1JGSA

Multiple antibiotic resistance repressor, marr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of MarR, a regulator of multiple antibiotic resistance, at 2.3 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jgsA00
4I09A 1P4WA 4PZJA 1ZGAA 5KVRA 1ON2A 4RB0A 1HBXG 3KZZA 3GFJA 5FGMA 5CVJA 1D8JA 2H94A 4OIQF 2CG4A 4NB5A 4KIBA 1UFMA 3KCCA 3V7RA 3ERED 3DKWA 4KYWA 4CHUA 1XCBA 5IT9K 3DF8A 2B0LA 3I59A 2PBIA 3FHZA 1L3LA 2VBZA 2Q8KA 5LLQA 1UHWA 1ZG1A 2V1UA 4HZFA 4S04A 1AOYA 3K1PA 1D8KA 3HRSA 1TLHB 2P5KA 1KYWA 1OKRA 1I27A 1PDNC 4UNOA 1DUXC 4KIFA 1BIBA 4LD5A 3KP6A 1Z6TA 2JZYA 2O6GE 2DTRA 2A6EF 2QQBA 1ZLJA 2L3DA 2X4HA 1JHFA 4Z2YA 1Z7UA 3ZPLA 2LSOA 4ZYGA 1S7OA 1W4MA 1O3RA 4HF1A 3E5QA 2YX4A 4ON0A 1K78A 3FX3A 1IXRC 1S29A 3LA2A 4LG0B 3MZYA 5D5WB 3PQKA 4G7ZF 4CZZA 4ENMA 4MTEA 3I71A 1KU2A 1ODDA 1G3YA 1P92A 3ZN1A 1KU9A 4CO8A 5D4SA 1Q1HA 1F4KA 3T8TA 4CICA 3E5UA 4PCQA 1FLIA 1SFXA 5D6FA 4HDVA 2QBYB 4G7OF 1PP7U 3FXQA 3DQVC 1XSDA 3I0TA 2PEXA 3QAHA 4WWCA 3SQNA 2LDUA 2E1CA 1HW1A 4D0PA 2ZO4A 1KGSA 1L0OC 4BHBA 2H6CA 2R3SA 2OA4A 1FNNA 2NNYA 5K5RA 3C18A 5K5QA 2ZMEB 2LKPA 3FM3A 2FBHA 3LA3A 2EJRA 4E70A 5ICGA 4HX4A 2OZUA 3WG9A 3J80K 1ZH5A 3M8EA 4EGYA 4MEYF 3IHUA 4PGGA 4HA8A 4OMZA 4KMFA 4A6EA 2QBYA 1R5GA 2UWMA 2STWA 4A0XA 3J81Z 4WXDA 2F5FA 1H0MA 4EJVA 2FEZA 4MGRA 1YTYA 3RKXA 1LB2A 3ZMZA 1RIOH 2FBIA 1R00A 5CJ9A 2NS0A 1X3UA 3FMQA 4M9XA 5E1WA 2KRFA 3GWZA 4KIGA 1DPRA 4L18B 3KZYA 2RDPA 1FT9A 3WU1B 1JXSA 4FT8A 4P9UA 2PMUA 4B8XA 3QRFF 4LK0F 1B59A 4LG0A 1B1BA 3F6VA 1XGNA 5FB2A 2QZ8A 1Z1DA 2YX7A 3V7CA 3I58A 2HKOA 2O61A 1I6XA 2XAFA 4BQAA 3HSRA 1QGPA 3MCZA 4S05A 2KIUA 4NHJA 3W6KB 2W57A 3ELKA 3LAJA 4BH9A 1UCRA 5ICCA 2L01A 4G9YA 2IA1A 4QLCU 1U5TA 2CQKA 1IXSB 1F9NA 1HKTA 2PMHA 1UHMA 1QO0D 3ZMUA 2XRNA 3T0YA 4UVAA 2Z9OA 2FNAA 3CO7C 3F23A 3F8CA 2UZKA 3QPTA 3JTHA 4I98B 1B9MA 2TDXA 2A5YB 4A5MA 3ULQB 5A2QZ 2HWVA 2VBXA 1OYWA 1IN7A 2A07F 1KQ8A 3BDDA 5DD4A 1R7JA 4IRHA 3I59B 1Z05A 5E8IA 4RGSA 1QZYA 4RGRA 3K0LA 2L4AA 5CVUA 2DQLA 1OMIA 3IWZA 1QNTA 4MQ9F 2DI3A 3TO9A 1W7PA 1H9TA 5CLSA 3GYHX 4RB1A 2ZMEA 5BS6A 5TJJA 5ILSA 1HSTA 1LDKB 5E20A 1QZZA 3NEUA 2FQ3A 3QP5A 5J8CA 1FYLA 1KYZA 3I64A 5IT9Z 4M6XA 1T39A 3CUQA 5D5VB 1ZRFA 1IXCA 4O3MA 2ZJ2A 4K2EA 4R8HA 2DAOA 3LFKA 1E17A 1EH8A 2H09A 2QQAA 2IJLA 2Y0MA 1IW7F 4ASNA 3WGHA 1LJ9A 4M9SA 5ICEA 3WTSC 4A5NA 4KICA 2GA2A 3RKWA 4IVNA 3QPHA 3RIRA 2WC2A 2Z5UA 1DDNA 2JT1A 4GGGA 1YLFA 3GEZA 2EFNA 2VN2A 4ZH4F 3JTGA 5DDGA 1BI3A 4EGZA 1T38A 3GLXA 4LFUA 1G3WA 3CUOA 4HLYA 5J6XA 4MQVA 2EK5A 2O3FA 4WX9A 4RB2C 1TQIA 4EJOA 1BC7C 3BP8A 1S8NA 3GF2A 1TBXA 4ENKA 1LEAA 5CVRA 1FOKA 4BXUA 2F2EA 3TQNA 4ZYHA 1YQAA 3FXUA 3K9TA 3V8LA 2FMYA 1XMAA 3HHGA 1KU3A 3MWMA 2L54A 1Z91A 3REOA 1K79A 1ON1A 3FMSA 1NHAA 1YG2A 3BOQA 3TOBA 1BN5A 4ESJA 2QQ9A 4XRFA 4KUMA 2OAZA 3JAMZ 2IA0A 3WTXC 3F8NA 4UV9A 4EJUA 1R58A 2HOEA 3IKTA 3KEOA 2IVMA 4H0EA 4U0VA 2XVCA 3GO5A 3KP2A 4BHPA 2YPRA 1ULYA 5ILVA 4ZYDA 2MBFA 1E2XA 3HRUA 3T5XA 4HAMA 3F8FA 5FLXK 1SD4A 1XGSA 2RN7A 5H6RA 1XSVA 4Q4ZF 2NNNA 1W5TA 3GZ5A 4Q47A 5FFXA 3B73A 3I4PA 1TQPA 4I0BA 2H27A 2F5DA 3QU3A 3ZMTA 1ZHFA 3ZN0A 4RB3C 1EH6A 1CF7B 4LGWA 1K7AA 2VONA 3KP3A 2V79A 4YG2F 3J80Z 1S3JA 3B02A 5E18F 3J7AO 1D5VA 4U7DA 2Y48A 4L9VA 3F8MA 3IWFA 3SZPA 1B6AA 1TQMA 3HHHA 2XIGA 3NRVA 4IJAA 3RI4A 3V8JA 1MD0A 1O3TA 5LGTA 3RYPA 3RKYA 1IN8A 2YSRA 3MEXA 1YW9A 4P9FA 2P5LC 3Q5FA 3WTYC 3EUHA 3HIFA 3BJ6A 3T1BA 3KE2A 1S7AA 2A61A 2Z33A 3TKYA 3GXOA 2Z99A 1P4XA 1QPMA 5DV5A 1BI0A 2GIVA 2QM3A 3GUDA 5DCMB 5E8GA 1U6GA 2ZFWA 3IC7A 5AONA 5E17F 4WK8F 2HGCA 4L9JA 1UB9A 4LLNA 3H3UA 1V4RA 1HXDA 2CWEA 1ONVA 2K4JA 2DO7A 1XB4A 2ISYA 4WXHA 5L3DA 2W84A 4O5VA 1D3YA 2JPCA 5HVQC 5CVVA 2ZCWA 1R36A 3TOAA 3LQQA 1XGMA 3DP7A 3E6MA 1KQ0A 1MKMA 2R7DA 2XAJA 3F72A 3RPUA 2XAHA 3IL2A 1ZG5A 5DD8A 3C1DA 3J81K 2W85A 2UXNA 2M1BA 2MH9A 2P7CB 2PFBA 1LDDA 5BQTA 4G7HF 1JE8A 4L0ZB 2LF8A 3H92A 4IRGA 3W6JB 3AAFA 1KQ9A 4RS8A 3JAMK 2PI0A 1FC3A 5LHIA 3GFMA 5A2QK 4BAYA 2ACJA 4BNCA 3I54A 3JW4A 2Q2EA 4Q48A 3H3ZA 2F5CA 4WXCA 1OPCA 1USTA 4WCGA 4IF4A 4GCVA 1HKSA 4UUVA 4MTDA 5HDGA 4HW0A 2HS5A 5HLIA 4KN7X 2XKOA 2G7UA 5L3BA 4M73A 1RUOA 2IW5A 5DCFA 4BYYA 2XGXA 4OOIA 5ILUA 2ESHA 4MEXF 3M7GA 1P4AA 1U3EM 3ABUA 1MDMA 3ZP5A 3C3WA 1ZGJA 1PP8F 4IHSA 4HV6A 1BOAA 3QP6A 4LLGF 2J5OA 1O57A 2X0LA 3RJPA 3O3KA 1O7LA 2HKXA 2V1DA 3Q9SA 3HOSA 1T98A 1B4AA 3WGIA 2OU2A 1XSXA 2BBYA 1EV7A 4M6YA 1W7PB 4EM2A 1O7FA 3WGGA 5HOOA 1FWZA 2XROA 2V1XA 5FLXZ 2CW0F 3R4KA 2MD5A 2MC3A 2XAGA 4JQFA 4RAYA 3FZVA 1EH7A 4M72A 2HTSA 5JI6A 2EFWA 5L3EA 2O8XA 2PN6A 3HRTA 3K2ZA 3CO6C 2ISZA 1PUEE 3KP4A 2OBPA 5CYVA 3R60A 5F64A 2QWWA 1F5TA 1QBJA 1LDJA 3P7NA 1O3QA 1S6LA 3IRQA 2K02A 3N97A 3G73A 3Q9VA 3R0AA 1B9NA 1YYVA 1HSJA 3RTRA 3E6CC 1J5YA 4P96A 3R6SA 3G3ZA 3GVAA 3T8RA 5JFRA 1U5TB 2RKHA 3IRRA 1FSEA 4ZZDA 1LQ1A 5D6EA 5HS7A 2FU4A 4EV0A 3FMRA 2EV6A 1HW2A 3QU6A 5H6QA 4OU0A 3BJOA 3GFLA 3GW2A 3KP5A 2OZ6A 4KNYA 3QOPA 3V8KA 2VBYA 1FYKA 2D1HA 3JSPA 2EFQA 3MFKA 1WWXA 5CVIA 2QUFA 4M9ZA 1FSHA 3K69A 3KETA 3R0JA 5D5XB 2KKOA 4RGXA 3RPQA 3E6BA 6PAXA 5D4RA 1HKQA 1SD7A 4HF2A 1AWCA 5J8FA 3HSFA 2FA5A 4YFNF 1Z6RA 2E7XA 2YU3A 3FWEA 1V3FA 4JBAA 5L3FA 1TTYA 1R1TA 2DPUA 2QVOA 4ESBA 4OIPF 1ZYRF 2E7WA 2M30A 3KFWX 5JHUA 2FE3A 2JSCA 4I2OA 2DK5A 3DPLC 3V7SA 3GX4X 2BYVE 5TRDA 1LNWA 5LHGA 1Z9CA 3HUGA 2HDCA 3KP7A 4OIOF 1J75A 2QLZA 3P9KA 1GHCA 4UXNA 4L5IA 4QWQA 1F1ZA 2L02A 3E3VA 2M5WA 2BV6A 2OQRA 4RGUA 5LEKA 1O3SA 3M1EA 1Y0UA 3WE2A 2W25A 1LVAA 2Y75A 3MQ0A 3VODA 3BPXA 1SFUA 1OR7A 1BI2A 4L9TA 1T6SA 4I02A 5IT3A 4F7ZA 2K86A 1FP1D 4IPAA 2M87A 3K1MA 2DT5A 3D0SA 2PG4A 1U78A 3TO6A 2A3SA 5ERIA 2ADUA 1TW2A 4OMYA 1FBSA 1YW8A 2BEOA 4R79A 4N9IA 2HQRA 4G6QA 1FZPB 2C6YA 5EEGA 5LGUA 5KK1A 4IXAA 3SZTA 4O6JA 2FF4A 2GXBA 1T2KA 4FX4A 2RC4A 3I5UA 2G9WA 2XUBA 4TV7A 1IF1A 3LAPA 4FHTA 2R7FA 3WE3A 2H6BA 3E6DA 3EYYA 3KLNA 3GZ6A 3OOPA 3N4MA 2QYOA 4UVCA 1GXPA 3R61A 3GFIA 2KJBA 1J2XA 5BPIA 4AVPA 4KT5C 2A68F 4I01A 1R5HA 3HSEA 3SHFA 3LSTA 2PQ8A 5D8LB 1R23A 1RUNA 3EETA 2VODA 1J9IA 3F21A 2OQGA 2FOKA 4A12A 1HQCA 1FP2A 2RNJA 1P6RA 4L0YB 3RDIA 2EA2A 3WTTC 2GQQA 1KU7A 2VOOA 4A6DA 2FNPA 4P55A 2HTJA 1IZ1A 5ICFA 3U9GA 1VTNC 2P6SA 2DQRA 1JGSA 1XDUA 5F1RA 4EMSA 1G6NA 3VB2A 2GWRA 5D5UB 5HDKA 3L09A 1U5TC 5L3CA 1DPUA 1QQIA 4YIIA 2CO5A 1A04A 4ESFA 3TO7A 1ZG3A 3L9FA 4GYIA 3ISPA 4HQMA 3CUQB 2CGPA 3HYIA 2PLYA 3L00A 2STTA 1GXQA 4HYEA 2RGVA 3PQJA 2FSWA 1ZLKA 3DV8A 4XLNF 2ESNA 2FXAA 1MJAA 1R1UA 4HX7A 2K27A 3P9IA 4MNUA 4UVBA 4OINF 2GXGA 2CFXA 1I1GA 4Y15A 2HQNA 4HF0A 4EQQA 4G6DA 2AS5F 2YR2A 1CGPA 2EFPA 4KN4X 2EB7A 3EDPA 4U0WA 2LF7A 1P2FA 4Q5SF 2DU9A 2ZXJA 5HDNA 1BBYA 4LB5A 1BC8C 4I0AA 1SD5A 3ZQ7A 4AD9A 3CJNA 1WRJA 3CDHA 4B09A 4IHTA 1FYMA 3E5XA 4G94A 5AIQA 1FBQA 2Z3YA 1IAWA 3F6OA 3DEUA 2K7LA 2COMA 3JSOA 1HW5A 1T0FA 1LEBA 1H9GA 2CSOA 1MJBA 5FFZA 3VOEA 3COAC 3NQOA 5K5OA 2RQPA 3F8BA 1XDSA 3ZMVA 2FRHA 3TDUC 2WWYA 2VE8A 2P6TA 2P5VA 2M45A 3O2PE 2HEOA 4KA4A 1FPQA 2KIMA 2D1VA 2XKPA 4KDPA 4CXFA 5E1ZB 5DUIA 4GO1A 3ECOA 1KA8A 2VBWA 4G8XA 3O6BB 1YFHA 4M74A 3SXYA 2XASA 2VE9A 4L9NA 2O03A 2O0YA 3U2RA 3DPTA 2K4BA 4CYDA 5DEQA 5LRSA 1W5SA 2VC0A 4HOBA 4AIHA 2KIFA 4YFKF 1K6OA 1WQ2A 3V4GA 1SAXA 4XSZF 3BWGA 2RV8A 3WODF 1W7PD 1FY7A 3I53A 1CF7A 2BGCA 2DW4A 3E97A 3K1NA 3ZMSA 1R22A 5H20A 2DPDA 1ZARA 1SMTA 4GYGA 4LJZF 3WTWC 4YFXF 4Y17A 4EM1A 4GXOA 2ZNZA 5AIPA 2HFHA 1BJAA 2ELHA 3RYRA 3D5LA 2MLKA 2XAQA 1SD6A 1XGOA 2XV4S 3M9AA 4KMUX 4AIKA 1RI7A 4XBFA 2MA3A 1ZREA 2EFOA 2VOPA 2OD5A 2ZNYA 2NRAC 4U7BA 1RZ4A 3BROA 2M8EA 4HX8A 2UXXA 4MHGA 3HTSB 4WF2A 3VEPA 4EM0B 3TDZC 3S2WA 1BIAA 3SFZA 2CYYA 2V9VA 2HYGD 2EV0A 2AXLA 3HOTA 4NQWA 4HV5A 3KEQA 1C0WA 2A6HF 1YIOA 2DFIA 4ZYEA 2IA2A 4PGHA 2LNBA 5BOXA 1WI9A 4HDUA 3F3XA 4L5JA 3LQRA 3M8FA 2QENA 4N9HA 2ETHA 4UV8A 1MJ9A 2J5PA 2V6CA 4A0YA 2D2WA 4N0BA 3BJAA 5HLGA 1TW3A 1IN5A 3BZ6A 1U2WA 2RVCA 3ECHA 5FD6A 1ZAOA 5D8KB 1YO5C 3CUQC 4HQEA 2JPBA 3WTZA 2A69F 1ZN2A 3L2CA 2BE5F 2HYFA 5DCMA 4JK1X 1JHHA 3CLOA 4XSXF 5ED4A 4YIFA 1FBUA 1TNTA 1OYYA 2KJCA 2XHKA 4LLLA 4M71A 5LRRA 2GA1A 1YS6A 3TGNA 2P7VB 3VFZA 4EVIA 3EQLF 1TNSA 4Y13A 1J7KA 2DLLA 2GAUA 3PFIA 5DYMA 1G3TA 3FM5A 1SMYF 4DQ2A 3P9CA 2NAZA 3IKVA 2VT3A 2EV5A 3CTAA 2MLGA 2IPQX 2ZKZA 2GZWA 1STZA 4OIRF 4KFCA 1IN4A 1MDMB 1BI1A 2F5EA 3OV8A 1MZBA 3HRMA 5FO5A 4LK1F 2HR3A 3EYIA 1YW7A 5BMZA 1GVJA 2WV0A 1IRGA 3ZMDA 2VT2A 1XCVA 1ZRDA 5LEJA 2IT0A 4IRIA 1IN6A 4EJWA 2VXZA 3FF5A 3F22A 1J0RA 3ROUA 3HTUA 2P8TA 5LHHA 5LGNA 1BM9A 1J59A 1G3SA 4I7HA 4ENJA 4CGZA 4P5OA 3MAJA 1U8RA 2ZBKA 2JTVA 3BPVA 4A2UA 1I1SA 3BY6A 2FBKA 4BHCA 4A0ZA 4PDKA 5DUKA 4DNCA 1MGTA 4LB6B 1K78B 5L3GA 4XLPF 3WTVC 3WU0A 5BPDA 3U1DA 3ML6A 5EEHA 1FX7A 5E1XA 2MH2A 3FXRA 4ZZLA 1ZRCA 2P4WA 1YS7A 1REPC 3DFGA 2E1NA 4RAZA 2FMLA 5JR3A 5F6FA 1G4DA 5HLHA 3KLOA 2G7HA 3C7JA 3LWFA 2VC1A 2JRTA 4EJTA 1SFEA 2DK8A 1DP7P 2EA4A 4HLXA 2HZTA 3WTUC 5JVTA 1RNLA 4FX0A 2IP2A 2DBBA 4HBLA 2W24A 1I5ZA 2Q0OA 2L4MA 4R1HA 1WSUA 1IUYA 4LMYA 2NYXA 5FD5A 2PJPA 1OYIA 4U88A 4CDGA 4ETSA 1XN7A 2WTEA 3L7WA 3MZHA 1XD7A 4ENNA 2EWNA 3ABTA 5HS9A 2IRFG 3DXJF 4U0YA 1WKMA 5HS8A 1IRFA 2D45A 1USSA 5LBQA 1R1VA 5K1YA 4AWXB 4AIJA 3LA7A 4UHTA 1XMKA
chains in the Genus database with same CATH superfamily
4I09A 2QQ8A 2I10A 2L5QA 5GADJ 1QU3A 1P4WA 4PZJA 2E2JJ 4MFEA 1ZGAA 2W82A 5KVRA 1N75A 2M0CA 1ON2A 1RPWA 2P0WA 2TRTA 5DM6F 4RB0A 1HBXG 2O7OA 3KZZA 3GFJA 5FGMA 5CVJA 1D8JA 2H94A 4OIQF 2CG4A 3SDBA 1WHUA 4NB5A 4KIBA 4FCYA 1YRNA 1UFMA 3KCCA 3L2WA 3V7RA 3GTKJ 3ERED 3I4MJ 3DKWA 4KYWA 3WHCA 2EH3A 4CHUA 1XCBA 5IT9K 2DOFA 3PNYA 1XTAA 3DF8A 2B0LA 2HVQA 3I59A 2PBIA 2E1MC 3FHZA 1LFPA 2MG4A 1L3LA 2VBZA 2Q8KA 5LLQA 1UHWA 1ZG1A 2V1UA 4HZFA 2R5ZB 2E71A 4S04A 2JA2A 3K1PA 1D8KA 4MO7A 3HRSA 1AOYA 3RQ4A 1TLHB 1KZHA 2CFOA 2P5KA 1KYWA 2IAIA 2LMDA 3RPUD 1OKRA 1I27A 1PDNC 2CUZA 3ZRGA 3QYBA 4UNOA 1WZ2A 1X1PA 5F08A 1DUXC 2NOJB 3TW6A 4KIFA 4B43A 1BIBA 3LSRA 1Z3YA 1VI0A 4LD5A 3KP6A 5GAHJ 5EG0A 1Z6TA 3Q3SA 2JZYA 1A36A 1VQLI 2FUG2 2O6GE 2VIXA 2HVSA 4CCNA 3BTJA 4XM3A 4HNVA 2DTRA 2A6EF 3CD6I 5K7ZA 2QQBA 2OCCH 1ZLJA 3S1MJ 2KFDA 5CQEA 2L3DA 2X4HA 4CCJA 1JHFA 2IGOA 4Z2YA 4UY8I 1A6IA 1Z7UA 3ZPLA 2LSOA 1VQ7I 4ZYGA 1S7OA 2QA4I 1FOWA 4J19A 3U1KA 2A05A 4DIQA 4D9JA 2IS1A 1W4MA 1O3RA 1Z0XA 4HF1A 4W97A 3S1QJ 3E5QA 3CMAI 2YX4A 4QIWN 4RLQA 4ON0A 1K78A 1DGRM 3FX3A 2X85A 4AVZA 1ETYA 2GLOA 4XKWA 5C3EJ 2Y9ZA 2R7XA 1IXRC 2K9NA 1S29A 3LA2A 3I56I 2L9NA 4F91B 4LG0B 3CMMA 3JRGA 3MZYA 3C2BA 5D5WB 1JGGA 4JYKA 3PQKA 5F0HA 4G7ZF 4CZZA 4ENMA 4BQNA 4MTEA 4D7NA 3DWLE 3I71A 1KU2A 1ODDA 1G3YA 1P92A 3ZN1A 5E3OA 1KU9A 4CO8A 2JVHA 2O5RA 2LG4A 5D4SA 1I3AA 5C44J 1Q1HA 4F93B 5FLMJ 1F4KA 3T8TA 2AXTC 4CICA 3E5UA 4CA0A 5M5XJ 3FXJA 1R9TJ 3DBHB 1VNDA 1RRJA 2E60A 2WAQA 2OTJI 4PCQA 2R7ZJ 1MMSA 1FLIA 2EBIA 1FIAA 4JX4A 4FISA 3JRIA 3OS0A 1SFXA 2JN6A 5D6FA 4HDVA 2QBYB 2JJ7A 2DA6A 1PP7U 3FXQA 1VQ5I 1RETA 2R5ZA 1W36C 1WI3A 5J4YA 3DQVC 1XSDA 3I0TA 3CF2A 5GAEJ 4B48A 2PEXA 2BOLA 2R7RA 2V7FA 3QAHA 4LOCA 2OUMA 4WWCA 3SQNA 3VDXA 2WAQN 2XB5A 3S1NJ 1JJ8C 2V26A 1OCPA 2EIMH 1MMDA 4NC6A 2LDUA 4IQJA 3I9V2 2E1CA 2HQAA 1HW1A 4D0PA 2ZO4A 3VWBA 1KGSA 1L0OC 1F43A 4BHBA 2H6CA 3AG1H 3BC8A 1P7JA 4LITA 2LY9A 2VB6A 5M5WJ 2R3SA 3LSKA 2IGMA 3K6GA 2OA4A 1FNNA 3K4MA 2NNYA 5K5RA 5M3FJ 1PYVA 3C18A 1NK3P 1CQTA 2WBMA 3OYCA 1X58A 5K5QA 4UB6C 2ZMEB 2LKPA 2UV1A 3FM3A 4F55A 1X1DA 1UHSA 3D5RC 2FBHA 3OS1A 3ZQIA 5IP6A 3LA3A 4ZDPA 2EJRA 1VQ9I 3DTIA 1W0TA 4E70A 5ICGA 1T0FC 4HX4A 4B44A 2ECBA 2OZUA 3OYKA 3WG9A 1IRZA 3J80K 1MW7A 4Y7NJ 1ZH5A 3ZQLA 1OCCH 1K4TA 3M8EA 5K7HA 2VLAA 4EGYA 2B63J 1WVRA 1IO2A 4Y4RA 2QF7A 4MEYF 5EEAA 3IHUA 4PGGA 3J7YJ 4HA8A 4OMZA 4KMFA 5FKLA 4A6EA 2QBYA 4A3MJ 4IHYA 1LKXA 1R5GA 2UWMA 2STWA 4A0XA 3J81Z 2F48A 3BG6A 4WXDA 2E36A 2HXIA 2F5FA 1H0MA 4EJVA 2OC6A 2FEZA 4MGRA 2R7SA 1YTYA 2B7EA 3RKXA 5FKOA 1LB2A 3ZMZA 1JUMA 1TWGJ 1RIOH 3RZDJ 2FBIA 1R00A 4KITB 5CJ9A 2NS0A 1X3UA 2WAFA 2XPUA 3BR6A 3FMQA 4M9XA 5E1WA 3ZOBA 3GWZA 2KRFA 2M4GA 3EUAA 3ZQGA 4BBSJ 4KIGA 1DPRA 4L18B 3KZYA 2RDPA 1FT9A 3WU1B 2QKMB 1JXSA 3V42A 2WV1A 2DJNA 4DJAA 4FT8A 4DW6A 2PMUA 4B8XA 4P9UA 3QRFF 4ZDOA 4LK0F 5B1AH 4B4CA 3LSPA 4A3EJ 2DFEA 1B59A 2QSFX 1B1BA 3FBNB 4LG0A 3F6VA 1XGNA 2DA4A 2EZLA 5FB2A 2QZ8A 4RAFA 1Z1DA 2CUFA 2YX7A 4ZC3A 2KRCA 3I58A 1Q1VA 2EPFA 3NWTA 2DCEA 3V7CA 1T08B 3HL2A 2HKOA 2JUGA 2O61A 1I6XA 2CW7A 2XAFA 4BQAA 1ZR4A 3HSRA 1QGPA 2X1EA 3MCZA 4S05A 2KIUA 4NHJA 3JRBA 1MBEA 3W6KB 2A5WA 2W57A 3ELKA 3LAJA 4BL0B 4BH9A 1DGWY 2Y30A 4BY7J 1UCRA 4BJ6C 5ICCA 2BY0A 3MMYB 3C2GA 2VKDA 2L01A 1D1AA 3N05A 3G1OA 3IAS2 4G9YA 1IUFA 2IA1A 4C30A 4QLCU 1U5TA 2CQKA 3OYHA 2CV1A 1IXSB 5EG0B 1WCMJ 1F9NA 4CYCA 1HKTA 2RREA 4BEHB 2PMHA 1WH7A 1UHMA 1QVTA 1SVMA 4BGDA 3UKGA 1X2MA 4A69C 1QO0D 2N8GA 3ZMUA 2XRNA 3T0YA 2BHZA 2KT0A 4UVAA 2Z9OA 2FNAA 3CO7C 2CH0A 3F0CA 3F23A 1YI2I 3F8CA 1G59A 2IS4A 2UZKA 3VSKA 3QPTA 2XDVA 3JTHA 2FX0A 4I98B 4BQQA 3A0HC 1B9MA 2TDXA 2A5YB 3KPHA 4A5MA 3ZQQA 3ULQB 5A2QZ 2HWVA 2VBXA 3NAUA 1OYWA 2CMPA 1IN7A 1LFBA 2WAEA 2A07F 1KQ8A 3BDDA 2EZIA 5DD4A 1R7JA 4IRHA 3I59B 4RLFA 3K4KA 1Z05A 5E8IA 4RGSA 5GTHC 1QZYA 2E34A 3A03A 4RGRA 3SEZA 4AYBA 3K0LA 3K4NA 5HODA 3HOXJ 4QPOA 1ZELA 4PUSA 2L4AA 3LMMA 5CVUA 2DQLA 2XSDC 1NG7A 3DEEA 1OMIA 1Y1VJ 3WHBA 3IWZA 1QNTA 3AG2H 4MQ9F 3BCBA 4MLOA 2DI3A 2W4SA 1POGA 2ZJPF 3TO9A 1W7PA 5M5YJ 3S3OA 1H9TA 4A3CJ 5CLSA 2QEXI 3LSJA 2VQLA 4N4NB 4PJMA 4RB1A 3GYHX 2ZMEA 2M3AA 3CC7I 1OCTC 5BS6A 1JKPC 2K5CA 5TJJA 2X51A 5ILSA 4EEFG 4I99C 1HSTA 2O8KA 3EPZA 1LDKB 2F4MB 5E20A 4G6TB 1QZZA 3NEUA 3BG5A 2FQ3A 3QP5A 5J8CA 3RKQA 1FYLA 1KYZA 3I64A 5IT9Z 3CMEI 4M6XA 1T39A 3S3NA 3CUQA 2NVYJ 4AIDA 5D5VB 1VQNI 1ZRFA 1IXCA 4O3MA 2W48A 2ZJ2A 4K2EA 4R8HA 4CYCB 5FRNA 2DAOA 3DPUA 2Z16A 2Y0SN 3LFKA 1E17A 1ZR2A 1H8AC 3BZKA 4XIDA 3GLLA 3CCMI 1EH8A 3K4CA 2H09A 2QQAA 1XPXA 3G6EI 2IJLA 2Y0MA 1IW7F 4ASNA 3WGHA 2KPMA 1LJ9A 4M9SA 2DXIA 3HG9A 4BXFA 4A5NA 5ICEA 3WTSC 3BTLA 1TZLA 4KICA 2GA2A 3RKWA 3A01A 1ETWA 3PNTA 4IVNA 2LK2A 2IS6A 3QPHA 3RIRA 2V4JC 2WC2A 2Z5UA 3ZXSA 1DDNA 4IQ4A 2JT1A 4GGGA 2X6XA 1YLFA 2LVSA 2EFNA 3GEZA 4DBQA 1Z77A 1EJ9A 2VN2A 3HEFA 3HXLA 1FMVA 2Q2EB 3OYMA 3H36A 3UR3C 4ZH4F 3PL8A 4Y33A 3JTGA 4F92B 2PJRA 1HDPA 1UMQA 5DDGA 1BI3A 2I8DA 3HGGA 4EGZA 1T38A 3GLXA 1AA7A 4I6ZA 3ASOH 4LFUA 1G3WA 3CUOA 3SYTA 3GTGJ 4HLYA 1X4OA 1GDTA 5J6XA 3OYJA 1MBHA 4MQVA 3G71I 5C4JJ 2H1LA 2EK5A 1ZGWA 2O3FA 2DMQA 1D0XA 4WX9A 2E1MB 2JK3A 3ZCOA 5B66C 2QCOA 4RB2C 1X3WB 1TQIA 2XF7A 4EJOA 2HOTA 1BC7C 1FOXA 3BP8A 1S8NA 3VYUB 3GF2A 4PJNA 3CCUI 1TBXA 3ERMA 4ENKA 4XR6A 1UELB 5TISC 1LEAA 1ZTRA 2PMZA 5CVRA 3CCQI 3S1RJ 5EZHA 1FOKA 4BXUA 1YE9A 2F2EA 1QZEA 2VQHA 3S3MA 4C3HJ 2DDBA 3TQNA 1TL8A 4ZYHA 1YQAA 3FXUA 3K9TA 2X6WA 3V8LA 5EF6A 4PSWA 4HSRA 2FMYA 2K40A 1XMAA 2KQRA 3HHGA 1KU3A 3MWMA 2L54A 1Z91A 1SVLA 3KX2A 3REOA 1K79A 1ON1A 3FMSA 1NHAA 1YG2A 3OR1C 3CCSI 3E0JB 3BOQA 3TOBA 4YEJA 1BN5A 4ESJA 1ZQ3P 1NK2P 2QQ9A 4XRFA 1D0YA 4KUMA 2OAZA 3JAMZ 2IA0A 3WTXC 1TC3C 3F8NA 2DA2A 3F9KA 2M7BA 4UV9A 4A3JJ 4EJUA 4C9YA 1R58A 2HOEA 3IKTA 4A3KJ 3KEOA 3GTQJ 1WPKA 3HM5A 4XICA 2E2HJ 1JT0A 1PJRA 2XGDA 4A3FJ 2IVMA 1R4MB 4H0EA 4U0VA 2DFHA 1BR1A 4XLAA 5K7FA 2XVCA 3GO5A 5IYDJ 3KP2A 4BHPA 2YPRA 1ULYA 2IBDA 5ILVA 3BCAA 3S14J 2CQQA 2GBYA 4ZYDA 2MBFA 1E2XA 1YJWI 1W0UA 2V9KA 2M4KA 3HRUA 3T5XA 3LSIA 1D0ZA 2K9LA 4HAMA 2VUMJ 3F8FA 5FLXK 2G0EA 1SD4A 1XGSA 2RN7A 4FASD 2B9SA 2JUCA 1DP3A 5H6RA 4IX7A 2OV7A 1XSVA 4Q4ZF 2NNNA 1W5TA 3GZ5A 4HSTA 1V5EA 4XOTA 5JLXA 1HCRA 4Q47A 1YRNB 5FFXA 3B73A 1TT0A 3I4PA 5B5EC 1SANA 1TQPA 2EQRA 5J47A 2XF5A 4LG3A 2IGKA 4I0BA 5J3LA 4M3GA 2F5DA 3QU3A 2H27A 3ZMTA 1ZHFA 3ZN0A 2M0MA 4RB3C 3JRHA 1VQKI 1EH6A 4AM3A 1CF7B 4RAGA 2V1NA 4LGWA 2LD5A 4DGWB 1K7AA 2F5VA 3S32A 2VONA 3KP3A 2V79A 4YG2F 3J80Z 2DYSH 1S3JA 2MW8A 1S72I 2CS3A 3B02A 5E18F 4QSHA 3J7AO 4U7DA 2Z1DA 2AHQA 1D5VA 2Y48A 4L9VA 1TWHJ 4RMNA 3F8MA 3CJQB 3IWFA 1NTCA 2IEKA 3L2UA 1IC8A 4B1RA 1V54H 1B6AA 3SZPA 2R0QC 2XB0X 1TQMA 3HHHA 2XIGA 3NRVA 4IKFA 4IJAA 3H5RA 3RI4A 3V8JA 2ME0A 2VQGA 1RR7A 3KYCB 4M3FA 1MD0A 1O3TA 5LGTA 3HUGB 3RYPA 3RKYA 1IN8A 2YSRA 3MEXA 1YW9A 4P9FA 2P5LC 2R93J 1EKEA 2AO9A 3Q5FA 4P1WA 3WTYC 1VQOI 3EUHA 3HIFA 3BJ6A 3T1BA 2BHYA 3GCMA 3KE2A 4XRSG 2E19A 4XKVA 1S7AA 2A61A 3Q0WA 1DQUA 3BG3A 2Z33A 3H3VK 5F04A 3ZGKA 3TKYA 3OYBA 1IGNA 2Y31A 2Z99A 3GXOA 1P4XA 1QPMA 3PSIA 5DV5A 1BI0A 2GIVA 2QM3A 5EJCA 2X6OA 3GUDA 5DCMB 5E8GA 1U6GA 2ZFWA 3IC7A 5AONA 5FKKA 5E17F 4WK8F 2W1OA 3OS2A 2HGCA 4L9JA 4LIUA 1B8IA 1UB9A 1MMAA 4LLNA 2W00A 2VPLA 2ZXWH 3H3UA 1V4RA 9ANTA 3MKLA 1HXDA 2Y69H 4XN3A 2CWEA 1UG0A 4BS9A 1ONVA 2K4JA 2DO7A 1XB4A 1Z3XA 2ISYA 3OOUA 5FKMA 4WXHA 2HVRA 2AQFA 3L1PA 1JT6A 5L3DA 1AKHA 2RAEA 3FHNA 2W84A 4O5VA 1D3YA 2JPCA 4JX6A 5HVQC 5CVVA 1MNMC 2HDDA 2LC2A 3W6VA 2EINH 2ZCWA 1R36A 2DMTA 3S8PA 3TOAA 3LQQA 1XGMA 1S5LC 5FRMA 3DP7A 1MBJA 2NVUB 2VASA 1WJ5A 2LP0A 3HGYA 3E6MA 1KQ0A 1MKMA 2R7DA 2XAJA 4XLEA 4XLCA 1ETKA 2KRHA 4DYCA 1V5GA 3LSMA 3F72A 3RPUA 1XG1A 2XAHA 3PUFA 3IL2A 1G2HA 1ZG5A 5DD8A 3G4SI 2DODA 3C1DA 2DT7B 3J81K 3W2AA 2MC4A 2UXNA 2M1BA 2MH9A 2W85A 3E7LA 2PFBA 2P7CB 4PFOA 2BZTA 3TEDA 4E7IA 5F1JA 4XNFA 2LREA 1BA5A 3CP2A 1LDDA 5BQTA 5E3LA 4G7HF 3IH2A 1JE8A 2Q1ZB 2F4OB 4L0ZB 2VKHA 2LF8A 3H9QA 3CCVI 3H92A 4IRGA 2DMPA 3LSGA 3IV5A 3W6JB 3OIPA 1IV6A 4EATA 3FK7A 1YIJI 3AAFA 1KQ9A 4RS8A 1YHQI 3CJRB 4JP0A 3JAMK 1MMNA 1D5YA 1FC3A 2PI0A 1VQ6I 5LHIA 1G8XA 1APLC 3GFMA 5A2QK 4BAYA 2KDZA 2ACJA 3TL4X 1VQ8I 1BJZA 2PJRB 4BNCA 2L9SA 3I54A 3JW4A 2Q2EA 3K4JA 3H3ZA 4Q48A 2F5CA 1MBFA 4WXCA 1P9QC 2E1OA 1OPCA 4C2UA 1USTA 3HZJA 1HC8A 4WCGA 1JTYA 2ELJA 4IF4A 4GCVA 1SC7A 1HKSA 1HDDC 2JRMA 4BU2A 4UUVA 1GV2A 4MTDA 1B72A 2OPTA 3CMYA 5HDGA 4HW0A 4A93J 2HS5A 5HLIA 5J1YA 3BR5A 4KN7X 2XKOA 2G7UA 5L3BA 4M73A 1RUOA 1WJCA 3HPHA 4G7OF 2K9SA 2IW5A 5DCFA 1PUFB 4BYYA 4D5CA 2XGXA 3QWLA 4OOIA 5ILUA 3CQZJ 5IP9J 5JVGF 2ESHA 4MEXF 3M7GA 1P4AA 4LIVA 2DDAA 1U3EM 2BVLA 3ABUA 4NNJA 1MDMA 3CJTB 1E0EA 2K9MA 2MD0A 3BT9A 3ZP5A 4BDZA 3C3WA 1ZGJA 1DU6A 1PP8F 5J1RA 5IYBJ 1QHHD 1E3OC 4IHSA 1J09A 1RKTA 4HV6A 1R71A 1BOAA 2DN0A 3QP6A 3I3LA 2XSJC 3PUBA 4LLGF 1VQPI 2J5OA 2QGUA 1O57A 2X0LA 3RJPA 3O3KA 1O7LA 2HKXA 4PFPA 3W3CA 2V1DA 3Q9SA 3HOSA 2L7FP 3D1NI 1T98A 2BY3A 1B4AA 3WGIA 4NDLA 2OU2A 2EILH 3PIOF 1XSXA 1R4NB 2BBYA 3MN2A 1EV7A 4M6YA 1A35A 1W7PB 4E4HA 4EM2A 2XGEA 1O7FA 3WGGA 2DMNA 1FWZA 5HOOA 2XROA 2JQ7A 4U87A 3PNVA 1WGXA 2V1XA 5FLXZ 2CW0F 3R4KA 1W1WE 2MD5A 1E3HA 2MC3A 3BR1A 4IL6C 2XAGA 3FK6A 4JQFA 1FTTA 4RAYA 3FZVA 1EH7A 4IOAF 2FJ1A 1I39A 4M72A 2ID3A 2HTSA 1I3QJ 1EA3A 5JI6A 1SFKA 1OCZH 2L9VA 4UUTA 2P81A 2XRLA 2EFWA 4MFDA 5L3EA 2XGCA 4D5FA 2MSYA 1FMWA 2O8XA 1YJNI 4BJ5C 2PN6A 3HRTA 4E7KA 3K2ZA 1JI8A 1JJ6C 2FOWA 2L0KA 3TW7A 3CO6C 2ISZA 1NG6A 1PUEE 3KP4A 2VI6A 2L7KA 4BXXJ 2OBPA 5CYVA 5F27A 3G2BA 3R60A 5F64A 4FE7A 2BW3A 4IZZA 3H5AA 2E5ZA 3BQZA 2ZSHB 2QWWA 1F5TA 1QBJA 3UNGC 1LDJA 3P7NA 1ETOA 3KYLA 3KIOA 1O3QA 1S6LA 2VKVA 4JX5A 3IRQA 4A3LJ 2K02A 3N97A 5B3SH 3G73A 3Q9VA 1HF0A 1MSEC 4IHVA 1BR2A 3LL7A 4ITVA 1X2NA 3R0AA 2LKSA 2JA7J 2CU7A 1B9NA 1YYVA 1MNEA 1HSJA 3RTRA 3E6CC 3H9GA 1J5YA 2E2IJ 4P96A 2ZXIA 5F0FA 3R6SA 3G3ZA 3GVAA 5J4VA 2R5YB 3T8RA 1UG2A 5JFRA 1U5TB 2RKHA 3QYEA 3OIOA 4XK4A 2TCTA 4M6VA 3IRRA 1FSEA 3DBLB 2VXDA 4ZZDA 2DA5A 1LQ1A 2VKEA 5D6EA 3GTJJ 1OLTA 1LE8A 4FETA 4UUSA 1Y6IA 4E7SA 5HS7A 4X0GA 1WJFA 2FU4A 4BDYA 4BE2A 4EV0A 3FMRA 2XC7A 2EV6A 5EZGA 1HW2A 2F6CA 3QU6A 5H6QA 4OU0A 2BXZA 3BJOA 5KCMA 1MH4A 3MKWB 3PO3J 2A6TA 2R7QA 3GFLA 3GW2A 3KP5A 2X48A 2OZ6A 4KNYA 3QOPA 3V8KA 2VBYA 1A31A 1FYKA 3DLLF 2HZDA 2D1HA 3JSPA 2EFQA 1H88C 3MFKA 1WWXA 5CVIA 4XORA 2QUFA 4A3BJ 2LBFB 4M9ZA 1FSHA 2LH9A 3K69A 3KETA 3S16J 1OQYA 1N78A 3R0JA 5D5XB 4XLFA 2KKOA 4RGXA 3RPQA 3E6BA 6PAXA 3DEWA 5D4RA 1AKHB 1HKQA 1SD7A 5BNGA 4GRIA 4HF2A 1AWCA 2JA5J 5J8FA 3HSFA 2FA5A 4YFNF 4XONA 4C3JJ 1AU7A 1Z6RA 1TWAJ 4HNTA 1F36A 2E7XA 2YU3A 3FWEA 5E79C 1V3FA 3M1CA 4JBAA 4E7LA 1HA8A 1M1EB 1OJLA 5L3FA 3IP4B 1TTYA 2QSHX 2JSPA 1R1TA 2DPUA 1IJWC 1E3PA 2QVOA 2ELKA 4ESBA 5B1BH 5LFAA 1T33A 4OIPF 3AL0C 1ZYRF 2E7WA 2CQNA 1GUUA 2M30A 3KFWX 4ZDLA 1V5FA 5JHUA 2FE3A 2JSCA 4I2OA 3SFIA 2DK5A 4XN0A 3DPLC 3V7SA 3GX4X 4CSWA 2BYVE 5TRDA 1LNWA 5LHGA 4BACA 3HUGA 1Z9CA 1K6YA 3ONQA 5E3MA 2XPVA 4V19K 4W1UA 3RSNA 3BQYA 2HDCA 3KP7A 3DTKA 1SEUA 4OIOF 3ABMH 1J75A 2QLZA 2HU9A 3ESWB 3FXMA 3DU5A 2Z2SB 3P9KA 1GHCA 4UXNA 4L5IA 4QWQA 1F1ZA 1VFCA 3VYTB 2L02A 4PJJA 1JUSA 3CDLA 3E3VA 1LFUP 2KISA 4M3BA 4BBRJ 4XRSA 2M5WA 2BV6A 2OQRA 4RGUA 5EGOB 3PO2J 4BE0A 5LEKA 1O3SA 3M1EA 3HJEA 3OY9A 1Y0UA 1YX3A 2W25A 4PSXA 3WE2A 5C4XJ 1QVUA 3K2AA 1LVAA 2Y75A 3MQ0A 4CCOA 3FKJA 3VODA 3BPXA 1SFUA 1OR7A 3KYDB 1BI2A 1X1CA 4E7JA 4L9TA 1T6SA 4XOPA 4OWRB 4X6AJ 3JREA 4I02A 4DOZA 4ZJZA 5IT3A 2LKXA 1QPIA 4F7ZA 2K86A 1FP1D 4IPAA 2M87A 3K1MA 1BW5A 3HKZN 2DT5A 1MMGA 3D0SA 2M8GX 2WA0A 4ZTFA 2WB1A 2PG4A 2DFFA 1U78A 3TO6A 3WU2C 2A3SA 3ABLH 5ERIA 2DMUA 3QOEA 4UUSB 1WJDA 2ADUA 4RA2A 1TW2A 2JVGA 4OMYA 3CLQA 1FBSA 3CZ6A 1R49A 1YW8A 2BEOA 4R79A 4N9IA 2R5YA 2ECCA 2HQRA 3OYIA 4II2A 4G6QA 4CUGA 3J7ZI 1FZPB 2C6YA 5EEGA 5LGUA 2GOMA 1X19A 5KK1A 4IXAA 3SZTA 3K70C 1JUPA 1SVOA 3CP8A 2ZJRF 4O6JA 1Y1WJ 2FF4A 2GXBA 1T2KA 4FX4A 2ZSIB 1TP4A 2NVQJ 1FTZA 2KHMA 4D7MA 3JRDA 2RC4A 3CESA 3I5UA 3CCYA 3CCLI 1MSFC 2G9WA 3CF5F 4J00A 2XUBA 4TV7A 3CC2I 3FIWA 4AYBN 2HOSA 3OL4A 2BY1A 3LAPA 1IF1A 4FHTA 1BR4A 2R7FA 3WE3A 2H6BA 3E6DA 1XMXA 1RC9A 2VL8A 1X1BA 3EYYA 3KLNA 1YJ9I 3GZ6A 3OOPA 3N4MA 2QYOA 5GP9A 5HNHA 4UVCA 1GXPA 2HYJA 3R61A 3CCEI 3DTEA 3TP3A 3GFIA 2KJBA 1J2XA 5BPIA 2OJED 5IPAA 4AVPA 1FIPA 4KT5C 2R7VA 2A68F 4I01A 1R5HA 2DOEA 3HSEA 2GIZA 3FISA 5JLWA 3SHFA 3LSTA 2PQ8A 5D8LB 3ABKH 4H4KC 1R23A 1RUNA 2M2EA 2HPMA 3S15J 2D5VA 1LVKA 3EETA 4RDUA 2VODA 1TWCJ 2JWTA 1J9IA 1D1BA 1FOYA 3F21A 2OQGA 2FOKA 4A12A 1HQCA 1FP2A 1NH3A 5LD2C 5EGOA 3A0BC 2RNJA 2DYRH 1P6RA 4L0YB 3RDIA 2EA2A 3WTTC 2LRDA 3PJRA 2AQEA 3TBIA 2Y0SA 2GQQA 1KU7A 2VOOA 3S17J 4A6DA 2CJJA 2FNPA 5GTIC 4YIRX 2K9QA 4BUPA 4P55A 4B47A 3SJMA 2HTJA 4NC8A 1Z21A 2HXOA 1IZ1A 2KZGA 5ICFA 3U9GA 2PMZN 1VTNC 2P6SA 2DQRA 1JGSA 1XDUA 4B3XA 1WH5A 3IH3A 5F1RA 4EMSA 1MBKA 3HOUJ 2KIQA 1GT0C 1G6NA 2LTPA 3VB2A 2GWRA 5D5UB 3H0DA 4GFBA 5HDKA 2V9PA 1OR7C 2R92J 3RZOJ 2CRGA 1XX5A 3D5SC 1AHDP 2L2OA 3L09A 1U5TC 5L3CA 3ZR8X 3A2KA 1K61A 1DPUA 1QQIA 2DJIA 4YIIA 3TMOA 2CO5A 2CUEA 1A04A 2K3FA 4DBRA 4ESFA 3BTCA 3HB9A 2MGQA 4PJ0C 3TO7A 1ZG3A 1B72B 3L9FA 4GYIA 3ISPA 4HQMA 1ETVA 2NVTJ 1QA6A 5KNLA 3CUQB 2CGPA 5E3NA 3SEQA 3HYIA 2PLYA 3L00A 3AFHA 2STTA 1GXQA 4HYEA 2KP6A 3ZQCA 3K70D 4FTHA 1RESA 4IHXA 2RGVA 4C2MJ 3PQJA 1ENHA 1Y8RB 2FSWA 1IDZA 2HDWA 1ZLKA 3DV8A 4XLNF 2ESNA 2FXAA 3VYRB 1MJAA 1MNDA 1BW6A 1R1UA 2LBFA 3BLYA 4HX7A 2K27A 4FE4A 5GPAA 3P9IA 4MNUA 1GV5A 1IDYA 1HLVA 5FLVA 4UVBA 4OINF 2GXGA 2CFXA 3H1CA 4OAYA 1I1GA 4BKXA 4CZCA 2R7OA 2HQNA 4Y15A 3IH4A 3M3YJ 1W36D 1U0JA 2MFZA 4HF0A 4KISA 4EQQA 4G6DA 2AS5F 1W5CC 3HBLA 1V55H 2YR2A 4YELA 2ZC2A 2NXNB 3H0GJ 1TT5B 1SFOJ 1X3ZB 2EFPA 1CGPA 4KN4X 1JKOC 2EB7A 5H2FC 3EDPA 4HG2A 4DZPA 5M3MJ 4U0WA 2CQXA 4C2TA 1T56A 2LF7A 4XKCA 1U8BA 1A6QA 3C2HA 1P2FA 5CKTA 2DU9A 3VYSB 4Q5SF 2MYSA 2ZXJA 5HDNA 1BBYA 4LB5A 1BC8C 4I0AA 1SD5A 3AL0B 3ZQ7A 4AD9A 4AUXA 3OYLA 3CJNA 3HOWJ 4RM3A 1WRJA 3CDHA 2MABA 2HNHA 4B09A 3GTOJ 3BR2A 4IHTA 1WFXA 1FYMA 2COBA 3E5XA 1R5ID 4G94A 2FQ4A 2BVMA 5FROA 5AIQA 1MBGA 4V2FA 1TWFJ 1DU0A 1WJBA 1RKWA 4IEJA 2R4GA 4BY1J 3AKZA 5GPCA 1FBQA 2Z3YA 4CH7A 2HOAA 2VJIA 3F6OA 3OYFA 1IAWA 4E6KG 3DEUA 5KAIC 2K7LA 3HDDA 1FEXA 2COMA 4ABZA 3DLAA 3L2RA 3JSOA 1HW5A 4BEHA 3AG3H 1T0FA 2XAUA 2XPWA 1LEBA 2EZHA 1UZCA 3FXKA 1N25A 1H9GA 2ICWG 3GBGA 2CSOA 2VPRA 1B8IB 1MJBA 2DA3A 2VJ5A 3O8HA 2ME6A 5IOZA 5FFZA 2E5NA 3VOEA 3COAC 2JA8J 3NQOA 3M8JA 5K5OA 2RQPA 3F8BA 1XDSA 4F3QA 3ZMVA 2FRHA 3TDUC 2WWYA 5DTDA 1BOBA 1X4PA 2VE8A 2P6TA 2NS8A 2P5VA 2M45A 2DT6A 3O2PE 2HEOA 4KA4A 1FPQA 1JTXA 3L2QA 2KIMA 2D1VA 3Q0UA 4E7HA 2XKPA 4HRIA 4KDPA 4CXFA 5E1ZB 5DUIA 1T95A 4GO1A 2X6YA 2CW8A 4YRVA 3S2HJ 2CV2A 3ECOA 1KA8A 2KZVA 2VBWA 3CDIA 4G8XA 4F52A 3O6BB 1ZKGA 1YFHA 1MIJA 4G12A 4M74A 3SXYA 2XASA 4BE1A 2VE9A 3JRAA 4L9NA 2O03A 4BQOA 2O0YA 3U2RA 1ORKA 2YUSA 3DPTA 2K4BA 1IG7A 1SAUA 2PX9A 4CCMA 3OR2C 4CYDA 3LNQA 4RM2A 5DEQA 3JRFA 5LRSA 2NS7A 1W5SA 2E35A 3MD2A 3BZCA 2VC0A 4HOBA 4AIHA 2KIFA 4YFKF 1K6OA 3QPSA 2EIKH 1WQ2A 3V4GA 1SAXA 4XSZF 3LOCA 5CQGA 3OL3A 3BWGA 2RV8A 4V2GA 3WODF 1W7PD 1FY7A 1ITYA 3I53A 1CF7A 2GM4A 2BGCA 2DW4A 3HKZA 3E97A 3K1NA 3ZMSA 1R22A 2LLKA 5H20A 2ID6A 4Y52J 2DPDA 3M4OJ 1ZARA 4M3DA 1SMTA 2LOOA 4GYGA 4LJZF 3WTWC 4YFXF 4Y17A 4EM1A 2R7WA 1U9NA 2GOXB 4GXOA 4XKBA 2ZNZA 4DYRA 2R7UA 1BL0A 4Z6YA 2OCEA 5AIPA 3Q0VA 4XQFA 2HFHA 1BJAA 2QSGX 2ELHA 3RYRA 4C3IJ 3PIPF 2R7TA 2DOAA 3D5LA 2MLKA 1Z7LA 5DS9A 1UJ8A 4D1QA 2XAQA 1H89C 1SD6A 1XGOA 3EUKL 2CQ7A 3DBRB 1S7EA 1VZ0A 2XV4S 3M9AA 4PJLA 3S2DJ 1IV8A 2VJ4A 4MIMA 4KMUX 1UAAA 4AIKA 1RI7A 1Y56A 4XBFA 2MA3A 1ZREA 1WJEA 3DU6A 2EFOA 2VOPA 2OD5A 2ZNYA 2NRAC 1X1AA 4N4OB 4U7BA 1RZ4A 2UUZA 2M8EA 3BROA 4HX8A 4XL9A 2UXXA 4Y3OA 5CPRB 3BTIA 4MHGA 2YU9J 3HTSB 4WF2A 2LYCA 5IYCJ 3VEPA 4IOCF 4EM0B 3TDZC 3EUHC 3S2WA 1XC5A 1BIAA 3SFZA 5IP7J 5KHDA 2CYYA 4ZYAA 4S0HB 1MH3A 2V9VA 1YITI 2DTZA 2HYGD 3A1YA 3IAM2 2EV0A 3QPLA 1OISA 2AXLA 4KJZA 3HOTA 4NQWA 4HV5A 4NUBA 5DM7F 3KEQA 4FQGA 5J1UA 1C0WA 2A6HF 3HOZJ 1YIOA 2DFIA 2IA2A 4ZYEA 4PGHA 2LNBA 2H8RA 1D1CA 3BR0A 5BOXA 3OYEA 5KAFC 1VQ4I 4AU7A 1WI9A 4HDUA 3F3XA 4L5JA 4XLHA 3AG4H 3CCJI 3OMYA 4QTRA 3LQRA 3M8FA 2QENA 4N9HA 5HLTA 3SDGA 1FJLA 2L9RA 1I6HJ 2ETHA 4GDFA 4UV8A 3SZGA 1MJ9A 2I5UA 2J5PA 2X9DA 1ETXA 1Y39A 2V6CA 4A0YA 1GLNA 2D2WA 4N0BA 3BJAA 3B6CA 5HLGA 2V6EA 1TW3A 2WY7Q 1IN5A 3BZ6A 5J40A 3I4NJ 1U2WA 2RVCA 3ECHA 5FD6A 1JKQC 1ZAOA 5D8KB 1S9HA 1YO5C 3MZ8A 3CUQC 4HQEA 2DA7A 3JCUC 5EDNA 2JPBA 3WTZA 3QQAA 2A69F 4IHWA 1T8IA 3GMEA 1OCRH 2L7MP 2EIJH 1JKRC 1ZN2A 1VQMI 3L2CA 2NOGA 2BE5F 2HYFA 5DCMA 4JK1X 4A3DJ 1JHHA 1IRXA 2ZMEC 1LPQA 3CLOA 3BG7A 4XSXF 1Z67A 3W2VA 3H9JA 5ED4A 3KEYA 3PM1A 4YIFA 3MKZA 1FBUA 1TNTA 4NQWB 3WG7H 2FD5A 1OYYA 2KJCA 2XHKA 4LLLA 3A02A 4M71A 2WY8Q 3OYAA 3FDYA 2HPIA 3NWSA 4OAZA 5LRRA 4AC0A 3G1LA 2GA1A 1U9OA 1YS6A 4IO9F 3TGNA 2P7VB 3BG9A 2LY2A 1KONA 5F0CA 3VFZA 1ACIA 4EVIA 3EQLF 1TNSA 3A4CA 3H35A 4Y13A 1J7KA 3GTMJ 2DLLA 2GAUA 4ANJA 2H8WA 3PFIA 5DYMA 1ERDA 3HPGA 3VPRA 1G3TA 3FM5A 1K4SA 3MKYB 2CV0A 2M9HA 1SMYF 4DQ2A 3P9CA 3FBIB 2NAZA 3IKVA 3H5NA 2VT3A 1VF9A 2JA6J 2EV5A 2QKLB 3CTAA 4NC7A 2MLGA 2IPQX 5TGTA 2ZKZA 2GZWA 1STZA 4OIRF 2ZB9A 4KFCA 3LSHA 1IN4A 1MDMB 1BI1A 2JMWA 2GXAA 1Y8QB 1XS9A 4II3A 5HNFA 4XRMA 3QYFA 3OSGA 3GTPJ 1Y0NA 2F5EA 3OV8A 1MZBA 1PUFA 3HRMA 3FXOA 5FO5A 3QODA 4J01A 2K85A 4LK1F 2ZFUA 2RNGA 2HR3A 2X1CA 3EYIA 1YW7A 5BMZA 1GVJA 2BXYA 2WV0A 3K4BA 1IRGA 1R6RA 3HC7A 1LE8B 3ZMDA 2VT2A 2YS9A 3OSFA 1XCVA 3G1MA 1ZRDA 5LEJA 3J7AY 2IT0A 4IRIA 1IN6A 4EJWA 3CC4I 2X1DA 1P7IA 4QPQA 3B6AA 2VXZA 3FF5A 3GZNB 4M3EA 3F22A 3HOVJ 1J0RA 3E1SA 3ROUA 3HTUA 3W2WA 3CCRI 2P8TA 5LHHA 2O9LA 1LUJB 3VSLA 5LGNA 1BM9A 2BY2A 1J59A 1G3SA 4I7HA 4ENJA 4CGZA 4P5OA 3MAJA 3O8GA 4DZJA 4I76A 1U8RA 2ZBKA 2JTVA 3BPVA 4A2UA 1I1SA 3BY6A 2Y2ZA 2CUJA 2ZJQF 4HEA2 2LR8A 2FBKA 3DCFA 5FJ8J 3GTLJ 2BW3B 2KMUA 3PSFA 1ZK8A 3DKXA 3M07A 4A0ZA 4BHCA 1QRYA 4XMYA 4PDKA 5DUKA 3FXLA 4B3AA 4DNCA 3FKIJ 1MGTA 4LB6B 1K78B 5L3GA 2RQQA 4XLPF 3WTVC 3WU0A 5BPDA 3U1DA 4DYQA 2NVXJ 2IS2A 1A5JA 2L7ZA 3ML6A 2Y9YA 5EEHA 1FX7A 2LFBA 1ETQA 5E1XA 2EZKA 2MH2A 3FXRA 4ZZLA 3S93A 1ZRCA 4NBQA 3HOYJ 4E7ZA 4PK4A 1PVEA 4UB8C 2H1KA 3MVPA 3K4LA 2P4WA 1YS7A 1REPC 4JOMA 3L2VA 3DFGA 2E1NA 2IGNA 3P5JA 4A3GJ 3ZQFA 4RAZA 5EYRA 1OCOH 2KDOA 2HI3A 3LFUA 2FMLA 3NARA 4A3IJ 5JR3A 3DKYA 3IUOA 5F6FA 3OYGA 3OWTA 4RBOA 2IXSA 1YX5A 2XF6A 5FKNA 3JR9A 1G4DA 5HLHA 3KLOA 2G7HA 2KLOA 3ZQHA 4L5EA 3C7JA 3LWFA 3RCOA 5JHFA 2VC1A 2JRTA 4CCKA 1SFEA 2F4IA 4EJTA 2DK8A 1HOMA 1DP7P 2EA4A 1EF4A 2WADA 4HLXA 4ZTJA 2HZTA 3WTUC 1QHGA 2WB1N 5JVTA 1YOVB 2KL4A 1RNLA 3K7AJ 2LY1A 3A01B 4FX0A 3TP0A 2IP2A 3I55I 3K10A 1WJAA 2DBBA 4HNUA 4HBLA 5GAGJ 2W24A 1I5ZA 2Q0OA 4X1EA 2L4MA 4R1HA 1WSUA 1IUYA 3U21A 4LMYA 2M34A 2OTLI 2NYXA 5FD5A 2PJPA 2VQCA 3JRCA 1OYIA 4U88A 4CDGA 4ETSA 1XN7A 2WTEA 4BJTA 2W7NA 1K83J 3L7WA 2K3PA 4CCLA 3OYNA 3MZHA 1XD7A 3BR3A 4ENNA 3X2QH 3OYDA 2EWNA 3ABTA 2DA1A 3OIQA 5HS9A 2IRFG 3RQIA 3DXJF 4U0YA 1WKMA 5HS8A 2HQ5A 3ASNH 1GVDA 3PFYA 1IRFA 5IY5H 5IOYA 2D45A 2ZXHA 1USSA 5LBQA 1R1VA 5K1YA 1RR8C 4KT6A 4AWXB 4AIJA 1OFCX 3LA7A 4UHTA 4HPQA 2VJJA 1O4XA 1XMKA 1I50J 2M7AA 2OF7A 1N77A 3KZIC
chains in the Genus database with same CATH topology
4I09A 1P4WA 4PZJA 1ZGAA 5KVRA 1ON2A 4RB0A 1HBXG 3KZZA 3GFJA 5FGMA 5CVJA 1D8JA 2H94A 4OIQF 2CG4A 4NB5A 4KIBA 1UFMA 3KCCA 3V7RA 3ERED 3DKWA 4KYWA 4CHUA 1XCBA 5IT9K 3DF8A 2B0LA 3I59A 2PBIA 3FHZA 1L3LA 2VBZA 2Q8KA 5LLQA 1UHWA 1ZG1A 2V1UA 4HZFA 4S04A 1AOYA 3K1PA 1D8KA 3HRSA 1TLHB 2P5KA 1KYWA 1OKRA 1I27A 1PDNC 4UNOA 1DUXC 4KIFA 1BIBA 4LD5A 3KP6A 1Z6TA 2JZYA 2O6GE 2DTRA 2A6EF 2QQBA 1ZLJA 2L3DA 2X4HA 1JHFA 4Z2YA 1Z7UA 3ZPLA 2LSOA 4ZYGA 1S7OA 1W4MA 1O3RA 4HF1A 3E5QA 2YX4A 4ON0A 1K78A 3FX3A 1IXRC 1S29A 3LA2A 4LG0B 3MZYA 5D5WB 3PQKA 4G7ZF 4CZZA 4ENMA 4MTEA 3I71A 1KU2A 1ODDA 1G3YA 1P92A 3ZN1A 1KU9A 4CO8A 5D4SA 1Q1HA 1F4KA 3T8TA 4CICA 3E5UA 4PCQA 1FLIA 1SFXA 5D6FA 4HDVA 2QBYB 4G7OF 1PP7U 3FXQA 3DQVC 1XSDA 3I0TA 2PEXA 3QAHA 4WWCA 3SQNA 2LDUA 2E1CA 1HW1A 4D0PA 2ZO4A 1KGSA 1L0OC 4BHBA 2H6CA 2R3SA 2OA4A 1FNNA 2NNYA 5K5RA 3C18A 5K5QA 2ZMEB 2LKPA 3FM3A 2FBHA 3LA3A 2EJRA 4E70A 5ICGA 4HX4A 2OZUA 3WG9A 3J80K 1ZH5A 3M8EA 4EGYA 4MEYF 3IHUA 4PGGA 4HA8A 4OMZA 4KMFA 4A6EA 2QBYA 1R5GA 2UWMA 2STWA 4A0XA 3J81Z 4WXDA 2F5FA 1H0MA 4EJVA 2FEZA 4MGRA 1YTYA 3RKXA 1LB2A 3ZMZA 1RIOH 2FBIA 1R00A 5CJ9A 2NS0A 1X3UA 3FMQA 4M9XA 5E1WA 2KRFA 3GWZA 4KIGA 1DPRA 4L18B 3KZYA 2RDPA 1FT9A 3WU1B 1JXSA 4FT8A 4P9UA 2PMUA 4B8XA 3QRFF 4LK0F 1B59A 4LG0A 1B1BA 3F6VA 1XGNA 5FB2A 2QZ8A 1Z1DA 2YX7A 3V7CA 3I58A 2HKOA 2O61A 1I6XA 2XAFA 4BQAA 3HSRA 1QGPA 3MCZA 4S05A 2KIUA 4NHJA 3W6KB 2W57A 3ELKA 3LAJA 4BH9A 1UCRA 5ICCA 2L01A 4G9YA 2IA1A 4QLCU 1U5TA 2CQKA 1IXSB 1F9NA 1HKTA 2PMHA 1UHMA 1QO0D 3ZMUA 2XRNA 3T0YA 4UVAA 2Z9OA 2FNAA 3CO7C 3F23A 3F8CA 2UZKA 3QPTA 3JTHA 4I98B 1B9MA 2TDXA 2A5YB 4A5MA 3ULQB 5A2QZ 2HWVA 2VBXA 1OYWA 1IN7A 2A07F 1KQ8A 3BDDA 5DD4A 1R7JA 4IRHA 3I59B 1Z05A 5E8IA 4RGSA 1QZYA 4RGRA 3K0LA 2L4AA 5CVUA 2DQLA 1OMIA 3IWZA 1QNTA 4MQ9F 2DI3A 3TO9A 1W7PA 1H9TA 5CLSA 3GYHX 4RB1A 2ZMEA 5BS6A 5TJJA 5ILSA 1HSTA 1LDKB 5E20A 1QZZA 3NEUA 2FQ3A 3QP5A 5J8CA 1FYLA 1KYZA 3I64A 5IT9Z 4M6XA 1T39A 3CUQA 5D5VB 1ZRFA 1IXCA 4O3MA 2ZJ2A 4K2EA 4R8HA 2DAOA 3LFKA 1E17A 1EH8A 2H09A 2QQAA 2IJLA 2Y0MA 1IW7F 4ASNA 3WGHA 1LJ9A 4M9SA 5ICEA 3WTSC 4A5NA 4KICA 2GA2A 3RKWA 4IVNA 3QPHA 3RIRA 2WC2A 2Z5UA 1DDNA 2JT1A 4GGGA 1YLFA 3GEZA 2EFNA 2VN2A 4ZH4F 3JTGA 5DDGA 1BI3A 4EGZA 1T38A 3GLXA 4LFUA 1G3WA 3CUOA 4HLYA 5J6XA 4MQVA 2EK5A 2O3FA 4WX9A 4RB2C 1TQIA 4EJOA 1BC7C 3BP8A 1S8NA 3GF2A 1TBXA 4ENKA 1LEAA 5CVRA 1FOKA 4BXUA 2F2EA 3TQNA 4ZYHA 1YQAA 3FXUA 3K9TA 3V8LA 2FMYA 1XMAA 3HHGA 1KU3A 3MWMA 2L54A 1Z91A 3REOA 1K79A 1ON1A 3FMSA 1NHAA 1YG2A 3BOQA 3TOBA 1BN5A 4ESJA 2QQ9A 4XRFA 4KUMA 2OAZA 3JAMZ 2IA0A 3WTXC 3F8NA 4UV9A 4EJUA 1R58A 2HOEA 3IKTA 3KEOA 2IVMA 4H0EA 4U0VA 2XVCA 3GO5A 3KP2A 4BHPA 2YPRA 1ULYA 5ILVA 4ZYDA 2MBFA 1E2XA 3HRUA 3T5XA 4HAMA 3F8FA 5FLXK 1SD4A 1XGSA 2RN7A 5H6RA 1XSVA 4Q4ZF 2NNNA 1W5TA 3GZ5A 4Q47A 5FFXA 3B73A 3I4PA 1TQPA 4I0BA 2H27A 2F5DA 3QU3A 3ZMTA 1ZHFA 3ZN0A 4RB3C 1EH6A 1CF7B 4LGWA 1K7AA 2VONA 3KP3A 2V79A 4YG2F 3J80Z 1S3JA 3B02A 5E18F 3J7AO 1D5VA 4U7DA 2Y48A 4L9VA 3F8MA 3IWFA 3SZPA 1B6AA 1TQMA 3HHHA 2XIGA 3NRVA 4IJAA 3RI4A 3V8JA 1MD0A 1O3TA 5LGTA 3RYPA 3RKYA 1IN8A 2YSRA 3MEXA 1YW9A 4P9FA 2P5LC 3Q5FA 3WTYC 3EUHA 3HIFA 3BJ6A 3T1BA 3KE2A 1S7AA 2A61A 2Z33A 3TKYA 3GXOA 2Z99A 1P4XA 1QPMA 5DV5A 1BI0A 2GIVA 2QM3A 3GUDA 5DCMB 5E8GA 1U6GA 2ZFWA 3IC7A 5AONA 5E17F 4WK8F 2HGCA 4L9JA 1UB9A 4LLNA 3H3UA 1V4RA 1HXDA 2CWEA 1ONVA 2K4JA 2DO7A 1XB4A 2ISYA 4WXHA 5L3DA 2W84A 4O5VA 1D3YA 2JPCA 5HVQC 5CVVA 2ZCWA 1R36A 3TOAA 3LQQA 1XGMA 3DP7A 3E6MA 1KQ0A 1MKMA 2R7DA 2XAJA 3F72A 3RPUA 2XAHA 3IL2A 1ZG5A 5DD8A 3C1DA 3J81K 2W85A 2UXNA 2M1BA 2MH9A 2P7CB 2PFBA 1LDDA 5BQTA 4G7HF 1JE8A 4L0ZB 2LF8A 3H92A 4IRGA 3W6JB 3AAFA 1KQ9A 4RS8A 3JAMK 2PI0A 1FC3A 5LHIA 3GFMA 5A2QK 4BAYA 2ACJA 4BNCA 3I54A 3JW4A 2Q2EA 4Q48A 3H3ZA 2F5CA 4WXCA 1OPCA 1USTA 4WCGA 4IF4A 4GCVA 1HKSA 4UUVA 4MTDA 5HDGA 4HW0A 2HS5A 5HLIA 4KN7X 2XKOA 2G7UA 5L3BA 4M73A 1RUOA 2IW5A 5DCFA 4BYYA 2XGXA 4OOIA 5ILUA 2ESHA 4MEXF 3M7GA 1P4AA 1U3EM 3ABUA 1MDMA 3ZP5A 3C3WA 1ZGJA 1PP8F 4IHSA 4HV6A 1BOAA 3QP6A 4LLGF 2J5OA 1O57A 2X0LA 3RJPA 3O3KA 1O7LA 2HKXA 2V1DA 3Q9SA 3HOSA 1T98A 1B4AA 3WGIA 2OU2A 1XSXA 2BBYA 1EV7A 4M6YA 1W7PB 4EM2A 1O7FA 3WGGA 5HOOA 1FWZA 2XROA 2V1XA 5FLXZ 2CW0F 3R4KA 2MD5A 2MC3A 2XAGA 4JQFA 4RAYA 3FZVA 1EH7A 4M72A 2HTSA 5JI6A 2EFWA 5L3EA 2O8XA 2PN6A 3HRTA 3K2ZA 3CO6C 2ISZA 1PUEE 3KP4A 2OBPA 5CYVA 3R60A 5F64A 2QWWA 1F5TA 1QBJA 1LDJA 3P7NA 1O3QA 1S6LA 3IRQA 2K02A 3N97A 3G73A 3Q9VA 3R0AA 1B9NA 1YYVA 1HSJA 3RTRA 3E6CC 1J5YA 4P96A 3R6SA 3G3ZA 3GVAA 3T8RA 5JFRA 1U5TB 2RKHA 3IRRA 1FSEA 4ZZDA 1LQ1A 5D6EA 5HS7A 2FU4A 4EV0A 3FMRA 2EV6A 1HW2A 3QU6A 5H6QA 4OU0A 3BJOA 3GFLA 3GW2A 3KP5A 2OZ6A 4KNYA 3QOPA 3V8KA 2VBYA 1FYKA 2D1HA 3JSPA 2EFQA 3MFKA 1WWXA 5CVIA 2QUFA 4M9ZA 1FSHA 3K69A 3KETA 3R0JA 5D5XB 2KKOA 4RGXA 3RPQA 3E6BA 6PAXA 5D4RA 1HKQA 1SD7A 4HF2A 1AWCA 5J8FA 3HSFA 2FA5A 4YFNF 1Z6RA 2E7XA 2YU3A 3FWEA 1V3FA 4JBAA 5L3FA 1TTYA 1R1TA 2DPUA 2QVOA 4ESBA 4OIPF 1ZYRF 2E7WA 2M30A 3KFWX 5JHUA 2FE3A 2JSCA 4I2OA 2DK5A 3DPLC 3V7SA 3GX4X 2BYVE 5TRDA 1LNWA 5LHGA 1Z9CA 3HUGA 2HDCA 3KP7A 4OIOF 1J75A 2QLZA 3P9KA 1GHCA 4UXNA 4L5IA 4QWQA 1F1ZA 2L02A 3E3VA 2M5WA 2BV6A 2OQRA 4RGUA 5LEKA 1O3SA 3M1EA 1Y0UA 3WE2A 2W25A 1LVAA 2Y75A 3MQ0A 3VODA 3BPXA 1SFUA 1OR7A 1BI2A 4L9TA 1T6SA 4I02A 5IT3A 4F7ZA 2K86A 1FP1D 4IPAA 2M87A 3K1MA 2DT5A 3D0SA 2PG4A 1U78A 3TO6A 2A3SA 5ERIA 2ADUA 1TW2A 4OMYA 1FBSA 1YW8A 2BEOA 4R79A 4N9IA 2HQRA 4G6QA 1FZPB 2C6YA 5EEGA 5LGUA 5KK1A 4IXAA 3SZTA 4O6JA 2FF4A 2GXBA 1T2KA 4FX4A 2RC4A 3I5UA 2G9WA 2XUBA 4TV7A 1IF1A 3LAPA 4FHTA 2R7FA 3WE3A 2H6BA 3E6DA 3EYYA 3KLNA 3GZ6A 3OOPA 3N4MA 2QYOA 4UVCA 1GXPA 3R61A 3GFIA 2KJBA 1J2XA 5BPIA 4AVPA 4KT5C 2A68F 4I01A 1R5HA 3HSEA 3SHFA 3LSTA 2PQ8A 5D8LB 1R23A 1RUNA 3EETA 2VODA 1J9IA 3F21A 2OQGA 2FOKA 4A12A 1HQCA 1FP2A 2RNJA 1P6RA 4L0YB 3RDIA 2EA2A 3WTTC 2GQQA 1KU7A 2VOOA 4A6DA 2FNPA 4P55A 2HTJA 1IZ1A 5ICFA 3U9GA 1VTNC 2P6SA 2DQRA 1JGSA 1XDUA 5F1RA 4EMSA 1G6NA 3VB2A 2GWRA 5D5UB 5HDKA 3L09A 1U5TC 5L3CA 1DPUA 1QQIA 4YIIA 2CO5A 1A04A 4ESFA 3TO7A 1ZG3A 3L9FA 4GYIA 3ISPA 4HQMA 3CUQB 2CGPA 3HYIA 2PLYA 3L00A 2STTA 1GXQA 4HYEA 2RGVA 3PQJA 2FSWA 1ZLKA 3DV8A 4XLNF 2ESNA 2FXAA 1MJAA 1R1UA 4HX7A 2K27A 3P9IA 4MNUA 4UVBA 4OINF 2GXGA 2CFXA 1I1GA 4Y15A 2HQNA 4HF0A 4EQQA 4G6DA 2AS5F 2YR2A 1CGPA 2EFPA 4KN4X 2EB7A 3EDPA 4U0WA 2LF7A 1P2FA 4Q5SF 2DU9A 2ZXJA 5HDNA 1BBYA 4LB5A 1BC8C 4I0AA 1SD5A 3ZQ7A 4AD9A 3CJNA 1WRJA 3CDHA 4B09A 4IHTA 1FYMA 3E5XA 4G94A 5AIQA 1FBQA 2Z3YA 1IAWA 3F6OA 3DEUA 2K7LA 2COMA 3JSOA 1HW5A 1T0FA 1LEBA 1H9GA 2CSOA 1MJBA 5FFZA 3VOEA 3COAC 3NQOA 5K5OA 2RQPA 3F8BA 1XDSA 3ZMVA 2FRHA 3TDUC 2WWYA 2VE8A 2P6TA 2P5VA 2M45A 3O2PE 2HEOA 4KA4A 1FPQA 2KIMA 2D1VA 2XKPA 4KDPA 4CXFA 5E1ZB 5DUIA 4GO1A 3ECOA 1KA8A 2VBWA 4G8XA 3O6BB 1YFHA 4M74A 3SXYA 2XASA 2VE9A 4L9NA 2O03A 2O0YA 3U2RA 3DPTA 2K4BA 4CYDA 5DEQA 5LRSA 1W5SA 2VC0A 4HOBA 4AIHA 2KIFA 4YFKF 1K6OA 1WQ2A 3V4GA 1SAXA 4XSZF 3BWGA 2RV8A 3WODF 1W7PD 1FY7A 3I53A 1CF7A 2BGCA 2DW4A 3E97A 3K1NA 3ZMSA 1R22A 5H20A 2DPDA 1ZARA 1SMTA 4GYGA 4LJZF 3WTWC 4YFXF 4Y17A 4EM1A 4GXOA 2ZNZA 5AIPA 2HFHA 1BJAA 2ELHA 3RYRA 3D5LA 2MLKA 2XAQA 1SD6A 1XGOA 2XV4S 3M9AA 4KMUX 4AIKA 1RI7A 4XBFA 2MA3A 1ZREA 2EFOA 2VOPA 2OD5A 2ZNYA 2NRAC 4U7BA 1RZ4A 3BROA 2M8EA 4HX8A 2UXXA 4MHGA 3HTSB 4WF2A 3VEPA 4EM0B 3TDZC 3S2WA 1BIAA 3SFZA 2CYYA 2V9VA 2HYGD 2EV0A 2AXLA 3HOTA 4NQWA 4HV5A 3KEQA 1C0WA 2A6HF 1YIOA 2DFIA 4ZYEA 2IA2A 4PGHA 2LNBA 5BOXA 1WI9A 4HDUA 3F3XA 4L5JA 3LQRA 3M8FA 2QENA 4N9HA 2ETHA 4UV8A 1MJ9A 2J5PA 2V6CA 4A0YA 2D2WA 4N0BA 3BJAA 5HLGA 1TW3A 1IN5A 3BZ6A 1U2WA 2RVCA 3ECHA 5FD6A 1ZAOA 5D8KB 1YO5C 3CUQC 4HQEA 2JPBA 3WTZA 2A69F 1ZN2A 3L2CA 2BE5F 2HYFA 5DCMA 4JK1X 1JHHA 3CLOA 4XSXF 5ED4A 4YIFA 1FBUA 1TNTA 1OYYA 2KJCA 2XHKA 4LLLA 4M71A 5LRRA 2GA1A 1YS6A 3TGNA 2P7VB 3VFZA 4EVIA 3EQLF 1TNSA 4Y13A 1J7KA 2DLLA 2GAUA 3PFIA 5DYMA 1G3TA 3FM5A 1SMYF 4DQ2A 3P9CA 2NAZA 3IKVA 2VT3A 2EV5A 3CTAA 2MLGA 2IPQX 2ZKZA 2GZWA 1STZA 4OIRF 4KFCA 1IN4A 1MDMB 1BI1A 2F5EA 3OV8A 1MZBA 3HRMA 5FO5A 4LK1F 2HR3A 3EYIA 1YW7A 5BMZA 1GVJA 2WV0A 1IRGA 3ZMDA 2VT2A 1XCVA 1ZRDA 5LEJA 2IT0A 4IRIA 1IN6A 4EJWA 2VXZA 3FF5A 3F22A 1J0RA 3ROUA 3HTUA 2P8TA 5LHHA 5LGNA 1BM9A 1J59A 1G3SA 4I7HA 4ENJA 4CGZA 4P5OA 3MAJA 1U8RA 2ZBKA 2JTVA 3BPVA 4A2UA 1I1SA 3BY6A 2FBKA 4BHCA 4A0ZA 4PDKA 5DUKA 4DNCA 1MGTA 4LB6B 1K78B 5L3GA 4XLPF 3WTVC 3WU0A 5BPDA 3U1DA 3ML6A 5EEHA 1FX7A 5E1XA 2MH2A 3FXRA 4ZZLA 1ZRCA 2P4WA 1YS7A 1REPC 3DFGA 2E1NA 4RAZA 2FMLA 5JR3A 5F6FA 1G4DA 5HLHA 3KLOA 2G7HA 3C7JA 3LWFA 2VC1A 2JRTA 4EJTA 1SFEA 2DK8A 1DP7P 2EA4A 4HLXA 2HZTA 3WTUC 5JVTA 1RNLA 4FX0A 2IP2A 2DBBA 4HBLA 2W24A 1I5ZA 2Q0OA 2L4MA 4R1HA 1WSUA 1IUYA 4LMYA 2NYXA 5FD5A 2PJPA 1OYIA 4U88A 4CDGA 4ETSA 1XN7A 2WTEA 3L7WA 3MZHA 1XD7A 4ENNA 2EWNA 3ABTA 5HS9A 2IRFG 3DXJF 4U0YA 1WKMA 5HS8A 1IRFA 2D45A 1USSA 5LBQA 1R1VA 5K1YA 4AWXB 4AIJA 3LA7A 4UHTA 1XMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I09 A;  1P4W A;  4PZJ A;  1ZGA A;  5KVR A;  1ON2 A;  4RB0 A;  1HBX G;  3KZZ A;  3GFJ A;  5FGM A;  5CVJ A;  1D8J A;  2H94 A;  4OIQ F;  2CG4 A;  4NB5 A;  4KIB A;  1UFM A;  3KCC A;  3V7R A;  3ERE D;  3DKW A;  4KYW A;  4CHU A;  1XCB A;  5IT9 K;  3DF8 A;  2B0L A;  3I59 A;  2PBI A;  3FHZ A;  1L3L A;  2VBZ A;  2Q8K A;  5LLQ A;  1UHW A;  1ZG1 A;  2V1U A;  4HZF A;  4S04 A;  1AOY A;  3K1P A;  1D8K A;  3HRS A;  1TLH B;  2P5K A;  1KYW A;  1OKR A;  1I27 A;  1PDN C;  4UNO A;  1DUX C;  4KIF A;  1BIB A;  4LD5 A;  3KP6 A;  1Z6T A;  2JZY A;  2O6G E;  2DTR A;  2A6E F;  2QQB A;  1ZLJ A;  2L3D A;  2X4H A;  1JHF A;  4Z2Y A;  1Z7U A;  3ZPL A;  2LSO A;  4ZYG A;  1S7O A;  1W4M A;  1O3R A;  4HF1 A;  3E5Q A;  2YX4 A;  4ON0 A;  1K78 A;  3FX3 A;  1IXR C;  1S29 A;  3LA2 A;  4LG0 B;  3MZY A;  5D5W B;  3PQK A;  4G7Z F;  4CZZ A;  4ENM A;  4MTE A;  3I71 A;  1KU2 A;  1ODD A;  1G3Y A;  1P92 A;  3ZN1 A;  1KU9 A;  4CO8 A;  5D4S A;  1Q1H A;  1F4K A;  3T8T A;  4CIC A;  3E5U A;  4PCQ A;  1FLI A;  1SFX A;  5D6F A;  4HDV A;  2QBY B;  4G7O F;  1PP7 U;  3FXQ A;  3DQV C;  1XSD A;  3I0T A;  2PEX A;  3QAH A;  4WWC A;  3SQN A;  2LDU A;  2E1C A;  1HW1 A;  4D0P A;  2ZO4 A;  1KGS A;  1L0O C;  4BHB A;  2H6C A;  2R3S A;  2OA4 A;  1FNN A;  2NNY A;  5K5R A;  3C18 A;  5K5Q A;  2ZME B;  2LKP A;  3FM3 A;  2FBH A;  3LA3 A;  2EJR A;  4E70 A;  5ICG A;  4HX4 A;  2OZU A;  3WG9 A;  3J80 K;  1ZH5 A;  3M8E A;  4EGY A;  4MEY F;  3IHU A;  4PGG A;  4HA8 A;  4OMZ A;  4KMF A;  4A6E A;  2QBY A;  1R5G A;  2UWM A;  2STW A;  4A0X A;  3J81 Z;  4WXD A;  2F5F A;  1H0M A;  4EJV A;  2FEZ A;  4MGR A;  1YTY A;  3RKX A;  1LB2 A;  3ZMZ A;  1RIO H;  2FBI A;  1R00 A;  5CJ9 A;  2NS0 A;  1X3U A;  3FMQ A;  4M9X A;  5E1W A;  2KRF A;  3GWZ A;  4KIG A;  1DPR A;  4L18 B;  3KZY A;  2RDP A;  1FT9 A;  3WU1 B;  1JXS A;  4FT8 A;  4P9U A;  2PMU A;  4B8X A;  3QRF F;  4LK0 F;  1B59 A;  4LG0 A;  1B1B A;  3F6V A;  1XGN A;  5FB2 A;  2QZ8 A;  1Z1D A;  2YX7 A;  3V7C A;  3I58 A;  2HKO A;  2O61 A;  1I6X A;  2XAF A;  4BQA A;  3HSR A;  1QGP A;  3MCZ A;  4S05 A;  2KIU A;  4NHJ A;  3W6K B;  2W57 A;  3ELK A;  3LAJ A;  4BH9 A;  1UCR A;  5ICC A;  2L01 A;  4G9Y A;  2IA1 A;  4QLC U;  1U5T A;  2CQK A;  1IXS B;  1F9N A;  1HKT A;  2PMH A;  1UHM A;  1QO0 D;  3ZMU A;  2XRN A;  3T0Y A;  4UVA A;  2Z9O A;  2FNA A;  3CO7 C;  3F23 A;  3F8C A;  2UZK A;  3QPT A;  3JTH A;  4I98 B;  1B9M A;  2TDX A;  2A5Y B;  4A5M A;  3ULQ B;  5A2Q Z;  2HWV A;  2VBX A;  1OYW A;  1IN7 A;  2A07 F;  1KQ8 A;  3BDD A;  5DD4 A;  1R7J A;  4IRH A;  3I59 B;  1Z05 A;  5E8I A;  4RGS A;  1QZY A;  4RGR A;  3K0L A;  2L4A A;  5CVU A;  2DQL A;  1OMI A;  3IWZ A;  1QNT A;  4MQ9 F;  2DI3 A;  3TO9 A;  1W7P A;  1H9T A;  5CLS A;  3GYH X;  4RB1 A;  2ZME A;  5BS6 A;  5TJJ A;  5ILS A;  1HST A;  1LDK B;  5E20 A;  1QZZ A;  3NEU A;  2FQ3 A;  3QP5 A;  5J8C A;  1FYL A;  1KYZ A;  3I64 A;  5IT9 Z;  4M6X A;  1T39 A;  3CUQ A;  5D5V B;  1ZRF A;  1IXC A;  4O3M A;  2ZJ2 A;  4K2E A;  4R8H A;  2DAO A;  3LFK A;  1E17 A;  1EH8 A;  2H09 A;  2QQA A;  2IJL A;  2Y0M A;  1IW7 F;  4ASN A;  3WGH A;  1LJ9 A;  4M9S A;  5ICE A;  3WTS C;  4A5N A;  4KIC A;  2GA2 A;  3RKW A;  4IVN A;  3QPH A;  3RIR A;  2WC2 A;  2Z5U A;  1DDN A;  2JT1 A;  4GGG A;  1YLF A;  3GEZ A;  2EFN A;  2VN2 A;  4ZH4 F;  3JTG A;  5DDG A;  1BI3 A;  4EGZ A;  1T38 A;  3GLX A;  4LFU A;  1G3W A;  3CUO A;  4HLY A;  5J6X A;  4MQV A;  2EK5 A;  2O3F A;  4WX9 A;  4RB2 C;  1TQI A;  4EJO A;  1BC7 C;  3BP8 A;  1S8N A;  3GF2 A;  1TBX A;  4ENK A;  1LEA A;  5CVR A;  1FOK A;  4BXU A;  2F2E A;  3TQN A;  4ZYH A;  1YQA A;  3FXU A;  3K9T A;  3V8L A;  2FMY A;  1XMA A;  3HHG A;  1KU3 A;  3MWM A;  2L54 A;  1Z91 A;  3REO A;  1K79 A;  1ON1 A;  3FMS A;  1NHA A;  1YG2 A;  3BOQ A;  3TOB A;  1BN5 A;  4ESJ A;  2QQ9 A;  4XRF A;  4KUM A;  2OAZ A;  3JAM Z;  2IA0 A;  3WTX C;  3F8N A;  4UV9 A;  4EJU A;  1R58 A;  2HOE A;  3IKT A;  3KEO A;  2IVM A;  4H0E A;  4U0V A;  2XVC A;  3GO5 A;  3KP2 A;  4BHP A;  2YPR A;  1ULY A;  5ILV A;  4ZYD A;  2MBF A;  1E2X A;  3HRU A;  3T5X A;  4HAM A;  3F8F A;  5FLX K;  1SD4 A;  1XGS A;  2RN7 A;  5H6R A;  1XSV A;  4Q4Z F;  2NNN A;  1W5T A;  3GZ5 A;  4Q47 A;  5FFX A;  3B73 A;  3I4P A;  1TQP A;  4I0B A;  2H27 A;  2F5D A;  3QU3 A;  3ZMT A;  1ZHF A;  3ZN0 A;  4RB3 C;  1EH6 A;  1CF7 B;  4LGW A;  1K7A A;  2VON A;  3KP3 A;  2V79 A;  4YG2 F;  3J80 Z;  1S3J A;  3B02 A;  5E18 F;  3J7A O;  1D5V A;  4U7D A;  2Y48 A;  4L9V A;  3F8M A;  3IWF A;  3SZP A;  1B6A A;  1TQM A;  3HHH A;  2XIG A;  3NRV A;  4IJA A;  3RI4 A;  3V8J A;  1MD0 A;  1O3T A;  5LGT A;  3RYP A;  3RKY A;  1IN8 A;  2YSR A;  3MEX A;  1YW9 A;  4P9F A;  2P5L C;  3Q5F A;  3WTY C;  3EUH A;  3HIF A;  3BJ6 A;  3T1B A;  3KE2 A;  1S7A A;  2A61 A;  2Z33 A;  3TKY A;  3GXO A;  2Z99 A;  1P4X A;  1QPM A;  5DV5 A;  1BI0 A;  2GIV A;  2QM3 A;  3GUD A;  5DCM B;  5E8G A;  1U6G A;  2ZFW A;  3IC7 A;  5AON A;  5E17 F;  4WK8 F;  2HGC A;  4L9J A;  1UB9 A;  4LLN A;  3H3U A;  1V4R A;  1HXD A;  2CWE A;  1ONV A;  2K4J A;  2DO7 A;  1XB4 A;  2ISY A;  4WXH A;  5L3D A;  2W84 A;  4O5V A;  1D3Y A;  2JPC A;  5HVQ C;  5CVV A;  2ZCW A;  1R36 A;  3TOA A;  3LQQ A;  1XGM A;  3DP7 A;  3E6M A;  1KQ0 A;  1MKM A;  2R7D A;  2XAJ A;  3F72 A;  3RPU A;  2XAH A;  3IL2 A;  1ZG5 A;  5DD8 A;  3C1D A;  3J81 K;  2W85 A;  2UXN A;  2M1B A;  2MH9 A;  2P7C B;  2PFB A;  1LDD A;  5BQT A;  4G7H F;  1JE8 A;  4L0Z B;  2LF8 A;  3H92 A;  4IRG A;  3W6J B;  3AAF A;  1KQ9 A;  4RS8 A;  3JAM K;  2PI0 A;  1FC3 A;  5LHI A;  3GFM A;  5A2Q K;  4BAY A;  2ACJ A;  4BNC A;  3I54 A;  3JW4 A;  2Q2E A;  4Q48 A;  3H3Z A;  2F5C A;  4WXC A;  1OPC A;  1UST A;  4WCG A;  4IF4 A;  4GCV A;  1HKS A;  4UUV A;  4MTD A;  5HDG A;  4HW0 A;  2HS5 A;  5HLI A;  4KN7 X;  2XKO A;  2G7U A;  5L3B A;  4M73 A;  1RUO A;  2IW5 A;  5DCF A;  4BYY A;  2XGX A;  4OOI A;  5ILU A;  2ESH A;  4MEX F;  3M7G A;  1P4A A;  1U3E M;  3ABU A;  1MDM A;  3ZP5 A;  3C3W A;  1ZGJ A;  1PP8 F;  4IHS A;  4HV6 A;  1BOA A;  3QP6 A;  4LLG F;  2J5O A;  1O57 A;  2X0L A;  3RJP A;  3O3K A;  1O7L A;  2HKX A;  2V1D A;  3Q9S A;  3HOS A;  1T98 A;  1B4A A;  3WGI A;  2OU2 A;  1XSX A;  2BBY A;  1EV7 A;  4M6Y A;  1W7P B;  4EM2 A;  1O7F A;  3WGG A;  5HOO A;  1FWZ A;  2XRO A;  2V1X A;  5FLX Z;  2CW0 F;  3R4K A;  2MD5 A;  2MC3 A;  2XAG A;  4JQF A;  4RAY A;  3FZV A;  1EH7 A;  4M72 A;  2HTS A;  5JI6 A;  2EFW A;  5L3E A;  2O8X A;  2PN6 A;  3HRT A;  3K2Z A;  3CO6 C;  2ISZ A;  1PUE E;  3KP4 A;  2OBP A;  5CYV A;  3R60 A;  5F64 A;  2QWW A;  1F5T A;  1QBJ A;  1LDJ A;  3P7N A;  1O3Q A;  1S6L A;  3IRQ A;  2K02 A;  3N97 A;  3G73 A;  3Q9V A;  3R0A A;  1B9N A;  1YYV A;  1HSJ A;  3RTR A;  3E6C C;  1J5Y A;  4P96 A;  3R6S A;  3G3Z A;  3GVA A;  3T8R A;  5JFR A;  1U5T B;  2RKH A;  3IRR A;  1FSE A;  4ZZD A;  1LQ1 A;  5D6E A;  5HS7 A;  2FU4 A;  4EV0 A;  3FMR A;  2EV6 A;  1HW2 A;  3QU6 A;  5H6Q A;  4OU0 A;  3BJO A;  3GFL A;  3GW2 A;  3KP5 A;  2OZ6 A;  4KNY A;  3QOP A;  3V8K A;  2VBY A;  1FYK A;  2D1H A;  3JSP A;  2EFQ A;  3MFK A;  1WWX A;  5CVI A;  2QUF A;  4M9Z A;  1FSH A;  3K69 A;  3KET A;  3R0J A;  5D5X B;  2KKO A;  4RGX A;  3RPQ A;  3E6B A;  6PAX A;  5D4R A;  1HKQ A;  1SD7 A;  4HF2 A;  1AWC A;  5J8F A;  3HSF A;  2FA5 A;  4YFN F;  1Z6R A;  2E7X A;  2YU3 A;  3FWE A;  1V3F A;  4JBA A;  5L3F A;  1TTY A;  1R1T A;  2DPU A;  2QVO A;  4ESB A;  4OIP F;  1ZYR F;  2E7W A;  2M30 A;  3KFW X;  5JHU A;  2FE3 A;  2JSC A;  4I2O A;  2DK5 A;  3DPL C;  3V7S A;  3GX4 X;  2BYV E;  5TRD A;  1LNW A;  5LHG A;  1Z9C A;  3HUG A;  2HDC A;  3KP7 A;  4OIO F;  1J75 A;  2QLZ A;  3P9K A;  1GHC A;  4UXN A;  4L5I A;  4QWQ A;  1F1Z A;  2L02 A;  3E3V A;  2M5W A;  2BV6 A;  2OQR A;  4RGU A;  5LEK A;  1O3S A;  3M1E A;  1Y0U A;  3WE2 A;  2W25 A;  1LVA A;  2Y75 A;  3MQ0 A;  3VOD A;  3BPX A;  1SFU A;  1OR7 A;  1BI2 A;  4L9T A;  1T6S A;  4I02 A;  5IT3 A;  4F7Z A;  2K86 A;  1FP1 D;  4IPA A;  2M87 A;  3K1M A;  2DT5 A;  3D0S A;  2PG4 A;  1U78 A;  3TO6 A;  2A3S A;  5ERI A;  2ADU A;  1TW2 A;  4OMY A;  1FBS A;  1YW8 A;  2BEO A;  4R79 A;  4N9I A;  2HQR A;  4G6Q A;  1FZP B;  2C6Y A;  5EEG A;  5LGU A;  5KK1 A;  4IXA A;  3SZT A;  4O6J A;  2FF4 A;  2GXB A;  1T2K A;  4FX4 A;  2RC4 A;  3I5U A;  2G9W A;  2XUB A;  4TV7 A;  1IF1 A;  3LAP A;  4FHT A;  2R7F A;  3WE3 A;  2H6B A;  3E6D A;  3EYY A;  3KLN A;  3GZ6 A;  3OOP A;  3N4M A;  2QYO A;  4UVC A;  1GXP A;  3R61 A;  3GFI A;  2KJB A;  1J2X A;  5BPI A;  4AVP A;  4KT5 C;  2A68 F;  4I01 A;  1R5H A;  3HSE A;  3SHF A;  3LST A;  2PQ8 A;  5D8L B;  1R23 A;  1RUN A;  3EET A;  2VOD A;  1J9I A;  3F21 A;  2OQG A;  2FOK A;  4A12 A;  1HQC A;  1FP2 A;  2RNJ A;  1P6R A;  4L0Y B;  3RDI A;  2EA2 A;  3WTT C;  2GQQ A;  1KU7 A;  2VOO A;  4A6D A;  2FNP A;  4P55 A;  2HTJ A;  1IZ1 A;  5ICF A;  3U9G A;  1VTN C;  2P6S A;  2DQR A;  1JGS A;  1XDU A;  5F1R A;  4EMS A;  1G6N A;  3VB2 A;  2GWR A;  5D5U B;  5HDK A;  3L09 A;  1U5T C;  5L3C A;  1DPU A;  1QQI A;  4YII A;  2CO5 A;  1A04 A;  4ESF A;  3TO7 A;  1ZG3 A;  3L9F A;  4GYI A;  3ISP A;  4HQM A;  3CUQ B;  2CGP A;  3HYI A;  2PLY A;  3L00 A;  2STT A;  1GXQ A;  4HYE A;  2RGV A;  3PQJ A;  2FSW A;  1ZLK A;  3DV8 A;  4XLN F;  2ESN A;  2FXA A;  1MJA A;  1R1U A;  4HX7 A;  2K27 A;  3P9I A;  4MNU A;  4UVB A;  4OIN F;  2GXG A;  2CFX A;  1I1G A;  4Y15 A;  2HQN A;  4HF0 A;  4EQQ A;  4G6D A;  2AS5 F;  2YR2 A;  1CGP A;  2EFP A;  4KN4 X;  2EB7 A;  3EDP A;  4U0W A;  2LF7 A;  1P2F A;  4Q5S F;  2DU9 A;  2ZXJ A;  5HDN A;  1BBY A;  4LB5 A;  1BC8 C;  4I0A A;  1SD5 A;  3ZQ7 A;  4AD9 A;  3CJN A;  1WRJ A;  3CDH A;  4B09 A;  4IHT A;  1FYM A;  3E5X A;  4G94 A;  5AIQ A;  1FBQ A;  2Z3Y A;  1IAW A;  3F6O A;  3DEU A;  2K7L A;  2COM A;  3JSO A;  1HW5 A;  1T0F A;  1LEB A;  1H9G A;  2CSO A;  1MJB A;  5FFZ A;  3VOE A;  3COA C;  3NQO A;  5K5O A;  2RQP A;  3F8B A;  1XDS A;  3ZMV A;  2FRH A;  3TDU C;  2WWY A;  2VE8 A;  2P6T A;  2P5V A;  2M45 A;  3O2P E;  2HEO A;  4KA4 A;  1FPQ A;  2KIM A;  2D1V A;  2XKP A;  4KDP A;  4CXF A;  5E1Z B;  5DUI A;  4GO1 A;  3ECO A;  1KA8 A;  2VBW A;  4G8X A;  3O6B B;  1YFH A;  4M74 A;  3SXY A;  2XAS A;  2VE9 A;  4L9N A;  2O03 A;  2O0Y A;  3U2R A;  3DPT A;  2K4B A;  4CYD A;  5DEQ A;  5LRS A;  1W5S A;  2VC0 A;  4HOB A;  4AIH A;  2KIF A;  4YFK F;  1K6O A;  1WQ2 A;  3V4G A;  1SAX A;  4XSZ F;  3BWG A;  2RV8 A;  3WOD F;  1W7P D;  1FY7 A;  3I53 A;  1CF7 A;  2BGC A;  2DW4 A;  3E97 A;  3K1N A;  3ZMS A;  1R22 A;  5H20 A;  2DPD A;  1ZAR A;  1SMT A;  4GYG A;  4LJZ F;  3WTW C;  4YFX F;  4Y17 A;  4EM1 A;  4GXO A;  2ZNZ A;  5AIP A;  2HFH A;  1BJA A;  2ELH A;  3RYR A;  3D5L A;  2MLK A;  2XAQ A;  1SD6 A;  1XGO A;  2XV4 S;  3M9A A;  4KMU X;  4AIK A;  1RI7 A;  4XBF A;  2MA3 A;  1ZRE A;  2EFO A;  2VOP A;  2OD5 A;  2ZNY A;  2NRA C;  4U7B A;  1RZ4 A;  3BRO A;  2M8E A;  4HX8 A;  2UXX A;  4MHG A;  3HTS B;  4WF2 A;  3VEP A;  4EM0 B;  3TDZ C;  3S2W A;  1BIA A;  3SFZ A;  2CYY A;  2V9V A;  2HYG D;  2EV0 A;  2AXL A;  3HOT A;  4NQW A;  4HV5 A;  3KEQ A;  1C0W A;  2A6H F;  1YIO A;  2DFI A;  4ZYE A;  2IA2 A;  4PGH A;  2LNB A;  5BOX A;  1WI9 A;  4HDU A;  3F3X A;  4L5J A;  3LQR A;  3M8F A;  2QEN A;  4N9H A;  2ETH A;  4UV8 A;  1MJ9 A;  2J5P A;  2V6C A;  4A0Y A;  2D2W A;  4N0B A;  3BJA A;  5HLG A;  1TW3 A;  1IN5 A;  3BZ6 A;  1U2W A;  2RVC A;  3ECH A;  5FD6 A;  1ZAO A;  5D8K B;  1YO5 C;  3CUQ C;  4HQE A;  2JPB A;  3WTZ A;  2A69 F;  1ZN2 A;  3L2C A;  2BE5 F;  2HYF A;  5DCM A;  4JK1 X;  1JHH A;  3CLO A;  4XSX F;  5ED4 A;  4YIF A;  1FBU A;  1TNT A;  1OYY A;  2KJC A;  2XHK A;  4LLL A;  4M71 A;  5LRR A;  2GA1 A;  1YS6 A;  3TGN A;  2P7V B;  3VFZ A;  4EVI A;  3EQL F;  1TNS A;  4Y13 A;  1J7K A;  2DLL A;  2GAU A;  3PFI A;  5DYM A;  1G3T A;  3FM5 A;  1SMY F;  4DQ2 A;  3P9C A;  2NAZ A;  3IKV A;  2VT3 A;  2EV5 A;  3CTA A;  2MLG A;  2IPQ X;  2ZKZ A;  2GZW A;  1STZ A;  4OIR F;  4KFC A;  1IN4 A;  1MDM B;  1BI1 A;  2F5E A;  3OV8 A;  1MZB A;  3HRM A;  5FO5 A;  4LK1 F;  2HR3 A;  3EYI A;  1YW7 A;  5BMZ A;  1GVJ A;  2WV0 A;  1IRG A;  3ZMD A;  2VT2 A;  1XCV A;  1ZRD A;  5LEJ A;  2IT0 A;  4IRI A;  1IN6 A;  4EJW A;  2VXZ A;  3FF5 A;  3F22 A;  1J0R A;  3ROU A;  3HTU A;  2P8T A;  5LHH A;  5LGN A;  1BM9 A;  1J59 A;  1G3S A;  4I7H A;  4ENJ A;  4CGZ A;  4P5O A;  3MAJ A;  1U8R A;  2ZBK A;  2JTV A;  3BPV A;  4A2U A;  1I1S A;  3BY6 A;  2FBK A;  4BHC A;  4A0Z A;  4PDK A;  5DUK A;  4DNC A;  1MGT A;  4LB6 B;  1K78 B;  5L3G A;  4XLP F;  3WTV C;  3WU0 A;  5BPD A;  3U1D A;  3ML6 A;  5EEH A;  1FX7 A;  5E1X A;  2MH2 A;  3FXR A;  4ZZL A;  1ZRC A;  2P4W A;  1YS7 A;  1REP C;  3DFG A;  2E1N A;  4RAZ A;  2FML A;  5JR3 A;  5F6F A;  1G4D A;  5HLH A;  3KLO A;  2G7H A;  3C7J A;  3LWF A;  2VC1 A;  2JRT A;  4EJT A;  1SFE A;  2DK8 A;  1DP7 P;  2EA4 A;  4HLX A;  2HZT A;  3WTU C;  5JVT A;  1RNL A;  4FX0 A;  2IP2 A;  2DBB A;  4HBL A;  2W24 A;  1I5Z A;  2Q0O A;  2L4M A;  4R1H A;  1WSU A;  1IUY A;  4LMY A;  2NYX A;  5FD5 A;  2PJP A;  1OYI A;  4U88 A;  4CDG A;  4ETS A;  1XN7 A;  2WTE A;  3L7W A;  3MZH A;  1XD7 A;  4ENN A;  2EWN A;  3ABT A;  5HS9 A;  2IRF G;  3DXJ F;  4U0Y A;  1WKM A;  5HS8 A;  1IRF A;  2D45 A;  1USS A;  5LBQ A;  1R1V A;  5K1Y A;  4AWX B;  4AIJ A;  3LA7 A;  4UHT A;  1XMK A; 
#chains in the Genus database with same CATH topology
 4I09 A;  2QQ8 A;  2I10 A;  2L5Q A;  5GAD J;  1QU3 A;  1P4W A;  4PZJ A;  2E2J J;  4MFE A;  1ZGA A;  2W82 A;  5KVR A;  1N75 A;  2M0C A;  1ON2 A;  1RPW A;  2P0W A;  2TRT A;  5DM6 F;  4RB0 A;  1HBX G;  2O7O A;  3KZZ A;  3GFJ A;  5FGM A;  5CVJ A;  1D8J A;  2H94 A;  4OIQ F;  2CG4 A;  3SDB A;  1WHU A;  4NB5 A;  4KIB A;  4FCY A;  1YRN A;  1UFM A;  3KCC A;  3L2W A;  3V7R A;  3GTK J;  3ERE D;  3I4M J;  3DKW A;  4KYW A;  3WHC A;  2EH3 A;  4CHU A;  1XCB A;  5IT9 K;  2DOF A;  3PNY A;  1XTA A;  3DF8 A;  2B0L A;  2HVQ A;  3I59 A;  2PBI A;  2E1M C;  3FHZ A;  1LFP A;  2MG4 A;  1L3L A;  2VBZ A;  2Q8K A;  5LLQ A;  1UHW A;  1ZG1 A;  2V1U A;  4HZF A;  2R5Z B;  2E71 A;  4S04 A;  2JA2 A;  3K1P A;  1D8K A;  4MO7 A;  3HRS A;  1AOY A;  3RQ4 A;  1TLH B;  1KZH A;  2CFO A;  2P5K A;  1KYW A;  2IAI A;  2LMD A;  3RPU D;  1OKR A;  1I27 A;  1PDN C;  2CUZ A;  3ZRG A;  3QYB A;  4UNO A;  1WZ2 A;  1X1P A;  5F08 A;  1DUX C;  2NOJ B;  3TW6 A;  4KIF A;  4B43 A;  1BIB A;  3LSR A;  1Z3Y A;  1VI0 A;  4LD5 A;  3KP6 A;  5GAH J;  5EG0 A;  1Z6T A;  3Q3S A;  2JZY A;  1A36 A;  1VQL I;  2FUG 2;  2O6G E;  2VIX A;  2HVS A;  4CCN A;  3BTJ A;  4XM3 A;  4HNV A;  2DTR A;  2A6E F;  3CD6 I;  5K7Z A;  2QQB A;  2OCC H;  1ZLJ A;  3S1M J;  2KFD A;  5CQE A;  2L3D A;  2X4H A;  4CCJ A;  1JHF A;  2IGO A;  4Z2Y A;  4UY8 I;  1A6I A;  1Z7U A;  3ZPL A;  2LSO A;  1VQ7 I;  4ZYG A;  1S7O A;  2QA4 I;  1FOW A;  4J19 A;  3U1K A;  2A05 A;  4DIQ A;  4D9J A;  2IS1 A;  1W4M A;  1O3R A;  1Z0X A;  4HF1 A;  4W97 A;  3S1Q J;  3E5Q A;  3CMA I;  2YX4 A;  4QIW N;  4RLQ A;  4ON0 A;  1K78 A;  1DGR M;  3FX3 A;  2X85 A;  4AVZ A;  1ETY A;  2GLO A;  4XKW A;  5C3E J;  2Y9Z A;  2R7X A;  1IXR C;  2K9N A;  1S29 A;  3LA2 A;  3I56 I;  2L9N A;  4F91 B;  4LG0 B;  3CMM A;  3JRG A;  3MZY A;  3C2B A;  5D5W B;  1JGG A;  4JYK A;  3PQK A;  5F0H A;  4G7Z F;  4CZZ A;  4ENM A;  4BQN A;  4MTE A;  4D7N A;  3DWL E;  3I71 A;  1KU2 A;  1ODD A;  1G3Y A;  1P92 A;  3ZN1 A;  5E3O A;  1KU9 A;  4CO8 A;  2JVH A;  2O5R A;  2LG4 A;  5D4S A;  1I3A A;  5C44 J;  1Q1H A;  4F93 B;  5FLM J;  1F4K A;  3T8T A;  2AXT C;  4CIC A;  3E5U A;  4CA0 A;  5M5X J;  3FXJ A;  1R9T J;  3DBH B;  1VND A;  1RRJ A;  2E60 A;  2WAQ A;  2OTJ I;  4PCQ A;  2R7Z J;  1MMS A;  1FLI A;  2EBI A;  1FIA A;  4JX4 A;  4FIS A;  3JRI A;  3OS0 A;  1SFX A;  2JN6 A;  5D6F A;  4HDV A;  2QBY B;  2JJ7 A;  2DA6 A;  1PP7 U;  3FXQ A;  1VQ5 I;  1RET A;  2R5Z A;  1W36 C;  1WI3 A;  5J4Y A;  3DQV C;  1XSD A;  3I0T A;  3CF2 A;  5GAE J;  4B48 A;  2PEX A;  2BOL A;  2R7R A;  2V7F A;  3QAH A;  4LOC A;  2OUM A;  4WWC A;  3SQN A;  3VDX A;  2WAQ N;  2XB5 A;  3S1N J;  1JJ8 C;  2V26 A;  1OCP A;  2EIM H;  1MMD A;  4NC6 A;  2LDU A;  4IQJ A;  3I9V 2;  2E1C A;  2HQA A;  1HW1 A;  4D0P A;  2ZO4 A;  3VWB A;  1KGS A;  1L0O C;  1F43 A;  4BHB A;  2H6C A;  3AG1 H;  3BC8 A;  1P7J A;  4LIT A;  2LY9 A;  2VB6 A;  5M5W J;  2R3S A;  3LSK A;  2IGM A;  3K6G A;  2OA4 A;  1FNN A;  3K4M A;  2NNY A;  5K5R A;  5M3F J;  1PYV A;  3C18 A;  1NK3 P;  1CQT A;  2WBM A;  3OYC A;  1X58 A;  5K5Q A;  4UB6 C;  2ZME B;  2LKP A;  2UV1 A;  3FM3 A;  4F55 A;  1X1D A;  1UHS A;  3D5R C;  2FBH A;  3OS1 A;  3ZQI A;  5IP6 A;  3LA3 A;  4ZDP A;  2EJR A;  1VQ9 I;  3DTI A;  1W0T A;  4E70 A;  5ICG A;  1T0F C;  4HX4 A;  4B44 A;  2ECB A;  2OZU A;  3OYK A;  3WG9 A;  1IRZ A;  3J80 K;  1MW7 A;  4Y7N J;  1ZH5 A;  3ZQL A;  1OCC H;  1K4T A;  3M8E A;  5K7H A;  2VLA A;  4EGY A;  2B63 J;  1WVR A;  1IO2 A;  4Y4R A;  2QF7 A;  4MEY F;  5EEA A;  3IHU A;  4PGG A;  3J7Y J;  4HA8 A;  4OMZ A;  4KMF A;  5FKL A;  4A6E A;  2QBY A;  4A3M J;  4IHY A;  1LKX A;  1R5G A;  2UWM A;  2STW A;  4A0X A;  3J81 Z;  2F48 A;  3BG6 A;  4WXD A;  2E36 A;  2HXI A;  2F5F A;  1H0M A;  4EJV A;  2OC6 A;  2FEZ A;  4MGR A;  2R7S A;  1YTY A;  2B7E A;  3RKX A;  5FKO A;  1LB2 A;  3ZMZ A;  1JUM A;  1TWG J;  1RIO H;  3RZD J;  2FBI A;  1R00 A;  4KIT B;  5CJ9 A;  2NS0 A;  1X3U A;  2WAF A;  2XPU A;  3BR6 A;  3FMQ A;  4M9X A;  5E1W A;  3ZOB A;  3GWZ A;  2KRF A;  2M4G A;  3EUA A;  3ZQG A;  4BBS J;  4KIG A;  1DPR A;  4L18 B;  3KZY A;  2RDP A;  1FT9 A;  3WU1 B;  2QKM B;  1JXS A;  3V42 A;  2WV1 A;  2DJN A;  4DJA A;  4FT8 A;  4DW6 A;  2PMU A;  4B8X A;  4P9U A;  3QRF F;  4ZDO A;  4LK0 F;  5B1A H;  4B4C A;  3LSP A;  4A3E J;  2DFE A;  1B59 A;  2QSF X;  1B1B A;  3FBN B;  4LG0 A;  3F6V A;  1XGN A;  2DA4 A;  2EZL A;  5FB2 A;  2QZ8 A;  4RAF A;  1Z1D A;  2CUF A;  2YX7 A;  4ZC3 A;  2KRC A;  3I58 A;  1Q1V A;  2EPF A;  3NWT A;  2DCE A;  3V7C A;  1T08 B;  3HL2 A;  2HKO A;  2JUG A;  2O61 A;  1I6X A;  2CW7 A;  2XAF A;  4BQA A;  1ZR4 A;  3HSR A;  1QGP A;  2X1E A;  3MCZ A;  4S05 A;  2KIU A;  4NHJ A;  3JRB A;  1MBE A;  3W6K B;  2A5W A;  2W57 A;  3ELK A;  3LAJ A;  4BL0 B;  4BH9 A;  1DGW Y;  2Y30 A;  4BY7 J;  1UCR A;  4BJ6 C;  5ICC A;  2BY0 A;  3MMY B;  3C2G A;  2VKD A;  2L01 A;  1D1A A;  3N05 A;  3G1O A;  3IAS 2;  4G9Y A;  1IUF A;  2IA1 A;  4C30 A;  4QLC U;  1U5T A;  2CQK A;  3OYH A;  2CV1 A;  1IXS B;  5EG0 B;  1WCM J;  1F9N A;  4CYC A;  1HKT A;  2RRE A;  4BEH B;  2PMH A;  1WH7 A;  1UHM A;  1QVT A;  1SVM A;  4BGD A;  3UKG A;  1X2M A;  4A69 C;  1QO0 D;  2N8G A;  3ZMU A;  2XRN A;  3T0Y A;  2BHZ A;  2KT0 A;  4UVA A;  2Z9O A;  2FNA A;  3CO7 C;  2CH0 A;  3F0C A;  3F23 A;  1YI2 I;  3F8C A;  1G59 A;  2IS4 A;  2UZK A;  3VSK A;  3QPT A;  2XDV A;  3JTH A;  2FX0 A;  4I98 B;  4BQQ A;  3A0H C;  1B9M A;  2TDX A;  2A5Y B;  3KPH A;  4A5M A;  3ZQQ A;  3ULQ B;  5A2Q Z;  2HWV A;  2VBX A;  3NAU A;  1OYW A;  2CMP A;  1IN7 A;  1LFB A;  2WAE A;  2A07 F;  1KQ8 A;  3BDD A;  2EZI A;  5DD4 A;  1R7J A;  4IRH A;  3I59 B;  4RLF A;  3K4K A;  1Z05 A;  5E8I A;  4RGS A;  5GTH C;  1QZY A;  2E34 A;  3A03 A;  4RGR A;  3SEZ A;  4AYB A;  3K0L A;  3K4N A;  5HOD A;  3HOX J;  4QPO A;  1ZEL A;  4PUS A;  2L4A A;  3LMM A;  5CVU A;  2DQL A;  2XSD C;  1NG7 A;  3DEE A;  1OMI A;  1Y1V J;  3WHB A;  3IWZ A;  1QNT A;  3AG2 H;  4MQ9 F;  3BCB A;  4MLO A;  2DI3 A;  2W4S A;  1POG A;  2ZJP F;  3TO9 A;  1W7P A;  5M5Y J;  3S3O A;  1H9T A;  4A3C J;  5CLS A;  2QEX I;  3LSJ A;  2VQL A;  4N4N B;  4PJM A;  4RB1 A;  3GYH X;  2ZME A;  2M3A A;  3CC7 I;  1OCT C;  5BS6 A;  1JKP C;  2K5C A;  5TJJ A;  2X51 A;  5ILS A;  4EEF G;  4I99 C;  1HST A;  2O8K A;  3EPZ A;  1LDK B;  2F4M B;  5E20 A;  4G6T B;  1QZZ A;  3NEU A;  3BG5 A;  2FQ3 A;  3QP5 A;  5J8C A;  3RKQ A;  1FYL A;  1KYZ A;  3I64 A;  5IT9 Z;  3CME I;  4M6X A;  1T39 A;  3S3N A;  3CUQ A;  2NVY J;  4AID A;  5D5V B;  1VQN I;  1ZRF A;  1IXC A;  4O3M A;  2W48 A;  2ZJ2 A;  4K2E A;  4R8H A;  4CYC B;  5FRN A;  2DAO A;  3DPU A;  2Z16 A;  2Y0S N;  3LFK A;  1E17 A;  1ZR2 A;  1H8A C;  3BZK A;  4XID A;  3GLL A;  3CCM I;  1EH8 A;  3K4C A;  2H09 A;  2QQA A;  1XPX A;  3G6E I;  2IJL A;  2Y0M A;  1IW7 F;  4ASN A;  3WGH A;  2KPM A;  1LJ9 A;  4M9S A;  2DXI A;  3HG9 A;  4BXF A;  4A5N A;  5ICE A;  3WTS C;  3BTL A;  1TZL A;  4KIC A;  2GA2 A;  3RKW A;  3A01 A;  1ETW A;  3PNT A;  4IVN A;  2LK2 A;  2IS6 A;  3QPH A;  3RIR A;  2V4J C;  2WC2 A;  2Z5U A;  3ZXS A;  1DDN A;  4IQ4 A;  2JT1 A;  4GGG A;  2X6X A;  1YLF A;  2LVS A;  2EFN A;  3GEZ A;  4DBQ A;  1Z77 A;  1EJ9 A;  2VN2 A;  3HEF A;  3HXL A;  1FMV A;  2Q2E B;  3OYM A;  3H36 A;  3UR3 C;  4ZH4 F;  3PL8 A;  4Y33 A;  3JTG A;  4F92 B;  2PJR A;  1HDP A;  1UMQ A;  5DDG A;  1BI3 A;  2I8D A;  3HGG A;  4EGZ A;  1T38 A;  3GLX A;  1AA7 A;  4I6Z A;  3ASO H;  4LFU A;  1G3W A;  3CUO A;  3SYT A;  3GTG J;  4HLY A;  1X4O A;  1GDT A;  5J6X A;  3OYJ A;  1MBH A;  4MQV A;  3G71 I;  5C4J J;  2H1L A;  2EK5 A;  1ZGW A;  2O3F A;  2DMQ A;  1D0X A;  4WX9 A;  2E1M B;  2JK3 A;  3ZCO A;  5B66 C;  2QCO A;  4RB2 C;  1X3W B;  1TQI A;  2XF7 A;  4EJO A;  2HOT A;  1BC7 C;  1FOX A;  3BP8 A;  1S8N A;  3VYU B;  3GF2 A;  4PJN A;  3CCU I;  1TBX A;  3ERM A;  4ENK A;  4XR6 A;  1UEL B;  5TIS C;  1LEA A;  1ZTR A;  2PMZ A;  5CVR A;  3CCQ I;  3S1R J;  5EZH A;  1FOK A;  4BXU A;  1YE9 A;  2F2E A;  1QZE A;  2VQH A;  3S3M A;  4C3H J;  2DDB A;  3TQN A;  1TL8 A;  4ZYH A;  1YQA A;  3FXU A;  3K9T A;  2X6W A;  3V8L A;  5EF6 A;  4PSW A;  4HSR A;  2FMY A;  2K40 A;  1XMA A;  2KQR A;  3HHG A;  1KU3 A;  3MWM A;  2L54 A;  1Z91 A;  1SVL A;  3KX2 A;  3REO A;  1K79 A;  1ON1 A;  3FMS A;  1NHA A;  1YG2 A;  3OR1 C;  3CCS I;  3E0J B;  3BOQ A;  3TOB A;  4YEJ A;  1BN5 A;  4ESJ A;  1ZQ3 P;  1NK2 P;  2QQ9 A;  4XRF A;  1D0Y A;  4KUM A;  2OAZ A;  3JAM Z;  2IA0 A;  3WTX C;  1TC3 C;  3F8N A;  2DA2 A;  3F9K A;  2M7B A;  4UV9 A;  4A3J J;  4EJU A;  4C9Y A;  1R58 A;  2HOE A;  3IKT A;  4A3K J;  3KEO A;  3GTQ J;  1WPK A;  3HM5 A;  4XIC A;  2E2H J;  1JT0 A;  1PJR A;  2XGD A;  4A3F J;  2IVM A;  1R4M B;  4H0E A;  4U0V A;  2DFH A;  1BR1 A;  4XLA A;  5K7F A;  2XVC A;  3GO5 A;  5IYD J;  3KP2 A;  4BHP A;  2YPR A;  1ULY A;  2IBD A;  5ILV A;  3BCA A;  3S14 J;  2CQQ A;  2GBY A;  4ZYD A;  2MBF A;  1E2X A;  1YJW I;  1W0U A;  2V9K A;  2M4K A;  3HRU A;  3T5X A;  3LSI A;  1D0Z A;  2K9L A;  4HAM A;  2VUM J;  3F8F A;  5FLX K;  2G0E A;  1SD4 A;  1XGS A;  2RN7 A;  4FAS D;  2B9S A;  2JUC A;  1DP3 A;  5H6R A;  4IX7 A;  2OV7 A;  1XSV A;  4Q4Z F;  2NNN A;  1W5T A;  3GZ5 A;  4HST A;  1V5E A;  4XOT A;  5JLX A;  1HCR A;  4Q47 A;  1YRN B;  5FFX A;  3B73 A;  1TT0 A;  3I4P A;  5B5E C;  1SAN A;  1TQP A;  2EQR A;  5J47 A;  2XF5 A;  4LG3 A;  2IGK A;  4I0B A;  5J3L A;  4M3G A;  2F5D A;  3QU3 A;  2H27 A;  3ZMT A;  1ZHF A;  3ZN0 A;  2M0M A;  4RB3 C;  3JRH A;  1VQK I;  1EH6 A;  4AM3 A;  1CF7 B;  4RAG A;  2V1N A;  4LGW A;  2LD5 A;  4DGW B;  1K7A A;  2F5V A;  3S32 A;  2VON A;  3KP3 A;  2V79 A;  4YG2 F;  3J80 Z;  2DYS H;  1S3J A;  2MW8 A;  1S72 I;  2CS3 A;  3B02 A;  5E18 F;  4QSH A;  3J7A O;  4U7D A;  2Z1D A;  2AHQ A;  1D5V A;  2Y48 A;  4L9V A;  1TWH J;  4RMN A;  3F8M A;  3CJQ B;  3IWF A;  1NTC A;  2IEK A;  3L2U A;  1IC8 A;  4B1R A;  1V54 H;  1B6A A;  3SZP A;  2R0Q C;  2XB0 X;  1TQM A;  3HHH A;  2XIG A;  3NRV A;  4IKF A;  4IJA A;  3H5R A;  3RI4 A;  3V8J A;  2ME0 A;  2VQG A;  1RR7 A;  3KYC B;  4M3F A;  1MD0 A;  1O3T A;  5LGT A;  3HUG B;  3RYP A;  3RKY A;  1IN8 A;  2YSR A;  3MEX A;  1YW9 A;  4P9F A;  2P5L C;  2R93 J;  1EKE A;  2AO9 A;  3Q5F A;  4P1W A;  3WTY C;  1VQO I;  3EUH A;  3HIF A;  3BJ6 A;  3T1B A;  2BHY A;  3GCM A;  3KE2 A;  4XRS G;  2E19 A;  4XKV A;  1S7A A;  2A61 A;  3Q0W A;  1DQU A;  3BG3 A;  2Z33 A;  3H3V K;  5F04 A;  3ZGK A;  3TKY A;  3OYB A;  1IGN A;  2Y31 A;  2Z99 A;  3GXO A;  1P4X A;  1QPM A;  3PSI A;  5DV5 A;  1BI0 A;  2GIV A;  2QM3 A;  5EJC A;  2X6O A;  3GUD A;  5DCM B;  5E8G A;  1U6G A;  2ZFW A;  3IC7 A;  5AON A;  5FKK A;  5E17 F;  4WK8 F;  2W1O A;  3OS2 A;  2HGC A;  4L9J A;  4LIU A;  1B8I A;  1UB9 A;  1MMA A;  4LLN A;  2W00 A;  2VPL A;  2ZXW H;  3H3U A;  1V4R A;  9ANT A;  3MKL A;  1HXD A;  2Y69 H;  4XN3 A;  2CWE A;  1UG0 A;  4BS9 A;  1ONV A;  2K4J A;  2DO7 A;  1XB4 A;  1Z3X A;  2ISY A;  3OOU A;  5FKM A;  4WXH A;  2HVR A;  2AQF A;  3L1P A;  1JT6 A;  5L3D A;  1AKH A;  2RAE A;  3FHN A;  2W84 A;  4O5V A;  1D3Y A;  2JPC A;  4JX6 A;  5HVQ C;  5CVV A;  1MNM C;  2HDD A;  2LC2 A;  3W6V A;  2EIN H;  2ZCW A;  1R36 A;  2DMT A;  3S8P A;  3TOA A;  3LQQ A;  1XGM A;  1S5L C;  5FRM A;  3DP7 A;  1MBJ A;  2NVU B;  2VAS A;  1WJ5 A;  2LP0 A;  3HGY A;  3E6M A;  1KQ0 A;  1MKM A;  2R7D A;  2XAJ A;  4XLE A;  4XLC A;  1ETK A;  2KRH A;  4DYC A;  1V5G A;  3LSM A;  3F72 A;  3RPU A;  1XG1 A;  2XAH A;  3PUF A;  3IL2 A;  1G2H A;  1ZG5 A;  5DD8 A;  3G4S I;  2DOD A;  3C1D A;  2DT7 B;  3J81 K;  3W2A A;  2MC4 A;  2UXN A;  2M1B A;  2MH9 A;  2W85 A;  3E7L A;  2PFB A;  2P7C B;  4PFO A;  2BZT A;  3TED A;  4E7I A;  5F1J A;  4XNF A;  2LRE A;  1BA5 A;  3CP2 A;  1LDD A;  5BQT A;  5E3L A;  4G7H F;  3IH2 A;  1JE8 A;  2Q1Z B;  2F4O B;  4L0Z B;  2VKH A;  2LF8 A;  3H9Q A;  3CCV I;  3H92 A;  4IRG A;  2DMP A;  3LSG A;  3IV5 A;  3W6J B;  3OIP A;  1IV6 A;  4EAT A;  3FK7 A;  1YIJ I;  3AAF A;  1KQ9 A;  4RS8 A;  1YHQ I;  3CJR B;  4JP0 A;  3JAM K;  1MMN A;  1D5Y A;  1FC3 A;  2PI0 A;  1VQ6 I;  5LHI A;  1G8X A;  1APL C;  3GFM A;  5A2Q K;  4BAY A;  2KDZ A;  2ACJ A;  3TL4 X;  1VQ8 I;  1BJZ A;  2PJR B;  4BNC A;  2L9S A;  3I54 A;  3JW4 A;  2Q2E A;  3K4J A;  3H3Z A;  4Q48 A;  2F5C A;  1MBF A;  4WXC A;  1P9Q C;  2E1O A;  1OPC A;  4C2U A;  1UST A;  3HZJ A;  1HC8 A;  4WCG A;  1JTY A;  2ELJ A;  4IF4 A;  4GCV A;  1SC7 A;  1HKS A;  1HDD C;  2JRM A;  4BU2 A;  4UUV A;  1GV2 A;  4MTD A;  1B72 A;  2OPT A;  3CMY A;  5HDG A;  4HW0 A;  4A93 J;  2HS5 A;  5HLI A;  5J1Y A;  3BR5 A;  4KN7 X;  2XKO A;  2G7U A;  5L3B A;  4M73 A;  1RUO A;  1WJC A;  3HPH A;  4G7O F;  2K9S A;  2IW5 A;  5DCF A;  1PUF B;  4BYY A;  4D5C A;  2XGX A;  3QWL A;  4OOI A;  5ILU A;  3CQZ J;  5IP9 J;  5JVG F;  2ESH A;  4MEX F;  3M7G A;  1P4A A;  4LIV A;  2DDA A;  1U3E M;  2BVL A;  3ABU A;  4NNJ A;  1MDM A;  3CJT B;  1E0E A;  2K9M A;  2MD0 A;  3BT9 A;  3ZP5 A;  4BDZ A;  3C3W A;  1ZGJ A;  1DU6 A;  1PP8 F;  5J1R A;  5IYB J;  1QHH D;  1E3O C;  4IHS A;  1J09 A;  1RKT A;  4HV6 A;  1R71 A;  1BOA A;  2DN0 A;  3QP6 A;  3I3L A;  2XSJ C;  3PUB A;  4LLG F;  1VQP I;  2J5O A;  2QGU A;  1O57 A;  2X0L A;  3RJP A;  3O3K A;  1O7L A;  2HKX A;  4PFP A;  3W3C A;  2V1D A;  3Q9S A;  3HOS A;  2L7F P;  3D1N I;  1T98 A;  2BY3 A;  1B4A A;  3WGI A;  4NDL A;  2OU2 A;  2EIL H;  3PIO F;  1XSX A;  1R4N B;  2BBY A;  3MN2 A;  1EV7 A;  4M6Y A;  1A35 A;  1W7P B;  4E4H A;  4EM2 A;  2XGE A;  1O7F A;  3WGG A;  2DMN A;  1FWZ A;  5HOO A;  2XRO A;  2JQ7 A;  4U87 A;  3PNV A;  1WGX A;  2V1X A;  5FLX Z;  2CW0 F;  3R4K A;  1W1W E;  2MD5 A;  1E3H A;  2MC3 A;  3BR1 A;  4IL6 C;  2XAG A;  3FK6 A;  4JQF A;  1FTT A;  4RAY A;  3FZV A;  1EH7 A;  4IOA F;  2FJ1 A;  1I39 A;  4M72 A;  2ID3 A;  2HTS A;  1I3Q J;  1EA3 A;  5JI6 A;  1SFK A;  1OCZ H;  2L9V A;  4UUT A;  2P81 A;  2XRL A;  2EFW A;  4MFD A;  5L3E A;  2XGC A;  4D5F A;  2MSY A;  1FMW A;  2O8X A;  1YJN I;  4BJ5 C;  2PN6 A;  3HRT A;  4E7K A;  3K2Z A;  1JI8 A;  1JJ6 C;  2FOW A;  2L0K A;  3TW7 A;  3CO6 C;  2ISZ A;  1NG6 A;  1PUE E;  3KP4 A;  2VI6 A;  2L7K A;  4BXX J;  2OBP A;  5CYV A;  5F27 A;  3G2B A;  3R60 A;  5F64 A;  4FE7 A;  2BW3 A;  4IZZ A;  3H5A A;  2E5Z A;  3BQZ A;  2ZSH B;  2QWW A;  1F5T A;  1QBJ A;  3UNG C;  1LDJ A;  3P7N A;  1ETO A;  3KYL A;  3KIO A;  1O3Q A;  1S6L A;  2VKV A;  4JX5 A;  3IRQ A;  4A3L J;  2K02 A;  3N97 A;  5B3S H;  3G73 A;  3Q9V A;  1HF0 A;  1MSE C;  4IHV A;  1BR2 A;  3LL7 A;  4ITV A;  1X2N A;  3R0A A;  2LKS A;  2JA7 J;  2CU7 A;  1B9N A;  1YYV A;  1MNE A;  1HSJ A;  3RTR A;  3E6C C;  3H9G A;  1J5Y A;  2E2I J;  4P96 A;  2ZXI A;  5F0F A;  3R6S A;  3G3Z A;  3GVA A;  5J4V A;  2R5Y B;  3T8R A;  1UG2 A;  5JFR A;  1U5T B;  2RKH A;  3QYE A;  3OIO A;  4XK4 A;  2TCT A;  4M6V A;  3IRR A;  1FSE A;  3DBL B;  2VXD A;  4ZZD A;  2DA5 A;  1LQ1 A;  2VKE A;  5D6E A;  3GTJ J;  1OLT A;  1LE8 A;  4FET A;  4UUS A;  1Y6I A;  4E7S A;  5HS7 A;  4X0G A;  1WJF A;  2FU4 A;  4BDY A;  4BE2 A;  4EV0 A;  3FMR A;  2XC7 A;  2EV6 A;  5EZG A;  1HW2 A;  2F6C A;  3QU6 A;  5H6Q A;  4OU0 A;  2BXZ A;  3BJO A;  5KCM A;  1MH4 A;  3MKW B;  3PO3 J;  2A6T A;  2R7Q A;  3GFL A;  3GW2 A;  3KP5 A;  2X48 A;  2OZ6 A;  4KNY A;  3QOP A;  3V8K A;  2VBY A;  1A31 A;  1FYK A;  3DLL F;  2HZD A;  2D1H A;  3JSP A;  2EFQ A;  1H88 C;  3MFK A;  1WWX A;  5CVI A;  4XOR A;  2QUF A;  4A3B J;  2LBF B;  4M9Z A;  1FSH A;  2LH9 A;  3K69 A;  3KET A;  3S16 J;  1OQY A;  1N78 A;  3R0J A;  5D5X B;  4XLF A;  2KKO A;  4RGX A;  3RPQ A;  3E6B A;  6PAX A;  3DEW A;  5D4R A;  1AKH B;  1HKQ A;  1SD7 A;  5BNG A;  4GRI A;  4HF2 A;  1AWC A;  2JA5 J;  5J8F A;  3HSF A;  2FA5 A;  4YFN F;  4XON A;  4C3J J;  1AU7 A;  1Z6R A;  1TWA J;  4HNT A;  1F36 A;  2E7X A;  2YU3 A;  3FWE A;  5E79 C;  1V3F A;  3M1C A;  4JBA A;  4E7L A;  1HA8 A;  1M1E B;  1OJL A;  5L3F A;  3IP4 B;  1TTY A;  2QSH X;  2JSP A;  1R1T A;  2DPU A;  1IJW C;  1E3P A;  2QVO A;  2ELK A;  4ESB A;  5B1B H;  5LFA A;  1T33 A;  4OIP F;  3AL0 C;  1ZYR F;  2E7W A;  2CQN A;  1GUU A;  2M30 A;  3KFW X;  4ZDL A;  1V5F A;  5JHU A;  2FE3 A;  2JSC A;  4I2O A;  3SFI A;  2DK5 A;  4XN0 A;  3DPL C;  3V7S A;  3GX4 X;  4CSW A;  2BYV E;  5TRD A;  1LNW A;  5LHG A;  4BAC A;  3HUG A;  1Z9C A;  1K6Y A;  3ONQ A;  5E3M A;  2XPV A;  4V19 K;  4W1U A;  3RSN A;  3BQY A;  2HDC A;  3KP7 A;  3DTK A;  1SEU A;  4OIO F;  3ABM H;  1J75 A;  2QLZ A;  2HU9 A;  3ESW B;  3FXM A;  3DU5 A;  2Z2S B;  3P9K A;  1GHC A;  4UXN A;  4L5I A;  4QWQ A;  1F1Z A;  1VFC A;  3VYT B;  2L02 A;  4PJJ A;  1JUS A;  3CDL A;  3E3V A;  1LFU P;  2KIS A;  4M3B A;  4BBR J;  4XRS A;  2M5W A;  2BV6 A;  2OQR A;  4RGU A;  5EGO B;  3PO2 J;  4BE0 A;  5LEK A;  1O3S A;  3M1E A;  3HJE A;  3OY9 A;  1Y0U A;  1YX3 A;  2W25 A;  4PSX A;  3WE2 A;  5C4X J;  1QVU A;  3K2A A;  1LVA A;  2Y75 A;  3MQ0 A;  4CCO A;  3FKJ A;  3VOD A;  3BPX A;  1SFU A;  1OR7 A;  3KYD B;  1BI2 A;  1X1C A;  4E7J A;  4L9T A;  1T6S A;  4XOP A;  4OWR B;  4X6A J;  3JRE A;  4I02 A;  4DOZ A;  4ZJZ A;  5IT3 A;  2LKX A;  1QPI A;  4F7Z A;  2K86 A;  1FP1 D;  4IPA A;  2M87 A;  3K1M A;  1BW5 A;  3HKZ N;  2DT5 A;  1MMG A;  3D0S A;  2M8G X;  2WA0 A;  4ZTF A;  2WB1 A;  2PG4 A;  2DFF A;  1U78 A;  3TO6 A;  3WU2 C;  2A3S A;  3ABL H;  5ERI A;  2DMU A;  3QOE A;  4UUS B;  1WJD A;  2ADU A;  4RA2 A;  1TW2 A;  2JVG A;  4OMY A;  3CLQ A;  1FBS A;  3CZ6 A;  1R49 A;  1YW8 A;  2BEO A;  4R79 A;  4N9I A;  2R5Y A;  2ECC A;  2HQR A;  3OYI A;  4II2 A;  4G6Q A;  4CUG A;  3J7Z I;  1FZP B;  2C6Y A;  5EEG A;  5LGU A;  2GOM A;  1X19 A;  5KK1 A;  4IXA A;  3SZT A;  3K70 C;  1JUP A;  1SVO A;  3CP8 A;  2ZJR F;  4O6J A;  1Y1W J;  2FF4 A;  2GXB A;  1T2K A;  4FX4 A;  2ZSI B;  1TP4 A;  2NVQ J;  1FTZ A;  2KHM A;  4D7M A;  3JRD A;  2RC4 A;  3CES A;  3I5U A;  3CCY A;  3CCL I;  1MSF C;  2G9W A;  3CF5 F;  4J00 A;  2XUB A;  4TV7 A;  3CC2 I;  3FIW A;  4AYB N;  2HOS A;  3OL4 A;  2BY1 A;  3LAP A;  1IF1 A;  4FHT A;  1BR4 A;  2R7F A;  3WE3 A;  2H6B A;  3E6D A;  1XMX A;  1RC9 A;  2VL8 A;  1X1B A;  3EYY A;  3KLN A;  1YJ9 I;  3GZ6 A;  3OOP A;  3N4M A;  2QYO A;  5GP9 A;  5HNH A;  4UVC A;  1GXP A;  2HYJ A;  3R61 A;  3CCE I;  3DTE A;  3TP3 A;  3GFI A;  2KJB A;  1J2X A;  5BPI A;  2OJE D;  5IPA A;  4AVP A;  1FIP A;  4KT5 C;  2R7V A;  2A68 F;  4I01 A;  1R5H A;  2DOE A;  3HSE A;  2GIZ A;  3FIS A;  5JLW A;  3SHF A;  3LST A;  2PQ8 A;  5D8L B;  3ABK H;  4H4K C;  1R23 A;  1RUN A;  2M2E A;  2HPM A;  3S15 J;  2D5V A;  1LVK A;  3EET A;  4RDU A;  2VOD A;  1TWC J;  2JWT A;  1J9I A;  1D1B A;  1FOY A;  3F21 A;  2OQG A;  2FOK A;  4A12 A;  1HQC A;  1FP2 A;  1NH3 A;  5LD2 C;  5EGO A;  3A0B C;  2RNJ A;  2DYR H;  1P6R A;  4L0Y B;  3RDI A;  2EA2 A;  3WTT C;  2LRD A;  3PJR A;  2AQE A;  3TBI A;  2Y0S A;  2GQQ A;  1KU7 A;  2VOO A;  3S17 J;  4A6D A;  2CJJ A;  2FNP A;  5GTI C;  4YIR X;  2K9Q A;  4BUP A;  4P55 A;  4B47 A;  3SJM A;  2HTJ A;  4NC8 A;  1Z21 A;  2HXO A;  1IZ1 A;  2KZG A;  5ICF A;  3U9G A;  2PMZ N;  1VTN C;  2P6S A;  2DQR A;  1JGS A;  1XDU A;  4B3X A;  1WH5 A;  3IH3 A;  5F1R A;  4EMS A;  1MBK A;  3HOU J;  2KIQ A;  1GT0 C;  1G6N A;  2LTP A;  3VB2 A;  2GWR A;  5D5U B;  3H0D A;  4GFB A;  5HDK A;  2V9P A;  1OR7 C;  2R92 J;  3RZO J;  2CRG A;  1XX5 A;  3D5S C;  1AHD P;  2L2O A;  3L09 A;  1U5T C;  5L3C A;  3ZR8 X;  3A2K A;  1K61 A;  1DPU A;  1QQI A;  2DJI A;  4YII A;  3TMO A;  2CO5 A;  2CUE A;  1A04 A;  2K3F A;  4DBR A;  4ESF A;  3BTC A;  3HB9 A;  2MGQ A;  4PJ0 C;  3TO7 A;  1ZG3 A;  1B72 B;  3L9F A;  4GYI A;  3ISP A;  4HQM A;  1ETV A;  2NVT J;  1QA6 A;  5KNL A;  3CUQ B;  2CGP A;  5E3N A;  3SEQ A;  3HYI A;  2PLY A;  3L00 A;  3AFH A;  2STT A;  1GXQ A;  4HYE A;  2KP6 A;  3ZQC A;  3K70 D;  4FTH A;  1RES A;  4IHX A;  2RGV A;  4C2M J;  3PQJ A;  1ENH A;  1Y8R B;  2FSW A;  1IDZ A;  2HDW A;  1ZLK A;  3DV8 A;  4XLN F;  2ESN A;  2FXA A;  3VYR B;  1MJA A;  1MND A;  1BW6 A;  1R1U A;  2LBF A;  3BLY A;  4HX7 A;  2K27 A;  4FE4 A;  5GPA A;  3P9I A;  4MNU A;  1GV5 A;  1IDY A;  1HLV A;  5FLV A;  4UVB A;  4OIN F;  2GXG A;  2CFX A;  3H1C A;  4OAY A;  1I1G A;  4BKX A;  4CZC A;  2R7O A;  2HQN A;  4Y15 A;  3IH4 A;  3M3Y J;  1W36 D;  1U0J A;  2MFZ A;  4HF0 A;  4KIS A;  4EQQ A;  4G6D A;  2AS5 F;  1W5C C;  3HBL A;  1V55 H;  2YR2 A;  4YEL A;  2ZC2 A;  2NXN B;  3H0G J;  1TT5 B;  1SFO J;  1X3Z B;  2EFP A;  1CGP A;  4KN4 X;  1JKO C;  2EB7 A;  5H2F C;  3EDP A;  4HG2 A;  4DZP A;  5M3M J;  4U0W A;  2CQX A;  4C2T A;  1T56 A;  2LF7 A;  4XKC A;  1U8B A;  1A6Q A;  3C2H A;  1P2F A;  5CKT A;  2DU9 A;  3VYS B;  4Q5S F;  2MYS A;  2ZXJ A;  5HDN A;  1BBY A;  4LB5 A;  1BC8 C;  4I0A A;  1SD5 A;  3AL0 B;  3ZQ7 A;  4AD9 A;  4AUX A;  3OYL A;  3CJN A;  3HOW J;  4RM3 A;  1WRJ A;  3CDH A;  2MAB A;  2HNH A;  4B09 A;  3GTO J;  3BR2 A;  4IHT A;  1WFX A;  1FYM A;  2COB A;  3E5X A;  1R5I D;  4G94 A;  2FQ4 A;  2BVM A;  5FRO A;  5AIQ A;  1MBG A;  4V2F A;  1TWF J;  1DU0 A;  1WJB A;  1RKW A;  4IEJ A;  2R4G A;  4BY1 J;  3AKZ A;  5GPC A;  1FBQ A;  2Z3Y A;  4CH7 A;  2HOA A;  2VJI A;  3F6O A;  3OYF A;  1IAW A;  4E6K G;  3DEU A;  5KAI C;  2K7L A;  3HDD A;  1FEX A;  2COM A;  4ABZ A;  3DLA A;  3L2R A;  3JSO A;  1HW5 A;  4BEH A;  3AG3 H;  1T0F A;  2XAU A;  2XPW A;  1LEB A;  2EZH A;  1UZC A;  3FXK A;  1N25 A;  1H9G A;  2ICW G;  3GBG A;  2CSO A;  2VPR A;  1B8I B;  1MJB A;  2DA3 A;  2VJ5 A;  3O8H A;  2ME6 A;  5IOZ A;  5FFZ A;  2E5N A;  3VOE A;  3COA C;  2JA8 J;  3NQO A;  3M8J A;  5K5O A;  2RQP A;  3F8B A;  1XDS A;  4F3Q A;  3ZMV A;  2FRH A;  3TDU C;  2WWY A;  5DTD A;  1BOB A;  1X4P A;  2VE8 A;  2P6T A;  2NS8 A;  2P5V A;  2M45 A;  2DT6 A;  3O2P E;  2HEO A;  4KA4 A;  1FPQ A;  1JTX A;  3L2Q A;  2KIM A;  2D1V A;  3Q0U A;  4E7H A;  2XKP A;  4HRI A;  4KDP A;  4CXF A;  5E1Z B;  5DUI A;  1T95 A;  4GO1 A;  2X6Y A;  2CW8 A;  4YRV A;  3S2H J;  2CV2 A;  3ECO A;  1KA8 A;  2KZV A;  2VBW A;  3CDI A;  4G8X A;  4F52 A;  3O6B B;  1ZKG A;  1YFH A;  1MIJ A;  4G12 A;  4M74 A;  3SXY A;  2XAS A;  4BE1 A;  2VE9 A;  3JRA A;  4L9N A;  2O03 A;  4BQO A;  2O0Y A;  3U2R A;  1ORK A;  2YUS A;  3DPT A;  2K4B A;  1IG7 A;  1SAU A;  2PX9 A;  4CCM A;  3OR2 C;  4CYD A;  3LNQ A;  4RM2 A;  5DEQ A;  3JRF A;  5LRS A;  2NS7 A;  1W5S A;  2E35 A;  3MD2 A;  3BZC A;  2VC0 A;  4HOB A;  4AIH A;  2KIF A;  4YFK F;  1K6O A;  3QPS A;  2EIK H;  1WQ2 A;  3V4G A;  1SAX A;  4XSZ F;  3LOC A;  5CQG A;  3OL3 A;  3BWG A;  2RV8 A;  4V2G A;  3WOD F;  1W7P D;  1FY7 A;  1ITY A;  3I53 A;  1CF7 A;  2GM4 A;  2BGC A;  2DW4 A;  3HKZ A;  3E97 A;  3K1N A;  3ZMS A;  1R22 A;  2LLK A;  5H20 A;  2ID6 A;  4Y52 J;  2DPD A;  3M4O J;  1ZAR A;  4M3D A;  1SMT A;  2LOO A;  4GYG A;  4LJZ F;  3WTW C;  4YFX F;  4Y17 A;  4EM1 A;  2R7W A;  1U9N A;  2GOX B;  4GXO A;  4XKB A;  2ZNZ A;  4DYR A;  2R7U A;  1BL0 A;  4Z6Y A;  2OCE A;  5AIP A;  3Q0V A;  4XQF A;  2HFH A;  1BJA A;  2QSG X;  2ELH A;  3RYR A;  4C3I J;  3PIP F;  2R7T A;  2DOA A;  3D5L A;  2MLK A;  1Z7L A;  5DS9 A;  1UJ8 A;  4D1Q A;  2XAQ A;  1H89 C;  1SD6 A;  1XGO A;  3EUK L;  2CQ7 A;  3DBR B;  1S7E A;  1VZ0 A;  2XV4 S;  3M9A A;  4PJL A;  3S2D J;  1IV8 A;  2VJ4 A;  4MIM A;  4KMU X;  1UAA A;  4AIK A;  1RI7 A;  1Y56 A;  4XBF A;  2MA3 A;  1ZRE A;  1WJE A;  3DU6 A;  2EFO A;  2VOP A;  2OD5 A;  2ZNY A;  2NRA C;  1X1A A;  4N4O B;  4U7B A;  1RZ4 A;  2UUZ A;  2M8E A;  3BRO A;  4HX8 A;  4XL9 A;  2UXX A;  4Y3O A;  5CPR B;  3BTI A;  4MHG A;  2YU9 J;  3HTS B;  4WF2 A;  2LYC A;  5IYC J;  3VEP A;  4IOC F;  4EM0 B;  3TDZ C;  3EUH C;  3S2W A;  1XC5 A;  1BIA A;  3SFZ A;  5IP7 J;  5KHD A;  2CYY A;  4ZYA A;  4S0H B;  1MH3 A;  2V9V A;  1YIT I;  2DTZ A;  2HYG D;  3A1Y A;  3IAM 2;  2EV0 A;  3QPL A;  1OIS A;  2AXL A;  4KJZ A;  3HOT A;  4NQW A;  4HV5 A;  4NUB A;  5DM7 F;  3KEQ A;  4FQG A;  5J1U A;  1C0W A;  2A6H F;  3HOZ J;  1YIO A;  2DFI A;  2IA2 A;  4ZYE A;  4PGH A;  2LNB A;  2H8R A;  1D1C A;  3BR0 A;  5BOX A;  3OYE A;  5KAF C;  1VQ4 I;  4AU7 A;  1WI9 A;  4HDU A;  3F3X A;  4L5J A;  4XLH A;  3AG4 H;  3CCJ I;  3OMY A;  4QTR A;  3LQR A;  3M8F A;  2QEN A;  4N9H A;  5HLT A;  3SDG A;  1FJL A;  2L9R A;  1I6H J;  2ETH A;  4GDF A;  4UV8 A;  3SZG A;  1MJ9 A;  2I5U A;  2J5P A;  2X9D A;  1ETX A;  1Y39 A;  2V6C A;  4A0Y A;  1GLN A;  2D2W A;  4N0B A;  3BJA A;  3B6C A;  5HLG A;  2V6E A;  1TW3 A;  2WY7 Q;  1IN5 A;  3BZ6 A;  5J40 A;  3I4N J;  1U2W A;  2RVC A;  3ECH A;  5FD6 A;  1JKQ C;  1ZAO A;  5D8K B;  1S9H A;  1YO5 C;  3MZ8 A;  3CUQ C;  4HQE A;  2DA7 A;  3JCU C;  5EDN A;  2JPB A;  3WTZ A;  3QQA A;  2A69 F;  4IHW A;  1T8I A;  3GME A;  1OCR H;  2L7M P;  2EIJ H;  1JKR C;  1ZN2 A;  1VQM I;  3L2C A;  2NOG A;  2BE5 F;  2HYF A;  5DCM A;  4JK1 X;  4A3D J;  1JHH A;  1IRX A;  2ZME C;  1LPQ A;  3CLO A;  3BG7 A;  4XSX F;  1Z67 A;  3W2V A;  3H9J A;  5ED4 A;  3KEY A;  3PM1 A;  4YIF A;  3MKZ A;  1FBU A;  1TNT A;  4NQW B;  3WG7 H;  2FD5 A;  1OYY A;  2KJC A;  2XHK A;  4LLL A;  3A02 A;  4M71 A;  2WY8 Q;  3OYA A;  3FDY A;  2HPI A;  3NWS A;  4OAZ A;  5LRR A;  4AC0 A;  3G1L A;  2GA1 A;  1U9O A;  1YS6 A;  4IO9 F;  3TGN A;  2P7V B;  3BG9 A;  2LY2 A;  1KON A;  5F0C A;  3VFZ A;  1ACI A;  4EVI A;  3EQL F;  1TNS A;  3A4C A;  3H35 A;  4Y13 A;  1J7K A;  3GTM J;  2DLL A;  2GAU A;  4ANJ A;  2H8W A;  3PFI A;  5DYM A;  1ERD A;  3HPG A;  3VPR A;  1G3T A;  3FM5 A;  1K4S A;  3MKY B;  2CV0 A;  2M9H A;  1SMY F;  4DQ2 A;  3P9C A;  3FBI B;  2NAZ A;  3IKV A;  3H5N A;  2VT3 A;  1VF9 A;  2JA6 J;  2EV5 A;  2QKL B;  3CTA A;  4NC7 A;  2MLG A;  2IPQ X;  5TGT A;  2ZKZ A;  2GZW A;  1STZ A;  4OIR F;  2ZB9 A;  4KFC A;  3LSH A;  1IN4 A;  1MDM B;  1BI1 A;  2JMW A;  2GXA A;  1Y8Q B;  1XS9 A;  4II3 A;  5HNF A;  4XRM A;  3QYF A;  3OSG A;  3GTP J;  1Y0N A;  2F5E A;  3OV8 A;  1MZB A;  1PUF A;  3HRM A;  3FXO A;  5FO5 A;  3QOD A;  4J01 A;  2K85 A;  4LK1 F;  2ZFU A;  2RNG A;  2HR3 A;  2X1C A;  3EYI A;  1YW7 A;  5BMZ A;  1GVJ A;  2BXY A;  2WV0 A;  3K4B A;  1IRG A;  1R6R A;  3HC7 A;  1LE8 B;  3ZMD A;  2VT2 A;  2YS9 A;  3OSF A;  1XCV A;  3G1M A;  1ZRD A;  5LEJ A;  3J7A Y;  2IT0 A;  4IRI A;  1IN6 A;  4EJW A;  3CC4 I;  2X1D A;  1P7I A;  4QPQ A;  3B6A A;  2VXZ A;  3FF5 A;  3GZN B;  4M3E A;  3F22 A;  3HOV J;  1J0R A;  3E1S A;  3ROU A;  3HTU A;  3W2W A;  3CCR I;  2P8T A;  5LHH A;  2O9L A;  1LUJ B;  3VSL A;  5LGN A;  1BM9 A;  2BY2 A;  1J59 A;  1G3S A;  4I7H A;  4ENJ A;  4CGZ A;  4P5O A;  3MAJ A;  3O8G A;  4DZJ A;  4I76 A;  1U8R A;  2ZBK A;  2JTV A;  3BPV A;  4A2U A;  1I1S A;  3BY6 A;  2Y2Z A;  2CUJ A;  2ZJQ F;  4HEA 2;  2LR8 A;  2FBK A;  3DCF A;  5FJ8 J;  3GTL J;  2BW3 B;  2KMU A;  3PSF A;  1ZK8 A;  3DKX A;  3M07 A;  4A0Z A;  4BHC A;  1QRY A;  4XMY A;  4PDK A;  5DUK A;  3FXL A;  4B3A A;  4DNC A;  3FKI J;  1MGT A;  4LB6 B;  1K78 B;  5L3G A;  2RQQ A;  4XLP F;  3WTV C;  3WU0 A;  5BPD A;  3U1D A;  4DYQ A;  2NVX J;  2IS2 A;  1A5J A;  2L7Z A;  3ML6 A;  2Y9Y A;  5EEH A;  1FX7 A;  2LFB A;  1ETQ A;  5E1X A;  2EZK A;  2MH2 A;  3FXR A;  4ZZL A;  3S93 A;  1ZRC A;  4NBQ A;  3HOY J;  4E7Z A;  4PK4 A;  1PVE A;  4UB8 C;  2H1K A;  3MVP A;  3K4L A;  2P4W A;  1YS7 A;  1REP C;  4JOM A;  3L2V A;  3DFG A;  2E1N A;  2IGN A;  3P5J A;  4A3G J;  3ZQF A;  4RAZ A;  5EYR A;  1OCO H;  2KDO A;  2HI3 A;  3LFU A;  2FML A;  3NAR A;  4A3I J;  5JR3 A;  3DKY A;  3IUO A;  5F6F A;  3OYG A;  3OWT A;  4RBO A;  2IXS A;  1YX5 A;  2XF6 A;  5FKN A;  3JR9 A;  1G4D A;  5HLH A;  3KLO A;  2G7H A;  2KLO A;  3ZQH A;  4L5E A;  3C7J A;  3LWF A;  3RCO A;  5JHF A;  2VC1 A;  2JRT A;  4CCK A;  1SFE A;  2F4I A;  4EJT A;  2DK8 A;  1HOM A;  1DP7 P;  2EA4 A;  1EF4 A;  2WAD A;  4HLX A;  4ZTJ A;  2HZT A;  3WTU C;  1QHG A;  2WB1 N;  5JVT A;  1YOV B;  2KL4 A;  1RNL A;  3K7A J;  2LY1 A;  3A01 B;  4FX0 A;  3TP0 A;  2IP2 A;  3I55 I;  3K10 A;  1WJA A;  2DBB A;  4HNU A;  4HBL A;  5GAG J;  2W24 A;  1I5Z A;  2Q0O A;  4X1E A;  2L4M A;  4R1H A;  1WSU A;  1IUY A;  3U21 A;  4LMY A;  2M34 A;  2OTL I;  2NYX A;  5FD5 A;  2PJP A;  2VQC A;  3JRC A;  1OYI A;  4U88 A;  4CDG A;  4ETS A;  1XN7 A;  2WTE A;  4BJT A;  2W7N A;  1K83 J;  3L7W A;  2K3P A;  4CCL A;  3OYN A;  3MZH A;  1XD7 A;  3BR3 A;  4ENN A;  3X2Q H;  3OYD A;  2EWN A;  3ABT A;  2DA1 A;  3OIQ A;  5HS9 A;  2IRF G;  3RQI A;  3DXJ F;  4U0Y A;  1WKM A;  5HS8 A;  2HQ5 A;  3ASN H;  1GVD A;  3PFY A;  1IRF A;  5IY5 H;  5IOY A;  2D45 A;  2ZXH A;  1USS A;  5LBQ A;  1R1V A;  5K1Y A;  1RR8 C;  4KT6 A;  4AWX B;  4AIJ A;  1OFC X;  3LA7 A;  4UHT A;  4HPQ A;  2VJJ A;  1O4X A;  1XMK A;  1I50 J;  2M7A A;  2OF7 A;  1N77 A;  3KZI C; 
#chains in the Genus database with same CATH homology
 4I09 A;  1P4W A;  4PZJ A;  1ZGA A;  5KVR A;  1ON2 A;  4RB0 A;  1HBX G;  3KZZ A;  3GFJ A;  5FGM A;  5CVJ A;  1D8J A;  2H94 A;  4OIQ F;  2CG4 A;  4NB5 A;  4KIB A;  1UFM A;  3KCC A;  3V7R A;  3ERE D;  3DKW A;  4KYW A;  4CHU A;  1XCB A;  5IT9 K;  3DF8 A;  2B0L A;  3I59 A;  2PBI A;  3FHZ A;  1L3L A;  2VBZ A;  2Q8K A;  5LLQ A;  1UHW A;  1ZG1 A;  2V1U A;  4HZF A;  4S04 A;  1AOY A;  3K1P A;  1D8K A;  3HRS A;  1TLH B;  2P5K A;  1KYW A;  1OKR A;  1I27 A;  1PDN C;  4UNO A;  1DUX C;  4KIF A;  1BIB A;  4LD5 A;  3KP6 A;  1Z6T A;  2JZY A;  2O6G E;  2DTR A;  2A6E F;  2QQB A;  1ZLJ A;  2L3D A;  2X4H A;  1JHF A;  4Z2Y A;  1Z7U A;  3ZPL A;  2LSO A;  4ZYG A;  1S7O A;  1W4M A;  1O3R A;  4HF1 A;  3E5Q A;  2YX4 A;  4ON0 A;  1K78 A;  3FX3 A;  1IXR C;  1S29 A;  3LA2 A;  4LG0 B;  3MZY A;  5D5W B;  3PQK A;  4G7Z F;  4CZZ A;  4ENM A;  4MTE A;  3I71 A;  1KU2 A;  1ODD A;  1G3Y A;  1P92 A;  3ZN1 A;  1KU9 A;  4CO8 A;  5D4S A;  1Q1H A;  1F4K A;  3T8T A;  4CIC A;  3E5U A;  4PCQ A;  1FLI A;  1SFX A;  5D6F A;  4HDV A;  2QBY B;  4G7O F;  1PP7 U;  3FXQ A;  3DQV C;  1XSD A;  3I0T A;  2PEX A;  3QAH A;  4WWC A;  3SQN A;  2LDU A;  2E1C A;  1HW1 A;  4D0P A;  2ZO4 A;  1KGS A;  1L0O C;  4BHB A;  2H6C A;  2R3S A;  2OA4 A;  1FNN A;  2NNY A;  5K5R A;  3C18 A;  5K5Q A;  2ZME B;  2LKP A;  3FM3 A;  2FBH A;  3LA3 A;  2EJR A;  4E70 A;  5ICG A;  4HX4 A;  2OZU A;  3WG9 A;  3J80 K;  1ZH5 A;  3M8E A;  4EGY A;  4MEY F;  3IHU A;  4PGG A;  4HA8 A;  4OMZ A;  4KMF A;  4A6E A;  2QBY A;  1R5G A;  2UWM A;  2STW A;  4A0X A;  3J81 Z;  4WXD A;  2F5F A;  1H0M A;  4EJV A;  2FEZ A;  4MGR A;  1YTY A;  3RKX A;  1LB2 A;  3ZMZ A;  1RIO H;  2FBI A;  1R00 A;  5CJ9 A;  2NS0 A;  1X3U A;  3FMQ A;  4M9X A;  5E1W A;  2KRF A;  3GWZ A;  4KIG A;  1DPR A;  4L18 B;  3KZY A;  2RDP A;  1FT9 A;  3WU1 B;  1JXS A;  4FT8 A;  4P9U A;  2PMU A;  4B8X A;  3QRF F;  4LK0 F;  1B59 A;  4LG0 A;  1B1B A;  3F6V A;  1XGN A;  5FB2 A;  2QZ8 A;  1Z1D A;  2YX7 A;  3V7C A;  3I58 A;  2HKO A;  2O61 A;  1I6X A;  2XAF A;  4BQA A;  3HSR A;  1QGP A;  3MCZ A;  4S05 A;  2KIU A;  4NHJ A;  3W6K B;  2W57 A;  3ELK A;  3LAJ A;  4BH9 A;  1UCR A;  5ICC A;  2L01 A;  4G9Y A;  2IA1 A;  4QLC U;  1U5T A;  2CQK A;  1IXS B;  1F9N A;  1HKT A;  2PMH A;  1UHM A;  1QO0 D;  3ZMU A;  2XRN A;  3T0Y A;  4UVA A;  2Z9O A;  2FNA A;  3CO7 C;  3F23 A;  3F8C A;  2UZK A;  3QPT A;  3JTH A;  4I98 B;  1B9M A;  2TDX A;  2A5Y B;  4A5M A;  3ULQ B;  5A2Q Z;  2HWV A;  2VBX A;  1OYW A;  1IN7 A;  2A07 F;  1KQ8 A;  3BDD A;  5DD4 A;  1R7J A;  4IRH A;  3I59 B;  1Z05 A;  5E8I A;  4RGS A;  1QZY A;  4RGR A;  3K0L A;  2L4A A;  5CVU A;  2DQL A;  1OMI A;  3IWZ A;  1QNT A;  4MQ9 F;  2DI3 A;  3TO9 A;  1W7P A;  1H9T A;  5CLS A;  3GYH X;  4RB1 A;  2ZME A;  5BS6 A;  5TJJ A;  5ILS A;  1HST A;  1LDK B;  5E20 A;  1QZZ A;  3NEU A;  2FQ3 A;  3QP5 A;  5J8C A;  1FYL A;  1KYZ A;  3I64 A;  5IT9 Z;  4M6X A;  1T39 A;  3CUQ A;  5D5V B;  1ZRF A;  1IXC A;  4O3M A;  2ZJ2 A;  4K2E A;  4R8H A;  2DAO A;  3LFK A;  1E17 A;  1EH8 A;  2H09 A;  2QQA A;  2IJL A;  2Y0M A;  1IW7 F;  4ASN A;  3WGH A;  1LJ9 A;  4M9S A;  5ICE A;  3WTS C;  4A5N A;  4KIC A;  2GA2 A;  3RKW A;  4IVN A;  3QPH A;  3RIR A;  2WC2 A;  2Z5U A;  1DDN A;  2JT1 A;  4GGG A;  1YLF A;  3GEZ A;  2EFN A;  2VN2 A;  4ZH4 F;  3JTG A;  5DDG A;  1BI3 A;  4EGZ A;  1T38 A;  3GLX A;  4LFU A;  1G3W A;  3CUO A;  4HLY A;  5J6X A;  4MQV A;  2EK5 A;  2O3F A;  4WX9 A;  4RB2 C;  1TQI A;  4EJO A;  1BC7 C;  3BP8 A;  1S8N A;  3GF2 A;  1TBX A;  4ENK A;  1LEA A;  5CVR A;  1FOK A;  4BXU A;  2F2E A;  3TQN A;  4ZYH A;  1YQA A;  3FXU A;  3K9T A;  3V8L A;  2FMY A;  1XMA A;  3HHG A;  1KU3 A;  3MWM A;  2L54 A;  1Z91 A;  3REO A;  1K79 A;  1ON1 A;  3FMS A;  1NHA A;  1YG2 A;  3BOQ A;  3TOB A;  1BN5 A;  4ESJ A;  2QQ9 A;  4XRF A;  4KUM A;  2OAZ A;  3JAM Z;  2IA0 A;  3WTX C;  3F8N A;  4UV9 A;  4EJU A;  1R58 A;  2HOE A;  3IKT A;  3KEO A;  2IVM A;  4H0E A;  4U0V A;  2XVC A;  3GO5 A;  3KP2 A;  4BHP A;  2YPR A;  1ULY A;  5ILV A;  4ZYD A;  2MBF A;  1E2X A;  3HRU A;  3T5X A;  4HAM A;  3F8F A;  5FLX K;  1SD4 A;  1XGS A;  2RN7 A;  5H6R A;  1XSV A;  4Q4Z F;  2NNN A;  1W5T A;  3GZ5 A;  4Q47 A;  5FFX A;  3B73 A;  3I4P A;  1TQP A;  4I0B A;  2H27 A;  2F5D A;  3QU3 A;  3ZMT A;  1ZHF A;  3ZN0 A;  4RB3 C;  1EH6 A;  1CF7 B;  4LGW A;  1K7A A;  2VON A;  3KP3 A;  2V79 A;  4YG2 F;  3J80 Z;  1S3J A;  3B02 A;  5E18 F;  3J7A O;  1D5V A;  4U7D A;  2Y48 A;  4L9V A;  3F8M A;  3IWF A;  3SZP A;  1B6A A;  1TQM A;  3HHH A;  2XIG A;  3NRV A;  4IJA A;  3RI4 A;  3V8J A;  1MD0 A;  1O3T A;  5LGT A;  3RYP A;  3RKY A;  1IN8 A;  2YSR A;  3MEX A;  1YW9 A;  4P9F A;  2P5L C;  3Q5F A;  3WTY C;  3EUH A;  3HIF A;  3BJ6 A;  3T1B A;  3KE2 A;  1S7A A;  2A61 A;  2Z33 A;  3TKY A;  3GXO A;  2Z99 A;  1P4X A;  1QPM A;  5DV5 A;  1BI0 A;  2GIV A;  2QM3 A;  3GUD A;  5DCM B;  5E8G A;  1U6G A;  2ZFW A;  3IC7 A;  5AON A;  5E17 F;  4WK8 F;  2HGC A;  4L9J A;  1UB9 A;  4LLN A;  3H3U A;  1V4R A;  1HXD A;  2CWE A;  1ONV A;  2K4J A;  2DO7 A;  1XB4 A;  2ISY A;  4WXH A;  5L3D A;  2W84 A;  4O5V A;  1D3Y A;  2JPC A;  5HVQ C;  5CVV A;  2ZCW A;  1R36 A;  3TOA A;  3LQQ A;  1XGM A;  3DP7 A;  3E6M A;  1KQ0 A;  1MKM A;  2R7D A;  2XAJ A;  3F72 A;  3RPU A;  2XAH A;  3IL2 A;  1ZG5 A;  5DD8 A;  3C1D A;  3J81 K;  2W85 A;  2UXN A;  2M1B A;  2MH9 A;  2P7C B;  2PFB A;  1LDD A;  5BQT A;  4G7H F;  1JE8 A;  4L0Z B;  2LF8 A;  3H92 A;  4IRG A;  3W6J B;  3AAF A;  1KQ9 A;  4RS8 A;  3JAM K;  2PI0 A;  1FC3 A;  5LHI A;  3GFM A;  5A2Q K;  4BAY A;  2ACJ A;  4BNC A;  3I54 A;  3JW4 A;  2Q2E A;  4Q48 A;  3H3Z A;  2F5C A;  4WXC A;  1OPC A;  1UST A;  4WCG A;  4IF4 A;  4GCV A;  1HKS A;  4UUV A;  4MTD A;  5HDG A;  4HW0 A;  2HS5 A;  5HLI A;  4KN7 X;  2XKO A;  2G7U A;  5L3B A;  4M73 A;  1RUO A;  2IW5 A;  5DCF A;  4BYY A;  2XGX A;  4OOI A;  5ILU A;  2ESH A;  4MEX F;  3M7G A;  1P4A A;  1U3E M;  3ABU A;  1MDM A;  3ZP5 A;  3C3W A;  1ZGJ A;  1PP8 F;  4IHS A;  4HV6 A;  1BOA A;  3QP6 A;  4LLG F;  2J5O A;  1O57 A;  2X0L A;  3RJP A;  3O3K A;  1O7L A;  2HKX A;  2V1D A;  3Q9S A;  3HOS A;  1T98 A;  1B4A A;  3WGI A;  2OU2 A;  1XSX A;  2BBY A;  1EV7 A;  4M6Y A;  1W7P B;  4EM2 A;  1O7F A;  3WGG A;  5HOO A;  1FWZ A;  2XRO A;  2V1X A;  5FLX Z;  2CW0 F;  3R4K A;  2MD5 A;  2MC3 A;  2XAG A;  4JQF A;  4RAY A;  3FZV A;  1EH7 A;  4M72 A;  2HTS A;  5JI6 A;  2EFW A;  5L3E A;  2O8X A;  2PN6 A;  3HRT A;  3K2Z A;  3CO6 C;  2ISZ A;  1PUE E;  3KP4 A;  2OBP A;  5CYV A;  3R60 A;  5F64 A;  2QWW A;  1F5T A;  1QBJ A;  1LDJ A;  3P7N A;  1O3Q A;  1S6L A;  3IRQ A;  2K02 A;  3N97 A;  3G73 A;  3Q9V A;  3R0A A;  1B9N A;  1YYV A;  1HSJ A;  3RTR A;  3E6C C;  1J5Y A;  4P96 A;  3R6S A;  3G3Z A;  3GVA A;  3T8R A;  5JFR A;  1U5T B;  2RKH A;  3IRR A;  1FSE A;  4ZZD A;  1LQ1 A;  5D6E A;  5HS7 A;  2FU4 A;  4EV0 A;  3FMR A;  2EV6 A;  1HW2 A;  3QU6 A;  5H6Q A;  4OU0 A;  3BJO A;  3GFL A;  3GW2 A;  3KP5 A;  2OZ6 A;  4KNY A;  3QOP A;  3V8K A;  2VBY A;  1FYK A;  2D1H A;  3JSP A;  2EFQ A;  3MFK A;  1WWX A;  5CVI A;  2QUF A;  4M9Z A;  1FSH A;  3K69 A;  3KET A;  3R0J A;  5D5X B;  2KKO A;  4RGX A;  3RPQ A;  3E6B A;  6PAX A;  5D4R A;  1HKQ A;  1SD7 A;  4HF2 A;  1AWC A;  5J8F A;  3HSF A;  2FA5 A;  4YFN F;  1Z6R A;  2E7X A;  2YU3 A;  3FWE A;  1V3F A;  4JBA A;  5L3F A;  1TTY A;  1R1T A;  2DPU A;  2QVO A;  4ESB A;  4OIP F;  1ZYR F;  2E7W A;  2M30 A;  3KFW X;  5JHU A;  2FE3 A;  2JSC A;  4I2O A;  2DK5 A;  3DPL C;  3V7S A;  3GX4 X;  2BYV E;  5TRD A;  1LNW A;  5LHG A;  1Z9C A;  3HUG A;  2HDC A;  3KP7 A;  4OIO F;  1J75 A;  2QLZ A;  3P9K A;  1GHC A;  4UXN A;  4L5I A;  4QWQ A;  1F1Z A;  2L02 A;  3E3V A;  2M5W A;  2BV6 A;  2OQR A;  4RGU A;  5LEK A;  1O3S A;  3M1E A;  1Y0U A;  3WE2 A;  2W25 A;  1LVA A;  2Y75 A;  3MQ0 A;  3VOD A;  3BPX A;  1SFU A;  1OR7 A;  1BI2 A;  4L9T A;  1T6S A;  4I02 A;  5IT3 A;  4F7Z A;  2K86 A;  1FP1 D;  4IPA A;  2M87 A;  3K1M A;  2DT5 A;  3D0S A;  2PG4 A;  1U78 A;  3TO6 A;  2A3S A;  5ERI A;  2ADU A;  1TW2 A;  4OMY A;  1FBS A;  1YW8 A;  2BEO A;  4R79 A;  4N9I A;  2HQR A;  4G6Q A;  1FZP B;  2C6Y A;  5EEG A;  5LGU A;  5KK1 A;  4IXA A;  3SZT A;  4O6J A;  2FF4 A;  2GXB A;  1T2K A;  4FX4 A;  2RC4 A;  3I5U A;  2G9W A;  2XUB A;  4TV7 A;  1IF1 A;  3LAP A;  4FHT A;  2R7F A;  3WE3 A;  2H6B A;  3E6D A;  3EYY A;  3KLN A;  3GZ6 A;  3OOP A;  3N4M A;  2QYO A;  4UVC A;  1GXP A;  3R61 A;  3GFI A;  2KJB A;  1J2X A;  5BPI A;  4AVP A;  4KT5 C;  2A68 F;  4I01 A;  1R5H A;  3HSE A;  3SHF A;  3LST A;  2PQ8 A;  5D8L B;  1R23 A;  1RUN A;  3EET A;  2VOD A;  1J9I A;  3F21 A;  2OQG A;  2FOK A;  4A12 A;  1HQC A;  1FP2 A;  2RNJ A;  1P6R A;  4L0Y B;  3RDI A;  2EA2 A;  3WTT C;  2GQQ A;  1KU7 A;  2VOO A;  4A6D A;  2FNP A;  4P55 A;  2HTJ A;  1IZ1 A;  5ICF A;  3U9G A;  1VTN C;  2P6S A;  2DQR A;  1JGS A;  1XDU A;  5F1R A;  4EMS A;  1G6N A;  3VB2 A;  2GWR A;  5D5U B;  5HDK A;  3L09 A;  1U5T C;  5L3C A;  1DPU A;  1QQI A;  4YII A;  2CO5 A;  1A04 A;  4ESF A;  3TO7 A;  1ZG3 A;  3L9F A;  4GYI A;  3ISP A;  4HQM A;  3CUQ B;  2CGP A;  3HYI A;  2PLY A;  3L00 A;  2STT A;  1GXQ A;  4HYE A;  2RGV A;  3PQJ A;  2FSW A;  1ZLK A;  3DV8 A;  4XLN F;  2ESN A;  2FXA A;  1MJA A;  1R1U A;  4HX7 A;  2K27 A;  3P9I A;  4MNU A;  4UVB A;  4OIN F;  2GXG A;  2CFX A;  1I1G A;  4Y15 A;  2HQN A;  4HF0 A;  4EQQ A;  4G6D A;  2AS5 F;  2YR2 A;  1CGP A;  2EFP A;  4KN4 X;  2EB7 A;  3EDP A;  4U0W A;  2LF7 A;  1P2F A;  4Q5S F;  2DU9 A;  2ZXJ A;  5HDN A;  1BBY A;  4LB5 A;  1BC8 C;  4I0A A;  1SD5 A;  3ZQ7 A;  4AD9 A;  3CJN A;  1WRJ A;  3CDH A;  4B09 A;  4IHT A;  1FYM A;  3E5X A;  4G94 A;  5AIQ A;  1FBQ A;  2Z3Y A;  1IAW A;  3F6O A;  3DEU A;  2K7L A;  2COM A;  3JSO A;  1HW5 A;  1T0F A;  1LEB A;  1H9G A;  2CSO A;  1MJB A;  5FFZ A;  3VOE A;  3COA C;  3NQO A;  5K5O A;  2RQP A;  3F8B A;  1XDS A;  3ZMV A;  2FRH A;  3TDU C;  2WWY A;  2VE8 A;  2P6T A;  2P5V A;  2M45 A;  3O2P E;  2HEO A;  4KA4 A;  1FPQ A;  2KIM A;  2D1V A;  2XKP A;  4KDP A;  4CXF A;  5E1Z B;  5DUI A;  4GO1 A;  3ECO A;  1KA8 A;  2VBW A;  4G8X A;  3O6B B;  1YFH A;  4M74 A;  3SXY A;  2XAS A;  2VE9 A;  4L9N A;  2O03 A;  2O0Y A;  3U2R A;  3DPT A;  2K4B A;  4CYD A;  5DEQ A;  5LRS A;  1W5S A;  2VC0 A;  4HOB A;  4AIH A;  2KIF A;  4YFK F;  1K6O A;  1WQ2 A;  3V4G A;  1SAX A;  4XSZ F;  3BWG A;  2RV8 A;  3WOD F;  1W7P D;  1FY7 A;  3I53 A;  1CF7 A;  2BGC A;  2DW4 A;  3E97 A;  3K1N A;  3ZMS A;  1R22 A;  5H20 A;  2DPD A;  1ZAR A;  1SMT A;  4GYG A;  4LJZ F;  3WTW C;  4YFX F;  4Y17 A;  4EM1 A;  4GXO A;  2ZNZ A;  5AIP A;  2HFH A;  1BJA A;  2ELH A;  3RYR A;  3D5L A;  2MLK A;  2XAQ A;  1SD6 A;  1XGO A;  2XV4 S;  3M9A A;  4KMU X;  4AIK A;  1RI7 A;  4XBF A;  2MA3 A;  1ZRE A;  2EFO A;  2VOP A;  2OD5 A;  2ZNY A;  2NRA C;  4U7B A;  1RZ4 A;  3BRO A;  2M8E A;  4HX8 A;  2UXX A;  4MHG A;  3HTS B;  4WF2 A;  3VEP A;  4EM0 B;  3TDZ C;  3S2W A;  1BIA A;  3SFZ A;  2CYY A;  2V9V A;  2HYG D;  2EV0 A;  2AXL A;  3HOT A;  4NQW A;  4HV5 A;  3KEQ A;  1C0W A;  2A6H F;  1YIO A;  2DFI A;  4ZYE A;  2IA2 A;  4PGH A;  2LNB A;  5BOX A;  1WI9 A;  4HDU A;  3F3X A;  4L5J A;  3LQR A;  3M8F A;  2QEN A;  4N9H A;  2ETH A;  4UV8 A;  1MJ9 A;  2J5P A;  2V6C A;  4A0Y A;  2D2W A;  4N0B A;  3BJA A;  5HLG A;  1TW3 A;  1IN5 A;  3BZ6 A;  1U2W A;  2RVC A;  3ECH A;  5FD6 A;  1ZAO A;  5D8K B;  1YO5 C;  3CUQ C;  4HQE A;  2JPB A;  3WTZ A;  2A69 F;  1ZN2 A;  3L2C A;  2BE5 F;  2HYF A;  5DCM A;  4JK1 X;  1JHH A;  3CLO A;  4XSX F;  5ED4 A;  4YIF A;  1FBU A;  1TNT A;  1OYY A;  2KJC A;  2XHK A;  4LLL A;  4M71 A;  5LRR A;  2GA1 A;  1YS6 A;  3TGN A;  2P7V B;  3VFZ A;  4EVI A;  3EQL F;  1TNS A;  4Y13 A;  1J7K A;  2DLL A;  2GAU A;  3PFI A;  5DYM A;  1G3T A;  3FM5 A;  1SMY F;  4DQ2 A;  3P9C A;  2NAZ A;  3IKV A;  2VT3 A;  2EV5 A;  3CTA A;  2MLG A;  2IPQ X;  2ZKZ A;  2GZW A;  1STZ A;  4OIR F;  4KFC A;  1IN4 A;  1MDM B;  1BI1 A;  2F5E A;  3OV8 A;  1MZB A;  3HRM A;  5FO5 A;  4LK1 F;  2HR3 A;  3EYI A;  1YW7 A;  5BMZ A;  1GVJ A;  2WV0 A;  1IRG A;  3ZMD A;  2VT2 A;  1XCV A;  1ZRD A;  5LEJ A;  2IT0 A;  4IRI A;  1IN6 A;  4EJW A;  2VXZ A;  3FF5 A;  3F22 A;  1J0R A;  3ROU A;  3HTU A;  2P8T A;  5LHH A;  5LGN A;  1BM9 A;  1J59 A;  1G3S A;  4I7H A;  4ENJ A;  4CGZ A;  4P5O A;  3MAJ A;  1U8R A;  2ZBK A;  2JTV A;  3BPV A;  4A2U A;  1I1S A;  3BY6 A;  2FBK A;  4BHC A;  4A0Z A;  4PDK A;  5DUK A;  4DNC A;  1MGT A;  4LB6 B;  1K78 B;  5L3G A;  4XLP F;  3WTV C;  3WU0 A;  5BPD A;  3U1D A;  3ML6 A;  5EEH A;  1FX7 A;  5E1X A;  2MH2 A;  3FXR A;  4ZZL A;  1ZRC A;  2P4W A;  1YS7 A;  1REP C;  3DFG A;  2E1N A;  4RAZ A;  2FML A;  5JR3 A;  5F6F A;  1G4D A;  5HLH A;  3KLO A;  2G7H A;  3C7J A;  3LWF A;  2VC1 A;  2JRT A;  4EJT A;  1SFE A;  2DK8 A;  1DP7 P;  2EA4 A;  4HLX A;  2HZT A;  3WTU C;  5JVT A;  1RNL A;  4FX0 A;  2IP2 A;  2DBB A;  4HBL A;  2W24 A;  1I5Z A;  2Q0O A;  2L4M A;  4R1H A;  1WSU A;  1IUY A;  4LMY A;  2NYX A;  5FD5 A;  2PJP A;  1OYI A;  4U88 A;  4CDG A;  4ETS A;  1XN7 A;  2WTE A;  3L7W A;  3MZH A;  1XD7 A;  4ENN A;  2EWN A;  3ABT A;  5HS9 A;  2IRF G;  3DXJ F;  4U0Y A;  1WKM A;  5HS8 A;  1IRF A;  2D45 A;  1USS A;  5LBQ A;  1R1V A;  5K1Y A;  4AWX B;  4AIJ A;  3LA7 A;  4UHT A;  1XMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...