5M3FJ

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m3fJ00
2IAIA 1RESA 1HLVA 4MIMA 5F0FA 4FE7A 3GTKJ 4AYBN 1JUMA 5FKLA 1LE8A 1IG7A 2ID6A 3GTQJ 4XRSA 1JKOC 1ETKA 3JRIA 1F43A 1MBHA 2E2JJ 3S16J 4I6ZA 2R5YB 5IPAA 1ITYA 2X48A 2CQXA 1UG2A 5F0CA 3S15J 2FQ4A 2NOGA 3BQYA 1ETWA 2LD5A 5DTDA 2LTPA 2AO9A 3QQAA 1JTYA 5FLMJ 1I3QJ 3S1QJ 5GPCA 2M9HA 4IHVA 3JREA 4FTHA 1IV6A 4BY1J 1ENHA 3NARA 2FX0A 2JWTA 3GTGJ 3HOUJ 1OFCX 2PMZN 2EH3A 1X2MA 4A3FJ 3DCFA 5FJ8J 1CQTA 2Y31A 2NS8A 4UUSB 3S2HJ 4RBOA 5F0HA 4W1UA 4I76A 3GTPJ 2EBIA 4X6AJ 2R5ZB 5IP7J 4V2FA 2R7ZJ 2IBDA 3DEWA 3D1NI 1Z77A 2O9LA 3I4MJ 2E2IJ 2Y2ZA 1UMQA 3TEDA 1O4XA 3F0CA 1RKTA 3BG3A 3JRAA 1WI3A 1TWFJ 2FJ1A 3JRFA 4B4CA 2CU7A 1EF4A 2CUEA 4DW6A 1GUUA 5EYRA 5EZGA 5J3LA 3BTIA 3IH3A 2L9RA 3HEFA 1MSFC 2EQRA 3BR2A 1S7EA 3TP0A 4A3JJ 1P7IA 2DA5A 1E3OC 1B72B 2HOTA 1FJLA 4IHYA 5F27A 4DYCA 1K61A 3CCYA 4D5CA 3HGYA 3ZOBA 2WV1A 3ZQGA 3HOWJ 2L7FP 5FKOA 1ZKGA 5IP9J 2Y9ZA 3CQZJ 1MNMC 1JKPC 3HKZN 2QCOA 3GTJJ 1HOMA 5FKKA 4IHWA 3MN2A 3TP3A 2H1KA 5EDNA 4A3IJ 1D5YA 3S14J 4BBSJ 1ZR4A 1JUSA 1TC3C 2DA4A 1X2NA 2DMUA 2M2EA 1FEXA 1SANA 5E3MA 4JX4A 3A02A 4BBRJ 2DJNA 2TCTA 2WAQN 3GTOJ 4M3DA 1ZGWA 3OSFA 4LOCA 1AKHB 3BTLA 3BG5A 1U78A 4XICA 1X58A 1BJZA 2NVQJ 1APLC 1QPIA 3BR5A 4C3JJ 3OOUA 2DA6A 3B6AA 1VNDA 5F08A 2EZLA 1IDZA 2XPUA 3HBLA 1B72A 5JLXA 1PUFA 3TW6A 3HOVJ 1I50J 3HOXJ 4DZPA 5C44J 2MSYA 2VI6A 2R93J 2LR8A 2JA6J 1AHDP 3MKLA 3JR9A 3Q0WA 1ETOA 5F04A 4HNVA 2GM4A 1Q1VA 1MBFA 3LSRA 1BW6A 2XGCA 2XPWA 3JRGA 3ZQHA 1B8IB 3E7LA 2NVYJ 2ECCA 2MG4A 2OPTA 3SDGA 1LFUP 1MBKA 2DMNA 5M3FJ 1ETQA 5M5XJ 2O8KA 5K7FA 4C3HJ 3FK6A 4A3GJ 1WH5A 5C4JJ 1IDYA 2ECBA 3NAUA 2O7OA 3O8GA 2LY9A 2N8GA 2M8GX 1MH3A 2X6OA 3S17J 4A69C 4C2MJ 2K9SA 3H3VK 1GT0C 5FLVA 3WHCA 1RPWA 2HQ5A 4UUTA 1GVDA 3LSPA 1YRNA 1TWCJ 3Q0UA 1LE8B 2JA8J 1ZTRA 1H88C 2L0KA 4BXXJ 4GFBA 4ABZA 4AC0A 3RZDJ 1FTZA 3OSGA 4CYCA 3S1NJ 5GP9A 3HOYJ 1P7JA 1XG1A 4JX5A 1TWHJ 2CJJA 4EEFG 3A01B 1ETXA 1IRZA 2CRGA 3ZQFA 2KT0A 3JRHA 1OCTC 1VF9A 1OCPA 1IUFA 1FIPA 5C3EJ 4FISA 2M0CA 3OIOA 1TWGJ 5EEAA 3Q3SA 1Y1WJ 5J1YA 3A03A 1RR7A 1MH4A 2M34A 4M3FA 3QPLA 4MLOA 2DTZA 2YUSA 5IOYA 4V2GA 3PM1A 2GBYA 1F36A 2H8RA 1HDPA 5M5WJ 2ME6A 3JRDA 1DU6A 4A3DJ 4UUSA 2L7MP 3HDDA 2ME0A 5EG0B 1IC8A 2I10A 3JRCA 4FE4A 1BA5A 4QTRA 4MFEA 1H8AC 1OJLA 2XGDA 1NTCA 1VI0A 5JLWA 4MO7A 1AU7A 2KDZA 5IYBJ 1A6IA 5K7ZA 4IEJA 3UKGA 2HXIA 3M4OJ 2XB0X 5C4XJ 2D5VA 2LKXA 2R5YA 3LSJA 1HF0A 2JA7J 2TRTA 3G1LA 3RZOJ 2W48A 4A3MJ 3FIWA 2WB1N 1JJ8C 2K40A 2ID3A 2HOAA 3MVPA 1ZQ3P 2L7ZA 2VKEA 5IYDJ 5DS9A 3BR0A 2R0QC 4A3KJ 2K9NA 3L1PA 2E2HJ 3ZQIA 1ORKA 3G1OA 5EG0A 1FTTA 2LFBA 3BR3A 1NK3P 1BW5A 2XGEA 2ZB9A 3IH2A 4D7MA 2B63J 3K2AA 2EZIA 3S1RJ 5K7HA 1JGGA 1QRYA 5IYCJ 4DYQA 3M3YJ 1ZK8A 4X1EA 4A3EJ 2ELKA 2YS9A 3LSGA 2JK3A 1T56A 4XK4A 4M3GA 3S2DJ 3Q0VA 2NS7A 5GPAA 3PO2J 1QVUA 3GTMJ 4XRMA 2OF7A 1WGXA 2LLKA 4L5EA 1SFOJ 1GV5A 4A3CJ 1JT0A 3TW7A 3GTLJ 9ANTA 2JN6A 1GV2A 1WPKA 3GBGA 2HXOA 1LFBA 4AUXA 5EF6A 1JJ6C 4JP0A 5E3LA 1MBGA 1Y1VJ 3A01A 5IP6A 1H89C 3BQZA 2YU9J 3HB9A 3RQIA 5M3MJ 4CYCB 3HGGA 3C2BA 3I4NJ 1G2HA 3CDLA 5J1UA 1T33A 1JKRC 1BL0A 2MGQA 2R5ZA 2G0EA 4M3BA 3H0GJ 2VKVA 3HM5A 2NVTJ 1JUPA 2VUMJ 1UHSA 1Z0XA 1ZR2A 4FCYA 1YRNB 3IH4A 1ETYA 2IEKA 2MW8A 2DA3A 4D7NA 4DYRA 4BY7J 1W0TA 3BG9A 2E1OA 4G12A 4IHXA 3SJMA 2CQQA 4M6VA 3QPSA 1FIAA 2HI3A 4B3AA 4A3BJ 5EZHA 2Y9YA 1R9TJ 4NDLA 1NK2P 3B6CA 3G1MA 3PO3J 1QVTA 4BKXA 4B1RA 2DMQA 4JYKA 1HDDC 2K9QA 2JMWA 3LNQA 1B8IA 2RAEA 2DMPA 1K83J 5IOZA 1TWAJ 1DU0A 3O8HA 2XPVA 1U9OA 2VPRA 4QSHA 4A93J 4W97A 5E3OA 2LVSA 5FKNA 5EGOA 1A5JA 1JKQC 4M3EA 5F1JA 3JRBA 2HYJA 4JX6A 1XS9A 3CMYA 3LOCA 2JA5J 4Y52J 1AKHA 1VFCA 4Y7NJ 2CUFA 3VPRA 1MBEA 2HDDA 3WHBA 5EGOB 3RKQA 2DA2A 3SFIA 5J1RA 2AHQA 1PUFB 1IGNA 1MSEC 5BNGA 2GLOA 3ZQCA 1GDTA 3ZQLA 4RDUA 3FKIJ 5HODA 2DA1A 2QF7A 3BT9A 3FK7A 1POGA 1ETVA 1U9NA 2LP0A 2NVXJ 1WCMJ 1JT6A 2Y0SN 4J19A 4A3LJ 2EZHA 4C3IJ 1WH7A 2LK2A 4QIWN 3S1MJ 5M5YJ 4MFDA 2XB5A 3BR1A 1MBJA 2EZKA 4XIDA 2XRLA 1RETA 4DZJA 2P81A 3FISA 1HCRA 2Y30A 2DMTA 1IJWC 2E19A 2DA7A 2X9DA 4D5FA 2XSDC 3BTJA 3BTCA 4XRSG 2HOSA 4S0HB 1XC5A 1RKWA 1I6HJ 3HOZJ 3W6VA 2JJ7A 1U8BA 1W0UA 3BR6A 5E3NA 2R92J 3IV5A 1JTXA 5FKMA 2COBA 2DN0A 3K7AJ 2FD5A
chains in the Genus database with same CATH superfamily
3W6KB 2IAIA 2D1HA 2ESHA 3O6BB 3ABMH 2PBIA 4MIMA 3W2AA 4AYBN 4LLNA 1G6NA 2EPFA 1YJNI 2M3AA 4E7ZA 3X2QH 1OLTA 1KA8A 2A68F 2ICWG 4G6DA 4LK0F 4I6ZA 1D1AA 2CQXA 4OWRB 2CQNA 2FQ4A 1T2KA 2R7SA 1ETWA 2A69F 2LD5A 2LTPA 1OCRH 2JSPA 2KRFA 1UHWA 4Y15A 3M8EA 5B5EC 2M9HA 3KP4A 5KAIC 3DPLC 3LL7A 2LREA 1BIBA 1V54H 2H27A 3GTGJ 2PMZN 3J80K 2EH3A 2HOEA 3EQLF 3K10A 3WTYC 3DCFA 1CQTA 2FA5A 1XB4A 4O5VA 3L2VA 1XD7A 4RB0A 2VQLA 4E4HA 1LVKA 2ZSIB 3GTPJ 4HV6A 2EBIA 3UR3C 4BQQA 4PJ0C 3I54A 2F4MB 4V2FA 4BS9A 2KKOA 3RJPA 2IBDA 4NQWA 3D1NI 2O9LA 3I4MJ 2VB6A 2E2IJ 2L54A 2OJED 3G2BA 2OC6A 5H20A 1ON2A 3SYTA 2W57A 3F0CA 2Y48A 3E6DA 2MA3A 2FMLA 3MFKA 1W5SA 1VTNC 2EFOA 3C2HA 4HQEA 3OYEA 2L7KA 1YI2I 5FRNA 5LGTA 5ICFA 2L2OA 2OCCH 3VSKA 4DQ2A 3BJOA 2GWRA 3K6GA 3FM5A 4XLHA 2HPMA 2HQAA 1YOVB 4BXFA 4HDVA 3QRFF 5HLIA 2V79A 4HX4A 1H9TA 1KU2A 3HG9A 1ULYA 2R7XA 2DA5A 4ASNA 4B43A 2IS6A 4L9NA 2OZ6A 3HIFA 3OL4A 1KGSA 4AVZA 2BY1A 2JPCA 2WV1A 3V7CA 3ZQGA 2PJRB 2L7FP 2RQPA 5FO5A 3TOAA 3HUGA 3CC7I 2Y9ZA 3CQZJ 1ERDA 1MNMC 1WRJA 1J5YA 3HKZN 3PFIA 3JTHA 3G73A 1HOMA 5FKKA 2HKXA 4BHBA 4A3IJ 2IPQX 3S14J 2FUG2 4BBSJ 4CZCA 4RGSA 2XAFA 1JUSA 2DBBA 3CF2A 3HRSA 3VDXA 4HNTA 1VQ8I 2CV1A 1WJ5A 1X2NA 2M2EA 2QQ8A 4UVBA 3KP3A 4U0VA 5E20A 1HKTA 1LNWA 3K4LA 3F21A 4PUSA 2YX4A 1ZGWA 4P9FA 1IXRC 3HSFA 1AKHB 5FB2A 3H5RA 1D1BA 1CGPA 2F5DA 4TV7A 3NWTA 3K0LA 3FZVA 1BJZA 4XOPA 3HC7A 2NVQJ 1BOAA 2NOJB 4EQQA 4U87A 2KMUA 3KPHA 2BW3A 2NXNB 2HPIA 2CWEA 2XPUA 3F6VA 1D0YA 2KPMA 4D0PA 4XLPF 2CMPA 1PUFA 1LDJA 1SD6A 3HOXJ 4A5NA 3CD6I 2DDBA 2DI3A 2QGUA 4HZFA 2MSYA 2ZJRF 3DKYA 1VQPI 2R93J 2LR8A 1QHGA 4HNVA 1IXCA 2LNBA 1MBFA 1KU3A 5CVIA 3LMMA 3CUQB 2XGCA 2XPWA 3ZQHA 4YFXF 3PFYA 2DJIA 2R7TA 4BNCA 2M0MA 2PG4A 2VASA 3VEPA 1T39A 3SEQA 4XKVA 5HDKA 3K4NA 5M5XJ 4P96A 2O5RA 2CG4A 5DDGA 1MKMA 4C3HJ 5K7FA 3FK6A 2ACJA 3EUHA 1WH5A 2DT7B 3J80Z 3U1KA 3FF5A 4ESFA 2LY9A 5DM7F 4BDYA 3WTUC 1Y56A 1UAAA 3FWEA 3PNYA 1ZAOA 2FRHA 1S7OA 4AWXB 1TQIA 4UXNA 1XX5A 3H3VK 1GT0C 1DPUA 1I3AA 2KDOA 1XMXA 1OISA 3H35A 1RPWA 3CF5F 1BC8C 1C0WA 4ENNA 3OR2C 3J7AO 1YRNA 2ELJA 4G6QA 3NQOA 1LE8B 1V5FA 1H88C 2HZTA 2X0LA 4BXXJ 4XLFA 4A5MA 1FTZA 2IVMA 2E7XA 6PAXA 3HOSA 4LG3A 5GP9A 3WTZA 3TBIA 3DU5A 1YG2A 1P7JA 4L9TA 1QHHD 2QBYA 2P7CB 2QUFA 2BVMA 2A6TA 2QZ8A 2Y69H 4RGRA 4KFCA 1IRZA 1YIJI 4IXAA 2CRGA 3ZQFA 3E0JB 5IT9K 1VF9A 5L3DA 3IWFA 3CCLI 4A2UA 5F64A 4KIFA 2B0LA 1R7JA 2M0CA 3J81K 4YFNF 1Y0NA 4P9UA 2MD5A 3TO9A 2EB7A 1HKSA 4C30A 3ZN1A 5E1XA 3ABUA 1J75A 1X1CA 3AG2H 3KZIC 4MLOA 3K4CA 4KYWA 4Q4ZF 2AXLA 2DTZA 4V2GA 2GBYA 3HHGA 4N9IA 1YS6A 3I53A 3VYRB 3NRVA 5M5WJ 1YW7A 3WU0A 3CCEI 2PMUA 1QA6A 4ZTFA 2ME0A 2GIZA 3MZYA 2EV0A 2I10A 1GLNA 2AXTC 5LEKA 3E5QA 4FE4A 2COMA 4QTRA 3TDUC 4MFEA 2JUGA 2OAZA 3K1PA 3OS2A 1J9IA 1XGMA 3H1CA 4HF0A 5JLWA 1AU7A 2XAQA 3DBLB 2EIJH 2WTEA 4I99C 1A6IA 1XGNA 4IRHA 4HEA2 2XB0X 5C4XJ 4XQFA 2KRHA 3HYIA 3G1LA 1BBYA 3D5SC 1UHMA 1Q1HA 1U5TA 3GFMA 3WG7H 2W48A 4L5IA 4D9JA 2OUMA 5HOOA 5LD2C 2BY0A 4E7KA 4HAMA 2K40A 2ID3A 2CQKA 4JBAA 1J7KA 1ZQ3P 2R0QC 1Z05A 3FHZA 3Q9VA 4KT6A 4CICA 5JI6A 1FBQA 2DOFA 4ESJA 3BR3A 1BW5A 2E60A 3UNGC 2XGEA 2B63J 1LKXA 5L3FA 3GZ5A 1G3SA 4HX7A 2B7EA 1DDNA 1QRYA 3V42A 5BQTA 4X1EA 4X0GA 4A3EJ 2CGPA 2JK3A 4XK4A 4ZYDA 1RR8C 3S2DJ 5GPAA 2H8WA 3C3WA 2MFZA 5KNLA 1TZLA 4XRMA 2VKHA 2OF7A 2KFDA 2J5OA 4O6JA 3W2VA 4WWCA 3N05A 1TT0A 4JOMA 3I4PA 3ONQA 5D5WB 5H6QA 3GTLJ 1G3TA 4JK1X 1WPKA 2ZC2A 3GBGA 5EF6A 1LFBA 2NNNA 3G4SI 1JJ6C 3C18A 4RLQA 1AWCA 2JA2A 1SAUA 1OR7A 4EGYA 1H89C 3HKZA 4IPAA 3HB9A 3RQIA 1Z67A 5K5QA 5ED4A 4HLXA 1P4AA 2MH9A 3IRRA 2Y75A 3RKXA 3HL2A 4M9ZA 1JKRC 4XLNF 3CJNA 3CTAA 4CDGA 1JUPA 4F7ZA 4FCYA 1Z6RA 1FOXA 3OYLA 4QPOA 4IHXA 4HRIA 4E7HA 3B73A 3IUOA 2CQQA 4PDKA 1IN8A 3ZMUA 4EV0A 4L0ZB 3KX2A 4S04A 3B6CA 4OOIA 2KIUA 4BJ5C 3HRUA 1ZLKA 2E35A 5EJCA 3QP6A 3F6OA 2JMWA 4BE1A 3CUOA 1ZLJA 2MBFA 1K78B 5IOZA 2IS2A 3TO7A 1DU0A 4OIQF 3P9CA 2XPVA 2MC4A 3A0HC 2VPRA 2H6BA 3OL3A 1HSTA 4QSHA 4W97A 1E3PA 2ZJQF 5E3OA 2LVSA 4XNFA 1TLHB 3ABTA 3F8BA 1RRJA 1KYZA 3JRBA 4JX6A 2W82A 3CMYA 2JA5J 4Y52J 5D4RA 2XUBA 5K1YA 4ZJZA 1VFCA 4Y7NJ 1X3UA 5EEGA 3HSRA 3WHBA 4L0YB 5GTIC 3I59A 1A35A 1I5ZA 3P7NA 1DGWY 2Z9OA 1MSEC 2XVCA 3KLOA 4IL6C 4I0AA 3ZQCA 1J09A 4XONA 3TGNA 4RDUA 2G7HA 2GXGA 5HODA 3ZGKA 4AVPA 4CXFA 2KHMA 1FOWA 2DA1A 3DPUA 2QF7A 4G94A 1R23A 3E1SA 2XASA 4EGZA 3E6BA 2LP0A 2X6WA 2OA4A 2CW7A 1XCVA 5HDNA 1TP4A 2Y0SN 3VFZA 2LK2A 4QIWN 5FRMA 5JR3A 2XB5A 1U0JA 1SC7A 4EJOA 2EZKA 1X1BA 1LPQA 3KP5A 3CC4I 1RETA 4EM0B 4NHJA 4BYYA 2P81A 4KJZA 1FMWA 2DA7A 2X9DA 4D5FA 1BI2A 3BTJA 2PMZA 3ASNH 3BTCA 5BMZA 5BPDA 3DLAA 3GFLA 4PK4A 3QU6A 2ZBKA 4Q47A 4GO1A 1MJAA 4M6YA 4OIRF 1SEUA 5H2FC 4E7SA 2QENA 4IOAF 1R36A 2E1MB 2BXZA 1W0UA 5E3NA 3ZMTA 1YHQI 1YTYA 2VOPA 1Y8QB 1JTXA 2RREA 5FKMA 4A6DA 3GTQJ 1FPQA 1TQPA 4BQAA 2R7QA 1Z1DA 3I71A 4FE7A 2NAZA 1MDMA 4HSRA 2P6TA 3FXQA 4FASD 2NRAC 2XKOA 4PFPA 2DODA 1IG7A 4F52A 4XRSA 2AQEA 1JKOC 3BROA 3TDZC 1WJBA 4BACA 1F43A 2E2JJ 3S16J 1U2WA 2DK8A 3OOPA 2L9SA 2R5YB 3H9JA 1FY7A 3HZJA 3S15J 3OYDA 2KIFA 2VJ5A 2MABA 5FLMJ 2F5CA 5BOXA 3FXKA 2HQRA 3HJEA 1VQKI 1I3QJ 3OIPA 3O2PE 3S1QJ 5GPCA 3MAJA 5J47A 3OYMA 3JREA 4FTHA 1IV6A 4DNCA 5HS8A 1X3WB 2FX0A 2JWTA 4A0ZA 1P4XA 3ERMA 4A3FJ 1X2MA 1VQ9I 3F72A 1MMAA 1V5GA 2NS8A 5DD4A 4UUSB 2WAEA 3PUBA 4EATA 1QBJA 4YIFA 3GCMA 4BL0B 1R6RA 3AAFA 2QVOA 4X6AJ 1IN4A 2P5VA 2VJJA 5IP7J 5F6FA 4MEYF 2R7ZJ 3FHNA 3GWZA 3ZXSA 4HOBA 2DFHA 2EK5A 1XMAA 1UMQA 3LSMA 3OYFA 3V8KA 1S6LA 2V9KA 1RKTA 5AIPA 3BG3A 3M1CA 1TWFJ 2VXDA 1SMTA 1B6AA 2ESNA 1BI1A 1B1BA 2QKMB 4WX9A 3RI4A 2RKHA 2K7LA 2HVSA 1EF4A 3AG4H 5HDGA 1GUUA 2ZJ2A 2PQ8A 5FD6A 4J00A 2FBIA 1T98A 2IA1A 2OV7A 1VZ0A 2VC1A 3BTIA 2L9RA 1FYKA 1Y0UA 2EQRA 2YU3A 2ZCWA 3TP0A 2R7WA 4A3JJ 1UB9A 3O3KA 4KA4A 2Z2SB 3CCYA 4ZTJA 1IN7A 4Y4RA 1W36D 3HHHA 4CCLA 2VONA 1KQ0A 1B9NA 2LC2A 3Q5FA 1U5TC 3CCQI 1ZKGA 2V1XA 2Q8KA 1JKPC 1H9GA 2EFPA 1KYWA 3H9GA 4IHWA 1TW2A 1Z6TA 4I02A 3TP3A 2RDPA 1KQ9A 3S3MA 5FLXK 2IXSA 2QM3A 2PLYA 1D5YA 1KU9A 1D0XA 3GFIA 5CQEA 1ZR4A 1YW8A 4UY8I 3L2WA 3CMEI 4ZYEA 3KFWX 2K4JA 3RQ4A 2DJNA 2WAQN 4MTDA 4CSWA 3VODA 1R5GA 1PJRA 3RYRA 4RB1A 2QSHX 3H5NA 3BTLA 1U78A 4PSXA 3DBHB 1X58A 2OZUA 1SAXA 5AIQA 2HNHA 1APLC 4EM2A 1ZREA 3BR5A 5J4VA 3W6JB 1S9HA 2KL4A 2PI0A 4RGUA 3OOUA 1KZHA 3R61A 1B4AA 3H3ZA 1R5ID 5F08A 3FXUA 1RC9A 1QZYA 3HBLA 1R00A 1TW3A 5JLXA 4ZYHA 3TW6A 2F6CA 3HOVJ 1I50J 5D4SA 2C6YA 4I7HA 2E1MC 4LLGF 4RMNA 2VI6A 1XSDA 1XPXA 2LKPA 3PL8A 1VQ4I 2NNYA 4AIJA 2Y0SA 3KP2A 1N75A 2LKSA 3ASOH 3Q0WA 4H4KC 3JTGA 3OV8A 4XLEA 2JVGA 1Q1VA 3GXOA 2GM4A 3LSRA 5LGNA 2YSRA 1B8IB 2BZTA 2V26A 3E7LA 4YG2F 3E6MA 3SDGA 1JXSA 1MBKA 1NH3A 4FX0A 5M3FJ 4I98B 1ETQA 5HVQC 2XAGA 2F5EA 4U0WA 4M74A 4D1QA 4A3GJ 2LBFA 4RB3C 1G3YA 2O7OA 3O8GA 3DP7A 4HV5A 2EV6A 4ZH4F 1D8JA 4IQJA 3U2RA 2ZNYA 2R7VA 2K4BA 4C2MJ 2V7FA 3F3XA 2DT5A 4LD5A 5DCMA 4ESBA 4CCMA 2VLAA 1P6RA 5TGTA 3RKWA 4N9HA 5FLVA 2OBPA 4Z6YA 2HQ5A 4PCQA 5EEHA 3K9TA 3LSPA 4E7IA 5FLXZ 1MMNA 2G9WA 3Q0UA 1SD5A 1ZTRA 5A2QK 3QPTA 1N77A 1DP7P 2EFWA 1F1ZA 2L4MA 3PNTA 1FZPB 3IRQA 3MWMA 4CYCA 3BPXA 5DD8A 2HVQA 1M1EB 5DUKA 1DPRA 4JX5A 1JHHA 3ZCOA 1OPCA 3L09A 1PVEA 3JW4A 3EUHC 2CJJA 1PUEE 3CESA 1DUXC 4M9XA 3JSOA 4M71A 5HS7A 1OCTC 2RNGA 1HW5A 2VL8A 3KZZA 1GXQA 4U7BA 3H9QA 4NB5A 3GEZA 4FISA 3KEQA 4MNUA 3V7RA 3Q3SA 2A5YB 1YLFA 4C2TA 1XSXA 3EYIA 4DGWB 1PP7U 1OYWA 4CHUA 1BM9A 4HBLA 2E34A 1WJAA 1A36A 2YUSA 5IOYA 4ENJA 3PM1A 4CCJA 4DBQA 1F36A 2H8RA 2PX9A 1OYYA 3JRDA 2M30A 3BJ6A 1W7PD 3HDDA 4QWQA 5FFXA 2Z99A 3BPVA 4G7HF 2XC7A 3S3NA 1RNLA 2DFFA 4NNJA 3L2CA 3H0DA 2DDAA 4IRIA 3H3UA 2QA4I 3CZ6A 1ZRFA 5B3SH 1OCCH 1P9QC 2YPRA 3EPZA 2KP6A 3MEXA 4L9JA 4OU0A 5KHDA 3J81Z 2R4GA 2EA2A 3CMAI 4HPQA 3FM3A 1HW1A 3VWBA 2KDZA 1UJ8A 3CCUI 2M45A 2R7UA 4RAZA 2HXIA 3OR1C 2HVRA 2H09A 5B1BH 2D5VA 2V1NA 1NG7A 2LKXA 1MJ9A 3T8TA 2KZGA 2JRTA 1HF0A 2UXNA 4V19K 1WZ2A 1T0FC 2KZVA 1XDSA 4A3MJ 3FIWA 1S8NA 1JJ8C 2XIGA 2FBKA 1P2FA 5B1AH 1FMVA 3FX3A 1WSUA 3KZYA 5DS9A 3BOQA 1B9MA 5JHFA 4A3KJ 5AONA 2AS5F 1PP8F 1XCBA 3L1PA 3E6CC 3TOBA 4UB8C 4MQ9F 4F92B 1VQ5I 3G1OA 1FTTA 2LFBA 2XRNA 4DJAA 1NK3P 3F9KA 5ICCA 2ZB9A 1L0OC 3IH2A 4M9SA 3K2AA 3VYSB 4BXUA 4C9YA 3S1RJ 4KN7X 1W36C 1Y8RB 3HUGB 1LDKB 4DYQA 2Z33A 5B66C 3SEZA 3MKWB 3LSGA 3P9IA 4N4OB 5H6RA 5LGUA 4BH9A 1T56A 3BDDA 5J40A 1TNSA 1SFKA 3DXJF 3PO2J 3ZQ7A 1WVRA 3GTMJ 2O8XA 1JE8A 4YRVA 4L5EA 1LEBA 3RDIA 1LJ9A 4LMYA 3SZPA 3MD2A 4A3CJ 1JT0A 1FOYA 3ZMVA 4XMYA 4BJ6C 2VT3A 3F8NA 5JVGF 1GV2A 3LSHA 2HU9A 1HXDA 3BZKA 4NC6A 2E36A 4E7JA 4CCKA 3P5JA 1YJ9I 4G6TB 2W00A 4GDFA 1JGSA 4CUGA 1VQNI 4WXDA 2CYYA 3DF8A 2IS4A 3LA3A 4XKCA 1FSHA 4XM3A 5JFRA 4CYCB 1MGTA 3HGGA 3C2BA 4HG2A 3JSPA 3I4NJ 4YFKF 4NC8A 2LF8A 3QWLA 2HTSA 1BL0A 2R5ZA 1HC8A 2DCEA 2E5NA 3JCUC 4M3BA 1WJFA 1USSA 4A0XA 2NVTJ 2M4GA 3LSKA 2VUMJ 2ZFUA 1Z0XA 2V6CA 4UB6C 2WY7Q 3LQQA 5E17F 1ETYA 3PUFA 3M07A 4DYRA 2GXAA 4WXHA 1W0TA 2A5WA 3KLNA 2E1OA 1Y39A 3HSEA 3CMMA 4G7OF 4RAFA 4M6VA 1AA7A 5KK1A 2VJIA 3QPSA 5CVUA 4B3AA 2LY2A 4IKFA 2L9VA 3H36A 1X1AA 1ZARA 2HYGD 5EZHA 1O57A 1R9TJ 4MGRA 3OYKA 4NDLA 1NK2P 1YITI 1N25A 1QVTA 3I0TA 3SXYA 5IT9Z 4HQMA 2XGXA 2DMQA 2MH2A 1HDDC 4XSZF 2CH0A 4XN0A 1OQYA 1E2XA 2RAEA 3U1DA 1OCZH 2FU4A 1W4MA 4XN3A 1U9OA 3MZHA 2BXYA 5BPIA 1H0MA 4A93J 1U5TB 4O3MA 5DV5A 4G9YA 4ITVA 4PJNA 4BQNA 1JKQC 5F1JA 1XS9A 4KDPA 2D2WA 3C2GA 3KCCA 3CC2I 2CUFA 3R6SA 2VBZA 3BCAA 5J1RA 3RKQA 1PUFB 2AHQA 3ECHA 1MNEA 4KICA 2XROA 4FQGA 2JSCA 1T6SA 5BNGA 2BVLA 2P6SA 2PN6A 1GDTA 1IW7F 2WAFA 1LDDA 3ZQQA 1R1UA 2GXBA 3I3LA 1YX5A 2AQFA 2VBWA 1ZH5A 2QWWA 1SVOA 1XMKA 2ZO4A 3HTSB 1WCMJ 1JT6A 2CV2A 3L9FA 3QODA 4AYBA 2F2EA 3SFZA 1VQOI 3S1MJ 3RTRA 2GA2A 1QU3A 1ZRDA 2KJCA 2PJRA 4KN4X 3WGGA 2EA4A 3KYCB 5CVVA 3KETA 3HOTA 3IL2A 4HF1A 2EV5A 4QPQA 3K4KA 2IGKA 4LGWA 2LF7A 4UV9A 2Y30A 2DMTA 1XGSA 1IJWC 2E19A 1ZG1A 3VYTB 2P8TA 4LG0A 4XRSG 1LQ1A 2UWMA 4G7ZF 3K4JA 4B48A 1MJBA 4CCNA 1YE9A 3HOZJ 3W6VA 1O3TA 1BR4A 3QAHA 5ILSA 1UFMA 4ZYGA 3N4MA 3IV5A 1FYLA 2COBA 1XN7A 1R4NB 3K7AJ 2FD5A 1E17A 3CP8A 4PJJA 1RESA 2DFEA 5F0FA 2H6CA 1JUMA 3KIOA 4IVNA 1LE8A 1R49A 2E71A 3LA2A 2K9MA 5LHIA 2EJRA 3JRIA 2ZNZA 1OMIA 1T08B 2DLLA 1REPC 3F8CA 1MBHA 2CS3A 1S72I 5D5UB 2K86A 1WHUA 3BWGA 5F0CA 2BY3A 4OIPF 3BQYA 1ZHFA 3T1BA 4F93B 1SMYF 1HA8A 4LIUA 2AO9A 2PEXA 1JTYA 4R79A 5J6XA 1HBXG 2P4WA 5HLTA 4KMUX 1WKMA 4OAYA 4BDZA 4IHVA 4YELA 1V5EA 4BY1J 1ENHA 4BHCA 3TKYA 1FLIA 2D1VA 2M1BA 2XHKA 5FJ8J 1B59A 3ROUA 2Y31A 3SQNA 1FOKA 4RBOA 5LFAA 1BC7C 5F0HA 1R1TA 2HS5A 2HYFA 1QZZA 4W1UA 1L3LA 1Z7LA 4N4NB 2VKDA 2DOAA 4E6KG 2TDXA 2ADUA 2R5ZB 2JUCA 4NC7A 2X85A 3DEWA 4RS8A 5LRRA 4LB5A 2VBYA 4OMZA 4L9VA 3OYIA 1BR2A 4F3QA 4Q5SF 2Y2ZA 3TEDA 2L01A 1EV7A 2DQLA 4ZZLA 4XLAA 1WI3A 1FBUA 1V55H 2H94A 3EYYA 2VBXA 3R60A 3OYHA 2P7VB 2O03A 1PYVA 5E8GA 3JRFA 2CU7A 2H1LA 4DBRA 2DU9A 2O6GE 2L4AA 5J4YA 1RI7A 5EYRA 3COAC 5J3LA 2ZMEA 3IH3A 3HEFA 4G8XA 5IT3A 1MZBA 2P0WA 1K4SA 1S7EA 1NG6A 2JZYA 2ZXJA 3ULQB 3AKZA 1E3OC 3IP4B 3SZGA 1B72B 3PNVA 3FMQA 4DYCA 1K61A 1EH6A 3ZOBA 3ZR8X 2A61A 5L3EA 2STTA 1FNNA 5FKOA 3R0AA 1ZGJA 2WBMA 2XF7A 2IP2A 5IP9J 1I27A 2QKLB 2QCOA 3GTJJ 3A0BC 2J5PA 3S32A 3MN2A 2GQQA 2H1KA 2BEOA 1MIJA 2MD0A 2HDWA 1IUYA 1G3WA 4PJLA 1TC3C 3WTTC 3I9V2 1FEXA 1SANA 5TJJA 3A02A 4JX4A 5LRSA 3AL0B 4M3DA 2XF6A 2ZXIA 3EUKL 1ZYRF 4XKWA 4LOCA 5DCMB 3BG5A 2HGCA 2VC0A 2L5QA 2XDVA 3EETA 4YIRX 1T95A 4CYDA 2STWA 4UVCA 5D5XB 2GA1A 3LAJA 4XL9A 3CLOA 2DA6A 3B6AA 1VNDA 1WWXA 2BBYA 3G71I 1G4DA 5CQGA 4IJAA 1LVAA 2DK5A 1ACIA 5C44J 3HPGA 4NQWB 4BEHB 1IF1A 4KMFA 5D6FA 3PIPF 1ETOA 1UG0A 3CDHA 5F04A 1N78A 1IXSB 2VODA 1RZ4A 4ANJA 1BW6A 3JRGA 2RGVA 3R0JA 2BOLA 4UHTA 3WGHA 1D5VA 1IRXA 1TT5B 2K5CA 2MLGA 3FBIB 3FXOA 2ECCA 5GAGJ 3QYEA 2X51A 1LFUP 1RUOA 2DPUA 1IV8A 1UELB 2PMHA 4AIHA 1LUJB 3DKXA 2P5KA 2Q2EA 1U3EM 1IDYA 3PSIA 3P9KA 1R22A 4A12A 4EJVA 3BZCA 2M4KA 2M8GX 2N8GA 3KP6A 4CH7A 2UV1A 2X6OA 1IRFA 3S17J 5ICGA 2RQQA 3I64A 3OYJA 3K1MA 3PQJA 2FMYA 1QNTA 2F4OB 4UUTA 2GOXB 5BS6A 1TWCJ 2JA8J 1D3YA 3VB2A 2FXAA 5FROA 4LJZF 5J8CA 2A6HF 2E7WA 3L00A 4ABZA 4AC0A 2RV8A 4QLCU 1Z9CA 4GFBA 1USTA 3ZRGA 2DTRA 3PSFA 3KEOA 3OSGA 3GLLA 3D5LA 4Y3OA 1IO2A 3OYCA 4HF2A 3S1NJ 1SVLA 4EJTA 1X3ZB 5GAEJ 4NUBA 2ZXWH 4IQ4A 4U7DA 1GXPA 1TWHJ 4NBQA 4EEFG 4WXCA 2DT6A 2IGNA 2VPLA 3A01B 1ETXA 1SFEA 2QQBA 3JAMK 1FSEA 3WTSC 2OD5A 2KT0A 4ZZDA 2NYXA 1S29A 1VQ7I 4PGHA 4HYEA 4M73A 2F5FA 2I8DA 1TWGJ 3C7JA 5J1YA 4BAYA 3D5RC 1RR7A 1DQUA 2DO7A 4M3FA 4IZZA 2ZFWA 3GUDA 3QPLA 4HDUA 3GVAA 5E79C 4BE2A 4CCOA 2DXIA 1S3JA 1S7AA 2Y0MA 1EA3A 1SD7A 3QYBA 1HDPA 3PIOF 1DU6A 1HQCA 4A3DJ 3F22A 4ETSA 1T0FA 2EFNA 1NHAA 4E7LA 1IC8A 4Z2YA 1OR7C 3CCJI 5TRDA 4ZYAA 4FX4A 1BA5A 2L02A 1I6XA 4K2EA 2GIVA 2R7DA 5E8IA 2XGDA 5IY5H 1H8AC 4Y13A 1NTCA 2E1CA 2DYSH 3GO5A 2ELHA 4M72A 3CP2A 3G6EI 4KIBA 5IYBJ 4GXOA 1O3SA 1XDUA 2IGMA 5K7ZA 4IEJA 3CCMI 3M4OJ 2IRFG 2BY2A 3BJAA 2JA7J 3LSJA 2TRTA 1E0EA 3W2WA 3ELKA 3D0SA 2W7NA 3OYBA 2WB1N 4BHPA 2HTJA 1RUNA 2HOAA 3MVPA 3BR0A 1CF7B 2KRCA 2M87A 3RCOA 2A07F 3FMSA 3TL4X 5E1WA 2XSJC 2KIMA 2E2HJ 3GZ6A 2A6EF 4OAZA 1R71A 4II3A 3WU1B 1W7PA 3LSIA 4YIIA 4BE0A 2HDCA 1JI8A 2EIKH 4GGGA 1J59A 3CCSI 4D7MA 2WA0A 3OIQA 3DU6A 1ONVA 4LFUA 3M8FA 3IWZA 5L3CA 1JGGA 1J0RA 3K1NA 5DEQA 5IYCJ 3LAPA 4H0EA 1ZK8A 3ML6A 5CKTA 2CUZA 2VN2A 1MDMB 5DYMA 5D8LB 3ESWB 2KIQA 4FHTA 4U0YA 2NS7A 1R5HA 4RAYA 3HRMA 1QVUA 2Z3YA 5HNHA 5FGMA 3KYLA 2KQRA 3S3OA 1YJWI 2W24A 4P5OA 2W1OA 3DEEA 2IA2A 3SHFA 3TW7A 3IKVA 2JN6A 2HXOA 2XKPA 4AUXA 5E3LA 1MBGA 2KISA 3DWLE 1ZELA 5KAFC 1Y1VJ 4EJUA 2R7FA 1FYMA 2EFQA 3MQ0A 4PGGA 2K27A 4EJWA 2GZWA 2QQ9A 3ISPA 4AD9A 1G2HA 3CDLA 5J1UA 3GLXA 4UUVA 4N0BA 3QOPA 2LOOA 2K3FA 3REOA 3J7ZI 3ZP5A 1XSVA 2MGQA 2LH9A 3H0GJ 2VKVA 4CA0A 1WFXA 1TQMA 2XAUA 1UHSA 3RIRA 4B3XA 2EIMH 1ZR2A 4D7NA 4HLYA 3U9GA 2EINH 2V9PA 3OWTA 4BY7J 1ZRCA 4I01A 3SJMA 3WE2A 1STZA 2NVUB 2ZMEC 3S8PA 4A3BJ 1MW7A 3IHUA 2DYRH 1Z3XA 4R1HA 4OMYA 2LBFB 3PO3J 2JT1A 1BI0A 1GHCA 4ENMA 4JQFA 1KU7A 4B1RA 1YYVA 1P92A 1BOBA 1YW9A 1EKEA 2K9QA 4ZC3A 3RYPA 4WF2A 3BC8A 2DMPA 1K83J 1TWAJ 2VQHA 3RPQA 4XOTA 4BU2A 3IAS2 4Y17A 2ZKZA 1LB2A 1VQMI 5FKNA 5EGOA 1FP1D 2BE5F 4M3EA 2HYJA 2G7UA 2QSFX 3BG6A 1DP3A 4ZDOA 1E3HA 3VPRA 3GW2A 3A2KA 3DPTA 2VJ4A 5DM6F 2JPBA 3V8JA 1CF7A 4FETA 4RLFA 2VOOA 3J7YJ 2GLOA 2WV0A 3ZQLA 2M7BA 3FKIJ 1SD4A 4PJMA 4IO9F 2DQRA 2LSOA 3BT9A 4LB6B 1FBSA 1POGA 4U88A 5CLSA 3DTKA 1ETVA 3V7SA 2NVXJ 2JVHA 1BJAA 4BJTA 2KLOA 4J19A 1WH7A 2ZXHA 2OTLI 3AG1H 2Q0OA 4EM1A 3IKTA 3TMOA 4DIQA 3J7AY 3BR1A 3QOEA 2HR3A 4XIDA 2XRLA 4DZJA 3FISA 1HCRA 3K4BA 2LYCA 4GYIA 3DEUA 3RPUD 2WWYA 2RN7A 3ABKH 2PJPA 2HWVA 2HOSA 4P55A 3K70D 1RKWA 1A6QA 1I6HJ 2ISZA 3GFJA 2JJ7A 2WAQA 3GZNB 4ZDLA 3L2RA 3FBNB 2K85A 1I1GA 3WGIA 2JQ7A 2R92J 1G8XA 4L5JA 3RSNA 5ERIA 2QQAA 4MTEA 5LBQA 3BG7A 3F8FA 1P4WA 2I5UA 1U6GA 2WB1A 1IRGA 1YIOA 1HLVA 2VT2A 2HEOA 3GTKJ 5FKLA 5J8FA 3KP7A 2ID6A 2M8EA 1ETKA 3BP8A 3JAMZ 1A04A 2CSOA 1UCRA 2CFOA 1XGOA 1FT9A 3AG3H 2QBYB 1D1CA 4MEXF 5IPAA 4LLLA 5E18F 2RC4A 3Q9SA 4CGZA 1ITYA 2X48A 1UG2A 4XRFA 2NOGA 2HZDA 4KNYA 1X1DA 5DTDA 3QQAA 1TNTA 4UNOA 3V4GA 2CW8A 4XLCA 3I59B 3QYFA 5K5RA 2EWNA 2KJBA 2UUZA 1HSJA 2R7RA 5LHGA 1T38A 3NARA 3HOUJ 1W1WE 1IZ1A 1OFCX 3OMYA 3VOEA 3TQNA 3FMRA 4RM3A 2HKOA 1V3FA 3S2HJ 2BV6A 2MC3A 4I76A 4XSXF 5GADJ 3SDBA 4GRIA 2QSGX 1FC3A 2FOKA 3FKJA 1Z77A 4LIVA 5D8KB 2E1NA 4I2OA 2X1EA 1FWZA 2IW5A 1O4XA 3QPHA 3BZ6A 3KE2A 1G59A 1SFXA 3JRAA 3K2ZA 3CUQA 2NS0A 2FJ1A 4B4CA 4P1WA 2CUEA 4DW6A 3CDIA 5KCMA 3QU3A 4RGXA 1K78A 3GF2A 4YEJA 2LRDA 5EZGA 2W85A 3A4CA 4WK8F 1MSFC 3M1EA 1QO0D 3BR2A 3R4KA 1W5TA 1P7IA 2HOTA 1FJLA 2FEZA 4CO8A 5F27A 4IHYA 5HLHA 4D5CA 3HGYA 4IRGA 3HOWJ 1ZG3A 3C1DA 2CW0F 5D5VB 4LITA 1HW2A 2Z1DA 5HLGA 2M7AA 3WODF 5EDNA 2QEXI 2V1DA 4B44A 3HRTA 2F48A 3G3ZA 2DA4A 4FT8A 2DMUA 3EDPA 5E3MA 3BCBA 3WE3A 2Z16A 2XAHA 4BBRJ 2A05A 2TCTA 4XR6A 3K70C 3GTOJ 3I5UA 3FDYA 2DFIA 3OSFA 1D0ZA 5HS9A 2K9LA 4F91B 2V6EA 4LK1F 4PFOA 2BHZA 4HX8A 4XICA 4B09A 1QPIA 4BGDA 3F23A 3AL0C 2VXZA 4C3JJ 3MCZA 2EZLA 3ERED 1IDZA 4RAGA 1X4OA 3M8JA 3VSLA 1HKQA 1B72A 4WCGA 4KIGA 2HQNA 4ZDPA 4A6EA 4AIDA 1LFPA 3DTEA 4DZPA 1GVJA 2UXXA 5CJ9A 2IS1A 1KQ8A 2FOWA 2JA6J 1AHDP 1WI9A 3MKLA 3CLQA 4Y33A 3JR9A 3N97A 1ZG5A 3FXRA 2XF5A 1TTYA 1WQ2A 3CJRB 2NVYJ 1IN6A 5L3BA 1YX3A 2MG4A 2OPTA 4BEHA 3RKYA 5ILVA 2DMNA 2JTVA 2DAOA 3FXJA 3WTWC 2X1DA 3B02A 2O8KA 2WC2A 3CCRI 1I1SA 2ETHA 5C4JJ 5ICEA 5HNFA 1K6OA 2ECBA 3NAUA 1BR1A 5LHHA 1ZGAA 1MH3A 2BYVE 4A69C 3OS0A 1I39A 1WJDA 2GOMA 3MZ8A 2F5VA 3H5AA 2PFBA 2K9SA 4C2UA 1MMGA 2FSWA 4Q48A 1F9NA 1SVMA 4XBFA 3WHCA 3ZMSA 4B47A 1MMSA 4RB2C 1GVDA 4IF4A 4ENKA 2QLZA 4PZJA 2CUJA 2L0KA 3TO6A 2FBHA 3RZDJ 1R58A 4MHGA 4ON0A 5LLQA 3I56I 3HOYJ 1QPMA 1XG1A 2R3SA 2FQ3A 2FNAA 4B8XA 3WTXC 4XORA 3DQVC 1MD0A 4AU7A 5FFZA 5A2QZ 2QYOA 3NEUA 3JRHA 3OYAA 1OCPA 1OKRA 1IUFA 1FIPA 3DLLF 3DTIA 2Q1ZB 3DBRB 5C3EJ 3L2UA 3CCVI 2CQ7A 3OIOA 5EEAA 3HPHA 2W4SA 1Y1WJ 1F4KA 1OYIA 2L3DA 5ILUA 2XAJA 4HW0A 3A03A 4UVAA 1MH4A 2M34A 4RA2A 3PJRA 3GYHX 1W7PB 3M7GA 2JRMA 3ABLH 1ODDA 2XV4S 2WADA 2X1CA 1T8IA 2WY8Q 2FE3A 5GAHJ 4RM2A 2ME6A 3WTVC 3H92A 5DCFA 4UUSA 2L7MP 4IHTA 5EG0B 1Z3YA 3JRCA 3RPUA 1AOYA 3U21A 2D45A 2OU2A 2W25A 1OJLA 2ISYA 3MMYB 2Z5UA 3T8RA 1VI0A 4MO7A 3DFGA 3LSTA 1K4TA 3UKGA 5CVRA 4E70A 2IJLA 4HA8A 1JHFA 3VYUB 2R5YA 3RZOJ 2VQCA 4I09A 3SZTA 2CV0A 3HXLA 3HTUA 4DOZA 5D6EA 1X4PA 4HSTA 5DUIA 2L7ZA 2VKEA 5IYDJ 1O7LA 2W84A 1TBXA 2K9NA 3E5XA 3I55I 3ZQIA 3MKZA 2FNPA 2V1UA 1ORKA 3BY6A 2UZKA 2K02A 4BUPA 5EG0A 3K69A 4IHSA 4KT5C 1O3QA 1KONA 2OQRA 2EZIA 2V4JC 5K7HA 2A3SA 1BIAA 3M9AA 5E1ZB 5FD5A 2BW3B 1UZCA 3GX4X 1O3RA 2IGOA 3WU2C 3M3YJ 4KITB 1ZN2A 2ELKA 2YS9A 1QGPA 3WG9A 2LDUA 4M3GA 3K4MA 1QZEA 1WJCA 2DOEA 2GAUA 3Q0VA 2DW4A 4F55A 3L7WA 3V8LA 1WGXA 2LLKA 1SFOJ 1GV5A 5KVRA 3AFHA 2BHYA 1IN5A 1SFUA 3DKWA 3OY9A 2IA0A 2M5WA 9ANTA 3E97A 3A1YA 1IAWA 1FX7A 4JP0A 4OINF 2R7OA 3ZMDA 2O61A 3A01A 3I58A 5IP6A 4R8HA 3BQZA 1F5TA 2YU9J 4A0YA 5M3MJ 4EMSA 3CJQB 2OQGA 2OCEA 2P5LC 1RIOH 3OYNA 3IC7A 1DGRM 2ZSHB 2L9NA 3LFUA 1T33A 1QQIA 1W5CC 1J2XA 4BQOA 2G0EA 3CO6C 3W3CA 5L3GA 3HM5A 1X19A 1VQLI 3FXLA 4AIKA 1MNDA 1YRNB 1Z21A 3GMEA 3LWFA 1O7FA 3IH4A 2IEKA 2MW8A 2DA3A 4GYGA 1YO5C 1R4MB 3CUQC 3BG9A 1K79A 5LEJA 4G12A 1ON1A 3MKYB 3OS1A 1TL8A 1EH8A 3DV8A 1FIAA 2HI3A 4UV8A 5K5OA 3ZN0A 2Y9YA 3L2QA 2X6YA 2VQGA 3G1MA 2Q2EB 5GTHC 2IT0A 4BKXA 3E3VA 5F1RA 2CO5A 2LG4A 2YX7A 1EH7A 4JYKA 1X1PA 2CFXA 4II2A 3S2WA 2ZMEB 5CPRB 5JVTA 4OIOF 3LNQA 2V9VA 1B8IA 1MMDA 1XTAA 4KISA 3O8HA 3IAM2 2ZJPF 4MQVA 2RVCA 3KEYA 1U8RA 1A5JA 3EUAA 3LQRA 3LA7A 1K6YA 1YFHA 2X6XA 1A31A 3LOCA 1Z7UA 1AKHA 4AM3A 2HDDA 1MBEA 2F4IA 2O3FA 4IOCF 5EGOB 2DA2A 2X4HA 3QP5A 3SFIA 4EVIA 2RNJA 1IGNA 2YR2A 3NWSA 2VIXA 2DPDA 4L18B 4S05A 4I0BA 3E5UA 1K7AA 3F8MA 1EJ9A 1R1VA 5CYVA 3T0YA 4LG0B 3FK7A 2E5ZA 1V4RA 3ZMZA 2K3PA 2O0YA 2OTJI 1U9NA 3CJTB 3S93A 2LY1A 1Z91A 4A3LJ 2EZHA 4C3IJ 2LMDA 1BN5A 5M5YJ 4MFDA 3PQKA 2HFHA 3KYDB 1MBJA 4PSWA 4J01A 1D8KA 2B9SA 3T5XA 4CZZA 1PDNC 3ECOA 3ZPLA 1S5LC 4KUMA 2VE9A 2MLKA 2VE8A 1BI3A 1YS7A 2BGCA 2MYSA 2XSDC 4XKBA 5TISC 3FXMA 3CO7C 1Y6IA 1YQAA 3OYGA 1OCOH 4S0HB 1VQ6I 2FF4A 1XC5A 2EILH 1LEAA 1FP2A 1U8BA 4HNUA 3BR6A 4GCVA 3BLYA 5CVJA 5JHUA 4M6XA 4IX7A 3LFKA 1WJEA 2DN0A
chains in the Genus database with same CATH topology
2IAIA 1RESA 1HLVA 4MIMA 5F0FA 4FE7A 3GTKJ 4AYBN 1JUMA 5FKLA 1LE8A 1IG7A 2ID6A 3GTQJ 4XRSA 1JKOC 1ETKA 3JRIA 1F43A 1MBHA 2E2JJ 3S16J 4I6ZA 2R5YB 5IPAA 1ITYA 2X48A 2CQXA 1UG2A 5F0CA 3S15J 2FQ4A 2NOGA 3BQYA 1ETWA 2LD5A 5DTDA 2LTPA 2AO9A 3QQAA 1JTYA 5FLMJ 1I3QJ 3S1QJ 5GPCA 2M9HA 4IHVA 3JREA 4FTHA 1IV6A 4BY1J 1ENHA 3NARA 2FX0A 2JWTA 3GTGJ 3HOUJ 1OFCX 2PMZN 2EH3A 1X2MA 4A3FJ 3DCFA 5FJ8J 1CQTA 2Y31A 2NS8A 4UUSB 3S2HJ 4RBOA 5F0HA 4W1UA 4I76A 3GTPJ 2EBIA 4X6AJ 2R5ZB 5IP7J 4V2FA 2R7ZJ 2IBDA 3DEWA 3D1NI 1Z77A 2O9LA 3I4MJ 2E2IJ 2Y2ZA 1UMQA 3TEDA 1O4XA 3F0CA 1RKTA 3BG3A 3JRAA 1WI3A 1TWFJ 2FJ1A 3JRFA 4B4CA 2CU7A 1EF4A 2CUEA 4DW6A 1GUUA 5EYRA 5EZGA 5J3LA 3BTIA 3IH3A 2L9RA 3HEFA 1MSFC 2EQRA 3BR2A 1S7EA 3TP0A 4A3JJ 1P7IA 2DA5A 1E3OC 1B72B 2HOTA 1FJLA 4IHYA 5F27A 4DYCA 1K61A 3CCYA 4D5CA 3HGYA 3ZOBA 2WV1A 3ZQGA 3HOWJ 2L7FP 5FKOA 1ZKGA 5IP9J 2Y9ZA 3CQZJ 1MNMC 1JKPC 3HKZN 2QCOA 3GTJJ 1HOMA 5FKKA 4IHWA 3MN2A 3TP3A 2H1KA 5EDNA 4A3IJ 1D5YA 3S14J 4BBSJ 1ZR4A 1JUSA 1TC3C 2DA4A 1X2NA 2DMUA 2M2EA 1FEXA 1SANA 5E3MA 4JX4A 3A02A 4BBRJ 2DJNA 2TCTA 2WAQN 3GTOJ 4M3DA 1ZGWA 3OSFA 4LOCA 1AKHB 3BTLA 3BG5A 1U78A 4XICA 1X58A 1BJZA 2NVQJ 1APLC 1QPIA 3BR5A 4C3JJ 3OOUA 2DA6A 3B6AA 1VNDA 5F08A 2EZLA 1IDZA 2XPUA 3HBLA 1B72A 5JLXA 1PUFA 3TW6A 3HOVJ 1I50J 3HOXJ 4DZPA 5C44J 2MSYA 2VI6A 2R93J 2LR8A 2JA6J 1AHDP 3MKLA 3JR9A 3Q0WA 1ETOA 5F04A 4HNVA 2GM4A 1Q1VA 1MBFA 3LSRA 1BW6A 2XGCA 2XPWA 3JRGA 3ZQHA 1B8IB 3E7LA 2NVYJ 2ECCA 2MG4A 2OPTA 3SDGA 1LFUP 1MBKA 2DMNA 5M3FJ 1ETQA 5M5XJ 2O8KA 5K7FA 4C3HJ 3FK6A 4A3GJ 1WH5A 5C4JJ 1IDYA 2ECBA 3NAUA 2O7OA 3O8GA 2LY9A 2N8GA 2M8GX 1MH3A 2X6OA 3S17J 4A69C 4C2MJ 2K9SA 3H3VK 1GT0C 5FLVA 3WHCA 1RPWA 2HQ5A 4UUTA 1GVDA 3LSPA 1YRNA 1TWCJ 3Q0UA 1LE8B 2JA8J 1ZTRA 1H88C 2L0KA 4BXXJ 4GFBA 4ABZA 4AC0A 3RZDJ 1FTZA 3OSGA 4CYCA 3S1NJ 5GP9A 3HOYJ 1P7JA 1XG1A 4JX5A 1TWHJ 2CJJA 4EEFG 3A01B 1ETXA 1IRZA 2CRGA 3ZQFA 2KT0A 3JRHA 1OCTC 1VF9A 1OCPA 1IUFA 1FIPA 5C3EJ 4FISA 2M0CA 3OIOA 1TWGJ 5EEAA 3Q3SA 1Y1WJ 5J1YA 3A03A 1RR7A 1MH4A 2M34A 4M3FA 3QPLA 4MLOA 2DTZA 2YUSA 5IOYA 4V2GA 3PM1A 2GBYA 1F36A 2H8RA 1HDPA 5M5WJ 2ME6A 3JRDA 1DU6A 4A3DJ 4UUSA 2L7MP 3HDDA 2ME0A 5EG0B 1IC8A 2I10A 3JRCA 4FE4A 1BA5A 4QTRA 4MFEA 1H8AC 1OJLA 2XGDA 1NTCA 1VI0A 5JLWA 4MO7A 1AU7A 2KDZA 5IYBJ 1A6IA 5K7ZA 4IEJA 3UKGA 2HXIA 3M4OJ 2XB0X 5C4XJ 2D5VA 2LKXA 2R5YA 3LSJA 1HF0A 2JA7J 2TRTA 3G1LA 3RZOJ 2W48A 4A3MJ 3FIWA 2WB1N 1JJ8C 2K40A 2ID3A 2HOAA 3MVPA 1ZQ3P 2L7ZA 2VKEA 5IYDJ 5DS9A 3BR0A 2R0QC 4A3KJ 2K9NA 3L1PA 2E2HJ 3ZQIA 1ORKA 3G1OA 5EG0A 1FTTA 2LFBA 3BR3A 1NK3P 1BW5A 2XGEA 2ZB9A 3IH2A 4D7MA 2B63J 3K2AA 2EZIA 3S1RJ 5K7HA 1JGGA 1QRYA 5IYCJ 4DYQA 3M3YJ 1ZK8A 4X1EA 4A3EJ 2ELKA 2YS9A 3LSGA 2JK3A 1T56A 4XK4A 4M3GA 3S2DJ 3Q0VA 2NS7A 5GPAA 3PO2J 1QVUA 3GTMJ 4XRMA 2OF7A 1WGXA 2LLKA 4L5EA 1SFOJ 1GV5A 4A3CJ 1JT0A 3TW7A 3GTLJ 9ANTA 2JN6A 1GV2A 1WPKA 3GBGA 2HXOA 1LFBA 4AUXA 5EF6A 1JJ6C 4JP0A 5E3LA 1MBGA 1Y1VJ 3A01A 5IP6A 1H89C 3BQZA 2YU9J 3HB9A 3RQIA 5M3MJ 4CYCB 3HGGA 3C2BA 3I4NJ 1G2HA 3CDLA 5J1UA 1T33A 1JKRC 1BL0A 2MGQA 2R5ZA 2G0EA 4M3BA 3H0GJ 2VKVA 3HM5A 2NVTJ 1JUPA 2VUMJ 1UHSA 1Z0XA 1ZR2A 4FCYA 1YRNB 3IH4A 1ETYA 2IEKA 2MW8A 2DA3A 4D7NA 4DYRA 4BY7J 1W0TA 3BG9A 2E1OA 4G12A 4IHXA 3SJMA 2CQQA 4M6VA 3QPSA 1FIAA 2HI3A 4B3AA 4A3BJ 5EZHA 2Y9YA 1R9TJ 4NDLA 1NK2P 3B6CA 3G1MA 3PO3J 1QVTA 4BKXA 4B1RA 2DMQA 4JYKA 1HDDC 2K9QA 2JMWA 3LNQA 1B8IA 2RAEA 2DMPA 1K83J 5IOZA 1TWAJ 1DU0A 3O8HA 2XPVA 1U9OA 2VPRA 4QSHA 4A93J 4W97A 5E3OA 2LVSA 5FKNA 5EGOA 1A5JA 1JKQC 4M3EA 5F1JA 3JRBA 2HYJA 4JX6A 1XS9A 3CMYA 3LOCA 2JA5J 4Y52J 1AKHA 1VFCA 4Y7NJ 2CUFA 3VPRA 1MBEA 2HDDA 3WHBA 5EGOB 3RKQA 2DA2A 3SFIA 5J1RA 2AHQA 1PUFB 1IGNA 1MSEC 5BNGA 2GLOA 3ZQCA 1GDTA 3ZQLA 4RDUA 3FKIJ 5HODA 2DA1A 2QF7A 3BT9A 3FK7A 1POGA 1ETVA 1U9NA 2LP0A 2NVXJ 1WCMJ 1JT6A 2Y0SN 4J19A 4A3LJ 2EZHA 4C3IJ 1WH7A 2LK2A 4QIWN 3S1MJ 5M5YJ 4MFDA 2XB5A 3BR1A 1MBJA 2EZKA 4XIDA 2XRLA 1RETA 4DZJA 2P81A 3FISA 1HCRA 2Y30A 2DMTA 1IJWC 2E19A 2DA7A 2X9DA 4D5FA 2XSDC 3BTJA 3BTCA 4XRSG 2HOSA 4S0HB 1XC5A 1RKWA 1I6HJ 3HOZJ 3W6VA 2JJ7A 1U8BA 1W0UA 3BR6A 5E3NA 2R92J 3IV5A 1JTXA 5FKMA 2COBA 2DN0A 3K7AJ 2FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAI A;  1RES A;  1HLV A;  4MIM A;  5F0F A;  4FE7 A;  3GTK J;  4AYB N;  1JUM A;  5FKL A;  1LE8 A;  1IG7 A;  2ID6 A;  3GTQ J;  4XRS A;  1JKO C;  1ETK A;  3JRI A;  1F43 A;  1MBH A;  2E2J J;  3S16 J;  4I6Z A;  2R5Y B;  5IPA A;  1ITY A;  2X48 A;  2CQX A;  1UG2 A;  5F0C A;  3S15 J;  2FQ4 A;  2NOG A;  3BQY A;  1ETW A;  2LD5 A;  5DTD A;  2LTP A;  2AO9 A;  3QQA A;  1JTY A;  5FLM J;  1I3Q J;  3S1Q J;  5GPC A;  2M9H A;  4IHV A;  3JRE A;  4FTH A;  1IV6 A;  4BY1 J;  1ENH A;  3NAR A;  2FX0 A;  2JWT A;  3GTG J;  3HOU J;  1OFC X;  2PMZ N;  2EH3 A;  1X2M A;  4A3F J;  3DCF A;  5FJ8 J;  1CQT A;  2Y31 A;  2NS8 A;  4UUS B;  3S2H J;  4RBO A;  5F0H A;  4W1U A;  4I76 A;  3GTP J;  2EBI A;  4X6A J;  2R5Z B;  5IP7 J;  4V2F A;  2R7Z J;  2IBD A;  3DEW A;  3D1N I;  1Z77 A;  2O9L A;  3I4M J;  2E2I J;  2Y2Z A;  1UMQ A;  3TED A;  1O4X A;  3F0C A;  1RKT A;  3BG3 A;  3JRA A;  1WI3 A;  1TWF J;  2FJ1 A;  3JRF A;  4B4C A;  2CU7 A;  1EF4 A;  2CUE A;  4DW6 A;  1GUU A;  5EYR A;  5EZG A;  5J3L A;  3BTI A;  3IH3 A;  2L9R A;  3HEF A;  1MSF C;  2EQR A;  3BR2 A;  1S7E A;  3TP0 A;  4A3J J;  1P7I A;  2DA5 A;  1E3O C;  1B72 B;  2HOT A;  1FJL A;  4IHY A;  5F27 A;  4DYC A;  1K61 A;  3CCY A;  4D5C A;  3HGY A;  3ZOB A;  2WV1 A;  3ZQG A;  3HOW J;  2L7F P;  5FKO A;  1ZKG A;  5IP9 J;  2Y9Z A;  3CQZ J;  1MNM C;  1JKP C;  3HKZ N;  2QCO A;  3GTJ J;  1HOM A;  5FKK A;  4IHW A;  3MN2 A;  3TP3 A;  2H1K A;  5EDN A;  4A3I J;  1D5Y A;  3S14 J;  4BBS J;  1ZR4 A;  1JUS A;  1TC3 C;  2DA4 A;  1X2N A;  2DMU A;  2M2E A;  1FEX A;  1SAN A;  5E3M A;  4JX4 A;  3A02 A;  4BBR J;  2DJN A;  2TCT A;  2WAQ N;  3GTO J;  4M3D A;  1ZGW A;  3OSF A;  4LOC A;  1AKH B;  3BTL A;  3BG5 A;  1U78 A;  4XIC A;  1X58 A;  1BJZ A;  2NVQ J;  1APL C;  1QPI A;  3BR5 A;  4C3J J;  3OOU A;  2DA6 A;  3B6A A;  1VND A;  5F08 A;  2EZL A;  1IDZ A;  2XPU A;  3HBL A;  1B72 A;  5JLX A;  1PUF A;  3TW6 A;  3HOV J;  1I50 J;  3HOX J;  4DZP A;  5C44 J;  2MSY A;  2VI6 A;  2R93 J;  2LR8 A;  2JA6 J;  1AHD P;  3MKL A;  3JR9 A;  3Q0W A;  1ETO A;  5F04 A;  4HNV A;  2GM4 A;  1Q1V A;  1MBF A;  3LSR A;  1BW6 A;  2XGC A;  2XPW A;  3JRG A;  3ZQH A;  1B8I B;  3E7L A;  2NVY J;  2ECC A;  2MG4 A;  2OPT A;  3SDG A;  1LFU P;  1MBK A;  2DMN A;  5M3F J;  1ETQ A;  5M5X J;  2O8K A;  5K7F A;  4C3H J;  3FK6 A;  4A3G J;  1WH5 A;  5C4J J;  1IDY A;  2ECB A;  3NAU A;  2O7O A;  3O8G A;  2LY9 A;  2N8G A;  2M8G X;  1MH3 A;  2X6O A;  3S17 J;  4A69 C;  4C2M J;  2K9S A;  3H3V K;  1GT0 C;  5FLV A;  3WHC A;  1RPW A;  2HQ5 A;  4UUT A;  1GVD A;  3LSP A;  1YRN A;  1TWC J;  3Q0U A;  1LE8 B;  2JA8 J;  1ZTR A;  1H88 C;  2L0K A;  4BXX J;  4GFB A;  4ABZ A;  4AC0 A;  3RZD J;  1FTZ A;  3OSG A;  4CYC A;  3S1N J;  5GP9 A;  3HOY J;  1P7J A;  1XG1 A;  4JX5 A;  1TWH J;  2CJJ A;  4EEF G;  3A01 B;  1ETX A;  1IRZ A;  2CRG A;  3ZQF A;  2KT0 A;  3JRH A;  1OCT C;  1VF9 A;  1OCP A;  1IUF A;  1FIP A;  5C3E J;  4FIS A;  2M0C A;  3OIO A;  1TWG J;  5EEA A;  3Q3S A;  1Y1W J;  5J1Y A;  3A03 A;  1RR7 A;  1MH4 A;  2M34 A;  4M3F A;  3QPL A;  4MLO A;  2DTZ A;  2YUS A;  5IOY A;  4V2G A;  3PM1 A;  2GBY A;  1F36 A;  2H8R A;  1HDP A;  5M5W J;  2ME6 A;  3JRD A;  1DU6 A;  4A3D J;  4UUS A;  2L7M P;  3HDD A;  2ME0 A;  5EG0 B;  1IC8 A;  2I10 A;  3JRC A;  4FE4 A;  1BA5 A;  4QTR A;  4MFE A;  1H8A C;  1OJL A;  2XGD A;  1NTC A;  1VI0 A;  5JLW A;  4MO7 A;  1AU7 A;  2KDZ A;  5IYB J;  1A6I A;  5K7Z A;  4IEJ A;  3UKG A;  2HXI A;  3M4O J;  2XB0 X;  5C4X J;  2D5V A;  2LKX A;  2R5Y A;  3LSJ A;  1HF0 A;  2JA7 J;  2TRT A;  3G1L A;  3RZO J;  2W48 A;  4A3M J;  3FIW A;  2WB1 N;  1JJ8 C;  2K40 A;  2ID3 A;  2HOA A;  3MVP A;  1ZQ3 P;  2L7Z A;  2VKE A;  5IYD J;  5DS9 A;  3BR0 A;  2R0Q C;  4A3K J;  2K9N A;  3L1P A;  2E2H J;  3ZQI A;  1ORK A;  3G1O A;  5EG0 A;  1FTT A;  2LFB A;  3BR3 A;  1NK3 P;  1BW5 A;  2XGE A;  2ZB9 A;  3IH2 A;  4D7M A;  2B63 J;  3K2A A;  2EZI A;  3S1R J;  5K7H A;  1JGG A;  1QRY A;  5IYC J;  4DYQ A;  3M3Y J;  1ZK8 A;  4X1E A;  4A3E J;  2ELK A;  2YS9 A;  3LSG A;  2JK3 A;  1T56 A;  4XK4 A;  4M3G A;  3S2D J;  3Q0V A;  2NS7 A;  5GPA A;  3PO2 J;  1QVU A;  3GTM J;  4XRM A;  2OF7 A;  1WGX A;  2LLK A;  4L5E A;  1SFO J;  1GV5 A;  4A3C J;  1JT0 A;  3TW7 A;  3GTL J;  9ANT A;  2JN6 A;  1GV2 A;  1WPK A;  3GBG A;  2HXO A;  1LFB A;  4AUX A;  5EF6 A;  1JJ6 C;  4JP0 A;  5E3L A;  1MBG A;  1Y1V J;  3A01 A;  5IP6 A;  1H89 C;  3BQZ A;  2YU9 J;  3HB9 A;  3RQI A;  5M3M J;  4CYC B;  3HGG A;  3C2B A;  3I4N J;  1G2H A;  3CDL A;  5J1U A;  1T33 A;  1JKR C;  1BL0 A;  2MGQ A;  2R5Z A;  2G0E A;  4M3B A;  3H0G J;  2VKV A;  3HM5 A;  2NVT J;  1JUP A;  2VUM J;  1UHS A;  1Z0X A;  1ZR2 A;  4FCY A;  1YRN B;  3IH4 A;  1ETY A;  2IEK A;  2MW8 A;  2DA3 A;  4D7N A;  4DYR A;  4BY7 J;  1W0T A;  3BG9 A;  2E1O A;  4G12 A;  4IHX A;  3SJM A;  2CQQ A;  4M6V A;  3QPS A;  1FIA A;  2HI3 A;  4B3A A;  4A3B J;  5EZH A;  2Y9Y A;  1R9T J;  4NDL A;  1NK2 P;  3B6C A;  3G1M A;  3PO3 J;  1QVT A;  4BKX A;  4B1R A;  2DMQ A;  4JYK A;  1HDD C;  2K9Q A;  2JMW A;  3LNQ A;  1B8I A;  2RAE A;  2DMP A;  1K83 J;  5IOZ A;  1TWA J;  1DU0 A;  3O8H A;  2XPV A;  1U9O A;  2VPR A;  4QSH A;  4A93 J;  4W97 A;  5E3O A;  2LVS A;  5FKN A;  5EGO A;  1A5J A;  1JKQ C;  4M3E A;  5F1J A;  3JRB A;  2HYJ A;  4JX6 A;  1XS9 A;  3CMY A;  3LOC A;  2JA5 J;  4Y52 J;  1AKH A;  1VFC A;  4Y7N J;  2CUF A;  3VPR A;  1MBE A;  2HDD A;  3WHB A;  5EGO B;  3RKQ A;  2DA2 A;  3SFI A;  5J1R A;  2AHQ A;  1PUF B;  1IGN A;  1MSE C;  5BNG A;  2GLO A;  3ZQC A;  1GDT A;  3ZQL A;  4RDU A;  3FKI J;  5HOD A;  2DA1 A;  2QF7 A;  3BT9 A;  3FK7 A;  1POG A;  1ETV A;  1U9N A;  2LP0 A;  2NVX J;  1WCM J;  1JT6 A;  2Y0S N;  4J19 A;  4A3L J;  2EZH A;  4C3I J;  1WH7 A;  2LK2 A;  4QIW N;  3S1M J;  5M5Y J;  4MFD A;  2XB5 A;  3BR1 A;  1MBJ A;  2EZK A;  4XID A;  2XRL A;  1RET A;  4DZJ A;  2P81 A;  3FIS A;  1HCR A;  2Y30 A;  2DMT A;  1IJW C;  2E19 A;  2DA7 A;  2X9D A;  4D5F A;  2XSD C;  3BTJ A;  3BTC A;  4XRS G;  2HOS A;  4S0H B;  1XC5 A;  1RKW A;  1I6H J;  3HOZ J;  3W6V A;  2JJ7 A;  1U8B A;  1W0U A;  3BR6 A;  5E3N A;  2R92 J;  3IV5 A;  1JTX A;  5FKM A;  2COB A;  2DN0 A;  3K7A J;  2FD5 A; 
#chains in the Genus database with same CATH topology
 3W6K B;  2IAI A;  2D1H A;  2ESH A;  3O6B B;  3ABM H;  2PBI A;  4MIM A;  3W2A A;  4AYB N;  4LLN A;  1G6N A;  2EPF A;  1YJN I;  2M3A A;  4E7Z A;  3X2Q H;  1OLT A;  1KA8 A;  2A68 F;  2ICW G;  4G6D A;  4LK0 F;  4I6Z A;  1D1A A;  2CQX A;  4OWR B;  2CQN A;  2FQ4 A;  1T2K A;  2R7S A;  1ETW A;  2A69 F;  2LD5 A;  2LTP A;  1OCR H;  2JSP A;  2KRF A;  1UHW A;  4Y15 A;  3M8E A;  5B5E C;  2M9H A;  3KP4 A;  5KAI C;  3DPL C;  3LL7 A;  2LRE A;  1BIB A;  1V54 H;  2H27 A;  3GTG J;  2PMZ N;  3J80 K;  2EH3 A;  2HOE A;  3EQL F;  3K10 A;  3WTY C;  3DCF A;  1CQT A;  2FA5 A;  1XB4 A;  4O5V A;  3L2V A;  1XD7 A;  4RB0 A;  2VQL A;  4E4H A;  1LVK A;  2ZSI B;  3GTP J;  4HV6 A;  2EBI A;  3UR3 C;  4BQQ A;  4PJ0 C;  3I54 A;  2F4M B;  4V2F A;  4BS9 A;  2KKO A;  3RJP A;  2IBD A;  4NQW A;  3D1N I;  2O9L A;  3I4M J;  2VB6 A;  2E2I J;  2L54 A;  2OJE D;  3G2B A;  2OC6 A;  5H20 A;  1ON2 A;  3SYT A;  2W57 A;  3F0C A;  2Y48 A;  3E6D A;  2MA3 A;  2FML A;  3MFK A;  1W5S A;  1VTN C;  2EFO A;  3C2H A;  4HQE A;  3OYE A;  2L7K A;  1YI2 I;  5FRN A;  5LGT A;  5ICF A;  2L2O A;  2OCC H;  3VSK A;  4DQ2 A;  3BJO A;  2GWR A;  3K6G A;  3FM5 A;  4XLH A;  2HPM A;  2HQA A;  1YOV B;  4BXF A;  4HDV A;  3QRF F;  5HLI A;  2V79 A;  4HX4 A;  1H9T A;  1KU2 A;  3HG9 A;  1ULY A;  2R7X A;  2DA5 A;  4ASN A;  4B43 A;  2IS6 A;  4L9N A;  2OZ6 A;  3HIF A;  3OL4 A;  1KGS A;  4AVZ A;  2BY1 A;  2JPC A;  2WV1 A;  3V7C A;  3ZQG A;  2PJR B;  2L7F P;  2RQP A;  5FO5 A;  3TOA A;  3HUG A;  3CC7 I;  2Y9Z A;  3CQZ J;  1ERD A;  1MNM C;  1WRJ A;  1J5Y A;  3HKZ N;  3PFI A;  3JTH A;  3G73 A;  1HOM A;  5FKK A;  2HKX A;  4BHB A;  4A3I J;  2IPQ X;  3S14 J;  2FUG 2;  4BBS J;  4CZC A;  4RGS A;  2XAF A;  1JUS A;  2DBB A;  3CF2 A;  3HRS A;  3VDX A;  4HNT A;  1VQ8 I;  2CV1 A;  1WJ5 A;  1X2N A;  2M2E A;  2QQ8 A;  4UVB A;  3KP3 A;  4U0V A;  5E20 A;  1HKT A;  1LNW A;  3K4L A;  3F21 A;  4PUS A;  2YX4 A;  1ZGW A;  4P9F A;  1IXR C;  3HSF A;  1AKH B;  5FB2 A;  3H5R A;  1D1B A;  1CGP A;  2F5D A;  4TV7 A;  3NWT A;  3K0L A;  3FZV A;  1BJZ A;  4XOP A;  3HC7 A;  2NVQ J;  1BOA A;  2NOJ B;  4EQQ A;  4U87 A;  2KMU A;  3KPH A;  2BW3 A;  2NXN B;  2HPI A;  2CWE A;  2XPU A;  3F6V A;  1D0Y A;  2KPM A;  4D0P A;  4XLP F;  2CMP A;  1PUF A;  1LDJ A;  1SD6 A;  3HOX J;  4A5N A;  3CD6 I;  2DDB A;  2DI3 A;  2QGU A;  4HZF A;  2MSY A;  2ZJR F;  3DKY A;  1VQP I;  2R93 J;  2LR8 A;  1QHG A;  4HNV A;  1IXC A;  2LNB A;  1MBF A;  1KU3 A;  5CVI A;  3LMM A;  3CUQ B;  2XGC A;  2XPW A;  3ZQH A;  4YFX F;  3PFY A;  2DJI A;  2R7T A;  4BNC A;  2M0M A;  2PG4 A;  2VAS A;  3VEP A;  1T39 A;  3SEQ A;  4XKV A;  5HDK A;  3K4N A;  5M5X J;  4P96 A;  2O5R A;  2CG4 A;  5DDG A;  1MKM A;  4C3H J;  5K7F A;  3FK6 A;  2ACJ A;  3EUH A;  1WH5 A;  2DT7 B;  3J80 Z;  3U1K A;  3FF5 A;  4ESF A;  2LY9 A;  5DM7 F;  4BDY A;  3WTU C;  1Y56 A;  1UAA A;  3FWE A;  3PNY A;  1ZAO A;  2FRH A;  1S7O A;  4AWX B;  1TQI A;  4UXN A;  1XX5 A;  3H3V K;  1GT0 C;  1DPU A;  1I3A A;  2KDO A;  1XMX A;  1OIS A;  3H35 A;  1RPW A;  3CF5 F;  1BC8 C;  1C0W A;  4ENN A;  3OR2 C;  3J7A O;  1YRN A;  2ELJ A;  4G6Q A;  3NQO A;  1LE8 B;  1V5F A;  1H88 C;  2HZT A;  2X0L A;  4BXX J;  4XLF A;  4A5M A;  1FTZ A;  2IVM A;  2E7X A;  6PAX A;  3HOS A;  4LG3 A;  5GP9 A;  3WTZ A;  3TBI A;  3DU5 A;  1YG2 A;  1P7J A;  4L9T A;  1QHH D;  2QBY A;  2P7C B;  2QUF A;  2BVM A;  2A6T A;  2QZ8 A;  2Y69 H;  4RGR A;  4KFC A;  1IRZ A;  1YIJ I;  4IXA A;  2CRG A;  3ZQF A;  3E0J B;  5IT9 K;  1VF9 A;  5L3D A;  3IWF A;  3CCL I;  4A2U A;  5F64 A;  4KIF A;  2B0L A;  1R7J A;  2M0C A;  3J81 K;  4YFN F;  1Y0N A;  4P9U A;  2MD5 A;  3TO9 A;  2EB7 A;  1HKS A;  4C30 A;  3ZN1 A;  5E1X A;  3ABU A;  1J75 A;  1X1C A;  3AG2 H;  3KZI C;  4MLO A;  3K4C A;  4KYW A;  4Q4Z F;  2AXL A;  2DTZ A;  4V2G A;  2GBY A;  3HHG A;  4N9I A;  1YS6 A;  3I53 A;  3VYR B;  3NRV A;  5M5W J;  1YW7 A;  3WU0 A;  3CCE I;  2PMU A;  1QA6 A;  4ZTF A;  2ME0 A;  2GIZ A;  3MZY A;  2EV0 A;  2I10 A;  1GLN A;  2AXT C;  5LEK A;  3E5Q A;  4FE4 A;  2COM A;  4QTR A;  3TDU C;  4MFE A;  2JUG A;  2OAZ A;  3K1P A;  3OS2 A;  1J9I A;  1XGM A;  3H1C A;  4HF0 A;  5JLW A;  1AU7 A;  2XAQ A;  3DBL B;  2EIJ H;  2WTE A;  4I99 C;  1A6I A;  1XGN A;  4IRH A;  4HEA 2;  2XB0 X;  5C4X J;  4XQF A;  2KRH A;  3HYI A;  3G1L A;  1BBY A;  3D5S C;  1UHM A;  1Q1H A;  1U5T A;  3GFM A;  3WG7 H;  2W48 A;  4L5I A;  4D9J A;  2OUM A;  5HOO A;  5LD2 C;  2BY0 A;  4E7K A;  4HAM A;  2K40 A;  2ID3 A;  2CQK A;  4JBA A;  1J7K A;  1ZQ3 P;  2R0Q C;  1Z05 A;  3FHZ A;  3Q9V A;  4KT6 A;  4CIC A;  5JI6 A;  1FBQ A;  2DOF A;  4ESJ A;  3BR3 A;  1BW5 A;  2E60 A;  3UNG C;  2XGE A;  2B63 J;  1LKX A;  5L3F A;  3GZ5 A;  1G3S A;  4HX7 A;  2B7E A;  1DDN A;  1QRY A;  3V42 A;  5BQT A;  4X1E A;  4X0G A;  4A3E J;  2CGP A;  2JK3 A;  4XK4 A;  4ZYD A;  1RR8 C;  3S2D J;  5GPA A;  2H8W A;  3C3W A;  2MFZ A;  5KNL A;  1TZL A;  4XRM A;  2VKH A;  2OF7 A;  2KFD A;  2J5O A;  4O6J A;  3W2V A;  4WWC A;  3N05 A;  1TT0 A;  4JOM A;  3I4P A;  3ONQ A;  5D5W B;  5H6Q A;  3GTL J;  1G3T A;  4JK1 X;  1WPK A;  2ZC2 A;  3GBG A;  5EF6 A;  1LFB A;  2NNN A;  3G4S I;  1JJ6 C;  3C18 A;  4RLQ A;  1AWC A;  2JA2 A;  1SAU A;  1OR7 A;  4EGY A;  1H89 C;  3HKZ A;  4IPA A;  3HB9 A;  3RQI A;  1Z67 A;  5K5Q A;  5ED4 A;  4HLX A;  1P4A A;  2MH9 A;  3IRR A;  2Y75 A;  3RKX A;  3HL2 A;  4M9Z A;  1JKR C;  4XLN F;  3CJN A;  3CTA A;  4CDG A;  1JUP A;  4F7Z A;  4FCY A;  1Z6R A;  1FOX A;  3OYL A;  4QPO A;  4IHX A;  4HRI A;  4E7H A;  3B73 A;  3IUO A;  2CQQ A;  4PDK A;  1IN8 A;  3ZMU A;  4EV0 A;  4L0Z B;  3KX2 A;  4S04 A;  3B6C A;  4OOI A;  2KIU A;  4BJ5 C;  3HRU A;  1ZLK A;  2E35 A;  5EJC A;  3QP6 A;  3F6O A;  2JMW A;  4BE1 A;  3CUO A;  1ZLJ A;  2MBF A;  1K78 B;  5IOZ A;  2IS2 A;  3TO7 A;  1DU0 A;  4OIQ F;  3P9C A;  2XPV A;  2MC4 A;  3A0H C;  2VPR A;  2H6B A;  3OL3 A;  1HST A;  4QSH A;  4W97 A;  1E3P A;  2ZJQ F;  5E3O A;  2LVS A;  4XNF A;  1TLH B;  3ABT A;  3F8B A;  1RRJ A;  1KYZ A;  3JRB A;  4JX6 A;  2W82 A;  3CMY A;  2JA5 J;  4Y52 J;  5D4R A;  2XUB A;  5K1Y A;  4ZJZ A;  1VFC A;  4Y7N J;  1X3U A;  5EEG A;  3HSR A;  3WHB A;  4L0Y B;  5GTI C;  3I59 A;  1A35 A;  1I5Z A;  3P7N A;  1DGW Y;  2Z9O A;  1MSE C;  2XVC A;  3KLO A;  4IL6 C;  4I0A A;  3ZQC A;  1J09 A;  4XON A;  3TGN A;  4RDU A;  2G7H A;  2GXG A;  5HOD A;  3ZGK A;  4AVP A;  4CXF A;  2KHM A;  1FOW A;  2DA1 A;  3DPU A;  2QF7 A;  4G94 A;  1R23 A;  3E1S A;  2XAS A;  4EGZ A;  3E6B A;  2LP0 A;  2X6W A;  2OA4 A;  2CW7 A;  1XCV A;  5HDN A;  1TP4 A;  2Y0S N;  3VFZ A;  2LK2 A;  4QIW N;  5FRM A;  5JR3 A;  2XB5 A;  1U0J A;  1SC7 A;  4EJO A;  2EZK A;  1X1B A;  1LPQ A;  3KP5 A;  3CC4 I;  1RET A;  4EM0 B;  4NHJ A;  4BYY A;  2P81 A;  4KJZ A;  1FMW A;  2DA7 A;  2X9D A;  4D5F A;  1BI2 A;  3BTJ A;  2PMZ A;  3ASN H;  3BTC A;  5BMZ A;  5BPD A;  3DLA A;  3GFL A;  4PK4 A;  3QU6 A;  2ZBK A;  4Q47 A;  4GO1 A;  1MJA A;  4M6Y A;  4OIR F;  1SEU A;  5H2F C;  4E7S A;  2QEN A;  4IOA F;  1R36 A;  2E1M B;  2BXZ A;  1W0U A;  5E3N A;  3ZMT A;  1YHQ I;  1YTY A;  2VOP A;  1Y8Q B;  1JTX A;  2RRE A;  5FKM A;  4A6D A;  3GTQ J;  1FPQ A;  1TQP A;  4BQA A;  2R7Q A;  1Z1D A;  3I71 A;  4FE7 A;  2NAZ A;  1MDM A;  4HSR A;  2P6T A;  3FXQ A;  4FAS D;  2NRA C;  2XKO A;  4PFP A;  2DOD A;  1IG7 A;  4F52 A;  4XRS A;  2AQE A;  1JKO C;  3BRO A;  3TDZ C;  1WJB A;  4BAC A;  1F43 A;  2E2J J;  3S16 J;  1U2W A;  2DK8 A;  3OOP A;  2L9S A;  2R5Y B;  3H9J A;  1FY7 A;  3HZJ A;  3S15 J;  3OYD A;  2KIF A;  2VJ5 A;  2MAB A;  5FLM J;  2F5C A;  5BOX A;  3FXK A;  2HQR A;  3HJE A;  1VQK I;  1I3Q J;  3OIP A;  3O2P E;  3S1Q J;  5GPC A;  3MAJ A;  5J47 A;  3OYM A;  3JRE A;  4FTH A;  1IV6 A;  4DNC A;  5HS8 A;  1X3W B;  2FX0 A;  2JWT A;  4A0Z A;  1P4X A;  3ERM A;  4A3F J;  1X2M A;  1VQ9 I;  3F72 A;  1MMA A;  1V5G A;  2NS8 A;  5DD4 A;  4UUS B;  2WAE A;  3PUB A;  4EAT A;  1QBJ A;  4YIF A;  3GCM A;  4BL0 B;  1R6R A;  3AAF A;  2QVO A;  4X6A J;  1IN4 A;  2P5V A;  2VJJ A;  5IP7 J;  5F6F A;  4MEY F;  2R7Z J;  3FHN A;  3GWZ A;  3ZXS A;  4HOB A;  2DFH A;  2EK5 A;  1XMA A;  1UMQ A;  3LSM A;  3OYF A;  3V8K A;  1S6L A;  2V9K A;  1RKT A;  5AIP A;  3BG3 A;  3M1C A;  1TWF J;  2VXD A;  1SMT A;  1B6A A;  2ESN A;  1BI1 A;  1B1B A;  2QKM B;  4WX9 A;  3RI4 A;  2RKH A;  2K7L A;  2HVS A;  1EF4 A;  3AG4 H;  5HDG A;  1GUU A;  2ZJ2 A;  2PQ8 A;  5FD6 A;  4J00 A;  2FBI A;  1T98 A;  2IA1 A;  2OV7 A;  1VZ0 A;  2VC1 A;  3BTI A;  2L9R A;  1FYK A;  1Y0U A;  2EQR A;  2YU3 A;  2ZCW A;  3TP0 A;  2R7W A;  4A3J J;  1UB9 A;  3O3K A;  4KA4 A;  2Z2S B;  3CCY A;  4ZTJ A;  1IN7 A;  4Y4R A;  1W36 D;  3HHH A;  4CCL A;  2VON A;  1KQ0 A;  1B9N A;  2LC2 A;  3Q5F A;  1U5T C;  3CCQ I;  1ZKG A;  2V1X A;  2Q8K A;  1JKP C;  1H9G A;  2EFP A;  1KYW A;  3H9G A;  4IHW A;  1TW2 A;  1Z6T A;  4I02 A;  3TP3 A;  2RDP A;  1KQ9 A;  3S3M A;  5FLX K;  2IXS A;  2QM3 A;  2PLY A;  1D5Y A;  1KU9 A;  1D0X A;  3GFI A;  5CQE A;  1ZR4 A;  1YW8 A;  4UY8 I;  3L2W A;  3CME I;  4ZYE A;  3KFW X;  2K4J A;  3RQ4 A;  2DJN A;  2WAQ N;  4MTD A;  4CSW A;  3VOD A;  1R5G A;  1PJR A;  3RYR A;  4RB1 A;  2QSH X;  3H5N A;  3BTL A;  1U78 A;  4PSX A;  3DBH B;  1X58 A;  2OZU A;  1SAX A;  5AIQ A;  2HNH A;  1APL C;  4EM2 A;  1ZRE A;  3BR5 A;  5J4V A;  3W6J B;  1S9H A;  2KL4 A;  2PI0 A;  4RGU A;  3OOU A;  1KZH A;  3R61 A;  1B4A A;  3H3Z A;  1R5I D;  5F08 A;  3FXU A;  1RC9 A;  1QZY A;  3HBL A;  1R00 A;  1TW3 A;  5JLX A;  4ZYH A;  3TW6 A;  2F6C A;  3HOV J;  1I50 J;  5D4S A;  2C6Y A;  4I7H A;  2E1M C;  4LLG F;  4RMN A;  2VI6 A;  1XSD A;  1XPX A;  2LKP A;  3PL8 A;  1VQ4 I;  2NNY A;  4AIJ A;  2Y0S A;  3KP2 A;  1N75 A;  2LKS A;  3ASO H;  3Q0W A;  4H4K C;  3JTG A;  3OV8 A;  4XLE A;  2JVG A;  1Q1V A;  3GXO A;  2GM4 A;  3LSR A;  5LGN A;  2YSR A;  1B8I B;  2BZT A;  2V26 A;  3E7L A;  4YG2 F;  3E6M A;  3SDG A;  1JXS A;  1MBK A;  1NH3 A;  4FX0 A;  5M3F J;  4I98 B;  1ETQ A;  5HVQ C;  2XAG A;  2F5E A;  4U0W A;  4M74 A;  4D1Q A;  4A3G J;  2LBF A;  4RB3 C;  1G3Y A;  2O7O A;  3O8G A;  3DP7 A;  4HV5 A;  2EV6 A;  4ZH4 F;  1D8J A;  4IQJ A;  3U2R A;  2ZNY A;  2R7V A;  2K4B A;  4C2M J;  2V7F A;  3F3X A;  2DT5 A;  4LD5 A;  5DCM A;  4ESB A;  4CCM A;  2VLA A;  1P6R A;  5TGT A;  3RKW A;  4N9H A;  5FLV A;  2OBP A;  4Z6Y A;  2HQ5 A;  4PCQ A;  5EEH A;  3K9T A;  3LSP A;  4E7I A;  5FLX Z;  1MMN A;  2G9W A;  3Q0U A;  1SD5 A;  1ZTR A;  5A2Q K;  3QPT A;  1N77 A;  1DP7 P;  2EFW A;  1F1Z A;  2L4M A;  3PNT A;  1FZP B;  3IRQ A;  3MWM A;  4CYC A;  3BPX A;  5DD8 A;  2HVQ A;  1M1E B;  5DUK A;  1DPR A;  4JX5 A;  1JHH A;  3ZCO A;  1OPC A;  3L09 A;  1PVE A;  3JW4 A;  3EUH C;  2CJJ A;  1PUE E;  3CES A;  1DUX C;  4M9X A;  3JSO A;  4M71 A;  5HS7 A;  1OCT C;  2RNG A;  1HW5 A;  2VL8 A;  3KZZ A;  1GXQ A;  4U7B A;  3H9Q A;  4NB5 A;  3GEZ A;  4FIS A;  3KEQ A;  4MNU A;  3V7R A;  3Q3S A;  2A5Y B;  1YLF A;  4C2T A;  1XSX A;  3EYI A;  4DGW B;  1PP7 U;  1OYW A;  4CHU A;  1BM9 A;  4HBL A;  2E34 A;  1WJA A;  1A36 A;  2YUS A;  5IOY A;  4ENJ A;  3PM1 A;  4CCJ A;  4DBQ A;  1F36 A;  2H8R A;  2PX9 A;  1OYY A;  3JRD A;  2M30 A;  3BJ6 A;  1W7P D;  3HDD A;  4QWQ A;  5FFX A;  2Z99 A;  3BPV A;  4G7H F;  2XC7 A;  3S3N A;  1RNL A;  2DFF A;  4NNJ A;  3L2C A;  3H0D A;  2DDA A;  4IRI A;  3H3U A;  2QA4 I;  3CZ6 A;  1ZRF A;  5B3S H;  1OCC H;  1P9Q C;  2YPR A;  3EPZ A;  2KP6 A;  3MEX A;  4L9J A;  4OU0 A;  5KHD A;  3J81 Z;  2R4G A;  2EA2 A;  3CMA I;  4HPQ A;  3FM3 A;  1HW1 A;  3VWB A;  2KDZ A;  1UJ8 A;  3CCU I;  2M45 A;  2R7U A;  4RAZ A;  2HXI A;  3OR1 C;  2HVR A;  2H09 A;  5B1B H;  2D5V A;  2V1N A;  1NG7 A;  2LKX A;  1MJ9 A;  3T8T A;  2KZG A;  2JRT A;  1HF0 A;  2UXN A;  4V19 K;  1WZ2 A;  1T0F C;  2KZV A;  1XDS A;  4A3M J;  3FIW A;  1S8N A;  1JJ8 C;  2XIG A;  2FBK A;  1P2F A;  5B1A H;  1FMV A;  3FX3 A;  1WSU A;  3KZY A;  5DS9 A;  3BOQ A;  1B9M A;  5JHF A;  4A3K J;  5AON A;  2AS5 F;  1PP8 F;  1XCB A;  3L1P A;  3E6C C;  3TOB A;  4UB8 C;  4MQ9 F;  4F92 B;  1VQ5 I;  3G1O A;  1FTT A;  2LFB A;  2XRN A;  4DJA A;  1NK3 P;  3F9K A;  5ICC A;  2ZB9 A;  1L0O C;  3IH2 A;  4M9S A;  3K2A A;  3VYS B;  4BXU A;  4C9Y A;  3S1R J;  4KN7 X;  1W36 C;  1Y8R B;  3HUG B;  1LDK B;  4DYQ A;  2Z33 A;  5B66 C;  3SEZ A;  3MKW B;  3LSG A;  3P9I A;  4N4O B;  5H6R A;  5LGU A;  4BH9 A;  1T56 A;  3BDD A;  5J40 A;  1TNS A;  1SFK A;  3DXJ F;  3PO2 J;  3ZQ7 A;  1WVR A;  3GTM J;  2O8X A;  1JE8 A;  4YRV A;  4L5E A;  1LEB A;  3RDI A;  1LJ9 A;  4LMY A;  3SZP A;  3MD2 A;  4A3C J;  1JT0 A;  1FOY A;  3ZMV A;  4XMY A;  4BJ6 C;  2VT3 A;  3F8N A;  5JVG F;  1GV2 A;  3LSH A;  2HU9 A;  1HXD A;  3BZK A;  4NC6 A;  2E36 A;  4E7J A;  4CCK A;  3P5J A;  1YJ9 I;  4G6T B;  2W00 A;  4GDF A;  1JGS A;  4CUG A;  1VQN I;  4WXD A;  2CYY A;  3DF8 A;  2IS4 A;  3LA3 A;  4XKC A;  1FSH A;  4XM3 A;  5JFR A;  4CYC B;  1MGT A;  3HGG A;  3C2B A;  4HG2 A;  3JSP A;  3I4N J;  4YFK F;  4NC8 A;  2LF8 A;  3QWL A;  2HTS A;  1BL0 A;  2R5Z A;  1HC8 A;  2DCE A;  2E5N A;  3JCU C;  4M3B A;  1WJF A;  1USS A;  4A0X A;  2NVT J;  2M4G A;  3LSK A;  2VUM J;  2ZFU A;  1Z0X A;  2V6C A;  4UB6 C;  2WY7 Q;  3LQQ A;  5E17 F;  1ETY A;  3PUF A;  3M07 A;  4DYR A;  2GXA A;  4WXH A;  1W0T A;  2A5W A;  3KLN A;  2E1O A;  1Y39 A;  3HSE A;  3CMM A;  4G7O F;  4RAF A;  4M6V A;  1AA7 A;  5KK1 A;  2VJI A;  3QPS A;  5CVU A;  4B3A A;  2LY2 A;  4IKF A;  2L9V A;  3H36 A;  1X1A A;  1ZAR A;  2HYG D;  5EZH A;  1O57 A;  1R9T J;  4MGR A;  3OYK A;  4NDL A;  1NK2 P;  1YIT I;  1N25 A;  1QVT A;  3I0T A;  3SXY A;  5IT9 Z;  4HQM A;  2XGX A;  2DMQ A;  2MH2 A;  1HDD C;  4XSZ F;  2CH0 A;  4XN0 A;  1OQY A;  1E2X A;  2RAE A;  3U1D A;  1OCZ H;  2FU4 A;  1W4M A;  4XN3 A;  1U9O A;  3MZH A;  2BXY A;  5BPI A;  1H0M A;  4A93 J;  1U5T B;  4O3M A;  5DV5 A;  4G9Y A;  4ITV A;  4PJN A;  4BQN A;  1JKQ C;  5F1J A;  1XS9 A;  4KDP A;  2D2W A;  3C2G A;  3KCC A;  3CC2 I;  2CUF A;  3R6S A;  2VBZ A;  3BCA A;  5J1R A;  3RKQ A;  1PUF B;  2AHQ A;  3ECH A;  1MNE A;  4KIC A;  2XRO A;  4FQG A;  2JSC A;  1T6S A;  5BNG A;  2BVL A;  2P6S A;  2PN6 A;  1GDT A;  1IW7 F;  2WAF A;  1LDD A;  3ZQQ A;  1R1U A;  2GXB A;  3I3L A;  1YX5 A;  2AQF A;  2VBW A;  1ZH5 A;  2QWW A;  1SVO A;  1XMK A;  2ZO4 A;  3HTS B;  1WCM J;  1JT6 A;  2CV2 A;  3L9F A;  3QOD A;  4AYB A;  2F2E A;  3SFZ A;  1VQO I;  3S1M J;  3RTR A;  2GA2 A;  1QU3 A;  1ZRD A;  2KJC A;  2PJR A;  4KN4 X;  3WGG A;  2EA4 A;  3KYC B;  5CVV A;  3KET A;  3HOT A;  3IL2 A;  4HF1 A;  2EV5 A;  4QPQ A;  3K4K A;  2IGK A;  4LGW A;  2LF7 A;  4UV9 A;  2Y30 A;  2DMT A;  1XGS A;  1IJW C;  2E19 A;  1ZG1 A;  3VYT B;  2P8T A;  4LG0 A;  4XRS G;  1LQ1 A;  2UWM A;  4G7Z F;  3K4J A;  4B48 A;  1MJB A;  4CCN A;  1YE9 A;  3HOZ J;  3W6V A;  1O3T A;  1BR4 A;  3QAH A;  5ILS A;  1UFM A;  4ZYG A;  3N4M A;  3IV5 A;  1FYL A;  2COB A;  1XN7 A;  1R4N B;  3K7A J;  2FD5 A;  1E17 A;  3CP8 A;  4PJJ A;  1RES A;  2DFE A;  5F0F A;  2H6C A;  1JUM A;  3KIO A;  4IVN A;  1LE8 A;  1R49 A;  2E71 A;  3LA2 A;  2K9M A;  5LHI A;  2EJR A;  3JRI A;  2ZNZ A;  1OMI A;  1T08 B;  2DLL A;  1REP C;  3F8C A;  1MBH A;  2CS3 A;  1S72 I;  5D5U B;  2K86 A;  1WHU A;  3BWG A;  5F0C A;  2BY3 A;  4OIP F;  3BQY A;  1ZHF A;  3T1B A;  4F93 B;  1SMY F;  1HA8 A;  4LIU A;  2AO9 A;  2PEX A;  1JTY A;  4R79 A;  5J6X A;  1HBX G;  2P4W A;  5HLT A;  4KMU X;  1WKM A;  4OAY A;  4BDZ A;  4IHV A;  4YEL A;  1V5E A;  4BY1 J;  1ENH A;  4BHC A;  3TKY A;  1FLI A;  2D1V A;  2M1B A;  2XHK A;  5FJ8 J;  1B59 A;  3ROU A;  2Y31 A;  3SQN A;  1FOK A;  4RBO A;  5LFA A;  1BC7 C;  5F0H A;  1R1T A;  2HS5 A;  2HYF A;  1QZZ A;  4W1U A;  1L3L A;  1Z7L A;  4N4N B;  2VKD A;  2DOA A;  4E6K G;  2TDX A;  2ADU A;  2R5Z B;  2JUC A;  4NC7 A;  2X85 A;  3DEW A;  4RS8 A;  5LRR A;  4LB5 A;  2VBY A;  4OMZ A;  4L9V A;  3OYI A;  1BR2 A;  4F3Q A;  4Q5S F;  2Y2Z A;  3TED A;  2L01 A;  1EV7 A;  2DQL A;  4ZZL A;  4XLA A;  1WI3 A;  1FBU A;  1V55 H;  2H94 A;  3EYY A;  2VBX A;  3R60 A;  3OYH A;  2P7V B;  2O03 A;  1PYV A;  5E8G A;  3JRF A;  2CU7 A;  2H1L A;  4DBR A;  2DU9 A;  2O6G E;  2L4A A;  5J4Y A;  1RI7 A;  5EYR A;  3COA C;  5J3L A;  2ZME A;  3IH3 A;  3HEF A;  4G8X A;  5IT3 A;  1MZB A;  2P0W A;  1K4S A;  1S7E A;  1NG6 A;  2JZY A;  2ZXJ A;  3ULQ B;  3AKZ A;  1E3O C;  3IP4 B;  3SZG A;  1B72 B;  3PNV A;  3FMQ A;  4DYC A;  1K61 A;  1EH6 A;  3ZOB A;  3ZR8 X;  2A61 A;  5L3E A;  2STT A;  1FNN A;  5FKO A;  3R0A A;  1ZGJ A;  2WBM A;  2XF7 A;  2IP2 A;  5IP9 J;  1I27 A;  2QKL B;  2QCO A;  3GTJ J;  3A0B C;  2J5P A;  3S32 A;  3MN2 A;  2GQQ A;  2H1K A;  2BEO A;  1MIJ A;  2MD0 A;  2HDW A;  1IUY A;  1G3W A;  4PJL A;  1TC3 C;  3WTT C;  3I9V 2;  1FEX A;  1SAN A;  5TJJ A;  3A02 A;  4JX4 A;  5LRS A;  3AL0 B;  4M3D A;  2XF6 A;  2ZXI A;  3EUK L;  1ZYR F;  4XKW A;  4LOC A;  5DCM B;  3BG5 A;  2HGC A;  2VC0 A;  2L5Q A;  2XDV A;  3EET A;  4YIR X;  1T95 A;  4CYD A;  2STW A;  4UVC A;  5D5X B;  2GA1 A;  3LAJ A;  4XL9 A;  3CLO A;  2DA6 A;  3B6A A;  1VND A;  1WWX A;  2BBY A;  3G71 I;  1G4D A;  5CQG A;  4IJA A;  1LVA A;  2DK5 A;  1ACI A;  5C44 J;  3HPG A;  4NQW B;  4BEH B;  1IF1 A;  4KMF A;  5D6F A;  3PIP F;  1ETO A;  1UG0 A;  3CDH A;  5F04 A;  1N78 A;  1IXS B;  2VOD A;  1RZ4 A;  4ANJ A;  1BW6 A;  3JRG A;  2RGV A;  3R0J A;  2BOL A;  4UHT A;  3WGH A;  1D5V A;  1IRX A;  1TT5 B;  2K5C A;  2MLG A;  3FBI B;  3FXO A;  2ECC A;  5GAG J;  3QYE A;  2X51 A;  1LFU P;  1RUO A;  2DPU A;  1IV8 A;  1UEL B;  2PMH A;  4AIH A;  1LUJ B;  3DKX A;  2P5K A;  2Q2E A;  1U3E M;  1IDY A;  3PSI A;  3P9K A;  1R22 A;  4A12 A;  4EJV A;  3BZC A;  2M4K A;  2M8G X;  2N8G A;  3KP6 A;  4CH7 A;  2UV1 A;  2X6O A;  1IRF A;  3S17 J;  5ICG A;  2RQQ A;  3I64 A;  3OYJ A;  3K1M A;  3PQJ A;  2FMY A;  1QNT A;  2F4O B;  4UUT A;  2GOX B;  5BS6 A;  1TWC J;  2JA8 J;  1D3Y A;  3VB2 A;  2FXA A;  5FRO A;  4LJZ F;  5J8C A;  2A6H F;  2E7W A;  3L00 A;  4ABZ A;  4AC0 A;  2RV8 A;  4QLC U;  1Z9C A;  4GFB A;  1UST A;  3ZRG A;  2DTR A;  3PSF A;  3KEO A;  3OSG A;  3GLL A;  3D5L A;  4Y3O A;  1IO2 A;  3OYC A;  4HF2 A;  3S1N J;  1SVL A;  4EJT A;  1X3Z B;  5GAE J;  4NUB A;  2ZXW H;  4IQ4 A;  4U7D A;  1GXP A;  1TWH J;  4NBQ A;  4EEF G;  4WXC A;  2DT6 A;  2IGN A;  2VPL A;  3A01 B;  1ETX A;  1SFE A;  2QQB A;  3JAM K;  1FSE A;  3WTS C;  2OD5 A;  2KT0 A;  4ZZD A;  2NYX A;  1S29 A;  1VQ7 I;  4PGH A;  4HYE A;  4M73 A;  2F5F A;  2I8D A;  1TWG J;  3C7J A;  5J1Y A;  4BAY A;  3D5R C;  1RR7 A;  1DQU A;  2DO7 A;  4M3F A;  4IZZ A;  2ZFW A;  3GUD A;  3QPL A;  4HDU A;  3GVA A;  5E79 C;  4BE2 A;  4CCO A;  2DXI A;  1S3J A;  1S7A A;  2Y0M A;  1EA3 A;  1SD7 A;  3QYB A;  1HDP A;  3PIO F;  1DU6 A;  1HQC A;  4A3D J;  3F22 A;  4ETS A;  1T0F A;  2EFN A;  1NHA A;  4E7L A;  1IC8 A;  4Z2Y A;  1OR7 C;  3CCJ I;  5TRD A;  4ZYA A;  4FX4 A;  1BA5 A;  2L02 A;  1I6X A;  4K2E A;  2GIV A;  2R7D A;  5E8I A;  2XGD A;  5IY5 H;  1H8A C;  4Y13 A;  1NTC A;  2E1C A;  2DYS H;  3GO5 A;  2ELH A;  4M72 A;  3CP2 A;  3G6E I;  4KIB A;  5IYB J;  4GXO A;  1O3S A;  1XDU A;  2IGM A;  5K7Z A;  4IEJ A;  3CCM I;  3M4O J;  2IRF G;  2BY2 A;  3BJA A;  2JA7 J;  3LSJ A;  2TRT A;  1E0E A;  3W2W A;  3ELK A;  3D0S A;  2W7N A;  3OYB A;  2WB1 N;  4BHP A;  2HTJ A;  1RUN A;  2HOA A;  3MVP A;  3BR0 A;  1CF7 B;  2KRC A;  2M87 A;  3RCO A;  2A07 F;  3FMS A;  3TL4 X;  5E1W A;  2XSJ C;  2KIM A;  2E2H J;  3GZ6 A;  2A6E F;  4OAZ A;  1R71 A;  4II3 A;  3WU1 B;  1W7P A;  3LSI A;  4YII A;  4BE0 A;  2HDC A;  1JI8 A;  2EIK H;  4GGG A;  1J59 A;  3CCS I;  4D7M A;  2WA0 A;  3OIQ A;  3DU6 A;  1ONV A;  4LFU A;  3M8F A;  3IWZ A;  5L3C A;  1JGG A;  1J0R A;  3K1N A;  5DEQ A;  5IYC J;  3LAP A;  4H0E A;  1ZK8 A;  3ML6 A;  5CKT A;  2CUZ A;  2VN2 A;  1MDM B;  5DYM A;  5D8L B;  3ESW B;  2KIQ A;  4FHT A;  4U0Y A;  2NS7 A;  1R5H A;  4RAY A;  3HRM A;  1QVU A;  2Z3Y A;  5HNH A;  5FGM A;  3KYL A;  2KQR A;  3S3O A;  1YJW I;  2W24 A;  4P5O A;  2W1O A;  3DEE A;  2IA2 A;  3SHF A;  3TW7 A;  3IKV A;  2JN6 A;  2HXO A;  2XKP A;  4AUX A;  5E3L A;  1MBG A;  2KIS A;  3DWL E;  1ZEL A;  5KAF C;  1Y1V J;  4EJU A;  2R7F A;  1FYM A;  2EFQ A;  3MQ0 A;  4PGG A;  2K27 A;  4EJW A;  2GZW A;  2QQ9 A;  3ISP A;  4AD9 A;  1G2H A;  3CDL A;  5J1U A;  3GLX A;  4UUV A;  4N0B A;  3QOP A;  2LOO A;  2K3F A;  3REO A;  3J7Z I;  3ZP5 A;  1XSV A;  2MGQ A;  2LH9 A;  3H0G J;  2VKV A;  4CA0 A;  1WFX A;  1TQM A;  2XAU A;  1UHS A;  3RIR A;  4B3X A;  2EIM H;  1ZR2 A;  4D7N A;  4HLY A;  3U9G A;  2EIN H;  2V9P A;  3OWT A;  4BY7 J;  1ZRC A;  4I01 A;  3SJM A;  3WE2 A;  1STZ A;  2NVU B;  2ZME C;  3S8P A;  4A3B J;  1MW7 A;  3IHU A;  2DYR H;  1Z3X A;  4R1H A;  4OMY A;  2LBF B;  3PO3 J;  2JT1 A;  1BI0 A;  1GHC A;  4ENM A;  4JQF A;  1KU7 A;  4B1R A;  1YYV A;  1P92 A;  1BOB A;  1YW9 A;  1EKE A;  2K9Q A;  4ZC3 A;  3RYP A;  4WF2 A;  3BC8 A;  2DMP A;  1K83 J;  1TWA J;  2VQH A;  3RPQ A;  4XOT A;  4BU2 A;  3IAS 2;  4Y17 A;  2ZKZ A;  1LB2 A;  1VQM I;  5FKN A;  5EGO A;  1FP1 D;  2BE5 F;  4M3E A;  2HYJ A;  2G7U A;  2QSF X;  3BG6 A;  1DP3 A;  4ZDO A;  1E3H A;  3VPR A;  3GW2 A;  3A2K A;  3DPT A;  2VJ4 A;  5DM6 F;  2JPB A;  3V8J A;  1CF7 A;  4FET A;  4RLF A;  2VOO A;  3J7Y J;  2GLO A;  2WV0 A;  3ZQL A;  2M7B A;  3FKI J;  1SD4 A;  4PJM A;  4IO9 F;  2DQR A;  2LSO A;  3BT9 A;  4LB6 B;  1FBS A;  1POG A;  4U88 A;  5CLS A;  3DTK A;  1ETV A;  3V7S A;  2NVX J;  2JVH A;  1BJA A;  4BJT A;  2KLO A;  4J19 A;  1WH7 A;  2ZXH A;  2OTL I;  3AG1 H;  2Q0O A;  4EM1 A;  3IKT A;  3TMO A;  4DIQ A;  3J7A Y;  3BR1 A;  3QOE A;  2HR3 A;  4XID A;  2XRL A;  4DZJ A;  3FIS A;  1HCR A;  3K4B A;  2LYC A;  4GYI A;  3DEU A;  3RPU D;  2WWY A;  2RN7 A;  3ABK H;  2PJP A;  2HWV A;  2HOS A;  4P55 A;  3K70 D;  1RKW A;  1A6Q A;  1I6H J;  2ISZ A;  3GFJ A;  2JJ7 A;  2WAQ A;  3GZN B;  4ZDL A;  3L2R A;  3FBN B;  2K85 A;  1I1G A;  3WGI A;  2JQ7 A;  2R92 J;  1G8X A;  4L5J A;  3RSN A;  5ERI A;  2QQA A;  4MTE A;  5LBQ A;  3BG7 A;  3F8F A;  1P4W A;  2I5U A;  1U6G A;  2WB1 A;  1IRG A;  1YIO A;  1HLV A;  2VT2 A;  2HEO A;  3GTK J;  5FKL A;  5J8F A;  3KP7 A;  2ID6 A;  2M8E A;  1ETK A;  3BP8 A;  3JAM Z;  1A04 A;  2CSO A;  1UCR A;  2CFO A;  1XGO A;  1FT9 A;  3AG3 H;  2QBY B;  1D1C A;  4MEX F;  5IPA A;  4LLL A;  5E18 F;  2RC4 A;  3Q9S A;  4CGZ A;  1ITY A;  2X48 A;  1UG2 A;  4XRF A;  2NOG A;  2HZD A;  4KNY A;  1X1D A;  5DTD A;  3QQA A;  1TNT A;  4UNO A;  3V4G A;  2CW8 A;  4XLC A;  3I59 B;  3QYF A;  5K5R A;  2EWN A;  2KJB A;  2UUZ A;  1HSJ A;  2R7R A;  5LHG A;  1T38 A;  3NAR A;  3HOU J;  1W1W E;  1IZ1 A;  1OFC X;  3OMY A;  3VOE A;  3TQN A;  3FMR A;  4RM3 A;  2HKO A;  1V3F A;  3S2H J;  2BV6 A;  2MC3 A;  4I76 A;  4XSX F;  5GAD J;  3SDB A;  4GRI A;  2QSG X;  1FC3 A;  2FOK A;  3FKJ A;  1Z77 A;  4LIV A;  5D8K B;  2E1N A;  4I2O A;  2X1E A;  1FWZ A;  2IW5 A;  1O4X A;  3QPH A;  3BZ6 A;  3KE2 A;  1G59 A;  1SFX A;  3JRA A;  3K2Z A;  3CUQ A;  2NS0 A;  2FJ1 A;  4B4C A;  4P1W A;  2CUE A;  4DW6 A;  3CDI A;  5KCM A;  3QU3 A;  4RGX A;  1K78 A;  3GF2 A;  4YEJ A;  2LRD A;  5EZG A;  2W85 A;  3A4C A;  4WK8 F;  1MSF C;  3M1E A;  1QO0 D;  3BR2 A;  3R4K A;  1W5T A;  1P7I A;  2HOT A;  1FJL A;  2FEZ A;  4CO8 A;  5F27 A;  4IHY A;  5HLH A;  4D5C A;  3HGY A;  4IRG A;  3HOW J;  1ZG3 A;  3C1D A;  2CW0 F;  5D5V B;  4LIT A;  1HW2 A;  2Z1D A;  5HLG A;  2M7A A;  3WOD F;  5EDN A;  2QEX I;  2V1D A;  4B44 A;  3HRT A;  2F48 A;  3G3Z A;  2DA4 A;  4FT8 A;  2DMU A;  3EDP A;  5E3M A;  3BCB A;  3WE3 A;  2Z16 A;  2XAH A;  4BBR J;  2A05 A;  2TCT A;  4XR6 A;  3K70 C;  3GTO J;  3I5U A;  3FDY A;  2DFI A;  3OSF A;  1D0Z A;  5HS9 A;  2K9L A;  4F91 B;  2V6E A;  4LK1 F;  4PFO A;  2BHZ A;  4HX8 A;  4XIC A;  4B09 A;  1QPI A;  4BGD A;  3F23 A;  3AL0 C;  2VXZ A;  4C3J J;  3MCZ A;  2EZL A;  3ERE D;  1IDZ A;  4RAG A;  1X4O A;  3M8J A;  3VSL A;  1HKQ A;  1B72 A;  4WCG A;  4KIG A;  2HQN A;  4ZDP A;  4A6E A;  4AID A;  1LFP A;  3DTE A;  4DZP A;  1GVJ A;  2UXX A;  5CJ9 A;  2IS1 A;  1KQ8 A;  2FOW A;  2JA6 J;  1AHD P;  1WI9 A;  3MKL A;  3CLQ A;  4Y33 A;  3JR9 A;  3N97 A;  1ZG5 A;  3FXR A;  2XF5 A;  1TTY A;  1WQ2 A;  3CJR B;  2NVY J;  1IN6 A;  5L3B A;  1YX3 A;  2MG4 A;  2OPT A;  4BEH A;  3RKY A;  5ILV A;  2DMN A;  2JTV A;  2DAO A;  3FXJ A;  3WTW C;  2X1D A;  3B02 A;  2O8K A;  2WC2 A;  3CCR I;  1I1S A;  2ETH A;  5C4J J;  5ICE A;  5HNF A;  1K6O A;  2ECB A;  3NAU A;  1BR1 A;  5LHH A;  1ZGA A;  1MH3 A;  2BYV E;  4A69 C;  3OS0 A;  1I39 A;  1WJD A;  2GOM A;  3MZ8 A;  2F5V A;  3H5A A;  2PFB A;  2K9S A;  4C2U A;  1MMG A;  2FSW A;  4Q48 A;  1F9N A;  1SVM A;  4XBF A;  3WHC A;  3ZMS A;  4B47 A;  1MMS A;  4RB2 C;  1GVD A;  4IF4 A;  4ENK A;  2QLZ A;  4PZJ A;  2CUJ A;  2L0K A;  3TO6 A;  2FBH A;  3RZD J;  1R58 A;  4MHG A;  4ON0 A;  5LLQ A;  3I56 I;  3HOY J;  1QPM A;  1XG1 A;  2R3S A;  2FQ3 A;  2FNA A;  4B8X A;  3WTX C;  4XOR A;  3DQV C;  1MD0 A;  4AU7 A;  5FFZ A;  5A2Q Z;  2QYO A;  3NEU A;  3JRH A;  3OYA A;  1OCP A;  1OKR A;  1IUF A;  1FIP A;  3DLL F;  3DTI A;  2Q1Z B;  3DBR B;  5C3E J;  3L2U A;  3CCV I;  2CQ7 A;  3OIO A;  5EEA A;  3HPH A;  2W4S A;  1Y1W J;  1F4K A;  1OYI A;  2L3D A;  5ILU A;  2XAJ A;  4HW0 A;  3A03 A;  4UVA A;  1MH4 A;  2M34 A;  4RA2 A;  3PJR A;  3GYH X;  1W7P B;  3M7G A;  2JRM A;  3ABL H;  1ODD A;  2XV4 S;  2WAD A;  2X1C A;  1T8I A;  2WY8 Q;  2FE3 A;  5GAH J;  4RM2 A;  2ME6 A;  3WTV C;  3H92 A;  5DCF A;  4UUS A;  2L7M P;  4IHT A;  5EG0 B;  1Z3Y A;  3JRC A;  3RPU A;  1AOY A;  3U21 A;  2D45 A;  2OU2 A;  2W25 A;  1OJL A;  2ISY A;  3MMY B;  2Z5U A;  3T8R A;  1VI0 A;  4MO7 A;  3DFG A;  3LST A;  1K4T A;  3UKG A;  5CVR A;  4E70 A;  2IJL A;  4HA8 A;  1JHF A;  3VYU B;  2R5Y A;  3RZO J;  2VQC A;  4I09 A;  3SZT A;  2CV0 A;  3HXL A;  3HTU A;  4DOZ A;  5D6E A;  1X4P A;  4HST A;  5DUI A;  2L7Z A;  2VKE A;  5IYD J;  1O7L A;  2W84 A;  1TBX A;  2K9N A;  3E5X A;  3I55 I;  3ZQI A;  3MKZ A;  2FNP A;  2V1U A;  1ORK A;  3BY6 A;  2UZK A;  2K02 A;  4BUP A;  5EG0 A;  3K69 A;  4IHS A;  4KT5 C;  1O3Q A;  1KON A;  2OQR A;  2EZI A;  2V4J C;  5K7H A;  2A3S A;  1BIA A;  3M9A A;  5E1Z B;  5FD5 A;  2BW3 B;  1UZC A;  3GX4 X;  1O3R A;  2IGO A;  3WU2 C;  3M3Y J;  4KIT B;  1ZN2 A;  2ELK A;  2YS9 A;  1QGP A;  3WG9 A;  2LDU A;  4M3G A;  3K4M A;  1QZE A;  1WJC A;  2DOE A;  2GAU A;  3Q0V A;  2DW4 A;  4F55 A;  3L7W A;  3V8L A;  1WGX A;  2LLK A;  1SFO J;  1GV5 A;  5KVR A;  3AFH A;  2BHY A;  1IN5 A;  1SFU A;  3DKW A;  3OY9 A;  2IA0 A;  2M5W A;  9ANT A;  3E97 A;  3A1Y A;  1IAW A;  1FX7 A;  4JP0 A;  4OIN F;  2R7O A;  3ZMD A;  2O61 A;  3A01 A;  3I58 A;  5IP6 A;  4R8H A;  3BQZ A;  1F5T A;  2YU9 J;  4A0Y A;  5M3M J;  4EMS A;  3CJQ B;  2OQG A;  2OCE A;  2P5L C;  1RIO H;  3OYN A;  3IC7 A;  1DGR M;  2ZSH B;  2L9N A;  3LFU A;  1T33 A;  1QQI A;  1W5C C;  1J2X A;  4BQO A;  2G0E A;  3CO6 C;  3W3C A;  5L3G A;  3HM5 A;  1X19 A;  1VQL I;  3FXL A;  4AIK A;  1MND A;  1YRN B;  1Z21 A;  3GME A;  3LWF A;  1O7F A;  3IH4 A;  2IEK A;  2MW8 A;  2DA3 A;  4GYG A;  1YO5 C;  1R4M B;  3CUQ C;  3BG9 A;  1K79 A;  5LEJ A;  4G12 A;  1ON1 A;  3MKY B;  3OS1 A;  1TL8 A;  1EH8 A;  3DV8 A;  1FIA A;  2HI3 A;  4UV8 A;  5K5O A;  3ZN0 A;  2Y9Y A;  3L2Q A;  2X6Y A;  2VQG A;  3G1M A;  2Q2E B;  5GTH C;  2IT0 A;  4BKX A;  3E3V A;  5F1R A;  2CO5 A;  2LG4 A;  2YX7 A;  1EH7 A;  4JYK A;  1X1P A;  2CFX A;  4II2 A;  3S2W A;  2ZME B;  5CPR B;  5JVT A;  4OIO F;  3LNQ A;  2V9V A;  1B8I A;  1MMD A;  1XTA A;  4KIS A;  3O8H A;  3IAM 2;  2ZJP F;  4MQV A;  2RVC A;  3KEY A;  1U8R A;  1A5J A;  3EUA A;  3LQR A;  3LA7 A;  1K6Y A;  1YFH A;  2X6X A;  1A31 A;  3LOC A;  1Z7U A;  1AKH A;  4AM3 A;  2HDD A;  1MBE A;  2F4I A;  2O3F A;  4IOC F;  5EGO B;  2DA2 A;  2X4H A;  3QP5 A;  3SFI A;  4EVI A;  2RNJ A;  1IGN A;  2YR2 A;  3NWS A;  2VIX A;  2DPD A;  4L18 B;  4S05 A;  4I0B A;  3E5U A;  1K7A A;  3F8M A;  1EJ9 A;  1R1V A;  5CYV A;  3T0Y A;  4LG0 B;  3FK7 A;  2E5Z A;  1V4R A;  3ZMZ A;  2K3P A;  2O0Y A;  2OTJ I;  1U9N A;  3CJT B;  3S93 A;  2LY1 A;  1Z91 A;  4A3L J;  2EZH A;  4C3I J;  2LMD A;  1BN5 A;  5M5Y J;  4MFD A;  3PQK A;  2HFH A;  3KYD B;  1MBJ A;  4PSW A;  4J01 A;  1D8K A;  2B9S A;  3T5X A;  4CZZ A;  1PDN C;  3ECO A;  3ZPL A;  1S5L C;  4KUM A;  2VE9 A;  2MLK A;  2VE8 A;  1BI3 A;  1YS7 A;  2BGC A;  2MYS A;  2XSD C;  4XKB A;  5TIS C;  3FXM A;  3CO7 C;  1Y6I A;  1YQA A;  3OYG A;  1OCO H;  4S0H B;  1VQ6 I;  2FF4 A;  1XC5 A;  2EIL H;  1LEA A;  1FP2 A;  1U8B A;  4HNU A;  3BR6 A;  4GCV A;  3BLY A;  5CVJ A;  5JHU A;  4M6X A;  4IX7 A;  3LFK A;  1WJE A;  2DN0 A; 
#chains in the Genus database with same CATH homology
 2IAI A;  1RES A;  1HLV A;  4MIM A;  5F0F A;  4FE7 A;  3GTK J;  4AYB N;  1JUM A;  5FKL A;  1LE8 A;  1IG7 A;  2ID6 A;  3GTQ J;  4XRS A;  1JKO C;  1ETK A;  3JRI A;  1F43 A;  1MBH A;  2E2J J;  3S16 J;  4I6Z A;  2R5Y B;  5IPA A;  1ITY A;  2X48 A;  2CQX A;  1UG2 A;  5F0C A;  3S15 J;  2FQ4 A;  2NOG A;  3BQY A;  1ETW A;  2LD5 A;  5DTD A;  2LTP A;  2AO9 A;  3QQA A;  1JTY A;  5FLM J;  1I3Q J;  3S1Q J;  5GPC A;  2M9H A;  4IHV A;  3JRE A;  4FTH A;  1IV6 A;  4BY1 J;  1ENH A;  3NAR A;  2FX0 A;  2JWT A;  3GTG J;  3HOU J;  1OFC X;  2PMZ N;  2EH3 A;  1X2M A;  4A3F J;  3DCF A;  5FJ8 J;  1CQT A;  2Y31 A;  2NS8 A;  4UUS B;  3S2H J;  4RBO A;  5F0H A;  4W1U A;  4I76 A;  3GTP J;  2EBI A;  4X6A J;  2R5Z B;  5IP7 J;  4V2F A;  2R7Z J;  2IBD A;  3DEW A;  3D1N I;  1Z77 A;  2O9L A;  3I4M J;  2E2I J;  2Y2Z A;  1UMQ A;  3TED A;  1O4X A;  3F0C A;  1RKT A;  3BG3 A;  3JRA A;  1WI3 A;  1TWF J;  2FJ1 A;  3JRF A;  4B4C A;  2CU7 A;  1EF4 A;  2CUE A;  4DW6 A;  1GUU A;  5EYR A;  5EZG A;  5J3L A;  3BTI A;  3IH3 A;  2L9R A;  3HEF A;  1MSF C;  2EQR A;  3BR2 A;  1S7E A;  3TP0 A;  4A3J J;  1P7I A;  2DA5 A;  1E3O C;  1B72 B;  2HOT A;  1FJL A;  4IHY A;  5F27 A;  4DYC A;  1K61 A;  3CCY A;  4D5C A;  3HGY A;  3ZOB A;  2WV1 A;  3ZQG A;  3HOW J;  2L7F P;  5FKO A;  1ZKG A;  5IP9 J;  2Y9Z A;  3CQZ J;  1MNM C;  1JKP C;  3HKZ N;  2QCO A;  3GTJ J;  1HOM A;  5FKK A;  4IHW A;  3MN2 A;  3TP3 A;  2H1K A;  5EDN A;  4A3I J;  1D5Y A;  3S14 J;  4BBS J;  1ZR4 A;  1JUS A;  1TC3 C;  2DA4 A;  1X2N A;  2DMU A;  2M2E A;  1FEX A;  1SAN A;  5E3M A;  4JX4 A;  3A02 A;  4BBR J;  2DJN A;  2TCT A;  2WAQ N;  3GTO J;  4M3D A;  1ZGW A;  3OSF A;  4LOC A;  1AKH B;  3BTL A;  3BG5 A;  1U78 A;  4XIC A;  1X58 A;  1BJZ A;  2NVQ J;  1APL C;  1QPI A;  3BR5 A;  4C3J J;  3OOU A;  2DA6 A;  3B6A A;  1VND A;  5F08 A;  2EZL A;  1IDZ A;  2XPU A;  3HBL A;  1B72 A;  5JLX A;  1PUF A;  3TW6 A;  3HOV J;  1I50 J;  3HOX J;  4DZP A;  5C44 J;  2MSY A;  2VI6 A;  2R93 J;  2LR8 A;  2JA6 J;  1AHD P;  3MKL A;  3JR9 A;  3Q0W A;  1ETO A;  5F04 A;  4HNV A;  2GM4 A;  1Q1V A;  1MBF A;  3LSR A;  1BW6 A;  2XGC A;  2XPW A;  3JRG A;  3ZQH A;  1B8I B;  3E7L A;  2NVY J;  2ECC A;  2MG4 A;  2OPT A;  3SDG A;  1LFU P;  1MBK A;  2DMN A;  5M3F J;  1ETQ A;  5M5X J;  2O8K A;  5K7F A;  4C3H J;  3FK6 A;  4A3G J;  1WH5 A;  5C4J J;  1IDY A;  2ECB A;  3NAU A;  2O7O A;  3O8G A;  2LY9 A;  2N8G A;  2M8G X;  1MH3 A;  2X6O A;  3S17 J;  4A69 C;  4C2M J;  2K9S A;  3H3V K;  1GT0 C;  5FLV A;  3WHC A;  1RPW A;  2HQ5 A;  4UUT A;  1GVD A;  3LSP A;  1YRN A;  1TWC J;  3Q0U A;  1LE8 B;  2JA8 J;  1ZTR A;  1H88 C;  2L0K A;  4BXX J;  4GFB A;  4ABZ A;  4AC0 A;  3RZD J;  1FTZ A;  3OSG A;  4CYC A;  3S1N J;  5GP9 A;  3HOY J;  1P7J A;  1XG1 A;  4JX5 A;  1TWH J;  2CJJ A;  4EEF G;  3A01 B;  1ETX A;  1IRZ A;  2CRG A;  3ZQF A;  2KT0 A;  3JRH A;  1OCT C;  1VF9 A;  1OCP A;  1IUF A;  1FIP A;  5C3E J;  4FIS A;  2M0C A;  3OIO A;  1TWG J;  5EEA A;  3Q3S A;  1Y1W J;  5J1Y A;  3A03 A;  1RR7 A;  1MH4 A;  2M34 A;  4M3F A;  3QPL A;  4MLO A;  2DTZ A;  2YUS A;  5IOY A;  4V2G A;  3PM1 A;  2GBY A;  1F36 A;  2H8R A;  1HDP A;  5M5W J;  2ME6 A;  3JRD A;  1DU6 A;  4A3D J;  4UUS A;  2L7M P;  3HDD A;  2ME0 A;  5EG0 B;  1IC8 A;  2I10 A;  3JRC A;  4FE4 A;  1BA5 A;  4QTR A;  4MFE A;  1H8A C;  1OJL A;  2XGD A;  1NTC A;  1VI0 A;  5JLW A;  4MO7 A;  1AU7 A;  2KDZ A;  5IYB J;  1A6I A;  5K7Z A;  4IEJ A;  3UKG A;  2HXI A;  3M4O J;  2XB0 X;  5C4X J;  2D5V A;  2LKX A;  2R5Y A;  3LSJ A;  1HF0 A;  2JA7 J;  2TRT A;  3G1L A;  3RZO J;  2W48 A;  4A3M J;  3FIW A;  2WB1 N;  1JJ8 C;  2K40 A;  2ID3 A;  2HOA A;  3MVP A;  1ZQ3 P;  2L7Z A;  2VKE A;  5IYD J;  5DS9 A;  3BR0 A;  2R0Q C;  4A3K J;  2K9N A;  3L1P A;  2E2H J;  3ZQI A;  1ORK A;  3G1O A;  5EG0 A;  1FTT A;  2LFB A;  3BR3 A;  1NK3 P;  1BW5 A;  2XGE A;  2ZB9 A;  3IH2 A;  4D7M A;  2B63 J;  3K2A A;  2EZI A;  3S1R J;  5K7H A;  1JGG A;  1QRY A;  5IYC J;  4DYQ A;  3M3Y J;  1ZK8 A;  4X1E A;  4A3E J;  2ELK A;  2YS9 A;  3LSG A;  2JK3 A;  1T56 A;  4XK4 A;  4M3G A;  3S2D J;  3Q0V A;  2NS7 A;  5GPA A;  3PO2 J;  1QVU A;  3GTM J;  4XRM A;  2OF7 A;  1WGX A;  2LLK A;  4L5E A;  1SFO J;  1GV5 A;  4A3C J;  1JT0 A;  3TW7 A;  3GTL J;  9ANT A;  2JN6 A;  1GV2 A;  1WPK A;  3GBG A;  2HXO A;  1LFB A;  4AUX A;  5EF6 A;  1JJ6 C;  4JP0 A;  5E3L A;  1MBG A;  1Y1V J;  3A01 A;  5IP6 A;  1H89 C;  3BQZ A;  2YU9 J;  3HB9 A;  3RQI A;  5M3M J;  4CYC B;  3HGG A;  3C2B A;  3I4N J;  1G2H A;  3CDL A;  5J1U A;  1T33 A;  1JKR C;  1BL0 A;  2MGQ A;  2R5Z A;  2G0E A;  4M3B A;  3H0G J;  2VKV A;  3HM5 A;  2NVT J;  1JUP A;  2VUM J;  1UHS A;  1Z0X A;  1ZR2 A;  4FCY A;  1YRN B;  3IH4 A;  1ETY A;  2IEK A;  2MW8 A;  2DA3 A;  4D7N A;  4DYR A;  4BY7 J;  1W0T A;  3BG9 A;  2E1O A;  4G12 A;  4IHX A;  3SJM A;  2CQQ A;  4M6V A;  3QPS A;  1FIA A;  2HI3 A;  4B3A A;  4A3B J;  5EZH A;  2Y9Y A;  1R9T J;  4NDL A;  1NK2 P;  3B6C A;  3G1M A;  3PO3 J;  1QVT A;  4BKX A;  4B1R A;  2DMQ A;  4JYK A;  1HDD C;  2K9Q A;  2JMW A;  3LNQ A;  1B8I A;  2RAE A;  2DMP A;  1K83 J;  5IOZ A;  1TWA J;  1DU0 A;  3O8H A;  2XPV A;  1U9O A;  2VPR A;  4QSH A;  4A93 J;  4W97 A;  5E3O A;  2LVS A;  5FKN A;  5EGO A;  1A5J A;  1JKQ C;  4M3E A;  5F1J A;  3JRB A;  2HYJ A;  4JX6 A;  1XS9 A;  3CMY A;  3LOC A;  2JA5 J;  4Y52 J;  1AKH A;  1VFC A;  4Y7N J;  2CUF A;  3VPR A;  1MBE A;  2HDD A;  3WHB A;  5EGO B;  3RKQ A;  2DA2 A;  3SFI A;  5J1R A;  2AHQ A;  1PUF B;  1IGN A;  1MSE C;  5BNG A;  2GLO A;  3ZQC A;  1GDT A;  3ZQL A;  4RDU A;  3FKI J;  5HOD A;  2DA1 A;  2QF7 A;  3BT9 A;  3FK7 A;  1POG A;  1ETV A;  1U9N A;  2LP0 A;  2NVX J;  1WCM J;  1JT6 A;  2Y0S N;  4J19 A;  4A3L J;  2EZH A;  4C3I J;  1WH7 A;  2LK2 A;  4QIW N;  3S1M J;  5M5Y J;  4MFD A;  2XB5 A;  3BR1 A;  1MBJ A;  2EZK A;  4XID A;  2XRL A;  1RET A;  4DZJ A;  2P81 A;  3FIS A;  1HCR A;  2Y30 A;  2DMT A;  1IJW C;  2E19 A;  2DA7 A;  2X9D A;  4D5F A;  2XSD C;  3BTJ A;  3BTC A;  4XRS G;  2HOS A;  4S0H B;  1XC5 A;  1RKW A;  1I6H J;  3HOZ J;  3W6V A;  2JJ7 A;  1U8B A;  1W0U A;  3BR6 A;  5E3N A;  2R92 J;  3IV5 A;  1JTX A;  5FKM A;  2COB A;  2DN0 A;  3K7A J;  2FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...