1HDPA

Solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
RRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a POU-specific homeodomain: 3D-NMR studies of human B-cell transcription factor Oct-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords OCT-2 POU HOMEODOMAIN
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hdpA00
1AHDP 1XC5A 2K9QA 5EG0A 5FLMJ 3IH4A 1BJZA 2EZHA 1NTCA 3FIWA 3NARA 4ABZA 2NOGA 4IHYA 3I4NJ 2ID6A 4BBRJ 1SANA 5EGOB 3DEWA 5EF6A 3GBGA 1F36A 1RR7A 1IG7A 5IYDJ 3FKIJ 2L9RA 5F0HA 3L1PA 2IAIA 3TEDA 1IUFA 2YS9A 3PO3J 4UUSA 1B8IA 1OJLA 1U78A 2QF7A 2XB0X 1UMQA 3A03A 1EF4A 1ETKA 1QVUA 3BR5A 1X58A 1QPIA 2ECBA 2K9SA 4A3BJ 1IC8A 3HOWJ 4NDLA 1GUUA 4JP0A 3A01B 2WV1A 4MIMA 5JLWA 3JRFA 5F08A 1HF0A 1G2HA 1DU0A 3RZDJ 3MVPA 1X2MA 3GTKJ 2L7ZA 3FISA 2X9DA 3JREA 3HOVJ 2DTZA 1JJ8C 2WB1N 3B6CA 1BA5A 1ITYA 2EZLA 4M6VA 1MBEA 2YUSA 4BY1J 1QVTA 3MKLA 3HGGA 5FKKA 2LKXA 3M3YJ 1WCMJ 2LY9A 2DA5A 2MW8A 1H8AC 1HDPA 2K40A 2O7OA 4UUTA 2JWTA 4QTRA 3GTJJ 4C3JJ 5EDNA 1WGXA 3ZQLA 1WH7A 1W0UA 2FX0A 1VF9A 2R93J 1WPKA 4HNVA 1RKWA 4I6ZA 1P7IA 3LOCA 2KDZA 2LLKA 1H88C 3E7LA 3HOYJ 5GPAA 3C2BA 2H1KA 1UHSA 2GLOA 2ID3A 1IV6A 5EYRA 1T33A 4D5FA 5GP9A 3LSRA 1TC3C 1UG2A 2R92J 3BR3A 2L7FP 1IDYA 1H89C 1ETOA 3GTOJ 4MFEA 3ZQFA 1A6IA 1XG1A 2VKEA 2Y31A 2ZB9A 1GV5A 2G0EA 1OCTC 4DZPA 3HM5A 2VKVA 3ZQCA 1TWGJ 3Q0UA 2AHQA 3BG3A 2HYJA 4B1RA 1TWHJ 3JR9A 3WHCA 3LSJA 2JA7J 2M9HA 5EZHA 4A93J 3GTPJ 3RKQA 2E1OA 2L0KA 4A3IJ 3B6AA 3I4MJ 2LP0A 5FKOA 4XRSG 5K7FA 4DZJA 2M0CA 1JUMA 1ZK8A 2P81A 2CQQA 3IH2A 5IP6A 2NS7A 4DYRA 3S15J 3HOUJ 1ZQ3P 2JA8J 1I3QJ 3ZQGA 4EEFG 1ENHA 2M34A 1RKTA 2DJNA 5FKLA 3S16J 4FTHA 4Y52J 1HOMA 2DA2A 2E2HJ 1AKHA 3S1QJ 3TW7A 2K9NA 2XGEA 1P7JA 2FD5A 3BG9A 2CQXA 2NVXJ 3HOZJ 1GDTA 5J1RA 4UUSB 4M3BA 1B8IB 4W97A 4MLOA 2LR8A 3HBLA 3JRIA 2XPWA 2R5ZB 2ME0A 4M3DA 3PM1A 2MSYA 1Y1WJ 4A69C 2Y30A 1JKOC 2DMUA 4A3FJ 1GVDA 3HGYA 3WHBA 4DW6A 4IHXA 5K7HA 1CQTA 1WH5A 1VFCA 2DN0A 2HXIA 1WI3A 3SFIA 3ZOBA 3S14J 4BBSJ 1LE8B 2VPRA 3OOUA 3JRHA 2MG4A 4BY7J 1B72B 4JYKA 1JKPC 2EZKA 1FTTA 3GTMJ 2YU9J 4AC0A 3IV5A 3W6VA 1JT6A 1YRNB 4IHVA 2TCTA 1APLC 4CYCB 2CUEA 3BR2A 1JKRC 1ZTRA 3Q0VA 2CU7A 1ZGWA 2LD5A 3BQZA 2H8RA 1W0TA 5IP7J 3H3VK 2CRGA 2DMPA 1OCPA 4G12A 4D7MA 2O8KA 1FIPA 2M8GX 3TP0A 4LOCA 2NVQJ 2HI3A 3SDGA 1GT0C 1Y1VJ 1VI0A 5DTDA 5BNGA 3JRBA 2DA3A 1LE8A 4S0HB 4JX4A 2JA6J 2R5ZA 2RAEA 5EG0B 2AO9A 1IJWC 1IDZA 1O4XA 5C4XJ 3JRAA 1TWFJ 2HQ5A 4XRSA 1MH3A 4C3HJ 2GBYA 4A3KJ 1YRNA 2DA1A 5F0CA 5EGOA 3BR0A 1JTYA 2EH3A 4M3EA 5FJ8J 2TRTA 1I6HJ 3UKGA 1MBKA 2M2EA 2LTPA 3CQZJ 2L7MP 1LFBA 2IEKA 1NK2P 1X2NA 2B63J 5E3LA 3ZQHA 2LK2A 3H0GJ 5J1YA 2N8GA 1ORKA 2FJ1A 2HOSA 4X6AJ 3K7AJ 3MN2A 5FKNA 3A01A 2HOAA 1MBHA 2NS8A 3OIOA 3G1OA 1OFCX 2JN6A 5C3EJ 1Z77A 3VPRA 5HODA 5C44J 1U9OA 5C4JJ 1HCRA 3Q0WA 2JK3A 4GFBA 4A3LJ 2ECCA 4IEJA 2R5YB 5E3OA 5IPAA 4A3EJ 2QCOA 2JMWA 2VUMJ 4X1EA 2Y2ZA 1GV2A 2DA7A 3A02A 3F0CA 3JRDA 5F1JA 4A3DJ 2DMTA 1AKHB 1HLVA 1BW5A 3BG5A 3NAUA 4MFDA 2OF7A 2MGQA 5F0FA 5J3LA 1ETXA 2Y0SN 4FE4A 1E3OC 2X48A 1TWAJ 4C3IJ 5FKMA 5EZGA 1Q1VA 1D5YA 3BR1A 4V2GA 4B3AA 5M5XJ 1FJLA 5FLVA 3LNQA 3OSGA 2VI6A 3JRGA 3SJMA 3BQYA 1RPWA 3K2AA 2DA6A 3BTCA 3IH3A 2IBDA 3O8GA 5IOYA 1JGGA 4W1UA 1IRZA 2CUFA 2COBA 2W48A 1IGNA 1K83J 4J19A 4L5EA 1U8BA 3HOXJ 2D5VA 1ETWA 1MSEC 3CCYA 1ETVA 4JX5A 3D1NI 1MBGA 5IYCJ 3JRCA 2NVTJ 5M5YJ 2Y9YA 5M3FJ 2CJJA 1VNDA 1RETA 5JLXA 1PUFA 5GPCA 2XRLA 4QSHA 1DU6A 4XK4A 4D5CA 1FEXA 4M3FA 4IHWA 3LSGA 2WAQN 5DS9A 4XIDA 3GTGJ 3RQIA 5F27A 1POGA 3OSFA 3M4OJ 3TP3A 2HXOA 4QIWN 3BT9A 2XPVA 4CYCA 5IOZA 1U9NA 3BTIA 2ME6A 2E19A 1Z0XA 3S1RJ 2LVSA 3S2DJ 1BW6A 5F04A 4DYQA 2XB5A 2XGDA 2LFBA 3DCFA 1JJ6C 2FQ4A 3HDDA 1R9TJ 2JJ7A 3HB9A 3TW6A 2KT0A 3ZQIA 3Q3SA 5M3MJ 1JKQC 4MO7A 3GTLJ 5J1UA 5E3MA 3S1NJ 4XRMA 1XS9A 4FCYA 2R7ZJ 3QQAA 3GTQJ 3FK6A 2EZIA 2XSDC 1I50J 9ANTA 3BTLA 1BL0A 2E2IJ 4BXXJ 2Y9ZA 4FISA 3BTJA 2XPUA 2OPTA 1MBJA 2DMNA 4V2FA 4RDUA 2EBIA 2GM4A 5M5WJ 5EEAA 1ETQA 1PUFB 1QRYA 3S17J 5IP9J 1JT0A 3QPLA 1JUPA 1B72A 3HEFA 1RESA 3CDLA 1ZR4A 3S2HJ 1SFOJ 4B4CA 2PMZN 2DMQA 4DYCA 2R5YA 2JA5J 3S1MJ 1ZKGA 4A3CJ 4XICA 1NK3P 2I10A 1ETYA 1MSFC 4A3GJ 1LFUP 1JUSA 1MH4A 3O8HA 2DA4A 3HKZN 1FIAA 2HDDA 1A5JA 3G1MA 4C2MJ 1ZR2A 1F43A 1JTXA 3CMYA 1AU7A 4A3JJ 5K7ZA 3QPSA 4A3MJ 3PO2J 4BKXA 3FK7A 4D7NA 3RZOJ 2X6OA 1MNMC 2HOTA 5E3NA 4I76A 1TWCJ 4FE7A 1MBFA 3LSPA 2EQRA 2ELKA 5IYBJ 4AYBN 2E2JJ 1FTZA 4AUXA 1K61A 1HDDC 2NVYJ 3BR6A 1S7EA 4Y7NJ 1T56A 2XGCA 3G1LA 2R0QC 4M3GA 2O9LA 4JX6A 4RBOA
chains in the Genus database with same CATH superfamily
2P6TA 1VQ9I 2IA0A 5EG0A 5FLMJ 3IH4A 1Z3YA 4M9SA 4NB5A 2XGXA 4J00A 2Y69H 1S72I 4ENNA 1BR1A 2V79A 4KDPA 3I4NJ 5CVIA 4DBQA 3GBGA 3WU1B 1CF7A 1IG7A 5L3EA 2L3DA 2L9RA 3F8CA 3RKWA 3L1PA 3TEDA 2R3SA 2HR3A 4UUSA 4ZC3A 4WXHA 4M9XA 1OJLA 1U78A 2QF7A 1ULYA 1UMQA 3ZQ7A 3ZMUA 3DLAA 2DQRA 5DCMA 1QVUA 3I53A 4EATA 4A3BJ 4MNUA 5D4SA 1YW9A 5DV5A 5ICEA 2E5ZA 3OOPA 1XSDA 3BZKA 3TO9A 3RZDJ 1X2MA 3DPUA 3EDPA 3OYLA 1AWCA 1LDDA 2RQPA 1G3YA 4M6VA 1VQPI 4Z6YA 1ITYA 1Y39A 2V1UA 3MWMA 1XX5A 1O3TA 5JHUA 5HLHA 2E7XA 3KPHA 3A0HC 2LKXA 1WCMJ 3K4BA 4EQQA 3HKZA 4OIPF 1FSEA 4UUTA 3AKZA 2ZKZA 2HVSA 4B43A 1IN8A 1FYLA 1E0EA 3HSFA 3BCAA 2FX0A 2W85A 1RKWA 4G9YA 5FFZA 2IS4A 2KDZA 3OL3A 2LLKA 4XN3A 4XQFA 2XRNA 1RZ4A 4N4NB 3I71A 3MD2A 4BDZA 2DXIA 3DU6A 4L9NA 2GLOA 1R58A 2STWA 5EYRA 2GXAA 2GOXB 3EUKL 1T33A 4D5FA 3DQVC 4FHTA 5FD5A 4C2UA 3ASOH 3PNVA 3M1CA 3RPUA 3OYNA 5FO5A 2OU2A 3BY6A 1Z21A 3N05A 3WGIA 3G2BA 4DGWB 5AIPA 1ODDA 3N97A 4XLCA 4DZPA 1WFXA 2VKVA 1TWGJ 1Y0NA 2V1XA 2Z16A 3WHCA 4L18B 5GAHJ 1U5TA 3JAMZ 2JA7J 1XGNA 1WJFA 2M9HA 4M9ZA 2KZGA 2GA2A 2D2WA 1TTYA 3RKQA 2A05A 3LAJA 2A5YB 3HPGA 2EINH 2P4WA 4I02A 1G3WA 5FKOA 4XRSG 1SMTA 2X85A 4YELA 4BXFA 1JUMA 1ZK8A 3IH2A 3NQOA 1FYMA 5IP6A 2YR2A 4DYRA 1J2XA 2LYCA 2XUBA 3MFKA 4KA4A 1I3QJ 2Q8KA 2FNAA 2DDAA 3WG7H 4I0AA 3MKYB 1ENHA 1X1BA 2O03A 3DKYA 2MC3A 3OYIA 2X6YA 1W36D 3S16J 1HOMA 1BOAA 1PUEE 2E2HJ 3DEUA 3H5NA 3G71I 1ZH5A 5CJ9A 1ZLJA 1V3FA 3CMAI 4IVNA 3ABLH 2UUZA 1T0FA 2FD5A 2Y75A 3TKYA 1DGRM 5AIQA 2NVXJ 2M30A 3HOZJ 4UUSB 4KNYA 4KIBA 5HS8A 4MLOA 3JRIA 2DOFA 1PYVA 2G9WA 3OWTA 2JRMA 2F5EA 3D0SA 4DNCA 2C6YA 3KEYA 2P0WA 4O5VA 4ESJA 1ACIA 3JAMK 4HA8A 4M3DA 1CF7B 4GXOA 3H36A 2O61A 2E1MC 3RDIA 2QQBA 1D1BA 3BWGA 1SFXA 4UVBA 5K5RA 3E5XA 4A3FJ 1K78A 1GVDA 3HGYA 3V8LA 1CQTA 4RGSA 1VFCA 1BI3A 3X2QH 3IRQA 2MC4A 4BJ6C 1HKTA 1V5EA 3OYCA 1X1CA 4G8XA 3WTYC 1T98A 1GVJA 1EV7A 5BS6A 3L2VA 2B7EA 4IHTA 5D5VB 2YU9J 4AC0A 2DCEA 3H9QA 4E7ZA 1YRNB 1IN4A 5ILSA 2CUEA 2DTRA 3H3ZA 2VQLA 2R7VA 3O3KA 1ZGWA 1FBSA 2NAZA 3ZR8X 1V54H 4AD9A 2QEXI 3KYCB 1I6XA 3J81Z 4OIQF 3CLOA 2FBIA 2EPFA 2O8KA 1W5CC 2KKOA 4PJJA 4AVZA 4WF2A 3RQ4A 3K1MA 3K0LA 3HTSB 2LBFA 1GT0C 1Y1VJ 1UAAA 2K4JA 1VI0A 5JHFA 3SEZA 1FOXA 1WJCA 4UVCA 2DA3A 2CW0F 3QP6A 2LSOA 2BYVE 2JA6J 2R5ZA 2RAEA 2R7SA 4EM0B 3RYPA 1W1WE 3AG4H 2VC1A 3K4MA 3LSHA 3TQNA 4U7DA 3CP8A 1UHMA 1XB4A 1P2FA 2AXTC 2GBYA 4G7ZF 2BVLA 3OYDA 4A3KJ 1O7FA 2K02A 2EFWA 4AIHA 5F0CA 2P5KA 3ABKH 3KZZA 1K4SA 1UELB 1U5TB 2QLZA 2M4KA 4EM1A 5CVJA 3CQZJ 2JT1A 3HSRA 2NVUB 5CKTA 2HOEA 1SFKA 2B63J 2BHZA 5KAIC 3EYIA 2XF7A 5E3LA 3WGHA 5IY5H 3H0GJ 1S3JA 5J1YA 1R1VA 3Q9VA 1MJBA 2J5PA 4X6AJ 1B6AA 3K7AJ 3GYHX 4BYYA 1OKRA 1LNWA 2HPMA 3A01A 3W2VA 2LC2A 2PFBA 1TNTA 4ASNA 2IW5A 4WXDA 1EJ9A 1TT0A 1ONVA 4XLFA 3VPRA 3CJRB 4PSWA 2HGCA 3KP7A 5C44J 2EFPA 4HAMA 1HCRA 2DOEA 2JK3A 3HRSA 4GFBA 4JOMA 4BHCA 2PJPA 2CS3A 2K9MA 4IEJA 1Z67A 4A3EJ 5KHDA 3UR3C 3BROA 2A61A 3L2UA 1OCZH 3AL0B 3ECOA 3ZMVA 3EPZA 4X1EA 2DFIA 1GV2A 1VQ8I 3L09A 1OYYA 4CSWA 4A3DJ 2E5NA 1V5GA 2LY2A 4MFDA 3NAUA 1FT9A 2OF7A 3V7SA 4PGGA 1ETXA 4QPQA 2VJ4A 2CH0A 5B1BH 3FXUA 2BBYA 2L9NA 2UZKA 1R6RA 1FY7A 5EZGA 1Q1VA 1TW3A 1MJAA 2OZUA 5K5QA 3BR1A 3JTGA 4F93B 5J6XA 1RC9A 3EUHC 1W36C 5H20A 1SAXA 5FLVA 3JRGA 2A6HF 2QQAA 2DYSH 4CGZA 3K2AA 3O8GA 2QBYA 5IOYA 3CO7C 3TBIA 5BMZA 4Q47A 2K4BA 3CMMA 3PIPF 1U8BA 3HOXJ 3CC4I 3SZTA 3WE3A 3K4NA 1STZA 1YFHA 1G59A 2PX9A 3ONQA 2P5VA 3ZXSA 2Y9YA 1UG0A 1BIAA 2KHMA 2QVOA 2EV5A 1VNDA 1RETA 1YQAA 4YFXF 4L5IA 1FEXA 5CVUA 4IHWA 2H6BA 3V8JA 2RREA 3HUGA 2WAQN 2XROA 1VQKI 3GTGJ 2BE5F 3U1KA 5KAFC 3OSFA 3TP3A 4CZCA 4QIWN 1VQLI 1EH6A 2L4AA 1KGSA 2XSJC 2EV0A 3HZJA 3CO6C 4RM3A 2ME6A 4YIRX 2LVSA 2Z2SB 1J9IA 5F04A 4DYQA 1TBXA 5FGMA 1Y56A 4PFPA 2XB5A 3CC2I 2V9KA 5JVTA 3LA2A 3WG9A 1JJ6C 1XSVA 2RVCA 3EETA 4HW0A 3LAPA 1I39A 4I2OA 2VKHA 3TW6A 1LKXA 3Q3SA 1XCBA 2Q2EA 5FD6A 5M3MJ 3GTLJ 5J1UA 5E1WA 5E3MA 2LF7A 2JUCA 4BUPA 1RRJA 3BG6A 3DPLC 2OA4A 2EZIA 2WY8Q 3FMQA 2XSDC 1I50J 3K4LA 3S2WA 4F3QA 1LEAA 1BN5A 1QHHD 2XPUA 1S7AA 2DMNA 1ZHFA 1XN7A 1G6NA 1ZGAA 3ZMZA 1PUFB 2NYXA 1UFMA 1KYZA 2EFQA 3ESWB 1YIJI 1FPQA 3S17J 3BCBA 5HS7A 1R00A 3PQKA 4RB0A 3KX2A 1JUPA 3LA7A 3C2GA 3TDUC 2V1NA 1SFOJ 1X3WB 2R5YA 2Q2EB 1PP7U 4A3CJ 4OWRB 2LMDA 4XICA 5L3BA 2I10A 1ETYA 5E1ZB 1YTYA 4A3GJ 4HX4A 4XLAA 1LFUP 1EA3A 1MH4A 3WTVC 1F4KA 2XASA 2W00A 1FOKA 1E2XA 3IAS2 2V6EA 2LNBA 4AVPA 2BVMA 4XLPF 3IL2A 3M8EA 2FOKA 3P9IA 3CMYA 5LGTA 4A3JJ 4D9JA 4A3MJ 1H9TA 3PO2J 2L4MA 3FK7A 2GXGA 3KP6A 3CC7I 1R23A 1W7PA 1TWCJ 1B9NA 2RKHA 4FE7A 2ZMEB 2IGMA 2LKPA 1IXRC 4V19K 2GXBA 4L9JA 1A35A 3BR6A 1TNSA 4XN0A 2ZJPF 2QQ9A 5A2QK 2JA2A 4L9TA 1T56A 2XGCA 2O9LA 4RMNA 4M3GA 3OYGA 1FLIA 4Y33A 1UHWA 3F6VA 4RBOA 1AHDP 4DOZA 4WK8F 3CCMI 4HLYA 4UB8C 3KP2A 2PMZA 4PUSA 1WWXA 3GVAA 1S7OA 1QZZA 4CDGA 3NARA 2OZ6A 4BE1A 4IHYA 1J75A 2ID6A 4BBRJ 2MA3A 2X6XA 1OPCA 1F36A 4IOAF 3FKIJ 4ZTJA 2F48A 5F0HA 1IUFA 2YS9A 3I59A 2DW4A 4XKCA 2XAGA 3SHFA 2F5VA 3KYDB 2BGCA 1ETKA 1H0MA 3NWTA 1EF4A 2Z9OA 1X58A 3L2CA 2MLGA 3E3VA 2K9SA 4BHBA 3CMEI 1IC8A 1DQUA 1GUUA 2BY1A 3P9KA 2E36A 2WV1A 4MIMA 3ERED 1R1UA 5BPDA 4EM2A 1LJ9A 1G2HA 3OIPA 1QNTA 1DU0A 3MVPA 3GTKJ 1ZYRF 3KP4A 2X9DA 4MHGA 3H1CA 3HOVJ 2DTZA 1JJ8C 2WB1N 3J80Z 3PJRA 3A4CA 2EZLA 2IA2A 4HV5A 3SZPA 4BY1J 1QVTA 3EYYA 4HSTA 3MKLA 3M3YJ 3K2ZA 3RCOA 3ZRGA 1H8AC 2K40A 5FROA 1A31A 4QTRA 3GTJJ 4C3JJ 1WGXA 4HNUA 3AG1H 5L3FA 2E1CA 1WH7A 1U0JA 2HNHA 3RYRA 3OS2A 2JQ7A 1WQ2A 1G3TA 1VF9A 2R93J 3OYEA 2CO5A 2HTJA 2QENA 3FM3A 3E7LA 3HOYJ 5TJJA 2E60A 2OCEA 3C2BA 3GW2A 3PFIA 5KVRA 3TOBA 3VSLA 1TT5B 2EIJH 1I1SA 2NXNB 3L00A 3W2AA 2CG4A 5GP9A 2Y48A 2HPIA 3M07A 2PBIA 3QYEA 1TC3C 3G73A 1IRXA 3E6MA 1WI9A 2M3AA 4IZZA 4E7LA 5LGUA 1IDYA 1H89C 1T38A 2XAHA 3ZQFA 1XG1A 2Y31A 3L2WA 2ZB9A 1YS6A 3HM5A 3DTIA 2MH9A 4ZYHA 3I0TA 3Q0UA 1HKQA 2IP2A 1Z05A 2D1HA 3GZ6A 2PJRB 2M7AA 1Z6TA 2RC4A 5EZHA 2OAZA 4NBQA 4A93J 4HOBA 2L0KA 2KL4A 5D6EA 1SMYF 3B6AA 3VWBA 2LP0A 3C3WA 2PEXA 4II3A 3CCRI 5K7FA 3MMYB 1JHHA 4P55A 3IRRA 4A6EA 1FNNA 4M74A 2W4SA 4GYIA 4HQEA 5HNFA 2M1BA 1F9NA 1MGTA 2W24A 3DF8A 2JA8J 2DT6A 4S05A 2VJ5A 3ZQGA 3DBRB 4B09A 2M34A 1ON1A 2E1MB 2Z1DA 2B9SA 2DJNA 3CUQB 2FEZA 1MKMA 1R36A 2QYOA 4UHTA 4ENJA 3LQQA 4FTHA 1BI1A 2A69F 3DBHB 2COMA 3HIFA 2V7FA 4RB1A 4ZYDA 3RKXA 4KICA 2K86A 3GF2A 4U0VA 2XGEA 1P7JA 3KEOA 3ZQQA 1N78A 1S8NA 4GO1A 2HKOA 1J0RA 2M5WA 4Q48A 4IXAA 4Y13A 1RUOA 3JCUC 1YJ9I 3GX4X 2HVQA 3V7RA 2VOPA 2MLKA 1MZBA 3K69A 1SD4A 2WY7Q 4FASD 1YITI 2RNJA 1RI7A 3E1SA 2V26A 4MEXF 4KISA 1Z91A 1S6LA 5IT3A 2QA4I 2Y0MA 2QBYB 1YG2A 2DYRH 2MSYA 1Y1WJ 4DJAA 4N0BA 2ACJA 4ITVA 4XLHA 5CPRB 2QGUA 3KIOA 4MGRA 1JKOC 2A68F 2DMUA 3P9CA 3WHBA 1HXDA 4H4KC 4DW6A 4IHXA 1WH5A 2CMPA 2L54A 1WI3A 3ASNH 4BBSJ 5E1XA 3F8FA 5BQTA 3T8RA 4BY7J 2K3FA 2OJED 3BP8A 4JYKA 2OC6A 3I55I 3CCEI 1EH8A 1FTTA 1B9MA 3GTMJ 3AL0C 4XM3A 3RIRA 1LEBA 2TCTA 2OQGA 2KMUA 1APLC 2WTEA 2EILH 4CYCB 2VN2A 3BR2A 4XRFA 3WU0A 4ENMA 4I99C 1O3RA 3BQZA 3GFMA 2H8RA 3P5JA 2XV4S 5IP7J 3H3VK 2DT7B 2DMPA 4G12A 1SFUA 1Z3XA 3TP0A 4QLCU 3K70C 3TL4X 3G6EI 5FRNA 1GXQA 2XF6A 3CCUI 4OMYA 5DTDA 1MNDA 3JRBA 1X3UA 5HLIA 3F21A 5LEKA 4JX4A 3F8NA 1U2WA 3JTHA 1X1AA 3TOAA 1H9GA 5GAEJ 3HG9A 2HQ5A 1D0YA 4XRSA 1ZG3A 3KLNA 3IC7A 1YRNA 2DA1A 5D8LB 1JTYA 2FA5A 2A6EF 2YPRA 2EH3A 2BEOA 4M3EA 3CCVI 5FJ8J 5KCMA 4IKFA 2Q1ZB 2M45A 2M2EA 3H5AA 4HPQA 3KZIC 2E34A 2IEKA 1NK2P 1LUJB 3W2WA 4DQ2A 2CV1A 3IWZA 3H35A 3ZQHA 2WAQA 2LK2A 2N8GA 2H1LA 2IA1A 3MZYA 2HOSA 2AS5F 2EJRA 5TISC 4F92B 3HL2A 3MN2A 2KDOA 2PI0A 4M6YA 4RLQA 2GIZA 3OIOA 3G1OA 4D1QA 1OFCX 3CCJI 2VLAA 2JN6A 5C3EJ 3VYTB 1XSXA 3CUQA 3L2QA 1U9OA 1IAWA 2XAUA 4L0YB 4IF4A 2ECCA 1O7LA 4E7JA 4PK4A 5E3OA 1KONA 2R5YB 2CFXA 2K3PA 1MJ9A 2Z99A 2JMWA 1XPXA 3AG2H 1ZN2A 2QSHX 4LLLA 5ILVA 2DA7A 3A02A 1X1DA 3F0CA 3JRDA 3QOPA 2J5OA 2H94A 1NG7A 4OINF 5HVQC 1BW5A 4IRHA 3OL4A 3HJEA 3BG5A 5TGTA 3V8KA 4HQMA 3VOEA 5D5UB 1OQYA 2OBPA 4P96A 5J3LA 2FXAA 2Y0SN 4LB6B 1P6RA 4FE4A 4FX0A 4BGDA 2KJCA 2X48A 1OCOH 4C3IJ 5KNLA 1ON2A 1D5YA 2R7FA 4U7BA 4BQAA 3DTKA 2R7DA 3ABUA 1UCRA 3FMRA 3W3CA 5LGNA 3U1DA 3SJMA 3BQYA 1Z7UA 2V1DA 2IJLA 3EUAA 4S04A 1SEUA 2DA6A 3IH3A 5BOXA 1JGGA 4W1UA 2FSWA 1WSUA 1IRZA 2CUFA 1W5SA 5LHGA 3QAHA 3WE2A 4BACA 2JPBA 3V42A 4JX5A 3D1NI 1DUXC 5IYCJ 2DAOA 2NVTJ 2QM3A 5M3FJ 1XCVA 2DOAA 4BDYA 2W82A 2WAEA 5GPCA 1WJAA 3NWSA 3K6GA 3VFZA 3BJOA 4I98B 4XNFA 5DYMA 2KRCA 4LK1F 5DS9A 1MDMB 5LFAA 1QZYA 2JTVA 3HXLA 4JQFA 5F27A 1POGA 2HZTA 3TO7A 2DLLA 4YIIA 4AIDA 3LWFA 5HS9A 1AA7A 2F4OB 3Q5FA 3NRVA 3I54A 1Y8RB 2IS2A 3BTIA 2OV7A 2E19A 3S1RJ 5DEQA 4EJUA 4I0BA 4GCVA 1YE9A 4BEHA 4MTDA 3H92A 3PUBA 3F3XA 3HYIA 3DU5A 2M4GA 2XGDA 3DCFA 3GWZA 4YFKF 2FQ4A 2H09A 1SAUA 1EKEA 4YG2F 1QO0D 5F6FA 2VBYA 2JJ7A 1XD7A 4WX9A 2QKMB 1JKQC 2VQCA 3ERMA 4U88A 5CVVA 1T39A 1WVRA 4XRMA 1SFEA 3KLOA 4G6QA 3O2PE 4E7KA 3QQAA 4A0ZA 2L9VA 4ESBA 3GCMA 3PL8A 2CW7A 1HSJA 1SVLA 3OS1A 2OTJI 1ZARA 1ZGJA 2HZDA 3BTLA 4CCOA 1YYVA 1JGSA 3GZNB 4BXXJ 1D8KA 3BTJA 2HYFA 3BG7A 1VTNC 2KFDA 2BHYA 2ELJA 3FXKA 4V2FA 2VASA 4KN4X 1R22A 1X19A 4ZH4F 4BEHB 4M6XA 2DBBA 4QPOA 1K78B 1N25A 4IJAA 3I3LA 1GHCA 4R1HA 5IP9J 2MD5A 4AWXB 4U0YA 1G8XA 2LY1A 3QYBA 1B72A 4Y17A 2ZFWA 3WTSC 3HHGA 4NQWB 1HSTA 3RSNA 3CZ6A 4B4CA 2PMZN 3M1EA 4DYCA 5LBQA 3S1MJ 3ZGKA 1HC8A 5FRMA 3JW4A 1FP1D 2VKDA 2ZO4A 3OYKA 2KRFA 2HS5A 4LK0F 3B73A 1MMSA 2BXYA 4F55A 3A0BC 4R79A 3BLYA 4CYDA 1KQ8A 2R7OA 1BJAA 3OR2C 5B3SH 4M72A 2OUMA 3M8JA 1ERDA 2HDDA 2LH9A 1F43A 3N4MA 1G4DA 2PLYA 1JTXA 3IAM2 3OR1C 1XMKA 1ZRDA 5F64A 2EK5A 3FDYA 3JSOA 4RGXA 2M7BA 1YIOA 4HX7A 4EJTA 1FTZA 1LDKB 5AONA 3OV8A 2LRDA 3COAC 4XBFA 1S9HA 1YLFA 2IGNA 3KE2A 3FXRA 4RA2A 1IRFA 3FHZA 2PQ8A 3H3UA 4Y7NJ 3KP5A 2GWRA 4BJTA 3G1LA 2KPMA 1KYWA 2ZJQF 4JX6A 3A1YA 3R61A 5K1YA 4UV8A 3Q9SA 4U0WA 2VXDA 4MQVA 1XC5A 2KIQA 4P9UA 2IS6A 2E71A 3ZPLA 3H0DA 1BIBA 2EZHA 2TDXA 1NTCA 3FHNA 4ABZA 4Z2YA 4CCMA 2NOGA 3ABTA 1LQ1A 4LGWA 1R4MB 1SANA 5EGOB 2M8EA 2VE9A 4M71A 1USTA 3CP2A 3MCZA 2IAIA 1B8IA 2GQQA 2QWWA 5EJCA 4KFCA 2EA4A 1U6GA 2XB0X 2XVCA 2UXNA 2OD5A 3KEQA 5ICCA 2DDBA 3HTUA 3BR5A 4RAGA 4KYWA 2ECBA 2ELHA 2ZJ2A 3FXOA 1OMIA 3HRMA 3A01B 3R6SA 3JRFA 5EEGA 5F08A 5A2QZ 1TL8A 1KQ0A 1CGPA 5HLGA 3DTEA 2CUJA 3FM5A 3PQJA 2MFZA 2QSGX 2K9LA 3LL7A 3B6CA 1BA5A 4HRIA 4IOCF 2ZNZA 4LIUA 4PFOA 3REOA 3DBLB 2DA5A 2MW8A 5FLXK 1ZELA 3C18A 3KETA 1F5TA 2ZCWA 1SVMA 3H9JA 2JSCA 2ZSIB 3R4KA 4RAZA 3ZMSA 3MZHA 5BPIA 1MW7A 1WPKA 5J4YA 3LOCA 3I9V2 4LD5A 4BL0B 3OIQA 1K6OA 3MQ0A 1H88C 3V7CA 2HDCA 5GAGJ 4Y4RA 4IRIA 2FNPA 4GGGA 1FBUA 1UHSA 3F72A 4X0GA 3OYMA 1IV6A 3ZMTA 2XF5A 1D3YA 3CESA 4OAZA 3SQNA 3LSRA 1WJBA 3E5QA 1YOVB 3T1BA 3BR3A 3C2HA 2L7FP 3GFJA 3GTOJ 1A6IA 1BI0A 2VKEA 5JR3A 1ZAOA 4C30A 1GV5A 2G0EA 2MABA 3K10A 3QWLA 4BHPA 2KJBA 2A5WA 2VONA 4LLNA 1P9QC 4ON0A 2VBWA 3BG3A 3GMEA 4LG0A 4OIRF 4B1RA 4BJ5C 3OYBA 2DK5A 3BOQA 2HKXA 4BE0A 2LOOA 2P6SA 3BPXA 5E18F 4MTEA 2BXZA 1J59A 3RI4A 4WCGA 1FZPB 5LEJA 3F8BA 3GTPJ 4IQJA 2VQGA 4BS9A 3I5UA 2VL8A 4A3IJ 4FQGA 4B8XA 3AG3H 2CWEA 1MD0A 5E17F 1VQ4I 3IUOA 4EGYA 2XKPA 2M0CA 3RPQA 3I4PA 2P81A 2CQQA 5H2FC 2YSRA 2NS7A 4BU2A 3S15J 2CQKA 5CYVA 3T5XA 3VYSB 3QPTA 3GXOA 4EEFG 1G3SA 1XMXA 2GAUA 4CCNA 3H9GA 2JPCA 4OMZA 3GFIA 5FKLA 1E3PA 3R0AA 2LF8A 4ZDOA 2FOWA 5DD4A 4Y52J 3OYHA 1SC7A 1L0OC 2CUZA 1AKHA 4NNJA 4KIGA 4A0XA 5IT9Z 1S5LC 2LREA 2NNNA 1E17A 2P7VB 4P5OA 3D5LA 4A0YA 2VPLA 4IRGA 1V5FA 1GDTA 5J1RA 1B8IB 5HNHA 1EH7A 1JXSA 3DEEA 3I59B 3GLXA 3WTXC 1XDSA 2XPWA 4ZYGA 1B1BA 2KISA 2VIXA 3QODA 4NC8A 2QKLB 4LMYA 4XOTA 3PM1A 1QU3A 2VT3A 1VQ5I 1QBJA 4E70A 1PVEA 1A04A 3C7JA 2DFFA 4ZDPA 3DPTA 5B1AH 2R7UA 1HW5A 2NRAC 3RKYA 1XDUA 2DN0A 1VQ7I 4Q5SF 2HXIA 3G3ZA 3KYLA 3MZ8A 3S14J 4AIKA 1QPMA 2CGPA 4AIJA 3OOUA 3JRHA 3L2RA 2K85A 1Z9CA 2H27A 1HQCA 2MG4A 2WB1A 5K5OA 2O0YA 2DQLA 2OTLI 2K5CA 3IV5A 2Z33A 3LMMA 2D1VA 4HX8A 1WHUA 1U8RA 1R5ID 1ZTRA 3Q0VA 5IT9K 2LD5A 1SD5A 1RR8C 2O6GE 3U2RA 1W0TA 1IW7F 4YIFA 2CRGA 3M8FA 4L0ZB 4CCJA 4D7MA 1FIPA 4IPAA 2M8GX 4PGHA 3DKWA 4LB5A 2ZSHB 3M9AA 1Q1HA 3SFZA 1YJWI 1L3LA 5BNGA 3W6KB 1J7KA 4HNTA 1I5ZA 3NEUA 4HV6A 2ZXHA 5EG0B 2LKSA 5CVRA 5B66C 2KP6A 1O4XA 3ZN0A 1TQPA 1QHGA 1TWFJ 4C3HJ 3VODA 2W1OA 3E0JB 3OS0A 4IO9F 3OY9A 2ISZA 4I09A 4A5MA 1FX7A 1T6SA 2TRTA 1I6HJ 2VXZA 2L7MP 4B48A 1X2NA 2NNYA 4LIVA 2HDWA 2VJIA 3CD6I 1JE8A 1TZLA 2KIMA 1ORKA 4GRIA 1BOBA 2HQAA 2M0MA 2WC2A 2PJRA 4XR6A 5FKNA 2BY2A 2WBMA 2X1DA 4G6TB 2EB7A 4FT8A 2NS8A 4E7IA 3MKWB 4LFUA 4KMUX 4UY8I 4KT6A 4QWQA 2AXLA 1X4PA 4LJZF 5C4JJ 3WTWC 1MMAA 1A36A 3Q0WA 3CCSI 4A3LJ 5D4RA 4CICA 2V4JC 3L7WA 5IPAA 5JI6A 3CCLI 1WRJA 2QCOA 4GYGA 2P7CB 4RLFA 3S8PA 1YS7A 2DFHA 3OYFA 2EIKH 1UJ8A 2FQ3A 2G7HA 3FZVA 3LSTA 3FBNB 5FLXZ 4CCLA 1MMNA 2WV0A 5D8KB 2GIVA 1A6QA 2DMTA 3QRFF 2Z3YA 2DJIA 1HLVA 2F4IA 2ZMEA 3ZMDA 3D5SC 4N9IA 1HW2A 2JUGA 1IXCA 2MGQA 1ZG5A 5F0FA 2X1EA 3K9TA 2O8XA 4MEYF 1E3OC 4YRVA 5ICGA 3FMSA 4BE2A 4B3AA 2BV6A 2MH2A 2XDVA 1VQOI 3LNQA 5J4VA 4CH7A 3CUQC 4D0PA 1RPWA 2IBDA 4Y3OA 4RGRA 1BR2A 2COBA 1IN6A 1IGNA 1FC3A 3IP4B 1FYKA 4OAYA 1K83J 4J19A 4G7HF 3HOTA 4M73A 4XMYA 1VQMI 4XONA 1ETWA 2D5VA 1MSEC 1S29A 3JRCA 5M5YJ 2F5DA 2XRLA 2ZXJA 4XK4A 4D5CA 4H0EA 3LSGA 4F7ZA 3HHHA 4LG0B 5EEHA 4L5JA 5LRSA 1RNLA 2KRHA 4A5NA 4CCKA 1AOYA 3I58A 2AQEA 2HXOA 2XPVA 4HZFA 3BZCA 4MQ9F 5D5XB 2XKOA 3GLLA 1U9NA 1BC7C 4ZJZA 3R0JA 1Z0XA 4NC6A 2R7XA 1UB9A 1FOYA 3S2DJ 1X4OA 1BW6A 3P7NA 5D5WB 2QSFX 5B5EC 4PJMA 1VQNI 2LFBA 3HDDA 2MYSA 2VQHA 2CFOA 2A07F 2CV2A 1OLTA 4G94A 4HF0A 3HB9A 5DM6F 1BBYA 4KJZA 3ZQIA 3U21A 3WGGA 2VC0A 4PCQA 3S3MA 1GLNA 2GOMA 2R7TA 4FCYA 2EWNA 3WTUC 3GTQJ 2HYGD 5CQEA 1T95A 3DKXA 3FK6A 4CA0A 9ANTA 2G7UA 3B02A 2V9PA 1OR7C 2X51A 3ELKA 5H6QA 4EJOA 1LPQA 2LG4A 4C2TA 2Y9ZA 5E8GA 2OPTA 3ISPA 3K4KA 1YJNI 4RDUA 2EBIA 1R5GA 5M5WJ 2HEOA 2R7WA 5EEAA 1O3SA 3DLLF 4AYBA 2VJJA 3CF2A 1XGMA 1K6YA 4ZTFA 1LVKA 1OCRH 2HFHA 1J5YA 3QPLA 4EGZA 2FF4A 1E3HA 5LD2C 1LFPA 3HEFA 1ZR4A 1Z7LA 3VB2A 4IHSA 3KZYA 3HSEA 2DMQA 3UNGC 5GADJ 2JA5J 2BY3A 2KIFA 3FXQA 3K4CA 4UV9A 5F1RA 1Z1DA 1ZKGA 2HU9A 3V4GA 1NK3P 1MSFC 4RB2C 1QZEA 1KU9A 3E6CC 2DPDA 2WWYA 1JUSA 2D45A 2W84A 4RM2A 2H6CA 2IXSA 1ZR2A 3H5RA 3D5RC 4XORA 1VQ6I 3F6OA 2HTSA 3QPSA 4XKWA 5L3DA 4CO8A 2X6OA 1K7AA 2KZVA 4I76A 5DUKA 3HC7A 4A2UA 1FMWA 2EQRA 2FU4A 2ELKA 3E6BA 4KT5C 1DPUA 4HDUA 1K61A 1HDDC 2KLOA 1S7EA 3FX3A 3RPUD 2V6CA 2KIUA 1D1CA 1I1GA 3CTAA 4Y15A 2VOOA 4E7SA 5JVGF 4XKBA 4WXCA 2K9QA 2AQFA 4ZDLA 3ROUA 2X6WA 3T8TA 4ENKA 1BJZA 2DFEA 1MMDA 4RAYA 3BC8A 2Y0SA 3FIWA 4XLNF 3F22A 3HRUA 3FXMA 5HOOA 2ZC2A 3DEWA 5EF6A 2OQRA 1KU3A 1RR7A 1IV8A 4ZYEA 5IYDJ 5D6FA 2O5RA 1K79A 2HQNA 1W7PB 1X1PA 2JVGA 3PO3J 1J09A 3PNTA 2RNGA 3CJTB 3A03A 1B4AA 2F5CA 3E5UA 3ZCOA 1QA6A 2EIMH 1QPIA 1XGSA 2XHKA 1W4MA 1IXSB 4UB6C 4EJWA 1ZG1A 4LG3A 3GEZA 4IX7A 4NDLA 4JP0A 3HOWJ 5JLWA 4A6DA 3A2KA 2R4GA 2BZTA 1HF0A 1K4TA 2XAFA 2VB6A 2L7ZA 2L5QA 3FISA 3JREA 4N9HA 1P92A 4B44A 2RQQA 2A3SA 1MBEA 2YUSA 4NUBA 5J40A 5FKKA 3HGGA 2W7NA 4HF1A 4PZJA 2LY9A 3PNYA 2ZJRF 3CUOA 4ANJA 4YFNF 5CQGA 1HDPA 1FP2A 3KFWX 2YX7A 2O7OA 2JWTA 3OYAA 4XL9A 5EDNA 2F5FA 3CLQA 3ZQLA 1U5TC 2DT5A 1W0UA 1XMAA 3GZ5A 2X0LA 4HNVA 3S32A 5KK1A 1P7IA 4I6ZA 4I7HA 4ESFA 2V9VA 2W25A 1YX3A 5GPAA 3GO5A 2H1KA 3MEXA 2VBXA 5E20A 3ML6A 2ID3A 3CJQB 1YW7A 3PUFA 3ZP5A 4PJNA 1OYIA 2QZ8A 1SD7A 3FWEA 4BH9A 1UG2A 2R92J 2KQRA 2CSOA 1D0XA 2HQRA 1ETOA 4MFEA 1YI2I 1IRGA 1FBQA 3PSIA 1OCTC 2I5UA 4HF2A 4R8HA 1BM9A 1MDMA 3ZQCA 5J47A 1ZLKA 2AHQA 2ZBKA 2HYJA 3JR9A 1TWHJ 3LSJA 2GZWA 3BPVA 4B47A 1V4RA 5HDGA 3VYRB 1BC8C 1IF1A 1R4NB 1U3EM 3AFHA 4HDVA 2E1OA 1DDNA 2F2EA 1OYWA 2CQ7A 3I4MJ 3HUGB 3I64A 1HA8A 2L02A 4BQOA 2UV1A 3FXLA 2DU9A 4DZJA 3TGNA 4DIQA 4KIFA 4ZZDA 4DBRA 4GDFA 2EA2A 2IGKA 4PJLA 3PIOF 5J8FA 3SZGA 3HOUJ 2ADUA 1ZQ3P 3O6BB 4AM3A 1YO5C 2RGVA 4XKVA 3HOSA 3VYUB 3K70D 1RKTA 5ILUA 1IUYA 3DWLE 4O6JA 3S93A 1FMVA 2CQNA 1DP7P 3ULQB 2DA2A 5DDGA 2JZYA 1ZREA 1XTAA 3S1QJ 3TW7A 2K9NA 2HVRA 4RB3C 1D0ZA 1Y6IA 4J01A 3BG9A 2ZXIA 2CQXA 3DFGA 3FBIB 2W57A 4M3BA 4UVAA 2IVMA 4N4OB 2IPQX 4W97A 4NHJA 2LR8A 3HBLA 1QGPA 2FUG2 3W6JB 4E6KG 2VBZA 2R5ZB 1LVAA 2JRTA 1I27A 2MBFA 1O57A 2EV6A 2ME0A 5ICFA 2XC7A 1R5HA 4BXUA 4A12A 4HG2A 4A69C 1D1AA 2DI3A 4CZZA 2Y30A 2LBFB 2ISYA 4ZZLA 3I56I 2I8DA 2PN6A 3QPHA 3VEPA 3FXJA 4BNCA 3E6DA 5K7HA 3ZN1A 2X1CA 4L9VA 1D8JA 2ZXWH 2IRFG 3QP5A 4YEJA 4G6DA 1TQIA 4OU0A 3SFIA 3ZOBA 1LE8B 2VPRA 4XSZF 1TW2A 3K4JA 5GTIC 1B72B 1JKPC 5E79C 2EZKA 3ABMH 4NQWA 1HBXG 2DPUA 3IWFA 3AAFA 5HDNA 3S3OA 5J8CA 2ZFUA 3QOEA 3W6VA 2Q0OA 1JT6A 4JBAA 4CHUA 4IHVA 5DUIA 4BQNA 2XAJA 4FETA 4E7HA 2H8WA 1JKRC 3RTRA 3BJ6A 2CU7A 5FB2A 3DXJF 3LSMA 3F23A 4LITA 4PJ0C 1WJDA 2HWVA 1IN5A 3BDDA 1OCPA 2EFNA 3LA3A 1FSHA 1I3AA 1BR4A 2R7QA 1FWZA 4LOCA 2NVQJ 1OCCH 3HPHA 2HI3A 2K27A 4RS8A 3SDGA 1ZRFA 2PMHA 1FOWA 4O3MA 2RN7A 1JHFA 3J7AY 1LE8A 2IS1A 4S0HB 1NHAA 1RUNA 2AO9A 1IJWC 1IDZA 3DP7A 5C4XJ 3JRAA 2CW8A 1KU2A 3J7ZI 1MH3A 1UZCA 4RAFA 4OOIA 3WODF 3J81K 2P5LC 2FRHA 3KCCA 5EGOA 3BR0A 2WAFA 2A6TA 2XAQA 1F1ZA 4IL6C 3UKGA 1MBKA 2STTA 2LTPA 2ZNYA 4UNOA 1LFBA 4F52A 1N75A 2R7RA 2ZMEC 2IGOA 2UWMA 2DODA 2XIGA 2FE3A 2F4MB 1IN7A 1WKMA 1OR7A 4I01A 5TRDA 4OIOF 2DK8A 2FJ1A 3WTTC 6PAXA 1JI8A 4U87A 2VODA 1KU7A 1DPRA 2HOAA 3VSKA 3S3NA 1MBHA 1N77A 3SXYA 4P9FA 2OCCH 4P1WA 4EVIA 2K7LA 4LLGF 1Z77A 2JSPA 4II2A 5HODA 2FMYA 1X3ZB 2MD0A 1RIOH 1IO2A 1DGWY 2NOJB 2L9SA 3TO6A 1Y0UA 1LDJA 3BZ6A 1T08B 5HLTA 3GFLA 1SD6A 1R1TA 2VUMJ 3OYJA 4JK1X 2Y2ZA 2ETHA 2GA1A 3CF5F 1QQIA 1MMGA 4HYEA 1YW8A 5LLQA 3IHUA 5F1JA 1P4AA 2QQ8A 5L3CA 1R7JA 1AKHB 2L7KA 2BOLA 1IZ1A 2L01A 4AU7A 1HW1A 4TV7A 1VZ0A 1O3QA 3GUDA 5DCFA 5DD8A 3J80K 4EMSA 1TWAJ 3KP3A 3E97A 5FKMA 1KQ9A 4ETSA 3CJNA 4UXNA 3MAJA 4UUVA 4V2GA 5M5XJ 1FJLA 1REPC 4KMFA 5FFXA 1ZRCA 2NS0A 2BW3B 4CXFA 3F8MA 5LRRA 2VI6A 3LQRA 3G4SI 3OSGA 1PP8F 1SVOA 2X4HA 1TLHB 2VT2A 3BTCA 4B3XA 3CCQI 1D5VA 2W48A 1W5TA 3MKZA 2FMLA 2ESNA 1USSA 4HLXA 1GXPA 4BAYA 4ZYAA 4L5EA 1OISA 3WTZA 3OMYA 3CCYA 1ETVA 1NG6A 1MBGA 2YU3A 5ERIA 1W7PD 3F9KA 2CJJA 2Z5UA 1TQMA 4HSRA 3RJPA 5JLXA 1B59A 1PUFA 1NH3A 3PSFA 4QSHA 1DU6A 5GTHC 2UXXA 4M3FA 4XSXF 3IKTA 1LB2A 3LSIA 1HKSA 4E4HA 2L2OA 4XIDA 1MIJA 3RQIA 2B0LA 1T8IA 3M4OJ 3K1PA 3R60A 4EJVA 3BT9A 4F91B 2CV0A 1DP3A 2QUFA 4CYCA 5IOZA 3SDBA 3CDHA 2ICWG 5LHHA 2YX4A 3K1NA 2M87A 5HDKA 2E1NA 1P4WA 5H6RA 1WJEA 1P4XA 1R9TJ 2BY0A 3HRTA 3J7AO 2PMUA 4IQ4A 4PSXA 4KITB 1WZ2A 4RGUA 2KT0A 1R71A 4NC7A 3LFUA 5CLSA 4MO7A 2WADA 2WA0A 3S1NJ 1XS9A 2R7ZJ 1T2KA 3SYTA 3U9GA 4K2EA 4PDKA 2ESHA 3BJAA 1V55H 3LFKA 1BL0A 2E2IJ 1WJ5A 3JSPA 4C9YA 4FISA 3ECHA 3CDIA 1MBJA 5DM7F 4FX4A 2GM4A 3SEQA 2IT0A 3TMOA 1ETQA 5ED4A 3PFYA 1QRYA 4HBLA 2JVHA 1JT0A 2PG4A 1YX5A 3IKVA 1PJRA 3WU2C 1Y8QB 4KN7X 2E35A 4G7OF 5L3GA 1RESA 3CDLA 2VE8A 3EUHA 3TDZC 3S2HJ 3J7YJ 2LDUA 4BQQA 4XOPA 3FF5A 1TP4A 1T0FC 4CUGA 2CYYA 3O8HA 2DA4A 3T0YA 2RDPA 3EQLF 1PDNC 1KA8A 2EFOA 3HKZN 1C0WA 1Z6RA 1KZHA 1FIAA 1A5JA 3G1MA 3M7GA 3QU6A 4C2MJ 1YHQI 4KUMA 3DV8A 2E7WA 3QU3A 1AU7A 1BI2A 3LSKA 3C1DA 5K7ZA 4WWCA 2P8TA 4BKXA 4D7NA 3RZOJ 3QYFA 1MNMC 2HOTA 5E3NA 1MBFA 3LSPA 5JFRA 2RV8A 4AYBN 2BW3A 5IYBJ 2FBKA 5LHIA 2E2JJ 2F6CA 4XLEA 4AUXA 2FBHA 1R49A 2NVYJ 2O3FA 3FKJA 5E8IA 5DCMB 2DO7A 4Q4ZF 4EV0A 2R0QC 1M1EB 3L9FA 3VDXA 1MNEA 4HEA2 1XGOA
chains in the Genus database with same CATH topology
1AHDP 1XC5A 2K9QA 5EG0A 5FLMJ 3IH4A 1BJZA 2EZHA 1NTCA 3FIWA 3NARA 4ABZA 2NOGA 4IHYA 3I4NJ 2ID6A 4BBRJ 1SANA 5EGOB 3DEWA 5EF6A 3GBGA 1F36A 1RR7A 1IG7A 5IYDJ 3FKIJ 2L9RA 5F0HA 3L1PA 2IAIA 3TEDA 1IUFA 2YS9A 3PO3J 4UUSA 1B8IA 1OJLA 1U78A 2QF7A 2XB0X 1UMQA 3A03A 1EF4A 1ETKA 1QVUA 3BR5A 1X58A 1QPIA 2ECBA 2K9SA 4A3BJ 1IC8A 3HOWJ 4NDLA 1GUUA 4JP0A 3A01B 2WV1A 4MIMA 5JLWA 3JRFA 5F08A 1HF0A 1G2HA 1DU0A 3RZDJ 3MVPA 1X2MA 3GTKJ 2L7ZA 3FISA 2X9DA 3JREA 3HOVJ 2DTZA 1JJ8C 2WB1N 3B6CA 1BA5A 1ITYA 2EZLA 4M6VA 1MBEA 2YUSA 4BY1J 1QVTA 3MKLA 3HGGA 5FKKA 2LKXA 3M3YJ 1WCMJ 2LY9A 2DA5A 2MW8A 1H8AC 1HDPA 2K40A 2O7OA 4UUTA 2JWTA 4QTRA 3GTJJ 4C3JJ 5EDNA 1WGXA 3ZQLA 1WH7A 1W0UA 2FX0A 1VF9A 2R93J 1WPKA 4HNVA 1RKWA 4I6ZA 1P7IA 3LOCA 2KDZA 2LLKA 1H88C 3E7LA 3HOYJ 5GPAA 3C2BA 2H1KA 1UHSA 2GLOA 2ID3A 1IV6A 5EYRA 1T33A 4D5FA 5GP9A 3LSRA 1TC3C 1UG2A 2R92J 3BR3A 2L7FP 1IDYA 1H89C 1ETOA 3GTOJ 4MFEA 3ZQFA 1A6IA 1XG1A 2VKEA 2Y31A 2ZB9A 1GV5A 2G0EA 1OCTC 4DZPA 3HM5A 2VKVA 3ZQCA 1TWGJ 3Q0UA 2AHQA 3BG3A 2HYJA 4B1RA 1TWHJ 3JR9A 3WHCA 3LSJA 2JA7J 2M9HA 5EZHA 4A93J 3GTPJ 3RKQA 2E1OA 2L0KA 4A3IJ 3B6AA 3I4MJ 2LP0A 5FKOA 4XRSG 5K7FA 4DZJA 2M0CA 1JUMA 1ZK8A 2P81A 2CQQA 3IH2A 5IP6A 2NS7A 4DYRA 3S15J 3HOUJ 1ZQ3P 2JA8J 1I3QJ 3ZQGA 4EEFG 1ENHA 2M34A 1RKTA 2DJNA 5FKLA 3S16J 4FTHA 4Y52J 1HOMA 2DA2A 2E2HJ 1AKHA 3S1QJ 3TW7A 2K9NA 2XGEA 1P7JA 2FD5A 3BG9A 2CQXA 2NVXJ 3HOZJ 1GDTA 5J1RA 4UUSB 4M3BA 1B8IB 4W97A 4MLOA 2LR8A 3HBLA 3JRIA 2XPWA 2R5ZB 2ME0A 4M3DA 3PM1A 2MSYA 1Y1WJ 4A69C 2Y30A 1JKOC 2DMUA 4A3FJ 1GVDA 3HGYA 3WHBA 4DW6A 4IHXA 5K7HA 1CQTA 1WH5A 1VFCA 2DN0A 2HXIA 1WI3A 3SFIA 3ZOBA 3S14J 4BBSJ 1LE8B 2VPRA 3OOUA 3JRHA 2MG4A 4BY7J 1B72B 4JYKA 1JKPC 2EZKA 1FTTA 3GTMJ 2YU9J 4AC0A 3IV5A 3W6VA 1JT6A 1YRNB 4IHVA 2TCTA 1APLC 4CYCB 2CUEA 3BR2A 1JKRC 1ZTRA 3Q0VA 2CU7A 1ZGWA 2LD5A 3BQZA 2H8RA 1W0TA 5IP7J 3H3VK 2CRGA 2DMPA 1OCPA 4G12A 4D7MA 2O8KA 1FIPA 2M8GX 3TP0A 4LOCA 2NVQJ 2HI3A 3SDGA 1GT0C 1Y1VJ 1VI0A 5DTDA 5BNGA 3JRBA 2DA3A 1LE8A 4S0HB 4JX4A 2JA6J 2R5ZA 2RAEA 5EG0B 2AO9A 1IJWC 1IDZA 1O4XA 5C4XJ 3JRAA 1TWFJ 2HQ5A 4XRSA 1MH3A 4C3HJ 2GBYA 4A3KJ 1YRNA 2DA1A 5F0CA 5EGOA 3BR0A 1JTYA 2EH3A 4M3EA 5FJ8J 2TRTA 1I6HJ 3UKGA 1MBKA 2M2EA 2LTPA 3CQZJ 2L7MP 1LFBA 2IEKA 1NK2P 1X2NA 2B63J 5E3LA 3ZQHA 2LK2A 3H0GJ 5J1YA 2N8GA 1ORKA 2FJ1A 2HOSA 4X6AJ 3K7AJ 3MN2A 5FKNA 3A01A 2HOAA 1MBHA 2NS8A 3OIOA 3G1OA 1OFCX 2JN6A 5C3EJ 1Z77A 3VPRA 5HODA 5C44J 1U9OA 5C4JJ 1HCRA 3Q0WA 2JK3A 4GFBA 4A3LJ 2ECCA 4IEJA 2R5YB 5E3OA 5IPAA 4A3EJ 2QCOA 2JMWA 2VUMJ 4X1EA 2Y2ZA 1GV2A 2DA7A 3A02A 3F0CA 3JRDA 5F1JA 4A3DJ 2DMTA 1AKHB 1HLVA 1BW5A 3BG5A 3NAUA 4MFDA 2OF7A 2MGQA 5F0FA 5J3LA 1ETXA 2Y0SN 4FE4A 1E3OC 2X48A 1TWAJ 4C3IJ 5FKMA 5EZGA 1Q1VA 1D5YA 3BR1A 4V2GA 4B3AA 5M5XJ 1FJLA 5FLVA 3LNQA 3OSGA 2VI6A 3JRGA 3SJMA 3BQYA 1RPWA 3K2AA 2DA6A 3BTCA 3IH3A 2IBDA 3O8GA 5IOYA 1JGGA 4W1UA 1IRZA 2CUFA 2COBA 2W48A 1IGNA 1K83J 4J19A 4L5EA 1U8BA 3HOXJ 2D5VA 1ETWA 1MSEC 3CCYA 1ETVA 4JX5A 3D1NI 1MBGA 5IYCJ 3JRCA 2NVTJ 5M5YJ 2Y9YA 5M3FJ 2CJJA 1VNDA 1RETA 5JLXA 1PUFA 5GPCA 2XRLA 4QSHA 1DU6A 4XK4A 4D5CA 1FEXA 4M3FA 4IHWA 3LSGA 2WAQN 5DS9A 4XIDA 3GTGJ 3RQIA 5F27A 1POGA 3OSFA 3M4OJ 3TP3A 2HXOA 4QIWN 3BT9A 2XPVA 4CYCA 5IOZA 1U9NA 3BTIA 2ME6A 2E19A 1Z0XA 3S1RJ 2LVSA 3S2DJ 1BW6A 5F04A 4DYQA 2XB5A 2XGDA 2LFBA 3DCFA 1JJ6C 2FQ4A 3HDDA 1R9TJ 2JJ7A 3HB9A 3TW6A 2KT0A 3ZQIA 3Q3SA 5M3MJ 1JKQC 4MO7A 3GTLJ 5J1UA 5E3MA 3S1NJ 4XRMA 1XS9A 4FCYA 2R7ZJ 3QQAA 3GTQJ 3FK6A 2EZIA 2XSDC 1I50J 9ANTA 3BTLA 1BL0A 2E2IJ 4BXXJ 2Y9ZA 4FISA 3BTJA 2XPUA 2OPTA 1MBJA 2DMNA 4V2FA 4RDUA 2EBIA 2GM4A 5M5WJ 5EEAA 1ETQA 1PUFB 1QRYA 3S17J 5IP9J 1JT0A 3QPLA 1JUPA 1B72A 3HEFA 1RESA 3CDLA 1ZR4A 3S2HJ 1SFOJ 4B4CA 2PMZN 2DMQA 4DYCA 2R5YA 2JA5J 3S1MJ 1ZKGA 4A3CJ 4XICA 1NK3P 2I10A 1ETYA 1MSFC 4A3GJ 1LFUP 1JUSA 1MH4A 3O8HA 2DA4A 3HKZN 1FIAA 2HDDA 1A5JA 3G1MA 4C2MJ 1ZR2A 1F43A 1JTXA 3CMYA 1AU7A 4A3JJ 5K7ZA 3QPSA 4A3MJ 3PO2J 4BKXA 3FK7A 4D7NA 3RZOJ 2X6OA 1MNMC 2HOTA 5E3NA 4I76A 1TWCJ 4FE7A 1MBFA 3LSPA 2EQRA 2ELKA 5IYBJ 4AYBN 2E2JJ 1FTZA 4AUXA 1K61A 1HDDC 2NVYJ 3BR6A 1S7EA 4Y7NJ 1T56A 2XGCA 3G1LA 2R0QC 4M3GA 2O9LA 4JX6A 4RBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHD P;  1XC5 A;  2K9Q A;  5EG0 A;  5FLM J;  3IH4 A;  1BJZ A;  2EZH A;  1NTC A;  3FIW A;  3NAR A;  4ABZ A;  2NOG A;  4IHY A;  3I4N J;  2ID6 A;  4BBR J;  1SAN A;  5EGO B;  3DEW A;  5EF6 A;  3GBG A;  1F36 A;  1RR7 A;  1IG7 A;  5IYD J;  3FKI J;  2L9R A;  5F0H A;  3L1P A;  2IAI A;  3TED A;  1IUF A;  2YS9 A;  3PO3 J;  4UUS A;  1B8I A;  1OJL A;  1U78 A;  2QF7 A;  2XB0 X;  1UMQ A;  3A03 A;  1EF4 A;  1ETK A;  1QVU A;  3BR5 A;  1X58 A;  1QPI A;  2ECB A;  2K9S A;  4A3B J;  1IC8 A;  3HOW J;  4NDL A;  1GUU A;  4JP0 A;  3A01 B;  2WV1 A;  4MIM A;  5JLW A;  3JRF A;  5F08 A;  1HF0 A;  1G2H A;  1DU0 A;  3RZD J;  3MVP A;  1X2M A;  3GTK J;  2L7Z A;  3FIS A;  2X9D A;  3JRE A;  3HOV J;  2DTZ A;  1JJ8 C;  2WB1 N;  3B6C A;  1BA5 A;  1ITY A;  2EZL A;  4M6V A;  1MBE A;  2YUS A;  4BY1 J;  1QVT A;  3MKL A;  3HGG A;  5FKK A;  2LKX A;  3M3Y J;  1WCM J;  2LY9 A;  2DA5 A;  2MW8 A;  1H8A C;  1HDP A;  2K40 A;  2O7O A;  4UUT A;  2JWT A;  4QTR A;  3GTJ J;  4C3J J;  5EDN A;  1WGX A;  3ZQL A;  1WH7 A;  1W0U A;  2FX0 A;  1VF9 A;  2R93 J;  1WPK A;  4HNV A;  1RKW A;  4I6Z A;  1P7I A;  3LOC A;  2KDZ A;  2LLK A;  1H88 C;  3E7L A;  3HOY J;  5GPA A;  3C2B A;  2H1K A;  1UHS A;  2GLO A;  2ID3 A;  1IV6 A;  5EYR A;  1T33 A;  4D5F A;  5GP9 A;  3LSR A;  1TC3 C;  1UG2 A;  2R92 J;  3BR3 A;  2L7F P;  1IDY A;  1H89 C;  1ETO A;  3GTO J;  4MFE A;  3ZQF A;  1A6I A;  1XG1 A;  2VKE A;  2Y31 A;  2ZB9 A;  1GV5 A;  2G0E A;  1OCT C;  4DZP A;  3HM5 A;  2VKV A;  3ZQC A;  1TWG J;  3Q0U A;  2AHQ A;  3BG3 A;  2HYJ A;  4B1R A;  1TWH J;  3JR9 A;  3WHC A;  3LSJ A;  2JA7 J;  2M9H A;  5EZH A;  4A93 J;  3GTP J;  3RKQ A;  2E1O A;  2L0K A;  4A3I J;  3B6A A;  3I4M J;  2LP0 A;  5FKO A;  4XRS G;  5K7F A;  4DZJ A;  2M0C A;  1JUM A;  1ZK8 A;  2P81 A;  2CQQ A;  3IH2 A;  5IP6 A;  2NS7 A;  4DYR A;  3S15 J;  3HOU J;  1ZQ3 P;  2JA8 J;  1I3Q J;  3ZQG A;  4EEF G;  1ENH A;  2M34 A;  1RKT A;  2DJN A;  5FKL A;  3S16 J;  4FTH A;  4Y52 J;  1HOM A;  2DA2 A;  2E2H J;  1AKH A;  3S1Q J;  3TW7 A;  2K9N A;  2XGE A;  1P7J A;  2FD5 A;  3BG9 A;  2CQX A;  2NVX J;  3HOZ J;  1GDT A;  5J1R A;  4UUS B;  4M3B A;  1B8I B;  4W97 A;  4MLO A;  2LR8 A;  3HBL A;  3JRI A;  2XPW A;  2R5Z B;  2ME0 A;  4M3D A;  3PM1 A;  2MSY A;  1Y1W J;  4A69 C;  2Y30 A;  1JKO C;  2DMU A;  4A3F J;  1GVD A;  3HGY A;  3WHB A;  4DW6 A;  4IHX A;  5K7H A;  1CQT A;  1WH5 A;  1VFC A;  2DN0 A;  2HXI A;  1WI3 A;  3SFI A;  3ZOB A;  3S14 J;  4BBS J;  1LE8 B;  2VPR A;  3OOU A;  3JRH A;  2MG4 A;  4BY7 J;  1B72 B;  4JYK A;  1JKP C;  2EZK A;  1FTT A;  3GTM J;  2YU9 J;  4AC0 A;  3IV5 A;  3W6V A;  1JT6 A;  1YRN B;  4IHV A;  2TCT A;  1APL C;  4CYC B;  2CUE A;  3BR2 A;  1JKR C;  1ZTR A;  3Q0V A;  2CU7 A;  1ZGW A;  2LD5 A;  3BQZ A;  2H8R A;  1W0T A;  5IP7 J;  3H3V K;  2CRG A;  2DMP A;  1OCP A;  4G12 A;  4D7M A;  2O8K A;  1FIP A;  2M8G X;  3TP0 A;  4LOC A;  2NVQ J;  2HI3 A;  3SDG A;  1GT0 C;  1Y1V J;  1VI0 A;  5DTD A;  5BNG A;  3JRB A;  2DA3 A;  1LE8 A;  4S0H B;  4JX4 A;  2JA6 J;  2R5Z A;  2RAE A;  5EG0 B;  2AO9 A;  1IJW C;  1IDZ A;  1O4X A;  5C4X J;  3JRA A;  1TWF J;  2HQ5 A;  4XRS A;  1MH3 A;  4C3H J;  2GBY A;  4A3K J;  1YRN A;  2DA1 A;  5F0C A;  5EGO A;  3BR0 A;  1JTY A;  2EH3 A;  4M3E A;  5FJ8 J;  2TRT A;  1I6H J;  3UKG A;  1MBK A;  2M2E A;  2LTP A;  3CQZ J;  2L7M P;  1LFB A;  2IEK A;  1NK2 P;  1X2N A;  2B63 J;  5E3L A;  3ZQH A;  2LK2 A;  3H0G J;  5J1Y A;  2N8G A;  1ORK A;  2FJ1 A;  2HOS A;  4X6A J;  3K7A J;  3MN2 A;  5FKN A;  3A01 A;  2HOA A;  1MBH A;  2NS8 A;  3OIO A;  3G1O A;  1OFC X;  2JN6 A;  5C3E J;  1Z77 A;  3VPR A;  5HOD A;  5C44 J;  1U9O A;  5C4J J;  1HCR A;  3Q0W A;  2JK3 A;  4GFB A;  4A3L J;  2ECC A;  4IEJ A;  2R5Y B;  5E3O A;  5IPA A;  4A3E J;  2QCO A;  2JMW A;  2VUM J;  4X1E A;  2Y2Z A;  1GV2 A;  2DA7 A;  3A02 A;  3F0C A;  3JRD A;  5F1J A;  4A3D J;  2DMT A;  1AKH B;  1HLV A;  1BW5 A;  3BG5 A;  3NAU A;  4MFD A;  2OF7 A;  2MGQ A;  5F0F A;  5J3L A;  1ETX A;  2Y0S N;  4FE4 A;  1E3O C;  2X48 A;  1TWA J;  4C3I J;  5FKM A;  5EZG A;  1Q1V A;  1D5Y A;  3BR1 A;  4V2G A;  4B3A A;  5M5X J;  1FJL A;  5FLV A;  3LNQ A;  3OSG A;  2VI6 A;  3JRG A;  3SJM A;  3BQY A;  1RPW A;  3K2A A;  2DA6 A;  3BTC A;  3IH3 A;  2IBD A;  3O8G A;  5IOY A;  1JGG A;  4W1U A;  1IRZ A;  2CUF A;  2COB A;  2W48 A;  1IGN A;  1K83 J;  4J19 A;  4L5E A;  1U8B A;  3HOX J;  2D5V A;  1ETW A;  1MSE C;  3CCY A;  1ETV A;  4JX5 A;  3D1N I;  1MBG A;  5IYC J;  3JRC A;  2NVT J;  5M5Y J;  2Y9Y A;  5M3F J;  2CJJ A;  1VND A;  1RET A;  5JLX A;  1PUF A;  5GPC A;  2XRL A;  4QSH A;  1DU6 A;  4XK4 A;  4D5C A;  1FEX A;  4M3F A;  4IHW A;  3LSG A;  2WAQ N;  5DS9 A;  4XID A;  3GTG J;  3RQI A;  5F27 A;  1POG A;  3OSF A;  3M4O J;  3TP3 A;  2HXO A;  4QIW N;  3BT9 A;  2XPV A;  4CYC A;  5IOZ A;  1U9N A;  3BTI A;  2ME6 A;  2E19 A;  1Z0X A;  3S1R J;  2LVS A;  3S2D J;  1BW6 A;  5F04 A;  4DYQ A;  2XB5 A;  2XGD A;  2LFB A;  3DCF A;  1JJ6 C;  2FQ4 A;  3HDD A;  1R9T J;  2JJ7 A;  3HB9 A;  3TW6 A;  2KT0 A;  3ZQI A;  3Q3S A;  5M3M J;  1JKQ C;  4MO7 A;  3GTL J;  5J1U A;  5E3M A;  3S1N J;  4XRM A;  1XS9 A;  4FCY A;  2R7Z J;  3QQA A;  3GTQ J;  3FK6 A;  2EZI A;  2XSD C;  1I50 J;  9ANT A;  3BTL A;  1BL0 A;  2E2I J;  4BXX J;  2Y9Z A;  4FIS A;  3BTJ A;  2XPU A;  2OPT A;  1MBJ A;  2DMN A;  4V2F A;  4RDU A;  2EBI A;  2GM4 A;  5M5W J;  5EEA A;  1ETQ A;  1PUF B;  1QRY A;  3S17 J;  5IP9 J;  1JT0 A;  3QPL A;  1JUP A;  1B72 A;  3HEF A;  1RES A;  3CDL A;  1ZR4 A;  3S2H J;  1SFO J;  4B4C A;  2PMZ N;  2DMQ A;  4DYC A;  2R5Y A;  2JA5 J;  3S1M J;  1ZKG A;  4A3C J;  4XIC A;  1NK3 P;  2I10 A;  1ETY A;  1MSF C;  4A3G J;  1LFU P;  1JUS A;  1MH4 A;  3O8H A;  2DA4 A;  3HKZ N;  1FIA A;  2HDD A;  1A5J A;  3G1M A;  4C2M J;  1ZR2 A;  1F43 A;  1JTX A;  3CMY A;  1AU7 A;  4A3J J;  5K7Z A;  3QPS A;  4A3M J;  3PO2 J;  4BKX A;  3FK7 A;  4D7N A;  3RZO J;  2X6O A;  1MNM C;  2HOT A;  5E3N A;  4I76 A;  1TWC J;  4FE7 A;  1MBF A;  3LSP A;  2EQR A;  2ELK A;  5IYB J;  4AYB N;  2E2J J;  1FTZ A;  4AUX A;  1K61 A;  1HDD C;  2NVY J;  3BR6 A;  1S7E A;  4Y7N J;  1T56 A;  2XGC A;  3G1L A;  2R0Q C;  4M3G A;  2O9L A;  4JX6 A;  4RBO A; 
#chains in the Genus database with same CATH topology
 2P6T A;  1VQ9 I;  2IA0 A;  5EG0 A;  5FLM J;  3IH4 A;  1Z3Y A;  4M9S A;  4NB5 A;  2XGX A;  4J00 A;  2Y69 H;  1S72 I;  4ENN A;  1BR1 A;  2V79 A;  4KDP A;  3I4N J;  5CVI A;  4DBQ A;  3GBG A;  3WU1 B;  1CF7 A;  1IG7 A;  5L3E A;  2L3D A;  2L9R A;  3F8C A;  3RKW A;  3L1P A;  3TED A;  2R3S A;  2HR3 A;  4UUS A;  4ZC3 A;  4WXH A;  4M9X A;  1OJL A;  1U78 A;  2QF7 A;  1ULY A;  1UMQ A;  3ZQ7 A;  3ZMU A;  3DLA A;  2DQR A;  5DCM A;  1QVU A;  3I53 A;  4EAT A;  4A3B J;  4MNU A;  5D4S A;  1YW9 A;  5DV5 A;  5ICE A;  2E5Z A;  3OOP A;  1XSD A;  3BZK A;  3TO9 A;  3RZD J;  1X2M A;  3DPU A;  3EDP A;  3OYL A;  1AWC A;  1LDD A;  2RQP A;  1G3Y A;  4M6V A;  1VQP I;  4Z6Y A;  1ITY A;  1Y39 A;  2V1U A;  3MWM A;  1XX5 A;  1O3T A;  5JHU A;  5HLH A;  2E7X A;  3KPH A;  3A0H C;  2LKX A;  1WCM J;  3K4B A;  4EQQ A;  3HKZ A;  4OIP F;  1FSE A;  4UUT A;  3AKZ A;  2ZKZ A;  2HVS A;  4B43 A;  1IN8 A;  1FYL A;  1E0E A;  3HSF A;  3BCA A;  2FX0 A;  2W85 A;  1RKW A;  4G9Y A;  5FFZ A;  2IS4 A;  2KDZ A;  3OL3 A;  2LLK A;  4XN3 A;  4XQF A;  2XRN A;  1RZ4 A;  4N4N B;  3I71 A;  3MD2 A;  4BDZ A;  2DXI A;  3DU6 A;  4L9N A;  2GLO A;  1R58 A;  2STW A;  5EYR A;  2GXA A;  2GOX B;  3EUK L;  1T33 A;  4D5F A;  3DQV C;  4FHT A;  5FD5 A;  4C2U A;  3ASO H;  3PNV A;  3M1C A;  3RPU A;  3OYN A;  5FO5 A;  2OU2 A;  3BY6 A;  1Z21 A;  3N05 A;  3WGI A;  3G2B A;  4DGW B;  5AIP A;  1ODD A;  3N97 A;  4XLC A;  4DZP A;  1WFX A;  2VKV A;  1TWG J;  1Y0N A;  2V1X A;  2Z16 A;  3WHC A;  4L18 B;  5GAH J;  1U5T A;  3JAM Z;  2JA7 J;  1XGN A;  1WJF A;  2M9H A;  4M9Z A;  2KZG A;  2GA2 A;  2D2W A;  1TTY A;  3RKQ A;  2A05 A;  3LAJ A;  2A5Y B;  3HPG A;  2EIN H;  2P4W A;  4I02 A;  1G3W A;  5FKO A;  4XRS G;  1SMT A;  2X85 A;  4YEL A;  4BXF A;  1JUM A;  1ZK8 A;  3IH2 A;  3NQO A;  1FYM A;  5IP6 A;  2YR2 A;  4DYR A;  1J2X A;  2LYC A;  2XUB A;  3MFK A;  4KA4 A;  1I3Q J;  2Q8K A;  2FNA A;  2DDA A;  3WG7 H;  4I0A A;  3MKY B;  1ENH A;  1X1B A;  2O03 A;  3DKY A;  2MC3 A;  3OYI A;  2X6Y A;  1W36 D;  3S16 J;  1HOM A;  1BOA A;  1PUE E;  2E2H J;  3DEU A;  3H5N A;  3G71 I;  1ZH5 A;  5CJ9 A;  1ZLJ A;  1V3F A;  3CMA I;  4IVN A;  3ABL H;  2UUZ A;  1T0F A;  2FD5 A;  2Y75 A;  3TKY A;  1DGR M;  5AIQ A;  2NVX J;  2M30 A;  3HOZ J;  4UUS B;  4KNY A;  4KIB A;  5HS8 A;  4MLO A;  3JRI A;  2DOF A;  1PYV A;  2G9W A;  3OWT A;  2JRM A;  2F5E A;  3D0S A;  4DNC A;  2C6Y A;  3KEY A;  2P0W A;  4O5V A;  4ESJ A;  1ACI A;  3JAM K;  4HA8 A;  4M3D A;  1CF7 B;  4GXO A;  3H36 A;  2O61 A;  2E1M C;  3RDI A;  2QQB A;  1D1B A;  3BWG A;  1SFX A;  4UVB A;  5K5R A;  3E5X A;  4A3F J;  1K78 A;  1GVD A;  3HGY A;  3V8L A;  1CQT A;  4RGS A;  1VFC A;  1BI3 A;  3X2Q H;  3IRQ A;  2MC4 A;  4BJ6 C;  1HKT A;  1V5E A;  3OYC A;  1X1C A;  4G8X A;  3WTY C;  1T98 A;  1GVJ A;  1EV7 A;  5BS6 A;  3L2V A;  2B7E A;  4IHT A;  5D5V B;  2YU9 J;  4AC0 A;  2DCE A;  3H9Q A;  4E7Z A;  1YRN B;  1IN4 A;  5ILS A;  2CUE A;  2DTR A;  3H3Z A;  2VQL A;  2R7V A;  3O3K A;  1ZGW A;  1FBS A;  2NAZ A;  3ZR8 X;  1V54 H;  4AD9 A;  2QEX I;  3KYC B;  1I6X A;  3J81 Z;  4OIQ F;  3CLO A;  2FBI A;  2EPF A;  2O8K A;  1W5C C;  2KKO A;  4PJJ A;  4AVZ A;  4WF2 A;  3RQ4 A;  3K1M A;  3K0L A;  3HTS B;  2LBF A;  1GT0 C;  1Y1V J;  1UAA A;  2K4J A;  1VI0 A;  5JHF A;  3SEZ A;  1FOX A;  1WJC A;  4UVC A;  2DA3 A;  2CW0 F;  3QP6 A;  2LSO A;  2BYV E;  2JA6 J;  2R5Z A;  2RAE A;  2R7S A;  4EM0 B;  3RYP A;  1W1W E;  3AG4 H;  2VC1 A;  3K4M A;  3LSH A;  3TQN A;  4U7D A;  3CP8 A;  1UHM A;  1XB4 A;  1P2F A;  2AXT C;  2GBY A;  4G7Z F;  2BVL A;  3OYD A;  4A3K J;  1O7F A;  2K02 A;  2EFW A;  4AIH A;  5F0C A;  2P5K A;  3ABK H;  3KZZ A;  1K4S A;  1UEL B;  1U5T B;  2QLZ A;  2M4K A;  4EM1 A;  5CVJ A;  3CQZ J;  2JT1 A;  3HSR A;  2NVU B;  5CKT A;  2HOE A;  1SFK A;  2B63 J;  2BHZ A;  5KAI C;  3EYI A;  2XF7 A;  5E3L A;  3WGH A;  5IY5 H;  3H0G J;  1S3J A;  5J1Y A;  1R1V A;  3Q9V A;  1MJB A;  2J5P A;  4X6A J;  1B6A A;  3K7A J;  3GYH X;  4BYY A;  1OKR A;  1LNW A;  2HPM A;  3A01 A;  3W2V A;  2LC2 A;  2PFB A;  1TNT A;  4ASN A;  2IW5 A;  4WXD A;  1EJ9 A;  1TT0 A;  1ONV A;  4XLF A;  3VPR A;  3CJR B;  4PSW A;  2HGC A;  3KP7 A;  5C44 J;  2EFP A;  4HAM A;  1HCR A;  2DOE A;  2JK3 A;  3HRS A;  4GFB A;  4JOM A;  4BHC A;  2PJP A;  2CS3 A;  2K9M A;  4IEJ A;  1Z67 A;  4A3E J;  5KHD A;  3UR3 C;  3BRO A;  2A61 A;  3L2U A;  1OCZ H;  3AL0 B;  3ECO A;  3ZMV A;  3EPZ A;  4X1E A;  2DFI A;  1GV2 A;  1VQ8 I;  3L09 A;  1OYY A;  4CSW A;  4A3D J;  2E5N A;  1V5G A;  2LY2 A;  4MFD A;  3NAU A;  1FT9 A;  2OF7 A;  3V7S A;  4PGG A;  1ETX A;  4QPQ A;  2VJ4 A;  2CH0 A;  5B1B H;  3FXU A;  2BBY A;  2L9N A;  2UZK A;  1R6R A;  1FY7 A;  5EZG A;  1Q1V A;  1TW3 A;  1MJA A;  2OZU A;  5K5Q A;  3BR1 A;  3JTG A;  4F93 B;  5J6X A;  1RC9 A;  3EUH C;  1W36 C;  5H20 A;  1SAX A;  5FLV A;  3JRG A;  2A6H F;  2QQA A;  2DYS H;  4CGZ A;  3K2A A;  3O8G A;  2QBY A;  5IOY A;  3CO7 C;  3TBI A;  5BMZ A;  4Q47 A;  2K4B A;  3CMM A;  3PIP F;  1U8B A;  3HOX J;  3CC4 I;  3SZT A;  3WE3 A;  3K4N A;  1STZ A;  1YFH A;  1G59 A;  2PX9 A;  3ONQ A;  2P5V A;  3ZXS A;  2Y9Y A;  1UG0 A;  1BIA A;  2KHM A;  2QVO A;  2EV5 A;  1VND A;  1RET A;  1YQA A;  4YFX F;  4L5I A;  1FEX A;  5CVU A;  4IHW A;  2H6B A;  3V8J A;  2RRE A;  3HUG A;  2WAQ N;  2XRO A;  1VQK I;  3GTG J;  2BE5 F;  3U1K A;  5KAF C;  3OSF A;  3TP3 A;  4CZC A;  4QIW N;  1VQL I;  1EH6 A;  2L4A A;  1KGS A;  2XSJ C;  2EV0 A;  3HZJ A;  3CO6 C;  4RM3 A;  2ME6 A;  4YIR X;  2LVS A;  2Z2S B;  1J9I A;  5F04 A;  4DYQ A;  1TBX A;  5FGM A;  1Y56 A;  4PFP A;  2XB5 A;  3CC2 I;  2V9K A;  5JVT A;  3LA2 A;  3WG9 A;  1JJ6 C;  1XSV A;  2RVC A;  3EET A;  4HW0 A;  3LAP A;  1I39 A;  4I2O A;  2VKH A;  3TW6 A;  1LKX A;  3Q3S A;  1XCB A;  2Q2E A;  5FD6 A;  5M3M J;  3GTL J;  5J1U A;  5E1W A;  5E3M A;  2LF7 A;  2JUC A;  4BUP A;  1RRJ A;  3BG6 A;  3DPL C;  2OA4 A;  2EZI A;  2WY8 Q;  3FMQ A;  2XSD C;  1I50 J;  3K4L A;  3S2W A;  4F3Q A;  1LEA A;  1BN5 A;  1QHH D;  2XPU A;  1S7A A;  2DMN A;  1ZHF A;  1XN7 A;  1G6N A;  1ZGA A;  3ZMZ A;  1PUF B;  2NYX A;  1UFM A;  1KYZ A;  2EFQ A;  3ESW B;  1YIJ I;  1FPQ A;  3S17 J;  3BCB A;  5HS7 A;  1R00 A;  3PQK A;  4RB0 A;  3KX2 A;  1JUP A;  3LA7 A;  3C2G A;  3TDU C;  2V1N A;  1SFO J;  1X3W B;  2R5Y A;  2Q2E B;  1PP7 U;  4A3C J;  4OWR B;  2LMD A;  4XIC A;  5L3B A;  2I10 A;  1ETY A;  5E1Z B;  1YTY A;  4A3G J;  4HX4 A;  4XLA A;  1LFU P;  1EA3 A;  1MH4 A;  3WTV C;  1F4K A;  2XAS A;  2W00 A;  1FOK A;  1E2X A;  3IAS 2;  2V6E A;  2LNB A;  4AVP A;  2BVM A;  4XLP F;  3IL2 A;  3M8E A;  2FOK A;  3P9I A;  3CMY A;  5LGT A;  4A3J J;  4D9J A;  4A3M J;  1H9T A;  3PO2 J;  2L4M A;  3FK7 A;  2GXG A;  3KP6 A;  3CC7 I;  1R23 A;  1W7P A;  1TWC J;  1B9N A;  2RKH A;  4FE7 A;  2ZME B;  2IGM A;  2LKP A;  1IXR C;  4V19 K;  2GXB A;  4L9J A;  1A35 A;  3BR6 A;  1TNS A;  4XN0 A;  2ZJP F;  2QQ9 A;  5A2Q K;  2JA2 A;  4L9T A;  1T56 A;  2XGC A;  2O9L A;  4RMN A;  4M3G A;  3OYG A;  1FLI A;  4Y33 A;  1UHW A;  3F6V A;  4RBO A;  1AHD P;  4DOZ A;  4WK8 F;  3CCM I;  4HLY A;  4UB8 C;  3KP2 A;  2PMZ A;  4PUS A;  1WWX A;  3GVA A;  1S7O A;  1QZZ A;  4CDG A;  3NAR A;  2OZ6 A;  4BE1 A;  4IHY A;  1J75 A;  2ID6 A;  4BBR J;  2MA3 A;  2X6X A;  1OPC A;  1F36 A;  4IOA F;  3FKI J;  4ZTJ A;  2F48 A;  5F0H A;  1IUF A;  2YS9 A;  3I59 A;  2DW4 A;  4XKC A;  2XAG A;  3SHF A;  2F5V A;  3KYD B;  2BGC A;  1ETK A;  1H0M A;  3NWT A;  1EF4 A;  2Z9O A;  1X58 A;  3L2C A;  2MLG A;  3E3V A;  2K9S A;  4BHB A;  3CME I;  1IC8 A;  1DQU A;  1GUU A;  2BY1 A;  3P9K A;  2E36 A;  2WV1 A;  4MIM A;  3ERE D;  1R1U A;  5BPD A;  4EM2 A;  1LJ9 A;  1G2H A;  3OIP A;  1QNT A;  1DU0 A;  3MVP A;  3GTK J;  1ZYR F;  3KP4 A;  2X9D A;  4MHG A;  3H1C A;  3HOV J;  2DTZ A;  1JJ8 C;  2WB1 N;  3J80 Z;  3PJR A;  3A4C A;  2EZL A;  2IA2 A;  4HV5 A;  3SZP A;  4BY1 J;  1QVT A;  3EYY A;  4HST A;  3MKL A;  3M3Y J;  3K2Z A;  3RCO A;  3ZRG A;  1H8A C;  2K40 A;  5FRO A;  1A31 A;  4QTR A;  3GTJ J;  4C3J J;  1WGX A;  4HNU A;  3AG1 H;  5L3F A;  2E1C A;  1WH7 A;  1U0J A;  2HNH A;  3RYR A;  3OS2 A;  2JQ7 A;  1WQ2 A;  1G3T A;  1VF9 A;  2R93 J;  3OYE A;  2CO5 A;  2HTJ A;  2QEN A;  3FM3 A;  3E7L A;  3HOY J;  5TJJ A;  2E60 A;  2OCE A;  3C2B A;  3GW2 A;  3PFI A;  5KVR A;  3TOB A;  3VSL A;  1TT5 B;  2EIJ H;  1I1S A;  2NXN B;  3L00 A;  3W2A A;  2CG4 A;  5GP9 A;  2Y48 A;  2HPI A;  3M07 A;  2PBI A;  3QYE A;  1TC3 C;  3G73 A;  1IRX A;  3E6M A;  1WI9 A;  2M3A A;  4IZZ A;  4E7L A;  5LGU A;  1IDY A;  1H89 C;  1T38 A;  2XAH A;  3ZQF A;  1XG1 A;  2Y31 A;  3L2W A;  2ZB9 A;  1YS6 A;  3HM5 A;  3DTI A;  2MH9 A;  4ZYH A;  3I0T A;  3Q0U A;  1HKQ A;  2IP2 A;  1Z05 A;  2D1H A;  3GZ6 A;  2PJR B;  2M7A A;  1Z6T A;  2RC4 A;  5EZH A;  2OAZ A;  4NBQ A;  4A93 J;  4HOB A;  2L0K A;  2KL4 A;  5D6E A;  1SMY F;  3B6A A;  3VWB A;  2LP0 A;  3C3W A;  2PEX A;  4II3 A;  3CCR I;  5K7F A;  3MMY B;  1JHH A;  4P55 A;  3IRR A;  4A6E A;  1FNN A;  4M74 A;  2W4S A;  4GYI A;  4HQE A;  5HNF A;  2M1B A;  1F9N A;  1MGT A;  2W24 A;  3DF8 A;  2JA8 J;  2DT6 A;  4S05 A;  2VJ5 A;  3ZQG A;  3DBR B;  4B09 A;  2M34 A;  1ON1 A;  2E1M B;  2Z1D A;  2B9S A;  2DJN A;  3CUQ B;  2FEZ A;  1MKM A;  1R36 A;  2QYO A;  4UHT A;  4ENJ A;  3LQQ A;  4FTH A;  1BI1 A;  2A69 F;  3DBH B;  2COM A;  3HIF A;  2V7F A;  4RB1 A;  4ZYD A;  3RKX A;  4KIC A;  2K86 A;  3GF2 A;  4U0V A;  2XGE A;  1P7J A;  3KEO A;  3ZQQ A;  1N78 A;  1S8N A;  4GO1 A;  2HKO A;  1J0R A;  2M5W A;  4Q48 A;  4IXA A;  4Y13 A;  1RUO A;  3JCU C;  1YJ9 I;  3GX4 X;  2HVQ A;  3V7R A;  2VOP A;  2MLK A;  1MZB A;  3K69 A;  1SD4 A;  2WY7 Q;  4FAS D;  1YIT I;  2RNJ A;  1RI7 A;  3E1S A;  2V26 A;  4MEX F;  4KIS A;  1Z91 A;  1S6L A;  5IT3 A;  2QA4 I;  2Y0M A;  2QBY B;  1YG2 A;  2DYR H;  2MSY A;  1Y1W J;  4DJA A;  4N0B A;  2ACJ A;  4ITV A;  4XLH A;  5CPR B;  2QGU A;  3KIO A;  4MGR A;  1JKO C;  2A68 F;  2DMU A;  3P9C A;  3WHB A;  1HXD A;  4H4K C;  4DW6 A;  4IHX A;  1WH5 A;  2CMP A;  2L54 A;  1WI3 A;  3ASN H;  4BBS J;  5E1X A;  3F8F A;  5BQT A;  3T8R A;  4BY7 J;  2K3F A;  2OJE D;  3BP8 A;  4JYK A;  2OC6 A;  3I55 I;  3CCE I;  1EH8 A;  1FTT A;  1B9M A;  3GTM J;  3AL0 C;  4XM3 A;  3RIR A;  1LEB A;  2TCT A;  2OQG A;  2KMU A;  1APL C;  2WTE A;  2EIL H;  4CYC B;  2VN2 A;  3BR2 A;  4XRF A;  3WU0 A;  4ENM A;  4I99 C;  1O3R A;  3BQZ A;  3GFM A;  2H8R A;  3P5J A;  2XV4 S;  5IP7 J;  3H3V K;  2DT7 B;  2DMP A;  4G12 A;  1SFU A;  1Z3X A;  3TP0 A;  4QLC U;  3K70 C;  3TL4 X;  3G6E I;  5FRN A;  1GXQ A;  2XF6 A;  3CCU I;  4OMY A;  5DTD A;  1MND A;  3JRB A;  1X3U A;  5HLI A;  3F21 A;  5LEK A;  4JX4 A;  3F8N A;  1U2W A;  3JTH A;  1X1A A;  3TOA A;  1H9G A;  5GAE J;  3HG9 A;  2HQ5 A;  1D0Y A;  4XRS A;  1ZG3 A;  3KLN A;  3IC7 A;  1YRN A;  2DA1 A;  5D8L B;  1JTY A;  2FA5 A;  2A6E F;  2YPR A;  2EH3 A;  2BEO A;  4M3E A;  3CCV I;  5FJ8 J;  5KCM A;  4IKF A;  2Q1Z B;  2M45 A;  2M2E A;  3H5A A;  4HPQ A;  3KZI C;  2E34 A;  2IEK A;  1NK2 P;  1LUJ B;  3W2W A;  4DQ2 A;  2CV1 A;  3IWZ A;  3H35 A;  3ZQH A;  2WAQ A;  2LK2 A;  2N8G A;  2H1L A;  2IA1 A;  3MZY A;  2HOS A;  2AS5 F;  2EJR A;  5TIS C;  4F92 B;  3HL2 A;  3MN2 A;  2KDO A;  2PI0 A;  4M6Y A;  4RLQ A;  2GIZ A;  3OIO A;  3G1O A;  4D1Q A;  1OFC X;  3CCJ I;  2VLA A;  2JN6 A;  5C3E J;  3VYT B;  1XSX A;  3CUQ A;  3L2Q A;  1U9O A;  1IAW A;  2XAU A;  4L0Y B;  4IF4 A;  2ECC A;  1O7L A;  4E7J A;  4PK4 A;  5E3O A;  1KON A;  2R5Y B;  2CFX A;  2K3P A;  1MJ9 A;  2Z99 A;  2JMW A;  1XPX A;  3AG2 H;  1ZN2 A;  2QSH X;  4LLL A;  5ILV A;  2DA7 A;  3A02 A;  1X1D A;  3F0C A;  3JRD A;  3QOP A;  2J5O A;  2H94 A;  1NG7 A;  4OIN F;  5HVQ C;  1BW5 A;  4IRH A;  3OL4 A;  3HJE A;  3BG5 A;  5TGT A;  3V8K A;  4HQM A;  3VOE A;  5D5U B;  1OQY A;  2OBP A;  4P96 A;  5J3L A;  2FXA A;  2Y0S N;  4LB6 B;  1P6R A;  4FE4 A;  4FX0 A;  4BGD A;  2KJC A;  2X48 A;  1OCO H;  4C3I J;  5KNL A;  1ON2 A;  1D5Y A;  2R7F A;  4U7B A;  4BQA A;  3DTK A;  2R7D A;  3ABU A;  1UCR A;  3FMR A;  3W3C A;  5LGN A;  3U1D A;  3SJM A;  3BQY A;  1Z7U A;  2V1D A;  2IJL A;  3EUA A;  4S04 A;  1SEU A;  2DA6 A;  3IH3 A;  5BOX A;  1JGG A;  4W1U A;  2FSW A;  1WSU A;  1IRZ A;  2CUF A;  1W5S A;  5LHG A;  3QAH A;  3WE2 A;  4BAC A;  2JPB A;  3V42 A;  4JX5 A;  3D1N I;  1DUX C;  5IYC J;  2DAO A;  2NVT J;  2QM3 A;  5M3F J;  1XCV A;  2DOA A;  4BDY A;  2W82 A;  2WAE A;  5GPC A;  1WJA A;  3NWS A;  3K6G A;  3VFZ A;  3BJO A;  4I98 B;  4XNF A;  5DYM A;  2KRC A;  4LK1 F;  5DS9 A;  1MDM B;  5LFA A;  1QZY A;  2JTV A;  3HXL A;  4JQF A;  5F27 A;  1POG A;  2HZT A;  3TO7 A;  2DLL A;  4YII A;  4AID A;  3LWF A;  5HS9 A;  1AA7 A;  2F4O B;  3Q5F A;  3NRV A;  3I54 A;  1Y8R B;  2IS2 A;  3BTI A;  2OV7 A;  2E19 A;  3S1R J;  5DEQ A;  4EJU A;  4I0B A;  4GCV A;  1YE9 A;  4BEH A;  4MTD A;  3H92 A;  3PUB A;  3F3X A;  3HYI A;  3DU5 A;  2M4G A;  2XGD A;  3DCF A;  3GWZ A;  4YFK F;  2FQ4 A;  2H09 A;  1SAU A;  1EKE A;  4YG2 F;  1QO0 D;  5F6F A;  2VBY A;  2JJ7 A;  1XD7 A;  4WX9 A;  2QKM B;  1JKQ C;  2VQC A;  3ERM A;  4U88 A;  5CVV A;  1T39 A;  1WVR A;  4XRM A;  1SFE A;  3KLO A;  4G6Q A;  3O2P E;  4E7K A;  3QQA A;  4A0Z A;  2L9V A;  4ESB A;  3GCM A;  3PL8 A;  2CW7 A;  1HSJ A;  1SVL A;  3OS1 A;  2OTJ I;  1ZAR A;  1ZGJ A;  2HZD A;  3BTL A;  4CCO A;  1YYV A;  1JGS A;  3GZN B;  4BXX J;  1D8K A;  3BTJ A;  2HYF A;  3BG7 A;  1VTN C;  2KFD A;  2BHY A;  2ELJ A;  3FXK A;  4V2F A;  2VAS A;  4KN4 X;  1R22 A;  1X19 A;  4ZH4 F;  4BEH B;  4M6X A;  2DBB A;  4QPO A;  1K78 B;  1N25 A;  4IJA A;  3I3L A;  1GHC A;  4R1H A;  5IP9 J;  2MD5 A;  4AWX B;  4U0Y A;  1G8X A;  2LY1 A;  3QYB A;  1B72 A;  4Y17 A;  2ZFW A;  3WTS C;  3HHG A;  4NQW B;  1HST A;  3RSN A;  3CZ6 A;  4B4C A;  2PMZ N;  3M1E A;  4DYC A;  5LBQ A;  3S1M J;  3ZGK A;  1HC8 A;  5FRM A;  3JW4 A;  1FP1 D;  2VKD A;  2ZO4 A;  3OYK A;  2KRF A;  2HS5 A;  4LK0 F;  3B73 A;  1MMS A;  2BXY A;  4F55 A;  3A0B C;  4R79 A;  3BLY A;  4CYD A;  1KQ8 A;  2R7O A;  1BJA A;  3OR2 C;  5B3S H;  4M72 A;  2OUM A;  3M8J A;  1ERD A;  2HDD A;  2LH9 A;  1F43 A;  3N4M A;  1G4D A;  2PLY A;  1JTX A;  3IAM 2;  3OR1 C;  1XMK A;  1ZRD A;  5F64 A;  2EK5 A;  3FDY A;  3JSO A;  4RGX A;  2M7B A;  1YIO A;  4HX7 A;  4EJT A;  1FTZ A;  1LDK B;  5AON A;  3OV8 A;  2LRD A;  3COA C;  4XBF A;  1S9H A;  1YLF A;  2IGN A;  3KE2 A;  3FXR A;  4RA2 A;  1IRF A;  3FHZ A;  2PQ8 A;  3H3U A;  4Y7N J;  3KP5 A;  2GWR A;  4BJT A;  3G1L A;  2KPM A;  1KYW A;  2ZJQ F;  4JX6 A;  3A1Y A;  3R61 A;  5K1Y A;  4UV8 A;  3Q9S A;  4U0W A;  2VXD A;  4MQV A;  1XC5 A;  2KIQ A;  4P9U A;  2IS6 A;  2E71 A;  3ZPL A;  3H0D A;  1BIB A;  2EZH A;  2TDX A;  1NTC A;  3FHN A;  4ABZ A;  4Z2Y A;  4CCM A;  2NOG A;  3ABT A;  1LQ1 A;  4LGW A;  1R4M B;  1SAN A;  5EGO B;  2M8E A;  2VE9 A;  4M71 A;  1UST A;  3CP2 A;  3MCZ A;  2IAI A;  1B8I A;  2GQQ A;  2QWW A;  5EJC A;  4KFC A;  2EA4 A;  1U6G A;  2XB0 X;  2XVC A;  2UXN A;  2OD5 A;  3KEQ A;  5ICC A;  2DDB A;  3HTU A;  3BR5 A;  4RAG A;  4KYW A;  2ECB A;  2ELH A;  2ZJ2 A;  3FXO A;  1OMI A;  3HRM A;  3A01 B;  3R6S A;  3JRF A;  5EEG A;  5F08 A;  5A2Q Z;  1TL8 A;  1KQ0 A;  1CGP A;  5HLG A;  3DTE A;  2CUJ A;  3FM5 A;  3PQJ A;  2MFZ A;  2QSG X;  2K9L A;  3LL7 A;  3B6C A;  1BA5 A;  4HRI A;  4IOC F;  2ZNZ A;  4LIU A;  4PFO A;  3REO A;  3DBL B;  2DA5 A;  2MW8 A;  5FLX K;  1ZEL A;  3C18 A;  3KET A;  1F5T A;  2ZCW A;  1SVM A;  3H9J A;  2JSC A;  2ZSI B;  3R4K A;  4RAZ A;  3ZMS A;  3MZH A;  5BPI A;  1MW7 A;  1WPK A;  5J4Y A;  3LOC A;  3I9V 2;  4LD5 A;  4BL0 B;  3OIQ A;  1K6O A;  3MQ0 A;  1H88 C;  3V7C A;  2HDC A;  5GAG J;  4Y4R A;  4IRI A;  2FNP A;  4GGG A;  1FBU A;  1UHS A;  3F72 A;  4X0G A;  3OYM A;  1IV6 A;  3ZMT A;  2XF5 A;  1D3Y A;  3CES A;  4OAZ A;  3SQN A;  3LSR A;  1WJB A;  3E5Q A;  1YOV B;  3T1B A;  3BR3 A;  3C2H A;  2L7F P;  3GFJ A;  3GTO J;  1A6I A;  1BI0 A;  2VKE A;  5JR3 A;  1ZAO A;  4C30 A;  1GV5 A;  2G0E A;  2MAB A;  3K10 A;  3QWL A;  4BHP A;  2KJB A;  2A5W A;  2VON A;  4LLN A;  1P9Q C;  4ON0 A;  2VBW A;  3BG3 A;  3GME A;  4LG0 A;  4OIR F;  4B1R A;  4BJ5 C;  3OYB A;  2DK5 A;  3BOQ A;  2HKX A;  4BE0 A;  2LOO A;  2P6S A;  3BPX A;  5E18 F;  4MTE A;  2BXZ A;  1J59 A;  3RI4 A;  4WCG A;  1FZP B;  5LEJ A;  3F8B A;  3GTP J;  4IQJ A;  2VQG A;  4BS9 A;  3I5U A;  2VL8 A;  4A3I J;  4FQG A;  4B8X A;  3AG3 H;  2CWE A;  1MD0 A;  5E17 F;  1VQ4 I;  3IUO A;  4EGY A;  2XKP A;  2M0C A;  3RPQ A;  3I4P A;  2P81 A;  2CQQ A;  5H2F C;  2YSR A;  2NS7 A;  4BU2 A;  3S15 J;  2CQK A;  5CYV A;  3T5X A;  3VYS B;  3QPT A;  3GXO A;  4EEF G;  1G3S A;  1XMX A;  2GAU A;  4CCN A;  3H9G A;  2JPC A;  4OMZ A;  3GFI A;  5FKL A;  1E3P A;  3R0A A;  2LF8 A;  4ZDO A;  2FOW A;  5DD4 A;  4Y52 J;  3OYH A;  1SC7 A;  1L0O C;  2CUZ A;  1AKH A;  4NNJ A;  4KIG A;  4A0X A;  5IT9 Z;  1S5L C;  2LRE A;  2NNN A;  1E17 A;  2P7V B;  4P5O A;  3D5L A;  4A0Y A;  2VPL A;  4IRG A;  1V5F A;  1GDT A;  5J1R A;  1B8I B;  5HNH A;  1EH7 A;  1JXS A;  3DEE A;  3I59 B;  3GLX A;  3WTX C;  1XDS A;  2XPW A;  4ZYG A;  1B1B A;  2KIS A;  2VIX A;  3QOD A;  4NC8 A;  2QKL B;  4LMY A;  4XOT A;  3PM1 A;  1QU3 A;  2VT3 A;  1VQ5 I;  1QBJ A;  4E70 A;  1PVE A;  1A04 A;  3C7J A;  2DFF A;  4ZDP A;  3DPT A;  5B1A H;  2R7U A;  1HW5 A;  2NRA C;  3RKY A;  1XDU A;  2DN0 A;  1VQ7 I;  4Q5S F;  2HXI A;  3G3Z A;  3KYL A;  3MZ8 A;  3S14 J;  4AIK A;  1QPM A;  2CGP A;  4AIJ A;  3OOU A;  3JRH A;  3L2R A;  2K85 A;  1Z9C A;  2H27 A;  1HQC A;  2MG4 A;  2WB1 A;  5K5O A;  2O0Y A;  2DQL A;  2OTL I;  2K5C A;  3IV5 A;  2Z33 A;  3LMM A;  2D1V A;  4HX8 A;  1WHU A;  1U8R A;  1R5I D;  1ZTR A;  3Q0V A;  5IT9 K;  2LD5 A;  1SD5 A;  1RR8 C;  2O6G E;  3U2R A;  1W0T A;  1IW7 F;  4YIF A;  2CRG A;  3M8F A;  4L0Z B;  4CCJ A;  4D7M A;  1FIP A;  4IPA A;  2M8G X;  4PGH A;  3DKW A;  4LB5 A;  2ZSH B;  3M9A A;  1Q1H A;  3SFZ A;  1YJW I;  1L3L A;  5BNG A;  3W6K B;  1J7K A;  4HNT A;  1I5Z A;  3NEU A;  4HV6 A;  2ZXH A;  5EG0 B;  2LKS A;  5CVR A;  5B66 C;  2KP6 A;  1O4X A;  3ZN0 A;  1TQP A;  1QHG A;  1TWF J;  4C3H J;  3VOD A;  2W1O A;  3E0J B;  3OS0 A;  4IO9 F;  3OY9 A;  2ISZ A;  4I09 A;  4A5M A;  1FX7 A;  1T6S A;  2TRT A;  1I6H J;  2VXZ A;  2L7M P;  4B48 A;  1X2N A;  2NNY A;  4LIV A;  2HDW A;  2VJI A;  3CD6 I;  1JE8 A;  1TZL A;  2KIM A;  1ORK A;  4GRI A;  1BOB A;  2HQA A;  2M0M A;  2WC2 A;  2PJR A;  4XR6 A;  5FKN A;  2BY2 A;  2WBM A;  2X1D A;  4G6T B;  2EB7 A;  4FT8 A;  2NS8 A;  4E7I A;  3MKW B;  4LFU A;  4KMU X;  4UY8 I;  4KT6 A;  4QWQ A;  2AXL A;  1X4P A;  4LJZ F;  5C4J J;  3WTW C;  1MMA A;  1A36 A;  3Q0W A;  3CCS I;  4A3L J;  5D4R A;  4CIC A;  2V4J C;  3L7W A;  5IPA A;  5JI6 A;  3CCL I;  1WRJ A;  2QCO A;  4GYG A;  2P7C B;  4RLF A;  3S8P A;  1YS7 A;  2DFH A;  3OYF A;  2EIK H;  1UJ8 A;  2FQ3 A;  2G7H A;  3FZV A;  3LST A;  3FBN B;  5FLX Z;  4CCL A;  1MMN A;  2WV0 A;  5D8K B;  2GIV A;  1A6Q A;  2DMT A;  3QRF F;  2Z3Y A;  2DJI A;  1HLV A;  2F4I A;  2ZME A;  3ZMD A;  3D5S C;  4N9I A;  1HW2 A;  2JUG A;  1IXC A;  2MGQ A;  1ZG5 A;  5F0F A;  2X1E A;  3K9T A;  2O8X A;  4MEY F;  1E3O C;  4YRV A;  5ICG A;  3FMS A;  4BE2 A;  4B3A A;  2BV6 A;  2MH2 A;  2XDV A;  1VQO I;  3LNQ A;  5J4V A;  4CH7 A;  3CUQ C;  4D0P A;  1RPW A;  2IBD A;  4Y3O A;  4RGR A;  1BR2 A;  2COB A;  1IN6 A;  1IGN A;  1FC3 A;  3IP4 B;  1FYK A;  4OAY A;  1K83 J;  4J19 A;  4G7H F;  3HOT A;  4M73 A;  4XMY A;  1VQM I;  4XON A;  1ETW A;  2D5V A;  1MSE C;  1S29 A;  3JRC A;  5M5Y J;  2F5D A;  2XRL A;  2ZXJ A;  4XK4 A;  4D5C A;  4H0E A;  3LSG A;  4F7Z A;  3HHH A;  4LG0 B;  5EEH A;  4L5J A;  5LRS A;  1RNL A;  2KRH A;  4A5N A;  4CCK A;  1AOY A;  3I58 A;  2AQE A;  2HXO A;  2XPV A;  4HZF A;  3BZC A;  4MQ9 F;  5D5X B;  2XKO A;  3GLL A;  1U9N A;  1BC7 C;  4ZJZ A;  3R0J A;  1Z0X A;  4NC6 A;  2R7X A;  1UB9 A;  1FOY A;  3S2D J;  1X4O A;  1BW6 A;  3P7N A;  5D5W B;  2QSF X;  5B5E C;  4PJM A;  1VQN I;  2LFB A;  3HDD A;  2MYS A;  2VQH A;  2CFO A;  2A07 F;  2CV2 A;  1OLT A;  4G94 A;  4HF0 A;  3HB9 A;  5DM6 F;  1BBY A;  4KJZ A;  3ZQI A;  3U21 A;  3WGG A;  2VC0 A;  4PCQ A;  3S3M A;  1GLN A;  2GOM A;  2R7T A;  4FCY A;  2EWN A;  3WTU C;  3GTQ J;  2HYG D;  5CQE A;  1T95 A;  3DKX A;  3FK6 A;  4CA0 A;  9ANT A;  2G7U A;  3B02 A;  2V9P A;  1OR7 C;  2X51 A;  3ELK A;  5H6Q A;  4EJO A;  1LPQ A;  2LG4 A;  4C2T A;  2Y9Z A;  5E8G A;  2OPT A;  3ISP A;  3K4K A;  1YJN I;  4RDU A;  2EBI A;  1R5G A;  5M5W J;  2HEO A;  2R7W A;  5EEA A;  1O3S A;  3DLL F;  4AYB A;  2VJJ A;  3CF2 A;  1XGM A;  1K6Y A;  4ZTF A;  1LVK A;  1OCR H;  2HFH A;  1J5Y A;  3QPL A;  4EGZ A;  2FF4 A;  1E3H A;  5LD2 C;  1LFP A;  3HEF A;  1ZR4 A;  1Z7L A;  3VB2 A;  4IHS A;  3KZY A;  3HSE A;  2DMQ A;  3UNG C;  5GAD J;  2JA5 J;  2BY3 A;  2KIF A;  3FXQ A;  3K4C A;  4UV9 A;  5F1R A;  1Z1D A;  1ZKG A;  2HU9 A;  3V4G A;  1NK3 P;  1MSF C;  4RB2 C;  1QZE A;  1KU9 A;  3E6C C;  2DPD A;  2WWY A;  1JUS A;  2D45 A;  2W84 A;  4RM2 A;  2H6C A;  2IXS A;  1ZR2 A;  3H5R A;  3D5R C;  4XOR A;  1VQ6 I;  3F6O A;  2HTS A;  3QPS A;  4XKW A;  5L3D A;  4CO8 A;  2X6O A;  1K7A A;  2KZV A;  4I76 A;  5DUK A;  3HC7 A;  4A2U A;  1FMW A;  2EQR A;  2FU4 A;  2ELK A;  3E6B A;  4KT5 C;  1DPU A;  4HDU A;  1K61 A;  1HDD C;  2KLO A;  1S7E A;  3FX3 A;  3RPU D;  2V6C A;  2KIU A;  1D1C A;  1I1G A;  3CTA A;  4Y15 A;  2VOO A;  4E7S A;  5JVG F;  4XKB A;  4WXC A;  2K9Q A;  2AQF A;  4ZDL A;  3ROU A;  2X6W A;  3T8T A;  4ENK A;  1BJZ A;  2DFE A;  1MMD A;  4RAY A;  3BC8 A;  2Y0S A;  3FIW A;  4XLN F;  3F22 A;  3HRU A;  3FXM A;  5HOO A;  2ZC2 A;  3DEW A;  5EF6 A;  2OQR A;  1KU3 A;  1RR7 A;  1IV8 A;  4ZYE A;  5IYD J;  5D6F A;  2O5R A;  1K79 A;  2HQN A;  1W7P B;  1X1P A;  2JVG A;  3PO3 J;  1J09 A;  3PNT A;  2RNG A;  3CJT B;  3A03 A;  1B4A A;  2F5C A;  3E5U A;  3ZCO A;  1QA6 A;  2EIM H;  1QPI A;  1XGS A;  2XHK A;  1W4M A;  1IXS B;  4UB6 C;  4EJW A;  1ZG1 A;  4LG3 A;  3GEZ A;  4IX7 A;  4NDL A;  4JP0 A;  3HOW J;  5JLW A;  4A6D A;  3A2K A;  2R4G A;  2BZT A;  1HF0 A;  1K4T A;  2XAF A;  2VB6 A;  2L7Z A;  2L5Q A;  3FIS A;  3JRE A;  4N9H A;  1P92 A;  4B44 A;  2RQQ A;  2A3S A;  1MBE A;  2YUS A;  4NUB A;  5J40 A;  5FKK A;  3HGG A;  2W7N A;  4HF1 A;  4PZJ A;  2LY9 A;  3PNY A;  2ZJR F;  3CUO A;  4ANJ A;  4YFN F;  5CQG A;  1HDP A;  1FP2 A;  3KFW X;  2YX7 A;  2O7O A;  2JWT A;  3OYA A;  4XL9 A;  5EDN A;  2F5F A;  3CLQ A;  3ZQL A;  1U5T C;  2DT5 A;  1W0U A;  1XMA A;  3GZ5 A;  2X0L A;  4HNV A;  3S32 A;  5KK1 A;  1P7I A;  4I6Z A;  4I7H A;  4ESF A;  2V9V A;  2W25 A;  1YX3 A;  5GPA A;  3GO5 A;  2H1K A;  3MEX A;  2VBX A;  5E20 A;  3ML6 A;  2ID3 A;  3CJQ B;  1YW7 A;  3PUF A;  3ZP5 A;  4PJN A;  1OYI A;  2QZ8 A;  1SD7 A;  3FWE A;  4BH9 A;  1UG2 A;  2R92 J;  2KQR A;  2CSO A;  1D0X A;  2HQR A;  1ETO A;  4MFE A;  1YI2 I;  1IRG A;  1FBQ A;  3PSI A;  1OCT C;  2I5U A;  4HF2 A;  4R8H A;  1BM9 A;  1MDM A;  3ZQC A;  5J47 A;  1ZLK A;  2AHQ A;  2ZBK A;  2HYJ A;  3JR9 A;  1TWH J;  3LSJ A;  2GZW A;  3BPV A;  4B47 A;  1V4R A;  5HDG A;  3VYR B;  1BC8 C;  1IF1 A;  1R4N B;  1U3E M;  3AFH A;  4HDV A;  2E1O A;  1DDN A;  2F2E A;  1OYW A;  2CQ7 A;  3I4M J;  3HUG B;  3I64 A;  1HA8 A;  2L02 A;  4BQO A;  2UV1 A;  3FXL A;  2DU9 A;  4DZJ A;  3TGN A;  4DIQ A;  4KIF A;  4ZZD A;  4DBR A;  4GDF A;  2EA2 A;  2IGK A;  4PJL A;  3PIO F;  5J8F A;  3SZG A;  3HOU J;  2ADU A;  1ZQ3 P;  3O6B B;  4AM3 A;  1YO5 C;  2RGV A;  4XKV A;  3HOS A;  3VYU B;  3K70 D;  1RKT A;  5ILU A;  1IUY A;  3DWL E;  4O6J A;  3S93 A;  1FMV A;  2CQN A;  1DP7 P;  3ULQ B;  2DA2 A;  5DDG A;  2JZY A;  1ZRE A;  1XTA A;  3S1Q J;  3TW7 A;  2K9N A;  2HVR A;  4RB3 C;  1D0Z A;  1Y6I A;  4J01 A;  3BG9 A;  2ZXI A;  2CQX A;  3DFG A;  3FBI B;  2W57 A;  4M3B A;  4UVA A;  2IVM A;  4N4O B;  2IPQ X;  4W97 A;  4NHJ A;  2LR8 A;  3HBL A;  1QGP A;  2FUG 2;  3W6J B;  4E6K G;  2VBZ A;  2R5Z B;  1LVA A;  2JRT A;  1I27 A;  2MBF A;  1O57 A;  2EV6 A;  2ME0 A;  5ICF A;  2XC7 A;  1R5H A;  4BXU A;  4A12 A;  4HG2 A;  4A69 C;  1D1A A;  2DI3 A;  4CZZ A;  2Y30 A;  2LBF B;  2ISY A;  4ZZL A;  3I56 I;  2I8D A;  2PN6 A;  3QPH A;  3VEP A;  3FXJ A;  4BNC A;  3E6D A;  5K7H A;  3ZN1 A;  2X1C A;  4L9V A;  1D8J A;  2ZXW H;  2IRF G;  3QP5 A;  4YEJ A;  4G6D A;  1TQI A;  4OU0 A;  3SFI A;  3ZOB A;  1LE8 B;  2VPR A;  4XSZ F;  1TW2 A;  3K4J A;  5GTI C;  1B72 B;  1JKP C;  5E79 C;  2EZK A;  3ABM H;  4NQW A;  1HBX G;  2DPU A;  3IWF A;  3AAF A;  5HDN A;  3S3O A;  5J8C A;  2ZFU A;  3QOE A;  3W6V A;  2Q0O A;  1JT6 A;  4JBA A;  4CHU A;  4IHV A;  5DUI A;  4BQN A;  2XAJ A;  4FET A;  4E7H A;  2H8W A;  1JKR C;  3RTR A;  3BJ6 A;  2CU7 A;  5FB2 A;  3DXJ F;  3LSM A;  3F23 A;  4LIT A;  4PJ0 C;  1WJD A;  2HWV A;  1IN5 A;  3BDD A;  1OCP A;  2EFN A;  3LA3 A;  1FSH A;  1I3A A;  1BR4 A;  2R7Q A;  1FWZ A;  4LOC A;  2NVQ J;  1OCC H;  3HPH A;  2HI3 A;  2K27 A;  4RS8 A;  3SDG A;  1ZRF A;  2PMH A;  1FOW A;  4O3M A;  2RN7 A;  1JHF A;  3J7A Y;  1LE8 A;  2IS1 A;  4S0H B;  1NHA A;  1RUN A;  2AO9 A;  1IJW C;  1IDZ A;  3DP7 A;  5C4X J;  3JRA A;  2CW8 A;  1KU2 A;  3J7Z I;  1MH3 A;  1UZC A;  4RAF A;  4OOI A;  3WOD F;  3J81 K;  2P5L C;  2FRH A;  3KCC A;  5EGO A;  3BR0 A;  2WAF A;  2A6T A;  2XAQ A;  1F1Z A;  4IL6 C;  3UKG A;  1MBK A;  2STT A;  2LTP A;  2ZNY A;  4UNO A;  1LFB A;  4F52 A;  1N75 A;  2R7R A;  2ZME C;  2IGO A;  2UWM A;  2DOD A;  2XIG A;  2FE3 A;  2F4M B;  1IN7 A;  1WKM A;  1OR7 A;  4I01 A;  5TRD A;  4OIO F;  2DK8 A;  2FJ1 A;  3WTT C;  6PAX A;  1JI8 A;  4U87 A;  2VOD A;  1KU7 A;  1DPR A;  2HOA A;  3VSK A;  3S3N A;  1MBH A;  1N77 A;  3SXY A;  4P9F A;  2OCC H;  4P1W A;  4EVI A;  2K7L A;  4LLG F;  1Z77 A;  2JSP A;  4II2 A;  5HOD A;  2FMY A;  1X3Z B;  2MD0 A;  1RIO H;  1IO2 A;  1DGW Y;  2NOJ B;  2L9S A;  3TO6 A;  1Y0U A;  1LDJ A;  3BZ6 A;  1T08 B;  5HLT A;  3GFL A;  1SD6 A;  1R1T A;  2VUM J;  3OYJ A;  4JK1 X;  2Y2Z A;  2ETH A;  2GA1 A;  3CF5 F;  1QQI A;  1MMG A;  4HYE A;  1YW8 A;  5LLQ A;  3IHU A;  5F1J A;  1P4A A;  2QQ8 A;  5L3C A;  1R7J A;  1AKH B;  2L7K A;  2BOL A;  1IZ1 A;  2L01 A;  4AU7 A;  1HW1 A;  4TV7 A;  1VZ0 A;  1O3Q A;  3GUD A;  5DCF A;  5DD8 A;  3J80 K;  4EMS A;  1TWA J;  3KP3 A;  3E97 A;  5FKM A;  1KQ9 A;  4ETS A;  3CJN A;  4UXN A;  3MAJ A;  4UUV A;  4V2G A;  5M5X J;  1FJL A;  1REP C;  4KMF A;  5FFX A;  1ZRC A;  2NS0 A;  2BW3 B;  4CXF A;  3F8M A;  5LRR A;  2VI6 A;  3LQR A;  3G4S I;  3OSG A;  1PP8 F;  1SVO A;  2X4H A;  1TLH B;  2VT2 A;  3BTC A;  4B3X A;  3CCQ I;  1D5V A;  2W48 A;  1W5T A;  3MKZ A;  2FML A;  2ESN A;  1USS A;  4HLX A;  1GXP A;  4BAY A;  4ZYA A;  4L5E A;  1OIS A;  3WTZ A;  3OMY A;  3CCY A;  1ETV A;  1NG6 A;  1MBG A;  2YU3 A;  5ERI A;  1W7P D;  3F9K A;  2CJJ A;  2Z5U A;  1TQM A;  4HSR A;  3RJP A;  5JLX A;  1B59 A;  1PUF A;  1NH3 A;  3PSF A;  4QSH A;  1DU6 A;  5GTH C;  2UXX A;  4M3F A;  4XSX F;  3IKT A;  1LB2 A;  3LSI A;  1HKS A;  4E4H A;  2L2O A;  4XID A;  1MIJ A;  3RQI A;  2B0L A;  1T8I A;  3M4O J;  3K1P A;  3R60 A;  4EJV A;  3BT9 A;  4F91 B;  2CV0 A;  1DP3 A;  2QUF A;  4CYC A;  5IOZ A;  3SDB A;  3CDH A;  2ICW G;  5LHH A;  2YX4 A;  3K1N A;  2M87 A;  5HDK A;  2E1N A;  1P4W A;  5H6R A;  1WJE A;  1P4X A;  1R9T J;  2BY0 A;  3HRT A;  3J7A O;  2PMU A;  4IQ4 A;  4PSX A;  4KIT B;  1WZ2 A;  4RGU A;  2KT0 A;  1R71 A;  4NC7 A;  3LFU A;  5CLS A;  4MO7 A;  2WAD A;  2WA0 A;  3S1N J;  1XS9 A;  2R7Z J;  1T2K A;  3SYT A;  3U9G A;  4K2E A;  4PDK A;  2ESH A;  3BJA A;  1V55 H;  3LFK A;  1BL0 A;  2E2I J;  1WJ5 A;  3JSP A;  4C9Y A;  4FIS A;  3ECH A;  3CDI A;  1MBJ A;  5DM7 F;  4FX4 A;  2GM4 A;  3SEQ A;  2IT0 A;  3TMO A;  1ETQ A;  5ED4 A;  3PFY A;  1QRY A;  4HBL A;  2JVH A;  1JT0 A;  2PG4 A;  1YX5 A;  3IKV A;  1PJR A;  3WU2 C;  1Y8Q B;  4KN7 X;  2E35 A;  4G7O F;  5L3G A;  1RES A;  3CDL A;  2VE8 A;  3EUH A;  3TDZ C;  3S2H J;  3J7Y J;  2LDU A;  4BQQ A;  4XOP A;  3FF5 A;  1TP4 A;  1T0F C;  4CUG A;  2CYY A;  3O8H A;  2DA4 A;  3T0Y A;  2RDP A;  3EQL F;  1PDN C;  1KA8 A;  2EFO A;  3HKZ N;  1C0W A;  1Z6R A;  1KZH A;  1FIA A;  1A5J A;  3G1M A;  3M7G A;  3QU6 A;  4C2M J;  1YHQ I;  4KUM A;  3DV8 A;  2E7W A;  3QU3 A;  1AU7 A;  1BI2 A;  3LSK A;  3C1D A;  5K7Z A;  4WWC A;  2P8T A;  4BKX A;  4D7N A;  3RZO J;  3QYF A;  1MNM C;  2HOT A;  5E3N A;  1MBF A;  3LSP A;  5JFR A;  2RV8 A;  4AYB N;  2BW3 A;  5IYB J;  2FBK A;  5LHI A;  2E2J J;  2F6C A;  4XLE A;  4AUX A;  2FBH A;  1R49 A;  2NVY J;  2O3F A;  3FKJ A;  5E8I A;  5DCM B;  2DO7 A;  4Q4Z F;  4EV0 A;  2R0Q C;  1M1E B;  3L9F A;  3VDX A;  1MNE A;  4HEA 2;  1XGO A; 
#chains in the Genus database with same CATH homology
 1AHD P;  1XC5 A;  2K9Q A;  5EG0 A;  5FLM J;  3IH4 A;  1BJZ A;  2EZH A;  1NTC A;  3FIW A;  3NAR A;  4ABZ A;  2NOG A;  4IHY A;  3I4N J;  2ID6 A;  4BBR J;  1SAN A;  5EGO B;  3DEW A;  5EF6 A;  3GBG A;  1F36 A;  1RR7 A;  1IG7 A;  5IYD J;  3FKI J;  2L9R A;  5F0H A;  3L1P A;  2IAI A;  3TED A;  1IUF A;  2YS9 A;  3PO3 J;  4UUS A;  1B8I A;  1OJL A;  1U78 A;  2QF7 A;  2XB0 X;  1UMQ A;  3A03 A;  1EF4 A;  1ETK A;  1QVU A;  3BR5 A;  1X58 A;  1QPI A;  2ECB A;  2K9S A;  4A3B J;  1IC8 A;  3HOW J;  4NDL A;  1GUU A;  4JP0 A;  3A01 B;  2WV1 A;  4MIM A;  5JLW A;  3JRF A;  5F08 A;  1HF0 A;  1G2H A;  1DU0 A;  3RZD J;  3MVP A;  1X2M A;  3GTK J;  2L7Z A;  3FIS A;  2X9D A;  3JRE A;  3HOV J;  2DTZ A;  1JJ8 C;  2WB1 N;  3B6C A;  1BA5 A;  1ITY A;  2EZL A;  4M6V A;  1MBE A;  2YUS A;  4BY1 J;  1QVT A;  3MKL A;  3HGG A;  5FKK A;  2LKX A;  3M3Y J;  1WCM J;  2LY9 A;  2DA5 A;  2MW8 A;  1H8A C;  1HDP A;  2K40 A;  2O7O A;  4UUT A;  2JWT A;  4QTR A;  3GTJ J;  4C3J J;  5EDN A;  1WGX A;  3ZQL A;  1WH7 A;  1W0U A;  2FX0 A;  1VF9 A;  2R93 J;  1WPK A;  4HNV A;  1RKW A;  4I6Z A;  1P7I A;  3LOC A;  2KDZ A;  2LLK A;  1H88 C;  3E7L A;  3HOY J;  5GPA A;  3C2B A;  2H1K A;  1UHS A;  2GLO A;  2ID3 A;  1IV6 A;  5EYR A;  1T33 A;  4D5F A;  5GP9 A;  3LSR A;  1TC3 C;  1UG2 A;  2R92 J;  3BR3 A;  2L7F P;  1IDY A;  1H89 C;  1ETO A;  3GTO J;  4MFE A;  3ZQF A;  1A6I A;  1XG1 A;  2VKE A;  2Y31 A;  2ZB9 A;  1GV5 A;  2G0E A;  1OCT C;  4DZP A;  3HM5 A;  2VKV A;  3ZQC A;  1TWG J;  3Q0U A;  2AHQ A;  3BG3 A;  2HYJ A;  4B1R A;  1TWH J;  3JR9 A;  3WHC A;  3LSJ A;  2JA7 J;  2M9H A;  5EZH A;  4A93 J;  3GTP J;  3RKQ A;  2E1O A;  2L0K A;  4A3I J;  3B6A A;  3I4M J;  2LP0 A;  5FKO A;  4XRS G;  5K7F A;  4DZJ A;  2M0C A;  1JUM A;  1ZK8 A;  2P81 A;  2CQQ A;  3IH2 A;  5IP6 A;  2NS7 A;  4DYR A;  3S15 J;  3HOU J;  1ZQ3 P;  2JA8 J;  1I3Q J;  3ZQG A;  4EEF G;  1ENH A;  2M34 A;  1RKT A;  2DJN A;  5FKL A;  3S16 J;  4FTH A;  4Y52 J;  1HOM A;  2DA2 A;  2E2H J;  1AKH A;  3S1Q J;  3TW7 A;  2K9N A;  2XGE A;  1P7J A;  2FD5 A;  3BG9 A;  2CQX A;  2NVX J;  3HOZ J;  1GDT A;  5J1R A;  4UUS B;  4M3B A;  1B8I B;  4W97 A;  4MLO A;  2LR8 A;  3HBL A;  3JRI A;  2XPW A;  2R5Z B;  2ME0 A;  4M3D A;  3PM1 A;  2MSY A;  1Y1W J;  4A69 C;  2Y30 A;  1JKO C;  2DMU A;  4A3F J;  1GVD A;  3HGY A;  3WHB A;  4DW6 A;  4IHX A;  5K7H A;  1CQT A;  1WH5 A;  1VFC A;  2DN0 A;  2HXI A;  1WI3 A;  3SFI A;  3ZOB A;  3S14 J;  4BBS J;  1LE8 B;  2VPR A;  3OOU A;  3JRH A;  2MG4 A;  4BY7 J;  1B72 B;  4JYK A;  1JKP C;  2EZK A;  1FTT A;  3GTM J;  2YU9 J;  4AC0 A;  3IV5 A;  3W6V A;  1JT6 A;  1YRN B;  4IHV A;  2TCT A;  1APL C;  4CYC B;  2CUE A;  3BR2 A;  1JKR C;  1ZTR A;  3Q0V A;  2CU7 A;  1ZGW A;  2LD5 A;  3BQZ A;  2H8R A;  1W0T A;  5IP7 J;  3H3V K;  2CRG A;  2DMP A;  1OCP A;  4G12 A;  4D7M A;  2O8K A;  1FIP A;  2M8G X;  3TP0 A;  4LOC A;  2NVQ J;  2HI3 A;  3SDG A;  1GT0 C;  1Y1V J;  1VI0 A;  5DTD A;  5BNG A;  3JRB A;  2DA3 A;  1LE8 A;  4S0H B;  4JX4 A;  2JA6 J;  2R5Z A;  2RAE A;  5EG0 B;  2AO9 A;  1IJW C;  1IDZ A;  1O4X A;  5C4X J;  3JRA A;  1TWF J;  2HQ5 A;  4XRS A;  1MH3 A;  4C3H J;  2GBY A;  4A3K J;  1YRN A;  2DA1 A;  5F0C A;  5EGO A;  3BR0 A;  1JTY A;  2EH3 A;  4M3E A;  5FJ8 J;  2TRT A;  1I6H J;  3UKG A;  1MBK A;  2M2E A;  2LTP A;  3CQZ J;  2L7M P;  1LFB A;  2IEK A;  1NK2 P;  1X2N A;  2B63 J;  5E3L A;  3ZQH A;  2LK2 A;  3H0G J;  5J1Y A;  2N8G A;  1ORK A;  2FJ1 A;  2HOS A;  4X6A J;  3K7A J;  3MN2 A;  5FKN A;  3A01 A;  2HOA A;  1MBH A;  2NS8 A;  3OIO A;  3G1O A;  1OFC X;  2JN6 A;  5C3E J;  1Z77 A;  3VPR A;  5HOD A;  5C44 J;  1U9O A;  5C4J J;  1HCR A;  3Q0W A;  2JK3 A;  4GFB A;  4A3L J;  2ECC A;  4IEJ A;  2R5Y B;  5E3O A;  5IPA A;  4A3E J;  2QCO A;  2JMW A;  2VUM J;  4X1E A;  2Y2Z A;  1GV2 A;  2DA7 A;  3A02 A;  3F0C A;  3JRD A;  5F1J A;  4A3D J;  2DMT A;  1AKH B;  1HLV A;  1BW5 A;  3BG5 A;  3NAU A;  4MFD A;  2OF7 A;  2MGQ A;  5F0F A;  5J3L A;  1ETX A;  2Y0S N;  4FE4 A;  1E3O C;  2X48 A;  1TWA J;  4C3I J;  5FKM A;  5EZG A;  1Q1V A;  1D5Y A;  3BR1 A;  4V2G A;  4B3A A;  5M5X J;  1FJL A;  5FLV A;  3LNQ A;  3OSG A;  2VI6 A;  3JRG A;  3SJM A;  3BQY A;  1RPW A;  3K2A A;  2DA6 A;  3BTC A;  3IH3 A;  2IBD A;  3O8G A;  5IOY A;  1JGG A;  4W1U A;  1IRZ A;  2CUF A;  2COB A;  2W48 A;  1IGN A;  1K83 J;  4J19 A;  4L5E A;  1U8B A;  3HOX J;  2D5V A;  1ETW A;  1MSE C;  3CCY A;  1ETV A;  4JX5 A;  3D1N I;  1MBG A;  5IYC J;  3JRC A;  2NVT J;  5M5Y J;  2Y9Y A;  5M3F J;  2CJJ A;  1VND A;  1RET A;  5JLX A;  1PUF A;  5GPC A;  2XRL A;  4QSH A;  1DU6 A;  4XK4 A;  4D5C A;  1FEX A;  4M3F A;  4IHW A;  3LSG A;  2WAQ N;  5DS9 A;  4XID A;  3GTG J;  3RQI A;  5F27 A;  1POG A;  3OSF A;  3M4O J;  3TP3 A;  2HXO A;  4QIW N;  3BT9 A;  2XPV A;  4CYC A;  5IOZ A;  1U9N A;  3BTI A;  2ME6 A;  2E19 A;  1Z0X A;  3S1R J;  2LVS A;  3S2D J;  1BW6 A;  5F04 A;  4DYQ A;  2XB5 A;  2XGD A;  2LFB A;  3DCF A;  1JJ6 C;  2FQ4 A;  3HDD A;  1R9T J;  2JJ7 A;  3HB9 A;  3TW6 A;  2KT0 A;  3ZQI A;  3Q3S A;  5M3M J;  1JKQ C;  4MO7 A;  3GTL J;  5J1U A;  5E3M A;  3S1N J;  4XRM A;  1XS9 A;  4FCY A;  2R7Z J;  3QQA A;  3GTQ J;  3FK6 A;  2EZI A;  2XSD C;  1I50 J;  9ANT A;  3BTL A;  1BL0 A;  2E2I J;  4BXX J;  2Y9Z A;  4FIS A;  3BTJ A;  2XPU A;  2OPT A;  1MBJ A;  2DMN A;  4V2F A;  4RDU A;  2EBI A;  2GM4 A;  5M5W J;  5EEA A;  1ETQ A;  1PUF B;  1QRY A;  3S17 J;  5IP9 J;  1JT0 A;  3QPL A;  1JUP A;  1B72 A;  3HEF A;  1RES A;  3CDL A;  1ZR4 A;  3S2H J;  1SFO J;  4B4C A;  2PMZ N;  2DMQ A;  4DYC A;  2R5Y A;  2JA5 J;  3S1M J;  1ZKG A;  4A3C J;  4XIC A;  1NK3 P;  2I10 A;  1ETY A;  1MSF C;  4A3G J;  1LFU P;  1JUS A;  1MH4 A;  3O8H A;  2DA4 A;  3HKZ N;  1FIA A;  2HDD A;  1A5J A;  3G1M A;  4C2M J;  1ZR2 A;  1F43 A;  1JTX A;  3CMY A;  1AU7 A;  4A3J J;  5K7Z A;  3QPS A;  4A3M J;  3PO2 J;  4BKX A;  3FK7 A;  4D7N A;  3RZO J;  2X6O A;  1MNM C;  2HOT A;  5E3N A;  4I76 A;  1TWC J;  4FE7 A;  1MBF A;  3LSP A;  2EQR A;  2ELK A;  5IYB J;  4AYB N;  2E2J J;  1FTZ A;  4AUX A;  1K61 A;  1HDD C;  2NVY J;  3BR6 A;  1S7E A;  4Y7N J;  1T56 A;  2XGC A;  3G1L A;  2R0Q C;  4M3G A;  2O9L A;  4JX6 A;  4RBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...