1JGSA

Multiple antibiotic resistance repressor, marr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
publication title The crystal structure of MarR, a regulator of multiple antibiotic resistance, at 2.3 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jgsA00
1U8RA 2P4WA 3BPXA 1H0MA 2KJBA 4L0YB 1XMAA 3KZYA 2MH9A 1MGTA 3WTVC 1FYMA 5H20A 4KIBA 3KP6A 4UV9A 3R61A 5D6FA 3TO7A 2P5LC 3WG9A 1SMYF 3M9AA 2PMUA 1Z05A 3E6DA 5E20A 1G3WA 1IN4A 3KEQA 3CTAA 1HXDA 1XDSA 1ZGAA 3P7NA 5FFZA 3WTUC 3GFIA 5E1XA 3ZMUA 4IF4A 3ISPA 4AIKA 3L7WA 5IT9K 3WTXC 5DD4A 1LDJA 3NQOA 1I5ZA 2MLKA 2A6HF 1RUNA 2F5DA 1O3SA 2EFNA 4UNOA 3HOSA 4BQAA 2MBFA 3IKTA 4LB6B 1Z6RA 2PFBA 3HHGA 2DPDA 2H6BA 5CVRA 2AS5F 2OBPA 1B4AA 4A5NA 5CLSA 1KYZA 2L3DA 1Z7UA 3HHHA 1HKSA 1J2XA 2K27A 2D2WA 2JPCA 2ZFWA 4P9FA 5EEGA 5K5OA 2Z33A 3L9FA 2XKPA 1TBXA 1DP7P 2NRAC 3SFZA 1ZH5A 1G3TA 4MEYF 1FYLA 3U2RA 3J80Z 1EV7A 2P6TA 3KETA 2QZ8A 2OAZA 4IJAA 1QGPA 2EJRA 2HKXA 3QAHA 4ZZLA 3GF2A 2P8TA 3QP6A 4P5OA 1XCBA 2QQAA 1HSJA 4RB1A 3ZQ7A 1IXCA 4YG2F 4TV7A 3CUQB 3KFWX 5CYVA 2IVMA 1BC7C 3IKVA 1LJ9A 2STWA 4EGZA 1T39A 3GX4X 1UHWA 3CO7C 2M45A 1FP2A 3T5XA 3OV8A 2EWNA 3WTWC 2WV0A 4KIFA 5DCMA 3ZPLA 3GLXA 2VBXA 3EYYA 3C7JA 3V4GA 2G7HA 2CG4A 3F8CA 4RB2C 1YS7A 3I58A 3F6OA 1FY7A 4HOBA 3KP2A 1QQIA 1L0OC 2WWYA 1MJBA 5CVIA 4D0PA 3GWZA 4MTEA 4I98B 5TRDA 2EFPA 1ONVA 1USSA 2XAGA 1PP7U 3LQRA 2FBHA 5LEKA 3RYRA 1P4XA 2EFOA 4HDVA 1C0WA 2FNAA 4P9UA 1OMIA 4L9NA 4PDKA 2FE3A 1B6AA 5CVJA 4G6DA 2QENA 3L09A 4WWCA 4CYDA 3IRQA 3T8TA 2V1UA 3C18A 1BM9A 1PDNC 5LRSA 2BYVE 1H9TA 5H6QA 2LF8A 5JHUA 3I59B 2O0YA 5ED4A 1W5SA 1IUYA 4BAYA 4LLGF 1IN5A 2GZWA 3K1MA 3GW2A 4LK0F 3KZZA 3JSPA 4UUVA 3H92A 3V8KA 3BPVA 3RKYA 1IXSB 4R1HA 1XGMA 5BPIA 1U78A 4N9HA 5EEHA 3BJOA 2WC2A 2A68F 4ASNA 2IA2A 2TDXA 4CICA 2GWRA 1ZLKA 2YX7A 3V7SA 3FMSA 3KLOA 2NAZA 2P6SA 1USTA 4WF2A 2FRHA 1XD7A 1STZA 3ABUA 1F5TA 1J0RA 3TQNA 4ESBA 2ETHA 3J80K 3KEOA 3I54A 2OQGA 1MDMA 2IJLA 1HW1A 4AIHA 2QBYA 1HKTA 4P55A 2EFQA 3ZMZA 4R79A 3F8NA 2FOKA 4IXAA 2XRNA 3GYHX 4M71A 2F5FA 3G73A 4XSXF 5HOOA 2DTRA 2XAQA 3RKXA 4HLYA 5A2QZ 5LBQA 3U1DA 2FNPA 4ENKA 2K7LA 5AIQA 2KKOA 2CO5A 1ZRDA 4BHPA 2ISYA 2CSOA 2J5OA 2W84A 4U0WA 4ESJA 2FA5A 1YLFA 4A0YA 4CDGA 2VC0A 4RGSA 1O3RA 3ABTA 4MEXF 1OPCA 3MWMA 2HKOA 4U0YA 3F8BA 5KK1A 2L4AA 2GA1A 1BI3A 5FLXK 1KU7A 4Y13A 3GZ5A 2V79A 4KNYA 3HSEA 3D0SA 2Z9OA 1ON1A 1ZGJA 1XGSA 2LDUA 3FZVA 4UHTA 5BPDA 3H3ZA 1D3YA 1ULYA 3F23A 4P96A 4L9JA 4DNCA 4OU0A 5D5WB 1FSHA 2HS5A 5BS6A 5LEJA 1WWXA 2R3SA 3W6JB 4PZJA 5D4SA 5E18F 5HS7A 1KQ8A 1YO5C 2AXLA 4ON0A 2Z99A 1QBJA 1UHMA 5JVTA 5DDGA 2QLZA 5DCMB 2ZMEA 1RZ4A 4G7HF 1ZYRF 2H27A 4UVCA 2M8EA 2DAOA 1RNLA 5LLQA 2D45A 4MQVA 2YSRA 3REOA 1JHHA 4IVNA 5L3BA 2DLLA 5K1YA 3VEPA 2GAUA 3PQKA 5FD6A 4YFNF 3ZMDA 4ETSA 3IHUA 3E5UA 1HKQA 2P5VA 1LVAA 3CJNA 2OQRA 4U7DA 1YS6A 1O3QA 4HF0A 1W7PD 1LEAA 2HOEA 1YW7A 5A2QK 5IT9Z 1W7PB 4K2EA 4HYEA 2PQ8A 5CJ9A 1BI2A 4BHCA 4HBLA 3WU1B 1V4RA 2JRTA 4O3MA 4OIPF 4KN7X 4U88A 1XN7A 3DXJF 4OIOF 2NNNA 4CGZA 4LGWA 4OMYA 1BI1A 4KYWA 3TGNA 3ROUA 3WGGA 2MLGA 4RB0A 2A5YB 5FO5A 5TJJA 4KDPA 1ODDA 4XRFA 1R1VA 2GQQA 4S05A 1KU2A 1SFXA 2A69F 1B9MA 3CO6C 3LFKA 4HQEA 4R8HA 4G6QA 3L00A 2KJCA 4GYGA 2ADUA 5L3GA 2NS0A 3MQ0A 3MZHA 1LDDA 2XAJA 2EA2A 2KRFA 5K5QA 3K9TA 3HYIA 3RIRA 2UXNA 4EM2A 3S2WA 4ZZDA 2EK5A 4OIQF 4O5VA 3ULQB 4HV6A 1F9NA 4UV8A 2HFHA 4F7ZA 3DKWA 4ZYEA 2C6YA 1G6NA 4JQFA 2V1DA 1FT9A 4KN4X 1DUXC 2H09A 1Q1HA 5E1ZB 2FU4A 2ZO4A 2HTJA 1Z9CA 3O6BB 3IC7A 2DQLA 1U5TB 1R00A 3ECOA 3SQNA 3EETA 2NNYA 1SD5A 5HVQC 3LA3A 2M30A 3F22A 4EM0B 2DK5A 3GFMA 1SAXA 2VBYA 3SHFA 2W25A 3T0YA 1OYIA 5LGNA 2F5CA 1J5YA 3N4MA 2P7VB 4Y17A 2HQRA 3VODA 1D8KA 4A12A 1VTNC 2HTSA 3HOTA 1ZG3A 2O3FA 4KMUX 2PI0A 4HF1A 5CVUA 2X4HA 2VONA 1DPUA 1KA8A 2O03A 4LD5A 1G3YA 2IW5A 1ZAOA 2OD5A 3F8MA 2JTVA 2OZ6A 4NB5A 3D5LA 1IN6A 2ZMEB 4LG0A 1IAWA 5ERIA 1CF7B 4IRIA 4WXCA 1FP1D 1I27A 1OKRA 1YQAA 4XLNF 4FT8A 4MQ9F 1DDNA 3HTSB 4RS8A 2XASA 2UWMA 1P6RA 3CUOA 2LF7A 2VBWA 4EJVA 3SZTA 4PGHA 3DP7A 1J9IA 4A6DA 2E1NA 4FX4A 1H9GA 1YIOA 5AONA 1FC3A 1SD4A 2GXGA 1XSXA 3RPQA 2CYYA 4XLPF 2VODA 3RKWA 3R6SA 1LEBA 2HDCA 1Z1DA 2KIFA 4HW0A 5ILUA 4G7OF 4OINF 1GXPA 3ZN0A 3HSFA 5JFRA 4EGYA 2Q2EA 3NEUA 3F3XA 3ZN1A 2RV8A 5LGUA 3BY6A 1Y0UA 3U9GA 1PP8F 4HLXA 2Z5UA 3AAFA 2L02A 2OU2A 4G7ZF 5ICFA 5FLXZ 2L4MA 3GFLA 2UXXA 2VN2A 4LJZF 4WCGA 1I1GA 2VOOA 1OYYA 2Y75A 5J8CA 3JAMZ 3BDDA 2G7UA 1MD0A 4HX8A 3KP5A 3FF5A 1FX7A 2PN6A 4Q48A 3Q9VA 2A6EF 3V7RA 2L01A 3WODF 3JW4A 2COMA 4E70A 1B9NA 3B73A 3DEUA 2G9WA 3J81Z 1KYWA 1QNTA 3H3UA 3R0JA 1T2KA 3I4PA 3IL2A 2ESHA 2QQBA 1UFMA 3L2CA 2WTEA 4M74A 1BIAA 1YTYA 4RAZA 1FWZA 1R36A 1XDUA 2HYFA 2V6CA 2YR2A 4H0EA 4U0VA 1V3FA 3P9CA 4L9TA 1RI7A 3KP3A 3JSOA 3M1EA 2JPBA 5LHIA 2JZYA 3QU6A 4G9YA 3ZMTA 1KQ9A 5E8GA 1Z91A 3LAPA 1BI0A 2XAHA 2F5EA 2EV6A 5DUKA 2ZBKA 3MCZA 3M8EA 1S7OA 1K78A 2FXAA 2Y0MA 2M87A 2XGXA 3QPHA 2GIVA 4WXDA 2XIGA 3LWFA 4LLLA 3RTRA 4MHGA 1YW8A 4RGXA 2IRFG 3JTGA 3IWFA 4O6JA 2P7CB 2J5PA 1TQMA 3R4KA 1U6GA 5D5XB 3WE3A 4LLNA 3CLOA 1LQ1A 3T1BA 1SFEA 4IRHA 1QZZA 1L3LA 1MJAA 5IT3A 3FXRA 2Q0OA 2QQ9A 3JAMK 2H94A 4ESFA 2LSOA 3DF8A 1RUOA 2FBKA 2A61A 3Q5FA 2B0LA 1R22A 3BOQA 2E7WA 1FNNA 3EDPA 3I0TA 2IA1A 3GXOA 1HW2A 1J59A 3O3KA 3J81K 3RDIA 4KIGA 3TDZC 3WTZA 3V8JA 2XHKA 3V7CA 2VXZA 4ZYDA 3WTSC 1UB9A 3BROA 4N0BA 1IN8A 4FHTA 5BQTA 2CWEA 2E1CA 3WGIA 5F64A 4RB3C 4ZYGA 1SFUA 3GO5A 4IHTA 4AWXB 4EJUA 4HX7A 5E1WA 2XKOA 3IRRA 1JHFA 3EUHA 1TNTA 1W5TA 2YU3A 4A0XA 2CW0F 1K79A 4CO8A 2QVOA 1AOYA 1XGNA 1ZHFA 1BC8C 1HW5A 5CVVA 4KICA 4UVAA 5LHHA 1O7FA 1SD7A 1LDKB 3EYIA 3O2PE 5DD8A 3RPUA 3HTUA 5D5VB 3CUQA 1JE8A 1G4DA 2DFIA 2FSWA 2K86A 2HQNA 3TOBA 1XSDA 3VB2A 2STTA 5K5RA 4M9SA 5F1RA 2PG4A 3OOPA 5HLGA 3P9KA 5F6FA 2PMHA 1F1ZA 5FFXA 3LA7A 2R7DA 2YPRA 4JBAA 2W85A 4LFUA 1TW3A 4G8XA 2IT0A 1T0FA 4QWQA 1KGSA 3DV8A 2DK8A 4OMZA 4UVBA 4MNUA 1EH8A 3Q9SA 2VC1A 3NRVA 4ENJA 3ERED 1D8JA 4DQ2A 5E17F 4EQQA 3K69A 2HWVA 1FLIA 1MDMB 4EJTA 4AIJA 3LQQA 1IW7F 1Z6TA 2K02A 3BZ6A 3TO6A 5D5UB 3ELKA 2QBYB 1GXQA 1R1UA 2Y48A 5HS9A 4I7HA 4A5MA 2KIUA 1U3EM 1D5VA 1TLHB 3FM5A 4Q5SF 1ZN2A 5AIPA 4YFKF 3I59A 3FX3A 4IPAA 2V9VA 1LB2A 3SXYA 4HQMA 4YIIA 3KP7A 4NHJA 1E2XA 3WTYC 4XSZF 5HDKA 2MD5A 3FXQA 1R58A 1B59A 3FWEA 2RC4A 3K0LA 3ML6A 1EH7A 4ZYHA 5JI6A 1R5HA 2D1VA 2DI3A 4WK8F 1WQ2A 4S04A 4M72A 2DU9A 1KU9A 3QRFF 4MGRA 4M6XA 4BNCA 5D8KB 3E5QA 3BJ6A 4LB5A 2X0LA 5L3DA 2D1HA 1S8NA 2MC3A 1DPRA 1BN5A 1PUEE 2EV5A 4GCVA 3E5XA 4I0AA 5ILVA 4EVIA 3BJAA 4CXFA 1ZLJA 2JSCA 1LNWA 2F2EA 2BV6A 3HRUA 1HSTA 1EH6A 3FM3A 3WTTC 2ESNA 2ZCWA 5LRRA 4LMYA 1XGOA 2ACJA 2A07F 1FBQA 4A6EA 3I71A 4LK1F 1R5GA 5E8IA 3HRTA 3ECHA 2EA4A 4EJOA 4I2OA 1X3UA 2DBBA 3M8FA 4Q47A 3I64A 1QO0D 3B02A 2E7XA 5L3FA 4L0ZB 1BBYA 2LNBA 3CUQC 4I01A 2VT2A 1K6OA 2CGPA 4EM1A 3LSTA 5HLIA 1FBUA 3FMQA 2BGCA 4I09A 1R23A 3RI4A 3DPLC 3GVAA 1S29A 3MZYA 1YG2A 2OZUA 2XV4S 1IRFA 3DPTA 3MFKA 1ZARA 4RGRA 2FMLA 1XB4A 4M6YA 2BE5F 3CDHA 2ELHA 1E17A 4KFCA 5HS8A 2FF4A 1UCRA 2ZXJA 4HA8A 4I02A 1BIBA 1ON2A 4RAYA 4I0BA 4KA4A 2PEXA 3E3VA 2DO7A 1R1TA 2CFXA 2RVCA 3HIFA 4AD9A 4N9IA 1CGPA 4BYYA 2RNJA 1GHCA 4MTDA 3TDUC 1O57A 3R60A 4IHSA 3GZ6A 4YFXF 1FBSA 3V8LA 4OIRF 5ICGA 2FBIA 3ZP5A 3FHZA 1IN7A 1YFHA 1FOKA 4UXNA 1JXSA 3KLNA 3LA2A 1T98A 2VE9A 4KMFA 4RGUA 4QLCU 3KP4A 4GXOA 4Y15A 5J8FA 4L18B 2MH2A 3WU0A 3E97A 2HR3A 3I5UA 2QM3A 4M73A 4BHBA 6PAXA 2W57A 3KE2A 3IWZA 4A2UA 2FMYA 2EV0A 4ENNA 2VOPA 2ZNZA 2ZKZA 3F6VA 1T6SA 5ICEA 1TW2A 5ILSA 4G94A 5LHGA 2VE8A 1W7PA 3F72A 1S6LA 4A0ZA 2HGCA 4PGGA 3PFIA 1K7AA 4M9ZA 1J7KA 4GYIA 5L3CA 4NQWA 2Z3YA 1TQPA 3MEXA 2ZNYA 5HDGA 2VT3A 1ZG5A 5FB2A 4ENMA 1WSUA 1YW9A 3QP5A 3DQVC 1YYVA 3F21A 2RN7A 4EV0A 1XCVA 3N97A 3J7AO 3QU3A 2HYGD 5FGMA 5DV5A 2Q8KA 1U2WA 2YX4A 5HDNA 1S7AA 2DQRA 2RDPA 2FQ3A 3GUDA 1KU3A 4KT5C 3WGHA 3HRMA 1G3SA 2R7FA 4Z2YA 1BJAA 1BOAA 1XMKA 2CQKA 5HLHA 1QPMA 4Q4ZF 2L54A 1KQ0A 2IA0A 1IXRC 1ZRCA 1REPC 1P4WA 3I53A 5BMZA 5BOXA 2GXBA 1ZG1A 5JR3A 3BP8A 1HBXG 5ICCA 2O6GE 1MKMA 4EMSA 1W4MA 2MA3A 1O3TA 4LG0B 2PLYA 2EB7A 1I6XA 4PCQA 1U5TA 1RIOH 3C1DA 4HDUA 3E6BA 3QOPA 3JTHA 2XAFA 5DUIA 4BXUA 1FSEA 1SD6A 2BBYA 4FX0A 2OA4A 3K2ZA 3E6MA 3W6KB 2UZKA 1AWCA 2FEZA 3VFZA 2V1XA 2PBIA 4CHUA 2NYXA 2ZJ2A 4L5IA 1A04A 4BH9A 1OYWA 3GFJA 4EJWA 2IP2A 3EQLF 5H6RA 4HAMA 5J6XA 4HV5A 3ZMVA 2XROA 1ZREA 4GGGA 2XVCA 1MZBA 2O61A 2P5KA 2K4BA 4JK1X 2HEOA 1P2FA 2HZTA 5DCFA 2QYOA 1R7JA 1S3JA 1WRJA 2O8XA 4HZFA 1CF7A 3C3WA 2W24A 4AVPA 4IRGA 1FYKA 1JGSA 3PQJA 4B8XA 1GVJA 4U7BA 1MJ9A 1FZPB 4L9VA 2DW4A 2M1BA 3K1NA 2IPQX 3GEZA 3SZPA 4M9XA 3QPTA 3MAJA 2DPUA 3KCCA 1IRGA 4KUMA 4XBFA 1IF1A 2RQPA 2ISZA 2BEOA 1WKMA 3LAJA 3M7GA 4WX9A 2K4JA 5D8LB 2QUFA 3K1PA 3FXUA 1HQCA 1XSVA 3COAC 1TNSA 4GO1A 2M5WA 3RYPA 4WXHA 4HX4A 1SMTA 2KIMA 3T8RA 1ZRFA 1B1BA 2EFWA 1P4AA 2RGVA 1TTYA 1J75A 2GA2A 4OOIA 3P9IA 5L3EA 2DT5A 1T38A 1F4KA 2PJPA 4L5JA 1IZ1A 2RKHA 3TOAA 5DEQA 2H6CA 2XUBA 1NHAA 5LGTA 2QWWA 2JT1A 5FD5A 1QZYA 2A3SA 3FMRA 3WE2A 3TKYA 5D6EA 3BWGA 3DFGA 3TO9A 3HSRA 3E6CC 1P92A 1I1SA 4B09A 1TQIA 4YIFA 3VOEA 1U5TC 3RJPA 2VBZA 1K78B 3G3ZA 1OR7A 3R0AA 5D4RA 4HF2A 2LKPA 4ZH4F 5DYMA 3HUGA 1WI9A 1FPQA 1O7LA 5KVRA 3HRSA 3F8FA 3ZMSA 4CZZA
chains in the Genus database with same CATH superfamily
5CKTA 1U8RA 4S0HB 5FROA 2P4WA 4BY1J 3BPXA 2KISA 2KLOA 5M5WJ 1H0MA 1XC5A 2AQFA 3TP3A 2LG4A 4GRIA 2KJBA 4L0YB 1XMAA 3KZYA 2MH9A 1MGTA 3WTVC 2K9MA 1FYMA 2H1LA 5H20A 4KIBA 3KP6A 4UV9A 3R61A 2QGUA 5D6FA 5K7HA 3TO7A 2P5LC 2DYSH 2L7KA 2E2IJ 3OWTA 5BNGA 3WG9A 1SMYF 3JRDA 3M9AA 2PMUA 3S3MA 1WHUA 1Z05A 4I76A 5DM7F 4N4NB 1QHGA 3E6DA 5E20A 2X1EA 1G3WA 4ANJA 1IN4A 3KEQA 4XN0A 2Y0SA 3K10A 2OC6A 2E2HJ 1PUFB 1IG7A 3CTAA 1HXDA 3FIWA 1XDSA 2ZMEC 2V9KA 1ZGAA 3P7NA 5FFZA 3WTUC 5HNHA 5E1XA 3GFIA 2IAIA 3ZMUA 5B1BH 3CESA 3ISPA 4IF4A 2I5UA 4AIKA 1OISA 4IHVA 2JA8J 2VJ4A 3L7WA 5IT9K 3I56I 1U9OA 3WTXC 1I50J 2X1CA 1X4PA 5DD4A 5F0FA 1LDJA 3NQOA 1I5ZA 5C4XJ 3CLQA 2MLKA 4BEHA 2A6HF 3W3CA 3SDGA 1RUNA 2F5DA 3HOWJ 2A6TA 1O3SA 2EFNA 1TP4A 4UNOA 3ZXSA 2NOJB 4ZJZA 3HOSA 4BQAA 4GDFA 4BBSJ 2MBFA 4BL0B 5IP6A 3IKTA 4LB6B 4NNJA 3I3LA 1Z6RA 2PFBA 2M7AA 2JA5J 3HHGA 4E7SA 2DPDA 3H5AA 2H6BA 3CCJI 5CVRA 2NVYJ 1V55H 2AS5F 1MBHA 2OBPA 1B4AA 2VPLA 4A5NA 5CLSA 1KYZA 2B9SA 2L3DA 1Z7UA 1FOXA 1MMNA 3HHHA 1DGWY 2KZVA 3GBGA 1HKSA 1J2XA 1AKHB 2K27A 4V19K 4BXXJ 2D2WA 5E3NA 1VQPI 2JPCA 4XMYA 5JHFA 2ZFWA 2ZFUA 4P9FA 4DIQA 5EEGA 5K5OA 3P5JA 2Z33A 4XORA 2QSHX 3L9FA 4YIRX 2V1NA 2XKPA 3M3YJ 1TBXA 1DP7P 2NRAC 3SFZA 2VB6A 1VQ5I 4NDLA 1ZH5A 1G3TA 4MEYF 1FYLA 3U2RA 3J80Z 3IH2A 1EV7A 3HG9A 3IUOA 3K4JA 2P6TA 3KETA 2QZ8A 2OAZA 4IJAA 1QGPA 2EJRA 2HKXA 3QAHA 4IHWA 4ZZLA 1F36A 1HC8A 2W1OA 3GF2A 2P8TA 3QP6A 4P5OA 4C3JJ 1XCBA 2QQAA 3AFHA 4DJAA 1HSJA 4RB1A 1A5JA 4G6TB 4EEFG 1YOVB 3ZQ7A 1IXCA 4YG2F 2HOSA 4TV7A 3CUQB 3KFWX 5CYVA 3H3VK 2IVMA 1BC7C 3IKVA 2KRHA 1RKTA 1I39A 1LJ9A 2LY2A 3CCYA 2STWA 3LSPA 2NVUB 4EGZA 1T39A 3LSJA 2CV0A 2JVHA 3LSMA 3GX4X 5F04A 1UHWA 2F5VA 4NBQA 4L5EA 3CO7C 4IO9F 2M45A 5KAFC 2EZLA 1FP2A 3T5XA 3OV8A 2P0WA 2EWNA 3WTWC 2WV0A 4KIFA 5DCMA 3ZPLA 4CYCA 2ZJRF 3GLXA 1N78A 2VBXA 4UB8C 2HYJA 3EYYA 3C7JA 1Y1VJ 3V4GA 2G7HA 2CG4A 3F8CA 2Y0SN 2E34A 1T08B 1YS7A 3I58A 3QODA 1QVUA 3F6OA 1FY7A 1QVTA 4HOBA 1JT0A 2WAQA 3KP2A 1QQIA 2AQEA 1L0OC 1MJBA 3PM1A 5CVIA 4D0PA 2WWYA 1OCZH 3GWZA 2Y30A 4I98B 4MTEA 3NWTA 1OR7C 4C3HJ 5TRDA 2EFPA 1D1AA 1ONVA 1USSA 2XAGA 5IOZA 2X51A 1PP7U 3IP4B 3LQRA 1WZ2A 3BR3A 4ZYAA 4C2MJ 2FBHA 3G2BA 4XKWA 5LEKA 3K4MA 3RYRA 1P4XA 2EFOA 1W36C 3BG7A 4HDVA 1C0WA 2FNAA 4P9UA 3OYLA 4CA0A 4JP0A 1OMIA 4L9NA 4PDKA 2FE3A 1B6AA 1Z3XA 2E1MC 5CVJA 2R7UA 4G6DA 1JJ6C 1HF0A 2QENA 3L09A 1UJ8A 2LBFA 4CYDA 4WWCA 2VUMJ 3OOUA 3CP8A 4BKXA 3IRQA 1ORKA 3T8TA 2V1UA 3KX2A 1OFCX 3C18A 4XLHA 1BM9A 3B6AA 3ESWB 5K7FA 2M2EA 3EUKL 3OIOA 5LRSA 2BYVE 1PDNC 1VQKI 3OL4A 1H9TA 5H6QA 2LF8A 4A69C 5JHUA 2L0KA 3I59B 2RREA 2O0YA 3K4NA 2CRGA 5ED4A 1W5SA 3FHNA 1IUYA 5E79C 4IKFA 4BAYA 3IH4A 4LLGF 1IN5A 1FMVA 1N75A 2GZWA 3K1MA 3GW2A 5IYDJ 4LK0F 2DA2A 3KZZA 2BY3A 4XNFA 3JSPA 4UUVA 3H92A 1TWCJ 3V8KA 3S17J 3BPVA 3RKYA 1LE8A 2IGNA 1IXSB 2K9SA 1XGMA 2NS8A 4R1HA 5BPIA 1W36D 1U78A 1ACIA 4N9HA 5EEHA 1IJWC 3BJOA 4CH7A 2WC2A 2A68F 2F4IA 3IAM2 3JCUC 3E0JB 1DU6A 2DTZA 4XKBA 4ASNA 2IA2A 2TDXA 3DLAA 2NS7A 3MD2A 1A6IA 2KT0A 2R7SA 4CICA 4BUPA 4PJLA 4AM3A 2K9LA 2GWRA 1ZLKA 2YX7A 4A93J 4I6ZA 5IP7J 2MD0A 4BQQA 3MKYB 1E3HA 2BW3A 3V7SA 2DA1A 3FMSA 3KLOA 2NAZA 2P6SA 4OAYA 3HL2A 4ZTFA 1USTA 3WU2C 3OYNA 4WF2A 1R4NB 1N25A 2FRHA 1XD7A 3HOXJ 3IH3A 1STZA 2BY0A 3ABUA 1F5TA 1J0RA 3TQNA 3V42A 1H88C 4ESBA 2ETHA 3Q0UA 4QSHA 3J80K 3KEOA 3NAUA 3I54A 2OQGA 1MDMA 3ZOBA 2W7NA 2IJLA 1HW1A 1Y8RB 3S15J 4AIHA 2QBYA 2YU9J 2VQHA 3HOYJ 1HKTA 4P55A 1JTYA 2EFQA 3ZMZA 3VWBA 3HM5A 4R79A 3F8NA 2FOKA 3ABLH 4IXAA 1ETXA 2XRNA 1HDDC 3JRCA 4OAZA 4M3BA 3GYHX 4M71A 4J19A 2DYRH 2F5FA 3G73A 4XSXF 5HOOA 2DTRA 2WAQN 2XAQA 2ZXIA 3RKXA 1V5EA 3CDLA 3FBIB 1VQOI 4HLYA 5A2QZ 3OS0A 1QHHD 2HVQA 5IOYA 1UMQA 5LBQA 3BR1A 3U1DA 2FNPA 4ENKA 2HPIA 4UY8I 1DGRM 2K7LA 5AIQA 1QZEA 2KKOA 3GTQJ 5HODA 4BBRJ 4A3IJ 2CO5A 1ZRDA 3CMYA 3SEZA 4HPQA 2KQRA 1ZGWA 2GOMA 2VASA 1HLVA 1WJEA 1JUPA 5DTDA 4BHPA 2ISYA 1R6RA 3HJEA 4FTHA 2CSOA 2J5OA 3OYIA 2W84A 1K4TA 1FIPA 4U0WA 3HPGA 4ESJA 1UHSA 2EZKA 2FA5A 1YLFA 4A0YA 3H1CA 3LSIA 4CDGA 2VC0A 3A4CA 4RGSA 1O3RA 3ABTA 1LPQA 4MEXF 1OPCA 3MWMA 2MABA 4J00A 2DMNA 1ETYA 2HKOA 4U0YA 3F8BA 2RQQA 2DJNA 5KK1A 3PL8A 2L4AA 2GA1A 4XLAA 1BI3A 5FLXK 1KU7A 1APLC 4Y13A 3GZ5A 3Q0WA 3K4CA 1FTZA 4C2TA 2V79A 4KNYA 3FXMA 3HSEA 3D0SA 3LSHA 2DCEA 5EYRA 3CC2I 1QA6A 2W00A 2IXSA 2Z9OA 1ON1A 1ZGJA 2W82A 1XGSA 3BLYA 5GPCA 3M4OJ 2DA6A 2JVGA 2LDUA 2MW8A 3FZVA 2ZC2A 3LOCA 4UHTA 5BPDA 3H3ZA 2COBA 1D3YA 1ULYA 3F23A 2R5ZB 2OV7A 2VXDA 3EUAA 2HXIA 1EF4A 4P96A 4L9JA 4DNCA 4OU0A 3TMOA 5D5WB 1FSHA 2CUFA 2HS5A 5BS6A 5LEJA 1WWXA 5IYBJ 2R3SA 2VKDA 3W6JB 4PZJA 5D4SA 1Z77A 5E18F 1OCTC 2XGDA 2F4MB 5HS7A 1KQ8A 1YO5C 2AXLA 2XDVA 5DS9A 4ON0A 2Z99A 4KT6A 1QBJA 3DBRB 2QKMB 1UHMA 5JVTA 5DDGA 4ITVA 2QLZA 1B72B 3VPRA 5DCMB 3GTOJ 2JA7J 1F43A 2ZMEA 1RZ4A 4RM3A 3RZDJ 3RQ4A 1LFPA 3W2WA 4G7HF 1ZYRF 2H27A 1VQLI 1NG7A 3CDIA 4UVCA 2M8EA 1GT0C 2LK2A 2DAOA 2K3PA 1RNLA 1UELB 1R9TJ 5LLQA 2D45A 4MQVA 2CU7A 5IP9J 2YSRA 2IBDA 3KYDB 3REOA 1JHHA 4IVNA 2MG4A 2VKHA 3H35A 5L3BA 4W1UA 2DLLA 5CQEA 1MBFA 5K1YA 3CMAI 5J4VA 3VEPA 2GAUA 2KDZA 4HNTA 3PQKA 1QPIA 3ZRGA 5FD6A 2HVSA 3W2AA 4CCLA 4YFNF 3PIPF 3ZMDA 1BW5A 4ETSA 1H89C 3IHUA 3E5UA 1HKQA 2AO9A 4RM2A 2P5VA 1LVAA 3CJNA 2OQRA 4IZZA 3HDDA 1Z21A 1D0YA 2LVSA 1AU7A 4U7DA 1YS6A 1O3QA 4HF0A 1VQ9I 2X6XA 1W7PD 2CS3A 1XPXA 1V54H 1LEAA 1OCPA 3LMMA 2BVMA 4DOZA 1EJ9A 3S2DJ 2HOEA 3ERMA 1TL8A 1I6HJ 1YW7A 5J4YA 3DTIA 5A2QK 5IT9Z 2E5NA 2XB0X 1W7PB 4K2EA 3DU6A 3OL3A 4HYEA 5GP9A 4ABZA 2PQ8A 5CJ9A 1BI2A 2RNGA 3G6EI 4UUSB 4BHCA 3JRFA 3DKYA 2E5ZA 1E0EA 1P9QC 4HBLA 3WU1B 1V4RA 3SZGA 2DMUA 5GAEJ 2JRTA 4O3MA 4OIPF 3H9QA 1ERDA 3E7LA 4NQWB 4KN7X 2TCTA 5EGOA 1Y6IA 1RKWA 4U88A 2DODA 3OYJA 3H36A 2GOXB 1XN7A 3DWLE 2X85A 3DXJF 4OIOF 4A3LJ 3KYCB 4NUBA 1W1WE 2NNNA 2M0CA 1WJAA 4CGZA 4LGWA 4OMYA 1BI1A 2CUEA 3HPHA 1VZ0A 4KYWA 3TGNA 3ROUA 3WGGA 2MLGA 4RB0A 2DDBA 4AIDA 2A5YB 2BY1A 3S16J 5FO5A 2XSJC 5TJJA 4KDPA 2NVQJ 1ODDA 1ZK8A 4XRFA 1R1VA 2GQQA 4S05A 3JRBA 1KU2A 4F52A 2CJJA 1SFXA 5FRMA 3OIQA 2A69F 1B9MA 3CO6C 3LFKA 4HQEA 3AG3H 4AVZA 5M5XJ 3BG3A 4R8HA 2ZSHB 4G6QA 3L00A 1X19A 3WG7H 3ZQGA 2KJCA 1QRYA 4GYGA 2ADUA 5L3GA 2NS0A 3MQ0A 3IV5A 3MZHA 1LDDA 1OQYA 2DA4A 1JJ8C 4A3GJ 2XAJA 2EA2A 2KRFA 5K5QA 2EQRA 3K9TA 3HYIA 2X6YA 4XLEA 3RIRA 5C44J 2UXNA 3DTKA 2KDOA 4EM2A 3HC7A 3S2WA 1LUJB 4ZZDA 1ZELA 2EK5A 4OIQF 4O5VA 1WFXA 2K3FA 3ULQB 4HV6A 2H8RA 1F9NA 4M3DA 4UV8A 4M3EA 1YI2I 2ZJQF 2WB1A 2HFHA 5IY5H 4F7ZA 3DKWA 2OTLI 2JN6A 3VSLA 4ZYEA 3DEEA 2XPUA 1RRJA 1G6NA 2C6YA 1R71A 4JQFA 3U21A 2V1DA 1FT9A 4KN4X 1BW6A 1DUXC 5GAGJ 2H09A 3QYEA 1NK2P 1Q1HA 4XIDA 3OS2A 3I4MJ 1S72I 2CW8A 4FASD 1X1CA 5E1ZB 3J7ZI 1CQTA 1XTAA 4PFPA 2FU4A 1R5ID 2ZO4A 5HLTA 2HTJA 1Z9CA 4HEA2 3O6BB 3IC7A 3QPSA 4IOAF 2DQLA 1U5TB 1VQ6I 1R00A 2IGOA 2KZGA 3BG9A 1XG1A 3ECOA 2Y69H 1RPWA 5GPAA 3SQNA 2ID6A 3EETA 2NNYA 2L9RA 3S14J 1SD5A 5HVQC 1OCCH 3LA3A 2M30A 1HDPA 1KONA 4IL6C 3F22A 2CQNA 3BTCA 4EM0B 2DK5A 1FIAA 1ZTRA 3GFMA 1SAXA 2VBYA 3OSFA 3A01A 4FE7A 2QF7A 2DT6A 2EIJH 2HQ5A 3L2VA 3SHFA 2W25A 3T0YA 1OYIA 1XMXA 2VKEA 4F92B 2GM4A 5LGNA 4BACA 5EG0A 1Z0XA 4A3JJ 4XL9A 4BJ6C 2F5CA 1J5YA 3N4MA 1MBKA 4QPOA 2P7VB 4Y17A 1MH4A 2HQRA 2Y2ZA 4XK4A 3VODA 1D8KA 4A12A 1VTNC 2HTSA 3HOTA 1ZG3A 2O3FA 5JLXA 4KMUX 2PI0A 2L9VA 3CCVI 4ZTJA 4HF1A 5EZHA 3S1MJ 5CVUA 2X4HA 2Z2SB 2VONA 1DPUA 1KA8A 2O03A 4LIVA 4LD5A 4E6KG 3CF5F 3G71I 4HSTA 4E7HA 2DOFA 3H9JA 1G3YA 2IW5A 1ZAOA 4E7KA 2OD5A 3TL4X 2PMZN 3F8MA 2JTVA 4XLCA 1P7IA 1IGNA 2OTJI 2OZ6A 4NB5A 3JRAA 2X6OA 4V2FA 3D5LA 4QPQA 2R5YB 1OCRH 3DKXA 1IN6A 1IDYA 2ZMEB 4LG0A 1IAWA 2DXIA 2JA6J 5ERIA 1WH5A 1CF7B 4IRIA 4WXCA 1FP1D 4DYRA 1I27A 2EZIA 1OKRA 1YQAA 1JI8A 4XLNF 3AL0C 4FT8A 5E3OA 3GTJJ 5CQGA 2WB1N 1MNDA 3JR9A 4MQ9F 1DDNA 3HTSB 4RS8A 4E4HA 2XASA 2KL4A 2LY9A 2UWMA 1P6RA 1MMDA 2E19A 4D7MA 1E3OC 3TBIA 5GADJ 3CUOA 2HPMA 2LF7A 2VBWA 4EJVA 3SZTA 5FKLA 4PGHA 3DP7A 1J9IA 4A6DA 2E1NA 5KHDA 3GTPJ 1ETKA 1U0JA 4FX4A 1H9GA 1YIOA 3A02A 2DJIA 3BC8A 5AONA 1FC3A 1T0FC 3ZGKA 1OLTA 1SD4A 1XSXA 2GXGA 2Q1ZB 2NVTJ 1O4XA 3RPQA 2CYYA 4XLPF 2VODA 3RKWA 3R6SA 2FX0A 1VQ8I 1TWFJ 1WJ5A 1D1CA 3S1RJ 1YJWI 4M3FA 4NC8A 1LEBA 1MBEA 1H8AC 2HDCA 1Z1DA 4QIWN 2KIFA 1T8IA 1VQMI 1NH3A 4HW0A 5ILUA 4G7OF 2BHZA 3FKIJ 4OINF 1GXPA 3WHCA 3KZIC 3ZN0A 3OYEA 4E7JA 3HSFA 5JFRA 2VLAA 4EGYA 5FKOA 2Q2EA 5CPRB 3NEUA 2VQLA 3F3XA 1UG0A 2DOEA 2E36A 2M4GA 3OYDA 1LKXA 3PNYA 5EGOB 3ZN1A 2RV8A 5LGUA 5M5YJ 3BY6A 1Y0UA 4B48A 3U9GA 3PSFA 1PP8F 4GFBA 2IEKA 1ZR2A 4HLXA 2Z5UA 4B44A 3AAFA 2L02A 1JKRC 1MMGA 4B43A 4DBRA 3JRGA 4D1QA 2OU2A 4KITB 2W48A 1FOYA 3M07A 4XM3A 2M34A 4BXFA 2LD5A 4G7ZF 3VYRB 3H5NA 1KZHA 3DCFA 4CCOA 5ICFA 2FOWA 5FLXZ 2L4MA 3GFLA 2UXXA 2VN2A 4LJZF 2F48A 5M3FJ 3LSGA 3L2WA 2E2JJ 4WCGA 4E7LA 1I1GA 2VOOA 3MN2A 1OYYA 2Y75A 1S7EA 5J8CA 3RQIA 2ELKA 3JAMZ 4DW6A 4UB6C 2V9PA 4B3XA 1GDTA 3SEQA 3FDYA 3M1CA 1R4MB 3BDDA 2G7UA 3OY9A 2O7OA 1MD0A 2N8GA 3PUFA 4HX8A 3KP5A 3FF5A 1FX7A 2L7ZA 2WAEA 2M9HA 2QSGX 3IAS2 5E3LA 2PN6A 1IV8A 4Q48A 3Q9VA 2B63J 2A6EF 3AG4H 3V7RA 2L01A 3WODF 1NG6A 3BTLA 3OYGA 3JW4A 3K4KA 4A3KJ 1AHDP 3K2AA 2COMA 4E70A 1B9NA 3B73A 1RETA 3DEUA 2G9WA 3HUGB 2CV2A 4FE4A 3J81Z 1KYWA 1QNTA 2WBMA 3H3UA 2CW7A 3R0JA 1T2KA 3BR5A 2MFZA 3CCSI 3I4PA 1WVRA 2WY7Q 2QA4I 3L1PA 1B8IA 3IL2A 3S3OA 2ESHA 2QQBA 1MH3A 1UFMA 2E1MB 3CJRB 1IRXA 2DFEA 2WTEA 3L2CA 1X1BA 4M74A 2DMQA 1BIAA 1YTYA 4RAZA 1FWZA 5GTHC 1R36A 2OF7A 1XDUA 2HYFA 1X58A 1ETQA 2V6CA 1JGGA 2W4SA 4XICA 2VJ5A 1X2MA 2YR2A 4F93B 3W6VA 3OR2C 3VSKA 4P1WA 3CCEI 4U0VA 2ZXHA 4H0EA 1V3FA 3P9CA 5FLMJ 4L9TA 1RI7A 1VQ4I 1JKOC 1Y8QB 3KP3A 3JSOA 3M1EA 3BZKA 2VJJA 3DBLB 4PSXA 2XF7A 2JPBA 4G12A 2Y31A 4PSWA 2WY8Q 5LHIA 2JZYA 1X1AA 3QU6A 4G9YA 3ZMTA 5F08A 1KQ9A 1X2NA 5E8GA 1Z91A 1ZR4A 4CCNA 4H4KC 4XQFA 2FJ1A 3LAPA 1R49A 1MMAA 1K4SA 1BI0A 2XAHA 3CCLI 4C2UA 4AC0A 2F5EA 2EV6A 3I55I 5DUKA 2ZBKA 3MCZA 3UKGA 2JMWA 2KP6A 3GCMA 3M8EA 4RA2A 3OYAA 1TT5B 4II3A 1S7OA 1K78A 5KNLA 2FXAA 3G4SI 2Y0MA 2M87A 3PNVA 4BEHB 1VQNI 2XGXA 3QPHA 4PJ0C 3JRHA 2GIVA 4DZPA 4WXDA 4OWRB 1YRNA 2NVXJ 2XIGA 2EBIA 4Z6YA 2M3AA 2CQXA 2BOLA 3KIOA 4RB2C 3VYUB 3MKZA 4A3BJ 3LWFA 2L5QA 4LLLA 4XOPA 3RTRA 4MHGA 1YW8A 2DA7A 3B6CA 4RGXA 2XPVA 5B5EC 2IRFG 3JTGA 3IWFA 3CCUI 3ZQLA 2LKSA 3HKZN 4AU7A 4O6JA 2P7CB 2J5PA 1TQMA 3R4KA 3G1MA 1U6GA 5D5XB 3WE3A 4LLNA 3CLOA 3M8JA 3T1BA 1LQ1A 1SFEA 4IRHA 2WADA 1V5FA 1YX3A 4ZDLA 1QZZA 1WH7A 3PO3J 2R0QC 1L3LA 1YIJI 3DBHB 1MJAA 5IT3A 4CCJA 5IPAA 4FETA 3FXRA 2V4JC 2Q0OA 4FCYA 1A31A 1A35A 2QQ9A 3JAMK 2H94A 4ESFA 1PUFA 2XAUA 3EPZA 1BJZA 3BR0A 3CCRI 3GTGJ 1D0ZA 2LSOA 2ELJA 3S93A 3DF8A 1RUOA 3HOVJ 2FBKA 2KIQA 2YS9A 4MO7A 2A61A 3Q5FA 2B0LA 1R22A 2M8GX 3BOQA 1HCRA 1YE9A 2E7WA 1FNNA 4BU2A 3EDPA 3ZQQA 3I0TA 3BZCA 2JA2A 2F4OB 2IA1A 4B47A 2XF5A 4XONA 3GXOA 1HW2A 1PYVA 2ECCA 1J59A 3O3KA 3J81K 1Z7LA 3RDIA 3DU5A 4KIGA 3CP2A 3TDZC 3WTZA 1ETWA 3HGGA 1G2HA 3V8JA 2XHKA 4CZCA 3V7CA 2VXZA 4CYCB 4ZYDA 3WTSC 2HXOA 3ZQHA 1UB9A 3BROA 2JRMA 4N0BA 2XC7A 1IN8A 4FHTA 2Q2EB 3LNQA 5BQTA 2CWEA 2E1CA 3FXLA 3WGIA 5F64A 4RB3C 4ZYGA 1SFUA 2Y9ZA 1AKHA 1RR7A 2XGEA 3GO5A 4IHTA 4AWXB 4EJUA 4HX7A 3H0GJ 1BR4A 1D0XA 3HEFA 5E1WA 2XKOA 3BG5A 3CJQB 3IRRA 1JHFA 3EUHA 2CQQA 2Y9YA 3ABKH 1TNTA 3K7AJ 1W5TA 2R7QA 2QEXI 3BCBA 2YU3A 4A0XA 2CW0F 1K79A 4CO8A 3AKZA 2QVOA 1AOYA 4QTRA 2LBFB 1XGNA 1ZHFA 3OYFA 1BC8C 2R93J 3NARA 1WJDA 1HOMA 1SFKA 3GMEA 1HW5A 3ASOH 5CVVA 5B66C 4KICA 4LITA 4UVAA 5LHHA 1O7FA 1SD7A 3ZQCA 4LIUA 1LDKB 3EYIA 1XX5A 3PIOF 3O2PE 5K7ZA 5DD8A 3RPUA 4PJMA 2IS6A 3HTUA 5D5VB 3CUQA 1JE8A 4KJZA 4IOCF 1SAUA 3QYFA 1G4DA 2K5CA 2DFIA 1WGXA 2FSWA 5JLWA 3C2BA 3ZQFA 3GTLJ 2K86A 2HQNA 3TOBA 1XSDA 2ICWG 2L9NA 3VB2A 4B1RA 4DZJA 1SVLA 2STTA 4HG2A 5K5RA 3K70C 2GXAA 1IRZA 3PNTA 4M9SA 5F1RA 2PG4A 3OOPA 2FD5A 2EINH 5HLGA 3P9KA 1LE8B 3H5RA 1D5YA 5F6FA 2PMHA 1F1ZA 5FFXA 5TISC 3LA7A 3WHBA 4C9YA 2NOGA 4IX7A 2LOOA 1EKEA 3A0HC 2HDWA 3OS1A 1BL0A 2R7DA 2YPRA 4JBAA 2M4KA 1W0TA 2W85A 2E71A 2JUCA 4LFUA 1TW3A 2GIZA 4G8XA 2IT0A 4PK4A 1T0FA 1G59A 4QWQA 1KGSA 3DV8A 3SYTA 2DK8A 2L9SA 2XB5A 2VKVA 4OMZA 4UVBA 4MNUA 3J7AY 2BW3B 1EH8A 1P7JA 3Q9SA 2VC1A 3NRVA 1EA3A 4ENJA 3ERED 2HNHA 3GZNB 4AYBN 2LKXA 1PVEA 1D8JA 3OYKA 4DQ2A 2PMZA 2E35A 5E17F 2X48A 4EQQA 3K69A 3A03A 2HWVA 1FLIA 3L2UA 1MDMB 4AIJA 4EJTA 3LQQA 1IW7F 1MNMC 1Z6TA 2K02A 3BZ6A 2ZSIB 3TO6A 5D5UB 3K70D 2KHMA 3HOZJ 3ELKA 2V26A 1DQUA 1GXQA 2QBYB 1UG2A 1R1UA 2XGCA 4JX6A 5EDNA 2Y48A 5HS9A 4I7HA 1I3QJ 4A5MA 2KIUA 5B1AH 4XRMA 1U3EM 5DM6F 1D5VA 2O8KA 1TLHB 3FM5A 4Q5SF 1WCMJ 1ZN2A 3CC7I 9ANTA 2LREA 5AIPA 2Z16A 2R92J 3G1OA 3PSIA 4YFKF 2XSDC 3I59A 1W0UA 2BHYA 2VL8A 3FX3A 4IPAA 2V9VA 4E7IA 1LB2A 3J7YJ 3SXYA 4HQMA 4YIIA 3KP7A 4NHJA 1E2XA 2EZHA 3WTYC 1PJRA 4BGDA 2ME0A 4XSZF 5HDKA 2MD5A 3FXQA 1R58A 1B59A 1SC7A 5FLVA 3FWEA 2RC4A 2XF6A 3OSGA 1OJLA 3K0LA 4EATA 3ML6A 3FXKA 1EH7A 3LL7A 2KMUA 2DA3A 3SJMA 1GV5A 4ZYHA 5JI6A 1R5HA 2D1VA 2DI3A 3F9KA 1WQ2A 4S04A 4WK8F 4M72A 2DU9A 1POGA 4F91B 1KU9A 3QRFF 2OJED 4MGRA 4M6XA 4BNCA 4I99C 5EZGA 5D8KB 3E5QA 3K6GA 3BJ6A 4DYQA 1TT0A 3C2GA 4LB5A 1JT6A 3RKQA 2X0LA 3KEYA 5L3DA 2D1HA 1S8NA 2MC3A 4RBOA 5TGTA 3Q0VA 2OPTA 1DPRA 1BN5A 1PUEE 2EV5A 3ABMH 3VDXA 4BDYA 3HBLA 1NK3P 1JKPC 4M6VA 3N05A 4GCVA 4HNVA 2M7BA 4A3FJ 3E5XA 2OCCH 3HXLA 2Z1DA 4I0AA 3VYSB 5ILVA 2DOAA 2HOAA 4EVIA 3BJAA 5H2FC 4CXFA 4Y52J 3BCAA 3L2QA 1DP3A 1ZLJA 2JSCA 1LNWA 2F2EA 3UNGC 4C30A 2BV6A 3HRUA 1HSTA 1S5LC 1EH6A 1JKQC 3FM3A 3WTTC 1YJNI 2ESNA 1TC3C 1FOWA 2R7VA 2R7OA 3Q3SA 2ZCWA 3BQZA 1W5CC 4XLFA 3UR3C 3L2RA 2DN0A 2EH3A 2HI3A 3EUHC 1XGOA 4LMYA 5LRRA 2ACJA 2A07F 1Q1VA 1RR8C 4BE1A 1FBQA 4A6EA 3I71A 2HVRA 4XKCA 4LK1F 1R5GA 1SEUA 1FTTA 5E8IA 3HRTA 2O9LA 3ECHA 4D7NA 2EA4A 4EJOA 2K9QA 4I2OA 1X3UA 2DBBA 3M8FA 2ZJPF 3JRIA 4Q47A 4N4OB 3X2QH 3I64A 1QO0D 1K6YA 3B02A 1IV6A 2E7XA 5L3FA 4L0ZB 4F55A 2UUZA 3C2HA 4XKVA 1BBYA 2LNBA 3CUQC 4I01A 2V6EA 2VT2A 3D1NI 1K6OA 2DDAA 2CGPA 4EM1A 3LFUA 4IQ4A 1T56A 3LSTA 1GLNA 2DT7B 1AA7A 5HLIA 1FBUA 2VJIA 2PJRA 4MFEA 3FMQA 2BGCA 2FUG2 2ZXWH 2LTPA 4PUSA 5J40A 4I09A 3S32A 4W97A 1R23A 3FKJA 3S3NA 2BY2A 3E1SA 3RI4A 3DPLC 3GVAA 3H9GA 1MIJA 1S29A 2ID3A 3MZYA 3RZOJ 1YG2A 2NXNB 4Y33A 2LH9A 5F1JA 2OZUA 1VI0A 2XV4S 2PX9A 1IRFA 3DPTA 1N77A 3MFKA 1ZARA 3MKLA 2IS1A 4RGRA 3LSRA 2VQGA 2FMLA 1XB4A 2ZB9A 2LRDA 1J09A 2M0MA 4M6YA 2BE5F 4B3AA 3CDHA 2R7WA 2ELHA 1E17A 4KFCA 4BE2A 1WJBA 3K4BA 5HS8A 2FF4A 1UCRA 2ZXJA 4HA8A 4I02A 1BIBA 1ETOA 3AG1H 1ON2A 4RAYA 4I0BA 4KA4A 1VNDA 2R7XA 3RPUD 5J1UA 1FEXA 3TW6A 2PEXA 3E3VA 2CUZA 2R5ZA 2DO7A 2I10A 1R1TA 2CFXA 1IC8A 4IHYA 2X6WA 2RVCA 3HIFA 3PO2J 4AD9A 4N9IA 4D9JA 2I8DA 4PFOA 1CGPA 1Z3YA 2RNJA 4BYYA 1GHCA 4MTDA 3TDUC 4BQOA 1O57A 2LLKA 3AL0B 3R60A 4IHSA 3GZ6A 4YFXF 1FBSA 1DU0A 3V8LA 1VQ7I 1MBGA 2EILH 1BR1A 1MNEA 2O5RA 4OIRF 1XS9A 1B72A 3VYTB 2JJ7A 2AXTC 5ICGA 4ZDOA 3ZCOA 2FBIA 3ZP5A 3FHZA 1IN7A 1YFHA 1FOKA 2F6CA 4UXNA 1JXSA 4MLOA 3O8GA 3KLNA 3LA2A 1T98A 2EIMH 2VE9A 4KMFA 2VI6A 4JOMA 4RGUA 4QLCU 2FQ4A 1WI3A 3KP4A 4GXOA 4RAFA 4Y15A 4ZDPA 5J8FA 1OCOH 2CH0A 2K40A 4RAGA 4L18B 2MH2A 3WU0A 3E97A 2HR3A 3I5UA 2QM3A 3MZ8A 4M73A 3HKZA 2BZTA 4BHBA 4CCKA 3U1KA 4CCMA 2IGKA 3CMMA 3OYCA 5J1RA 3BT9A 6PAXA 1K61A 2W57A 3KE2A 2HDDA 3IWZA 1MMSA 1ZQ3P 4HSRA 3A2KA 1BOBA 3O8HA 2H8WA 2LP0A 4A2UA 2FMYA 2YUSA 2EV0A 3ONQA 4ENNA 2VOPA 2ME6A 2ZNZA 3RSNA 4RDUA 1BR2A 2ZKZA 3F6VA 1T6SA 5J47A 4JX4A 5GAHJ 5ICEA 3PFYA 1TW2A 5ILSA 4G94A 2JSPA 4IEJA 4V2GA 2VE8A 3QWLA 4F3QA 5LHGA 1W7PA 4XRSA 2R7ZJ 3F72A 1S6LA 1FJLA 3QOEA 4A0ZA 2HGCA 4AUXA 2JWTA 4UUSA 3OYMA 3GTKJ 3F0CA 4PGGA 4D5CA 4A3DJ 2R7TA 1Y0NA 3PFIA 4RMNA 3A0BC 1K7AA 4M9ZA 4RLFA 5KCMA 3BQYA 1J7KA 2A5WA 4GYIA 3G1LA 2HU9A 2VPRA 5L3CA 2WAFA 4NQWA 2Z3YA 1TQPA 2X1DA 1JUMA 3MEXA 1M1EB 2ZNYA 1SVOA 1ETVA 2VQCA 5HDGA 3DEWA 2VT3A 4NC7A 1ZG5A 1GUUA 2AHQA 5FB2A 5FKMA 4ENMA 4C3IJ 2E60A 1WSUA 5EF6A 1YW9A 4XRSG 3QP5A 3DQVC 4II2A 2HOTA 2OUMA 2WV1A 3DLLF 1D1BA 1UAAA 2HQAA 1YYVA 3F21A 2RN7A 4EV0A 2BXZA 1TZLA 1XCVA 4X1EA 3N97A 2H1KA 1ZKGA 1YHQI 3J7AO 4E7ZA 3QPLA 4LOCA 2KRCA 1TWAJ 1MW7A 3FXJA 4YRVA 4X0GA 3OYHA 3QU3A 2HYGD 2X9DA 4XOTA 5FGMA 1X3ZB 5DV5A 5J3LA 5GTIC 2Q8KA 1U2WA 3KPHA 2CFOA 2YX4A 1Y1WJ 5M3MJ 5HDNA 1S7AA 1RC9A 2DQRA 2RDPA 4DBQA 3A01B 3HB9A 2FQ3A 3GUDA 3S2HJ 1KU3A 4KT5C 3WGHA 3HRMA 4FQGA 1G3SA 2R7FA 3MKWB 4Z2YA 2R7RA 1X3WB 4B4CA 2MYSA 2L7MP 2QQ8A 4HRIA 4XN3A 1BJAA 1BOAA 1XMKA 1YX5A 4BQNA 2CQKA 3NWSA 5HLHA 5EG0B 2CUJA 3CCQI 3MVPA 1TWGJ 1QPMA 4Q4ZF 2L54A 1A36A 1KQ0A 2IA0A 1IXRC 1ZRCA 2CV1A 1REPC 1P4WA 3I53A 5FKNA 5BMZA 5BOXA 1TWHJ 1LVKA 3SFIA 2GXBA 3DPUA 1ZG1A 3OR1C 5JR3A 5F27A 3BP8A 1HBXG 2EPFA 5ICCA 3D5SC 2O6GE 1MKMA 3RCOA 2V7FA 3TP0A 1U9NA 2JK3A 4EMSA 4M3GA 1W4MA 3KYLA 3PJRA 1IDZA 2MA3A 1X4OA 1QU3A 5J1YA 1O3TA 5IYCJ 4LG0B 2PLYA 2EB7A 2KPMA 1I6XA 4PCQA 2LY1A 1U5TA 1HA8A 1U8BA 1K83J 1RIOH 1X1DA 3C1DA 4HDUA 2G0EA 2PJRB 3PUBA 2DFHA 5JVGF 1Y56A 2QCOA 3ZQIA 3E6BA 2K85A 3QOPA 3JTHA 2DFFA 5LFAA 2XAFA 5DUIA 5E3MA 4FISA 4BXUA 2QKLB 1FSEA 1SD6A 2BBYA 4FX0A 2OA4A 3HOUJ 3K2ZA 4MFDA 4ZC3A 1X1PA 1MBJA 3E6MA 3W6KB 2UZKA 1AWCA 2XPWA 2FEZA 3CQZJ 3TW7A 4BE0A 3K4LA 3QYBA 3VFZA 1SVMA 2OCEA 2V1XA 4AYBA 2TRTA 4DGWB 4PJJA 1V5GA 5LD2C 2PBIA 5B3SH 4CHUA 2NYXA 1IO2A 2ZJ2A 4L5IA 1A04A 1GV2A 3OIPA 4BH9A 1OYWA 3GFJA 3CF2A 4JYKA 3W2VA 4EJWA 3OYBA 3CCMI 2IP2A 4IQJA 3EQLF 1WJFA 2CMPA 5H6RA 4A3MJ 4HAMA 5J6XA 4NC6A 4HNUA 3FK7A 3I9V2 4HV5A 3ZMVA 1WJCA 1YITI 1IUFA 3TEDA 2K9NA 2XROA 1ZREA 4GGGA 2XVCA 1MZBA 4BJ5C 3MMYB 2O61A 2P5KA 2K4BA 4JK1X 2HEOA 1P2FA 1SANA 3I4NJ 4J01A 2HZTA 4CUGA 5DCFA 2QYOA 5EJCA 5FRNA 1R7JA 2DMPA 5FKKA 4IHXA 1S3JA 1WRJA 2O8XA 2R5YA 3S1QJ 2L7FP 4BS9A 4HZFA 1CF7A 3C3WA 2W24A 4AVPA 1VFCA 2GLOA 2R4GA 4IRGA 1FYKA 1JGSA 3HGYA 3PQJA 1GVJA 4B8XA 4U7BA 1MJ9A 1FZPB 4L9VA 2DW4A 5C3EJ 4XR6A 2CQ7A 2BVLA 4MIMA 2ECBA 3CMEI 2M1BA 3BR2A 2B7EA 2IPQX 3K1NA 3S1NJ 2IS4A 3D5RC 3GEZA 3SZPA 1Z67A 2E1OA 2MGQA 5EEAA 3BG6A 3HZJA 4Y4RA 2MC4A 4M9XA 3QPTA 3GLLA 3A1YA 3MAJA 2DPUA 3KCCA 1IRGA 4KUMA 2P81A 4XBFA 1IF1A 2RQPA 3BR6A 1MSFC 2ISZA 4A3CJ 2BEOA 1NTCA 2LFBA 1WKMA 4BY7J 1LFBA 3LAJA 4BJTA 3M7GA 4WX9A 2K4JA 5D8LB 1T33A 2QUFA 3K1PA 4KISA 2DA5A 3FISA 4RLQA 4D5FA 4UUTA 3FXUA 2L2OA 1HQCA 1XSVA 3COAC 1TNSA 3FK6A 4GO1A 3H0DA 2M5WA 2HZDA 3SDBA 2QSFX 4WXHA 3RYPA 4HX4A 4LG3A 1SMTA 2KIMA 4U87A 3T8RA 1ZRFA 2D5VA 2IS2A 1B1BA 2EFWA 1RESA 2LC2A 4YEJA 1P4AA 2DMTA 2KFDA 2RGVA 1TTYA 5KAIC 2GBYA 1J75A 2GA2A 2JUGA 4OOIA 1B8IB 1I3AA 3S8PA 3P9IA 1Y39A 3OMYA 2LYCA 5L3EA 2DT5A 1T38A 5FJ8J 1F4KA 2PJPA 3JREA 4L5JA 4Y7NJ 5F0CA 1IZ1A 1BA5A 1SFOJ 2RKHA 3TOAA 4JX5A 5DEQA 2H6CA 2BXYA 1A6QA 2XUBA 1NHAA 5LGTA 3ZR8X 3CD6I 1ITYA 4X6AJ 3CC4I 3CJTB 3GTMJ 2QWWA 2JT1A 5FD5A 3FBNB 1QZYA 3ASNH 2A3SA 3FMRA 3FXOA 3WE2A 1LFUP 3AG2H 3TKYA 5D6EA 3DFGA 3BWGA 1FMWA 3TO9A 3HSRA 3E6CC 1ENHA 1P92A 2RAEA 3LSKA 1I1SA 4B09A 1JTXA 3DTEA 2LR8A 1TQIA 1G8XA 1T95A 4YIFA 1YJ9I 3VOEA 4DYCA 1WPKA 4YELA 1S9HA 1U5TC 3RJPA 2VBZA 4PJNA 1MSEC 5C4JJ 2A05A 2IGMA 4A3EJ 2UV1A 1K78B 3G3ZA 3BTIA 1OR7A 3R0AA 4BDZA 2JQ7A 5D4RA 4HF2A 2LKPA 4CSWA 1E3PA 4ZH4F 1UZCA 1YRNB 5DYMA 3HUGA 2LMDA 3BTJA 1WI9A 2WA0A 1FPQA 3QQAA 1O7LA 2MSYA 3CZ6A 4Y3OA 1VF9A 2VIXA 5F0HA 2XRLA 5KVRA 2EIKH 3HRSA 5HNFA 1JUSA 3F8FA 3ZMSA 1GVDA 4CZZA
chains in the Genus database with same CATH topology
1U8RA 2P4WA 3BPXA 1H0MA 2KJBA 4L0YB 1XMAA 3KZYA 2MH9A 1MGTA 3WTVC 1FYMA 5H20A 4KIBA 3KP6A 4UV9A 3R61A 5D6FA 3TO7A 2P5LC 3WG9A 1SMYF 3M9AA 2PMUA 1Z05A 3E6DA 5E20A 1G3WA 1IN4A 3KEQA 3CTAA 1HXDA 1XDSA 1ZGAA 3P7NA 5FFZA 3WTUC 3GFIA 5E1XA 3ZMUA 4IF4A 3ISPA 4AIKA 3L7WA 5IT9K 3WTXC 5DD4A 1LDJA 3NQOA 1I5ZA 2MLKA 2A6HF 1RUNA 2F5DA 1O3SA 2EFNA 4UNOA 3HOSA 4BQAA 2MBFA 3IKTA 4LB6B 1Z6RA 2PFBA 3HHGA 2DPDA 2H6BA 5CVRA 2AS5F 2OBPA 1B4AA 4A5NA 5CLSA 1KYZA 2L3DA 1Z7UA 3HHHA 1HKSA 1J2XA 2K27A 2D2WA 2JPCA 2ZFWA 4P9FA 5EEGA 5K5OA 2Z33A 3L9FA 2XKPA 1TBXA 1DP7P 2NRAC 3SFZA 1ZH5A 1G3TA 4MEYF 1FYLA 3U2RA 3J80Z 1EV7A 2P6TA 3KETA 2QZ8A 2OAZA 4IJAA 1QGPA 2EJRA 2HKXA 3QAHA 4ZZLA 3GF2A 2P8TA 3QP6A 4P5OA 1XCBA 2QQAA 1HSJA 4RB1A 3ZQ7A 1IXCA 4YG2F 4TV7A 3CUQB 3KFWX 5CYVA 2IVMA 1BC7C 3IKVA 1LJ9A 2STWA 4EGZA 1T39A 3GX4X 1UHWA 3CO7C 2M45A 1FP2A 3T5XA 3OV8A 2EWNA 3WTWC 2WV0A 4KIFA 5DCMA 3ZPLA 3GLXA 2VBXA 3EYYA 3C7JA 3V4GA 2G7HA 2CG4A 3F8CA 4RB2C 1YS7A 3I58A 3F6OA 1FY7A 4HOBA 3KP2A 1QQIA 1L0OC 2WWYA 1MJBA 5CVIA 4D0PA 3GWZA 4MTEA 4I98B 5TRDA 2EFPA 1ONVA 1USSA 2XAGA 1PP7U 3LQRA 2FBHA 5LEKA 3RYRA 1P4XA 2EFOA 4HDVA 1C0WA 2FNAA 4P9UA 1OMIA 4L9NA 4PDKA 2FE3A 1B6AA 5CVJA 4G6DA 2QENA 3L09A 4WWCA 4CYDA 3IRQA 3T8TA 2V1UA 3C18A 1BM9A 1PDNC 5LRSA 2BYVE 1H9TA 5H6QA 2LF8A 5JHUA 3I59B 2O0YA 5ED4A 1W5SA 1IUYA 4BAYA 4LLGF 1IN5A 2GZWA 3K1MA 3GW2A 4LK0F 3KZZA 3JSPA 4UUVA 3H92A 3V8KA 3BPVA 3RKYA 1IXSB 4R1HA 1XGMA 5BPIA 1U78A 4N9HA 5EEHA 3BJOA 2WC2A 2A68F 4ASNA 2IA2A 2TDXA 4CICA 2GWRA 1ZLKA 2YX7A 3V7SA 3FMSA 3KLOA 2NAZA 2P6SA 1USTA 4WF2A 2FRHA 1XD7A 1STZA 3ABUA 1F5TA 1J0RA 3TQNA 4ESBA 2ETHA 3J80K 3KEOA 3I54A 2OQGA 1MDMA 2IJLA 1HW1A 4AIHA 2QBYA 1HKTA 4P55A 2EFQA 3ZMZA 4R79A 3F8NA 2FOKA 4IXAA 2XRNA 3GYHX 4M71A 2F5FA 3G73A 4XSXF 5HOOA 2DTRA 2XAQA 3RKXA 4HLYA 5A2QZ 5LBQA 3U1DA 2FNPA 4ENKA 2K7LA 5AIQA 2KKOA 2CO5A 1ZRDA 4BHPA 2ISYA 2CSOA 2J5OA 2W84A 4U0WA 4ESJA 2FA5A 1YLFA 4A0YA 4CDGA 2VC0A 4RGSA 1O3RA 3ABTA 4MEXF 1OPCA 3MWMA 2HKOA 4U0YA 3F8BA 5KK1A 2L4AA 2GA1A 1BI3A 5FLXK 1KU7A 4Y13A 3GZ5A 2V79A 4KNYA 3HSEA 3D0SA 2Z9OA 1ON1A 1ZGJA 1XGSA 2LDUA 3FZVA 4UHTA 5BPDA 3H3ZA 1D3YA 1ULYA 3F23A 4P96A 4L9JA 4DNCA 4OU0A 5D5WB 1FSHA 2HS5A 5BS6A 5LEJA 1WWXA 2R3SA 3W6JB 4PZJA 5D4SA 5E18F 5HS7A 1KQ8A 1YO5C 2AXLA 4ON0A 2Z99A 1QBJA 1UHMA 5JVTA 5DDGA 2QLZA 5DCMB 2ZMEA 1RZ4A 4G7HF 1ZYRF 2H27A 4UVCA 2M8EA 2DAOA 1RNLA 5LLQA 2D45A 4MQVA 2YSRA 3REOA 1JHHA 4IVNA 5L3BA 2DLLA 5K1YA 3VEPA 2GAUA 3PQKA 5FD6A 4YFNF 3ZMDA 4ETSA 3IHUA 3E5UA 1HKQA 2P5VA 1LVAA 3CJNA 2OQRA 4U7DA 1YS6A 1O3QA 4HF0A 1W7PD 1LEAA 2HOEA 1YW7A 5A2QK 5IT9Z 1W7PB 4K2EA 4HYEA 2PQ8A 5CJ9A 1BI2A 4BHCA 4HBLA 3WU1B 1V4RA 2JRTA 4O3MA 4OIPF 4KN7X 4U88A 1XN7A 3DXJF 4OIOF 2NNNA 4CGZA 4LGWA 4OMYA 1BI1A 4KYWA 3TGNA 3ROUA 3WGGA 2MLGA 4RB0A 2A5YB 5FO5A 5TJJA 4KDPA 1ODDA 4XRFA 1R1VA 2GQQA 4S05A 1KU2A 1SFXA 2A69F 1B9MA 3CO6C 3LFKA 4HQEA 4R8HA 4G6QA 3L00A 2KJCA 4GYGA 2ADUA 5L3GA 2NS0A 3MQ0A 3MZHA 1LDDA 2XAJA 2EA2A 2KRFA 5K5QA 3K9TA 3HYIA 3RIRA 2UXNA 4EM2A 3S2WA 4ZZDA 2EK5A 4OIQF 4O5VA 3ULQB 4HV6A 1F9NA 4UV8A 2HFHA 4F7ZA 3DKWA 4ZYEA 2C6YA 1G6NA 4JQFA 2V1DA 1FT9A 4KN4X 1DUXC 2H09A 1Q1HA 5E1ZB 2FU4A 2ZO4A 2HTJA 1Z9CA 3O6BB 3IC7A 2DQLA 1U5TB 1R00A 3ECOA 3SQNA 3EETA 2NNYA 1SD5A 5HVQC 3LA3A 2M30A 3F22A 4EM0B 2DK5A 3GFMA 1SAXA 2VBYA 3SHFA 2W25A 3T0YA 1OYIA 5LGNA 2F5CA 1J5YA 3N4MA 2P7VB 4Y17A 2HQRA 3VODA 1D8KA 4A12A 1VTNC 2HTSA 3HOTA 1ZG3A 2O3FA 4KMUX 2PI0A 4HF1A 5CVUA 2X4HA 2VONA 1DPUA 1KA8A 2O03A 4LD5A 1G3YA 2IW5A 1ZAOA 2OD5A 3F8MA 2JTVA 2OZ6A 4NB5A 3D5LA 1IN6A 2ZMEB 4LG0A 1IAWA 5ERIA 1CF7B 4IRIA 4WXCA 1FP1D 1I27A 1OKRA 1YQAA 4XLNF 4FT8A 4MQ9F 1DDNA 3HTSB 4RS8A 2XASA 2UWMA 1P6RA 3CUOA 2LF7A 2VBWA 4EJVA 3SZTA 4PGHA 3DP7A 1J9IA 4A6DA 2E1NA 4FX4A 1H9GA 1YIOA 5AONA 1FC3A 1SD4A 2GXGA 1XSXA 3RPQA 2CYYA 4XLPF 2VODA 3RKWA 3R6SA 1LEBA 2HDCA 1Z1DA 2KIFA 4HW0A 5ILUA 4G7OF 4OINF 1GXPA 3ZN0A 3HSFA 5JFRA 4EGYA 2Q2EA 3NEUA 3F3XA 3ZN1A 2RV8A 5LGUA 3BY6A 1Y0UA 3U9GA 1PP8F 4HLXA 2Z5UA 3AAFA 2L02A 2OU2A 4G7ZF 5ICFA 5FLXZ 2L4MA 3GFLA 2UXXA 2VN2A 4LJZF 4WCGA 1I1GA 2VOOA 1OYYA 2Y75A 5J8CA 3JAMZ 3BDDA 2G7UA 1MD0A 4HX8A 3KP5A 3FF5A 1FX7A 2PN6A 4Q48A 3Q9VA 2A6EF 3V7RA 2L01A 3WODF 3JW4A 2COMA 4E70A 1B9NA 3B73A 3DEUA 2G9WA 3J81Z 1KYWA 1QNTA 3H3UA 3R0JA 1T2KA 3I4PA 3IL2A 2ESHA 2QQBA 1UFMA 3L2CA 2WTEA 4M74A 1BIAA 1YTYA 4RAZA 1FWZA 1R36A 1XDUA 2HYFA 2V6CA 2YR2A 4H0EA 4U0VA 1V3FA 3P9CA 4L9TA 1RI7A 3KP3A 3JSOA 3M1EA 2JPBA 5LHIA 2JZYA 3QU6A 4G9YA 3ZMTA 1KQ9A 5E8GA 1Z91A 3LAPA 1BI0A 2XAHA 2F5EA 2EV6A 5DUKA 2ZBKA 3MCZA 3M8EA 1S7OA 1K78A 2FXAA 2Y0MA 2M87A 2XGXA 3QPHA 2GIVA 4WXDA 2XIGA 3LWFA 4LLLA 3RTRA 4MHGA 1YW8A 4RGXA 2IRFG 3JTGA 3IWFA 4O6JA 2P7CB 2J5PA 1TQMA 3R4KA 1U6GA 5D5XB 3WE3A 4LLNA 3CLOA 1LQ1A 3T1BA 1SFEA 4IRHA 1QZZA 1L3LA 1MJAA 5IT3A 3FXRA 2Q0OA 2QQ9A 3JAMK 2H94A 4ESFA 2LSOA 3DF8A 1RUOA 2FBKA 2A61A 3Q5FA 2B0LA 1R22A 3BOQA 2E7WA 1FNNA 3EDPA 3I0TA 2IA1A 3GXOA 1HW2A 1J59A 3O3KA 3J81K 3RDIA 4KIGA 3TDZC 3WTZA 3V8JA 2XHKA 3V7CA 2VXZA 4ZYDA 3WTSC 1UB9A 3BROA 4N0BA 1IN8A 4FHTA 5BQTA 2CWEA 2E1CA 3WGIA 5F64A 4RB3C 4ZYGA 1SFUA 3GO5A 4IHTA 4AWXB 4EJUA 4HX7A 5E1WA 2XKOA 3IRRA 1JHFA 3EUHA 1TNTA 1W5TA 2YU3A 4A0XA 2CW0F 1K79A 4CO8A 2QVOA 1AOYA 1XGNA 1ZHFA 1BC8C 1HW5A 5CVVA 4KICA 4UVAA 5LHHA 1O7FA 1SD7A 1LDKB 3EYIA 3O2PE 5DD8A 3RPUA 3HTUA 5D5VB 3CUQA 1JE8A 1G4DA 2DFIA 2FSWA 2K86A 2HQNA 3TOBA 1XSDA 3VB2A 2STTA 5K5RA 4M9SA 5F1RA 2PG4A 3OOPA 5HLGA 3P9KA 5F6FA 2PMHA 1F1ZA 5FFXA 3LA7A 2R7DA 2YPRA 4JBAA 2W85A 4LFUA 1TW3A 4G8XA 2IT0A 1T0FA 4QWQA 1KGSA 3DV8A 2DK8A 4OMZA 4UVBA 4MNUA 1EH8A 3Q9SA 2VC1A 3NRVA 4ENJA 3ERED 1D8JA 4DQ2A 5E17F 4EQQA 3K69A 2HWVA 1FLIA 1MDMB 4EJTA 4AIJA 3LQQA 1IW7F 1Z6TA 2K02A 3BZ6A 3TO6A 5D5UB 3ELKA 2QBYB 1GXQA 1R1UA 2Y48A 5HS9A 4I7HA 4A5MA 2KIUA 1U3EM 1D5VA 1TLHB 3FM5A 4Q5SF 1ZN2A 5AIPA 4YFKF 3I59A 3FX3A 4IPAA 2V9VA 1LB2A 3SXYA 4HQMA 4YIIA 3KP7A 4NHJA 1E2XA 3WTYC 4XSZF 5HDKA 2MD5A 3FXQA 1R58A 1B59A 3FWEA 2RC4A 3K0LA 3ML6A 1EH7A 4ZYHA 5JI6A 1R5HA 2D1VA 2DI3A 4WK8F 1WQ2A 4S04A 4M72A 2DU9A 1KU9A 3QRFF 4MGRA 4M6XA 4BNCA 5D8KB 3E5QA 3BJ6A 4LB5A 2X0LA 5L3DA 2D1HA 1S8NA 2MC3A 1DPRA 1BN5A 1PUEE 2EV5A 4GCVA 3E5XA 4I0AA 5ILVA 4EVIA 3BJAA 4CXFA 1ZLJA 2JSCA 1LNWA 2F2EA 2BV6A 3HRUA 1HSTA 1EH6A 3FM3A 3WTTC 2ESNA 2ZCWA 5LRRA 4LMYA 1XGOA 2ACJA 2A07F 1FBQA 4A6EA 3I71A 4LK1F 1R5GA 5E8IA 3HRTA 3ECHA 2EA4A 4EJOA 4I2OA 1X3UA 2DBBA 3M8FA 4Q47A 3I64A 1QO0D 3B02A 2E7XA 5L3FA 4L0ZB 1BBYA 2LNBA 3CUQC 4I01A 2VT2A 1K6OA 2CGPA 4EM1A 3LSTA 5HLIA 1FBUA 3FMQA 2BGCA 4I09A 1R23A 3RI4A 3DPLC 3GVAA 1S29A 3MZYA 1YG2A 2OZUA 2XV4S 1IRFA 3DPTA 3MFKA 1ZARA 4RGRA 2FMLA 1XB4A 4M6YA 2BE5F 3CDHA 2ELHA 1E17A 4KFCA 5HS8A 2FF4A 1UCRA 2ZXJA 4HA8A 4I02A 1BIBA 1ON2A 4RAYA 4I0BA 4KA4A 2PEXA 3E3VA 2DO7A 1R1TA 2CFXA 2RVCA 3HIFA 4AD9A 4N9IA 1CGPA 4BYYA 2RNJA 1GHCA 4MTDA 3TDUC 1O57A 3R60A 4IHSA 3GZ6A 4YFXF 1FBSA 3V8LA 4OIRF 5ICGA 2FBIA 3ZP5A 3FHZA 1IN7A 1YFHA 1FOKA 4UXNA 1JXSA 3KLNA 3LA2A 1T98A 2VE9A 4KMFA 4RGUA 4QLCU 3KP4A 4GXOA 4Y15A 5J8FA 4L18B 2MH2A 3WU0A 3E97A 2HR3A 3I5UA 2QM3A 4M73A 4BHBA 6PAXA 2W57A 3KE2A 3IWZA 4A2UA 2FMYA 2EV0A 4ENNA 2VOPA 2ZNZA 2ZKZA 3F6VA 1T6SA 5ICEA 1TW2A 5ILSA 4G94A 5LHGA 2VE8A 1W7PA 3F72A 1S6LA 4A0ZA 2HGCA 4PGGA 3PFIA 1K7AA 4M9ZA 1J7KA 4GYIA 5L3CA 4NQWA 2Z3YA 1TQPA 3MEXA 2ZNYA 5HDGA 2VT3A 1ZG5A 5FB2A 4ENMA 1WSUA 1YW9A 3QP5A 3DQVC 1YYVA 3F21A 2RN7A 4EV0A 1XCVA 3N97A 3J7AO 3QU3A 2HYGD 5FGMA 5DV5A 2Q8KA 1U2WA 2YX4A 5HDNA 1S7AA 2DQRA 2RDPA 2FQ3A 3GUDA 1KU3A 4KT5C 3WGHA 3HRMA 1G3SA 2R7FA 4Z2YA 1BJAA 1BOAA 1XMKA 2CQKA 5HLHA 1QPMA 4Q4ZF 2L54A 1KQ0A 2IA0A 1IXRC 1ZRCA 1REPC 1P4WA 3I53A 5BMZA 5BOXA 2GXBA 1ZG1A 5JR3A 3BP8A 1HBXG 5ICCA 2O6GE 1MKMA 4EMSA 1W4MA 2MA3A 1O3TA 4LG0B 2PLYA 2EB7A 1I6XA 4PCQA 1U5TA 1RIOH 3C1DA 4HDUA 3E6BA 3QOPA 3JTHA 2XAFA 5DUIA 4BXUA 1FSEA 1SD6A 2BBYA 4FX0A 2OA4A 3K2ZA 3E6MA 3W6KB 2UZKA 1AWCA 2FEZA 3VFZA 2V1XA 2PBIA 4CHUA 2NYXA 2ZJ2A 4L5IA 1A04A 4BH9A 1OYWA 3GFJA 4EJWA 2IP2A 3EQLF 5H6RA 4HAMA 5J6XA 4HV5A 3ZMVA 2XROA 1ZREA 4GGGA 2XVCA 1MZBA 2O61A 2P5KA 2K4BA 4JK1X 2HEOA 1P2FA 2HZTA 5DCFA 2QYOA 1R7JA 1S3JA 1WRJA 2O8XA 4HZFA 1CF7A 3C3WA 2W24A 4AVPA 4IRGA 1FYKA 1JGSA 3PQJA 4B8XA 1GVJA 4U7BA 1MJ9A 1FZPB 4L9VA 2DW4A 2M1BA 3K1NA 2IPQX 3GEZA 3SZPA 4M9XA 3QPTA 3MAJA 2DPUA 3KCCA 1IRGA 4KUMA 4XBFA 1IF1A 2RQPA 2ISZA 2BEOA 1WKMA 3LAJA 3M7GA 4WX9A 2K4JA 5D8LB 2QUFA 3K1PA 3FXUA 1HQCA 1XSVA 3COAC 1TNSA 4GO1A 2M5WA 3RYPA 4WXHA 4HX4A 1SMTA 2KIMA 3T8RA 1ZRFA 1B1BA 2EFWA 1P4AA 2RGVA 1TTYA 1J75A 2GA2A 4OOIA 3P9IA 5L3EA 2DT5A 1T38A 1F4KA 2PJPA 4L5JA 1IZ1A 2RKHA 3TOAA 5DEQA 2H6CA 2XUBA 1NHAA 5LGTA 2QWWA 2JT1A 5FD5A 1QZYA 2A3SA 3FMRA 3WE2A 3TKYA 5D6EA 3BWGA 3DFGA 3TO9A 3HSRA 3E6CC 1P92A 1I1SA 4B09A 1TQIA 4YIFA 3VOEA 1U5TC 3RJPA 2VBZA 1K78B 3G3ZA 1OR7A 3R0AA 5D4RA 4HF2A 2LKPA 4ZH4F 5DYMA 3HUGA 1WI9A 1FPQA 1O7LA 5KVRA 3HRSA 3F8FA 3ZMSA 4CZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U8R A;  2P4W A;  3BPX A;  1H0M A;  2KJB A;  4L0Y B;  1XMA A;  3KZY A;  2MH9 A;  1MGT A;  3WTV C;  1FYM A;  5H20 A;  4KIB A;  3KP6 A;  4UV9 A;  3R61 A;  5D6F A;  3TO7 A;  2P5L C;  3WG9 A;  1SMY F;  3M9A A;  2PMU A;  1Z05 A;  3E6D A;  5E20 A;  1G3W A;  1IN4 A;  3KEQ A;  3CTA A;  1HXD A;  1XDS A;  1ZGA A;  3P7N A;  5FFZ A;  3WTU C;  3GFI A;  5E1X A;  3ZMU A;  4IF4 A;  3ISP A;  4AIK A;  3L7W A;  5IT9 K;  3WTX C;  5DD4 A;  1LDJ A;  3NQO A;  1I5Z A;  2MLK A;  2A6H F;  1RUN A;  2F5D A;  1O3S A;  2EFN A;  4UNO A;  3HOS A;  4BQA A;  2MBF A;  3IKT A;  4LB6 B;  1Z6R A;  2PFB A;  3HHG A;  2DPD A;  2H6B A;  5CVR A;  2AS5 F;  2OBP A;  1B4A A;  4A5N A;  5CLS A;  1KYZ A;  2L3D A;  1Z7U A;  3HHH A;  1HKS A;  1J2X A;  2K27 A;  2D2W A;  2JPC A;  2ZFW A;  4P9F A;  5EEG A;  5K5O A;  2Z33 A;  3L9F A;  2XKP A;  1TBX A;  1DP7 P;  2NRA C;  3SFZ A;  1ZH5 A;  1G3T A;  4MEY F;  1FYL A;  3U2R A;  3J80 Z;  1EV7 A;  2P6T A;  3KET A;  2QZ8 A;  2OAZ A;  4IJA A;  1QGP A;  2EJR A;  2HKX A;  3QAH A;  4ZZL A;  3GF2 A;  2P8T A;  3QP6 A;  4P5O A;  1XCB A;  2QQA A;  1HSJ A;  4RB1 A;  3ZQ7 A;  1IXC A;  4YG2 F;  4TV7 A;  3CUQ B;  3KFW X;  5CYV A;  2IVM A;  1BC7 C;  3IKV A;  1LJ9 A;  2STW A;  4EGZ A;  1T39 A;  3GX4 X;  1UHW A;  3CO7 C;  2M45 A;  1FP2 A;  3T5X A;  3OV8 A;  2EWN A;  3WTW C;  2WV0 A;  4KIF A;  5DCM A;  3ZPL A;  3GLX A;  2VBX A;  3EYY A;  3C7J A;  3V4G A;  2G7H A;  2CG4 A;  3F8C A;  4RB2 C;  1YS7 A;  3I58 A;  3F6O A;  1FY7 A;  4HOB A;  3KP2 A;  1QQI A;  1L0O C;  2WWY A;  1MJB A;  5CVI A;  4D0P A;  3GWZ A;  4MTE A;  4I98 B;  5TRD A;  2EFP A;  1ONV A;  1USS A;  2XAG A;  1PP7 U;  3LQR A;  2FBH A;  5LEK A;  3RYR A;  1P4X A;  2EFO A;  4HDV A;  1C0W A;  2FNA A;  4P9U A;  1OMI A;  4L9N A;  4PDK A;  2FE3 A;  1B6A A;  5CVJ A;  4G6D A;  2QEN A;  3L09 A;  4WWC A;  4CYD A;  3IRQ A;  3T8T A;  2V1U A;  3C18 A;  1BM9 A;  1PDN C;  5LRS A;  2BYV E;  1H9T A;  5H6Q A;  2LF8 A;  5JHU A;  3I59 B;  2O0Y A;  5ED4 A;  1W5S A;  1IUY A;  4BAY A;  4LLG F;  1IN5 A;  2GZW A;  3K1M A;  3GW2 A;  4LK0 F;  3KZZ A;  3JSP A;  4UUV A;  3H92 A;  3V8K A;  3BPV A;  3RKY A;  1IXS B;  4R1H A;  1XGM A;  5BPI A;  1U78 A;  4N9H A;  5EEH A;  3BJO A;  2WC2 A;  2A68 F;  4ASN A;  2IA2 A;  2TDX A;  4CIC A;  2GWR A;  1ZLK A;  2YX7 A;  3V7S A;  3FMS A;  3KLO A;  2NAZ A;  2P6S A;  1UST A;  4WF2 A;  2FRH A;  1XD7 A;  1STZ A;  3ABU A;  1F5T A;  1J0R A;  3TQN A;  4ESB A;  2ETH A;  3J80 K;  3KEO A;  3I54 A;  2OQG A;  1MDM A;  2IJL A;  1HW1 A;  4AIH A;  2QBY A;  1HKT A;  4P55 A;  2EFQ A;  3ZMZ A;  4R79 A;  3F8N A;  2FOK A;  4IXA A;  2XRN A;  3GYH X;  4M71 A;  2F5F A;  3G73 A;  4XSX F;  5HOO A;  2DTR A;  2XAQ A;  3RKX A;  4HLY A;  5A2Q Z;  5LBQ A;  3U1D A;  2FNP A;  4ENK A;  2K7L A;  5AIQ A;  2KKO A;  2CO5 A;  1ZRD A;  4BHP A;  2ISY A;  2CSO A;  2J5O A;  2W84 A;  4U0W A;  4ESJ A;  2FA5 A;  1YLF A;  4A0Y A;  4CDG A;  2VC0 A;  4RGS A;  1O3R A;  3ABT A;  4MEX F;  1OPC A;  3MWM A;  2HKO A;  4U0Y A;  3F8B A;  5KK1 A;  2L4A A;  2GA1 A;  1BI3 A;  5FLX K;  1KU7 A;  4Y13 A;  3GZ5 A;  2V79 A;  4KNY A;  3HSE A;  3D0S A;  2Z9O A;  1ON1 A;  1ZGJ A;  1XGS A;  2LDU A;  3FZV A;  4UHT A;  5BPD A;  3H3Z A;  1D3Y A;  1ULY A;  3F23 A;  4P96 A;  4L9J A;  4DNC A;  4OU0 A;  5D5W B;  1FSH A;  2HS5 A;  5BS6 A;  5LEJ A;  1WWX A;  2R3S A;  3W6J B;  4PZJ A;  5D4S A;  5E18 F;  5HS7 A;  1KQ8 A;  1YO5 C;  2AXL A;  4ON0 A;  2Z99 A;  1QBJ A;  1UHM A;  5JVT A;  5DDG A;  2QLZ A;  5DCM B;  2ZME A;  1RZ4 A;  4G7H F;  1ZYR F;  2H27 A;  4UVC A;  2M8E A;  2DAO A;  1RNL A;  5LLQ A;  2D45 A;  4MQV A;  2YSR A;  3REO A;  1JHH A;  4IVN A;  5L3B A;  2DLL A;  5K1Y A;  3VEP A;  2GAU A;  3PQK A;  5FD6 A;  4YFN F;  3ZMD A;  4ETS A;  3IHU A;  3E5U A;  1HKQ A;  2P5V A;  1LVA A;  3CJN A;  2OQR A;  4U7D A;  1YS6 A;  1O3Q A;  4HF0 A;  1W7P D;  1LEA A;  2HOE A;  1YW7 A;  5A2Q K;  5IT9 Z;  1W7P B;  4K2E A;  4HYE A;  2PQ8 A;  5CJ9 A;  1BI2 A;  4BHC A;  4HBL A;  3WU1 B;  1V4R A;  2JRT A;  4O3M A;  4OIP F;  4KN7 X;  4U88 A;  1XN7 A;  3DXJ F;  4OIO F;  2NNN A;  4CGZ A;  4LGW A;  4OMY A;  1BI1 A;  4KYW A;  3TGN A;  3ROU A;  3WGG A;  2MLG A;  4RB0 A;  2A5Y B;  5FO5 A;  5TJJ A;  4KDP A;  1ODD A;  4XRF A;  1R1V A;  2GQQ A;  4S05 A;  1KU2 A;  1SFX A;  2A69 F;  1B9M A;  3CO6 C;  3LFK A;  4HQE A;  4R8H A;  4G6Q A;  3L00 A;  2KJC A;  4GYG A;  2ADU A;  5L3G A;  2NS0 A;  3MQ0 A;  3MZH A;  1LDD A;  2XAJ A;  2EA2 A;  2KRF A;  5K5Q A;  3K9T A;  3HYI A;  3RIR A;  2UXN A;  4EM2 A;  3S2W A;  4ZZD A;  2EK5 A;  4OIQ F;  4O5V A;  3ULQ B;  4HV6 A;  1F9N A;  4UV8 A;  2HFH A;  4F7Z A;  3DKW A;  4ZYE A;  2C6Y A;  1G6N A;  4JQF A;  2V1D A;  1FT9 A;  4KN4 X;  1DUX C;  2H09 A;  1Q1H A;  5E1Z B;  2FU4 A;  2ZO4 A;  2HTJ A;  1Z9C A;  3O6B B;  3IC7 A;  2DQL A;  1U5T B;  1R00 A;  3ECO A;  3SQN A;  3EET A;  2NNY A;  1SD5 A;  5HVQ C;  3LA3 A;  2M30 A;  3F22 A;  4EM0 B;  2DK5 A;  3GFM A;  1SAX A;  2VBY A;  3SHF A;  2W25 A;  3T0Y A;  1OYI A;  5LGN A;  2F5C A;  1J5Y A;  3N4M A;  2P7V B;  4Y17 A;  2HQR A;  3VOD A;  1D8K A;  4A12 A;  1VTN C;  2HTS A;  3HOT A;  1ZG3 A;  2O3F A;  4KMU X;  2PI0 A;  4HF1 A;  5CVU A;  2X4H A;  2VON A;  1DPU A;  1KA8 A;  2O03 A;  4LD5 A;  1G3Y A;  2IW5 A;  1ZAO A;  2OD5 A;  3F8M A;  2JTV A;  2OZ6 A;  4NB5 A;  3D5L A;  1IN6 A;  2ZME B;  4LG0 A;  1IAW A;  5ERI A;  1CF7 B;  4IRI A;  4WXC A;  1FP1 D;  1I27 A;  1OKR A;  1YQA A;  4XLN F;  4FT8 A;  4MQ9 F;  1DDN A;  3HTS B;  4RS8 A;  2XAS A;  2UWM A;  1P6R A;  3CUO A;  2LF7 A;  2VBW A;  4EJV A;  3SZT A;  4PGH A;  3DP7 A;  1J9I A;  4A6D A;  2E1N A;  4FX4 A;  1H9G A;  1YIO A;  5AON A;  1FC3 A;  1SD4 A;  2GXG A;  1XSX A;  3RPQ A;  2CYY A;  4XLP F;  2VOD A;  3RKW A;  3R6S A;  1LEB A;  2HDC A;  1Z1D A;  2KIF A;  4HW0 A;  5ILU A;  4G7O F;  4OIN F;  1GXP A;  3ZN0 A;  3HSF A;  5JFR A;  4EGY A;  2Q2E A;  3NEU A;  3F3X A;  3ZN1 A;  2RV8 A;  5LGU A;  3BY6 A;  1Y0U A;  3U9G A;  1PP8 F;  4HLX A;  2Z5U A;  3AAF A;  2L02 A;  2OU2 A;  4G7Z F;  5ICF A;  5FLX Z;  2L4M A;  3GFL A;  2UXX A;  2VN2 A;  4LJZ F;  4WCG A;  1I1G A;  2VOO A;  1OYY A;  2Y75 A;  5J8C A;  3JAM Z;  3BDD A;  2G7U A;  1MD0 A;  4HX8 A;  3KP5 A;  3FF5 A;  1FX7 A;  2PN6 A;  4Q48 A;  3Q9V A;  2A6E F;  3V7R A;  2L01 A;  3WOD F;  3JW4 A;  2COM A;  4E70 A;  1B9N A;  3B73 A;  3DEU A;  2G9W A;  3J81 Z;  1KYW A;  1QNT A;  3H3U A;  3R0J A;  1T2K A;  3I4P A;  3IL2 A;  2ESH A;  2QQB A;  1UFM A;  3L2C A;  2WTE A;  4M74 A;  1BIA A;  1YTY A;  4RAZ A;  1FWZ A;  1R36 A;  1XDU A;  2HYF A;  2V6C A;  2YR2 A;  4H0E A;  4U0V A;  1V3F A;  3P9C A;  4L9T A;  1RI7 A;  3KP3 A;  3JSO A;  3M1E A;  2JPB A;  5LHI A;  2JZY A;  3QU6 A;  4G9Y A;  3ZMT A;  1KQ9 A;  5E8G A;  1Z91 A;  3LAP A;  1BI0 A;  2XAH A;  2F5E A;  2EV6 A;  5DUK A;  2ZBK A;  3MCZ A;  3M8E A;  1S7O A;  1K78 A;  2FXA A;  2Y0M A;  2M87 A;  2XGX A;  3QPH A;  2GIV A;  4WXD A;  2XIG A;  3LWF A;  4LLL A;  3RTR A;  4MHG A;  1YW8 A;  4RGX A;  2IRF G;  3JTG A;  3IWF A;  4O6J A;  2P7C B;  2J5P A;  1TQM A;  3R4K A;  1U6G A;  5D5X B;  3WE3 A;  4LLN A;  3CLO A;  1LQ1 A;  3T1B A;  1SFE A;  4IRH A;  1QZZ A;  1L3L A;  1MJA A;  5IT3 A;  3FXR A;  2Q0O A;  2QQ9 A;  3JAM K;  2H94 A;  4ESF A;  2LSO A;  3DF8 A;  1RUO A;  2FBK A;  2A61 A;  3Q5F A;  2B0L A;  1R22 A;  3BOQ A;  2E7W A;  1FNN A;  3EDP A;  3I0T A;  2IA1 A;  3GXO A;  1HW2 A;  1J59 A;  3O3K A;  3J81 K;  3RDI A;  4KIG A;  3TDZ C;  3WTZ A;  3V8J A;  2XHK A;  3V7C A;  2VXZ A;  4ZYD A;  3WTS C;  1UB9 A;  3BRO A;  4N0B A;  1IN8 A;  4FHT A;  5BQT A;  2CWE A;  2E1C A;  3WGI A;  5F64 A;  4RB3 C;  4ZYG A;  1SFU A;  3GO5 A;  4IHT A;  4AWX B;  4EJU A;  4HX7 A;  5E1W A;  2XKO A;  3IRR A;  1JHF A;  3EUH A;  1TNT A;  1W5T A;  2YU3 A;  4A0X A;  2CW0 F;  1K79 A;  4CO8 A;  2QVO A;  1AOY A;  1XGN A;  1ZHF A;  1BC8 C;  1HW5 A;  5CVV A;  4KIC A;  4UVA A;  5LHH A;  1O7F A;  1SD7 A;  1LDK B;  3EYI A;  3O2P E;  5DD8 A;  3RPU A;  3HTU A;  5D5V B;  3CUQ A;  1JE8 A;  1G4D A;  2DFI A;  2FSW A;  2K86 A;  2HQN A;  3TOB A;  1XSD A;  3VB2 A;  2STT A;  5K5R A;  4M9S A;  5F1R A;  2PG4 A;  3OOP A;  5HLG A;  3P9K A;  5F6F A;  2PMH A;  1F1Z A;  5FFX A;  3LA7 A;  2R7D A;  2YPR A;  4JBA A;  2W85 A;  4LFU A;  1TW3 A;  4G8X A;  2IT0 A;  1T0F A;  4QWQ A;  1KGS A;  3DV8 A;  2DK8 A;  4OMZ A;  4UVB A;  4MNU A;  1EH8 A;  3Q9S A;  2VC1 A;  3NRV A;  4ENJ A;  3ERE D;  1D8J A;  4DQ2 A;  5E17 F;  4EQQ A;  3K69 A;  2HWV A;  1FLI A;  1MDM B;  4EJT A;  4AIJ A;  3LQQ A;  1IW7 F;  1Z6T A;  2K02 A;  3BZ6 A;  3TO6 A;  5D5U B;  3ELK A;  2QBY B;  1GXQ A;  1R1U A;  2Y48 A;  5HS9 A;  4I7H A;  4A5M A;  2KIU A;  1U3E M;  1D5V A;  1TLH B;  3FM5 A;  4Q5S F;  1ZN2 A;  5AIP A;  4YFK F;  3I59 A;  3FX3 A;  4IPA A;  2V9V A;  1LB2 A;  3SXY A;  4HQM A;  4YII A;  3KP7 A;  4NHJ A;  1E2X A;  3WTY C;  4XSZ F;  5HDK A;  2MD5 A;  3FXQ A;  1R58 A;  1B59 A;  3FWE A;  2RC4 A;  3K0L A;  3ML6 A;  1EH7 A;  4ZYH A;  5JI6 A;  1R5H A;  2D1V A;  2DI3 A;  4WK8 F;  1WQ2 A;  4S04 A;  4M72 A;  2DU9 A;  1KU9 A;  3QRF F;  4MGR A;  4M6X A;  4BNC A;  5D8K B;  3E5Q A;  3BJ6 A;  4LB5 A;  2X0L A;  5L3D A;  2D1H A;  1S8N A;  2MC3 A;  1DPR A;  1BN5 A;  1PUE E;  2EV5 A;  4GCV A;  3E5X A;  4I0A A;  5ILV A;  4EVI A;  3BJA A;  4CXF A;  1ZLJ A;  2JSC A;  1LNW A;  2F2E A;  2BV6 A;  3HRU A;  1HST A;  1EH6 A;  3FM3 A;  3WTT C;  2ESN A;  2ZCW A;  5LRR A;  4LMY A;  1XGO A;  2ACJ A;  2A07 F;  1FBQ A;  4A6E A;  3I71 A;  4LK1 F;  1R5G A;  5E8I A;  3HRT A;  3ECH A;  2EA4 A;  4EJO A;  4I2O A;  1X3U A;  2DBB A;  3M8F A;  4Q47 A;  3I64 A;  1QO0 D;  3B02 A;  2E7X A;  5L3F A;  4L0Z B;  1BBY A;  2LNB A;  3CUQ C;  4I01 A;  2VT2 A;  1K6O A;  2CGP A;  4EM1 A;  3LST A;  5HLI A;  1FBU A;  3FMQ A;  2BGC A;  4I09 A;  1R23 A;  3RI4 A;  3DPL C;  3GVA A;  1S29 A;  3MZY A;  1YG2 A;  2OZU A;  2XV4 S;  1IRF A;  3DPT A;  3MFK A;  1ZAR A;  4RGR A;  2FML A;  1XB4 A;  4M6Y A;  2BE5 F;  3CDH A;  2ELH A;  1E17 A;  4KFC A;  5HS8 A;  2FF4 A;  1UCR A;  2ZXJ A;  4HA8 A;  4I02 A;  1BIB A;  1ON2 A;  4RAY A;  4I0B A;  4KA4 A;  2PEX A;  3E3V A;  2DO7 A;  1R1T A;  2CFX A;  2RVC A;  3HIF A;  4AD9 A;  4N9I A;  1CGP A;  4BYY A;  2RNJ A;  1GHC A;  4MTD A;  3TDU C;  1O57 A;  3R60 A;  4IHS A;  3GZ6 A;  4YFX F;  1FBS A;  3V8L A;  4OIR F;  5ICG A;  2FBI A;  3ZP5 A;  3FHZ A;  1IN7 A;  1YFH A;  1FOK A;  4UXN A;  1JXS A;  3KLN A;  3LA2 A;  1T98 A;  2VE9 A;  4KMF A;  4RGU A;  4QLC U;  3KP4 A;  4GXO A;  4Y15 A;  5J8F A;  4L18 B;  2MH2 A;  3WU0 A;  3E97 A;  2HR3 A;  3I5U A;  2QM3 A;  4M73 A;  4BHB A;  6PAX A;  2W57 A;  3KE2 A;  3IWZ A;  4A2U A;  2FMY A;  2EV0 A;  4ENN A;  2VOP A;  2ZNZ A;  2ZKZ A;  3F6V A;  1T6S A;  5ICE A;  1TW2 A;  5ILS A;  4G94 A;  5LHG A;  2VE8 A;  1W7P A;  3F72 A;  1S6L A;  4A0Z A;  2HGC A;  4PGG A;  3PFI A;  1K7A A;  4M9Z A;  1J7K A;  4GYI A;  5L3C A;  4NQW A;  2Z3Y A;  1TQP A;  3MEX A;  2ZNY A;  5HDG A;  2VT3 A;  1ZG5 A;  5FB2 A;  4ENM A;  1WSU A;  1YW9 A;  3QP5 A;  3DQV C;  1YYV A;  3F21 A;  2RN7 A;  4EV0 A;  1XCV A;  3N97 A;  3J7A O;  3QU3 A;  2HYG D;  5FGM A;  5DV5 A;  2Q8K A;  1U2W A;  2YX4 A;  5HDN A;  1S7A A;  2DQR A;  2RDP A;  2FQ3 A;  3GUD A;  1KU3 A;  4KT5 C;  3WGH A;  3HRM A;  1G3S A;  2R7F A;  4Z2Y A;  1BJA A;  1BOA A;  1XMK A;  2CQK A;  5HLH A;  1QPM A;  4Q4Z F;  2L54 A;  1KQ0 A;  2IA0 A;  1IXR C;  1ZRC A;  1REP C;  1P4W A;  3I53 A;  5BMZ A;  5BOX A;  2GXB A;  1ZG1 A;  5JR3 A;  3BP8 A;  1HBX G;  5ICC A;  2O6G E;  1MKM A;  4EMS A;  1W4M A;  2MA3 A;  1O3T A;  4LG0 B;  2PLY A;  2EB7 A;  1I6X A;  4PCQ A;  1U5T A;  1RIO H;  3C1D A;  4HDU A;  3E6B A;  3QOP A;  3JTH A;  2XAF A;  5DUI A;  4BXU A;  1FSE A;  1SD6 A;  2BBY A;  4FX0 A;  2OA4 A;  3K2Z A;  3E6M A;  3W6K B;  2UZK A;  1AWC A;  2FEZ A;  3VFZ A;  2V1X A;  2PBI A;  4CHU A;  2NYX A;  2ZJ2 A;  4L5I A;  1A04 A;  4BH9 A;  1OYW A;  3GFJ A;  4EJW A;  2IP2 A;  3EQL F;  5H6R A;  4HAM A;  5J6X A;  4HV5 A;  3ZMV A;  2XRO A;  1ZRE A;  4GGG A;  2XVC A;  1MZB A;  2O61 A;  2P5K A;  2K4B A;  4JK1 X;  2HEO A;  1P2F A;  2HZT A;  5DCF A;  2QYO A;  1R7J A;  1S3J A;  1WRJ A;  2O8X A;  4HZF A;  1CF7 A;  3C3W A;  2W24 A;  4AVP A;  4IRG A;  1FYK A;  1JGS A;  3PQJ A;  4B8X A;  1GVJ A;  4U7B A;  1MJ9 A;  1FZP B;  4L9V A;  2DW4 A;  2M1B A;  3K1N A;  2IPQ X;  3GEZ A;  3SZP A;  4M9X A;  3QPT A;  3MAJ A;  2DPU A;  3KCC A;  1IRG A;  4KUM A;  4XBF A;  1IF1 A;  2RQP A;  2ISZ A;  2BEO A;  1WKM A;  3LAJ A;  3M7G A;  4WX9 A;  2K4J A;  5D8L B;  2QUF A;  3K1P A;  3FXU A;  1HQC A;  1XSV A;  3COA C;  1TNS A;  4GO1 A;  2M5W A;  3RYP A;  4WXH A;  4HX4 A;  1SMT A;  2KIM A;  3T8R A;  1ZRF A;  1B1B A;  2EFW A;  1P4A A;  2RGV A;  1TTY A;  1J75 A;  2GA2 A;  4OOI A;  3P9I A;  5L3E A;  2DT5 A;  1T38 A;  1F4K A;  2PJP A;  4L5J A;  1IZ1 A;  2RKH A;  3TOA A;  5DEQ A;  2H6C A;  2XUB A;  1NHA A;  5LGT A;  2QWW A;  2JT1 A;  5FD5 A;  1QZY A;  2A3S A;  3FMR A;  3WE2 A;  3TKY A;  5D6E A;  3BWG A;  3DFG A;  3TO9 A;  3HSR A;  3E6C C;  1P92 A;  1I1S A;  4B09 A;  1TQI A;  4YIF A;  3VOE A;  1U5T C;  3RJP A;  2VBZ A;  1K78 B;  3G3Z A;  1OR7 A;  3R0A A;  5D4R A;  4HF2 A;  2LKP A;  4ZH4 F;  5DYM A;  3HUG A;  1WI9 A;  1FPQ A;  1O7L A;  5KVR A;  3HRS A;  3F8F A;  3ZMS A;  4CZZ A; 
#chains in the Genus database with same CATH topology
 5CKT A;  1U8R A;  4S0H B;  5FRO A;  2P4W A;  4BY1 J;  3BPX A;  2KIS A;  2KLO A;  5M5W J;  1H0M A;  1XC5 A;  2AQF A;  3TP3 A;  2LG4 A;  4GRI A;  2KJB A;  4L0Y B;  1XMA A;  3KZY A;  2MH9 A;  1MGT A;  3WTV C;  2K9M A;  1FYM A;  2H1L A;  5H20 A;  4KIB A;  3KP6 A;  4UV9 A;  3R61 A;  2QGU A;  5D6F A;  5K7H A;  3TO7 A;  2P5L C;  2DYS H;  2L7K A;  2E2I J;  3OWT A;  5BNG A;  3WG9 A;  1SMY F;  3JRD A;  3M9A A;  2PMU A;  3S3M A;  1WHU A;  1Z05 A;  4I76 A;  5DM7 F;  4N4N B;  1QHG A;  3E6D A;  5E20 A;  2X1E A;  1G3W A;  4ANJ A;  1IN4 A;  3KEQ A;  4XN0 A;  2Y0S A;  3K10 A;  2OC6 A;  2E2H J;  1PUF B;  1IG7 A;  3CTA A;  1HXD A;  3FIW A;  1XDS A;  2ZME C;  2V9K A;  1ZGA A;  3P7N A;  5FFZ A;  3WTU C;  5HNH A;  5E1X A;  3GFI A;  2IAI A;  3ZMU A;  5B1B H;  3CES A;  3ISP A;  4IF4 A;  2I5U A;  4AIK A;  1OIS A;  4IHV A;  2JA8 J;  2VJ4 A;  3L7W A;  5IT9 K;  3I56 I;  1U9O A;  3WTX C;  1I50 J;  2X1C A;  1X4P A;  5DD4 A;  5F0F A;  1LDJ A;  3NQO A;  1I5Z A;  5C4X J;  3CLQ A;  2MLK A;  4BEH A;  2A6H F;  3W3C A;  3SDG A;  1RUN A;  2F5D A;  3HOW J;  2A6T A;  1O3S A;  2EFN A;  1TP4 A;  4UNO A;  3ZXS A;  2NOJ B;  4ZJZ A;  3HOS A;  4BQA A;  4GDF A;  4BBS J;  2MBF A;  4BL0 B;  5IP6 A;  3IKT A;  4LB6 B;  4NNJ A;  3I3L A;  1Z6R A;  2PFB A;  2M7A A;  2JA5 J;  3HHG A;  4E7S A;  2DPD A;  3H5A A;  2H6B A;  3CCJ I;  5CVR A;  2NVY J;  1V55 H;  2AS5 F;  1MBH A;  2OBP A;  1B4A A;  2VPL A;  4A5N A;  5CLS A;  1KYZ A;  2B9S A;  2L3D A;  1Z7U A;  1FOX A;  1MMN A;  3HHH A;  1DGW Y;  2KZV A;  3GBG A;  1HKS A;  1J2X A;  1AKH B;  2K27 A;  4V19 K;  4BXX J;  2D2W A;  5E3N A;  1VQP I;  2JPC A;  4XMY A;  5JHF A;  2ZFW A;  2ZFU A;  4P9F A;  4DIQ A;  5EEG A;  5K5O A;  3P5J A;  2Z33 A;  4XOR A;  2QSH X;  3L9F A;  4YIR X;  2V1N A;  2XKP A;  3M3Y J;  1TBX A;  1DP7 P;  2NRA C;  3SFZ A;  2VB6 A;  1VQ5 I;  4NDL A;  1ZH5 A;  1G3T A;  4MEY F;  1FYL A;  3U2R A;  3J80 Z;  3IH2 A;  1EV7 A;  3HG9 A;  3IUO A;  3K4J A;  2P6T A;  3KET A;  2QZ8 A;  2OAZ A;  4IJA A;  1QGP A;  2EJR A;  2HKX A;  3QAH A;  4IHW A;  4ZZL A;  1F36 A;  1HC8 A;  2W1O A;  3GF2 A;  2P8T A;  3QP6 A;  4P5O A;  4C3J J;  1XCB A;  2QQA A;  3AFH A;  4DJA A;  1HSJ A;  4RB1 A;  1A5J A;  4G6T B;  4EEF G;  1YOV B;  3ZQ7 A;  1IXC A;  4YG2 F;  2HOS A;  4TV7 A;  3CUQ B;  3KFW X;  5CYV A;  3H3V K;  2IVM A;  1BC7 C;  3IKV A;  2KRH A;  1RKT A;  1I39 A;  1LJ9 A;  2LY2 A;  3CCY A;  2STW A;  3LSP A;  2NVU B;  4EGZ A;  1T39 A;  3LSJ A;  2CV0 A;  2JVH A;  3LSM A;  3GX4 X;  5F04 A;  1UHW A;  2F5V A;  4NBQ A;  4L5E A;  3CO7 C;  4IO9 F;  2M45 A;  5KAF C;  2EZL A;  1FP2 A;  3T5X A;  3OV8 A;  2P0W A;  2EWN A;  3WTW C;  2WV0 A;  4KIF A;  5DCM A;  3ZPL A;  4CYC A;  2ZJR F;  3GLX A;  1N78 A;  2VBX A;  4UB8 C;  2HYJ A;  3EYY A;  3C7J A;  1Y1V J;  3V4G A;  2G7H A;  2CG4 A;  3F8C A;  2Y0S N;  2E34 A;  1T08 B;  1YS7 A;  3I58 A;  3QOD A;  1QVU A;  3F6O A;  1FY7 A;  1QVT A;  4HOB A;  1JT0 A;  2WAQ A;  3KP2 A;  1QQI A;  2AQE A;  1L0O C;  1MJB A;  3PM1 A;  5CVI A;  4D0P A;  2WWY A;  1OCZ H;  3GWZ A;  2Y30 A;  4I98 B;  4MTE A;  3NWT A;  1OR7 C;  4C3H J;  5TRD A;  2EFP A;  1D1A A;  1ONV A;  1USS A;  2XAG A;  5IOZ A;  2X51 A;  1PP7 U;  3IP4 B;  3LQR A;  1WZ2 A;  3BR3 A;  4ZYA A;  4C2M J;  2FBH A;  3G2B A;  4XKW A;  5LEK A;  3K4M A;  3RYR A;  1P4X A;  2EFO A;  1W36 C;  3BG7 A;  4HDV A;  1C0W A;  2FNA A;  4P9U A;  3OYL A;  4CA0 A;  4JP0 A;  1OMI A;  4L9N A;  4PDK A;  2FE3 A;  1B6A A;  1Z3X A;  2E1M C;  5CVJ A;  2R7U A;  4G6D A;  1JJ6 C;  1HF0 A;  2QEN A;  3L09 A;  1UJ8 A;  2LBF A;  4CYD A;  4WWC A;  2VUM J;  3OOU A;  3CP8 A;  4BKX A;  3IRQ A;  1ORK A;  3T8T A;  2V1U A;  3KX2 A;  1OFC X;  3C18 A;  4XLH A;  1BM9 A;  3B6A A;  3ESW B;  5K7F A;  2M2E A;  3EUK L;  3OIO A;  5LRS A;  2BYV E;  1PDN C;  1VQK I;  3OL4 A;  1H9T A;  5H6Q A;  2LF8 A;  4A69 C;  5JHU A;  2L0K A;  3I59 B;  2RRE A;  2O0Y A;  3K4N A;  2CRG A;  5ED4 A;  1W5S A;  3FHN A;  1IUY A;  5E79 C;  4IKF A;  4BAY A;  3IH4 A;  4LLG F;  1IN5 A;  1FMV A;  1N75 A;  2GZW A;  3K1M A;  3GW2 A;  5IYD J;  4LK0 F;  2DA2 A;  3KZZ A;  2BY3 A;  4XNF A;  3JSP A;  4UUV A;  3H92 A;  1TWC J;  3V8K A;  3S17 J;  3BPV A;  3RKY A;  1LE8 A;  2IGN A;  1IXS B;  2K9S A;  1XGM A;  2NS8 A;  4R1H A;  5BPI A;  1W36 D;  1U78 A;  1ACI A;  4N9H A;  5EEH A;  1IJW C;  3BJO A;  4CH7 A;  2WC2 A;  2A68 F;  2F4I A;  3IAM 2;  3JCU C;  3E0J B;  1DU6 A;  2DTZ A;  4XKB A;  4ASN A;  2IA2 A;  2TDX A;  3DLA A;  2NS7 A;  3MD2 A;  1A6I A;  2KT0 A;  2R7S A;  4CIC A;  4BUP A;  4PJL A;  4AM3 A;  2K9L A;  2GWR A;  1ZLK A;  2YX7 A;  4A93 J;  4I6Z A;  5IP7 J;  2MD0 A;  4BQQ A;  3MKY B;  1E3H A;  2BW3 A;  3V7S A;  2DA1 A;  3FMS A;  3KLO A;  2NAZ A;  2P6S A;  4OAY A;  3HL2 A;  4ZTF A;  1UST A;  3WU2 C;  3OYN A;  4WF2 A;  1R4N B;  1N25 A;  2FRH A;  1XD7 A;  3HOX J;  3IH3 A;  1STZ A;  2BY0 A;  3ABU A;  1F5T A;  1J0R A;  3TQN A;  3V42 A;  1H88 C;  4ESB A;  2ETH A;  3Q0U A;  4QSH A;  3J80 K;  3KEO A;  3NAU A;  3I54 A;  2OQG A;  1MDM A;  3ZOB A;  2W7N A;  2IJL A;  1HW1 A;  1Y8R B;  3S15 J;  4AIH A;  2QBY A;  2YU9 J;  2VQH A;  3HOY J;  1HKT A;  4P55 A;  1JTY A;  2EFQ A;  3ZMZ A;  3VWB A;  3HM5 A;  4R79 A;  3F8N A;  2FOK A;  3ABL H;  4IXA A;  1ETX A;  2XRN A;  1HDD C;  3JRC A;  4OAZ A;  4M3B A;  3GYH X;  4M71 A;  4J19 A;  2DYR H;  2F5F A;  3G73 A;  4XSX F;  5HOO A;  2DTR A;  2WAQ N;  2XAQ A;  2ZXI A;  3RKX A;  1V5E A;  3CDL A;  3FBI B;  1VQO I;  4HLY A;  5A2Q Z;  3OS0 A;  1QHH D;  2HVQ A;  5IOY A;  1UMQ A;  5LBQ A;  3BR1 A;  3U1D A;  2FNP A;  4ENK A;  2HPI A;  4UY8 I;  1DGR M;  2K7L A;  5AIQ A;  1QZE A;  2KKO A;  3GTQ J;  5HOD A;  4BBR J;  4A3I J;  2CO5 A;  1ZRD A;  3CMY A;  3SEZ A;  4HPQ A;  2KQR A;  1ZGW A;  2GOM A;  2VAS A;  1HLV A;  1WJE A;  1JUP A;  5DTD A;  4BHP A;  2ISY A;  1R6R A;  3HJE A;  4FTH A;  2CSO A;  2J5O A;  3OYI A;  2W84 A;  1K4T A;  1FIP A;  4U0W A;  3HPG A;  4ESJ A;  1UHS A;  2EZK A;  2FA5 A;  1YLF A;  4A0Y A;  3H1C A;  3LSI A;  4CDG A;  2VC0 A;  3A4C A;  4RGS A;  1O3R A;  3ABT A;  1LPQ A;  4MEX F;  1OPC A;  3MWM A;  2MAB A;  4J00 A;  2DMN A;  1ETY A;  2HKO A;  4U0Y A;  3F8B A;  2RQQ A;  2DJN A;  5KK1 A;  3PL8 A;  2L4A A;  2GA1 A;  4XLA A;  1BI3 A;  5FLX K;  1KU7 A;  1APL C;  4Y13 A;  3GZ5 A;  3Q0W A;  3K4C A;  1FTZ A;  4C2T A;  2V79 A;  4KNY A;  3FXM A;  3HSE A;  3D0S A;  3LSH A;  2DCE A;  5EYR A;  3CC2 I;  1QA6 A;  2W00 A;  2IXS A;  2Z9O A;  1ON1 A;  1ZGJ A;  2W82 A;  1XGS A;  3BLY A;  5GPC A;  3M4O J;  2DA6 A;  2JVG A;  2LDU A;  2MW8 A;  3FZV A;  2ZC2 A;  3LOC A;  4UHT A;  5BPD A;  3H3Z A;  2COB A;  1D3Y A;  1ULY A;  3F23 A;  2R5Z B;  2OV7 A;  2VXD A;  3EUA A;  2HXI A;  1EF4 A;  4P96 A;  4L9J A;  4DNC A;  4OU0 A;  3TMO A;  5D5W B;  1FSH A;  2CUF A;  2HS5 A;  5BS6 A;  5LEJ A;  1WWX A;  5IYB J;  2R3S A;  2VKD A;  3W6J B;  4PZJ A;  5D4S A;  1Z77 A;  5E18 F;  1OCT C;  2XGD A;  2F4M B;  5HS7 A;  1KQ8 A;  1YO5 C;  2AXL A;  2XDV A;  5DS9 A;  4ON0 A;  2Z99 A;  4KT6 A;  1QBJ A;  3DBR B;  2QKM B;  1UHM A;  5JVT A;  5DDG A;  4ITV A;  2QLZ A;  1B72 B;  3VPR A;  5DCM B;  3GTO J;  2JA7 J;  1F43 A;  2ZME A;  1RZ4 A;  4RM3 A;  3RZD J;  3RQ4 A;  1LFP A;  3W2W A;  4G7H F;  1ZYR F;  2H27 A;  1VQL I;  1NG7 A;  3CDI A;  4UVC A;  2M8E A;  1GT0 C;  2LK2 A;  2DAO A;  2K3P A;  1RNL A;  1UEL B;  1R9T J;  5LLQ A;  2D45 A;  4MQV A;  2CU7 A;  5IP9 J;  2YSR A;  2IBD A;  3KYD B;  3REO A;  1JHH A;  4IVN A;  2MG4 A;  2VKH A;  3H35 A;  5L3B A;  4W1U A;  2DLL A;  5CQE A;  1MBF A;  5K1Y A;  3CMA I;  5J4V A;  3VEP A;  2GAU A;  2KDZ A;  4HNT A;  3PQK A;  1QPI A;  3ZRG A;  5FD6 A;  2HVS A;  3W2A A;  4CCL A;  4YFN F;  3PIP F;  3ZMD A;  1BW5 A;  4ETS A;  1H89 C;  3IHU A;  3E5U A;  1HKQ A;  2AO9 A;  4RM2 A;  2P5V A;  1LVA A;  3CJN A;  2OQR A;  4IZZ A;  3HDD A;  1Z21 A;  1D0Y A;  2LVS A;  1AU7 A;  4U7D A;  1YS6 A;  1O3Q A;  4HF0 A;  1VQ9 I;  2X6X A;  1W7P D;  2CS3 A;  1XPX A;  1V54 H;  1LEA A;  1OCP A;  3LMM A;  2BVM A;  4DOZ A;  1EJ9 A;  3S2D J;  2HOE A;  3ERM A;  1TL8 A;  1I6H J;  1YW7 A;  5J4Y A;  3DTI A;  5A2Q K;  5IT9 Z;  2E5N A;  2XB0 X;  1W7P B;  4K2E A;  3DU6 A;  3OL3 A;  4HYE A;  5GP9 A;  4ABZ A;  2PQ8 A;  5CJ9 A;  1BI2 A;  2RNG A;  3G6E I;  4UUS B;  4BHC A;  3JRF A;  3DKY A;  2E5Z A;  1E0E A;  1P9Q C;  4HBL A;  3WU1 B;  1V4R A;  3SZG A;  2DMU A;  5GAE J;  2JRT A;  4O3M A;  4OIP F;  3H9Q A;  1ERD A;  3E7L A;  4NQW B;  4KN7 X;  2TCT A;  5EGO A;  1Y6I A;  1RKW A;  4U88 A;  2DOD A;  3OYJ A;  3H36 A;  2GOX B;  1XN7 A;  3DWL E;  2X85 A;  3DXJ F;  4OIO F;  4A3L J;  3KYC B;  4NUB A;  1W1W E;  2NNN A;  2M0C A;  1WJA A;  4CGZ A;  4LGW A;  4OMY A;  1BI1 A;  2CUE A;  3HPH A;  1VZ0 A;  4KYW A;  3TGN A;  3ROU A;  3WGG A;  2MLG A;  4RB0 A;  2DDB A;  4AID A;  2A5Y B;  2BY1 A;  3S16 J;  5FO5 A;  2XSJ C;  5TJJ A;  4KDP A;  2NVQ J;  1ODD A;  1ZK8 A;  4XRF A;  1R1V A;  2GQQ A;  4S05 A;  3JRB A;  1KU2 A;  4F52 A;  2CJJ A;  1SFX A;  5FRM A;  3OIQ A;  2A69 F;  1B9M A;  3CO6 C;  3LFK A;  4HQE A;  3AG3 H;  4AVZ A;  5M5X J;  3BG3 A;  4R8H A;  2ZSH B;  4G6Q A;  3L00 A;  1X19 A;  3WG7 H;  3ZQG A;  2KJC A;  1QRY A;  4GYG A;  2ADU A;  5L3G A;  2NS0 A;  3MQ0 A;  3IV5 A;  3MZH A;  1LDD A;  1OQY A;  2DA4 A;  1JJ8 C;  4A3G J;  2XAJ A;  2EA2 A;  2KRF A;  5K5Q A;  2EQR A;  3K9T A;  3HYI A;  2X6Y A;  4XLE A;  3RIR A;  5C44 J;  2UXN A;  3DTK A;  2KDO A;  4EM2 A;  3HC7 A;  3S2W A;  1LUJ B;  4ZZD A;  1ZEL A;  2EK5 A;  4OIQ F;  4O5V A;  1WFX A;  2K3F A;  3ULQ B;  4HV6 A;  2H8R A;  1F9N A;  4M3D A;  4UV8 A;  4M3E A;  1YI2 I;  2ZJQ F;  2WB1 A;  2HFH A;  5IY5 H;  4F7Z A;  3DKW A;  2OTL I;  2JN6 A;  3VSL A;  4ZYE A;  3DEE A;  2XPU A;  1RRJ A;  1G6N A;  2C6Y A;  1R71 A;  4JQF A;  3U21 A;  2V1D A;  1FT9 A;  4KN4 X;  1BW6 A;  1DUX C;  5GAG J;  2H09 A;  3QYE A;  1NK2 P;  1Q1H A;  4XID A;  3OS2 A;  3I4M J;  1S72 I;  2CW8 A;  4FAS D;  1X1C A;  5E1Z B;  3J7Z I;  1CQT A;  1XTA A;  4PFP A;  2FU4 A;  1R5I D;  2ZO4 A;  5HLT A;  2HTJ A;  1Z9C A;  4HEA 2;  3O6B B;  3IC7 A;  3QPS A;  4IOA F;  2DQL A;  1U5T B;  1VQ6 I;  1R00 A;  2IGO A;  2KZG A;  3BG9 A;  1XG1 A;  3ECO A;  2Y69 H;  1RPW A;  5GPA A;  3SQN A;  2ID6 A;  3EET A;  2NNY A;  2L9R A;  3S14 J;  1SD5 A;  5HVQ C;  1OCC H;  3LA3 A;  2M30 A;  1HDP A;  1KON A;  4IL6 C;  3F22 A;  2CQN A;  3BTC A;  4EM0 B;  2DK5 A;  1FIA A;  1ZTR A;  3GFM A;  1SAX A;  2VBY A;  3OSF A;  3A01 A;  4FE7 A;  2QF7 A;  2DT6 A;  2EIJ H;  2HQ5 A;  3L2V A;  3SHF A;  2W25 A;  3T0Y A;  1OYI A;  1XMX A;  2VKE A;  4F92 B;  2GM4 A;  5LGN A;  4BAC A;  5EG0 A;  1Z0X A;  4A3J J;  4XL9 A;  4BJ6 C;  2F5C A;  1J5Y A;  3N4M A;  1MBK A;  4QPO A;  2P7V B;  4Y17 A;  1MH4 A;  2HQR A;  2Y2Z A;  4XK4 A;  3VOD A;  1D8K A;  4A12 A;  1VTN C;  2HTS A;  3HOT A;  1ZG3 A;  2O3F A;  5JLX A;  4KMU X;  2PI0 A;  2L9V A;  3CCV I;  4ZTJ A;  4HF1 A;  5EZH A;  3S1M J;  5CVU A;  2X4H A;  2Z2S B;  2VON A;  1DPU A;  1KA8 A;  2O03 A;  4LIV A;  4LD5 A;  4E6K G;  3CF5 F;  3G71 I;  4HST A;  4E7H A;  2DOF A;  3H9J A;  1G3Y A;  2IW5 A;  1ZAO A;  4E7K A;  2OD5 A;  3TL4 X;  2PMZ N;  3F8M A;  2JTV A;  4XLC A;  1P7I A;  1IGN A;  2OTJ I;  2OZ6 A;  4NB5 A;  3JRA A;  2X6O A;  4V2F A;  3D5L A;  4QPQ A;  2R5Y B;  1OCR H;  3DKX A;  1IN6 A;  1IDY A;  2ZME B;  4LG0 A;  1IAW A;  2DXI A;  2JA6 J;  5ERI A;  1WH5 A;  1CF7 B;  4IRI A;  4WXC A;  1FP1 D;  4DYR A;  1I27 A;  2EZI A;  1OKR A;  1YQA A;  1JI8 A;  4XLN F;  3AL0 C;  4FT8 A;  5E3O A;  3GTJ J;  5CQG A;  2WB1 N;  1MND A;  3JR9 A;  4MQ9 F;  1DDN A;  3HTS B;  4RS8 A;  4E4H A;  2XAS A;  2KL4 A;  2LY9 A;  2UWM A;  1P6R A;  1MMD A;  2E19 A;  4D7M A;  1E3O C;  3TBI A;  5GAD J;  3CUO A;  2HPM A;  2LF7 A;  2VBW A;  4EJV A;  3SZT A;  5FKL A;  4PGH A;  3DP7 A;  1J9I A;  4A6D A;  2E1N A;  5KHD A;  3GTP J;  1ETK A;  1U0J A;  4FX4 A;  1H9G A;  1YIO A;  3A02 A;  2DJI A;  3BC8 A;  5AON A;  1FC3 A;  1T0F C;  3ZGK A;  1OLT A;  1SD4 A;  1XSX A;  2GXG A;  2Q1Z B;  2NVT J;  1O4X A;  3RPQ A;  2CYY A;  4XLP F;  2VOD A;  3RKW A;  3R6S A;  2FX0 A;  1VQ8 I;  1TWF J;  1WJ5 A;  1D1C A;  3S1R J;  1YJW I;  4M3F A;  4NC8 A;  1LEB A;  1MBE A;  1H8A C;  2HDC A;  1Z1D A;  4QIW N;  2KIF A;  1T8I A;  1VQM I;  1NH3 A;  4HW0 A;  5ILU A;  4G7O F;  2BHZ A;  3FKI J;  4OIN F;  1GXP A;  3WHC A;  3KZI C;  3ZN0 A;  3OYE A;  4E7J A;  3HSF A;  5JFR A;  2VLA A;  4EGY A;  5FKO A;  2Q2E A;  5CPR B;  3NEU A;  2VQL A;  3F3X A;  1UG0 A;  2DOE A;  2E36 A;  2M4G A;  3OYD A;  1LKX A;  3PNY A;  5EGO B;  3ZN1 A;  2RV8 A;  5LGU A;  5M5Y J;  3BY6 A;  1Y0U A;  4B48 A;  3U9G A;  3PSF A;  1PP8 F;  4GFB A;  2IEK A;  1ZR2 A;  4HLX A;  2Z5U A;  4B44 A;  3AAF A;  2L02 A;  1JKR C;  1MMG A;  4B43 A;  4DBR A;  3JRG A;  4D1Q A;  2OU2 A;  4KIT B;  2W48 A;  1FOY A;  3M07 A;  4XM3 A;  2M34 A;  4BXF A;  2LD5 A;  4G7Z F;  3VYR B;  3H5N A;  1KZH A;  3DCF A;  4CCO A;  5ICF A;  2FOW A;  5FLX Z;  2L4M A;  3GFL A;  2UXX A;  2VN2 A;  4LJZ F;  2F48 A;  5M3F J;  3LSG A;  3L2W A;  2E2J J;  4WCG A;  4E7L A;  1I1G A;  2VOO A;  3MN2 A;  1OYY A;  2Y75 A;  1S7E A;  5J8C A;  3RQI A;  2ELK A;  3JAM Z;  4DW6 A;  4UB6 C;  2V9P A;  4B3X A;  1GDT A;  3SEQ A;  3FDY A;  3M1C A;  1R4M B;  3BDD A;  2G7U A;  3OY9 A;  2O7O A;  1MD0 A;  2N8G A;  3PUF A;  4HX8 A;  3KP5 A;  3FF5 A;  1FX7 A;  2L7Z A;  2WAE A;  2M9H A;  2QSG X;  3IAS 2;  5E3L A;  2PN6 A;  1IV8 A;  4Q48 A;  3Q9V A;  2B63 J;  2A6E F;  3AG4 H;  3V7R A;  2L01 A;  3WOD F;  1NG6 A;  3BTL A;  3OYG A;  3JW4 A;  3K4K A;  4A3K J;  1AHD P;  3K2A A;  2COM A;  4E70 A;  1B9N A;  3B73 A;  1RET A;  3DEU A;  2G9W A;  3HUG B;  2CV2 A;  4FE4 A;  3J81 Z;  1KYW A;  1QNT A;  2WBM A;  3H3U A;  2CW7 A;  3R0J A;  1T2K A;  3BR5 A;  2MFZ A;  3CCS I;  3I4P A;  1WVR A;  2WY7 Q;  2QA4 I;  3L1P A;  1B8I A;  3IL2 A;  3S3O A;  2ESH A;  2QQB A;  1MH3 A;  1UFM A;  2E1M B;  3CJR B;  1IRX A;  2DFE A;  2WTE A;  3L2C A;  1X1B A;  4M74 A;  2DMQ A;  1BIA A;  1YTY A;  4RAZ A;  1FWZ A;  5GTH C;  1R36 A;  2OF7 A;  1XDU A;  2HYF A;  1X58 A;  1ETQ A;  2V6C A;  1JGG A;  2W4S A;  4XIC A;  2VJ5 A;  1X2M A;  2YR2 A;  4F93 B;  3W6V A;  3OR2 C;  3VSK A;  4P1W A;  3CCE I;  4U0V A;  2ZXH A;  4H0E A;  1V3F A;  3P9C A;  5FLM J;  4L9T A;  1RI7 A;  1VQ4 I;  1JKO C;  1Y8Q B;  3KP3 A;  3JSO A;  3M1E A;  3BZK A;  2VJJ A;  3DBL B;  4PSX A;  2XF7 A;  2JPB A;  4G12 A;  2Y31 A;  4PSW A;  2WY8 Q;  5LHI A;  2JZY A;  1X1A A;  3QU6 A;  4G9Y A;  3ZMT A;  5F08 A;  1KQ9 A;  1X2N A;  5E8G A;  1Z91 A;  1ZR4 A;  4CCN A;  4H4K C;  4XQF A;  2FJ1 A;  3LAP A;  1R49 A;  1MMA A;  1K4S A;  1BI0 A;  2XAH A;  3CCL I;  4C2U A;  4AC0 A;  2F5E A;  2EV6 A;  3I55 I;  5DUK A;  2ZBK A;  3MCZ A;  3UKG A;  2JMW A;  2KP6 A;  3GCM A;  3M8E A;  4RA2 A;  3OYA A;  1TT5 B;  4II3 A;  1S7O A;  1K78 A;  5KNL A;  2FXA A;  3G4S I;  2Y0M A;  2M87 A;  3PNV A;  4BEH B;  1VQN I;  2XGX A;  3QPH A;  4PJ0 C;  3JRH A;  2GIV A;  4DZP A;  4WXD A;  4OWR B;  1YRN A;  2NVX J;  2XIG A;  2EBI A;  4Z6Y A;  2M3A A;  2CQX A;  2BOL A;  3KIO A;  4RB2 C;  3VYU B;  3MKZ A;  4A3B J;  3LWF A;  2L5Q A;  4LLL A;  4XOP A;  3RTR A;  4MHG A;  1YW8 A;  2DA7 A;  3B6C A;  4RGX A;  2XPV A;  5B5E C;  2IRF G;  3JTG A;  3IWF A;  3CCU I;  3ZQL A;  2LKS A;  3HKZ N;  4AU7 A;  4O6J A;  2P7C B;  2J5P A;  1TQM A;  3R4K A;  3G1M A;  1U6G A;  5D5X B;  3WE3 A;  4LLN A;  3CLO A;  3M8J A;  3T1B A;  1LQ1 A;  1SFE A;  4IRH A;  2WAD A;  1V5F A;  1YX3 A;  4ZDL A;  1QZZ A;  1WH7 A;  3PO3 J;  2R0Q C;  1L3L A;  1YIJ I;  3DBH B;  1MJA A;  5IT3 A;  4CCJ A;  5IPA A;  4FET A;  3FXR A;  2V4J C;  2Q0O A;  4FCY A;  1A31 A;  1A35 A;  2QQ9 A;  3JAM K;  2H94 A;  4ESF A;  1PUF A;  2XAU A;  3EPZ A;  1BJZ A;  3BR0 A;  3CCR I;  3GTG J;  1D0Z A;  2LSO A;  2ELJ A;  3S93 A;  3DF8 A;  1RUO A;  3HOV J;  2FBK A;  2KIQ A;  2YS9 A;  4MO7 A;  2A61 A;  3Q5F A;  2B0L A;  1R22 A;  2M8G X;  3BOQ A;  1HCR A;  1YE9 A;  2E7W A;  1FNN A;  4BU2 A;  3EDP A;  3ZQQ A;  3I0T A;  3BZC A;  2JA2 A;  2F4O B;  2IA1 A;  4B47 A;  2XF5 A;  4XON A;  3GXO A;  1HW2 A;  1PYV A;  2ECC A;  1J59 A;  3O3K A;  3J81 K;  1Z7L A;  3RDI A;  3DU5 A;  4KIG A;  3CP2 A;  3TDZ C;  3WTZ A;  1ETW A;  3HGG A;  1G2H A;  3V8J A;  2XHK A;  4CZC A;  3V7C A;  2VXZ A;  4CYC B;  4ZYD A;  3WTS C;  2HXO A;  3ZQH A;  1UB9 A;  3BRO A;  2JRM A;  4N0B A;  2XC7 A;  1IN8 A;  4FHT A;  2Q2E B;  3LNQ A;  5BQT A;  2CWE A;  2E1C A;  3FXL A;  3WGI A;  5F64 A;  4RB3 C;  4ZYG A;  1SFU A;  2Y9Z A;  1AKH A;  1RR7 A;  2XGE A;  3GO5 A;  4IHT A;  4AWX B;  4EJU A;  4HX7 A;  3H0G J;  1BR4 A;  1D0X A;  3HEF A;  5E1W A;  2XKO A;  3BG5 A;  3CJQ B;  3IRR A;  1JHF A;  3EUH A;  2CQQ A;  2Y9Y A;  3ABK H;  1TNT A;  3K7A J;  1W5T A;  2R7Q A;  2QEX I;  3BCB A;  2YU3 A;  4A0X A;  2CW0 F;  1K79 A;  4CO8 A;  3AKZ A;  2QVO A;  1AOY A;  4QTR A;  2LBF B;  1XGN A;  1ZHF A;  3OYF A;  1BC8 C;  2R93 J;  3NAR A;  1WJD A;  1HOM A;  1SFK A;  3GME A;  1HW5 A;  3ASO H;  5CVV A;  5B66 C;  4KIC A;  4LIT A;  4UVA A;  5LHH A;  1O7F A;  1SD7 A;  3ZQC A;  4LIU A;  1LDK B;  3EYI A;  1XX5 A;  3PIO F;  3O2P E;  5K7Z A;  5DD8 A;  3RPU A;  4PJM A;  2IS6 A;  3HTU A;  5D5V B;  3CUQ A;  1JE8 A;  4KJZ A;  4IOC F;  1SAU A;  3QYF A;  1G4D A;  2K5C A;  2DFI A;  1WGX A;  2FSW A;  5JLW A;  3C2B A;  3ZQF A;  3GTL J;  2K86 A;  2HQN A;  3TOB A;  1XSD A;  2ICW G;  2L9N A;  3VB2 A;  4B1R A;  4DZJ A;  1SVL A;  2STT A;  4HG2 A;  5K5R A;  3K70 C;  2GXA A;  1IRZ A;  3PNT A;  4M9S A;  5F1R A;  2PG4 A;  3OOP A;  2FD5 A;  2EIN H;  5HLG A;  3P9K A;  1LE8 B;  3H5R A;  1D5Y A;  5F6F A;  2PMH A;  1F1Z A;  5FFX A;  5TIS C;  3LA7 A;  3WHB A;  4C9Y A;  2NOG A;  4IX7 A;  2LOO A;  1EKE A;  3A0H C;  2HDW A;  3OS1 A;  1BL0 A;  2R7D A;  2YPR A;  4JBA A;  2M4K A;  1W0T A;  2W85 A;  2E71 A;  2JUC A;  4LFU A;  1TW3 A;  2GIZ A;  4G8X A;  2IT0 A;  4PK4 A;  1T0F A;  1G59 A;  4QWQ A;  1KGS A;  3DV8 A;  3SYT A;  2DK8 A;  2L9S A;  2XB5 A;  2VKV A;  4OMZ A;  4UVB A;  4MNU A;  3J7A Y;  2BW3 B;  1EH8 A;  1P7J A;  3Q9S A;  2VC1 A;  3NRV A;  1EA3 A;  4ENJ A;  3ERE D;  2HNH A;  3GZN B;  4AYB N;  2LKX A;  1PVE A;  1D8J A;  3OYK A;  4DQ2 A;  2PMZ A;  2E35 A;  5E17 F;  2X48 A;  4EQQ A;  3K69 A;  3A03 A;  2HWV A;  1FLI A;  3L2U A;  1MDM B;  4AIJ A;  4EJT A;  3LQQ A;  1IW7 F;  1MNM C;  1Z6T A;  2K02 A;  3BZ6 A;  2ZSI B;  3TO6 A;  5D5U B;  3K70 D;  2KHM A;  3HOZ J;  3ELK A;  2V26 A;  1DQU A;  1GXQ A;  2QBY B;  1UG2 A;  1R1U A;  2XGC A;  4JX6 A;  5EDN A;  2Y48 A;  5HS9 A;  4I7H A;  1I3Q J;  4A5M A;  2KIU A;  5B1A H;  4XRM A;  1U3E M;  5DM6 F;  1D5V A;  2O8K A;  1TLH B;  3FM5 A;  4Q5S F;  1WCM J;  1ZN2 A;  3CC7 I;  9ANT A;  2LRE A;  5AIP A;  2Z16 A;  2R92 J;  3G1O A;  3PSI A;  4YFK F;  2XSD C;  3I59 A;  1W0U A;  2BHY A;  2VL8 A;  3FX3 A;  4IPA A;  2V9V A;  4E7I A;  1LB2 A;  3J7Y J;  3SXY A;  4HQM A;  4YII A;  3KP7 A;  4NHJ A;  1E2X A;  2EZH A;  3WTY C;  1PJR A;  4BGD A;  2ME0 A;  4XSZ F;  5HDK A;  2MD5 A;  3FXQ A;  1R58 A;  1B59 A;  1SC7 A;  5FLV A;  3FWE A;  2RC4 A;  2XF6 A;  3OSG A;  1OJL A;  3K0L A;  4EAT A;  3ML6 A;  3FXK A;  1EH7 A;  3LL7 A;  2KMU A;  2DA3 A;  3SJM A;  1GV5 A;  4ZYH A;  5JI6 A;  1R5H A;  2D1V A;  2DI3 A;  3F9K A;  1WQ2 A;  4S04 A;  4WK8 F;  4M72 A;  2DU9 A;  1POG A;  4F91 B;  1KU9 A;  3QRF F;  2OJE D;  4MGR A;  4M6X A;  4BNC A;  4I99 C;  5EZG A;  5D8K B;  3E5Q A;  3K6G A;  3BJ6 A;  4DYQ A;  1TT0 A;  3C2G A;  4LB5 A;  1JT6 A;  3RKQ A;  2X0L A;  3KEY A;  5L3D A;  2D1H A;  1S8N A;  2MC3 A;  4RBO A;  5TGT A;  3Q0V A;  2OPT A;  1DPR A;  1BN5 A;  1PUE E;  2EV5 A;  3ABM H;  3VDX A;  4BDY A;  3HBL A;  1NK3 P;  1JKP C;  4M6V A;  3N05 A;  4GCV A;  4HNV A;  2M7B A;  4A3F J;  3E5X A;  2OCC H;  3HXL A;  2Z1D A;  4I0A A;  3VYS B;  5ILV A;  2DOA A;  2HOA A;  4EVI A;  3BJA A;  5H2F C;  4CXF A;  4Y52 J;  3BCA A;  3L2Q A;  1DP3 A;  1ZLJ A;  2JSC A;  1LNW A;  2F2E A;  3UNG C;  4C30 A;  2BV6 A;  3HRU A;  1HST A;  1S5L C;  1EH6 A;  1JKQ C;  3FM3 A;  3WTT C;  1YJN I;  2ESN A;  1TC3 C;  1FOW A;  2R7V A;  2R7O A;  3Q3S A;  2ZCW A;  3BQZ A;  1W5C C;  4XLF A;  3UR3 C;  3L2R A;  2DN0 A;  2EH3 A;  2HI3 A;  3EUH C;  1XGO A;  4LMY A;  5LRR A;  2ACJ A;  2A07 F;  1Q1V A;  1RR8 C;  4BE1 A;  1FBQ A;  4A6E A;  3I71 A;  2HVR A;  4XKC A;  4LK1 F;  1R5G A;  1SEU A;  1FTT A;  5E8I A;  3HRT A;  2O9L A;  3ECH A;  4D7N A;  2EA4 A;  4EJO A;  2K9Q A;  4I2O A;  1X3U A;  2DBB A;  3M8F A;  2ZJP F;  3JRI A;  4Q47 A;  4N4O B;  3X2Q H;  3I64 A;  1QO0 D;  1K6Y A;  3B02 A;  1IV6 A;  2E7X A;  5L3F A;  4L0Z B;  4F55 A;  2UUZ A;  3C2H A;  4XKV A;  1BBY A;  2LNB A;  3CUQ C;  4I01 A;  2V6E A;  2VT2 A;  3D1N I;  1K6O A;  2DDA A;  2CGP A;  4EM1 A;  3LFU A;  4IQ4 A;  1T56 A;  3LST A;  1GLN A;  2DT7 B;  1AA7 A;  5HLI A;  1FBU A;  2VJI A;  2PJR A;  4MFE A;  3FMQ A;  2BGC A;  2FUG 2;  2ZXW H;  2LTP A;  4PUS A;  5J40 A;  4I09 A;  3S32 A;  4W97 A;  1R23 A;  3FKJ A;  3S3N A;  2BY2 A;  3E1S A;  3RI4 A;  3DPL C;  3GVA A;  3H9G A;  1MIJ A;  1S29 A;  2ID3 A;  3MZY A;  3RZO J;  1YG2 A;  2NXN B;  4Y33 A;  2LH9 A;  5F1J A;  2OZU A;  1VI0 A;  2XV4 S;  2PX9 A;  1IRF A;  3DPT A;  1N77 A;  3MFK A;  1ZAR A;  3MKL A;  2IS1 A;  4RGR A;  3LSR A;  2VQG A;  2FML A;  1XB4 A;  2ZB9 A;  2LRD A;  1J09 A;  2M0M A;  4M6Y A;  2BE5 F;  4B3A A;  3CDH A;  2R7W A;  2ELH A;  1E17 A;  4KFC A;  4BE2 A;  1WJB A;  3K4B A;  5HS8 A;  2FF4 A;  1UCR A;  2ZXJ A;  4HA8 A;  4I02 A;  1BIB A;  1ETO A;  3AG1 H;  1ON2 A;  4RAY A;  4I0B A;  4KA4 A;  1VND A;  2R7X A;  3RPU D;  5J1U A;  1FEX A;  3TW6 A;  2PEX A;  3E3V A;  2CUZ A;  2R5Z A;  2DO7 A;  2I10 A;  1R1T A;  2CFX A;  1IC8 A;  4IHY A;  2X6W A;  2RVC A;  3HIF A;  3PO2 J;  4AD9 A;  4N9I A;  4D9J A;  2I8D A;  4PFO A;  1CGP A;  1Z3Y A;  2RNJ A;  4BYY A;  1GHC A;  4MTD A;  3TDU C;  4BQO A;  1O57 A;  2LLK A;  3AL0 B;  3R60 A;  4IHS A;  3GZ6 A;  4YFX F;  1FBS A;  1DU0 A;  3V8L A;  1VQ7 I;  1MBG A;  2EIL H;  1BR1 A;  1MNE A;  2O5R A;  4OIR F;  1XS9 A;  1B72 A;  3VYT B;  2JJ7 A;  2AXT C;  5ICG A;  4ZDO A;  3ZCO A;  2FBI A;  3ZP5 A;  3FHZ A;  1IN7 A;  1YFH A;  1FOK A;  2F6C A;  4UXN A;  1JXS A;  4MLO A;  3O8G A;  3KLN A;  3LA2 A;  1T98 A;  2EIM H;  2VE9 A;  4KMF A;  2VI6 A;  4JOM A;  4RGU A;  4QLC U;  2FQ4 A;  1WI3 A;  3KP4 A;  4GXO A;  4RAF A;  4Y15 A;  4ZDP A;  5J8F A;  1OCO H;  2CH0 A;  2K40 A;  4RAG A;  4L18 B;  2MH2 A;  3WU0 A;  3E97 A;  2HR3 A;  3I5U A;  2QM3 A;  3MZ8 A;  4M73 A;  3HKZ A;  2BZT A;  4BHB A;  4CCK A;  3U1K A;  4CCM A;  2IGK A;  3CMM A;  3OYC A;  5J1R A;  3BT9 A;  6PAX A;  1K61 A;  2W57 A;  3KE2 A;  2HDD A;  3IWZ A;  1MMS A;  1ZQ3 P;  4HSR A;  3A2K A;  1BOB A;  3O8H A;  2H8W A;  2LP0 A;  4A2U A;  2FMY A;  2YUS A;  2EV0 A;  3ONQ A;  4ENN A;  2VOP A;  2ME6 A;  2ZNZ A;  3RSN A;  4RDU A;  1BR2 A;  2ZKZ A;  3F6V A;  1T6S A;  5J47 A;  4JX4 A;  5GAH J;  5ICE A;  3PFY A;  1TW2 A;  5ILS A;  4G94 A;  2JSP A;  4IEJ A;  4V2G A;  2VE8 A;  3QWL A;  4F3Q A;  5LHG A;  1W7P A;  4XRS A;  2R7Z J;  3F72 A;  1S6L A;  1FJL A;  3QOE A;  4A0Z A;  2HGC A;  4AUX A;  2JWT A;  4UUS A;  3OYM A;  3GTK J;  3F0C A;  4PGG A;  4D5C A;  4A3D J;  2R7T A;  1Y0N A;  3PFI A;  4RMN A;  3A0B C;  1K7A A;  4M9Z A;  4RLF A;  5KCM A;  3BQY A;  1J7K A;  2A5W A;  4GYI A;  3G1L A;  2HU9 A;  2VPR A;  5L3C A;  2WAF A;  4NQW A;  2Z3Y A;  1TQP A;  2X1D A;  1JUM A;  3MEX A;  1M1E B;  2ZNY A;  1SVO A;  1ETV A;  2VQC A;  5HDG A;  3DEW A;  2VT3 A;  4NC7 A;  1ZG5 A;  1GUU A;  2AHQ A;  5FB2 A;  5FKM A;  4ENM A;  4C3I J;  2E60 A;  1WSU A;  5EF6 A;  1YW9 A;  4XRS G;  3QP5 A;  3DQV C;  4II2 A;  2HOT A;  2OUM A;  2WV1 A;  3DLL F;  1D1B A;  1UAA A;  2HQA A;  1YYV A;  3F21 A;  2RN7 A;  4EV0 A;  2BXZ A;  1TZL A;  1XCV A;  4X1E A;  3N97 A;  2H1K A;  1ZKG A;  1YHQ I;  3J7A O;  4E7Z A;  3QPL A;  4LOC A;  2KRC A;  1TWA J;  1MW7 A;  3FXJ A;  4YRV A;  4X0G A;  3OYH A;  3QU3 A;  2HYG D;  2X9D A;  4XOT A;  5FGM A;  1X3Z B;  5DV5 A;  5J3L A;  5GTI C;  2Q8K A;  1U2W A;  3KPH A;  2CFO A;  2YX4 A;  1Y1W J;  5M3M J;  5HDN A;  1S7A A;  1RC9 A;  2DQR A;  2RDP A;  4DBQ A;  3A01 B;  3HB9 A;  2FQ3 A;  3GUD A;  3S2H J;  1KU3 A;  4KT5 C;  3WGH A;  3HRM A;  4FQG A;  1G3S A;  2R7F A;  3MKW B;  4Z2Y A;  2R7R A;  1X3W B;  4B4C A;  2MYS A;  2L7M P;  2QQ8 A;  4HRI A;  4XN3 A;  1BJA A;  1BOA A;  1XMK A;  1YX5 A;  4BQN A;  2CQK A;  3NWS A;  5HLH A;  5EG0 B;  2CUJ A;  3CCQ I;  3MVP A;  1TWG J;  1QPM A;  4Q4Z F;  2L54 A;  1A36 A;  1KQ0 A;  2IA0 A;  1IXR C;  1ZRC A;  2CV1 A;  1REP C;  1P4W A;  3I53 A;  5FKN A;  5BMZ A;  5BOX A;  1TWH J;  1LVK A;  3SFI A;  2GXB A;  3DPU A;  1ZG1 A;  3OR1 C;  5JR3 A;  5F27 A;  3BP8 A;  1HBX G;  2EPF A;  5ICC A;  3D5S C;  2O6G E;  1MKM A;  3RCO A;  2V7F A;  3TP0 A;  1U9N A;  2JK3 A;  4EMS A;  4M3G A;  1W4M A;  3KYL A;  3PJR A;  1IDZ A;  2MA3 A;  1X4O A;  1QU3 A;  5J1Y A;  1O3T A;  5IYC J;  4LG0 B;  2PLY A;  2EB7 A;  2KPM A;  1I6X A;  4PCQ A;  2LY1 A;  1U5T A;  1HA8 A;  1U8B A;  1K83 J;  1RIO H;  1X1D A;  3C1D A;  4HDU A;  2G0E A;  2PJR B;  3PUB A;  2DFH A;  5JVG F;  1Y56 A;  2QCO A;  3ZQI A;  3E6B A;  2K85 A;  3QOP A;  3JTH A;  2DFF A;  5LFA A;  2XAF A;  5DUI A;  5E3M A;  4FIS A;  4BXU A;  2QKL B;  1FSE A;  1SD6 A;  2BBY A;  4FX0 A;  2OA4 A;  3HOU J;  3K2Z A;  4MFD A;  4ZC3 A;  1X1P A;  1MBJ A;  3E6M A;  3W6K B;  2UZK A;  1AWC A;  2XPW A;  2FEZ A;  3CQZ J;  3TW7 A;  4BE0 A;  3K4L A;  3QYB A;  3VFZ A;  1SVM A;  2OCE A;  2V1X A;  4AYB A;  2TRT A;  4DGW B;  4PJJ A;  1V5G A;  5LD2 C;  2PBI A;  5B3S H;  4CHU A;  2NYX A;  1IO2 A;  2ZJ2 A;  4L5I A;  1A04 A;  1GV2 A;  3OIP A;  4BH9 A;  1OYW A;  3GFJ A;  3CF2 A;  4JYK A;  3W2V A;  4EJW A;  3OYB A;  3CCM I;  2IP2 A;  4IQJ A;  3EQL F;  1WJF A;  2CMP A;  5H6R A;  4A3M J;  4HAM A;  5J6X A;  4NC6 A;  4HNU A;  3FK7 A;  3I9V 2;  4HV5 A;  3ZMV A;  1WJC A;  1YIT I;  1IUF A;  3TED A;  2K9N A;  2XRO A;  1ZRE A;  4GGG A;  2XVC A;  1MZB A;  4BJ5 C;  3MMY B;  2O61 A;  2P5K A;  2K4B A;  4JK1 X;  2HEO A;  1P2F A;  1SAN A;  3I4N J;  4J01 A;  2HZT A;  4CUG A;  5DCF A;  2QYO A;  5EJC A;  5FRN A;  1R7J A;  2DMP A;  5FKK A;  4IHX A;  1S3J A;  1WRJ A;  2O8X A;  2R5Y A;  3S1Q J;  2L7F P;  4BS9 A;  4HZF A;  1CF7 A;  3C3W A;  2W24 A;  4AVP A;  1VFC A;  2GLO A;  2R4G A;  4IRG A;  1FYK A;  1JGS A;  3HGY A;  3PQJ A;  1GVJ A;  4B8X A;  4U7B A;  1MJ9 A;  1FZP B;  4L9V A;  2DW4 A;  5C3E J;  4XR6 A;  2CQ7 A;  2BVL A;  4MIM A;  2ECB A;  3CME I;  2M1B A;  3BR2 A;  2B7E A;  2IPQ X;  3K1N A;  3S1N J;  2IS4 A;  3D5R C;  3GEZ A;  3SZP A;  1Z67 A;  2E1O A;  2MGQ A;  5EEA A;  3BG6 A;  3HZJ A;  4Y4R A;  2MC4 A;  4M9X A;  3QPT A;  3GLL A;  3A1Y A;  3MAJ A;  2DPU A;  3KCC A;  1IRG A;  4KUM A;  2P81 A;  4XBF A;  1IF1 A;  2RQP A;  3BR6 A;  1MSF C;  2ISZ A;  4A3C J;  2BEO A;  1NTC A;  2LFB A;  1WKM A;  4BY7 J;  1LFB A;  3LAJ A;  4BJT A;  3M7G A;  4WX9 A;  2K4J A;  5D8L B;  1T33 A;  2QUF A;  3K1P A;  4KIS A;  2DA5 A;  3FIS A;  4RLQ A;  4D5F A;  4UUT A;  3FXU A;  2L2O A;  1HQC A;  1XSV A;  3COA C;  1TNS A;  3FK6 A;  4GO1 A;  3H0D A;  2M5W A;  2HZD A;  3SDB A;  2QSF X;  4WXH A;  3RYP A;  4HX4 A;  4LG3 A;  1SMT A;  2KIM A;  4U87 A;  3T8R A;  1ZRF A;  2D5V A;  2IS2 A;  1B1B A;  2EFW A;  1RES A;  2LC2 A;  4YEJ A;  1P4A A;  2DMT A;  2KFD A;  2RGV A;  1TTY A;  5KAI C;  2GBY A;  1J75 A;  2GA2 A;  2JUG A;  4OOI A;  1B8I B;  1I3A A;  3S8P A;  3P9I A;  1Y39 A;  3OMY A;  2LYC A;  5L3E A;  2DT5 A;  1T38 A;  5FJ8 J;  1F4K A;  2PJP A;  3JRE A;  4L5J A;  4Y7N J;  5F0C A;  1IZ1 A;  1BA5 A;  1SFO J;  2RKH A;  3TOA A;  4JX5 A;  5DEQ A;  2H6C A;  2BXY A;  1A6Q A;  2XUB A;  1NHA A;  5LGT A;  3ZR8 X;  3CD6 I;  1ITY A;  4X6A J;  3CC4 I;  3CJT B;  3GTM J;  2QWW A;  2JT1 A;  5FD5 A;  3FBN B;  1QZY A;  3ASN H;  2A3S A;  3FMR A;  3FXO A;  3WE2 A;  1LFU P;  3AG2 H;  3TKY A;  5D6E A;  3DFG A;  3BWG A;  1FMW A;  3TO9 A;  3HSR A;  3E6C C;  1ENH A;  1P92 A;  2RAE A;  3LSK A;  1I1S A;  4B09 A;  1JTX A;  3DTE A;  2LR8 A;  1TQI A;  1G8X A;  1T95 A;  4YIF A;  1YJ9 I;  3VOE A;  4DYC A;  1WPK A;  4YEL A;  1S9H A;  1U5T C;  3RJP A;  2VBZ A;  4PJN A;  1MSE C;  5C4J J;  2A05 A;  2IGM A;  4A3E J;  2UV1 A;  1K78 B;  3G3Z A;  3BTI A;  1OR7 A;  3R0A A;  4BDZ A;  2JQ7 A;  5D4R A;  4HF2 A;  2LKP A;  4CSW A;  1E3P A;  4ZH4 F;  1UZC A;  1YRN B;  5DYM A;  3HUG A;  2LMD A;  3BTJ A;  1WI9 A;  2WA0 A;  1FPQ A;  3QQA A;  1O7L A;  2MSY A;  3CZ6 A;  4Y3O A;  1VF9 A;  2VIX A;  5F0H A;  2XRL A;  5KVR A;  2EIK H;  3HRS A;  5HNF A;  1JUS A;  3F8F A;  3ZMS A;  1GVD A;  4CZZ A; 
#chains in the Genus database with same CATH homology
 1U8R A;  2P4W A;  3BPX A;  1H0M A;  2KJB A;  4L0Y B;  1XMA A;  3KZY A;  2MH9 A;  1MGT A;  3WTV C;  1FYM A;  5H20 A;  4KIB A;  3KP6 A;  4UV9 A;  3R61 A;  5D6F A;  3TO7 A;  2P5L C;  3WG9 A;  1SMY F;  3M9A A;  2PMU A;  1Z05 A;  3E6D A;  5E20 A;  1G3W A;  1IN4 A;  3KEQ A;  3CTA A;  1HXD A;  1XDS A;  1ZGA A;  3P7N A;  5FFZ A;  3WTU C;  3GFI A;  5E1X A;  3ZMU A;  4IF4 A;  3ISP A;  4AIK A;  3L7W A;  5IT9 K;  3WTX C;  5DD4 A;  1LDJ A;  3NQO A;  1I5Z A;  2MLK A;  2A6H F;  1RUN A;  2F5D A;  1O3S A;  2EFN A;  4UNO A;  3HOS A;  4BQA A;  2MBF A;  3IKT A;  4LB6 B;  1Z6R A;  2PFB A;  3HHG A;  2DPD A;  2H6B A;  5CVR A;  2AS5 F;  2OBP A;  1B4A A;  4A5N A;  5CLS A;  1KYZ A;  2L3D A;  1Z7U A;  3HHH A;  1HKS A;  1J2X A;  2K27 A;  2D2W A;  2JPC A;  2ZFW A;  4P9F A;  5EEG A;  5K5O A;  2Z33 A;  3L9F A;  2XKP A;  1TBX A;  1DP7 P;  2NRA C;  3SFZ A;  1ZH5 A;  1G3T A;  4MEY F;  1FYL A;  3U2R A;  3J80 Z;  1EV7 A;  2P6T A;  3KET A;  2QZ8 A;  2OAZ A;  4IJA A;  1QGP A;  2EJR A;  2HKX A;  3QAH A;  4ZZL A;  3GF2 A;  2P8T A;  3QP6 A;  4P5O A;  1XCB A;  2QQA A;  1HSJ A;  4RB1 A;  3ZQ7 A;  1IXC A;  4YG2 F;  4TV7 A;  3CUQ B;  3KFW X;  5CYV A;  2IVM A;  1BC7 C;  3IKV A;  1LJ9 A;  2STW A;  4EGZ A;  1T39 A;  3GX4 X;  1UHW A;  3CO7 C;  2M45 A;  1FP2 A;  3T5X A;  3OV8 A;  2EWN A;  3WTW C;  2WV0 A;  4KIF A;  5DCM A;  3ZPL A;  3GLX A;  2VBX A;  3EYY A;  3C7J A;  3V4G A;  2G7H A;  2CG4 A;  3F8C A;  4RB2 C;  1YS7 A;  3I58 A;  3F6O A;  1FY7 A;  4HOB A;  3KP2 A;  1QQI A;  1L0O C;  2WWY A;  1MJB A;  5CVI A;  4D0P A;  3GWZ A;  4MTE A;  4I98 B;  5TRD A;  2EFP A;  1ONV A;  1USS A;  2XAG A;  1PP7 U;  3LQR A;  2FBH A;  5LEK A;  3RYR A;  1P4X A;  2EFO A;  4HDV A;  1C0W A;  2FNA A;  4P9U A;  1OMI A;  4L9N A;  4PDK A;  2FE3 A;  1B6A A;  5CVJ A;  4G6D A;  2QEN A;  3L09 A;  4WWC A;  4CYD A;  3IRQ A;  3T8T A;  2V1U A;  3C18 A;  1BM9 A;  1PDN C;  5LRS A;  2BYV E;  1H9T A;  5H6Q A;  2LF8 A;  5JHU A;  3I59 B;  2O0Y A;  5ED4 A;  1W5S A;  1IUY A;  4BAY A;  4LLG F;  1IN5 A;  2GZW A;  3K1M A;  3GW2 A;  4LK0 F;  3KZZ A;  3JSP A;  4UUV A;  3H92 A;  3V8K A;  3BPV A;  3RKY A;  1IXS B;  4R1H A;  1XGM A;  5BPI A;  1U78 A;  4N9H A;  5EEH A;  3BJO A;  2WC2 A;  2A68 F;  4ASN A;  2IA2 A;  2TDX A;  4CIC A;  2GWR A;  1ZLK A;  2YX7 A;  3V7S A;  3FMS A;  3KLO A;  2NAZ A;  2P6S A;  1UST A;  4WF2 A;  2FRH A;  1XD7 A;  1STZ A;  3ABU A;  1F5T A;  1J0R A;  3TQN A;  4ESB A;  2ETH A;  3J80 K;  3KEO A;  3I54 A;  2OQG A;  1MDM A;  2IJL A;  1HW1 A;  4AIH A;  2QBY A;  1HKT A;  4P55 A;  2EFQ A;  3ZMZ A;  4R79 A;  3F8N A;  2FOK A;  4IXA A;  2XRN A;  3GYH X;  4M71 A;  2F5F A;  3G73 A;  4XSX F;  5HOO A;  2DTR A;  2XAQ A;  3RKX A;  4HLY A;  5A2Q Z;  5LBQ A;  3U1D A;  2FNP A;  4ENK A;  2K7L A;  5AIQ A;  2KKO A;  2CO5 A;  1ZRD A;  4BHP A;  2ISY A;  2CSO A;  2J5O A;  2W84 A;  4U0W A;  4ESJ A;  2FA5 A;  1YLF A;  4A0Y A;  4CDG A;  2VC0 A;  4RGS A;  1O3R A;  3ABT A;  4MEX F;  1OPC A;  3MWM A;  2HKO A;  4U0Y A;  3F8B A;  5KK1 A;  2L4A A;  2GA1 A;  1BI3 A;  5FLX K;  1KU7 A;  4Y13 A;  3GZ5 A;  2V79 A;  4KNY A;  3HSE A;  3D0S A;  2Z9O A;  1ON1 A;  1ZGJ A;  1XGS A;  2LDU A;  3FZV A;  4UHT A;  5BPD A;  3H3Z A;  1D3Y A;  1ULY A;  3F23 A;  4P96 A;  4L9J A;  4DNC A;  4OU0 A;  5D5W B;  1FSH A;  2HS5 A;  5BS6 A;  5LEJ A;  1WWX A;  2R3S A;  3W6J B;  4PZJ A;  5D4S A;  5E18 F;  5HS7 A;  1KQ8 A;  1YO5 C;  2AXL A;  4ON0 A;  2Z99 A;  1QBJ A;  1UHM A;  5JVT A;  5DDG A;  2QLZ A;  5DCM B;  2ZME A;  1RZ4 A;  4G7H F;  1ZYR F;  2H27 A;  4UVC A;  2M8E A;  2DAO A;  1RNL A;  5LLQ A;  2D45 A;  4MQV A;  2YSR A;  3REO A;  1JHH A;  4IVN A;  5L3B A;  2DLL A;  5K1Y A;  3VEP A;  2GAU A;  3PQK A;  5FD6 A;  4YFN F;  3ZMD A;  4ETS A;  3IHU A;  3E5U A;  1HKQ A;  2P5V A;  1LVA A;  3CJN A;  2OQR A;  4U7D A;  1YS6 A;  1O3Q A;  4HF0 A;  1W7P D;  1LEA A;  2HOE A;  1YW7 A;  5A2Q K;  5IT9 Z;  1W7P B;  4K2E A;  4HYE A;  2PQ8 A;  5CJ9 A;  1BI2 A;  4BHC A;  4HBL A;  3WU1 B;  1V4R A;  2JRT A;  4O3M A;  4OIP F;  4KN7 X;  4U88 A;  1XN7 A;  3DXJ F;  4OIO F;  2NNN A;  4CGZ A;  4LGW A;  4OMY A;  1BI1 A;  4KYW A;  3TGN A;  3ROU A;  3WGG A;  2MLG A;  4RB0 A;  2A5Y B;  5FO5 A;  5TJJ A;  4KDP A;  1ODD A;  4XRF A;  1R1V A;  2GQQ A;  4S05 A;  1KU2 A;  1SFX A;  2A69 F;  1B9M A;  3CO6 C;  3LFK A;  4HQE A;  4R8H A;  4G6Q A;  3L00 A;  2KJC A;  4GYG A;  2ADU A;  5L3G A;  2NS0 A;  3MQ0 A;  3MZH A;  1LDD A;  2XAJ A;  2EA2 A;  2KRF A;  5K5Q A;  3K9T A;  3HYI A;  3RIR A;  2UXN A;  4EM2 A;  3S2W A;  4ZZD A;  2EK5 A;  4OIQ F;  4O5V A;  3ULQ B;  4HV6 A;  1F9N A;  4UV8 A;  2HFH A;  4F7Z A;  3DKW A;  4ZYE A;  2C6Y A;  1G6N A;  4JQF A;  2V1D A;  1FT9 A;  4KN4 X;  1DUX C;  2H09 A;  1Q1H A;  5E1Z B;  2FU4 A;  2ZO4 A;  2HTJ A;  1Z9C A;  3O6B B;  3IC7 A;  2DQL A;  1U5T B;  1R00 A;  3ECO A;  3SQN A;  3EET A;  2NNY A;  1SD5 A;  5HVQ C;  3LA3 A;  2M30 A;  3F22 A;  4EM0 B;  2DK5 A;  3GFM A;  1SAX A;  2VBY A;  3SHF A;  2W25 A;  3T0Y A;  1OYI A;  5LGN A;  2F5C A;  1J5Y A;  3N4M A;  2P7V B;  4Y17 A;  2HQR A;  3VOD A;  1D8K A;  4A12 A;  1VTN C;  2HTS A;  3HOT A;  1ZG3 A;  2O3F A;  4KMU X;  2PI0 A;  4HF1 A;  5CVU A;  2X4H A;  2VON A;  1DPU A;  1KA8 A;  2O03 A;  4LD5 A;  1G3Y A;  2IW5 A;  1ZAO A;  2OD5 A;  3F8M A;  2JTV A;  2OZ6 A;  4NB5 A;  3D5L A;  1IN6 A;  2ZME B;  4LG0 A;  1IAW A;  5ERI A;  1CF7 B;  4IRI A;  4WXC A;  1FP1 D;  1I27 A;  1OKR A;  1YQA A;  4XLN F;  4FT8 A;  4MQ9 F;  1DDN A;  3HTS B;  4RS8 A;  2XAS A;  2UWM A;  1P6R A;  3CUO A;  2LF7 A;  2VBW A;  4EJV A;  3SZT A;  4PGH A;  3DP7 A;  1J9I A;  4A6D A;  2E1N A;  4FX4 A;  1H9G A;  1YIO A;  5AON A;  1FC3 A;  1SD4 A;  2GXG A;  1XSX A;  3RPQ A;  2CYY A;  4XLP F;  2VOD A;  3RKW A;  3R6S A;  1LEB A;  2HDC A;  1Z1D A;  2KIF A;  4HW0 A;  5ILU A;  4G7O F;  4OIN F;  1GXP A;  3ZN0 A;  3HSF A;  5JFR A;  4EGY A;  2Q2E A;  3NEU A;  3F3X A;  3ZN1 A;  2RV8 A;  5LGU A;  3BY6 A;  1Y0U A;  3U9G A;  1PP8 F;  4HLX A;  2Z5U A;  3AAF A;  2L02 A;  2OU2 A;  4G7Z F;  5ICF A;  5FLX Z;  2L4M A;  3GFL A;  2UXX A;  2VN2 A;  4LJZ F;  4WCG A;  1I1G A;  2VOO A;  1OYY A;  2Y75 A;  5J8C A;  3JAM Z;  3BDD A;  2G7U A;  1MD0 A;  4HX8 A;  3KP5 A;  3FF5 A;  1FX7 A;  2PN6 A;  4Q48 A;  3Q9V A;  2A6E F;  3V7R A;  2L01 A;  3WOD F;  3JW4 A;  2COM A;  4E70 A;  1B9N A;  3B73 A;  3DEU A;  2G9W A;  3J81 Z;  1KYW A;  1QNT A;  3H3U A;  3R0J A;  1T2K A;  3I4P A;  3IL2 A;  2ESH A;  2QQB A;  1UFM A;  3L2C A;  2WTE A;  4M74 A;  1BIA A;  1YTY A;  4RAZ A;  1FWZ A;  1R36 A;  1XDU A;  2HYF A;  2V6C A;  2YR2 A;  4H0E A;  4U0V A;  1V3F A;  3P9C A;  4L9T A;  1RI7 A;  3KP3 A;  3JSO A;  3M1E A;  2JPB A;  5LHI A;  2JZY A;  3QU6 A;  4G9Y A;  3ZMT A;  1KQ9 A;  5E8G A;  1Z91 A;  3LAP A;  1BI0 A;  2XAH A;  2F5E A;  2EV6 A;  5DUK A;  2ZBK A;  3MCZ A;  3M8E A;  1S7O A;  1K78 A;  2FXA A;  2Y0M A;  2M87 A;  2XGX A;  3QPH A;  2GIV A;  4WXD A;  2XIG A;  3LWF A;  4LLL A;  3RTR A;  4MHG A;  1YW8 A;  4RGX A;  2IRF G;  3JTG A;  3IWF A;  4O6J A;  2P7C B;  2J5P A;  1TQM A;  3R4K A;  1U6G A;  5D5X B;  3WE3 A;  4LLN A;  3CLO A;  1LQ1 A;  3T1B A;  1SFE A;  4IRH A;  1QZZ A;  1L3L A;  1MJA A;  5IT3 A;  3FXR A;  2Q0O A;  2QQ9 A;  3JAM K;  2H94 A;  4ESF A;  2LSO A;  3DF8 A;  1RUO A;  2FBK A;  2A61 A;  3Q5F A;  2B0L A;  1R22 A;  3BOQ A;  2E7W A;  1FNN A;  3EDP A;  3I0T A;  2IA1 A;  3GXO A;  1HW2 A;  1J59 A;  3O3K A;  3J81 K;  3RDI A;  4KIG A;  3TDZ C;  3WTZ A;  3V8J A;  2XHK A;  3V7C A;  2VXZ A;  4ZYD A;  3WTS C;  1UB9 A;  3BRO A;  4N0B A;  1IN8 A;  4FHT A;  5BQT A;  2CWE A;  2E1C A;  3WGI A;  5F64 A;  4RB3 C;  4ZYG A;  1SFU A;  3GO5 A;  4IHT A;  4AWX B;  4EJU A;  4HX7 A;  5E1W A;  2XKO A;  3IRR A;  1JHF A;  3EUH A;  1TNT A;  1W5T A;  2YU3 A;  4A0X A;  2CW0 F;  1K79 A;  4CO8 A;  2QVO A;  1AOY A;  1XGN A;  1ZHF A;  1BC8 C;  1HW5 A;  5CVV A;  4KIC A;  4UVA A;  5LHH A;  1O7F A;  1SD7 A;  1LDK B;  3EYI A;  3O2P E;  5DD8 A;  3RPU A;  3HTU A;  5D5V B;  3CUQ A;  1JE8 A;  1G4D A;  2DFI A;  2FSW A;  2K86 A;  2HQN A;  3TOB A;  1XSD A;  3VB2 A;  2STT A;  5K5R A;  4M9S A;  5F1R A;  2PG4 A;  3OOP A;  5HLG A;  3P9K A;  5F6F A;  2PMH A;  1F1Z A;  5FFX A;  3LA7 A;  2R7D A;  2YPR A;  4JBA A;  2W85 A;  4LFU A;  1TW3 A;  4G8X A;  2IT0 A;  1T0F A;  4QWQ A;  1KGS A;  3DV8 A;  2DK8 A;  4OMZ A;  4UVB A;  4MNU A;  1EH8 A;  3Q9S A;  2VC1 A;  3NRV A;  4ENJ A;  3ERE D;  1D8J A;  4DQ2 A;  5E17 F;  4EQQ A;  3K69 A;  2HWV A;  1FLI A;  1MDM B;  4EJT A;  4AIJ A;  3LQQ A;  1IW7 F;  1Z6T A;  2K02 A;  3BZ6 A;  3TO6 A;  5D5U B;  3ELK A;  2QBY B;  1GXQ A;  1R1U A;  2Y48 A;  5HS9 A;  4I7H A;  4A5M A;  2KIU A;  1U3E M;  1D5V A;  1TLH B;  3FM5 A;  4Q5S F;  1ZN2 A;  5AIP A;  4YFK F;  3I59 A;  3FX3 A;  4IPA A;  2V9V A;  1LB2 A;  3SXY A;  4HQM A;  4YII A;  3KP7 A;  4NHJ A;  1E2X A;  3WTY C;  4XSZ F;  5HDK A;  2MD5 A;  3FXQ A;  1R58 A;  1B59 A;  3FWE A;  2RC4 A;  3K0L A;  3ML6 A;  1EH7 A;  4ZYH A;  5JI6 A;  1R5H A;  2D1V A;  2DI3 A;  4WK8 F;  1WQ2 A;  4S04 A;  4M72 A;  2DU9 A;  1KU9 A;  3QRF F;  4MGR A;  4M6X A;  4BNC A;  5D8K B;  3E5Q A;  3BJ6 A;  4LB5 A;  2X0L A;  5L3D A;  2D1H A;  1S8N A;  2MC3 A;  1DPR A;  1BN5 A;  1PUE E;  2EV5 A;  4GCV A;  3E5X A;  4I0A A;  5ILV A;  4EVI A;  3BJA A;  4CXF A;  1ZLJ A;  2JSC A;  1LNW A;  2F2E A;  2BV6 A;  3HRU A;  1HST A;  1EH6 A;  3FM3 A;  3WTT C;  2ESN A;  2ZCW A;  5LRR A;  4LMY A;  1XGO A;  2ACJ A;  2A07 F;  1FBQ A;  4A6E A;  3I71 A;  4LK1 F;  1R5G A;  5E8I A;  3HRT A;  3ECH A;  2EA4 A;  4EJO A;  4I2O A;  1X3U A;  2DBB A;  3M8F A;  4Q47 A;  3I64 A;  1QO0 D;  3B02 A;  2E7X A;  5L3F A;  4L0Z B;  1BBY A;  2LNB A;  3CUQ C;  4I01 A;  2VT2 A;  1K6O A;  2CGP A;  4EM1 A;  3LST A;  5HLI A;  1FBU A;  3FMQ A;  2BGC A;  4I09 A;  1R23 A;  3RI4 A;  3DPL C;  3GVA A;  1S29 A;  3MZY A;  1YG2 A;  2OZU A;  2XV4 S;  1IRF A;  3DPT A;  3MFK A;  1ZAR A;  4RGR A;  2FML A;  1XB4 A;  4M6Y A;  2BE5 F;  3CDH A;  2ELH A;  1E17 A;  4KFC A;  5HS8 A;  2FF4 A;  1UCR A;  2ZXJ A;  4HA8 A;  4I02 A;  1BIB A;  1ON2 A;  4RAY A;  4I0B A;  4KA4 A;  2PEX A;  3E3V A;  2DO7 A;  1R1T A;  2CFX A;  2RVC A;  3HIF A;  4AD9 A;  4N9I A;  1CGP A;  4BYY A;  2RNJ A;  1GHC A;  4MTD A;  3TDU C;  1O57 A;  3R60 A;  4IHS A;  3GZ6 A;  4YFX F;  1FBS A;  3V8L A;  4OIR F;  5ICG A;  2FBI A;  3ZP5 A;  3FHZ A;  1IN7 A;  1YFH A;  1FOK A;  4UXN A;  1JXS A;  3KLN A;  3LA2 A;  1T98 A;  2VE9 A;  4KMF A;  4RGU A;  4QLC U;  3KP4 A;  4GXO A;  4Y15 A;  5J8F A;  4L18 B;  2MH2 A;  3WU0 A;  3E97 A;  2HR3 A;  3I5U A;  2QM3 A;  4M73 A;  4BHB A;  6PAX A;  2W57 A;  3KE2 A;  3IWZ A;  4A2U A;  2FMY A;  2EV0 A;  4ENN A;  2VOP A;  2ZNZ A;  2ZKZ A;  3F6V A;  1T6S A;  5ICE A;  1TW2 A;  5ILS A;  4G94 A;  5LHG A;  2VE8 A;  1W7P A;  3F72 A;  1S6L A;  4A0Z A;  2HGC A;  4PGG A;  3PFI A;  1K7A A;  4M9Z A;  1J7K A;  4GYI A;  5L3C A;  4NQW A;  2Z3Y A;  1TQP A;  3MEX A;  2ZNY A;  5HDG A;  2VT3 A;  1ZG5 A;  5FB2 A;  4ENM A;  1WSU A;  1YW9 A;  3QP5 A;  3DQV C;  1YYV A;  3F21 A;  2RN7 A;  4EV0 A;  1XCV A;  3N97 A;  3J7A O;  3QU3 A;  2HYG D;  5FGM A;  5DV5 A;  2Q8K A;  1U2W A;  2YX4 A;  5HDN A;  1S7A A;  2DQR A;  2RDP A;  2FQ3 A;  3GUD A;  1KU3 A;  4KT5 C;  3WGH A;  3HRM A;  1G3S A;  2R7F A;  4Z2Y A;  1BJA A;  1BOA A;  1XMK A;  2CQK A;  5HLH A;  1QPM A;  4Q4Z F;  2L54 A;  1KQ0 A;  2IA0 A;  1IXR C;  1ZRC A;  1REP C;  1P4W A;  3I53 A;  5BMZ A;  5BOX A;  2GXB A;  1ZG1 A;  5JR3 A;  3BP8 A;  1HBX G;  5ICC A;  2O6G E;  1MKM A;  4EMS A;  1W4M A;  2MA3 A;  1O3T A;  4LG0 B;  2PLY A;  2EB7 A;  1I6X A;  4PCQ A;  1U5T A;  1RIO H;  3C1D A;  4HDU A;  3E6B A;  3QOP A;  3JTH A;  2XAF A;  5DUI A;  4BXU A;  1FSE A;  1SD6 A;  2BBY A;  4FX0 A;  2OA4 A;  3K2Z A;  3E6M A;  3W6K B;  2UZK A;  1AWC A;  2FEZ A;  3VFZ A;  2V1X A;  2PBI A;  4CHU A;  2NYX A;  2ZJ2 A;  4L5I A;  1A04 A;  4BH9 A;  1OYW A;  3GFJ A;  4EJW A;  2IP2 A;  3EQL F;  5H6R A;  4HAM A;  5J6X A;  4HV5 A;  3ZMV A;  2XRO A;  1ZRE A;  4GGG A;  2XVC A;  1MZB A;  2O61 A;  2P5K A;  2K4B A;  4JK1 X;  2HEO A;  1P2F A;  2HZT A;  5DCF A;  2QYO A;  1R7J A;  1S3J A;  1WRJ A;  2O8X A;  4HZF A;  1CF7 A;  3C3W A;  2W24 A;  4AVP A;  4IRG A;  1FYK A;  1JGS A;  3PQJ A;  4B8X A;  1GVJ A;  4U7B A;  1MJ9 A;  1FZP B;  4L9V A;  2DW4 A;  2M1B A;  3K1N A;  2IPQ X;  3GEZ A;  3SZP A;  4M9X A;  3QPT A;  3MAJ A;  2DPU A;  3KCC A;  1IRG A;  4KUM A;  4XBF A;  1IF1 A;  2RQP A;  2ISZ A;  2BEO A;  1WKM A;  3LAJ A;  3M7G A;  4WX9 A;  2K4J A;  5D8L B;  2QUF A;  3K1P A;  3FXU A;  1HQC A;  1XSV A;  3COA C;  1TNS A;  4GO1 A;  2M5W A;  3RYP A;  4WXH A;  4HX4 A;  1SMT A;  2KIM A;  3T8R A;  1ZRF A;  1B1B A;  2EFW A;  1P4A A;  2RGV A;  1TTY A;  1J75 A;  2GA2 A;  4OOI A;  3P9I A;  5L3E A;  2DT5 A;  1T38 A;  1F4K A;  2PJP A;  4L5J A;  1IZ1 A;  2RKH A;  3TOA A;  5DEQ A;  2H6C A;  2XUB A;  1NHA A;  5LGT A;  2QWW A;  2JT1 A;  5FD5 A;  1QZY A;  2A3S A;  3FMR A;  3WE2 A;  3TKY A;  5D6E A;  3BWG A;  3DFG A;  3TO9 A;  3HSR A;  3E6C C;  1P92 A;  1I1S A;  4B09 A;  1TQI A;  4YIF A;  3VOE A;  1U5T C;  3RJP A;  2VBZ A;  1K78 B;  3G3Z A;  1OR7 A;  3R0A A;  5D4R A;  4HF2 A;  2LKP A;  4ZH4 F;  5DYM A;  3HUG A;  1WI9 A;  1FPQ A;  1O7L A;  5KVR A;  3HRS A;  3F8F A;  3ZMS A;  4CZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...