1HDPA

Solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
RRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a POU-specific homeodomain: 3D-NMR studies of human B-cell transcription factor Oct-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords OCT-2 POU HOMEODOMAIN
total genus 15
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hdpA00
1ETXA 1ETQA 3GTJJ 2HXOA 2ELKA 1APLC 4A3GJ 3L1PA 2XSDC 3ZQHA 3Q0WA 4FE4A 3OSFA 3K7AJ 4M6VA 3QPSA 3ZQFA 1FEXA 3Q0UA 1JT6A 5EDNA 3GBGA 4B4CA 2LFBA 2LY9A 5EGOB 1X2NA 5GPAA 3JRAA 4DW6A 4M3GA 3BTJA 3GTLJ 3S15J 3I4NJ 4DZJA 3SFIA 1I3QJ 4A3BJ 5GPCA 3S1NJ 2K9QA 2JJ7A 2DA5A 1JKPC 2DMUA 3PM1A 3BTIA 1HCRA 1GV5A 3G1LA 4B1RA 2Y9ZA 2EZKA 1DU0A 1MNMC 3VPRA 3IH3A 3WHCA 5M5WJ 4V2FA 1ZTRA 1OFCX 2G0EA 2L7ZA 1RKWA 1NTCA 4DYRA 2NVTJ 3A01B 1ETYA 1JGGA 3HOZJ 1ETWA 1WCMJ 1TWGJ 2ZB9A 4J19A 4A3MJ 2M0CA 2YUSA 3BR6A 1GDTA 3HOYJ 3HOUJ 2K9SA 4FISA 1MBJA 1JKQC 2W48A 1TC3C 2YS9A 2KDZA 1MBGA 2E2IJ 5J1RA 1K83J 2L0KA 3HGYA 1BJZA 4I6ZA 5F0HA 2XPVA 4AC0A 1HDPA 4JP0A 2HI3A 3RKQA 3GTOJ 4V2GA 5E3MA 5IYDJ 4A3KJ 2L7FP 1TWAJ 5IP9J 4GFBA 2O8KA 1HF0A 1MH3A 1JKRC 3QQAA 3CQZJ 4Y7NJ 4S0HB 1Z77A 1P7JA 5E3LA 1U78A 2MG4A 4A3EJ 1OCPA 3S1MJ 2O9LA 2VUMJ 3E7LA 3HM5A 4A3JJ 2K40A 4MIMA 4W97A 1T33A 1GV2A 3MVPA 2E2HJ 1VNDA 3H0GJ 1LFUP 3GTQJ 1I6HJ 3CMYA 3LSRA 2DMPA 4D7NA 1ZR4A 1PUFA 1W0TA 3BT9A 1T56A 1AKHA 3S16J 4M3DA 1RPWA 5C44J 2JN6A 4C3IJ 1VI0A 2LTPA 2Y0SN 1LE8A 1DU6A 3OOUA 1JUMA 2E19A 2HOSA 4IHVA 1K61A 1Q1VA 4XIDA 1SANA 1Y1WJ 1H88C 5JLWA 3JRHA 2CQQA 1F36A 4DYQA 2JA5J 2XB5A 3TEDA 3TW6A 4M3EA 1ETVA 2ECCA 2ID3A 3G1MA 3QPLA 1YRNB 5FLVA 3IH2A 3SDGA 5BNGA 5M3MJ 4LOCA 2NVYJ 3BR0A 2CJJA 3JRBA 3S1RJ 4A3FJ 3GTMJ 2XB0X 5C4XJ 1MSEC 4NDLA 1ZGWA 4MFEA 2X48A 1XC5A 4I76A 1MSFC 2ECBA 1WH5A 5IP7J 1WH7A 1JTYA 3BR2A 1IC8A 4BXXJ 1UG2A 2HOAA 4FTHA 4QTRA 3CCYA 1AHDP 2OF7A 5DS9A 4QSHA 5FKNA 3NARA 1H8AC 2AHQA 2RAEA 5J1YA 3FISA 4JYKA 4JX5A 3A01A 1B8IB 2GM4A 3H3VK 3TW7A 2VKEA 3JRIA 1PUFB 5M5YJ 2FJ1A 1NK2P 3LNQA 3HEFA 5EG0A 4A3LJ 3LSPA 3LSGA 4AYBN 3B6CA 1XG1A 1QVTA 3JRFA 1SFOJ 2JA6J 4BY1J 2DA3A 4UUTA 2CUEA 1ZR2A 3JRCA 2HQ5A 3HBLA 4QIWN 1UMQA 1MBHA 3Q0VA 1IDZA 1YRNA 5JLXA 1IRZA 2LD5A 2EBIA 5EF6A 3LSJA 2TRTA 4W1UA 3TP0A 2AO9A 5K7FA 3FK6A 3BG3A 4IHWA 4JX4A 2M34A 3IH4A 2CUFA 5K7HA 2K9NA 1IG7A 2QCOA 3M4OJ 5HODA 1MBEA 2KT0A 3BR5A 2CU7A 3BR1A 4XRSA 2DA1A 4A3DJ 3ZOBA 1A6IA 5K7ZA 2OPTA 1ITYA 5F0CA 4B3AA 2XRLA 2D5VA 2X9DA 3TP3A 4D7MA 1MBKA 4XK4A 2FQ4A 4ABZA 3BR3A 4D5CA 2H8RA 1B72B 1QPIA 2EZHA 5FKKA 1GT0C 5C4JJ 1IGNA 3BG5A 5M3FJ 3ZQCA 4BKXA 4FCYA 1S7EA 4C3HJ 2EZIA 2VKVA 3MKLA 2COBA 5DTDA 3HDDA 5F08A 1U9OA 1GUUA 2GBYA 5IYBJ 1IJWC 3S17J 3WHBA 2LLKA 3RZOJ 5EZGA 1RR7A 4IHXA 2HYJA 2E2JJ 1FTTA 4MLOA 1BA5A 3OIOA 5FKOA 1GVDA 1ZK8A 3JRGA 2YU9J 2DA6A 2NVQJ 4CYCA 2DJNA 2WB1N 2R7ZJ 2M9HA 3NAUA 3BTLA 4C3JJ 1JJ6C 2JWTA 2NS8A 4EEFG 2Y30A 3GTGJ 4RBOA 3HKZN 1WI3A 3FIWA 1ZQ3P 1W0UA 2WAQN 1HDDC 4IHYA 2O7OA 2NVXJ 2E1OA 3BQYA 2XPWA 3GTKJ 3FK7A 3C2BA 3PO3J 2M2EA 1JTXA 3B6AA 4MO7A 1LE8B 2XGCA 1FIAA 1A5JA 1TWCJ 2Y9YA 2NOGA 2HXIA 1VF9A 1Y1VJ 3DEWA 4A93J 1O4XA 5F0FA 3JREA 4RDUA 1EF4A 4BBRJ 3K2AA 2JMWA 5GP9A 3S2HJ 2FX0A 2L9RA 4G12A 2DMTA 1X2MA 1RKTA 5EGOA 2MSYA 5E3OA 5EEAA 3D1NI 2LR8A 3DCFA 2HDDA 5IPAA 2CRGA 1WPKA 2R5YB 2IAIA 1FTZA 2IEKA 1JJ8C 2B63J 2JA7J 2ME6A 1RETA 1I50J 2VI6A 3BTCA 5F27A 3Q3SA 2WV1A 2I10A 1R9TJ 3HOWJ 1FIPA 5J3LA 3PO2J 2DN0A 1AU7A 2XGDA 5IOYA 5EG0B 1IUFA 1BW5A 4A69C 2JA8J 1IDYA 4AUXA 5IOZA 1H89C 2R5ZA 3SJMA 1OCTC 1VFCA 2L7MP 4XRSG 4BBSJ 3G1OA 4X1EA 1AKHB 5FKLA 1Z0XA 2R0QC 1FJLA 1CQTA 2EZLA 2EH3A 4FE7A 3S2DJ 4Y52J 2DA2A 2Y2ZA 1BL0A 2QF7A 3UKGA 1JKOC 2R93J 1ETKA 2R5YA 1U9NA 5EYRA 1RESA 2DA7A 1F43A 4JX6A 4UUSA 3OSGA 3MN2A 5FKMA 2LP0A 2VPRA 5EZHA 2XGEA 1U8BA 5FLMJ 3ZQGA 4M3BA 4D5FA 1G2HA 1UHSA 1TWHJ 4MFDA 5J1UA 5FJ8J 4XICA 1HOMA 2IBDA 1BW6A 3BG9A 3HB9A 2DMQA 4HNVA 2R5ZB 3ZQIA 4M3FA 4DYCA 3M3YJ 3A02A 2MW8A 2DTZA 5M5XJ 3IV5A 5E3NA 2P81A 1TWFJ 1HLVA 1JT0A 9ANTA 3A03A 4A3IJ 1ORKA 1NK3P 1X58A 4BY7J 1D5YA 3JR9A 2ME0A 4C2MJ 2R92J 2HOTA 5F1JA 1E3OC 2MGQA 5IP6A 2LKXA 2TCTA 3O8HA 3RZDJ 2FD5A 3FKIJ 3O8GA 3GTPJ 3JRDA 2NS7A 4IEJA 1JUSA 2X6OA 2XPUA 4UUSB 1POGA 3HOXJ 1ETOA 4CYCB 2ID6A 2H1KA 2DMNA 3LOCA 1ENHA 2LVSA 4A3CJ 1QRYA 1WGXA 1LFBA 2Y31A 5C3EJ 2CQXA 3S1QJ 2N8GA 3W6VA 2LK2A 2JK3A 2GLOA 3HOVJ 5IYCJ 1QVUA 4X6AJ 1ZKGA 1JUPA 1XS9A 3HGGA 5F04A 3I4MJ 3ZQLA 2EQRA 2DA4A 1OJLA 1MH4A 4L5EA 1MBFA 3F0CA 4DZPA 3CDLA 1B8IA 1P7IA 1IV6A 3RQIA 3S14J 2M8GX 2PMZN 1B72A 4XRMA 3BQZA
chains in the Genus database with same CATH superfamily
1MMSA 3GTJJ 2ZMEB 3GFLA 4A3GJ 1NH3A 3L1PA 2XSDC 4ESBA 3OSFA 1VQOI 2A61A 2A68F 3PNTA 3U9GA 4XN0A 3FKJA 1XPXA 3KE2A 3Q0UA 2QM3A 3FF5A 3I71A 1IF1A 1KU7A 1B9MA 3M9AA 4XQFA 1DP3A 5D6FA 4F52A 5EGOB 3RJPA 4YFXF 3HHHA 1TTYA 2B0LA 3GTLJ 1XGNA 3F3XA 1W5CC 1BOAA 4GYIA 4DZJA 4U7DA 4A3BJ 4IRHA 5GPCA 3S1NJ 1JKPC 1GV5A 1X19A 3G1LA 4PJJA 1BOBA 3K6GA 1DU0A 1XCBA 3VPRA 2M4KA 5M5WJ 4OWRB 1OFCX 2G0EA 3SDBA 3WTVC 3CCUI 2ZFWA 5TJJA 1YIOA 5D6EA 2NVTJ 3A01B 3W3CA 1ULYA 4HSRA 1JGGA 3U1DA 1ETWA 2VQLA 1WJFA 3T8RA 2ZB9A 3RKWA 4ZZDA 3F8CA 1MW7A 2E1MB 3HOUJ 5HLHA 5FLXK 1MBJA 1A31A 5FRNA 1UJ8A 3K4NA 4CUGA 4OAYA 1VQKI 4BGDA 2IS1A 2PMZA 5J1RA 1K83J 2L0KA 4IOCF 4GO1A 3QOEA 1QPMA 2EIKH 2DFHA 2PMUA 5DCMA 4AC0A 2NS0A 2XF5A 3EUHC 1K4TA 1HDPA 3H0DA 5ICCA 1TBXA 4H4KC 3GTOJ 4XLHA 3FM5A 4KJZA 5IYDJ 4DBRA 2L7FP 1MDMA 4AIHA 2BY1A 5IP9J 2IA1A 1WFXA 3BJAA 1I6XA 3OS0A 4FT8A 3PQJA 4BE2A 2OC6A 1Z77A 3VSKA 4R79A 1U78A 3E5UA 3S1MJ 2Z33A 1ZG5A 1Y0NA 4PSXA 4EJVA 3WGGA 5K5OA 5H6RA 4MIMA 4O6JA 2P6TA 4LIVA 4G7ZF 1U8RA 1VNDA 1WVRA 3H0GJ 2KIMA 4XL9A 4OIPF 5HNHA 2ZXJA 2ACJA 1LFUP 3H9GA 2WBMA 3LSRA 1O3RA 3OYGA 2HTSA 3J80K 2BXYA 1ZH5A 3U1KA 3BT9A 3BY6A 1T56A 4RLQA 1W1WE 4HDUA 4AVZA 3DPTA 2V1NA 3ZXSA 5C44J 1EH8A 3ABUA 1ZLKA 1KONA 3T0YA 1LE8A 3KZZA 1PYVA 1K61A 1K7AA 3IKVA 3MKYB 4EGYA 3HSFA 2QUFA 2CQQA 2JA5J 3TEDA 2DOFA 2YR2A 2ECCA 5AIPA 2K27A 3QPLA 1YRNB 4KT6A 2ISZA 4DOZA 5J4VA 1HKQA 5M3MJ 2QSFX 3KZYA 1WKMA 5HDNA 1DPUA 5D4SA 4C2TA 2CJJA 4AIDA 2V1XA 4RGSA 4B43A 5C4XJ 1KYWA 3DBRB 3OYCA 3KX2A 4NDLA 2PJRB 1UFMA 1A6QA 2FSWA 3TO6A 1X3UA 2CW7A 1WH5A 3OYIA 1WH7A 5H2FC 2DXIA 4HRIA 2WY7Q 3D5RC 1CF7A 4EJWA 4BXXJ 1UG2A 3WG9A 1R5GA 3OMYA 5L3DA 3CCYA 4QTRA 2BGCA 1SAUA 4BQNA 1Z21A 1XD7A 2RAEA 5HLTA 3FISA 3QP5A 4G7HF 5LD2C 4CCJA 2OV7A 4F55A 2FA5A 3OYKA 2NVUB 3JRIA 1PUFB 4ZDOA 2DK8A 2VC0A 4I98B 1UCRA 3ECHA 3LSPA 3LSGA 4AYBN 1IXRC 4BJTA 5ERIA 2PMHA 3JRFA 3AL0B 3DF8A 2CUEA 1V54H 4R8HA 3MZHA 4XSXF 2V9VA 1LJ9A 4A5MA 2HQ5A 4I01A 4QIWN 1TNTA 4ENNA 1UMQA 2LF8A 1YRNA 2R7FA 4G6QA 4KFCA 2EPFA 3GZ6A 4JK1X 4UV9A 4PJMA 3TP0A 1YJNI 3BG3A 4IHWA 2KRHA 1D1CA 4EVIA 1X1AA 2KHMA 4JX4A 4NQWB 3C1DA 3C7JA 1R5HA 1P9QC 2K5CA 3J81K 1LEBA 3WGHA 1R4NB 1Y56A 2Q0OA 4ZYAA 1MBEA 4BNCA 1T08B 4BE0A 2OTLI 2VIXA 4L5JA 3HSRA 2OPTA 2TDXA 2X1DA 4B3AA 3GMEA 4E7ZA 3CF5F 1LDDA 4PSWA 5TISC 3P9KA 4CH7A 2VODA 3QRFF 1NHAA 3HUGB 2F4MB 1X1BA 2VB6A 4D5CA 4IZZA 2Z3YA 2Y0MA 3WGIA 1VTNC 2VPLA 2K3PA 2QQAA 2ZMEA 3DP7A 1L3LA 2DYSH 2GA2A 2RVCA 4IVNA 1WHUA 2NNYA 5FRMA 2ELHA 4HA8A 3KPHA 4P9UA 1E3HA 4AD9A 2EZIA 2V9KA 3ML6A 2COBA 4M9XA 1USSA 5DTDA 3L09A 5F08A 1U9OA 3V7CA 4L9VA 3K9TA 4HV6A 5IYBJ 3X2QH 2R7SA 3WHBA 2QKLB 3LA2A 5D8LB 3CCMI 2ZCWA 2A5WA 2EFQA 5BMZA 1T98A 1RR7A 1N75A 2OUMA 2RQPA 3K4CA 1QQIA 3M8EA 3CCEI 4P1WA 4LLNA 1E0EA 1N25A 5FKOA 1GVDA 4DQ2A 5J4YA 3IWZA 1YS7A 4HZFA 1BI1A 4F7ZA 3AG1H 1F9NA 5DUKA 3TL4X 4MQ9F 3RKYA 4XR6A 4RBOA 3K4BA 3E6DA 1M1EB 1WI3A 2BHYA 3P9CA 1PVEA 1KYZA 2V7FA 1DGWY 2DDAA 2FMLA 5HDGA 2MBFA 2MH9A 3WU1B 4C2UA 4IHYA 3HPGA 2VASA 3UNGC 2I5UA 3PO3J 2D1VA 2M2EA 1JTXA 3B6AA 1Z05A 4MO7A 1VQPI 5LRRA 2STTA 1U0JA 1O7LA 5J47A 1YW9A 2GA1A 3DPUA 4RAGA 1AWCA 4HYEA 1U2WA 1LEAA 3LL7A 5F64A 3CMAI 4LK1F 1MMGA 3HG9A 4II3A 4Q5SF 2BXZA 1FNNA 1EKEA 2E7WA 1TNSA 4BXUA 1L0OC 1DQUA 3JREA 1EF4A 3QU6A 3K2AA 2P7CB 2MH2A 3C2HA 5GP9A 4ZYEA 3J7AO 3S2HJ 3FXKA 2L9RA 4HBLA 2W7NA 1RKTA 1YG2A 5EGOA 2MSYA 1UAAA 1IN5A 2M7AA 2Q8KA 4HW0A 4ESFA 4P9FA 2DFFA 5FO5A 1IN4A 1SFXA 1EV7A 2OD5A 3PIPF 2BYVE 4FHTA 3I5UA 3Q3SA 1STZA 5F6FA 5H6QA 3K0LA 4Y3OA 2A5YB 1J5YA 2ISYA 4ETSA 3HOWJ 5J3LA 3KFWX 1NG7A 2XGDA 5DCFA 4CCNA 1YLFA 3F72A 1YTYA 3FM3A 1JXSA 4U88A 1HW5A 2V1UA 1MZBA 2Z5UA 1BJAA 4CCLA 1Y39A 2HVQA 2HZDA 4A69C 3ERED 2JA8J 1IDYA 1UZCA 5IOZA 3DTEA 2DCEA 4KNYA 2J5PA 3G73A 4R1HA 2Q1ZB 2P0WA 3J81Z 1SC7A 3M1CA 4BBSJ 3I56I 4OOIA 3G1OA 3GX4X 1YO5C 1T95A 3F23A 3V4GA 2HTJA 1PJRA 2K7LA 3FXUA 1V55H 5GAHJ 2HU9A 2VQHA 2EZLA 1IN6A 1QNTA 2RV8A 3SEZA 3ZGKA 4II2A 1BM9A 4J00A 1F1ZA 3NWTA 3UKGA 1JKOC 1ETKA 2BY3A 3KP7A 1UHMA 2DI3A 4RAFA 1FP2A 4EMSA 4UUSA 3OSGA 1XX5A 2VXDA 5KCMA 4CXFA 4MQVA 3K4JA 4P5OA 3CO7C 1XB4A 1FZPB 2BE5F 2XGEA 3WTXC 1YS6A 3F9KA 2L4AA 5GTHC 1LFPA 4M3BA 1G8XA 4WXHA 2QYOA 1H0MA 5BQTA 1R1UA 3NRVA 1HOMA 2IGKA 5B3SH 1BW6A 3K1MA 4HNVA 4ZTFA 1K4SA 2A07F 3HOSA 4IF4A 2XHKA 1D5VA 5FD6A 5E3NA 1JT0A 4M71A 3T5XA 4M6YA 3D5SC 2CO5A 4A3IJ 1ORKA 3P7NA 3QPHA 2L54A 2GWRA 3LA7A 3JR9A 2QVOA 3G71I 2R92J 4NBQA 3CJRB 1QBJA 1R4MB 4XOTA 4BQQA 3FMRA 5FROA 4IHTA 2IGOA 3RZDJ 2CSOA 1RI7A 3O8GA 3DXJF 2M30A 4DBQA 2VXZA 3PFIA 1ZRCA 3F6OA 4UUSB 3K69A 2O5RA 3ZP5A 2PEXA 6PAXA 2LVSA 4LFUA 2ETHA 1BC7C 1IRFA 4G94A 2KKOA 1SAXA 5E8GA 3S1QJ 2ZBKA 3RCOA 1FLIA 2LK2A 1XGOA 1XSXA 1AA7A 2FRHA 4YIRX 5IYCJ 3MFKA 4KIBA 1YJWI 4BEHA 4N9IA 3TO7A 3HL2A 3I4MJ 2G9WA 2HYGD 2D2WA 2EQRA 4DZPA 5KVRA 3WTSC 2AXTC 3K4KA 1B8IA 4J01A 3ASNH 1P7IA 4I09A 4XRMA 3DLAA 3I3LA 3ZPLA 5LHGA 3WE3A 2R7VA 1HW2A 1APLC 2BY2A 1V5EA 1RUNA 5LGUA 1U5TA 2R7UA 1E17A 3KLOA 3ZQHA 3Q0WA 3K7AJ 3CCQI 2MA3A 2H09A 3QPSA 3CESA 4E70A 1MJ9A 3K4LA 4E7KA 4EGZA 1H9TA 1JT6A 5EDNA 1X4OA 3HIFA 3KETA 3HC7A 3TOBA 2LFBA 3W6JB 3ZR8X 3PL8A 5D5UB 2VE9A 2EFWA 3CZ6A 2VQGA 1Z6RA 4M3GA 1EH6A 2KQRA 4KN7X 1IXSB 2JSPA 4B44A 3S15J 3J7YJ 5IT9K 1KU3A 2M7BA 1WJAA 5HLIA 2K9QA 2DA5A 2DMUA 2X51A 3I55I 5CPRB 1HW1A 2X6YA 3IH3A 4V2FA 1C0WA 1ZTRA 2KIUA 1DPRA 2L7ZA 1RKWA 4ZC3A 1NTCA 1R23A 4DYRA 1T0FC 3RIRA 2HPMA 1ETYA 2V6CA 2DO7A 3CD6I 1FBQA 3O2PE 3HOZJ 1WJCA 2LYCA 5E17F 3WTYC 4HX4A 2IGNA 2YUSA 2M8EA 2WAQA 2K9SA 2I8DA 3ZMZA 3NQOA 1G3YA 1JKQC 2MFZA 2LKPA 2KDZA 4XSZF 1IN7A 2YSRA 1W7PD 1PP8F 1FP1D 1QHGA 1ZELA 3HGYA 3EETA 1H9GA 2L7KA 1EH7A 1D0ZA 2XAGA 3AG3H 1TW2A 4ZDLA 1BJZA 1EA3A 1LUJB 4OINF 4AWXB 5ICGA 4QLCU 4I6ZA 2Z9OA 4CCKA 3AG4H 2HI3A 3G3ZA 3J7AY 2CH0A 3IHUA 1WJ5A 4V2GA 4UVCA 3CF2A 1B9NA 3K1PA 1U3EM 1Y0UA 4GFBA 4CZCA 1SD6A 1HF0A 5E1XA 4E4HA 3G6EI 1BC8C 3R0AA 1IAWA 5ILVA 4XKBA 2L9NA 2VKHA 3EUHA 5B1AH 4S0HB 4KA4A 4PUSA 5FFZA 2DLLA 5E3LA 1TL8A 2EJRA 2EFPA 4A3EJ 4BS9A 2JRTA 4NC6A 2NAZA 3V8JA 1GV2A 3SXYA 1I27A 3OIQA 5FB2A 4IOAF 2Q2EA 5E1ZB 5BPDA 2ZNZA 3ZQQA 1XCVA 3CMYA 4BL0B 2O6GE 4CCMA 1PUFA 2EIMH 2AS5F 1SFUA 3FXRA 2R3SA 2JN6A 4EM0B 3CCLI 2LTPA 1JUMA 2UXNA 3KP5A 3AAFA 3DFGA 3WU2C 4GXOA 4PDKA 2V1DA 1X4PA 4E7HA 4GCVA 3VYRB 3WTWC 3TW6A 4IRGA 4UV8A 3G1MA 5E8IA 1LKXA 3E97A 3SEQA 5FLVA 2G7UA 3IH2A 4LIUA 3MZ8A 4A2UA 2KPMA 4RGUA 1WRJA 1D0YA 1RNLA 4HAMA 4YFNF 3BR0A 4ZYDA 2GOXB 4A3FJ 2XB0X 5GAEJ 2XV4S 4OAZA 3BCBA 4AIKA 3BPXA 1ZGWA 4JOMA 3AG2H 4G9YA 3BR2A 2PI0A 1TQIA 4M73A 3KCCA 4FTHA 4ON0A 2ELJA 2ZNYA 1ZREA 5DS9A 1LB2A 2Q2EB 3L00A 3M7GA 3E5QA 1YOVB 4JX5A 3A01A 2GM4A 2Y75A 1DUXC 5M5YJ 4HNTA 4HF0A 1NK2P 2LF7A 2ZSHB 3HRMA 3UR3C 3CP8A 4LJZF 1QVTA 3DTIA 1SFOJ 4BY1J 2K4JA 2P5LC 2DA3A 1MNEA 4E7SA 1MJBA 5CKTA 1ZR2A 3O6BB 4CA0A 1ZRDA 3HBLA 3WU0A 3PNYA 1X1PA 3Q0VA 4DGWB 1IDZA 1HQCA 3GUDA 5JLXA 3MQ0A 4IKFA 2ZXWH 1QO0D 5EF6A 1TQPA 2LMDA 4ZZLA 3JTGA 4HF1A 3HRSA 2QBYB 4IPAA 1S72I 3IH4A 2CUFA 2K9NA 1MDMB 1IG7A 2KIQA 2ZO4A 2FNPA 3M4OJ 1GHCA 2AXLA 2KL4A 2BEOA 3Q9SA 1HBXG 3LAJA 1BIAA 2CU7A 3BR1A 2KZGA 4XRSA 1J0RA 2MYSA 5CVUA 3DBHB 2VONA 2XC7A 3J80Z 2QQ9A 3PSFA 3DV8A 4XK4A 2FQ4A 4ABZA 3EDPA 3BR3A 2VL8A 5E79C 4D1QA 3E0JB 2RNGA 4B3XA 2EZHA 5J40A 2OBPA 3REOA 4BHBA 4NUBA 1DGRM 4PJ0C 5C4JJ 3H9QA 1SMTA 3KP2A 1IGNA 1GXQA 2WWYA 3ZQCA 3E5XA 4C3HJ 5EEGA 1K6YA 3ABLH 1U5TB 2GBYA 3U21A 2VQCA 1WJDA 3HYIA 3R0JA 2DPUA 3S17J 1G59A 1OCRH 4BUPA 3AL0C 5LLQA 2LBFB 3VYSB 2X6WA 3VSLA 3RZOJ 3CMMA 1P92A 5HS9A 2K02A 2DQRA 3SFZA 2JSCA 3OYDA 3QOPA 1R71A 1XDSA 1ZK8A 2JUGA 4DNCA 1Z6TA 3BJOA 3KYCB 2DA6A 2NVQJ 2F2EA 3ROUA 3KP4A 2DJNA 4BYYA 1FY7A 4BXFA 4CYCA 1FOYA 3GZNB 1X3WB 3NAUA 3BTLA 1WZ2A 3H5AA 3SZTA 2NS8A 3OYEA 1AOYA 3LSMA 2JRMA 2JVHA 2HDCA 3GTGJ 2X4HA 4XM3A 2QENA 3HKZN 3FIWA 1ZQ3P 3I59B 1W0UA 3IRRA 4HPQA 1KA8A 1O3QA 2M5WA 1HDDC 3OWTA 1S7OA 3MZYA 2XF6A 2O7OA 2GQQA 1R5ID 3GF2A 2CQ7A 4L9JA 4RGRA 3SYTA 3GTKJ 3C2BA 4OIQF 4MTDA 3S2WA 2QGUA 2LC2A 2XGCA 3PUBA 1FIAA 3DEUA 4LD5A 1FOWA 2Y9YA 2ZXHA 1SD4A 2X1EA 3H36A 1Y1VJ 4TV7A 2FOWA 2LKSA 1D0XA 3DEWA 4GRIA 1ODDA 1VQ4I 3RQ4A 4RDUA 2JMWA 2K85A 2W85A 3K4MA 1O3TA 2IS6A 3DLLF 2CUJA 3RKXA 3S3NA 2EA4A 4S05A 5E3OA 5EEAA 2R7XA 4BJ6C 2HDDA 2GXBA 2CRGA 1XN7A 4NHJA 2IAIA 4RB2C 2IEKA 3PJRA 1JJ8C 2ME6A 1RETA 2XDVA 2CS3A 3I59A 2F5DA 3OYAA 2P5VA 2H94A 1A35A 3NEUA 1FIPA 1AU7A 1R6RA 4MGRA 1SEUA 3CC7I 1V5FA 5IOYA 5CVRA 2HZTA 1IUFA 1YX3A 2AQEA 3A0HC 5GADJ 2MABA 4A6DA 2PQ8A 2DAOA 4L5IA 2R5ZA 2VT2A 3BC8A 2CFXA 1O3SA 1ZLJA 4E7IA 3GFMA 2L7MP 2K3FA 4Q4ZF 3SQNA 2Y48A 1BR4A 2MC3A 2R7DA 4F92B 2R0QC 1GLNA 3W2AA 2HEOA 3S2DJ 4I7HA 3H1CA 4Y52J 3ABTA 2HOEA 5JHFA 2Y2ZA 3BCAA 4CICA 2QF7A 3BJ6A 4U0YA 1RESA 1P2FA 1F43A 3JCUC 3EUAA 3ECOA 4AM3A 2P5KA 3HRUA 1E3PA 2LP0A 3V7SA 3L2CA 4ENKA 5EZHA 2XF7A 1U8BA 3MWMA 5B66C 3OYNA 2W00A 2LH9A 4D5FA 4I02A 4MFDA 2EK5A 2BV6A 3GLXA 4XICA 2IBDA 5LRSA 3HB9A 2R5ZB 4YG2F 2M1BA 1P4AA 4M3FA 4DYCA 5CVIA 1XSVA 3DU6A 3PIOF 3ZMSA 5DDGA 1FOKA 3CP2A 5JFRA 5IY5H 3DU5A 1BI3A 1WQ2A 1SFEA 2P81A 3K70D 1W5TA 1HLVA 1D8JA 2CG4A 2DODA 4PZJA 1OCCH 5ILSA 1P6RA 1NK3P 1X58A 1YW8A 4AYBA 3OOPA 4G7OF 1VZ0A 1R7JA 3WTUC 1X1DA 2ME0A 4FX4A 2KZVA 5F1JA 1QZEA 1E3OC 5KAFC 3RSNA 5K1YA 5IP6A 3F21A 2TCTA 3O8HA 1LVAA 1VQLI 1FSHA 2JPCA 3FKIJ 2QBYA 1JUSA 1T2KA 2XPUA 3WE2A 2IS4A 3HOXJ 2ID6A 1BN5A 2DMNA 4BACA 3ULQB 1ZARA 2K9MA 2ZSIB 4WXCA 5KNLA 1ON2A 3WTZA 1R22A 4FASD 3RDIA 3HSEA 2Z99A 1D1BA 2JK3A 3QP6A 5AONA 3RPQA 1K79A 5CYVA 4AVPA 2GLOA 4IX7A 3SZGA 4QPOA 4HDVA 1QVUA 3IUOA 5BS6A 1XGMA 4HLYA 1XS9A 5LHHA 4UVBA 3HGGA 5HVQC 1FMVA 1EJ9A 2C6YA 1O7FA 2VE8A 1MH4A 3F0CA 4OU0A 1IN8A 1P4XA 4QPQA 5DD4A 3H3UA 2M8GX 2PMZN 1J2XA 3QAHA 3S3OA 3RPUD 2OJED 3H3ZA 2IT0A 2HXOA 2ELKA 4UHTA 4X0GA 2FU4A 3TGNA 3ZCOA 4FE4A 4MHGA 3BZCA 4M6VA 1D3YA 3QYEA 3ZQFA 2VBXA 1FEXA 1D1AA 3E3VA 3GBGA 3CUQC 3DPLC 3KIOA 4PFOA 2LY9A 4XLCA 3NWSA 4LGWA 5EJCA 4DW6A 4ZYGA 3FXOA 4EATA 3BTJA 2ZXIA 3IAS2 1S8NA 4HF2A 1K78B 2L02A 3BTIA 4OMZA 4GYGA 3OS1A 4IQ4A 2Y9ZA 4B1RA 4KISA 2EZKA 1OCZH 2L9VA 1PP7U 4KT5C 3JW4A 3JAMK 2IGMA 2W84A 1HXDA 2EV6A 1Z7UA 4A12A 2VJJA 1U6GA 1Z91A 3TO9A 2QSGX 4RM2A 5EEHA 1WCMJ 4CHUA 4J19A 2KLOA 4O5VA 2M0CA 1FC3A 3BR6A 4A3MJ 1GDTA 4FISA 3OYBA 1JHHA 4PGGA 2YS9A 3TQNA 1MBGA 2RNJA 1K6OA 3CJNA 1QHHD 1OKRA 1RIOH 2F5FA 1FYMA 4P55A 2XIGA 3S93A 4NC7A 1FPQA 4M72A 4WCGA 1OQYA 2O0YA 4ITVA 1KU9A 2ICWG 4JP0A 3COAC 4ZTJA 4EJTA 2Y69H 3D0SA 4PJNA 3FMSA 5B5EC 1K78A 5L3GA 4LG0A 2O8KA 1ZGJA 1GVJA 2GIVA 5JHUA 5E20A 3RPUA 4U0VA 3KP6A 4ENJA 1VQ9I 3QQAA 3FDYA 2E60A 5BOXA 1P7JA 2AQFA 4FETA 2R7QA 3PFYA 3GCMA 3CTAA 2O9LA 2ADUA 2JZYA 5K5QA 4A3JJ 4Y33A 2K40A 2VOPA 2F4OB 3CCVI 5DM7F 1T33A 1QZYA 1XMKA 3CO6C 4EV0A 4LITA 1Z1DA 3FWEA 2D45A 3GTQJ 4WX9A 4N4OB 1ZR4A 1FYKA 1YE9A 3S8PA 1W0TA 1J75A 4G6DA 5JR3A 4B48A 4M3DA 5HNFA 1MKMA 1R58A 4NNJA 4C3IJ 2OQGA 2Y0SN 4HOBA 3OOUA 2HOSA 4IHVA 1Q1VA 4XIDA 2ZFUA 1SANA 1Y1WJ 1G3TA 5JLWA 4JBAA 4LG3A 3JRHA 1F36A 4DYQA 2XB5A 5IT9Z 2V26A 1ETVA 3H92A 4ZYHA 1R36A 4YEJA 4NB5A 3Q5FA 2Y0SA 1T39A 3I64A 4LOCA 2BHZA 2M3AA 1MMDA 2DOAA 2NVYJ 3VOEA 3GTMJ 3FZVA 4Q48A 3IAM2 1LVKA 4XN3A 3IKTA 3L2QA 1MSEC 1BI0A 3BLYA 4MFEA 1GXPA 1MSFC 3L2WA 2ECBA 5IP7J 2VKDA 2QSHX 1JTYA 4KDPA 1O57A 2KP6A 2VBYA 2VJIA 2Z16A 2HOAA 1S6LA 2IP2A 4OIOF 1TZLA 2OF7A 2NXNB 3WG7H 4QSHA 1WSUA 3OS2A 5FKNA 3W2VA 1H8AC 5J1YA 1IXCA 2NNNA 3LNQA 3HEFA 2HYFA 1ZRFA 5J8CA 3E6MA 1N77A 2UXXA 1XG1A 2CMPA 2HR3A 4CO8A 2VLAA 1REPC 4UUTA 1S9HA 3LQRA 3JRCA 3JAMZ 2FF4A 3LWFA 3F22A 2XSJC 1I5ZA 2DFEA 2BOLA 2EBIA 2O03A 2IVMA 2XAJA 2VT3A 1LDJA 2RREA 4W1UA 2AO9A 3DEEA 4MEXF 4YRVA 4RAYA 3OYHA 2M34A 2ZJRF 3MEXA 2H6BA 5K7HA 2J5OA 3MCZA 4B09A 5DUIA 4O3MA 2GOMA 2P4WA 4KIGA 5HOOA 3M8JA 1JHFA 2FOKA 3PUFA 4E6KG 3BG7A 4CSWA 2E5NA 3R6SA 4Y13A 1Z3XA 2DA1A 4A3DJ 1A6IA 4Y17A 5K7ZA 5F0CA 1ZG1A 1FBSA 3AFHA 4PFPA 2XRLA 3HKZA 4DJAA 3EQLF 1YFHA 3S32A 3V7RA 4D7MA 1MBKA 2W4SA 4BU2A 2G7HA 1BBYA 3QWLA 2H8RA 1YQAA 1IUYA 1FX7A 2HGCA 2LY2A 4WWCA 3L2VA 4BHPA 2JQ7A 1W7PA 1GT0C 2LDUA 1RRJA 5FD5A 3BG5A 5HLGA 1UG0A 3ABKH 2ZJ2A 5M3FJ 2R7OA 1V4RA 4BKXA 4FCYA 4HG2A 2VKVA 3MKLA 1T6SA 3GLLA 4IJAA 5DYMA 1IJWC 4IO9F 1BI2A 5AIQA 4KUMA 1TLHB 1WWXA 1TT0A 4IHXA 1D8KA 3GZ5A 2HKXA 2JT1A 2E2JJ 3HRTA 1YYVA 4BJ5C 2V6EA 2E36A 1LNWA 3I54A 5E18F 1W4MA 1UB9A 2PX9A 5D5XB 1UHWA 4EJOA 5LGTA 2E7XA 1CGPA 2GXAA 2DPDA 2R7ZJ 2VC1A 1X1CA 3JSOA 2GZWA 3K70C 1VQ5I 2JWTA 3IL2A 5LBQA 2IW5A 3VDXA 1IW7F 3RYRA 1B1BA 3PSIA 3FXQA 4M74A 2XAFA 2PN6A 1OPCA 2RC4A 3TMOA 3VEPA 2NVXJ 3HXLA 2E1OA 3BQYA 1OCOH 4BEHB 1QZZA 1IRXA 3OL4A 1SMYF 3FK7A 4H0EA 1V3FA 5CQEA 5L3CA 1LE8B 1QA6A 2M45A 2L5QA 3LQQA 4XLPF 1A5JA 1WI9A 2STWA 1TWCJ 2NOGA 3OL3A 4UUVA 3SHFA 4C9YA 1O4XA 2JVGA 5F0FA 3J7ZI 3HPHA 2LSOA 2PG4A 5TRDA 2WAFA 4LG0B 2EFNA 2FX0A 1G4DA 4G12A 3DWLE 1HKSA 2CW0F 3MKZA 2PLYA 2XROA 3DKWA 1U5TC 4GGGA 3D1NI 2KISA 2LR8A 3DCFA 3WODF 3JTHA 1TT5B 5IPAA 3OY9A 3HZJA 1WPKA 3MAJA 3MMYB 2R5YB 3VODA 3KEOA 1ON1A 3F8MA 4G6TB 5KAIC 4BE1A 3JSPA 5F1RA 5F27A 3ZRGA 2X1CA 2M4GA 2WV1A 2WADA 4IXAA 4IHSA 1R9TJ 2HNHA 2DFIA 1OR7C 2ZC2A 4RMNA 4YIIA 2DN0A 2XKOA 1FMWA 4Z6YA 5EG0B 3P9IA 2ESHA 2PJPA 2HDWA 3KEYA 3VFZA 3OYLA 1RUOA 3GWZA 2HS5A 3SJMA 1OCTC 2YX4A 5DV5A 2IS2A 1S5LC 1SD7A 1XSDA 5ED4A 4XRSG 1Y6IA 4ASNA 3A4CA 2W1OA 2Z1DA 2NYXA 1Z0XA 1FJLA 3EUKL 4M6XA 1CQTA 2H8WA 2RKHA 2FNAA 2EH3A 4I2OA 3OIPA 4U87A 3CUOA 4S04A 3GFIA 1BL0A 1N78A 1TP4A 2R5YA 2COMA 1U9NA 3L9FA 5EYRA 2FEZA 2XASA 2DBBA 2VBZA 1IZ1A 2IA2A 3CCRI 4CZZA 4JX6A 1MJAA 4N4NB 2VPRA 4V19K 4NC8A 2O8XA 3KEQA 3WTTC 1XMXA 2IA0A 4XLFA 2QLZA 1UHSA 1TWHJ 5CQGA 5J1UA 1YW7A 5FJ8J 4GDFA 2FBKA 1FSEA 1XMAA 2YU3A 2Z2SB 2ZMEC 2F6CA 3M3YJ 1ZN2A 3C18A 2WY8Q 1QGPA 5LHIA 4F93B 2DTZA 2HVSA 4M9ZA 3A03A 3K1NA 3A2KA 2BZTA 1UELB 1OYYA 1USTA 4BY7J 1KZHA 4B47A 2RN7A 3L2RA 5FLXZ 2E1NA 3ZMDA 4XORA 2KIFA 5D8KB 4U7BA 2HOTA 2F4IA 1J9IA 2KFDA 2MGQA 3BROA 3LSHA 2BY0A 3JRDA 2UV1A 4IEJA 2X6OA 4B8XA 4LLGF 4RB0A 1POGA 2HFHA 3R4KA 1ETOA 1HA8A 1DDNA 3H5RA 2H1KA 2FBHA 3T8TA 2ZKZA 1G6NA 1WGXA 2WTEA 3HTSB 1LFBA 5C3EJ 3P5JA 2L4MA 2LREA 4HQMA 2CQXA 3FXLA 4XKCA 2E1MC 2EIJH 2HQAA 4LK0F 4K2EA 3HOVJ 2R7WA 1KU2A 1Z7LA 2DJIA 4ZDPA 4X6AJ 1Z3YA 3DKXA 1JUPA 4Y4RA 5H20A 5F04A 4JQFA 4FX0A 5ICFA 3ZQLA 1YI2I 1OJLA 3U2RA 4L5EA 1MBFA 1S3JA 3CDLA 3GYHX 2B9SA 1IV6A 2DU9A 1W36D 1J59A 5ILUA 2P7VB 1ETXA 1ETQA 2OZUA 3QU3A 4A0ZA 3MKWB 3CMEI 4BDYA 1IRGA 1I39A 3G2BA 3LFUA 2EB7A 5FFXA 3KZIC 1RZ4A 2A6TA 1J09A 1T8IA 4PCQA 4KYWA 3BWGA 2H27A 3EYIA 4B4CA 3Q9VA 2V79A 2MD5A 4D0PA 5HS7A 5GTIC 3KYLA 2A6EF 1X2NA 5GPAA 4RB1A 3JRAA 3S3MA 5CLSA 2CV1A 2PFBA 3I53A 3TOAA 3K2ZA 1SVMA 1FOXA 2YX7A 1VQ8I 4KIFA 4OMYA 3I4NJ 3FHNA 3SFIA 1I3QJ 4WF2A 4EM2A 1JE8A 2FQ3A 2JJ7A 2W25A 2KRFA 3A0BC 3PM1A 2JPBA 3IRQA 4Y15A 1FBUA 2VBWA 4HEA2 1HCRA 1MNMC 3WHCA 2M0MA 1VQ7I 2OAZA 3CLOA 3L7WA 1MMAA 5DD8A 3ZQ7A 3W6KB 2CGPA 1MNDA 4UVAA 1Z67A 2P6SA 3GVAA 1TWGJ 5L3EA 1JI8A 2LRDA 3HOYJ 1SD5A 5B1BH 3QODA 3ERMA 2W48A 1TC3C 2BW3A 2DT6A 4I0BA 4BHCA 3FX3A 5KHDA 2E2IJ 1B4AA 3HOTA 3QYBA 1P4WA 3ZN0A 4XRFA 3GEZA 3FBNB 2A6HF 3PQKA 4IL6C 2OZ6A 2XPVA 5F0HA 3KP3A 1FWZA 3FMQA 5GAGJ 3I58A 2WAEA 1KGSA 3RKQA 4NQWA 5E3MA 4A3KJ 1HC8A 5CJ9A 5CVJA 5LEKA 2ESNA 2HQNA 1TWAJ 2UUZA 1A04A 2A05A 2EA2A 1S7AA 1SVOA 2LBFA 1HKTA 1ONVA 4KMFA 1MH3A 3CUQB 4UB6C 1JKRC 2FXAA 3CCJI 3CQZJ 4Y7NJ 2RGVA 1I1SA 2GAUA 2H6CA 2WC2A 2XAQA 3H9JA 3IC7A 4UB8C 3LMMA 2OU2A 4Q47A 2MG4A 3H35A 1OCPA 3OYFA 3V42A 3M1EA 3E7LA 4EJUA 1LPQA 3BP8A 3HM5A 2VUMJ 4I0AA 5TGTA 1R1VA 1OYWA 4W97A 3IWFA 2HWVA 3MVPA 1HSJA 2EILH 2E2HJ 2L2OA 3ZMTA 3CLQA 4PGHA 2W82A 2XGXA 3DTKA 2DT5A 1I6HJ 2OCEA 2DTRA 2DMPA 4D7NA 1JGSA 4N9HA 4BH9A 1LDKB 2EV5A 1AKHA 3S16J 3ESWB 2W57A 5IT3A 1RPWA 3BOQA 5LFAA 2HPIA 1VI0A 1DU6A 2E19A 4AIJA 1T38A 3F8FA 5E1WA 4CYDA 4XMYA 2K9LA 2RQQA 3DKYA 4M9SA 1H88C 3OV8A 5HDKA 4IRIA 2UWMA 3AKZA 4A5NA 1X3ZB 4M3EA 3FXJA 1OISA 4ESJA 2ID3A 3CUQA 1V5GA 3SDGA 5BNGA 1VQNI 4F3QA 5DM6F 4HX7A 1Q1HA 4YFKF 3HHGA 2VJ4A 3JRBA 3S1RJ 4HV5A 4PK4A 4RLFA 1OLTA 3C2GA 3CDIA 1MGTA 2KDOA 4PJLA 2CV0A 2X48A 1XC5A 4I76A 1B6AA 2FE3A 1IC8A 3A1YA 1WJEA 3G4SI 5JVGF 2JTVA 1AHDP 3CC2I 3NARA 1YIJI 2RDPA 2WA0A 2AHQA 3VYTB 4JYKA 3H3VK 1OYIA 3N05A 4A0YA 1B8IB 3TW7A 1YX5A 2VKEA 3R60A 5JI6A 2FJ1A 4XOPA 5EG0A 4CGZA 4A3LJ 2BBYA 1ZGAA 3B6CA 2F48A 2XAHA 1KQ8A 2JA6J 3KLNA 1OR7A 2K4BA 1BIBA 3LA3A 4BQAA 3LAPA 4BDZA 2OCCH 1MBHA 2FMYA 3LFKA 1IRZA 2PBIA 2LD5A 1R1TA 1VQ6I 1PDNC 4UNOA 3LSJA 2H1LA 2TRTA 4OIRF 5K7FA 3FK6A 3E1SA 4UXNA 4RB3C 1A36A 3TDUC 3C3WA 4HNUA 2PJRA 2ZJQF 4RM3A 4CDGA 2QCOA 3I9V2 1J7KA 3E6BA 5HODA 2KT0A 2QWWA 3BR5A 5LGNA 3ZMVA 1B59A 4WK8F 2QA4I 1ITYA 3GO5A 3ZOBA 1BR2A 2LG4A 3M8FA 2D5VA 4XKVA 3OYMA 2X9DA 3TP3A 2EFOA 3LSIA 4AU7A 2R4GA 2MLKA 1NG6A 4F91B 2F5EA 2MLGA 1B72B 1KQ0A 1QPIA 3TDZC 4FQGA 2FBIA 2IPQX 2KMUA 3KYDB 5FKKA 3MD2A 4ZJZA 1WJBA 3M07A 1ZYRF 1LQ1A 1Y8QB 2CQNA 1S7EA 3B73A 3O3KA 4MEYF 2R7RA 4XLEA 3HDDA 2VOOA 1I3AA 1GUUA 4LMYA 2DOEA 3GFJA 2DW4A 2CYYA 3N4MA 2LLKA 2L3DA 5L3FA 2WB1A 5EZGA 4A0XA 2CWEA 2HYJA 3I0TA 4L9NA 3E6CC 3CDHA 2XRNA 4DIQA 3BZ6A 4MTEA 5BPIA 3ZMUA 3IP4B 1FTTA 4MLOA 3RYPA 3OIOA 1OMIA 3D5LA 2QZ8A 3DBLB 3N97A 2HQRA 1BA5A 2YU9J 3JRGA 2A69F 2LY1A 2WB1N 2A3SA 2DQLA 2M9HA 5JVTA 1R49A 3H5NA 4C3JJ 4ENMA 1JJ6C 5D4RA 2XAUA 2EINH 2X0LA 4RA2A 4EEFG 5D5VB 4XNFA 2Y30A 4LB5A 4L0YB 1IV8A 4HLXA 4L0ZB 4RS8A 2WAQN 1ZHFA 4RAZA 5L3BA 3SZPA 2QQ8A 2BW3B 3EPZA 3ABMH 3B02A 2KRCA 3T1BA 1KQ9A 2XPWA 3CJQB 4KICA 2O61A 1YITI 4ZH4F 1F5TA 2F5CA 4N0BA 2HXIA 1VF9A 2QQBA 2CW8A 2IRFG 4U0WA 3TBIA 3L2UA 4I99C 3ISPA 3HTUA 5A2QK 4A93J 2DYRH 3EYYA 4BBRJ 4KN4X 2IXSA 4D9JA 2VJ5A 2ZJPF 4Z2YA 1T0FA 2CV2A 3BG6A 4KMUX 2DMTA 3BZKA 1X2MA 2E35A 2NRAC 2FUG2 4L18B 2CFOA 3RTRA 3I4PA 1G3SA 2OQRA 2EV0A 1FTZA 2D1HA 1CF7B 1MD0A 2L9SA 2YPRA 4WXDA 5J8FA 2B63J 5K5RA 2JUCA 2QEXI 3BDDA 2JA7J 3BTCA 1I50J 2DDBA 2VI6A 4BAYA 1W36C 1HSTA 1R00A 1XTAA 1MMNA 2I10A 2WV0A 3OR1C 1XGSA 4YELA 3CCSI 3QPTA 3PO2J 2QKMB 3DQVC 4UY8I 5HS8A 1BW5A 2CUZA 4XBFA 4AUXA 1H89C 5KK1A 3ZN1A 1VFCA 1IO2A 4BQOA 3PNVA 2F5VA 2VN2A 4LB6B 1W7PB 3FBIB 1Y8RB 2CQKA 4X1EA 1AKHB 5FKLA 3FHZA 3W2WA 3OYJA 3FXMA 1XDUA 2X85A 3HJEA 4HX8A 2KJCA 1SVLA 4FE7A 2DA2A 2E5ZA 1FYLA 1TQMA 3QYFA 3V8LA 2V4JC 1G3WA 3ONQA 3RI4A 2R93J 2HVRA 4CCOA 1VQMI 2GXGA 2E1CA 1E2XA 1ZAOA 5CVVA 4XLNF 1RR8C 2DA7A 2GIZA 2XKPA 3ASOH 2XUBA 2O3FA 3VWBA 3K10A 3MN2A 3VB2A 5FKMA 1ZG3A 1BR1A 1S29A 3OR2C 5FLMJ 3TKYA 1RC9A 4HQEA 4MNUA 1I1GA 3ZQGA 2KJBA 4A6EA 1G2HA 5ICEA 3ELKA 2LOOA 1QU3A 2K86A 1DP7P 2IJLA 2OA4A 3BG9A 2DMQA 3GW2A 3ZQIA 1PUEE 4IQJA 4RGXA 4G8XA 2LNBA 3A02A 2MW8A 2X6XA 4P96A 3F8BA 5M5XJ 4XLAA 4LLLA 3IV5A 1TWFJ 1ERDA 3LSTA 9ANTA 3F6VA 1FT9A 5DEQA 2B7EA 5DCMB 2XVCA 1D5YA 4L9TA 5J6XA 2NOJB 4HSTA 4C2MJ 3F8NA 1TW3A 2DT7B 3CJTB 2LKXA 2OTJI 2FD5A 2MD0A 3VYUB 3GTPJ 4E7JA 3CC4I 2NS7A 1F4KA 3BPVA 2EWNA 2HKOA 4XONA 4ANJA 4CYCB 5LEJA 4KITB 3LOCA 1ENHA 4E7LA 2BVMA 1YJ9I 4A3CJ 1QRYA 1SFKA 5FGMA 2Y31A 4QWQA 4EQQA 2W24A 2N8GA 2V9PA 3W6VA 1ACIA 1W5SA 2BVLA 2P8TA 2L01A 4YIFA 2JA2A 5A2QZ 2E34A 1ZKGA 3R61A 4EM1A 2M87A 2E71A 2UZKA 2DA4A 1YHQI 2R7TA 3LSKA 5D5WB 1Z9CA 2MC4A 3V8KA 1MIJA 4C30A 3S14J 3HUGA 3RQIA 2DK5A 1B72A 3GXOA 4XKWA 3BQZA
chains in the Genus database with same CATH topology
1ETXA 1ETQA 3GTJJ 2HXOA 2ELKA 1APLC 4A3GJ 3L1PA 2XSDC 3ZQHA 3Q0WA 4FE4A 3OSFA 3K7AJ 4M6VA 3QPSA 3ZQFA 1FEXA 3Q0UA 1JT6A 5EDNA 3GBGA 4B4CA 2LFBA 2LY9A 5EGOB 1X2NA 5GPAA 3JRAA 4DW6A 4M3GA 3BTJA 3GTLJ 3S15J 3I4NJ 4DZJA 3SFIA 1I3QJ 4A3BJ 5GPCA 3S1NJ 2K9QA 2JJ7A 2DA5A 1JKPC 2DMUA 3PM1A 3BTIA 1HCRA 1GV5A 3G1LA 4B1RA 2Y9ZA 2EZKA 1DU0A 1MNMC 3VPRA 3IH3A 3WHCA 5M5WJ 4V2FA 1ZTRA 1OFCX 2G0EA 2L7ZA 1RKWA 1NTCA 4DYRA 2NVTJ 3A01B 1ETYA 1JGGA 3HOZJ 1ETWA 1WCMJ 1TWGJ 2ZB9A 4J19A 4A3MJ 2M0CA 2YUSA 3BR6A 1GDTA 3HOYJ 3HOUJ 2K9SA 4FISA 1MBJA 1JKQC 2W48A 1TC3C 2YS9A 2KDZA 1MBGA 2E2IJ 5J1RA 1K83J 2L0KA 3HGYA 1BJZA 4I6ZA 5F0HA 2XPVA 4AC0A 1HDPA 4JP0A 2HI3A 3RKQA 3GTOJ 4V2GA 5E3MA 5IYDJ 4A3KJ 2L7FP 1TWAJ 5IP9J 4GFBA 2O8KA 1HF0A 1MH3A 1JKRC 3QQAA 3CQZJ 4Y7NJ 4S0HB 1Z77A 1P7JA 5E3LA 1U78A 2MG4A 4A3EJ 1OCPA 3S1MJ 2O9LA 2VUMJ 3E7LA 3HM5A 4A3JJ 2K40A 4MIMA 4W97A 1T33A 1GV2A 3MVPA 2E2HJ 1VNDA 3H0GJ 1LFUP 3GTQJ 1I6HJ 3CMYA 3LSRA 2DMPA 4D7NA 1ZR4A 1PUFA 1W0TA 3BT9A 1T56A 1AKHA 3S16J 4M3DA 1RPWA 5C44J 2JN6A 4C3IJ 1VI0A 2LTPA 2Y0SN 1LE8A 1DU6A 3OOUA 1JUMA 2E19A 2HOSA 4IHVA 1K61A 1Q1VA 4XIDA 1SANA 1Y1WJ 1H88C 5JLWA 3JRHA 2CQQA 1F36A 4DYQA 2JA5J 2XB5A 3TEDA 3TW6A 4M3EA 1ETVA 2ECCA 2ID3A 3G1MA 3QPLA 1YRNB 5FLVA 3IH2A 3SDGA 5BNGA 5M3MJ 4LOCA 2NVYJ 3BR0A 2CJJA 3JRBA 3S1RJ 4A3FJ 3GTMJ 2XB0X 5C4XJ 1MSEC 4NDLA 1ZGWA 4MFEA 2X48A 1XC5A 4I76A 1MSFC 2ECBA 1WH5A 5IP7J 1WH7A 1JTYA 3BR2A 1IC8A 4BXXJ 1UG2A 2HOAA 4FTHA 4QTRA 3CCYA 1AHDP 2OF7A 5DS9A 4QSHA 5FKNA 3NARA 1H8AC 2AHQA 2RAEA 5J1YA 3FISA 4JYKA 4JX5A 3A01A 1B8IB 2GM4A 3H3VK 3TW7A 2VKEA 3JRIA 1PUFB 5M5YJ 2FJ1A 1NK2P 3LNQA 3HEFA 5EG0A 4A3LJ 3LSPA 3LSGA 4AYBN 3B6CA 1XG1A 1QVTA 3JRFA 1SFOJ 2JA6J 4BY1J 2DA3A 4UUTA 2CUEA 1ZR2A 3JRCA 2HQ5A 3HBLA 4QIWN 1UMQA 1MBHA 3Q0VA 1IDZA 1YRNA 5JLXA 1IRZA 2LD5A 2EBIA 5EF6A 3LSJA 2TRTA 4W1UA 3TP0A 2AO9A 5K7FA 3FK6A 3BG3A 4IHWA 4JX4A 2M34A 3IH4A 2CUFA 5K7HA 2K9NA 1IG7A 2QCOA 3M4OJ 5HODA 1MBEA 2KT0A 3BR5A 2CU7A 3BR1A 4XRSA 2DA1A 4A3DJ 3ZOBA 1A6IA 5K7ZA 2OPTA 1ITYA 5F0CA 4B3AA 2XRLA 2D5VA 2X9DA 3TP3A 4D7MA 1MBKA 4XK4A 2FQ4A 4ABZA 3BR3A 4D5CA 2H8RA 1B72B 1QPIA 2EZHA 5FKKA 1GT0C 5C4JJ 1IGNA 3BG5A 5M3FJ 3ZQCA 4BKXA 4FCYA 1S7EA 4C3HJ 2EZIA 2VKVA 3MKLA 2COBA 5DTDA 3HDDA 5F08A 1U9OA 1GUUA 2GBYA 5IYBJ 1IJWC 3S17J 3WHBA 2LLKA 3RZOJ 5EZGA 1RR7A 4IHXA 2HYJA 2E2JJ 1FTTA 4MLOA 1BA5A 3OIOA 5FKOA 1GVDA 1ZK8A 3JRGA 2YU9J 2DA6A 2NVQJ 4CYCA 2DJNA 2WB1N 2R7ZJ 2M9HA 3NAUA 3BTLA 4C3JJ 1JJ6C 2JWTA 2NS8A 4EEFG 2Y30A 3GTGJ 4RBOA 3HKZN 1WI3A 3FIWA 1ZQ3P 1W0UA 2WAQN 1HDDC 4IHYA 2O7OA 2NVXJ 2E1OA 3BQYA 2XPWA 3GTKJ 3FK7A 3C2BA 3PO3J 2M2EA 1JTXA 3B6AA 4MO7A 1LE8B 2XGCA 1FIAA 1A5JA 1TWCJ 2Y9YA 2NOGA 2HXIA 1VF9A 1Y1VJ 3DEWA 4A93J 1O4XA 5F0FA 3JREA 4RDUA 1EF4A 4BBRJ 3K2AA 2JMWA 5GP9A 3S2HJ 2FX0A 2L9RA 4G12A 2DMTA 1X2MA 1RKTA 5EGOA 2MSYA 5E3OA 5EEAA 3D1NI 2LR8A 3DCFA 2HDDA 5IPAA 2CRGA 1WPKA 2R5YB 2IAIA 1FTZA 2IEKA 1JJ8C 2B63J 2JA7J 2ME6A 1RETA 1I50J 2VI6A 3BTCA 5F27A 3Q3SA 2WV1A 2I10A 1R9TJ 3HOWJ 1FIPA 5J3LA 3PO2J 2DN0A 1AU7A 2XGDA 5IOYA 5EG0B 1IUFA 1BW5A 4A69C 2JA8J 1IDYA 4AUXA 5IOZA 1H89C 2R5ZA 3SJMA 1OCTC 1VFCA 2L7MP 4XRSG 4BBSJ 3G1OA 4X1EA 1AKHB 5FKLA 1Z0XA 2R0QC 1FJLA 1CQTA 2EZLA 2EH3A 4FE7A 3S2DJ 4Y52J 2DA2A 2Y2ZA 1BL0A 2QF7A 3UKGA 1JKOC 2R93J 1ETKA 2R5YA 1U9NA 5EYRA 1RESA 2DA7A 1F43A 4JX6A 4UUSA 3OSGA 3MN2A 5FKMA 2LP0A 2VPRA 5EZHA 2XGEA 1U8BA 5FLMJ 3ZQGA 4M3BA 4D5FA 1G2HA 1UHSA 1TWHJ 4MFDA 5J1UA 5FJ8J 4XICA 1HOMA 2IBDA 1BW6A 3BG9A 3HB9A 2DMQA 4HNVA 2R5ZB 3ZQIA 4M3FA 4DYCA 3M3YJ 3A02A 2MW8A 2DTZA 5M5XJ 3IV5A 5E3NA 2P81A 1TWFJ 1HLVA 1JT0A 9ANTA 3A03A 4A3IJ 1ORKA 1NK3P 1X58A 4BY7J 1D5YA 3JR9A 2ME0A 4C2MJ 2R92J 2HOTA 5F1JA 1E3OC 2MGQA 5IP6A 2LKXA 2TCTA 3O8HA 3RZDJ 2FD5A 3FKIJ 3O8GA 3GTPJ 3JRDA 2NS7A 4IEJA 1JUSA 2X6OA 2XPUA 4UUSB 1POGA 3HOXJ 1ETOA 4CYCB 2ID6A 2H1KA 2DMNA 3LOCA 1ENHA 2LVSA 4A3CJ 1QRYA 1WGXA 1LFBA 2Y31A 5C3EJ 2CQXA 3S1QJ 2N8GA 3W6VA 2LK2A 2JK3A 2GLOA 3HOVJ 5IYCJ 1QVUA 4X6AJ 1ZKGA 1JUPA 1XS9A 3HGGA 5F04A 3I4MJ 3ZQLA 2EQRA 2DA4A 1OJLA 1MH4A 4L5EA 1MBFA 3F0CA 4DZPA 3CDLA 1B8IA 1P7IA 1IV6A 3RQIA 3S14J 2M8GX 2PMZN 1B72A 4XRMA 3BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETX A;  1ETQ A;  3GTJ J;  2HXO A;  2ELK A;  1APL C;  4A3G J;  3L1P A;  2XSD C;  3ZQH A;  3Q0W A;  4FE4 A;  3OSF A;  3K7A J;  4M6V A;  3QPS A;  3ZQF A;  1FEX A;  3Q0U A;  1JT6 A;  5EDN A;  3GBG A;  4B4C A;  2LFB A;  2LY9 A;  5EGO B;  1X2N A;  5GPA A;  3JRA A;  4DW6 A;  4M3G A;  3BTJ A;  3GTL J;  3S15 J;  3I4N J;  4DZJ A;  3SFI A;  1I3Q J;  4A3B J;  5GPC A;  3S1N J;  2K9Q A;  2JJ7 A;  2DA5 A;  1JKP C;  2DMU A;  3PM1 A;  3BTI A;  1HCR A;  1GV5 A;  3G1L A;  4B1R A;  2Y9Z A;  2EZK A;  1DU0 A;  1MNM C;  3VPR A;  3IH3 A;  3WHC A;  5M5W J;  4V2F A;  1ZTR A;  1OFC X;  2G0E A;  2L7Z A;  1RKW A;  1NTC A;  4DYR A;  2NVT J;  3A01 B;  1ETY A;  1JGG A;  3HOZ J;  1ETW A;  1WCM J;  1TWG J;  2ZB9 A;  4J19 A;  4A3M J;  2M0C A;  2YUS A;  3BR6 A;  1GDT A;  3HOY J;  3HOU J;  2K9S A;  4FIS A;  1MBJ A;  1JKQ C;  2W48 A;  1TC3 C;  2YS9 A;  2KDZ A;  1MBG A;  2E2I J;  5J1R A;  1K83 J;  2L0K A;  3HGY A;  1BJZ A;  4I6Z A;  5F0H A;  2XPV A;  4AC0 A;  1HDP A;  4JP0 A;  2HI3 A;  3RKQ A;  3GTO J;  4V2G A;  5E3M A;  5IYD J;  4A3K J;  2L7F P;  1TWA J;  5IP9 J;  4GFB A;  2O8K A;  1HF0 A;  1MH3 A;  1JKR C;  3QQA A;  3CQZ J;  4Y7N J;  4S0H B;  1Z77 A;  1P7J A;  5E3L A;  1U78 A;  2MG4 A;  4A3E J;  1OCP A;  3S1M J;  2O9L A;  2VUM J;  3E7L A;  3HM5 A;  4A3J J;  2K40 A;  4MIM A;  4W97 A;  1T33 A;  1GV2 A;  3MVP A;  2E2H J;  1VND A;  3H0G J;  1LFU P;  3GTQ J;  1I6H J;  3CMY A;  3LSR A;  2DMP A;  4D7N A;  1ZR4 A;  1PUF A;  1W0T A;  3BT9 A;  1T56 A;  1AKH A;  3S16 J;  4M3D A;  1RPW A;  5C44 J;  2JN6 A;  4C3I J;  1VI0 A;  2LTP A;  2Y0S N;  1LE8 A;  1DU6 A;  3OOU A;  1JUM A;  2E19 A;  2HOS A;  4IHV A;  1K61 A;  1Q1V A;  4XID A;  1SAN A;  1Y1W J;  1H88 C;  5JLW A;  3JRH A;  2CQQ A;  1F36 A;  4DYQ A;  2JA5 J;  2XB5 A;  3TED A;  3TW6 A;  4M3E A;  1ETV A;  2ECC A;  2ID3 A;  3G1M A;  3QPL A;  1YRN B;  5FLV A;  3IH2 A;  3SDG A;  5BNG A;  5M3M J;  4LOC A;  2NVY J;  3BR0 A;  2CJJ A;  3JRB A;  3S1R J;  4A3F J;  3GTM J;  2XB0 X;  5C4X J;  1MSE C;  4NDL A;  1ZGW A;  4MFE A;  2X48 A;  1XC5 A;  4I76 A;  1MSF C;  2ECB A;  1WH5 A;  5IP7 J;  1WH7 A;  1JTY A;  3BR2 A;  1IC8 A;  4BXX J;  1UG2 A;  2HOA A;  4FTH A;  4QTR A;  3CCY A;  1AHD P;  2OF7 A;  5DS9 A;  4QSH A;  5FKN A;  3NAR A;  1H8A C;  2AHQ A;  2RAE A;  5J1Y A;  3FIS A;  4JYK A;  4JX5 A;  3A01 A;  1B8I B;  2GM4 A;  3H3V K;  3TW7 A;  2VKE A;  3JRI A;  1PUF B;  5M5Y J;  2FJ1 A;  1NK2 P;  3LNQ A;  3HEF A;  5EG0 A;  4A3L J;  3LSP A;  3LSG A;  4AYB N;  3B6C A;  1XG1 A;  1QVT A;  3JRF A;  1SFO J;  2JA6 J;  4BY1 J;  2DA3 A;  4UUT A;  2CUE A;  1ZR2 A;  3JRC A;  2HQ5 A;  3HBL A;  4QIW N;  1UMQ A;  1MBH A;  3Q0V A;  1IDZ A;  1YRN A;  5JLX A;  1IRZ A;  2LD5 A;  2EBI A;  5EF6 A;  3LSJ A;  2TRT A;  4W1U A;  3TP0 A;  2AO9 A;  5K7F A;  3FK6 A;  3BG3 A;  4IHW A;  4JX4 A;  2M34 A;  3IH4 A;  2CUF A;  5K7H A;  2K9N A;  1IG7 A;  2QCO A;  3M4O J;  5HOD A;  1MBE A;  2KT0 A;  3BR5 A;  2CU7 A;  3BR1 A;  4XRS A;  2DA1 A;  4A3D J;  3ZOB A;  1A6I A;  5K7Z A;  2OPT A;  1ITY A;  5F0C A;  4B3A A;  2XRL A;  2D5V A;  2X9D A;  3TP3 A;  4D7M A;  1MBK A;  4XK4 A;  2FQ4 A;  4ABZ A;  3BR3 A;  4D5C A;  2H8R A;  1B72 B;  1QPI A;  2EZH A;  5FKK A;  1GT0 C;  5C4J J;  1IGN A;  3BG5 A;  5M3F J;  3ZQC A;  4BKX A;  4FCY A;  1S7E A;  4C3H J;  2EZI A;  2VKV A;  3MKL A;  2COB A;  5DTD A;  3HDD A;  5F08 A;  1U9O A;  1GUU A;  2GBY A;  5IYB J;  1IJW C;  3S17 J;  3WHB A;  2LLK A;  3RZO J;  5EZG A;  1RR7 A;  4IHX A;  2HYJ A;  2E2J J;  1FTT A;  4MLO A;  1BA5 A;  3OIO A;  5FKO A;  1GVD A;  1ZK8 A;  3JRG A;  2YU9 J;  2DA6 A;  2NVQ J;  4CYC A;  2DJN A;  2WB1 N;  2R7Z J;  2M9H A;  3NAU A;  3BTL A;  4C3J J;  1JJ6 C;  2JWT A;  2NS8 A;  4EEF G;  2Y30 A;  3GTG J;  4RBO A;  3HKZ N;  1WI3 A;  3FIW A;  1ZQ3 P;  1W0U A;  2WAQ N;  1HDD C;  4IHY A;  2O7O A;  2NVX J;  2E1O A;  3BQY A;  2XPW A;  3GTK J;  3FK7 A;  3C2B A;  3PO3 J;  2M2E A;  1JTX A;  3B6A A;  4MO7 A;  1LE8 B;  2XGC A;  1FIA A;  1A5J A;  1TWC J;  2Y9Y A;  2NOG A;  2HXI A;  1VF9 A;  1Y1V J;  3DEW A;  4A93 J;  1O4X A;  5F0F A;  3JRE A;  4RDU A;  1EF4 A;  4BBR J;  3K2A A;  2JMW A;  5GP9 A;  3S2H J;  2FX0 A;  2L9R A;  4G12 A;  2DMT A;  1X2M A;  1RKT A;  5EGO A;  2MSY A;  5E3O A;  5EEA A;  3D1N I;  2LR8 A;  3DCF A;  2HDD A;  5IPA A;  2CRG A;  1WPK A;  2R5Y B;  2IAI A;  1FTZ A;  2IEK A;  1JJ8 C;  2B63 J;  2JA7 J;  2ME6 A;  1RET A;  1I50 J;  2VI6 A;  3BTC A;  5F27 A;  3Q3S A;  2WV1 A;  2I10 A;  1R9T J;  3HOW J;  1FIP A;  5J3L A;  3PO2 J;  2DN0 A;  1AU7 A;  2XGD A;  5IOY A;  5EG0 B;  1IUF A;  1BW5 A;  4A69 C;  2JA8 J;  1IDY A;  4AUX A;  5IOZ A;  1H89 C;  2R5Z A;  3SJM A;  1OCT C;  1VFC A;  2L7M P;  4XRS G;  4BBS J;  3G1O A;  4X1E A;  1AKH B;  5FKL A;  1Z0X A;  2R0Q C;  1FJL A;  1CQT A;  2EZL A;  2EH3 A;  4FE7 A;  3S2D J;  4Y52 J;  2DA2 A;  2Y2Z A;  1BL0 A;  2QF7 A;  3UKG A;  1JKO C;  2R93 J;  1ETK A;  2R5Y A;  1U9N A;  5EYR A;  1RES A;  2DA7 A;  1F43 A;  4JX6 A;  4UUS A;  3OSG A;  3MN2 A;  5FKM A;  2LP0 A;  2VPR A;  5EZH A;  2XGE A;  1U8B A;  5FLM J;  3ZQG A;  4M3B A;  4D5F A;  1G2H A;  1UHS A;  1TWH J;  4MFD A;  5J1U A;  5FJ8 J;  4XIC A;  1HOM A;  2IBD A;  1BW6 A;  3BG9 A;  3HB9 A;  2DMQ A;  4HNV A;  2R5Z B;  3ZQI A;  4M3F A;  4DYC A;  3M3Y J;  3A02 A;  2MW8 A;  2DTZ A;  5M5X J;  3IV5 A;  5E3N A;  2P81 A;  1TWF J;  1HLV A;  1JT0 A;  9ANT A;  3A03 A;  4A3I J;  1ORK A;  1NK3 P;  1X58 A;  4BY7 J;  1D5Y A;  3JR9 A;  2ME0 A;  4C2M J;  2R92 J;  2HOT A;  5F1J A;  1E3O C;  2MGQ A;  5IP6 A;  2LKX A;  2TCT A;  3O8H A;  3RZD J;  2FD5 A;  3FKI J;  3O8G A;  3GTP J;  3JRD A;  2NS7 A;  4IEJ A;  1JUS A;  2X6O A;  2XPU A;  4UUS B;  1POG A;  3HOX J;  1ETO A;  4CYC B;  2ID6 A;  2H1K A;  2DMN A;  3LOC A;  1ENH A;  2LVS A;  4A3C J;  1QRY A;  1WGX A;  1LFB A;  2Y31 A;  5C3E J;  2CQX A;  3S1Q J;  2N8G A;  3W6V A;  2LK2 A;  2JK3 A;  2GLO A;  3HOV J;  5IYC J;  1QVU A;  4X6A J;  1ZKG A;  1JUP A;  1XS9 A;  3HGG A;  5F04 A;  3I4M J;  3ZQL A;  2EQR A;  2DA4 A;  1OJL A;  1MH4 A;  4L5E A;  1MBF A;  3F0C A;  4DZP A;  3CDL A;  1B8I A;  1P7I A;  1IV6 A;  3RQI A;  3S14 J;  2M8G X;  2PMZ N;  1B72 A;  4XRM A;  3BQZ A; 
#chains in the Genus database with same CATH topology
 1MMS A;  3GTJ J;  2ZME B;  3GFL A;  4A3G J;  1NH3 A;  3L1P A;  2XSD C;  4ESB A;  3OSF A;  1VQO I;  2A61 A;  2A68 F;  3PNT A;  3U9G A;  4XN0 A;  3FKJ A;  1XPX A;  3KE2 A;  3Q0U A;  2QM3 A;  3FF5 A;  3I71 A;  1IF1 A;  1KU7 A;  1B9M A;  3M9A A;  4XQF A;  1DP3 A;  5D6F A;  4F52 A;  5EGO B;  3RJP A;  4YFX F;  3HHH A;  1TTY A;  2B0L A;  3GTL J;  1XGN A;  3F3X A;  1W5C C;  1BOA A;  4GYI A;  4DZJ A;  4U7D A;  4A3B J;  4IRH A;  5GPC A;  3S1N J;  1JKP C;  1GV5 A;  1X19 A;  3G1L A;  4PJJ A;  1BOB A;  3K6G A;  1DU0 A;  1XCB A;  3VPR A;  2M4K A;  5M5W J;  4OWR B;  1OFC X;  2G0E A;  3SDB A;  3WTV C;  3CCU I;  2ZFW A;  5TJJ A;  1YIO A;  5D6E A;  2NVT J;  3A01 B;  3W3C A;  1ULY A;  4HSR A;  1JGG A;  3U1D A;  1ETW A;  2VQL A;  1WJF A;  3T8R A;  2ZB9 A;  3RKW A;  4ZZD A;  3F8C A;  1MW7 A;  2E1M B;  3HOU J;  5HLH A;  5FLX K;  1MBJ A;  1A31 A;  5FRN A;  1UJ8 A;  3K4N A;  4CUG A;  4OAY A;  1VQK I;  4BGD A;  2IS1 A;  2PMZ A;  5J1R A;  1K83 J;  2L0K A;  4IOC F;  4GO1 A;  3QOE A;  1QPM A;  2EIK H;  2DFH A;  2PMU A;  5DCM A;  4AC0 A;  2NS0 A;  2XF5 A;  3EUH C;  1K4T A;  1HDP A;  3H0D A;  5ICC A;  1TBX A;  4H4K C;  3GTO J;  4XLH A;  3FM5 A;  4KJZ A;  5IYD J;  4DBR A;  2L7F P;  1MDM A;  4AIH A;  2BY1 A;  5IP9 J;  2IA1 A;  1WFX A;  3BJA A;  1I6X A;  3OS0 A;  4FT8 A;  3PQJ A;  4BE2 A;  2OC6 A;  1Z77 A;  3VSK A;  4R79 A;  1U78 A;  3E5U A;  3S1M J;  2Z33 A;  1ZG5 A;  1Y0N A;  4PSX A;  4EJV A;  3WGG A;  5K5O A;  5H6R A;  4MIM A;  4O6J A;  2P6T A;  4LIV A;  4G7Z F;  1U8R A;  1VND A;  1WVR A;  3H0G J;  2KIM A;  4XL9 A;  4OIP F;  5HNH A;  2ZXJ A;  2ACJ A;  1LFU P;  3H9G A;  2WBM A;  3LSR A;  1O3R A;  3OYG A;  2HTS A;  3J80 K;  2BXY A;  1ZH5 A;  3U1K A;  3BT9 A;  3BY6 A;  1T56 A;  4RLQ A;  1W1W E;  4HDU A;  4AVZ A;  3DPT A;  2V1N A;  3ZXS A;  5C44 J;  1EH8 A;  3ABU A;  1ZLK A;  1KON A;  3T0Y A;  1LE8 A;  3KZZ A;  1PYV A;  1K61 A;  1K7A A;  3IKV A;  3MKY B;  4EGY A;  3HSF A;  2QUF A;  2CQQ A;  2JA5 J;  3TED A;  2DOF A;  2YR2 A;  2ECC A;  5AIP A;  2K27 A;  3QPL A;  1YRN B;  4KT6 A;  2ISZ A;  4DOZ A;  5J4V A;  1HKQ A;  5M3M J;  2QSF X;  3KZY A;  1WKM A;  5HDN A;  1DPU A;  5D4S A;  4C2T A;  2CJJ A;  4AID A;  2V1X A;  4RGS A;  4B43 A;  5C4X J;  1KYW A;  3DBR B;  3OYC A;  3KX2 A;  4NDL A;  2PJR B;  1UFM A;  1A6Q A;  2FSW A;  3TO6 A;  1X3U A;  2CW7 A;  1WH5 A;  3OYI A;  1WH7 A;  5H2F C;  2DXI A;  4HRI A;  2WY7 Q;  3D5R C;  1CF7 A;  4EJW A;  4BXX J;  1UG2 A;  3WG9 A;  1R5G A;  3OMY A;  5L3D A;  3CCY A;  4QTR A;  2BGC A;  1SAU A;  4BQN A;  1Z21 A;  1XD7 A;  2RAE A;  5HLT A;  3FIS A;  3QP5 A;  4G7H F;  5LD2 C;  4CCJ A;  2OV7 A;  4F55 A;  2FA5 A;  3OYK A;  2NVU B;  3JRI A;  1PUF B;  4ZDO A;  2DK8 A;  2VC0 A;  4I98 B;  1UCR A;  3ECH A;  3LSP A;  3LSG A;  4AYB N;  1IXR C;  4BJT A;  5ERI A;  2PMH A;  3JRF A;  3AL0 B;  3DF8 A;  2CUE A;  1V54 H;  4R8H A;  3MZH A;  4XSX F;  2V9V A;  1LJ9 A;  4A5M A;  2HQ5 A;  4I01 A;  4QIW N;  1TNT A;  4ENN A;  1UMQ A;  2LF8 A;  1YRN A;  2R7F A;  4G6Q A;  4KFC A;  2EPF A;  3GZ6 A;  4JK1 X;  4UV9 A;  4PJM A;  3TP0 A;  1YJN I;  3BG3 A;  4IHW A;  2KRH A;  1D1C A;  4EVI A;  1X1A A;  2KHM A;  4JX4 A;  4NQW B;  3C1D A;  3C7J A;  1R5H A;  1P9Q C;  2K5C A;  3J81 K;  1LEB A;  3WGH A;  1R4N B;  1Y56 A;  2Q0O A;  4ZYA A;  1MBE A;  4BNC A;  1T08 B;  4BE0 A;  2OTL I;  2VIX A;  4L5J A;  3HSR A;  2OPT A;  2TDX A;  2X1D A;  4B3A A;  3GME A;  4E7Z A;  3CF5 F;  1LDD A;  4PSW A;  5TIS C;  3P9K A;  4CH7 A;  2VOD A;  3QRF F;  1NHA A;  3HUG B;  2F4M B;  1X1B A;  2VB6 A;  4D5C A;  4IZZ A;  2Z3Y A;  2Y0M A;  3WGI A;  1VTN C;  2VPL A;  2K3P A;  2QQA A;  2ZME A;  3DP7 A;  1L3L A;  2DYS H;  2GA2 A;  2RVC A;  4IVN A;  1WHU A;  2NNY A;  5FRM A;  2ELH A;  4HA8 A;  3KPH A;  4P9U A;  1E3H A;  4AD9 A;  2EZI A;  2V9K A;  3ML6 A;  2COB A;  4M9X A;  1USS A;  5DTD A;  3L09 A;  5F08 A;  1U9O A;  3V7C A;  4L9V A;  3K9T A;  4HV6 A;  5IYB J;  3X2Q H;  2R7S A;  3WHB A;  2QKL B;  3LA2 A;  5D8L B;  3CCM I;  2ZCW A;  2A5W A;  2EFQ A;  5BMZ A;  1T98 A;  1RR7 A;  1N75 A;  2OUM A;  2RQP A;  3K4C A;  1QQI A;  3M8E A;  3CCE I;  4P1W A;  4LLN A;  1E0E A;  1N25 A;  5FKO A;  1GVD A;  4DQ2 A;  5J4Y A;  3IWZ A;  1YS7 A;  4HZF A;  1BI1 A;  4F7Z A;  3AG1 H;  1F9N A;  5DUK A;  3TL4 X;  4MQ9 F;  3RKY A;  4XR6 A;  4RBO A;  3K4B A;  3E6D A;  1M1E B;  1WI3 A;  2BHY A;  3P9C A;  1PVE A;  1KYZ A;  2V7F A;  1DGW Y;  2DDA A;  2FML A;  5HDG A;  2MBF A;  2MH9 A;  3WU1 B;  4C2U A;  4IHY A;  3HPG A;  2VAS A;  3UNG C;  2I5U A;  3PO3 J;  2D1V A;  2M2E A;  1JTX A;  3B6A A;  1Z05 A;  4MO7 A;  1VQP I;  5LRR A;  2STT A;  1U0J A;  1O7L A;  5J47 A;  1YW9 A;  2GA1 A;  3DPU A;  4RAG A;  1AWC A;  4HYE A;  1U2W A;  1LEA A;  3LL7 A;  5F64 A;  3CMA I;  4LK1 F;  1MMG A;  3HG9 A;  4II3 A;  4Q5S F;  2BXZ A;  1FNN A;  1EKE A;  2E7W A;  1TNS A;  4BXU A;  1L0O C;  1DQU A;  3JRE A;  1EF4 A;  3QU6 A;  3K2A A;  2P7C B;  2MH2 A;  3C2H A;  5GP9 A;  4ZYE A;  3J7A O;  3S2H J;  3FXK A;  2L9R A;  4HBL A;  2W7N A;  1RKT A;  1YG2 A;  5EGO A;  2MSY A;  1UAA A;  1IN5 A;  2M7A A;  2Q8K A;  4HW0 A;  4ESF A;  4P9F A;  2DFF A;  5FO5 A;  1IN4 A;  1SFX A;  1EV7 A;  2OD5 A;  3PIP F;  2BYV E;  4FHT A;  3I5U A;  3Q3S A;  1STZ A;  5F6F A;  5H6Q A;  3K0L A;  4Y3O A;  2A5Y B;  1J5Y A;  2ISY A;  4ETS A;  3HOW J;  5J3L A;  3KFW X;  1NG7 A;  2XGD A;  5DCF A;  4CCN A;  1YLF A;  3F72 A;  1YTY A;  3FM3 A;  1JXS A;  4U88 A;  1HW5 A;  2V1U A;  1MZB A;  2Z5U A;  1BJA A;  4CCL A;  1Y39 A;  2HVQ A;  2HZD A;  4A69 C;  3ERE D;  2JA8 J;  1IDY A;  1UZC A;  5IOZ A;  3DTE A;  2DCE A;  4KNY A;  2J5P A;  3G73 A;  4R1H A;  2Q1Z B;  2P0W A;  3J81 Z;  1SC7 A;  3M1C A;  4BBS J;  3I56 I;  4OOI A;  3G1O A;  3GX4 X;  1YO5 C;  1T95 A;  3F23 A;  3V4G A;  2HTJ A;  1PJR A;  2K7L A;  3FXU A;  1V55 H;  5GAH J;  2HU9 A;  2VQH A;  2EZL A;  1IN6 A;  1QNT A;  2RV8 A;  3SEZ A;  3ZGK A;  4II2 A;  1BM9 A;  4J00 A;  1F1Z A;  3NWT A;  3UKG A;  1JKO C;  1ETK A;  2BY3 A;  3KP7 A;  1UHM A;  2DI3 A;  4RAF A;  1FP2 A;  4EMS A;  4UUS A;  3OSG A;  1XX5 A;  2VXD A;  5KCM A;  4CXF A;  4MQV A;  3K4J A;  4P5O A;  3CO7 C;  1XB4 A;  1FZP B;  2BE5 F;  2XGE A;  3WTX C;  1YS6 A;  3F9K A;  2L4A A;  5GTH C;  1LFP A;  4M3B A;  1G8X A;  4WXH A;  2QYO A;  1H0M A;  5BQT A;  1R1U A;  3NRV A;  1HOM A;  2IGK A;  5B3S H;  1BW6 A;  3K1M A;  4HNV A;  4ZTF A;  1K4S A;  2A07 F;  3HOS A;  4IF4 A;  2XHK A;  1D5V A;  5FD6 A;  5E3N A;  1JT0 A;  4M71 A;  3T5X A;  4M6Y A;  3D5S C;  2CO5 A;  4A3I J;  1ORK A;  3P7N A;  3QPH A;  2L54 A;  2GWR A;  3LA7 A;  3JR9 A;  2QVO A;  3G71 I;  2R92 J;  4NBQ A;  3CJR B;  1QBJ A;  1R4M B;  4XOT A;  4BQQ A;  3FMR A;  5FRO A;  4IHT A;  2IGO A;  3RZD J;  2CSO A;  1RI7 A;  3O8G A;  3DXJ F;  2M30 A;  4DBQ A;  2VXZ A;  3PFI A;  1ZRC A;  3F6O A;  4UUS B;  3K69 A;  2O5R A;  3ZP5 A;  2PEX A;  6PAX A;  2LVS A;  4LFU A;  2ETH A;  1BC7 C;  1IRF A;  4G94 A;  2KKO A;  1SAX A;  5E8G A;  3S1Q J;  2ZBK A;  3RCO A;  1FLI A;  2LK2 A;  1XGO A;  1XSX A;  1AA7 A;  2FRH A;  4YIR X;  5IYC J;  3MFK A;  4KIB A;  1YJW I;  4BEH A;  4N9I A;  3TO7 A;  3HL2 A;  3I4M J;  2G9W A;  2HYG D;  2D2W A;  2EQR A;  4DZP A;  5KVR A;  3WTS C;  2AXT C;  3K4K A;  1B8I A;  4J01 A;  3ASN H;  1P7I A;  4I09 A;  4XRM A;  3DLA A;  3I3L A;  3ZPL A;  5LHG A;  3WE3 A;  2R7V A;  1HW2 A;  1APL C;  2BY2 A;  1V5E A;  1RUN A;  5LGU A;  1U5T A;  2R7U A;  1E17 A;  3KLO A;  3ZQH A;  3Q0W A;  3K7A J;  3CCQ I;  2MA3 A;  2H09 A;  3QPS A;  3CES A;  4E70 A;  1MJ9 A;  3K4L A;  4E7K A;  4EGZ A;  1H9T A;  1JT6 A;  5EDN A;  1X4O A;  3HIF A;  3KET A;  3HC7 A;  3TOB A;  2LFB A;  3W6J B;  3ZR8 X;  3PL8 A;  5D5U B;  2VE9 A;  2EFW A;  3CZ6 A;  2VQG A;  1Z6R A;  4M3G A;  1EH6 A;  2KQR A;  4KN7 X;  1IXS B;  2JSP A;  4B44 A;  3S15 J;  3J7Y J;  5IT9 K;  1KU3 A;  2M7B A;  1WJA A;  5HLI A;  2K9Q A;  2DA5 A;  2DMU A;  2X51 A;  3I55 I;  5CPR B;  1HW1 A;  2X6Y A;  3IH3 A;  4V2F A;  1C0W A;  1ZTR A;  2KIU A;  1DPR A;  2L7Z A;  1RKW A;  4ZC3 A;  1NTC A;  1R23 A;  4DYR A;  1T0F C;  3RIR A;  2HPM A;  1ETY A;  2V6C A;  2DO7 A;  3CD6 I;  1FBQ A;  3O2P E;  3HOZ J;  1WJC A;  2LYC A;  5E17 F;  3WTY C;  4HX4 A;  2IGN A;  2YUS A;  2M8E A;  2WAQ A;  2K9S A;  2I8D A;  3ZMZ A;  3NQO A;  1G3Y A;  1JKQ C;  2MFZ A;  2LKP A;  2KDZ A;  4XSZ F;  1IN7 A;  2YSR A;  1W7P D;  1PP8 F;  1FP1 D;  1QHG A;  1ZEL A;  3HGY A;  3EET A;  1H9G A;  2L7K A;  1EH7 A;  1D0Z A;  2XAG A;  3AG3 H;  1TW2 A;  4ZDL A;  1BJZ A;  1EA3 A;  1LUJ B;  4OIN F;  4AWX B;  5ICG A;  4QLC U;  4I6Z A;  2Z9O A;  4CCK A;  3AG4 H;  2HI3 A;  3G3Z A;  3J7A Y;  2CH0 A;  3IHU A;  1WJ5 A;  4V2G A;  4UVC A;  3CF2 A;  1B9N A;  3K1P A;  1U3E M;  1Y0U A;  4GFB A;  4CZC A;  1SD6 A;  1HF0 A;  5E1X A;  4E4H A;  3G6E I;  1BC8 C;  3R0A A;  1IAW A;  5ILV A;  4XKB A;  2L9N A;  2VKH A;  3EUH A;  5B1A H;  4S0H B;  4KA4 A;  4PUS A;  5FFZ A;  2DLL A;  5E3L A;  1TL8 A;  2EJR A;  2EFP A;  4A3E J;  4BS9 A;  2JRT A;  4NC6 A;  2NAZ A;  3V8J A;  1GV2 A;  3SXY A;  1I27 A;  3OIQ A;  5FB2 A;  4IOA F;  2Q2E A;  5E1Z B;  5BPD A;  2ZNZ A;  3ZQQ A;  1XCV A;  3CMY A;  4BL0 B;  2O6G E;  4CCM A;  1PUF A;  2EIM H;  2AS5 F;  1SFU A;  3FXR A;  2R3S A;  2JN6 A;  4EM0 B;  3CCL I;  2LTP A;  1JUM A;  2UXN A;  3KP5 A;  3AAF A;  3DFG A;  3WU2 C;  4GXO A;  4PDK A;  2V1D A;  1X4P A;  4E7H A;  4GCV A;  3VYR B;  3WTW C;  3TW6 A;  4IRG A;  4UV8 A;  3G1M A;  5E8I A;  1LKX A;  3E97 A;  3SEQ A;  5FLV A;  2G7U A;  3IH2 A;  4LIU A;  3MZ8 A;  4A2U A;  2KPM A;  4RGU A;  1WRJ A;  1D0Y A;  1RNL A;  4HAM A;  4YFN F;  3BR0 A;  4ZYD A;  2GOX B;  4A3F J;  2XB0 X;  5GAE J;  2XV4 S;  4OAZ A;  3BCB A;  4AIK A;  3BPX A;  1ZGW A;  4JOM A;  3AG2 H;  4G9Y A;  3BR2 A;  2PI0 A;  1TQI A;  4M73 A;  3KCC A;  4FTH A;  4ON0 A;  2ELJ A;  2ZNY A;  1ZRE A;  5DS9 A;  1LB2 A;  2Q2E B;  3L00 A;  3M7G A;  3E5Q A;  1YOV B;  4JX5 A;  3A01 A;  2GM4 A;  2Y75 A;  1DUX C;  5M5Y J;  4HNT A;  4HF0 A;  1NK2 P;  2LF7 A;  2ZSH B;  3HRM A;  3UR3 C;  3CP8 A;  4LJZ F;  1QVT A;  3DTI A;  1SFO J;  4BY1 J;  2K4J A;  2P5L C;  2DA3 A;  1MNE A;  4E7S A;  1MJB A;  5CKT A;  1ZR2 A;  3O6B B;  4CA0 A;  1ZRD A;  3HBL A;  3WU0 A;  3PNY A;  1X1P A;  3Q0V A;  4DGW B;  1IDZ A;  1HQC A;  3GUD A;  5JLX A;  3MQ0 A;  4IKF A;  2ZXW H;  1QO0 D;  5EF6 A;  1TQP A;  2LMD A;  4ZZL A;  3JTG A;  4HF1 A;  3HRS A;  2QBY B;  4IPA A;  1S72 I;  3IH4 A;  2CUF A;  2K9N A;  1MDM B;  1IG7 A;  2KIQ A;  2ZO4 A;  2FNP A;  3M4O J;  1GHC A;  2AXL A;  2KL4 A;  2BEO A;  3Q9S A;  1HBX G;  3LAJ A;  1BIA A;  2CU7 A;  3BR1 A;  2KZG A;  4XRS A;  1J0R A;  2MYS A;  5CVU A;  3DBH B;  2VON A;  2XC7 A;  3J80 Z;  2QQ9 A;  3PSF A;  3DV8 A;  4XK4 A;  2FQ4 A;  4ABZ A;  3EDP A;  3BR3 A;  2VL8 A;  5E79 C;  4D1Q A;  3E0J B;  2RNG A;  4B3X A;  2EZH A;  5J40 A;  2OBP A;  3REO A;  4BHB A;  4NUB A;  1DGR M;  4PJ0 C;  5C4J J;  3H9Q A;  1SMT A;  3KP2 A;  1IGN A;  1GXQ A;  2WWY A;  3ZQC A;  3E5X A;  4C3H J;  5EEG A;  1K6Y A;  3ABL H;  1U5T B;  2GBY A;  3U21 A;  2VQC A;  1WJD A;  3HYI A;  3R0J A;  2DPU A;  3S17 J;  1G59 A;  1OCR H;  4BUP A;  3AL0 C;  5LLQ A;  2LBF B;  3VYS B;  2X6W A;  3VSL A;  3RZO J;  3CMM A;  1P92 A;  5HS9 A;  2K02 A;  2DQR A;  3SFZ A;  2JSC A;  3OYD A;  3QOP A;  1R71 A;  1XDS A;  1ZK8 A;  2JUG A;  4DNC A;  1Z6T A;  3BJO A;  3KYC B;  2DA6 A;  2NVQ J;  2F2E A;  3ROU A;  3KP4 A;  2DJN A;  4BYY A;  1FY7 A;  4BXF A;  4CYC A;  1FOY A;  3GZN B;  1X3W B;  3NAU A;  3BTL A;  1WZ2 A;  3H5A A;  3SZT A;  2NS8 A;  3OYE A;  1AOY A;  3LSM A;  2JRM A;  2JVH A;  2HDC A;  3GTG J;  2X4H A;  4XM3 A;  2QEN A;  3HKZ N;  3FIW A;  1ZQ3 P;  3I59 B;  1W0U A;  3IRR A;  4HPQ A;  1KA8 A;  1O3Q A;  2M5W A;  1HDD C;  3OWT A;  1S7O A;  3MZY A;  2XF6 A;  2O7O A;  2GQQ A;  1R5I D;  3GF2 A;  2CQ7 A;  4L9J A;  4RGR A;  3SYT A;  3GTK J;  3C2B A;  4OIQ F;  4MTD A;  3S2W A;  2QGU A;  2LC2 A;  2XGC A;  3PUB A;  1FIA A;  3DEU A;  4LD5 A;  1FOW A;  2Y9Y A;  2ZXH A;  1SD4 A;  2X1E A;  3H36 A;  1Y1V J;  4TV7 A;  2FOW A;  2LKS A;  1D0X A;  3DEW A;  4GRI A;  1ODD A;  1VQ4 I;  3RQ4 A;  4RDU A;  2JMW A;  2K85 A;  2W85 A;  3K4M A;  1O3T A;  2IS6 A;  3DLL F;  2CUJ A;  3RKX A;  3S3N A;  2EA4 A;  4S05 A;  5E3O A;  5EEA A;  2R7X A;  4BJ6 C;  2HDD A;  2GXB A;  2CRG A;  1XN7 A;  4NHJ A;  2IAI A;  4RB2 C;  2IEK A;  3PJR A;  1JJ8 C;  2ME6 A;  1RET A;  2XDV A;  2CS3 A;  3I59 A;  2F5D A;  3OYA A;  2P5V A;  2H94 A;  1A35 A;  3NEU A;  1FIP A;  1AU7 A;  1R6R A;  4MGR A;  1SEU A;  3CC7 I;  1V5F A;  5IOY A;  5CVR A;  2HZT A;  1IUF A;  1YX3 A;  2AQE A;  3A0H C;  5GAD J;  2MAB A;  4A6D A;  2PQ8 A;  2DAO A;  4L5I A;  2R5Z A;  2VT2 A;  3BC8 A;  2CFX A;  1O3S A;  1ZLJ A;  4E7I A;  3GFM A;  2L7M P;  2K3F A;  4Q4Z F;  3SQN A;  2Y48 A;  1BR4 A;  2MC3 A;  2R7D A;  4F92 B;  2R0Q C;  1GLN A;  3W2A A;  2HEO A;  3S2D J;  4I7H A;  3H1C A;  4Y52 J;  3ABT A;  2HOE A;  5JHF A;  2Y2Z A;  3BCA A;  4CIC A;  2QF7 A;  3BJ6 A;  4U0Y A;  1RES A;  1P2F A;  1F43 A;  3JCU C;  3EUA A;  3ECO A;  4AM3 A;  2P5K A;  3HRU A;  1E3P A;  2LP0 A;  3V7S A;  3L2C A;  4ENK A;  5EZH A;  2XF7 A;  1U8B A;  3MWM A;  5B66 C;  3OYN A;  2W00 A;  2LH9 A;  4D5F A;  4I02 A;  4MFD A;  2EK5 A;  2BV6 A;  3GLX A;  4XIC A;  2IBD A;  5LRS A;  3HB9 A;  2R5Z B;  4YG2 F;  2M1B A;  1P4A A;  4M3F A;  4DYC A;  5CVI A;  1XSV A;  3DU6 A;  3PIO F;  3ZMS A;  5DDG A;  1FOK A;  3CP2 A;  5JFR A;  5IY5 H;  3DU5 A;  1BI3 A;  1WQ2 A;  1SFE A;  2P81 A;  3K70 D;  1W5T A;  1HLV A;  1D8J A;  2CG4 A;  2DOD A;  4PZJ A;  1OCC H;  5ILS A;  1P6R A;  1NK3 P;  1X58 A;  1YW8 A;  4AYB A;  3OOP A;  4G7O F;  1VZ0 A;  1R7J A;  3WTU C;  1X1D A;  2ME0 A;  4FX4 A;  2KZV A;  5F1J A;  1QZE A;  1E3O C;  5KAF C;  3RSN A;  5K1Y A;  5IP6 A;  3F21 A;  2TCT A;  3O8H A;  1LVA A;  1VQL I;  1FSH A;  2JPC A;  3FKI J;  2QBY A;  1JUS A;  1T2K A;  2XPU A;  3WE2 A;  2IS4 A;  3HOX J;  2ID6 A;  1BN5 A;  2DMN A;  4BAC A;  3ULQ B;  1ZAR A;  2K9M A;  2ZSI B;  4WXC A;  5KNL A;  1ON2 A;  3WTZ A;  1R22 A;  4FAS D;  3RDI A;  3HSE A;  2Z99 A;  1D1B A;  2JK3 A;  3QP6 A;  5AON A;  3RPQ A;  1K79 A;  5CYV A;  4AVP A;  2GLO A;  4IX7 A;  3SZG A;  4QPO A;  4HDV A;  1QVU A;  3IUO A;  5BS6 A;  1XGM A;  4HLY A;  1XS9 A;  5LHH A;  4UVB A;  3HGG A;  5HVQ C;  1FMV A;  1EJ9 A;  2C6Y A;  1O7F A;  2VE8 A;  1MH4 A;  3F0C A;  4OU0 A;  1IN8 A;  1P4X A;  4QPQ A;  5DD4 A;  3H3U A;  2M8G X;  2PMZ N;  1J2X A;  3QAH A;  3S3O A;  3RPU D;  2OJE D;  3H3Z A;  2IT0 A;  2HXO A;  2ELK A;  4UHT A;  4X0G A;  2FU4 A;  3TGN A;  3ZCO A;  4FE4 A;  4MHG A;  3BZC A;  4M6V A;  1D3Y A;  3QYE A;  3ZQF A;  2VBX A;  1FEX A;  1D1A A;  3E3V A;  3GBG A;  3CUQ C;  3DPL C;  3KIO A;  4PFO A;  2LY9 A;  4XLC A;  3NWS A;  4LGW A;  5EJC A;  4DW6 A;  4ZYG A;  3FXO A;  4EAT A;  3BTJ A;  2ZXI A;  3IAS 2;  1S8N A;  4HF2 A;  1K78 B;  2L02 A;  3BTI A;  4OMZ A;  4GYG A;  3OS1 A;  4IQ4 A;  2Y9Z A;  4B1R A;  4KIS A;  2EZK A;  1OCZ H;  2L9V A;  1PP7 U;  4KT5 C;  3JW4 A;  3JAM K;  2IGM A;  2W84 A;  1HXD A;  2EV6 A;  1Z7U A;  4A12 A;  2VJJ A;  1U6G A;  1Z91 A;  3TO9 A;  2QSG X;  4RM2 A;  5EEH A;  1WCM J;  4CHU A;  4J19 A;  2KLO A;  4O5V A;  2M0C A;  1FC3 A;  3BR6 A;  4A3M J;  1GDT A;  4FIS A;  3OYB A;  1JHH A;  4PGG A;  2YS9 A;  3TQN A;  1MBG A;  2RNJ A;  1K6O A;  3CJN A;  1QHH D;  1OKR A;  1RIO H;  2F5F A;  1FYM A;  4P55 A;  2XIG A;  3S93 A;  4NC7 A;  1FPQ A;  4M72 A;  4WCG A;  1OQY A;  2O0Y A;  4ITV A;  1KU9 A;  2ICW G;  4JP0 A;  3COA C;  4ZTJ A;  4EJT A;  2Y69 H;  3D0S A;  4PJN A;  3FMS A;  5B5E C;  1K78 A;  5L3G A;  4LG0 A;  2O8K A;  1ZGJ A;  1GVJ A;  2GIV A;  5JHU A;  5E20 A;  3RPU A;  4U0V A;  3KP6 A;  4ENJ A;  1VQ9 I;  3QQA A;  3FDY A;  2E60 A;  5BOX A;  1P7J A;  2AQF A;  4FET A;  2R7Q A;  3PFY A;  3GCM A;  3CTA A;  2O9L A;  2ADU A;  2JZY A;  5K5Q A;  4A3J J;  4Y33 A;  2K40 A;  2VOP A;  2F4O B;  3CCV I;  5DM7 F;  1T33 A;  1QZY A;  1XMK A;  3CO6 C;  4EV0 A;  4LIT A;  1Z1D A;  3FWE A;  2D45 A;  3GTQ J;  4WX9 A;  4N4O B;  1ZR4 A;  1FYK A;  1YE9 A;  3S8P A;  1W0T A;  1J75 A;  4G6D A;  5JR3 A;  4B48 A;  4M3D A;  5HNF A;  1MKM A;  1R58 A;  4NNJ A;  4C3I J;  2OQG A;  2Y0S N;  4HOB A;  3OOU A;  2HOS A;  4IHV A;  1Q1V A;  4XID A;  2ZFU A;  1SAN A;  1Y1W J;  1G3T A;  5JLW A;  4JBA A;  4LG3 A;  3JRH A;  1F36 A;  4DYQ A;  2XB5 A;  5IT9 Z;  2V26 A;  1ETV A;  3H92 A;  4ZYH A;  1R36 A;  4YEJ A;  4NB5 A;  3Q5F A;  2Y0S A;  1T39 A;  3I64 A;  4LOC A;  2BHZ A;  2M3A A;  1MMD A;  2DOA A;  2NVY J;  3VOE A;  3GTM J;  3FZV A;  4Q48 A;  3IAM 2;  1LVK A;  4XN3 A;  3IKT A;  3L2Q A;  1MSE C;  1BI0 A;  3BLY A;  4MFE A;  1GXP A;  1MSF C;  3L2W A;  2ECB A;  5IP7 J;  2VKD A;  2QSH X;  1JTY A;  4KDP A;  1O57 A;  2KP6 A;  2VBY A;  2VJI A;  2Z16 A;  2HOA A;  1S6L A;  2IP2 A;  4OIO F;  1TZL A;  2OF7 A;  2NXN B;  3WG7 H;  4QSH A;  1WSU A;  3OS2 A;  5FKN A;  3W2V A;  1H8A C;  5J1Y A;  1IXC A;  2NNN A;  3LNQ A;  3HEF A;  2HYF A;  1ZRF A;  5J8C A;  3E6M A;  1N77 A;  2UXX A;  1XG1 A;  2CMP A;  2HR3 A;  4CO8 A;  2VLA A;  1REP C;  4UUT A;  1S9H A;  3LQR A;  3JRC A;  3JAM Z;  2FF4 A;  3LWF A;  3F22 A;  2XSJ C;  1I5Z A;  2DFE A;  2BOL A;  2EBI A;  2O03 A;  2IVM A;  2XAJ A;  2VT3 A;  1LDJ A;  2RRE A;  4W1U A;  2AO9 A;  3DEE A;  4MEX F;  4YRV A;  4RAY A;  3OYH A;  2M34 A;  2ZJR F;  3MEX A;  2H6B A;  5K7H A;  2J5O A;  3MCZ A;  4B09 A;  5DUI A;  4O3M A;  2GOM A;  2P4W A;  4KIG A;  5HOO A;  3M8J A;  1JHF A;  2FOK A;  3PUF A;  4E6K G;  3BG7 A;  4CSW A;  2E5N A;  3R6S A;  4Y13 A;  1Z3X A;  2DA1 A;  4A3D J;  1A6I A;  4Y17 A;  5K7Z A;  5F0C A;  1ZG1 A;  1FBS A;  3AFH A;  4PFP A;  2XRL A;  3HKZ A;  4DJA A;  3EQL F;  1YFH A;  3S32 A;  3V7R A;  4D7M A;  1MBK A;  2W4S A;  4BU2 A;  2G7H A;  1BBY A;  3QWL A;  2H8R A;  1YQA A;  1IUY A;  1FX7 A;  2HGC A;  2LY2 A;  4WWC A;  3L2V A;  4BHP A;  2JQ7 A;  1W7P A;  1GT0 C;  2LDU A;  1RRJ A;  5FD5 A;  3BG5 A;  5HLG A;  1UG0 A;  3ABK H;  2ZJ2 A;  5M3F J;  2R7O A;  1V4R A;  4BKX A;  4FCY A;  4HG2 A;  2VKV A;  3MKL A;  1T6S A;  3GLL A;  4IJA A;  5DYM A;  1IJW C;  4IO9 F;  1BI2 A;  5AIQ A;  4KUM A;  1TLH B;  1WWX A;  1TT0 A;  4IHX A;  1D8K A;  3GZ5 A;  2HKX A;  2JT1 A;  2E2J J;  3HRT A;  1YYV A;  4BJ5 C;  2V6E A;  2E36 A;  1LNW A;  3I54 A;  5E18 F;  1W4M A;  1UB9 A;  2PX9 A;  5D5X B;  1UHW A;  4EJO A;  5LGT A;  2E7X A;  1CGP A;  2GXA A;  2DPD A;  2R7Z J;  2VC1 A;  1X1C A;  3JSO A;  2GZW A;  3K70 C;  1VQ5 I;  2JWT A;  3IL2 A;  5LBQ A;  2IW5 A;  3VDX A;  1IW7 F;  3RYR A;  1B1B A;  3PSI A;  3FXQ A;  4M74 A;  2XAF A;  2PN6 A;  1OPC A;  2RC4 A;  3TMO A;  3VEP A;  2NVX J;  3HXL A;  2E1O A;  3BQY A;  1OCO H;  4BEH B;  1QZZ A;  1IRX A;  3OL4 A;  1SMY F;  3FK7 A;  4H0E A;  1V3F A;  5CQE A;  5L3C A;  1LE8 B;  1QA6 A;  2M45 A;  2L5Q A;  3LQQ A;  4XLP F;  1A5J A;  1WI9 A;  2STW A;  1TWC J;  2NOG A;  3OL3 A;  4UUV A;  3SHF A;  4C9Y A;  1O4X A;  2JVG A;  5F0F A;  3J7Z I;  3HPH A;  2LSO A;  2PG4 A;  5TRD A;  2WAF A;  4LG0 B;  2EFN A;  2FX0 A;  1G4D A;  4G12 A;  3DWL E;  1HKS A;  2CW0 F;  3MKZ A;  2PLY A;  2XRO A;  3DKW A;  1U5T C;  4GGG A;  3D1N I;  2KIS A;  2LR8 A;  3DCF A;  3WOD F;  3JTH A;  1TT5 B;  5IPA A;  3OY9 A;  3HZJ A;  1WPK A;  3MAJ A;  3MMY B;  2R5Y B;  3VOD A;  3KEO A;  1ON1 A;  3F8M A;  4G6T B;  5KAI C;  4BE1 A;  3JSP A;  5F1R A;  5F27 A;  3ZRG A;  2X1C A;  2M4G A;  2WV1 A;  2WAD A;  4IXA A;  4IHS A;  1R9T J;  2HNH A;  2DFI A;  1OR7 C;  2ZC2 A;  4RMN A;  4YII A;  2DN0 A;  2XKO A;  1FMW A;  4Z6Y A;  5EG0 B;  3P9I A;  2ESH A;  2PJP A;  2HDW A;  3KEY A;  3VFZ A;  3OYL A;  1RUO A;  3GWZ A;  2HS5 A;  3SJM A;  1OCT C;  2YX4 A;  5DV5 A;  2IS2 A;  1S5L C;  1SD7 A;  1XSD A;  5ED4 A;  4XRS G;  1Y6I A;  4ASN A;  3A4C A;  2W1O A;  2Z1D A;  2NYX A;  1Z0X A;  1FJL A;  3EUK L;  4M6X A;  1CQT A;  2H8W A;  2RKH A;  2FNA A;  2EH3 A;  4I2O A;  3OIP A;  4U87 A;  3CUO A;  4S04 A;  3GFI A;  1BL0 A;  1N78 A;  1TP4 A;  2R5Y A;  2COM A;  1U9N A;  3L9F A;  5EYR A;  2FEZ A;  2XAS A;  2DBB A;  2VBZ A;  1IZ1 A;  2IA2 A;  3CCR I;  4CZZ A;  4JX6 A;  1MJA A;  4N4N B;  2VPR A;  4V19 K;  4NC8 A;  2O8X A;  3KEQ A;  3WTT C;  1XMX A;  2IA0 A;  4XLF A;  2QLZ A;  1UHS A;  1TWH J;  5CQG A;  5J1U A;  1YW7 A;  5FJ8 J;  4GDF A;  2FBK A;  1FSE A;  1XMA A;  2YU3 A;  2Z2S B;  2ZME C;  2F6C A;  3M3Y J;  1ZN2 A;  3C18 A;  2WY8 Q;  1QGP A;  5LHI A;  4F93 B;  2DTZ A;  2HVS A;  4M9Z A;  3A03 A;  3K1N A;  3A2K A;  2BZT A;  1UEL B;  1OYY A;  1UST A;  4BY7 J;  1KZH A;  4B47 A;  2RN7 A;  3L2R A;  5FLX Z;  2E1N A;  3ZMD A;  4XOR A;  2KIF A;  5D8K B;  4U7B A;  2HOT A;  2F4I A;  1J9I A;  2KFD A;  2MGQ A;  3BRO A;  3LSH A;  2BY0 A;  3JRD A;  2UV1 A;  4IEJ A;  2X6O A;  4B8X A;  4LLG F;  4RB0 A;  1POG A;  2HFH A;  3R4K A;  1ETO A;  1HA8 A;  1DDN A;  3H5R A;  2H1K A;  2FBH A;  3T8T A;  2ZKZ A;  1G6N A;  1WGX A;  2WTE A;  3HTS B;  1LFB A;  5C3E J;  3P5J A;  2L4M A;  2LRE A;  4HQM A;  2CQX A;  3FXL A;  4XKC A;  2E1M C;  2EIJ H;  2HQA A;  4LK0 F;  4K2E A;  3HOV J;  2R7W A;  1KU2 A;  1Z7L A;  2DJI A;  4ZDP A;  4X6A J;  1Z3Y A;  3DKX A;  1JUP A;  4Y4R A;  5H20 A;  5F04 A;  4JQF A;  4FX0 A;  5ICF A;  3ZQL A;  1YI2 I;  1OJL A;  3U2R A;  4L5E A;  1MBF A;  1S3J A;  3CDL A;  3GYH X;  2B9S A;  1IV6 A;  2DU9 A;  1W36 D;  1J59 A;  5ILU A;  2P7V B;  1ETX A;  1ETQ A;  2OZU A;  3QU3 A;  4A0Z A;  3MKW B;  3CME I;  4BDY A;  1IRG A;  1I39 A;  3G2B A;  3LFU A;  2EB7 A;  5FFX A;  3KZI C;  1RZ4 A;  2A6T A;  1J09 A;  1T8I A;  4PCQ A;  4KYW A;  3BWG A;  2H27 A;  3EYI A;  4B4C A;  3Q9V A;  2V79 A;  2MD5 A;  4D0P A;  5HS7 A;  5GTI C;  3KYL A;  2A6E F;  1X2N A;  5GPA A;  4RB1 A;  3JRA A;  3S3M A;  5CLS A;  2CV1 A;  2PFB A;  3I53 A;  3TOA A;  3K2Z A;  1SVM A;  1FOX A;  2YX7 A;  1VQ8 I;  4KIF A;  4OMY A;  3I4N J;  3FHN A;  3SFI A;  1I3Q J;  4WF2 A;  4EM2 A;  1JE8 A;  2FQ3 A;  2JJ7 A;  2W25 A;  2KRF A;  3A0B C;  3PM1 A;  2JPB A;  3IRQ A;  4Y15 A;  1FBU A;  2VBW A;  4HEA 2;  1HCR A;  1MNM C;  3WHC A;  2M0M A;  1VQ7 I;  2OAZ A;  3CLO A;  3L7W A;  1MMA A;  5DD8 A;  3ZQ7 A;  3W6K B;  2CGP A;  1MND A;  4UVA A;  1Z67 A;  2P6S A;  3GVA A;  1TWG J;  5L3E A;  1JI8 A;  2LRD A;  3HOY J;  1SD5 A;  5B1B H;  3QOD A;  3ERM A;  2W48 A;  1TC3 C;  2BW3 A;  2DT6 A;  4I0B A;  4BHC A;  3FX3 A;  5KHD A;  2E2I J;  1B4A A;  3HOT A;  3QYB A;  1P4W A;  3ZN0 A;  4XRF A;  3GEZ A;  3FBN B;  2A6H F;  3PQK A;  4IL6 C;  2OZ6 A;  2XPV A;  5F0H A;  3KP3 A;  1FWZ A;  3FMQ A;  5GAG J;  3I58 A;  2WAE A;  1KGS A;  3RKQ A;  4NQW A;  5E3M A;  4A3K J;  1HC8 A;  5CJ9 A;  5CVJ A;  5LEK A;  2ESN A;  2HQN A;  1TWA J;  2UUZ A;  1A04 A;  2A05 A;  2EA2 A;  1S7A A;  1SVO A;  2LBF A;  1HKT A;  1ONV A;  4KMF A;  1MH3 A;  3CUQ B;  4UB6 C;  1JKR C;  2FXA A;  3CCJ I;  3CQZ J;  4Y7N J;  2RGV A;  1I1S A;  2GAU A;  2H6C A;  2WC2 A;  2XAQ A;  3H9J A;  3IC7 A;  4UB8 C;  3LMM A;  2OU2 A;  4Q47 A;  2MG4 A;  3H35 A;  1OCP A;  3OYF A;  3V42 A;  3M1E A;  3E7L A;  4EJU A;  1LPQ A;  3BP8 A;  3HM5 A;  2VUM J;  4I0A A;  5TGT A;  1R1V A;  1OYW A;  4W97 A;  3IWF A;  2HWV A;  3MVP A;  1HSJ A;  2EIL H;  2E2H J;  2L2O A;  3ZMT A;  3CLQ A;  4PGH A;  2W82 A;  2XGX A;  3DTK A;  2DT5 A;  1I6H J;  2OCE A;  2DTR A;  2DMP A;  4D7N A;  1JGS A;  4N9H A;  4BH9 A;  1LDK B;  2EV5 A;  1AKH A;  3S16 J;  3ESW B;  2W57 A;  5IT3 A;  1RPW A;  3BOQ A;  5LFA A;  2HPI A;  1VI0 A;  1DU6 A;  2E19 A;  4AIJ A;  1T38 A;  3F8F A;  5E1W A;  4CYD A;  4XMY A;  2K9L A;  2RQQ A;  3DKY A;  4M9S A;  1H88 C;  3OV8 A;  5HDK A;  4IRI A;  2UWM A;  3AKZ A;  4A5N A;  1X3Z B;  4M3E A;  3FXJ A;  1OIS A;  4ESJ A;  2ID3 A;  3CUQ A;  1V5G A;  3SDG A;  5BNG A;  1VQN I;  4F3Q A;  5DM6 F;  4HX7 A;  1Q1H A;  4YFK F;  3HHG A;  2VJ4 A;  3JRB A;  3S1R J;  4HV5 A;  4PK4 A;  4RLF A;  1OLT A;  3C2G A;  3CDI A;  1MGT A;  2KDO A;  4PJL A;  2CV0 A;  2X48 A;  1XC5 A;  4I76 A;  1B6A A;  2FE3 A;  1IC8 A;  3A1Y A;  1WJE A;  3G4S I;  5JVG F;  2JTV A;  1AHD P;  3CC2 I;  3NAR A;  1YIJ I;  2RDP A;  2WA0 A;  2AHQ A;  3VYT B;  4JYK A;  3H3V K;  1OYI A;  3N05 A;  4A0Y A;  1B8I B;  3TW7 A;  1YX5 A;  2VKE A;  3R60 A;  5JI6 A;  2FJ1 A;  4XOP A;  5EG0 A;  4CGZ A;  4A3L J;  2BBY A;  1ZGA A;  3B6C A;  2F48 A;  2XAH A;  1KQ8 A;  2JA6 J;  3KLN A;  1OR7 A;  2K4B A;  1BIB A;  3LA3 A;  4BQA A;  3LAP A;  4BDZ A;  2OCC H;  1MBH A;  2FMY A;  3LFK A;  1IRZ A;  2PBI A;  2LD5 A;  1R1T A;  1VQ6 I;  1PDN C;  4UNO A;  3LSJ A;  2H1L A;  2TRT A;  4OIR F;  5K7F A;  3FK6 A;  3E1S A;  4UXN A;  4RB3 C;  1A36 A;  3TDU C;  3C3W A;  4HNU A;  2PJR A;  2ZJQ F;  4RM3 A;  4CDG A;  2QCO A;  3I9V 2;  1J7K A;  3E6B A;  5HOD A;  2KT0 A;  2QWW A;  3BR5 A;  5LGN A;  3ZMV A;  1B59 A;  4WK8 F;  2QA4 I;  1ITY A;  3GO5 A;  3ZOB A;  1BR2 A;  2LG4 A;  3M8F A;  2D5V A;  4XKV A;  3OYM A;  2X9D A;  3TP3 A;  2EFO A;  3LSI A;  4AU7 A;  2R4G A;  2MLK A;  1NG6 A;  4F91 B;  2F5E A;  2MLG A;  1B72 B;  1KQ0 A;  1QPI A;  3TDZ C;  4FQG A;  2FBI A;  2IPQ X;  2KMU A;  3KYD B;  5FKK A;  3MD2 A;  4ZJZ A;  1WJB A;  3M07 A;  1ZYR F;  1LQ1 A;  1Y8Q B;  2CQN A;  1S7E A;  3B73 A;  3O3K A;  4MEY F;  2R7R A;  4XLE A;  3HDD A;  2VOO A;  1I3A A;  1GUU A;  4LMY A;  2DOE A;  3GFJ A;  2DW4 A;  2CYY A;  3N4M A;  2LLK A;  2L3D A;  5L3F A;  2WB1 A;  5EZG A;  4A0X A;  2CWE A;  2HYJ A;  3I0T A;  4L9N A;  3E6C C;  3CDH A;  2XRN A;  4DIQ A;  3BZ6 A;  4MTE A;  5BPI A;  3ZMU A;  3IP4 B;  1FTT A;  4MLO A;  3RYP A;  3OIO A;  1OMI A;  3D5L A;  2QZ8 A;  3DBL B;  3N97 A;  2HQR A;  1BA5 A;  2YU9 J;  3JRG A;  2A69 F;  2LY1 A;  2WB1 N;  2A3S A;  2DQL A;  2M9H A;  5JVT A;  1R49 A;  3H5N A;  4C3J J;  4ENM A;  1JJ6 C;  5D4R A;  2XAU A;  2EIN H;  2X0L A;  4RA2 A;  4EEF G;  5D5V B;  4XNF A;  2Y30 A;  4LB5 A;  4L0Y B;  1IV8 A;  4HLX A;  4L0Z B;  4RS8 A;  2WAQ N;  1ZHF A;  4RAZ A;  5L3B A;  3SZP A;  2QQ8 A;  2BW3 B;  3EPZ A;  3ABM H;  3B02 A;  2KRC A;  3T1B A;  1KQ9 A;  2XPW A;  3CJQ B;  4KIC A;  2O61 A;  1YIT I;  4ZH4 F;  1F5T A;  2F5C A;  4N0B A;  2HXI A;  1VF9 A;  2QQB A;  2CW8 A;  2IRF G;  4U0W A;  3TBI A;  3L2U A;  4I99 C;  3ISP A;  3HTU A;  5A2Q K;  4A93 J;  2DYR H;  3EYY A;  4BBR J;  4KN4 X;  2IXS A;  4D9J A;  2VJ5 A;  2ZJP F;  4Z2Y A;  1T0F A;  2CV2 A;  3BG6 A;  4KMU X;  2DMT A;  3BZK A;  1X2M A;  2E35 A;  2NRA C;  2FUG 2;  4L18 B;  2CFO A;  3RTR A;  3I4P A;  1G3S A;  2OQR A;  2EV0 A;  1FTZ A;  2D1H A;  1CF7 B;  1MD0 A;  2L9S A;  2YPR A;  4WXD A;  5J8F A;  2B63 J;  5K5R A;  2JUC A;  2QEX I;  3BDD A;  2JA7 J;  3BTC A;  1I50 J;  2DDB A;  2VI6 A;  4BAY A;  1W36 C;  1HST A;  1R00 A;  1XTA A;  1MMN A;  2I10 A;  2WV0 A;  3OR1 C;  1XGS A;  4YEL A;  3CCS I;  3QPT A;  3PO2 J;  2QKM B;  3DQV C;  4UY8 I;  5HS8 A;  1BW5 A;  2CUZ A;  4XBF A;  4AUX A;  1H89 C;  5KK1 A;  3ZN1 A;  1VFC A;  1IO2 A;  4BQO A;  3PNV A;  2F5V A;  2VN2 A;  4LB6 B;  1W7P B;  3FBI B;  1Y8R B;  2CQK A;  4X1E A;  1AKH B;  5FKL A;  3FHZ A;  3W2W A;  3OYJ A;  3FXM A;  1XDU A;  2X85 A;  3HJE A;  4HX8 A;  2KJC A;  1SVL A;  4FE7 A;  2DA2 A;  2E5Z A;  1FYL A;  1TQM A;  3QYF A;  3V8L A;  2V4J C;  1G3W A;  3ONQ A;  3RI4 A;  2R93 J;  2HVR A;  4CCO A;  1VQM I;  2GXG A;  2E1C A;  1E2X A;  1ZAO A;  5CVV A;  4XLN F;  1RR8 C;  2DA7 A;  2GIZ A;  2XKP A;  3ASO H;  2XUB A;  2O3F A;  3VWB A;  3K10 A;  3MN2 A;  3VB2 A;  5FKM A;  1ZG3 A;  1BR1 A;  1S29 A;  3OR2 C;  5FLM J;  3TKY A;  1RC9 A;  4HQE A;  4MNU A;  1I1G A;  3ZQG A;  2KJB A;  4A6E A;  1G2H A;  5ICE A;  3ELK A;  2LOO A;  1QU3 A;  2K86 A;  1DP7 P;  2IJL A;  2OA4 A;  3BG9 A;  2DMQ A;  3GW2 A;  3ZQI A;  1PUE E;  4IQJ A;  4RGX A;  4G8X A;  2LNB A;  3A02 A;  2MW8 A;  2X6X A;  4P96 A;  3F8B A;  5M5X J;  4XLA A;  4LLL A;  3IV5 A;  1TWF J;  1ERD A;  3LST A;  9ANT A;  3F6V A;  1FT9 A;  5DEQ A;  2B7E A;  5DCM B;  2XVC A;  1D5Y A;  4L9T A;  5J6X A;  2NOJ B;  4HST A;  4C2M J;  3F8N A;  1TW3 A;  2DT7 B;  3CJT B;  2LKX A;  2OTJ I;  2FD5 A;  2MD0 A;  3VYU B;  3GTP J;  4E7J A;  3CC4 I;  2NS7 A;  1F4K A;  3BPV A;  2EWN A;  2HKO A;  4XON A;  4ANJ A;  4CYC B;  5LEJ A;  4KIT B;  3LOC A;  1ENH A;  4E7L A;  2BVM A;  1YJ9 I;  4A3C J;  1QRY A;  1SFK A;  5FGM A;  2Y31 A;  4QWQ A;  4EQQ A;  2W24 A;  2N8G A;  2V9P A;  3W6V A;  1ACI A;  1W5S A;  2BVL A;  2P8T A;  2L01 A;  4YIF A;  2JA2 A;  5A2Q Z;  2E34 A;  1ZKG A;  3R61 A;  4EM1 A;  2M87 A;  2E71 A;  2UZK A;  2DA4 A;  1YHQ I;  2R7T A;  3LSK A;  5D5W B;  1Z9C A;  2MC4 A;  3V8K A;  1MIJ A;  4C30 A;  3S14 J;  3HUG A;  3RQI A;  2DK5 A;  1B72 A;  3GXO A;  4XKW A;  3BQZ A; 
#chains in the Genus database with same CATH homology
 1ETX A;  1ETQ A;  3GTJ J;  2HXO A;  2ELK A;  1APL C;  4A3G J;  3L1P A;  2XSD C;  3ZQH A;  3Q0W A;  4FE4 A;  3OSF A;  3K7A J;  4M6V A;  3QPS A;  3ZQF A;  1FEX A;  3Q0U A;  1JT6 A;  5EDN A;  3GBG A;  4B4C A;  2LFB A;  2LY9 A;  5EGO B;  1X2N A;  5GPA A;  3JRA A;  4DW6 A;  4M3G A;  3BTJ A;  3GTL J;  3S15 J;  3I4N J;  4DZJ A;  3SFI A;  1I3Q J;  4A3B J;  5GPC A;  3S1N J;  2K9Q A;  2JJ7 A;  2DA5 A;  1JKP C;  2DMU A;  3PM1 A;  3BTI A;  1HCR A;  1GV5 A;  3G1L A;  4B1R A;  2Y9Z A;  2EZK A;  1DU0 A;  1MNM C;  3VPR A;  3IH3 A;  3WHC A;  5M5W J;  4V2F A;  1ZTR A;  1OFC X;  2G0E A;  2L7Z A;  1RKW A;  1NTC A;  4DYR A;  2NVT J;  3A01 B;  1ETY A;  1JGG A;  3HOZ J;  1ETW A;  1WCM J;  1TWG J;  2ZB9 A;  4J19 A;  4A3M J;  2M0C A;  2YUS A;  3BR6 A;  1GDT A;  3HOY J;  3HOU J;  2K9S A;  4FIS A;  1MBJ A;  1JKQ C;  2W48 A;  1TC3 C;  2YS9 A;  2KDZ A;  1MBG A;  2E2I J;  5J1R A;  1K83 J;  2L0K A;  3HGY A;  1BJZ A;  4I6Z A;  5F0H A;  2XPV A;  4AC0 A;  1HDP A;  4JP0 A;  2HI3 A;  3RKQ A;  3GTO J;  4V2G A;  5E3M A;  5IYD J;  4A3K J;  2L7F P;  1TWA J;  5IP9 J;  4GFB A;  2O8K A;  1HF0 A;  1MH3 A;  1JKR C;  3QQA A;  3CQZ J;  4Y7N J;  4S0H B;  1Z77 A;  1P7J A;  5E3L A;  1U78 A;  2MG4 A;  4A3E J;  1OCP A;  3S1M J;  2O9L A;  2VUM J;  3E7L A;  3HM5 A;  4A3J J;  2K40 A;  4MIM A;  4W97 A;  1T33 A;  1GV2 A;  3MVP A;  2E2H J;  1VND A;  3H0G J;  1LFU P;  3GTQ J;  1I6H J;  3CMY A;  3LSR A;  2DMP A;  4D7N A;  1ZR4 A;  1PUF A;  1W0T A;  3BT9 A;  1T56 A;  1AKH A;  3S16 J;  4M3D A;  1RPW A;  5C44 J;  2JN6 A;  4C3I J;  1VI0 A;  2LTP A;  2Y0S N;  1LE8 A;  1DU6 A;  3OOU A;  1JUM A;  2E19 A;  2HOS A;  4IHV A;  1K61 A;  1Q1V A;  4XID A;  1SAN A;  1Y1W J;  1H88 C;  5JLW A;  3JRH A;  2CQQ A;  1F36 A;  4DYQ A;  2JA5 J;  2XB5 A;  3TED A;  3TW6 A;  4M3E A;  1ETV A;  2ECC A;  2ID3 A;  3G1M A;  3QPL A;  1YRN B;  5FLV A;  3IH2 A;  3SDG A;  5BNG A;  5M3M J;  4LOC A;  2NVY J;  3BR0 A;  2CJJ A;  3JRB A;  3S1R J;  4A3F J;  3GTM J;  2XB0 X;  5C4X J;  1MSE C;  4NDL A;  1ZGW A;  4MFE A;  2X48 A;  1XC5 A;  4I76 A;  1MSF C;  2ECB A;  1WH5 A;  5IP7 J;  1WH7 A;  1JTY A;  3BR2 A;  1IC8 A;  4BXX J;  1UG2 A;  2HOA A;  4FTH A;  4QTR A;  3CCY A;  1AHD P;  2OF7 A;  5DS9 A;  4QSH A;  5FKN A;  3NAR A;  1H8A C;  2AHQ A;  2RAE A;  5J1Y A;  3FIS A;  4JYK A;  4JX5 A;  3A01 A;  1B8I B;  2GM4 A;  3H3V K;  3TW7 A;  2VKE A;  3JRI A;  1PUF B;  5M5Y J;  2FJ1 A;  1NK2 P;  3LNQ A;  3HEF A;  5EG0 A;  4A3L J;  3LSP A;  3LSG A;  4AYB N;  3B6C A;  1XG1 A;  1QVT A;  3JRF A;  1SFO J;  2JA6 J;  4BY1 J;  2DA3 A;  4UUT A;  2CUE A;  1ZR2 A;  3JRC A;  2HQ5 A;  3HBL A;  4QIW N;  1UMQ A;  1MBH A;  3Q0V A;  1IDZ A;  1YRN A;  5JLX A;  1IRZ A;  2LD5 A;  2EBI A;  5EF6 A;  3LSJ A;  2TRT A;  4W1U A;  3TP0 A;  2AO9 A;  5K7F A;  3FK6 A;  3BG3 A;  4IHW A;  4JX4 A;  2M34 A;  3IH4 A;  2CUF A;  5K7H A;  2K9N A;  1IG7 A;  2QCO A;  3M4O J;  5HOD A;  1MBE A;  2KT0 A;  3BR5 A;  2CU7 A;  3BR1 A;  4XRS A;  2DA1 A;  4A3D J;  3ZOB A;  1A6I A;  5K7Z A;  2OPT A;  1ITY A;  5F0C A;  4B3A A;  2XRL A;  2D5V A;  2X9D A;  3TP3 A;  4D7M A;  1MBK A;  4XK4 A;  2FQ4 A;  4ABZ A;  3BR3 A;  4D5C A;  2H8R A;  1B72 B;  1QPI A;  2EZH A;  5FKK A;  1GT0 C;  5C4J J;  1IGN A;  3BG5 A;  5M3F J;  3ZQC A;  4BKX A;  4FCY A;  1S7E A;  4C3H J;  2EZI A;  2VKV A;  3MKL A;  2COB A;  5DTD A;  3HDD A;  5F08 A;  1U9O A;  1GUU A;  2GBY A;  5IYB J;  1IJW C;  3S17 J;  3WHB A;  2LLK A;  3RZO J;  5EZG A;  1RR7 A;  4IHX A;  2HYJ A;  2E2J J;  1FTT A;  4MLO A;  1BA5 A;  3OIO A;  5FKO A;  1GVD A;  1ZK8 A;  3JRG A;  2YU9 J;  2DA6 A;  2NVQ J;  4CYC A;  2DJN A;  2WB1 N;  2R7Z J;  2M9H A;  3NAU A;  3BTL A;  4C3J J;  1JJ6 C;  2JWT A;  2NS8 A;  4EEF G;  2Y30 A;  3GTG J;  4RBO A;  3HKZ N;  1WI3 A;  3FIW A;  1ZQ3 P;  1W0U A;  2WAQ N;  1HDD C;  4IHY A;  2O7O A;  2NVX J;  2E1O A;  3BQY A;  2XPW A;  3GTK J;  3FK7 A;  3C2B A;  3PO3 J;  2M2E A;  1JTX A;  3B6A A;  4MO7 A;  1LE8 B;  2XGC A;  1FIA A;  1A5J A;  1TWC J;  2Y9Y A;  2NOG A;  2HXI A;  1VF9 A;  1Y1V J;  3DEW A;  4A93 J;  1O4X A;  5F0F A;  3JRE A;  4RDU A;  1EF4 A;  4BBR J;  3K2A A;  2JMW A;  5GP9 A;  3S2H J;  2FX0 A;  2L9R A;  4G12 A;  2DMT A;  1X2M A;  1RKT A;  5EGO A;  2MSY A;  5E3O A;  5EEA A;  3D1N I;  2LR8 A;  3DCF A;  2HDD A;  5IPA A;  2CRG A;  1WPK A;  2R5Y B;  2IAI A;  1FTZ A;  2IEK A;  1JJ8 C;  2B63 J;  2JA7 J;  2ME6 A;  1RET A;  1I50 J;  2VI6 A;  3BTC A;  5F27 A;  3Q3S A;  2WV1 A;  2I10 A;  1R9T J;  3HOW J;  1FIP A;  5J3L A;  3PO2 J;  2DN0 A;  1AU7 A;  2XGD A;  5IOY A;  5EG0 B;  1IUF A;  1BW5 A;  4A69 C;  2JA8 J;  1IDY A;  4AUX A;  5IOZ A;  1H89 C;  2R5Z A;  3SJM A;  1OCT C;  1VFC A;  2L7M P;  4XRS G;  4BBS J;  3G1O A;  4X1E A;  1AKH B;  5FKL A;  1Z0X A;  2R0Q C;  1FJL A;  1CQT A;  2EZL A;  2EH3 A;  4FE7 A;  3S2D J;  4Y52 J;  2DA2 A;  2Y2Z A;  1BL0 A;  2QF7 A;  3UKG A;  1JKO C;  2R93 J;  1ETK A;  2R5Y A;  1U9N A;  5EYR A;  1RES A;  2DA7 A;  1F43 A;  4JX6 A;  4UUS A;  3OSG A;  3MN2 A;  5FKM A;  2LP0 A;  2VPR A;  5EZH A;  2XGE A;  1U8B A;  5FLM J;  3ZQG A;  4M3B A;  4D5F A;  1G2H A;  1UHS A;  1TWH J;  4MFD A;  5J1U A;  5FJ8 J;  4XIC A;  1HOM A;  2IBD A;  1BW6 A;  3BG9 A;  3HB9 A;  2DMQ A;  4HNV A;  2R5Z B;  3ZQI A;  4M3F A;  4DYC A;  3M3Y J;  3A02 A;  2MW8 A;  2DTZ A;  5M5X J;  3IV5 A;  5E3N A;  2P81 A;  1TWF J;  1HLV A;  1JT0 A;  9ANT A;  3A03 A;  4A3I J;  1ORK A;  1NK3 P;  1X58 A;  4BY7 J;  1D5Y A;  3JR9 A;  2ME0 A;  4C2M J;  2R92 J;  2HOT A;  5F1J A;  1E3O C;  2MGQ A;  5IP6 A;  2LKX A;  2TCT A;  3O8H A;  3RZD J;  2FD5 A;  3FKI J;  3O8G A;  3GTP J;  3JRD A;  2NS7 A;  4IEJ A;  1JUS A;  2X6O A;  2XPU A;  4UUS B;  1POG A;  3HOX J;  1ETO A;  4CYC B;  2ID6 A;  2H1K A;  2DMN A;  3LOC A;  1ENH A;  2LVS A;  4A3C J;  1QRY A;  1WGX A;  1LFB A;  2Y31 A;  5C3E J;  2CQX A;  3S1Q J;  2N8G A;  3W6V A;  2LK2 A;  2JK3 A;  2GLO A;  3HOV J;  5IYC J;  1QVU A;  4X6A J;  1ZKG A;  1JUP A;  1XS9 A;  3HGG A;  5F04 A;  3I4M J;  3ZQL A;  2EQR A;  2DA4 A;  1OJL A;  1MH4 A;  4L5E A;  1MBF A;  3F0C A;  4DZP A;  3CDL A;  1B8I A;  1P7I A;  1IV6 A;  3RQI A;  3S14 J;  2M8G X;  2PMZ N;  1B72 A;  4XRM A;  3BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...