2VQGA

Crystal structure of porb from corynebacterium glutamicum (crystal form i)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
76
structure length
76
Chain Sequence
LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN CGL0972
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
total genus 31
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqgA00
2VQLA 2VQGA 2VQHA
chains in the Genus database with same CATH superfamily
1IUFA 3ABUA 4A3MJ 4I99C 2EA2A 1PVEA 2P6TA 3S8PA 4JYKA 5FO5A 1J0RA 3KZYA 3GO5A 4PFPA 2R93J 3GCMA 1VQOI 4EM1A 3S1NJ 5HLIA 5E1ZB 4I01A 2KJBA 1H9GA 2CYYA 4C3JJ 1OISA 2LKPA 4PZJA 2UWMA 4MTDA 3A4CA 5JVGF 1RKTA 2D5VA 3CC4I 3KYCB 3PSFA 1A5JA 3GZ6A 3HRSA 3O2PE 2L02A 3FHZA 4I2OA 2M4KA 2UUZA 2YUSA 2QWWA 2W57A 2MC3A 2L2OA 3H36A 3KYLA 3BG6A 3FXOA 4I76A 5J40A 1T38A 3EUKL 3W2WA 3LSTA 1USTA 3U9GA 3RI4A 1X1AA 2KKOA 5F1JA 2ACJA 3VDXA 1X1BA 1X1PA 3QYBA 2ZSHB 3DTKA 5FKLA 4AD9A 5DS9A 2QLZA 2FOWA 3QP5A 1ETWA 3F6VA 3WTYC 2DFFA 2LD5A 5DDGA 3CMEI 1BI3A 2LLKA 5TISC 3I55I 5DD8A 4B4CA 2XF7A 1UJ8A 3QU3A 3FXJA 3HXLA 1YTYA 1BN5A 3K9TA 1RIOH 3HHGA 2CUZA 2ZXWH 3FK6A 5DYMA 3E0JB 5FFZA 4PJLA 5AIPA 2EV6A 3QYEA 1D8KA 2BV6A 3GTGJ 4WXDA 5KCMA 5L3GA 1W5CC 5EEAA 2DMUA 4XMYA 1RZ4A 3CDIA 3P7NA 3LSGA 3U21A 5IY5H 2JA6J 2FJ1A 1OLTA 2X85A 4GRIA 3SDBA 3ISPA 4BL0B 4ABZA 4OIPF 1JGSA 4YIRX 1IXRC 1K6YA 1HW5A 2KDOA 4BDZA 3V8JA 3SDGA 1EF4A 1WJ5A 1J2XA 2EPFA 2VT3A 3BR2A 3GMEA 2LYCA 3BROA 3DTIA 1HCRA 4BQAA 5J4VA 2EFOA 4M72A 5FKNA 3PM1A 3G1LA 4PDKA 4LMYA 5F6FA 2EFWA 3JRDA 3FMSA 2B9SA 3MQ0A 5E17F 1MH3A 1MGTA 5JLWA 4O3MA 3S17J 2W25A 1JHHA 1YOVB 2XGCA 2G7UA 3VSLA 2F48A 2IBDA 1R22A 3I58A 2BE5F 5H20A 4BHCA 5J4YA 4ZYEA 3MFKA 3J80Z 3MN2A 3OOUA 1FIAA 5E3OA 2LH9A 4HAMA 2VXZA 2M4GA 1D0YA 2E1NA 4CYDA 3RKQA 4BHBA 3EYIA 1B9MA 1NHAA 2HVSA 1BI2A 4Y33A 4Q5SF 2Q0OA 3O8GA 2EH3A 5LGTA 3G73A 2DPDA 3LFKA 2QBYB 2H8RA 1BIAA 1AKHA 2W00A 4DYCA 3EPZA 2PMZA 4XIDA 4BY1J 3L09A 4WWCA 1I50J 4EJWA 4ZYGA 5E8GA 1T8IA 1YW7A 1R71A 3EDPA 5CQGA 1XC5A 1RUOA 4LK0F 3VSKA 5EF6A 1SD6A 3DPTA 3JW4A 4IQJA 2R4GA 5J8CA 4OAZA 3J81Z 2KJCA 1JKOC 1IXCA 1YW9A 4D5CA 3KP5A 3KEQA 5ERIA 2E1OA 4BBRJ 3FX3A 1FX7A 3KEYA 2OQGA 4MFEA 2ECBA 2ZBKA 1R4NB 4PSXA 1Z9CA 5DCFA 2VJIA 3BJOA 1T0FA 4P9FA 2ZXJA 1EH7A 2QA4I 2FMLA 2PJRA 2H6BA 3I0TA 5CVJA 4BEHA 4WCGA 1VQ5I 4BDYA 3ZPLA 2KQRA 4IJAA 3AAFA 3FXUA 1HLVA 4P96A 1P9QC 2ZSIB 3HTUA 3QOPA 5EYRA 4D7NA 3ZQCA 4CGZA 4ZDOA 3AL0C 2HXIA 3H9QA 2LR8A 5D8KB 3S3MA 1B1BA 2IXSA 4KISA 2JT1A 1RC9A 5JR3A 3K6GA 4FTHA 1SD4A 1U9OA 1SD5A 3GEZA 3DPUA 3HPHA 1QPIA 2K4BA 3FM5A 4BQNA 2LMDA 5CKTA 3GTKJ 3ZMUA 1T95A 4CICA 5CVIA 2R7QA 4FASD 2OZUA 4F7ZA 3K2ZA 4FQGA 2OTJI 3HGGA 3RDIA 3LFUA 4LLNA 2AQEA 2P7VB 3TOAA 1YRNA 2L54A 4L0ZB 2HOEA 1R23A 5TRDA 2K9QA 3IH3A 3TDZC 3VYSB 1QVTA 1OYWA 2PJPA 2M34A 3OL3A 5D4RA 2DOAA 3CCEI 2LFBA 5HLGA 3OYMA 4QTRA 1W0UA 2ZB9A 5D6FA 4XQFA 4OIQF 2ZKZA 3K4KA 3PQJA 2I10A 4RLQA 1WHUA 1DP7P 1D1AA 3M1CA 2JVHA 2BZTA 1TW2A 4CYCB 1XSDA 1ZKGA 3H5RA 3IAM2 1TTYA 1OR7A 2LP0A 3DFGA 3O3KA 2PG4A 1ETKA 5GAHJ 3QYFA 1LEBA 1AKHB 5JVTA 3HRTA 1WPKA 2FNAA 2IGKA 3IRQA 2P0WA 2JUCA 3AG3H 3JR9A 3Q0VA 4JK1X 5EGOA 4M9ZA 4E4HA 2XGEA 3S2WA 1LJ9A 2OCCH 1W7PB 1RR8C 1Y39A 2O7OA 3FXLA 4IHXA 2LBFB 2EJRA 1R5ID 4IRHA 5ICEA 2DA1A 2F4OB 4KICA 3L7WA 3VYRB 2VB6A 4DQ2A 2K9NA 1PUFA 5FLVA 3PFIA 5CJ9A 2AXLA 2DMTA 1BI0A 1HQCA 3PNTA 5DUKA 2VKEA 3H0GJ 3A2KA 2XB5A 3G1OA 5F27A 4EJTA 1JI8A 1UCRA 1JJ6C 4BBSJ 1WZ2A 1QNTA 2IGMA 1Z3YA 1Q1HA 1WRJA 5D6EA 4QSHA 4AYBN 2R3SA 2CQKA 2PJRB 1LKXA 3IAS2 1ON1A 1ZLKA 4MGRA 2IRFG 3IC7A 4JX4A 2V9PA 2E2IJ 4RDUA 3KLOA 5C3EJ 1Z67A 5M3MJ 2DI3A 1K78A 5GADJ 1S9HA 3TGNA 2R7WA 5AIQA 3CZ6A 5KK1A 4CXFA 1G3WA 3X2QH 1WFXA 2TRTA 3H92A 1FYMA 4FX0A 4N0BA 3GTQJ 3K10A 3KYDB 1GHCA 4ESBA 1W5SA 4LIVA 3VB2A 2GWRA 4PGGA 2DLLA 2G0EA 4MIMA 1HSJA 3T8TA 2Y0MA 2NVQJ 4LOCA 1ERDA 1MH4A 1KU7A 3ZMTA 1ZN2A 2HGCA 4L5IA 1QHGA 3EETA 1KU9A 2VQHA 2DDAA 3MKWB 2ELHA 3ECHA 2BOLA 1YRNB 3TO7A 3K0LA 4HX4A 5LRRA 1C0WA 3HKZA 4XKWA 4OU0A 1NH3A 1ZHFA 5K7HA 1U6GA 3KZIC 4E6KG 3M9AA 5HS9A 3F22A 4IX7A 2GAUA 4MTEA 3WE2A 1AHDP 4M6YA 1F5TA 1FEXA 1E2XA 4A3IJ 2Y9ZA 2W48A 4HQMA 2K7LA 5IYBJ 2GIZA 2HI3A 3CCMI 4BE2A 1IDYA 5KHDA 4C9YA 4C2TA 1W36D 1NG7A 3FXKA 1Y6IA 1Z05A 3JRAA 2OV7A 2Q2EA 2VKVA 1SANA 2F5CA 4FHTA 5E3LA 5EZGA 1S7AA 4PUSA 2CV0A 4IXAA 1J9IA 4WXCA 3E6CC 2VC0A 2Y9YA 1E3HA 1ODDA 4AIHA 1HF0A 3K2AA 2YSRA 2LY2A 1T2KA 4OIOF 3ZN1A 3WHBA 2D2WA 3K70D 4XICA 2BHZA 2IGOA 4DZPA 3HRMA 4NDLA 5GAEJ 3M3YJ 3UR3C 1X3WB 2ADUA 2DA5A 2EFNA 4XRFA 2WB1N 4NQWA 1MIJA 2CSOA 4QPQA 3P9IA 2R7OA 3DU6A 2H6CA 2CH0A 2RNGA 4MLOA 1B6AA 3DLLF 3K4CA 5M5WJ 3F8BA 4A3FJ 4IL6C 4Y17A 1OJLA 2EA4A 5HS8A 5BOXA 3OYIA 3W6JB 3P5JA 3RZDJ 4UVBA 4KT5C 1JKQC 1G4DA 4M3DA 4LIUA 4KDPA 3Q5FA 1JKPC 2ZO4A 1I39A 2B63J 2M8EA 4FE4A 5DEQA 1UAAA 2VKDA 1JUPA 1IN7A 1OR7C 1QGPA 5BPIA 1ONVA 2CQQA 2P81A 4KIFA 3CJTB 5HLHA 1DGRM 1LVKA 1ZTRA 4F91B 1LB2A 3HSRA 4HBLA 1K4TA 3CUOA 1ZG3A 2Y48A 3OS2A 2JPBA 2HPIA 4AC0A 3HSFA 4BHPA 1WQ2A 3E6DA 3LAPA 1S5LC 4C2MJ 1BI1A 2D45A 1ETOA 3TP3A 4QLCU 2F4IA 1I3AA 3CF5F 3WTUC 1SD7A 1I6XA 3NARA 1DU0A 3PO3J 1PUEE 1L3LA 2OCEA 5FRMA 1VQ6I 3OR1C 3RPQA 1NK2P 2Q8KA 3L2RA 4ZC3A 3QPHA 4HNUA 1IZ1A 2AXTC 3T8RA 2XASA 2F2EA 2VQCA 5BMZA 1MBFA 3NAUA 4KJZA 5D5XB 2DOFA 4RA2A 2EWNA 1ZG5A 3AG1H 5HDGA 1DUXC 2H94A 2RREA 4WK8F 3BZCA 2Q2EB 3FBNB 2O6GE 1BW5A 2IJLA 3MZHA 1FIPA 2CW8A 3OYKA 3H9GA 2WA0A 2KISA 3GWZA 3IV5A 1Y1WJ 4W97A 2HOAA 5ILSA 1QZYA 4YRVA 4KITB 4KFCA 3ZP5A 1NK3P 4HF2A 3BTCA 5IT3A 3M8EA 2L01A 4FCYA 3VYUB 5EEGA 2KZVA 2W85A 3DBHB 3WU2C 4E7LA 3H3VK 4CZZA 2LOOA 2EK5A 2WTEA 3E5QA 3JAMK 1D8JA 3I59A 3I4PA 3QWLA 1XGSA 4LITA 4RAFA 1KU3A 2DFEA 5E8IA 1SAXA 4YG2F 5K7ZA 1LE8A 3I53A 2K4JA 1POGA 4A3CJ 5EJCA 1USSA 1K83J 3S2DJ 2YX7A 1X1CA 2XPVA 1FY7A 3HEFA 2NVYJ 5D4SA 4B3AA 2IS4A 5CYVA 2WV0A 4A3KJ 4WXHA 2UZKA 3LA3A 3ERMA 3F6OA 2KRHA 2PMHA 1YJWI 1T33A 5K5OA 2X1EA 5HODA 1FMVA 2NVTJ 2J5PA 4V2FA 4UVCA 2KT0A 3CCJI 1R4MB 2PN6A 3DTEA 3IH2A 4NC7A 3CF2A 3NQOA 3MZYA 5M5XJ 2E71A 1Z21A 1FYLA 3V4GA 2JSPA 3E6MA 1J5YA 4AU7A 2MA3A 2QM3A 1OMIA 3ECOA 3PNYA 3ABKH 1GUUA 1R5GA 3KP2A 2E2HJ 3LL7A 4IF4A 1TL8A 4XKCA 2FQ4A 3VEPA 2CV1A 2IS2A 3KZZA 1S7OA 1JHFA 2NS0A 2L9SA 3CDLA 1FSEA 3DKYA 2OTLI 2FD5A 5L3DA 4OINF 1N25A 4BXXJ 1FPQA 4A3JJ 4BE0A 4HEA2 1ZR2A 2EV5A 3TQNA 2FXAA 3BLYA 4Y52J 2COMA 3SZPA 2Z9OA 2FU4A 2MBFA 2V7FA 2VN2A 4MFDA 5B1BH 3CJRB 3G71I 4QWQA 1MD0A 3UKGA 3ZXSA 2Z33A 1AA7A 3NEUA 4IRIA 2XB0X 1DPRA 1TP4A 4I0BA 5FGMA 1A31A 2WY7Q 3SXYA 1B4AA 2JA7J 1G3SA 1UHWA 2HQAA 1D5VA 1FOXA 4C3IJ 5FD6A 2ZJ2A 4EV0A 3I71A 4LG0A 4I0AA 3U1DA 2VOPA 2HNHA 3I59B 4AM3A 4BU2A 2CGPA 3PL8A 1WVRA 2BGCA 4KNYA 2QKMB 4H0EA 4IHYA 2A3SA 1FBUA 2LNBA 3HL2A 1LE8B 3OYNA 4HX8A 1BM9A 2FOKA 2I5UA 2M1BA 1B72B 2I8DA 2HTSA 2KP6A 3GZ5A 1QBJA 2XGDA 2MLGA 1VQNI 2VBZA 1MMNA 2F6CA 4PJ0C 3KCCA 1NG6A 3L2CA 3A01B 4QIWN 4HLYA 4ESJA 3Q9VA 4LGWA 2STTA 5H2FC 1ZARA 3WTVC 2LF7A 3E6BA 2VQLA 2MD0A 3KP7A 3A1YA 4B44A 4CH7A 2LY1A 2VUMJ 5FLXK 3GLLA 2DT7B 5ICFA 1SVOA 3A0HC 3HPGA 2RKHA 3LQRA 3M1EA 1OCTC 3ZQFA 4F52A 3HOTA 4A0ZA 1CQTA 1RRJA 1HOMA 1YJ9I 1JTYA 4YIFA 3DEEA 3ABTA 4E7JA 3GVAA 1NTCA 2IA1A 3RQIA 4MO7A 4A6EA 1VQMI 3RKWA 5IYDJ 3CCRI 2DK5A 3G4SI 2XSDC 1IF1A 3A03A 1ZR4A 1XSVA 3HOZJ 1X3ZB 5ICCA 1ACIA 3GZNB 1VQ9I 5H6QA 5EDNA 2Z1DA 2FSWA 4EJVA 1D1CA 3F21A 3FXRA 4S05A 1IC8A 4IRGA 1SMYF 3BY6A 4XLPF 5E20A 3GTLJ 2QQ9A 1HA8A 1QZZA 1H8AC 2BY0A 2QBYA 1XGMA 2VPRA 2VODA 2L7ZA 1IDZA 3QODA 2IW5A 2DFHA 2WV1A 3CMMA 3SYTA 4DYQA 3RIRA 4RBOA 2V26A 3ZMDA 4BS9A 2M0MA 4U7BA 3BG9A 1OCCH 2MYSA 4W1UA 4B8XA 2VE8A 3SQNA 5HOOA 1UELB 2DTZA 2PFBA 2PBIA 4HQEA 2M7BA 4G7ZF 1R6RA 1SVLA 3KP4A 2CQXA 4EGZA 2Y0SN 4NUBA 3WG7H 4R79A 3LSPA 1LEAA 3BOQA 1VQPI 4P1WA 4NB5A 2E34A 2L7FP 2WAQN 2XVCA 4IHTA 5K5QA 3QP6A 3LSMA 1YW8A 2X51A 1A04A 4D5FA 1PDNC 1VZ0A 4BKXA 1B8IB 2CQNA 4LG0B 1S7EA 4AYBA 4UVAA 5E1WA 3RYPA 2M9HA 2DAOA 2A6TA 5JHFA 1ETYA 5LHHA 1XS9A 2JN6A 1X4PA 1IV6A 1SVMA 4J01A 1TW3A 2EV0A 2E7XA 3WU0A 2K3FA 3ZQLA 5J6XA 2GM4A 4Q47A 2X48A 4A0YA 5A2QK 4E70A 4DBRA 5F0CA 1X3UA 3EUAA 1REPC 2IA2A 4M74A 1UB9A 2KIMA 3E3VA 2HEOA 1RR7A 3OOPA 3LSRA 2ISYA 4A12A 3JAMZ 9ANTA 4MEXF 3DCFA 2JWTA 4XBFA 5IT9Z 4HRIA 2HYFA 1ZH5A 1Z7LA 1I3QJ 2QQ8A 4BNCA 3CUQB 1XX5A 2VKHA 3UNGC 2XKPA 3K7AJ 2XV4S 1MDMB 3TEDA 1LDJA 4G8XA 2RAEA 4MNUA 4EJOA 2VC1A 2L5QA 3R4KA 3RPUA 1UG0A 4UB8C 1BBYA 1IN6A 5LD2C 1WJCA 3KLNA 1RNLA 1ETXA 4XKVA 2K9LA 3HB9A 5FFXA 3AL0B 1K61A 3HUGB 4CYCA 2LG4A 2BYVE 2CW0F 1KU2A 3BQYA 1GLNA 1MNMC 3D5SC 4YFNF 1QHHD 3ZR8X 2JPCA 2CV2A 1U9NA 4M6VA 3CCSI 1F36A 3HTSB 4FISA 3TW6A 4ESFA 1FBSA 2DODA 4L0YB 2R0QC 5DV5A 2IS1A 5DCMB 3R60A 3GFLA 2M5WA 2RQQA 1ORKA 4A5NA 1W7PA 3B6AA 3TO6A 3LNQA 2NVXJ 2EZKA 1W1WE 1V4RA 1LVAA 2LBFA 2DN0A 2OA4A 3GUDA 4XSXF 3DBRB 2AHQA 1MMGA 4ZZLA 1P2FA 3IH4A 2V6EA 1IRXA 2EB7A 3JTGA 4KMUX 5LFAA 5E3NA 4M3EA 2M45A 4O6JA 4GFBA 3TMOA 1MW7A 1J75A 3GLXA 4CHUA 2VPLA 2LDUA 3ZMSA 3CUQC 2WB1A 5ILUA 5JI6A 1KQ9A 5BNGA 2YU9J 3BZKA 2KRFA 4UB6C 2ME0A 4ZYAA 3LAJA 2OJED 3H3UA 2HZTA 4ZH4F 2XAGA 4RS8A 1K4SA 5CPRB 1IN4A 3I3LA 3PSIA 4ZJZA 1MMDA 4RGUA 2LC2A 4L5EA 1ZGWA 3KFWX 3G3ZA 5D5VB 4D7MA 2H8WA 1HW1A 3HM5A 2DU9A 3FXQA 4L9JA 4L5JA 1RUNA 1HSTA 2KIUA 2MH2A 4B09A 2CS3A 4IKFA 3M4OJ 3LQQA 1O3QA 3HOYJ 1MBJA 2K9SA 1LFBA 1R36A 2DYSH 2WAFA 1BA5A 3M8JA 2R7SA 4AVPA 2HOSA 1BIBA 3TBIA 3W6KB 3OYFA 3Q3SA 2W7NA 3FZVA 4IZZA 3G1MA 3OYGA 4AIJA 3K4NA 4AVZA 5FKOA 4XKBA 1DU6A 2DT5A 1G6NA 2BW3A 2HQ5A 2NOGA 2IVMA 3W2AA 1A6QA 3FIWA 3LSJA 4YFKF 4Y3OA 3TDUC 1J59A 1KONA 1TWFJ 1YYVA 2XRNA 1RPWA 1D0ZA 3RKYA 5HLTA 2EZHA 4G9YA 5KAFC 2PEXA 3JRHA 3VFZA 3BTIA 2B0LA 1FTTA 3FISA 3EYYA 3S2HJ 1HBXG 1R00A 4IO9F 4BUPA 1XSXA 2Z99A 2QQAA 2P5VA 4OMZA 1HW2A 2ZFUA 3L9FA 2QF7A 5F04A 4N4NB 1MSEC 1UMQA 4IPAA 1YI2I 3CESA 3QAHA 2VIXA 3OIPA 3LOCA 3FK7A 3TO9A 4ANJA 4E7ZA 1R58A 3CCYA 4UV8A 3HOVJ 2LK2A 3VYTB 3W6VA 2DQRA 1G3TA 3OS1A 4PSWA 3BR1A 1R9TJ 3P9KA 3H5NA 3BWGA 2PQ8A 2HXOA 4NHJA 1FWZA 4II2A 1GDTA 1MKMA 4XORA 4U0VA 3SEQA 3PQKA 1HKSA 1J09A 4M73A 3T1BA 4IHVA 2CWEA 1X2MA 3E1SA 2HVRA 4ZZDA 1X19A 4D9JA 3J7ZI 2NOJB 4HYEA 2ZXIA 1TWGJ 3K1PA 3OSGA 2WADA 3MWMA 2VJ4A 5FROA 5C4JJ 1Z77A 2DMNA 1LDDA 3S16J 4O5VA 1R7JA 3H35A 2KRCA 3FXMA 2MW8A 3N4MA 3S14J 4E7HA 1IG7A 5D5WB 1FOKA 2VBYA 2ESNA 1T08B 4LD5A 2W24A 5K1YA 4E7SA 2BXZA 2K86A 4XN0A 4EMSA 1WH5A 2L3DA 2Y30A 2DA7A 2EFQA 4G6QA 3G6EI 2DXIA 2HDDA 1ZRDA 4NBQA 3BTJA 1ZREA 3DV8A 2LKXA 4JBAA 2W82A 1ZGJA 4P5OA 2XSJC 2FBKA 1AOYA 4CCJA 4GDFA 1WJBA 1JT0A 3C1DA 1EA3A 2X6WA 1X4OA 2O0YA 2BY2A 2BW3B 4RM3A 3Q0WA 4L9VA 2EIJH 2FQ3A 3IHUA 2XPWA 2MABA 5M5YJ 2GZWA 1LUJB 4D1QA 1IV8A 1BC8C 1IRGA 4U0YA 2V1XA 3DEUA 3W2VA 2A5YB 2VXDA 3ZMZA 4ZYDA 2EBIA 3OR2C 5HDKA 1BR2A 3K1MA 1VTNC 2AO9A 2CG4A 2XAHA 3GX4X 1ETQA 2E1MB 4AUXA 3WTSC 4X6AJ 2X6OA 4NC8A 2OU2A 4GXOA 2GOMA 2D1VA 2O03A 3N05A 2HDWA 3IWFA 5L3BA 3ZRGA 2X1CA 2QSFX 3BT9A 1OCRH 2UXXA 4J19A 4J00A 3PUBA 2HWVA 4XK4A 1ZGAA 1K6OA 4B3XA 4I02A 3ASNH 2X6YA 1WJFA 2V1UA 5J1RA 2FUG2 3DPLC 5LBQA 5K5RA 3CCVI 1IO2A 1L0OC 1TT0A 4UV9A 4ZDPA 3CJQB 3DLAA 4EM0B 5J47A 4BJ6C 1U5TB 2CMPA 4M9SA 2R5ZB 4L9TA 2OPTA 4CSWA 4KIBA 2PLYA 2CJJA 1E3OC 2VONA 2LVSA 4UUTA 3ROUA 1SMTA 3MKLA 1EJ9A 1HDPA 3JRGA 4L9NA 1T98A 4LB6B 3FKIJ 3R0AA 2F5FA 4PK4A 2VJJA 3LWFA 4ZDLA 4UUSA 2V9VA 2G9WA 3KP6A 3TL4X 2E1MC 2OAZA 2ECCA 1OQYA 1IN5A 4X1EA 4Y13A 1LDKB 4HNTA 2BY3A 1U2WA 2DA3A 2ID3A 2IPQX 4DOZA 3HOSA 2HYJA 2O9LA 3I9V2 1U0JA 1ENHA 1EH6A 1HXDA 2A07F 2HDCA 3S15J 2BVMA 1JJ8C 2HQRA 2H1KA 2RN7A 4WF2A 5LEKA 2VQGA 3BCAA 2ESHA 2VLAA 3R0JA 1YS7A 4XOTA 4H4KC 4HG2A 3QOEA 2GXGA 3S32A 3WTZA 1QA6A 4C30A 4DNCA 1J7KA 2QKLB 4BYYA 3V7SA 2DA4A 5BS6A 3RJPA 3RCOA 4A6DA 3OIOA 3CLQA 2HTJA 4I98B 4U87A 3HOWJ 2COBA 3V42A 1FLIA 1S72I 2A68F 4UY8I 2CO5A 3E97A 1MZBA 3HSEA 5ED4A 2XROA 3BR0A 1U5TC 2YX4A 1XCBA 4BXUA 5DM6F 2JUGA 3HGYA 2R7UA 1QVUA 4ENNA 3S93A 2VL8A 4HV5A 2Y0SA 4LLLA 4CDGA 5HNFA 2DJNA 3HIFA 3LSKA 2HPMA 3RKXA 1H0MA 3RSNA 4EVIA 2KIFA 2WAQA 3F8FA 3OYBA 1P4XA 2LTPA 3OSFA 2KLOA 3D5LA 4ON0A 4A5MA 1GV5A 1KZHA 2CRGA 3JRBA 2YR2A 1XMKA 2VE9A 4K2EA 1KA8A 1K7AA 1JGGA 2FRHA 1ZRCA 2E19A 1QPMA 4GYGA 4YFXF 3KP3A 2BHYA 2UV1A 3LA2A 4ENKA 3L00A 2K9MA 1O3SA 1UHMA 2JQ7A 2CUJA 1XG1A 4BQOA 2XIGA 5F0FA 2MGQA 5DUIA 1ZLJA 4A3LJ 3F72A 1HKTA 1V55H 2M7AA 2V1DA 3WODF 3I4MJ 1B72A 4GGGA 1ETVA 4LG3A 2TDXA 4EJUA 2V6CA 1HKQA 3CP8A 4U88A 2O3FA 2E2JJ 2E7WA 4CCNA 3WGHA 1O7LA 1ULYA 3A01A 3PJRA 2F4MB 1LQ1A 3KIOA 3ZOBA 5F1RA 2DW4A 1P6RA 2LY9A 3ZGKA 5M3FJ 1CGPA 3IP4B 3SJMA 4BJTA 2Y69H 4QPOA 3ZQQA 1CF7B 4UUSB 2BBYA 2ZFWA 3WG9A 3J80K 3LSHA 1P4AA 4AIDA 5B66C 3OV8A 4DZJA 5HDNA 1I1SA 2V9KA 4A3GJ 1HC8A 1R1VA 3V7CA 4YELA 3J7YJ 3R6SA 1HDDC 3L2WA 1FT9A 3ZQGA 1VQ4I 3VODA 1FOYA 3OS0A 3CC7I 4A2UA 3MMYB 2KIQA 4KA4A 3GF2A 3OL4A 5LEJA 1MMSA 4RAZA 4BACA 1UHSA 2KMUA 3WE3A 2V1NA 4RGRA 4ZTFA 2L9NA 1GV2A 3SFZA 2LF8A 2B7EA 3OIQA 3FHNA 1R1TA 4CZCA 2BXYA 4U0WA 3U1KA 4GCVA 4S04A 2M30A 2E5ZA 2ME6A 1XPXA 3QRFF 4IHSA 4CCMA 1A6IA 1X58A 4R8HA 3J81K 2NRAC 2CFOA 1WJAA 2XKOA 4LK1F 3MKZA 5LRSA 2JRTA 3KX2A 3S3OA 3ELKA 3MZ8A 3RPUD 1OKRA 1RI7A 1IJWC 1S6LA 2WAEA 2Z16A 3BG3A 2GIVA 3C3WA 4NC6A 5FLMJ 3OYEA 4AWXB 4BY7J 2YS9A 3O6BB 1BW6A 1BC7C 2GOXB 2ZNYA 2P4WA 4XLNF 5EEHA 5H6RA 3ZN0A 2ZJPF 5LHGA 1B8IA 2A61A 3MCZA 1WKMA 4X0GA 3L2UA 2DQLA 2E1CA 4I09A 3QU6A 2HZDA 3K4BA 2NYXA 2NXNB 2QZ8A 2V4JC 1JKRC 1W7PD 3D5RC 4M6XA 2P5LC 5KAIC 3WGGA 1U78A 5IP9J 4EGYA 4LFUA 2MD5A 4UHTA 2FX0A 4M3GA 1JUSA 2EQRA 5FKKA 5J3LA 3HRUA 1FP1D 1TWAJ 4RLFA 1T56A 2OF7A 3KPHA 4M9XA 2JZYA 3BQZA 1YX5A 3DF8A 3K69A 3GYHX 3CO7C 1JXSA 1VNDA 3BP8A 2QYOA 1GXQA 1QU3A 1WGXA 1N75A 1KQ8A 3ML6A 3CUQA 2DFIA 1O4XA 2CQ7A 1B59A 2EFPA 1MDMA 1E17A 3F8MA 1SFEA 1TT5B 3I64A 3CMAI 2O8KA 2IT0A 4XNFA 1YE9A 4UNOA 2A6EF 5F64A 3BG7A 2ID6A 2DBBA 5DTDA 3BJ6A 2BVLA 5E3MA 1QZEA 3RQ4A 4RB3C 4Q48A 4RGXA 3HUGA 4RM2A 1XB4A 4ITVA 2F5DA 3E5UA 2OD5A 5DM7F 4Y7NJ 4JQFA 1YLFA 3MAJA 2OUMA 1OYIA 4CUGA 4RB0A 1AWCA 2JA5J 1V5FA 4PJNA 4NNJA 4XN3A 1SFXA 2E60A 1TWCJ 1V3FA 5LGNA 1G2HA 2ZC2A 1VQ8I 1X1DA 4MQ9F 5DCMA 3S3NA 1P92A 3WTXC 1DP3A 4IOAF 4CCOA 3J7AY 3GFIA 3I4NJ 3DXJF 1IGNA 5E79C 2O5RA 3L2VA 3HOXJ 3WTWC 2M0CA 1SC7A 1TZLA 1VI0A 2X4HA 5FRNA 4I7HA 3HDDA 4HNVA 1LFPA 4HPQA 4N4OB 2L9RA 3VOEA 1XMAA 4P55A 3LA7A 2JK3A 2W4SA 5FB2A 2ZJRF 1E0EA 3AKZA 1F9NA 2JA2A 4MQVA 2K02A 4HSTA 4KMFA 2K3PA 2DYRH 3AG4H 3CCQI 1IW7F 2XAFA 3F23A 3FKJA 1BR1A 4ENMA 1YHQI 2QSHX 1N77A 1U8BA 2NAZA 4CCLA 4Z6YA 1MSFC 2ZXHA 3FDYA 2MH9A 1MMAA 3BJAA 1M1EB 3RZOJ 2LSOA 5IPAA 3T0YA 4KIGA 1W36C 1U8RA 1EH8A 2FEZA 3AG2H 3CD6I 3N97A 1TQIA 2F5EA 3AFHA 2DO7A 3SZGA 3I56I 2DK8A 4FT8A 2ZMEB 5CVVA 2EIKH 3COAC 3B02A 3EUHA 3E7LA 3HZJA 2QENA 5HVQC 5B1AH 2LRDA 5DD4A 2VJ5A 4OWRB 3CP2A 5E18F 4AIKA 1Q1VA 1D0XA 1WI9A 3K70C 3J7AO 2L4MA 5L3CA 3V8LA 5IP6A 3H3ZA 2L9VA 4HZFA 4RAYA 4EATA 4N9HA 2Z3YA 2GBYA 2P5KA 3BDDA 3QPSA 2OC6A 4IEJA 5ILVA 2KPMA 4YIIA 5J1YA 1PP7U 1Y56A 4N9IA 1MBKA 3TP0A 3PO2J 1V5EA 2XGXA 2PMUA 2BEOA 4XLFA 3RYRA 1Z0XA 1VQKI 4JX5A 2R7TA 1WJDA 2HYGD 2RDPA 2C6YA 3CLOA 4UXNA 2R7DA 5D8LB 3RTRA 4HSRA 4DJAA 1KYZA 4PFOA 3TOBA 4B43A 2A5WA 1S8NA 3JTHA 5J1UA 4FX4A 4XR6A 3HHHA 4Z2YA 4DYRA 4G6DA 2DPUA 1I1GA 3P9CA 4RGSA 1D1BA 3GW2A 4B47A 3CDHA 1A36A 5GAGJ 3CJNA 4IOCF 3MKYB 2ZMEC 3SZTA 3OY9A 1TLHB 1PP8F 2D1HA 2VBWA 2DA2A 2JRMA 4IVNA 2P8TA 3ZQ7A 4KT6A 2ZCWA 3L2QA 3BR5A 4YEJA 2L7MP 4A0XA 2EZIA 2RVCA 2XPUA 2QVOA 3B6CA 2CU7A 4XLEA 2Z5UA 4XRSA 1IN8A 4RB1A 2QQBA 2TCTA 4JX6A 1KQ0A 3NRVA 4DGWB 3IKVA 1KYWA 3DP7A 4HX7A 3C2HA 2PX9A 3CO6C 2ZJQF 4UUVA 3REOA 3FMQA 1R49A 2O8XA 4GYIA 2P7CB 4B48A 2DDBA 1FC3A 1TNSA 1SAUA 1XTAA 1ZYRF 4LJZF 4CCKA 3A0BC 1Z91A 2RV8A 1SEUA 3G2BA 2YPRA 4KYWA 2GLOA 3OYJA 3DU5A 4OMYA 4A3BJ 2E35A 3HOUJ 3GTMJ 4XLCA 4U7DA 3F8CA 2GXAA 1I5ZA 4R1HA 4XRSG 4I6ZA 1BR4A 2XAJA 5HS7A 1XN7A 3GBGA 1OFCX 1OPCA 5FJ8J 3CCUI 1ZQ3P 3GTOJ 1N78A 2DTRA 4OOIA 5IOZA 3NWTA 1FP2A 1Y1VJ 3M7GA 3QPTA 3IL2A 5K7FA 4PJJA 4XLHA 1XGNA 2L4AA 2OQRA 4BQQA 3L1PA 1S29A 3PIOF 5JHUA 2HKXA 2Y31A 1H88C 1O57A 4HOBA 1JUMA 1FOWA 4XONA 5C4XJ 5ICGA 5FLXZ 3PIPF 3BG5A 1UG2A 1BL0A 1ZG1A 2BY1A 4JOMA 2JVGA 1YO5C 1DGWY 2M8GX 1MBHA 1OCOH 4RMNA 4FETA 5CQEA 2HQNA 2R92J 2N8GA 3V8KA 2VT2A 3BC8A 3FBIB 4BXFA 4KUMA 1FSHA 3H1CA 2CUFA 2P6SA 1MNEA 2QCOA 3ABLH 3M07A 2KFDA 3ONQA 3GFMA 4ZTJA 1IRZA 5LHIA 1QQIA 1F43A 2H1LA 1LPQA 5IYCJ 1QO0D 3EUHC 5IP7J 1BJZA 2FF4A 3E5XA 4BGDA 3FWEA 4F93B 3DKXA 1MBEA 5EG0A 3C2GA 1U5TA 3SHFA 2FA5A 1TQMA 2R5ZA 1VF9A 4HDUA 1XCVA 2MLKA 2PI0A 1ON2A 2VBXA 3HC7A 1YS6A 3JRCA 1P7IA 1TWHJ 4EQQA 4HA8A 1I6HJ 3H9JA 2XAQA 1YQAA 2LREA 5B3SH 3IUOA 3LMMA 4CA0A 2DMQA 1D5YA 1XDUA 5CVUA 3C18A 5L3FA 4S0HB 5CLSA 4BEHB 3ERED 4Y15A 3CMYA 2R7FA 3DWLE 2DMPA 2XRLA 4V2GA 5TGTA 3VPRA 3BPXA 3OWTA 1ZK8A 4LLGF 1FBQA 2NS7A 2QUFA 4B1RA 4F3QA 2WY8Q 3JSOA 2HR3A 1U3EM 3B73A 5A2QZ 2WC2A 5KNLA 5KVRA 2OZ6A 1YJNI 1ITYA 3DBLB 4OAYA 4E7IA 2L7KA 5D5UB 3Q9SA 1PJRA 4C3HJ 1OCPA 3ULQB 3QPLA 3K4LA 4A69C 5B5EC 3F8NA 3CQZJ 5IOYA 1Z1DA 2IP2A 2LKSA 5CVRA 1YFHA 2WWYA 3C2BA 5E1XA 2M87A 2EINH 1Z6RA 2KL4A 3KE2A 3MEXA 1Y0UA 4A3EJ 2XC7A 1PYVA 1SFOJ 1FTZA 2A69F 2NVUB 3M8FA 1Y8QB 2HS5A 3ESWB 2IGNA 1T0FC 6PAXA 2VOOA 1P7JA 3LSIA 2GQQA 2RQPA 2E36A 4MHGA 2NS8A 1XD7A 2MC4A 1BOBA 1WJEA 4M3FA 3HG9A 1MJAA 4IQ4A 2PMZN 2EILH 5F0HA 4XRMA 4HDVA 1YITI 5HNHA 3HBLA 4ASNA 5GPCA 1ZRFA 2MFZA 1H9TA 3K4MA 2QEXI 4D0PA 4A3DJ 1BJAA 2DOEA 4HLXA 3S1QJ 3U2RA 1A35A 5EGOB 4E7KA 1GXPA 4PJMA 3IKTA 3CTAA 5F08A 1W0TA 1RKWA 5L3EA 1DPUA 5EG0B 1MBGA 1JT6A 2DCEA 2KZGA 3HYIA 2X0LA 3IRRA 1PUFB 1SFKA 5GPAA 1OCZH 4WX9A 1VQ7I 1Z7UA 3QQAA 2KDZA 4Q4ZF 1CF7A 1BOAA 4DW6A 1GVJA 3GXOA 2WBMA 4V19K 2JJ7A 5TJJA 2K27A 2DT6A 3ZMVA 1F1ZA 5GP9A 1SFUA 3BTLA 1T39A 1YIJI 2CFXA 1JTXA 2FMYA 1K78B 1GT0C 1V54H 3FM3A 2K40A 1MNDA 4HF1A 4CO8A 3OYLA 1G3YA 1O3RA 3MVPA 4HW0A 2FE3A 1WWXA 2J5OA 4RAGA 3KETA 4BAYA 2M3AA 2MSYA 1Z3XA 2A05A 1FYKA 4M3BA 2X1DA 4XL9A 3TW7A 2GA1A 3C7JA 2X6XA 4LB5A 1O7FA 2XHKA 1YG2A 3JSPA 4F55A 2FNPA 4HF0A 1QRYA 2NNYA 1IRFA 2R5YA 3OMYA 1UZCA 1TNTA 2ISZA 2HVQA 2A6HF 2K5CA 3BR3A 1D3YA 4ZYHA 2AQFA 1DDNA 3OYAA 3OYCA 1WI3A 3BPVA 2L0KA 2UXNA 4P9UA 3H0DA 4IHWA 1MJBA 3V7RA 4Y4RA 1ZELA 3H5AA 4XLAA 5LGUA 1X2NA 3Q0UA 1LNWA 3T5XA 2JA8J 4F92B 1GVDA 2Z2SB 3BR6A 5J8FA 1IAWA 1EV7A 2DJIA 1APLC 3DEWA 1UFMA 2K85A 4MEYF 2QSGX 3MD2A 3EQLF 1LFUP 2FBHA 4OIRF 1OYYA 3OYHA 2ICWG 2IA0A 2XF6A 1S3JA 2XF5A 4EM2A 2VASA 1IXSB 2CUEA 3JREA 1E3PA 1VQLI 2R7VA 2VI6A 2HOTA 2JMWA 2R7XA 2XUBA 4L18B 3KEOA 3ZQHA 2M2EA 1IUYA 5EZHA 2OBPA 4XSZF 2ELJA 3ZQIA 3JRFA 1WSUA 1AU7A 3CCLI 2EZLA 5IT9K 3SEZA 3OYDA 1TQPA 1V5GA 1ZAOA 5BPDA 4NQWB 4BJ5C 3CC2I 1O3TA 2NNNA 1WH7A 5GTIC 1G8XA 2ETHA 3F0CA 4G7OF 5FKMA 3I54A 3BZ6A 1R5HA 1RESA 4C2UA 2AS5F 1XGOA 2IEKA 2EIMH 3GTJJ 1WCMJ 5LLQA 3DQVC 3F9KA 1T6SA 4TV7A 5BQTA 3BCBA 2JSCA 4M71A 4BE1A 3PFYA 4KN7X 1FNNA 4XM3A 2X9DA 5GTHC 4HV6A 3D0SA 3I5UA 1G59A 2H27A 3DKWA 5JLXA 3ABMH 2XDVA 3D1NI 2R7ZJ 3W3CA 4GO1A 4JP0A 4FE7A 4PGHA 4EEFG 1FMWA 1W4MA 3JRIA 1TC3C 1MJ9A 3TKYA 4G12A 4G7HF 3NWSA 4ENJA 4KN4X 4ETSA 2R5YB 2W84A 3HKZN 3K1NA 1FZPB 1R1UA 1K79A 2FBIA 1XMXA 2HU9A 4II3A 1YIOA 3GFJA 2GXBA 5JFRA 1B9NA 4BH9A 2CW7A 3GTPJ 2O61A 3A02A 2G7HA 2R7RA 3ZCOA 1JE8A 2ELKA 3JCUC 3ASOH 3S1RJ 3WTTC 2XAUA 1XDSA 2RNJA 3S1MJ 3F3XA 2H09A 3WHCA 2Y2ZA 2Y75A 1EKEA 1RETA 1YX3A 4A93J 2F5VA 1F4KA 3HJEA 3FMRA 2QGUA 2STWA 2ZNZA 3K4JA 1DQUA 3WGIA 4PCQA 1TBXA 3SFIA 1I27A 2V79A 3IWZA 2RC4A 4RB2C 3VWBA 2IS6A 2MG4A 2GA2A 1FJLA 3PUFA 4XOPA 1H89C 2HKOA 5FD5A 1Y0NA 4G6TB 1KGSA 4DIQA 1VFCA 2JTVA 2Q1ZB 5C44J 1W5TA 3FF5A 1Y8RB 4DBQA 5AONA 4G94A 2W1OA 3R61A 3O8HA 2ZMEA 1P4WA 2E5NA 2YU3A 3PNVA 1Z6TA 3WU1B 2HFHA 2DA6A 1STZA 2IAIA 2KHMA 2RGVA
chains in the Genus database with same CATH topology
4XR6A 4E7SA 2CW8A 3OYKA 3H9GA 2WA0A 4XN0A 1D1BA 4B47A 3S8PA 2DXIA 4YRVA 3MKYB 4PFPA 3OY9A 4KITB 2W82A 4P5OA 2XSJC 3VYUB 4CCJA 2KZVA 4E7LA 4KT6A 1WJBA 3L2QA 2LOOA 4YEJA 1EA3A 2X6WA 1X4OA 2UWMA 4XLEA 3A4CA 4LITA 2BW3B 4DGWB 4RM3A 3PSFA 2M4KA 2UUZA 3C2HA 2MABA 2L2OA 4D1QA 3KYLA 3BG6A 3W2VA 2VXDA 4B48A 3EUKL 1X1CA 3OR2C 1SAUA 3W2WA 1BR2A 4CCKA 1X1AA 3G2BA 2IS4A 2E1MB 3VDXA 1X1BA 3QYBA 2ZSHB 3DTKA 3OYJA 3DU5A 2KRHA 4NC8A 4XLCA 2GOMA 2X1EA 1FMVA 1BR4A 3N05A 2HDWA 3GBGA 3DTEA 4NC7A 1N78A 3ZRGA 3CF2A 2X1CA 2XF7A 1Z21A 3NWTA 3HXLA 2JSPA 4J00A 4AU7A 2CUZA 3PUBA 4PJJA 3PNYA 4XLHA 4B3XA 3E0JB 4BQQA 4PJLA 2X6YA 1WJFA 3QYEA 2FUG2 3DPLC 3LL7A 5KCMA 4XKCA 2CV1A 4XONA 1TT0A 4ZDPA 3CJQB 3DLAA 2IS2A 4XMYA 3U21A 3LSGA 4BJ6C 2CMPA 1OLTA 2X85A 4GRIA 2L9SA 3DKYA 3SDBA 4CSWA 4JOMA 4BL0B 2JVGA 1DGWY 1K6YA 2KDOA 4BDZA 4RMNA 4FETA 5CQEA 1WJ5A 4BE0A 4HEA2 3BC8A 3FBIB 4PK4A 2LYCA 2VJJA 3DTIA 3BLYA 4ZDLA 4BXFA 2V7FA 3CJRB 1MNEA 3TL4X 2E1MC 3ONQA 4ZTJA 3ZXSA 1LDKB 4HNTA 1AA7A 4DOZA 3HOSA 3I9V2 1U0JA 3EUHC 2WY7Q 2BVMA 2HQAA 3VSLA 4BGDA 2VQGA 3BCAA 2VLAA 4F93B 3DKXA 4XOTA 3C2GA 4H4KC 4HG2A 3QOEA 3S32A 2HNHA 3OOUA 2LH9A 4BU2A 4C30A 2QKLB 3PL8A 2VXZA 3HC7A 2QKMB 2M4GA 3HL2A 1D0YA 3RCOA 4U87A 3H9JA 3V42A 3OYNA 2LREA 3IUOA 3LMMA 4CA0A 2HVSA 4Y33A 2I8DA 2JUGA 4BEHB 2KP6A 2R7UA 3S93A 1MMNA 2F6CA 2VL8A 2Y0SA 2W00A 1NG6A 3EPZA 2PMZA 3DWLE 3LSKA 5TGTA 5HNFA 2HPMA 3OWTA 3RSNA 2WAQA 5CQGA 3OYBA 3VSKA 3DPTA 2VQLA 2MD0A 4IQJA 3A1YA 4F3QA 2WY8Q 2KLOA 3D5LA 4B44A 2LY1A 4CH7A 2R4GA 2DT7B 4OAZA 3HPGA 5KNLA 4F52A 3HOTA 4OAYA 3DEEA 4E7JA 4E7IA 2L7KA 3KEYA 1PJRA 2UV1A 3K4LA 4PSXA 2K9MA 2VJIA 2CUJA 4BQOA 2Z1DA 1D1CA 2M7AA 1HA8A 4LG3A 2KL4A 3CP8A 2PJRA 4BEHA 2XC7A 1PYVA 4BDYA 4CCNA 3QODA 2KQRA 3PJRA 3CMMA 3SYTA 1P9QC 2ZSIB 2IGNA 1T0FC 2V26A 4ZDOA 3ZGKA 4BS9A 2M0MA 4U7BA 3LSIA 3IP4B 3AL0C 2MYSA 3H9QA 3S3MA 2IXSA 4BJTA 4QPOA 3ZQQA 5HOOA 1UELB 4KISA 2MC4A 3K6GA 2M7BA 1BOBA 1WJEA 3LSHA 1R6RA 2V9KA 3HG9A 3DPUA 3HPHA 4IQ4A 4NUBA 4BQNA 4R79A 4YELA 5CKTA 4P1WA 5HNHA 1T95A 3L2WA 2MFZA 2R7QA 4FASD 3K4MA 3LSMA 2X51A 3OS0A 4E7KA 1VZ0A 3LFUA 4PJMA 3MMYB 2AQEA 3OL4A 4AYBA 3VYSB 4BACA 2DCEA 3OL3A 2KMUA 2A6TA 2V1NA 5JHFA 4ZTFA 2L9NA 2DOAA 3OYMA 1X4PA 3OIQA 3FHNA 4CZCA 1SFKA 4XQFA 4J01A 3K4KA 2E5ZA 4RLQA 1D1AA 3M1CA 2JVHA 4CCMA 4DBRA 3EUAA 2CFOA 1WJAA 3MKZA 3KX2A 3H5RA 3IAM2 3S3OA 3RPUD 2WBMA 2DT6A 3QYFA 2WAEA 2Z16A 2IGKA 3OYEA 4HRIA 2P0WA 2GOXB 1MNDA 1Z7LA 3OYLA 4E4HA 2VKHA 3UNGC 4X0GA 3L2UA 2LBFB 2HZDA 2M3AA 3K4BA 1Z3XA 2L5QA 3VYRB 2VB6A 2V4JC 2X1DA 4XL9A 3D5RC 2X6XA 1UG0A 5LD2C 3PNTA 1WJCA 4XKVA 3A2KA 4F55A 2K9LA 3AL0B 1JI8A 3HUGB 2IGMA 1Z3YA 2LG4A 3OMYA 2HVQA 2K5CA 2PJRB 1GLNA 1LKXA 2AQFA 3IAS2 3D5SC 1QHHD 4RLFA 3ZR8X 2CV2A 3OYAA 3OYCA 1YX5A 3H0DA 1QU3A 4Y4RA 1N75A 1ZELA 3H5AA 1S9HA 4XLAA 2R7WA 3CZ6A 2IS1A 4F92B 2RQQA 2Z2SB 1WFXA 3K10A 2DJIA 2LBFA 1MMGA 4LIVA 3MD2A 1IRXA 2V6EA 4XNFA 1YE9A 5LFAA 3OYHA 1ERDA 3TMOA 1MW7A 3BG7A 2XF6A 2XF5A 2VPLA 2BVLA 1QHGA 2VASA 2WB1A 3RQ4A 2VQHA 3MKWB 4RM2A 2BOLA 2R7VA 4ZYAA 2R7XA 3HKZA 4ITVA 4XKWA 4JQFA 2ELJA 2OUMA 4E6KG 4CUGA 5CPRB 4IX7A 1V5FA 3SEZA 4PJNA 3PSIA 3I3LA 4NNJA 4XN3A 4ZJZA 3OYDA 2E60A 1V5GA 1MMDA 4NQWB 4BJ5C 2LC2A 1G8XA 1X1DA 4BE2A 5KHDA 3S3NA 4C9YA 4C2TA 1W36D 1DP3A 1NG7A 4CCOA 1Y6IA 3J7AY 2OV7A 4C2UA 2CS3A 4IKFA 2O5RA 3L2VA 3DQVC 3F9KA 1TZLA 3BCBA 4PUSA 4BE1A 3PFYA 2CV0A 5FRNA 1LFPA 4HPQA 4XM3A 4N4OB 1G59A 2WAFA 3M8JA 2R7SA 2W4SA 3TBIA 1E0EA 3AKZA 2JA2A 3OYFA 2LY2A 2W7NA 4IZZA 4HSTA 3OYGA 2K3PA 2XDVA 3K70D 3W3CA 2IGOA 3K4NA 4AVZA 3FKJA 4XKBA 3UR3C 1FMWA 1BR1A 2BW3A 3W2AA 4QPQA 3NWSA 1N77A 4Y3OA 2R7OA 3DU6A 4CCLA 1KONA 2CH0A 2RNGA 4MLOA 2ZXHA 3FDYA 1MMAA 2HU9A 1D0ZA 3K4CA 4II3A 5HLTA 2CW7A 1W36C 3OYIA 2R7RA 3ZCOA 3AFHA 4BUPA 3SZGA 4LIUA 2ZFUA 1UAAA 4N4NB 2VKDA 2XAUA 1OR7C 3CESA 2VIXA 3OIPA 5HVQC 2LRDA 4ANJA 4E7ZA 2VJ5A 1DGRM 4OWRB 1LVKA 1YX3A 3VYTB 4F91B 2F5VA 3CP2A 3OS1A 4PSWA 3K4JA 3OS2A 2HPIA 1D0XA 1DQUA 3K70C 3H5NA 4II2A 4EATA 2F4IA 3VWBA 4XORA 2IS6A 3SEQA 4XOPA 1J09A 2OC6A 2KPMA 4G6TB 3E1SA 5FRMA 2HVRA 1Y56A 3OR1C 4DIQA 1X19A 2Q1ZB 1V5EA 4D9JA 2NOJB 4XLFA 3L2RA 2ZXIA 4ZC3A 2R7TA 1WJDA 4HNUA 4DBQA 2WADA 2VQCA 2W1OA 2VJ4A 5FROA 2E5NA 4KJZA 3PNVA 3RTRA 4HSRA 3H35A 2KRCA 2RREA 4PFOA 4B43A 4DJAA 2A5WA 2Q2EB 4E7HA 3FBNB 2KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQL A;  2VQG A;  2VQH A; 
#chains in the Genus database with same CATH topology
 1IUF A;  3ABU A;  4A3M J;  4I99 C;  2EA2 A;  1PVE A;  2P6T A;  3S8P A;  4JYK A;  5FO5 A;  1J0R A;  3KZY A;  3GO5 A;  4PFP A;  2R93 J;  3GCM A;  1VQO I;  4EM1 A;  3S1N J;  5HLI A;  5E1Z B;  4I01 A;  2KJB A;  1H9G A;  2CYY A;  4C3J J;  1OIS A;  2LKP A;  4PZJ A;  2UWM A;  4MTD A;  3A4C A;  5JVG F;  1RKT A;  2D5V A;  3CC4 I;  3KYC B;  3PSF A;  1A5J A;  3GZ6 A;  3HRS A;  3O2P E;  2L02 A;  3FHZ A;  4I2O A;  2M4K A;  2UUZ A;  2YUS A;  2QWW A;  2W57 A;  2MC3 A;  2L2O A;  3H36 A;  3KYL A;  3BG6 A;  3FXO A;  4I76 A;  5J40 A;  1T38 A;  3EUK L;  3W2W A;  3LST A;  1UST A;  3U9G A;  3RI4 A;  1X1A A;  2KKO A;  5F1J A;  2ACJ A;  3VDX A;  1X1B A;  1X1P A;  3QYB A;  2ZSH B;  3DTK A;  5FKL A;  4AD9 A;  5DS9 A;  2QLZ A;  2FOW A;  3QP5 A;  1ETW A;  3F6V A;  3WTY C;  2DFF A;  2LD5 A;  5DDG A;  3CME I;  1BI3 A;  2LLK A;  5TIS C;  3I55 I;  5DD8 A;  4B4C A;  2XF7 A;  1UJ8 A;  3QU3 A;  3FXJ A;  3HXL A;  1YTY A;  1BN5 A;  3K9T A;  1RIO H;  3HHG A;  2CUZ A;  2ZXW H;  3FK6 A;  5DYM A;  3E0J B;  5FFZ A;  4PJL A;  5AIP A;  2EV6 A;  3QYE A;  1D8K A;  2BV6 A;  3GTG J;  4WXD A;  5KCM A;  5L3G A;  1W5C C;  5EEA A;  2DMU A;  4XMY A;  1RZ4 A;  3CDI A;  3P7N A;  3LSG A;  3U21 A;  5IY5 H;  2JA6 J;  2FJ1 A;  1OLT A;  2X85 A;  4GRI A;  3SDB A;  3ISP A;  4BL0 B;  4ABZ A;  4OIP F;  1JGS A;  4YIR X;  1IXR C;  1K6Y A;  1HW5 A;  2KDO A;  4BDZ A;  3V8J A;  3SDG A;  1EF4 A;  1WJ5 A;  1J2X A;  2EPF A;  2VT3 A;  3BR2 A;  3GME A;  2LYC A;  3BRO A;  3DTI A;  1HCR A;  4BQA A;  5J4V A;  2EFO A;  4M72 A;  5FKN A;  3PM1 A;  3G1L A;  4PDK A;  4LMY A;  5F6F A;  2EFW A;  3JRD A;  3FMS A;  2B9S A;  3MQ0 A;  5E17 F;  1MH3 A;  1MGT A;  5JLW A;  4O3M A;  3S17 J;  2W25 A;  1JHH A;  1YOV B;  2XGC A;  2G7U A;  3VSL A;  2F48 A;  2IBD A;  1R22 A;  3I58 A;  2BE5 F;  5H20 A;  4BHC A;  5J4Y A;  4ZYE A;  3MFK A;  3J80 Z;  3MN2 A;  3OOU A;  1FIA A;  5E3O A;  2LH9 A;  4HAM A;  2VXZ A;  2M4G A;  1D0Y A;  2E1N A;  4CYD A;  3RKQ A;  4BHB A;  3EYI A;  1B9M A;  1NHA A;  2HVS A;  1BI2 A;  4Y33 A;  4Q5S F;  2Q0O A;  3O8G A;  2EH3 A;  5LGT A;  3G73 A;  2DPD A;  3LFK A;  2QBY B;  2H8R A;  1BIA A;  1AKH A;  2W00 A;  4DYC A;  3EPZ A;  2PMZ A;  4XID A;  4BY1 J;  3L09 A;  4WWC A;  1I50 J;  4EJW A;  4ZYG A;  5E8G A;  1T8I A;  1YW7 A;  1R71 A;  3EDP A;  5CQG A;  1XC5 A;  1RUO A;  4LK0 F;  3VSK A;  5EF6 A;  1SD6 A;  3DPT A;  3JW4 A;  4IQJ A;  2R4G A;  5J8C A;  4OAZ A;  3J81 Z;  2KJC A;  1JKO C;  1IXC A;  1YW9 A;  4D5C A;  3KP5 A;  3KEQ A;  5ERI A;  2E1O A;  4BBR J;  3FX3 A;  1FX7 A;  3KEY A;  2OQG A;  4MFE A;  2ECB A;  2ZBK A;  1R4N B;  4PSX A;  1Z9C A;  5DCF A;  2VJI A;  3BJO A;  1T0F A;  4P9F A;  2ZXJ A;  1EH7 A;  2QA4 I;  2FML A;  2PJR A;  2H6B A;  3I0T A;  5CVJ A;  4BEH A;  4WCG A;  1VQ5 I;  4BDY A;  3ZPL A;  2KQR A;  4IJA A;  3AAF A;  3FXU A;  1HLV A;  4P96 A;  1P9Q C;  2ZSI B;  3HTU A;  3QOP A;  5EYR A;  4D7N A;  3ZQC A;  4CGZ A;  4ZDO A;  3AL0 C;  2HXI A;  3H9Q A;  2LR8 A;  5D8K B;  3S3M A;  1B1B A;  2IXS A;  4KIS A;  2JT1 A;  1RC9 A;  5JR3 A;  3K6G A;  4FTH A;  1SD4 A;  1U9O A;  1SD5 A;  3GEZ A;  3DPU A;  3HPH A;  1QPI A;  2K4B A;  3FM5 A;  4BQN A;  2LMD A;  5CKT A;  3GTK J;  3ZMU A;  1T95 A;  4CIC A;  5CVI A;  2R7Q A;  4FAS D;  2OZU A;  4F7Z A;  3K2Z A;  4FQG A;  2OTJ I;  3HGG A;  3RDI A;  3LFU A;  4LLN A;  2AQE A;  2P7V B;  3TOA A;  1YRN A;  2L54 A;  4L0Z B;  2HOE A;  1R23 A;  5TRD A;  2K9Q A;  3IH3 A;  3TDZ C;  3VYS B;  1QVT A;  1OYW A;  2PJP A;  2M34 A;  3OL3 A;  5D4R A;  2DOA A;  3CCE I;  2LFB A;  5HLG A;  3OYM A;  4QTR A;  1W0U A;  2ZB9 A;  5D6F A;  4XQF A;  4OIQ F;  2ZKZ A;  3K4K A;  3PQJ A;  2I10 A;  4RLQ A;  1WHU A;  1DP7 P;  1D1A A;  3M1C A;  2JVH A;  2BZT A;  1TW2 A;  4CYC B;  1XSD A;  1ZKG A;  3H5R A;  3IAM 2;  1TTY A;  1OR7 A;  2LP0 A;  3DFG A;  3O3K A;  2PG4 A;  1ETK A;  5GAH J;  3QYF A;  1LEB A;  1AKH B;  5JVT A;  3HRT A;  1WPK A;  2FNA A;  2IGK A;  3IRQ A;  2P0W A;  2JUC A;  3AG3 H;  3JR9 A;  3Q0V A;  4JK1 X;  5EGO A;  4M9Z A;  4E4H A;  2XGE A;  3S2W A;  1LJ9 A;  2OCC H;  1W7P B;  1RR8 C;  1Y39 A;  2O7O A;  3FXL A;  4IHX A;  2LBF B;  2EJR A;  1R5I D;  4IRH A;  5ICE A;  2DA1 A;  2F4O B;  4KIC A;  3L7W A;  3VYR B;  2VB6 A;  4DQ2 A;  2K9N A;  1PUF A;  5FLV A;  3PFI A;  5CJ9 A;  2AXL A;  2DMT A;  1BI0 A;  1HQC A;  3PNT A;  5DUK A;  2VKE A;  3H0G J;  3A2K A;  2XB5 A;  3G1O A;  5F27 A;  4EJT A;  1JI8 A;  1UCR A;  1JJ6 C;  4BBS J;  1WZ2 A;  1QNT A;  2IGM A;  1Z3Y A;  1Q1H A;  1WRJ A;  5D6E A;  4QSH A;  4AYB N;  2R3S A;  2CQK A;  2PJR B;  1LKX A;  3IAS 2;  1ON1 A;  1ZLK A;  4MGR A;  2IRF G;  3IC7 A;  4JX4 A;  2V9P A;  2E2I J;  4RDU A;  3KLO A;  5C3E J;  1Z67 A;  5M3M J;  2DI3 A;  1K78 A;  5GAD J;  1S9H A;  3TGN A;  2R7W A;  5AIQ A;  3CZ6 A;  5KK1 A;  4CXF A;  1G3W A;  3X2Q H;  1WFX A;  2TRT A;  3H92 A;  1FYM A;  4FX0 A;  4N0B A;  3GTQ J;  3K10 A;  3KYD B;  1GHC A;  4ESB A;  1W5S A;  4LIV A;  3VB2 A;  2GWR A;  4PGG A;  2DLL A;  2G0E A;  4MIM A;  1HSJ A;  3T8T A;  2Y0M A;  2NVQ J;  4LOC A;  1ERD A;  1MH4 A;  1KU7 A;  3ZMT A;  1ZN2 A;  2HGC A;  4L5I A;  1QHG A;  3EET A;  1KU9 A;  2VQH A;  2DDA A;  3MKW B;  2ELH A;  3ECH A;  2BOL A;  1YRN B;  3TO7 A;  3K0L A;  4HX4 A;  5LRR A;  1C0W A;  3HKZ A;  4XKW A;  4OU0 A;  1NH3 A;  1ZHF A;  5K7H A;  1U6G A;  3KZI C;  4E6K G;  3M9A A;  5HS9 A;  3F22 A;  4IX7 A;  2GAU A;  4MTE A;  3WE2 A;  1AHD P;  4M6Y A;  1F5T A;  1FEX A;  1E2X A;  4A3I J;  2Y9Z A;  2W48 A;  4HQM A;  2K7L A;  5IYB J;  2GIZ A;  2HI3 A;  3CCM I;  4BE2 A;  1IDY A;  5KHD A;  4C9Y A;  4C2T A;  1W36 D;  1NG7 A;  3FXK A;  1Y6I A;  1Z05 A;  3JRA A;  2OV7 A;  2Q2E A;  2VKV A;  1SAN A;  2F5C A;  4FHT A;  5E3L A;  5EZG A;  1S7A A;  4PUS A;  2CV0 A;  4IXA A;  1J9I A;  4WXC A;  3E6C C;  2VC0 A;  2Y9Y A;  1E3H A;  1ODD A;  4AIH A;  1HF0 A;  3K2A A;  2YSR A;  2LY2 A;  1T2K A;  4OIO F;  3ZN1 A;  3WHB A;  2D2W A;  3K70 D;  4XIC A;  2BHZ A;  2IGO A;  4DZP A;  3HRM A;  4NDL A;  5GAE J;  3M3Y J;  3UR3 C;  1X3W B;  2ADU A;  2DA5 A;  2EFN A;  4XRF A;  2WB1 N;  4NQW A;  1MIJ A;  2CSO A;  4QPQ A;  3P9I A;  2R7O A;  3DU6 A;  2H6C A;  2CH0 A;  2RNG A;  4MLO A;  1B6A A;  3DLL F;  3K4C A;  5M5W J;  3F8B A;  4A3F J;  4IL6 C;  4Y17 A;  1OJL A;  2EA4 A;  5HS8 A;  5BOX A;  3OYI A;  3W6J B;  3P5J A;  3RZD J;  4UVB A;  4KT5 C;  1JKQ C;  1G4D A;  4M3D A;  4LIU A;  4KDP A;  3Q5F A;  1JKP C;  2ZO4 A;  1I39 A;  2B63 J;  2M8E A;  4FE4 A;  5DEQ A;  1UAA A;  2VKD A;  1JUP A;  1IN7 A;  1OR7 C;  1QGP A;  5BPI A;  1ONV A;  2CQQ A;  2P81 A;  4KIF A;  3CJT B;  5HLH A;  1DGR M;  1LVK A;  1ZTR A;  4F91 B;  1LB2 A;  3HSR A;  4HBL A;  1K4T A;  3CUO A;  1ZG3 A;  2Y48 A;  3OS2 A;  2JPB A;  2HPI A;  4AC0 A;  3HSF A;  4BHP A;  1WQ2 A;  3E6D A;  3LAP A;  1S5L C;  4C2M J;  1BI1 A;  2D45 A;  1ETO A;  3TP3 A;  4QLC U;  2F4I A;  1I3A A;  3CF5 F;  3WTU C;  1SD7 A;  1I6X A;  3NAR A;  1DU0 A;  3PO3 J;  1PUE E;  1L3L A;  2OCE A;  5FRM A;  1VQ6 I;  3OR1 C;  3RPQ A;  1NK2 P;  2Q8K A;  3L2R A;  4ZC3 A;  3QPH A;  4HNU A;  1IZ1 A;  2AXT C;  3T8R A;  2XAS A;  2F2E A;  2VQC A;  5BMZ A;  1MBF A;  3NAU A;  4KJZ A;  5D5X B;  2DOF A;  4RA2 A;  2EWN A;  1ZG5 A;  3AG1 H;  5HDG A;  1DUX C;  2H94 A;  2RRE A;  4WK8 F;  3BZC A;  2Q2E B;  3FBN B;  2O6G E;  1BW5 A;  2IJL A;  3MZH A;  1FIP A;  2CW8 A;  3OYK A;  3H9G A;  2WA0 A;  2KIS A;  3GWZ A;  3IV5 A;  1Y1W J;  4W97 A;  2HOA A;  5ILS A;  1QZY A;  4YRV A;  4KIT B;  4KFC A;  3ZP5 A;  1NK3 P;  4HF2 A;  3BTC A;  5IT3 A;  3M8E A;  2L01 A;  4FCY A;  3VYU B;  5EEG A;  2KZV A;  2W85 A;  3DBH B;  3WU2 C;  4E7L A;  3H3V K;  4CZZ A;  2LOO A;  2EK5 A;  2WTE A;  3E5Q A;  3JAM K;  1D8J A;  3I59 A;  3I4P A;  3QWL A;  1XGS A;  4LIT A;  4RAF A;  1KU3 A;  2DFE A;  5E8I A;  1SAX A;  4YG2 F;  5K7Z A;  1LE8 A;  3I53 A;  2K4J A;  1POG A;  4A3C J;  5EJC A;  1USS A;  1K83 J;  3S2D J;  2YX7 A;  1X1C A;  2XPV A;  1FY7 A;  3HEF A;  2NVY J;  5D4S A;  4B3A A;  2IS4 A;  5CYV A;  2WV0 A;  4A3K J;  4WXH A;  2UZK A;  3LA3 A;  3ERM A;  3F6O A;  2KRH A;  2PMH A;  1YJW I;  1T33 A;  5K5O A;  2X1E A;  5HOD A;  1FMV A;  2NVT J;  2J5P A;  4V2F A;  4UVC A;  2KT0 A;  3CCJ I;  1R4M B;  2PN6 A;  3DTE A;  3IH2 A;  4NC7 A;  3CF2 A;  3NQO A;  3MZY A;  5M5X J;  2E71 A;  1Z21 A;  1FYL A;  3V4G A;  2JSP A;  3E6M A;  1J5Y A;  4AU7 A;  2MA3 A;  2QM3 A;  1OMI A;  3ECO A;  3PNY A;  3ABK H;  1GUU A;  1R5G A;  3KP2 A;  2E2H J;  3LL7 A;  4IF4 A;  1TL8 A;  4XKC A;  2FQ4 A;  3VEP A;  2CV1 A;  2IS2 A;  3KZZ A;  1S7O A;  1JHF A;  2NS0 A;  2L9S A;  3CDL A;  1FSE A;  3DKY A;  2OTL I;  2FD5 A;  5L3D A;  4OIN F;  1N25 A;  4BXX J;  1FPQ A;  4A3J J;  4BE0 A;  4HEA 2;  1ZR2 A;  2EV5 A;  3TQN A;  2FXA A;  3BLY A;  4Y52 J;  2COM A;  3SZP A;  2Z9O A;  2FU4 A;  2MBF A;  2V7F A;  2VN2 A;  4MFD A;  5B1B H;  3CJR B;  3G71 I;  4QWQ A;  1MD0 A;  3UKG A;  3ZXS A;  2Z33 A;  1AA7 A;  3NEU A;  4IRI A;  2XB0 X;  1DPR A;  1TP4 A;  4I0B A;  5FGM A;  1A31 A;  2WY7 Q;  3SXY A;  1B4A A;  2JA7 J;  1G3S A;  1UHW A;  2HQA A;  1D5V A;  1FOX A;  4C3I J;  5FD6 A;  2ZJ2 A;  4EV0 A;  3I71 A;  4LG0 A;  4I0A A;  3U1D A;  2VOP A;  2HNH A;  3I59 B;  4AM3 A;  4BU2 A;  2CGP A;  3PL8 A;  1WVR A;  2BGC A;  4KNY A;  2QKM B;  4H0E A;  4IHY A;  2A3S A;  1FBU A;  2LNB A;  3HL2 A;  1LE8 B;  3OYN A;  4HX8 A;  1BM9 A;  2FOK A;  2I5U A;  2M1B A;  1B72 B;  2I8D A;  2HTS A;  2KP6 A;  3GZ5 A;  1QBJ A;  2XGD A;  2MLG A;  1VQN I;  2VBZ A;  1MMN A;  2F6C A;  4PJ0 C;  3KCC A;  1NG6 A;  3L2C A;  3A01 B;  4QIW N;  4HLY A;  4ESJ A;  3Q9V A;  4LGW A;  2STT A;  5H2F C;  1ZAR A;  3WTV C;  2LF7 A;  3E6B A;  2VQL A;  2MD0 A;  3KP7 A;  3A1Y A;  4B44 A;  4CH7 A;  2LY1 A;  2VUM J;  5FLX K;  3GLL A;  2DT7 B;  5ICF A;  1SVO A;  3A0H C;  3HPG A;  2RKH A;  3LQR A;  3M1E A;  1OCT C;  3ZQF A;  4F52 A;  3HOT A;  4A0Z A;  1CQT A;  1RRJ A;  1HOM A;  1YJ9 I;  1JTY A;  4YIF A;  3DEE A;  3ABT A;  4E7J A;  3GVA A;  1NTC A;  2IA1 A;  3RQI A;  4MO7 A;  4A6E A;  1VQM I;  3RKW A;  5IYD J;  3CCR I;  2DK5 A;  3G4S I;  2XSD C;  1IF1 A;  3A03 A;  1ZR4 A;  1XSV A;  3HOZ J;  1X3Z B;  5ICC A;  1ACI A;  3GZN B;  1VQ9 I;  5H6Q A;  5EDN A;  2Z1D A;  2FSW A;  4EJV A;  1D1C A;  3F21 A;  3FXR A;  4S05 A;  1IC8 A;  4IRG A;  1SMY F;  3BY6 A;  4XLP F;  5E20 A;  3GTL J;  2QQ9 A;  1HA8 A;  1QZZ A;  1H8A C;  2BY0 A;  2QBY A;  1XGM A;  2VPR A;  2VOD A;  2L7Z A;  1IDZ A;  3QOD A;  2IW5 A;  2DFH A;  2WV1 A;  3CMM A;  3SYT A;  4DYQ A;  3RIR A;  4RBO A;  2V26 A;  3ZMD A;  4BS9 A;  2M0M A;  4U7B A;  3BG9 A;  1OCC H;  2MYS A;  4W1U A;  4B8X A;  2VE8 A;  3SQN A;  5HOO A;  1UEL B;  2DTZ A;  2PFB A;  2PBI A;  4HQE A;  2M7B A;  4G7Z F;  1R6R A;  1SVL A;  3KP4 A;  2CQX A;  4EGZ A;  2Y0S N;  4NUB A;  3WG7 H;  4R79 A;  3LSP A;  1LEA A;  3BOQ A;  1VQP I;  4P1W A;  4NB5 A;  2E34 A;  2L7F P;  2WAQ N;  2XVC A;  4IHT A;  5K5Q A;  3QP6 A;  3LSM A;  1YW8 A;  2X51 A;  1A04 A;  4D5F A;  1PDN C;  1VZ0 A;  4BKX A;  1B8I B;  2CQN A;  4LG0 B;  1S7E A;  4AYB A;  4UVA A;  5E1W A;  3RYP A;  2M9H A;  2DAO A;  2A6T A;  5JHF A;  1ETY A;  5LHH A;  1XS9 A;  2JN6 A;  1X4P A;  1IV6 A;  1SVM A;  4J01 A;  1TW3 A;  2EV0 A;  2E7X A;  3WU0 A;  2K3F A;  3ZQL A;  5J6X A;  2GM4 A;  4Q47 A;  2X48 A;  4A0Y A;  5A2Q K;  4E70 A;  4DBR A;  5F0C A;  1X3U A;  3EUA A;  1REP C;  2IA2 A;  4M74 A;  1UB9 A;  2KIM A;  3E3V A;  2HEO A;  1RR7 A;  3OOP A;  3LSR A;  2ISY A;  4A12 A;  3JAM Z;  9ANT A;  4MEX F;  3DCF A;  2JWT A;  4XBF A;  5IT9 Z;  4HRI A;  2HYF A;  1ZH5 A;  1Z7L A;  1I3Q J;  2QQ8 A;  4BNC A;  3CUQ B;  1XX5 A;  2VKH A;  3UNG C;  2XKP A;  3K7A J;  2XV4 S;  1MDM B;  3TED A;  1LDJ A;  4G8X A;  2RAE A;  4MNU A;  4EJO A;  2VC1 A;  2L5Q A;  3R4K A;  3RPU A;  1UG0 A;  4UB8 C;  1BBY A;  1IN6 A;  5LD2 C;  1WJC A;  3KLN A;  1RNL A;  1ETX A;  4XKV A;  2K9L A;  3HB9 A;  5FFX A;  3AL0 B;  1K61 A;  3HUG B;  4CYC A;  2LG4 A;  2BYV E;  2CW0 F;  1KU2 A;  3BQY A;  1GLN A;  1MNM C;  3D5S C;  4YFN F;  1QHH D;  3ZR8 X;  2JPC A;  2CV2 A;  1U9N A;  4M6V A;  3CCS I;  1F36 A;  3HTS B;  4FIS A;  3TW6 A;  4ESF A;  1FBS A;  2DOD A;  4L0Y B;  2R0Q C;  5DV5 A;  2IS1 A;  5DCM B;  3R60 A;  3GFL A;  2M5W A;  2RQQ A;  1ORK A;  4A5N A;  1W7P A;  3B6A A;  3TO6 A;  3LNQ A;  2NVX J;  2EZK A;  1W1W E;  1V4R A;  1LVA A;  2LBF A;  2DN0 A;  2OA4 A;  3GUD A;  4XSX F;  3DBR B;  2AHQ A;  1MMG A;  4ZZL A;  1P2F A;  3IH4 A;  2V6E A;  1IRX A;  2EB7 A;  3JTG A;  4KMU X;  5LFA A;  5E3N A;  4M3E A;  2M45 A;  4O6J A;  4GFB A;  3TMO A;  1MW7 A;  1J75 A;  3GLX A;  4CHU A;  2VPL A;  2LDU A;  3ZMS A;  3CUQ C;  2WB1 A;  5ILU A;  5JI6 A;  1KQ9 A;  5BNG A;  2YU9 J;  3BZK A;  2KRF A;  4UB6 C;  2ME0 A;  4ZYA A;  3LAJ A;  2OJE D;  3H3U A;  2HZT A;  4ZH4 F;  2XAG A;  4RS8 A;  1K4S A;  5CPR B;  1IN4 A;  3I3L A;  3PSI A;  4ZJZ A;  1MMD A;  4RGU A;  2LC2 A;  4L5E A;  1ZGW A;  3KFW X;  3G3Z A;  5D5V B;  4D7M A;  2H8W A;  1HW1 A;  3HM5 A;  2DU9 A;  3FXQ A;  4L9J A;  4L5J A;  1RUN A;  1HST A;  2KIU A;  2MH2 A;  4B09 A;  2CS3 A;  4IKF A;  3M4O J;  3LQQ A;  1O3Q A;  3HOY J;  1MBJ A;  2K9S A;  1LFB A;  1R36 A;  2DYS H;  2WAF A;  1BA5 A;  3M8J A;  2R7S A;  4AVP A;  2HOS A;  1BIB A;  3TBI A;  3W6K B;  3OYF A;  3Q3S A;  2W7N A;  3FZV A;  4IZZ A;  3G1M A;  3OYG A;  4AIJ A;  3K4N A;  4AVZ A;  5FKO A;  4XKB A;  1DU6 A;  2DT5 A;  1G6N A;  2BW3 A;  2HQ5 A;  2NOG A;  2IVM A;  3W2A A;  1A6Q A;  3FIW A;  3LSJ A;  4YFK F;  4Y3O A;  3TDU C;  1J59 A;  1KON A;  1TWF J;  1YYV A;  2XRN A;  1RPW A;  1D0Z A;  3RKY A;  5HLT A;  2EZH A;  4G9Y A;  5KAF C;  2PEX A;  3JRH A;  3VFZ A;  3BTI A;  2B0L A;  1FTT A;  3FIS A;  3EYY A;  3S2H J;  1HBX G;  1R00 A;  4IO9 F;  4BUP A;  1XSX A;  2Z99 A;  2QQA A;  2P5V A;  4OMZ A;  1HW2 A;  2ZFU A;  3L9F A;  2QF7 A;  5F04 A;  4N4N B;  1MSE C;  1UMQ A;  4IPA A;  1YI2 I;  3CES A;  3QAH A;  2VIX A;  3OIP A;  3LOC A;  3FK7 A;  3TO9 A;  4ANJ A;  4E7Z A;  1R58 A;  3CCY A;  4UV8 A;  3HOV J;  2LK2 A;  3VYT B;  3W6V A;  2DQR A;  1G3T A;  3OS1 A;  4PSW A;  3BR1 A;  1R9T J;  3P9K A;  3H5N A;  3BWG A;  2PQ8 A;  2HXO A;  4NHJ A;  1FWZ A;  4II2 A;  1GDT A;  1MKM A;  4XOR A;  4U0V A;  3SEQ A;  3PQK A;  1HKS A;  1J09 A;  4M73 A;  3T1B A;  4IHV A;  2CWE A;  1X2M A;  3E1S A;  2HVR A;  4ZZD A;  1X19 A;  4D9J A;  3J7Z I;  2NOJ B;  4HYE A;  2ZXI A;  1TWG J;  3K1P A;  3OSG A;  2WAD A;  3MWM A;  2VJ4 A;  5FRO A;  5C4J J;  1Z77 A;  2DMN A;  1LDD A;  3S16 J;  4O5V A;  1R7J A;  3H35 A;  2KRC A;  3FXM A;  2MW8 A;  3N4M A;  3S14 J;  4E7H A;  1IG7 A;  5D5W B;  1FOK A;  2VBY A;  2ESN A;  1T08 B;  4LD5 A;  2W24 A;  5K1Y A;  4E7S A;  2BXZ A;  2K86 A;  4XN0 A;  4EMS A;  1WH5 A;  2L3D A;  2Y30 A;  2DA7 A;  2EFQ A;  4G6Q A;  3G6E I;  2DXI A;  2HDD A;  1ZRD A;  4NBQ A;  3BTJ A;  1ZRE A;  3DV8 A;  2LKX A;  4JBA A;  2W82 A;  1ZGJ A;  4P5O A;  2XSJ C;  2FBK A;  1AOY A;  4CCJ A;  4GDF A;  1WJB A;  1JT0 A;  3C1D A;  1EA3 A;  2X6W A;  1X4O A;  2O0Y A;  2BY2 A;  2BW3 B;  4RM3 A;  3Q0W A;  4L9V A;  2EIJ H;  2FQ3 A;  3IHU A;  2XPW A;  2MAB A;  5M5Y J;  2GZW A;  1LUJ B;  4D1Q A;  1IV8 A;  1BC8 C;  1IRG A;  4U0Y A;  2V1X A;  3DEU A;  3W2V A;  2A5Y B;  2VXD A;  3ZMZ A;  4ZYD A;  2EBI A;  3OR2 C;  5HDK A;  1BR2 A;  3K1M A;  1VTN C;  2AO9 A;  2CG4 A;  2XAH A;  3GX4 X;  1ETQ A;  2E1M B;  4AUX A;  3WTS C;  4X6A J;  2X6O A;  4NC8 A;  2OU2 A;  4GXO A;  2GOM A;  2D1V A;  2O03 A;  3N05 A;  2HDW A;  3IWF A;  5L3B A;  3ZRG A;  2X1C A;  2QSF X;  3BT9 A;  1OCR H;  2UXX A;  4J19 A;  4J00 A;  3PUB A;  2HWV A;  4XK4 A;  1ZGA A;  1K6O A;  4B3X A;  4I02 A;  3ASN H;  2X6Y A;  1WJF A;  2V1U A;  5J1R A;  2FUG 2;  3DPL C;  5LBQ A;  5K5R A;  3CCV I;  1IO2 A;  1L0O C;  1TT0 A;  4UV9 A;  4ZDP A;  3CJQ B;  3DLA A;  4EM0 B;  5J47 A;  4BJ6 C;  1U5T B;  2CMP A;  4M9S A;  2R5Z B;  4L9T A;  2OPT A;  4CSW A;  4KIB A;  2PLY A;  2CJJ A;  1E3O C;  2VON A;  2LVS A;  4UUT A;  3ROU A;  1SMT A;  3MKL A;  1EJ9 A;  1HDP A;  3JRG A;  4L9N A;  1T98 A;  4LB6 B;  3FKI J;  3R0A A;  2F5F A;  4PK4 A;  2VJJ A;  3LWF A;  4ZDL A;  4UUS A;  2V9V A;  2G9W A;  3KP6 A;  3TL4 X;  2E1M C;  2OAZ A;  2ECC A;  1OQY A;  1IN5 A;  4X1E A;  4Y13 A;  1LDK B;  4HNT A;  2BY3 A;  1U2W A;  2DA3 A;  2ID3 A;  2IPQ X;  4DOZ A;  3HOS A;  2HYJ A;  2O9L A;  3I9V 2;  1U0J A;  1ENH A;  1EH6 A;  1HXD A;  2A07 F;  2HDC A;  3S15 J;  2BVM A;  1JJ8 C;  2HQR A;  2H1K A;  2RN7 A;  4WF2 A;  5LEK A;  2VQG A;  3BCA A;  2ESH A;  2VLA A;  3R0J A;  1YS7 A;  4XOT A;  4H4K C;  4HG2 A;  3QOE A;  2GXG A;  3S32 A;  3WTZ A;  1QA6 A;  4C30 A;  4DNC A;  1J7K A;  2QKL B;  4BYY A;  3V7S A;  2DA4 A;  5BS6 A;  3RJP A;  3RCO A;  4A6D A;  3OIO A;  3CLQ A;  2HTJ A;  4I98 B;  4U87 A;  3HOW J;  2COB A;  3V42 A;  1FLI A;  1S72 I;  2A68 F;  4UY8 I;  2CO5 A;  3E97 A;  1MZB A;  3HSE A;  5ED4 A;  2XRO A;  3BR0 A;  1U5T C;  2YX4 A;  1XCB A;  4BXU A;  5DM6 F;  2JUG A;  3HGY A;  2R7U A;  1QVU A;  4ENN A;  3S93 A;  2VL8 A;  4HV5 A;  2Y0S A;  4LLL A;  4CDG A;  5HNF A;  2DJN A;  3HIF A;  3LSK A;  2HPM A;  3RKX A;  1H0M A;  3RSN A;  4EVI A;  2KIF A;  2WAQ A;  3F8F A;  3OYB A;  1P4X A;  2LTP A;  3OSF A;  2KLO A;  3D5L A;  4ON0 A;  4A5M A;  1GV5 A;  1KZH A;  2CRG A;  3JRB A;  2YR2 A;  1XMK A;  2VE9 A;  4K2E A;  1KA8 A;  1K7A A;  1JGG A;  2FRH A;  1ZRC A;  2E19 A;  1QPM A;  4GYG A;  4YFX F;  3KP3 A;  2BHY A;  2UV1 A;  3LA2 A;  4ENK A;  3L00 A;  2K9M A;  1O3S A;  1UHM A;  2JQ7 A;  2CUJ A;  1XG1 A;  4BQO A;  2XIG A;  5F0F A;  2MGQ A;  5DUI A;  1ZLJ A;  4A3L J;  3F72 A;  1HKT A;  1V55 H;  2M7A A;  2V1D A;  3WOD F;  3I4M J;  1B72 A;  4GGG A;  1ETV A;  4LG3 A;  2TDX A;  4EJU A;  2V6C A;  1HKQ A;  3CP8 A;  4U88 A;  2O3F A;  2E2J J;  2E7W A;  4CCN A;  3WGH A;  1O7L A;  1ULY A;  3A01 A;  3PJR A;  2F4M B;  1LQ1 A;  3KIO A;  3ZOB A;  5F1R A;  2DW4 A;  1P6R A;  2LY9 A;  3ZGK A;  5M3F J;  1CGP A;  3IP4 B;  3SJM A;  4BJT A;  2Y69 H;  4QPO A;  3ZQQ A;  1CF7 B;  4UUS B;  2BBY A;  2ZFW A;  3WG9 A;  3J80 K;  3LSH A;  1P4A A;  4AID A;  5B66 C;  3OV8 A;  4DZJ A;  5HDN A;  1I1S A;  2V9K A;  4A3G J;  1HC8 A;  1R1V A;  3V7C A;  4YEL A;  3J7Y J;  3R6S A;  1HDD C;  3L2W A;  1FT9 A;  3ZQG A;  1VQ4 I;  3VOD A;  1FOY A;  3OS0 A;  3CC7 I;  4A2U A;  3MMY B;  2KIQ A;  4KA4 A;  3GF2 A;  3OL4 A;  5LEJ A;  1MMS A;  4RAZ A;  4BAC A;  1UHS A;  2KMU A;  3WE3 A;  2V1N A;  4RGR A;  4ZTF A;  2L9N A;  1GV2 A;  3SFZ A;  2LF8 A;  2B7E A;  3OIQ A;  3FHN A;  1R1T A;  4CZC A;  2BXY A;  4U0W A;  3U1K A;  4GCV A;  4S04 A;  2M30 A;  2E5Z A;  2ME6 A;  1XPX A;  3QRF F;  4IHS A;  4CCM A;  1A6I A;  1X58 A;  4R8H A;  3J81 K;  2NRA C;  2CFO A;  1WJA A;  2XKO A;  4LK1 F;  3MKZ A;  5LRS A;  2JRT A;  3KX2 A;  3S3O A;  3ELK A;  3MZ8 A;  3RPU D;  1OKR A;  1RI7 A;  1IJW C;  1S6L A;  2WAE A;  2Z16 A;  3BG3 A;  2GIV A;  3C3W A;  4NC6 A;  5FLM J;  3OYE A;  4AWX B;  4BY7 J;  2YS9 A;  3O6B B;  1BW6 A;  1BC7 C;  2GOX B;  2ZNY A;  2P4W A;  4XLN F;  5EEH A;  5H6R A;  3ZN0 A;  2ZJP F;  5LHG A;  1B8I A;  2A61 A;  3MCZ A;  1WKM A;  4X0G A;  3L2U A;  2DQL A;  2E1C A;  4I09 A;  3QU6 A;  2HZD A;  3K4B A;  2NYX A;  2NXN B;  2QZ8 A;  2V4J C;  1JKR C;  1W7P D;  3D5R C;  4M6X A;  2P5L C;  5KAI C;  3WGG A;  1U78 A;  5IP9 J;  4EGY A;  4LFU A;  2MD5 A;  4UHT A;  2FX0 A;  4M3G A;  1JUS A;  2EQR A;  5FKK A;  5J3L A;  3HRU A;  1FP1 D;  1TWA J;  4RLF A;  1T56 A;  2OF7 A;  3KPH A;  4M9X A;  2JZY A;  3BQZ A;  1YX5 A;  3DF8 A;  3K69 A;  3GYH X;  3CO7 C;  1JXS A;  1VND A;  3BP8 A;  2QYO A;  1GXQ A;  1QU3 A;  1WGX A;  1N75 A;  1KQ8 A;  3ML6 A;  3CUQ A;  2DFI A;  1O4X A;  2CQ7 A;  1B59 A;  2EFP A;  1MDM A;  1E17 A;  3F8M A;  1SFE A;  1TT5 B;  3I64 A;  3CMA I;  2O8K A;  2IT0 A;  4XNF A;  1YE9 A;  4UNO A;  2A6E F;  5F64 A;  3BG7 A;  2ID6 A;  2DBB A;  5DTD A;  3BJ6 A;  2BVL A;  5E3M A;  1QZE A;  3RQ4 A;  4RB3 C;  4Q48 A;  4RGX A;  3HUG A;  4RM2 A;  1XB4 A;  4ITV A;  2F5D A;  3E5U A;  2OD5 A;  5DM7 F;  4Y7N J;  4JQF A;  1YLF A;  3MAJ A;  2OUM A;  1OYI A;  4CUG A;  4RB0 A;  1AWC A;  2JA5 J;  1V5F A;  4PJN A;  4NNJ A;  4XN3 A;  1SFX A;  2E60 A;  1TWC J;  1V3F A;  5LGN A;  1G2H A;  2ZC2 A;  1VQ8 I;  1X1D A;  4MQ9 F;  5DCM A;  3S3N A;  1P92 A;  3WTX C;  1DP3 A;  4IOA F;  4CCO A;  3J7A Y;  3GFI A;  3I4N J;  3DXJ F;  1IGN A;  5E79 C;  2O5R A;  3L2V A;  3HOX J;  3WTW C;  2M0C A;  1SC7 A;  1TZL A;  1VI0 A;  2X4H A;  5FRN A;  4I7H A;  3HDD A;  4HNV A;  1LFP A;  4HPQ A;  4N4O B;  2L9R A;  3VOE A;  1XMA A;  4P55 A;  3LA7 A;  2JK3 A;  2W4S A;  5FB2 A;  2ZJR F;  1E0E A;  3AKZ A;  1F9N A;  2JA2 A;  4MQV A;  2K02 A;  4HST A;  4KMF A;  2K3P A;  2DYR H;  3AG4 H;  3CCQ I;  1IW7 F;  2XAF A;  3F23 A;  3FKJ A;  1BR1 A;  4ENM A;  1YHQ I;  2QSH X;  1N77 A;  1U8B A;  2NAZ A;  4CCL A;  4Z6Y A;  1MSF C;  2ZXH A;  3FDY A;  2MH9 A;  1MMA A;  3BJA A;  1M1E B;  3RZO J;  2LSO A;  5IPA A;  3T0Y A;  4KIG A;  1W36 C;  1U8R A;  1EH8 A;  2FEZ A;  3AG2 H;  3CD6 I;  3N97 A;  1TQI A;  2F5E A;  3AFH A;  2DO7 A;  3SZG A;  3I56 I;  2DK8 A;  4FT8 A;  2ZME B;  5CVV A;  2EIK H;  3COA C;  3B02 A;  3EUH A;  3E7L A;  3HZJ A;  2QEN A;  5HVQ C;  5B1A H;  2LRD A;  5DD4 A;  2VJ5 A;  4OWR B;  3CP2 A;  5E18 F;  4AIK A;  1Q1V A;  1D0X A;  1WI9 A;  3K70 C;  3J7A O;  2L4M A;  5L3C A;  3V8L A;  5IP6 A;  3H3Z A;  2L9V A;  4HZF A;  4RAY A;  4EAT A;  4N9H A;  2Z3Y A;  2GBY A;  2P5K A;  3BDD A;  3QPS A;  2OC6 A;  4IEJ A;  5ILV A;  2KPM A;  4YII A;  5J1Y A;  1PP7 U;  1Y56 A;  4N9I A;  1MBK A;  3TP0 A;  3PO2 J;  1V5E A;  2XGX A;  2PMU A;  2BEO A;  4XLF A;  3RYR A;  1Z0X A;  1VQK I;  4JX5 A;  2R7T A;  1WJD A;  2HYG D;  2RDP A;  2C6Y A;  3CLO A;  4UXN A;  2R7D A;  5D8L B;  3RTR A;  4HSR A;  4DJA A;  1KYZ A;  4PFO A;  3TOB A;  4B43 A;  2A5W A;  1S8N A;  3JTH A;  5J1U A;  4FX4 A;  4XR6 A;  3HHH A;  4Z2Y A;  4DYR A;  4G6D A;  2DPU A;  1I1G A;  3P9C A;  4RGS A;  1D1B A;  3GW2 A;  4B47 A;  3CDH A;  1A36 A;  5GAG J;  3CJN A;  4IOC F;  3MKY B;  2ZME C;  3SZT A;  3OY9 A;  1TLH B;  1PP8 F;  2D1H A;  2VBW A;  2DA2 A;  2JRM A;  4IVN A;  2P8T A;  3ZQ7 A;  4KT6 A;  2ZCW A;  3L2Q A;  3BR5 A;  4YEJ A;  2L7M P;  4A0X A;  2EZI A;  2RVC A;  2XPU A;  2QVO A;  3B6C A;  2CU7 A;  4XLE A;  2Z5U A;  4XRS A;  1IN8 A;  4RB1 A;  2QQB A;  2TCT A;  4JX6 A;  1KQ0 A;  3NRV A;  4DGW B;  3IKV A;  1KYW A;  3DP7 A;  4HX7 A;  3C2H A;  2PX9 A;  3CO6 C;  2ZJQ F;  4UUV A;  3REO A;  3FMQ A;  1R49 A;  2O8X A;  4GYI A;  2P7C B;  4B48 A;  2DDB A;  1FC3 A;  1TNS A;  1SAU A;  1XTA A;  1ZYR F;  4LJZ F;  4CCK A;  3A0B C;  1Z91 A;  2RV8 A;  1SEU A;  3G2B A;  2YPR A;  4KYW A;  2GLO A;  3OYJ A;  3DU5 A;  4OMY A;  4A3B J;  2E35 A;  3HOU J;  3GTM J;  4XLC A;  4U7D A;  3F8C A;  2GXA A;  1I5Z A;  4R1H A;  4XRS G;  4I6Z A;  1BR4 A;  2XAJ A;  5HS7 A;  1XN7 A;  3GBG A;  1OFC X;  1OPC A;  5FJ8 J;  3CCU I;  1ZQ3 P;  3GTO J;  1N78 A;  2DTR A;  4OOI A;  5IOZ A;  3NWT A;  1FP2 A;  1Y1V J;  3M7G A;  3QPT A;  3IL2 A;  5K7F A;  4PJJ A;  4XLH A;  1XGN A;  2L4A A;  2OQR A;  4BQQ A;  3L1P A;  1S29 A;  3PIO F;  5JHU A;  2HKX A;  2Y31 A;  1H88 C;  1O57 A;  4HOB A;  1JUM A;  1FOW A;  4XON A;  5C4X J;  5ICG A;  5FLX Z;  3PIP F;  3BG5 A;  1UG2 A;  1BL0 A;  1ZG1 A;  2BY1 A;  4JOM A;  2JVG A;  1YO5 C;  1DGW Y;  2M8G X;  1MBH A;  1OCO H;  4RMN A;  4FET A;  5CQE A;  2HQN A;  2R92 J;  2N8G A;  3V8K A;  2VT2 A;  3BC8 A;  3FBI B;  4BXF A;  4KUM A;  1FSH A;  3H1C A;  2CUF A;  2P6S A;  1MNE A;  2QCO A;  3ABL H;  3M07 A;  2KFD A;  3ONQ A;  3GFM A;  4ZTJ A;  1IRZ A;  5LHI A;  1QQI A;  1F43 A;  2H1L A;  1LPQ A;  5IYC J;  1QO0 D;  3EUH C;  5IP7 J;  1BJZ A;  2FF4 A;  3E5X A;  4BGD A;  3FWE A;  4F93 B;  3DKX A;  1MBE A;  5EG0 A;  3C2G A;  1U5T A;  3SHF A;  2FA5 A;  1TQM A;  2R5Z A;  1VF9 A;  4HDU A;  1XCV A;  2MLK A;  2PI0 A;  1ON2 A;  2VBX A;  3HC7 A;  1YS6 A;  3JRC A;  1P7I A;  1TWH J;  4EQQ A;  4HA8 A;  1I6H J;  3H9J A;  2XAQ A;  1YQA A;  2LRE A;  5B3S H;  3IUO A;  3LMM A;  4CA0 A;  2DMQ A;  1D5Y A;  1XDU A;  5CVU A;  3C18 A;  5L3F A;  4S0H B;  5CLS A;  4BEH B;  3ERE D;  4Y15 A;  3CMY A;  2R7F A;  3DWL E;  2DMP A;  2XRL A;  4V2G A;  5TGT A;  3VPR A;  3BPX A;  3OWT A;  1ZK8 A;  4LLG F;  1FBQ A;  2NS7 A;  2QUF A;  4B1R A;  4F3Q A;  2WY8 Q;  3JSO A;  2HR3 A;  1U3E M;  3B73 A;  5A2Q Z;  2WC2 A;  5KNL A;  5KVR A;  2OZ6 A;  1YJN I;  1ITY A;  3DBL B;  4OAY A;  4E7I A;  2L7K A;  5D5U B;  3Q9S A;  1PJR A;  4C3H J;  1OCP A;  3ULQ B;  3QPL A;  3K4L A;  4A69 C;  5B5E C;  3F8N A;  3CQZ J;  5IOY A;  1Z1D A;  2IP2 A;  2LKS A;  5CVR A;  1YFH A;  2WWY A;  3C2B A;  5E1X A;  2M87 A;  2EIN H;  1Z6R A;  2KL4 A;  3KE2 A;  3MEX A;  1Y0U A;  4A3E J;  2XC7 A;  1PYV A;  1SFO J;  1FTZ A;  2A69 F;  2NVU B;  3M8F A;  1Y8Q B;  2HS5 A;  3ESW B;  2IGN A;  1T0F C;  6PAX A;  2VOO A;  1P7J A;  3LSI A;  2GQQ A;  2RQP A;  2E36 A;  4MHG A;  2NS8 A;  1XD7 A;  2MC4 A;  1BOB A;  1WJE A;  4M3F A;  3HG9 A;  1MJA A;  4IQ4 A;  2PMZ N;  2EIL H;  5F0H A;  4XRM A;  4HDV A;  1YIT I;  5HNH A;  3HBL A;  4ASN A;  5GPC A;  1ZRF A;  2MFZ A;  1H9T A;  3K4M A;  2QEX I;  4D0P A;  4A3D J;  1BJA A;  2DOE A;  4HLX A;  3S1Q J;  3U2R A;  1A35 A;  5EGO B;  4E7K A;  1GXP A;  4PJM A;  3IKT A;  3CTA A;  5F08 A;  1W0T A;  1RKW A;  5L3E A;  1DPU A;  5EG0 B;  1MBG A;  1JT6 A;  2DCE A;  2KZG A;  3HYI A;  2X0L A;  3IRR A;  1PUF B;  1SFK A;  5GPA A;  1OCZ H;  4WX9 A;  1VQ7 I;  1Z7U A;  3QQA A;  2KDZ A;  4Q4Z F;  1CF7 A;  1BOA A;  4DW6 A;  1GVJ A;  3GXO A;  2WBM A;  4V19 K;  2JJ7 A;  5TJJ A;  2K27 A;  2DT6 A;  3ZMV A;  1F1Z A;  5GP9 A;  1SFU A;  3BTL A;  1T39 A;  1YIJ I;  2CFX A;  1JTX A;  2FMY A;  1K78 B;  1GT0 C;  1V54 H;  3FM3 A;  2K40 A;  1MND A;  4HF1 A;  4CO8 A;  3OYL A;  1G3Y A;  1O3R A;  3MVP A;  4HW0 A;  2FE3 A;  1WWX A;  2J5O A;  4RAG A;  3KET A;  4BAY A;  2M3A A;  2MSY A;  1Z3X A;  2A05 A;  1FYK A;  4M3B A;  2X1D A;  4XL9 A;  3TW7 A;  2GA1 A;  3C7J A;  2X6X A;  4LB5 A;  1O7F A;  2XHK A;  1YG2 A;  3JSP A;  4F55 A;  2FNP A;  4HF0 A;  1QRY A;  2NNY A;  1IRF A;  2R5Y A;  3OMY A;  1UZC A;  1TNT A;  2ISZ A;  2HVQ A;  2A6H F;  2K5C A;  3BR3 A;  1D3Y A;  4ZYH A;  2AQF A;  1DDN A;  3OYA A;  3OYC A;  1WI3 A;  3BPV A;  2L0K A;  2UXN A;  4P9U A;  3H0D A;  4IHW A;  1MJB A;  3V7R A;  4Y4R A;  1ZEL A;  3H5A A;  4XLA A;  5LGU A;  1X2N A;  3Q0U A;  1LNW A;  3T5X A;  2JA8 J;  4F92 B;  1GVD A;  2Z2S B;  3BR6 A;  5J8F A;  1IAW A;  1EV7 A;  2DJI A;  1APL C;  3DEW A;  1UFM A;  2K85 A;  4MEY F;  2QSG X;  3MD2 A;  3EQL F;  1LFU P;  2FBH A;  4OIR F;  1OYY A;  3OYH A;  2ICW G;  2IA0 A;  2XF6 A;  1S3J A;  2XF5 A;  4EM2 A;  2VAS A;  1IXS B;  2CUE A;  3JRE A;  1E3P A;  1VQL I;  2R7V A;  2VI6 A;  2HOT A;  2JMW A;  2R7X A;  2XUB A;  4L18 B;  3KEO A;  3ZQH A;  2M2E A;  1IUY A;  5EZH A;  2OBP A;  4XSZ F;  2ELJ A;  3ZQI A;  3JRF A;  1WSU A;  1AU7 A;  3CCL I;  2EZL A;  5IT9 K;  3SEZ A;  3OYD A;  1TQP A;  1V5G A;  1ZAO A;  5BPD A;  4NQW B;  4BJ5 C;  3CC2 I;  1O3T A;  2NNN A;  1WH7 A;  5GTI C;  1G8X A;  2ETH A;  3F0C A;  4G7O F;  5FKM A;  3I54 A;  3BZ6 A;  1R5H A;  1RES A;  4C2U A;  2AS5 F;  1XGO A;  2IEK A;  2EIM H;  3GTJ J;  1WCM J;  5LLQ A;  3DQV C;  3F9K A;  1T6S A;  4TV7 A;  5BQT A;  3BCB A;  2JSC A;  4M71 A;  4BE1 A;  3PFY A;  4KN7 X;  1FNN A;  4XM3 A;  2X9D A;  5GTH C;  4HV6 A;  3D0S A;  3I5U A;  1G59 A;  2H27 A;  3DKW A;  5JLX A;  3ABM H;  2XDV A;  3D1N I;  2R7Z J;  3W3C A;  4GO1 A;  4JP0 A;  4FE7 A;  4PGH A;  4EEF G;  1FMW A;  1W4M A;  3JRI A;  1TC3 C;  1MJ9 A;  3TKY A;  4G12 A;  4G7H F;  3NWS A;  4ENJ A;  4KN4 X;  4ETS A;  2R5Y B;  2W84 A;  3HKZ N;  3K1N A;  1FZP B;  1R1U A;  1K79 A;  2FBI A;  1XMX A;  2HU9 A;  4II3 A;  1YIO A;  3GFJ A;  2GXB A;  5JFR A;  1B9N A;  4BH9 A;  2CW7 A;  3GTP J;  2O61 A;  3A02 A;  2G7H A;  2R7R A;  3ZCO A;  1JE8 A;  2ELK A;  3JCU C;  3ASO H;  3S1R J;  3WTT C;  2XAU A;  1XDS A;  2RNJ A;  3S1M J;  3F3X A;  2H09 A;  3WHC A;  2Y2Z A;  2Y75 A;  1EKE A;  1RET A;  1YX3 A;  4A93 J;  2F5V A;  1F4K A;  3HJE A;  3FMR A;  2QGU A;  2STW A;  2ZNZ A;  3K4J A;  1DQU A;  3WGI A;  4PCQ A;  1TBX A;  3SFI A;  1I27 A;  2V79 A;  3IWZ A;  2RC4 A;  4RB2 C;  3VWB A;  2IS6 A;  2MG4 A;  2GA2 A;  1FJL A;  3PUF A;  4XOP A;  1H89 C;  2HKO A;  5FD5 A;  1Y0N A;  4G6T B;  1KGS A;  4DIQ A;  1VFC A;  2JTV A;  2Q1Z B;  5C44 J;  1W5T A;  3FF5 A;  1Y8R B;  4DBQ A;  5AON A;  4G94 A;  2W1O A;  3R61 A;  3O8H A;  2ZME A;  1P4W A;  2E5N A;  2YU3 A;  3PNV A;  1Z6T A;  3WU1 B;  2HFH A;  2DA6 A;  1STZ A;  2IAI A;  2KHM A;  2RGV A; 
#chains in the Genus database with same CATH homology
 4XR6 A;  4E7S A;  2CW8 A;  3OYK A;  3H9G A;  2WA0 A;  4XN0 A;  1D1B A;  4B47 A;  3S8P A;  2DXI A;  4YRV A;  3MKY B;  4PFP A;  3OY9 A;  4KIT B;  2W82 A;  4P5O A;  2XSJ C;  3VYU B;  4CCJ A;  2KZV A;  4E7L A;  4KT6 A;  1WJB A;  3L2Q A;  2LOO A;  4YEJ A;  1EA3 A;  2X6W A;  1X4O A;  2UWM A;  4XLE A;  3A4C A;  4LIT A;  2BW3 B;  4DGW B;  4RM3 A;  3PSF A;  2M4K A;  2UUZ A;  3C2H A;  2MAB A;  2L2O A;  4D1Q A;  3KYL A;  3BG6 A;  3W2V A;  2VXD A;  4B48 A;  3EUK L;  1X1C A;  3OR2 C;  1SAU A;  3W2W A;  1BR2 A;  4CCK A;  1X1A A;  3G2B A;  2IS4 A;  2E1M B;  3VDX A;  1X1B A;  3QYB A;  2ZSH B;  3DTK A;  3OYJ A;  3DU5 A;  2KRH A;  4NC8 A;  4XLC A;  2GOM A;  2X1E A;  1FMV A;  1BR4 A;  3N05 A;  2HDW A;  3GBG A;  3DTE A;  4NC7 A;  1N78 A;  3ZRG A;  3CF2 A;  2X1C A;  2XF7 A;  1Z21 A;  3NWT A;  3HXL A;  2JSP A;  4J00 A;  4AU7 A;  2CUZ A;  3PUB A;  4PJJ A;  3PNY A;  4XLH A;  4B3X A;  3E0J B;  4BQQ A;  4PJL A;  2X6Y A;  1WJF A;  3QYE A;  2FUG 2;  3DPL C;  3LL7 A;  5KCM A;  4XKC A;  2CV1 A;  4XON A;  1TT0 A;  4ZDP A;  3CJQ B;  3DLA A;  2IS2 A;  4XMY A;  3U21 A;  3LSG A;  4BJ6 C;  2CMP A;  1OLT A;  2X85 A;  4GRI A;  2L9S A;  3DKY A;  3SDB A;  4CSW A;  4JOM A;  4BL0 B;  2JVG A;  1DGW Y;  1K6Y A;  2KDO A;  4BDZ A;  4RMN A;  4FET A;  5CQE A;  1WJ5 A;  4BE0 A;  4HEA 2;  3BC8 A;  3FBI B;  4PK4 A;  2LYC A;  2VJJ A;  3DTI A;  3BLY A;  4ZDL A;  4BXF A;  2V7F A;  3CJR B;  1MNE A;  3TL4 X;  2E1M C;  3ONQ A;  4ZTJ A;  3ZXS A;  1LDK B;  4HNT A;  1AA7 A;  4DOZ A;  3HOS A;  3I9V 2;  1U0J A;  3EUH C;  2WY7 Q;  2BVM A;  2HQA A;  3VSL A;  4BGD A;  2VQG A;  3BCA A;  2VLA A;  4F93 B;  3DKX A;  4XOT A;  3C2G A;  4H4K C;  4HG2 A;  3QOE A;  3S32 A;  2HNH A;  3OOU A;  2LH9 A;  4BU2 A;  4C30 A;  2QKL B;  3PL8 A;  2VXZ A;  3HC7 A;  2QKM B;  2M4G A;  3HL2 A;  1D0Y A;  3RCO A;  4U87 A;  3H9J A;  3V42 A;  3OYN A;  2LRE A;  3IUO A;  3LMM A;  4CA0 A;  2HVS A;  4Y33 A;  2I8D A;  2JUG A;  4BEH B;  2KP6 A;  2R7U A;  3S93 A;  1MMN A;  2F6C A;  2VL8 A;  2Y0S A;  2W00 A;  1NG6 A;  3EPZ A;  2PMZ A;  3DWL E;  3LSK A;  5TGT A;  5HNF A;  2HPM A;  3OWT A;  3RSN A;  2WAQ A;  5CQG A;  3OYB A;  3VSK A;  3DPT A;  2VQL A;  2MD0 A;  4IQJ A;  3A1Y A;  4F3Q A;  2WY8 Q;  2KLO A;  3D5L A;  4B44 A;  2LY1 A;  4CH7 A;  2R4G A;  2DT7 B;  4OAZ A;  3HPG A;  5KNL A;  4F52 A;  3HOT A;  4OAY A;  3DEE A;  4E7J A;  4E7I A;  2L7K A;  3KEY A;  1PJR A;  2UV1 A;  3K4L A;  4PSX A;  2K9M A;  2VJI A;  2CUJ A;  4BQO A;  2Z1D A;  1D1C A;  2M7A A;  1HA8 A;  4LG3 A;  2KL4 A;  3CP8 A;  2PJR A;  4BEH A;  2XC7 A;  1PYV A;  4BDY A;  4CCN A;  3QOD A;  2KQR A;  3PJR A;  3CMM A;  3SYT A;  1P9Q C;  2ZSI B;  2IGN A;  1T0F C;  2V26 A;  4ZDO A;  3ZGK A;  4BS9 A;  2M0M A;  4U7B A;  3LSI A;  3IP4 B;  3AL0 C;  2MYS A;  3H9Q A;  3S3M A;  2IXS A;  4BJT A;  4QPO A;  3ZQQ A;  5HOO A;  1UEL B;  4KIS A;  2MC4 A;  3K6G A;  2M7B A;  1BOB A;  1WJE A;  3LSH A;  1R6R A;  2V9K A;  3HG9 A;  3DPU A;  3HPH A;  4IQ4 A;  4NUB A;  4BQN A;  4R79 A;  4YEL A;  5CKT A;  4P1W A;  5HNH A;  1T95 A;  3L2W A;  2MFZ A;  2R7Q A;  4FAS D;  3K4M A;  3LSM A;  2X51 A;  3OS0 A;  4E7K A;  1VZ0 A;  3LFU A;  4PJM A;  3MMY B;  2AQE A;  3OL4 A;  4AYB A;  3VYS B;  4BAC A;  2DCE A;  3OL3 A;  2KMU A;  2A6T A;  2V1N A;  5JHF A;  4ZTF A;  2L9N A;  2DOA A;  3OYM A;  1X4P A;  3OIQ A;  3FHN A;  4CZC A;  1SFK A;  4XQF A;  4J01 A;  3K4K A;  2E5Z A;  4RLQ A;  1D1A A;  3M1C A;  2JVH A;  4CCM A;  4DBR A;  3EUA A;  2CFO A;  1WJA A;  3MKZ A;  3KX2 A;  3H5R A;  3IAM 2;  3S3O A;  3RPU D;  2WBM A;  2DT6 A;  3QYF A;  2WAE A;  2Z16 A;  2IGK A;  3OYE A;  4HRI A;  2P0W A;  2GOX B;  1MND A;  1Z7L A;  3OYL A;  4E4H A;  2VKH A;  3UNG C;  4X0G A;  3L2U A;  2LBF B;  2HZD A;  2M3A A;  3K4B A;  1Z3X A;  2L5Q A;  3VYR B;  2VB6 A;  2V4J C;  2X1D A;  4XL9 A;  3D5R C;  2X6X A;  1UG0 A;  5LD2 C;  3PNT A;  1WJC A;  4XKV A;  3A2K A;  4F55 A;  2K9L A;  3AL0 B;  1JI8 A;  3HUG B;  2IGM A;  1Z3Y A;  2LG4 A;  3OMY A;  2HVQ A;  2K5C A;  2PJR B;  1GLN A;  1LKX A;  2AQF A;  3IAS 2;  3D5S C;  1QHH D;  4RLF A;  3ZR8 X;  2CV2 A;  3OYA A;  3OYC A;  1YX5 A;  3H0D A;  1QU3 A;  4Y4R A;  1N75 A;  1ZEL A;  3H5A A;  1S9H A;  4XLA A;  2R7W A;  3CZ6 A;  2IS1 A;  4F92 B;  2RQQ A;  2Z2S B;  1WFX A;  3K10 A;  2DJI A;  2LBF A;  1MMG A;  4LIV A;  3MD2 A;  1IRX A;  2V6E A;  4XNF A;  1YE9 A;  5LFA A;  3OYH A;  1ERD A;  3TMO A;  1MW7 A;  3BG7 A;  2XF6 A;  2XF5 A;  2VPL A;  2BVL A;  1QHG A;  2VAS A;  2WB1 A;  3RQ4 A;  2VQH A;  3MKW B;  4RM2 A;  2BOL A;  2R7V A;  4ZYA A;  2R7X A;  3HKZ A;  4ITV A;  4XKW A;  4JQF A;  2ELJ A;  2OUM A;  4E6K G;  4CUG A;  5CPR B;  4IX7 A;  1V5F A;  3SEZ A;  4PJN A;  3PSI A;  3I3L A;  4NNJ A;  4XN3 A;  4ZJZ A;  3OYD A;  2E60 A;  1V5G A;  1MMD A;  4NQW B;  4BJ5 C;  2LC2 A;  1G8X A;  1X1D A;  4BE2 A;  5KHD A;  3S3N A;  4C9Y A;  4C2T A;  1W36 D;  1DP3 A;  1NG7 A;  4CCO A;  1Y6I A;  3J7A Y;  2OV7 A;  4C2U A;  2CS3 A;  4IKF A;  2O5R A;  3L2V A;  3DQV C;  3F9K A;  1TZL A;  3BCB A;  4PUS A;  4BE1 A;  3PFY A;  2CV0 A;  5FRN A;  1LFP A;  4HPQ A;  4XM3 A;  4N4O B;  1G59 A;  2WAF A;  3M8J A;  2R7S A;  2W4S A;  3TBI A;  1E0E A;  3AKZ A;  2JA2 A;  3OYF A;  2LY2 A;  2W7N A;  4IZZ A;  4HST A;  3OYG A;  2K3P A;  2XDV A;  3K70 D;  3W3C A;  2IGO A;  3K4N A;  4AVZ A;  3FKJ A;  4XKB A;  3UR3 C;  1FMW A;  1BR1 A;  2BW3 A;  3W2A A;  4QPQ A;  3NWS A;  1N77 A;  4Y3O A;  2R7O A;  3DU6 A;  4CCL A;  1KON A;  2CH0 A;  2RNG A;  4MLO A;  2ZXH A;  3FDY A;  1MMA A;  2HU9 A;  1D0Z A;  3K4C A;  4II3 A;  5HLT A;  2CW7 A;  1W36 C;  3OYI A;  2R7R A;  3ZCO A;  3AFH A;  4BUP A;  3SZG A;  4LIU A;  2ZFU A;  1UAA A;  4N4N B;  2VKD A;  2XAU A;  1OR7 C;  3CES A;  2VIX A;  3OIP A;  5HVQ C;  2LRD A;  4ANJ A;  4E7Z A;  2VJ5 A;  1DGR M;  4OWR B;  1LVK A;  1YX3 A;  3VYT B;  4F91 B;  2F5V A;  3CP2 A;  3OS1 A;  4PSW A;  3K4J A;  3OS2 A;  2HPI A;  1D0X A;  1DQU A;  3K70 C;  3H5N A;  4II2 A;  4EAT A;  2F4I A;  3VWB A;  4XOR A;  2IS6 A;  3SEQ A;  4XOP A;  1J09 A;  2OC6 A;  2KPM A;  4G6T B;  3E1S A;  5FRM A;  2HVR A;  1Y56 A;  3OR1 C;  4DIQ A;  1X19 A;  2Q1Z B;  1V5E A;  4D9J A;  2NOJ B;  4XLF A;  3L2R A;  2ZXI A;  4ZC3 A;  2R7T A;  1WJD A;  4HNU A;  4DBQ A;  2WAD A;  2VQC A;  2W1O A;  2VJ4 A;  5FRO A;  2E5N A;  4KJZ A;  3PNV A;  3RTR A;  4HSR A;  3H35 A;  2KRC A;  2RRE A;  4PFO A;  4B43 A;  4DJA A;  2A5W A;  2Q2E B;  4E7H A;  3FBN B;  2KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...