1JGSA

Multiple antibiotic resistance repressor, marr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of MarR, a regulator of multiple antibiotic resistance, at 2.3 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jgsA00
3CO6C 3M7GA 1SFXA 1I1SA 1LDDA 2ADUA 1HKTA 3E6BA 2G7UA 4ETSA 1ZLKA 1PUEE 3E5XA 2NYXA 3WTSC 4I2OA 2VE8A 4MHGA 2QQBA 1O3QA 3WTYC 3WGHA 3H3UA 3FM5A 5LHHA 3KZZA 2HS5A 4OOIA 1W5TA 1G3TA 4Y15A 4OMZA 6PAXA 4Z2YA 5CVVA 4LMYA 2A61A 2X0LA 2IA0A 2H27A 1ZRDA 2CFXA 4IRIA 1ZH5A 4U0WA 5FGMA 2QM3A 2DQRA 3WTUC 2XRNA 4MQVA 2ACJA 4P9UA 1IRGA 2V1UA 5ILSA 3EYYA 4HA8A 2WTEA 2MLKA 4EGYA 4U0VA 4EJTA 4HQMA 1J5YA 4RGXA 1FYKA 3I54A 4BNCA 5FLXK 2F5DA 5FFZA 1KQ0A 4ESJA 1FBSA 4KUMA 5DD8A 2PG4A 1DUXC 2CSOA 3U9GA 1IF1A 3KETA 4YIFA 1D8JA 1OR7A 1G3SA 4OIOF 3BP8A 1S7AA 1USTA 3TDUC 3GXOA 3KP4A 1FYLA 2RV8A 3HRTA 1R23A 4YFKF 3GWZA 1NHAA 3IRRA 3FZVA 3R60A 1GVJA 5FLXZ 5LHGA 3SFZA 3IL2A 3VEPA 3J80Z 1XGOA 3GX4X 1P4XA 4LLGF 1T6SA 1RZ4A 1F5TA 1F4KA 4HOBA 3KP7A 2OZ6A 4Y13A 2RDPA 1G3WA 2LSOA 2R7DA 5D5XB 2LF7A 1DPUA 3SZPA 2HWVA 1ZYRF 3K69A 1ON1A 5J8FA 2IW5A 1QQIA 1JHHA 3GLXA 4RS8A 3K2ZA 4LLLA 3WGGA 5F6FA 5LLQA 3QAHA 2M8EA 4ZYEA 4HW0A 4Q47A 3U1DA 5HLGA 3DFGA 2D1HA 1DP7P 2EV6A 4P55A 4M9SA 1BI2A 3KLOA 2DBBA 3ISPA 3LQQA 3GYHX 1YW9A 3REOA 1OPCA 1XGSA 3GZ5A 4LJZF 1FYMA 3F8CA 4QLCU 2MD5A 1HQCA 2PQ8A 3F6VA 1B9NA 2OZUA 3QPHA 3H3ZA 4O3MA 1ZRFA 5LGTA 2K4JA 3R4KA 2WC2A 4RAYA 4BHCA 4HDUA 4KDPA 4EQQA 2EB7A 2DO7A 3HSEA 3IKTA 1WKMA 1UHWA 2QENA 2ZBKA 2QQ9A 1E2XA 1K6OA 4CHUA 4FX0A 2XAGA 1HKQA 3AAFA 5BPDA 4LGWA 3I71A 3F21A 5CVUA 3KP5A 2XASA 4HLYA 4EM0B 3QRFF 3LA7A 2OBPA 3E97A 5D5WB 4Y17A 3F6OA 3F8FA 3L09A 5LEKA 5ERIA 4I0BA 2RC4A 4HQEA 4L5JA 3DQVC 4MQ9F 2W84A 1LDKB 1IN7A 1KU2A 2Z5UA 2RKHA 4D0PA 3M1EA 4LB6B 2X4HA 3E5UA 4GCVA 5K5OA 4O5VA 4EV0A 3E6DA 4GYIA 2JRTA 2ZKZA 2GIVA 2EA2A 1U6GA 5AIQA 3FXUA 2K7LA 2CYYA 1MDMA 1TBXA 2HEOA 3WE3A 1J59A 2F5CA 4KMFA 2ISYA 4HAMA 4YIIA 1C0WA 4A12A 1S3JA 1TLHB 3N4MA 2FNAA 1BOAA 2PN6A 3RKYA 2W85A 2L4AA 3P7NA 1BI3A 1J0RA 3COAC 1G3YA 2ZO4A 2HTJA 2ISZA 3DKWA 4HZFA 4G7OF 3K1PA 4AVPA 1YLFA 1AOYA 1BIBA 2BGCA 2QYOA 5IT3A 1O7FA 1R22A 4DNCA 2GAUA 4M9XA 3O2PE 2HR3A 2BBYA 2K4BA 3FHZA 4IJAA 3CTAA 1HSJA 1ON2A 1MGTA 4MEYF 1STZA 4PGGA 1ZAOA 4BXUA 4ENJA 2YX7A 5FD5A 1YW7A 2K27A 3EYIA 1KA8A 1Z6RA 3LQRA 3U2RA 2XGXA 3HOSA 2Q8KA 5BOXA 5A2QK 2A69F 4N0BA 2E7WA 3ULQB 3IHUA 4AWXB 1W7PD 4ZH4F 4WCGA 5EEHA 2C6YA 2KJCA 2JPCA 3LA3A 2FXAA 1XSXA 3WTVC 2DPDA 1T39A 2AS5F 1MDMB 4IF4A 1Z7UA 2B0LA 2ZJ2A 5AIPA 1R7JA 5JHUA 3PFIA 4L5IA 1GXPA 5FD6A 4AIHA 3R0JA 1BJAA 4MEXF 3O3KA 1XGMA 3L00A 4IRGA 5FFXA 4HF2A 5LEJA 4CICA 1IW7F 2PMHA 3F8BA 2FRHA 2EV0A 2YR2A 5D8KB 5LGNA 2OQRA 1RI7A 3BY6A 2P5KA 4GO1A 1O57A 3Q9SA 3BWGA 3FMQA 3CJNA 2ZCWA 4G7ZF 2E1CA 2PBIA 4KIGA 2ESHA 4NB5A 2GQQA 1U5TA 2WWYA 3LA2A 1HW5A 3KEQA 1FP2A 3OOPA 2V6CA 3J81Z 3KP2A 2DU9A 2P7VB 1HKSA 5CLSA 3F72A 4ON0A 3JAMZ 5DDGA 3IRQA 4HYEA 4K2EA 5DV5A 4KFCA 1D5VA 3B73A 5LRSA 1F9NA 3W6KB 1OYIA 1ZRCA 3M8EA 1Z05A 1FY7A 2ZFWA 1SAXA 3HTUA 3RPUA 2E1NA 2PEXA 2L54A 1TNTA 3SXYA 2ZXJA 1UFMA 1OYYA 2HYFA 2KIMA 3DPTA 3JSPA 3BDDA 4G8XA 1J9IA 4YG2F 2M45A 4IHSA 2VBYA 1EH8A 2F5EA 4P5OA 1W5SA 3ZMUA 4RB3C 4UUVA 5E20A 4ZZLA 1LEAA 5LGUA 1I27A 5ILVA 2NNNA 4P96A 3HUGA 1Z91A 4JBAA 4U0YA 1U5TB 3GVAA 3T1BA 4R8HA 2G7HA 1TQPA 1R58A 5K5QA 2NAZA 5ILUA 1FT9A 4QWQA 3QPTA 4EVIA 4M71A 1B9MA 3TKYA 3T8RA 2V79A 1J75A 2IA1A 4EM2A 1G6NA 4L9VA 2VXZA 2MBFA 3BPVA 1WWXA 5F64A 4O6JA 1ZG3A 1MKMA 3GEZA 5JI6A 2EJRA 1H9TA 3L9FA 1Z9CA 5CJ9A 2JTVA 1B59A 2MC3A 1LDJA 3VFZA 1KGSA 2UWMA 1P92A 3V8KA 5TRDA 1GXQA 2MH2A 4FX4A 4FHTA 1X3UA 1B4AA 2K86A 1TW3A 3ROUA 1JE8A 1Z6TA 2O03A 5D5VB 4HX7A 1Y0UA 1IXSB 2PI0A 3BPXA 1IAWA 3KEOA 1LNWA 5JFRA 3FWEA 5IT9Z 1QNTA 4UVBA 2YX4A 4DQ2A 3ECHA 4EJVA 3TDZC 3ZMZA 3MZYA 1K79A 1XD7A 2F2EA 2EWNA 1OYWA 2OD5A 4BH9A 1SFEA 4Q5SF 1T0FA 1YW8A 2QLZA 3ZMVA 2H09A 2XUBA 1YS7A 3ABTA 4JK1X 1FBUA 5FB2A 2DFIA 1SMTA 2DPUA 2Y0MA 4KYWA 1FC3A 1EH7A 4KIBA 5LHIA 3I4PA 1XB4A 3RTRA 3RYPA 1SFUA 2A6EF 3E5QA 2IVMA 1S6LA 2VBXA 1KYWA 2XKPA 4B8XA 2OU2A 1KYZA 3DPLC 1R5HA 1HSTA 2JPBA 3C7JA 3KCCA 1O3RA 3DF8A 3MAJA 4CGZA 4UHTA 2KKOA 5K5RA 2L01A 2QWWA 4G9YA 4RB1A 3EQLF 1WSUA 3V7RA 1AWCA 4BHPA 2IPQX 4WWCA 1RNLA 3BJ6A 1WI9A 2JT1A 4CXFA 1P4AA 3HRUA 4IXAA 3JSOA 2RGVA 2UXNA 3TOAA 3D0SA 1OMIA 3TO6A 1W7PB 4R79A 2QZ8A 3WE2A 4IVNA 5L3CA 5TJJA 1I6XA 3D5LA 2O0YA 3BROA 3E6MA 4E70A 2O61A 2A68F 1SD7A 4OIRF 3R61A 2DAOA 4S05A 2HTSA 4I0AA 1XSVA 2RN7A 1S29A 3RJPA 3SQNA 5K1YA 1UCRA 4HX4A 5HDGA 4JQFA 2UXXA 1ONVA 4PGHA 1XMKA 3HTSB 2IP2A 1MJ9A 4XLNF 2MH9A 2ZNZA 3MQ0A 3C18A 3WTXC 3W6JB 3QOPA 2GA1A 4OIPF 2STWA 1SD4A 1I1GA 3F22A 2CQKA 2XKOA 2RVCA 4IRHA 2KRFA 3WODF 1IXCA 1FSEA 2FOKA 3BOQA 1G4DA 2V1DA 1QPMA 4UV9A 5HLHA 1JGSA 5CYVA 1V4RA 4EGZA 2HGCA 3NRVA 4UNOA 1MD0A 2FSWA 1BC8C 3RDIA 2VC1A 5BQTA 2MA3A 4A6DA 3T0YA 3S2WA 1IUYA 4HF1A 3MEXA 3HYIA 3HRSA 4L9JA 3G3ZA 3IWZA 2EK5A 3N97A 2IRFG 3FMSA 4L9TA 3ERED 4ENMA 4CDGA 4RB2C 3BZ6A 2OA4A 4ENNA 4KN4X 1J7KA 1KU3A 2W57A 2EFWA 3ZN1A 1XN7A 1FLIA 3MFKA 2VE9A 1RUOA 2P4WA 2V9VA 1E17A 3RPQA 2O6GE 4P9FA 2A5YB 5CVIA 2BE5F 1O3TA 5LRRA 1BIAA 2COMA 2NNYA 5L3FA 2GZWA 1TW2A 2FU4A 2FEZA 2JZYA 4XSXF 2KIFA 3CUQC 1BC7C 1S8NA 3KLNA 1FOKA 3TOBA 3VODA 3WTWC 3HIFA 2GWRA 3L2CA 4WF2A 5ICCA 2P7CB 1QGPA 1O7LA 2CW0F 3RYRA 3HRMA 1K7AA 3G73A 1Z1DA 3QP5A 5DYMA 2L3DA 3MWMA 1IN4A 3V4GA 1U3EM 2ETHA 3FF5A 2PMUA 1BI0A 1L3LA 3IWFA 3I59B 2L4MA 5J6XA 1K78B 2CWEA 5E18F 2Z3YA 3M8FA 3C3WA 1IN6A 3I0TA 3FX3A 4G7HF 4MGRA 2Q0OA 2STTA 5DCMB 3SHFA 2EA4A 2Y75A 2GA2A 3I5UA 1EV7A 4LD5A 1QZZA 3LWFA 3ML6A 1RUNA 1FBQA 4BAYA 2IT0A 3V8JA 4XBFA 3R6SA 2LDUA 2W24A 3GUDA 3I64A 3ABUA 1P2FA 1YYVA 1FP1D 2CG4A 2NRAC 3GFIA 1U5TC 4KA4A 1UB9A 1R1VA 2HKOA 3RI4A 1YQAA 4YFXF 3TGNA 2EV5A 4KN7X 3RIRA 5AONA 4MTDA 1SMYF 4I98B 3V8LA 2IJLA 4KNYA 1ZG5A 2P6TA 4IPAA 3FXQA 2A6HF 1H0MA 1F1ZA 2VOPA 1XDSA 1IN8A 5D6FA 3ZP5A 4A0YA 4S04A 1K78A 1ZREA 1SD5A 4EJUA 2GXBA 4N9IA 2NS0A 5HLIA 5L3BA 5DUIA 3C1DA 4RGRA 4AD9A 2XAJA 1CF7A 2KIUA 1P4WA 3M9AA 1MJAA 2D2WA 1O3SA 4LFUA 3RKWA 2A07F 1WQ2A 1YS6A 2VONA 5BPIA 4ESBA 4LG0B 3KP3A 1T38A 4KIFA 4WK8F 3SZTA 2DTRA 2F5FA 1S7OA 1YIOA 5DD4A 3TO9A 4OMYA 5BMZA 4UVAA 2P6SA 2FMYA 2LKPA 2QQAA 2D45A 2H6BA 3MZHA 3TO7A 1HW1A 3GW2A 4M6XA 3HHGA 3EDPA 2FBKA 2TDXA 1YTYA 5FO5A 2RNJA 3BJOA 2XHKA 3KZYA 2DT5A 4UVCA 1R36A 4I01A 1FPQA 3DXJF 2UZKA 4IHTA 2Y48A 4PCQA 3TQNA 1XGNA 3ECOA 4RGSA 1W7PA 3LAJA 4I02A 1LVAA 3ZMTA 3WU1B 4G6DA 3QU3A 4M72A 5KVRA 1USSA 4BHBA 5E1XA 1MZBA 3HSFA 3CO7C 5BS6A 3J81K 1IRFA 1CF7B 2PJPA 1XCBA 1PP8F 2YSRA 2HYGD 5EEGA 5DUKA 1ULYA 2XAFA 2L02A 4WXDA 1FZPB 1YG2A 4GXOA 2VT3A 1GHCA 1FSHA 4RAZA 1PP7U 3BJAA 2EFQA 1ZARA 1U2WA 2QBYA 2XIGA 2OQGA 1REPC 3FMRA 3F8NA 1BI1A 5CVJA 3KP6A 3H92A 4OU0A 5ICGA 1XDUA 4ASNA 2DI3A 4L9NA 5HOOA 3P9IA 2FBIA 3LFKA 1R5GA 3LAPA 1J2XA 2VC0A 4WXCA 4XSZF 3Q9VA 4Q4ZF 2CO5A 1HW2A 3E6CC 1TQIA 4GGGA 1XSDA 1XMAA 2HQRA 2HFHA 3F3XA 3KE2A 3WTTC 4RB0A 5IT9K 4BYYA 2O8XA 4NHJA 3HOTA 3K9TA 3O6BB 2VOOA 1CGPA 3ELKA 3IKVA 2PLYA 4EJWA 2P5LC 1IXRC 1OKRA 2Z9OA 1JXSA 3I53A 1BM9A 4M9ZA 2Z33A 3ZQ7A 4MTEA 3DP7A 2VN2A 2P8TA 4KMUX 5L3GA 2M87A 2VBWA 4M74A 5D6EA 2PFBA 2VODA 3F8MA 4TV7A 1ZGAA 3GO5A 3J7AO 2QUFA 2QBYB 4A0ZA 3ZMDA 4A2UA 5E8IA 3LSTA 2BV6A 3Q5FA 1VTNC 4L0YB 4EM1A 5ICFA 1T98A 4H0EA 5HS7A 3B02A 4PZJA 2XVCA 5DCFA 2YPRA 2DLLA 2XAQA 4ENKA 2EFPA 2M1BA 2W25A 1D3YA 1IZ1A 3HHHA 4EMSA 1FNNA 2A3SA 5D4SA 4L0ZB 3F23A 3MCZA 2V1XA 2DK8A 1L0OC 1D8KA 1R1TA 4WX9A 2H94A 2HKXA 2R3SA 1BBYA 4A0XA 2HDCA 2G9WA 2OAZA 5JR3A 3IC7A 3K1MA 1R00A 5E1ZB 3P9CA 2HZTA 2Q2EA 3JTGA 2VT2A 1LB2A 3I59A 1R1UA 2HQNA 2JSCA 1B6AA 4M6YA 3T5XA 4CO8A 4NQWA 4I09A 1KQ8A 4ZYDA 4LB5A 5HDKA 5D4RA 5DCMA 1IN5A 4RGUA 5L3EA 3ZMSA 1BN5A 5ICEA 3K1NA 1TNSA 1I5ZA 3I58A 4WXHA 2FE3A 4XLPF 2VBZA 5ED4A 2ESNA 2ZNYA 4LK0F 1U8RA 4FT8A 4L18B 1KU7A 3CDHA 3DV8A 1LJ9A 2DW4A 2Z99A 1DPRA 4B09A 3WGIA 5DEQA 1KU9A 5E17F 2J5OA 2MLGA 3KFWX 1TQMA 2ZMEA 3GFMA 3JAMK 2DQLA 1ZN2A 5HS8A 1XCVA 2FNPA 4A6EA 5A2QZ 1ZGJA 2D1VA 1KQ9A 2YU3A 4ZYGA 1DDNA 3GFJA 3PQJA 4A5NA 4PDKA 5H6QA 2BYVE 2FBHA 4CYDA 5H20A 1QZYA 5HVQC 2ELHA 4AIJA 2LNBA 4YFNF 2KJBA 2LF8A 1T2KA 2WV0A 3FXRA 4U7BA 4HF0A 2CGPA 3L7WA 4I7HA 4HV5A 1Q1HA 2K02A 4G94A 3ZPLA 4F7ZA 4ZYHA 4Q48A 3FM3A 4HBLA 4ZZDA 4U7DA 4CZZA 2FA5A 3WTZA 2QVOA 2DK5A 2IA2A 1U78A 1QBJA 1FWZA 3GZ6A 4KICA 3WU0A 2FQ3A 4N9HA 3GFLA 4HLXA 4OINF 4U88A 4LLNA 1YO5C 2H6CA 2EFOA 4LG0A 5H6RA 3JW4A 3CUQB 3P9KA 5HS9A 2R7FA 3V7SA 5JVTA 5E8GA 3QP6A 1SD6A 1HBXG 1LEBA 3T8TA 4HDVA 1HXDA 2BEOA 2ZMEB 5L3DA 4A5MA 4MNUA 1ZLJA 3PQKA 4XRFA 3QU6A 1MJBA 2RQPA 4AIKA 5CVRA 1JHFA 5D5UB 1P6RA 2J5PA 3V7CA 3HSRA 5D8LB 3GF2A 1ZG1A 2FF4A 1A04A 2FMLA 1V3FA 5LBQA 4R1HA 3JTHA 4LK1F 4KT5C 1PDNC 2HOEA 4HX8A 3J80K 2E7XA 4M73A 2AXLA 2M30A 3WG9A 5E1WA 3NEUA 1YFHA 3EETA 3CUOA 1LQ1A 2EFNA 1WRJA 1QO0D 2P5VA 3VB2A 1ZHFA 3K0LA 5KK1A 5J8CA 1RIOH 3E3VA 3R0AA 3VOEA 3EUHA 2M5WA 4BQAA 3CLOA 5F1RA 1ODDA 4EJOA 1H9GA 2GXGA 4ESFA 1TTYA 4G6QA 1EH6A 4OIQF 2XV4S 4HV6A 3OV8A 2XAHA 4GYGA 1FX7A 2O3FA 3CUQA 4UXNA 5HDNA 3ZN0A 1UHMA 3DEUA 4UV8A 3NQOA 1W4MA 1B1BA 3RKXA 2XROA
chains in the Genus database with same CATH superfamily
3IH4A 3S1NJ 3CO6C 2BHZA 3M7GA 4H4KC 1SFXA 2V26A 4HRIA 1I1SA 1LDDA 2ADUA 4B44A 1HKTA 3OYIA 3H0GJ 3E6BA 1V55H 2G7UA 4ETSA 1ZLKA 4A3FJ 1PUEE 3E5XA 3ABKH 3M3YJ 5EZHA 2R7SA 2NYXA 3WTSC 1JI8A 2LY2A 5C44J 4I2OA 2VE8A 4BDZA 3PNYA 4XNFA 4MHGA 5M3FJ 4E4HA 2QQBA 1O3QA 1UAAA 3WTYC 3BC8A 3WGHA 3H3UA 3K7AJ 3FM5A 5LHHA 3KZZA 2HS5A 2M9HA 4OOIA 1W5TA 2XPVA 1G3TA 2GM4A 4Y15A 4OMZA 6PAXA 1Y1VJ 3MMYB 4Z2YA 5CVVA 4LMYA 2A61A 1WJFA 2MGQA 3LSJA 2X0LA 3IP4B 2JQ7A 5JVGF 2EPFA 2IA0A 2K3PA 3LSKA 1JKOC 2H27A 2O9LA 1ZRDA 2CFXA 5GAHJ 2JA6J 1R4NB 1X1AA 4IRIA 5IYBJ 1ZH5A 4U0WA 5FGMA 2ZJRF 2QM3A 2DQRA 3CCMI 3TP0A 3WTUC 2XRNA 4MQVA 2ACJA 1G59A 1XG1A 3GTJJ 4DZPA 2KRCA 2MD0A 3I4MJ 4P9UA 2ICWG 1IRGA 1RC9A 2ME0A 1XS9A 2V1UA 2MC4A 5ILSA 3EYYA 2DA4A 2ZSHB 4HA8A 3A4CA 4V2FA 3RQIA 3S3MA 2WTEA 2KFDA 2MLKA 1R49A 4EGYA 4A3MJ 4U0VA 4NDLA 2L7KA 3LOCA 5FLVA 4EJTA 4HQMA 1YRNB 1J5YA 4RGXA 2LBFA 1FYKA 3I54A 3QYBA 4CYCA 4BNCA 5FLXK 3OYLA 3S14J 1K83J 5EG0A 2F5DA 3HZJA 2ZJPF 3JRGA 1H88C 4JOMA 5FFZA 2WAQA 4B48A 1KQ0A 2AO9A 5BNGA 4ESJA 3CDIA 4IOAF 3CJTB 1FBSA 2HQAA 4KUMA 4BU2A 2NVTJ 5J3LA 5DD8A 2PG4A 1DUXC 2CSOA 3U9GA 4ZJZA 5GTHC 1A31A 3FISA 4S0HB 1IF1A 1H8AC 1MH4A 3KETA 3BCBA 4YIFA 1D8JA 1ENHA 1OR7A 1VQOI 1QU3A 1G3SA 1ETKA 4OIOF 3BP8A 1S7AA 4GDFA 1USTA 3TDUC 1IRZA 1HDPA 3C2HA 3GXOA 2W1OA 3KP4A 2MG4A 1FYLA 1YOVB 3HM5A 2RV8A 3HRTA 3DBHB 1R23A 4QIWN 4YFKF 3GWZA 1NHAA 3IRRA 1LFBA 3FZVA 3AG3H 3R60A 1GVJA 1HA8A 3DEEA 5FLXZ 5LHGA 3SFZA 2UV1A 4C30A 3IL2A 2QSGX 5B5EC 3VEPA 4C3JJ 2BY2A 3L2RA 3J80Z 1XGOA 3GX4X 4A3CJ 1P4XA 4LLGF 1T6SA 1RZ4A 1UG0A 1XC5A 1F4KA 1F5TA 5CPRB 3I4NJ 2I10A 4HOBA 3KP7A 4C2TA 3BG9A 2OZ6A 2K5CA 4Y13A 1MBGA 2RDPA 1G3WA 1OCPA 2LSOA 2R7DA 4XOTA 3CP2A 2K3FA 5GAGJ 5D5XB 2LF7A 5LFAA 1DPUA 3SZPA 2HWVA 4XKCA 1ZYRF 2L7ZA 1WPKA 3K69A 1ON1A 5J8FA 3IUOA 2IW5A 3OL4A 1QQIA 4E6KG 3FXJA 2WY7Q 3EUAA 2CMPA 5M3MJ 1AU7A 5J4VA 1JHHA 3PSIA 3GLXA 2XF5A 1YI2I 2ZMEC 4RS8A 3K2ZA 5FKNA 4LLLA 2XB5A 4E7HA 3WGGA 5F6FA 5LLQA 3FKIJ 3QAHA 2M8EA 1D0ZA 4ZYEA 4HW0A 3ONQA 4Q47A 3U1DA 5HLGA 2E1MB 3DFGA 2D1HA 1NG6A 2L5QA 2EV6A 1DP7P 4P55A 2A05A 3GZNB 1BI2A 3O8GA 3KLOA 2DBBA 4I99C 4M9SA 4XR6A 3SJMA 5J1UA 3ISPA 3LQQA 1HDDC 3VWBA 3JRBA 4CCNA 3GYHX 1AKHB 1YW9A 3REOA 2QGUA 2OCEA 2WV1A 5EGOB 2KL4A 3BTJA 1OPCA 1WH5A 3NARA 4HSRA 1Z0XA 2HQ5A 1XGSA 3GZ5A 2WBMA 4LJZF 2LKXA 1FYMA 3F8CA 4QLCU 2CV0A 2MD5A 1HQCA 2PQ8A 4DYRA 3F6VA 4A3EJ 3ESWB 2M4GA 1B9NA 2OZUA 2LY1A 1UMQA 3QPHA 2CV1A 3H3ZA 2RREA 4O3MA 4MIMA 2KHMA 1ZRFA 4FQGA 5LGTA 2K4JA 4F91B 1IDYA 1TWHJ 3R4KA 2WC2A 2Y30A 1S9HA 2BZTA 4RAYA 4BHCA 4HDUA 3CC4I 4JX4A 4V2GA 3JRCA 1MBJA 2AXTC 4KDPA 3S17J 4FASD 1WZ2A 4U87A 4EQQA 5HLTA 1SEUA 1FOXA 2EB7A 2DO7A 4Y33A 1WJCA 3FK7A 4HEA2 5LD2C 3DBLB 3HSEA 4XN3A 4BDYA 2Y0SN 3S8PA 4B3XA 3IKTA 1YX3A 2H8RA 2E1OA 3D5RC 1SC7A 1ETYA 1WKMA 5IY5H 1UHWA 2QENA 1MMAA 1YITI 2V9KA 2ZJQF 2ZBKA 2ZXIA 2QQ9A 4BJ6C 1E2XA 1W36C 2DJNA 5FJ8J 4PJNA 1K6OA 4CHUA 4FX0A 2XAGA 1HKQA 3AAFA 2KDOA 1G8XA 5BPDA 4LGWA 3I71A 1T8IA 3HPHA 2IS4A 1XTAA 3F21A 1OCCH 2A5WA 5CVUA 4XRSG 4NC7A 3KP5A 2R5ZA 2CQXA 2BVMA 2XASA 4Y4RA 2FX0A 3UR3C 4HLYA 2HOSA 4EM0B 2HVSA 2WB1N 3QRFF 2HOAA 1Y8RB 2IGNA 4F93B 2DYRH 3BTCA 3SEZA 3K10A 5DTDA 2P81A 3LA7A 2OBPA 3E97A 3VYRB 2VJIA 5D5WB 4Y17A 3F6OA 3F8FA 4PFPA 2F4IA 2NXNB 3FK6A 3LSRA 2CS3A 3L09A 2O8KA 3LSIA 1OR7C 5LEKA 3CDLA 3FXMA 4FISA 5ERIA 3Q0WA 4I0BA 2RC4A 4X0GA 1KZHA 4L5JA 3DQVC 4MQ9F 4HQEA 2W84A 1LDKB 1IN7A 1KU2A 5HNHA 1EA3A 2L7MP 3LL7A 2Z5UA 2RKHA 4D0PA 3M1EA 2E60A 2I8DA 4LB6B 2X4HA 1J09A 3E5UA 2DA5A 4GCVA 4IEJA 5K5OA 2R7OA 4AYBN 4RA2A 4O5VA 1ZKGA 3OOUA 4EV0A 3E6DA 5E79C 3CCVI 3AL0B 4BXXJ 4GYIA 1OLTA 1ZQ3P 3CCSI 2JRTA 2ZKZA 1BJZA 3HJEA 3OWTA 4W1UA 2QKLB 3FXLA 2GIVA 4HNUA 3CQZJ 2JJ7A 2EA2A 1U6GA 5AIQA 3FXUA 1OCRH 2B63J 3KZIC 2K7LA 3J7YJ 2CYYA 4M3BA 2BXZA 1MDMA 1UJ8A 1IUFA 1TBXA 3IH3A 2HEOA 2K9LA 3WE3A 2MSYA 1J59A 1R5ID 3HEFA 2F5CA 4FE4A 3QPLA 5B1AH 1Y1WJ 4KMFA 3J7AY 2ISYA 3DKYA 3H1CA 4HAMA 2ID6A 4YIIA 1C0WA 4A12A 1S3JA 1TLHB 2L9VA 3N4MA 3W2VA 2FNAA 1W0TA 3JRIA 1RR7A 1BOAA 3FKJA 4BY7J 2F4OB 2PN6A 3OYHA 3HPGA 4C3HJ 3RKYA 1NK3P 2W85A 4GFBA 2L4AA 5IP6A 3P7NA 3E0JB 1UELB 1BI3A 1J0RA 3COAC 1G3YA 3MKLA 3CC2I 2ZO4A 2LOOA 3K4KA 2HTJA 2ISZA 3DKWA 2GBYA 1VF9A 4HZFA 2L7FP 2V9PA 2B7EA 2ZXHA 2DMTA 4J19A 3KX2A 1V5EA 1SFKA 1VQ8I 4G7OF 3K1PA 4D7MA 3TEDA 4AVPA 4KISA 4CCLA 1YLFA 1H89C 1AOYA 1BIBA 2YUSA 2BGCA 2JSPA 1FIPA 2QYOA 5IT3A 1O7FA 1R22A 2W48A 3IH2A 4DNCA 2R7ZJ 2GAUA 4M9XA 4CUGA 3J7ZI 1MW7A 2QEXI 3O2PE 1RESA 2HR3A 2BBYA 4Y3OA 2K4BA 3V42A 3FHZA 4IJAA 3CTAA 3WHBA 1HSJA 1ON2A 1YJNI 3OSGA 1MGTA 4MEYF 1STZA 4PGGA 2NVXJ 1ZAOA 3ZOBA 4BXUA 4ENJA 2YX7A 3BZCA 2ECCA 5FLMJ 5FD5A 1YW7A 2K27A 4BGDA 2GIZA 3EYIA 1VQ9I 3G1LA 3LSGA 1KA8A 1BOBA 1MNEA 4CZCA 1Z6RA 3LQRA 3A0HC 3U2RA 2XGXA 3HOSA 1FOYA 4MFDA 2Q8KA 5BOXA 5A2QK 1IG7A 1FIAA 2A69F 4N0BA 4M3GA 2E7WA 1BW6A 3IHUA 3QYFA 3ULQB 4AWXB 5B3SH 1W7PD 4ZH4F 4WCGA 2LMDA 5EEHA 2C6YA 1W1WE 2JPCA 2KJCA 3LA3A 2M2EA 1GV2A 2FXAA 1XSXA 3WTVC 2DPDA 2NVYJ 3M07A 5J4YA 1T39A 3C2BA 2AS5F 1MDMB 3FXKA 5EDNA 4IF4A 4XLAA 1Z7UA 2B0LA 3PIPF 1SVLA 2ZJ2A 5AIPA 5HODA 1R7JA 5FROA 2LTPA 4XKWA 1TT5B 2X6WA 5JHUA 3PFIA 4YEJA 3GTKJ 4L5IA 1GXPA 2WAEA 4B3AA 4C2MJ 5FD6A 3OYFA 4J01A 4XQFA 4AIHA 3DLLF 3S1MJ 1MBFA 1E3HA 3R0JA 1BJAA 1X19A 1X3ZB 2F48A 5KNLA 3O3KA 1PUFB 4MEXF 1XX5A 1XGMA 3L00A 4IRGA 5FFXA 4HF2A 5LEJA 1LUJB 2VXDA 2JVGA 2DA3A 3BR3A 4CICA 2XGEA 2CU7A 1T56A 1IW7F 1X58A 2IS6A 5EYRA 1WJDA 2PMHA 3A0BC 3F8BA 3G1MA 3H3VK 2FRHA 2EV0A 2YR2A 1LFPA 1FOWA 5D8KB 5LGNA 1LKXA 5KAFC 5F04A 2HU9A 3S32A 2ZXWH 2CQ7A 1T95A 4IQ4A 2R7RA 2Q1ZB 2XSJC 2OQRA 4BJTA 1RI7A 2F5VA 3BY6A 1YE9A 2P5KA 3K4JA 4GO1A 1N75A 3TBIA 2CQQA 2AQFA 1O57A 4X1EA 3Q9SA 3BWGA 3FMQA 3CJNA 5E3LA 5J47A 3OYEA 2ZCWA 1ETQA 4QPQA 2BY1A 2LBFB 5F27A 2MFZA 4G7ZF 1FJLA 2O7OA 4XRSA 2KPMA 1LVKA 5E3NA 2E1CA 4A69C 4PSWA 4XK4A 2IAIA 2PBIA 5C3EJ 4KIGA 2ESHA 4NB5A 2GQQA 1U5TA 2VIXA 2KZGA 3LA2A 1HW5A 2WWYA 5CKTA 3GMEA 1WH7A 3KEQA 3SFIA 1FP2A 3OOPA 2V6CA 3J81Z 3KP2A 2X85A 2DU9A 2P7VB 3L1PA 2E2JJ 2V6EA 1HC8A 1HKSA 3Q0VA 2X1CA 5CLSA 3F72A 1UZCA 2R7VA 4W97A 5K7ZA 4ON0A 1OQYA 2NVUB 3JAMZ 5DDGA 3IRQA 4HYEA 4K2EA 2MABA 3OYMA 5DV5A 4KFCA 1IDZA 1D5VA 3B73A 3OYBA 5LRSA 4M6VA 3ZXSA 1RR8C 2XF7A 1F9NA 3W6KB 1D0XA 3S1RJ 1OYIA 3LMMA 4IO9F 1ZRCA 4HNTA 3M8EA 3W6VA 1R4MB 2WY8Q 2DTZA 1MSEC 2JWTA 1PUFA 1MH3A 2LVSA 1Z05A 1FY7A 2ZFWA 1SAXA 3HTUA 3A02A 4RAFA 3RPUA 2E1NA 2PEXA 1X4OA 5H2FC 2V1NA 4BBRJ 3N05A 2LD5A 3A2KA 2L54A 1TNTA 4L5EA 4A3KJ 3SXYA 1NTCA 2Z1DA 3BR5A 2CV2A 3DPUA 2DOEA 4IL6C 2CFOA 2ZXJA 1UFMA 3OIOA 1OYYA 2HZDA 2HYFA 2KIMA 5FRMA 1S5LC 1QZEA 3DPTA 4UY8I 3JSPA 3BDDA 4G8XA 3AKZA 2FQ4A 4YG2F 1J9IA 2M45A 1U9NA 1JUSA 4IHSA 4D5CA 2VBYA 4ANJA 1EH8A 2XC7A 2F5EA 4FTHA 2CJJA 4P5OA 1W5SA 3ZMUA 2EILH 4RB3C 4UUVA 5E20A 3AL0C 3BQYA 4ZZLA 1LEAA 4NBQA 5LGUA 2PMZA 1I27A 5ILVA 3RZDJ 4MFEA 3S1QJ 2NNNA 4P96A 3HUGA 1D0YA 1Z91A 4JBAA 4U0YA 1AKHA 2ECBA 1P7JA 1U5TB 3GVAA 3T1BA 2K9MA 5EGOA 4R8HA 3OYJA 2G7HA 1XPXA 1F36A 1TQPA 1R58A 5K5QA 3DEWA 2NAZA 4NC8A 4XIDA 2CW7A 5ILUA 2W82A 4A3DJ 1FT9A 4QWQA 1CQTA 3QPTA 3H9QA 5F0CA 4CCKA 4EVIA 4M71A 1B9MA 3TKYA 5FKLA 4BE0A 2EZHA 2LH9A 3P5JA 3T8RA 2V79A 1DU0A 1J75A 1SFOJ 2IA1A 4EM2A 1G6NA 3M1CA 4L9VA 2VXZA 2MBFA 1EKEA 2GLOA 3BPVA 3ZQQA 1WWXA 2Y69H 5F64A 4RLFA 4B43A 2NS7A 5GADJ 3AG1H 4O6JA 1ZG3A 1MKMA 3HGYA 3GEZA 2L9SA 3IAM2 5JI6A 2EJRA 1VQ7I 1H9TA 3L9FA 2GXAA 1Z9CA 5CJ9A 5F1JA 2JTVA 3HBLA 1B59A 2MC3A 4A3LJ 1LDJA 1IV6A 4Z6YA 3HDDA 2VKDA 2JMWA 1DGRM 1JTYA 4BQQA 3VFZA 1KGSA 2UWMA 2M7BA 3PFYA 4KT6A 3VSLA 1P92A 3V8KA 5TRDA 2E35A 1GXQA 2R5ZB 2MH2A 4FETA 2EZIA 1VQKI 3OY9A 4FX4A 4FHTA 1X3UA 1B4AA 2K86A 4QPOA 3F0CA 3MKWB 1TW3A 4ITVA 3ROUA 1JE8A 1Z6TA 2O03A 3GBGA 5D5VB 2XSDC 1JKQC 4HX7A 1Y0UA 1IXSB 2PI0A 3BPXA 1IAWA 2M8GX 2DCEA 3KEOA 1LNWA 5JFRA 2K85A 2HPMA 3FWEA 5IT9Z 1QNTA 3NWSA 4UVBA 3CC7I 4RAGA 2TRTA 2M34A 2YX4A 4DQ2A 4BE1A 3ECHA 2DJIA 4EJVA 3TDZC 2R7WA 3ZMZA 3MZYA 2R7XA 1K79A 1W36D 2X6OA 1N77A 1XD7A 1DQUA 4UB6C 2F2EA 2VASA 4DW6A 2EWNA 1OYWA 2OD5A 1RRJA 4BH9A 2K9NA 1SFEA 2LR8A 4Q5SF 1T0FA 1YW8A 2M4KA 2HVRA 2QLZA 3ZMVA 2XRLA 2H09A 2XUBA 4HPQA 3VPRA 1YS7A 4PJ0C 3ABTA 3BLYA 4JK1X 1FBUA 5FB2A 2DFIA 4QSHA 3G6EI 2YS9A 1SMTA 2JA2A 2R4GA 2Y0MA 2DPUA 4KYWA 3LSPA 2FD5A 1FC3A 3OR2C 1JTXA 1EH7A 4KIBA 5LHIA 2E2IJ 3EUKL 3ZQHA 3I4PA 1XB4A 3RTRA 3RYPA 1SFUA 2A6EF 3E5QA 2IVMA 3MZ8A 2VBXA 1S6LA 3VYTB 1KYWA 4XORA 2XKPA 4B8XA 1Y6IA 2OU2A 1KYZA 4E7KA 3DPLC 4OAZA 3CCRI 1R5HA 1HSTA 3B6AA 2JPBA 3C7JA 3KCCA 4RMNA 1O3RA 1OFCX 4IZZA 3DF8A 3MAJA 4CGZA 4UHTA 2KKOA 5K5RA 3WG7H 2L01A 2QWWA 4G9YA 4RB1A 2H8WA 4GRIA 4NUBA 3EQLF 4PSXA 4V19K 2KIQA 1WSUA 3V7RA 1AWCA 3FBIB 4N4OB 4BHPA 2UUZA 3BR1A 2IBDA 2VL8A 2RAEA 5B66C 3GTQJ 2IPQX 4WWCA 1RNLA 2KDZA 3BJ6A 1WI9A 2JT1A 4CXFA 1X1DA 1P4AA 3HRUA 2DYSH 4IXAA 3JSOA 1GDTA 2RGVA 2BW3B 2OCCH 2UXNA 1NH3A 4YELA 3TOAA 2PMZN 3D0SA 2OTJI 2VKEA 1OMIA 3OS0A 3G71I 3TO6A 1W7PB 1MIJA 4R79A 3DTIA 2QZ8A 4RM2A 3WE2A 4IVNA 2FUG2 2LRDA 3CJRB 2R7UA 5L3CA 2IGKA 1I6XA 5TJJA 3D5LA 1V54H 2JK3A 2O0YA 3BROA 3VSKA 3U21A 3BG6A 3E6MA 4E70A 3I9V2 2O61A 4C2UA 3S15J 2E71A 1HCRA 2A68F 1SD7A 2JA7J 4OIRF 3R61A 2DAOA 4XLFA 3PO3J 4S05A 2VJ4A 4D5FA 2HTSA 5FKKA 4XICA 3OIPA 1IRXA 4I0AA 1XSVA 1SVOA 4BACA 2N8GA 1OCTC 3PSFA 2KP6A 2RN7A 1YX5A 1S29A 2DN0A 2E5ZA 5KCMA 3RJPA 3SQNA 2X1EA 3ZQLA 3H9JA 1WJEA 1V5GA 5K1YA 2FJ1A 1UCRA 2ID3A 4HX4A 5JLXA 1JKRC 3OYKA 5HDGA 4M3EA 4JQFA 4PJLA 2UXXA 3TMOA 1ONVA 4PGHA 1XMKA 3HTSB 2IP2A 1MJ9A 4XLNF 2VQCA 2MH9A 4LOCA 2ZNZA 3GLLA 3MQ0A 4DBQA 3U1KA 5EZGA 2NOGA 3C18A 4JYKA 3ASNH 2JRMA 3WTXC 4BQOA 3RCOA 3QOPA 1Z3YA 3W6JB 2X48A 2GA1A 4OIPF 2STWA 1SD4A 3CCUI 1I1GA 3F22A 4LIVA 3DWLE 4F92B 2CQKA 2XKOA 2RVCA 4C9YA 1APLC 4II2A 4IRHA 2KRFA 2WA0A 3WODF 1IXCA 1FSEA 2FOKA 3BOQA 3FHNA 2V1DA 1U8BA 1G4DA 1QPMA 1ACIA 4PK4A 4UV9A 2DFFA 5HLHA 5IYCJ 1JGSA 5CYVA 2HPIA 1V4RA 1MMGA 4EGZA 2HGCA 3OYAA 3NRVA 4UNOA 1MD0A 2Z2SB 3M8JA 1AA7A 1TL8A 2FSWA 1BC8C 1A6QA 3RDIA 1O4XA 2IGOA 2VC1A 3B6CA 5BQTA 2MA3A 4A6DA 2BW3A 3VYSB 4D9JA 1X2MA 3T0YA 3S2WA 1IUYA 4HF1A 3QQAA 1GLNA 3OMYA 3MEXA 1Y8QB 2W4SA 3HYIA 3S3NA 3HRSA 4L9JA 3G3ZA 2LP0A 3FXOA 3IWZA 4XN0A 2EK5A 3H5RA 1YJ9I 2JVHA 1BR2A 3N97A 2HI3A 3FMSA 2G0EA 4L9TA 4XLEA 3ERED 2IRFG 1W5CC 4D7NA 4ENMA 2PJRB 3AG2H 4CDGA 5FRNA 4RB2C 3BZ6A 4NNJA 2OA4A 1U0JA 4ENNA 2JA5J 4LITA 3DKXA 4KN4X 1PJRA 1QVUA 3HKZA 1A36A 1J7KA 1KU3A 2W57A 3PL8A 2EFWA 2BHYA 3ZN1A 1XN7A 5K7FA 3GCMA 3FIWA 4PJMA 1FLIA 3UKGA 3I56I 5JLWA 3MFKA 2VE9A 1EJ9A 1Y0NA 1SANA 1E3OC 1RUOA 2P4WA 2E2HJ 2V9VA 1E17A 3RPQA 2O6GE 1ETXA 4HG2A 4P9FA 2A5YB 5CVIA 1NK2P 3S93A 2BE5F 1O3TA 5TGTA 5LRRA 4AC0A 1BIAA 2COMA 5K7HA 3PIOF 1JJ6C 2BVLA 2NNYA 2M3AA 1WFXA 5L3FA 1D1AA 2GZWA 2KISA 2MW8A 1TW2A 2FU4A 2FEZA 2JZYA 4XSXF 2KIFA 3NWTA 3CUQC 2VPLA 1BC7C 1WJAA 3BTLA 2L2OA 4B47A 1S8NA 3KLNA 4PFOA 4BKXA 3JRHA 4IX7A 1FOKA 3TOBA 2W7NA 4XRMA 3MKZA 2DA1A 4MLOA 4YIRX 3VODA 1VNDA 4QTRA 4E7ZA 3WTWC 3OYGA 2VI6A 2XGCA 3HIFA 3PUBA 2GWRA 3L2CA 3HOUJ 1VZ0A 4WF2A 3L2VA 3BG3A 2R5YB 5ICCA 3FDYA 1QGPA 2P7CB 4HSTA 1O7LA 1OCZH 3DBRB 1SAUA 2CW0F 3A01B 2XB0X 3RYRA 2CUFA 3HRMA 1VFCA 1K7AA 4ZDPA 3G73A 1Z1DA 1IO2A 3QP5A 2JUCA 4FCYA 1MNDA 2F4MB 3H9GA 5DYMA 1KONA 2L3DA 2R7QA 1MSFC 3MWMA 1IN4A 3HC7A 1MMNA 3ZQIA 3V4GA 1TT0A 4PUSA 1U3EM 2Q2EB 1VI0A 2ETHA 2DA7A 3FF5A 2PMUA 3OS2A 1BI0A 1L3LA 2M7AA 3PUFA 3IWFA 3I59B 2L4MA 2HXIA 5J6XA 1K78B 3BR6A 1Y56A 1B72B 1T33A 2IGMA 3CF2A 4CA0A 2CWEA 2D5VA 5E18F 4DIQA 5EEAA 5F0FA 2Z3YA 2W00A 1XMXA 3UNGC 3JRDA 3M8FA 5FKOA 3C3WA 1IN6A 3I0TA 3FX3A 2KRHA 1S7EA 3Q3SA 4G7HF 1UHSA 5J40A 3HUGB 4MGRA 3ZGKA 2KLOA 3CP8A 1FEXA 2Q0OA 3JRAA 2STTA 1OISA 5DCMB 3SHFA 3DTEA 2EA4A 2Y75A 1ZELA 2GA2A 3I5UA 1EV7A 4N4NB 4BBSJ 4LD5A 3DLAA 3ZQGA 2CUZA 1QZZA 2VUMJ 3A03A 3LWFA 3ML6A 3G2BA 2O5RA 3RQ4A 3JREA 4IHVA 2X1DA 1RUNA 3BG7A 2Y9YA 1FBQA 4BAYA 2IT0A 2CUJA 3CZ6A 3V8JA 3K4CA 2QF7A 3W2AA 4XBFA 2OJED 1ZR4A 3R6SA 2LDUA 2W24A 3GUDA 3I64A 4ABZA 5TISC 3KYCB 1R9TJ 5J1YA 4M3FA 3CCJI 1PYVA 3ABUA 1P2FA 1YYVA 1FP1D 2CG4A 2NRAC 1I6HJ 3GFIA 1U5TC 4A3IJ 4RDUA 4KA4A 1GT0C 1UB9A 1R1VA 2HKOA 2E5NA 3RI4A 1YQAA 4BE2A 4YFXF 3TGNA 4CCOA 2EV5A 4KN7X 3RIRA 2DDBA 5AONA 2R5YA 2CRGA 4MTDA 1F43A 1SMYF 4I98B 3OYCA 3V8LA 1ZR2A 3BCAA 3O8HA 2IJLA 4KNYA 2LYCA 4MO7A 1ZG5A 2A6TA 1QA6A 3NAUA 2P6TA 3DTKA 4KJZA 4IPAA 3FXQA 1S72I 4JX5A 2A6HF 3MVPA 4RBOA 2OV7A 1H0MA 1F1ZA 1TWAJ 4BUPA 3BR2A 2VOPA 1XDSA 1IN8A 5D6FA 3TW7A 3K70D 3ZP5A 1HOMA 1GUUA 4G12A 4A0YA 2JN6A 4S04A 1LFUP 1K78A 1ZREA 1SD5A 2X6XA 5JHFA 4DYQA 3CMMA 1B72A 1FTZA 4EJUA 3RSNA 3CLQA 3CCLI 1BW5A 2GXBA 2DA6A 2K9SA 3QPSA 1WJ5A 4N9IA 2NS0A 1IGNA 3K4BA 4IQJA 5HLIA 5L3BA 1X2NA 2DODA 5DUIA 2VQHA 3C1DA 4RGRA 4AD9A 2XAJA 2E36A 1CF7A 3PJRA 2KIUA 2E19A 1T0FC 1MMSA 1P4WA 3M9AA 1MJAA 3MD2A 2D2WA 3GTGJ 1O3SA 1U9OA 3HOVJ 1BR4A 1Y39A 4LFUA 1TP4A 1V5FA 1IV8A 1X4PA 1BR1A 3RKWA 2A07F 4F52A 1WQ2A 1YS6A 3W2WA 2VONA 5BPIA 4ESBA 4LG0B 3KP3A 3LNQA 5C4JJ 2L0KA 1JUMA 5IP7J 1T38A 2IS2A 4KIFA 1HLVA 2R0QC 1B8IB 4WK8F 3SZTA 1A6IA 2DTRA 2F5FA 1S7OA 1YIOA 5DD4A 3PNVA 2VKVA 3TO9A 4P1WA 4OMYA 5BMZA 2LFBA 4UVAA 2P6SA 2FMYA 3HOYJ 2LKPA 2QQAA 2EQRA 2D45A 2H6BA 2QSFX 4YRVA 3MZHA 3TO7A 1HW1A 3GW2A 4M6XA 3H0DA 4OWRB 3HHGA 5EF6A 2H1KA 3EDPA 4BQNA 2FBKA 4E7LA 2CQNA 3CD6I 1K4SA 2TDXA 3KYDB 2QQ8A 3JCUC 1K4TA 1TC3C 1YTYA 5FO5A 1YHQI 1QPIA 2RNJA 3KIOA 1A5JA 3BJOA 5KHDA 5J1RA 2XHKA 3KZYA 3AG4H 2DMPA 2WB1A 3OIQA 2DT5A 4UVCA 1WJBA 2XGDA 2V4JC 2M0CA 2K40A 1R36A 4I01A 1FPQA 3DXJF 2UZKA 3ASOH 4IHTA 2Y48A 4PCQA 3TQNA 1XGNA 1R6RA 2QCOA 3ECOA 4RGSA 1W7PA 2F6CA 1DU6A 2DOFA 1FMVA 3LAJA 4I02A 1LVAA 3ZMTA 4AIDA 1X1BA 2VKHA 3WU1B 3VYUB 5HNFA 4G6DA 5M5YJ 2LREA 3CF5F 2R92J 4II3A 3QU3A 1POGA 4IHYA 2XF6A 4M72A 2VQLA 5KVRA 1WCMJ 1USSA 1ZK8A 2XAUA 3MKYB 4BHBA 5E1XA 3OYDA 1MZBA 3HSFA 3CO7C 3PM1A 2OF7A 4XOPA 5BS6A 4BEHA 3J81K 3H5NA 1IRFA 1CF7B 1DP3A 2PJPA 1XCBA 2BXYA 1PP8F 2HVQA 2YSRA 3IV5A 5FKMA 4XMYA 2HYGD 5EEGA 1I3QJ 2P0WA 5DUKA 5IP9J 2LG4A 1ULYA 2EZKA 2XAFA 2L02A 4WXDA 4XONA 1FZPB 2VB6A 4DOZA 4X6AJ 1YIJI 1YG2A 1LE8A 3K70C 1BA5A 1VQMI 4GXOA 2HOTA 3SEQA 3HOZJ 1OCOH 2VT3A 1GHCA 4BXFA 1FSHA 4RAZA 1PP7U 3BJAA 2DMQA 1B8IA 3HKZN 4IOCF 2EFQA 3S3OA 4E7SA 1ZARA 1U2WA 2QBYA 2XIGA 2OQGA 5IOYA 1I3AA 2PX9A 1REPC 4XLHA 1JJ8C 3OS1A 3FMRA 3L2WA 1TWFJ 3F8NA 5GPAA 4DZJA 3ERMA 2COBA 1BI1A 5CVJA 1WHUA 1IC8A 3KP6A 3H92A 4OU0A 5ICGA 2DT7B 1VQLI 1XDUA 4ASNA 2DI3A 4L9NA 4BS9A 5HOOA 1ERDA 3I3LA 3P9IA 2FBIA 3HOXJ 3LFKA 2IEKA 4E7IA 1R5GA 3LAPA 1J2XA 2VC0A 4WXCA 2Y2ZA 3EPZA 3Q9VA 4XSZF 5IOZA 4Q4ZF 2CO5A 4AYBA 1HW2A 3E6CC 1Z67A 1QVTA 1TQIA 3CMYA 1AHDP 4GGGA 4F55A 4HNVA 4UUSB 2XDVA 3HOWJ 3H35A 1XSDA 1XMAA 2VJ5A 4DBRA 3RZOJ 2HQRA 4LG3A 1LPQA 2HFHA 1JT0A 3LFUA 3F3XA 3KE2A 3WTTC 1I39A 4RB0A 2L9RA 5IT9K 2DDAA 1FTTA 4BYYA 2IXSA 2O8XA 3HG9A 3K2AA 4NHJA 3HOTA 3K9TA 1N78A 9ANTA 3O6BB 1E0EA 2DMUA 1Z77A 4BL0B 2VOOA 1D1CA 1CGPA 4A3BJ 2KZVA 3ELKA 3IKVA 2PJRA 4XM3A 2PLYA 4EJWA 1N25A 1BL0A 2I5UA 2P5LC 1IXRC 1OKRA 1IJWC 2Z9OA 1T08B 1JXSA 3SDGA 3I53A 4D1QA 1BM9A 4AU7A 4BJ5C 4M9ZA 2Z33A 4AVZA 3ZQ7A 1D5YA 4MTEA 2CUEA 3DP7A 4F3QA 2VN2A 2P8TA 4KMUX 5IYDJ 1OJLA 4ZDLA 1A35A 5L3GA 2M87A 2VBWA 2H1LA 3H5AA 4M74A 5D6EA 2X6YA 2PFBA 2VODA 1GV5A 3F8MA 4IKFA 2DFEA 4TV7A 1ZGAA 1JKPC 1ETWA 3GO5A 3J7AO 2QUFA 5CQEA 4A0ZA 1TZLA 3QYEA 2QBYB 2IS1A 3X2QH 3ZMDA 4A2UA 3LSTA 5E8IA 2YU9J 2BV6A 3Q5FA 1VTNC 4L0YB 3JRFA 4EM1A 5ICFA 3EUHC 1T98A 5DM6F 4H0EA 1TWCJ 2BY3A 3IAS2 2ZSIB 5HS7A 3B02A 2WAQN 2BOLA 4PZJA 3CCQI 5GTIC 2XVCA 2BY0A 5DCFA 2HXOA 2YPRA 2DLLA 2K9QA 2XAQA 1QHHD 1MMDA 3CMAI 2EINH 2HNHA 5DM7F 4A93J 4ENKA 2EFPA 1Z3XA 2FOWA 2M1BA 2W25A 1D3YA 3D5SC 1IZ1A 1DGWY 3HHHA 1EF4A 2LK2A 2KMUA 1FNNA 2A3SA 5D4SA 4EMSA 4L0ZB 3F23A 3H36A 5F08A 3MCZA 2OUMA 2V1XA 2DK8A 4UUSA 4NC6A 1L0OC 1D8KA 1R1TA 4WX9A 3A01A 2H94A 2HKXA 2R3SA 3ABMH 3F9KA 4XKBA 3CJQB 2KQRA 1BBYA 4A0XA 4G6TB 4B4CA 3OR1C 1Q1VA 2HDCA 2CH0A 2G9WA 1K6YA 1ZTRA 2OAZA 3BTIA 5JR3A 3L2QA 4BY1J 3K4MA 3IC7A 3KEYA 3K1MA 1R00A 5E1ZB 2LLKA 3ZRGA 3P9CA 2HZTA 2Q2EA 3JTGA 2VT2A 1LB2A 5GPCA 3I59A 3BG5A 1R1UA 2HQNA 2JSCA 1B6AA 4M6YA 5GP9A 3T5XA 4B1RA 3CCYA 4CO8A 5E3MA 4NQWA 3W3CA 3E7LA 5B1BH 1D1BA 3GTPJ 2M0MA 3GTMJ 1JT6A 1Z21A 3K4LA 2EBIA 4I09A 1ETVA 2CW8A 3HXLA 4DGWB 3ZR8X 2VQGA 1KQ8A 4AM3A 4ZYDA 2LKSA 3Q0UA 4LB5A 5HDKA 5D4RA 4Y7NJ 4JX6A 5EJCA 2Y31A 5DCMA 1IN5A 3BZKA 4RGUA 2LC2A 5L3EA 3OL3A 1BN5A 3ZMSA 3K1NA 5ICEA 1ORKA 1TNSA 1I5ZA 3I58A 2Z16A 4WXHA 2FE3A 4XLPF 1R71A 5M5XJ 2VBZA 3PO2J 5ED4A 2ESNA 3BT9A 2ZNYA 4LK0F 1U8RA 3GTLJ 4FT8A 1YJWI 3HB9A 5C4XJ 4L18B 1WVRA 1KU7A 3CDHA 3DV8A 2TCTA 4AUXA 1WGXA 2VLAA 1LJ9A 4UUTA 3QOEA 2VJJA 2DW4A 2ME6A 3ZQCA 2Z99A 1DPRA 5E3OA 1ETOA 4B09A 3WGIA 5DEQA 5DS9A 2RNGA 2WAFA 1JGGA 4ZTFA 1KU9A 1QRYA 5E17F 3ZCOA 3FBNB 2J5OA 2MLGA 3K4NA 3KFWX 1TQMA 2ZMEA 3WU2C 3GFMA 4EEFG 5CQGA 2DQLA 1ZN2A 3JAMK 3HL2A 5HS8A 4JP0A 2DFHA 2JA8J 1XCVA 3SYTA 1VQ4I 1FMWA 2FNPA 4A6EA 5A2QZ 1PVEA 1ZGJA 2D1VA 2XPWA 1KQ9A 2YU3A 4ZYGA 1DDNA 3GFJA 3PQJA 3DU6A 4A5NA 1ITYA 4IHXA 4PDKA 1MBHA 5H6QA 2BYVE 4DYCA 4ZTJA 3VDXA 2FBHA 3ZQFA 2HDDA 4ZYAA 1VQ6I 2WADA 4DJAA 4CYDA 5H20A 1QZYA 2EZLA 1VQNI 3L2UA 2Y0SA 4XL9A 5HVQC 4M3DA 4RM3A 2ELHA 1G2HA 4AIJA 1WI3A 2LNBA 4YFNF 3LSMA 3A1YA 4OAYA 2KJBA 2LF8A 1UG2A 1VQ5I 3WHCA 1RPWA 2EH3A 2NVQJ 1T2KA 2WV0A 2X9DA 3FXRA 4UB8C 2OC6A 4U7BA 4HF0A 2CGPA 3CMEI 3G1OA 4NQWB 2RQQA 2ZFUA 3L7WA 4I7HA 4HV5A 1RKWA 1MNMC 3S2DJ 1Q1HA 2EIJH 2DT6A 2K02A 4G94A 1GVDA 3ZPLA 4CH7A 4F7ZA 4ZYHA 4Q48A 1JUPA 3FM3A 2DOAA 3MN2A 4HBLA 4ZZDA 4CZZA 4U7DA 2FA5A 3WTZA 5IPAA 2AQEA 2DK5A 2QVOA 2IA2A 3D1NI 4XLCA 2KT0A 2R93J 4I6ZA 5KAIC 1X3WB 1U78A 1QBJA 2QSHX 1FWZA 1MBEA 2AHQA 3GZ6A 1X1CA 4KICA 2LY9A 3WU0A 2FQ3A 3TW6A 3QWLA 2OPTA 4N9HA 2DMNA 2B9SA 2GOMA 1ZGWA 3GFLA 4HLXA 4OINF 5F0HA 3I55I 4U88A 4LLNA 3RKQA 4ZC3A 1YO5C 2H6CA 2EIKH 2EFOA 4LG0A 2ZB9A 5H6RA 3JW4A 3CUQB 3P9KA 2NS8A 5HS9A 2JUGA 3PNTA 4A3JJ 3DU5A 3HGGA 2E1MC 2R7FA 3V7SA 5JVTA 5E8GA 3QP6A 1SD6A 1HBXG 1P7IA 1LEBA 4CCJA 3T8TA 2R7TA 3KPHA 4HDVA 1HXDA 2BEOA 2ZMEB 5L3DA 4KITB 2DXIA 1I50J 4A5MA 4A3GJ 4MNUA 1ZLJA 3PQKA 1TWGJ 1MJBA 3QU6A 4XRFA 2RQPA 3QODA 4AIKA 5CVRA 1JHFA 5GAEJ 5D5UB 2ZC2A 1P6RA 1MBKA 2J5PA 3V7CA 2E34A 3HSRA 2Y9ZA 4IHWA 5D8LB 3M4OJ 3GF2A 4EATA 1ZG1A 2FF4A 1A04A 3S16J 2FMLA 3AFHA 1V3FA 4FE7A 2ELKA 4R1HA 5LBQA 3C2GA 3TP3A 1NG7A 3CESA 3JTHA 4LK1F 1E3PA 2EIMH 3ABLH 4KT5C 2HOEA 4HX8A 1PDNC 3J80K 3RPUD 2E7XA 5M5WJ 4M73A 2AXLA 1RETA 4XKVA 4J00A 1VQPI 3JR9A 4CCMA 2M30A 3WG9A 4PJJA 3NEUA 5E1WA 3K6GA 1YFHA 3EETA 1HF0A 3CUOA 3LSHA 3GTOJ 4ZDOA 1LQ1A 2NOJB 2EFNA 2X51A 4RLQA 1WRJA 1QO0D 1W0UA 2P5VA 2DA2A 2GOXB 3VB2A 2ELJA 2MYSA 3TL4X 3CCEI 1ZHFA 4E7JA 3K0LA 1M1EB 2QKMB 4CSWA 5KK1A 3BQZA 3S2HJ 2V7FA 3BR0A 5J8CA 1RIOH 3E3VA 2XPUA 3R0AA 3VOEA 3DCFA 4Y52J 3SZGA 3EUHA 1QHGA 3KYLA 2M5WA 4BQAA 3CLOA 4BEHB 5F1RA 1ODDA 4EJOA 1SVMA 1H9GA 2GXGA 4ESFA 4LIUA 1TTYA 4G6QA 1EH6A 1P9QC 2HYJA 2XV4S 4OIQF 1X1PA 4HV6A 3OV8A 1RKTA 2XAHA 2HDWA 3OSFA 1K61A 1LE8B 2L9NA 3OYNA 1YRNA 4GYGA 1FX7A 3E1SA 4I76A 2O3FA 3CUQA 4UXNA 5HDNA 2QA4I 3ZN0A 1UHMA 3SDBA 3G4SI 4CYCB 3DEUA 1Z7LA 4UV8A 3NQOA 1W4MA 2OTLI 4C3IJ 2VPRA 1B1BA 3RKXA 5EG0B 2XROA
chains in the Genus database with same CATH topology
3CO6C 3M7GA 1SFXA 1I1SA 1LDDA 2ADUA 1HKTA 3E6BA 2G7UA 4ETSA 1ZLKA 1PUEE 3E5XA 2NYXA 3WTSC 4I2OA 2VE8A 4MHGA 2QQBA 1O3QA 3WTYC 3WGHA 3H3UA 3FM5A 5LHHA 3KZZA 2HS5A 4OOIA 1W5TA 1G3TA 4Y15A 4OMZA 6PAXA 4Z2YA 5CVVA 4LMYA 2A61A 2X0LA 2IA0A 2H27A 1ZRDA 2CFXA 4IRIA 1ZH5A 4U0WA 5FGMA 2QM3A 2DQRA 3WTUC 2XRNA 4MQVA 2ACJA 4P9UA 1IRGA 2V1UA 5ILSA 3EYYA 4HA8A 2WTEA 2MLKA 4EGYA 4U0VA 4EJTA 4HQMA 1J5YA 4RGXA 1FYKA 3I54A 4BNCA 5FLXK 2F5DA 5FFZA 1KQ0A 4ESJA 1FBSA 4KUMA 5DD8A 2PG4A 1DUXC 2CSOA 3U9GA 1IF1A 3KETA 4YIFA 1D8JA 1OR7A 1G3SA 4OIOF 3BP8A 1S7AA 1USTA 3TDUC 3GXOA 3KP4A 1FYLA 2RV8A 3HRTA 1R23A 4YFKF 3GWZA 1NHAA 3IRRA 3FZVA 3R60A 1GVJA 5FLXZ 5LHGA 3SFZA 3IL2A 3VEPA 3J80Z 1XGOA 3GX4X 1P4XA 4LLGF 1T6SA 1RZ4A 1F5TA 1F4KA 4HOBA 3KP7A 2OZ6A 4Y13A 2RDPA 1G3WA 2LSOA 2R7DA 5D5XB 2LF7A 1DPUA 3SZPA 2HWVA 1ZYRF 3K69A 1ON1A 5J8FA 2IW5A 1QQIA 1JHHA 3GLXA 4RS8A 3K2ZA 4LLLA 3WGGA 5F6FA 5LLQA 3QAHA 2M8EA 4ZYEA 4HW0A 4Q47A 3U1DA 5HLGA 3DFGA 2D1HA 1DP7P 2EV6A 4P55A 4M9SA 1BI2A 3KLOA 2DBBA 3ISPA 3LQQA 3GYHX 1YW9A 3REOA 1OPCA 1XGSA 3GZ5A 4LJZF 1FYMA 3F8CA 4QLCU 2MD5A 1HQCA 2PQ8A 3F6VA 1B9NA 2OZUA 3QPHA 3H3ZA 4O3MA 1ZRFA 5LGTA 2K4JA 3R4KA 2WC2A 4RAYA 4BHCA 4HDUA 4KDPA 4EQQA 2EB7A 2DO7A 3HSEA 3IKTA 1WKMA 1UHWA 2QENA 2ZBKA 2QQ9A 1E2XA 1K6OA 4CHUA 4FX0A 2XAGA 1HKQA 3AAFA 5BPDA 4LGWA 3I71A 3F21A 5CVUA 3KP5A 2XASA 4HLYA 4EM0B 3QRFF 3LA7A 2OBPA 3E97A 5D5WB 4Y17A 3F6OA 3F8FA 3L09A 5LEKA 5ERIA 4I0BA 2RC4A 4HQEA 4L5JA 3DQVC 4MQ9F 2W84A 1LDKB 1IN7A 1KU2A 2Z5UA 2RKHA 4D0PA 3M1EA 4LB6B 2X4HA 3E5UA 4GCVA 5K5OA 4O5VA 4EV0A 3E6DA 4GYIA 2JRTA 2ZKZA 2GIVA 2EA2A 1U6GA 5AIQA 3FXUA 2K7LA 2CYYA 1MDMA 1TBXA 2HEOA 3WE3A 1J59A 2F5CA 4KMFA 2ISYA 4HAMA 4YIIA 1C0WA 4A12A 1S3JA 1TLHB 3N4MA 2FNAA 1BOAA 2PN6A 3RKYA 2W85A 2L4AA 3P7NA 1BI3A 1J0RA 3COAC 1G3YA 2ZO4A 2HTJA 2ISZA 3DKWA 4HZFA 4G7OF 3K1PA 4AVPA 1YLFA 1AOYA 1BIBA 2BGCA 2QYOA 5IT3A 1O7FA 1R22A 4DNCA 2GAUA 4M9XA 3O2PE 2HR3A 2BBYA 2K4BA 3FHZA 4IJAA 3CTAA 1HSJA 1ON2A 1MGTA 4MEYF 1STZA 4PGGA 1ZAOA 4BXUA 4ENJA 2YX7A 5FD5A 1YW7A 2K27A 3EYIA 1KA8A 1Z6RA 3LQRA 3U2RA 2XGXA 3HOSA 2Q8KA 5BOXA 5A2QK 2A69F 4N0BA 2E7WA 3ULQB 3IHUA 4AWXB 1W7PD 4ZH4F 4WCGA 5EEHA 2C6YA 2KJCA 2JPCA 3LA3A 2FXAA 1XSXA 3WTVC 2DPDA 1T39A 2AS5F 1MDMB 4IF4A 1Z7UA 2B0LA 2ZJ2A 5AIPA 1R7JA 5JHUA 3PFIA 4L5IA 1GXPA 5FD6A 4AIHA 3R0JA 1BJAA 4MEXF 3O3KA 1XGMA 3L00A 4IRGA 5FFXA 4HF2A 5LEJA 4CICA 1IW7F 2PMHA 3F8BA 2FRHA 2EV0A 2YR2A 5D8KB 5LGNA 2OQRA 1RI7A 3BY6A 2P5KA 4GO1A 1O57A 3Q9SA 3BWGA 3FMQA 3CJNA 2ZCWA 4G7ZF 2E1CA 2PBIA 4KIGA 2ESHA 4NB5A 2GQQA 1U5TA 2WWYA 3LA2A 1HW5A 3KEQA 1FP2A 3OOPA 2V6CA 3J81Z 3KP2A 2DU9A 2P7VB 1HKSA 5CLSA 3F72A 4ON0A 3JAMZ 5DDGA 3IRQA 4HYEA 4K2EA 5DV5A 4KFCA 1D5VA 3B73A 5LRSA 1F9NA 3W6KB 1OYIA 1ZRCA 3M8EA 1Z05A 1FY7A 2ZFWA 1SAXA 3HTUA 3RPUA 2E1NA 2PEXA 2L54A 1TNTA 3SXYA 2ZXJA 1UFMA 1OYYA 2HYFA 2KIMA 3DPTA 3JSPA 3BDDA 4G8XA 1J9IA 4YG2F 2M45A 4IHSA 2VBYA 1EH8A 2F5EA 4P5OA 1W5SA 3ZMUA 4RB3C 4UUVA 5E20A 4ZZLA 1LEAA 5LGUA 1I27A 5ILVA 2NNNA 4P96A 3HUGA 1Z91A 4JBAA 4U0YA 1U5TB 3GVAA 3T1BA 4R8HA 2G7HA 1TQPA 1R58A 5K5QA 2NAZA 5ILUA 1FT9A 4QWQA 3QPTA 4EVIA 4M71A 1B9MA 3TKYA 3T8RA 2V79A 1J75A 2IA1A 4EM2A 1G6NA 4L9VA 2VXZA 2MBFA 3BPVA 1WWXA 5F64A 4O6JA 1ZG3A 1MKMA 3GEZA 5JI6A 2EJRA 1H9TA 3L9FA 1Z9CA 5CJ9A 2JTVA 1B59A 2MC3A 1LDJA 3VFZA 1KGSA 2UWMA 1P92A 3V8KA 5TRDA 1GXQA 2MH2A 4FX4A 4FHTA 1X3UA 1B4AA 2K86A 1TW3A 3ROUA 1JE8A 1Z6TA 2O03A 5D5VB 4HX7A 1Y0UA 1IXSB 2PI0A 3BPXA 1IAWA 3KEOA 1LNWA 5JFRA 3FWEA 5IT9Z 1QNTA 4UVBA 2YX4A 4DQ2A 3ECHA 4EJVA 3TDZC 3ZMZA 3MZYA 1K79A 1XD7A 2F2EA 2EWNA 1OYWA 2OD5A 4BH9A 1SFEA 4Q5SF 1T0FA 1YW8A 2QLZA 3ZMVA 2H09A 2XUBA 1YS7A 3ABTA 4JK1X 1FBUA 5FB2A 2DFIA 1SMTA 2DPUA 2Y0MA 4KYWA 1FC3A 1EH7A 4KIBA 5LHIA 3I4PA 1XB4A 3RTRA 3RYPA 1SFUA 2A6EF 3E5QA 2IVMA 1S6LA 2VBXA 1KYWA 2XKPA 4B8XA 2OU2A 1KYZA 3DPLC 1R5HA 1HSTA 2JPBA 3C7JA 3KCCA 1O3RA 3DF8A 3MAJA 4CGZA 4UHTA 2KKOA 5K5RA 2L01A 2QWWA 4G9YA 4RB1A 3EQLF 1WSUA 3V7RA 1AWCA 4BHPA 2IPQX 4WWCA 1RNLA 3BJ6A 1WI9A 2JT1A 4CXFA 1P4AA 3HRUA 4IXAA 3JSOA 2RGVA 2UXNA 3TOAA 3D0SA 1OMIA 3TO6A 1W7PB 4R79A 2QZ8A 3WE2A 4IVNA 5L3CA 5TJJA 1I6XA 3D5LA 2O0YA 3BROA 3E6MA 4E70A 2O61A 2A68F 1SD7A 4OIRF 3R61A 2DAOA 4S05A 2HTSA 4I0AA 1XSVA 2RN7A 1S29A 3RJPA 3SQNA 5K1YA 1UCRA 4HX4A 5HDGA 4JQFA 2UXXA 1ONVA 4PGHA 1XMKA 3HTSB 2IP2A 1MJ9A 4XLNF 2MH9A 2ZNZA 3MQ0A 3C18A 3WTXC 3W6JB 3QOPA 2GA1A 4OIPF 2STWA 1SD4A 1I1GA 3F22A 2CQKA 2XKOA 2RVCA 4IRHA 2KRFA 3WODF 1IXCA 1FSEA 2FOKA 3BOQA 1G4DA 2V1DA 1QPMA 4UV9A 5HLHA 1JGSA 5CYVA 1V4RA 4EGZA 2HGCA 3NRVA 4UNOA 1MD0A 2FSWA 1BC8C 3RDIA 2VC1A 5BQTA 2MA3A 4A6DA 3T0YA 3S2WA 1IUYA 4HF1A 3MEXA 3HYIA 3HRSA 4L9JA 3G3ZA 3IWZA 2EK5A 3N97A 2IRFG 3FMSA 4L9TA 3ERED 4ENMA 4CDGA 4RB2C 3BZ6A 2OA4A 4ENNA 4KN4X 1J7KA 1KU3A 2W57A 2EFWA 3ZN1A 1XN7A 1FLIA 3MFKA 2VE9A 1RUOA 2P4WA 2V9VA 1E17A 3RPQA 2O6GE 4P9FA 2A5YB 5CVIA 2BE5F 1O3TA 5LRRA 1BIAA 2COMA 2NNYA 5L3FA 2GZWA 1TW2A 2FU4A 2FEZA 2JZYA 4XSXF 2KIFA 3CUQC 1BC7C 1S8NA 3KLNA 1FOKA 3TOBA 3VODA 3WTWC 3HIFA 2GWRA 3L2CA 4WF2A 5ICCA 2P7CB 1QGPA 1O7LA 2CW0F 3RYRA 3HRMA 1K7AA 3G73A 1Z1DA 3QP5A 5DYMA 2L3DA 3MWMA 1IN4A 3V4GA 1U3EM 2ETHA 3FF5A 2PMUA 1BI0A 1L3LA 3IWFA 3I59B 2L4MA 5J6XA 1K78B 2CWEA 5E18F 2Z3YA 3M8FA 3C3WA 1IN6A 3I0TA 3FX3A 4G7HF 4MGRA 2Q0OA 2STTA 5DCMB 3SHFA 2EA4A 2Y75A 2GA2A 3I5UA 1EV7A 4LD5A 1QZZA 3LWFA 3ML6A 1RUNA 1FBQA 4BAYA 2IT0A 3V8JA 4XBFA 3R6SA 2LDUA 2W24A 3GUDA 3I64A 3ABUA 1P2FA 1YYVA 1FP1D 2CG4A 2NRAC 3GFIA 1U5TC 4KA4A 1UB9A 1R1VA 2HKOA 3RI4A 1YQAA 4YFXF 3TGNA 2EV5A 4KN7X 3RIRA 5AONA 4MTDA 1SMYF 4I98B 3V8LA 2IJLA 4KNYA 1ZG5A 2P6TA 4IPAA 3FXQA 2A6HF 1H0MA 1F1ZA 2VOPA 1XDSA 1IN8A 5D6FA 3ZP5A 4A0YA 4S04A 1K78A 1ZREA 1SD5A 4EJUA 2GXBA 4N9IA 2NS0A 5HLIA 5L3BA 5DUIA 3C1DA 4RGRA 4AD9A 2XAJA 1CF7A 2KIUA 1P4WA 3M9AA 1MJAA 2D2WA 1O3SA 4LFUA 3RKWA 2A07F 1WQ2A 1YS6A 2VONA 5BPIA 4ESBA 4LG0B 3KP3A 1T38A 4KIFA 4WK8F 3SZTA 2DTRA 2F5FA 1S7OA 1YIOA 5DD4A 3TO9A 4OMYA 5BMZA 4UVAA 2P6SA 2FMYA 2LKPA 2QQAA 2D45A 2H6BA 3MZHA 3TO7A 1HW1A 3GW2A 4M6XA 3HHGA 3EDPA 2FBKA 2TDXA 1YTYA 5FO5A 2RNJA 3BJOA 2XHKA 3KZYA 2DT5A 4UVCA 1R36A 4I01A 1FPQA 3DXJF 2UZKA 4IHTA 2Y48A 4PCQA 3TQNA 1XGNA 3ECOA 4RGSA 1W7PA 3LAJA 4I02A 1LVAA 3ZMTA 3WU1B 4G6DA 3QU3A 4M72A 5KVRA 1USSA 4BHBA 5E1XA 1MZBA 3HSFA 3CO7C 5BS6A 3J81K 1IRFA 1CF7B 2PJPA 1XCBA 1PP8F 2YSRA 2HYGD 5EEGA 5DUKA 1ULYA 2XAFA 2L02A 4WXDA 1FZPB 1YG2A 4GXOA 2VT3A 1GHCA 1FSHA 4RAZA 1PP7U 3BJAA 2EFQA 1ZARA 1U2WA 2QBYA 2XIGA 2OQGA 1REPC 3FMRA 3F8NA 1BI1A 5CVJA 3KP6A 3H92A 4OU0A 5ICGA 1XDUA 4ASNA 2DI3A 4L9NA 5HOOA 3P9IA 2FBIA 3LFKA 1R5GA 3LAPA 1J2XA 2VC0A 4WXCA 4XSZF 3Q9VA 4Q4ZF 2CO5A 1HW2A 3E6CC 1TQIA 4GGGA 1XSDA 1XMAA 2HQRA 2HFHA 3F3XA 3KE2A 3WTTC 4RB0A 5IT9K 4BYYA 2O8XA 4NHJA 3HOTA 3K9TA 3O6BB 2VOOA 1CGPA 3ELKA 3IKVA 2PLYA 4EJWA 2P5LC 1IXRC 1OKRA 2Z9OA 1JXSA 3I53A 1BM9A 4M9ZA 2Z33A 3ZQ7A 4MTEA 3DP7A 2VN2A 2P8TA 4KMUX 5L3GA 2M87A 2VBWA 4M74A 5D6EA 2PFBA 2VODA 3F8MA 4TV7A 1ZGAA 3GO5A 3J7AO 2QUFA 2QBYB 4A0ZA 3ZMDA 4A2UA 5E8IA 3LSTA 2BV6A 3Q5FA 1VTNC 4L0YB 4EM1A 5ICFA 1T98A 4H0EA 5HS7A 3B02A 4PZJA 2XVCA 5DCFA 2YPRA 2DLLA 2XAQA 4ENKA 2EFPA 2M1BA 2W25A 1D3YA 1IZ1A 3HHHA 4EMSA 1FNNA 2A3SA 5D4SA 4L0ZB 3F23A 3MCZA 2V1XA 2DK8A 1L0OC 1D8KA 1R1TA 4WX9A 2H94A 2HKXA 2R3SA 1BBYA 4A0XA 2HDCA 2G9WA 2OAZA 5JR3A 3IC7A 3K1MA 1R00A 5E1ZB 3P9CA 2HZTA 2Q2EA 3JTGA 2VT2A 1LB2A 3I59A 1R1UA 2HQNA 2JSCA 1B6AA 4M6YA 3T5XA 4CO8A 4NQWA 4I09A 1KQ8A 4ZYDA 4LB5A 5HDKA 5D4RA 5DCMA 1IN5A 4RGUA 5L3EA 3ZMSA 1BN5A 5ICEA 3K1NA 1TNSA 1I5ZA 3I58A 4WXHA 2FE3A 4XLPF 2VBZA 5ED4A 2ESNA 2ZNYA 4LK0F 1U8RA 4FT8A 4L18B 1KU7A 3CDHA 3DV8A 1LJ9A 2DW4A 2Z99A 1DPRA 4B09A 3WGIA 5DEQA 1KU9A 5E17F 2J5OA 2MLGA 3KFWX 1TQMA 2ZMEA 3GFMA 3JAMK 2DQLA 1ZN2A 5HS8A 1XCVA 2FNPA 4A6EA 5A2QZ 1ZGJA 2D1VA 1KQ9A 2YU3A 4ZYGA 1DDNA 3GFJA 3PQJA 4A5NA 4PDKA 5H6QA 2BYVE 2FBHA 4CYDA 5H20A 1QZYA 5HVQC 2ELHA 4AIJA 2LNBA 4YFNF 2KJBA 2LF8A 1T2KA 2WV0A 3FXRA 4U7BA 4HF0A 2CGPA 3L7WA 4I7HA 4HV5A 1Q1HA 2K02A 4G94A 3ZPLA 4F7ZA 4ZYHA 4Q48A 3FM3A 4HBLA 4ZZDA 4U7DA 4CZZA 2FA5A 3WTZA 2QVOA 2DK5A 2IA2A 1U78A 1QBJA 1FWZA 3GZ6A 4KICA 3WU0A 2FQ3A 4N9HA 3GFLA 4HLXA 4OINF 4U88A 4LLNA 1YO5C 2H6CA 2EFOA 4LG0A 5H6RA 3JW4A 3CUQB 3P9KA 5HS9A 2R7FA 3V7SA 5JVTA 5E8GA 3QP6A 1SD6A 1HBXG 1LEBA 3T8TA 4HDVA 1HXDA 2BEOA 2ZMEB 5L3DA 4A5MA 4MNUA 1ZLJA 3PQKA 4XRFA 3QU6A 1MJBA 2RQPA 4AIKA 5CVRA 1JHFA 5D5UB 1P6RA 2J5PA 3V7CA 3HSRA 5D8LB 3GF2A 1ZG1A 2FF4A 1A04A 2FMLA 1V3FA 5LBQA 4R1HA 3JTHA 4LK1F 4KT5C 1PDNC 2HOEA 4HX8A 3J80K 2E7XA 4M73A 2AXLA 2M30A 3WG9A 5E1WA 3NEUA 1YFHA 3EETA 3CUOA 1LQ1A 2EFNA 1WRJA 1QO0D 2P5VA 3VB2A 1ZHFA 3K0LA 5KK1A 5J8CA 1RIOH 3E3VA 3R0AA 3VOEA 3EUHA 2M5WA 4BQAA 3CLOA 5F1RA 1ODDA 4EJOA 1H9GA 2GXGA 4ESFA 1TTYA 4G6QA 1EH6A 4OIQF 2XV4S 4HV6A 3OV8A 2XAHA 4GYGA 1FX7A 2O3FA 3CUQA 4UXNA 5HDNA 3ZN0A 1UHMA 3DEUA 4UV8A 3NQOA 1W4MA 1B1BA 3RKXA 2XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CO6 C;  3M7G A;  1SFX A;  1I1S A;  1LDD A;  2ADU A;  1HKT A;  3E6B A;  2G7U A;  4ETS A;  1ZLK A;  1PUE E;  3E5X A;  2NYX A;  3WTS C;  4I2O A;  2VE8 A;  4MHG A;  2QQB A;  1O3Q A;  3WTY C;  3WGH A;  3H3U A;  3FM5 A;  5LHH A;  3KZZ A;  2HS5 A;  4OOI A;  1W5T A;  1G3T A;  4Y15 A;  4OMZ A;  6PAX A;  4Z2Y A;  5CVV A;  4LMY A;  2A61 A;  2X0L A;  2IA0 A;  2H27 A;  1ZRD A;  2CFX A;  4IRI A;  1ZH5 A;  4U0W A;  5FGM A;  2QM3 A;  2DQR A;  3WTU C;  2XRN A;  4MQV A;  2ACJ A;  4P9U A;  1IRG A;  2V1U A;  5ILS A;  3EYY A;  4HA8 A;  2WTE A;  2MLK A;  4EGY A;  4U0V A;  4EJT A;  4HQM A;  1J5Y A;  4RGX A;  1FYK A;  3I54 A;  4BNC A;  5FLX K;  2F5D A;  5FFZ A;  1KQ0 A;  4ESJ A;  1FBS A;  4KUM A;  5DD8 A;  2PG4 A;  1DUX C;  2CSO A;  3U9G A;  1IF1 A;  3KET A;  4YIF A;  1D8J A;  1OR7 A;  1G3S A;  4OIO F;  3BP8 A;  1S7A A;  1UST A;  3TDU C;  3GXO A;  3KP4 A;  1FYL A;  2RV8 A;  3HRT A;  1R23 A;  4YFK F;  3GWZ A;  1NHA A;  3IRR A;  3FZV A;  3R60 A;  1GVJ A;  5FLX Z;  5LHG A;  3SFZ A;  3IL2 A;  3VEP A;  3J80 Z;  1XGO A;  3GX4 X;  1P4X A;  4LLG F;  1T6S A;  1RZ4 A;  1F5T A;  1F4K A;  4HOB A;  3KP7 A;  2OZ6 A;  4Y13 A;  2RDP A;  1G3W A;  2LSO A;  2R7D A;  5D5X B;  2LF7 A;  1DPU A;  3SZP A;  2HWV A;  1ZYR F;  3K69 A;  1ON1 A;  5J8F A;  2IW5 A;  1QQI A;  1JHH A;  3GLX A;  4RS8 A;  3K2Z A;  4LLL A;  3WGG A;  5F6F A;  5LLQ A;  3QAH A;  2M8E A;  4ZYE A;  4HW0 A;  4Q47 A;  3U1D A;  5HLG A;  3DFG A;  2D1H A;  1DP7 P;  2EV6 A;  4P55 A;  4M9S A;  1BI2 A;  3KLO A;  2DBB A;  3ISP A;  3LQQ A;  3GYH X;  1YW9 A;  3REO A;  1OPC A;  1XGS A;  3GZ5 A;  4LJZ F;  1FYM A;  3F8C A;  4QLC U;  2MD5 A;  1HQC A;  2PQ8 A;  3F6V A;  1B9N A;  2OZU A;  3QPH A;  3H3Z A;  4O3M A;  1ZRF A;  5LGT A;  2K4J A;  3R4K A;  2WC2 A;  4RAY A;  4BHC A;  4HDU A;  4KDP A;  4EQQ A;  2EB7 A;  2DO7 A;  3HSE A;  3IKT A;  1WKM A;  1UHW A;  2QEN A;  2ZBK A;  2QQ9 A;  1E2X A;  1K6O A;  4CHU A;  4FX0 A;  2XAG A;  1HKQ A;  3AAF A;  5BPD A;  4LGW A;  3I71 A;  3F21 A;  5CVU A;  3KP5 A;  2XAS A;  4HLY A;  4EM0 B;  3QRF F;  3LA7 A;  2OBP A;  3E97 A;  5D5W B;  4Y17 A;  3F6O A;  3F8F A;  3L09 A;  5LEK A;  5ERI A;  4I0B A;  2RC4 A;  4HQE A;  4L5J A;  3DQV C;  4MQ9 F;  2W84 A;  1LDK B;  1IN7 A;  1KU2 A;  2Z5U A;  2RKH A;  4D0P A;  3M1E A;  4LB6 B;  2X4H A;  3E5U A;  4GCV A;  5K5O A;  4O5V A;  4EV0 A;  3E6D A;  4GYI A;  2JRT A;  2ZKZ A;  2GIV A;  2EA2 A;  1U6G A;  5AIQ A;  3FXU A;  2K7L A;  2CYY A;  1MDM A;  1TBX A;  2HEO A;  3WE3 A;  1J59 A;  2F5C A;  4KMF A;  2ISY A;  4HAM A;  4YII A;  1C0W A;  4A12 A;  1S3J A;  1TLH B;  3N4M A;  2FNA A;  1BOA A;  2PN6 A;  3RKY A;  2W85 A;  2L4A A;  3P7N A;  1BI3 A;  1J0R A;  3COA C;  1G3Y A;  2ZO4 A;  2HTJ A;  2ISZ A;  3DKW A;  4HZF A;  4G7O F;  3K1P A;  4AVP A;  1YLF A;  1AOY A;  1BIB A;  2BGC A;  2QYO A;  5IT3 A;  1O7F A;  1R22 A;  4DNC A;  2GAU A;  4M9X A;  3O2P E;  2HR3 A;  2BBY A;  2K4B A;  3FHZ A;  4IJA A;  3CTA A;  1HSJ A;  1ON2 A;  1MGT A;  4MEY F;  1STZ A;  4PGG A;  1ZAO A;  4BXU A;  4ENJ A;  2YX7 A;  5FD5 A;  1YW7 A;  2K27 A;  3EYI A;  1KA8 A;  1Z6R A;  3LQR A;  3U2R A;  2XGX A;  3HOS A;  2Q8K A;  5BOX A;  5A2Q K;  2A69 F;  4N0B A;  2E7W A;  3ULQ B;  3IHU A;  4AWX B;  1W7P D;  4ZH4 F;  4WCG A;  5EEH A;  2C6Y A;  2KJC A;  2JPC A;  3LA3 A;  2FXA A;  1XSX A;  3WTV C;  2DPD A;  1T39 A;  2AS5 F;  1MDM B;  4IF4 A;  1Z7U A;  2B0L A;  2ZJ2 A;  5AIP A;  1R7J A;  5JHU A;  3PFI A;  4L5I A;  1GXP A;  5FD6 A;  4AIH A;  3R0J A;  1BJA A;  4MEX F;  3O3K A;  1XGM A;  3L00 A;  4IRG A;  5FFX A;  4HF2 A;  5LEJ A;  4CIC A;  1IW7 F;  2PMH A;  3F8B A;  2FRH A;  2EV0 A;  2YR2 A;  5D8K B;  5LGN A;  2OQR A;  1RI7 A;  3BY6 A;  2P5K A;  4GO1 A;  1O57 A;  3Q9S A;  3BWG A;  3FMQ A;  3CJN A;  2ZCW A;  4G7Z F;  2E1C A;  2PBI A;  4KIG A;  2ESH A;  4NB5 A;  2GQQ A;  1U5T A;  2WWY A;  3LA2 A;  1HW5 A;  3KEQ A;  1FP2 A;  3OOP A;  2V6C A;  3J81 Z;  3KP2 A;  2DU9 A;  2P7V B;  1HKS A;  5CLS A;  3F72 A;  4ON0 A;  3JAM Z;  5DDG A;  3IRQ A;  4HYE A;  4K2E A;  5DV5 A;  4KFC A;  1D5V A;  3B73 A;  5LRS A;  1F9N A;  3W6K B;  1OYI A;  1ZRC A;  3M8E A;  1Z05 A;  1FY7 A;  2ZFW A;  1SAX A;  3HTU A;  3RPU A;  2E1N A;  2PEX A;  2L54 A;  1TNT A;  3SXY A;  2ZXJ A;  1UFM A;  1OYY A;  2HYF A;  2KIM A;  3DPT A;  3JSP A;  3BDD A;  4G8X A;  1J9I A;  4YG2 F;  2M45 A;  4IHS A;  2VBY A;  1EH8 A;  2F5E A;  4P5O A;  1W5S A;  3ZMU A;  4RB3 C;  4UUV A;  5E20 A;  4ZZL A;  1LEA A;  5LGU A;  1I27 A;  5ILV A;  2NNN A;  4P96 A;  3HUG A;  1Z91 A;  4JBA A;  4U0Y A;  1U5T B;  3GVA A;  3T1B A;  4R8H A;  2G7H A;  1TQP A;  1R58 A;  5K5Q A;  2NAZ A;  5ILU A;  1FT9 A;  4QWQ A;  3QPT A;  4EVI A;  4M71 A;  1B9M A;  3TKY A;  3T8R A;  2V79 A;  1J75 A;  2IA1 A;  4EM2 A;  1G6N A;  4L9V A;  2VXZ A;  2MBF A;  3BPV A;  1WWX A;  5F64 A;  4O6J A;  1ZG3 A;  1MKM A;  3GEZ A;  5JI6 A;  2EJR A;  1H9T A;  3L9F A;  1Z9C A;  5CJ9 A;  2JTV A;  1B59 A;  2MC3 A;  1LDJ A;  3VFZ A;  1KGS A;  2UWM A;  1P92 A;  3V8K A;  5TRD A;  1GXQ A;  2MH2 A;  4FX4 A;  4FHT A;  1X3U A;  1B4A A;  2K86 A;  1TW3 A;  3ROU A;  1JE8 A;  1Z6T A;  2O03 A;  5D5V B;  4HX7 A;  1Y0U A;  1IXS B;  2PI0 A;  3BPX A;  1IAW A;  3KEO A;  1LNW A;  5JFR A;  3FWE A;  5IT9 Z;  1QNT A;  4UVB A;  2YX4 A;  4DQ2 A;  3ECH A;  4EJV A;  3TDZ C;  3ZMZ A;  3MZY A;  1K79 A;  1XD7 A;  2F2E A;  2EWN A;  1OYW A;  2OD5 A;  4BH9 A;  1SFE A;  4Q5S F;  1T0F A;  1YW8 A;  2QLZ A;  3ZMV A;  2H09 A;  2XUB A;  1YS7 A;  3ABT A;  4JK1 X;  1FBU A;  5FB2 A;  2DFI A;  1SMT A;  2DPU A;  2Y0M A;  4KYW A;  1FC3 A;  1EH7 A;  4KIB A;  5LHI A;  3I4P A;  1XB4 A;  3RTR A;  3RYP A;  1SFU A;  2A6E F;  3E5Q A;  2IVM A;  1S6L A;  2VBX A;  1KYW A;  2XKP A;  4B8X A;  2OU2 A;  1KYZ A;  3DPL C;  1R5H A;  1HST A;  2JPB A;  3C7J A;  3KCC A;  1O3R A;  3DF8 A;  3MAJ A;  4CGZ A;  4UHT A;  2KKO A;  5K5R A;  2L01 A;  2QWW A;  4G9Y A;  4RB1 A;  3EQL F;  1WSU A;  3V7R A;  1AWC A;  4BHP A;  2IPQ X;  4WWC A;  1RNL A;  3BJ6 A;  1WI9 A;  2JT1 A;  4CXF A;  1P4A A;  3HRU A;  4IXA A;  3JSO A;  2RGV A;  2UXN A;  3TOA A;  3D0S A;  1OMI A;  3TO6 A;  1W7P B;  4R79 A;  2QZ8 A;  3WE2 A;  4IVN A;  5L3C A;  5TJJ A;  1I6X A;  3D5L A;  2O0Y A;  3BRO A;  3E6M A;  4E70 A;  2O61 A;  2A68 F;  1SD7 A;  4OIR F;  3R61 A;  2DAO A;  4S05 A;  2HTS A;  4I0A A;  1XSV A;  2RN7 A;  1S29 A;  3RJP A;  3SQN A;  5K1Y A;  1UCR A;  4HX4 A;  5HDG A;  4JQF A;  2UXX A;  1ONV A;  4PGH A;  1XMK A;  3HTS B;  2IP2 A;  1MJ9 A;  4XLN F;  2MH9 A;  2ZNZ A;  3MQ0 A;  3C18 A;  3WTX C;  3W6J B;  3QOP A;  2GA1 A;  4OIP F;  2STW A;  1SD4 A;  1I1G A;  3F22 A;  2CQK A;  2XKO A;  2RVC A;  4IRH A;  2KRF A;  3WOD F;  1IXC A;  1FSE A;  2FOK A;  3BOQ A;  1G4D A;  2V1D A;  1QPM A;  4UV9 A;  5HLH A;  1JGS A;  5CYV A;  1V4R A;  4EGZ A;  2HGC A;  3NRV A;  4UNO A;  1MD0 A;  2FSW A;  1BC8 C;  3RDI A;  2VC1 A;  5BQT A;  2MA3 A;  4A6D A;  3T0Y A;  3S2W A;  1IUY A;  4HF1 A;  3MEX A;  3HYI A;  3HRS A;  4L9J A;  3G3Z A;  3IWZ A;  2EK5 A;  3N97 A;  2IRF G;  3FMS A;  4L9T A;  3ERE D;  4ENM A;  4CDG A;  4RB2 C;  3BZ6 A;  2OA4 A;  4ENN A;  4KN4 X;  1J7K A;  1KU3 A;  2W57 A;  2EFW A;  3ZN1 A;  1XN7 A;  1FLI A;  3MFK A;  2VE9 A;  1RUO A;  2P4W A;  2V9V A;  1E17 A;  3RPQ A;  2O6G E;  4P9F A;  2A5Y B;  5CVI A;  2BE5 F;  1O3T A;  5LRR A;  1BIA A;  2COM A;  2NNY A;  5L3F A;  2GZW A;  1TW2 A;  2FU4 A;  2FEZ A;  2JZY A;  4XSX F;  2KIF A;  3CUQ C;  1BC7 C;  1S8N A;  3KLN A;  1FOK A;  3TOB A;  3VOD A;  3WTW C;  3HIF A;  2GWR A;  3L2C A;  4WF2 A;  5ICC A;  2P7C B;  1QGP A;  1O7L A;  2CW0 F;  3RYR A;  3HRM A;  1K7A A;  3G73 A;  1Z1D A;  3QP5 A;  5DYM A;  2L3D A;  3MWM A;  1IN4 A;  3V4G A;  1U3E M;  2ETH A;  3FF5 A;  2PMU A;  1BI0 A;  1L3L A;  3IWF A;  3I59 B;  2L4M A;  5J6X A;  1K78 B;  2CWE A;  5E18 F;  2Z3Y A;  3M8F A;  3C3W A;  1IN6 A;  3I0T A;  3FX3 A;  4G7H F;  4MGR A;  2Q0O A;  2STT A;  5DCM B;  3SHF A;  2EA4 A;  2Y75 A;  2GA2 A;  3I5U A;  1EV7 A;  4LD5 A;  1QZZ A;  3LWF A;  3ML6 A;  1RUN A;  1FBQ A;  4BAY A;  2IT0 A;  3V8J A;  4XBF A;  3R6S A;  2LDU A;  2W24 A;  3GUD A;  3I64 A;  3ABU A;  1P2F A;  1YYV A;  1FP1 D;  2CG4 A;  2NRA C;  3GFI A;  1U5T C;  4KA4 A;  1UB9 A;  1R1V A;  2HKO A;  3RI4 A;  1YQA A;  4YFX F;  3TGN A;  2EV5 A;  4KN7 X;  3RIR A;  5AON A;  4MTD A;  1SMY F;  4I98 B;  3V8L A;  2IJL A;  4KNY A;  1ZG5 A;  2P6T A;  4IPA A;  3FXQ A;  2A6H F;  1H0M A;  1F1Z A;  2VOP A;  1XDS A;  1IN8 A;  5D6F A;  3ZP5 A;  4A0Y A;  4S04 A;  1K78 A;  1ZRE A;  1SD5 A;  4EJU A;  2GXB A;  4N9I A;  2NS0 A;  5HLI A;  5L3B A;  5DUI A;  3C1D A;  4RGR A;  4AD9 A;  2XAJ A;  1CF7 A;  2KIU A;  1P4W A;  3M9A A;  1MJA A;  2D2W A;  1O3S A;  4LFU A;  3RKW A;  2A07 F;  1WQ2 A;  1YS6 A;  2VON A;  5BPI A;  4ESB A;  4LG0 B;  3KP3 A;  1T38 A;  4KIF A;  4WK8 F;  3SZT A;  2DTR A;  2F5F A;  1S7O A;  1YIO A;  5DD4 A;  3TO9 A;  4OMY A;  5BMZ A;  4UVA A;  2P6S A;  2FMY A;  2LKP A;  2QQA A;  2D45 A;  2H6B A;  3MZH A;  3TO7 A;  1HW1 A;  3GW2 A;  4M6X A;  3HHG A;  3EDP A;  2FBK A;  2TDX A;  1YTY A;  5FO5 A;  2RNJ A;  3BJO A;  2XHK A;  3KZY A;  2DT5 A;  4UVC A;  1R36 A;  4I01 A;  1FPQ A;  3DXJ F;  2UZK A;  4IHT A;  2Y48 A;  4PCQ A;  3TQN A;  1XGN A;  3ECO A;  4RGS A;  1W7P A;  3LAJ A;  4I02 A;  1LVA A;  3ZMT A;  3WU1 B;  4G6D A;  3QU3 A;  4M72 A;  5KVR A;  1USS A;  4BHB A;  5E1X A;  1MZB A;  3HSF A;  3CO7 C;  5BS6 A;  3J81 K;  1IRF A;  1CF7 B;  2PJP A;  1XCB A;  1PP8 F;  2YSR A;  2HYG D;  5EEG A;  5DUK A;  1ULY A;  2XAF A;  2L02 A;  4WXD A;  1FZP B;  1YG2 A;  4GXO A;  2VT3 A;  1GHC A;  1FSH A;  4RAZ A;  1PP7 U;  3BJA A;  2EFQ A;  1ZAR A;  1U2W A;  2QBY A;  2XIG A;  2OQG A;  1REP C;  3FMR A;  3F8N A;  1BI1 A;  5CVJ A;  3KP6 A;  3H92 A;  4OU0 A;  5ICG A;  1XDU A;  4ASN A;  2DI3 A;  4L9N A;  5HOO A;  3P9I A;  2FBI A;  3LFK A;  1R5G A;  3LAP A;  1J2X A;  2VC0 A;  4WXC A;  4XSZ F;  3Q9V A;  4Q4Z F;  2CO5 A;  1HW2 A;  3E6C C;  1TQI A;  4GGG A;  1XSD A;  1XMA A;  2HQR A;  2HFH A;  3F3X A;  3KE2 A;  3WTT C;  4RB0 A;  5IT9 K;  4BYY A;  2O8X A;  4NHJ A;  3HOT A;  3K9T A;  3O6B B;  2VOO A;  1CGP A;  3ELK A;  3IKV A;  2PLY A;  4EJW A;  2P5L C;  1IXR C;  1OKR A;  2Z9O A;  1JXS A;  3I53 A;  1BM9 A;  4M9Z A;  2Z33 A;  3ZQ7 A;  4MTE A;  3DP7 A;  2VN2 A;  2P8T A;  4KMU X;  5L3G A;  2M87 A;  2VBW A;  4M74 A;  5D6E A;  2PFB A;  2VOD A;  3F8M A;  4TV7 A;  1ZGA A;  3GO5 A;  3J7A O;  2QUF A;  2QBY B;  4A0Z A;  3ZMD A;  4A2U A;  5E8I A;  3LST A;  2BV6 A;  3Q5F A;  1VTN C;  4L0Y B;  4EM1 A;  5ICF A;  1T98 A;  4H0E A;  5HS7 A;  3B02 A;  4PZJ A;  2XVC A;  5DCF A;  2YPR A;  2DLL A;  2XAQ A;  4ENK A;  2EFP A;  2M1B A;  2W25 A;  1D3Y A;  1IZ1 A;  3HHH A;  4EMS A;  1FNN A;  2A3S A;  5D4S A;  4L0Z B;  3F23 A;  3MCZ A;  2V1X A;  2DK8 A;  1L0O C;  1D8K A;  1R1T A;  4WX9 A;  2H94 A;  2HKX A;  2R3S A;  1BBY A;  4A0X A;  2HDC A;  2G9W A;  2OAZ A;  5JR3 A;  3IC7 A;  3K1M A;  1R00 A;  5E1Z B;  3P9C A;  2HZT A;  2Q2E A;  3JTG A;  2VT2 A;  1LB2 A;  3I59 A;  1R1U A;  2HQN A;  2JSC A;  1B6A A;  4M6Y A;  3T5X A;  4CO8 A;  4NQW A;  4I09 A;  1KQ8 A;  4ZYD A;  4LB5 A;  5HDK A;  5D4R A;  5DCM A;  1IN5 A;  4RGU A;  5L3E A;  3ZMS A;  1BN5 A;  5ICE A;  3K1N A;  1TNS A;  1I5Z A;  3I58 A;  4WXH A;  2FE3 A;  4XLP F;  2VBZ A;  5ED4 A;  2ESN A;  2ZNY A;  4LK0 F;  1U8R A;  4FT8 A;  4L18 B;  1KU7 A;  3CDH A;  3DV8 A;  1LJ9 A;  2DW4 A;  2Z99 A;  1DPR A;  4B09 A;  3WGI A;  5DEQ A;  1KU9 A;  5E17 F;  2J5O A;  2MLG A;  3KFW X;  1TQM A;  2ZME A;  3GFM A;  3JAM K;  2DQL A;  1ZN2 A;  5HS8 A;  1XCV A;  2FNP A;  4A6E A;  5A2Q Z;  1ZGJ A;  2D1V A;  1KQ9 A;  2YU3 A;  4ZYG A;  1DDN A;  3GFJ A;  3PQJ A;  4A5N A;  4PDK A;  5H6Q A;  2BYV E;  2FBH A;  4CYD A;  5H20 A;  1QZY A;  5HVQ C;  2ELH A;  4AIJ A;  2LNB A;  4YFN F;  2KJB A;  2LF8 A;  1T2K A;  2WV0 A;  3FXR A;  4U7B A;  4HF0 A;  2CGP A;  3L7W A;  4I7H A;  4HV5 A;  1Q1H A;  2K02 A;  4G94 A;  3ZPL A;  4F7Z A;  4ZYH A;  4Q48 A;  3FM3 A;  4HBL A;  4ZZD A;  4U7D A;  4CZZ A;  2FA5 A;  3WTZ A;  2QVO A;  2DK5 A;  2IA2 A;  1U78 A;  1QBJ A;  1FWZ A;  3GZ6 A;  4KIC A;  3WU0 A;  2FQ3 A;  4N9H A;  3GFL A;  4HLX A;  4OIN F;  4U88 A;  4LLN A;  1YO5 C;  2H6C A;  2EFO A;  4LG0 A;  5H6R A;  3JW4 A;  3CUQ B;  3P9K A;  5HS9 A;  2R7F A;  3V7S A;  5JVT A;  5E8G A;  3QP6 A;  1SD6 A;  1HBX G;  1LEB A;  3T8T A;  4HDV A;  1HXD A;  2BEO A;  2ZME B;  5L3D A;  4A5M A;  4MNU A;  1ZLJ A;  3PQK A;  4XRF A;  3QU6 A;  1MJB A;  2RQP A;  4AIK A;  5CVR A;  1JHF A;  5D5U B;  1P6R A;  2J5P A;  3V7C A;  3HSR A;  5D8L B;  3GF2 A;  1ZG1 A;  2FF4 A;  1A04 A;  2FML A;  1V3F A;  5LBQ A;  4R1H A;  3JTH A;  4LK1 F;  4KT5 C;  1PDN C;  2HOE A;  4HX8 A;  3J80 K;  2E7X A;  4M73 A;  2AXL A;  2M30 A;  3WG9 A;  5E1W A;  3NEU A;  1YFH A;  3EET A;  3CUO A;  1LQ1 A;  2EFN A;  1WRJ A;  1QO0 D;  2P5V A;  3VB2 A;  1ZHF A;  3K0L A;  5KK1 A;  5J8C A;  1RIO H;  3E3V A;  3R0A A;  3VOE A;  3EUH A;  2M5W A;  4BQA A;  3CLO A;  5F1R A;  1ODD A;  4EJO A;  1H9G A;  2GXG A;  4ESF A;  1TTY A;  4G6Q A;  1EH6 A;  4OIQ F;  2XV4 S;  4HV6 A;  3OV8 A;  2XAH A;  4GYG A;  1FX7 A;  2O3F A;  3CUQ A;  4UXN A;  5HDN A;  3ZN0 A;  1UHM A;  3DEU A;  4UV8 A;  3NQO A;  1W4M A;  1B1B A;  3RKX A;  2XRO A; 
#chains in the Genus database with same CATH topology
 3IH4 A;  3S1N J;  3CO6 C;  2BHZ A;  3M7G A;  4H4K C;  1SFX A;  2V26 A;  4HRI A;  1I1S A;  1LDD A;  2ADU A;  4B44 A;  1HKT A;  3OYI A;  3H0G J;  3E6B A;  1V55 H;  2G7U A;  4ETS A;  1ZLK A;  4A3F J;  1PUE E;  3E5X A;  3ABK H;  3M3Y J;  5EZH A;  2R7S A;  2NYX A;  3WTS C;  1JI8 A;  2LY2 A;  5C44 J;  4I2O A;  2VE8 A;  4BDZ A;  3PNY A;  4XNF A;  4MHG A;  5M3F J;  4E4H A;  2QQB A;  1O3Q A;  1UAA A;  3WTY C;  3BC8 A;  3WGH A;  3H3U A;  3K7A J;  3FM5 A;  5LHH A;  3KZZ A;  2HS5 A;  2M9H A;  4OOI A;  1W5T A;  2XPV A;  1G3T A;  2GM4 A;  4Y15 A;  4OMZ A;  6PAX A;  1Y1V J;  3MMY B;  4Z2Y A;  5CVV A;  4LMY A;  2A61 A;  1WJF A;  2MGQ A;  3LSJ A;  2X0L A;  3IP4 B;  2JQ7 A;  5JVG F;  2EPF A;  2IA0 A;  2K3P A;  3LSK A;  1JKO C;  2H27 A;  2O9L A;  1ZRD A;  2CFX A;  5GAH J;  2JA6 J;  1R4N B;  1X1A A;  4IRI A;  5IYB J;  1ZH5 A;  4U0W A;  5FGM A;  2ZJR F;  2QM3 A;  2DQR A;  3CCM I;  3TP0 A;  3WTU C;  2XRN A;  4MQV A;  2ACJ A;  1G59 A;  1XG1 A;  3GTJ J;  4DZP A;  2KRC A;  2MD0 A;  3I4M J;  4P9U A;  2ICW G;  1IRG A;  1RC9 A;  2ME0 A;  1XS9 A;  2V1U A;  2MC4 A;  5ILS A;  3EYY A;  2DA4 A;  2ZSH B;  4HA8 A;  3A4C A;  4V2F A;  3RQI A;  3S3M A;  2WTE A;  2KFD A;  2MLK A;  1R49 A;  4EGY A;  4A3M J;  4U0V A;  4NDL A;  2L7K A;  3LOC A;  5FLV A;  4EJT A;  4HQM A;  1YRN B;  1J5Y A;  4RGX A;  2LBF A;  1FYK A;  3I54 A;  3QYB A;  4CYC A;  4BNC A;  5FLX K;  3OYL A;  3S14 J;  1K83 J;  5EG0 A;  2F5D A;  3HZJ A;  2ZJP F;  3JRG A;  1H88 C;  4JOM A;  5FFZ A;  2WAQ A;  4B48 A;  1KQ0 A;  2AO9 A;  5BNG A;  4ESJ A;  3CDI A;  4IOA F;  3CJT B;  1FBS A;  2HQA A;  4KUM A;  4BU2 A;  2NVT J;  5J3L A;  5DD8 A;  2PG4 A;  1DUX C;  2CSO A;  3U9G A;  4ZJZ A;  5GTH C;  1A31 A;  3FIS A;  4S0H B;  1IF1 A;  1H8A C;  1MH4 A;  3KET A;  3BCB A;  4YIF A;  1D8J A;  1ENH A;  1OR7 A;  1VQO I;  1QU3 A;  1G3S A;  1ETK A;  4OIO F;  3BP8 A;  1S7A A;  4GDF A;  1UST A;  3TDU C;  1IRZ A;  1HDP A;  3C2H A;  3GXO A;  2W1O A;  3KP4 A;  2MG4 A;  1FYL A;  1YOV B;  3HM5 A;  2RV8 A;  3HRT A;  3DBH B;  1R23 A;  4QIW N;  4YFK F;  3GWZ A;  1NHA A;  3IRR A;  1LFB A;  3FZV A;  3AG3 H;  3R60 A;  1GVJ A;  1HA8 A;  3DEE A;  5FLX Z;  5LHG A;  3SFZ A;  2UV1 A;  4C30 A;  3IL2 A;  2QSG X;  5B5E C;  3VEP A;  4C3J J;  2BY2 A;  3L2R A;  3J80 Z;  1XGO A;  3GX4 X;  4A3C J;  1P4X A;  4LLG F;  1T6S A;  1RZ4 A;  1UG0 A;  1XC5 A;  1F4K A;  1F5T A;  5CPR B;  3I4N J;  2I10 A;  4HOB A;  3KP7 A;  4C2T A;  3BG9 A;  2OZ6 A;  2K5C A;  4Y13 A;  1MBG A;  2RDP A;  1G3W A;  1OCP A;  2LSO A;  2R7D A;  4XOT A;  3CP2 A;  2K3F A;  5GAG J;  5D5X B;  2LF7 A;  5LFA A;  1DPU A;  3SZP A;  2HWV A;  4XKC A;  1ZYR F;  2L7Z A;  1WPK A;  3K69 A;  1ON1 A;  5J8F A;  3IUO A;  2IW5 A;  3OL4 A;  1QQI A;  4E6K G;  3FXJ A;  2WY7 Q;  3EUA A;  2CMP A;  5M3M J;  1AU7 A;  5J4V A;  1JHH A;  3PSI A;  3GLX A;  2XF5 A;  1YI2 I;  2ZME C;  4RS8 A;  3K2Z A;  5FKN A;  4LLL A;  2XB5 A;  4E7H A;  3WGG A;  5F6F A;  5LLQ A;  3FKI J;  3QAH A;  2M8E A;  1D0Z A;  4ZYE A;  4HW0 A;  3ONQ A;  4Q47 A;  3U1D A;  5HLG A;  2E1M B;  3DFG A;  2D1H A;  1NG6 A;  2L5Q A;  2EV6 A;  1DP7 P;  4P55 A;  2A05 A;  3GZN B;  1BI2 A;  3O8G A;  3KLO A;  2DBB A;  4I99 C;  4M9S A;  4XR6 A;  3SJM A;  5J1U A;  3ISP A;  3LQQ A;  1HDD C;  3VWB A;  3JRB A;  4CCN A;  3GYH X;  1AKH B;  1YW9 A;  3REO A;  2QGU A;  2OCE A;  2WV1 A;  5EGO B;  2KL4 A;  3BTJ A;  1OPC A;  1WH5 A;  3NAR A;  4HSR A;  1Z0X A;  2HQ5 A;  1XGS A;  3GZ5 A;  2WBM A;  4LJZ F;  2LKX A;  1FYM A;  3F8C A;  4QLC U;  2CV0 A;  2MD5 A;  1HQC A;  2PQ8 A;  4DYR A;  3F6V A;  4A3E J;  3ESW B;  2M4G A;  1B9N A;  2OZU A;  2LY1 A;  1UMQ A;  3QPH A;  2CV1 A;  3H3Z A;  2RRE A;  4O3M A;  4MIM A;  2KHM A;  1ZRF A;  4FQG A;  5LGT A;  2K4J A;  4F91 B;  1IDY A;  1TWH J;  3R4K A;  2WC2 A;  2Y30 A;  1S9H A;  2BZT A;  4RAY A;  4BHC A;  4HDU A;  3CC4 I;  4JX4 A;  4V2G A;  3JRC A;  1MBJ A;  2AXT C;  4KDP A;  3S17 J;  4FAS D;  1WZ2 A;  4U87 A;  4EQQ A;  5HLT A;  1SEU A;  1FOX A;  2EB7 A;  2DO7 A;  4Y33 A;  1WJC A;  3FK7 A;  4HEA 2;  5LD2 C;  3DBL B;  3HSE A;  4XN3 A;  4BDY A;  2Y0S N;  3S8P A;  4B3X A;  3IKT A;  1YX3 A;  2H8R A;  2E1O A;  3D5R C;  1SC7 A;  1ETY A;  1WKM A;  5IY5 H;  1UHW A;  2QEN A;  1MMA A;  1YIT I;  2V9K A;  2ZJQ F;  2ZBK A;  2ZXI A;  2QQ9 A;  4BJ6 C;  1E2X A;  1W36 C;  2DJN A;  5FJ8 J;  4PJN A;  1K6O A;  4CHU A;  4FX0 A;  2XAG A;  1HKQ A;  3AAF A;  2KDO A;  1G8X A;  5BPD A;  4LGW A;  3I71 A;  1T8I A;  3HPH A;  2IS4 A;  1XTA A;  3F21 A;  1OCC H;  2A5W A;  5CVU A;  4XRS G;  4NC7 A;  3KP5 A;  2R5Z A;  2CQX A;  2BVM A;  2XAS A;  4Y4R A;  2FX0 A;  3UR3 C;  4HLY A;  2HOS A;  4EM0 B;  2HVS A;  2WB1 N;  3QRF F;  2HOA A;  1Y8R B;  2IGN A;  4F93 B;  2DYR H;  3BTC A;  3SEZ A;  3K10 A;  5DTD A;  2P81 A;  3LA7 A;  2OBP A;  3E97 A;  3VYR B;  2VJI A;  5D5W B;  4Y17 A;  3F6O A;  3F8F A;  4PFP A;  2F4I A;  2NXN B;  3FK6 A;  3LSR A;  2CS3 A;  3L09 A;  2O8K A;  3LSI A;  1OR7 C;  5LEK A;  3CDL A;  3FXM A;  4FIS A;  5ERI A;  3Q0W A;  4I0B A;  2RC4 A;  4X0G A;  1KZH A;  4L5J A;  3DQV C;  4MQ9 F;  4HQE A;  2W84 A;  1LDK B;  1IN7 A;  1KU2 A;  5HNH A;  1EA3 A;  2L7M P;  3LL7 A;  2Z5U A;  2RKH A;  4D0P A;  3M1E A;  2E60 A;  2I8D A;  4LB6 B;  2X4H A;  1J09 A;  3E5U A;  2DA5 A;  4GCV A;  4IEJ A;  5K5O A;  2R7O A;  4AYB N;  4RA2 A;  4O5V A;  1ZKG A;  3OOU A;  4EV0 A;  3E6D A;  5E79 C;  3CCV I;  3AL0 B;  4BXX J;  4GYI A;  1OLT A;  1ZQ3 P;  3CCS I;  2JRT A;  2ZKZ A;  1BJZ A;  3HJE A;  3OWT A;  4W1U A;  2QKL B;  3FXL A;  2GIV A;  4HNU A;  3CQZ J;  2JJ7 A;  2EA2 A;  1U6G A;  5AIQ A;  3FXU A;  1OCR H;  2B63 J;  3KZI C;  2K7L A;  3J7Y J;  2CYY A;  4M3B A;  2BXZ A;  1MDM A;  1UJ8 A;  1IUF A;  1TBX A;  3IH3 A;  2HEO A;  2K9L A;  3WE3 A;  2MSY A;  1J59 A;  1R5I D;  3HEF A;  2F5C A;  4FE4 A;  3QPL A;  5B1A H;  1Y1W J;  4KMF A;  3J7A Y;  2ISY A;  3DKY A;  3H1C A;  4HAM A;  2ID6 A;  4YII A;  1C0W A;  4A12 A;  1S3J A;  1TLH B;  2L9V A;  3N4M A;  3W2V A;  2FNA A;  1W0T A;  3JRI A;  1RR7 A;  1BOA A;  3FKJ A;  4BY7 J;  2F4O B;  2PN6 A;  3OYH A;  3HPG A;  4C3H J;  3RKY A;  1NK3 P;  2W85 A;  4GFB A;  2L4A A;  5IP6 A;  3P7N A;  3E0J B;  1UEL B;  1BI3 A;  1J0R A;  3COA C;  1G3Y A;  3MKL A;  3CC2 I;  2ZO4 A;  2LOO A;  3K4K A;  2HTJ A;  2ISZ A;  3DKW A;  2GBY A;  1VF9 A;  4HZF A;  2L7F P;  2V9P A;  2B7E A;  2ZXH A;  2DMT A;  4J19 A;  3KX2 A;  1V5E A;  1SFK A;  1VQ8 I;  4G7O F;  3K1P A;  4D7M A;  3TED A;  4AVP A;  4KIS A;  4CCL A;  1YLF A;  1H89 C;  1AOY A;  1BIB A;  2YUS A;  2BGC A;  2JSP A;  1FIP A;  2QYO A;  5IT3 A;  1O7F A;  1R22 A;  2W48 A;  3IH2 A;  4DNC A;  2R7Z J;  2GAU A;  4M9X A;  4CUG A;  3J7Z I;  1MW7 A;  2QEX I;  3O2P E;  1RES A;  2HR3 A;  2BBY A;  4Y3O A;  2K4B A;  3V42 A;  3FHZ A;  4IJA A;  3CTA A;  3WHB A;  1HSJ A;  1ON2 A;  1YJN I;  3OSG A;  1MGT A;  4MEY F;  1STZ A;  4PGG A;  2NVX J;  1ZAO A;  3ZOB A;  4BXU A;  4ENJ A;  2YX7 A;  3BZC A;  2ECC A;  5FLM J;  5FD5 A;  1YW7 A;  2K27 A;  4BGD A;  2GIZ A;  3EYI A;  1VQ9 I;  3G1L A;  3LSG A;  1KA8 A;  1BOB A;  1MNE A;  4CZC A;  1Z6R A;  3LQR A;  3A0H C;  3U2R A;  2XGX A;  3HOS A;  1FOY A;  4MFD A;  2Q8K A;  5BOX A;  5A2Q K;  1IG7 A;  1FIA A;  2A69 F;  4N0B A;  4M3G A;  2E7W A;  1BW6 A;  3IHU A;  3QYF A;  3ULQ B;  4AWX B;  5B3S H;  1W7P D;  4ZH4 F;  4WCG A;  2LMD A;  5EEH A;  2C6Y A;  1W1W E;  2JPC A;  2KJC A;  3LA3 A;  2M2E A;  1GV2 A;  2FXA A;  1XSX A;  3WTV C;  2DPD A;  2NVY J;  3M07 A;  5J4Y A;  1T39 A;  3C2B A;  2AS5 F;  1MDM B;  3FXK A;  5EDN A;  4IF4 A;  4XLA A;  1Z7U A;  2B0L A;  3PIP F;  1SVL A;  2ZJ2 A;  5AIP A;  5HOD A;  1R7J A;  5FRO A;  2LTP A;  4XKW A;  1TT5 B;  2X6W A;  5JHU A;  3PFI A;  4YEJ A;  3GTK J;  4L5I A;  1GXP A;  2WAE A;  4B3A A;  4C2M J;  5FD6 A;  3OYF A;  4J01 A;  4XQF A;  4AIH A;  3DLL F;  3S1M J;  1MBF A;  1E3H A;  3R0J A;  1BJA A;  1X19 A;  1X3Z B;  2F48 A;  5KNL A;  3O3K A;  1PUF B;  4MEX F;  1XX5 A;  1XGM A;  3L00 A;  4IRG A;  5FFX A;  4HF2 A;  5LEJ A;  1LUJ B;  2VXD A;  2JVG A;  2DA3 A;  3BR3 A;  4CIC A;  2XGE A;  2CU7 A;  1T56 A;  1IW7 F;  1X58 A;  2IS6 A;  5EYR A;  1WJD A;  2PMH A;  3A0B C;  3F8B A;  3G1M A;  3H3V K;  2FRH A;  2EV0 A;  2YR2 A;  1LFP A;  1FOW A;  5D8K B;  5LGN A;  1LKX A;  5KAF C;  5F04 A;  2HU9 A;  3S32 A;  2ZXW H;  2CQ7 A;  1T95 A;  4IQ4 A;  2R7R A;  2Q1Z B;  2XSJ C;  2OQR A;  4BJT A;  1RI7 A;  2F5V A;  3BY6 A;  1YE9 A;  2P5K A;  3K4J A;  4GO1 A;  1N75 A;  3TBI A;  2CQQ A;  2AQF A;  1O57 A;  4X1E A;  3Q9S A;  3BWG A;  3FMQ A;  3CJN A;  5E3L A;  5J47 A;  3OYE A;  2ZCW A;  1ETQ A;  4QPQ A;  2BY1 A;  2LBF B;  5F27 A;  2MFZ A;  4G7Z F;  1FJL A;  2O7O A;  4XRS A;  2KPM A;  1LVK A;  5E3N A;  2E1C A;  4A69 C;  4PSW A;  4XK4 A;  2IAI A;  2PBI A;  5C3E J;  4KIG A;  2ESH A;  4NB5 A;  2GQQ A;  1U5T A;  2VIX A;  2KZG A;  3LA2 A;  1HW5 A;  2WWY A;  5CKT A;  3GME A;  1WH7 A;  3KEQ A;  3SFI A;  1FP2 A;  3OOP A;  2V6C A;  3J81 Z;  3KP2 A;  2X85 A;  2DU9 A;  2P7V B;  3L1P A;  2E2J J;  2V6E A;  1HC8 A;  1HKS A;  3Q0V A;  2X1C A;  5CLS A;  3F72 A;  1UZC A;  2R7V A;  4W97 A;  5K7Z A;  4ON0 A;  1OQY A;  2NVU B;  3JAM Z;  5DDG A;  3IRQ A;  4HYE A;  4K2E A;  2MAB A;  3OYM A;  5DV5 A;  4KFC A;  1IDZ A;  1D5V A;  3B73 A;  3OYB A;  5LRS A;  4M6V A;  3ZXS A;  1RR8 C;  2XF7 A;  1F9N A;  3W6K B;  1D0X A;  3S1R J;  1OYI A;  3LMM A;  4IO9 F;  1ZRC A;  4HNT A;  3M8E A;  3W6V A;  1R4M B;  2WY8 Q;  2DTZ A;  1MSE C;  2JWT A;  1PUF A;  1MH3 A;  2LVS A;  1Z05 A;  1FY7 A;  2ZFW A;  1SAX A;  3HTU A;  3A02 A;  4RAF A;  3RPU A;  2E1N A;  2PEX A;  1X4O A;  5H2F C;  2V1N A;  4BBR J;  3N05 A;  2LD5 A;  3A2K A;  2L54 A;  1TNT A;  4L5E A;  4A3K J;  3SXY A;  1NTC A;  2Z1D A;  3BR5 A;  2CV2 A;  3DPU A;  2DOE A;  4IL6 C;  2CFO A;  2ZXJ A;  1UFM A;  3OIO A;  1OYY A;  2HZD A;  2HYF A;  2KIM A;  5FRM A;  1S5L C;  1QZE A;  3DPT A;  4UY8 I;  3JSP A;  3BDD A;  4G8X A;  3AKZ A;  2FQ4 A;  4YG2 F;  1J9I A;  2M45 A;  1U9N A;  1JUS A;  4IHS A;  4D5C A;  2VBY A;  4ANJ A;  1EH8 A;  2XC7 A;  2F5E A;  4FTH A;  2CJJ A;  4P5O A;  1W5S A;  3ZMU A;  2EIL H;  4RB3 C;  4UUV A;  5E20 A;  3AL0 C;  3BQY A;  4ZZL A;  1LEA A;  4NBQ A;  5LGU A;  2PMZ A;  1I27 A;  5ILV A;  3RZD J;  4MFE A;  3S1Q J;  2NNN A;  4P96 A;  3HUG A;  1D0Y A;  1Z91 A;  4JBA A;  4U0Y A;  1AKH A;  2ECB A;  1P7J A;  1U5T B;  3GVA A;  3T1B A;  2K9M A;  5EGO A;  4R8H A;  3OYJ A;  2G7H A;  1XPX A;  1F36 A;  1TQP A;  1R58 A;  5K5Q A;  3DEW A;  2NAZ A;  4NC8 A;  4XID A;  2CW7 A;  5ILU A;  2W82 A;  4A3D J;  1FT9 A;  4QWQ A;  1CQT A;  3QPT A;  3H9Q A;  5F0C A;  4CCK A;  4EVI A;  4M71 A;  1B9M A;  3TKY A;  5FKL A;  4BE0 A;  2EZH A;  2LH9 A;  3P5J A;  3T8R A;  2V79 A;  1DU0 A;  1J75 A;  1SFO J;  2IA1 A;  4EM2 A;  1G6N A;  3M1C A;  4L9V A;  2VXZ A;  2MBF A;  1EKE A;  2GLO A;  3BPV A;  3ZQQ A;  1WWX A;  2Y69 H;  5F64 A;  4RLF A;  4B43 A;  2NS7 A;  5GAD J;  3AG1 H;  4O6J A;  1ZG3 A;  1MKM A;  3HGY A;  3GEZ A;  2L9S A;  3IAM 2;  5JI6 A;  2EJR A;  1VQ7 I;  1H9T A;  3L9F A;  2GXA A;  1Z9C A;  5CJ9 A;  5F1J A;  2JTV A;  3HBL A;  1B59 A;  2MC3 A;  4A3L J;  1LDJ A;  1IV6 A;  4Z6Y A;  3HDD A;  2VKD A;  2JMW A;  1DGR M;  1JTY A;  4BQQ A;  3VFZ A;  1KGS A;  2UWM A;  2M7B A;  3PFY A;  4KT6 A;  3VSL A;  1P92 A;  3V8K A;  5TRD A;  2E35 A;  1GXQ A;  2R5Z B;  2MH2 A;  4FET A;  2EZI A;  1VQK I;  3OY9 A;  4FX4 A;  4FHT A;  1X3U A;  1B4A A;  2K86 A;  4QPO A;  3F0C A;  3MKW B;  1TW3 A;  4ITV A;  3ROU A;  1JE8 A;  1Z6T A;  2O03 A;  3GBG A;  5D5V B;  2XSD C;  1JKQ C;  4HX7 A;  1Y0U A;  1IXS B;  2PI0 A;  3BPX A;  1IAW A;  2M8G X;  2DCE A;  3KEO A;  1LNW A;  5JFR A;  2K85 A;  2HPM A;  3FWE A;  5IT9 Z;  1QNT A;  3NWS A;  4UVB A;  3CC7 I;  4RAG A;  2TRT A;  2M34 A;  2YX4 A;  4DQ2 A;  4BE1 A;  3ECH A;  2DJI A;  4EJV A;  3TDZ C;  2R7W A;  3ZMZ A;  3MZY A;  2R7X A;  1K79 A;  1W36 D;  2X6O A;  1N77 A;  1XD7 A;  1DQU A;  4UB6 C;  2F2E A;  2VAS A;  4DW6 A;  2EWN A;  1OYW A;  2OD5 A;  1RRJ A;  4BH9 A;  2K9N A;  1SFE A;  2LR8 A;  4Q5S F;  1T0F A;  1YW8 A;  2M4K A;  2HVR A;  2QLZ A;  3ZMV A;  2XRL A;  2H09 A;  2XUB A;  4HPQ A;  3VPR A;  1YS7 A;  4PJ0 C;  3ABT A;  3BLY A;  4JK1 X;  1FBU A;  5FB2 A;  2DFI A;  4QSH A;  3G6E I;  2YS9 A;  1SMT A;  2JA2 A;  2R4G A;  2Y0M A;  2DPU A;  4KYW A;  3LSP A;  2FD5 A;  1FC3 A;  3OR2 C;  1JTX A;  1EH7 A;  4KIB A;  5LHI A;  2E2I J;  3EUK L;  3ZQH A;  3I4P A;  1XB4 A;  3RTR A;  3RYP A;  1SFU A;  2A6E F;  3E5Q A;  2IVM A;  3MZ8 A;  2VBX A;  1S6L A;  3VYT B;  1KYW A;  4XOR A;  2XKP A;  4B8X A;  1Y6I A;  2OU2 A;  1KYZ A;  4E7K A;  3DPL C;  4OAZ A;  3CCR I;  1R5H A;  1HST A;  3B6A A;  2JPB A;  3C7J A;  3KCC A;  4RMN A;  1O3R A;  1OFC X;  4IZZ A;  3DF8 A;  3MAJ A;  4CGZ A;  4UHT A;  2KKO A;  5K5R A;  3WG7 H;  2L01 A;  2QWW A;  4G9Y A;  4RB1 A;  2H8W A;  4GRI A;  4NUB A;  3EQL F;  4PSX A;  4V19 K;  2KIQ A;  1WSU A;  3V7R A;  1AWC A;  3FBI B;  4N4O B;  4BHP A;  2UUZ A;  3BR1 A;  2IBD A;  2VL8 A;  2RAE A;  5B66 C;  3GTQ J;  2IPQ X;  4WWC A;  1RNL A;  2KDZ A;  3BJ6 A;  1WI9 A;  2JT1 A;  4CXF A;  1X1D A;  1P4A A;  3HRU A;  2DYS H;  4IXA A;  3JSO A;  1GDT A;  2RGV A;  2BW3 B;  2OCC H;  2UXN A;  1NH3 A;  4YEL A;  3TOA A;  2PMZ N;  3D0S A;  2OTJ I;  2VKE A;  1OMI A;  3OS0 A;  3G71 I;  3TO6 A;  1W7P B;  1MIJ A;  4R79 A;  3DTI A;  2QZ8 A;  4RM2 A;  3WE2 A;  4IVN A;  2FUG 2;  2LRD A;  3CJR B;  2R7U A;  5L3C A;  2IGK A;  1I6X A;  5TJJ A;  3D5L A;  1V54 H;  2JK3 A;  2O0Y A;  3BRO A;  3VSK A;  3U21 A;  3BG6 A;  3E6M A;  4E70 A;  3I9V 2;  2O61 A;  4C2U A;  3S15 J;  2E71 A;  1HCR A;  2A68 F;  1SD7 A;  2JA7 J;  4OIR F;  3R61 A;  2DAO A;  4XLF A;  3PO3 J;  4S05 A;  2VJ4 A;  4D5F A;  2HTS A;  5FKK A;  4XIC A;  3OIP A;  1IRX A;  4I0A A;  1XSV A;  1SVO A;  4BAC A;  2N8G A;  1OCT C;  3PSF A;  2KP6 A;  2RN7 A;  1YX5 A;  1S29 A;  2DN0 A;  2E5Z A;  5KCM A;  3RJP A;  3SQN A;  2X1E A;  3ZQL A;  3H9J A;  1WJE A;  1V5G A;  5K1Y A;  2FJ1 A;  1UCR A;  2ID3 A;  4HX4 A;  5JLX A;  1JKR C;  3OYK A;  5HDG A;  4M3E A;  4JQF A;  4PJL A;  2UXX A;  3TMO A;  1ONV A;  4PGH A;  1XMK A;  3HTS B;  2IP2 A;  1MJ9 A;  4XLN F;  2VQC A;  2MH9 A;  4LOC A;  2ZNZ A;  3GLL A;  3MQ0 A;  4DBQ A;  3U1K A;  5EZG A;  2NOG A;  3C18 A;  4JYK A;  3ASN H;  2JRM A;  3WTX C;  4BQO A;  3RCO A;  3QOP A;  1Z3Y A;  3W6J B;  2X48 A;  2GA1 A;  4OIP F;  2STW A;  1SD4 A;  3CCU I;  1I1G A;  3F22 A;  4LIV A;  3DWL E;  4F92 B;  2CQK A;  2XKO A;  2RVC A;  4C9Y A;  1APL C;  4II2 A;  4IRH A;  2KRF A;  2WA0 A;  3WOD F;  1IXC A;  1FSE A;  2FOK A;  3BOQ A;  3FHN A;  2V1D A;  1U8B A;  1G4D A;  1QPM A;  1ACI A;  4PK4 A;  4UV9 A;  2DFF A;  5HLH A;  5IYC J;  1JGS A;  5CYV A;  2HPI A;  1V4R A;  1MMG A;  4EGZ A;  2HGC A;  3OYA A;  3NRV A;  4UNO A;  1MD0 A;  2Z2S B;  3M8J A;  1AA7 A;  1TL8 A;  2FSW A;  1BC8 C;  1A6Q A;  3RDI A;  1O4X A;  2IGO A;  2VC1 A;  3B6C A;  5BQT A;  2MA3 A;  4A6D A;  2BW3 A;  3VYS B;  4D9J A;  1X2M A;  3T0Y A;  3S2W A;  1IUY A;  4HF1 A;  3QQA A;  1GLN A;  3OMY A;  3MEX A;  1Y8Q B;  2W4S A;  3HYI A;  3S3N A;  3HRS A;  4L9J A;  3G3Z A;  2LP0 A;  3FXO A;  3IWZ A;  4XN0 A;  2EK5 A;  3H5R A;  1YJ9 I;  2JVH A;  1BR2 A;  3N97 A;  2HI3 A;  3FMS A;  2G0E A;  4L9T A;  4XLE A;  3ERE D;  2IRF G;  1W5C C;  4D7N A;  4ENM A;  2PJR B;  3AG2 H;  4CDG A;  5FRN A;  4RB2 C;  3BZ6 A;  4NNJ A;  2OA4 A;  1U0J A;  4ENN A;  2JA5 J;  4LIT A;  3DKX A;  4KN4 X;  1PJR A;  1QVU A;  3HKZ A;  1A36 A;  1J7K A;  1KU3 A;  2W57 A;  3PL8 A;  2EFW A;  2BHY A;  3ZN1 A;  1XN7 A;  5K7F A;  3GCM A;  3FIW A;  4PJM A;  1FLI A;  3UKG A;  3I56 I;  5JLW A;  3MFK A;  2VE9 A;  1EJ9 A;  1Y0N A;  1SAN A;  1E3O C;  1RUO A;  2P4W A;  2E2H J;  2V9V A;  1E17 A;  3RPQ A;  2O6G E;  1ETX A;  4HG2 A;  4P9F A;  2A5Y B;  5CVI A;  1NK2 P;  3S93 A;  2BE5 F;  1O3T A;  5TGT A;  5LRR A;  4AC0 A;  1BIA A;  2COM A;  5K7H A;  3PIO F;  1JJ6 C;  2BVL A;  2NNY A;  2M3A A;  1WFX A;  5L3F A;  1D1A A;  2GZW A;  2KIS A;  2MW8 A;  1TW2 A;  2FU4 A;  2FEZ A;  2JZY A;  4XSX F;  2KIF A;  3NWT A;  3CUQ C;  2VPL A;  1BC7 C;  1WJA A;  3BTL A;  2L2O A;  4B47 A;  1S8N A;  3KLN A;  4PFO A;  4BKX A;  3JRH A;  4IX7 A;  1FOK A;  3TOB A;  2W7N A;  4XRM A;  3MKZ A;  2DA1 A;  4MLO A;  4YIR X;  3VOD A;  1VND A;  4QTR A;  4E7Z A;  3WTW C;  3OYG A;  2VI6 A;  2XGC A;  3HIF A;  3PUB A;  2GWR A;  3L2C A;  3HOU J;  1VZ0 A;  4WF2 A;  3L2V A;  3BG3 A;  2R5Y B;  5ICC A;  3FDY A;  1QGP A;  2P7C B;  4HST A;  1O7L A;  1OCZ H;  3DBR B;  1SAU A;  2CW0 F;  3A01 B;  2XB0 X;  3RYR A;  2CUF A;  3HRM A;  1VFC A;  1K7A A;  4ZDP A;  3G73 A;  1Z1D A;  1IO2 A;  3QP5 A;  2JUC A;  4FCY A;  1MND A;  2F4M B;  3H9G A;  5DYM A;  1KON A;  2L3D A;  2R7Q A;  1MSF C;  3MWM A;  1IN4 A;  3HC7 A;  1MMN A;  3ZQI A;  3V4G A;  1TT0 A;  4PUS A;  1U3E M;  2Q2E B;  1VI0 A;  2ETH A;  2DA7 A;  3FF5 A;  2PMU A;  3OS2 A;  1BI0 A;  1L3L A;  2M7A A;  3PUF A;  3IWF A;  3I59 B;  2L4M A;  2HXI A;  5J6X A;  1K78 B;  3BR6 A;  1Y56 A;  1B72 B;  1T33 A;  2IGM A;  3CF2 A;  4CA0 A;  2CWE A;  2D5V A;  5E18 F;  4DIQ A;  5EEA A;  5F0F A;  2Z3Y A;  2W00 A;  1XMX A;  3UNG C;  3JRD A;  3M8F A;  5FKO A;  3C3W A;  1IN6 A;  3I0T A;  3FX3 A;  2KRH A;  1S7E A;  3Q3S A;  4G7H F;  1UHS A;  5J40 A;  3HUG B;  4MGR A;  3ZGK A;  2KLO A;  3CP8 A;  1FEX A;  2Q0O A;  3JRA A;  2STT A;  1OIS A;  5DCM B;  3SHF A;  3DTE A;  2EA4 A;  2Y75 A;  1ZEL A;  2GA2 A;  3I5U A;  1EV7 A;  4N4N B;  4BBS J;  4LD5 A;  3DLA A;  3ZQG A;  2CUZ A;  1QZZ A;  2VUM J;  3A03 A;  3LWF A;  3ML6 A;  3G2B A;  2O5R A;  3RQ4 A;  3JRE A;  4IHV A;  2X1D A;  1RUN A;  3BG7 A;  2Y9Y A;  1FBQ A;  4BAY A;  2IT0 A;  2CUJ A;  3CZ6 A;  3V8J A;  3K4C A;  2QF7 A;  3W2A A;  4XBF A;  2OJE D;  1ZR4 A;  3R6S A;  2LDU A;  2W24 A;  3GUD A;  3I64 A;  4ABZ A;  5TIS C;  3KYC B;  1R9T J;  5J1Y A;  4M3F A;  3CCJ I;  1PYV A;  3ABU A;  1P2F A;  1YYV A;  1FP1 D;  2CG4 A;  2NRA C;  1I6H J;  3GFI A;  1U5T C;  4A3I J;  4RDU A;  4KA4 A;  1GT0 C;  1UB9 A;  1R1V A;  2HKO A;  2E5N A;  3RI4 A;  1YQA A;  4BE2 A;  4YFX F;  3TGN A;  4CCO A;  2EV5 A;  4KN7 X;  3RIR A;  2DDB A;  5AON A;  2R5Y A;  2CRG A;  4MTD A;  1F43 A;  1SMY F;  4I98 B;  3OYC A;  3V8L A;  1ZR2 A;  3BCA A;  3O8H A;  2IJL A;  4KNY A;  2LYC A;  4MO7 A;  1ZG5 A;  2A6T A;  1QA6 A;  3NAU A;  2P6T A;  3DTK A;  4KJZ A;  4IPA A;  3FXQ A;  1S72 I;  4JX5 A;  2A6H F;  3MVP A;  4RBO A;  2OV7 A;  1H0M A;  1F1Z A;  1TWA J;  4BUP A;  3BR2 A;  2VOP A;  1XDS A;  1IN8 A;  5D6F A;  3TW7 A;  3K70 D;  3ZP5 A;  1HOM A;  1GUU A;  4G12 A;  4A0Y A;  2JN6 A;  4S04 A;  1LFU P;  1K78 A;  1ZRE A;  1SD5 A;  2X6X A;  5JHF A;  4DYQ A;  3CMM A;  1B72 A;  1FTZ A;  4EJU A;  3RSN A;  3CLQ A;  3CCL I;  1BW5 A;  2GXB A;  2DA6 A;  2K9S A;  3QPS A;  1WJ5 A;  4N9I A;  2NS0 A;  1IGN A;  3K4B A;  4IQJ A;  5HLI A;  5L3B A;  1X2N A;  2DOD A;  5DUI A;  2VQH A;  3C1D A;  4RGR A;  4AD9 A;  2XAJ A;  2E36 A;  1CF7 A;  3PJR A;  2KIU A;  2E19 A;  1T0F C;  1MMS A;  1P4W A;  3M9A A;  1MJA A;  3MD2 A;  2D2W A;  3GTG J;  1O3S A;  1U9O A;  3HOV J;  1BR4 A;  1Y39 A;  4LFU A;  1TP4 A;  1V5F A;  1IV8 A;  1X4P A;  1BR1 A;  3RKW A;  2A07 F;  4F52 A;  1WQ2 A;  1YS6 A;  3W2W A;  2VON A;  5BPI A;  4ESB A;  4LG0 B;  3KP3 A;  3LNQ A;  5C4J J;  2L0K A;  1JUM A;  5IP7 J;  1T38 A;  2IS2 A;  4KIF A;  1HLV A;  2R0Q C;  1B8I B;  4WK8 F;  3SZT A;  1A6I A;  2DTR A;  2F5F A;  1S7O A;  1YIO A;  5DD4 A;  3PNV A;  2VKV A;  3TO9 A;  4P1W A;  4OMY A;  5BMZ A;  2LFB A;  4UVA A;  2P6S A;  2FMY A;  3HOY J;  2LKP A;  2QQA A;  2EQR A;  2D45 A;  2H6B A;  2QSF X;  4YRV A;  3MZH A;  3TO7 A;  1HW1 A;  3GW2 A;  4M6X A;  3H0D A;  4OWR B;  3HHG A;  5EF6 A;  2H1K A;  3EDP A;  4BQN A;  2FBK A;  4E7L A;  2CQN A;  3CD6 I;  1K4S A;  2TDX A;  3KYD B;  2QQ8 A;  3JCU C;  1K4T A;  1TC3 C;  1YTY A;  5FO5 A;  1YHQ I;  1QPI A;  2RNJ A;  3KIO A;  1A5J A;  3BJO A;  5KHD A;  5J1R A;  2XHK A;  3KZY A;  3AG4 H;  2DMP A;  2WB1 A;  3OIQ A;  2DT5 A;  4UVC A;  1WJB A;  2XGD A;  2V4J C;  2M0C A;  2K40 A;  1R36 A;  4I01 A;  1FPQ A;  3DXJ F;  2UZK A;  3ASO H;  4IHT A;  2Y48 A;  4PCQ A;  3TQN A;  1XGN A;  1R6R A;  2QCO A;  3ECO A;  4RGS A;  1W7P A;  2F6C A;  1DU6 A;  2DOF A;  1FMV A;  3LAJ A;  4I02 A;  1LVA A;  3ZMT A;  4AID A;  1X1B A;  2VKH A;  3WU1 B;  3VYU B;  5HNF A;  4G6D A;  5M5Y J;  2LRE A;  3CF5 F;  2R92 J;  4II3 A;  3QU3 A;  1POG A;  4IHY A;  2XF6 A;  4M72 A;  2VQL A;  5KVR A;  1WCM J;  1USS A;  1ZK8 A;  2XAU A;  3MKY B;  4BHB A;  5E1X A;  3OYD A;  1MZB A;  3HSF A;  3CO7 C;  3PM1 A;  2OF7 A;  4XOP A;  5BS6 A;  4BEH A;  3J81 K;  3H5N A;  1IRF A;  1CF7 B;  1DP3 A;  2PJP A;  1XCB A;  2BXY A;  1PP8 F;  2HVQ A;  2YSR A;  3IV5 A;  5FKM A;  4XMY A;  2HYG D;  5EEG A;  1I3Q J;  2P0W A;  5DUK A;  5IP9 J;  2LG4 A;  1ULY A;  2EZK A;  2XAF A;  2L02 A;  4WXD A;  4XON A;  1FZP B;  2VB6 A;  4DOZ A;  4X6A J;  1YIJ I;  1YG2 A;  1LE8 A;  3K70 C;  1BA5 A;  1VQM I;  4GXO A;  2HOT A;  3SEQ A;  3HOZ J;  1OCO H;  2VT3 A;  1GHC A;  4BXF A;  1FSH A;  4RAZ A;  1PP7 U;  3BJA A;  2DMQ A;  1B8I A;  3HKZ N;  4IOC F;  2EFQ A;  3S3O A;  4E7S A;  1ZAR A;  1U2W A;  2QBY A;  2XIG A;  2OQG A;  5IOY A;  1I3A A;  2PX9 A;  1REP C;  4XLH A;  1JJ8 C;  3OS1 A;  3FMR A;  3L2W A;  1TWF J;  3F8N A;  5GPA A;  4DZJ A;  3ERM A;  2COB A;  1BI1 A;  5CVJ A;  1WHU A;  1IC8 A;  3KP6 A;  3H92 A;  4OU0 A;  5ICG A;  2DT7 B;  1VQL I;  1XDU A;  4ASN A;  2DI3 A;  4L9N A;  4BS9 A;  5HOO A;  1ERD A;  3I3L A;  3P9I A;  2FBI A;  3HOX J;  3LFK A;  2IEK A;  4E7I A;  1R5G A;  3LAP A;  1J2X A;  2VC0 A;  4WXC A;  2Y2Z A;  3EPZ A;  3Q9V A;  4XSZ F;  5IOZ A;  4Q4Z F;  2CO5 A;  4AYB A;  1HW2 A;  3E6C C;  1Z67 A;  1QVT A;  1TQI A;  3CMY A;  1AHD P;  4GGG A;  4F55 A;  4HNV A;  4UUS B;  2XDV A;  3HOW J;  3H35 A;  1XSD A;  1XMA A;  2VJ5 A;  4DBR A;  3RZO J;  2HQR A;  4LG3 A;  1LPQ A;  2HFH A;  1JT0 A;  3LFU A;  3F3X A;  3KE2 A;  3WTT C;  1I39 A;  4RB0 A;  2L9R A;  5IT9 K;  2DDA A;  1FTT A;  4BYY A;  2IXS A;  2O8X A;  3HG9 A;  3K2A A;  4NHJ A;  3HOT A;  3K9T A;  1N78 A;  9ANT A;  3O6B B;  1E0E A;  2DMU A;  1Z77 A;  4BL0 B;  2VOO A;  1D1C A;  1CGP A;  4A3B J;  2KZV A;  3ELK A;  3IKV A;  2PJR A;  4XM3 A;  2PLY A;  4EJW A;  1N25 A;  1BL0 A;  2I5U A;  2P5L C;  1IXR C;  1OKR A;  1IJW C;  2Z9O A;  1T08 B;  1JXS A;  3SDG A;  3I53 A;  4D1Q A;  1BM9 A;  4AU7 A;  4BJ5 C;  4M9Z A;  2Z33 A;  4AVZ A;  3ZQ7 A;  1D5Y A;  4MTE A;  2CUE A;  3DP7 A;  4F3Q A;  2VN2 A;  2P8T A;  4KMU X;  5IYD J;  1OJL A;  4ZDL A;  1A35 A;  5L3G A;  2M87 A;  2VBW A;  2H1L A;  3H5A A;  4M74 A;  5D6E A;  2X6Y A;  2PFB A;  2VOD A;  1GV5 A;  3F8M A;  4IKF A;  2DFE A;  4TV7 A;  1ZGA A;  1JKP C;  1ETW A;  3GO5 A;  3J7A O;  2QUF A;  5CQE A;  4A0Z A;  1TZL A;  3QYE A;  2QBY B;  2IS1 A;  3X2Q H;  3ZMD A;  4A2U A;  3LST A;  5E8I A;  2YU9 J;  2BV6 A;  3Q5F A;  1VTN C;  4L0Y B;  3JRF A;  4EM1 A;  5ICF A;  3EUH C;  1T98 A;  5DM6 F;  4H0E A;  1TWC J;  2BY3 A;  3IAS 2;  2ZSI B;  5HS7 A;  3B02 A;  2WAQ N;  2BOL A;  4PZJ A;  3CCQ I;  5GTI C;  2XVC A;  2BY0 A;  5DCF A;  2HXO A;  2YPR A;  2DLL A;  2K9Q A;  2XAQ A;  1QHH D;  1MMD A;  3CMA I;  2EIN H;  2HNH A;  5DM7 F;  4A93 J;  4ENK A;  2EFP A;  1Z3X A;  2FOW A;  2M1B A;  2W25 A;  1D3Y A;  3D5S C;  1IZ1 A;  1DGW Y;  3HHH A;  1EF4 A;  2LK2 A;  2KMU A;  1FNN A;  2A3S A;  5D4S A;  4EMS A;  4L0Z B;  3F23 A;  3H36 A;  5F08 A;  3MCZ A;  2OUM A;  2V1X A;  2DK8 A;  4UUS A;  4NC6 A;  1L0O C;  1D8K A;  1R1T A;  4WX9 A;  3A01 A;  2H94 A;  2HKX A;  2R3S A;  3ABM H;  3F9K A;  4XKB A;  3CJQ B;  2KQR A;  1BBY A;  4A0X A;  4G6T B;  4B4C A;  3OR1 C;  1Q1V A;  2HDC A;  2CH0 A;  2G9W A;  1K6Y A;  1ZTR A;  2OAZ A;  3BTI A;  5JR3 A;  3L2Q A;  4BY1 J;  3K4M A;  3IC7 A;  3KEY A;  3K1M A;  1R00 A;  5E1Z B;  2LLK A;  3ZRG A;  3P9C A;  2HZT A;  2Q2E A;  3JTG A;  2VT2 A;  1LB2 A;  5GPC A;  3I59 A;  3BG5 A;  1R1U A;  2HQN A;  2JSC A;  1B6A A;  4M6Y A;  5GP9 A;  3T5X A;  4B1R A;  3CCY A;  4CO8 A;  5E3M A;  4NQW A;  3W3C A;  3E7L A;  5B1B H;  1D1B A;  3GTP J;  2M0M A;  3GTM J;  1JT6 A;  1Z21 A;  3K4L A;  2EBI A;  4I09 A;  1ETV A;  2CW8 A;  3HXL A;  4DGW B;  3ZR8 X;  2VQG A;  1KQ8 A;  4AM3 A;  4ZYD A;  2LKS A;  3Q0U A;  4LB5 A;  5HDK A;  5D4R A;  4Y7N J;  4JX6 A;  5EJC A;  2Y31 A;  5DCM A;  1IN5 A;  3BZK A;  4RGU A;  2LC2 A;  5L3E A;  3OL3 A;  1BN5 A;  3ZMS A;  3K1N A;  5ICE A;  1ORK A;  1TNS A;  1I5Z A;  3I58 A;  2Z16 A;  4WXH A;  2FE3 A;  4XLP F;  1R71 A;  5M5X J;  2VBZ A;  3PO2 J;  5ED4 A;  2ESN A;  3BT9 A;  2ZNY A;  4LK0 F;  1U8R A;  3GTL J;  4FT8 A;  1YJW I;  3HB9 A;  5C4X J;  4L18 B;  1WVR A;  1KU7 A;  3CDH A;  3DV8 A;  2TCT A;  4AUX A;  1WGX A;  2VLA A;  1LJ9 A;  4UUT A;  3QOE A;  2VJJ A;  2DW4 A;  2ME6 A;  3ZQC A;  2Z99 A;  1DPR A;  5E3O A;  1ETO A;  4B09 A;  3WGI A;  5DEQ A;  5DS9 A;  2RNG A;  2WAF A;  1JGG A;  4ZTF A;  1KU9 A;  1QRY A;  5E17 F;  3ZCO A;  3FBN B;  2J5O A;  2MLG A;  3K4N A;  3KFW X;  1TQM A;  2ZME A;  3WU2 C;  3GFM A;  4EEF G;  5CQG A;  2DQL A;  1ZN2 A;  3JAM K;  3HL2 A;  5HS8 A;  4JP0 A;  2DFH A;  2JA8 J;  1XCV A;  3SYT A;  1VQ4 I;  1FMW A;  2FNP A;  4A6E A;  5A2Q Z;  1PVE A;  1ZGJ A;  2D1V A;  2XPW A;  1KQ9 A;  2YU3 A;  4ZYG A;  1DDN A;  3GFJ A;  3PQJ A;  3DU6 A;  4A5N A;  1ITY A;  4IHX A;  4PDK A;  1MBH A;  5H6Q A;  2BYV E;  4DYC A;  4ZTJ A;  3VDX A;  2FBH A;  3ZQF A;  2HDD A;  4ZYA A;  1VQ6 I;  2WAD A;  4DJA A;  4CYD A;  5H20 A;  1QZY A;  2EZL A;  1VQN I;  3L2U A;  2Y0S A;  4XL9 A;  5HVQ C;  4M3D A;  4RM3 A;  2ELH A;  1G2H A;  4AIJ A;  1WI3 A;  2LNB A;  4YFN F;  3LSM A;  3A1Y A;  4OAY A;  2KJB A;  2LF8 A;  1UG2 A;  1VQ5 I;  3WHC A;  1RPW A;  2EH3 A;  2NVQ J;  1T2K A;  2WV0 A;  2X9D A;  3FXR A;  4UB8 C;  2OC6 A;  4U7B A;  4HF0 A;  2CGP A;  3CME I;  3G1O A;  4NQW B;  2RQQ A;  2ZFU A;  3L7W A;  4I7H A;  4HV5 A;  1RKW A;  1MNM C;  3S2D J;  1Q1H A;  2EIJ H;  2DT6 A;  2K02 A;  4G94 A;  1GVD A;  3ZPL A;  4CH7 A;  4F7Z A;  4ZYH A;  4Q48 A;  1JUP A;  3FM3 A;  2DOA A;  3MN2 A;  4HBL A;  4ZZD A;  4CZZ A;  4U7D A;  2FA5 A;  3WTZ A;  5IPA A;  2AQE A;  2DK5 A;  2QVO A;  2IA2 A;  3D1N I;  4XLC A;  2KT0 A;  2R93 J;  4I6Z A;  5KAI C;  1X3W B;  1U78 A;  1QBJ A;  2QSH X;  1FWZ A;  1MBE A;  2AHQ A;  3GZ6 A;  1X1C A;  4KIC A;  2LY9 A;  3WU0 A;  2FQ3 A;  3TW6 A;  3QWL A;  2OPT A;  4N9H A;  2DMN A;  2B9S A;  2GOM A;  1ZGW A;  3GFL A;  4HLX A;  4OIN F;  5F0H A;  3I55 I;  4U88 A;  4LLN A;  3RKQ A;  4ZC3 A;  1YO5 C;  2H6C A;  2EIK H;  2EFO A;  4LG0 A;  2ZB9 A;  5H6R A;  3JW4 A;  3CUQ B;  3P9K A;  2NS8 A;  5HS9 A;  2JUG A;  3PNT A;  4A3J J;  3DU5 A;  3HGG A;  2E1M C;  2R7F A;  3V7S A;  5JVT A;  5E8G A;  3QP6 A;  1SD6 A;  1HBX G;  1P7I A;  1LEB A;  4CCJ A;  3T8T A;  2R7T A;  3KPH A;  4HDV A;  1HXD A;  2BEO A;  2ZME B;  5L3D A;  4KIT B;  2DXI A;  1I50 J;  4A5M A;  4A3G J;  4MNU A;  1ZLJ A;  3PQK A;  1TWG J;  1MJB A;  3QU6 A;  4XRF A;  2RQP A;  3QOD A;  4AIK A;  5CVR A;  1JHF A;  5GAE J;  5D5U B;  2ZC2 A;  1P6R A;  1MBK A;  2J5P A;  3V7C A;  2E34 A;  3HSR A;  2Y9Z A;  4IHW A;  5D8L B;  3M4O J;  3GF2 A;  4EAT A;  1ZG1 A;  2FF4 A;  1A04 A;  3S16 J;  2FML A;  3AFH A;  1V3F A;  4FE7 A;  2ELK A;  4R1H A;  5LBQ A;  3C2G A;  3TP3 A;  1NG7 A;  3CES A;  3JTH A;  4LK1 F;  1E3P A;  2EIM H;  3ABL H;  4KT5 C;  2HOE A;  4HX8 A;  1PDN C;  3J80 K;  3RPU D;  2E7X A;  5M5W J;  4M73 A;  2AXL A;  1RET A;  4XKV A;  4J00 A;  1VQP I;  3JR9 A;  4CCM A;  2M30 A;  3WG9 A;  4PJJ A;  3NEU A;  5E1W A;  3K6G A;  1YFH A;  3EET A;  1HF0 A;  3CUO A;  3LSH A;  3GTO J;  4ZDO A;  1LQ1 A;  2NOJ B;  2EFN A;  2X51 A;  4RLQ A;  1WRJ A;  1QO0 D;  1W0U A;  2P5V A;  2DA2 A;  2GOX B;  3VB2 A;  2ELJ A;  2MYS A;  3TL4 X;  3CCE I;  1ZHF A;  4E7J A;  3K0L A;  1M1E B;  2QKM B;  4CSW A;  5KK1 A;  3BQZ A;  3S2H J;  2V7F A;  3BR0 A;  5J8C A;  1RIO H;  3E3V A;  2XPU A;  3R0A A;  3VOE A;  3DCF A;  4Y52 J;  3SZG A;  3EUH A;  1QHG A;  3KYL A;  2M5W A;  4BQA A;  3CLO A;  4BEH B;  5F1R A;  1ODD A;  4EJO A;  1SVM A;  1H9G A;  2GXG A;  4ESF A;  4LIU A;  1TTY A;  4G6Q A;  1EH6 A;  1P9Q C;  2HYJ A;  2XV4 S;  4OIQ F;  1X1P A;  4HV6 A;  3OV8 A;  1RKT A;  2XAH A;  2HDW A;  3OSF A;  1K61 A;  1LE8 B;  2L9N A;  3OYN A;  1YRN A;  4GYG A;  1FX7 A;  3E1S A;  4I76 A;  2O3F A;  3CUQ A;  4UXN A;  5HDN A;  2QA4 I;  3ZN0 A;  1UHM A;  3SDB A;  3G4S I;  4CYC B;  3DEU A;  1Z7L A;  4UV8 A;  3NQO A;  1W4M A;  2OTL I;  4C3I J;  2VPR A;  1B1B A;  3RKX A;  5EG0 B;  2XRO A; 
#chains in the Genus database with same CATH homology
 3CO6 C;  3M7G A;  1SFX A;  1I1S A;  1LDD A;  2ADU A;  1HKT A;  3E6B A;  2G7U A;  4ETS A;  1ZLK A;  1PUE E;  3E5X A;  2NYX A;  3WTS C;  4I2O A;  2VE8 A;  4MHG A;  2QQB A;  1O3Q A;  3WTY C;  3WGH A;  3H3U A;  3FM5 A;  5LHH A;  3KZZ A;  2HS5 A;  4OOI A;  1W5T A;  1G3T A;  4Y15 A;  4OMZ A;  6PAX A;  4Z2Y A;  5CVV A;  4LMY A;  2A61 A;  2X0L A;  2IA0 A;  2H27 A;  1ZRD A;  2CFX A;  4IRI A;  1ZH5 A;  4U0W A;  5FGM A;  2QM3 A;  2DQR A;  3WTU C;  2XRN A;  4MQV A;  2ACJ A;  4P9U A;  1IRG A;  2V1U A;  5ILS A;  3EYY A;  4HA8 A;  2WTE A;  2MLK A;  4EGY A;  4U0V A;  4EJT A;  4HQM A;  1J5Y A;  4RGX A;  1FYK A;  3I54 A;  4BNC A;  5FLX K;  2F5D A;  5FFZ A;  1KQ0 A;  4ESJ A;  1FBS A;  4KUM A;  5DD8 A;  2PG4 A;  1DUX C;  2CSO A;  3U9G A;  1IF1 A;  3KET A;  4YIF A;  1D8J A;  1OR7 A;  1G3S A;  4OIO F;  3BP8 A;  1S7A A;  1UST A;  3TDU C;  3GXO A;  3KP4 A;  1FYL A;  2RV8 A;  3HRT A;  1R23 A;  4YFK F;  3GWZ A;  1NHA A;  3IRR A;  3FZV A;  3R60 A;  1GVJ A;  5FLX Z;  5LHG A;  3SFZ A;  3IL2 A;  3VEP A;  3J80 Z;  1XGO A;  3GX4 X;  1P4X A;  4LLG F;  1T6S A;  1RZ4 A;  1F5T A;  1F4K A;  4HOB A;  3KP7 A;  2OZ6 A;  4Y13 A;  2RDP A;  1G3W A;  2LSO A;  2R7D A;  5D5X B;  2LF7 A;  1DPU A;  3SZP A;  2HWV A;  1ZYR F;  3K69 A;  1ON1 A;  5J8F A;  2IW5 A;  1QQI A;  1JHH A;  3GLX A;  4RS8 A;  3K2Z A;  4LLL A;  3WGG A;  5F6F A;  5LLQ A;  3QAH A;  2M8E A;  4ZYE A;  4HW0 A;  4Q47 A;  3U1D A;  5HLG A;  3DFG A;  2D1H A;  1DP7 P;  2EV6 A;  4P55 A;  4M9S A;  1BI2 A;  3KLO A;  2DBB A;  3ISP A;  3LQQ A;  3GYH X;  1YW9 A;  3REO A;  1OPC A;  1XGS A;  3GZ5 A;  4LJZ F;  1FYM A;  3F8C A;  4QLC U;  2MD5 A;  1HQC A;  2PQ8 A;  3F6V A;  1B9N A;  2OZU A;  3QPH A;  3H3Z A;  4O3M A;  1ZRF A;  5LGT A;  2K4J A;  3R4K A;  2WC2 A;  4RAY A;  4BHC A;  4HDU A;  4KDP A;  4EQQ A;  2EB7 A;  2DO7 A;  3HSE A;  3IKT A;  1WKM A;  1UHW A;  2QEN A;  2ZBK A;  2QQ9 A;  1E2X A;  1K6O A;  4CHU A;  4FX0 A;  2XAG A;  1HKQ A;  3AAF A;  5BPD A;  4LGW A;  3I71 A;  3F21 A;  5CVU A;  3KP5 A;  2XAS A;  4HLY A;  4EM0 B;  3QRF F;  3LA7 A;  2OBP A;  3E97 A;  5D5W B;  4Y17 A;  3F6O A;  3F8F A;  3L09 A;  5LEK A;  5ERI A;  4I0B A;  2RC4 A;  4HQE A;  4L5J A;  3DQV C;  4MQ9 F;  2W84 A;  1LDK B;  1IN7 A;  1KU2 A;  2Z5U A;  2RKH A;  4D0P A;  3M1E A;  4LB6 B;  2X4H A;  3E5U A;  4GCV A;  5K5O A;  4O5V A;  4EV0 A;  3E6D A;  4GYI A;  2JRT A;  2ZKZ A;  2GIV A;  2EA2 A;  1U6G A;  5AIQ A;  3FXU A;  2K7L A;  2CYY A;  1MDM A;  1TBX A;  2HEO A;  3WE3 A;  1J59 A;  2F5C A;  4KMF A;  2ISY A;  4HAM A;  4YII A;  1C0W A;  4A12 A;  1S3J A;  1TLH B;  3N4M A;  2FNA A;  1BOA A;  2PN6 A;  3RKY A;  2W85 A;  2L4A A;  3P7N A;  1BI3 A;  1J0R A;  3COA C;  1G3Y A;  2ZO4 A;  2HTJ A;  2ISZ A;  3DKW A;  4HZF A;  4G7O F;  3K1P A;  4AVP A;  1YLF A;  1AOY A;  1BIB A;  2BGC A;  2QYO A;  5IT3 A;  1O7F A;  1R22 A;  4DNC A;  2GAU A;  4M9X A;  3O2P E;  2HR3 A;  2BBY A;  2K4B A;  3FHZ A;  4IJA A;  3CTA A;  1HSJ A;  1ON2 A;  1MGT A;  4MEY F;  1STZ A;  4PGG A;  1ZAO A;  4BXU A;  4ENJ A;  2YX7 A;  5FD5 A;  1YW7 A;  2K27 A;  3EYI A;  1KA8 A;  1Z6R A;  3LQR A;  3U2R A;  2XGX A;  3HOS A;  2Q8K A;  5BOX A;  5A2Q K;  2A69 F;  4N0B A;  2E7W A;  3ULQ B;  3IHU A;  4AWX B;  1W7P D;  4ZH4 F;  4WCG A;  5EEH A;  2C6Y A;  2KJC A;  2JPC A;  3LA3 A;  2FXA A;  1XSX A;  3WTV C;  2DPD A;  1T39 A;  2AS5 F;  1MDM B;  4IF4 A;  1Z7U A;  2B0L A;  2ZJ2 A;  5AIP A;  1R7J A;  5JHU A;  3PFI A;  4L5I A;  1GXP A;  5FD6 A;  4AIH A;  3R0J A;  1BJA A;  4MEX F;  3O3K A;  1XGM A;  3L00 A;  4IRG A;  5FFX A;  4HF2 A;  5LEJ A;  4CIC A;  1IW7 F;  2PMH A;  3F8B A;  2FRH A;  2EV0 A;  2YR2 A;  5D8K B;  5LGN A;  2OQR A;  1RI7 A;  3BY6 A;  2P5K A;  4GO1 A;  1O57 A;  3Q9S A;  3BWG A;  3FMQ A;  3CJN A;  2ZCW A;  4G7Z F;  2E1C A;  2PBI A;  4KIG A;  2ESH A;  4NB5 A;  2GQQ A;  1U5T A;  2WWY A;  3LA2 A;  1HW5 A;  3KEQ A;  1FP2 A;  3OOP A;  2V6C A;  3J81 Z;  3KP2 A;  2DU9 A;  2P7V B;  1HKS A;  5CLS A;  3F72 A;  4ON0 A;  3JAM Z;  5DDG A;  3IRQ A;  4HYE A;  4K2E A;  5DV5 A;  4KFC A;  1D5V A;  3B73 A;  5LRS A;  1F9N A;  3W6K B;  1OYI A;  1ZRC A;  3M8E A;  1Z05 A;  1FY7 A;  2ZFW A;  1SAX A;  3HTU A;  3RPU A;  2E1N A;  2PEX A;  2L54 A;  1TNT A;  3SXY A;  2ZXJ A;  1UFM A;  1OYY A;  2HYF A;  2KIM A;  3DPT A;  3JSP A;  3BDD A;  4G8X A;  1J9I A;  4YG2 F;  2M45 A;  4IHS A;  2VBY A;  1EH8 A;  2F5E A;  4P5O A;  1W5S A;  3ZMU A;  4RB3 C;  4UUV A;  5E20 A;  4ZZL A;  1LEA A;  5LGU A;  1I27 A;  5ILV A;  2NNN A;  4P96 A;  3HUG A;  1Z91 A;  4JBA A;  4U0Y A;  1U5T B;  3GVA A;  3T1B A;  4R8H A;  2G7H A;  1TQP A;  1R58 A;  5K5Q A;  2NAZ A;  5ILU A;  1FT9 A;  4QWQ A;  3QPT A;  4EVI A;  4M71 A;  1B9M A;  3TKY A;  3T8R A;  2V79 A;  1J75 A;  2IA1 A;  4EM2 A;  1G6N A;  4L9V A;  2VXZ A;  2MBF A;  3BPV A;  1WWX A;  5F64 A;  4O6J A;  1ZG3 A;  1MKM A;  3GEZ A;  5JI6 A;  2EJR A;  1H9T A;  3L9F A;  1Z9C A;  5CJ9 A;  2JTV A;  1B59 A;  2MC3 A;  1LDJ A;  3VFZ A;  1KGS A;  2UWM A;  1P92 A;  3V8K A;  5TRD A;  1GXQ A;  2MH2 A;  4FX4 A;  4FHT A;  1X3U A;  1B4A A;  2K86 A;  1TW3 A;  3ROU A;  1JE8 A;  1Z6T A;  2O03 A;  5D5V B;  4HX7 A;  1Y0U A;  1IXS B;  2PI0 A;  3BPX A;  1IAW A;  3KEO A;  1LNW A;  5JFR A;  3FWE A;  5IT9 Z;  1QNT A;  4UVB A;  2YX4 A;  4DQ2 A;  3ECH A;  4EJV A;  3TDZ C;  3ZMZ A;  3MZY A;  1K79 A;  1XD7 A;  2F2E A;  2EWN A;  1OYW A;  2OD5 A;  4BH9 A;  1SFE A;  4Q5S F;  1T0F A;  1YW8 A;  2QLZ A;  3ZMV A;  2H09 A;  2XUB A;  1YS7 A;  3ABT A;  4JK1 X;  1FBU A;  5FB2 A;  2DFI A;  1SMT A;  2DPU A;  2Y0M A;  4KYW A;  1FC3 A;  1EH7 A;  4KIB A;  5LHI A;  3I4P A;  1XB4 A;  3RTR A;  3RYP A;  1SFU A;  2A6E F;  3E5Q A;  2IVM A;  1S6L A;  2VBX A;  1KYW A;  2XKP A;  4B8X A;  2OU2 A;  1KYZ A;  3DPL C;  1R5H A;  1HST A;  2JPB A;  3C7J A;  3KCC A;  1O3R A;  3DF8 A;  3MAJ A;  4CGZ A;  4UHT A;  2KKO A;  5K5R A;  2L01 A;  2QWW A;  4G9Y A;  4RB1 A;  3EQL F;  1WSU A;  3V7R A;  1AWC A;  4BHP A;  2IPQ X;  4WWC A;  1RNL A;  3BJ6 A;  1WI9 A;  2JT1 A;  4CXF A;  1P4A A;  3HRU A;  4IXA A;  3JSO A;  2RGV A;  2UXN A;  3TOA A;  3D0S A;  1OMI A;  3TO6 A;  1W7P B;  4R79 A;  2QZ8 A;  3WE2 A;  4IVN A;  5L3C A;  5TJJ A;  1I6X A;  3D5L A;  2O0Y A;  3BRO A;  3E6M A;  4E70 A;  2O61 A;  2A68 F;  1SD7 A;  4OIR F;  3R61 A;  2DAO A;  4S05 A;  2HTS A;  4I0A A;  1XSV A;  2RN7 A;  1S29 A;  3RJP A;  3SQN A;  5K1Y A;  1UCR A;  4HX4 A;  5HDG A;  4JQF A;  2UXX A;  1ONV A;  4PGH A;  1XMK A;  3HTS B;  2IP2 A;  1MJ9 A;  4XLN F;  2MH9 A;  2ZNZ A;  3MQ0 A;  3C18 A;  3WTX C;  3W6J B;  3QOP A;  2GA1 A;  4OIP F;  2STW A;  1SD4 A;  1I1G A;  3F22 A;  2CQK A;  2XKO A;  2RVC A;  4IRH A;  2KRF A;  3WOD F;  1IXC A;  1FSE A;  2FOK A;  3BOQ A;  1G4D A;  2V1D A;  1QPM A;  4UV9 A;  5HLH A;  1JGS A;  5CYV A;  1V4R A;  4EGZ A;  2HGC A;  3NRV A;  4UNO A;  1MD0 A;  2FSW A;  1BC8 C;  3RDI A;  2VC1 A;  5BQT A;  2MA3 A;  4A6D A;  3T0Y A;  3S2W A;  1IUY A;  4HF1 A;  3MEX A;  3HYI A;  3HRS A;  4L9J A;  3G3Z A;  3IWZ A;  2EK5 A;  3N97 A;  2IRF G;  3FMS A;  4L9T A;  3ERE D;  4ENM A;  4CDG A;  4RB2 C;  3BZ6 A;  2OA4 A;  4ENN A;  4KN4 X;  1J7K A;  1KU3 A;  2W57 A;  2EFW A;  3ZN1 A;  1XN7 A;  1FLI A;  3MFK A;  2VE9 A;  1RUO A;  2P4W A;  2V9V A;  1E17 A;  3RPQ A;  2O6G E;  4P9F A;  2A5Y B;  5CVI A;  2BE5 F;  1O3T A;  5LRR A;  1BIA A;  2COM A;  2NNY A;  5L3F A;  2GZW A;  1TW2 A;  2FU4 A;  2FEZ A;  2JZY A;  4XSX F;  2KIF A;  3CUQ C;  1BC7 C;  1S8N A;  3KLN A;  1FOK A;  3TOB A;  3VOD A;  3WTW C;  3HIF A;  2GWR A;  3L2C A;  4WF2 A;  5ICC A;  2P7C B;  1QGP A;  1O7L A;  2CW0 F;  3RYR A;  3HRM A;  1K7A A;  3G73 A;  1Z1D A;  3QP5 A;  5DYM A;  2L3D A;  3MWM A;  1IN4 A;  3V4G A;  1U3E M;  2ETH A;  3FF5 A;  2PMU A;  1BI0 A;  1L3L A;  3IWF A;  3I59 B;  2L4M A;  5J6X A;  1K78 B;  2CWE A;  5E18 F;  2Z3Y A;  3M8F A;  3C3W A;  1IN6 A;  3I0T A;  3FX3 A;  4G7H F;  4MGR A;  2Q0O A;  2STT A;  5DCM B;  3SHF A;  2EA4 A;  2Y75 A;  2GA2 A;  3I5U A;  1EV7 A;  4LD5 A;  1QZZ A;  3LWF A;  3ML6 A;  1RUN A;  1FBQ A;  4BAY A;  2IT0 A;  3V8J A;  4XBF A;  3R6S A;  2LDU A;  2W24 A;  3GUD A;  3I64 A;  3ABU A;  1P2F A;  1YYV A;  1FP1 D;  2CG4 A;  2NRA C;  3GFI A;  1U5T C;  4KA4 A;  1UB9 A;  1R1V A;  2HKO A;  3RI4 A;  1YQA A;  4YFX F;  3TGN A;  2EV5 A;  4KN7 X;  3RIR A;  5AON A;  4MTD A;  1SMY F;  4I98 B;  3V8L A;  2IJL A;  4KNY A;  1ZG5 A;  2P6T A;  4IPA A;  3FXQ A;  2A6H F;  1H0M A;  1F1Z A;  2VOP A;  1XDS A;  1IN8 A;  5D6F A;  3ZP5 A;  4A0Y A;  4S04 A;  1K78 A;  1ZRE A;  1SD5 A;  4EJU A;  2GXB A;  4N9I A;  2NS0 A;  5HLI A;  5L3B A;  5DUI A;  3C1D A;  4RGR A;  4AD9 A;  2XAJ A;  1CF7 A;  2KIU A;  1P4W A;  3M9A A;  1MJA A;  2D2W A;  1O3S A;  4LFU A;  3RKW A;  2A07 F;  1WQ2 A;  1YS6 A;  2VON A;  5BPI A;  4ESB A;  4LG0 B;  3KP3 A;  1T38 A;  4KIF A;  4WK8 F;  3SZT A;  2DTR A;  2F5F A;  1S7O A;  1YIO A;  5DD4 A;  3TO9 A;  4OMY A;  5BMZ A;  4UVA A;  2P6S A;  2FMY A;  2LKP A;  2QQA A;  2D45 A;  2H6B A;  3MZH A;  3TO7 A;  1HW1 A;  3GW2 A;  4M6X A;  3HHG A;  3EDP A;  2FBK A;  2TDX A;  1YTY A;  5FO5 A;  2RNJ A;  3BJO A;  2XHK A;  3KZY A;  2DT5 A;  4UVC A;  1R36 A;  4I01 A;  1FPQ A;  3DXJ F;  2UZK A;  4IHT A;  2Y48 A;  4PCQ A;  3TQN A;  1XGN A;  3ECO A;  4RGS A;  1W7P A;  3LAJ A;  4I02 A;  1LVA A;  3ZMT A;  3WU1 B;  4G6D A;  3QU3 A;  4M72 A;  5KVR A;  1USS A;  4BHB A;  5E1X A;  1MZB A;  3HSF A;  3CO7 C;  5BS6 A;  3J81 K;  1IRF A;  1CF7 B;  2PJP A;  1XCB A;  1PP8 F;  2YSR A;  2HYG D;  5EEG A;  5DUK A;  1ULY A;  2XAF A;  2L02 A;  4WXD A;  1FZP B;  1YG2 A;  4GXO A;  2VT3 A;  1GHC A;  1FSH A;  4RAZ A;  1PP7 U;  3BJA A;  2EFQ A;  1ZAR A;  1U2W A;  2QBY A;  2XIG A;  2OQG A;  1REP C;  3FMR A;  3F8N A;  1BI1 A;  5CVJ A;  3KP6 A;  3H92 A;  4OU0 A;  5ICG A;  1XDU A;  4ASN A;  2DI3 A;  4L9N A;  5HOO A;  3P9I A;  2FBI A;  3LFK A;  1R5G A;  3LAP A;  1J2X A;  2VC0 A;  4WXC A;  4XSZ F;  3Q9V A;  4Q4Z F;  2CO5 A;  1HW2 A;  3E6C C;  1TQI A;  4GGG A;  1XSD A;  1XMA A;  2HQR A;  2HFH A;  3F3X A;  3KE2 A;  3WTT C;  4RB0 A;  5IT9 K;  4BYY A;  2O8X A;  4NHJ A;  3HOT A;  3K9T A;  3O6B B;  2VOO A;  1CGP A;  3ELK A;  3IKV A;  2PLY A;  4EJW A;  2P5L C;  1IXR C;  1OKR A;  2Z9O A;  1JXS A;  3I53 A;  1BM9 A;  4M9Z A;  2Z33 A;  3ZQ7 A;  4MTE A;  3DP7 A;  2VN2 A;  2P8T A;  4KMU X;  5L3G A;  2M87 A;  2VBW A;  4M74 A;  5D6E A;  2PFB A;  2VOD A;  3F8M A;  4TV7 A;  1ZGA A;  3GO5 A;  3J7A O;  2QUF A;  2QBY B;  4A0Z A;  3ZMD A;  4A2U A;  5E8I A;  3LST A;  2BV6 A;  3Q5F A;  1VTN C;  4L0Y B;  4EM1 A;  5ICF A;  1T98 A;  4H0E A;  5HS7 A;  3B02 A;  4PZJ A;  2XVC A;  5DCF A;  2YPR A;  2DLL A;  2XAQ A;  4ENK A;  2EFP A;  2M1B A;  2W25 A;  1D3Y A;  1IZ1 A;  3HHH A;  4EMS A;  1FNN A;  2A3S A;  5D4S A;  4L0Z B;  3F23 A;  3MCZ A;  2V1X A;  2DK8 A;  1L0O C;  1D8K A;  1R1T A;  4WX9 A;  2H94 A;  2HKX A;  2R3S A;  1BBY A;  4A0X A;  2HDC A;  2G9W A;  2OAZ A;  5JR3 A;  3IC7 A;  3K1M A;  1R00 A;  5E1Z B;  3P9C A;  2HZT A;  2Q2E A;  3JTG A;  2VT2 A;  1LB2 A;  3I59 A;  1R1U A;  2HQN A;  2JSC A;  1B6A A;  4M6Y A;  3T5X A;  4CO8 A;  4NQW A;  4I09 A;  1KQ8 A;  4ZYD A;  4LB5 A;  5HDK A;  5D4R A;  5DCM A;  1IN5 A;  4RGU A;  5L3E A;  3ZMS A;  1BN5 A;  5ICE A;  3K1N A;  1TNS A;  1I5Z A;  3I58 A;  4WXH A;  2FE3 A;  4XLP F;  2VBZ A;  5ED4 A;  2ESN A;  2ZNY A;  4LK0 F;  1U8R A;  4FT8 A;  4L18 B;  1KU7 A;  3CDH A;  3DV8 A;  1LJ9 A;  2DW4 A;  2Z99 A;  1DPR A;  4B09 A;  3WGI A;  5DEQ A;  1KU9 A;  5E17 F;  2J5O A;  2MLG A;  3KFW X;  1TQM A;  2ZME A;  3GFM A;  3JAM K;  2DQL A;  1ZN2 A;  5HS8 A;  1XCV A;  2FNP A;  4A6E A;  5A2Q Z;  1ZGJ A;  2D1V A;  1KQ9 A;  2YU3 A;  4ZYG A;  1DDN A;  3GFJ A;  3PQJ A;  4A5N A;  4PDK A;  5H6Q A;  2BYV E;  2FBH A;  4CYD A;  5H20 A;  1QZY A;  5HVQ C;  2ELH A;  4AIJ A;  2LNB A;  4YFN F;  2KJB A;  2LF8 A;  1T2K A;  2WV0 A;  3FXR A;  4U7B A;  4HF0 A;  2CGP A;  3L7W A;  4I7H A;  4HV5 A;  1Q1H A;  2K02 A;  4G94 A;  3ZPL A;  4F7Z A;  4ZYH A;  4Q48 A;  3FM3 A;  4HBL A;  4ZZD A;  4U7D A;  4CZZ A;  2FA5 A;  3WTZ A;  2QVO A;  2DK5 A;  2IA2 A;  1U78 A;  1QBJ A;  1FWZ A;  3GZ6 A;  4KIC A;  3WU0 A;  2FQ3 A;  4N9H A;  3GFL A;  4HLX A;  4OIN F;  4U88 A;  4LLN A;  1YO5 C;  2H6C A;  2EFO A;  4LG0 A;  5H6R A;  3JW4 A;  3CUQ B;  3P9K A;  5HS9 A;  2R7F A;  3V7S A;  5JVT A;  5E8G A;  3QP6 A;  1SD6 A;  1HBX G;  1LEB A;  3T8T A;  4HDV A;  1HXD A;  2BEO A;  2ZME B;  5L3D A;  4A5M A;  4MNU A;  1ZLJ A;  3PQK A;  4XRF A;  3QU6 A;  1MJB A;  2RQP A;  4AIK A;  5CVR A;  1JHF A;  5D5U B;  1P6R A;  2J5P A;  3V7C A;  3HSR A;  5D8L B;  3GF2 A;  1ZG1 A;  2FF4 A;  1A04 A;  2FML A;  1V3F A;  5LBQ A;  4R1H A;  3JTH A;  4LK1 F;  4KT5 C;  1PDN C;  2HOE A;  4HX8 A;  3J80 K;  2E7X A;  4M73 A;  2AXL A;  2M30 A;  3WG9 A;  5E1W A;  3NEU A;  1YFH A;  3EET A;  3CUO A;  1LQ1 A;  2EFN A;  1WRJ A;  1QO0 D;  2P5V A;  3VB2 A;  1ZHF A;  3K0L A;  5KK1 A;  5J8C A;  1RIO H;  3E3V A;  3R0A A;  3VOE A;  3EUH A;  2M5W A;  4BQA A;  3CLO A;  5F1R A;  1ODD A;  4EJO A;  1H9G A;  2GXG A;  4ESF A;  1TTY A;  4G6Q A;  1EH6 A;  4OIQ F;  2XV4 S;  4HV6 A;  3OV8 A;  2XAH A;  4GYG A;  1FX7 A;  2O3F A;  3CUQ A;  4UXN A;  5HDN A;  3ZN0 A;  1UHM A;  3DEU A;  4UV8 A;  3NQO A;  1W4M A;  1B1B A;  3RKX A;  2XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...