 1MMNA 1D0XA 1WJBA 4H4KC 3S3OA 2F4IA 4E7LA 1FMVA 3VSKA 4B48A 1N78A 2VQGA 3N05A 4RM3A 5KHDA 2MC4A 4XL9A 2P0WA 2VIXA 3G2BA 5KNLA 2IGKA 4F52A 4B3XA 1V5FA 2L9SA 1Z21A 3L2RA 3OYCA 1WFXA 2VJJA 4BJ6C 2HPMA 3H9GA 5TGTA 5LD2C 1S9HA 4F91B 2OC6A 4II2A 1QU3A 3H9JA 1SFKA 3KYLA 2E5NA 3HUGB 2KDOA 1D1BA 3PNTA 3PL8A 4NC8A 1X4PA 4HEA2 3DKXA 3H0DA 5FRMA 4II3A 4E4HA 3DTEA 4FETA 2JSPA 3VYTB 4Y3OA 4CSWA 3M1CA 2JVHA 1D0YA 4F92B 1OR7C 1T0FC 2LH9A 4YELA 4CA0A 2PMZA 2LBFB 1BOBA 4P1WA 2ZXIA 1X1DA 2WAFA 3OIQA 4JOMA 1Y56A 2X51A 4BS9A 1X4OA 4HPQA 1ZELA 3DPTA 4U87A 4CCNA 3BCBA 5HVQC 4BQQA 1D0ZA 2HDWA 2KRHA 1R6RA 2DT6A 4ZDOA 4PFOA 3UNGC 2PJRB 2A6TA 4E7ZA 4IQ4A 2V4JC 3OYEA 2M7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD0 A; 
#chains in the Genus database with same CATH topology
 2V9P A;  3F0C A;  4LLL A;  4UUS B;  3V7S A;  2OF7 A;  4KIG A;  2VBZ A;  1T38 A;  3LWF A;  3CCJ I;  2AQF A;  3G4S I;  4EJW A;  5IOZ A;  1IUY A;  2JUG A;  3DEU A;  3DWL E;  3NWS A;  4WCG A;  4ZTJ A;  2XF7 A;  2F5V A;  1P7J A;  1DPR A;  3GZ5 A;  2P4W A;  4MTD A;  5L3B A;  4D9J A;  4HF0 A;  5LFA A;  3T5X A;  4PK4 A;  1B59 A;  3GLX A;  3PUB A;  1POG A;  3OYL A;  4A3F J;  3QPH A;  4BDZ A;  5FLX K;  5EEA A;  3F23 A;  3R60 A;  5DDG A;  3DU6 A;  2GOM A;  2CRG A;  2HOA A;  2L4M A;  2XAS A;  2NVU B;  4RGS A;  4DBR A;  3S2W A;  1X3Z B;  2BYV E;  4RLQ A;  2L7Z A;  4PSW A;  1DGR M;  2VOD A;  3AG1 H;  3S1N J;  2XAG A;  3IH2 A;  4HX8 A;  2XAH A;  3CUQ C;  4NNJ A;  1O57 A;  3RKW A;  3K1M A;  1HF0 A;  1JGG A;  2FXA A;  4CCK A;  1U5T B;  2OA4 A;  2PQ8 A;  2CQQ A;  2ZKZ A;  1U9O A;  1MGT A;  4Q4Z F;  3IKV A;  4DZJ A;  4AIH A;  2V6E A;  1OLT A;  2VL8 A;  2HZD A;  1SVM A;  4NUB A;  1JUM A;  5ICE A;  1MH3 A;  3MD2 A;  3SDG A;  1P7I A;  3KP2 A;  4N0B A;  1ZGW A;  5GPC A;  4OAY A;  5F0F A;  2E1M C;  3C18 A;  5DYM A;  1W7P A;  4CZC A;  3LSK A;  3OOU A;  3CDL A;  3BR0 A;  5B3S H;  1MNM C;  3HJE A;  3OOP A;  4UB8 C;  1G8X A;  2ZXH A;  2ELK A;  5FLV A;  4I01 A;  2WB1 A;  5M5X J;  4LLN A;  1M1E B;  3OYJ A;  3M9A A;  4E7J A;  4GGG A;  4ENK A;  4HLX A;  4IRG A;  1HKQ A;  4M6V A;  4WXC A;  2A6H F;  1Z67 A;  5KVR A;  2BEO A;  3QU3 A;  5K5R A;  3RQ4 A;  1WJD A;  2LG4 A;  3OS2 A;  3NAR A;  2VJ5 A;  2GQQ A;  3KE2 A;  3TP3 A;  3J7Z I;  5C44 J;  3FKJ A;  4RAG A;  2JZY A;  2ZME A;  2ZXW H;  3ASO H;  4RGX A;  1GHC A;  4D1Q A;  1S5L C;  2PMU A;  4CCM A;  2JSC A;  3VDX A;  3P5J A;  1G6N A;  5HLH A;  2GIZ A;  4G7Z F;  3BRO A;  5JFR A;  2CFX A;  2X1E A;  1CQT A;  2KZV A;  1UHW A;  2HR3 A;  1WKM A;  2COB A;  1D3Y A;  1ZLJ A;  2EZI A;  1X1B A;  2NNN A;  2JRM A;  3NWT A;  2F48 A;  5IY5 H;  5FD6 A;  2PJP A;  1YW7 A;  4CCJ A;  3JSP A;  1VQM I;  4QWQ A;  3EUA A;  3DU5 A;  1N75 A;  2XDV A;  1EKE A;  1ZRE A;  1NG7 A;  3W3C A;  1XX5 A;  3R61 A;  4HF1 A;  3CJN A;  3BTI A;  3WGI A;  2CQ7 A;  3OSG A;  3CCV I;  4FTH A;  4GO1 A;  3OYF A;  2WBM A;  3TO7 A;  2VBY A;  1FC3 A;  5E3L A;  2IXS A;  4OAZ A;  2OZU A;  3FMQ A;  1MJ9 A;  1QPI A;  4IJA A;  3C2G A;  3PQK A;  4MGR A;  3TMO A;  1VF9 A;  2FA5 A;  1XSD A;  4WF2 A;  2E2I J;  2NVX J;  1D1A A;  1FTZ A;  3P7N A;  3SZT A;  3I71 A;  3D5R C;  3F8C A;  4P9U A;  3PJR A;  1VQN I;  4FT8 A;  2XF6 A;  2LSO A;  1TT5 B;  3ZN0 A;  1L0O C;  2GWR A;  3QYF A;  4PJ0 C;  1KQ9 A;  1O7L A;  2QEN A;  4DYR A;  3P9I A;  2DOD A;  2JVG A;  1ETQ A;  2LRD A;  2VXD A;  1E3O C;  5IYD J;  2R7O A;  3IRQ A;  2P5V A;  1XDS A;  4M6X A;  2XRL A;  4L5E A;  2OQG A;  4C3J J;  2XC7 A;  1Q1V A;  2DMN A;  1IDY A;  3A4C A;  3BJ6 A;  1B72 A;  3JW4 A;  1ZGJ A;  4A3J J;  4PJN A;  1OQY A;  4XOT A;  3TO9 A;  5K1Y A;  3L2W A;  3CF5 F;  3SDB A;  3KLO A;  1ZHF A;  2DMP A;  2K7L A;  2UXN A;  3IHU A;  1QA6 A;  1AA7 A;  3PIO F;  4M74 A;  3R0A A;  4B4C A;  3OL3 A;  3K4M A;  2FNA A;  2JPB A;  2DDA A;  1J5Y A;  2JA8 J;  1R00 A;  1W7P B;  3K7A J;  3K4C A;  4YFX F;  1G3S A;  3JRI A;  1K4T A;  2K9M A;  4EM0 B;  1XCB A;  2IA1 A;  2O5R A;  3I59 B;  4XKC A;  5CVR A;  1KU3 A;  4IOC F;  2JPC A;  2O8X A;  5JHF A;  3JRH A;  4A3B J;  1BI2 A;  2R7U A;  1JKP C;  4L0Z B;  2EA2 A;  2XGX A;  2MBF A;  5HLI A;  4NC6 A;  2D1V A;  3I4N J;  1X1A A;  3CUO A;  4RAZ A;  2PG4 A;  5BS6 A;  1UFM A;  2EK5 A;  2MG4 A;  4LB5 A;  3BTJ A;  1HW5 A;  3E5Q A;  1Y0N A;  1Z91 A;  2PLY A;  4O5V A;  1Z3Y A;  4C30 A;  1K4S A;  3GTK J;  5C4J J;  4BQA A;  1V54 H;  3HSR A;  2ZME B;  3KEO A;  1FYL A;  3TW7 A;  1R49 A;  3IP4 B;  2BW3 B;  2ZO4 A;  1RI7 A;  1HOM A;  3OS0 A;  1RNL A;  1KQ8 A;  4KDP A;  3RIR A;  3CCR I;  3HOZ J;  2HGC A;  1IO2 A;  2XB0 X;  1RR8 C;  1IXS B;  2OBP A;  4FCY A;  3ISP A;  3VYS B;  4JBA A;  2WAD A;  3TOA A;  2CFO A;  2Q0O A;  5CVV A;  2DT7 B;  4V19 K;  3MAJ A;  1D5Y A;  4HZF A;  2LYC A;  5J1R A;  4V2G A;  1B9N A;  1IV8 A;  4BUP A;  2VI6 A;  1SD6 A;  3LL7 A;  1U9N A;  1O3T A;  3LQR A;  3HEF A;  2HDD A;  2HYF A;  3RPU A;  1TNS A;  2R5Z B;  2W25 A;  1PJR A;  1TQP A;  3CO7 C;  3AG4 H;  4ZDL A;  4DW6 A;  1QPM A;  2M8E A;  2KJC A;  1U0J A;  2XSD C;  4GCV A;  1S72 I;  1GXP A;  2A68 F;  3FXO A;  1IDZ A;  1T8I A;  2NS7 A;  1X1C A;  2EWN A;  3OYI A;  3DTK A;  1OR7 A;  3WTT C;  2W57 A;  2PFB A;  2BVL A;  2IS1 A;  1LKX A;  2ID3 A;  2M9H A;  3F8F A;  1UCR A;  1SFU A;  1J9I A;  1FYM A;  4KMF A;  3GEZ A;  3PUF A;  1BOA A;  1B72 B;  2L9N A;  2XRN A;  2CV1 A;  3OIO A;  4MHG A;  5L3F A;  3K1P A;  2ZNY A;  3ABK H;  2BHZ A;  3I4M J;  3MKY B;  5D6E A;  4AU7 A;  3RYP A;  3TP0 A;  3E6M A;  4HV5 A;  3ZOB A;  4XOR A;  4MQ9 F;  3HTU A;  2DBB A;  2IGM A;  2IBD A;  3KX2 A;  5J1U A;  3HOS A;  1MJB A;  2I8D A;  1WJ5 A;  1IV6 A;  5E8I A;  1DQU A;  1E3P A;  4U7B A;  5EF6 A;  1OCO H;  5A2Q Z;  4A3M J;  3FBN B;  5J6X A;  1IN5 A;  4M9Z A;  4WX9 A;  2ZSH B;  5TIS C;  1T98 A;  2FNP A;  1ZRC A;  2JA5 J;  2FSW A;  4UNO A;  2E60 A;  2FEZ A;  3GW2 A;  1TP4 A;  2L9V A;  3W2W A;  1BR2 A;  1LVA A;  4E7H A;  1NH3 A;  5M5Y J;  1YRN B;  4EJT A;  3BG3 A;  5HOO A;  1YIT I;  4L5I A;  1G59 A;  2R7V A;  1YS7 A;  3IAM 2;  3R0J A;  1MBF A;  5LEJ A;  1JHH A;  3I58 A;  2V79 A;  3EUH C;  4A69 C;  5J8F A;  1I1S A;  1D8J A;  3W2A A;  3KFW X;  3SZG A;  2LDU A;  2DTZ A;  3ZXS A;  4IHV A;  2R4G A;  1MMA A;  4LG3 A;  5FKO A;  3JRA A;  4BHP A;  1WJF A;  3ZQH A;  3HKZ N;  3OYB A;  2Q8K A;  2LR8 A;  1A6I A;  2F4O B;  1V4R A;  3BQZ A;  5AIP A;  4C3I J;  4BYY A;  1NTC A;  2FBH A;  4EV0 A;  1ZG5 A;  1TWH J;  1MSF C;  2D2W A;  3CDH A;  2OQR A;  1JUS A;  3FIS A;  3ABL H;  1KYZ A;  5FD5 A;  4ANJ A;  3L2U A;  1LFU P;  5CVI A;  3I5U A;  4XKB A;  2CQK A;  5LHG A;  2ZC2 A;  4LOC A;  5BNG A;  3A1Y A;  2M0M A;  2LD5 A;  1RUN A;  3S16 J;  4B3A A;  1YS6 A;  4JQF A;  4LG0 B;  2BE5 F;  3M4O J;  3WTX C;  5CKT A;  4M3B A;  4R79 A;  2OPT A;  5J4V A;  1WJB A;  3EET A;  3FZV A;  4HQM A;  1YJW I;  5H6R A;  3WG9 A;  1YW8 A;  3HOV J;  5B1B H;  1FMV A;  3VSK A;  2XIG A;  2DFI A;  4JX6 A;  1B9M A;  4TV7 A;  2GAU A;  2P0W A;  5KNL A;  1FSH A;  3IV5 A;  2IGK A;  4KT5 C;  2O3F A;  1IG7 A;  1P92 A;  2XAJ A;  4B3X A;  5HDN A;  1RRJ A;  4NQW A;  4EMS A;  3IH3 A;  1ZG1 A;  4IHX A;  1VTN C;  4YG2 F;  2XPW A;  3BPX A;  5DD4 A;  2LKS A;  4BJ6 C;  4A93 J;  3H9G A;  1ZKG A;  3K2A A;  4IF4 A;  4A6D A;  1WVR A;  1R5H A;  4F91 B;  5LLQ A;  3WTV C;  3FWE A;  3HHH A;  3JAM K;  5K7H A;  2EQR A;  3CMY A;  2E1N A;  1MKM A;  2FE3 A;  3PL8 A;  1BJZ A;  1TTY A;  2R3S A;  2STT A;  2CG4 A;  3CCY A;  5FRM A;  2H27 A;  1ZK8 A;  3JSO A;  2G9W A;  4OMZ A;  4Y3O A;  4CSW A;  1ZG3 A;  4F92 B;  3SXY A;  1T0F C;  1HCR A;  4L0Y B;  3MWM A;  5HLG A;  1PUF A;  4CA0 A;  2PMZ A;  4BY1 J;  3J80 K;  2O0Y A;  3OIQ A;  4JOM A;  1Y56 A;  2E7X A;  1FWZ A;  5FKK A;  4BS9 A;  2ADU A;  1MDM A;  5LHH A;  4HPQ A;  4U87 A;  5DCF A;  1KU2 A;  1UHM A;  1JT6 A;  5D5U B;  4P96 A;  3F8N A;  1IXC A;  3LOC A;  4A3G J;  5KK1 A;  2HDW A;  2KRH A;  1U78 A;  2KRF A;  1WQ2 A;  2P6S A;  2XGC A;  1FP2 A;  4IL6 C;  1WI9 A;  2G7U A;  1VQP I;  4EM1 A;  3UNG C;  1FIP A;  2PJR B;  4A3I J;  2EB7 A;  1NK2 P;  1P4W A;  2R92 J;  1E17 A;  2HVR A;  2M7A A;  3LA7 A;  1J59 A;  1VI0 A;  4BBR J;  4DJA A;  3CC2 I;  4LK1 F;  2VQC A;  4YII A;  2OCC H;  1S7O A;  3BR2 A;  3DKW A;  1F4K A;  4C3H J;  2DA1 A;  4P55 A;  3V7R A;  2ESN A;  3CUQ B;  5F1R A;  2D5V A;  3HSF A;  3OYD A;  4ZH4 F;  1WI3 A;  2Z3Y A;  3QRF F;  2E71 A;  4AVP A;  1QZY A;  3BZK A;  2V1D A;  3ZMT A;  2E35 A;  4DIQ A;  2K9Q A;  4XKW A;  1U8R A;  1OCZ H;  4Q47 A;  4UXN A;  3E6D A;  3K10 A;  2HQ5 A;  3WHB A;  2F5C A;  2R7W A;  2VE8 A;  2JA7 J;  3ZRG A;  3CJT B;  2VT3 A;  4G7O F;  2OAZ A;  3N97 A;  1O3S A;  2H8W A;  4CCO A;  1K61 A;  1IN4 A;  4GXO A;  1WJA A;  2O9L A;  1FPQ A;  2CGP A;  2L7K A;  2MAB A;  3FK6 A;  2E1M B;  1HW2 A;  5JLX A;  1BC7 C;  3CZ6 A;  3LA2 A;  2DJN A;  3A03 A;  1F5T A;  2Z99 A;  4LGW A;  3WTW C;  2A5W A;  2VBW A;  2L7F P;  2DLL A;  3GFM A;  1LFB A;  5F04 A;  1YIO A;  2XGE A;  3W6J B;  1WJC A;  5M3M J;  2GXG A;  3F8M A;  1KON A;  4IZZ A;  1LEB A;  2X85 A;  5HS9 A;  2R7T A;  5J40 A;  3G73 A;  3ZR8 X;  1FBU A;  2HOT A;  4LK0 F;  5ILV A;  2CH0 A;  4OWR B;  1JHF A;  1SD4 A;  1H0M A;  3ECO A;  2OU2 A;  2CS3 A;  2HI3 A;  4HOB A;  2N8G A;  4AID A;  2LLK A;  1A31 A;  3OIP A;  1FYK A;  2H6B A;  1J7K A;  3LSM A;  1YX3 A;  2BY3 A;  1XMK A;  5DEQ A;  4ZYE A;  3IAS 2;  1CGP A;  5D8L B;  2NVY J;  3RDI A;  1U5T A;  3F72 A;  2XKP A;  2JJ7 A;  3QOE A;  4AYB N;  5DCM B;  3ECH A;  3B73 A;  1QVU A;  3I54 A;  1XDU A;  5DS9 A;  2M7B A;  4HYE A;  2E7W A;  2K40 A;  3W6K B;  4S04 A;  4Y52 J;  1R23 A;  2M3A A;  2HXI A;  3G71 I;  1ETV A;  2OTL I;  4CHU A;  3OL4 A;  1FBS A;  1OYI A;  3JAM Z;  4HG2 A;  5CVU A;  2XPV A;  3TOB A;  1PUF B;  4RB3 C;  4XR6 A;  4KJZ A;  5IYB J;  1UHS A;  1YHQ I;  4FAS D;  5GAD J;  1EA3 A;  2MGQ A;  2CV0 A;  4I98 B;  4KYW A;  3IKT A;  2EFW A;  4G94 A;  2HWV A;  2DQR A;  1VQL I;  2DPU A;  3WTZ A;  1IN8 A;  1QVT A;  3JRB A;  2A6E F;  1XC5 A;  4I02 A;  3RPU D;  1X3W B;  5F6F A;  5ICC A;  3M8J A;  2UZK A;  4IRH A;  1Z1D A;  3CLQ A;  3QPS A;  2IJL A;  3SQN A;  4XQF A;  1BR4 A;  3FXL A;  2DOF A;  2XF5 A;  1N25 A;  3PSF A;  1WHU A;  1MMS A;  3OYG A;  1TWA J;  1W0U A;  3K0L A;  3GME A;  4W1U A;  4DBQ A;  3B6C A;  4PUS A;  4BQN A;  2IGO A;  3FMS A;  4MIM A;  1XPX A;  2FOK A;  4DZP A;  1IZ1 A;  3S1M J;  1IAW A;  3MFK A;  3CCS I;  3NRV A;  4KIT B;  2HEO A;  3DPL C;  4N9I A;  5FB2 A;  3HRT A;  4BXF A;  1F36 A;  1FY7 A;  3GTJ J;  1BC8 C;  4XON A;  3LSJ A;  1HDD C;  4A3K J;  4UUV A;  3BLY A;  2V9V A;  4EGZ A;  2UXX A;  4U0W A;  1HSJ A;  5EEG A;  3BJO A;  3V8J A;  4X0G A;  1APL C;  4G6D A;  1YE9 A;  3B6A A;  2LTP A;  3WE3 A;  4LFU A;  3P9C A;  4G12 A;  5HOD A;  3IH4 A;  3OMY A;  4HDV A;  1UZC A;  3OYN A;  1VQK I;  2Z1D A;  2KRC A;  4XLP F;  3RZD J;  2X1C A;  2Z9O A;  1TW3 A;  3GYH X;  2QBY A;  3HXL A;  1IN6 A;  2R7Q A;  1X3U A;  3OYH A;  2FBI A;  3FM3 A;  1RIO H;  2L54 A;  1OCR H;  4A5N A;  1R4N B;  1BR1 A;  4BL0 B;  2ZFW A;  2VOO A;  3FHZ A;  3VWB A;  3GTO J;  3H92 A;  4PCQ A;  4CH7 A;  4L5J A;  4G7H F;  3OS1 A;  3K4J A;  2K5C A;  2MLK A;  3CF2 A;  3GF2 A;  1Y1V J;  1TW2 A;  2EFO A;  2YR2 A;  2H6C A;  4M9S A;  4QPQ A;  5K5O A;  3S2D J;  4B09 A;  3O6B B;  3MEX A;  2D1H A;  1DP7 P;  1LVK A;  2KIQ A;  3K4L A;  4L9N A;  4G6T B;  2EFQ A;  2P8T A;  1X2M A;  4JX5 A;  5E20 A;  4HNU A;  2M1B A;  2MFZ A;  2E2H J;  1BIB A;  3H0G J;  3WU0 A;  5LRR A;  1MBG A;  2HYJ A;  1HKT A;  1WWX A;  4MFD A;  1TQM A;  3CCU I;  5CLS A;  9ANT A;  2ESH A;  3PNY A;  2QKM B;  4YEJ A;  3HTS B;  2EJR A;  1Z3X A;  2GA1 A;  4LMY A;  4RA2 A;  4BH9 A;  1R36 A;  3S93 A;  2DOA A;  2HXO A;  4D5F A;  2A5Y B;  3BZC A;  2CW0 F;  2E1O A;  3IRR A;  3K69 A;  2K9L A;  1O3Q A;  4BJ5 C;  3MN2 A;  4IQJ A;  1XMA A;  2GIV A;  3N4M A;  4XRS A;  2HOS A;  3I59 A;  1Z0X A;  3ML6 A;  3MKZ A;  6PAX A;  5EGO A;  4C9Y A;  3CCM I;  4KIF A;  1GV5 A;  3BG6 A;  5FKM A;  2DPD A;  4P5O A;  1SVL A;  1WPK A;  2DQL A;  3FXM A;  2VUM J;  2VQH A;  4XNF A;  5F27 A;  3QU6 A;  5LGN A;  4EJV A;  2WTE A;  3L00 A;  3A2K A;  4I2O A;  2QQB A;  4BE1 A;  1IF1 A;  4QSH A;  1YOV B;  1AKH A;  5H20 A;  2YU3 A;  1LDD A;  5L3D A;  3BT9 A;  1H88 C;  3K4N A;  3RKQ A;  4FX0 A;  1AWC A;  1VZ0 A;  2BW3 A;  1V5E A;  5J3L A;  3UKG A;  4BU2 A;  5J8C A;  3LFK A;  3R6S A;  4XK4 A;  3RCO A;  5IT9 Z;  2EA4 A;  3RJP A;  3L2C A;  4EVI A;  1SAU A;  5KCM A;  2QF7 A;  1FT9 A;  1XGM A;  2WC2 A;  4PGG A;  2HQR A;  1P4A A;  4GFB A;  2XAF A;  2KT0 A;  5DTD A;  3E0J B;  1G3Y A;  2BGC A;  1QZE A;  2VAS A;  3V4G A;  4HDU A;  1IUF A;  2WV1 A;  4WWC A;  4ON0 A;  4RB0 A;  4UHT A;  1VQ5 I;  2HYG D;  3FK7 A;  1K79 A;  2YX7 A;  2IPQ X;  3CJQ B;  4U0Y A;  1DU6 A;  2CW7 A;  2YS9 A;  1T0F A;  2O7O A;  2QBY B;  1OCP A;  1TZL A;  2DMU A;  1P6R A;  2Y31 A;  4LLG F;  4ZJZ A;  1BN5 A;  3I55 I;  2M0C A;  3ZMU A;  2R5Z A;  3GTP J;  3OR1 C;  4R8H A;  1TLH B;  2HQA A;  2GXB A;  4E6K G;  1O4X A;  4UV9 A;  1RUO A;  1LFP A;  2NS0 A;  2MA3 A;  2WAQ A;  4HBL A;  3I3L A;  1ZRF A;  1UJ8 A;  2JA2 A;  4BJT A;  1YFH A;  3HOT A;  1I5Z A;  2NYX A;  4GYG A;  3ASN H;  2RDP A;  1NK3 P;  3TDU C;  1STZ A;  3M1E A;  5H6Q A;  1SEU A;  3DV8 A;  3LST A;  4LD5 A;  2GOX B;  2JTV A;  4S05 A;  3DBH B;  2CSO A;  3TBI A;  2NS8 A;  4J01 A;  2P5K A;  3VFZ A;  3SEZ A;  1DPU A;  2VC0 A;  1R1U A;  1W0T A;  1FLI A;  3G1O A;  1YQA A;  4KNY A;  2ZJP F;  2QM3 A;  3DXJ F;  4P9F A;  1EH6 A;  2K3P A;  3REO A;  1JJ8 C;  1LDJ A;  2L4A A;  1LUJ B;  1G4D A;  1YIJ I;  3SYT A;  5A2Q K;  1JKQ C;  3LMM A;  4ENM A;  2LOO A;  2FX0 A;  1YYV A;  1OYY A;  5L3C A;  4M72 A;  3DCF A;  4BBS J;  1Q1H A;  2CYY A;  3K9T A;  5E79 C;  1YJ9 I;  4DOZ A;  1S6L A;  2C6Y A;  2VKV A;  2Y0S A;  3ZMZ A;  1FOW A;  2P7V B;  4F3Q A;  5EGO B;  2MD5 A;  1XMX A;  1MD0 A;  3TL4 X;  5IOY A;  2HNH A;  5F0C A;  3ULQ B;  5HLT A;  2Z33 A;  3DPU A;  1OYW A;  1JGS A;  1RET A;  3E97 A;  5FO5 A;  3K4K A;  2IS6 A;  3KEQ A;  3WE2 A;  3BJA A;  5TJJ A;  3WU2 C;  2IGN A;  3CP8 A;  4BAC A;  2BXY A;  1UG2 A;  1K7A A;  3CLO A;  3AFH A;  4QPO A;  1YRN A;  1AKH B;  1MBH A;  3BR6 A;  2VXZ A;  4FQG A;  4MNU A;  2K85 A;  1QHG A;  4OU0 A;  5CPR B;  1EJ9 A;  1YO5 C;  5HNF A;  5B5E C;  3HGY A;  1BA5 A;  5F1J A;  1ITY A;  1FOX A;  3DKY A;  3S8P A;  4UVA A;  3GFL A;  1ZN2 A;  5LEK A;  3BG5 A;  2WAE A;  2HFH A;  3EUK L;  4IRI A;  2EIL H;  5D4S A;  1TL8 A;  2YUS A;  2DW4 A;  1S3J A;  4E7L A;  2RNJ A;  1DDN A;  1FP1 D;  4J19 A;  4RM3 A;  3JRD A;  3OSF A;  2VIX A;  5IP7 J;  4I6Z A;  1ZLK A;  2XB5 A;  4D7M A;  5F0H A;  2R0Q C;  3S17 J;  2FF4 A;  3KZZ A;  2ELH A;  4A12 A;  3OV8 A;  2XUB A;  4A3E J;  3AG2 H;  4LG0 A;  1Z21 A;  2NRA C;  1R7J A;  3OYC A;  1SAN A;  1WFX A;  4B8X A;  2HPM A;  2EIK H;  1KGS A;  1G3W A;  1O7F A;  2OC6 A;  3CDI A;  2FBK A;  2Y9Y A;  3GWZ A;  3M8F A;  2JK3 A;  3IWF A;  5GTH C;  4BNC A;  2VE9 A;  5C3E J;  5JVG F;  2BV6 A;  3M1C A;  1ZGA A;  1NHA A;  1Z7U A;  2LK2 A;  4A0Z A;  3X2Q H;  2LBF B;  3U1K A;  4YFK F;  3F6V A;  2P7C B;  3CO6 C;  3DEW A;  4D7N A;  1FNN A;  3BR1 A;  4PDK A;  1MH4 A;  4KN7 X;  1T39 A;  1TC3 C;  4UY8 I;  1ZEL A;  1L3L A;  3BCB A;  3A01 A;  2ZJQ F;  1A35 A;  1VQO I;  1LJ9 A;  2FML A;  2VPR A;  1I50 J;  2HTS A;  3Q0W A;  5BMZ A;  1TWG J;  3HYI A;  2DT5 A;  1O3R A;  5E8G A;  1S8N A;  2O61 A;  1MBE A;  4RGR A;  4ZDO A;  1B4A A;  1SD7 A;  3V8K A;  4V2F A;  4EEF G;  2R93 J;  2XGD A;  3MMY B;  4OOI A;  3BG9 A;  2X6X A;  2OUM A;  3I53 A;  4PZJ A;  3IC7 A;  3EQL F;  5TRD A;  2DFH A;  2VJ4 A;  2J5P A;  5ERI A;  4G8X A;  1HBX G;  1ZRD A;  1LNW A;  4CYC B;  2FRH A;  4B1R A;  1SD5 A;  3EYI A;  3L2V A;  1JT0 A;  3LNQ A;  3TDZ C;  3J81 Z;  3U2R A;  5K7Z A;  2PJR A;  2UV1 A;  3ZQG A;  2QYO A;  4JX4 A;  2V1N A;  2DJI A;  4MTE A;  3ZGK A;  1RKW A;  1ZTR A;  2AHQ A;  2NOG A;  4Y15 A;  5D5W B;  3FF5 A;  1R22 A;  2IS4 A;  2R7R A;  2A69 F;  3D5L A;  2COM A;  1JJ6 C;  4OIN F;  3H1C A;  3ESW B;  3SHF A;  1FSE A;  1WH5 A;  2CJJ A;  4F7Z A;  1P9Q C;  3CUQ A;  4UVC A;  5J47 A;  4ETS A;  2Q1Z B;  3LFU A;  4EJU A;  4BQO A;  2CUJ A;  2EV6 A;  4WXD A;  3V8L A;  3A02 A;  5LGU A;  3I56 I;  3IUO A;  3OWT A;  5JI6 A;  4MO7 A;  1VFC A;  2OZ6 A;  1N77 A;  3PFI A;  4CXF A;  3AAF A;  4Y33 A;  1Y0U A;  4GRI A;  3HIF A;  4DYC A;  4M3D A;  2IT0 A;  2V9K A;  3BTC A;  4MFE A;  4E7K A;  2DN0 A;  4ENN A;  2DMQ A;  1W7P D;  3W2V A;  1K78 A;  4EAT A;  4U7D A;  1Z7L A;  2FU4 A;  4GYI A;  2H1K A;  2FQ3 A;  3HGG A;  2MD0 A;  4YIR X;  1R1T A;  4RMN A;  1GVJ A;  2E1C A;  1BL0 A;  3HL2 A;  1KQ0 A;  3FXJ A;  3I4P A;  1Y1W J;  2E19 A;  2PI0 A;  3PFY A;  2EV5 A;  3GFI A;  3GO5 A;  4B44 A;  1K6O A;  2WB1 N;  1H8A C;  4XM3 A;  4L9V A;  4DYQ A;  5EJC A;  3KZI C;  4IX7 A;  1QO0 D;  3HBL A;  3KP5 A;  3P9K A;  4XSZ F;  4CCL A;  4Y7N J;  3A01 B;  5BOX A;  5DCM A;  4PJL A;  3WOD F;  1TNT A;  5AON A;  1Y6I A;  3CJR B;  1GV2 A;  1YW9 A;  2ZXJ A;  4MLO A;  4FX4 A;  3BDD A;  3H36 A;  4ZYH A;  1OMI A;  2BY0 A;  2KJB A;  4XLF A;  3C2H A;  4XKV A;  3GTL J;  2R5Y B;  2JUC A;  3VEP A;  3TED A;  2TDX A;  3UR3 C;  4RBO A;  2Q2E A;  2H1L A;  3KYD B;  4J00 A;  3M7G A;  4EQQ A;  1R9T J;  2B0L A;  1XG1 A;  2W1O A;  2LKP A;  3S14 J;  2LMD A;  4IVN A;  2BY2 A;  2ISY A;  3KEY A;  3GVA A;  4ENJ A;  4AVZ A;  3W6V A;  1R1V A;  3VYR B;  4EM2 A;  2V26 A;  3Q9S A;  5FRN A;  2TRT A;  4X1E A;  5CQG A;  2Y75 A;  1Z6T A;  1I3A A;  2Z5U A;  5D5X B;  3I0T A;  1VQ7 I;  2R7Z J;  4I76 A;  2NOJ B;  3FXQ A;  4ZDP A;  4B47 A;  2HQN A;  1HA8 A;  1ONV A;  3G6E I;  1J75 A;  5F64 A;  1EF4 A;  2LY1 A;  3LA3 A;  2M5W A;  2GBY A;  2HOE A;  3KIO A;  3ZQF A;  1W36 D;  2K27 A;  1ZQ3 P;  2Y9Z A;  2BBY A;  2F5F A;  2VON A;  2M30 A;  2OJE D;  2H8R A;  3OYA A;  3U21 A;  3ZPL A;  3OR2 C;  4ZYG A;  2FMY A;  1QNT A;  1BI3 A;  1FBQ A;  4XSX F;  2MH2 A;  3IWZ A;  2VN2 A;  4PFP A;  4IHY A;  2ZJR F;  1B6A A;  3TQN A;  2BVM A;  2KL4 A;  3KYC B;  2CV2 A;  2QUF A;  3GX4 X;  4M71 A;  1FX7 A;  1OCT C;  1JTY A;  4RB2 C;  1WCM J;  2WY8 Q;  3K1N A;  3KET A;  2F5E A;  3D1N I;  2PX9 A;  3K70 D;  1K78 B;  2HU9 A;  1K83 J;  1Z77 A;  2M2E A;  4DQ2 A;  3D0S A;  3TW6 A;  1D1C A;  2P81 A;  4ESJ A;  1NG6 A;  2BZT A;  3KP7 A;  1PP8 F;  1J09 A;  2KIU A;  4HF2 A;  5M5W J;  2DFE A;  4MEY F;  1VQ8 I;  1AOY A;  1REP C;  2L7M P;  3BZ6 A;  2JQ7 A;  2K86 A;  4KIS A;  3A0B C;  1U2W A;  3AL0 C;  2K3F A;  3WGH A;  4HX4 A;  1LE8 A;  2H09 A;  3JRC A;  2NVQ J;  3U9G A;  1D5V A;  4Q5S F;  2I5U A;  1J0R A;  2STW A;  2DA5 A;  3ZQI A;  5GTI C;  4NBQ A;  2P5L C;  2VPL A;  2OV7 A;  2RVC A;  5E3O A;  2LY2 A;  1KYW A;  2DA2 A;  1ORK A;  3RSN A;  3FXR A;  3HRS A;  2ISZ A;  4XLC A;  5FFZ A;  4ITV A;  1UG0 A;  4HA8 A;  3GUD A;  1KZH A;  5LHI A;  3GZN B;  4S0H B;  3BY6 A;  1B8I A;  3ZQ7 A;  3LAP A;  3BCA A;  2DYS H;  1TWC J;  2Q2E B;  2W4S A;  1IRZ A;  3ZQL A;  2GM4 A;  4NB5 A;  1I6H J;  1TWF J;  2Y69 H;  2WA0 A;  2QSF X;  1WJE A;  2RC4 A;  1H9G A;  1F1Z A;  3OYK A;  3VOD A;  2QWW A;  3J7Y J;  2NVT J;  4HQE A;  2PMH A;  1UB9 A;  2ME0 A;  3HDD A;  3L1P A;  5CYV A;  2BHY A;  5E1Z B;  1U6G A;  1XB4 A;  2L2O A;  1OFC X;  1R5G A;  3BR3 A;  3RKX A;  1T95 A;  2UWM A;  3H3V K;  1FEX A;  5IT9 K;  2HZT A;  4BXU A;  3JTG A;  4IO9 F;  3E6C C;  4OIP F;  4N4N B;  1DGW Y;  1T08 B;  3FX3 A;  3F22 A;  1TQI A;  5ICF A;  2V1X A;  4A3D J;  3J7A O;  1ZH5 A;  1IRG A;  1W5C C;  4RAY A;  2AXT C;  1XGO A;  3GFJ A;  1BBY A;  3GBG A;  3QPT A;  1FZP B;  1VQ9 I;  2QQ9 A;  2LF8 A;  2O8K A;  3ONQ A;  4CYD A;  1EV7 A;  2XV4 S;  5EEH A;  4UB6 C;  2MLG A;  5GP9 A;  3PO3 J;  2VOP A;  3CMM A;  3S1Q J;  1W5S A;  3H3Z A;  3ABU A;  4QLC U;  3RPQ A;  1XD7 A;  3BQY A;  2K9N A;  1VQ6 I;  3IL2 A;  4HRI A;  1MMD A;  4KMU X;  4L9J A;  4U88 A;  4DNC A;  3QQA A;  1OJL A;  2B7E A;  1OCC H;  2ID6 A;  2IP2 A;  2WY7 Q;  3DF8 A;  1S29 A;  3LSR A;  3A0H C;  4A5M A;  1H9T A;  3L7W A;  1J2X A;  3DFG A;  4I99 C;  2RNG A;  2RQQ A;  2DK5 A;  1GXQ A;  4CDG A;  1W1W E;  1PYV A;  2XVC A;  1ETK A;  2DAO A;  3HPH A;  1LE8 B;  1BI1 A;  1Z05 A;  3CC4 I;  3MZY A;  2X48 A;  2Y0M A;  5DUK A;  5GAE J;  1KU9 A;  2RQP A;  4B43 A;  5EDN A;  3EUH A;  2AQE A;  4HAM A;  3HKZ A;  1Y8Q B;  4MEX F;  4BAY A;  3NEU A;  5L3G A;  2AO9 A;  1H89 C;  4DGW B;  4I0B A;  4ZYD A;  4C2U A;  3HC7 A;  3K4B A;  1IN7 A;  4I09 A;  4KN4 X;  3EYY A;  4FE4 A;  5HS8 A;  3M8E A;  2G7H A;  3DLA A;  5D4R A;  1B8I B;  3LSH A;  1WZ2 A;  3ZP5 A;  1BW6 A;  1CF7 A;  3WU1 B;  2YSR A;  4M3E A;  4IKF A;  5BPD A;  2NXN B;  2ZFU A;  3JTH A;  4AIK A;  3QOP A;  4JYK A;  2XAU A;  5ILU A;  1YX5 A;  2GZW A;  3GTQ J;  3E5X A;  1ETO A;  2VKH A;  4XLN F;  3T1B A;  3VOE A;  2KHM A;  5B66 C;  3WTU C;  1QZZ A;  1T6S A;  2X6Y A;  3J7A Y;  3ZCO A;  4KT6 A;  1IW7 F;  4LB6 B;  3E7L A;  3O3K A;  4BHC A;  4HLY A;  4ESB A;  1GDT A;  3QP6 A;  2IRF G;  2B63 J;  2DTR A;  1IRF A;  1MMN A;  1HW1 A;  5DV5 A;  4Z2Y A;  2XPU A;  5K5Q A;  2F4I A;  4G9Y A;  4UV8 A;  1WGX A;  1N78 A;  3N05 A;  1G2H A;  1XTA A;  4I0A A;  2QA4 I;  2AXL A;  4IEJ A;  4C2M J;  1IC8 A;  1V5F A;  2CUF A;  4Y13 A;  3GZ6 A;  3HOU J;  1ETW A;  4EJO A;  3L2R A;  2JWT A;  2MH9 A;  4RS8 A;  4UVB A;  2W24 A;  1GT0 C;  2QSH X;  2LNB A;  3QP5 A;  4G6Q A;  3BPV A;  3H9J A;  1I27 A;  1YG2 A;  4L9T A;  5IT3 A;  3PO2 J;  2FD5 A;  1I6X A;  3KYL A;  1MJA A;  3M07 A;  3HHG A;  2KDO A;  4WXH A;  1D1B A;  1JUP A;  1YLF A;  3PNT A;  4LJZ F;  4NC8 A;  1X4P A;  3E3V A;  3H0D A;  2QEX I;  1UMQ A;  2B9S A;  5JLW A;  1HC8 A;  1U3E M;  4II3 A;  4E4H A;  3DTE A;  4FET A;  3T8T A;  2CWE A;  2JSP A;  3VYT B;  5BQT A;  2DA7 A;  1LB2 A;  1XS9 A;  4K2E A;  1DUX C;  2Y30 A;  1XN7 A;  2I10 A;  3QWL A;  3ZMS A;  4YFN F;  2EIN H;  1X1D A;  2WAF A;  3HSE A;  4D5C A;  2PBI A;  1YJN I;  3ZMD A;  1GUU A;  2LY9 A;  3DPT A;  4CCN A;  5HVQ C;  1T2K A;  1R71 A;  1Z6R A;  1D0Z A;  2JMW A;  4OIR F;  2PMZ N;  2IA0 A;  1R6R A;  2EFN A;  3GCM A;  2DA6 A;  5E17 F;  4PFO A;  2G0E A;  3MZ8 A;  2ZBK A;  2M34 A;  2X9D A;  1QRY A;  3MCZ A;  4GDF A;  2A6T A;  4IQ4 A;  3JRG A;  2GXA A;  4E70 A;  2LBF A;  2X1D A;  2DDB A;  1EH7 A;  1K6Y A;  4AD9 A;  1HXD A;  3ELK A;  1A36 A;  2MYS A;  3PNV A;  2W48 A;  1KU7 A;  2EPF A;  5GAG J;  1XSV A;  2MW8 A;  4FHT A;  4JK1 X;  2RV8 A;  2CW8 A;  4OIQ F;  5FLX Z;  4N4O B;  1I39 A;  2K9S A;  2A05 A;  1JKO C;  1CF7 B;  5E18 F;  3Q5F A;  1EH8 A;  4ZC3 A;  3OYM A;  3QPL A;  2H94 A;  1RKT A;  3BTL A;  3CES A;  4NC7 A;  3RYR A;  2R7S A;  2EBI A;  3J81 K;  3HM5 A;  1XCV A;  2E36 A;  3F3X A;  1ZR2 A;  2QSG X;  3CD6 I;  3E6B A;  3O8H A;  2RAE A;  1UST A;  4ZYA A;  4CYC A;  1IRX A;  5JHU A;  4I7H A;  2K4B A;  5IYC J;  4M6Y A;  1LEA A;  1E2X A;  2CMP A;  2JA6 J;  4C2T A;  4BKX A;  2KQR A;  1BI0 A;  2LP0 A;  1LPQ A;  1IGN A;  1A6Q A;  2WWY A;  2IAI A;  4YRV A;  2E34 A;  3LAJ A;  5JVT A;  5JR3 A;  1B1B A;  3NQO A;  2DI3 A;  2L3D A;  3S3M A;  1C0W A;  1RZ4 A;  2EIM H;  2XHK A;  3BG7 A;  5HS7 A;  1HST A;  5L3E A;  3TGN A;  3F21 A;  4LIV A;  2EZL A;  4RGU A;  1I3Q J;  2NAZ A;  3DTI A;  4NDL A;  1ERD A;  4ABZ A;  4AYB A;  1P4X A;  4XLE A;  1AU7 A;  2HPI A;  4R1H A;  2KLO A;  1UEL B;  3V42 A;  2DMT A;  2W82 A;  5EZH A;  3C2B A;  2DFF A;  2IEK A;  2ZJ2 A;  4IXA A;  4HNT A;  3JRE A;  4EGY A;  2EZH A;  1I1G A;  1R5I D;  1U5T C;  3CCQ I;  2ETH A;  1PP7 U;  3DLL F;  3H9Q A;  5DUI A;  1X19 A;  3QYB A;  4OIO F;  2DA3 A;  2M87 A;  3HRU A;  2R7F A;  1SFE A;  1PDN C;  4CO8 A;  2M45 A;  3CC7 I;  1YI2 I;  1OIS A;  2Z2S B;  4CUG A;  2DXI A;  2X6O A;  4ZZL A;  3LSG A;  1FTT A;  1XSX A;  2V7F A;  4ESF A;  4IPA A;  2VC1 A;  4KA4 A;  5E1X A;  1F9N A;  1IXR C;  4HV6 A;  3DEE A;  5IPA A;  3D5S C;  2P6T A;  2IW5 A;  2HDC A;  2KPM A;  2UUZ A;  3V7C A;  1HLV A;  4FE7 A;  5KAF C;  2QQ8 A;  3HG9 A;  2DYR H;  5CVJ A;  4M73 A;  4ASN A;  4X6A J;  4A0X A;  3HPG A;  1FIA A;  2KIM A;  1JXS A;  4BGD A;  2X6W A;  3FDY A;  2XSJ C;  5FGM A;  2YU9 J;  3B02 A;  1SAX A;  3E1S A;  5E3N A;  4XBF A;  3L09 A;  1BM9 A;  3ZQC A;  1S7E A;  3CCE I;  2JT1 A;  4XN0 A;  2M8G X;  3MKL A;  4XRS G;  4KUM A;  5FJ8 J;  5GAH J;  4WK8 F;  3T0Y A;  4F93 B;  2KIF A;  2ACJ A;  2PN6 A;  1ON2 A;  2VKD A;  1RES A;  3PM1 A;  5B1A H;  4Q48 A;  2KMU A;  3BR5 A;  3PQJ A;  3RZO J;  3HRM A;  3DBL B;  2QGU A;  3Q9V A;  2RGV A;  4M3G A;  2L0K A;  2XRO A;  3FBI B;  2BXZ A;  1HQC A;  2HVS A;  2XKO A;  1IJW C;  5HDK A;  2R5Y A;  3H5R A;  5BPI A;  4CIC A;  5HDG A;  5LBQ A;  1ZR4 A;  4CZZ A;  4BE0 A;  2IS2 A;  1MMG A;  2ICW G;  3O2P E;  5ED4 A;  1XGS A;  2MC3 A;  3SEQ A;  4F55 A;  1V5G A;  2ZB9 A;  3GTM J;  2XAQ A;  4D0P A;  5D5V B;  4XIC A;  2DU9 A;  3ZMV A;  5LGT A;  2FQ4 A;  2RKH A;  2ZCW A;  3H5A A;  4RDU A;  1T33 A;  3RQI A;  2X4H A;  5HNH A;  1BIA A;  3VPR A;  3BC8 A;  1MW7 A;  3LSI A;  1ACI A;  1XGN A;  2LVS A;  2L5Q A;  2JRT A;  2KIS A;  4PJM A;  1HKS A;  3L2Q A;  2EZK A;  2YX4 A;  3KZY A;  5FRO A;  2A61 A;  2VQL A;  3PSI A;  4IHW A;  3FMR A;  2L9R A;  3GLL A;  3RTR A;  3U1D A;  1V3F A;  2CO5 A;  3AL0 B;  4AM3 A;  1MIJ A;  1TT0 A;  3K2Z A;  2JN6 A;  2LF7 A;  3MVP A;  4Y4R A;  2ELJ A;  1QHH D;  3KP6 A;  2AS5 F;  4HST A;  2KZG A;  4NHJ A;  4XRM A;  4XMY A;  4IOA F;  1KA8 A;  2GA2 A;  2ZSI B;  1T56 A;  4BEH A;  1DP3 A;  2RRE A;  1UAA A;  5KAI C;  3JCU C;  3K6G A;  4XN3 A;  2X0L A;  2A07 F;  4LIU A;  4A6E A;  1WH7 A;  2HKX A;  2CQX A;  1X2N A;  1FJL A;  3HOW J;  1FOY A;  1ZYR F;  1MNE A;  2W7N A;  2YPR A;  5M3F J;  2D45 A;  5J1Y A;  2Y2Z A;  3VYU B;  2BOL A;  1D8K A;  3H3U A;  3BP8 A;  4AWX B;  3G1M A;  5LRS A;  2FOW A;  2DCE A;  2KDZ A;  2QQA A;  1JI8 A;  5CQE A;  1R58 A;  4JP0 A;  4BXX J;  2ME6 A;  4RM2 A;  2HKO A;  2PEX A;  3C3W A;  1JKR C;  3WGG A;  1LQ1 A;  3O8G A;  4AC0 A;  4MQV A;  2KP6 A;  3VSL A;  3S1R J;  2QLZ A;  3I9V 2;  2LC2 A;  3SFZ A;  2Z16 A;  3GTG J;  2R7X A;  2LRE A;  4XOP A;  4PSX A;  1G3T A;  5ILS A;  2ZME C;  4N9H A;  1S7A A;  2CUZ A;  2HVQ A;  2EIJ H;  3CP2 A;  4ZZD A;  3S2H J;  2A3S A;  1MBK A;  3ZQQ A;  2EV0 A;  2J5O A;  1FOK A;  3OY9 A;  4BDY A;  2E2J J;  3Q0V A;  4HX7 A;  3H35 A;  2F4M B;  4L18 B;  3FHN A;  3KCC A;  2EH3 A;  3ERE D;  1F43 A;  4E7I A;  4IHS A;  1ZAO A;  2K4J A;  3F9K A;  3C7J A;  4OMY A;  1HDP A;  2F6C A;  3DQV C;  4M9X A;  5EG0 A;  2DO7 A;  3Q0U A;  3F8B A;  4A3C J;  2OTJ I;  1OPC A;  3QOD A;  3KPH A;  4XID A;  3G3Z A;  3FXK A;  2IVM A;  1LDK B;  3AG3 H;  5ICG A;  4ZTF A;  1RR7 A;  3F6O A;  3M3Y J;  2FUG 2;  3FXU A;  1GVD A;  4FIS A;  3RI4 A;  2VKE A;  2QZ8 A;  2DA4 A;  2L02 A;  4O3M A;  3RKY A;  3E5U A;  1DU0 A;  1RC9 A;  3CTA A;  3TO6 A;  1JTX A;  2CU7 A;  1ETY A;  1VND A;  1A5J A;  4PGH A;  2VBX A;  1ETX A;  3H5N A;  4UUT A;  3HUG A;  5FFX A;  1Y39 A;  3ABT A;  3KP3 A;  3ROU A;  3AKZ A;  3S32 A;  3BOQ A;  1QQI A;  1JE8 A;  1MBJ A;  3MKW B;  2ECB A;  3G1L A;  3MQ0 A;  1PVE A;  2KFD A;  4A2U A;  4YIF A;  1W36 C;  1MSE C;  3C1D A;  2WAQ N;  2O03 A;  3DBR B;  3HOX J;  1X58 A;  2ECC A;  2M4G A;  3FKI J;  4BEH B;  2Y48 A;  2E5Z A;  4M3F A;  5E1W A;  1MND A;  1ODD A;  3CCL I;  3S15 J;  2QCO A;  2IA2 A;  4BHB A;  3FM5 A;  4HNV A;  3ERM A;  5FKL A;  5EZG A;  1SMT A;  4HW0 A;  4BE2 A;  4AUX A;  3I64 A;  2VLA A;  3S3N A;  2MSY A;  4QTR A;  4KIB A;  5EYR A;  3QAH A;  4HSR A;  4A3L J;  1W4M A;  2LKX A;  4KIC A;  5K7F A;  3K70 C;  4UUS A;  3QYE A;  1WRJ A;  2HTJ A;  1GLN A;  4Y17 A;  3NAU A;  2QVO A;  2V1U A;  2V6C A;  1TBX A;  1E0E A;  2M4K A;  3KP4 A;  5DM7 F;  3T8R A;  2W00 A;  1AHD P;  4RB1 A;  4E7S A;  4IHT A;  4CGZ A;  2TCT A;  2Y0S N;  3HB9 A;  1ON1 A;  5F08 A;  2QKL B;  4RLF A;  1BJA A;  4XLA A;  5J4Y A;  1VQ4 I;  2VJI A;  2OCE A;  3BWG A;  5IP9 J;  1SC7 A;  4O6J A;  3L9F A;  3GXO A;  5IP6 A;  1E3H A;  2VT2 A;  2CUE A;  4LIT A;  1PUE E;  1ENH A;  3MZH A;  3COA C;  3FIW A;  3WTS C;  3WTY C;  3HZJ A;  3R4K A;  1SVO A;  3LQQ A;  4XLH A;  4NQW B;  5AIQ A;  2VB6 A;  3CQZ J;  4A0Y A;  4QIW N;  2EFP A;  4PJJ A;  3EPZ A;  3CMA I;  2BY1 A;  5GPA A;  1FMW A;  5E3M A;  1SMY F;  3ABM H;  4W97 A;  1D0X A;  5H2F C;  5CJ9 A;  4H4K C;  2L01 A;  3KLN A;  1P2F A;  4H0E A;  3VB2 A;  5EG0 B;  3S3O A;  5D8K B;  3HOY J;  5D6F A;  4B48 A;  2LFB A;  2VQG A;  3Q3S A;  2W84 A;  5KHD A;  2MC4 A;  4XL9 A;  4Z6Y A;  3G2B A;  1BW5 A;  1YTY A;  1ZAR A;  4F52 A;  5FLM J;  2F2E A;  2DK8 A;  3PIP F;  5C4X J;  1USS A;  2L9S A;  2O6G E;  2VJJ A;  5LD2 C;  5TGT A;  1SFX A;  2ZNZ A;  1S9H A;  1ULY A;  3EDP A;  3JRF A;  4II2 A;  1QU3 A;  4U0V A;  1A04 A;  1SFK A;  3LSP A;  1MDM B;  5DD8 A;  2NNY A;  1R4M B;  2WV0 A;  2E5N A;  3DP7 A;  2KKO A;  3HUG B;  1SFO J;  3CME I;  3SFI A;  2CQN A;  4HEA 2;  2HS5 A;  2W85 A;  3DKX A;  3J80 Z;  5DM6 F;  2FJ1 A;  1V55 H;  2DOE A;  1U8B A;  2JVH A;  1D0Y A;  1OKR A;  1OR7 C;  2OD5 A;  2LH9 A;  4YEL A;  1Y8R B;  1BOB A;  3SJM A;  4P1W A;  2ZXI A;  1X1P A;  2GLO A;  1RPW A;  4XRF A;  2X51 A;  4RAF A;  1X4O A;  4BQQ A;  2R7D A;  1WSU A;  1QBJ A;  3WG7 H;  2F5D A;  2K02 A;  1QGP A;  5FKN A;  2DT6 A;  4BY7 J;  4KFC A;  3TKY A;  1MZB A;  2RN7 A;  1Z9C A;  3ZN1 A;  3SZP A;  4AIJ A;  4E7Z A;  1W5T A;  2V4J C;  3WHC A;  3JR9 A;  3OYE A; 
#chains in the Genus database with same CATH homology
 2LBF A;  2X1D A;  2X6X A;  4DJA A;  1K6Y A;  2OUM A;  2VQC A;  2MYS A;  3PNV A;  2VJ4 A;  2AQF A;  2HVR A;  3DWL E;  2JUG A;  2CW8 A;  3NWS A;  4N4O B;  4ZTJ A;  2XF7 A;  2F5V A;  3OYD A;  3L2V A;  4D9J A;  5LFA A;  4PK4 A;  2PJR A;  2UV1 A;  3PUB A;  3OYL A;  4ZC3 A;  4DIQ A;  3OYM A;  2V1N A;  2DJI A;  4XKW A;  3ZGK A;  4BDZ A;  3K10 A;  3CES A;  4NC7 A;  3DU6 A;  2R7S A;  2IS4 A;  2GOM A;  2R7W A;  3ZRG A;  2R7R A;  3D5L A;  4DBR A;  4CCO A;  4RLQ A;  4ZYA A;  1IRX A;  1P9Q C;  1WJA A;  4PSW A;  1DGR M;  2CMP A;  2L7K A;  2MAB A;  4C2T A;  2E1M B;  4NNJ A;  2KQR A;  3CZ6 A;  2Q1Z B;  3LFU A;  4BQO A;  2CUJ A;  4YRV A;  2A5W A;  4CCK A;  3IUO A;  3OWT A;  1WJC A;  1KON A;  4IZZ A;  3S3M A;  1N77 A;  2X85 A;  3BG7 A;  4Y33 A;  2R7T A;  3ZR8 X;  4GRI A;  2V6E A;  4LIV A;  1OLT A;  2CH0 A;  2VL8 A;  3DTI A;  4OWR B;  2HZD A;  1ERD A;  4AYB A;  4NUB A;  2CS3 A;  4XLE A;  2V9K A;  2HPI A;  4E7K A;  3MD2 A;  2KLO A;  3OIP A;  1UEL B;  3V42 A;  2W82 A;  3LSM A;  1YX3 A;  4OAY A;  2E1M C;  3W2V A;  4HNT A;  3IAS 2;  4EAT A;  3LSK A;  4CZC A;  1Z7L A;  3OOU A;  3QOE A;  1G8X A;  2ZXH A;  2MD0 A;  3H9Q A;  2M7B A;  1X19 A;  4RMN A;  2WB1 A;  3OYJ A;  3QYB A;  3HL2 A;  4E7J A;  2M3A A;  3OL4 A;  4HG2 A;  3PFY A;  2Z2S B;  4CUG A;  3RQ4 A;  2DXI A;  4XR6 A;  1WJD A;  2LG4 A;  4KJZ A;  3OS2 A;  3LSG A;  2VJ5 A;  4B44 A;  2V7F A;  4XM3 A;  4FAS D;  3FKJ A;  4IX7 A;  1EA3 A;  4CCL A;  2CV0 A;  3DEE A;  3D5S C;  4D1Q A;  4PJL A;  4CCM A;  2KPM A;  2UUZ A;  1Y6I A;  3VDX A;  3CJR B;  3RPU D;  3M8J A;  3HG9 A;  4MLO A;  4XQF A;  2X1E A;  3HPG A;  2KZV A;  1BR4 A;  4BGD A;  2X6W A;  3FDY A;  2XSJ C;  2XF5 A;  4XKV A;  4XLF A;  3C2H A;  3E1S A;  3PSF A;  3OYG A;  3NWT A;  1X1B A;  3UR3 C;  4XN0 A;  4CCJ A;  4J00 A;  4DBQ A;  3EUA A;  3DU5 A;  4PUS A;  2W1O A;  1N75 A;  2XDV A;  4BQN A;  2IGO A;  1NG7 A;  3W3C A;  4F93 B;  3KEY A;  2VKD A;  3OYF A;  4AVZ A;  2WBM A;  4KIT B;  3DPL C;  2KMU A;  3VYR B;  2V26 A;  2IXS A;  4OAZ A;  5FRN A;  5CQG A;  4BXF A;  3FBI B;  3C2G A;  2HVS A;  4XON A;  3H5R A;  3TMO A;  3BLY A;  2NOJ B;  4ZDP A;  4BE0 A;  2IS2 A;  1MMG A;  4B47 A;  1D1A A;  3SEQ A;  1HA8 A;  4X0G A;  4F55 A;  3D5R C;  1V5G A;  1YE9 A;  3PJR A;  2LY1 A;  2XF6 A;  3QYF A;  1W36 D;  3OMY A;  3OYN A;  3H5A A;  2Z1D A;  2KRC A;  2X1C A;  5HNH A;  2JVG A;  3HXL A;  3BC8 A;  1MW7 A;  2R7Q A;  3LSI A;  3OR2 C;  2LRD A;  3U21 A;  3OYA A;  3OYH A;  2VXD A;  2L5Q A;  2R7O A;  1BR1 A;  4PJM A;  4BL0 B;  3L2Q A;  4PFP A;  3VWB A;  2XC7 A;  5FRO A;  2BVM A;  2VQL A;  3PSI A;  2KL4 A;  3A4C A;  2CV2 A;  4CH7 A;  4PJN A;  4XOT A;  3OS1 A;  3K4J A;  3RTR A;  2K5C A;  3CF2 A;  3L2W A;  3AL0 B;  3SDB A;  1TT0 A;  1AA7 A;  2WY8 Q;  2ELJ A;  4Y4R A;  4QPQ A;  1QHH D;  3OL3 A;  3K4M A;  4HST A;  3K70 D;  1LVK A;  2HU9 A;  3K4C A;  3K4L A;  4XMY A;  2K9M A;  4G6T B;  2ZSI B;  4BEH A;  4HNU A;  1DP3 A;  2O5R A;  2RRE A;  1D1C A;  4XKC A;  2MFZ A;  1UAA A;  3K6G A;  4XN3 A;  5JHF A;  2R7U A;  1NG6 A;  4LIU A;  1J09 A;  3PNY A;  2QKM B;  4YEJ A;  1Z3X A;  1X1A A;  3S93 A;  2DOA A;  4KIS A;  3AL0 C;  2K9L A;  1MNE A;  2W7N A;  1Z3Y A;  4C30 A;  4BJ5 C;  4IQJ A;  3VYU B;  2BOL A;  3IP4 B;  2BW3 B;  2VPL A;  3MKZ A;  2OV7 A;  3OS0 A;  4C9Y A;  2LY2 A;  3BG6 A;  2DCE A;  3RSN A;  1JI8 A;  4P5O A;  4XLC A;  5CQE A;  4ITV A;  1UG0 A;  4RM2 A;  3VYS B;  2VQH A;  4XNF A;  3BCA A;  2WAD A;  2CFO A;  3A2K A;  2KP6 A;  2Q2E B;  2W4S A;  3VSL A;  3I9V 2;  2DT7 B;  4BE1 A;  2LC2 A;  2Z16 A;  2R7X A;  2LRE A;  2LYC A;  4XOP A;  4PSX A;  3K4N A;  2HVQ A;  2CUZ A;  1VZ0 A;  2WA0 A;  3CP2 A;  2BW3 A;  4BUP A;  1V5E A;  1WJE A;  3ZQQ A;  3LL7 A;  3OY9 A;  4BU2 A;  3MMY B;  3OYK A;  4BDY A;  3H35 A;  3FHN A;  3RCO A;  4E7I A;  1PJR A;  1SAU A;  3F9K A;  4ZDL A;  5KCM A;  2F6C A;  3DQV C;  1U0J A;  2L2O A;  3E0J B;  2VAS A;  1T95 A;  2UWM A;  3QOD A;  1LDK B;  1X1C A;  4N4N B;  4ZTF A;  3CJQ B;  3OYI A;  2FUG 2;  3DTK A;  1DGW Y;  2CW7 A;  1TZL A;  2BVL A;  4ZJZ A;  2IS1 A;  1LKX A;  3OR1 C;  2HQA A;  4E6K G;  1LFP A;  3GBG A;  3H5N A;  2WAQ A;  3ONQ A;  2L9N A;  3I3L A;  2CV1 A;  2JA2 A;  4BJT A;  3HOT A;  3AKZ A;  3CMM A;  3S32 A;  3MKY B;  3MKW B;  4AU7 A;  1W36 C;  4XOR A;  2IGM A;  3KX2 A;  3HOS A;  2M4G A;  2I8D A;  2GOX B;  1WJ5 A;  4BEH B;  3TBI A;  1DQU A;  2E5Z A;  4U7B A;  4J01 A;  4HRI A;  1MMD A;  3SEZ A;  3FBN B;  1MND A;  2ZSH B;  2WY7 Q;  4BE2 A;  2K3P A;  2RNG A;  2RQQ A;  2VLA A;  3S3N A;  3SYT A;  2E60 A;  1PYV A;  3LMM A;  2LOO A;  3HPH A;  3W2W A;  1BR2 A;  4HSR A;  4E7H A;  5HOO A;  1G59 A;  2R7V A;  4DOZ A;  3K70 C;  4B43 A;  3IAM 2;  2Y0S A;  3QYE A;  4F3Q A;  2AQE A;  1GLN A;  3HKZ A;  3EUH C;  3TL4 X;  1E0E A;  2HNH A;  3W2A A;  3SZG A;  2M4K A;  4DGW B;  2W00 A;  5HLT A;  4C2U A;  3HC7 A;  3K4B A;  3ZXS A;  3DPU A;  2R4G A;  1MMA A;  4LG3 A;  4E7S A;  3DLA A;  3LSH A;  3K4K A;  2IS6 A;  1WJF A;  2QKL B;  4RLF A;  2IGN A;  3CP8 A;  4XLA A;  4BAC A;  2VJI A;  4IKF A;  4QPO A;  3AFH A;  3OYB A;  2ZFU A;  2VXZ A;  2XAU A;  1YX5 A;  4LIT A;  1QHG A;  5CPR B;  4ANJ A;  3L2U A;  2VKH A;  4XKB A;  3J7A Y;  2KHM A;  5HNF A;  2X6Y A;  4XLH A;  4NQW B;  3A1Y A;  2M0M A;  2VB6 A;  4KT6 A;  3ZCO A;  3DKY A;  4PJJ A;  3S8P A;  3EPZ A;  4JQF A;  5CKT A;  2WAE A;  3EUK L;  1FMW A;  4R79 A;  1MMN A;  1D0X A;  1WJB A;  4H4K C;  3S3O A;  2F4I A;  4E7L A;  1FMV A;  3VSK A;  4B48 A;  1N78 A;  2VQG A;  3N05 A;  4RM3 A;  5KHD A;  2MC4 A;  4XL9 A;  2P0W A;  2VIX A;  3G2B A;  5KNL A;  2IGK A;  4F52 A;  4B3X A;  1V5F A;  2L9S A;  1Z21 A;  3L2R A;  3OYC A;  1WFX A;  2VJJ A;  4BJ6 C;  2HPM A;  3H9G A;  5TGT A;  5LD2 C;  1S9H A;  4F91 B;  2OC6 A;  4II2 A;  1QU3 A;  3H9J A;  1SFK A;  3KYL A;  2E5N A;  3HUG B;  2KDO A;  1D1B A;  3PNT A;  3PL8 A;  4NC8 A;  1X4P A;  4HEA 2;  3DKX A;  3H0D A;  5FRM A;  4II3 A;  4E4H A;  3DTE A;  4FET A;  2JSP A;  3VYT B;  4Y3O A;  4CSW A;  3M1C A;  2JVH A;  1D0Y A;  4F92 B;  1OR7 C;  1T0F C;  2LH9 A;  4YEL A;  4CA0 A;  2PMZ A;  2LBF B;  1BOB A;  4P1W A;  2ZXI A;  1X1D A;  2WAF A;  3OIQ A;  4JOM A;  1Y56 A;  2X51 A;  4BS9 A;  1X4O A;  4HPQ A;  1ZEL A;  3DPT A;  4U87 A;  4CCN A;  3BCB A;  5HVQ C;  4BQQ A;  1D0Z A;  2HDW A;  2KRH A;  1R6R A;  2DT6 A;  4ZDO A;  4PFO A;  3UNG C;  2PJR B;  2A6T A;  4E7Z A;  4IQ4 A;  2V4J C;  3OYE A;  2M7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...