2MD0A

Solution structure of shk-like immunomodulatory peptide from ancylostoma caninum (hookworm)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
NDIRTAADMEHCADEKNFDCRRSLRNGDCDNDDKLLEMGYYCPVTCGFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AcK1
publication title Kv1.3 channel-blocking immunomodulatory peptides from parasitic worms: implications for autoimmune diseases.
pubmed doi rcsb
source organism Ancylostoma caninum
molecule tags Immune system
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01549 ShK ShK domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1940 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2md0A00
2MD0A
chains in the Genus database with same CATH superfamily
2HR3A 1QHGA 2MC4A 4M6VA 2IW5A 2EIJH 1ERDA 1UJ8A 2XPWA 2EFWA 2X9DA 2DMTA 4IPAA 5HS9A 2LP0A 3ZN0A 2HEOA 3IL2A 2UV1A 1OR7A 1XDSA 3CLQA 4A12A 2E2IJ 1D1CA 2FE3A 4XLFA 2EILH 3EPZA 2R7FA 3JRHA 2RREA 1G3TA 2JMWA 2OV7A 1W36D 2DA6A 2LBFB 4A69C 1GV5A 5K7FA 1B8IA 2MD5A 1CGPA 2DFEA 2ZBKA 2ZKZA 1X3WB 1GXPA 3ZOBA 2F4MB 3PQKA 5E1WA 4U87A 1QNTA 4WK8F 2HPMA 1QQIA 4XKCA 2DJNA 1OCPA 2F5EA 3KP7A 1J0RA 1FSEA 2QEXI 1LEBA 1QHHD 2R92J 1TW2A 5L3BA 4MEYF 2Z2SB 3NWTA 1VQ6I 1PVEA 3ZMVA 2X1DA 3RI4A 1W7PA 4IXAA 2PFBA 2Y48A 3Q5FA 5C4XJ 2VL8A 5FLVA 3QYFA 4DYRA 2H8RA 4IEJA 4YFNF 2M8GX 3FBIB 3MN2A 1BIBA 3MKLA 1ON1A 3KZIC 4P9FA 3EUKL 3O6BB 2OZUA 1ETWA 1S5LC 2GM4A 1OQYA 3UR3C 3TDZC 2EZIA 5DM6F 1K7AA 4WF2A 4W1UA 4P1WA 1X1AA 4I6ZA 3B6AA 3J81Z 1ZELA 2ESNA 3I59B 3SHFA 4D9JA 1Y0UA 2R7WA 1D0ZA 2VQHA 4PJJA 1V5EA 5JVTA 2NOGA 3FXQA 5IOYA 2CW7A 2W25A 3OYBA 2R3SA 2EFNA 2E60A 5GADJ 1XCBA 4MO7A 2V7FA 3GWZA 1Z05A 4Y3OA 3SFZA 4IF4A 3KP5A 4Y33A 3BQZA 4B3XA 4I0AA 3BG6A 2K4BA 3HL2A 1O7LA 2BGCA 1Z3XA 2XAQA 2EK5A 2DMQA 2M45A 1KU7A 1JHHA 5L3GA 2OQGA 1D5VA 1DP3A 3SZPA 4IO9F 5F27A 3OYCA 4HX8A 1YYVA 2KZVA 1O3SA 4OMZA 1R5GA 5HLTA 3GFJA 3WGIA 2L5QA 2PG4A 3HZJA 3HGGA 2VB6A 2G7UA 2QQ9A 2P7VB 2KT0A 3GBGA 5BMZA 3JSOA 3FMQA 5J4YA 3T1BA 2DT6A 4HX7A 3OIQA 4AYBN 1P4XA 1PP8F 1Z3YA 2DA2A 2K85A 4Y7NJ 5GTIC 3TKYA 2M7BA 1Q1VA 2D2WA 2FX0A 2DT5A 3QYEA 2KDZA 2CQNA 4OIQF 3OIOA 4PGGA 5KVRA 3TP3A 4P9UA 4M3DA 4H0EA 2O8KA 1IW7F 1I6HJ 4J19A 4MQVA 3GO5A 2CV1A 4J00A 2F48A 3GFMA 2AS5F 2PEXA 3HSRA 3CF2A 4BE0A 2JA6J 4PK4A 5L3CA 2AXTC 3ONQA 4UB6C 3H5RA 2VT3A 4C30A 1QPMA 4C2UA 3VYUB 2ME0A 3F22A 3S15J 3PNTA 1JUMA 4KN7X 2D45A 1MMNA 3CC4I 3K10A 1PJRA 3I54A 3GTJJ 1KA8A 2R7ZJ 1S7EA 1STZA 1U0JA 2ZNZA 1FP2A 3AL0C 4D7MA 1WI9A 1V5FA 3DQVC 1KYWA 3TO9A 3WG9A 4IHXA 3ECHA 4BKXA 2XKPA 3FWEA 3V7SA 3PIOF 3NAUA 1FTTA 4L18B 3F0CA 3TL4X 1MSFC 2QWWA 1LJ9A 4N4NB 5CVUA 4LB6B 3VOEA 5J8FA 3COAC 2ISYA 1HW1A 3OV8A 2ISZA 2O61A 2FQ3A 2KKOA 5F1RA 1VQKI 3JRBA 1KYZA 2R4GA 3OIPA 3I53A 2HKXA 4A3JJ 4HDVA 1LFBA 2HQNA 3IWZA 4Z6YA 1WWXA 2EJRA 4V2FA 1JT0A 3H9JA 1CQTA 4CA0A 4OIOF 4BQNA 3DPTA 3LSMA 3GCMA 1W5CC 1X3ZB 2W84A 4L9JA 4LIUA 5DUKA 3GYHX 4RS8A 4BBRJ 4HQEA 1FT9A 5E20A 2OQRA 2OPTA 2EBIA 3HXLA 2H09A 3ABTA 3WU0A 3J7ZI 1D0XA 1D1AA 2K9NA 4HLXA 5K7HA 1LFUP 2R0QC 2GZWA 2KIUA 3ZR8X 2MH9A 4ZDPA 4O5VA 3GXOA 4IHYA 4A3CJ 4ZYHA 3HOTA 3DEWA 2GIVA 2YU3A 3RKWA 2BY0A 3BR1A 3ESWB 1BN5A 1SD7A 1GUUA 5F0FA 4S05A 2XAJA 1FMWA 1W7PD 2VKVA 5CQGA 1F4KA 3MQ0A 5F0CA 4YFKF 4HSRA 4KITB 5IYDJ 2ID6A 4BE2A 1ZYRF 3KP2A 3PNYA 2LK2A 5F08A 3ELKA 3U1KA 4A5MA 1F1ZA 5EG0A 4CUGA 2H6BA 3OYHA 3CC7I 2DFFA 2L4MA 4FX4A 4EJTA 2VIXA 1TQMA 2BBYA 2CUEA 3VODA 3PM1A 1FYKA 3ABMH 1A36A 1IN7A 5HS8A 2CSOA 4XSZF 4QTRA 3K70D 2R5ZB 4AUXA 1APLC 2Y30A 1RR7A 4FASD 2ZNYA 1BOBA 1X1CA 5K5QA 4NC8A 4IQJA 5F1JA 1ZHFA 5DDGA 3LSJA 2ICWG 1ITYA 3SZTA 2Z9OA 3HJEA 4ZTJA 2IGKA 2DCEA 2L4AA 3HUGA 3LMMA 3PNVA 3CMMA 1X2NA 2XGEA 4NB5A 4OIRF 2E5NA 2M5WA 3RCOA 2YX4A 1N75A 2FEZA 2HQRA 3NQOA 4YFXF 4LD5A 3E97A 4KISA 3IH3A 3LOCA 4M9XA 1U78A 3OS2A 3LA7A 3GTKJ 3KLOA 2IVMA 4I99C 2RGVA 4LK1F 2L54A 1AKHA 2KISA 3LAPA 2P4WA 3CCVI 1LDDA 3BROA 4UY8I 3C2GA 1TWFJ 4HYEA 4G7ZF 1G3SA 1FEXA 4XN0A 5FJ8J 3GTQJ 2LMDA 1HA8A 3AG2H 1T95A 2WV0A 2K9MA 4BXUA 3GW2A 2E2JJ 1TW3A 1JGSA 3CMYA 4DBQA 1YO5C 3DV8A 2QQBA 2OD5A 5J47A 1RPWA 2YUSA 2VQCA 2PMZN 1I1GA 4CYCB 1UMQA 2RDPA 1BI2A 4HX4A 2CQXA 3I9V2 2H27A 2XAFA 4AM3A 4A0YA 3L1PA 1MGTA 3GTGJ 2CH0A 4Z2YA 3M1EA 3LL7A 2IS1A 3KP4A 3RYPA 4N9IA 3H92A 4LIVA 2E7WA 1SMTA 2B9SA 4F93B 3H3ZA 1R49A 2H1KA 3E5UA 2V9KA 4PJ0C 3HOSA 2QZ8A 3LSGA 4JX6A 2KMUA 4U7BA 1EV7A 2KJCA 5LHGA 2XUBA 3DXJF 5GAHJ 2MG4A 5CKTA 2LG4A 1ZR2A 2QGUA 2E71A 1T0FA 3OR2C 4QLCU 2WTEA 2ZXWH 4HF1A 5L3DA 4ZJZA 2STTA 4EGYA 4BGDA 1E2XA 3QPSA 4OU0A 3OYNA 1H89C 2VJJA 3SZGA 5EZHA 4AIJA 5FLXK 3B6CA 2LC2A 2VQLA 4DW6A 3BG7A 1S72I 2A68F 3CLOA 1U5TA 2O0YA 2XPUA 3OYJA 5LLQA 1BM9A 5C3EJ 4M9SA 1OLTA 2CW8A 3A03A 1RNLA 5HODA 3K4BA 1TLHB 2Y0MA 2DA7A 3REOA 2ZSHB 4AIHA 1I3QJ 1VQOI 1RR8C 1XCVA 2Y2ZA 3CJTB 4GYIA 4KIGA 1U3EM 2G9WA 1Q1HA 2VKEA 4ZH4F 3ZMZA 5C44J 3WTTC 5B1BH 3AL0B 2O8XA 1BJAA 4EM0B 3QAHA 3ZRGA 2IS6A 2IS2A 1X1PA 1K6YA 1VTNC 2M0CA 1JGGA 4CSWA 4ESFA 2LKXA 2NNYA 1POGA 2Z16A 2QBYA 2DA5A 1TNSA 1ZG1A 2Q2EB 4QIWN 2L2OA 4BAYA 2DXIA 3D5RC 2JWTA 4DBRA 2HXOA 4NQWA 1P9QC 4MIMA 3I55I 3M3YJ 1OYWA 4S0HB 3U2RA 3F9KA 3BTLA 3PO3J 2F4OB 1MKMA 3CJRB 3V8JA 1LB2A 2VI6A 2O7OA 3CZ6A 3ZMSA 5H6QA 2K9QA 1EJ9A 3LQQA 3KYCB 3MD2A 1XX5A 4CCOA 1DP7P 3DF8A 4G7OF 4S04A 4I0BA 2EZKA 1U2WA 3HOYJ 1MBHA 3DWLE 4HNUA 1PUFA 3IC7A 1EA3A 2I10A 2KL4A 1LEAA 5D8KB 4BL0B 3HOWJ 1LDKB 4XLAA 3G1LA 4X6AJ 3RKYA 4N9HA 3ZQCA 1DGRM 1T38A 1H88C 3P9KA 4AC0A 2CW0F 2XHKA 4N0BA 3LAJA 2BVLA 2F5FA 2WB1N 2CUJA 4JQFA 1J7KA 3WE2A 4B48A 4R1HA 4WWCA 2K86A 1O3TA 2COMA 4DJAA 1ENHA 2GXAA 1ZK8A 1R1UA 1R1TA 1QBJA 2LBFA 1UG2A 4YELA 3DPUA 3CUOA 3P9CA 1R7JA 3L2RA 4G9YA 3CO6C 2M4GA 1H0MA 4IHVA 4EM2A 1UB9A 1YLFA 4AU7A 2YX7A 4KYWA 2A6EF 4BE1A 2BHZA 1AA7A 4M73A 4PSXA 2DDBA 1TWHJ 2V4JC 3CDLA 4L9NA 4RBOA 1G59A 2XIGA 4PCQA 3NARA 3G71I 2NVQJ 1IJWC 4BH9A 2CFXA 1TBXA 3ABKH 4FETA 1HKTA 1IUYA 2R7SA 1OYYA 2X6WA 3MAJA 1E3HA 2DOEA 2YS9A 4XLPF 2DMUA 4XRSA 3G6EI 4IL6C 2L7MP 5FLXZ 1UAAA 3A2KA 3S17J 2LD5A 1YITI 5BPIA 4NC6A 4D7NA 3MVPA 2K3FA 4GRIA 3CESA 3TO6A 2QM3A 4XLHA 5EJCA 1Z77A 5EEHA 2ECBA 2V6EA 1IDYA 3ZN1A 1SFOJ 1XGMA 2RKHA 2K40A 5EF6A 1Y1WJ 2LF8A 1LE8B 3PUFA 3OSGA 2MABA 5FFZA 3I59A 2HXIA 5KAFC 2PI0A 3BWGA 1JTYA 1TZLA 2FBKA 4F52A 4B3AA 3AG1H 2IXSA 1OPCA 2XPVA 3S3NA 3KIOA 3EUAA 3SYTA 4XOPA 3BR0A 3DP7A 2A6HF 2JUGA 2L3DA 3CDHA 1MMAA 3FISA 4A3MJ 1P7IA 4LLNA 1WJBA 1C0WA 5FROA 4BJ6C 1NG7A 4F91B 1WCMJ 3CDIA 3IUOA 2ZJ2A 1Z7LA 1YHQI 1SVOA 1FOXA 3FM3A 4C3HJ 2EFPA 5M5YJ 2VT2A 2OBPA 3HHGA 3D0SA 1WFXA 2HOAA 4HEA2 4BY1J 3QPHA 3O8HA 3T8RA 3I71A 2LR8A 2PX9A 1BIAA 1FC3A 5IT9Z 3D5SC 2JZYA 3HOZJ 2XB0X 2FOWA 1KQ9A 2NAZA 2EQRA 1O3RA 4ASNA 5KNLA 3DU6A 5EYRA 1X1BA 2HOTA 1Y56A 2DI3A 2KIQA 3OYAA 2IGNA 4BXXJ 5EEGA 2R7OA 2Y9ZA 2IP2A 3V8KA 2V26A 1IUFA 3CQZJ 3RPQA 3RQ4A 1FWZA 4D5CA 4FTHA 2FMYA 2VBZA 1OCTC 1MMGA 5D4SA 5CYVA 2X85A 3W2VA 4R79A 2KHMA 3OYEA 2WWYA 2IJLA 3H1CA 2ZXHA 1SVLA 2E7XA 1B9MA 1R5HA 3CJQB 3KCCA 2DQRA 4ABZA 4KIBA 4ENKA 1Y1VJ 2TDXA 5F04A 4BJ5C 1IN5A 1NTCA 2XF5A 1WJDA 5B5EC 4FCYA 3BR2A 3MZYA 4B44A 4U88A 3H3VK 1AHDP 1V3FA 2MGQA 5BPDA 1YOVB 2IS4A 3QRFF 4A93J 4LLGF 4L9VA 2DT7B 1LQ1A 3ML6A 2BXYA 1U9NA 4HG2A 2QSHX 1N78A 1WJEA 3U1DA 1YG2A 3R4KA 3V7RA 3BZ6A 2NVTJ 4KIFA 2M1BA 2R7XA 1ZKGA 1FY7A 2HS5A 2HTJA 2D5VA 1TT5B 5JHUA 3FHZA 3F72A 2J5OA 3A1YA 3ABUA 2LDUA 1GV2A 1AWCA 2X48A 3ZQFA 4WCGA 2KIFA 4AVPA 4RDUA 5GPAA 4I98B 3OYGA 2OU2A 2R5YB 4ZDOA 2Q1ZB 4D1QA 1MDMA 1YFHA 1ETVA 2HQ5A 5JFRA 2Z99A 4K2EA 2IA1A 2E36A 3DTIA 3S8PA 1EKEA 3CCYA 1G3WA 2R7DA 1GT0C 1W5TA 1XMKA 4UHTA 1KONA 2RNJA 5D4RA 4B43A 3LWFA 2QCOA 3K4LA 2J5PA 3RZOJ 3RKXA 1QA6A 5LFAA 3F6OA 4OINF 4XLEA 3D1NI 4E7LA 3EYIA 2HGCA 4CICA 3FM5A 3CP8A 1X58A 2HYJA 2EV0A 3KYDB 1J9IA 5CLSA 1ETQA 4BEHB 3JTHA 2E1CA 3ZQLA 1ZRFA 2ESHA 4C3IJ 3AKZA 4KA4A 1XSVA 1K4TA 4Q47A 4F92B 4U0WA 2OUMA 5CJ9A 2VE8A 2JA5J 1RZ4A 2XB5A 1A04A 4AYBA 1OKRA 1ZH5A 3SXYA 2Z5UA 1IRZA 4A6EA 4XKBA 4E7SA 4I76A 3QOPA 3Q9VA 3N05A 4HPQA 5CQEA 1HSJA 3HRMA 1ETKA 4IQ4A 3V7CA 4EATA 3JRCA 3CCQI 2PJRB 1ETYA 3I0TA 1SVMA 2P5VA 3GFLA 2NYXA 4BYYA 5LEKA 4DZJA 3L9FA 5HDNA 3BDDA 3H0GJ 4L0ZB 2A5YB 1P4AA 2ZFUA 3DTEA 1J75A 2E35A 4ZDLA 4YG2F 5D5UB 1VQMI 2G7HA 2HI3A 3R60A 4H4KC 1Y8QB 5K1YA 3C2BA 1Z67A 4AIDA 3JAMK 3QYBA 1WVRA 1DU0A 3BPVA 2GLOA 2EIMH 2K02A 4D0PA 2VC1A 2LRDA 2H6CA 2LTPA 5LGTA 3C3WA 3MKZA 2MFZA 2BXZA 4LFUA 2XSDC 2HDCA 1E3OC 1JUPA 1SFUA 3L2VA 2R7TA 3ZMUA 4BQQA 1OCOH 2AQEA 4J01A 5FD6A 3HC7A 1HKSA 1FX7A 4I01A 5F64A 4LG0B 2DTZA 3HYIA 2UUZA 2HZTA 1J59A 2M87A 1PP7U 1MBEA 2BY2A 1EH6A 2W1OA 5ICFA 2WAEA 1B72A 1O57A 2NVXJ 3RTRA 1LUJB 3N4MA 5DEQA 3MKYB 1JJ6C 1LVAA 1YTYA 5K7ZA 2LKPA 4XSXF 1F36A 2KQRA 1WHUA 4EM1A 4HQMA 3S93A 4FE7A 2HU9A 3PSFA 5FKNA 3N97A 1ZARA 4KT5C 2QLZA 3F3XA 1HXDA 1IRFA 3VPRA 4HOBA 1Y6IA 2XGDA 3JRFA 3MCZA 5E17F 3BPXA 4BUPA 2MW8A 4GDFA 5HNFA 5E3OA 1Z9CA 1TWCJ 2C6YA 4NUBA 1XS9A 5D5WB 2LY2A 2JPBA 3BQYA 1IRGA 1V5GA 2ZCWA 3WU1B 2ZMEA 3FF5A 4IHWA 1MNEA 1S7AA 2XF6A 5K5RA 1I5ZA 3ZMDA 5DS9A 1WZ2A 3E3VA 5E1ZB 4RM3A 3R6SA 2DO7A 1R36A 4A3LJ 3RQIA 1MH3A 2WADA 2V79A 4RAFA 4CO8A 1XSXA 2KLOA 1K6OA 2HOSA 2NRAC 5ED4A 1MJBA 4JYKA 3CCRI 3S16J 2F5DA 1MMDA 1VQ4I 4XLNF 1Z7UA 2RV8A 2GA2A 2VODA 2HYFA 4BHPA 5FKKA 2HOEA 3VB2A 1TTYA 5TRDA 3RJPA 3TW6A 1ZRDA 1RETA 2GXGA 2M34A 4CYCA 4X1EA 3HOXJ 5D8LB 1ZG5A 4MHGA 4BDZA 2EZLA 2NS0A 2Y9YA 4LJZF 4E70A 1U9OA 4F7ZA 4UNOA 2XSJC 2CJJA 4W97A 3CCMI 3PJRA 1WRJA 1SAXA 1UHSA 1YIJI 1ORKA 3I3LA 3RSNA 1N25A 3GTPJ 1MJAA 2VXZA 2XGCA 2O03A 4FQGA 2W4SA 2V9PA 2B0LA 2DODA 2X51A 1VQLI 3HG9A 2EZHA 4HV5A 4G6TB 5J1UA 2LKSA 4QPQA 2A5WA 4MLOA 2GAUA 4YIFA 5L3EA 3FMRA 1P4WA 3U21A 4HNTA 2CRGA 2YSRA 5GPCA 2EA2A 5GTHC 1YW7A 2CQQA 2WV1A 1WJCA 3P5JA 1N77A 1YX3A 3BZKA 2E5ZA 3KP6A 2BY3A 2I5UA 4I7HA 1B6AA 4KT6A 5B3SH 2DU9A 2FMLA 3ASNH 3H9QA 1IXSB 1TQIA 2QUFA 4UUTA 4UVAA 1E0EA 1XMAA 4RA2A 1S9HA 1W4MA 1VQ8I 4C2TA 2M3AA 2AQFA 5E8IA 5J1YA 2W24A 5TJJA 2VPLA 1HCRA 2HKOA 2DPUA 3HDDA 1A31A 2DJIA 2EFQA 5JVGF 1S6LA 2LFBA 1JKRC 4UUSB 2K9SA 3BZCA 5AONA 5IPAA 1S3JA 2W00A 1OISA 2UXNA 1T98A 2CV0A 2K27A 3K1MA 4M72A 3MZHA 1QGPA 4E7IA 2W85A 1WSUA 4EJWA 1T39A 3L2QA 4C2MJ 3M4OJ 1MZBA 4UB8C 5D5XB 4IRIA 1UFMA 3LSHA 1JUSA 4GXOA 3E6BA 2VQGA 2KRHA 1Y8RB 2HFHA 1A6IA 5M5XJ 1FIAA 3TO7A 2Z3YA 4QPOA 4LITA 1YJWI 2Q2EA 1MSEC 2DA1A 2AXLA 2E34A 1BR2A 3I4MJ 4G8XA 4HAMA 2KDOA 4I09A 1VF9A 5J40A 5IP9J 1LDJA 2YR2A 4XIDA 1DQUA 1BA5A 3H5AA 3Q0VA 5ICCA 2GQQA 3QPLA 2OJED 5HLHA 1VZ0A 2GXBA 1G3YA 3CP2A 3ZQ7A 2XDVA 4YIRX 4I2OA 1IO2A 2F6CA 3G2BA 4NC7A 1IF1A 3JREA 2H8WA 3F21A 2DBBA 2PMZA 3ZPLA 2FD5A 4G6QA 5FFXA 3ZP5A 4DZPA 3RKQA 1P2FA 3A0BC 4CCJA 3H36A 4FX0A 2RQQA 3DPLC 5H6RA 1S7OA 4L0YB 1XSDA 1RKTA 1T2KA 2VE9A 3NWSA 3OMYA 2VOOA 2R7VA 1WH7A 3FXLA 2PMUA 1ZR4A 2F2EA 2M9HA 2EH3A 3PSIA 2W57A 3ROUA 4BHBA 2HVSA 3HRTA 1YE9A 4CXFA 2ZJRF 4L5JA 3OWTA 2R93J 3HM5A 1DDNA 5L3FA 4BNCA 3KPHA 4Y17A 4ESJA 2L01A 4IJAA 1QPIA 3ECOA 4A2UA 1IDZA 2BOLA 2D1HA 1ZGAA 2BVMA 4PJMA 2ZO4A 1LFPA 3A4CA 3T5XA 5LHIA 1IC8A 3TQNA 2L7ZA 4CHUA 3GZ6A 1W36C 1H9TA 1FBQA 3AG4H 3K0LA 3W2WA 3CMAI 1Z91A 4C3JJ 1R58A 1CF7A 3ZMTA 1QVTA 2X1EA 3A02A 2W48A 1W0UA 1U6GA 1I27A 4R8HA 4UVBA 1AU7A 5C4JJ 2JA7J 2B7EA 4RGSA 5IYCJ 3ZCOA 4RGUA 3J7YJ 3O2PE 3W6KB 3I64A 3K2ZA 1ZREA 2DOFA 2FNAA 2LY9A 5J3LA 3C18A 4M6YA 2GA1A 1LPQA 1K78A 1I6XA 1P7JA 2PBIA 5FKLA 3W6VA 3E6CC 1V4RA 1OYIA 3O8GA 2BW3A 5JHFA 2A61A 3WE3A 3J80K 2MLGA 4PFPA 2UWMA 1HOMA 1TWAJ 3M9AA 2Z1DA 3GEZA 2IPQX 5DCFA 1XPXA 2CYYA 1LE8A 2VBXA 3ABLH 1KU9A 1SFEA 1YQAA 5AIQA 3CD6I 1WJFA 3T8TA 2FRHA 3X2QH 1F9NA 1TL8A 1GVJA 2DA4A 3CUQC 2L9RA 3HHHA 3ZQQA 4A5NA 2IRFG 1G8XA 1T08B 2FOKA 3J7AY 2CQKA 2FSWA 3DFGA 3PFIA 5EDNA 2QA4I 3DKXA 3IH2A 1RI7A 3PIPF 2NXNB 4IOCF 1K79A 2O6GE 2IGOA 4XQFA 2EINH 1RRJA 1EH8A 2P5KA 5GP9A 3M8EA 1X4OA 5FD5A 3FKIJ 1BJZA 1PDNC 1YRNB 2ZJPF 2H94A 2JSCA 4KMFA 3FXRA 4ANJA 2JN6A 3TEDA 1HBXG 1BC7C 1FMVA 2BZTA 1GXQA 3F8BA 2G0EA 2R7UA 2VC0A 3WTZA 1NG6A 1O3QA 1HQCA 1ZLKA 2FBHA 2ZXIA 1QZZA 3PFYA 3VSLA 5EG0B 1FLIA 3IAM2 3FXJA 2K3PA 2CGPA 1R1VA 2WB1A 3BR3A 3LSRA 4B47A 3CCUI 3E7LA 1R71A 2FQ4A 1LKXA 1RUNA 3KP3A 5IP7J 2WBMA 3KETA 5IT3A 5HS7A 4BQOA 4RAGA 1FOYA 3ISPA 4M71A 2VUMJ 2AO9A 2FU4A 3K9TA 3S2WA 2KP6A 4AWXB 2L7KA 5GAEJ 1R6RA 2A07F 2FJ1A 4MNUA 2CUFA 4CYDA 1MBJA 5ILSA 3QP6A 3WHCA 1VQNI 3M07A 4V19K 4RLFA 3HUGB 1VQPI 3H35A 3EUHC 2HVRA 1XD7A 2I8DA 1M1EB 3QODA 1SD5A 3TOBA 1KGSA 5DTDA 3IKVA 1AOYA 3S1NJ 5K5OA 5M5WJ 4V2GA 3B73A 1TP4A 3KEQA 4OAZA 4WXDA 5EGOB 3ERED 1VQ7I 5KHDA 4BACA 3FBNB 2N8GA 1SD6A 5LRRA 1ZGWA 2MSYA 3LSKA 4A3BJ 1ACIA 2KRCA 1WH5A 3I5UA 4A0XA 1HLVA 2IA0A 4NBQA 4Q5SF 4GGGA 2ADUA 3GTLJ 4A3GJ 4TV7A 2OCCH 4MFDA 3W2AA 3LFKA 2QYOA 2Q0OA 5BOXA 5H20A 3ZQHA 3BT9A 3Q3SA 1HF0A 1YIOA 3L2WA 2CG4A 1MNMC 1FBSA 2R5YA 4BY7J 5AIPA 4MTDA 5LHHA 1B4AA 4KFCA 3BJAA 5M3FJ 4DIQA 3GX4X 4L5EA 1YW8A 1NK2P 3KZYA 2O5RA 3C2HA 4DQ2A 3J80Z 2Y31A 4DNCA 4LK0F 2LSOA 1J2XA 1WGXA 2YPRA 5LBQA 3TP0A 1F5TA 3I4NJ 4AVZA 1D8KA 4X0GA 1FOWA 2M4KA 5CPRB 3L09A 3VDXA 2VN2A 5FO5A 2VLAA 1I39A 2DYRH 3H9GA 1USSA 3WTYC 1OCZH 2HWVA 4EEFG 3VEPA 4XLCA 5J6XA 3DKYA 4GCVA 3K4MA 2V6CA 4E7KA 1V54H 3K69A 4XN3A 5D6FA 3M8JA 3J7AO 3BC8A 1FBUA 3K7AJ 4IVNA 3W6JB 3RIRA 5FLMJ 4WXHA 3SFIA 3KEOA 3QOEA 2MLKA 3SJMA 1SFXA 1OR7C 2JRMA 3UKGA 3QU3A 2GBYA 4AD9A 2DMPA 2F5VA 2AHQA 3GF2A 3ERMA 4XICA 4YRVA 1Z21A 2P7CB 1WJAA 3BY6A 2PJRA 3W3CA 1IAWA 1H8AC 1H9GA 1RUOA 1IG7A 2VOPA 5DYMA 3L2UA 4OOIA 3IKTA 5H2FC 2QSGX 2HPIA 1FJLA 4XM3A 3K4KA 4UV9A 3S3MA 1FZPB 2V1DA 1R00A 2EPFA 2JVGA 2ETHA 3BR6A 1IXRC 1FNNA 1QVUA 2QQ8A 3LA2A 1FPQA 2LYCA 3M7GA 4LGWA 2NS7A 2ZFWA 2H1LA 2V1XA 3HTUA 4PJNA 5E3MA 4CCNA 3QPTA 3DTKA 3DKWA 3DLAA 3IV5A 1VI0A 3L7WA 3GTOJ 3GLXA 2FF4A 5DM7F 3HKZN 2DK8A 3EETA 2LOOA 3CTAA 4N4OB 1YX5A 2X1CA 3IAS2 2QVOA 4A3KJ 3IRRA 1UHWA 1WI3A 3PO2J 2QBYB 4L5IA 5IY5H 1IN6A 5E79C 3OS0A 2RVCA 4LG0A 2EV6A 3DBHB 3BCBA 4NQWB 2WC2A 5HNHA 2X4HA 4KJZA 5BNGA 3DEEA 5DCMB 4II3A 1K61A 2ZSIB 1X1DA 5M3MJ 4XKWA 2MYSA 2DYSH 3K1NA 5HLIA 2DMNA 2Y0SN 3WHBA 3K70C 2MBFA 1GHCA 3S1QJ 1K4SA 3F6VA 5HVQC 3CC2I 2LLKA 2M2EA 1B9NA 4A6DA 1HSTA 4BXFA 2KJBA 3CCEI 4IKFA 2XVCA 1PUFB 3WU2C 3VFZA 1HW2A 1S8NA 3JRGA 3IP4B 3CUQB 3VYTB 2E1MC 2EWNA 3OYMA 3SDGA 4E7ZA 4HDUA 2HTSA 3D5LA 1R9TJ 2JA2A 1J09A 3G73A 2VBYA 3KEYA 2YU9J 1P6RA 4A3FJ 3FK7A 5F6FA 1L0OC 3OL3A 1OCRH 2KFDA 2KIMA 4QWQA 3WTXC 1XGOA 4JX4A 4D5FA 4OMYA 1HC8A 3ZGKA 2Y69H 3KZZA 4EV0A 3K2AA 3MFKA 3FXOA 4HZFA 3K6GA 2JUCA 4HBLA 2EIKH 2WA0A 1YJ9I 4MQ9F 3O3KA 2XKOA 4QSHA 2CU7A 3WTUC 5LRSA 2QKMB 4RGXA 3KYLA 5J8CA 3VWBA 4ZYDA 3G1OA 3K4NA 4M3GA 2IGMA 4DYQA 1VQ5I 1IGNA 4Q4ZF 3A01B 2XROA 4LB5A 1XGSA 3E0JB 4E7JA 2HYGD 2LF7A 1ZAOA 4XONA 2Q8KA 4C9YA 3ASOH 5FRMA 3HEFA 1IZ1A 5LD2C 4IHSA 4B8XA 3OYKA 3CF5F 1FP1D 4MFEA 1IN4A 2CWEA 2KPMA 2M8EA 4JBAA 3V42A 1NH3A 1FTZA 2BHYA 4GYGA 3U9GA 4PFOA 3CO7C 5LGNA 3PQJA 2K7LA 1FYMA 2LH9A 3JRDA 3DLLF 1T8IA 3PUBA 1D5YA 3F8CA 1S29A 2CS3A 1DGWY 3F8FA 3EYYA 1OMIA 2ZMEC 5IP6A 2X6XA 4RB3C 4YEJA 4G6DA 4RAYA 4EJUA 3E6MA 3HB9A 3JSPA 2FUG2 2CO5A 4G7HF 4UUSA 1D8JA 2VJIA 2VJ4A 1OJLA 1JKQC 4JK1X 4M3EA 5JR3A 1T6SA 2E19A 3FKJA 3S32A 5HLGA 4FE4A 1O4XA 4XORA 3G4SI 1HDDC 2R5ZA 1IN8A 3S14J 2P6TA 3RPUA 3QQAA 2DK5A 1TT0A 3DCFA 1G6NA 4IRGA 1QU3A 2A3SA 1BR1A 1BI3A 4NDLA 1LNWA 2DAOA 3M8FA 4HRIA 2L9VA 5DD8A 2QKLB 3P9IA 2EV5A 4CDGA 3K4CA 3F23A 3BOQA 5F0HA 3HGYA 3BG3A 2CQ7A 2GIZA 4XR6A 2EA4A 3I4PA 4YIIA 4XBFA 4U0YA 1JKPC 1USTA 5J1RA 2STWA 2HVQA 4PUSA 2VKDA 6PAXA 1E17A 3I58A 1X2MA 2PLYA 3DEUA 2OZ6A 3DU5A 3Q9SA 1L3LA 4Y15A 1MMSA 5EEAA 1JI8A 2P6SA 2BV6A 2DDAA 2BY1A 5TISC 1MW7A 3VYSB 2ZC2A 2Y75A 1KZHA 2LNBA 2FNPA 3KX2A 1QZEA 2QQAA 1O7FA 1XC5A 2WAFA 2W7NA 4IOAF 4RM2A 5LGUA 3LSIA 4HV6A 2CMPA 2QSFX 2DFHA 1XN7A 3F8MA 5ILUA 2O9LA 2OTLI 1W1WE 1B8IB 2PN6A 4BBSJ 1KQ0A 4ON0A 2P5LC 3UNGC 1BI0A 4ESBA 3LNQA 4HLYA 2A05A 1ULYA 1W5SA 2NNNA 2NVUB 2GOMA 2P81A 3KFWX 3E6DA 2DFIA 1BC8C 1MDMB 5DV5A 5HOOA 2HDDA 1Z6RA 3VSKA 2ECCA 1PYVA 2ME6A 4EQQA 4M3FA 1X3UA 4ZZLA 5DD4A 1W7PB 1GDTA 3IHUA 3HIFA 3Q0UA 2OCEA 2RQPA 9ANTA 1JTXA 1R5ID 3HPGA 1UZCA 2DW4A 2L0KA 3FX3A 2ZJQF 4Y4RA 1QO0D 2DN0A 2PMHA 1A6QA 3NEUA 4XKVA 1UCRA 4Y13A 2X6OA 4ZZDA 4EGZA 4EVIA 1Z0XA 4KN4X 4HF0A 4DYCA 2VJ5A 3JAMZ 4P55A 1UG0A 1FIPA 5FKMA 1YW9A 2WY8Q 4RB1A 1X19A 1XB4A 4ZYAA 4E7HA 3OS1A 5BS6A 3KLNA 4BU2A 3HRSA 4IZZA 4BQAA 2XF7A 5B1AH 4KNYA 3VYRB 2E1MB 2M30A 2KZGA 2X6YA 3QU6A 3BG9A 3QWLA 5ICGA 4KUMA 2JRTA 2VPRA 1YJNI 2VKHA 1IV6A 2K4JA 2CUZA 3IWFA 1J5YA 3WTVC 1ZN2A 4XRSG 4B4CA 3GTMJ 4OIPF 2OC6A 2VBWA 4CCLA 1YRNA 2LY1A 1TWGJ 4A3DJ 1UHMA 4UV8A 4FT8A 1V55H 2ZB9A 3H3UA 3SEZA 1FYLA 2JSPA 2A69F 4XL9A 3V8LA 2WAQA 2D1VA 1KU3A 1E3PA 1A35A 5FKOA 4RB0A 3DBRB 3HOVJ 2RC4A 3LSTA 1YI2I 2RN7A 2P0WA 3CCJI 1BW6A 3KE2A 4A0ZA 1GVDA 2CV2A 5KCMA 3OOPA 3NRVA 1MBFA 5CVIA 1R23A 5DUIA 1SAUA 1SANA 5A2QK 2ACJA 2M7AA 4RMNA 3AAFA 3SQNA 1G2HA 4M3BA 1SMYF 2GOXB 1T0FC 2QENA 1JJ8C 2E2HJ 1SD4A 1GLNA 2V9VA 5D5VB 2L9SA 1B72B 1U8RA 1NK3P 3JW4A 4GO1A 5FB2A 2WAQN 4WX9A 2IBDA 1BI1A 1WKMA 3LQRA 3G3ZA 1U5TC 3OYIA 1OFCX 4BHCA 2JTVA 1HKQA 1SEUA 4O6JA 4UVCA 2W82A 4E6KG 4ZYGA 3HTSB 2NVYJ 5EGOA 2XAGA 1EF4A 1ON2A 1YS6A 2QF7A 1U8BA 5TGTA 1R4MB 1R22A 2ZMEB 4HW0A 4NNJA 5JI6A 2VXDA 4F3QA 3R61A 2NS8A 5IOZA 4KDPA 3MEXA 4KMUX 3RPUD 3BR5A 2MD0A 4JX5A 2EB7A 3HRUA 2ID3A 4L9TA 2BE5F 1I1SA 3L2CA 2JPCA 2DPDA 3G1MA 3WGHA 4FISA 4CCKA 1RC9A 3OYLA 3MZ8A 1YS7A 4LOCA 2DOAA 4RGRA 3FXKA 1D0YA 3LFUA 2BYVE 2XRLA 3P7NA 3GMEA 1R4NB 2ELHA 3MKWB 3TDUC 3TOAA 4CCMA 3OY9A 2JK3A 1QZYA 3BTJA 3Q0WA 1B1BA 1QRYA 1NHAA 2GWRA 2P8TA 2XASA 3FXMA 3WTSC 4NHJA 4BS9A 2OAZA 3JCUC 5CVVA 3GUDA 4U7DA 1ETXA 1RKWA 4ITVA 3H5NA 1VQ9I 5J4VA 3AG3H 1RIOH 1DPUA 1XDUA 1SC7A 3FK6A 3LA3A 5CVJA 2Z33A 3S1MJ 3T0YA 3FXUA 1I50J 3EDPA 4PZJA 2K5CA 4B09A 2VASA 3GLLA 2R7QA 4RB2C 1ONVA 1PUEE 3FMSA 3OOUA 4HA8A 4HSTA 5E18F 1WJ5A 3ZXSA 3CCLI 2COBA 1XGNA 5BQTA 4XRFA 5EZGA 4EJVA 2ELKA 3MWMA 1MBGA 1HDPA 2M0MA 1ODDA 1BOAA 2HQAA 1DPRA 4WXCA 3HSEA 2UZKA 1XTAA 5ERIA 2RNGA 4IHTA 4CZZA 1BR4A 4G94A 4HNVA 2L9NA 2PJPA 5E1XA 3HPHA 5A2QZ 2IT0A 1B59A 3TBIA 4RAZA 3SDBA 3OYDA 2TCTA 3BJ6A 1BBYA 4LLLA 3V4GA 1MIJA 2JT1A 2MC3A 4ZYEA 1XMXA 4PJLA 4EJOA 3BTCA 4JOMA 2R7RA 1FOKA 4XOTA 2VONA 5E8GA 1I3AA 3WG7H 4ENJA 3HOUJ 1ZG3A 3I56I 4HF2A 2B63J 1XG1A 2XRNA 1MH4A 2BEOA 1HW5A 3TMOA 5HDKA 4DOZA 1REPC 2CFOA 4BDYA 2FXAA 2E1NA 3RZDJ 3C7JA 2V1NA 3E5QA 5DCMA 2PQ8A 2ZXJA 3EQLF 5IT9K 5JLXA 1MD0A 3R0AA 5KAIC 2UXXA 3TW7A 4ETSA 1RESA 4IX7A 1ETOA 3OSFA 3AFHA 1JKOC 4PGHA 4G12A 3H0DA 1ZRCA 3E5XA 3GZ5A 1T56A 4ENNA 2JJ7A 1T33A 4UUVA 3ZQIA 3ULQB 1WPKA 2E1OA 1KU2A 1AKHB 3S3OA 4A3EJ 2DA3A 3CUQA 1FSHA 1VFCA 3A0HC 4XK4A 4XRMA 3RDIA 1ZLJA 4MEXF 1MBKA 4KICA 2XAHA 2A6TA 3JRIA 3MMYB 3E1SA 4XMYA 3BCAA 1DU6A 2L02A 3FDYA 2OF7A 3R0JA 4F55A 1Z6TA 3HSFA 2IA2A 4JP0A 2O3FA 2XC7A 4O3MA 2XV4S 2OA4A 1K83J 2IAIA 3FZVA 4FHTA 4ENMA 3BJOA 5KK1A 2JVHA 1OCCH 4M6XA 1ZTRA 1JT6A 2MA3A 1CF7B 1A5JA 1F43A 4LG3A 1W0TA 4II2A 4IRHA 3PL8A 3WGGA 2RAEA 4Y52J 2DLLA 3A01A 3C1DA 4P96A 4BEHA 4A3IJ 1TC3C 4I02A 4M9ZA 3FIWA 2LVSA 4U0VA 3CJNA 5D6EA 4E4HA 1JE8A 5JLWA 3GFIA 3S2DJ 2LREA 1MJ9A 2XAUA 3OYFA 1JXSA 1WQ2A 4LMYA 2HZDA 5FRNA 1IXCA 1X4PA 1K78B 1D1BA 5E3LA 3HKZA 2K9LA 3K4JA 3F8NA 2BW3B 3GVAA 1KQ8A 1Y0NA 1D3YA 4CGZA 4P5OA 3LSPA 4DGWB 4ZTFA 1ZQ3P 2F5CA 1EH7A 4PDKA 3BTIA 2FA5A 1MNDA 1U5TB 3M1CA 3OR1C 4OWRB 5LEJA 5FGMA 3EUHA 2HNHA 4MTEA 3RYRA 4GFBA 2JQ7A 1P92A 1TNTA 2L7FP 4MGRA 3JTGA 2WY7Q 3B02A 5IYBJ 3CMEI 4CH7A 2JA8J 3DBLB 3J81K 3WTWC 1IV8A 4AIKA 2Y0SA 3IH4A 3JR9A 3S2HJ 3BG5A 5CVRA 4OAYA 3K1PA 1VNDA 3OL4A 4UXNA 4ZC3A 3TGNA 5GAGJ 1TQPA 4PSWA 1DUXC 5E3NA 2HDWA 3BP8A 2NOJB 3JRAA 5ILVA 1SFKA 2OTJI 5B66C 4B1RA 1IRXA 3ZQGA 1Y39A 2FBIA 3FHNA 2DTRA 1LVKA 2MH2A 4CZCA 1UELB 3L00A 3GZNB 2X0LA 4Q48A 4EMSA 1JHFA 3CCSI 2EFOA 3WODF 1BW5A 2TRTA 2XGXA 3HBLA 1BL0A 1ZGJA 4RLQA 2V1UA 5HDGA 4XNFA 3S1RJ 2KRFA 3IRQA 1Z1DA 3QP5A 2DQLA 2ELJA 2F4IA 4M74A 3SEQA 5ICEA 4BJTA 2IEKA 1G4DA 3BLYA
chains in the Genus database with same CATH topology
1QHGA 2MC4A 3DU5A 4CCJA 3DWLE 4HNUA 1EA3A 2RQQA 2KL4A 1JI8A 3DPLC 4BL0B 1LDKB 4XLAA 1MW7A 3VYSB 1DGRM 2UV1A 3KX2A 3NWSA 3OMYA 1D1CA 2R7VA 2BVLA 2WAFA 4XLFA 2W7NA 2CUJA 3EPZA 4RM2A 4JQFA 4B48A 2RREA 3LSIA 2CMPA 4DJAA 2OV7A 1W36D 3PSIA 2LBFB 2HVSA 2LBFA 1YE9A 4YELA 3OWTA 3DPUA 3L2RA 3UNGC 2M4GA 2BOLA 4PJMA 2GOMA 2BVMA 4AU7A 1LFPA 3A4CA 4BE1A 4U87A 2HPMA 1AA7A 4XKCA 1W36C 3W2WA 5HOOA 4PSXA 3VSKA 2V4JC 1PYVA 1QHHD 1G59A 2X1EA 2Z2SB 3NWTA 2X1DA 4FETA 2VL8A 3ZCOA 2R7SA 2X6WA 3QYFA 1UAAA 3A2KA 3FBIB 3EUKL 3HPGA 4GRIA 3CESA 3UR3C 4XLHA 5JHFA 4Y4RA 2BW3A 2V6EA 4XKVA 2UWMA 4PFPA 4P1WA 1X1AA 2Z1DA 2VJ5A 1ZELA 1UG0A 2MABA 4D9JA 2R7WA 1D0ZA 2VQHA 1WJFA 2WY8Q 4PJJA 1TZLA 1X19A 3ZQQA 1V5EA 4F52A 1G8XA 2IXSA 4ZYAA 3J7AY 2CW7A 4E7HA 3OS1A 3S3NA 3EUAA 3OYBA 3DKXA 3SYTA 4XOPA 2E60A 4BU2A 4IZZA 2JUGA 1MMAA 2XF7A 2V7FA 1WJBA 3VYRB 5FROA 2IGOA 4BJ6C 1NG7A 4XQFA 4F91B 4Y3OA 2E1MB 2X6YA 3IUOA 4Y33A 4B3XA 1X4OA 1Z7LA 2VKHA 3BG6A 1ERDA 3HL2A 1Z3XA 2CUZA 2OC6A 1DP3A 4CCLA 2LY1A 1WFXA 3OYCA 4ANJA 4HEA2 2KZVA 5HLTA 2L5QA 2R7UA 1FMVA 3D5SC 3SEZA 2JSPA 4XL9A 2VB6A 1NG6A 2WAQA 3GBGA 5KNLA 3DU6A 2ZXIA 3PFYA 1X1BA 2DT6A 3VSLA 3OIQA 3IAM2 1Y56A 1Z3YA 3OYAA 2K3PA 2IGNA 2P0WA 2CV2A 2WB1A 2R7OA 5KCMA 2V26A 4B47A 2M7BA 3RQ4A 1LKXA 1SAUA 2WBMA 1MMGA 2M7AA 3QYEA 4RMNA 2X85A 3W2VA 4R79A 2KHMA 3OYEA 2GOXB 1T0FC 4BQOA 2ZXHA 3CJQB 2KP6A 2L7KA 1R6RA 1GLNA 2L9SA 2CV1A 4BJ5C 4J00A 2XF5A 1WJDA 4RLFA 3CF2A 4BE0A 3HUGB 4B44A 4PK4A 3H35A 3EUHC 3OYIA 2HVRA 2I8DA 3QODA 3ONQA 2IS4A 2DT7B 3H5RA 2W82A 4C30A 4E6KG 4OAZA 3VYUB 4C2UA 4HG2A 1N78A 1WJEA 3PNTA 5KHDA 4BACA 3FBNB 1MMNA 2R7XA 3LSKA 5TGTA 3K10A 1PJRA 2KRCA 4NNJA 2VXDA 3A1YA 4F3QA 1U0JA 3W2AA 3RPUD 3AL0C 2MD0A 1V5FA 3DQVC 3OYGA 3L2WA 4ZDOA 2Q1ZB 4CCKA 4D1QA 3OYLA 3TL4X 2DOAA 4N4NB 1D0YA 3LFUA 4DIQA 3DTIA 3S8PA 2O5RA 3C2HA 3MKWB 4CCMA 3OY9A 2R4GA 1KONA 3OIPA 4B43A 3K4LA 4AVZA 5LFAA 4X0GA 4XLEA 4E7LA 2M4KA 5CPRB 4BS9A 3VDXA 3H9JA 3CP8A 2VLAA 3H9GA 4ITVA 4CA0A 3H5NA 4BQNA 3DPTA 3LSMA 4XLCA 4BEHB 3DKYA 3K4MA 4E7KA 3AKZA 4XN3A 4F92B 3M8JA 2OUMA 4LIUA 3BC8A 2K5CA 2VASA 2R7QA 3HXLA 3QOEA 4AYBA 3OOUA 1OR7C 1D0XA 1D1AA 4HSTA 1WJ5A 4XKBA 3ZR8X 4E7SA 4ZDPA 2F5VA 3ZXSA 3N05A 4HPQA 5CQEA 2PJRB 4YRVA 1Z21A 4IQ4A 1WJAA 4EATA 3HOTA 2PJRA 3W3CA 2M0MA 2HQAA 3L2UA 2HPIA 4XM3A 2RNGA 1FMWA 3K4KA 5CQGA 2ZFUA 3DTEA 3S3MA 2JVGA 1BR4A 4ZDLA 4HSRA 4KITB 2L9NA 4H4KC 4BE2A 3HPHA 3PNYA 3TBIA 3QYBA 3SDBA 2LYCA 3OYDA 4PJNA 4CCNA 3DTKA 3DLAA 2LRDA 4CUGA 4PJLA 3OYHA 4JOMA 2LOOA 3MKZA 2R7RA 4XOTA 2MFZA 4N4OB 1YX5A 2X1CA 2VIXA 3IAS2 3L2VA 2R7TA 4BQQA 2AQEA 4J01A 3HC7A 3K70D 4FASD 3TMOA 4DOZA 3OS0A 2CFOA 2UUZA 1BOBA 3BCBA 4NQWB 5HNHA 4BDYA 1X1CA 2W1OA 4KJZA 4NC8A 4IQJA 2WAEA 3DEEA 3RTRA 4II3A 3MKYB 2V1NA 1X1DA 2ZSIB 4XKWA 2MYSA 2IGKA 2DCEA 4ZTJA 3LMMA 3PNVA 3CMMA 3K70C 2KQRA 2E5NA 3RCOA 3S93A 2HU9A 3PSFA 1N75A 5HVQC 4IX7A 3AFHA 4BXFA 3H0DA 4KISA 1Y6IA 4IKFA 4BUPA 3OS2A 5HNFA 4NUBA 3S3OA 2LY2A 3IP4B 1V5GA 3VYTB 2E1MC 3OYMA 4E7ZA 1MNEA 2XF6A 3D5LA 2JA2A 3C2GA 1J09A 3KEYA 4XN0A 4RM3A 1HA8A 3OL3A 2WADA 1T95A 2KLOA 2A6TA 2K9MA 4DBQA 3MMYB 3ZGKA 3E1SA 4XMYA 3BCAA 3FDYA 1MMDA 4F55A 3K6GA 2WA0A 2XC7A 2VQCA 2JVHA 2QKMB 4BDZA 3I9V2 3KYLA 3VWBA 3K4NA 2CH0A 2IGMA 4LG3A 2XSJC 4II2A 3LL7A 2IS1A 3PJRA 3PL8A 4LIVA 3E0JB 4E7JA 4F93B 4BEHA 3I3LA 3RSNA 4XONA 2V9KA 4C9YA 2VXZA 4E4HA 5FRMA 3HOSA 2W4SA 3LSGA 5LD2C 2KMUA 4U7BA 2LREA 2X51A 3HG9A 3OYKA 5CKTA 2KPMA 2LG4A 2XAUA 3V42A 3OYFA 3OR2C 4G6TB 2HZDA 5FRNA 1X4PA 4QPQA 1D1BA 2A5WA 4MLOA 4PFOA 4ZJZA 3HKZA 2K9LA 3K4JA 2BW3B 3U21A 4HNTA 2LH9A 4BGDA 3OYNA 1N77A 4P5OA 1WJCA 2VJJA 3SZGA 4DGWB 1YX3A 4ZTFA 2E5ZA 3PUBA 2LC2A 2VQLA 1MNDA 3M1CA 3BG7A 3H9QA 3OR1C 4KT6A 4OWRB 2CS3A 1DGWY 2HNHA 1E0EA 1S9HA 3OYJA 4C2TA 2M3AA 2AQFA 1OLTA 2CW8A 2VPLA 2X6XA 3K4BA 4YEJA 2ZSHB 2WY7Q 2DJIA 4CH7A 2FUG2 2Y0SA 2W00A 2VJIA 2VJ4A 4OAYA 2CV0A 3OL4A 4ZC3A 3AL0B 4PSWA 4E7IA 3ZRGA 2IS6A 2HDWA 2IS2A 2NOJB 3L2QA 1SFKA 3FKJA 1K6YA 3S32A 1IRXA 3LSHA 4CSWA 3FHNA 2VQGA 2KRHA 1LVKA 4XORA 4CZCA 2Z16A 1UELB 4PUSA 2Q2EB 4QPOA 4LITA 2L2OA 2DXIA 3D5RC 4DBRA 1TT0A 1P9QC 1BR2A 1QU3A 4RLQA 1BR1A 2KDOA 3F9KA 1DQUA 4HRIA 3H5AA 3CJRB 2QKLB 4XNFA 1VZ0A 3K4CA 3CP2A 2XDVA 3CZ6A 4XR6A 2F4IA 2ELJA 3G2BA 2F6CA 4NC7A 3SEQA 4BJTA 3MD2A 4CCOA 2HVQA 2PMZA 2VKDA 3BLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD0 A; 
#chains in the Genus database with same CATH topology
 2HR3 A;  1QHG A;  2MC4 A;  4M6V A;  2IW5 A;  2EIJ H;  1ERD A;  1UJ8 A;  2XPW A;  2EFW A;  2X9D A;  2DMT A;  4IPA A;  5HS9 A;  2LP0 A;  3ZN0 A;  2HEO A;  3IL2 A;  2UV1 A;  1OR7 A;  1XDS A;  3CLQ A;  4A12 A;  2E2I J;  1D1C A;  2FE3 A;  4XLF A;  2EIL H;  3EPZ A;  2R7F A;  3JRH A;  2RRE A;  1G3T A;  2JMW A;  2OV7 A;  1W36 D;  2DA6 A;  2LBF B;  4A69 C;  1GV5 A;  5K7F A;  1B8I A;  2MD5 A;  1CGP A;  2DFE A;  2ZBK A;  2ZKZ A;  1X3W B;  1GXP A;  3ZOB A;  2F4M B;  3PQK A;  5E1W A;  4U87 A;  1QNT A;  4WK8 F;  2HPM A;  1QQI A;  4XKC A;  2DJN A;  1OCP A;  2F5E A;  3KP7 A;  1J0R A;  1FSE A;  2QEX I;  1LEB A;  1QHH D;  2R92 J;  1TW2 A;  5L3B A;  4MEY F;  2Z2S B;  3NWT A;  1VQ6 I;  1PVE A;  3ZMV A;  2X1D A;  3RI4 A;  1W7P A;  4IXA A;  2PFB A;  2Y48 A;  3Q5F A;  5C4X J;  2VL8 A;  5FLV A;  3QYF A;  4DYR A;  2H8R A;  4IEJ A;  4YFN F;  2M8G X;  3FBI B;  3MN2 A;  1BIB A;  3MKL A;  1ON1 A;  3KZI C;  4P9F A;  3EUK L;  3O6B B;  2OZU A;  1ETW A;  1S5L C;  2GM4 A;  1OQY A;  3UR3 C;  3TDZ C;  2EZI A;  5DM6 F;  1K7A A;  4WF2 A;  4W1U A;  4P1W A;  1X1A A;  4I6Z A;  3B6A A;  3J81 Z;  1ZEL A;  2ESN A;  3I59 B;  3SHF A;  4D9J A;  1Y0U A;  2R7W A;  1D0Z A;  2VQH A;  4PJJ A;  1V5E A;  5JVT A;  2NOG A;  3FXQ A;  5IOY A;  2CW7 A;  2W25 A;  3OYB A;  2R3S A;  2EFN A;  2E60 A;  5GAD J;  1XCB A;  4MO7 A;  2V7F A;  3GWZ A;  1Z05 A;  4Y3O A;  3SFZ A;  4IF4 A;  3KP5 A;  4Y33 A;  3BQZ A;  4B3X A;  4I0A A;  3BG6 A;  2K4B A;  3HL2 A;  1O7L A;  2BGC A;  1Z3X A;  2XAQ A;  2EK5 A;  2DMQ A;  2M45 A;  1KU7 A;  1JHH A;  5L3G A;  2OQG A;  1D5V A;  1DP3 A;  3SZP A;  4IO9 F;  5F27 A;  3OYC A;  4HX8 A;  1YYV A;  2KZV A;  1O3S A;  4OMZ A;  1R5G A;  5HLT A;  3GFJ A;  3WGI A;  2L5Q A;  2PG4 A;  3HZJ A;  3HGG A;  2VB6 A;  2G7U A;  2QQ9 A;  2P7V B;  2KT0 A;  3GBG A;  5BMZ A;  3JSO A;  3FMQ A;  5J4Y A;  3T1B A;  2DT6 A;  4HX7 A;  3OIQ A;  4AYB N;  1P4X A;  1PP8 F;  1Z3Y A;  2DA2 A;  2K85 A;  4Y7N J;  5GTI C;  3TKY A;  2M7B A;  1Q1V A;  2D2W A;  2FX0 A;  2DT5 A;  3QYE A;  2KDZ A;  2CQN A;  4OIQ F;  3OIO A;  4PGG A;  5KVR A;  3TP3 A;  4P9U A;  4M3D A;  4H0E A;  2O8K A;  1IW7 F;  1I6H J;  4J19 A;  4MQV A;  3GO5 A;  2CV1 A;  4J00 A;  2F48 A;  3GFM A;  2AS5 F;  2PEX A;  3HSR A;  3CF2 A;  4BE0 A;  2JA6 J;  4PK4 A;  5L3C A;  2AXT C;  3ONQ A;  4UB6 C;  3H5R A;  2VT3 A;  4C30 A;  1QPM A;  4C2U A;  3VYU B;  2ME0 A;  3F22 A;  3S15 J;  3PNT A;  1JUM A;  4KN7 X;  2D45 A;  1MMN A;  3CC4 I;  3K10 A;  1PJR A;  3I54 A;  3GTJ J;  1KA8 A;  2R7Z J;  1S7E A;  1STZ A;  1U0J A;  2ZNZ A;  1FP2 A;  3AL0 C;  4D7M A;  1WI9 A;  1V5F A;  3DQV C;  1KYW A;  3TO9 A;  3WG9 A;  4IHX A;  3ECH A;  4BKX A;  2XKP A;  3FWE A;  3V7S A;  3PIO F;  3NAU A;  1FTT A;  4L18 B;  3F0C A;  3TL4 X;  1MSF C;  2QWW A;  1LJ9 A;  4N4N B;  5CVU A;  4LB6 B;  3VOE A;  5J8F A;  3COA C;  2ISY A;  1HW1 A;  3OV8 A;  2ISZ A;  2O61 A;  2FQ3 A;  2KKO A;  5F1R A;  1VQK I;  3JRB A;  1KYZ A;  2R4G A;  3OIP A;  3I53 A;  2HKX A;  4A3J J;  4HDV A;  1LFB A;  2HQN A;  3IWZ A;  4Z6Y A;  1WWX A;  2EJR A;  4V2F A;  1JT0 A;  3H9J A;  1CQT A;  4CA0 A;  4OIO F;  4BQN A;  3DPT A;  3LSM A;  3GCM A;  1W5C C;  1X3Z B;  2W84 A;  4L9J A;  4LIU A;  5DUK A;  3GYH X;  4RS8 A;  4BBR J;  4HQE A;  1FT9 A;  5E20 A;  2OQR A;  2OPT A;  2EBI A;  3HXL A;  2H09 A;  3ABT A;  3WU0 A;  3J7Z I;  1D0X A;  1D1A A;  2K9N A;  4HLX A;  5K7H A;  1LFU P;  2R0Q C;  2GZW A;  2KIU A;  3ZR8 X;  2MH9 A;  4ZDP A;  4O5V A;  3GXO A;  4IHY A;  4A3C J;  4ZYH A;  3HOT A;  3DEW A;  2GIV A;  2YU3 A;  3RKW A;  2BY0 A;  3BR1 A;  3ESW B;  1BN5 A;  1SD7 A;  1GUU A;  5F0F A;  4S05 A;  2XAJ A;  1FMW A;  1W7P D;  2VKV A;  5CQG A;  1F4K A;  3MQ0 A;  5F0C A;  4YFK F;  4HSR A;  4KIT B;  5IYD J;  2ID6 A;  4BE2 A;  1ZYR F;  3KP2 A;  3PNY A;  2LK2 A;  5F08 A;  3ELK A;  3U1K A;  4A5M A;  1F1Z A;  5EG0 A;  4CUG A;  2H6B A;  3OYH A;  3CC7 I;  2DFF A;  2L4M A;  4FX4 A;  4EJT A;  2VIX A;  1TQM A;  2BBY A;  2CUE A;  3VOD A;  3PM1 A;  1FYK A;  3ABM H;  1A36 A;  1IN7 A;  5HS8 A;  2CSO A;  4XSZ F;  4QTR A;  3K70 D;  2R5Z B;  4AUX A;  1APL C;  2Y30 A;  1RR7 A;  4FAS D;  2ZNY A;  1BOB A;  1X1C A;  5K5Q A;  4NC8 A;  4IQJ A;  5F1J A;  1ZHF A;  5DDG A;  3LSJ A;  2ICW G;  1ITY A;  3SZT A;  2Z9O A;  3HJE A;  4ZTJ A;  2IGK A;  2DCE A;  2L4A A;  3HUG A;  3LMM A;  3PNV A;  3CMM A;  1X2N A;  2XGE A;  4NB5 A;  4OIR F;  2E5N A;  2M5W A;  3RCO A;  2YX4 A;  1N75 A;  2FEZ A;  2HQR A;  3NQO A;  4YFX F;  4LD5 A;  3E97 A;  4KIS A;  3IH3 A;  3LOC A;  4M9X A;  1U78 A;  3OS2 A;  3LA7 A;  3GTK J;  3KLO A;  2IVM A;  4I99 C;  2RGV A;  4LK1 F;  2L54 A;  1AKH A;  2KIS A;  3LAP A;  2P4W A;  3CCV I;  1LDD A;  3BRO A;  4UY8 I;  3C2G A;  1TWF J;  4HYE A;  4G7Z F;  1G3S A;  1FEX A;  4XN0 A;  5FJ8 J;  3GTQ J;  2LMD A;  1HA8 A;  3AG2 H;  1T95 A;  2WV0 A;  2K9M A;  4BXU A;  3GW2 A;  2E2J J;  1TW3 A;  1JGS A;  3CMY A;  4DBQ A;  1YO5 C;  3DV8 A;  2QQB A;  2OD5 A;  5J47 A;  1RPW A;  2YUS A;  2VQC A;  2PMZ N;  1I1G A;  4CYC B;  1UMQ A;  2RDP A;  1BI2 A;  4HX4 A;  2CQX A;  3I9V 2;  2H27 A;  2XAF A;  4AM3 A;  4A0Y A;  3L1P A;  1MGT A;  3GTG J;  2CH0 A;  4Z2Y A;  3M1E A;  3LL7 A;  2IS1 A;  3KP4 A;  3RYP A;  4N9I A;  3H92 A;  4LIV A;  2E7W A;  1SMT A;  2B9S A;  4F93 B;  3H3Z A;  1R49 A;  2H1K A;  3E5U A;  2V9K A;  4PJ0 C;  3HOS A;  2QZ8 A;  3LSG A;  4JX6 A;  2KMU A;  4U7B A;  1EV7 A;  2KJC A;  5LHG A;  2XUB A;  3DXJ F;  5GAH J;  2MG4 A;  5CKT A;  2LG4 A;  1ZR2 A;  2QGU A;  2E71 A;  1T0F A;  3OR2 C;  4QLC U;  2WTE A;  2ZXW H;  4HF1 A;  5L3D A;  4ZJZ A;  2STT A;  4EGY A;  4BGD A;  1E2X A;  3QPS A;  4OU0 A;  3OYN A;  1H89 C;  2VJJ A;  3SZG A;  5EZH A;  4AIJ A;  5FLX K;  3B6C A;  2LC2 A;  2VQL A;  4DW6 A;  3BG7 A;  1S72 I;  2A68 F;  3CLO A;  1U5T A;  2O0Y A;  2XPU A;  3OYJ A;  5LLQ A;  1BM9 A;  5C3E J;  4M9S A;  1OLT A;  2CW8 A;  3A03 A;  1RNL A;  5HOD A;  3K4B A;  1TLH B;  2Y0M A;  2DA7 A;  3REO A;  2ZSH B;  4AIH A;  1I3Q J;  1VQO I;  1RR8 C;  1XCV A;  2Y2Z A;  3CJT B;  4GYI A;  4KIG A;  1U3E M;  2G9W A;  1Q1H A;  2VKE A;  4ZH4 F;  3ZMZ A;  5C44 J;  3WTT C;  5B1B H;  3AL0 B;  2O8X A;  1BJA A;  4EM0 B;  3QAH A;  3ZRG A;  2IS6 A;  2IS2 A;  1X1P A;  1K6Y A;  1VTN C;  2M0C A;  1JGG A;  4CSW A;  4ESF A;  2LKX A;  2NNY A;  1POG A;  2Z16 A;  2QBY A;  2DA5 A;  1TNS A;  1ZG1 A;  2Q2E B;  4QIW N;  2L2O A;  4BAY A;  2DXI A;  3D5R C;  2JWT A;  4DBR A;  2HXO A;  4NQW A;  1P9Q C;  4MIM A;  3I55 I;  3M3Y J;  1OYW A;  4S0H B;  3U2R A;  3F9K A;  3BTL A;  3PO3 J;  2F4O B;  1MKM A;  3CJR B;  3V8J A;  1LB2 A;  2VI6 A;  2O7O A;  3CZ6 A;  3ZMS A;  5H6Q A;  2K9Q A;  1EJ9 A;  3LQQ A;  3KYC B;  3MD2 A;  1XX5 A;  4CCO A;  1DP7 P;  3DF8 A;  4G7O F;  4S04 A;  4I0B A;  2EZK A;  1U2W A;  3HOY J;  1MBH A;  3DWL E;  4HNU A;  1PUF A;  3IC7 A;  1EA3 A;  2I10 A;  2KL4 A;  1LEA A;  5D8K B;  4BL0 B;  3HOW J;  1LDK B;  4XLA A;  3G1L A;  4X6A J;  3RKY A;  4N9H A;  3ZQC A;  1DGR M;  1T38 A;  1H88 C;  3P9K A;  4AC0 A;  2CW0 F;  2XHK A;  4N0B A;  3LAJ A;  2BVL A;  2F5F A;  2WB1 N;  2CUJ A;  4JQF A;  1J7K A;  3WE2 A;  4B48 A;  4R1H A;  4WWC A;  2K86 A;  1O3T A;  2COM A;  4DJA A;  1ENH A;  2GXA A;  1ZK8 A;  1R1U A;  1R1T A;  1QBJ A;  2LBF A;  1UG2 A;  4YEL A;  3DPU A;  3CUO A;  3P9C A;  1R7J A;  3L2R A;  4G9Y A;  3CO6 C;  2M4G A;  1H0M A;  4IHV A;  4EM2 A;  1UB9 A;  1YLF A;  4AU7 A;  2YX7 A;  4KYW A;  2A6E F;  4BE1 A;  2BHZ A;  1AA7 A;  4M73 A;  4PSX A;  2DDB A;  1TWH J;  2V4J C;  3CDL A;  4L9N A;  4RBO A;  1G59 A;  2XIG A;  4PCQ A;  3NAR A;  3G71 I;  2NVQ J;  1IJW C;  4BH9 A;  2CFX A;  1TBX A;  3ABK H;  4FET A;  1HKT A;  1IUY A;  2R7S A;  1OYY A;  2X6W A;  3MAJ A;  1E3H A;  2DOE A;  2YS9 A;  4XLP F;  2DMU A;  4XRS A;  3G6E I;  4IL6 C;  2L7M P;  5FLX Z;  1UAA A;  3A2K A;  3S17 J;  2LD5 A;  1YIT I;  5BPI A;  4NC6 A;  4D7N A;  3MVP A;  2K3F A;  4GRI A;  3CES A;  3TO6 A;  2QM3 A;  4XLH A;  5EJC A;  1Z77 A;  5EEH A;  2ECB A;  2V6E A;  1IDY A;  3ZN1 A;  1SFO J;  1XGM A;  2RKH A;  2K40 A;  5EF6 A;  1Y1W J;  2LF8 A;  1LE8 B;  3PUF A;  3OSG A;  2MAB A;  5FFZ A;  3I59 A;  2HXI A;  5KAF C;  2PI0 A;  3BWG A;  1JTY A;  1TZL A;  2FBK A;  4F52 A;  4B3A A;  3AG1 H;  2IXS A;  1OPC A;  2XPV A;  3S3N A;  3KIO A;  3EUA A;  3SYT A;  4XOP A;  3BR0 A;  3DP7 A;  2A6H F;  2JUG A;  2L3D A;  3CDH A;  1MMA A;  3FIS A;  4A3M J;  1P7I A;  4LLN A;  1WJB A;  1C0W A;  5FRO A;  4BJ6 C;  1NG7 A;  4F91 B;  1WCM J;  3CDI A;  3IUO A;  2ZJ2 A;  1Z7L A;  1YHQ I;  1SVO A;  1FOX A;  3FM3 A;  4C3H J;  2EFP A;  5M5Y J;  2VT2 A;  2OBP A;  3HHG A;  3D0S A;  1WFX A;  2HOA A;  4HEA 2;  4BY1 J;  3QPH A;  3O8H A;  3T8R A;  3I71 A;  2LR8 A;  2PX9 A;  1BIA A;  1FC3 A;  5IT9 Z;  3D5S C;  2JZY A;  3HOZ J;  2XB0 X;  2FOW A;  1KQ9 A;  2NAZ A;  2EQR A;  1O3R A;  4ASN A;  5KNL A;  3DU6 A;  5EYR A;  1X1B A;  2HOT A;  1Y56 A;  2DI3 A;  2KIQ A;  3OYA A;  2IGN A;  4BXX J;  5EEG A;  2R7O A;  2Y9Z A;  2IP2 A;  3V8K A;  2V26 A;  1IUF A;  3CQZ J;  3RPQ A;  3RQ4 A;  1FWZ A;  4D5C A;  4FTH A;  2FMY A;  2VBZ A;  1OCT C;  1MMG A;  5D4S A;  5CYV A;  2X85 A;  3W2V A;  4R79 A;  2KHM A;  3OYE A;  2WWY A;  2IJL A;  3H1C A;  2ZXH A;  1SVL A;  2E7X A;  1B9M A;  1R5H A;  3CJQ B;  3KCC A;  2DQR A;  4ABZ A;  4KIB A;  4ENK A;  1Y1V J;  2TDX A;  5F04 A;  4BJ5 C;  1IN5 A;  1NTC A;  2XF5 A;  1WJD A;  5B5E C;  4FCY A;  3BR2 A;  3MZY A;  4B44 A;  4U88 A;  3H3V K;  1AHD P;  1V3F A;  2MGQ A;  5BPD A;  1YOV B;  2IS4 A;  3QRF F;  4A93 J;  4LLG F;  4L9V A;  2DT7 B;  1LQ1 A;  3ML6 A;  2BXY A;  1U9N A;  4HG2 A;  2QSH X;  1N78 A;  1WJE A;  3U1D A;  1YG2 A;  3R4K A;  3V7R A;  3BZ6 A;  2NVT J;  4KIF A;  2M1B A;  2R7X A;  1ZKG A;  1FY7 A;  2HS5 A;  2HTJ A;  2D5V A;  1TT5 B;  5JHU A;  3FHZ A;  3F72 A;  2J5O A;  3A1Y A;  3ABU A;  2LDU A;  1GV2 A;  1AWC A;  2X48 A;  3ZQF A;  4WCG A;  2KIF A;  4AVP A;  4RDU A;  5GPA A;  4I98 B;  3OYG A;  2OU2 A;  2R5Y B;  4ZDO A;  2Q1Z B;  4D1Q A;  1MDM A;  1YFH A;  1ETV A;  2HQ5 A;  5JFR A;  2Z99 A;  4K2E A;  2IA1 A;  2E36 A;  3DTI A;  3S8P A;  1EKE A;  3CCY A;  1G3W A;  2R7D A;  1GT0 C;  1W5T A;  1XMK A;  4UHT A;  1KON A;  2RNJ A;  5D4R A;  4B43 A;  3LWF A;  2QCO A;  3K4L A;  2J5P A;  3RZO J;  3RKX A;  1QA6 A;  5LFA A;  3F6O A;  4OIN F;  4XLE A;  3D1N I;  4E7L A;  3EYI A;  2HGC A;  4CIC A;  3FM5 A;  3CP8 A;  1X58 A;  2HYJ A;  2EV0 A;  3KYD B;  1J9I A;  5CLS A;  1ETQ A;  4BEH B;  3JTH A;  2E1C A;  3ZQL A;  1ZRF A;  2ESH A;  4C3I J;  3AKZ A;  4KA4 A;  1XSV A;  1K4T A;  4Q47 A;  4F92 B;  4U0W A;  2OUM A;  5CJ9 A;  2VE8 A;  2JA5 J;  1RZ4 A;  2XB5 A;  1A04 A;  4AYB A;  1OKR A;  1ZH5 A;  3SXY A;  2Z5U A;  1IRZ A;  4A6E A;  4XKB A;  4E7S A;  4I76 A;  3QOP A;  3Q9V A;  3N05 A;  4HPQ A;  5CQE A;  1HSJ A;  3HRM A;  1ETK A;  4IQ4 A;  3V7C A;  4EAT A;  3JRC A;  3CCQ I;  2PJR B;  1ETY A;  3I0T A;  1SVM A;  2P5V A;  3GFL A;  2NYX A;  4BYY A;  5LEK A;  4DZJ A;  3L9F A;  5HDN A;  3BDD A;  3H0G J;  4L0Z B;  2A5Y B;  1P4A A;  2ZFU A;  3DTE A;  1J75 A;  2E35 A;  4ZDL A;  4YG2 F;  5D5U B;  1VQM I;  2G7H A;  2HI3 A;  3R60 A;  4H4K C;  1Y8Q B;  5K1Y A;  3C2B A;  1Z67 A;  4AID A;  3JAM K;  3QYB A;  1WVR A;  1DU0 A;  3BPV A;  2GLO A;  2EIM H;  2K02 A;  4D0P A;  2VC1 A;  2LRD A;  2H6C A;  2LTP A;  5LGT A;  3C3W A;  3MKZ A;  2MFZ A;  2BXZ A;  4LFU A;  2XSD C;  2HDC A;  1E3O C;  1JUP A;  1SFU A;  3L2V A;  2R7T A;  3ZMU A;  4BQQ A;  1OCO H;  2AQE A;  4J01 A;  5FD6 A;  3HC7 A;  1HKS A;  1FX7 A;  4I01 A;  5F64 A;  4LG0 B;  2DTZ A;  3HYI A;  2UUZ A;  2HZT A;  1J59 A;  2M87 A;  1PP7 U;  1MBE A;  2BY2 A;  1EH6 A;  2W1O A;  5ICF A;  2WAE A;  1B72 A;  1O57 A;  2NVX J;  3RTR A;  1LUJ B;  3N4M A;  5DEQ A;  3MKY B;  1JJ6 C;  1LVA A;  1YTY A;  5K7Z A;  2LKP A;  4XSX F;  1F36 A;  2KQR A;  1WHU A;  4EM1 A;  4HQM A;  3S93 A;  4FE7 A;  2HU9 A;  3PSF A;  5FKN A;  3N97 A;  1ZAR A;  4KT5 C;  2QLZ A;  3F3X A;  1HXD A;  1IRF A;  3VPR A;  4HOB A;  1Y6I A;  2XGD A;  3JRF A;  3MCZ A;  5E17 F;  3BPX A;  4BUP A;  2MW8 A;  4GDF A;  5HNF A;  5E3O A;  1Z9C A;  1TWC J;  2C6Y A;  4NUB A;  1XS9 A;  5D5W B;  2LY2 A;  2JPB A;  3BQY A;  1IRG A;  1V5G A;  2ZCW A;  3WU1 B;  2ZME A;  3FF5 A;  4IHW A;  1MNE A;  1S7A A;  2XF6 A;  5K5R A;  1I5Z A;  3ZMD A;  5DS9 A;  1WZ2 A;  3E3V A;  5E1Z B;  4RM3 A;  3R6S A;  2DO7 A;  1R36 A;  4A3L J;  3RQI A;  1MH3 A;  2WAD A;  2V79 A;  4RAF A;  4CO8 A;  1XSX A;  2KLO A;  1K6O A;  2HOS A;  2NRA C;  5ED4 A;  1MJB A;  4JYK A;  3CCR I;  3S16 J;  2F5D A;  1MMD A;  1VQ4 I;  4XLN F;  1Z7U A;  2RV8 A;  2GA2 A;  2VOD A;  2HYF A;  4BHP A;  5FKK A;  2HOE A;  3VB2 A;  1TTY A;  5TRD A;  3RJP A;  3TW6 A;  1ZRD A;  1RET A;  2GXG A;  2M34 A;  4CYC A;  4X1E A;  3HOX J;  5D8L B;  1ZG5 A;  4MHG A;  4BDZ A;  2EZL A;  2NS0 A;  2Y9Y A;  4LJZ F;  4E70 A;  1U9O A;  4F7Z A;  4UNO A;  2XSJ C;  2CJJ A;  4W97 A;  3CCM I;  3PJR A;  1WRJ A;  1SAX A;  1UHS A;  1YIJ I;  1ORK A;  3I3L A;  3RSN A;  1N25 A;  3GTP J;  1MJA A;  2VXZ A;  2XGC A;  2O03 A;  4FQG A;  2W4S A;  2V9P A;  2B0L A;  2DOD A;  2X51 A;  1VQL I;  3HG9 A;  2EZH A;  4HV5 A;  4G6T B;  5J1U A;  2LKS A;  4QPQ A;  2A5W A;  4MLO A;  2GAU A;  4YIF A;  5L3E A;  3FMR A;  1P4W A;  3U21 A;  4HNT A;  2CRG A;  2YSR A;  5GPC A;  2EA2 A;  5GTH C;  1YW7 A;  2CQQ A;  2WV1 A;  1WJC A;  3P5J A;  1N77 A;  1YX3 A;  3BZK A;  2E5Z A;  3KP6 A;  2BY3 A;  2I5U A;  4I7H A;  1B6A A;  4KT6 A;  5B3S H;  2DU9 A;  2FML A;  3ASN H;  3H9Q A;  1IXS B;  1TQI A;  2QUF A;  4UUT A;  4UVA A;  1E0E A;  1XMA A;  4RA2 A;  1S9H A;  1W4M A;  1VQ8 I;  4C2T A;  2M3A A;  2AQF A;  5E8I A;  5J1Y A;  2W24 A;  5TJJ A;  2VPL A;  1HCR A;  2HKO A;  2DPU A;  3HDD A;  1A31 A;  2DJI A;  2EFQ A;  5JVG F;  1S6L A;  2LFB A;  1JKR C;  4UUS B;  2K9S A;  3BZC A;  5AON A;  5IPA A;  1S3J A;  2W00 A;  1OIS A;  2UXN A;  1T98 A;  2CV0 A;  2K27 A;  3K1M A;  4M72 A;  3MZH A;  1QGP A;  4E7I A;  2W85 A;  1WSU A;  4EJW A;  1T39 A;  3L2Q A;  4C2M J;  3M4O J;  1MZB A;  4UB8 C;  5D5X B;  4IRI A;  1UFM A;  3LSH A;  1JUS A;  4GXO A;  3E6B A;  2VQG A;  2KRH A;  1Y8R B;  2HFH A;  1A6I A;  5M5X J;  1FIA A;  3TO7 A;  2Z3Y A;  4QPO A;  4LIT A;  1YJW I;  2Q2E A;  1MSE C;  2DA1 A;  2AXL A;  2E34 A;  1BR2 A;  3I4M J;  4G8X A;  4HAM A;  2KDO A;  4I09 A;  1VF9 A;  5J40 A;  5IP9 J;  1LDJ A;  2YR2 A;  4XID A;  1DQU A;  1BA5 A;  3H5A A;  3Q0V A;  5ICC A;  2GQQ A;  3QPL A;  2OJE D;  5HLH A;  1VZ0 A;  2GXB A;  1G3Y A;  3CP2 A;  3ZQ7 A;  2XDV A;  4YIR X;  4I2O A;  1IO2 A;  2F6C A;  3G2B A;  4NC7 A;  1IF1 A;  3JRE A;  2H8W A;  3F21 A;  2DBB A;  2PMZ A;  3ZPL A;  2FD5 A;  4G6Q A;  5FFX A;  3ZP5 A;  4DZP A;  3RKQ A;  1P2F A;  3A0B C;  4CCJ A;  3H36 A;  4FX0 A;  2RQQ A;  3DPL C;  5H6R A;  1S7O A;  4L0Y B;  1XSD A;  1RKT A;  1T2K A;  2VE9 A;  3NWS A;  3OMY A;  2VOO A;  2R7V A;  1WH7 A;  3FXL A;  2PMU A;  1ZR4 A;  2F2E A;  2M9H A;  2EH3 A;  3PSI A;  2W57 A;  3ROU A;  4BHB A;  2HVS A;  3HRT A;  1YE9 A;  4CXF A;  2ZJR F;  4L5J A;  3OWT A;  2R93 J;  3HM5 A;  1DDN A;  5L3F A;  4BNC A;  3KPH A;  4Y17 A;  4ESJ A;  2L01 A;  4IJA A;  1QPI A;  3ECO A;  4A2U A;  1IDZ A;  2BOL A;  2D1H A;  1ZGA A;  2BVM A;  4PJM A;  2ZO4 A;  1LFP A;  3A4C A;  3T5X A;  5LHI A;  1IC8 A;  3TQN A;  2L7Z A;  4CHU A;  3GZ6 A;  1W36 C;  1H9T A;  1FBQ A;  3AG4 H;  3K0L A;  3W2W A;  3CMA I;  1Z91 A;  4C3J J;  1R58 A;  1CF7 A;  3ZMT A;  1QVT A;  2X1E A;  3A02 A;  2W48 A;  1W0U A;  1U6G A;  1I27 A;  4R8H A;  4UVB A;  1AU7 A;  5C4J J;  2JA7 J;  2B7E A;  4RGS A;  5IYC J;  3ZCO A;  4RGU A;  3J7Y J;  3O2P E;  3W6K B;  3I64 A;  3K2Z A;  1ZRE A;  2DOF A;  2FNA A;  2LY9 A;  5J3L A;  3C18 A;  4M6Y A;  2GA1 A;  1LPQ A;  1K78 A;  1I6X A;  1P7J A;  2PBI A;  5FKL A;  3W6V A;  3E6C C;  1V4R A;  1OYI A;  3O8G A;  2BW3 A;  5JHF A;  2A61 A;  3WE3 A;  3J80 K;  2MLG A;  4PFP A;  2UWM A;  1HOM A;  1TWA J;  3M9A A;  2Z1D A;  3GEZ A;  2IPQ X;  5DCF A;  1XPX A;  2CYY A;  1LE8 A;  2VBX A;  3ABL H;  1KU9 A;  1SFE A;  1YQA A;  5AIQ A;  3CD6 I;  1WJF A;  3T8T A;  2FRH A;  3X2Q H;  1F9N A;  1TL8 A;  1GVJ A;  2DA4 A;  3CUQ C;  2L9R A;  3HHH A;  3ZQQ A;  4A5N A;  2IRF G;  1G8X A;  1T08 B;  2FOK A;  3J7A Y;  2CQK A;  2FSW A;  3DFG A;  3PFI A;  5EDN A;  2QA4 I;  3DKX A;  3IH2 A;  1RI7 A;  3PIP F;  2NXN B;  4IOC F;  1K79 A;  2O6G E;  2IGO A;  4XQF A;  2EIN H;  1RRJ A;  1EH8 A;  2P5K A;  5GP9 A;  3M8E A;  1X4O A;  5FD5 A;  3FKI J;  1BJZ A;  1PDN C;  1YRN B;  2ZJP F;  2H94 A;  2JSC A;  4KMF A;  3FXR A;  4ANJ A;  2JN6 A;  3TED A;  1HBX G;  1BC7 C;  1FMV A;  2BZT A;  1GXQ A;  3F8B A;  2G0E A;  2R7U A;  2VC0 A;  3WTZ A;  1NG6 A;  1O3Q A;  1HQC A;  1ZLK A;  2FBH A;  2ZXI A;  1QZZ A;  3PFY A;  3VSL A;  5EG0 B;  1FLI A;  3IAM 2;  3FXJ A;  2K3P A;  2CGP A;  1R1V A;  2WB1 A;  3BR3 A;  3LSR A;  4B47 A;  3CCU I;  3E7L A;  1R71 A;  2FQ4 A;  1LKX A;  1RUN A;  3KP3 A;  5IP7 J;  2WBM A;  3KET A;  5IT3 A;  5HS7 A;  4BQO A;  4RAG A;  1FOY A;  3ISP A;  4M71 A;  2VUM J;  2AO9 A;  2FU4 A;  3K9T A;  3S2W A;  2KP6 A;  4AWX B;  2L7K A;  5GAE J;  1R6R A;  2A07 F;  2FJ1 A;  4MNU A;  2CUF A;  4CYD A;  1MBJ A;  5ILS A;  3QP6 A;  3WHC A;  1VQN I;  3M07 A;  4V19 K;  4RLF A;  3HUG B;  1VQP I;  3H35 A;  3EUH C;  2HVR A;  1XD7 A;  2I8D A;  1M1E B;  3QOD A;  1SD5 A;  3TOB A;  1KGS A;  5DTD A;  3IKV A;  1AOY A;  3S1N J;  5K5O A;  5M5W J;  4V2G A;  3B73 A;  1TP4 A;  3KEQ A;  4OAZ A;  4WXD A;  5EGO B;  3ERE D;  1VQ7 I;  5KHD A;  4BAC A;  3FBN B;  2N8G A;  1SD6 A;  5LRR A;  1ZGW A;  2MSY A;  3LSK A;  4A3B J;  1ACI A;  2KRC A;  1WH5 A;  3I5U A;  4A0X A;  1HLV A;  2IA0 A;  4NBQ A;  4Q5S F;  4GGG A;  2ADU A;  3GTL J;  4A3G J;  4TV7 A;  2OCC H;  4MFD A;  3W2A A;  3LFK A;  2QYO A;  2Q0O A;  5BOX A;  5H20 A;  3ZQH A;  3BT9 A;  3Q3S A;  1HF0 A;  1YIO A;  3L2W A;  2CG4 A;  1MNM C;  1FBS A;  2R5Y A;  4BY7 J;  5AIP A;  4MTD A;  5LHH A;  1B4A A;  4KFC A;  3BJA A;  5M3F J;  4DIQ A;  3GX4 X;  4L5E A;  1YW8 A;  1NK2 P;  3KZY A;  2O5R A;  3C2H A;  4DQ2 A;  3J80 Z;  2Y31 A;  4DNC A;  4LK0 F;  2LSO A;  1J2X A;  1WGX A;  2YPR A;  5LBQ A;  3TP0 A;  1F5T A;  3I4N J;  4AVZ A;  1D8K A;  4X0G A;  1FOW A;  2M4K A;  5CPR B;  3L09 A;  3VDX A;  2VN2 A;  5FO5 A;  2VLA A;  1I39 A;  2DYR H;  3H9G A;  1USS A;  3WTY C;  1OCZ H;  2HWV A;  4EEF G;  3VEP A;  4XLC A;  5J6X A;  3DKY A;  4GCV A;  3K4M A;  2V6C A;  4E7K A;  1V54 H;  3K69 A;  4XN3 A;  5D6F A;  3M8J A;  3J7A O;  3BC8 A;  1FBU A;  3K7A J;  4IVN A;  3W6J B;  3RIR A;  5FLM J;  4WXH A;  3SFI A;  3KEO A;  3QOE A;  2MLK A;  3SJM A;  1SFX A;  1OR7 C;  2JRM A;  3UKG A;  3QU3 A;  2GBY A;  4AD9 A;  2DMP A;  2F5V A;  2AHQ A;  3GF2 A;  3ERM A;  4XIC A;  4YRV A;  1Z21 A;  2P7C B;  1WJA A;  3BY6 A;  2PJR A;  3W3C A;  1IAW A;  1H8A C;  1H9G A;  1RUO A;  1IG7 A;  2VOP A;  5DYM A;  3L2U A;  4OOI A;  3IKT A;  5H2F C;  2QSG X;  2HPI A;  1FJL A;  4XM3 A;  3K4K A;  4UV9 A;  3S3M A;  1FZP B;  2V1D A;  1R00 A;  2EPF A;  2JVG A;  2ETH A;  3BR6 A;  1IXR C;  1FNN A;  1QVU A;  2QQ8 A;  3LA2 A;  1FPQ A;  2LYC A;  3M7G A;  4LGW A;  2NS7 A;  2ZFW A;  2H1L A;  2V1X A;  3HTU A;  4PJN A;  5E3M A;  4CCN A;  3QPT A;  3DTK A;  3DKW A;  3DLA A;  3IV5 A;  1VI0 A;  3L7W A;  3GTO J;  3GLX A;  2FF4 A;  5DM7 F;  3HKZ N;  2DK8 A;  3EET A;  2LOO A;  3CTA A;  4N4O B;  1YX5 A;  2X1C A;  3IAS 2;  2QVO A;  4A3K J;  3IRR A;  1UHW A;  1WI3 A;  3PO2 J;  2QBY B;  4L5I A;  5IY5 H;  1IN6 A;  5E79 C;  3OS0 A;  2RVC A;  4LG0 A;  2EV6 A;  3DBH B;  3BCB A;  4NQW B;  2WC2 A;  5HNH A;  2X4H A;  4KJZ A;  5BNG A;  3DEE A;  5DCM B;  4II3 A;  1K61 A;  2ZSI B;  1X1D A;  5M3M J;  4XKW A;  2MYS A;  2DYS H;  3K1N A;  5HLI A;  2DMN A;  2Y0S N;  3WHB A;  3K70 C;  2MBF A;  1GHC A;  3S1Q J;  1K4S A;  3F6V A;  5HVQ C;  3CC2 I;  2LLK A;  2M2E A;  1B9N A;  4A6D A;  1HST A;  4BXF A;  2KJB A;  3CCE I;  4IKF A;  2XVC A;  1PUF B;  3WU2 C;  3VFZ A;  1HW2 A;  1S8N A;  3JRG A;  3IP4 B;  3CUQ B;  3VYT B;  2E1M C;  2EWN A;  3OYM A;  3SDG A;  4E7Z A;  4HDU A;  2HTS A;  3D5L A;  1R9T J;  2JA2 A;  1J09 A;  3G73 A;  2VBY A;  3KEY A;  2YU9 J;  1P6R A;  4A3F J;  3FK7 A;  5F6F A;  1L0O C;  3OL3 A;  1OCR H;  2KFD A;  2KIM A;  4QWQ A;  3WTX C;  1XGO A;  4JX4 A;  4D5F A;  4OMY A;  1HC8 A;  3ZGK A;  2Y69 H;  3KZZ A;  4EV0 A;  3K2A A;  3MFK A;  3FXO A;  4HZF A;  3K6G A;  2JUC A;  4HBL A;  2EIK H;  2WA0 A;  1YJ9 I;  4MQ9 F;  3O3K A;  2XKO A;  4QSH A;  2CU7 A;  3WTU C;  5LRS A;  2QKM B;  4RGX A;  3KYL A;  5J8C A;  3VWB A;  4ZYD A;  3G1O A;  3K4N A;  4M3G A;  2IGM A;  4DYQ A;  1VQ5 I;  1IGN A;  4Q4Z F;  3A01 B;  2XRO A;  4LB5 A;  1XGS A;  3E0J B;  4E7J A;  2HYG D;  2LF7 A;  1ZAO A;  4XON A;  2Q8K A;  4C9Y A;  3ASO H;  5FRM A;  3HEF A;  1IZ1 A;  5LD2 C;  4IHS A;  4B8X A;  3OYK A;  3CF5 F;  1FP1 D;  4MFE A;  1IN4 A;  2CWE A;  2KPM A;  2M8E A;  4JBA A;  3V42 A;  1NH3 A;  1FTZ A;  2BHY A;  4GYG A;  3U9G A;  4PFO A;  3CO7 C;  5LGN A;  3PQJ A;  2K7L A;  1FYM A;  2LH9 A;  3JRD A;  3DLL F;  1T8I A;  3PUB A;  1D5Y A;  3F8C A;  1S29 A;  2CS3 A;  1DGW Y;  3F8F A;  3EYY A;  1OMI A;  2ZME C;  5IP6 A;  2X6X A;  4RB3 C;  4YEJ A;  4G6D A;  4RAY A;  4EJU A;  3E6M A;  3HB9 A;  3JSP A;  2FUG 2;  2CO5 A;  4G7H F;  4UUS A;  1D8J A;  2VJI A;  2VJ4 A;  1OJL A;  1JKQ C;  4JK1 X;  4M3E A;  5JR3 A;  1T6S A;  2E19 A;  3FKJ A;  3S32 A;  5HLG A;  4FE4 A;  1O4X A;  4XOR A;  3G4S I;  1HDD C;  2R5Z A;  1IN8 A;  3S14 J;  2P6T A;  3RPU A;  3QQA A;  2DK5 A;  1TT0 A;  3DCF A;  1G6N A;  4IRG A;  1QU3 A;  2A3S A;  1BR1 A;  1BI3 A;  4NDL A;  1LNW A;  2DAO A;  3M8F A;  4HRI A;  2L9V A;  5DD8 A;  2QKL B;  3P9I A;  2EV5 A;  4CDG A;  3K4C A;  3F23 A;  3BOQ A;  5F0H A;  3HGY A;  3BG3 A;  2CQ7 A;  2GIZ A;  4XR6 A;  2EA4 A;  3I4P A;  4YII A;  4XBF A;  4U0Y A;  1JKP C;  1UST A;  5J1R A;  2STW A;  2HVQ A;  4PUS A;  2VKD A;  6PAX A;  1E17 A;  3I58 A;  1X2M A;  2PLY A;  3DEU A;  2OZ6 A;  3DU5 A;  3Q9S A;  1L3L A;  4Y15 A;  1MMS A;  5EEA A;  1JI8 A;  2P6S A;  2BV6 A;  2DDA A;  2BY1 A;  5TIS C;  1MW7 A;  3VYS B;  2ZC2 A;  2Y75 A;  1KZH A;  2LNB A;  2FNP A;  3KX2 A;  1QZE A;  2QQA A;  1O7F A;  1XC5 A;  2WAF A;  2W7N A;  4IOA F;  4RM2 A;  5LGU A;  3LSI A;  4HV6 A;  2CMP A;  2QSF X;  2DFH A;  1XN7 A;  3F8M A;  5ILU A;  2O9L A;  2OTL I;  1W1W E;  1B8I B;  2PN6 A;  4BBS J;  1KQ0 A;  4ON0 A;  2P5L C;  3UNG C;  1BI0 A;  4ESB A;  3LNQ A;  4HLY A;  2A05 A;  1ULY A;  1W5S A;  2NNN A;  2NVU B;  2GOM A;  2P81 A;  3KFW X;  3E6D A;  2DFI A;  1BC8 C;  1MDM B;  5DV5 A;  5HOO A;  2HDD A;  1Z6R A;  3VSK A;  2ECC A;  1PYV A;  2ME6 A;  4EQQ A;  4M3F A;  1X3U A;  4ZZL A;  5DD4 A;  1W7P B;  1GDT A;  3IHU A;  3HIF A;  3Q0U A;  2OCE A;  2RQP A;  9ANT A;  1JTX A;  1R5I D;  3HPG A;  1UZC A;  2DW4 A;  2L0K A;  3FX3 A;  2ZJQ F;  4Y4R A;  1QO0 D;  2DN0 A;  2PMH A;  1A6Q A;  3NEU A;  4XKV A;  1UCR A;  4Y13 A;  2X6O A;  4ZZD A;  4EGZ A;  4EVI A;  1Z0X A;  4KN4 X;  4HF0 A;  4DYC A;  2VJ5 A;  3JAM Z;  4P55 A;  1UG0 A;  1FIP A;  5FKM A;  1YW9 A;  2WY8 Q;  4RB1 A;  1X19 A;  1XB4 A;  4ZYA A;  4E7H A;  3OS1 A;  5BS6 A;  3KLN A;  4BU2 A;  3HRS A;  4IZZ A;  4BQA A;  2XF7 A;  5B1A H;  4KNY A;  3VYR B;  2E1M B;  2M30 A;  2KZG A;  2X6Y A;  3QU6 A;  3BG9 A;  3QWL A;  5ICG A;  4KUM A;  2JRT A;  2VPR A;  1YJN I;  2VKH A;  1IV6 A;  2K4J A;  2CUZ A;  3IWF A;  1J5Y A;  3WTV C;  1ZN2 A;  4XRS G;  4B4C A;  3GTM J;  4OIP F;  2OC6 A;  2VBW A;  4CCL A;  1YRN A;  2LY1 A;  1TWG J;  4A3D J;  1UHM A;  4UV8 A;  4FT8 A;  1V55 H;  2ZB9 A;  3H3U A;  3SEZ A;  1FYL A;  2JSP A;  2A69 F;  4XL9 A;  3V8L A;  2WAQ A;  2D1V A;  1KU3 A;  1E3P A;  1A35 A;  5FKO A;  4RB0 A;  3DBR B;  3HOV J;  2RC4 A;  3LST A;  1YI2 I;  2RN7 A;  2P0W A;  3CCJ I;  1BW6 A;  3KE2 A;  4A0Z A;  1GVD A;  2CV2 A;  5KCM A;  3OOP A;  3NRV A;  1MBF A;  5CVI A;  1R23 A;  5DUI A;  1SAU A;  1SAN A;  5A2Q K;  2ACJ A;  2M7A A;  4RMN A;  3AAF A;  3SQN A;  1G2H A;  4M3B A;  1SMY F;  2GOX B;  1T0F C;  2QEN A;  1JJ8 C;  2E2H J;  1SD4 A;  1GLN A;  2V9V A;  5D5V B;  2L9S A;  1B72 B;  1U8R A;  1NK3 P;  3JW4 A;  4GO1 A;  5FB2 A;  2WAQ N;  4WX9 A;  2IBD A;  1BI1 A;  1WKM A;  3LQR A;  3G3Z A;  1U5T C;  3OYI A;  1OFC X;  4BHC A;  2JTV A;  1HKQ A;  1SEU A;  4O6J A;  4UVC A;  2W82 A;  4E6K G;  4ZYG A;  3HTS B;  2NVY J;  5EGO A;  2XAG A;  1EF4 A;  1ON2 A;  1YS6 A;  2QF7 A;  1U8B A;  5TGT A;  1R4M B;  1R22 A;  2ZME B;  4HW0 A;  4NNJ A;  5JI6 A;  2VXD A;  4F3Q A;  3R61 A;  2NS8 A;  5IOZ A;  4KDP A;  3MEX A;  4KMU X;  3RPU D;  3BR5 A;  2MD0 A;  4JX5 A;  2EB7 A;  3HRU A;  2ID3 A;  4L9T A;  2BE5 F;  1I1S A;  3L2C A;  2JPC A;  2DPD A;  3G1M A;  3WGH A;  4FIS A;  4CCK A;  1RC9 A;  3OYL A;  3MZ8 A;  1YS7 A;  4LOC A;  2DOA A;  4RGR A;  3FXK A;  1D0Y A;  3LFU A;  2BYV E;  2XRL A;  3P7N A;  3GME A;  1R4N B;  2ELH A;  3MKW B;  3TDU C;  3TOA A;  4CCM A;  3OY9 A;  2JK3 A;  1QZY A;  3BTJ A;  3Q0W A;  1B1B A;  1QRY A;  1NHA A;  2GWR A;  2P8T A;  2XAS A;  3FXM A;  3WTS C;  4NHJ A;  4BS9 A;  2OAZ A;  3JCU C;  5CVV A;  3GUD A;  4U7D A;  1ETX A;  1RKW A;  4ITV A;  3H5N A;  1VQ9 I;  5J4V A;  3AG3 H;  1RIO H;  1DPU A;  1XDU A;  1SC7 A;  3FK6 A;  3LA3 A;  5CVJ A;  2Z33 A;  3S1M J;  3T0Y A;  3FXU A;  1I50 J;  3EDP A;  4PZJ A;  2K5C A;  4B09 A;  2VAS A;  3GLL A;  2R7Q A;  4RB2 C;  1ONV A;  1PUE E;  3FMS A;  3OOU A;  4HA8 A;  4HST A;  5E18 F;  1WJ5 A;  3ZXS A;  3CCL I;  2COB A;  1XGN A;  5BQT A;  4XRF A;  5EZG A;  4EJV A;  2ELK A;  3MWM A;  1MBG A;  1HDP A;  2M0M A;  1ODD A;  1BOA A;  2HQA A;  1DPR A;  4WXC A;  3HSE A;  2UZK A;  1XTA A;  5ERI A;  2RNG A;  4IHT A;  4CZZ A;  1BR4 A;  4G94 A;  4HNV A;  2L9N A;  2PJP A;  5E1X A;  3HPH A;  5A2Q Z;  2IT0 A;  1B59 A;  3TBI A;  4RAZ A;  3SDB A;  3OYD A;  2TCT A;  3BJ6 A;  1BBY A;  4LLL A;  3V4G A;  1MIJ A;  2JT1 A;  2MC3 A;  4ZYE A;  1XMX A;  4PJL A;  4EJO A;  3BTC A;  4JOM A;  2R7R A;  1FOK A;  4XOT A;  2VON A;  5E8G A;  1I3A A;  3WG7 H;  4ENJ A;  3HOU J;  1ZG3 A;  3I56 I;  4HF2 A;  2B63 J;  1XG1 A;  2XRN A;  1MH4 A;  2BEO A;  1HW5 A;  3TMO A;  5HDK A;  4DOZ A;  1REP C;  2CFO A;  4BDY A;  2FXA A;  2E1N A;  3RZD J;  3C7J A;  2V1N A;  3E5Q A;  5DCM A;  2PQ8 A;  2ZXJ A;  3EQL F;  5IT9 K;  5JLX A;  1MD0 A;  3R0A A;  5KAI C;  2UXX A;  3TW7 A;  4ETS A;  1RES A;  4IX7 A;  1ETO A;  3OSF A;  3AFH A;  1JKO C;  4PGH A;  4G12 A;  3H0D A;  1ZRC A;  3E5X A;  3GZ5 A;  1T56 A;  4ENN A;  2JJ7 A;  1T33 A;  4UUV A;  3ZQI A;  3ULQ B;  1WPK A;  2E1O A;  1KU2 A;  1AKH B;  3S3O A;  4A3E J;  2DA3 A;  3CUQ A;  1FSH A;  1VFC A;  3A0H C;  4XK4 A;  4XRM A;  3RDI A;  1ZLJ A;  4MEX F;  1MBK A;  4KIC A;  2XAH A;  2A6T A;  3JRI A;  3MMY B;  3E1S A;  4XMY A;  3BCA A;  1DU6 A;  2L02 A;  3FDY A;  2OF7 A;  3R0J A;  4F55 A;  1Z6T A;  3HSF A;  2IA2 A;  4JP0 A;  2O3F A;  2XC7 A;  4O3M A;  2XV4 S;  2OA4 A;  1K83 J;  2IAI A;  3FZV A;  4FHT A;  4ENM A;  3BJO A;  5KK1 A;  2JVH A;  1OCC H;  4M6X A;  1ZTR A;  1JT6 A;  2MA3 A;  1CF7 B;  1A5J A;  1F43 A;  4LG3 A;  1W0T A;  4II2 A;  4IRH A;  3PL8 A;  3WGG A;  2RAE A;  4Y52 J;  2DLL A;  3A01 A;  3C1D A;  4P96 A;  4BEH A;  4A3I J;  1TC3 C;  4I02 A;  4M9Z A;  3FIW A;  2LVS A;  4U0V A;  3CJN A;  5D6E A;  4E4H A;  1JE8 A;  5JLW A;  3GFI A;  3S2D J;  2LRE A;  1MJ9 A;  2XAU A;  3OYF A;  1JXS A;  1WQ2 A;  4LMY A;  2HZD A;  5FRN A;  1IXC A;  1X4P A;  1K78 B;  1D1B A;  5E3L A;  3HKZ A;  2K9L A;  3K4J A;  3F8N A;  2BW3 B;  3GVA A;  1KQ8 A;  1Y0N A;  1D3Y A;  4CGZ A;  4P5O A;  3LSP A;  4DGW B;  4ZTF A;  1ZQ3 P;  2F5C A;  1EH7 A;  4PDK A;  3BTI A;  2FA5 A;  1MND A;  1U5T B;  3M1C A;  3OR1 C;  4OWR B;  5LEJ A;  5FGM A;  3EUH A;  2HNH A;  4MTE A;  3RYR A;  4GFB A;  2JQ7 A;  1P92 A;  1TNT A;  2L7F P;  4MGR A;  3JTG A;  2WY7 Q;  3B02 A;  5IYB J;  3CME I;  4CH7 A;  2JA8 J;  3DBL B;  3J81 K;  3WTW C;  1IV8 A;  4AIK A;  2Y0S A;  3IH4 A;  3JR9 A;  3S2H J;  3BG5 A;  5CVR A;  4OAY A;  3K1P A;  1VND A;  3OL4 A;  4UXN A;  4ZC3 A;  3TGN A;  5GAG J;  1TQP A;  4PSW A;  1DUX C;  5E3N A;  2HDW A;  3BP8 A;  2NOJ B;  3JRA A;  5ILV A;  1SFK A;  2OTJ I;  5B66 C;  4B1R A;  1IRX A;  3ZQG A;  1Y39 A;  2FBI A;  3FHN A;  2DTR A;  1LVK A;  2MH2 A;  4CZC A;  1UEL B;  3L00 A;  3GZN B;  2X0L A;  4Q48 A;  4EMS A;  1JHF A;  3CCS I;  2EFO A;  3WOD F;  1BW5 A;  2TRT A;  2XGX A;  3HBL A;  1BL0 A;  1ZGJ A;  4RLQ A;  2V1U A;  5HDG A;  4XNF A;  3S1R J;  2KRF A;  3IRQ A;  1Z1D A;  3QP5 A;  2DQL A;  2ELJ A;  2F4I A;  4M74 A;  3SEQ A;  5ICE A;  4BJT A;  2IEK A;  1G4D A;  3BLY A; 
#chains in the Genus database with same CATH homology
 1QHG A;  2MC4 A;  3DU5 A;  4CCJ A;  3DWL E;  4HNU A;  1EA3 A;  2RQQ A;  2KL4 A;  1JI8 A;  3DPL C;  4BL0 B;  1LDK B;  4XLA A;  1MW7 A;  3VYS B;  1DGR M;  2UV1 A;  3KX2 A;  3NWS A;  3OMY A;  1D1C A;  2R7V A;  2BVL A;  2WAF A;  4XLF A;  2W7N A;  2CUJ A;  3EPZ A;  4RM2 A;  4JQF A;  4B48 A;  2RRE A;  3LSI A;  2CMP A;  4DJA A;  2OV7 A;  1W36 D;  3PSI A;  2LBF B;  2HVS A;  2LBF A;  1YE9 A;  4YEL A;  3OWT A;  3DPU A;  3L2R A;  3UNG C;  2M4G A;  2BOL A;  4PJM A;  2GOM A;  2BVM A;  4AU7 A;  1LFP A;  3A4C A;  4BE1 A;  4U87 A;  2HPM A;  1AA7 A;  4XKC A;  1W36 C;  3W2W A;  5HOO A;  4PSX A;  3VSK A;  2V4J C;  1PYV A;  1QHH D;  1G59 A;  2X1E A;  2Z2S B;  3NWT A;  2X1D A;  4FET A;  2VL8 A;  3ZCO A;  2R7S A;  2X6W A;  3QYF A;  1UAA A;  3A2K A;  3FBI B;  3EUK L;  3HPG A;  4GRI A;  3CES A;  3UR3 C;  4XLH A;  5JHF A;  4Y4R A;  2BW3 A;  2V6E A;  4XKV A;  2UWM A;  4PFP A;  4P1W A;  1X1A A;  2Z1D A;  2VJ5 A;  1ZEL A;  1UG0 A;  2MAB A;  4D9J A;  2R7W A;  1D0Z A;  2VQH A;  1WJF A;  2WY8 Q;  4PJJ A;  1TZL A;  1X19 A;  3ZQQ A;  1V5E A;  4F52 A;  1G8X A;  2IXS A;  4ZYA A;  3J7A Y;  2CW7 A;  4E7H A;  3OS1 A;  3S3N A;  3EUA A;  3OYB A;  3DKX A;  3SYT A;  4XOP A;  2E60 A;  4BU2 A;  4IZZ A;  2JUG A;  1MMA A;  2XF7 A;  2V7F A;  1WJB A;  3VYR B;  5FRO A;  2IGO A;  4BJ6 C;  1NG7 A;  4XQF A;  4F91 B;  4Y3O A;  2E1M B;  2X6Y A;  3IUO A;  4Y33 A;  4B3X A;  1X4O A;  1Z7L A;  2VKH A;  3BG6 A;  1ERD A;  3HL2 A;  1Z3X A;  2CUZ A;  2OC6 A;  1DP3 A;  4CCL A;  2LY1 A;  1WFX A;  3OYC A;  4ANJ A;  4HEA 2;  2KZV A;  5HLT A;  2L5Q A;  2R7U A;  1FMV A;  3D5S C;  3SEZ A;  2JSP A;  4XL9 A;  2VB6 A;  1NG6 A;  2WAQ A;  3GBG A;  5KNL A;  3DU6 A;  2ZXI A;  3PFY A;  1X1B A;  2DT6 A;  3VSL A;  3OIQ A;  3IAM 2;  1Y56 A;  1Z3Y A;  3OYA A;  2K3P A;  2IGN A;  2P0W A;  2CV2 A;  2WB1 A;  2R7O A;  5KCM A;  2V26 A;  4B47 A;  2M7B A;  3RQ4 A;  1LKX A;  1SAU A;  2WBM A;  1MMG A;  2M7A A;  3QYE A;  4RMN A;  2X85 A;  3W2V A;  4R79 A;  2KHM A;  3OYE A;  2GOX B;  1T0F C;  4BQO A;  2ZXH A;  3CJQ B;  2KP6 A;  2L7K A;  1R6R A;  1GLN A;  2L9S A;  2CV1 A;  4BJ5 C;  4J00 A;  2XF5 A;  1WJD A;  4RLF A;  3CF2 A;  4BE0 A;  3HUG B;  4B44 A;  4PK4 A;  3H35 A;  3EUH C;  3OYI A;  2HVR A;  2I8D A;  3QOD A;  3ONQ A;  2IS4 A;  2DT7 B;  3H5R A;  2W82 A;  4C30 A;  4E6K G;  4OAZ A;  3VYU B;  4C2U A;  4HG2 A;  1N78 A;  1WJE A;  3PNT A;  5KHD A;  4BAC A;  3FBN B;  1MMN A;  2R7X A;  3LSK A;  5TGT A;  3K10 A;  1PJR A;  2KRC A;  4NNJ A;  2VXD A;  3A1Y A;  4F3Q A;  1U0J A;  3W2A A;  3RPU D;  3AL0 C;  2MD0 A;  1V5F A;  3DQV C;  3OYG A;  3L2W A;  4ZDO A;  2Q1Z B;  4CCK A;  4D1Q A;  3OYL A;  3TL4 X;  2DOA A;  4N4N B;  1D0Y A;  3LFU A;  4DIQ A;  3DTI A;  3S8P A;  2O5R A;  3C2H A;  3MKW B;  4CCM A;  3OY9 A;  2R4G A;  1KON A;  3OIP A;  4B43 A;  3K4L A;  4AVZ A;  5LFA A;  4X0G A;  4XLE A;  4E7L A;  2M4K A;  5CPR B;  4BS9 A;  3VDX A;  3H9J A;  3CP8 A;  2VLA A;  3H9G A;  4ITV A;  4CA0 A;  3H5N A;  4BQN A;  3DPT A;  3LSM A;  4XLC A;  4BEH B;  3DKY A;  3K4M A;  4E7K A;  3AKZ A;  4XN3 A;  4F92 B;  3M8J A;  2OUM A;  4LIU A;  3BC8 A;  2K5C A;  2VAS A;  2R7Q A;  3HXL A;  3QOE A;  4AYB A;  3OOU A;  1OR7 C;  1D0X A;  1D1A A;  4HST A;  1WJ5 A;  4XKB A;  3ZR8 X;  4E7S A;  4ZDP A;  2F5V A;  3ZXS A;  3N05 A;  4HPQ A;  5CQE A;  2PJR B;  4YRV A;  1Z21 A;  4IQ4 A;  1WJA A;  4EAT A;  3HOT A;  2PJR A;  3W3C A;  2M0M A;  2HQA A;  3L2U A;  2HPI A;  4XM3 A;  2RNG A;  1FMW A;  3K4K A;  5CQG A;  2ZFU A;  3DTE A;  3S3M A;  2JVG A;  1BR4 A;  4ZDL A;  4HSR A;  4KIT B;  2L9N A;  4H4K C;  4BE2 A;  3HPH A;  3PNY A;  3TBI A;  3QYB A;  3SDB A;  2LYC A;  3OYD A;  4PJN A;  4CCN A;  3DTK A;  3DLA A;  2LRD A;  4CUG A;  4PJL A;  3OYH A;  4JOM A;  2LOO A;  3MKZ A;  2R7R A;  4XOT A;  2MFZ A;  4N4O B;  1YX5 A;  2X1C A;  2VIX A;  3IAS 2;  3L2V A;  2R7T A;  4BQQ A;  2AQE A;  4J01 A;  3HC7 A;  3K70 D;  4FAS D;  3TMO A;  4DOZ A;  3OS0 A;  2CFO A;  2UUZ A;  1BOB A;  3BCB A;  4NQW B;  5HNH A;  4BDY A;  1X1C A;  2W1O A;  4KJZ A;  4NC8 A;  4IQJ A;  2WAE A;  3DEE A;  3RTR A;  4II3 A;  3MKY B;  2V1N A;  1X1D A;  2ZSI B;  4XKW A;  2MYS A;  2IGK A;  2DCE A;  4ZTJ A;  3LMM A;  3PNV A;  3CMM A;  3K70 C;  2KQR A;  2E5N A;  3RCO A;  3S93 A;  2HU9 A;  3PSF A;  1N75 A;  5HVQ C;  4IX7 A;  3AFH A;  4BXF A;  3H0D A;  4KIS A;  1Y6I A;  4IKF A;  4BUP A;  3OS2 A;  5HNF A;  4NUB A;  3S3O A;  2LY2 A;  3IP4 B;  1V5G A;  3VYT B;  2E1M C;  3OYM A;  4E7Z A;  1MNE A;  2XF6 A;  3D5L A;  2JA2 A;  3C2G A;  1J09 A;  3KEY A;  4XN0 A;  4RM3 A;  1HA8 A;  3OL3 A;  2WAD A;  1T95 A;  2KLO A;  2A6T A;  2K9M A;  4DBQ A;  3MMY B;  3ZGK A;  3E1S A;  4XMY A;  3BCA A;  3FDY A;  1MMD A;  4F55 A;  3K6G A;  2WA0 A;  2XC7 A;  2VQC A;  2JVH A;  2QKM B;  4BDZ A;  3I9V 2;  3KYL A;  3VWB A;  3K4N A;  2CH0 A;  2IGM A;  4LG3 A;  2XSJ C;  4II2 A;  3LL7 A;  2IS1 A;  3PJR A;  3PL8 A;  4LIV A;  3E0J B;  4E7J A;  4F93 B;  4BEH A;  3I3L A;  3RSN A;  4XON A;  2V9K A;  4C9Y A;  2VXZ A;  4E4H A;  5FRM A;  3HOS A;  2W4S A;  3LSG A;  5LD2 C;  2KMU A;  4U7B A;  2LRE A;  2X51 A;  3HG9 A;  3OYK A;  5CKT A;  2KPM A;  2LG4 A;  2XAU A;  3V42 A;  3OYF A;  3OR2 C;  4G6T B;  2HZD A;  5FRN A;  1X4P A;  4QPQ A;  1D1B A;  2A5W A;  4MLO A;  4PFO A;  4ZJZ A;  3HKZ A;  2K9L A;  3K4J A;  2BW3 B;  3U21 A;  4HNT A;  2LH9 A;  4BGD A;  3OYN A;  1N77 A;  4P5O A;  1WJC A;  2VJJ A;  3SZG A;  4DGW B;  1YX3 A;  4ZTF A;  2E5Z A;  3PUB A;  2LC2 A;  2VQL A;  1MND A;  3M1C A;  3BG7 A;  3H9Q A;  3OR1 C;  4KT6 A;  4OWR B;  2CS3 A;  1DGW Y;  2HNH A;  1E0E A;  1S9H A;  3OYJ A;  4C2T A;  2M3A A;  2AQF A;  1OLT A;  2CW8 A;  2VPL A;  2X6X A;  3K4B A;  4YEJ A;  2ZSH B;  2WY7 Q;  2DJI A;  4CH7 A;  2FUG 2;  2Y0S A;  2W00 A;  2VJI A;  2VJ4 A;  4OAY A;  2CV0 A;  3OL4 A;  4ZC3 A;  3AL0 B;  4PSW A;  4E7I A;  3ZRG A;  2IS6 A;  2HDW A;  2IS2 A;  2NOJ B;  3L2Q A;  1SFK A;  3FKJ A;  1K6Y A;  3S32 A;  1IRX A;  3LSH A;  4CSW A;  3FHN A;  2VQG A;  2KRH A;  1LVK A;  4XOR A;  4CZC A;  2Z16 A;  1UEL B;  4PUS A;  2Q2E B;  4QPO A;  4LIT A;  2L2O A;  2DXI A;  3D5R C;  4DBR A;  1TT0 A;  1P9Q C;  1BR2 A;  1QU3 A;  4RLQ A;  1BR1 A;  2KDO A;  3F9K A;  1DQU A;  4HRI A;  3H5A A;  3CJR B;  2QKL B;  4XNF A;  1VZ0 A;  3K4C A;  3CP2 A;  2XDV A;  3CZ6 A;  4XR6 A;  2F4I A;  2ELJ A;  3G2B A;  2F6C A;  4NC7 A;  3SEQ A;  4BJT A;  3MD2 A;  4CCO A;  2HVQ A;  2PMZ A;  2VKD A;  3BLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...