5M3FJ

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m3fJ00
1F43A 1B72B 3DEWA 5FKNA 5F1JA 2ZB9A 2DA3A 5E3MA 1T56A 5F08A 1WPKA 1HF0A 5FKLA 3JRFA 2W48A 2EZIA 3BTJA 1LFBA 3IH4A 1I3QJ 1Q1VA 2M9HA 5J1RA 3QQAA 2CQXA 5FKMA 1Z0XA 1TWCJ 4A3DJ 2KT0A 3BG9A 3C2BA 1FJLA 2JA5J 1IDZA 1IC8A 2L7MP 2XGEA 1FTZA 2JA8J 1OJLA 4A3MJ 1SFOJ 3GTLJ 1F36A 2HXIA 2ECCA 4FE4A 2M2EA 1MSEC 2CU7A 2DJNA 1HDDC 3JRAA 2NVQJ 3S14J 4BY7J 1IGNA 2ID3A 2XB5A 2CRGA 5DTDA 3BT9A 5K7ZA 3D1NI 5DS9A 1JTXA 1QVTA 1MBHA 3ZQLA 3HOXJ 2XPUA 1GV5A 1OCPA 4B3AA 3BR0A 5EF6A 1JUSA 2EZKA 1ETKA 3ZQCA 3JRCA 2HOAA 2EZHA 3MKLA 3M3YJ 4MLOA 4A3JJ 1VNDA 1IJWC 5M5WJ 1IV6A 1I50J 5FLMJ 1ETVA 1JUMA 5IP9J 3BQYA 1ZQ3P 1PUFA 2EQRA 1ETWA 3GTJJ 1MSFC 1JKOC 3S17J 5IYDJ 5F0CA 1MH3A 3OSFA 1RKTA 4MFEA 2NVTJ 5F04A 3G1LA 2YS9A 2HDDA 1T33A 2YUSA 1SANA 1TWGJ 1P7IA 3Q0WA 1DU0A 2L0KA 3HOUJ 2R5YB 4JX5A 4D7NA 3BG5A 2Y9ZA 3JRHA 3JRIA 1GV2A 3G1OA 3LSJA 1VI0A 3H0GJ 4L5EA 3FK7A 2LK2A 3HKZN 3JRDA 5FKOA 3IH3A 4V2GA 1MBEA 4MIMA 2HOTA 2XSDC 4EEFG 2R93J 4NDLA 1R9TJ 1NK2P 3BTIA 2E2JJ 3BR2A 3CMYA 1B72A 3HBLA 2R92J 5EG0B 1JT6A 5GPCA 4RBOA 1ZR2A 3F0CA 4J19A 3CCYA 4A3EJ 3Q0UA 1MNMC 2JN6A 2ME6A 1HOMA 4A69C 4AYBN 2NVYJ 2X6OA 5EYRA 1E3OC 4BBSJ 4M3GA 3O8GA 5K7FA 1S7EA 4M3FA 3BR1A 1LE8B 1AKHB 2DMQA 3K2AA 3VPRA 2LP0A 2H1KA 3LSGA 2JMWA 5IYBJ 5FJ8J 4FTHA 1H8AC 2FX0A 1BJZA 3A01A 1W0UA 3BR6A 1B8IB 2X9DA 4CYCB 4D5CA 1H88C 2CUEA 4A3FJ 3GTMJ 4DYCA 2IBDA 2M8GX 2XGCA 3ZOBA 3BR5A 1AU7A 1JKQC 2DTZA 1JKPC 3LSRA 3HEFA 1Y1WJ 4DZPA 2DA4A 4C3HJ 2NS7A 5FLVA 1ETQA 2DA7A 2K9NA 5JLWA 3GBGA 1WGXA 2K9SA 2O8KA 2WV1A 4FE7A 5IP7J 2GLOA 2MGQA 3OIOA 4UUSB 4A3BJ 2CJJA 3CDLA 1K61A 2O9LA 2KDZA 5J1UA 2YU9J 3Q3SA 1FIPA 1UG2A 4XRSA 2WAQN 2H8RA 1X58A 3A02A 5C3EJ 1MBFA 2DMUA 3HM5A 4W1UA 2Y2ZA 2E1OA 1GUUA 1JJ8C 2TCTA 4I6ZA 2WB1N 1ZKGA 1APLC 1NK3P 1XG1A 3QPLA 1ZR4A 1OCTC 2JA6J 3RZDJ 2XRLA 2QF7A 2R5YA 4GFBA 2L9RA 3QPSA 2N8GA 4V2FA 1I6HJ 1IG7A 3GTKJ 5M3MJ 3JRBA 5M3FJ 1BL0A 3HDDA 4M6VA 5E3LA 4JYKA 2QCOA 2TRTA 2ID6A 2R5ZB 3GTPJ 3ZQIA 4A3CJ 2I10A 1YRNA 2HYJA 3TW6A 3IH2A 1ZK8A 3UKGA 4XRSG 1X2MA 4XICA 1TC3C 2K40A 3RQIA 1JKRC 1NTCA 3CQZJ 1ETOA 2NOGA 3FKIJ 2FJ1A 2NS8A 3S2DJ 5EEAA 2DA2A 1RESA 3BG3A 1UHSA 2LKXA 5EG0A 2PMZN 2IAIA 3FIWA 3TP0A 1TWAJ 5E3NA 3PO3J 2JWTA 1IUFA 1ORKA 1HLVA 3S1QJ 3ZQGA 2DA1A 2VI6A 4Y7NJ 4A3KJ 1AKHA 2DMPA 1AHDP 5F0FA 5F27A 1RETA 3HGGA 4XIDA 2LR8A 3SFIA 4FISA 1BW6A 5EZGA 1U9OA 3S1RJ 1EF4A 4AUXA 3RKQA 3JREA 2Y30A 1X2NA 1HDPA 3PO2J 1UMQA 3W6VA 4QIWN 5C44J 3GTOJ 4IHVA 1QPIA 4W97A 3I4NJ 2RAEA 5J1YA 1BA5A 1U9NA 2X48A 2NVXJ 3WHCA 1MBKA 4BBRJ 3E7LA 4M3EA 3RZOJ 4QTRA 4DYQA 2Y31A 4JP0A 2P81A 2LY9A 3Q0VA 3S1NJ 5HODA 2ELKA 2OPTA 4X1EA 2LD5A 1IDYA 2L7ZA 2M0CA 3ZQHA 2XGDA 3OOUA 5IP6A 2HI3A 5M5YJ 3S15J 4FCYA 3IV5A 1H89C 4IHYA 2VKEA 2XB0X 3HOYJ 2VKVA 3OSGA 1U8BA 5IPAA 2HOSA 4A3IJ 4A93J 3A03A 5IOYA 1WCMJ 3B6CA 2E19A 4DYRA 2O7OA 3B6AA 3DCFA 3H3VK 1XS9A 4Y52J 4D7MA 2JK3A 1FEXA 3SJMA 1GVDA 4IHXA 1U78A 1GT0C 2E2IJ 3HOZJ 2LFBA 2M34A 2LTPA 3HOWJ 4XRMA 3ZQFA 2B63J 3BR3A 1O4XA 1MBGA 2R5ZA 5IOZA 5EGOB 4HNVA 1TWHJ 2OF7A 2DMTA 3MVPA 3NAUA 1A5JA 3BQZA 1JTYA 3S1MJ 1ETYA 5M5XJ 3SDGA 1DU6A 3TP3A 9ANTA 3A01B 3LOCA 5J3LA 3BTLA 2VUMJ 1RPWA 2VPRA 3PM1A 5BNGA 1XC5A 4A3LJ 2EH3A 2GM4A 2JJ7A 2Y9YA 2IEKA 2CUFA 4AC0A 1POGA 1MH4A 2EBIA 3LNQA 2E2HJ 5C4JJ 1CQTA 4C3JJ 3HGYA 1JT0A 2R7ZJ 1W0TA 4XK4A 2AO9A 4C2MJ 5JLXA 4C3IJ 1VF9A 3I4MJ 1ITYA 5GP9A 4BY1J 4BKXA 1JGGA 4M3BA 2Y0SN 4M3DA 3TEDA 1WH7A 2FQ4A 3FK6A 3TW7A 1FTTA 4DZJA 1HCRA 4I76A 1P7JA 4DW6A 3JRGA 2XPVA 4QSHA 2LVSA 3MN2A 3WHBA 5F0HA 1LFUP 2R0QC 4IHWA 2AHQA 2XPWA 2DA5A 3O8HA 1ENHA 5E3OA 1LE8A 2DA6A 2DMNA 2MG4A 2EZLA 1MBJA 1ETXA 5IYCJ 5EDNA 1G2HA 1Y1VJ 3LSPA 2FD5A 4LOCA 4S0HB 4D5FA 2K9QA 4RDUA 1PUFB 4A3GJ 1ZGWA 1A6IA 4JX6A 4ABZA 3NARA 2D5VA 1YRNB 1GDTA 1RR7A 2HXOA 1RKWA 1QRYA 1FIAA 1B8IA 2CQQA 4CYCA 3HOVJ 3JR9A 3M4OJ 1VFCA 2MW8A 4B1RA 1ZTRA 3BTCA 1WI3A 2DN0A 5EZHA 4JX4A 1JUPA 2G0EA 2LLKA 1OFCX 1BW5A 4IEJA 1JJ6C 2MSYA 1QVUA 4MFDA 3S16J 4UUSA 5GPAA 2JA7J 3FISA 1WH5A 3S2HJ 3GTGJ 2ECBA 2HQ5A 5K7HA 1IRZA 1Z77A 2GBYA 3K7AJ 4UUTA 3L1PA 1D5YA 2L7FP 4G12A 4X6AJ 3G1MA 3GTQJ 4BXXJ 4MO7A 5C4XJ 5EGOA 1TWFJ 4B4CA 3HB9A 5FKKA 2COBA 1K83J 2ME0A
chains in the Genus database with same CATH superfamily
4OWRB 3TDZC 4AM3A 1B72B 3DEWA 3GVAA 4FETA 2W82A 4XR6A 5F1JA 5H6QA 3LFKA 4LIVA 3D0SA 4ENNA 2CMPA 5E3MA 1K7AA 5F08A 3J80Z 1R1UA 1V54H 1Z91A 3T8TA 3J7AY 4N4NB 5FKLA 5J8CA 4HQMA 3BTJA 3WG9A 2FUG2 3T0YA 1YI2I 4A0YA 1S7OA 3TKYA 2CQXA 1Z0XA 2FXAA 3DU5A 1TWCJ 2HKOA 4A0ZA 1K4TA 4A3DJ 2IT0A 3JTGA 4L9TA 2HGCA 5DM7F 4FASD 2JA5J 2O61A 4L0YB 2XKOA 2L7MP 1D0ZA 1OJLA 3JSOA 3BG7A 2M4KA 1F36A 1NHAA 3MFKA 1R71A 1S6LA 3KLOA 1RR8C 5L3CA 4I7HA 4BY7J 2BHYA 2ZJRF 2DDBA 2MLGA 2X51A 3DEEA 1IZ1A 2XHKA 3BLYA 3EETA 4OU0A 4PSWA 4OIRF 1MBHA 2R3SA 3W6JB 3LWFA 3CMEI 3ZQLA 3HOXJ 5HOOA 2K3PA 2XAHA 3KFWX 1DP3A 1R36A 1XCBA 4PFOA 3V4GA 4UV9A 3ECOA 1O3TA 3HIFA 1K78A 1G3TA 3JRCA 3CC7I 2L4AA 4OAYA 3HUGB 4WF2A 5GAHJ 4A3JJ 4KYWA 3FM5A 1IJWC 3F21A 1EH8A 3KPHA 1IV6A 1YIOA 1I50J 1U5TB 3LL7A 3P9CA 4XMYA 3LMMA 3BQYA 3U1DA 2HU9A 3ZN0A 1OYYA 3GTJJ 2BGCA 3QYBA 3S17J 1VQ6I 2Z99A 1HXDA 3KP4A 1YO5C 3DBLB 3VYTB 1ZYRF 5DV5A 2AQFA 2ZMEA 2IA0A 4MFEA 2NVTJ 3A2KA 2DYRH 5F04A 1LDKB 1QBJA 2HDDA 1ODDA 2OZUA 1SANA 1YFHA 1WRJA 1DU0A 3HOUJ 2JSCA 2R5YB 4HLYA 2FOWA 2XUBA 4DIQA 5K5QA 3JRHA 2E1CA 4E7LA 3ZXSA 5CQEA 1F1ZA 4RLQA 4BHBA 3P7NA 3ZR8X 1OLTA 2QKMB 3CP8A 3H0GJ 3FK7A 2LK2A 3EUAA 2MC3A 1HW5A 2FE3A 4HRIA 3IH3A 4XRFA 1MBEA 4MIMA 1PUEE 4CCOA 2XSDC 4C9YA 4BU2A 1BR1A 3TGNA 2NYXA 3M9AA 2WTEA 3BR2A 3LA2A 3GF2A 4YFNF 3KZYA 3HBLA 5DD8A 2R92J 5EG0B 2M45A 3QODA 1W7PA 2VE9A 4A3EJ 1ZH5A 3F8CA 4RB1A 4G7HF 3JAMK 2R7OA 2C6YA 5EYRA 1E3OC 1TBXA 3CMAI 3TOAA 2MC4A 3PUFA 1VQOI 3OY9A 2Z9OA 2VOOA 1AKHB 3ABMH 2DMQA 2XAFA 3QU6A 3AG1H 2W57A 1OCZH 2M5WA 2ICWG 3GWZA 4JOMA 3K2ZA 5D5XB 3DPUA 3LSGA 1LEAA 5IYBJ 1OR7A 2DXIA 2DT7B 2PBIA 1B8IB 4E70A 2MD5A 4CYCB 2CUEA 3BP8A 4A3FJ 2MFZA 3GTMJ 4MEXF 2IBDA 3K70D 3CC4I 2OA4A 4CUGA 2QSFX 1JKPC 2UXXA 5HS8A 3J7YJ 5KCMA 2HQNA 1I1SA 1IUYA 5E8GA 1PYVA 1WGXA 1WJEA 2WV1A 2B7EA 4EM2A 1A6QA 2DJIA 2RN7A 4G6DA 2K27A 2O9LA 1YS7A 4ZTJA 2KDZA 5J1UA 2YU9J 3CJNA 3QOEA 1FIPA 3Q3SA 2WAQN 1X58A 4BE0A 2P0WA 2LBFA 2Y2ZA 3ONQA 2M1BA 1T38A 2E1OA 4HBLA 1OKRA 1ZG3A 2ZJQF 3RKWA 2WB1N 2WAEA 1ZKGA 4IRHA 3FXQA 4M6YA 3J7AO 2LSOA 5LEJA 3KEQA 1IN4A 3L2WA 1WVRA 2QSGX 1XX5A 1UFMA 4ZDPA 1Y8RB 2HKXA 4V2FA 4XL9A 1IG7A 2P4WA 3GTKJ 5M3MJ 4M72A 5GAEJ 5DDGA 1I5ZA 4JYKA 2R5ZB 3GTPJ 3ZMVA 3ZQIA 1JHFA 3M7GA 4RAZA 1YRNA 4EV0A 2B9SA 1QZZA 1WJ5A 5K1YA 3KETA 2DPUA 2R7DA 1O57A 3UKGA 1YQAA 2QUFA 3OIPA 4U7DA 1TQMA 4E7IA 1NTCA 1OISA 3FWEA 2NOGA 2KDOA 1QZEA 4IX7A 3U9GA 4E6KG 2LY1A 2OCEA 2LKXA 4EJUA 5F64A 3OYHA 4XLEA 4EGZA 3TP0A 5E3NA 3LSHA 2IA2A 1ORKA 2QA4I 1DGWY 2OQGA 2IJLA 3S1QJ 3ZQGA 2DA1A 1K78B 4E7JA 2X4HA 2XAGA 3GEZA 3Q5FA 2DYSH 3ZMUA 3DPTA 3SDBA 5E79C 4MEYF 2VBYA 3FX3A 3C3WA 5A2QZ 5JR3A 1D8JA 1CGPA 4C2UA 1YOVB 1I39A 2QGUA 2VXDA 2CO5A 2FEZA 5F1RA 3SFIA 3OR1C 2DDAA 2JVGA 1YITI 2JUGA 4B3XA 5FROA 1KYWA 4BDZA 2PG4A 3KEOA 5ICGA 2BY2A 3ULQB 4NC6A 1XDSA 1XSVA 3W6VA 5C44J 2ZMEB 5E8IA 2IGOA 2OV7A 2X48A 2BY1A 1T2KA 2QQAA 2DFFA 2ZXHA 4BBRJ 2BOLA 3DF8A 1JI8A 4JP0A 2BBYA 3F6VA 3ZQ7A 1IN8A 1SD6A 1XMXA 4X1EA 2LD5A 3KEYA 4WXDA 3ECHA 1IDYA 2LF7A 2M0CA 2Q0OA 3DP7A 3FMSA 3ZQHA 2XGDA 2WA0A 2TDXA 2KIFA 3IV5A 1TZLA 4XOTA 2L9SA 3CCQI 3ABTA 3CCLI 1BIBA 2M30A 4HW0A 2ZXIA 4A3IJ 4Y33A 2E71A 3F3XA 2KMUA 3A03A 2R7VA 4XNFA 2PJRB 1WWXA 3OYLA 3B6CA 1O7FA 3B6AA 1XS9A 4Y52J 2JK3A 4IXAA 1FEXA 4A5NA 1U78A 3OYNA 4YIRX 3C2GA 2Z5UA 3FXOA 1SVMA 2IA1A 1WSUA 3ZQFA 2JTVA 5D8KB 3DEUA 1O4XA 1KQ9A 1R5ID 4HNVA 1TWHJ 1ZRFA 2E1MC 2M0MA 2OF7A 2WAFA 3LA3A 1JTYA 5EEHA 1UELB 2V9PA 3H9GA 1P4AA 2V6CA 1KU3A 2GIZA 9ANTA 4I0AA 3LOCA 4LB6B 2CYYA 1IRXA 1RNLA 3BTLA 3PM1A 3WU1B 4WWCA 2MH9A 2JJ7A 1ZELA 2Y9YA 2CUFA 1M1EB 1POGA 5E20A 1HSTA 5ED4A 4BS9A 2R7WA 1MMSA 2R7ZJ 3DBRB 4FQGA 4XK4A 5E1ZB 3GXOA 5FLXZ 4RAYA 3IC7A 4IQJA 2KIQA 2YR2A 3F8FA 4CICA 5GP9A 2KRFA 3FHNA 4NQWA 3BROA 1WH7A 1YJ9I 2AXTC 3HG9A 3Q9SA 3TW7A 1MZBA 4BJTA 3FXLA 1FTTA 5LHHA 2GAUA 1XSXA 4F91B 1P7JA 4G94A 4DW6A 4ASNA 2HQAA 4XKBA 2EFOA 4PK4A 3MN2A 1LFUP 3EUHC 2R0QC 3I58A 4DBQA 2L3DA 3DV8A 2L9NA 3TQNA 1LE8A 2EA4A 3F9KA 2EIJH 1YW8A 1ZLKA 2O0YA 2MG4A 2EZLA 4PCQA 1Z6RA 1FP1D 2WAQA 1GVJA 1G2HA 4NBQA 3G3ZA 2J5PA 2A69F 3W2WA 2K9QA 1PP8F 3GLLA 2WY8Q 4HF2A 1YRNB 4O5VA 5CJ9A 2HXOA 2Q2EB 4GO1A 1QRYA 1FIAA 3W6KB 3Q9VA 2JPCA 2CFXA 4XONA 2MW8A 3HL2A 4FX4A 3FBIB 1J0RA 3E0JB 2BE5F 5D4RA 3VYSB 4BJ6C 1IRGA 3JSPA 4JX4A 2HFHA 1BW5A 2COMA 2PQ8A 1D3YA 2KJCA 2VN2A 1QVUA 2OTJI 3WTVC 1TQPA 1Z3YA 3A4CA 2VASA 3S16J 1HKSA 4PGHA 4UUSA 2ECBA 5K7HA 1Z77A 1TW2A 4UUTA 3K7AJ 5L3GA 2JT1A 4X0GA 1FSHA 3VSLA 1MIJA 3CMMA 4ITVA 1F4KA 4D0PA 1TLHB 5CVIA 3GX4X 3V7RA 4KT6A 1MGTA 3I55I 2A07F 3VOEA 2Y69H 3IKVA 5GADJ 1OCOH 1R5HA 4U0WA 3EYYA 1F43A 2IGKA 3WTSC 5BPDA 1WPKA 1HF0A 1SAUA 1Z21A 1G3SA 3ZMTA 3MKWB 2XV4S 2EZIA 2IS2A 5DCMA 1I3QJ 1Q1VA 2FBHA 3DBHB 4XBFA 5J1RA 3L7WA 2WWYA 2IGMA 2EIKH 3WTXC 3HPGA 4B48A 1FP2A 5FKMA 2JVHA 1R22A 2FU4A 2G9WA 2DOFA 4HOBA 1FJLA 3FBNB 5LRRA 1GHCA 4HV5A 1IC8A 3GTLJ 2OBPA 2X6WA 2ECCA 2F5EA 2M2EA 3BZCA 4BEHA 3KIOA 3OYAA 2NXNB 2DJNA 2W00A 1USSA 2V79A 3LQRA 4G6QA 4AIHA 2GWRA 1A35A 2X6XA 3L2UA 2XB5A 4XQFA 2CRGA 3KYDB 4BGDA 3GW2A 3D1NI 1HA8A 3CF2A 4XSZF 4IOCF 3WGGA 3H5NA 4CCMA 1JTXA 4BQQA 2G7HA 3M8JA 3H1CA 1S29A 1GV5A 5KVRA 3CJQB 4B3AA 4MTEA 4LB5A 3PFIA 3S93A 3RCOA 4KNYA 2EZKA 2STWA 4RS8A 1Y39A 1LDJA 2EZHA 1H0MA 4M71A 4MLOA 4H0EA 2KRHA 3T5XA 2W4SA 2R7FA 2EINH 3UR3C 2F6CA 1VNDA 1YG2A 5M5WJ 1P4WA 2DK8A 3G4SI 1ZAOA 4AVZA 2VIXA 2E1NA 5IP9J 1JUMA 2MABA 1JE8A 1ZQ3P 3H3UA 1PUFA 4HX4A 1ETWA 2Y0MA 2BY3A 1H9TA 3N97A 1OYIA 4IHTA 1NH3A 5JVTA 1JKOC 2M87A 4NNJA 5IYDJ 3A0BC 4A2UA 1BR2A 5F0CA 3E3VA 3FMRA 3OSFA 1RKTA 1RI7A 1W7PD 2KISA 3K1PA 3J81K 3PNVA 3MKYB 3G1LA 2YS9A 5JFRA 2YUSA 1R7JA 4HEA2 1O3SA 2HNHA 1PDNC 1G59A 1XTAA 2VT3A 4F7ZA 4JX5A 4D7NA 2QBYB 2Y9ZA 1P2FA 1XN7A 3BG6A 2O6GE 1I1GA 2A05A 3BJAA 4UB8C 1X1CA 1Q1HA 4DNCA 4L5EA 3CUQA 4WCGA 3DU6A 4E7HA 1KU9A 2QM3A 3HKZN 5ILVA 3DLLF 3JRDA 2PMUA 2R7QA 1DP7P 4NC8A 1MD0A 1V4RA 2A5WA 4P5OA 4V2GA 3OYDA 1BC7C 5CYVA 3TL4X 5EJCA 3K4JA 1R1VA 5BPIA 1XB4A 2K02A 4NDLA 2LH9A 3RIRA 3DKYA 4CCKA 4WK8F 1K6YA 3K0LA 3I59A 1FYKA 1NK2P 3BTIA 4NQWB 4ZZDA 4BXUA 3CMYA 3V42A 3DXJF 2DODA 1IW7F 2DT5A 1FBUA 1VQ8I 4BDYA 2Z1DA 1Z05A 1BI1A 3BOQA 3F0CA 1ZR2A 1EV7A 3SZPA 1X4PA 2G7UA 3WTUC 1MNMC 3FMQA 3V8LA 4A69C 3OL3A 5LLQA 1J09A 2HYGD 2X6OA 4BBSJ 3DTKA 4F55A 5LRSA 3KX2A 2HVSA 2DW4A 4P9FA 3O8GA 3OYGA 1S7EA 1AA7A 4BL0B 4M3FA 2A3SA 3I3LA 1LE8B 5ILUA 1ZG5A 4XLHA 5B3SH 1Z9CA 4IPAA 1V5GA 4GRIA 3GZ6A 1WJAA 1V5FA 2VC1A 4FTHA 2FX0A 3H35A 3F22A 1WI9A 4OAZA 3A01A 5HNHA 2W85A 4HDVA 3BR6A 4UV8A 3EDPA 1UG0A 2VB6A 1KGSA 4AVPA 1B9NA 4DYCA 1WQ2A 3ZOBA 3BR5A 1AU7A 2VJJA 1SAXA 5FB2A 1T39A 3QP6A 4AD9A 3DQVC 2XKPA 4EJOA 3NEUA 2HS5A 4R8HA 2DA7A 3HJEA 1W5CC 1MDMB 2H27A 1FMVA 4UUSB 4PJNA 1Z67A 2E35A 3KCCA 2CJJA 4U7BA 2H1LA 5CVUA 2LKPA 1YIJI 2A61A 4PJLA 4BE2A 4OMZA 2HYFA 4L0ZB 2DU9A 1BIAA 1H9GA 5L3FA 4KA4A 4KN7X 2EV5A 1MBFA 2B0LA 4IJAA 2K7LA 3HM5A 3F8BA 3U2RA 4EM1A 2V9KA 1GUUA 2DFEA 2TCTA 4P55A 4I6ZA 1JJ8C 2A68F 3KYLA 3QPLA 1ZR4A 1OCTC 3RYRA 4S05A 3RZDJ 1LB2A 2XRLA 2QF7A 4GFBA 2L9RA 2GA1A 4IKFA 2MYSA 3P9KA 4AWXB 4KMUX 4BH9A 1I6HJ 1XGMA 3JRBA 4QWQA 5M3FJ 3S2WA 4M6VA 5E3LA 2BW3A 1BM9A 3ZCOA 2ID6A 1VQ5I 4ZYGA 2BZTA 2I10A 4A3CJ 1R23A 3ZGKA 3TW6A 2F5FA 2Z2SB 3IH2A 3K4NA 1N78A 4DOZA 1X2MA 4V19K 1TC3C 1MJ9A 4G7ZF 1MNDA 2DPDA 2EJRA 2NS8A 1OYWA 5AONA 1FSEA 2RVCA 3S2DJ 2QVOA 4F52A 3QPTA 2DFHA 5DD4A 1W1WE 3HRTA 1YJWI 3OYCA 1U3EM 1QU3A 2PMZN 2ZFWA 3FIWA 2RQPA 2OUMA 4H4KC 2VQGA 1T8IA 2JWTA 1R00A 1HBXG 1LNWA 2VI6A 4Y7NJ 2P5KA 2DMPA 2EFPA 4HNUA 4ZYDA 3OYBA 2W84A 4KIBA 3OL4A 3VWBA 1RETA 5LGUA 4Y15A 4XIDA 3MMYB 3VYUB 5ICCA 3V7CA 4XN0A 2ESHA 5HDNA 4I0BA 1ULYA 2CS3A 1A36A 3RKQA 5CKTA 3JREA 4BNCA 3PQKA 3AFHA 2LC2A 4XORA 3HOSA 3LAJA 4WX9A 3MZYA 4IHVA 3ASOH 2RAEA 2DLLA 2KRCA 2ZBKA 3HHHA 3WHCA 3L2VA 1B6AA 1YTYA 1YX5A 1QO0D 2VBWA 1ONVA 2KP6A 3DTEA 1UAAA 2L9VA 2Y31A 3LSMA 2P81A 4HPQA 2LY9A 1OCRH 5HODA 3AG4H 1XMAA 3CUQB 4M9SA 5IP6A 4HSRA 3G73A 3H5RA 2QLZA 1S72I 2VKEA 2XB0X 4HF0A 3HOYJ 3BCBA 3KP5A 1QNTA 1D8KA 5IPAA 2HOSA 2HZDA 1KYZA 3VB2A 2EFQA 3I59B 2HOEA 4R1HA 3PNYA 1LQ1A 4M74A 1WJBA 2H09A 4LG0B 3GLXA 5J4YA 3CCJI 3C1DA 4DYRA 2VC0A 3H3VK 3DCFA 3I64A 1HKTA 3L00A 2IGNA 4ESBA 4M9XA 3VSKA 4D7MA 3CCSI 4O3MA 3M8EA 5CVJA 3HKZA 3SJMA 1GXPA 2R7SA 4Y17A 3AL0B 2M34A 2LTPA 2HZTA 3GCMA 3FXKA 4CH7A 1TP4A 5FD5A 2UWMA 2B63J 2BEOA 3ERMA 1WKMA 3BR3A 3C2HA 2H6BA 1DPUA 1HC8A 4Z6YA 4K2EA 2D2WA 3KYCB 1YX3A 1Z7UA 1RUNA 3NAUA 4PZJA 1A5JA 3ISPA 3J7ZI 3S1MJ 2O8XA 2F48A 1XPXA 2VBZA 4UHTA 5M5XJ 3SDGA 4UB6C 2UUZA 1Y0NA 4LLLA 3IKTA 1SVOA 3A01B 4HG2A 4PSXA 3SXYA 2ZO4A 1XD7A 1DPRA 5DYMA 3CO7C 1RPWA 2VPRA 1XC5A 5CQGA 2IS6A 3MZ8A 3RKYA 1U8RA 2XF6A 2QQ8A 1J75A 4IZZA 3S3MA 2JA2A 3WTYC 3LNQA 4A6EA 1CQTA 4C3JJ 1QA6A 1Z3XA 1UCRA 4Z2YA 3I4MJ 3BZ6A 5TISC 4Q4ZF 3FXUA 1I27A 4BKXA 2A6TA 2E5ZA 4N4OB 4M3BA 2Y0SN 3TEDA 1E2XA 2FQ4A 3FK6A 2LMDA 4F92B 2V1NA 4YEJA 3H3ZA 4ZYAA 4DZJA 2EFWA 5IY5H 4EJWA 2PMHA 2QZ8A 2DBBA 1RC9A 2Z3YA 4QSHA 2LVSA 3WHBA 3LSKA 2EV6A 4IHWA 5IT9Z 4PJJA 2PLYA 1T6SA 2DA5A 3AG2H 3MCZA 4HX8A 4OMYA 4NC7A 1FWZA 5CPRB 1GXQA 4IRGA 2ELHA 3CCUI 1MBJA 1ETXA 5EDNA 1OCCH 2FD5A 4S0HB 1BI0A 4RDUA 4BQAA 4A3GJ 1L3LA 1WJFA 3QP5A 2BXZA 3M4OJ 1VFCA 1KZHA 1FYMA 5KK1A 1P9QC 2CWEA 2VE8A 1ZTRA 4PDKA 1F9NA 3BTCA 3M8FA 4PJMA 2D1VA 3SQNA 1YW9A 5EZHA 2KHMA 1JJ6C 4FT8A 3GUDA 4MFDA 5E17F 1G6NA 3K1MA 4B44A 1TW3A 4ZDOA 2X85A 5TRDA 3BC8A 5GPAA 4KICA 1TL8A 3GTGJ 3LAPA 2W7NA 2GBYA 1FOYA 1F5TA 1U0JA 1S7AA 1BOBA 2L7FP 4G12A 5GAGJ 3GTQJ 3V7SA 4NB5A 4MO7A 5C4XJ 5EGOA 2BVLA 3HB9A 3HTSB 4YIFA 2QEXI 1K83J 2CG4A 3K9TA 1ZREA 1I3AA 3L2QA 5JHFA 5FKNA 2Y75A 2PMZA 3SZGA 2ZB9A 3WG7H 2KLOA 4RB0A 2JQ7A 3LA7A 1D1AA 1W7PB 1IRFA 3TDUC 1UHMA 4RM2A 2DTRA 2ZKZA 4MGRA 2O03A 3I53A 3WE3A 2W48A 3RYPA 1IAWA 4HF1A 1BI2A 3CCMI 2Q8KA 4ZYHA 2M9HA 3VODA 2NAZA 5CLSA 2NS0A 4EGYA 4IOAF 5FFZA 3I0TA 2KT0A 2A6EF 2W1OA 4NHJA 1FTZA 1U5TC 3RKXA 2LYCA 4YFXF 1SFOJ 2CSOA 2JA8J 1OQYA 2HXIA 4FE4A 3O3KA 2HPIA 1MSEC 1P92A 3OS1A 2H8WA 3HYIA 4EJVA 3OWTA 3S14J 2P8TA 2D1HA 2E5NA 3ABLH 2ID3A 1D0XA 1XGNA 2M4GA 3EYIA 5DTDA 1EA3A 4RGSA 4MQ9F 3AKZA 2DQRA 4BYYA 5HNFA 1DQUA 3N05A 3F8NA 1Z6TA 2WADA 4C30A 5LD2C 3BR0A 5LFAA 4YG2F 4A12A 3M3YJ 1NG7A 2X1CA 2L02A 1ACIA 1SD5A 3OIQA 3S3NA 3E6CC 1LUJB 3K4LA 1S9HA 5GTIC 1WZ2A 1IXCA 4GCVA 1ETVA 2IXSA 5J8FA 3GFJA 3I4PA 5D5VB 1Y0UA 3K4BA 2LBFB 3KP7A 4HDUA 4XLAA 1KU7A 4KT5C 3IAM2 4A6DA 1LFPA 4LMYA 5JHUA 5FRMA 1T33A 2ZCWA 1P7IA 1MJAA 2LKSA 3BG5A 4RM3A 4I2OA 3B02A 3JRIA 5DEQA 3G1OA 2WBMA 5HLGA 3LSJA 3TMOA 3RJPA 1B9MA 1XGOA 3HPHA 3K4KA 2BXYA 4C2TA 5BS6A 4ESFA 1BN5A 1YW7A 2P5LC 2Q1ZB 5FKOA 4UUVA 2IPQX 4XN3A 4ESJA 2HVQA 2BHZA 3OYEA 2R93J 1X1PA 3KZZA 3CLQA 2R7UA 5HS9A 2FRHA 4G9YA 1R9TJ 2M7BA 1U6GA 3L9FA 2E2JJ 2UZKA 3M07A 2OU2A 1HKQA 1B72A 2XAUA 1D5VA 2DO7A 1JT6A 2GIVA 4CSWA 5GPCA 4RBOA 1UZCA 4UVCA 2FBIA 3FXRA 4B8XA 1G3YA 3CTAA 2JN6A 4AYBN 1R1TA 4R79A 3OYIA 4OIPF 3C7JA 4EM0B 2OD5A 4XKWA 4Q5SF 5HVQC 1WJDA 3BR1A 2X0LA 1IO2A 2CW7A 1HW1A 6PAXA 3VPRA 4LLNA 2Y0SA 2LP0A 1E17A 4PUSA 2H1KA 4HNTA 1ON1A 3WGHA 3MAJA 1G8XA 2UXNA 2JMWA 3H9JA 3CCRI 2D45A 1H8AC 2K9LA 4IHSA 1BJZA 2EFNA 2FSWA 2VJ4A 2OQRA 1WFXA 1W0UA 2VODA 4KJZA 2FBKA 2H6CA 5A2QK 1H88C 1LDDA 1K79A 2XAQA 2XGCA 1J5YA 2E60A 3LSRA 5CVVA 1Y1WJ 1X19A 4DZPA 4M6XA 3SYTA 3E5UA 5L3BA 2AS5F 2F4OB 1ETQA 2K9NA 5JLWA 2K9SA 3FXJA 4YELA 1G4DA 2MGQA 4G6TB 1NG6A 2VLAA 1ZRDA 3SEZA 1EH7A 5B66C 1R58A 5GTHC 3BPXA 5D4SA 1UG2A 1RUOA 2FMLA 2H8RA 3ZP5A 4GYGA 2CV0A 4KIGA 3ESWB 5FGMA 5F6FA 2DMUA 2P6SA 4F93B 4W1UA 4XLPF 2FF4A 2XF5A 2OC6A 3HTUA 4UVBA 2F2EA 3ASNH 2KQRA 3RPQA 4BAYA 1HW2A 1NK3P 4GXOA 3P9IA 1XG1A 3HZJA 3T1BA 2EB7A 2R5YA 5K5RA 2E36A 1HSJA 3ERED 2CW0F 4L18B 4ZTFA 1BL0A 1VQ7I 1SFKA 3HDDA 3AG3H 1VQ9I 1ZHFA 2TRTA 2EA2A 1XSDA 1WJCA 4CZCA 4BHPA 3RPUD 3QAHA 3PIPF 5DUIA 3X2QH 1SD7A 4N0BA 1ZK8A 2KIMA 3S32A 4XRSG 4XICA 1YJNI 2CV1A 4QPOA 3TO6A 4B47A 3CD6I 5B5EC 4MTDA 3RQIA 1JKRC 3JAMZ 1ETOA 4ZYEA 3FKIJ 2XGXA 3EUHA 5LEKA 2HQRA 1ZLJA 5EEAA 1S3JA 5D6EA 3BG3A 4AIDA 3WTWC 1UHSA 4EMSA 1ERDA 5EG0A 1MW7A 2ZMEC 1PP7U 2IAIA 2KJBA 1TWAJ 2QWWA 3W3CA 2I5UA 3PO3J 1RRJA 4I98B 1IUFA 3TBIA 1HLVA 2X6YA 2VONA 2VBXA 2RGVA 2VJIA 4A3KJ 1AKHA 2IS1A 1AHDP 3IWZA 4U0VA 2CH0A 5F0FA 1LPQA 1JGSA 1V55H 5E18F 4FISA 5DUKA 1BC8C 2FQ3A 1BW6A 4ZZLA 4ANJA 5H2FC 1TTYA 4Q48A 1EH6A 3D5LA 3S1RJ 1QHGA 1EF4A 2Y30A 3LSIA 3PO2J 1UMQA 4M73A 1UHWA 3TO7A 3GTOJ 4JK1X 4W97A 2XASA 3IRRA 1VQPI 1N77A 2GOXB 1KA8A 3KLNA 1BA5A 2HDWA 2ZXJA 2NVXJ 1C0WA 1MBKA 3RDIA 2QQ9A 4M3EA 4QTRA 2IS4A 1MNEA 3E6DA 5H6RA 3W2VA 4U88A 1DDNA 3DWLE 2DFIA 3Q0VA 3S1NJ 2STTA 1YS6A 2ELKA 2OPTA 4XKVA 2PEXA 3HSEA 1T08B 4IF4A 1YHQI 5M5YJ 4FCYA 1O7LA 5LHGA 2RQQA 4IHYA 1J59A 4ENJA 3HHGA 3I56I 1U8BA 4A93J 2V1XA 4UXNA 5B1AH 3IWFA 3KP6A 4S04A 4L5JA 4PFPA 3QOPA 4HZFA 5DCFA 4KITB 2E19A 1G3WA 2O7OA 3P5JA 4QPQA 2V1UA 5AIPA 3NWTA 3LFUA 4IHXA 2LFBA 2KL4A 4IL6C 1ON2A 2FMYA 1W36C 2HEOA 5HS7A 2RV8A 2O5RA 2F4IA 4FX0A 4LITA 4XRMA 3GFLA 2K85A 3GYHX 2R5ZA 3SHFA 5IOZA 1Z7LA 4LK1F 3OYJA 1D1BA 1IV8A 2DMTA 2A6HF 5J4VA 1SVLA 2FNPA 1FT9A 3AAFA 1DU6A 1TT0A 3KZIC 1ZRCA 3HSRA 3A0HC 3BPVA 1V5EA 4U0YA 1X4OA 4AYBA 5BQTA 2F4MB 2VUMJ 1A04A 3MZHA 1SD4A 5BNGA 5J6XA 1KONA 2VQCA 4A3LJ 5DCMB 2IRFG 4ENMA 2IVMA 2GM4A 2R7TA 5J47A 4AC0A 1BI3A 1FPQA 1LKXA 1MH4A 3U21A 2E2HJ 5C4JJ 1SFXA 1JT0A 2AO9A 5AIQA 1STZA 5K5OA 4B09A 3DFGA 1Z1DA 4IRIA 2QENA 3IP4B 4BEHB 1ITYA 2E1MB 2K86A 4BY1J 5E1WA 1JGGA 4M3DA 2NNNA 3D5RC 1USTA 2LRDA 2E7XA 2ISYA 3BWGA 1X1BA 1W4MA 2EILH 2ESNA 2OAZA 1HCRA 3M1EA 3GFIA 5BMZA 4RB3C 2XPVA 5KAIC 4LG3A 2IW5A 2JZYA 2V7FA 4HYEA 5F0HA 2QQBA 4XKCA 3E6MA 1L0OC 2XPWA 4U87A 3HC7A 4HA8A 3WTTC 4EVIA 4KDPA 3O8HA 1ENHA 4CO8A 2AXLA 2HTJA 2DA6A 3NWSA 3PNTA 2DMNA 3WODF 4ETSA 2M7AA 2V9VA 3FHZA 4LD5A 4BACA 3H0DA 1S5LC 2H94A 3RPUA 5IYCJ 3ZMSA 1Y1VJ 3LSPA 3N4MA 4O6JA 3K4MA 4ZC3A 1U2WA 1XGSA 1VQMI 1PUFB 4G7OF 1ZGWA 4JX6A 4ABZA 2NRAC 4LIUA 2EIMH 3NARA 3BJOA 1IN7A 2D5VA 4KISA 4DQ2A 1RR7A 2RNJA 1RKWA 5H20A 4ZDLA 3CDHA 3W2AA 1J2XA 2CQQA 4BHCA 3HOVJ 3E5XA 4M9ZA 1SC7A 2PX9A 5TJJA 1VQKI 2GA2A 3H5AA 1I6XA 1D0YA 3FKJA 3R6SA 2DN0A 4P9UA 2KZGA 2CUJA 1T0FC 2Y48A 3GFMA 2PJRA 2RC4A 1OFCX 1X1DA 4IEJA 4D1QA 3CC2I 4RMNA 3L2RA 4E7KA 2XROA 2KKOA 3LQQA 3L09A 3FISA 4HQEA 2JA7J 1WH5A 3A1YA 3S2HJ 2HQ5A 5HLTA 1IRZA 4NUBA 3L1PA 1D5YA 2R7XA 2MBFA 3ABUA 5ICEA 3PQJA 4X6AJ 3E5QA 3G1MA 1EKEA 1FX7A 4BXXJ 4OINF 3QWLA 3BJ6A 1TWFJ 5LHIA 4B4CA 5FKKA 4E4HA 1VQLI 2COBA 4CCLA 4LGWA 1B59A 4A5MA 1XMKA 2EWNA 1SMTA 2L5QA 4CYDA 1RZ4A 1R6RA 2DA3A 1AOYA 3WU2C 1T56A 1ZG1A 1E3HA 1FOWA 4F3QA 4MHGA 5KAFC 4AIJA 3JRFA 1LFBA 3IH4A 3MD2A 2KZVA 3RQ4A 2ZFUA 2JRTA 2K3FA 3QQAA 1SFUA 3C18A 4UY8I 2LDUA 3BG9A 2O3FA 3HOTA 3C2BA 4Y13A 1BOAA 1IDZA 2P5VA 2KFDA 2XGEA 2YX4A 4A3MJ 2OCCH 2LG4A 5LGTA 1FNNA 2I8DA 2CU7A 1HDDC 2R7RA 3RSNA 3JRAA 2NVQJ 1LJ9A 1A31A 1IGNA 2FA5A 3BT9A 5K7ZA 5DS9A 1VTNC 2V26A 1P6RA 2ZSIB 3CP2A 1QVTA 3RI4A 3U1KA 3K70C 2QKLB 2M8EA 2XPUA 4UNOA 4Y3OA 1OCPA 3J80K 3OS2A 4LFUA 5EF6A 4GYIA 1JUSA 3ZQCA 1ETKA 4ON0A 3ZN1A 3MKZA 2HOAA 2RNGA 5D8LB 2K5CA 1R4NB 4YRVA 3MKLA 2YX7A 2X1EA 2NNYA 2DT6A 1QQIA 3VDXA 4J00A 2GXBA 1R5GA 5FLMJ 4RAGA 2CQKA 2DAOA 3BCAA 2EQRA 1QZYA 1MSFC 2RKHA 2Q2EA 3DPLC 1IF1A 3I71A 1ZARA 4KN4X 1MH3A 2L4MA 4Y4RA 3R60A 3B73A 3MWMA 1TWGJ 3Q0WA 2P7CB 2L0KA 3IAS2 4I99C 2QYOA 4I01A 3IHUA 3L2CA 3CCVI 2CGPA 4XLFA 4UVAA 1GV2A 2GZWA 1HQCA 4IO9F 1BJAA 2BW3B 4ZH4F 2YU3A 3IUOA 4II2A 3OOPA 1UJ8A 1VI0A 1OPCA 3FF5A 1X1AA 2WC2A 3SEQA 2LOOA 4P96A 1QGPA 2HOTA 4OIOF 4EEFG 3OYMA 3R0AA 3SZTA 3WGIA 3VEPA 4CXFA 3OR2C 2ZJPF 3R4KA 3O2PE 4EJTA 4E7SA 2W24A 1FBQA 4J19A 1T0FA 2K4BA 3CCYA 2XC7A 2ACJA 2VPLA 3Q0UA 3S3OA 2J5OA 1HOMA 2ME6A 1D1CA 5EEGA 3WTZA 2NVYJ 2QSHX 1CF7A 2ZJ2A 2CQNA 2GQQA 4M3GA 1GLNA 5FO5A 3UNGC 3GO5A 3ABKH 1KQ0A 5ERIA 5K7FA 1RIOH 4RGXA 1R49A 4MQVA 1E0EA 2FOKA 3K2AA 4KUMA 4MNUA 2DI3A 4XSXF 1YYVA 2K4JA 1UB9A 2DOEA 5FJ8J 4ENKA 2VT2A 3ROUA 2HVRA 1IN5A 5D6FA 2EK5A 4HAMA 4WXCA 3TO9A 3HRMA 2X9DA 2ZC2A 3MEXA 4D5CA 3GMEA 3FM3A 4RLFA 1K6OA 3LSTA 2M8GX 4PGGA 1XDUA 2Z33A 3CJTB 1LEBA 1JKQC 2DTZA 3CLOA 3CZ6A 3HEFA 2PJPA 4BE1A 2DA4A 4C3HJ 5J40A 4DBRA 4AIKA 2NS7A 5FLVA 5E1XA 4RA2A 3K10A 3GBGA 2O8KA 2DCEA 4FE7A 2F5DA 5IP7J 4N9HA 3KE2A 3DLAA 3OIOA 3QPHA 2BV6A 2GLOA 3K6GA 4A3BJ 1R4MB 2XRNA 3CDLA 1K61A 1MMNA 2ZSHB 4GGGA 1YLFA 2ZNYA 3J81Z 4EATA 1LVAA 4RB2C 1B4AA 4XRSA 1FOXA 1TNSA 1IXRC 2VKDA 2WV0A 3K69A 4II3A 2ELJA 4CCNA 3REOA 3A02A 5C3EJ 4RGUA 3D5SC 1KQ8A 3F6OA 2XVCA 5DM6F 3E97A 4KMFA 1DGRM 3QYEA 1APLC 3ELKA 2JA6J 3QPSA 4AU7A 1MMAA 2N8GA 3CUOA 2QBYA 3FDYA 2E7WA 3KP3A 4DJAA 2PN6A 2QCOA 2F5CA 3MQ0A 3ZMDA 2HYJA 1ZGAA 2VJ5A 4A0XA 4JQFA 1P4XA 4CDGA 3T8RA 3HXLA 2K40A 1B1BA 3BDDA 2KPMA 3CQZJ 5KHDA 3H36A 2FJ1A 3CJRB 4HV6A 1MJBA 2DA2A 1RESA 1BR4A 3E1SA 3SFZA 2V4JC 2DK5A 4XM3A 1QPMA 4L5IA 3GZ5A 1E3PA 2LF8A 3DKWA 4BQOA 1FMWA 3OV8A 4EQQA 2JRMA 3HSFA 2CV2A 3KP2A 3OYKA 2JSPA 1N25A 2L54A 3PL8A 1Y56A 4CCJA 1JXSA 3M1CA 2ADUA 2ZNZA 3CUQC 4Q47A 5F27A 2P6TA 1MKMA 2YSRA 5JVGF 3HGGA 1N75A 3PIOF 2LR8A 2XAJA 1ZN2A 2AQEA 1S8NA 3E6BA 5EZGA 1W5SA 1U9OA 4BUPA 4KFCA 4L9JA 4AUXA 2WB1A 4PJ0C 1W5TA 1X2NA 1HDPA 2VOPA 1KU2A 5B1BH 4QIWN 3DTIA 3OYFA 1QPIA 3I4NJ 2XF7A 5L3DA 5J1YA 1SFEA 1FY7A 1U9NA 3BZKA 1X3ZB 3F23A 3E7LA 1FOKA 3RZOJ 3EUKL 3AL0C 4DYQA 3NRVA 2OZ6A 4BJ5C 5IT9K 2E34A 1DUXC 1MDMA 1IXSB 2FNAA 2LY2A 2CUZA 4ZJZA 1Y6IA 1ZGJA 2R4GA 2L7ZA 3V8KA 5LBQA 3OOUA 3ZMZA 2HI3A 4RGRA 5ILSA 3S15J 1H89C 3EPZA 3RTRA 4J01A 2IP2A 2VKVA 2WY7Q 3OSGA 2GXAA 3JCUC 1WHUA 1VQNI 3VYRB 5IOYA 1FC3A 4XLNF 1MMDA 3PSFA 3WE2A 3TOBA 1WCMJ 3O6BB 4HX7A 4HLXA 5CVRA 5HLHA 1T98A 3K1NA 5HDKA 3HUGA 2XSJC 1GVDA 1GT0C 2E2IJ 3HOZJ 2P7VB 3WU0A 2EPFA 2K9MA 1CF7B 2BYVE 1U5TA 4XOPA 3HOWJ 3I54A 2ISZA 2GOMA 4P1WA 1MBGA 2HWVA 4I09A 3NQOA 5FFXA 5EGOB 5FD6A 2M3AA 3CDIA 1VZ0A 4QLCU 5KNLA 3VFZA 3OS0A 1TQIA 3MVPA 3BQZA 5ICFA 5JI6A 4RAFA 1MMGA 1ETYA 1X3WB 4LLGF 2NVUB 5D5WB 1J7KA 2OJED 2MLKA 4L9NA 1LVKA 3PUBA 3TP3A 3IRQA 3GZNB 3JTHA 3CF5F 3ZQQA 2VKHA 5J3LA 2VXZA 5IT3A 3I9V2 2X1DA 2Z16A 3G6EI 2EH3A 4D9JA 2DOAA 4E7ZA 2HDCA 3EQLF 2A5YB 4BQNA 2CFOA 2IEKA 1PJRA 2EBIA 2CW8A 2XDVA 2YPRA 3OMYA 3QYFA 4TV7A 2BVMA 2V6EA 3S8PA 1V3FA 3HGYA 1W0TA 2V1DA 4C2MJ 1FZPB 2DQLA 4HSTA 3FZVA 3JW4A 3H9QA 5TGTA 5JLXA 4JBAA 1VF9A 4C3IJ 2ETHA 2KIUA 4IQ4A 3R61A 4FHTA 4OOIA 4IVNA 5D5UB 4CA0A 1O3RA 1BBYA 3DKXA 1TT5B 3IL2A 1FYLA 3CESA 1Y8QB 3K4CA 1OMIA 2HPMA 1EJ9A 1IN6A 4I76A 4YIIA 2VQLA 3HRUA 4DGWB 3JRGA 2UV1A 2GXGA 4I02A 2VQHA 4WXHA 3PJRA 2CQ7A 1AWCA 1VQ4I 2AHQA 1FLIA 1J9IA 2LREA 2XIGA 5LGNA 3G71I 4BXFA 3HRSA 5E3OA 1TNTA 3H92A 2L01A 5BOXA 4G8XA 2L7KA 2HTSA 3PFYA 3F8MA 3CO6C 2MD0A 4CZZA 1JHHA 3V8JA 4LJZF 4OIQF 2BY0A 2MA3A 3COAC 2W25A 4CHUA 4GDFA 4LOCA 4D5FA 1A6IA 5FLXK 3R0JA 3QU3A 4KIFA 1GDTA 2PI0A 3G2BA 2F5VA 2NOJB 1B8IA 2VL8A 4CYCA 2L2OA 3JR9A 1YE9A 2HR3A 4N9IA 3F72A 2JUCA 4B1RA 2LNBA 1FBSA 1WI3A 2RDPA 1O3QA 1JUPA 2RREA 2G0EA 2LLKA 5HLIA 1QHHD 1X3UA 4LG0A 1SEUA 2MSYA 1K4SA 4B43A 4L9VA 5FRNA 1PVEA 2PFBA 5L3EA 2EV0A 3I5UA 3ML6A 4LK0F 2JPBA 2MH2A 5HDGA 3ZRGA 1W36D 3ZPLA 4XLCA 2OTLI 4YFKF 3FXMA 3CCEI 1REPC 1SMYF 1XCVA 1OR7C 2ZXWH 3BY6A 4CGZA 1T95A 3PSIA 2ME0A 3QRFF
chains in the Genus database with same CATH topology
1F43A 1B72B 3DEWA 5FKNA 5F1JA 2ZB9A 2DA3A 5E3MA 1T56A 5F08A 1WPKA 1HF0A 5FKLA 3JRFA 2W48A 2EZIA 3BTJA 1LFBA 3IH4A 1I3QJ 1Q1VA 2M9HA 5J1RA 3QQAA 2CQXA 5FKMA 1Z0XA 1TWCJ 4A3DJ 2KT0A 3BG9A 3C2BA 1FJLA 2JA5J 1IDZA 1IC8A 2L7MP 2XGEA 1FTZA 2JA8J 1OJLA 4A3MJ 1SFOJ 3GTLJ 1F36A 2HXIA 2ECCA 4FE4A 2M2EA 1MSEC 2CU7A 2DJNA 1HDDC 3JRAA 2NVQJ 3S14J 4BY7J 1IGNA 2ID3A 2XB5A 2CRGA 5DTDA 3BT9A 5K7ZA 3D1NI 5DS9A 1JTXA 1QVTA 1MBHA 3ZQLA 3HOXJ 2XPUA 1GV5A 1OCPA 4B3AA 3BR0A 5EF6A 1JUSA 2EZKA 1ETKA 3ZQCA 3JRCA 2HOAA 2EZHA 3MKLA 3M3YJ 4MLOA 4A3JJ 1VNDA 1IJWC 5M5WJ 1IV6A 1I50J 5FLMJ 1ETVA 1JUMA 5IP9J 3BQYA 1ZQ3P 1PUFA 2EQRA 1ETWA 3GTJJ 1MSFC 1JKOC 3S17J 5IYDJ 5F0CA 1MH3A 3OSFA 1RKTA 4MFEA 2NVTJ 5F04A 3G1LA 2YS9A 2HDDA 1T33A 2YUSA 1SANA 1TWGJ 1P7IA 3Q0WA 1DU0A 2L0KA 3HOUJ 2R5YB 4JX5A 4D7NA 3BG5A 2Y9ZA 3JRHA 3JRIA 1GV2A 3G1OA 3LSJA 1VI0A 3H0GJ 4L5EA 3FK7A 2LK2A 3HKZN 3JRDA 5FKOA 3IH3A 4V2GA 1MBEA 4MIMA 2HOTA 2XSDC 4EEFG 2R93J 4NDLA 1R9TJ 1NK2P 3BTIA 2E2JJ 3BR2A 3CMYA 1B72A 3HBLA 2R92J 5EG0B 1JT6A 5GPCA 4RBOA 1ZR2A 3F0CA 4J19A 3CCYA 4A3EJ 3Q0UA 1MNMC 2JN6A 2ME6A 1HOMA 4A69C 4AYBN 2NVYJ 2X6OA 5EYRA 1E3OC 4BBSJ 4M3GA 3O8GA 5K7FA 1S7EA 4M3FA 3BR1A 1LE8B 1AKHB 2DMQA 3K2AA 3VPRA 2LP0A 2H1KA 3LSGA 2JMWA 5IYBJ 5FJ8J 4FTHA 1H8AC 2FX0A 1BJZA 3A01A 1W0UA 3BR6A 1B8IB 2X9DA 4CYCB 4D5CA 1H88C 2CUEA 4A3FJ 3GTMJ 4DYCA 2IBDA 2M8GX 2XGCA 3ZOBA 3BR5A 1AU7A 1JKQC 2DTZA 1JKPC 3LSRA 3HEFA 1Y1WJ 4DZPA 2DA4A 4C3HJ 2NS7A 5FLVA 1ETQA 2DA7A 2K9NA 5JLWA 3GBGA 1WGXA 2K9SA 2O8KA 2WV1A 4FE7A 5IP7J 2GLOA 2MGQA 3OIOA 4UUSB 4A3BJ 2CJJA 3CDLA 1K61A 2O9LA 2KDZA 5J1UA 2YU9J 3Q3SA 1FIPA 1UG2A 4XRSA 2WAQN 2H8RA 1X58A 3A02A 5C3EJ 1MBFA 2DMUA 3HM5A 4W1UA 2Y2ZA 2E1OA 1GUUA 1JJ8C 2TCTA 4I6ZA 2WB1N 1ZKGA 1APLC 1NK3P 1XG1A 3QPLA 1ZR4A 1OCTC 2JA6J 3RZDJ 2XRLA 2QF7A 2R5YA 4GFBA 2L9RA 3QPSA 2N8GA 4V2FA 1I6HJ 1IG7A 3GTKJ 5M3MJ 3JRBA 5M3FJ 1BL0A 3HDDA 4M6VA 5E3LA 4JYKA 2QCOA 2TRTA 2ID6A 2R5ZB 3GTPJ 3ZQIA 4A3CJ 2I10A 1YRNA 2HYJA 3TW6A 3IH2A 1ZK8A 3UKGA 4XRSG 1X2MA 4XICA 1TC3C 2K40A 3RQIA 1JKRC 1NTCA 3CQZJ 1ETOA 2NOGA 3FKIJ 2FJ1A 2NS8A 3S2DJ 5EEAA 2DA2A 1RESA 3BG3A 1UHSA 2LKXA 5EG0A 2PMZN 2IAIA 3FIWA 3TP0A 1TWAJ 5E3NA 3PO3J 2JWTA 1IUFA 1ORKA 1HLVA 3S1QJ 3ZQGA 2DA1A 2VI6A 4Y7NJ 4A3KJ 1AKHA 2DMPA 1AHDP 5F0FA 5F27A 1RETA 3HGGA 4XIDA 2LR8A 3SFIA 4FISA 1BW6A 5EZGA 1U9OA 3S1RJ 1EF4A 4AUXA 3RKQA 3JREA 2Y30A 1X2NA 1HDPA 3PO2J 1UMQA 3W6VA 4QIWN 5C44J 3GTOJ 4IHVA 1QPIA 4W97A 3I4NJ 2RAEA 5J1YA 1BA5A 1U9NA 2X48A 2NVXJ 3WHCA 1MBKA 4BBRJ 3E7LA 4M3EA 3RZOJ 4QTRA 4DYQA 2Y31A 4JP0A 2P81A 2LY9A 3Q0VA 3S1NJ 5HODA 2ELKA 2OPTA 4X1EA 2LD5A 1IDYA 2L7ZA 2M0CA 3ZQHA 2XGDA 3OOUA 5IP6A 2HI3A 5M5YJ 3S15J 4FCYA 3IV5A 1H89C 4IHYA 2VKEA 2XB0X 3HOYJ 2VKVA 3OSGA 1U8BA 5IPAA 2HOSA 4A3IJ 4A93J 3A03A 5IOYA 1WCMJ 3B6CA 2E19A 4DYRA 2O7OA 3B6AA 3DCFA 3H3VK 1XS9A 4Y52J 4D7MA 2JK3A 1FEXA 3SJMA 1GVDA 4IHXA 1U78A 1GT0C 2E2IJ 3HOZJ 2LFBA 2M34A 2LTPA 3HOWJ 4XRMA 3ZQFA 2B63J 3BR3A 1O4XA 1MBGA 2R5ZA 5IOZA 5EGOB 4HNVA 1TWHJ 2OF7A 2DMTA 3MVPA 3NAUA 1A5JA 3BQZA 1JTYA 3S1MJ 1ETYA 5M5XJ 3SDGA 1DU6A 3TP3A 9ANTA 3A01B 3LOCA 5J3LA 3BTLA 2VUMJ 1RPWA 2VPRA 3PM1A 5BNGA 1XC5A 4A3LJ 2EH3A 2GM4A 2JJ7A 2Y9YA 2IEKA 2CUFA 4AC0A 1POGA 1MH4A 2EBIA 3LNQA 2E2HJ 5C4JJ 1CQTA 4C3JJ 3HGYA 1JT0A 2R7ZJ 1W0TA 4XK4A 2AO9A 4C2MJ 5JLXA 4C3IJ 1VF9A 3I4MJ 1ITYA 5GP9A 4BY1J 4BKXA 1JGGA 4M3BA 2Y0SN 4M3DA 3TEDA 1WH7A 2FQ4A 3FK6A 3TW7A 1FTTA 4DZJA 1HCRA 4I76A 1P7JA 4DW6A 3JRGA 2XPVA 4QSHA 2LVSA 3MN2A 3WHBA 5F0HA 1LFUP 2R0QC 4IHWA 2AHQA 2XPWA 2DA5A 3O8HA 1ENHA 5E3OA 1LE8A 2DA6A 2DMNA 2MG4A 2EZLA 1MBJA 1ETXA 5IYCJ 5EDNA 1G2HA 1Y1VJ 3LSPA 2FD5A 4LOCA 4S0HB 4D5FA 2K9QA 4RDUA 1PUFB 4A3GJ 1ZGWA 1A6IA 4JX6A 4ABZA 3NARA 2D5VA 1YRNB 1GDTA 1RR7A 2HXOA 1RKWA 1QRYA 1FIAA 1B8IA 2CQQA 4CYCA 3HOVJ 3JR9A 3M4OJ 1VFCA 2MW8A 4B1RA 1ZTRA 3BTCA 1WI3A 2DN0A 5EZHA 4JX4A 1JUPA 2G0EA 2LLKA 1OFCX 1BW5A 4IEJA 1JJ6C 2MSYA 1QVUA 4MFDA 3S16J 4UUSA 5GPAA 2JA7J 3FISA 1WH5A 3S2HJ 3GTGJ 2ECBA 2HQ5A 5K7HA 1IRZA 1Z77A 2GBYA 3K7AJ 4UUTA 3L1PA 1D5YA 2L7FP 4G12A 4X6AJ 3G1MA 3GTQJ 4BXXJ 4MO7A 5C4XJ 5EGOA 1TWFJ 4B4CA 3HB9A 5FKKA 2COBA 1K83J 2ME0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F43 A;  1B72 B;  3DEW A;  5FKN A;  5F1J A;  2ZB9 A;  2DA3 A;  5E3M A;  1T56 A;  5F08 A;  1WPK A;  1HF0 A;  5FKL A;  3JRF A;  2W48 A;  2EZI A;  3BTJ A;  1LFB A;  3IH4 A;  1I3Q J;  1Q1V A;  2M9H A;  5J1R A;  3QQA A;  2CQX A;  5FKM A;  1Z0X A;  1TWC J;  4A3D J;  2KT0 A;  3BG9 A;  3C2B A;  1FJL A;  2JA5 J;  1IDZ A;  1IC8 A;  2L7M P;  2XGE A;  1FTZ A;  2JA8 J;  1OJL A;  4A3M J;  1SFO J;  3GTL J;  1F36 A;  2HXI A;  2ECC A;  4FE4 A;  2M2E A;  1MSE C;  2CU7 A;  2DJN A;  1HDD C;  3JRA A;  2NVQ J;  3S14 J;  4BY7 J;  1IGN A;  2ID3 A;  2XB5 A;  2CRG A;  5DTD A;  3BT9 A;  5K7Z A;  3D1N I;  5DS9 A;  1JTX A;  1QVT A;  1MBH A;  3ZQL A;  3HOX J;  2XPU A;  1GV5 A;  1OCP A;  4B3A A;  3BR0 A;  5EF6 A;  1JUS A;  2EZK A;  1ETK A;  3ZQC A;  3JRC A;  2HOA A;  2EZH A;  3MKL A;  3M3Y J;  4MLO A;  4A3J J;  1VND A;  1IJW C;  5M5W J;  1IV6 A;  1I50 J;  5FLM J;  1ETV A;  1JUM A;  5IP9 J;  3BQY A;  1ZQ3 P;  1PUF A;  2EQR A;  1ETW A;  3GTJ J;  1MSF C;  1JKO C;  3S17 J;  5IYD J;  5F0C A;  1MH3 A;  3OSF A;  1RKT A;  4MFE A;  2NVT J;  5F04 A;  3G1L A;  2YS9 A;  2HDD A;  1T33 A;  2YUS A;  1SAN A;  1TWG J;  1P7I A;  3Q0W A;  1DU0 A;  2L0K A;  3HOU J;  2R5Y B;  4JX5 A;  4D7N A;  3BG5 A;  2Y9Z A;  3JRH A;  3JRI A;  1GV2 A;  3G1O A;  3LSJ A;  1VI0 A;  3H0G J;  4L5E A;  3FK7 A;  2LK2 A;  3HKZ N;  3JRD A;  5FKO A;  3IH3 A;  4V2G A;  1MBE A;  4MIM A;  2HOT A;  2XSD C;  4EEF G;  2R93 J;  4NDL A;  1R9T J;  1NK2 P;  3BTI A;  2E2J J;  3BR2 A;  3CMY A;  1B72 A;  3HBL A;  2R92 J;  5EG0 B;  1JT6 A;  5GPC A;  4RBO A;  1ZR2 A;  3F0C A;  4J19 A;  3CCY A;  4A3E J;  3Q0U A;  1MNM C;  2JN6 A;  2ME6 A;  1HOM A;  4A69 C;  4AYB N;  2NVY J;  2X6O A;  5EYR A;  1E3O C;  4BBS J;  4M3G A;  3O8G A;  5K7F A;  1S7E A;  4M3F A;  3BR1 A;  1LE8 B;  1AKH B;  2DMQ A;  3K2A A;  3VPR A;  2LP0 A;  2H1K A;  3LSG A;  2JMW A;  5IYB J;  5FJ8 J;  4FTH A;  1H8A C;  2FX0 A;  1BJZ A;  3A01 A;  1W0U A;  3BR6 A;  1B8I B;  2X9D A;  4CYC B;  4D5C A;  1H88 C;  2CUE A;  4A3F J;  3GTM J;  4DYC A;  2IBD A;  2M8G X;  2XGC A;  3ZOB A;  3BR5 A;  1AU7 A;  1JKQ C;  2DTZ A;  1JKP C;  3LSR A;  3HEF A;  1Y1W J;  4DZP A;  2DA4 A;  4C3H J;  2NS7 A;  5FLV A;  1ETQ A;  2DA7 A;  2K9N A;  5JLW A;  3GBG A;  1WGX A;  2K9S A;  2O8K A;  2WV1 A;  4FE7 A;  5IP7 J;  2GLO A;  2MGQ A;  3OIO A;  4UUS B;  4A3B J;  2CJJ A;  3CDL A;  1K61 A;  2O9L A;  2KDZ A;  5J1U A;  2YU9 J;  3Q3S A;  1FIP A;  1UG2 A;  4XRS A;  2WAQ N;  2H8R A;  1X58 A;  3A02 A;  5C3E J;  1MBF A;  2DMU A;  3HM5 A;  4W1U A;  2Y2Z A;  2E1O A;  1GUU A;  1JJ8 C;  2TCT A;  4I6Z A;  2WB1 N;  1ZKG A;  1APL C;  1NK3 P;  1XG1 A;  3QPL A;  1ZR4 A;  1OCT C;  2JA6 J;  3RZD J;  2XRL A;  2QF7 A;  2R5Y A;  4GFB A;  2L9R A;  3QPS A;  2N8G A;  4V2F A;  1I6H J;  1IG7 A;  3GTK J;  5M3M J;  3JRB A;  5M3F J;  1BL0 A;  3HDD A;  4M6V A;  5E3L A;  4JYK A;  2QCO A;  2TRT A;  2ID6 A;  2R5Z B;  3GTP J;  3ZQI A;  4A3C J;  2I10 A;  1YRN A;  2HYJ A;  3TW6 A;  3IH2 A;  1ZK8 A;  3UKG A;  4XRS G;  1X2M A;  4XIC A;  1TC3 C;  2K40 A;  3RQI A;  1JKR C;  1NTC A;  3CQZ J;  1ETO A;  2NOG A;  3FKI J;  2FJ1 A;  2NS8 A;  3S2D J;  5EEA A;  2DA2 A;  1RES A;  3BG3 A;  1UHS A;  2LKX A;  5EG0 A;  2PMZ N;  2IAI A;  3FIW A;  3TP0 A;  1TWA J;  5E3N A;  3PO3 J;  2JWT A;  1IUF A;  1ORK A;  1HLV A;  3S1Q J;  3ZQG A;  2DA1 A;  2VI6 A;  4Y7N J;  4A3K J;  1AKH A;  2DMP A;  1AHD P;  5F0F A;  5F27 A;  1RET A;  3HGG A;  4XID A;  2LR8 A;  3SFI A;  4FIS A;  1BW6 A;  5EZG A;  1U9O A;  3S1R J;  1EF4 A;  4AUX A;  3RKQ A;  3JRE A;  2Y30 A;  1X2N A;  1HDP A;  3PO2 J;  1UMQ A;  3W6V A;  4QIW N;  5C44 J;  3GTO J;  4IHV A;  1QPI A;  4W97 A;  3I4N J;  2RAE A;  5J1Y A;  1BA5 A;  1U9N A;  2X48 A;  2NVX J;  3WHC A;  1MBK A;  4BBR J;  3E7L A;  4M3E A;  3RZO J;  4QTR A;  4DYQ A;  2Y31 A;  4JP0 A;  2P81 A;  2LY9 A;  3Q0V A;  3S1N J;  5HOD A;  2ELK A;  2OPT A;  4X1E A;  2LD5 A;  1IDY A;  2L7Z A;  2M0C A;  3ZQH A;  2XGD A;  3OOU A;  5IP6 A;  2HI3 A;  5M5Y J;  3S15 J;  4FCY A;  3IV5 A;  1H89 C;  4IHY A;  2VKE A;  2XB0 X;  3HOY J;  2VKV A;  3OSG A;  1U8B A;  5IPA A;  2HOS A;  4A3I J;  4A93 J;  3A03 A;  5IOY A;  1WCM J;  3B6C A;  2E19 A;  4DYR A;  2O7O A;  3B6A A;  3DCF A;  3H3V K;  1XS9 A;  4Y52 J;  4D7M A;  2JK3 A;  1FEX A;  3SJM A;  1GVD A;  4IHX A;  1U78 A;  1GT0 C;  2E2I J;  3HOZ J;  2LFB A;  2M34 A;  2LTP A;  3HOW J;  4XRM A;  3ZQF A;  2B63 J;  3BR3 A;  1O4X A;  1MBG A;  2R5Z A;  5IOZ A;  5EGO B;  4HNV A;  1TWH J;  2OF7 A;  2DMT A;  3MVP A;  3NAU A;  1A5J A;  3BQZ A;  1JTY A;  3S1M J;  1ETY A;  5M5X J;  3SDG A;  1DU6 A;  3TP3 A;  9ANT A;  3A01 B;  3LOC A;  5J3L A;  3BTL A;  2VUM J;  1RPW A;  2VPR A;  3PM1 A;  5BNG A;  1XC5 A;  4A3L J;  2EH3 A;  2GM4 A;  2JJ7 A;  2Y9Y A;  2IEK A;  2CUF A;  4AC0 A;  1POG A;  1MH4 A;  2EBI A;  3LNQ A;  2E2H J;  5C4J J;  1CQT A;  4C3J J;  3HGY A;  1JT0 A;  2R7Z J;  1W0T A;  4XK4 A;  2AO9 A;  4C2M J;  5JLX A;  4C3I J;  1VF9 A;  3I4M J;  1ITY A;  5GP9 A;  4BY1 J;  4BKX A;  1JGG A;  4M3B A;  2Y0S N;  4M3D A;  3TED A;  1WH7 A;  2FQ4 A;  3FK6 A;  3TW7 A;  1FTT A;  4DZJ A;  1HCR A;  4I76 A;  1P7J A;  4DW6 A;  3JRG A;  2XPV A;  4QSH A;  2LVS A;  3MN2 A;  3WHB A;  5F0H A;  1LFU P;  2R0Q C;  4IHW A;  2AHQ A;  2XPW A;  2DA5 A;  3O8H A;  1ENH A;  5E3O A;  1LE8 A;  2DA6 A;  2DMN A;  2MG4 A;  2EZL A;  1MBJ A;  1ETX A;  5IYC J;  5EDN A;  1G2H A;  1Y1V J;  3LSP A;  2FD5 A;  4LOC A;  4S0H B;  4D5F A;  2K9Q A;  4RDU A;  1PUF B;  4A3G J;  1ZGW A;  1A6I A;  4JX6 A;  4ABZ A;  3NAR A;  2D5V A;  1YRN B;  1GDT A;  1RR7 A;  2HXO A;  1RKW A;  1QRY A;  1FIA A;  1B8I A;  2CQQ A;  4CYC A;  3HOV J;  3JR9 A;  3M4O J;  1VFC A;  2MW8 A;  4B1R A;  1ZTR A;  3BTC A;  1WI3 A;  2DN0 A;  5EZH A;  4JX4 A;  1JUP A;  2G0E A;  2LLK A;  1OFC X;  1BW5 A;  4IEJ A;  1JJ6 C;  2MSY A;  1QVU A;  4MFD A;  3S16 J;  4UUS A;  5GPA A;  2JA7 J;  3FIS A;  1WH5 A;  3S2H J;  3GTG J;  2ECB A;  2HQ5 A;  5K7H A;  1IRZ A;  1Z77 A;  2GBY A;  3K7A J;  4UUT A;  3L1P A;  1D5Y A;  2L7F P;  4G12 A;  4X6A J;  3G1M A;  3GTQ J;  4BXX J;  4MO7 A;  5C4X J;  5EGO A;  1TWF J;  4B4C A;  3HB9 A;  5FKK A;  2COB A;  1K83 J;  2ME0 A; 
#chains in the Genus database with same CATH topology
 4OWR B;  3TDZ C;  4AM3 A;  1B72 B;  3DEW A;  3GVA A;  4FET A;  2W82 A;  4XR6 A;  5F1J A;  5H6Q A;  3LFK A;  4LIV A;  3D0S A;  4ENN A;  2CMP A;  5E3M A;  1K7A A;  5F08 A;  3J80 Z;  1R1U A;  1V54 H;  1Z91 A;  3T8T A;  3J7A Y;  4N4N B;  5FKL A;  5J8C A;  4HQM A;  3BTJ A;  3WG9 A;  2FUG 2;  3T0Y A;  1YI2 I;  4A0Y A;  1S7O A;  3TKY A;  2CQX A;  1Z0X A;  2FXA A;  3DU5 A;  1TWC J;  2HKO A;  4A0Z A;  1K4T A;  4A3D J;  2IT0 A;  3JTG A;  4L9T A;  2HGC A;  5DM7 F;  4FAS D;  2JA5 J;  2O61 A;  4L0Y B;  2XKO A;  2L7M P;  1D0Z A;  1OJL A;  3JSO A;  3BG7 A;  2M4K A;  1F36 A;  1NHA A;  3MFK A;  1R71 A;  1S6L A;  3KLO A;  1RR8 C;  5L3C A;  4I7H A;  4BY7 J;  2BHY A;  2ZJR F;  2DDB A;  2MLG A;  2X51 A;  3DEE A;  1IZ1 A;  2XHK A;  3BLY A;  3EET A;  4OU0 A;  4PSW A;  4OIR F;  1MBH A;  2R3S A;  3W6J B;  3LWF A;  3CME I;  3ZQL A;  3HOX J;  5HOO A;  2K3P A;  2XAH A;  3KFW X;  1DP3 A;  1R36 A;  1XCB A;  4PFO A;  3V4G A;  4UV9 A;  3ECO A;  1O3T A;  3HIF A;  1K78 A;  1G3T A;  3JRC A;  3CC7 I;  2L4A A;  4OAY A;  3HUG B;  4WF2 A;  5GAH J;  4A3J J;  4KYW A;  3FM5 A;  1IJW C;  3F21 A;  1EH8 A;  3KPH A;  1IV6 A;  1YIO A;  1I50 J;  1U5T B;  3LL7 A;  3P9C A;  4XMY A;  3LMM A;  3BQY A;  3U1D A;  2HU9 A;  3ZN0 A;  1OYY A;  3GTJ J;  2BGC A;  3QYB A;  3S17 J;  1VQ6 I;  2Z99 A;  1HXD A;  3KP4 A;  1YO5 C;  3DBL B;  3VYT B;  1ZYR F;  5DV5 A;  2AQF A;  2ZME A;  2IA0 A;  4MFE A;  2NVT J;  3A2K A;  2DYR H;  5F04 A;  1LDK B;  1QBJ A;  2HDD A;  1ODD A;  2OZU A;  1SAN A;  1YFH A;  1WRJ A;  1DU0 A;  3HOU J;  2JSC A;  2R5Y B;  4HLY A;  2FOW A;  2XUB A;  4DIQ A;  5K5Q A;  3JRH A;  2E1C A;  4E7L A;  3ZXS A;  5CQE A;  1F1Z A;  4RLQ A;  4BHB A;  3P7N A;  3ZR8 X;  1OLT A;  2QKM B;  3CP8 A;  3H0G J;  3FK7 A;  2LK2 A;  3EUA A;  2MC3 A;  1HW5 A;  2FE3 A;  4HRI A;  3IH3 A;  4XRF A;  1MBE A;  4MIM A;  1PUE E;  4CCO A;  2XSD C;  4C9Y A;  4BU2 A;  1BR1 A;  3TGN A;  2NYX A;  3M9A A;  2WTE A;  3BR2 A;  3LA2 A;  3GF2 A;  4YFN F;  3KZY A;  3HBL A;  5DD8 A;  2R92 J;  5EG0 B;  2M45 A;  3QOD A;  1W7P A;  2VE9 A;  4A3E J;  1ZH5 A;  3F8C A;  4RB1 A;  4G7H F;  3JAM K;  2R7O A;  2C6Y A;  5EYR A;  1E3O C;  1TBX A;  3CMA I;  3TOA A;  2MC4 A;  3PUF A;  1VQO I;  3OY9 A;  2Z9O A;  2VOO A;  1AKH B;  3ABM H;  2DMQ A;  2XAF A;  3QU6 A;  3AG1 H;  2W57 A;  1OCZ H;  2M5W A;  2ICW G;  3GWZ A;  4JOM A;  3K2Z A;  5D5X B;  3DPU A;  3LSG A;  1LEA A;  5IYB J;  1OR7 A;  2DXI A;  2DT7 B;  2PBI A;  1B8I B;  4E70 A;  2MD5 A;  4CYC B;  2CUE A;  3BP8 A;  4A3F J;  2MFZ A;  3GTM J;  4MEX F;  2IBD A;  3K70 D;  3CC4 I;  2OA4 A;  4CUG A;  2QSF X;  1JKP C;  2UXX A;  5HS8 A;  3J7Y J;  5KCM A;  2HQN A;  1I1S A;  1IUY A;  5E8G A;  1PYV A;  1WGX A;  1WJE A;  2WV1 A;  2B7E A;  4EM2 A;  1A6Q A;  2DJI A;  2RN7 A;  4G6D A;  2K27 A;  2O9L A;  1YS7 A;  4ZTJ A;  2KDZ A;  5J1U A;  2YU9 J;  3CJN A;  3QOE A;  1FIP A;  3Q3S A;  2WAQ N;  1X58 A;  4BE0 A;  2P0W A;  2LBF A;  2Y2Z A;  3ONQ A;  2M1B A;  1T38 A;  2E1O A;  4HBL A;  1OKR A;  1ZG3 A;  2ZJQ F;  3RKW A;  2WB1 N;  2WAE A;  1ZKG A;  4IRH A;  3FXQ A;  4M6Y A;  3J7A O;  2LSO A;  5LEJ A;  3KEQ A;  1IN4 A;  3L2W A;  1WVR A;  2QSG X;  1XX5 A;  1UFM A;  4ZDP A;  1Y8R B;  2HKX A;  4V2F A;  4XL9 A;  1IG7 A;  2P4W A;  3GTK J;  5M3M J;  4M72 A;  5GAE J;  5DDG A;  1I5Z A;  4JYK A;  2R5Z B;  3GTP J;  3ZMV A;  3ZQI A;  1JHF A;  3M7G A;  4RAZ A;  1YRN A;  4EV0 A;  2B9S A;  1QZZ A;  1WJ5 A;  5K1Y A;  3KET A;  2DPU A;  2R7D A;  1O57 A;  3UKG A;  1YQA A;  2QUF A;  3OIP A;  4U7D A;  1TQM A;  4E7I A;  1NTC A;  1OIS A;  3FWE A;  2NOG A;  2KDO A;  1QZE A;  4IX7 A;  3U9G A;  4E6K G;  2LY1 A;  2OCE A;  2LKX A;  4EJU A;  5F64 A;  3OYH A;  4XLE A;  4EGZ A;  3TP0 A;  5E3N A;  3LSH A;  2IA2 A;  1ORK A;  2QA4 I;  1DGW Y;  2OQG A;  2IJL A;  3S1Q J;  3ZQG A;  2DA1 A;  1K78 B;  4E7J A;  2X4H A;  2XAG A;  3GEZ A;  3Q5F A;  2DYS H;  3ZMU A;  3DPT A;  3SDB A;  5E79 C;  4MEY F;  2VBY A;  3FX3 A;  3C3W A;  5A2Q Z;  5JR3 A;  1D8J A;  1CGP A;  4C2U A;  1YOV B;  1I39 A;  2QGU A;  2VXD A;  2CO5 A;  2FEZ A;  5F1R A;  3SFI A;  3OR1 C;  2DDA A;  2JVG A;  1YIT I;  2JUG A;  4B3X A;  5FRO A;  1KYW A;  4BDZ A;  2PG4 A;  3KEO A;  5ICG A;  2BY2 A;  3ULQ B;  4NC6 A;  1XDS A;  1XSV A;  3W6V A;  5C44 J;  2ZME B;  5E8I A;  2IGO A;  2OV7 A;  2X48 A;  2BY1 A;  1T2K A;  2QQA A;  2DFF A;  2ZXH A;  4BBR J;  2BOL A;  3DF8 A;  1JI8 A;  4JP0 A;  2BBY A;  3F6V A;  3ZQ7 A;  1IN8 A;  1SD6 A;  1XMX A;  4X1E A;  2LD5 A;  3KEY A;  4WXD A;  3ECH A;  1IDY A;  2LF7 A;  2M0C A;  2Q0O A;  3DP7 A;  3FMS A;  3ZQH A;  2XGD A;  2WA0 A;  2TDX A;  2KIF A;  3IV5 A;  1TZL A;  4XOT A;  2L9S A;  3CCQ I;  3ABT A;  3CCL I;  1BIB A;  2M30 A;  4HW0 A;  2ZXI A;  4A3I J;  4Y33 A;  2E71 A;  3F3X A;  2KMU A;  3A03 A;  2R7V A;  4XNF A;  2PJR B;  1WWX A;  3OYL A;  3B6C A;  1O7F A;  3B6A A;  1XS9 A;  4Y52 J;  2JK3 A;  4IXA A;  1FEX A;  4A5N A;  1U78 A;  3OYN A;  4YIR X;  3C2G A;  2Z5U A;  3FXO A;  1SVM A;  2IA1 A;  1WSU A;  3ZQF A;  2JTV A;  5D8K B;  3DEU A;  1O4X A;  1KQ9 A;  1R5I D;  4HNV A;  1TWH J;  1ZRF A;  2E1M C;  2M0M A;  2OF7 A;  2WAF A;  3LA3 A;  1JTY A;  5EEH A;  1UEL B;  2V9P A;  3H9G A;  1P4A A;  2V6C A;  1KU3 A;  2GIZ A;  9ANT A;  4I0A A;  3LOC A;  4LB6 B;  2CYY A;  1IRX A;  1RNL A;  3BTL A;  3PM1 A;  3WU1 B;  4WWC A;  2MH9 A;  2JJ7 A;  1ZEL A;  2Y9Y A;  2CUF A;  1M1E B;  1POG A;  5E20 A;  1HST A;  5ED4 A;  4BS9 A;  2R7W A;  1MMS A;  2R7Z J;  3DBR B;  4FQG A;  4XK4 A;  5E1Z B;  3GXO A;  5FLX Z;  4RAY A;  3IC7 A;  4IQJ A;  2KIQ A;  2YR2 A;  3F8F A;  4CIC A;  5GP9 A;  2KRF A;  3FHN A;  4NQW A;  3BRO A;  1WH7 A;  1YJ9 I;  2AXT C;  3HG9 A;  3Q9S A;  3TW7 A;  1MZB A;  4BJT A;  3FXL A;  1FTT A;  5LHH A;  2GAU A;  1XSX A;  4F91 B;  1P7J A;  4G94 A;  4DW6 A;  4ASN A;  2HQA A;  4XKB A;  2EFO A;  4PK4 A;  3MN2 A;  1LFU P;  3EUH C;  2R0Q C;  3I58 A;  4DBQ A;  2L3D A;  3DV8 A;  2L9N A;  3TQN A;  1LE8 A;  2EA4 A;  3F9K A;  2EIJ H;  1YW8 A;  1ZLK A;  2O0Y A;  2MG4 A;  2EZL A;  4PCQ A;  1Z6R A;  1FP1 D;  2WAQ A;  1GVJ A;  1G2H A;  4NBQ A;  3G3Z A;  2J5P A;  2A69 F;  3W2W A;  2K9Q A;  1PP8 F;  3GLL A;  2WY8 Q;  4HF2 A;  1YRN B;  4O5V A;  5CJ9 A;  2HXO A;  2Q2E B;  4GO1 A;  1QRY A;  1FIA A;  3W6K B;  3Q9V A;  2JPC A;  2CFX A;  4XON A;  2MW8 A;  3HL2 A;  4FX4 A;  3FBI B;  1J0R A;  3E0J B;  2BE5 F;  5D4R A;  3VYS B;  4BJ6 C;  1IRG A;  3JSP A;  4JX4 A;  2HFH A;  1BW5 A;  2COM A;  2PQ8 A;  1D3Y A;  2KJC A;  2VN2 A;  1QVU A;  2OTJ I;  3WTV C;  1TQP A;  1Z3Y A;  3A4C A;  2VAS A;  3S16 J;  1HKS A;  4PGH A;  4UUS A;  2ECB A;  5K7H A;  1Z77 A;  1TW2 A;  4UUT A;  3K7A J;  5L3G A;  2JT1 A;  4X0G A;  1FSH A;  3VSL A;  1MIJ A;  3CMM A;  4ITV A;  1F4K A;  4D0P A;  1TLH B;  5CVI A;  3GX4 X;  3V7R A;  4KT6 A;  1MGT A;  3I55 I;  2A07 F;  3VOE A;  2Y69 H;  3IKV A;  5GAD J;  1OCO H;  1R5H A;  4U0W A;  3EYY A;  1F43 A;  2IGK A;  3WTS C;  5BPD A;  1WPK A;  1HF0 A;  1SAU A;  1Z21 A;  1G3S A;  3ZMT A;  3MKW B;  2XV4 S;  2EZI A;  2IS2 A;  5DCM A;  1I3Q J;  1Q1V A;  2FBH A;  3DBH B;  4XBF A;  5J1R A;  3L7W A;  2WWY A;  2IGM A;  2EIK H;  3WTX C;  3HPG A;  4B48 A;  1FP2 A;  5FKM A;  2JVH A;  1R22 A;  2FU4 A;  2G9W A;  2DOF A;  4HOB A;  1FJL A;  3FBN B;  5LRR A;  1GHC A;  4HV5 A;  1IC8 A;  3GTL J;  2OBP A;  2X6W A;  2ECC A;  2F5E A;  2M2E A;  3BZC A;  4BEH A;  3KIO A;  3OYA A;  2NXN B;  2DJN A;  2W00 A;  1USS A;  2V79 A;  3LQR A;  4G6Q A;  4AIH A;  2GWR A;  1A35 A;  2X6X A;  3L2U A;  2XB5 A;  4XQF A;  2CRG A;  3KYD B;  4BGD A;  3GW2 A;  3D1N I;  1HA8 A;  3CF2 A;  4XSZ F;  4IOC F;  3WGG A;  3H5N A;  4CCM A;  1JTX A;  4BQQ A;  2G7H A;  3M8J A;  3H1C A;  1S29 A;  1GV5 A;  5KVR A;  3CJQ B;  4B3A A;  4MTE A;  4LB5 A;  3PFI A;  3S93 A;  3RCO A;  4KNY A;  2EZK A;  2STW A;  4RS8 A;  1Y39 A;  1LDJ A;  2EZH A;  1H0M A;  4M71 A;  4MLO A;  4H0E A;  2KRH A;  3T5X A;  2W4S A;  2R7F A;  2EIN H;  3UR3 C;  2F6C A;  1VND A;  1YG2 A;  5M5W J;  1P4W A;  2DK8 A;  3G4S I;  1ZAO A;  4AVZ A;  2VIX A;  2E1N A;  5IP9 J;  1JUM A;  2MAB A;  1JE8 A;  1ZQ3 P;  3H3U A;  1PUF A;  4HX4 A;  1ETW A;  2Y0M A;  2BY3 A;  1H9T A;  3N97 A;  1OYI A;  4IHT A;  1NH3 A;  5JVT A;  1JKO C;  2M87 A;  4NNJ A;  5IYD J;  3A0B C;  4A2U A;  1BR2 A;  5F0C A;  3E3V A;  3FMR A;  3OSF A;  1RKT A;  1RI7 A;  1W7P D;  2KIS A;  3K1P A;  3J81 K;  3PNV A;  3MKY B;  3G1L A;  2YS9 A;  5JFR A;  2YUS A;  1R7J A;  4HEA 2;  1O3S A;  2HNH A;  1PDN C;  1G59 A;  1XTA A;  2VT3 A;  4F7Z A;  4JX5 A;  4D7N A;  2QBY B;  2Y9Z A;  1P2F A;  1XN7 A;  3BG6 A;  2O6G E;  1I1G A;  2A05 A;  3BJA A;  4UB8 C;  1X1C A;  1Q1H A;  4DNC A;  4L5E A;  3CUQ A;  4WCG A;  3DU6 A;  4E7H A;  1KU9 A;  2QM3 A;  3HKZ N;  5ILV A;  3DLL F;  3JRD A;  2PMU A;  2R7Q A;  1DP7 P;  4NC8 A;  1MD0 A;  1V4R A;  2A5W A;  4P5O A;  4V2G A;  3OYD A;  1BC7 C;  5CYV A;  3TL4 X;  5EJC A;  3K4J A;  1R1V A;  5BPI A;  1XB4 A;  2K02 A;  4NDL A;  2LH9 A;  3RIR A;  3DKY A;  4CCK A;  4WK8 F;  1K6Y A;  3K0L A;  3I59 A;  1FYK A;  1NK2 P;  3BTI A;  4NQW B;  4ZZD A;  4BXU A;  3CMY A;  3V42 A;  3DXJ F;  2DOD A;  1IW7 F;  2DT5 A;  1FBU A;  1VQ8 I;  4BDY A;  2Z1D A;  1Z05 A;  1BI1 A;  3BOQ A;  3F0C A;  1ZR2 A;  1EV7 A;  3SZP A;  1X4P A;  2G7U A;  3WTU C;  1MNM C;  3FMQ A;  3V8L A;  4A69 C;  3OL3 A;  5LLQ A;  1J09 A;  2HYG D;  2X6O A;  4BBS J;  3DTK A;  4F55 A;  5LRS A;  3KX2 A;  2HVS A;  2DW4 A;  4P9F A;  3O8G A;  3OYG A;  1S7E A;  1AA7 A;  4BL0 B;  4M3F A;  2A3S A;  3I3L A;  1LE8 B;  5ILU A;  1ZG5 A;  4XLH A;  5B3S H;  1Z9C A;  4IPA A;  1V5G A;  4GRI A;  3GZ6 A;  1WJA A;  1V5F A;  2VC1 A;  4FTH A;  2FX0 A;  3H35 A;  3F22 A;  1WI9 A;  4OAZ A;  3A01 A;  5HNH A;  2W85 A;  4HDV A;  3BR6 A;  4UV8 A;  3EDP A;  1UG0 A;  2VB6 A;  1KGS A;  4AVP A;  1B9N A;  4DYC A;  1WQ2 A;  3ZOB A;  3BR5 A;  1AU7 A;  2VJJ A;  1SAX A;  5FB2 A;  1T39 A;  3QP6 A;  4AD9 A;  3DQV C;  2XKP A;  4EJO A;  3NEU A;  2HS5 A;  4R8H A;  2DA7 A;  3HJE A;  1W5C C;  1MDM B;  2H27 A;  1FMV A;  4UUS B;  4PJN A;  1Z67 A;  2E35 A;  3KCC A;  2CJJ A;  4U7B A;  2H1L A;  5CVU A;  2LKP A;  1YIJ I;  2A61 A;  4PJL A;  4BE2 A;  4OMZ A;  2HYF A;  4L0Z B;  2DU9 A;  1BIA A;  1H9G A;  5L3F A;  4KA4 A;  4KN7 X;  2EV5 A;  1MBF A;  2B0L A;  4IJA A;  2K7L A;  3HM5 A;  3F8B A;  3U2R A;  4EM1 A;  2V9K A;  1GUU A;  2DFE A;  2TCT A;  4P55 A;  4I6Z A;  1JJ8 C;  2A68 F;  3KYL A;  3QPL A;  1ZR4 A;  1OCT C;  3RYR A;  4S05 A;  3RZD J;  1LB2 A;  2XRL A;  2QF7 A;  4GFB A;  2L9R A;  2GA1 A;  4IKF A;  2MYS A;  3P9K A;  4AWX B;  4KMU X;  4BH9 A;  1I6H J;  1XGM A;  3JRB A;  4QWQ A;  5M3F J;  3S2W A;  4M6V A;  5E3L A;  2BW3 A;  1BM9 A;  3ZCO A;  2ID6 A;  1VQ5 I;  4ZYG A;  2BZT A;  2I10 A;  4A3C J;  1R23 A;  3ZGK A;  3TW6 A;  2F5F A;  2Z2S B;  3IH2 A;  3K4N A;  1N78 A;  4DOZ A;  1X2M A;  4V19 K;  1TC3 C;  1MJ9 A;  4G7Z F;  1MND A;  2DPD A;  2EJR A;  2NS8 A;  1OYW A;  5AON A;  1FSE A;  2RVC A;  3S2D J;  2QVO A;  4F52 A;  3QPT A;  2DFH A;  5DD4 A;  1W1W E;  3HRT A;  1YJW I;  3OYC A;  1U3E M;  1QU3 A;  2PMZ N;  2ZFW A;  3FIW A;  2RQP A;  2OUM A;  4H4K C;  2VQG A;  1T8I A;  2JWT A;  1R00 A;  1HBX G;  1LNW A;  2VI6 A;  4Y7N J;  2P5K A;  2DMP A;  2EFP A;  4HNU A;  4ZYD A;  3OYB A;  2W84 A;  4KIB A;  3OL4 A;  3VWB A;  1RET A;  5LGU A;  4Y15 A;  4XID A;  3MMY B;  3VYU B;  5ICC A;  3V7C A;  4XN0 A;  2ESH A;  5HDN A;  4I0B A;  1ULY A;  2CS3 A;  1A36 A;  3RKQ A;  5CKT A;  3JRE A;  4BNC A;  3PQK A;  3AFH A;  2LC2 A;  4XOR A;  3HOS A;  3LAJ A;  4WX9 A;  3MZY A;  4IHV A;  3ASO H;  2RAE A;  2DLL A;  2KRC A;  2ZBK A;  3HHH A;  3WHC A;  3L2V A;  1B6A A;  1YTY A;  1YX5 A;  1QO0 D;  2VBW A;  1ONV A;  2KP6 A;  3DTE A;  1UAA A;  2L9V A;  2Y31 A;  3LSM A;  2P81 A;  4HPQ A;  2LY9 A;  1OCR H;  5HOD A;  3AG4 H;  1XMA A;  3CUQ B;  4M9S A;  5IP6 A;  4HSR A;  3G73 A;  3H5R A;  2QLZ A;  1S72 I;  2VKE A;  2XB0 X;  4HF0 A;  3HOY J;  3BCB A;  3KP5 A;  1QNT A;  1D8K A;  5IPA A;  2HOS A;  2HZD A;  1KYZ A;  3VB2 A;  2EFQ A;  3I59 B;  2HOE A;  4R1H A;  3PNY A;  1LQ1 A;  4M74 A;  1WJB A;  2H09 A;  4LG0 B;  3GLX A;  5J4Y A;  3CCJ I;  3C1D A;  4DYR A;  2VC0 A;  3H3V K;  3DCF A;  3I64 A;  1HKT A;  3L00 A;  2IGN A;  4ESB A;  4M9X A;  3VSK A;  4D7M A;  3CCS I;  4O3M A;  3M8E A;  5CVJ A;  3HKZ A;  3SJM A;  1GXP A;  2R7S A;  4Y17 A;  3AL0 B;  2M34 A;  2LTP A;  2HZT A;  3GCM A;  3FXK A;  4CH7 A;  1TP4 A;  5FD5 A;  2UWM A;  2B63 J;  2BEO A;  3ERM A;  1WKM A;  3BR3 A;  3C2H A;  2H6B A;  1DPU A;  1HC8 A;  4Z6Y A;  4K2E A;  2D2W A;  3KYC B;  1YX3 A;  1Z7U A;  1RUN A;  3NAU A;  4PZJ A;  1A5J A;  3ISP A;  3J7Z I;  3S1M J;  2O8X A;  2F48 A;  1XPX A;  2VBZ A;  4UHT A;  5M5X J;  3SDG A;  4UB6 C;  2UUZ A;  1Y0N A;  4LLL A;  3IKT A;  1SVO A;  3A01 B;  4HG2 A;  4PSX A;  3SXY A;  2ZO4 A;  1XD7 A;  1DPR A;  5DYM A;  3CO7 C;  1RPW A;  2VPR A;  1XC5 A;  5CQG A;  2IS6 A;  3MZ8 A;  3RKY A;  1U8R A;  2XF6 A;  2QQ8 A;  1J75 A;  4IZZ A;  3S3M A;  2JA2 A;  3WTY C;  3LNQ A;  4A6E A;  1CQT A;  4C3J J;  1QA6 A;  1Z3X A;  1UCR A;  4Z2Y A;  3I4M J;  3BZ6 A;  5TIS C;  4Q4Z F;  3FXU A;  1I27 A;  4BKX A;  2A6T A;  2E5Z A;  4N4O B;  4M3B A;  2Y0S N;  3TED A;  1E2X A;  2FQ4 A;  3FK6 A;  2LMD A;  4F92 B;  2V1N A;  4YEJ A;  3H3Z A;  4ZYA A;  4DZJ A;  2EFW A;  5IY5 H;  4EJW A;  2PMH A;  2QZ8 A;  2DBB A;  1RC9 A;  2Z3Y A;  4QSH A;  2LVS A;  3WHB A;  3LSK A;  2EV6 A;  4IHW A;  5IT9 Z;  4PJJ A;  2PLY A;  1T6S A;  2DA5 A;  3AG2 H;  3MCZ A;  4HX8 A;  4OMY A;  4NC7 A;  1FWZ A;  5CPR B;  1GXQ A;  4IRG A;  2ELH A;  3CCU I;  1MBJ A;  1ETX A;  5EDN A;  1OCC H;  2FD5 A;  4S0H B;  1BI0 A;  4RDU A;  4BQA A;  4A3G J;  1L3L A;  1WJF A;  3QP5 A;  2BXZ A;  3M4O J;  1VFC A;  1KZH A;  1FYM A;  5KK1 A;  1P9Q C;  2CWE A;  2VE8 A;  1ZTR A;  4PDK A;  1F9N A;  3BTC A;  3M8F A;  4PJM A;  2D1V A;  3SQN A;  1YW9 A;  5EZH A;  2KHM A;  1JJ6 C;  4FT8 A;  3GUD A;  4MFD A;  5E17 F;  1G6N A;  3K1M A;  4B44 A;  1TW3 A;  4ZDO A;  2X85 A;  5TRD A;  3BC8 A;  5GPA A;  4KIC A;  1TL8 A;  3GTG J;  3LAP A;  2W7N A;  2GBY A;  1FOY A;  1F5T A;  1U0J A;  1S7A A;  1BOB A;  2L7F P;  4G12 A;  5GAG J;  3GTQ J;  3V7S A;  4NB5 A;  4MO7 A;  5C4X J;  5EGO A;  2BVL A;  3HB9 A;  3HTS B;  4YIF A;  2QEX I;  1K83 J;  2CG4 A;  3K9T A;  1ZRE A;  1I3A A;  3L2Q A;  5JHF A;  5FKN A;  2Y75 A;  2PMZ A;  3SZG A;  2ZB9 A;  3WG7 H;  2KLO A;  4RB0 A;  2JQ7 A;  3LA7 A;  1D1A A;  1W7P B;  1IRF A;  3TDU C;  1UHM A;  4RM2 A;  2DTR A;  2ZKZ A;  4MGR A;  2O03 A;  3I53 A;  3WE3 A;  2W48 A;  3RYP A;  1IAW A;  4HF1 A;  1BI2 A;  3CCM I;  2Q8K A;  4ZYH A;  2M9H A;  3VOD A;  2NAZ A;  5CLS A;  2NS0 A;  4EGY A;  4IOA F;  5FFZ A;  3I0T A;  2KT0 A;  2A6E F;  2W1O A;  4NHJ A;  1FTZ A;  1U5T C;  3RKX A;  2LYC A;  4YFX F;  1SFO J;  2CSO A;  2JA8 J;  1OQY A;  2HXI A;  4FE4 A;  3O3K A;  2HPI A;  1MSE C;  1P92 A;  3OS1 A;  2H8W A;  3HYI A;  4EJV A;  3OWT A;  3S14 J;  2P8T A;  2D1H A;  2E5N A;  3ABL H;  2ID3 A;  1D0X A;  1XGN A;  2M4G A;  3EYI A;  5DTD A;  1EA3 A;  4RGS A;  4MQ9 F;  3AKZ A;  2DQR A;  4BYY A;  5HNF A;  1DQU A;  3N05 A;  3F8N A;  1Z6T A;  2WAD A;  4C30 A;  5LD2 C;  3BR0 A;  5LFA A;  4YG2 F;  4A12 A;  3M3Y J;  1NG7 A;  2X1C A;  2L02 A;  1ACI A;  1SD5 A;  3OIQ A;  3S3N A;  3E6C C;  1LUJ B;  3K4L A;  1S9H A;  5GTI C;  1WZ2 A;  1IXC A;  4GCV A;  1ETV A;  2IXS A;  5J8F A;  3GFJ A;  3I4P A;  5D5V B;  1Y0U A;  3K4B A;  2LBF B;  3KP7 A;  4HDU A;  4XLA A;  1KU7 A;  4KT5 C;  3IAM 2;  4A6D A;  1LFP A;  4LMY A;  5JHU A;  5FRM A;  1T33 A;  2ZCW A;  1P7I A;  1MJA A;  2LKS A;  3BG5 A;  4RM3 A;  4I2O A;  3B02 A;  3JRI A;  5DEQ A;  3G1O A;  2WBM A;  5HLG A;  3LSJ A;  3TMO A;  3RJP A;  1B9M A;  1XGO A;  3HPH A;  3K4K A;  2BXY A;  4C2T A;  5BS6 A;  4ESF A;  1BN5 A;  1YW7 A;  2P5L C;  2Q1Z B;  5FKO A;  4UUV A;  2IPQ X;  4XN3 A;  4ESJ A;  2HVQ A;  2BHZ A;  3OYE A;  2R93 J;  1X1P A;  3KZZ A;  3CLQ A;  2R7U A;  5HS9 A;  2FRH A;  4G9Y A;  1R9T J;  2M7B A;  1U6G A;  3L9F A;  2E2J J;  2UZK A;  3M07 A;  2OU2 A;  1HKQ A;  1B72 A;  2XAU A;  1D5V A;  2DO7 A;  1JT6 A;  2GIV A;  4CSW A;  5GPC A;  4RBO A;  1UZC A;  4UVC A;  2FBI A;  3FXR A;  4B8X A;  1G3Y A;  3CTA A;  2JN6 A;  4AYB N;  1R1T A;  4R79 A;  3OYI A;  4OIP F;  3C7J A;  4EM0 B;  2OD5 A;  4XKW A;  4Q5S F;  5HVQ C;  1WJD A;  3BR1 A;  2X0L A;  1IO2 A;  2CW7 A;  1HW1 A;  6PAX A;  3VPR A;  4LLN A;  2Y0S A;  2LP0 A;  1E17 A;  4PUS A;  2H1K A;  4HNT A;  1ON1 A;  3WGH A;  3MAJ A;  1G8X A;  2UXN A;  2JMW A;  3H9J A;  3CCR I;  2D45 A;  1H8A C;  2K9L A;  4IHS A;  1BJZ A;  2EFN A;  2FSW A;  2VJ4 A;  2OQR A;  1WFX A;  1W0U A;  2VOD A;  4KJZ A;  2FBK A;  2H6C A;  5A2Q K;  1H88 C;  1LDD A;  1K79 A;  2XAQ A;  2XGC A;  1J5Y A;  2E60 A;  3LSR A;  5CVV A;  1Y1W J;  1X19 A;  4DZP A;  4M6X A;  3SYT A;  3E5U A;  5L3B A;  2AS5 F;  2F4O B;  1ETQ A;  2K9N A;  5JLW A;  2K9S A;  3FXJ A;  4YEL A;  1G4D A;  2MGQ A;  4G6T B;  1NG6 A;  2VLA A;  1ZRD A;  3SEZ A;  1EH7 A;  5B66 C;  1R58 A;  5GTH C;  3BPX A;  5D4S A;  1UG2 A;  1RUO A;  2FML A;  2H8R A;  3ZP5 A;  4GYG A;  2CV0 A;  4KIG A;  3ESW B;  5FGM A;  5F6F A;  2DMU A;  2P6S A;  4F93 B;  4W1U A;  4XLP F;  2FF4 A;  2XF5 A;  2OC6 A;  3HTU A;  4UVB A;  2F2E A;  3ASN H;  2KQR A;  3RPQ A;  4BAY A;  1HW2 A;  1NK3 P;  4GXO A;  3P9I A;  1XG1 A;  3HZJ A;  3T1B A;  2EB7 A;  2R5Y A;  5K5R A;  2E36 A;  1HSJ A;  3ERE D;  2CW0 F;  4L18 B;  4ZTF A;  1BL0 A;  1VQ7 I;  1SFK A;  3HDD A;  3AG3 H;  1VQ9 I;  1ZHF A;  2TRT A;  2EA2 A;  1XSD A;  1WJC A;  4CZC A;  4BHP A;  3RPU D;  3QAH A;  3PIP F;  5DUI A;  3X2Q H;  1SD7 A;  4N0B A;  1ZK8 A;  2KIM A;  3S32 A;  4XRS G;  4XIC A;  1YJN I;  2CV1 A;  4QPO A;  3TO6 A;  4B47 A;  3CD6 I;  5B5E C;  4MTD A;  3RQI A;  1JKR C;  3JAM Z;  1ETO A;  4ZYE A;  3FKI J;  2XGX A;  3EUH A;  5LEK A;  2HQR A;  1ZLJ A;  5EEA A;  1S3J A;  5D6E A;  3BG3 A;  4AID A;  3WTW C;  1UHS A;  4EMS A;  1ERD A;  5EG0 A;  1MW7 A;  2ZME C;  1PP7 U;  2IAI A;  2KJB A;  1TWA J;  2QWW A;  3W3C A;  2I5U A;  3PO3 J;  1RRJ A;  4I98 B;  1IUF A;  3TBI A;  1HLV A;  2X6Y A;  2VON A;  2VBX A;  2RGV A;  2VJI A;  4A3K J;  1AKH A;  2IS1 A;  1AHD P;  3IWZ A;  4U0V A;  2CH0 A;  5F0F A;  1LPQ A;  1JGS A;  1V55 H;  5E18 F;  4FIS A;  5DUK A;  1BC8 C;  2FQ3 A;  1BW6 A;  4ZZL A;  4ANJ A;  5H2F C;  1TTY A;  4Q48 A;  1EH6 A;  3D5L A;  3S1R J;  1QHG A;  1EF4 A;  2Y30 A;  3LSI A;  3PO2 J;  1UMQ A;  4M73 A;  1UHW A;  3TO7 A;  3GTO J;  4JK1 X;  4W97 A;  2XAS A;  3IRR A;  1VQP I;  1N77 A;  2GOX B;  1KA8 A;  3KLN A;  1BA5 A;  2HDW A;  2ZXJ A;  2NVX J;  1C0W A;  1MBK A;  3RDI A;  2QQ9 A;  4M3E A;  4QTR A;  2IS4 A;  1MNE A;  3E6D A;  5H6R A;  3W2V A;  4U88 A;  1DDN A;  3DWL E;  2DFI A;  3Q0V A;  3S1N J;  2STT A;  1YS6 A;  2ELK A;  2OPT A;  4XKV A;  2PEX A;  3HSE A;  1T08 B;  4IF4 A;  1YHQ I;  5M5Y J;  4FCY A;  1O7L A;  5LHG A;  2RQQ A;  4IHY A;  1J59 A;  4ENJ A;  3HHG A;  3I56 I;  1U8B A;  4A93 J;  2V1X A;  4UXN A;  5B1A H;  3IWF A;  3KP6 A;  4S04 A;  4L5J A;  4PFP A;  3QOP A;  4HZF A;  5DCF A;  4KIT B;  2E19 A;  1G3W A;  2O7O A;  3P5J A;  4QPQ A;  2V1U A;  5AIP A;  3NWT A;  3LFU A;  4IHX A;  2LFB A;  2KL4 A;  4IL6 C;  1ON2 A;  2FMY A;  1W36 C;  2HEO A;  5HS7 A;  2RV8 A;  2O5R A;  2F4I A;  4FX0 A;  4LIT A;  4XRM A;  3GFL A;  2K85 A;  3GYH X;  2R5Z A;  3SHF A;  5IOZ A;  1Z7L A;  4LK1 F;  3OYJ A;  1D1B A;  1IV8 A;  2DMT A;  2A6H F;  5J4V A;  1SVL A;  2FNP A;  1FT9 A;  3AAF A;  1DU6 A;  1TT0 A;  3KZI C;  1ZRC A;  3HSR A;  3A0H C;  3BPV A;  1V5E A;  4U0Y A;  1X4O A;  4AYB A;  5BQT A;  2F4M B;  2VUM J;  1A04 A;  3MZH A;  1SD4 A;  5BNG A;  5J6X A;  1KON A;  2VQC A;  4A3L J;  5DCM B;  2IRF G;  4ENM A;  2IVM A;  2GM4 A;  2R7T A;  5J47 A;  4AC0 A;  1BI3 A;  1FPQ A;  1LKX A;  1MH4 A;  3U21 A;  2E2H J;  5C4J J;  1SFX A;  1JT0 A;  2AO9 A;  5AIQ A;  1STZ A;  5K5O A;  4B09 A;  3DFG A;  1Z1D A;  4IRI A;  2QEN A;  3IP4 B;  4BEH B;  1ITY A;  2E1M B;  2K86 A;  4BY1 J;  5E1W A;  1JGG A;  4M3D A;  2NNN A;  3D5R C;  1UST A;  2LRD A;  2E7X A;  2ISY A;  3BWG A;  1X1B A;  1W4M A;  2EIL H;  2ESN A;  2OAZ A;  1HCR A;  3M1E A;  3GFI A;  5BMZ A;  4RB3 C;  2XPV A;  5KAI C;  4LG3 A;  2IW5 A;  2JZY A;  2V7F A;  4HYE A;  5F0H A;  2QQB A;  4XKC A;  3E6M A;  1L0O C;  2XPW A;  4U87 A;  3HC7 A;  4HA8 A;  3WTT C;  4EVI A;  4KDP A;  3O8H A;  1ENH A;  4CO8 A;  2AXL A;  2HTJ A;  2DA6 A;  3NWS A;  3PNT A;  2DMN A;  3WOD F;  4ETS A;  2M7A A;  2V9V A;  3FHZ A;  4LD5 A;  4BAC A;  3H0D A;  1S5L C;  2H94 A;  3RPU A;  5IYC J;  3ZMS A;  1Y1V J;  3LSP A;  3N4M A;  4O6J A;  3K4M A;  4ZC3 A;  1U2W A;  1XGS A;  1VQM I;  1PUF B;  4G7O F;  1ZGW A;  4JX6 A;  4ABZ A;  2NRA C;  4LIU A;  2EIM H;  3NAR A;  3BJO A;  1IN7 A;  2D5V A;  4KIS A;  4DQ2 A;  1RR7 A;  2RNJ A;  1RKW A;  5H20 A;  4ZDL A;  3CDH A;  3W2A A;  1J2X A;  2CQQ A;  4BHC A;  3HOV J;  3E5X A;  4M9Z A;  1SC7 A;  2PX9 A;  5TJJ A;  1VQK I;  2GA2 A;  3H5A A;  1I6X A;  1D0Y A;  3FKJ A;  3R6S A;  2DN0 A;  4P9U A;  2KZG A;  2CUJ A;  1T0F C;  2Y48 A;  3GFM A;  2PJR A;  2RC4 A;  1OFC X;  1X1D A;  4IEJ A;  4D1Q A;  3CC2 I;  4RMN A;  3L2R A;  4E7K A;  2XRO A;  2KKO A;  3LQQ A;  3L09 A;  3FIS A;  4HQE A;  2JA7 J;  1WH5 A;  3A1Y A;  3S2H J;  2HQ5 A;  5HLT A;  1IRZ A;  4NUB A;  3L1P A;  1D5Y A;  2R7X A;  2MBF A;  3ABU A;  5ICE A;  3PQJ A;  4X6A J;  3E5Q A;  3G1M A;  1EKE A;  1FX7 A;  4BXX J;  4OIN F;  3QWL A;  3BJ6 A;  1TWF J;  5LHI A;  4B4C A;  5FKK A;  4E4H A;  1VQL I;  2COB A;  4CCL A;  4LGW A;  1B59 A;  4A5M A;  1XMK A;  2EWN A;  1SMT A;  2L5Q A;  4CYD A;  1RZ4 A;  1R6R A;  2DA3 A;  1AOY A;  3WU2 C;  1T56 A;  1ZG1 A;  1E3H A;  1FOW A;  4F3Q A;  4MHG A;  5KAF C;  4AIJ A;  3JRF A;  1LFB A;  3IH4 A;  3MD2 A;  2KZV A;  3RQ4 A;  2ZFU A;  2JRT A;  2K3F A;  3QQA A;  1SFU A;  3C18 A;  4UY8 I;  2LDU A;  3BG9 A;  2O3F A;  3HOT A;  3C2B A;  4Y13 A;  1BOA A;  1IDZ A;  2P5V A;  2KFD A;  2XGE A;  2YX4 A;  4A3M J;  2OCC H;  2LG4 A;  5LGT A;  1FNN A;  2I8D A;  2CU7 A;  1HDD C;  2R7R A;  3RSN A;  3JRA A;  2NVQ J;  1LJ9 A;  1A31 A;  1IGN A;  2FA5 A;  3BT9 A;  5K7Z A;  5DS9 A;  1VTN C;  2V26 A;  1P6R A;  2ZSI B;  3CP2 A;  1QVT A;  3RI4 A;  3U1K A;  3K70 C;  2QKL B;  2M8E A;  2XPU A;  4UNO A;  4Y3O A;  1OCP A;  3J80 K;  3OS2 A;  4LFU A;  5EF6 A;  4GYI A;  1JUS A;  3ZQC A;  1ETK A;  4ON0 A;  3ZN1 A;  3MKZ A;  2HOA A;  2RNG A;  5D8L B;  2K5C A;  1R4N B;  4YRV A;  3MKL A;  2YX7 A;  2X1E A;  2NNY A;  2DT6 A;  1QQI A;  3VDX A;  4J00 A;  2GXB A;  1R5G A;  5FLM J;  4RAG A;  2CQK A;  2DAO A;  3BCA A;  2EQR A;  1QZY A;  1MSF C;  2RKH A;  2Q2E A;  3DPL C;  1IF1 A;  3I71 A;  1ZAR A;  4KN4 X;  1MH3 A;  2L4M A;  4Y4R A;  3R60 A;  3B73 A;  3MWM A;  1TWG J;  3Q0W A;  2P7C B;  2L0K A;  3IAS 2;  4I99 C;  2QYO A;  4I01 A;  3IHU A;  3L2C A;  3CCV I;  2CGP A;  4XLF A;  4UVA A;  1GV2 A;  2GZW A;  1HQC A;  4IO9 F;  1BJA A;  2BW3 B;  4ZH4 F;  2YU3 A;  3IUO A;  4II2 A;  3OOP A;  1UJ8 A;  1VI0 A;  1OPC A;  3FF5 A;  1X1A A;  2WC2 A;  3SEQ A;  2LOO A;  4P96 A;  1QGP A;  2HOT A;  4OIO F;  4EEF G;  3OYM A;  3R0A A;  3SZT A;  3WGI A;  3VEP A;  4CXF A;  3OR2 C;  2ZJP F;  3R4K A;  3O2P E;  4EJT A;  4E7S A;  2W24 A;  1FBQ A;  4J19 A;  1T0F A;  2K4B A;  3CCY A;  2XC7 A;  2ACJ A;  2VPL A;  3Q0U A;  3S3O A;  2J5O A;  1HOM A;  2ME6 A;  1D1C A;  5EEG A;  3WTZ A;  2NVY J;  2QSH X;  1CF7 A;  2ZJ2 A;  2CQN A;  2GQQ A;  4M3G A;  1GLN A;  5FO5 A;  3UNG C;  3GO5 A;  3ABK H;  1KQ0 A;  5ERI A;  5K7F A;  1RIO H;  4RGX A;  1R49 A;  4MQV A;  1E0E A;  2FOK A;  3K2A A;  4KUM A;  4MNU A;  2DI3 A;  4XSX F;  1YYV A;  2K4J A;  1UB9 A;  2DOE A;  5FJ8 J;  4ENK A;  2VT2 A;  3ROU A;  2HVR A;  1IN5 A;  5D6F A;  2EK5 A;  4HAM A;  4WXC A;  3TO9 A;  3HRM A;  2X9D A;  2ZC2 A;  3MEX A;  4D5C A;  3GME A;  3FM3 A;  4RLF A;  1K6O A;  3LST A;  2M8G X;  4PGG A;  1XDU A;  2Z33 A;  3CJT B;  1LEB A;  1JKQ C;  2DTZ A;  3CLO A;  3CZ6 A;  3HEF A;  2PJP A;  4BE1 A;  2DA4 A;  4C3H J;  5J40 A;  4DBR A;  4AIK A;  2NS7 A;  5FLV A;  5E1X A;  4RA2 A;  3K10 A;  3GBG A;  2O8K A;  2DCE A;  4FE7 A;  2F5D A;  5IP7 J;  4N9H A;  3KE2 A;  3DLA A;  3OIO A;  3QPH A;  2BV6 A;  2GLO A;  3K6G A;  4A3B J;  1R4M B;  2XRN A;  3CDL A;  1K61 A;  1MMN A;  2ZSH B;  4GGG A;  1YLF A;  2ZNY A;  3J81 Z;  4EAT A;  1LVA A;  4RB2 C;  1B4A A;  4XRS A;  1FOX A;  1TNS A;  1IXR C;  2VKD A;  2WV0 A;  3K69 A;  4II3 A;  2ELJ A;  4CCN A;  3REO A;  3A02 A;  5C3E J;  4RGU A;  3D5S C;  1KQ8 A;  3F6O A;  2XVC A;  5DM6 F;  3E97 A;  4KMF A;  1DGR M;  3QYE A;  1APL C;  3ELK A;  2JA6 J;  3QPS A;  4AU7 A;  1MMA A;  2N8G A;  3CUO A;  2QBY A;  3FDY A;  2E7W A;  3KP3 A;  4DJA A;  2PN6 A;  2QCO A;  2F5C A;  3MQ0 A;  3ZMD A;  2HYJ A;  1ZGA A;  2VJ5 A;  4A0X A;  4JQF A;  1P4X A;  4CDG A;  3T8R A;  3HXL A;  2K40 A;  1B1B A;  3BDD A;  2KPM A;  3CQZ J;  5KHD A;  3H36 A;  2FJ1 A;  3CJR B;  4HV6 A;  1MJB A;  2DA2 A;  1RES A;  1BR4 A;  3E1S A;  3SFZ A;  2V4J C;  2DK5 A;  4XM3 A;  1QPM A;  4L5I A;  3GZ5 A;  1E3P A;  2LF8 A;  3DKW A;  4BQO A;  1FMW A;  3OV8 A;  4EQQ A;  2JRM A;  3HSF A;  2CV2 A;  3KP2 A;  3OYK A;  2JSP A;  1N25 A;  2L54 A;  3PL8 A;  1Y56 A;  4CCJ A;  1JXS A;  3M1C A;  2ADU A;  2ZNZ A;  3CUQ C;  4Q47 A;  5F27 A;  2P6T A;  1MKM A;  2YSR A;  5JVG F;  3HGG A;  1N75 A;  3PIO F;  2LR8 A;  2XAJ A;  1ZN2 A;  2AQE A;  1S8N A;  3E6B A;  5EZG A;  1W5S A;  1U9O A;  4BUP A;  4KFC A;  4L9J A;  4AUX A;  2WB1 A;  4PJ0 C;  1W5T A;  1X2N A;  1HDP A;  2VOP A;  1KU2 A;  5B1B H;  4QIW N;  3DTI A;  3OYF A;  1QPI A;  3I4N J;  2XF7 A;  5L3D A;  5J1Y A;  1SFE A;  1FY7 A;  1U9N A;  3BZK A;  1X3Z B;  3F23 A;  3E7L A;  1FOK A;  3RZO J;  3EUK L;  3AL0 C;  4DYQ A;  3NRV A;  2OZ6 A;  4BJ5 C;  5IT9 K;  2E34 A;  1DUX C;  1MDM A;  1IXS B;  2FNA A;  2LY2 A;  2CUZ A;  4ZJZ A;  1Y6I A;  1ZGJ A;  2R4G A;  2L7Z A;  3V8K A;  5LBQ A;  3OOU A;  3ZMZ A;  2HI3 A;  4RGR A;  5ILS A;  3S15 J;  1H89 C;  3EPZ A;  3RTR A;  4J01 A;  2IP2 A;  2VKV A;  2WY7 Q;  3OSG A;  2GXA A;  3JCU C;  1WHU A;  1VQN I;  3VYR B;  5IOY A;  1FC3 A;  4XLN F;  1MMD A;  3PSF A;  3WE2 A;  3TOB A;  1WCM J;  3O6B B;  4HX7 A;  4HLX A;  5CVR A;  5HLH A;  1T98 A;  3K1N A;  5HDK A;  3HUG A;  2XSJ C;  1GVD A;  1GT0 C;  2E2I J;  3HOZ J;  2P7V B;  3WU0 A;  2EPF A;  2K9M A;  1CF7 B;  2BYV E;  1U5T A;  4XOP A;  3HOW J;  3I54 A;  2ISZ A;  2GOM A;  4P1W A;  1MBG A;  2HWV A;  4I09 A;  3NQO A;  5FFX A;  5EGO B;  5FD6 A;  2M3A A;  3CDI A;  1VZ0 A;  4QLC U;  5KNL A;  3VFZ A;  3OS0 A;  1TQI A;  3MVP A;  3BQZ A;  5ICF A;  5JI6 A;  4RAF A;  1MMG A;  1ETY A;  1X3W B;  4LLG F;  2NVU B;  5D5W B;  1J7K A;  2OJE D;  2MLK A;  4L9N A;  1LVK A;  3PUB A;  3TP3 A;  3IRQ A;  3GZN B;  3JTH A;  3CF5 F;  3ZQQ A;  2VKH A;  5J3L A;  2VXZ A;  5IT3 A;  3I9V 2;  2X1D A;  2Z16 A;  3G6E I;  2EH3 A;  4D9J A;  2DOA A;  4E7Z A;  2HDC A;  3EQL F;  2A5Y B;  4BQN A;  2CFO A;  2IEK A;  1PJR A;  2EBI A;  2CW8 A;  2XDV A;  2YPR A;  3OMY A;  3QYF A;  4TV7 A;  2BVM A;  2V6E A;  3S8P A;  1V3F A;  3HGY A;  1W0T A;  2V1D A;  4C2M J;  1FZP B;  2DQL A;  4HST A;  3FZV A;  3JW4 A;  3H9Q A;  5TGT A;  5JLX A;  4JBA A;  1VF9 A;  4C3I J;  2ETH A;  2KIU A;  4IQ4 A;  3R61 A;  4FHT A;  4OOI A;  4IVN A;  5D5U B;  4CA0 A;  1O3R A;  1BBY A;  3DKX A;  1TT5 B;  3IL2 A;  1FYL A;  3CES A;  1Y8Q B;  3K4C A;  1OMI A;  2HPM A;  1EJ9 A;  1IN6 A;  4I76 A;  4YII A;  2VQL A;  3HRU A;  4DGW B;  3JRG A;  2UV1 A;  2GXG A;  4I02 A;  2VQH A;  4WXH A;  3PJR A;  2CQ7 A;  1AWC A;  1VQ4 I;  2AHQ A;  1FLI A;  1J9I A;  2LRE A;  2XIG A;  5LGN A;  3G71 I;  4BXF A;  3HRS A;  5E3O A;  1TNT A;  3H92 A;  2L01 A;  5BOX A;  4G8X A;  2L7K A;  2HTS A;  3PFY A;  3F8M A;  3CO6 C;  2MD0 A;  4CZZ A;  1JHH A;  3V8J A;  4LJZ F;  4OIQ F;  2BY0 A;  2MA3 A;  3COA C;  2W25 A;  4CHU A;  4GDF A;  4LOC A;  4D5F A;  1A6I A;  5FLX K;  3R0J A;  3QU3 A;  4KIF A;  1GDT A;  2PI0 A;  3G2B A;  2F5V A;  2NOJ B;  1B8I A;  2VL8 A;  4CYC A;  2L2O A;  3JR9 A;  1YE9 A;  2HR3 A;  4N9I A;  3F72 A;  2JUC A;  4B1R A;  2LNB A;  1FBS A;  1WI3 A;  2RDP A;  1O3Q A;  1JUP A;  2RRE A;  2G0E A;  2LLK A;  5HLI A;  1QHH D;  1X3U A;  4LG0 A;  1SEU A;  2MSY A;  1K4S A;  4B43 A;  4L9V A;  5FRN A;  1PVE A;  2PFB A;  5L3E A;  2EV0 A;  3I5U A;  3ML6 A;  4LK0 F;  2JPB A;  2MH2 A;  5HDG A;  3ZRG A;  1W36 D;  3ZPL A;  4XLC A;  2OTL I;  4YFK F;  3FXM A;  3CCE I;  1REP C;  1SMY F;  1XCV A;  1OR7 C;  2ZXW H;  3BY6 A;  4CGZ A;  1T95 A;  3PSI A;  2ME0 A;  3QRF F; 
#chains in the Genus database with same CATH homology
 1F43 A;  1B72 B;  3DEW A;  5FKN A;  5F1J A;  2ZB9 A;  2DA3 A;  5E3M A;  1T56 A;  5F08 A;  1WPK A;  1HF0 A;  5FKL A;  3JRF A;  2W48 A;  2EZI A;  3BTJ A;  1LFB A;  3IH4 A;  1I3Q J;  1Q1V A;  2M9H A;  5J1R A;  3QQA A;  2CQX A;  5FKM A;  1Z0X A;  1TWC J;  4A3D J;  2KT0 A;  3BG9 A;  3C2B A;  1FJL A;  2JA5 J;  1IDZ A;  1IC8 A;  2L7M P;  2XGE A;  1FTZ A;  2JA8 J;  1OJL A;  4A3M J;  1SFO J;  3GTL J;  1F36 A;  2HXI A;  2ECC A;  4FE4 A;  2M2E A;  1MSE C;  2CU7 A;  2DJN A;  1HDD C;  3JRA A;  2NVQ J;  3S14 J;  4BY7 J;  1IGN A;  2ID3 A;  2XB5 A;  2CRG A;  5DTD A;  3BT9 A;  5K7Z A;  3D1N I;  5DS9 A;  1JTX A;  1QVT A;  1MBH A;  3ZQL A;  3HOX J;  2XPU A;  1GV5 A;  1OCP A;  4B3A A;  3BR0 A;  5EF6 A;  1JUS A;  2EZK A;  1ETK A;  3ZQC A;  3JRC A;  2HOA A;  2EZH A;  3MKL A;  3M3Y J;  4MLO A;  4A3J J;  1VND A;  1IJW C;  5M5W J;  1IV6 A;  1I50 J;  5FLM J;  1ETV A;  1JUM A;  5IP9 J;  3BQY A;  1ZQ3 P;  1PUF A;  2EQR A;  1ETW A;  3GTJ J;  1MSF C;  1JKO C;  3S17 J;  5IYD J;  5F0C A;  1MH3 A;  3OSF A;  1RKT A;  4MFE A;  2NVT J;  5F04 A;  3G1L A;  2YS9 A;  2HDD A;  1T33 A;  2YUS A;  1SAN A;  1TWG J;  1P7I A;  3Q0W A;  1DU0 A;  2L0K A;  3HOU J;  2R5Y B;  4JX5 A;  4D7N A;  3BG5 A;  2Y9Z A;  3JRH A;  3JRI A;  1GV2 A;  3G1O A;  3LSJ A;  1VI0 A;  3H0G J;  4L5E A;  3FK7 A;  2LK2 A;  3HKZ N;  3JRD A;  5FKO A;  3IH3 A;  4V2G A;  1MBE A;  4MIM A;  2HOT A;  2XSD C;  4EEF G;  2R93 J;  4NDL A;  1R9T J;  1NK2 P;  3BTI A;  2E2J J;  3BR2 A;  3CMY A;  1B72 A;  3HBL A;  2R92 J;  5EG0 B;  1JT6 A;  5GPC A;  4RBO A;  1ZR2 A;  3F0C A;  4J19 A;  3CCY A;  4A3E J;  3Q0U A;  1MNM C;  2JN6 A;  2ME6 A;  1HOM A;  4A69 C;  4AYB N;  2NVY J;  2X6O A;  5EYR A;  1E3O C;  4BBS J;  4M3G A;  3O8G A;  5K7F A;  1S7E A;  4M3F A;  3BR1 A;  1LE8 B;  1AKH B;  2DMQ A;  3K2A A;  3VPR A;  2LP0 A;  2H1K A;  3LSG A;  2JMW A;  5IYB J;  5FJ8 J;  4FTH A;  1H8A C;  2FX0 A;  1BJZ A;  3A01 A;  1W0U A;  3BR6 A;  1B8I B;  2X9D A;  4CYC B;  4D5C A;  1H88 C;  2CUE A;  4A3F J;  3GTM J;  4DYC A;  2IBD A;  2M8G X;  2XGC A;  3ZOB A;  3BR5 A;  1AU7 A;  1JKQ C;  2DTZ A;  1JKP C;  3LSR A;  3HEF A;  1Y1W J;  4DZP A;  2DA4 A;  4C3H J;  2NS7 A;  5FLV A;  1ETQ A;  2DA7 A;  2K9N A;  5JLW A;  3GBG A;  1WGX A;  2K9S A;  2O8K A;  2WV1 A;  4FE7 A;  5IP7 J;  2GLO A;  2MGQ A;  3OIO A;  4UUS B;  4A3B J;  2CJJ A;  3CDL A;  1K61 A;  2O9L A;  2KDZ A;  5J1U A;  2YU9 J;  3Q3S A;  1FIP A;  1UG2 A;  4XRS A;  2WAQ N;  2H8R A;  1X58 A;  3A02 A;  5C3E J;  1MBF A;  2DMU A;  3HM5 A;  4W1U A;  2Y2Z A;  2E1O A;  1GUU A;  1JJ8 C;  2TCT A;  4I6Z A;  2WB1 N;  1ZKG A;  1APL C;  1NK3 P;  1XG1 A;  3QPL A;  1ZR4 A;  1OCT C;  2JA6 J;  3RZD J;  2XRL A;  2QF7 A;  2R5Y A;  4GFB A;  2L9R A;  3QPS A;  2N8G A;  4V2F A;  1I6H J;  1IG7 A;  3GTK J;  5M3M J;  3JRB A;  5M3F J;  1BL0 A;  3HDD A;  4M6V A;  5E3L A;  4JYK A;  2QCO A;  2TRT A;  2ID6 A;  2R5Z B;  3GTP J;  3ZQI A;  4A3C J;  2I10 A;  1YRN A;  2HYJ A;  3TW6 A;  3IH2 A;  1ZK8 A;  3UKG A;  4XRS G;  1X2M A;  4XIC A;  1TC3 C;  2K40 A;  3RQI A;  1JKR C;  1NTC A;  3CQZ J;  1ETO A;  2NOG A;  3FKI J;  2FJ1 A;  2NS8 A;  3S2D J;  5EEA A;  2DA2 A;  1RES A;  3BG3 A;  1UHS A;  2LKX A;  5EG0 A;  2PMZ N;  2IAI A;  3FIW A;  3TP0 A;  1TWA J;  5E3N A;  3PO3 J;  2JWT A;  1IUF A;  1ORK A;  1HLV A;  3S1Q J;  3ZQG A;  2DA1 A;  2VI6 A;  4Y7N J;  4A3K J;  1AKH A;  2DMP A;  1AHD P;  5F0F A;  5F27 A;  1RET A;  3HGG A;  4XID A;  2LR8 A;  3SFI A;  4FIS A;  1BW6 A;  5EZG A;  1U9O A;  3S1R J;  1EF4 A;  4AUX A;  3RKQ A;  3JRE A;  2Y30 A;  1X2N A;  1HDP A;  3PO2 J;  1UMQ A;  3W6V A;  4QIW N;  5C44 J;  3GTO J;  4IHV A;  1QPI A;  4W97 A;  3I4N J;  2RAE A;  5J1Y A;  1BA5 A;  1U9N A;  2X48 A;  2NVX J;  3WHC A;  1MBK A;  4BBR J;  3E7L A;  4M3E A;  3RZO J;  4QTR A;  4DYQ A;  2Y31 A;  4JP0 A;  2P81 A;  2LY9 A;  3Q0V A;  3S1N J;  5HOD A;  2ELK A;  2OPT A;  4X1E A;  2LD5 A;  1IDY A;  2L7Z A;  2M0C A;  3ZQH A;  2XGD A;  3OOU A;  5IP6 A;  2HI3 A;  5M5Y J;  3S15 J;  4FCY A;  3IV5 A;  1H89 C;  4IHY A;  2VKE A;  2XB0 X;  3HOY J;  2VKV A;  3OSG A;  1U8B A;  5IPA A;  2HOS A;  4A3I J;  4A93 J;  3A03 A;  5IOY A;  1WCM J;  3B6C A;  2E19 A;  4DYR A;  2O7O A;  3B6A A;  3DCF A;  3H3V K;  1XS9 A;  4Y52 J;  4D7M A;  2JK3 A;  1FEX A;  3SJM A;  1GVD A;  4IHX A;  1U78 A;  1GT0 C;  2E2I J;  3HOZ J;  2LFB A;  2M34 A;  2LTP A;  3HOW J;  4XRM A;  3ZQF A;  2B63 J;  3BR3 A;  1O4X A;  1MBG A;  2R5Z A;  5IOZ A;  5EGO B;  4HNV A;  1TWH J;  2OF7 A;  2DMT A;  3MVP A;  3NAU A;  1A5J A;  3BQZ A;  1JTY A;  3S1M J;  1ETY A;  5M5X J;  3SDG A;  1DU6 A;  3TP3 A;  9ANT A;  3A01 B;  3LOC A;  5J3L A;  3BTL A;  2VUM J;  1RPW A;  2VPR A;  3PM1 A;  5BNG A;  1XC5 A;  4A3L J;  2EH3 A;  2GM4 A;  2JJ7 A;  2Y9Y A;  2IEK A;  2CUF A;  4AC0 A;  1POG A;  1MH4 A;  2EBI A;  3LNQ A;  2E2H J;  5C4J J;  1CQT A;  4C3J J;  3HGY A;  1JT0 A;  2R7Z J;  1W0T A;  4XK4 A;  2AO9 A;  4C2M J;  5JLX A;  4C3I J;  1VF9 A;  3I4M J;  1ITY A;  5GP9 A;  4BY1 J;  4BKX A;  1JGG A;  4M3B A;  2Y0S N;  4M3D A;  3TED A;  1WH7 A;  2FQ4 A;  3FK6 A;  3TW7 A;  1FTT A;  4DZJ A;  1HCR A;  4I76 A;  1P7J A;  4DW6 A;  3JRG A;  2XPV A;  4QSH A;  2LVS A;  3MN2 A;  3WHB A;  5F0H A;  1LFU P;  2R0Q C;  4IHW A;  2AHQ A;  2XPW A;  2DA5 A;  3O8H A;  1ENH A;  5E3O A;  1LE8 A;  2DA6 A;  2DMN A;  2MG4 A;  2EZL A;  1MBJ A;  1ETX A;  5IYC J;  5EDN A;  1G2H A;  1Y1V J;  3LSP A;  2FD5 A;  4LOC A;  4S0H B;  4D5F A;  2K9Q A;  4RDU A;  1PUF B;  4A3G J;  1ZGW A;  1A6I A;  4JX6 A;  4ABZ A;  3NAR A;  2D5V A;  1YRN B;  1GDT A;  1RR7 A;  2HXO A;  1RKW A;  1QRY A;  1FIA A;  1B8I A;  2CQQ A;  4CYC A;  3HOV J;  3JR9 A;  3M4O J;  1VFC A;  2MW8 A;  4B1R A;  1ZTR A;  3BTC A;  1WI3 A;  2DN0 A;  5EZH A;  4JX4 A;  1JUP A;  2G0E A;  2LLK A;  1OFC X;  1BW5 A;  4IEJ A;  1JJ6 C;  2MSY A;  1QVU A;  4MFD A;  3S16 J;  4UUS A;  5GPA A;  2JA7 J;  3FIS A;  1WH5 A;  3S2H J;  3GTG J;  2ECB A;  2HQ5 A;  5K7H A;  1IRZ A;  1Z77 A;  2GBY A;  3K7A J;  4UUT A;  3L1P A;  1D5Y A;  2L7F P;  4G12 A;  4X6A J;  3G1M A;  3GTQ J;  4BXX J;  4MO7 A;  5C4X J;  5EGO A;  1TWF J;  4B4C A;  3HB9 A;  5FKK A;  2COB A;  1K83 J;  2ME0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...