1HDPA

Solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
RRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCT-2 POU HOMEODOMAIN
publication title Solution structure of a POU-specific homeodomain: 3D-NMR studies of human B-cell transcription factor Oct-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hdpA00
2NVTJ 3GTQJ 4JX6A 4UUSB 4XK4A 2E19A 5IYBJ 3JRAA 2NVQJ 4A3CJ 1MBKA 5IOZA 2DA1A 2JWTA 1HDPA 5IOYA 2H1KA 4AC0A 3HEFA 1F43A 3Q3SA 2MGQA 2L7FP 2LR8A 1VFCA 1WH5A 2EZIA 2DA2A 3HOUJ 3BTCA 3S1MJ 3BR0A 1RPWA 4S0HB 2R93J 3C2BA 4J19A 1AKHB 1FTZA 4B4CA 5GPAA 1JT0A 1WPKA 4BXXJ 2HDDA 1MH4A 4RDUA 3TW7A 5E3OA 3JRCA 2NS7A 1CQTA 3JR9A 1B8IB 3CQZJ 5K7ZA 2NVYJ 1W0UA 3O8HA 4I6ZA 3IV5A 2DTZA 2OF7A 2PMZN 4JX5A 3O8GA 1IV6A 1U9OA 5EZHA 4AUXA 3RZDJ 2CU7A 1JJ8C 3HKZN 4A3MJ 1T56A 4X6AJ 5FKOA 2VKVA 1YRNB 4BKXA 3MKLA 3FK6A 2LP0A 5M5XJ 3BTIA 1MBJA 1NTCA 1OJLA 1WI3A 4D7NA 2L7MP 2ECCA 2ZB9A 4A3BJ 4RBOA 2M0CA 3IH4A 5DTDA 2M8GX 2HOTA 1P7JA 2ME6A 2IBDA 2GBYA 5EG0B 4IHWA 1GVDA 1Q1VA 1JTXA 3G1MA 3ZQIA 5EDNA 4A3GJ 2YUSA 3ZQGA 1ZKGA 4FCYA 1X58A 3HB9A 1TWHJ 4W1UA 1IDYA 1A6IA 1JT6A 4EEFG 1HCRA 2DMUA 5F27A 1FTTA 2LLKA 3VPRA 4GFBA 5M3MJ 2R5ZB 2QCOA 4L5EA 2O8KA 4A3KJ 1R9TJ 2CQXA 5IP6A 2W48A 3JRIA 4C2MJ 3H3VK 4IHYA 4A3IJ 5E3LA 1LFBA 4X1EA 1AKHA 2R5YB 3BG9A 5FKLA 1U78A 2DN0A 5EF6A 1UHSA 5M5WJ 2P81A 2M2EA 3A03A 1MBEA 3PM1A 3TW6A 4D7MA 4C3IJ 1FEXA 1I3QJ 1B8IA 4MLOA 3BTLA 2DA7A 2QF7A 3K7AJ 4D5CA 2VUMJ 1SFOJ 2FQ4A 2R0QC 3LOCA 1IC8A 2JJ7A 5FJ8J 4M3FA 3ZQFA 1H88C 3A01B 2CRGA 1RKWA 1YRNA 3S14J 3A02A 2HYJA 1ETYA 3BQYA 3S16J 2Y2ZA 4CYCB 2COBA 2Y30A 5IYDJ 4FE7A 5C4XJ 2L0KA 4V2FA 2AHQA 3HM5A 3GTGJ 1H8AC 2CUEA 2H8RA 5IYCJ 3CCYA 1ZK8A 2LKXA 4W97A 3WHCA 5IP7J 1JUPA 2KT0A 3F0CA 3NAUA 4NDLA 5F0FA 4Y52J 5EG0A 1ZR4A 2HQ5A 3HBLA 5FLMJ 5E3NA 2WAQN 2EZLA 4BY1J 1X2MA 5GP9A 5F04A 1K61A 4XRSA 5F0HA 4A69C 2LFBA 3JRGA 2JK3A 5C3EJ 2EH3A 1NK3P 1ETQA 3BG5A 3LSGA 1IUFA 5FKKA 3ZQCA 2JA7J 3BQZA 4BBSJ 2MSYA 4MFDA 4A3LJ 2EBIA 4JYKA 4HNVA 1GDTA 2LY9A 2RAEA 3TP3A 2R5ZA 1FIAA 5GPCA 4B1RA 5EZGA 3ZOBA 2L7ZA 2VPRA 3Q0VA 3JRHA 4JX4A 2NS8A 3MN2A 2ELKA 2B63J 1DU0A 2R5YA 1F36A 3S1RJ 4BY7J 3SFIA 1ZQ3P 1O4XA 3PO2J 3LSPA 2WV1A 4MIMA 3HOZJ 5DS9A 3HOYJ 3OSGA 4MO7A 3S17J 2E2JJ 3GTOJ 3B6CA 2FD5A 4IHVA 4QIWN 2L9RA 3LNQA 9ANTA 4DYCA 5JLWA 4ABZA 1ZTRA 2GLOA 1G2HA 2ID3A 1MSFC 4AYBN 3FISA 5J3LA 4LOCA 5FKMA 3A01A 2N8GA 1OCTC 2XPUA 2NVXJ 5K7FA 3MVPA 3S1QJ 2X6OA 3BT9A 1OCPA 1LFUP 2YS9A 4CYCA 4IEJA 3IH3A 4BBRJ 1ETOA 2G0EA 3G1LA 4M3DA 4DZPA 3LSJA 1JUMA 1QVTA 3OOUA 5BNGA 2CQQA 4UUSA 1B72B 5EYRA 2OPTA 3FIWA 1RETA 1EF4A 1MBFA 3HOWJ 3Q0WA 2DMPA 3CDLA 5FLVA 2DJNA 3OIOA 4A3FJ 3M3YJ 4XRMA 3DEWA 3JRFA 1IJWC 2M34A 4M3EA 2IEKA 1LE8B 1VI0A 1Z0XA 2K9QA 3CMYA 2IAIA 1TWCJ 1IRZA 3JREA 4D5FA 5C44J 2LVSA 2Y9ZA 4FTHA 3D1NI 1QVUA 1XC5A 5J1YA 2ECBA 4FISA 2DA5A 2HOAA 2Y0SN 2DA6A 3B6AA 2DMTA 2XGEA 2K9NA 2E2IJ 1QRYA 1SANA 2AO9A 2TCTA 1BW6A 2XPVA 5J1UA 1PUFB 4I76A 4B3AA 1NK2P 1WCMJ 2HXOA 3HDDA 1I6HJ 1GV5A 1ETWA 3PO3J 3OSFA 1ETKA 2X48A 1ETXA 1DU6A 1RESA 1BJZA 5FKNA 3HGYA 3GBGA 2I10A 2VKEA 5F1JA 5IPAA 2O9LA 2XGCA 1RKTA 3HOXJ 4V2GA 2DA3A 1JJ6C 3FKIJ 1ITYA 3JRBA 3LSRA 1Y1WJ 1TC3C 4DYQA 5C4JJ 2HOSA 5HODA 3H0GJ 3GTJJ 3GTPJ 1XG1A 2EZKA 3BR5A 3GTKJ 2XGDA 1WH7A 1UG2A 4MFEA 2DMNA 2XRLA 2HI3A 3BR1A 5K7HA 1HLVA 4JP0A 4DYRA 3S1NJ 3NARA 1B72A 3L1PA 2JA8J 2VI6A 2X9DA 3SJMA 5EGOB 1BA5A 1MNMC 2GM4A 2JN6A 4QSHA 1JKOC 1Z77A 4M3GA 2MG4A 2KDZA 5M3FJ 4A3DJ 2EZHA 2LTPA 2Y31A 3BR3A 3WHBA 2NOGA 2M9HA 3BTJA 3ZQHA 1X2NA 1LE8A 1ENHA 2XB0X 2XB5A 1TWGJ 2DA4A 3IH2A 1MBHA 3HOVJ 1FIPA 1P7IA 1QPIA 3HGGA 1Y1VJ 3W6VA 2DMQA 4UUTA 4XRSG 2XSDC 4IHXA 1HDDC 1PUFA 5EEAA 3G1OA 1ETVA 1ZGWA 1BW5A 2MW8A 1JKPC 2K9SA 3RQIA 3K2AA 2O7OA 1IDZA 4XICA 2D5VA 3S15J 1POGA 1APLC 1AU7A 1GV2A 1A5JA 2LK2A 2YU9J 1OFCX 2WB1N 4M3BA 2JA6J 3M4OJ 1FJLA 2E1OA 3TEDA 1ORKA 1E3OC 1U8BA 1H89C 1I50J 5M5YJ 1HF0A 2JMWA 1IGNA 2JA5J 5F08A 1ZR2A 1TWAJ 2ID6A 1JTYA 4Y7NJ 3DCFA 1AHDP 2ME0A 2R7ZJ 4A3EJ 1JUSA 4A3JJ 3BR6A 1W0TA 1MBGA 4C3JJ 4G12A 2K40A 1RR7A 1BL0A 1IG7A 3BR2A 1U9NA 5EGOA 3I4MJ 3FK7A 1MSEC 1HOMA 5F0CA 2FJ1A 1K83J 3QPLA 3JRDA 1GT0C 2LD5A 3SDGA 3BG3A 2Y9YA 1T33A 2CJJA 3RKQA 4M6VA 1VNDA 3Q0UA 2E2HJ 3ZQLA 1MH3A 3RZOJ 4QTRA 3QQAA 4DW6A 1JGGA 1XS9A 3I4NJ 4XIDA 2FX0A 2TRTA 5JLXA 2R92J 1TWFJ 3TP0A 4C3HJ 2CUFA 5J1RA 3GTMJ 4DZJA 1GUUA 3S2HJ 2EQRA 3E7LA 3S2DJ 4A93J 3GTLJ 5IP9J 3QPSA 1D5YA 2XPWA 1S7EA 4FE4A 2HXIA 5E3MA 1VF9A 1JKRC 3UKGA 1JKQC 1WGXA 1UMQA
chains in the Genus database with same CATH superfamily
2JRTA 2NVTJ 4XK4A 2E19A 1MBKA 4KNYA 1RC9A 5IOZA 1KU3A 4AVZA 2JWTA 3K70C 5IOYA 3GW2A 4M74A 2H1LA 1MJAA 3HEFA 3RDIA 1U0JA 1F43A 2L7FP 1X3WB 2EFWA 3PNVA 5BPDA 1VFCA 1WH5A 3G3ZA 1A04A 2DA2A 3KP6A 2P7CB 1ON1A 3HOUJ 3S1MJ 4ZZDA 3LA2A 4NQWB 4CCKA 3C2BA 4J19A 4ENMA 1AKHB 4KIFA 3P9CA 1IW7F 4H4KC 4A5NA 1FTZA 4UY8I 5E8IA 2QBYA 4ZTFA 2KHMA 3J80Z 4QPOA 3N97A 2DBBA 4UVCA 4ETSA 2HNHA 3JRCA 1HA8A 3LFKA 2E5NA 5KNLA 1ZYRF 4YIRX 3DPLC 1O3TA 2UXNA 4F93B 3CQZJ 3L2CA 2D1HA 3GFIA 2DTZA 2OF7A 2PMZN 3O8GA 2FQ3A 3J7AO 3I71A 1U9OA 4BAYA 1EKEA 1FBQA 3CCSI 1YIJI 3HKZN 3DLLF 5FKOA 1BN5A 1S3JA 3M8JA 3VSKA 3GLXA 1YRNB 3BZCA 3W6JB 3MKLA 3X2QH 1I3AA 4NC7A 3HG9A 1XDUA 5KHDA 4S04A 3MMYB 4CDGA 3BJ6A 2R3SA 1NTCA 4CCOA 3S3NA 2F5EA 2ECCA 3U2RA 4CUGA 2ZB9A 5JVTA 3CTAA 2HQRA 3DBRB 4KITB 4A3BJ 4A6EA 2EFPA 3RSNA 5LD2C 1P7JA 1YYVA 2BYVE 2K4BA 1G6NA 3MWMA 4BEHB 5H2FC 5E20A 2GBYA 3V4GA 2EA2A 1STZA 5HS8A 5EG0B 1SMYF 4IHWA 3A0HC 2E7WA 4HG2A 4CCMA 3ZQIA 1O3RA 2L9SA 2Y0SA 1ZKGA 3HB9A 3AG3H 4ZYAA 4BJ6C 1OCOH 3ZQQA 2JTVA 2QQBA 2P5LC 4XONA 4LLLA 1Z6TA 2M8EA 2LF7A 3VPRA 2X51A 4IRHA 1ACIA 1U2WA 2QCOA 3CJNA 2V7FA 3CZ6A 4Y15A 2E1NA 4WXHA 4XLFA 4XORA 4EJUA 4O5VA 3S32A 2HKOA 2M45A 4C2MJ 4NNJA 3U1DA 3KE2A 3KLNA 4KT6A 4IHYA 3H3VK 4NQWA 3QPHA 1AKHA 3BG7A 3QP5A 3CMEI 1HXDA 1WJFA 3TW6A 3VYTB 4OIOF 4C3IJ 1FEXA 4LJZF 2QF7A 3K7AJ 4D5CA 2L4AA 1SFOJ 2VXZA 2R0QC 4RGSA 1SVOA 4IJAA 2E1CA 1RR8C 2P5VA 1MKMA 3MD2A 3ZRGA 2Z99A 2KZVA 1RKWA 3EUKL 3RKXA 1YRNA 3A1YA 3S16J 1USSA 2M5WA 3FXOA 4HDVA 1QZZA 2Q0OA 4RB1A 1OQYA 4L5JA 4DIQA 1S9HA 3DU5A 1YJ9I 2L0KA 4ZDPA 3K4MA 3HTSB 3CJRB 1K79A 1R00A 2DLLA 2RQQA 1S72I 1BIBA 4V19K 3WHCA 3D5RC 2FBIA 4BEHA 4KUMA 2JSCA 3T5XA 3NAUA 1FPQA 2K86A 2ZJ2A 3EPZA 1TL8A 4Y52J 5EG0A 3JTHA 2HQ5A 2H27A 5E3NA 1R5HA 1EA3A 2V1NA 4BY1J 1SVMA 1YW7A 3J7AY 2YR2A 5F04A 2UZKA 2LY1A 2CQNA 3P7NA 1KYZA 3BC8A 2MC3A 1B9NA 4XOTA 1R4MB 2VBZA 3DFGA 2EH3A 2E36A 1NK3P 3BLYA 3QWLA 3ZQCA 3OWTA 1WFXA 1XN7A 3PNYA 2EBIA 4JYKA 4HNVA 2RAEA 1R1TA 1FIAA 2HPIA 1XX5A 3DP7A 1TTYA 1RI7A 3Q0VA 2DXIA 4M6XA 1K4SA 4PJNA 3BOQA 2RQPA 2MD0A 1P4AA 3DKWA 3GWZA 3MN2A 4HQMA 1IN4A 4EVIA 3FXRA 1P4XA 2B63J 4I09A 1SFKA 4A6DA 3H5AA 4UV9A 1PVEA 1F36A 3LA3A 3SZGA 4A5MA 1I39A 4EJVA 4GYIA 5E18F 2LDUA 1QU3A 2F6CA 5DM6F 3OYIA 2JA2A 4EV0A 2I8DA 1YJNI 2BHZA 4DQ2A 4MIMA 1BI1A 2WTEA 5GAEJ 2A6EF 2P0WA 1K6OA 1DPRA 3WTYC 3ZMTA 4ESJA 3GTOJ 3B6CA 3CUOA 3KP7A 4A0XA 1VQ6I 2GLOA 2ZJQF 2E5ZA 3FMRA 2ACJA 2NVXJ 1Q1HA 1KQ0A 3CCLI 1OCTC 5FGMA 1IXCA 4PSWA 5JI6A 4PK4A 2LKPA 2GXGA 3BT9A 3U21A 4EGYA 1OCCH 2LMDA 4LITA 1XTAA 2GAUA 4IEJA 4BBRJ 5LHGA 4M3DA 4UHTA 4D1QA 5BNGA 1VQPI 2WA0A 1FOXA 1G3WA 5BMZA 2Y48A 1OYWA 1LDDA 3A4CA 1FSEA 1RUOA 4A0YA 5LLQA 3CDLA 3FF5A 2NAZA 1X4PA 2DJNA 2I5UA 3F8NA 1UCRA 4WXDA 3L2QA 4ZC3A 2LH9A 3JRFA 4AIJA 4M3EA 2KDOA 2ZXWH 3W2AA 4RAFA 4MHGA 2W57A 2B0LA 4XLPF 3E6DA 2IAIA 1TWCJ 1IRZA 2VOOA 5C44J 1QVUA 1XC5A 1Z05A 5J1YA 1R5ID 3ZN1A 2DPUA 2DA6A 2XGEA 5CVJA 2NOJB 1BBYA 2E2IJ 1T98A 1QPMA 3ECOA 4G7OF 4XLAA 3HSEA 4I01A 5TISC 1BW6A 2ZC2A 2QLZA 4HX8A 3W2WA 3WE2A 1PDNC 3ZN0A 4N4OB 3L7WA 4XNFA 4S05A 1R1UA 4KA4A 1WCMJ 3R4KA 4ITVA 2FNAA 2HZDA 1ZLKA 1Y6IA 3K0LA 2X48A 4HAMA 4JQFA 1ETXA 3ELKA 4C30A 1S5LC 3HUGB 3OY9A 1RESA 3U1KA 1W36D 3H9GA 2LF8A 4FQGA 3EYIA 3GBGA 2A68F 3IUOA 4IPAA 5D8KB 5F1JA 2J5OA 4BQAA 3HOXJ 3BPVA 1QNTA 3CC2I 1Z6RA 2DA3A 3I58A 3FKIJ 3JRBA 3LSRA 1TC3C 2HOSA 5C4JJ 5HOOA 3H0GJ 3GTJJ 5B1AH 3DKYA 3L2VA 3TO9A 2EV5A 2JUGA 4Y3OA 2LNBA 2XGDA 4HV5A 4BL0B 3ASOH 4X0GA 4R79A 2R7VA 4MFEA 2HI3A 2QQAA 5K7HA 1G59A 3SQNA 3QOPA 4DYRA 3I55I 3FHZA 3NARA 1I1SA 4MEYF 4U87A 2JA8J 2VI6A 3SJMA 2QKLB 2DK5A 5J6XA 2QQ8A 4QSHA 4LLGF 2OQGA 1R36A 4A3DJ 2BY3A 4TV7A 2LTPA 3GO5A 4B43A 3FX3A 4M9SA 2M9HA 3KP3A 3BTJA 4Y4RA 3ZQHA 4IRIA 2MH9A 5KVRA 5HDKA 2G7UA 4IRGA 3CCVI 3HOVJ 1FIPA 1P7IA 1W5TA 3RKWA 2W85A 2A6HF 2A61A 1R22A 1YW9A 1U5TC 3W6VA 2OU2A 2FNPA 4N9HA 1KZHA 2HTJA 1W36C 3HZJA 1LVAA 4Q48A 2V6CA 5EEAA 1ETVA 2F5VA 1H9TA 1YE9A 2KLOA 1X1CA 2IP2A 4MTEA 3ABUA 1LPQA 3DTEA 2F5DA 3S15J 3DKXA 1GV2A 5GAHJ 4RB2C 4BE0A 2YU9J 3HUGA 2WB1N 4UUVA 3DBLB 3OYAA 5E1WA 3ZGKA 1L3LA 1OMIA 3TDZC 1QHHD 3P5JA 1YQAA 4L9VA 1MMNA 1Z67A 3H9JA 3FXUA 3BP8A 5CLSA 1FJLA 2Z33A 1VQOI 2EPFA 3JSPA 2IVMA 2KIUA 1ZARA 2K02A 1LDKB 2JA5J 5CVUA 5F08A 1ZR2A 2ID6A 1IRGA 3DCFA 3TO7A 1KU7A 1D0ZA 1LQ1A 1JUSA 2VQCA 3ESWB 4NB5A 3BR6A 3IC7A 1IO2A 3SXYA 3F6VA 2HR3A 1WJBA 3FM5A 3ABMH 3FK7A 3HRMA 5H6QA 2ZJPF 2V6EA 5F0CA 1KQ8A 3OV8A 4LG3A 1T08B 3M1CA 3J7YJ 5JHFA 1QZYA 2EINH 3HRSA 4ZTJA 2Y9YA 2QVOA 2V4JC 1Z7UA 1MGTA 1VNDA 3MZHA 4AIHA 3SDBA 2ZXJA 1B4AA 4B44A 3IWFA 1BC7C 4Q5SF 3R6SA 3WTVC 3HSFA 3QQAA 3CCEI 3WU0A 3DLAA 2TRTA 1I6XA 3TMOA 3LFUA 4LK0F 5JLXA 2HQAA 3FKJA 3FDYA 2WAEA 1MNEA 3TP0A 3O3KA 4C3HJ 3EUHC 1KGSA 3TOAA 1GVJA 1KA8A 4OIRF 1ZG3A 4M73A 2J5PA 1UAAA 1K6YA 4EJWA 2MH2A 4KIGA 4IX7A 2WAQA 3CDIA 3ERMA 2KRCA 1Y8QB 4A2UA 2DT5A 6PAXA 3FZVA 3D5SC 1X4OA 1R49A 4XSXF 5EEHA 2PJRB 1LJ9A 1Y0UA 2RGVA 3ZMSA 2EFOA 4ON0A 4M9ZA 1S8NA 2HXIA 2ZO4A 3FBNB 1VF9A 1S7AA 3UKGA 3D5LA 1JKQC 4KDPA 4HNUA 2DU9A 1KYWA 3FXKA 1BM9A 1ZG1A 3ISPA 3RI4A 3GTQJ 3M1EA 4UUSB 2G9WA 2JZYA 4A3CJ 2OAZA 2VB6A 2XAGA 4YFXF 5CQGA 5D6FA 2DA1A 4HQEA 3HHHA 2R7FA 1HDPA 5K5RA 2EB7A 3RYPA 2H1KA 2W7NA 1BC8C 2MGQA 3DPUA 5EJCA 2EZIA 2JVHA 1IN7A 4S0HB 2GXBA 2VKHA 3CESA 1UG0A 3GZ5A 1RIOH 3ABTA 3E5QA 2FU4A 2KMUA 3CJQB 4LGWA 1U3EM 2HDDA 3F6OA 3K2ZA 1YHQI 2EWNA 3TW7A 1MMGA 3JR9A 2X1CA 4HOBA 1D0XA 2VC1A 4DBRA 2Z3YA 1G8XA 5KAFC 4UVBA 1R71A 3O8HA 3ASNH 1HSJA 3HPHA 2LSOA 2KJBA 1IV6A 1W5CC 3J7ZI 4XKWA 3NWSA 1TW3A 1R7JA 1X1AA 3F9KA 2STTA 5J40A 4MEXF 2B9SA 4HSRA 5LRRA 3FK6A 1QO0D 1OYYA 1MBJA 5HDNA 1F5TA 1Z9CA 2VT2A 5L3CA 1LEAA 2KIQA 1BR4A 1EH8A 4CYDA 3BDDA 2M0CA 4BHCA 5CPRB 5DTDA 3I59B 1MMDA 2DDBA 3PJRA 3VYRB 5KAIC 2LY2A 4XBFA 4HV6A 1Q1VA 4II2A 2MD5A 3RYRA 3JCUC 2PJRA 4HBLA 1TQPA 1SAUA 2V9KA 5HVQC 5EDNA 2YUSA 3ZQGA 1ZAOA 4FCYA 1X58A 4DGWB 4W1UA 2KP6A 1OR7A 1IXSB 2DOFA 3P9KA 2IT0A 4D9JA 2HWVA 4PGHA 2L02A 2DMUA 4O6JA 1A35A 3K70D 4GDFA 4JK1X 4B48A 2BE5F 3CCUI 1XMKA 5M3MJ 2DYRH 2O8KA 2H8WA 3LA7A 5IP6A 3TO6A 1B1BA 2IA1A 4A3IJ 1T6SA 3QPTA 5E3LA 1X1DA 2H94A 5L3GA 3OYEA 4GGGA 3K4BA 2AQEA 5FKLA 4E6KG 3UNGC 2VE8A 3KYDB 3AKZA 3H36A 3GLLA 2PI0A 1T38A 2OJED 2LREA 2M2EA 3A03A 3GF2A 1BIAA 2OD5A 5GADJ 3JW4A 5J4VA 2EJRA 3KZZA 2ISYA 1HKSA 3BTLA 3KZYA 3BG6A 2FQ4A 1FY7A 4RM2A 2FUG2 1XGOA 1F9NA 2ZSIB 1FOYA 2XAQA 3OL4A 4M3FA 3ZQFA 1H88C 1FMWA 2PMUA 2XSJC 4HF2A 2EA4A 4EMSA 1U6GA 2FOKA 1V55H 3F3XA 3ZMZA 2DAOA 2W24A 2CV1A 3A02A 4AU7A 1ETYA 5ILVA 3BQYA 3OIPA 1FP2A 3CLOA 4E7SA 3M8FA 5DCMB 3F8MA 2ZFUA 2R7WA 1QBJA 1LVKA 5ICEA 3GVAA 4V2FA 2VQHA 2AHQA 4L9NA 1G3TA 5IYCJ 5HS7A 2XGXA 1ZK8A 3OIQA 5L3DA 3RPUD 5IP7J 2YU3A 3I59A 1JUPA 4AIDA 3COAC 3F0CA 4BE1A 3B02A 1AWCA 1O57A 4PJJA 2R7QA 1UELB 3G6EI 2DYSH 4NBQA 1FX7A 3C3WA 3FBIB 3SYTA 2GZWA 3JRGA 2JK3A 5C3EJ 3H5RA 1R5GA 1ETQA 3L9FA 5L3EA 1IUFA 1YS7A 3S3MA 4RGUA 2EV6A 2PMZA 2NNNA 4UNOA 2ELHA 3GFMA 3BZ6A 3TP3A 1JGSA 1HQCA 4EM1A 2HYGD 2L7ZA 1A36A 3CP8A 4I7HA 3MZYA 1FLIA 2NS8A 3L09A 5IT9K 4I0BA 3ZMVA 2V9VA 3GMEA 1O4XA 1TW2A 3PO2J 5JR3A 5LHIA 1MMAA 1YW8A 2VASA 1EH6A 3GFJA 3LSIA 2XAHA 2GA2A 3GYHX 2GQQA 2E2JJ 3AFHA 1YTYA 2FD5A 4YFNF 4QIWN 4HF1A 4IHVA 1WRJA 4IHSA 2FBKA 1G2HA 1ULYA 2WC2A 3KPHA 4LOCA 1YOVB 3OYGA 2XPUA 3F23A 5K7FA 2XAJA 2PMHA 1S29A 3FM3A 4NHJA 1OCPA 1OR7C 2YS9A 3QU6A 2HFHA 5DCMA 1BOBA 1YX3A 2K85A 2G0EA 2XUBA 2O5RA 2XASA 1JUMA 4BXUA 2R4GA 4LD5A 4U0VA 4BDZA 3A2KA 2CQQA 5DM7F 4G8XA 1ZREA 1EF4A 1MBFA 3HOWJ 5BS6A 4CCNA 2OQRA 3Q0WA 1J9IA 4F52A 2RN7A 5FLVA 3QAHA 4GXOA 1WI9A 3BCBA 1D0YA 4XRMA 3DEWA 2X85A 4HRIA 1IJWC 1K7AA 2F5FA 4ZDOA 2E7XA 2M30A 2XKOA 4WCGA 2EV0A 3JREA 2LVSA 2Y9ZA 2KJCA 2EFQA 1VQNI 1SD6A 4FISA 5B3SH 5D5UB 2CUJA 1LB2A 2KRHA 2HOAA 2Y0SN 4MQVA 4ZZLA 1QRYA 2O3FA 5E1XA 1T8IA 4ZYDA 1SFXA 1U5TB 2Z2SB 3JSOA 4WXCA 4OIPF 2TCTA 2XPVA 4G94A 2WBMA 5LEKA 3S93A 2DO7A 1NK2P 2A6TA 1T0FC 3E3VA 1ZGJA 1LUJB 4KISA 3PO3J 5E1ZB 2OZUA 5H20A 3DQVC 4UB6C 1V5FA 2BZTA 3W6KB 3QOEA 1DU6A 2F4OB 1MDMB 1DP3A 3CCMI 2KL4A 5IPAA 1Z3XA 1PP7U 2GXAA 2O9LA 2BVMA 1T2KA 2MC4A 2RNGA 4RLFA 1OKRA 3EDPA 1FWZA 1V5GA 4E4HA 4OMYA 5FD6A 4BACA 1IAWA 3WTSC 1I27A 2YSRA 5HODA 5KCMA 4BGDA 3GTPJ 2EZKA 1KONA 3I54A 5E79C 5F64A 2DODA 2FMYA 1UG2A 3LSTA 2Z5UA 1HLVA 2PQ8A 3S1NJ 2XF5A 3QYBA 2CWEA 2W00A 4ANJA 3L1PA 5EGOB 1S7OA 5D6EA 5AIPA 2JN6A 3PQKA 2LC2A 2PLYA 4IOAF 1Z77A 1UJ8A 2MG4A 4WK8F 2KDZA 3F22A 2EZHA 2OA4A 5EEGA 3V8KA 3GCMA 3CUQC 3TKYA 1X2NA 1DP7P 4ENNA 2CW8A 1ENHA 2KQRA 2XB0X 1WKMA 2DFIA 2IJLA 1UHWA 3E97A 3VYUB 4WWCA 2VOPA 1DGWY 5CVRA 3ABLH 2ZXHA 4RAYA 4OU0A 5CYVA 3HGGA 1ZH5A 3EETA 4BNCA 4L0ZB 5J8CA 2DMQA 4XRSG 3CC4I 2FF4A 1U5TA 1HDDC 1JHFA 1NG7A 4N4NB 4PFPA 2L01A 5DD4A 4UB8C 3G1OA 3FMQA 1A31A 2K27A 3C7JA 5ICFA 4GO1A 1BW5A 2MW8A 1JKPC 4RGXA 3RQIA 2O7OA 1FC3A 2JVGA 2HVQA 4I99C 1G3YA 3N05A 2XF6A 3OYHA 2D45A 1IN8A 5TGTA 5D4RA 2CSOA 2WY7Q 1MDMA 1YLFA 1W5SA 2PEXA 5LBQA 4M3BA 2HPMA 3CCQI 4AVPA 3M4OJ 1GLNA 2DDAA 1HKQA 2E1OA 5DUIA 3W3CA 1N75A 3TEDA 4LK1F 2CFXA 3PSFA 1BR2A 2WAFA 3L00A 4YIIA 3PFIA 1SAXA 2JMWA 2EIKH 4NC8A 3WU2C 3DEEA 4OOIA 4BQOA 5DYMA 2ICWG 4PUSA 4LMYA 1ZRCA 3HC7A 2R7ZJ 4A3EJ 1N77A 1OPCA 1W0TA 1MBGA 1Y39A 4G12A 3AL0B 2OTJI 1WZ2A 1IG7A 3CCJI 5EGOA 4F55A 2VE9A 3VSLA 4CXFA 2X4HA 3GEZA 3M07A 3KYLA 2RNJA 2VODA 5DV5A 3Q0UA 3ZQLA 4BQNA 1MH3A 1XD7A 2ADUA 2CYYA 4L18B 4QTRA 2DQRA 3U9GA 4LG0B 3A0BC 3NQOA 4D0PA 2FX0A 5FFZA 3ZP5A 4XKVA 4IF4A 2D1VA 1JI8A 3MKYB 4K2EA 1E3HA 4ZDLA 4FX0A 3GZNB 3CMAI 2VPLA 2GIZA 1AOYA 4LIUA 5J1RA 4P55A 3OL3A 2M0MA 2PG4A 3EUHA 1ON2A 5K1YA 2EQRA 2MYSA 3DTKA 2AS5F 1ZRFA 3I0TA 3MEXA 4ZJZA 2A07F 2CO5A 1XSXA 3TL4X 3H3UA 1ZGAA 5TJJA 5IP9J 3MZ8A 3QPSA 1D5YA 4DJAA 4NUBA 4FE4A 5GTIC 2EIMH 5E17F 2BY2A 1WGXA 1J75A 1UMQA 5ICGA 1K78B 2GWRA 3JRAA 2NVQJ 3DEUA 4KYWA 1OCZH 2FXAA 3TQNA 1NHAA 2HDCA 3DBHB 1Z91A 4RAZA 3BPXA 3Q3SA 3S8PA 2W1OA 4N9IA 1D1AA 2IPQX 4BQQA 3BTCA 5FLXZ 2R7XA 1IUYA 2R93J 1BI2A 4AM3A 5BQTA 5GPAA 1WPKA 4RA2A 1L0OC 4RDUA 2GOMA 1E17A 1JHHA 2X6XA 3CLQA 3LSHA 2NS7A 4R8HA 4FHTA 2X1EA 2ZCWA 4AYBA 1FYMA 1B8IB 2LG4A 3WTXC 1MJBA 5K7ZA 2VBYA 2QA4I 2NVYJ 2E34A 2VJIA 2VJJA 4CZCA 1YITI 1W0UA 2ESHA 3HSRA 2ZNYA 3V8LA 3DWLE 1J7KA 3IV5A 3I9V2 4JX5A 1OLTA 4J00A 1O7LA 2LYCA 3K1MA 2WWYA 2IGMA 1QHGA 1JJ8C 4A3MJ 4LG0A 1V3FA 4X6AJ 4YELA 2VKVA 1E2XA 1I5ZA 3Q9VA 1VQLI 5M5XJ 5IT9Z 3BTIA 4XRFA 1AA7A 4XLCA 1D8KA 2BY1A 3F8CA 3K9TA 4XLEA 5IY5H 1ONVA 3I5UA 1IXRC 4D7NA 5LRSA 2CS3A 4RB3C 4WX9A 2YX4A 3IH4A 1FOWA 2M8GX 2HOTA 4HNTA 2QZ8A 3TBIA 2ME6A 4Z6YA 2IS4A 2EK5A 3ZMDA 5LGUA 2Q1ZB 1JTXA 2WADA 5L3BA 3K1NA 3K10A 3R60A 4CCLA 4Y17A 2O6GE 1IDYA 1JT6A 4PZJA 1HCRA 1E3PA 5ED4A 3KEQA 1K78A 3IL2A 2DK8A 2EFNA 4BE2A 2FRHA 1MMSA 1IRXA 1FTTA 4IVNA 2LLKA 1VQMI 4I0AA 4GFBA 3GXOA 2R5ZB 4L5EA 2V1DA 1WJEA 4A3KJ 3K4NA 1R9TJ 2GA1A 1CGPA 2W48A 1B6AA 4UXNA 4G6DA 3KFWX 3TGNA 4X1EA 2R5YB 3BG9A 1V4RA 4PJLA 1U78A 4XM3A 5EF6A 5M5WJ 3HXLA 2P81A 3R0JA 2MLKA 3VOEA 1MBEA 1I3QJ 4XQFA 4RMNA 4IZZA 4U7DA 1B8IA 2DA7A 2JSPA 2VUMJ 5J47A 1ZN2A 1IC8A 1Z21A 5FJ8J 3GZ6A 2DTRA 2CRGA 1FP1D 2HGCA 1ODDA 5TRDA 2QSHX 4F7ZA 1XCBA 2HYJA 4Q47A 3E5XA 2Y2ZA 1SFEA 3K4CA 4CYCB 3LMMA 3IRRA 5IYDJ 3QRFF 2DOAA 1FYLA 5CJ9A 3WTUC 2ZNZA 3HJEA 5BPIA 2QQ9A 3IRQA 2CUEA 1P9QC 3CCYA 5FFXA 2HVSA 1SD4A 4KFCA 3ZMUA 5CQEA 4XSZF 2CV0A 4IHTA 4HDUA 5F0FA 4EM0B 2DFEA 2WAQN 3I4PA 2EZLA 3RIRA 1K61A 4XRSA 4KN4X 4A69C 2LFBA 3AL0C 2VN2A 2IA0A 4CICA 3BG5A 3LQRA 1N25A 5FKKA 2QSFX 4RS8A 2JA7J 3O2PE 3RQ4A 5ERIA 4L0YB 4XN0A 1YI2I 4GRIA 4LB5A 1RUNA 1GDTA 3FMSA 2A5YB 2LY9A 2R5ZA 1BR1A 2NVUB 4N0BA 5EZGA 5J8FA 2UWMA 2UXXA 3RKYA 2R5YA 5A2QK 3S1RJ 4BY7J 3RPQA 2OUMA 2DT6A 2X6YA 2Z16A 3I53A 5DD8A 1HW2A 4KMUX 1C0WA 1GHCA 2BBYA 2WV1A 1HSTA 4NC6A 4CH7A 3KP5A 4G7HF 2A69F 2CMPA 4BXFA 1VQ5I 4XL9A 1G3SA 1P4WA 4MO7A 1WJDA 1DQUA 3S3OA 4M71A 1FBSA 3KP4A 2VBXA 2L9RA 3LNQA 9ANTA 4DYCA 2V1XA 4ABZA 1J0RA 5JLWA 1MSFC 3G71I 2ETHA 2Y0MA 4HSTA 2XKPA 2N8GA 2VIXA 2IGNA 2QYOA 3MVPA 3IWZA 3WODF 2RVCA 3RPUA 1MW7A 1LFUP 2QEXI 2DW4A 2HS5A 5LEJA 4CYCA 4MGRA 3MCZA 3IH3A 2GIVA 1ETOA 2P6SA 2VXDA 5JVGF 3SEQA 4DZPA 1M1EB 4A12A 1R4NB 2EILH 1QVTA 4CZZA 3ML6A 1XPXA 4XLHA 4UUSA 1B72B 2E1MC 2OPTA 3FIWA 4RGRA 2F48A 5H6RA 2P7VB 2QWWA 4WF2A 5ILUA 1X1PA 3V42A 3LWFA 4YRVA 3OIOA 4A3FJ 2FSWA 2CGPA 4B8XA 2F4MB 1RZ4A 2TDXA 3DPTA 1E0EA 1YJWI 1LE8B 1VI0A 2LOOA 3CUQB 5CVIA 4UVAA 4D5FA 2KRFA 3PUFA 1ERDA 3PSIA 1I1GA 2OBPA 2DMTA 4PCQA 2ZJRF 1SANA 2XVCA 4ZYGA 1T39A 3OYKA 2PFBA 2HU9A 1PUFB 4DOZA 1O3SA 1VQ7I 3VWBA 2CW7A 3AAFA 5D5WB 3V8JA 3KZIC 3R61A 2QUFA 4PDKA 3HDDA 3OSFA 4M9XA 1Z3YA 2L54A 1T0FA 3KEOA 3ZR8X 4YIFA 3HHGA 1BJZA 3GUDA 5FKNA 5E8GA 5HNHA 1H0MA 3HGYA 1XMAA 4HX7A 4XMYA 2VKEA 4QWQA 4G6QA 3H9QA 5L3FA 1F1ZA 2MBFA 3CF2A 1JJ6C 1ITYA 3K4KA 3L2RA 4KIBA 5FLXK 1Y1WJ 4DYQA 3VYSB 1FBUA 1MNDA 2L2OA 3BR5A 5LGTA 2E71A 2JT1A 2VJ4A 3GTKJ 3WE3A 3K6GA 2NRAC 5CKTA 3K4JA 3HRUA 2DMNA 2XRLA 1MZBA 5GTHC 2AXTC 3W2VA 2K9MA 4BUPA 1B72A 1DUXC 3DXJF 3HKZA 2A05A 1SVLA 4DNCA 1EV7A 2L9VA 4FX4A 4HLXA 3JTGA 3G4SI 2DFHA 2M87A 1IZ1A 1VQKI 1LE8A 4LFUA 2DA4A 1SD5A 4MTDA 3T8TA 3CUQA 3IH2A 3PUBA 2M1BA 4OMZA 4IKFA 3OR2C 2JUCA 1MBHA 4BS9A 1QPIA 5BOXA 1SC7A 1EJ9A 1HW5A 1XGNA 1CF7B 3F8BA 3WGGA 4CO8A 1YS6A 2YPRA 2ISZA 4HF0A 3Q9SA 3SZTA 3K1PA 3V7RA 4UUTA 2L9NA 4IHXA 4IXAA 3NWTA 1P92A 3QP6A 4EM2A 4U88A 5HLGA 2DJIA 2DQLA 4EJOA 1XGSA 1PUFA 1W1WE 3OYNA 1A6QA 4PSXA 2C6YA 5B5EC 2JPBA 2G7HA 2K9SA 3LSMA 3H5NA 5B66C 4U7BA 2Z9OA 4Z2YA 4XICA 1KU9A 1IDZA 3CO6C 1POGA 2BOLA 1Y56A 3CMMA 1AU7A 1APLC 2XV4S 1J5YA 2QENA 3N4MA 4C2TA 1IN6A 1OFCX 1TQMA 2BVLA 4E7KA 2JA6J 2P5KA 3BZKA 4OIQF 4LIVA 4XKBA 2FA5A 2IW5A 1E3OC 4G6TB 5M5YJ 1HF0A 3NEUA 1IGNA 1WHUA 3H35A 4H0EA 1R1VA 3NRVA 4IL6C 4RM3A 1XSVA 2PX9A 2RV8A 1JTYA 4Y7NJ 1TZLA 2ME0A 4I02A 1VTNC 4A3JJ 2PJPA 1Z7LA 3VB2A 4U0YA 1RR7A 1BL0A 4E7HA 1U9NA 3RTRA 1TT5B 3ZCOA 1MSEC 2ZBKA 1HOMA 2L5QA 3WTTC 4CHUA 1K83J 2KPMA 3JRDA 2LD5A 5AIQA 1H9GA 2RDPA 3FXMA 4RAGA 3K69A 1T33A 3MAJA 2OV7A 4BJ5C 2VKDA 1IN5A 1W4MA 2HVRA 3RZOJ 2XF7A 1XS9A 3I4NJ 4XIDA 4ESFA 2M7AA 2ZXIA 1W7PB 1TWFJ 1CF7A 4UV8A 3SHFA 3HOTA 2CUFA 1FSHA 4KN7X 3GTMJ 3AG1H 4DZJA 1TP4A 3S2HJ 2NYXA 1D8JA 1JE8A 2KIFA 3E7LA 1O7FA 3S2DJ 2XROA 4A93J 3GTLJ 3C1DA 2UUZA 5DUKA 2MA3A 2OCEA 1J2XA 3HTUA 4P9UA 3OYMA 2V9PA 3KETA 3OYBA 3UR3C 1P6RA 4JBAA 4JX6A 5IYBJ 1XB4A 4ENJA 2H6CA 1X19A 3M7GA 5J4YA 4BDYA 1J09A 3M8EA 4E7LA 2R7DA 4HYEA 3OYCA 3IKTA 3FHNA 4AC0A 4BYYA 2IS1A 1QQIA 1JXSA 2HYFA 2LR8A 4JOMA 4KMFA 2E35A 2KFDA 1RPWA 3BR0A 2K7LA 2A3SA 3KLOA 1X3UA 4RB0A 2IA2A 1YG2A 4B4CA 1JT0A 4BXXJ 4IOCF 4F91B 4XLNF 1MH4A 3BJOA 2QSGX 2VC0A 3C18A 4HA8A 5E3OA 1WQ2A 1X1BA 3KIOA 1CQTA 1PUEE 2X0LA 3K4LA 2FBHA 2DI3A 2L3DA 4EGZA 3I56I 3KP2A 1XMXA 3ZPLA 3PIOF 3IAS2 3AG4H 2ZSHB 3KYCB 2ZFWA 3BY6A 1ZELA 4I6ZA 4CGZA 4Y33A 5LHHA 3T1BA 5EZHA 4AUXA 3RZDJ 2H09A 2CU7A 3EUAA 1PYVA 2BV6A 5D5VB 4G7ZF 1T56A 3O6BB 1FZPB 2KISA 4BKXA 3JAMK 1W7PA 3LQQA 3HPGA 4O3MA 2LP0A 3L2WA 1O3QA 1UB9A 5A2QZ 5DDGA 2JRMA 2VJ5A 1OJLA 1WI3A 2P6TA 3I3LA 2L7MP 2XAFA 2DCEA 1LFPA 3BROA 3EYYA 3GFLA 3KEYA 2BGCA 5JHUA 4RBOA 5LGNA 3SFZA 3H0DA 2HZTA 3MKZA 4OINF 2IBDA 2UV1A 1DDNA 3T8RA 1GVDA 1SD7A 5KK1A 3G1MA 1OCRH 3IKVA 4EQQA 4FETA 2QKMB 2PN6A 4I2OA 4A3GJ 3ZXSA 1EH7A 3VEPA 1TWHJ 4L9TA 1A6IA 4EEFG 3L2UA 3SEZA 1Y8RB 2MLGA 4B47A 5F27A 3WU1B 2A5WA 3ECHA 2V79A 3OS1A 5FROA 2VT3A 2CQXA 3E6BA 2OZ6A 2LBFB 3JRIA 3DU6A 3OS2A 1LFBA 3CJTB 4PJ0C 1OISA 2AQFA 3ONQA 5K5QA 2DN0A 1UHSA 2HOEA 3R0AA 3FWEA 3KCCA 1HW1A 3PM1A 4D7MA 5DCFA 3F8FA 3SZPA 1U8RA 1WVRA 2W82A 2VBWA 4MLOA 2FE3A 2R7OA 5CVVA 2XHKA 1MIJA 4YG2F 3LOCA 1W7PD 2JJ7A 3RCOA 2O61A 3A01B 1WJCA 3V7CA 4CSWA 2L7KA 2LRDA 4FT8A 3MKWB 1G4DA 3FXLA 2RREA 3S14J 2D2WA 5ICCA 1D1CA 1ZRDA 3HOSA 1BI3A 3QYEA 2COBA 2KIMA 2Y30A 2ZMEB 4OAYA 4FE7A 3J81Z 5C4XJ 3TDUC 5D5XB 3GTGJ 3HM5A 1H8AC 2H8RA 4E7ZA 2F5CA 2LKXA 1K4TA 4W97A 2KT0A 4PGGA 2E1MB 4NDLA 2XIGA 3LAPA 1ZR4A 3E5UA 1R23A 1MD0A 3HBLA 5FLMJ 2BXZA 2DPDA 2VONA 3ULQB 4BH9A 1X2MA 5GP9A 3J80K 4YFKF 5F0HA 1QGPA 4U0WA 2R7SA 1P2FA 1RRJA 3LSGA 2JQ7A 3PIPF 1DPUA 1VQ4I 2BHYA 4ESBA 3HYIA 3BQZA 2STWA 5JFRA 4BBSJ 2F4IA 1Z1DA 2MSYA 4MFDA 3PFYA 3WG9A 4A3LJ 5D4SA 1B59A 2K9LA 4YEJA 5GPCA 4G9YA 3ZOBA 1BOAA 3WGHA 4B1RA 1XSDA 2VPRA 2LBFA 3JRHA 2BY0A 1V54H 4JX4A 3OYDA 1FYKA 2ELKA 1DU0A 1B9MA 2WB1A 2Q8KA 4OAZA 4HW0A 3D0SA 1QA6A 2CFOA 3SFIA 2CW0F 1ZQ3P 1FOKA 2EIJH 3LSPA 2IS2A 1UHMA 3VFZA 3IAM2 1YFHA 2V26A 3HOZJ 5DS9A 1BJAA 3HOYJ 3OSGA 4B3XA 2HQNA 3S17J 1N78A 2COMA 4OWRB 1ZTRA 5F6FA 2ID3A 4AYBN 4LB6B 3FISA 5J3LA 5FKMA 1R6RA 2DT7B 3A01A 2LKSA 2V1UA 3OOPA 2QGUA 3ABKH 3S1QJ 2X6OA 5HNFA 2NXNB 3RJPA 2R7TA 3FXQA 2ZMEA 1S6LA 2GOXB 1DGRM 3G1LA 1D1BA 1TQIA 1WWXA 3LSJA 1D5VA 3DTIA 3V7SA 3OOUA 3CO7C 4AIKA 5EYRA 1FT9A 1RETA 5HLHA 5HLTA 1RNLA 3TOBA 2XDVA 2QM3A 3LSKA 2HKXA 2DMPA 5LFAA 4BJTA 2K5CA 3M3YJ 5FRNA 4F3QA 2L4MA 5GAGJ 2VL8A 2M34A 2ESNA 5AONA 4FASD 4KICA 2IEKA 1Z0XA 3VDXA 1V5EA 2E60A 5HS9A 2K9QA 3CMYA 1OYIA 2W25A 3M9AA 1T95A 4RLQA 4FTHA 3D1NI 2ECBA 2M4GA 4R1HA 2DA5A 2VLAA 3B6AA 3REOA 2K9NA 1PP8F 3IP4B 1BI0A 3E0JB 2W84A 2IXSA 4BHPA 3Q5FA 4HPQA 2AO9A 3AG2H 1ZHFA 2O0YA 2BW3B 3OMYA 5J1UA 4I76A 2HTSA 3DV8A 4B3AA 1FNNA 3WG7H 2HXOA 4E7IA 1I6HJ 1GV5A 1ZLJA 4M72A 2HEOA 1ETWA 1GXQA 1LNWA 2OC6A 1ETKA 4QLCU 2CG4A 3QODA 4XR6A 2OCCH 3P9IA 5IT3A 4MNUA 4DBQA 2R7UA 2O03A 2I10A 2Q2EB 3OYFA 4II3A 2IRFG 4KT5C 2ELJA 2RC4A 2XGCA 2CQKA 1RKTA 2JPCA 2K4JA 3G73A 2B7EA 4V2GA 4M6YA 1REPC 3OYJA 1J59A 1HC8A 1GXPA 4IO9F 2MABA 4BU2A 1XGMA 5DEQA 4E70A 1XG1A 2M7BA 3WTWC 4MQ9F 1IF1A 2FEZA 3BCAA 2DOEA 1WH7A 1D3YA 3B73A 3BR1A 3QU3A 4JP0A 3HRTA 2X9DA 1BA5A 3ZQ7A 2O8XA 2W4SA 3GX4X 1MNMC 2OTLI 1XDSA 1HKTA 2GM4A 1JKOC 3E1SA 4P96A 4EJTA 4M3GA 2FOWA 3FXJA 4PJMA 5M3FJ 3E6MA 4P5OA 2Y31A 3BR3A 1LDJA 1X3ZB 3WHBA 1PJRA 3F21A 2NOGA 4KJZA 3ROUA 1VQ8I 1F4KA 3MFKA 3IHUA 3KX2A 2CUZA 2XB5A 1TWGJ 1IRFA 3PL8A 1ZG5A 3CP2A 2NS0A 3E6CC 2IS6A 3CCRI 4F92B 1Y0NA 3H92A 4A0ZA 1Y1VJ 1YIOA 4P9FA 4XOPA 4ZYEA 3OS0A 2KKOA 2XSDC 2IGKA 4P1WA 3DF8A 4ZYHA 2Z1DA 1YO5C 4HX4A 2BW3A 3HIFA 2CH0A 2X6WA 2KZGA 2XC7A 4HEA2 1USTA 2CQ7A 3PNTA 1ZGWA 1NH3A 2K3FA 4C9YA 1TLHB 2BEOA 3F72A 4CCJA 3WGIA 3K2AA 2ZMEC 5ILSA 2D5VA 1A5JA 2LK2A 2WV0A 3JAMZ 4ASNA 3QYFA 1TT0A 2X1DA 2Q2EA 3S2WA 3BJAA 3C2GA 4B09A 4Y13A 3OR1C 4HLYA 4E7JA 3I64A 1ORKA 4L9JA 2VQGA 1U8BA 1UFMA 1H89C 1I50J 2R7RA 1KQ9A 2CV2A 3CC7I 2M4KA 1SMTA 1TWAJ 4L5IA 2HDWA 3ERED 2BXYA 2VQLA 2XAUA 1AHDP 2M3AA 4HZFA 4ZH4F 4BHBA 3CDHA 1VQ9I 5HLIA 1R58A 2QBYB 2F2EA 1IV8A 4C3JJ 4GYGA 3EQLF 4Q4ZF 2K40A 3BR2A 1QZEA 2Y75A 4XKCA 3HL2A 3I4MJ 3C2HA 3LL7A 1SEUA 2FJ1A 5FD5A 1SFUA 3QPLA 2XRNA 3MQ0A 1GT0C 3SDGA 2P4WA 3BG3A 4ENKA 3G2BA 2NNYA 2YX7A 4EATA 2CJJA 3RKQA 4M6VA 1WSUA 2E2HJ 2P8TA 1FMVA 1TNTA 4GCVA 3BWGA 1UZCA 4PFOA 4DW6A 1JGGA 3CD6I 2FMLA 5B1BH 3H3ZA 2MFZA 4IQ4A 3J81K 1VZ0A 4C2UA 3WTZA 2R92J 4LLNA 1WJ5A 4I98B 2DFFA 3OYLA 3CF5F 2ZKZA 4QPQA 1YX5A 4XN3A 1GUUA 2RKHA 1XCVA 1TBXA 4CA0A 5D8LB 2IGOA 5FO5A 1LEBA 1WJAA 1KU2A 1NG6A 5FRMA 5K5OA 5HDGA 1LKXA 2PBIA 3H1CA 3T0YA 3LAJA 4J01A 2XPWA 5FB2A 2WY8Q 1HBXG 4IQJA 1S7EA 2H6BA 2K3PA 4AWXB 5E3MA 1TNSA 1JKRC 4AD9A 3PQJA 5F1RA 3VODA 2AXLA 2Y69H 1MJ9A
chains in the Genus database with same CATH topology
2NVTJ 3GTQJ 4JX6A 4UUSB 4XK4A 2E19A 5IYBJ 3JRAA 2NVQJ 4A3CJ 1MBKA 5IOZA 2DA1A 2JWTA 1HDPA 5IOYA 2H1KA 4AC0A 3HEFA 1F43A 3Q3SA 2MGQA 2L7FP 2LR8A 1VFCA 1WH5A 2EZIA 2DA2A 3HOUJ 3BTCA 3S1MJ 3BR0A 1RPWA 4S0HB 2R93J 3C2BA 4J19A 1AKHB 1FTZA 4B4CA 5GPAA 1JT0A 1WPKA 4BXXJ 2HDDA 1MH4A 4RDUA 3TW7A 5E3OA 3JRCA 2NS7A 1CQTA 3JR9A 1B8IB 3CQZJ 5K7ZA 2NVYJ 1W0UA 3O8HA 4I6ZA 3IV5A 2DTZA 2OF7A 2PMZN 4JX5A 3O8GA 1IV6A 1U9OA 5EZHA 4AUXA 3RZDJ 2CU7A 1JJ8C 3HKZN 4A3MJ 1T56A 4X6AJ 5FKOA 2VKVA 1YRNB 4BKXA 3MKLA 3FK6A 2LP0A 5M5XJ 3BTIA 1MBJA 1NTCA 1OJLA 1WI3A 4D7NA 2L7MP 2ECCA 2ZB9A 4A3BJ 4RBOA 2M0CA 3IH4A 5DTDA 2M8GX 2HOTA 1P7JA 2ME6A 2IBDA 2GBYA 5EG0B 4IHWA 1GVDA 1Q1VA 1JTXA 3G1MA 3ZQIA 5EDNA 4A3GJ 2YUSA 3ZQGA 1ZKGA 4FCYA 1X58A 3HB9A 1TWHJ 4W1UA 1IDYA 1A6IA 1JT6A 4EEFG 1HCRA 2DMUA 5F27A 1FTTA 2LLKA 3VPRA 4GFBA 5M3MJ 2R5ZB 2QCOA 4L5EA 2O8KA 4A3KJ 1R9TJ 2CQXA 5IP6A 2W48A 3JRIA 4C2MJ 3H3VK 4IHYA 4A3IJ 5E3LA 1LFBA 4X1EA 1AKHA 2R5YB 3BG9A 5FKLA 1U78A 2DN0A 5EF6A 1UHSA 5M5WJ 2P81A 2M2EA 3A03A 1MBEA 3PM1A 3TW6A 4D7MA 4C3IJ 1FEXA 1I3QJ 1B8IA 4MLOA 3BTLA 2DA7A 2QF7A 3K7AJ 4D5CA 2VUMJ 1SFOJ 2FQ4A 2R0QC 3LOCA 1IC8A 2JJ7A 5FJ8J 4M3FA 3ZQFA 1H88C 3A01B 2CRGA 1RKWA 1YRNA 3S14J 3A02A 2HYJA 1ETYA 3BQYA 3S16J 2Y2ZA 4CYCB 2COBA 2Y30A 5IYDJ 4FE7A 5C4XJ 2L0KA 4V2FA 2AHQA 3HM5A 3GTGJ 1H8AC 2CUEA 2H8RA 5IYCJ 3CCYA 1ZK8A 2LKXA 4W97A 3WHCA 5IP7J 1JUPA 2KT0A 3F0CA 3NAUA 4NDLA 5F0FA 4Y52J 5EG0A 1ZR4A 2HQ5A 3HBLA 5FLMJ 5E3NA 2WAQN 2EZLA 4BY1J 1X2MA 5GP9A 5F04A 1K61A 4XRSA 5F0HA 4A69C 2LFBA 3JRGA 2JK3A 5C3EJ 2EH3A 1NK3P 1ETQA 3BG5A 3LSGA 1IUFA 5FKKA 3ZQCA 2JA7J 3BQZA 4BBSJ 2MSYA 4MFDA 4A3LJ 2EBIA 4JYKA 4HNVA 1GDTA 2LY9A 2RAEA 3TP3A 2R5ZA 1FIAA 5GPCA 4B1RA 5EZGA 3ZOBA 2L7ZA 2VPRA 3Q0VA 3JRHA 4JX4A 2NS8A 3MN2A 2ELKA 2B63J 1DU0A 2R5YA 1F36A 3S1RJ 4BY7J 3SFIA 1ZQ3P 1O4XA 3PO2J 3LSPA 2WV1A 4MIMA 3HOZJ 5DS9A 3HOYJ 3OSGA 4MO7A 3S17J 2E2JJ 3GTOJ 3B6CA 2FD5A 4IHVA 4QIWN 2L9RA 3LNQA 9ANTA 4DYCA 5JLWA 4ABZA 1ZTRA 2GLOA 1G2HA 2ID3A 1MSFC 4AYBN 3FISA 5J3LA 4LOCA 5FKMA 3A01A 2N8GA 1OCTC 2XPUA 2NVXJ 5K7FA 3MVPA 3S1QJ 2X6OA 3BT9A 1OCPA 1LFUP 2YS9A 4CYCA 4IEJA 3IH3A 4BBRJ 1ETOA 2G0EA 3G1LA 4M3DA 4DZPA 3LSJA 1JUMA 1QVTA 3OOUA 5BNGA 2CQQA 4UUSA 1B72B 5EYRA 2OPTA 3FIWA 1RETA 1EF4A 1MBFA 3HOWJ 3Q0WA 2DMPA 3CDLA 5FLVA 2DJNA 3OIOA 4A3FJ 3M3YJ 4XRMA 3DEWA 3JRFA 1IJWC 2M34A 4M3EA 2IEKA 1LE8B 1VI0A 1Z0XA 2K9QA 3CMYA 2IAIA 1TWCJ 1IRZA 3JREA 4D5FA 5C44J 2LVSA 2Y9ZA 4FTHA 3D1NI 1QVUA 1XC5A 5J1YA 2ECBA 4FISA 2DA5A 2HOAA 2Y0SN 2DA6A 3B6AA 2DMTA 2XGEA 2K9NA 2E2IJ 1QRYA 1SANA 2AO9A 2TCTA 1BW6A 2XPVA 5J1UA 1PUFB 4I76A 4B3AA 1NK2P 1WCMJ 2HXOA 3HDDA 1I6HJ 1GV5A 1ETWA 3PO3J 3OSFA 1ETKA 2X48A 1ETXA 1DU6A 1RESA 1BJZA 5FKNA 3HGYA 3GBGA 2I10A 2VKEA 5F1JA 5IPAA 2O9LA 2XGCA 1RKTA 3HOXJ 4V2GA 2DA3A 1JJ6C 3FKIJ 1ITYA 3JRBA 3LSRA 1Y1WJ 1TC3C 4DYQA 5C4JJ 2HOSA 5HODA 3H0GJ 3GTJJ 3GTPJ 1XG1A 2EZKA 3BR5A 3GTKJ 2XGDA 1WH7A 1UG2A 4MFEA 2DMNA 2XRLA 2HI3A 3BR1A 5K7HA 1HLVA 4JP0A 4DYRA 3S1NJ 3NARA 1B72A 3L1PA 2JA8J 2VI6A 2X9DA 3SJMA 5EGOB 1BA5A 1MNMC 2GM4A 2JN6A 4QSHA 1JKOC 1Z77A 4M3GA 2MG4A 2KDZA 5M3FJ 4A3DJ 2EZHA 2LTPA 2Y31A 3BR3A 3WHBA 2NOGA 2M9HA 3BTJA 3ZQHA 1X2NA 1LE8A 1ENHA 2XB0X 2XB5A 1TWGJ 2DA4A 3IH2A 1MBHA 3HOVJ 1FIPA 1P7IA 1QPIA 3HGGA 1Y1VJ 3W6VA 2DMQA 4UUTA 4XRSG 2XSDC 4IHXA 1HDDC 1PUFA 5EEAA 3G1OA 1ETVA 1ZGWA 1BW5A 2MW8A 1JKPC 2K9SA 3RQIA 3K2AA 2O7OA 1IDZA 4XICA 2D5VA 3S15J 1POGA 1APLC 1AU7A 1GV2A 1A5JA 2LK2A 2YU9J 1OFCX 2WB1N 4M3BA 2JA6J 3M4OJ 1FJLA 2E1OA 3TEDA 1ORKA 1E3OC 1U8BA 1H89C 1I50J 5M5YJ 1HF0A 2JMWA 1IGNA 2JA5J 5F08A 1ZR2A 1TWAJ 2ID6A 1JTYA 4Y7NJ 3DCFA 1AHDP 2ME0A 2R7ZJ 4A3EJ 1JUSA 4A3JJ 3BR6A 1W0TA 1MBGA 4C3JJ 4G12A 2K40A 1RR7A 1BL0A 1IG7A 3BR2A 1U9NA 5EGOA 3I4MJ 3FK7A 1MSEC 1HOMA 5F0CA 2FJ1A 1K83J 3QPLA 3JRDA 1GT0C 2LD5A 3SDGA 3BG3A 2Y9YA 1T33A 2CJJA 3RKQA 4M6VA 1VNDA 3Q0UA 2E2HJ 3ZQLA 1MH3A 3RZOJ 4QTRA 3QQAA 4DW6A 1JGGA 1XS9A 3I4NJ 4XIDA 2FX0A 2TRTA 5JLXA 2R92J 1TWFJ 3TP0A 4C3HJ 2CUFA 5J1RA 3GTMJ 4DZJA 1GUUA 3S2HJ 2EQRA 3E7LA 3S2DJ 4A93J 3GTLJ 5IP9J 3QPSA 1D5YA 2XPWA 1S7EA 4FE4A 2HXIA 5E3MA 1VF9A 1JKRC 3UKGA 1JKQC 1WGXA 1UMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT J;  3GTQ J;  4JX6 A;  4UUS B;  4XK4 A;  2E19 A;  5IYB J;  3JRA A;  2NVQ J;  4A3C J;  1MBK A;  5IOZ A;  2DA1 A;  2JWT A;  1HDP A;  5IOY A;  2H1K A;  4AC0 A;  3HEF A;  1F43 A;  3Q3S A;  2MGQ A;  2L7F P;  2LR8 A;  1VFC A;  1WH5 A;  2EZI A;  2DA2 A;  3HOU J;  3BTC A;  3S1M J;  3BR0 A;  1RPW A;  4S0H B;  2R93 J;  3C2B A;  4J19 A;  1AKH B;  1FTZ A;  4B4C A;  5GPA A;  1JT0 A;  1WPK A;  4BXX J;  2HDD A;  1MH4 A;  4RDU A;  3TW7 A;  5E3O A;  3JRC A;  2NS7 A;  1CQT A;  3JR9 A;  1B8I B;  3CQZ J;  5K7Z A;  2NVY J;  1W0U A;  3O8H A;  4I6Z A;  3IV5 A;  2DTZ A;  2OF7 A;  2PMZ N;  4JX5 A;  3O8G A;  1IV6 A;  1U9O A;  5EZH A;  4AUX A;  3RZD J;  2CU7 A;  1JJ8 C;  3HKZ N;  4A3M J;  1T56 A;  4X6A J;  5FKO A;  2VKV A;  1YRN B;  4BKX A;  3MKL A;  3FK6 A;  2LP0 A;  5M5X J;  3BTI A;  1MBJ A;  1NTC A;  1OJL A;  1WI3 A;  4D7N A;  2L7M P;  2ECC A;  2ZB9 A;  4A3B J;  4RBO A;  2M0C A;  3IH4 A;  5DTD A;  2M8G X;  2HOT A;  1P7J A;  2ME6 A;  2IBD A;  2GBY A;  5EG0 B;  4IHW A;  1GVD A;  1Q1V A;  1JTX A;  3G1M A;  3ZQI A;  5EDN A;  4A3G J;  2YUS A;  3ZQG A;  1ZKG A;  4FCY A;  1X58 A;  3HB9 A;  1TWH J;  4W1U A;  1IDY A;  1A6I A;  1JT6 A;  4EEF G;  1HCR A;  2DMU A;  5F27 A;  1FTT A;  2LLK A;  3VPR A;  4GFB A;  5M3M J;  2R5Z B;  2QCO A;  4L5E A;  2O8K A;  4A3K J;  1R9T J;  2CQX A;  5IP6 A;  2W48 A;  3JRI A;  4C2M J;  3H3V K;  4IHY A;  4A3I J;  5E3L A;  1LFB A;  4X1E A;  1AKH A;  2R5Y B;  3BG9 A;  5FKL A;  1U78 A;  2DN0 A;  5EF6 A;  1UHS A;  5M5W J;  2P81 A;  2M2E A;  3A03 A;  1MBE A;  3PM1 A;  3TW6 A;  4D7M A;  4C3I J;  1FEX A;  1I3Q J;  1B8I A;  4MLO A;  3BTL A;  2DA7 A;  2QF7 A;  3K7A J;  4D5C A;  2VUM J;  1SFO J;  2FQ4 A;  2R0Q C;  3LOC A;  1IC8 A;  2JJ7 A;  5FJ8 J;  4M3F A;  3ZQF A;  1H88 C;  3A01 B;  2CRG A;  1RKW A;  1YRN A;  3S14 J;  3A02 A;  2HYJ A;  1ETY A;  3BQY A;  3S16 J;  2Y2Z A;  4CYC B;  2COB A;  2Y30 A;  5IYD J;  4FE7 A;  5C4X J;  2L0K A;  4V2F A;  2AHQ A;  3HM5 A;  3GTG J;  1H8A C;  2CUE A;  2H8R A;  5IYC J;  3CCY A;  1ZK8 A;  2LKX A;  4W97 A;  3WHC A;  5IP7 J;  1JUP A;  2KT0 A;  3F0C A;  3NAU A;  4NDL A;  5F0F A;  4Y52 J;  5EG0 A;  1ZR4 A;  2HQ5 A;  3HBL A;  5FLM J;  5E3N A;  2WAQ N;  2EZL A;  4BY1 J;  1X2M A;  5GP9 A;  5F04 A;  1K61 A;  4XRS A;  5F0H A;  4A69 C;  2LFB A;  3JRG A;  2JK3 A;  5C3E J;  2EH3 A;  1NK3 P;  1ETQ A;  3BG5 A;  3LSG A;  1IUF A;  5FKK A;  3ZQC A;  2JA7 J;  3BQZ A;  4BBS J;  2MSY A;  4MFD A;  4A3L J;  2EBI A;  4JYK A;  4HNV A;  1GDT A;  2LY9 A;  2RAE A;  3TP3 A;  2R5Z A;  1FIA A;  5GPC A;  4B1R A;  5EZG A;  3ZOB A;  2L7Z A;  2VPR A;  3Q0V A;  3JRH A;  4JX4 A;  2NS8 A;  3MN2 A;  2ELK A;  2B63 J;  1DU0 A;  2R5Y A;  1F36 A;  3S1R J;  4BY7 J;  3SFI A;  1ZQ3 P;  1O4X A;  3PO2 J;  3LSP A;  2WV1 A;  4MIM A;  3HOZ J;  5DS9 A;  3HOY J;  3OSG A;  4MO7 A;  3S17 J;  2E2J J;  3GTO J;  3B6C A;  2FD5 A;  4IHV A;  4QIW N;  2L9R A;  3LNQ A;  9ANT A;  4DYC A;  5JLW A;  4ABZ A;  1ZTR A;  2GLO A;  1G2H A;  2ID3 A;  1MSF C;  4AYB N;  3FIS A;  5J3L A;  4LOC A;  5FKM A;  3A01 A;  2N8G A;  1OCT C;  2XPU A;  2NVX J;  5K7F A;  3MVP A;  3S1Q J;  2X6O A;  3BT9 A;  1OCP A;  1LFU P;  2YS9 A;  4CYC A;  4IEJ A;  3IH3 A;  4BBR J;  1ETO A;  2G0E A;  3G1L A;  4M3D A;  4DZP A;  3LSJ A;  1JUM A;  1QVT A;  3OOU A;  5BNG A;  2CQQ A;  4UUS A;  1B72 B;  5EYR A;  2OPT A;  3FIW A;  1RET A;  1EF4 A;  1MBF A;  3HOW J;  3Q0W A;  2DMP A;  3CDL A;  5FLV A;  2DJN A;  3OIO A;  4A3F J;  3M3Y J;  4XRM A;  3DEW A;  3JRF A;  1IJW C;  2M34 A;  4M3E A;  2IEK A;  1LE8 B;  1VI0 A;  1Z0X A;  2K9Q A;  3CMY A;  2IAI A;  1TWC J;  1IRZ A;  3JRE A;  4D5F A;  5C44 J;  2LVS A;  2Y9Z A;  4FTH A;  3D1N I;  1QVU A;  1XC5 A;  5J1Y A;  2ECB A;  4FIS A;  2DA5 A;  2HOA A;  2Y0S N;  2DA6 A;  3B6A A;  2DMT A;  2XGE A;  2K9N A;  2E2I J;  1QRY A;  1SAN A;  2AO9 A;  2TCT A;  1BW6 A;  2XPV A;  5J1U A;  1PUF B;  4I76 A;  4B3A A;  1NK2 P;  1WCM J;  2HXO A;  3HDD A;  1I6H J;  1GV5 A;  1ETW A;  3PO3 J;  3OSF A;  1ETK A;  2X48 A;  1ETX A;  1DU6 A;  1RES A;  1BJZ A;  5FKN A;  3HGY A;  3GBG A;  2I10 A;  2VKE A;  5F1J A;  5IPA A;  2O9L A;  2XGC A;  1RKT A;  3HOX J;  4V2G A;  2DA3 A;  1JJ6 C;  3FKI J;  1ITY A;  3JRB A;  3LSR A;  1Y1W J;  1TC3 C;  4DYQ A;  5C4J J;  2HOS A;  5HOD A;  3H0G J;  3GTJ J;  3GTP J;  1XG1 A;  2EZK A;  3BR5 A;  3GTK J;  2XGD A;  1WH7 A;  1UG2 A;  4MFE A;  2DMN A;  2XRL A;  2HI3 A;  3BR1 A;  5K7H A;  1HLV A;  4JP0 A;  4DYR A;  3S1N J;  3NAR A;  1B72 A;  3L1P A;  2JA8 J;  2VI6 A;  2X9D A;  3SJM A;  5EGO B;  1BA5 A;  1MNM C;  2GM4 A;  2JN6 A;  4QSH A;  1JKO C;  1Z77 A;  4M3G A;  2MG4 A;  2KDZ A;  5M3F J;  4A3D J;  2EZH A;  2LTP A;  2Y31 A;  3BR3 A;  3WHB A;  2NOG A;  2M9H A;  3BTJ A;  3ZQH A;  1X2N A;  1LE8 A;  1ENH A;  2XB0 X;  2XB5 A;  1TWG J;  2DA4 A;  3IH2 A;  1MBH A;  3HOV J;  1FIP A;  1P7I A;  1QPI A;  3HGG A;  1Y1V J;  3W6V A;  2DMQ A;  4UUT A;  4XRS G;  2XSD C;  4IHX A;  1HDD C;  1PUF A;  5EEA A;  3G1O A;  1ETV A;  1ZGW A;  1BW5 A;  2MW8 A;  1JKP C;  2K9S A;  3RQI A;  3K2A A;  2O7O A;  1IDZ A;  4XIC A;  2D5V A;  3S15 J;  1POG A;  1APL C;  1AU7 A;  1GV2 A;  1A5J A;  2LK2 A;  2YU9 J;  1OFC X;  2WB1 N;  4M3B A;  2JA6 J;  3M4O J;  1FJL A;  2E1O A;  3TED A;  1ORK A;  1E3O C;  1U8B A;  1H89 C;  1I50 J;  5M5Y J;  1HF0 A;  2JMW A;  1IGN A;  2JA5 J;  5F08 A;  1ZR2 A;  1TWA J;  2ID6 A;  1JTY A;  4Y7N J;  3DCF A;  1AHD P;  2ME0 A;  2R7Z J;  4A3E J;  1JUS A;  4A3J J;  3BR6 A;  1W0T A;  1MBG A;  4C3J J;  4G12 A;  2K40 A;  1RR7 A;  1BL0 A;  1IG7 A;  3BR2 A;  1U9N A;  5EGO A;  3I4M J;  3FK7 A;  1MSE C;  1HOM A;  5F0C A;  2FJ1 A;  1K83 J;  3QPL A;  3JRD A;  1GT0 C;  2LD5 A;  3SDG A;  3BG3 A;  2Y9Y A;  1T33 A;  2CJJ A;  3RKQ A;  4M6V A;  1VND A;  3Q0U A;  2E2H J;  3ZQL A;  1MH3 A;  3RZO J;  4QTR A;  3QQA A;  4DW6 A;  1JGG A;  1XS9 A;  3I4N J;  4XID A;  2FX0 A;  2TRT A;  5JLX A;  2R92 J;  1TWF J;  3TP0 A;  4C3H J;  2CUF A;  5J1R A;  3GTM J;  4DZJ A;  1GUU A;  3S2H J;  2EQR A;  3E7L A;  3S2D J;  4A93 J;  3GTL J;  5IP9 J;  3QPS A;  1D5Y A;  2XPW A;  1S7E A;  4FE4 A;  2HXI A;  5E3M A;  1VF9 A;  1JKR C;  3UKG A;  1JKQ C;  1WGX A;  1UMQ A; 
#chains in the Genus database with same CATH topology
 2JRT A;  2NVT J;  4XK4 A;  2E19 A;  1MBK A;  4KNY A;  1RC9 A;  5IOZ A;  1KU3 A;  4AVZ A;  2JWT A;  3K70 C;  5IOY A;  3GW2 A;  4M74 A;  2H1L A;  1MJA A;  3HEF A;  3RDI A;  1U0J A;  1F43 A;  2L7F P;  1X3W B;  2EFW A;  3PNV A;  5BPD A;  1VFC A;  1WH5 A;  3G3Z A;  1A04 A;  2DA2 A;  3KP6 A;  2P7C B;  1ON1 A;  3HOU J;  3S1M J;  4ZZD A;  3LA2 A;  4NQW B;  4CCK A;  3C2B A;  4J19 A;  4ENM A;  1AKH B;  4KIF A;  3P9C A;  1IW7 F;  4H4K C;  4A5N A;  1FTZ A;  4UY8 I;  5E8I A;  2QBY A;  4ZTF A;  2KHM A;  3J80 Z;  4QPO A;  3N97 A;  2DBB A;  4UVC A;  4ETS A;  2HNH A;  3JRC A;  1HA8 A;  3LFK A;  2E5N A;  5KNL A;  1ZYR F;  4YIR X;  3DPL C;  1O3T A;  2UXN A;  4F93 B;  3CQZ J;  3L2C A;  2D1H A;  3GFI A;  2DTZ A;  2OF7 A;  2PMZ N;  3O8G A;  2FQ3 A;  3J7A O;  3I71 A;  1U9O A;  4BAY A;  1EKE A;  1FBQ A;  3CCS I;  1YIJ I;  3HKZ N;  3DLL F;  5FKO A;  1BN5 A;  1S3J A;  3M8J A;  3VSK A;  3GLX A;  1YRN B;  3BZC A;  3W6J B;  3MKL A;  3X2Q H;  1I3A A;  4NC7 A;  3HG9 A;  1XDU A;  5KHD A;  4S04 A;  3MMY B;  4CDG A;  3BJ6 A;  2R3S A;  1NTC A;  4CCO A;  3S3N A;  2F5E A;  2ECC A;  3U2R A;  4CUG A;  2ZB9 A;  5JVT A;  3CTA A;  2HQR A;  3DBR B;  4KIT B;  4A3B J;  4A6E A;  2EFP A;  3RSN A;  5LD2 C;  1P7J A;  1YYV A;  2BYV E;  2K4B A;  1G6N A;  3MWM A;  4BEH B;  5H2F C;  5E20 A;  2GBY A;  3V4G A;  2EA2 A;  1STZ A;  5HS8 A;  5EG0 B;  1SMY F;  4IHW A;  3A0H C;  2E7W A;  4HG2 A;  4CCM A;  3ZQI A;  1O3R A;  2L9S A;  2Y0S A;  1ZKG A;  3HB9 A;  3AG3 H;  4ZYA A;  4BJ6 C;  1OCO H;  3ZQQ A;  2JTV A;  2QQB A;  2P5L C;  4XON A;  4LLL A;  1Z6T A;  2M8E A;  2LF7 A;  3VPR A;  2X51 A;  4IRH A;  1ACI A;  1U2W A;  2QCO A;  3CJN A;  2V7F A;  3CZ6 A;  4Y15 A;  2E1N A;  4WXH A;  4XLF A;  4XOR A;  4EJU A;  4O5V A;  3S32 A;  2HKO A;  2M45 A;  4C2M J;  4NNJ A;  3U1D A;  3KE2 A;  3KLN A;  4KT6 A;  4IHY A;  3H3V K;  4NQW A;  3QPH A;  1AKH A;  3BG7 A;  3QP5 A;  3CME I;  1HXD A;  1WJF A;  3TW6 A;  3VYT B;  4OIO F;  4C3I J;  1FEX A;  4LJZ F;  2QF7 A;  3K7A J;  4D5C A;  2L4A A;  1SFO J;  2VXZ A;  2R0Q C;  4RGS A;  1SVO A;  4IJA A;  2E1C A;  1RR8 C;  2P5V A;  1MKM A;  3MD2 A;  3ZRG A;  2Z99 A;  2KZV A;  1RKW A;  3EUK L;  3RKX A;  1YRN A;  3A1Y A;  3S16 J;  1USS A;  2M5W A;  3FXO A;  4HDV A;  1QZZ A;  2Q0O A;  4RB1 A;  1OQY A;  4L5J A;  4DIQ A;  1S9H A;  3DU5 A;  1YJ9 I;  2L0K A;  4ZDP A;  3K4M A;  3HTS B;  3CJR B;  1K79 A;  1R00 A;  2DLL A;  2RQQ A;  1S72 I;  1BIB A;  4V19 K;  3WHC A;  3D5R C;  2FBI A;  4BEH A;  4KUM A;  2JSC A;  3T5X A;  3NAU A;  1FPQ A;  2K86 A;  2ZJ2 A;  3EPZ A;  1TL8 A;  4Y52 J;  5EG0 A;  3JTH A;  2HQ5 A;  2H27 A;  5E3N A;  1R5H A;  1EA3 A;  2V1N A;  4BY1 J;  1SVM A;  1YW7 A;  3J7A Y;  2YR2 A;  5F04 A;  2UZK A;  2LY1 A;  2CQN A;  3P7N A;  1KYZ A;  3BC8 A;  2MC3 A;  1B9N A;  4XOT A;  1R4M B;  2VBZ A;  3DFG A;  2EH3 A;  2E36 A;  1NK3 P;  3BLY A;  3QWL A;  3ZQC A;  3OWT A;  1WFX A;  1XN7 A;  3PNY A;  2EBI A;  4JYK A;  4HNV A;  2RAE A;  1R1T A;  1FIA A;  2HPI A;  1XX5 A;  3DP7 A;  1TTY A;  1RI7 A;  3Q0V A;  2DXI A;  4M6X A;  1K4S A;  4PJN A;  3BOQ A;  2RQP A;  2MD0 A;  1P4A A;  3DKW A;  3GWZ A;  3MN2 A;  4HQM A;  1IN4 A;  4EVI A;  3FXR A;  1P4X A;  2B63 J;  4I09 A;  1SFK A;  4A6D A;  3H5A A;  4UV9 A;  1PVE A;  1F36 A;  3LA3 A;  3SZG A;  4A5M A;  1I39 A;  4EJV A;  4GYI A;  5E18 F;  2LDU A;  1QU3 A;  2F6C A;  5DM6 F;  3OYI A;  2JA2 A;  4EV0 A;  2I8D A;  1YJN I;  2BHZ A;  4DQ2 A;  4MIM A;  1BI1 A;  2WTE A;  5GAE J;  2A6E F;  2P0W A;  1K6O A;  1DPR A;  3WTY C;  3ZMT A;  4ESJ A;  3GTO J;  3B6C A;  3CUO A;  3KP7 A;  4A0X A;  1VQ6 I;  2GLO A;  2ZJQ F;  2E5Z A;  3FMR A;  2ACJ A;  2NVX J;  1Q1H A;  1KQ0 A;  3CCL I;  1OCT C;  5FGM A;  1IXC A;  4PSW A;  5JI6 A;  4PK4 A;  2LKP A;  2GXG A;  3BT9 A;  3U21 A;  4EGY A;  1OCC H;  2LMD A;  4LIT A;  1XTA A;  2GAU A;  4IEJ A;  4BBR J;  5LHG A;  4M3D A;  4UHT A;  4D1Q A;  5BNG A;  1VQP I;  2WA0 A;  1FOX A;  1G3W A;  5BMZ A;  2Y48 A;  1OYW A;  1LDD A;  3A4C A;  1FSE A;  1RUO A;  4A0Y A;  5LLQ A;  3CDL A;  3FF5 A;  2NAZ A;  1X4P A;  2DJN A;  2I5U A;  3F8N A;  1UCR A;  4WXD A;  3L2Q A;  4ZC3 A;  2LH9 A;  3JRF A;  4AIJ A;  4M3E A;  2KDO A;  2ZXW H;  3W2A A;  4RAF A;  4MHG A;  2W57 A;  2B0L A;  4XLP F;  3E6D A;  2IAI A;  1TWC J;  1IRZ A;  2VOO A;  5C44 J;  1QVU A;  1XC5 A;  1Z05 A;  5J1Y A;  1R5I D;  3ZN1 A;  2DPU A;  2DA6 A;  2XGE A;  5CVJ A;  2NOJ B;  1BBY A;  2E2I J;  1T98 A;  1QPM A;  3ECO A;  4G7O F;  4XLA A;  3HSE A;  4I01 A;  5TIS C;  1BW6 A;  2ZC2 A;  2QLZ A;  4HX8 A;  3W2W A;  3WE2 A;  1PDN C;  3ZN0 A;  4N4O B;  3L7W A;  4XNF A;  4S05 A;  1R1U A;  4KA4 A;  1WCM J;  3R4K A;  4ITV A;  2FNA A;  2HZD A;  1ZLK A;  1Y6I A;  3K0L A;  2X48 A;  4HAM A;  4JQF A;  1ETX A;  3ELK A;  4C30 A;  1S5L C;  3HUG B;  3OY9 A;  1RES A;  3U1K A;  1W36 D;  3H9G A;  2LF8 A;  4FQG A;  3EYI A;  3GBG A;  2A68 F;  3IUO A;  4IPA A;  5D8K B;  5F1J A;  2J5O A;  4BQA A;  3HOX J;  3BPV A;  1QNT A;  3CC2 I;  1Z6R A;  2DA3 A;  3I58 A;  3FKI J;  3JRB A;  3LSR A;  1TC3 C;  2HOS A;  5C4J J;  5HOO A;  3H0G J;  3GTJ J;  5B1A H;  3DKY A;  3L2V A;  3TO9 A;  2EV5 A;  2JUG A;  4Y3O A;  2LNB A;  2XGD A;  4HV5 A;  4BL0 B;  3ASO H;  4X0G A;  4R79 A;  2R7V A;  4MFE A;  2HI3 A;  2QQA A;  5K7H A;  1G59 A;  3SQN A;  3QOP A;  4DYR A;  3I55 I;  3FHZ A;  3NAR A;  1I1S A;  4MEY F;  4U87 A;  2JA8 J;  2VI6 A;  3SJM A;  2QKL B;  2DK5 A;  5J6X A;  2QQ8 A;  4QSH A;  4LLG F;  2OQG A;  1R36 A;  4A3D J;  2BY3 A;  4TV7 A;  2LTP A;  3GO5 A;  4B43 A;  3FX3 A;  4M9S A;  2M9H A;  3KP3 A;  3BTJ A;  4Y4R A;  3ZQH A;  4IRI A;  2MH9 A;  5KVR A;  5HDK A;  2G7U A;  4IRG A;  3CCV I;  3HOV J;  1FIP A;  1P7I A;  1W5T A;  3RKW A;  2W85 A;  2A6H F;  2A61 A;  1R22 A;  1YW9 A;  1U5T C;  3W6V A;  2OU2 A;  2FNP A;  4N9H A;  1KZH A;  2HTJ A;  1W36 C;  3HZJ A;  1LVA A;  4Q48 A;  2V6C A;  5EEA A;  1ETV A;  2F5V A;  1H9T A;  1YE9 A;  2KLO A;  1X1C A;  2IP2 A;  4MTE A;  3ABU A;  1LPQ A;  3DTE A;  2F5D A;  3S15 J;  3DKX A;  1GV2 A;  5GAH J;  4RB2 C;  4BE0 A;  2YU9 J;  3HUG A;  2WB1 N;  4UUV A;  3DBL B;  3OYA A;  5E1W A;  3ZGK A;  1L3L A;  1OMI A;  3TDZ C;  1QHH D;  3P5J A;  1YQA A;  4L9V A;  1MMN A;  1Z67 A;  3H9J A;  3FXU A;  3BP8 A;  5CLS A;  1FJL A;  2Z33 A;  1VQO I;  2EPF A;  3JSP A;  2IVM A;  2KIU A;  1ZAR A;  2K02 A;  1LDK B;  2JA5 J;  5CVU A;  5F08 A;  1ZR2 A;  2ID6 A;  1IRG A;  3DCF A;  3TO7 A;  1KU7 A;  1D0Z A;  1LQ1 A;  1JUS A;  2VQC A;  3ESW B;  4NB5 A;  3BR6 A;  3IC7 A;  1IO2 A;  3SXY A;  3F6V A;  2HR3 A;  1WJB A;  3FM5 A;  3ABM H;  3FK7 A;  3HRM A;  5H6Q A;  2ZJP F;  2V6E A;  5F0C A;  1KQ8 A;  3OV8 A;  4LG3 A;  1T08 B;  3M1C A;  3J7Y J;  5JHF A;  1QZY A;  2EIN H;  3HRS A;  4ZTJ A;  2Y9Y A;  2QVO A;  2V4J C;  1Z7U A;  1MGT A;  1VND A;  3MZH A;  4AIH A;  3SDB A;  2ZXJ A;  1B4A A;  4B44 A;  3IWF A;  1BC7 C;  4Q5S F;  3R6S A;  3WTV C;  3HSF A;  3QQA A;  3CCE I;  3WU0 A;  3DLA A;  2TRT A;  1I6X A;  3TMO A;  3LFU A;  4LK0 F;  5JLX A;  2HQA A;  3FKJ A;  3FDY A;  2WAE A;  1MNE A;  3TP0 A;  3O3K A;  4C3H J;  3EUH C;  1KGS A;  3TOA A;  1GVJ A;  1KA8 A;  4OIR F;  1ZG3 A;  4M73 A;  2J5P A;  1UAA A;  1K6Y A;  4EJW A;  2MH2 A;  4KIG A;  4IX7 A;  2WAQ A;  3CDI A;  3ERM A;  2KRC A;  1Y8Q B;  4A2U A;  2DT5 A;  6PAX A;  3FZV A;  3D5S C;  1X4O A;  1R49 A;  4XSX F;  5EEH A;  2PJR B;  1LJ9 A;  1Y0U A;  2RGV A;  3ZMS A;  2EFO A;  4ON0 A;  4M9Z A;  1S8N A;  2HXI A;  2ZO4 A;  3FBN B;  1VF9 A;  1S7A A;  3UKG A;  3D5L A;  1JKQ C;  4KDP A;  4HNU A;  2DU9 A;  1KYW A;  3FXK A;  1BM9 A;  1ZG1 A;  3ISP A;  3RI4 A;  3GTQ J;  3M1E A;  4UUS B;  2G9W A;  2JZY A;  4A3C J;  2OAZ A;  2VB6 A;  2XAG A;  4YFX F;  5CQG A;  5D6F A;  2DA1 A;  4HQE A;  3HHH A;  2R7F A;  1HDP A;  5K5R A;  2EB7 A;  3RYP A;  2H1K A;  2W7N A;  1BC8 C;  2MGQ A;  3DPU A;  5EJC A;  2EZI A;  2JVH A;  1IN7 A;  4S0H B;  2GXB A;  2VKH A;  3CES A;  1UG0 A;  3GZ5 A;  1RIO H;  3ABT A;  3E5Q A;  2FU4 A;  2KMU A;  3CJQ B;  4LGW A;  1U3E M;  2HDD A;  3F6O A;  3K2Z A;  1YHQ I;  2EWN A;  3TW7 A;  1MMG A;  3JR9 A;  2X1C A;  4HOB A;  1D0X A;  2VC1 A;  4DBR A;  2Z3Y A;  1G8X A;  5KAF C;  4UVB A;  1R71 A;  3O8H A;  3ASN H;  1HSJ A;  3HPH A;  2LSO A;  2KJB A;  1IV6 A;  1W5C C;  3J7Z I;  4XKW A;  3NWS A;  1TW3 A;  1R7J A;  1X1A A;  3F9K A;  2STT A;  5J40 A;  4MEX F;  2B9S A;  4HSR A;  5LRR A;  3FK6 A;  1QO0 D;  1OYY A;  1MBJ A;  5HDN A;  1F5T A;  1Z9C A;  2VT2 A;  5L3C A;  1LEA A;  2KIQ A;  1BR4 A;  1EH8 A;  4CYD A;  3BDD A;  2M0C A;  4BHC A;  5CPR B;  5DTD A;  3I59 B;  1MMD A;  2DDB A;  3PJR A;  3VYR B;  5KAI C;  2LY2 A;  4XBF A;  4HV6 A;  1Q1V A;  4II2 A;  2MD5 A;  3RYR A;  3JCU C;  2PJR A;  4HBL A;  1TQP A;  1SAU A;  2V9K A;  5HVQ C;  5EDN A;  2YUS A;  3ZQG A;  1ZAO A;  4FCY A;  1X58 A;  4DGW B;  4W1U A;  2KP6 A;  1OR7 A;  1IXS B;  2DOF A;  3P9K A;  2IT0 A;  4D9J A;  2HWV A;  4PGH A;  2L02 A;  2DMU A;  4O6J A;  1A35 A;  3K70 D;  4GDF A;  4JK1 X;  4B48 A;  2BE5 F;  3CCU I;  1XMK A;  5M3M J;  2DYR H;  2O8K A;  2H8W A;  3LA7 A;  5IP6 A;  3TO6 A;  1B1B A;  2IA1 A;  4A3I J;  1T6S A;  3QPT A;  5E3L A;  1X1D A;  2H94 A;  5L3G A;  3OYE A;  4GGG A;  3K4B A;  2AQE A;  5FKL A;  4E6K G;  3UNG C;  2VE8 A;  3KYD B;  3AKZ A;  3H36 A;  3GLL A;  2PI0 A;  1T38 A;  2OJE D;  2LRE A;  2M2E A;  3A03 A;  3GF2 A;  1BIA A;  2OD5 A;  5GAD J;  3JW4 A;  5J4V A;  2EJR A;  3KZZ A;  2ISY A;  1HKS A;  3BTL A;  3KZY A;  3BG6 A;  2FQ4 A;  1FY7 A;  4RM2 A;  2FUG 2;  1XGO A;  1F9N A;  2ZSI B;  1FOY A;  2XAQ A;  3OL4 A;  4M3F A;  3ZQF A;  1H88 C;  1FMW A;  2PMU A;  2XSJ C;  4HF2 A;  2EA4 A;  4EMS A;  1U6G A;  2FOK A;  1V55 H;  3F3X A;  3ZMZ A;  2DAO A;  2W24 A;  2CV1 A;  3A02 A;  4AU7 A;  1ETY A;  5ILV A;  3BQY A;  3OIP A;  1FP2 A;  3CLO A;  4E7S A;  3M8F A;  5DCM B;  3F8M A;  2ZFU A;  2R7W A;  1QBJ A;  1LVK A;  5ICE A;  3GVA A;  4V2F A;  2VQH A;  2AHQ A;  4L9N A;  1G3T A;  5IYC J;  5HS7 A;  2XGX A;  1ZK8 A;  3OIQ A;  5L3D A;  3RPU D;  5IP7 J;  2YU3 A;  3I59 A;  1JUP A;  4AID A;  3COA C;  3F0C A;  4BE1 A;  3B02 A;  1AWC A;  1O57 A;  4PJJ A;  2R7Q A;  1UEL B;  3G6E I;  2DYS H;  4NBQ A;  1FX7 A;  3C3W A;  3FBI B;  3SYT A;  2GZW A;  3JRG A;  2JK3 A;  5C3E J;  3H5R A;  1R5G A;  1ETQ A;  3L9F A;  5L3E A;  1IUF A;  1YS7 A;  3S3M A;  4RGU A;  2EV6 A;  2PMZ A;  2NNN A;  4UNO A;  2ELH A;  3GFM A;  3BZ6 A;  3TP3 A;  1JGS A;  1HQC A;  4EM1 A;  2HYG D;  2L7Z A;  1A36 A;  3CP8 A;  4I7H A;  3MZY A;  1FLI A;  2NS8 A;  3L09 A;  5IT9 K;  4I0B A;  3ZMV A;  2V9V A;  3GME A;  1O4X A;  1TW2 A;  3PO2 J;  5JR3 A;  5LHI A;  1MMA A;  1YW8 A;  2VAS A;  1EH6 A;  3GFJ A;  3LSI A;  2XAH A;  2GA2 A;  3GYH X;  2GQQ A;  2E2J J;  3AFH A;  1YTY A;  2FD5 A;  4YFN F;  4QIW N;  4HF1 A;  4IHV A;  1WRJ A;  4IHS A;  2FBK A;  1G2H A;  1ULY A;  2WC2 A;  3KPH A;  4LOC A;  1YOV B;  3OYG A;  2XPU A;  3F23 A;  5K7F A;  2XAJ A;  2PMH A;  1S29 A;  3FM3 A;  4NHJ A;  1OCP A;  1OR7 C;  2YS9 A;  3QU6 A;  2HFH A;  5DCM A;  1BOB A;  1YX3 A;  2K85 A;  2G0E A;  2XUB A;  2O5R A;  2XAS A;  1JUM A;  4BXU A;  2R4G A;  4LD5 A;  4U0V A;  4BDZ A;  3A2K A;  2CQQ A;  5DM7 F;  4G8X A;  1ZRE A;  1EF4 A;  1MBF A;  3HOW J;  5BS6 A;  4CCN A;  2OQR A;  3Q0W A;  1J9I A;  4F52 A;  2RN7 A;  5FLV A;  3QAH A;  4GXO A;  1WI9 A;  3BCB A;  1D0Y A;  4XRM A;  3DEW A;  2X85 A;  4HRI A;  1IJW C;  1K7A A;  2F5F A;  4ZDO A;  2E7X A;  2M30 A;  2XKO A;  4WCG A;  2EV0 A;  3JRE A;  2LVS A;  2Y9Z A;  2KJC A;  2EFQ A;  1VQN I;  1SD6 A;  4FIS A;  5B3S H;  5D5U B;  2CUJ A;  1LB2 A;  2KRH A;  2HOA A;  2Y0S N;  4MQV A;  4ZZL A;  1QRY A;  2O3F A;  5E1X A;  1T8I A;  4ZYD A;  1SFX A;  1U5T B;  2Z2S B;  3JSO A;  4WXC A;  4OIP F;  2TCT A;  2XPV A;  4G94 A;  2WBM A;  5LEK A;  3S93 A;  2DO7 A;  1NK2 P;  2A6T A;  1T0F C;  3E3V A;  1ZGJ A;  1LUJ B;  4KIS A;  3PO3 J;  5E1Z B;  2OZU A;  5H20 A;  3DQV C;  4UB6 C;  1V5F A;  2BZT A;  3W6K B;  3QOE A;  1DU6 A;  2F4O B;  1MDM B;  1DP3 A;  3CCM I;  2KL4 A;  5IPA A;  1Z3X A;  1PP7 U;  2GXA A;  2O9L A;  2BVM A;  1T2K A;  2MC4 A;  2RNG A;  4RLF A;  1OKR A;  3EDP A;  1FWZ A;  1V5G A;  4E4H A;  4OMY A;  5FD6 A;  4BAC A;  1IAW A;  3WTS C;  1I27 A;  2YSR A;  5HOD A;  5KCM A;  4BGD A;  3GTP J;  2EZK A;  1KON A;  3I54 A;  5E79 C;  5F64 A;  2DOD A;  2FMY A;  1UG2 A;  3LST A;  2Z5U A;  1HLV A;  2PQ8 A;  3S1N J;  2XF5 A;  3QYB A;  2CWE A;  2W00 A;  4ANJ A;  3L1P A;  5EGO B;  1S7O A;  5D6E A;  5AIP A;  2JN6 A;  3PQK A;  2LC2 A;  2PLY A;  4IOA F;  1Z77 A;  1UJ8 A;  2MG4 A;  4WK8 F;  2KDZ A;  3F22 A;  2EZH A;  2OA4 A;  5EEG A;  3V8K A;  3GCM A;  3CUQ C;  3TKY A;  1X2N A;  1DP7 P;  4ENN A;  2CW8 A;  1ENH A;  2KQR A;  2XB0 X;  1WKM A;  2DFI A;  2IJL A;  1UHW A;  3E97 A;  3VYU B;  4WWC A;  2VOP A;  1DGW Y;  5CVR A;  3ABL H;  2ZXH A;  4RAY A;  4OU0 A;  5CYV A;  3HGG A;  1ZH5 A;  3EET A;  4BNC A;  4L0Z B;  5J8C A;  2DMQ A;  4XRS G;  3CC4 I;  2FF4 A;  1U5T A;  1HDD C;  1JHF A;  1NG7 A;  4N4N B;  4PFP A;  2L01 A;  5DD4 A;  4UB8 C;  3G1O A;  3FMQ A;  1A31 A;  2K27 A;  3C7J A;  5ICF A;  4GO1 A;  1BW5 A;  2MW8 A;  1JKP C;  4RGX A;  3RQI A;  2O7O A;  1FC3 A;  2JVG A;  2HVQ A;  4I99 C;  1G3Y A;  3N05 A;  2XF6 A;  3OYH A;  2D45 A;  1IN8 A;  5TGT A;  5D4R A;  2CSO A;  2WY7 Q;  1MDM A;  1YLF A;  1W5S A;  2PEX A;  5LBQ A;  4M3B A;  2HPM A;  3CCQ I;  4AVP A;  3M4O J;  1GLN A;  2DDA A;  1HKQ A;  2E1O A;  5DUI A;  3W3C A;  1N75 A;  3TED A;  4LK1 F;  2CFX A;  3PSF A;  1BR2 A;  2WAF A;  3L00 A;  4YII A;  3PFI A;  1SAX A;  2JMW A;  2EIK H;  4NC8 A;  3WU2 C;  3DEE A;  4OOI A;  4BQO A;  5DYM A;  2ICW G;  4PUS A;  4LMY A;  1ZRC A;  3HC7 A;  2R7Z J;  4A3E J;  1N77 A;  1OPC A;  1W0T A;  1MBG A;  1Y39 A;  4G12 A;  3AL0 B;  2OTJ I;  1WZ2 A;  1IG7 A;  3CCJ I;  5EGO A;  4F55 A;  2VE9 A;  3VSL A;  4CXF A;  2X4H A;  3GEZ A;  3M07 A;  3KYL A;  2RNJ A;  2VOD A;  5DV5 A;  3Q0U A;  3ZQL A;  4BQN A;  1MH3 A;  1XD7 A;  2ADU A;  2CYY A;  4L18 B;  4QTR A;  2DQR A;  3U9G A;  4LG0 B;  3A0B C;  3NQO A;  4D0P A;  2FX0 A;  5FFZ A;  3ZP5 A;  4XKV A;  4IF4 A;  2D1V A;  1JI8 A;  3MKY B;  4K2E A;  1E3H A;  4ZDL A;  4FX0 A;  3GZN B;  3CMA I;  2VPL A;  2GIZ A;  1AOY A;  4LIU A;  5J1R A;  4P55 A;  3OL3 A;  2M0M A;  2PG4 A;  3EUH A;  1ON2 A;  5K1Y A;  2EQR A;  2MYS A;  3DTK A;  2AS5 F;  1ZRF A;  3I0T A;  3MEX A;  4ZJZ A;  2A07 F;  2CO5 A;  1XSX A;  3TL4 X;  3H3U A;  1ZGA A;  5TJJ A;  5IP9 J;  3MZ8 A;  3QPS A;  1D5Y A;  4DJA A;  4NUB A;  4FE4 A;  5GTI C;  2EIM H;  5E17 F;  2BY2 A;  1WGX A;  1J75 A;  1UMQ A;  5ICG A;  1K78 B;  2GWR A;  3JRA A;  2NVQ J;  3DEU A;  4KYW A;  1OCZ H;  2FXA A;  3TQN A;  1NHA A;  2HDC A;  3DBH B;  1Z91 A;  4RAZ A;  3BPX A;  3Q3S A;  3S8P A;  2W1O A;  4N9I A;  1D1A A;  2IPQ X;  4BQQ A;  3BTC A;  5FLX Z;  2R7X A;  1IUY A;  2R93 J;  1BI2 A;  4AM3 A;  5BQT A;  5GPA A;  1WPK A;  4RA2 A;  1L0O C;  4RDU A;  2GOM A;  1E17 A;  1JHH A;  2X6X A;  3CLQ A;  3LSH A;  2NS7 A;  4R8H A;  4FHT A;  2X1E A;  2ZCW A;  4AYB A;  1FYM A;  1B8I B;  2LG4 A;  3WTX C;  1MJB A;  5K7Z A;  2VBY A;  2QA4 I;  2NVY J;  2E34 A;  2VJI A;  2VJJ A;  4CZC A;  1YIT I;  1W0U A;  2ESH A;  3HSR A;  2ZNY A;  3V8L A;  3DWL E;  1J7K A;  3IV5 A;  3I9V 2;  4JX5 A;  1OLT A;  4J00 A;  1O7L A;  2LYC A;  3K1M A;  2WWY A;  2IGM A;  1QHG A;  1JJ8 C;  4A3M J;  4LG0 A;  1V3F A;  4X6A J;  4YEL A;  2VKV A;  1E2X A;  1I5Z A;  3Q9V A;  1VQL I;  5M5X J;  5IT9 Z;  3BTI A;  4XRF A;  1AA7 A;  4XLC A;  1D8K A;  2BY1 A;  3F8C A;  3K9T A;  4XLE A;  5IY5 H;  1ONV A;  3I5U A;  1IXR C;  4D7N A;  5LRS A;  2CS3 A;  4RB3 C;  4WX9 A;  2YX4 A;  3IH4 A;  1FOW A;  2M8G X;  2HOT A;  4HNT A;  2QZ8 A;  3TBI A;  2ME6 A;  4Z6Y A;  2IS4 A;  2EK5 A;  3ZMD A;  5LGU A;  2Q1Z B;  1JTX A;  2WAD A;  5L3B A;  3K1N A;  3K10 A;  3R60 A;  4CCL A;  4Y17 A;  2O6G E;  1IDY A;  1JT6 A;  4PZJ A;  1HCR A;  1E3P A;  5ED4 A;  3KEQ A;  1K78 A;  3IL2 A;  2DK8 A;  2EFN A;  4BE2 A;  2FRH A;  1MMS A;  1IRX A;  1FTT A;  4IVN A;  2LLK A;  1VQM I;  4I0A A;  4GFB A;  3GXO A;  2R5Z B;  4L5E A;  2V1D A;  1WJE A;  4A3K J;  3K4N A;  1R9T J;  2GA1 A;  1CGP A;  2W48 A;  1B6A A;  4UXN A;  4G6D A;  3KFW X;  3TGN A;  4X1E A;  2R5Y B;  3BG9 A;  1V4R A;  4PJL A;  1U78 A;  4XM3 A;  5EF6 A;  5M5W J;  3HXL A;  2P81 A;  3R0J A;  2MLK A;  3VOE A;  1MBE A;  1I3Q J;  4XQF A;  4RMN A;  4IZZ A;  4U7D A;  1B8I A;  2DA7 A;  2JSP A;  2VUM J;  5J47 A;  1ZN2 A;  1IC8 A;  1Z21 A;  5FJ8 J;  3GZ6 A;  2DTR A;  2CRG A;  1FP1 D;  2HGC A;  1ODD A;  5TRD A;  2QSH X;  4F7Z A;  1XCB A;  2HYJ A;  4Q47 A;  3E5X A;  2Y2Z A;  1SFE A;  3K4C A;  4CYC B;  3LMM A;  3IRR A;  5IYD J;  3QRF F;  2DOA A;  1FYL A;  5CJ9 A;  3WTU C;  2ZNZ A;  3HJE A;  5BPI A;  2QQ9 A;  3IRQ A;  2CUE A;  1P9Q C;  3CCY A;  5FFX A;  2HVS A;  1SD4 A;  4KFC A;  3ZMU A;  5CQE A;  4XSZ F;  2CV0 A;  4IHT A;  4HDU A;  5F0F A;  4EM0 B;  2DFE A;  2WAQ N;  3I4P A;  2EZL A;  3RIR A;  1K61 A;  4XRS A;  4KN4 X;  4A69 C;  2LFB A;  3AL0 C;  2VN2 A;  2IA0 A;  4CIC A;  3BG5 A;  3LQR A;  1N25 A;  5FKK A;  2QSF X;  4RS8 A;  2JA7 J;  3O2P E;  3RQ4 A;  5ERI A;  4L0Y B;  4XN0 A;  1YI2 I;  4GRI A;  4LB5 A;  1RUN A;  1GDT A;  3FMS A;  2A5Y B;  2LY9 A;  2R5Z A;  1BR1 A;  2NVU B;  4N0B A;  5EZG A;  5J8F A;  2UWM A;  2UXX A;  3RKY A;  2R5Y A;  5A2Q K;  3S1R J;  4BY7 J;  3RPQ A;  2OUM A;  2DT6 A;  2X6Y A;  2Z16 A;  3I53 A;  5DD8 A;  1HW2 A;  4KMU X;  1C0W A;  1GHC A;  2BBY A;  2WV1 A;  1HST A;  4NC6 A;  4CH7 A;  3KP5 A;  4G7H F;  2A69 F;  2CMP A;  4BXF A;  1VQ5 I;  4XL9 A;  1G3S A;  1P4W A;  4MO7 A;  1WJD A;  1DQU A;  3S3O A;  4M71 A;  1FBS A;  3KP4 A;  2VBX A;  2L9R A;  3LNQ A;  9ANT A;  4DYC A;  2V1X A;  4ABZ A;  1J0R A;  5JLW A;  1MSF C;  3G71 I;  2ETH A;  2Y0M A;  4HST A;  2XKP A;  2N8G A;  2VIX A;  2IGN A;  2QYO A;  3MVP A;  3IWZ A;  3WOD F;  2RVC A;  3RPU A;  1MW7 A;  1LFU P;  2QEX I;  2DW4 A;  2HS5 A;  5LEJ A;  4CYC A;  4MGR A;  3MCZ A;  3IH3 A;  2GIV A;  1ETO A;  2P6S A;  2VXD A;  5JVG F;  3SEQ A;  4DZP A;  1M1E B;  4A12 A;  1R4N B;  2EIL H;  1QVT A;  4CZZ A;  3ML6 A;  1XPX A;  4XLH A;  4UUS A;  1B72 B;  2E1M C;  2OPT A;  3FIW A;  4RGR A;  2F48 A;  5H6R A;  2P7V B;  2QWW A;  4WF2 A;  5ILU A;  1X1P A;  3V42 A;  3LWF A;  4YRV A;  3OIO A;  4A3F J;  2FSW A;  2CGP A;  4B8X A;  2F4M B;  1RZ4 A;  2TDX A;  3DPT A;  1E0E A;  1YJW I;  1LE8 B;  1VI0 A;  2LOO A;  3CUQ B;  5CVI A;  4UVA A;  4D5F A;  2KRF A;  3PUF A;  1ERD A;  3PSI A;  1I1G A;  2OBP A;  2DMT A;  4PCQ A;  2ZJR F;  1SAN A;  2XVC A;  4ZYG A;  1T39 A;  3OYK A;  2PFB A;  2HU9 A;  1PUF B;  4DOZ A;  1O3S A;  1VQ7 I;  3VWB A;  2CW7 A;  3AAF A;  5D5W B;  3V8J A;  3KZI C;  3R61 A;  2QUF A;  4PDK A;  3HDD A;  3OSF A;  4M9X A;  1Z3Y A;  2L54 A;  1T0F A;  3KEO A;  3ZR8 X;  4YIF A;  3HHG A;  1BJZ A;  3GUD A;  5FKN A;  5E8G A;  5HNH A;  1H0M A;  3HGY A;  1XMA A;  4HX7 A;  4XMY A;  2VKE A;  4QWQ A;  4G6Q A;  3H9Q A;  5L3F A;  1F1Z A;  2MBF A;  3CF2 A;  1JJ6 C;  1ITY A;  3K4K A;  3L2R A;  4KIB A;  5FLX K;  1Y1W J;  4DYQ A;  3VYS B;  1FBU A;  1MND A;  2L2O A;  3BR5 A;  5LGT A;  2E71 A;  2JT1 A;  2VJ4 A;  3GTK J;  3WE3 A;  3K6G A;  2NRA C;  5CKT A;  3K4J A;  3HRU A;  2DMN A;  2XRL A;  1MZB A;  5GTH C;  2AXT C;  3W2V A;  2K9M A;  4BUP A;  1B72 A;  1DUX C;  3DXJ F;  3HKZ A;  2A05 A;  1SVL A;  4DNC A;  1EV7 A;  2L9V A;  4FX4 A;  4HLX A;  3JTG A;  3G4S I;  2DFH A;  2M87 A;  1IZ1 A;  1VQK I;  1LE8 A;  4LFU A;  2DA4 A;  1SD5 A;  4MTD A;  3T8T A;  3CUQ A;  3IH2 A;  3PUB A;  2M1B A;  4OMZ A;  4IKF A;  3OR2 C;  2JUC A;  1MBH A;  4BS9 A;  1QPI A;  5BOX A;  1SC7 A;  1EJ9 A;  1HW5 A;  1XGN A;  1CF7 B;  3F8B A;  3WGG A;  4CO8 A;  1YS6 A;  2YPR A;  2ISZ A;  4HF0 A;  3Q9S A;  3SZT A;  3K1P A;  3V7R A;  4UUT A;  2L9N A;  4IHX A;  4IXA A;  3NWT A;  1P92 A;  3QP6 A;  4EM2 A;  4U88 A;  5HLG A;  2DJI A;  2DQL A;  4EJO A;  1XGS A;  1PUF A;  1W1W E;  3OYN A;  1A6Q A;  4PSX A;  2C6Y A;  5B5E C;  2JPB A;  2G7H A;  2K9S A;  3LSM A;  3H5N A;  5B66 C;  4U7B A;  2Z9O A;  4Z2Y A;  4XIC A;  1KU9 A;  1IDZ A;  3CO6 C;  1POG A;  2BOL A;  1Y56 A;  3CMM A;  1AU7 A;  1APL C;  2XV4 S;  1J5Y A;  2QEN A;  3N4M A;  4C2T A;  1IN6 A;  1OFC X;  1TQM A;  2BVL A;  4E7K A;  2JA6 J;  2P5K A;  3BZK A;  4OIQ F;  4LIV A;  4XKB A;  2FA5 A;  2IW5 A;  1E3O C;  4G6T B;  5M5Y J;  1HF0 A;  3NEU A;  1IGN A;  1WHU A;  3H35 A;  4H0E A;  1R1V A;  3NRV A;  4IL6 C;  4RM3 A;  1XSV A;  2PX9 A;  2RV8 A;  1JTY A;  4Y7N J;  1TZL A;  2ME0 A;  4I02 A;  1VTN C;  4A3J J;  2PJP A;  1Z7L A;  3VB2 A;  4U0Y A;  1RR7 A;  1BL0 A;  4E7H A;  1U9N A;  3RTR A;  1TT5 B;  3ZCO A;  1MSE C;  2ZBK A;  1HOM A;  2L5Q A;  3WTT C;  4CHU A;  1K83 J;  2KPM A;  3JRD A;  2LD5 A;  5AIQ A;  1H9G A;  2RDP A;  3FXM A;  4RAG A;  3K69 A;  1T33 A;  3MAJ A;  2OV7 A;  4BJ5 C;  2VKD A;  1IN5 A;  1W4M A;  2HVR A;  3RZO J;  2XF7 A;  1XS9 A;  3I4N J;  4XID A;  4ESF A;  2M7A A;  2ZXI A;  1W7P B;  1TWF J;  1CF7 A;  4UV8 A;  3SHF A;  3HOT A;  2CUF A;  1FSH A;  4KN7 X;  3GTM J;  3AG1 H;  4DZJ A;  1TP4 A;  3S2H J;  2NYX A;  1D8J A;  1JE8 A;  2KIF A;  3E7L A;  1O7F A;  3S2D J;  2XRO A;  4A93 J;  3GTL J;  3C1D A;  2UUZ A;  5DUK A;  2MA3 A;  2OCE A;  1J2X A;  3HTU A;  4P9U A;  3OYM A;  2V9P A;  3KET A;  3OYB A;  3UR3 C;  1P6R A;  4JBA A;  4JX6 A;  5IYB J;  1XB4 A;  4ENJ A;  2H6C A;  1X19 A;  3M7G A;  5J4Y A;  4BDY A;  1J09 A;  3M8E A;  4E7L A;  2R7D A;  4HYE A;  3OYC A;  3IKT A;  3FHN A;  4AC0 A;  4BYY A;  2IS1 A;  1QQI A;  1JXS A;  2HYF A;  2LR8 A;  4JOM A;  4KMF A;  2E35 A;  2KFD A;  1RPW A;  3BR0 A;  2K7L A;  2A3S A;  3KLO A;  1X3U A;  4RB0 A;  2IA2 A;  1YG2 A;  4B4C A;  1JT0 A;  4BXX J;  4IOC F;  4F91 B;  4XLN F;  1MH4 A;  3BJO A;  2QSG X;  2VC0 A;  3C18 A;  4HA8 A;  5E3O A;  1WQ2 A;  1X1B A;  3KIO A;  1CQT A;  1PUE E;  2X0L A;  3K4L A;  2FBH A;  2DI3 A;  2L3D A;  4EGZ A;  3I56 I;  3KP2 A;  1XMX A;  3ZPL A;  3PIO F;  3IAS 2;  3AG4 H;  2ZSH B;  3KYC B;  2ZFW A;  3BY6 A;  1ZEL A;  4I6Z A;  4CGZ A;  4Y33 A;  5LHH A;  3T1B A;  5EZH A;  4AUX A;  3RZD J;  2H09 A;  2CU7 A;  3EUA A;  1PYV A;  2BV6 A;  5D5V B;  4G7Z F;  1T56 A;  3O6B B;  1FZP B;  2KIS A;  4BKX A;  3JAM K;  1W7P A;  3LQQ A;  3HPG A;  4O3M A;  2LP0 A;  3L2W A;  1O3Q A;  1UB9 A;  5A2Q Z;  5DDG A;  2JRM A;  2VJ5 A;  1OJL A;  1WI3 A;  2P6T A;  3I3L A;  2L7M P;  2XAF A;  2DCE A;  1LFP A;  3BRO A;  3EYY A;  3GFL A;  3KEY A;  2BGC A;  5JHU A;  4RBO A;  5LGN A;  3SFZ A;  3H0D A;  2HZT A;  3MKZ A;  4OIN F;  2IBD A;  2UV1 A;  1DDN A;  3T8R A;  1GVD A;  1SD7 A;  5KK1 A;  3G1M A;  1OCR H;  3IKV A;  4EQQ A;  4FET A;  2QKM B;  2PN6 A;  4I2O A;  4A3G J;  3ZXS A;  1EH7 A;  3VEP A;  1TWH J;  4L9T A;  1A6I A;  4EEF G;  3L2U A;  3SEZ A;  1Y8R B;  2MLG A;  4B47 A;  5F27 A;  3WU1 B;  2A5W A;  3ECH A;  2V79 A;  3OS1 A;  5FRO A;  2VT3 A;  2CQX A;  3E6B A;  2OZ6 A;  2LBF B;  3JRI A;  3DU6 A;  3OS2 A;  1LFB A;  3CJT B;  4PJ0 C;  1OIS A;  2AQF A;  3ONQ A;  5K5Q A;  2DN0 A;  1UHS A;  2HOE A;  3R0A A;  3FWE A;  3KCC A;  1HW1 A;  3PM1 A;  4D7M A;  5DCF A;  3F8F A;  3SZP A;  1U8R A;  1WVR A;  2W82 A;  2VBW A;  4MLO A;  2FE3 A;  2R7O A;  5CVV A;  2XHK A;  1MIJ A;  4YG2 F;  3LOC A;  1W7P D;  2JJ7 A;  3RCO A;  2O61 A;  3A01 B;  1WJC A;  3V7C A;  4CSW A;  2L7K A;  2LRD A;  4FT8 A;  3MKW B;  1G4D A;  3FXL A;  2RRE A;  3S14 J;  2D2W A;  5ICC A;  1D1C A;  1ZRD A;  3HOS A;  1BI3 A;  3QYE A;  2COB A;  2KIM A;  2Y30 A;  2ZME B;  4OAY A;  4FE7 A;  3J81 Z;  5C4X J;  3TDU C;  5D5X B;  3GTG J;  3HM5 A;  1H8A C;  2H8R A;  4E7Z A;  2F5C A;  2LKX A;  1K4T A;  4W97 A;  2KT0 A;  4PGG A;  2E1M B;  4NDL A;  2XIG A;  3LAP A;  1ZR4 A;  3E5U A;  1R23 A;  1MD0 A;  3HBL A;  5FLM J;  2BXZ A;  2DPD A;  2VON A;  3ULQ B;  4BH9 A;  1X2M A;  5GP9 A;  3J80 K;  4YFK F;  5F0H A;  1QGP A;  4U0W A;  2R7S A;  1P2F A;  1RRJ A;  3LSG A;  2JQ7 A;  3PIP F;  1DPU A;  1VQ4 I;  2BHY A;  4ESB A;  3HYI A;  3BQZ A;  2STW A;  5JFR A;  4BBS J;  2F4I A;  1Z1D A;  2MSY A;  4MFD A;  3PFY A;  3WG9 A;  4A3L J;  5D4S A;  1B59 A;  2K9L A;  4YEJ A;  5GPC A;  4G9Y A;  3ZOB A;  1BOA A;  3WGH A;  4B1R A;  1XSD A;  2VPR A;  2LBF A;  3JRH A;  2BY0 A;  1V54 H;  4JX4 A;  3OYD A;  1FYK A;  2ELK A;  1DU0 A;  1B9M A;  2WB1 A;  2Q8K A;  4OAZ A;  4HW0 A;  3D0S A;  1QA6 A;  2CFO A;  3SFI A;  2CW0 F;  1ZQ3 P;  1FOK A;  2EIJ H;  3LSP A;  2IS2 A;  1UHM A;  3VFZ A;  3IAM 2;  1YFH A;  2V26 A;  3HOZ J;  5DS9 A;  1BJA A;  3HOY J;  3OSG A;  4B3X A;  2HQN A;  3S17 J;  1N78 A;  2COM A;  4OWR B;  1ZTR A;  5F6F A;  2ID3 A;  4AYB N;  4LB6 B;  3FIS A;  5J3L A;  5FKM A;  1R6R A;  2DT7 B;  3A01 A;  2LKS A;  2V1U A;  3OOP A;  2QGU A;  3ABK H;  3S1Q J;  2X6O A;  5HNF A;  2NXN B;  3RJP A;  2R7T A;  3FXQ A;  2ZME A;  1S6L A;  2GOX B;  1DGR M;  3G1L A;  1D1B A;  1TQI A;  1WWX A;  3LSJ A;  1D5V A;  3DTI A;  3V7S A;  3OOU A;  3CO7 C;  4AIK A;  5EYR A;  1FT9 A;  1RET A;  5HLH A;  5HLT A;  1RNL A;  3TOB A;  2XDV A;  2QM3 A;  3LSK A;  2HKX A;  2DMP A;  5LFA A;  4BJT A;  2K5C A;  3M3Y J;  5FRN A;  4F3Q A;  2L4M A;  5GAG J;  2VL8 A;  2M34 A;  2ESN A;  5AON A;  4FAS D;  4KIC A;  2IEK A;  1Z0X A;  3VDX A;  1V5E A;  2E60 A;  5HS9 A;  2K9Q A;  3CMY A;  1OYI A;  2W25 A;  3M9A A;  1T95 A;  4RLQ A;  4FTH A;  3D1N I;  2ECB A;  2M4G A;  4R1H A;  2DA5 A;  2VLA A;  3B6A A;  3REO A;  2K9N A;  1PP8 F;  3IP4 B;  1BI0 A;  3E0J B;  2W84 A;  2IXS A;  4BHP A;  3Q5F A;  4HPQ A;  2AO9 A;  3AG2 H;  1ZHF A;  2O0Y A;  2BW3 B;  3OMY A;  5J1U A;  4I76 A;  2HTS A;  3DV8 A;  4B3A A;  1FNN A;  3WG7 H;  2HXO A;  4E7I A;  1I6H J;  1GV5 A;  1ZLJ A;  4M72 A;  2HEO A;  1ETW A;  1GXQ A;  1LNW A;  2OC6 A;  1ETK A;  4QLC U;  2CG4 A;  3QOD A;  4XR6 A;  2OCC H;  3P9I A;  5IT3 A;  4MNU A;  4DBQ A;  2R7U A;  2O03 A;  2I10 A;  2Q2E B;  3OYF A;  4II3 A;  2IRF G;  4KT5 C;  2ELJ A;  2RC4 A;  2XGC A;  2CQK A;  1RKT A;  2JPC A;  2K4J A;  3G73 A;  2B7E A;  4V2G A;  4M6Y A;  1REP C;  3OYJ A;  1J59 A;  1HC8 A;  1GXP A;  4IO9 F;  2MAB A;  4BU2 A;  1XGM A;  5DEQ A;  4E70 A;  1XG1 A;  2M7B A;  3WTW C;  4MQ9 F;  1IF1 A;  2FEZ A;  3BCA A;  2DOE A;  1WH7 A;  1D3Y A;  3B73 A;  3BR1 A;  3QU3 A;  4JP0 A;  3HRT A;  2X9D A;  1BA5 A;  3ZQ7 A;  2O8X A;  2W4S A;  3GX4 X;  1MNM C;  2OTL I;  1XDS A;  1HKT A;  2GM4 A;  1JKO C;  3E1S A;  4P96 A;  4EJT A;  4M3G A;  2FOW A;  3FXJ A;  4PJM A;  5M3F J;  3E6M A;  4P5O A;  2Y31 A;  3BR3 A;  1LDJ A;  1X3Z B;  3WHB A;  1PJR A;  3F21 A;  2NOG A;  4KJZ A;  3ROU A;  1VQ8 I;  1F4K A;  3MFK A;  3IHU A;  3KX2 A;  2CUZ A;  2XB5 A;  1TWG J;  1IRF A;  3PL8 A;  1ZG5 A;  3CP2 A;  2NS0 A;  3E6C C;  2IS6 A;  3CCR I;  4F92 B;  1Y0N A;  3H92 A;  4A0Z A;  1Y1V J;  1YIO A;  4P9F A;  4XOP A;  4ZYE A;  3OS0 A;  2KKO A;  2XSD C;  2IGK A;  4P1W A;  3DF8 A;  4ZYH A;  2Z1D A;  1YO5 C;  4HX4 A;  2BW3 A;  3HIF A;  2CH0 A;  2X6W A;  2KZG A;  2XC7 A;  4HEA 2;  1UST A;  2CQ7 A;  3PNT A;  1ZGW A;  1NH3 A;  2K3F A;  4C9Y A;  1TLH B;  2BEO A;  3F72 A;  4CCJ A;  3WGI A;  3K2A A;  2ZME C;  5ILS A;  2D5V A;  1A5J A;  2LK2 A;  2WV0 A;  3JAM Z;  4ASN A;  3QYF A;  1TT0 A;  2X1D A;  2Q2E A;  3S2W A;  3BJA A;  3C2G A;  4B09 A;  4Y13 A;  3OR1 C;  4HLY A;  4E7J A;  3I64 A;  1ORK A;  4L9J A;  2VQG A;  1U8B A;  1UFM A;  1H89 C;  1I50 J;  2R7R A;  1KQ9 A;  2CV2 A;  3CC7 I;  2M4K A;  1SMT A;  1TWA J;  4L5I A;  2HDW A;  3ERE D;  2BXY A;  2VQL A;  2XAU A;  1AHD P;  2M3A A;  4HZF A;  4ZH4 F;  4BHB A;  3CDH A;  1VQ9 I;  5HLI A;  1R58 A;  2QBY B;  2F2E A;  1IV8 A;  4C3J J;  4GYG A;  3EQL F;  4Q4Z F;  2K40 A;  3BR2 A;  1QZE A;  2Y75 A;  4XKC A;  3HL2 A;  3I4M J;  3C2H A;  3LL7 A;  1SEU A;  2FJ1 A;  5FD5 A;  1SFU A;  3QPL A;  2XRN A;  3MQ0 A;  1GT0 C;  3SDG A;  2P4W A;  3BG3 A;  4ENK A;  3G2B A;  2NNY A;  2YX7 A;  4EAT A;  2CJJ A;  3RKQ A;  4M6V A;  1WSU A;  2E2H J;  2P8T A;  1FMV A;  1TNT A;  4GCV A;  3BWG A;  1UZC A;  4PFO A;  4DW6 A;  1JGG A;  3CD6 I;  2FML A;  5B1B H;  3H3Z A;  2MFZ A;  4IQ4 A;  3J81 K;  1VZ0 A;  4C2U A;  3WTZ A;  2R92 J;  4LLN A;  1WJ5 A;  4I98 B;  2DFF A;  3OYL A;  3CF5 F;  2ZKZ A;  4QPQ A;  1YX5 A;  4XN3 A;  1GUU A;  2RKH A;  1XCV A;  1TBX A;  4CA0 A;  5D8L B;  2IGO A;  5FO5 A;  1LEB A;  1WJA A;  1KU2 A;  1NG6 A;  5FRM A;  5K5O A;  5HDG A;  1LKX A;  2PBI A;  3H1C A;  3T0Y A;  3LAJ A;  4J01 A;  2XPW A;  5FB2 A;  2WY8 Q;  1HBX G;  4IQJ A;  1S7E A;  2H6B A;  2K3P A;  4AWX B;  5E3M A;  1TNS A;  1JKR C;  4AD9 A;  3PQJ A;  5F1R A;  3VOD A;  2AXL A;  2Y69 H;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 2NVT J;  3GTQ J;  4JX6 A;  4UUS B;  4XK4 A;  2E19 A;  5IYB J;  3JRA A;  2NVQ J;  4A3C J;  1MBK A;  5IOZ A;  2DA1 A;  2JWT A;  1HDP A;  5IOY A;  2H1K A;  4AC0 A;  3HEF A;  1F43 A;  3Q3S A;  2MGQ A;  2L7F P;  2LR8 A;  1VFC A;  1WH5 A;  2EZI A;  2DA2 A;  3HOU J;  3BTC A;  3S1M J;  3BR0 A;  1RPW A;  4S0H B;  2R93 J;  3C2B A;  4J19 A;  1AKH B;  1FTZ A;  4B4C A;  5GPA A;  1JT0 A;  1WPK A;  4BXX J;  2HDD A;  1MH4 A;  4RDU A;  3TW7 A;  5E3O A;  3JRC A;  2NS7 A;  1CQT A;  3JR9 A;  1B8I B;  3CQZ J;  5K7Z A;  2NVY J;  1W0U A;  3O8H A;  4I6Z A;  3IV5 A;  2DTZ A;  2OF7 A;  2PMZ N;  4JX5 A;  3O8G A;  1IV6 A;  1U9O A;  5EZH A;  4AUX A;  3RZD J;  2CU7 A;  1JJ8 C;  3HKZ N;  4A3M J;  1T56 A;  4X6A J;  5FKO A;  2VKV A;  1YRN B;  4BKX A;  3MKL A;  3FK6 A;  2LP0 A;  5M5X J;  3BTI A;  1MBJ A;  1NTC A;  1OJL A;  1WI3 A;  4D7N A;  2L7M P;  2ECC A;  2ZB9 A;  4A3B J;  4RBO A;  2M0C A;  3IH4 A;  5DTD A;  2M8G X;  2HOT A;  1P7J A;  2ME6 A;  2IBD A;  2GBY A;  5EG0 B;  4IHW A;  1GVD A;  1Q1V A;  1JTX A;  3G1M A;  3ZQI A;  5EDN A;  4A3G J;  2YUS A;  3ZQG A;  1ZKG A;  4FCY A;  1X58 A;  3HB9 A;  1TWH J;  4W1U A;  1IDY A;  1A6I A;  1JT6 A;  4EEF G;  1HCR A;  2DMU A;  5F27 A;  1FTT A;  2LLK A;  3VPR A;  4GFB A;  5M3M J;  2R5Z B;  2QCO A;  4L5E A;  2O8K A;  4A3K J;  1R9T J;  2CQX A;  5IP6 A;  2W48 A;  3JRI A;  4C2M J;  3H3V K;  4IHY A;  4A3I J;  5E3L A;  1LFB A;  4X1E A;  1AKH A;  2R5Y B;  3BG9 A;  5FKL A;  1U78 A;  2DN0 A;  5EF6 A;  1UHS A;  5M5W J;  2P81 A;  2M2E A;  3A03 A;  1MBE A;  3PM1 A;  3TW6 A;  4D7M A;  4C3I J;  1FEX A;  1I3Q J;  1B8I A;  4MLO A;  3BTL A;  2DA7 A;  2QF7 A;  3K7A J;  4D5C A;  2VUM J;  1SFO J;  2FQ4 A;  2R0Q C;  3LOC A;  1IC8 A;  2JJ7 A;  5FJ8 J;  4M3F A;  3ZQF A;  1H88 C;  3A01 B;  2CRG A;  1RKW A;  1YRN A;  3S14 J;  3A02 A;  2HYJ A;  1ETY A;  3BQY A;  3S16 J;  2Y2Z A;  4CYC B;  2COB A;  2Y30 A;  5IYD J;  4FE7 A;  5C4X J;  2L0K A;  4V2F A;  2AHQ A;  3HM5 A;  3GTG J;  1H8A C;  2CUE A;  2H8R A;  5IYC J;  3CCY A;  1ZK8 A;  2LKX A;  4W97 A;  3WHC A;  5IP7 J;  1JUP A;  2KT0 A;  3F0C A;  3NAU A;  4NDL A;  5F0F A;  4Y52 J;  5EG0 A;  1ZR4 A;  2HQ5 A;  3HBL A;  5FLM J;  5E3N A;  2WAQ N;  2EZL A;  4BY1 J;  1X2M A;  5GP9 A;  5F04 A;  1K61 A;  4XRS A;  5F0H A;  4A69 C;  2LFB A;  3JRG A;  2JK3 A;  5C3E J;  2EH3 A;  1NK3 P;  1ETQ A;  3BG5 A;  3LSG A;  1IUF A;  5FKK A;  3ZQC A;  2JA7 J;  3BQZ A;  4BBS J;  2MSY A;  4MFD A;  4A3L J;  2EBI A;  4JYK A;  4HNV A;  1GDT A;  2LY9 A;  2RAE A;  3TP3 A;  2R5Z A;  1FIA A;  5GPC A;  4B1R A;  5EZG A;  3ZOB A;  2L7Z A;  2VPR A;  3Q0V A;  3JRH A;  4JX4 A;  2NS8 A;  3MN2 A;  2ELK A;  2B63 J;  1DU0 A;  2R5Y A;  1F36 A;  3S1R J;  4BY7 J;  3SFI A;  1ZQ3 P;  1O4X A;  3PO2 J;  3LSP A;  2WV1 A;  4MIM A;  3HOZ J;  5DS9 A;  3HOY J;  3OSG A;  4MO7 A;  3S17 J;  2E2J J;  3GTO J;  3B6C A;  2FD5 A;  4IHV A;  4QIW N;  2L9R A;  3LNQ A;  9ANT A;  4DYC A;  5JLW A;  4ABZ A;  1ZTR A;  2GLO A;  1G2H A;  2ID3 A;  1MSF C;  4AYB N;  3FIS A;  5J3L A;  4LOC A;  5FKM A;  3A01 A;  2N8G A;  1OCT C;  2XPU A;  2NVX J;  5K7F A;  3MVP A;  3S1Q J;  2X6O A;  3BT9 A;  1OCP A;  1LFU P;  2YS9 A;  4CYC A;  4IEJ A;  3IH3 A;  4BBR J;  1ETO A;  2G0E A;  3G1L A;  4M3D A;  4DZP A;  3LSJ A;  1JUM A;  1QVT A;  3OOU A;  5BNG A;  2CQQ A;  4UUS A;  1B72 B;  5EYR A;  2OPT A;  3FIW A;  1RET A;  1EF4 A;  1MBF A;  3HOW J;  3Q0W A;  2DMP A;  3CDL A;  5FLV A;  2DJN A;  3OIO A;  4A3F J;  3M3Y J;  4XRM A;  3DEW A;  3JRF A;  1IJW C;  2M34 A;  4M3E A;  2IEK A;  1LE8 B;  1VI0 A;  1Z0X A;  2K9Q A;  3CMY A;  2IAI A;  1TWC J;  1IRZ A;  3JRE A;  4D5F A;  5C44 J;  2LVS A;  2Y9Z A;  4FTH A;  3D1N I;  1QVU A;  1XC5 A;  5J1Y A;  2ECB A;  4FIS A;  2DA5 A;  2HOA A;  2Y0S N;  2DA6 A;  3B6A A;  2DMT A;  2XGE A;  2K9N A;  2E2I J;  1QRY A;  1SAN A;  2AO9 A;  2TCT A;  1BW6 A;  2XPV A;  5J1U A;  1PUF B;  4I76 A;  4B3A A;  1NK2 P;  1WCM J;  2HXO A;  3HDD A;  1I6H J;  1GV5 A;  1ETW A;  3PO3 J;  3OSF A;  1ETK A;  2X48 A;  1ETX A;  1DU6 A;  1RES A;  1BJZ A;  5FKN A;  3HGY A;  3GBG A;  2I10 A;  2VKE A;  5F1J A;  5IPA A;  2O9L A;  2XGC A;  1RKT A;  3HOX J;  4V2G A;  2DA3 A;  1JJ6 C;  3FKI J;  1ITY A;  3JRB A;  3LSR A;  1Y1W J;  1TC3 C;  4DYQ A;  5C4J J;  2HOS A;  5HOD A;  3H0G J;  3GTJ J;  3GTP J;  1XG1 A;  2EZK A;  3BR5 A;  3GTK J;  2XGD A;  1WH7 A;  1UG2 A;  4MFE A;  2DMN A;  2XRL A;  2HI3 A;  3BR1 A;  5K7H A;  1HLV A;  4JP0 A;  4DYR A;  3S1N J;  3NAR A;  1B72 A;  3L1P A;  2JA8 J;  2VI6 A;  2X9D A;  3SJM A;  5EGO B;  1BA5 A;  1MNM C;  2GM4 A;  2JN6 A;  4QSH A;  1JKO C;  1Z77 A;  4M3G A;  2MG4 A;  2KDZ A;  5M3F J;  4A3D J;  2EZH A;  2LTP A;  2Y31 A;  3BR3 A;  3WHB A;  2NOG A;  2M9H A;  3BTJ A;  3ZQH A;  1X2N A;  1LE8 A;  1ENH A;  2XB0 X;  2XB5 A;  1TWG J;  2DA4 A;  3IH2 A;  1MBH A;  3HOV J;  1FIP A;  1P7I A;  1QPI A;  3HGG A;  1Y1V J;  3W6V A;  2DMQ A;  4UUT A;  4XRS G;  2XSD C;  4IHX A;  1HDD C;  1PUF A;  5EEA A;  3G1O A;  1ETV A;  1ZGW A;  1BW5 A;  2MW8 A;  1JKP C;  2K9S A;  3RQI A;  3K2A A;  2O7O A;  1IDZ A;  4XIC A;  2D5V A;  3S15 J;  1POG A;  1APL C;  1AU7 A;  1GV2 A;  1A5J A;  2LK2 A;  2YU9 J;  1OFC X;  2WB1 N;  4M3B A;  2JA6 J;  3M4O J;  1FJL A;  2E1O A;  3TED A;  1ORK A;  1E3O C;  1U8B A;  1H89 C;  1I50 J;  5M5Y J;  1HF0 A;  2JMW A;  1IGN A;  2JA5 J;  5F08 A;  1ZR2 A;  1TWA J;  2ID6 A;  1JTY A;  4Y7N J;  3DCF A;  1AHD P;  2ME0 A;  2R7Z J;  4A3E J;  1JUS A;  4A3J J;  3BR6 A;  1W0T A;  1MBG A;  4C3J J;  4G12 A;  2K40 A;  1RR7 A;  1BL0 A;  1IG7 A;  3BR2 A;  1U9N A;  5EGO A;  3I4M J;  3FK7 A;  1MSE C;  1HOM A;  5F0C A;  2FJ1 A;  1K83 J;  3QPL A;  3JRD A;  1GT0 C;  2LD5 A;  3SDG A;  3BG3 A;  2Y9Y A;  1T33 A;  2CJJ A;  3RKQ A;  4M6V A;  1VND A;  3Q0U A;  2E2H J;  3ZQL A;  1MH3 A;  3RZO J;  4QTR A;  3QQA A;  4DW6 A;  1JGG A;  1XS9 A;  3I4N J;  4XID A;  2FX0 A;  2TRT A;  5JLX A;  2R92 J;  1TWF J;  3TP0 A;  4C3H J;  2CUF A;  5J1R A;  3GTM J;  4DZJ A;  1GUU A;  3S2H J;  2EQR A;  3E7L A;  3S2D J;  4A93 J;  3GTL J;  5IP9 J;  3QPS A;  1D5Y A;  2XPW A;  1S7E A;  4FE4 A;  2HXI A;  5E3M A;  1VF9 A;  1JKR C;  3UKG A;  1JKQ C;  1WGX A;  1UMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...