1SFXA

X-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
HMSNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein AF2008
publication title X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01978 TrmB Sugar-specific transcriptional regulator TrmB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sfxA00
2KIFA 3F8FA 3LFKA 5FD5A 4M74A 2A07F 4PCQA 4A12A 1P2FA 2GXGA 1IN7A 3IL2A 1B59A 2FMLA 1ZH5A 3CJNA 3WTVC 1FP1D 1K78A 3ML6A 3KP4A 1EH8A 2EV6A 1H9TA 2LSOA 4BXUA 2HDCA 2A69F 2M87A 3HRSA 1P92A 1IRFA 4IRIA 3KLNA 3B73A 3FM3A 1E2XA 4LK0F 3BJ6A 3KP2A 3IRRA 2EFWA 3JSPA 2A61A 1DP7P 4RAYA 3EQLF 4P96A 1Z9CA 2RC4A 2NS0A 1TBXA 3M8FA 3EUHA 2IPQX 1PP7U 1FYKA 4HAMA 3IC7A 3S2WA 2R7DA 3FZVA 1K6OA 2XV4S 3JSOA 3E5UA 3CUOA 2CO5A 5LBQA 3GW2A 2EV0A 5FB2A 1BIAA 3I59B 4OIPF 1K79A 1S3JA 1W7PD 5LLQA 3DKWA 1S7OA 2P5VA 5AIQA 5TRDA 2FNPA 5H20A 1F1ZA 2NRAC 5LHIA 2VE9A 4IXAA 3NEUA 3F8CA 3D5LA 1HW2A 5HLIA 2ZKZA 4MEXF 4UHTA 4UVCA 3WTYC 3V4GA 1S29A 5LHHA 2IA0A 5FO5A 5E20A 2K86A 1XSDA 2E1CA 2RVCA 3RPUA 2CYYA 4U0YA 1KYWA 3PQJA 5L3FA 2D45A 1K7AA 2O61A 1ON1A 2IA1A 1B9NA 5CJ9A 3HRMA 4OU0A 1DUXC 2ISZA 1C0WA 2WTEA 2KRFA 4HF2A 3P7NA 1ONVA 3N97A 1WQ2A 4YG2F 1U78A 3TO7A 3DFGA 5JVTA 1ZLJA 2AS5F 2OQRA 3F23A 2Z3YA 4HDVA 1BC7C 3KZYA 2PN6A 4CXFA 3EYIA 2IJLA 4O3MA 1KQ8A 3I58A 1IXRC 2CG4A 4M9XA 2W24A 4HV6A 4GXOA 1HKTA 1GXPA 3REOA 4FX0A 4MGRA 3IWFA 4A6EA 4RGSA 1D5VA 1BI3A 1XDUA 3KE2A 1LJ9A 4RB2C 2F5CA 2XAGA 2EWNA 1BN5A 1SMTA 5H6RA 4CZZA 5LGTA 4ZYGA 3CUQB 1Z1DA 2FNAA 4P5OA 3H3UA 4PZJA 3TDUC 5F64A 4N0BA 4IRGA 5EEGA 4BAYA 1LDDA 2Z5UA 3ERED 1QZZA 5EEHA 4LMYA 2XAFA 2QQ9A 5LRRA 3VEPA 4KT5C 1R1UA 3JAMZ 5L3CA 3WGIA 2ZBKA 4DQ2A 4HF1A 1KU9A 3NRVA 1XMKA 4EMSA 2QUFA 2FU4A 4NQWA 4U0WA 3L09A 3CLOA 2XUBA 3RKYA 3R6SA 2L4MA 2BBYA 4M72A 4KDPA 3CUQC 2FE3A 2DLLA 4KICA 1R1TA 1Z6TA 1MJ9A 4G6QA 1J0RA 4G7HF 3SZPA 4IPAA 2K02A 3I64A 4M73A 2MC3A 3QAHA 1OKRA 1J9IA 3E5QA 1KYZA 3LSTA 5ICCA 3HYIA 5D4SA 3M1EA 4LK1F 1TNSA 3H3ZA 3JTHA 3SFZA 1IXSB 3K69A 2L54A 2HQRA 2OZ6A 2K7LA 4BHBA 5KK1A 5HVQC 2W85A 1ZARA 1YQAA 3B02A 2CWEA 4HOBA 3R0JA 2FA5A 4LLGF 3DEUA 3I4PA 4OMZA 4BHCA 3I54A 3FMRA 1FY7A 2RN7A 3CTAA 2VONA 2IW5A 2DTRA 4KYWA 3DV8A 1OMIA 3M9AA 1U2WA 3K9TA 2RGVA 3COAC 3ECHA 4JK1X 4OINF 2R7FA 5BQTA 1LVAA 2FBKA 6PAXA 4HYEA 3HTUA 4NHJA 2HTJA 4O5VA 4S04A 1GHCA 3FXRA 1TW3A 2XAQA 2ZMEB 3IWZA 3FHZA 1T0FA 4ZYHA 2MLGA 2HGCA 1IN4A 4HX7A 3TO9A 2E7XA 2ZXJA 1FC3A 2CSOA 2KKOA 1YS6A 1BOAA 3F8NA 2JPBA 1TQPA 5D5WB 2JTVA 2O0YA 3J7AO 3ISPA 3V8JA 4I0BA 2PJPA 1HSTA 1PP8F 5FGMA 2A6EF 2P6SA 1ULYA 4MHGA 2DPUA 1ZREA 2P5LC 3CO7C 3BZ6A 4WX9A 2XASA 4ZYEA 1MDMB 1J59A 2FSWA 1YTYA 3Q5FA 1TW2A 4HBLA 4ENJA 2DAOA 1RI7A 3BP8A 2EK5A 2FMYA 2JSCA 3V7CA 2IP2A 3IRQA 2ETHA 2EFNA 1JHFA 5CYVA 2STTA 1YLFA 3F22A 1FNNA 2KJBA 4YIFA 1I5ZA 3RPQA 1U8RA 1CF7A 3LQRA 2A6HF 3LWFA 2ESHA 1IRGA 1IW7F 2GAUA 5JHUA 1A04A 1AWCA 4N9IA 4IVNA 2W57A 4G9YA 2QBYB 5K1YA 3EETA 2FBIA 2K4JA 5ICEA 1FP2A 1R1VA 5E1ZB 2MBFA 2ESNA 5CLSA 1R36A 4RGUA 3TKYA 5ILSA 4HQEA 1OYIA 2DBBA 3GXOA 2NAZA 1REPC 3DP7A 2IRFG 1RUOA 3ZP5A 1U5TB 3K1NA 2J5OA 2F2EA 3ROUA 3KEOA 5BOXA 1KU7A 3C18A 4FHTA 2XVCA 3BPXA 4KUMA 5A2QK 4WXCA 3U2RA 4KMFA 5CVVA 3ULQB 3P9KA 5BPIA 3EYYA 4Q4ZF 3WODF 1QZYA 1J5YA 1ZRDA 3J81K 3Q9VA 2HWVA 3FX3A 3GLXA 1MJAA 2P7CB 1JHHA 5E1WA 1CGPA 4NB5A 1LB2A 1E17A 5DCFA 1R5GA 4HQMA 3OOPA 1MGTA 1U5TC 1XSXA 4EQQA 3U1DA 5ILUA 1W5SA 2MD5A 2L02A 3GO5A 3C1DA 1ZYRF 3H92A 3ZQ7A 1KU3A 4HV5A 4G7ZF 3FXQA 2QQAA 2DU9A 1FBSA 2O3FA 4AIJA 2EFQA 3IKVA 3F21A 1XGMA 1XSVA 2R3SA 5DDGA 2DK5A 4M6XA 4EJUA 1MZBA 4WK8F 5CVIA 1BC8C 2C6YA 4ZYDA 1YYVA 2D1VA 2DW4A 2W25A 4MQVA 1IXCA 4M6YA 3WTSC 4CYDA 4CDGA 1OPCA 2YSRA 2NNYA 3HOSA 2BEOA 3DPTA 1K78B 1NHAA 3FXUA 3T5XA 4KA4A 1JXSA 1QO0D 3N4MA 4EJWA 3GYHX 4GYGA 3SHFA 3WGHA 2VOOA 3E6DA 4EM1A 3KP5A 1R5HA 4UUVA 1FPQA 3EDPA 1S6LA 2IT0A 4A2UA 1P4WA 2H6BA 4UNOA 2DFIA 5D5UB 2EA2A 1QBJA 3WTWC 2HOEA 2COMA 2HYGD 3KP6A 3VOEA 1EV7A 2IA2A 2DO7A 1ZRCA 2PMHA 2OA4A 2OAZA 2CW0F 1UCRA 2Z99A 3TQNA 4LFUA 4TV7A 2EV5A 3QOPA 2EJRA 1BI1A 1HXDA 4GYIA 3SQNA 3PFIA 4A0XA 1SFEA 4ENNA 2P5KA 4ETSA 2M45A 4G7OF 2DT5A 4I2OA 4D0PA 4EM2A 3Q9SA 3F3XA 2WV0A 2H27A 1W7PA 4KN7X 2B0LA 3MFKA 1KU2A 3D0SA 4HW0A 3QPHA 1XCVA 3WG9A 2XKOA 3WTUC 1WKMA 2QQBA 5H6QA 2M1BA 3QPTA 4HZFA 1J7KA 4YIIA 5LEJA 3OV8A 1ZGJA 1KA8A 3KZZA 5ED4A 5HLGA 5L3BA 4OOIA 3IKTA 1QGPA 3L9FA 4RAZA 3F8BA 1STZA 2P6TA 3KETA 1U6GA 2M5WA 1SFUA 4XSZF 5HDNA 1YS7A 4ZZDA 2PBIA 3K2ZA 1ZN2A 1BI0A 4EGYA 4LGWA 1R23A 1T6SA 3KP3A 2GQQA 3GUDA 3KCCA 3MZHA 4I7HA 1J2XA 3U9GA 5ICFA 4AD9A 2V79A 3ELKA 1L0OC 4Q47A 3HSRA 3T0YA 3T1BA 1J75A 4O6JA 3PQKA 1FSEA 4L9JA 5LGUA 5DCMA 3W6KB 3ZMTA 2HFHA 4AVPA 3GFMA 3GFJA 5HOOA 2JT1A 1F9NA 2ZJ2A 2FQ3A 5L3DA 3K1MA 5D5VB 4L5JA 1O3QA 4MEYF 2XROA 4BYYA 1SAXA 2DI3A 1QPMA 4EVIA 4L0ZB 3GVAA 4R8HA 2QENA 4OMYA 2IVMA 3QU6A 1LNWA 3BPVA 3MAJA 3V7RA 1KGSA 5DV5A 1FSHA 3WTZA 1FWZA 1FZPB 4K2EA 4IRHA 4B8XA 4ESFA 4KIBA 3DF8A 3LAJA 3WU0A 1IF1A 3HOTA 5TJJA 3R4KA 4A5NA 4U7DA 2ZFWA 3R61A 1LDJA 5JI6A 4HLXA 1YIOA 3HUGA 5DD8A 4IJAA 4WXHA 3HIFA 5J8CA 2RQPA 3E5XA 2ELHA 5DCMB 1ODDA 4EGZA 1I27A 4JQFA 1X3UA 3WE2A 4R1HA 3R0AA 4M9SA 4Q48A 5HS8A 3GFLA 2ZNZA 1MKMA 2HYFA 3L7WA 2PG4A 5LGNA 2DPDA 2H6CA 1T98A 2D2WA 1QQIA 2VE8A 2OQGA 3QP6A 2K4BA 2G9WA 3E6BA 1R00A 2X4HA 2RKHA 4PGHA 1USTA 1HW5A 3W6JB 5A2QZ 4XSXF 4UV8A 4ESJA 3BY6A 1L3LA 3ECOA 2YPRA 2F5FA 1G3TA 1ZLKA 1LEAA 1YO5C 2H09A 4CO8A 1FYMA 4YFKF 3HSFA 3F72A 2PFBA 2YU3A 1W5TA 3J81Z 2LNBA 5K5RA 2A5YB 2F5EA 3TOBA 1HQCA 1SD6A 5BPDA 2UXXA 4WWCA 2BV6A 4WF2A 3MZYA 3FMSA 3HTSB 4HDUA 1ZG3A 4LLLA 1O3TA 3RYPA 4UVAA 1FYLA 3HRTA 2EFPA 4I02A 1V3FA 2Y48A 5D5XB 3MCZA 2GXBA 1U3EM 4XLPF 2V1UA 2LF7A 1XB4A 5D6FA 2NYXA 2XAJA 4LB5A 4KIGA 4RGRA 1B1BA 2FBHA 2V1XA 4RB3C 1SD5A 4HLYA 3HRUA 2HQNA 5ILVA 1WWXA 5HDKA 1Z7UA 3F8MA 3L2CA 3V7SA 2HEOA 4Y15A 3WTXC 3ZMSA 3BJAA 2HR3A 3IHUA 2Y75A 2QLZA 2O03A 3KP7A 1ZGAA 2PLYA 1O7LA 1I1SA 3WGGA 2PMUA 3DXJF 3HHGA 4G94A 4GCVA 4I01A 2GA2A 1GXQA 3LA2A 4KMUX 1IN5A 3BJOA 5FFZA 2L4AA 4L5IA 4CHUA 2XAHA 1OYWA 4P9UA 4AWXB 2VBYA 3WU1B 5IT3A 4RB0A 4LD5A 2XKPA 3WTTC 2VOPA 2X0LA 2DK8A 2Q0OA 4EJOA 2Y0MA 3MQ0A 3TO6A 3J80K 2JZYA 4BHPA 1CF7B 1D3YA 2ISYA 5HLHA 4LB6B 4CGZA 2HTSA 2QM3A 5DD4A 2LKPA 3I59A 1T2KA 2MH2A 3P9IA 3E97A 2DQRA 4OIQF 2VXZA 2BYVE 2P7VB 2MLKA 1OYYA 3QU3A 4AIKA 1Z6RA 2XHKA 4R79A 4BH9A 1ZHFA 2UZKA 3RKWA 1DPUA 3MWMA 1RUNA 1XGSA 1BI2A 4IHTA 2RNJA 3RIRA 1P4XA 5HS7A 1EH7A 5D8LB 3QP5A 4A0ZA 1SMYF 1T38A 2QZ8A 2VBZA 1IUYA 3CO6C 4B09A 2MH9A 2FOKA 2GZWA 5IT9K 1BM9A 1XDSA 4LJZF 1TTYA 2UXNA 2Z33A 1XN7A 1ZG1A 3DPLC 1BJAA 5DUIA 1GVJA 5E8GA 1ZAOA 4PGGA 3GEZA 3I71A 3LQQA 4UV9A 5CVUA 5J6XA 4U88A 4KN4X 3JW4A 2AXLA 1MJBA 5J8FA 2O6GE 3LA7A 4IF4A 1I1GA 3SXYA 3O3KA 4PDKA 1PUEE 1P6RA 1LQ1A 2VBWA 1UHWA 2VODA 2QVOA 3RYRA 1UB9A 4YFNF 1TQIA 1B4AA 1LEBA 4ZH4F 1WSUA 5DYMA 1TQMA 4E70A 2XIGA 4AIHA 5D6EA 2ZNYA 4EM0B 2F5DA 1R58A 3P9CA 5E17F 2A68F 2GIVA 3SZTA 1S7AA 3E6CC 4RGXA 4MTDA 2E7WA 4CICA 2JPCA 2FXAA 1ZRFA 2STWA 1DDNA 3NQOA 3ZMVA 5CVJA 3CUQA 1YW7A 2ZO4A 1B6AA 3GX4X 4UXNA 4Y17A 1IN6A 5AONA 3TDZC 1PDNC 1XGNA 3M7GA 5BS6A 2HZTA 5E18F 1P4AA 2VT3A 4N9HA 3DQVC 5LHGA 2O8XA 5D8KB 3FM5A 2LF8A 1ON2A 2MA3A 5D4RA 2KJCA 4DNCA 4XLNF 1O57A 5HS9A 1S8NA 1Q1HA 3ZN1A 3I53A 3VFZA 3RJPA 4U7BA 4Q5SF 2CGPA 1HW1A 2Q8KA 4L0YB 3V8LA 3K1PA 2FF4A 2ACJA 1EH6A 2OBPA 2CQKA 1USSA 2QYOA 2CFXA 4L9NA 3F6OA 3V8KA 2Q2EA 2EB7A 5LRSA 1UHMA 1YW9A 2L3DA 1JGSA 2V1DA 4YFXF 4ENMA 3ZMZA 3RDIA 5E8IA 4I98B 3JTGA 4IHSA 1FX7A 1G6NA 4KIFA 1WRJA 3FF5A 2VC1A 4QLCU 4KNYA 4ZZLA 3F6VA 1KQ0A 3I5UA 5DUKA 3E3VA 1FBUA 2RDPA 1UFMA 3LA3A 1YFHA 5KVRA 4XBFA 4XRFA 1W7PB 1KQ9A 5L3EA 1F5TA 3HSEA 2UWMA 3C7JA 3VODA 3VB2A 2GWRA 1B9MA 1FBQA 3I0TA 1Z05A 4RB1A 5F6FA 3T8TA 3ABUA 4ON0A 1BIBA 1AOYA 4I0AA 2PI0A 5JFRA 1H0MA 1MD0A 5FLXZ 2Z9OA 3RTRA 2H94A 3GF2A 2VC0A 4HA8A 3WE3A 2ADUA 2OZUA 2ZMEA 4Z2YA 4HX4A 4OIRF 4EJTA 2E1NA 5DEQA 2G7HA 1R22A 4M9ZA 3ZMUA 2LDUA 5L3GA 3BWGA 4OIOF 1HKQA 4GO1A 3GZ5A 1G3YA 1O7FA 2TDXA 4HX8A 2HS5A 5E1XA 1YG2A 4H0EA 2OU2A 4P9FA 1W4MA 1YW8A 1ZG5A 1V4RA 2RV8A 3T8RA 5JR3A 2VBXA 5CVRA 4L18B 1WI9A 3G3ZA 5BMZA 2QWWA 1XCBA 2EA4A 2VT2A 1RNLA 3AAFA 1MDMA 4UVBA 4LG0A 2YX4A 1F4KA 5LEKA 4HF0A 1Z91A 3FWEA 1I6XA 4RS8A 1IN8A 2K27A 4ESBA 4GGGA 1FOKA 4A0YA 1D8JA 4F7ZA 3C3WA 2HKXA 4ENKA 4U0VA 5HDGA 3JAMK 4KFCA 3RKXA 3KLOA 5AIPA 2M30A 1RIOH 2JRTA 3ZMDA 1D8KA 2M8EA 2D1HA 2WC2A 1XGOA 5K5OA 5FLXK 2QBYA 2KIMA 4ASNA 1XD7A 3TGNA 1QNTA 4FT8A 2J5PA 3GFIA 2W84A 1BBYA 5FD6A 1DPRA 5ERIA 4M71A 2GA1A 2OD5A 1HSJA 2XGXA 3J80Z 4LLNA 3QRFF 3RI4A 1G4DA 2L01A 1XMAA 1U5TA 2V6CA 1T39A 3E6MA 2BGCA 4I09A 5K5QA 3ABTA 4P55A 2DQLA 4MQ9F 4LG0B 1TNTA 3G73A 2KIUA 1Y0UA 4G6DA 2P4WA 3CDHA 4MNUA 1O3SA 3GWZA 2NNNA 2ZCWA 2FEZA 4WXDA 4QWQA 1HBXG 3O6BB 1H9GA 3KFWX 1JE8A 2FRHA 1FT9A 3O2PE 4A5MA 3L00A 3ZN0A 2PEXA 5IT9Z 1FLIA 3M8EA 3BDDA 1G3SA 4FX4A 1LDKB 5FFXA 4A6DA 5ICGA 3BOQA 4BNCA 1RZ4A 4JBAA 1R7JA 2WWYA 1O3RA 4MTEA 2YR2A 3BROA 1OR7A 2V9VA 2G7UA 4BQAA 3K0LA 2XRNA 4EV0A 4Y13A 1SD7A 3R60A 3MEXA 4L9TA 2HKOA 3FMQA 3LAPA 2YX7A 1HKSA 1TLHB 5F1RA 1IAWA 4L9VA 4WCGA 2P8TA 4S05A 4EJVA 3TOAA 4G8XA 3HHHA 2EFOA 3GZ6A 2PQ8A 1SFXA 1IZ1A 1G3WA 1SD4A 3KEQA 2A3SA 1VTNC 2BE5F 2VN2A 3ZPLA
chains in the Genus database with same CATH superfamily
2HNHA 2KIFA 3F8FA 2XPVA 4C9YA 2KISA 1LE8B 3JRDA 3LFKA 5FD5A 4M74A 2A07F 2DA5A 4PCQA 4A12A 1P2FA 2GXGA 1IN7A 1WI3A 2X9DA 3IL2A 1B59A 1LFPA 2DOAA 5FKMA 5E3OA 2XGDA 2FMLA 2NVUB 1ZH5A 2EBIA 3CJNA 4I99C 2EPFA 3WTVC 1HF0A 1FP1D 1RR8C 5J1UA 1Z77A 3AKZA 1K78A 3ML6A 1B72B 5EZGA 2JJ7A 2ZSIB 3KP4A 3W2WA 1EH8A 2DFEA 2OTLI 2EV6A 2P0WA 2EQRA 1N77A 1H9TA 1U8BA 1F36A 3L2WA 2OCCH 1W0UA 3BT9A 4XLAA 2LSOA 5CQEA 1G59A 4BXUA 3ZGKA 5FKKA 2HDCA 2A69F 3CC4I 2M87A 3HRSA 1Y1VJ 3ZR8X 1NTCA 1P92A 4XKCA 3K4CA 2E5NA 1IRFA 2XGCA 4IRIA 2BY0A 3KLNA 3B73A 3FM3A 1E2XA 3CCVI 1OCPA 1YITI 3CDIA 4LK0F 3W2VA 3BJ6A 1E3OC 1T95A 3KP2A 4IQ4A 3S3MA 4RAFA 1D1CA 1XC5A 1MH3A 2OF7A 3G4SI 3IRRA 2EFWA 4NNJA 2JN6A 1A6IA 3JSPA 2A61A 2KL4A 1DP7P 3PNTA 3SEQA 3ZXSA 2DJIA 2V4JC 4RAYA 2VJ4A 3AL0B 2P81A 3EQLF 4P96A 2R5YB 1Z9CA 5M5YJ 5IPAA 3OS1A 2RC4A 1HOMA 2NS0A 1TBXA 4Y33A 3NWSA 2RQQA 2K9MA 3M8FA 3EUHA 2IPQX 1PP7U 1VNDA 1FYKA 2EINH 4HAMA 3IC7A 1VQOI 3S2WA 1U0JA 2R7DA 3FZVA 3K10A 4BS9A 1K6OA 2XV4S 3JSOA 3LSRA 3E5UA 1Y56A 3CUOA 4HG2A 1QVUA 2R0QC 2CO5A 4M3GA 1VQ5I 5LBQA 3GW2A 2R5ZA 3HGYA 2EV0A 3IH2A 3PFYA 4A3CJ 3ZQCA 5FB2A 1BIAA 3I59B 4OIPF 3PNYA 1K79A 1S3JA 1ETQA 1IO2A 4II3A 1W7PD 1ACIA 5E3LA 5LLQA 3DKWA 1S7OA 1Z0XA 2P5VA 5AIQA 5TRDA 2FNPA 3CJTB 2XB5A 4BQQA 3ABMH 2X6OA 5H20A 1Z21A 4IHXA 3FXMA 5KAFC 1F1ZA 4XMYA 2NRAC 2CW8A 2DYRH 3LSMA 4NC8A 5LHIA 1W0TA 2VE9A 1JKRC 1X19A 3JREA 2V6EA 4IXAA 3NEUA 3F8CA 2L9RA 3D5LA 3AL0C 4AVZA 2LLKA 2CUZA 4HSTA 1IV6A 1ZK8A 1HW2A 3A0HC 3TEDA 2D5VA 5HLIA 2ZKZA 4MEXF 2HDDA 4UHTA 4UVCA 3WTYC 1IJWC 3V4GA 1S29A 5LHHA 1OQYA 2IA0A 5FO5A 5E20A 2B63J 3ESWB 4QIWN 2K86A 1XSDA 2E1CA 3OWTA 2RVCA 3RPUA 1R71A 4A3LJ 3AG4H 2E1OA 2NOJB 3B6AA 1LPQA 2CYYA 4U0YA 4PSWA 3OIQA 1KYWA 3K4MA 3PQJA 3LSJA 5L3FA 2D45A 2R7UA 1K7AA 2O61A 1SC7A 1ON1A 2IA1A 4RAGA 1B9NA 5CJ9A 3HRMA 4OU0A 1IRXA 4XRSA 1DUXC 2ISZA 4BQNA 1C0WA 2WTEA 4MFDA 2KRFA 1G8XA 3A01A 4HF2A 4UUTA 3P7NA 1FMVA 1OFCX 3GTJJ 1ONVA 2X1DA 3C2GA 4RLQA 2GOMA 3N97A 1WQ2A 3OYNA 4E7HA 4YG2F 1YX3A 1U78A 3TO7A 4IOAF 3DFGA 5JVTA 2Y0SA 1DU6A 1ZLJA 1XS9A 2AS5F 2OQRA 3F23A 2Z3YA 4HDVA 1BC7C 3KZYA 2PN6A 3LSIA 2M2EA 3MZ8A 3H9GA 4CXFA 2R7RA 2MGQA 3EYIA 2IJLA 4O3MA 1KQ8A 3I58A 3CCRI 1IXRC 3S32A 2A6TA 2CG4A 3HOVJ 2H1LA 2HPMA 4M9XA 2ZJRF 1VI0A 2W24A 3CZ6A 4HV6A 4GXOA 1HKTA 3G1OA 1GXPA 4A3IJ 3REOA 4A69C 1HDPA 4FX0A 4MGRA 1IGNA 2PJRA 3IWFA 2DA7A 4A6EA 4RGSA 1D5VA 1BI3A 4BE2A 2E19A 1XDUA 3CF2A 2XB0X 5GTIC 3KE2A 3FISA 2E2JJ 1LJ9A 4RB2C 2F5CA 2XAGA 3JRHA 5CKTA 4UB8C 2V9PA 2K9NA 2EWNA 1BN5A 1SMTA 5H6RA 4CZZA 4A3MJ 5LGTA 2ECBA 2NVYJ 4ZYGA 2XRLA 1Z1DA 2FNAA 3CUQB 4E6KG 1YRNB 4P5OA 2XPUA 1MMNA 3H3UA 4PZJA 4HSRA 2F48A 4N4NB 3FXOA 3TDUC 3HB9A 5F64A 1UZCA 4N0BA 4GDFA 2K9QA 4IRGA 2L9VA 1YOVB 5EEGA 4BAYA 1JJ8C 1LDDA 3O8HA 2Z5UA 3ERED 1QZZA 2MW8A 5EEHA 4LMYA 2XAFA 2QQ9A 3HPHA 3ZQLA 2ECCA 2M0CA 1Q1VA 5CQGA 4CCOA 2MFZA 5LRRA 1MH4A 3VEPA 3MMYB 4KT5C 1RETA 2NS7A 3DCFA 1R1UA 1ZGWA 4F91B 3JAMZ 5L3CA 3WGIA 2ZBKA 4DQ2A 4AUXA 5E79C 3OYFA 1BW6A 1GT0C 1KU9A 3NRVA 4M3DA 1P7JA 3OSFA 4HF1A 4B4CA 1XMKA 4EMSA 2QUFA 5J4VA 4A93J 2VIXA 2FU4A 1T33A 4NQWA 4JOMA 1APLC 4U0WA 3L09A 3CLOA 2XUBA 2G0EA 2OUMA 3GTOJ 3RKYA 4F3QA 2CQ7A 1WJFA 3R6SA 2L4MA 3JRFA 1VFCA 2BBYA 4M72A 2RNGA 4H4KC 4KDPA 3CUQC 2FE3A 1I3AA 3HOZJ 2R4GA 1OLTA 2HYJA 2L9SA 1PUFA 1GDTA 5GADJ 1QHGA 2Q2EB 2DLLA 4KICA 1R1TA 4BUPA 1Z6TA 2HOSA 1MJ9A 4G6QA 1VQ8I 1J0RA 1Z3XA 4G7HF 4HRIA 3SZPA 3W3CA 4IPAA 1KONA 2K02A 4FISA 3I64A 4M73A 1I50J 2MC3A 4BJ6C 3QAHA 4RLFA 1OKRA 1J9IA 3ZQIA 3E5QA 1KYZA 2JA2A 1NG7A 5IY5H 3H36A 3HM5A 3LSTA 3HYIA 5ICCA 5D4SA 1B8IA 3M1EA 4LK1F 2HQ5A 1TNSA 2AXTC 3H3ZA 3JTHA 3MD2A 3SFZA 1IXSB 3BR0A 1QPIA 3K69A 2L54A 1WCMJ 3AG3H 4CH7A 2HQRA 2OZ6A 2HVSA 2K7LA 4CYCB 3OYMA 4BHBA 2IGMA 3CCLI 3ASOH 5KK1A 1GUUA 2BXYA 5HVQC 3K4LA 5F0FA 4C3JJ 5GAHJ 4DBRA 3RCOA 2W85A 3JRCA 3BR3A 3B02A 1ZARA 1YQAA 2CWEA 4HOBA 1RESA 2KP6A 3R0JA 1Y8QB 5E3NA 3OOUA 2DA4A 3RQIA 4BGDA 2FA5A 4LLGF 3DEUA 1TWGJ 1E3PA 2N8GA 3I4PA 3O8GA 3I54A 4OMZA 4BHCA 3FMRA 1FY7A 2RN7A 3CTAA 2VONA 2IW5A 3E1SA 2DTRA 4KYWA 3DV8A 1OMIA 5F04A 3V42A 3L1PA 1SVMA 1U2WA 2LH9A 3M9AA 3K9TA 4PK4A 2L7KA 1UHSA 2RGVA 5EEAA 3COAC 2HI3A 3ECHA 3FKIJ 4JK1X 4A3KJ 4OINF 2R7FA 4IX7A 5BQTA 1LVAA 2FBKA 1V55H 6PAXA 2O8KA 2X6XA 1Y8RB 3MN2A 1AA7A 4HYEA 3K4BA 3HTUA 3TW6A 4NHJA 2K85A 2HTJA 4O5VA 4LITA 2ICWG 1K6YA 4S04A 1GHCA 2AQEA 3FXRA 1TW3A 2XAQA 2ZMEB 5HODA 3IWZA 3FHZA 1T0FA 4F52A 4ZYHA 1WH5A 2MLGA 4HPQA 2LY1A 2HGCA 1IN4A 4HX7A 3TO9A 3A0BC 2E7XA 1A6QA 2ZXJA 4C2MJ 4DBQA 1FC3A 2CSOA 4NBQA 2KKOA 1YS6A 1BOAA 2IGNA 3J7AY 3F8NA 3SYTA 3CMEI 2JPBA 2QA4I 1TQPA 2HVQA 4RM3A 2JTVA 5D5WB 2O0YA 1X1AA 1JTYA 4BY1J 3J7AO 5C4XJ 1N75A 3ISPA 3S3OA 3V8JA 4I0BA 2HOAA 2OJED 4PJ0C 2PJPA 4IOCF 1HSTA 1PP8F 4FE7A 5FGMA 2LMDA 2A6EF 2P6SA 1ULYA 4MHGA 2DPUA 3QODA 1ZREA 2P5LC 1W36D 3CO7C 2VQHA 3BZ6A 2XASA 3PSIA 4WX9A 4ZYEA 1UG0A 1MDMB 4DZPA 1PVEA 3FBNB 1J59A 2FSWA 1YTYA 1R49A 4N4OB 4ZTFA 2JA5J 2OTJI 3Q5FA 3ZQHA 1TW2A 4HBLA 1MBHA 4PSXA 2ZMEC 2KPMA 3H5AA 3VYUB 4ENJA 2DT6A 4OWRB 2DAOA 3L2RA 1RI7A 3BP8A 2EK5A 5GP9A 2FMYA 2JSCA 2WAEA 4V19K 3V7CA 2OPTA 2IP2A 3CCSI 4CCNA 4JYKA 3IRQA 2ETHA 2EFNA 1JHFA 4MIMA 5CYVA 2STTA 1YLFA 1VQ6I 3F22A 4BACA 1FNNA 2KJBA 4YIFA 2MC4A 4CCJA 4CCKA 1I5ZA 5M3FJ 3RPQA 2LKXA 4Y3OA 1U8RA 1CF7A 4M3EA 3LQRA 2A6HF 4KITB 1MMSA 3FHNA 3LWFA 1WH7A 2ESHA 1IRGA 2E71A 4BJTA 1IW7F 2GAUA 3TW7A 5JHUA 1HDDC 3HC7A 1A04A 2B7EA 1AWCA 2JMWA 4N9IA 4IVNA 2W57A 4GRIA 4J19A 2JUCA 4G9YA 2QBYB 3G71I 1IG7A 5K1YA 3EETA 1O4XA 2FBIA 2O7OA 1OCTC 3SJMA 1YHQI 2BVMA 2K4JA 2V26A 2VUMJ 1VF9A 5ICEA 2F4MB 1FP2A 2FJ1A 1R1VA 1V5GA 2CUEA 5E1ZB 2MBFA 4E7JA 3VYSB 2ESNA 3EPZA 5CLSA 1R36A 4RGUA 1IC8A 3S1NJ 4DZJA 4YRVA 3TKYA 5ILSA 3QPSA 4HQEA 1OYIA 1X1BA 2DBBA 1FOWA 2DMUA 2NAZA 3DKYA 3GXOA 4RMNA 5F0CA 1REPC 3HEFA 3DP7A 4U87A 1H88C 2IRFG 4XKVA 1RUOA 3ZP5A 1U5TB 3K1NA 1JT0A 2J5OA 1XTAA 2F2EA 5FLMJ 2LC2A 2WBMA 3ROUA 2Y31A 3SFIA 3PJRA 3KEOA 1VQNI 5BOXA 3BCAA 1KU7A 3C18A 2HU9A 4FHTA 2XVCA 3H0DA 5JLXA 3BPXA 2WB1N 1EJ9A 4ABZA 4KUMA 5A2QK 2NXNB 4WXCA 3U2RA 4KMFA 4ZDOA 3RZDJ 2F6CA 2GXAA 5CVVA 3BZKA 3ULQB 2VQCA 3P9KA 3RKQA 4JX5A 4XRSG 2X48A 2KT0A 4W97A 5BPIA 3I56I 1F43A 5EGOB 3E0JB 3G6EI 3EYYA 4Q4ZF 1GLNA 3WODF 1BR4A 2CV0A 1QZYA 2F5VA 1J5YA 1ZRDA 3J81K 2Z2SB 3Q9VA 2HWVA 5DM7F 1M1EB 3OYDA 3FX3A 3GLXA 1MJAA 2P7CB 1JHHA 5E1WA 1CGPA 3S8PA 4DGWB 3GCMA 4NB5A 3OYBA 1TZLA 1LB2A 2WY8Q 1E17A 5DCFA 1BOBA 1R5GA 4HQMA 4PJNA 5IYDJ 3BZCA 2M9HA 2XPWA 2L5QA 5IP7J 2ME6A 3OOPA 1MGTA 4C3IJ 3C2HA 1X2NA 1U5TC 1N25A 3CD6I 1JUMA 1XSXA 3H1CA 1OCOH 4EQQA 5EYRA 3U1DA 5ILUA 2KRCA 1W5SA 3VDXA 4L5EA 2MD5A 4DW6A 2TCTA 2L02A 3S1RJ 3GO5A 1N78A 3C1DA 2XSDC 1ZR2A 1ZYRF 4V2GA 2DFHA 5HNFA 2PX9A 3H92A 5H2FC 4QSHA 3ZQ7A 2KDZA 1KU3A 4HV5A 4G7ZF 1ZQ3P 3FXQA 2QQAA 1YJWI 3HDDA 2EH3A 1A5JA 2DU9A 1FBSA 2LKSA 2O3FA 3DBRB 4AIJA 5FRMA 3FIWA 2EFQA 3D5RC 2A05A 3IKVA 4XNFA 3F21A 1XGMA 3H35A 3S93A 1XSVA 3PIOF 2R3SA 5DDGA 2DK5A 4XLEA 4A3FJ 4M6XA 4EJUA 1MZBA 4WK8F 5CVIA 1BC8C 1NK3P 2C6YA 4ZYDA 1XPXA 1YYVA 3SZGA 2R7VA 1QZEA 2D1VA 5FKOA 2DW4A 2W25A 4MQVA 5FKLA 3IAS2 1IXCA 3TMOA 2MYSA 4M6YA 3WTSC 4CYDA 4CDGA 3QYFA 4NDLA 1HLVA 1OPCA 2E60A 2COBA 1TT5B 2YSRA 5IOZA 2NNYA 4KJZA 2M0MA 3HOSA 1OR7C 2BEOA 2HQAA 3PUBA 4G12A 4BKXA 2ZJQF 3ZOBA 3DPTA 5BNGA 1K78B 2AO9A 3OYLA 1ZTRA 1NHAA 3M8JA 3OS2A 3OR1C 3FXUA 3T5XA 4KA4A 1JXSA 4RA2A 1QO0D 2K3FA 3PM1A 4KISA 3N4MA 1I3QJ 4EJWA 3K4KA 4LIVA 3GYHX 3G2BA 4GYGA 2H8RA 1YX5A 3FK6A 3SHFA 3WGHA 2VOOA 4C2UA 4W1UA 3E6DA 3NWTA 3CLQA 4EM1A 3CQZJ 1K4SA 3KP5A 1R5HA 4UUVA 1FPQA 5IYCJ 2QKLB 3EDPA 1S6LA 2IT0A 4A2UA 1UMQA 1FIPA 1P4WA 2H6BA 2R7QA 1SFKA 5K7FA 4UNOA 2DFIA 3AFHA 3ASNH 5D5UB 2XDVA 2EA2A 1QBJA 3WTWC 2HOEA 5KHDA 1WJAA 4XKWA 3FXLA 2COMA 2HYGD 3F9KA 3KP6A 1RRJA 3VOEA 1EV7A 2IA2A 2DO7A 1ZRCA 2PMHA 2OA4A 4UUSA 2OAZA 2VI6A 5LFAA 2CW0F 1EKEA 3LL7A 4Y7NJ 1IUFA 1UCRA 2Z99A 3TQNA 4LFUA 4TV7A 2VKDA 5FROA 2O9LA 2EV5A 1AHDP 3QOPA 4D9JA 2EJRA 1R6RA 1BI1A 1HXDA 4GYIA 3SQNA 3GTMJ 2MABA 1YE9A 3PFIA 1SFEA 3QWLA 3OR2C 4A0XA 4ENNA 1FTTA 2P5KA 1A36A 3IH4A 3VYRB 4ETSA 2X1EA 2IBDA 2LRDA 3CC2I 3NAUA 3N05A 2AHQA 2X1CA 2M45A 3IUOA 2BVLA 4G7OF 4A3BJ 1TP4A 2DT5A 3A4CA 4C3HJ 1ETWA 3HBLA 2E1MB 3KZIC 4I2OA 4D7NA 4D0PA 4EM2A 5KNLA 2R5ZB 3UKGA 2ZFUA 3F3XA 2LBFA 3Q9SA 4E7ZA 4UB6C 3H5RA 2R7SA 2WV0A 2H27A 1W7PA 3HOYJ 4Y4RA 4D1QA 1DP3A 4KN7X 2Y2ZA 2B0LA 3MFKA 1KU2A 3UNGC 4DOZA 2M4GA 3D0SA 2DODA 3DEEA 4HW0A 3HKZN 4D5FA 3QPHA 1XCVA 2W00A 1IDYA 3WG9A 3DTEA 4IL6C 2XKOA 3CP8A 1SEUA 3J7YJ 3WTUC 1WKMA 1JKOC 2Y30A 1ENHA 2QQBA 2AQFA 5H6QA 2M1BA 3QPTA 4HZFA 5F08A 1J7KA 1TT0A 4PFPA 4YIIA 5LEJA 3QYBA 3OV8A 2WADA 1ZGJA 5TGTA 4HNVA 1CQTA 2LY9A 1KA8A 2M8GX 3EUHC 1MBFA 3KZZA 5HLGA 5ED4A 3LFUA 5L3BA 3K70D 3D1NI 5EZHA 4OOIA 3IKTA 3DEWA 4XK4A 1QGPA 1S72I 2QGUA 3L9FA 3L2VA 1Z67A 3D5SC 1FOYA 1QHHD 3A02A 3WHCA 2E1MC 2ELJA 4RAZA 3F8BA 3VWBA 2JVGA 1STZA 2P6TA 3CCJI 5FJ8J 3KETA 2LD5A 1U6GA 2M5WA 1PYVA 1OJLA 1BJZA 2WAQN 1SFUA 4XSZF 2DA6A 2XF5A 5HDNA 1NH3A 1V5EA 1YS7A 4ZZDA 1AKHA 2PBIA 1VQ4I 9ANTA 3K2ZA 1ZN2A 2BZTA 3BTCA 1BI0A 5FKNA 4EGYA 4LGWA 3A01B 1R23A 4KT6A 1T08B 1T6SA 3KP3A 3CCUI 1IV8A 3EUKL 2GQQA 3GUDA 3KCCA 3MZHA 3BLYA 4I7HA 4XLFA 1J2XA 2CS3A 2YU9J 3U9GA 4RDUA 3NARA 5ICFA 4AD9A 2JVHA 2V79A 4D5CA 3ELKA 4A3EJ 1L0OC 2DA3A 1R4NB 4Q47A 3HSRA 2ZSHB 3T0YA 3T1BA 1J75A 3HZJA 4BEHA 4O6JA 3M4OJ 3PQKA 3GTKJ 2QQ8A 1FSEA 4L9JA 3B6CA 2MSYA 5LGUA 3GTQJ 5DCMA 4UY8I 3W6KB 2EIMH 3ZMTA 2HFHA 3S3NA 2WB1A 4AVPA 3GFMA 4IQJA 1Y39A 1X1PA 2VJIA 5IOYA 3GFJA 5HOOA 2JT1A 2EZHA 4S0HB 1F9NA 3IAM2 2ZJ2A 2FQ3A 4II2A 2VKVA 3K1MA 5L3DA 2PJRB 1VQ7I 5D5VB 4YEJA 1NG6A 4L5JA 1O3QA 4MEYF 2XROA 4BYYA 2LP0A 1SAXA 2LY2A 1QRYA 1QPMA 2DI3A 4EVIA 4L0ZB 3GVAA 3BR1A 4R8HA 1BR1A 2QENA 3AG1H 3A1YA 4OMYA 2OCEA 3GZNB 3OYEA 1GV2A 2IVMA 1I6HJ 1EF4A 3QU6A 1LNWA 4QPQA 1K83J 3F0CA 2VLAA 3BPVA 2IS4A 3MAJA 3V7RA 1KGSA 5DV5A 1FSHA 3GLLA 3OY9A 2DA1A 3G1LA 3WTZA 1YJ9I 1R9TJ 1FWZA 1FZPB 4K2EA 2CRGA 4IRHA 3MKWB 4B8XA 4ESFA 4KIBA 3DF8A 3LAJA 3WU0A 2Y9YA 4HNUA 2ZJPF 3HOTA 1X2MA 3R4KA 5TJJA 4A5NA 4U7DA 2ZFWA 1IF1A 3R61A 4BXFA 1LDJA 5JI6A 4JP0A 4HLXA 2BY1A 1FTZA 2H8WA 5GTHC 2E2IJ 5EG0A 3BTIA 2OC6A 5FLVA 2HVRA 1YIOA 1D1AA 3HUGA 5DD8A 4IJAA 3S1MJ 1D1BA 1ETVA 4WXHA 5F27A 3HIFA 4ZC3A 5J8CA 2CH0A 2RQPA 3SEZA 1E0EA 3E5XA 2ELHA 2VASA 1HC8A 1U9NA 4B3AA 4NQWB 2JA8J 4BDZA 5DCMB 1ODDA 4EGZA 1I27A 2LTPA 4JQFA 1A35A 1X3UA 2LOOA 3WE2A 3BR2A 1X4PA 2EZKA 4R1HA 2M7AA 4CA0A 3R0AA 3VSLA 4XL9A 1T8IA 2BW3A 4M9SA 4Q48A 5F0HA 1PUFB 2HZDA 2KIQA 2M7BA 5HS8A 1X1CA 2XSJC 3J7ZI 1RKWA 3GFLA 4BJ5C 2ZNZA 3BQZA 1MKMA 2HYFA 1DQUA 3L7WA 4NC6A 4XONA 1BR2A 3M1CA 2PG4A 5LGNA 4CCLA 2DPDA 2H6CA 1T98A 2D2WA 5DM6F 1QQIA 2VE8A 2OQGA 4XOTA 3QP6A 1VQLI 2M4KA 2K4BA 2E34A 2G9WA 2K40A 3E6BA 1WJCA 3S15J 4FETA 4AC0A 1R00A 2X4HA 5C3EJ 3GTLJ 2RKHA 4PGHA 1WPKA 1B8IB 1WHUA 1USTA 2KDOA 4LIUA 1HW5A 2XAUA 3W6JB 2VPRA 1TWAJ 1FJLA 3LSHA 4MFEA 5J1YA 5A2QZ 4M3BA 1LUJB 1T56A 3G1MA 4XSXF 4UV8A 4ESJA 3BY6A 1L3LA 3KPHA 3ECOA 3OYKA 2YPRA 2F5FA 1G3TA 1QA6A 1ZLKA 2HDWA 3W2AA 2IS6A 2GM4A 1LEAA 1YO5C 3S16J 2K9LA 2H09A 3CCMI 4CO8A 3M3YJ 2VQGA 1FYMA 4YFKF 3HSFA 3F72A 5GPAA 2KRHA 2PFBA 2YU3A 2DXIA 1W5TA 1LKXA 3J81Z 2LNBA 1KZHA 5K5RA 4QPOA 2A5YB 2F5EA 3FK7A 4XLCA 2VL8A 1HQCA 1SD6A 3TOBA 1Z3YA 5BPDA 2UXXA 4WWCA 3E7LA 3HGGA 1JUSA 2BV6A 1SANA 2KMUA 4WF2A 3MZYA 4AYBN 5M3MJ 2BXZA 3FMSA 3HTSB 4BXXJ 4HDUA 1ZG3A 3MKLA 4P1WA 4LLLA 4E4HA 1MBGA 1O3TA 5JVGF 3OYGA 3RYPA 2E35A 4UVAA 3L2QA 1FYLA 3HRTA 5K7ZA 4PJJA 2EFPA 3ABLH 2L0KA 4I02A 1ERDA 1V3FA 4IHYA 2Y48A 5D5XB 4AIDA 3MCZA 1JI8A 2GXBA 1U3EM 1HCRA 4CUGA 4A3GJ 1SVLA 2BW3B 3QPLA 4XLPF 1I39A 2V1UA 3BTLA 2LF7A 1X1DA 1XB4A 1TL8A 1DGRM 5D6FA 2NYXA 2XAJA 4LB5A 2KZGA 1P7IA 4KIGA 4RGRA 2DA2A 3CC7I 3DWLE 1B1BA 2FBHA 3CP2A 2V1XA 4RB3C 1SD5A 3LOCA 4HLYA 1B72A 2GLOA 3HRUA 2HQNA 5ILVA 1WWXA 5HDKA 5B1AH 4B1RA 1Z7UA 3F8MA 4ANJA 2EIKH 3L2CA 3V7SA 2HEOA 4DYQA 3HKZA 1UELB 3RSNA 4Y15A 3WTXC 4RM2A 1X58A 3ZMSA 2DMNA 1WZ2A 4XOPA 3BJAA 2BHYA 2HR3A 3GTPJ 2FQ4A 3IHUA 3WHBA 2Y75A 2R7ZJ 2QLZA 5LD2C 3OYHA 4ZTJA 2O03A 3KP7A 1ZGAA 2PLYA 1O7LA 4LG3A 4XN0A 2DFFA 1I1SA 3WGGA 4F55A 2PMUA 3DXJF 3CMMA 3HHGA 2V1NA 4G94A 4GCVA 4XN3A 4I01A 2GA2A 2RAEA 2ME0A 1GXQA 1X3WB 3LA2A 4KMUX 1OCRH 4IKFA 3FBIB 1IN5A 3DLAA 3BJOA 1EA3A 5FFZA 3C2BA 2W1OA 1T0FC 2L4AA 1UJ8A 4M3FA 4L5IA 2R5YA 4CHUA 2XAHA 2EZLA 4CSWA 3S2DJ 1OYWA 1W1WE 3L2UA 1LFBA 2DJNA 4P9UA 2RREA 4AWXB 2KZVA 2VBYA 3WU1B 5IT3A 4RB0A 4LD5A 2WAQA 1PJRA 1VQKI 2XKPA 3WTTC 3OSGA 2B9SA 2DTZA 4Z6YA 1JJ6C 4PJLA 2VOPA 2X0LA 2DK8A 2Q0OA 1X4OA 4EJOA 4PFOA 2NVXJ 2Y0MA 4E7SA 2JWTA 3MQ0A 3TO6A 2DT7B 2F4OB 3J80K 2JZYA 4BHPA 1CF7B 1D3YA 2ISYA 2E5ZA 5HLHA 2W7NA 2E2HJ 3PO3J 4LB6B 2IS1A 3CDLA 3LSGA 3H5NA 4CGZA 2HTSA 2QM3A 4RBOA 3IH3A 1ZELA 3K4JA 1BL0A 5DD4A 3PNVA 2LKPA 3I59A 3S14J 4D7MA 4XM3A 1T2KA 2MH2A 2GIZA 3P9IA 3QYEA 4PUSA 4BBRJ 3E97A 2DQRA 4DYRA 1MSEC 4OIQF 2CQNA 2VXZA 2BYVE 3PIPF 2P7VB 2MLKA 4JX4A 1OYYA 3QU3A 4AIKA 2XC7A 1Z6RA 2XHKA 4R79A 5C4JJ 1NK2P 4BH9A 1ZHFA 2UZKA 3SDGA 3BG5A 3RKWA 2V9KA 3MWMA 1RUNA 1RPWA 1R4MB 1XGSA 1DPUA 1BI2A 4IHTA 2RNJA 3RIRA 1WJEA 2IXSA 1P4XA 1OCZH 1EH7A 2ZXHA 5HS7A 1FIAA 2ZXIA 5D8LB 1HA8A 3QP5A 1LFUP 4A0ZA 1Y0NA 4XKBA 1SMYF 1T38A 4IHVA 3OMYA 1D0ZA 1K4TA 1FOXA 2L9NA 2DDBA 2QZ8A 3X2QH 4AU7A 2VB6A 2VBZA 1IUYA 3CO6C 5HNHA 1Y1WJ 2MH9A 2FOKA 2GZWA 4B09A 5IT9K 1BM9A 1XDSA 2CUJA 2PMZN 4LJZF 1TTYA 2XGEA 2UXNA 3Q0VA 3S1QJ 2IAIA 5GPCA 2Z33A 3DBLB 1XN7A 1ZG1A 3DPLC 1BJAA 2EILH 5DUIA 1GVJA 5E8GA 1ZAOA 4B3XA 2K3PA 3BG7A 3RPUD 4J00A 4PGGA 3AG2H 3GEZA 3I71A 1MBKA 3HJEA 3P5JA 3LQQA 5B3SH 4UV9A 1MW7A 5CVUA 2R7OA 1SAUA 3H3VK 2ZC2A 3PL8A 3TL4X 5J6XA 4U88A 4KN4X 4E7LA 3VPRA 4ZDPA 1OISA 2AXLA 3JW4A 3JR9A 4E7KA 2DMPA 3A2KA 1MJBA 5J8FA 2O6GE 3LA7A 2BY2A 2KHMA 3VSKA 1OCCH 2IGOA 2LREA 4LOCA 4IF4A 2R7XA 1MMGA 1VQPI 1I1GA 3BQYA 3SXYA 3O3KA 1IDZA 4PDKA 2DMQA 5FRNA 1YIJI 1PUEE 1P6RA 2ID6A 3K4NA 3JCUC 3LMMA 3CESA 1LQ1A 2VBWA 1YJNI 1UHWA 2VODA 2Z1DA 4JX6A 2F4IA 3A03A 4X0GA 5M5WJ 2LVSA 3DTIA 1K61A 1YI2I 1RC9A 2IEKA 2QVOA 3RYRA 3OYAA 2Z16A 1UB9A 4YFNF 1TQIA 1B4AA 2VKEA 1W36C 1LEBA 3WG7H 3PUFA 4ZH4F 1WSUA 4F92B 1JKQC 4EEFG 2UUZA 3M07A 4XICA 5DYMA 4XRMA 2GBYA 1TQMA 2ID3A 4E70A 3U1KA 1S5LC 2XIGA 4AIHA 1ITYA 5C44J 5D6EA 2ZNYA 4EM0B 2F5DA 1R58A 3P9CA 5E17F 2A68F 2JA6J 2GIVA 1JGGA 4CZCA 3SZTA 3VYTB 4J01A 1S7AA 1TWHJ 1WJ5A 1G2HA 2M3AA 3E6CC 5J4YA 2Q1ZB 4NC7A 4RGXA 4MTDA 2VPLA 2E7WA 4CICA 2JPCA 2FXAA 3OYCA 1ZRFA 1U9OA 4I6ZA 2STWA 1DDNA 3K7AJ 3NQOA 3DU5A 3ZMVA 5CVJA 2ELKA 3BC8A 3CUQA 1YRNA 2JUGA 5GAEJ 1YW7A 2JRMA 2ZO4A 1B6AA 3GX4X 4ZJZA 4UXNA 4ZYAA 3RZOJ 4Y17A 2NVQJ 1IN6A 5AONA 3TDZC 1PDNC 1XMXA 2HXIA 2QSHX 1XGNA 2YS9A 3M7GA 5BS6A 2HZTA 1WGXA 5E18F 1P4AA 2LFBA 3JRGA 4YELA 2VT3A 2TRTA 3ZCOA 4N9HA 2L2OA 3LSPA 4BU2A 2JQ7A 3DQVC 2HXOA 5LHGA 1XX5A 5KCMA 2O8XA 5D8KB 3FM5A 2LF8A 1ON2A 2WV1A 3KX2A 1LVKA 3ONQA 3CJQB 2MA3A 2Y9ZA 5D4RA 1ETOA 2KJCA 3DKXA 3UR3C 4DNCA 4B43A 1DGWY 4XLNF 1O57A 2DOEA 5HS9A 1S8NA 3H9JA 1Q1HA 3RQ4A 4DIQA 3ZN1A 2E36A 2FOWA 2QKMB 3I53A 2KQRA 3RJPA 2I5UA 3VFZA 4U7BA 4Q5SF 4AYBA 2CGPA 2DYSH 1HW1A 2Q8KA 2CJJA 3W6VA 4L0YB 3V8LA 1ETXA 4GFBA 2XF6A 5GAGJ 3CF5F 3KIOA 3K1PA 4Y52J 1BA5A 2FF4A 2ACJA 1EH6A 2DCEA 2CQKA 1D0XA 1USSA 2OBPA 2QYOA 4BE1A 2CFXA 4L9NA 1WJDA 1WJBA 3F6OA 4X1EA 3V8KA 1V5FA 2Q2EA 2EB7A 3FKJA 5LRSA 5F1JA 1UHMA 3CMAI 1YW9A 4EATA 4UUSB 2L3DA 1JGSA 2V1DA 4YFXF 4ENMA 1MNDA 3ZMZA 3RDIA 5E8IA 3S2HJ 2FUG2 4I98B 3JTGA 3FXKA 1A31A 4IHSA 1FX7A 1G6NA 2W48A 4KIFA 3I4MJ 1WRJA 3FF5A 2R93J 2VC1A 2EIJH 3KYLA 4QLCU 4ZDLA 4BE0A 4KNYA 4ZZLA 3PSFA 3F6VA 1KQ0A 3OIOA 3I5UA 5DUKA 3E3VA 1FBUA 2BHZA 2X51A 3DBHB 2RDPA 2LBFB 1UFMA 3OL3A 3LA3A 1YFHA 5KVRA 2LK2A 4CYCA 4XBFA 5J3LA 4XRFA 1W7PB 3K2AA 1KQ9A 5L3EA 4OAZA 1F5TA 3KYDB 2DDAA 1RKTA 5J47A 4M6VA 3ZQQA 3HSEA 5TISC 2UWMA 3C7JA 2FX0A 3VODA 4C2TA 5JLWA 3VB2A 2GWRA 4BQOA 1B9MA 2MG4A 2EZIA 3H0GJ 2R92J 1SVOA 1FBQA 3I0TA 5M5XJ 4XR6A 1Z05A 4AM3A 4RB1A 5F6FA 1SFOJ 2QCOA 4XORA 3T8TA 3ABUA 1DU0A 4ON0A 1BIBA 1Z7LA 3JRBA 4I0AA 1AOYA 2PI0A 5JFRA 1H0MA 2VXDA 3IP4B 4QTRA 2L7FP 1MD0A 5FLXZ 2Z9OA 3RTRA 2H94A 3GF2A 2VC0A 4HA8A 3WE3A 2ADUA 5EF6A 4BDYA 5IP6A 1JKPC 3CJRB 2JSPA 3BCBA 3JRAA 1R5ID 2HOTA 2OZUA 3GMEA 3MKZA 2ZMEA 4Z2YA 4HX4A 4A3JJ 4OIRF 4EJTA 2E1NA 2M34A 1GVDA 5DEQA 5EJCA 2ZB9A 2G7HA 2K5CA 4FE4A 1R22A 4M9ZA 3ZMUA 2LDUA 4MO7A 5L3GA 2KFDA 2CFOA 3BWGA 4OIOF 1HKQA 1Y6IA 3GZ5A 4GO1A 1G3YA 1O7FA 5B66C 3I9V2 1AKHB 2TDXA 1ZKGA 4HX8A 2HS5A 2W4SA 3U21A 3I4NJ 2QF7A 1TWFJ 5DS9A 2A5WA 5E1XA 3TBIA 1J09A 1YG2A 4H0EA 2R7WA 1AU7A 3ZRGA 2OU2A 4BBSJ 5JHFA 4P9FA 4IO9F 1W4MA 2LG4A 3LSKA 1MMDA 1D5YA 1YW8A 3BR5A 3HOXJ 1ZG5A 1V4RA 4XIDA 2RV8A 3GTGJ 3T8RA 5JR3A 2VBXA 5CVRA 1TC3C 3EUAA 4L18B 4DYCA 4G6TB 1WI9A 2DOFA 4B48A 2IS2A 3G3ZA 4BEHB 3CCEI 5BMZA 2PMZA 3HL2A 2QWWA 1XCBA 2EA4A 2VT2A 2NS8A 1RNLA 3OL4A 1ETKA 3OIPA 1H8AC 3AAFA 3I55I 4UVBA 4LG0A 1MDMA 2YX4A 1F4KA 1UAAA 3BTJA 2QEXI 5LEKA 4HF0A 1Z91A 2X85A 3FWEA 4FASD 1IRZA 1I6XA 2CMPA 2QSGX 4RS8A 3OYJA 2X6YA 1IN8A 2K27A 3ZQGA 4ESBA 4A3DJ 4GGGA 1JT6A 4A0YA 1FOKA 1D8JA 2UV1A 4F7ZA 3Q0WA 2LYCA 1WVRA 3C3WA 4CCMA 1QVTA 5EDNA 3GBGA 2HKXA 4ENKA 4U0VA 3S17J 5HDGA 3JAMK 4KFCA 2O5RA 3DTKA 3RKXA 1FMWA 3KLOA 2NVTJ 5AIPA 4XLHA 4V2FA 2M30A 2VJJA 1RIOH 2VQLA 2BOLA 3ZQFA 4I76A 2DN0A 2JRTA 4PJMA 5B5EC 3ZMDA 4E7IA 1D8KA 4IEJA 1MNMC 1MIJA 2M8EA 4FQGA 2D1HA 1S9HA 3HOWJ 2WC2A 1JTXA 1XGOA 2I8DA 5K7HA 1MSFC 5K5OA 1ZR4A 5FLXK 2QBYA 2KIMA 2QSFX 4DJAA 2BY3A 2XF7A 3FDYA 4ASNA 1XD7A 1MBJA 1POGA 3TGNA 1QNTA 4FT8A 2J5PA 4F93B 3HPGA 3GFIA 2W84A 1P9QC 3ABKH 1BBYA 5FD6A 1VQ9I 2H1KA 5B1BH 1DPRA 2CV2A 4B44A 5ERIA 4M71A 5HLTA 4MLOA 5EG0B 3LNQA 2KLOA 2GA1A 5J40A 2WY7Q 3MKYB 3OYIA 2XGXA 1HSJA 2OD5A 3J80Z 2Y0SN 4LLNA 3HUGB 1H89C 3CCQI 3QRFF 3JRIA 3RI4A 1G4DA 2L01A 1XMAA 2LR8A 1U5TA 3DLLF 4FTHA 3HXLA 4XQFA 2FD5A 1S7EA 1ORKA 2V6CA 1T39A 3E6MA 2BGCA 4I09A 3QOEA 5K5QA 5CPRB 1WFXA 3ABTA 1TWCJ 1MMAA 3DU6A 4P55A 2DQLA 4MQ9F 1BW5A 3DPUA 3K70C 2L7MP 4LG0B 3KYCB 2WA0A 1TNTA 3G73A 2YUSA 2KIUA 1Y0UA 4G6DA 2P4WA 3CDHA 4MNUA 4C30A 2CUFA 3PO2J 1X3ZB 1O3SA 3GWZA 2NNNA 3WU2C 4IHWA 2IGKA 2ZCWA 2K9SA 1LE8A 2FEZA 4WXDA 4QWQA 1MBEA 3BR6A 1HBXG 2CW7A 3O6BB 5EGOA 1RR7A 1H9GA 3BG6A 3KFWX 3TP0A 1VQMI 2FRHA 1JE8A 1FT9A 2W82A 4B47A 1VZ0A 3O2PE 4A5MA 3L00A 2X6WA 4BY7J 3ZN0A 2JA7J 2PEXA 5IT9Z 1FLIA 3M8EA 5KAIC 3H9QA 3BDDA 2CQXA 2HPIA 1G3SA 2JK3A 4FX4A 3BG9A 2GOXB 1LDKB 4ITVA 5FFXA 4A6DA 5ICGA 3BOQA 2L7ZA 4BNCA 4HEA2 1RZ4A 1D0YA 4JBAA 5J1RA 1R7JA 2WWYA 4IZZA 1O3RA 4NUBA 3ERMA 4MTEA 2YR2A 3BROA 2NOGA 5E3MA 1OR7A 1FEXA 4OAYA 1ETYA 1V54H 2V9VA 2G7UA 2VJ5A 3KEYA 4BQAA 3K0LA 2XRNA 4FCYA 4EV0A 3TP3A 5IP9J 4Y13A 3K6GA 1SD7A 3R60A 5DTDA 3MEXA 4L9TA 2HKOA 3FMQA 3HG9A 3LAPA 2YX7A 5IYBJ 3Q0UA 2CQQA 4HNTA 1MNEA 2CV1A 2WAFA 3CMYA 1HKSA 1TLHB 2V7FA 5F1RA 2DMTA 2OV7A 3CCYA 2Y69H 4L9VA 1IAWA 3SDBA 4WCGA 2P8TA 2MD0A 4S05A 4EJVA 3HOUJ 3TOAA 3Q3SA 4G8XA 3HHHA 2EFOA 3GZ6A 2CU7A 1JUPA 2PQ8A 3OS0A 1SFXA 1IZ1A 2I10A 3I3LA 1E3HA 4YIRX 2VKHA 1G3WA 1UG2A 1SD4A 3KEQA 4BL0B 3FXJA 2A3SA 2R7TA 1GV5A 1QU3A 2ZXWH 3IV5A 1VTNC 3MVPA 2BE5F 2VN2A 3BG3A 4X6AJ 1XG1A 1W5CC 3QQAA 3ZPLA
chains in the Genus database with same CATH topology
2KIFA 3F8FA 3LFKA 5FD5A 4M74A 2A07F 4PCQA 4A12A 1P2FA 2GXGA 1IN7A 3IL2A 1B59A 2FMLA 1ZH5A 3CJNA 3WTVC 1FP1D 1K78A 3ML6A 3KP4A 1EH8A 2EV6A 1H9TA 2LSOA 4BXUA 2HDCA 2A69F 2M87A 3HRSA 1P92A 1IRFA 4IRIA 3KLNA 3B73A 3FM3A 1E2XA 4LK0F 3BJ6A 3KP2A 3IRRA 2EFWA 3JSPA 2A61A 1DP7P 4RAYA 3EQLF 4P96A 1Z9CA 2RC4A 2NS0A 1TBXA 3M8FA 3EUHA 2IPQX 1PP7U 1FYKA 4HAMA 3IC7A 3S2WA 2R7DA 3FZVA 1K6OA 2XV4S 3JSOA 3E5UA 3CUOA 2CO5A 5LBQA 3GW2A 2EV0A 5FB2A 1BIAA 3I59B 4OIPF 1K79A 1S3JA 1W7PD 5LLQA 3DKWA 1S7OA 2P5VA 5AIQA 5TRDA 2FNPA 5H20A 1F1ZA 2NRAC 5LHIA 2VE9A 4IXAA 3NEUA 3F8CA 3D5LA 1HW2A 5HLIA 2ZKZA 4MEXF 4UHTA 4UVCA 3WTYC 3V4GA 1S29A 5LHHA 2IA0A 5FO5A 5E20A 2K86A 1XSDA 2E1CA 2RVCA 3RPUA 2CYYA 4U0YA 1KYWA 3PQJA 5L3FA 2D45A 1K7AA 2O61A 1ON1A 2IA1A 1B9NA 5CJ9A 3HRMA 4OU0A 1DUXC 2ISZA 1C0WA 2WTEA 2KRFA 4HF2A 3P7NA 1ONVA 3N97A 1WQ2A 4YG2F 1U78A 3TO7A 3DFGA 5JVTA 1ZLJA 2AS5F 2OQRA 3F23A 2Z3YA 4HDVA 1BC7C 3KZYA 2PN6A 4CXFA 3EYIA 2IJLA 4O3MA 1KQ8A 3I58A 1IXRC 2CG4A 4M9XA 2W24A 4HV6A 4GXOA 1HKTA 1GXPA 3REOA 4FX0A 4MGRA 3IWFA 4A6EA 4RGSA 1D5VA 1BI3A 1XDUA 3KE2A 1LJ9A 4RB2C 2F5CA 2XAGA 2EWNA 1BN5A 1SMTA 5H6RA 4CZZA 5LGTA 4ZYGA 3CUQB 1Z1DA 2FNAA 4P5OA 3H3UA 4PZJA 3TDUC 5F64A 4N0BA 4IRGA 5EEGA 4BAYA 1LDDA 2Z5UA 3ERED 1QZZA 5EEHA 4LMYA 2XAFA 2QQ9A 5LRRA 3VEPA 4KT5C 1R1UA 3JAMZ 5L3CA 3WGIA 2ZBKA 4DQ2A 4HF1A 1KU9A 3NRVA 1XMKA 4EMSA 2QUFA 2FU4A 4NQWA 4U0WA 3L09A 3CLOA 2XUBA 3RKYA 3R6SA 2L4MA 2BBYA 4M72A 4KDPA 3CUQC 2FE3A 2DLLA 4KICA 1R1TA 1Z6TA 1MJ9A 4G6QA 1J0RA 4G7HF 3SZPA 4IPAA 2K02A 3I64A 4M73A 2MC3A 3QAHA 1OKRA 1J9IA 3E5QA 1KYZA 3LSTA 5ICCA 3HYIA 5D4SA 3M1EA 4LK1F 1TNSA 3H3ZA 3JTHA 3SFZA 1IXSB 3K69A 2L54A 2HQRA 2OZ6A 2K7LA 4BHBA 5KK1A 5HVQC 2W85A 1ZARA 1YQAA 3B02A 2CWEA 4HOBA 3R0JA 2FA5A 4LLGF 3DEUA 3I4PA 4OMZA 4BHCA 3I54A 3FMRA 1FY7A 2RN7A 3CTAA 2VONA 2IW5A 2DTRA 4KYWA 3DV8A 1OMIA 3M9AA 1U2WA 3K9TA 2RGVA 3COAC 3ECHA 4JK1X 4OINF 2R7FA 5BQTA 1LVAA 2FBKA 6PAXA 4HYEA 3HTUA 4NHJA 2HTJA 4O5VA 4S04A 1GHCA 3FXRA 1TW3A 2XAQA 2ZMEB 3IWZA 3FHZA 1T0FA 4ZYHA 2MLGA 2HGCA 1IN4A 4HX7A 3TO9A 2E7XA 2ZXJA 1FC3A 2CSOA 2KKOA 1YS6A 1BOAA 3F8NA 2JPBA 1TQPA 5D5WB 2JTVA 2O0YA 3J7AO 3ISPA 3V8JA 4I0BA 2PJPA 1HSTA 1PP8F 5FGMA 2A6EF 2P6SA 1ULYA 4MHGA 2DPUA 1ZREA 2P5LC 3CO7C 3BZ6A 4WX9A 2XASA 4ZYEA 1MDMB 1J59A 2FSWA 1YTYA 3Q5FA 1TW2A 4HBLA 4ENJA 2DAOA 1RI7A 3BP8A 2EK5A 2FMYA 2JSCA 3V7CA 2IP2A 3IRQA 2ETHA 2EFNA 1JHFA 5CYVA 2STTA 1YLFA 3F22A 1FNNA 2KJBA 4YIFA 1I5ZA 3RPQA 1U8RA 1CF7A 3LQRA 2A6HF 3LWFA 2ESHA 1IRGA 1IW7F 2GAUA 5JHUA 1A04A 1AWCA 4N9IA 4IVNA 2W57A 4G9YA 2QBYB 5K1YA 3EETA 2FBIA 2K4JA 5ICEA 1FP2A 1R1VA 5E1ZB 2MBFA 2ESNA 5CLSA 1R36A 4RGUA 3TKYA 5ILSA 4HQEA 1OYIA 2DBBA 3GXOA 2NAZA 1REPC 3DP7A 2IRFG 1RUOA 3ZP5A 1U5TB 3K1NA 2J5OA 2F2EA 3ROUA 3KEOA 5BOXA 1KU7A 3C18A 4FHTA 2XVCA 3BPXA 4KUMA 5A2QK 4WXCA 3U2RA 4KMFA 5CVVA 3ULQB 3P9KA 5BPIA 3EYYA 4Q4ZF 3WODF 1QZYA 1J5YA 1ZRDA 3J81K 3Q9VA 2HWVA 3FX3A 3GLXA 1MJAA 2P7CB 1JHHA 5E1WA 1CGPA 4NB5A 1LB2A 1E17A 5DCFA 1R5GA 4HQMA 3OOPA 1MGTA 1U5TC 1XSXA 4EQQA 3U1DA 5ILUA 1W5SA 2MD5A 2L02A 3GO5A 3C1DA 1ZYRF 3H92A 3ZQ7A 1KU3A 4HV5A 4G7ZF 3FXQA 2QQAA 2DU9A 1FBSA 2O3FA 4AIJA 2EFQA 3IKVA 3F21A 1XGMA 1XSVA 2R3SA 5DDGA 2DK5A 4M6XA 4EJUA 1MZBA 4WK8F 5CVIA 1BC8C 2C6YA 4ZYDA 1YYVA 2D1VA 2DW4A 2W25A 4MQVA 1IXCA 4M6YA 3WTSC 4CYDA 4CDGA 1OPCA 2YSRA 2NNYA 3HOSA 2BEOA 3DPTA 1K78B 1NHAA 3FXUA 3T5XA 4KA4A 1JXSA 1QO0D 3N4MA 4EJWA 3GYHX 4GYGA 3SHFA 3WGHA 2VOOA 3E6DA 4EM1A 3KP5A 1R5HA 4UUVA 1FPQA 3EDPA 1S6LA 2IT0A 4A2UA 1P4WA 2H6BA 4UNOA 2DFIA 5D5UB 2EA2A 1QBJA 3WTWC 2HOEA 2COMA 2HYGD 3KP6A 3VOEA 1EV7A 2IA2A 2DO7A 1ZRCA 2PMHA 2OA4A 2OAZA 2CW0F 1UCRA 2Z99A 3TQNA 4LFUA 4TV7A 2EV5A 3QOPA 2EJRA 1BI1A 1HXDA 4GYIA 3SQNA 3PFIA 4A0XA 1SFEA 4ENNA 2P5KA 4ETSA 2M45A 4G7OF 2DT5A 4I2OA 4D0PA 4EM2A 3Q9SA 3F3XA 2WV0A 2H27A 1W7PA 4KN7X 2B0LA 3MFKA 1KU2A 3D0SA 4HW0A 3QPHA 1XCVA 3WG9A 2XKOA 3WTUC 1WKMA 2QQBA 5H6QA 2M1BA 3QPTA 4HZFA 1J7KA 4YIIA 5LEJA 3OV8A 1ZGJA 1KA8A 3KZZA 5ED4A 5HLGA 5L3BA 4OOIA 3IKTA 1QGPA 3L9FA 4RAZA 3F8BA 1STZA 2P6TA 3KETA 1U6GA 2M5WA 1SFUA 4XSZF 5HDNA 1YS7A 4ZZDA 2PBIA 3K2ZA 1ZN2A 1BI0A 4EGYA 4LGWA 1R23A 1T6SA 3KP3A 2GQQA 3GUDA 3KCCA 3MZHA 4I7HA 1J2XA 3U9GA 5ICFA 4AD9A 2V79A 3ELKA 1L0OC 4Q47A 3HSRA 3T0YA 3T1BA 1J75A 4O6JA 3PQKA 1FSEA 4L9JA 5LGUA 5DCMA 3W6KB 3ZMTA 2HFHA 4AVPA 3GFMA 3GFJA 5HOOA 2JT1A 1F9NA 2ZJ2A 2FQ3A 5L3DA 3K1MA 5D5VB 4L5JA 1O3QA 4MEYF 2XROA 4BYYA 1SAXA 2DI3A 1QPMA 4EVIA 4L0ZB 3GVAA 4R8HA 2QENA 4OMYA 2IVMA 3QU6A 1LNWA 3BPVA 3MAJA 3V7RA 1KGSA 5DV5A 1FSHA 3WTZA 1FWZA 1FZPB 4K2EA 4IRHA 4B8XA 4ESFA 4KIBA 3DF8A 3LAJA 3WU0A 1IF1A 3HOTA 5TJJA 3R4KA 4A5NA 4U7DA 2ZFWA 3R61A 1LDJA 5JI6A 4HLXA 1YIOA 3HUGA 5DD8A 4IJAA 4WXHA 3HIFA 5J8CA 2RQPA 3E5XA 2ELHA 5DCMB 1ODDA 4EGZA 1I27A 4JQFA 1X3UA 3WE2A 4R1HA 3R0AA 4M9SA 4Q48A 5HS8A 3GFLA 2ZNZA 1MKMA 2HYFA 3L7WA 2PG4A 5LGNA 2DPDA 2H6CA 1T98A 2D2WA 1QQIA 2VE8A 2OQGA 3QP6A 2K4BA 2G9WA 3E6BA 1R00A 2X4HA 2RKHA 4PGHA 1USTA 1HW5A 3W6JB 5A2QZ 4XSXF 4UV8A 4ESJA 3BY6A 1L3LA 3ECOA 2YPRA 2F5FA 1G3TA 1ZLKA 1LEAA 1YO5C 2H09A 4CO8A 1FYMA 4YFKF 3HSFA 3F72A 2PFBA 2YU3A 1W5TA 3J81Z 2LNBA 5K5RA 2A5YB 2F5EA 3TOBA 1HQCA 1SD6A 5BPDA 2UXXA 4WWCA 2BV6A 4WF2A 3MZYA 3FMSA 3HTSB 4HDUA 1ZG3A 4LLLA 1O3TA 3RYPA 4UVAA 1FYLA 3HRTA 2EFPA 4I02A 1V3FA 2Y48A 5D5XB 3MCZA 2GXBA 1U3EM 4XLPF 2V1UA 2LF7A 1XB4A 5D6FA 2NYXA 2XAJA 4LB5A 4KIGA 4RGRA 1B1BA 2FBHA 2V1XA 4RB3C 1SD5A 4HLYA 3HRUA 2HQNA 5ILVA 1WWXA 5HDKA 1Z7UA 3F8MA 3L2CA 3V7SA 2HEOA 4Y15A 3WTXC 3ZMSA 3BJAA 2HR3A 3IHUA 2Y75A 2QLZA 2O03A 3KP7A 1ZGAA 2PLYA 1O7LA 1I1SA 3WGGA 2PMUA 3DXJF 3HHGA 4G94A 4GCVA 4I01A 2GA2A 1GXQA 3LA2A 4KMUX 1IN5A 3BJOA 5FFZA 2L4AA 4L5IA 4CHUA 2XAHA 1OYWA 4P9UA 4AWXB 2VBYA 3WU1B 5IT3A 4RB0A 4LD5A 2XKPA 3WTTC 2VOPA 2X0LA 2DK8A 2Q0OA 4EJOA 2Y0MA 3MQ0A 3TO6A 3J80K 2JZYA 4BHPA 1CF7B 1D3YA 2ISYA 5HLHA 4LB6B 4CGZA 2HTSA 2QM3A 5DD4A 2LKPA 3I59A 1T2KA 2MH2A 3P9IA 3E97A 2DQRA 4OIQF 2VXZA 2BYVE 2P7VB 2MLKA 1OYYA 3QU3A 4AIKA 1Z6RA 2XHKA 4R79A 4BH9A 1ZHFA 2UZKA 3RKWA 1DPUA 3MWMA 1RUNA 1XGSA 1BI2A 4IHTA 2RNJA 3RIRA 1P4XA 5HS7A 1EH7A 5D8LB 3QP5A 4A0ZA 1SMYF 1T38A 2QZ8A 2VBZA 1IUYA 3CO6C 4B09A 2MH9A 2FOKA 2GZWA 5IT9K 1BM9A 1XDSA 4LJZF 1TTYA 2UXNA 2Z33A 1XN7A 1ZG1A 3DPLC 1BJAA 5DUIA 1GVJA 5E8GA 1ZAOA 4PGGA 3GEZA 3I71A 3LQQA 4UV9A 5CVUA 5J6XA 4U88A 4KN4X 3JW4A 2AXLA 1MJBA 5J8FA 2O6GE 3LA7A 4IF4A 1I1GA 3SXYA 3O3KA 4PDKA 1PUEE 1P6RA 1LQ1A 2VBWA 1UHWA 2VODA 2QVOA 3RYRA 1UB9A 4YFNF 1TQIA 1B4AA 1LEBA 4ZH4F 1WSUA 5DYMA 1TQMA 4E70A 2XIGA 4AIHA 5D6EA 2ZNYA 4EM0B 2F5DA 1R58A 3P9CA 5E17F 2A68F 2GIVA 3SZTA 1S7AA 3E6CC 4RGXA 4MTDA 2E7WA 4CICA 2JPCA 2FXAA 1ZRFA 2STWA 1DDNA 3NQOA 3ZMVA 5CVJA 3CUQA 1YW7A 2ZO4A 1B6AA 3GX4X 4UXNA 4Y17A 1IN6A 5AONA 3TDZC 1PDNC 1XGNA 3M7GA 5BS6A 2HZTA 5E18F 1P4AA 2VT3A 4N9HA 3DQVC 5LHGA 2O8XA 5D8KB 3FM5A 2LF8A 1ON2A 2MA3A 5D4RA 2KJCA 4DNCA 4XLNF 1O57A 5HS9A 1S8NA 1Q1HA 3ZN1A 3I53A 3VFZA 3RJPA 4U7BA 4Q5SF 2CGPA 1HW1A 2Q8KA 4L0YB 3V8LA 3K1PA 2FF4A 2ACJA 1EH6A 2OBPA 2CQKA 1USSA 2QYOA 2CFXA 4L9NA 3F6OA 3V8KA 2Q2EA 2EB7A 5LRSA 1UHMA 1YW9A 2L3DA 1JGSA 2V1DA 4YFXF 4ENMA 3ZMZA 3RDIA 5E8IA 4I98B 3JTGA 4IHSA 1FX7A 1G6NA 4KIFA 1WRJA 3FF5A 2VC1A 4QLCU 4KNYA 4ZZLA 3F6VA 1KQ0A 3I5UA 5DUKA 3E3VA 1FBUA 2RDPA 1UFMA 3LA3A 1YFHA 5KVRA 4XBFA 4XRFA 1W7PB 1KQ9A 5L3EA 1F5TA 3HSEA 2UWMA 3C7JA 3VODA 3VB2A 2GWRA 1B9MA 1FBQA 3I0TA 1Z05A 4RB1A 5F6FA 3T8TA 3ABUA 4ON0A 1BIBA 1AOYA 4I0AA 2PI0A 5JFRA 1H0MA 1MD0A 5FLXZ 2Z9OA 3RTRA 2H94A 3GF2A 2VC0A 4HA8A 3WE3A 2ADUA 2OZUA 2ZMEA 4Z2YA 4HX4A 4OIRF 4EJTA 2E1NA 5DEQA 2G7HA 1R22A 4M9ZA 3ZMUA 2LDUA 5L3GA 3BWGA 4OIOF 1HKQA 4GO1A 3GZ5A 1G3YA 1O7FA 2TDXA 4HX8A 2HS5A 5E1XA 1YG2A 4H0EA 2OU2A 4P9FA 1W4MA 1YW8A 1ZG5A 1V4RA 2RV8A 3T8RA 5JR3A 2VBXA 5CVRA 4L18B 1WI9A 3G3ZA 5BMZA 2QWWA 1XCBA 2EA4A 2VT2A 1RNLA 3AAFA 1MDMA 4UVBA 4LG0A 2YX4A 1F4KA 5LEKA 4HF0A 1Z91A 3FWEA 1I6XA 4RS8A 1IN8A 2K27A 4ESBA 4GGGA 1FOKA 4A0YA 1D8JA 4F7ZA 3C3WA 2HKXA 4ENKA 4U0VA 5HDGA 3JAMK 4KFCA 3RKXA 3KLOA 5AIPA 2M30A 1RIOH 2JRTA 3ZMDA 1D8KA 2M8EA 2D1HA 2WC2A 1XGOA 5K5OA 5FLXK 2QBYA 2KIMA 4ASNA 1XD7A 3TGNA 1QNTA 4FT8A 2J5PA 3GFIA 2W84A 1BBYA 5FD6A 1DPRA 5ERIA 4M71A 2GA1A 2OD5A 1HSJA 2XGXA 3J80Z 4LLNA 3QRFF 3RI4A 1G4DA 2L01A 1XMAA 1U5TA 2V6CA 1T39A 3E6MA 2BGCA 4I09A 5K5QA 3ABTA 4P55A 2DQLA 4MQ9F 4LG0B 1TNTA 3G73A 2KIUA 1Y0UA 4G6DA 2P4WA 3CDHA 4MNUA 1O3SA 3GWZA 2NNNA 2ZCWA 2FEZA 4WXDA 4QWQA 1HBXG 3O6BB 1H9GA 3KFWX 1JE8A 2FRHA 1FT9A 3O2PE 4A5MA 3L00A 3ZN0A 2PEXA 5IT9Z 1FLIA 3M8EA 3BDDA 1G3SA 4FX4A 1LDKB 5FFXA 4A6DA 5ICGA 3BOQA 4BNCA 1RZ4A 4JBAA 1R7JA 2WWYA 1O3RA 4MTEA 2YR2A 3BROA 1OR7A 2V9VA 2G7UA 4BQAA 3K0LA 2XRNA 4EV0A 4Y13A 1SD7A 3R60A 3MEXA 4L9TA 2HKOA 3FMQA 3LAPA 2YX7A 1HKSA 1TLHB 5F1RA 1IAWA 4L9VA 4WCGA 2P8TA 4S05A 4EJVA 3TOAA 4G8XA 3HHHA 2EFOA 3GZ6A 2PQ8A 1SFXA 1IZ1A 1G3WA 1SD4A 3KEQA 2A3SA 1VTNC 2BE5F 2VN2A 3ZPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIF A;  3F8F A;  3LFK A;  5FD5 A;  4M74 A;  2A07 F;  4PCQ A;  4A12 A;  1P2F A;  2GXG A;  1IN7 A;  3IL2 A;  1B59 A;  2FML A;  1ZH5 A;  3CJN A;  3WTV C;  1FP1 D;  1K78 A;  3ML6 A;  3KP4 A;  1EH8 A;  2EV6 A;  1H9T A;  2LSO A;  4BXU A;  2HDC A;  2A69 F;  2M87 A;  3HRS A;  1P92 A;  1IRF A;  4IRI A;  3KLN A;  3B73 A;  3FM3 A;  1E2X A;  4LK0 F;  3BJ6 A;  3KP2 A;  3IRR A;  2EFW A;  3JSP A;  2A61 A;  1DP7 P;  4RAY A;  3EQL F;  4P96 A;  1Z9C A;  2RC4 A;  2NS0 A;  1TBX A;  3M8F A;  3EUH A;  2IPQ X;  1PP7 U;  1FYK A;  4HAM A;  3IC7 A;  3S2W A;  2R7D A;  3FZV A;  1K6O A;  2XV4 S;  3JSO A;  3E5U A;  3CUO A;  2CO5 A;  5LBQ A;  3GW2 A;  2EV0 A;  5FB2 A;  1BIA A;  3I59 B;  4OIP F;  1K79 A;  1S3J A;  1W7P D;  5LLQ A;  3DKW A;  1S7O A;  2P5V A;  5AIQ A;  5TRD A;  2FNP A;  5H20 A;  1F1Z A;  2NRA C;  5LHI A;  2VE9 A;  4IXA A;  3NEU A;  3F8C A;  3D5L A;  1HW2 A;  5HLI A;  2ZKZ A;  4MEX F;  4UHT A;  4UVC A;  3WTY C;  3V4G A;  1S29 A;  5LHH A;  2IA0 A;  5FO5 A;  5E20 A;  2K86 A;  1XSD A;  2E1C A;  2RVC A;  3RPU A;  2CYY A;  4U0Y A;  1KYW A;  3PQJ A;  5L3F A;  2D45 A;  1K7A A;  2O61 A;  1ON1 A;  2IA1 A;  1B9N A;  5CJ9 A;  3HRM A;  4OU0 A;  1DUX C;  2ISZ A;  1C0W A;  2WTE A;  2KRF A;  4HF2 A;  3P7N A;  1ONV A;  3N97 A;  1WQ2 A;  4YG2 F;  1U78 A;  3TO7 A;  3DFG A;  5JVT A;  1ZLJ A;  2AS5 F;  2OQR A;  3F23 A;  2Z3Y A;  4HDV A;  1BC7 C;  3KZY A;  2PN6 A;  4CXF A;  3EYI A;  2IJL A;  4O3M A;  1KQ8 A;  3I58 A;  1IXR C;  2CG4 A;  4M9X A;  2W24 A;  4HV6 A;  4GXO A;  1HKT A;  1GXP A;  3REO A;  4FX0 A;  4MGR A;  3IWF A;  4A6E A;  4RGS A;  1D5V A;  1BI3 A;  1XDU A;  3KE2 A;  1LJ9 A;  4RB2 C;  2F5C A;  2XAG A;  2EWN A;  1BN5 A;  1SMT A;  5H6R A;  4CZZ A;  5LGT A;  4ZYG A;  3CUQ B;  1Z1D A;  2FNA A;  4P5O A;  3H3U A;  4PZJ A;  3TDU C;  5F64 A;  4N0B A;  4IRG A;  5EEG A;  4BAY A;  1LDD A;  2Z5U A;  3ERE D;  1QZZ A;  5EEH A;  4LMY A;  2XAF A;  2QQ9 A;  5LRR A;  3VEP A;  4KT5 C;  1R1U A;  3JAM Z;  5L3C A;  3WGI A;  2ZBK A;  4DQ2 A;  4HF1 A;  1KU9 A;  3NRV A;  1XMK A;  4EMS A;  2QUF A;  2FU4 A;  4NQW A;  4U0W A;  3L09 A;  3CLO A;  2XUB A;  3RKY A;  3R6S A;  2L4M A;  2BBY A;  4M72 A;  4KDP A;  3CUQ C;  2FE3 A;  2DLL A;  4KIC A;  1R1T A;  1Z6T A;  1MJ9 A;  4G6Q A;  1J0R A;  4G7H F;  3SZP A;  4IPA A;  2K02 A;  3I64 A;  4M73 A;  2MC3 A;  3QAH A;  1OKR A;  1J9I A;  3E5Q A;  1KYZ A;  3LST A;  5ICC A;  3HYI A;  5D4S A;  3M1E A;  4LK1 F;  1TNS A;  3H3Z A;  3JTH A;  3SFZ A;  1IXS B;  3K69 A;  2L54 A;  2HQR A;  2OZ6 A;  2K7L A;  4BHB A;  5KK1 A;  5HVQ C;  2W85 A;  1ZAR A;  1YQA A;  3B02 A;  2CWE A;  4HOB A;  3R0J A;  2FA5 A;  4LLG F;  3DEU A;  3I4P A;  4OMZ A;  4BHC A;  3I54 A;  3FMR A;  1FY7 A;  2RN7 A;  3CTA A;  2VON A;  2IW5 A;  2DTR A;  4KYW A;  3DV8 A;  1OMI A;  3M9A A;  1U2W A;  3K9T A;  2RGV A;  3COA C;  3ECH A;  4JK1 X;  4OIN F;  2R7F A;  5BQT A;  1LVA A;  2FBK A;  6PAX A;  4HYE A;  3HTU A;  4NHJ A;  2HTJ A;  4O5V A;  4S04 A;  1GHC A;  3FXR A;  1TW3 A;  2XAQ A;  2ZME B;  3IWZ A;  3FHZ A;  1T0F A;  4ZYH A;  2MLG A;  2HGC A;  1IN4 A;  4HX7 A;  3TO9 A;  2E7X A;  2ZXJ A;  1FC3 A;  2CSO A;  2KKO A;  1YS6 A;  1BOA A;  3F8N A;  2JPB A;  1TQP A;  5D5W B;  2JTV A;  2O0Y A;  3J7A O;  3ISP A;  3V8J A;  4I0B A;  2PJP A;  1HST A;  1PP8 F;  5FGM A;  2A6E F;  2P6S A;  1ULY A;  4MHG A;  2DPU A;  1ZRE A;  2P5L C;  3CO7 C;  3BZ6 A;  4WX9 A;  2XAS A;  4ZYE A;  1MDM B;  1J59 A;  2FSW A;  1YTY A;  3Q5F A;  1TW2 A;  4HBL A;  4ENJ A;  2DAO A;  1RI7 A;  3BP8 A;  2EK5 A;  2FMY A;  2JSC A;  3V7C A;  2IP2 A;  3IRQ A;  2ETH A;  2EFN A;  1JHF A;  5CYV A;  2STT A;  1YLF A;  3F22 A;  1FNN A;  2KJB A;  4YIF A;  1I5Z A;  3RPQ A;  1U8R A;  1CF7 A;  3LQR A;  2A6H F;  3LWF A;  2ESH A;  1IRG A;  1IW7 F;  2GAU A;  5JHU A;  1A04 A;  1AWC A;  4N9I A;  4IVN A;  2W57 A;  4G9Y A;  2QBY B;  5K1Y A;  3EET A;  2FBI A;  2K4J A;  5ICE A;  1FP2 A;  1R1V A;  5E1Z B;  2MBF A;  2ESN A;  5CLS A;  1R36 A;  4RGU A;  3TKY A;  5ILS A;  4HQE A;  1OYI A;  2DBB A;  3GXO A;  2NAZ A;  1REP C;  3DP7 A;  2IRF G;  1RUO A;  3ZP5 A;  1U5T B;  3K1N A;  2J5O A;  2F2E A;  3ROU A;  3KEO A;  5BOX A;  1KU7 A;  3C18 A;  4FHT A;  2XVC A;  3BPX A;  4KUM A;  5A2Q K;  4WXC A;  3U2R A;  4KMF A;  5CVV A;  3ULQ B;  3P9K A;  5BPI A;  3EYY A;  4Q4Z F;  3WOD F;  1QZY A;  1J5Y A;  1ZRD A;  3J81 K;  3Q9V A;  2HWV A;  3FX3 A;  3GLX A;  1MJA A;  2P7C B;  1JHH A;  5E1W A;  1CGP A;  4NB5 A;  1LB2 A;  1E17 A;  5DCF A;  1R5G A;  4HQM A;  3OOP A;  1MGT A;  1U5T C;  1XSX A;  4EQQ A;  3U1D A;  5ILU A;  1W5S A;  2MD5 A;  2L02 A;  3GO5 A;  3C1D A;  1ZYR F;  3H92 A;  3ZQ7 A;  1KU3 A;  4HV5 A;  4G7Z F;  3FXQ A;  2QQA A;  2DU9 A;  1FBS A;  2O3F A;  4AIJ A;  2EFQ A;  3IKV A;  3F21 A;  1XGM A;  1XSV A;  2R3S A;  5DDG A;  2DK5 A;  4M6X A;  4EJU A;  1MZB A;  4WK8 F;  5CVI A;  1BC8 C;  2C6Y A;  4ZYD A;  1YYV A;  2D1V A;  2DW4 A;  2W25 A;  4MQV A;  1IXC A;  4M6Y A;  3WTS C;  4CYD A;  4CDG A;  1OPC A;  2YSR A;  2NNY A;  3HOS A;  2BEO A;  3DPT A;  1K78 B;  1NHA A;  3FXU A;  3T5X A;  4KA4 A;  1JXS A;  1QO0 D;  3N4M A;  4EJW A;  3GYH X;  4GYG A;  3SHF A;  3WGH A;  2VOO A;  3E6D A;  4EM1 A;  3KP5 A;  1R5H A;  4UUV A;  1FPQ A;  3EDP A;  1S6L A;  2IT0 A;  4A2U A;  1P4W A;  2H6B A;  4UNO A;  2DFI A;  5D5U B;  2EA2 A;  1QBJ A;  3WTW C;  2HOE A;  2COM A;  2HYG D;  3KP6 A;  3VOE A;  1EV7 A;  2IA2 A;  2DO7 A;  1ZRC A;  2PMH A;  2OA4 A;  2OAZ A;  2CW0 F;  1UCR A;  2Z99 A;  3TQN A;  4LFU A;  4TV7 A;  2EV5 A;  3QOP A;  2EJR A;  1BI1 A;  1HXD A;  4GYI A;  3SQN A;  3PFI A;  4A0X A;  1SFE A;  4ENN A;  2P5K A;  4ETS A;  2M45 A;  4G7O F;  2DT5 A;  4I2O A;  4D0P A;  4EM2 A;  3Q9S A;  3F3X A;  2WV0 A;  2H27 A;  1W7P A;  4KN7 X;  2B0L A;  3MFK A;  1KU2 A;  3D0S A;  4HW0 A;  3QPH A;  1XCV A;  3WG9 A;  2XKO A;  3WTU C;  1WKM A;  2QQB A;  5H6Q A;  2M1B A;  3QPT A;  4HZF A;  1J7K A;  4YII A;  5LEJ A;  3OV8 A;  1ZGJ A;  1KA8 A;  3KZZ A;  5ED4 A;  5HLG A;  5L3B A;  4OOI A;  3IKT A;  1QGP A;  3L9F A;  4RAZ A;  3F8B A;  1STZ A;  2P6T A;  3KET A;  1U6G A;  2M5W A;  1SFU A;  4XSZ F;  5HDN A;  1YS7 A;  4ZZD A;  2PBI A;  3K2Z A;  1ZN2 A;  1BI0 A;  4EGY A;  4LGW A;  1R23 A;  1T6S A;  3KP3 A;  2GQQ A;  3GUD A;  3KCC A;  3MZH A;  4I7H A;  1J2X A;  3U9G A;  5ICF A;  4AD9 A;  2V79 A;  3ELK A;  1L0O C;  4Q47 A;  3HSR A;  3T0Y A;  3T1B A;  1J75 A;  4O6J A;  3PQK A;  1FSE A;  4L9J A;  5LGU A;  5DCM A;  3W6K B;  3ZMT A;  2HFH A;  4AVP A;  3GFM A;  3GFJ A;  5HOO A;  2JT1 A;  1F9N A;  2ZJ2 A;  2FQ3 A;  5L3D A;  3K1M A;  5D5V B;  4L5J A;  1O3Q A;  4MEY F;  2XRO A;  4BYY A;  1SAX A;  2DI3 A;  1QPM A;  4EVI A;  4L0Z B;  3GVA A;  4R8H A;  2QEN A;  4OMY A;  2IVM A;  3QU6 A;  1LNW A;  3BPV A;  3MAJ A;  3V7R A;  1KGS A;  5DV5 A;  1FSH A;  3WTZ A;  1FWZ A;  1FZP B;  4K2E A;  4IRH A;  4B8X A;  4ESF A;  4KIB A;  3DF8 A;  3LAJ A;  3WU0 A;  1IF1 A;  3HOT A;  5TJJ A;  3R4K A;  4A5N A;  4U7D A;  2ZFW A;  3R61 A;  1LDJ A;  5JI6 A;  4HLX A;  1YIO A;  3HUG A;  5DD8 A;  4IJA A;  4WXH A;  3HIF A;  5J8C A;  2RQP A;  3E5X A;  2ELH A;  5DCM B;  1ODD A;  4EGZ A;  1I27 A;  4JQF A;  1X3U A;  3WE2 A;  4R1H A;  3R0A A;  4M9S A;  4Q48 A;  5HS8 A;  3GFL A;  2ZNZ A;  1MKM A;  2HYF A;  3L7W A;  2PG4 A;  5LGN A;  2DPD A;  2H6C A;  1T98 A;  2D2W A;  1QQI A;  2VE8 A;  2OQG A;  3QP6 A;  2K4B A;  2G9W A;  3E6B A;  1R00 A;  2X4H A;  2RKH A;  4PGH A;  1UST A;  1HW5 A;  3W6J B;  5A2Q Z;  4XSX F;  4UV8 A;  4ESJ A;  3BY6 A;  1L3L A;  3ECO A;  2YPR A;  2F5F A;  1G3T A;  1ZLK A;  1LEA A;  1YO5 C;  2H09 A;  4CO8 A;  1FYM A;  4YFK F;  3HSF A;  3F72 A;  2PFB A;  2YU3 A;  1W5T A;  3J81 Z;  2LNB A;  5K5R A;  2A5Y B;  2F5E A;  3TOB A;  1HQC A;  1SD6 A;  5BPD A;  2UXX A;  4WWC A;  2BV6 A;  4WF2 A;  3MZY A;  3FMS A;  3HTS B;  4HDU A;  1ZG3 A;  4LLL A;  1O3T A;  3RYP A;  4UVA A;  1FYL A;  3HRT A;  2EFP A;  4I02 A;  1V3F A;  2Y48 A;  5D5X B;  3MCZ A;  2GXB A;  1U3E M;  4XLP F;  2V1U A;  2LF7 A;  1XB4 A;  5D6F A;  2NYX A;  2XAJ A;  4LB5 A;  4KIG A;  4RGR A;  1B1B A;  2FBH A;  2V1X A;  4RB3 C;  1SD5 A;  4HLY A;  3HRU A;  2HQN A;  5ILV A;  1WWX A;  5HDK A;  1Z7U A;  3F8M A;  3L2C A;  3V7S A;  2HEO A;  4Y15 A;  3WTX C;  3ZMS A;  3BJA A;  2HR3 A;  3IHU A;  2Y75 A;  2QLZ A;  2O03 A;  3KP7 A;  1ZGA A;  2PLY A;  1O7L A;  1I1S A;  3WGG A;  2PMU A;  3DXJ F;  3HHG A;  4G94 A;  4GCV A;  4I01 A;  2GA2 A;  1GXQ A;  3LA2 A;  4KMU X;  1IN5 A;  3BJO A;  5FFZ A;  2L4A A;  4L5I A;  4CHU A;  2XAH A;  1OYW A;  4P9U A;  4AWX B;  2VBY A;  3WU1 B;  5IT3 A;  4RB0 A;  4LD5 A;  2XKP A;  3WTT C;  2VOP A;  2X0L A;  2DK8 A;  2Q0O A;  4EJO A;  2Y0M A;  3MQ0 A;  3TO6 A;  3J80 K;  2JZY A;  4BHP A;  1CF7 B;  1D3Y A;  2ISY A;  5HLH A;  4LB6 B;  4CGZ A;  2HTS A;  2QM3 A;  5DD4 A;  2LKP A;  3I59 A;  1T2K A;  2MH2 A;  3P9I A;  3E97 A;  2DQR A;  4OIQ F;  2VXZ A;  2BYV E;  2P7V B;  2MLK A;  1OYY A;  3QU3 A;  4AIK A;  1Z6R A;  2XHK A;  4R79 A;  4BH9 A;  1ZHF A;  2UZK A;  3RKW A;  1DPU A;  3MWM A;  1RUN A;  1XGS A;  1BI2 A;  4IHT A;  2RNJ A;  3RIR A;  1P4X A;  5HS7 A;  1EH7 A;  5D8L B;  3QP5 A;  4A0Z A;  1SMY F;  1T38 A;  2QZ8 A;  2VBZ A;  1IUY A;  3CO6 C;  4B09 A;  2MH9 A;  2FOK A;  2GZW A;  5IT9 K;  1BM9 A;  1XDS A;  4LJZ F;  1TTY A;  2UXN A;  2Z33 A;  1XN7 A;  1ZG1 A;  3DPL C;  1BJA A;  5DUI A;  1GVJ A;  5E8G A;  1ZAO A;  4PGG A;  3GEZ A;  3I71 A;  3LQQ A;  4UV9 A;  5CVU A;  5J6X A;  4U88 A;  4KN4 X;  3JW4 A;  2AXL A;  1MJB A;  5J8F A;  2O6G E;  3LA7 A;  4IF4 A;  1I1G A;  3SXY A;  3O3K A;  4PDK A;  1PUE E;  1P6R A;  1LQ1 A;  2VBW A;  1UHW A;  2VOD A;  2QVO A;  3RYR A;  1UB9 A;  4YFN F;  1TQI A;  1B4A A;  1LEB A;  4ZH4 F;  1WSU A;  5DYM A;  1TQM A;  4E70 A;  2XIG A;  4AIH A;  5D6E A;  2ZNY A;  4EM0 B;  2F5D A;  1R58 A;  3P9C A;  5E17 F;  2A68 F;  2GIV A;  3SZT A;  1S7A A;  3E6C C;  4RGX A;  4MTD A;  2E7W A;  4CIC A;  2JPC A;  2FXA A;  1ZRF A;  2STW A;  1DDN A;  3NQO A;  3ZMV A;  5CVJ A;  3CUQ A;  1YW7 A;  2ZO4 A;  1B6A A;  3GX4 X;  4UXN A;  4Y17 A;  1IN6 A;  5AON A;  3TDZ C;  1PDN C;  1XGN A;  3M7G A;  5BS6 A;  2HZT A;  5E18 F;  1P4A A;  2VT3 A;  4N9H A;  3DQV C;  5LHG A;  2O8X A;  5D8K B;  3FM5 A;  2LF8 A;  1ON2 A;  2MA3 A;  5D4R A;  2KJC A;  4DNC A;  4XLN F;  1O57 A;  5HS9 A;  1S8N A;  1Q1H A;  3ZN1 A;  3I53 A;  3VFZ A;  3RJP A;  4U7B A;  4Q5S F;  2CGP A;  1HW1 A;  2Q8K A;  4L0Y B;  3V8L A;  3K1P A;  2FF4 A;  2ACJ A;  1EH6 A;  2OBP A;  2CQK A;  1USS A;  2QYO A;  2CFX A;  4L9N A;  3F6O A;  3V8K A;  2Q2E A;  2EB7 A;  5LRS A;  1UHM A;  1YW9 A;  2L3D A;  1JGS A;  2V1D A;  4YFX F;  4ENM A;  3ZMZ A;  3RDI A;  5E8I A;  4I98 B;  3JTG A;  4IHS A;  1FX7 A;  1G6N A;  4KIF A;  1WRJ A;  3FF5 A;  2VC1 A;  4QLC U;  4KNY A;  4ZZL A;  3F6V A;  1KQ0 A;  3I5U A;  5DUK A;  3E3V A;  1FBU A;  2RDP A;  1UFM A;  3LA3 A;  1YFH A;  5KVR A;  4XBF A;  4XRF A;  1W7P B;  1KQ9 A;  5L3E A;  1F5T A;  3HSE A;  2UWM A;  3C7J A;  3VOD A;  3VB2 A;  2GWR A;  1B9M A;  1FBQ A;  3I0T A;  1Z05 A;  4RB1 A;  5F6F A;  3T8T A;  3ABU A;  4ON0 A;  1BIB A;  1AOY A;  4I0A A;  2PI0 A;  5JFR A;  1H0M A;  1MD0 A;  5FLX Z;  2Z9O A;  3RTR A;  2H94 A;  3GF2 A;  2VC0 A;  4HA8 A;  3WE3 A;  2ADU A;  2OZU A;  2ZME A;  4Z2Y A;  4HX4 A;  4OIR F;  4EJT A;  2E1N A;  5DEQ A;  2G7H A;  1R22 A;  4M9Z A;  3ZMU A;  2LDU A;  5L3G A;  3BWG A;  4OIO F;  1HKQ A;  4GO1 A;  3GZ5 A;  1G3Y A;  1O7F A;  2TDX A;  4HX8 A;  2HS5 A;  5E1X A;  1YG2 A;  4H0E A;  2OU2 A;  4P9F A;  1W4M A;  1YW8 A;  1ZG5 A;  1V4R A;  2RV8 A;  3T8R A;  5JR3 A;  2VBX A;  5CVR A;  4L18 B;  1WI9 A;  3G3Z A;  5BMZ A;  2QWW A;  1XCB A;  2EA4 A;  2VT2 A;  1RNL A;  3AAF A;  1MDM A;  4UVB A;  4LG0 A;  2YX4 A;  1F4K A;  5LEK A;  4HF0 A;  1Z91 A;  3FWE A;  1I6X A;  4RS8 A;  1IN8 A;  2K27 A;  4ESB A;  4GGG A;  1FOK A;  4A0Y A;  1D8J A;  4F7Z A;  3C3W A;  2HKX A;  4ENK A;  4U0V A;  5HDG A;  3JAM K;  4KFC A;  3RKX A;  3KLO A;  5AIP A;  2M30 A;  1RIO H;  2JRT A;  3ZMD A;  1D8K A;  2M8E A;  2D1H A;  2WC2 A;  1XGO A;  5K5O A;  5FLX K;  2QBY A;  2KIM A;  4ASN A;  1XD7 A;  3TGN A;  1QNT A;  4FT8 A;  2J5P A;  3GFI A;  2W84 A;  1BBY A;  5FD6 A;  1DPR A;  5ERI A;  4M71 A;  2GA1 A;  2OD5 A;  1HSJ A;  2XGX A;  3J80 Z;  4LLN A;  3QRF F;  3RI4 A;  1G4D A;  2L01 A;  1XMA A;  1U5T A;  2V6C A;  1T39 A;  3E6M A;  2BGC A;  4I09 A;  5K5Q A;  3ABT A;  4P55 A;  2DQL A;  4MQ9 F;  4LG0 B;  1TNT A;  3G73 A;  2KIU A;  1Y0U A;  4G6D A;  2P4W A;  3CDH A;  4MNU A;  1O3S A;  3GWZ A;  2NNN A;  2ZCW A;  2FEZ A;  4WXD A;  4QWQ A;  1HBX G;  3O6B B;  1H9G A;  3KFW X;  1JE8 A;  2FRH A;  1FT9 A;  3O2P E;  4A5M A;  3L00 A;  3ZN0 A;  2PEX A;  5IT9 Z;  1FLI A;  3M8E A;  3BDD A;  1G3S A;  4FX4 A;  1LDK B;  5FFX A;  4A6D A;  5ICG A;  3BOQ A;  4BNC A;  1RZ4 A;  4JBA A;  1R7J A;  2WWY A;  1O3R A;  4MTE A;  2YR2 A;  3BRO A;  1OR7 A;  2V9V A;  2G7U A;  4BQA A;  3K0L A;  2XRN A;  4EV0 A;  4Y13 A;  1SD7 A;  3R60 A;  3MEX A;  4L9T A;  2HKO A;  3FMQ A;  3LAP A;  2YX7 A;  1HKS A;  1TLH B;  5F1R A;  1IAW A;  4L9V A;  4WCG A;  2P8T A;  4S05 A;  4EJV A;  3TOA A;  4G8X A;  3HHH A;  2EFO A;  3GZ6 A;  2PQ8 A;  1SFX A;  1IZ1 A;  1G3W A;  1SD4 A;  3KEQ A;  2A3S A;  1VTN C;  2BE5 F;  2VN2 A;  3ZPL A; 
#chains in the Genus database with same CATH topology
 2HNH A;  2KIF A;  3F8F A;  2XPV A;  4C9Y A;  2KIS A;  1LE8 B;  3JRD A;  3LFK A;  5FD5 A;  4M74 A;  2A07 F;  2DA5 A;  4PCQ A;  4A12 A;  1P2F A;  2GXG A;  1IN7 A;  1WI3 A;  2X9D A;  3IL2 A;  1B59 A;  1LFP A;  2DOA A;  5FKM A;  5E3O A;  2XGD A;  2FML A;  2NVU B;  1ZH5 A;  2EBI A;  3CJN A;  4I99 C;  2EPF A;  3WTV C;  1HF0 A;  1FP1 D;  1RR8 C;  5J1U A;  1Z77 A;  3AKZ A;  1K78 A;  3ML6 A;  1B72 B;  5EZG A;  2JJ7 A;  2ZSI B;  3KP4 A;  3W2W A;  1EH8 A;  2DFE A;  2OTL I;  2EV6 A;  2P0W A;  2EQR A;  1N77 A;  1H9T A;  1U8B A;  1F36 A;  3L2W A;  2OCC H;  1W0U A;  3BT9 A;  4XLA A;  2LSO A;  5CQE A;  1G59 A;  4BXU A;  3ZGK A;  5FKK A;  2HDC A;  2A69 F;  3CC4 I;  2M87 A;  3HRS A;  1Y1V J;  3ZR8 X;  1NTC A;  1P92 A;  4XKC A;  3K4C A;  2E5N A;  1IRF A;  2XGC A;  4IRI A;  2BY0 A;  3KLN A;  3B73 A;  3FM3 A;  1E2X A;  3CCV I;  1OCP A;  1YIT I;  3CDI A;  4LK0 F;  3W2V A;  3BJ6 A;  1E3O C;  1T95 A;  3KP2 A;  4IQ4 A;  3S3M A;  4RAF A;  1D1C A;  1XC5 A;  1MH3 A;  2OF7 A;  3G4S I;  3IRR A;  2EFW A;  4NNJ A;  2JN6 A;  1A6I A;  3JSP A;  2A61 A;  2KL4 A;  1DP7 P;  3PNT A;  3SEQ A;  3ZXS A;  2DJI A;  2V4J C;  4RAY A;  2VJ4 A;  3AL0 B;  2P81 A;  3EQL F;  4P96 A;  2R5Y B;  1Z9C A;  5M5Y J;  5IPA A;  3OS1 A;  2RC4 A;  1HOM A;  2NS0 A;  1TBX A;  4Y33 A;  3NWS A;  2RQQ A;  2K9M A;  3M8F A;  3EUH A;  2IPQ X;  1PP7 U;  1VND A;  1FYK A;  2EIN H;  4HAM A;  3IC7 A;  1VQO I;  3S2W A;  1U0J A;  2R7D A;  3FZV A;  3K10 A;  4BS9 A;  1K6O A;  2XV4 S;  3JSO A;  3LSR A;  3E5U A;  1Y56 A;  3CUO A;  4HG2 A;  1QVU A;  2R0Q C;  2CO5 A;  4M3G A;  1VQ5 I;  5LBQ A;  3GW2 A;  2R5Z A;  3HGY A;  2EV0 A;  3IH2 A;  3PFY A;  4A3C J;  3ZQC A;  5FB2 A;  1BIA A;  3I59 B;  4OIP F;  3PNY A;  1K79 A;  1S3J A;  1ETQ A;  1IO2 A;  4II3 A;  1W7P D;  1ACI A;  5E3L A;  5LLQ A;  3DKW A;  1S7O A;  1Z0X A;  2P5V A;  5AIQ A;  5TRD A;  2FNP A;  3CJT B;  2XB5 A;  4BQQ A;  3ABM H;  2X6O A;  5H20 A;  1Z21 A;  4IHX A;  3FXM A;  5KAF C;  1F1Z A;  4XMY A;  2NRA C;  2CW8 A;  2DYR H;  3LSM A;  4NC8 A;  5LHI A;  1W0T A;  2VE9 A;  1JKR C;  1X19 A;  3JRE A;  2V6E A;  4IXA A;  3NEU A;  3F8C A;  2L9R A;  3D5L A;  3AL0 C;  4AVZ A;  2LLK A;  2CUZ A;  4HST A;  1IV6 A;  1ZK8 A;  1HW2 A;  3A0H C;  3TED A;  2D5V A;  5HLI A;  2ZKZ A;  4MEX F;  2HDD A;  4UHT A;  4UVC A;  3WTY C;  1IJW C;  3V4G A;  1S29 A;  5LHH A;  1OQY A;  2IA0 A;  5FO5 A;  5E20 A;  2B63 J;  3ESW B;  4QIW N;  2K86 A;  1XSD A;  2E1C A;  3OWT A;  2RVC A;  3RPU A;  1R71 A;  4A3L J;  3AG4 H;  2E1O A;  2NOJ B;  3B6A A;  1LPQ A;  2CYY A;  4U0Y A;  4PSW A;  3OIQ A;  1KYW A;  3K4M A;  3PQJ A;  3LSJ A;  5L3F A;  2D45 A;  2R7U A;  1K7A A;  2O61 A;  1SC7 A;  1ON1 A;  2IA1 A;  4RAG A;  1B9N A;  5CJ9 A;  3HRM A;  4OU0 A;  1IRX A;  4XRS A;  1DUX C;  2ISZ A;  4BQN A;  1C0W A;  2WTE A;  4MFD A;  2KRF A;  1G8X A;  3A01 A;  4HF2 A;  4UUT A;  3P7N A;  1FMV A;  1OFC X;  3GTJ J;  1ONV A;  2X1D A;  3C2G A;  4RLQ A;  2GOM A;  3N97 A;  1WQ2 A;  3OYN A;  4E7H A;  4YG2 F;  1YX3 A;  1U78 A;  3TO7 A;  4IOA F;  3DFG A;  5JVT A;  2Y0S A;  1DU6 A;  1ZLJ A;  1XS9 A;  2AS5 F;  2OQR A;  3F23 A;  2Z3Y A;  4HDV A;  1BC7 C;  3KZY A;  2PN6 A;  3LSI A;  2M2E A;  3MZ8 A;  3H9G A;  4CXF A;  2R7R A;  2MGQ A;  3EYI A;  2IJL A;  4O3M A;  1KQ8 A;  3I58 A;  3CCR I;  1IXR C;  3S32 A;  2A6T A;  2CG4 A;  3HOV J;  2H1L A;  2HPM A;  4M9X A;  2ZJR F;  1VI0 A;  2W24 A;  3CZ6 A;  4HV6 A;  4GXO A;  1HKT A;  3G1O A;  1GXP A;  4A3I J;  3REO A;  4A69 C;  1HDP A;  4FX0 A;  4MGR A;  1IGN A;  2PJR A;  3IWF A;  2DA7 A;  4A6E A;  4RGS A;  1D5V A;  1BI3 A;  4BE2 A;  2E19 A;  1XDU A;  3CF2 A;  2XB0 X;  5GTI C;  3KE2 A;  3FIS A;  2E2J J;  1LJ9 A;  4RB2 C;  2F5C A;  2XAG A;  3JRH A;  5CKT A;  4UB8 C;  2V9P A;  2K9N A;  2EWN A;  1BN5 A;  1SMT A;  5H6R A;  4CZZ A;  4A3M J;  5LGT A;  2ECB A;  2NVY J;  4ZYG A;  2XRL A;  1Z1D A;  2FNA A;  3CUQ B;  4E6K G;  1YRN B;  4P5O A;  2XPU A;  1MMN A;  3H3U A;  4PZJ A;  4HSR A;  2F48 A;  4N4N B;  3FXO A;  3TDU C;  3HB9 A;  5F64 A;  1UZC A;  4N0B A;  4GDF A;  2K9Q A;  4IRG A;  2L9V A;  1YOV B;  5EEG A;  4BAY A;  1JJ8 C;  1LDD A;  3O8H A;  2Z5U A;  3ERE D;  1QZZ A;  2MW8 A;  5EEH A;  4LMY A;  2XAF A;  2QQ9 A;  3HPH A;  3ZQL A;  2ECC A;  2M0C A;  1Q1V A;  5CQG A;  4CCO A;  2MFZ A;  5LRR A;  1MH4 A;  3VEP A;  3MMY B;  4KT5 C;  1RET A;  2NS7 A;  3DCF A;  1R1U A;  1ZGW A;  4F91 B;  3JAM Z;  5L3C A;  3WGI A;  2ZBK A;  4DQ2 A;  4AUX A;  5E79 C;  3OYF A;  1BW6 A;  1GT0 C;  1KU9 A;  3NRV A;  4M3D A;  1P7J A;  3OSF A;  4HF1 A;  4B4C A;  1XMK A;  4EMS A;  2QUF A;  5J4V A;  4A93 J;  2VIX A;  2FU4 A;  1T33 A;  4NQW A;  4JOM A;  1APL C;  4U0W A;  3L09 A;  3CLO A;  2XUB A;  2G0E A;  2OUM A;  3GTO J;  3RKY A;  4F3Q A;  2CQ7 A;  1WJF A;  3R6S A;  2L4M A;  3JRF A;  1VFC A;  2BBY A;  4M72 A;  2RNG A;  4H4K C;  4KDP A;  3CUQ C;  2FE3 A;  1I3A A;  3HOZ J;  2R4G A;  1OLT A;  2HYJ A;  2L9S A;  1PUF A;  1GDT A;  5GAD J;  1QHG A;  2Q2E B;  2DLL A;  4KIC A;  1R1T A;  4BUP A;  1Z6T A;  2HOS A;  1MJ9 A;  4G6Q A;  1VQ8 I;  1J0R A;  1Z3X A;  4G7H F;  4HRI A;  3SZP A;  3W3C A;  4IPA A;  1KON A;  2K02 A;  4FIS A;  3I64 A;  4M73 A;  1I50 J;  2MC3 A;  4BJ6 C;  3QAH A;  4RLF A;  1OKR A;  1J9I A;  3ZQI A;  3E5Q A;  1KYZ A;  2JA2 A;  1NG7 A;  5IY5 H;  3H36 A;  3HM5 A;  3LST A;  3HYI A;  5ICC A;  5D4S A;  1B8I A;  3M1E A;  4LK1 F;  2HQ5 A;  1TNS A;  2AXT C;  3H3Z A;  3JTH A;  3MD2 A;  3SFZ A;  1IXS B;  3BR0 A;  1QPI A;  3K69 A;  2L54 A;  1WCM J;  3AG3 H;  4CH7 A;  2HQR A;  2OZ6 A;  2HVS A;  2K7L A;  4CYC B;  3OYM A;  4BHB A;  2IGM A;  3CCL I;  3ASO H;  5KK1 A;  1GUU A;  2BXY A;  5HVQ C;  3K4L A;  5F0F A;  4C3J J;  5GAH J;  4DBR A;  3RCO A;  2W85 A;  3JRC A;  3BR3 A;  3B02 A;  1ZAR A;  1YQA A;  2CWE A;  4HOB A;  1RES A;  2KP6 A;  3R0J A;  1Y8Q B;  5E3N A;  3OOU A;  2DA4 A;  3RQI A;  4BGD A;  2FA5 A;  4LLG F;  3DEU A;  1TWG J;  1E3P A;  2N8G A;  3I4P A;  3O8G A;  3I54 A;  4OMZ A;  4BHC A;  3FMR A;  1FY7 A;  2RN7 A;  3CTA A;  2VON A;  2IW5 A;  3E1S A;  2DTR A;  4KYW A;  3DV8 A;  1OMI A;  5F04 A;  3V42 A;  3L1P A;  1SVM A;  1U2W A;  2LH9 A;  3M9A A;  3K9T A;  4PK4 A;  2L7K A;  1UHS A;  2RGV A;  5EEA A;  3COA C;  2HI3 A;  3ECH A;  3FKI J;  4JK1 X;  4A3K J;  4OIN F;  2R7F A;  4IX7 A;  5BQT A;  1LVA A;  2FBK A;  1V55 H;  6PAX A;  2O8K A;  2X6X A;  1Y8R B;  3MN2 A;  1AA7 A;  4HYE A;  3K4B A;  3HTU A;  3TW6 A;  4NHJ A;  2K85 A;  2HTJ A;  4O5V A;  4LIT A;  2ICW G;  1K6Y A;  4S04 A;  1GHC A;  2AQE A;  3FXR A;  1TW3 A;  2XAQ A;  2ZME B;  5HOD A;  3IWZ A;  3FHZ A;  1T0F A;  4F52 A;  4ZYH A;  1WH5 A;  2MLG A;  4HPQ A;  2LY1 A;  2HGC A;  1IN4 A;  4HX7 A;  3TO9 A;  3A0B C;  2E7X A;  1A6Q A;  2ZXJ A;  4C2M J;  4DBQ A;  1FC3 A;  2CSO A;  4NBQ A;  2KKO A;  1YS6 A;  1BOA A;  2IGN A;  3J7A Y;  3F8N A;  3SYT A;  3CME I;  2JPB A;  2QA4 I;  1TQP A;  2HVQ A;  4RM3 A;  2JTV A;  5D5W B;  2O0Y A;  1X1A A;  1JTY A;  4BY1 J;  3J7A O;  5C4X J;  1N75 A;  3ISP A;  3S3O A;  3V8J A;  4I0B A;  2HOA A;  2OJE D;  4PJ0 C;  2PJP A;  4IOC F;  1HST A;  1PP8 F;  4FE7 A;  5FGM A;  2LMD A;  2A6E F;  2P6S A;  1ULY A;  4MHG A;  2DPU A;  3QOD A;  1ZRE A;  2P5L C;  1W36 D;  3CO7 C;  2VQH A;  3BZ6 A;  2XAS A;  3PSI A;  4WX9 A;  4ZYE A;  1UG0 A;  1MDM B;  4DZP A;  1PVE A;  3FBN B;  1J59 A;  2FSW A;  1YTY A;  1R49 A;  4N4O B;  4ZTF A;  2JA5 J;  2OTJ I;  3Q5F A;  3ZQH A;  1TW2 A;  4HBL A;  1MBH A;  4PSX A;  2ZME C;  2KPM A;  3H5A A;  3VYU B;  4ENJ A;  2DT6 A;  4OWR B;  2DAO A;  3L2R A;  1RI7 A;  3BP8 A;  2EK5 A;  5GP9 A;  2FMY A;  2JSC A;  2WAE A;  4V19 K;  3V7C A;  2OPT A;  2IP2 A;  3CCS I;  4CCN A;  4JYK A;  3IRQ A;  2ETH A;  2EFN A;  1JHF A;  4MIM A;  5CYV A;  2STT A;  1YLF A;  1VQ6 I;  3F22 A;  4BAC A;  1FNN A;  2KJB A;  4YIF A;  2MC4 A;  4CCJ A;  4CCK A;  1I5Z A;  5M3F J;  3RPQ A;  2LKX A;  4Y3O A;  1U8R A;  1CF7 A;  4M3E A;  3LQR A;  2A6H F;  4KIT B;  1MMS A;  3FHN A;  3LWF A;  1WH7 A;  2ESH A;  1IRG A;  2E71 A;  4BJT A;  1IW7 F;  2GAU A;  3TW7 A;  5JHU A;  1HDD C;  3HC7 A;  1A04 A;  2B7E A;  1AWC A;  2JMW A;  4N9I A;  4IVN A;  2W57 A;  4GRI A;  4J19 A;  2JUC A;  4G9Y A;  2QBY B;  3G71 I;  1IG7 A;  5K1Y A;  3EET A;  1O4X A;  2FBI A;  2O7O A;  1OCT C;  3SJM A;  1YHQ I;  2BVM A;  2K4J A;  2V26 A;  2VUM J;  1VF9 A;  5ICE A;  2F4M B;  1FP2 A;  2FJ1 A;  1R1V A;  1V5G A;  2CUE A;  5E1Z B;  2MBF A;  4E7J A;  3VYS B;  2ESN A;  3EPZ A;  5CLS A;  1R36 A;  4RGU A;  1IC8 A;  3S1N J;  4DZJ A;  4YRV A;  3TKY A;  5ILS A;  3QPS A;  4HQE A;  1OYI A;  1X1B A;  2DBB A;  1FOW A;  2DMU A;  2NAZ A;  3DKY A;  3GXO A;  4RMN A;  5F0C A;  1REP C;  3HEF A;  3DP7 A;  4U87 A;  1H88 C;  2IRF G;  4XKV A;  1RUO A;  3ZP5 A;  1U5T B;  3K1N A;  1JT0 A;  2J5O A;  1XTA A;  2F2E A;  5FLM J;  2LC2 A;  2WBM A;  3ROU A;  2Y31 A;  3SFI A;  3PJR A;  3KEO A;  1VQN I;  5BOX A;  3BCA A;  1KU7 A;  3C18 A;  2HU9 A;  4FHT A;  2XVC A;  3H0D A;  5JLX A;  3BPX A;  2WB1 N;  1EJ9 A;  4ABZ A;  4KUM A;  5A2Q K;  2NXN B;  4WXC A;  3U2R A;  4KMF A;  4ZDO A;  3RZD J;  2F6C A;  2GXA A;  5CVV A;  3BZK A;  3ULQ B;  2VQC A;  3P9K A;  3RKQ A;  4JX5 A;  4XRS G;  2X48 A;  2KT0 A;  4W97 A;  5BPI A;  3I56 I;  1F43 A;  5EGO B;  3E0J B;  3G6E I;  3EYY A;  4Q4Z F;  1GLN A;  3WOD F;  1BR4 A;  2CV0 A;  1QZY A;  2F5V A;  1J5Y A;  1ZRD A;  3J81 K;  2Z2S B;  3Q9V A;  2HWV A;  5DM7 F;  1M1E B;  3OYD A;  3FX3 A;  3GLX A;  1MJA A;  2P7C B;  1JHH A;  5E1W A;  1CGP A;  3S8P A;  4DGW B;  3GCM A;  4NB5 A;  3OYB A;  1TZL A;  1LB2 A;  2WY8 Q;  1E17 A;  5DCF A;  1BOB A;  1R5G A;  4HQM A;  4PJN A;  5IYD J;  3BZC A;  2M9H A;  2XPW A;  2L5Q A;  5IP7 J;  2ME6 A;  3OOP A;  1MGT A;  4C3I J;  3C2H A;  1X2N A;  1U5T C;  1N25 A;  3CD6 I;  1JUM A;  1XSX A;  3H1C A;  1OCO H;  4EQQ A;  5EYR A;  3U1D A;  5ILU A;  2KRC A;  1W5S A;  3VDX A;  4L5E A;  2MD5 A;  4DW6 A;  2TCT A;  2L02 A;  3S1R J;  3GO5 A;  1N78 A;  3C1D A;  2XSD C;  1ZR2 A;  1ZYR F;  4V2G A;  2DFH A;  5HNF A;  2PX9 A;  3H92 A;  5H2F C;  4QSH A;  3ZQ7 A;  2KDZ A;  1KU3 A;  4HV5 A;  4G7Z F;  1ZQ3 P;  3FXQ A;  2QQA A;  1YJW I;  3HDD A;  2EH3 A;  1A5J A;  2DU9 A;  1FBS A;  2LKS A;  2O3F A;  3DBR B;  4AIJ A;  5FRM A;  3FIW A;  2EFQ A;  3D5R C;  2A05 A;  3IKV A;  4XNF A;  3F21 A;  1XGM A;  3H35 A;  3S93 A;  1XSV A;  3PIO F;  2R3S A;  5DDG A;  2DK5 A;  4XLE A;  4A3F J;  4M6X A;  4EJU A;  1MZB A;  4WK8 F;  5CVI A;  1BC8 C;  1NK3 P;  2C6Y A;  4ZYD A;  1XPX A;  1YYV A;  3SZG A;  2R7V A;  1QZE A;  2D1V A;  5FKO A;  2DW4 A;  2W25 A;  4MQV A;  5FKL A;  3IAS 2;  1IXC A;  3TMO A;  2MYS A;  4M6Y A;  3WTS C;  4CYD A;  4CDG A;  3QYF A;  4NDL A;  1HLV A;  1OPC A;  2E60 A;  2COB A;  1TT5 B;  2YSR A;  5IOZ A;  2NNY A;  4KJZ A;  2M0M A;  3HOS A;  1OR7 C;  2BEO A;  2HQA A;  3PUB A;  4G12 A;  4BKX A;  2ZJQ F;  3ZOB A;  3DPT A;  5BNG A;  1K78 B;  2AO9 A;  3OYL A;  1ZTR A;  1NHA A;  3M8J A;  3OS2 A;  3OR1 C;  3FXU A;  3T5X A;  4KA4 A;  1JXS A;  4RA2 A;  1QO0 D;  2K3F A;  3PM1 A;  4KIS A;  3N4M A;  1I3Q J;  4EJW A;  3K4K A;  4LIV A;  3GYH X;  3G2B A;  4GYG A;  2H8R A;  1YX5 A;  3FK6 A;  3SHF A;  3WGH A;  2VOO A;  4C2U A;  4W1U A;  3E6D A;  3NWT A;  3CLQ A;  4EM1 A;  3CQZ J;  1K4S A;  3KP5 A;  1R5H A;  4UUV A;  1FPQ A;  5IYC J;  2QKL B;  3EDP A;  1S6L A;  2IT0 A;  4A2U A;  1UMQ A;  1FIP A;  1P4W A;  2H6B A;  2R7Q A;  1SFK A;  5K7F A;  4UNO A;  2DFI A;  3AFH A;  3ASN H;  5D5U B;  2XDV A;  2EA2 A;  1QBJ A;  3WTW C;  2HOE A;  5KHD A;  1WJA A;  4XKW A;  3FXL A;  2COM A;  2HYG D;  3F9K A;  3KP6 A;  1RRJ A;  3VOE A;  1EV7 A;  2IA2 A;  2DO7 A;  1ZRC A;  2PMH A;  2OA4 A;  4UUS A;  2OAZ A;  2VI6 A;  5LFA A;  2CW0 F;  1EKE A;  3LL7 A;  4Y7N J;  1IUF A;  1UCR A;  2Z99 A;  3TQN A;  4LFU A;  4TV7 A;  2VKD A;  5FRO A;  2O9L A;  2EV5 A;  1AHD P;  3QOP A;  4D9J A;  2EJR A;  1R6R A;  1BI1 A;  1HXD A;  4GYI A;  3SQN A;  3GTM J;  2MAB A;  1YE9 A;  3PFI A;  1SFE A;  3QWL A;  3OR2 C;  4A0X A;  4ENN A;  1FTT A;  2P5K A;  1A36 A;  3IH4 A;  3VYR B;  4ETS A;  2X1E A;  2IBD A;  2LRD A;  3CC2 I;  3NAU A;  3N05 A;  2AHQ A;  2X1C A;  2M45 A;  3IUO A;  2BVL A;  4G7O F;  4A3B J;  1TP4 A;  2DT5 A;  3A4C A;  4C3H J;  1ETW A;  3HBL A;  2E1M B;  3KZI C;  4I2O A;  4D7N A;  4D0P A;  4EM2 A;  5KNL A;  2R5Z B;  3UKG A;  2ZFU A;  3F3X A;  2LBF A;  3Q9S A;  4E7Z A;  4UB6 C;  3H5R A;  2R7S A;  2WV0 A;  2H27 A;  1W7P A;  3HOY J;  4Y4R A;  4D1Q A;  1DP3 A;  4KN7 X;  2Y2Z A;  2B0L A;  3MFK A;  1KU2 A;  3UNG C;  4DOZ A;  2M4G A;  3D0S A;  2DOD A;  3DEE A;  4HW0 A;  3HKZ N;  4D5F A;  3QPH A;  1XCV A;  2W00 A;  1IDY A;  3WG9 A;  3DTE A;  4IL6 C;  2XKO A;  3CP8 A;  1SEU A;  3J7Y J;  3WTU C;  1WKM A;  1JKO C;  2Y30 A;  1ENH A;  2QQB A;  2AQF A;  5H6Q A;  2M1B A;  3QPT A;  4HZF A;  5F08 A;  1J7K A;  1TT0 A;  4PFP A;  4YII A;  5LEJ A;  3QYB A;  3OV8 A;  2WAD A;  1ZGJ A;  5TGT A;  4HNV A;  1CQT A;  2LY9 A;  1KA8 A;  2M8G X;  3EUH C;  1MBF A;  3KZZ A;  5HLG A;  5ED4 A;  3LFU A;  5L3B A;  3K70 D;  3D1N I;  5EZH A;  4OOI A;  3IKT A;  3DEW A;  4XK4 A;  1QGP A;  1S72 I;  2QGU A;  3L9F A;  3L2V A;  1Z67 A;  3D5S C;  1FOY A;  1QHH D;  3A02 A;  3WHC A;  2E1M C;  2ELJ A;  4RAZ A;  3F8B A;  3VWB A;  2JVG A;  1STZ A;  2P6T A;  3CCJ I;  5FJ8 J;  3KET A;  2LD5 A;  1U6G A;  2M5W A;  1PYV A;  1OJL A;  1BJZ A;  2WAQ N;  1SFU A;  4XSZ F;  2DA6 A;  2XF5 A;  5HDN A;  1NH3 A;  1V5E A;  1YS7 A;  4ZZD A;  1AKH A;  2PBI A;  1VQ4 I;  9ANT A;  3K2Z A;  1ZN2 A;  2BZT A;  3BTC A;  1BI0 A;  5FKN A;  4EGY A;  4LGW A;  3A01 B;  1R23 A;  4KT6 A;  1T08 B;  1T6S A;  3KP3 A;  3CCU I;  1IV8 A;  3EUK L;  2GQQ A;  3GUD A;  3KCC A;  3MZH A;  3BLY A;  4I7H A;  4XLF A;  1J2X A;  2CS3 A;  2YU9 J;  3U9G A;  4RDU A;  3NAR A;  5ICF A;  4AD9 A;  2JVH A;  2V79 A;  4D5C A;  3ELK A;  4A3E J;  1L0O C;  2DA3 A;  1R4N B;  4Q47 A;  3HSR A;  2ZSH B;  3T0Y A;  3T1B A;  1J75 A;  3HZJ A;  4BEH A;  4O6J A;  3M4O J;  3PQK A;  3GTK J;  2QQ8 A;  1FSE A;  4L9J A;  3B6C A;  2MSY A;  5LGU A;  3GTQ J;  5DCM A;  4UY8 I;  3W6K B;  2EIM H;  3ZMT A;  2HFH A;  3S3N A;  2WB1 A;  4AVP A;  3GFM A;  4IQJ A;  1Y39 A;  1X1P A;  2VJI A;  5IOY A;  3GFJ A;  5HOO A;  2JT1 A;  2EZH A;  4S0H B;  1F9N A;  3IAM 2;  2ZJ2 A;  2FQ3 A;  4II2 A;  2VKV A;  3K1M A;  5L3D A;  2PJR B;  1VQ7 I;  5D5V B;  4YEJ A;  1NG6 A;  4L5J A;  1O3Q A;  4MEY F;  2XRO A;  4BYY A;  2LP0 A;  1SAX A;  2LY2 A;  1QRY A;  1QPM A;  2DI3 A;  4EVI A;  4L0Z B;  3GVA A;  3BR1 A;  4R8H A;  1BR1 A;  2QEN A;  3AG1 H;  3A1Y A;  4OMY A;  2OCE A;  3GZN B;  3OYE A;  1GV2 A;  2IVM A;  1I6H J;  1EF4 A;  3QU6 A;  1LNW A;  4QPQ A;  1K83 J;  3F0C A;  2VLA A;  3BPV A;  2IS4 A;  3MAJ A;  3V7R A;  1KGS A;  5DV5 A;  1FSH A;  3GLL A;  3OY9 A;  2DA1 A;  3G1L A;  3WTZ A;  1YJ9 I;  1R9T J;  1FWZ A;  1FZP B;  4K2E A;  2CRG A;  4IRH A;  3MKW B;  4B8X A;  4ESF A;  4KIB A;  3DF8 A;  3LAJ A;  3WU0 A;  2Y9Y A;  4HNU A;  2ZJP F;  3HOT A;  1X2M A;  3R4K A;  5TJJ A;  4A5N A;  4U7D A;  2ZFW A;  1IF1 A;  3R61 A;  4BXF A;  1LDJ A;  5JI6 A;  4JP0 A;  4HLX A;  2BY1 A;  1FTZ A;  2H8W A;  5GTH C;  2E2I J;  5EG0 A;  3BTI A;  2OC6 A;  5FLV A;  2HVR A;  1YIO A;  1D1A A;  3HUG A;  5DD8 A;  4IJA A;  3S1M J;  1D1B A;  1ETV A;  4WXH A;  5F27 A;  3HIF A;  4ZC3 A;  5J8C A;  2CH0 A;  2RQP A;  3SEZ A;  1E0E A;  3E5X A;  2ELH A;  2VAS A;  1HC8 A;  1U9N A;  4B3A A;  4NQW B;  2JA8 J;  4BDZ A;  5DCM B;  1ODD A;  4EGZ A;  1I27 A;  2LTP A;  4JQF A;  1A35 A;  1X3U A;  2LOO A;  3WE2 A;  3BR2 A;  1X4P A;  2EZK A;  4R1H A;  2M7A A;  4CA0 A;  3R0A A;  3VSL A;  4XL9 A;  1T8I A;  2BW3 A;  4M9S A;  4Q48 A;  5F0H A;  1PUF B;  2HZD A;  2KIQ A;  2M7B A;  5HS8 A;  1X1C A;  2XSJ C;  3J7Z I;  1RKW A;  3GFL A;  4BJ5 C;  2ZNZ A;  3BQZ A;  1MKM A;  2HYF A;  1DQU A;  3L7W A;  4NC6 A;  4XON A;  1BR2 A;  3M1C A;  2PG4 A;  5LGN A;  4CCL A;  2DPD A;  2H6C A;  1T98 A;  2D2W A;  5DM6 F;  1QQI A;  2VE8 A;  2OQG A;  4XOT A;  3QP6 A;  1VQL I;  2M4K A;  2K4B A;  2E34 A;  2G9W A;  2K40 A;  3E6B A;  1WJC A;  3S15 J;  4FET A;  4AC0 A;  1R00 A;  2X4H A;  5C3E J;  3GTL J;  2RKH A;  4PGH A;  1WPK A;  1B8I B;  1WHU A;  1UST A;  2KDO A;  4LIU A;  1HW5 A;  2XAU A;  3W6J B;  2VPR A;  1TWA J;  1FJL A;  3LSH A;  4MFE A;  5J1Y A;  5A2Q Z;  4M3B A;  1LUJ B;  1T56 A;  3G1M A;  4XSX F;  4UV8 A;  4ESJ A;  3BY6 A;  1L3L A;  3KPH A;  3ECO A;  3OYK A;  2YPR A;  2F5F A;  1G3T A;  1QA6 A;  1ZLK A;  2HDW A;  3W2A A;  2IS6 A;  2GM4 A;  1LEA A;  1YO5 C;  3S16 J;  2K9L A;  2H09 A;  3CCM I;  4CO8 A;  3M3Y J;  2VQG A;  1FYM A;  4YFK F;  3HSF A;  3F72 A;  5GPA A;  2KRH A;  2PFB A;  2YU3 A;  2DXI A;  1W5T A;  1LKX A;  3J81 Z;  2LNB A;  1KZH A;  5K5R A;  4QPO A;  2A5Y B;  2F5E A;  3FK7 A;  4XLC A;  2VL8 A;  1HQC A;  1SD6 A;  3TOB A;  1Z3Y A;  5BPD A;  2UXX A;  4WWC A;  3E7L A;  3HGG A;  1JUS A;  2BV6 A;  1SAN A;  2KMU A;  4WF2 A;  3MZY A;  4AYB N;  5M3M J;  2BXZ A;  3FMS A;  3HTS B;  4BXX J;  4HDU A;  1ZG3 A;  3MKL A;  4P1W A;  4LLL A;  4E4H A;  1MBG A;  1O3T A;  5JVG F;  3OYG A;  3RYP A;  2E35 A;  4UVA A;  3L2Q A;  1FYL A;  3HRT A;  5K7Z A;  4PJJ A;  2EFP A;  3ABL H;  2L0K A;  4I02 A;  1ERD A;  1V3F A;  4IHY A;  2Y48 A;  5D5X B;  4AID A;  3MCZ A;  1JI8 A;  2GXB A;  1U3E M;  1HCR A;  4CUG A;  4A3G J;  1SVL A;  2BW3 B;  3QPL A;  4XLP F;  1I39 A;  2V1U A;  3BTL A;  2LF7 A;  1X1D A;  1XB4 A;  1TL8 A;  1DGR M;  5D6F A;  2NYX A;  2XAJ A;  4LB5 A;  2KZG A;  1P7I A;  4KIG A;  4RGR A;  2DA2 A;  3CC7 I;  3DWL E;  1B1B A;  2FBH A;  3CP2 A;  2V1X A;  4RB3 C;  1SD5 A;  3LOC A;  4HLY A;  1B72 A;  2GLO A;  3HRU A;  2HQN A;  5ILV A;  1WWX A;  5HDK A;  5B1A H;  4B1R A;  1Z7U A;  3F8M A;  4ANJ A;  2EIK H;  3L2C A;  3V7S A;  2HEO A;  4DYQ A;  3HKZ A;  1UEL B;  3RSN A;  4Y15 A;  3WTX C;  4RM2 A;  1X58 A;  3ZMS A;  2DMN A;  1WZ2 A;  4XOP A;  3BJA A;  2BHY A;  2HR3 A;  3GTP J;  2FQ4 A;  3IHU A;  3WHB A;  2Y75 A;  2R7Z J;  2QLZ A;  5LD2 C;  3OYH A;  4ZTJ A;  2O03 A;  3KP7 A;  1ZGA A;  2PLY A;  1O7L A;  4LG3 A;  4XN0 A;  2DFF A;  1I1S A;  3WGG A;  4F55 A;  2PMU A;  3DXJ F;  3CMM A;  3HHG A;  2V1N A;  4G94 A;  4GCV A;  4XN3 A;  4I01 A;  2GA2 A;  2RAE A;  2ME0 A;  1GXQ A;  1X3W B;  3LA2 A;  4KMU X;  1OCR H;  4IKF A;  3FBI B;  1IN5 A;  3DLA A;  3BJO A;  1EA3 A;  5FFZ A;  3C2B A;  2W1O A;  1T0F C;  2L4A A;  1UJ8 A;  4M3F A;  4L5I A;  2R5Y A;  4CHU A;  2XAH A;  2EZL A;  4CSW A;  3S2D J;  1OYW A;  1W1W E;  3L2U A;  1LFB A;  2DJN A;  4P9U A;  2RRE A;  4AWX B;  2KZV A;  2VBY A;  3WU1 B;  5IT3 A;  4RB0 A;  4LD5 A;  2WAQ A;  1PJR A;  1VQK I;  2XKP A;  3WTT C;  3OSG A;  2B9S A;  2DTZ A;  4Z6Y A;  1JJ6 C;  4PJL A;  2VOP A;  2X0L A;  2DK8 A;  2Q0O A;  1X4O A;  4EJO A;  4PFO A;  2NVX J;  2Y0M A;  4E7S A;  2JWT A;  3MQ0 A;  3TO6 A;  2DT7 B;  2F4O B;  3J80 K;  2JZY A;  4BHP A;  1CF7 B;  1D3Y A;  2ISY A;  2E5Z A;  5HLH A;  2W7N A;  2E2H J;  3PO3 J;  4LB6 B;  2IS1 A;  3CDL A;  3LSG A;  3H5N A;  4CGZ A;  2HTS A;  2QM3 A;  4RBO A;  3IH3 A;  1ZEL A;  3K4J A;  1BL0 A;  5DD4 A;  3PNV A;  2LKP A;  3I59 A;  3S14 J;  4D7M A;  4XM3 A;  1T2K A;  2MH2 A;  2GIZ A;  3P9I A;  3QYE A;  4PUS A;  4BBR J;  3E97 A;  2DQR A;  4DYR A;  1MSE C;  4OIQ F;  2CQN A;  2VXZ A;  2BYV E;  3PIP F;  2P7V B;  2MLK A;  4JX4 A;  1OYY A;  3QU3 A;  4AIK A;  2XC7 A;  1Z6R A;  2XHK A;  4R79 A;  5C4J J;  1NK2 P;  4BH9 A;  1ZHF A;  2UZK A;  3SDG A;  3BG5 A;  3RKW A;  2V9K A;  3MWM A;  1RUN A;  1RPW A;  1R4M B;  1XGS A;  1DPU A;  1BI2 A;  4IHT A;  2RNJ A;  3RIR A;  1WJE A;  2IXS A;  1P4X A;  1OCZ H;  1EH7 A;  2ZXH A;  5HS7 A;  1FIA A;  2ZXI A;  5D8L B;  1HA8 A;  3QP5 A;  1LFU P;  4A0Z A;  1Y0N A;  4XKB A;  1SMY F;  1T38 A;  4IHV A;  3OMY A;  1D0Z A;  1K4T A;  1FOX A;  2L9N A;  2DDB A;  2QZ8 A;  3X2Q H;  4AU7 A;  2VB6 A;  2VBZ A;  1IUY A;  3CO6 C;  5HNH A;  1Y1W J;  2MH9 A;  2FOK A;  2GZW A;  4B09 A;  5IT9 K;  1BM9 A;  1XDS A;  2CUJ A;  2PMZ N;  4LJZ F;  1TTY A;  2XGE A;  2UXN A;  3Q0V A;  3S1Q J;  2IAI A;  5GPC A;  2Z33 A;  3DBL B;  1XN7 A;  1ZG1 A;  3DPL C;  1BJA A;  2EIL H;  5DUI A;  1GVJ A;  5E8G A;  1ZAO A;  4B3X A;  2K3P A;  3BG7 A;  3RPU D;  4J00 A;  4PGG A;  3AG2 H;  3GEZ A;  3I71 A;  1MBK A;  3HJE A;  3P5J A;  3LQQ A;  5B3S H;  4UV9 A;  1MW7 A;  5CVU A;  2R7O A;  1SAU A;  3H3V K;  2ZC2 A;  3PL8 A;  3TL4 X;  5J6X A;  4U88 A;  4KN4 X;  4E7L A;  3VPR A;  4ZDP A;  1OIS A;  2AXL A;  3JW4 A;  3JR9 A;  4E7K A;  2DMP A;  3A2K A;  1MJB A;  5J8F A;  2O6G E;  3LA7 A;  2BY2 A;  2KHM A;  3VSK A;  1OCC H;  2IGO A;  2LRE A;  4LOC A;  4IF4 A;  2R7X A;  1MMG A;  1VQP I;  1I1G A;  3BQY A;  3SXY A;  3O3K A;  1IDZ A;  4PDK A;  2DMQ A;  5FRN A;  1YIJ I;  1PUE E;  1P6R A;  2ID6 A;  3K4N A;  3JCU C;  3LMM A;  3CES A;  1LQ1 A;  2VBW A;  1YJN I;  1UHW A;  2VOD A;  2Z1D A;  4JX6 A;  2F4I A;  3A03 A;  4X0G A;  5M5W J;  2LVS A;  3DTI A;  1K61 A;  1YI2 I;  1RC9 A;  2IEK A;  2QVO A;  3RYR A;  3OYA A;  2Z16 A;  1UB9 A;  4YFN F;  1TQI A;  1B4A A;  2VKE A;  1W36 C;  1LEB A;  3WG7 H;  3PUF A;  4ZH4 F;  1WSU A;  4F92 B;  1JKQ C;  4EEF G;  2UUZ A;  3M07 A;  4XIC A;  5DYM A;  4XRM A;  2GBY A;  1TQM A;  2ID3 A;  4E70 A;  3U1K A;  1S5L C;  2XIG A;  4AIH A;  1ITY A;  5C44 J;  5D6E A;  2ZNY A;  4EM0 B;  2F5D A;  1R58 A;  3P9C A;  5E17 F;  2A68 F;  2JA6 J;  2GIV A;  1JGG A;  4CZC A;  3SZT A;  3VYT B;  4J01 A;  1S7A A;  1TWH J;  1WJ5 A;  1G2H A;  2M3A A;  3E6C C;  5J4Y A;  2Q1Z B;  4NC7 A;  4RGX A;  4MTD A;  2VPL A;  2E7W A;  4CIC A;  2JPC A;  2FXA A;  3OYC A;  1ZRF A;  1U9O A;  4I6Z A;  2STW A;  1DDN A;  3K7A J;  3NQO A;  3DU5 A;  3ZMV A;  5CVJ A;  2ELK A;  3BC8 A;  3CUQ A;  1YRN A;  2JUG A;  5GAE J;  1YW7 A;  2JRM A;  2ZO4 A;  1B6A A;  3GX4 X;  4ZJZ A;  4UXN A;  4ZYA A;  3RZO J;  4Y17 A;  2NVQ J;  1IN6 A;  5AON A;  3TDZ C;  1PDN C;  1XMX A;  2HXI A;  2QSH X;  1XGN A;  2YS9 A;  3M7G A;  5BS6 A;  2HZT A;  1WGX A;  5E18 F;  1P4A A;  2LFB A;  3JRG A;  4YEL A;  2VT3 A;  2TRT A;  3ZCO A;  4N9H A;  2L2O A;  3LSP A;  4BU2 A;  2JQ7 A;  3DQV C;  2HXO A;  5LHG A;  1XX5 A;  5KCM A;  2O8X A;  5D8K B;  3FM5 A;  2LF8 A;  1ON2 A;  2WV1 A;  3KX2 A;  1LVK A;  3ONQ A;  3CJQ B;  2MA3 A;  2Y9Z A;  5D4R A;  1ETO A;  2KJC A;  3DKX A;  3UR3 C;  4DNC A;  4B43 A;  1DGW Y;  4XLN F;  1O57 A;  2DOE A;  5HS9 A;  1S8N A;  3H9J A;  1Q1H A;  3RQ4 A;  4DIQ A;  3ZN1 A;  2E36 A;  2FOW A;  2QKM B;  3I53 A;  2KQR A;  3RJP A;  2I5U A;  3VFZ A;  4U7B A;  4Q5S F;  4AYB A;  2CGP A;  2DYS H;  1HW1 A;  2Q8K A;  2CJJ A;  3W6V A;  4L0Y B;  3V8L A;  1ETX A;  4GFB A;  2XF6 A;  5GAG J;  3CF5 F;  3KIO A;  3K1P A;  4Y52 J;  1BA5 A;  2FF4 A;  2ACJ A;  1EH6 A;  2DCE A;  2CQK A;  1D0X A;  1USS A;  2OBP A;  2QYO A;  4BE1 A;  2CFX A;  4L9N A;  1WJD A;  1WJB A;  3F6O A;  4X1E A;  3V8K A;  1V5F A;  2Q2E A;  2EB7 A;  3FKJ A;  5LRS A;  5F1J A;  1UHM A;  3CMA I;  1YW9 A;  4EAT A;  4UUS B;  2L3D A;  1JGS A;  2V1D A;  4YFX F;  4ENM A;  1MND A;  3ZMZ A;  3RDI A;  5E8I A;  3S2H J;  2FUG 2;  4I98 B;  3JTG A;  3FXK A;  1A31 A;  4IHS A;  1FX7 A;  1G6N A;  2W48 A;  4KIF A;  3I4M J;  1WRJ A;  3FF5 A;  2R93 J;  2VC1 A;  2EIJ H;  3KYL A;  4QLC U;  4ZDL A;  4BE0 A;  4KNY A;  4ZZL A;  3PSF A;  3F6V A;  1KQ0 A;  3OIO A;  3I5U A;  5DUK A;  3E3V A;  1FBU A;  2BHZ A;  2X51 A;  3DBH B;  2RDP A;  2LBF B;  1UFM A;  3OL3 A;  3LA3 A;  1YFH A;  5KVR A;  2LK2 A;  4CYC A;  4XBF A;  5J3L A;  4XRF A;  1W7P B;  3K2A A;  1KQ9 A;  5L3E A;  4OAZ A;  1F5T A;  3KYD B;  2DDA A;  1RKT A;  5J47 A;  4M6V A;  3ZQQ A;  3HSE A;  5TIS C;  2UWM A;  3C7J A;  2FX0 A;  3VOD A;  4C2T A;  5JLW A;  3VB2 A;  2GWR A;  4BQO A;  1B9M A;  2MG4 A;  2EZI A;  3H0G J;  2R92 J;  1SVO A;  1FBQ A;  3I0T A;  5M5X J;  4XR6 A;  1Z05 A;  4AM3 A;  4RB1 A;  5F6F A;  1SFO J;  2QCO A;  4XOR A;  3T8T A;  3ABU A;  1DU0 A;  4ON0 A;  1BIB A;  1Z7L A;  3JRB A;  4I0A A;  1AOY A;  2PI0 A;  5JFR A;  1H0M A;  2VXD A;  3IP4 B;  4QTR A;  2L7F P;  1MD0 A;  5FLX Z;  2Z9O A;  3RTR A;  2H94 A;  3GF2 A;  2VC0 A;  4HA8 A;  3WE3 A;  2ADU A;  5EF6 A;  4BDY A;  5IP6 A;  1JKP C;  3CJR B;  2JSP A;  3BCB A;  3JRA A;  1R5I D;  2HOT A;  2OZU A;  3GME A;  3MKZ A;  2ZME A;  4Z2Y A;  4HX4 A;  4A3J J;  4OIR F;  4EJT A;  2E1N A;  2M34 A;  1GVD A;  5DEQ A;  5EJC A;  2ZB9 A;  2G7H A;  2K5C A;  4FE4 A;  1R22 A;  4M9Z A;  3ZMU A;  2LDU A;  4MO7 A;  5L3G A;  2KFD A;  2CFO A;  3BWG A;  4OIO F;  1HKQ A;  1Y6I A;  3GZ5 A;  4GO1 A;  1G3Y A;  1O7F A;  5B66 C;  3I9V 2;  1AKH B;  2TDX A;  1ZKG A;  4HX8 A;  2HS5 A;  2W4S A;  3U21 A;  3I4N J;  2QF7 A;  1TWF J;  5DS9 A;  2A5W A;  5E1X A;  3TBI A;  1J09 A;  1YG2 A;  4H0E A;  2R7W A;  1AU7 A;  3ZRG A;  2OU2 A;  4BBS J;  5JHF A;  4P9F A;  4IO9 F;  1W4M A;  2LG4 A;  3LSK A;  1MMD A;  1D5Y A;  1YW8 A;  3BR5 A;  3HOX J;  1ZG5 A;  1V4R A;  4XID A;  2RV8 A;  3GTG J;  3T8R A;  5JR3 A;  2VBX A;  5CVR A;  1TC3 C;  3EUA A;  4L18 B;  4DYC A;  4G6T B;  1WI9 A;  2DOF A;  4B48 A;  2IS2 A;  3G3Z A;  4BEH B;  3CCE I;  5BMZ A;  2PMZ A;  3HL2 A;  2QWW A;  1XCB A;  2EA4 A;  2VT2 A;  2NS8 A;  1RNL A;  3OL4 A;  1ETK A;  3OIP A;  1H8A C;  3AAF A;  3I55 I;  4UVB A;  4LG0 A;  1MDM A;  2YX4 A;  1F4K A;  1UAA A;  3BTJ A;  2QEX I;  5LEK A;  4HF0 A;  1Z91 A;  2X85 A;  3FWE A;  4FAS D;  1IRZ A;  1I6X A;  2CMP A;  2QSG X;  4RS8 A;  3OYJ A;  2X6Y A;  1IN8 A;  2K27 A;  3ZQG A;  4ESB A;  4A3D J;  4GGG A;  1JT6 A;  4A0Y A;  1FOK A;  1D8J A;  2UV1 A;  4F7Z A;  3Q0W A;  2LYC A;  1WVR A;  3C3W A;  4CCM A;  1QVT A;  5EDN A;  3GBG A;  2HKX A;  4ENK A;  4U0V A;  3S17 J;  5HDG A;  3JAM K;  4KFC A;  2O5R A;  3DTK A;  3RKX A;  1FMW A;  3KLO A;  2NVT J;  5AIP A;  4XLH A;  4V2F A;  2M30 A;  2VJJ A;  1RIO H;  2VQL A;  2BOL A;  3ZQF A;  4I76 A;  2DN0 A;  2JRT A;  4PJM A;  5B5E C;  3ZMD A;  4E7I A;  1D8K A;  4IEJ A;  1MNM C;  1MIJ A;  2M8E A;  4FQG A;  2D1H A;  1S9H A;  3HOW J;  2WC2 A;  1JTX A;  1XGO A;  2I8D A;  5K7H A;  1MSF C;  5K5O A;  1ZR4 A;  5FLX K;  2QBY A;  2KIM A;  2QSF X;  4DJA A;  2BY3 A;  2XF7 A;  3FDY A;  4ASN A;  1XD7 A;  1MBJ A;  1POG A;  3TGN A;  1QNT A;  4FT8 A;  2J5P A;  4F93 B;  3HPG A;  3GFI A;  2W84 A;  1P9Q C;  3ABK H;  1BBY A;  5FD6 A;  1VQ9 I;  2H1K A;  5B1B H;  1DPR A;  2CV2 A;  4B44 A;  5ERI A;  4M71 A;  5HLT A;  4MLO A;  5EG0 B;  3LNQ A;  2KLO A;  2GA1 A;  5J40 A;  2WY7 Q;  3MKY B;  3OYI A;  2XGX A;  1HSJ A;  2OD5 A;  3J80 Z;  2Y0S N;  4LLN A;  3HUG B;  1H89 C;  3CCQ I;  3QRF F;  3JRI A;  3RI4 A;  1G4D A;  2L01 A;  1XMA A;  2LR8 A;  1U5T A;  3DLL F;  4FTH A;  3HXL A;  4XQF A;  2FD5 A;  1S7E A;  1ORK A;  2V6C A;  1T39 A;  3E6M A;  2BGC A;  4I09 A;  3QOE A;  5K5Q A;  5CPR B;  1WFX A;  3ABT A;  1TWC J;  1MMA A;  3DU6 A;  4P55 A;  2DQL A;  4MQ9 F;  1BW5 A;  3DPU A;  3K70 C;  2L7M P;  4LG0 B;  3KYC B;  2WA0 A;  1TNT A;  3G73 A;  2YUS A;  2KIU A;  1Y0U A;  4G6D A;  2P4W A;  3CDH A;  4MNU A;  4C30 A;  2CUF A;  3PO2 J;  1X3Z B;  1O3S A;  3GWZ A;  2NNN A;  3WU2 C;  4IHW A;  2IGK A;  2ZCW A;  2K9S A;  1LE8 A;  2FEZ A;  4WXD A;  4QWQ A;  1MBE A;  3BR6 A;  1HBX G;  2CW7 A;  3O6B B;  5EGO A;  1RR7 A;  1H9G A;  3BG6 A;  3KFW X;  3TP0 A;  1VQM I;  2FRH A;  1JE8 A;  1FT9 A;  2W82 A;  4B47 A;  1VZ0 A;  3O2P E;  4A5M A;  3L00 A;  2X6W A;  4BY7 J;  3ZN0 A;  2JA7 J;  2PEX A;  5IT9 Z;  1FLI A;  3M8E A;  5KAI C;  3H9Q A;  3BDD A;  2CQX A;  2HPI A;  1G3S A;  2JK3 A;  4FX4 A;  3BG9 A;  2GOX B;  1LDK B;  4ITV A;  5FFX A;  4A6D A;  5ICG A;  3BOQ A;  2L7Z A;  4BNC A;  4HEA 2;  1RZ4 A;  1D0Y A;  4JBA A;  5J1R A;  1R7J A;  2WWY A;  4IZZ A;  1O3R A;  4NUB A;  3ERM A;  4MTE A;  2YR2 A;  3BRO A;  2NOG A;  5E3M A;  1OR7 A;  1FEX A;  4OAY A;  1ETY A;  1V54 H;  2V9V A;  2G7U A;  2VJ5 A;  3KEY A;  4BQA A;  3K0L A;  2XRN A;  4FCY A;  4EV0 A;  3TP3 A;  5IP9 J;  4Y13 A;  3K6G A;  1SD7 A;  3R60 A;  5DTD A;  3MEX A;  4L9T A;  2HKO A;  3FMQ A;  3HG9 A;  3LAP A;  2YX7 A;  5IYB J;  3Q0U A;  2CQQ A;  4HNT A;  1MNE A;  2CV1 A;  2WAF A;  3CMY A;  1HKS A;  1TLH B;  2V7F A;  5F1R A;  2DMT A;  2OV7 A;  3CCY A;  2Y69 H;  4L9V A;  1IAW A;  3SDB A;  4WCG A;  2P8T A;  2MD0 A;  4S05 A;  4EJV A;  3HOU J;  3TOA A;  3Q3S A;  4G8X A;  3HHH A;  2EFO A;  3GZ6 A;  2CU7 A;  1JUP A;  2PQ8 A;  3OS0 A;  1SFX A;  1IZ1 A;  2I10 A;  3I3L A;  1E3H A;  4YIR X;  2VKH A;  1G3W A;  1UG2 A;  1SD4 A;  3KEQ A;  4BL0 B;  3FXJ A;  2A3S A;  2R7T A;  1GV5 A;  1QU3 A;  2ZXW H;  3IV5 A;  1VTN C;  3MVP A;  2BE5 F;  2VN2 A;  3BG3 A;  4X6A J;  1XG1 A;  1W5C C;  3QQA A;  3ZPL A; 
#chains in the Genus database with same CATH homology
 2KIF A;  3F8F A;  3LFK A;  5FD5 A;  4M74 A;  2A07 F;  4PCQ A;  4A12 A;  1P2F A;  2GXG A;  1IN7 A;  3IL2 A;  1B59 A;  2FML A;  1ZH5 A;  3CJN A;  3WTV C;  1FP1 D;  1K78 A;  3ML6 A;  3KP4 A;  1EH8 A;  2EV6 A;  1H9T A;  2LSO A;  4BXU A;  2HDC A;  2A69 F;  2M87 A;  3HRS A;  1P92 A;  1IRF A;  4IRI A;  3KLN A;  3B73 A;  3FM3 A;  1E2X A;  4LK0 F;  3BJ6 A;  3KP2 A;  3IRR A;  2EFW A;  3JSP A;  2A61 A;  1DP7 P;  4RAY A;  3EQL F;  4P96 A;  1Z9C A;  2RC4 A;  2NS0 A;  1TBX A;  3M8F A;  3EUH A;  2IPQ X;  1PP7 U;  1FYK A;  4HAM A;  3IC7 A;  3S2W A;  2R7D A;  3FZV A;  1K6O A;  2XV4 S;  3JSO A;  3E5U A;  3CUO A;  2CO5 A;  5LBQ A;  3GW2 A;  2EV0 A;  5FB2 A;  1BIA A;  3I59 B;  4OIP F;  1K79 A;  1S3J A;  1W7P D;  5LLQ A;  3DKW A;  1S7O A;  2P5V A;  5AIQ A;  5TRD A;  2FNP A;  5H20 A;  1F1Z A;  2NRA C;  5LHI A;  2VE9 A;  4IXA A;  3NEU A;  3F8C A;  3D5L A;  1HW2 A;  5HLI A;  2ZKZ A;  4MEX F;  4UHT A;  4UVC A;  3WTY C;  3V4G A;  1S29 A;  5LHH A;  2IA0 A;  5FO5 A;  5E20 A;  2K86 A;  1XSD A;  2E1C A;  2RVC A;  3RPU A;  2CYY A;  4U0Y A;  1KYW A;  3PQJ A;  5L3F A;  2D45 A;  1K7A A;  2O61 A;  1ON1 A;  2IA1 A;  1B9N A;  5CJ9 A;  3HRM A;  4OU0 A;  1DUX C;  2ISZ A;  1C0W A;  2WTE A;  2KRF A;  4HF2 A;  3P7N A;  1ONV A;  3N97 A;  1WQ2 A;  4YG2 F;  1U78 A;  3TO7 A;  3DFG A;  5JVT A;  1ZLJ A;  2AS5 F;  2OQR A;  3F23 A;  2Z3Y A;  4HDV A;  1BC7 C;  3KZY A;  2PN6 A;  4CXF A;  3EYI A;  2IJL A;  4O3M A;  1KQ8 A;  3I58 A;  1IXR C;  2CG4 A;  4M9X A;  2W24 A;  4HV6 A;  4GXO A;  1HKT A;  1GXP A;  3REO A;  4FX0 A;  4MGR A;  3IWF A;  4A6E A;  4RGS A;  1D5V A;  1BI3 A;  1XDU A;  3KE2 A;  1LJ9 A;  4RB2 C;  2F5C A;  2XAG A;  2EWN A;  1BN5 A;  1SMT A;  5H6R A;  4CZZ A;  5LGT A;  4ZYG A;  3CUQ B;  1Z1D A;  2FNA A;  4P5O A;  3H3U A;  4PZJ A;  3TDU C;  5F64 A;  4N0B A;  4IRG A;  5EEG A;  4BAY A;  1LDD A;  2Z5U A;  3ERE D;  1QZZ A;  5EEH A;  4LMY A;  2XAF A;  2QQ9 A;  5LRR A;  3VEP A;  4KT5 C;  1R1U A;  3JAM Z;  5L3C A;  3WGI A;  2ZBK A;  4DQ2 A;  4HF1 A;  1KU9 A;  3NRV A;  1XMK A;  4EMS A;  2QUF A;  2FU4 A;  4NQW A;  4U0W A;  3L09 A;  3CLO A;  2XUB A;  3RKY A;  3R6S A;  2L4M A;  2BBY A;  4M72 A;  4KDP A;  3CUQ C;  2FE3 A;  2DLL A;  4KIC A;  1R1T A;  1Z6T A;  1MJ9 A;  4G6Q A;  1J0R A;  4G7H F;  3SZP A;  4IPA A;  2K02 A;  3I64 A;  4M73 A;  2MC3 A;  3QAH A;  1OKR A;  1J9I A;  3E5Q A;  1KYZ A;  3LST A;  5ICC A;  3HYI A;  5D4S A;  3M1E A;  4LK1 F;  1TNS A;  3H3Z A;  3JTH A;  3SFZ A;  1IXS B;  3K69 A;  2L54 A;  2HQR A;  2OZ6 A;  2K7L A;  4BHB A;  5KK1 A;  5HVQ C;  2W85 A;  1ZAR A;  1YQA A;  3B02 A;  2CWE A;  4HOB A;  3R0J A;  2FA5 A;  4LLG F;  3DEU A;  3I4P A;  4OMZ A;  4BHC A;  3I54 A;  3FMR A;  1FY7 A;  2RN7 A;  3CTA A;  2VON A;  2IW5 A;  2DTR A;  4KYW A;  3DV8 A;  1OMI A;  3M9A A;  1U2W A;  3K9T A;  2RGV A;  3COA C;  3ECH A;  4JK1 X;  4OIN F;  2R7F A;  5BQT A;  1LVA A;  2FBK A;  6PAX A;  4HYE A;  3HTU A;  4NHJ A;  2HTJ A;  4O5V A;  4S04 A;  1GHC A;  3FXR A;  1TW3 A;  2XAQ A;  2ZME B;  3IWZ A;  3FHZ A;  1T0F A;  4ZYH A;  2MLG A;  2HGC A;  1IN4 A;  4HX7 A;  3TO9 A;  2E7X A;  2ZXJ A;  1FC3 A;  2CSO A;  2KKO A;  1YS6 A;  1BOA A;  3F8N A;  2JPB A;  1TQP A;  5D5W B;  2JTV A;  2O0Y A;  3J7A O;  3ISP A;  3V8J A;  4I0B A;  2PJP A;  1HST A;  1PP8 F;  5FGM A;  2A6E F;  2P6S A;  1ULY A;  4MHG A;  2DPU A;  1ZRE A;  2P5L C;  3CO7 C;  3BZ6 A;  4WX9 A;  2XAS A;  4ZYE A;  1MDM B;  1J59 A;  2FSW A;  1YTY A;  3Q5F A;  1TW2 A;  4HBL A;  4ENJ A;  2DAO A;  1RI7 A;  3BP8 A;  2EK5 A;  2FMY A;  2JSC A;  3V7C A;  2IP2 A;  3IRQ A;  2ETH A;  2EFN A;  1JHF A;  5CYV A;  2STT A;  1YLF A;  3F22 A;  1FNN A;  2KJB A;  4YIF A;  1I5Z A;  3RPQ A;  1U8R A;  1CF7 A;  3LQR A;  2A6H F;  3LWF A;  2ESH A;  1IRG A;  1IW7 F;  2GAU A;  5JHU A;  1A04 A;  1AWC A;  4N9I A;  4IVN A;  2W57 A;  4G9Y A;  2QBY B;  5K1Y A;  3EET A;  2FBI A;  2K4J A;  5ICE A;  1FP2 A;  1R1V A;  5E1Z B;  2MBF A;  2ESN A;  5CLS A;  1R36 A;  4RGU A;  3TKY A;  5ILS A;  4HQE A;  1OYI A;  2DBB A;  3GXO A;  2NAZ A;  1REP C;  3DP7 A;  2IRF G;  1RUO A;  3ZP5 A;  1U5T B;  3K1N A;  2J5O A;  2F2E A;  3ROU A;  3KEO A;  5BOX A;  1KU7 A;  3C18 A;  4FHT A;  2XVC A;  3BPX A;  4KUM A;  5A2Q K;  4WXC A;  3U2R A;  4KMF A;  5CVV A;  3ULQ B;  3P9K A;  5BPI A;  3EYY A;  4Q4Z F;  3WOD F;  1QZY A;  1J5Y A;  1ZRD A;  3J81 K;  3Q9V A;  2HWV A;  3FX3 A;  3GLX A;  1MJA A;  2P7C B;  1JHH A;  5E1W A;  1CGP A;  4NB5 A;  1LB2 A;  1E17 A;  5DCF A;  1R5G A;  4HQM A;  3OOP A;  1MGT A;  1U5T C;  1XSX A;  4EQQ A;  3U1D A;  5ILU A;  1W5S A;  2MD5 A;  2L02 A;  3GO5 A;  3C1D A;  1ZYR F;  3H92 A;  3ZQ7 A;  1KU3 A;  4HV5 A;  4G7Z F;  3FXQ A;  2QQA A;  2DU9 A;  1FBS A;  2O3F A;  4AIJ A;  2EFQ A;  3IKV A;  3F21 A;  1XGM A;  1XSV A;  2R3S A;  5DDG A;  2DK5 A;  4M6X A;  4EJU A;  1MZB A;  4WK8 F;  5CVI A;  1BC8 C;  2C6Y A;  4ZYD A;  1YYV A;  2D1V A;  2DW4 A;  2W25 A;  4MQV A;  1IXC A;  4M6Y A;  3WTS C;  4CYD A;  4CDG A;  1OPC A;  2YSR A;  2NNY A;  3HOS A;  2BEO A;  3DPT A;  1K78 B;  1NHA A;  3FXU A;  3T5X A;  4KA4 A;  1JXS A;  1QO0 D;  3N4M A;  4EJW A;  3GYH X;  4GYG A;  3SHF A;  3WGH A;  2VOO A;  3E6D A;  4EM1 A;  3KP5 A;  1R5H A;  4UUV A;  1FPQ A;  3EDP A;  1S6L A;  2IT0 A;  4A2U A;  1P4W A;  2H6B A;  4UNO A;  2DFI A;  5D5U B;  2EA2 A;  1QBJ A;  3WTW C;  2HOE A;  2COM A;  2HYG D;  3KP6 A;  3VOE A;  1EV7 A;  2IA2 A;  2DO7 A;  1ZRC A;  2PMH A;  2OA4 A;  2OAZ A;  2CW0 F;  1UCR A;  2Z99 A;  3TQN A;  4LFU A;  4TV7 A;  2EV5 A;  3QOP A;  2EJR A;  1BI1 A;  1HXD A;  4GYI A;  3SQN A;  3PFI A;  4A0X A;  1SFE A;  4ENN A;  2P5K A;  4ETS A;  2M45 A;  4G7O F;  2DT5 A;  4I2O A;  4D0P A;  4EM2 A;  3Q9S A;  3F3X A;  2WV0 A;  2H27 A;  1W7P A;  4KN7 X;  2B0L A;  3MFK A;  1KU2 A;  3D0S A;  4HW0 A;  3QPH A;  1XCV A;  3WG9 A;  2XKO A;  3WTU C;  1WKM A;  2QQB A;  5H6Q A;  2M1B A;  3QPT A;  4HZF A;  1J7K A;  4YII A;  5LEJ A;  3OV8 A;  1ZGJ A;  1KA8 A;  3KZZ A;  5ED4 A;  5HLG A;  5L3B A;  4OOI A;  3IKT A;  1QGP A;  3L9F A;  4RAZ A;  3F8B A;  1STZ A;  2P6T A;  3KET A;  1U6G A;  2M5W A;  1SFU A;  4XSZ F;  5HDN A;  1YS7 A;  4ZZD A;  2PBI A;  3K2Z A;  1ZN2 A;  1BI0 A;  4EGY A;  4LGW A;  1R23 A;  1T6S A;  3KP3 A;  2GQQ A;  3GUD A;  3KCC A;  3MZH A;  4I7H A;  1J2X A;  3U9G A;  5ICF A;  4AD9 A;  2V79 A;  3ELK A;  1L0O C;  4Q47 A;  3HSR A;  3T0Y A;  3T1B A;  1J75 A;  4O6J A;  3PQK A;  1FSE A;  4L9J A;  5LGU A;  5DCM A;  3W6K B;  3ZMT A;  2HFH A;  4AVP A;  3GFM A;  3GFJ A;  5HOO A;  2JT1 A;  1F9N A;  2ZJ2 A;  2FQ3 A;  5L3D A;  3K1M A;  5D5V B;  4L5J A;  1O3Q A;  4MEY F;  2XRO A;  4BYY A;  1SAX A;  2DI3 A;  1QPM A;  4EVI A;  4L0Z B;  3GVA A;  4R8H A;  2QEN A;  4OMY A;  2IVM A;  3QU6 A;  1LNW A;  3BPV A;  3MAJ A;  3V7R A;  1KGS A;  5DV5 A;  1FSH A;  3WTZ A;  1FWZ A;  1FZP B;  4K2E A;  4IRH A;  4B8X A;  4ESF A;  4KIB A;  3DF8 A;  3LAJ A;  3WU0 A;  1IF1 A;  3HOT A;  5TJJ A;  3R4K A;  4A5N A;  4U7D A;  2ZFW A;  3R61 A;  1LDJ A;  5JI6 A;  4HLX A;  1YIO A;  3HUG A;  5DD8 A;  4IJA A;  4WXH A;  3HIF A;  5J8C A;  2RQP A;  3E5X A;  2ELH A;  5DCM B;  1ODD A;  4EGZ A;  1I27 A;  4JQF A;  1X3U A;  3WE2 A;  4R1H A;  3R0A A;  4M9S A;  4Q48 A;  5HS8 A;  3GFL A;  2ZNZ A;  1MKM A;  2HYF A;  3L7W A;  2PG4 A;  5LGN A;  2DPD A;  2H6C A;  1T98 A;  2D2W A;  1QQI A;  2VE8 A;  2OQG A;  3QP6 A;  2K4B A;  2G9W A;  3E6B A;  1R00 A;  2X4H A;  2RKH A;  4PGH A;  1UST A;  1HW5 A;  3W6J B;  5A2Q Z;  4XSX F;  4UV8 A;  4ESJ A;  3BY6 A;  1L3L A;  3ECO A;  2YPR A;  2F5F A;  1G3T A;  1ZLK A;  1LEA A;  1YO5 C;  2H09 A;  4CO8 A;  1FYM A;  4YFK F;  3HSF A;  3F72 A;  2PFB A;  2YU3 A;  1W5T A;  3J81 Z;  2LNB A;  5K5R A;  2A5Y B;  2F5E A;  3TOB A;  1HQC A;  1SD6 A;  5BPD A;  2UXX A;  4WWC A;  2BV6 A;  4WF2 A;  3MZY A;  3FMS A;  3HTS B;  4HDU A;  1ZG3 A;  4LLL A;  1O3T A;  3RYP A;  4UVA A;  1FYL A;  3HRT A;  2EFP A;  4I02 A;  1V3F A;  2Y48 A;  5D5X B;  3MCZ A;  2GXB A;  1U3E M;  4XLP F;  2V1U A;  2LF7 A;  1XB4 A;  5D6F A;  2NYX A;  2XAJ A;  4LB5 A;  4KIG A;  4RGR A;  1B1B A;  2FBH A;  2V1X A;  4RB3 C;  1SD5 A;  4HLY A;  3HRU A;  2HQN A;  5ILV A;  1WWX A;  5HDK A;  1Z7U A;  3F8M A;  3L2C A;  3V7S A;  2HEO A;  4Y15 A;  3WTX C;  3ZMS A;  3BJA A;  2HR3 A;  3IHU A;  2Y75 A;  2QLZ A;  2O03 A;  3KP7 A;  1ZGA A;  2PLY A;  1O7L A;  1I1S A;  3WGG A;  2PMU A;  3DXJ F;  3HHG A;  4G94 A;  4GCV A;  4I01 A;  2GA2 A;  1GXQ A;  3LA2 A;  4KMU X;  1IN5 A;  3BJO A;  5FFZ A;  2L4A A;  4L5I A;  4CHU A;  2XAH A;  1OYW A;  4P9U A;  4AWX B;  2VBY A;  3WU1 B;  5IT3 A;  4RB0 A;  4LD5 A;  2XKP A;  3WTT C;  2VOP A;  2X0L A;  2DK8 A;  2Q0O A;  4EJO A;  2Y0M A;  3MQ0 A;  3TO6 A;  3J80 K;  2JZY A;  4BHP A;  1CF7 B;  1D3Y A;  2ISY A;  5HLH A;  4LB6 B;  4CGZ A;  2HTS A;  2QM3 A;  5DD4 A;  2LKP A;  3I59 A;  1T2K A;  2MH2 A;  3P9I A;  3E97 A;  2DQR A;  4OIQ F;  2VXZ A;  2BYV E;  2P7V B;  2MLK A;  1OYY A;  3QU3 A;  4AIK A;  1Z6R A;  2XHK A;  4R79 A;  4BH9 A;  1ZHF A;  2UZK A;  3RKW A;  1DPU A;  3MWM A;  1RUN A;  1XGS A;  1BI2 A;  4IHT A;  2RNJ A;  3RIR A;  1P4X A;  5HS7 A;  1EH7 A;  5D8L B;  3QP5 A;  4A0Z A;  1SMY F;  1T38 A;  2QZ8 A;  2VBZ A;  1IUY A;  3CO6 C;  4B09 A;  2MH9 A;  2FOK A;  2GZW A;  5IT9 K;  1BM9 A;  1XDS A;  4LJZ F;  1TTY A;  2UXN A;  2Z33 A;  1XN7 A;  1ZG1 A;  3DPL C;  1BJA A;  5DUI A;  1GVJ A;  5E8G A;  1ZAO A;  4PGG A;  3GEZ A;  3I71 A;  3LQQ A;  4UV9 A;  5CVU A;  5J6X A;  4U88 A;  4KN4 X;  3JW4 A;  2AXL A;  1MJB A;  5J8F A;  2O6G E;  3LA7 A;  4IF4 A;  1I1G A;  3SXY A;  3O3K A;  4PDK A;  1PUE E;  1P6R A;  1LQ1 A;  2VBW A;  1UHW A;  2VOD A;  2QVO A;  3RYR A;  1UB9 A;  4YFN F;  1TQI A;  1B4A A;  1LEB A;  4ZH4 F;  1WSU A;  5DYM A;  1TQM A;  4E70 A;  2XIG A;  4AIH A;  5D6E A;  2ZNY A;  4EM0 B;  2F5D A;  1R58 A;  3P9C A;  5E17 F;  2A68 F;  2GIV A;  3SZT A;  1S7A A;  3E6C C;  4RGX A;  4MTD A;  2E7W A;  4CIC A;  2JPC A;  2FXA A;  1ZRF A;  2STW A;  1DDN A;  3NQO A;  3ZMV A;  5CVJ A;  3CUQ A;  1YW7 A;  2ZO4 A;  1B6A A;  3GX4 X;  4UXN A;  4Y17 A;  1IN6 A;  5AON A;  3TDZ C;  1PDN C;  1XGN A;  3M7G A;  5BS6 A;  2HZT A;  5E18 F;  1P4A A;  2VT3 A;  4N9H A;  3DQV C;  5LHG A;  2O8X A;  5D8K B;  3FM5 A;  2LF8 A;  1ON2 A;  2MA3 A;  5D4R A;  2KJC A;  4DNC A;  4XLN F;  1O57 A;  5HS9 A;  1S8N A;  1Q1H A;  3ZN1 A;  3I53 A;  3VFZ A;  3RJP A;  4U7B A;  4Q5S F;  2CGP A;  1HW1 A;  2Q8K A;  4L0Y B;  3V8L A;  3K1P A;  2FF4 A;  2ACJ A;  1EH6 A;  2OBP A;  2CQK A;  1USS A;  2QYO A;  2CFX A;  4L9N A;  3F6O A;  3V8K A;  2Q2E A;  2EB7 A;  5LRS A;  1UHM A;  1YW9 A;  2L3D A;  1JGS A;  2V1D A;  4YFX F;  4ENM A;  3ZMZ A;  3RDI A;  5E8I A;  4I98 B;  3JTG A;  4IHS A;  1FX7 A;  1G6N A;  4KIF A;  1WRJ A;  3FF5 A;  2VC1 A;  4QLC U;  4KNY A;  4ZZL A;  3F6V A;  1KQ0 A;  3I5U A;  5DUK A;  3E3V A;  1FBU A;  2RDP A;  1UFM A;  3LA3 A;  1YFH A;  5KVR A;  4XBF A;  4XRF A;  1W7P B;  1KQ9 A;  5L3E A;  1F5T A;  3HSE A;  2UWM A;  3C7J A;  3VOD A;  3VB2 A;  2GWR A;  1B9M A;  1FBQ A;  3I0T A;  1Z05 A;  4RB1 A;  5F6F A;  3T8T A;  3ABU A;  4ON0 A;  1BIB A;  1AOY A;  4I0A A;  2PI0 A;  5JFR A;  1H0M A;  1MD0 A;  5FLX Z;  2Z9O A;  3RTR A;  2H94 A;  3GF2 A;  2VC0 A;  4HA8 A;  3WE3 A;  2ADU A;  2OZU A;  2ZME A;  4Z2Y A;  4HX4 A;  4OIR F;  4EJT A;  2E1N A;  5DEQ A;  2G7H A;  1R22 A;  4M9Z A;  3ZMU A;  2LDU A;  5L3G A;  3BWG A;  4OIO F;  1HKQ A;  4GO1 A;  3GZ5 A;  1G3Y A;  1O7F A;  2TDX A;  4HX8 A;  2HS5 A;  5E1X A;  1YG2 A;  4H0E A;  2OU2 A;  4P9F A;  1W4M A;  1YW8 A;  1ZG5 A;  1V4R A;  2RV8 A;  3T8R A;  5JR3 A;  2VBX A;  5CVR A;  4L18 B;  1WI9 A;  3G3Z A;  5BMZ A;  2QWW A;  1XCB A;  2EA4 A;  2VT2 A;  1RNL A;  3AAF A;  1MDM A;  4UVB A;  4LG0 A;  2YX4 A;  1F4K A;  5LEK A;  4HF0 A;  1Z91 A;  3FWE A;  1I6X A;  4RS8 A;  1IN8 A;  2K27 A;  4ESB A;  4GGG A;  1FOK A;  4A0Y A;  1D8J A;  4F7Z A;  3C3W A;  2HKX A;  4ENK A;  4U0V A;  5HDG A;  3JAM K;  4KFC A;  3RKX A;  3KLO A;  5AIP A;  2M30 A;  1RIO H;  2JRT A;  3ZMD A;  1D8K A;  2M8E A;  2D1H A;  2WC2 A;  1XGO A;  5K5O A;  5FLX K;  2QBY A;  2KIM A;  4ASN A;  1XD7 A;  3TGN A;  1QNT A;  4FT8 A;  2J5P A;  3GFI A;  2W84 A;  1BBY A;  5FD6 A;  1DPR A;  5ERI A;  4M71 A;  2GA1 A;  2OD5 A;  1HSJ A;  2XGX A;  3J80 Z;  4LLN A;  3QRF F;  3RI4 A;  1G4D A;  2L01 A;  1XMA A;  1U5T A;  2V6C A;  1T39 A;  3E6M A;  2BGC A;  4I09 A;  5K5Q A;  3ABT A;  4P55 A;  2DQL A;  4MQ9 F;  4LG0 B;  1TNT A;  3G73 A;  2KIU A;  1Y0U A;  4G6D A;  2P4W A;  3CDH A;  4MNU A;  1O3S A;  3GWZ A;  2NNN A;  2ZCW A;  2FEZ A;  4WXD A;  4QWQ A;  1HBX G;  3O6B B;  1H9G A;  3KFW X;  1JE8 A;  2FRH A;  1FT9 A;  3O2P E;  4A5M A;  3L00 A;  3ZN0 A;  2PEX A;  5IT9 Z;  1FLI A;  3M8E A;  3BDD A;  1G3S A;  4FX4 A;  1LDK B;  5FFX A;  4A6D A;  5ICG A;  3BOQ A;  4BNC A;  1RZ4 A;  4JBA A;  1R7J A;  2WWY A;  1O3R A;  4MTE A;  2YR2 A;  3BRO A;  1OR7 A;  2V9V A;  2G7U A;  4BQA A;  3K0L A;  2XRN A;  4EV0 A;  4Y13 A;  1SD7 A;  3R60 A;  3MEX A;  4L9T A;  2HKO A;  3FMQ A;  3LAP A;  2YX7 A;  1HKS A;  1TLH B;  5F1R A;  1IAW A;  4L9V A;  4WCG A;  2P8T A;  4S05 A;  4EJV A;  3TOA A;  4G8X A;  3HHH A;  2EFO A;  3GZ6 A;  2PQ8 A;  1SFX A;  1IZ1 A;  1G3W A;  1SD4 A;  3KEQ A;  2A3S A;  1VTN C;  2BE5 F;  2VN2 A;  3ZPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...