1SFXA

X-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
b'HMSNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTDGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein AF2008
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus
publication title X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
rcsb
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01978 TrmB Sugar-specific transcriptional regulator TrmB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sfxA00
1SFEA 2A6HF 3K0LA 2WTEA 1R23A 1Z1DA 1U5TC 2OBPA 2ETHA 3HTSB 2OA4A 1J2XA 4AWXB 5ICGA 3T5XA 2IPQX 4M6XA 1HKSA 3R61A 3IRRA 1DDNA 1FSHA 5LEKA 1PP7U 1FBQA 2NAZA 1BI1A 1JXSA 2H27A 5DEQA 2F2EA 5L3DA 5ICCA 1B1BA 3SHFA 2H6CA 2Q0OA 5HS9A 3GF2A 3W6JB 2XASA 3IL2A 4GYIA 3TQNA 2RDPA 2L01A 2ZXJA 3GFLA 1RI7A 1YLFA 3H92A 4ON0A 1WWXA 3BJ6A 5AONA 1EH7A 3T8TA 1U5TA 3F6OA 2P5KA 2EA4A 5E1WA 4RGUA 3G3ZA 5FLXZ 4G9YA 1XGMA 3QU3A 3FMRA 2VBYA 4KIBA 4L9TA 5ED4A 2MH9A 2L54A 2CW0F 2PMUA 5DUIA 5HLGA 4U0WA 2FF4A 2FNPA 1SD7A 3KFWX 1FNNA 1HXDA 2DBBA 4LFUA 1IUYA 4AD9A 3RPQA 4KT5C 2D1HA 4AVPA 1QBJA 3HTUA 2XROA 1MD0A 3L2CA 1ZLJA 5E20A 1HKQA 2QYOA 4WK8F 4Q5SF 1FYMA 4G7OF 1J9IA 2M45A 2UXXA 3WTZA 3WTTC 4CDGA 3BP8A 2RKHA 4UNOA 2RN7A 5CVJA 1T2KA 1U8RA 4ESBA 4M74A 1W5SA 4KN7X 2C6YA 2W25A 4LD5A 3MZHA 1FOKA 1CF7B 1AOYA 4P5OA 2BEOA 1JHFA 1FY7A 3MCZA 2DI3A 4HQEA 3CLOA 3IKVA 3RKXA 1U2WA 1ZYRF 5L3FA 2HYGD 3M9AA 1BC7C 4HAMA 2W57A 3ZMZA 1T98A 5A2QK 4ESJA 2H94A 2XIGA 1LEAA 2P5VA 5H20A 4WXHA 2MBFA 3KE2A 1KQ9A 1ZRFA 4FHTA 2E1NA 3BROA 1S8NA 1CGPA 2LKPA 1FYLA 3BZ6A 1KU7A 4G6QA 3LAJA 1BM9A 4XLPF 2HEOA 2QBYA 4A0YA 4GCVA 5IT3A 3WE3A 1DP7P 2HQRA 1FLIA 1HKTA 2L3DA 2XRNA 2IVMA 1Q1HA 4L18B 1ZGAA 1DPUA 1A04A 3ZMDA 1I27A 4GXOA 5BPDA 1XMKA 4KNYA 3WG9A 1MZBA 2Y48A 5DD4A 2E7WA 1B4AA 5F6FA 3TDUC 3E6CC 4KIFA 3QAHA 1BOAA 3DXJF 2DK8A 4E70A 3GUDA 3JSPA 4N9HA 5AIPA 3PQKA 1MDMA 4G7HF 1G3YA 2ZNYA 3HOTA 2D2WA 2V1XA 3TO9A 4L9NA 4HDVA 3K9TA 4HF1A 3RKYA 2P4WA 4CZZA 1O57A 2OZ6A 2UWMA 3F22A 2O8XA 5CVRA 3N4MA 1USTA 5FB2A 1R5HA 4L0YB 5JI6A 1GHCA 2V79A 1LNWA 4IHSA 3E3VA 4EM1A 3BY6A 2EFNA 5D5VB 2TDXA 1MJAA 3G73A 3SZPA 2NS0A 4H0EA 5HLHA 1IAWA 5E1ZB 4EM2A 5L3EA 5FFXA 2AXLA 2G7HA 3HSFA 2V9VA 3QOPA 1I5ZA 1ZG3A 2YX7A 1P2FA 5CVUA 4BHBA 2H6BA 3R6SA 4K2EA 2L02A 2HOEA 2MC3A 4LB5A 2QQ9A 2A07F 1TTYA 2RNJA 4OU0A 2X4HA 2CGPA 1G3SA 4HF0A 3DFGA 4A5MA 5LGNA 2FBHA 4TV7A 3KP3A 2ZCWA 5HDNA 5E8GA 3V7CA 4UHTA 3EETA 3VEPA 4S04A 3F21A 3RYPA 1P92A 4LG0B 3REOA 2XAJA 2A5YB 2M5WA 3GW2A 2H09A 2O3FA 2GA1A 3CUQC 4KDPA 4UVAA 4JQFA 2IJLA 2DAOA 2A3SA 3ZMVA 1ULYA 2PMHA 2QQAA 4IF4A 2KIFA 1SD6A 3WODF 1XSVA 4Q48A 4UV9A 5DCMA 2FSWA 3QP5A 2QVOA 1ON1A 4KYWA 1AWCA 4S05A 3LWFA 4A0ZA 2ZBKA 1D3YA 4N0BA 2RC4A 4YFNF 2CFXA 2IA2A 1WSUA 2ZMEB 1HW1A 3E5UA 3J81Z 2OD5A 1IN7A 3TDZC 1R7JA 1KA8A 1TNTA 3I54A 3V8JA 6PAXA 2KKOA 2R7DA 2BYVE 3NEUA 3LAPA 1TNSA 3KZYA 1HSJA 3F23A 3DKWA 4BHCA 2CG4A 5BQTA 3HSEA 1IW7F 4PGHA 4MGRA 2NNYA 1L0OC 2EA2A 4OOIA 3BPXA 3QP6A 3WTWC 3L9FA 1J0RA 4EJOA 4LB6B 1I1SA 3TKYA 2XUBA 3ZQ7A 5KK1A 3WTXC 4WXDA 3KP7A 2STTA 2MLKA 4UXNA 4BH9A 3KCCA 2ESHA 4HBLA 3V7RA 5H6RA 2EV0A 4BNCA 2P7VB 4OIPF 1KU3A 4RB2C 5FO5A 5J8CA 5ILVA 3BPVA 1ZRCA 1YTYA 1FP2A 4WX9A 3ML6A 1HW5A 2A61A 4M72A 5LHHA 5HDKA 2MA3A 4B8XA 4A6EA 1W7PD 3TOAA 5LHGA 5EEHA 3NQOA 4KN4X 2A6EF 4EM0B 1XCBA 4GO1A 1F4KA 4CYDA 2QZ8A 2EK5A 3F8BA 3FM5A 3PFIA 1BJAA 2GXGA 2Q2EA 3PQJA 3MFKA 3RDIA 2GAUA 2RV8A 3IC7A 5FLXK 5JFRA 2XHKA 4ETSA 3HRSA 2DLLA 1RUOA 3B02A 3DQVC 3U9GA 1O3QA 2XGXA 2HS5A 3ELKA 4M73A 3O6BB 4A0XA 5LGTA 5ILSA 3FHZA 3E5QA 1GXPA 1EH6A 2OU2A 1ZARA 4EGZA 4JBAA 1K79A 2K86A 1SMYF 3J81K 3N97A 3B73A 3U1DA 2PI0A 3GFJA 3KP2A 3KEOA 1YW8A 2P8TA 1L3LA 3ZPLA 2QM3A 3KP5A 1PUEE 3EDPA 2EB7A 1LQ1A 4I0AA 2MD5A 2M1BA 4HF2A 1TW2A 2E1CA 1S3JA 1MJBA 4U0VA 2P6TA 3QPTA 1SD4A 4CXFA 4RB1A 4ZYEA 4N9IA 3LA3A 4PCQA 2KIUA 4LJZF 5HS8A 2QBYB 1FBSA 2VXZA 1MDMB 3E6BA 2XVCA 4HA8A 2LNBA 2PN6A 1ZLKA 2DTRA 4G94A 4R79A 1BBYA 3VODA 1BIBA 3KP6A 2HFHA 1YYVA 2HZTA 3F8FA 2ZNZA 1FC3A 3ABTA 2VOOA 1Z6RA 4U88A 1R1UA 1MJ9A 4AIHA 2R7FA 5FFZA 4L9VA 5BMZA 1B9NA 5LHIA 3C7JA 4WCGA 1IRFA 4I09A 1P6RA 3HRTA 2GWRA 1G4DA 3EUHA 1R00A 1XSXA 4M9SA 4IRGA 5JHUA 3SZTA 4ENNA 1R36A 4OIRF 5DDGA 3C3WA 1MKMA 4ESFA 5F1RA 3K69A 1UHMA 3D5LA 1OYYA 3I59A 4BQAA 2L4MA 4FX4A 5BOXA 1LDJA 3OOPA 4OINF 3LQRA 4OMYA 1O7FA 1IXRC 1S7OA 1QPMA 1EH8A 3HIFA 2XAQA 1R5GA 2DK5A 3BWGA 1H0MA 1HQCA 1XSDA 1OPCA 3ABUA 3DEUA 3D0SA 3R0AA 3KLOA 2K4JA 4JK1X 1W5TA 1LDKB 4YFXF 4ZZLA 5HS7A 2FNAA 4KMUX 1V4RA 1P4XA 3F8MA 4A2UA 3K1PA 1QGPA 3CJNA 4QWQA 2QWWA 2EFOA 1TLHB 3CDHA 4IJAA 2GQQA 4CICA 5CVIA 4P96A 2EV5A 4ZH4F 1QZYA 3EYYA 2JTVA 2BBYA 4GGGA 2VOPA 1YW9A 4KICA 1XB4A 5D6EA 2ESNA 2JRTA 3U2RA 2HR3A 2HTSA 2EFWA 4LK1F 1R58A 1DPRA 5D8LB 1U5TB 1YFHA 5D5XB 4XRFA 4IHTA 4CGZA 2VONA 3E6DA 2XKPA 1IXCA 1G3TA 2PG4A 4MHGA 2FA5A 2PLYA 1QO0D 3S2WA 4NB5A 4HLYA 5E1XA 4EV0A 3W6KB 2OQGA 2XAGA 3IHUA 1WKMA 5FD5A 5H6QA 2DPDA 4HYEA 2DQLA 2VBWA 2JT1A 2P5LC 3GO5A 3JTHA 2ACJA 4I02A 2ELHA 2LDUA 4IVNA 3V4GA 4ZYGA 2Z3YA 1YO5C 1F1ZA 1ZG5A 1QZZA 3WU0A 3LSTA 4U0YA 2STWA 1KQ8A 2F5FA 4MEXF 5CYVA 5F64A 1UCRA 4LK0F 3L7WA 2ADUA 4LG0A 5CLSA 1ZAOA 2A69F 4KIGA 4AIJA 3K1NA 4A12A 1S29A 4RGSA 4MTDA 1SMTA 2YX4A 2LF8A 2NRAC 4ENMA 4O3MA 2P7CB 3FWEA 4RB0A 3O3KA 3BDDA 5DUKA 1LJ9A 1XGSA 1EV7A 3FMSA 2WWYA 1D5VA 4Y15A 4IRIA 3KLNA 2F5EA 1W4MA 2FBIA 2ZMEA 2IA1A 3E5XA 1MGTA 2O6GE 1D8KA 3GZ6A 2COMA 2FXAA 2KJCA 3K1MA 2W84A 4LLGF 2A68F 4L5IA 3KETA 5E17F 2FU4A 1FT9A 1YS7A 1T0FA 5BPIA 5LBQA 5DCMB 2DW4A 1P4AA 4CO8A 4EQQA 2W24A 2VC1A 1HSTA 2FMLA 3P9CA 1RZ4A 4NQWA 3T1BA 2HDCA 4I2OA 3JTGA 1G6NA 1U78A 4Q4ZF 4CHUA 1YG2A 4HQMA 1J59A 1J7KA 1Z91A 3ZMSA 3JAMZ 3I53A 4ZYHA 2IP2A 3JAMK 1B6AA 3C1DA 5J6XA 1U3EM 4QLCU 1SFXA 1SFUA 1TQPA 5DYMA 2HWVA 4BHPA 3HSRA 2VN2A 1ZN2A 4EJWA 1REPC 2D45A 2VBZA 3GZ5A 3I58A 4D0PA 3BJAA 2Y75A 5DD8A 1XDUA 3Q5FA 1J5YA 3J80K 1IN5A 3R4KA 3J80Z 1LVAA 2BE5F 2FEZA 4ZZDA 3V8KA 1K7AA 4Q47A 1Z6TA 1TQMA 1YQAA 1W7PB 1Z05A 4MQVA 2DPUA 5JR3A 1F5TA 2QLZA 3P7NA 2Z99A 1KQ0A 3GFMA 4PGGA 2DO7A 3ZN0A 5E18F 4L0ZB 4U7DA 3R60A 4I0BA 4BAYA 5LLQA 4Z2YA 2PFBA 3H3UA 2LF7A 2LSOA 2V6CA 3F8CA 5D5UB 5D4RA 2EFPA 3V8LA 4PZJA 3I71A 3CUOA 1DUXC 1OR7A 1NHAA 2XAHA 5BS6A 2G7UA 3LA2A 2FQ3A 5L3GA 4M9ZA 3RKWA 1OYIA 2V1DA 4IRHA 4EJUA 2Z5UA 4DNCA 1Z7UA 4XLNF 4RAYA 3V7SA 4EMSA 3ISPA 5KVRA 3ECHA 4BYYA 3DPTA 2VE8A 1FZPB 3FXRA 4KA4A 3FF5A 1J75A 2M30A 3DV8A 1TQIA 4OMZA 3TOBA 1XD7A 2QQBA 3I5UA 2V1UA 3TO7A 3FM3A 4I01A 1ODDA 4IXAA 5HDGA 5D5WB 4HOBA 1G3WA 3GYHX 1T38A 3WGIA 2FMYA 3WTYC 2YPRA 3Q9VA 3TO6A 1C0WA 1USSA 1KU9A 1UFMA 2JZYA 1T39A 5K5OA 3LQQA 1YW7A 4XBFA 2DT5A 2FRHA 4KMFA 1JHHA 2F5DA 5TJJA 4RS8A 2DFIA 2PJPA 1ON2A 3GFIA 1X3UA 3I64A 4RAZA 3FXQA 4Y17A 3RTRA 4UVCA 2HQNA 1FPQA 5K5QA 1H9GA 2HKXA 2ISYA 3HRMA 3T0YA 3GVAA 3OV8A 2YSRA 1CF7A 3WTSC 2QENA 1XCVA 2YR2A 5J8FA 2VBXA 2NYXA 1KU2A 2B0LA 3AAFA 1I1GA 1B59A 2IRFG 3GEZA 3GXOA 2O61A 1TBXA 2VC0A 3CO7C 1JGSA 2HTJA 1H9TA 4MEYF 5L3CA 3MEXA 4AIKA 5D8KB 2EWNA 5ERIA 2EV6A 3MQ0A 3ULQB 4BXUA 3E6MA 2K4BA 2GIVA 1E17A 5IT9Z 1WRJA 4G8XA 4HX8A 2WC2A 1JE8A 3O2PE 3FMQA 3WTVC 3F72A 3M1EA 4A5NA 5A2QZ 3RIRA 1U6GA 4KFCA 5HVQC 1Y0UA 3MWMA 1VTNC 2RVCA 5FGMA 3E97A 4LGWA 3J7AO 3HHHA 4L9JA 4M71A 1IRGA 4YIIA 1O3SA 2AS5F 2VT2A 4LLNA 4DQ2A 3EYIA 1RIOH 2DU9A 3IWZA 4OIOF 4XSZF 1FP1D 2GA2A 2MLGA 1PP8F 2Y0MA 2KIMA 1R22A 3SFZA 1K6OA 2K27A 1ZRDA 4I7HA 3TGNA 1OYWA 2RGVA 2EFQA 3HHGA 2X0LA 3BJOA 2R3SA 2IT0A 4FT8A 3LFKA 1S7AA 3F3XA 3NRVA 3VB2A 1BI2A 3L00A 2PEXA 3R0JA 4HX7A 3M7GA 5LRRA 5CVVA 3P9IA 3HUGA 1STZA 5HLIA 4L5JA 3FZVA 3I4PA 2OAZA 4IPAA 1QQIA 3BOQA 5FD6A 4WXCA 4M6YA 4PDKA 4R8HA 3ROUA 2EJRA 1IN8A 2BGCA 1HW2A 3WTUC 1KYZA 1FBUA 1IXSB 3F8NA 3ERED 2GZWA 3I0TA 2Z33A 2F5CA 4HX4A 3WGHA 2JPBA 2O0YA 3F6VA 4MQ9F 4KUMA 3K2ZA 4A6DA 4HV6A 2PBIA 4GYGA 5ICEA 2KJBA 2ZFWA 3RYRA 2G9WA 4P9UA 1ONVA 3ECOA 4EVIA 4P9FA 4U7BA 1RNLA 5L3BA 5EEGA 3VOEA 3WE2A 1XN7A 1O3RA 1ZG1A 1ZGJA 3P9KA 5AIQA 3CUQB 5LGUA 3RI4A 5IT9K 3GX4X 1IN6A 3GLXA 3QRFF 1XMAA 3Q9SA 3JSOA 1GVJA 3RPUA 1BI3A 3HRUA 1IN4A 3ZN1A 4F7ZA 3QU6A 2HGCA 3I59B 4I98B 4ENJA 4EJVA 2OZUA 3DPLC 2FE3A 3M8FA 3IKTA 1SD5A 5LEJA 4ZYDA 4O5VA 1XGNA 1D8JA 2D1VA 2ZKZA 4HLXA 1E2XA 4ASNA 3IRQA 2M87A 2UXNA 2E7XA 5DV5A 3MAJA 3C18A 1SAXA 4EGYA 5TRDA 5DCFA 4Y13A 2MH2A 2L4AA 1OKRA 5K1YA 1B9MA 1RUNA 1XGOA 1K78B 2YU3A 1BI0A 1YIOA 2WV0A 2XAFA 1IF1A 4MNUA 3KP4A 4M9XA 3GWZA 2JPCA 2CQKA 2FBKA 1Z9CA 3H3ZA 2O03A 3FX3A 1S6LA 2CWEA 4YIFA 3CTAA 1I6XA 2IA0A 2CSOA 1OMIA 1K78A 2Q8KA 2P6SA 3M8EA 4O6JA 2VODA 1O7LA 1UHWA 1F9NA 4HDUA 1WI9A 2HKOA 2JSCA 2RQPA 4RGXA 1YS6A 5E8IA 2VE9A 3KEQA 3CO6C 4YG2F 2QUFA 4HV5A 2GXBA 1HBXG 1T6SA 3SQNA 1KYWA 4UVBA 5K5RA 3FXUA 5D6FA 3WGGA 1W7PA 2VT3A 3HOSA 4UV8A 1KGSA 2K02A 1V3FA 1UB9A 4FX0A 1FWZA 1TW3A 1WQ2A 4B09A 4LLLA 4HZFA 4WF2A 5HOOA 1LEBA 2XV4S 1FYKA 3QPHA 3ZMUA 3ZP5A 2IW5A 4UUVA 1R1VA 1BIAA 3DF8A 2PQ8A 1QNTA 2J5PA 2W85A 1LB2A 1GXQA 2XKOA 5CJ9A 3CUQA 3DP7A 1ZH5A 4G7ZF 1LDDA 1IZ1A 2ZO4A 3KZZA 5ICFA 2ZJ2A 2HYFA 1FX7A 3WU1B 4RGRA 3HYIA 1PDNC 1P4WA 2DQRA 1FSEA 2KRFA 1BC8C 2FOKA 4OIQF 2CYYA 4HW0A 1XDSA 4YFKF 5ILUA 3VFZA 3RJPA 2ISZA 4WWCA 4P55A 1ZHFA 2K7LA 3L09A 2BV6A 2NNNA 3JW4A 4MTEA 3MZYA 4G6DA 5JVTA 5D4SA 3COAC 3ZMTA 1BN5A 4NHJA 3IWFA 4RB3C 4EJTA 2UZKA 2OQRA 5LRSA 4ENKA 3LA7A 2M8EA 2Z9OA 4R1HA 2J5OA 3SXYA 1R1TA 1O3TA 4XSXF 2CO5A 1ZREA 4LMYA 3EQLF 3T8RA
chains in the Genus database with same CATH superfamily
3BCAA 1SFEA 2JA8J 2LG4A 2A6HF 1OISA 3K0LA 2WTEA 5BNGA 1R23A 2M4KA 1Z1DA 1U5TC 2R7RA 2OBPA 2ETHA 3X2QH 1FJLA 3HTSB 2OA4A 2OPTA 3B6CA 1J2XA 1LFPA 2R0QC 4AWXB 5ICGA 3WG7H 3T5XA 2IPQX 4M6XA 1HKSA 3B6AA 3R61A 3IRRA 1DDNA 1FSHA 1OCOH 4XK4A 1MBKA 1ORKA 5LEKA 1PP7U 1FBQA 2NAZA 1BI1A 4E6KG 1JXSA 4C2TA 1G2HA 3H5RA 4D9JA 2H27A 5DEQA 2F2EA 1V5GA 5L3DA 3A4CA 4X1EA 5ICCA 1B1BA 1Y8QB 1E3OC 1OCTC 1SVMA 4JYKA 3SHFA 4C2UA 2DOFA 2H6CA 2Q0OA 5HS9A 3DBHB 3GF2A 2JMWA 3W6JB 2XASA 2LBFA 5E79C 3IL2A 2OCEA 4GYIA 3K10A 3TQNA 2RDPA 2DTZA 3FIWA 2L01A 1X1DA 2ZXJA 2GXAA 3GFLA 4OAYA 5IOZA 4M3FA 1RI7A 1YLFA 3H92A 2BVLA 2BZTA 2VKVA 4ON0A 1JKRC 3ZGKA 2Z16A 1WWXA 4GFBA 3HOUJ 1XTAA 3BG7A 4G12A 3RZDJ 3IUOA 3BJ6A 5AONA 1EH7A 3T8TA 1U5TA 2X1EA 4XKCA 2JVGA 3F6OA 2P5KA 2EA4A 1AA7A 4D7NA 1D5YA 5E1WA 4RGUA 3G3ZA 5FLXZ 4G9YA 3OS1A 3K6GA 1XGMA 1T0FC 3QU3A 3FMRA 2VBYA 4KIBA 4L9TA 5ED4A 5IYBJ 2MH9A 3VYRB 2VPRA 5E3LA 2L54A 4BS9A 2CW0F 1I39A 2PMUA 2ICWG 5DUIA 4W1UA 5HLGA 1XX5A 4U0WA 2FF4A 2FNPA 4J19A 3RKQA 3A2KA 2KL4A 1QPIA 5JLWA 3GMEA 2A5WA 4XOTA 1BW5A 1SD7A 1TZLA 3HOZJ 3OIOA 4F91B 3KFWX 2L9RA 4NBQA 2VQCA 4XORA 1FNNA 4XN0A 1HXDA 2DBBA 4LFUA 2R7ZJ 1IUYA 4AD9A 2F4MB 3RPQA 4DZJA 1NH3A 4KT5C 3CC7I 2DA3A 1Q1VA 2E2HJ 1MBEA 2D1HA 1A6QA 1VQ9I 4AVPA 3S3OA 4FTHA 3HTUA 2XROA 1NG6A 1QBJA 3DLLF 2Q1ZB 4P1WA 1MD0A 2DXIA 3L2CA 2VKEA 1ZLJA 5E20A 1HKQA 1Y1WJ 2QYOA 4WK8F 1HF0A 4Q5SF 1FYMA 4G7OF 3GTQJ 4KJZA 1ITYA 1J9IA 2QEXI 2M45A 2UXXA 3SDBA 3WTZA 3WTTC 4IHVA 4CDGA 3BP8A 2RKHA 5EZGA 4UNOA 5EEAA 2RN7A 3S1QJ 5CVJA 4ABZA 1T2KA 1U8RA 2JQ7A 4ESBA 1JKOC 4U87A 3HOVJ 4M74A 3BZKA 1W5SA 1GT0C 1K4TA 4KN7X 1A6IA 2W25A 3MZHA 4LD5A 1FOKA 2C6YA 1CF7B 1AOYA 4P5OA 2BEOA 1JHFA 1FY7A 1RKWA 3MCZA 2DI3A 2DMTA 2JUGA 4HQEA 2JA5J 4DBRA 3CLOA 3IKVA 4FQGA 1UAAA 1RR7A 3RKXA 1U2WA 1ZYRF 5L3FA 3JRIA 2HYGD 3S1MJ 3H9GA 3VYSB 2WADA 3M8JA 5J1UA 3M9AA 3ZR8X 1BC7C 4HAMA 5M5YJ 2W57A 2DMPA 3ZMZA 1T98A 2KISA 1JTXA 4CCLA 1T08B 5A2QK 4ESJA 4E4HA 3G6EI 2H94A 3DBRB 1HCRA 2XIGA 1LEAA 3HKZN 3Q3SA 2P5VA 5H20A 4WXHA 1MMNA 2K85A 3CCMI 1KZHA 2MBFA 2VLAA 1Y56A 2HOAA 3KE2A 3RZOJ 1KQ9A 3OYGA 1ZRFA 2WB1A 4FHTA 1IG7A 3L1PA 2E1NA 3BROA 1FMWA 1S8NA 1CGPA 2LKPA 2XAUA 1IRZA 1FYLA 2Z1DA 4C2MJ 4C3JJ 3BZ6A 4YELA 2K9NA 1KU7A 3DCFA 5IP9J 4G6QA 5FKNA 3LAJA 4M3DA 1J09A 2R7QA 3MD2A 2QKMB 1BM9A 4RM2A 4CCMA 4XLPF 5E3MA 3QPSA 3OYIA 2HEOA 2QBYA 1S5LC 4GCVA 4A0YA 3WE3A 5IT3A 3H0DA 1AU7A 1DP7P 1WPKA 2HQRA 1VQKI 1FLIA 1HKTA 2L3DA 2XRNA 2IVMA 2ZSHB 1Q1HA 4BY1J 4L18B 3VYUB 3HOWJ 3BR5A 2XF5A 2KRCA 1ZGAA 1DPUA 3FKIJ 1A04A 3ZMDA 1I27A 2X9DA 4GXOA 1XMKA 3ZQQA 2NS7A 5BPDA 4KNYA 3WG9A 1MZBA 5F08A 2MC4A 2Y48A 4XLCA 2ZJPF 5DD4A 2E7WA 1B4AA 1LFBA 1X3ZB 3O8GA 5F6FA 3TDUC 3E6CC 4KIFA 3QAHA 1BOAA 4B4CA 4LITA 4UUSA 3DXJF 4C3HJ 2DK8A 4E70A 2IBDA 3GUDA 2ME6A 3JSPA 3S17J 4N9HA 5HNHA 5AIPA 3PQKA 1MDMA 4BQQA 4G7HF 1G3YA 2ZNYA 3HOTA 1BW6A 2D2WA 4IHWA 2LREA 5F0HA 1SC7A 2VI6A 2CW7A 5J4YA 4AU7A 3KYDB 3MKZA 3JR9A 2VXDA 1WI3A 2V1XA 4XM3A 2V9KA 3TO9A 1QRYA 4L9NA 4HDVA 1YHQI 1U0JA 1WVRA 3K9TA 4HF1A 3GTMJ 3RKYA 2CH0A 2P4WA 4XLAA 1R4NB 4CZZA 1O57A 2OZ6A 2UWMA 4B3AA 3F22A 3FHNA 3V42A 4BJ5C 1UMQA 1N25A 1GVDA 2O8XA 2VQHA 2DYSH 3PJRA 1IV6A 5CVRA 1PJRA 3BG9A 3N4MA 1USTA 3KZIC 5FB2A 3FKJA 1R5HA 2EIJH 4L0YB 1PYVA 4A3KJ 3K7AJ 1V55H 5JI6A 4A69C 1GHCA 4D5FA 2V79A 3JCUC 1LNWA 1B72B 1E0EA 4IHSA 3HPGA 3E3VA 4EM1A 3BY6A 2LKSA 2EFNA 5D5VB 4EEFG 2TDXA 5H2FC 1DP3A 1W0TA 3RCOA 4F93B 3TMOA 1MJAA 3GLLA 1RESA 1Z77A 3SZPA 3G73A 1XG1A 2EIMH 4PUSA 2NS0A 4H0EA 2H1LA 5HLHA 1IAWA 5E1ZB 4EM2A 5L3EA 3BCBA 5FFXA 2AXLA 3HSFA 2G7HA 1OCRH 4ZC3A 2V9VA 3QOPA 1I5ZA 1ZG3A 4QSHA 1NK3P 1FTTA 2YX7A 1P2FA 3GTOJ 1VF9A 5CVUA 4BHBA 2H6BA 1HA8A 3R6SA 4K2EA 2L02A 1EKEA 1GDTA 2HOEA 2F4IA 2MC3A 4LB5A 2QQ9A 3Q0WA 2A07F 3QQAA 3NWTA 2L7KA 4J01A 1TTYA 3LSMA 2RNJA 5EGOA 4OU0A 4PFPA 1B8IA 2X4HA 2CGPA 1G3SA 3OR1C 4HF0A 4UY8I 4IKFA 2DT7B 3DFGA 4A5MA 1WJBA 1ETXA 5LGNA 2FBHA 4JX6A 4ZTJA 4TV7A 3KP3A 3PM1A 3HDDA 2X6OA 2UV1A 1SFKA 4DYCA 3DKYA 3S16J 1Z3XA 2ZCWA 5HDNA 3U21A 5IP6A 2O7OA 2OCCH 1MMDA 4PJ0C 5E8GA 1SVOA 3V7CA 4UHTA 3ZOBA 3EETA 3VEPA 3ZCOA 4S04A 3F21A 3RYPA 3RSNA 1P92A 2NVTJ 2X6XA 4LG0B 3REOA 3CMYA 2XSJC 2R5ZB 5B3SH 2XAJA 2A5YB 2M5WA 3GW2A 3OYAA 4C9YA 2MW8A 2H09A 3RPUD 3OOUA 1R5ID 2O3FA 2GA1A 3CUQC 4KDPA 3FISA 4EATA 3L2VA 4UVAA 4IZZA 4JQFA 4A3FJ 4IOCF 4HG2A 1TWHJ 2IJLA 2DAOA 2A3SA 3DWLE 3ZMVA 1ULYA 3JRBA 2PMHA 2ZXHA 2QQAA 4NQWB 2HPMA 4QIWN 4BKXA 4IF4A 3VSKA 5EF6A 2KIFA 5K7ZA 1SD6A 3WODF 1XSVA 4Q48A 4UV9A 5DCMA 1YRNB 2AHQA 2IGMA 3I4MJ 1PUFA 4NC7A 2FSWA 2Y2ZA 3QP5A 3HOXJ 2QVOA 1ON1A 4KYWA 1JUMA 1AWCA 2WV1A 1WHUA 1VQMI 4S05A 3PNYA 3LWFA 4A0ZA 4FE4A 3AG3H 2ZBKA 1D3YA 2A6TA 4N0BA 2HVRA 2LKXA 2RC4A 1JT0A 4YFNF 1UZCA 2CFXA 2IA2A 1WSUA 1QA6A 1ETVA 2ZMEB 1HW1A 2BW3A 1AKHB 3HKZA 3E5UA 1GV2A 2BY2A 4ZDLA 3J81Z 2OD5A 1JT6A 3IP4B 1IN7A 5IOYA 3TDZC 1R7JA 1KA8A 3DTEA 1R4MB 1TNTA 1YRNA 3L2WA 2VUMJ 2DFFA 3I54A 3WU2C 4CCNA 2JN6A 3D5RC 3V8JA 3C2HA 6PAXA 2XF7A 2KKOA 3CF2A 2R7DA 1MNEA 2BYVE 3NEUA 3LAPA 1TNSA 3IH2A 3KZYA 2W1OA 1HSJA 3F23A 2IS6A 1WCMJ 1NTCA 3DKWA 4XKWA 4BHCA 2CG4A 4E7ZA 2L7MP 5BQTA 3HSEA 1IW7F 1FEXA 4MGRA 2L7FP 2NNYA 1L0OC 2EA2A 2XB0X 2R5YB 4OOIA 4CSWA 2LVSA 4Y3OA 3BPXA 3QP6A 3WTWC 3SJMA 3L9FA 1X3WB 1J0RA 3W2VA 4EJOA 1K6YA 3L2UA 4LB6B 3CCJI 2H1KA 2K9QA 1I1SA 5CQGA 3TKYA 2XUBA 1RC9A 2X1CA 3ZQ7A 5KK1A 3WTXC 1A31A 3M4OJ 1HDPA 1H8AC 4BBRJ 4WXDA 3SYTA 3KP7A 2STTA 2MLKA 4UXNA 4BH9A 1HLVA 3KCCA 4A3MJ 2KT0A 2R7UA 5JLXA 4NNJA 3BR2A 1JTYA 2ESHA 5F0FA 4HBLA 3ONQA 3HGGA 1OQYA 4KITB 3V7RA 5B1AH 1XMXA 4DW6A 2R7OA 3QWLA 3AL0B 2KPMA 5H6RA 3PO3J 3FXLA 4X0GA 1B8IB 3S2DJ 2K9SA 5EGOB 1JI8A 2EV0A 3DTIA 4BNCA 2P7VB 2LK2A 3PIOF 4OIPF 1KU3A 4RB2C 3IAS2 5FO5A 5J8CA 2QA4I 1YITI 5ILVA 2R5ZA 3BPVA 1VQPI 3OYHA 1ZRCA 4A3JJ 2FD5A 4BU2A 2VQGA 1YTYA 1FP2A 4BXFA 4WX9A 2JA6J 1MMGA 3TEDA 3DBLB 1P7IA 4S0HB 3ML6A 3H5AA 1HW5A 4OAZA 2A61A 3VYTB 3BR0A 4M72A 4PFOA 5J1YA 5LHHA 5HDKA 1MMSA 2MA3A 2JRMA 2COBA 4B8XA 5FRNA 4A6EA 2QSFX 1W7PD 5LFAA 3E7LA 1DQUA 3TOAA 5LHGA 5EEHA 3NQOA 4KN4X 2A6EF 4XOPA 4EM0B 1ZR2A 4NDLA 1XCBA 4GO1A 1F4KA 3S15J 4CYDA 3FDYA 2QZ8A 1MSFC 2X1DA 1I3AA 2EK5A 3F8BA 1YOVB 3FM5A 3PFIA 2KRHA 5CKTA 4IEJA 2K5CA 3VDXA 1BJAA 2Y31A 2GXGA 2Q2EA 2HXIA 3PQJA 5KHDA 3MFKA 1TWFJ 5B5EC 1V5FA 3RDIA 2BY1A 5IP7J 2GAUA 2RV8A 3IC7A 3M1CA 2P0WA 2JA7J 3HZJA 2LLKA 5FLXK 1U8BA 4RM3A 5JFRA 5DM6F 4M3EA 1SEUA 2XHKA 4ETSA 2NVYJ 2GOMA 3HRSA 2DLLA 1RUOA 3ZXSA 3B02A 3DQVC 3U9GA 4I99C 1O3QA 2XGXA 4Y4RA 3K4JA 2HS5A 3ELKA 1YJ9I 4M73A 1R6RA 3O6BB 3CCUI 3PNTA 4A0XA 5LGTA 5ILSA 1Z3YA 3FHZA 3E5QA 1GXPA 4BQOA 1EH6A 2OU2A 4E7SA 1ZARA 2DODA 4EGZA 4JBAA 1K79A 3M07A 4YRVA 1JUSA 2K86A 1JKPC 2HOTA 1MIJA 1SMYF 3MMYB 3J81K 5FROA 3N97A 1ZQ3P 2NVXJ 4RLFA 3CC2I 3B73A 1WH5A 2LY9A 3U1DA 1RETA 2PI0A 2X48A 3GFJA 3KP2A 1WJ5A 3KEOA 1YW8A 2CQQA 2P8TA 3H1CA 1L3LA 3ZPLA 2QM3A 2DA2A 1W5CC 3KP5A 5EJCA 1PUEE 3EDPA 2EB7A 1LQ1A 1OFCX 2MD5A 4I0AA 2M1BA 2VB6A 4HF2A 1P9QC 1TW2A 5HLTA 3OSGA 1S3JA 1MJBA 2E1CA 2V1NA 3PIPF 2UUZA 2FOWA 4I76A 4U0VA 2P6TA 4F55A 3QPTA 2QGUA 1SD4A 5F27A 3OL4A 4HNTA 4CXFA 4RB1A 4ZYEA 2ZMEC 2O9LA 3OYMA 4N9IA 3VSLA 1MW7A 4HSTA 3LA3A 2CW8A 4PCQA 2KIUA 4LJZF 5HS8A 2M4GA 2QBYB 1FBSA 3OS2A 2VXZA 1O4XA 1MDMB 4YIRX 2HNHA 1QU3A 4QPQA 3CQZJ 3E6BA 5FRMA 4QTRA 2XVCA 4HA8A 1IDZA 1YE9A 2LNBA 2KQRA 2PN6A 1WJCA 4V2FA 4ZJZA 1ZLKA 3LSPA 2B7EA 2MGQA 2OTLI 2L7ZA 2DTRA 4G94A 2PX9A 4UUSB 4RDUA 4R79A 1BBYA 3VODA 1BIBA 3K4CA 3KP6A 2HQAA 2HFHA 4AYBA 1B72A 1ACIA 2ZJRF 1DU0A 1YYVA 4XIDA 2HZTA 1A35A 1TP4A 4UUTA 3AG4H 4D1QA 3F8FA 1SAUA 1DGWY 4J00A 3H0GJ 2XRLA 3LSHA 2ZNZA 1FC3A 3ABTA 2VOOA 1Z6RA 2Y9ZA 3PL8A 4MFEA 3TP3A 4CZCA 4U88A 4DYRA 1POGA 1R1UA 1MJ9A 4DYQA 1D0ZA 1E3PA 2OJED 2Z2SB 2R7FA 4AIHA 2ZXWH 1OLTA 5FFZA 3CESA 2K40A 2CV2A 4L9VA 5BMZA 3K4NA 1B9NA 5LHIA 1MNDA 3C7JA 2CRGA 4WCGA 3G1MA 1IRFA 4I09A 3MKYB 1P6RA 3HRTA 3M3YJ 2M7AA 3DLAA 1QVUA 3HPHA 1JJ6C 2GWRA 1RKTA 1G4DA 3EUHA 2R7XA 1WH7A 1R00A 1XSXA 4M9SA 4IRGA 2WAFA 2QCOA 3EPZA 5FKKA 2DT6A 4YEJA 5JHUA 4B44A 1X1CA 4RBOA 3SZTA 2FUG2 3ZRGA 4ENNA 1R36A 2E35A 2LMDA 4OIRF 5DDGA 4IOAF 2IS1A 1PVEA 3C3WA 1MKMA 1D1BA 1X1BA 4ESFA 5F1RA 3K69A 1UHMA 2EBIA 3BZCA 1OYYA 1UG0A 1GV5A 3D5LA 4FE7A 3I59A 4BQAA 4XQFA 2L4MA 3CMAI 4FX4A 1ETYA 3CCVI 4F92B 5BOXA 3W2WA 3BR3A 4IHXA 1X58A 1LDJA 3OOPA 4OINF 4HSRA 3LQRA 4OMYA 1K61A 4D7MA 1NK2P 2VQLA 1O7FA 1IXRC 1S7OA 1ENHA 3HOYJ 1QPMA 1HC8A 4ITVA 1EH8A 3HIFA 2XAQA 1LVKA 3ZQHA 3OYFA 1R5GA 2ME0A 2DK5A 3BWGA 3K4KA 1UG2A 1H0MA 2R7SA 2DA1A 1EA3A 1HQCA 1XSDA 2DJNA 1UELB 3OL3A 4XR6A 5IPAA 1OCCH 1OPCA 3IH4A 2RREA 2M0CA 3I4NJ 1X4PA 3FK7A 3ABUA 4IL6C 4B47A 3DEUA 2X6WA 3D0SA 3R0AA 3BTCA 3KLOA 2LY1A 2W82A 4ZTFA 2M8GX 2K4JA 4JK1X 2EZLA 1W5TA 1LDKB 1D0XA 4YFXF 4ZZLA 1RR8C 1OJLA 5HS7A 3UR3C 2Q2EB 2YS9A 1UHSA 2FNAA 2W48A 3SDGA 3D5SC 2JVHA 3HXLA 2M9HA 4KMUX 1V4RA 1P4XA 3F8MA 2ZJQF 4A2UA 3K1PA 1QGPA 3CJNA 4QWQA 2QWWA 2EFOA 4L5EA 1TLHB 3CDHA 1YJNI 4IJAA 3BR1A 2GQQA 4CICA 5E3OA 2E1MC 5CVIA 4P96A 3NARA 3GTLJ 2EV5A 4ZH4F 1QZYA 3EYYA 3QYEA 1T95A 2JTVA 2QQ8A 2W7NA 2BBYA 1ZK8A 1R9TJ 3OIPA 3ABMH 4GGGA 2BHZA 4XKBA 2VOPA 1YW9A 3EUAA 4KICA 1XB4A 5D6EA 2ESNA 3HUGB 2JRTA 2LY2A 3BG5A 3U2RA 2KFDA 3IV5A 1XC5A 3OR2C 3ZQFA 2HR3A 4DZPA 3KIOA 2HTSA 3GTGJ 1X1AA 2E5ZA 3OY9A 2EFWA 4HRIA 3DEWA 1IO2A 1R58A 3HC7A 4LK1F 1DPRA 5D8LB 2R7TA 1U5TB 2D5VA 3DU6A 3OYCA 5D5XB 4XRFA 1YFHA 4IHTA 3CP8A 2Y0SA 3IAM2 1QHHD 1VI0A 4CGZA 2VONA 3E6DA 1LPQA 2XKPA 2DMNA 1IXCA 1G3TA 2PG4A 4XLHA 2L9VA 1IGNA 2L2OA 5GPCA 4MHGA 2FA5A 1QO0D 2PLYA 4PK4A 5EYRA 5C4JJ 3S2WA 5HODA 2DA7A 4NB5A 3CF5F 4HLYA 5E1XA 3J7ZI 4EV0A 3W6KB 2KZVA 2OQGA 4JX5A 2LP0A 2XAGA 3A0BC 3F9KA 3IHUA 1WKMA 5FD5A 5IYCJ 5H6QA 3KYLA 2EZIA 1T56A 2DPDA 2E2JJ 2R7VA 2WBMA 1BJZA 4HYEA 4BE2A 3HB9A 2DQLA 4CUGA 4AIDA 2CUEA 1TWAJ 2VBWA 1D1CA 1PUFB 1IUFA 2PMZA 2E5NA 2E1OA 3EUHC 2JT1A 4DIQA 2P5LC 3GO5A 4MLOA 5GTIC 3JTHA 1UJ8A 2E36A 1M1EB 3CP2A 2R92J 2ACJA 3HBLA 4I02A 2ELHA 2LD5A 2WY7Q 3H9QA 2LDUA 4IVNA 2IGNA 1APLC 3OYNA 3V4GA 1YIJI 4XL9A 4ZYGA 2BY0A 2Z3YA 1YO5C 1U9NA 1N77A 1F1ZA 3BT9A 1ZG5A 1QZZA 3H5NA 3WU0A 3LSTA 4U0YA 2HDDA 2STWA 3OYBA 1KQ8A 2F5FA 1JKQC 4JX4A 4Y7NJ 2GIZA 3K4BA 5CYVA 4MEXF 2FQ4A 3JREA 3D1NI 5F64A 4E7IA 1UCRA 3PUBA 1ETKA 3L7WA 4LK0F 3KPHA 1W1WE 2ADUA 1AKHA 3ZQLA 2DFHA 5F04A 4LG0A 2EINH 2R5YA 4PJJA 5CLSA 2O5RA 1ZAOA 2A69F 4OWRB 4KIGA 4AIJA 3K1NA 4E7KA 4BL0B 2IAIA 4A12A 3CD6I 1S29A 1BL0A 4RGSA 4MTDA 1SMTA 2YX4A 2LF8A 4XLEA 2NRAC 4ENMA 4AUXA 4O3MA 1Y39A 2P7CB 1LE8B 2CV1A 3FWEA 4RB0A 3O3KA 3OSFA 1H89C 1S7EA 4C3IJ 5B1BH 4IQ4A 4XRSG 2F48A 3S3MA 3CC4I 3BDDA 5DUKA 1LJ9A 1XGSA 1EV7A 3FMSA 2WWYA 1BOBA 1D5VA 3QODA 3J7AY 4Y15A 3PO2J 1LFUP 4IRIA 3KLNA 2F5EA 1VNDA 3I9V2 1FIAA 1BA5A 1W4MA 2FBIA 1V54H 3GTJJ 2ZMEA 2IA1A 2HVSA 3E5XA 1MGTA 1Y1VJ 3LL7A 2O6GE 4UB6C 1D8KA 2E1MB 3S8PA 4IQJA 3GZ6A 1XS9A 5C44J 2COMA 2FXAA 2KJCA 2XGDA 1IV8A 3K1MA 2VPLA 1D0YA 2W84A 5DS9A 4LLGF 3CCQI 2CUJA 2A68F 5JVGF 4L5IA 3KETA 4HNVA 3FXOA 2VJIA 2N8GA 2FU4A 5E17F 1FT9A 2XB5A 1YS7A 1S72I 1T0FA 5BPIA 5LBQA 5DCMB 2DW4A 1P4AA 1Y8RB 3NWSA 3TW6A 1V5EA 4CO8A 1F36A 2L5QA 4EQQA 2CQ7A 2W24A 2DYRH 1HSTA 2VC1A 2FMLA 2OTJI 3VPRA 1N78A 3P9CA 1RZ4A 4NQWA 2NXNB 3MVPA 3T1BA 2HDCA 1TL8A 4XNFA 4KT6A 5M3MJ 4I2OA 2X85A 3LSKA 3CCSI 3BG3A 1HDDC 1VQOI 3JTGA 1R49A 2OV7A 1G6NA 5K7FA 1U78A 4Q4ZF 1EJ9A 4CHUA 1ETWA 1YG2A 4HQMA 4ZDPA 2LR8A 1J59A 1X2NA 5F1JA 1J7KA 1Z91A 3ZMSA 4PJLA 5KAFC 1WGXA 4ZYAA 3JAMZ 3PNVA 4FASD 3I53A 1YX5A 2EQRA 3QPLA 4ZYHA 2IP2A 4XRSA 3JAMK 1MH3A 1B6AA 3C1DA 5J6XA 3OYEA 4AC0A 1U3EM 2X6YA 4QLCU 3GTKJ 1SFXA 1SFUA 2BVMA 1TQPA 5DYMA 2HWVA 5FLVA 1FOYA 4IHYA 2L9NA 3NAUA 4BHPA 3G4SI 5GADJ 2R93J 5JHFA 1BR1A 1GLNA 3ABKH 4A3GJ 3DU5A 2ZXIA 5GP9A 3HSRA 2VN2A 1ZN2A 4EJWA 5M3FJ 4BY7J 1G8XA 2JWTA 3S1RJ 5GPAA 1X4OA 1REPC 2D45A 2VBZA 2DDAA 3GZ5A 3I58A 4D0PA 3BJAA 2Y75A 1P7JA 4I6ZA 1HOMA 3OYLA 5DD8A 2DCEA 3ASOH 1XDUA 3UKGA 4XMYA 2LYCA 2AO9A 3Q5FA 4M3GA 2YU9J 1J5YA 2IEKA 3J80K 2E71A 1IN5A 3R4KA 1SVLA 3J80Z 1LVAA 2BE5F 2FEZA 1FIPA 4ZZDA 3JRGA 2ID3A 3HJEA 3W3CA 3V8KA 1K7AA 4Q47A 2HXOA 3ZQGA 4BDYA 1A5JA 3HG9A 2LTPA 1Z6TA 1TQMA 2HU9A 1GUUA 2JK3A 1OCPA 2VKDA 1WJEA 4E7JA 1F43A 1EF4A 4CCKA 2RAEA 2DOEA 4A3CJ 1YQAA 2XGCA 1W7PB 5IY5H 1Z05A 4MQVA 2DPUA 5JR3A 1F5TA 2CQXA 2QLZA 2CS3A 3P7NA 2Z99A 4II3A 1KQ0A 3GFMA 4PGGA 2EPFA 3FBIB 2IS2A 2DO7A 3ZN0A 5E18F 2WAQA 4L0ZB 1WJAA 4CCOA 1RRJA 4U7DA 4BJTA 3R60A 3BTLA 4I0BA 5DTDA 1X2MA 3JRAA 3AG1H 4BAYA 1LKXA 5LLQA 1TWCJ 4Z2YA 2PFBA 3JRFA 3H3UA 4A93J 1ZKGA 2LF7A 2LSOA 3G1OA 2V6CA 3F8CA 2JSPA 5D5UB 5D4RA 2EFPA 3A03A 3V8LA 2KLOA 1YJWI 2HZDA 2JA2A 2HYJA 4PZJA 2EILH 4NUBA 3I71A 3CUOA 1DUXC 1OR7A 1NHAA 3H9JA 2MSYA 2HPIA 3MZ8A 3MN2A 3H36A 2ECBA 5FKLA 3CLQA 3ASNH 1W0UA 2XAHA 4Z6YA 5BS6A 3OYDA 2XPVA 1VQ6I 2G7UA 3HEFA 3TW7A 3JRDA 3LA2A 4H4KC 2FQ3A 5L3GA 3W2AA 2KP6A 4M9ZA 4BACA 3RKWA 4LG3A 2XF6A 4MFDA 4BBSJ 1OYIA 3OWTA 2V1DA 4IRHA 4EJUA 2Z5UA 3BC8A 4BEHB 4DNCA 2BXYA 1Z7UA 2XSDC 2QSGX 4XLNF 4RAYA 3V7SA 3N05A 4EMSA 2CUZA 1VQ4I 3OIQA 3ISPA 5KVRA 1MMAA 2AQEA 2XPUA 4ZDOA 2ELKA 2NOGA 3ECHA 3H3VK 4BYYA 2HQ5A 4XKVA 1ETOA 3DPTA 3K4MA 4ANJA 3J7YJ 3LMMA 3I55I 2DMQA 4CYCB 2VE8A 1FZPB 4DGWB 2AQFA 3FXRA 4KA4A 3FF5A 1N75A 1H88C 1J75A 2GM4A 2M30A 3DV8A 3CCRI 1TQIA 4OMZA 3TOBA 5LD2C 1XD7A 1IC8A 3CDLA 2QQBA 3I5UA 4A3EJ 3TO7A 2V1UA 1T33A 2PMZN 3FM3A 2OUMA 4I01A 3BLYA 1X19A 3A01B 1ODDA 2I5UA 2DFEA 4IXAA 3IH3A 4HOBA 1MH4A 5HDGA 5KCMA 1Z21A 5D5WB 1G3WA 5GAGJ 3GYHX 1T38A 4AVZA 2KDOA 1A36A 3WGIA 5FKOA 2E60A 2FMYA 4M3BA 3WTYC 2YPRA 2QSHX 4JP0A 3UNGC 3FK6A 1OCZH 2CUFA 3Q9VA 4Y52J 2FX0A 3TO6A 3KX2A 1USSA 1KU9A 1C0WA 2DA6A 1UFMA 3AG2H 2JZYA 3QYFA 1T39A 5K5OA 2BHYA 3LQQA 1ZR4A 4PSWA 1YW7A 2CV0A 3QYBA 4XBFA 2DT5A 2TCTA 2FRHA 3W6VA 1Y0NA 4FETA 2M2EA 3KEYA 3ZQIA 5EZHA 4KMFA 1KONA 1JHHA 2F5DA 1ZGWA 5TJJA 4RS8A 2DFIA 2I8DA 2PJPA 3JRCA 5IYDJ 1ON2A 4RAZA 1X3UA 3I64A 4BGDA 2CJJA 3FXQA 4Y17A 3RTRA 3GFIA 5EG0B 4HPQA 4UVCA 2HQNA 1QHGA 1FPQA 4LOCA 5K5QA 1H9GA 2HKXA 2ISYA 2VIXA 3HRMA 5GTHC 3T0YA 5K7HA 2WAQN 3GVAA 3OV8A 2YSRA 3L2RA 1CF7A 3WTSC 5TISC 2QENA 1XCVA 2TRTA 2YR2A 5J8FA 2VBXA 4IX7A 2NYXA 2I10A 1KU2A 3DTKA 2B0LA 3AAFA 2Y0SN 3RQ4A 2LBFB 2K3PA 2EZKA 1I1GA 1B59A 2IRFG 2LOOA 3GEZA 3CCEI 3GXOA 2O61A 5CPRB 3BTIA 2IS4A 1TBXA 2VC0A 2BY3A 1JGSA 3CO7C 2HTJA 4A3IJ 2NS8A 3I56I 3G71I 4XONA 1H9TA 1FTZA 3DPUA 4MEYF 3S3NA 4XRMA 3E1SA 5L3CA 4PJNA 3MEXA 1Z0XA 4AIKA 5D8KB 2EWNA 3PUFA 2EV6A 5ERIA 2K9MA 1VFCA 3MQ0A 3QOEA 2B9SA 3ULQB 4BXUA 3E6MA 2K4BA 4JOMA 3LSJA 2M34A 2GIVA 4XICA 1E17A 5IT9Z 2XGEA 3F0CA 1WRJA 2WY8Q 4NC8A 4G8XA 4RMNA 3LOCA 4HX8A 4M6VA 2WC2A 1JE8A 3O2PE 2PJRA 3FMQA 2Y30A 3SFIA 3WTVC 3F72A 2CU7A 3M1EA 3GBGA 3SEQA 1WJFA 1YI2I 3ERMA 4A5NA 5A2QZ 3PFYA 2M0MA 3RIRA 3Q0VA 1U6GA 4KFCA 5HVQC 1Y0UA 3MWMA 1VTNC 4BDZA 2RVCA 5FGMA 3E97A 3U1KA 4HNUA 4LGWA 4CCJA 3J7AO 1LUJB 1OR7C 1QVTA 1MBFA 2LC2A 3HHHA 4L9JA 4M71A 3WHCA 1IRGA 4YIIA 1R71A 2OC6A 1O3SA 1G59A 2MABA 2AS5F 2VT2A 1VZ0A 2FJ1A 2F5VA 4LLNA 4DQ2A 3EYIA 1DGRM 1ERDA 1RIOH 1IRXA 2HVQA 1RPWA 2DU9A 3IWZA 4CA0A 4OIOF 2P81A 4XSZF 1YX3A 1FP1D 2GA2A 3SZGA 2MLGA 1PP8F 3AL0C 2Y0MA 2KIMA 1R22A 3SFZA 1S9HA 1K6OA 2K27A 4XN3A 2BW3B 1ZRDA 4I7HA 3TGNA 4AM3A 1OYWA 2RGVA 4D5CA 2EFQA 5EG0A 5GAEJ 2V4JC 1SFOJ 4BXXJ 2W4SA 3BQZA 2QF7A 3HHGA 2X0LA 3KYCB 3BJOA 2R3SA 5CQEA 3LFUA 2IT0A 4FT8A 3LFKA 3EUKL 1S7AA 3F3XA 3NRVA 4DOZA 4BE1A 2KZGA 1TWGJ 2GBYA 1BI2A 3L00A 3VB2A 2PEXA 3R0JA 2V9PA 3G1LA 4HX7A 3M7GA 5LRRA 2QKLB 5CVVA 3P9IA 2WB1N 2GOXB 3LNQA 3HM5A 3HUGA 1STZA 5HLIA 2KIQA 1VQ5I 1U9OA 2Y69H 4C30A 4L5JA 3FZVA 3I4PA 1TT5B 2ZSIB 2XPWA 1Z7LA 2OAZA 4IPAA 4PJMA 1QQIA 4IO9F 3BOQA 2O8KA 5FD6A 4WXCA 4M6YA 5KAIC 1JUPA 2AXTC 3CJTB 4N4NB 4PDKA 3MKLA 4R8HA 2PJRB 2DDBA 3ROUA 3CCLI 1MBGA 2EJRA 4PSXA 1VQNI 1IN8A 2BGCA 1HW2A 1W36D 3K70C 3WTUC 1KYZA 2K9LA 1T8IA 4QPOA 2ECCA 1FBUA 4V19K 1IXSB 3F8NA 3ERED 3S2HJ 2X51A 3OMYA 1MSEC 2WAEA 3FXMA 2GZWA 3I0TA 2Z33A 2F5CA 4FISA 3JRHA 4HX4A 3TBIA 5E3NA 1AHDP 2E2IJ 3HGYA 1NG7A 3WGHA 2JPBA 2O0YA 3F6VA 4RAGA 4MQ9F 2LFBA 4KUMA 3A02A 3K2ZA 5TGTA 2EZHA 2OF7A 4A6DA 2IGOA 4HV6A 4II2A 4B3XA 2PBIA 4GRIA 4GYGA 5ICEA 2KJBA 2ZFWA 3RYRA 4FCYA 3CCYA 2G9WA 4P9UA 3GTPJ 1ONVA 2B63J 3ECOA 5J3LA 4EVIA 4P9FA 4E7HA 4U7BA 1RNLA 5L3BA 5EEGA 1WFXA 1ETQA 5F0CA 3VOEA 3WE2A 1XN7A 2F6CA 1O3RA 1ZG1A 3A01A 2K3FA 1ZGJA 2WA0A 3BR6A 3CMMA 2V7FA 3FXKA 3P9KA 1TC3C 3T8RA 5AIQA 5GAHJ 4V2GA 2JJ7A 3CUQB 5LGUA 2L9SA 3RI4A 5IT9K 3GX4X 2V6EA 1IN6A 3GLXA 2KHMA 3QRFF 5J47A 1XMAA 3Q9SA 3JSOA 4CYCA 1GVJA 3RPUA 1BI3A 3HRUA 3S32A 1IN4A 3OS0A 3ZN1A 4F7ZA 3QU6A 2HGCA 3I59B 4I98B 4UB8C 4ENJA 4EJVA 3S1NJ 1Y6IA 2OZUA 3DPLC 3LSRA 2HI3A 2FE3A 2IXSA 3M8FA 3IKTA 1IJWC 3FBNB 1I6HJ 1SD5A 5M5WJ 5LEJA 4A3BJ 4ZYDA 3C2GA 4O5VA 5J4VA 1XGNA 2DA4A 1MNMC 5FJ8J 1D8JA 2W00A 2D1VA 2ZKZA 4HLXA 3OYKA 1BR4A 1QZEA 2HOSA 1K4SA 3FXJA 4KISA 1E2XA 1FMVA 2DOAA 2NVUB 4ASNA 3IRQA 2DMUA 5FLMJ 2XDVA 4BE0A 2M87A 2MFZA 4LIVA 2UXNA 3E0JB 2MD0A 1D1AA 2RQQA 2E7XA 1E3HA 5DV5A 4B48A 3MAJA 1ZELA 1TT0A 2ELJA 3PSFA 3C18A 3O8HA 4GDFA 4BUPA 5J1RA 2LH9A 1SAXA 4EGYA 5TRDA 2A05A 3A1YA 5DCFA 4Y13A 2MH2A 2L4AA 2ZFUA 3ZQCA 1OKRA 2ID6A 5K1YA 1B9MA 1RUNA 3GZNB 1XGOA 1K78B 4LIUA 2YU3A 1BI0A 1YIOA 3LSGA 2WV0A 3CDIA 4RAFA 2XAFA 1K83J 2ZC2A 1IF1A 4MNUA 3KP4A 3HL2A 3K4LA 1W36C 2BOLA 4M9XA 3GWZA 2JPCA 2CQKA 4AYBN 2ZB9A 2FBKA 3K2AA 3BQYA 1Z9CA 3H3ZA 4BEHA 4MIMA 4F3QA 5C4XJ 2O03A 2BXZA 3FX3A 1S6LA 2CMPA 3LSIA 4N4OB 2CWEA 4YIFA 3I3LA 3CTAA 1I6XA 2IA0A 2KDZA 1FOWA 4W97A 3BTJA 2CSOA 1WZ2A 4XLFA 2VJJA 2XC7A 1OMIA 1K78A 2Q8KA 3AFHA 2P6SA 4RLQA 3M8EA 4O6JA 3CZ6A 2VODA 5C3EJ 1I3QJ 1O7LA 1UHWA 3CJQB 1F9NA 2HDWA 4HDUA 1WI9A 4F52A 2HKOA 2M3AA 2JSCA 2RQPA 4RGXA 1YS6A 5E8IA 2VE9A 3S93A 3H35A 3KEQA 2NVQJ 2H8WA 2VL8A 3AKZA 3CO6C 1CQTA 3K70D 3Q0UA 1VQ8I 4YG2F 2QUFA 4HV5A 2GXBA 1HBXG 1T6SA 5J40A 5M5XJ 2VASA 3SQNA 2RNGA 4G6TB 1KYWA 4UVBA 5K5RA 2R7WA 3FXUA 5D6FA 3BG6A 3G2BA 2DA5A 3WGGA 3DKXA 1W7PA 4Y33A 2VJ4A 3TL4X 2VT3A 3HOSA 2V26A 1VQ7I 4UV8A 1JGGA 1KGSA 2K02A 1V3FA 5EDNA 1UB9A 1DU6A 4FX0A 2E34A 1FWZA 1TW3A 1WQ2A 2YUSA 5DM7F 2LRDA 4B09A 3PSIA 4LLLA 4HZFA 3C2BA 1MBJA 1XPXA 2NOJB 2IGKA 4B1RA 2MYSA 4WF2A 5HOOA 2JUCA 1LEBA 2XV4S 1FYKA 3QPHA 3ZMUA 3ZP5A 2IW5A 1Z67A 4UUVA 1I50J 5KNLA 2H8RA 1R1VA 3DF8A 1BIAA 2PQ8A 4MO7A 1QNTA 2J5PA 3L2QA 3SEZA 4BJ6C 1SANA 2DN0A 2W85A 2EIKH 1LB2A 2L0KA 1GXQA 2XKOA 5CJ9A 2DJIA 3CUQA 3DEEA 3DP7A 1ZH5A 4G7ZF 1LDDA 1IZ1A 2ZO4A 3KZZA 1WJDA 3A0HC 2G0EA 1BR2A 2VJ5A 5ICFA 2ZJ2A 4DBQA 4NC6A 5B66C 2HYFA 3ESWB 1FX7A 3WU1B 2Y9YA 4RGRA 3HYIA 1PDNC 1P4WA 3CMEI 2DQRA 1VQLI 4X6AJ 1FSEA 2KRFA 1BC8C 1X1PA 2FOKA 4OIQF 2CYYA 4HW0A 1XDSA 3VWBA 4YFKF 5ILUA 3VFZA 3RJPA 1ZTRA 2ISZA 3OYJA 3TP0A 3MKWB 4E7LA 4WWCA 1JJ8C 4P55A 2GLOA 2R4GA 2CQNA 1ZHFA 3P5JA 2K7LA 9ANTA 3L09A 2BV6A 2NNNA 4HEA2 1FOXA 4A3LJ 3JW4A 2VKHA 1LE8A 4MTEA 2CFOA 3MZYA 2M7BA 4G6DA 5JVTA 5D4SA 2EH3A 3ZMTA 3COAC 5HNFA 1BN5A 4NHJA 3IWFA 2KMUA 5FKMA 4BQNA 4RB3C 2MG4A 4EJTA 2E19A 2UZKA 3CJRB 4DJAA 2OQRA 5LRSA 3S14J 4ENKA 3GCMA 3LA7A 2M8EA 2Z9OA 4R1HA 2J5OA 3SXYA 1R1TA 3RQIA 3ABLH 4B43A 1IDYA 1O3TA 3WHBA 4A3DJ 4XSXF 2CO5A 4RA2A 1ZREA 4LMYA 3EQLF 4CH7A 1MBHA 2F4OB 4PGHA
chains in the Genus database with same CATH topology
1SFEA 2A6HF 3K0LA 2WTEA 1R23A 1Z1DA 1U5TC 2OBPA 2ETHA 3HTSB 2OA4A 1J2XA 4AWXB 5ICGA 3T5XA 2IPQX 4M6XA 1HKSA 3R61A 3IRRA 1DDNA 1FSHA 5LEKA 1PP7U 1FBQA 2NAZA 1BI1A 1JXSA 2H27A 5DEQA 2F2EA 5L3DA 5ICCA 1B1BA 3SHFA 2H6CA 2Q0OA 5HS9A 3GF2A 3W6JB 2XASA 3IL2A 4GYIA 3TQNA 2RDPA 2L01A 2ZXJA 3GFLA 1RI7A 1YLFA 3H92A 4ON0A 1WWXA 3BJ6A 5AONA 1EH7A 3T8TA 1U5TA 3F6OA 2P5KA 2EA4A 5E1WA 4RGUA 3G3ZA 5FLXZ 4G9YA 1XGMA 3QU3A 3FMRA 2VBYA 4KIBA 4L9TA 5ED4A 2MH9A 2L54A 2CW0F 2PMUA 5DUIA 5HLGA 4U0WA 2FF4A 2FNPA 1SD7A 3KFWX 1FNNA 1HXDA 2DBBA 4LFUA 1IUYA 4AD9A 3RPQA 4KT5C 2D1HA 4AVPA 1QBJA 3HTUA 2XROA 1MD0A 3L2CA 1ZLJA 5E20A 1HKQA 2QYOA 4WK8F 4Q5SF 1FYMA 4G7OF 1J9IA 2M45A 2UXXA 3WTZA 3WTTC 4CDGA 3BP8A 2RKHA 4UNOA 2RN7A 5CVJA 1T2KA 1U8RA 4ESBA 4M74A 1W5SA 4KN7X 2C6YA 2W25A 4LD5A 3MZHA 1FOKA 1CF7B 1AOYA 4P5OA 2BEOA 1JHFA 1FY7A 3MCZA 2DI3A 4HQEA 3CLOA 3IKVA 3RKXA 1U2WA 1ZYRF 5L3FA 2HYGD 3M9AA 1BC7C 4HAMA 2W57A 3ZMZA 1T98A 5A2QK 4ESJA 2H94A 2XIGA 1LEAA 2P5VA 5H20A 4WXHA 2MBFA 3KE2A 1KQ9A 1ZRFA 4FHTA 2E1NA 3BROA 1S8NA 1CGPA 2LKPA 1FYLA 3BZ6A 1KU7A 4G6QA 3LAJA 1BM9A 4XLPF 2HEOA 2QBYA 4A0YA 4GCVA 5IT3A 3WE3A 1DP7P 2HQRA 1FLIA 1HKTA 2L3DA 2XRNA 2IVMA 1Q1HA 4L18B 1ZGAA 1DPUA 1A04A 3ZMDA 1I27A 4GXOA 5BPDA 1XMKA 4KNYA 3WG9A 1MZBA 2Y48A 5DD4A 2E7WA 1B4AA 5F6FA 3TDUC 3E6CC 4KIFA 3QAHA 1BOAA 3DXJF 2DK8A 4E70A 3GUDA 3JSPA 4N9HA 5AIPA 3PQKA 1MDMA 4G7HF 1G3YA 2ZNYA 3HOTA 2D2WA 2V1XA 3TO9A 4L9NA 4HDVA 3K9TA 4HF1A 3RKYA 2P4WA 4CZZA 1O57A 2OZ6A 2UWMA 3F22A 2O8XA 5CVRA 3N4MA 1USTA 5FB2A 1R5HA 4L0YB 5JI6A 1GHCA 2V79A 1LNWA 4IHSA 3E3VA 4EM1A 3BY6A 2EFNA 5D5VB 2TDXA 1MJAA 3G73A 3SZPA 2NS0A 4H0EA 5HLHA 1IAWA 5E1ZB 4EM2A 5L3EA 5FFXA 2AXLA 2G7HA 3HSFA 2V9VA 3QOPA 1I5ZA 1ZG3A 2YX7A 1P2FA 5CVUA 4BHBA 2H6BA 3R6SA 4K2EA 2L02A 2HOEA 2MC3A 4LB5A 2QQ9A 2A07F 1TTYA 2RNJA 4OU0A 2X4HA 2CGPA 1G3SA 4HF0A 3DFGA 4A5MA 5LGNA 2FBHA 4TV7A 3KP3A 2ZCWA 5HDNA 5E8GA 3V7CA 4UHTA 3EETA 3VEPA 4S04A 3F21A 3RYPA 1P92A 4LG0B 3REOA 2XAJA 2A5YB 2M5WA 3GW2A 2H09A 2O3FA 2GA1A 3CUQC 4KDPA 4UVAA 4JQFA 2IJLA 2DAOA 2A3SA 3ZMVA 1ULYA 2PMHA 2QQAA 4IF4A 2KIFA 1SD6A 3WODF 1XSVA 4Q48A 4UV9A 5DCMA 2FSWA 3QP5A 2QVOA 1ON1A 4KYWA 1AWCA 4S05A 3LWFA 4A0ZA 2ZBKA 1D3YA 4N0BA 2RC4A 4YFNF 2CFXA 2IA2A 1WSUA 2ZMEB 1HW1A 3E5UA 3J81Z 2OD5A 1IN7A 3TDZC 1R7JA 1KA8A 1TNTA 3I54A 3V8JA 6PAXA 2KKOA 2R7DA 2BYVE 3NEUA 3LAPA 1TNSA 3KZYA 1HSJA 3F23A 3DKWA 4BHCA 2CG4A 5BQTA 3HSEA 1IW7F 4PGHA 4MGRA 2NNYA 1L0OC 2EA2A 4OOIA 3BPXA 3QP6A 3WTWC 3L9FA 1J0RA 4EJOA 4LB6B 1I1SA 3TKYA 2XUBA 3ZQ7A 5KK1A 3WTXC 4WXDA 3KP7A 2STTA 2MLKA 4UXNA 4BH9A 3KCCA 2ESHA 4HBLA 3V7RA 5H6RA 2EV0A 4BNCA 2P7VB 4OIPF 1KU3A 4RB2C 5FO5A 5J8CA 5ILVA 3BPVA 1ZRCA 1YTYA 1FP2A 4WX9A 3ML6A 1HW5A 2A61A 4M72A 5LHHA 5HDKA 2MA3A 4B8XA 4A6EA 1W7PD 3TOAA 5LHGA 5EEHA 3NQOA 4KN4X 2A6EF 4EM0B 1XCBA 4GO1A 1F4KA 4CYDA 2QZ8A 2EK5A 3F8BA 3FM5A 3PFIA 1BJAA 2GXGA 2Q2EA 3PQJA 3MFKA 3RDIA 2GAUA 2RV8A 3IC7A 5FLXK 5JFRA 2XHKA 4ETSA 3HRSA 2DLLA 1RUOA 3B02A 3DQVC 3U9GA 1O3QA 2XGXA 2HS5A 3ELKA 4M73A 3O6BB 4A0XA 5LGTA 5ILSA 3FHZA 3E5QA 1GXPA 1EH6A 2OU2A 1ZARA 4EGZA 4JBAA 1K79A 2K86A 1SMYF 3J81K 3N97A 3B73A 3U1DA 2PI0A 3GFJA 3KP2A 3KEOA 1YW8A 2P8TA 1L3LA 3ZPLA 2QM3A 3KP5A 1PUEE 3EDPA 2EB7A 1LQ1A 4I0AA 2MD5A 2M1BA 4HF2A 1TW2A 2E1CA 1S3JA 1MJBA 4U0VA 2P6TA 3QPTA 1SD4A 4CXFA 4RB1A 4ZYEA 4N9IA 3LA3A 4PCQA 2KIUA 4LJZF 5HS8A 2QBYB 1FBSA 2VXZA 1MDMB 3E6BA 2XVCA 4HA8A 2LNBA 2PN6A 1ZLKA 2DTRA 4G94A 4R79A 1BBYA 3VODA 1BIBA 3KP6A 2HFHA 1YYVA 2HZTA 3F8FA 2ZNZA 1FC3A 3ABTA 2VOOA 1Z6RA 4U88A 1R1UA 1MJ9A 4AIHA 2R7FA 5FFZA 4L9VA 5BMZA 1B9NA 5LHIA 3C7JA 4WCGA 1IRFA 4I09A 1P6RA 3HRTA 2GWRA 1G4DA 3EUHA 1R00A 1XSXA 4M9SA 4IRGA 5JHUA 3SZTA 4ENNA 1R36A 4OIRF 5DDGA 3C3WA 1MKMA 4ESFA 5F1RA 3K69A 1UHMA 3D5LA 1OYYA 3I59A 4BQAA 2L4MA 4FX4A 5BOXA 1LDJA 3OOPA 4OINF 3LQRA 4OMYA 1O7FA 1IXRC 1S7OA 1QPMA 1EH8A 3HIFA 2XAQA 1R5GA 2DK5A 3BWGA 1H0MA 1HQCA 1XSDA 1OPCA 3ABUA 3DEUA 3D0SA 3R0AA 3KLOA 2K4JA 4JK1X 1W5TA 1LDKB 4YFXF 4ZZLA 5HS7A 2FNAA 4KMUX 1V4RA 1P4XA 3F8MA 4A2UA 3K1PA 1QGPA 3CJNA 4QWQA 2QWWA 2EFOA 1TLHB 3CDHA 4IJAA 2GQQA 4CICA 5CVIA 4P96A 2EV5A 4ZH4F 1QZYA 3EYYA 2JTVA 2BBYA 4GGGA 2VOPA 1YW9A 4KICA 1XB4A 5D6EA 2ESNA 2JRTA 3U2RA 2HR3A 2HTSA 2EFWA 4LK1F 1R58A 1DPRA 5D8LB 1U5TB 1YFHA 5D5XB 4XRFA 4IHTA 4CGZA 2VONA 3E6DA 2XKPA 1IXCA 1G3TA 2PG4A 4MHGA 2FA5A 2PLYA 1QO0D 3S2WA 4NB5A 4HLYA 5E1XA 4EV0A 3W6KB 2OQGA 2XAGA 3IHUA 1WKMA 5FD5A 5H6QA 2DPDA 4HYEA 2DQLA 2VBWA 2JT1A 2P5LC 3GO5A 3JTHA 2ACJA 4I02A 2ELHA 2LDUA 4IVNA 3V4GA 4ZYGA 2Z3YA 1YO5C 1F1ZA 1ZG5A 1QZZA 3WU0A 3LSTA 4U0YA 2STWA 1KQ8A 2F5FA 4MEXF 5CYVA 5F64A 1UCRA 4LK0F 3L7WA 2ADUA 4LG0A 5CLSA 1ZAOA 2A69F 4KIGA 4AIJA 3K1NA 4A12A 1S29A 4RGSA 4MTDA 1SMTA 2YX4A 2LF8A 2NRAC 4ENMA 4O3MA 2P7CB 3FWEA 4RB0A 3O3KA 3BDDA 5DUKA 1LJ9A 1XGSA 1EV7A 3FMSA 2WWYA 1D5VA 4Y15A 4IRIA 3KLNA 2F5EA 1W4MA 2FBIA 2ZMEA 2IA1A 3E5XA 1MGTA 2O6GE 1D8KA 3GZ6A 2COMA 2FXAA 2KJCA 3K1MA 2W84A 4LLGF 2A68F 4L5IA 3KETA 5E17F 2FU4A 1FT9A 1YS7A 1T0FA 5BPIA 5LBQA 5DCMB 2DW4A 1P4AA 4CO8A 4EQQA 2W24A 2VC1A 1HSTA 2FMLA 3P9CA 1RZ4A 4NQWA 3T1BA 2HDCA 4I2OA 3JTGA 1G6NA 1U78A 4Q4ZF 4CHUA 1YG2A 4HQMA 1J59A 1J7KA 1Z91A 3ZMSA 3JAMZ 3I53A 4ZYHA 2IP2A 3JAMK 1B6AA 3C1DA 5J6XA 1U3EM 4QLCU 1SFXA 1SFUA 1TQPA 5DYMA 2HWVA 4BHPA 3HSRA 2VN2A 1ZN2A 4EJWA 1REPC 2D45A 2VBZA 3GZ5A 3I58A 4D0PA 3BJAA 2Y75A 5DD8A 1XDUA 3Q5FA 1J5YA 3J80K 1IN5A 3R4KA 3J80Z 1LVAA 2BE5F 2FEZA 4ZZDA 3V8KA 1K7AA 4Q47A 1Z6TA 1TQMA 1YQAA 1W7PB 1Z05A 4MQVA 2DPUA 5JR3A 1F5TA 2QLZA 3P7NA 2Z99A 1KQ0A 3GFMA 4PGGA 2DO7A 3ZN0A 5E18F 4L0ZB 4U7DA 3R60A 4I0BA 4BAYA 5LLQA 4Z2YA 2PFBA 3H3UA 2LF7A 2LSOA 2V6CA 3F8CA 5D5UB 5D4RA 2EFPA 3V8LA 4PZJA 3I71A 3CUOA 1DUXC 1OR7A 1NHAA 2XAHA 5BS6A 2G7UA 3LA2A 2FQ3A 5L3GA 4M9ZA 3RKWA 1OYIA 2V1DA 4IRHA 4EJUA 2Z5UA 4DNCA 1Z7UA 4XLNF 4RAYA 3V7SA 4EMSA 3ISPA 5KVRA 3ECHA 4BYYA 3DPTA 2VE8A 1FZPB 3FXRA 4KA4A 3FF5A 1J75A 2M30A 3DV8A 1TQIA 4OMZA 3TOBA 1XD7A 2QQBA 3I5UA 2V1UA 3TO7A 3FM3A 4I01A 1ODDA 4IXAA 5HDGA 5D5WB 4HOBA 1G3WA 3GYHX 1T38A 3WGIA 2FMYA 3WTYC 2YPRA 3Q9VA 3TO6A 1C0WA 1USSA 1KU9A 1UFMA 2JZYA 1T39A 5K5OA 3LQQA 1YW7A 4XBFA 2DT5A 2FRHA 4KMFA 1JHHA 2F5DA 5TJJA 4RS8A 2DFIA 2PJPA 1ON2A 3GFIA 1X3UA 3I64A 4RAZA 3FXQA 4Y17A 3RTRA 4UVCA 2HQNA 1FPQA 5K5QA 1H9GA 2HKXA 2ISYA 3HRMA 3T0YA 3GVAA 3OV8A 2YSRA 1CF7A 3WTSC 2QENA 1XCVA 2YR2A 5J8FA 2VBXA 2NYXA 1KU2A 2B0LA 3AAFA 1I1GA 1B59A 2IRFG 3GEZA 3GXOA 2O61A 1TBXA 2VC0A 3CO7C 1JGSA 2HTJA 1H9TA 4MEYF 5L3CA 3MEXA 4AIKA 5D8KB 2EWNA 5ERIA 2EV6A 3MQ0A 3ULQB 4BXUA 3E6MA 2K4BA 2GIVA 1E17A 5IT9Z 1WRJA 4G8XA 4HX8A 2WC2A 1JE8A 3O2PE 3FMQA 3WTVC 3F72A 3M1EA 4A5NA 5A2QZ 3RIRA 1U6GA 4KFCA 5HVQC 1Y0UA 3MWMA 1VTNC 2RVCA 5FGMA 3E97A 4LGWA 3J7AO 3HHHA 4L9JA 4M71A 1IRGA 4YIIA 1O3SA 2AS5F 2VT2A 4LLNA 4DQ2A 3EYIA 1RIOH 2DU9A 3IWZA 4OIOF 4XSZF 1FP1D 2GA2A 2MLGA 1PP8F 2Y0MA 2KIMA 1R22A 3SFZA 1K6OA 2K27A 1ZRDA 4I7HA 3TGNA 1OYWA 2RGVA 2EFQA 3HHGA 2X0LA 3BJOA 2R3SA 2IT0A 4FT8A 3LFKA 1S7AA 3F3XA 3NRVA 3VB2A 1BI2A 3L00A 2PEXA 3R0JA 4HX7A 3M7GA 5LRRA 5CVVA 3P9IA 3HUGA 1STZA 5HLIA 4L5JA 3FZVA 3I4PA 2OAZA 4IPAA 1QQIA 3BOQA 5FD6A 4WXCA 4M6YA 4PDKA 4R8HA 3ROUA 2EJRA 1IN8A 2BGCA 1HW2A 3WTUC 1KYZA 1FBUA 1IXSB 3F8NA 3ERED 2GZWA 3I0TA 2Z33A 2F5CA 4HX4A 3WGHA 2JPBA 2O0YA 3F6VA 4MQ9F 4KUMA 3K2ZA 4A6DA 4HV6A 2PBIA 4GYGA 5ICEA 2KJBA 2ZFWA 3RYRA 2G9WA 4P9UA 1ONVA 3ECOA 4EVIA 4P9FA 4U7BA 1RNLA 5L3BA 5EEGA 3VOEA 3WE2A 1XN7A 1O3RA 1ZG1A 1ZGJA 3P9KA 5AIQA 3CUQB 5LGUA 3RI4A 5IT9K 3GX4X 1IN6A 3GLXA 3QRFF 1XMAA 3Q9SA 3JSOA 1GVJA 3RPUA 1BI3A 3HRUA 1IN4A 3ZN1A 4F7ZA 3QU6A 2HGCA 3I59B 4I98B 4ENJA 4EJVA 2OZUA 3DPLC 2FE3A 3M8FA 3IKTA 1SD5A 5LEJA 4ZYDA 4O5VA 1XGNA 1D8JA 2D1VA 2ZKZA 4HLXA 1E2XA 4ASNA 3IRQA 2M87A 2UXNA 2E7XA 5DV5A 3MAJA 3C18A 1SAXA 4EGYA 5TRDA 5DCFA 4Y13A 2MH2A 2L4AA 1OKRA 5K1YA 1B9MA 1RUNA 1XGOA 1K78B 2YU3A 1BI0A 1YIOA 2WV0A 2XAFA 1IF1A 4MNUA 3KP4A 4M9XA 3GWZA 2JPCA 2CQKA 2FBKA 1Z9CA 3H3ZA 2O03A 3FX3A 1S6LA 2CWEA 4YIFA 3CTAA 1I6XA 2IA0A 2CSOA 1OMIA 1K78A 2Q8KA 2P6SA 3M8EA 4O6JA 2VODA 1O7LA 1UHWA 1F9NA 4HDUA 1WI9A 2HKOA 2JSCA 2RQPA 4RGXA 1YS6A 5E8IA 2VE9A 3KEQA 3CO6C 4YG2F 2QUFA 4HV5A 2GXBA 1HBXG 1T6SA 3SQNA 1KYWA 4UVBA 5K5RA 3FXUA 5D6FA 3WGGA 1W7PA 2VT3A 3HOSA 4UV8A 1KGSA 2K02A 1V3FA 1UB9A 4FX0A 1FWZA 1TW3A 1WQ2A 4B09A 4LLLA 4HZFA 4WF2A 5HOOA 1LEBA 2XV4S 1FYKA 3QPHA 3ZMUA 3ZP5A 2IW5A 4UUVA 1R1VA 1BIAA 3DF8A 2PQ8A 1QNTA 2J5PA 2W85A 1LB2A 1GXQA 2XKOA 5CJ9A 3CUQA 3DP7A 1ZH5A 4G7ZF 1LDDA 1IZ1A 2ZO4A 3KZZA 5ICFA 2ZJ2A 2HYFA 1FX7A 3WU1B 4RGRA 3HYIA 1PDNC 1P4WA 2DQRA 1FSEA 2KRFA 1BC8C 2FOKA 4OIQF 2CYYA 4HW0A 1XDSA 4YFKF 5ILUA 3VFZA 3RJPA 2ISZA 4WWCA 4P55A 1ZHFA 2K7LA 3L09A 2BV6A 2NNNA 3JW4A 4MTEA 3MZYA 4G6DA 5JVTA 5D4SA 3COAC 3ZMTA 1BN5A 4NHJA 3IWFA 4RB3C 4EJTA 2UZKA 2OQRA 5LRSA 4ENKA 3LA7A 2M8EA 2Z9OA 4R1HA 2J5OA 3SXYA 1R1TA 1O3TA 4XSXF 2CO5A 1ZREA 4LMYA 3EQLF 3T8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFE A;  2A6H F;  3K0L A;  2WTE A;  1R23 A;  1Z1D A;  1U5T C;  2OBP A;  2ETH A;  3HTS B;  2OA4 A;  1J2X A;  4AWX B;  5ICG A;  3T5X A;  2IPQ X;  4M6X A;  1HKS A;  3R61 A;  3IRR A;  1DDN A;  1FSH A;  5LEK A;  1PP7 U;  1FBQ A;  2NAZ A;  1BI1 A;  1JXS A;  2H27 A;  5DEQ A;  2F2E A;  5L3D A;  5ICC A;  1B1B A;  3SHF A;  2H6C A;  2Q0O A;  5HS9 A;  3GF2 A;  3W6J B;  2XAS A;  3IL2 A;  4GYI A;  3TQN A;  2RDP A;  2L01 A;  2ZXJ A;  3GFL A;  1RI7 A;  1YLF A;  3H92 A;  4ON0 A;  1WWX A;  3BJ6 A;  5AON A;  1EH7 A;  3T8T A;  1U5T A;  3F6O A;  2P5K A;  2EA4 A;  5E1W A;  4RGU A;  3G3Z A;  5FLX Z;  4G9Y A;  1XGM A;  3QU3 A;  3FMR A;  2VBY A;  4KIB A;  4L9T A;  5ED4 A;  2MH9 A;  2L54 A;  2CW0 F;  2PMU A;  5DUI A;  5HLG A;  4U0W A;  2FF4 A;  2FNP A;  1SD7 A;  3KFW X;  1FNN A;  1HXD A;  2DBB A;  4LFU A;  1IUY A;  4AD9 A;  3RPQ A;  4KT5 C;  2D1H A;  4AVP A;  1QBJ A;  3HTU A;  2XRO A;  1MD0 A;  3L2C A;  1ZLJ A;  5E20 A;  1HKQ A;  2QYO A;  4WK8 F;  4Q5S F;  1FYM A;  4G7O F;  1J9I A;  2M45 A;  2UXX A;  3WTZ A;  3WTT C;  4CDG A;  3BP8 A;  2RKH A;  4UNO A;  2RN7 A;  5CVJ A;  1T2K A;  1U8R A;  4ESB A;  4M74 A;  1W5S A;  4KN7 X;  2C6Y A;  2W25 A;  4LD5 A;  3MZH A;  1FOK A;  1CF7 B;  1AOY A;  4P5O A;  2BEO A;  1JHF A;  1FY7 A;  3MCZ A;  2DI3 A;  4HQE A;  3CLO A;  3IKV A;  3RKX A;  1U2W A;  1ZYR F;  5L3F A;  2HYG D;  3M9A A;  1BC7 C;  4HAM A;  2W57 A;  3ZMZ A;  1T98 A;  5A2Q K;  4ESJ A;  2H94 A;  2XIG A;  1LEA A;  2P5V A;  5H20 A;  4WXH A;  2MBF A;  3KE2 A;  1KQ9 A;  1ZRF A;  4FHT A;  2E1N A;  3BRO A;  1S8N A;  1CGP A;  2LKP A;  1FYL A;  3BZ6 A;  1KU7 A;  4G6Q A;  3LAJ A;  1BM9 A;  4XLP F;  2HEO A;  2QBY A;  4A0Y A;  4GCV A;  5IT3 A;  3WE3 A;  1DP7 P;  2HQR A;  1FLI A;  1HKT A;  2L3D A;  2XRN A;  2IVM A;  1Q1H A;  4L18 B;  1ZGA A;  1DPU A;  1A04 A;  3ZMD A;  1I27 A;  4GXO A;  5BPD A;  1XMK A;  4KNY A;  3WG9 A;  1MZB A;  2Y48 A;  5DD4 A;  2E7W A;  1B4A A;  5F6F A;  3TDU C;  3E6C C;  4KIF A;  3QAH A;  1BOA A;  3DXJ F;  2DK8 A;  4E70 A;  3GUD A;  3JSP A;  4N9H A;  5AIP A;  3PQK A;  1MDM A;  4G7H F;  1G3Y A;  2ZNY A;  3HOT A;  2D2W A;  2V1X A;  3TO9 A;  4L9N A;  4HDV A;  3K9T A;  4HF1 A;  3RKY A;  2P4W A;  4CZZ A;  1O57 A;  2OZ6 A;  2UWM A;  3F22 A;  2O8X A;  5CVR A;  3N4M A;  1UST A;  5FB2 A;  1R5H A;  4L0Y B;  5JI6 A;  1GHC A;  2V79 A;  1LNW A;  4IHS A;  3E3V A;  4EM1 A;  3BY6 A;  2EFN A;  5D5V B;  2TDX A;  1MJA A;  3G73 A;  3SZP A;  2NS0 A;  4H0E A;  5HLH A;  1IAW A;  5E1Z B;  4EM2 A;  5L3E A;  5FFX A;  2AXL A;  2G7H A;  3HSF A;  2V9V A;  3QOP A;  1I5Z A;  1ZG3 A;  2YX7 A;  1P2F A;  5CVU A;  4BHB A;  2H6B A;  3R6S A;  4K2E A;  2L02 A;  2HOE A;  2MC3 A;  4LB5 A;  2QQ9 A;  2A07 F;  1TTY A;  2RNJ A;  4OU0 A;  2X4H A;  2CGP A;  1G3S A;  4HF0 A;  3DFG A;  4A5M A;  5LGN A;  2FBH A;  4TV7 A;  3KP3 A;  2ZCW A;  5HDN A;  5E8G A;  3V7C A;  4UHT A;  3EET A;  3VEP A;  4S04 A;  3F21 A;  3RYP A;  1P92 A;  4LG0 B;  3REO A;  2XAJ A;  2A5Y B;  2M5W A;  3GW2 A;  2H09 A;  2O3F A;  2GA1 A;  3CUQ C;  4KDP A;  4UVA A;  4JQF A;  2IJL A;  2DAO A;  2A3S A;  3ZMV A;  1ULY A;  2PMH A;  2QQA A;  4IF4 A;  2KIF A;  1SD6 A;  3WOD F;  1XSV A;  4Q48 A;  4UV9 A;  5DCM A;  2FSW A;  3QP5 A;  2QVO A;  1ON1 A;  4KYW A;  1AWC A;  4S05 A;  3LWF A;  4A0Z A;  2ZBK A;  1D3Y A;  4N0B A;  2RC4 A;  4YFN F;  2CFX A;  2IA2 A;  1WSU A;  2ZME B;  1HW1 A;  3E5U A;  3J81 Z;  2OD5 A;  1IN7 A;  3TDZ C;  1R7J A;  1KA8 A;  1TNT A;  3I54 A;  3V8J A;  6PAX A;  2KKO A;  2R7D A;  2BYV E;  3NEU A;  3LAP A;  1TNS A;  3KZY A;  1HSJ A;  3F23 A;  3DKW A;  4BHC A;  2CG4 A;  5BQT A;  3HSE A;  1IW7 F;  4PGH A;  4MGR A;  2NNY A;  1L0O C;  2EA2 A;  4OOI A;  3BPX A;  3QP6 A;  3WTW C;  3L9F A;  1J0R A;  4EJO A;  4LB6 B;  1I1S A;  3TKY A;  2XUB A;  3ZQ7 A;  5KK1 A;  3WTX C;  4WXD A;  3KP7 A;  2STT A;  2MLK A;  4UXN A;  4BH9 A;  3KCC A;  2ESH A;  4HBL A;  3V7R A;  5H6R A;  2EV0 A;  4BNC A;  2P7V B;  4OIP F;  1KU3 A;  4RB2 C;  5FO5 A;  5J8C A;  5ILV A;  3BPV A;  1ZRC A;  1YTY A;  1FP2 A;  4WX9 A;  3ML6 A;  1HW5 A;  2A61 A;  4M72 A;  5LHH A;  5HDK A;  2MA3 A;  4B8X A;  4A6E A;  1W7P D;  3TOA A;  5LHG A;  5EEH A;  3NQO A;  4KN4 X;  2A6E F;  4EM0 B;  1XCB A;  4GO1 A;  1F4K A;  4CYD A;  2QZ8 A;  2EK5 A;  3F8B A;  3FM5 A;  3PFI A;  1BJA A;  2GXG A;  2Q2E A;  3PQJ A;  3MFK A;  3RDI A;  2GAU A;  2RV8 A;  3IC7 A;  5FLX K;  5JFR A;  2XHK A;  4ETS A;  3HRS A;  2DLL A;  1RUO A;  3B02 A;  3DQV C;  3U9G A;  1O3Q A;  2XGX A;  2HS5 A;  3ELK A;  4M73 A;  3O6B B;  4A0X A;  5LGT A;  5ILS A;  3FHZ A;  3E5Q A;  1GXP A;  1EH6 A;  2OU2 A;  1ZAR A;  4EGZ A;  4JBA A;  1K79 A;  2K86 A;  1SMY F;  3J81 K;  3N97 A;  3B73 A;  3U1D A;  2PI0 A;  3GFJ A;  3KP2 A;  3KEO A;  1YW8 A;  2P8T A;  1L3L A;  3ZPL A;  2QM3 A;  3KP5 A;  1PUE E;  3EDP A;  2EB7 A;  1LQ1 A;  4I0A A;  2MD5 A;  2M1B A;  4HF2 A;  1TW2 A;  2E1C A;  1S3J A;  1MJB A;  4U0V A;  2P6T A;  3QPT A;  1SD4 A;  4CXF A;  4RB1 A;  4ZYE A;  4N9I A;  3LA3 A;  4PCQ A;  2KIU A;  4LJZ F;  5HS8 A;  2QBY B;  1FBS A;  2VXZ A;  1MDM B;  3E6B A;  2XVC A;  4HA8 A;  2LNB A;  2PN6 A;  1ZLK A;  2DTR A;  4G94 A;  4R79 A;  1BBY A;  3VOD A;  1BIB A;  3KP6 A;  2HFH A;  1YYV A;  2HZT A;  3F8F A;  2ZNZ A;  1FC3 A;  3ABT A;  2VOO A;  1Z6R A;  4U88 A;  1R1U A;  1MJ9 A;  4AIH A;  2R7F A;  5FFZ A;  4L9V A;  5BMZ A;  1B9N A;  5LHI A;  3C7J A;  4WCG A;  1IRF A;  4I09 A;  1P6R A;  3HRT A;  2GWR A;  1G4D A;  3EUH A;  1R00 A;  1XSX A;  4M9S A;  4IRG A;  5JHU A;  3SZT A;  4ENN A;  1R36 A;  4OIR F;  5DDG A;  3C3W A;  1MKM A;  4ESF A;  5F1R A;  3K69 A;  1UHM A;  3D5L A;  1OYY A;  3I59 A;  4BQA A;  2L4M A;  4FX4 A;  5BOX A;  1LDJ A;  3OOP A;  4OIN F;  3LQR A;  4OMY A;  1O7F A;  1IXR C;  1S7O A;  1QPM A;  1EH8 A;  3HIF A;  2XAQ A;  1R5G A;  2DK5 A;  3BWG A;  1H0M A;  1HQC A;  1XSD A;  1OPC A;  3ABU A;  3DEU A;  3D0S A;  3R0A A;  3KLO A;  2K4J A;  4JK1 X;  1W5T A;  1LDK B;  4YFX F;  4ZZL A;  5HS7 A;  2FNA A;  4KMU X;  1V4R A;  1P4X A;  3F8M A;  4A2U A;  3K1P A;  1QGP A;  3CJN A;  4QWQ A;  2QWW A;  2EFO A;  1TLH B;  3CDH A;  4IJA A;  2GQQ A;  4CIC A;  5CVI A;  4P96 A;  2EV5 A;  4ZH4 F;  1QZY A;  3EYY A;  2JTV A;  2BBY A;  4GGG A;  2VOP A;  1YW9 A;  4KIC A;  1XB4 A;  5D6E A;  2ESN A;  2JRT A;  3U2R A;  2HR3 A;  2HTS A;  2EFW A;  4LK1 F;  1R58 A;  1DPR A;  5D8L B;  1U5T B;  1YFH A;  5D5X B;  4XRF A;  4IHT A;  4CGZ A;  2VON A;  3E6D A;  2XKP A;  1IXC A;  1G3T A;  2PG4 A;  4MHG A;  2FA5 A;  2PLY A;  1QO0 D;  3S2W A;  4NB5 A;  4HLY A;  5E1X A;  4EV0 A;  3W6K B;  2OQG A;  2XAG A;  3IHU A;  1WKM A;  5FD5 A;  5H6Q A;  2DPD A;  4HYE A;  2DQL A;  2VBW A;  2JT1 A;  2P5L C;  3GO5 A;  3JTH A;  2ACJ A;  4I02 A;  2ELH A;  2LDU A;  4IVN A;  3V4G A;  4ZYG A;  2Z3Y A;  1YO5 C;  1F1Z A;  1ZG5 A;  1QZZ A;  3WU0 A;  3LST A;  4U0Y A;  2STW A;  1KQ8 A;  2F5F A;  4MEX F;  5CYV A;  5F64 A;  1UCR A;  4LK0 F;  3L7W A;  2ADU A;  4LG0 A;  5CLS A;  1ZAO A;  2A69 F;  4KIG A;  4AIJ A;  3K1N A;  4A12 A;  1S29 A;  4RGS A;  4MTD A;  1SMT A;  2YX4 A;  2LF8 A;  2NRA C;  4ENM A;  4O3M A;  2P7C B;  3FWE A;  4RB0 A;  3O3K A;  3BDD A;  5DUK A;  1LJ9 A;  1XGS A;  1EV7 A;  3FMS A;  2WWY A;  1D5V A;  4Y15 A;  4IRI A;  3KLN A;  2F5E A;  1W4M A;  2FBI A;  2ZME A;  2IA1 A;  3E5X A;  1MGT A;  2O6G E;  1D8K A;  3GZ6 A;  2COM A;  2FXA A;  2KJC A;  3K1M A;  2W84 A;  4LLG F;  2A68 F;  4L5I A;  3KET A;  5E17 F;  2FU4 A;  1FT9 A;  1YS7 A;  1T0F A;  5BPI A;  5LBQ A;  5DCM B;  2DW4 A;  1P4A A;  4CO8 A;  4EQQ A;  2W24 A;  2VC1 A;  1HST A;  2FML A;  3P9C A;  1RZ4 A;  4NQW A;  3T1B A;  2HDC A;  4I2O A;  3JTG A;  1G6N A;  1U78 A;  4Q4Z F;  4CHU A;  1YG2 A;  4HQM A;  1J59 A;  1J7K A;  1Z91 A;  3ZMS A;  3JAM Z;  3I53 A;  4ZYH A;  2IP2 A;  3JAM K;  1B6A A;  3C1D A;  5J6X A;  1U3E M;  4QLC U;  1SFX A;  1SFU A;  1TQP A;  5DYM A;  2HWV A;  4BHP A;  3HSR A;  2VN2 A;  1ZN2 A;  4EJW A;  1REP C;  2D45 A;  2VBZ A;  3GZ5 A;  3I58 A;  4D0P A;  3BJA A;  2Y75 A;  5DD8 A;  1XDU A;  3Q5F A;  1J5Y A;  3J80 K;  1IN5 A;  3R4K A;  3J80 Z;  1LVA A;  2BE5 F;  2FEZ A;  4ZZD A;  3V8K A;  1K7A A;  4Q47 A;  1Z6T A;  1TQM A;  1YQA A;  1W7P B;  1Z05 A;  4MQV A;  2DPU A;  5JR3 A;  1F5T A;  2QLZ A;  3P7N A;  2Z99 A;  1KQ0 A;  3GFM A;  4PGG A;  2DO7 A;  3ZN0 A;  5E18 F;  4L0Z B;  4U7D A;  3R60 A;  4I0B A;  4BAY A;  5LLQ A;  4Z2Y A;  2PFB A;  3H3U A;  2LF7 A;  2LSO A;  2V6C A;  3F8C A;  5D5U B;  5D4R A;  2EFP A;  3V8L A;  4PZJ A;  3I71 A;  3CUO A;  1DUX C;  1OR7 A;  1NHA A;  2XAH A;  5BS6 A;  2G7U A;  3LA2 A;  2FQ3 A;  5L3G A;  4M9Z A;  3RKW A;  1OYI A;  2V1D A;  4IRH A;  4EJU A;  2Z5U A;  4DNC A;  1Z7U A;  4XLN F;  4RAY A;  3V7S A;  4EMS A;  3ISP A;  5KVR A;  3ECH A;  4BYY A;  3DPT A;  2VE8 A;  1FZP B;  3FXR A;  4KA4 A;  3FF5 A;  1J75 A;  2M30 A;  3DV8 A;  1TQI A;  4OMZ A;  3TOB A;  1XD7 A;  2QQB A;  3I5U A;  2V1U A;  3TO7 A;  3FM3 A;  4I01 A;  1ODD A;  4IXA A;  5HDG A;  5D5W B;  4HOB A;  1G3W A;  3GYH X;  1T38 A;  3WGI A;  2FMY A;  3WTY C;  2YPR A;  3Q9V A;  3TO6 A;  1C0W A;  1USS A;  1KU9 A;  1UFM A;  2JZY A;  1T39 A;  5K5O A;  3LQQ A;  1YW7 A;  4XBF A;  2DT5 A;  2FRH A;  4KMF A;  1JHH A;  2F5D A;  5TJJ A;  4RS8 A;  2DFI A;  2PJP A;  1ON2 A;  3GFI A;  1X3U A;  3I64 A;  4RAZ A;  3FXQ A;  4Y17 A;  3RTR A;  4UVC A;  2HQN A;  1FPQ A;  5K5Q A;  1H9G A;  2HKX A;  2ISY A;  3HRM A;  3T0Y A;  3GVA A;  3OV8 A;  2YSR A;  1CF7 A;  3WTS C;  2QEN A;  1XCV A;  2YR2 A;  5J8F A;  2VBX A;  2NYX A;  1KU2 A;  2B0L A;  3AAF A;  1I1G A;  1B59 A;  2IRF G;  3GEZ A;  3GXO A;  2O61 A;  1TBX A;  2VC0 A;  3CO7 C;  1JGS A;  2HTJ A;  1H9T A;  4MEY F;  5L3C A;  3MEX A;  4AIK A;  5D8K B;  2EWN A;  5ERI A;  2EV6 A;  3MQ0 A;  3ULQ B;  4BXU A;  3E6M A;  2K4B A;  2GIV A;  1E17 A;  5IT9 Z;  1WRJ A;  4G8X A;  4HX8 A;  2WC2 A;  1JE8 A;  3O2P E;  3FMQ A;  3WTV C;  3F72 A;  3M1E A;  4A5N A;  5A2Q Z;  3RIR A;  1U6G A;  4KFC A;  5HVQ C;  1Y0U A;  3MWM A;  1VTN C;  2RVC A;  5FGM A;  3E97 A;  4LGW A;  3J7A O;  3HHH A;  4L9J A;  4M71 A;  1IRG A;  4YII A;  1O3S A;  2AS5 F;  2VT2 A;  4LLN A;  4DQ2 A;  3EYI A;  1RIO H;  2DU9 A;  3IWZ A;  4OIO F;  4XSZ F;  1FP1 D;  2GA2 A;  2MLG A;  1PP8 F;  2Y0M A;  2KIM A;  1R22 A;  3SFZ A;  1K6O A;  2K27 A;  1ZRD A;  4I7H A;  3TGN A;  1OYW A;  2RGV A;  2EFQ A;  3HHG A;  2X0L A;  3BJO A;  2R3S A;  2IT0 A;  4FT8 A;  3LFK A;  1S7A A;  3F3X A;  3NRV A;  3VB2 A;  1BI2 A;  3L00 A;  2PEX A;  3R0J A;  4HX7 A;  3M7G A;  5LRR A;  5CVV A;  3P9I A;  3HUG A;  1STZ A;  5HLI A;  4L5J A;  3FZV A;  3I4P A;  2OAZ A;  4IPA A;  1QQI A;  3BOQ A;  5FD6 A;  4WXC A;  4M6Y A;  4PDK A;  4R8H A;  3ROU A;  2EJR A;  1IN8 A;  2BGC A;  1HW2 A;  3WTU C;  1KYZ A;  1FBU A;  1IXS B;  3F8N A;  3ERE D;  2GZW A;  3I0T A;  2Z33 A;  2F5C A;  4HX4 A;  3WGH A;  2JPB A;  2O0Y A;  3F6V A;  4MQ9 F;  4KUM A;  3K2Z A;  4A6D A;  4HV6 A;  2PBI A;  4GYG A;  5ICE A;  2KJB A;  2ZFW A;  3RYR A;  2G9W A;  4P9U A;  1ONV A;  3ECO A;  4EVI A;  4P9F A;  4U7B A;  1RNL A;  5L3B A;  5EEG A;  3VOE A;  3WE2 A;  1XN7 A;  1O3R A;  1ZG1 A;  1ZGJ A;  3P9K A;  5AIQ A;  3CUQ B;  5LGU A;  3RI4 A;  5IT9 K;  3GX4 X;  1IN6 A;  3GLX A;  3QRF F;  1XMA A;  3Q9S A;  3JSO A;  1GVJ A;  3RPU A;  1BI3 A;  3HRU A;  1IN4 A;  3ZN1 A;  4F7Z A;  3QU6 A;  2HGC A;  3I59 B;  4I98 B;  4ENJ A;  4EJV A;  2OZU A;  3DPL C;  2FE3 A;  3M8F A;  3IKT A;  1SD5 A;  5LEJ A;  4ZYD A;  4O5V A;  1XGN A;  1D8J A;  2D1V A;  2ZKZ A;  4HLX A;  1E2X A;  4ASN A;  3IRQ A;  2M87 A;  2UXN A;  2E7X A;  5DV5 A;  3MAJ A;  3C18 A;  1SAX A;  4EGY A;  5TRD A;  5DCF A;  4Y13 A;  2MH2 A;  2L4A A;  1OKR A;  5K1Y A;  1B9M A;  1RUN A;  1XGO A;  1K78 B;  2YU3 A;  1BI0 A;  1YIO A;  2WV0 A;  2XAF A;  1IF1 A;  4MNU A;  3KP4 A;  4M9X A;  3GWZ A;  2JPC A;  2CQK A;  2FBK A;  1Z9C A;  3H3Z A;  2O03 A;  3FX3 A;  1S6L A;  2CWE A;  4YIF A;  3CTA A;  1I6X A;  2IA0 A;  2CSO A;  1OMI A;  1K78 A;  2Q8K A;  2P6S A;  3M8E A;  4O6J A;  2VOD A;  1O7L A;  1UHW A;  1F9N A;  4HDU A;  1WI9 A;  2HKO A;  2JSC A;  2RQP A;  4RGX A;  1YS6 A;  5E8I A;  2VE9 A;  3KEQ A;  3CO6 C;  4YG2 F;  2QUF A;  4HV5 A;  2GXB A;  1HBX G;  1T6S A;  3SQN A;  1KYW A;  4UVB A;  5K5R A;  3FXU A;  5D6F A;  3WGG A;  1W7P A;  2VT3 A;  3HOS A;  4UV8 A;  1KGS A;  2K02 A;  1V3F A;  1UB9 A;  4FX0 A;  1FWZ A;  1TW3 A;  1WQ2 A;  4B09 A;  4LLL A;  4HZF A;  4WF2 A;  5HOO A;  1LEB A;  2XV4 S;  1FYK A;  3QPH A;  3ZMU A;  3ZP5 A;  2IW5 A;  4UUV A;  1R1V A;  1BIA A;  3DF8 A;  2PQ8 A;  1QNT A;  2J5P A;  2W85 A;  1LB2 A;  1GXQ A;  2XKO A;  5CJ9 A;  3CUQ A;  3DP7 A;  1ZH5 A;  4G7Z F;  1LDD A;  1IZ1 A;  2ZO4 A;  3KZZ A;  5ICF A;  2ZJ2 A;  2HYF A;  1FX7 A;  3WU1 B;  4RGR A;  3HYI A;  1PDN C;  1P4W A;  2DQR A;  1FSE A;  2KRF A;  1BC8 C;  2FOK A;  4OIQ F;  2CYY A;  4HW0 A;  1XDS A;  4YFK F;  5ILU A;  3VFZ A;  3RJP A;  2ISZ A;  4WWC A;  4P55 A;  1ZHF A;  2K7L A;  3L09 A;  2BV6 A;  2NNN A;  3JW4 A;  4MTE A;  3MZY A;  4G6D A;  5JVT A;  5D4S A;  3COA C;  3ZMT A;  1BN5 A;  4NHJ A;  3IWF A;  4RB3 C;  4EJT A;  2UZK A;  2OQR A;  5LRS A;  4ENK A;  3LA7 A;  2M8E A;  2Z9O A;  4R1H A;  2J5O A;  3SXY A;  1R1T A;  1O3T A;  4XSX F;  2CO5 A;  1ZRE A;  4LMY A;  3EQL F;  3T8R A; 
#chains in the Genus database with same CATH topology
 3BCA A;  1SFE A;  2JA8 J;  2LG4 A;  2A6H F;  1OIS A;  3K0L A;  2WTE A;  5BNG A;  1R23 A;  2M4K A;  1Z1D A;  1U5T C;  2R7R A;  2OBP A;  2ETH A;  3X2Q H;  1FJL A;  3HTS B;  2OA4 A;  2OPT A;  3B6C A;  1J2X A;  1LFP A;  2R0Q C;  4AWX B;  5ICG A;  3WG7 H;  3T5X A;  2IPQ X;  4M6X A;  1HKS A;  3B6A A;  3R61 A;  3IRR A;  1DDN A;  1FSH A;  1OCO H;  4XK4 A;  1MBK A;  1ORK A;  5LEK A;  1PP7 U;  1FBQ A;  2NAZ A;  1BI1 A;  4E6K G;  1JXS A;  4C2T A;  1G2H A;  3H5R A;  4D9J A;  2H27 A;  5DEQ A;  2F2E A;  1V5G A;  5L3D A;  3A4C A;  4X1E A;  5ICC A;  1B1B A;  1Y8Q B;  1E3O C;  1OCT C;  1SVM A;  4JYK A;  3SHF A;  4C2U A;  2DOF A;  2H6C A;  2Q0O A;  5HS9 A;  3DBH B;  3GF2 A;  2JMW A;  3W6J B;  2XAS A;  2LBF A;  5E79 C;  3IL2 A;  2OCE A;  4GYI A;  3K10 A;  3TQN A;  2RDP A;  2DTZ A;  3FIW A;  2L01 A;  1X1D A;  2ZXJ A;  2GXA A;  3GFL A;  4OAY A;  5IOZ A;  4M3F A;  1RI7 A;  1YLF A;  3H92 A;  2BVL A;  2BZT A;  2VKV A;  4ON0 A;  1JKR C;  3ZGK A;  2Z16 A;  1WWX A;  4GFB A;  3HOU J;  1XTA A;  3BG7 A;  4G12 A;  3RZD J;  3IUO A;  3BJ6 A;  5AON A;  1EH7 A;  3T8T A;  1U5T A;  2X1E A;  4XKC A;  2JVG A;  3F6O A;  2P5K A;  2EA4 A;  1AA7 A;  4D7N A;  1D5Y A;  5E1W A;  4RGU A;  3G3Z A;  5FLX Z;  4G9Y A;  3OS1 A;  3K6G A;  1XGM A;  1T0F C;  3QU3 A;  3FMR A;  2VBY A;  4KIB A;  4L9T A;  5ED4 A;  5IYB J;  2MH9 A;  3VYR B;  2VPR A;  5E3L A;  2L54 A;  4BS9 A;  2CW0 F;  1I39 A;  2PMU A;  2ICW G;  5DUI A;  4W1U A;  5HLG A;  1XX5 A;  4U0W A;  2FF4 A;  2FNP A;  4J19 A;  3RKQ A;  3A2K A;  2KL4 A;  1QPI A;  5JLW A;  3GME A;  2A5W A;  4XOT A;  1BW5 A;  1SD7 A;  1TZL A;  3HOZ J;  3OIO A;  4F91 B;  3KFW X;  2L9R A;  4NBQ A;  2VQC A;  4XOR A;  1FNN A;  4XN0 A;  1HXD A;  2DBB A;  4LFU A;  2R7Z J;  1IUY A;  4AD9 A;  2F4M B;  3RPQ A;  4DZJ A;  1NH3 A;  4KT5 C;  3CC7 I;  2DA3 A;  1Q1V A;  2E2H J;  1MBE A;  2D1H A;  1A6Q A;  1VQ9 I;  4AVP A;  3S3O A;  4FTH A;  3HTU A;  2XRO A;  1NG6 A;  1QBJ A;  3DLL F;  2Q1Z B;  4P1W A;  1MD0 A;  2DXI A;  3L2C A;  2VKE A;  1ZLJ A;  5E20 A;  1HKQ A;  1Y1W J;  2QYO A;  4WK8 F;  1HF0 A;  4Q5S F;  1FYM A;  4G7O F;  3GTQ J;  4KJZ A;  1ITY A;  1J9I A;  2QEX I;  2M45 A;  2UXX A;  3SDB A;  3WTZ A;  3WTT C;  4IHV A;  4CDG A;  3BP8 A;  2RKH A;  5EZG A;  4UNO A;  5EEA A;  2RN7 A;  3S1Q J;  5CVJ A;  4ABZ A;  1T2K A;  1U8R A;  2JQ7 A;  4ESB A;  1JKO C;  4U87 A;  3HOV J;  4M74 A;  3BZK A;  1W5S A;  1GT0 C;  1K4T A;  4KN7 X;  1A6I A;  2W25 A;  3MZH A;  4LD5 A;  1FOK A;  2C6Y A;  1CF7 B;  1AOY A;  4P5O A;  2BEO A;  1JHF A;  1FY7 A;  1RKW A;  3MCZ A;  2DI3 A;  2DMT A;  2JUG A;  4HQE A;  2JA5 J;  4DBR A;  3CLO A;  3IKV A;  4FQG A;  1UAA A;  1RR7 A;  3RKX A;  1U2W A;  1ZYR F;  5L3F A;  3JRI A;  2HYG D;  3S1M J;  3H9G A;  3VYS B;  2WAD A;  3M8J A;  5J1U A;  3M9A A;  3ZR8 X;  1BC7 C;  4HAM A;  5M5Y J;  2W57 A;  2DMP A;  3ZMZ A;  1T98 A;  2KIS A;  1JTX A;  4CCL A;  1T08 B;  5A2Q K;  4ESJ A;  4E4H A;  3G6E I;  2H94 A;  3DBR B;  1HCR A;  2XIG A;  1LEA A;  3HKZ N;  3Q3S A;  2P5V A;  5H20 A;  4WXH A;  1MMN A;  2K85 A;  3CCM I;  1KZH A;  2MBF A;  2VLA A;  1Y56 A;  2HOA A;  3KE2 A;  3RZO J;  1KQ9 A;  3OYG A;  1ZRF A;  2WB1 A;  4FHT A;  1IG7 A;  3L1P A;  2E1N A;  3BRO A;  1FMW A;  1S8N A;  1CGP A;  2LKP A;  2XAU A;  1IRZ A;  1FYL A;  2Z1D A;  4C2M J;  4C3J J;  3BZ6 A;  4YEL A;  2K9N A;  1KU7 A;  3DCF A;  5IP9 J;  4G6Q A;  5FKN A;  3LAJ A;  4M3D A;  1J09 A;  2R7Q A;  3MD2 A;  2QKM B;  1BM9 A;  4RM2 A;  4CCM A;  4XLP F;  5E3M A;  3QPS A;  3OYI A;  2HEO A;  2QBY A;  1S5L C;  4GCV A;  4A0Y A;  3WE3 A;  5IT3 A;  3H0D A;  1AU7 A;  1DP7 P;  1WPK A;  2HQR A;  1VQK I;  1FLI A;  1HKT A;  2L3D A;  2XRN A;  2IVM A;  2ZSH B;  1Q1H A;  4BY1 J;  4L18 B;  3VYU B;  3HOW J;  3BR5 A;  2XF5 A;  2KRC A;  1ZGA A;  1DPU A;  3FKI J;  1A04 A;  3ZMD A;  1I27 A;  2X9D A;  4GXO A;  1XMK A;  3ZQQ A;  2NS7 A;  5BPD A;  4KNY A;  3WG9 A;  1MZB A;  5F08 A;  2MC4 A;  2Y48 A;  4XLC A;  2ZJP F;  5DD4 A;  2E7W A;  1B4A A;  1LFB A;  1X3Z B;  3O8G A;  5F6F A;  3TDU C;  3E6C C;  4KIF A;  3QAH A;  1BOA A;  4B4C A;  4LIT A;  4UUS A;  3DXJ F;  4C3H J;  2DK8 A;  4E70 A;  2IBD A;  3GUD A;  2ME6 A;  3JSP A;  3S17 J;  4N9H A;  5HNH A;  5AIP A;  3PQK A;  1MDM A;  4BQQ A;  4G7H F;  1G3Y A;  2ZNY A;  3HOT A;  1BW6 A;  2D2W A;  4IHW A;  2LRE A;  5F0H A;  1SC7 A;  2VI6 A;  2CW7 A;  5J4Y A;  4AU7 A;  3KYD B;  3MKZ A;  3JR9 A;  2VXD A;  1WI3 A;  2V1X A;  4XM3 A;  2V9K A;  3TO9 A;  1QRY A;  4L9N A;  4HDV A;  1YHQ I;  1U0J A;  1WVR A;  3K9T A;  4HF1 A;  3GTM J;  3RKY A;  2CH0 A;  2P4W A;  4XLA A;  1R4N B;  4CZZ A;  1O57 A;  2OZ6 A;  2UWM A;  4B3A A;  3F22 A;  3FHN A;  3V42 A;  4BJ5 C;  1UMQ A;  1N25 A;  1GVD A;  2O8X A;  2VQH A;  2DYS H;  3PJR A;  1IV6 A;  5CVR A;  1PJR A;  3BG9 A;  3N4M A;  1UST A;  3KZI C;  5FB2 A;  3FKJ A;  1R5H A;  2EIJ H;  4L0Y B;  1PYV A;  4A3K J;  3K7A J;  1V55 H;  5JI6 A;  4A69 C;  1GHC A;  4D5F A;  2V79 A;  3JCU C;  1LNW A;  1B72 B;  1E0E A;  4IHS A;  3HPG A;  3E3V A;  4EM1 A;  3BY6 A;  2LKS A;  2EFN A;  5D5V B;  4EEF G;  2TDX A;  5H2F C;  1DP3 A;  1W0T A;  3RCO A;  4F93 B;  3TMO A;  1MJA A;  3GLL A;  1RES A;  1Z77 A;  3SZP A;  3G73 A;  1XG1 A;  2EIM H;  4PUS A;  2NS0 A;  4H0E A;  2H1L A;  5HLH A;  1IAW A;  5E1Z B;  4EM2 A;  5L3E A;  3BCB A;  5FFX A;  2AXL A;  3HSF A;  2G7H A;  1OCR H;  4ZC3 A;  2V9V A;  3QOP A;  1I5Z A;  1ZG3 A;  4QSH A;  1NK3 P;  1FTT A;  2YX7 A;  1P2F A;  3GTO J;  1VF9 A;  5CVU A;  4BHB A;  2H6B A;  1HA8 A;  3R6S A;  4K2E A;  2L02 A;  1EKE A;  1GDT A;  2HOE A;  2F4I A;  2MC3 A;  4LB5 A;  2QQ9 A;  3Q0W A;  2A07 F;  3QQA A;  3NWT A;  2L7K A;  4J01 A;  1TTY A;  3LSM A;  2RNJ A;  5EGO A;  4OU0 A;  4PFP A;  1B8I A;  2X4H A;  2CGP A;  1G3S A;  3OR1 C;  4HF0 A;  4UY8 I;  4IKF A;  2DT7 B;  3DFG A;  4A5M A;  1WJB A;  1ETX A;  5LGN A;  2FBH A;  4JX6 A;  4ZTJ A;  4TV7 A;  3KP3 A;  3PM1 A;  3HDD A;  2X6O A;  2UV1 A;  1SFK A;  4DYC A;  3DKY A;  3S16 J;  1Z3X A;  2ZCW A;  5HDN A;  3U21 A;  5IP6 A;  2O7O A;  2OCC H;  1MMD A;  4PJ0 C;  5E8G A;  1SVO A;  3V7C A;  4UHT A;  3ZOB A;  3EET A;  3VEP A;  3ZCO A;  4S04 A;  3F21 A;  3RYP A;  3RSN A;  1P92 A;  2NVT J;  2X6X A;  4LG0 B;  3REO A;  3CMY A;  2XSJ C;  2R5Z B;  5B3S H;  2XAJ A;  2A5Y B;  2M5W A;  3GW2 A;  3OYA A;  4C9Y A;  2MW8 A;  2H09 A;  3RPU D;  3OOU A;  1R5I D;  2O3F A;  2GA1 A;  3CUQ C;  4KDP A;  3FIS A;  4EAT A;  3L2V A;  4UVA A;  4IZZ A;  4JQF A;  4A3F J;  4IOC F;  4HG2 A;  1TWH J;  2IJL A;  2DAO A;  2A3S A;  3DWL E;  3ZMV A;  1ULY A;  3JRB A;  2PMH A;  2ZXH A;  2QQA A;  4NQW B;  2HPM A;  4QIW N;  4BKX A;  4IF4 A;  3VSK A;  5EF6 A;  2KIF A;  5K7Z A;  1SD6 A;  3WOD F;  1XSV A;  4Q48 A;  4UV9 A;  5DCM A;  1YRN B;  2AHQ A;  2IGM A;  3I4M J;  1PUF A;  4NC7 A;  2FSW A;  2Y2Z A;  3QP5 A;  3HOX J;  2QVO A;  1ON1 A;  4KYW A;  1JUM A;  1AWC A;  2WV1 A;  1WHU A;  1VQM I;  4S05 A;  3PNY A;  3LWF A;  4A0Z A;  4FE4 A;  3AG3 H;  2ZBK A;  1D3Y A;  2A6T A;  4N0B A;  2HVR A;  2LKX A;  2RC4 A;  1JT0 A;  4YFN F;  1UZC A;  2CFX A;  2IA2 A;  1WSU A;  1QA6 A;  1ETV A;  2ZME B;  1HW1 A;  2BW3 A;  1AKH B;  3HKZ A;  3E5U A;  1GV2 A;  2BY2 A;  4ZDL A;  3J81 Z;  2OD5 A;  1JT6 A;  3IP4 B;  1IN7 A;  5IOY A;  3TDZ C;  1R7J A;  1KA8 A;  3DTE A;  1R4M B;  1TNT A;  1YRN A;  3L2W A;  2VUM J;  2DFF A;  3I54 A;  3WU2 C;  4CCN A;  2JN6 A;  3D5R C;  3V8J A;  3C2H A;  6PAX A;  2XF7 A;  2KKO A;  3CF2 A;  2R7D A;  1MNE A;  2BYV E;  3NEU A;  3LAP A;  1TNS A;  3IH2 A;  3KZY A;  2W1O A;  1HSJ A;  3F23 A;  2IS6 A;  1WCM J;  1NTC A;  3DKW A;  4XKW A;  4BHC A;  2CG4 A;  4E7Z A;  2L7M P;  5BQT A;  3HSE A;  1IW7 F;  1FEX A;  4MGR A;  2L7F P;  2NNY A;  1L0O C;  2EA2 A;  2XB0 X;  2R5Y B;  4OOI A;  4CSW A;  2LVS A;  4Y3O A;  3BPX A;  3QP6 A;  3WTW C;  3SJM A;  3L9F A;  1X3W B;  1J0R A;  3W2V A;  4EJO A;  1K6Y A;  3L2U A;  4LB6 B;  3CCJ I;  2H1K A;  2K9Q A;  1I1S A;  5CQG A;  3TKY A;  2XUB A;  1RC9 A;  2X1C A;  3ZQ7 A;  5KK1 A;  3WTX C;  1A31 A;  3M4O J;  1HDP A;  1H8A C;  4BBR J;  4WXD A;  3SYT A;  3KP7 A;  2STT A;  2MLK A;  4UXN A;  4BH9 A;  1HLV A;  3KCC A;  4A3M J;  2KT0 A;  2R7U A;  5JLX A;  4NNJ A;  3BR2 A;  1JTY A;  2ESH A;  5F0F A;  4HBL A;  3ONQ A;  3HGG A;  1OQY A;  4KIT B;  3V7R A;  5B1A H;  1XMX A;  4DW6 A;  2R7O A;  3QWL A;  3AL0 B;  2KPM A;  5H6R A;  3PO3 J;  3FXL A;  4X0G A;  1B8I B;  3S2D J;  2K9S A;  5EGO B;  1JI8 A;  2EV0 A;  3DTI A;  4BNC A;  2P7V B;  2LK2 A;  3PIO F;  4OIP F;  1KU3 A;  4RB2 C;  3IAS 2;  5FO5 A;  5J8C A;  2QA4 I;  1YIT I;  5ILV A;  2R5Z A;  3BPV A;  1VQP I;  3OYH A;  1ZRC A;  4A3J J;  2FD5 A;  4BU2 A;  2VQG A;  1YTY A;  1FP2 A;  4BXF A;  4WX9 A;  2JA6 J;  1MMG A;  3TED A;  3DBL B;  1P7I A;  4S0H B;  3ML6 A;  3H5A A;  1HW5 A;  4OAZ A;  2A61 A;  3VYT B;  3BR0 A;  4M72 A;  4PFO A;  5J1Y A;  5LHH A;  5HDK A;  1MMS A;  2MA3 A;  2JRM A;  2COB A;  4B8X A;  5FRN A;  4A6E A;  2QSF X;  1W7P D;  5LFA A;  3E7L A;  1DQU A;  3TOA A;  5LHG A;  5EEH A;  3NQO A;  4KN4 X;  2A6E F;  4XOP A;  4EM0 B;  1ZR2 A;  4NDL A;  1XCB A;  4GO1 A;  1F4K A;  3S15 J;  4CYD A;  3FDY A;  2QZ8 A;  1MSF C;  2X1D A;  1I3A A;  2EK5 A;  3F8B A;  1YOV B;  3FM5 A;  3PFI A;  2KRH A;  5CKT A;  4IEJ A;  2K5C A;  3VDX A;  1BJA A;  2Y31 A;  2GXG A;  2Q2E A;  2HXI A;  3PQJ A;  5KHD A;  3MFK A;  1TWF J;  5B5E C;  1V5F A;  3RDI A;  2BY1 A;  5IP7 J;  2GAU A;  2RV8 A;  3IC7 A;  3M1C A;  2P0W A;  2JA7 J;  3HZJ A;  2LLK A;  5FLX K;  1U8B A;  4RM3 A;  5JFR A;  5DM6 F;  4M3E A;  1SEU A;  2XHK A;  4ETS A;  2NVY J;  2GOM A;  3HRS A;  2DLL A;  1RUO A;  3ZXS A;  3B02 A;  3DQV C;  3U9G A;  4I99 C;  1O3Q A;  2XGX A;  4Y4R A;  3K4J A;  2HS5 A;  3ELK A;  1YJ9 I;  4M73 A;  1R6R A;  3O6B B;  3CCU I;  3PNT A;  4A0X A;  5LGT A;  5ILS A;  1Z3Y A;  3FHZ A;  3E5Q A;  1GXP A;  4BQO A;  1EH6 A;  2OU2 A;  4E7S A;  1ZAR A;  2DOD A;  4EGZ A;  4JBA A;  1K79 A;  3M07 A;  4YRV A;  1JUS A;  2K86 A;  1JKP C;  2HOT A;  1MIJ A;  1SMY F;  3MMY B;  3J81 K;  5FRO A;  3N97 A;  1ZQ3 P;  2NVX J;  4RLF A;  3CC2 I;  3B73 A;  1WH5 A;  2LY9 A;  3U1D A;  1RET A;  2PI0 A;  2X48 A;  3GFJ A;  3KP2 A;  1WJ5 A;  3KEO A;  1YW8 A;  2CQQ A;  2P8T A;  3H1C A;  1L3L A;  3ZPL A;  2QM3 A;  2DA2 A;  1W5C C;  3KP5 A;  5EJC A;  1PUE E;  3EDP A;  2EB7 A;  1LQ1 A;  1OFC X;  2MD5 A;  4I0A A;  2M1B A;  2VB6 A;  4HF2 A;  1P9Q C;  1TW2 A;  5HLT A;  3OSG A;  1S3J A;  1MJB A;  2E1C A;  2V1N A;  3PIP F;  2UUZ A;  2FOW A;  4I76 A;  4U0V A;  2P6T A;  4F55 A;  3QPT A;  2QGU A;  1SD4 A;  5F27 A;  3OL4 A;  4HNT A;  4CXF A;  4RB1 A;  4ZYE A;  2ZME C;  2O9L A;  3OYM A;  4N9I A;  3VSL A;  1MW7 A;  4HST A;  3LA3 A;  2CW8 A;  4PCQ A;  2KIU A;  4LJZ F;  5HS8 A;  2M4G A;  2QBY B;  1FBS A;  3OS2 A;  2VXZ A;  1O4X A;  1MDM B;  4YIR X;  2HNH A;  1QU3 A;  4QPQ A;  3CQZ J;  3E6B A;  5FRM A;  4QTR A;  2XVC A;  4HA8 A;  1IDZ A;  1YE9 A;  2LNB A;  2KQR A;  2PN6 A;  1WJC A;  4V2F A;  4ZJZ A;  1ZLK A;  3LSP A;  2B7E A;  2MGQ A;  2OTL I;  2L7Z A;  2DTR A;  4G94 A;  2PX9 A;  4UUS B;  4RDU A;  4R79 A;  1BBY A;  3VOD A;  1BIB A;  3K4C A;  3KP6 A;  2HQA A;  2HFH A;  4AYB A;  1B72 A;  1ACI A;  2ZJR F;  1DU0 A;  1YYV A;  4XID A;  2HZT A;  1A35 A;  1TP4 A;  4UUT A;  3AG4 H;  4D1Q A;  3F8F A;  1SAU A;  1DGW Y;  4J00 A;  3H0G J;  2XRL A;  3LSH A;  2ZNZ A;  1FC3 A;  3ABT A;  2VOO A;  1Z6R A;  2Y9Z A;  3PL8 A;  4MFE A;  3TP3 A;  4CZC A;  4U88 A;  4DYR A;  1POG A;  1R1U A;  1MJ9 A;  4DYQ A;  1D0Z A;  1E3P A;  2OJE D;  2Z2S B;  2R7F A;  4AIH A;  2ZXW H;  1OLT A;  5FFZ A;  3CES A;  2K40 A;  2CV2 A;  4L9V A;  5BMZ A;  3K4N A;  1B9N A;  5LHI A;  1MND A;  3C7J A;  2CRG A;  4WCG A;  3G1M A;  1IRF A;  4I09 A;  3MKY B;  1P6R A;  3HRT A;  3M3Y J;  2M7A A;  3DLA A;  1QVU A;  3HPH A;  1JJ6 C;  2GWR A;  1RKT A;  1G4D A;  3EUH A;  2R7X A;  1WH7 A;  1R00 A;  1XSX A;  4M9S A;  4IRG A;  2WAF A;  2QCO A;  3EPZ A;  5FKK A;  2DT6 A;  4YEJ A;  5JHU A;  4B44 A;  1X1C A;  4RBO A;  3SZT A;  2FUG 2;  3ZRG A;  4ENN A;  1R36 A;  2E35 A;  2LMD A;  4OIR F;  5DDG A;  4IOA F;  2IS1 A;  1PVE A;  3C3W A;  1MKM A;  1D1B A;  1X1B A;  4ESF A;  5F1R A;  3K69 A;  1UHM A;  2EBI A;  3BZC A;  1OYY A;  1UG0 A;  1GV5 A;  3D5L A;  4FE7 A;  3I59 A;  4BQA A;  4XQF A;  2L4M A;  3CMA I;  4FX4 A;  1ETY A;  3CCV I;  4F92 B;  5BOX A;  3W2W A;  3BR3 A;  4IHX A;  1X58 A;  1LDJ A;  3OOP A;  4OIN F;  4HSR A;  3LQR A;  4OMY A;  1K61 A;  4D7M A;  1NK2 P;  2VQL A;  1O7F A;  1IXR C;  1S7O A;  1ENH A;  3HOY J;  1QPM A;  1HC8 A;  4ITV A;  1EH8 A;  3HIF A;  2XAQ A;  1LVK A;  3ZQH A;  3OYF A;  1R5G A;  2ME0 A;  2DK5 A;  3BWG A;  3K4K A;  1UG2 A;  1H0M A;  2R7S A;  2DA1 A;  1EA3 A;  1HQC A;  1XSD A;  2DJN A;  1UEL B;  3OL3 A;  4XR6 A;  5IPA A;  1OCC H;  1OPC A;  3IH4 A;  2RRE A;  2M0C A;  3I4N J;  1X4P A;  3FK7 A;  3ABU A;  4IL6 C;  4B47 A;  3DEU A;  2X6W A;  3D0S A;  3R0A A;  3BTC A;  3KLO A;  2LY1 A;  2W82 A;  4ZTF A;  2M8G X;  2K4J A;  4JK1 X;  2EZL A;  1W5T A;  1LDK B;  1D0X A;  4YFX F;  4ZZL A;  1RR8 C;  1OJL A;  5HS7 A;  3UR3 C;  2Q2E B;  2YS9 A;  1UHS A;  2FNA A;  2W48 A;  3SDG A;  3D5S C;  2JVH A;  3HXL A;  2M9H A;  4KMU X;  1V4R A;  1P4X A;  3F8M A;  2ZJQ F;  4A2U A;  3K1P A;  1QGP A;  3CJN A;  4QWQ A;  2QWW A;  2EFO A;  4L5E A;  1TLH B;  3CDH A;  1YJN I;  4IJA A;  3BR1 A;  2GQQ A;  4CIC A;  5E3O A;  2E1M C;  5CVI A;  4P96 A;  3NAR A;  3GTL J;  2EV5 A;  4ZH4 F;  1QZY A;  3EYY A;  3QYE A;  1T95 A;  2JTV A;  2QQ8 A;  2W7N A;  2BBY A;  1ZK8 A;  1R9T J;  3OIP A;  3ABM H;  4GGG A;  2BHZ A;  4XKB A;  2VOP A;  1YW9 A;  3EUA A;  4KIC A;  1XB4 A;  5D6E A;  2ESN A;  3HUG B;  2JRT A;  2LY2 A;  3BG5 A;  3U2R A;  2KFD A;  3IV5 A;  1XC5 A;  3OR2 C;  3ZQF A;  2HR3 A;  4DZP A;  3KIO A;  2HTS A;  3GTG J;  1X1A A;  2E5Z A;  3OY9 A;  2EFW A;  4HRI A;  3DEW A;  1IO2 A;  1R58 A;  3HC7 A;  4LK1 F;  1DPR A;  5D8L B;  2R7T A;  1U5T B;  2D5V A;  3DU6 A;  3OYC A;  5D5X B;  4XRF A;  1YFH A;  4IHT A;  3CP8 A;  2Y0S A;  3IAM 2;  1QHH D;  1VI0 A;  4CGZ A;  2VON A;  3E6D A;  1LPQ A;  2XKP A;  2DMN A;  1IXC A;  1G3T A;  2PG4 A;  4XLH A;  2L9V A;  1IGN A;  2L2O A;  5GPC A;  4MHG A;  2FA5 A;  1QO0 D;  2PLY A;  4PK4 A;  5EYR A;  5C4J J;  3S2W A;  5HOD A;  2DA7 A;  4NB5 A;  3CF5 F;  4HLY A;  5E1X A;  3J7Z I;  4EV0 A;  3W6K B;  2KZV A;  2OQG A;  4JX5 A;  2LP0 A;  2XAG A;  3A0B C;  3F9K A;  3IHU A;  1WKM A;  5FD5 A;  5IYC J;  5H6Q A;  3KYL A;  2EZI A;  1T56 A;  2DPD A;  2E2J J;  2R7V A;  2WBM A;  1BJZ A;  4HYE A;  4BE2 A;  3HB9 A;  2DQL A;  4CUG A;  4AID A;  2CUE A;  1TWA J;  2VBW A;  1D1C A;  1PUF B;  1IUF A;  2PMZ A;  2E5N A;  2E1O A;  3EUH C;  2JT1 A;  4DIQ A;  2P5L C;  3GO5 A;  4MLO A;  5GTI C;  3JTH A;  1UJ8 A;  2E36 A;  1M1E B;  3CP2 A;  2R92 J;  2ACJ A;  3HBL A;  4I02 A;  2ELH A;  2LD5 A;  2WY7 Q;  3H9Q A;  2LDU A;  4IVN A;  2IGN A;  1APL C;  3OYN A;  3V4G A;  1YIJ I;  4XL9 A;  4ZYG A;  2BY0 A;  2Z3Y A;  1YO5 C;  1U9N A;  1N77 A;  1F1Z A;  3BT9 A;  1ZG5 A;  1QZZ A;  3H5N A;  3WU0 A;  3LST A;  4U0Y A;  2HDD A;  2STW A;  3OYB A;  1KQ8 A;  2F5F A;  1JKQ C;  4JX4 A;  4Y7N J;  2GIZ A;  3K4B A;  5CYV A;  4MEX F;  2FQ4 A;  3JRE A;  3D1N I;  5F64 A;  4E7I A;  1UCR A;  3PUB A;  1ETK A;  3L7W A;  4LK0 F;  3KPH A;  1W1W E;  2ADU A;  1AKH A;  3ZQL A;  2DFH A;  5F04 A;  4LG0 A;  2EIN H;  2R5Y A;  4PJJ A;  5CLS A;  2O5R A;  1ZAO A;  2A69 F;  4OWR B;  4KIG A;  4AIJ A;  3K1N A;  4E7K A;  4BL0 B;  2IAI A;  4A12 A;  3CD6 I;  1S29 A;  1BL0 A;  4RGS A;  4MTD A;  1SMT A;  2YX4 A;  2LF8 A;  4XLE A;  2NRA C;  4ENM A;  4AUX A;  4O3M A;  1Y39 A;  2P7C B;  1LE8 B;  2CV1 A;  3FWE A;  4RB0 A;  3O3K A;  3OSF A;  1H89 C;  1S7E A;  4C3I J;  5B1B H;  4IQ4 A;  4XRS G;  2F48 A;  3S3M A;  3CC4 I;  3BDD A;  5DUK A;  1LJ9 A;  1XGS A;  1EV7 A;  3FMS A;  2WWY A;  1BOB A;  1D5V A;  3QOD A;  3J7A Y;  4Y15 A;  3PO2 J;  1LFU P;  4IRI A;  3KLN A;  2F5E A;  1VND A;  3I9V 2;  1FIA A;  1BA5 A;  1W4M A;  2FBI A;  1V54 H;  3GTJ J;  2ZME A;  2IA1 A;  2HVS A;  3E5X A;  1MGT A;  1Y1V J;  3LL7 A;  2O6G E;  4UB6 C;  1D8K A;  2E1M B;  3S8P A;  4IQJ A;  3GZ6 A;  1XS9 A;  5C44 J;  2COM A;  2FXA A;  2KJC A;  2XGD A;  1IV8 A;  3K1M A;  2VPL A;  1D0Y A;  2W84 A;  5DS9 A;  4LLG F;  3CCQ I;  2CUJ A;  2A68 F;  5JVG F;  4L5I A;  3KET A;  4HNV A;  3FXO A;  2VJI A;  2N8G A;  2FU4 A;  5E17 F;  1FT9 A;  2XB5 A;  1YS7 A;  1S72 I;  1T0F A;  5BPI A;  5LBQ A;  5DCM B;  2DW4 A;  1P4A A;  1Y8R B;  3NWS A;  3TW6 A;  1V5E A;  4CO8 A;  1F36 A;  2L5Q A;  4EQQ A;  2CQ7 A;  2W24 A;  2DYR H;  1HST A;  2VC1 A;  2FML A;  2OTJ I;  3VPR A;  1N78 A;  3P9C A;  1RZ4 A;  4NQW A;  2NXN B;  3MVP A;  3T1B A;  2HDC A;  1TL8 A;  4XNF A;  4KT6 A;  5M3M J;  4I2O A;  2X85 A;  3LSK A;  3CCS I;  3BG3 A;  1HDD C;  1VQO I;  3JTG A;  1R49 A;  2OV7 A;  1G6N A;  5K7F A;  1U78 A;  4Q4Z F;  1EJ9 A;  4CHU A;  1ETW A;  1YG2 A;  4HQM A;  4ZDP A;  2LR8 A;  1J59 A;  1X2N A;  5F1J A;  1J7K A;  1Z91 A;  3ZMS A;  4PJL A;  5KAF C;  1WGX A;  4ZYA A;  3JAM Z;  3PNV A;  4FAS D;  3I53 A;  1YX5 A;  2EQR A;  3QPL A;  4ZYH A;  2IP2 A;  4XRS A;  3JAM K;  1MH3 A;  1B6A A;  3C1D A;  5J6X A;  3OYE A;  4AC0 A;  1U3E M;  2X6Y A;  4QLC U;  3GTK J;  1SFX A;  1SFU A;  2BVM A;  1TQP A;  5DYM A;  2HWV A;  5FLV A;  1FOY A;  4IHY A;  2L9N A;  3NAU A;  4BHP A;  3G4S I;  5GAD J;  2R93 J;  5JHF A;  1BR1 A;  1GLN A;  3ABK H;  4A3G J;  3DU5 A;  2ZXI A;  5GP9 A;  3HSR A;  2VN2 A;  1ZN2 A;  4EJW A;  5M3F J;  4BY7 J;  1G8X A;  2JWT A;  3S1R J;  5GPA A;  1X4O A;  1REP C;  2D45 A;  2VBZ A;  2DDA A;  3GZ5 A;  3I58 A;  4D0P A;  3BJA A;  2Y75 A;  1P7J A;  4I6Z A;  1HOM A;  3OYL A;  5DD8 A;  2DCE A;  3ASO H;  1XDU A;  3UKG A;  4XMY A;  2LYC A;  2AO9 A;  3Q5F A;  4M3G A;  2YU9 J;  1J5Y A;  2IEK A;  3J80 K;  2E71 A;  1IN5 A;  3R4K A;  1SVL A;  3J80 Z;  1LVA A;  2BE5 F;  2FEZ A;  1FIP A;  4ZZD A;  3JRG A;  2ID3 A;  3HJE A;  3W3C A;  3V8K A;  1K7A A;  4Q47 A;  2HXO A;  3ZQG A;  4BDY A;  1A5J A;  3HG9 A;  2LTP A;  1Z6T A;  1TQM A;  2HU9 A;  1GUU A;  2JK3 A;  1OCP A;  2VKD A;  1WJE A;  4E7J A;  1F43 A;  1EF4 A;  4CCK A;  2RAE A;  2DOE A;  4A3C J;  1YQA A;  2XGC A;  1W7P B;  5IY5 H;  1Z05 A;  4MQV A;  2DPU A;  5JR3 A;  1F5T A;  2CQX A;  2QLZ A;  2CS3 A;  3P7N A;  2Z99 A;  4II3 A;  1KQ0 A;  3GFM A;  4PGG A;  2EPF A;  3FBI B;  2IS2 A;  2DO7 A;  3ZN0 A;  5E18 F;  2WAQ A;  4L0Z B;  1WJA A;  4CCO A;  1RRJ A;  4U7D A;  4BJT A;  3R60 A;  3BTL A;  4I0B A;  5DTD A;  1X2M A;  3JRA A;  3AG1 H;  4BAY A;  1LKX A;  5LLQ A;  1TWC J;  4Z2Y A;  2PFB A;  3JRF A;  3H3U A;  4A93 J;  1ZKG A;  2LF7 A;  2LSO A;  3G1O A;  2V6C A;  3F8C A;  2JSP A;  5D5U B;  5D4R A;  2EFP A;  3A03 A;  3V8L A;  2KLO A;  1YJW I;  2HZD A;  2JA2 A;  2HYJ A;  4PZJ A;  2EIL H;  4NUB A;  3I71 A;  3CUO A;  1DUX C;  1OR7 A;  1NHA A;  3H9J A;  2MSY A;  2HPI A;  3MZ8 A;  3MN2 A;  3H36 A;  2ECB A;  5FKL A;  3CLQ A;  3ASN H;  1W0U A;  2XAH A;  4Z6Y A;  5BS6 A;  3OYD A;  2XPV A;  1VQ6 I;  2G7U A;  3HEF A;  3TW7 A;  3JRD A;  3LA2 A;  4H4K C;  2FQ3 A;  5L3G A;  3W2A A;  2KP6 A;  4M9Z A;  4BAC A;  3RKW A;  4LG3 A;  2XF6 A;  4MFD A;  4BBS J;  1OYI A;  3OWT A;  2V1D A;  4IRH A;  4EJU A;  2Z5U A;  3BC8 A;  4BEH B;  4DNC A;  2BXY A;  1Z7U A;  2XSD C;  2QSG X;  4XLN F;  4RAY A;  3V7S A;  3N05 A;  4EMS A;  2CUZ A;  1VQ4 I;  3OIQ A;  3ISP A;  5KVR A;  1MMA A;  2AQE A;  2XPU A;  4ZDO A;  2ELK A;  2NOG A;  3ECH A;  3H3V K;  4BYY A;  2HQ5 A;  4XKV A;  1ETO A;  3DPT A;  3K4M A;  4ANJ A;  3J7Y J;  3LMM A;  3I55 I;  2DMQ A;  4CYC B;  2VE8 A;  1FZP B;  4DGW B;  2AQF A;  3FXR A;  4KA4 A;  3FF5 A;  1N75 A;  1H88 C;  1J75 A;  2GM4 A;  2M30 A;  3DV8 A;  3CCR I;  1TQI A;  4OMZ A;  3TOB A;  5LD2 C;  1XD7 A;  1IC8 A;  3CDL A;  2QQB A;  3I5U A;  4A3E J;  3TO7 A;  2V1U A;  1T33 A;  2PMZ N;  3FM3 A;  2OUM A;  4I01 A;  3BLY A;  1X19 A;  3A01 B;  1ODD A;  2I5U A;  2DFE A;  4IXA A;  3IH3 A;  4HOB A;  1MH4 A;  5HDG A;  5KCM A;  1Z21 A;  5D5W B;  1G3W A;  5GAG J;  3GYH X;  1T38 A;  4AVZ A;  2KDO A;  1A36 A;  3WGI A;  5FKO A;  2E60 A;  2FMY A;  4M3B A;  3WTY C;  2YPR A;  2QSH X;  4JP0 A;  3UNG C;  3FK6 A;  1OCZ H;  2CUF A;  3Q9V A;  4Y52 J;  2FX0 A;  3TO6 A;  3KX2 A;  1USS A;  1KU9 A;  1C0W A;  2DA6 A;  1UFM A;  3AG2 H;  2JZY A;  3QYF A;  1T39 A;  5K5O A;  2BHY A;  3LQQ A;  1ZR4 A;  4PSW A;  1YW7 A;  2CV0 A;  3QYB A;  4XBF A;  2DT5 A;  2TCT A;  2FRH A;  3W6V A;  1Y0N A;  4FET A;  2M2E A;  3KEY A;  3ZQI A;  5EZH A;  4KMF A;  1KON A;  1JHH A;  2F5D A;  1ZGW A;  5TJJ A;  4RS8 A;  2DFI A;  2I8D A;  2PJP A;  3JRC A;  5IYD J;  1ON2 A;  4RAZ A;  1X3U A;  3I64 A;  4BGD A;  2CJJ A;  3FXQ A;  4Y17 A;  3RTR A;  3GFI A;  5EG0 B;  4HPQ A;  4UVC A;  2HQN A;  1QHG A;  1FPQ A;  4LOC A;  5K5Q A;  1H9G A;  2HKX A;  2ISY A;  2VIX A;  3HRM A;  5GTH C;  3T0Y A;  5K7H A;  2WAQ N;  3GVA A;  3OV8 A;  2YSR A;  3L2R A;  1CF7 A;  3WTS C;  5TIS C;  2QEN A;  1XCV A;  2TRT A;  2YR2 A;  5J8F A;  2VBX A;  4IX7 A;  2NYX A;  2I10 A;  1KU2 A;  3DTK A;  2B0L A;  3AAF A;  2Y0S N;  3RQ4 A;  2LBF B;  2K3P A;  2EZK A;  1I1G A;  1B59 A;  2IRF G;  2LOO A;  3GEZ A;  3CCE I;  3GXO A;  2O61 A;  5CPR B;  3BTI A;  2IS4 A;  1TBX A;  2VC0 A;  2BY3 A;  1JGS A;  3CO7 C;  2HTJ A;  4A3I J;  2NS8 A;  3I56 I;  3G71 I;  4XON A;  1H9T A;  1FTZ A;  3DPU A;  4MEY F;  3S3N A;  4XRM A;  3E1S A;  5L3C A;  4PJN A;  3MEX A;  1Z0X A;  4AIK A;  5D8K B;  2EWN A;  3PUF A;  2EV6 A;  5ERI A;  2K9M A;  1VFC A;  3MQ0 A;  3QOE A;  2B9S A;  3ULQ B;  4BXU A;  3E6M A;  2K4B A;  4JOM A;  3LSJ A;  2M34 A;  2GIV A;  4XIC A;  1E17 A;  5IT9 Z;  2XGE A;  3F0C A;  1WRJ A;  2WY8 Q;  4NC8 A;  4G8X A;  4RMN A;  3LOC A;  4HX8 A;  4M6V A;  2WC2 A;  1JE8 A;  3O2P E;  2PJR A;  3FMQ A;  2Y30 A;  3SFI A;  3WTV C;  3F72 A;  2CU7 A;  3M1E A;  3GBG A;  3SEQ A;  1WJF A;  1YI2 I;  3ERM A;  4A5N A;  5A2Q Z;  3PFY A;  2M0M A;  3RIR A;  3Q0V A;  1U6G A;  4KFC A;  5HVQ C;  1Y0U A;  3MWM A;  1VTN C;  4BDZ A;  2RVC A;  5FGM A;  3E97 A;  3U1K A;  4HNU A;  4LGW A;  4CCJ A;  3J7A O;  1LUJ B;  1OR7 C;  1QVT A;  1MBF A;  2LC2 A;  3HHH A;  4L9J A;  4M71 A;  3WHC A;  1IRG A;  4YII A;  1R71 A;  2OC6 A;  1O3S A;  1G59 A;  2MAB A;  2AS5 F;  2VT2 A;  1VZ0 A;  2FJ1 A;  2F5V A;  4LLN A;  4DQ2 A;  3EYI A;  1DGR M;  1ERD A;  1RIO H;  1IRX A;  2HVQ A;  1RPW A;  2DU9 A;  3IWZ A;  4CA0 A;  4OIO F;  2P81 A;  4XSZ F;  1YX3 A;  1FP1 D;  2GA2 A;  3SZG A;  2MLG A;  1PP8 F;  3AL0 C;  2Y0M A;  2KIM A;  1R22 A;  3SFZ A;  1S9H A;  1K6O A;  2K27 A;  4XN3 A;  2BW3 B;  1ZRD A;  4I7H A;  3TGN A;  4AM3 A;  1OYW A;  2RGV A;  4D5C A;  2EFQ A;  5EG0 A;  5GAE J;  2V4J C;  1SFO J;  4BXX J;  2W4S A;  3BQZ A;  2QF7 A;  3HHG A;  2X0L A;  3KYC B;  3BJO A;  2R3S A;  5CQE A;  3LFU A;  2IT0 A;  4FT8 A;  3LFK A;  3EUK L;  1S7A A;  3F3X A;  3NRV A;  4DOZ A;  4BE1 A;  2KZG A;  1TWG J;  2GBY A;  1BI2 A;  3L00 A;  3VB2 A;  2PEX A;  3R0J A;  2V9P A;  3G1L A;  4HX7 A;  3M7G A;  5LRR A;  2QKL B;  5CVV A;  3P9I A;  2WB1 N;  2GOX B;  3LNQ A;  3HM5 A;  3HUG A;  1STZ A;  5HLI A;  2KIQ A;  1VQ5 I;  1U9O A;  2Y69 H;  4C30 A;  4L5J A;  3FZV A;  3I4P A;  1TT5 B;  2ZSI B;  2XPW A;  1Z7L A;  2OAZ A;  4IPA A;  4PJM A;  1QQI A;  4IO9 F;  3BOQ A;  2O8K A;  5FD6 A;  4WXC A;  4M6Y A;  5KAI C;  1JUP A;  2AXT C;  3CJT B;  4N4N B;  4PDK A;  3MKL A;  4R8H A;  2PJR B;  2DDB A;  3ROU A;  3CCL I;  1MBG A;  2EJR A;  4PSX A;  1VQN I;  1IN8 A;  2BGC A;  1HW2 A;  1W36 D;  3K70 C;  3WTU C;  1KYZ A;  2K9L A;  1T8I A;  4QPO A;  2ECC A;  1FBU A;  4V19 K;  1IXS B;  3F8N A;  3ERE D;  3S2H J;  2X51 A;  3OMY A;  1MSE C;  2WAE A;  3FXM A;  2GZW A;  3I0T A;  2Z33 A;  2F5C A;  4FIS A;  3JRH A;  4HX4 A;  3TBI A;  5E3N A;  1AHD P;  2E2I J;  3HGY A;  1NG7 A;  3WGH A;  2JPB A;  2O0Y A;  3F6V A;  4RAG A;  4MQ9 F;  2LFB A;  4KUM A;  3A02 A;  3K2Z A;  5TGT A;  2EZH A;  2OF7 A;  4A6D A;  2IGO A;  4HV6 A;  4II2 A;  4B3X A;  2PBI A;  4GRI A;  4GYG A;  5ICE A;  2KJB A;  2ZFW A;  3RYR A;  4FCY A;  3CCY A;  2G9W A;  4P9U A;  3GTP J;  1ONV A;  2B63 J;  3ECO A;  5J3L A;  4EVI A;  4P9F A;  4E7H A;  4U7B A;  1RNL A;  5L3B A;  5EEG A;  1WFX A;  1ETQ A;  5F0C A;  3VOE A;  3WE2 A;  1XN7 A;  2F6C A;  1O3R A;  1ZG1 A;  3A01 A;  2K3F A;  1ZGJ A;  2WA0 A;  3BR6 A;  3CMM A;  2V7F A;  3FXK A;  3P9K A;  1TC3 C;  3T8R A;  5AIQ A;  5GAH J;  4V2G A;  2JJ7 A;  3CUQ B;  5LGU A;  2L9S A;  3RI4 A;  5IT9 K;  3GX4 X;  2V6E A;  1IN6 A;  3GLX A;  2KHM A;  3QRF F;  5J47 A;  1XMA A;  3Q9S A;  3JSO A;  4CYC A;  1GVJ A;  3RPU A;  1BI3 A;  3HRU A;  3S32 A;  1IN4 A;  3OS0 A;  3ZN1 A;  4F7Z A;  3QU6 A;  2HGC A;  3I59 B;  4I98 B;  4UB8 C;  4ENJ A;  4EJV A;  3S1N J;  1Y6I A;  2OZU A;  3DPL C;  3LSR A;  2HI3 A;  2FE3 A;  2IXS A;  3M8F A;  3IKT A;  1IJW C;  3FBN B;  1I6H J;  1SD5 A;  5M5W J;  5LEJ A;  4A3B J;  4ZYD A;  3C2G A;  4O5V A;  5J4V A;  1XGN A;  2DA4 A;  1MNM C;  5FJ8 J;  1D8J A;  2W00 A;  2D1V A;  2ZKZ A;  4HLX A;  3OYK A;  1BR4 A;  1QZE A;  2HOS A;  1K4S A;  3FXJ A;  4KIS A;  1E2X A;  1FMV A;  2DOA A;  2NVU B;  4ASN A;  3IRQ A;  2DMU A;  5FLM J;  2XDV A;  4BE0 A;  2M87 A;  2MFZ A;  4LIV A;  2UXN A;  3E0J B;  2MD0 A;  1D1A A;  2RQQ A;  2E7X A;  1E3H A;  5DV5 A;  4B48 A;  3MAJ A;  1ZEL A;  1TT0 A;  2ELJ A;  3PSF A;  3C18 A;  3O8H A;  4GDF A;  4BUP A;  5J1R A;  2LH9 A;  1SAX A;  4EGY A;  5TRD A;  2A05 A;  3A1Y A;  5DCF A;  4Y13 A;  2MH2 A;  2L4A A;  2ZFU A;  3ZQC A;  1OKR A;  2ID6 A;  5K1Y A;  1B9M A;  1RUN A;  3GZN B;  1XGO A;  1K78 B;  4LIU A;  2YU3 A;  1BI0 A;  1YIO A;  3LSG A;  2WV0 A;  3CDI A;  4RAF A;  2XAF A;  1K83 J;  2ZC2 A;  1IF1 A;  4MNU A;  3KP4 A;  3HL2 A;  3K4L A;  1W36 C;  2BOL A;  4M9X A;  3GWZ A;  2JPC A;  2CQK A;  4AYB N;  2ZB9 A;  2FBK A;  3K2A A;  3BQY A;  1Z9C A;  3H3Z A;  4BEH A;  4MIM A;  4F3Q A;  5C4X J;  2O03 A;  2BXZ A;  3FX3 A;  1S6L A;  2CMP A;  3LSI A;  4N4O B;  2CWE A;  4YIF A;  3I3L A;  3CTA A;  1I6X A;  2IA0 A;  2KDZ A;  1FOW A;  4W97 A;  3BTJ A;  2CSO A;  1WZ2 A;  4XLF A;  2VJJ A;  2XC7 A;  1OMI A;  1K78 A;  2Q8K A;  3AFH A;  2P6S A;  4RLQ A;  3M8E A;  4O6J A;  3CZ6 A;  2VOD A;  5C3E J;  1I3Q J;  1O7L A;  1UHW A;  3CJQ B;  1F9N A;  2HDW A;  4HDU A;  1WI9 A;  4F52 A;  2HKO A;  2M3A A;  2JSC A;  2RQP A;  4RGX A;  1YS6 A;  5E8I A;  2VE9 A;  3S93 A;  3H35 A;  3KEQ A;  2NVQ J;  2H8W A;  2VL8 A;  3AKZ A;  3CO6 C;  1CQT A;  3K70 D;  3Q0U A;  1VQ8 I;  4YG2 F;  2QUF A;  4HV5 A;  2GXB A;  1HBX G;  1T6S A;  5J40 A;  5M5X J;  2VAS A;  3SQN A;  2RNG A;  4G6T B;  1KYW A;  4UVB A;  5K5R A;  2R7W A;  3FXU A;  5D6F A;  3BG6 A;  3G2B A;  2DA5 A;  3WGG A;  3DKX A;  1W7P A;  4Y33 A;  2VJ4 A;  3TL4 X;  2VT3 A;  3HOS A;  2V26 A;  1VQ7 I;  4UV8 A;  1JGG A;  1KGS A;  2K02 A;  1V3F A;  5EDN A;  1UB9 A;  1DU6 A;  4FX0 A;  2E34 A;  1FWZ A;  1TW3 A;  1WQ2 A;  2YUS A;  5DM7 F;  2LRD A;  4B09 A;  3PSI A;  4LLL A;  4HZF A;  3C2B A;  1MBJ A;  1XPX A;  2NOJ B;  2IGK A;  4B1R A;  2MYS A;  4WF2 A;  5HOO A;  2JUC A;  1LEB A;  2XV4 S;  1FYK A;  3QPH A;  3ZMU A;  3ZP5 A;  2IW5 A;  1Z67 A;  4UUV A;  1I50 J;  5KNL A;  2H8R A;  1R1V A;  3DF8 A;  1BIA A;  2PQ8 A;  4MO7 A;  1QNT A;  2J5P A;  3L2Q A;  3SEZ A;  4BJ6 C;  1SAN A;  2DN0 A;  2W85 A;  2EIK H;  1LB2 A;  2L0K A;  1GXQ A;  2XKO A;  5CJ9 A;  2DJI A;  3CUQ A;  3DEE A;  3DP7 A;  1ZH5 A;  4G7Z F;  1LDD A;  1IZ1 A;  2ZO4 A;  3KZZ A;  1WJD A;  3A0H C;  2G0E A;  1BR2 A;  2VJ5 A;  5ICF A;  2ZJ2 A;  4DBQ A;  4NC6 A;  5B66 C;  2HYF A;  3ESW B;  1FX7 A;  3WU1 B;  2Y9Y A;  4RGR A;  3HYI A;  1PDN C;  1P4W A;  3CME I;  2DQR A;  1VQL I;  4X6A J;  1FSE A;  2KRF A;  1BC8 C;  1X1P A;  2FOK A;  4OIQ F;  2CYY A;  4HW0 A;  1XDS A;  3VWB A;  4YFK F;  5ILU A;  3VFZ A;  3RJP A;  1ZTR A;  2ISZ A;  3OYJ A;  3TP0 A;  3MKW B;  4E7L A;  4WWC A;  1JJ8 C;  4P55 A;  2GLO A;  2R4G A;  2CQN A;  1ZHF A;  3P5J A;  2K7L A;  9ANT A;  3L09 A;  2BV6 A;  2NNN A;  4HEA 2;  1FOX A;  4A3L J;  3JW4 A;  2VKH A;  1LE8 A;  4MTE A;  2CFO A;  3MZY A;  2M7B A;  4G6D A;  5JVT A;  5D4S A;  2EH3 A;  3ZMT A;  3COA C;  5HNF A;  1BN5 A;  4NHJ A;  3IWF A;  2KMU A;  5FKM A;  4BQN A;  4RB3 C;  2MG4 A;  4EJT A;  2E19 A;  2UZK A;  3CJR B;  4DJA A;  2OQR A;  5LRS A;  3S14 J;  4ENK A;  3GCM A;  3LA7 A;  2M8E A;  2Z9O A;  4R1H A;  2J5O A;  3SXY A;  1R1T A;  3RQI A;  3ABL H;  4B43 A;  1IDY A;  1O3T A;  3WHB A;  4A3D J;  4XSX F;  2CO5 A;  4RA2 A;  1ZRE A;  4LMY A;  3EQL F;  4CH7 A;  1MBH A;  2F4O B;  4PGH A; 
#chains in the Genus database with same CATH homology
 1SFE A;  2A6H F;  3K0L A;  2WTE A;  1R23 A;  1Z1D A;  1U5T C;  2OBP A;  2ETH A;  3HTS B;  2OA4 A;  1J2X A;  4AWX B;  5ICG A;  3T5X A;  2IPQ X;  4M6X A;  1HKS A;  3R61 A;  3IRR A;  1DDN A;  1FSH A;  5LEK A;  1PP7 U;  1FBQ A;  2NAZ A;  1BI1 A;  1JXS A;  2H27 A;  5DEQ A;  2F2E A;  5L3D A;  5ICC A;  1B1B A;  3SHF A;  2H6C A;  2Q0O A;  5HS9 A;  3GF2 A;  3W6J B;  2XAS A;  3IL2 A;  4GYI A;  3TQN A;  2RDP A;  2L01 A;  2ZXJ A;  3GFL A;  1RI7 A;  1YLF A;  3H92 A;  4ON0 A;  1WWX A;  3BJ6 A;  5AON A;  1EH7 A;  3T8T A;  1U5T A;  3F6O A;  2P5K A;  2EA4 A;  5E1W A;  4RGU A;  3G3Z A;  5FLX Z;  4G9Y A;  1XGM A;  3QU3 A;  3FMR A;  2VBY A;  4KIB A;  4L9T A;  5ED4 A;  2MH9 A;  2L54 A;  2CW0 F;  2PMU A;  5DUI A;  5HLG A;  4U0W A;  2FF4 A;  2FNP A;  1SD7 A;  3KFW X;  1FNN A;  1HXD A;  2DBB A;  4LFU A;  1IUY A;  4AD9 A;  3RPQ A;  4KT5 C;  2D1H A;  4AVP A;  1QBJ A;  3HTU A;  2XRO A;  1MD0 A;  3L2C A;  1ZLJ A;  5E20 A;  1HKQ A;  2QYO A;  4WK8 F;  4Q5S F;  1FYM A;  4G7O F;  1J9I A;  2M45 A;  2UXX A;  3WTZ A;  3WTT C;  4CDG A;  3BP8 A;  2RKH A;  4UNO A;  2RN7 A;  5CVJ A;  1T2K A;  1U8R A;  4ESB A;  4M74 A;  1W5S A;  4KN7 X;  2C6Y A;  2W25 A;  4LD5 A;  3MZH A;  1FOK A;  1CF7 B;  1AOY A;  4P5O A;  2BEO A;  1JHF A;  1FY7 A;  3MCZ A;  2DI3 A;  4HQE A;  3CLO A;  3IKV A;  3RKX A;  1U2W A;  1ZYR F;  5L3F A;  2HYG D;  3M9A A;  1BC7 C;  4HAM A;  2W57 A;  3ZMZ A;  1T98 A;  5A2Q K;  4ESJ A;  2H94 A;  2XIG A;  1LEA A;  2P5V A;  5H20 A;  4WXH A;  2MBF A;  3KE2 A;  1KQ9 A;  1ZRF A;  4FHT A;  2E1N A;  3BRO A;  1S8N A;  1CGP A;  2LKP A;  1FYL A;  3BZ6 A;  1KU7 A;  4G6Q A;  3LAJ A;  1BM9 A;  4XLP F;  2HEO A;  2QBY A;  4A0Y A;  4GCV A;  5IT3 A;  3WE3 A;  1DP7 P;  2HQR A;  1FLI A;  1HKT A;  2L3D A;  2XRN A;  2IVM A;  1Q1H A;  4L18 B;  1ZGA A;  1DPU A;  1A04 A;  3ZMD A;  1I27 A;  4GXO A;  5BPD A;  1XMK A;  4KNY A;  3WG9 A;  1MZB A;  2Y48 A;  5DD4 A;  2E7W A;  1B4A A;  5F6F A;  3TDU C;  3E6C C;  4KIF A;  3QAH A;  1BOA A;  3DXJ F;  2DK8 A;  4E70 A;  3GUD A;  3JSP A;  4N9H A;  5AIP A;  3PQK A;  1MDM A;  4G7H F;  1G3Y A;  2ZNY A;  3HOT A;  2D2W A;  2V1X A;  3TO9 A;  4L9N A;  4HDV A;  3K9T A;  4HF1 A;  3RKY A;  2P4W A;  4CZZ A;  1O57 A;  2OZ6 A;  2UWM A;  3F22 A;  2O8X A;  5CVR A;  3N4M A;  1UST A;  5FB2 A;  1R5H A;  4L0Y B;  5JI6 A;  1GHC A;  2V79 A;  1LNW A;  4IHS A;  3E3V A;  4EM1 A;  3BY6 A;  2EFN A;  5D5V B;  2TDX A;  1MJA A;  3G73 A;  3SZP A;  2NS0 A;  4H0E A;  5HLH A;  1IAW A;  5E1Z B;  4EM2 A;  5L3E A;  5FFX A;  2AXL A;  2G7H A;  3HSF A;  2V9V A;  3QOP A;  1I5Z A;  1ZG3 A;  2YX7 A;  1P2F A;  5CVU A;  4BHB A;  2H6B A;  3R6S A;  4K2E A;  2L02 A;  2HOE A;  2MC3 A;  4LB5 A;  2QQ9 A;  2A07 F;  1TTY A;  2RNJ A;  4OU0 A;  2X4H A;  2CGP A;  1G3S A;  4HF0 A;  3DFG A;  4A5M A;  5LGN A;  2FBH A;  4TV7 A;  3KP3 A;  2ZCW A;  5HDN A;  5E8G A;  3V7C A;  4UHT A;  3EET A;  3VEP A;  4S04 A;  3F21 A;  3RYP A;  1P92 A;  4LG0 B;  3REO A;  2XAJ A;  2A5Y B;  2M5W A;  3GW2 A;  2H09 A;  2O3F A;  2GA1 A;  3CUQ C;  4KDP A;  4UVA A;  4JQF A;  2IJL A;  2DAO A;  2A3S A;  3ZMV A;  1ULY A;  2PMH A;  2QQA A;  4IF4 A;  2KIF A;  1SD6 A;  3WOD F;  1XSV A;  4Q48 A;  4UV9 A;  5DCM A;  2FSW A;  3QP5 A;  2QVO A;  1ON1 A;  4KYW A;  1AWC A;  4S05 A;  3LWF A;  4A0Z A;  2ZBK A;  1D3Y A;  4N0B A;  2RC4 A;  4YFN F;  2CFX A;  2IA2 A;  1WSU A;  2ZME B;  1HW1 A;  3E5U A;  3J81 Z;  2OD5 A;  1IN7 A;  3TDZ C;  1R7J A;  1KA8 A;  1TNT A;  3I54 A;  3V8J A;  6PAX A;  2KKO A;  2R7D A;  2BYV E;  3NEU A;  3LAP A;  1TNS A;  3KZY A;  1HSJ A;  3F23 A;  3DKW A;  4BHC A;  2CG4 A;  5BQT A;  3HSE A;  1IW7 F;  4PGH A;  4MGR A;  2NNY A;  1L0O C;  2EA2 A;  4OOI A;  3BPX A;  3QP6 A;  3WTW C;  3L9F A;  1J0R A;  4EJO A;  4LB6 B;  1I1S A;  3TKY A;  2XUB A;  3ZQ7 A;  5KK1 A;  3WTX C;  4WXD A;  3KP7 A;  2STT A;  2MLK A;  4UXN A;  4BH9 A;  3KCC A;  2ESH A;  4HBL A;  3V7R A;  5H6R A;  2EV0 A;  4BNC A;  2P7V B;  4OIP F;  1KU3 A;  4RB2 C;  5FO5 A;  5J8C A;  5ILV A;  3BPV A;  1ZRC A;  1YTY A;  1FP2 A;  4WX9 A;  3ML6 A;  1HW5 A;  2A61 A;  4M72 A;  5LHH A;  5HDK A;  2MA3 A;  4B8X A;  4A6E A;  1W7P D;  3TOA A;  5LHG A;  5EEH A;  3NQO A;  4KN4 X;  2A6E F;  4EM0 B;  1XCB A;  4GO1 A;  1F4K A;  4CYD A;  2QZ8 A;  2EK5 A;  3F8B A;  3FM5 A;  3PFI A;  1BJA A;  2GXG A;  2Q2E A;  3PQJ A;  3MFK A;  3RDI A;  2GAU A;  2RV8 A;  3IC7 A;  5FLX K;  5JFR A;  2XHK A;  4ETS A;  3HRS A;  2DLL A;  1RUO A;  3B02 A;  3DQV C;  3U9G A;  1O3Q A;  2XGX A;  2HS5 A;  3ELK A;  4M73 A;  3O6B B;  4A0X A;  5LGT A;  5ILS A;  3FHZ A;  3E5Q A;  1GXP A;  1EH6 A;  2OU2 A;  1ZAR A;  4EGZ A;  4JBA A;  1K79 A;  2K86 A;  1SMY F;  3J81 K;  3N97 A;  3B73 A;  3U1D A;  2PI0 A;  3GFJ A;  3KP2 A;  3KEO A;  1YW8 A;  2P8T A;  1L3L A;  3ZPL A;  2QM3 A;  3KP5 A;  1PUE E;  3EDP A;  2EB7 A;  1LQ1 A;  4I0A A;  2MD5 A;  2M1B A;  4HF2 A;  1TW2 A;  2E1C A;  1S3J A;  1MJB A;  4U0V A;  2P6T A;  3QPT A;  1SD4 A;  4CXF A;  4RB1 A;  4ZYE A;  4N9I A;  3LA3 A;  4PCQ A;  2KIU A;  4LJZ F;  5HS8 A;  2QBY B;  1FBS A;  2VXZ A;  1MDM B;  3E6B A;  2XVC A;  4HA8 A;  2LNB A;  2PN6 A;  1ZLK A;  2DTR A;  4G94 A;  4R79 A;  1BBY A;  3VOD A;  1BIB A;  3KP6 A;  2HFH A;  1YYV A;  2HZT A;  3F8F A;  2ZNZ A;  1FC3 A;  3ABT A;  2VOO A;  1Z6R A;  4U88 A;  1R1U A;  1MJ9 A;  4AIH A;  2R7F A;  5FFZ A;  4L9V A;  5BMZ A;  1B9N A;  5LHI A;  3C7J A;  4WCG A;  1IRF A;  4I09 A;  1P6R A;  3HRT A;  2GWR A;  1G4D A;  3EUH A;  1R00 A;  1XSX A;  4M9S A;  4IRG A;  5JHU A;  3SZT A;  4ENN A;  1R36 A;  4OIR F;  5DDG A;  3C3W A;  1MKM A;  4ESF A;  5F1R A;  3K69 A;  1UHM A;  3D5L A;  1OYY A;  3I59 A;  4BQA A;  2L4M A;  4FX4 A;  5BOX A;  1LDJ A;  3OOP A;  4OIN F;  3LQR A;  4OMY A;  1O7F A;  1IXR C;  1S7O A;  1QPM A;  1EH8 A;  3HIF A;  2XAQ A;  1R5G A;  2DK5 A;  3BWG A;  1H0M A;  1HQC A;  1XSD A;  1OPC A;  3ABU A;  3DEU A;  3D0S A;  3R0A A;  3KLO A;  2K4J A;  4JK1 X;  1W5T A;  1LDK B;  4YFX F;  4ZZL A;  5HS7 A;  2FNA A;  4KMU X;  1V4R A;  1P4X A;  3F8M A;  4A2U A;  3K1P A;  1QGP A;  3CJN A;  4QWQ A;  2QWW A;  2EFO A;  1TLH B;  3CDH A;  4IJA A;  2GQQ A;  4CIC A;  5CVI A;  4P96 A;  2EV5 A;  4ZH4 F;  1QZY A;  3EYY A;  2JTV A;  2BBY A;  4GGG A;  2VOP A;  1YW9 A;  4KIC A;  1XB4 A;  5D6E A;  2ESN A;  2JRT A;  3U2R A;  2HR3 A;  2HTS A;  2EFW A;  4LK1 F;  1R58 A;  1DPR A;  5D8L B;  1U5T B;  1YFH A;  5D5X B;  4XRF A;  4IHT A;  4CGZ A;  2VON A;  3E6D A;  2XKP A;  1IXC A;  1G3T A;  2PG4 A;  4MHG A;  2FA5 A;  2PLY A;  1QO0 D;  3S2W A;  4NB5 A;  4HLY A;  5E1X A;  4EV0 A;  3W6K B;  2OQG A;  2XAG A;  3IHU A;  1WKM A;  5FD5 A;  5H6Q A;  2DPD A;  4HYE A;  2DQL A;  2VBW A;  2JT1 A;  2P5L C;  3GO5 A;  3JTH A;  2ACJ A;  4I02 A;  2ELH A;  2LDU A;  4IVN A;  3V4G A;  4ZYG A;  2Z3Y A;  1YO5 C;  1F1Z A;  1ZG5 A;  1QZZ A;  3WU0 A;  3LST A;  4U0Y A;  2STW A;  1KQ8 A;  2F5F A;  4MEX F;  5CYV A;  5F64 A;  1UCR A;  4LK0 F;  3L7W A;  2ADU A;  4LG0 A;  5CLS A;  1ZAO A;  2A69 F;  4KIG A;  4AIJ A;  3K1N A;  4A12 A;  1S29 A;  4RGS A;  4MTD A;  1SMT A;  2YX4 A;  2LF8 A;  2NRA C;  4ENM A;  4O3M A;  2P7C B;  3FWE A;  4RB0 A;  3O3K A;  3BDD A;  5DUK A;  1LJ9 A;  1XGS A;  1EV7 A;  3FMS A;  2WWY A;  1D5V A;  4Y15 A;  4IRI A;  3KLN A;  2F5E A;  1W4M A;  2FBI A;  2ZME A;  2IA1 A;  3E5X A;  1MGT A;  2O6G E;  1D8K A;  3GZ6 A;  2COM A;  2FXA A;  2KJC A;  3K1M A;  2W84 A;  4LLG F;  2A68 F;  4L5I A;  3KET A;  5E17 F;  2FU4 A;  1FT9 A;  1YS7 A;  1T0F A;  5BPI A;  5LBQ A;  5DCM B;  2DW4 A;  1P4A A;  4CO8 A;  4EQQ A;  2W24 A;  2VC1 A;  1HST A;  2FML A;  3P9C A;  1RZ4 A;  4NQW A;  3T1B A;  2HDC A;  4I2O A;  3JTG A;  1G6N A;  1U78 A;  4Q4Z F;  4CHU A;  1YG2 A;  4HQM A;  1J59 A;  1J7K A;  1Z91 A;  3ZMS A;  3JAM Z;  3I53 A;  4ZYH A;  2IP2 A;  3JAM K;  1B6A A;  3C1D A;  5J6X A;  1U3E M;  4QLC U;  1SFX A;  1SFU A;  1TQP A;  5DYM A;  2HWV A;  4BHP A;  3HSR A;  2VN2 A;  1ZN2 A;  4EJW A;  1REP C;  2D45 A;  2VBZ A;  3GZ5 A;  3I58 A;  4D0P A;  3BJA A;  2Y75 A;  5DD8 A;  1XDU A;  3Q5F A;  1J5Y A;  3J80 K;  1IN5 A;  3R4K A;  3J80 Z;  1LVA A;  2BE5 F;  2FEZ A;  4ZZD A;  3V8K A;  1K7A A;  4Q47 A;  1Z6T A;  1TQM A;  1YQA A;  1W7P B;  1Z05 A;  4MQV A;  2DPU A;  5JR3 A;  1F5T A;  2QLZ A;  3P7N A;  2Z99 A;  1KQ0 A;  3GFM A;  4PGG A;  2DO7 A;  3ZN0 A;  5E18 F;  4L0Z B;  4U7D A;  3R60 A;  4I0B A;  4BAY A;  5LLQ A;  4Z2Y A;  2PFB A;  3H3U A;  2LF7 A;  2LSO A;  2V6C A;  3F8C A;  5D5U B;  5D4R A;  2EFP A;  3V8L A;  4PZJ A;  3I71 A;  3CUO A;  1DUX C;  1OR7 A;  1NHA A;  2XAH A;  5BS6 A;  2G7U A;  3LA2 A;  2FQ3 A;  5L3G A;  4M9Z A;  3RKW A;  1OYI A;  2V1D A;  4IRH A;  4EJU A;  2Z5U A;  4DNC A;  1Z7U A;  4XLN F;  4RAY A;  3V7S A;  4EMS A;  3ISP A;  5KVR A;  3ECH A;  4BYY A;  3DPT A;  2VE8 A;  1FZP B;  3FXR A;  4KA4 A;  3FF5 A;  1J75 A;  2M30 A;  3DV8 A;  1TQI A;  4OMZ A;  3TOB A;  1XD7 A;  2QQB A;  3I5U A;  2V1U A;  3TO7 A;  3FM3 A;  4I01 A;  1ODD A;  4IXA A;  5HDG A;  5D5W B;  4HOB A;  1G3W A;  3GYH X;  1T38 A;  3WGI A;  2FMY A;  3WTY C;  2YPR A;  3Q9V A;  3TO6 A;  1C0W A;  1USS A;  1KU9 A;  1UFM A;  2JZY A;  1T39 A;  5K5O A;  3LQQ A;  1YW7 A;  4XBF A;  2DT5 A;  2FRH A;  4KMF A;  1JHH A;  2F5D A;  5TJJ A;  4RS8 A;  2DFI A;  2PJP A;  1ON2 A;  3GFI A;  1X3U A;  3I64 A;  4RAZ A;  3FXQ A;  4Y17 A;  3RTR A;  4UVC A;  2HQN A;  1FPQ A;  5K5Q A;  1H9G A;  2HKX A;  2ISY A;  3HRM A;  3T0Y A;  3GVA A;  3OV8 A;  2YSR A;  1CF7 A;  3WTS C;  2QEN A;  1XCV A;  2YR2 A;  5J8F A;  2VBX A;  2NYX A;  1KU2 A;  2B0L A;  3AAF A;  1I1G A;  1B59 A;  2IRF G;  3GEZ A;  3GXO A;  2O61 A;  1TBX A;  2VC0 A;  3CO7 C;  1JGS A;  2HTJ A;  1H9T A;  4MEY F;  5L3C A;  3MEX A;  4AIK A;  5D8K B;  2EWN A;  5ERI A;  2EV6 A;  3MQ0 A;  3ULQ B;  4BXU A;  3E6M A;  2K4B A;  2GIV A;  1E17 A;  5IT9 Z;  1WRJ A;  4G8X A;  4HX8 A;  2WC2 A;  1JE8 A;  3O2P E;  3FMQ A;  3WTV C;  3F72 A;  3M1E A;  4A5N A;  5A2Q Z;  3RIR A;  1U6G A;  4KFC A;  5HVQ C;  1Y0U A;  3MWM A;  1VTN C;  2RVC A;  5FGM A;  3E97 A;  4LGW A;  3J7A O;  3HHH A;  4L9J A;  4M71 A;  1IRG A;  4YII A;  1O3S A;  2AS5 F;  2VT2 A;  4LLN A;  4DQ2 A;  3EYI A;  1RIO H;  2DU9 A;  3IWZ A;  4OIO F;  4XSZ F;  1FP1 D;  2GA2 A;  2MLG A;  1PP8 F;  2Y0M A;  2KIM A;  1R22 A;  3SFZ A;  1K6O A;  2K27 A;  1ZRD A;  4I7H A;  3TGN A;  1OYW A;  2RGV A;  2EFQ A;  3HHG A;  2X0L A;  3BJO A;  2R3S A;  2IT0 A;  4FT8 A;  3LFK A;  1S7A A;  3F3X A;  3NRV A;  3VB2 A;  1BI2 A;  3L00 A;  2PEX A;  3R0J A;  4HX7 A;  3M7G A;  5LRR A;  5CVV A;  3P9I A;  3HUG A;  1STZ A;  5HLI A;  4L5J A;  3FZV A;  3I4P A;  2OAZ A;  4IPA A;  1QQI A;  3BOQ A;  5FD6 A;  4WXC A;  4M6Y A;  4PDK A;  4R8H A;  3ROU A;  2EJR A;  1IN8 A;  2BGC A;  1HW2 A;  3WTU C;  1KYZ A;  1FBU A;  1IXS B;  3F8N A;  3ERE D;  2GZW A;  3I0T A;  2Z33 A;  2F5C A;  4HX4 A;  3WGH A;  2JPB A;  2O0Y A;  3F6V A;  4MQ9 F;  4KUM A;  3K2Z A;  4A6D A;  4HV6 A;  2PBI A;  4GYG A;  5ICE A;  2KJB A;  2ZFW A;  3RYR A;  2G9W A;  4P9U A;  1ONV A;  3ECO A;  4EVI A;  4P9F A;  4U7B A;  1RNL A;  5L3B A;  5EEG A;  3VOE A;  3WE2 A;  1XN7 A;  1O3R A;  1ZG1 A;  1ZGJ A;  3P9K A;  5AIQ A;  3CUQ B;  5LGU A;  3RI4 A;  5IT9 K;  3GX4 X;  1IN6 A;  3GLX A;  3QRF F;  1XMA A;  3Q9S A;  3JSO A;  1GVJ A;  3RPU A;  1BI3 A;  3HRU A;  1IN4 A;  3ZN1 A;  4F7Z A;  3QU6 A;  2HGC A;  3I59 B;  4I98 B;  4ENJ A;  4EJV A;  2OZU A;  3DPL C;  2FE3 A;  3M8F A;  3IKT A;  1SD5 A;  5LEJ A;  4ZYD A;  4O5V A;  1XGN A;  1D8J A;  2D1V A;  2ZKZ A;  4HLX A;  1E2X A;  4ASN A;  3IRQ A;  2M87 A;  2UXN A;  2E7X A;  5DV5 A;  3MAJ A;  3C18 A;  1SAX A;  4EGY A;  5TRD A;  5DCF A;  4Y13 A;  2MH2 A;  2L4A A;  1OKR A;  5K1Y A;  1B9M A;  1RUN A;  1XGO A;  1K78 B;  2YU3 A;  1BI0 A;  1YIO A;  2WV0 A;  2XAF A;  1IF1 A;  4MNU A;  3KP4 A;  4M9X A;  3GWZ A;  2JPC A;  2CQK A;  2FBK A;  1Z9C A;  3H3Z A;  2O03 A;  3FX3 A;  1S6L A;  2CWE A;  4YIF A;  3CTA A;  1I6X A;  2IA0 A;  2CSO A;  1OMI A;  1K78 A;  2Q8K A;  2P6S A;  3M8E A;  4O6J A;  2VOD A;  1O7L A;  1UHW A;  1F9N A;  4HDU A;  1WI9 A;  2HKO A;  2JSC A;  2RQP A;  4RGX A;  1YS6 A;  5E8I A;  2VE9 A;  3KEQ A;  3CO6 C;  4YG2 F;  2QUF A;  4HV5 A;  2GXB A;  1HBX G;  1T6S A;  3SQN A;  1KYW A;  4UVB A;  5K5R A;  3FXU A;  5D6F A;  3WGG A;  1W7P A;  2VT3 A;  3HOS A;  4UV8 A;  1KGS A;  2K02 A;  1V3F A;  1UB9 A;  4FX0 A;  1FWZ A;  1TW3 A;  1WQ2 A;  4B09 A;  4LLL A;  4HZF A;  4WF2 A;  5HOO A;  1LEB A;  2XV4 S;  1FYK A;  3QPH A;  3ZMU A;  3ZP5 A;  2IW5 A;  4UUV A;  1R1V A;  1BIA A;  3DF8 A;  2PQ8 A;  1QNT A;  2J5P A;  2W85 A;  1LB2 A;  1GXQ A;  2XKO A;  5CJ9 A;  3CUQ A;  3DP7 A;  1ZH5 A;  4G7Z F;  1LDD A;  1IZ1 A;  2ZO4 A;  3KZZ A;  5ICF A;  2ZJ2 A;  2HYF A;  1FX7 A;  3WU1 B;  4RGR A;  3HYI A;  1PDN C;  1P4W A;  2DQR A;  1FSE A;  2KRF A;  1BC8 C;  2FOK A;  4OIQ F;  2CYY A;  4HW0 A;  1XDS A;  4YFK F;  5ILU A;  3VFZ A;  3RJP A;  2ISZ A;  4WWC A;  4P55 A;  1ZHF A;  2K7L A;  3L09 A;  2BV6 A;  2NNN A;  3JW4 A;  4MTE A;  3MZY A;  4G6D A;  5JVT A;  5D4S A;  3COA C;  3ZMT A;  1BN5 A;  4NHJ A;  3IWF A;  4RB3 C;  4EJT A;  2UZK A;  2OQR A;  5LRS A;  4ENK A;  3LA7 A;  2M8E A;  2Z9O A;  4R1H A;  2J5O A;  3SXY A;  1R1T A;  1O3T A;  4XSX F;  2CO5 A;  1ZRE A;  4LMY A;  3EQL F;  3T8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...