1HDPA

Solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
b'RRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCT-2 POU HOMEODOMAIN
publication title Solution structure of a POU-specific homeodomain: 3D-NMR studies of human B-cell transcription factor Oct-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hdpA00
3OIOA 4RBOA 2M8GX 4M6VA 1VI0A 3LSPA 4A3KJ 3S1QJ 4LOCA 1K83J 3BR2A 3PM1A 1WH7A 2XB5A 4UUSB 2HOTA 2LD5A 3O8HA 4UUSA 3HB9A 2CUEA 4DZPA 1ZTRA 2VUMJ 1BL0A 1RKWA 2E19A 2COBA 2X6OA 2CUFA 5E3OA 2H8RA 3S17J 2GM4A 2IEKA 3HDDA 3JRIA 3MVPA 2OPTA 2DMTA 2ECCA 1ORKA 9ANTA 3G1LA 2H1KA 4BY1J 1MH4A 2JMWA 5IP7J 2KDZA 1ZR4A 2I10A 3S15J 5F27A 2HOSA 5C44J 5F1JA 1WH5A 2L7ZA 4A3IJ 1IDZA 3E7LA 4M3EA 4DYRA 2DA3A 2MG4A 4W97A 3SFIA 3K2AA 2JN6A 4ABZA 3BR1A 2AHQA 3G1OA 3H3VK 3SJMA 3K7AJ 2QF7A 5IP6A 4FTHA 3FISA 4MIMA 1IC8A 2ID6A 1HDDC 1NK3P 3I4NJ 2JA7J 4XICA 2B63J 2K9NA 4DYQA 1PUFA 2VI6A 5F0HA 3D1NI 2XPUA 3HOXJ 1JKRC 1IDYA 2R93J 2Y0SN 5HODA 2W48A 1XG1A 3BG9A 3FIWA 1S7EA 2CQXA 2CU7A 1F43A 3IH4A 1B72B 5GP9A 1VNDA 3GTLJ 4A93J 4XIDA 3IV5A 3CMYA 1AKHB 3BTLA 2Y30A 2ID3A 4IHXA 1OCPA 1BW6A 2MSYA 1D5YA 1H8AC 3LOCA 4I6ZA 3HOUJ 3FK6A 5EYRA 4V2GA 1XS9A 1MSFC 2Y2ZA 3CDLA 1R9TJ 2ZB9A 2DMNA 5J1UA 2ECBA 3UKGA 4A3BJ 2K40A 3RQIA 3I4MJ 2WAQN 5EZHA 4J19A 3OSFA 3M4OJ 4XK4A 2EZKA 3JRGA 4AYBN 4M3GA 1DU0A 3JR9A 2FJ1A 3S1MJ 4FE7A 4D5CA 2Y31A 4AC0A 1TC3C 2JWTA 4D7NA 5FKLA 2ME6A 3LSGA 2R5ZB 1A6IA 3ZQIA 4FCYA 3JRBA 1Q1VA 1UG2A 5K7HA 1IRZA 2FD5A 3ZQGA 1JTYA 1RKTA 3DCFA 1BA5A 2AO9A 1IG7A 3MN2A 2JA6J 1ETOA 1P7JA 2IBDA 3H0GJ 1U9OA 1HLVA 3QQAA 1JTXA 4GFBA 1JJ8C 2DA4A 1QRYA 4FISA 3QPLA 2L7MP 2HDDA 4A3GJ 1GV5A 5EDNA 4MFDA 4BBRJ 2DA5A 4S0HB 2DA1A 4C3IJ 3Q0WA 3B6CA 3GTOJ 2DA2A 1MBKA 3BR6A 2Y9YA 3ZQCA 4EEFG 4A3CJ 4QIWN 4G12A 1U78A 1JKOC 1O4XA 2DJNA 3JRHA 2HOAA 4V2FA 2EBIA 5FJ8J 1IGNA 1XC5A 1Z77A 2LFBA 2EH3A 1BJZA 3C2BA 2E2IJ 5F08A 4IHVA 5E3MA 2K9SA 3BR3A 2LY9A 5JLXA 2NOGA 4QSHA 3HOYJ 1VF9A 1U8BA 4BBSJ 3GTGJ 1OJLA 3S16J 2DA6A 2XGDA 4I76A 1FIPA 4M3BA 1IV6A 4A3FJ 2GLOA 1FTZA 1H89C 5FKNA 3S1RJ 4M3DA 3IH3A 4JX4A 1IJWC 5EF6A 2RAEA 2JK3A 1GDTA 3GTMJ 4JYKA 2R92J 3SDGA 1JT0A 1GUUA 2X48A 3M3YJ 3OOUA 3TW7A 3PO3J 3RZDJ 3BR0A 1TWFJ 2FQ4A 1WCMJ 2M2EA 1JUSA 1MBGA 1PUFB 1UHSA 5GPAA 1QVTA 2NS7A 3RKQA 5M5XJ 3WHCA 3NAUA 2GBYA 3GTKJ 3S2HJ 5J1RA 2MW8A 3GBGA 2DTZA 1FEXA 5C4JJ 2XGCA 2KT0A 1ITYA 1FTTA 3G1MA 2NVYJ 3PO2J 3BTIA 1Y1VJ 2P81A 2YS9A 1UMQA 3IH2A 2NS8A 4JX6A 4A3DJ 3BTJA 4MO7A 1RETA 1AHDP 3OSGA 1WI3A 4RDUA 4NDLA 3A02A 4Y52J 1JT6A 4Y7NJ 4A3EJ 3HOZJ 1ETYA 2VKEA 2R5YA 3RZOJ 1HOMA 1B8IA 1HCRA 1EF4A 4QTRA 1LFUP 1JKPC 4MLOA 4C2MJ 3LSJA 1SFOJ 2XPWA 1GT0C 1SANA 1A5JA 4CYCB 5C3EJ 4A69C 2EZHA 4CYCA 2WB1N 3BTCA 1CQTA 5FLMJ 2M9HA 5DS9A 3S14J 1NTCA 2EZLA 3NARA 4XRSG 5M3FJ 1JUMA 1ENHA 2EQRA 2JJ7A 2HXOA 4B1RA 2LVSA 2N8GA 1ETXA 4MFEA 5M5YJ 1YRNA 3HKZN 2HQ5A 2HYJA 3VPRA 3HEFA 3FK7A 1MH3A 5F04A 4C3JJ 3HGYA 2HI3A 5BNGA 1E3OC 3LNQA 5K7ZA 3L1PA 3FKIJ 3DEWA 1ZKGA 4HNVA 2XRLA 5EGOB 2LKXA 3CQZJ 3A01A 5EZGA 1APLC 3TW6A 1MSEC 3BQZA 2VPRA 1LE8A 2XGEA 1JUPA 1JKQC 1ETQA 1MBFA 5EGOA 4B3AA 4XRMA 2DMQA 5IYDJ 2L9RA 1MBHA 5IPAA 1NK2P 5F0FA 5C4XJ 1ZK8A 1WPKA 4W1UA 2R7ZJ 1MBEA 4L5EA 1VFCA 2ME0A 2TCTA 1POGA 5E3LA 1HDPA 3A03A 3W6VA 2NVTJ 1X2MA 2TRTA 5FKOA 1I50J 2DMPA 2L0KA 2YUSA 4B4CA 1FJLA 3HM5A 3JREA 3LSRA 3S1NJ 1W0TA 1OFCX 2O8KA 4BKXA 4DZJA 2LR8A 2OF7A 1WGXA 4DW6A 4BY7J 1QVUA 5J1YA 5EG0B 3ZQLA 1TWAJ 2E2JJ 1I6HJ 5EG0A 2R0QC 1MBJA 3Q0VA 5F0CA 1X2NA 3ZQHA 2QCOA 1Y1WJ 2O9LA 2LK2A 2DA7A 1IUFA 4AUXA 1RPWA 2HXIA 1G2HA 5DTDA 2XPVA 3B6AA 3S2DJ 2LLKA 2CRGA 3F0CA 1OCTC 1BW5A 1JJ6C 1MNMC 5EEAA 4A3JJ 4A3MJ 1Z0XA 1ZQ3P 2CQQA 2EZIA 2DN0A 2YU9J 5GPCA 1ETVA 3WHBA 1GV2A 1FIAA 2K9QA 3BT9A 1ZGWA 4IHWA 5IP9J 1T33A 1TWHJ 3JRFA 1TWCJ 5IYBJ 4C3HJ 2DMUA 1T56A 5E3NA 1RESA 3BG3A 2XSDC 2NVQJ 5IYCJ 2O7OA 1RR7A 2CJJA 1HF0A 2NVXJ 2JA8J 3GTPJ 3HGGA 1LFBA 2R5YB 4D5FA 1B72A 3BR5A 1B8IB 1AKHA 3BQYA 2WV1A 3JRAA 5M5WJ 2LTPA 5IOZA 4D7MA 5FKMA 1X58A 2VKVA 3O8GA 4X1EA 1W0UA 1ZR2A 5FLVA 2MGQA 1DU6A 4X6AJ 3Q3SA 3BG5A 2G0EA 1F36A 2JA5J 1JGGA 5J3LA 1YRNB 2E2HJ 3MKLA 3Q0UA 5JLWA 1QPIA 4BXXJ 1GVDA 2M0CA 4IHYA 2M34A 3TEDA 4A3LJ 3HBLA 1U9NA 1K61A 5IOYA 4M3FA 1AU7A 1I3QJ 3ZQFA 2Y9ZA 4JX5A 3ZOBA 2R5ZA 1ETWA 2E1OA 3GTQJ 4JP0A 3TP3A 3A01B 4IEJA 1P7IA 4XRSA 3CCYA 2XB0X 3QPSA 3HOWJ 1ETKA 4FE4A 2X9DA 1LE8B 5M3MJ 2PMZN 4DYCA 3TP0A 4UUTA 5K7FA 1H88C 2LP0A 3JRDA 5FKKA 3GTJJ 2L7FP 2D5VA 3JRCA 3HOVJ 2FX0A 1TWGJ 2IAIA 2ELKA
chains in the Genus database with same CATH superfamily
1Z05A 2L5QA 3LWFA 4RBOA 1GLNA 3VOEA 3IKTA 3DEEA 3TDZC 3CZ6A 4PJJA 1RNLA 2ZMEB 3LSPA 2VIXA 3CF5F 1VQMI 5FRMA 3S1QJ 4Z2YA 5D4RA 1IV8A 3KP5A 4LIVA 4IRGA 2VL8A 1MIJA 1WH7A 3E0JB 4EJTA 1EA3A 1E3HA 2J5PA 2VJ4A 1ZTRA 1MNDA 3ZPLA 1XGSA 3ECOA 1FBSA 2E19A 4ETSA 3DTKA 2X6OA 2IGOA 3ZMSA 5E3OA 2H8RA 2PG4A 1J0RA 2A69F 2IEKA 2XKPA 4RLQA 2GM4A 4AD9A 4AIDA 1ORKA 2IPQX 1MH4A 1WJ5A 2A5YB 2JMWA 5IP7J 2CFOA 4AWXB 1OMIA 3GLXA 1S3JA 2C6YA 2LKPA 4A3IJ 5F1JA 2CV2A 1IDZA 2GXAA 3BLYA 2R7WA 2MG4A 4XBFA 1TQMA 3SXYA 1FYMA 3JCUC 3DKWA 3FM5A 3K2AA 2QWWA 1O3TA 5BPIA 2V26A 3H3VK 2MABA 5KNLA 3PL8A 4WWCA 2B7EA 1VQ6I 2QF7A 1QHHD 1TQIA 3L00A 4OIOF 4HZFA 2DTRA 4EQQA 3CD6I 2E1MB 3BZKA 4ESBA 4NQWA 4L18B 1STZA 2YR2A 4WF2A 3I4NJ 4EATA 2KIUA 3KX2A 3MZ8A 4DYQA 1PUFA 4Y15A 5F0HA 1X1PA 2ADUA 1JKRC 2Y0SN 2JSCA 3I5UA 1NH3A 1GXPA 1Z1DA 1XG1A 4XRFA 3P5JA 4S04A 1MMGA 2BYVE 5H6RA 2W24A 4LK1F 4XR6A 4DJAA 4M9SA 5DD8A 4TV7A 5J47A 3IV5A 3CMYA 3RPUA 3BTLA 2ID3A 3DLAA 3N97A 4IHXA 4PZJA 1BW6A 2IVMA 3DBRB 4JK1X 4IZZA 3K4JA 2HDWA 3HKZA 1XS9A 4EVIA 2DOFA 3NQOA 5J1UA 3CO6C 4BUPA 4CCJA 2DQLA 4HAMA 3OSFA 1YJWI 3QYBA 1K6YA 1U5TB 2CWEA 4AYBN 3JRGA 2P8TA 2DBBA 2M87A 3JR9A 4RS8A 1YJNI 1SVMA 2VQHA 1K79A 3IL2A 3CP2A 3EDPA 4MTDA 4KISA 2ETHA 3EUHC 3K9TA 4RGRA 4BNCA 1J2XA 4D7NA 2X85A 1BI1A 4PJLA 5FKLA 3ZQQA 1R7JA 3LSGA 2R5ZB 4MEXF 1A6IA 3BZ6A 3JRBA 2LH9A 1J75A 2JTVA 2GA2A 3K2ZA 1BA5A 4JQFA 3RJPA 1ZG5A 1QQIA 1D0ZA 2JA6J 5K5RA 3HPHA 4A0ZA 3TO9A 2IBDA 2K5CA 2W57A 3H0GJ 3PSFA 4KITB 1HLVA 1RUOA 4GFBA 1JTXA 3S93A 1QRYA 4Y13A 3QPLA 2HDDA 4A3GJ 5EDNA 3P9IA 2DA5A 4ESFA 4JOMA 2UXNA 4S0HB 3JW4A 2ZXHA 2DW4A 2L3DA 3B6CA 1MNEA 4BDYA 1G8XA 1R23A 1IO2A 4DQ2A 1X4PA 2Y9YA 4EEFG 3JTGA 2V1XA 4CCMA 4G12A 4QIWN 3I3LA 4HOBA 3HRMA 5DCMA 2BV6A 1O4XA 1IF1A 4FX4A 4XLNF 1ZRFA 4V2FA 4ZJZA 2H6BA 2NS0A 2F5VA 1IN6A 1IGNA 2ZSHB 4IVNA 4HRIA 3TOBA 3CC7I 2LFBA 3DBLB 4XM3A 3VYUB 3MQ0A 1G3YA 5HS7A 4E7HA 1VQKI 1IW7F 1R22A 3E6DA 5F08A 4IHVA 1BIAA 2LY9A 3KCCA 5JLXA 2NOGA 1Z91A 3NRVA 2W4SA 4E7SA 2UZKA 1HQCA 2KIMA 2XC7A 4KMUX 4ZYAA 2NNYA 3GTGJ 4GCVA 2DA6A 2Z1DA 2XGDA 1FIPA 3H5AA 2LBFA 4I09A 1XCBA 3ONQA 4M3BA 3S2WA 4A3FJ 4UVAA 1H89C 2GLOA 4M3DA 1IJWC 2E1CA 1H9TA 3MKZA 4HX8A 1K78B 2R92J 1ZGAA 3R61A 2MA3A 2PQ8A 2YSRA 3ZGKA 4E7LA 4MGRA 3FBIB 4G7OF 2XF7A 2VKDA 2FU4A 4WXDA 3SHFA 2CW8A 3PUBA 5LLQA 3KZYA 2BHYA 1K6OA 5EEGA 4M71A 1X1BA 4YFKF 5D6EA 3NAUA 4KIBA 2BY2A 3GTKJ 2F4MB 3KP7A 2A68F 3SZTA 5LGTA 2RDPA 1X19A 3TMOA 4XLFA 2KT0A 1FTTA 1WVRA 3W6KB 2NVYJ 3D5RC 1MZBA 4RAFA 1BI3A 1USSA 4G94A 1P4AA 1UMQA 2WY7Q 4JX6A 1B9MA 2VN2A 3C18A 4MO7A 1AHDP 1OYIA 1WI3A 4EM2A 5AONA 3A02A 2KRHA 1JT6A 4Y52J 2OTJI 3CCMI 4HF2A 4A3EJ 1K4SA 1ETYA 2VKEA 4O5VA 1B9NA 2QBYA 2CGPA 3PNYA 3HUGB 3CUQC 3HUGA 2DJIA 4ZDLA 4C2MJ 1QNTA 5CKTA 3LSTA 5ICGA 2VB6A 1GT0C 2Y69H 4A69C 3CJNA 1KZHA 2EZHA 3CP8A 3QP5A 4HDVA 2O5RA 1XSXA 1OKRA 2WB1N 4EM0B 1CQTA 3OYNA 1DP3A 2M9HA 1NTCA 4LG0A 2P5LC 3CJRB 5M3FJ 3ULQB 1JHHA 1ENHA 3HRUA 2HXOA 2K7LA 3OYIA 2LVSA 1ETXA 5M5YJ 1SEUA 2HQ5A 1EV7A 3CJTB 3LQQA 2ELJA 2L4AA 2OD5A 4L9NA 4XSZF 4C3JJ 1U0JA 4BYYA 4OMZA 3WTWC 4IHSA 1R5ID 2IGNA 1X4OA 3TGNA 4V19K 1BOAA 3M7GA 3K4NA 2EB7A 5J8CA 1IRFA 3FHZA 2E7WA 2H8WA 1MBFA 3W6JB 3CCRI 4E7IA 4XRMA 2JVGA 1TW2A 2E71A 2Z99A 5H20A 2LKSA 1MBHA 4RGUA 4UHTA 2VASA 1NK2P 2OV7A 2ZFUA 1YE9A 2HPMA 1WWXA 2X0LA 3K0LA 2LF7A 3QPTA 4D1QA 1WPKA 4S05A 1BM9A 3K4MA 5CVVA 3MWMA 3RQ4A 1VFCA 2ME0A 3AL0C 2NVTJ 1POGA 4AVZA 1IN5A 1HDPA 2VOPA 4BE1A 2FNAA 3V8KA 1I6XA 3ZQ7A 2EIMH 2X6WA 2Y48A 4R1HA 3KYDB 2VXDA 3M1EA 4F3QA 4BU2A 3CCVI 3P9KA 3NEUA 1MDMA 4YIIA 1FWZA 1TQPA 1BOBA 1WGXA 3WTYC 4PGGA 1I6HJ 2L9SA 4BGDA 1TNSA 4NHJA 1FYKA 2OCEA 1KU7A 3I59B 4PK4A 1X2NA 3ZQHA 4NC7A 1Y1WJ 3LA2A 1ZG3A 2K86A 3LSMA 1TLHB 4AUXA 3CCLI 3FDYA 5FRNA 5DEQA 3BPVA 1I5ZA 1G2HA 5DTDA 2NVUB 4DGWB 3B6AA 1A31A 3S2DJ 1BW5A 2CRGA 3J7AO 1MNMC 5LGUA 3PIPF 4A3JJ 1Z0XA 4A3MJ 1MD0A 1ZQ3P 3JSPA 2CQQA 2EZIA 5GPCA 3WHBA 4B44A 2HTSA 4G6DA 4AYBA 5IT9Z 2IS6A 5TGTA 5IP9J 1T33A 1TWHJ 5IYBJ 1YG2A 1RESA 2XAJA 3BJOA 1IRXA 2J5OA 4CZCA 2F4IA 4F93B 3I56I 1W5SA 1RR7A 2CJJA 2K02A 2X1DA 1D1AA 5KVRA 2VE9A 2RQPA 3ABMH 3GTPJ 2R5YB 2E5NA 1P92A 4N9HA 2KRCA 2P6TA 3G6EI 3BQYA 4XSXF 2QSGX 2XVCA 3CC4I 1FP2A 3HRTA 4KICA 5M5WJ 3Q5FA 2LTPA 2XDVA 1R6RA 2QUFA 5LHHA 4E4HA 2IGMA 1FY7A 2IT0A 1XDUA 3WTZA 2IW5A 3MMYB 2H27A 5DV5A 1BBYA 2VKVA 5FLVA 3GZ5A 3OYAA 3BJ6A 3BG5A 2EFPA 1NG7A 1ON2A 3OYHA 1Z6TA 4HF1A 1YIOA 4EM1A 2E2HJ 1WJDA 3ABKH 3Q0UA 4II2A 3ZMZA 2XHKA 3GFJA 2M34A 4IHYA 3ZRGA 3V7RA 1U9NA 4LB6B 1U3EM 3RDIA 3CMEI 1AU7A 1I3QJ 3B02A 4LITA 4JX5A 4OINF 3ZQFA 4G9YA 5J4VA 1ACIA 1HSJA 2Q0OA 2M5WA 1DGWY 3GTQJ 3I54A 1YYVA 5D5XB 3LA7A 3U9GA 2KDOA 3TP3A 3PFYA 3A01B 1A36A 2HZDA 1P7IA 4XOTA 4FE4A 2X9DA 3F8NA 2JRMA 3CUQB 3PQJA 5M3MJ 2PMZN 2Y75A 4NBQA 4HF0A 1QZZA 3GMEA 1D8JA 3WTUC 4RB2C 3WTVC 5L3GA 2HEOA 2D5VA 4DIQA 3JRCA 4UNOA 3HOVJ 4LLGF 3LSHA 1YJ9I 2FX0A 5LEKA 4OWRB 5EGOB 3ZMTA 5EGOA 1XB4A 3SZPA 1XN7A 4YIRX 2V9VA 4M6VA 1VQ9I 4QWQA 1S7OA 5B66C 1Y56A 4GXOA 1FSHA 2GIVA 4LOCA 3PM1A 2NAZA 4CXFA 4UUSB 2HOTA 5ILSA 2LD5A 4UUSA 1YFHA 1T95A 2CUEA 1QZYA 2LDUA 1UCRA 2A6EF 1BL0A 5H2FC 1I1GA 1RKWA 3E3VA 2CUFA 1LVAA 2OZ6A 3S17J 3FZVA 4BHCA 2EIJH 4ZYDA 3MVPA 1G3TA 3WE2A 2OPTA 1F1ZA 2DMTA 4FASD 1TL8A 4HX4A 2H1KA 4BY1J 2FBKA 2VBXA 2KDZA 2JA2A 1U6GA 5TRDA 1Q1HA 4UXNA 2HOSA 2WY8Q 2RREA 1FZPB 3E7LA 1D3YA 4DYRA 1YW7A 2DA3A 3O2PE 3OYJA 1P4XA 3WTTC 3AG1H 3SFIA 3VSKA 5ED4A 2JN6A 3ABLH 3IRRA 3CCJI 5HLIA 4A12A 1ZRDA 3BR1A 3AL0B 3G1OA 3QU6A 2RQQA 1YOVB 2R7RA 2ZNYA 3SJMA 4RM2A 2Z9OA 3L7WA 3D5SC 5IP6A 1ZHFA 4FTHA 2E60A 3HIFA 2H09A 5DM7F 1IC8A 2ID6A 1J7KA 1OCOH 5J8FA 2CFXA 1G6NA 2JA7J 1ON1A 5HDGA 2H1LA 3H3ZA 3D1NI 1E17A 1R1VA 2R93J 1EH6A 4IRHA 2GOMA 3BG9A 4HSTA 2CQXA 3V7CA 3BY6A 3S3OA 3IH4A 1B72B 5GP9A 4AM3A 5DCFA 1VNDA 3GTLJ 5E18F 4XIDA 5CJ9A 5BQTA 2CH0A 2L02A 4XN3A 1ZAOA 5CVRA 1OCPA 2BEOA 1N78A 1FMVA 1HKSA 4LMYA 3LOCA 4XKBA 2LY1A 4PUSA 3E6MA 4E70A 3TO7A 3K1MA 4V2GA 1S7AA 4J00A 4ENNA 4BQAA 2DT5A 4QPOA 2A05A 3OYMA 4XNFA 4KMFA 3G71I 2DMNA 2F48A 4I7HA 3UKGA 4L5JA 2WAQN 4J19A 3UR3C 1IXCA 1T6SA 2P7VB 4XK4A 1IAWA 3BPXA 1DU0A 2ELHA 1D0XA 4ENMA 4FE7A 1V3FA 4RAZA 2GIZA 2ACJA 1DP7P 3HRSA 4FX0A 2JWTA 1T2KA 2KIFA 3LL7A 1Y8RB 2FNPA 3M8EA 5GAHJ 1KQ8A 2PEXA 5ILUA 1ZARA 2VC0A 2VT2A 4ASNA 4FCYA 1LKXA 1UJ8A 2IRFG 5FLXK 4CHUA 2KQRA 3ZQGA 3MZYA 3DCFA 5E1XA 3FXKA 3MN2A 2VJJA 4HNTA 3V4GA 4XKCA 3QU3A 3P9CA 3KYLA 4HQEA 2VC1A 1KYWA 1FC3A 3BJAA 3ERED 2DA4A 3FXQA 2VQGA 1E0EA 4BBRJ 1I39A 2TDXA 3EETA 3H0DA 3RYPA 5JHFA 3AG2H 3WU0A 3GTOJ 2BE5F 2R7FA 1H9GA 3J7YJ 2FOKA 3DFGA 3M9AA 5BOXA 4XN0A 1ZELA 4A5MA 1HSTA 1JKOC 2R7QA 3DLLF 3WGHA 5K1YA 4XORA 3T8TA 5HNHA 4IQ4A 2LSOA 1XTAA 2LNBA 2IS2A 3T5XA 1XC5A 2GWRA 1P9QC 3FMSA 3GFMA 1L3LA 5JR3A 1YQAA 3CLQA 3DU6A 2E2IJ 1XGMA 2XSJC 1AWCA 2CSOA 3ZN0A 3GXOA 4P96A 2LREA 1VF9A 1U8BA 2VODA 3PIOF 2EPFA 3F9KA 4XOPA 2FQ3A 1JHFA 4CGZA 5LRSA 1VQ8I 2BY1A 2MD0A 1YS6A 1OYWA 2E35A 2VBWA 2ISZA 4LB5A 1V5GA 3ESWB 4CZZA 4U0YA 5GTHC 4JYKA 2BGCA 2WAEA 1OLTA 3QODA 3GO5A 1WJAA 3SDGA 3LAJA 2XASA 2H6CA 2RNJA 4G7HF 2XUBA 2RGVA 1WSUA 3TW7A 2LG4A 4F92B 1QBJA 3RZDJ 4NQWB 1WCMJ 4Y17A 4YFNF 1T98A 1MBGA 1PUFB 1UHSA 5GPAA 1VQ7I 3OL4A 4L0ZB 3LSKA 4E7KA 3E1SA 3F22A 2GBYA 3S2HJ 5J1RA 3ZMUA 2P7CB 3H36A 1MMNA 1FEXA 1YIJI 2D1VA 3DPUA 3RKXA 4CCNA 2ZC2A 3G1MA 4CA0A 1UHWA 4CYDA 4P9UA 5FB2A 1LEBA 3E5XA 4BJ5C 3BTIA 3HC7A 1X1AA 2B0LA 5AIQA 5LHGA 2IXSA 1RETA 1MJ9A 4ITVA 4AVPA 4RDUA 4ZTFA 3GUDA 2YU3A 1ZG1A 1HOMA 2A61A 3RZOJ 4P5OA 1HCRA 1C0WA 4QTRA 4MLOA 2PMZA 3LSIA 2G9WA 1CF7A 3LSJA 1SFOJ 3WU1B 1SANA 2DQRA 5HLHA 3T1BA 1A5JA 3VDXA 3Q9VA 1FLIA 4HQMA 1VQPI 3VEPA 2M0MA 1XSDA 1G3SA 4RAYA 4HDUA 4P1WA 1V54H 3SEZA 5HVQC 2VBYA 1F4KA 3FXUA 5CQGA 3KIOA 2XAUA 2N8GA 3HOSA 4MFEA 1YRNA 1YO5C 3C1DA 3CCUI 2HYJA 1LPQA 1SFKA 3FK7A 4YELA 1OQYA 5F04A 1XD7A 4BH9A 1XPXA 3F6OA 2F5EA 4LIUA 3K70C 1BI0A 3BCBA 5K7ZA 2UWMA 5E1ZB 2FUG2 1R4NB 2XRLA 4M9XA 2G7HA 3OYGA 1APLC 1P2FA 5DCMB 2ZXIA 3BQZA 3E6CC 1LE8A 2XGEA 1S8NA 1KQ0A 3K4BA 4HX7A 4KIFA 2DMQA 2MLKA 2QKMB 5C4XJ 3IHUA 4G6QA 4HPQA 2WC2A 4ZTJA 1LUJB 3K10A 3DP7A 4W1UA 3OYDA 3P7NA 1TNTA 4U7DA 4BAYA 3M1CA 4XONA 2ZFWA 3W6VA 3A03A 1GHCA 5CQEA 4H4KC 2XAQA 2HU9A 3EUAA 2LBFB 5FKOA 1AA7A 2YUSA 3IUOA 1S6LA 3FMQA 1VQ4I 1SMYF 1FNNA 2YPRA 4BXFA 3DU5A 2M30A 3VB2A 4WCGA 3JREA 3FXJA 4HSRA 4BKXA 3PUFA 3C3WA 2LR8A 3GCMA 1YTYA 4XMYA 3H92A 1R00A 1QVUA 5J1YA 2GA1A 3HTSB 2E2JJ 1USTA 4DBRA 1WJFA 5F0CA 4LGWA 2W25A 1B1BA 3X2QH 2QCOA 2O0YA 2RN7A 2O9LA 3VODA 3HG9A 2PFBA 5E1WA 1IUFA 1WRJA 1FOXA 1RPWA 2XPVA 2KRFA 2LLKA 2O03A 3OOPA 1TZLA 1OCTC 2MD5A 4X0GA 2L4MA 3MCZA 4ENKA 5EEAA 2NXNB 4AIKA 2EFQA 2K27A 3N05A 1F9NA 2WAQA 1ETVA 4YG2F 1GV2A 4C30A 1FIAA 2K9QA 1HW1A 3BT9A 4ZC3A 1LDJA 2QKLB 2R7OA 5A2QZ 1UFMA 4NB5A 3IRQA 2PI0A 4B48A 5ICEA 3AAFA 2R7UA 1T56A 2JPBA 1O7FA 1IZ1A 2KISA 5E3NA 4BS9A 1HA8A 2XSDC 4ESJA 1VQOI 4O6JA 2I8DA 4BXUA 2HZTA 2O7OA 4D9JA 2JA8J 2E1NA 5GAEJ 3F21A 2QBYB 4D5FA 3ASOH 2EJRA 3R0JA 3AG3H 5FO5A 3FXLA 4KN7X 4U0VA 4U0WA 3J80Z 1OR7A 3ZCOA 1AKHA 2M7AA 1T38A 3J81Z 1HW5A 3QAHA 4N4NB 2VLAA 5GTIC 5FKMA 2Z2SB 1X58A 1JE8A 3OS0A 3J7AY 2LYCA 4DNCA 4ENJA 2F5DA 1SVOA 1XDSA 4X1EA 1W0UA 4LG0B 2MGQA 4X6AJ 3M07A 1TT5B 1G3WA 4B8XA 1IN8A 2G0EA 3CMMA 2JA5J 1WHUA 2GQQA 2NYXA 3SYTA 4GGGA 5D5WB 3OIQA 5ICFA 4HA8A 1Z7LA 4IJAA 5FGMA 1ZGJA 1LVKA 2AXTC 3BC8A 5J6XA 3HTUA 2EINH 3H5RA 2ZO4A 3CCYA 2XB0X 1SD4A 4CUGA 2BVMA 3A0HC 3ISPA 3TP0A 3SDBA 5K7FA 3JRDA 3BWGA 5JVTA 2L7FP 3WG9A 3VYSB 2PJRA 1XSVA 3KZIC 1TWGJ 2A3SA 2HKOA 3QOEA 4E7JA 3R4KA 4GRIA 4BDZA 1KQ9A 2M8GX 1W36C 1VI0A 1V55H 2GZWA 1Z9CA 3FXOA 2KHMA 2DFEA 1XMXA 2QM3A 1K83J 5TISC 3U1DA 2XB5A 2VT3A 1KGSA 1YW8A 1R5HA 2CW7A 4XLHA 4DZPA 2DYSH 2HYGD 5FROA 3OIPA 4B3XA 5L3BA 4KDPA 5DD4A 1MDMB 2VUMJ 2L9VA 4A0YA 4IO9F 1EJ9A 5IY5H 2WAFA 5HS8A 1FT9A 2FE3A 2Z3YA 4OAZA 4FHTA 5DYMA 2HVQA 2Y0SA 3DEUA 5D5VB 2W84A 2RVCA 2EA4A 3F72A 4XKVA 2R7SA 2VXZA 3MFKA 4G7ZF 2ISYA 5KK1A 4XQFA 1ZR4A 4HEA2 2I10A 3MD2A 1HKTA 5C44J 1OPCA 2L7ZA 1MMSA 3HL2A 2BBYA 4HYEA 2O3FA 2M3AA 2ZXJA 2VQCA 4B43A 4HLYA 3EUKL 2AHQA 1SD5A 4KUMA 2OU2A 3K7AJ 3MKYB 2PMHA 4PGHA 5LD2C 2HDCA 1VQNI 1ERDA 4M6YA 5E17F 1HDDC 4PFOA 3CESA 3KP3A 4F55A 4XICA 1B6AA 3DXJF 1Y0NA 3D5LA 3RSNA 2G7UA 2K9NA 5A2QK 2B63J 2VI6A 2XKOA 2XPUA 3H9QA 3HOXJ 2MC4A 3WU2C 1S7EA 3ERMA 4UB6C 4Q4ZF 2CU7A 3LQRA 4BE0A 1TTYA 3DTIA 1O3QA 3DF8A 1YHQI 3K4LA 2MSYA 3J80K 1D5YA 1H8AC 3HOUJ 3RYRA 3DPTA 3J81K 5EYRA 5HDKA 2NRAC 3RPUD 1MSFC 2IA0A 2Y2ZA 4M6XA 1X3UA 3R6SA 3RIRA 4RM3A 2KZVA 1R9TJ 2ZB9A 3H9GA 2FMYA 3L2UA 4A3BJ 2K40A 2QGUA 3OMYA 3RQIA 4GDFA 4I01A 5EZHA 3M4OJ 2DU9A 1Y8QB 2BOLA 2EZKA 2WBMA 4IPAA 4M3GA 4IOCF 1B4AA 4D5CA 3V42A 3I0TA 5JFRA 4WX9A 3LMMA 5LRRA 2OZUA 5HS9A 2ME6A 1QU3A 5FLXZ 3AKZA 2FEZA 5KAFC 2CYYA 2MH9A 1UG2A 1O7LA 1SFXA 5K7HA 2ESNA 3T8RA 3L2VA 1JTYA 1RKTA 3GZNB 3TO6A 4IOAF 3GF2A 5KHDA 2FMLA 1JXSA 4OOIA 1P7JA 2BY3A 2VE8A 3FKJA 1NHAA 1W5TA 3QQAA 3F6VA 3BG6A 2OAZA 3C2HA 4RGXA 1GV5A 4MFDA 4CSWA 3KPHA 1W7PB 2GXBA 2DA1A 3ABTA 1W7PA 2DFHA 3Q0WA 4C3IJ 3WGIA 1SAUA 1Y39A 1W1WE 1T8IA 2F5CA 2R3SA 4PJNA 3HOTA 3BR6A 5CVJA 4HNUA 2EV6A 3ZQCA 3IP4B 1U78A 3H9JA 3KYCB 4UY8I 2DJNA 3JRHA 5KCMA 2EBIA 4EJOA 5FJ8J 5EEHA 3OYFA 3OYKA 3F8BA 4KT6A 5F1RA 3CTAA 1Z3YA 2OCCH 4IX7A 1W4MA 3E97A 1WJBA 4YRVA 2IJLA 2WWYA 1TP4A 3ROUA 2HGCA 1P4WA 1J59A 2X6XA 3BR3A 4BJ6C 4QSHA 2KL4A 2KP6A 3HJEA 3M8JA 3HOYJ 5B1BH 4BBSJ 2A6HF 1IXSB 2DT7B 3S16J 4A6DA 2CW0F 3HXLA 4I76A 2Q1ZB 1FTZA 3OR2C 2JRTA 2X1EA 5FKNA 2HR3A 3S1RJ 3IH3A 1LNWA 4I02A 1SD6A 4JX4A 3OYCA 2DFFA 3IWZA 2FSWA 2RAEA 2R7DA 4Y33A 1LEAA 4KFCA 4EJUA 1GDTA 2CUZA 4UVBA 3GTMJ 3ZP5A 3V7SA 5L3EA 2ZXWH 1V5FA 1JT0A 1GUUA 3ZMDA 2X48A 5E8GA 3M3YJ 1DDNA 1MKMA 1ZH5A 3KLOA 1FSEA 2FQ4A 4KNYA 2A5WA 2A07F 3I71A 4O3MA 1JUSA 2QQ8A 4HLXA 2LC2A 2Z33A 1Z21A 3KP6A 3HSFA 5ILVA 3RKQA 5M5XJ 3WHCA 3WODF 1Z6RA 2DCEA 2WB1A 3W2VA 4BQOA 1G4DA 5B1AH 2XAGA 2EILH 3H3UA 4AIJA 3S3NA 1IRGA 3GBGA 2DTZA 4C2UA 2ZJQF 5F64A 5JVGF 1F5TA 3SFZA 4CH7A 3PFIA 1O3RA 1A6QA 4HV5A 4GYGA 4GYIA 1Y1VJ 2P81A 3CLOA 3IH2A 2NS8A 3HPGA 3LFUA 3QPHA 5E20A 2FBIA 1JGSA 3OSGA 1KU3A 4NDLA 4G6TB 3OWTA 4LK0F 4Y7NJ 4ZYHA 2RV8A 1B8IA 3IAS2 2CG4A 2D45A 2IS1A 4I2OA 1KU2A 2UXXA 1LFUP 1YW9A 1JKPC 3KZZA 4PDKA 1N25A 4OIRF 3DQVC 3U2RA 2RKHA 1SVLA 4ZDPA 2V9PA 3GFLA 4M72A 2OUMA 1OCRH 2IA1A 3BTCA 5JHUA 5FLMJ 2K85A 1BI2A 4DBQA 2KIQA 1SD7A 1XMKA 3S14J 2EZLA 2W1OA 3R0AA 4Y3OA 3NARA 1JUMA 1XGNA 2FXAA 2MYSA 2EQRA 2JJ7A 3HSRA 2DK5A 4U7BA 3JTHA 3O3KA 5L3DA 4KT5C 5TJJA 3VPRA 3HEFA 1TBXA 2Z5UA 3K1PA 4NC8A 4LG3A 3HGYA 2EK5A 3G3ZA 5BNGA 1LQ1A 4A5NA 5ICCA 3LNQA 2CUJA 2DXIA 3OYBA 3FKIJ 3FWEA 3DEWA 3QP6A 3TBIA 4HNVA 2K3FA 1IXRC 1HXDA 3CQZJ 5EZGA 3JAMZ 1PDNC 2PX9A 2K3PA 1MSEC 3K1NA 3W2AA 1JKQC 1FOKA 4MTEA 4B3AA 5IYDJ 1WJCA 2BVLA 5IPAA 3AG4H 4FETA 5F0FA 2VJ5A 3CCEI 3LAPA 5BMZA 4A0XA 1YLFA 4KJZA 2WTEA 3ASNH 3IKVA 2KPMA 1ZRCA 1T0FA 1WQ2A 3BDDA 3R60A 2JZYA 1SFEA 4L5EA 3BCAA 3L9FA 3CCQI 2ZMEA 4PFPA 1D1CA 3ECHA 5E3LA 4YIFA 3FMRA 1X2MA 3OYLA 1QZEA 2AQFA 1BIBA 2EWNA 2TRTA 3RCOA 3SEQA 5CLSA 1EH7A 1I50J 2DMPA 2L0KA 2XF6A 3Q9SA 4B4CA 2VPLA 4IHTA 4D0PA 3HM5A 2BW3B 1VZ0A 1XGOA 2M7BA 2BW3A 3W3CA 2QQAA 1W0TA 2O8KA 2M4GA 4RLFA 4DZJA 3K70D 2OF7A 4XLEA 4BY7J 2P6SA 3FF5A 5EG0B 1TWAJ 3W2WA 2HS5A 5EG0A 3RKYA 3REOA 3GFIA 3COAC 6PAXA 2R0QC 1OR7C 3CF2A 2QQ9A 3Q0VA 5AIPA 2LK2A 2L9NA 2DA7A 1MMAA 2MLGA 3VFZA 2DPDA 4OIQF 3WE3A 1WZ2A 4WXCA 3IWFA 2MH2A 2HXIA 3G4SI 1W5CC 1J5YA 1NG6A 1DUXC 2Q8KA 3F0CA 2DT6A 3F8CA 1JJ6C 4EGYA 3QYFA 2VOOA 2HQAA 4II3A 2DN0A 2ICWG 2HQNA 2RC4A 3WG7H 4EMSA 2XROA 4BJTA 1RIOH 5B3SH 2LMDA 2BY0A 4QPQA 3JRFA 3H35A 3K6GA 2BXZA 1TWCJ 2P5VA 4C3HJ 1PP7U 2V9KA 2CQKA 2DMUA 2DDBA 3PJRA 1OCZH 2QLZA 1J9IA 3BG3A 1R71A 4ZZDA 1FMWA 1QPMA 4YEJA 3T0YA 2X1CA 1YS7A 2STTA 1MGTA 1L0OC 2NVXJ 3MKWB 3N4MA 1LFBA 2KMUA 3S8PA 5HNFA 1D1BA 3S32A 1LFPA 5BS6A 1CF7B 4UVCA 4RGSA 1PUEE 2IS4A 5IOZA 4XLPF 4D7MA 5DUIA 3K4KA 5L3FA 3OY9A 1VQLI 4KIGA 2X6YA 5HLTA 4ZH4F 3HHHA 1U2WA 1ZR2A 1SMTA 4EJVA 1MJAA 2PMUA 4P55A 1T08B 1F36A 2DODA 1U5TA 4AIHA 1YRNB 5JLWA 1QPIA 1BJAA 2H94A 2L54A 1GVDA 1BR4A 5HLGA 4M3FA 4LD5A 3TKYA 4B09A 1XX5A 2R5ZA 2HWVA 1BR1A 1KYZA 5D5UB 3WTSC 3K4CA 2DFIA 3L2RA 2DI3A 4GO1A 2JQ7A 2ZKZA 4XRSA 3HOWJ 2V6CA 2ZSIB 4RMNA 1ETKA 3GZ6A 1LE8B 1Y6IA 1QA6A 3M8FA 4DYCA 4EGZA 3JAMK 2JUCA 1H88C 2LP0A 4MEYF 4H0EA 1EH8A 2JUGA 5FKKA 4C9YA 4C2TA 2ZJ2A 2JSPA 1R58A 4ZYGA 4OU0A 1U8RA 2KJCA 2MC3A 2K4JA 1TW3A 2IAIA 2P0WA 2ELKA 2F2EA 1UB9A 2CMPA 3OIOA 4CDGA 2VQLA 3CMAI 2EV0A 2EA2A 1HC8A 2QSFX 2LOOA 3DWLE 2CS3A 3I53A 4A3KJ 1N75A 1ONVA 1W7PD 1XCVA 5F6FA 2HNHA 4PJMA 3LA3A 2B9SA 3BR2A 4I98B 2QVOA 1R36A 3B73A 3O8HA 1ZN2A 3HB9A 3VYTB 3WTXC 1LB2A 2V1NA 1PJRA 3D0SA 3FX3A 1FX7A 5E79C 2COBA 4RAGA 4WXHA 4DOZA 3HDDA 2VBZA 3JRIA 5FD6A 3EPZA 4PJ0C 2ECCA 3OS1A 9ANTA 3G1LA 1DGRM 2XIGA 2DAOA 3RKWA 2R7TA 3QWLA 1PP8F 4NNJA 1VTNC 3DKXA 4P9FA 2E36A 3JSOA 3S15J 5F27A 1X1CA 3CJQB 1WH5A 2F6CA 1QGPA 2CQ7A 3FBNB 4KA4A 3RI4A 4M3EA 1IUYA 4BEHB 4W97A 3NWSA 2HVRA 4BEHA 4BL0B 2AQEA 4ABZA 2F5FA 4PSWA 4Y4RA 1K78A 1X3ZB 4BQQA 1PYVA 4XL9A 3A1YA 1R5GA 3MEXA 4A6EA 3FISA 2BXYA 4MIMA 1RUNA 4U88A 5K5OA 3L2WA 1W36D 4E6KG 3RPQA 1NK3P 1E3PA 1R49A 2L2OA 3SZGA 3MAJA 2Y0MA 2AS5F 2R4GA 3ELKA 1IDYA 3I4PA 3ZXSA 3CC2I 5HODA 2W48A 3FIWA 3ZN1A 2FA5A 1F43A 5CVIA 2CV1A 4A93J 1R1UA 1AKHB 3NWTA 5LHIA 2DYRH 2Y30A 3L2QA 3VYRB 4M9ZA 4I6ZA 3FK6A 5IT3A 3UNGC 4BQNA 2K9LA 4ZYEA 4XLAA 3CDLA 3KP4A 2ECBA 3I4MJ 2DO7A 2P5KA 2O6GE 2X4HA 5FFZA 3CUOA 1KA8A 1GXQA 2D1HA 2FJ1A 1SFUA 1MW7A 1REPC 3S1MJ 4WK8F 2ZNZA 3PSIA 4I0AA 2Y31A 4AC0A 1TC3C 1OISA 3OL3A 1BN5A 4OAYA 1IN4A 2D2WA 3BROA 3ZQIA 4N4OB 1Q1VA 2HQRA 4L9VA 1D0YA 2FBHA 2L01A 3EYIA 1IRZA 4IF4A 1HKQA 1Y0UA 2FD5A 4XLCA 5BPDA 2HVSA 2AO9A 3U1KA 1IG7A 1J09A 2RNGA 1ETOA 4EV0A 5D6FA 2HFHA 2CV0A 4Q48A 4I99C 2FF4A 3OR1C 5ERIA 3ZR8X 1U9OA 4CCOA 1Z7UA 4UUVA 2ESHA 1JJ8C 2DOEA 4UV8A 4FISA 3RTRA 2L7MP 2PJRB 2PJPA 2VJIA 1MJBA 2WADA 2FOWA 3HSEA 2QQBA 2DA2A 1EKEA 1MBKA 5JI6A 4A3CJ 1S72I 3OV8A 4LFUA 2IGKA 3EUHA 4L9TA 3KE2A 5GADJ 2HOAA 2FRHA 1FOWA 3MZHA 4E7ZA 4F91B 1RC9A 2OQRA 5H6QA 2V7FA 3EYYA 1Z77A 2EH3A 5J40A 4BHPA 1BJZA 2V1UA 3C2BA 3E5QA 3L2CA 3G2BA 2KLOA 2K9SA 3TOAA 3V8LA 2IA2A 4A2UA 1D8KA 2DLLA 2E34A 1ZLJA 1OJLA 1IV6A 2BZTA 4MHGA 1RI7A 4RB3C 1WI9A 3PNTA 3QYEA 2EFNA 2KZGA 1I27A 4BACA 2UV1A 4KN4X 5EF6A 2OC6A 2JK3A 4UB8C 5CVUA 1V4RA 2YX4A 4CCLA 3TL4X 2PBIA 2GXGA 3C7JA 3A4CA 1V5EA 3E5UA 5HOOA 1HBXG 3BP8A 3AFHA 3F8FA 3OOUA 3PO3J 4CICA 3BR0A 1S9HA 1TWFJ 1Z67A 3ABUA 4IRIA 2M2EA 5CYVA 3I59A 1R4MB 4MQVA 1QVTA 2NS7A 4CO8A 2A6TA 4Q5SF 5D4SA 3CCSI 1UAAA 4R79A 2EFWA 1UZCA 1A35A 2MW8A 1BC8C 4ANJA 1K4TA 2LRDA 3FXMA 5D8KB 5C4JJ 2XGCA 1UHMA 1ITYA 2QZ8A 3S3MA 3VWBA 1DPUA 1KU9A 2MFZA 2XAHA 3PO2J 2YS9A 2AXLA 2XV4S 3G73A 4OMYA 3F3XA 4A3DJ 1YX3A 3BTJA 4MNUA 1ZLKA 2LF8A 4N9IA 1P6RA 4G8XA 1SC7A 2DPUA 1AOYA 4HG2A 1PVEA 1OCCH 4IL6C 5KAIC 3HOZJ 3FXRA 2L7KA 2R5YA 4F52A 2HYFA 2COMA 1EF4A 1RZ4A 2XPWA 4HV6A 5D8LB 3K69A 3I55I 3H1CA 2F4OB 4M74A 3HHGA 3TQNA 5C3EJ 4CYCB 2VONA 4CYCA 2CQNA 4UV9A 4Q47A 2XF5A 5LEJA 1I3AA 5DS9A 4B47A 4K2EA 4XRSG 1T0FC 4YFXF 2QEXI 3EQLF 2QA4I 5HDNA 4B1RA 2ZMEC 4R8HA 2OBPA 3ZMVA 4ZZLA 2GAUA 3CDIA 3HKZN 2V4JC 3A2KA 2K4BA 2W00A 4L9JA 1MH3A 1FBQA 1BR2A 2I5UA 2HI3A 1E3OC 3IAM2 3DV8A 5LFAA 3GX4X 3L1PA 2STWA 3KEOA 3BZCA 1ZKGA 2W7NA 1YI2I 2LKXA 3A01A 4IQJA 3TW6A 2OQGA 2VPRA 1JUPA 3CUQA 2MBFA 1ETQA 2HPIA 1LDKB 4NC6A 1R1TA 2L9RA 4N0BA 2PN6A 3KP2A 4EJWA 4XKWA 4PSXA 2ZCWA 3H5NA 5LBQA 1O3SA 3GYHX 2NNNA 1OYYA 1ZK8A 1FYLA 3GW2A 3GVAA 5L3CA 2R7ZJ 2VKHA 3DKYA 2NOJB 3BOQA 1HW2A 1MBEA 3KLNA 2X51A 2TCTA 2LY2A 3IC7A 2EV5A 5GAGJ 4ON0A 3BG7A 3KETA 1E2XA 4HBLA 3LFKA 4MQ9F 4RA2A 5CPRB 3OS2A 1DPRA 1QHGA 3FM3A 2K9MA 3GWZA 1ULYA 1ZYRF 2E1MC 3CO7C 1FJLA 1DQUA 2HKXA 1UG0A 2XAFA 1QO0D 1Z3XA 2GOXB 1YX5A 3LSRA 1A04A 2BHZA 3S1NJ 1WFXA 5EJCA 1B59A 1OFCX 1TT0A 3PQKA 4ZDOA 3SQNA 2XRNA 2HTJA 3V8JA 3I64A 4DW6A 4IKFA 2KFDA 4M73A 5E8IA 2DK8A 2UUZA 3ZQLA 3QOPA 3E6BA 3HZJA 1LJ9A 3L09A 1O57A 3DTEA 1MBJA 1N77A 2ZJRF 4I0BA 5DDGA 3GLLA 2PLYA 2WA0A 2WV0A 2XGXA 1KONA 3CDHA 3GEZA 2EFOA 1T39A 4RB0A 4LLNA 1RR8C 1LDDA 3C2GA 2R7XA 1S5LC 1XMAA 4QLCU 1GVJA 2YU9J 2OJED 2DDAA 3KEYA 1U5TC 1FPQA 2QSHX 3O6BB 4IXAA 3U21A 1ZGWA 1WKMA 2P4WA 4IHWA 4LLLA 1X1DA 4JBAA 2KJBA 2M8EA 3DPLC 1YITI 5IT9K 3OYEA 1UELB 2W85A 4KYWA 2Z16A 2NVQJ 5IYCJ 3HYIA 1I1SA 2OA4A 5FD5A 2JPCA 1HF0A 3I9V2 5B5EC 4BE2A 3HGGA 2E5ZA 4AU7A 4CCKA 4HW0A 3F23A 1B72A 2JT1A 3BR5A 4Z6YA 3J7ZI 1B8IB 3KEQA 3QRFF 4L0YB 2WV1A 3JRAA 2O61A 5DUKA 4BHBA 2EIKH 1MMDA 2O8XA 1S29A 4RB1A 2JVHA 5LGNA 1ODDA 2KKOA 2E7XA 4L5IA 1RRJA 1ZREA 4NUBA 1FP1D 2YX7A 3F8MA 3ML6A 3O8GA 1D5VA 1DU6A 3Q3SA 1H0MA 1SAXA 2QYOA 2OTLI 4U87A 1BC7C 2V79A 5DM6F 2IP2A 1JGGA 2CO5A 5J3LA 1IN7A 5J4YA 1FBUA 3MKLA 3PNVA 3TDUC 3KFWX 4BXXJ 2M0CA 5FFXA 3TEDA 2V6EA 4A3LJ 3HBLA 2M1BA 1K61A 4F7ZA 5IOYA 2DOAA 2M45A 2Y9ZA 3ZOBA 3I58A 1ETWA 1FOYA 2E1OA 1CGPA 3FHNA 4JP0A 2ZJPF 3WGGA 4IEJA 1K7AA 3QPSA 1M1EB 2V1DA 4FT8A 4OIPF 3VSLA 2ZBKA 5K5QA 1X3WB 3A0BC 2Q2EB 4UUTA 4LJZF 2Q2EA 2R7VA 3DBHB 4J01A 1G59A 3GTJJ 1JI8A 2W82A 4FQGA 2HOEA 2M4KA 4PCQA 2QENA 1VQ5I 1WJEA 5E3MA
chains in the Genus database with same CATH topology
3OIOA 4RBOA 2M8GX 4M6VA 1VI0A 3LSPA 4A3KJ 3S1QJ 4LOCA 1K83J 3BR2A 3PM1A 1WH7A 2XB5A 4UUSB 2HOTA 2LD5A 3O8HA 4UUSA 3HB9A 2CUEA 4DZPA 1ZTRA 2VUMJ 1BL0A 1RKWA 2E19A 2COBA 2X6OA 2CUFA 5E3OA 2H8RA 3S17J 2GM4A 2IEKA 3HDDA 3JRIA 3MVPA 2OPTA 2DMTA 2ECCA 1ORKA 9ANTA 3G1LA 2H1KA 4BY1J 1MH4A 2JMWA 5IP7J 2KDZA 1ZR4A 2I10A 3S15J 5F27A 2HOSA 5C44J 5F1JA 1WH5A 2L7ZA 4A3IJ 1IDZA 3E7LA 4M3EA 4DYRA 2DA3A 2MG4A 4W97A 3SFIA 3K2AA 2JN6A 4ABZA 3BR1A 2AHQA 3G1OA 3H3VK 3SJMA 3K7AJ 2QF7A 5IP6A 4FTHA 3FISA 4MIMA 1IC8A 2ID6A 1HDDC 1NK3P 3I4NJ 2JA7J 4XICA 2B63J 2K9NA 4DYQA 1PUFA 2VI6A 5F0HA 3D1NI 2XPUA 3HOXJ 1JKRC 1IDYA 2R93J 2Y0SN 5HODA 2W48A 1XG1A 3BG9A 3FIWA 1S7EA 2CQXA 2CU7A 1F43A 3IH4A 1B72B 5GP9A 1VNDA 3GTLJ 4A93J 4XIDA 3IV5A 3CMYA 1AKHB 3BTLA 2Y30A 2ID3A 4IHXA 1OCPA 1BW6A 2MSYA 1D5YA 1H8AC 3LOCA 4I6ZA 3HOUJ 3FK6A 5EYRA 4V2GA 1XS9A 1MSFC 2Y2ZA 3CDLA 1R9TJ 2ZB9A 2DMNA 5J1UA 2ECBA 3UKGA 4A3BJ 2K40A 3RQIA 3I4MJ 2WAQN 5EZHA 4J19A 3OSFA 3M4OJ 4XK4A 2EZKA 3JRGA 4AYBN 4M3GA 1DU0A 3JR9A 2FJ1A 3S1MJ 4FE7A 4D5CA 2Y31A 4AC0A 1TC3C 2JWTA 4D7NA 5FKLA 2ME6A 3LSGA 2R5ZB 1A6IA 3ZQIA 4FCYA 3JRBA 1Q1VA 1UG2A 5K7HA 1IRZA 2FD5A 3ZQGA 1JTYA 1RKTA 3DCFA 1BA5A 2AO9A 1IG7A 3MN2A 2JA6J 1ETOA 1P7JA 2IBDA 3H0GJ 1U9OA 1HLVA 3QQAA 1JTXA 4GFBA 1JJ8C 2DA4A 1QRYA 4FISA 3QPLA 2L7MP 2HDDA 4A3GJ 1GV5A 5EDNA 4MFDA 4BBRJ 2DA5A 4S0HB 2DA1A 4C3IJ 3Q0WA 3B6CA 3GTOJ 2DA2A 1MBKA 3BR6A 2Y9YA 3ZQCA 4EEFG 4A3CJ 4QIWN 4G12A 1U78A 1JKOC 1O4XA 2DJNA 3JRHA 2HOAA 4V2FA 2EBIA 5FJ8J 1IGNA 1XC5A 1Z77A 2LFBA 2EH3A 1BJZA 3C2BA 2E2IJ 5F08A 4IHVA 5E3MA 2K9SA 3BR3A 2LY9A 5JLXA 2NOGA 4QSHA 3HOYJ 1VF9A 1U8BA 4BBSJ 3GTGJ 1OJLA 3S16J 2DA6A 2XGDA 4I76A 1FIPA 4M3BA 1IV6A 4A3FJ 2GLOA 1FTZA 1H89C 5FKNA 3S1RJ 4M3DA 3IH3A 4JX4A 1IJWC 5EF6A 2RAEA 2JK3A 1GDTA 3GTMJ 4JYKA 2R92J 3SDGA 1JT0A 1GUUA 2X48A 3M3YJ 3OOUA 3TW7A 3PO3J 3RZDJ 3BR0A 1TWFJ 2FQ4A 1WCMJ 2M2EA 1JUSA 1MBGA 1PUFB 1UHSA 5GPAA 1QVTA 2NS7A 3RKQA 5M5XJ 3WHCA 3NAUA 2GBYA 3GTKJ 3S2HJ 5J1RA 2MW8A 3GBGA 2DTZA 1FEXA 5C4JJ 2XGCA 2KT0A 1ITYA 1FTTA 3G1MA 2NVYJ 3PO2J 3BTIA 1Y1VJ 2P81A 2YS9A 1UMQA 3IH2A 2NS8A 4JX6A 4A3DJ 3BTJA 4MO7A 1RETA 1AHDP 3OSGA 1WI3A 4RDUA 4NDLA 3A02A 4Y52J 1JT6A 4Y7NJ 4A3EJ 3HOZJ 1ETYA 2VKEA 2R5YA 3RZOJ 1HOMA 1B8IA 1HCRA 1EF4A 4QTRA 1LFUP 1JKPC 4MLOA 4C2MJ 3LSJA 1SFOJ 2XPWA 1GT0C 1SANA 1A5JA 4CYCB 5C3EJ 4A69C 2EZHA 4CYCA 2WB1N 3BTCA 1CQTA 5FLMJ 2M9HA 5DS9A 3S14J 1NTCA 2EZLA 3NARA 4XRSG 5M3FJ 1JUMA 1ENHA 2EQRA 2JJ7A 2HXOA 4B1RA 2LVSA 2N8GA 1ETXA 4MFEA 5M5YJ 1YRNA 3HKZN 2HQ5A 2HYJA 3VPRA 3HEFA 3FK7A 1MH3A 5F04A 4C3JJ 3HGYA 2HI3A 5BNGA 1E3OC 3LNQA 5K7ZA 3L1PA 3FKIJ 3DEWA 1ZKGA 4HNVA 2XRLA 5EGOB 2LKXA 3CQZJ 3A01A 5EZGA 1APLC 3TW6A 1MSEC 3BQZA 2VPRA 1LE8A 2XGEA 1JUPA 1JKQC 1ETQA 1MBFA 5EGOA 4B3AA 4XRMA 2DMQA 5IYDJ 2L9RA 1MBHA 5IPAA 1NK2P 5F0FA 5C4XJ 1ZK8A 1WPKA 4W1UA 2R7ZJ 1MBEA 4L5EA 1VFCA 2ME0A 2TCTA 1POGA 5E3LA 1HDPA 3A03A 3W6VA 2NVTJ 1X2MA 2TRTA 5FKOA 1I50J 2DMPA 2L0KA 2YUSA 4B4CA 1FJLA 3HM5A 3JREA 3LSRA 3S1NJ 1W0TA 1OFCX 2O8KA 4BKXA 4DZJA 2LR8A 2OF7A 1WGXA 4DW6A 4BY7J 1QVUA 5J1YA 5EG0B 3ZQLA 1TWAJ 2E2JJ 1I6HJ 5EG0A 2R0QC 1MBJA 3Q0VA 5F0CA 1X2NA 3ZQHA 2QCOA 1Y1WJ 2O9LA 2LK2A 2DA7A 1IUFA 4AUXA 1RPWA 2HXIA 1G2HA 5DTDA 2XPVA 3B6AA 3S2DJ 2LLKA 2CRGA 3F0CA 1OCTC 1BW5A 1JJ6C 1MNMC 5EEAA 4A3JJ 4A3MJ 1Z0XA 1ZQ3P 2CQQA 2EZIA 2DN0A 2YU9J 5GPCA 1ETVA 3WHBA 1GV2A 1FIAA 2K9QA 3BT9A 1ZGWA 4IHWA 5IP9J 1T33A 1TWHJ 3JRFA 1TWCJ 5IYBJ 4C3HJ 2DMUA 1T56A 5E3NA 1RESA 3BG3A 2XSDC 2NVQJ 5IYCJ 2O7OA 1RR7A 2CJJA 1HF0A 2NVXJ 2JA8J 3GTPJ 3HGGA 1LFBA 2R5YB 4D5FA 1B72A 3BR5A 1B8IB 1AKHA 3BQYA 2WV1A 3JRAA 5M5WJ 2LTPA 5IOZA 4D7MA 5FKMA 1X58A 2VKVA 3O8GA 4X1EA 1W0UA 1ZR2A 5FLVA 2MGQA 1DU6A 4X6AJ 3Q3SA 3BG5A 2G0EA 1F36A 2JA5J 1JGGA 5J3LA 1YRNB 2E2HJ 3MKLA 3Q0UA 5JLWA 1QPIA 4BXXJ 1GVDA 2M0CA 4IHYA 2M34A 3TEDA 4A3LJ 3HBLA 1U9NA 1K61A 5IOYA 4M3FA 1AU7A 1I3QJ 3ZQFA 2Y9ZA 4JX5A 3ZOBA 2R5ZA 1ETWA 2E1OA 3GTQJ 4JP0A 3TP3A 3A01B 4IEJA 1P7IA 4XRSA 3CCYA 2XB0X 3QPSA 3HOWJ 1ETKA 4FE4A 2X9DA 1LE8B 5M3MJ 2PMZN 4DYCA 3TP0A 4UUTA 5K7FA 1H88C 2LP0A 3JRDA 5FKKA 3GTJJ 2L7FP 2D5VA 3JRCA 3HOVJ 2FX0A 1TWGJ 2IAIA 2ELKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIO A;  4RBO A;  2M8G X;  4M6V A;  1VI0 A;  3LSP A;  4A3K J;  3S1Q J;  4LOC A;  1K83 J;  3BR2 A;  3PM1 A;  1WH7 A;  2XB5 A;  4UUS B;  2HOT A;  2LD5 A;  3O8H A;  4UUS A;  3HB9 A;  2CUE A;  4DZP A;  1ZTR A;  2VUM J;  1BL0 A;  1RKW A;  2E19 A;  2COB A;  2X6O A;  2CUF A;  5E3O A;  2H8R A;  3S17 J;  2GM4 A;  2IEK A;  3HDD A;  3JRI A;  3MVP A;  2OPT A;  2DMT A;  2ECC A;  1ORK A;  9ANT A;  3G1L A;  2H1K A;  4BY1 J;  1MH4 A;  2JMW A;  5IP7 J;  2KDZ A;  1ZR4 A;  2I10 A;  3S15 J;  5F27 A;  2HOS A;  5C44 J;  5F1J A;  1WH5 A;  2L7Z A;  4A3I J;  1IDZ A;  3E7L A;  4M3E A;  4DYR A;  2DA3 A;  2MG4 A;  4W97 A;  3SFI A;  3K2A A;  2JN6 A;  4ABZ A;  3BR1 A;  2AHQ A;  3G1O A;  3H3V K;  3SJM A;  3K7A J;  2QF7 A;  5IP6 A;  4FTH A;  3FIS A;  4MIM A;  1IC8 A;  2ID6 A;  1HDD C;  1NK3 P;  3I4N J;  2JA7 J;  4XIC A;  2B63 J;  2K9N A;  4DYQ A;  1PUF A;  2VI6 A;  5F0H A;  3D1N I;  2XPU A;  3HOX J;  1JKR C;  1IDY A;  2R93 J;  2Y0S N;  5HOD A;  2W48 A;  1XG1 A;  3BG9 A;  3FIW A;  1S7E A;  2CQX A;  2CU7 A;  1F43 A;  3IH4 A;  1B72 B;  5GP9 A;  1VND A;  3GTL J;  4A93 J;  4XID A;  3IV5 A;  3CMY A;  1AKH B;  3BTL A;  2Y30 A;  2ID3 A;  4IHX A;  1OCP A;  1BW6 A;  2MSY A;  1D5Y A;  1H8A C;  3LOC A;  4I6Z A;  3HOU J;  3FK6 A;  5EYR A;  4V2G A;  1XS9 A;  1MSF C;  2Y2Z A;  3CDL A;  1R9T J;  2ZB9 A;  2DMN A;  5J1U A;  2ECB A;  3UKG A;  4A3B J;  2K40 A;  3RQI A;  3I4M J;  2WAQ N;  5EZH A;  4J19 A;  3OSF A;  3M4O J;  4XK4 A;  2EZK A;  3JRG A;  4AYB N;  4M3G A;  1DU0 A;  3JR9 A;  2FJ1 A;  3S1M J;  4FE7 A;  4D5C A;  2Y31 A;  4AC0 A;  1TC3 C;  2JWT A;  4D7N A;  5FKL A;  2ME6 A;  3LSG A;  2R5Z B;  1A6I A;  3ZQI A;  4FCY A;  3JRB A;  1Q1V A;  1UG2 A;  5K7H A;  1IRZ A;  2FD5 A;  3ZQG A;  1JTY A;  1RKT A;  3DCF A;  1BA5 A;  2AO9 A;  1IG7 A;  3MN2 A;  2JA6 J;  1ETO A;  1P7J A;  2IBD A;  3H0G J;  1U9O A;  1HLV A;  3QQA A;  1JTX A;  4GFB A;  1JJ8 C;  2DA4 A;  1QRY A;  4FIS A;  3QPL A;  2L7M P;  2HDD A;  4A3G J;  1GV5 A;  5EDN A;  4MFD A;  4BBR J;  2DA5 A;  4S0H B;  2DA1 A;  4C3I J;  3Q0W A;  3B6C A;  3GTO J;  2DA2 A;  1MBK A;  3BR6 A;  2Y9Y A;  3ZQC A;  4EEF G;  4A3C J;  4QIW N;  4G12 A;  1U78 A;  1JKO C;  1O4X A;  2DJN A;  3JRH A;  2HOA A;  4V2F A;  2EBI A;  5FJ8 J;  1IGN A;  1XC5 A;  1Z77 A;  2LFB A;  2EH3 A;  1BJZ A;  3C2B A;  2E2I J;  5F08 A;  4IHV A;  5E3M A;  2K9S A;  3BR3 A;  2LY9 A;  5JLX A;  2NOG A;  4QSH A;  3HOY J;  1VF9 A;  1U8B A;  4BBS J;  3GTG J;  1OJL A;  3S16 J;  2DA6 A;  2XGD A;  4I76 A;  1FIP A;  4M3B A;  1IV6 A;  4A3F J;  2GLO A;  1FTZ A;  1H89 C;  5FKN A;  3S1R J;  4M3D A;  3IH3 A;  4JX4 A;  1IJW C;  5EF6 A;  2RAE A;  2JK3 A;  1GDT A;  3GTM J;  4JYK A;  2R92 J;  3SDG A;  1JT0 A;  1GUU A;  2X48 A;  3M3Y J;  3OOU A;  3TW7 A;  3PO3 J;  3RZD J;  3BR0 A;  1TWF J;  2FQ4 A;  1WCM J;  2M2E A;  1JUS A;  1MBG A;  1PUF B;  1UHS A;  5GPA A;  1QVT A;  2NS7 A;  3RKQ A;  5M5X J;  3WHC A;  3NAU A;  2GBY A;  3GTK J;  3S2H J;  5J1R A;  2MW8 A;  3GBG A;  2DTZ A;  1FEX A;  5C4J J;  2XGC A;  2KT0 A;  1ITY A;  1FTT A;  3G1M A;  2NVY J;  3PO2 J;  3BTI A;  1Y1V J;  2P81 A;  2YS9 A;  1UMQ A;  3IH2 A;  2NS8 A;  4JX6 A;  4A3D J;  3BTJ A;  4MO7 A;  1RET A;  1AHD P;  3OSG A;  1WI3 A;  4RDU A;  4NDL A;  3A02 A;  4Y52 J;  1JT6 A;  4Y7N J;  4A3E J;  3HOZ J;  1ETY A;  2VKE A;  2R5Y A;  3RZO J;  1HOM A;  1B8I A;  1HCR A;  1EF4 A;  4QTR A;  1LFU P;  1JKP C;  4MLO A;  4C2M J;  3LSJ A;  1SFO J;  2XPW A;  1GT0 C;  1SAN A;  1A5J A;  4CYC B;  5C3E J;  4A69 C;  2EZH A;  4CYC A;  2WB1 N;  3BTC A;  1CQT A;  5FLM J;  2M9H A;  5DS9 A;  3S14 J;  1NTC A;  2EZL A;  3NAR A;  4XRS G;  5M3F J;  1JUM A;  1ENH A;  2EQR A;  2JJ7 A;  2HXO A;  4B1R A;  2LVS A;  2N8G A;  1ETX A;  4MFE A;  5M5Y J;  1YRN A;  3HKZ N;  2HQ5 A;  2HYJ A;  3VPR A;  3HEF A;  3FK7 A;  1MH3 A;  5F04 A;  4C3J J;  3HGY A;  2HI3 A;  5BNG A;  1E3O C;  3LNQ A;  5K7Z A;  3L1P A;  3FKI J;  3DEW A;  1ZKG A;  4HNV A;  2XRL A;  5EGO B;  2LKX A;  3CQZ J;  3A01 A;  5EZG A;  1APL C;  3TW6 A;  1MSE C;  3BQZ A;  2VPR A;  1LE8 A;  2XGE A;  1JUP A;  1JKQ C;  1ETQ A;  1MBF A;  5EGO A;  4B3A A;  4XRM A;  2DMQ A;  5IYD J;  2L9R A;  1MBH A;  5IPA A;  1NK2 P;  5F0F A;  5C4X J;  1ZK8 A;  1WPK A;  4W1U A;  2R7Z J;  1MBE A;  4L5E A;  1VFC A;  2ME0 A;  2TCT A;  1POG A;  5E3L A;  1HDP A;  3A03 A;  3W6V A;  2NVT J;  1X2M A;  2TRT A;  5FKO A;  1I50 J;  2DMP A;  2L0K A;  2YUS A;  4B4C A;  1FJL A;  3HM5 A;  3JRE A;  3LSR A;  3S1N J;  1W0T A;  1OFC X;  2O8K A;  4BKX A;  4DZJ A;  2LR8 A;  2OF7 A;  1WGX A;  4DW6 A;  4BY7 J;  1QVU A;  5J1Y A;  5EG0 B;  3ZQL A;  1TWA J;  2E2J J;  1I6H J;  5EG0 A;  2R0Q C;  1MBJ A;  3Q0V A;  5F0C A;  1X2N A;  3ZQH A;  2QCO A;  1Y1W J;  2O9L A;  2LK2 A;  2DA7 A;  1IUF A;  4AUX A;  1RPW A;  2HXI A;  1G2H A;  5DTD A;  2XPV A;  3B6A A;  3S2D J;  2LLK A;  2CRG A;  3F0C A;  1OCT C;  1BW5 A;  1JJ6 C;  1MNM C;  5EEA A;  4A3J J;  4A3M J;  1Z0X A;  1ZQ3 P;  2CQQ A;  2EZI A;  2DN0 A;  2YU9 J;  5GPC A;  1ETV A;  3WHB A;  1GV2 A;  1FIA A;  2K9Q A;  3BT9 A;  1ZGW A;  4IHW A;  5IP9 J;  1T33 A;  1TWH J;  3JRF A;  1TWC J;  5IYB J;  4C3H J;  2DMU A;  1T56 A;  5E3N A;  1RES A;  3BG3 A;  2XSD C;  2NVQ J;  5IYC J;  2O7O A;  1RR7 A;  2CJJ A;  1HF0 A;  2NVX J;  2JA8 J;  3GTP J;  3HGG A;  1LFB A;  2R5Y B;  4D5F A;  1B72 A;  3BR5 A;  1B8I B;  1AKH A;  3BQY A;  2WV1 A;  3JRA A;  5M5W J;  2LTP A;  5IOZ A;  4D7M A;  5FKM A;  1X58 A;  2VKV A;  3O8G A;  4X1E A;  1W0U A;  1ZR2 A;  5FLV A;  2MGQ A;  1DU6 A;  4X6A J;  3Q3S A;  3BG5 A;  2G0E A;  1F36 A;  2JA5 J;  1JGG A;  5J3L A;  1YRN B;  2E2H J;  3MKL A;  3Q0U A;  5JLW A;  1QPI A;  4BXX J;  1GVD A;  2M0C A;  4IHY A;  2M34 A;  3TED A;  4A3L J;  3HBL A;  1U9N A;  1K61 A;  5IOY A;  4M3F A;  1AU7 A;  1I3Q J;  3ZQF A;  2Y9Z A;  4JX5 A;  3ZOB A;  2R5Z A;  1ETW A;  2E1O A;  3GTQ J;  4JP0 A;  3TP3 A;  3A01 B;  4IEJ A;  1P7I A;  4XRS A;  3CCY A;  2XB0 X;  3QPS A;  3HOW J;  1ETK A;  4FE4 A;  2X9D A;  1LE8 B;  5M3M J;  2PMZ N;  4DYC A;  3TP0 A;  4UUT A;  5K7F A;  1H88 C;  2LP0 A;  3JRD A;  5FKK A;  3GTJ J;  2L7F P;  2D5V A;  3JRC A;  3HOV J;  2FX0 A;  1TWG J;  2IAI A;  2ELK A; 
#chains in the Genus database with same CATH topology
 1Z05 A;  2L5Q A;  3LWF A;  4RBO A;  1GLN A;  3VOE A;  3IKT A;  3DEE A;  3TDZ C;  3CZ6 A;  4PJJ A;  1RNL A;  2ZME B;  3LSP A;  2VIX A;  3CF5 F;  1VQM I;  5FRM A;  3S1Q J;  4Z2Y A;  5D4R A;  1IV8 A;  3KP5 A;  4LIV A;  4IRG A;  2VL8 A;  1MIJ A;  1WH7 A;  3E0J B;  4EJT A;  1EA3 A;  1E3H A;  2J5P A;  2VJ4 A;  1ZTR A;  1MND A;  3ZPL A;  1XGS A;  3ECO A;  1FBS A;  2E19 A;  4ETS A;  3DTK A;  2X6O A;  2IGO A;  3ZMS A;  5E3O A;  2H8R A;  2PG4 A;  1J0R A;  2A69 F;  2IEK A;  2XKP A;  4RLQ A;  2GM4 A;  4AD9 A;  4AID A;  1ORK A;  2IPQ X;  1MH4 A;  1WJ5 A;  2A5Y B;  2JMW A;  5IP7 J;  2CFO A;  4AWX B;  1OMI A;  3GLX A;  1S3J A;  2C6Y A;  2LKP A;  4A3I J;  5F1J A;  2CV2 A;  1IDZ A;  2GXA A;  3BLY A;  2R7W A;  2MG4 A;  4XBF A;  1TQM A;  3SXY A;  1FYM A;  3JCU C;  3DKW A;  3FM5 A;  3K2A A;  2QWW A;  1O3T A;  5BPI A;  2V26 A;  3H3V K;  2MAB A;  5KNL A;  3PL8 A;  4WWC A;  2B7E A;  1VQ6 I;  2QF7 A;  1QHH D;  1TQI A;  3L00 A;  4OIO F;  4HZF A;  2DTR A;  4EQQ A;  3CD6 I;  2E1M B;  3BZK A;  4ESB A;  4NQW A;  4L18 B;  1STZ A;  2YR2 A;  4WF2 A;  3I4N J;  4EAT A;  2KIU A;  3KX2 A;  3MZ8 A;  4DYQ A;  1PUF A;  4Y15 A;  5F0H A;  1X1P A;  2ADU A;  1JKR C;  2Y0S N;  2JSC A;  3I5U A;  1NH3 A;  1GXP A;  1Z1D A;  1XG1 A;  4XRF A;  3P5J A;  4S04 A;  1MMG A;  2BYV E;  5H6R A;  2W24 A;  4LK1 F;  4XR6 A;  4DJA A;  4M9S A;  5DD8 A;  4TV7 A;  5J47 A;  3IV5 A;  3CMY A;  3RPU A;  3BTL A;  2ID3 A;  3DLA A;  3N97 A;  4IHX A;  4PZJ A;  1BW6 A;  2IVM A;  3DBR B;  4JK1 X;  4IZZ A;  3K4J A;  2HDW A;  3HKZ A;  1XS9 A;  4EVI A;  2DOF A;  3NQO A;  5J1U A;  3CO6 C;  4BUP A;  4CCJ A;  2DQL A;  4HAM A;  3OSF A;  1YJW I;  3QYB A;  1K6Y A;  1U5T B;  2CWE A;  4AYB N;  3JRG A;  2P8T A;  2DBB A;  2M87 A;  3JR9 A;  4RS8 A;  1YJN I;  1SVM A;  2VQH A;  1K79 A;  3IL2 A;  3CP2 A;  3EDP A;  4MTD A;  4KIS A;  2ETH A;  3EUH C;  3K9T A;  4RGR A;  4BNC A;  1J2X A;  4D7N A;  2X85 A;  1BI1 A;  4PJL A;  5FKL A;  3ZQQ A;  1R7J A;  3LSG A;  2R5Z B;  4MEX F;  1A6I A;  3BZ6 A;  3JRB A;  2LH9 A;  1J75 A;  2JTV A;  2GA2 A;  3K2Z A;  1BA5 A;  4JQF A;  3RJP A;  1ZG5 A;  1QQI A;  1D0Z A;  2JA6 J;  5K5R A;  3HPH A;  4A0Z A;  3TO9 A;  2IBD A;  2K5C A;  2W57 A;  3H0G J;  3PSF A;  4KIT B;  1HLV A;  1RUO A;  4GFB A;  1JTX A;  3S93 A;  1QRY A;  4Y13 A;  3QPL A;  2HDD A;  4A3G J;  5EDN A;  3P9I A;  2DA5 A;  4ESF A;  4JOM A;  2UXN A;  4S0H B;  3JW4 A;  2ZXH A;  2DW4 A;  2L3D A;  3B6C A;  1MNE A;  4BDY A;  1G8X A;  1R23 A;  1IO2 A;  4DQ2 A;  1X4P A;  2Y9Y A;  4EEF G;  3JTG A;  2V1X A;  4CCM A;  4G12 A;  4QIW N;  3I3L A;  4HOB A;  3HRM A;  5DCM A;  2BV6 A;  1O4X A;  1IF1 A;  4FX4 A;  4XLN F;  1ZRF A;  4V2F A;  4ZJZ A;  2H6B A;  2NS0 A;  2F5V A;  1IN6 A;  1IGN A;  2ZSH B;  4IVN A;  4HRI A;  3TOB A;  3CC7 I;  2LFB A;  3DBL B;  4XM3 A;  3VYU B;  3MQ0 A;  1G3Y A;  5HS7 A;  4E7H A;  1VQK I;  1IW7 F;  1R22 A;  3E6D A;  5F08 A;  4IHV A;  1BIA A;  2LY9 A;  3KCC A;  5JLX A;  2NOG A;  1Z91 A;  3NRV A;  2W4S A;  4E7S A;  2UZK A;  1HQC A;  2KIM A;  2XC7 A;  4KMU X;  4ZYA A;  2NNY A;  3GTG J;  4GCV A;  2DA6 A;  2Z1D A;  2XGD A;  1FIP A;  3H5A A;  2LBF A;  4I09 A;  1XCB A;  3ONQ A;  4M3B A;  3S2W A;  4A3F J;  4UVA A;  1H89 C;  2GLO A;  4M3D A;  1IJW C;  2E1C A;  1H9T A;  3MKZ A;  4HX8 A;  1K78 B;  2R92 J;  1ZGA A;  3R61 A;  2MA3 A;  2PQ8 A;  2YSR A;  3ZGK A;  4E7L A;  4MGR A;  3FBI B;  4G7O F;  2XF7 A;  2VKD A;  2FU4 A;  4WXD A;  3SHF A;  2CW8 A;  3PUB A;  5LLQ A;  3KZY A;  2BHY A;  1K6O A;  5EEG A;  4M71 A;  1X1B A;  4YFK F;  5D6E A;  3NAU A;  4KIB A;  2BY2 A;  3GTK J;  2F4M B;  3KP7 A;  2A68 F;  3SZT A;  5LGT A;  2RDP A;  1X19 A;  3TMO A;  4XLF A;  2KT0 A;  1FTT A;  1WVR A;  3W6K B;  2NVY J;  3D5R C;  1MZB A;  4RAF A;  1BI3 A;  1USS A;  4G94 A;  1P4A A;  1UMQ A;  2WY7 Q;  4JX6 A;  1B9M A;  2VN2 A;  3C18 A;  4MO7 A;  1AHD P;  1OYI A;  1WI3 A;  4EM2 A;  5AON A;  3A02 A;  2KRH A;  1JT6 A;  4Y52 J;  2OTJ I;  3CCM I;  4HF2 A;  4A3E J;  1K4S A;  1ETY A;  2VKE A;  4O5V A;  1B9N A;  2QBY A;  2CGP A;  3PNY A;  3HUG B;  3CUQ C;  3HUG A;  2DJI A;  4ZDL A;  4C2M J;  1QNT A;  5CKT A;  3LST A;  5ICG A;  2VB6 A;  1GT0 C;  2Y69 H;  4A69 C;  3CJN A;  1KZH A;  2EZH A;  3CP8 A;  3QP5 A;  4HDV A;  2O5R A;  1XSX A;  1OKR A;  2WB1 N;  4EM0 B;  1CQT A;  3OYN A;  1DP3 A;  2M9H A;  1NTC A;  4LG0 A;  2P5L C;  3CJR B;  5M3F J;  3ULQ B;  1JHH A;  1ENH A;  3HRU A;  2HXO A;  2K7L A;  3OYI A;  2LVS A;  1ETX A;  5M5Y J;  1SEU A;  2HQ5 A;  1EV7 A;  3CJT B;  3LQQ A;  2ELJ A;  2L4A A;  2OD5 A;  4L9N A;  4XSZ F;  4C3J J;  1U0J A;  4BYY A;  4OMZ A;  3WTW C;  4IHS A;  1R5I D;  2IGN A;  1X4O A;  3TGN A;  4V19 K;  1BOA A;  3M7G A;  3K4N A;  2EB7 A;  5J8C A;  1IRF A;  3FHZ A;  2E7W A;  2H8W A;  1MBF A;  3W6J B;  3CCR I;  4E7I A;  4XRM A;  2JVG A;  1TW2 A;  2E71 A;  2Z99 A;  5H20 A;  2LKS A;  1MBH A;  4RGU A;  4UHT A;  2VAS A;  1NK2 P;  2OV7 A;  2ZFU A;  1YE9 A;  2HPM A;  1WWX A;  2X0L A;  3K0L A;  2LF7 A;  3QPT A;  4D1Q A;  1WPK A;  4S05 A;  1BM9 A;  3K4M A;  5CVV A;  3MWM A;  3RQ4 A;  1VFC A;  2ME0 A;  3AL0 C;  2NVT J;  1POG A;  4AVZ A;  1IN5 A;  1HDP A;  2VOP A;  4BE1 A;  2FNA A;  3V8K A;  1I6X A;  3ZQ7 A;  2EIM H;  2X6W A;  2Y48 A;  4R1H A;  3KYD B;  2VXD A;  3M1E A;  4F3Q A;  4BU2 A;  3CCV I;  3P9K A;  3NEU A;  1MDM A;  4YII A;  1FWZ A;  1TQP A;  1BOB A;  1WGX A;  3WTY C;  4PGG A;  1I6H J;  2L9S A;  4BGD A;  1TNS A;  4NHJ A;  1FYK A;  2OCE A;  1KU7 A;  3I59 B;  4PK4 A;  1X2N A;  3ZQH A;  4NC7 A;  1Y1W J;  3LA2 A;  1ZG3 A;  2K86 A;  3LSM A;  1TLH B;  4AUX A;  3CCL I;  3FDY A;  5FRN A;  5DEQ A;  3BPV A;  1I5Z A;  1G2H A;  5DTD A;  2NVU B;  4DGW B;  3B6A A;  1A31 A;  3S2D J;  1BW5 A;  2CRG A;  3J7A O;  1MNM C;  5LGU A;  3PIP F;  4A3J J;  1Z0X A;  4A3M J;  1MD0 A;  1ZQ3 P;  3JSP A;  2CQQ A;  2EZI A;  5GPC A;  3WHB A;  4B44 A;  2HTS A;  4G6D A;  4AYB A;  5IT9 Z;  2IS6 A;  5TGT A;  5IP9 J;  1T33 A;  1TWH J;  5IYB J;  1YG2 A;  1RES A;  2XAJ A;  3BJO A;  1IRX A;  2J5O A;  4CZC A;  2F4I A;  4F93 B;  3I56 I;  1W5S A;  1RR7 A;  2CJJ A;  2K02 A;  2X1D A;  1D1A A;  5KVR A;  2VE9 A;  2RQP A;  3ABM H;  3GTP J;  2R5Y B;  2E5N A;  1P92 A;  4N9H A;  2KRC A;  2P6T A;  3G6E I;  3BQY A;  4XSX F;  2QSG X;  2XVC A;  3CC4 I;  1FP2 A;  3HRT A;  4KIC A;  5M5W J;  3Q5F A;  2LTP A;  2XDV A;  1R6R A;  2QUF A;  5LHH A;  4E4H A;  2IGM A;  1FY7 A;  2IT0 A;  1XDU A;  3WTZ A;  2IW5 A;  3MMY B;  2H27 A;  5DV5 A;  1BBY A;  2VKV A;  5FLV A;  3GZ5 A;  3OYA A;  3BJ6 A;  3BG5 A;  2EFP A;  1NG7 A;  1ON2 A;  3OYH A;  1Z6T A;  4HF1 A;  1YIO A;  4EM1 A;  2E2H J;  1WJD A;  3ABK H;  3Q0U A;  4II2 A;  3ZMZ A;  2XHK A;  3GFJ A;  2M34 A;  4IHY A;  3ZRG A;  3V7R A;  1U9N A;  4LB6 B;  1U3E M;  3RDI A;  3CME I;  1AU7 A;  1I3Q J;  3B02 A;  4LIT A;  4JX5 A;  4OIN F;  3ZQF A;  4G9Y A;  5J4V A;  1ACI A;  1HSJ A;  2Q0O A;  2M5W A;  1DGW Y;  3GTQ J;  3I54 A;  1YYV A;  5D5X B;  3LA7 A;  3U9G A;  2KDO A;  3TP3 A;  3PFY A;  3A01 B;  1A36 A;  2HZD A;  1P7I A;  4XOT A;  4FE4 A;  2X9D A;  3F8N A;  2JRM A;  3CUQ B;  3PQJ A;  5M3M J;  2PMZ N;  2Y75 A;  4NBQ A;  4HF0 A;  1QZZ A;  3GME A;  1D8J A;  3WTU C;  4RB2 C;  3WTV C;  5L3G A;  2HEO A;  2D5V A;  4DIQ A;  3JRC A;  4UNO A;  3HOV J;  4LLG F;  3LSH A;  1YJ9 I;  2FX0 A;  5LEK A;  4OWR B;  5EGO B;  3ZMT A;  5EGO A;  1XB4 A;  3SZP A;  1XN7 A;  4YIR X;  2V9V A;  4M6V A;  1VQ9 I;  4QWQ A;  1S7O A;  5B66 C;  1Y56 A;  4GXO A;  1FSH A;  2GIV A;  4LOC A;  3PM1 A;  2NAZ A;  4CXF A;  4UUS B;  2HOT A;  5ILS A;  2LD5 A;  4UUS A;  1YFH A;  1T95 A;  2CUE A;  1QZY A;  2LDU A;  1UCR A;  2A6E F;  1BL0 A;  5H2F C;  1I1G A;  1RKW A;  3E3V A;  2CUF A;  1LVA A;  2OZ6 A;  3S17 J;  3FZV A;  4BHC A;  2EIJ H;  4ZYD A;  3MVP A;  1G3T A;  3WE2 A;  2OPT A;  1F1Z A;  2DMT A;  4FAS D;  1TL8 A;  4HX4 A;  2H1K A;  4BY1 J;  2FBK A;  2VBX A;  2KDZ A;  2JA2 A;  1U6G A;  5TRD A;  1Q1H A;  4UXN A;  2HOS A;  2WY8 Q;  2RRE A;  1FZP B;  3E7L A;  1D3Y A;  4DYR A;  1YW7 A;  2DA3 A;  3O2P E;  3OYJ A;  1P4X A;  3WTT C;  3AG1 H;  3SFI A;  3VSK A;  5ED4 A;  2JN6 A;  3ABL H;  3IRR A;  3CCJ I;  5HLI A;  4A12 A;  1ZRD A;  3BR1 A;  3AL0 B;  3G1O A;  3QU6 A;  2RQQ A;  1YOV B;  2R7R A;  2ZNY A;  3SJM A;  4RM2 A;  2Z9O A;  3L7W A;  3D5S C;  5IP6 A;  1ZHF A;  4FTH A;  2E60 A;  3HIF A;  2H09 A;  5DM7 F;  1IC8 A;  2ID6 A;  1J7K A;  1OCO H;  5J8F A;  2CFX A;  1G6N A;  2JA7 J;  1ON1 A;  5HDG A;  2H1L A;  3H3Z A;  3D1N I;  1E17 A;  1R1V A;  2R93 J;  1EH6 A;  4IRH A;  2GOM A;  3BG9 A;  4HST A;  2CQX A;  3V7C A;  3BY6 A;  3S3O A;  3IH4 A;  1B72 B;  5GP9 A;  4AM3 A;  5DCF A;  1VND A;  3GTL J;  5E18 F;  4XID A;  5CJ9 A;  5BQT A;  2CH0 A;  2L02 A;  4XN3 A;  1ZAO A;  5CVR A;  1OCP A;  2BEO A;  1N78 A;  1FMV A;  1HKS A;  4LMY A;  3LOC A;  4XKB A;  2LY1 A;  4PUS A;  3E6M A;  4E70 A;  3TO7 A;  3K1M A;  4V2G A;  1S7A A;  4J00 A;  4ENN A;  4BQA A;  2DT5 A;  4QPO A;  2A05 A;  3OYM A;  4XNF A;  4KMF A;  3G71 I;  2DMN A;  2F48 A;  4I7H A;  3UKG A;  4L5J A;  2WAQ N;  4J19 A;  3UR3 C;  1IXC A;  1T6S A;  2P7V B;  4XK4 A;  1IAW A;  3BPX A;  1DU0 A;  2ELH A;  1D0X A;  4ENM A;  4FE7 A;  1V3F A;  4RAZ A;  2GIZ A;  2ACJ A;  1DP7 P;  3HRS A;  4FX0 A;  2JWT A;  1T2K A;  2KIF A;  3LL7 A;  1Y8R B;  2FNP A;  3M8E A;  5GAH J;  1KQ8 A;  2PEX A;  5ILU A;  1ZAR A;  2VC0 A;  2VT2 A;  4ASN A;  4FCY A;  1LKX A;  1UJ8 A;  2IRF G;  5FLX K;  4CHU A;  2KQR A;  3ZQG A;  3MZY A;  3DCF A;  5E1X A;  3FXK A;  3MN2 A;  2VJJ A;  4HNT A;  3V4G A;  4XKC A;  3QU3 A;  3P9C A;  3KYL A;  4HQE A;  2VC1 A;  1KYW A;  1FC3 A;  3BJA A;  3ERE D;  2DA4 A;  3FXQ A;  2VQG A;  1E0E A;  4BBR J;  1I39 A;  2TDX A;  3EET A;  3H0D A;  3RYP A;  5JHF A;  3AG2 H;  3WU0 A;  3GTO J;  2BE5 F;  2R7F A;  1H9G A;  3J7Y J;  2FOK A;  3DFG A;  3M9A A;  5BOX A;  4XN0 A;  1ZEL A;  4A5M A;  1HST A;  1JKO C;  2R7Q A;  3DLL F;  3WGH A;  5K1Y A;  4XOR A;  3T8T A;  5HNH A;  4IQ4 A;  2LSO A;  1XTA A;  2LNB A;  2IS2 A;  3T5X A;  1XC5 A;  2GWR A;  1P9Q C;  3FMS A;  3GFM A;  1L3L A;  5JR3 A;  1YQA A;  3CLQ A;  3DU6 A;  2E2I J;  1XGM A;  2XSJ C;  1AWC A;  2CSO A;  3ZN0 A;  3GXO A;  4P96 A;  2LRE A;  1VF9 A;  1U8B A;  2VOD A;  3PIO F;  2EPF A;  3F9K A;  4XOP A;  2FQ3 A;  1JHF A;  4CGZ A;  5LRS A;  1VQ8 I;  2BY1 A;  2MD0 A;  1YS6 A;  1OYW A;  2E35 A;  2VBW A;  2ISZ A;  4LB5 A;  1V5G A;  3ESW B;  4CZZ A;  4U0Y A;  5GTH C;  4JYK A;  2BGC A;  2WAE A;  1OLT A;  3QOD A;  3GO5 A;  1WJA A;  3SDG A;  3LAJ A;  2XAS A;  2H6C A;  2RNJ A;  4G7H F;  2XUB A;  2RGV A;  1WSU A;  3TW7 A;  2LG4 A;  4F92 B;  1QBJ A;  3RZD J;  4NQW B;  1WCM J;  4Y17 A;  4YFN F;  1T98 A;  1MBG A;  1PUF B;  1UHS A;  5GPA A;  1VQ7 I;  3OL4 A;  4L0Z B;  3LSK A;  4E7K A;  3E1S A;  3F22 A;  2GBY A;  3S2H J;  5J1R A;  3ZMU A;  2P7C B;  3H36 A;  1MMN A;  1FEX A;  1YIJ I;  2D1V A;  3DPU A;  3RKX A;  4CCN A;  2ZC2 A;  3G1M A;  4CA0 A;  1UHW A;  4CYD A;  4P9U A;  5FB2 A;  1LEB A;  3E5X A;  4BJ5 C;  3BTI A;  3HC7 A;  1X1A A;  2B0L A;  5AIQ A;  5LHG A;  2IXS A;  1RET A;  1MJ9 A;  4ITV A;  4AVP A;  4RDU A;  4ZTF A;  3GUD A;  2YU3 A;  1ZG1 A;  1HOM A;  2A61 A;  3RZO J;  4P5O A;  1HCR A;  1C0W A;  4QTR A;  4MLO A;  2PMZ A;  3LSI A;  2G9W A;  1CF7 A;  3LSJ A;  1SFO J;  3WU1 B;  1SAN A;  2DQR A;  5HLH A;  3T1B A;  1A5J A;  3VDX A;  3Q9V A;  1FLI A;  4HQM A;  1VQP I;  3VEP A;  2M0M A;  1XSD A;  1G3S A;  4RAY A;  4HDU A;  4P1W A;  1V54 H;  3SEZ A;  5HVQ C;  2VBY A;  1F4K A;  3FXU A;  5CQG A;  3KIO A;  2XAU A;  2N8G A;  3HOS A;  4MFE A;  1YRN A;  1YO5 C;  3C1D A;  3CCU I;  2HYJ A;  1LPQ A;  1SFK A;  3FK7 A;  4YEL A;  1OQY A;  5F04 A;  1XD7 A;  4BH9 A;  1XPX A;  3F6O A;  2F5E A;  4LIU A;  3K70 C;  1BI0 A;  3BCB A;  5K7Z A;  2UWM A;  5E1Z B;  2FUG 2;  1R4N B;  2XRL A;  4M9X A;  2G7H A;  3OYG A;  1APL C;  1P2F A;  5DCM B;  2ZXI A;  3BQZ A;  3E6C C;  1LE8 A;  2XGE A;  1S8N A;  1KQ0 A;  3K4B A;  4HX7 A;  4KIF A;  2DMQ A;  2MLK A;  2QKM B;  5C4X J;  3IHU A;  4G6Q A;  4HPQ A;  2WC2 A;  4ZTJ A;  1LUJ B;  3K10 A;  3DP7 A;  4W1U A;  3OYD A;  3P7N A;  1TNT A;  4U7D A;  4BAY A;  3M1C A;  4XON A;  2ZFW A;  3W6V A;  3A03 A;  1GHC A;  5CQE A;  4H4K C;  2XAQ A;  2HU9 A;  3EUA A;  2LBF B;  5FKO A;  1AA7 A;  2YUS A;  3IUO A;  1S6L A;  3FMQ A;  1VQ4 I;  1SMY F;  1FNN A;  2YPR A;  4BXF A;  3DU5 A;  2M30 A;  3VB2 A;  4WCG A;  3JRE A;  3FXJ A;  4HSR A;  4BKX A;  3PUF A;  3C3W A;  2LR8 A;  3GCM A;  1YTY A;  4XMY A;  3H92 A;  1R00 A;  1QVU A;  5J1Y A;  2GA1 A;  3HTS B;  2E2J J;  1UST A;  4DBR A;  1WJF A;  5F0C A;  4LGW A;  2W25 A;  1B1B A;  3X2Q H;  2QCO A;  2O0Y A;  2RN7 A;  2O9L A;  3VOD A;  3HG9 A;  2PFB A;  5E1W A;  1IUF A;  1WRJ A;  1FOX A;  1RPW A;  2XPV A;  2KRF A;  2LLK A;  2O03 A;  3OOP A;  1TZL A;  1OCT C;  2MD5 A;  4X0G A;  2L4M A;  3MCZ A;  4ENK A;  5EEA A;  2NXN B;  4AIK A;  2EFQ A;  2K27 A;  3N05 A;  1F9N A;  2WAQ A;  1ETV A;  4YG2 F;  1GV2 A;  4C30 A;  1FIA A;  2K9Q A;  1HW1 A;  3BT9 A;  4ZC3 A;  1LDJ A;  2QKL B;  2R7O A;  5A2Q Z;  1UFM A;  4NB5 A;  3IRQ A;  2PI0 A;  4B48 A;  5ICE A;  3AAF A;  2R7U A;  1T56 A;  2JPB A;  1O7F A;  1IZ1 A;  2KIS A;  5E3N A;  4BS9 A;  1HA8 A;  2XSD C;  4ESJ A;  1VQO I;  4O6J A;  2I8D A;  4BXU A;  2HZT A;  2O7O A;  4D9J A;  2JA8 J;  2E1N A;  5GAE J;  3F21 A;  2QBY B;  4D5F A;  3ASO H;  2EJR A;  3R0J A;  3AG3 H;  5FO5 A;  3FXL A;  4KN7 X;  4U0V A;  4U0W A;  3J80 Z;  1OR7 A;  3ZCO A;  1AKH A;  2M7A A;  1T38 A;  3J81 Z;  1HW5 A;  3QAH A;  4N4N B;  2VLA A;  5GTI C;  5FKM A;  2Z2S B;  1X58 A;  1JE8 A;  3OS0 A;  3J7A Y;  2LYC A;  4DNC A;  4ENJ A;  2F5D A;  1SVO A;  1XDS A;  4X1E A;  1W0U A;  4LG0 B;  2MGQ A;  4X6A J;  3M07 A;  1TT5 B;  1G3W A;  4B8X A;  1IN8 A;  2G0E A;  3CMM A;  2JA5 J;  1WHU A;  2GQQ A;  2NYX A;  3SYT A;  4GGG A;  5D5W B;  3OIQ A;  5ICF A;  4HA8 A;  1Z7L A;  4IJA A;  5FGM A;  1ZGJ A;  1LVK A;  2AXT C;  3BC8 A;  5J6X A;  3HTU A;  2EIN H;  3H5R A;  2ZO4 A;  3CCY A;  2XB0 X;  1SD4 A;  4CUG A;  2BVM A;  3A0H C;  3ISP A;  3TP0 A;  3SDB A;  5K7F A;  3JRD A;  3BWG A;  5JVT A;  2L7F P;  3WG9 A;  3VYS B;  2PJR A;  1XSV A;  3KZI C;  1TWG J;  2A3S A;  2HKO A;  3QOE A;  4E7J A;  3R4K A;  4GRI A;  4BDZ A;  1KQ9 A;  2M8G X;  1W36 C;  1VI0 A;  1V55 H;  2GZW A;  1Z9C A;  3FXO A;  2KHM A;  2DFE A;  1XMX A;  2QM3 A;  1K83 J;  5TIS C;  3U1D A;  2XB5 A;  2VT3 A;  1KGS A;  1YW8 A;  1R5H A;  2CW7 A;  4XLH A;  4DZP A;  2DYS H;  2HYG D;  5FRO A;  3OIP A;  4B3X A;  5L3B A;  4KDP A;  5DD4 A;  1MDM B;  2VUM J;  2L9V A;  4A0Y A;  4IO9 F;  1EJ9 A;  5IY5 H;  2WAF A;  5HS8 A;  1FT9 A;  2FE3 A;  2Z3Y A;  4OAZ A;  4FHT A;  5DYM A;  2HVQ A;  2Y0S A;  3DEU A;  5D5V B;  2W84 A;  2RVC A;  2EA4 A;  3F72 A;  4XKV A;  2R7S A;  2VXZ A;  3MFK A;  4G7Z F;  2ISY A;  5KK1 A;  4XQF A;  1ZR4 A;  4HEA 2;  2I10 A;  3MD2 A;  1HKT A;  5C44 J;  1OPC A;  2L7Z A;  1MMS A;  3HL2 A;  2BBY A;  4HYE A;  2O3F A;  2M3A A;  2ZXJ A;  2VQC A;  4B43 A;  4HLY A;  3EUK L;  2AHQ A;  1SD5 A;  4KUM A;  2OU2 A;  3K7A J;  3MKY B;  2PMH A;  4PGH A;  5LD2 C;  2HDC A;  1VQN I;  1ERD A;  4M6Y A;  5E17 F;  1HDD C;  4PFO A;  3CES A;  3KP3 A;  4F55 A;  4XIC A;  1B6A A;  3DXJ F;  1Y0N A;  3D5L A;  3RSN A;  2G7U A;  2K9N A;  5A2Q K;  2B63 J;  2VI6 A;  2XKO A;  2XPU A;  3H9Q A;  3HOX J;  2MC4 A;  3WU2 C;  1S7E A;  3ERM A;  4UB6 C;  4Q4Z F;  2CU7 A;  3LQR A;  4BE0 A;  1TTY A;  3DTI A;  1O3Q A;  3DF8 A;  1YHQ I;  3K4L A;  2MSY A;  3J80 K;  1D5Y A;  1H8A C;  3HOU J;  3RYR A;  3DPT A;  3J81 K;  5EYR A;  5HDK A;  2NRA C;  3RPU D;  1MSF C;  2IA0 A;  2Y2Z A;  4M6X A;  1X3U A;  3R6S A;  3RIR A;  4RM3 A;  2KZV A;  1R9T J;  2ZB9 A;  3H9G A;  2FMY A;  3L2U A;  4A3B J;  2K40 A;  2QGU A;  3OMY A;  3RQI A;  4GDF A;  4I01 A;  5EZH A;  3M4O J;  2DU9 A;  1Y8Q B;  2BOL A;  2EZK A;  2WBM A;  4IPA A;  4M3G A;  4IOC F;  1B4A A;  4D5C A;  3V42 A;  3I0T A;  5JFR A;  4WX9 A;  3LMM A;  5LRR A;  2OZU A;  5HS9 A;  2ME6 A;  1QU3 A;  5FLX Z;  3AKZ A;  2FEZ A;  5KAF C;  2CYY A;  2MH9 A;  1UG2 A;  1O7L A;  1SFX A;  5K7H A;  2ESN A;  3T8R A;  3L2V A;  1JTY A;  1RKT A;  3GZN B;  3TO6 A;  4IOA F;  3GF2 A;  5KHD A;  2FML A;  1JXS A;  4OOI A;  1P7J A;  2BY3 A;  2VE8 A;  3FKJ A;  1NHA A;  1W5T A;  3QQA A;  3F6V A;  3BG6 A;  2OAZ A;  3C2H A;  4RGX A;  1GV5 A;  4MFD A;  4CSW A;  3KPH A;  1W7P B;  2GXB A;  2DA1 A;  3ABT A;  1W7P A;  2DFH A;  3Q0W A;  4C3I J;  3WGI A;  1SAU A;  1Y39 A;  1W1W E;  1T8I A;  2F5C A;  2R3S A;  4PJN A;  3HOT A;  3BR6 A;  5CVJ A;  4HNU A;  2EV6 A;  3ZQC A;  3IP4 B;  1U78 A;  3H9J A;  3KYC B;  4UY8 I;  2DJN A;  3JRH A;  5KCM A;  2EBI A;  4EJO A;  5FJ8 J;  5EEH A;  3OYF A;  3OYK A;  3F8B A;  4KT6 A;  5F1R A;  3CTA A;  1Z3Y A;  2OCC H;  4IX7 A;  1W4M A;  3E97 A;  1WJB A;  4YRV A;  2IJL A;  2WWY A;  1TP4 A;  3ROU A;  2HGC A;  1P4W A;  1J59 A;  2X6X A;  3BR3 A;  4BJ6 C;  4QSH A;  2KL4 A;  2KP6 A;  3HJE A;  3M8J A;  3HOY J;  5B1B H;  4BBS J;  2A6H F;  1IXS B;  2DT7 B;  3S16 J;  4A6D A;  2CW0 F;  3HXL A;  4I76 A;  2Q1Z B;  1FTZ A;  3OR2 C;  2JRT A;  2X1E A;  5FKN A;  2HR3 A;  3S1R J;  3IH3 A;  1LNW A;  4I02 A;  1SD6 A;  4JX4 A;  3OYC A;  2DFF A;  3IWZ A;  2FSW A;  2RAE A;  2R7D A;  4Y33 A;  1LEA A;  4KFC A;  4EJU A;  1GDT A;  2CUZ A;  4UVB A;  3GTM J;  3ZP5 A;  3V7S A;  5L3E A;  2ZXW H;  1V5F A;  1JT0 A;  1GUU A;  3ZMD A;  2X48 A;  5E8G A;  3M3Y J;  1DDN A;  1MKM A;  1ZH5 A;  3KLO A;  1FSE A;  2FQ4 A;  4KNY A;  2A5W A;  2A07 F;  3I71 A;  4O3M A;  1JUS A;  2QQ8 A;  4HLX A;  2LC2 A;  2Z33 A;  1Z21 A;  3KP6 A;  3HSF A;  5ILV A;  3RKQ A;  5M5X J;  3WHC A;  3WOD F;  1Z6R A;  2DCE A;  2WB1 A;  3W2V A;  4BQO A;  1G4D A;  5B1A H;  2XAG A;  2EIL H;  3H3U A;  4AIJ A;  3S3N A;  1IRG A;  3GBG A;  2DTZ A;  4C2U A;  2ZJQ F;  5F64 A;  5JVG F;  1F5T A;  3SFZ A;  4CH7 A;  3PFI A;  1O3R A;  1A6Q A;  4HV5 A;  4GYG A;  4GYI A;  1Y1V J;  2P81 A;  3CLO A;  3IH2 A;  2NS8 A;  3HPG A;  3LFU A;  3QPH A;  5E20 A;  2FBI A;  1JGS A;  3OSG A;  1KU3 A;  4NDL A;  4G6T B;  3OWT A;  4LK0 F;  4Y7N J;  4ZYH A;  2RV8 A;  1B8I A;  3IAS 2;  2CG4 A;  2D45 A;  2IS1 A;  4I2O A;  1KU2 A;  2UXX A;  1LFU P;  1YW9 A;  1JKP C;  3KZZ A;  4PDK A;  1N25 A;  4OIR F;  3DQV C;  3U2R A;  2RKH A;  1SVL A;  4ZDP A;  2V9P A;  3GFL A;  4M72 A;  2OUM A;  1OCR H;  2IA1 A;  3BTC A;  5JHU A;  5FLM J;  2K85 A;  1BI2 A;  4DBQ A;  2KIQ A;  1SD7 A;  1XMK A;  3S14 J;  2EZL A;  2W1O A;  3R0A A;  4Y3O A;  3NAR A;  1JUM A;  1XGN A;  2FXA A;  2MYS A;  2EQR A;  2JJ7 A;  3HSR A;  2DK5 A;  4U7B A;  3JTH A;  3O3K A;  5L3D A;  4KT5 C;  5TJJ A;  3VPR A;  3HEF A;  1TBX A;  2Z5U A;  3K1P A;  4NC8 A;  4LG3 A;  3HGY A;  2EK5 A;  3G3Z A;  5BNG A;  1LQ1 A;  4A5N A;  5ICC A;  3LNQ A;  2CUJ A;  2DXI A;  3OYB A;  3FKI J;  3FWE A;  3DEW A;  3QP6 A;  3TBI A;  4HNV A;  2K3F A;  1IXR C;  1HXD A;  3CQZ J;  5EZG A;  3JAM Z;  1PDN C;  2PX9 A;  2K3P A;  1MSE C;  3K1N A;  3W2A A;  1JKQ C;  1FOK A;  4MTE A;  4B3A A;  5IYD J;  1WJC A;  2BVL A;  5IPA A;  3AG4 H;  4FET A;  5F0F A;  2VJ5 A;  3CCE I;  3LAP A;  5BMZ A;  4A0X A;  1YLF A;  4KJZ A;  2WTE A;  3ASN H;  3IKV A;  2KPM A;  1ZRC A;  1T0F A;  1WQ2 A;  3BDD A;  3R60 A;  2JZY A;  1SFE A;  4L5E A;  3BCA A;  3L9F A;  3CCQ I;  2ZME A;  4PFP A;  1D1C A;  3ECH A;  5E3L A;  4YIF A;  3FMR A;  1X2M A;  3OYL A;  1QZE A;  2AQF A;  1BIB A;  2EWN A;  2TRT A;  3RCO A;  3SEQ A;  5CLS A;  1EH7 A;  1I50 J;  2DMP A;  2L0K A;  2XF6 A;  3Q9S A;  4B4C A;  2VPL A;  4IHT A;  4D0P A;  3HM5 A;  2BW3 B;  1VZ0 A;  1XGO A;  2M7B A;  2BW3 A;  3W3C A;  2QQA A;  1W0T A;  2O8K A;  2M4G A;  4RLF A;  4DZJ A;  3K70 D;  2OF7 A;  4XLE A;  4BY7 J;  2P6S A;  3FF5 A;  5EG0 B;  1TWA J;  3W2W A;  2HS5 A;  5EG0 A;  3RKY A;  3REO A;  3GFI A;  3COA C;  6PAX A;  2R0Q C;  1OR7 C;  3CF2 A;  2QQ9 A;  3Q0V A;  5AIP A;  2LK2 A;  2L9N A;  2DA7 A;  1MMA A;  2MLG A;  3VFZ A;  2DPD A;  4OIQ F;  3WE3 A;  1WZ2 A;  4WXC A;  3IWF A;  2MH2 A;  2HXI A;  3G4S I;  1W5C C;  1J5Y A;  1NG6 A;  1DUX C;  2Q8K A;  3F0C A;  2DT6 A;  3F8C A;  1JJ6 C;  4EGY A;  3QYF A;  2VOO A;  2HQA A;  4II3 A;  2DN0 A;  2ICW G;  2HQN A;  2RC4 A;  3WG7 H;  4EMS A;  2XRO A;  4BJT A;  1RIO H;  5B3S H;  2LMD A;  2BY0 A;  4QPQ A;  3JRF A;  3H35 A;  3K6G A;  2BXZ A;  1TWC J;  2P5V A;  4C3H J;  1PP7 U;  2V9K A;  2CQK A;  2DMU A;  2DDB A;  3PJR A;  1OCZ H;  2QLZ A;  1J9I A;  3BG3 A;  1R71 A;  4ZZD A;  1FMW A;  1QPM A;  4YEJ A;  3T0Y A;  2X1C A;  1YS7 A;  2STT A;  1MGT A;  1L0O C;  2NVX J;  3MKW B;  3N4M A;  1LFB A;  2KMU A;  3S8P A;  5HNF A;  1D1B A;  3S32 A;  1LFP A;  5BS6 A;  1CF7 B;  4UVC A;  4RGS A;  1PUE E;  2IS4 A;  5IOZ A;  4XLP F;  4D7M A;  5DUI A;  3K4K A;  5L3F A;  3OY9 A;  1VQL I;  4KIG A;  2X6Y A;  5HLT A;  4ZH4 F;  3HHH A;  1U2W A;  1ZR2 A;  1SMT A;  4EJV A;  1MJA A;  2PMU A;  4P55 A;  1T08 B;  1F36 A;  2DOD A;  1U5T A;  4AIH A;  1YRN B;  5JLW A;  1QPI A;  1BJA A;  2H94 A;  2L54 A;  1GVD A;  1BR4 A;  5HLG A;  4M3F A;  4LD5 A;  3TKY A;  4B09 A;  1XX5 A;  2R5Z A;  2HWV A;  1BR1 A;  1KYZ A;  5D5U B;  3WTS C;  3K4C A;  2DFI A;  3L2R A;  2DI3 A;  4GO1 A;  2JQ7 A;  2ZKZ A;  4XRS A;  3HOW J;  2V6C A;  2ZSI B;  4RMN A;  1ETK A;  3GZ6 A;  1LE8 B;  1Y6I A;  1QA6 A;  3M8F A;  4DYC A;  4EGZ A;  3JAM K;  2JUC A;  1H88 C;  2LP0 A;  4MEY F;  4H0E A;  1EH8 A;  2JUG A;  5FKK A;  4C9Y A;  4C2T A;  2ZJ2 A;  2JSP A;  1R58 A;  4ZYG A;  4OU0 A;  1U8R A;  2KJC A;  2MC3 A;  2K4J A;  1TW3 A;  2IAI A;  2P0W A;  2ELK A;  2F2E A;  1UB9 A;  2CMP A;  3OIO A;  4CDG A;  2VQL A;  3CMA I;  2EV0 A;  2EA2 A;  1HC8 A;  2QSF X;  2LOO A;  3DWL E;  2CS3 A;  3I53 A;  4A3K J;  1N75 A;  1ONV A;  1W7P D;  1XCV A;  5F6F A;  2HNH A;  4PJM A;  3LA3 A;  2B9S A;  3BR2 A;  4I98 B;  2QVO A;  1R36 A;  3B73 A;  3O8H A;  1ZN2 A;  3HB9 A;  3VYT B;  3WTX C;  1LB2 A;  2V1N A;  1PJR A;  3D0S A;  3FX3 A;  1FX7 A;  5E79 C;  2COB A;  4RAG A;  4WXH A;  4DOZ A;  3HDD A;  2VBZ A;  3JRI A;  5FD6 A;  3EPZ A;  4PJ0 C;  2ECC A;  3OS1 A;  9ANT A;  3G1L A;  1DGR M;  2XIG A;  2DAO A;  3RKW A;  2R7T A;  3QWL A;  1PP8 F;  4NNJ A;  1VTN C;  3DKX A;  4P9F A;  2E36 A;  3JSO A;  3S15 J;  5F27 A;  1X1C A;  3CJQ B;  1WH5 A;  2F6C A;  1QGP A;  2CQ7 A;  3FBN B;  4KA4 A;  3RI4 A;  4M3E A;  1IUY A;  4BEH B;  4W97 A;  3NWS A;  2HVR A;  4BEH A;  4BL0 B;  2AQE A;  4ABZ A;  2F5F A;  4PSW A;  4Y4R A;  1K78 A;  1X3Z B;  4BQQ A;  1PYV A;  4XL9 A;  3A1Y A;  1R5G A;  3MEX A;  4A6E A;  3FIS A;  2BXY A;  4MIM A;  1RUN A;  4U88 A;  5K5O A;  3L2W A;  1W36 D;  4E6K G;  3RPQ A;  1NK3 P;  1E3P A;  1R49 A;  2L2O A;  3SZG A;  3MAJ A;  2Y0M A;  2AS5 F;  2R4G A;  3ELK A;  1IDY A;  3I4P A;  3ZXS A;  3CC2 I;  5HOD A;  2W48 A;  3FIW A;  3ZN1 A;  2FA5 A;  1F43 A;  5CVI A;  2CV1 A;  4A93 J;  1R1U A;  1AKH B;  3NWT A;  5LHI A;  2DYR H;  2Y30 A;  3L2Q A;  3VYR B;  4M9Z A;  4I6Z A;  3FK6 A;  5IT3 A;  3UNG C;  4BQN A;  2K9L A;  4ZYE A;  4XLA A;  3CDL A;  3KP4 A;  2ECB A;  3I4M J;  2DO7 A;  2P5K A;  2O6G E;  2X4H A;  5FFZ A;  3CUO A;  1KA8 A;  1GXQ A;  2D1H A;  2FJ1 A;  1SFU A;  1MW7 A;  1REP C;  3S1M J;  4WK8 F;  2ZNZ A;  3PSI A;  4I0A A;  2Y31 A;  4AC0 A;  1TC3 C;  1OIS A;  3OL3 A;  1BN5 A;  4OAY A;  1IN4 A;  2D2W A;  3BRO A;  3ZQI A;  4N4O B;  1Q1V A;  2HQR A;  4L9V A;  1D0Y A;  2FBH A;  2L01 A;  3EYI A;  1IRZ A;  4IF4 A;  1HKQ A;  1Y0U A;  2FD5 A;  4XLC A;  5BPD A;  2HVS A;  2AO9 A;  3U1K A;  1IG7 A;  1J09 A;  2RNG A;  1ETO A;  4EV0 A;  5D6F A;  2HFH A;  2CV0 A;  4Q48 A;  4I99 C;  2FF4 A;  3OR1 C;  5ERI A;  3ZR8 X;  1U9O A;  4CCO A;  1Z7U A;  4UUV A;  2ESH A;  1JJ8 C;  2DOE A;  4UV8 A;  4FIS A;  3RTR A;  2L7M P;  2PJR B;  2PJP A;  2VJI A;  1MJB A;  2WAD A;  2FOW A;  3HSE A;  2QQB A;  2DA2 A;  1EKE A;  1MBK A;  5JI6 A;  4A3C J;  1S72 I;  3OV8 A;  4LFU A;  2IGK A;  3EUH A;  4L9T A;  3KE2 A;  5GAD J;  2HOA A;  2FRH A;  1FOW A;  3MZH A;  4E7Z A;  4F91 B;  1RC9 A;  2OQR A;  5H6Q A;  2V7F A;  3EYY A;  1Z77 A;  2EH3 A;  5J40 A;  4BHP A;  1BJZ A;  2V1U A;  3C2B A;  3E5Q A;  3L2C A;  3G2B A;  2KLO A;  2K9S A;  3TOA A;  3V8L A;  2IA2 A;  4A2U A;  1D8K A;  2DLL A;  2E34 A;  1ZLJ A;  1OJL A;  1IV6 A;  2BZT A;  4MHG A;  1RI7 A;  4RB3 C;  1WI9 A;  3PNT A;  3QYE A;  2EFN A;  2KZG A;  1I27 A;  4BAC A;  2UV1 A;  4KN4 X;  5EF6 A;  2OC6 A;  2JK3 A;  4UB8 C;  5CVU A;  1V4R A;  2YX4 A;  4CCL A;  3TL4 X;  2PBI A;  2GXG A;  3C7J A;  3A4C A;  1V5E A;  3E5U A;  5HOO A;  1HBX G;  3BP8 A;  3AFH A;  3F8F A;  3OOU A;  3PO3 J;  4CIC A;  3BR0 A;  1S9H A;  1TWF J;  1Z67 A;  3ABU A;  4IRI A;  2M2E A;  5CYV A;  3I59 A;  1R4M B;  4MQV A;  1QVT A;  2NS7 A;  4CO8 A;  2A6T A;  4Q5S F;  5D4S A;  3CCS I;  1UAA A;  4R79 A;  2EFW A;  1UZC A;  1A35 A;  2MW8 A;  1BC8 C;  4ANJ A;  1K4T A;  2LRD A;  3FXM A;  5D8K B;  5C4J J;  2XGC A;  1UHM A;  1ITY A;  2QZ8 A;  3S3M A;  3VWB A;  1DPU A;  1KU9 A;  2MFZ A;  2XAH A;  3PO2 J;  2YS9 A;  2AXL A;  2XV4 S;  3G73 A;  4OMY A;  3F3X A;  4A3D J;  1YX3 A;  3BTJ A;  4MNU A;  1ZLK A;  2LF8 A;  4N9I A;  1P6R A;  4G8X A;  1SC7 A;  2DPU A;  1AOY A;  4HG2 A;  1PVE A;  1OCC H;  4IL6 C;  5KAI C;  3HOZ J;  3FXR A;  2L7K A;  2R5Y A;  4F52 A;  2HYF A;  2COM A;  1EF4 A;  1RZ4 A;  2XPW A;  4HV6 A;  5D8L B;  3K69 A;  3I55 I;  3H1C A;  2F4O B;  4M74 A;  3HHG A;  3TQN A;  5C3E J;  4CYC B;  2VON A;  4CYC A;  2CQN A;  4UV9 A;  4Q47 A;  2XF5 A;  5LEJ A;  1I3A A;  5DS9 A;  4B47 A;  4K2E A;  4XRS G;  1T0F C;  4YFX F;  2QEX I;  3EQL F;  2QA4 I;  5HDN A;  4B1R A;  2ZME C;  4R8H A;  2OBP A;  3ZMV A;  4ZZL A;  2GAU A;  3CDI A;  3HKZ N;  2V4J C;  3A2K A;  2K4B A;  2W00 A;  4L9J A;  1MH3 A;  1FBQ A;  1BR2 A;  2I5U A;  2HI3 A;  1E3O C;  3IAM 2;  3DV8 A;  5LFA A;  3GX4 X;  3L1P A;  2STW A;  3KEO A;  3BZC A;  1ZKG A;  2W7N A;  1YI2 I;  2LKX A;  3A01 A;  4IQJ A;  3TW6 A;  2OQG A;  2VPR A;  1JUP A;  3CUQ A;  2MBF A;  1ETQ A;  2HPI A;  1LDK B;  4NC6 A;  1R1T A;  2L9R A;  4N0B A;  2PN6 A;  3KP2 A;  4EJW A;  4XKW A;  4PSX A;  2ZCW A;  3H5N A;  5LBQ A;  1O3S A;  3GYH X;  2NNN A;  1OYY A;  1ZK8 A;  1FYL A;  3GW2 A;  3GVA A;  5L3C A;  2R7Z J;  2VKH A;  3DKY A;  2NOJ B;  3BOQ A;  1HW2 A;  1MBE A;  3KLN A;  2X51 A;  2TCT A;  2LY2 A;  3IC7 A;  2EV5 A;  5GAG J;  4ON0 A;  3BG7 A;  3KET A;  1E2X A;  4HBL A;  3LFK A;  4MQ9 F;  4RA2 A;  5CPR B;  3OS2 A;  1DPR A;  1QHG A;  3FM3 A;  2K9M A;  3GWZ A;  1ULY A;  1ZYR F;  2E1M C;  3CO7 C;  1FJL A;  1DQU A;  2HKX A;  1UG0 A;  2XAF A;  1QO0 D;  1Z3X A;  2GOX B;  1YX5 A;  3LSR A;  1A04 A;  2BHZ A;  3S1N J;  1WFX A;  5EJC A;  1B59 A;  1OFC X;  1TT0 A;  3PQK A;  4ZDO A;  3SQN A;  2XRN A;  2HTJ A;  3V8J A;  3I64 A;  4DW6 A;  4IKF A;  2KFD A;  4M73 A;  5E8I A;  2DK8 A;  2UUZ A;  3ZQL A;  3QOP A;  3E6B A;  3HZJ A;  1LJ9 A;  3L09 A;  1O57 A;  3DTE A;  1MBJ A;  1N77 A;  2ZJR F;  4I0B A;  5DDG A;  3GLL A;  2PLY A;  2WA0 A;  2WV0 A;  2XGX A;  1KON A;  3CDH A;  3GEZ A;  2EFO A;  1T39 A;  4RB0 A;  4LLN A;  1RR8 C;  1LDD A;  3C2G A;  2R7X A;  1S5L C;  1XMA A;  4QLC U;  1GVJ A;  2YU9 J;  2OJE D;  2DDA A;  3KEY A;  1U5T C;  1FPQ A;  2QSH X;  3O6B B;  4IXA A;  3U21 A;  1ZGW A;  1WKM A;  2P4W A;  4IHW A;  4LLL A;  1X1D A;  4JBA A;  2KJB A;  2M8E A;  3DPL C;  1YIT I;  5IT9 K;  3OYE A;  1UEL B;  2W85 A;  4KYW A;  2Z16 A;  2NVQ J;  5IYC J;  3HYI A;  1I1S A;  2OA4 A;  5FD5 A;  2JPC A;  1HF0 A;  3I9V 2;  5B5E C;  4BE2 A;  3HGG A;  2E5Z A;  4AU7 A;  4CCK A;  4HW0 A;  3F23 A;  1B72 A;  2JT1 A;  3BR5 A;  4Z6Y A;  3J7Z I;  1B8I B;  3KEQ A;  3QRF F;  4L0Y B;  2WV1 A;  3JRA A;  2O61 A;  5DUK A;  4BHB A;  2EIK H;  1MMD A;  2O8X A;  1S29 A;  4RB1 A;  2JVH A;  5LGN A;  1ODD A;  2KKO A;  2E7X A;  4L5I A;  1RRJ A;  1ZRE A;  4NUB A;  1FP1 D;  2YX7 A;  3F8M A;  3ML6 A;  3O8G A;  1D5V A;  1DU6 A;  3Q3S A;  1H0M A;  1SAX A;  2QYO A;  2OTL I;  4U87 A;  1BC7 C;  2V79 A;  5DM6 F;  2IP2 A;  1JGG A;  2CO5 A;  5J3L A;  1IN7 A;  5J4Y A;  1FBU A;  3MKL A;  3PNV A;  3TDU C;  3KFW X;  4BXX J;  2M0C A;  5FFX A;  3TED A;  2V6E A;  4A3L J;  3HBL A;  2M1B A;  1K61 A;  4F7Z A;  5IOY A;  2DOA A;  2M45 A;  2Y9Z A;  3ZOB A;  3I58 A;  1ETW A;  1FOY A;  2E1O A;  1CGP A;  3FHN A;  4JP0 A;  2ZJP F;  3WGG A;  4IEJ A;  1K7A A;  3QPS A;  1M1E B;  2V1D A;  4FT8 A;  4OIP F;  3VSL A;  2ZBK A;  5K5Q A;  1X3W B;  3A0B C;  2Q2E B;  4UUT A;  4LJZ F;  2Q2E A;  2R7V A;  3DBH B;  4J01 A;  1G59 A;  3GTJ J;  1JI8 A;  2W82 A;  4FQG A;  2HOE A;  2M4K A;  4PCQ A;  2QEN A;  1VQ5 I;  1WJE A;  5E3M A; 
#chains in the Genus database with same CATH homology
 3OIO A;  4RBO A;  2M8G X;  4M6V A;  1VI0 A;  3LSP A;  4A3K J;  3S1Q J;  4LOC A;  1K83 J;  3BR2 A;  3PM1 A;  1WH7 A;  2XB5 A;  4UUS B;  2HOT A;  2LD5 A;  3O8H A;  4UUS A;  3HB9 A;  2CUE A;  4DZP A;  1ZTR A;  2VUM J;  1BL0 A;  1RKW A;  2E19 A;  2COB A;  2X6O A;  2CUF A;  5E3O A;  2H8R A;  3S17 J;  2GM4 A;  2IEK A;  3HDD A;  3JRI A;  3MVP A;  2OPT A;  2DMT A;  2ECC A;  1ORK A;  9ANT A;  3G1L A;  2H1K A;  4BY1 J;  1MH4 A;  2JMW A;  5IP7 J;  2KDZ A;  1ZR4 A;  2I10 A;  3S15 J;  5F27 A;  2HOS A;  5C44 J;  5F1J A;  1WH5 A;  2L7Z A;  4A3I J;  1IDZ A;  3E7L A;  4M3E A;  4DYR A;  2DA3 A;  2MG4 A;  4W97 A;  3SFI A;  3K2A A;  2JN6 A;  4ABZ A;  3BR1 A;  2AHQ A;  3G1O A;  3H3V K;  3SJM A;  3K7A J;  2QF7 A;  5IP6 A;  4FTH A;  3FIS A;  4MIM A;  1IC8 A;  2ID6 A;  1HDD C;  1NK3 P;  3I4N J;  2JA7 J;  4XIC A;  2B63 J;  2K9N A;  4DYQ A;  1PUF A;  2VI6 A;  5F0H A;  3D1N I;  2XPU A;  3HOX J;  1JKR C;  1IDY A;  2R93 J;  2Y0S N;  5HOD A;  2W48 A;  1XG1 A;  3BG9 A;  3FIW A;  1S7E A;  2CQX A;  2CU7 A;  1F43 A;  3IH4 A;  1B72 B;  5GP9 A;  1VND A;  3GTL J;  4A93 J;  4XID A;  3IV5 A;  3CMY A;  1AKH B;  3BTL A;  2Y30 A;  2ID3 A;  4IHX A;  1OCP A;  1BW6 A;  2MSY A;  1D5Y A;  1H8A C;  3LOC A;  4I6Z A;  3HOU J;  3FK6 A;  5EYR A;  4V2G A;  1XS9 A;  1MSF C;  2Y2Z A;  3CDL A;  1R9T J;  2ZB9 A;  2DMN A;  5J1U A;  2ECB A;  3UKG A;  4A3B J;  2K40 A;  3RQI A;  3I4M J;  2WAQ N;  5EZH A;  4J19 A;  3OSF A;  3M4O J;  4XK4 A;  2EZK A;  3JRG A;  4AYB N;  4M3G A;  1DU0 A;  3JR9 A;  2FJ1 A;  3S1M J;  4FE7 A;  4D5C A;  2Y31 A;  4AC0 A;  1TC3 C;  2JWT A;  4D7N A;  5FKL A;  2ME6 A;  3LSG A;  2R5Z B;  1A6I A;  3ZQI A;  4FCY A;  3JRB A;  1Q1V A;  1UG2 A;  5K7H A;  1IRZ A;  2FD5 A;  3ZQG A;  1JTY A;  1RKT A;  3DCF A;  1BA5 A;  2AO9 A;  1IG7 A;  3MN2 A;  2JA6 J;  1ETO A;  1P7J A;  2IBD A;  3H0G J;  1U9O A;  1HLV A;  3QQA A;  1JTX A;  4GFB A;  1JJ8 C;  2DA4 A;  1QRY A;  4FIS A;  3QPL A;  2L7M P;  2HDD A;  4A3G J;  1GV5 A;  5EDN A;  4MFD A;  4BBR J;  2DA5 A;  4S0H B;  2DA1 A;  4C3I J;  3Q0W A;  3B6C A;  3GTO J;  2DA2 A;  1MBK A;  3BR6 A;  2Y9Y A;  3ZQC A;  4EEF G;  4A3C J;  4QIW N;  4G12 A;  1U78 A;  1JKO C;  1O4X A;  2DJN A;  3JRH A;  2HOA A;  4V2F A;  2EBI A;  5FJ8 J;  1IGN A;  1XC5 A;  1Z77 A;  2LFB A;  2EH3 A;  1BJZ A;  3C2B A;  2E2I J;  5F08 A;  4IHV A;  5E3M A;  2K9S A;  3BR3 A;  2LY9 A;  5JLX A;  2NOG A;  4QSH A;  3HOY J;  1VF9 A;  1U8B A;  4BBS J;  3GTG J;  1OJL A;  3S16 J;  2DA6 A;  2XGD A;  4I76 A;  1FIP A;  4M3B A;  1IV6 A;  4A3F J;  2GLO A;  1FTZ A;  1H89 C;  5FKN A;  3S1R J;  4M3D A;  3IH3 A;  4JX4 A;  1IJW C;  5EF6 A;  2RAE A;  2JK3 A;  1GDT A;  3GTM J;  4JYK A;  2R92 J;  3SDG A;  1JT0 A;  1GUU A;  2X48 A;  3M3Y J;  3OOU A;  3TW7 A;  3PO3 J;  3RZD J;  3BR0 A;  1TWF J;  2FQ4 A;  1WCM J;  2M2E A;  1JUS A;  1MBG A;  1PUF B;  1UHS A;  5GPA A;  1QVT A;  2NS7 A;  3RKQ A;  5M5X J;  3WHC A;  3NAU A;  2GBY A;  3GTK J;  3S2H J;  5J1R A;  2MW8 A;  3GBG A;  2DTZ A;  1FEX A;  5C4J J;  2XGC A;  2KT0 A;  1ITY A;  1FTT A;  3G1M A;  2NVY J;  3PO2 J;  3BTI A;  1Y1V J;  2P81 A;  2YS9 A;  1UMQ A;  3IH2 A;  2NS8 A;  4JX6 A;  4A3D J;  3BTJ A;  4MO7 A;  1RET A;  1AHD P;  3OSG A;  1WI3 A;  4RDU A;  4NDL A;  3A02 A;  4Y52 J;  1JT6 A;  4Y7N J;  4A3E J;  3HOZ J;  1ETY A;  2VKE A;  2R5Y A;  3RZO J;  1HOM A;  1B8I A;  1HCR A;  1EF4 A;  4QTR A;  1LFU P;  1JKP C;  4MLO A;  4C2M J;  3LSJ A;  1SFO J;  2XPW A;  1GT0 C;  1SAN A;  1A5J A;  4CYC B;  5C3E J;  4A69 C;  2EZH A;  4CYC A;  2WB1 N;  3BTC A;  1CQT A;  5FLM J;  2M9H A;  5DS9 A;  3S14 J;  1NTC A;  2EZL A;  3NAR A;  4XRS G;  5M3F J;  1JUM A;  1ENH A;  2EQR A;  2JJ7 A;  2HXO A;  4B1R A;  2LVS A;  2N8G A;  1ETX A;  4MFE A;  5M5Y J;  1YRN A;  3HKZ N;  2HQ5 A;  2HYJ A;  3VPR A;  3HEF A;  3FK7 A;  1MH3 A;  5F04 A;  4C3J J;  3HGY A;  2HI3 A;  5BNG A;  1E3O C;  3LNQ A;  5K7Z A;  3L1P A;  3FKI J;  3DEW A;  1ZKG A;  4HNV A;  2XRL A;  5EGO B;  2LKX A;  3CQZ J;  3A01 A;  5EZG A;  1APL C;  3TW6 A;  1MSE C;  3BQZ A;  2VPR A;  1LE8 A;  2XGE A;  1JUP A;  1JKQ C;  1ETQ A;  1MBF A;  5EGO A;  4B3A A;  4XRM A;  2DMQ A;  5IYD J;  2L9R A;  1MBH A;  5IPA A;  1NK2 P;  5F0F A;  5C4X J;  1ZK8 A;  1WPK A;  4W1U A;  2R7Z J;  1MBE A;  4L5E A;  1VFC A;  2ME0 A;  2TCT A;  1POG A;  5E3L A;  1HDP A;  3A03 A;  3W6V A;  2NVT J;  1X2M A;  2TRT A;  5FKO A;  1I50 J;  2DMP A;  2L0K A;  2YUS A;  4B4C A;  1FJL A;  3HM5 A;  3JRE A;  3LSR A;  3S1N J;  1W0T A;  1OFC X;  2O8K A;  4BKX A;  4DZJ A;  2LR8 A;  2OF7 A;  1WGX A;  4DW6 A;  4BY7 J;  1QVU A;  5J1Y A;  5EG0 B;  3ZQL A;  1TWA J;  2E2J J;  1I6H J;  5EG0 A;  2R0Q C;  1MBJ A;  3Q0V A;  5F0C A;  1X2N A;  3ZQH A;  2QCO A;  1Y1W J;  2O9L A;  2LK2 A;  2DA7 A;  1IUF A;  4AUX A;  1RPW A;  2HXI A;  1G2H A;  5DTD A;  2XPV A;  3B6A A;  3S2D J;  2LLK A;  2CRG A;  3F0C A;  1OCT C;  1BW5 A;  1JJ6 C;  1MNM C;  5EEA A;  4A3J J;  4A3M J;  1Z0X A;  1ZQ3 P;  2CQQ A;  2EZI A;  2DN0 A;  2YU9 J;  5GPC A;  1ETV A;  3WHB A;  1GV2 A;  1FIA A;  2K9Q A;  3BT9 A;  1ZGW A;  4IHW A;  5IP9 J;  1T33 A;  1TWH J;  3JRF A;  1TWC J;  5IYB J;  4C3H J;  2DMU A;  1T56 A;  5E3N A;  1RES A;  3BG3 A;  2XSD C;  2NVQ J;  5IYC J;  2O7O A;  1RR7 A;  2CJJ A;  1HF0 A;  2NVX J;  2JA8 J;  3GTP J;  3HGG A;  1LFB A;  2R5Y B;  4D5F A;  1B72 A;  3BR5 A;  1B8I B;  1AKH A;  3BQY A;  2WV1 A;  3JRA A;  5M5W J;  2LTP A;  5IOZ A;  4D7M A;  5FKM A;  1X58 A;  2VKV A;  3O8G A;  4X1E A;  1W0U A;  1ZR2 A;  5FLV A;  2MGQ A;  1DU6 A;  4X6A J;  3Q3S A;  3BG5 A;  2G0E A;  1F36 A;  2JA5 J;  1JGG A;  5J3L A;  1YRN B;  2E2H J;  3MKL A;  3Q0U A;  5JLW A;  1QPI A;  4BXX J;  1GVD A;  2M0C A;  4IHY A;  2M34 A;  3TED A;  4A3L J;  3HBL A;  1U9N A;  1K61 A;  5IOY A;  4M3F A;  1AU7 A;  1I3Q J;  3ZQF A;  2Y9Z A;  4JX5 A;  3ZOB A;  2R5Z A;  1ETW A;  2E1O A;  3GTQ J;  4JP0 A;  3TP3 A;  3A01 B;  4IEJ A;  1P7I A;  4XRS A;  3CCY A;  2XB0 X;  3QPS A;  3HOW J;  1ETK A;  4FE4 A;  2X9D A;  1LE8 B;  5M3M J;  2PMZ N;  4DYC A;  3TP0 A;  4UUT A;  5K7F A;  1H88 C;  2LP0 A;  3JRD A;  5FKK A;  3GTJ J;  2L7F P;  2D5V A;  3JRC A;  3HOV J;  2FX0 A;  1TWG J;  2IAI A;  2ELK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...