5M3FJ

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m3fJ00
1FEXA 2P81A 3LNQA 3HBLA 2QF7A 1Z0XA 3G1MA 2M9HA 4C2MJ 2EBIA 4DZJA 2X6OA 1K83J 1T33A 2WB1N 2XPWA 2D5VA 1DU6A 2TCTA 3GTLJ 1B8IA 1JKPC 2JWTA 3HOVJ 4Y7NJ 5F27A 2JN6A 1TWAJ 2LFBA 5M5YJ 3QPSA 2DA7A 1I6HJ 2LKXA 5M5XJ 4A3FJ 1H8AC 1BJZA 2LD5A 4FE7A 3IH3A 1G2HA 1ETQA 5IYDJ 2H1KA 2MGQA 4JX5A 4BBRJ 2HYJA 1NK3P 1JTYA 5F0CA 3SJMA 5FKLA 3BTIA 1GV2A 3JRFA 3I4NJ 4J19A 1AKHB 5F0FA 1ZK8A 2OF7A 1NK2P 2FX0A 3TW7A 5IPAA 3HOWJ 3BR2A 3HM5A 2COBA 1NTCA 2NS7A 3S17J 1JT6A 1XG1A 1IC8A 1LFUP 4V2GA 3HGGA 4B4CA 2AHQA 1SFOJ 5IOZA 1PUFA 2X48A 2DMQA 4MFDA 3JRDA 3S2HJ 2HOSA 4QSHA 4AC0A 2R5ZB 1QRYA 3S1RJ 3QPLA 2VKVA 3Q3SA 1D5YA 5HODA 2DA1A 4A3MJ 2GBYA 4DW6A 5K7FA 2I10A 3HDDA 5J1RA 4I6ZA 1IG7A 3B6AA 2M2EA 1B8IB 1XS9A 2EZHA 2Y9ZA 3OOUA 2GM4A 4A93J 1GV5A 1OCTC 1ETWA 1S7EA 1JUSA 3HOXJ 4XRSA 2K9NA 1Y1WJ 4UUSA 1LE8A 4A69C 3G1LA 2Y0SN 3DCFA 3S1QJ 1JUMA 4Y52J 5J3LA 1GUUA 2FJ1A 1RKWA 1BA5A 4AYBN 3GTOJ 3IH4A 1ZKGA 4MFEA 4A3DJ 1YRNA 5C4JJ 2AO9A 3BG5A 2WV1A 2E1OA 4FTHA 4X6AJ 3CQZJ 5K7ZA 3GTKJ 4DYRA 5EG0A 2XGEA 1AKHA 3TP0A 4XIDA 3TW6A 2L7MP 2H8RA 4BBSJ 3SFIA 2CUEA 1ETYA 1WI3A 3BTCA 4IHVA 1MBFA 2K9QA 3ZQGA 1PUFB 3GTQJ 1ZR4A 3ZOBA 4HNVA 1VNDA 1W0UA 1JGGA 4BXXJ 2CQQA 3FK7A 4XICA 2JA6J 5EGOA 2R5YB 1A6IA 3MN2A 4QIWN 2IBDA 2R93J 1GDTA 5GP9A 1ENHA 3K7AJ 2R7ZJ 4DZPA 2LR8A 1U9NA 2DA6A 2DMUA 4JX4A 2O7OA 4DYQA 1UG2A 2JMWA 4MO7A 5JLXA 3FKIJ 2GLOA 4UUSB 4M3GA 1LE8B 1HDDC 3NAUA 3LSPA 1HF0A 3BTLA 2R92J 2XRLA 2E2HJ 5F04A 1RETA 1EF4A 1VI0A 4M6VA 4M3EA 3UKGA 4W97A 4D5CA 1T56A 4G12A 1R9TJ 4JYKA 1YRNB 2Y9YA 4M3BA 2XB5A 2LLKA 3BQYA 3PO2J 3D1NI 5M5WJ 5FKOA 5EG0B 4FCYA 1IDYA 1TWHJ 1IV6A 1ITYA 5F1JA 3GTPJ 3HOZJ 1SANA 1CQTA 3MVPA 2JA5J 2XGCA 3HEFA 3BG3A 1Y1VJ 3G1OA 3BG9A 3ZQFA 1GT0C 2HOAA 3HKZN 2M34A 3JREA 3BT9A 1APLC 1FIAA 3S16J 1ETKA 1FTZA 5J1UA 4NDLA 1ETVA 2CUFA 4D5FA 4JP0A 5EGOB 3ZQCA 3WHBA 1HLVA 2L7FP 5IYBJ 2LTPA 3W6VA 5GPAA 5IP9J 2VUMJ 3C2BA 5F08A 4D7MA 2DMNA 2JA7J 5C4XJ 2R5YA 3BR3A 3CDLA 3ZQLA 4RDUA 2HDDA 5DS9A 2YS9A 1ZTRA 3IV5A 1BL0A 2L9RA 1AU7A 2VPRA 2M0CA 5FKMA 3BR0A 1IGNA 5IOYA 2OPTA 1MBGA 1ZGWA 4D7NA 4A3BJ 2Y30A 2K40A 4IHYA 4MIMA 2EH3A 3MKLA 1B72B 4IEJA 1IJWC 4IHWA 4EEFG 5IP7J 3PM1A 4BY7J 1MBHA 3ZQIA 2XPVA 2NS8A 2KT0A 3JRHA 3M4OJ 1TC3C 1GVDA 2X9DA 1JJ6C 1F43A 4S0HB 1JT0A 3OSFA 1JKRC 2VKEA 5EZHA 2CQXA 2VI6A 4V2FA 3A03A 3BQZA 2HI3A 2TRTA 4I76A 5IYCJ 3Q0WA 3O8GA 2ME0A 5EZGA 3GTMJ 1JJ8C 4A3JJ 3F0CA 2DJNA 2DN0A 2ID6A 4XRMA 5FKKA 3LSRA 1MBJA 4FE4A 1O4XA 2N8GA 3LSGA 4DYCA 1JTXA 5F0HA 3S1MJ 1RPWA 4C3IJ 2Y31A 2JK3A 3HOUJ 3S2DJ 1WH7A 2CRGA 1MSFC 2KDZA 4FISA 1FTTA 3BR6A 2E19A 2NOGA 1FIPA 2EQRA 3Q0UA 5JLWA 2ELKA 5EDNA 3CCYA 1XC5A 1U8BA 1MBKA 4M3FA 4XK4A 1JUPA 2XPUA 3HB9A 3WHCA 5E3NA 1E3OC 4A3EJ 1MH4A 1TWFJ 4XRSG 2NVXJ 1P7JA 2EZKA 1BW6A 1WPKA 1B72A 2WAQN 1DU0A 3TP3A 3SDGA 1OJLA 5IP6A 1X58A 4C3JJ 4LOCA 4MLOA 3LSJA 1F36A 2K9SA 3GTJJ 4BKXA 3BTJA 4A3LJ 1VFCA 2IEKA 2L0KA 5FJ8J 1MNMC 1LFBA 2NVTJ 1IRZA 2LP0A 1MBEA 3A01A 2ECCA 1ZQ3P 9ANTA 3FK6A 2DA2A 3RQIA 3RZOJ 4BY1J 2EZLA 4A3GJ 4JX6A 4W1UA 2YU9J 5E3LA 3A02A 1JKOC 5K7HA 3DEWA 2HXOA 1BW5A 2QCOA 1A5JA 2XSDC 4CYCA 5E3OA 1H88C 3JRAA 2IAIA 4A3CJ 2B63J 3S1NJ 3JRCA 2LK2A 4IHXA 2JA8J 2EZIA 3B6CA 2LY9A 1HDPA 2ECBA 3M3YJ 1W0TA 3RKQA 2DA4A 1TWCJ 5C3EJ 2NVYJ 3K2AA 2R0QC 1TWGJ 1X2MA 3FIWA 1I50J 3HGYA 1JKQC 3GBGA 3JR9A 1X2NA 3IH2A 3FISA 2HOTA 2O8KA 5FKNA 2LVSA 2W48A 4UUTA 2O9LA 4AUXA 1HOMA 1UHSA 1RR7A 1QPIA 2HXIA 3PO3J 2E2JJ 1I3QJ 1WH5A 2ZB9A 5FLMJ 3BR1A 1UMQA 2XB0X 4L5EA 3ZQHA 1ZR2A 5M3FJ 2ID3A 2L7ZA 2ME6A 2NVQJ 2DA3A 1WCMJ 2M8GX 3JRBA 3A01B 1Q1VA 3OSGA 3OIOA 4B1RA 2YUSA 2CJJA 1ORKA 5GPCA 2Y2ZA 1RKTA 2DMPA 3VPRA 3JRIA 3RZDJ 3S15J 5BNGA 1QVTA 3TEDA 2DMTA 1IUFA 5EF6A 1HCRA 1VF9A 5J1YA 3I4MJ 1P7IA 5DTDA 4CYCB 5C44J 1RESA 1ETOA 2MW8A 1U78A 1MH3A 1OFCX 2MG4A 3H0GJ 3NARA 1ETXA 2CU7A 1OCPA 3O8HA 3QQAA 5E3MA 1AHDP 1FJLA 3BR5A 1H89C 4B3AA 1IDZA 3E7LA 3Q0VA 5FLVA 3S14J 4X1EA 4C3HJ 3JRGA 4QTRA 1POGA 4GFBA 2FQ4A 3HOYJ 5EEAA 4A3IJ 1K61A 4RBOA 1U9OA 2DTZA 1MSEC 4ABZA 4A3KJ 1QVUA 3GTGJ 3LOCA 2JJ7A 1Z77A 2RAEA 1WGXA 5EYRA 2E2IJ 2DA5A 2MSYA 3L1PA 3CMYA 4M3DA 5M3MJ 3H3VK 2HQ5A 2R5ZA 2FD5A 2PMZN 2XGDA 2G0EA
chains in the Genus database with same CATH superfamily
3LNQA 1KYZA 2EA4A 1Z0XA 2ZMEB 1DP3A 2M9HA 3VODA 3BCAA 2M87A 2WB1N 1QHGA 2XPWA 2H1LA 1B8IA 2XVCA 2L4MA 2PFBA 2EV5A 3HOVJ 2DO7A 3I58A 3QPSA 1I6HJ 3QU3A 1FBQA 1V54H 2KRFA 3IRQA 1BJZA 2LD5A 1G2HA 3IH3A 3SFZA 2H1KA 1WWXA 2GZWA 5DD4A 2PJRB 1P4WA 1SFXA 5ILSA 1JTYA 2P7VB 4PCQA 4J19A 1FMVA 4OOIA 4A2UA 3WE3A 2V1UA 2QLZA 3I59A 1A31A 2COBA 4ITVA 1ERDA 3OYNA 5LGUA 3CMEI 4OIQF 4ZYHA 3S17J 2ZC2A 2D1HA 1IC8A 2HNHA 4M74A 2VJ4A 2QBYB 3T0YA 4KA4A 5B66C 1J09A 2ZSHB 2IJLA 1SFOJ 2VC0A 4XLPF 4ENJA 2VLAA 3T8TA 2EA2A 4MFDA 1W5CC 4RM2A 4HPQA 3S2HJ 2IP2A 4CCJA 2HOSA 1W5TA 1D5VA 1IXRC 2FRHA 1QRYA 2K7LA 2VBXA 4BQQA 3WTXC 2QA4I 1ZG3A 1SC7A 5ED4A 3M7GA 1FMWA 4NUBA 5FB2A 4DW6A 3HOTA 1R1TA 2ZNZA 2I10A 3BROA 5E79C 1IG7A 4NQWA 2RKHA 2V1XA 1OQYA 4HQMA 3SXYA 3FXRA 2M2EA 1EH6A 4LG3A 4A93J 2VXDA 1I3AA 3S3MA 4KDPA 3LAJA 3A2KA 1JHHA 4UUSA 1GXQA 4A69C 1LE8A 3G1LA 3QWLA 4RB1A 2EFQA 3DCFA 5JHUA 2KIQA 5J3LA 3AL0B 2BOLA 4XONA 3WGHA 4B47A 1GUUA 3AG3H 1Y0UA 3FZVA 3IH4A 1ZKGA 1R4NB 5CVUA 2AO9A 3LAPA 3OIQA 2QQBA 3TQNA 2E36A 3HSRA 5D6EA 2Q0OA 2XAJA 3PSFA 2QEXI 2LRDA 1VQMI 2XGEA 2UXXA 3TP0A 4EGZA 3TW6A 2H8RA 1QA6A 1R00A 1G3TA 4ZYEA 1BR2A 2KQRA 2WWYA 4BBSJ 2CUEA 2JVHA 1ETYA 3DQVC 4BXFA 3ZQGA 1ZRCA 2LOOA 4EJVA 3ZMZA 4S05A 2ISZA 2YU3A 1A6QA 3I9V2 5LGTA 1WJEA 2IS6A 5GADJ 3K1PA 3QRFF 2JQ7A 1LKXA 3L2UA 1Z6TA 2DK5A 2Q2EA 4BXXJ 2EPFA 2VBWA 4Y33A 5EGOA 4LLGF 4U87A 1U3EM 1BI1A 3CP2A 1DGRM 5GP9A 3OMYA 4AU7A 1NHAA 4ZZLA 1TZLA 4DZPA 5FGMA 4CZZA 4C2UA 1U9NA 2F5FA 1H9TA 3RPUA 3AFHA 3GZNB 4CO8A 1WKMA 4DYQA 3AAFA 2KIFA 2W1OA 3FKIJ 5JLXA 1IO2A 4E6KG 2GLOA 3CCQI 3HTUA 3LL7A 3RYPA 1YTYA 2ZKZA 3BTLA 3QU6A 1QO0D 1X4PA 4B43A 1VI0A 2DU9A 4W97A 4R1HA 2LKSA 2P5LC 1R9TJ 5HS9A 4JYKA 2BVLA 2DYRH 1YRNB 2Y9YA 2WY7Q 3CJNA 4M3BA 5J8FA 2XIGA 1ZELA 3REOA 4G6TB 2GAUA 3FBNB 4FCYA 1QHHD 3ABKH 1TWHJ 2EIJH 2RNGA 3OL3A 4E7ZA 1FSHA 1SVLA 3PIOF 3GWZA 1J2XA 3GTPJ 1LVAA 1YX3A 2DOEA 2DCEA 5JFRA 2VQGA 2MABA 3RYRA 4U0WA 3HEFA 2LG4A 1U5TC 1Y1VJ 2E1MC 2BXZA 3ZQFA 2IGKA 4XKCA 1K4TA 3HRTA 3JREA 1FBSA 1YW8A 1QZEA 3MFKA 3DLLF 3TMOA 3S16J 2VOOA 2FMLA 2V9PA 1TW3A 4J01A 3NARA 3CO6C 2HZTA 4GYIA 1Z1DA 2XAQA 2L7FP 1VQPI 3W6VA 1AHDP 1OR7A 5GPAA 3OS1A 5ICCA 1R4MB 2HQNA 3V42A 3RI4A 4BQAA 5C4XJ 3BR3A 3CDLA 2L2OA 4RDUA 1TP4A 3Q9SA 2HDDA 5DS9A 2YS9A 3IV5A 1ACIA 4WX9A 4FHTA 3BR0A 4I0AA 1IGNA 2M3AA 3VOEA 2VASA 4D7NA 2HOEA 2LY2A 2FBHA 2F48A 3GUDA 4OINF 1YX5A 1U2WA 1QBJA 2K40A 1OCZH 3MKLA 3SEZA 2ISYA 3X2QH 2FNAA 4BS9A 1Z21A 4G7ZF 4CCKA 4F91B 5CPRB 3M1EA 4EEFG 1BIAA 4BY7J 1MBHA 3I54A 3OYBA 4ZH4F 1WJFA 2NS8A 2KT0A 3M4OJ 3L2QA 1TC3C 1BI0A 1YJWI 4I99C 2BW3A 4S0HB 3IAS2 1JT0A 1HW2A 3VWBA 1R7JA 4OMZA 3A03A 3CO7C 3BQZA 2TRTA 4A0ZA 1SD5A 4I76A 5IYCJ 3ELKA 4LITA 4YIFA 3KZYA 1CGPA 4IOCF 4XRMA 3IWZA 4KIGA 2ZNYA 2STWA 2NXNB 1R71A 1FOWA 4FE4A 2P8TA 4BACA 1I27A 6PAXA 1P9QC 4DYCA 4KITB 2HVRA 2R7RA 2QQ9A 1HKTA 3S1MJ 4P9FA 4EQQA 2Y31A 1VQLI 2JK3A 3JSPA 2IS1A 2EWNA 4PJ0C 4KYWA 3D5LA 3H3UA 1LDJA 2R7FA 2JT1A 1S72I 3F8MA 3NWSA 2NYXA 5CLSA 1P92A 5FLXK 5E1ZB 1U8BA 3ONQA 3WHCA 5KHDA 1YI2I 4KJZA 5E3NA 4A3EJ 2EIMH 3D0SA 4QPQA 4XRSG 2A07F 1ZLJA 3VYSB 2ZO4A 2QKMB 1E17A 4DIQA 2XASA 3K4MA 1OYYA 4KIFA 1TTYA 4Q5SF 5E1XA 4PUSA 2PQ8A 2ZXIA 3H9JA 3KX2A 1A36A 1KU9A 2OZUA 4MLOA 3ZMSA 3ZN0A 5LBQA 1JE8A 3GTJJ 3S3OA 4MEYF 1DPUA 1XCBA 3ML6A 1IRZA 1U6GA 1MBEA 3WE2A 3M9AA 3DP7A 9ANTA 2JZYA 2EK5A 3RQIA 2I5UA 2STTA 4BY1J 1J9IA 1R5HA 2FA5A 3NEUA 4JX6A 5K1YA 3WGGA 1LEBA 4W1UA 3SDBA 2XAUA 2WAFA 5GAHJ 3DEWA 4XLHA 2IGNA 5H6RA 4HSTA 4LK0F 1A5JA 1FYMA 4LK1F 3JRAA 4FQGA 2R7DA 2COMA 5HLGA 2BVMA 3J7ZI 2BGCA 1UZCA 1TT5B 2EIKH 2HVQA 3AG1H 1P6RA 2EZIA 4MHGA 2UV1A 2JUGA 2K4JA 4Y13A 1W0TA 2VT3A 2GA2A 1TWCJ 3QPHA 4ZZDA 4N4NB 1FWZA 1TWGJ 4XLEA 1LDKB 3GBGA 1X2NA 3KZIC 2V4JC 4UUTA 2MC3A 2HU9A 2O5RA 3HUGB 3KIOA 3L9FA 4FASD 1ZREA 4AUXA 1IRFA 1V55H 2EB7A 4PGHA 2VE9A 2HXIA 3TO7A 1WJBA 3FWEA 1K4SA 5FD5A 3D5RC 3K4KA 3HL2A 2JRTA 5M3FJ 2ID3A 2ME6A 2FE3A 3I4PA 4RAZA 4IHTA 3GW2A 3A01B 3WTUC 4HX4A 2DXIA 3HC7A 2KJBA 3OIOA 4GXOA 4RA2A 2Y48A 2VQCA 4Y3OA 4N9HA 4BQNA 1XGNA 2DMPA 1X3WB 5B1BH 2Q1ZB 2BY2A 2HPIA 3JSOA 3TEDA 4HDUA 1FC3A 4E7LA 1R22A 2XF7A 3R4KA 3S2WA 2RQQA 3EYYA 1VF9A 3E6BA 1Z7UA 1RRJA 1P7IA 3PQKA 2JVGA 4YFNF 5KAIC 1ETOA 4WXDA 3E6CC 1SAUA 1ODDA 1FJLA 2O8XA 2FOWA 3BR5A 1H89C 2P5KA 4I0BA 4B3AA 3ERED 3Q0VA 3CCJI 1IDZA 4X1EA 2KIMA 3DF8A 4AVZA 2AXTC 5K5QA 2X6WA 3V8KA 5EEAA 1K61A 4RBOA 2LY1A 2IS4A 5TRDA 1MSEC 2AS5F 2FQ3A 3DKWA 3H5AA 1O3RA 2JJ7A 1Z77A 4FETA 1UB9A 3D5SC 3ZXSA 2E2IJ 1T0FC 3L1PA 3T1BA 4M3DA 5M3MJ 3ZP5A 3O2PE 2V9KA 1HSTA 4BYYA 3FHNA 1FEXA 5DCMA 2F6CA 2MLKA 2EBIA 4BDZA 2D5VA 1K83J 1T33A 2H27A 5KAFC 3W2WA 1J59A 3CUOA 3KYCB 1EH7A 2XHKA 2TCTA 4HYEA 1W36C 4I01A 1JKPC 4MTDA 3GEZA 4YFKF 3UNGC 1RC9A 2JN6A 2VKDA 1TWAJ 2LFBA 1D8JA 3M8JA 2DA7A 3I71A 5FLXZ 2LKXA 5M5XJ 1VQ7I 3M8EA 1ETQA 5IYDJ 4GCVA 4JX5A 2V1NA 4BGDA 1MZBA 3HHGA 3SJMA 3BTIA 5HLTA 3OYCA 1MDMA 3I4NJ 2VOPA 1G59A 5F0FA 3ZR8X 3VDXA 3WG9A 2R7TA 1PVEA 1ZHFA 5D4SA 3EUKL 3TW7A 2X51A 2MC4A 2A3SA 2LBFA 1WHUA 3BR2A 3Q5FA 3QOPA 1FOKA 3LSIA 1N77A 4EJWA 2KLOA 3QYFA 4B4CA 3HGGA 3W2AA 3E5XA 3TKYA 1PUFA 2X48A 2K27A 3IP4B 3CLOA 2V6EA 2KZVA 1ON1A 1NG6A 3OYJA 3F9KA 1VQ4I 3PQJA 5LD2C 4BAYA 2EFWA 1HXDA 1YO5C 1J75A 1UELB 2GBYA 5K7FA 1R5GA 2V9VA 5J1RA 4I6ZA 2VBYA 3CESA 2X1DA 3FXJA 4OU0A 1YLFA 1B8IB 1XS9A 2EZHA 2Y9ZA 1OCCH 1STZA 4O5VA 1HSJA 5ILVA 2EV0A 4XRSA 3SZGA 5DUKA 1V3FA 2L01A 5ILUA 1MD0A 2WY8Q 4CXFA 1HW1A 1R23A 2Y0SN 1U5TA 3S1QJ 2CGPA 2W84A 1XX5A 4NNJA 3M8FA 3ESWB 3GZ6A 4BNCA 2FJ1A 1MJAA 1RKWA 3CD6I 3GTOJ 2YX4A 2L9VA 4MFEA 2VONA 3DWLE 3E1SA 4G6QA 2CQ7A 2ZJQF 2DDBA 1T95A 2DDAA 2ICWG 2HYGD 4ZDLA 5CVJA 5F1RA 3E6DA 4FTHA 4I2OA 4X6AJ 5F64A 2MA3A 3HSEA 2FMYA 3H0DA 3CQZJ 2O0YA 3IAM2 2DYSH 5LHGA 4RB0A 5EG0A 1S5LC 4XIDA 1IRXA 2L7MP 2QKLB 4HW0A 1REPC 3FXQA 2IA1A 2VQHA 1VQ8I 2QSFX 1TNSA 2A6EF 3LSKA 1ZYRF 3BTCA 3O3KA 4HA8A 2K9QA 1USSA 1YW9A 1ZR4A 2DW4A 3U21A 3ZOBA 1U0JA 2WBMA 3EPZA 3W6KB 3GFIA 2VB6A 4X0GA 1ONVA 5E1WA 3FK7A 2KPMA 4XICA 5FROA 4QPOA 4IX7A 5AONA 4B09A 4EM2A 1A6IA 1IXSB 4QIWN 5CYVA 1HA8A 2OV7A 1R58A 4KFCA 3K7AJ 3HHHA 2R7QA 4BUPA 3OWTA 3SYTA 1YYVA 2XF5A 2DA6A 4HDVA 2DMUA 1YITI 3LFKA 2O7OA 2ACJA 2IVMA 5HOOA 2P7CB 1UG2A 2L02A 2OCCH 5E20A 5L3DA 2V7FA 4CYDA 4A5NA 4UUSB 1LE8B 2CV2A 3C7JA 3LSHA 3NAUA 1EA3A 1OCRH 1HF0A 4IO9F 2XRLA 1FP1D 2UXNA 5LFAA 3CF5F 2DFFA 1B9NA 1OKRA 5D8LB 1J0RA 1RETA 3K9TA 5GTIC 1SFUA 1EF4A 4OAZA 1O57A 2PEXA 4PJNA 3UKGA 4D5CA 1T56A 4EM1A 1FYLA 4K2EA 3H5RA 3LFUA 4XL9A 1GVJA 2XB5A 3BCBA 2XV4S 4PZJA 2PLYA 2A6HF 1FOXA 1IDYA 3N05A 3F22A 2GIZA 3AG2H 3BPXA 4ZTFA 3R6SA 5TISC 1ZARA 2DFEA 3VYTB 2HDCA 2A68F 1W7PB 3HOZJ 1CQTA 2O6GE 2J5PA 3KLNA 3I53A 2JA5J 3T5XA 2XGCA 3OYFA 1KONA 2XKOA 2GA1A 3E3VA 4IOAF 2HOAA 2M34A 1HBXG 1T6SA 3MKZA 4XNFA 2DFIA 2Q2EB 5J1UA 3ISPA 3P9IA 5EGOB 1R6RA 1MW7A 1Z91A 4V19K 3A1YA 5IP9J 2RNJA 2LYCA 3CCRI 1IAWA 4D7MA 2DMNA 1X19A 3DU5A 1JXSA 4BHBA 3KEQA 2CFXA 2KMUA 1AU7A 3GFLA 4UHTA 1EJ9A 3DBHB 1ZGWA 4A3BJ 2PMZA 4MGRA 2Y30A 3MKWB 5J4YA 4EVIA 2E1NA 4L0ZB 1XDSA 1RUNA 2WAQA 2OQRA 5E8GA 1B72B 2DOFA 3L2RA 3WG7H 3F3XA 1SFEA 3CDHA 1MMGA 4U88A 3E0JB 2LDUA 2X1CA 5AIQA 4L9JA 5IP7J 1ULYA 2F5EA 4XORA 1D0YA 4XKWA 3ZQIA 1TQMA 2ETHA 2B7EA 3JRHA 1KYWA 3CUQC 3GXOA 1HQCA 5J8CA 2FSWA 1JJ6C 4BHCA 3OV8A 5FFXA 3OSFA 3CCSI 1JKRC 3WTVC 3WU0A 2R7VA 2CQXA 2A61A 1W7PA 3QYBA 4JK1X 3ZCOA 5BMZA 3E5QA 4L0YB 2IT0A 2F5DA 4WXCA 1FPQA 5DV5A 2AXLA 3V7RA 4H0EA 2ME0A 3WODF 2Y75A 2ZXHA 3GTMJ 1FNNA 4JBAA 3ERMA 3GMEA 3WU1B 5FKKA 4XMYA 2IRFG 3QAHA 4XBFA 1O4XA 4EV0A 3LSGA 4UV9A 1G6NA 1VQKI 4AM3A 5F6FA 2NNNA 2P0WA 4MQVA 3HOUJ 2WTEA 3S2DJ 5JVTA 1WH7A 2CRGA 4XKBA 2O3FA 2KDZA 5DD8A 1N75A 1K78A 4KISA 3V8JA 4TV7A 2M7BA 1V5FA 3Q0UA 2ELKA 2PJPA 2M4KA 3CCYA 4XN3A 2HEOA 1XC5A 3BG7A 3CC2I 1MBKA 3BZKA 4M3FA 1JUPA 3H3ZA 3HB9A 1DU6A 3V4GA 1MH4A 1TWFJ 2L3DA 2NVXJ 1D3YA 1P7JA 1B1BA 2E35A 3PL8A 1B72A 2CQKA 1T8IA 1QZYA 2WAQN 4XSZF 3FMRA 1DU0A 2KHMA 5IP6A 5HLHA 3GYHX 1X4OA 3K2ZA 1F36A 3EETA 2K9SA 1W1WE 4WF2A 1P2FA 2BW3B 4HAMA 3H35A 4HEA2 5FJ8J 3CDIA 1YS7A 1YS6A 2L5QA 4AYBA 1WVRA 2VL8A 2ECCA 4DNCA 1SEUA 2DA2A 3KYDB 3OYEA 1WQ2A 3F8CA 4A3GJ 5FRMA 1Y39A 4Y4RA 2IXSA 3CTAA 3OYGA 3BP8A 2Z1DA 4KUMA 2MH2A 4GYGA 5EEHA 2EFPA 1MIJA 5K7HA 1JKOC 3TDUC 5LEJA 1BIBA 1T0FA 2QCOA 4XLNF 4BQOA 1Q1HA 4CYCA 3CJQB 4U0VA 3MEXA 2B63J 3GFJA 3S1NJ 3I56I 4P9UA 4J00A 3NWTA 3Q9VA 3CC4I 2LK2A 3DXJF 2HZDA 1I6XA 3B6CA 4LFUA 2LY9A 3IRRA 1HDPA 2ECBA 2VJ5A 4FX4A 4KMFA 3F72A 5D8KB 1VQNI 2ZXJA 2X85A 3BLYA 3CCMI 2HDWA 3GCMA 2R0QC 1X2MA 2KL4A 3B73A 3FMQA 2DBBA 2GWRA 3U2RA 1I1GA 1XSVA 3OIPA 4QLCU 3JTGA 3SZPA 4EJOA 2O8KA 1XCVA 2H8WA 2W48A 4KMUX 2O9LA 2KJCA 1RR7A 3A0HC 3BJ6A 2Q8KA 2JSCA 4I7HA 2E2JJ 1I3QJ 1WH5A 3M1CA 1R1UA 3BR1A 1UMQA 3DFGA 4ENKA 3H92A 2LF8A 2NVQJ 4IF4A 4L18B 1PP8F 1G8XA 1LB2A 1Q1VA 3OSGA 1YJ9I 4RLFA 1CF7A 1PDNC 2LH9A 4B1RA 1QQIA 4I09A 4G94A 4AWXB 2Y2ZA 3VPRA 3RZDJ 3KCCA 4L9VA 4PK4A 2R7XA 2M4GA 2DI3A 4NB5A 5BNGA 1WJAA 1QVTA 1T08B 1XN7A 2OQGA 1X3UA 3VFZA 2YSRA 4WCGA 3K69A 1WRJA 5J1YA 4EJUA 2O61A 3LSMA 2GXGA 1OYIA 2GQQA 5C44J 3V7SA 1RESA 2HR3A 4RGXA 5D4RA 4RLQA 1S3JA 4HX7A 1AWCA 1MH3A 1M1EB 1OFCX 2MG4A 1KU3A 1X1CA 1ETXA 1XGOA 1OCPA 2E7XA 2E60A 2JPBA 2XGXA 3O8HA 1SD7A 3QQAA 3SQNA 4F3QA 5JR3A 3H9GA 2VODA 3HKZA 1Z3XA 5FLVA 2BHYA 4QTRA 4CCMA 3HOYJ 2ESNA 2E7WA 1U9OA 2JTVA 2DTZA 2HKXA 2HTJA 4YG2F 3OYAA 3TO6A 3CJRB 2K3PA 5DUIA 1WGXA 5EYRA 2A5WA 3CMYA 4A12A 2EFOA 1TQPA 4HNUA 3FM5A 2R5ZA 2FD5A 3C2HA 2XGDA 3LWFA 1LQ1A 3VYRB 4XOPA 2H09A 1IXCA 3CCUI 2NVUB 1ZLKA 1FLIA 5BOXA 5H6QA 2QF7A 3G1MA 4C2MJ 4DZJA 4FX0A 1XSDA 2ESHA 2QUFA 2VBZA 1OCOH 3KFWX 1D1BA 4E7KA 3GTLJ 4KNYA 3GFMA 2JWTA 3GX4X 1E3PA 2MFZA 5F27A 2AQFA 3CP8A 4LG0B 4WWCA 1VQOI 3FM3A 4B44A 4CUGA 4Z6YA 3R0JA 1Y8RB 1NG7A 2QSHX 4GRIA 1BOAA 2EJRA 4PJMA 4AVPA 2V1DA 3KEOA 2MGQA 1SFKA 4BBRJ 2HYJA 2Z2SB 4Z2YA 2IS2A 5F0CA 1GV2A 1BC8C 1AKHB 3A0BC 2VIXA 2ZMEC 3FBIB 1ZK8A 5J4VA 2OF7A 5B5EC 4ANJA 1XPXA 3K4BA 3MZHA 3RQ4A 2M0MA 4EJTA 4E7IA 2NS7A 3ECHA 1UCRA 1XG1A 4O3MA 2CW8A 1I1SA 3LQRA 3ABLH 3J7AY 2XAHA 4UVBA 4A0YA 5IOZA 2DMQA 3GLXA 5CVIA 3JRDA 2Z99A 3SZTA 2A69F 4QSHA 2XC7A 4AC0A 4HX8A 1EH8A 3PUFA 3KP5A 3S1RJ 2VKVA 3Q3SA 3PNTA 2F2EA 5DCMB 3BOQA 3VEPA 2HTSA 4A3MJ 4M73A 4BE1A 3GLLA 2GOMA 2HQRA 1BM9A 1YHQI 2Y0MA 3MKYB 1PJRA 4XN0A 3BWGA 3KP3A 2OAZA 3CZ6A 2VE8A 2GM4A 1GV5A 1ETWA 1E2XA 4HSRA 2DQLA 1JUSA 5J40A 3HOXJ 1OPCA 1S6LA 1Y1WJ 2VXZA 3G6EI 4LG0A 2XKPA 1DGWY 5L3GA 1VZ0A 2M30A 1FZPB 1TW2A 2RQPA 4WK8F 2CFOA 1IN5A 3ZMUA 4IVNA 1MDMB 1D1CA 3DEEA 3BG5A 1YOVB 2E1OA 3CF2A 1IN7A 5L3CA 1KQ8A 1MMAA 3TL4X 1B9MA 3K0LA 3GTKJ 1T98A 2LBFB 1XMXA 2E34A 5H20A 4E70A 1AKHA 2QENA 4G7OF 5CQEA 3PNYA 4ASNA 2XAFA 1ZRDA 2GOXB 4AIJA 1X3ZB 4N9IA 2AQEA 3PJRA 1PUFB 2EV6A 2IA0A 3DPLC 5DM7F 2D45A 2HQAA 5ICFA 1MKMA 1VQ6I 3JTHA 5HVQC 3AL0C 1D0XA 4AIHA 1VNDA 4L5JA 3TBIA 1R5ID 5CQGA 2BBYA 1W0UA 2IPQX 1JGGA 3BC8A 2VQLA 3TOBA 1XDUA 2K9MA 1WJ5A 3MN2A 4NHJA 3EYIA 1KA8A 1UJ8A 1ZGJA 1LJ9A 5B3SH 1GDTA 2PBIA 1ON2A 4PSWA 2KDOA 1KU7A 4F93B 2VJIA 1YIOA 3K6GA 2BXYA 2JUCA 2LR8A 4M72A 3F21A 1YJNI 4LJZF 3CUQA 1V5GA 1TLHB 4G8XA 2JMWA 1IW7F 4MO7A 2DODA 2RVCA 2KIUA 4XSXF 1S7OA 3IHUA 1K79A 1FT9A 2ZSIB 1HDDC 4HF2A 2P5VA 4AD9A 3K70D 3LQQA 1U5TB 2E1MB 2P6SA 2Y69H 4MTEA 2R92J 2B0LA 4WXHA 5F04A 4ESJA 2DT7B 4XLFA 4HF1A 4M6VA 3TOAA 1LEAA 2JA2A 2BY1A 2FF4A 3DPTA 4OMYA 3J7AO 4ZDOA 2M5WA 3U1DA 2LLKA 2OJED 1SMTA 3BPVA 5FKOA 5EG0B 3BJOA 5M5WJ 4PDKA 4HV6A 2HWVA 3P7NA 2IGMA 3FF5A 1ITYA 4HOBA 3I55I 5TJJA 2NRAC 4L9NA 2E1CA 2Z3YA 3KEYA 4HG2A 4ESBA 2V79A 3BDDA 4HNTA 3BG3A 4LLNA 4CH7A 2PN6A 1BN5A 1GT0C 4BJ6C 4GDFA 4NC6A 2M1BA 4RAFA 2KZGA 2XAGA 3HG9A 1LUJB 4FT8A 4D5FA 3ZQCA 4JP0A 1E0EA 1NH3A 4M9SA 2FOKA 5IYBJ 4LB6B 3TDZC 1MNDA 2A6TA 3U9GA 1RIOH 2LTPA 1GXPA 1FYKA 2FBKA 2VUMJ 3ABTA 3C2BA 5F08A 3E6MA 2OBPA 2F5CA 5D5UB 3HTSB 2R7SA 1DUXC 2OC6A 2ZFWA 4IKFA 1BR1A 1FBUA 2VPRA 5FD6A 2FNPA 2M0CA 3L09A 4G6DA 1XMKA 2CG4A 2OPTA 2JRMA 2IA2A 5IOYA 3RPQA 3H36A 1V5EA 2XUBA 1I5ZA 4IPAA 3J7YJ 3K70C 2QZ8A 4JQFA 1X1DA 1RZ4A 4MIMA 3W2VA 2EH3A 3HOSA 1O7FA 3BZCA 3KZZA 5HDNA 1K7AA 4IEJA 1IJWC 1FY7A 4OWRB 1WI9A 1R36A 5LHIA 4IHWA 1D8KA 2HFHA 1IN8A 3QOEA 4B3XA 2FUG2 2H6BA 2WA0A 3HSFA 2EFNA 4UV8A 2UUZA 4NC7A 4A0XA 4JOMA 1GVDA 2X9DA 5L3EA 4RGUA 1RR8C 3EUAA 3KLOA 3CJTB 3V8LA 3G2BA 2M8EA 5D5XB 1SMYF 4CICA 2V26A 3OY9A 1XGSA 1YQAA 3L7WA 5KVRA 2HI3A 2L4AA 4LMYA 3VSLA 4I98B 1IV8A 3LA3A 4RS8A 3IKTA 3KP2A 1DPRA 4DQ2A 3KPHA 5EZGA 2A05A 5BPDA 2X6YA 4GGGA 2DN0A 2H6CA 2ID6A 2CV0A 3RKWA 3CMAI 1MBJA 4RAYA 4BE2A 4ZYGA 3F23A 4R8HA 5F0HA 3HRUA 1KZHA 3EUHC 4C3IJ 3EDPA 5ERIA 3F6OA 1AA7A 4XRFA 4CGZA 3H5NA 4M9ZA 4YIIA 4BH9A 4O6JA 4XKVA 4UY8I 4FISA 3MCZA 1FTTA 2XF6A 4LIUA 5GTHC 2NOGA 4HQEA 1FIPA 4MNUA 4RB2C 1O3QA 2EQRA 4M71A 4F55A 5JLWA 2W25A 3JAMK 1UFMA 2PX9A 1E3OC 4XK4A 2XPUA 1HW5A 4UNOA 2K85A 2LMDA 4E7HA 2IGOA 2CQNA 3CCVI 4KIBA 4C3JJ 5FRNA 1SD4A 3LA7A 4CA0A 2FXAA 2X1EA 3BTJA 4A3LJ 1G3SA 2KFDA 2ADUA 4U0YA 1MNMC 1ZH5A 2NVTJ 2LP0A 4IL6C 5K5RA 3FK6A 4ZTJA 4Y17A 2BY0A 2BHZA 4B8XA 4XM3A 3A4CA 3QP5A 4KT6A 1VQ5I 2YU9J 4LD5A 3FXLA 5GAEJ 3FKJA 3KP6A 4D9JA 2DLLA 2HXOA 3ZMVA 3BY6A 2F5VA 3FXKA 2XSDC 5E3OA 1H88C 1Z7LA 2IAIA 2YR2A 3PFYA 1J5YA 1H0MA 4A3CJ 3G3ZA 2LKPA 2XSJC 3GVAA 1WSUA 4YEJA 2JA8J 1LFPA 1USTA 1L0OC 3BZ6A 2BEOA 1K78B 3RJPA 3QPTA 2OA4A 4P1WA 3GO5A 3G71I 2DA4A 5C3EJ 3RKQA 2NVYJ 5GAGJ 4M6YA 4Y15A 3FIWA 1I50J 1JKQC 3IUOA 2RV8A 3JR9A 4BDYA 3IH2A 3CLQA 4XLCA 1X1BA 3FISA 1B4AA 5FKNA 2LVSA 2UZKA 3KYLA 3J81K 2L7KA 4ZDPA 1HOMA 4CCOA 1UHSA 3ZQ7A 3KETA 4KN4X 5CVRA 3OYIA 3PO3J 3HRMA 2ZB9A 5FLMJ 1MNEA 4L5EA 3ZQHA 2ZMEA 3K10A 2HVSA 3RTRA 2LF7A 4ZC3A 2IW5A 2FU4A 1WCMJ 2M8GX 2BV6A 4RAGA 1N25A 3RKXA 4ENNA 2VPLA 2YUSA 2CJJA 1F4KA 1FP2A 3JRIA 3S15J 1SAXA 3BJAA 1IF1A 4ENMA 5FO5A 4BE0A 2MD0A 5EF6A 3LSTA 1MMDA 3OYMA 2PJRA 3F8BA 4CYCB 5DTDA 4CSWA 4H4KC 1A35A 2V6CA 3RCOA 3HPGA 5HDGA 4BHPA 1U78A 3N97A 5IT3A 2OD5A 3K4LA 4F7ZA 2Z9OA 4XQFA 1BI2A 1OMIA 4CHUA 3DPUA 4M6XA 3S14J 2B9SA 4C3HJ 4EM0B 3JRGA 2BYVE 1TBXA 1P4AA 5CJ9A 2FQ4A 3JCUC 4IQ4A 4A3IJ 1BJAA 2E71A 3KP4A 3MQ0A 2QBYA 1S8NA 2KRCA 1JHFA 1LDDA 3ABMH 4ABZA 1LNWA 5HNFA 1QVUA 4C9YA 3LOCA 4PSXA 2KRHA 2DA5A 2L54A 4XR6A 1YIJI 2MYSA 1EKEA 2W57A 2PMZN 4DOZA 3O6BB 4OIOF 4UVCA 3OL4A 2P81A 4RGSA 1O7LA 3ULQB 2ZJPF 3HBLA 4II3A 5H2FC 1C0WA 2MD5A 2KISA 2X6OA 3MZYA 2W7NA 2LSOA 3MD2A 3PFIA 1Z67A 2DAOA 5TGTA 1RI7A 3I5UA 3FDYA 1X1PA 1RNLA 5BQTA 4HBLA 1CF7B 4Y7NJ 2A5YB 5E17F 1B6AA 3K1MA 3WTYC 5M5YJ 4U7BA 2FEZA 2CO5A 2MBFA 3JAMZ 2ZFUA 4IXAA 4YFXF 5L3BA 4A3FJ 1H8AC 4FE7A 3S93A 3ZMTA 3QYEA 1R49A 3ZPLA 3CCLI 1NK3P 1LVKA 5FKLA 4M9XA 4B48A 3H0GJ 3JRFA 3L2VA 4DBRA 1QNTA 5BPIA 4EGYA 1YFHA 5K5OA 1Y0NA 3P5JA 1G3WA 3VSKA 1NK2P 2FX0A 3R60A 1FX7A 3U1KA 3R61A 5IPAA 3HOWJ 3HM5A 4DJAA 1XTAA 4QWQA 1JI8A 1NTCA 1JT6A 3P9KA 4HZFA 5E18F 2W00A 1LFUP 4ZYDA 3DTEA 2FBIA 3BG6A 4V2GA 2AHQA 1F1ZA 3W3CA 1QZZA 1UHMA 1YW7A 1BI3A 2OU2A 4E7JA 3HJEA 4KN7X 3J80K 1XD7A 4YELA 4PJLA 3L2WA 2R5ZB 4IRHA 4IZZA 2G7UA 3QPLA 1ZG5A 4HF0A 1HC8A 2M7AA 3GF2A 2DOAA 3DU6A 1D5YA 4BEHB 5HODA 2DA1A 1T39A 2YX7A 3HDDA 2DJIA 3IKVA 3B6AA 5HLIA 1G3YA 2ZBKA 5LRSA 3OOUA 4NC8A 2X6XA 1OCTC 1S7EA 3OYKA 1MMNA 3I3LA 2K9NA 4CDGA 2W82A 4AIDA 1YE9A 4HLXA 4HLYA 2W85A 1MGTA 1WZ2A 1JUMA 4Y52J 3J81Z 2R7OA 3ZMDA 5L3FA 4N4OB 4NBQA 1BA5A 4AYBN 1TQIA 1XMAA 3K1NA 4A3DJ 1Z3YA 2HKOA 1YRNA 3W6JB 1ZG1A 5C4JJ 2HS5A 2WV1A 2WADA 1DDNA 3FXMA 1KQ9A 3ROUA 5EEGA 3F8NA 5K7ZA 4DYRA 3IWFA 1D0ZA 2Z33A 2BY3A 3QP6A 2MLGA 1O3TA 3HZJA 3SFIA 2K5CA 1WI3A 2VC1A 4IHVA 1MBFA 2QYOA 3GTQJ 2JSPA 4F92B 4HNVA 5LRRA 3ZRGA 2LC2A 3ASNH 3DLAA 1K6YA 4KICA 1U8RA 3F6VA 2HGCA 5ICGA 4F52A 4GO1A 2CQQA 2JA6J 2CSOA 2R5YB 3MZ8A 4ZJZA 5LGNA 1MJ9A 2IBDA 2R93J 2ELJA 1ENHA 3LMMA 5KK1A 5ICEA 2R7ZJ 2D2WA 2G7HA 3WTZA 3DKXA 4BEHA 2F4OB 4JX4A 2TDXA 5D6FA 1W7PD 1V4RA 4G7HF 2J5OA 1Z05A 1TL8A 1UHWA 4YIRX 1F5TA 1RUOA 4LGWA 2ELHA 1XSXA 4M3GA 3LSPA 2E2HJ 5CKTA 3FHZA 1F9NA 1IN6A 1FSEA 4M3EA 4P55A 2P4WA 4G12A 1BOBA 3ECOA 5LHHA 5E8IA 2Z5UA 3TGNA 2KP6A 4MQ9F 3L00A 3DKYA 3BQYA 3PO2J 1SD6A 3D1NI 3RPUD 5DCFA 3TO9A 2CUJA 2F4IA 5HS7A 3COAC 1IV6A 4Q4ZF 3EUHA 1S9HA 1X1AA 5F1JA 1OYWA 3K4JA 4S04A 1SANA 3MVPA 3AKZA 4Q48A 5IT9K 3SHFA 3G1OA 2ZJ2A 3BG9A 2QQAA 1W5SA 3HKZN 3BT9A 1APLC 5CVVA 2RGVA 1FIAA 2VT2A 1ETKA 1FTZA 2OZ6A 4NDLA 2CWEA 4PFOA 3T8RA 4BJTA 1ETVA 2CUFA 3HIFA 4BXUA 3WHBA 1HLVA 4PJJA 5A2QK 2QGUA 2CS3A 2QQ8A 2JA7J 5JI6A 2NNYA 2R5YA 3K4NA 3ZQLA 3JW4A 1L3LA 1FOYA 5D5WB 2DFHA 3CUQB 1ZTRA 4I02A 1BL0A 2L9RA 3HRSA 3C2GA 3WTTC 5DDGA 4UB8C 2XDVA 5FKMA 5KCMA 3UR3C 1MBGA 3F8FA 1BR4A 3SEQA 4C30A 3LA2A 4IQJA 3IC7A 3HYIA 3J80Z 3E97A 4IHYA 1KU2A 2DQRA 3DBRB 4D0PA 3OR1C 3OS2A 3WTWC 2DPUA 2RC4A 4MEXF 1PUEE 2NOJB 5D5VB 2W24A 2E5ZA 3PM1A 1VTNC 3DEUA 2DTRA 2E5NA 1IUYA 4CCLA 3DTKA 3G4SI 1Y56A 1PYVA 2XPVA 4UUVA 1MMSA 1Z9CA 3L2CA 1W36D 1VQ9I 3KP7A 4RB3C 1F43A 1XGMA 3GZ5A 5LLQA 2CH0A 2VKEA 2BE5F 5EZHA 2CV1A 2VI6A 4V2FA 1ZRFA 1WJCA 5HS8A 2EINH 3OOPA 3Q0WA 2W4SA 3O8GA 2CMPA 5FFZA 3CMMA 1JJ8C 4A3JJ 3F0CA 2DJNA 3E5UA 4UXNA 2QM3A 3S3NA 1S7AA 3LSRA 3FX3A 3AG4H 3HPHA 2R7WA 2N8GA 1S29A 1JTXA 1RPWA 4BL0B 1QPMA 3ZN1A 2R4GA 2NS0A 2K02A 3MAJA 4N0BA 4R79A 1AOYA 1Y8QB 2ZXWH 1MSFC 4XOTA 1IN4A 1KGSA 3ABUA 1HKQA 3BR6A 2E19A 1H9GA 1O3SA 1N78A 1D1AA 2RN7A 4EATA 5EDNA 3HXLA 3VYUB 1B59A 3P9CA 2YPRA 3B02A 2OTLI 1Y6IA 4UVAA 3DTIA 2OUMA 2EZKA 2RREA 5HNHA 1OR7C 1BW6A 1WPKA 2F4MB 3HUGA 3H1CA 2DT6A 2R3SA 5BS6A 3DBLB 3TP3A 3SDGA 1OJLA 2CW7A 1X58A 2HYFA 3RDIA 4LOCA 2VJJA 4OAYA 2C6YA 2P6TA 2VN2A 3LSJA 4Q47A 2CYYA 1SVOA 3WGIA 1TT0A 2ZJRF 5EJCA 2Y0SA 4BKXA 3C18A 4IHSA 5B1AH 5E3MA 1VFCA 2IEKA 2L0KA 2QVOA 4AIKA 1LFBA 1Z6RA 3EQLF 2DT5A 1OLTA 3A01A 1ZQ3P 3RZOJ 3PIPF 2Z16A 3QODA 2RDPA 2WC2A 2EZLA 1GHCA 1K6OA 2O03A 3G73A 2ZCWA 2G9WA 5E3LA 2EILH 2X0LA 3A02A 1EV7A 4ON0A 1SVMA 3M07A 1BW5A 5DM6F 1MJBA 3NRVA 3PUBA 1KQ0A 3VB2A 1I39A 1YG2A 3PSIA 5LEKA 4U7DA 4ETSA 2PMHA 2XROA 2XRNA 1T2KA 3OYHA 2L9SA 1WFXA 1E3HA 2OCEA 1XB4A 4RGRA 4CZCA 3JRCA 1IZ1A 4IHXA 1LPQA 4PGGA 4P96A 4XLAA 4C2TA 2KKOA 4L5IA 3M3YJ 3RIRA 2K9LA 1R1VA 5IT9Z 3S32A 4UB6C 3K2AA 2K4BA 4IRIA 2JPCA 2QSGX 2CW0F 3HGYA 3FMSA 3R0AA 3N4MA 3MMYB 2DPDA 2HOTA 4A6DA 1T38A 3I64A 5DYMA 2PG4A 5HDKA 3DV8A 1ZAOA 1PP7U 5A2QZ 4G9YA 3WTSC 2K3FA 2WB1A 1QPIA 4OIRF 1GLNA 1OISA 4IRGA 4BJ5C 4DBQA 1P4XA 2R7UA 3OR2C 1ZN2A 5JHFA 3OS0A 3OYDA 1WJDA 2XB0X 4YRVA 3IL2A 4EMSA 2WAEA 2OTJI 3RKYA 2QWWA 3OYLA 1ZR2A 2L7ZA 1ZGAA 5AIPA 2DA3A 3JRBA 2M45A 4A6EA 2PMUA 4PFPA 1A04A 3FXOA 4IJAA 4OIPF 1IRGA 4ESFA 3RSNA 3C3WA 2NAZA 1ORKA 3I0TA 1TNTA 2K86A 5GPCA 4E4HA 1HKSA 1RKTA 3H9QA 4RM3A 4E7SA 1DP7P 1G4DA 4HRIA 3CCEI 4LB5A 1J7KA 3NQOA 1W4MA 2DMTA 3WU2C 1IUFA 2X4HA 1HCRA 3K4CA 3I4MJ 2PI0A 3C1DA 3ASOH 5JVGF 1QU3A 4RMNA 1BC7C 3I59B 2MW8A 2LNBA 2CUZA 2CU7A 4P5OA 2MH9A 3CC7I 4BU2A 2GXAA 4HV5A 3PNVA 3E7LA 3MWMA 2UWMA 4KT5C 3FXUA 3ZGKA 2D1VA 2VKHA 1POGA 4D1QA 4GFBA 3S8PA 5DEQA 2LREA 1DQUA 4DGWB 3KE2A 5J47A 2L9NA 2DK8A 3ZQQA 1BBYA 1QGPA 2GIVA 2I8DA 2BZTA 4L9TA 5J6XA 5KNLA 4A3KJ 2HPMA 5IY5H 2GXBA 3GTGJ 2RAEA 1JGSA 2H94A 2MSYA 4A5MA 4CCNA 4LLLA 3H3VK 1UAAA 4ZYAA 2HQ5A 4II2A 1UG0A 4LIVA 2WV0A 3V7CA 4NQWB 2G0EA
chains in the Genus database with same CATH topology
1FEXA 2P81A 3LNQA 3HBLA 2QF7A 1Z0XA 3G1MA 2M9HA 4C2MJ 2EBIA 4DZJA 2X6OA 1K83J 1T33A 2WB1N 2XPWA 2D5VA 1DU6A 2TCTA 3GTLJ 1B8IA 1JKPC 2JWTA 3HOVJ 4Y7NJ 5F27A 2JN6A 1TWAJ 2LFBA 5M5YJ 3QPSA 2DA7A 1I6HJ 2LKXA 5M5XJ 4A3FJ 1H8AC 1BJZA 2LD5A 4FE7A 3IH3A 1G2HA 1ETQA 5IYDJ 2H1KA 2MGQA 4JX5A 4BBRJ 2HYJA 1NK3P 1JTYA 5F0CA 3SJMA 5FKLA 3BTIA 1GV2A 3JRFA 3I4NJ 4J19A 1AKHB 5F0FA 1ZK8A 2OF7A 1NK2P 2FX0A 3TW7A 5IPAA 3HOWJ 3BR2A 3HM5A 2COBA 1NTCA 2NS7A 3S17J 1JT6A 1XG1A 1IC8A 1LFUP 4V2GA 3HGGA 4B4CA 2AHQA 1SFOJ 5IOZA 1PUFA 2X48A 2DMQA 4MFDA 3JRDA 3S2HJ 2HOSA 4QSHA 4AC0A 2R5ZB 1QRYA 3S1RJ 3QPLA 2VKVA 3Q3SA 1D5YA 5HODA 2DA1A 4A3MJ 2GBYA 4DW6A 5K7FA 2I10A 3HDDA 5J1RA 4I6ZA 1IG7A 3B6AA 2M2EA 1B8IB 1XS9A 2EZHA 2Y9ZA 3OOUA 2GM4A 4A93J 1GV5A 1OCTC 1ETWA 1S7EA 1JUSA 3HOXJ 4XRSA 2K9NA 1Y1WJ 4UUSA 1LE8A 4A69C 3G1LA 2Y0SN 3DCFA 3S1QJ 1JUMA 4Y52J 5J3LA 1GUUA 2FJ1A 1RKWA 1BA5A 4AYBN 3GTOJ 3IH4A 1ZKGA 4MFEA 4A3DJ 1YRNA 5C4JJ 2AO9A 3BG5A 2WV1A 2E1OA 4FTHA 4X6AJ 3CQZJ 5K7ZA 3GTKJ 4DYRA 5EG0A 2XGEA 1AKHA 3TP0A 4XIDA 3TW6A 2L7MP 2H8RA 4BBSJ 3SFIA 2CUEA 1ETYA 1WI3A 3BTCA 4IHVA 1MBFA 2K9QA 3ZQGA 1PUFB 3GTQJ 1ZR4A 3ZOBA 4HNVA 1VNDA 1W0UA 1JGGA 4BXXJ 2CQQA 3FK7A 4XICA 2JA6J 5EGOA 2R5YB 1A6IA 3MN2A 4QIWN 2IBDA 2R93J 1GDTA 5GP9A 1ENHA 3K7AJ 2R7ZJ 4DZPA 2LR8A 1U9NA 2DA6A 2DMUA 4JX4A 2O7OA 4DYQA 1UG2A 2JMWA 4MO7A 5JLXA 3FKIJ 2GLOA 4UUSB 4M3GA 1LE8B 1HDDC 3NAUA 3LSPA 1HF0A 3BTLA 2R92J 2XRLA 2E2HJ 5F04A 1RETA 1EF4A 1VI0A 4M6VA 4M3EA 3UKGA 4W97A 4D5CA 1T56A 4G12A 1R9TJ 4JYKA 1YRNB 2Y9YA 4M3BA 2XB5A 2LLKA 3BQYA 3PO2J 3D1NI 5M5WJ 5FKOA 5EG0B 4FCYA 1IDYA 1TWHJ 1IV6A 1ITYA 5F1JA 3GTPJ 3HOZJ 1SANA 1CQTA 3MVPA 2JA5J 2XGCA 3HEFA 3BG3A 1Y1VJ 3G1OA 3BG9A 3ZQFA 1GT0C 2HOAA 3HKZN 2M34A 3JREA 3BT9A 1APLC 1FIAA 3S16J 1ETKA 1FTZA 5J1UA 4NDLA 1ETVA 2CUFA 4D5FA 4JP0A 5EGOB 3ZQCA 3WHBA 1HLVA 2L7FP 5IYBJ 2LTPA 3W6VA 5GPAA 5IP9J 2VUMJ 3C2BA 5F08A 4D7MA 2DMNA 2JA7J 5C4XJ 2R5YA 3BR3A 3CDLA 3ZQLA 4RDUA 2HDDA 5DS9A 2YS9A 1ZTRA 3IV5A 1BL0A 2L9RA 1AU7A 2VPRA 2M0CA 5FKMA 3BR0A 1IGNA 5IOYA 2OPTA 1MBGA 1ZGWA 4D7NA 4A3BJ 2Y30A 2K40A 4IHYA 4MIMA 2EH3A 3MKLA 1B72B 4IEJA 1IJWC 4IHWA 4EEFG 5IP7J 3PM1A 4BY7J 1MBHA 3ZQIA 2XPVA 2NS8A 2KT0A 3JRHA 3M4OJ 1TC3C 1GVDA 2X9DA 1JJ6C 1F43A 4S0HB 1JT0A 3OSFA 1JKRC 2VKEA 5EZHA 2CQXA 2VI6A 4V2FA 3A03A 3BQZA 2HI3A 2TRTA 4I76A 5IYCJ 3Q0WA 3O8GA 2ME0A 5EZGA 3GTMJ 1JJ8C 4A3JJ 3F0CA 2DJNA 2DN0A 2ID6A 4XRMA 5FKKA 3LSRA 1MBJA 4FE4A 1O4XA 2N8GA 3LSGA 4DYCA 1JTXA 5F0HA 3S1MJ 1RPWA 4C3IJ 2Y31A 2JK3A 3HOUJ 3S2DJ 1WH7A 2CRGA 1MSFC 2KDZA 4FISA 1FTTA 3BR6A 2E19A 2NOGA 1FIPA 2EQRA 3Q0UA 5JLWA 2ELKA 5EDNA 3CCYA 1XC5A 1U8BA 1MBKA 4M3FA 4XK4A 1JUPA 2XPUA 3HB9A 3WHCA 5E3NA 1E3OC 4A3EJ 1MH4A 1TWFJ 4XRSG 2NVXJ 1P7JA 2EZKA 1BW6A 1WPKA 1B72A 2WAQN 1DU0A 3TP3A 3SDGA 1OJLA 5IP6A 1X58A 4C3JJ 4LOCA 4MLOA 3LSJA 1F36A 2K9SA 3GTJJ 4BKXA 3BTJA 4A3LJ 1VFCA 2IEKA 2L0KA 5FJ8J 1MNMC 1LFBA 2NVTJ 1IRZA 2LP0A 1MBEA 3A01A 2ECCA 1ZQ3P 9ANTA 3FK6A 2DA2A 3RQIA 3RZOJ 4BY1J 2EZLA 4A3GJ 4JX6A 4W1UA 2YU9J 5E3LA 3A02A 1JKOC 5K7HA 3DEWA 2HXOA 1BW5A 2QCOA 1A5JA 2XSDC 4CYCA 5E3OA 1H88C 3JRAA 2IAIA 4A3CJ 2B63J 3S1NJ 3JRCA 2LK2A 4IHXA 2JA8J 2EZIA 3B6CA 2LY9A 1HDPA 2ECBA 3M3YJ 1W0TA 3RKQA 2DA4A 1TWCJ 5C3EJ 2NVYJ 3K2AA 2R0QC 1TWGJ 1X2MA 3FIWA 1I50J 3HGYA 1JKQC 3GBGA 3JR9A 1X2NA 3IH2A 3FISA 2HOTA 2O8KA 5FKNA 2LVSA 2W48A 4UUTA 2O9LA 4AUXA 1HOMA 1UHSA 1RR7A 1QPIA 2HXIA 3PO3J 2E2JJ 1I3QJ 1WH5A 2ZB9A 5FLMJ 3BR1A 1UMQA 2XB0X 4L5EA 3ZQHA 1ZR2A 5M3FJ 2ID3A 2L7ZA 2ME6A 2NVQJ 2DA3A 1WCMJ 2M8GX 3JRBA 3A01B 1Q1VA 3OSGA 3OIOA 4B1RA 2YUSA 2CJJA 1ORKA 5GPCA 2Y2ZA 1RKTA 2DMPA 3VPRA 3JRIA 3RZDJ 3S15J 5BNGA 1QVTA 3TEDA 2DMTA 1IUFA 5EF6A 1HCRA 1VF9A 5J1YA 3I4MJ 1P7IA 5DTDA 4CYCB 5C44J 1RESA 1ETOA 2MW8A 1U78A 1MH3A 1OFCX 2MG4A 3H0GJ 3NARA 1ETXA 2CU7A 1OCPA 3O8HA 3QQAA 5E3MA 1AHDP 1FJLA 3BR5A 1H89C 4B3AA 1IDZA 3E7LA 3Q0VA 5FLVA 3S14J 4X1EA 4C3HJ 3JRGA 4QTRA 1POGA 4GFBA 2FQ4A 3HOYJ 5EEAA 4A3IJ 1K61A 4RBOA 1U9OA 2DTZA 1MSEC 4ABZA 4A3KJ 1QVUA 3GTGJ 3LOCA 2JJ7A 1Z77A 2RAEA 1WGXA 5EYRA 2E2IJ 2DA5A 2MSYA 3L1PA 3CMYA 4M3DA 5M3MJ 3H3VK 2HQ5A 2R5ZA 2FD5A 2PMZN 2XGDA 2G0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEX A;  2P81 A;  3LNQ A;  3HBL A;  2QF7 A;  1Z0X A;  3G1M A;  2M9H A;  4C2M J;  2EBI A;  4DZJ A;  2X6O A;  1K83 J;  1T33 A;  2WB1 N;  2XPW A;  2D5V A;  1DU6 A;  2TCT A;  3GTL J;  1B8I A;  1JKP C;  2JWT A;  3HOV J;  4Y7N J;  5F27 A;  2JN6 A;  1TWA J;  2LFB A;  5M5Y J;  3QPS A;  2DA7 A;  1I6H J;  2LKX A;  5M5X J;  4A3F J;  1H8A C;  1BJZ A;  2LD5 A;  4FE7 A;  3IH3 A;  1G2H A;  1ETQ A;  5IYD J;  2H1K A;  2MGQ A;  4JX5 A;  4BBR J;  2HYJ A;  1NK3 P;  1JTY A;  5F0C A;  3SJM A;  5FKL A;  3BTI A;  1GV2 A;  3JRF A;  3I4N J;  4J19 A;  1AKH B;  5F0F A;  1ZK8 A;  2OF7 A;  1NK2 P;  2FX0 A;  3TW7 A;  5IPA A;  3HOW J;  3BR2 A;  3HM5 A;  2COB A;  1NTC A;  2NS7 A;  3S17 J;  1JT6 A;  1XG1 A;  1IC8 A;  1LFU P;  4V2G A;  3HGG A;  4B4C A;  2AHQ A;  1SFO J;  5IOZ A;  1PUF A;  2X48 A;  2DMQ A;  4MFD A;  3JRD A;  3S2H J;  2HOS A;  4QSH A;  4AC0 A;  2R5Z B;  1QRY A;  3S1R J;  3QPL A;  2VKV A;  3Q3S A;  1D5Y A;  5HOD A;  2DA1 A;  4A3M J;  2GBY A;  4DW6 A;  5K7F A;  2I10 A;  3HDD A;  5J1R A;  4I6Z A;  1IG7 A;  3B6A A;  2M2E A;  1B8I B;  1XS9 A;  2EZH A;  2Y9Z A;  3OOU A;  2GM4 A;  4A93 J;  1GV5 A;  1OCT C;  1ETW A;  1S7E A;  1JUS A;  3HOX J;  4XRS A;  2K9N A;  1Y1W J;  4UUS A;  1LE8 A;  4A69 C;  3G1L A;  2Y0S N;  3DCF A;  3S1Q J;  1JUM A;  4Y52 J;  5J3L A;  1GUU A;  2FJ1 A;  1RKW A;  1BA5 A;  4AYB N;  3GTO J;  3IH4 A;  1ZKG A;  4MFE A;  4A3D J;  1YRN A;  5C4J J;  2AO9 A;  3BG5 A;  2WV1 A;  2E1O A;  4FTH A;  4X6A J;  3CQZ J;  5K7Z A;  3GTK J;  4DYR A;  5EG0 A;  2XGE A;  1AKH A;  3TP0 A;  4XID A;  3TW6 A;  2L7M P;  2H8R A;  4BBS J;  3SFI A;  2CUE A;  1ETY A;  1WI3 A;  3BTC A;  4IHV A;  1MBF A;  2K9Q A;  3ZQG A;  1PUF B;  3GTQ J;  1ZR4 A;  3ZOB A;  4HNV A;  1VND A;  1W0U A;  1JGG A;  4BXX J;  2CQQ A;  3FK7 A;  4XIC A;  2JA6 J;  5EGO A;  2R5Y B;  1A6I A;  3MN2 A;  4QIW N;  2IBD A;  2R93 J;  1GDT A;  5GP9 A;  1ENH A;  3K7A J;  2R7Z J;  4DZP A;  2LR8 A;  1U9N A;  2DA6 A;  2DMU A;  4JX4 A;  2O7O A;  4DYQ A;  1UG2 A;  2JMW A;  4MO7 A;  5JLX A;  3FKI J;  2GLO A;  4UUS B;  4M3G A;  1LE8 B;  1HDD C;  3NAU A;  3LSP A;  1HF0 A;  3BTL A;  2R92 J;  2XRL A;  2E2H J;  5F04 A;  1RET A;  1EF4 A;  1VI0 A;  4M6V A;  4M3E A;  3UKG A;  4W97 A;  4D5C A;  1T56 A;  4G12 A;  1R9T J;  4JYK A;  1YRN B;  2Y9Y A;  4M3B A;  2XB5 A;  2LLK A;  3BQY A;  3PO2 J;  3D1N I;  5M5W J;  5FKO A;  5EG0 B;  4FCY A;  1IDY A;  1TWH J;  1IV6 A;  1ITY A;  5F1J A;  3GTP J;  3HOZ J;  1SAN A;  1CQT A;  3MVP A;  2JA5 J;  2XGC A;  3HEF A;  3BG3 A;  1Y1V J;  3G1O A;  3BG9 A;  3ZQF A;  1GT0 C;  2HOA A;  3HKZ N;  2M34 A;  3JRE A;  3BT9 A;  1APL C;  1FIA A;  3S16 J;  1ETK A;  1FTZ A;  5J1U A;  4NDL A;  1ETV A;  2CUF A;  4D5F A;  4JP0 A;  5EGO B;  3ZQC A;  3WHB A;  1HLV A;  2L7F P;  5IYB J;  2LTP A;  3W6V A;  5GPA A;  5IP9 J;  2VUM J;  3C2B A;  5F08 A;  4D7M A;  2DMN A;  2JA7 J;  5C4X J;  2R5Y A;  3BR3 A;  3CDL A;  3ZQL A;  4RDU A;  2HDD A;  5DS9 A;  2YS9 A;  1ZTR A;  3IV5 A;  1BL0 A;  2L9R A;  1AU7 A;  2VPR A;  2M0C A;  5FKM A;  3BR0 A;  1IGN A;  5IOY A;  2OPT A;  1MBG A;  1ZGW A;  4D7N A;  4A3B J;  2Y30 A;  2K40 A;  4IHY A;  4MIM A;  2EH3 A;  3MKL A;  1B72 B;  4IEJ A;  1IJW C;  4IHW A;  4EEF G;  5IP7 J;  3PM1 A;  4BY7 J;  1MBH A;  3ZQI A;  2XPV A;  2NS8 A;  2KT0 A;  3JRH A;  3M4O J;  1TC3 C;  1GVD A;  2X9D A;  1JJ6 C;  1F43 A;  4S0H B;  1JT0 A;  3OSF A;  1JKR C;  2VKE A;  5EZH A;  2CQX A;  2VI6 A;  4V2F A;  3A03 A;  3BQZ A;  2HI3 A;  2TRT A;  4I76 A;  5IYC J;  3Q0W A;  3O8G A;  2ME0 A;  5EZG A;  3GTM J;  1JJ8 C;  4A3J J;  3F0C A;  2DJN A;  2DN0 A;  2ID6 A;  4XRM A;  5FKK A;  3LSR A;  1MBJ A;  4FE4 A;  1O4X A;  2N8G A;  3LSG A;  4DYC A;  1JTX A;  5F0H A;  3S1M J;  1RPW A;  4C3I J;  2Y31 A;  2JK3 A;  3HOU J;  3S2D J;  1WH7 A;  2CRG A;  1MSF C;  2KDZ A;  4FIS A;  1FTT A;  3BR6 A;  2E19 A;  2NOG A;  1FIP A;  2EQR A;  3Q0U A;  5JLW A;  2ELK A;  5EDN A;  3CCY A;  1XC5 A;  1U8B A;  1MBK A;  4M3F A;  4XK4 A;  1JUP A;  2XPU A;  3HB9 A;  3WHC A;  5E3N A;  1E3O C;  4A3E J;  1MH4 A;  1TWF J;  4XRS G;  2NVX J;  1P7J A;  2EZK A;  1BW6 A;  1WPK A;  1B72 A;  2WAQ N;  1DU0 A;  3TP3 A;  3SDG A;  1OJL A;  5IP6 A;  1X58 A;  4C3J J;  4LOC A;  4MLO A;  3LSJ A;  1F36 A;  2K9S A;  3GTJ J;  4BKX A;  3BTJ A;  4A3L J;  1VFC A;  2IEK A;  2L0K A;  5FJ8 J;  1MNM C;  1LFB A;  2NVT J;  1IRZ A;  2LP0 A;  1MBE A;  3A01 A;  2ECC A;  1ZQ3 P;  9ANT A;  3FK6 A;  2DA2 A;  3RQI A;  3RZO J;  4BY1 J;  2EZL A;  4A3G J;  4JX6 A;  4W1U A;  2YU9 J;  5E3L A;  3A02 A;  1JKO C;  5K7H A;  3DEW A;  2HXO A;  1BW5 A;  2QCO A;  1A5J A;  2XSD C;  4CYC A;  5E3O A;  1H88 C;  3JRA A;  2IAI A;  4A3C J;  2B63 J;  3S1N J;  3JRC A;  2LK2 A;  4IHX A;  2JA8 J;  2EZI A;  3B6C A;  2LY9 A;  1HDP A;  2ECB A;  3M3Y J;  1W0T A;  3RKQ A;  2DA4 A;  1TWC J;  5C3E J;  2NVY J;  3K2A A;  2R0Q C;  1TWG J;  1X2M A;  3FIW A;  1I50 J;  3HGY A;  1JKQ C;  3GBG A;  3JR9 A;  1X2N A;  3IH2 A;  3FIS A;  2HOT A;  2O8K A;  5FKN A;  2LVS A;  2W48 A;  4UUT A;  2O9L A;  4AUX A;  1HOM A;  1UHS A;  1RR7 A;  1QPI A;  2HXI A;  3PO3 J;  2E2J J;  1I3Q J;  1WH5 A;  2ZB9 A;  5FLM J;  3BR1 A;  1UMQ A;  2XB0 X;  4L5E A;  3ZQH A;  1ZR2 A;  5M3F J;  2ID3 A;  2L7Z A;  2ME6 A;  2NVQ J;  2DA3 A;  1WCM J;  2M8G X;  3JRB A;  3A01 B;  1Q1V A;  3OSG A;  3OIO A;  4B1R A;  2YUS A;  2CJJ A;  1ORK A;  5GPC A;  2Y2Z A;  1RKT A;  2DMP A;  3VPR A;  3JRI A;  3RZD J;  3S15 J;  5BNG A;  1QVT A;  3TED A;  2DMT A;  1IUF A;  5EF6 A;  1HCR A;  1VF9 A;  5J1Y A;  3I4M J;  1P7I A;  5DTD A;  4CYC B;  5C44 J;  1RES A;  1ETO A;  2MW8 A;  1U78 A;  1MH3 A;  1OFC X;  2MG4 A;  3H0G J;  3NAR A;  1ETX A;  2CU7 A;  1OCP A;  3O8H A;  3QQA A;  5E3M A;  1AHD P;  1FJL A;  3BR5 A;  1H89 C;  4B3A A;  1IDZ A;  3E7L A;  3Q0V A;  5FLV A;  3S14 J;  4X1E A;  4C3H J;  3JRG A;  4QTR A;  1POG A;  4GFB A;  2FQ4 A;  3HOY J;  5EEA A;  4A3I J;  1K61 A;  4RBO A;  1U9O A;  2DTZ A;  1MSE C;  4ABZ A;  4A3K J;  1QVU A;  3GTG J;  3LOC A;  2JJ7 A;  1Z77 A;  2RAE A;  1WGX A;  5EYR A;  2E2I J;  2DA5 A;  2MSY A;  3L1P A;  3CMY A;  4M3D A;  5M3M J;  3H3V K;  2HQ5 A;  2R5Z A;  2FD5 A;  2PMZ N;  2XGD A;  2G0E A; 
#chains in the Genus database with same CATH topology
 3LNQ A;  1KYZ A;  2EA4 A;  1Z0X A;  2ZME B;  1DP3 A;  2M9H A;  3VOD A;  3BCA A;  2M87 A;  2WB1 N;  1QHG A;  2XPW A;  2H1L A;  1B8I A;  2XVC A;  2L4M A;  2PFB A;  2EV5 A;  3HOV J;  2DO7 A;  3I58 A;  3QPS A;  1I6H J;  3QU3 A;  1FBQ A;  1V54 H;  2KRF A;  3IRQ A;  1BJZ A;  2LD5 A;  1G2H A;  3IH3 A;  3SFZ A;  2H1K A;  1WWX A;  2GZW A;  5DD4 A;  2PJR B;  1P4W A;  1SFX A;  5ILS A;  1JTY A;  2P7V B;  4PCQ A;  4J19 A;  1FMV A;  4OOI A;  4A2U A;  3WE3 A;  2V1U A;  2QLZ A;  3I59 A;  1A31 A;  2COB A;  4ITV A;  1ERD A;  3OYN A;  5LGU A;  3CME I;  4OIQ F;  4ZYH A;  3S17 J;  2ZC2 A;  2D1H A;  1IC8 A;  2HNH A;  4M74 A;  2VJ4 A;  2QBY B;  3T0Y A;  4KA4 A;  5B66 C;  1J09 A;  2ZSH B;  2IJL A;  1SFO J;  2VC0 A;  4XLP F;  4ENJ A;  2VLA A;  3T8T A;  2EA2 A;  4MFD A;  1W5C C;  4RM2 A;  4HPQ A;  3S2H J;  2IP2 A;  4CCJ A;  2HOS A;  1W5T A;  1D5V A;  1IXR C;  2FRH A;  1QRY A;  2K7L A;  2VBX A;  4BQQ A;  3WTX C;  2QA4 I;  1ZG3 A;  1SC7 A;  5ED4 A;  3M7G A;  1FMW A;  4NUB A;  5FB2 A;  4DW6 A;  3HOT A;  1R1T A;  2ZNZ A;  2I10 A;  3BRO A;  5E79 C;  1IG7 A;  4NQW A;  2RKH A;  2V1X A;  1OQY A;  4HQM A;  3SXY A;  3FXR A;  2M2E A;  1EH6 A;  4LG3 A;  4A93 J;  2VXD A;  1I3A A;  3S3M A;  4KDP A;  3LAJ A;  3A2K A;  1JHH A;  4UUS A;  1GXQ A;  4A69 C;  1LE8 A;  3G1L A;  3QWL A;  4RB1 A;  2EFQ A;  3DCF A;  5JHU A;  2KIQ A;  5J3L A;  3AL0 B;  2BOL A;  4XON A;  3WGH A;  4B47 A;  1GUU A;  3AG3 H;  1Y0U A;  3FZV A;  3IH4 A;  1ZKG A;  1R4N B;  5CVU A;  2AO9 A;  3LAP A;  3OIQ A;  2QQB A;  3TQN A;  2E36 A;  3HSR A;  5D6E A;  2Q0O A;  2XAJ A;  3PSF A;  2QEX I;  2LRD A;  1VQM I;  2XGE A;  2UXX A;  3TP0 A;  4EGZ A;  3TW6 A;  2H8R A;  1QA6 A;  1R00 A;  1G3T A;  4ZYE A;  1BR2 A;  2KQR A;  2WWY A;  4BBS J;  2CUE A;  2JVH A;  1ETY A;  3DQV C;  4BXF A;  3ZQG A;  1ZRC A;  2LOO A;  4EJV A;  3ZMZ A;  4S05 A;  2ISZ A;  2YU3 A;  1A6Q A;  3I9V 2;  5LGT A;  1WJE A;  2IS6 A;  5GAD J;  3K1P A;  3QRF F;  2JQ7 A;  1LKX A;  3L2U A;  1Z6T A;  2DK5 A;  2Q2E A;  4BXX J;  2EPF A;  2VBW A;  4Y33 A;  5EGO A;  4LLG F;  4U87 A;  1U3E M;  1BI1 A;  3CP2 A;  1DGR M;  5GP9 A;  3OMY A;  4AU7 A;  1NHA A;  4ZZL A;  1TZL A;  4DZP A;  5FGM A;  4CZZ A;  4C2U A;  1U9N A;  2F5F A;  1H9T A;  3RPU A;  3AFH A;  3GZN B;  4CO8 A;  1WKM A;  4DYQ A;  3AAF A;  2KIF A;  2W1O A;  3FKI J;  5JLX A;  1IO2 A;  4E6K G;  2GLO A;  3CCQ I;  3HTU A;  3LL7 A;  3RYP A;  1YTY A;  2ZKZ A;  3BTL A;  3QU6 A;  1QO0 D;  1X4P A;  4B43 A;  1VI0 A;  2DU9 A;  4W97 A;  4R1H A;  2LKS A;  2P5L C;  1R9T J;  5HS9 A;  4JYK A;  2BVL A;  2DYR H;  1YRN B;  2Y9Y A;  2WY7 Q;  3CJN A;  4M3B A;  5J8F A;  2XIG A;  1ZEL A;  3REO A;  4G6T B;  2GAU A;  3FBN B;  4FCY A;  1QHH D;  3ABK H;  1TWH J;  2EIJ H;  2RNG A;  3OL3 A;  4E7Z A;  1FSH A;  1SVL A;  3PIO F;  3GWZ A;  1J2X A;  3GTP J;  1LVA A;  1YX3 A;  2DOE A;  2DCE A;  5JFR A;  2VQG A;  2MAB A;  3RYR A;  4U0W A;  3HEF A;  2LG4 A;  1U5T C;  1Y1V J;  2E1M C;  2BXZ A;  3ZQF A;  2IGK A;  4XKC A;  1K4T A;  3HRT A;  3JRE A;  1FBS A;  1YW8 A;  1QZE A;  3MFK A;  3DLL F;  3TMO A;  3S16 J;  2VOO A;  2FML A;  2V9P A;  1TW3 A;  4J01 A;  3NAR A;  3CO6 C;  2HZT A;  4GYI A;  1Z1D A;  2XAQ A;  2L7F P;  1VQP I;  3W6V A;  1AHD P;  1OR7 A;  5GPA A;  3OS1 A;  5ICC A;  1R4M B;  2HQN A;  3V42 A;  3RI4 A;  4BQA A;  5C4X J;  3BR3 A;  3CDL A;  2L2O A;  4RDU A;  1TP4 A;  3Q9S A;  2HDD A;  5DS9 A;  2YS9 A;  3IV5 A;  1ACI A;  4WX9 A;  4FHT A;  3BR0 A;  4I0A A;  1IGN A;  2M3A A;  3VOE A;  2VAS A;  4D7N A;  2HOE A;  2LY2 A;  2FBH A;  2F48 A;  3GUD A;  4OIN F;  1YX5 A;  1U2W A;  1QBJ A;  2K40 A;  1OCZ H;  3MKL A;  3SEZ A;  2ISY A;  3X2Q H;  2FNA A;  4BS9 A;  1Z21 A;  4G7Z F;  4CCK A;  4F91 B;  5CPR B;  3M1E A;  4EEF G;  1BIA A;  4BY7 J;  1MBH A;  3I54 A;  3OYB A;  4ZH4 F;  1WJF A;  2NS8 A;  2KT0 A;  3M4O J;  3L2Q A;  1TC3 C;  1BI0 A;  1YJW I;  4I99 C;  2BW3 A;  4S0H B;  3IAS 2;  1JT0 A;  1HW2 A;  3VWB A;  1R7J A;  4OMZ A;  3A03 A;  3CO7 C;  3BQZ A;  2TRT A;  4A0Z A;  1SD5 A;  4I76 A;  5IYC J;  3ELK A;  4LIT A;  4YIF A;  3KZY A;  1CGP A;  4IOC F;  4XRM A;  3IWZ A;  4KIG A;  2ZNY A;  2STW A;  2NXN B;  1R71 A;  1FOW A;  4FE4 A;  2P8T A;  4BAC A;  1I27 A;  6PAX A;  1P9Q C;  4DYC A;  4KIT B;  2HVR A;  2R7R A;  2QQ9 A;  1HKT A;  3S1M J;  4P9F A;  4EQQ A;  2Y31 A;  1VQL I;  2JK3 A;  3JSP A;  2IS1 A;  2EWN A;  4PJ0 C;  4KYW A;  3D5L A;  3H3U A;  1LDJ A;  2R7F A;  2JT1 A;  1S72 I;  3F8M A;  3NWS A;  2NYX A;  5CLS A;  1P92 A;  5FLX K;  5E1Z B;  1U8B A;  3ONQ A;  3WHC A;  5KHD A;  1YI2 I;  4KJZ A;  5E3N A;  4A3E J;  2EIM H;  3D0S A;  4QPQ A;  4XRS G;  2A07 F;  1ZLJ A;  3VYS B;  2ZO4 A;  2QKM B;  1E17 A;  4DIQ A;  2XAS A;  3K4M A;  1OYY A;  4KIF A;  1TTY A;  4Q5S F;  5E1X A;  4PUS A;  2PQ8 A;  2ZXI A;  3H9J A;  3KX2 A;  1A36 A;  1KU9 A;  2OZU A;  4MLO A;  3ZMS A;  3ZN0 A;  5LBQ A;  1JE8 A;  3GTJ J;  3S3O A;  4MEY F;  1DPU A;  1XCB A;  3ML6 A;  1IRZ A;  1U6G A;  1MBE A;  3WE2 A;  3M9A A;  3DP7 A;  9ANT A;  2JZY A;  2EK5 A;  3RQI A;  2I5U A;  2STT A;  4BY1 J;  1J9I A;  1R5H A;  2FA5 A;  3NEU A;  4JX6 A;  5K1Y A;  3WGG A;  1LEB A;  4W1U A;  3SDB A;  2XAU A;  2WAF A;  5GAH J;  3DEW A;  4XLH A;  2IGN A;  5H6R A;  4HST A;  4LK0 F;  1A5J A;  1FYM A;  4LK1 F;  3JRA A;  4FQG A;  2R7D A;  2COM A;  5HLG A;  2BVM A;  3J7Z I;  2BGC A;  1UZC A;  1TT5 B;  2EIK H;  2HVQ A;  3AG1 H;  1P6R A;  2EZI A;  4MHG A;  2UV1 A;  2JUG A;  2K4J A;  4Y13 A;  1W0T A;  2VT3 A;  2GA2 A;  1TWC J;  3QPH A;  4ZZD A;  4N4N B;  1FWZ A;  1TWG J;  4XLE A;  1LDK B;  3GBG A;  1X2N A;  3KZI C;  2V4J C;  4UUT A;  2MC3 A;  2HU9 A;  2O5R A;  3HUG B;  3KIO A;  3L9F A;  4FAS D;  1ZRE A;  4AUX A;  1IRF A;  1V55 H;  2EB7 A;  4PGH A;  2VE9 A;  2HXI A;  3TO7 A;  1WJB A;  3FWE A;  1K4S A;  5FD5 A;  3D5R C;  3K4K A;  3HL2 A;  2JRT A;  5M3F J;  2ID3 A;  2ME6 A;  2FE3 A;  3I4P A;  4RAZ A;  4IHT A;  3GW2 A;  3A01 B;  3WTU C;  4HX4 A;  2DXI A;  3HC7 A;  2KJB A;  3OIO A;  4GXO A;  4RA2 A;  2Y48 A;  2VQC A;  4Y3O A;  4N9H A;  4BQN A;  1XGN A;  2DMP A;  1X3W B;  5B1B H;  2Q1Z B;  2BY2 A;  2HPI A;  3JSO A;  3TED A;  4HDU A;  1FC3 A;  4E7L A;  1R22 A;  2XF7 A;  3R4K A;  3S2W A;  2RQQ A;  3EYY A;  1VF9 A;  3E6B A;  1Z7U A;  1RRJ A;  1P7I A;  3PQK A;  2JVG A;  4YFN F;  5KAI C;  1ETO A;  4WXD A;  3E6C C;  1SAU A;  1ODD A;  1FJL A;  2O8X A;  2FOW A;  3BR5 A;  1H89 C;  2P5K A;  4I0B A;  4B3A A;  3ERE D;  3Q0V A;  3CCJ I;  1IDZ A;  4X1E A;  2KIM A;  3DF8 A;  4AVZ A;  2AXT C;  5K5Q A;  2X6W A;  3V8K A;  5EEA A;  1K61 A;  4RBO A;  2LY1 A;  2IS4 A;  5TRD A;  1MSE C;  2AS5 F;  2FQ3 A;  3DKW A;  3H5A A;  1O3R A;  2JJ7 A;  1Z77 A;  4FET A;  1UB9 A;  3D5S C;  3ZXS A;  2E2I J;  1T0F C;  3L1P A;  3T1B A;  4M3D A;  5M3M J;  3ZP5 A;  3O2P E;  2V9K A;  1HST A;  4BYY A;  3FHN A;  1FEX A;  5DCM A;  2F6C A;  2MLK A;  2EBI A;  4BDZ A;  2D5V A;  1K83 J;  1T33 A;  2H27 A;  5KAF C;  3W2W A;  1J59 A;  3CUO A;  3KYC B;  1EH7 A;  2XHK A;  2TCT A;  4HYE A;  1W36 C;  4I01 A;  1JKP C;  4MTD A;  3GEZ A;  4YFK F;  3UNG C;  1RC9 A;  2JN6 A;  2VKD A;  1TWA J;  2LFB A;  1D8J A;  3M8J A;  2DA7 A;  3I71 A;  5FLX Z;  2LKX A;  5M5X J;  1VQ7 I;  3M8E A;  1ETQ A;  5IYD J;  4GCV A;  4JX5 A;  2V1N A;  4BGD A;  1MZB A;  3HHG A;  3SJM A;  3BTI A;  5HLT A;  3OYC A;  1MDM A;  3I4N J;  2VOP A;  1G59 A;  5F0F A;  3ZR8 X;  3VDX A;  3WG9 A;  2R7T A;  1PVE A;  1ZHF A;  5D4S A;  3EUK L;  3TW7 A;  2X51 A;  2MC4 A;  2A3S A;  2LBF A;  1WHU A;  3BR2 A;  3Q5F A;  3QOP A;  1FOK A;  3LSI A;  1N77 A;  4EJW A;  2KLO A;  3QYF A;  4B4C A;  3HGG A;  3W2A A;  3E5X A;  3TKY A;  1PUF A;  2X48 A;  2K27 A;  3IP4 B;  3CLO A;  2V6E A;  2KZV A;  1ON1 A;  1NG6 A;  3OYJ A;  3F9K A;  1VQ4 I;  3PQJ A;  5LD2 C;  4BAY A;  2EFW A;  1HXD A;  1YO5 C;  1J75 A;  1UEL B;  2GBY A;  5K7F A;  1R5G A;  2V9V A;  5J1R A;  4I6Z A;  2VBY A;  3CES A;  2X1D A;  3FXJ A;  4OU0 A;  1YLF A;  1B8I B;  1XS9 A;  2EZH A;  2Y9Z A;  1OCC H;  1STZ A;  4O5V A;  1HSJ A;  5ILV A;  2EV0 A;  4XRS A;  3SZG A;  5DUK A;  1V3F A;  2L01 A;  5ILU A;  1MD0 A;  2WY8 Q;  4CXF A;  1HW1 A;  1R23 A;  2Y0S N;  1U5T A;  3S1Q J;  2CGP A;  2W84 A;  1XX5 A;  4NNJ A;  3M8F A;  3ESW B;  3GZ6 A;  4BNC A;  2FJ1 A;  1MJA A;  1RKW A;  3CD6 I;  3GTO J;  2YX4 A;  2L9V A;  4MFE A;  2VON A;  3DWL E;  3E1S A;  4G6Q A;  2CQ7 A;  2ZJQ F;  2DDB A;  1T95 A;  2DDA A;  2ICW G;  2HYG D;  4ZDL A;  5CVJ A;  5F1R A;  3E6D A;  4FTH A;  4I2O A;  4X6A J;  5F64 A;  2MA3 A;  3HSE A;  2FMY A;  3H0D A;  3CQZ J;  2O0Y A;  3IAM 2;  2DYS H;  5LHG A;  4RB0 A;  5EG0 A;  1S5L C;  4XID A;  1IRX A;  2L7M P;  2QKL B;  4HW0 A;  1REP C;  3FXQ A;  2IA1 A;  2VQH A;  1VQ8 I;  2QSF X;  1TNS A;  2A6E F;  3LSK A;  1ZYR F;  3BTC A;  3O3K A;  4HA8 A;  2K9Q A;  1USS A;  1YW9 A;  1ZR4 A;  2DW4 A;  3U21 A;  3ZOB A;  1U0J A;  2WBM A;  3EPZ A;  3W6K B;  3GFI A;  2VB6 A;  4X0G A;  1ONV A;  5E1W A;  3FK7 A;  2KPM A;  4XIC A;  5FRO A;  4QPO A;  4IX7 A;  5AON A;  4B09 A;  4EM2 A;  1A6I A;  1IXS B;  4QIW N;  5CYV A;  1HA8 A;  2OV7 A;  1R58 A;  4KFC A;  3K7A J;  3HHH A;  2R7Q A;  4BUP A;  3OWT A;  3SYT A;  1YYV A;  2XF5 A;  2DA6 A;  4HDV A;  2DMU A;  1YIT I;  3LFK A;  2O7O A;  2ACJ A;  2IVM A;  5HOO A;  2P7C B;  1UG2 A;  2L02 A;  2OCC H;  5E20 A;  5L3D A;  2V7F A;  4CYD A;  4A5N A;  4UUS B;  1LE8 B;  2CV2 A;  3C7J A;  3LSH A;  3NAU A;  1EA3 A;  1OCR H;  1HF0 A;  4IO9 F;  2XRL A;  1FP1 D;  2UXN A;  5LFA A;  3CF5 F;  2DFF A;  1B9N A;  1OKR A;  5D8L B;  1J0R A;  1RET A;  3K9T A;  5GTI C;  1SFU A;  1EF4 A;  4OAZ A;  1O57 A;  2PEX A;  4PJN A;  3UKG A;  4D5C A;  1T56 A;  4EM1 A;  1FYL A;  4K2E A;  3H5R A;  3LFU A;  4XL9 A;  1GVJ A;  2XB5 A;  3BCB A;  2XV4 S;  4PZJ A;  2PLY A;  2A6H F;  1FOX A;  1IDY A;  3N05 A;  3F22 A;  2GIZ A;  3AG2 H;  3BPX A;  4ZTF A;  3R6S A;  5TIS C;  1ZAR A;  2DFE A;  3VYT B;  2HDC A;  2A68 F;  1W7P B;  3HOZ J;  1CQT A;  2O6G E;  2J5P A;  3KLN A;  3I53 A;  2JA5 J;  3T5X A;  2XGC A;  3OYF A;  1KON A;  2XKO A;  2GA1 A;  3E3V A;  4IOA F;  2HOA A;  2M34 A;  1HBX G;  1T6S A;  3MKZ A;  4XNF A;  2DFI A;  2Q2E B;  5J1U A;  3ISP A;  3P9I A;  5EGO B;  1R6R A;  1MW7 A;  1Z91 A;  4V19 K;  3A1Y A;  5IP9 J;  2RNJ A;  2LYC A;  3CCR I;  1IAW A;  4D7M A;  2DMN A;  1X19 A;  3DU5 A;  1JXS A;  4BHB A;  3KEQ A;  2CFX A;  2KMU A;  1AU7 A;  3GFL A;  4UHT A;  1EJ9 A;  3DBH B;  1ZGW A;  4A3B J;  2PMZ A;  4MGR A;  2Y30 A;  3MKW B;  5J4Y A;  4EVI A;  2E1N A;  4L0Z B;  1XDS A;  1RUN A;  2WAQ A;  2OQR A;  5E8G A;  1B72 B;  2DOF A;  3L2R A;  3WG7 H;  3F3X A;  1SFE A;  3CDH A;  1MMG A;  4U88 A;  3E0J B;  2LDU A;  2X1C A;  5AIQ A;  4L9J A;  5IP7 J;  1ULY A;  2F5E A;  4XOR A;  1D0Y A;  4XKW A;  3ZQI A;  1TQM A;  2ETH A;  2B7E A;  3JRH A;  1KYW A;  3CUQ C;  3GXO A;  1HQC A;  5J8C A;  2FSW A;  1JJ6 C;  4BHC A;  3OV8 A;  5FFX A;  3OSF A;  3CCS I;  1JKR C;  3WTV C;  3WU0 A;  2R7V A;  2CQX A;  2A61 A;  1W7P A;  3QYB A;  4JK1 X;  3ZCO A;  5BMZ A;  3E5Q A;  4L0Y B;  2IT0 A;  2F5D A;  4WXC A;  1FPQ A;  5DV5 A;  2AXL A;  3V7R A;  4H0E A;  2ME0 A;  3WOD F;  2Y75 A;  2ZXH A;  3GTM J;  1FNN A;  4JBA A;  3ERM A;  3GME A;  3WU1 B;  5FKK A;  4XMY A;  2IRF G;  3QAH A;  4XBF A;  1O4X A;  4EV0 A;  3LSG A;  4UV9 A;  1G6N A;  1VQK I;  4AM3 A;  5F6F A;  2NNN A;  2P0W A;  4MQV A;  3HOU J;  2WTE A;  3S2D J;  5JVT A;  1WH7 A;  2CRG A;  4XKB A;  2O3F A;  2KDZ A;  5DD8 A;  1N75 A;  1K78 A;  4KIS A;  3V8J A;  4TV7 A;  2M7B A;  1V5F A;  3Q0U A;  2ELK A;  2PJP A;  2M4K A;  3CCY A;  4XN3 A;  2HEO A;  1XC5 A;  3BG7 A;  3CC2 I;  1MBK A;  3BZK A;  4M3F A;  1JUP A;  3H3Z A;  3HB9 A;  1DU6 A;  3V4G A;  1MH4 A;  1TWF J;  2L3D A;  2NVX J;  1D3Y A;  1P7J A;  1B1B A;  2E35 A;  3PL8 A;  1B72 A;  2CQK A;  1T8I A;  1QZY A;  2WAQ N;  4XSZ F;  3FMR A;  1DU0 A;  2KHM A;  5IP6 A;  5HLH A;  3GYH X;  1X4O A;  3K2Z A;  1F36 A;  3EET A;  2K9S A;  1W1W E;  4WF2 A;  1P2F A;  2BW3 B;  4HAM A;  3H35 A;  4HEA 2;  5FJ8 J;  3CDI A;  1YS7 A;  1YS6 A;  2L5Q A;  4AYB A;  1WVR A;  2VL8 A;  2ECC A;  4DNC A;  1SEU A;  2DA2 A;  3KYD B;  3OYE A;  1WQ2 A;  3F8C A;  4A3G J;  5FRM A;  1Y39 A;  4Y4R A;  2IXS A;  3CTA A;  3OYG A;  3BP8 A;  2Z1D A;  4KUM A;  2MH2 A;  4GYG A;  5EEH A;  2EFP A;  1MIJ A;  5K7H A;  1JKO C;  3TDU C;  5LEJ A;  1BIB A;  1T0F A;  2QCO A;  4XLN F;  4BQO A;  1Q1H A;  4CYC A;  3CJQ B;  4U0V A;  3MEX A;  2B63 J;  3GFJ A;  3S1N J;  3I56 I;  4P9U A;  4J00 A;  3NWT A;  3Q9V A;  3CC4 I;  2LK2 A;  3DXJ F;  2HZD A;  1I6X A;  3B6C A;  4LFU A;  2LY9 A;  3IRR A;  1HDP A;  2ECB A;  2VJ5 A;  4FX4 A;  4KMF A;  3F72 A;  5D8K B;  1VQN I;  2ZXJ A;  2X85 A;  3BLY A;  3CCM I;  2HDW A;  3GCM A;  2R0Q C;  1X2M A;  2KL4 A;  3B73 A;  3FMQ A;  2DBB A;  2GWR A;  3U2R A;  1I1G A;  1XSV A;  3OIP A;  4QLC U;  3JTG A;  3SZP A;  4EJO A;  2O8K A;  1XCV A;  2H8W A;  2W48 A;  4KMU X;  2O9L A;  2KJC A;  1RR7 A;  3A0H C;  3BJ6 A;  2Q8K A;  2JSC A;  4I7H A;  2E2J J;  1I3Q J;  1WH5 A;  3M1C A;  1R1U A;  3BR1 A;  1UMQ A;  3DFG A;  4ENK A;  3H92 A;  2LF8 A;  2NVQ J;  4IF4 A;  4L18 B;  1PP8 F;  1G8X A;  1LB2 A;  1Q1V A;  3OSG A;  1YJ9 I;  4RLF A;  1CF7 A;  1PDN C;  2LH9 A;  4B1R A;  1QQI A;  4I09 A;  4G94 A;  4AWX B;  2Y2Z A;  3VPR A;  3RZD J;  3KCC A;  4L9V A;  4PK4 A;  2R7X A;  2M4G A;  2DI3 A;  4NB5 A;  5BNG A;  1WJA A;  1QVT A;  1T08 B;  1XN7 A;  2OQG A;  1X3U A;  3VFZ A;  2YSR A;  4WCG A;  3K69 A;  1WRJ A;  5J1Y A;  4EJU A;  2O61 A;  3LSM A;  2GXG A;  1OYI A;  2GQQ A;  5C44 J;  3V7S A;  1RES A;  2HR3 A;  4RGX A;  5D4R A;  4RLQ A;  1S3J A;  4HX7 A;  1AWC A;  1MH3 A;  1M1E B;  1OFC X;  2MG4 A;  1KU3 A;  1X1C A;  1ETX A;  1XGO A;  1OCP A;  2E7X A;  2E60 A;  2JPB A;  2XGX A;  3O8H A;  1SD7 A;  3QQA A;  3SQN A;  4F3Q A;  5JR3 A;  3H9G A;  2VOD A;  3HKZ A;  1Z3X A;  5FLV A;  2BHY A;  4QTR A;  4CCM A;  3HOY J;  2ESN A;  2E7W A;  1U9O A;  2JTV A;  2DTZ A;  2HKX A;  2HTJ A;  4YG2 F;  3OYA A;  3TO6 A;  3CJR B;  2K3P A;  5DUI A;  1WGX A;  5EYR A;  2A5W A;  3CMY A;  4A12 A;  2EFO A;  1TQP A;  4HNU A;  3FM5 A;  2R5Z A;  2FD5 A;  3C2H A;  2XGD A;  3LWF A;  1LQ1 A;  3VYR B;  4XOP A;  2H09 A;  1IXC A;  3CCU I;  2NVU B;  1ZLK A;  1FLI A;  5BOX A;  5H6Q A;  2QF7 A;  3G1M A;  4C2M J;  4DZJ A;  4FX0 A;  1XSD A;  2ESH A;  2QUF A;  2VBZ A;  1OCO H;  3KFW X;  1D1B A;  4E7K A;  3GTL J;  4KNY A;  3GFM A;  2JWT A;  3GX4 X;  1E3P A;  2MFZ A;  5F27 A;  2AQF A;  3CP8 A;  4LG0 B;  4WWC A;  1VQO I;  3FM3 A;  4B44 A;  4CUG A;  4Z6Y A;  3R0J A;  1Y8R B;  1NG7 A;  2QSH X;  4GRI A;  1BOA A;  2EJR A;  4PJM A;  4AVP A;  2V1D A;  3KEO A;  2MGQ A;  1SFK A;  4BBR J;  2HYJ A;  2Z2S B;  4Z2Y A;  2IS2 A;  5F0C A;  1GV2 A;  1BC8 C;  1AKH B;  3A0B C;  2VIX A;  2ZME C;  3FBI B;  1ZK8 A;  5J4V A;  2OF7 A;  5B5E C;  4ANJ A;  1XPX A;  3K4B A;  3MZH A;  3RQ4 A;  2M0M A;  4EJT A;  4E7I A;  2NS7 A;  3ECH A;  1UCR A;  1XG1 A;  4O3M A;  2CW8 A;  1I1S A;  3LQR A;  3ABL H;  3J7A Y;  2XAH A;  4UVB A;  4A0Y A;  5IOZ A;  2DMQ A;  3GLX A;  5CVI A;  3JRD A;  2Z99 A;  3SZT A;  2A69 F;  4QSH A;  2XC7 A;  4AC0 A;  4HX8 A;  1EH8 A;  3PUF A;  3KP5 A;  3S1R J;  2VKV A;  3Q3S A;  3PNT A;  2F2E A;  5DCM B;  3BOQ A;  3VEP A;  2HTS A;  4A3M J;  4M73 A;  4BE1 A;  3GLL A;  2GOM A;  2HQR A;  1BM9 A;  1YHQ I;  2Y0M A;  3MKY B;  1PJR A;  4XN0 A;  3BWG A;  3KP3 A;  2OAZ A;  3CZ6 A;  2VE8 A;  2GM4 A;  1GV5 A;  1ETW A;  1E2X A;  4HSR A;  2DQL A;  1JUS A;  5J40 A;  3HOX J;  1OPC A;  1S6L A;  1Y1W J;  2VXZ A;  3G6E I;  4LG0 A;  2XKP A;  1DGW Y;  5L3G A;  1VZ0 A;  2M30 A;  1FZP B;  1TW2 A;  2RQP A;  4WK8 F;  2CFO A;  1IN5 A;  3ZMU A;  4IVN A;  1MDM B;  1D1C A;  3DEE A;  3BG5 A;  1YOV B;  2E1O A;  3CF2 A;  1IN7 A;  5L3C A;  1KQ8 A;  1MMA A;  3TL4 X;  1B9M A;  3K0L A;  3GTK J;  1T98 A;  2LBF B;  1XMX A;  2E34 A;  5H20 A;  4E70 A;  1AKH A;  2QEN A;  4G7O F;  5CQE A;  3PNY A;  4ASN A;  2XAF A;  1ZRD A;  2GOX B;  4AIJ A;  1X3Z B;  4N9I A;  2AQE A;  3PJR A;  1PUF B;  2EV6 A;  2IA0 A;  3DPL C;  5DM7 F;  2D45 A;  2HQA A;  5ICF A;  1MKM A;  1VQ6 I;  3JTH A;  5HVQ C;  3AL0 C;  1D0X A;  4AIH A;  1VND A;  4L5J A;  3TBI A;  1R5I D;  5CQG A;  2BBY A;  1W0U A;  2IPQ X;  1JGG A;  3BC8 A;  2VQL A;  3TOB A;  1XDU A;  2K9M A;  1WJ5 A;  3MN2 A;  4NHJ A;  3EYI A;  1KA8 A;  1UJ8 A;  1ZGJ A;  1LJ9 A;  5B3S H;  1GDT A;  2PBI A;  1ON2 A;  4PSW A;  2KDO A;  1KU7 A;  4F93 B;  2VJI A;  1YIO A;  3K6G A;  2BXY A;  2JUC A;  2LR8 A;  4M72 A;  3F21 A;  1YJN I;  4LJZ F;  3CUQ A;  1V5G A;  1TLH B;  4G8X A;  2JMW A;  1IW7 F;  4MO7 A;  2DOD A;  2RVC A;  2KIU A;  4XSX F;  1S7O A;  3IHU A;  1K79 A;  1FT9 A;  2ZSI B;  1HDD C;  4HF2 A;  2P5V A;  4AD9 A;  3K70 D;  3LQQ A;  1U5T B;  2E1M B;  2P6S A;  2Y69 H;  4MTE A;  2R92 J;  2B0L A;  4WXH A;  5F04 A;  4ESJ A;  2DT7 B;  4XLF A;  4HF1 A;  4M6V A;  3TOA A;  1LEA A;  2JA2 A;  2BY1 A;  2FF4 A;  3DPT A;  4OMY A;  3J7A O;  4ZDO A;  2M5W A;  3U1D A;  2LLK A;  2OJE D;  1SMT A;  3BPV A;  5FKO A;  5EG0 B;  3BJO A;  5M5W J;  4PDK A;  4HV6 A;  2HWV A;  3P7N A;  2IGM A;  3FF5 A;  1ITY A;  4HOB A;  3I55 I;  5TJJ A;  2NRA C;  4L9N A;  2E1C A;  2Z3Y A;  3KEY A;  4HG2 A;  4ESB A;  2V79 A;  3BDD A;  4HNT A;  3BG3 A;  4LLN A;  4CH7 A;  2PN6 A;  1BN5 A;  1GT0 C;  4BJ6 C;  4GDF A;  4NC6 A;  2M1B A;  4RAF A;  2KZG A;  2XAG A;  3HG9 A;  1LUJ B;  4FT8 A;  4D5F A;  3ZQC A;  4JP0 A;  1E0E A;  1NH3 A;  4M9S A;  2FOK A;  5IYB J;  4LB6 B;  3TDZ C;  1MND A;  2A6T A;  3U9G A;  1RIO H;  2LTP A;  1GXP A;  1FYK A;  2FBK A;  2VUM J;  3ABT A;  3C2B A;  5F08 A;  3E6M A;  2OBP A;  2F5C A;  5D5U B;  3HTS B;  2R7S A;  1DUX C;  2OC6 A;  2ZFW A;  4IKF A;  1BR1 A;  1FBU A;  2VPR A;  5FD6 A;  2FNP A;  2M0C A;  3L09 A;  4G6D A;  1XMK A;  2CG4 A;  2OPT A;  2JRM A;  2IA2 A;  5IOY A;  3RPQ A;  3H36 A;  1V5E A;  2XUB A;  1I5Z A;  4IPA A;  3J7Y J;  3K70 C;  2QZ8 A;  4JQF A;  1X1D A;  1RZ4 A;  4MIM A;  3W2V A;  2EH3 A;  3HOS A;  1O7F A;  3BZC A;  3KZZ A;  5HDN A;  1K7A A;  4IEJ A;  1IJW C;  1FY7 A;  4OWR B;  1WI9 A;  1R36 A;  5LHI A;  4IHW A;  1D8K A;  2HFH A;  1IN8 A;  3QOE A;  4B3X A;  2FUG 2;  2H6B A;  2WA0 A;  3HSF A;  2EFN A;  4UV8 A;  2UUZ A;  4NC7 A;  4A0X A;  4JOM A;  1GVD A;  2X9D A;  5L3E A;  4RGU A;  1RR8 C;  3EUA A;  3KLO A;  3CJT B;  3V8L A;  3G2B A;  2M8E A;  5D5X B;  1SMY F;  4CIC A;  2V26 A;  3OY9 A;  1XGS A;  1YQA A;  3L7W A;  5KVR A;  2HI3 A;  2L4A A;  4LMY A;  3VSL A;  4I98 B;  1IV8 A;  3LA3 A;  4RS8 A;  3IKT A;  3KP2 A;  1DPR A;  4DQ2 A;  3KPH A;  5EZG A;  2A05 A;  5BPD A;  2X6Y A;  4GGG A;  2DN0 A;  2H6C A;  2ID6 A;  2CV0 A;  3RKW A;  3CMA I;  1MBJ A;  4RAY A;  4BE2 A;  4ZYG A;  3F23 A;  4R8H A;  5F0H A;  3HRU A;  1KZH A;  3EUH C;  4C3I J;  3EDP A;  5ERI A;  3F6O A;  1AA7 A;  4XRF A;  4CGZ A;  3H5N A;  4M9Z A;  4YII A;  4BH9 A;  4O6J A;  4XKV A;  4UY8 I;  4FIS A;  3MCZ A;  1FTT A;  2XF6 A;  4LIU A;  5GTH C;  2NOG A;  4HQE A;  1FIP A;  4MNU A;  4RB2 C;  1O3Q A;  2EQR A;  4M71 A;  4F55 A;  5JLW A;  2W25 A;  3JAM K;  1UFM A;  2PX9 A;  1E3O C;  4XK4 A;  2XPU A;  1HW5 A;  4UNO A;  2K85 A;  2LMD A;  4E7H A;  2IGO A;  2CQN A;  3CCV I;  4KIB A;  4C3J J;  5FRN A;  1SD4 A;  3LA7 A;  4CA0 A;  2FXA A;  2X1E A;  3BTJ A;  4A3L J;  1G3S A;  2KFD A;  2ADU A;  4U0Y A;  1MNM C;  1ZH5 A;  2NVT J;  2LP0 A;  4IL6 C;  5K5R A;  3FK6 A;  4ZTJ A;  4Y17 A;  2BY0 A;  2BHZ A;  4B8X A;  4XM3 A;  3A4C A;  3QP5 A;  4KT6 A;  1VQ5 I;  2YU9 J;  4LD5 A;  3FXL A;  5GAE J;  3FKJ A;  3KP6 A;  4D9J A;  2DLL A;  2HXO A;  3ZMV A;  3BY6 A;  2F5V A;  3FXK A;  2XSD C;  5E3O A;  1H88 C;  1Z7L A;  2IAI A;  2YR2 A;  3PFY A;  1J5Y A;  1H0M A;  4A3C J;  3G3Z A;  2LKP A;  2XSJ C;  3GVA A;  1WSU A;  4YEJ A;  2JA8 J;  1LFP A;  1UST A;  1L0O C;  3BZ6 A;  2BEO A;  1K78 B;  3RJP A;  3QPT A;  2OA4 A;  4P1W A;  3GO5 A;  3G71 I;  2DA4 A;  5C3E J;  3RKQ A;  2NVY J;  5GAG J;  4M6Y A;  4Y15 A;  3FIW A;  1I50 J;  1JKQ C;  3IUO A;  2RV8 A;  3JR9 A;  4BDY A;  3IH2 A;  3CLQ A;  4XLC A;  1X1B A;  3FIS A;  1B4A A;  5FKN A;  2LVS A;  2UZK A;  3KYL A;  3J81 K;  2L7K A;  4ZDP A;  1HOM A;  4CCO A;  1UHS A;  3ZQ7 A;  3KET A;  4KN4 X;  5CVR A;  3OYI A;  3PO3 J;  3HRM A;  2ZB9 A;  5FLM J;  1MNE A;  4L5E A;  3ZQH A;  2ZME A;  3K10 A;  2HVS A;  3RTR A;  2LF7 A;  4ZC3 A;  2IW5 A;  2FU4 A;  1WCM J;  2M8G X;  2BV6 A;  4RAG A;  1N25 A;  3RKX A;  4ENN A;  2VPL A;  2YUS A;  2CJJ A;  1F4K A;  1FP2 A;  3JRI A;  3S15 J;  1SAX A;  3BJA A;  1IF1 A;  4ENM A;  5FO5 A;  4BE0 A;  2MD0 A;  5EF6 A;  3LST A;  1MMD A;  3OYM A;  2PJR A;  3F8B A;  4CYC B;  5DTD A;  4CSW A;  4H4K C;  1A35 A;  2V6C A;  3RCO A;  3HPG A;  5HDG A;  4BHP A;  1U78 A;  3N97 A;  5IT3 A;  2OD5 A;  3K4L A;  4F7Z A;  2Z9O A;  4XQF A;  1BI2 A;  1OMI A;  4CHU A;  3DPU A;  4M6X A;  3S14 J;  2B9S A;  4C3H J;  4EM0 B;  3JRG A;  2BYV E;  1TBX A;  1P4A A;  5CJ9 A;  2FQ4 A;  3JCU C;  4IQ4 A;  4A3I J;  1BJA A;  2E71 A;  3KP4 A;  3MQ0 A;  2QBY A;  1S8N A;  2KRC A;  1JHF A;  1LDD A;  3ABM H;  4ABZ A;  1LNW A;  5HNF A;  1QVU A;  4C9Y A;  3LOC A;  4PSX A;  2KRH A;  2DA5 A;  2L54 A;  4XR6 A;  1YIJ I;  2MYS A;  1EKE A;  2W57 A;  2PMZ N;  4DOZ A;  3O6B B;  4OIO F;  4UVC A;  3OL4 A;  2P81 A;  4RGS A;  1O7L A;  3ULQ B;  2ZJP F;  3HBL A;  4II3 A;  5H2F C;  1C0W A;  2MD5 A;  2KIS A;  2X6O A;  3MZY A;  2W7N A;  2LSO A;  3MD2 A;  3PFI A;  1Z67 A;  2DAO A;  5TGT A;  1RI7 A;  3I5U A;  3FDY A;  1X1P A;  1RNL A;  5BQT A;  4HBL A;  1CF7 B;  4Y7N J;  2A5Y B;  5E17 F;  1B6A A;  3K1M A;  3WTY C;  5M5Y J;  4U7B A;  2FEZ A;  2CO5 A;  2MBF A;  3JAM Z;  2ZFU A;  4IXA A;  4YFX F;  5L3B A;  4A3F J;  1H8A C;  4FE7 A;  3S93 A;  3ZMT A;  3QYE A;  1R49 A;  3ZPL A;  3CCL I;  1NK3 P;  1LVK A;  5FKL A;  4M9X A;  4B48 A;  3H0G J;  3JRF A;  3L2V A;  4DBR A;  1QNT A;  5BPI A;  4EGY A;  1YFH A;  5K5O A;  1Y0N A;  3P5J A;  1G3W A;  3VSK A;  1NK2 P;  2FX0 A;  3R60 A;  1FX7 A;  3U1K A;  3R61 A;  5IPA A;  3HOW J;  3HM5 A;  4DJA A;  1XTA A;  4QWQ A;  1JI8 A;  1NTC A;  1JT6 A;  3P9K A;  4HZF A;  5E18 F;  2W00 A;  1LFU P;  4ZYD A;  3DTE A;  2FBI A;  3BG6 A;  4V2G A;  2AHQ A;  1F1Z A;  3W3C A;  1QZZ A;  1UHM A;  1YW7 A;  1BI3 A;  2OU2 A;  4E7J A;  3HJE A;  4KN7 X;  3J80 K;  1XD7 A;  4YEL A;  4PJL A;  3L2W A;  2R5Z B;  4IRH A;  4IZZ A;  2G7U A;  3QPL A;  1ZG5 A;  4HF0 A;  1HC8 A;  2M7A A;  3GF2 A;  2DOA A;  3DU6 A;  1D5Y A;  4BEH B;  5HOD A;  2DA1 A;  1T39 A;  2YX7 A;  3HDD A;  2DJI A;  3IKV A;  3B6A A;  5HLI A;  1G3Y A;  2ZBK A;  5LRS A;  3OOU A;  4NC8 A;  2X6X A;  1OCT C;  1S7E A;  3OYK A;  1MMN A;  3I3L A;  2K9N A;  4CDG A;  2W82 A;  4AID A;  1YE9 A;  4HLX A;  4HLY A;  2W85 A;  1MGT A;  1WZ2 A;  1JUM A;  4Y52 J;  3J81 Z;  2R7O A;  3ZMD A;  5L3F A;  4N4O B;  4NBQ A;  1BA5 A;  4AYB N;  1TQI A;  1XMA A;  3K1N A;  4A3D J;  1Z3Y A;  2HKO A;  1YRN A;  3W6J B;  1ZG1 A;  5C4J J;  2HS5 A;  2WV1 A;  2WAD A;  1DDN A;  3FXM A;  1KQ9 A;  3ROU A;  5EEG A;  3F8N A;  5K7Z A;  4DYR A;  3IWF A;  1D0Z A;  2Z33 A;  2BY3 A;  3QP6 A;  2MLG A;  1O3T A;  3HZJ A;  3SFI A;  2K5C A;  1WI3 A;  2VC1 A;  4IHV A;  1MBF A;  2QYO A;  3GTQ J;  2JSP A;  4F92 B;  4HNV A;  5LRR A;  3ZRG A;  2LC2 A;  3ASN H;  3DLA A;  1K6Y A;  4KIC A;  1U8R A;  3F6V A;  2HGC A;  5ICG A;  4F52 A;  4GO1 A;  2CQQ A;  2JA6 J;  2CSO A;  2R5Y B;  3MZ8 A;  4ZJZ A;  5LGN A;  1MJ9 A;  2IBD A;  2R93 J;  2ELJ A;  1ENH A;  3LMM A;  5KK1 A;  5ICE A;  2R7Z J;  2D2W A;  2G7H A;  3WTZ A;  3DKX A;  4BEH A;  2F4O B;  4JX4 A;  2TDX A;  5D6F A;  1W7P D;  1V4R A;  4G7H F;  2J5O A;  1Z05 A;  1TL8 A;  1UHW A;  4YIR X;  1F5T A;  1RUO A;  4LGW A;  2ELH A;  1XSX A;  4M3G A;  3LSP A;  2E2H J;  5CKT A;  3FHZ A;  1F9N A;  1IN6 A;  1FSE A;  4M3E A;  4P55 A;  2P4W A;  4G12 A;  1BOB A;  3ECO A;  5LHH A;  5E8I A;  2Z5U A;  3TGN A;  2KP6 A;  4MQ9 F;  3L00 A;  3DKY A;  3BQY A;  3PO2 J;  1SD6 A;  3D1N I;  3RPU D;  5DCF A;  3TO9 A;  2CUJ A;  2F4I A;  5HS7 A;  3COA C;  1IV6 A;  4Q4Z F;  3EUH A;  1S9H A;  1X1A A;  5F1J A;  1OYW A;  3K4J A;  4S04 A;  1SAN A;  3MVP A;  3AKZ A;  4Q48 A;  5IT9 K;  3SHF A;  3G1O A;  2ZJ2 A;  3BG9 A;  2QQA A;  1W5S A;  3HKZ N;  3BT9 A;  1APL C;  5CVV A;  2RGV A;  1FIA A;  2VT2 A;  1ETK A;  1FTZ A;  2OZ6 A;  4NDL A;  2CWE A;  4PFO A;  3T8R A;  4BJT A;  1ETV A;  2CUF A;  3HIF A;  4BXU A;  3WHB A;  1HLV A;  4PJJ A;  5A2Q K;  2QGU A;  2CS3 A;  2QQ8 A;  2JA7 J;  5JI6 A;  2NNY A;  2R5Y A;  3K4N A;  3ZQL A;  3JW4 A;  1L3L A;  1FOY A;  5D5W B;  2DFH A;  3CUQ B;  1ZTR A;  4I02 A;  1BL0 A;  2L9R A;  3HRS A;  3C2G A;  3WTT C;  5DDG A;  4UB8 C;  2XDV A;  5FKM A;  5KCM A;  3UR3 C;  1MBG A;  3F8F A;  1BR4 A;  3SEQ A;  4C30 A;  3LA2 A;  4IQJ A;  3IC7 A;  3HYI A;  3J80 Z;  3E97 A;  4IHY A;  1KU2 A;  2DQR A;  3DBR B;  4D0P A;  3OR1 C;  3OS2 A;  3WTW C;  2DPU A;  2RC4 A;  4MEX F;  1PUE E;  2NOJ B;  5D5V B;  2W24 A;  2E5Z A;  3PM1 A;  1VTN C;  3DEU A;  2DTR A;  2E5N A;  1IUY A;  4CCL A;  3DTK A;  3G4S I;  1Y56 A;  1PYV A;  2XPV A;  4UUV A;  1MMS A;  1Z9C A;  3L2C A;  1W36 D;  1VQ9 I;  3KP7 A;  4RB3 C;  1F43 A;  1XGM A;  3GZ5 A;  5LLQ A;  2CH0 A;  2VKE A;  2BE5 F;  5EZH A;  2CV1 A;  2VI6 A;  4V2F A;  1ZRF A;  1WJC A;  5HS8 A;  2EIN H;  3OOP A;  3Q0W A;  2W4S A;  3O8G A;  2CMP A;  5FFZ A;  3CMM A;  1JJ8 C;  4A3J J;  3F0C A;  2DJN A;  3E5U A;  4UXN A;  2QM3 A;  3S3N A;  1S7A A;  3LSR A;  3FX3 A;  3AG4 H;  3HPH A;  2R7W A;  2N8G A;  1S29 A;  1JTX A;  1RPW A;  4BL0 B;  1QPM A;  3ZN1 A;  2R4G A;  2NS0 A;  2K02 A;  3MAJ A;  4N0B A;  4R79 A;  1AOY A;  1Y8Q B;  2ZXW H;  1MSF C;  4XOT A;  1IN4 A;  1KGS A;  3ABU A;  1HKQ A;  3BR6 A;  2E19 A;  1H9G A;  1O3S A;  1N78 A;  1D1A A;  2RN7 A;  4EAT A;  5EDN A;  3HXL A;  3VYU B;  1B59 A;  3P9C A;  2YPR A;  3B02 A;  2OTL I;  1Y6I A;  4UVA A;  3DTI A;  2OUM A;  2EZK A;  2RRE A;  5HNH A;  1OR7 C;  1BW6 A;  1WPK A;  2F4M B;  3HUG A;  3H1C A;  2DT6 A;  2R3S A;  5BS6 A;  3DBL B;  3TP3 A;  3SDG A;  1OJL A;  2CW7 A;  1X58 A;  2HYF A;  3RDI A;  4LOC A;  2VJJ A;  4OAY A;  2C6Y A;  2P6T A;  2VN2 A;  3LSJ A;  4Q47 A;  2CYY A;  1SVO A;  3WGI A;  1TT0 A;  2ZJR F;  5EJC A;  2Y0S A;  4BKX A;  3C18 A;  4IHS A;  5B1A H;  5E3M A;  1VFC A;  2IEK A;  2L0K A;  2QVO A;  4AIK A;  1LFB A;  1Z6R A;  3EQL F;  2DT5 A;  1OLT A;  3A01 A;  1ZQ3 P;  3RZO J;  3PIP F;  2Z16 A;  3QOD A;  2RDP A;  2WC2 A;  2EZL A;  1GHC A;  1K6O A;  2O03 A;  3G73 A;  2ZCW A;  2G9W A;  5E3L A;  2EIL H;  2X0L A;  3A02 A;  1EV7 A;  4ON0 A;  1SVM A;  3M07 A;  1BW5 A;  5DM6 F;  1MJB A;  3NRV A;  3PUB A;  1KQ0 A;  3VB2 A;  1I39 A;  1YG2 A;  3PSI A;  5LEK A;  4U7D A;  4ETS A;  2PMH A;  2XRO A;  2XRN A;  1T2K A;  3OYH A;  2L9S A;  1WFX A;  1E3H A;  2OCE A;  1XB4 A;  4RGR A;  4CZC A;  3JRC A;  1IZ1 A;  4IHX A;  1LPQ A;  4PGG A;  4P96 A;  4XLA A;  4C2T A;  2KKO A;  4L5I A;  3M3Y J;  3RIR A;  2K9L A;  1R1V A;  5IT9 Z;  3S32 A;  4UB6 C;  3K2A A;  2K4B A;  4IRI A;  2JPC A;  2QSG X;  2CW0 F;  3HGY A;  3FMS A;  3R0A A;  3N4M A;  3MMY B;  2DPD A;  2HOT A;  4A6D A;  1T38 A;  3I64 A;  5DYM A;  2PG4 A;  5HDK A;  3DV8 A;  1ZAO A;  1PP7 U;  5A2Q Z;  4G9Y A;  3WTS C;  2K3F A;  2WB1 A;  1QPI A;  4OIR F;  1GLN A;  1OIS A;  4IRG A;  4BJ5 C;  4DBQ A;  1P4X A;  2R7U A;  3OR2 C;  1ZN2 A;  5JHF A;  3OS0 A;  3OYD A;  1WJD A;  2XB0 X;  4YRV A;  3IL2 A;  4EMS A;  2WAE A;  2OTJ I;  3RKY A;  2QWW A;  3OYL A;  1ZR2 A;  2L7Z A;  1ZGA A;  5AIP A;  2DA3 A;  3JRB A;  2M45 A;  4A6E A;  2PMU A;  4PFP A;  1A04 A;  3FXO A;  4IJA A;  4OIP F;  1IRG A;  4ESF A;  3RSN A;  3C3W A;  2NAZ A;  1ORK A;  3I0T A;  1TNT A;  2K86 A;  5GPC A;  4E4H A;  1HKS A;  1RKT A;  3H9Q A;  4RM3 A;  4E7S A;  1DP7 P;  1G4D A;  4HRI A;  3CCE I;  4LB5 A;  1J7K A;  3NQO A;  1W4M A;  2DMT A;  3WU2 C;  1IUF A;  2X4H A;  1HCR A;  3K4C A;  3I4M J;  2PI0 A;  3C1D A;  3ASO H;  5JVG F;  1QU3 A;  4RMN A;  1BC7 C;  3I59 B;  2MW8 A;  2LNB A;  2CUZ A;  2CU7 A;  4P5O A;  2MH9 A;  3CC7 I;  4BU2 A;  2GXA A;  4HV5 A;  3PNV A;  3E7L A;  3MWM A;  2UWM A;  4KT5 C;  3FXU A;  3ZGK A;  2D1V A;  2VKH A;  1POG A;  4D1Q A;  4GFB A;  3S8P A;  5DEQ A;  2LRE A;  1DQU A;  4DGW B;  3KE2 A;  5J47 A;  2L9N A;  2DK8 A;  3ZQQ A;  1BBY A;  1QGP A;  2GIV A;  2I8D A;  2BZT A;  4L9T A;  5J6X A;  5KNL A;  4A3K J;  2HPM A;  5IY5 H;  2GXB A;  3GTG J;  2RAE A;  1JGS A;  2H94 A;  2MSY A;  4A5M A;  4CCN A;  4LLL A;  3H3V K;  1UAA A;  4ZYA A;  2HQ5 A;  4II2 A;  1UG0 A;  4LIV A;  2WV0 A;  3V7C A;  4NQW B;  2G0E A; 
#chains in the Genus database with same CATH homology
 1FEX A;  2P81 A;  3LNQ A;  3HBL A;  2QF7 A;  1Z0X A;  3G1M A;  2M9H A;  4C2M J;  2EBI A;  4DZJ A;  2X6O A;  1K83 J;  1T33 A;  2WB1 N;  2XPW A;  2D5V A;  1DU6 A;  2TCT A;  3GTL J;  1B8I A;  1JKP C;  2JWT A;  3HOV J;  4Y7N J;  5F27 A;  2JN6 A;  1TWA J;  2LFB A;  5M5Y J;  3QPS A;  2DA7 A;  1I6H J;  2LKX A;  5M5X J;  4A3F J;  1H8A C;  1BJZ A;  2LD5 A;  4FE7 A;  3IH3 A;  1G2H A;  1ETQ A;  5IYD J;  2H1K A;  2MGQ A;  4JX5 A;  4BBR J;  2HYJ A;  1NK3 P;  1JTY A;  5F0C A;  3SJM A;  5FKL A;  3BTI A;  1GV2 A;  3JRF A;  3I4N J;  4J19 A;  1AKH B;  5F0F A;  1ZK8 A;  2OF7 A;  1NK2 P;  2FX0 A;  3TW7 A;  5IPA A;  3HOW J;  3BR2 A;  3HM5 A;  2COB A;  1NTC A;  2NS7 A;  3S17 J;  1JT6 A;  1XG1 A;  1IC8 A;  1LFU P;  4V2G A;  3HGG A;  4B4C A;  2AHQ A;  1SFO J;  5IOZ A;  1PUF A;  2X48 A;  2DMQ A;  4MFD A;  3JRD A;  3S2H J;  2HOS A;  4QSH A;  4AC0 A;  2R5Z B;  1QRY A;  3S1R J;  3QPL A;  2VKV A;  3Q3S A;  1D5Y A;  5HOD A;  2DA1 A;  4A3M J;  2GBY A;  4DW6 A;  5K7F A;  2I10 A;  3HDD A;  5J1R A;  4I6Z A;  1IG7 A;  3B6A A;  2M2E A;  1B8I B;  1XS9 A;  2EZH A;  2Y9Z A;  3OOU A;  2GM4 A;  4A93 J;  1GV5 A;  1OCT C;  1ETW A;  1S7E A;  1JUS A;  3HOX J;  4XRS A;  2K9N A;  1Y1W J;  4UUS A;  1LE8 A;  4A69 C;  3G1L A;  2Y0S N;  3DCF A;  3S1Q J;  1JUM A;  4Y52 J;  5J3L A;  1GUU A;  2FJ1 A;  1RKW A;  1BA5 A;  4AYB N;  3GTO J;  3IH4 A;  1ZKG A;  4MFE A;  4A3D J;  1YRN A;  5C4J J;  2AO9 A;  3BG5 A;  2WV1 A;  2E1O A;  4FTH A;  4X6A J;  3CQZ J;  5K7Z A;  3GTK J;  4DYR A;  5EG0 A;  2XGE A;  1AKH A;  3TP0 A;  4XID A;  3TW6 A;  2L7M P;  2H8R A;  4BBS J;  3SFI A;  2CUE A;  1ETY A;  1WI3 A;  3BTC A;  4IHV A;  1MBF A;  2K9Q A;  3ZQG A;  1PUF B;  3GTQ J;  1ZR4 A;  3ZOB A;  4HNV A;  1VND A;  1W0U A;  1JGG A;  4BXX J;  2CQQ A;  3FK7 A;  4XIC A;  2JA6 J;  5EGO A;  2R5Y B;  1A6I A;  3MN2 A;  4QIW N;  2IBD A;  2R93 J;  1GDT A;  5GP9 A;  1ENH A;  3K7A J;  2R7Z J;  4DZP A;  2LR8 A;  1U9N A;  2DA6 A;  2DMU A;  4JX4 A;  2O7O A;  4DYQ A;  1UG2 A;  2JMW A;  4MO7 A;  5JLX A;  3FKI J;  2GLO A;  4UUS B;  4M3G A;  1LE8 B;  1HDD C;  3NAU A;  3LSP A;  1HF0 A;  3BTL A;  2R92 J;  2XRL A;  2E2H J;  5F04 A;  1RET A;  1EF4 A;  1VI0 A;  4M6V A;  4M3E A;  3UKG A;  4W97 A;  4D5C A;  1T56 A;  4G12 A;  1R9T J;  4JYK A;  1YRN B;  2Y9Y A;  4M3B A;  2XB5 A;  2LLK A;  3BQY A;  3PO2 J;  3D1N I;  5M5W J;  5FKO A;  5EG0 B;  4FCY A;  1IDY A;  1TWH J;  1IV6 A;  1ITY A;  5F1J A;  3GTP J;  3HOZ J;  1SAN A;  1CQT A;  3MVP A;  2JA5 J;  2XGC A;  3HEF A;  3BG3 A;  1Y1V J;  3G1O A;  3BG9 A;  3ZQF A;  1GT0 C;  2HOA A;  3HKZ N;  2M34 A;  3JRE A;  3BT9 A;  1APL C;  1FIA A;  3S16 J;  1ETK A;  1FTZ A;  5J1U A;  4NDL A;  1ETV A;  2CUF A;  4D5F A;  4JP0 A;  5EGO B;  3ZQC A;  3WHB A;  1HLV A;  2L7F P;  5IYB J;  2LTP A;  3W6V A;  5GPA A;  5IP9 J;  2VUM J;  3C2B A;  5F08 A;  4D7M A;  2DMN A;  2JA7 J;  5C4X J;  2R5Y A;  3BR3 A;  3CDL A;  3ZQL A;  4RDU A;  2HDD A;  5DS9 A;  2YS9 A;  1ZTR A;  3IV5 A;  1BL0 A;  2L9R A;  1AU7 A;  2VPR A;  2M0C A;  5FKM A;  3BR0 A;  1IGN A;  5IOY A;  2OPT A;  1MBG A;  1ZGW A;  4D7N A;  4A3B J;  2Y30 A;  2K40 A;  4IHY A;  4MIM A;  2EH3 A;  3MKL A;  1B72 B;  4IEJ A;  1IJW C;  4IHW A;  4EEF G;  5IP7 J;  3PM1 A;  4BY7 J;  1MBH A;  3ZQI A;  2XPV A;  2NS8 A;  2KT0 A;  3JRH A;  3M4O J;  1TC3 C;  1GVD A;  2X9D A;  1JJ6 C;  1F43 A;  4S0H B;  1JT0 A;  3OSF A;  1JKR C;  2VKE A;  5EZH A;  2CQX A;  2VI6 A;  4V2F A;  3A03 A;  3BQZ A;  2HI3 A;  2TRT A;  4I76 A;  5IYC J;  3Q0W A;  3O8G A;  2ME0 A;  5EZG A;  3GTM J;  1JJ8 C;  4A3J J;  3F0C A;  2DJN A;  2DN0 A;  2ID6 A;  4XRM A;  5FKK A;  3LSR A;  1MBJ A;  4FE4 A;  1O4X A;  2N8G A;  3LSG A;  4DYC A;  1JTX A;  5F0H A;  3S1M J;  1RPW A;  4C3I J;  2Y31 A;  2JK3 A;  3HOU J;  3S2D J;  1WH7 A;  2CRG A;  1MSF C;  2KDZ A;  4FIS A;  1FTT A;  3BR6 A;  2E19 A;  2NOG A;  1FIP A;  2EQR A;  3Q0U A;  5JLW A;  2ELK A;  5EDN A;  3CCY A;  1XC5 A;  1U8B A;  1MBK A;  4M3F A;  4XK4 A;  1JUP A;  2XPU A;  3HB9 A;  3WHC A;  5E3N A;  1E3O C;  4A3E J;  1MH4 A;  1TWF J;  4XRS G;  2NVX J;  1P7J A;  2EZK A;  1BW6 A;  1WPK A;  1B72 A;  2WAQ N;  1DU0 A;  3TP3 A;  3SDG A;  1OJL A;  5IP6 A;  1X58 A;  4C3J J;  4LOC A;  4MLO A;  3LSJ A;  1F36 A;  2K9S A;  3GTJ J;  4BKX A;  3BTJ A;  4A3L J;  1VFC A;  2IEK A;  2L0K A;  5FJ8 J;  1MNM C;  1LFB A;  2NVT J;  1IRZ A;  2LP0 A;  1MBE A;  3A01 A;  2ECC A;  1ZQ3 P;  9ANT A;  3FK6 A;  2DA2 A;  3RQI A;  3RZO J;  4BY1 J;  2EZL A;  4A3G J;  4JX6 A;  4W1U A;  2YU9 J;  5E3L A;  3A02 A;  1JKO C;  5K7H A;  3DEW A;  2HXO A;  1BW5 A;  2QCO A;  1A5J A;  2XSD C;  4CYC A;  5E3O A;  1H88 C;  3JRA A;  2IAI A;  4A3C J;  2B63 J;  3S1N J;  3JRC A;  2LK2 A;  4IHX A;  2JA8 J;  2EZI A;  3B6C A;  2LY9 A;  1HDP A;  2ECB A;  3M3Y J;  1W0T A;  3RKQ A;  2DA4 A;  1TWC J;  5C3E J;  2NVY J;  3K2A A;  2R0Q C;  1TWG J;  1X2M A;  3FIW A;  1I50 J;  3HGY A;  1JKQ C;  3GBG A;  3JR9 A;  1X2N A;  3IH2 A;  3FIS A;  2HOT A;  2O8K A;  5FKN A;  2LVS A;  2W48 A;  4UUT A;  2O9L A;  4AUX A;  1HOM A;  1UHS A;  1RR7 A;  1QPI A;  2HXI A;  3PO3 J;  2E2J J;  1I3Q J;  1WH5 A;  2ZB9 A;  5FLM J;  3BR1 A;  1UMQ A;  2XB0 X;  4L5E A;  3ZQH A;  1ZR2 A;  5M3F J;  2ID3 A;  2L7Z A;  2ME6 A;  2NVQ J;  2DA3 A;  1WCM J;  2M8G X;  3JRB A;  3A01 B;  1Q1V A;  3OSG A;  3OIO A;  4B1R A;  2YUS A;  2CJJ A;  1ORK A;  5GPC A;  2Y2Z A;  1RKT A;  2DMP A;  3VPR A;  3JRI A;  3RZD J;  3S15 J;  5BNG A;  1QVT A;  3TED A;  2DMT A;  1IUF A;  5EF6 A;  1HCR A;  1VF9 A;  5J1Y A;  3I4M J;  1P7I A;  5DTD A;  4CYC B;  5C44 J;  1RES A;  1ETO A;  2MW8 A;  1U78 A;  1MH3 A;  1OFC X;  2MG4 A;  3H0G J;  3NAR A;  1ETX A;  2CU7 A;  1OCP A;  3O8H A;  3QQA A;  5E3M A;  1AHD P;  1FJL A;  3BR5 A;  1H89 C;  4B3A A;  1IDZ A;  3E7L A;  3Q0V A;  5FLV A;  3S14 J;  4X1E A;  4C3H J;  3JRG A;  4QTR A;  1POG A;  4GFB A;  2FQ4 A;  3HOY J;  5EEA A;  4A3I J;  1K61 A;  4RBO A;  1U9O A;  2DTZ A;  1MSE C;  4ABZ A;  4A3K J;  1QVU A;  3GTG J;  3LOC A;  2JJ7 A;  1Z77 A;  2RAE A;  1WGX A;  5EYR A;  2E2I J;  2DA5 A;  2MSY A;  3L1P A;  3CMY A;  4M3D A;  5M3M J;  3H3V K;  2HQ5 A;  2R5Z A;  2FD5 A;  2PMZ N;  2XGD A;  2G0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...