1SFXA

X-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
HMSNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved hypothetical protein AF2008
publication title X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01978 TrmB Sugar-specific transcriptional regulator TrmB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sfxA00
3KCCA 4OMYA 2V79A 1I1SA 1FX7A 1S3JA 1ZGAA 3K69A 2OQRA 2LSOA 1FZPB 2A5YB 3FMRA 1HW2A 1IAWA 5BPDA 3ERED 4L9JA 3MZHA 1DUXC 4S04A 5J8CA 4HLYA 4UHTA 4BYYA 4AWXB 4HOBA 4CHUA 2W84A 1U2WA 2Z33A 2KJCA 2VBXA 4Q5SF 2TDXA 4ASNA 4DNCA 1LJ9A 5LEKA 1OYIA 5BS6A 2XROA 4L0YB 5DUKA 4PGHA 3EDPA 5LHIA 4OIPF 1TQMA 2A69F 2EV6A 5LEJA 1QGPA 3QU6A 5ILUA 1J59A 3K1NA 2YU3A 3F8MA 4NB5A 2BE5F 2FQ3A 3K1PA 3CUQB 1ZRCA 2XIGA 5LBQA 2EJRA 4G9YA 3P9CA 3O6BB 1X3UA 3KZZA 3BPVA 3IL2A 4UUVA 1R5GA 1XMAA 4A5MA 1HQCA 4XSXF 4IPAA 1J9IA 5L3FA 2EFNA 5DD4A 2HDCA 3WTXC 2DO7A 2EB7A 4IXAA 3WGHA 1XD7A 4N9HA 1RNLA 3LA3A 3R0JA 2DQLA 2ZO4A 3FXRA 3FWEA 3CTAA 2OU2A 1TLHB 5H6QA 3RPQA 3NEUA 4HX7A 3WE3A 5E1XA 3QOPA 2A68F 4WX9A 1XGSA 3KFWX 3M8FA 4JQFA 2L02A 2ETHA 5HS9A 2DPDA 5CVIA 1V4RA 3K0LA 2VE8A 1YS7A 3NQOA 5AIPA 5IT9Z 1IXSB 1KQ8A 1P2FA 2FBHA 1L3LA 2A3SA 4U7BA 3TOBA 4I0BA 3TGNA 4EMSA 4G7HF 5HS7A 4FX0A 5J6XA 5JR3A 2PG4A 4ZYDA 3M7GA 2BGCA 2IA0A 2JPBA 2VOOA 5FGMA 2ZNZA 4K2EA 5EEHA 1RI7A 5K5RA 3DV8A 4KN4X 4PCQA 2CSOA 3TDZC 1FBUA 2FNPA 1OMIA 2YX4A 1XSVA 2Q2EA 1BIAA 4KNYA 2A6HF 2HKXA 4RB0A 3M9AA 2L4AA 4Y13A 2PEXA 1EH6A 2GIVA 5LRRA 2K7LA 2YR2A 2FBIA 2LDUA 3LA7A 4ENMA 5DDGA 3TQNA 4B09A 2L01A 1SMTA 1CGPA 4KN7X 5IT9K 3GO5A 4ZZDA 3F6VA 4ON0A 3GZ5A 3DP7A 1FNNA 3KLNA 4HW0A 5BMZA 2DT5A 3BWGA 1CF7B 4IRHA 2QQAA 3BJOA 4OIRF 2GA2A 1QPMA 4GO1A 4BAYA 1G3SA 2HGCA 1ZRDA 2H94A 4BHBA 4ENKA 2VBYA 1U5TC 1F1ZA 2QYOA 4ZYEA 3HRTA 4CYDA 2KRFA 2PMHA 2Y75A 4LB6B 3I59B 1JE8A 5LGTA 2EFPA 4Q48A 2YPRA 1R1UA 3BJAA 3T0YA 1P4WA 3E5QA 1IN6A 3RPUA 5FFZA 3ULQB 3B73A 4Q47A 2XAJA 2D1VA 3GXOA 3F72A 1FP1D 3FF5A 2P8TA 2CO5A 3AAFA 3VOEA 4KIGA 4I02A 3LA2A 1E17A 3ECHA 4RAZA 3I53A 1FBSA 3E6CC 4BNCA 4OU0A 5D8KB 2HZTA 1MGTA 2EK5A 3L09A 1K79A 3C1DA 4YFKF 4WK8F 5L3GA 3HSEA 2ISYA 3MZYA 2Y0MA 5CVRA 2DLLA 1HBXG 3BY6A 4HQMA 5ERIA 3T1BA 4G6DA 1QQIA 2P5VA 2ZJ2A 3CUQA 4L9VA 4BXUA 4WCGA 4CXFA 4R1HA 3LWFA 2QQBA 2OZUA 1BI2A 5DV5A 3WU0A 5CJ9A 5ILSA 2PLYA 2JZYA 4LB5A 3RKXA 2Z9OA 2GQQA 3HTSB 2HFHA 2G7HA 2RN7A 3K2ZA 3BDDA 2D45A 4H0EA 2FOKA 2ESHA 4OIOF 4UV9A 3G73A 2X4HA 4KT5C 4UVBA 5FD6A 1W5TA 2CYYA 3MQ0A 4XSZF 3DF8A 2QM3A 1T6SA 2XAHA 3FX3A 3CO6C 2COMA 5ED4A 3EETA 2R7FA 3E6DA 4ZYGA 1TQPA 3ABTA 5CLSA 3FM3A 4CDGA 1ZGJA 2NNYA 3EQLF 1S8NA 1B9MA 4AVPA 2NNNA 2RDPA 2IA1A 3J80Z 4IF4A 1QZYA 2ACJA 2FMLA 1FY7A 4RAYA 2GXBA 4KYWA 1UFMA 2DW4A 1RZ4A 3FHZA 1U5TB 3SQNA 4A0ZA 3FZVA 2LF8A 1HSTA 5E18F 5TJJA 2UZKA 2FBKA 1B59A 2XKOA 1XGOA 3RKWA 2H6BA 1LNWA 2K02A 3DPLC 2P7VB 2HKOA 2VODA 3V7CA 3P9KA 3VB2A 1P4AA 3FXQA 2P4WA 1XSXA 3S2WA 2IP2A 3IHUA 3MWMA 3I4PA 1TTYA 3COAC 1BC8C 3SZPA 1BN5A 4UVCA 2KJBA 3N97A 1BM9A 1FYLA 3BJ6A 1UCRA 3J80K 1CF7A 3GF2A 3KP6A 5DD8A 4M74A 5CVJA 5L3BA 3B02A 1YS6A 3FXUA 1TNTA 2DK5A 3R4KA 4ETSA 4L9TA 2E1CA 2EFWA 4WXDA 4JK1X 2XV4S 3VFZA 3I59A 3TO6A 4OMZA 1D8JA 1UHWA 3R6SA 2FEZA 3V7RA 1PDNC 1G3WA 2JPCA 4LG0B 3BOQA 4IHTA 2E7WA 4U0VA 1XSDA 2P5LC 2QBYB 5HS8A 2B0LA 1W7PB 1PP8F 3J7AO 2F5CA 4B8XA 3IRRA 4EJWA 2NYXA 1LVAA 5D5UB 1WWXA 2WTEA 3HSFA 2O0YA 3V8KA 2PMUA 3PFIA 1I27A 3V8LA 2YX7A 1BI0A 2PN6A 4EM2A 2NS0A 3WU1B 2XVCA 2D2WA 4A6EA 2XAQA 1YIOA 4L5IA 2GAUA 1R1VA 1K7AA 1W5SA 3WG9A 4HQEA 2DU9A 4EJOA 2V6CA 5IT3A 3T8TA 1QNTA 1LDJA 4RGRA 1L0OC 4Y15A 3MFKA 1JXSA 1D3YA 5D4SA 1C0WA 2UXNA 5FLXZ 4AIKA 2RNJA 2F5DA 1ZARA 4YFNF 3MCZA 2XHKA 3ZN0A 2VC0A 2IPQX 2O03A 3W6JB 1R36A 3M8EA 2HTJA 3F23A 3KP2A 3ZMTA 3RI4A 3RKYA 4HA8A 1XGNA 3RJPA 1DP7P 1G6NA 3C18A 1XCVA 1Z6RA 3EYIA 3L00A 5ICEA 5D5XB 1U6GA 5F64A 4HDUA 3QPHA 3ROUA 1FP2A 4RB1A 3BZ6A 1R22A 3E6BA 2M1BA 4EM1A 2BBYA 1O3RA 4FX4A 2EWNA 1YW8A 4HV6A 2MH9A 4CZZA 4A5NA 3L2CA 4EJTA 3QRFF 1AWCA 1SAXA 1XN7A 2Q8KA 4CGZA 2O3FA 4L5JA 1LDKB 1IN4A 1O3QA 2M5WA 1YQAA 2CW0F 1DPRA 2O6GE 3TOAA 2K4JA 1ON2A 4LJZF 5FLXK 5HDKA 1ULYA 1IXCA 2E7XA 1Z05A 3GW2A 2EFQA 3M1EA 5FD5A 1MJ9A 4NQWA 1FT9A 3DPTA 1D5VA 2HYFA 1SD5A 1U5TA 4MNUA 4GYIA 2FA5A 1KU3A 2M87A 4ZH4F 1I6XA 4S05A 2LKPA 3TO9A 1QZZA 1QO0D 4HAMA 1GHCA 1O3TA 2MLGA 2K27A 1UB9A 3GWZA 1LEAA 1IN5A 1FWZA 1HKQA 2O8XA 3HIFA 3JTGA 3ZQ7A 2UWMA 3ABUA 4M9ZA 2P7CB 3GEZA 4WF2A 5H20A 4RB2C 4AD9A 3U2RA 3F21A 2K86A 1JGSA 3TKYA 1P92A 4RGUA 2OAZA 1U8RA 1R7JA 2NAZA 3FM5A 3LAPA 4MEYF 6PAXA 1ZG5A 3KE2A 3HUGA 1H9TA 1S29A 3ECOA 4O3MA 1MKMA 1E2XA 3H3UA 5E1ZB 1YW7A 4HZFA 3CLOA 4EM0B 2ADUA 1IN8A 2DFIA 2QQ9A 4HV5A 4FHTA 4MQ9F 2RQPA 3HHGA 4JBAA 2IA2A 3D5LA 2GA1A 5ILVA 3ZMSA 1ONVA 2XRNA 4CO8A 1R5HA 3WE2A 1LDDA 1JHHA 3QU3A 5A2QK 2HOEA 3Q5FA 5LHHA 4BH9A 4TV7A 2G9WA 5DCMA 2W85A 1ZYRF 2ZKZA 4HBLA 4Q4ZF 1HXDA 2IVMA 4LG0A 2FNAA 5DUIA 3JTHA 3RDIA 1J5YA 2JRTA 3BP8A 3OOPA 2Z99A 1IN7A 2RKHA 3BROA 3F8BA 2QBYA 3EYYA 1W7PA 2WC2A 4MHGA 2QWWA 3PQJA 1DPUA 1PUEE 3RYPA 1YYVA 2VE9A 3FMSA 4A12A 4PZJA 5FFXA 4KDPA 4D0PA 2MD5A 1XDUA 4BQAA 1SFXA 2EFOA 1ZH5A 3KP5A 3RYRA 3QP5A 4HYEA 1KQ0A 3KEOA 2A6EF 1Z1DA 5L3DA 5HOOA 4XRFA 4L0ZB 2OD5A 1T2KA 2OQGA 2MH2A 5LRSA 3ZP5A 2FU4A 1UHMA 4ESBA 1S7AA 3P9IA 3IWFA 4KA4A 1J7KA 5JI6A 2HWVA 2XAGA 4HF1A 3K9TA 1K6OA 2DAOA 3GLXA 3KP3A 3PQKA 3L7WA 1ZHFA 4UVAA 1HSJA 5KK1A 1TW2A 1D8KA 1RUOA 2F2EA 1B6AA 1YW9A 2QLZA 2ZBKA 1ON1A 1WRJA 2ELHA 4U7DA 2P6TA 1BC7C 4G7ZF 3NRVA 1B4AA 3HSRA 2ZXJA 2P6SA 2V9VA 2KIUA 4HX8A 3K1MA 2H09A 4ENNA 3D0SA 4P9FA 4ENJA 1HW5A 5FO5A 3RTRA 1XB4A 5E1WA 1XCBA 1NHAA 3GX4X 3SFZA 1H0MA 2VN2A 1OYWA 3H92A 3E3VA 3GUDA 2W24A 3TO7A 3U1DA 3ML6A 2STWA 4YG2F 2AS5F 1Z91A 4P5OA 1BIBA 4O5VA 5CVUA 3HRUA 5D4RA 2FF4A 5D6FA 2X0LA 4LFUA 5K5OA 2VT3A 2BEOA 2HQNA 3E97A 2QZ8A 4RGXA 1SFUA 4M6XA 2HQRA 1XDSA 2RV8A 5CVVA 2VXZA 2J5OA 4N0BA 5BOXA 4OINF 3JSOA 1O3SA 3E5XA 2UXXA 4F7ZA 3KP7A 1IZ1A 1MJAA 2JT1A 1ZAOA 4R79A 2DTRA 1F9NA 3HRSA 1WQ2A 4ZZLA 1SD7A 1ZRFA 3LQQA 4M9XA 3GZ6A 2HTSA 3R0AA 4ESJA 3J81Z 1V3FA 1S6LA 3F8FA 4ESFA 1OR7A 1O57A 1T39A 4HDVA 2Q0OA 2GXGA 4XLNF 1STZA 4M71A 3F8CA 4G6QA 3W6KB 3GVAA 4WXCA 1OKRA 2BV6A 2RGVA 2IW5A 1BI1A 3WTZA 3F8NA 2DI3A 4LLGF 2BYVE 4PDKA 2H27A 4M9SA 4U0WA 2HR3A 4UV8A 5HDGA 4EGYA 5TRDA 2C6YA 1VTNC 3O3KA 5DCMB 1PP7U 4KICA 2FRHA 1EH8A 1U3EM 3BPXA 4IJAA 1XMKA 3CO7C 1FSHA 3DXJF 3WTVC 2JTVA 2ZMEA 2JSCA 5L3EA 1HKSA 1YG2A 2PI0A 1XGMA 4CICA 4GGGA 3J81K 1BI3A 1O7FA 4M72A 3ZMDA 1F5TA 5ICGA 1FSEA 5LLQA 3Q9SA 2MC3A 3MEXA 2XAFA 4P9UA 1ODDA 1KU7A 2ESNA 1FBQA 3WTTC 2R3SA 2FE3A 4I0AA 4A6DA 2Z5UA 2XKPA 4GYGA 1OYYA 1USTA 4HF0A 4G7OF 5LHGA 5EEGA 3IKVA 1F4KA 1KYZA 1ZG3A 3T8RA 5E17F 2EV5A 2XUBA 4RGSA 4QWQA 3DQVC 2V1UA 4YIIA 4KMFA 4GCVA 5D6EA 4LK0F 4LK1F 5CYVA 4EJUA 2ZFWA 4UXNA 5F6FA 4AIHA 4L18B 2GWRA 3ELKA 4MTEA 1O7LA 1Q1HA 1KQ9A 1J2XA 4L9NA 1T0FA 1R58A 2G7UA 3JSPA 5E8IA 3WTWC 1B1BA 3CDHA 2H6CA 1Z7UA 1S7OA 2VBZA 3R60A 2QVOA 4I09A 4ZYHA 3DEUA 1ZREA 5HLIA 3I71A 4WXHA 4OIQF 3CJNA 3KZYA 4HLXA 1B9NA 1U78A 4YIFA 3WGIA 5F1RA 2M30A 3ZMUA 1MJBA 1SFEA 4IHSA 1YTYA 5LGNA 1GXQA 4KUMA 2DK8A 4P55A 1K78A 1TQIA 3LFKA 2R7DA 4FT8A 2ZCWA 3C7JA 4LD5A 2QENA 4I2OA 4MQVA 2LF7A 3GYHX 5KVRA 5AONA 1H9GA 3GFJA 4P96A 2E1NA 2VC1A 5A2QZ 4KFCA 1IRFA 5D5VB 2M8EA 2STTA 3O2PE 5J8FA 1YFHA 2VBWA 4MEXF 3HYIA 2ISZA 2A61A 2MA3A 2VONA 2CFXA 3F6OA 1RUNA 5BPIA 4GXOA 3HRMA 4WWCA 1ZN2A 3Q9VA 3QAHA 3LAJA 1TNSA 1REPC 3REOA 2W57A 1MDMA 5ICCA 2CG4A 3ZMZA 4EV0A 5D8LB 3F3XA 2K4BA 1LQ1A 1G3TA 4LLLA 3CUOA 1W7PD 1HW1A 2VT2A 2IT0A 4UNOA 2F5EA 3T5XA 2F5FA 4KIFA 2J5PA 2OZ6A 4RB3C 1YLFA 2IRFG 5JFRA 4Z2YA 4LLNA 4HX4A 1ZG1A 2IJLA 2PBIA 1P4XA 2D1HA 2HYGD 3GFMA 2ZNYA 3L9FA 1TW3A 2KIMA 5K1YA 1USSA 2Y48A 1G4DA 2PJPA 1JHFA 1OPCA 4XBFA 1DDNA 1R23A 2DBBA 4EVIA 4QLCU 2ZMEB 3VEPA 4DQ2A 4YFXF 4MTDA 2RVCA 4LGWA 4MGRA 3V7SA 4M73A 2FMYA 5HLHA 2AXLA 1SMYF 5E20A 5HDNA 3GFLA 4IVNA 4M6YA 2A07F 3EUHA 1ZLJA 1QBJA 4IRGA 1MD0A 2CGPA 5DEQA 1G3YA 1T38A 3SHFA 2V1XA 4G8XA 1Z6TA 3C3WA 1BJAA 3E6MA 3DKWA 3GFIA 3V4GA 3ZPLA 5DYMA 4EQQA 1T98A 2L3DA 2FSWA 3SZTA 1HKTA 4AIJA 2M45A 1LEBA 4KMUX 3IC7A 4I01A 2WWYA 1Z9CA 1I1GA 4N9IA 5LGUA 2EA2A 2DQRA 2Z3YA 5E8GA 4A2UA 2MLKA 1KA8A 3WGGA 1BBYA 3IKTA 1KU9A 4I98B 2NRAC 2L54A 1FOKA 1YO5C 2XASA 4E70A 3QP6A 4O6JA 4EGZA 1IW7F 2OA4A 3LSTA 1FPQA 1KGSA 3SXYA 2DPUA 3JAMZ 3I58A 1ZLKA 4G94A 5HVQC 1WSUA 1TBXA 3JW4A 4R8HA 1GXPA 2KKOA 1R00A 2RC4A 3HOSA 3P7NA 3IWZA 4IRIA 5ICFA 2YSRA 4KIBA 3VODA 4NHJA 3KP4A 2EV0A 3ZMVA 5FB2A 4OOIA 3ISPA 5AIQA 5L3CA 1K78B 3G3ZA 2LNBA 5K5QA 4A0XA 3WTSC 4Y17A 1MZBA 4RS8A 3ZN1A 1FLIA 3WODF 5BQTA 1GVJA 3IRQA 3QPTA 3CUQC 3DFGA 2PFBA 3LQRA 4BHCA 1IF1A 2GZWA 3OV8A 1FYMA 1W4MA 1RIOH 5H6RA 1SD6A 2L4MA 2HEOA 3HOTA 2PQ8A 3HHHA 3WTYC 1WI9A 1Y0UA 4HF2A 2O61A 1IXRC 1I5ZA 3E5UA 3U9GA 3JAMK 1KU2A 4EJVA 5JVTA 3MAJA 4XLPF 3I54A 3I5UA 3R61A 4I7HA 3N4MA 3V8JA 2HS5A 3H3ZA 1J75A 1J0RA 2W25A 2CQKA 1SD4A 2MBFA 3KLOA 1R1TA 4U0YA 3FMQA 5D5WB 3HTUA 1KYWA 1FYKA 3I64A 1MDMB 2FXAA 3I0TA 2XGXA 3TDUC 2EA4A 1A04A 2WV0A 5HLGA 1IUYA 2OBPA 1LB2A 1EH7A 4A0YA 4LMYA 4BHPA 1AOYA 1EV7A 2V1DA 3KEQA 4U88A 2CWEA 3F22A 1FC3A 3RIRA 3WTUC 2VOPA 2QUFA 1P6RA 2KIFA 4PGGA 1IRGA 5JHUA 2P5KA 3KETA 1WKMA 1BOAA 5DCFA
chains in the Genus database with same CATH superfamily
2E34A 3KCCA 4OMYA 1SFKA 2R92J 2DMUA 2V79A 1I1SA 1FX7A 1E3OC 1RESA 1S3JA 4IEJA 4BDYA 1ZGAA 2KPMA 2E5NA 3K69A 2CJJA 2WADA 3ZQIA 2OQRA 3BTIA 5EG0A 2B9SA 1BL0A 2DA4A 2YU9J 2LSOA 3DEEA 1FZPB 2A5YB 3FMRA 1HW2A 2V4JC 5BPDA 1IAWA 1ETKA 1GUUA 2WAQA 3ERMA 3ERED 4L9JA 3MZHA 1DUXC 2JA5J 2KLOA 3GBGA 4S04A 5J8CA 2TRTA 2WAFA 2F6CA 1T08B 4HLYA 4UHTA 2R7ZJ 4BYYA 4AWXB 2N8GA 5J4VA 1NH3A 4HOBA 4CHUA 2MGQA 2W84A 3ZQFA 1U2WA 1N25A 3OSFA 1RPWA 2BXYA 3CCSI 2Z33A 2KJCA 2E1MB 2VBXA 4X0GA 4Q5SF 2TDXA 2YS9A 2PMZA 4ASNA 4DNCA 4XLCA 2QKMB 2L7KA 1LJ9A 3PUBA 5LEKA 2FOWA 4BU2A 2DFEA 2VQCA 3ABKH 4MO7A 1OYIA 3M4OJ 5BS6A 2XROA 3QWLA 4L0YB 5DUKA 4PGHA 2ICWG 4XLEA 3EDPA 4C3JJ 5LHIA 4OIPF 5IYCJ 1TQMA 3JRBA 2A69F 2EV6A 4HPQA 3OS2A 3OS0A 5LEJA 1QGPA 3QU6A 2LREA 3PNTA 2V9KA 5ILUA 5GP9A 5FJ8J 3K1NA 1FIAA 1J59A 2YU3A 3F8MA 4NB5A 4ZDOA 4PJMA 2X6XA 2BE5F 2FQ3A 3K1PA 3CUQB 5F0FA 3BR6A 1ZRCA 2XIGA 1F43A 5LBQA 1WHUA 4FTHA 1JTXA 2EJRA 2L9NA 4G9YA 3P9CA 3O6BB 1X3UA 3KZZA 2VPLA 1U0JA 3BPVA 4JYKA 3IL2A 4UUVA 1R5GA 2BY0A 1OJLA 5M5YJ 4RM2A 4YIRX 1XMAA 3ZRGA 1ETOA 2VXDA 4A5MA 1HQCA 4XSXF 4XONA 4IPAA 1J9IA 4Y52J 2KZVA 5TISC 4J01A 5L3FA 2EFNA 5DD4A 3PIPF 2HDCA 3WTXC 3UNGC 1VFCA 2DO7A 2EB7A 1W0UA 1D1AA 3CJQB 4IXAA 4W1UA 5EZHA 3WGHA 1XD7A 5GTHC 4N9HA 1U8BA 1RNLA 3LA3A 2IS4A 4UY8I 2GBYA 3BT9A 3R0JA 2DQLA 3WU2C 2ZO4A 3FXRA 2EQRA 1TZLA 1WJDA 3EPZA 3FWEA 3CTAA 3OYNA 3BG6A 2OU2A 1TLHB 5H6QA 3RPQA 3H9QA 1LVKA 3NEUA 4HX7A 3WE3A 1H89C 5E1XA 4BQOA 1ZQ3P 3QOPA 3S2HJ 2A68F 5DTDA 1OCCH 3FXJA 3LMMA 5GPAA 4WX9A 2Y9ZA 2X85A 1XGSA 3KFWX 3M8FA 4JQFA 2L02A 2ETHA 3H36A 5HS9A 2DPDA 2E60A 4HEA2 1MMAA 1HDDC 3BG7A 5CVIA 1V4RA 2I5UA 2VE8A 3BC8A 3K0LA 3ASOH 3WHCA 2XAUA 4Y3OA 1YS7A 2LTPA 3NQOA 4NUBA 5AIPA 1QA6A 5IT9Z 1IXSB 4FETA 4OAYA 1KQ8A 1P2FA 1I3QJ 1RKTA 2FBHA 2K3FA 3OR2C 3BG5A 2A3SA 1L3LA 4IKFA 5TGTA 3CMAI 4U7BA 1K83J 3TOBA 4I0BA 3CCMI 3I3LA 1MIJA 3JREA 3TGNA 4EMSA 3JRHA 4MFDA 3S3OA 4G7HF 5HS7A 4FX0A 4BJTA 2IGMA 5J6XA 5JR3A 2PG4A 4ZYDA 4GFBA 2DJIA 2OCCH 3M7GA 1VQ4I 1QPIA 2BGCA 2IA0A 2JPBA 1IV6A 2VOOA 1VZ0A 2DA6A 3HC7A 5FGMA 1FMVA 2ZNZA 4CCLA 4K2EA 5EEHA 1RI7A 5K5RA 1ZK8A 2ZJRF 3U1KA 5KAFC 1X1AA 3DV8A 4KN4X 4PCQA 2CSOA 4BEHA 4BACA 3TDZC 3IH4A 1FBUA 2FNPA 1OMIA 3K2AA 2YX4A 2JK3A 2OC6A 1XSVA 2Q2EA 2EZIA 4D7MA 1BIAA 2K9SA 4KNYA 3RQIA 2A6HF 1BOBA 4E7KA 2HKXA 4H4KC 1XMXA 3HOYJ 2DFFA 3M9AA 2L4AA 4RB0A 5J1UA 1SFOJ 4IOCF 4Y13A 2PEXA 1EH6A 2MD0A 2LKXA 1WJEA 2QQ8A 2GIVA 4BUPA 3HGGA 5LRRA 2K7LA 5EJCA 1AKHB 2NXNB 2LH9A 1AHDP 4PSXA 1DU0A 2LYCA 5FKNA 4YRVA 2YR2A 1XTAA 1BR1A 2DMTA 2FBIA 2LDUA 3LA7A 3GTJJ 2R5YB 4ENMA 2JUCA 4LIVA 5DDGA 1R6RA 3TQNA 4B09A 2L01A 3OS1A 1SMTA 1CGPA 2Z2SB 4KN7X 3SDGA 3VYUB 5IT9K 2GM4A 3GO5A 5CPRB 4ZZDA 5JLXA 3F6VA 4ON0A 2Y31A 3DP7A 1FNNA 3GZ5A 2HQ5A 3KLNA 4HW0A 3GTOJ 3F0CA 5BMZA 1YJWI 2DT5A 4RM3A 1JT6A 3BWGA 2KMUA 1CF7B 4IRHA 2QQAA 3I55I 2H8RA 2CRGA 2XGCA 2XF6A 3BJOA 1B8IA 4OIRF 3S16J 2W48A 2JUGA 3H9JA 2CQXA 2GA2A 1QPMA 2DOEA 4DGWB 4GO1A 1UJ8A 4BAYA 1G3SA 3ZQGA 3C2GA 3ZGKA 2M0MA 2HGCA 1ZRDA 2H94A 1A36A 4BHBA 4ENKA 2VBYA 4IHYA 4BE1A 1U5TC 1F1ZA 4PJJA 2QYOA 4ZYEA 2Y30A 3HRTA 2MYSA 4CYDA 2VKHA 3RQ4A 2KRFA 2PMHA 2HPIA 2Y75A 4LB6B 2EZLA 3G71I 3I59B 2JA6J 1JE8A 5LGTA 2EFPA 4Q48A 3QODA 2YPRA 1R1UA 3BJAA 3T0YA 5EG0B 1P4WA 4AC0A 3E5QA 1IN6A 3PO3J 2X1EA 3RPUA 5F04A 1BR2A 5FFZA 3ULQB 3FHNA 3B73A 2HNHA 3P5JA 4Q47A 1JT0A 2M7AA 4MIMA 3PNVA 2XAJA 1PJRA 4DW6A 2R4GA 2D1VA 3GXOA 4PSWA 3FK7A 2VPRA 2BY2A 3F72A 4A3EJ 1FP1D 5J47A 3A0BC 1IDZA 3DCFA 3FF5A 1ETYA 1LFBA 3MZ8A 2P8TA 2LRDA 3F9KA 2CO5A 3AAFA 2WY7Q 3SZGA 4M3FA 3VOEA 3OYAA 4KIGA 5EEAA 4I02A 3LA2A 3KYDB 1E17A 4B48A 2GOMA 3ECHA 4M6VA 3A01B 4RAZA 3I53A 1FBSA 3E6CC 4BNCA 1HDPA 1Z21A 3NARA 3QYFA 4OU0A 5D8KB 2F5VA 2HZTA 1MBHA 1MGTA 2CFOA 1DP3A 2EK5A 3L09A 4KITB 5IOYA 1K79A 3C1DA 4YFKF 4WK8F 5L3GA 2LG4A 3HSEA 2ISYA 1VQ6I 3MZYA 2Y0MA 2NVTJ 5CVRA 5IOZA 1MBKA 2DLLA 5C44J 3BY6A 2ID6A 3KZIC 4HQMA 5ERIA 1YJ9I 1HBXG 3MVPA 3GTPJ 4V19K 2HDWA 3T1BA 4G6DA 1QQIA 4ABZA 4UB6C 1CQTA 3BTCA 2P5VA 1VQ8I 4IHXA 2ZJ2A 3CUQA 4L9VA 4PJLA 3SEZA 4BXUA 3H0DA 1LPQA 4WCGA 1GV2A 2TCTA 4CXFA 4R1HA 1JGGA 3LWFA 2QQBA 1JKQC 2OZUA 1BI2A 5DV5A 3WU0A 5CJ9A 5ILSA 2PLYA 4BDZA 2JZYA 4LB5A 4XLFA 4C3HJ 4W97A 3SJMA 3RKXA 2Z9OA 2GQQA 4BQQA 2HFHA 2OCEA 3HTSB 2H8WA 2G7HA 2RN7A 3K2ZA 3BDDA 4XRSA 2D45A 4H0EA 4C2TA 3CESA 4X1EA 1ZELA 4II3A 2FOKA 2ESHA 4DYQA 4OIOF 2K9LA 1WJ5A 1X1BA 1V55H 2CUFA 4UV9A 4D7NA 1JI8A 3G73A 2RREA 1MW7A 2K85A 2X4HA 3L2UA 3DBHB 4KT5C 1MH3A 3NWTA 1VQ9I 4UVBA 2VQLA 5FD6A 1YJNI 1W5TA 2VJ4A 2CYYA 3MQ0A 4XSZF 3DF8A 4OAZA 2E1MC 4AVZA 2QM3A 3BR5A 1T6SA 2XAHA 4A3DJ 3CQZJ 1SAUA 2RAEA 3FX3A 3CO6C 3M07A 1MH4A 2COMA 2DYSH 5ED4A 4IZZA 1VQ7I 2R7FA 3EETA 2W7NA 4XN0A 3E6DA 3SDBA 4ZYGA 2CU7A 1WJBA 1TQPA 1OFCX 1IC8A 3CZ6A 3Q0VA 3ABTA 3CC7I 3ZOBA 3OYKA 1IG7A 5CLSA 3FM3A 2EIJH 3AG4H 4CDGA 1ZGJA 3GTQJ 2NNYA 1QVTA 1QZEA 3EQLF 5FLVA 1S8NA 5DM6F 3BR0A 1B9MA 5IP9J 4AVPA 3GTMJ 2NNNA 2RDPA 4I99C 4ANJA 2IA1A 3LSPA 3J80Z 4IF4A 4A3MJ 4XR6A 1NG7A 1E3PA 1QZYA 2ACJA 2CW7A 2FMLA 2NOJB 4A3KJ 4BBSJ 3K4LA 2V26A 1FY7A 3FXOA 4RAYA 4NQWB 1TL8A 2GXBA 4RLFA 4KYWA 1UFMA 2DW4A 1RZ4A 3PSIA 1W36D 3FHZA 1U5TB 4JX4A 3SQNA 4A0ZA 3FZVA 2LF8A 1HSTA 5E18F 5TJJA 2UZKA 3AG2H 1ZGWA 3HXLA 3EUKL 3D1NI 3IH2A 2GOXB 4M3DA 2FBKA 1B59A 2ELKA 2KRCA 2XKOA 1XGOA 3RKWA 2JQ7A 2ZXWH 3DU5A 2H6BA 2IS1A 3HB9A 1LNWA 2K02A 3DPLC 2P7VB 2HKOA 4XOPA 2VODA 3V7CA 4CA0A 2AO9A 3P9KA 3VB2A 4PFOA 2ELJA 1P4AA 3FXQA 2P4WA 1SVLA 1XSXA 4RA2A 3S2WA 2IP2A 3IHUA 2LOOA 3A03A 3CCJI 3MWMA 4XLHA 3I4PA 1WH5A 3DBLB 2OF7A 3PFYA 1TTYA 4B44A 4F55A 2X51A 3COAC 1W1WE 3SZPA 3OYLA 4F93B 2R5YA 1BC8C 3LSHA 1BN5A 2K3PA 4PJNA 1APLC 4UVCA 2KJBA 1F36A 3N97A 1BM9A 3D5SC 2DMQA 3OIOA 1FYLA 4BBRJ 2JA2A 2IGKA 4E7HA 3BJ6A 4M3GA 1UCRA 4NC7A 3J80K 4X6AJ 4A3BJ 1CF7A 3FK6A 2L9RA 1VQMI 3S1NJ 3D5RC 3GF2A 3KP6A 4Y4RA 3AKZA 1FOYA 5DD8A 4M74A 4KISA 4JP0A 5FRNA 2E5ZA 5GTIC 5CVJA 5L3BA 3B02A 1YS6A 1MNEA 3FXUA 1TNTA 3HM5A 2DK5A 3R4KA 1YX5A 4ETSA 2O8KA 2BW3B 4L9TA 2E1CA 3OR1C 2HQAA 2EFWA 1I3AA 2PX9A 3CCEI 4WXDA 3BR2A 4JK1X 4J00A 2HVSA 4QSHA 1VQOI 2XV4S 3VFZA 3I59A 3TO6A 4OMZA 1D8JA 1UHWA 5F1JA 2LC2A 2DFHA 3CMEI 3R6SA 2FEZA 3GTLJ 2NVYJ 3V7RA 1ETQA 2CUJA 4RAGA 1YI2I 2BZTA 2WAQN 4DZJA 1PDNC 1G3WA 2JPCA 1UAAA 1V5FA 3JRDA 4LG0B 3BOQA 2B63J 4IHTA 3DEWA 3A0HC 2E7WA 4CYCB 4U0VA 3ABLH 1WJAA 1IO2A 3I9V2 2KRHA 1XSDA 3FXLA 2P5LC 2QBYB 2A5WA 2DT6A 3S14J 3AFHA 5HS8A 2B0LA 2BVMA 5JHFA 1W7PB 2WV1A 1GDTA 1TP4A 1PP8F 3J7AO 2F5CA 3M1CA 1ETWA 1ZTRA 2PMZN 4B8XA 3IRRA 3K6GA 4NDLA 4EJWA 3A01A 3WG7H 2NYXA 4UUTA 2E1OA 2QA4I 1YOVB 2CH0A 3J7AY 1LVAA 5D5UB 1WWXA 2WTEA 1OR7C 3HSFA 1MBEA 2O0YA 3KIOA 5HNHA 3V8KA 2PMUA 3VWBA 3PFIA 2AHQA 1I27A 3K4BA 4IQ4A 3CC4I 5IYBJ 3V8LA 2YX7A 1BI0A 2K9MA 1JTYA 1WI3A 2PN6A 1QU3A 3OIQA 1WPKA 2NS0A 4JOMA 4EM2A 4CCKA 3WU1B 2XVCA 1R5ID 2D2WA 2XAQA 1YIOA 3G1LA 4A6EA 2JJ7A 2GAUA 4L5IA 1R1VA 1K7AA 3S8PA 1W5SA 3WG9A 4HQEA 1VQLI 2DU9A 3IH3A 4EJOA 3CLQA 3OYGA 2V6CA 2X48A 5IT3A 3T8TA 1QNTA 1LDJA 3K4NA 4RGRA 1L0OC 4Y15A 3MFKA 1JXSA 1D3YA 3W3CA 5D4SA 1C0WA 5B5EC 2OTLI 2UXNA 3DBRB 3C2BA 1X1DA 5FLXZ 3QYEA 4AIKA 2RNJA 3K4CA 2F5DA 2QCOA 1ZARA 1UG2A 4YFNF 4XLAA 3MCZA 3QOEA 2XHKA 3K10A 3I4NJ 4XKCA 4DYRA 3ZN0A 2VC0A 1JKRC 2IPQX 2O03A 3W6JB 4ZJZA 1R36A 4HNVA 1IGNA 3M8EA 3AG3H 4B1RA 2HTJA 2DA7A 3F23A 2WBMA 4HNUA 4FASD 3KP2A 3MMYB 3ZMTA 4D5CA 3RI4A 3RKYA 4HA8A 3OOUA 1XGNA 3RJPA 1HA8A 3Q0WA 1DP7P 2OJED 1G6NA 3C18A 1XCVA 1Z6RA 2IS6A 4IHWA 3EYIA 1X19A 3L00A 5ICEA 4GRIA 2V9PA 2LY2A 5D5XB 1MNDA 1U6GA 5F64A 4HDUA 3QPHA 4A69C 2HPMA 3ROUA 1FP2A 4RB1A 3BZ6A 2L9VA 1R22A 3E6BA 2M1BA 4E4HA 4EM1A 1BJZA 3OYCA 2R5ZB 2BBYA 2OTJI 1O3RA 3MKLA 3VSLA 4FX4A 5FKOA 2EWNA 1YW8A 4A93J 3ZCOA 3QPSA 4HV6A 2P0WA 4DYCA 2MH9A 2XB5A 4CZZA 4A5NA 3GLLA 3L2CA 4EJTA 2XPWA 3QRFF 2JA8J 1AWCA 1WGXA 3PJRA 3CP8A 2E2IJ 5C4XJ 2NS7A 1SAXA 2DDAA 4DZPA 5F08A 1XN7A 2Q8KA 4CGZA 5E3MA 2O3FA 2VL8A 4L5JA 1LDKB 1IN4A 1O3QA 2CV2A 2M5WA 3H9GA 4XMYA 3S93A 1YQAA 2DA5A 2CW0F 5F27A 1DPRA 2O7OA 3L2VA 2EZHA 1T95A 4HSRA 1FOXA 2O6GE 3MN2A 1IRZA 3TOAA 1V5GA 1AU7A 2K4JA 1OCTC 1ON2A 2VQGA 4LJZF 5FLXK 3FBIB 2LBFB 5HDKA 3FBNB 1ULYA 4MLOA 1IXCA 2E7XA 1Z05A 2HVQA 3GW2A 4GDFA 3S15J 5E3LA 3G6EI 2EFQA 3M1EA 5FD5A 1R49A 1MJ9A 4NQWA 1R71A 1FT9A 3DPTA 1D5VA 2HYFA 1SD5A 4QPQA 3LSMA 1U5TA 3CJRB 4MNUA 4GYIA 2K40A 3M3YJ 2FA5A 1KU3A 3UKGA 2M87A 2HYJA 1RRJA 4ZH4F 3W6VA 3GMEA 1I6XA 3OMYA 3RKQA 4S05A 2QKLB 2LKPA 2ZC2A 3TO9A 1X2NA 1QZZA 2CS3A 2EPFA 1QO0D 4HAMA 1VI0A 3HOVJ 4ZTJA 1O3TA 1GHCA 2MLGA 3K70C 2K27A 1T0FC 1H88C 1Y56A 1U9OA 1UB9A 3GWZA 1LEAA 1IN5A 1MMDA 2AXTC 1FWZA 1HKQA 2E2HJ 2O8XA 1A35A 2VKEA 4LOCA 3HIFA 3JTGA 3ZQ7A 2UWMA 3AG1H 3VYSB 3DLLF 2V1NA 3RCOA 3ABUA 1ETXA 4M9ZA 2HOAA 2P7CB 3GEZA 4WF2A 5H20A 2KIQA 4AU7A 3HJEA 4U87A 4RB2C 2L2OA 4AD9A 2VJIA 2LP0A 3U2RA 2K86A 2LK2A 3F21A 1JGSA 2ZSHB 3TKYA 1P92A 4RGUA 2CQQA 2OAZA 3W2AA 2R7XA 3RPUD 1U8RA 1R7JA 2NAZA 3FM5A 3LAPA 2ZXIA 2KL4A 4MEYF 6PAXA 1ZG5A 4QPOA 3KE2A 3HUGA 1XG1A 1H9TA 2HXIA 3DTKA 1S29A 3ECOA 4O3MA 1MKMA 2CW8A 3DWLE 5EGOB 1UG0A 1E2XA 3H3UA 5E1ZB 1YW7A 3ZQLA 1TWGJ 4YEJA 1J09A 4HZFA 2YUSA 3CLOA 4EM0B 2CUEA 2ADUA 4DOZA 3ZXSA 2ID3A 5EZGA 2V6EA 2K5CA 1IN8A 2DFIA 3GZNB 2QQ9A 1A31A 4HV5A 4JX5A 2DA2A 4FHTA 1RKWA 1WJCA 4MQ9F 4FCYA 3FKIJ 2RQPA 3HHGA 5C3EJ 4A3CJ 4JBAA 3D5LA 2IA2A 4F52A 2GA1A 5ILVA 2DJNA 3ZMSA 1WCMJ 1ONVA 2XRNA 5FKKA 4CO8A 3BQZA 4E6KG 2R7TA 1S9HA 2F4OB 2CV1A 2BW3A 3SFIA 3BZKA 1YHQI 1R5HA 3OYBA 3WE2A 1X1CA 4QTRA 2IEKA 4MFEA 1LDDA 1JHHA 3QU3A 5A2QK 3MKYB 2HOEA 2HDDA 3Q5FA 1X3ZB 5LHHA 4BH9A 2JRMA 3CJTB 3W2VA 4TV7A 3J7YJ 2M4KA 1T56A 2G9WA 2KDZA 5DCMA 2W85A 1ZYRF 2ZKZA 4XKWA 4RDUA 4HBLA 4Q4ZF 1HXDA 3IAM2 2IVMA 4LG0A 9ANTA 3BR3A 2FNAA 2CMPA 2Y2ZA 4EATA 5DUIA 4XK4A 4CYCA 3JTHA 1RR8C 2JVGA 1J5YA 2JRTA 3BP8A 3ONQA 3RDIA 4CCJA 3OOPA 4S0HB 1FMWA 2Z99A 4BQNA 2GXAA 1XPXA 1NG6A 1IN7A 1PUFB 2RKHA 3BROA 3F8BA 3TP3A 3L2WA 2QBYA 2M2EA 2R7OA 4XRSG 3EYYA 3S3MA 1W7PA 2WC2A 4MHGA 3H1CA 2QWWA 3PQJA 4J19A 1DPUA 1O4XA 5B1BH 1PUEE 1Z0XA 3LFUA 3RYPA 1YYVA 2VE9A 3MKWB 2DOAA 2JA7J 3OYJA 4N4NB 2JN6A 3FMSA 3BTLA 4A12A 1WJFA 4PZJA 5FFXA 5BNGA 4KDPA 4FE7A 2ECCA 4D0PA 2MD5A 1XDUA 4BS9A 1EJ9A 3Q3SA 4BQAA 4AYBA 2M4GA 3PL8A 4L5EA 1SFXA 2EFOA 2MABA 4PJ0C 3W2WA 1ZH5A 1LE8B 2R7SA 3OL3A 2XGDA 4ZTFA 3KP5A 1K4TA 4NBQA 4LG3A 3RYRA 3HOZJ 1VQKI 3QP5A 1D1CA 3TP0A 4HYEA 1KQ0A 3KEOA 2A6EF 2E35A 4C30A 5EF6A 1Z1DA 3TW7A 1PYVA 5L3DA 5HOOA 4XRFA 4L0ZB 2OD5A 1UELB 1T2KA 2OQGA 4IHVA 2MH2A 1YE9A 5H2FC 5LRSA 3ZP5A 2CUZA 1SEUA 2FU4A 1UHMA 4ESBA 2VLAA 2NVUB 1S7AA 3LNQA 3P9IA 3IWFA 4DBQA 4KA4A 1UHSA 1J7KA 5JI6A 3TW6A 2HWVA 2XAGA 4HF1A 5GADJ 2XPUA 5IYDJ 3K9TA 1K6OA 3FXMA 2KT0A 3HKZA 4G12A 1OCRH 2L7FP 3HG9A 3PIOF 2WB1A 2L7MP 2DAOA 3GLXA 3KP3A 3PQKA 3L7WA 1ZHFA 4UVAA 1HSJA 5KK1A 1TW2A 1D0XA 1D8KA 4XRMA 2ZJQF 1G2HA 1RUOA 5E3OA 2F2EA 1B6AA 1YW9A 4RBOA 5J4YA 2R5ZA 2QLZA 4RLQA 2XGEA 3HOWJ 2ZBKA 5K7FA 1ON1A 1Z3YA 3HEFA 1WRJA 2ELHA 2DA3A 4U7DA 4NNJA 1YX3A 2P6TA 1BC7C 4CUGA 1X3WB 3BTJA 4G7ZF 4XL9A 2XPVA 3NRVA 1GLNA 3EUHC 2M7BA 4C2MJ 1XC5A 2QF7A 1VQ5I 1B4AA 1T8IA 3HSRA 2ZXJA 3TL4X 1S72I 1IDYA 2P6SA 2V9VA 2KIUA 1MSEC 1LFUP 4HX8A 3K1MA 2H09A 3G1OA 4ENNA 3D0SA 4BJ5C 5E3NA 4P9FA 4ENJA 1HW5A 3I56I 5FO5A 3RTRA 1XB4A 2L7ZA 3RSNA 5E1WA 1Y8RB 1XCBA 1LKXA 1R4MB 1NHAA 3GX4X 2FD5A 4B4CA 3SFZA 1H0MA 2VN2A 1OYWA 4XKVA 2LBFA 2KP6A 2LKSA 3VYTB 4ZDPA 3H92A 3JCUC 3E3VA 3GUDA 4BKXA 2W24A 3TO7A 3U1DA 4FISA 4FE4A 4BGDA 3ML6A 2STWA 4YG2F 2AS5F 1Z91A 4P5OA 1BIBA 2MSYA 4O5VA 5CVUA 3HRUA 4EEFG 4HG2A 5D4RA 2FF4A 1G8XA 5D6FA 2X0LA 4LFUA 1TWHJ 5K5OA 3TMOA 2VT3A 5CKTA 1QHHD 2BEOA 2HQNA 2NVXJ 3S1MJ 3E97A 2QZ8A 4RGXA 3HBLA 1SFUA 3ASNH 4M6XA 2HQRA 4Z6YA 1XDSA 4P1WA 2RV8A 5CVVA 2VXZA 2J5OA 4N0BA 4IOAF 1NK2P 1IV8A 5BOXA 5K7HA 3B6CA 4OINF 3VDXA 3JSOA 1O3SA 4JX6A 4ZDLA 3E5XA 2ZB9A 2UXXA 4F7ZA 2CV0A 3KP7A 2QEXI 1IZ1A 2KZGA 2R7UA 2AQFA 2FUG2 2ZSIB 1MJAA 2JT1A 1ZAOA 4R79A 1FIPA 1X4PA 1Y1WJ 3HPHA 1ITYA 2DTRA 1F9NA 2L0KA 4XN3A 2R0QC 1EF4A 3HRSA 4DIQA 1WQ2A 4ZZLA 2IGNA 1SD7A 1ZRFA 3LQQA 1E3HA 5J1YA 4A3LJ 4M9XA 4BJ6C 4AM3A 5FROA 3K4JA 3GZ6A 2HTSA 3R0AA 4ESJA 3BR1A 3G2BA 3HUGB 3J81Z 3LSRA 1LUJB 1V3FA 4RAFA 5EGOA 1P7JA 1WVRA 1S6LA 3F8FA 5KHDA 4XM3A 4ESFA 1OR7A 1O57A 3KYCB 2WY8Q 1T39A 2IGOA 4HDVA 1HC8A 2Q0OA 1OCOH 2GXGA 4XLNF 1STZA 4M71A 2I10A 2L5QA 3F8CA 3CMMA 4A3IJ 4G6QA 1JUPA 3SEQA 3W6KB 2V7FA 3GVAA 3OSGA 2MG4A 2L9SA 2IS2A 4WXCA 1OKRA 2BV6A 2RGVA 1Y8QB 2NVQJ 2IW5A 1BI1A 2LMDA 3DPUA 4B3AA 3OYEA 2VJJA 1Z3XA 1JKPC 3WTZA 3E7LA 3F8NA 2DI3A 4LLGF 1N77A 2BYVE 3HDDA 3MKZA 3OWTA 4PDKA 3HOXJ 2H27A 2RQQA 2DT7B 2COBA 4M9SA 4U0WA 2HR3A 1BA5A 2W82A 4UV8A 5HDGA 4XQFA 3DU6A 2BVLA 4V2GA 2Y0SA 4EGYA 1TWCJ 2E36A 5TRDA 1B72B 2C6YA 2BOLA 1ZKGA 2X6YA 2LY9A 1QRYA 1PVEA 1OISA 1D5YA 2A05A 1VTNC 1IRXA 3L1PA 2R7RA 3O3KA 5DCMB 3ZQQA 1PP7U 4KICA 2F4MB 2FRHA 1EH8A 4XOTA 1U3EM 3BPXA 4IJAA 1XMKA 3CO7C 4B47A 1FSHA 3DXJF 3WTVC 3CD6I 2JTVA 2W00A 2ZMEA 2HI3A 1RC9A 2JSCA 5L3EA 3Q0UA 1HKSA 1FEXA 1YG2A 1PUFA 2PI0A 1XGMA 2KQRA 5FKLA 3DLAA 4XNFA 3O8HA 4CCNA 1MBFA 4CICA 4LITA 4ITVA 4GGGA 3J81K 4M3EA 1EA3A 2VASA 4CSWA 2ECBA 4HNTA 1BI3A 1O7FA 4M72A 1YRNB 3ZMDA 2JMWA 1F5TA 5F0HA 5ICGA 1FSEA 3L2RA 5LLQA 2E19A 3Q9SA 1HF0A 1Y6IA 3K4MA 3S1RJ 2MC3A 3MEXA 2HOTA 2XAFA 4P9UA 1ODDA 1YIJI 1KU7A 2QSHX 1D0ZA 3K70D 2ESNA 1TT5B 1FBQA 2X1DA 3ESWB 3WTTC 3ZQCA 3S3NA 5C4JJ 2R3SA 2FE3A 3PM1A 4I0AA 4A6DA 1WZ2A 2Z5UA 2XKPA 1LE8A 4PFPA 2X1CA 1OYYA 3CDLA 4GYGA 1USTA 3CCYA 4HF0A 1NK3P 4G7OF 5LHGA 2DTZA 3DKXA 3E1SA 5EEGA 1W36C 2HOSA 4A3GJ 3H35A 3OYHA 3JRCA 5LFAA 2VB6A 1ORKA 3IKVA 1F4KA 1KYZA 1M1EB 1ZG3A 2XDVA 3BQYA 2VUMJ 3T8RA 5E17F 2EV5A 3C2HA 1ACIA 3CCUI 2XUBA 4RGSA 2IAIA 3QYBA 4QWQA 4ZYAA 3DQVC 4E7LA 4YIIA 2V1UA 4GCVA 5CQEA 5D6EA 4KMFA 2FX0A 4LK0F 4LK1F 5CYVA 4LIUA 4EJUA 2LR8A 2MC4A 2DA1A 2ZFWA 4UXNA 5F6FA 4AIDA 1ZR4A 4N4OB 3DTIA 5GAEJ 5IY5H 2DDBA 3CMYA 1K4SA 1JJ8C 4AIHA 2OUMA 1G59A 3MD2A 3S2DJ 3IAS2 4L18B 2GWRA 3ELKA 4MTEA 1I50J 3BZCA 1O7LA 1XX5A 2ZMEC 1Q1HA 2HZDA 2Z16A 1KQ9A 3H5AA 4BY1J 2P81A 1J2XA 4L9NA 1T0FA 1MSFC 1JJ6C 2M34A 2Y9YA 1R58A 2G7UA 3JSPA 5E8IA 3WTWC 4PUSA 2NS8A 1B1BA 1MMNA 3CDHA 3TBIA 3L2QA 2H6CA 1Z7UA 1S7OA 2HXOA 2VBZA 4C9YA 3R60A 2QVOA 2QSFX 4I09A 4ZYHA 1H8AC 3DEUA 3UR3C 1ZREA 3ZR8X 5HLIA 3I71A 4WXHA 3HGYA 2M0CA 4OIQF 4BXXJ 4BE0A 2LVSA 4C2UA 4I76A 3CP2A 4Y7NJ 1DGRM 3CJNA 3KZYA 1Z67A 2R7WA 4IQJA 4HLXA 3CCQI 1B9NA 2W4SA 4YIFA 1XS9A 1U78A 2GIZA 3CCVI 3WGIA 5F1RA 3S1QJ 4HSTA 2PJRA 2DXIA 2KDOA 1VQPI 4F92B 2M30A 5KAIC 1MJBA 1SFEA 3ZMUA 4D9JA 4IHSA 1YTYA 1DQUA 5FKMA 5LGNA 1GXQA 3BCBA 3X2QH 5J1RA 4KUMA 5IP6A 2DK8A 4P55A 1K78A 2VQHA 1Z77A 1TQIA 3LFKA 2R7DA 3CCLI 4II2A 2DODA 2X6OA 4FT8A 2ZCWA 2ZJPF 1Z7LA 2FQ4A 1UZCA 4XKBA 2VKDA 4UUSB 3C7JA 4LD5A 5E79C 2QENA 4I2OA 4MQVA 2LF7A 3CF2A 3A4CA 3IP4B 3GYHX 2EINH 5KVRA 5AONA 1H9GA 3GFJA 4P96A 2E1NA 2VC1A 5A2QZ 1U9NA 3S17J 4KFCA 1IJWC 1FOWA 1IRFA 5D5VB 3KYLA 3OIPA 2BXZA 1AA7A 2EZKA 1TWFJ 3BLYA 5M5WJ 2M8EA 3A1YA 4E7JA 2STTA 3KEYA 3O2PE 5J8FA 1YFHA 1S5LC 2VBWA 4ZC3A 2HVRA 2KISA 4MEXF 1K6YA 3HYIA 5EYRA 4B43A 2ISZA 3JRIA 3RZOJ 2A61A 2MA3A 2VONA 2DMNA 2CFXA 2CQ7A 3F6OA 5B3SH 5M3FJ 1RUNA 2B7EA 3U21A 5BPIA 2RNGA 5J40A 4GXOA 3DTEA 3HRMA 4WWCA 2K9QA 1GV5A 2XF7A 2EBIA 3LSJA 2UUZA 1ZN2A 3Q9VA 3QAHA 3LAJA 2F48A 4BXFA 3OYIA 2K9NA 1TNSA 2IXSA 3PUFA 4G6TB 1W0TA 1REPC 2KFDA 3REOA 2W57A 1MDMA 1K61A 1I39A 3H5NA 5ICCA 4CZCA 3HZJA 1LFPA 1Q1VA 2CG4A 3EUAA 3ZMZA 4EV0A 5D8LB 2QSGX 3E0JB 2MW8A 3F3XA 2K4BA 1LQ1A 2DYRH 1G3TA 1DGWY 3FDYA 4LLLA 1FJLA 3CUOA 1N75A 3ZQHA 1W7PD 1HW1A 2VT2A 2IT0A 2M3AA 1RR7A 5B66C 3AL0C 4UNOA 2LY1A 2F5EA 4RMNA 3T5XA 2F5FA 2UV1A 4KIFA 2J5PA 2JVHA 2OZ6A 2HU9A 4RB3C 5JVGF 2R93J 1YLFA 2KHMA 1A6IA 3PNYA 1R4NB 2IRFG 5JFRA 5B1AH 3VYRB 1B72A 4Z2YA 4LLNA 2AQEA 4HX4A 4BE2A 1ZG1A 2LLKA 3K4KA 2IJLA 2PBIA 1X2MA 2EIMH 1P4XA 1A6QA 2D1HA 2HYGD 3GFMA 2ZNYA 2MFZA 3L9FA 3N05A 1TW3A 2KIMA 5K1YA 1USSA 2NOGA 5HODA 2Y48A 1G4DA 1OCZH 2W1OA 1POGA 2PJPA 1JHFA 3M8JA 1OPCA 2D5VA 3GTGJ 4IL6C 3G4SI 1QHGA 4XBFA 1DDNA 1NTCA 1I6HJ 4FQGA 3O8GA 1R23A 2DBBA 4EVIA 4QLCU 2ZMEB 4CCMA 3OYDA 3I4MJ 3PSFA 3VEPA 4DQ2A 1X1PA 2EIKH 4YFXF 4MTDA 2RVCA 3FIWA 4LGWA 4MGRA 2DCEA 1D0YA 3V7SA 4IO9F 4M73A 2FMYA 5HLHA 2AXLA 4NC6A 3G1MA 1SMYF 4XORA 4A3FJ 2XSDC 1YRNA 4KT6A 5E20A 3H0GJ 5HDNA 3GFLA 4IVNA 4M6YA 3KPHA 4YELA 2A07F 2LFBA 3EUHA 1MMGA 1ZLJA 4DJAA 5JLWA 1QBJA 5GPCA 1VF9A 3FXKA 1MNMC 3BCAA 4IRGA 1MD0A 3WHBA 3OY9A 3QQAA 2BY3A 2CGPA 5DEQA 4AYBN 1SVOA 4F91B 4PK4A 4A3JJ 2H1KA 3CC2I 1V54H 1G3YA 2E2JJ 1FTZA 3JRAA 5KCMA 1T38A 2VKVA 3SHFA 2V1XA 3A02A 4G8XA 1Z6TA 3C3WA 1BJAA 3SYTA 4I6ZA 1X4OA 3E6MA 4Y33A 2BHYA 1SANA 3FISA 3DKWA 2XC7A 1X58A 5EDNA 4F3QA 3GFIA 3V4GA 3ZPLA 1SC7A 3TEDA 5DYMA 1P9QC 4EQQA 1T98A 2OPTA 3BG3A 2L3DA 2FSWA 3SZTA 1V5EA 2FJ1A 1HKTA 4AIJA 2IBDA 2M45A 2ZXHA 4OWRB 1LEBA 3VPRA 4KMUX 1N78A 1IUFA 1TWAJ 3IC7A 5HLTA 4I01A 2WWYA 1Z9CA 1I1GA 4N9IA 5LGUA 1ERDA 2EA2A 4CH7A 4NC8A 4D1QA 1YITI 2DQRA 2Z3YA 5E8GA 4A2UA 2MLKA 1KA8A 1OCPA 3PO2J 3LSGA 3LOCA 1JUMA 3WGGA 1BBYA 3IKTA 3HKZN 2WB1N 1KU9A 4I98B 2NRAC 3BG9A 2DOFA 2L54A 3KX2A 1FOKA 1YO5C 4XIDA 2XASA 1ETVA 4E70A 3QP6A 4HRIA 3DKYA 4O6JA 4EGZA 1DU6A 1IW7F 2OA4A 3LSTA 1FPQA 2G0EA 2Y69H 1KGSA 1QVUA 2X9DA 3S32A 1P7IA 1WFXA 3SXYA 2DPUA 3FKJA 3JAMZ 4E7ZA 3I58A 1ZLKA 3OL4A 4G94A 2EILH 5HVQC 2ZFUA 1WSUA 2O9LA 1TBXA 3JRGA 3JW4A 1GVDA 4R8HA 1GXPA 3CF5F 2KKOA 1R00A 1Y1VJ 2RC4A 3B6AA 3V42A 2BHZA 1MBJA 3H5RA 4D5FA 3H3VK 3HPGA 2XSJC 5KNLA 3LSIA 5F0CA 4KJZA 3HOSA 3P7NA 1OLTA 3IWZA 4B3XA 3J7ZI 4IRIA 2PJRB 2ME0A 5ICFA 2YSRA 2X6WA 4KIBA 3GTKJ 2JWTA 3VODA 4NHJA 4AUXA 1WH7A 4C3IJ 3K7AJ 3KP4A 1D1BA 2EV0A 3ZMVA 5FB2A 5DM7F 3QPLA 4OOIA 3ISPA 3LL7A 4QIWN 5AIQA 1MBGA 5L3CA 1K78B 2R7VA 3G3ZA 2LNBA 1TT0A 2F4IA 5FRMA 1VQNI 5K5QA 3AL0B 3NAUA 4A0XA 3WTSC 4CCOA 4Y17A 2Z1DA 1MZBA 1A5JA 4RS8A 3ZN1A 3GCMA 3IV5A 1BW5A 1FLIA 5J3LA 3WODF 5BQTA 5DS9A 4UUSA 1GVJA 3IRQA 3A2KA 3QPTA 5M3MJ 3CUQC 5IP7J 3DFGA 2PFBA 5K7ZA 3LQRA 1S7EA 3CCRI 4BHCA 1ZR2A 2O5RA 2XB0X 1IF1A 5M5XJ 2GZWA 2WA0A 2VI6A 3OV8A 1FYMA 1W4MA 1RIOH 5IPAA 2JSPA 5H6RA 1SD6A 2L4MA 2HEOA 1T33A 2PQ8A 3HOTA 2Q1ZB 3HHHA 1ENHA 2I8DA 2DMPA 3WTYC 1OQYA 1WI9A 1Y0UA 5GAGJ 1GT0C 4HF2A 2O61A 3RZDJ 1IXRC 1Y39A 1I5ZA 3E5UA 3U9GA 3JR9A 3JAMK 4BEHB 4V2FA 1KU2A 4EJVA 5JVTA 2EH3A 5LD2C 3MAJA 1E0EA 4XLPF 4DBRA 1HLVA 3I54A 3I5UA 3R61A 4I7HA 3N4MA 1Y0NA 3V8JA 2ME6A 2HS5A 2Q2EB 2BY1A 3H3ZA 3OYFA 1J75A 1J0RA 3ABMH 2XF5A 2W25A 4BL0B 1BW6A 1JKOC 2CQKA 1SD4A 2MBFA 1VNDA 3NWSA 3KLOA 3HOUJ 1R9TJ 3HL2A 1R1TA 4U0YA 3FMQA 4E7IA 1FTTA 5D5WB 3HTUA 1KYWA 4IX7A 1FYKA 1RETA 3I64A 3JRFA 1MDMB 1AKHA 1HCRA 4UB8C 2FXAA 3I0TA 2A6TA 5FLMJ 3OYMA 2XGXA 3TDUC 2EA4A 1A04A 2WV0A 3LSKA 5HLGA 1IUYA 2OBPA 4E7SA 5CQGA 1LB2A 1EH7A 4M3BA 2LD5A 4A0YA 4BY7J 3IUOA 1W5CC 3CDIA 2M8GX 1TC3C 4LMYA 4BHPA 1AOYA 1EV7A 2QGUA 1KZHA 2M9HA 2E71A 2V1DA 1UMQA 2R7QA 3KEQA 4U88A 2CQNA 1SVMA 2CWEA 3F22A 1B8IB 1FC3A 1EKEA 2OV7A 2VIXA 2H1LA 3RIRA 5HNFA 4XICA 2Y0SN 3WTUC 3VSKA 2VOPA 2QUFA 5GAHJ 2VJ5A 1BR4A 2WAEA 1KONA 1P6RA 2KIFA 2GLOA 4PGGA 1IRGA 5JHUA 2P5KA 2XRLA 3KETA 1JUSA 2DN0A 1HOMA 1WKMA 1BOAA 5DCFA 1MMSA
chains in the Genus database with same CATH topology
3KCCA 4OMYA 2V79A 1I1SA 1FX7A 1S3JA 1ZGAA 3K69A 2OQRA 2LSOA 1FZPB 2A5YB 3FMRA 1HW2A 1IAWA 5BPDA 3ERED 4L9JA 3MZHA 1DUXC 4S04A 5J8CA 4HLYA 4UHTA 4BYYA 4AWXB 4HOBA 4CHUA 2W84A 1U2WA 2Z33A 2KJCA 2VBXA 4Q5SF 2TDXA 4ASNA 4DNCA 1LJ9A 5LEKA 1OYIA 5BS6A 2XROA 4L0YB 5DUKA 4PGHA 3EDPA 5LHIA 4OIPF 1TQMA 2A69F 2EV6A 5LEJA 1QGPA 3QU6A 5ILUA 1J59A 3K1NA 2YU3A 3F8MA 4NB5A 2BE5F 2FQ3A 3K1PA 3CUQB 1ZRCA 2XIGA 5LBQA 2EJRA 4G9YA 3P9CA 3O6BB 1X3UA 3KZZA 3BPVA 3IL2A 4UUVA 1R5GA 1XMAA 4A5MA 1HQCA 4XSXF 4IPAA 1J9IA 5L3FA 2EFNA 5DD4A 2HDCA 3WTXC 2DO7A 2EB7A 4IXAA 3WGHA 1XD7A 4N9HA 1RNLA 3LA3A 3R0JA 2DQLA 2ZO4A 3FXRA 3FWEA 3CTAA 2OU2A 1TLHB 5H6QA 3RPQA 3NEUA 4HX7A 3WE3A 5E1XA 3QOPA 2A68F 4WX9A 1XGSA 3KFWX 3M8FA 4JQFA 2L02A 2ETHA 5HS9A 2DPDA 5CVIA 1V4RA 3K0LA 2VE8A 1YS7A 3NQOA 5AIPA 5IT9Z 1IXSB 1KQ8A 1P2FA 2FBHA 1L3LA 2A3SA 4U7BA 3TOBA 4I0BA 3TGNA 4EMSA 4G7HF 5HS7A 4FX0A 5J6XA 5JR3A 2PG4A 4ZYDA 3M7GA 2BGCA 2IA0A 2JPBA 2VOOA 5FGMA 2ZNZA 4K2EA 5EEHA 1RI7A 5K5RA 3DV8A 4KN4X 4PCQA 2CSOA 3TDZC 1FBUA 2FNPA 1OMIA 2YX4A 1XSVA 2Q2EA 1BIAA 4KNYA 2A6HF 2HKXA 4RB0A 3M9AA 2L4AA 4Y13A 2PEXA 1EH6A 2GIVA 5LRRA 2K7LA 2YR2A 2FBIA 2LDUA 3LA7A 4ENMA 5DDGA 3TQNA 4B09A 2L01A 1SMTA 1CGPA 4KN7X 5IT9K 3GO5A 4ZZDA 3F6VA 4ON0A 3GZ5A 3DP7A 1FNNA 3KLNA 4HW0A 5BMZA 2DT5A 3BWGA 1CF7B 4IRHA 2QQAA 3BJOA 4OIRF 2GA2A 1QPMA 4GO1A 4BAYA 1G3SA 2HGCA 1ZRDA 2H94A 4BHBA 4ENKA 2VBYA 1U5TC 1F1ZA 2QYOA 4ZYEA 3HRTA 4CYDA 2KRFA 2PMHA 2Y75A 4LB6B 3I59B 1JE8A 5LGTA 2EFPA 4Q48A 2YPRA 1R1UA 3BJAA 3T0YA 1P4WA 3E5QA 1IN6A 3RPUA 5FFZA 3ULQB 3B73A 4Q47A 2XAJA 2D1VA 3GXOA 3F72A 1FP1D 3FF5A 2P8TA 2CO5A 3AAFA 3VOEA 4KIGA 4I02A 3LA2A 1E17A 3ECHA 4RAZA 3I53A 1FBSA 3E6CC 4BNCA 4OU0A 5D8KB 2HZTA 1MGTA 2EK5A 3L09A 1K79A 3C1DA 4YFKF 4WK8F 5L3GA 3HSEA 2ISYA 3MZYA 2Y0MA 5CVRA 2DLLA 1HBXG 3BY6A 4HQMA 5ERIA 3T1BA 4G6DA 1QQIA 2P5VA 2ZJ2A 3CUQA 4L9VA 4BXUA 4WCGA 4CXFA 4R1HA 3LWFA 2QQBA 2OZUA 1BI2A 5DV5A 3WU0A 5CJ9A 5ILSA 2PLYA 2JZYA 4LB5A 3RKXA 2Z9OA 2GQQA 3HTSB 2HFHA 2G7HA 2RN7A 3K2ZA 3BDDA 2D45A 4H0EA 2FOKA 2ESHA 4OIOF 4UV9A 3G73A 2X4HA 4KT5C 4UVBA 5FD6A 1W5TA 2CYYA 3MQ0A 4XSZF 3DF8A 2QM3A 1T6SA 2XAHA 3FX3A 3CO6C 2COMA 5ED4A 3EETA 2R7FA 3E6DA 4ZYGA 1TQPA 3ABTA 5CLSA 3FM3A 4CDGA 1ZGJA 2NNYA 3EQLF 1S8NA 1B9MA 4AVPA 2NNNA 2RDPA 2IA1A 3J80Z 4IF4A 1QZYA 2ACJA 2FMLA 1FY7A 4RAYA 2GXBA 4KYWA 1UFMA 2DW4A 1RZ4A 3FHZA 1U5TB 3SQNA 4A0ZA 3FZVA 2LF8A 1HSTA 5E18F 5TJJA 2UZKA 2FBKA 1B59A 2XKOA 1XGOA 3RKWA 2H6BA 1LNWA 2K02A 3DPLC 2P7VB 2HKOA 2VODA 3V7CA 3P9KA 3VB2A 1P4AA 3FXQA 2P4WA 1XSXA 3S2WA 2IP2A 3IHUA 3MWMA 3I4PA 1TTYA 3COAC 1BC8C 3SZPA 1BN5A 4UVCA 2KJBA 3N97A 1BM9A 1FYLA 3BJ6A 1UCRA 3J80K 1CF7A 3GF2A 3KP6A 5DD8A 4M74A 5CVJA 5L3BA 3B02A 1YS6A 3FXUA 1TNTA 2DK5A 3R4KA 4ETSA 4L9TA 2E1CA 2EFWA 4WXDA 4JK1X 2XV4S 3VFZA 3I59A 3TO6A 4OMZA 1D8JA 1UHWA 3R6SA 2FEZA 3V7RA 1PDNC 1G3WA 2JPCA 4LG0B 3BOQA 4IHTA 2E7WA 4U0VA 1XSDA 2P5LC 2QBYB 5HS8A 2B0LA 1W7PB 1PP8F 3J7AO 2F5CA 4B8XA 3IRRA 4EJWA 2NYXA 1LVAA 5D5UB 1WWXA 2WTEA 3HSFA 2O0YA 3V8KA 2PMUA 3PFIA 1I27A 3V8LA 2YX7A 1BI0A 2PN6A 4EM2A 2NS0A 3WU1B 2XVCA 2D2WA 4A6EA 2XAQA 1YIOA 4L5IA 2GAUA 1R1VA 1K7AA 1W5SA 3WG9A 4HQEA 2DU9A 4EJOA 2V6CA 5IT3A 3T8TA 1QNTA 1LDJA 4RGRA 1L0OC 4Y15A 3MFKA 1JXSA 1D3YA 5D4SA 1C0WA 2UXNA 5FLXZ 4AIKA 2RNJA 2F5DA 1ZARA 4YFNF 3MCZA 2XHKA 3ZN0A 2VC0A 2IPQX 2O03A 3W6JB 1R36A 3M8EA 2HTJA 3F23A 3KP2A 3ZMTA 3RI4A 3RKYA 4HA8A 1XGNA 3RJPA 1DP7P 1G6NA 3C18A 1XCVA 1Z6RA 3EYIA 3L00A 5ICEA 5D5XB 1U6GA 5F64A 4HDUA 3QPHA 3ROUA 1FP2A 4RB1A 3BZ6A 1R22A 3E6BA 2M1BA 4EM1A 2BBYA 1O3RA 4FX4A 2EWNA 1YW8A 4HV6A 2MH9A 4CZZA 4A5NA 3L2CA 4EJTA 3QRFF 1AWCA 1SAXA 1XN7A 2Q8KA 4CGZA 2O3FA 4L5JA 1LDKB 1IN4A 1O3QA 2M5WA 1YQAA 2CW0F 1DPRA 2O6GE 3TOAA 2K4JA 1ON2A 4LJZF 5FLXK 5HDKA 1ULYA 1IXCA 2E7XA 1Z05A 3GW2A 2EFQA 3M1EA 5FD5A 1MJ9A 4NQWA 1FT9A 3DPTA 1D5VA 2HYFA 1SD5A 1U5TA 4MNUA 4GYIA 2FA5A 1KU3A 2M87A 4ZH4F 1I6XA 4S05A 2LKPA 3TO9A 1QZZA 1QO0D 4HAMA 1GHCA 1O3TA 2MLGA 2K27A 1UB9A 3GWZA 1LEAA 1IN5A 1FWZA 1HKQA 2O8XA 3HIFA 3JTGA 3ZQ7A 2UWMA 3ABUA 4M9ZA 2P7CB 3GEZA 4WF2A 5H20A 4RB2C 4AD9A 3U2RA 3F21A 2K86A 1JGSA 3TKYA 1P92A 4RGUA 2OAZA 1U8RA 1R7JA 2NAZA 3FM5A 3LAPA 4MEYF 6PAXA 1ZG5A 3KE2A 3HUGA 1H9TA 1S29A 3ECOA 4O3MA 1MKMA 1E2XA 3H3UA 5E1ZB 1YW7A 4HZFA 3CLOA 4EM0B 2ADUA 1IN8A 2DFIA 2QQ9A 4HV5A 4FHTA 4MQ9F 2RQPA 3HHGA 4JBAA 2IA2A 3D5LA 2GA1A 5ILVA 3ZMSA 1ONVA 2XRNA 4CO8A 1R5HA 3WE2A 1LDDA 1JHHA 3QU3A 5A2QK 2HOEA 3Q5FA 5LHHA 4BH9A 4TV7A 2G9WA 5DCMA 2W85A 1ZYRF 2ZKZA 4HBLA 4Q4ZF 1HXDA 2IVMA 4LG0A 2FNAA 5DUIA 3JTHA 3RDIA 1J5YA 2JRTA 3BP8A 3OOPA 2Z99A 1IN7A 2RKHA 3BROA 3F8BA 2QBYA 3EYYA 1W7PA 2WC2A 4MHGA 2QWWA 3PQJA 1DPUA 1PUEE 3RYPA 1YYVA 2VE9A 3FMSA 4A12A 4PZJA 5FFXA 4KDPA 4D0PA 2MD5A 1XDUA 4BQAA 1SFXA 2EFOA 1ZH5A 3KP5A 3RYRA 3QP5A 4HYEA 1KQ0A 3KEOA 2A6EF 1Z1DA 5L3DA 5HOOA 4XRFA 4L0ZB 2OD5A 1T2KA 2OQGA 2MH2A 5LRSA 3ZP5A 2FU4A 1UHMA 4ESBA 1S7AA 3P9IA 3IWFA 4KA4A 1J7KA 5JI6A 2HWVA 2XAGA 4HF1A 3K9TA 1K6OA 2DAOA 3GLXA 3KP3A 3PQKA 3L7WA 1ZHFA 4UVAA 1HSJA 5KK1A 1TW2A 1D8KA 1RUOA 2F2EA 1B6AA 1YW9A 2QLZA 2ZBKA 1ON1A 1WRJA 2ELHA 4U7DA 2P6TA 1BC7C 4G7ZF 3NRVA 1B4AA 3HSRA 2ZXJA 2P6SA 2V9VA 2KIUA 4HX8A 3K1MA 2H09A 4ENNA 3D0SA 4P9FA 4ENJA 1HW5A 5FO5A 3RTRA 1XB4A 5E1WA 1XCBA 1NHAA 3GX4X 3SFZA 1H0MA 2VN2A 1OYWA 3H92A 3E3VA 3GUDA 2W24A 3TO7A 3U1DA 3ML6A 2STWA 4YG2F 2AS5F 1Z91A 4P5OA 1BIBA 4O5VA 5CVUA 3HRUA 5D4RA 2FF4A 5D6FA 2X0LA 4LFUA 5K5OA 2VT3A 2BEOA 2HQNA 3E97A 2QZ8A 4RGXA 1SFUA 4M6XA 2HQRA 1XDSA 2RV8A 5CVVA 2VXZA 2J5OA 4N0BA 5BOXA 4OINF 3JSOA 1O3SA 3E5XA 2UXXA 4F7ZA 3KP7A 1IZ1A 1MJAA 2JT1A 1ZAOA 4R79A 2DTRA 1F9NA 3HRSA 1WQ2A 4ZZLA 1SD7A 1ZRFA 3LQQA 4M9XA 3GZ6A 2HTSA 3R0AA 4ESJA 3J81Z 1V3FA 1S6LA 3F8FA 4ESFA 1OR7A 1O57A 1T39A 4HDVA 2Q0OA 2GXGA 4XLNF 1STZA 4M71A 3F8CA 4G6QA 3W6KB 3GVAA 4WXCA 1OKRA 2BV6A 2RGVA 2IW5A 1BI1A 3WTZA 3F8NA 2DI3A 4LLGF 2BYVE 4PDKA 2H27A 4M9SA 4U0WA 2HR3A 4UV8A 5HDGA 4EGYA 5TRDA 2C6YA 1VTNC 3O3KA 5DCMB 1PP7U 4KICA 2FRHA 1EH8A 1U3EM 3BPXA 4IJAA 1XMKA 3CO7C 1FSHA 3DXJF 3WTVC 2JTVA 2ZMEA 2JSCA 5L3EA 1HKSA 1YG2A 2PI0A 1XGMA 4CICA 4GGGA 3J81K 1BI3A 1O7FA 4M72A 3ZMDA 1F5TA 5ICGA 1FSEA 5LLQA 3Q9SA 2MC3A 3MEXA 2XAFA 4P9UA 1ODDA 1KU7A 2ESNA 1FBQA 3WTTC 2R3SA 2FE3A 4I0AA 4A6DA 2Z5UA 2XKPA 4GYGA 1OYYA 1USTA 4HF0A 4G7OF 5LHGA 5EEGA 3IKVA 1F4KA 1KYZA 1ZG3A 3T8RA 5E17F 2EV5A 2XUBA 4RGSA 4QWQA 3DQVC 2V1UA 4YIIA 4KMFA 4GCVA 5D6EA 4LK0F 4LK1F 5CYVA 4EJUA 2ZFWA 4UXNA 5F6FA 4AIHA 4L18B 2GWRA 3ELKA 4MTEA 1O7LA 1Q1HA 1KQ9A 1J2XA 4L9NA 1T0FA 1R58A 2G7UA 3JSPA 5E8IA 3WTWC 1B1BA 3CDHA 2H6CA 1Z7UA 1S7OA 2VBZA 3R60A 2QVOA 4I09A 4ZYHA 3DEUA 1ZREA 5HLIA 3I71A 4WXHA 4OIQF 3CJNA 3KZYA 4HLXA 1B9NA 1U78A 4YIFA 3WGIA 5F1RA 2M30A 3ZMUA 1MJBA 1SFEA 4IHSA 1YTYA 5LGNA 1GXQA 4KUMA 2DK8A 4P55A 1K78A 1TQIA 3LFKA 2R7DA 4FT8A 2ZCWA 3C7JA 4LD5A 2QENA 4I2OA 4MQVA 2LF7A 3GYHX 5KVRA 5AONA 1H9GA 3GFJA 4P96A 2E1NA 2VC1A 5A2QZ 4KFCA 1IRFA 5D5VB 2M8EA 2STTA 3O2PE 5J8FA 1YFHA 2VBWA 4MEXF 3HYIA 2ISZA 2A61A 2MA3A 2VONA 2CFXA 3F6OA 1RUNA 5BPIA 4GXOA 3HRMA 4WWCA 1ZN2A 3Q9VA 3QAHA 3LAJA 1TNSA 1REPC 3REOA 2W57A 1MDMA 5ICCA 2CG4A 3ZMZA 4EV0A 5D8LB 3F3XA 2K4BA 1LQ1A 1G3TA 4LLLA 3CUOA 1W7PD 1HW1A 2VT2A 2IT0A 4UNOA 2F5EA 3T5XA 2F5FA 4KIFA 2J5PA 2OZ6A 4RB3C 1YLFA 2IRFG 5JFRA 4Z2YA 4LLNA 4HX4A 1ZG1A 2IJLA 2PBIA 1P4XA 2D1HA 2HYGD 3GFMA 2ZNYA 3L9FA 1TW3A 2KIMA 5K1YA 1USSA 2Y48A 1G4DA 2PJPA 1JHFA 1OPCA 4XBFA 1DDNA 1R23A 2DBBA 4EVIA 4QLCU 2ZMEB 3VEPA 4DQ2A 4YFXF 4MTDA 2RVCA 4LGWA 4MGRA 3V7SA 4M73A 2FMYA 5HLHA 2AXLA 1SMYF 5E20A 5HDNA 3GFLA 4IVNA 4M6YA 2A07F 3EUHA 1ZLJA 1QBJA 4IRGA 1MD0A 2CGPA 5DEQA 1G3YA 1T38A 3SHFA 2V1XA 4G8XA 1Z6TA 3C3WA 1BJAA 3E6MA 3DKWA 3GFIA 3V4GA 3ZPLA 5DYMA 4EQQA 1T98A 2L3DA 2FSWA 3SZTA 1HKTA 4AIJA 2M45A 1LEBA 4KMUX 3IC7A 4I01A 2WWYA 1Z9CA 1I1GA 4N9IA 5LGUA 2EA2A 2DQRA 2Z3YA 5E8GA 4A2UA 2MLKA 1KA8A 3WGGA 1BBYA 3IKTA 1KU9A 4I98B 2NRAC 2L54A 1FOKA 1YO5C 2XASA 4E70A 3QP6A 4O6JA 4EGZA 1IW7F 2OA4A 3LSTA 1FPQA 1KGSA 3SXYA 2DPUA 3JAMZ 3I58A 1ZLKA 4G94A 5HVQC 1WSUA 1TBXA 3JW4A 4R8HA 1GXPA 2KKOA 1R00A 2RC4A 3HOSA 3P7NA 3IWZA 4IRIA 5ICFA 2YSRA 4KIBA 3VODA 4NHJA 3KP4A 2EV0A 3ZMVA 5FB2A 4OOIA 3ISPA 5AIQA 5L3CA 1K78B 3G3ZA 2LNBA 5K5QA 4A0XA 3WTSC 4Y17A 1MZBA 4RS8A 3ZN1A 1FLIA 3WODF 5BQTA 1GVJA 3IRQA 3QPTA 3CUQC 3DFGA 2PFBA 3LQRA 4BHCA 1IF1A 2GZWA 3OV8A 1FYMA 1W4MA 1RIOH 5H6RA 1SD6A 2L4MA 2HEOA 3HOTA 2PQ8A 3HHHA 3WTYC 1WI9A 1Y0UA 4HF2A 2O61A 1IXRC 1I5ZA 3E5UA 3U9GA 3JAMK 1KU2A 4EJVA 5JVTA 3MAJA 4XLPF 3I54A 3I5UA 3R61A 4I7HA 3N4MA 3V8JA 2HS5A 3H3ZA 1J75A 1J0RA 2W25A 2CQKA 1SD4A 2MBFA 3KLOA 1R1TA 4U0YA 3FMQA 5D5WB 3HTUA 1KYWA 1FYKA 3I64A 1MDMB 2FXAA 3I0TA 2XGXA 3TDUC 2EA4A 1A04A 2WV0A 5HLGA 1IUYA 2OBPA 1LB2A 1EH7A 4A0YA 4LMYA 4BHPA 1AOYA 1EV7A 2V1DA 3KEQA 4U88A 2CWEA 3F22A 1FC3A 3RIRA 3WTUC 2VOPA 2QUFA 1P6RA 2KIFA 4PGGA 1IRGA 5JHUA 2P5KA 3KETA 1WKMA 1BOAA 5DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KCC A;  4OMY A;  2V79 A;  1I1S A;  1FX7 A;  1S3J A;  1ZGA A;  3K69 A;  2OQR A;  2LSO A;  1FZP B;  2A5Y B;  3FMR A;  1HW2 A;  1IAW A;  5BPD A;  3ERE D;  4L9J A;  3MZH A;  1DUX C;  4S04 A;  5J8C A;  4HLY A;  4UHT A;  4BYY A;  4AWX B;  4HOB A;  4CHU A;  2W84 A;  1U2W A;  2Z33 A;  2KJC A;  2VBX A;  4Q5S F;  2TDX A;  4ASN A;  4DNC A;  1LJ9 A;  5LEK A;  1OYI A;  5BS6 A;  2XRO A;  4L0Y B;  5DUK A;  4PGH A;  3EDP A;  5LHI A;  4OIP F;  1TQM A;  2A69 F;  2EV6 A;  5LEJ A;  1QGP A;  3QU6 A;  5ILU A;  1J59 A;  3K1N A;  2YU3 A;  3F8M A;  4NB5 A;  2BE5 F;  2FQ3 A;  3K1P A;  3CUQ B;  1ZRC A;  2XIG A;  5LBQ A;  2EJR A;  4G9Y A;  3P9C A;  3O6B B;  1X3U A;  3KZZ A;  3BPV A;  3IL2 A;  4UUV A;  1R5G A;  1XMA A;  4A5M A;  1HQC A;  4XSX F;  4IPA A;  1J9I A;  5L3F A;  2EFN A;  5DD4 A;  2HDC A;  3WTX C;  2DO7 A;  2EB7 A;  4IXA A;  3WGH A;  1XD7 A;  4N9H A;  1RNL A;  3LA3 A;  3R0J A;  2DQL A;  2ZO4 A;  3FXR A;  3FWE A;  3CTA A;  2OU2 A;  1TLH B;  5H6Q A;  3RPQ A;  3NEU A;  4HX7 A;  3WE3 A;  5E1X A;  3QOP A;  2A68 F;  4WX9 A;  1XGS A;  3KFW X;  3M8F A;  4JQF A;  2L02 A;  2ETH A;  5HS9 A;  2DPD A;  5CVI A;  1V4R A;  3K0L A;  2VE8 A;  1YS7 A;  3NQO A;  5AIP A;  5IT9 Z;  1IXS B;  1KQ8 A;  1P2F A;  2FBH A;  1L3L A;  2A3S A;  4U7B A;  3TOB A;  4I0B A;  3TGN A;  4EMS A;  4G7H F;  5HS7 A;  4FX0 A;  5J6X A;  5JR3 A;  2PG4 A;  4ZYD A;  3M7G A;  2BGC A;  2IA0 A;  2JPB A;  2VOO A;  5FGM A;  2ZNZ A;  4K2E A;  5EEH A;  1RI7 A;  5K5R A;  3DV8 A;  4KN4 X;  4PCQ A;  2CSO A;  3TDZ C;  1FBU A;  2FNP A;  1OMI A;  2YX4 A;  1XSV A;  2Q2E A;  1BIA A;  4KNY A;  2A6H F;  2HKX A;  4RB0 A;  3M9A A;  2L4A A;  4Y13 A;  2PEX A;  1EH6 A;  2GIV A;  5LRR A;  2K7L A;  2YR2 A;  2FBI A;  2LDU A;  3LA7 A;  4ENM A;  5DDG A;  3TQN A;  4B09 A;  2L01 A;  1SMT A;  1CGP A;  4KN7 X;  5IT9 K;  3GO5 A;  4ZZD A;  3F6V A;  4ON0 A;  3GZ5 A;  3DP7 A;  1FNN A;  3KLN A;  4HW0 A;  5BMZ A;  2DT5 A;  3BWG A;  1CF7 B;  4IRH A;  2QQA A;  3BJO A;  4OIR F;  2GA2 A;  1QPM A;  4GO1 A;  4BAY A;  1G3S A;  2HGC A;  1ZRD A;  2H94 A;  4BHB A;  4ENK A;  2VBY A;  1U5T C;  1F1Z A;  2QYO A;  4ZYE A;  3HRT A;  4CYD A;  2KRF A;  2PMH A;  2Y75 A;  4LB6 B;  3I59 B;  1JE8 A;  5LGT A;  2EFP A;  4Q48 A;  2YPR A;  1R1U A;  3BJA A;  3T0Y A;  1P4W A;  3E5Q A;  1IN6 A;  3RPU A;  5FFZ A;  3ULQ B;  3B73 A;  4Q47 A;  2XAJ A;  2D1V A;  3GXO A;  3F72 A;  1FP1 D;  3FF5 A;  2P8T A;  2CO5 A;  3AAF A;  3VOE A;  4KIG A;  4I02 A;  3LA2 A;  1E17 A;  3ECH A;  4RAZ A;  3I53 A;  1FBS A;  3E6C C;  4BNC A;  4OU0 A;  5D8K B;  2HZT A;  1MGT A;  2EK5 A;  3L09 A;  1K79 A;  3C1D A;  4YFK F;  4WK8 F;  5L3G A;  3HSE A;  2ISY A;  3MZY A;  2Y0M A;  5CVR A;  2DLL A;  1HBX G;  3BY6 A;  4HQM A;  5ERI A;  3T1B A;  4G6D A;  1QQI A;  2P5V A;  2ZJ2 A;  3CUQ A;  4L9V A;  4BXU A;  4WCG A;  4CXF A;  4R1H A;  3LWF A;  2QQB A;  2OZU A;  1BI2 A;  5DV5 A;  3WU0 A;  5CJ9 A;  5ILS A;  2PLY A;  2JZY A;  4LB5 A;  3RKX A;  2Z9O A;  2GQQ A;  3HTS B;  2HFH A;  2G7H A;  2RN7 A;  3K2Z A;  3BDD A;  2D45 A;  4H0E A;  2FOK A;  2ESH A;  4OIO F;  4UV9 A;  3G73 A;  2X4H A;  4KT5 C;  4UVB A;  5FD6 A;  1W5T A;  2CYY A;  3MQ0 A;  4XSZ F;  3DF8 A;  2QM3 A;  1T6S A;  2XAH A;  3FX3 A;  3CO6 C;  2COM A;  5ED4 A;  3EET A;  2R7F A;  3E6D A;  4ZYG A;  1TQP A;  3ABT A;  5CLS A;  3FM3 A;  4CDG A;  1ZGJ A;  2NNY A;  3EQL F;  1S8N A;  1B9M A;  4AVP A;  2NNN A;  2RDP A;  2IA1 A;  3J80 Z;  4IF4 A;  1QZY A;  2ACJ A;  2FML A;  1FY7 A;  4RAY A;  2GXB A;  4KYW A;  1UFM A;  2DW4 A;  1RZ4 A;  3FHZ A;  1U5T B;  3SQN A;  4A0Z A;  3FZV A;  2LF8 A;  1HST A;  5E18 F;  5TJJ A;  2UZK A;  2FBK A;  1B59 A;  2XKO A;  1XGO A;  3RKW A;  2H6B A;  1LNW A;  2K02 A;  3DPL C;  2P7V B;  2HKO A;  2VOD A;  3V7C A;  3P9K A;  3VB2 A;  1P4A A;  3FXQ A;  2P4W A;  1XSX A;  3S2W A;  2IP2 A;  3IHU A;  3MWM A;  3I4P A;  1TTY A;  3COA C;  1BC8 C;  3SZP A;  1BN5 A;  4UVC A;  2KJB A;  3N97 A;  1BM9 A;  1FYL A;  3BJ6 A;  1UCR A;  3J80 K;  1CF7 A;  3GF2 A;  3KP6 A;  5DD8 A;  4M74 A;  5CVJ A;  5L3B A;  3B02 A;  1YS6 A;  3FXU A;  1TNT A;  2DK5 A;  3R4K A;  4ETS A;  4L9T A;  2E1C A;  2EFW A;  4WXD A;  4JK1 X;  2XV4 S;  3VFZ A;  3I59 A;  3TO6 A;  4OMZ A;  1D8J A;  1UHW A;  3R6S A;  2FEZ A;  3V7R A;  1PDN C;  1G3W A;  2JPC A;  4LG0 B;  3BOQ A;  4IHT A;  2E7W A;  4U0V A;  1XSD A;  2P5L C;  2QBY B;  5HS8 A;  2B0L A;  1W7P B;  1PP8 F;  3J7A O;  2F5C A;  4B8X A;  3IRR A;  4EJW A;  2NYX A;  1LVA A;  5D5U B;  1WWX A;  2WTE A;  3HSF A;  2O0Y A;  3V8K A;  2PMU A;  3PFI A;  1I27 A;  3V8L A;  2YX7 A;  1BI0 A;  2PN6 A;  4EM2 A;  2NS0 A;  3WU1 B;  2XVC A;  2D2W A;  4A6E A;  2XAQ A;  1YIO A;  4L5I A;  2GAU A;  1R1V A;  1K7A A;  1W5S A;  3WG9 A;  4HQE A;  2DU9 A;  4EJO A;  2V6C A;  5IT3 A;  3T8T A;  1QNT A;  1LDJ A;  4RGR A;  1L0O C;  4Y15 A;  3MFK A;  1JXS A;  1D3Y A;  5D4S A;  1C0W A;  2UXN A;  5FLX Z;  4AIK A;  2RNJ A;  2F5D A;  1ZAR A;  4YFN F;  3MCZ A;  2XHK A;  3ZN0 A;  2VC0 A;  2IPQ X;  2O03 A;  3W6J B;  1R36 A;  3M8E A;  2HTJ A;  3F23 A;  3KP2 A;  3ZMT A;  3RI4 A;  3RKY A;  4HA8 A;  1XGN A;  3RJP A;  1DP7 P;  1G6N A;  3C18 A;  1XCV A;  1Z6R A;  3EYI A;  3L00 A;  5ICE A;  5D5X B;  1U6G A;  5F64 A;  4HDU A;  3QPH A;  3ROU A;  1FP2 A;  4RB1 A;  3BZ6 A;  1R22 A;  3E6B A;  2M1B A;  4EM1 A;  2BBY A;  1O3R A;  4FX4 A;  2EWN A;  1YW8 A;  4HV6 A;  2MH9 A;  4CZZ A;  4A5N A;  3L2C A;  4EJT A;  3QRF F;  1AWC A;  1SAX A;  1XN7 A;  2Q8K A;  4CGZ A;  2O3F A;  4L5J A;  1LDK B;  1IN4 A;  1O3Q A;  2M5W A;  1YQA A;  2CW0 F;  1DPR A;  2O6G E;  3TOA A;  2K4J A;  1ON2 A;  4LJZ F;  5FLX K;  5HDK A;  1ULY A;  1IXC A;  2E7X A;  1Z05 A;  3GW2 A;  2EFQ A;  3M1E A;  5FD5 A;  1MJ9 A;  4NQW A;  1FT9 A;  3DPT A;  1D5V A;  2HYF A;  1SD5 A;  1U5T A;  4MNU A;  4GYI A;  2FA5 A;  1KU3 A;  2M87 A;  4ZH4 F;  1I6X A;  4S05 A;  2LKP A;  3TO9 A;  1QZZ A;  1QO0 D;  4HAM A;  1GHC A;  1O3T A;  2MLG A;  2K27 A;  1UB9 A;  3GWZ A;  1LEA A;  1IN5 A;  1FWZ A;  1HKQ A;  2O8X A;  3HIF A;  3JTG A;  3ZQ7 A;  2UWM A;  3ABU A;  4M9Z A;  2P7C B;  3GEZ A;  4WF2 A;  5H20 A;  4RB2 C;  4AD9 A;  3U2R A;  3F21 A;  2K86 A;  1JGS A;  3TKY A;  1P92 A;  4RGU A;  2OAZ A;  1U8R A;  1R7J A;  2NAZ A;  3FM5 A;  3LAP A;  4MEY F;  6PAX A;  1ZG5 A;  3KE2 A;  3HUG A;  1H9T A;  1S29 A;  3ECO A;  4O3M A;  1MKM A;  1E2X A;  3H3U A;  5E1Z B;  1YW7 A;  4HZF A;  3CLO A;  4EM0 B;  2ADU A;  1IN8 A;  2DFI A;  2QQ9 A;  4HV5 A;  4FHT A;  4MQ9 F;  2RQP A;  3HHG A;  4JBA A;  2IA2 A;  3D5L A;  2GA1 A;  5ILV A;  3ZMS A;  1ONV A;  2XRN A;  4CO8 A;  1R5H A;  3WE2 A;  1LDD A;  1JHH A;  3QU3 A;  5A2Q K;  2HOE A;  3Q5F A;  5LHH A;  4BH9 A;  4TV7 A;  2G9W A;  5DCM A;  2W85 A;  1ZYR F;  2ZKZ A;  4HBL A;  4Q4Z F;  1HXD A;  2IVM A;  4LG0 A;  2FNA A;  5DUI A;  3JTH A;  3RDI A;  1J5Y A;  2JRT A;  3BP8 A;  3OOP A;  2Z99 A;  1IN7 A;  2RKH A;  3BRO A;  3F8B A;  2QBY A;  3EYY A;  1W7P A;  2WC2 A;  4MHG A;  2QWW A;  3PQJ A;  1DPU A;  1PUE E;  3RYP A;  1YYV A;  2VE9 A;  3FMS A;  4A12 A;  4PZJ A;  5FFX A;  4KDP A;  4D0P A;  2MD5 A;  1XDU A;  4BQA A;  1SFX A;  2EFO A;  1ZH5 A;  3KP5 A;  3RYR A;  3QP5 A;  4HYE A;  1KQ0 A;  3KEO A;  2A6E F;  1Z1D A;  5L3D A;  5HOO A;  4XRF A;  4L0Z B;  2OD5 A;  1T2K A;  2OQG A;  2MH2 A;  5LRS A;  3ZP5 A;  2FU4 A;  1UHM A;  4ESB A;  1S7A A;  3P9I A;  3IWF A;  4KA4 A;  1J7K A;  5JI6 A;  2HWV A;  2XAG A;  4HF1 A;  3K9T A;  1K6O A;  2DAO A;  3GLX A;  3KP3 A;  3PQK A;  3L7W A;  1ZHF A;  4UVA A;  1HSJ A;  5KK1 A;  1TW2 A;  1D8K A;  1RUO A;  2F2E A;  1B6A A;  1YW9 A;  2QLZ A;  2ZBK A;  1ON1 A;  1WRJ A;  2ELH A;  4U7D A;  2P6T A;  1BC7 C;  4G7Z F;  3NRV A;  1B4A A;  3HSR A;  2ZXJ A;  2P6S A;  2V9V A;  2KIU A;  4HX8 A;  3K1M A;  2H09 A;  4ENN A;  3D0S A;  4P9F A;  4ENJ A;  1HW5 A;  5FO5 A;  3RTR A;  1XB4 A;  5E1W A;  1XCB A;  1NHA A;  3GX4 X;  3SFZ A;  1H0M A;  2VN2 A;  1OYW A;  3H92 A;  3E3V A;  3GUD A;  2W24 A;  3TO7 A;  3U1D A;  3ML6 A;  2STW A;  4YG2 F;  2AS5 F;  1Z91 A;  4P5O A;  1BIB A;  4O5V A;  5CVU A;  3HRU A;  5D4R A;  2FF4 A;  5D6F A;  2X0L A;  4LFU A;  5K5O A;  2VT3 A;  2BEO A;  2HQN A;  3E97 A;  2QZ8 A;  4RGX A;  1SFU A;  4M6X A;  2HQR A;  1XDS A;  2RV8 A;  5CVV A;  2VXZ A;  2J5O A;  4N0B A;  5BOX A;  4OIN F;  3JSO A;  1O3S A;  3E5X A;  2UXX A;  4F7Z A;  3KP7 A;  1IZ1 A;  1MJA A;  2JT1 A;  1ZAO A;  4R79 A;  2DTR A;  1F9N A;  3HRS A;  1WQ2 A;  4ZZL A;  1SD7 A;  1ZRF A;  3LQQ A;  4M9X A;  3GZ6 A;  2HTS A;  3R0A A;  4ESJ A;  3J81 Z;  1V3F A;  1S6L A;  3F8F A;  4ESF A;  1OR7 A;  1O57 A;  1T39 A;  4HDV A;  2Q0O A;  2GXG A;  4XLN F;  1STZ A;  4M71 A;  3F8C A;  4G6Q A;  3W6K B;  3GVA A;  4WXC A;  1OKR A;  2BV6 A;  2RGV A;  2IW5 A;  1BI1 A;  3WTZ A;  3F8N A;  2DI3 A;  4LLG F;  2BYV E;  4PDK A;  2H27 A;  4M9S A;  4U0W A;  2HR3 A;  4UV8 A;  5HDG A;  4EGY A;  5TRD A;  2C6Y A;  1VTN C;  3O3K A;  5DCM B;  1PP7 U;  4KIC A;  2FRH A;  1EH8 A;  1U3E M;  3BPX A;  4IJA A;  1XMK A;  3CO7 C;  1FSH A;  3DXJ F;  3WTV C;  2JTV A;  2ZME A;  2JSC A;  5L3E A;  1HKS A;  1YG2 A;  2PI0 A;  1XGM A;  4CIC A;  4GGG A;  3J81 K;  1BI3 A;  1O7F A;  4M72 A;  3ZMD A;  1F5T A;  5ICG A;  1FSE A;  5LLQ A;  3Q9S A;  2MC3 A;  3MEX A;  2XAF A;  4P9U A;  1ODD A;  1KU7 A;  2ESN A;  1FBQ A;  3WTT C;  2R3S A;  2FE3 A;  4I0A A;  4A6D A;  2Z5U A;  2XKP A;  4GYG A;  1OYY A;  1UST A;  4HF0 A;  4G7O F;  5LHG A;  5EEG A;  3IKV A;  1F4K A;  1KYZ A;  1ZG3 A;  3T8R A;  5E17 F;  2EV5 A;  2XUB A;  4RGS A;  4QWQ A;  3DQV C;  2V1U A;  4YII A;  4KMF A;  4GCV A;  5D6E A;  4LK0 F;  4LK1 F;  5CYV A;  4EJU A;  2ZFW A;  4UXN A;  5F6F A;  4AIH A;  4L18 B;  2GWR A;  3ELK A;  4MTE A;  1O7L A;  1Q1H A;  1KQ9 A;  1J2X A;  4L9N A;  1T0F A;  1R58 A;  2G7U A;  3JSP A;  5E8I A;  3WTW C;  1B1B A;  3CDH A;  2H6C A;  1Z7U A;  1S7O A;  2VBZ A;  3R60 A;  2QVO A;  4I09 A;  4ZYH A;  3DEU A;  1ZRE A;  5HLI A;  3I71 A;  4WXH A;  4OIQ F;  3CJN A;  3KZY A;  4HLX A;  1B9N A;  1U78 A;  4YIF A;  3WGI A;  5F1R A;  2M30 A;  3ZMU A;  1MJB A;  1SFE A;  4IHS A;  1YTY A;  5LGN A;  1GXQ A;  4KUM A;  2DK8 A;  4P55 A;  1K78 A;  1TQI A;  3LFK A;  2R7D A;  4FT8 A;  2ZCW A;  3C7J A;  4LD5 A;  2QEN A;  4I2O A;  4MQV A;  2LF7 A;  3GYH X;  5KVR A;  5AON A;  1H9G A;  3GFJ A;  4P96 A;  2E1N A;  2VC1 A;  5A2Q Z;  4KFC A;  1IRF A;  5D5V B;  2M8E A;  2STT A;  3O2P E;  5J8F A;  1YFH A;  2VBW A;  4MEX F;  3HYI A;  2ISZ A;  2A61 A;  2MA3 A;  2VON A;  2CFX A;  3F6O A;  1RUN A;  5BPI A;  4GXO A;  3HRM A;  4WWC A;  1ZN2 A;  3Q9V A;  3QAH A;  3LAJ A;  1TNS A;  1REP C;  3REO A;  2W57 A;  1MDM A;  5ICC A;  2CG4 A;  3ZMZ A;  4EV0 A;  5D8L B;  3F3X A;  2K4B A;  1LQ1 A;  1G3T A;  4LLL A;  3CUO A;  1W7P D;  1HW1 A;  2VT2 A;  2IT0 A;  4UNO A;  2F5E A;  3T5X A;  2F5F A;  4KIF A;  2J5P A;  2OZ6 A;  4RB3 C;  1YLF A;  2IRF G;  5JFR A;  4Z2Y A;  4LLN A;  4HX4 A;  1ZG1 A;  2IJL A;  2PBI A;  1P4X A;  2D1H A;  2HYG D;  3GFM A;  2ZNY A;  3L9F A;  1TW3 A;  2KIM A;  5K1Y A;  1USS A;  2Y48 A;  1G4D A;  2PJP A;  1JHF A;  1OPC A;  4XBF A;  1DDN A;  1R23 A;  2DBB A;  4EVI A;  4QLC U;  2ZME B;  3VEP A;  4DQ2 A;  4YFX F;  4MTD A;  2RVC A;  4LGW A;  4MGR A;  3V7S A;  4M73 A;  2FMY A;  5HLH A;  2AXL A;  1SMY F;  5E20 A;  5HDN A;  3GFL A;  4IVN A;  4M6Y A;  2A07 F;  3EUH A;  1ZLJ A;  1QBJ A;  4IRG A;  1MD0 A;  2CGP A;  5DEQ A;  1G3Y A;  1T38 A;  3SHF A;  2V1X A;  4G8X A;  1Z6T A;  3C3W A;  1BJA A;  3E6M A;  3DKW A;  3GFI A;  3V4G A;  3ZPL A;  5DYM A;  4EQQ A;  1T98 A;  2L3D A;  2FSW A;  3SZT A;  1HKT A;  4AIJ A;  2M45 A;  1LEB A;  4KMU X;  3IC7 A;  4I01 A;  2WWY A;  1Z9C A;  1I1G A;  4N9I A;  5LGU A;  2EA2 A;  2DQR A;  2Z3Y A;  5E8G A;  4A2U A;  2MLK A;  1KA8 A;  3WGG A;  1BBY A;  3IKT A;  1KU9 A;  4I98 B;  2NRA C;  2L54 A;  1FOK A;  1YO5 C;  2XAS A;  4E70 A;  3QP6 A;  4O6J A;  4EGZ A;  1IW7 F;  2OA4 A;  3LST A;  1FPQ A;  1KGS A;  3SXY A;  2DPU A;  3JAM Z;  3I58 A;  1ZLK A;  4G94 A;  5HVQ C;  1WSU A;  1TBX A;  3JW4 A;  4R8H A;  1GXP A;  2KKO A;  1R00 A;  2RC4 A;  3HOS A;  3P7N A;  3IWZ A;  4IRI A;  5ICF A;  2YSR A;  4KIB A;  3VOD A;  4NHJ A;  3KP4 A;  2EV0 A;  3ZMV A;  5FB2 A;  4OOI A;  3ISP A;  5AIQ A;  5L3C A;  1K78 B;  3G3Z A;  2LNB A;  5K5Q A;  4A0X A;  3WTS C;  4Y17 A;  1MZB A;  4RS8 A;  3ZN1 A;  1FLI A;  3WOD F;  5BQT A;  1GVJ A;  3IRQ A;  3QPT A;  3CUQ C;  3DFG A;  2PFB A;  3LQR A;  4BHC A;  1IF1 A;  2GZW A;  3OV8 A;  1FYM A;  1W4M A;  1RIO H;  5H6R A;  1SD6 A;  2L4M A;  2HEO A;  3HOT A;  2PQ8 A;  3HHH A;  3WTY C;  1WI9 A;  1Y0U A;  4HF2 A;  2O61 A;  1IXR C;  1I5Z A;  3E5U A;  3U9G A;  3JAM K;  1KU2 A;  4EJV A;  5JVT A;  3MAJ A;  4XLP F;  3I54 A;  3I5U A;  3R61 A;  4I7H A;  3N4M A;  3V8J A;  2HS5 A;  3H3Z A;  1J75 A;  1J0R A;  2W25 A;  2CQK A;  1SD4 A;  2MBF A;  3KLO A;  1R1T A;  4U0Y A;  3FMQ A;  5D5W B;  3HTU A;  1KYW A;  1FYK A;  3I64 A;  1MDM B;  2FXA A;  3I0T A;  2XGX A;  3TDU C;  2EA4 A;  1A04 A;  2WV0 A;  5HLG A;  1IUY A;  2OBP A;  1LB2 A;  1EH7 A;  4A0Y A;  4LMY A;  4BHP A;  1AOY A;  1EV7 A;  2V1D A;  3KEQ A;  4U88 A;  2CWE A;  3F22 A;  1FC3 A;  3RIR A;  3WTU C;  2VOP A;  2QUF A;  1P6R A;  2KIF A;  4PGG A;  1IRG A;  5JHU A;  2P5K A;  3KET A;  1WKM A;  1BOA A;  5DCF A; 
#chains in the Genus database with same CATH topology
 2E34 A;  3KCC A;  4OMY A;  1SFK A;  2R92 J;  2DMU A;  2V79 A;  1I1S A;  1FX7 A;  1E3O C;  1RES A;  1S3J A;  4IEJ A;  4BDY A;  1ZGA A;  2KPM A;  2E5N A;  3K69 A;  2CJJ A;  2WAD A;  3ZQI A;  2OQR A;  3BTI A;  5EG0 A;  2B9S A;  1BL0 A;  2DA4 A;  2YU9 J;  2LSO A;  3DEE A;  1FZP B;  2A5Y B;  3FMR A;  1HW2 A;  2V4J C;  5BPD A;  1IAW A;  1ETK A;  1GUU A;  2WAQ A;  3ERM A;  3ERE D;  4L9J A;  3MZH A;  1DUX C;  2JA5 J;  2KLO A;  3GBG A;  4S04 A;  5J8C A;  2TRT A;  2WAF A;  2F6C A;  1T08 B;  4HLY A;  4UHT A;  2R7Z J;  4BYY A;  4AWX B;  2N8G A;  5J4V A;  1NH3 A;  4HOB A;  4CHU A;  2MGQ A;  2W84 A;  3ZQF A;  1U2W A;  1N25 A;  3OSF A;  1RPW A;  2BXY A;  3CCS I;  2Z33 A;  2KJC A;  2E1M B;  2VBX A;  4X0G A;  4Q5S F;  2TDX A;  2YS9 A;  2PMZ A;  4ASN A;  4DNC A;  4XLC A;  2QKM B;  2L7K A;  1LJ9 A;  3PUB A;  5LEK A;  2FOW A;  4BU2 A;  2DFE A;  2VQC A;  3ABK H;  4MO7 A;  1OYI A;  3M4O J;  5BS6 A;  2XRO A;  3QWL A;  4L0Y B;  5DUK A;  4PGH A;  2ICW G;  4XLE A;  3EDP A;  4C3J J;  5LHI A;  4OIP F;  5IYC J;  1TQM A;  3JRB A;  2A69 F;  2EV6 A;  4HPQ A;  3OS2 A;  3OS0 A;  5LEJ A;  1QGP A;  3QU6 A;  2LRE A;  3PNT A;  2V9K A;  5ILU A;  5GP9 A;  5FJ8 J;  3K1N A;  1FIA A;  1J59 A;  2YU3 A;  3F8M A;  4NB5 A;  4ZDO A;  4PJM A;  2X6X A;  2BE5 F;  2FQ3 A;  3K1P A;  3CUQ B;  5F0F A;  3BR6 A;  1ZRC A;  2XIG A;  1F43 A;  5LBQ A;  1WHU A;  4FTH A;  1JTX A;  2EJR A;  2L9N A;  4G9Y A;  3P9C A;  3O6B B;  1X3U A;  3KZZ A;  2VPL A;  1U0J A;  3BPV A;  4JYK A;  3IL2 A;  4UUV A;  1R5G A;  2BY0 A;  1OJL A;  5M5Y J;  4RM2 A;  4YIR X;  1XMA A;  3ZRG A;  1ETO A;  2VXD A;  4A5M A;  1HQC A;  4XSX F;  4XON A;  4IPA A;  1J9I A;  4Y52 J;  2KZV A;  5TIS C;  4J01 A;  5L3F A;  2EFN A;  5DD4 A;  3PIP F;  2HDC A;  3WTX C;  3UNG C;  1VFC A;  2DO7 A;  2EB7 A;  1W0U A;  1D1A A;  3CJQ B;  4IXA A;  4W1U A;  5EZH A;  3WGH A;  1XD7 A;  5GTH C;  4N9H A;  1U8B A;  1RNL A;  3LA3 A;  2IS4 A;  4UY8 I;  2GBY A;  3BT9 A;  3R0J A;  2DQL A;  3WU2 C;  2ZO4 A;  3FXR A;  2EQR A;  1TZL A;  1WJD A;  3EPZ A;  3FWE A;  3CTA A;  3OYN A;  3BG6 A;  2OU2 A;  1TLH B;  5H6Q A;  3RPQ A;  3H9Q A;  1LVK A;  3NEU A;  4HX7 A;  3WE3 A;  1H89 C;  5E1X A;  4BQO A;  1ZQ3 P;  3QOP A;  3S2H J;  2A68 F;  5DTD A;  1OCC H;  3FXJ A;  3LMM A;  5GPA A;  4WX9 A;  2Y9Z A;  2X85 A;  1XGS A;  3KFW X;  3M8F A;  4JQF A;  2L02 A;  2ETH A;  3H36 A;  5HS9 A;  2DPD A;  2E60 A;  4HEA 2;  1MMA A;  1HDD C;  3BG7 A;  5CVI A;  1V4R A;  2I5U A;  2VE8 A;  3BC8 A;  3K0L A;  3ASO H;  3WHC A;  2XAU A;  4Y3O A;  1YS7 A;  2LTP A;  3NQO A;  4NUB A;  5AIP A;  1QA6 A;  5IT9 Z;  1IXS B;  4FET A;  4OAY A;  1KQ8 A;  1P2F A;  1I3Q J;  1RKT A;  2FBH A;  2K3F A;  3OR2 C;  3BG5 A;  2A3S A;  1L3L A;  4IKF A;  5TGT A;  3CMA I;  4U7B A;  1K83 J;  3TOB A;  4I0B A;  3CCM I;  3I3L A;  1MIJ A;  3JRE A;  3TGN A;  4EMS A;  3JRH A;  4MFD A;  3S3O A;  4G7H F;  5HS7 A;  4FX0 A;  4BJT A;  2IGM A;  5J6X A;  5JR3 A;  2PG4 A;  4ZYD A;  4GFB A;  2DJI A;  2OCC H;  3M7G A;  1VQ4 I;  1QPI A;  2BGC A;  2IA0 A;  2JPB A;  1IV6 A;  2VOO A;  1VZ0 A;  2DA6 A;  3HC7 A;  5FGM A;  1FMV A;  2ZNZ A;  4CCL A;  4K2E A;  5EEH A;  1RI7 A;  5K5R A;  1ZK8 A;  2ZJR F;  3U1K A;  5KAF C;  1X1A A;  3DV8 A;  4KN4 X;  4PCQ A;  2CSO A;  4BEH A;  4BAC A;  3TDZ C;  3IH4 A;  1FBU A;  2FNP A;  1OMI A;  3K2A A;  2YX4 A;  2JK3 A;  2OC6 A;  1XSV A;  2Q2E A;  2EZI A;  4D7M A;  1BIA A;  2K9S A;  4KNY A;  3RQI A;  2A6H F;  1BOB A;  4E7K A;  2HKX A;  4H4K C;  1XMX A;  3HOY J;  2DFF A;  3M9A A;  2L4A A;  4RB0 A;  5J1U A;  1SFO J;  4IOC F;  4Y13 A;  2PEX A;  1EH6 A;  2MD0 A;  2LKX A;  1WJE A;  2QQ8 A;  2GIV A;  4BUP A;  3HGG A;  5LRR A;  2K7L A;  5EJC A;  1AKH B;  2NXN B;  2LH9 A;  1AHD P;  4PSX A;  1DU0 A;  2LYC A;  5FKN A;  4YRV A;  2YR2 A;  1XTA A;  1BR1 A;  2DMT A;  2FBI A;  2LDU A;  3LA7 A;  3GTJ J;  2R5Y B;  4ENM A;  2JUC A;  4LIV A;  5DDG A;  1R6R A;  3TQN A;  4B09 A;  2L01 A;  3OS1 A;  1SMT A;  1CGP A;  2Z2S B;  4KN7 X;  3SDG A;  3VYU B;  5IT9 K;  2GM4 A;  3GO5 A;  5CPR B;  4ZZD A;  5JLX A;  3F6V A;  4ON0 A;  2Y31 A;  3DP7 A;  1FNN A;  3GZ5 A;  2HQ5 A;  3KLN A;  4HW0 A;  3GTO J;  3F0C A;  5BMZ A;  1YJW I;  2DT5 A;  4RM3 A;  1JT6 A;  3BWG A;  2KMU A;  1CF7 B;  4IRH A;  2QQA A;  3I55 I;  2H8R A;  2CRG A;  2XGC A;  2XF6 A;  3BJO A;  1B8I A;  4OIR F;  3S16 J;  2W48 A;  2JUG A;  3H9J A;  2CQX A;  2GA2 A;  1QPM A;  2DOE A;  4DGW B;  4GO1 A;  1UJ8 A;  4BAY A;  1G3S A;  3ZQG A;  3C2G A;  3ZGK A;  2M0M A;  2HGC A;  1ZRD A;  2H94 A;  1A36 A;  4BHB A;  4ENK A;  2VBY A;  4IHY A;  4BE1 A;  1U5T C;  1F1Z A;  4PJJ A;  2QYO A;  4ZYE A;  2Y30 A;  3HRT A;  2MYS A;  4CYD A;  2VKH A;  3RQ4 A;  2KRF A;  2PMH A;  2HPI A;  2Y75 A;  4LB6 B;  2EZL A;  3G71 I;  3I59 B;  2JA6 J;  1JE8 A;  5LGT A;  2EFP A;  4Q48 A;  3QOD A;  2YPR A;  1R1U A;  3BJA A;  3T0Y A;  5EG0 B;  1P4W A;  4AC0 A;  3E5Q A;  1IN6 A;  3PO3 J;  2X1E A;  3RPU A;  5F04 A;  1BR2 A;  5FFZ A;  3ULQ B;  3FHN A;  3B73 A;  2HNH A;  3P5J A;  4Q47 A;  1JT0 A;  2M7A A;  4MIM A;  3PNV A;  2XAJ A;  1PJR A;  4DW6 A;  2R4G A;  2D1V A;  3GXO A;  4PSW A;  3FK7 A;  2VPR A;  2BY2 A;  3F72 A;  4A3E J;  1FP1 D;  5J47 A;  3A0B C;  1IDZ A;  3DCF A;  3FF5 A;  1ETY A;  1LFB A;  3MZ8 A;  2P8T A;  2LRD A;  3F9K A;  2CO5 A;  3AAF A;  2WY7 Q;  3SZG A;  4M3F A;  3VOE A;  3OYA A;  4KIG A;  5EEA A;  4I02 A;  3LA2 A;  3KYD B;  1E17 A;  4B48 A;  2GOM A;  3ECH A;  4M6V A;  3A01 B;  4RAZ A;  3I53 A;  1FBS A;  3E6C C;  4BNC A;  1HDP A;  1Z21 A;  3NAR A;  3QYF A;  4OU0 A;  5D8K B;  2F5V A;  2HZT A;  1MBH A;  1MGT A;  2CFO A;  1DP3 A;  2EK5 A;  3L09 A;  4KIT B;  5IOY A;  1K79 A;  3C1D A;  4YFK F;  4WK8 F;  5L3G A;  2LG4 A;  3HSE A;  2ISY A;  1VQ6 I;  3MZY A;  2Y0M A;  2NVT J;  5CVR A;  5IOZ A;  1MBK A;  2DLL A;  5C44 J;  3BY6 A;  2ID6 A;  3KZI C;  4HQM A;  5ERI A;  1YJ9 I;  1HBX G;  3MVP A;  3GTP J;  4V19 K;  2HDW A;  3T1B A;  4G6D A;  1QQI A;  4ABZ A;  4UB6 C;  1CQT A;  3BTC A;  2P5V A;  1VQ8 I;  4IHX A;  2ZJ2 A;  3CUQ A;  4L9V A;  4PJL A;  3SEZ A;  4BXU A;  3H0D A;  1LPQ A;  4WCG A;  1GV2 A;  2TCT A;  4CXF A;  4R1H A;  1JGG A;  3LWF A;  2QQB A;  1JKQ C;  2OZU A;  1BI2 A;  5DV5 A;  3WU0 A;  5CJ9 A;  5ILS A;  2PLY A;  4BDZ A;  2JZY A;  4LB5 A;  4XLF A;  4C3H J;  4W97 A;  3SJM A;  3RKX A;  2Z9O A;  2GQQ A;  4BQQ A;  2HFH A;  2OCE A;  3HTS B;  2H8W A;  2G7H A;  2RN7 A;  3K2Z A;  3BDD A;  4XRS A;  2D45 A;  4H0E A;  4C2T A;  3CES A;  4X1E A;  1ZEL A;  4II3 A;  2FOK A;  2ESH A;  4DYQ A;  4OIO F;  2K9L A;  1WJ5 A;  1X1B A;  1V55 H;  2CUF A;  4UV9 A;  4D7N A;  1JI8 A;  3G73 A;  2RRE A;  1MW7 A;  2K85 A;  2X4H A;  3L2U A;  3DBH B;  4KT5 C;  1MH3 A;  3NWT A;  1VQ9 I;  4UVB A;  2VQL A;  5FD6 A;  1YJN I;  1W5T A;  2VJ4 A;  2CYY A;  3MQ0 A;  4XSZ F;  3DF8 A;  4OAZ A;  2E1M C;  4AVZ A;  2QM3 A;  3BR5 A;  1T6S A;  2XAH A;  4A3D J;  3CQZ J;  1SAU A;  2RAE A;  3FX3 A;  3CO6 C;  3M07 A;  1MH4 A;  2COM A;  2DYS H;  5ED4 A;  4IZZ A;  1VQ7 I;  2R7F A;  3EET A;  2W7N A;  4XN0 A;  3E6D A;  3SDB A;  4ZYG A;  2CU7 A;  1WJB A;  1TQP A;  1OFC X;  1IC8 A;  3CZ6 A;  3Q0V A;  3ABT A;  3CC7 I;  3ZOB A;  3OYK A;  1IG7 A;  5CLS A;  3FM3 A;  2EIJ H;  3AG4 H;  4CDG A;  1ZGJ A;  3GTQ J;  2NNY A;  1QVT A;  1QZE A;  3EQL F;  5FLV A;  1S8N A;  5DM6 F;  3BR0 A;  1B9M A;  5IP9 J;  4AVP A;  3GTM J;  2NNN A;  2RDP A;  4I99 C;  4ANJ A;  2IA1 A;  3LSP A;  3J80 Z;  4IF4 A;  4A3M J;  4XR6 A;  1NG7 A;  1E3P A;  1QZY A;  2ACJ A;  2CW7 A;  2FML A;  2NOJ B;  4A3K J;  4BBS J;  3K4L A;  2V26 A;  1FY7 A;  3FXO A;  4RAY A;  4NQW B;  1TL8 A;  2GXB A;  4RLF A;  4KYW A;  1UFM A;  2DW4 A;  1RZ4 A;  3PSI A;  1W36 D;  3FHZ A;  1U5T B;  4JX4 A;  3SQN A;  4A0Z A;  3FZV A;  2LF8 A;  1HST A;  5E18 F;  5TJJ A;  2UZK A;  3AG2 H;  1ZGW A;  3HXL A;  3EUK L;  3D1N I;  3IH2 A;  2GOX B;  4M3D A;  2FBK A;  1B59 A;  2ELK A;  2KRC A;  2XKO A;  1XGO A;  3RKW A;  2JQ7 A;  2ZXW H;  3DU5 A;  2H6B A;  2IS1 A;  3HB9 A;  1LNW A;  2K02 A;  3DPL C;  2P7V B;  2HKO A;  4XOP A;  2VOD A;  3V7C A;  4CA0 A;  2AO9 A;  3P9K A;  3VB2 A;  4PFO A;  2ELJ A;  1P4A A;  3FXQ A;  2P4W A;  1SVL A;  1XSX A;  4RA2 A;  3S2W A;  2IP2 A;  3IHU A;  2LOO A;  3A03 A;  3CCJ I;  3MWM A;  4XLH A;  3I4P A;  1WH5 A;  3DBL B;  2OF7 A;  3PFY A;  1TTY A;  4B44 A;  4F55 A;  2X51 A;  3COA C;  1W1W E;  3SZP A;  3OYL A;  4F93 B;  2R5Y A;  1BC8 C;  3LSH A;  1BN5 A;  2K3P A;  4PJN A;  1APL C;  4UVC A;  2KJB A;  1F36 A;  3N97 A;  1BM9 A;  3D5S C;  2DMQ A;  3OIO A;  1FYL A;  4BBR J;  2JA2 A;  2IGK A;  4E7H A;  3BJ6 A;  4M3G A;  1UCR A;  4NC7 A;  3J80 K;  4X6A J;  4A3B J;  1CF7 A;  3FK6 A;  2L9R A;  1VQM I;  3S1N J;  3D5R C;  3GF2 A;  3KP6 A;  4Y4R A;  3AKZ A;  1FOY A;  5DD8 A;  4M74 A;  4KIS A;  4JP0 A;  5FRN A;  2E5Z A;  5GTI C;  5CVJ A;  5L3B A;  3B02 A;  1YS6 A;  1MNE A;  3FXU A;  1TNT A;  3HM5 A;  2DK5 A;  3R4K A;  1YX5 A;  4ETS A;  2O8K A;  2BW3 B;  4L9T A;  2E1C A;  3OR1 C;  2HQA A;  2EFW A;  1I3A A;  2PX9 A;  3CCE I;  4WXD A;  3BR2 A;  4JK1 X;  4J00 A;  2HVS A;  4QSH A;  1VQO I;  2XV4 S;  3VFZ A;  3I59 A;  3TO6 A;  4OMZ A;  1D8J A;  1UHW A;  5F1J A;  2LC2 A;  2DFH A;  3CME I;  3R6S A;  2FEZ A;  3GTL J;  2NVY J;  3V7R A;  1ETQ A;  2CUJ A;  4RAG A;  1YI2 I;  2BZT A;  2WAQ N;  4DZJ A;  1PDN C;  1G3W A;  2JPC A;  1UAA A;  1V5F A;  3JRD A;  4LG0 B;  3BOQ A;  2B63 J;  4IHT A;  3DEW A;  3A0H C;  2E7W A;  4CYC B;  4U0V A;  3ABL H;  1WJA A;  1IO2 A;  3I9V 2;  2KRH A;  1XSD A;  3FXL A;  2P5L C;  2QBY B;  2A5W A;  2DT6 A;  3S14 J;  3AFH A;  5HS8 A;  2B0L A;  2BVM A;  5JHF A;  1W7P B;  2WV1 A;  1GDT A;  1TP4 A;  1PP8 F;  3J7A O;  2F5C A;  3M1C A;  1ETW A;  1ZTR A;  2PMZ N;  4B8X A;  3IRR A;  3K6G A;  4NDL A;  4EJW A;  3A01 A;  3WG7 H;  2NYX A;  4UUT A;  2E1O A;  2QA4 I;  1YOV B;  2CH0 A;  3J7A Y;  1LVA A;  5D5U B;  1WWX A;  2WTE A;  1OR7 C;  3HSF A;  1MBE A;  2O0Y A;  3KIO A;  5HNH A;  3V8K A;  2PMU A;  3VWB A;  3PFI A;  2AHQ A;  1I27 A;  3K4B A;  4IQ4 A;  3CC4 I;  5IYB J;  3V8L A;  2YX7 A;  1BI0 A;  2K9M A;  1JTY A;  1WI3 A;  2PN6 A;  1QU3 A;  3OIQ A;  1WPK A;  2NS0 A;  4JOM A;  4EM2 A;  4CCK A;  3WU1 B;  2XVC A;  1R5I D;  2D2W A;  2XAQ A;  1YIO A;  3G1L A;  4A6E A;  2JJ7 A;  2GAU A;  4L5I A;  1R1V A;  1K7A A;  3S8P A;  1W5S A;  3WG9 A;  4HQE A;  1VQL I;  2DU9 A;  3IH3 A;  4EJO A;  3CLQ A;  3OYG A;  2V6C A;  2X48 A;  5IT3 A;  3T8T A;  1QNT A;  1LDJ A;  3K4N A;  4RGR A;  1L0O C;  4Y15 A;  3MFK A;  1JXS A;  1D3Y A;  3W3C A;  5D4S A;  1C0W A;  5B5E C;  2OTL I;  2UXN A;  3DBR B;  3C2B A;  1X1D A;  5FLX Z;  3QYE A;  4AIK A;  2RNJ A;  3K4C A;  2F5D A;  2QCO A;  1ZAR A;  1UG2 A;  4YFN F;  4XLA A;  3MCZ A;  3QOE A;  2XHK A;  3K10 A;  3I4N J;  4XKC A;  4DYR A;  3ZN0 A;  2VC0 A;  1JKR C;  2IPQ X;  2O03 A;  3W6J B;  4ZJZ A;  1R36 A;  4HNV A;  1IGN A;  3M8E A;  3AG3 H;  4B1R A;  2HTJ A;  2DA7 A;  3F23 A;  2WBM A;  4HNU A;  4FAS D;  3KP2 A;  3MMY B;  3ZMT A;  4D5C A;  3RI4 A;  3RKY A;  4HA8 A;  3OOU A;  1XGN A;  3RJP A;  1HA8 A;  3Q0W A;  1DP7 P;  2OJE D;  1G6N A;  3C18 A;  1XCV A;  1Z6R A;  2IS6 A;  4IHW A;  3EYI A;  1X19 A;  3L00 A;  5ICE A;  4GRI A;  2V9P A;  2LY2 A;  5D5X B;  1MND A;  1U6G A;  5F64 A;  4HDU A;  3QPH A;  4A69 C;  2HPM A;  3ROU A;  1FP2 A;  4RB1 A;  3BZ6 A;  2L9V A;  1R22 A;  3E6B A;  2M1B A;  4E4H A;  4EM1 A;  1BJZ A;  3OYC A;  2R5Z B;  2BBY A;  2OTJ I;  1O3R A;  3MKL A;  3VSL A;  4FX4 A;  5FKO A;  2EWN A;  1YW8 A;  4A93 J;  3ZCO A;  3QPS A;  4HV6 A;  2P0W A;  4DYC A;  2MH9 A;  2XB5 A;  4CZZ A;  4A5N A;  3GLL A;  3L2C A;  4EJT A;  2XPW A;  3QRF F;  2JA8 J;  1AWC A;  1WGX A;  3PJR A;  3CP8 A;  2E2I J;  5C4X J;  2NS7 A;  1SAX A;  2DDA A;  4DZP A;  5F08 A;  1XN7 A;  2Q8K A;  4CGZ A;  5E3M A;  2O3F A;  2VL8 A;  4L5J A;  1LDK B;  1IN4 A;  1O3Q A;  2CV2 A;  2M5W A;  3H9G A;  4XMY A;  3S93 A;  1YQA A;  2DA5 A;  2CW0 F;  5F27 A;  1DPR A;  2O7O A;  3L2V A;  2EZH A;  1T95 A;  4HSR A;  1FOX A;  2O6G E;  3MN2 A;  1IRZ A;  3TOA A;  1V5G A;  1AU7 A;  2K4J A;  1OCT C;  1ON2 A;  2VQG A;  4LJZ F;  5FLX K;  3FBI B;  2LBF B;  5HDK A;  3FBN B;  1ULY A;  4MLO A;  1IXC A;  2E7X A;  1Z05 A;  2HVQ A;  3GW2 A;  4GDF A;  3S15 J;  5E3L A;  3G6E I;  2EFQ A;  3M1E A;  5FD5 A;  1R49 A;  1MJ9 A;  4NQW A;  1R71 A;  1FT9 A;  3DPT A;  1D5V A;  2HYF A;  1SD5 A;  4QPQ A;  3LSM A;  1U5T A;  3CJR B;  4MNU A;  4GYI A;  2K40 A;  3M3Y J;  2FA5 A;  1KU3 A;  3UKG A;  2M87 A;  2HYJ A;  1RRJ A;  4ZH4 F;  3W6V A;  3GME A;  1I6X A;  3OMY A;  3RKQ A;  4S05 A;  2QKL B;  2LKP A;  2ZC2 A;  3TO9 A;  1X2N A;  1QZZ A;  2CS3 A;  2EPF A;  1QO0 D;  4HAM A;  1VI0 A;  3HOV J;  4ZTJ A;  1O3T A;  1GHC A;  2MLG A;  3K70 C;  2K27 A;  1T0F C;  1H88 C;  1Y56 A;  1U9O A;  1UB9 A;  3GWZ A;  1LEA A;  1IN5 A;  1MMD A;  2AXT C;  1FWZ A;  1HKQ A;  2E2H J;  2O8X A;  1A35 A;  2VKE A;  4LOC A;  3HIF A;  3JTG A;  3ZQ7 A;  2UWM A;  3AG1 H;  3VYS B;  3DLL F;  2V1N A;  3RCO A;  3ABU A;  1ETX A;  4M9Z A;  2HOA A;  2P7C B;  3GEZ A;  4WF2 A;  5H20 A;  2KIQ A;  4AU7 A;  3HJE A;  4U87 A;  4RB2 C;  2L2O A;  4AD9 A;  2VJI A;  2LP0 A;  3U2R A;  2K86 A;  2LK2 A;  3F21 A;  1JGS A;  2ZSH B;  3TKY A;  1P92 A;  4RGU A;  2CQQ A;  2OAZ A;  3W2A A;  2R7X A;  3RPU D;  1U8R A;  1R7J A;  2NAZ A;  3FM5 A;  3LAP A;  2ZXI A;  2KL4 A;  4MEY F;  6PAX A;  1ZG5 A;  4QPO A;  3KE2 A;  3HUG A;  1XG1 A;  1H9T A;  2HXI A;  3DTK A;  1S29 A;  3ECO A;  4O3M A;  1MKM A;  2CW8 A;  3DWL E;  5EGO B;  1UG0 A;  1E2X A;  3H3U A;  5E1Z B;  1YW7 A;  3ZQL A;  1TWG J;  4YEJ A;  1J09 A;  4HZF A;  2YUS A;  3CLO A;  4EM0 B;  2CUE A;  2ADU A;  4DOZ A;  3ZXS A;  2ID3 A;  5EZG A;  2V6E A;  2K5C A;  1IN8 A;  2DFI A;  3GZN B;  2QQ9 A;  1A31 A;  4HV5 A;  4JX5 A;  2DA2 A;  4FHT A;  1RKW A;  1WJC A;  4MQ9 F;  4FCY A;  3FKI J;  2RQP A;  3HHG A;  5C3E J;  4A3C J;  4JBA A;  3D5L A;  2IA2 A;  4F52 A;  2GA1 A;  5ILV A;  2DJN A;  3ZMS A;  1WCM J;  1ONV A;  2XRN A;  5FKK A;  4CO8 A;  3BQZ A;  4E6K G;  2R7T A;  1S9H A;  2F4O B;  2CV1 A;  2BW3 A;  3SFI A;  3BZK A;  1YHQ I;  1R5H A;  3OYB A;  3WE2 A;  1X1C A;  4QTR A;  2IEK A;  4MFE A;  1LDD A;  1JHH A;  3QU3 A;  5A2Q K;  3MKY B;  2HOE A;  2HDD A;  3Q5F A;  1X3Z B;  5LHH A;  4BH9 A;  2JRM A;  3CJT B;  3W2V A;  4TV7 A;  3J7Y J;  2M4K A;  1T56 A;  2G9W A;  2KDZ A;  5DCM A;  2W85 A;  1ZYR F;  2ZKZ A;  4XKW A;  4RDU A;  4HBL A;  4Q4Z F;  1HXD A;  3IAM 2;  2IVM A;  4LG0 A;  9ANT A;  3BR3 A;  2FNA A;  2CMP A;  2Y2Z A;  4EAT A;  5DUI A;  4XK4 A;  4CYC A;  3JTH A;  1RR8 C;  2JVG A;  1J5Y A;  2JRT A;  3BP8 A;  3ONQ A;  3RDI A;  4CCJ A;  3OOP A;  4S0H B;  1FMW A;  2Z99 A;  4BQN A;  2GXA A;  1XPX A;  1NG6 A;  1IN7 A;  1PUF B;  2RKH A;  3BRO A;  3F8B A;  3TP3 A;  3L2W A;  2QBY A;  2M2E A;  2R7O A;  4XRS G;  3EYY A;  3S3M A;  1W7P A;  2WC2 A;  4MHG A;  3H1C A;  2QWW A;  3PQJ A;  4J19 A;  1DPU A;  1O4X A;  5B1B H;  1PUE E;  1Z0X A;  3LFU A;  3RYP A;  1YYV A;  2VE9 A;  3MKW B;  2DOA A;  2JA7 J;  3OYJ A;  4N4N B;  2JN6 A;  3FMS A;  3BTL A;  4A12 A;  1WJF A;  4PZJ A;  5FFX A;  5BNG A;  4KDP A;  4FE7 A;  2ECC A;  4D0P A;  2MD5 A;  1XDU A;  4BS9 A;  1EJ9 A;  3Q3S A;  4BQA A;  4AYB A;  2M4G A;  3PL8 A;  4L5E A;  1SFX A;  2EFO A;  2MAB A;  4PJ0 C;  3W2W A;  1ZH5 A;  1LE8 B;  2R7S A;  3OL3 A;  2XGD A;  4ZTF A;  3KP5 A;  1K4T A;  4NBQ A;  4LG3 A;  3RYR A;  3HOZ J;  1VQK I;  3QP5 A;  1D1C A;  3TP0 A;  4HYE A;  1KQ0 A;  3KEO A;  2A6E F;  2E35 A;  4C30 A;  5EF6 A;  1Z1D A;  3TW7 A;  1PYV A;  5L3D A;  5HOO A;  4XRF A;  4L0Z B;  2OD5 A;  1UEL B;  1T2K A;  2OQG A;  4IHV A;  2MH2 A;  1YE9 A;  5H2F C;  5LRS A;  3ZP5 A;  2CUZ A;  1SEU A;  2FU4 A;  1UHM A;  4ESB A;  2VLA A;  2NVU B;  1S7A A;  3LNQ A;  3P9I A;  3IWF A;  4DBQ A;  4KA4 A;  1UHS A;  1J7K A;  5JI6 A;  3TW6 A;  2HWV A;  2XAG A;  4HF1 A;  5GAD J;  2XPU A;  5IYD J;  3K9T A;  1K6O A;  3FXM A;  2KT0 A;  3HKZ A;  4G12 A;  1OCR H;  2L7F P;  3HG9 A;  3PIO F;  2WB1 A;  2L7M P;  2DAO A;  3GLX A;  3KP3 A;  3PQK A;  3L7W A;  1ZHF A;  4UVA A;  1HSJ A;  5KK1 A;  1TW2 A;  1D0X A;  1D8K A;  4XRM A;  2ZJQ F;  1G2H A;  1RUO A;  5E3O A;  2F2E A;  1B6A A;  1YW9 A;  4RBO A;  5J4Y A;  2R5Z A;  2QLZ A;  4RLQ A;  2XGE A;  3HOW J;  2ZBK A;  5K7F A;  1ON1 A;  1Z3Y A;  3HEF A;  1WRJ A;  2ELH A;  2DA3 A;  4U7D A;  4NNJ A;  1YX3 A;  2P6T A;  1BC7 C;  4CUG A;  1X3W B;  3BTJ A;  4G7Z F;  4XL9 A;  2XPV A;  3NRV A;  1GLN A;  3EUH C;  2M7B A;  4C2M J;  1XC5 A;  2QF7 A;  1VQ5 I;  1B4A A;  1T8I A;  3HSR A;  2ZXJ A;  3TL4 X;  1S72 I;  1IDY A;  2P6S A;  2V9V A;  2KIU A;  1MSE C;  1LFU P;  4HX8 A;  3K1M A;  2H09 A;  3G1O A;  4ENN A;  3D0S A;  4BJ5 C;  5E3N A;  4P9F A;  4ENJ A;  1HW5 A;  3I56 I;  5FO5 A;  3RTR A;  1XB4 A;  2L7Z A;  3RSN A;  5E1W A;  1Y8R B;  1XCB A;  1LKX A;  1R4M B;  1NHA A;  3GX4 X;  2FD5 A;  4B4C A;  3SFZ A;  1H0M A;  2VN2 A;  1OYW A;  4XKV A;  2LBF A;  2KP6 A;  2LKS A;  3VYT B;  4ZDP A;  3H92 A;  3JCU C;  3E3V A;  3GUD A;  4BKX A;  2W24 A;  3TO7 A;  3U1D A;  4FIS A;  4FE4 A;  4BGD A;  3ML6 A;  2STW A;  4YG2 F;  2AS5 F;  1Z91 A;  4P5O A;  1BIB A;  2MSY A;  4O5V A;  5CVU A;  3HRU A;  4EEF G;  4HG2 A;  5D4R A;  2FF4 A;  1G8X A;  5D6F A;  2X0L A;  4LFU A;  1TWH J;  5K5O A;  3TMO A;  2VT3 A;  5CKT A;  1QHH D;  2BEO A;  2HQN A;  2NVX J;  3S1M J;  3E97 A;  2QZ8 A;  4RGX A;  3HBL A;  1SFU A;  3ASN H;  4M6X A;  2HQR A;  4Z6Y A;  1XDS A;  4P1W A;  2RV8 A;  5CVV A;  2VXZ A;  2J5O A;  4N0B A;  4IOA F;  1NK2 P;  1IV8 A;  5BOX A;  5K7H A;  3B6C A;  4OIN F;  3VDX A;  3JSO A;  1O3S A;  4JX6 A;  4ZDL A;  3E5X A;  2ZB9 A;  2UXX A;  4F7Z A;  2CV0 A;  3KP7 A;  2QEX I;  1IZ1 A;  2KZG A;  2R7U A;  2AQF A;  2FUG 2;  2ZSI B;  1MJA A;  2JT1 A;  1ZAO A;  4R79 A;  1FIP A;  1X4P A;  1Y1W J;  3HPH A;  1ITY A;  2DTR A;  1F9N A;  2L0K A;  4XN3 A;  2R0Q C;  1EF4 A;  3HRS A;  4DIQ A;  1WQ2 A;  4ZZL A;  2IGN A;  1SD7 A;  1ZRF A;  3LQQ A;  1E3H A;  5J1Y A;  4A3L J;  4M9X A;  4BJ6 C;  4AM3 A;  5FRO A;  3K4J A;  3GZ6 A;  2HTS A;  3R0A A;  4ESJ A;  3BR1 A;  3G2B A;  3HUG B;  3J81 Z;  3LSR A;  1LUJ B;  1V3F A;  4RAF A;  5EGO A;  1P7J A;  1WVR A;  1S6L A;  3F8F A;  5KHD A;  4XM3 A;  4ESF A;  1OR7 A;  1O57 A;  3KYC B;  2WY8 Q;  1T39 A;  2IGO A;  4HDV A;  1HC8 A;  2Q0O A;  1OCO H;  2GXG A;  4XLN F;  1STZ A;  4M71 A;  2I10 A;  2L5Q A;  3F8C A;  3CMM A;  4A3I J;  4G6Q A;  1JUP A;  3SEQ A;  3W6K B;  2V7F A;  3GVA A;  3OSG A;  2MG4 A;  2L9S A;  2IS2 A;  4WXC A;  1OKR A;  2BV6 A;  2RGV A;  1Y8Q B;  2NVQ J;  2IW5 A;  1BI1 A;  2LMD A;  3DPU A;  4B3A A;  3OYE A;  2VJJ A;  1Z3X A;  1JKP C;  3WTZ A;  3E7L A;  3F8N A;  2DI3 A;  4LLG F;  1N77 A;  2BYV E;  3HDD A;  3MKZ A;  3OWT A;  4PDK A;  3HOX J;  2H27 A;  2RQQ A;  2DT7 B;  2COB A;  4M9S A;  4U0W A;  2HR3 A;  1BA5 A;  2W82 A;  4UV8 A;  5HDG A;  4XQF A;  3DU6 A;  2BVL A;  4V2G A;  2Y0S A;  4EGY A;  1TWC J;  2E36 A;  5TRD A;  1B72 B;  2C6Y A;  2BOL A;  1ZKG A;  2X6Y A;  2LY9 A;  1QRY A;  1PVE A;  1OIS A;  1D5Y A;  2A05 A;  1VTN C;  1IRX A;  3L1P A;  2R7R A;  3O3K A;  5DCM B;  3ZQQ A;  1PP7 U;  4KIC A;  2F4M B;  2FRH A;  1EH8 A;  4XOT A;  1U3E M;  3BPX A;  4IJA A;  1XMK A;  3CO7 C;  4B47 A;  1FSH A;  3DXJ F;  3WTV C;  3CD6 I;  2JTV A;  2W00 A;  2ZME A;  2HI3 A;  1RC9 A;  2JSC A;  5L3E A;  3Q0U A;  1HKS A;  1FEX A;  1YG2 A;  1PUF A;  2PI0 A;  1XGM A;  2KQR A;  5FKL A;  3DLA A;  4XNF A;  3O8H A;  4CCN A;  1MBF A;  4CIC A;  4LIT A;  4ITV A;  4GGG A;  3J81 K;  4M3E A;  1EA3 A;  2VAS A;  4CSW A;  2ECB A;  4HNT A;  1BI3 A;  1O7F A;  4M72 A;  1YRN B;  3ZMD A;  2JMW A;  1F5T A;  5F0H A;  5ICG A;  1FSE A;  3L2R A;  5LLQ A;  2E19 A;  3Q9S A;  1HF0 A;  1Y6I A;  3K4M A;  3S1R J;  2MC3 A;  3MEX A;  2HOT A;  2XAF A;  4P9U A;  1ODD A;  1YIJ I;  1KU7 A;  2QSH X;  1D0Z A;  3K70 D;  2ESN A;  1TT5 B;  1FBQ A;  2X1D A;  3ESW B;  3WTT C;  3ZQC A;  3S3N A;  5C4J J;  2R3S A;  2FE3 A;  3PM1 A;  4I0A A;  4A6D A;  1WZ2 A;  2Z5U A;  2XKP A;  1LE8 A;  4PFP A;  2X1C A;  1OYY A;  3CDL A;  4GYG A;  1UST A;  3CCY A;  4HF0 A;  1NK3 P;  4G7O F;  5LHG A;  2DTZ A;  3DKX A;  3E1S A;  5EEG A;  1W36 C;  2HOS A;  4A3G J;  3H35 A;  3OYH A;  3JRC A;  5LFA A;  2VB6 A;  1ORK A;  3IKV A;  1F4K A;  1KYZ A;  1M1E B;  1ZG3 A;  2XDV A;  3BQY A;  2VUM J;  3T8R A;  5E17 F;  2EV5 A;  3C2H A;  1ACI A;  3CCU I;  2XUB A;  4RGS A;  2IAI A;  3QYB A;  4QWQ A;  4ZYA A;  3DQV C;  4E7L A;  4YII A;  2V1U A;  4GCV A;  5CQE A;  5D6E A;  4KMF A;  2FX0 A;  4LK0 F;  4LK1 F;  5CYV A;  4LIU A;  4EJU A;  2LR8 A;  2MC4 A;  2DA1 A;  2ZFW A;  4UXN A;  5F6F A;  4AID A;  1ZR4 A;  4N4O B;  3DTI A;  5GAE J;  5IY5 H;  2DDB A;  3CMY A;  1K4S A;  1JJ8 C;  4AIH A;  2OUM A;  1G59 A;  3MD2 A;  3S2D J;  3IAS 2;  4L18 B;  2GWR A;  3ELK A;  4MTE A;  1I50 J;  3BZC A;  1O7L A;  1XX5 A;  2ZME C;  1Q1H A;  2HZD A;  2Z16 A;  1KQ9 A;  3H5A A;  4BY1 J;  2P81 A;  1J2X A;  4L9N A;  1T0F A;  1MSF C;  1JJ6 C;  2M34 A;  2Y9Y A;  1R58 A;  2G7U A;  3JSP A;  5E8I A;  3WTW C;  4PUS A;  2NS8 A;  1B1B A;  1MMN A;  3CDH A;  3TBI A;  3L2Q A;  2H6C A;  1Z7U A;  1S7O A;  2HXO A;  2VBZ A;  4C9Y A;  3R60 A;  2QVO A;  2QSF X;  4I09 A;  4ZYH A;  1H8A C;  3DEU A;  3UR3 C;  1ZRE A;  3ZR8 X;  5HLI A;  3I71 A;  4WXH A;  3HGY A;  2M0C A;  4OIQ F;  4BXX J;  4BE0 A;  2LVS A;  4C2U A;  4I76 A;  3CP2 A;  4Y7N J;  1DGR M;  3CJN A;  3KZY A;  1Z67 A;  2R7W A;  4IQJ A;  4HLX A;  3CCQ I;  1B9N A;  2W4S A;  4YIF A;  1XS9 A;  1U78 A;  2GIZ A;  3CCV I;  3WGI A;  5F1R A;  3S1Q J;  4HST A;  2PJR A;  2DXI A;  2KDO A;  1VQP I;  4F92 B;  2M30 A;  5KAI C;  1MJB A;  1SFE A;  3ZMU A;  4D9J A;  4IHS A;  1YTY A;  1DQU A;  5FKM A;  5LGN A;  1GXQ A;  3BCB A;  3X2Q H;  5J1R A;  4KUM A;  5IP6 A;  2DK8 A;  4P55 A;  1K78 A;  2VQH A;  1Z77 A;  1TQI A;  3LFK A;  2R7D A;  3CCL I;  4II2 A;  2DOD A;  2X6O A;  4FT8 A;  2ZCW A;  2ZJP F;  1Z7L A;  2FQ4 A;  1UZC A;  4XKB A;  2VKD A;  4UUS B;  3C7J A;  4LD5 A;  5E79 C;  2QEN A;  4I2O A;  4MQV A;  2LF7 A;  3CF2 A;  3A4C A;  3IP4 B;  3GYH X;  2EIN H;  5KVR A;  5AON A;  1H9G A;  3GFJ A;  4P96 A;  2E1N A;  2VC1 A;  5A2Q Z;  1U9N A;  3S17 J;  4KFC A;  1IJW C;  1FOW A;  1IRF A;  5D5V B;  3KYL A;  3OIP A;  2BXZ A;  1AA7 A;  2EZK A;  1TWF J;  3BLY A;  5M5W J;  2M8E A;  3A1Y A;  4E7J A;  2STT A;  3KEY A;  3O2P E;  5J8F A;  1YFH A;  1S5L C;  2VBW A;  4ZC3 A;  2HVR A;  2KIS A;  4MEX F;  1K6Y A;  3HYI A;  5EYR A;  4B43 A;  2ISZ A;  3JRI A;  3RZO J;  2A61 A;  2MA3 A;  2VON A;  2DMN A;  2CFX A;  2CQ7 A;  3F6O A;  5B3S H;  5M3F J;  1RUN A;  2B7E A;  3U21 A;  5BPI A;  2RNG A;  5J40 A;  4GXO A;  3DTE A;  3HRM A;  4WWC A;  2K9Q A;  1GV5 A;  2XF7 A;  2EBI A;  3LSJ A;  2UUZ A;  1ZN2 A;  3Q9V A;  3QAH A;  3LAJ A;  2F48 A;  4BXF A;  3OYI A;  2K9N A;  1TNS A;  2IXS A;  3PUF A;  4G6T B;  1W0T A;  1REP C;  2KFD A;  3REO A;  2W57 A;  1MDM A;  1K61 A;  1I39 A;  3H5N A;  5ICC A;  4CZC A;  3HZJ A;  1LFP A;  1Q1V A;  2CG4 A;  3EUA A;  3ZMZ A;  4EV0 A;  5D8L B;  2QSG X;  3E0J B;  2MW8 A;  3F3X A;  2K4B A;  1LQ1 A;  2DYR H;  1G3T A;  1DGW Y;  3FDY A;  4LLL A;  1FJL A;  3CUO A;  1N75 A;  3ZQH A;  1W7P D;  1HW1 A;  2VT2 A;  2IT0 A;  2M3A A;  1RR7 A;  5B66 C;  3AL0 C;  4UNO A;  2LY1 A;  2F5E A;  4RMN A;  3T5X A;  2F5F A;  2UV1 A;  4KIF A;  2J5P A;  2JVH A;  2OZ6 A;  2HU9 A;  4RB3 C;  5JVG F;  2R93 J;  1YLF A;  2KHM A;  1A6I A;  3PNY A;  1R4N B;  2IRF G;  5JFR A;  5B1A H;  3VYR B;  1B72 A;  4Z2Y A;  4LLN A;  2AQE A;  4HX4 A;  4BE2 A;  1ZG1 A;  2LLK A;  3K4K A;  2IJL A;  2PBI A;  1X2M A;  2EIM H;  1P4X A;  1A6Q A;  2D1H A;  2HYG D;  3GFM A;  2ZNY A;  2MFZ A;  3L9F A;  3N05 A;  1TW3 A;  2KIM A;  5K1Y A;  1USS A;  2NOG A;  5HOD A;  2Y48 A;  1G4D A;  1OCZ H;  2W1O A;  1POG A;  2PJP A;  1JHF A;  3M8J A;  1OPC A;  2D5V A;  3GTG J;  4IL6 C;  3G4S I;  1QHG A;  4XBF A;  1DDN A;  1NTC A;  1I6H J;  4FQG A;  3O8G A;  1R23 A;  2DBB A;  4EVI A;  4QLC U;  2ZME B;  4CCM A;  3OYD A;  3I4M J;  3PSF A;  3VEP A;  4DQ2 A;  1X1P A;  2EIK H;  4YFX F;  4MTD A;  2RVC A;  3FIW A;  4LGW A;  4MGR A;  2DCE A;  1D0Y A;  3V7S A;  4IO9 F;  4M73 A;  2FMY A;  5HLH A;  2AXL A;  4NC6 A;  3G1M A;  1SMY F;  4XOR A;  4A3F J;  2XSD C;  1YRN A;  4KT6 A;  5E20 A;  3H0G J;  5HDN A;  3GFL A;  4IVN A;  4M6Y A;  3KPH A;  4YEL A;  2A07 F;  2LFB A;  3EUH A;  1MMG A;  1ZLJ A;  4DJA A;  5JLW A;  1QBJ A;  5GPC A;  1VF9 A;  3FXK A;  1MNM C;  3BCA A;  4IRG A;  1MD0 A;  3WHB A;  3OY9 A;  3QQA A;  2BY3 A;  2CGP A;  5DEQ A;  4AYB N;  1SVO A;  4F91 B;  4PK4 A;  4A3J J;  2H1K A;  3CC2 I;  1V54 H;  1G3Y A;  2E2J J;  1FTZ A;  3JRA A;  5KCM A;  1T38 A;  2VKV A;  3SHF A;  2V1X A;  3A02 A;  4G8X A;  1Z6T A;  3C3W A;  1BJA A;  3SYT A;  4I6Z A;  1X4O A;  3E6M A;  4Y33 A;  2BHY A;  1SAN A;  3FIS A;  3DKW A;  2XC7 A;  1X58 A;  5EDN A;  4F3Q A;  3GFI A;  3V4G A;  3ZPL A;  1SC7 A;  3TED A;  5DYM A;  1P9Q C;  4EQQ A;  1T98 A;  2OPT A;  3BG3 A;  2L3D A;  2FSW A;  3SZT A;  1V5E A;  2FJ1 A;  1HKT A;  4AIJ A;  2IBD A;  2M45 A;  2ZXH A;  4OWR B;  1LEB A;  3VPR A;  4KMU X;  1N78 A;  1IUF A;  1TWA J;  3IC7 A;  5HLT A;  4I01 A;  2WWY A;  1Z9C A;  1I1G A;  4N9I A;  5LGU A;  1ERD A;  2EA2 A;  4CH7 A;  4NC8 A;  4D1Q A;  1YIT I;  2DQR A;  2Z3Y A;  5E8G A;  4A2U A;  2MLK A;  1KA8 A;  1OCP A;  3PO2 J;  3LSG A;  3LOC A;  1JUM A;  3WGG A;  1BBY A;  3IKT A;  3HKZ N;  2WB1 N;  1KU9 A;  4I98 B;  2NRA C;  3BG9 A;  2DOF A;  2L54 A;  3KX2 A;  1FOK A;  1YO5 C;  4XID A;  2XAS A;  1ETV A;  4E70 A;  3QP6 A;  4HRI A;  3DKY A;  4O6J A;  4EGZ A;  1DU6 A;  1IW7 F;  2OA4 A;  3LST A;  1FPQ A;  2G0E A;  2Y69 H;  1KGS A;  1QVU A;  2X9D A;  3S32 A;  1P7I A;  1WFX A;  3SXY A;  2DPU A;  3FKJ A;  3JAM Z;  4E7Z A;  3I58 A;  1ZLK A;  3OL4 A;  4G94 A;  2EIL H;  5HVQ C;  2ZFU A;  1WSU A;  2O9L A;  1TBX A;  3JRG A;  3JW4 A;  1GVD A;  4R8H A;  1GXP A;  3CF5 F;  2KKO A;  1R00 A;  1Y1V J;  2RC4 A;  3B6A A;  3V42 A;  2BHZ A;  1MBJ A;  3H5R A;  4D5F A;  3H3V K;  3HPG A;  2XSJ C;  5KNL A;  3LSI A;  5F0C A;  4KJZ A;  3HOS A;  3P7N A;  1OLT A;  3IWZ A;  4B3X A;  3J7Z I;  4IRI A;  2PJR B;  2ME0 A;  5ICF A;  2YSR A;  2X6W A;  4KIB A;  3GTK J;  2JWT A;  3VOD A;  4NHJ A;  4AUX A;  1WH7 A;  4C3I J;  3K7A J;  3KP4 A;  1D1B A;  2EV0 A;  3ZMV A;  5FB2 A;  5DM7 F;  3QPL A;  4OOI A;  3ISP A;  3LL7 A;  4QIW N;  5AIQ A;  1MBG A;  5L3C A;  1K78 B;  2R7V A;  3G3Z A;  2LNB A;  1TT0 A;  2F4I A;  5FRM A;  1VQN I;  5K5Q A;  3AL0 B;  3NAU A;  4A0X A;  3WTS C;  4CCO A;  4Y17 A;  2Z1D A;  1MZB A;  1A5J A;  4RS8 A;  3ZN1 A;  3GCM A;  3IV5 A;  1BW5 A;  1FLI A;  5J3L A;  3WOD F;  5BQT A;  5DS9 A;  4UUS A;  1GVJ A;  3IRQ A;  3A2K A;  3QPT A;  5M3M J;  3CUQ C;  5IP7 J;  3DFG A;  2PFB A;  5K7Z A;  3LQR A;  1S7E A;  3CCR I;  4BHC A;  1ZR2 A;  2O5R A;  2XB0 X;  1IF1 A;  5M5X J;  2GZW A;  2WA0 A;  2VI6 A;  3OV8 A;  1FYM A;  1W4M A;  1RIO H;  5IPA A;  2JSP A;  5H6R A;  1SD6 A;  2L4M A;  2HEO A;  1T33 A;  2PQ8 A;  3HOT A;  2Q1Z B;  3HHH A;  1ENH A;  2I8D A;  2DMP A;  3WTY C;  1OQY A;  1WI9 A;  1Y0U A;  5GAG J;  1GT0 C;  4HF2 A;  2O61 A;  3RZD J;  1IXR C;  1Y39 A;  1I5Z A;  3E5U A;  3U9G A;  3JR9 A;  3JAM K;  4BEH B;  4V2F A;  1KU2 A;  4EJV A;  5JVT A;  2EH3 A;  5LD2 C;  3MAJ A;  1E0E A;  4XLP F;  4DBR A;  1HLV A;  3I54 A;  3I5U A;  3R61 A;  4I7H A;  3N4M A;  1Y0N A;  3V8J A;  2ME6 A;  2HS5 A;  2Q2E B;  2BY1 A;  3H3Z A;  3OYF A;  1J75 A;  1J0R A;  3ABM H;  2XF5 A;  2W25 A;  4BL0 B;  1BW6 A;  1JKO C;  2CQK A;  1SD4 A;  2MBF A;  1VND A;  3NWS A;  3KLO A;  3HOU J;  1R9T J;  3HL2 A;  1R1T A;  4U0Y A;  3FMQ A;  4E7I A;  1FTT A;  5D5W B;  3HTU A;  1KYW A;  4IX7 A;  1FYK A;  1RET A;  3I64 A;  3JRF A;  1MDM B;  1AKH A;  1HCR A;  4UB8 C;  2FXA A;  3I0T A;  2A6T A;  5FLM J;  3OYM A;  2XGX A;  3TDU C;  2EA4 A;  1A04 A;  2WV0 A;  3LSK A;  5HLG A;  1IUY A;  2OBP A;  4E7S A;  5CQG A;  1LB2 A;  1EH7 A;  4M3B A;  2LD5 A;  4A0Y A;  4BY7 J;  3IUO A;  1W5C C;  3CDI A;  2M8G X;  1TC3 C;  4LMY A;  4BHP A;  1AOY A;  1EV7 A;  2QGU A;  1KZH A;  2M9H A;  2E71 A;  2V1D A;  1UMQ A;  2R7Q A;  3KEQ A;  4U88 A;  2CQN A;  1SVM A;  2CWE A;  3F22 A;  1B8I B;  1FC3 A;  1EKE A;  2OV7 A;  2VIX A;  2H1L A;  3RIR A;  5HNF A;  4XIC A;  2Y0S N;  3WTU C;  3VSK A;  2VOP A;  2QUF A;  5GAH J;  2VJ5 A;  1BR4 A;  2WAE A;  1KON A;  1P6R A;  2KIF A;  2GLO A;  4PGG A;  1IRG A;  5JHU A;  2P5K A;  2XRL A;  3KET A;  1JUS A;  2DN0 A;  1HOM A;  1WKM A;  1BOA A;  5DCF A;  1MMS A; 
#chains in the Genus database with same CATH homology
 3KCC A;  4OMY A;  2V79 A;  1I1S A;  1FX7 A;  1S3J A;  1ZGA A;  3K69 A;  2OQR A;  2LSO A;  1FZP B;  2A5Y B;  3FMR A;  1HW2 A;  1IAW A;  5BPD A;  3ERE D;  4L9J A;  3MZH A;  1DUX C;  4S04 A;  5J8C A;  4HLY A;  4UHT A;  4BYY A;  4AWX B;  4HOB A;  4CHU A;  2W84 A;  1U2W A;  2Z33 A;  2KJC A;  2VBX A;  4Q5S F;  2TDX A;  4ASN A;  4DNC A;  1LJ9 A;  5LEK A;  1OYI A;  5BS6 A;  2XRO A;  4L0Y B;  5DUK A;  4PGH A;  3EDP A;  5LHI A;  4OIP F;  1TQM A;  2A69 F;  2EV6 A;  5LEJ A;  1QGP A;  3QU6 A;  5ILU A;  1J59 A;  3K1N A;  2YU3 A;  3F8M A;  4NB5 A;  2BE5 F;  2FQ3 A;  3K1P A;  3CUQ B;  1ZRC A;  2XIG A;  5LBQ A;  2EJR A;  4G9Y A;  3P9C A;  3O6B B;  1X3U A;  3KZZ A;  3BPV A;  3IL2 A;  4UUV A;  1R5G A;  1XMA A;  4A5M A;  1HQC A;  4XSX F;  4IPA A;  1J9I A;  5L3F A;  2EFN A;  5DD4 A;  2HDC A;  3WTX C;  2DO7 A;  2EB7 A;  4IXA A;  3WGH A;  1XD7 A;  4N9H A;  1RNL A;  3LA3 A;  3R0J A;  2DQL A;  2ZO4 A;  3FXR A;  3FWE A;  3CTA A;  2OU2 A;  1TLH B;  5H6Q A;  3RPQ A;  3NEU A;  4HX7 A;  3WE3 A;  5E1X A;  3QOP A;  2A68 F;  4WX9 A;  1XGS A;  3KFW X;  3M8F A;  4JQF A;  2L02 A;  2ETH A;  5HS9 A;  2DPD A;  5CVI A;  1V4R A;  3K0L A;  2VE8 A;  1YS7 A;  3NQO A;  5AIP A;  5IT9 Z;  1IXS B;  1KQ8 A;  1P2F A;  2FBH A;  1L3L A;  2A3S A;  4U7B A;  3TOB A;  4I0B A;  3TGN A;  4EMS A;  4G7H F;  5HS7 A;  4FX0 A;  5J6X A;  5JR3 A;  2PG4 A;  4ZYD A;  3M7G A;  2BGC A;  2IA0 A;  2JPB A;  2VOO A;  5FGM A;  2ZNZ A;  4K2E A;  5EEH A;  1RI7 A;  5K5R A;  3DV8 A;  4KN4 X;  4PCQ A;  2CSO A;  3TDZ C;  1FBU A;  2FNP A;  1OMI A;  2YX4 A;  1XSV A;  2Q2E A;  1BIA A;  4KNY A;  2A6H F;  2HKX A;  4RB0 A;  3M9A A;  2L4A A;  4Y13 A;  2PEX A;  1EH6 A;  2GIV A;  5LRR A;  2K7L A;  2YR2 A;  2FBI A;  2LDU A;  3LA7 A;  4ENM A;  5DDG A;  3TQN A;  4B09 A;  2L01 A;  1SMT A;  1CGP A;  4KN7 X;  5IT9 K;  3GO5 A;  4ZZD A;  3F6V A;  4ON0 A;  3GZ5 A;  3DP7 A;  1FNN A;  3KLN A;  4HW0 A;  5BMZ A;  2DT5 A;  3BWG A;  1CF7 B;  4IRH A;  2QQA A;  3BJO A;  4OIR F;  2GA2 A;  1QPM A;  4GO1 A;  4BAY A;  1G3S A;  2HGC A;  1ZRD A;  2H94 A;  4BHB A;  4ENK A;  2VBY A;  1U5T C;  1F1Z A;  2QYO A;  4ZYE A;  3HRT A;  4CYD A;  2KRF A;  2PMH A;  2Y75 A;  4LB6 B;  3I59 B;  1JE8 A;  5LGT A;  2EFP A;  4Q48 A;  2YPR A;  1R1U A;  3BJA A;  3T0Y A;  1P4W A;  3E5Q A;  1IN6 A;  3RPU A;  5FFZ A;  3ULQ B;  3B73 A;  4Q47 A;  2XAJ A;  2D1V A;  3GXO A;  3F72 A;  1FP1 D;  3FF5 A;  2P8T A;  2CO5 A;  3AAF A;  3VOE A;  4KIG A;  4I02 A;  3LA2 A;  1E17 A;  3ECH A;  4RAZ A;  3I53 A;  1FBS A;  3E6C C;  4BNC A;  4OU0 A;  5D8K B;  2HZT A;  1MGT A;  2EK5 A;  3L09 A;  1K79 A;  3C1D A;  4YFK F;  4WK8 F;  5L3G A;  3HSE A;  2ISY A;  3MZY A;  2Y0M A;  5CVR A;  2DLL A;  1HBX G;  3BY6 A;  4HQM A;  5ERI A;  3T1B A;  4G6D A;  1QQI A;  2P5V A;  2ZJ2 A;  3CUQ A;  4L9V A;  4BXU A;  4WCG A;  4CXF A;  4R1H A;  3LWF A;  2QQB A;  2OZU A;  1BI2 A;  5DV5 A;  3WU0 A;  5CJ9 A;  5ILS A;  2PLY A;  2JZY A;  4LB5 A;  3RKX A;  2Z9O A;  2GQQ A;  3HTS B;  2HFH A;  2G7H A;  2RN7 A;  3K2Z A;  3BDD A;  2D45 A;  4H0E A;  2FOK A;  2ESH A;  4OIO F;  4UV9 A;  3G73 A;  2X4H A;  4KT5 C;  4UVB A;  5FD6 A;  1W5T A;  2CYY A;  3MQ0 A;  4XSZ F;  3DF8 A;  2QM3 A;  1T6S A;  2XAH A;  3FX3 A;  3CO6 C;  2COM A;  5ED4 A;  3EET A;  2R7F A;  3E6D A;  4ZYG A;  1TQP A;  3ABT A;  5CLS A;  3FM3 A;  4CDG A;  1ZGJ A;  2NNY A;  3EQL F;  1S8N A;  1B9M A;  4AVP A;  2NNN A;  2RDP A;  2IA1 A;  3J80 Z;  4IF4 A;  1QZY A;  2ACJ A;  2FML A;  1FY7 A;  4RAY A;  2GXB A;  4KYW A;  1UFM A;  2DW4 A;  1RZ4 A;  3FHZ A;  1U5T B;  3SQN A;  4A0Z A;  3FZV A;  2LF8 A;  1HST A;  5E18 F;  5TJJ A;  2UZK A;  2FBK A;  1B59 A;  2XKO A;  1XGO A;  3RKW A;  2H6B A;  1LNW A;  2K02 A;  3DPL C;  2P7V B;  2HKO A;  2VOD A;  3V7C A;  3P9K A;  3VB2 A;  1P4A A;  3FXQ A;  2P4W A;  1XSX A;  3S2W A;  2IP2 A;  3IHU A;  3MWM A;  3I4P A;  1TTY A;  3COA C;  1BC8 C;  3SZP A;  1BN5 A;  4UVC A;  2KJB A;  3N97 A;  1BM9 A;  1FYL A;  3BJ6 A;  1UCR A;  3J80 K;  1CF7 A;  3GF2 A;  3KP6 A;  5DD8 A;  4M74 A;  5CVJ A;  5L3B A;  3B02 A;  1YS6 A;  3FXU A;  1TNT A;  2DK5 A;  3R4K A;  4ETS A;  4L9T A;  2E1C A;  2EFW A;  4WXD A;  4JK1 X;  2XV4 S;  3VFZ A;  3I59 A;  3TO6 A;  4OMZ A;  1D8J A;  1UHW A;  3R6S A;  2FEZ A;  3V7R A;  1PDN C;  1G3W A;  2JPC A;  4LG0 B;  3BOQ A;  4IHT A;  2E7W A;  4U0V A;  1XSD A;  2P5L C;  2QBY B;  5HS8 A;  2B0L A;  1W7P B;  1PP8 F;  3J7A O;  2F5C A;  4B8X A;  3IRR A;  4EJW A;  2NYX A;  1LVA A;  5D5U B;  1WWX A;  2WTE A;  3HSF A;  2O0Y A;  3V8K A;  2PMU A;  3PFI A;  1I27 A;  3V8L A;  2YX7 A;  1BI0 A;  2PN6 A;  4EM2 A;  2NS0 A;  3WU1 B;  2XVC A;  2D2W A;  4A6E A;  2XAQ A;  1YIO A;  4L5I A;  2GAU A;  1R1V A;  1K7A A;  1W5S A;  3WG9 A;  4HQE A;  2DU9 A;  4EJO A;  2V6C A;  5IT3 A;  3T8T A;  1QNT A;  1LDJ A;  4RGR A;  1L0O C;  4Y15 A;  3MFK A;  1JXS A;  1D3Y A;  5D4S A;  1C0W A;  2UXN A;  5FLX Z;  4AIK A;  2RNJ A;  2F5D A;  1ZAR A;  4YFN F;  3MCZ A;  2XHK A;  3ZN0 A;  2VC0 A;  2IPQ X;  2O03 A;  3W6J B;  1R36 A;  3M8E A;  2HTJ A;  3F23 A;  3KP2 A;  3ZMT A;  3RI4 A;  3RKY A;  4HA8 A;  1XGN A;  3RJP A;  1DP7 P;  1G6N A;  3C18 A;  1XCV A;  1Z6R A;  3EYI A;  3L00 A;  5ICE A;  5D5X B;  1U6G A;  5F64 A;  4HDU A;  3QPH A;  3ROU A;  1FP2 A;  4RB1 A;  3BZ6 A;  1R22 A;  3E6B A;  2M1B A;  4EM1 A;  2BBY A;  1O3R A;  4FX4 A;  2EWN A;  1YW8 A;  4HV6 A;  2MH9 A;  4CZZ A;  4A5N A;  3L2C A;  4EJT A;  3QRF F;  1AWC A;  1SAX A;  1XN7 A;  2Q8K A;  4CGZ A;  2O3F A;  4L5J A;  1LDK B;  1IN4 A;  1O3Q A;  2M5W A;  1YQA A;  2CW0 F;  1DPR A;  2O6G E;  3TOA A;  2K4J A;  1ON2 A;  4LJZ F;  5FLX K;  5HDK A;  1ULY A;  1IXC A;  2E7X A;  1Z05 A;  3GW2 A;  2EFQ A;  3M1E A;  5FD5 A;  1MJ9 A;  4NQW A;  1FT9 A;  3DPT A;  1D5V A;  2HYF A;  1SD5 A;  1U5T A;  4MNU A;  4GYI A;  2FA5 A;  1KU3 A;  2M87 A;  4ZH4 F;  1I6X A;  4S05 A;  2LKP A;  3TO9 A;  1QZZ A;  1QO0 D;  4HAM A;  1GHC A;  1O3T A;  2MLG A;  2K27 A;  1UB9 A;  3GWZ A;  1LEA A;  1IN5 A;  1FWZ A;  1HKQ A;  2O8X A;  3HIF A;  3JTG A;  3ZQ7 A;  2UWM A;  3ABU A;  4M9Z A;  2P7C B;  3GEZ A;  4WF2 A;  5H20 A;  4RB2 C;  4AD9 A;  3U2R A;  3F21 A;  2K86 A;  1JGS A;  3TKY A;  1P92 A;  4RGU A;  2OAZ A;  1U8R A;  1R7J A;  2NAZ A;  3FM5 A;  3LAP A;  4MEY F;  6PAX A;  1ZG5 A;  3KE2 A;  3HUG A;  1H9T A;  1S29 A;  3ECO A;  4O3M A;  1MKM A;  1E2X A;  3H3U A;  5E1Z B;  1YW7 A;  4HZF A;  3CLO A;  4EM0 B;  2ADU A;  1IN8 A;  2DFI A;  2QQ9 A;  4HV5 A;  4FHT A;  4MQ9 F;  2RQP A;  3HHG A;  4JBA A;  2IA2 A;  3D5L A;  2GA1 A;  5ILV A;  3ZMS A;  1ONV A;  2XRN A;  4CO8 A;  1R5H A;  3WE2 A;  1LDD A;  1JHH A;  3QU3 A;  5A2Q K;  2HOE A;  3Q5F A;  5LHH A;  4BH9 A;  4TV7 A;  2G9W A;  5DCM A;  2W85 A;  1ZYR F;  2ZKZ A;  4HBL A;  4Q4Z F;  1HXD A;  2IVM A;  4LG0 A;  2FNA A;  5DUI A;  3JTH A;  3RDI A;  1J5Y A;  2JRT A;  3BP8 A;  3OOP A;  2Z99 A;  1IN7 A;  2RKH A;  3BRO A;  3F8B A;  2QBY A;  3EYY A;  1W7P A;  2WC2 A;  4MHG A;  2QWW A;  3PQJ A;  1DPU A;  1PUE E;  3RYP A;  1YYV A;  2VE9 A;  3FMS A;  4A12 A;  4PZJ A;  5FFX A;  4KDP A;  4D0P A;  2MD5 A;  1XDU A;  4BQA A;  1SFX A;  2EFO A;  1ZH5 A;  3KP5 A;  3RYR A;  3QP5 A;  4HYE A;  1KQ0 A;  3KEO A;  2A6E F;  1Z1D A;  5L3D A;  5HOO A;  4XRF A;  4L0Z B;  2OD5 A;  1T2K A;  2OQG A;  2MH2 A;  5LRS A;  3ZP5 A;  2FU4 A;  1UHM A;  4ESB A;  1S7A A;  3P9I A;  3IWF A;  4KA4 A;  1J7K A;  5JI6 A;  2HWV A;  2XAG A;  4HF1 A;  3K9T A;  1K6O A;  2DAO A;  3GLX A;  3KP3 A;  3PQK A;  3L7W A;  1ZHF A;  4UVA A;  1HSJ A;  5KK1 A;  1TW2 A;  1D8K A;  1RUO A;  2F2E A;  1B6A A;  1YW9 A;  2QLZ A;  2ZBK A;  1ON1 A;  1WRJ A;  2ELH A;  4U7D A;  2P6T A;  1BC7 C;  4G7Z F;  3NRV A;  1B4A A;  3HSR A;  2ZXJ A;  2P6S A;  2V9V A;  2KIU A;  4HX8 A;  3K1M A;  2H09 A;  4ENN A;  3D0S A;  4P9F A;  4ENJ A;  1HW5 A;  5FO5 A;  3RTR A;  1XB4 A;  5E1W A;  1XCB A;  1NHA A;  3GX4 X;  3SFZ A;  1H0M A;  2VN2 A;  1OYW A;  3H92 A;  3E3V A;  3GUD A;  2W24 A;  3TO7 A;  3U1D A;  3ML6 A;  2STW A;  4YG2 F;  2AS5 F;  1Z91 A;  4P5O A;  1BIB A;  4O5V A;  5CVU A;  3HRU A;  5D4R A;  2FF4 A;  5D6F A;  2X0L A;  4LFU A;  5K5O A;  2VT3 A;  2BEO A;  2HQN A;  3E97 A;  2QZ8 A;  4RGX A;  1SFU A;  4M6X A;  2HQR A;  1XDS A;  2RV8 A;  5CVV A;  2VXZ A;  2J5O A;  4N0B A;  5BOX A;  4OIN F;  3JSO A;  1O3S A;  3E5X A;  2UXX A;  4F7Z A;  3KP7 A;  1IZ1 A;  1MJA A;  2JT1 A;  1ZAO A;  4R79 A;  2DTR A;  1F9N A;  3HRS A;  1WQ2 A;  4ZZL A;  1SD7 A;  1ZRF A;  3LQQ A;  4M9X A;  3GZ6 A;  2HTS A;  3R0A A;  4ESJ A;  3J81 Z;  1V3F A;  1S6L A;  3F8F A;  4ESF A;  1OR7 A;  1O57 A;  1T39 A;  4HDV A;  2Q0O A;  2GXG A;  4XLN F;  1STZ A;  4M71 A;  3F8C A;  4G6Q A;  3W6K B;  3GVA A;  4WXC A;  1OKR A;  2BV6 A;  2RGV A;  2IW5 A;  1BI1 A;  3WTZ A;  3F8N A;  2DI3 A;  4LLG F;  2BYV E;  4PDK A;  2H27 A;  4M9S A;  4U0W A;  2HR3 A;  4UV8 A;  5HDG A;  4EGY A;  5TRD A;  2C6Y A;  1VTN C;  3O3K A;  5DCM B;  1PP7 U;  4KIC A;  2FRH A;  1EH8 A;  1U3E M;  3BPX A;  4IJA A;  1XMK A;  3CO7 C;  1FSH A;  3DXJ F;  3WTV C;  2JTV A;  2ZME A;  2JSC A;  5L3E A;  1HKS A;  1YG2 A;  2PI0 A;  1XGM A;  4CIC A;  4GGG A;  3J81 K;  1BI3 A;  1O7F A;  4M72 A;  3ZMD A;  1F5T A;  5ICG A;  1FSE A;  5LLQ A;  3Q9S A;  2MC3 A;  3MEX A;  2XAF A;  4P9U A;  1ODD A;  1KU7 A;  2ESN A;  1FBQ A;  3WTT C;  2R3S A;  2FE3 A;  4I0A A;  4A6D A;  2Z5U A;  2XKP A;  4GYG A;  1OYY A;  1UST A;  4HF0 A;  4G7O F;  5LHG A;  5EEG A;  3IKV A;  1F4K A;  1KYZ A;  1ZG3 A;  3T8R A;  5E17 F;  2EV5 A;  2XUB A;  4RGS A;  4QWQ A;  3DQV C;  2V1U A;  4YII A;  4KMF A;  4GCV A;  5D6E A;  4LK0 F;  4LK1 F;  5CYV A;  4EJU A;  2ZFW A;  4UXN A;  5F6F A;  4AIH A;  4L18 B;  2GWR A;  3ELK A;  4MTE A;  1O7L A;  1Q1H A;  1KQ9 A;  1J2X A;  4L9N A;  1T0F A;  1R58 A;  2G7U A;  3JSP A;  5E8I A;  3WTW C;  1B1B A;  3CDH A;  2H6C A;  1Z7U A;  1S7O A;  2VBZ A;  3R60 A;  2QVO A;  4I09 A;  4ZYH A;  3DEU A;  1ZRE A;  5HLI A;  3I71 A;  4WXH A;  4OIQ F;  3CJN A;  3KZY A;  4HLX A;  1B9N A;  1U78 A;  4YIF A;  3WGI A;  5F1R A;  2M30 A;  3ZMU A;  1MJB A;  1SFE A;  4IHS A;  1YTY A;  5LGN A;  1GXQ A;  4KUM A;  2DK8 A;  4P55 A;  1K78 A;  1TQI A;  3LFK A;  2R7D A;  4FT8 A;  2ZCW A;  3C7J A;  4LD5 A;  2QEN A;  4I2O A;  4MQV A;  2LF7 A;  3GYH X;  5KVR A;  5AON A;  1H9G A;  3GFJ A;  4P96 A;  2E1N A;  2VC1 A;  5A2Q Z;  4KFC A;  1IRF A;  5D5V B;  2M8E A;  2STT A;  3O2P E;  5J8F A;  1YFH A;  2VBW A;  4MEX F;  3HYI A;  2ISZ A;  2A61 A;  2MA3 A;  2VON A;  2CFX A;  3F6O A;  1RUN A;  5BPI A;  4GXO A;  3HRM A;  4WWC A;  1ZN2 A;  3Q9V A;  3QAH A;  3LAJ A;  1TNS A;  1REP C;  3REO A;  2W57 A;  1MDM A;  5ICC A;  2CG4 A;  3ZMZ A;  4EV0 A;  5D8L B;  3F3X A;  2K4B A;  1LQ1 A;  1G3T A;  4LLL A;  3CUO A;  1W7P D;  1HW1 A;  2VT2 A;  2IT0 A;  4UNO A;  2F5E A;  3T5X A;  2F5F A;  4KIF A;  2J5P A;  2OZ6 A;  4RB3 C;  1YLF A;  2IRF G;  5JFR A;  4Z2Y A;  4LLN A;  4HX4 A;  1ZG1 A;  2IJL A;  2PBI A;  1P4X A;  2D1H A;  2HYG D;  3GFM A;  2ZNY A;  3L9F A;  1TW3 A;  2KIM A;  5K1Y A;  1USS A;  2Y48 A;  1G4D A;  2PJP A;  1JHF A;  1OPC A;  4XBF A;  1DDN A;  1R23 A;  2DBB A;  4EVI A;  4QLC U;  2ZME B;  3VEP A;  4DQ2 A;  4YFX F;  4MTD A;  2RVC A;  4LGW A;  4MGR A;  3V7S A;  4M73 A;  2FMY A;  5HLH A;  2AXL A;  1SMY F;  5E20 A;  5HDN A;  3GFL A;  4IVN A;  4M6Y A;  2A07 F;  3EUH A;  1ZLJ A;  1QBJ A;  4IRG A;  1MD0 A;  2CGP A;  5DEQ A;  1G3Y A;  1T38 A;  3SHF A;  2V1X A;  4G8X A;  1Z6T A;  3C3W A;  1BJA A;  3E6M A;  3DKW A;  3GFI A;  3V4G A;  3ZPL A;  5DYM A;  4EQQ A;  1T98 A;  2L3D A;  2FSW A;  3SZT A;  1HKT A;  4AIJ A;  2M45 A;  1LEB A;  4KMU X;  3IC7 A;  4I01 A;  2WWY A;  1Z9C A;  1I1G A;  4N9I A;  5LGU A;  2EA2 A;  2DQR A;  2Z3Y A;  5E8G A;  4A2U A;  2MLK A;  1KA8 A;  3WGG A;  1BBY A;  3IKT A;  1KU9 A;  4I98 B;  2NRA C;  2L54 A;  1FOK A;  1YO5 C;  2XAS A;  4E70 A;  3QP6 A;  4O6J A;  4EGZ A;  1IW7 F;  2OA4 A;  3LST A;  1FPQ A;  1KGS A;  3SXY A;  2DPU A;  3JAM Z;  3I58 A;  1ZLK A;  4G94 A;  5HVQ C;  1WSU A;  1TBX A;  3JW4 A;  4R8H A;  1GXP A;  2KKO A;  1R00 A;  2RC4 A;  3HOS A;  3P7N A;  3IWZ A;  4IRI A;  5ICF A;  2YSR A;  4KIB A;  3VOD A;  4NHJ A;  3KP4 A;  2EV0 A;  3ZMV A;  5FB2 A;  4OOI A;  3ISP A;  5AIQ A;  5L3C A;  1K78 B;  3G3Z A;  2LNB A;  5K5Q A;  4A0X A;  3WTS C;  4Y17 A;  1MZB A;  4RS8 A;  3ZN1 A;  1FLI A;  3WOD F;  5BQT A;  1GVJ A;  3IRQ A;  3QPT A;  3CUQ C;  3DFG A;  2PFB A;  3LQR A;  4BHC A;  1IF1 A;  2GZW A;  3OV8 A;  1FYM A;  1W4M A;  1RIO H;  5H6R A;  1SD6 A;  2L4M A;  2HEO A;  3HOT A;  2PQ8 A;  3HHH A;  3WTY C;  1WI9 A;  1Y0U A;  4HF2 A;  2O61 A;  1IXR C;  1I5Z A;  3E5U A;  3U9G A;  3JAM K;  1KU2 A;  4EJV A;  5JVT A;  3MAJ A;  4XLP F;  3I54 A;  3I5U A;  3R61 A;  4I7H A;  3N4M A;  3V8J A;  2HS5 A;  3H3Z A;  1J75 A;  1J0R A;  2W25 A;  2CQK A;  1SD4 A;  2MBF A;  3KLO A;  1R1T A;  4U0Y A;  3FMQ A;  5D5W B;  3HTU A;  1KYW A;  1FYK A;  3I64 A;  1MDM B;  2FXA A;  3I0T A;  2XGX A;  3TDU C;  2EA4 A;  1A04 A;  2WV0 A;  5HLG A;  1IUY A;  2OBP A;  1LB2 A;  1EH7 A;  4A0Y A;  4LMY A;  4BHP A;  1AOY A;  1EV7 A;  2V1D A;  3KEQ A;  4U88 A;  2CWE A;  3F22 A;  1FC3 A;  3RIR A;  3WTU C;  2VOP A;  2QUF A;  1P6R A;  2KIF A;  4PGG A;  1IRG A;  5JHU A;  2P5K A;  3KET A;  1WKM A;  1BOA A;  5DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...