1SFXA

X-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
HMSNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Conserved hypothetical protein AF2008
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01978 TrmB Sugar-specific transcriptional regulator TrmB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sfxA00
5ICEA 1CGPA 4O5VA 4EJTA 3HOSA 1TQPA 4XRFA 1IW7F 4A0XA 4QWQA 4U7DA 2ZBKA 1R1UA 2F2EA 3BPXA 2P7VB 2W25A 2RVCA 2STTA 1B9MA 3V7SA 2W85A 2X4HA 3CUQB 4KN4X 1D3YA 2O61A 2PBIA 3REOA 3T8TA 4LLLA 3LFKA 4M71A 1ZGJA 4UV8A 3LA2A 4HQMA 3KE2A 1PDNC 1R1TA 2Y0MA 1LDDA 5HVQC 1Q1HA 4DNCA 2R7FA 3B73A 4EM0B 3O6BB 3E97A 3TO6A 2MC3A 3W6KB 4R8HA 1XGOA 5E18F 5A2QZ 2HYGD 2JSCA 1XSVA 1JE8A 5FGMA 4CXFA 3ZMSA 3MAJA 5D6FA 2QENA 1WSUA 1SFXA 2DI3A 4I98B 1F5TA 2YX7A 1YS6A 1S7AA 1H9GA 1UB9A 4A0YA 2EJRA 5D8LB 1JGSA 4AIHA 2VC0A 3LAJA 1FSHA 3GW2A 1J75A 5E1XA 4CZZA 1AWCA 1B59A 2E7XA 2NS0A 1W7PD 3BOQA 2Z9OA 2XVCA 5FD5A 2QLZA 2P5LC 3CUOA 1KU2A 1F9NA 2XAHA 3I64A 3QPHA 2JZYA 4MTEA 2ELHA 1USTA 2HQRA 1R00A 1P4WA 4BHPA 1DP7P 2PEXA 1SD7A 1EV7A 2M30A 1QPMA 3BDDA 1FBUA 2HEOA 1TW3A 2UXNA 3HUGA 1K79A 2DBBA 3R4KA 5D5UB 1U5TA 2VBYA 3KEOA 1FLIA 4BH9A 2NNNA 4KMFA 1O3RA 4OOIA 1LJ9A 5HDKA 2FRHA 5DV5A 5LHIA 4HDVA 2O03A 2P8TA 4ENJA 5BQTA 1O3SA 1ZN2A 1R7JA 1ZYRF 5TRDA 1UFMA 2J5PA 1D8JA 2FA5A 4KN7X 2KRFA 3T8RA 2Q8KA 3DKWA 4LMYA 2NNYA 3K69A 1SD4A 4EV0A 4L0YB 5E8GA 2QVOA 2WTEA 1GXQA 2D2WA 4L9VA 4ZZDA 4OMYA 2VBWA 3R0JA 3ZQ7A 4RAZA 5CVRA 2WWYA 1MD0A 5D4SA 4HOBA 1U2WA 4U7BA 1UHMA 6PAXA 2DQRA 2FEZA 2VE8A 1D5VA 3W6JB 1U3EM 3HRTA 2VOOA 3MZYA 2HR3A 2VN2A 2FBIA 4BNCA 2MLGA 3E5XA 5L3BA 4A6EA 4L9TA 4P96A 2GZWA 2A61A 1OMIA 5LGNA 1O7FA 4EM2A 3VFZA 4Y15A 4MEXF 2VC1A 1BN5A 2ZJ2A 4G94A 1IRGA 1P4XA 2CO5A 2L3DA 2V1UA 2FE3A 2ESNA 3ULQB 3T5XA 2P5KA 2H6CA 3ISPA 3EDPA 2E7WA 1KYZA 5CVIA 3K9TA 1ZG1A 1MJBA 3SHFA 3DFGA 2FQ3A 1XSXA 4CDGA 2YSRA 4YIFA 2M1BA 3LSTA 4ZYDA 4L0ZB 4L9JA 3F8NA 2IA0A 1ZRDA 1B9NA 3RKWA 4JQFA 1AOYA 4GXOA 5HOOA 2IRFG 5EEHA 2P6TA 2BEOA 1T39A 1EH6A 2LNBA 1DPRA 3J81Z 2QQ9A 1IF1A 3V8JA 2QUFA 3WTZA 2HYFA 4HX7A 4Y17A 2BGCA 2PFBA 4KNYA 4KIGA 3GFLA 5IT9K 1ZARA 5FLXK 3BY6A 3CUQC 2EB7A 2NAZA 4I09A 3I58A 4EMSA 3KLOA 3QP5A 3BP8A 2DAOA 2EFQA 1NHAA 1YW9A 1Z05A 4HX8A 3IKVA 4GCVA 5TJJA 4ZZLA 4I2OA 2DFIA 4HW0A 1ONVA 1XMKA 5HDNA 3V4GA 1LB2A 1IXRC 2H6BA 4U0YA 4EM1A 4CYDA 1FWZA 1OR7A 2F5EA 3M9AA 1T2KA 2VE9A 4EGZA 5K5QA 1IXCA 5LEKA 2IA1A 3TDZC 4EJUA 1SFUA 3J80K 3R61A 1BBYA 1YW7A 3IWFA 4HF2A 2PLYA 4KIBA 3DQVC 2VT3A 1TW2A 3D0SA 5JFRA 1ZREA 2VODA 4BHBA 4BAYA 4ENNA 4HLYA 4G8XA 2GA1A 2ZO4A 5FLXZ 4CHUA 2DPDA 2TDXA 3GFMA 2DLLA 4L18B 4IPAA 3B02A 2COMA 1TNSA 1ZG5A 1EH8A 2D1VA 2L02A 3I54A 4KMUX 4FX4A 3FM3A 4OMZA 1HXDA 4S05A 3SFZA 3FF5A 3F3XA 2QYOA 4D0PA 1SAXA 3R60A 2E1NA 3K1MA 2OZ6A 2C6YA 2HS5A 1P6RA 1MJAA 3U9GA 3HRSA 1GHCA 2GWRA 1MGTA 3KP3A 4AWXB 2VOPA 2NYXA 3LQQA 4MEYF 3L7WA 4AIJA 4LFUA 2QBYA 1TQMA 5J8FA 1XB4A 1W5TA 3MWMA 4MNUA 4HX4A 1TNTA 1IXSB 2DU9A 3GO5A 1OPCA 4M9SA 4ZYEA 2EV0A 1YTYA 1MDMB 5FFZA 3M8FA 1XGNA 1FBSA 3F23A 2CYYA 3G3ZA 4UUVA 4BXUA 4PDKA 2QBYB 3F8BA 4MQVA 1I6XA 3JSPA 4CICA 1FPQA 1LNWA 2F5CA 3FMQA 3I0TA 3F8MA 3GYHX 3TGNA 5DYMA 1KU7A 4ZYGA 4RB3C 2STWA 4Q48A 3TDUC 5DUIA 4OIRF 2L01A 3DF8A 1XSDA 1JXSA 4UV9A 5LGTA 4WWCA 1K6OA 5HDGA 3EETA 3HIFA 5DEQA 1FYLA 3QU3A 5BS6A 2YU3A 1IN8A 3R6SA 1R5HA 2KKOA 2VXZA 1I5ZA 1T0FA 2O6GE 2GA2A 5AIPA 3OV8A 2OQRA 1S29A 1ODDA 3F72A 5K5OA 3Q9SA 2P5VA 3WU0A 4WXCA 5F6FA 1BM9A 2P4WA 4XSXF 5JVTA 1I1GA 2XIGA 4WXHA 3RKYA 4RGSA 3KP5A 5CVUA 4RGUA 3BJAA 3TKYA 5BMZA 1KQ0A 3TO9A 1ZGAA 1XCBA 2UWMA 1FP2A 2EV6A 1F1ZA 2A5YB 5ERIA 2HZTA 3SZPA 3P9IA 4HZFA 1FX7A 3I53A 1FP1D 4A2UA 1Z6TA 1RI7A 5H6QA 3DPTA 4RGXA 4F7ZA 2P7CB 3FXRA 4E70A 3FMRA 1LEAA 4RS8A 3RPQA 1J7KA 4RGRA 1CF7A 3QOPA 1H9TA 4IHTA 3OOPA 4OIQF 4YIIA 2M5WA 2CSOA 3CTAA 4IJAA 2ZFWA 4LG0B 3WTYC 5D6EA 2ZXJA 3WODF 2HFHA 2GAUA 4N0BA 5AONA 1K7AA 3FWEA 1FOKA 2K02A 5FFXA 3O3KA 4XLNF 2JPCA 1OYWA 1K78B 1UCRA 5LHHA 3GX4X 5L3CA 3V8KA 2DK8A 5JI6A 5HLIA 4LLNA 3GFIA 4XBFA 4IF4A 1PUEE 2PMUA 1QNTA 3EQLF 4RB0A 4WCGA 5LRSA 1G3TA 2JPBA 2Z99A 2F5DA 1J5YA 4KYWA 4LGWA 4U0VA 2UZKA 4QLCU 4I7HA 2LSOA 1YQAA 1O57A 5LGUA 5ILUA 1O7LA 2RV8A 1J0RA 2QQAA 5L3FA 1JHHA 1RZ4A 2VBZA 1HW5A 4BHCA 4WF2A 1Z91A 3EUHA 1WI9A 2BV6A 2Y75A 4AD9A 4WXDA 5D5WB 4GYGA 2FMYA 3H3UA 1U5TB 2IPQX 3KP7A 2DPUA 1HKQA 5DCMA 2KJBA 3K2ZA 1W7PB 2ETHA 4XSZF 3KZYA 4YG2F 1IUYA 2EA4A 4U0WA 3ZMTA 2VT2A 5K5RA 2ISZA 3I59A 4HAMA 3QAHA 2KIFA 2HOEA 4B8XA 1BI1A 3ROUA 2A6EF 3NRVA 4YFNF 2CW0F 4P9FA 3WGHA 1R23A 2A07F 4O6JA 1QZZA 1IZ1A 4B09A 1R5GA 2OZUA 1R36A 2O8XA 3GVAA 1HQCA 2EFNA 1BOAA 2XAFA 2A69F 3QRFF 3VODA 2YR2A 2PG4A 5H6RA 3MFKA 4A6DA 3IC7A 2G9WA 4NHJA 1KA8A 4EJWA 3BWGA 3F6VA 1BI0A 1QZYA 2ZCWA 5J8CA 2MBFA 2ESHA 3KFWX 4IRGA 3ZMVA 2RDPA 1QQIA 3DEUA 3L2CA 5DD4A 2ZKZA 5LRRA 4EJVA 2FMLA 4XLPF 3GLXA 4UVAA 2B0LA 3J7AO 3WTWC 4M6XA 1P2FA 1FYKA 1BIAA 4HA8A 1RUNA 1T6SA 4IXAA 2L54A 3RIRA 3CLOA 4ESFA 5ILSA 1ZLKA 1IN4A 3E5QA 4FHTA 1FBQA 1ZAOA 2JTVA 2LDUA 4RB2C 3IKTA 4P9UA 3GUDA 4ASNA 5BPDA 4UHTA 3E6DA 2DTRA 3QPTA 1U78A 2ZNZA 1WKMA 2IA2A 5FO5A 2HDCA 1G3YA 4GGGA 2PN6A 2FXAA 3ABTA 3PQJA 1BIBA 1W5SA 3R0AA 3FXUA 5CJ9A 3M7GA 1R1VA 1S8NA 4G9YA 2PI0A 3I5UA 4A12A 4G6DA 4Q5SF 2M45A 3GF2A 2AXLA 3HTSB 1XGSA 3GWZA 4UXNA 2YPRA 3NQOA 5DCFA 3BPVA 2HTJA 4Z2YA 3ZMDA 4OINF 1T38A 1SMTA 1DUXC 3LQRA 3KEQA 2OU2A 1K78A 5DUKA 3WTSC 3JW4A 4I02A 4ENMA 4Q4ZF 2PMHA 2QM3A 3BROA 3K0LA 1J9IA 1RUOA 3SXYA 3L9FA 3WTUC 3V7CA 2XAGA 2MA3A 2OBPA 4A5NA 1Z9CA 4HF0A 3GZ6A 1HW1A 4KICA 3FHZA 1XMAA 3S2WA 1G3WA 1H0MA 1R58A 3JTGA 2EK5A 2XASA 3T1BA 3WGIA 2HTSA 1HKTA 3DP7A 1JHFA 2VONA 5LLQA 4M73A 1GXPA 4UNOA 1YFHA 2CQKA 3RYRA 3CO7C 2BBYA 3LA3A 4LD5A 1YO5C 1U5TC 1KQ8A 4CO8A 2M8EA 4P5OA 2HGCA 1OYYA 2CG4A 3GZ5A 1SMYF 2PQ8A 1HSJA 2V6CA 2L4MA 1TLHB 3HOTA 3VEPA 3GEZA 3P9KA 4JBAA 5L3EA 2XUBA 4LB6B 4UVCA 3WTVC 2JT1A 4M74A 2PJPA 1O3TA 2FNAA 3KP6A 2LF7A 3H3ZA 3IHUA 3ECHA 3C7JA 3PQKA 4WX9A 1YLFA 2V9VA 2WC2A 5DDGA 1LQ1A 4KFCA 2XKPA 1R22A 3CO6C 2O3FA 4KT5C 4N9IA 2RQPA 3IWZA 1SFEA 3FMSA 5HS7A 2FF4A 4P55A 2R7DA 2F5FA 3Q9VA 2QQBA 3QU6A 2XRNA 1WWXA 5ICFA 3H92A 2Z3YA 4HV6A 3ML6A 2RN7A 4HBLA 5HLHA 3J80Z 2MH2A 4G7HF 3M8EA 2CWEA 3WGGA 3ZP5A 3COAC 4EGYA 1GVJA 2A3SA 2DQLA 2E1CA 3DXJF 1L0OC 1TQIA 2EFPA 2ISYA 1KGSA 4PCQA 5K1YA 1YG2A 2NRAC 5E8IA 4I0AA 4KIFA 1IN7A 1P4AA 2DO7A 2QZ8A 3JAMZ 1E2XA 1XGMA 2W24A 1S6LA 3JSOA 4MTDA 4HV5A 4EQQA 4LG0A 2IP2A 3G73A 2GXBA 3ZN1A 5JR3A 3J81K 2QWWA 4Q47A 3ZMUA 1WQ2A 1HKSA 4I01A 2ACJA 3C3WA 2L4AA 1IN6A 3FX3A 3TOBA 5IT3A 4G6QA 3HTUA 1ZLJA 1XD7A 3TOAA 3V8LA 4M9XA 4KA4A 1O3QA 2LKPA 1RIOH 3DV8A 1G3SA 1UHWA 3O2PE 2HWVA 2YX4A 3BJ6A 1STZA 3DPLC 1ZG3A 1LDKB 4ON0A 3WE3A 5LEJA 5CVVA 2GQQA 3RPUA 1REPC 1TBXA 3BZ6A 5BOXA 3E3VA 3RYPA 3HHGA 3KP4A 4UVBA 5D8KB 5ICGA 1B6AA 5E1WA 2ADUA 4RAYA 5FB2A 1BC7C 4R79A 3TQNA 2EWNA 2Z5UA 1L3LA 3ELKA 2GIVA 5ED4A 1LVAA 3LAPA 2ZNYA 4K2EA 3U2RA 3EYYA 1TTYA 3HRUA 1MKMA 1CF7B 4LJZF 3RJPA 1G4DA 2DT5A 3KETA 4OU0A 1P92A 3WTXC 3SQNA 2FBHA 1MDMA 3KCCA 4ESBA 2VBXA 3GXOA 5L3GA 1MZBA 1EH7A 4A5MA 3KLNA 1U8RA 3EYIA 1FY7A 5HLGA 4LLGF 2G7HA 1KYWA 5F64A 3WTTC 4S04A 1XDUA 2MLKA 4BYYA 5D5XB 1BI3A 1WRJA 1J2XA 1F4KA 5J6XA 2FU4A 4L5IA 3N97A 5D4RA 1T98A 2J5OA 4ENKA 1IRFA 3LA7A 1ZH5A 4N9HA 4WK8F 1X3UA 3HRMA 3NEUA 2OAZA 3LWFA 1I27A 1FSEA 3ZN0A 2OA4A 3IRRA 2OD5A 3GFJA 4OIOF 2MH9A 3RKXA 1J59A 2H27A 3I59B 3JAMK 2RGVA 4CGZA 2EFWA 4MQ9F 3ABUA 3IRQA 2GXGA 2MD5A 2WV0A 2K27A 5AIQA 2IJLA 3E6BA 5KK1A 5F1RA 4AIKA 4U88A 3C1DA 3HHHA 5BPIA 1LEBA 3P7NA 4R1HA 4FX0A 1Z1DA 1Z6RA 1XCVA 1PP7U 4FT8A 4HDUA 1KQ9A 1S3JA 1I1SA 2Z33A 2V1DA 4NQWA 2RC4A 5E20A 2BYVE 3I4PA 1XDSA 5EEGA 5L3DA 2BE5F 1PP8F 3F6OA 5H20A 2H94A 1B4AA 2Q2EA 3RTRA 3VOEA 5LHGA 1HBXG 1E17A 2K7LA 1OKRA 1HSTA 3F22A 4M9ZA 3AAFA 1ON1A 3T0YA 5FD6A 4PZJA 2IW5A 3QP6A 2XV4S 4HQEA 4PGGA 4OIPF 3KZZA 4A0ZA 4IHSA 1KU9A 2D1HA 2HQNA 2O0YA 2Y48A 3F21A 1LDJA 4ESJA 2X0LA 3CDHA 1MJ9A 1ULYA 4HLXA 1IAWA 3K1PA 4IRHA 1BC8C 1YYVA 1YW8A 1FC3A 2R3SA 3RI4A 2RKHA 5JHUA 1Y0UA 2H09A 2XKOA 2IVMA 1VTNC 2A6HF 3JTHA 4GO1A 2XROA 3CJNA 3V7RA 4BQAA 5ICCA 3PFIA 4MGRA 3L09A 1FZPB 3MZHA 1SD6A 4H0EA 5DD8A 4PGHA 2K86A 2OQGA 4KUMA 5E1ZB 5IT9Z 2UXXA 1W7PA 2D45A 4ZYHA 1SD5A 4G7OF 3E6CC 4ETSA 4YFXF 1C0WA 3HYIA 3MQ0A 5CVJA 4TV7A 1ON2A 5E17F 4HYEA 4IRIA 4M6YA 3SZTA 2K4JA 3RDIA 5ILVA 3U1DA 3MCZA 2XHKA 5CYVA 3FM5A 3ERED 3E6MA 5LBQA 1IN5A 4RB1A 4JK1X 5HS8A 1DDNA 3L00A 2RNJA 4LB5A 1ZHFA 1USSA 1V4RA 3D5LA 3HSEA 1B1BA 3E5UA 3Q5FA 2IT0A 3TO7A 1W4MA 2XAJA 2XAQA 3VB2A 2KIMA 1YIOA 3F8FA 3KP2A 3HSFA 3FXQA 1FNNA 3BJOA 1D8KA 2KIUA 2KJCA 4I0BA 1FYMA 2W84A 1RNLA 3P9CA 1ZRCA 2FBKA 2ZMEA 2LF8A 3IL2A 1U6GA 2Q0OA 2XGXA 2EV5A 4LK1F 4KDPA 3HSRA 2CGPA 1ZRFA 2M87A 3C18A 1QGPA 4L9NA 2FNPA 3I71A 2HKXA 2K4BA 4O3MA 1XN7A 2DW4A 2G7UA 4ZH4F 1A04A 4L5JA 4DQ2A 3ZPLA 3N4MA 5KVRA 1DPUA 1V3FA 5CLSA 3F8CA 4Y13A 1KU3A 3M1EA 2CFXA 4EJOA 3WE2A 2A68F 5D5VB 2EFOA 4AVPA 1QBJA 1YS7A 2ZMEB 4HF1A 3WG9A 3CUQA 3WU1B 4MHGA 2FSWA 4IVNA 2P6SA 1FT9A 5HS9A 2V79A 2AS5F 2HKOA 2V1XA 1BJAA 3FZVA 1S7OA 1QO0D 4GYIA 1G6NA 1OYIA 4LK0F 4G7ZF 4M72A 3MEXA 1BI2A 5A2QK 2JRTA 2DK5A 2EA2A 5DCMB 3ZMZA 1HW2A 4NB5A 4EVIA 2FOKA 3ECOA 4YFKF 3K1NA 2W57A 1Z7UA
chains in the Genus database with same CATH superfamily
2O8KA 3QODA 5ICEA 1CGPA 4O5VA 2E60A 4EJTA 3HOSA 2EQRA 1TQPA 2IEKA 4BDYA 4XRFA 3I55I 1W0UA 2RREA 1IW7F 4A0XA 4QWQA 1UHSA 4I99C 4U7DA 4W1UA 2ZBKA 1QPIA 1R1UA 2F2EA 1TWAJ 3BPXA 1KZHA 2LY9A 4KITB 2P7VB 1U0JA 2W25A 2RVCA 5IYDJ 3W2AA 4MFEA 2STTA 1B9MA 3V7SA 4A3MJ 2W85A 2X4HA 1XMXA 2IAIA 3CUQB 4KN4X 5FLVA 1D3YA 1E3PA 2GOXB 2PBIA 1YI2I 2O61A 3FISA 3REOA 3T8TA 2VPLA 2AQEA 4LLLA 3LFKA 3L2RA 4M71A 1ZGJA 2EH3A 3FHNA 1V54H 4FE4A 2QKLB 4UV8A 2HQ5A 3BZKA 3A0HC 3LA2A 4HQMA 1Y8RB 3KE2A 1PDNC 1HDPA 1R1TA 3LSIA 2ICWG 2WB1N 1OCCH 1FOYA 2BW3B 2Y0MA 3HKZA 4JX5A 3ZCOA 3GMEA 1LDDA 3SZGA 5HVQC 1Q1HA 3ZOBA 3NWSA 4DNCA 3S3NA 2R7FA 3B73A 5F0HA 2CV2A 4NBQA 1SVLA 2WA0A 5FKOA 4EM0B 3O6BB 3E97A 3TO6A 2MC3A 3W6KB 4DYCA 4R8HA 1XGOA 1Q1VA 3ERMA 4CCLA 4HNVA 3VWBA 1ORKA 2K3PA 3TP3A 5E18F 1QVTA 1HLVA 5A2QZ 2XF5A 2HYGD 2DT7B 2JSCA 1RRJA 1XPXA 3G1LA 4MFDA 1XSVA 2BZTA 1JE8A 5FGMA 3VSKA 4CXFA 1QA6A 3LOCA 3CDLA 4I76A 2XDVA 3ZMSA 4CH7A 1OR7C 2LOOA 3MAJA 5D6FA 3VYUB 2B7EA 2QENA 3HL2A 1WSUA 3J7ZI 1SFXA 2DI3A 4I98B 4OAYA 1F5TA 2YX7A 5J4VA 2DA5A 1YS6A 2DTZA 1S7AA 3GTKJ 2BW3A 2VKVA 2AHQA 3LSGA 4XONA 3A01B 1H9GA 1A6IA 1UB9A 4A0YA 2EJRA 3BT9A 1D0XA 1JGSA 5CKTA 5D8LB 2MG4A 4AIHA 1D1AA 3AG1H 2R93J 2VC0A 3LAJA 2IBDA 1FSHA 3GW2A 3ZQCA 1J75A 5E1XA 4IOCF 2ZXHA 5IOYA 3ZQQA 4CZZA 1AWCA 1B59A 2E7XA 2RNGA 2NVQJ 2NS0A 1MH4A 5HODA 1W7PD 3BOQA 2Z9OA 2XVCA 1D0YA 1WJEA 5FD5A 4C2MJ 3OYNA 2QLZA 2DFEA 2P5LC 3CUOA 1JUPA 5H2FC 1KU2A 1F9NA 2XAHA 3I64A 3QPHA 2JZYA 3SFIA 1F36A 4MTEA 1NH3A 2ELHA 1MMAA 1USTA 2HQRA 2HXOA 1R00A 3Q0VA 2LD5A 1XTAA 1P4WA 4BHPA 4F92B 1ZR4A 1DP7P 2LKXA 2BVMA 2PEXA 3K70C 1SD7A 1EV7A 5EZGA 2M30A 3DBLB 3OYIA 3K4NA 1VQ9I 1QPMA 2P81A 3BDDA 1FBUA 2HEOA 1ZGWA 3CF2A 1TW3A 3AG3H 3OYJA 2HOTA 2UXNA 3HUGA 2ZSHB 3ASNH 3IAS2 4RAFA 4RLQA 2DBBA 3R4KA 1JKQC 1K79A 4A3FJ 5D5UB 1U5TA 2VBYA 1P7IA 4L5EA 1DU6A 3KEOA 3O8GA 1FLIA 2VQCA 3TBIA 4BH9A 1LE8A 2NNNA 3ZQGA 4KMFA 3QPSA 1O3RA 4OOIA 1LJ9A 5HDKA 2FRHA 3QYFA 4UB6C 1VQOI 1R49A 1JKOC 5DV5A 5LHIA 1Z67A 5DM6F 4HDVA 2O03A 2F6CA 2P8TA 4ENJA 3OS0A 1FMWA 4BBSJ 2M9HA 2VQHA 3AG4H 5BQTA 2NVTJ 2DOAA 5B5EC 1O3SA 4XRSA 1ZN2A 3S2HJ 1R7JA 1ZYRF 2BOLA 5TRDA 1UFMA 2J5PA 5HNFA 1D8JA 2FA5A 4KN7X 4P1WA 2KRFA 1NK2P 2X9DA 2XGDA 4XOTA 3T8RA 2ZB9A 2Q8KA 1SFOJ 3BLYA 2L9VA 2K9QA 3DKWA 2OF7A 4LMYA 2NNYA 3K69A 3HOZJ 1SD4A 5IYBJ 4EV0A 4L0YB 5E8GA 2XRLA 2JUCA 2QVOA 3EPZA 4PUSA 1FMVA 2WTEA 1GXQA 2D2WA 3KPHA 4L9VA 4XRMA 3RZOJ 4ZZDA 2ZXIA 4OMYA 2VBWA 1WJBA 2LC2A 3GLLA 3R0JA 1TT5B 4RAZA 5CVRA 2X6XA 3ZQ7A 2WWYA 2DMPA 1YRNB 4IHWA 3S16J 4UB8C 4IOAF 1MD0A 5D4SA 4HOBA 1U2WA 4U7BA 2IXSA 2KMUA 3DU5A 1VFCA 1MBJA 1Y0NA 1IRZA 1UHMA 6PAXA 3LMMA 4D5CA 2DQRA 5CQGA 2FEZA 2VJJA 3DTEA 3GTMJ 3PM1A 2VE8A 3BR2A 1D5VA 3W6JB 1U3EM 3HRTA 2E1OA 5GP9A 1U9NA 1LPQA 2VOOA 3MZYA 3K10A 2HR3A 2VN2A 3BCBA 4BGDA 1EJ9A 2FBIA 4BNCA 2MLGA 3E5XA 5L3BA 4A6EA 5DM7F 4L9TA 4P96A 2GZWA 2A61A 1OMIA 5LGNA 1O7FA 3PO2J 4EM2A 3VFZA 3PJRA 4CSWA 3MZ8A 4YELA 4Y15A 4MEXF 2VC1A 1BN5A 2ZJ2A 2A5WA 3S93A 3HOWJ 4G94A 3S14J 3CCMI 2ID3A 1IRGA 5EG0B 1P4XA 2CO5A 1ACIA 2NS8A 2L3DA 5B1AH 2V1UA 2FE3A 5E3NA 3NARA 1U9OA 2ESNA 3ULQB 3T5XA 1LVKA 1E0EA 2P5KA 2H6CA 2Q2EB 3ISPA 1I3AA 3PNVA 3EDPA 2E7WA 2MGQA 4A93J 5J4YA 1KYZA 5E79C 4M3BA 3FKJA 3KYCB 5CVIA 2BY0A 3K9TA 1VQ4I 1ZG1A 2JA5J 1MJBA 3SHFA 3DFGA 1WI3A 2FQ3A 1ZTRA 1XSXA 4CDGA 4BDZA 1LFUP 2YSRA 1MSFC 1OCRH 4YIFA 5J1YA 3S1QJ 2M1BA 3LSTA 4ZYDA 4L0ZB 5K7HA 4A3LJ 2LREA 4L9JA 4RM2A 3F8NA 2IA0A 2WAFA 4II3A 2DJIA 1ZRDA 1B9NA 2I8DA 3BTJA 3RKWA 4JQFA 4D9JA 1AOYA 4GXOA 4ZDPA 5HOOA 4ZTJA 2DA4A 3VPRA 3GZNB 2IRFG 4HEA2 5EEHA 3OYGA 2P6TA 4FASD 1WPKA 2BEOA 2TRTA 4ANJA 1T39A 1EH6A 2LNBA 4ABZA 1DPRA 3J81Z 2QQ9A 2EIJH 1IF1A 2BVLA 3V8JA 2OPTA 2QUFA 3WTZA 3S3OA 2HYFA 4XMYA 4HX7A 4Y17A 2BGCA 1BR1A 2PFBA 2K9NA 3D5RC 4KNYA 5E3OA 2Z2SB 1YITI 1HA8A 4KIGA 1R71A 2OJED 3GFLA 3KYLA 5IT9K 1ZARA 5FLXK 3BY6A 3CUQC 2LTPA 2EB7A 2NAZA 4AM3A 4I09A 5EZHA 3I58A 4EMSA 1VI0A 3KLOA 1V5GA 3QP5A 3S32A 3BP8A 3A01A 1GV5A 1SVOA 4E7IA 2DAOA 3DEEA 2NOGA 1NHAA 1YW9A 1Z05A 2EFQA 2OCCH 3HB9A 3IKVA 4HX8A 4GCVA 3RZDJ 4BXXJ 5TJJA 2ECBA 3B6CA 1MMSA 4ZZLA 4I2OA 2DFIA 2NXNB 4HW0A 1ONVA 1XMKA 2XF7A 3HEFA 2LKSA 5HDNA 3V4GA 1LB2A 1IXRC 2H6BA 4U0YA 1UMQA 3WG7H 1BL0A 2EINH 4EM1A 4CYDA 3CCVI 1FWZA 1OR7A 4NDLA 5TISC 1QU3A 1ZELA 4H4KC 4ZC3A 2LG4A 3FXJA 2F5EA 4CA0A 2HOSA 5FROA 3M9AA 1T2KA 4RMNA 5B1BH 3RQ4A 2VE9A 4E7SA 4EGZA 5K5QA 1IXCA 4HG2A 4KT6A 5LEKA 3V42A 2K85A 3NAUA 4JYKA 2IA1A 3OSGA 2M7BA 3TDZC 4EJUA 1JI8A 3HGYA 1SFUA 3I9V2 3J80K 3R61A 1BBYA 1YW7A 3IWFA 1Z0XA 1JGGA 1UELB 4HF2A 4IHXA 2PLYA 2WV1A 1ERDA 2WAEA 2XC7A 4KIBA 3DQVC 1PVEA 2VT3A 2XAUA 4PK4A 1AU7A 1TW2A 3D0SA 5JFRA 1ZREA 2VODA 3PSIA 3K4CA 4BHBA 4BAYA 4AIDA 4HLYA 5B3SH 4ENNA 4G8XA 2GA1A 4LG3A 2ZO4A 5FLXZ 5GPCA 5GTIC 4CHUA 2DPDA 1Z3YA 2BXYA 3JRHA 1S7EA 1K6YA 2DLLA 3GFMA 2TDXA 2OUMA 2OV7A 2KIQA 4L18B 4E7LA 4IPAA 3B02A 2COMA 4IQJA 1RKTA 1TNSA 4IEJA 2V6EA 1POGA 4QPQA 1ZG5A 1EH8A 1VZ0A 2D1VA 2KLOA 2HVSA 2L02A 3I54A 4DYQA 1GV2A 4KMUX 4FX4A 2H8RA 2JRMA 2QGUA 3FM3A 3JCUC 2DDBA 4OMZA 4B44A 1HXDA 2B9SA 1WJ5A 4S05A 3SFZA 3S1RJ 3FF5A 2EIKH 2OCEA 3F3XA 2O7OA 3DLAA 2E2JJ 2QYOA 4D0PA 3S8PA 1SAXA 5EGOB 1D0ZA 3R60A 2E1NA 3K1MA 4XNFA 5FRMA 2OZ6A 3FBIB 1TWGJ 1X58A 5GADJ 3S3MA 2C6YA 2HS5A 1P6RA 4XOPA 1MJAA 2V9PA 3U9GA 3HRSA 1GLNA 1WVRA 5E3MA 1GHCA 2GWRA 3PIPF 1MGTA 3KP3A 1BA5A 2ZC2A 4AWXB 1AKHB 2VOPA 2NYXA 3LQQA 4MEYF 2LFBA 3L7WA 3G1OA 4AIJA 4LFUA 1YIJI 2QBYA 3U1KA 1J09A 1TQMA 2WAQN 4B4CA 4BUPA 4A69C 2BY2A 5J8FA 1XB4A 5CQEA 1W5TA 3MWMA 1NG7A 1RETA 4CCMA 4MNUA 3DCFA 4F93B 2KISA 4HX4A 4AYBN 3DPUA 1TNTA 1IXSB 2DU9A 3DBRB 3FDYA 4DZPA 3GO5A 1KONA 1OPCA 4M9SA 4ZYEA 3L2QA 4BACA 2EV0A 1A5JA 2L9NA 2V4JC 2XF6A 4IZZA 2F4IA 1YTYA 1MDMB 5FKKA 1FIPA 5FFZA 2DA2A 3M8FA 2H8WA 1VQ5I 3H9QA 3G4SI 1T8IA 1XGNA 2O5RA 1JJ8C 2DA6A 3QPLA 1FBSA 3F23A 2CYYA 1NK3P 3G3ZA 3CP2A 4BEHB 2D5VA 4MO7A 4UUVA 4J01A 3DTKA 3SEZA 4PDKA 2L2OA 4BXUA 3E0JB 1BW5A 2E2IJ 4PSWA 2QBYB 3F8BA 4MQVA 4Z6YA 1I6XA 3JSPA 4CICA 3HBLA 1VQLI 1FPQA 1XG1A 1LNWA 2XPUA 2EZKA 2F5CA 2VJIA 3FMQA 3I0TA 3LFUA 3F8MA 3GYHX 1B8IB 3DU6A 5DYMA 3TGNA 1RC9A 1KU7A 4ZYGA 4RB3C 2STWA 4Q48A 3TDUC 3OIPA 2WBMA 5DUIA 4CCNA 2R7SA 4OIRF 2L01A 3DF8A 3JREA 2CV0A 1X4OA 1XSDA 1BOBA 3RSNA 1JXSA 4UV9A 5LGTA 4WWCA 1K6OA 5HDGA 3EETA 3HIFA 3F9KA 5DEQA 1WJFA 2M2EA 4XR6A 1FYLA 3MKWB 3QU3A 5BS6A 2YU3A 1IN8A 3MD2A 4UUSB 4EATA 2GLOA 3OOUA 3R6SA 1R5HA 2KKOA 3GTGJ 2VXZA 2Q1ZB 3AL0B 2O9LA 1I5ZA 1T0FA 3FBNB 2O6GE 2GA2A 3DKXA 5AIPA 4NNJA 3OV8A 4Y3OA 2OQRA 1OCTC 1S29A 3PNTA 1ODDA 1P7JA 4A3BJ 4DBQA 3F72A 5K5OA 4CCJA 3Q9SA 2P5VA 4B47A 2M0CA 3WU0A 2Y2ZA 4WXCA 2X48A 5F6FA 2MC4A 2EZIA 4XN3A 3VDXA 2QSHX 4CCKA 2DA7A 3IV5A 1BM9A 2OTJI 2K5CA 3A4CA 3M1CA 2P4WA 2JA7J 4XSXF 5JVTA 1I3QJ 1I1GA 3OYCA 2E1MC 2LBFA 3CMYA 2XIGA 3OIOA 3QYEA 1TWCJ 4RGSA 4WXHA 3RKYA 3JRGA 3KP5A 4UUTA 5CVUA 2JN6A 2R7UA 2VB6A 4RGUA 1E3HA 3BJAA 4OWRB 3TKYA 5BMZA 3HGGA 3LSHA 1KQ0A 3TO9A 1ZGAA 1XCBA 2UWMA 1FP2A 4XKCA 3L1PA 1ZKGA 2EV6A 1F1ZA 2A5YB 2CQXA 5ERIA 3I4MJ 2CUZA 2HZTA 3I4NJ 3SZPA 3P9IA 4HZFA 4BJ5C 2HYJA 1FX7A 2X6YA 1N78A 2KL4A 3I53A 1BJZA 5IOZA 1WHUA 4A3GJ 1FP1D 2DA1A 1X3ZB 5C4XJ 4A2UA 1Z6TA 1RI7A 2QEXI 5H6QA 3DPTA 3L2WA 2NVUB 4RGXA 4F7ZA 3DTIA 5J47A 3FXRA 2NS7A 4E70A 2P7CB 3FMRA 1LEAA 2DFHA 4RS8A 3RPQA 1J7KA 4RGRA 2MFZA 3A02A 3OR2C 2R7QA 3QOPA 1H9TA 1CF7A 2R4GA 2W1OA 3H9JA 4IHTA 3JR9A 2XSJC 3OOPA 4OIQF 3CJQB 4YIIA 4X6AJ 3OIQA 1QRYA 2M5WA 1MBKA 1W0TA 2CSOA 3S2DJ 3CTAA 1K4TA 4IJAA 2ZFWA 4LG0B 3WTYC 1YJNI 5D6EA 2ZXJA 3WODF 2HFHA 3WHCA 1VQ7I 2I5UA 2GAUA 4N0BA 5AONA 4DW6A 3FWEA 1K7AA 1FOKA 4D7MA 1HCRA 2K02A 5FFXA 3O3KA 4XLNF 2JPCA 3HOYJ 1OYWA 4HNTA 3CCLI 1K78B 1UCRA 5LHHA 3GX4X 5L3CA 1ZQ3P 1MSEC 3CQZJ 2UUZA 1VQPI 2M4GA 3V8KA 2DK8A 1Y6IA 2YS9A 5JI6A 1MBHA 2IGOA 5HLIA 4LLNA 3K6GA 4XICA 4XBFA 3GFIA 4IF4A 1PUEE 2GIZA 2PMUA 1QHHD 1R9TJ 1LKXA 1QNTA 3EQLF 4GFBA 2HVRA 2VQGA 4RB0A 4WCGA 5LRSA 3CDIA 2E5NA 1G3TA 4BQQA 2JPBA 2LLKA 2Z99A 2F5DA 2VLAA 1Y1VJ 2R7WA 4BE0A 5LD2C 1S72I 1J5YA 2BHYA 4KYWA 5BNGA 4LGWA 2E19A 4U0VA 4BY1J 4HSRA 4QLCU 4I7HA 2UZKA 1TL8A 2FD5A 2LSOA 1YQAA 1O57A 2FOWA 5LGUA 5ILUA 1O7LA 3BR1A 2RV8A 3TL4X 4X1EA 1J0RA 2QQAA 5L3FA 1JHHA 1RZ4A 4DYRA 2LH9A 2VBZA 5M3FJ 1HW5A 4BHCA 2CQNA 4WF2A 2CS3A 3PUBA 2E5ZA 2KQRA 1DGRM 2ELKA 1K4SA 3GTQJ 1Z91A 3EUHA 1WI9A 2KDZA 1WH5A 3SYTA 4C3JJ 3X2QH 1SC7A 2BV6A 3H36A 2Y75A 4AD9A 1R6RA 1PYVA 2QF7A 4WXDA 4XORA 5D5WB 4W97A 5KAIC 4GYGA 2FMYA 4GDFA 3H3UA 3H0DA 3CCUI 3JRCA 5F1JA 1U5TB 2IPQX 2R0QC 3KP7A 5GAGJ 2DPUA 4M6VA 2ZMEC 4JP0A 4AU7A 5F04A 1HKQA 5DCMA 2KJBA 3CLQA 3K2ZA 1W7PB 2ETHA 4XSZF 3KZYA 4YG2F 1IUYA 2EA4A 3ABMH 4U0WA 3ZMTA 5HLTA 2VT2A 3WU2C 5K5RA 2JSPA 2F4OB 1DQUA 3P5JA 2ISZA 3I59A 4HAMA 3QAHA 2KIFA 1IGNA 2HOEA 2XGEA 4RDUA 2EIMH 4B8XA 2FX0A 1BI1A 3ROUA 2A6EF 1EA3A 1ETXA 3NRVA 5FJ8J 2DA3A 3GTLJ 4YFNF 3G1MA 2CW0F 4P9FA 3OYFA 3WGHA 1R23A 4BY7J 3O8HA 2A07F 4O6JA 2MSYA 1QZZA 4ZDOA 1IZ1A 2PX9A 4BQOA 1RPWA 3PNYA 4B09A 4BQNA 2IS4A 3JRBA 2K9SA 1N75A 4PJLA 4CYCB 5JLXA 5K7FA 5FKNA 1R5GA 2OZUA 3H5AA 1R36A 2O8XA 3GVAA 2X1DA 4DIQA 1UAAA 1HQCA 2EFNA 1BOAA 2XAFA 4F91B 2A69F 2IS6A 3VODA 3QRFF 1VQ6I 4F3QA 2CUEA 2YR2A 1ETWA 2PG4A 1W1WE 5H6RA 4AC0A 3MFKA 4A6DA 1MNEA 3IC7A 2G9WA 4NHJA 2QQ8A 3DWLE 2NOJB 3I56I 1KA8A 4QSHA 3ZQLA 4EJWA 2DYSH 2HDWA 3BWGA 3Q0UA 5EEAA 3F6VA 1JUSA 1BI0A 1QZYA 3RPUD 2PJRA 2JJ7A 4XIDA 2ZCWA 3HXLA 3W6VA 3LSRA 1VQMI 5J8CA 2MBFA 2ESHA 2R7XA 3KFWX 4IRGA 3ZMVA 2DXIA 2RDPA 2R7VA 3CCQI 2EZLA 4G12A 3LSJA 3HOXJ 1QQIA 3DEUA 3L2CA 3SDBA 4B1RA 3OYDA 2NVYJ 2ZKZA 3EUHC 5DD4A 3CC7I 5LRRA 5IP9J 4EJVA 2FMLA 4XLPF 3GLXA 4C3HJ 4UVAA 2B0LA 1NG6A 3J7AO 3IP4B 3WTWC 4M6XA 1P2FA 1FYKA 4UY8I 1BIAA 2L9RA 2X1CA 4HA8A 1RUNA 1TZLA 1T6SA 2LP0A 1X2NA 1CQTA 3D5SC 9ANTA 4MLOA 4IXAA 2L54A 1VNDA 3E7LA 3RIRA 2PJRB 2Y31A 3CLOA 4PFPA 2CUFA 4ESFA 5ILSA 5EG0A 1ZLKA 1IN4A 3E5QA 2CV1A 4FHTA 3H3VK 2Z1DA 1FBQA 3OYMA 1ZAOA 3CESA 3OL4A 2JTVA 2LDUA 4BKXA 4RB2C 4FTHA 2KZVA 3IKTA 3ABKH 4P9UA 1UG2A 4E7ZA 3GUDA 3L2VA 4ASNA 1UG0A 1Y39A 1F43A 1X1CA 4JX4A 5J40A 4BU2A 1VF9A 5BPDA 4UHTA 3E6DA 1YJ9I 1K83J 2DT6A 4V19K 2DTRA 3QPTA 1U78A 2QSGX 1P9QC 2IGKA 3HJEA 3OYHA 3OYEA 3K4KA 1OJLA 2ZNZA 5J1UA 3OS1A 4HNUA 4LOCA 1WKMA 2IA2A 5FO5A 2HDCA 1G3YA 4GGGA 3OMYA 2PN6A 4NC7A 2JK3A 1ITYA 2FXAA 3ABTA 1X19A 2BXZA 3PQJA 2GXAA 2KP6A 1FEXA 3DLLF 5IPAA 1BIBA 1W5SA 1X2MA 4AYBA 2IS1A 2DMUA 3R0AA 3ESWB 2HU9A 3FXUA 4D7NA 1JUMA 4FE7A 4JX6A 3OS2A 2L5QA 1MMDA 2DODA 3S1NJ 3A1YA 5CJ9A 2X51A 1X1BA 5IYCJ 4BL0B 4OAZA 2R7TA 3M7GA 1R1VA 2HXIA 1S8NA 4G9YA 1WH7A 2PI0A 3I5UA 1T95A 3CMAI 2CMPA 3FIWA 4A12A 1X1DA 3S15J 4G6DA 4Q5SF 1ENHA 2M45A 4M3FA 3GF2A 3IH4A 4S0HB 2AXLA 2ELJA 4FQGA 2ZSIB 3C2GA 3HTSB 1WGXA 1XGSA 4B3XA 4BE1A 3GWZA 2CU7A 1V55H 4UXNA 2YPRA 3NQOA 1MNMC 5DCFA 3BPVA 2HTJA 4Z2YA 5FKMA 3ZMDA 1VQ8I 4OINF 2PMZN 1T38A 1SMTA 4N4NB 1E3OC 1DUXC 3LQRA 3KEQA 4A3CJ 1X1PA 3CCJI 2OU2A 1DP3A 1K78A 1IV6A 5DUKA 3WTSC 2VIXA 3MKZA 3AG2H 3BR5A 3JW4A 3HUGB 1BR4A 4I02A 4ENMA 4FISA 2IGNA 3HKZN 1XX5A 4Q4ZF 1MBGA 2PMHA 3CCSI 2QM3A 3BROA 3K0LA 3SJMA 4IX7A 4PJMA 1RUOA 1J9IA 3SXYA 3L9FA 3WTUC 3V7CA 2XAGA 4DGWB 2COBA 4AUXA 2MA3A 1ETVA 3HM5A 2WY8Q 1H8AC 1IO2A 2OBPA 2ZXWH 1BW6A 3A03A 4A5NA 1Z9CA 2K3FA 4HF0A 4M3GA 3GZ6A 5C4JJ 1RESA 2IGMA 1HW1A 3C2BA 3HZJA 5F27A 4KICA 1X1AA 3FHZA 1XMAA 3S2WA 1G3WA 1H0MA 1R58A 3PFYA 3JTGA 2EK5A 2EILH 3CMEI 4BBRJ 2XASA 3T1BA 3WGIA 1FIAA 2HTSA 1YX5A 1TT0A 3DP7A 1HKTA 1JHFA 2VONA 2H1LA 5LLQA 4M73A 1U8BA 1GXPA 1ETOA 4UNOA 1YFHA 1T33A 4ZJZA 2CQKA 1S9HA 3RYRA 3HOVJ 3CO7C 2BBYA 2L9SA 2ECCA 2EPFA 3LA3A 4I6ZA 4LD5A 1YO5C 2KFDA 1U5TC 5JLWA 1KQ8A 4CO8A 2M8EA 4P5OA 1IJWC 2HGCA 3ZRGA 2JA2A 1OYYA 3NWTA 1PUFB 5EJCA 2CG4A 3S1MJ 2KDOA 3GZ5A 3H35A 4BE2A 1SMYF 2IS2A 2PQ8A 1HSJA 4CUGA 2V6CA 2L4MA 1TLHB 3HOTA 1Y1WJ 1IUFA 1OISA 3IH3A 3VEPA 3GEZA 3P9KA 3BG7A 4JBAA 5L3EA 2XUBA 4HPQA 2LBFB 4LB6B 1D1CA 1MW7A 1SANA 2JMWA 4UVCA 2L7MP 4Y33A 3RQIA 3WTVC 4RLFA 2JT1A 2JVHA 4M74A 2PJPA 1A31A 1O3TA 1RR7A 2VXDA 2FNAA 3KP6A 1GDTA 2XPWA 3TEDA 2LF7A 3H3ZA 3BG9A 4JOMA 1Z77A 3IHUA 2LY1A 3C7JA 3ECHA 3PQKA 4WX9A 1YLFA 2V9VA 1LE8B 3OYKA 2WC2A 2KHMA 5DDGA 1TWHJ 1LQ1A 4YRVA 1FOWA 3CC2I 2VPRA 3ABLH 5KHDA 2G0EA 4E7HA 4KFCA 2XKPA 1R22A 3DBHB 3OR1C 3CO6C 1JTYA 3C2HA 5GTHC 1OCOH 3G6EI 2O3FA 1WJAA 4KT5C 4N9IA 4V2FA 1D1BA 2RQPA 3RKQA 3IWZA 1SFEA 2E35A 3FMSA 5HS7A 4ZTFA 5FLMJ 2FF4A 4P55A 2LYCA 2QKMB 2R7DA 2F5FA 3Q9VA 2QQBA 3QU6A 3BCAA 2XRNA 3CCRI 1WWXA 5ICFA 3H92A 2Z3YA 5CPRB 3BC8A 4HV6A 1I39A 3ML6A 2RN7A 4HBLA 5HLHA 3J80Z 1YE9A 2MH2A 3ZQFA 4HRIA 4C30A 4G7HF 3M8EA 4XKBA 4N4OB 1OCPA 2CWEA 3WGGA 4QIWN 3ZP5A 1QHGA 3COAC 4EGYA 3OL3A 5IP6A 1GVJA 4DJAA 2A3SA 2DQLA 2KPMA 2E1CA 1B72A 3DXJF 1L0OC 2DDAA 1TQIA 2EFPA 2ISYA 1KGSA 4XKWA 2LRDA 4PCQA 1Z21A 1FOXA 5K1YA 1YG2A 1WFXA 2NRAC 1YRNA 1IG7A 2L7FP 4PJNA 5EYRA 5GPAA 5E8IA 2VQLA 1OCZH 3FKIJ 2F4MB 4I0AA 4KIFA 1IN7A 1P4AA 2DO7A 1GT0C 2QZ8A 2M7AA 3JAMZ 1ETQA 1E2XA 4E6KG 1S5LC 3G71I 1XGMA 2W24A 1S6LA 2ZJPF 3JSOA 4MTDA 4HV5A 4EQQA 3H9GA 3DKYA 4LG0A 2IP2A 2Y9YA 2PMZA 3G73A 2XSDC 3JRIA 2GXBA 3ZN1A 5JR3A 2B63J 3UKGA 4A3DJ 4A3EJ 3GTPJ 2EZHA 1JT6A 4XLAA 3J81K 1APLC 5C44J 2QWWA 2CFOA 1SVMA 4Q47A 2VUMJ 1A35A 1B72B 3CP8A 2R5ZB 3ZMUA 1MH3A 1WQ2A 1YX3A 1HKSA 4XN0A 3H1CA 4I01A 2ACJA 3PIOF 3C3WA 3WHBA 2L4AA 1IN6A 3FX3A 3TOBA 1A6QA 4G6TB 1SFKA 2AQFA 2CJJA 3VSLA 1W5CC 5IT3A 1R4MB 4G6QA 4AVZA 1G59A 3HTUA 1ZLJA 3BG6A 4XLCA 2DN0A 5C3EJ 2R5YA 1XD7A 3TOAA 3V8LA 4M9XA 5GAHJ 4KA4A 1O3QA 3F0CA 2LKPA 5FKLA 1RIOH 1FJLA 1K61A 2ZJRF 3DV8A 1H89C 2VKDA 1G3SA 1EKEA 4F52A 1UHWA 3QOEA 1W36C 2W00A 3O2PE 1MNDA 2CRGA 2HWVA 4XM3A 3GTOJ 1WJDA 2BHZA 2YX4A 3BJ6A 3K4LA 2JA8J 5J1RA 2QSFX 4B3AA 5K7ZA 1STZA 3DPLC 4F55A 1ZG3A 4E7JA 1IDYA 1LDKB 4ON0A 2R7ZJ 3WE3A 5LEJA 3CC4I 5CVVA 2GQQA 3RPUA 2KZGA 2JA6J 1REPC 3H5RA 3I3LA 1TBXA 4LIVA 2DMTA 4M3DA 3BZ6A 3JRDA 1N77A 3PL8A 5KAFC 4E7KA 5BOXA 3ONQA 3D1NI 1VQNI 1ETKA 3M8JA 3E3VA 1N25A 3RYPA 3HHGA 3KP4A 4UVBA 5D8KB 5ICGA 1B6AA 5E1WA 2ADUA 1JT0A 3BTLA 2XPVA 3BR3A 4RAYA 2DMNA 5FB2A 1BC7C 2YU9J 4R79A 3JRFA 1QZEA 3TQNA 1MBFA 2EWNA 3FXLA 2H1KA 4NC8A 2Z5UA 1L3LA 3ELKA 2GIVA 4DBRA 5ED4A 1A36A 2L7KA 4HSTA 1LVAA 3LAPA 1Z3XA 5F0FA 5DTDA 2JWTA 2ZNYA 3ZQIA 3GTJJ 4K2EA 1GUUA 3U2RA 3EYYA 1TTYA 3HRUA 3K7AJ 1MKMA 2DMQA 2K40A 1CF7B 1T0FC 4LJZF 3RJPA 1G4DA 2DT5A 5EGOA 3Q0WA 3KETA 1IDZA 4OU0A 5F0CA 2JQ7A 1P92A 4LIUA 1FTZA 3WTXC 3SQNA 2FBHA 1MDMA 3KCCA 2W82A 3CJRB 3ZXSA 4ESBA 2W7NA 2VBXA 2LK2A 3GXOA 1X4PA 1Y56A 2KT0A 3EUAA 4MIMA 5L3GA 1TC3C 1MIJA 1MZBA 1EH7A 1GVDA 3KEYA 4E4HA 4A5MA 3KLNA 1U8RA 3TP0A 3EYIA 1FY7A 1MMGA 2F5VA 5HLGA 4C2UA 3H5NA 4LLGF 2G7HA 3CF5F 3J7AY 2VKHA 1KYWA 5F64A 2ID6A 3WTTC 2CH0A 4XQFA 4FETA 3BQYA 4A3JJ 2V1NA 3BR0A 4S04A 3UNGC 2CQ7A 1XDUA 2MLKA 4BYYA 2TCTA 5D5XB 3J7YJ 2XGCA 3BG5A 1B8IA 1BI3A 1WRJA 5F08A 1J2XA 3K2AA 2GM4A 3W3CA 1F4KA 5J6XA 3U21A 2FU4A 2WY7Q 4L5IA 3N97A 5D4RA 1T98A 2J5OA 4ENKA 5M3MJ 4GRIA 2VL8A 1JKPC 4XK4A 1IRFA 3LA7A 3OY9A 1ZH5A 5GAEJ 4N9HA 3MN2A 2FJ1A 4WK8F 3BZCA 1X3UA 1XC5A 3HRMA 3NEUA 2OAZA 2LY2A 3LWFA 1I27A 1V5EA 3BQZA 1FSEA 3ZN0A 2GOMA 2WB1A 2OA4A 2I10A 4Y7NJ 3IRRA 3L2UA 1UJ8A 3S17J 2OD5A 1NTCA 3GFJA 4RBOA 4BXFA 2A05A 2MH9A 4OIOF 4KISA 3RKXA 1J59A 2H27A 3I59B 3JAMK 4C3IJ 2RGVA 4CGZA 2M0MA 2EFWA 5TGTA 4MQ9F 2CUJA 3ABUA 3IRQA 2GXGA 2MD5A 1WJCA 2WV0A 2K27A 3IUOA 5AIQA 2CW8A 5J3LA 2FUG2 2YUSA 2IJLA 1AA7A 4QPOA 4IHYA 3E6BA 3QWLA 4CZCA 5KK1A 2Y0SA 2OTLI 5F1RA 3GBGA 4AIKA 2DCEA 4CYCA 1VQKI 4U88A 2M4KA 2HOAA 3C1DA 3HHHA 5BPIA 1TP4A 1LEBA 1OQYA 3P7NA 4R1HA 4FX0A 1JTXA 3TW7A 3OWTA 1Z1DA 3BR6A 1Z6RA 1HF0A 1XCVA 3TMOA 1PP7U 4FT8A 4HDUA 1KQ9A 1S3JA 1WCMJ 1I1SA 2Z33A 3RCOA 2V1DA 5E3LA 2DFFA 4NQWA 2RC4A 1HC8A 5E20A 2BYVE 3I4PA 1XDSA 5EEGA 2F48A 5L3DA 1I6HJ 2E34A 2BE5F 1PP8F 1FTTA 2ZJQF 2KRHA 3F6OA 3BTIA 3CJTB 5H20A 5IP7J 2H94A 2XB5A 1B4AA 1ETYA 2Q2EA 2E2HJ 3RTRA 4M3EA 3VOEA 5LHGA 1BR2A 2M34A 2VI6A 1HBXG 1E17A 3CZ6A 2K7LA 3KZIC 1Z7LA 1OKRA 1SAUA 3LSKA 1ZR2A 1HSTA 3F22A 4M9ZA 3AAFA 1ON1A 2VKEA 3GCMA 4XLHA 3T0YA 4B43A 2X6OA 2BY1A 5FD6A 4PZJA 1RKWA 3K4JA 2IW5A 3QP6A 2XV4S 2R5ZA 4HQEA 2KRCA 3B6AA 4PGGA 4OIPF 3KZZA 4KJZA 4A0ZA 4RM3A 3OYLA 1JJ6C 4IHSA 4J19A 3OYAA 1KU9A 2D1HA 2MYSA 2HQNA 2O0YA 3KX2A 1QVUA 1TWFJ 2AO9A 4Y4RA 1ZK8A 2Y48A 5DS9A 1Y8QB 3F21A 1LDJA 4PJJA 1T08B 3CMMA 3M07A 4ESJA 2X0LA 3CDHA 3HC7A 2WAQA 3MVPA 2JUGA 3BG3A 4NUBA 1MJ9A 2Y9ZA 2R5YB 1ULYA 4V2GA 4HLXA 2MW8A 1IAWA 3K1PA 4IRHA 5HNHA 1MBEA 2VASA 1YYVA 1BC8C 1YW8A 1FC3A 2R3SA 4EEFG 3HG9A 2R7OA 3RI4A 2RKHA 3N05A 5M5XJ 4NC6A 5JHUA 1Y0UA 3K4MA 2H09A 4DOZA 2XKOA 4D5FA 2IVMA 3PUFA 1VTNC 2HQAA 2A6HF 2NVXJ 3JTHA 4GO1A 2XROA 3ZQHA 4FCYA 3HPHA 3CJNA 3CCEI 3V7RA 5M5YJ 4BQAA 4BJTA 5ICCA 2JVGA 2LR8A 3PFIA 4MGRA 2CW7A 3L09A 3FXOA 1FZPB 3MZHA 1SD6A 4H0EA 2GBYA 3VYRB 5DD8A 2HNHA 4PGHA 2K86A 2OQGA 4PJ0C 5EDNA 4KUMA 5E1ZB 4BS9A 5IT9Z 3HOUJ 4BJ6C 2UXXA 3KIOA 4II2A 1W7PA 1MMNA 2Y0SN 2D45A 1W36D 1DU0A 1YHQI 4ZYHA 3H0GJ 1SD5A 4G7OF 1WZ2A 2A6TA 3Q3SA 3E6CC 4ETSA 3G2BA 4YFXF 2QCOA 1IRXA 2BY3A 1SEUA 2P0WA 3EUKL 1C0WA 3HYIA 3MQ0A 5CVJA 2Y30A 4TV7A 3HDDA 4Y52J 1ON2A 5E17F 4HYEA 4IRIA 1X3WB 4M6YA 4ITVA 2HPMA 2DOFA 2DJNA 3ZR8X 5LFAA 4IQ4A 3MMYB 3SZTA 2K4JA 3PSFA 3RDIA 3LL7A 5ILVA 2K9LA 3FK6A 1OLTA 3U1DA 2W48A 2X1EA 3MCZA 2XHKA 5CYVA 3FM5A 3ERED 2Y69H 4XRSG 3E6MA 3LSPA 2MD0A 2AXTC 4XL9A 1IN5A 5LBQA 4RB1A 3VYSB 1RR8C 3IH2A 1G8XA 4JK1X 5HS8A 1DDNA 2HPIA 3L00A 2RNJA 2QA4I 4LB5A 1IC8A 1ZHFA 1USSA 3ASOH 2XB0X 1V4RA 4IHVA 3D5LA 3HSEA 4XKVA 4UUSA 1B1BA 3E5UA 5M5WJ 3Q5FA 1O4XA 4CCOA 1XS9A 1V5FA 2IT0A 3TO7A 5EF6A 1W4MA 2XAJA 2XAQA 3VB2A 1R5ID 2KIMA 2X6WA 1YIOA 4A3IJ 3F8FA 3KP2A 3M3YJ 1R4NB 3HSFA 3FXQA 1LFBA 2HI3A 4A3KJ 4C2TA 3SEQA 1FNNA 3M4OJ 3LSMA 3BJOA 3A0BC 3K70D 3AL0C 2OC6A 1DGWY 1D8KA 2KIUA 4U87A 4B48A 2R7RA 2K9MA 4IO9F 2L7ZA 2KJCA 4YIRX 2E36A 1I50J 2M3AA 4I0BA 1FYMA 2W84A 1RNLA 3P9CA 1ZRCA 2FBKA 1M1EB 2ZMEA 2LF8A 1T56A 3IL2A 1U6GA 3VYTB 3LNQA 2Q0OA 2XGXA 3TW6A 4ZDLA 2CQQA 2EV5A 4LK1F 3QQAA 3AKZA 2E71A 4KDPA 2WADA 3HSRA 4PSXA 2CGPA 4PFOA 5KNLA 1ZRFA 2M87A 2M8GX 4BEHA 3C18A 2LVSA 1QGPA 4L9NA 2FNPA 3I71A 4DZJA 2HKXA 2VJ5A 4LITA 2LMDA 2K4BA 2E1MB 1AKHA 2RQQA 4O3MA 4X0GA 1PUFA 4ZYAA 2HZDA 4YEJA 3UR3C 1XN7A 1UZCA 2DW4A 2G7UA 3AFHA 2R92J 3FK7A 1IV8A 4ZH4F 1A04A 4L5JA 4DQ2A 1HOMA 1OFCX 3DEWA 3ZPLA 3N4MA 3KYDB 5KVRA 4NQWB 2MABA 1DPUA 1V3FA 1G2HA 3QYBA 3CCYA 1LFPA 5CLSA 2DOEA 3FXKA 2ME0A 2RAEA 3F8CA 2VJ4A 4Y13A 1EF4A 5JHFA 1KU3A 4RA2A 2L0KA 3M1EA 2CFXA 2HVQA 2V26A 2EBIA 3A2KA 4EJOA 3CD6I 3WE2A 1D5YA 2A68F 5D5VB 2EFOA 5FRNA 1YOVB 4AVPA 3MKYB 2W4SA 3HPGA 1QBJA 1YS7A 4IL6C 2X85A 1HDDC 3JRAA 2ZMEB 4HF1A 5B66C 3K4BA 3OYBA 5KCMA 1AHDP 3WG9A 3CUQA 3MKLA 3WU1B 2ME6A 3W2WA 2UV1A 2HDDA 4XLEA 4MHGA 4C9YA 3OSFA 3BTCA 2FSWA 4IVNA 2P6SA 1FT9A 5HS9A 2V79A 2AS5F 2N8GA 2V7FA 3W2VA 2HKOA 5IY5H 3FXMA 2V1XA 3ZGKA 2ZFUA 1BJAA 2DYRH 3FZVA 1S7OA 4RAGA 1QO0D 5JVGF 4GYIA 1G6NA 1OYIA 4LK0F 4G7ZF 4M72A 4XLFA 3MEXA 1BI2A 3SDGA 3IAM2 5A2QK 1H88C 4QTRA 4IKFA 2JRTA 1PJRA 2DK5A 2EA2A 2V9KA 1YJWI 5DCMB 3ZMZA 4J00A 1LUJB 2FQ4A 1HW2A 4NB5A 1JKRC 4EVIA 2FOKA 3E1SA 2Z16A 3ECOA 4YFKF 3K1NA 4D1QA 3PO3J 2W57A 1Z7UA
chains in the Genus database with same CATH topology
5ICEA 1CGPA 4O5VA 4EJTA 3HOSA 1TQPA 4XRFA 1IW7F 4A0XA 4QWQA 4U7DA 2ZBKA 1R1UA 2F2EA 3BPXA 2P7VB 2W25A 2RVCA 2STTA 1B9MA 3V7SA 2W85A 2X4HA 3CUQB 4KN4X 1D3YA 2O61A 2PBIA 3REOA 3T8TA 4LLLA 3LFKA 4M71A 1ZGJA 4UV8A 3LA2A 4HQMA 3KE2A 1PDNC 1R1TA 2Y0MA 1LDDA 5HVQC 1Q1HA 4DNCA 2R7FA 3B73A 4EM0B 3O6BB 3E97A 3TO6A 2MC3A 3W6KB 4R8HA 1XGOA 5E18F 5A2QZ 2HYGD 2JSCA 1XSVA 1JE8A 5FGMA 4CXFA 3ZMSA 3MAJA 5D6FA 2QENA 1WSUA 1SFXA 2DI3A 4I98B 1F5TA 2YX7A 1YS6A 1S7AA 1H9GA 1UB9A 4A0YA 2EJRA 5D8LB 1JGSA 4AIHA 2VC0A 3LAJA 1FSHA 3GW2A 1J75A 5E1XA 4CZZA 1AWCA 1B59A 2E7XA 2NS0A 1W7PD 3BOQA 2Z9OA 2XVCA 5FD5A 2QLZA 2P5LC 3CUOA 1KU2A 1F9NA 2XAHA 3I64A 3QPHA 2JZYA 4MTEA 2ELHA 1USTA 2HQRA 1R00A 1P4WA 4BHPA 1DP7P 2PEXA 1SD7A 1EV7A 2M30A 1QPMA 3BDDA 1FBUA 2HEOA 1TW3A 2UXNA 3HUGA 1K79A 2DBBA 3R4KA 5D5UB 1U5TA 2VBYA 3KEOA 1FLIA 4BH9A 2NNNA 4KMFA 1O3RA 4OOIA 1LJ9A 5HDKA 2FRHA 5DV5A 5LHIA 4HDVA 2O03A 2P8TA 4ENJA 5BQTA 1O3SA 1ZN2A 1R7JA 1ZYRF 5TRDA 1UFMA 2J5PA 1D8JA 2FA5A 4KN7X 2KRFA 3T8RA 2Q8KA 3DKWA 4LMYA 2NNYA 3K69A 1SD4A 4EV0A 4L0YB 5E8GA 2QVOA 2WTEA 1GXQA 2D2WA 4L9VA 4ZZDA 4OMYA 2VBWA 3R0JA 3ZQ7A 4RAZA 5CVRA 2WWYA 1MD0A 5D4SA 4HOBA 1U2WA 4U7BA 1UHMA 6PAXA 2DQRA 2FEZA 2VE8A 1D5VA 3W6JB 1U3EM 3HRTA 2VOOA 3MZYA 2HR3A 2VN2A 2FBIA 4BNCA 2MLGA 3E5XA 5L3BA 4A6EA 4L9TA 4P96A 2GZWA 2A61A 1OMIA 5LGNA 1O7FA 4EM2A 3VFZA 4Y15A 4MEXF 2VC1A 1BN5A 2ZJ2A 4G94A 1IRGA 1P4XA 2CO5A 2L3DA 2V1UA 2FE3A 2ESNA 3ULQB 3T5XA 2P5KA 2H6CA 3ISPA 3EDPA 2E7WA 1KYZA 5CVIA 3K9TA 1ZG1A 1MJBA 3SHFA 3DFGA 2FQ3A 1XSXA 4CDGA 2YSRA 4YIFA 2M1BA 3LSTA 4ZYDA 4L0ZB 4L9JA 3F8NA 2IA0A 1ZRDA 1B9NA 3RKWA 4JQFA 1AOYA 4GXOA 5HOOA 2IRFG 5EEHA 2P6TA 2BEOA 1T39A 1EH6A 2LNBA 1DPRA 3J81Z 2QQ9A 1IF1A 3V8JA 2QUFA 3WTZA 2HYFA 4HX7A 4Y17A 2BGCA 2PFBA 4KNYA 4KIGA 3GFLA 5IT9K 1ZARA 5FLXK 3BY6A 3CUQC 2EB7A 2NAZA 4I09A 3I58A 4EMSA 3KLOA 3QP5A 3BP8A 2DAOA 2EFQA 1NHAA 1YW9A 1Z05A 4HX8A 3IKVA 4GCVA 5TJJA 4ZZLA 4I2OA 2DFIA 4HW0A 1ONVA 1XMKA 5HDNA 3V4GA 1LB2A 1IXRC 2H6BA 4U0YA 4EM1A 4CYDA 1FWZA 1OR7A 2F5EA 3M9AA 1T2KA 2VE9A 4EGZA 5K5QA 1IXCA 5LEKA 2IA1A 3TDZC 4EJUA 1SFUA 3J80K 3R61A 1BBYA 1YW7A 3IWFA 4HF2A 2PLYA 4KIBA 3DQVC 2VT3A 1TW2A 3D0SA 5JFRA 1ZREA 2VODA 4BHBA 4BAYA 4ENNA 4HLYA 4G8XA 2GA1A 2ZO4A 5FLXZ 4CHUA 2DPDA 2TDXA 3GFMA 2DLLA 4L18B 4IPAA 3B02A 2COMA 1TNSA 1ZG5A 1EH8A 2D1VA 2L02A 3I54A 4KMUX 4FX4A 3FM3A 4OMZA 1HXDA 4S05A 3SFZA 3FF5A 3F3XA 2QYOA 4D0PA 1SAXA 3R60A 2E1NA 3K1MA 2OZ6A 2C6YA 2HS5A 1P6RA 1MJAA 3U9GA 3HRSA 1GHCA 2GWRA 1MGTA 3KP3A 4AWXB 2VOPA 2NYXA 3LQQA 4MEYF 3L7WA 4AIJA 4LFUA 2QBYA 1TQMA 5J8FA 1XB4A 1W5TA 3MWMA 4MNUA 4HX4A 1TNTA 1IXSB 2DU9A 3GO5A 1OPCA 4M9SA 4ZYEA 2EV0A 1YTYA 1MDMB 5FFZA 3M8FA 1XGNA 1FBSA 3F23A 2CYYA 3G3ZA 4UUVA 4BXUA 4PDKA 2QBYB 3F8BA 4MQVA 1I6XA 3JSPA 4CICA 1FPQA 1LNWA 2F5CA 3FMQA 3I0TA 3F8MA 3GYHX 3TGNA 5DYMA 1KU7A 4ZYGA 4RB3C 2STWA 4Q48A 3TDUC 5DUIA 4OIRF 2L01A 3DF8A 1XSDA 1JXSA 4UV9A 5LGTA 4WWCA 1K6OA 5HDGA 3EETA 3HIFA 5DEQA 1FYLA 3QU3A 5BS6A 2YU3A 1IN8A 3R6SA 1R5HA 2KKOA 2VXZA 1I5ZA 1T0FA 2O6GE 2GA2A 5AIPA 3OV8A 2OQRA 1S29A 1ODDA 3F72A 5K5OA 3Q9SA 2P5VA 3WU0A 4WXCA 5F6FA 1BM9A 2P4WA 4XSXF 5JVTA 1I1GA 2XIGA 4WXHA 3RKYA 4RGSA 3KP5A 5CVUA 4RGUA 3BJAA 3TKYA 5BMZA 1KQ0A 3TO9A 1ZGAA 1XCBA 2UWMA 1FP2A 2EV6A 1F1ZA 2A5YB 5ERIA 2HZTA 3SZPA 3P9IA 4HZFA 1FX7A 3I53A 1FP1D 4A2UA 1Z6TA 1RI7A 5H6QA 3DPTA 4RGXA 4F7ZA 2P7CB 3FXRA 4E70A 3FMRA 1LEAA 4RS8A 3RPQA 1J7KA 4RGRA 1CF7A 3QOPA 1H9TA 4IHTA 3OOPA 4OIQF 4YIIA 2M5WA 2CSOA 3CTAA 4IJAA 2ZFWA 4LG0B 3WTYC 5D6EA 2ZXJA 3WODF 2HFHA 2GAUA 4N0BA 5AONA 1K7AA 3FWEA 1FOKA 2K02A 5FFXA 3O3KA 4XLNF 2JPCA 1OYWA 1K78B 1UCRA 5LHHA 3GX4X 5L3CA 3V8KA 2DK8A 5JI6A 5HLIA 4LLNA 3GFIA 4XBFA 4IF4A 1PUEE 2PMUA 1QNTA 3EQLF 4RB0A 4WCGA 5LRSA 1G3TA 2JPBA 2Z99A 2F5DA 1J5YA 4KYWA 4LGWA 4U0VA 2UZKA 4QLCU 4I7HA 2LSOA 1YQAA 1O57A 5LGUA 5ILUA 1O7LA 2RV8A 1J0RA 2QQAA 5L3FA 1JHHA 1RZ4A 2VBZA 1HW5A 4BHCA 4WF2A 1Z91A 3EUHA 1WI9A 2BV6A 2Y75A 4AD9A 4WXDA 5D5WB 4GYGA 2FMYA 3H3UA 1U5TB 2IPQX 3KP7A 2DPUA 1HKQA 5DCMA 2KJBA 3K2ZA 1W7PB 2ETHA 4XSZF 3KZYA 4YG2F 1IUYA 2EA4A 4U0WA 3ZMTA 2VT2A 5K5RA 2ISZA 3I59A 4HAMA 3QAHA 2KIFA 2HOEA 4B8XA 1BI1A 3ROUA 2A6EF 3NRVA 4YFNF 2CW0F 4P9FA 3WGHA 1R23A 2A07F 4O6JA 1QZZA 1IZ1A 4B09A 1R5GA 2OZUA 1R36A 2O8XA 3GVAA 1HQCA 2EFNA 1BOAA 2XAFA 2A69F 3QRFF 3VODA 2YR2A 2PG4A 5H6RA 3MFKA 4A6DA 3IC7A 2G9WA 4NHJA 1KA8A 4EJWA 3BWGA 3F6VA 1BI0A 1QZYA 2ZCWA 5J8CA 2MBFA 2ESHA 3KFWX 4IRGA 3ZMVA 2RDPA 1QQIA 3DEUA 3L2CA 5DD4A 2ZKZA 5LRRA 4EJVA 2FMLA 4XLPF 3GLXA 4UVAA 2B0LA 3J7AO 3WTWC 4M6XA 1P2FA 1FYKA 1BIAA 4HA8A 1RUNA 1T6SA 4IXAA 2L54A 3RIRA 3CLOA 4ESFA 5ILSA 1ZLKA 1IN4A 3E5QA 4FHTA 1FBQA 1ZAOA 2JTVA 2LDUA 4RB2C 3IKTA 4P9UA 3GUDA 4ASNA 5BPDA 4UHTA 3E6DA 2DTRA 3QPTA 1U78A 2ZNZA 1WKMA 2IA2A 5FO5A 2HDCA 1G3YA 4GGGA 2PN6A 2FXAA 3ABTA 3PQJA 1BIBA 1W5SA 3R0AA 3FXUA 5CJ9A 3M7GA 1R1VA 1S8NA 4G9YA 2PI0A 3I5UA 4A12A 4G6DA 4Q5SF 2M45A 3GF2A 2AXLA 3HTSB 1XGSA 3GWZA 4UXNA 2YPRA 3NQOA 5DCFA 3BPVA 2HTJA 4Z2YA 3ZMDA 4OINF 1T38A 1SMTA 1DUXC 3LQRA 3KEQA 2OU2A 1K78A 5DUKA 3WTSC 3JW4A 4I02A 4ENMA 4Q4ZF 2PMHA 2QM3A 3BROA 3K0LA 1J9IA 1RUOA 3SXYA 3L9FA 3WTUC 3V7CA 2XAGA 2MA3A 2OBPA 4A5NA 1Z9CA 4HF0A 3GZ6A 1HW1A 4KICA 3FHZA 1XMAA 3S2WA 1G3WA 1H0MA 1R58A 3JTGA 2EK5A 2XASA 3T1BA 3WGIA 2HTSA 1HKTA 3DP7A 1JHFA 2VONA 5LLQA 4M73A 1GXPA 4UNOA 1YFHA 2CQKA 3RYRA 3CO7C 2BBYA 3LA3A 4LD5A 1YO5C 1U5TC 1KQ8A 4CO8A 2M8EA 4P5OA 2HGCA 1OYYA 2CG4A 3GZ5A 1SMYF 2PQ8A 1HSJA 2V6CA 2L4MA 1TLHB 3HOTA 3VEPA 3GEZA 3P9KA 4JBAA 5L3EA 2XUBA 4LB6B 4UVCA 3WTVC 2JT1A 4M74A 2PJPA 1O3TA 2FNAA 3KP6A 2LF7A 3H3ZA 3IHUA 3ECHA 3C7JA 3PQKA 4WX9A 1YLFA 2V9VA 2WC2A 5DDGA 1LQ1A 4KFCA 2XKPA 1R22A 3CO6C 2O3FA 4KT5C 4N9IA 2RQPA 3IWZA 1SFEA 3FMSA 5HS7A 2FF4A 4P55A 2R7DA 2F5FA 3Q9VA 2QQBA 3QU6A 2XRNA 1WWXA 5ICFA 3H92A 2Z3YA 4HV6A 3ML6A 2RN7A 4HBLA 5HLHA 3J80Z 2MH2A 4G7HF 3M8EA 2CWEA 3WGGA 3ZP5A 3COAC 4EGYA 1GVJA 2A3SA 2DQLA 2E1CA 3DXJF 1L0OC 1TQIA 2EFPA 2ISYA 1KGSA 4PCQA 5K1YA 1YG2A 2NRAC 5E8IA 4I0AA 4KIFA 1IN7A 1P4AA 2DO7A 2QZ8A 3JAMZ 1E2XA 1XGMA 2W24A 1S6LA 3JSOA 4MTDA 4HV5A 4EQQA 4LG0A 2IP2A 3G73A 2GXBA 3ZN1A 5JR3A 3J81K 2QWWA 4Q47A 3ZMUA 1WQ2A 1HKSA 4I01A 2ACJA 3C3WA 2L4AA 1IN6A 3FX3A 3TOBA 5IT3A 4G6QA 3HTUA 1ZLJA 1XD7A 3TOAA 3V8LA 4M9XA 4KA4A 1O3QA 2LKPA 1RIOH 3DV8A 1G3SA 1UHWA 3O2PE 2HWVA 2YX4A 3BJ6A 1STZA 3DPLC 1ZG3A 1LDKB 4ON0A 3WE3A 5LEJA 5CVVA 2GQQA 3RPUA 1REPC 1TBXA 3BZ6A 5BOXA 3E3VA 3RYPA 3HHGA 3KP4A 4UVBA 5D8KB 5ICGA 1B6AA 5E1WA 2ADUA 4RAYA 5FB2A 1BC7C 4R79A 3TQNA 2EWNA 2Z5UA 1L3LA 3ELKA 2GIVA 5ED4A 1LVAA 3LAPA 2ZNYA 4K2EA 3U2RA 3EYYA 1TTYA 3HRUA 1MKMA 1CF7B 4LJZF 3RJPA 1G4DA 2DT5A 3KETA 4OU0A 1P92A 3WTXC 3SQNA 2FBHA 1MDMA 3KCCA 4ESBA 2VBXA 3GXOA 5L3GA 1MZBA 1EH7A 4A5MA 3KLNA 1U8RA 3EYIA 1FY7A 5HLGA 4LLGF 2G7HA 1KYWA 5F64A 3WTTC 4S04A 1XDUA 2MLKA 4BYYA 5D5XB 1BI3A 1WRJA 1J2XA 1F4KA 5J6XA 2FU4A 4L5IA 3N97A 5D4RA 1T98A 2J5OA 4ENKA 1IRFA 3LA7A 1ZH5A 4N9HA 4WK8F 1X3UA 3HRMA 3NEUA 2OAZA 3LWFA 1I27A 1FSEA 3ZN0A 2OA4A 3IRRA 2OD5A 3GFJA 4OIOF 2MH9A 3RKXA 1J59A 2H27A 3I59B 3JAMK 2RGVA 4CGZA 2EFWA 4MQ9F 3ABUA 3IRQA 2GXGA 2MD5A 2WV0A 2K27A 5AIQA 2IJLA 3E6BA 5KK1A 5F1RA 4AIKA 4U88A 3C1DA 3HHHA 5BPIA 1LEBA 3P7NA 4R1HA 4FX0A 1Z1DA 1Z6RA 1XCVA 1PP7U 4FT8A 4HDUA 1KQ9A 1S3JA 1I1SA 2Z33A 2V1DA 4NQWA 2RC4A 5E20A 2BYVE 3I4PA 1XDSA 5EEGA 5L3DA 2BE5F 1PP8F 3F6OA 5H20A 2H94A 1B4AA 2Q2EA 3RTRA 3VOEA 5LHGA 1HBXG 1E17A 2K7LA 1OKRA 1HSTA 3F22A 4M9ZA 3AAFA 1ON1A 3T0YA 5FD6A 4PZJA 2IW5A 3QP6A 2XV4S 4HQEA 4PGGA 4OIPF 3KZZA 4A0ZA 4IHSA 1KU9A 2D1HA 2HQNA 2O0YA 2Y48A 3F21A 1LDJA 4ESJA 2X0LA 3CDHA 1MJ9A 1ULYA 4HLXA 1IAWA 3K1PA 4IRHA 1BC8C 1YYVA 1YW8A 1FC3A 2R3SA 3RI4A 2RKHA 5JHUA 1Y0UA 2H09A 2XKOA 2IVMA 1VTNC 2A6HF 3JTHA 4GO1A 2XROA 3CJNA 3V7RA 4BQAA 5ICCA 3PFIA 4MGRA 3L09A 1FZPB 3MZHA 1SD6A 4H0EA 5DD8A 4PGHA 2K86A 2OQGA 4KUMA 5E1ZB 5IT9Z 2UXXA 1W7PA 2D45A 4ZYHA 1SD5A 4G7OF 3E6CC 4ETSA 4YFXF 1C0WA 3HYIA 3MQ0A 5CVJA 4TV7A 1ON2A 5E17F 4HYEA 4IRIA 4M6YA 3SZTA 2K4JA 3RDIA 5ILVA 3U1DA 3MCZA 2XHKA 5CYVA 3FM5A 3ERED 3E6MA 5LBQA 1IN5A 4RB1A 4JK1X 5HS8A 1DDNA 3L00A 2RNJA 4LB5A 1ZHFA 1USSA 1V4RA 3D5LA 3HSEA 1B1BA 3E5UA 3Q5FA 2IT0A 3TO7A 1W4MA 2XAJA 2XAQA 3VB2A 2KIMA 1YIOA 3F8FA 3KP2A 3HSFA 3FXQA 1FNNA 3BJOA 1D8KA 2KIUA 2KJCA 4I0BA 1FYMA 2W84A 1RNLA 3P9CA 1ZRCA 2FBKA 2ZMEA 2LF8A 3IL2A 1U6GA 2Q0OA 2XGXA 2EV5A 4LK1F 4KDPA 3HSRA 2CGPA 1ZRFA 2M87A 3C18A 1QGPA 4L9NA 2FNPA 3I71A 2HKXA 2K4BA 4O3MA 1XN7A 2DW4A 2G7UA 4ZH4F 1A04A 4L5JA 4DQ2A 3ZPLA 3N4MA 5KVRA 1DPUA 1V3FA 5CLSA 3F8CA 4Y13A 1KU3A 3M1EA 2CFXA 4EJOA 3WE2A 2A68F 5D5VB 2EFOA 4AVPA 1QBJA 1YS7A 2ZMEB 4HF1A 3WG9A 3CUQA 3WU1B 4MHGA 2FSWA 4IVNA 2P6SA 1FT9A 5HS9A 2V79A 2AS5F 2HKOA 2V1XA 1BJAA 3FZVA 1S7OA 1QO0D 4GYIA 1G6NA 1OYIA 4LK0F 4G7ZF 4M72A 3MEXA 1BI2A 5A2QK 2JRTA 2DK5A 2EA2A 5DCMB 3ZMZA 1HW2A 4NB5A 4EVIA 2FOKA 3ECOA 4YFKF 3K1NA 2W57A 1Z7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICE A;  1CGP A;  4O5V A;  4EJT A;  3HOS A;  1TQP A;  4XRF A;  1IW7 F;  4A0X A;  4QWQ A;  4U7D A;  2ZBK A;  1R1U A;  2F2E A;  3BPX A;  2P7V B;  2W25 A;  2RVC A;  2STT A;  1B9M A;  3V7S A;  2W85 A;  2X4H A;  3CUQ B;  4KN4 X;  1D3Y A;  2O61 A;  2PBI A;  3REO A;  3T8T A;  4LLL A;  3LFK A;  4M71 A;  1ZGJ A;  4UV8 A;  3LA2 A;  4HQM A;  3KE2 A;  1PDN C;  1R1T A;  2Y0M A;  1LDD A;  5HVQ C;  1Q1H A;  4DNC A;  2R7F A;  3B73 A;  4EM0 B;  3O6B B;  3E97 A;  3TO6 A;  2MC3 A;  3W6K B;  4R8H A;  1XGO A;  5E18 F;  5A2Q Z;  2HYG D;  2JSC A;  1XSV A;  1JE8 A;  5FGM A;  4CXF A;  3ZMS A;  3MAJ A;  5D6F A;  2QEN A;  1WSU A;  1SFX A;  2DI3 A;  4I98 B;  1F5T A;  2YX7 A;  1YS6 A;  1S7A A;  1H9G A;  1UB9 A;  4A0Y A;  2EJR A;  5D8L B;  1JGS A;  4AIH A;  2VC0 A;  3LAJ A;  1FSH A;  3GW2 A;  1J75 A;  5E1X A;  4CZZ A;  1AWC A;  1B59 A;  2E7X A;  2NS0 A;  1W7P D;  3BOQ A;  2Z9O A;  2XVC A;  5FD5 A;  2QLZ A;  2P5L C;  3CUO A;  1KU2 A;  1F9N A;  2XAH A;  3I64 A;  3QPH A;  2JZY A;  4MTE A;  2ELH A;  1UST A;  2HQR A;  1R00 A;  1P4W A;  4BHP A;  1DP7 P;  2PEX A;  1SD7 A;  1EV7 A;  2M30 A;  1QPM A;  3BDD A;  1FBU A;  2HEO A;  1TW3 A;  2UXN A;  3HUG A;  1K79 A;  2DBB A;  3R4K A;  5D5U B;  1U5T A;  2VBY A;  3KEO A;  1FLI A;  4BH9 A;  2NNN A;  4KMF A;  1O3R A;  4OOI A;  1LJ9 A;  5HDK A;  2FRH A;  5DV5 A;  5LHI A;  4HDV A;  2O03 A;  2P8T A;  4ENJ A;  5BQT A;  1O3S A;  1ZN2 A;  1R7J A;  1ZYR F;  5TRD A;  1UFM A;  2J5P A;  1D8J A;  2FA5 A;  4KN7 X;  2KRF A;  3T8R A;  2Q8K A;  3DKW A;  4LMY A;  2NNY A;  3K69 A;  1SD4 A;  4EV0 A;  4L0Y B;  5E8G A;  2QVO A;  2WTE A;  1GXQ A;  2D2W A;  4L9V A;  4ZZD A;  4OMY A;  2VBW A;  3R0J A;  3ZQ7 A;  4RAZ A;  5CVR A;  2WWY A;  1MD0 A;  5D4S A;  4HOB A;  1U2W A;  4U7B A;  1UHM A;  6PAX A;  2DQR A;  2FEZ A;  2VE8 A;  1D5V A;  3W6J B;  1U3E M;  3HRT A;  2VOO A;  3MZY A;  2HR3 A;  2VN2 A;  2FBI A;  4BNC A;  2MLG A;  3E5X A;  5L3B A;  4A6E A;  4L9T A;  4P96 A;  2GZW A;  2A61 A;  1OMI A;  5LGN A;  1O7F A;  4EM2 A;  3VFZ A;  4Y15 A;  4MEX F;  2VC1 A;  1BN5 A;  2ZJ2 A;  4G94 A;  1IRG A;  1P4X A;  2CO5 A;  2L3D A;  2V1U A;  2FE3 A;  2ESN A;  3ULQ B;  3T5X A;  2P5K A;  2H6C A;  3ISP A;  3EDP A;  2E7W A;  1KYZ A;  5CVI A;  3K9T A;  1ZG1 A;  1MJB A;  3SHF A;  3DFG A;  2FQ3 A;  1XSX A;  4CDG A;  2YSR A;  4YIF A;  2M1B A;  3LST A;  4ZYD A;  4L0Z B;  4L9J A;  3F8N A;  2IA0 A;  1ZRD A;  1B9N A;  3RKW A;  4JQF A;  1AOY A;  4GXO A;  5HOO A;  2IRF G;  5EEH A;  2P6T A;  2BEO A;  1T39 A;  1EH6 A;  2LNB A;  1DPR A;  3J81 Z;  2QQ9 A;  1IF1 A;  3V8J A;  2QUF A;  3WTZ A;  2HYF A;  4HX7 A;  4Y17 A;  2BGC A;  2PFB A;  4KNY A;  4KIG A;  3GFL A;  5IT9 K;  1ZAR A;  5FLX K;  3BY6 A;  3CUQ C;  2EB7 A;  2NAZ A;  4I09 A;  3I58 A;  4EMS A;  3KLO A;  3QP5 A;  3BP8 A;  2DAO A;  2EFQ A;  1NHA A;  1YW9 A;  1Z05 A;  4HX8 A;  3IKV A;  4GCV A;  5TJJ A;  4ZZL A;  4I2O A;  2DFI A;  4HW0 A;  1ONV A;  1XMK A;  5HDN A;  3V4G A;  1LB2 A;  1IXR C;  2H6B A;  4U0Y A;  4EM1 A;  4CYD A;  1FWZ A;  1OR7 A;  2F5E A;  3M9A A;  1T2K A;  2VE9 A;  4EGZ A;  5K5Q A;  1IXC A;  5LEK A;  2IA1 A;  3TDZ C;  4EJU A;  1SFU A;  3J80 K;  3R61 A;  1BBY A;  1YW7 A;  3IWF A;  4HF2 A;  2PLY A;  4KIB A;  3DQV C;  2VT3 A;  1TW2 A;  3D0S A;  5JFR A;  1ZRE A;  2VOD A;  4BHB A;  4BAY A;  4ENN A;  4HLY A;  4G8X A;  2GA1 A;  2ZO4 A;  5FLX Z;  4CHU A;  2DPD A;  2TDX A;  3GFM A;  2DLL A;  4L18 B;  4IPA A;  3B02 A;  2COM A;  1TNS A;  1ZG5 A;  1EH8 A;  2D1V A;  2L02 A;  3I54 A;  4KMU X;  4FX4 A;  3FM3 A;  4OMZ A;  1HXD A;  4S05 A;  3SFZ A;  3FF5 A;  3F3X A;  2QYO A;  4D0P A;  1SAX A;  3R60 A;  2E1N A;  3K1M A;  2OZ6 A;  2C6Y A;  2HS5 A;  1P6R A;  1MJA A;  3U9G A;  3HRS A;  1GHC A;  2GWR A;  1MGT A;  3KP3 A;  4AWX B;  2VOP A;  2NYX A;  3LQQ A;  4MEY F;  3L7W A;  4AIJ A;  4LFU A;  2QBY A;  1TQM A;  5J8F A;  1XB4 A;  1W5T A;  3MWM A;  4MNU A;  4HX4 A;  1TNT A;  1IXS B;  2DU9 A;  3GO5 A;  1OPC A;  4M9S A;  4ZYE A;  2EV0 A;  1YTY A;  1MDM B;  5FFZ A;  3M8F A;  1XGN A;  1FBS A;  3F23 A;  2CYY A;  3G3Z A;  4UUV A;  4BXU A;  4PDK A;  2QBY B;  3F8B A;  4MQV A;  1I6X A;  3JSP A;  4CIC A;  1FPQ A;  1LNW A;  2F5C A;  3FMQ A;  3I0T A;  3F8M A;  3GYH X;  3TGN A;  5DYM A;  1KU7 A;  4ZYG A;  4RB3 C;  2STW A;  4Q48 A;  3TDU C;  5DUI A;  4OIR F;  2L01 A;  3DF8 A;  1XSD A;  1JXS A;  4UV9 A;  5LGT A;  4WWC A;  1K6O A;  5HDG A;  3EET A;  3HIF A;  5DEQ A;  1FYL A;  3QU3 A;  5BS6 A;  2YU3 A;  1IN8 A;  3R6S A;  1R5H A;  2KKO A;  2VXZ A;  1I5Z A;  1T0F A;  2O6G E;  2GA2 A;  5AIP A;  3OV8 A;  2OQR A;  1S29 A;  1ODD A;  3F72 A;  5K5O A;  3Q9S A;  2P5V A;  3WU0 A;  4WXC A;  5F6F A;  1BM9 A;  2P4W A;  4XSX F;  5JVT A;  1I1G A;  2XIG A;  4WXH A;  3RKY A;  4RGS A;  3KP5 A;  5CVU A;  4RGU A;  3BJA A;  3TKY A;  5BMZ A;  1KQ0 A;  3TO9 A;  1ZGA A;  1XCB A;  2UWM A;  1FP2 A;  2EV6 A;  1F1Z A;  2A5Y B;  5ERI A;  2HZT A;  3SZP A;  3P9I A;  4HZF A;  1FX7 A;  3I53 A;  1FP1 D;  4A2U A;  1Z6T A;  1RI7 A;  5H6Q A;  3DPT A;  4RGX A;  4F7Z A;  2P7C B;  3FXR A;  4E70 A;  3FMR A;  1LEA A;  4RS8 A;  3RPQ A;  1J7K A;  4RGR A;  1CF7 A;  3QOP A;  1H9T A;  4IHT A;  3OOP A;  4OIQ F;  4YII A;  2M5W A;  2CSO A;  3CTA A;  4IJA A;  2ZFW A;  4LG0 B;  3WTY C;  5D6E A;  2ZXJ A;  3WOD F;  2HFH A;  2GAU A;  4N0B A;  5AON A;  1K7A A;  3FWE A;  1FOK A;  2K02 A;  5FFX A;  3O3K A;  4XLN F;  2JPC A;  1OYW A;  1K78 B;  1UCR A;  5LHH A;  3GX4 X;  5L3C A;  3V8K A;  2DK8 A;  5JI6 A;  5HLI A;  4LLN A;  3GFI A;  4XBF A;  4IF4 A;  1PUE E;  2PMU A;  1QNT A;  3EQL F;  4RB0 A;  4WCG A;  5LRS A;  1G3T A;  2JPB A;  2Z99 A;  2F5D A;  1J5Y A;  4KYW A;  4LGW A;  4U0V A;  2UZK A;  4QLC U;  4I7H A;  2LSO A;  1YQA A;  1O57 A;  5LGU A;  5ILU A;  1O7L A;  2RV8 A;  1J0R A;  2QQA A;  5L3F A;  1JHH A;  1RZ4 A;  2VBZ A;  1HW5 A;  4BHC A;  4WF2 A;  1Z91 A;  3EUH A;  1WI9 A;  2BV6 A;  2Y75 A;  4AD9 A;  4WXD A;  5D5W B;  4GYG A;  2FMY A;  3H3U A;  1U5T B;  2IPQ X;  3KP7 A;  2DPU A;  1HKQ A;  5DCM A;  2KJB A;  3K2Z A;  1W7P B;  2ETH A;  4XSZ F;  3KZY A;  4YG2 F;  1IUY A;  2EA4 A;  4U0W A;  3ZMT A;  2VT2 A;  5K5R A;  2ISZ A;  3I59 A;  4HAM A;  3QAH A;  2KIF A;  2HOE A;  4B8X A;  1BI1 A;  3ROU A;  2A6E F;  3NRV A;  4YFN F;  2CW0 F;  4P9F A;  3WGH A;  1R23 A;  2A07 F;  4O6J A;  1QZZ A;  1IZ1 A;  4B09 A;  1R5G A;  2OZU A;  1R36 A;  2O8X A;  3GVA A;  1HQC A;  2EFN A;  1BOA A;  2XAF A;  2A69 F;  3QRF F;  3VOD A;  2YR2 A;  2PG4 A;  5H6R A;  3MFK A;  4A6D A;  3IC7 A;  2G9W A;  4NHJ A;  1KA8 A;  4EJW A;  3BWG A;  3F6V A;  1BI0 A;  1QZY A;  2ZCW A;  5J8C A;  2MBF A;  2ESH A;  3KFW X;  4IRG A;  3ZMV A;  2RDP A;  1QQI A;  3DEU A;  3L2C A;  5DD4 A;  2ZKZ A;  5LRR A;  4EJV A;  2FML A;  4XLP F;  3GLX A;  4UVA A;  2B0L A;  3J7A O;  3WTW C;  4M6X A;  1P2F A;  1FYK A;  1BIA A;  4HA8 A;  1RUN A;  1T6S A;  4IXA A;  2L54 A;  3RIR A;  3CLO A;  4ESF A;  5ILS A;  1ZLK A;  1IN4 A;  3E5Q A;  4FHT A;  1FBQ A;  1ZAO A;  2JTV A;  2LDU A;  4RB2 C;  3IKT A;  4P9U A;  3GUD A;  4ASN A;  5BPD A;  4UHT A;  3E6D A;  2DTR A;  3QPT A;  1U78 A;  2ZNZ A;  1WKM A;  2IA2 A;  5FO5 A;  2HDC A;  1G3Y A;  4GGG A;  2PN6 A;  2FXA A;  3ABT A;  3PQJ A;  1BIB A;  1W5S A;  3R0A A;  3FXU A;  5CJ9 A;  3M7G A;  1R1V A;  1S8N A;  4G9Y A;  2PI0 A;  3I5U A;  4A12 A;  4G6D A;  4Q5S F;  2M45 A;  3GF2 A;  2AXL A;  3HTS B;  1XGS A;  3GWZ A;  4UXN A;  2YPR A;  3NQO A;  5DCF A;  3BPV A;  2HTJ A;  4Z2Y A;  3ZMD A;  4OIN F;  1T38 A;  1SMT A;  1DUX C;  3LQR A;  3KEQ A;  2OU2 A;  1K78 A;  5DUK A;  3WTS C;  3JW4 A;  4I02 A;  4ENM A;  4Q4Z F;  2PMH A;  2QM3 A;  3BRO A;  3K0L A;  1J9I A;  1RUO A;  3SXY A;  3L9F A;  3WTU C;  3V7C A;  2XAG A;  2MA3 A;  2OBP A;  4A5N A;  1Z9C A;  4HF0 A;  3GZ6 A;  1HW1 A;  4KIC A;  3FHZ A;  1XMA A;  3S2W A;  1G3W A;  1H0M A;  1R58 A;  3JTG A;  2EK5 A;  2XAS A;  3T1B A;  3WGI A;  2HTS A;  1HKT A;  3DP7 A;  1JHF A;  2VON A;  5LLQ A;  4M73 A;  1GXP A;  4UNO A;  1YFH A;  2CQK A;  3RYR A;  3CO7 C;  2BBY A;  3LA3 A;  4LD5 A;  1YO5 C;  1U5T C;  1KQ8 A;  4CO8 A;  2M8E A;  4P5O A;  2HGC A;  1OYY A;  2CG4 A;  3GZ5 A;  1SMY F;  2PQ8 A;  1HSJ A;  2V6C A;  2L4M A;  1TLH B;  3HOT A;  3VEP A;  3GEZ A;  3P9K A;  4JBA A;  5L3E A;  2XUB A;  4LB6 B;  4UVC A;  3WTV C;  2JT1 A;  4M74 A;  2PJP A;  1O3T A;  2FNA A;  3KP6 A;  2LF7 A;  3H3Z A;  3IHU A;  3ECH A;  3C7J A;  3PQK A;  4WX9 A;  1YLF A;  2V9V A;  2WC2 A;  5DDG A;  1LQ1 A;  4KFC A;  2XKP A;  1R22 A;  3CO6 C;  2O3F A;  4KT5 C;  4N9I A;  2RQP A;  3IWZ A;  1SFE A;  3FMS A;  5HS7 A;  2FF4 A;  4P55 A;  2R7D A;  2F5F A;  3Q9V A;  2QQB A;  3QU6 A;  2XRN A;  1WWX A;  5ICF A;  3H92 A;  2Z3Y A;  4HV6 A;  3ML6 A;  2RN7 A;  4HBL A;  5HLH A;  3J80 Z;  2MH2 A;  4G7H F;  3M8E A;  2CWE A;  3WGG A;  3ZP5 A;  3COA C;  4EGY A;  1GVJ A;  2A3S A;  2DQL A;  2E1C A;  3DXJ F;  1L0O C;  1TQI A;  2EFP A;  2ISY A;  1KGS A;  4PCQ A;  5K1Y A;  1YG2 A;  2NRA C;  5E8I A;  4I0A A;  4KIF A;  1IN7 A;  1P4A A;  2DO7 A;  2QZ8 A;  3JAM Z;  1E2X A;  1XGM A;  2W24 A;  1S6L A;  3JSO A;  4MTD A;  4HV5 A;  4EQQ A;  4LG0 A;  2IP2 A;  3G73 A;  2GXB A;  3ZN1 A;  5JR3 A;  3J81 K;  2QWW A;  4Q47 A;  3ZMU A;  1WQ2 A;  1HKS A;  4I01 A;  2ACJ A;  3C3W A;  2L4A A;  1IN6 A;  3FX3 A;  3TOB A;  5IT3 A;  4G6Q A;  3HTU A;  1ZLJ A;  1XD7 A;  3TOA A;  3V8L A;  4M9X A;  4KA4 A;  1O3Q A;  2LKP A;  1RIO H;  3DV8 A;  1G3S A;  1UHW A;  3O2P E;  2HWV A;  2YX4 A;  3BJ6 A;  1STZ A;  3DPL C;  1ZG3 A;  1LDK B;  4ON0 A;  3WE3 A;  5LEJ A;  5CVV A;  2GQQ A;  3RPU A;  1REP C;  1TBX A;  3BZ6 A;  5BOX A;  3E3V A;  3RYP A;  3HHG A;  3KP4 A;  4UVB A;  5D8K B;  5ICG A;  1B6A A;  5E1W A;  2ADU A;  4RAY A;  5FB2 A;  1BC7 C;  4R79 A;  3TQN A;  2EWN A;  2Z5U A;  1L3L A;  3ELK A;  2GIV A;  5ED4 A;  1LVA A;  3LAP A;  2ZNY A;  4K2E A;  3U2R A;  3EYY A;  1TTY A;  3HRU A;  1MKM A;  1CF7 B;  4LJZ F;  3RJP A;  1G4D A;  2DT5 A;  3KET A;  4OU0 A;  1P92 A;  3WTX C;  3SQN A;  2FBH A;  1MDM A;  3KCC A;  4ESB A;  2VBX A;  3GXO A;  5L3G A;  1MZB A;  1EH7 A;  4A5M A;  3KLN A;  1U8R A;  3EYI A;  1FY7 A;  5HLG A;  4LLG F;  2G7H A;  1KYW A;  5F64 A;  3WTT C;  4S04 A;  1XDU A;  2MLK A;  4BYY A;  5D5X B;  1BI3 A;  1WRJ A;  1J2X A;  1F4K A;  5J6X A;  2FU4 A;  4L5I A;  3N97 A;  5D4R A;  1T98 A;  2J5O A;  4ENK A;  1IRF A;  3LA7 A;  1ZH5 A;  4N9H A;  4WK8 F;  1X3U A;  3HRM A;  3NEU A;  2OAZ A;  3LWF A;  1I27 A;  1FSE A;  3ZN0 A;  2OA4 A;  3IRR A;  2OD5 A;  3GFJ A;  4OIO F;  2MH9 A;  3RKX A;  1J59 A;  2H27 A;  3I59 B;  3JAM K;  2RGV A;  4CGZ A;  2EFW A;  4MQ9 F;  3ABU A;  3IRQ A;  2GXG A;  2MD5 A;  2WV0 A;  2K27 A;  5AIQ A;  2IJL A;  3E6B A;  5KK1 A;  5F1R A;  4AIK A;  4U88 A;  3C1D A;  3HHH A;  5BPI A;  1LEB A;  3P7N A;  4R1H A;  4FX0 A;  1Z1D A;  1Z6R A;  1XCV A;  1PP7 U;  4FT8 A;  4HDU A;  1KQ9 A;  1S3J A;  1I1S A;  2Z33 A;  2V1D A;  4NQW A;  2RC4 A;  5E20 A;  2BYV E;  3I4P A;  1XDS A;  5EEG A;  5L3D A;  2BE5 F;  1PP8 F;  3F6O A;  5H20 A;  2H94 A;  1B4A A;  2Q2E A;  3RTR A;  3VOE A;  5LHG A;  1HBX G;  1E17 A;  2K7L A;  1OKR A;  1HST A;  3F22 A;  4M9Z A;  3AAF A;  1ON1 A;  3T0Y A;  5FD6 A;  4PZJ A;  2IW5 A;  3QP6 A;  2XV4 S;  4HQE A;  4PGG A;  4OIP F;  3KZZ A;  4A0Z A;  4IHS A;  1KU9 A;  2D1H A;  2HQN A;  2O0Y A;  2Y48 A;  3F21 A;  1LDJ A;  4ESJ A;  2X0L A;  3CDH A;  1MJ9 A;  1ULY A;  4HLX A;  1IAW A;  3K1P A;  4IRH A;  1BC8 C;  1YYV A;  1YW8 A;  1FC3 A;  2R3S A;  3RI4 A;  2RKH A;  5JHU A;  1Y0U A;  2H09 A;  2XKO A;  2IVM A;  1VTN C;  2A6H F;  3JTH A;  4GO1 A;  2XRO A;  3CJN A;  3V7R A;  4BQA A;  5ICC A;  3PFI A;  4MGR A;  3L09 A;  1FZP B;  3MZH A;  1SD6 A;  4H0E A;  5DD8 A;  4PGH A;  2K86 A;  2OQG A;  4KUM A;  5E1Z B;  5IT9 Z;  2UXX A;  1W7P A;  2D45 A;  4ZYH A;  1SD5 A;  4G7O F;  3E6C C;  4ETS A;  4YFX F;  1C0W A;  3HYI A;  3MQ0 A;  5CVJ A;  4TV7 A;  1ON2 A;  5E17 F;  4HYE A;  4IRI A;  4M6Y A;  3SZT A;  2K4J A;  3RDI A;  5ILV A;  3U1D A;  3MCZ A;  2XHK A;  5CYV A;  3FM5 A;  3ERE D;  3E6M A;  5LBQ A;  1IN5 A;  4RB1 A;  4JK1 X;  5HS8 A;  1DDN A;  3L00 A;  2RNJ A;  4LB5 A;  1ZHF A;  1USS A;  1V4R A;  3D5L A;  3HSE A;  1B1B A;  3E5U A;  3Q5F A;  2IT0 A;  3TO7 A;  1W4M A;  2XAJ A;  2XAQ A;  3VB2 A;  2KIM A;  1YIO A;  3F8F A;  3KP2 A;  3HSF A;  3FXQ A;  1FNN A;  3BJO A;  1D8K A;  2KIU A;  2KJC A;  4I0B A;  1FYM A;  2W84 A;  1RNL A;  3P9C A;  1ZRC A;  2FBK A;  2ZME A;  2LF8 A;  3IL2 A;  1U6G A;  2Q0O A;  2XGX A;  2EV5 A;  4LK1 F;  4KDP A;  3HSR A;  2CGP A;  1ZRF A;  2M87 A;  3C18 A;  1QGP A;  4L9N A;  2FNP A;  3I71 A;  2HKX A;  2K4B A;  4O3M A;  1XN7 A;  2DW4 A;  2G7U A;  4ZH4 F;  1A04 A;  4L5J A;  4DQ2 A;  3ZPL A;  3N4M A;  5KVR A;  1DPU A;  1V3F A;  5CLS A;  3F8C A;  4Y13 A;  1KU3 A;  3M1E A;  2CFX A;  4EJO A;  3WE2 A;  2A68 F;  5D5V B;  2EFO A;  4AVP A;  1QBJ A;  1YS7 A;  2ZME B;  4HF1 A;  3WG9 A;  3CUQ A;  3WU1 B;  4MHG A;  2FSW A;  4IVN A;  2P6S A;  1FT9 A;  5HS9 A;  2V79 A;  2AS5 F;  2HKO A;  2V1X A;  1BJA A;  3FZV A;  1S7O A;  1QO0 D;  4GYI A;  1G6N A;  1OYI A;  4LK0 F;  4G7Z F;  4M72 A;  3MEX A;  1BI2 A;  5A2Q K;  2JRT A;  2DK5 A;  2EA2 A;  5DCM B;  3ZMZ A;  1HW2 A;  4NB5 A;  4EVI A;  2FOK A;  3ECO A;  4YFK F;  3K1N A;  2W57 A;  1Z7U A; 
#chains in the Genus database with same CATH topology
 2O8K A;  3QOD A;  5ICE A;  1CGP A;  4O5V A;  2E60 A;  4EJT A;  3HOS A;  2EQR A;  1TQP A;  2IEK A;  4BDY A;  4XRF A;  3I55 I;  1W0U A;  2RRE A;  1IW7 F;  4A0X A;  4QWQ A;  1UHS A;  4I99 C;  4U7D A;  4W1U A;  2ZBK A;  1QPI A;  1R1U A;  2F2E A;  1TWA J;  3BPX A;  1KZH A;  2LY9 A;  4KIT B;  2P7V B;  1U0J A;  2W25 A;  2RVC A;  5IYD J;  3W2A A;  4MFE A;  2STT A;  1B9M A;  3V7S A;  4A3M J;  2W85 A;  2X4H A;  1XMX A;  2IAI A;  3CUQ B;  4KN4 X;  5FLV A;  1D3Y A;  1E3P A;  2GOX B;  2PBI A;  1YI2 I;  2O61 A;  3FIS A;  3REO A;  3T8T A;  2VPL A;  2AQE A;  4LLL A;  3LFK A;  3L2R A;  4M71 A;  1ZGJ A;  2EH3 A;  3FHN A;  1V54 H;  4FE4 A;  2QKL B;  4UV8 A;  2HQ5 A;  3BZK A;  3A0H C;  3LA2 A;  4HQM A;  1Y8R B;  3KE2 A;  1PDN C;  1HDP A;  1R1T A;  3LSI A;  2ICW G;  2WB1 N;  1OCC H;  1FOY A;  2BW3 B;  2Y0M A;  3HKZ A;  4JX5 A;  3ZCO A;  3GME A;  1LDD A;  3SZG A;  5HVQ C;  1Q1H A;  3ZOB A;  3NWS A;  4DNC A;  3S3N A;  2R7F A;  3B73 A;  5F0H A;  2CV2 A;  4NBQ A;  1SVL A;  2WA0 A;  5FKO A;  4EM0 B;  3O6B B;  3E97 A;  3TO6 A;  2MC3 A;  3W6K B;  4DYC A;  4R8H A;  1XGO A;  1Q1V A;  3ERM A;  4CCL A;  4HNV A;  3VWB A;  1ORK A;  2K3P A;  3TP3 A;  5E18 F;  1QVT A;  1HLV A;  5A2Q Z;  2XF5 A;  2HYG D;  2DT7 B;  2JSC A;  1RRJ A;  1XPX A;  3G1L A;  4MFD A;  1XSV A;  2BZT A;  1JE8 A;  5FGM A;  3VSK A;  4CXF A;  1QA6 A;  3LOC A;  3CDL A;  4I76 A;  2XDV A;  3ZMS A;  4CH7 A;  1OR7 C;  2LOO A;  3MAJ A;  5D6F A;  3VYU B;  2B7E A;  2QEN A;  3HL2 A;  1WSU A;  3J7Z I;  1SFX A;  2DI3 A;  4I98 B;  4OAY A;  1F5T A;  2YX7 A;  5J4V A;  2DA5 A;  1YS6 A;  2DTZ A;  1S7A A;  3GTK J;  2BW3 A;  2VKV A;  2AHQ A;  3LSG A;  4XON A;  3A01 B;  1H9G A;  1A6I A;  1UB9 A;  4A0Y A;  2EJR A;  3BT9 A;  1D0X A;  1JGS A;  5CKT A;  5D8L B;  2MG4 A;  4AIH A;  1D1A A;  3AG1 H;  2R93 J;  2VC0 A;  3LAJ A;  2IBD A;  1FSH A;  3GW2 A;  3ZQC A;  1J75 A;  5E1X A;  4IOC F;  2ZXH A;  5IOY A;  3ZQQ A;  4CZZ A;  1AWC A;  1B59 A;  2E7X A;  2RNG A;  2NVQ J;  2NS0 A;  1MH4 A;  5HOD A;  1W7P D;  3BOQ A;  2Z9O A;  2XVC A;  1D0Y A;  1WJE A;  5FD5 A;  4C2M J;  3OYN A;  2QLZ A;  2DFE A;  2P5L C;  3CUO A;  1JUP A;  5H2F C;  1KU2 A;  1F9N A;  2XAH A;  3I64 A;  3QPH A;  2JZY A;  3SFI A;  1F36 A;  4MTE A;  1NH3 A;  2ELH A;  1MMA A;  1UST A;  2HQR A;  2HXO A;  1R00 A;  3Q0V A;  2LD5 A;  1XTA A;  1P4W A;  4BHP A;  4F92 B;  1ZR4 A;  1DP7 P;  2LKX A;  2BVM A;  2PEX A;  3K70 C;  1SD7 A;  1EV7 A;  5EZG A;  2M30 A;  3DBL B;  3OYI A;  3K4N A;  1VQ9 I;  1QPM A;  2P81 A;  3BDD A;  1FBU A;  2HEO A;  1ZGW A;  3CF2 A;  1TW3 A;  3AG3 H;  3OYJ A;  2HOT A;  2UXN A;  3HUG A;  2ZSH B;  3ASN H;  3IAS 2;  4RAF A;  4RLQ A;  2DBB A;  3R4K A;  1JKQ C;  1K79 A;  4A3F J;  5D5U B;  1U5T A;  2VBY A;  1P7I A;  4L5E A;  1DU6 A;  3KEO A;  3O8G A;  1FLI A;  2VQC A;  3TBI A;  4BH9 A;  1LE8 A;  2NNN A;  3ZQG A;  4KMF A;  3QPS A;  1O3R A;  4OOI A;  1LJ9 A;  5HDK A;  2FRH A;  3QYF A;  4UB6 C;  1VQO I;  1R49 A;  1JKO C;  5DV5 A;  5LHI A;  1Z67 A;  5DM6 F;  4HDV A;  2O03 A;  2F6C A;  2P8T A;  4ENJ A;  3OS0 A;  1FMW A;  4BBS J;  2M9H A;  2VQH A;  3AG4 H;  5BQT A;  2NVT J;  2DOA A;  5B5E C;  1O3S A;  4XRS A;  1ZN2 A;  3S2H J;  1R7J A;  1ZYR F;  2BOL A;  5TRD A;  1UFM A;  2J5P A;  5HNF A;  1D8J A;  2FA5 A;  4KN7 X;  4P1W A;  2KRF A;  1NK2 P;  2X9D A;  2XGD A;  4XOT A;  3T8R A;  2ZB9 A;  2Q8K A;  1SFO J;  3BLY A;  2L9V A;  2K9Q A;  3DKW A;  2OF7 A;  4LMY A;  2NNY A;  3K69 A;  3HOZ J;  1SD4 A;  5IYB J;  4EV0 A;  4L0Y B;  5E8G A;  2XRL A;  2JUC A;  2QVO A;  3EPZ A;  4PUS A;  1FMV A;  2WTE A;  1GXQ A;  2D2W A;  3KPH A;  4L9V A;  4XRM A;  3RZO J;  4ZZD A;  2ZXI A;  4OMY A;  2VBW A;  1WJB A;  2LC2 A;  3GLL A;  3R0J A;  1TT5 B;  4RAZ A;  5CVR A;  2X6X A;  3ZQ7 A;  2WWY A;  2DMP A;  1YRN B;  4IHW A;  3S16 J;  4UB8 C;  4IOA F;  1MD0 A;  5D4S A;  4HOB A;  1U2W A;  4U7B A;  2IXS A;  2KMU A;  3DU5 A;  1VFC A;  1MBJ A;  1Y0N A;  1IRZ A;  1UHM A;  6PAX A;  3LMM A;  4D5C A;  2DQR A;  5CQG A;  2FEZ A;  2VJJ A;  3DTE A;  3GTM J;  3PM1 A;  2VE8 A;  3BR2 A;  1D5V A;  3W6J B;  1U3E M;  3HRT A;  2E1O A;  5GP9 A;  1U9N A;  1LPQ A;  2VOO A;  3MZY A;  3K10 A;  2HR3 A;  2VN2 A;  3BCB A;  4BGD A;  1EJ9 A;  2FBI A;  4BNC A;  2MLG A;  3E5X A;  5L3B A;  4A6E A;  5DM7 F;  4L9T A;  4P96 A;  2GZW A;  2A61 A;  1OMI A;  5LGN A;  1O7F A;  3PO2 J;  4EM2 A;  3VFZ A;  3PJR A;  4CSW A;  3MZ8 A;  4YEL A;  4Y15 A;  4MEX F;  2VC1 A;  1BN5 A;  2ZJ2 A;  2A5W A;  3S93 A;  3HOW J;  4G94 A;  3S14 J;  3CCM I;  2ID3 A;  1IRG A;  5EG0 B;  1P4X A;  2CO5 A;  1ACI A;  2NS8 A;  2L3D A;  5B1A H;  2V1U A;  2FE3 A;  5E3N A;  3NAR A;  1U9O A;  2ESN A;  3ULQ B;  3T5X A;  1LVK A;  1E0E A;  2P5K A;  2H6C A;  2Q2E B;  3ISP A;  1I3A A;  3PNV A;  3EDP A;  2E7W A;  2MGQ A;  4A93 J;  5J4Y A;  1KYZ A;  5E79 C;  4M3B A;  3FKJ A;  3KYC B;  5CVI A;  2BY0 A;  3K9T A;  1VQ4 I;  1ZG1 A;  2JA5 J;  1MJB A;  3SHF A;  3DFG A;  1WI3 A;  2FQ3 A;  1ZTR A;  1XSX A;  4CDG A;  4BDZ A;  1LFU P;  2YSR A;  1MSF C;  1OCR H;  4YIF A;  5J1Y A;  3S1Q J;  2M1B A;  3LST A;  4ZYD A;  4L0Z B;  5K7H A;  4A3L J;  2LRE A;  4L9J A;  4RM2 A;  3F8N A;  2IA0 A;  2WAF A;  4II3 A;  2DJI A;  1ZRD A;  1B9N A;  2I8D A;  3BTJ A;  3RKW A;  4JQF A;  4D9J A;  1AOY A;  4GXO A;  4ZDP A;  5HOO A;  4ZTJ A;  2DA4 A;  3VPR A;  3GZN B;  2IRF G;  4HEA 2;  5EEH A;  3OYG A;  2P6T A;  4FAS D;  1WPK A;  2BEO A;  2TRT A;  4ANJ A;  1T39 A;  1EH6 A;  2LNB A;  4ABZ A;  1DPR A;  3J81 Z;  2QQ9 A;  2EIJ H;  1IF1 A;  2BVL A;  3V8J A;  2OPT A;  2QUF A;  3WTZ A;  3S3O A;  2HYF A;  4XMY A;  4HX7 A;  4Y17 A;  2BGC A;  1BR1 A;  2PFB A;  2K9N A;  3D5R C;  4KNY A;  5E3O A;  2Z2S B;  1YIT I;  1HA8 A;  4KIG A;  1R71 A;  2OJE D;  3GFL A;  3KYL A;  5IT9 K;  1ZAR A;  5FLX K;  3BY6 A;  3CUQ C;  2LTP A;  2EB7 A;  2NAZ A;  4AM3 A;  4I09 A;  5EZH A;  3I58 A;  4EMS A;  1VI0 A;  3KLO A;  1V5G A;  3QP5 A;  3S32 A;  3BP8 A;  3A01 A;  1GV5 A;  1SVO A;  4E7I A;  2DAO A;  3DEE A;  2NOG A;  1NHA A;  1YW9 A;  1Z05 A;  2EFQ A;  2OCC H;  3HB9 A;  3IKV A;  4HX8 A;  4GCV A;  3RZD J;  4BXX J;  5TJJ A;  2ECB A;  3B6C A;  1MMS A;  4ZZL A;  4I2O A;  2DFI A;  2NXN B;  4HW0 A;  1ONV A;  1XMK A;  2XF7 A;  3HEF A;  2LKS A;  5HDN A;  3V4G A;  1LB2 A;  1IXR C;  2H6B A;  4U0Y A;  1UMQ A;  3WG7 H;  1BL0 A;  2EIN H;  4EM1 A;  4CYD A;  3CCV I;  1FWZ A;  1OR7 A;  4NDL A;  5TIS C;  1QU3 A;  1ZEL A;  4H4K C;  4ZC3 A;  2LG4 A;  3FXJ A;  2F5E A;  4CA0 A;  2HOS A;  5FRO A;  3M9A A;  1T2K A;  4RMN A;  5B1B H;  3RQ4 A;  2VE9 A;  4E7S A;  4EGZ A;  5K5Q A;  1IXC A;  4HG2 A;  4KT6 A;  5LEK A;  3V42 A;  2K85 A;  3NAU A;  4JYK A;  2IA1 A;  3OSG A;  2M7B A;  3TDZ C;  4EJU A;  1JI8 A;  3HGY A;  1SFU A;  3I9V 2;  3J80 K;  3R61 A;  1BBY A;  1YW7 A;  3IWF A;  1Z0X A;  1JGG A;  1UEL B;  4HF2 A;  4IHX A;  2PLY A;  2WV1 A;  1ERD A;  2WAE A;  2XC7 A;  4KIB A;  3DQV C;  1PVE A;  2VT3 A;  2XAU A;  4PK4 A;  1AU7 A;  1TW2 A;  3D0S A;  5JFR A;  1ZRE A;  2VOD A;  3PSI A;  3K4C A;  4BHB A;  4BAY A;  4AID A;  4HLY A;  5B3S H;  4ENN A;  4G8X A;  2GA1 A;  4LG3 A;  2ZO4 A;  5FLX Z;  5GPC A;  5GTI C;  4CHU A;  2DPD A;  1Z3Y A;  2BXY A;  3JRH A;  1S7E A;  1K6Y A;  2DLL A;  3GFM A;  2TDX A;  2OUM A;  2OV7 A;  2KIQ A;  4L18 B;  4E7L A;  4IPA A;  3B02 A;  2COM A;  4IQJ A;  1RKT A;  1TNS A;  4IEJ A;  2V6E A;  1POG A;  4QPQ A;  1ZG5 A;  1EH8 A;  1VZ0 A;  2D1V A;  2KLO A;  2HVS A;  2L02 A;  3I54 A;  4DYQ A;  1GV2 A;  4KMU X;  4FX4 A;  2H8R A;  2JRM A;  2QGU A;  3FM3 A;  3JCU C;  2DDB A;  4OMZ A;  4B44 A;  1HXD A;  2B9S A;  1WJ5 A;  4S05 A;  3SFZ A;  3S1R J;  3FF5 A;  2EIK H;  2OCE A;  3F3X A;  2O7O A;  3DLA A;  2E2J J;  2QYO A;  4D0P A;  3S8P A;  1SAX A;  5EGO B;  1D0Z A;  3R60 A;  2E1N A;  3K1M A;  4XNF A;  5FRM A;  2OZ6 A;  3FBI B;  1TWG J;  1X58 A;  5GAD J;  3S3M A;  2C6Y A;  2HS5 A;  1P6R A;  4XOP A;  1MJA A;  2V9P A;  3U9G A;  3HRS A;  1GLN A;  1WVR A;  5E3M A;  1GHC A;  2GWR A;  3PIP F;  1MGT A;  3KP3 A;  1BA5 A;  2ZC2 A;  4AWX B;  1AKH B;  2VOP A;  2NYX A;  3LQQ A;  4MEY F;  2LFB A;  3L7W A;  3G1O A;  4AIJ A;  4LFU A;  1YIJ I;  2QBY A;  3U1K A;  1J09 A;  1TQM A;  2WAQ N;  4B4C A;  4BUP A;  4A69 C;  2BY2 A;  5J8F A;  1XB4 A;  5CQE A;  1W5T A;  3MWM A;  1NG7 A;  1RET A;  4CCM A;  4MNU A;  3DCF A;  4F93 B;  2KIS A;  4HX4 A;  4AYB N;  3DPU A;  1TNT A;  1IXS B;  2DU9 A;  3DBR B;  3FDY A;  4DZP A;  3GO5 A;  1KON A;  1OPC A;  4M9S A;  4ZYE A;  3L2Q A;  4BAC A;  2EV0 A;  1A5J A;  2L9N A;  2V4J C;  2XF6 A;  4IZZ A;  2F4I A;  1YTY A;  1MDM B;  5FKK A;  1FIP A;  5FFZ A;  2DA2 A;  3M8F A;  2H8W A;  1VQ5 I;  3H9Q A;  3G4S I;  1T8I A;  1XGN A;  2O5R A;  1JJ8 C;  2DA6 A;  3QPL A;  1FBS A;  3F23 A;  2CYY A;  1NK3 P;  3G3Z A;  3CP2 A;  4BEH B;  2D5V A;  4MO7 A;  4UUV A;  4J01 A;  3DTK A;  3SEZ A;  4PDK A;  2L2O A;  4BXU A;  3E0J B;  1BW5 A;  2E2I J;  4PSW A;  2QBY B;  3F8B A;  4MQV A;  4Z6Y A;  1I6X A;  3JSP A;  4CIC A;  3HBL A;  1VQL I;  1FPQ A;  1XG1 A;  1LNW A;  2XPU A;  2EZK A;  2F5C A;  2VJI A;  3FMQ A;  3I0T A;  3LFU A;  3F8M A;  3GYH X;  1B8I B;  3DU6 A;  5DYM A;  3TGN A;  1RC9 A;  1KU7 A;  4ZYG A;  4RB3 C;  2STW A;  4Q48 A;  3TDU C;  3OIP A;  2WBM A;  5DUI A;  4CCN A;  2R7S A;  4OIR F;  2L01 A;  3DF8 A;  3JRE A;  2CV0 A;  1X4O A;  1XSD A;  1BOB A;  3RSN A;  1JXS A;  4UV9 A;  5LGT A;  4WWC A;  1K6O A;  5HDG A;  3EET A;  3HIF A;  3F9K A;  5DEQ A;  1WJF A;  2M2E A;  4XR6 A;  1FYL A;  3MKW B;  3QU3 A;  5BS6 A;  2YU3 A;  1IN8 A;  3MD2 A;  4UUS B;  4EAT A;  2GLO A;  3OOU A;  3R6S A;  1R5H A;  2KKO A;  3GTG J;  2VXZ A;  2Q1Z B;  3AL0 B;  2O9L A;  1I5Z A;  1T0F A;  3FBN B;  2O6G E;  2GA2 A;  3DKX A;  5AIP A;  4NNJ A;  3OV8 A;  4Y3O A;  2OQR A;  1OCT C;  1S29 A;  3PNT A;  1ODD A;  1P7J A;  4A3B J;  4DBQ A;  3F72 A;  5K5O A;  4CCJ A;  3Q9S A;  2P5V A;  4B47 A;  2M0C A;  3WU0 A;  2Y2Z A;  4WXC A;  2X48 A;  5F6F A;  2MC4 A;  2EZI A;  4XN3 A;  3VDX A;  2QSH X;  4CCK A;  2DA7 A;  3IV5 A;  1BM9 A;  2OTJ I;  2K5C A;  3A4C A;  3M1C A;  2P4W A;  2JA7 J;  4XSX F;  5JVT A;  1I3Q J;  1I1G A;  3OYC A;  2E1M C;  2LBF A;  3CMY A;  2XIG A;  3OIO A;  3QYE A;  1TWC J;  4RGS A;  4WXH A;  3RKY A;  3JRG A;  3KP5 A;  4UUT A;  5CVU A;  2JN6 A;  2R7U A;  2VB6 A;  4RGU A;  1E3H A;  3BJA A;  4OWR B;  3TKY A;  5BMZ A;  3HGG A;  3LSH A;  1KQ0 A;  3TO9 A;  1ZGA A;  1XCB A;  2UWM A;  1FP2 A;  4XKC A;  3L1P A;  1ZKG A;  2EV6 A;  1F1Z A;  2A5Y B;  2CQX A;  5ERI A;  3I4M J;  2CUZ A;  2HZT A;  3I4N J;  3SZP A;  3P9I A;  4HZF A;  4BJ5 C;  2HYJ A;  1FX7 A;  2X6Y A;  1N78 A;  2KL4 A;  3I53 A;  1BJZ A;  5IOZ A;  1WHU A;  4A3G J;  1FP1 D;  2DA1 A;  1X3Z B;  5C4X J;  4A2U A;  1Z6T A;  1RI7 A;  2QEX I;  5H6Q A;  3DPT A;  3L2W A;  2NVU B;  4RGX A;  4F7Z A;  3DTI A;  5J47 A;  3FXR A;  2NS7 A;  4E70 A;  2P7C B;  3FMR A;  1LEA A;  2DFH A;  4RS8 A;  3RPQ A;  1J7K A;  4RGR A;  2MFZ A;  3A02 A;  3OR2 C;  2R7Q A;  3QOP A;  1H9T A;  1CF7 A;  2R4G A;  2W1O A;  3H9J A;  4IHT A;  3JR9 A;  2XSJ C;  3OOP A;  4OIQ F;  3CJQ B;  4YII A;  4X6A J;  3OIQ A;  1QRY A;  2M5W A;  1MBK A;  1W0T A;  2CSO A;  3S2D J;  3CTA A;  1K4T A;  4IJA A;  2ZFW A;  4LG0 B;  3WTY C;  1YJN I;  5D6E A;  2ZXJ A;  3WOD F;  2HFH A;  3WHC A;  1VQ7 I;  2I5U A;  2GAU A;  4N0B A;  5AON A;  4DW6 A;  3FWE A;  1K7A A;  1FOK A;  4D7M A;  1HCR A;  2K02 A;  5FFX A;  3O3K A;  4XLN F;  2JPC A;  3HOY J;  1OYW A;  4HNT A;  3CCL I;  1K78 B;  1UCR A;  5LHH A;  3GX4 X;  5L3C A;  1ZQ3 P;  1MSE C;  3CQZ J;  2UUZ A;  1VQP I;  2M4G A;  3V8K A;  2DK8 A;  1Y6I A;  2YS9 A;  5JI6 A;  1MBH A;  2IGO A;  5HLI A;  4LLN A;  3K6G A;  4XIC A;  4XBF A;  3GFI A;  4IF4 A;  1PUE E;  2GIZ A;  2PMU A;  1QHH D;  1R9T J;  1LKX A;  1QNT A;  3EQL F;  4GFB A;  2HVR A;  2VQG A;  4RB0 A;  4WCG A;  5LRS A;  3CDI A;  2E5N A;  1G3T A;  4BQQ A;  2JPB A;  2LLK A;  2Z99 A;  2F5D A;  2VLA A;  1Y1V J;  2R7W A;  4BE0 A;  5LD2 C;  1S72 I;  1J5Y A;  2BHY A;  4KYW A;  5BNG A;  4LGW A;  2E19 A;  4U0V A;  4BY1 J;  4HSR A;  4QLC U;  4I7H A;  2UZK A;  1TL8 A;  2FD5 A;  2LSO A;  1YQA A;  1O57 A;  2FOW A;  5LGU A;  5ILU A;  1O7L A;  3BR1 A;  2RV8 A;  3TL4 X;  4X1E A;  1J0R A;  2QQA A;  5L3F A;  1JHH A;  1RZ4 A;  4DYR A;  2LH9 A;  2VBZ A;  5M3F J;  1HW5 A;  4BHC A;  2CQN A;  4WF2 A;  2CS3 A;  3PUB A;  2E5Z A;  2KQR A;  1DGR M;  2ELK A;  1K4S A;  3GTQ J;  1Z91 A;  3EUH A;  1WI9 A;  2KDZ A;  1WH5 A;  3SYT A;  4C3J J;  3X2Q H;  1SC7 A;  2BV6 A;  3H36 A;  2Y75 A;  4AD9 A;  1R6R A;  1PYV A;  2QF7 A;  4WXD A;  4XOR A;  5D5W B;  4W97 A;  5KAI C;  4GYG A;  2FMY A;  4GDF A;  3H3U A;  3H0D A;  3CCU I;  3JRC A;  5F1J A;  1U5T B;  2IPQ X;  2R0Q C;  3KP7 A;  5GAG J;  2DPU A;  4M6V A;  2ZME C;  4JP0 A;  4AU7 A;  5F04 A;  1HKQ A;  5DCM A;  2KJB A;  3CLQ A;  3K2Z A;  1W7P B;  2ETH A;  4XSZ F;  3KZY A;  4YG2 F;  1IUY A;  2EA4 A;  3ABM H;  4U0W A;  3ZMT A;  5HLT A;  2VT2 A;  3WU2 C;  5K5R A;  2JSP A;  2F4O B;  1DQU A;  3P5J A;  2ISZ A;  3I59 A;  4HAM A;  3QAH A;  2KIF A;  1IGN A;  2HOE A;  2XGE A;  4RDU A;  2EIM H;  4B8X A;  2FX0 A;  1BI1 A;  3ROU A;  2A6E F;  1EA3 A;  1ETX A;  3NRV A;  5FJ8 J;  2DA3 A;  3GTL J;  4YFN F;  3G1M A;  2CW0 F;  4P9F A;  3OYF A;  3WGH A;  1R23 A;  4BY7 J;  3O8H A;  2A07 F;  4O6J A;  2MSY A;  1QZZ A;  4ZDO A;  1IZ1 A;  2PX9 A;  4BQO A;  1RPW A;  3PNY A;  4B09 A;  4BQN A;  2IS4 A;  3JRB A;  2K9S A;  1N75 A;  4PJL A;  4CYC B;  5JLX A;  5K7F A;  5FKN A;  1R5G A;  2OZU A;  3H5A A;  1R36 A;  2O8X A;  3GVA A;  2X1D A;  4DIQ A;  1UAA A;  1HQC A;  2EFN A;  1BOA A;  2XAF A;  4F91 B;  2A69 F;  2IS6 A;  3VOD A;  3QRF F;  1VQ6 I;  4F3Q A;  2CUE A;  2YR2 A;  1ETW A;  2PG4 A;  1W1W E;  5H6R A;  4AC0 A;  3MFK A;  4A6D A;  1MNE A;  3IC7 A;  2G9W A;  4NHJ A;  2QQ8 A;  3DWL E;  2NOJ B;  3I56 I;  1KA8 A;  4QSH A;  3ZQL A;  4EJW A;  2DYS H;  2HDW A;  3BWG A;  3Q0U A;  5EEA A;  3F6V A;  1JUS A;  1BI0 A;  1QZY A;  3RPU D;  2PJR A;  2JJ7 A;  4XID A;  2ZCW A;  3HXL A;  3W6V A;  3LSR A;  1VQM I;  5J8C A;  2MBF A;  2ESH A;  2R7X A;  3KFW X;  4IRG A;  3ZMV A;  2DXI A;  2RDP A;  2R7V A;  3CCQ I;  2EZL A;  4G12 A;  3LSJ A;  3HOX J;  1QQI A;  3DEU A;  3L2C A;  3SDB A;  4B1R A;  3OYD A;  2NVY J;  2ZKZ A;  3EUH C;  5DD4 A;  3CC7 I;  5LRR A;  5IP9 J;  4EJV A;  2FML A;  4XLP F;  3GLX A;  4C3H J;  4UVA A;  2B0L A;  1NG6 A;  3J7A O;  3IP4 B;  3WTW C;  4M6X A;  1P2F A;  1FYK A;  4UY8 I;  1BIA A;  2L9R A;  2X1C A;  4HA8 A;  1RUN A;  1TZL A;  1T6S A;  2LP0 A;  1X2N A;  1CQT A;  3D5S C;  9ANT A;  4MLO A;  4IXA A;  2L54 A;  1VND A;  3E7L A;  3RIR A;  2PJR B;  2Y31 A;  3CLO A;  4PFP A;  2CUF A;  4ESF A;  5ILS A;  5EG0 A;  1ZLK A;  1IN4 A;  3E5Q A;  2CV1 A;  4FHT A;  3H3V K;  2Z1D A;  1FBQ A;  3OYM A;  1ZAO A;  3CES A;  3OL4 A;  2JTV A;  2LDU A;  4BKX A;  4RB2 C;  4FTH A;  2KZV A;  3IKT A;  3ABK H;  4P9U A;  1UG2 A;  4E7Z A;  3GUD A;  3L2V A;  4ASN A;  1UG0 A;  1Y39 A;  1F43 A;  1X1C A;  4JX4 A;  5J40 A;  4BU2 A;  1VF9 A;  5BPD A;  4UHT A;  3E6D A;  1YJ9 I;  1K83 J;  2DT6 A;  4V19 K;  2DTR A;  3QPT A;  1U78 A;  2QSG X;  1P9Q C;  2IGK A;  3HJE A;  3OYH A;  3OYE A;  3K4K A;  1OJL A;  2ZNZ A;  5J1U A;  3OS1 A;  4HNU A;  4LOC A;  1WKM A;  2IA2 A;  5FO5 A;  2HDC A;  1G3Y A;  4GGG A;  3OMY A;  2PN6 A;  4NC7 A;  2JK3 A;  1ITY A;  2FXA A;  3ABT A;  1X19 A;  2BXZ A;  3PQJ A;  2GXA A;  2KP6 A;  1FEX A;  3DLL F;  5IPA A;  1BIB A;  1W5S A;  1X2M A;  4AYB A;  2IS1 A;  2DMU A;  3R0A A;  3ESW B;  2HU9 A;  3FXU A;  4D7N A;  1JUM A;  4FE7 A;  4JX6 A;  3OS2 A;  2L5Q A;  1MMD A;  2DOD A;  3S1N J;  3A1Y A;  5CJ9 A;  2X51 A;  1X1B A;  5IYC J;  4BL0 B;  4OAZ A;  2R7T A;  3M7G A;  1R1V A;  2HXI A;  1S8N A;  4G9Y A;  1WH7 A;  2PI0 A;  3I5U A;  1T95 A;  3CMA I;  2CMP A;  3FIW A;  4A12 A;  1X1D A;  3S15 J;  4G6D A;  4Q5S F;  1ENH A;  2M45 A;  4M3F A;  3GF2 A;  3IH4 A;  4S0H B;  2AXL A;  2ELJ A;  4FQG A;  2ZSI B;  3C2G A;  3HTS B;  1WGX A;  1XGS A;  4B3X A;  4BE1 A;  3GWZ A;  2CU7 A;  1V55 H;  4UXN A;  2YPR A;  3NQO A;  1MNM C;  5DCF A;  3BPV A;  2HTJ A;  4Z2Y A;  5FKM A;  3ZMD A;  1VQ8 I;  4OIN F;  2PMZ N;  1T38 A;  1SMT A;  4N4N B;  1E3O C;  1DUX C;  3LQR A;  3KEQ A;  4A3C J;  1X1P A;  3CCJ I;  2OU2 A;  1DP3 A;  1K78 A;  1IV6 A;  5DUK A;  3WTS C;  2VIX A;  3MKZ A;  3AG2 H;  3BR5 A;  3JW4 A;  3HUG B;  1BR4 A;  4I02 A;  4ENM A;  4FIS A;  2IGN A;  3HKZ N;  1XX5 A;  4Q4Z F;  1MBG A;  2PMH A;  3CCS I;  2QM3 A;  3BRO A;  3K0L A;  3SJM A;  4IX7 A;  4PJM A;  1RUO A;  1J9I A;  3SXY A;  3L9F A;  3WTU C;  3V7C A;  2XAG A;  4DGW B;  2COB A;  4AUX A;  2MA3 A;  1ETV A;  3HM5 A;  2WY8 Q;  1H8A C;  1IO2 A;  2OBP A;  2ZXW H;  1BW6 A;  3A03 A;  4A5N A;  1Z9C A;  2K3F A;  4HF0 A;  4M3G A;  3GZ6 A;  5C4J J;  1RES A;  2IGM A;  1HW1 A;  3C2B A;  3HZJ A;  5F27 A;  4KIC A;  1X1A A;  3FHZ A;  1XMA A;  3S2W A;  1G3W A;  1H0M A;  1R58 A;  3PFY A;  3JTG A;  2EK5 A;  2EIL H;  3CME I;  4BBR J;  2XAS A;  3T1B A;  3WGI A;  1FIA A;  2HTS A;  1YX5 A;  1TT0 A;  3DP7 A;  1HKT A;  1JHF A;  2VON A;  2H1L A;  5LLQ A;  4M73 A;  1U8B A;  1GXP A;  1ETO A;  4UNO A;  1YFH A;  1T33 A;  4ZJZ A;  2CQK A;  1S9H A;  3RYR A;  3HOV J;  3CO7 C;  2BBY A;  2L9S A;  2ECC A;  2EPF A;  3LA3 A;  4I6Z A;  4LD5 A;  1YO5 C;  2KFD A;  1U5T C;  5JLW A;  1KQ8 A;  4CO8 A;  2M8E A;  4P5O A;  1IJW C;  2HGC A;  3ZRG A;  2JA2 A;  1OYY A;  3NWT A;  1PUF B;  5EJC A;  2CG4 A;  3S1M J;  2KDO A;  3GZ5 A;  3H35 A;  4BE2 A;  1SMY F;  2IS2 A;  2PQ8 A;  1HSJ A;  4CUG A;  2V6C A;  2L4M A;  1TLH B;  3HOT A;  1Y1W J;  1IUF A;  1OIS A;  3IH3 A;  3VEP A;  3GEZ A;  3P9K A;  3BG7 A;  4JBA A;  5L3E A;  2XUB A;  4HPQ A;  2LBF B;  4LB6 B;  1D1C A;  1MW7 A;  1SAN A;  2JMW A;  4UVC A;  2L7M P;  4Y33 A;  3RQI A;  3WTV C;  4RLF A;  2JT1 A;  2JVH A;  4M74 A;  2PJP A;  1A31 A;  1O3T A;  1RR7 A;  2VXD A;  2FNA A;  3KP6 A;  1GDT A;  2XPW A;  3TED A;  2LF7 A;  3H3Z A;  3BG9 A;  4JOM A;  1Z77 A;  3IHU A;  2LY1 A;  3C7J A;  3ECH A;  3PQK A;  4WX9 A;  1YLF A;  2V9V A;  1LE8 B;  3OYK A;  2WC2 A;  2KHM A;  5DDG A;  1TWH J;  1LQ1 A;  4YRV A;  1FOW A;  3CC2 I;  2VPR A;  3ABL H;  5KHD A;  2G0E A;  4E7H A;  4KFC A;  2XKP A;  1R22 A;  3DBH B;  3OR1 C;  3CO6 C;  1JTY A;  3C2H A;  5GTH C;  1OCO H;  3G6E I;  2O3F A;  1WJA A;  4KT5 C;  4N9I A;  4V2F A;  1D1B A;  2RQP A;  3RKQ A;  3IWZ A;  1SFE A;  2E35 A;  3FMS A;  5HS7 A;  4ZTF A;  5FLM J;  2FF4 A;  4P55 A;  2LYC A;  2QKM B;  2R7D A;  2F5F A;  3Q9V A;  2QQB A;  3QU6 A;  3BCA A;  2XRN A;  3CCR I;  1WWX A;  5ICF A;  3H92 A;  2Z3Y A;  5CPR B;  3BC8 A;  4HV6 A;  1I39 A;  3ML6 A;  2RN7 A;  4HBL A;  5HLH A;  3J80 Z;  1YE9 A;  2MH2 A;  3ZQF A;  4HRI A;  4C30 A;  4G7H F;  3M8E A;  4XKB A;  4N4O B;  1OCP A;  2CWE A;  3WGG A;  4QIW N;  3ZP5 A;  1QHG A;  3COA C;  4EGY A;  3OL3 A;  5IP6 A;  1GVJ A;  4DJA A;  2A3S A;  2DQL A;  2KPM A;  2E1C A;  1B72 A;  3DXJ F;  1L0O C;  2DDA A;  1TQI A;  2EFP A;  2ISY A;  1KGS A;  4XKW A;  2LRD A;  4PCQ A;  1Z21 A;  1FOX A;  5K1Y A;  1YG2 A;  1WFX A;  2NRA C;  1YRN A;  1IG7 A;  2L7F P;  4PJN A;  5EYR A;  5GPA A;  5E8I A;  2VQL A;  1OCZ H;  3FKI J;  2F4M B;  4I0A A;  4KIF A;  1IN7 A;  1P4A A;  2DO7 A;  1GT0 C;  2QZ8 A;  2M7A A;  3JAM Z;  1ETQ A;  1E2X A;  4E6K G;  1S5L C;  3G71 I;  1XGM A;  2W24 A;  1S6L A;  2ZJP F;  3JSO A;  4MTD A;  4HV5 A;  4EQQ A;  3H9G A;  3DKY A;  4LG0 A;  2IP2 A;  2Y9Y A;  2PMZ A;  3G73 A;  2XSD C;  3JRI A;  2GXB A;  3ZN1 A;  5JR3 A;  2B63 J;  3UKG A;  4A3D J;  4A3E J;  3GTP J;  2EZH A;  1JT6 A;  4XLA A;  3J81 K;  1APL C;  5C44 J;  2QWW A;  2CFO A;  1SVM A;  4Q47 A;  2VUM J;  1A35 A;  1B72 B;  3CP8 A;  2R5Z B;  3ZMU A;  1MH3 A;  1WQ2 A;  1YX3 A;  1HKS A;  4XN0 A;  3H1C A;  4I01 A;  2ACJ A;  3PIO F;  3C3W A;  3WHB A;  2L4A A;  1IN6 A;  3FX3 A;  3TOB A;  1A6Q A;  4G6T B;  1SFK A;  2AQF A;  2CJJ A;  3VSL A;  1W5C C;  5IT3 A;  1R4M B;  4G6Q A;  4AVZ A;  1G59 A;  3HTU A;  1ZLJ A;  3BG6 A;  4XLC A;  2DN0 A;  5C3E J;  2R5Y A;  1XD7 A;  3TOA A;  3V8L A;  4M9X A;  5GAH J;  4KA4 A;  1O3Q A;  3F0C A;  2LKP A;  5FKL A;  1RIO H;  1FJL A;  1K61 A;  2ZJR F;  3DV8 A;  1H89 C;  2VKD A;  1G3S A;  1EKE A;  4F52 A;  1UHW A;  3QOE A;  1W36 C;  2W00 A;  3O2P E;  1MND A;  2CRG A;  2HWV A;  4XM3 A;  3GTO J;  1WJD A;  2BHZ A;  2YX4 A;  3BJ6 A;  3K4L A;  2JA8 J;  5J1R A;  2QSF X;  4B3A A;  5K7Z A;  1STZ A;  3DPL C;  4F55 A;  1ZG3 A;  4E7J A;  1IDY A;  1LDK B;  4ON0 A;  2R7Z J;  3WE3 A;  5LEJ A;  3CC4 I;  5CVV A;  2GQQ A;  3RPU A;  2KZG A;  2JA6 J;  1REP C;  3H5R A;  3I3L A;  1TBX A;  4LIV A;  2DMT A;  4M3D A;  3BZ6 A;  3JRD A;  1N77 A;  3PL8 A;  5KAF C;  4E7K A;  5BOX A;  3ONQ A;  3D1N I;  1VQN I;  1ETK A;  3M8J A;  3E3V A;  1N25 A;  3RYP A;  3HHG A;  3KP4 A;  4UVB A;  5D8K B;  5ICG A;  1B6A A;  5E1W A;  2ADU A;  1JT0 A;  3BTL A;  2XPV A;  3BR3 A;  4RAY A;  2DMN A;  5FB2 A;  1BC7 C;  2YU9 J;  4R79 A;  3JRF A;  1QZE A;  3TQN A;  1MBF A;  2EWN A;  3FXL A;  2H1K A;  4NC8 A;  2Z5U A;  1L3L A;  3ELK A;  2GIV A;  4DBR A;  5ED4 A;  1A36 A;  2L7K A;  4HST A;  1LVA A;  3LAP A;  1Z3X A;  5F0F A;  5DTD A;  2JWT A;  2ZNY A;  3ZQI A;  3GTJ J;  4K2E A;  1GUU A;  3U2R A;  3EYY A;  1TTY A;  3HRU A;  3K7A J;  1MKM A;  2DMQ A;  2K40 A;  1CF7 B;  1T0F C;  4LJZ F;  3RJP A;  1G4D A;  2DT5 A;  5EGO A;  3Q0W A;  3KET A;  1IDZ A;  4OU0 A;  5F0C A;  2JQ7 A;  1P92 A;  4LIU A;  1FTZ A;  3WTX C;  3SQN A;  2FBH A;  1MDM A;  3KCC A;  2W82 A;  3CJR B;  3ZXS A;  4ESB A;  2W7N A;  2VBX A;  2LK2 A;  3GXO A;  1X4P A;  1Y56 A;  2KT0 A;  3EUA A;  4MIM A;  5L3G A;  1TC3 C;  1MIJ A;  1MZB A;  1EH7 A;  1GVD A;  3KEY A;  4E4H A;  4A5M A;  3KLN A;  1U8R A;  3TP0 A;  3EYI A;  1FY7 A;  1MMG A;  2F5V A;  5HLG A;  4C2U A;  3H5N A;  4LLG F;  2G7H A;  3CF5 F;  3J7A Y;  2VKH A;  1KYW A;  5F64 A;  2ID6 A;  3WTT C;  2CH0 A;  4XQF A;  4FET A;  3BQY A;  4A3J J;  2V1N A;  3BR0 A;  4S04 A;  3UNG C;  2CQ7 A;  1XDU A;  2MLK A;  4BYY A;  2TCT A;  5D5X B;  3J7Y J;  2XGC A;  3BG5 A;  1B8I A;  1BI3 A;  1WRJ A;  5F08 A;  1J2X A;  3K2A A;  2GM4 A;  3W3C A;  1F4K A;  5J6X A;  3U21 A;  2FU4 A;  2WY7 Q;  4L5I A;  3N97 A;  5D4R A;  1T98 A;  2J5O A;  4ENK A;  5M3M J;  4GRI A;  2VL8 A;  1JKP C;  4XK4 A;  1IRF A;  3LA7 A;  3OY9 A;  1ZH5 A;  5GAE J;  4N9H A;  3MN2 A;  2FJ1 A;  4WK8 F;  3BZC A;  1X3U A;  1XC5 A;  3HRM A;  3NEU A;  2OAZ A;  2LY2 A;  3LWF A;  1I27 A;  1V5E A;  3BQZ A;  1FSE A;  3ZN0 A;  2GOM A;  2WB1 A;  2OA4 A;  2I10 A;  4Y7N J;  3IRR A;  3L2U A;  1UJ8 A;  3S17 J;  2OD5 A;  1NTC A;  3GFJ A;  4RBO A;  4BXF A;  2A05 A;  2MH9 A;  4OIO F;  4KIS A;  3RKX A;  1J59 A;  2H27 A;  3I59 B;  3JAM K;  4C3I J;  2RGV A;  4CGZ A;  2M0M A;  2EFW A;  5TGT A;  4MQ9 F;  2CUJ A;  3ABU A;  3IRQ A;  2GXG A;  2MD5 A;  1WJC A;  2WV0 A;  2K27 A;  3IUO A;  5AIQ A;  2CW8 A;  5J3L A;  2FUG 2;  2YUS A;  2IJL A;  1AA7 A;  4QPO A;  4IHY A;  3E6B A;  3QWL A;  4CZC A;  5KK1 A;  2Y0S A;  2OTL I;  5F1R A;  3GBG A;  4AIK A;  2DCE A;  4CYC A;  1VQK I;  4U88 A;  2M4K A;  2HOA A;  3C1D A;  3HHH A;  5BPI A;  1TP4 A;  1LEB A;  1OQY A;  3P7N A;  4R1H A;  4FX0 A;  1JTX A;  3TW7 A;  3OWT A;  1Z1D A;  3BR6 A;  1Z6R A;  1HF0 A;  1XCV A;  3TMO A;  1PP7 U;  4FT8 A;  4HDU A;  1KQ9 A;  1S3J A;  1WCM J;  1I1S A;  2Z33 A;  3RCO A;  2V1D A;  5E3L A;  2DFF A;  4NQW A;  2RC4 A;  1HC8 A;  5E20 A;  2BYV E;  3I4P A;  1XDS A;  5EEG A;  2F48 A;  5L3D A;  1I6H J;  2E34 A;  2BE5 F;  1PP8 F;  1FTT A;  2ZJQ F;  2KRH A;  3F6O A;  3BTI A;  3CJT B;  5H20 A;  5IP7 J;  2H94 A;  2XB5 A;  1B4A A;  1ETY A;  2Q2E A;  2E2H J;  3RTR A;  4M3E A;  3VOE A;  5LHG A;  1BR2 A;  2M34 A;  2VI6 A;  1HBX G;  1E17 A;  3CZ6 A;  2K7L A;  3KZI C;  1Z7L A;  1OKR A;  1SAU A;  3LSK A;  1ZR2 A;  1HST A;  3F22 A;  4M9Z A;  3AAF A;  1ON1 A;  2VKE A;  3GCM A;  4XLH A;  3T0Y A;  4B43 A;  2X6O A;  2BY1 A;  5FD6 A;  4PZJ A;  1RKW A;  3K4J A;  2IW5 A;  3QP6 A;  2XV4 S;  2R5Z A;  4HQE A;  2KRC A;  3B6A A;  4PGG A;  4OIP F;  3KZZ A;  4KJZ A;  4A0Z A;  4RM3 A;  3OYL A;  1JJ6 C;  4IHS A;  4J19 A;  3OYA A;  1KU9 A;  2D1H A;  2MYS A;  2HQN A;  2O0Y A;  3KX2 A;  1QVU A;  1TWF J;  2AO9 A;  4Y4R A;  1ZK8 A;  2Y48 A;  5DS9 A;  1Y8Q B;  3F21 A;  1LDJ A;  4PJJ A;  1T08 B;  3CMM A;  3M07 A;  4ESJ A;  2X0L A;  3CDH A;  3HC7 A;  2WAQ A;  3MVP A;  2JUG A;  3BG3 A;  4NUB A;  1MJ9 A;  2Y9Z A;  2R5Y B;  1ULY A;  4V2G A;  4HLX A;  2MW8 A;  1IAW A;  3K1P A;  4IRH A;  5HNH A;  1MBE A;  2VAS A;  1YYV A;  1BC8 C;  1YW8 A;  1FC3 A;  2R3S A;  4EEF G;  3HG9 A;  2R7O A;  3RI4 A;  2RKH A;  3N05 A;  5M5X J;  4NC6 A;  5JHU A;  1Y0U A;  3K4M A;  2H09 A;  4DOZ A;  2XKO A;  4D5F A;  2IVM A;  3PUF A;  1VTN C;  2HQA A;  2A6H F;  2NVX J;  3JTH A;  4GO1 A;  2XRO A;  3ZQH A;  4FCY A;  3HPH A;  3CJN A;  3CCE I;  3V7R A;  5M5Y J;  4BQA A;  4BJT A;  5ICC A;  2JVG A;  2LR8 A;  3PFI A;  4MGR A;  2CW7 A;  3L09 A;  3FXO A;  1FZP B;  3MZH A;  1SD6 A;  4H0E A;  2GBY A;  3VYR B;  5DD8 A;  2HNH A;  4PGH A;  2K86 A;  2OQG A;  4PJ0 C;  5EDN A;  4KUM A;  5E1Z B;  4BS9 A;  5IT9 Z;  3HOU J;  4BJ6 C;  2UXX A;  3KIO A;  4II2 A;  1W7P A;  1MMN A;  2Y0S N;  2D45 A;  1W36 D;  1DU0 A;  1YHQ I;  4ZYH A;  3H0G J;  1SD5 A;  4G7O F;  1WZ2 A;  2A6T A;  3Q3S A;  3E6C C;  4ETS A;  3G2B A;  4YFX F;  2QCO A;  1IRX A;  2BY3 A;  1SEU A;  2P0W A;  3EUK L;  1C0W A;  3HYI A;  3MQ0 A;  5CVJ A;  2Y30 A;  4TV7 A;  3HDD A;  4Y52 J;  1ON2 A;  5E17 F;  4HYE A;  4IRI A;  1X3W B;  4M6Y A;  4ITV A;  2HPM A;  2DOF A;  2DJN A;  3ZR8 X;  5LFA A;  4IQ4 A;  3MMY B;  3SZT A;  2K4J A;  3PSF A;  3RDI A;  3LL7 A;  5ILV A;  2K9L A;  3FK6 A;  1OLT A;  3U1D A;  2W48 A;  2X1E A;  3MCZ A;  2XHK A;  5CYV A;  3FM5 A;  3ERE D;  2Y69 H;  4XRS G;  3E6M A;  3LSP A;  2MD0 A;  2AXT C;  4XL9 A;  1IN5 A;  5LBQ A;  4RB1 A;  3VYS B;  1RR8 C;  3IH2 A;  1G8X A;  4JK1 X;  5HS8 A;  1DDN A;  2HPI A;  3L00 A;  2RNJ A;  2QA4 I;  4LB5 A;  1IC8 A;  1ZHF A;  1USS A;  3ASO H;  2XB0 X;  1V4R A;  4IHV A;  3D5L A;  3HSE A;  4XKV A;  4UUS A;  1B1B A;  3E5U A;  5M5W J;  3Q5F A;  1O4X A;  4CCO A;  1XS9 A;  1V5F A;  2IT0 A;  3TO7 A;  5EF6 A;  1W4M A;  2XAJ A;  2XAQ A;  3VB2 A;  1R5I D;  2KIM A;  2X6W A;  1YIO A;  4A3I J;  3F8F A;  3KP2 A;  3M3Y J;  1R4N B;  3HSF A;  3FXQ A;  1LFB A;  2HI3 A;  4A3K J;  4C2T A;  3SEQ A;  1FNN A;  3M4O J;  3LSM A;  3BJO A;  3A0B C;  3K70 D;  3AL0 C;  2OC6 A;  1DGW Y;  1D8K A;  2KIU A;  4U87 A;  4B48 A;  2R7R A;  2K9M A;  4IO9 F;  2L7Z A;  2KJC A;  4YIR X;  2E36 A;  1I50 J;  2M3A A;  4I0B A;  1FYM A;  2W84 A;  1RNL A;  3P9C A;  1ZRC A;  2FBK A;  1M1E B;  2ZME A;  2LF8 A;  1T56 A;  3IL2 A;  1U6G A;  3VYT B;  3LNQ A;  2Q0O A;  2XGX A;  3TW6 A;  4ZDL A;  2CQQ A;  2EV5 A;  4LK1 F;  3QQA A;  3AKZ A;  2E71 A;  4KDP A;  2WAD A;  3HSR A;  4PSX A;  2CGP A;  4PFO A;  5KNL A;  1ZRF A;  2M87 A;  2M8G X;  4BEH A;  3C18 A;  2LVS A;  1QGP A;  4L9N A;  2FNP A;  3I71 A;  4DZJ A;  2HKX A;  2VJ5 A;  4LIT A;  2LMD A;  2K4B A;  2E1M B;  1AKH A;  2RQQ A;  4O3M A;  4X0G A;  1PUF A;  4ZYA A;  2HZD A;  4YEJ A;  3UR3 C;  1XN7 A;  1UZC A;  2DW4 A;  2G7U A;  3AFH A;  2R92 J;  3FK7 A;  1IV8 A;  4ZH4 F;  1A04 A;  4L5J A;  4DQ2 A;  1HOM A;  1OFC X;  3DEW A;  3ZPL A;  3N4M A;  3KYD B;  5KVR A;  4NQW B;  2MAB A;  1DPU A;  1V3F A;  1G2H A;  3QYB A;  3CCY A;  1LFP A;  5CLS A;  2DOE A;  3FXK A;  2ME0 A;  2RAE A;  3F8C A;  2VJ4 A;  4Y13 A;  1EF4 A;  5JHF A;  1KU3 A;  4RA2 A;  2L0K A;  3M1E A;  2CFX A;  2HVQ A;  2V26 A;  2EBI A;  3A2K A;  4EJO A;  3CD6 I;  3WE2 A;  1D5Y A;  2A68 F;  5D5V B;  2EFO A;  5FRN A;  1YOV B;  4AVP A;  3MKY B;  2W4S A;  3HPG A;  1QBJ A;  1YS7 A;  4IL6 C;  2X85 A;  1HDD C;  3JRA A;  2ZME B;  4HF1 A;  5B66 C;  3K4B A;  3OYB A;  5KCM A;  1AHD P;  3WG9 A;  3CUQ A;  3MKL A;  3WU1 B;  2ME6 A;  3W2W A;  2UV1 A;  2HDD A;  4XLE A;  4MHG A;  4C9Y A;  3OSF A;  3BTC A;  2FSW A;  4IVN A;  2P6S A;  1FT9 A;  5HS9 A;  2V79 A;  2AS5 F;  2N8G A;  2V7F A;  3W2V A;  2HKO A;  5IY5 H;  3FXM A;  2V1X A;  3ZGK A;  2ZFU A;  1BJA A;  2DYR H;  3FZV A;  1S7O A;  4RAG A;  1QO0 D;  5JVG F;  4GYI A;  1G6N A;  1OYI A;  4LK0 F;  4G7Z F;  4M72 A;  4XLF A;  3MEX A;  1BI2 A;  3SDG A;  3IAM 2;  5A2Q K;  1H88 C;  4QTR A;  4IKF A;  2JRT A;  1PJR A;  2DK5 A;  2EA2 A;  2V9K A;  1YJW I;  5DCM B;  3ZMZ A;  4J00 A;  1LUJ B;  2FQ4 A;  1HW2 A;  4NB5 A;  1JKR C;  4EVI A;  2FOK A;  3E1S A;  2Z16 A;  3ECO A;  4YFK F;  3K1N A;  4D1Q A;  3PO3 J;  2W57 A;  1Z7U A; 
#chains in the Genus database with same CATH homology
 5ICE A;  1CGP A;  4O5V A;  4EJT A;  3HOS A;  1TQP A;  4XRF A;  1IW7 F;  4A0X A;  4QWQ A;  4U7D A;  2ZBK A;  1R1U A;  2F2E A;  3BPX A;  2P7V B;  2W25 A;  2RVC A;  2STT A;  1B9M A;  3V7S A;  2W85 A;  2X4H A;  3CUQ B;  4KN4 X;  1D3Y A;  2O61 A;  2PBI A;  3REO A;  3T8T A;  4LLL A;  3LFK A;  4M71 A;  1ZGJ A;  4UV8 A;  3LA2 A;  4HQM A;  3KE2 A;  1PDN C;  1R1T A;  2Y0M A;  1LDD A;  5HVQ C;  1Q1H A;  4DNC A;  2R7F A;  3B73 A;  4EM0 B;  3O6B B;  3E97 A;  3TO6 A;  2MC3 A;  3W6K B;  4R8H A;  1XGO A;  5E18 F;  5A2Q Z;  2HYG D;  2JSC A;  1XSV A;  1JE8 A;  5FGM A;  4CXF A;  3ZMS A;  3MAJ A;  5D6F A;  2QEN A;  1WSU A;  1SFX A;  2DI3 A;  4I98 B;  1F5T A;  2YX7 A;  1YS6 A;  1S7A A;  1H9G A;  1UB9 A;  4A0Y A;  2EJR A;  5D8L B;  1JGS A;  4AIH A;  2VC0 A;  3LAJ A;  1FSH A;  3GW2 A;  1J75 A;  5E1X A;  4CZZ A;  1AWC A;  1B59 A;  2E7X A;  2NS0 A;  1W7P D;  3BOQ A;  2Z9O A;  2XVC A;  5FD5 A;  2QLZ A;  2P5L C;  3CUO A;  1KU2 A;  1F9N A;  2XAH A;  3I64 A;  3QPH A;  2JZY A;  4MTE A;  2ELH A;  1UST A;  2HQR A;  1R00 A;  1P4W A;  4BHP A;  1DP7 P;  2PEX A;  1SD7 A;  1EV7 A;  2M30 A;  1QPM A;  3BDD A;  1FBU A;  2HEO A;  1TW3 A;  2UXN A;  3HUG A;  1K79 A;  2DBB A;  3R4K A;  5D5U B;  1U5T A;  2VBY A;  3KEO A;  1FLI A;  4BH9 A;  2NNN A;  4KMF A;  1O3R A;  4OOI A;  1LJ9 A;  5HDK A;  2FRH A;  5DV5 A;  5LHI A;  4HDV A;  2O03 A;  2P8T A;  4ENJ A;  5BQT A;  1O3S A;  1ZN2 A;  1R7J A;  1ZYR F;  5TRD A;  1UFM A;  2J5P A;  1D8J A;  2FA5 A;  4KN7 X;  2KRF A;  3T8R A;  2Q8K A;  3DKW A;  4LMY A;  2NNY A;  3K69 A;  1SD4 A;  4EV0 A;  4L0Y B;  5E8G A;  2QVO A;  2WTE A;  1GXQ A;  2D2W A;  4L9V A;  4ZZD A;  4OMY A;  2VBW A;  3R0J A;  3ZQ7 A;  4RAZ A;  5CVR A;  2WWY A;  1MD0 A;  5D4S A;  4HOB A;  1U2W A;  4U7B A;  1UHM A;  6PAX A;  2DQR A;  2FEZ A;  2VE8 A;  1D5V A;  3W6J B;  1U3E M;  3HRT A;  2VOO A;  3MZY A;  2HR3 A;  2VN2 A;  2FBI A;  4BNC A;  2MLG A;  3E5X A;  5L3B A;  4A6E A;  4L9T A;  4P96 A;  2GZW A;  2A61 A;  1OMI A;  5LGN A;  1O7F A;  4EM2 A;  3VFZ A;  4Y15 A;  4MEX F;  2VC1 A;  1BN5 A;  2ZJ2 A;  4G94 A;  1IRG A;  1P4X A;  2CO5 A;  2L3D A;  2V1U A;  2FE3 A;  2ESN A;  3ULQ B;  3T5X A;  2P5K A;  2H6C A;  3ISP A;  3EDP A;  2E7W A;  1KYZ A;  5CVI A;  3K9T A;  1ZG1 A;  1MJB A;  3SHF A;  3DFG A;  2FQ3 A;  1XSX A;  4CDG A;  2YSR A;  4YIF A;  2M1B A;  3LST A;  4ZYD A;  4L0Z B;  4L9J A;  3F8N A;  2IA0 A;  1ZRD A;  1B9N A;  3RKW A;  4JQF A;  1AOY A;  4GXO A;  5HOO A;  2IRF G;  5EEH A;  2P6T A;  2BEO A;  1T39 A;  1EH6 A;  2LNB A;  1DPR A;  3J81 Z;  2QQ9 A;  1IF1 A;  3V8J A;  2QUF A;  3WTZ A;  2HYF A;  4HX7 A;  4Y17 A;  2BGC A;  2PFB A;  4KNY A;  4KIG A;  3GFL A;  5IT9 K;  1ZAR A;  5FLX K;  3BY6 A;  3CUQ C;  2EB7 A;  2NAZ A;  4I09 A;  3I58 A;  4EMS A;  3KLO A;  3QP5 A;  3BP8 A;  2DAO A;  2EFQ A;  1NHA A;  1YW9 A;  1Z05 A;  4HX8 A;  3IKV A;  4GCV A;  5TJJ A;  4ZZL A;  4I2O A;  2DFI A;  4HW0 A;  1ONV A;  1XMK A;  5HDN A;  3V4G A;  1LB2 A;  1IXR C;  2H6B A;  4U0Y A;  4EM1 A;  4CYD A;  1FWZ A;  1OR7 A;  2F5E A;  3M9A A;  1T2K A;  2VE9 A;  4EGZ A;  5K5Q A;  1IXC A;  5LEK A;  2IA1 A;  3TDZ C;  4EJU A;  1SFU A;  3J80 K;  3R61 A;  1BBY A;  1YW7 A;  3IWF A;  4HF2 A;  2PLY A;  4KIB A;  3DQV C;  2VT3 A;  1TW2 A;  3D0S A;  5JFR A;  1ZRE A;  2VOD A;  4BHB A;  4BAY A;  4ENN A;  4HLY A;  4G8X A;  2GA1 A;  2ZO4 A;  5FLX Z;  4CHU A;  2DPD A;  2TDX A;  3GFM A;  2DLL A;  4L18 B;  4IPA A;  3B02 A;  2COM A;  1TNS A;  1ZG5 A;  1EH8 A;  2D1V A;  2L02 A;  3I54 A;  4KMU X;  4FX4 A;  3FM3 A;  4OMZ A;  1HXD A;  4S05 A;  3SFZ A;  3FF5 A;  3F3X A;  2QYO A;  4D0P A;  1SAX A;  3R60 A;  2E1N A;  3K1M A;  2OZ6 A;  2C6Y A;  2HS5 A;  1P6R A;  1MJA A;  3U9G A;  3HRS A;  1GHC A;  2GWR A;  1MGT A;  3KP3 A;  4AWX B;  2VOP A;  2NYX A;  3LQQ A;  4MEY F;  3L7W A;  4AIJ A;  4LFU A;  2QBY A;  1TQM A;  5J8F A;  1XB4 A;  1W5T A;  3MWM A;  4MNU A;  4HX4 A;  1TNT A;  1IXS B;  2DU9 A;  3GO5 A;  1OPC A;  4M9S A;  4ZYE A;  2EV0 A;  1YTY A;  1MDM B;  5FFZ A;  3M8F A;  1XGN A;  1FBS A;  3F23 A;  2CYY A;  3G3Z A;  4UUV A;  4BXU A;  4PDK A;  2QBY B;  3F8B A;  4MQV A;  1I6X A;  3JSP A;  4CIC A;  1FPQ A;  1LNW A;  2F5C A;  3FMQ A;  3I0T A;  3F8M A;  3GYH X;  3TGN A;  5DYM A;  1KU7 A;  4ZYG A;  4RB3 C;  2STW A;  4Q48 A;  3TDU C;  5DUI A;  4OIR F;  2L01 A;  3DF8 A;  1XSD A;  1JXS A;  4UV9 A;  5LGT A;  4WWC A;  1K6O A;  5HDG A;  3EET A;  3HIF A;  5DEQ A;  1FYL A;  3QU3 A;  5BS6 A;  2YU3 A;  1IN8 A;  3R6S A;  1R5H A;  2KKO A;  2VXZ A;  1I5Z A;  1T0F A;  2O6G E;  2GA2 A;  5AIP A;  3OV8 A;  2OQR A;  1S29 A;  1ODD A;  3F72 A;  5K5O A;  3Q9S A;  2P5V A;  3WU0 A;  4WXC A;  5F6F A;  1BM9 A;  2P4W A;  4XSX F;  5JVT A;  1I1G A;  2XIG A;  4WXH A;  3RKY A;  4RGS A;  3KP5 A;  5CVU A;  4RGU A;  3BJA A;  3TKY A;  5BMZ A;  1KQ0 A;  3TO9 A;  1ZGA A;  1XCB A;  2UWM A;  1FP2 A;  2EV6 A;  1F1Z A;  2A5Y B;  5ERI A;  2HZT A;  3SZP A;  3P9I A;  4HZF A;  1FX7 A;  3I53 A;  1FP1 D;  4A2U A;  1Z6T A;  1RI7 A;  5H6Q A;  3DPT A;  4RGX A;  4F7Z A;  2P7C B;  3FXR A;  4E70 A;  3FMR A;  1LEA A;  4RS8 A;  3RPQ A;  1J7K A;  4RGR A;  1CF7 A;  3QOP A;  1H9T A;  4IHT A;  3OOP A;  4OIQ F;  4YII A;  2M5W A;  2CSO A;  3CTA A;  4IJA A;  2ZFW A;  4LG0 B;  3WTY C;  5D6E A;  2ZXJ A;  3WOD F;  2HFH A;  2GAU A;  4N0B A;  5AON A;  1K7A A;  3FWE A;  1FOK A;  2K02 A;  5FFX A;  3O3K A;  4XLN F;  2JPC A;  1OYW A;  1K78 B;  1UCR A;  5LHH A;  3GX4 X;  5L3C A;  3V8K A;  2DK8 A;  5JI6 A;  5HLI A;  4LLN A;  3GFI A;  4XBF A;  4IF4 A;  1PUE E;  2PMU A;  1QNT A;  3EQL F;  4RB0 A;  4WCG A;  5LRS A;  1G3T A;  2JPB A;  2Z99 A;  2F5D A;  1J5Y A;  4KYW A;  4LGW A;  4U0V A;  2UZK A;  4QLC U;  4I7H A;  2LSO A;  1YQA A;  1O57 A;  5LGU A;  5ILU A;  1O7L A;  2RV8 A;  1J0R A;  2QQA A;  5L3F A;  1JHH A;  1RZ4 A;  2VBZ A;  1HW5 A;  4BHC A;  4WF2 A;  1Z91 A;  3EUH A;  1WI9 A;  2BV6 A;  2Y75 A;  4AD9 A;  4WXD A;  5D5W B;  4GYG A;  2FMY A;  3H3U A;  1U5T B;  2IPQ X;  3KP7 A;  2DPU A;  1HKQ A;  5DCM A;  2KJB A;  3K2Z A;  1W7P B;  2ETH A;  4XSZ F;  3KZY A;  4YG2 F;  1IUY A;  2EA4 A;  4U0W A;  3ZMT A;  2VT2 A;  5K5R A;  2ISZ A;  3I59 A;  4HAM A;  3QAH A;  2KIF A;  2HOE A;  4B8X A;  1BI1 A;  3ROU A;  2A6E F;  3NRV A;  4YFN F;  2CW0 F;  4P9F A;  3WGH A;  1R23 A;  2A07 F;  4O6J A;  1QZZ A;  1IZ1 A;  4B09 A;  1R5G A;  2OZU A;  1R36 A;  2O8X A;  3GVA A;  1HQC A;  2EFN A;  1BOA A;  2XAF A;  2A69 F;  3QRF F;  3VOD A;  2YR2 A;  2PG4 A;  5H6R A;  3MFK A;  4A6D A;  3IC7 A;  2G9W A;  4NHJ A;  1KA8 A;  4EJW A;  3BWG A;  3F6V A;  1BI0 A;  1QZY A;  2ZCW A;  5J8C A;  2MBF A;  2ESH A;  3KFW X;  4IRG A;  3ZMV A;  2RDP A;  1QQI A;  3DEU A;  3L2C A;  5DD4 A;  2ZKZ A;  5LRR A;  4EJV A;  2FML A;  4XLP F;  3GLX A;  4UVA A;  2B0L A;  3J7A O;  3WTW C;  4M6X A;  1P2F A;  1FYK A;  1BIA A;  4HA8 A;  1RUN A;  1T6S A;  4IXA A;  2L54 A;  3RIR A;  3CLO A;  4ESF A;  5ILS A;  1ZLK A;  1IN4 A;  3E5Q A;  4FHT A;  1FBQ A;  1ZAO A;  2JTV A;  2LDU A;  4RB2 C;  3IKT A;  4P9U A;  3GUD A;  4ASN A;  5BPD A;  4UHT A;  3E6D A;  2DTR A;  3QPT A;  1U78 A;  2ZNZ A;  1WKM A;  2IA2 A;  5FO5 A;  2HDC A;  1G3Y A;  4GGG A;  2PN6 A;  2FXA A;  3ABT A;  3PQJ A;  1BIB A;  1W5S A;  3R0A A;  3FXU A;  5CJ9 A;  3M7G A;  1R1V A;  1S8N A;  4G9Y A;  2PI0 A;  3I5U A;  4A12 A;  4G6D A;  4Q5S F;  2M45 A;  3GF2 A;  2AXL A;  3HTS B;  1XGS A;  3GWZ A;  4UXN A;  2YPR A;  3NQO A;  5DCF A;  3BPV A;  2HTJ A;  4Z2Y A;  3ZMD A;  4OIN F;  1T38 A;  1SMT A;  1DUX C;  3LQR A;  3KEQ A;  2OU2 A;  1K78 A;  5DUK A;  3WTS C;  3JW4 A;  4I02 A;  4ENM A;  4Q4Z F;  2PMH A;  2QM3 A;  3BRO A;  3K0L A;  1J9I A;  1RUO A;  3SXY A;  3L9F A;  3WTU C;  3V7C A;  2XAG A;  2MA3 A;  2OBP A;  4A5N A;  1Z9C A;  4HF0 A;  3GZ6 A;  1HW1 A;  4KIC A;  3FHZ A;  1XMA A;  3S2W A;  1G3W A;  1H0M A;  1R58 A;  3JTG A;  2EK5 A;  2XAS A;  3T1B A;  3WGI A;  2HTS A;  1HKT A;  3DP7 A;  1JHF A;  2VON A;  5LLQ A;  4M73 A;  1GXP A;  4UNO A;  1YFH A;  2CQK A;  3RYR A;  3CO7 C;  2BBY A;  3LA3 A;  4LD5 A;  1YO5 C;  1U5T C;  1KQ8 A;  4CO8 A;  2M8E A;  4P5O A;  2HGC A;  1OYY A;  2CG4 A;  3GZ5 A;  1SMY F;  2PQ8 A;  1HSJ A;  2V6C A;  2L4M A;  1TLH B;  3HOT A;  3VEP A;  3GEZ A;  3P9K A;  4JBA A;  5L3E A;  2XUB A;  4LB6 B;  4UVC A;  3WTV C;  2JT1 A;  4M74 A;  2PJP A;  1O3T A;  2FNA A;  3KP6 A;  2LF7 A;  3H3Z A;  3IHU A;  3ECH A;  3C7J A;  3PQK A;  4WX9 A;  1YLF A;  2V9V A;  2WC2 A;  5DDG A;  1LQ1 A;  4KFC A;  2XKP A;  1R22 A;  3CO6 C;  2O3F A;  4KT5 C;  4N9I A;  2RQP A;  3IWZ A;  1SFE A;  3FMS A;  5HS7 A;  2FF4 A;  4P55 A;  2R7D A;  2F5F A;  3Q9V A;  2QQB A;  3QU6 A;  2XRN A;  1WWX A;  5ICF A;  3H92 A;  2Z3Y A;  4HV6 A;  3ML6 A;  2RN7 A;  4HBL A;  5HLH A;  3J80 Z;  2MH2 A;  4G7H F;  3M8E A;  2CWE A;  3WGG A;  3ZP5 A;  3COA C;  4EGY A;  1GVJ A;  2A3S A;  2DQL A;  2E1C A;  3DXJ F;  1L0O C;  1TQI A;  2EFP A;  2ISY A;  1KGS A;  4PCQ A;  5K1Y A;  1YG2 A;  2NRA C;  5E8I A;  4I0A A;  4KIF A;  1IN7 A;  1P4A A;  2DO7 A;  2QZ8 A;  3JAM Z;  1E2X A;  1XGM A;  2W24 A;  1S6L A;  3JSO A;  4MTD A;  4HV5 A;  4EQQ A;  4LG0 A;  2IP2 A;  3G73 A;  2GXB A;  3ZN1 A;  5JR3 A;  3J81 K;  2QWW A;  4Q47 A;  3ZMU A;  1WQ2 A;  1HKS A;  4I01 A;  2ACJ A;  3C3W A;  2L4A A;  1IN6 A;  3FX3 A;  3TOB A;  5IT3 A;  4G6Q A;  3HTU A;  1ZLJ A;  1XD7 A;  3TOA A;  3V8L A;  4M9X A;  4KA4 A;  1O3Q A;  2LKP A;  1RIO H;  3DV8 A;  1G3S A;  1UHW A;  3O2P E;  2HWV A;  2YX4 A;  3BJ6 A;  1STZ A;  3DPL C;  1ZG3 A;  1LDK B;  4ON0 A;  3WE3 A;  5LEJ A;  5CVV A;  2GQQ A;  3RPU A;  1REP C;  1TBX A;  3BZ6 A;  5BOX A;  3E3V A;  3RYP A;  3HHG A;  3KP4 A;  4UVB A;  5D8K B;  5ICG A;  1B6A A;  5E1W A;  2ADU A;  4RAY A;  5FB2 A;  1BC7 C;  4R79 A;  3TQN A;  2EWN A;  2Z5U A;  1L3L A;  3ELK A;  2GIV A;  5ED4 A;  1LVA A;  3LAP A;  2ZNY A;  4K2E A;  3U2R A;  3EYY A;  1TTY A;  3HRU A;  1MKM A;  1CF7 B;  4LJZ F;  3RJP A;  1G4D A;  2DT5 A;  3KET A;  4OU0 A;  1P92 A;  3WTX C;  3SQN A;  2FBH A;  1MDM A;  3KCC A;  4ESB A;  2VBX A;  3GXO A;  5L3G A;  1MZB A;  1EH7 A;  4A5M A;  3KLN A;  1U8R A;  3EYI A;  1FY7 A;  5HLG A;  4LLG F;  2G7H A;  1KYW A;  5F64 A;  3WTT C;  4S04 A;  1XDU A;  2MLK A;  4BYY A;  5D5X B;  1BI3 A;  1WRJ A;  1J2X A;  1F4K A;  5J6X A;  2FU4 A;  4L5I A;  3N97 A;  5D4R A;  1T98 A;  2J5O A;  4ENK A;  1IRF A;  3LA7 A;  1ZH5 A;  4N9H A;  4WK8 F;  1X3U A;  3HRM A;  3NEU A;  2OAZ A;  3LWF A;  1I27 A;  1FSE A;  3ZN0 A;  2OA4 A;  3IRR A;  2OD5 A;  3GFJ A;  4OIO F;  2MH9 A;  3RKX A;  1J59 A;  2H27 A;  3I59 B;  3JAM K;  2RGV A;  4CGZ A;  2EFW A;  4MQ9 F;  3ABU A;  3IRQ A;  2GXG A;  2MD5 A;  2WV0 A;  2K27 A;  5AIQ A;  2IJL A;  3E6B A;  5KK1 A;  5F1R A;  4AIK A;  4U88 A;  3C1D A;  3HHH A;  5BPI A;  1LEB A;  3P7N A;  4R1H A;  4FX0 A;  1Z1D A;  1Z6R A;  1XCV A;  1PP7 U;  4FT8 A;  4HDU A;  1KQ9 A;  1S3J A;  1I1S A;  2Z33 A;  2V1D A;  4NQW A;  2RC4 A;  5E20 A;  2BYV E;  3I4P A;  1XDS A;  5EEG A;  5L3D A;  2BE5 F;  1PP8 F;  3F6O A;  5H20 A;  2H94 A;  1B4A A;  2Q2E A;  3RTR A;  3VOE A;  5LHG A;  1HBX G;  1E17 A;  2K7L A;  1OKR A;  1HST A;  3F22 A;  4M9Z A;  3AAF A;  1ON1 A;  3T0Y A;  5FD6 A;  4PZJ A;  2IW5 A;  3QP6 A;  2XV4 S;  4HQE A;  4PGG A;  4OIP F;  3KZZ A;  4A0Z A;  4IHS A;  1KU9 A;  2D1H A;  2HQN A;  2O0Y A;  2Y48 A;  3F21 A;  1LDJ A;  4ESJ A;  2X0L A;  3CDH A;  1MJ9 A;  1ULY A;  4HLX A;  1IAW A;  3K1P A;  4IRH A;  1BC8 C;  1YYV A;  1YW8 A;  1FC3 A;  2R3S A;  3RI4 A;  2RKH A;  5JHU A;  1Y0U A;  2H09 A;  2XKO A;  2IVM A;  1VTN C;  2A6H F;  3JTH A;  4GO1 A;  2XRO A;  3CJN A;  3V7R A;  4BQA A;  5ICC A;  3PFI A;  4MGR A;  3L09 A;  1FZP B;  3MZH A;  1SD6 A;  4H0E A;  5DD8 A;  4PGH A;  2K86 A;  2OQG A;  4KUM A;  5E1Z B;  5IT9 Z;  2UXX A;  1W7P A;  2D45 A;  4ZYH A;  1SD5 A;  4G7O F;  3E6C C;  4ETS A;  4YFX F;  1C0W A;  3HYI A;  3MQ0 A;  5CVJ A;  4TV7 A;  1ON2 A;  5E17 F;  4HYE A;  4IRI A;  4M6Y A;  3SZT A;  2K4J A;  3RDI A;  5ILV A;  3U1D A;  3MCZ A;  2XHK A;  5CYV A;  3FM5 A;  3ERE D;  3E6M A;  5LBQ A;  1IN5 A;  4RB1 A;  4JK1 X;  5HS8 A;  1DDN A;  3L00 A;  2RNJ A;  4LB5 A;  1ZHF A;  1USS A;  1V4R A;  3D5L A;  3HSE A;  1B1B A;  3E5U A;  3Q5F A;  2IT0 A;  3TO7 A;  1W4M A;  2XAJ A;  2XAQ A;  3VB2 A;  2KIM A;  1YIO A;  3F8F A;  3KP2 A;  3HSF A;  3FXQ A;  1FNN A;  3BJO A;  1D8K A;  2KIU A;  2KJC A;  4I0B A;  1FYM A;  2W84 A;  1RNL A;  3P9C A;  1ZRC A;  2FBK A;  2ZME A;  2LF8 A;  3IL2 A;  1U6G A;  2Q0O A;  2XGX A;  2EV5 A;  4LK1 F;  4KDP A;  3HSR A;  2CGP A;  1ZRF A;  2M87 A;  3C18 A;  1QGP A;  4L9N A;  2FNP A;  3I71 A;  2HKX A;  2K4B A;  4O3M A;  1XN7 A;  2DW4 A;  2G7U A;  4ZH4 F;  1A04 A;  4L5J A;  4DQ2 A;  3ZPL A;  3N4M A;  5KVR A;  1DPU A;  1V3F A;  5CLS A;  3F8C A;  4Y13 A;  1KU3 A;  3M1E A;  2CFX A;  4EJO A;  3WE2 A;  2A68 F;  5D5V B;  2EFO A;  4AVP A;  1QBJ A;  1YS7 A;  2ZME B;  4HF1 A;  3WG9 A;  3CUQ A;  3WU1 B;  4MHG A;  2FSW A;  4IVN A;  2P6S A;  1FT9 A;  5HS9 A;  2V79 A;  2AS5 F;  2HKO A;  2V1X A;  1BJA A;  3FZV A;  1S7O A;  1QO0 D;  4GYI A;  1G6N A;  1OYI A;  4LK0 F;  4G7Z F;  4M72 A;  3MEX A;  1BI2 A;  5A2Q K;  2JRT A;  2DK5 A;  2EA2 A;  5DCM B;  3ZMZ A;  1HW2 A;  4NB5 A;  4EVI A;  2FOK A;  3ECO A;  4YFK F;  3K1N A;  2W57 A;  1Z7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...