2MD0A

Solution structure of shk-like immunomodulatory peptide from ancylostoma caninum (hookworm)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
NDIRTAADMEHCADEKNFDCRRSLRNGDCDNDDKLLEMGYYCPVTCGFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords AcK1
publication title Kv1.3 channel-blocking immunomodulatory peptides from parasitic worms: implications for autoimmune diseases.
pubmed doi rcsb
source organism Ancylostoma caninum
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01549 ShK ShK domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1940 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2md0A00
2MD0A
chains in the Genus database with same CATH superfamily
2DPDA 2E60A 3S2DJ 3RCOA 5J6XA 3ULQB 3FBNB 4DYCA 2Z99A 3IH3A 2ZKZA 2IPQX 4AIJA 1D8KA 1FYMA 2XF5A 5LRRA 5ILUA 3K1NA 4BKXA 1PUEE 4HQEA 1ZQ3P 4EJVA 1JGSA 1FIPA 2KRHA 3TP0A 3VB2A 4BJTA 3S14J 1DU6A 1YI2I 4HNUA 4BAYA 1VZ0A 3QODA 5EEHA 4GYGA 3P7NA 5D8KB 4RGUA 2IA2A 1E3HA 3MCZA 2QEXI 1QVUA 4ETSA 2JTVA 1X1DA 3HGGA 2HVRA 2R5ZA 3H9JA 3WTYC 4AWXB 4WK8F 2B9SA 2HZTA 2FA5A 5BS6A 3HSEA 3F8MA 4FHTA 4U7BA 3GXOA 4XOTA 3VYRB 4PJJA 1X2MA 1X1PA 2XPUA 3PFYA 4A5NA 3LQRA 2EILH 3M7GA 1JUMA 1U5TB 1S7OA 3M8FA 3OYGA 3ASOH 1YJNI 2NS7A 1N25A 2H8RA 2IP2A 1V54H 3DU5A 5KCMA 4CCMA 1WGXA 2AO9A 1TWGJ 2LREA 1GVDA 1J5YA 2KLOA 3A01A 3H5AA 1K4SA 2EFNA 2CW8A 4BE2A 3FXRA 1XSDA 4DIQA 1A35A 1MJAA 1LE8A 3HOWJ 1P92A 3V8KA 4CYDA 1D8JA 4F92B 3GX4X 4MO7A 3QYEA 3CCUI 3HJEA 2KZGA 1QA6A 2CYYA 1IRFA 2HQRA 5J4VA 2VXZA 3N05A 1U8RA 1PVEA 1TBXA 3RKWA 4CXFA 3BTIA 2GIVA 4ZZDA 1ORKA 3BJ6A 4HZFA 2IA0A 2EFOA 5GPAA 3LSHA 4DJAA 2WAFA 5CKTA 3AG4H 2XAFA 2J5PA 3LSPA 4G12A 2GAUA 5E1XA 3L1PA 3HKZA 4XORA 3OYJA 3L2WA 1P7IA 4L9NA 4RS8A 4W97A 1KQ0A 3F21A 1TWCJ 1KGSA 2V1XA 2IAIA 2UUZA 1T0FA 3DEEA 4XMYA 5GTIC 4IPAA 3M1EA 3K2ZA 1WHUA 1CF7A 1OMIA 4F7ZA 2IEKA 3TOBA 2DDAA 5HLIA 5AIQA 3NARA 3PSIA 4XBFA 3BG5A 4RB0A 2DFHA 1BW5A 1ODDA 3WE3A 1Y1WJ 1V5FA 1XMKA 3F6VA 4BY7J 3G73A 4XIDA 1BC8C 4CDGA 3TO6A 5GADJ 5D4SA 3NRVA 1G2HA 1BOBA 4HV5A 4XRSG 2ZMEA 2WY7Q 2B63J 2IS6A 4AVPA 2CQQA 3CUQC 3OY9A 3HOXJ 3FISA 3G1LA 3RKQA 1IN4A 2LYCA 1ZGJA 3ZQGA 3J7AO 3DWLE 1JJ8C 5TISC 2VI6A 4M3BA 2VODA 2R5ZB 3MKYB 2WA0A 4WCGA 2JJ7A 2VXDA 1N78A 3RIRA 1SD6A 2QSHX 3MKWB 1K61A 3JRIA 4HG2A 3S2WA 3V4GA 1WH7A 2OUMA 4J00A 1H0MA 2R7TA 2VBZA 3BG6A 4DZJA 1PP7U 3CMEI 3S1RJ 3GWZA 4ZYEA 4ENJA 1T95A 1IRGA 4ABZA 1LQ1A 2ZJQF 3CUOA 2JA5J 2IS2A 1R1UA 3ZQQA 5FD5A 2XGCA 3ZQHA 1SMYF 1O3SA 2LLKA 3KEOA 2MD5A 2YUSA 2L02A 2I5UA 3GVAA 1RR7A 4CCKA 2LC2A 2PEXA 3FMQA 2W48A 3D5LA 4BXUA 3ZOBA 1LFUP 2W25A 3I59A 3PNYA 1FBUA 5CVUA 3TQNA 2R7RA 2LR8A 3HPHA 2QA4I 1ZHFA 1B72A 3V42A 2FRHA 1IG7A 5ERIA 3K4CA 2L9NA 1RZ4A 4KIGA 2OTJI 3IC7A 4F91B 1D1AA 5GTHC 3AAFA 2KJCA 4HX4A 1HBXG 4EATA 2A05A 2DMUA 2F5EA 3PSFA 2O61A 1RPWA 2EV0A 4I09A 1HDPA 1V5GA 2QLZA 5CYVA 1S7AA 2IXSA 4U7DA 2CUJA 3DTKA 4ASNA 3PO3J 4E7LA 4UUVA 1BBYA 2NNNA 1D5VA 2ESNA 5B5EC 2IW5A 1Z0XA 4ESBA 5FB2A 1E3OC 2F4OB 5IYBJ 1XMXA 1YX3A 3BR0A 1X1CA 1HSTA 5F6FA 1CF7B 2LVSA 4PSWA 3VODA 4EVIA 1QRYA 5GAHJ 2HQAA 1X58A 2UXXA 2VQLA 3W6JB 3LOCA 5K5OA 3H92A 3WU0A 4BQOA 5L3FA 1YYVA 1KQ8A 3KLNA 5EEAA 4KFCA 4A3CJ 2H1KA 4KISA 3T0YA 5J8FA 2BVMA 2EA2A 2CJJA 1IDZA 2ZMEB 4AUXA 2JA7J 3RQ4A 5CLSA 2DA6A 1YOVB 1LEAA 1NH3A 2E2IJ 1IGNA 3S32A 4LMYA 4XLFA 1FX7A 2MD0A 4LB6B 2DFFA 2A6EF 3LSRA 2IS4A 1G3SA 4WWCA 4IRGA 1D3YA 4D5FA 1HKSA 2CUFA 1MSFC 2Q2EA 3I54A 3OS0A 4UV8A 4RGXA 1OCPA 3AL0B 3DKYA 2B0LA 4MTDA 1FOWA 3K4NA 3IKVA 3F8NA 2JUCA 1GUUA 4M6VA 5FFXA 2ETHA 5IYCJ 2O03A 4A12A 3K1MA 2VPRA 3SFIA 2L2OA 2E1MB 2DTZA 2BHZA 3LMMA 4OWRB 1P9QC 1YJWI 2CQNA 5DTDA 1GXPA 2OJED 3PQJA 2BOLA 3GLLA 1IDYA 2HYFA 2HKXA 2VT2A 2NVUB 3C2GA 4NHJA 2R92J 5C4JJ 2PMUA 1R22A 3W3CA 2COMA 2QYOA 2PX9A 3Q0WA 1Z3YA 2HNHA 3L09A 1YIOA 1U9OA 4XKWA 1H9TA 1YHQI 1FZPB 4CZCA 2CMPA 1B6AA 2V6EA 4RB1A 4PUSA 4XSZF 4DNCA 4LLGF 1IV6A 1MBGA 3GZ5A 5ICCA 4YIIA 3TKYA 3BZKA 4RAGA 5K5QA 4II2A 1U2WA 5B66C 2QBYB 2YU9J 2VBWA 4BH9A 4E7ZA 3TEDA 4AYBA 3LQQA 1Z91A 3FMSA 2A6HF 5M5YJ 2FOKA 4A69C 5TRDA 5E3MA 3CO6C 1PP8F 1MMNA 4XLPF 1TNSA 2C6YA 1WI3A 4JX4A 1X3UA 2VJJA 2FU4A 2VIXA 3O6BB 3HG9A 4BGDA 2ZNYA 2HVSA 5DCMA 1HF0A 1B9NA 3JW4A 5FLXZ 2O5RA 1UCRA 3FKJA 3L2CA 4PGGA 5F1RA 3GFLA 3SYTA 4YEJA 1FBQA 4UVAA 2CQXA 2Z3YA 3V8JA 3CJNA 5DS9A 2PFBA 4UHTA 4A6DA 4BBRJ 2LKSA 1Q1HA 2Y30A 4PDKA 5DD4A 2OCCH 3E1SA 4IRHA 3JAMZ 4E7SA 2OD5A 4G6DA 1SC7A 2A6TA 5F04A 1BJAA 2ADUA 2PLYA 3GW2A 1KQ9A 2HYJA 3BR5A 5E3NA 2R0QC 4IOAF 2FSWA 2O7OA 2Q8KA 4ZZLA 2V9KA 4BHPA 3WTZA 4F93B 3M3YJ 1YITI 2DOEA 3NWSA 1JT6A 4A3IJ 1LDJA 1DDNA 2BZTA 1ETWA 1V3FA 1IXRC 2KIMA 1H8AC 2DN0A 5LLQA 5J8CA 3U21A 4LIVA 3MZYA 4A3EJ 4L0YB 1DUXC 4IRIA 1RR8C 3Q9SA 2R7UA 3BG9A 4KICA 2UXNA 4HV6A 5HNHA 3SDGA 1RI7A 4HSTA 3RKYA 3TDUC 2DO7A 3QOPA 2LF7A 4Q4ZF 1UJ8A 2V6CA 3RTRA 4IHYA 2L9VA 2HOSA 4M71A 1OYYA 2OV7A 3P5JA 2DK8A 2GXBA 4BXFA 3GYHX 3HUGB 2F5DA 3CDHA 4B4CA 4M3GA 2FOWA 3HHGA 4S05A 3B02A 4YFKF 3FXKA 2LSOA 3TP3A 2FBIA 5J3LA 3HOTA 3QYFA 3FM3A 2JWTA 4B48A 4JX6A 2JPBA 4Q48A 5KAIC 5HOOA 1MJBA 5IOZA 3ZRGA 4D7MA 4WF2A 3KYLA 3K4LA 3G71I 2WBMA 2R7OA 1TW2A 5CVVA 1YIJI 1T0FC 2PJPA 1B9MA 3CMAI 2R4GA 2CSOA 4EGZA 3BDDA 5B3SH 3BZCA 2JUGA 3TBIA 3FHZA 2VB6A 2Q1ZB 4GXOA 4QSHA 1R58A 1FOKA 1S3JA 2GA2A 2HQ5A 2OCEA 3BJAA 3BG3A 2R7SA 1ON1A 2YU3A 2XKPA 3E6BA 5F0CA 2DT5A 2TCTA 4YIFA 1FT9A 5BPIA 2QVOA 2EIJH 4CH7A 3E7LA 1FMWA 5BMZA 1XG1A 2OPTA 1MKMA 1HDDC 4M9SA 1JHFA 3UR3C 3HXLA 1K83J 3SFZA 2EZHA 2F4MB 1HLVA 3BP8A 1WFXA 4B09A 4ENKA 4X6AJ 3H35A 4HDVA 2WB1N 3D0SA 2JA8J 1Z6TA 2RGVA 1SVLA 5DV5A 1STZA 2MG4A 3W6VA 1MSEC 2DT7B 3UKGA 3DU6A 4BY1J 3OYKA 2CO5A 2VT3A 5EJCA 3GTOJ 2E1MC 3DBRB 3CCMI 2YR2A 2HR3A 3JSPA 1I1GA 1B59A 2QKLB 3A1YA 1LFPA 3I3LA 2M0MA 2ZFWA 4C30A 1E0EA 2MBFA 2M8EA 5L3GA 1KU7A 2OC6A 5IT3A 3OSFA 2EZIA 4WXDA 4HLYA 3HSFA 1VQ4I 1SFXA 4UUSB 5HDKA 5HS8A 1LPQA 2YSRA 1AKHA 4XICA 1K79A 1MIJA 2LK2A 3Q0VA 4ZYDA 2DDBA 4WXHA 4I01A 1K78A 4XR6A 4EGYA 2X1DA 3F9KA 4Z6YA 5LEKA 1OCTC 2O8KA 1U78A 2A3SA 2ME0A 2MH2A 1TC3C 4XLHA 3QP5A 3KP4A 3H3VK 3FMRA 5CVJA 1RNLA 4GRIA 4FASD 1D1BA 3LAJA 1SAXA 1Z05A 2OAZA 2VKHA 2GA1A 5D8LB 2KQRA 5B1BH 1HOMA 4XKVA 3M4OJ 5TJJA 1I3AA 2DA3A 1P4AA 1YTYA 2FX0A 4BQNA 3RI4A 1G3TA 3ZCOA 2EPFA 4GO1A 2Y75A 4B8XA 1VQNI 2JRMA 4PGHA 2KIQA 4QPOA 1LUJB 2DOAA 2W84A 1USSA 2HXOA 2HXIA 3OL3A 2VE8A 3R0AA 4I02A 2CGPA 5IYDJ 4GDFA 1CGPA 2ZJRF 2RAEA 1D5YA 1WJFA 3F6OA 2H94A 1ZRFA 1BOAA 2XF6A 4I76A 1U5TA 3W2VA 3FHNA 1MMDA 2ID6A 4KJZA 3MKZA 3DQVC 2BEOA 4A3KJ 5F0FA 4NC6A 2JPCA 4I99C 3BR3A 2E7WA 3WGGA 3RYPA 1YFHA 2DFIA 1HKQA 1Q1VA 2KZVA 3QAHA 3JREA 3HOSA 2ZB9A 5J40A 1XC5A 1T39A 1ETXA 2UV1A 1MBJA 2A61A 3FZVA 2VUMJ 2KRCA 3S16J 3BR1A 3L2UA 1L0OC 4U0VA 3I71A 1KA8A 2ZXIA 4C2UA 2ZXJA 2MA3A 5EZGA 1EF4A 5KNLA 4MTEA 3J81Z 2E7XA 3VSKA 2Z9OA 3ERMA 4A0YA 3IAS2 1SD4A 4IXAA 4E7KA 3EYIA 3F23A 9ANTA 3CLQA 2HTSA 1FOXA 1YW8A 3FDYA 3WU2C 4KN7X 3DPUA 2HYGD 3E5QA 2XKOA 2DJIA 2NS8A 4OINF 2XSDC 1T08B 3S1QJ 3M1CA 2JA2A 2L7ZA 3HPGA 2FBHA 2M0CA 4EJTA 1VFCA 1VTNC 1W0UA 2L7MP 3HGYA 2NVYJ 4RAZA 4PJNA 3HKZN 3EYYA 4RBOA 5HS7A 3FXMA 1EH6A 2LDUA 2EB7A 2LTPA 4HPQA 4RGSA 2XGDA 3BTCA 5BOXA 3S1NJ 1K78B 1NG7A 4E7JA 2E36A 1XDUA 3CMMA 2DLLA 4LOCA 5IOYA 2ZXWH 1UB9A 1I50J 3Q9VA 3R6SA 4KNYA 2P81A 2NYXA 3I56I 1X1BA 2L0KA 1FOYA 2EZKA 3OIOA 3CLOA 3J80Z 3WHBA 1XGOA 5EZHA 2EFQA 4II3A 2WAEA 4L18B 4XLCA 5K7ZA 1FTZA 1UG0A 1KYZA 1TWHJ 3REOA 5JVGF 2K9SA 4ZTJA 2WV1A 1T33A 3IKTA 4PSXA 1YG2A 2JVGA 2P5VA 3IAM2 5EF6A 2PG4A 1IRZA 1A6IA 1IJWC 5EYRA 4RLQA 3CDIA 3U2RA 3QP6A 5H6RA 3JRHA 2I8DA 2QQBA 4M9ZA 2NXNB 3AG2H 4FE4A 1GV2A 4D5CA 1DP3A 1KU3A 5H2FC 4MLOA 1YE9A 1TQPA 1WPKA 1R9TJ 1MMSA 2M4GA 3S3MA 3D1NI 4A0ZA 3L7WA 3JSOA 4UY8I 3MMYB 1S29A 4EJWA 5LGTA 4OIQF 1U6GA 4G94A 4H4KC 3LNQA 2LY9A 2UZKA 2HQNA 5D6EA 2L54A 3ASNH 1WJDA 5LFAA 4XLEA 1XCBA 1N75A 4YG2F 4N4NB 5DEQA 3KP3A 1MBFA 4A3MJ 2V26A 1VQ8I 2TRTA 3K10A 1RESA 3KYCB 4D7NA 2FQ3A 3G3ZA 2L5QA 5IT9Z 5KAFC 1BM9A 4FX0A 3I58A 3LA2A 1ZG5A 2PI0A 3BR6A 2GZWA 3ZQIA 1XSXA 2BGCA 2K02A 3K4KA 4I2OA 5D4RA 5F08A 3CJTB 4CICA 4ON0A 5J4YA 3TW6A 2EV6A 4BQQA 1A31A 1Y1VJ 3PIOF 2B7EA 3CESA 2DW4A 1YLFA 1ETQA 3VYUB 1BW6A 4EM2A 5F1JA 2VQGA 1E17A 1ON2A 4U0WA 4ENNA 1D1CA 1QPMA 3R4KA 4FETA 2K3PA 5HLHA 1EA3A 3HBLA 3T5XA 1XB4A 1ZH5A 4A3LJ 5ICFA 2Y9ZA 5M3FJ 2HVQA 4YELA 1W36D 2FEZA 4AIDA 2HEOA 3S15J 1O3TA 2VOPA 3PNTA 4PFPA 4EM1A 1BR1A 4DYQA 3BC8A 1B4AA 1SMTA 1MH4A 5F0HA 3J81K 4MNUA 4CCLA 4RAFA 3DEUA 4Q5SF 2JA6J 3BQZA 1K6OA 1R36A 1UHSA 2KKOA 2W57A 3GO5A 1RKWA 2IVMA 4AU7A 4BDYA 2M45A 4B44A 2K85A 3S17J 1OJLA 4S04A 1ZYRF 1TTYA 2P5KA 3DP7A 1R5HA 2KDZA 4IEJA 1OCRH 2KP6A 4IKFA 2R93J 2Z33A 4ZTFA 4PFOA 4UUTA 3VPRA 1WVRA 4MQVA 2NOJB 5JR3A 3JCUC 3MEXA 2E1NA 4RLFA 4MHGA 3WG7H 3JRCA 1Z77A 4DZPA 1BA5A 4Y17A 1W5TA 3ZP5A 1QZEA 2E5NA 3OS1A 3KFWX 1TT0A 5FKLA 1G3YA 1OYIA 3SJMA 2GQQA 4D1QA 4L0ZB 3J80K 4CGZA 3BOQA 3TO7A 4OIOF 2MW8A 1P4WA 1O3QA 4G6TB 1APLC 1IF1A 3BTJA 5K7HA 1USTA 1Y6IA 4ESJA 3L00A 4ZYAA 2QBYA 4DBRA 2HZDA 3VSLA 2WY8Q 2DMQA 2DMPA 2LMDA 1QVTA 4CCJA 2O0YA 1FBSA 5IP7J 3N97A 2CV1A 1F1ZA 3OSGA 4DW6A 5LHIA 1NK3P 5KVRA 2GBYA 2JQ7A 2LF8A 1T6SA 4ZC3A 2FMLA 1QNTA 3IH4A 1JUSA 4P5OA 4J19A 2XAUA 2CFXA 1X19A 4E6KG 5J1YA 2K9NA 3X2QH 1VQKI 1JKOC 4X1EA 1I6XA 5FO5A 2CU7A 2M8GX 2KL4A 3O8HA 1QQIA 2RNGA 4Y15A 1K6YA 3DLAA 2M30A 3SDBA 4CCNA 3QPHA 3U1KA 3E5XA 4OMZA 4D0PA 3CJRB 1BI3A 3FXLA 3KEQA 2KRFA 5M5WJ 2F5CA 2GOMA 2HFHA 3OL4A 3L9FA 3QPLA 1JHHA 3K4BA 1MNEA 1IO2A 2CW7A 3BPVA 5J1RA 2VJIA 4S0HB 4F55A 3W2AA 5ED4A 3M8EA 3ML6A 1I3QJ 1DGRM 2DMTA 1UZCA 4Y7NJ 1F9NA 4YRVA 2VKEA 3SXYA 1YX5A 3CCYA 3ABMH 5DM6F 3CCEI 1UHWA 1FWZA 4KMFA 2EV5A 1FPQA 2CG4A 4XM3A 5F64A 5JI6A 1WJBA 2IGKA 3V7RA 2D45A 2DJNA 1RRJA 2BVLA 1R00A 1REPC 2TDXA 3HHHA 3ZPLA 4AIHA 5KHDA 2RDPA 3ZMZA 4BU2A 2DOFA 1U5TC 4F3QA 1HQCA 3GZNB 2STTA 4XLAA 2Z2SB 4J01A 4KMUX 2X9DA 4BHBA 1E2XA 1XTAA 3KIOA 5D5XB 5HDGA 1X4PA 4HNVA 1FIAA 3QU3A 2P4WA 2ZBKA 2F5VA 2A5WA 3DTEA 4HSRA 1ZN2A 1WJAA 3JRBA 4LG0A 4MIMA 3HUGA 1JI8A 2OF7A 4HNTA 1O3RA 3BTLA 4A5MA 4MGRA 5D6FA 2PN6A 1LJ9A 2QF7A 2E2HJ 2EINH 4BJ5C 3ECHA 3LAPA 1HA8A 5A2QZ 2QM3A 2RREA 3Q3SA 2VC1A 2XUBA 1ZR2A 4G7ZF 2ICWG 5FROA 4P9FA 4OAZA 1EV7A 1PUFB 1POGA 2STWA 4HF1A 1J7KA 1IRXA 1MDMA 2ESHA 4ITVA 3F8BA 1ULYA 1TWFJ 3C1DA 2MH9A 4LIUA 1RUNA 1U8BA 3RYRA 4WXCA 4ZYHA 4M74A 4D9JA 1KU9A 5K1YA 2WAQA 4PJ0C 3L2QA 2F5FA 1WSUA 5FJ8J 4O6JA 2GLOA 1ETOA 2ISYA 5E3LA 3ESWB 4CO8A 5LD2C 2R5YB 2V1NA 2JT1A 2CUEA 2MLGA 3K1PA 2QSGX 2ISZA 2OBPA 2A07F 3D5RC 4MEYF 1WCMJ 1YQAA 2ZCWA 1QZYA 1SVOA 3JRFA 1HW2A 1VQ9I 3KX2A 2VBYA 2I10A 3VYTB 1FYKA 3ZN1A 1R4NB 2RN7A 3MFKA 4P96A 2BHYA 2GXGA 2IGOA 1FLIA 4R1HA 1G3WA 3I55I 2OZ6A 1TNTA 2AQEA 3ISPA 3K4MA 3HIFA 1L3LA 1RIOH 1OCZH 3BG7A 2W82A 4BDZA 3P9KA 2Y0SA 1D0XA 1MW7A 4RB3C 2NS0A 1YS7A 1YS6A 1YO5C 3S2HJ 3E6CC 4HLXA 3EPZA 1ZLKA 4IHTA 2PJRB 3MWMA 4EJUA 3G1OA 1T38A 2XF7A 3GUDA 1NTCA 1IC8A 3KLOA 2BW3B 3AKZA 5EGOB 2KFDA 1OCOH 3BZ6A 4XLNF 1LEBA 2K4BA 2K7LA 4KDPA 1GV5A 5B1AH 4UUSA 1I5ZA 4B43A 4LG0B 1KZHA 3I53A 1MJ9A 2RQPA 2GOXB 2Z5UA 4EV0A 1J0RA 4CYCA 1BI0A 3ERED 2BY2A 2RVCA 3IL2A 2R7FA 3ZQLA 1O4XA 5HS9A 2XPWA 3Q0UA 4A6EA 2AHQA 3GFMA 4ENMA 4BACA 2V1UA 3CC4I 2MLKA 1J09A 1DGWY 1ONVA 4MQ9F 4BE1A 1X1AA 3OR1C 1F43A 2H8WA 1FY7A 1R6RA 2EJRA 3M9AA 4A3FJ 2DPUA 3CP8A 5ICEA 1JXSA 3K69A 2EH3A 2DAOA 1FYLA 2L4AA 4N9IA 3FK6A 4XSXF 4BUPA 3S1MJ 2IBDA 2QUFA 4KN4X 3JRGA 4Q47A 1MDMB 2V1DA 1V5EA 3OYHA 3P9IA 1BI1A 3JTGA 2P6TA 1XMAA 3VDXA 1Z7LA 2PMZA 3J7YJ 1ETYA 4O5VA 4QLCU 2K3FA 3OOUA 2BBYA 2XGXA 1IUFA 2ZMEC 2DA5A 5EDNA 2F6CA 2QZ8A 2X6XA 3UNGC 3C18A 4LGWA 4L9JA 2BV6A 4HX8A 4H0EA 1TZLA 2P5LC 4G9YA 2HI3A 3RPUA 4QPQA 4NNJA 3CCVI 2CQ7A 4BYYA 2F2EA 1B8IA 3RZOJ 5FRMA 4C9YA 2O9LA 2VONA 3AL0C 1IN7A 1BI2A 3SQNA 1LVAA 5CVRA 5A2QK 3LSGA 4MEXF 3LSJA 2W24A 2K86A 3RPUD 4UB6C 3QRFF 2M3AA 3EQLF 2QCOA 5EG0B 3C3WA 1BR2A 4HF2A 4A93J 1ZRCA 1UG2A 4JX5A 2VQCA 2WC2A 5FLXK 2YPRA 4BQAA 3VFZA 2NRAC 4A2UA 1JE8A 5FLMJ 4P55A 3MQ0A 3FXJA 2XHKA 1Z1DA 2XAHA 3HM5A 4NQWB 4EEFG 1WQ2A 3WE2A 2MC4A 1FP1D 1YRNB 5AIPA 5ILSA 3DBHB 3ZXSA 3FWEA 2XVCA 4GCVA 4UXNA 1PYVA 1RC9A 4M73A 4E70A 3DLLF 2Y69H 6PAXA 3JAMK 1BC7C 4JOMA 5CQEA 1DU0A 1WJ5A 3BROA 3HRSA 5HVQC 3WODF 3ABUA 3IWZA 4KITB 2GWRA 4CYCB 3WTTC 3SZGA 5DCFA 2E34A 1ZARA 5DDGA 3QU6A 3LFKA 4B47A 4FX4A 2W00A 4E4HA 4L9TA 3A4CA 4JQFA 4R8HA 3PUFA 3JRAA 3E5UA 4O3MA 1FP2A 5FRNA 3MKLA 1QHHD 1YW9A 3SZTA 1LNWA 4XL9A 2H6BA 5CPRB 4FT8A 1GXQA 2ZJ2A 2KISA 2LKXA 5J1UA 4I7HA 5DD8A 3MN2A 2HKOA 2ME6A 2P7VB 5GAEJ 3J7ZI 1TT5B 1WI9A 2P0WA 2WADA 2IGMA 3L2VA 1TW3A 4XKBA 3G2BA 4HA8A 3DPTA 4DOZA 1T2KA 3FXQA 1X3ZB 1R4MB 4IL6C 1X4OA 4FE7A 2LBFB 1VQOI 4R79A 2XRNA 2M5WA 2E1CA 2DMNA 5L3DA 5C3EJ 1RETA 1UHMA 1WRJA 3CUQB 2EK5A 3NEUA 1QO0D 2XDVA 4ZYGA 1AOYA 2OA4A 2G7HA 5BPDA 4RDUA 3G1MA 3KZYA 2DYSH 3FXUA 4XRSA 1R1TA 2K5CA 2LH9A 3HOYJ 2ZXHA 2BY3A 4BL0B 3QYBA 1FTTA 3O3KA 3EUAA 4L5JA 4QWQA 4B1RA 2R7WA 1B8IB 1A5JA 2XSJC 1JTYA 4BE0A 3CF2A 2LKPA 2RNJA 2HWVA 2AS5F 4XQFA 1XSVA 4ANJA 2L7FP 4UVBA 1BIBA 1Z6RA 2XGEA 4LLLA 1X3WB 3AG3H 1ETVA 2ELHA 2JVHA 2W4SA 3R60A 2FE3A 3OYLA 3H0DA 3U1DA 1JTXA 5E3OA 4GYIA 4IX7A 2J5OA 4HW0A 1OCCH 1S8NA 2R7ZJ 1T98A 2HPMA 3ABKH 2FNPA 2LY2A 2V7FA 2LNBA 1I39A 3HOUJ 2BXYA 2ELJA 2H09A 2O6GE 3KCCA 1FEXA 2X51A 3K70D 3PJRA 4I98B 1TQIA 2MABA 5H6QA 3LSIA 5DUIA 3LSMA 3WTUC 4IHWA 3IWFA 3VWBA 3H9QA 3HZJA 3S93A 3QPTA 4FCYA 4PJLA 1ZREA 3ZR8X 3PFIA 2VJ4A 3CC7I 1Y8RB 2CWEA 3JRDA 1QGPA 3GZ6A 5LEJA 2BE5F 1MH3A 4WX9A 1Y56A 1MNMC 4IVNA 4YFNF 2JSPA 1QPIA 1OYWA 3GTJJ 3GTKJ 1ZKGA 3OIQA 2DYRH 3K9TA 2VASA 1R71A 2E71A 1JGGA 4ZDOA 3ZMSA 4AM3A 2HDCA 1GVJA 1VF9A 1U3EM 1ENHA 5F27A 2CW0F 3KE2A 3A0HC 4UB8C 3KP7A 2DQLA 3K6GA 2W7NA 3M8JA 2CV0A 3BPXA 1Z7UA 3AG1H 5JLWA 1EKEA 3NWTA 2XB5A 2KT0A 2A5YB 3TMOA 5IP6A 3AFHA 1UFMA 4ZJZA 1GLNA 5M3MJ 2HDDA 4I0AA 5IY5H 4ESFA 3KZIC 1LVKA 3WGHA 4LG3A 4NBQA 1OKRA 1EJ9A 3F0CA 3HC7A 4K2EA 4LJZF 2EWNA 2E2JJ 3KYDB 5E8GA 1D0YA 2JMWA 3S8PA 4MFDA 2ACJA 2NNYA 3GTLJ 2JSCA 5AONA 5CJ9A 5LHGA 1F4KA 4BEHA 5JHUA 3B73A 2VOOA 2XROA 1C0WA 2O8XA 3PUBA 3PM1A 4UVCA 1ACIA 3LL7A 2X48A 1ZGAA 1JKQC 4G7HF 1OISA 2EZLA 2RV8A 2M7AA 5D5UB 1OPCA 3ZMVA 4Y33A 3M07A 5L3BA 3IUOA 4IOCF 5HDNA 5LRSA 1FNNA 1FSEA 2PQ8A 5L3EA 2R7XA 2P6SA 5HODA 1X2NA 3HOVJ 3DV8A 5JFRA 3PO2J 5DUKA 4EMSA 1XS9A 1QBJA 1BN5A 2VQHA 4A3GJ 3I64A 3QOEA 1MBHA 3WG9A 4U88A 3V7CA 2M34A 3PL8A 1SD5A 2HS5A 4ZDLA 4P9UA 2HOEA 4KIFA 1WWXA 3PNVA 2Y0MA 2CRGA 3CMYA 2Y48A 1VQPI 3H3UA 2FQ4A 3FX3A 1IUYA 1W0TA 3BLYA 3GBGA 4RA2A 1ZK8A 4IHVA 2CQKA 2R3SA 2ZC2A 3VYSB 4N9HA 2XRLA 1BIAA 1NK2P 2E35A 1B1BA 5IP9J 2R7QA 4P1WA 4G7OF 3OV8A 4A3DJ 3DCFA 3DXJF 1BR4A 1JT0A 1R49A 3HL2A 2IS1A 2EIMH 1Y0NA 5K5RA 1I1SA 3LA3A 4CSWA 1IN6A 1W7PA 5KK1A 2G7UA 2KJBA 3DF8A 4E7IA 2E19A 3I0TA 1IW7F 1WJCA 3LSTA 3CZ6A 2N8GA 3PQKA 3RPQA 2KDOA 2ZSHB 1W7PD 3IRRA 2QQAA 1DPUA 3ABTA 2AXLA 1SAUA 1ZRDA 3C2HA 1GT0C 1R23A 1J2XA 3ELKA 3GMEA 3CTAA 4IHXA 1Z21A 1DQUA 4Y3OA 2DA2A 2QWWA 1V4RA 1OR7A 1XD7A 3TO9A 4FQGA 2YX7A 4V19K 2RQQA 3C7JA 3FBIB 2WTEA 2QQ8A 2PMHA 1R5ID 4I6ZA 2FJ1A 4BEHB 3EUHA 3NQOA 2K27A 3H1CA 4NC8A 4XN3A 1NG6A 1H88C 3CJQB 4RGRA 4BBSJ 1IXSB 1MZBA 2W85A 2V79A 2AXTC 3E97A 5ICGA 5E17F 1OQYA 3TGNA 2IA1A 1VNDA 4CA0A 1IZ1A 1KYWA 1HKTA 4XN0A 2QSFX 2D1VA 3MD2A 3K7AJ 3A01B 1XGSA 4HOBA 3HYIA 2K40A 1F36A 5LGNA 3WTSC 2X6YA 4HDUA 3WU1B 1LE8B 2ZO4A 3IRQA 2X6OA 3I4MJ 1G4DA 3W2WA 2KHMA 4L5EA 3OYAA 2Z1DA 3IP4B 3LSKA 3FKIJ 2Y2ZA 5GP9A 4AYBN 4M3EA 3HRTA 5HNFA 4IHSA 4OMYA 3I4NJ 1N77A 1PUFA 2XPVA 1W4MA 4G6QA 2XV4S 3F8FA 4Y4RA 3FM5A 4Z2YA 2XC7A 2NAZA 3A2KA 1TWAJ 4XRMA 2DFEA 1Z3XA 2RC4A 3MVPA 4IF4A 4L9VA 5FKOA 2CUZA 1HW5A 1T56A 3DEWA 3W6KB 2CFOA 3CCJI 3H0GJ 5L3CA 3RDIA 3R61A 2CS3A 1LDKB 3DKWA 2D1HA 2DA7A 2R5YA 4M9XA 3RQIA 2WAQN 3E6MA 3FK7A 3T1BA 1BJZA 5LGUA 2FF4A 2GIZA 4F52A 1QHGA 2DTRA 2G0EA 3DTIA 1HXDA 1XDSA 4PJMA 1RUOA 4TV7A 1S6LA 5JVTA 1W7PB 2V9PA 4OAYA 1BL0A 3A0BC 3WHCA 5BNGA 4CZZA 4KIBA 1VQ5I 2DU9A 5E20A 2VBXA 3GTPJ 5IT9K 2XAGA 5DYMA 2X6WA 4ZDPA 3I4PA 1MGTA 1SVMA 2DCEA 3LA7A 3CCQI 2HPIA 5D5WB 3DKXA 4JK1X 3OYIA 3SZPA 1ZG1A 1ZG3A 1LB2A 4EJOA 2VE9A 2DBBA 3A03A 1SANA 3HDDA 5E79C 4UNOA 4KA4A 1MBKA 3H5NA 1GHCA 4LLNA 5FLVA 2M1BA 3GTMJ 3FF5A 2Y0SN 2GXAA 4YFXF 1PDNC 3SEQA 2PJRA 1AA7A 2P7CB 4KT5C 1P2FA 5FKNA 5GPCA 2BW3A 1MD0A 1TQMA 2MSYA 4CUGA 5EGOA 4CHUA 3RJPA 1P6RA 3OYFA 1H89C 3HB9A 2LG4A 3HRMA 2DT6A 2X1EA 4LK0F 2MYSA 2LD5A 3KZZA 4DYRA 3S3NA 2VPLA 4HX7A 1Z9CA 1P7JA 1FSHA 3TDZC 2EQRA 4IQ4A 1R5GA 2W1OA 2ZFUA 2R7VA 1XN7A 1U0JA 1Y0UA 5ILVA 2RKHA 3K70C 2HTJA 1XPXA 3QPSA 2Y9YA 2COBA 4HYEA 4AD9A 1HC8A 4OOIA 4IZZA 2DA4A 1SD7A 1S9HA 2OZUA 3ONQA 3VEPA 1SFUA 3KP2A 3I59B 4JP0A 2V4JC 1D0ZA 3IH2A 3OYEA 1B72B 2NVQJ 1ETKA 4XONA 4Y13A 1IN8A 5E1ZB 3O8GA 2KMUA 4G8XA 2NOGA 3F8CA 3CQZJ 4BHCA 1K7AA 2BXZA 4M6XA 3HTSB 3VOEA 4U87A 1A6QA 3J7AY 4OU0A 4V2GA 1UELB 1UMQA 2ZSIB 4HAMA 3U9GA 4RB2C 4NC7A 1VQ6I 2NVXJ 2PBIA 3DFGA 3WTXC 4HRIA 3SHFA 1FC3A 2DQRA 2H6CA 3GFJA 3TL4X 3G4SI 3CC2I 2MGQA 4OIPF 2PMZN 3BQYA 3K0LA 1GDTA 3B6CA 2O3FA 5E8IA 3CP2A 4JBAA 1KU2A 3PIPF 1TL8A 1IV8A 1E3PA 1M1EB 4IO9F 3BCAA 4JYKA 5FKKA 1MMGA 4AC0A 4RM2A 2F48A 4M3DA 1G59A 2ELKA 4HEA2 3HOZJ 1S7EA 1SFKA 2F4IA 4N4OB 4ZH4F 5LHHA 3QWLA 4EM0B 3WTWC 1DP7P 2MFZA 4KYWA 3FXOA 5EG0A 1VQMI 3RKXA 4XOPA 2A69F 3E0JB 4HBLA 2Q2EB 2ZNZA 1SFEA 2DODA 1R7JA 1VI0A 2FD5A 3GF2A 4GFBA 5HLTA 2K4JA 1AU7A 1TLHB 3K4JA 5BQTA 1G8XA 2R7DA 2VKDA 3JTHA 4NQWA 4MFEA 5HLGA 2XAJA 2DK5A 3KEYA 1Y39A 1YRNA 3WGIA 4W1UA 1JJ6C 4XNFA 3OR2C 1OLTA 2UWMA 1IAWA 4M3FA 1JKRC 2ZJPF 1ZR4A 3BJOA 4LK1F 1QZZA 4PZJA 3CDLA 2KPMA 3WTVC 3GTGJ 1IXCA 1ZELA 3BT9A 4NUBA 2LOOA 3BR2A 1WH5A 3C2BA 5FD6A 3LWFA 1A04A 4YIRX 1G6NA 2K9MA 5FKMA 1PJRA 4DGWB 5TGTA 3P9CA 2HOAA 3GEZA 2BY1A 2DI3A 1HW1A 2EBIA 1EH8A 3GCMA 4LFUA 2E5ZA 2QKMB 1FMVA 2VN2A 5CVIA 4A3JJ 2LFBA 1O7LA 4C3HJ 5DM7F 3S3OA 2KIUA 2OQGA 1J9IA 2QENA 2A68F 4C2MJ 1T8IA 1XCVA 3ZMUA 2JRTA 2MC3A 2X4HA 3KPHA 3OYCA 4BXXJ 2L01A 2LBFA 1W36C 1H9GA 1U9NA 3O2PE 1NHAA 3OYBA 1HSJA 3IHUA 4PCQA 2LP0A 2ECCA 3CUQA 3GLXA 4L5IA 5DCMB 3GFIA 1WKMA 3KP5A 3OMYA 3MZ8A 3OWTA 5H20A 2HU9A 3F3XA 1VQLI 4I0BA 5FFZA 2HDWA 3H5RA 1Z67A 3RSNA 3I9V2 4V2FA 3LFUA 2L9SA 2VJ5A 3KETA 3KP6A 1P4XA 4BJ6C 4BS9A 4LD5A 3OIPA 1ITYA 4GGGA 3B6AA 3OYDA 1VQ7I 2Z16A 1SEUA 1J59A 1MBEA 2OQRA 4HF0A 4U0YA 1LKXA 4RAYA 3N4MA 4Y52J 3E3VA 3GTQJ 3CCRI 1W5CC 2VLAA 1S72I 1OFCX 1O7FA 5FGMA 4C3IJ 3OS2A 2EFWA 1OR7C 3ZQ7A 3F72A 2E1OA 2VC0A 2DXIA 3CCSI 3HTUA 2EA4A 4FISA 4B3XA 5LBQA 3G6EI 1LDDA 2L9RA 1KONA 2JZYA 2CH0A 2X85A 2XB0X 3EUHC 1XGMA 2FXAA 3CD6I 2WV0A 3HEFA 2IJLA 3NAUA 2P8TA 2V9VA 2BY0A 3ECOA 1RKTA 2CV2A 2XAQA 4OIRF 1TP4A 2EIKH 5E18F 2GM4A 2DA1A 2YX4A 3EDPA 1UAAA 1ZLJA 3E6DA 2IRFG 2D2WA 3A02A 1F5TA 1J75A 5D5VB 1ZGWA 2L3DA 2FBKA 2KIFA 2K9LA 3I5UA 3HRUA 4NB5A 2G9WA 1Y8QB 5JLXA 1O57A 2LY1A 3ABLH 4N0BA 2Y31A 1I6HJ 4RMNA 3CCLI 5M5XJ 4QTRA 3RZDJ 4FTHA 1IN5A 2BYVE 4LITA 5E1WA 2YS9A 1MMAA 3BCBA 1LFBA 3ZMTA 2HGCA 3D5SC 3H3ZA 3Q5FA 4C3JJ 3TW7A 3ZN0A 2JK3A 2WWYA 3ROUA 2FUG2 1QU3A 2ECBA 2X1CA 3ZMDA 2L7KA 4DQ2A 5GAGJ 2QGUA 3EETA 4HQMA 4X0GA 2IT0A 3BY6A 4CCOA 4DBQA 1V55H 4A3BJ 4IJAA 4QIWN 5IPAA 3MZHA 1FJLA 5K7FA 4XRFA 2M4KA 1ERDA 3JR9A 2FNAA 1SFOJ 1EH7A 4BNCA 2OTLI 3OYMA 2M87A 3T8RA 1YW7A 3L2RA 1WJEA 2WB1A 3K2AA 4KT6A 3V7SA 4KUMA 4LB5A 1ZTRA 4IQJA 3ZQCA 4C2TA 5EEGA 4PK4A 1JKPC 2Q0OA 4A0XA 2VL8A 2K9QA 1YJ9I 3EUKL 2OU2A 4AVZA 1AHDP 3FIWA 2HOTA 1I27A 3HSRA 1WZ2A 3H36A 3DPLC 3IV5A 4UV9A 3T8TA 2AQFA 3V8LA 2M7BA 3F22A 2ID3A 2M2EA 1DPRA 1A36A 1JUPA 3R0JA 2XIGA 2H27A 3OYNA 1CQTA 5C4XJ 3BWGA 1ZAOA 2VKVA 1AWCA 2H1LA 2X0LA 4B3AA 4AIKA 4E7HA 3DBLB 2FMYA 1XGNA 1R1VA 2JN6A 2QQ9A 2LRDA 2XASA 3SEZA 1S5LC 4RM3A 4XKCA 4EQQA 3MAJA 1K4TA 4NDLA 3ZGKA 1MNDA 2NVTJ 5C44J 4M6YA 1HCRA 2D5VA 1W5SA 5CQGA 3OOPA 4M72A 3H9GA 5J47A 1W1WE 4XK4A 3ZQFA 1AKHB 3COAC 3QQAA 2EFPA 3CO7C 5JHFA 3TOAA 2L4MA 2M9HA 1XX5A 3CF5F 2IGNA
chains in the Genus database with same CATH topology
2E60A 4NC8A 4XN3A 3RCOA 1NG6A 3CJQB 4LIUA 3FBNB 2E1MC 4D9JA 2WAQA 2XF5A 4CA0A 3L2QA 4XN0A 3MD2A 3OYKA 2KRHA 2QKLB 3A1YA 4BJTA 5LD2C 1LFPA 2X6YA 2V1NA 3I3LA 2M0MA 4HNUA 1VZ0A 4C30A 3QODA 3D5RC 3W2WA 1E0EA 2KHMA 3OYAA 2Z1DA 3IP4B 3LSKA 2OC6A 1X1DA 2HVRA 3KX2A 3VYTB 3H9JA 5HNFA 1N77A 2IGOA 2AQEA 3K4MA 4Y4RA 2XC7A 4U7BA 3A2KA 4XOTA 3VYRB 4PJJA 3PFYA 4XR6A 2X1DA 3BG7A 2W82A 3F9KA 4BDZA 2Y0SA 1Z3XA 1D0XA 3OYGA 1MW7A 2CUZA 4XLHA 2CFOA 4GRIA 3DU5A 1D1BA 2CS3A 5KCMA 4CCMA 4FASD 2LREA 1LDKB 2KLOA 3H5AA 2VKHA 2CW8A 3EPZA 4BE2A 2KQRA 4DIQA 4XKVA 2PJRB 2XF7A 2BW3B 4F92B 4BQNA 3AKZA 3QYEA 1QHGA 3DTIA 4PJMA 3ZCOA 4F52A 4QPOA 4OAYA 2VXZA 3N05A 2DOAA 3OL3A 4B43A 2GOXB 1WJFA 2X6WA 4ZDPA 3LSHA 4DJAA 2WAFA 5CKTA 2DCEA 2XF6A 2HPIA 3W2VA 3DKXA 3OYIA 4BACA 3FHNA 1MMDA 3HKZA 4KJZA 4XORA 3DQVC 1J09A 1DGWY 3OYJA 3MKZA 4BE1A 1X1AA 3OR1C 1R6RA 3H5NA 2UUZA 3CP8A 3DEEA 2KZVA 4XMYA 3HOSA 3SEQA 2PJRA 4BUPA 1AA7A 2BW3A 2UV1A 4CUGA 2KRCA 3PSIA 1V5EA 3OYFA 3L2UA 3OYHA 2LG4A 2DT6A 2X1EA 2MYSA 1V5FA 2ZXIA 3VDXA 3S3NA 1Z7LA 4C2UA 2VPLA 2PMZA 5KNLA 3VSKA 1BOBA 4IQ4A 2ZFUA 2W1OA 2R7VA 4E7KA 3IAS2 2IS6A 2WY7Q 1U0JA 3OOUA 3FDYA 3K70C 3DPUA 2DJIA 2F6CA 2X6XA 3UNGC 3OY9A 4IZZA 1TZLA 1S9HA 2LYCA 3M1CA 3ONQA 2JA2A 3HPGA 3DWLE 4QPQA 4NNJA 2V4JC 1D0ZA 3MKYB 2WA0A 3OYEA 2VXDA 1N78A 5FRMA 4PJNA 4C9YA 4XONA 3AL0C 2KMUA 3L2WA 3MKWB 4HPQA 3LSGA 4HG2A 3RPUD 2OUMA 4J00A 1NG7A 4E7JA 2R7TA 4U87A 3BG6A 3CMMA 3J7AY 2M3AA 1UELB 2ZSIB 4NC7A 1BR2A 1T95A 4HRIA 2VQCA 2IS2A 1X1BA 3ZQQA 3TL4X 4CCKA 2LC2A 4II3A 2WAEA 4NQWB 4XLCA 3D5LA 2MC4A 3ZXSA 1UG0A 3CP2A 3PNYA 1PYVA 2R7RA 4ZTJA 3HPHA 4JOMA 5CQEA 3V42A 3BCAA 4PSXA 1WJ5A 2JVGA 1MMGA 3IAM2 2L9NA 3K4CA 5HVQC 4KITB 4RM2A 1G59A 4F91B 1D1AA 4HEA2 1SFKA 2F4IA 4N4OB 4RLQA 3SZGA 4EATA 4B47A 3PSFA 2W00A 4E4HA 2MFZA 1V5GA 3A4CA 2I8DA 2IXSA 2CUJA 4JQFA 3DTKA 4E7LA 4XOPA 3E0JB 1DP3A 2Q2EB 5FRNA 1QHHD 4MLOA 4XL9A 5CPRB 1YX3A 5HLTA 1YE9A 1X1CA 3K4JA 2M4GA 4PSWA 3S3MA 1G8XA 2VKDA 3MMYB 2HQAA 2VQLA 3KEYA 2P0WA 2WADA 2IGMA 3OR2C 4XNFA 1OLTA 4H4KC 4XKBA 3L2VA 2UWMA 4BQOA 3G2BA 5LFAA 1WJDA 3DPTA 4XLEA 4DOZA 4KISA 1N75A 2KPMA 1X4OA 2LBFB 4N4NB 2BVMA 1ZELA 4NUBA 2LOOA 4R79A 3RQ4A 2V26A 2K9MA 2XDVA 3K10A 4XLFA 3S32A 1PJRA 4DGWB 2MD0A 5TGTA 2L5QA 2IS4A 2K5CA 2LH9A 2ZXHA 2E5ZA 2QKMB 3OS0A 4BL0B 3QYBA 2R7WA 3EUAA 3AL0B 1FMVA 3K4KA 3DKYA 2XSJC 3K4NA 4BE0A 3CF2A 4BQQA 3S3OA 4XQFA 3CESA 4ANJA 3VYUB 2E1MB 2L2OA 2VQGA 2JVHA 2W4SA 1P9QC 3LMMA 4OWRB 3H0DA 3OYLA 3OYCA 4IX7A 2BOLA 2LBFA 1W36C 1D1CA 4FETA 2K3PA 3C2GA 2HPMA 3OYBA 1EA3A 3W3CA 2LY2A 2V7FA 2HVQA 4YELA 1W36D 1Z3YA 2HNHA 3PNTA 2ELJA 1BR1A 4PFPA 3BC8A 3OMYA 3OWTA 2X51A 4XKWA 3K70D 3PJRA 2HU9A 4CCLA 2MABA 4CZCA 2CMPA 2HDWA 3H5RA 3RSNA 2V6EA 3I9V2 4PUSA 3LFUA 3LSIA 2L9SA 3LSMA 4AU7A 2VJ5A 4BDYA 4B44A 4BJ6C 4BS9A 3VWBA 3OIPA 3H9QA 3S93A 4II2A 3OYDA 4E7ZA 4PJLA 2Z16A 3ZR8X 4AYBA 2VJ4A 1LKXA 2KP6A 4IKFA 4ZTFA 1Y56A 4PFOA 1MMNA 2JSPA 2VLAA 3OIQA 2VASA 3OS2A 2NOJB 1OR7C 2VJJA 4ZDOA 2DXIA 2VIXA 3HG9A 4BGDA 2HVSA 4RLFA 2O5RA 4B3XA 3FKJA 2E5NA 3OS1A 1TT0A 1KONA 2CH0A 3K6GA 3SYTA 2X85A 4YEJA 4D1QA 3EUHC 2W7NA 3M8JA 2CV0A 4G6TB 3NWTA 2CV2A 1Y6IA 4ZYAA 3E1SA 3TMOA 4DBRA 3AFHA 4E7SA 1UAAA 2A6TA 2HZDA 1GLNA 3VSLA 4ZJZA 2WY8Q 4CCJA 2CV1A 1LVKA 2V9KA 4LG3A 4F93B 2K9LA 3NWSA 3HC7A 4ZC3A 1D0YA 3S8PA 2LY1A 4P5OA 2XAUA 4RMNA 1X19A 4BEHA 4E6KG 4LITA 3U21A 4LIVA 1MMAA 3PUBA 3BCBA 2KL4A 2RNGA 3LL7A 3D5SC 1K6YA 3DLAA 2R7UA 3SDBA 4CCNA 2FUG2 5HNHA 3CJRB 1QU3A 2GOMA 2X1CA 2L7KA 3OL4A 2M7AA 4HSTA 3K4BA 4X0GA 1MNEA 2CW7A 4Y33A 3IUOA 4CCOA 2VJIA 4DBQA 4F55A 3RTRA 3W2AA 2R7XA 1DGRM 4YRVA 2OV7A 1YX5A 2M4KA 1ERDA 2VQHA 4BXFA 3HUGB 3QOEA 4XM3A 3OYMA 1WJBA 3PL8A 4ZDLA 2IGKA 3L2RA 3PNVA 2BVLA 1WJEA 2WB1A 4KT6A 4IQJA 3HOTA 3QYFA 4BU2A 5KHDA 4C2TA 4PK4A 3BLYA 3GBGA 4B48A 5HOOA 4F3QA 3ZRGA 3KYLA 3VYSB 2VL8A 3K4LA 4XLAA 3EUKL 4AVZA 2WBMA 2Z2SB 2R7OA 4J01A 2R7QA 4P1WA 1T0FC 3DPLC 1BR4A 1X4PA 2R4GA 2AQFA 2M7BA 3HL2A 2IS1A 2F5VA 2A5WA 3TBIA 2JUGA 3DTEA 2Q1ZB 2VB6A 4HSRA 4CSWA 3OYNA 1WJAA 2R7SA 4E7IA 1JI8A 4HNTA 4E7HA 1WJCA 3CZ6A 2KDOA 4CH7A 2ZSHB 1FMWA 2LRDA 3SEZA 4RM3A 4XKCA 4BJ5C 3ZGKA 1MNDA 1SAUA 3C2HA 1HA8A 3UR3C 3HXLA 2RREA 1Z21A 1DQUA 1WFXA 4Y3OA 5CQGA 3H35A 3H9GA 5FROA 2RQQA 4OAZA 5JHFA 1IRXA 3FBIB 2DT7B 3DU6A 4BEHB 2IGNA 4ITVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD0 A; 
#chains in the Genus database with same CATH topology
 2DPD A;  2E60 A;  3S2D J;  3RCO A;  5J6X A;  3ULQ B;  3FBN B;  4DYC A;  2Z99 A;  3IH3 A;  2ZKZ A;  2IPQ X;  4AIJ A;  1D8K A;  1FYM A;  2XF5 A;  5LRR A;  5ILU A;  3K1N A;  4BKX A;  1PUE E;  4HQE A;  1ZQ3 P;  4EJV A;  1JGS A;  1FIP A;  2KRH A;  3TP0 A;  3VB2 A;  4BJT A;  3S14 J;  1DU6 A;  1YI2 I;  4HNU A;  4BAY A;  1VZ0 A;  3QOD A;  5EEH A;  4GYG A;  3P7N A;  5D8K B;  4RGU A;  2IA2 A;  1E3H A;  3MCZ A;  2QEX I;  1QVU A;  4ETS A;  2JTV A;  1X1D A;  3HGG A;  2HVR A;  2R5Z A;  3H9J A;  3WTY C;  4AWX B;  4WK8 F;  2B9S A;  2HZT A;  2FA5 A;  5BS6 A;  3HSE A;  3F8M A;  4FHT A;  4U7B A;  3GXO A;  4XOT A;  3VYR B;  4PJJ A;  1X2M A;  1X1P A;  2XPU A;  3PFY A;  4A5N A;  3LQR A;  2EIL H;  3M7G A;  1JUM A;  1U5T B;  1S7O A;  3M8F A;  3OYG A;  3ASO H;  1YJN I;  2NS7 A;  1N25 A;  2H8R A;  2IP2 A;  1V54 H;  3DU5 A;  5KCM A;  4CCM A;  1WGX A;  2AO9 A;  1TWG J;  2LRE A;  1GVD A;  1J5Y A;  2KLO A;  3A01 A;  3H5A A;  1K4S A;  2EFN A;  2CW8 A;  4BE2 A;  3FXR A;  1XSD A;  4DIQ A;  1A35 A;  1MJA A;  1LE8 A;  3HOW J;  1P92 A;  3V8K A;  4CYD A;  1D8J A;  4F92 B;  3GX4 X;  4MO7 A;  3QYE A;  3CCU I;  3HJE A;  2KZG A;  1QA6 A;  2CYY A;  1IRF A;  2HQR A;  5J4V A;  2VXZ A;  3N05 A;  1U8R A;  1PVE A;  1TBX A;  3RKW A;  4CXF A;  3BTI A;  2GIV A;  4ZZD A;  1ORK A;  3BJ6 A;  4HZF A;  2IA0 A;  2EFO A;  5GPA A;  3LSH A;  4DJA A;  2WAF A;  5CKT A;  3AG4 H;  2XAF A;  2J5P A;  3LSP A;  4G12 A;  2GAU A;  5E1X A;  3L1P A;  3HKZ A;  4XOR A;  3OYJ A;  3L2W A;  1P7I A;  4L9N A;  4RS8 A;  4W97 A;  1KQ0 A;  3F21 A;  1TWC J;  1KGS A;  2V1X A;  2IAI A;  2UUZ A;  1T0F A;  3DEE A;  4XMY A;  5GTI C;  4IPA A;  3M1E A;  3K2Z A;  1WHU A;  1CF7 A;  1OMI A;  4F7Z A;  2IEK A;  3TOB A;  2DDA A;  5HLI A;  5AIQ A;  3NAR A;  3PSI A;  4XBF A;  3BG5 A;  4RB0 A;  2DFH A;  1BW5 A;  1ODD A;  3WE3 A;  1Y1W J;  1V5F A;  1XMK A;  3F6V A;  4BY7 J;  3G73 A;  4XID A;  1BC8 C;  4CDG A;  3TO6 A;  5GAD J;  5D4S A;  3NRV A;  1G2H A;  1BOB A;  4HV5 A;  4XRS G;  2ZME A;  2WY7 Q;  2B63 J;  2IS6 A;  4AVP A;  2CQQ A;  3CUQ C;  3OY9 A;  3HOX J;  3FIS A;  3G1L A;  3RKQ A;  1IN4 A;  2LYC A;  1ZGJ A;  3ZQG A;  3J7A O;  3DWL E;  1JJ8 C;  5TIS C;  2VI6 A;  4M3B A;  2VOD A;  2R5Z B;  3MKY B;  2WA0 A;  4WCG A;  2JJ7 A;  2VXD A;  1N78 A;  3RIR A;  1SD6 A;  2QSH X;  3MKW B;  1K61 A;  3JRI A;  4HG2 A;  3S2W A;  3V4G A;  1WH7 A;  2OUM A;  4J00 A;  1H0M A;  2R7T A;  2VBZ A;  3BG6 A;  4DZJ A;  1PP7 U;  3CME I;  3S1R J;  3GWZ A;  4ZYE A;  4ENJ A;  1T95 A;  1IRG A;  4ABZ A;  1LQ1 A;  2ZJQ F;  3CUO A;  2JA5 J;  2IS2 A;  1R1U A;  3ZQQ A;  5FD5 A;  2XGC A;  3ZQH A;  1SMY F;  1O3S A;  2LLK A;  3KEO A;  2MD5 A;  2YUS A;  2L02 A;  2I5U A;  3GVA A;  1RR7 A;  4CCK A;  2LC2 A;  2PEX A;  3FMQ A;  2W48 A;  3D5L A;  4BXU A;  3ZOB A;  1LFU P;  2W25 A;  3I59 A;  3PNY A;  1FBU A;  5CVU A;  3TQN A;  2R7R A;  2LR8 A;  3HPH A;  2QA4 I;  1ZHF A;  1B72 A;  3V42 A;  2FRH A;  1IG7 A;  5ERI A;  3K4C A;  2L9N A;  1RZ4 A;  4KIG A;  2OTJ I;  3IC7 A;  4F91 B;  1D1A A;  5GTH C;  3AAF A;  2KJC A;  4HX4 A;  1HBX G;  4EAT A;  2A05 A;  2DMU A;  2F5E A;  3PSF A;  2O61 A;  1RPW A;  2EV0 A;  4I09 A;  1HDP A;  1V5G A;  2QLZ A;  5CYV A;  1S7A A;  2IXS A;  4U7D A;  2CUJ A;  3DTK A;  4ASN A;  3PO3 J;  4E7L A;  4UUV A;  1BBY A;  2NNN A;  1D5V A;  2ESN A;  5B5E C;  2IW5 A;  1Z0X A;  4ESB A;  5FB2 A;  1E3O C;  2F4O B;  5IYB J;  1XMX A;  1YX3 A;  3BR0 A;  1X1C A;  1HST A;  5F6F A;  1CF7 B;  2LVS A;  4PSW A;  3VOD A;  4EVI A;  1QRY A;  5GAH J;  2HQA A;  1X58 A;  2UXX A;  2VQL A;  3W6J B;  3LOC A;  5K5O A;  3H92 A;  3WU0 A;  4BQO A;  5L3F A;  1YYV A;  1KQ8 A;  3KLN A;  5EEA A;  4KFC A;  4A3C J;  2H1K A;  4KIS A;  3T0Y A;  5J8F A;  2BVM A;  2EA2 A;  2CJJ A;  1IDZ A;  2ZME B;  4AUX A;  2JA7 J;  3RQ4 A;  5CLS A;  2DA6 A;  1YOV B;  1LEA A;  1NH3 A;  2E2I J;  1IGN A;  3S32 A;  4LMY A;  4XLF A;  1FX7 A;  2MD0 A;  4LB6 B;  2DFF A;  2A6E F;  3LSR A;  2IS4 A;  1G3S A;  4WWC A;  4IRG A;  1D3Y A;  4D5F A;  1HKS A;  2CUF A;  1MSF C;  2Q2E A;  3I54 A;  3OS0 A;  4UV8 A;  4RGX A;  1OCP A;  3AL0 B;  3DKY A;  2B0L A;  4MTD A;  1FOW A;  3K4N A;  3IKV A;  3F8N A;  2JUC A;  1GUU A;  4M6V A;  5FFX A;  2ETH A;  5IYC J;  2O03 A;  4A12 A;  3K1M A;  2VPR A;  3SFI A;  2L2O A;  2E1M B;  2DTZ A;  2BHZ A;  3LMM A;  4OWR B;  1P9Q C;  1YJW I;  2CQN A;  5DTD A;  1GXP A;  2OJE D;  3PQJ A;  2BOL A;  3GLL A;  1IDY A;  2HYF A;  2HKX A;  2VT2 A;  2NVU B;  3C2G A;  4NHJ A;  2R92 J;  5C4J J;  2PMU A;  1R22 A;  3W3C A;  2COM A;  2QYO A;  2PX9 A;  3Q0W A;  1Z3Y A;  2HNH A;  3L09 A;  1YIO A;  1U9O A;  4XKW A;  1H9T A;  1YHQ I;  1FZP B;  4CZC A;  2CMP A;  1B6A A;  2V6E A;  4RB1 A;  4PUS A;  4XSZ F;  4DNC A;  4LLG F;  1IV6 A;  1MBG A;  3GZ5 A;  5ICC A;  4YII A;  3TKY A;  3BZK A;  4RAG A;  5K5Q A;  4II2 A;  1U2W A;  5B66 C;  2QBY B;  2YU9 J;  2VBW A;  4BH9 A;  4E7Z A;  3TED A;  4AYB A;  3LQQ A;  1Z91 A;  3FMS A;  2A6H F;  5M5Y J;  2FOK A;  4A69 C;  5TRD A;  5E3M A;  3CO6 C;  1PP8 F;  1MMN A;  4XLP F;  1TNS A;  2C6Y A;  1WI3 A;  4JX4 A;  1X3U A;  2VJJ A;  2FU4 A;  2VIX A;  3O6B B;  3HG9 A;  4BGD A;  2ZNY A;  2HVS A;  5DCM A;  1HF0 A;  1B9N A;  3JW4 A;  5FLX Z;  2O5R A;  1UCR A;  3FKJ A;  3L2C A;  4PGG A;  5F1R A;  3GFL A;  3SYT A;  4YEJ A;  1FBQ A;  4UVA A;  2CQX A;  2Z3Y A;  3V8J A;  3CJN A;  5DS9 A;  2PFB A;  4UHT A;  4A6D A;  4BBR J;  2LKS A;  1Q1H A;  2Y30 A;  4PDK A;  5DD4 A;  2OCC H;  3E1S A;  4IRH A;  3JAM Z;  4E7S A;  2OD5 A;  4G6D A;  1SC7 A;  2A6T A;  5F04 A;  1BJA A;  2ADU A;  2PLY A;  3GW2 A;  1KQ9 A;  2HYJ A;  3BR5 A;  5E3N A;  2R0Q C;  4IOA F;  2FSW A;  2O7O A;  2Q8K A;  4ZZL A;  2V9K A;  4BHP A;  3WTZ A;  4F93 B;  3M3Y J;  1YIT I;  2DOE A;  3NWS A;  1JT6 A;  4A3I J;  1LDJ A;  1DDN A;  2BZT A;  1ETW A;  1V3F A;  1IXR C;  2KIM A;  1H8A C;  2DN0 A;  5LLQ A;  5J8C A;  3U21 A;  4LIV A;  3MZY A;  4A3E J;  4L0Y B;  1DUX C;  4IRI A;  1RR8 C;  3Q9S A;  2R7U A;  3BG9 A;  4KIC A;  2UXN A;  4HV6 A;  5HNH A;  3SDG A;  1RI7 A;  4HST A;  3RKY A;  3TDU C;  2DO7 A;  3QOP A;  2LF7 A;  4Q4Z F;  1UJ8 A;  2V6C A;  3RTR A;  4IHY A;  2L9V A;  2HOS A;  4M71 A;  1OYY A;  2OV7 A;  3P5J A;  2DK8 A;  2GXB A;  4BXF A;  3GYH X;  3HUG B;  2F5D A;  3CDH A;  4B4C A;  4M3G A;  2FOW A;  3HHG A;  4S05 A;  3B02 A;  4YFK F;  3FXK A;  2LSO A;  3TP3 A;  2FBI A;  5J3L A;  3HOT A;  3QYF A;  3FM3 A;  2JWT A;  4B48 A;  4JX6 A;  2JPB A;  4Q48 A;  5KAI C;  5HOO A;  1MJB A;  5IOZ A;  3ZRG A;  4D7M A;  4WF2 A;  3KYL A;  3K4L A;  3G71 I;  2WBM A;  2R7O A;  1TW2 A;  5CVV A;  1YIJ I;  1T0F C;  2PJP A;  1B9M A;  3CMA I;  2R4G A;  2CSO A;  4EGZ A;  3BDD A;  5B3S H;  3BZC A;  2JUG A;  3TBI A;  3FHZ A;  2VB6 A;  2Q1Z B;  4GXO A;  4QSH A;  1R58 A;  1FOK A;  1S3J A;  2GA2 A;  2HQ5 A;  2OCE A;  3BJA A;  3BG3 A;  2R7S A;  1ON1 A;  2YU3 A;  2XKP A;  3E6B A;  5F0C A;  2DT5 A;  2TCT A;  4YIF A;  1FT9 A;  5BPI A;  2QVO A;  2EIJ H;  4CH7 A;  3E7L A;  1FMW A;  5BMZ A;  1XG1 A;  2OPT A;  1MKM A;  1HDD C;  4M9S A;  1JHF A;  3UR3 C;  3HXL A;  1K83 J;  3SFZ A;  2EZH A;  2F4M B;  1HLV A;  3BP8 A;  1WFX A;  4B09 A;  4ENK A;  4X6A J;  3H35 A;  4HDV A;  2WB1 N;  3D0S A;  2JA8 J;  1Z6T A;  2RGV A;  1SVL A;  5DV5 A;  1STZ A;  2MG4 A;  3W6V A;  1MSE C;  2DT7 B;  3UKG A;  3DU6 A;  4BY1 J;  3OYK A;  2CO5 A;  2VT3 A;  5EJC A;  3GTO J;  2E1M C;  3DBR B;  3CCM I;  2YR2 A;  2HR3 A;  3JSP A;  1I1G A;  1B59 A;  2QKL B;  3A1Y A;  1LFP A;  3I3L A;  2M0M A;  2ZFW A;  4C30 A;  1E0E A;  2MBF A;  2M8E A;  5L3G A;  1KU7 A;  2OC6 A;  5IT3 A;  3OSF A;  2EZI A;  4WXD A;  4HLY A;  3HSF A;  1VQ4 I;  1SFX A;  4UUS B;  5HDK A;  5HS8 A;  1LPQ A;  2YSR A;  1AKH A;  4XIC A;  1K79 A;  1MIJ A;  2LK2 A;  3Q0V A;  4ZYD A;  2DDB A;  4WXH A;  4I01 A;  1K78 A;  4XR6 A;  4EGY A;  2X1D A;  3F9K A;  4Z6Y A;  5LEK A;  1OCT C;  2O8K A;  1U78 A;  2A3S A;  2ME0 A;  2MH2 A;  1TC3 C;  4XLH A;  3QP5 A;  3KP4 A;  3H3V K;  3FMR A;  5CVJ A;  1RNL A;  4GRI A;  4FAS D;  1D1B A;  3LAJ A;  1SAX A;  1Z05 A;  2OAZ A;  2VKH A;  2GA1 A;  5D8L B;  2KQR A;  5B1B H;  1HOM A;  4XKV A;  3M4O J;  5TJJ A;  1I3A A;  2DA3 A;  1P4A A;  1YTY A;  2FX0 A;  4BQN A;  3RI4 A;  1G3T A;  3ZCO A;  2EPF A;  4GO1 A;  2Y75 A;  4B8X A;  1VQN I;  2JRM A;  4PGH A;  2KIQ A;  4QPO A;  1LUJ B;  2DOA A;  2W84 A;  1USS A;  2HXO A;  2HXI A;  3OL3 A;  2VE8 A;  3R0A A;  4I02 A;  2CGP A;  5IYD J;  4GDF A;  1CGP A;  2ZJR F;  2RAE A;  1D5Y A;  1WJF A;  3F6O A;  2H94 A;  1ZRF A;  1BOA A;  2XF6 A;  4I76 A;  1U5T A;  3W2V A;  3FHN A;  1MMD A;  2ID6 A;  4KJZ A;  3MKZ A;  3DQV C;  2BEO A;  4A3K J;  5F0F A;  4NC6 A;  2JPC A;  4I99 C;  3BR3 A;  2E7W A;  3WGG A;  3RYP A;  1YFH A;  2DFI A;  1HKQ A;  1Q1V A;  2KZV A;  3QAH A;  3JRE A;  3HOS A;  2ZB9 A;  5J40 A;  1XC5 A;  1T39 A;  1ETX A;  2UV1 A;  1MBJ A;  2A61 A;  3FZV A;  2VUM J;  2KRC A;  3S16 J;  3BR1 A;  3L2U A;  1L0O C;  4U0V A;  3I71 A;  1KA8 A;  2ZXI A;  4C2U A;  2ZXJ A;  2MA3 A;  5EZG A;  1EF4 A;  5KNL A;  4MTE A;  3J81 Z;  2E7X A;  3VSK A;  2Z9O A;  3ERM A;  4A0Y A;  3IAS 2;  1SD4 A;  4IXA A;  4E7K A;  3EYI A;  3F23 A;  9ANT A;  3CLQ A;  2HTS A;  1FOX A;  1YW8 A;  3FDY A;  3WU2 C;  4KN7 X;  3DPU A;  2HYG D;  3E5Q A;  2XKO A;  2DJI A;  2NS8 A;  4OIN F;  2XSD C;  1T08 B;  3S1Q J;  3M1C A;  2JA2 A;  2L7Z A;  3HPG A;  2FBH A;  2M0C A;  4EJT A;  1VFC A;  1VTN C;  1W0U A;  2L7M P;  3HGY A;  2NVY J;  4RAZ A;  4PJN A;  3HKZ N;  3EYY A;  4RBO A;  5HS7 A;  3FXM A;  1EH6 A;  2LDU A;  2EB7 A;  2LTP A;  4HPQ A;  4RGS A;  2XGD A;  3BTC A;  5BOX A;  3S1N J;  1K78 B;  1NG7 A;  4E7J A;  2E36 A;  1XDU A;  3CMM A;  2DLL A;  4LOC A;  5IOY A;  2ZXW H;  1UB9 A;  1I50 J;  3Q9V A;  3R6S A;  4KNY A;  2P81 A;  2NYX A;  3I56 I;  1X1B A;  2L0K A;  1FOY A;  2EZK A;  3OIO A;  3CLO A;  3J80 Z;  3WHB A;  1XGO A;  5EZH A;  2EFQ A;  4II3 A;  2WAE A;  4L18 B;  4XLC A;  5K7Z A;  1FTZ A;  1UG0 A;  1KYZ A;  1TWH J;  3REO A;  5JVG F;  2K9S A;  4ZTJ A;  2WV1 A;  1T33 A;  3IKT A;  4PSX A;  1YG2 A;  2JVG A;  2P5V A;  3IAM 2;  5EF6 A;  2PG4 A;  1IRZ A;  1A6I A;  1IJW C;  5EYR A;  4RLQ A;  3CDI A;  3U2R A;  3QP6 A;  5H6R A;  3JRH A;  2I8D A;  2QQB A;  4M9Z A;  2NXN B;  3AG2 H;  4FE4 A;  1GV2 A;  4D5C A;  1DP3 A;  1KU3 A;  5H2F C;  4MLO A;  1YE9 A;  1TQP A;  1WPK A;  1R9T J;  1MMS A;  2M4G A;  3S3M A;  3D1N I;  4A0Z A;  3L7W A;  3JSO A;  4UY8 I;  3MMY B;  1S29 A;  4EJW A;  5LGT A;  4OIQ F;  1U6G A;  4G94 A;  4H4K C;  3LNQ A;  2LY9 A;  2UZK A;  2HQN A;  5D6E A;  2L54 A;  3ASN H;  1WJD A;  5LFA A;  4XLE A;  1XCB A;  1N75 A;  4YG2 F;  4N4N B;  5DEQ A;  3KP3 A;  1MBF A;  4A3M J;  2V26 A;  1VQ8 I;  2TRT A;  3K10 A;  1RES A;  3KYC B;  4D7N A;  2FQ3 A;  3G3Z A;  2L5Q A;  5IT9 Z;  5KAF C;  1BM9 A;  4FX0 A;  3I58 A;  3LA2 A;  1ZG5 A;  2PI0 A;  3BR6 A;  2GZW A;  3ZQI A;  1XSX A;  2BGC A;  2K02 A;  3K4K A;  4I2O A;  5D4R A;  5F08 A;  3CJT B;  4CIC A;  4ON0 A;  5J4Y A;  3TW6 A;  2EV6 A;  4BQQ A;  1A31 A;  1Y1V J;  3PIO F;  2B7E A;  3CES A;  2DW4 A;  1YLF A;  1ETQ A;  3VYU B;  1BW6 A;  4EM2 A;  5F1J A;  2VQG A;  1E17 A;  1ON2 A;  4U0W A;  4ENN A;  1D1C A;  1QPM A;  3R4K A;  4FET A;  2K3P A;  5HLH A;  1EA3 A;  3HBL A;  3T5X A;  1XB4 A;  1ZH5 A;  4A3L J;  5ICF A;  2Y9Z A;  5M3F J;  2HVQ A;  4YEL A;  1W36 D;  2FEZ A;  4AID A;  2HEO A;  3S15 J;  1O3T A;  2VOP A;  3PNT A;  4PFP A;  4EM1 A;  1BR1 A;  4DYQ A;  3BC8 A;  1B4A A;  1SMT A;  1MH4 A;  5F0H A;  3J81 K;  4MNU A;  4CCL A;  4RAF A;  3DEU A;  4Q5S F;  2JA6 J;  3BQZ A;  1K6O A;  1R36 A;  1UHS A;  2KKO A;  2W57 A;  3GO5 A;  1RKW A;  2IVM A;  4AU7 A;  4BDY A;  2M45 A;  4B44 A;  2K85 A;  3S17 J;  1OJL A;  4S04 A;  1ZYR F;  1TTY A;  2P5K A;  3DP7 A;  1R5H A;  2KDZ A;  4IEJ A;  1OCR H;  2KP6 A;  4IKF A;  2R93 J;  2Z33 A;  4ZTF A;  4PFO A;  4UUT A;  3VPR A;  1WVR A;  4MQV A;  2NOJ B;  5JR3 A;  3JCU C;  3MEX A;  2E1N A;  4RLF A;  4MHG A;  3WG7 H;  3JRC A;  1Z77 A;  4DZP A;  1BA5 A;  4Y17 A;  1W5T A;  3ZP5 A;  1QZE A;  2E5N A;  3OS1 A;  3KFW X;  1TT0 A;  5FKL A;  1G3Y A;  1OYI A;  3SJM A;  2GQQ A;  4D1Q A;  4L0Z B;  3J80 K;  4CGZ A;  3BOQ A;  3TO7 A;  4OIO F;  2MW8 A;  1P4W A;  1O3Q A;  4G6T B;  1APL C;  1IF1 A;  3BTJ A;  5K7H A;  1UST A;  1Y6I A;  4ESJ A;  3L00 A;  4ZYA A;  2QBY A;  4DBR A;  2HZD A;  3VSL A;  2WY8 Q;  2DMQ A;  2DMP A;  2LMD A;  1QVT A;  4CCJ A;  2O0Y A;  1FBS A;  5IP7 J;  3N97 A;  2CV1 A;  1F1Z A;  3OSG A;  4DW6 A;  5LHI A;  1NK3 P;  5KVR A;  2GBY A;  2JQ7 A;  2LF8 A;  1T6S A;  4ZC3 A;  2FML A;  1QNT A;  3IH4 A;  1JUS A;  4P5O A;  4J19 A;  2XAU A;  2CFX A;  1X19 A;  4E6K G;  5J1Y A;  2K9N A;  3X2Q H;  1VQK I;  1JKO C;  4X1E A;  1I6X A;  5FO5 A;  2CU7 A;  2M8G X;  2KL4 A;  3O8H A;  1QQI A;  2RNG A;  4Y15 A;  1K6Y A;  3DLA A;  2M30 A;  3SDB A;  4CCN A;  3QPH A;  3U1K A;  3E5X A;  4OMZ A;  4D0P A;  3CJR B;  1BI3 A;  3FXL A;  3KEQ A;  2KRF A;  5M5W J;  2F5C A;  2GOM A;  2HFH A;  3OL4 A;  3L9F A;  3QPL A;  1JHH A;  3K4B A;  1MNE A;  1IO2 A;  2CW7 A;  3BPV A;  5J1R A;  2VJI A;  4S0H B;  4F55 A;  3W2A A;  5ED4 A;  3M8E A;  3ML6 A;  1I3Q J;  1DGR M;  2DMT A;  1UZC A;  4Y7N J;  1F9N A;  4YRV A;  2VKE A;  3SXY A;  1YX5 A;  3CCY A;  3ABM H;  5DM6 F;  3CCE I;  1UHW A;  1FWZ A;  4KMF A;  2EV5 A;  1FPQ A;  2CG4 A;  4XM3 A;  5F64 A;  5JI6 A;  1WJB A;  2IGK A;  3V7R A;  2D45 A;  2DJN A;  1RRJ A;  2BVL A;  1R00 A;  1REP C;  2TDX A;  3HHH A;  3ZPL A;  4AIH A;  5KHD A;  2RDP A;  3ZMZ A;  4BU2 A;  2DOF A;  1U5T C;  4F3Q A;  1HQC A;  3GZN B;  2STT A;  4XLA A;  2Z2S B;  4J01 A;  4KMU X;  2X9D A;  4BHB A;  1E2X A;  1XTA A;  3KIO A;  5D5X B;  5HDG A;  1X4P A;  4HNV A;  1FIA A;  3QU3 A;  2P4W A;  2ZBK A;  2F5V A;  2A5W A;  3DTE A;  4HSR A;  1ZN2 A;  1WJA A;  3JRB A;  4LG0 A;  4MIM A;  3HUG A;  1JI8 A;  2OF7 A;  4HNT A;  1O3R A;  3BTL A;  4A5M A;  4MGR A;  5D6F A;  2PN6 A;  1LJ9 A;  2QF7 A;  2E2H J;  2EIN H;  4BJ5 C;  3ECH A;  3LAP A;  1HA8 A;  5A2Q Z;  2QM3 A;  2RRE A;  3Q3S A;  2VC1 A;  2XUB A;  1ZR2 A;  4G7Z F;  2ICW G;  5FRO A;  4P9F A;  4OAZ A;  1EV7 A;  1PUF B;  1POG A;  2STW A;  4HF1 A;  1J7K A;  1IRX A;  1MDM A;  2ESH A;  4ITV A;  3F8B A;  1ULY A;  1TWF J;  3C1D A;  2MH9 A;  4LIU A;  1RUN A;  1U8B A;  3RYR A;  4WXC A;  4ZYH A;  4M74 A;  4D9J A;  1KU9 A;  5K1Y A;  2WAQ A;  4PJ0 C;  3L2Q A;  2F5F A;  1WSU A;  5FJ8 J;  4O6J A;  2GLO A;  1ETO A;  2ISY A;  5E3L A;  3ESW B;  4CO8 A;  5LD2 C;  2R5Y B;  2V1N A;  2JT1 A;  2CUE A;  2MLG A;  3K1P A;  2QSG X;  2ISZ A;  2OBP A;  2A07 F;  3D5R C;  4MEY F;  1WCM J;  1YQA A;  2ZCW A;  1QZY A;  1SVO A;  3JRF A;  1HW2 A;  1VQ9 I;  3KX2 A;  2VBY A;  2I10 A;  3VYT B;  1FYK A;  3ZN1 A;  1R4N B;  2RN7 A;  3MFK A;  4P96 A;  2BHY A;  2GXG A;  2IGO A;  1FLI A;  4R1H A;  1G3W A;  3I55 I;  2OZ6 A;  1TNT A;  2AQE A;  3ISP A;  3K4M A;  3HIF A;  1L3L A;  1RIO H;  1OCZ H;  3BG7 A;  2W82 A;  4BDZ A;  3P9K A;  2Y0S A;  1D0X A;  1MW7 A;  4RB3 C;  2NS0 A;  1YS7 A;  1YS6 A;  1YO5 C;  3S2H J;  3E6C C;  4HLX A;  3EPZ A;  1ZLK A;  4IHT A;  2PJR B;  3MWM A;  4EJU A;  3G1O A;  1T38 A;  2XF7 A;  3GUD A;  1NTC A;  1IC8 A;  3KLO A;  2BW3 B;  3AKZ A;  5EGO B;  2KFD A;  1OCO H;  3BZ6 A;  4XLN F;  1LEB A;  2K4B A;  2K7L A;  4KDP A;  1GV5 A;  5B1A H;  4UUS A;  1I5Z A;  4B43 A;  4LG0 B;  1KZH A;  3I53 A;  1MJ9 A;  2RQP A;  2GOX B;  2Z5U A;  4EV0 A;  1J0R A;  4CYC A;  1BI0 A;  3ERE D;  2BY2 A;  2RVC A;  3IL2 A;  2R7F A;  3ZQL A;  1O4X A;  5HS9 A;  2XPW A;  3Q0U A;  4A6E A;  2AHQ A;  3GFM A;  4ENM A;  4BAC A;  2V1U A;  3CC4 I;  2MLK A;  1J09 A;  1DGW Y;  1ONV A;  4MQ9 F;  4BE1 A;  1X1A A;  3OR1 C;  1F43 A;  2H8W A;  1FY7 A;  1R6R A;  2EJR A;  3M9A A;  4A3F J;  2DPU A;  3CP8 A;  5ICE A;  1JXS A;  3K69 A;  2EH3 A;  2DAO A;  1FYL A;  2L4A A;  4N9I A;  3FK6 A;  4XSX F;  4BUP A;  3S1M J;  2IBD A;  2QUF A;  4KN4 X;  3JRG A;  4Q47 A;  1MDM B;  2V1D A;  1V5E A;  3OYH A;  3P9I A;  1BI1 A;  3JTG A;  2P6T A;  1XMA A;  3VDX A;  1Z7L A;  2PMZ A;  3J7Y J;  1ETY A;  4O5V A;  4QLC U;  2K3F A;  3OOU A;  2BBY A;  2XGX A;  1IUF A;  2ZME C;  2DA5 A;  5EDN A;  2F6C A;  2QZ8 A;  2X6X A;  3UNG C;  3C18 A;  4LGW A;  4L9J A;  2BV6 A;  4HX8 A;  4H0E A;  1TZL A;  2P5L C;  4G9Y A;  2HI3 A;  3RPU A;  4QPQ A;  4NNJ A;  3CCV I;  2CQ7 A;  4BYY A;  2F2E A;  1B8I A;  3RZO J;  5FRM A;  4C9Y A;  2O9L A;  2VON A;  3AL0 C;  1IN7 A;  1BI2 A;  3SQN A;  1LVA A;  5CVR A;  5A2Q K;  3LSG A;  4MEX F;  3LSJ A;  2W24 A;  2K86 A;  3RPU D;  4UB6 C;  3QRF F;  2M3A A;  3EQL F;  2QCO A;  5EG0 B;  3C3W A;  1BR2 A;  4HF2 A;  4A93 J;  1ZRC A;  1UG2 A;  4JX5 A;  2VQC A;  2WC2 A;  5FLX K;  2YPR A;  4BQA A;  3VFZ A;  2NRA C;  4A2U A;  1JE8 A;  5FLM J;  4P55 A;  3MQ0 A;  3FXJ A;  2XHK A;  1Z1D A;  2XAH A;  3HM5 A;  4NQW B;  4EEF G;  1WQ2 A;  3WE2 A;  2MC4 A;  1FP1 D;  1YRN B;  5AIP A;  5ILS A;  3DBH B;  3ZXS A;  3FWE A;  2XVC A;  4GCV A;  4UXN A;  1PYV A;  1RC9 A;  4M73 A;  4E70 A;  3DLL F;  2Y69 H;  6PAX A;  3JAM K;  1BC7 C;  4JOM A;  5CQE A;  1DU0 A;  1WJ5 A;  3BRO A;  3HRS A;  5HVQ C;  3WOD F;  3ABU A;  3IWZ A;  4KIT B;  2GWR A;  4CYC B;  3WTT C;  3SZG A;  5DCF A;  2E34 A;  1ZAR A;  5DDG A;  3QU6 A;  3LFK A;  4B47 A;  4FX4 A;  2W00 A;  4E4H A;  4L9T A;  3A4C A;  4JQF A;  4R8H A;  3PUF A;  3JRA A;  3E5U A;  4O3M A;  1FP2 A;  5FRN A;  3MKL A;  1QHH D;  1YW9 A;  3SZT A;  1LNW A;  4XL9 A;  2H6B A;  5CPR B;  4FT8 A;  1GXQ A;  2ZJ2 A;  2KIS A;  2LKX A;  5J1U A;  4I7H A;  5DD8 A;  3MN2 A;  2HKO A;  2ME6 A;  2P7V B;  5GAE J;  3J7Z I;  1TT5 B;  1WI9 A;  2P0W A;  2WAD A;  2IGM A;  3L2V A;  1TW3 A;  4XKB A;  3G2B A;  4HA8 A;  3DPT A;  4DOZ A;  1T2K A;  3FXQ A;  1X3Z B;  1R4M B;  4IL6 C;  1X4O A;  4FE7 A;  2LBF B;  1VQO I;  4R79 A;  2XRN A;  2M5W A;  2E1C A;  2DMN A;  5L3D A;  5C3E J;  1RET A;  1UHM A;  1WRJ A;  3CUQ B;  2EK5 A;  3NEU A;  1QO0 D;  2XDV A;  4ZYG A;  1AOY A;  2OA4 A;  2G7H A;  5BPD A;  4RDU A;  3G1M A;  3KZY A;  2DYS H;  3FXU A;  4XRS A;  1R1T A;  2K5C A;  2LH9 A;  3HOY J;  2ZXH A;  2BY3 A;  4BL0 B;  3QYB A;  1FTT A;  3O3K A;  3EUA A;  4L5J A;  4QWQ A;  4B1R A;  2R7W A;  1B8I B;  1A5J A;  2XSJ C;  1JTY A;  4BE0 A;  3CF2 A;  2LKP A;  2RNJ A;  2HWV A;  2AS5 F;  4XQF A;  1XSV A;  4ANJ A;  2L7F P;  4UVB A;  1BIB A;  1Z6R A;  2XGE A;  4LLL A;  1X3W B;  3AG3 H;  1ETV A;  2ELH A;  2JVH A;  2W4S A;  3R60 A;  2FE3 A;  3OYL A;  3H0D A;  3U1D A;  1JTX A;  5E3O A;  4GYI A;  4IX7 A;  2J5O A;  4HW0 A;  1OCC H;  1S8N A;  2R7Z J;  1T98 A;  2HPM A;  3ABK H;  2FNP A;  2LY2 A;  2V7F A;  2LNB A;  1I39 A;  3HOU J;  2BXY A;  2ELJ A;  2H09 A;  2O6G E;  3KCC A;  1FEX A;  2X51 A;  3K70 D;  3PJR A;  4I98 B;  1TQI A;  2MAB A;  5H6Q A;  3LSI A;  5DUI A;  3LSM A;  3WTU C;  4IHW A;  3IWF A;  3VWB A;  3H9Q A;  3HZJ A;  3S93 A;  3QPT A;  4FCY A;  4PJL A;  1ZRE A;  3ZR8 X;  3PFI A;  2VJ4 A;  3CC7 I;  1Y8R B;  2CWE A;  3JRD A;  1QGP A;  3GZ6 A;  5LEJ A;  2BE5 F;  1MH3 A;  4WX9 A;  1Y56 A;  1MNM C;  4IVN A;  4YFN F;  2JSP A;  1QPI A;  1OYW A;  3GTJ J;  3GTK J;  1ZKG A;  3OIQ A;  2DYR H;  3K9T A;  2VAS A;  1R71 A;  2E71 A;  1JGG A;  4ZDO A;  3ZMS A;  4AM3 A;  2HDC A;  1GVJ A;  1VF9 A;  1U3E M;  1ENH A;  5F27 A;  2CW0 F;  3KE2 A;  3A0H C;  4UB8 C;  3KP7 A;  2DQL A;  3K6G A;  2W7N A;  3M8J A;  2CV0 A;  3BPX A;  1Z7U A;  3AG1 H;  5JLW A;  1EKE A;  3NWT A;  2XB5 A;  2KT0 A;  2A5Y B;  3TMO A;  5IP6 A;  3AFH A;  1UFM A;  4ZJZ A;  1GLN A;  5M3M J;  2HDD A;  4I0A A;  5IY5 H;  4ESF A;  3KZI C;  1LVK A;  3WGH A;  4LG3 A;  4NBQ A;  1OKR A;  1EJ9 A;  3F0C A;  3HC7 A;  4K2E A;  4LJZ F;  2EWN A;  2E2J J;  3KYD B;  5E8G A;  1D0Y A;  2JMW A;  3S8P A;  4MFD A;  2ACJ A;  2NNY A;  3GTL J;  2JSC A;  5AON A;  5CJ9 A;  5LHG A;  1F4K A;  4BEH A;  5JHU A;  3B73 A;  2VOO A;  2XRO A;  1C0W A;  2O8X A;  3PUB A;  3PM1 A;  4UVC A;  1ACI A;  3LL7 A;  2X48 A;  1ZGA A;  1JKQ C;  4G7H F;  1OIS A;  2EZL A;  2RV8 A;  2M7A A;  5D5U B;  1OPC A;  3ZMV A;  4Y33 A;  3M07 A;  5L3B A;  3IUO A;  4IOC F;  5HDN A;  5LRS A;  1FNN A;  1FSE A;  2PQ8 A;  5L3E A;  2R7X A;  2P6S A;  5HOD A;  1X2N A;  3HOV J;  3DV8 A;  5JFR A;  3PO2 J;  5DUK A;  4EMS A;  1XS9 A;  1QBJ A;  1BN5 A;  2VQH A;  4A3G J;  3I64 A;  3QOE A;  1MBH A;  3WG9 A;  4U88 A;  3V7C A;  2M34 A;  3PL8 A;  1SD5 A;  2HS5 A;  4ZDL A;  4P9U A;  2HOE A;  4KIF A;  1WWX A;  3PNV A;  2Y0M A;  2CRG A;  3CMY A;  2Y48 A;  1VQP I;  3H3U A;  2FQ4 A;  3FX3 A;  1IUY A;  1W0T A;  3BLY A;  3GBG A;  4RA2 A;  1ZK8 A;  4IHV A;  2CQK A;  2R3S A;  2ZC2 A;  3VYS B;  4N9H A;  2XRL A;  1BIA A;  1NK2 P;  2E35 A;  1B1B A;  5IP9 J;  2R7Q A;  4P1W A;  4G7O F;  3OV8 A;  4A3D J;  3DCF A;  3DXJ F;  1BR4 A;  1JT0 A;  1R49 A;  3HL2 A;  2IS1 A;  2EIM H;  1Y0N A;  5K5R A;  1I1S A;  3LA3 A;  4CSW A;  1IN6 A;  1W7P A;  5KK1 A;  2G7U A;  2KJB A;  3DF8 A;  4E7I A;  2E19 A;  3I0T A;  1IW7 F;  1WJC A;  3LST A;  3CZ6 A;  2N8G A;  3PQK A;  3RPQ A;  2KDO A;  2ZSH B;  1W7P D;  3IRR A;  2QQA A;  1DPU A;  3ABT A;  2AXL A;  1SAU A;  1ZRD A;  3C2H A;  1GT0 C;  1R23 A;  1J2X A;  3ELK A;  3GME A;  3CTA A;  4IHX A;  1Z21 A;  1DQU A;  4Y3O A;  2DA2 A;  2QWW A;  1V4R A;  1OR7 A;  1XD7 A;  3TO9 A;  4FQG A;  2YX7 A;  4V19 K;  2RQQ A;  3C7J A;  3FBI B;  2WTE A;  2QQ8 A;  2PMH A;  1R5I D;  4I6Z A;  2FJ1 A;  4BEH B;  3EUH A;  3NQO A;  2K27 A;  3H1C A;  4NC8 A;  4XN3 A;  1NG6 A;  1H88 C;  3CJQ B;  4RGR A;  4BBS J;  1IXS B;  1MZB A;  2W85 A;  2V79 A;  2AXT C;  3E97 A;  5ICG A;  5E17 F;  1OQY A;  3TGN A;  2IA1 A;  1VND A;  4CA0 A;  1IZ1 A;  1KYW A;  1HKT A;  4XN0 A;  2QSF X;  2D1V A;  3MD2 A;  3K7A J;  3A01 B;  1XGS A;  4HOB A;  3HYI A;  2K40 A;  1F36 A;  5LGN A;  3WTS C;  2X6Y A;  4HDU A;  3WU1 B;  1LE8 B;  2ZO4 A;  3IRQ A;  2X6O A;  3I4M J;  1G4D A;  3W2W A;  2KHM A;  4L5E A;  3OYA A;  2Z1D A;  3IP4 B;  3LSK A;  3FKI J;  2Y2Z A;  5GP9 A;  4AYB N;  4M3E A;  3HRT A;  5HNF A;  4IHS A;  4OMY A;  3I4N J;  1N77 A;  1PUF A;  2XPV A;  1W4M A;  4G6Q A;  2XV4 S;  3F8F A;  4Y4R A;  3FM5 A;  4Z2Y A;  2XC7 A;  2NAZ A;  3A2K A;  1TWA J;  4XRM A;  2DFE A;  1Z3X A;  2RC4 A;  3MVP A;  4IF4 A;  4L9V A;  5FKO A;  2CUZ A;  1HW5 A;  1T56 A;  3DEW A;  3W6K B;  2CFO A;  3CCJ I;  3H0G J;  5L3C A;  3RDI A;  3R61 A;  2CS3 A;  1LDK B;  3DKW A;  2D1H A;  2DA7 A;  2R5Y A;  4M9X A;  3RQI A;  2WAQ N;  3E6M A;  3FK7 A;  3T1B A;  1BJZ A;  5LGU A;  2FF4 A;  2GIZ A;  4F52 A;  1QHG A;  2DTR A;  2G0E A;  3DTI A;  1HXD A;  1XDS A;  4PJM A;  1RUO A;  4TV7 A;  1S6L A;  5JVT A;  1W7P B;  2V9P A;  4OAY A;  1BL0 A;  3A0B C;  3WHC A;  5BNG A;  4CZZ A;  4KIB A;  1VQ5 I;  2DU9 A;  5E20 A;  2VBX A;  3GTP J;  5IT9 K;  2XAG A;  5DYM A;  2X6W A;  4ZDP A;  3I4P A;  1MGT A;  1SVM A;  2DCE A;  3LA7 A;  3CCQ I;  2HPI A;  5D5W B;  3DKX A;  4JK1 X;  3OYI A;  3SZP A;  1ZG1 A;  1ZG3 A;  1LB2 A;  4EJO A;  2VE9 A;  2DBB A;  3A03 A;  1SAN A;  3HDD A;  5E79 C;  4UNO A;  4KA4 A;  1MBK A;  3H5N A;  1GHC A;  4LLN A;  5FLV A;  2M1B A;  3GTM J;  3FF5 A;  2Y0S N;  2GXA A;  4YFX F;  1PDN C;  3SEQ A;  2PJR A;  1AA7 A;  2P7C B;  4KT5 C;  1P2F A;  5FKN A;  5GPC A;  2BW3 A;  1MD0 A;  1TQM A;  2MSY A;  4CUG A;  5EGO A;  4CHU A;  3RJP A;  1P6R A;  3OYF A;  1H89 C;  3HB9 A;  2LG4 A;  3HRM A;  2DT6 A;  2X1E A;  4LK0 F;  2MYS A;  2LD5 A;  3KZZ A;  4DYR A;  3S3N A;  2VPL A;  4HX7 A;  1Z9C A;  1P7J A;  1FSH A;  3TDZ C;  2EQR A;  4IQ4 A;  1R5G A;  2W1O A;  2ZFU A;  2R7V A;  1XN7 A;  1U0J A;  1Y0U A;  5ILV A;  2RKH A;  3K70 C;  2HTJ A;  1XPX A;  3QPS A;  2Y9Y A;  2COB A;  4HYE A;  4AD9 A;  1HC8 A;  4OOI A;  4IZZ A;  2DA4 A;  1SD7 A;  1S9H A;  2OZU A;  3ONQ A;  3VEP A;  1SFU A;  3KP2 A;  3I59 B;  4JP0 A;  2V4J C;  1D0Z A;  3IH2 A;  3OYE A;  1B72 B;  2NVQ J;  1ETK A;  4XON A;  4Y13 A;  1IN8 A;  5E1Z B;  3O8G A;  2KMU A;  4G8X A;  2NOG A;  3F8C A;  3CQZ J;  4BHC A;  1K7A A;  2BXZ A;  4M6X A;  3HTS B;  3VOE A;  4U87 A;  1A6Q A;  3J7A Y;  4OU0 A;  4V2G A;  1UEL B;  1UMQ A;  2ZSI B;  4HAM A;  3U9G A;  4RB2 C;  4NC7 A;  1VQ6 I;  2NVX J;  2PBI A;  3DFG A;  3WTX C;  4HRI A;  3SHF A;  1FC3 A;  2DQR A;  2H6C A;  3GFJ A;  3TL4 X;  3G4S I;  3CC2 I;  2MGQ A;  4OIP F;  2PMZ N;  3BQY A;  3K0L A;  1GDT A;  3B6C A;  2O3F A;  5E8I A;  3CP2 A;  4JBA A;  1KU2 A;  3PIP F;  1TL8 A;  1IV8 A;  1E3P A;  1M1E B;  4IO9 F;  3BCA A;  4JYK A;  5FKK A;  1MMG A;  4AC0 A;  4RM2 A;  2F48 A;  4M3D A;  1G59 A;  2ELK A;  4HEA 2;  3HOZ J;  1S7E A;  1SFK A;  2F4I A;  4N4O B;  4ZH4 F;  5LHH A;  3QWL A;  4EM0 B;  3WTW C;  1DP7 P;  2MFZ A;  4KYW A;  3FXO A;  5EG0 A;  1VQM I;  3RKX A;  4XOP A;  2A69 F;  3E0J B;  4HBL A;  2Q2E B;  2ZNZ A;  1SFE A;  2DOD A;  1R7J A;  1VI0 A;  2FD5 A;  3GF2 A;  4GFB A;  5HLT A;  2K4J A;  1AU7 A;  1TLH B;  3K4J A;  5BQT A;  1G8X A;  2R7D A;  2VKD A;  3JTH A;  4NQW A;  4MFE A;  5HLG A;  2XAJ A;  2DK5 A;  3KEY A;  1Y39 A;  1YRN A;  3WGI A;  4W1U A;  1JJ6 C;  4XNF A;  3OR2 C;  1OLT A;  2UWM A;  1IAW A;  4M3F A;  1JKR C;  2ZJP F;  1ZR4 A;  3BJO A;  4LK1 F;  1QZZ A;  4PZJ A;  3CDL A;  2KPM A;  3WTV C;  3GTG J;  1IXC A;  1ZEL A;  3BT9 A;  4NUB A;  2LOO A;  3BR2 A;  1WH5 A;  3C2B A;  5FD6 A;  3LWF A;  1A04 A;  4YIR X;  1G6N A;  2K9M A;  5FKM A;  1PJR A;  4DGW B;  5TGT A;  3P9C A;  2HOA A;  3GEZ A;  2BY1 A;  2DI3 A;  1HW1 A;  2EBI A;  1EH8 A;  3GCM A;  4LFU A;  2E5Z A;  2QKM B;  1FMV A;  2VN2 A;  5CVI A;  4A3J J;  2LFB A;  1O7L A;  4C3H J;  5DM7 F;  3S3O A;  2KIU A;  2OQG A;  1J9I A;  2QEN A;  2A68 F;  4C2M J;  1T8I A;  1XCV A;  3ZMU A;  2JRT A;  2MC3 A;  2X4H A;  3KPH A;  3OYC A;  4BXX J;  2L01 A;  2LBF A;  1W36 C;  1H9G A;  1U9N A;  3O2P E;  1NHA A;  3OYB A;  1HSJ A;  3IHU A;  4PCQ A;  2LP0 A;  2ECC A;  3CUQ A;  3GLX A;  4L5I A;  5DCM B;  3GFI A;  1WKM A;  3KP5 A;  3OMY A;  3MZ8 A;  3OWT A;  5H20 A;  2HU9 A;  3F3X A;  1VQL I;  4I0B A;  5FFZ A;  2HDW A;  3H5R A;  1Z67 A;  3RSN A;  3I9V 2;  4V2F A;  3LFU A;  2L9S A;  2VJ5 A;  3KET A;  3KP6 A;  1P4X A;  4BJ6 C;  4BS9 A;  4LD5 A;  3OIP A;  1ITY A;  4GGG A;  3B6A A;  3OYD A;  1VQ7 I;  2Z16 A;  1SEU A;  1J59 A;  1MBE A;  2OQR A;  4HF0 A;  4U0Y A;  1LKX A;  4RAY A;  3N4M A;  4Y52 J;  3E3V A;  3GTQ J;  3CCR I;  1W5C C;  2VLA A;  1S72 I;  1OFC X;  1O7F A;  5FGM A;  4C3I J;  3OS2 A;  2EFW A;  1OR7 C;  3ZQ7 A;  3F72 A;  2E1O A;  2VC0 A;  2DXI A;  3CCS I;  3HTU A;  2EA4 A;  4FIS A;  4B3X A;  5LBQ A;  3G6E I;  1LDD A;  2L9R A;  1KON A;  2JZY A;  2CH0 A;  2X85 A;  2XB0 X;  3EUH C;  1XGM A;  2FXA A;  3CD6 I;  2WV0 A;  3HEF A;  2IJL A;  3NAU A;  2P8T A;  2V9V A;  2BY0 A;  3ECO A;  1RKT A;  2CV2 A;  2XAQ A;  4OIR F;  1TP4 A;  2EIK H;  5E18 F;  2GM4 A;  2DA1 A;  2YX4 A;  3EDP A;  1UAA A;  1ZLJ A;  3E6D A;  2IRF G;  2D2W A;  3A02 A;  1F5T A;  1J75 A;  5D5V B;  1ZGW A;  2L3D A;  2FBK A;  2KIF A;  2K9L A;  3I5U A;  3HRU A;  4NB5 A;  2G9W A;  1Y8Q B;  5JLX A;  1O57 A;  2LY1 A;  3ABL H;  4N0B A;  2Y31 A;  1I6H J;  4RMN A;  3CCL I;  5M5X J;  4QTR A;  3RZD J;  4FTH A;  1IN5 A;  2BYV E;  4LIT A;  5E1W A;  2YS9 A;  1MMA A;  3BCB A;  1LFB A;  3ZMT A;  2HGC A;  3D5S C;  3H3Z A;  3Q5F A;  4C3J J;  3TW7 A;  3ZN0 A;  2JK3 A;  2WWY A;  3ROU A;  2FUG 2;  1QU3 A;  2ECB A;  2X1C A;  3ZMD A;  2L7K A;  4DQ2 A;  5GAG J;  2QGU A;  3EET A;  4HQM A;  4X0G A;  2IT0 A;  3BY6 A;  4CCO A;  4DBQ A;  1V55 H;  4A3B J;  4IJA A;  4QIW N;  5IPA A;  3MZH A;  1FJL A;  5K7F A;  4XRF A;  2M4K A;  1ERD A;  3JR9 A;  2FNA A;  1SFO J;  1EH7 A;  4BNC A;  2OTL I;  3OYM A;  2M87 A;  3T8R A;  1YW7 A;  3L2R A;  1WJE A;  2WB1 A;  3K2A A;  4KT6 A;  3V7S A;  4KUM A;  4LB5 A;  1ZTR A;  4IQJ A;  3ZQC A;  4C2T A;  5EEG A;  4PK4 A;  1JKP C;  2Q0O A;  4A0X A;  2VL8 A;  2K9Q A;  1YJ9 I;  3EUK L;  2OU2 A;  4AVZ A;  1AHD P;  3FIW A;  2HOT A;  1I27 A;  3HSR A;  1WZ2 A;  3H36 A;  3DPL C;  3IV5 A;  4UV9 A;  3T8T A;  2AQF A;  3V8L A;  2M7B A;  3F22 A;  2ID3 A;  2M2E A;  1DPR A;  1A36 A;  1JUP A;  3R0J A;  2XIG A;  2H27 A;  3OYN A;  1CQT A;  5C4X J;  3BWG A;  1ZAO A;  2VKV A;  1AWC A;  2H1L A;  2X0L A;  4B3A A;  4AIK A;  4E7H A;  3DBL B;  2FMY A;  1XGN A;  1R1V A;  2JN6 A;  2QQ9 A;  2LRD A;  2XAS A;  3SEZ A;  1S5L C;  4RM3 A;  4XKC A;  4EQQ A;  3MAJ A;  1K4T A;  4NDL A;  3ZGK A;  1MND A;  2NVT J;  5C44 J;  4M6Y A;  1HCR A;  2D5V A;  1W5S A;  5CQG A;  3OOP A;  4M72 A;  3H9G A;  5J47 A;  1W1W E;  4XK4 A;  3ZQF A;  1AKH B;  3COA C;  3QQA A;  2EFP A;  3CO7 C;  5JHF A;  3TOA A;  2L4M A;  2M9H A;  1XX5 A;  3CF5 F;  2IGN A; 
#chains in the Genus database with same CATH homology
 2E60 A;  4NC8 A;  4XN3 A;  3RCO A;  1NG6 A;  3CJQ B;  4LIU A;  3FBN B;  2E1M C;  4D9J A;  2WAQ A;  2XF5 A;  4CA0 A;  3L2Q A;  4XN0 A;  3MD2 A;  3OYK A;  2KRH A;  2QKL B;  3A1Y A;  4BJT A;  5LD2 C;  1LFP A;  2X6Y A;  2V1N A;  3I3L A;  2M0M A;  4HNU A;  1VZ0 A;  4C30 A;  3QOD A;  3D5R C;  3W2W A;  1E0E A;  2KHM A;  3OYA A;  2Z1D A;  3IP4 B;  3LSK A;  2OC6 A;  1X1D A;  2HVR A;  3KX2 A;  3VYT B;  3H9J A;  5HNF A;  1N77 A;  2IGO A;  2AQE A;  3K4M A;  4Y4R A;  2XC7 A;  4U7B A;  3A2K A;  4XOT A;  3VYR B;  4PJJ A;  3PFY A;  4XR6 A;  2X1D A;  3BG7 A;  2W82 A;  3F9K A;  4BDZ A;  2Y0S A;  1Z3X A;  1D0X A;  3OYG A;  1MW7 A;  2CUZ A;  4XLH A;  2CFO A;  4GRI A;  3DU5 A;  1D1B A;  2CS3 A;  5KCM A;  4CCM A;  4FAS D;  2LRE A;  1LDK B;  2KLO A;  3H5A A;  2VKH A;  2CW8 A;  3EPZ A;  4BE2 A;  2KQR A;  4DIQ A;  4XKV A;  2PJR B;  2XF7 A;  2BW3 B;  4F92 B;  4BQN A;  3AKZ A;  3QYE A;  1QHG A;  3DTI A;  4PJM A;  3ZCO A;  4F52 A;  4QPO A;  4OAY A;  2VXZ A;  3N05 A;  2DOA A;  3OL3 A;  4B43 A;  2GOX B;  1WJF A;  2X6W A;  4ZDP A;  3LSH A;  4DJA A;  2WAF A;  5CKT A;  2DCE A;  2XF6 A;  2HPI A;  3W2V A;  3DKX A;  3OYI A;  4BAC A;  3FHN A;  1MMD A;  3HKZ A;  4KJZ A;  4XOR A;  3DQV C;  1J09 A;  1DGW Y;  3OYJ A;  3MKZ A;  4BE1 A;  1X1A A;  3OR1 C;  1R6R A;  3H5N A;  2UUZ A;  3CP8 A;  3DEE A;  2KZV A;  4XMY A;  3HOS A;  3SEQ A;  2PJR A;  4BUP A;  1AA7 A;  2BW3 A;  2UV1 A;  4CUG A;  2KRC A;  3PSI A;  1V5E A;  3OYF A;  3L2U A;  3OYH A;  2LG4 A;  2DT6 A;  2X1E A;  2MYS A;  1V5F A;  2ZXI A;  3VDX A;  3S3N A;  1Z7L A;  4C2U A;  2VPL A;  2PMZ A;  5KNL A;  3VSK A;  1BOB A;  4IQ4 A;  2ZFU A;  2W1O A;  2R7V A;  4E7K A;  3IAS 2;  2IS6 A;  2WY7 Q;  1U0J A;  3OOU A;  3FDY A;  3K70 C;  3DPU A;  2DJI A;  2F6C A;  2X6X A;  3UNG C;  3OY9 A;  4IZZ A;  1TZL A;  1S9H A;  2LYC A;  3M1C A;  3ONQ A;  2JA2 A;  3HPG A;  3DWL E;  4QPQ A;  4NNJ A;  2V4J C;  1D0Z A;  3MKY B;  2WA0 A;  3OYE A;  2VXD A;  1N78 A;  5FRM A;  4PJN A;  4C9Y A;  4XON A;  3AL0 C;  2KMU A;  3L2W A;  3MKW B;  4HPQ A;  3LSG A;  4HG2 A;  3RPU D;  2OUM A;  4J00 A;  1NG7 A;  4E7J A;  2R7T A;  4U87 A;  3BG6 A;  3CMM A;  3J7A Y;  2M3A A;  1UEL B;  2ZSI B;  4NC7 A;  1BR2 A;  1T95 A;  4HRI A;  2VQC A;  2IS2 A;  1X1B A;  3ZQQ A;  3TL4 X;  4CCK A;  2LC2 A;  4II3 A;  2WAE A;  4NQW B;  4XLC A;  3D5L A;  2MC4 A;  3ZXS A;  1UG0 A;  3CP2 A;  3PNY A;  1PYV A;  2R7R A;  4ZTJ A;  3HPH A;  4JOM A;  5CQE A;  3V42 A;  3BCA A;  4PSX A;  1WJ5 A;  2JVG A;  1MMG A;  3IAM 2;  2L9N A;  3K4C A;  5HVQ C;  4KIT B;  4RM2 A;  1G59 A;  4F91 B;  1D1A A;  4HEA 2;  1SFK A;  2F4I A;  4N4O B;  4RLQ A;  3SZG A;  4EAT A;  4B47 A;  3PSF A;  2W00 A;  4E4H A;  2MFZ A;  1V5G A;  3A4C A;  2I8D A;  2IXS A;  2CUJ A;  4JQF A;  3DTK A;  4E7L A;  4XOP A;  3E0J B;  1DP3 A;  2Q2E B;  5FRN A;  1QHH D;  4MLO A;  4XL9 A;  5CPR B;  1YX3 A;  5HLT A;  1YE9 A;  1X1C A;  3K4J A;  2M4G A;  4PSW A;  3S3M A;  1G8X A;  2VKD A;  3MMY B;  2HQA A;  2VQL A;  3KEY A;  2P0W A;  2WAD A;  2IGM A;  3OR2 C;  4XNF A;  1OLT A;  4H4K C;  4XKB A;  3L2V A;  2UWM A;  4BQO A;  3G2B A;  5LFA A;  1WJD A;  3DPT A;  4XLE A;  4DOZ A;  4KIS A;  1N75 A;  2KPM A;  1X4O A;  2LBF B;  4N4N B;  2BVM A;  1ZEL A;  4NUB A;  2LOO A;  4R79 A;  3RQ4 A;  2V26 A;  2K9M A;  2XDV A;  3K10 A;  4XLF A;  3S32 A;  1PJR A;  4DGW B;  2MD0 A;  5TGT A;  2L5Q A;  2IS4 A;  2K5C A;  2LH9 A;  2ZXH A;  2E5Z A;  2QKM B;  3OS0 A;  4BL0 B;  3QYB A;  2R7W A;  3EUA A;  3AL0 B;  1FMV A;  3K4K A;  3DKY A;  2XSJ C;  3K4N A;  4BE0 A;  3CF2 A;  4BQQ A;  3S3O A;  4XQF A;  3CES A;  4ANJ A;  3VYU B;  2E1M B;  2L2O A;  2VQG A;  2JVH A;  2W4S A;  1P9Q C;  3LMM A;  4OWR B;  3H0D A;  3OYL A;  3OYC A;  4IX7 A;  2BOL A;  2LBF A;  1W36 C;  1D1C A;  4FET A;  2K3P A;  3C2G A;  2HPM A;  3OYB A;  1EA3 A;  3W3C A;  2LY2 A;  2V7F A;  2HVQ A;  4YEL A;  1W36 D;  1Z3Y A;  2HNH A;  3PNT A;  2ELJ A;  1BR1 A;  4PFP A;  3BC8 A;  3OMY A;  3OWT A;  2X51 A;  4XKW A;  3K70 D;  3PJR A;  2HU9 A;  4CCL A;  2MAB A;  4CZC A;  2CMP A;  2HDW A;  3H5R A;  3RSN A;  2V6E A;  3I9V 2;  4PUS A;  3LFU A;  3LSI A;  2L9S A;  3LSM A;  4AU7 A;  2VJ5 A;  4BDY A;  4B44 A;  4BJ6 C;  4BS9 A;  3VWB A;  3OIP A;  3H9Q A;  3S93 A;  4II2 A;  3OYD A;  4E7Z A;  4PJL A;  2Z16 A;  3ZR8 X;  4AYB A;  2VJ4 A;  1LKX A;  2KP6 A;  4IKF A;  4ZTF A;  1Y56 A;  4PFO A;  1MMN A;  2JSP A;  2VLA A;  3OIQ A;  2VAS A;  3OS2 A;  2NOJ B;  1OR7 C;  2VJJ A;  4ZDO A;  2DXI A;  2VIX A;  3HG9 A;  4BGD A;  2HVS A;  4RLF A;  2O5R A;  4B3X A;  3FKJ A;  2E5N A;  3OS1 A;  1TT0 A;  1KON A;  2CH0 A;  3K6G A;  3SYT A;  2X85 A;  4YEJ A;  4D1Q A;  3EUH C;  2W7N A;  3M8J A;  2CV0 A;  4G6T B;  3NWT A;  2CV2 A;  1Y6I A;  4ZYA A;  3E1S A;  3TMO A;  4DBR A;  3AFH A;  4E7S A;  1UAA A;  2A6T A;  2HZD A;  1GLN A;  3VSL A;  4ZJZ A;  2WY8 Q;  4CCJ A;  2CV1 A;  1LVK A;  2V9K A;  4LG3 A;  4F93 B;  2K9L A;  3NWS A;  3HC7 A;  4ZC3 A;  1D0Y A;  3S8P A;  2LY1 A;  4P5O A;  2XAU A;  4RMN A;  1X19 A;  4BEH A;  4E6K G;  4LIT A;  3U21 A;  4LIV A;  1MMA A;  3PUB A;  3BCB A;  2KL4 A;  2RNG A;  3LL7 A;  3D5S C;  1K6Y A;  3DLA A;  2R7U A;  3SDB A;  4CCN A;  2FUG 2;  5HNH A;  3CJR B;  1QU3 A;  2GOM A;  2X1C A;  2L7K A;  3OL4 A;  2M7A A;  4HST A;  3K4B A;  4X0G A;  1MNE A;  2CW7 A;  4Y33 A;  3IUO A;  4CCO A;  2VJI A;  4DBQ A;  4F55 A;  3RTR A;  3W2A A;  2R7X A;  1DGR M;  4YRV A;  2OV7 A;  1YX5 A;  2M4K A;  1ERD A;  2VQH A;  4BXF A;  3HUG B;  3QOE A;  4XM3 A;  3OYM A;  1WJB A;  3PL8 A;  4ZDL A;  2IGK A;  3L2R A;  3PNV A;  2BVL A;  1WJE A;  2WB1 A;  4KT6 A;  4IQJ A;  3HOT A;  3QYF A;  4BU2 A;  5KHD A;  4C2T A;  4PK4 A;  3BLY A;  3GBG A;  4B48 A;  5HOO A;  4F3Q A;  3ZRG A;  3KYL A;  3VYS B;  2VL8 A;  3K4L A;  4XLA A;  3EUK L;  4AVZ A;  2WBM A;  2Z2S B;  2R7O A;  4J01 A;  2R7Q A;  4P1W A;  1T0F C;  3DPL C;  1BR4 A;  1X4P A;  2R4G A;  2AQF A;  2M7B A;  3HL2 A;  2IS1 A;  2F5V A;  2A5W A;  3TBI A;  2JUG A;  3DTE A;  2Q1Z B;  2VB6 A;  4HSR A;  4CSW A;  3OYN A;  1WJA A;  2R7S A;  4E7I A;  1JI8 A;  4HNT A;  4E7H A;  1WJC A;  3CZ6 A;  2KDO A;  4CH7 A;  2ZSH B;  1FMW A;  2LRD A;  3SEZ A;  4RM3 A;  4XKC A;  4BJ5 C;  3ZGK A;  1MND A;  1SAU A;  3C2H A;  1HA8 A;  3UR3 C;  3HXL A;  2RRE A;  1Z21 A;  1DQU A;  1WFX A;  4Y3O A;  5CQG A;  3H35 A;  3H9G A;  5FRO A;  2RQQ A;  4OAZ A;  5JHF A;  1IRX A;  3FBI B;  2DT7 B;  3DU6 A;  4BEH B;  2IGN A;  4ITV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...