1JGSA

Multiple antibiotic resistance repressor, marr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
publication title The crystal structure of MarR, a regulator of multiple antibiotic resistance, at 2.3 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jgsA00
2W85A 1MKMA 2RVCA 5HVQC 2PG4A 1V3FA 3I58A 2PMHA 2OD5A 3BJ6A 4UV9A 4RB3C 3ABUA 2A3SA 4ZZDA 3FZVA 4MEYF 3I71A 3HSFA 4L9NA 2F5EA 2V1DA 1U5TC 1XMAA 2Y0MA 2A61A 2FU4A 4WX9A 1FBUA 1DPUA 5DV5A 2VBZA 1UFMA 2LKPA 4G6QA 2W57A 5LGTA 1R5GA 3Q9VA 1ULYA 3E6MA 4WXHA 1FYMA 1B9NA 5L3EA 4GYIA 1D8KA 2HWVA 4S04A 1FZPB 4I01A 3WGHA 4RGSA 2IA1A 1FT9A 1F9NA 3BROA 5BMZA 3ZN1A 3DFGA 1MD0A 1OR7A 3ML6A 4DQ2A 4A0ZA 1TTYA 3IL2A 4Q47A 1O57A 1NHAA 1WKMA 3WU1B 1G4DA 4HLYA 5L3DA 5DD4A 4HLXA 1TNSA 5H6RA 3F8BA 1XSXA 4OIQF 2H6BA 3HHGA 3KP6A 3ELKA 3I4PA 4GYGA 5JFRA 4EJOA 1OYIA 5L3GA 2ZNZA 3L7WA 2O3FA 3HRMA 2EJRA 2E1CA 1LDJA 1JE8A 2LF8A 4CDGA 3KP4A 4BHPA 1IXRC 5D5XB 4ZYEA 4CGZA 1J7KA 1USTA 2RQPA 3ISPA 5ICEA 4KMFA 4IXAA 1XGNA 3L00A 3ZQ7A 5DUKA 3RKWA 1C0WA 4OMZA 4XBFA 3W6JB 2FXAA 1R5HA 3KE2A 2VE8A 2CWEA 4P9UA 2DT5A 1YW8A 3MEXA 1I5ZA 3FXRA 3SHFA 4XSXF 3F22A 4CXFA 2D45A 2NRAC 3E5XA 5CLSA 1ON2A 1HBXG 2KJCA 2IA2A 2XAQA 3IRQA 2GZWA 2GWRA 3ZMTA 3CUQB 2A69F 2CSOA 1RNLA 4HX7A 1L0OC 2VXZA 2X4HA 3BDDA 4I02A 3EYYA 1AOYA 2E1NA 3WGGA 1HW5A 1E2XA 4LG0A 4WXDA 3GZ6A 3P9IA 1HW1A 3V7CA 3R0JA 4OOIA 3FMSA 1KA8A 2R3SA 1Z05A 4WXCA 5DDGA 3FF5A 4A2UA 2BE5F 3EETA 5AIPA 2QYOA 2P6SA 2FEZA 3MZYA 1YO5C 1S8NA 2RV8A 1K79A 1BC7C 4LGWA 1DDNA 3R60A 1R36A 3GUDA 2JSCA 3QU3A 2K4JA 1XMKA 4JBAA 3GX4X 1O7FA 5LLQA 1XGSA 3WTWC 3SQNA 1U3EM 3BPVA 3DPLC 2FBIA 1BIBA 1S6LA 4RS8A 3PFIA 3DPTA 2W84A 4IVNA 1SD5A 4UV8A 2CQKA 5D8LB 3RYPA 3QRFF 5LEKA 3HRUA 1XB4A 1EV7A 2K02A 3ZMUA 3GVAA 4AIJA 1STZA 4G7HF 1PUEE 2CO5A 5KVRA 4Q48A 2VODA 1G3WA 2QWWA 3R61A 4OU0A 1YTYA 5FO5A 3K1MA 4AVPA 5ILVA 4A5MA 2G9WA 1R00A 2JT1A 1YIOA 2EFPA 3WGIA 1IXCA 2VOOA 2HOEA 4UVCA 3T0YA 5ED4A 2KIMA 2Q2EA 3ZN0A 6PAXA 4ASNA 1Z6RA 5HDNA 1J0RA 2COMA 5HDGA 2IT0A 1SD7A 3TO7A 3ROUA 1J9IA 1FSEA 1SD4A 2BEOA 5D6EA 4HQEA 3I59A 4HF0A 4M71A 3JW4A 1LB2A 2XAJA 4BQAA 1HSTA 1O3SA 2VBXA 1UHWA 3K9TA 2P5VA 1E17A 3U9GA 2F5CA 1HKSA 4A5NA 4IRIA 3F3XA 2V1UA 2GA1A 4A6DA 4FT8A 1DPRA 5ICCA 4KT5C 5DCMB 4BH9A 4PGGA 2X0LA 1H0MA 3M9AA 3J81K 4LLNA 1RUNA 2QENA 3TO9A 3WU0A 2XVCA 1Y0UA 1BBYA 3CLOA 1BJAA 4B8XA 1OYWA 1F1ZA 1B9MA 3P9CA 1I1SA 3WTUC 4IRGA 4GO1A 3VB2A 4P96A 3RDIA 4HA8A 3H3ZA 2PN6A 2XHKA 4U0WA 1FPQA 3GXOA 1T98A 4Q4ZF 5FLXK 4KN7X 4HBLA 4M6XA 4EJWA 2XKPA 2JZYA 2FMYA 2FQ3A 4HX4A 2QZ8A 2C6YA 1JHFA 3GF2A 3E97A 3HSRA 2BGCA 2DO7A 4Y17A 5CVVA 5LRSA 2Y48A 2MH9A 2L3DA 3MFKA 1H9GA 2FF4A 4MNUA 1ZGJA 2LF7A 1U5TB 2BV6A 1H9TA 2RDPA 5AIQA 3KETA 1FP1D 5HS9A 1TLHB 5K5OA 3TO6A 3ZMVA 4MQVA 3TQNA 2D2WA 2HKOA 4ETSA 1SMTA 3CDHA 3BJAA 3BJOA 3C1DA 5K5RA 2VC0A 5AONA 3LFKA 2XAGA 4KIGA 3KZYA 4G8XA 4KIBA 3D5LA 3NQOA 3VODA 4RGUA 2NAZA 3V8LA 1YFHA 3KEQA 1RUOA 3GLXA 4NQWA 5D5VB 1B4AA 3EYIA 3IC7A 1KYWA 2PI0A 1ZRCA 2ADUA 4HF1A 2CGPA 1ZYRF 3HUGA 3CO6C 4ESJA 2HDCA 1KQ8A 4Q5SF 4AIHA 3LQQA 5CYVA 2F2EA 3IWFA 2EV0A 2A68F 2JPCA 4KDPA 1YS7A 3HIFA 1ON1A 1IN5A 3KZZA 3RJPA 3J7AO 3JAMK 1Q1HA 4UHTA 2A5YB 2M87A 5LGNA 1TW2A 1JHHA 1SD6A 4MTEA 2F5DA 1J5YA 1ZRFA 4PDKA 4IHSA 1RZ4A 3GO5A 1BM9A 1W7PD 3E6DA 3WG9A 3WTYC 1HQCA 4M73A 1FSHA 1P4XA 2OBPA 5H20A 1ZN2A 5BQTA 4U0YA 5EEGA 5H6QA 2P7CB 3U1DA 3MZHA 1IF1A 5JHUA 1B1BA 3VOEA 1OYYA 3SXYA 1KQ9A 2IW5A 3H92A 5LRRA 4MGRA 4OIPF 3REOA 5D8KB 4A12A 2QBYA 1U78A 1GHCA 4L5JA 1YW7A 3KP2A 4KYWA 2YR2A 1D3YA 3F8MA 3OV8A 3RPQA 1BIAA 3ABTA 1FNNA 3T8RA 4U88A 2WTEA 1I6XA 4BAYA 3CO7C 1USSA 1HW2A 3WTSC 3KFWX 3WE2A 5LEJA 1SFXA 2E7WA 2V6CA 3K1NA 1XGOA 4BYYA 1G3YA 2XIGA 1XDUA 3GEZA 3KCCA 1YG2A 4QWQA 1CF7B 2VN2A 4NHJA 2VBWA 4UXNA 1OKRA 4ZH4F 1O7LA 4DNCA 5ILUA 1R23A 3J80Z 2H6CA 3V7SA 1MDMA 3DEUA 4ESBA 2IPQX 4TV7A 5IT9K 3R6SA 1LNWA 4LK0F 5HS7A 3COAC 2DK5A 3HOTA 1UHMA 1R22A 4RGXA 2P4WA 3LAPA 1XCVA 1QGPA 3SZPA 2ZXJA 1FBSA 1L3LA 1W5TA 2LDUA 5HLIA 1BI0A 5ERIA 1T39A 1DP7P 2Z5UA 1QBJA 4AD9A 3E6CC 4EJUA 5FGMA 3ZMZA 3BWGA 3LWFA 4A6EA 3O2PE 3I54A 5E1WA 4N9IA 3MCZA 5J8CA 2JPBA 2ZMEA 1W7PB 2J5OA 1QPMA 4OMYA 1T38A 5J6XA 1JGSA 2GAUA 2MD5A 2STWA 4NB5A 4RB2C 2PQ8A 2ZCWA 1ZRDA 3GFIA 2RC4A 1QNTA 3TDUC 1Z1DA 2O03A 4IJAA 4KICA 3RIRA 4L18B 2VE9A 2O6GE 4WF2A 1J75A 2B0LA 2P7VB 2KJBA 4HAMA 4KN4X 4GXOA 4M9SA 3WTVC 4N0BA 3I64A 3TOBA 5E17F 1K78B 3AAFA 4Y15A 3K0LA 4M9XA 3FX3A 4RGRA 5KK1A 3V8KA 4LB6B 1G3TA 4UVAA 3JTGA 4KNYA 4G94A 5F6FA 5K5QA 1F5TA 4HF2A 2EK5A 4HV6A 1KU7A 3BZ6A 2FMLA 2E7XA 4L9TA 1EH6A 4HDVA 4S05A 3KP7A 5CJ9A 3CJNA 5F1RA 3DV8A 2AS5F 1OMIA 1XD7A 1OPCA 2XKOA 4EM1A 5HDKA 2KKOA 2EA2A 3GFJA 2YPRA 2DPDA 4UNOA 3GFMA 3QP5A 3I53A 3B73A 3KP3A 3J80K 5ICFA 4HDUA 4KFCA 1FC3A 4KIFA 1WQ2A 2Y75A 1J2XA 4EMSA 1LDDA 4ON0A 2PFBA 3WE3A 4I98B 2CW0F 4P5OA 3KLOA 2CG4A 1QQIA 2WC2A 3P9KA 2HQRA 4EVIA 1TQPA 3QP6A 3QPHA 5BS6A 2XROA 1BI2A 4RAYA 2D1HA 2DU9A 3F6OA 4AIKA 5CVUA 2EFOA 4PGHA 5F64A 3MWMA 2ESNA 4GCVA 4ENKA 1JXSA 2YU3A 1EH7A 4LK1F 2UXNA 3E5QA 2CFXA 3C3WA 2DLLA 5CVIA 4Z2YA 1Z91A 1W4MA 2MC3A 4LJZF 2V79A 1R7JA 5BPDA 2GXGA 5DEQA 4L9VA 2GQQA 1BI3A 1P92A 4L5IA 4KMUX 4HQMA 2VC1A 3K69A 4OIOF 1Z6TA 2YX7A 4ZYDA 1PDNC 4HZFA 2L4AA 2MLKA 4K2EA 2VONA 4CICA 4IPAA 2PJPA 4FX0A 4M9ZA 3SFZA 4A0YA 4E70A 3SZTA 2ZBKA 2PBIA 3FM3A 2OU2A 1QZZA 1MDMB 1SAXA 3EUHA 3F21A 2DFIA 5E8IA 1ZGAA 4LFUA 3GWZA 2G7UA 3CTAA 5E20A 4BHCA 1XDSA 4YFXF 3HHHA 2M1BA 4MHGA 4PZJA 2QQAA 3LA3A 4EM2A 3HOSA 2NNNA 4OIRF 3LA7A 2ACJA 2FBHA 2MH2A 3QAHA 2STTA 2UWMA 3F8FA 1Z9CA 2BYVE 3IKTA 1CGPA 5E1ZB 4RB1A 1WSUA 4JK1X 3CUQA 2HTJA 4YG2F 5LGUA 2DBBA 2ELHA 4P9FA 1IN6A 1GXQA 2KIUA 1LEBA 3V8JA 1KU2A 2OZUA 3H3UA 3KEOA 1D5VA 3KP5A 3FWEA 1O3TA 4P55A 1W5SA 4LG0B 1B59A 4H0EA 1IZ1A 2F5FA 3W6KB 4G6DA 1IN8A 5JR3A 3R0AA 2HTSA 3FXQA 3QPTA 3F6VA 1IRGA 2XUBA 4Y13A 2DQLA 5K1YA 3NRVA 1HKQA 3E5UA 1TW3A 1ZAOA 1U6GA 2M30A 1DUXC 2FOKA 1XN7A 4LB5A 1FOKA 3TGNA 1KQ0A 1KU3A 3LA2A 3N4MA 2EA4A 4UUVA 3F23A 4IHTA 3L09A 2ZNYA 2OZ6A 1MJAA 3TKYA 1P2FA 2K27A 3I0TA 1LDKB 2YSRA 3V4GA 1P6RA 1YW9A 2DK8A 1MJ9A 3HTUA 4R79A 2P6TA 3MAJA 3GZ5A 3C18A 3DKWA 2L54A 4L0ZB 2P5KA 4O6JA 1BC8C 2DPUA 5LHIA 2LSOA 2M8EA 2FRHA 2EFNA 1IN4A 1FYLA 1D8JA 3Q5FA 3DQVC 4HW0A 5CVRA 4L9JA 4B09A 4O3MA 1O3QA 1ZREA 4LLGF 1TNTA 1RIOH 2FNPA 2HEOA 2VBYA 2PEXA 2KRFA 3E6BA 3C7JA 1K7AA 1UB9A 1KU9A 3BP8A 1XGMA 1KYZA 3K1PA 2GA2A 5D5WB 4M72A 2RGVA 2V1XA 1IRFA 3I59B 3DXJF 2EV6A 4ENJA 3R4KA 4WWCA 1PP7U 4IRHA 1TQIA 1ODDA 3RKXA 4EGYA 2EV5A 1BN5A 4EV0A 3DP7A 4ZYHA 5A2QZ 1SFUA 3T8TA 5E8GA 4IF4A 4ZYGA 5ICGA 5DCMA 2RN7A 4HOBA 2IVMA 2JRTA 2EFQA 4L0YB 1HKTA 1REPC 2M45A 1U2WA 4A0XA 2RNJA 2HKXA 1FWZA 5D4RA 3RTRA 1T2KA 2Z99A 1GXPA 3M1EA 3U2RA 4LLLA 1YQAA 4EGZA 1B6AA 4HX8A 2IJLA 2K86A 4WCGA 5E1XA 1MJBA 5FFXA 2OA4A 3IKVA 4D0PA 2NNYA 2HYFA 1YYVA 4FHTA 4I09A 2Z3YA 4ENMA 3IWZA 1KGSA 2GIVA 2ISYA 1IXSB 2K7LA 2EFWA 3HSEA 2V9VA 3HRSA 1WRJA 4KA4A 4EJTA 5FD5A 4CYDA 2YX4A 1WWXA 2TDXA 4I0BA 1S29A 2LNBA 1EH8A 2AXLA 3F8CA 3KLNA 2Z33A 3RPUA 2D1VA 4QLCU 4EM0B 2ISZA 2L4MA 4BXUA 4BHBA 4RB0A 2FE3A 1U5TA 1T0FA 4AWXB 3JTHA 3BOQA 1K6OA 5CVJA 2FBKA 1LQ1A 2HZTA 1I27A 4CZZA 3T1BA 1VTNC 1F4KA 4MQ9F 4R8HA 1I1GA 2FA5A 3ECHA 2H27A 2W25A 1T6SA 4FX4A 3FXUA 3J81Z 1FLIA 4F7ZA 1QZYA 3ZPLA 2QLZA 4XLNF 1X3UA 2XASA 1FP2A 3ERED 5JVTA 4U7BA 3FMRA 2ZJ2A 4G7OF 2WV0A 3Q9SA 5HOOA 1ZG3A 4MTDA 3DF8A 3M7GA 4YIFA 2DAOA 1BOAA 2HYGD 5IT3A 2MA3A 3G3ZA 4ESFA 3N97A 4RAZA 5D4SA 2QVOA 3BPXA 3IRRA 3FHZA 4I7HA 1GVJA 2J5PA 2WWYA 1TQMA 2QQBA 4G9YA 5L3FA 2IRFG 5FLXZ 1MGTA 3P7NA 4XSZF 5DCFA 2P5LC 3WODF 4PCQA 3OOPA 1IAWA 3FM5A 2XRNA 2CYYA 5A2QK 3NEUA 4U7DA 1PP8F 5DUIA 2NS0A 2FSWA 1RI7A 3FMQA 4M74A 1XSDA 4CO8A 2DI3A 4HV5A 3F72A 4YIIA 3GW2A 2A6HF 5D5UB 2ZFWA 2FNAA 4N9HA 3E3VA 2O0YA 2A6EF 2VT3A 1AWCA 1ZG1A 3HTSB 3I5UA 2DQRA 2VOPA 2G7HA 3O6BB 2P8TA 5BPIA 2EB7A 3F8NA 1FX7A 2EWNA 5DD8A 4R1HA 4WK8F 1P4WA 5DYMA 3TOAA 2JTVA 2QUFA 3TDZC 3RKYA 2A07F 4BNCA 2ZKZA 1S7OA 2GXBA 3CUQC 5LBQA 3M8EA 5TJJA 3S2WA 2UXXA 1TBXA 3ULQB 1IW7F 1ZG5A 3PQKA 2PLYA 2ETHA 2OQRA 4XRFA 2QBYB 3ZMDA 4U0VA 4KUMA 2NYXA 5L3CA 4EQQA 2L02A 3D0SA 4OINF 5E18F 3BY6A 4JQFA 5ILSA 3WTXC 1SMYF 2HGCA 2Z9OA 4I2OA 2KIFA 2Q0OA 2XAHA 5BOXA 3HRTA 1XSVA 3JAMZ 2R7DA 2IA0A 1V4RA 1HXDA 3V7RA 1IUYA 3JSOA 4I0AA 2PMUA 2Q8KA 1CF7A 3QOPA 3PQJA 2QM3A 4LMYA 3MQ0A 5LHHA 1G3SA 4MEXF 5FD6A 1G6NA 3GFLA 3IHUA 2W24A 3VFZA 5J8FA 3LAJA 1R1VA 1R1TA 1O3RA 4YFKF 1J59A 2O61A 3CUOA 4GGGA 3L2CA 2VT2A 4ZZLA 1YS6A 3ECOA 3ZP5A 2K4BA 1ONVA 3RYRA 2M5WA 2HQNA 5HS8A 1WI9A 4LD5A 2IP2A 3M8FA 4EJVA 2QQ9A 2OQGA 1R58A 5HLGA 3EDPA 1UCRA 1R1UA 3L9FA 1P4AA 3GYHX 2L01A 2XGXA 5HLHA 2ZO4A 2HR3A 1LJ9A 1LEAA 2DW4A 5EEHA 1YLFA 1ZHFA 4HYEA 2HFHA 1W7PA 2RKHA 3WTZA 1ZH5A 1ZLKA 3K2ZA 2BBYA 2ZMEB 1S3JA 2O8XA 2MLGA 2DTRA 1FY7A 3WTTC 2R7FA 1XCBA 4CHUA 4M6YA 3LSTA 1U8RA 1QO0D 2HS5A 3VEPA 1A04A 4XLPF 5L3BA 2MBFA 4ENNA 2XV4S 5TRDA 3O3KA 2H94A 5LHGA 5FB2A 3G73A 1SFEA 2UZKA 1BI1A 2H09A 5FFZA 1MZBA 1FYKA 4G7ZF 5D6FA 3B02A 5IT9Z 1HSJA 2XAFA 3T5XA 5JI6A 2OAZA 1LVAA 3HYIA 4UVBA 1FBQA 1S7AA 1Z7UA 4O5VA 3RI4A 1K78A 3QU6A 4YFNF 1ZLJA 3JSPA 1IN7A 2ESHA 3LQRA 1ZARA 3ZMSA 3EQLF
chains in the Genus database with same CATH superfamily
2QA4I 4OAZA 2W85A 3CMEI 1MKMA 2KDZA 2ECCA 3L2RA 2RVCA 1U9NA 5J4VA 3PO2J 5HVQC 2PG4A 1OQYA 1WPKA 1BL0A 2IAIA 2K3FA 1V3FA 3I58A 2PMHA 3DBLB 2OD5A 3BJ6A 4UV9A 4RB3C 2EINH 4ZTFA 3QOEA 2KL4A 1N25A 3ABUA 2A3SA 5IYBJ 4CH7A 4ZZDA 3FZVA 5BNGA 3CC2I 1YHQI 4MEYF 1T33A 3OS1A 3I71A 3HSFA 4L9NA 1N77A 2F5EA 1U0JA 2H8RA 2L7KA 2V1DA 4XRSA 1U5TC 2CRGA 2KZGA 4D1QA 1XMAA 2Y0MA 2ZXWH 1FOXA 2A61A 3K4NA 1PVEA 2FU4A 2V9PA 5HODA 4JYKA 5B66C 4ANJA 3GTOJ 4XK4A 4WX9A 3OYAA 1FBUA 2DXIA 1DPUA 5DV5A 2VBZA 1UFMA 3OL3A 1GDTA 1QPIA 3JRBA 2LKPA 1OCPA 4G6QA 2W57A 4V2FA 4LOCA 5GTHC 1RESA 3CZ6A 3S15J 3PFYA 5LGTA 4C2UA 1R5GA 3Q9VA 3ONQA 4XIDA 1ULYA 3E6MA 2GM4A 4WXHA 1FYMA 1B9NA 5L3EA 4PJ0C 4F93B 4GYIA 1D8KA 4D5CA 2NS7A 2HWVA 3S93A 4S04A 2KMUA 1FZPB 1DQUA 4I01A 4ZDLA 2R7UA 3DPUA 3WGHA 1BR4A 4RGSA 2IA1A 1RKWA 1FT9A 1X4PA 5F0HA 3OIPA 3BROA 1F9NA 1VQ7I 5BMZA 1ACIA 2AHQA 3ZN1A 2QGUA 5EJCA 3K70C 3DFGA 1MD0A 1OR7A 1SFOJ 2BOLA 4E7IA 3ML6A 3GZNB 4DQ2A 4A0ZA 5H2FC 2JA2A 1R71A 1Z0XA 1TTYA 3IL2A 4Q47A 1O57A 1NHAA 1WKMA 3CJTB 3WU1B 2XGCA 2AQFA 1G4DA 4HLYA 4ZC3A 2ID6A 1Z77A 3PSIA 5L3DA 2LREA 2Y2ZA 3W2VA 3WU2C 5DD4A 4HLXA 1K4TA 1TNSA 4XRSG 4QSHA 5K7FA 5H6RA 3MKLA 3F8BA 3X2QH 2XC7A 1XSXA 2A6TA 4OIQF 3HOWJ 2H6BA 5M5XJ 3HHGA 2B9SA 1R4MB 3KP6A 3ELKA 3I4PA 4GYGA 5JFRA 4EJOA 3F9KA 4J19A 1OYIA 5L3GA 2ZNZA 3L7WA 2KLOA 2O3FA 4QIWN 1XMXA 1YI2I 3HRMA 2EJRA 1V5GA 4PJJA 1LDJA 2E1CA 1JE8A 2LF8A 4CDGA 3JRCA 3KP4A 4BACA 5KAIC 4BHPA 1IXRC 3G6EI 3OMYA 2CV2A 4DGWB 5D5XB 4ZYEA 4CGZA 1J7KA 4C30A 1USTA 2RQPA 3ISPA 5ICEA 2LR8A 1HLVA 3HGYA 4KMFA 4IXAA 2HXIA 1XGNA 3GCMA 3CCMI 2F48A 2R7WA 3L00A 4E7HA 3ZQ7A 2OC6A 2RNGA 5DUKA 3RKWA 1C0WA 4Y52J 4OMZA 2DJIA 4X0GA 2O5RA 4N4OB 4XBFA 3KEYA 4YIRX 3W6JB 3I9V2 2FXAA 4E7ZA 1R5HA 3KE2A 2R7XA 3FXJA 4GRIA 3Q3SA 2UV1A 2VE8A 2CWEA 3C2BA 2Y0SN 2CUZA 4P9UA 1A6IA 2DT5A 2OCCH 3FBIB 5J47A 1YW8A 2Y9YA 3MEXA 1I5ZA 1K61A 2DA5A 3FXRA 5EGOA 1ETKA 3SHFA 1WJFA 4XSXF 3F22A 1SVLA 4CXFA 2D45A 2NRAC 3LSKA 3DKYA 3E5XA 5CLSA 3ZXSA 1ON2A 5F27A 1JJ6C 2M7AA 1HBXG 5FLMJ 2KJCA 2LD5A 3D1NI 1ZQ3P 2IA2A 2HPIA 2LLKA 2DA4A 2XAQA 2XRLA 3IRQA 2GZWA 2GWRA 3ZMTA 3CUQB 1A35A 1EF4A 5DM7F 2A69F 4XORA 2CSOA 1YRNB 1RNLA 4HX7A 2ICWG 3KYCB 3QODA 2ME6A 1L0OC 3DTKA 2VXZA 2X4HA 3BDDA 4I02A 2WAQA 3LFUA 3EYYA 2FQ4A 2L7MP 3K4JA 3ZCOA 1AOYA 1S9HA 2E1NA 3PSFA 3WGGA 1HW5A 4BQQA 1E2XA 4LG0A 4WXDA 1W36C 1U8BA 2VJJA 3GZ6A 3P9IA 4Y3OA 1HW1A 3V7CA 3R0JA 4OOIA 3BT9A 3FMSA 3PIOF 1D1CA 1KA8A 4AYBA 2R3SA 3KPHA 1Z05A 4WXCA 5DDGA 2I5UA 3FF5A 4A2UA 2BE5F 2Y9ZA 3EETA 3SEZA 1VI0A 5AIPA 2QYOA 2P6SA 2FEZA 3OSGA 4D7NA 3S1RJ 3MZYA 1ENHA 1UG2A 1YO5C 1S8NA 2RV8A 3BR1A 1K79A 4ZJZA 3HXLA 4P1WA 2H1LA 4FQGA 5M3FJ 1BC7C 4LGWA 1DDNA 3R60A 2PX9A 4NDLA 4CCJA 1R36A 3GUDA 2JSCA 3SYTA 3OYFA 2QSGX 3E7LA 1IV8A 3QU3A 4Y7NJ 4EEFG 2K4JA 2LYCA 1XMKA 1Y1VJ 4JBAA 3GX4X 1O7FA 3G4SI 3HC7A 5LLQA 1XGSA 3I3LA 3WTWC 3SQNA 5LD2C 2NVXJ 4OWRB 1U3EM 2WY8Q 2L9RA 3NARA 4FE4A 4BL0B 3RPUD 3BPVA 2W82A 3DPLC 2FBIA 1BIBA 3DTEA 3A01B 1S6LA 4RS8A 3PFIA 2UUZA 4UY8I 3DPTA 2W84A 4C3IJ 2M34A 4IVNA 5IOZA 2R7RA 1SD5A 3HJEA 4UV8A 3HM5A 3DU6A 3PNYA 1J09A 4E7LA 4XKBA 1FMVA 1YJWI 2CQKA 4XOTA 2R7ZJ 5D8LB 5CQEA 4IHVA 2QF7A 3RYPA 2HVQA 3QRFF 3PJRA 5LEKA 3H5RA 3HRUA 3AFHA 3J7AY 1XB4A 1LFBA 1EV7A 2K02A 3ZMUA 3GVAA 4PUSA 4AIJA 2HU9A 2DFHA 3HPGA 5IP9J 1STZA 1PYVA 2KHMA 2MSYA 4G7HF 1PUEE 2BY1A 2CO5A 5KVRA 2VASA 5EF6A 4Q48A 2VODA 1G3WA 4AM3A 4EATA 4FCYA 2QWWA 3R61A 4OU0A 2P0WA 1BW5A 1YTYA 2CQ7A 5IY5H 5FO5A 1XPXA 2RQQA 3K1MA 3OIQA 4AVPA 3HOYJ 5ILVA 4Y4RA 4A5MA 3AG3H 1AKHA 2G9WA 1R00A 2JT1A 4F3QA 1YIOA 2MFZA 3ZQLA 2EFPA 3WGIA 2JWTA 2X6YA 1IXCA 2VOOA 2VJIA 1GV5A 2HOEA 4UVCA 3OYDA 3T0YA 4KISA 5ED4A 2KIMA 2R5ZA 3QPSA 1TL8A 4B4CA 2Q2EA 3ZN0A 2K9LA 6PAXA 4A69C 4ASNA 1Z6RA 5HDNA 1J0RA 2COMA 4W97A 5HDGA 4QTRA 1YJ9I 2IT0A 3S1NJ 1SD7A 3TO7A 3ROUA 3K70D 1J9IA 2QSFX 2EIKH 1FSEA 1SD4A 2BEOA 5D6EA 4HQEA 3I59A 1LFUP 5FRNA 4XMYA 2EBIA 4HF0A 4M71A 3JW4A 4S0HB 1LB2A 2XAJA 2CUJA 4PJMA 4XQFA 2DA1A 4BQAA 1HSTA 3OYEA 3CP2A 2VBXA 5KNLA 1O3SA 1UHWA 3K9TA 2P5VA 3JRDA 1E17A 4HNVA 3U9GA 2F5CA 2CV0A 2HDWA 1HKSA 4A5NA 2CW8A 4IRIA 1TWGJ 3F3XA 3BG7A 2V1UA 1IC8A 2GA1A 2HVSA 2IS1A 4A6DA 2HOAA 1OISA 4FT8A 3TMOA 2EH3A 1DPRA 5M5WJ 3ZQHA 3HDDA 5ICCA 4MO7A 4KT5C 2R0QC 5DCMB 4BH9A 3CMMA 4PGGA 2CS3A 2X0LA 4LIUA 2QKMB 1S7EA 1E3PA 3EUAA 3M9AA 1H0MA 3J81K 2E34A 4IHWA 3GTLJ 2DYRH 4C3HJ 4LLNA 1LE8B 1IDZA 5K7ZA 2QENA 1RUNA 3TO9A 4E7KA 2RREA 3CCJI 3WU0A 4RBOA 2XVCA 1Y0UA 4CYCA 1BBYA 1I39A 3CLOA 1BJAA 3FKJA 4B8XA 1OYWA 1QU3A 1F1ZA 1B9MA 3P9CA 1MBJA 2F4IA 2X85A 1QZEA 2EQRA 2BY3A 2K3PA 1I1SA 1GUUA 2X51A 4XKWA 2JA7J 3WTUC 1S5LC 4IRGA 3HG9A 2VPLA 4GO1A 3E1SA 2HNHA 3VB2A 4P96A 3LMMA 3D5SC 3UNGC 3RDIA 4HA8A 3H3ZA 2PN6A 2XHKA 4NC6A 4MFDA 1Y39A 5TISC 3G2BA 4U0WA 3TP3A 1FPQA 3B6CA 2LK2A 1T98A 3GXOA 1NG6A 3TP0A 4Q4ZF 3CMAI 5M3MJ 3CCLI 3K4BA 5FLXK 4KN7X 4HBLA 4M6XA 2NXNB 3K4LA 4EJWA 2XKPA 2JZYA 1OCZH 1QRYA 2FMYA 2FQ3A 3BTIA 2FX0A 4HX4A 4II2A 1VQMI 2L5QA 2XAUA 4G6TB 3SZGA 2TRTA 2QZ8A 2C6YA 1JHFA 3HB9A 4XNFA 3GF2A 3E97A 4UB6C 5F0FA 3CCRI 3HSRA 2BGCA 1O4XA 2BW3B 3GBGA 3L2VA 2DO7A 2LP0A 4Y17A 1T08B 4HEA2 2L2OA 5CVVA 5LRSA 3ERMA 4ZDOA 2LBFA 3L2QA 2Y48A 2MH9A 1YITI 2L3DA 1Y6IA 3MFKA 1H9GA 5M5YJ 4XN3A 3A03A 2FF4A 4C2MJ 4MNUA 4F91B 4NC7A 3WHCA 1X58A 5CKTA 4HNUA 1ZGJA 2LF7A 3GTMJ 1U5TB 2BV6A 5JLXA 5DTDA 4FTHA 2DCEA 3LSJA 4UUSA 1H9TA 3QYFA 2RDPA 2IGNA 4IHYA 5AIQA 3KETA 1T8IA 3CCSI 3N05A 3MMYB 1FP1D 5HS9A 3ABKH 1TLHB 5K5OA 1WJAA 4M6VA 3TO6A 2KQRA 1MBHA 1SEUA 2VQLA 3ZMVA 4MQVA 3TQNA 2D2WA 2HKOA 4ETSA 3H0GJ 1SMTA 4BU2A 3CDHA 5C4XJ 3IH2A 3O8HA 3BJAA 1JTYA 3BJOA 3H35A 3C1DA 1WJBA 2OUMA 5K5RA 1LFPA 2JSPA 2OF7A 2VC0A 2E1MC 5AONA 2K40A 3LFKA 2XAGA 1SC7A 4KIGA 1RC9A 3U21A 3VSKA 1TT0A 3KZYA 2LY9A 2K9SA 2LY2A 4G8XA 1PUFA 2CUEA 4G12A 1RKTA 3DEEA 4KIBA 3D5LA 3NQOA 3VODA 4RGUA 2NAZA 3V8LA 1JKOC 2F4OB 4KT6A 4A3KJ 3KEQA 1YFHA 3K4MA 1RR7A 1RUOA 3GLXA 2WAQN 4NQWA 5D5VB 1B4AA 4V19K 3EYIA 3BR6A 2KP6A 3IC7A 2EPFA 4IQJA 1KYWA 3K6GA 1B72A 2PI0A 1ZRCA 2EIMH 2ADUA 4HF1A 2CGPA 1ZYRF 3H9QA 3PM1A 4B48A 4PFPA 3HUGA 4L5EA 4BEHB 3CO6C 2BVLA 2DFEA 4ESJA 2HDCA 1KQ8A 4Q5SF 4AYBN 4AIHA 1IRZA 3LQQA 2E60A 3IP4B 5CYVA 3S1MJ 2F2EA 3IWFA 2EV0A 2A68F 4H4KC 2VUMJ 2JPCA 4KDPA 1YS7A 1WHUA 5J40A 3A2KA 3HIFA 1ON1A 3DEWA 1WFXA 1IN5A 1BR1A 3S3NA 1ZR4A 3KZZA 3RJPA 3J7AO 3JAMK 1Q1HA 2BXYA 3LOCA 1M1EB 4UHTA 2VQHA 2A5YB 3RQ4A 1P7JA 5GAEJ 3H36A 2M87A 1HDPA 1YX3A 2B63J 2AO9A 2E5ZA 5LGNA 1TW2A 1ZELA 2FD5A 3BR3A 4XLAA 4M3DA 2BY0A 1JHHA 1SD6A 1LPQA 4MTEA 2F5DA 1JUSA 4JX5A 1J5YA 4XKVA 3OOUA 4PDKA 1ZRFA 3LSHA 4IHSA 3CMYA 1LKXA 1RZ4A 3GO5A 1BM9A 1W7PD 3E6DA 3WG9A 2MYSA 3WTYC 1VQ6I 3CDIA 1K4SA 1HQCA 2WB1A 4IEJA 4M73A 2JN6A 2WV1A 1MBEA 3HGGA 3S17J 1FSHA 1P4XA 2OBPA 5E3OA 3GTQJ 5H20A 2E19A 1G2HA 1ZN2A 4LIVA 4CUGA 2YU9J 5BQTA 2QCOA 3FK7A 1W0UA 1Y0NA 3C2GA 2TCTA 4U0YA 5E79C 2E2IJ 1FTTA 5EEGA 1D0XA 3ABLH 5H6QA 2KIQA 2P7CB 1D1BA 3TEDA 2ELJA 1TWCJ 3U1DA 3MZHA 1AKHB 5JHUA 4BDYA 1IF1A 3M3YJ 3H1CA 3TL4X 1B1BA 2M3AA 4FE7A 3VOEA 1OYYA 2DN0A 1UELB 3SXYA 1KQ9A 4DJAA 5KAFC 2IW5A 3H92A 1OCCH 5LRRA 4B44A 3M07A 2VPRA 4MGRA 4OIPF 3REOA 5D8KB 4A12A 2QBYA 2IEKA 1DP3A 1UMQA 1U78A 2X9DA 2M7BA 1GHCA 4L5JA 3BTLA 2EIJH 2VL8A 1YW7A 3B6AA 3KP2A 1N78A 1JI8A 3FK6A 4KYWA 4A3FJ 3I4NJ 3CD6I 2YR2A 1D3YA 1ZK8A 3BCAA 3F8MA 3OV8A 3RPQA 1BIAA 3ABTA 1FNNA 1SANA 3T8RA 4U88A 2OCEA 5FJ8J 2WTEA 2QSHX 1I6XA 3QWLA 4BAYA 5B3SH 3CO7C 1USSA 1HW2A 3S2DJ 1AA7A 4NUBA 3WTSC 4JX6A 1P7IA 3KFWX 3WE2A 2NOGA 1TWAJ 2R93J 5LEJA 1SFXA 2E7WA 2V6CA 3K1NA 1XGOA 3LL7A 4BYYA 1G3YA 3CLQA 2XIGA 3NAUA 1XDUA 2DA7A 3GEZA 3HL2A 3KCCA 1YG2A 2DYSH 4QWQA 3FXKA 1CF7B 1R4NB 3OS0A 1BW6A 3BG3A 2VN2A 2HOSA 3DTIA 4NHJA 2VBWA 3K4KA 1B8IA 4UXNA 1OKRA 3FIWA 4XLCA 4ZH4F 5DS9A 2W00A 2GIZA 1FOWA 1O7LA 4DNCA 1R23A 5ILUA 3J80Z 2H6CA 3V7SA 1MDMA 2V9KA 3ZQFA 2F4MB 3DEUA 2GOXB 1H8AC 5GPCA 4ESBA 2IPQX 4Z6YA 4TV7A 5IT9K 3KX2A 3R6SA 3LNQA 5EG0B 1LNWA 4A3GJ 4LK0F 5HS7A 2M4KA 3COAC 1MMDA 2DK5A 3HOTA 1GV2A 2FJ1A 4BGDA 3IH4A 1UHMA 1R22A 4RGXA 2P4WA 3BG5A 3J7YJ 1MW7A 2M9HA 3I56I 5FKNA 1XCVA 3LAPA 4LITA 1WI3A 2M2EA 4HSTA 3BG6A 3FBNB 1JUMA 3TW7A 1QGPA 2E5NA 5IPAA 3OYCA 1R5ID 3SZPA 2ZXJA 1FBSA 1L3LA 1W5TA 2LDUA 3L1PA 5HLIA 1BI0A 4QPOA 5ERIA 1T39A 1DP7P 2Z5UA 1QBJA 2MG4A 4AD9A 1OCOH 3PNVA 1VQNI 3E6CC 4EJUA 3CCVI 3AKZA 2ZB9A 5FGMA 3ZMZA 2KRCA 3BWGA 3MKZA 3LWFA 3O2PE 5E1WA 3I54A 1D0YA 4A6EA 4N9IA 3MCZA 4XICA 2ZXIA 2JVGA 3UKGA 1ETXA 1G59A 5J8CA 3OYMA 2DMUA 1VQKI 2JPBA 2ZMEA 1BA5A 1I3QJ 1W7PB 5J1YA 1WZ2A 2J5OA 1QPMA 1WGXA 4I99C 4OMYA 1T38A 5J6XA 3JREA 4IQ4A 1JGSA 1ORKA 1KONA 4PK4A 4IX7A 4X6AJ 3HEFA 2GAUA 2HDDA 4AUXA 5IP6A 2R5YB 1MMNA 2MD5A 2JUGA 2XDVA 3HZJA 2STWA 2Z1DA 3SJMA 3HBLA 2NVTJ 1JKRC 4NB5A 2CUFA 4RB2C 2PQ8A 2ZCWA 1ZRDA 3GFIA 2RC4A 2HOTA 1QNTA 1XG1A 1Z1DA 2O03A 4IJAA 4KICA 3MD2A 3TDUC 3PUBA 3VDXA 1ETOA 3MVPA 3RIRA 3VPRA 4L18B 2VE9A 3DBRB 2O6GE 1Z3XA 1YX5A 1MNEA 2Y31A 4WF2A 1J75A 4X1EA 2B0LA 2P7VB 1X2MA 1V5EA 3CCEI 2KJBA 4HAMA 4KN4X 3BTJA 4A3CJ 4MFEA 3GTPJ 4GXOA 4HG2A 2IGKA 5F1JA 1QHGA 4M9SA 4A3MJ 2ZJQF 5KCMA 1MMGA 3WTVC 3ABMH 4C9YA 2HQ5A 1T56A 3FXLA 2JK3A 4RA2A 3GTJJ 3D5RC 2VKHA 4N0BA 4LG3A 4XOPA 3CCQI 2VXDA 3I64A 3TOBA 1BJZA 1Y1WJ 3CC4I 5E17F 1K78B 2AQEA 3AAFA 3LSPA 5C44J 1UJ8A 4Y15A 3K0LA 4M9XA 3FX3A 4RGRA 5KK1A 2V1NA 3S14J 3V8KA 1E0EA 2XF6A 4LB6B 4BE0A 1NTCA 2Z16A 1G3TA 2K5CA 2DMNA 3CJRB 4UVAA 3JTGA 4KNYA 1V5FA 2IS4A 4G94A 2EILH 5F6FA 4XRMA 5K5QA 1F5TA 5LFAA 3CQZJ 4HF2A 2EK5A 2GLOA 5E3NA 4HV6A 1KU7A 3BZ6A 1RETA 3DU5A 2FMLA 2E7XA 2BHZA 1EH6A 4L9TA 4HDVA 4E7SA 3HOXJ 5C3EJ 5FKOA 4S05A 4ZDPA 3M8JA 3KP7A 1Y8QB 5F04A 5CJ9A 4B43A 2I10A 3CJNA 5F1RA 2BXZA 2ZXHA 3OS2A 3DV8A 3CESA 2AS5F 1OMIA 1XD7A 1OPCA 2VKEA 4XONA 2XKOA 4EM1A 1FEXA 5HDKA 5B5EC 1Z21A 2KKOA 1QVTA 2EA2A 3GFJA 2YPRA 2DPDA 4UNOA 2K9MA 3DLLF 3GFMA 2G0EA 3QP5A 3VYRB 3I53A 3B73A 3KP3A 4BXXJ 3J80K 1LUJB 5ICFA 3JRIA 4J01A 4HDUA 4KFCA 1FC3A 5JHFA 3W6VA 4KIFA 2LKXA 1WQ2A 2Y75A 1J2XA 1FIAA 3L2UA 4EMSA 3OYJA 5GAHJ 1LDDA 2ZSIB 2PFBA 2XGDA 4ON0A 3SDBA 3WE3A 4XL9A 3ZR8X 2PMZA 4IOAF 1F43A 4I98B 2LOOA 2CW0F 4P5OA 2WB1N 4II3A 2BY2A 4OAYA 2X1EA 3KLOA 4DYQA 3F0CA 2CG4A 1QQIA 2OV7A 2XPUA 2WC2A 5GADJ 3P9KA 2HQRA 4EVIA 1X19A 1TQPA 3QP6A 4PSXA 1K83J 3BG9A 4DZPA 3QPHA 5BS6A 1JGGA 2W4SA 2KT0A 2XROA 1BI2A 3DCFA 2D1HA 4RAYA 3OR2C 2DU9A 2XSDC 4RLQA 3PO3J 3F6OA 4FETA 4BY1J 4AIKA 5CVUA 1OCRH 2EFOA 4PGHA 5F64A 3MWMA 4F55A 1EJ9A 2ESNA 4GCVA 4ENKA 1JXSA 2YU3A 1EH7A 4LK1F 4DW6A 2UXNA 1TZLA 3RQIA 1F36A 3E5QA 2Y30A 4FASD 2CFXA 1OFCX 3C3WA 3H9JA 1X3ZB 2CJJA 3MKWB 2DLLA 5CVIA 5J1UA 2WAEA 4BJ6C 2CU7A 1WJDA 2ID3A 4Z2YA 1GVDA 4QPQA 1Z91A 1W4MA 4IKFA 5FKMA 2MC3A 2CV1A 4LJZF 2V79A 1A31A 1CQTA 1YOVB 1R7JA 5BPDA 1WCMJ 2GXGA 5DEQA 4L9VA 3ZQCA 2GQQA 1BI3A 2VI6A 3BR0A 1P92A 2B7EA 1AU7A 1SVMA 4E6KG 2DA2A 4IZZA 4NNJA 1FMWA 4L5IA 2HXOA 5J4YA 4KMUX 1UHSA 3JRFA 1SAUA 4HQMA 2VC1A 1ZTRA 1P9QC 3K69A 4A3EJ 4OIOF 1Z6TA 2YX7A 4ZYDA 1PDNC 3KYLA 4HZFA 2VKVA 2L4AA 2MLKA 2NS8A 2ME0A 4K2EA 2VONA 3HOZJ 3BZCA 1XTAA 2E2HJ 2YUSA 4CICA 4IPAA 2JJ7A 2PJPA 1TWHJ 3ESWB 4FX0A 2L9VA 4M9ZA 3SFZA 4A0YA 4E70A 2KISA 3SZTA 1MSFC 1E3OC 2LVSA 3CF2A 1DGWY 2ZBKA 2PBIA 3HKZN 3FM3A 5FKLA 1Q1VA 2OU2A 1QZZA 1MDMB 3ZRGA 4IHXA 1SAXA 1ETVA 3EUHA 3F21A 2DFIA 5E8IA 3IV5A 1WH7A 2EZLA 3JRHA 4RAFA 1ZGAA 1ETQA 4LFUA 1WJ5A 2GOMA 3GWZA 3CJQB 1DU6A 2G7UA 3CTAA 1HA8A 2CFOA 5FLVA 5E20A 3EPZA 2FOWA 2WBMA 1XDSA 4BHCA 5GAGJ 3H5AA 2DMPA 4YFXF 3A0BC 3HHHA 2M1BA 4MHGA 2L7ZA 1TWFJ 4PZJA 2QQAA 3LA3A 4EM2A 3HOSA 4UUTA 2NNNA 5JVGF 2ZJPF 2DA6A 4OIRF 4KITB 3ZQGA 3RZOJ 1W36D 3LA7A 2ACJA 3J7ZI 2IGOA 2FBHA 2MH2A 4AVZA 1MMSA 1I6HJ 5K7HA 3QAHA 2STTA 4D9JA 2UWMA 3F8FA 1Z9CA 2BYVE 3IKTA 2VJ4A 4BJ5C 5EGOB 4GFBA 1CGPA 2MABA 5E1ZB 4RB1A 1MIJA 2LH9A 4JK1X 1WSUA 1JKQC 3CUQA 1IJWC 1IO2A 2HTJA 4YG2F 2VB6A 1OJLA 3S8PA 5LGUA 1YRNA 2DBBA 2ELHA 4P9FA 2Z2SB 3S32A 1IN6A 4XLHA 4NC8A 3HOVJ 1GXQA 2KIUA 1IGNA 2IBDA 1BR2A 4M3FA 1BOBA 1LEBA 3V8JA 1KU2A 2OZUA 4XLEA 3H3UA 3KEOA 1D5VA 3KP5A 3FWEA 4E4HA 1O3TA 3GMEA 4P55A 5DM6F 1W5SA 4LG0B 1B59A 4H0EA 1IZ1A 2F5FA 3W6KB 2X1DA 4RAGA 4G6DA 1IN8A 5EZHA 3LSRA 1T95A 5JR3A 3A02A 3R0AA 2HTSA 3FXQA 3QPTA 2Y69H 3F6VA 2NVQJ 1VQOI 2E71A 3TW6A 1IRGA 2XUBA 2M0CA 3AG1H 4Y13A 2DQLA 2O7OA 1X3WB 5K1YA 3NRVA 1YIJI 1HKQA 3OYBA 3E5UA 1TW3A 1ZAOA 3FHNA 3PIPF 3JRAA 1U6GA 2M30A 1DUXC 3HOUJ 2FOKA 1XN7A 4LB5A 1FOKA 4J00A 3TGNA 1JUPA 2M8GX 2JA8J 5TGTA 3I4MJ 1KQ0A 1KU3A 2XSJC 3LA2A 3N4MA 2EA4A 4UUVA 3F23A 4IHTA 3L09A 2ZNYA 1DGRM 1VQ4I 1G8XA 2CQXA 2OZ6A 5EYRA 1MJAA 4NBQA 3TKYA 1P2FA 1MBFA 3SEQA 1MH3A 2K27A 3I0TA 4PJNA 3SFIA 1OLTA 4JX4A 1LDKB 1W0TA 2YSRA 1YJNI 1VZ0A 3V4GA 1VQLI 3A01A 1P6RA 1YW9A 1I50J 2DK8A 1JTXA 1MJ9A 2JRMA 3HTUA 4R79A 1X1CA 4D7MA 1VQ5I 4DIQA 2ECBA 3AG2H 4CZCA 2P6TA 3A1YA 3MAJA 5E3LA 3GZ5A 5IYDJ 2LTPA 4XN0A 3C18A 2P81A 3DKWA 2L54A 2LMDA 1MNDA 1ETWA 2X6WA 4L0ZB 3OYGA 2BZTA 3C2HA 4PJLA 2P5KA 1IUFA 1I3AA 2CQQA 4O6JA 2K9NA 1BC8C 4BBSJ 3Q0UA 2WAFA 2XPVA 2WADA 5FROA 4U87A 2O9LA 1S72I 2XF5A 2DPUA 5LHIA 2LSOA 2DDAA 4BY7J 1HF0A 1IV6A 4YEJA 2M8EA 1UAAA 2FRHA 4A93J 3BR2A 2EFNA 3CCUI 4A3IJ 2YS9A 3S16J 1IN4A 3KZIC 5EEAA 1FYLA 2O8KA 1D8JA 1QHHD 2R7OA 3Q5FA 3AL0C 2LRDA 3DQVC 2A5WA 3O8GA 4HW0A 5CVRA 4I76A 4L9JA 4B09A 4O3MA 1O3QA 1ZREA 4LLGF 1TNTA 3M1CA 2CQNA 1RIOH 2FNPA 2HEOA 1MBGA 2VBYA 2PEXA 1T0FC 4F52A 2V6EA 2KRFA 3E6BA 3QQAA 2W7NA 3C7JA 4AC0A 4IOCF 1K7AA 2AXTC 1UB9A 1KU9A 2Q1ZB 3BP8A 1XGMA 2R5ZB 2DA3A 2ZMEC 2Q2EB 1KYZA 4XKCA 3K1PA 5FRMA 3SDGA 2GA2A 5D5WB 4M72A 2RGVA 1HCRA 3OL4A 2V1XA 1RPWA 1W5CC 1IRFA 2DFFA 3I59B 3DXJF 2EV6A 4ENJA 3R4KA 4IO9F 4WWCA 1PP7U 4DYCA 3RKQA 2KFDA 4IRHA 5GTIC 1TQIA 1ODDA 3RKXA 4V2GA 2WY7Q 4EGYA 2PMZN 2EV5A 5B1BH 1BN5A 4EV0A 1Z67A 1Y8RB 2R7QA 3DP7A 4ZYHA 5A2QZ 1SFUA 2I8DA 3T8TA 5E8GA 4IF4A 4ZYGA 5ICGA 2HYJA 5DCMA 3OYKA 1WVRA 2RN7A 3NWSA 3MZ8A 4HOBA 2LC2A 3DWLE 2IVMA 4BUPA 5HNHA 2JRTA 3JR9A 5EZGA 1LE8A 2HZDA 3HKZA 2EFQA 1X4OA 4L0YB 4BXFA 1HKTA 1REPC 2M45A 1U2WA 5CQGA 2CH0A 3ZGKA 2HVRA 1JKPC 4JOMA 1QVUA 3QPLA 2GXAA 4A0XA 2RNJA 3ZQQA 2HKXA 1FWZA 5D4RA 3RTRA 1SFKA 1T2KA 2Z99A 1GXPA 1R6RA 4CYCB 4DYRA 1GLNA 1D5YA 3M1EA 3U2RA 4LLLA 1YQAA 3JCUC 4EGZA 1B6AA 4HX8A 4RDUA 3S1QJ 2IJLA 4B3XA 2K86A 3PUFA 4CA0A 1NH3A 3IAS2 4WCGA 5CPRB 5E1XA 4B47A 1MJBA 5FFXA 3DLAA 1HC8A 2OA4A 2DT6A 2PJRA 3GTGJ 3IKVA 1UZCA 4D0PA 2NNYA 2HYFA 5F08A 1XX5A 1YYVA 2HI3A 4FHTA 3BR5A 3VYUB 4I09A 2Z3YA 1WJEA 1Z3YA 4ENMA 2E35A 5F0CA 3IWZA 1KGSA 2GIVA 4PSWA 4HRIA 1FIPA 2ISYA 3L2WA 1IXSB 2K7LA 2EFWA 1AHDP 3EUKL 3K4CA 4PFOA 3HSEA 2V9VA 3HRSA 4FISA 3G1MA 1MBKA 1TT5B 1WRJA 4KA4A 4EJTA 5FD5A 4JP0A 4CYDA 2YX4A 4B1RA 2BW3A 1FJLA 1WWXA 2L9NA 2TDXA 4I0BA 3RSNA 1S29A 4ABZA 2LNBA 1EH8A 2AXLA 2DOAA 2KZVA 3F8CA 2LG4A 3IUOA 2F5VA 4CCNA 3KLNA 4F92B 2Z33A 2N8GA 2D1VA 3RPUA 4QLCU 4EM0B 2ISZA 3VYTB 2L4MA 2LBFB 3S3MA 4BXUA 3CCYA 5GPAA 4BHBA 4RB0A 2FE3A 1U5TA 4RM3A 3RCOA 4RLFA 1T0FA 2NVUB 4AWXB 3JTHA 3BOQA 1K6OA 2VJ5A 5CVJA 3RZDJ 2FBKA 5KHDA 2DJNA 1LQ1A 2HZTA 4HNTA 4UUSB 5J3LA 1I27A 4CZZA 1H88C 2MGQA 2DODA 1A6QA 3BZKA 2DDBA 3ASOH 4BQOA 2XB5A 3T1BA 1VTNC 2JVHA 1F4KA 3K10A 4MQ9F 4R8HA 1I1GA 3A0HC 2V26A 2FA5A 3ECHA 2EZKA 2H1KA 2H27A 2W25A 1A5JA 3W3CA 1T6SA 3BQZA 3Q0VA 4FX4A 3BLYA 3FXUA 3J81Z 2K85A 1FLIA 3GTKJ 2COBA 4A3JJ 1JJ8C 2IS6A 4F7ZA 2LKSA 4Y33A 1QZYA 2M4GA 4M3GA 3ZPLA 1IG7A 2QLZA 3CDLA 1X2NA 4XLNF 1ITYA 1QA6A 1X3UA 2XASA 1FP2A 2QEXI 5JVTA 3BC8A 2WA0A 3ERED 4U7BA 3K7AJ 3FMRA 1FOYA 2A05A 1N75A 2ZJ2A 4G7OF 3OIOA 2WV0A 3Q9SA 5HOOA 1ZG3A 4MTDA 1WJCA 3DF8A 3M7GA 4YIFA 1VNDA 2K9QA 1JT6A 1SVOA 1PUFB 3OSFA 2DAOA 1BOAA 1A36A 2HYGD 1EA3A 2F6CA 2H8WA 3LSGA 5IT3A 4YRVA 2MA3A 1E3HA 3G3ZA 4ESFA 3N97A 4CCMA 4RAZA 1X1AA 2VQGA 5D4SA 2QVOA 4NQWB 3BPXA 2KDOA 2JUCA 3IRRA 3FHZA 4I7HA 1GVJA 2J5PA 2WWYA 1TQMA 2QQBA 3IAM2 2XGEA 4G9YA 5L3FA 3OYHA 1B72B 4ITVA 2IRFG 4BEHA 2IS2A 3W2WA 4BJTA 5FLXZ 1MGTA 3IH3A 5FKKA 4XLFA 3HUGB 3P7NA 4C3JJ 1TC3C 4XSZF 5DCFA 2P5LC 3WODF 1XS9A 4M3EA 3OOPA 4PCQA 3S3OA 4A3BJ 1IAWA 3FM5A 2XRNA 3FDYA 2D5VA 2CYYA 4C2TA 4GDFA 2DMTA 4DZJA 3ZOBA 5A2QK 3NEUA 1Y56A 4U7DA 1PP8F 4ZYAA 2BVMA 2MC4A 5J1RA 5DUIA 2NS0A 2FSWA 5IOYA 1RI7A 4M3BA 3DKXA 3FMQA 3QYBA 4M74A 3FKIJ 3M4OJ 2L9SA 1XSDA 4CO8A 2DI3A 4HV5A 3EUHC 3G71I 3F72A 4YIIA 4DBQA 3JRGA 3GW2A 2E1OA 1NK2P 2A6HF 2DT7B 1WH5A 5D5UB 2ZFWA 2FNAA 4N9HA 3E3VA 3QYEA 3V42A 3WG7H 2ELKA 2O0YA 2A6EF 2VT3A 1AWCA 1ZGWA 2JA5J 1ZG1A 4IL6C 3KIOA 5GP9A 3HTSB 3E0JB 4ZTJA 3FXMA 3H3VK 1LVKA 3I5UA 1D0ZA 3PL8A 2DQRA 2VOPA 2G7HA 2R7TA 4AU7A 3O6BB 2P8TA 3U1KA 4CCOA 5BPIA 2EB7A 5HNFA 3F8NA 1MSEC 4E7JA 1FX7A 2EWNA 5DD8A 1ETYA 1VQ8I 4R1HA 1TP4A 4WK8F 1X1PA 1R49A 3S2HJ 1P4WA 1W1WE 2LY1A 5DYMA 1MMAA 3TOAA 4I6ZA 3G1LA 1GT0C 2JTVA 3K2AA 4CCLA 2RAEA 2QUFA 3TDZC 3I55I 4DOZA 3RKYA 3P5JA 2A07F 4BNCA 2ZKZA 1MH4A 1S7OA 2GXBA 2JA6J 2X1CA 3LSIA 3MKYB 3CUQC 4A3DJ 9ANTA 5LBQA 3M8EA 5TJJA 2OTJI 3S2WA 2IGMA 2UXXA 2R92J 3FXOA 5C4JJ 1TBXA 3ULQB 3AG4H 2OTLI 1IW7F 1ZG5A 3PQKA 2PLYA 2ETHA 2OQRA 2DTZA 2DOEA 4AIDA 1X1BA 4XRFA 2QBYB 1ZR2A 3ZMDA 4U0VA 4KUMA 2NYXA 5L3CA 4EQQA 2L02A 3D0SA 2E1MB 4BQNA 3H9GA 3CC7I 4OINF 2VIXA 4RMNA 1NK3P 2V7FA 5E18F 2HPMA 2XF7A 4CSWA 3H5NA 3BY6A 4JQFA 5ILSA 1RR8C 4XM3A 1IDYA 4KJZA 2ZSHB 3WTXC 1SMYF 2HGCA 2Z9OA 4W1UA 2DMQA 4I2OA 2KIFA 2QQ8A 2Q0OA 2XB0X 2ZJRF 2XAHA 5BOXA 3HRTA 4BDZA 1XSVA 3JAMZ 3HPHA 4YELA 2R7DA 2IA0A 1V4RA 1HXDA 3V7RA 1IUYA 3MN2A 2M0MA 2ZFUA 2JMWA 3JSOA 2R7VA 2NOJB 2L7FP 4I0AA 2E36A 2PMUA 2Q8KA 4XR6A 1CF7A 3QOPA 3PQJA 2QM3A 1EKEA 3OYIA 4LMYA 3MQ0A 5LHHA 1G3SA 4MEXF 2VLAA 2R4GA 5FD6A 1VF9A 1G6NA 3GFLA 3IHUA 2W24A 3VFZA 4A3LJ 4HPQA 2R7SA 5J8FA 5IP7J 5JLWA 1R1VA 3LAJA 1FTZA 1VQ9I 1JT0A 1R1TA 1O3RA 4YFKF 1J59A 2O61A 3CUOA 4GGGA 3L2CA 1B8IB 2JQ7A 2BHYA 2VT2A 4ZZLA 1YS6A 2CMPA 3PNTA 4BE2A 3G1OA 3ECOA 3ZP5A 2K4BA 3DBHB 1ONVA 3RYRA 2M5WA 5EG0A 4UB8C 2HQNA 2PJRB 2Y0SA 1V54H 5HS8A 1IRXA 3OWTA 3A4CA 3VSLA 3FISA 1WI9A 4LD5A 1K6YA 4MLOA 2VKDA 2IP2A 3OYLA 1VQPI 1ZKGA 2V4JC 3M8FA 4EJVA 2E2JJ 3BTCA 1Z7LA 2QQ9A 2XPWA 2X6XA 1ERDA 2OQGA 1R58A 1KZHA 1R9TJ 4DBRA 5HLGA 2DOFA 3EDPA 1UCRA 1R1UA 5E3MA 3OY9A 2KPMA 4RM2A 3L9FA 1P4AA 2MD0A 3LSMA 3TBIA 3GYHX 1VFCA 1H89C 3W2AA 2L01A 2XGXA 4D5FA 1POGA 5HLHA 3AL0B 5IYCJ 2ZO4A 3BCBA 1HOMA 2HR3A 1LJ9A 4N4NB 1LEAA 2DW4A 1RRJA 1HDDC 5EEHA 1YLFA 3UR3C 1ZHFA 3BQYA 5B1AH 2LFBA 4HYEA 2HFHA 4BE1A 1W7PA 2RKHA 3WTZA 1ZH5A 3VWBA 1ZLKA 3K2ZA 3VYSB 2BBYA 2ZMEB 1S3JA 4MIMA 2O8XA 1NG7A 2MLGA 2X48A 3H0DA 2EZIA 2DTRA 1FY7A 2R7FA 3WTTC 1XCBA 4CHUA 4M6YA 2R5YA 3NWTA 2ZC2A 3LSTA 1U8RA 4BKXA 2CW7A 1UG0A 3CF5F 1QO0D 1YE9A 2HS5A 2VQCA 2FUG2 2MW8A 3VEPA 1A04A 1V55H 2KRHA 4XLPF 5L3BA 2MBFA 4ENNA 2OJED 2XV4S 5TRDA 2NVYJ 4BS9A 2X6OA 3O3KA 1MNMC 2H94A 5LHGA 5FB2A 3G73A 1SFEA 2QKLB 1OCTC 2HQAA 3ZQIA 2UZKA 3OYNA 1BI1A 2H09A 3OR1C 5FFZA 1MZBA 1FYKA 4G7ZF 2OPTA 1OR7C 5D6FA 3ASNH 3B02A 5IT9Z 1HSJA 2XAFA 3T5XA 2L0KA 5JI6A 2OAZA 1LVAA 2W1OA 3HYIA 3Q0WA 4UVBA 2IXSA 1FBQA 2GBYA 1S7AA 4HSRA 1Z7UA 3KYDB 1PJRA 4CCKA 4O5VA 3CP8A 3RI4A 1XC5A 1K78A 3WHBA 4B3AA 3QU6A 4YFNF 1APLC 1ZLJA 2W48A 1D1AA 3JSPA 1IN7A 1U9OA 2ESHA 3LQRA 2EZHA 1DU0A 4BBRJ 1ZARA 5HLTA 1X1DA 3ZMSA 5EDNA 3EQLF 3GLLA
chains in the Genus database with same CATH topology
2W85A 1MKMA 2RVCA 5HVQC 2PG4A 1V3FA 3I58A 2PMHA 2OD5A 3BJ6A 4UV9A 4RB3C 3ABUA 2A3SA 4ZZDA 3FZVA 4MEYF 3I71A 3HSFA 4L9NA 2F5EA 2V1DA 1U5TC 1XMAA 2Y0MA 2A61A 2FU4A 4WX9A 1FBUA 1DPUA 5DV5A 2VBZA 1UFMA 2LKPA 4G6QA 2W57A 5LGTA 1R5GA 3Q9VA 1ULYA 3E6MA 4WXHA 1FYMA 1B9NA 5L3EA 4GYIA 1D8KA 2HWVA 4S04A 1FZPB 4I01A 3WGHA 4RGSA 2IA1A 1FT9A 1F9NA 3BROA 5BMZA 3ZN1A 3DFGA 1MD0A 1OR7A 3ML6A 4DQ2A 4A0ZA 1TTYA 3IL2A 4Q47A 1O57A 1NHAA 1WKMA 3WU1B 1G4DA 4HLYA 5L3DA 5DD4A 4HLXA 1TNSA 5H6RA 3F8BA 1XSXA 4OIQF 2H6BA 3HHGA 3KP6A 3ELKA 3I4PA 4GYGA 5JFRA 4EJOA 1OYIA 5L3GA 2ZNZA 3L7WA 2O3FA 3HRMA 2EJRA 2E1CA 1LDJA 1JE8A 2LF8A 4CDGA 3KP4A 4BHPA 1IXRC 5D5XB 4ZYEA 4CGZA 1J7KA 1USTA 2RQPA 3ISPA 5ICEA 4KMFA 4IXAA 1XGNA 3L00A 3ZQ7A 5DUKA 3RKWA 1C0WA 4OMZA 4XBFA 3W6JB 2FXAA 1R5HA 3KE2A 2VE8A 2CWEA 4P9UA 2DT5A 1YW8A 3MEXA 1I5ZA 3FXRA 3SHFA 4XSXF 3F22A 4CXFA 2D45A 2NRAC 3E5XA 5CLSA 1ON2A 1HBXG 2KJCA 2IA2A 2XAQA 3IRQA 2GZWA 2GWRA 3ZMTA 3CUQB 2A69F 2CSOA 1RNLA 4HX7A 1L0OC 2VXZA 2X4HA 3BDDA 4I02A 3EYYA 1AOYA 2E1NA 3WGGA 1HW5A 1E2XA 4LG0A 4WXDA 3GZ6A 3P9IA 1HW1A 3V7CA 3R0JA 4OOIA 3FMSA 1KA8A 2R3SA 1Z05A 4WXCA 5DDGA 3FF5A 4A2UA 2BE5F 3EETA 5AIPA 2QYOA 2P6SA 2FEZA 3MZYA 1YO5C 1S8NA 2RV8A 1K79A 1BC7C 4LGWA 1DDNA 3R60A 1R36A 3GUDA 2JSCA 3QU3A 2K4JA 1XMKA 4JBAA 3GX4X 1O7FA 5LLQA 1XGSA 3WTWC 3SQNA 1U3EM 3BPVA 3DPLC 2FBIA 1BIBA 1S6LA 4RS8A 3PFIA 3DPTA 2W84A 4IVNA 1SD5A 4UV8A 2CQKA 5D8LB 3RYPA 3QRFF 5LEKA 3HRUA 1XB4A 1EV7A 2K02A 3ZMUA 3GVAA 4AIJA 1STZA 4G7HF 1PUEE 2CO5A 5KVRA 4Q48A 2VODA 1G3WA 2QWWA 3R61A 4OU0A 1YTYA 5FO5A 3K1MA 4AVPA 5ILVA 4A5MA 2G9WA 1R00A 2JT1A 1YIOA 2EFPA 3WGIA 1IXCA 2VOOA 2HOEA 4UVCA 3T0YA 5ED4A 2KIMA 2Q2EA 3ZN0A 6PAXA 4ASNA 1Z6RA 5HDNA 1J0RA 2COMA 5HDGA 2IT0A 1SD7A 3TO7A 3ROUA 1J9IA 1FSEA 1SD4A 2BEOA 5D6EA 4HQEA 3I59A 4HF0A 4M71A 3JW4A 1LB2A 2XAJA 4BQAA 1HSTA 1O3SA 2VBXA 1UHWA 3K9TA 2P5VA 1E17A 3U9GA 2F5CA 1HKSA 4A5NA 4IRIA 3F3XA 2V1UA 2GA1A 4A6DA 4FT8A 1DPRA 5ICCA 4KT5C 5DCMB 4BH9A 4PGGA 2X0LA 1H0MA 3M9AA 3J81K 4LLNA 1RUNA 2QENA 3TO9A 3WU0A 2XVCA 1Y0UA 1BBYA 3CLOA 1BJAA 4B8XA 1OYWA 1F1ZA 1B9MA 3P9CA 1I1SA 3WTUC 4IRGA 4GO1A 3VB2A 4P96A 3RDIA 4HA8A 3H3ZA 2PN6A 2XHKA 4U0WA 1FPQA 3GXOA 1T98A 4Q4ZF 5FLXK 4KN7X 4HBLA 4M6XA 4EJWA 2XKPA 2JZYA 2FMYA 2FQ3A 4HX4A 2QZ8A 2C6YA 1JHFA 3GF2A 3E97A 3HSRA 2BGCA 2DO7A 4Y17A 5CVVA 5LRSA 2Y48A 2MH9A 2L3DA 3MFKA 1H9GA 2FF4A 4MNUA 1ZGJA 2LF7A 1U5TB 2BV6A 1H9TA 2RDPA 5AIQA 3KETA 1FP1D 5HS9A 1TLHB 5K5OA 3TO6A 3ZMVA 4MQVA 3TQNA 2D2WA 2HKOA 4ETSA 1SMTA 3CDHA 3BJAA 3BJOA 3C1DA 5K5RA 2VC0A 5AONA 3LFKA 2XAGA 4KIGA 3KZYA 4G8XA 4KIBA 3D5LA 3NQOA 3VODA 4RGUA 2NAZA 3V8LA 1YFHA 3KEQA 1RUOA 3GLXA 4NQWA 5D5VB 1B4AA 3EYIA 3IC7A 1KYWA 2PI0A 1ZRCA 2ADUA 4HF1A 2CGPA 1ZYRF 3HUGA 3CO6C 4ESJA 2HDCA 1KQ8A 4Q5SF 4AIHA 3LQQA 5CYVA 2F2EA 3IWFA 2EV0A 2A68F 2JPCA 4KDPA 1YS7A 3HIFA 1ON1A 1IN5A 3KZZA 3RJPA 3J7AO 3JAMK 1Q1HA 4UHTA 2A5YB 2M87A 5LGNA 1TW2A 1JHHA 1SD6A 4MTEA 2F5DA 1J5YA 1ZRFA 4PDKA 4IHSA 1RZ4A 3GO5A 1BM9A 1W7PD 3E6DA 3WG9A 3WTYC 1HQCA 4M73A 1FSHA 1P4XA 2OBPA 5H20A 1ZN2A 5BQTA 4U0YA 5EEGA 5H6QA 2P7CB 3U1DA 3MZHA 1IF1A 5JHUA 1B1BA 3VOEA 1OYYA 3SXYA 1KQ9A 2IW5A 3H92A 5LRRA 4MGRA 4OIPF 3REOA 5D8KB 4A12A 2QBYA 1U78A 1GHCA 4L5JA 1YW7A 3KP2A 4KYWA 2YR2A 1D3YA 3F8MA 3OV8A 3RPQA 1BIAA 3ABTA 1FNNA 3T8RA 4U88A 2WTEA 1I6XA 4BAYA 3CO7C 1USSA 1HW2A 3WTSC 3KFWX 3WE2A 5LEJA 1SFXA 2E7WA 2V6CA 3K1NA 1XGOA 4BYYA 1G3YA 2XIGA 1XDUA 3GEZA 3KCCA 1YG2A 4QWQA 1CF7B 2VN2A 4NHJA 2VBWA 4UXNA 1OKRA 4ZH4F 1O7LA 4DNCA 5ILUA 1R23A 3J80Z 2H6CA 3V7SA 1MDMA 3DEUA 4ESBA 2IPQX 4TV7A 5IT9K 3R6SA 1LNWA 4LK0F 5HS7A 3COAC 2DK5A 3HOTA 1UHMA 1R22A 4RGXA 2P4WA 3LAPA 1XCVA 1QGPA 3SZPA 2ZXJA 1FBSA 1L3LA 1W5TA 2LDUA 5HLIA 1BI0A 5ERIA 1T39A 1DP7P 2Z5UA 1QBJA 4AD9A 3E6CC 4EJUA 5FGMA 3ZMZA 3BWGA 3LWFA 4A6EA 3O2PE 3I54A 5E1WA 4N9IA 3MCZA 5J8CA 2JPBA 2ZMEA 1W7PB 2J5OA 1QPMA 4OMYA 1T38A 5J6XA 1JGSA 2GAUA 2MD5A 2STWA 4NB5A 4RB2C 2PQ8A 2ZCWA 1ZRDA 3GFIA 2RC4A 1QNTA 3TDUC 1Z1DA 2O03A 4IJAA 4KICA 3RIRA 4L18B 2VE9A 2O6GE 4WF2A 1J75A 2B0LA 2P7VB 2KJBA 4HAMA 4KN4X 4GXOA 4M9SA 3WTVC 4N0BA 3I64A 3TOBA 5E17F 1K78B 3AAFA 4Y15A 3K0LA 4M9XA 3FX3A 4RGRA 5KK1A 3V8KA 4LB6B 1G3TA 4UVAA 3JTGA 4KNYA 4G94A 5F6FA 5K5QA 1F5TA 4HF2A 2EK5A 4HV6A 1KU7A 3BZ6A 2FMLA 2E7XA 4L9TA 1EH6A 4HDVA 4S05A 3KP7A 5CJ9A 3CJNA 5F1RA 3DV8A 2AS5F 1OMIA 1XD7A 1OPCA 2XKOA 4EM1A 5HDKA 2KKOA 2EA2A 3GFJA 2YPRA 2DPDA 4UNOA 3GFMA 3QP5A 3I53A 3B73A 3KP3A 3J80K 5ICFA 4HDUA 4KFCA 1FC3A 4KIFA 1WQ2A 2Y75A 1J2XA 4EMSA 1LDDA 4ON0A 2PFBA 3WE3A 4I98B 2CW0F 4P5OA 3KLOA 2CG4A 1QQIA 2WC2A 3P9KA 2HQRA 4EVIA 1TQPA 3QP6A 3QPHA 5BS6A 2XROA 1BI2A 4RAYA 2D1HA 2DU9A 3F6OA 4AIKA 5CVUA 2EFOA 4PGHA 5F64A 3MWMA 2ESNA 4GCVA 4ENKA 1JXSA 2YU3A 1EH7A 4LK1F 2UXNA 3E5QA 2CFXA 3C3WA 2DLLA 5CVIA 4Z2YA 1Z91A 1W4MA 2MC3A 4LJZF 2V79A 1R7JA 5BPDA 2GXGA 5DEQA 4L9VA 2GQQA 1BI3A 1P92A 4L5IA 4KMUX 4HQMA 2VC1A 3K69A 4OIOF 1Z6TA 2YX7A 4ZYDA 1PDNC 4HZFA 2L4AA 2MLKA 4K2EA 2VONA 4CICA 4IPAA 2PJPA 4FX0A 4M9ZA 3SFZA 4A0YA 4E70A 3SZTA 2ZBKA 2PBIA 3FM3A 2OU2A 1QZZA 1MDMB 1SAXA 3EUHA 3F21A 2DFIA 5E8IA 1ZGAA 4LFUA 3GWZA 2G7UA 3CTAA 5E20A 4BHCA 1XDSA 4YFXF 3HHHA 2M1BA 4MHGA 4PZJA 2QQAA 3LA3A 4EM2A 3HOSA 2NNNA 4OIRF 3LA7A 2ACJA 2FBHA 2MH2A 3QAHA 2STTA 2UWMA 3F8FA 1Z9CA 2BYVE 3IKTA 1CGPA 5E1ZB 4RB1A 1WSUA 4JK1X 3CUQA 2HTJA 4YG2F 5LGUA 2DBBA 2ELHA 4P9FA 1IN6A 1GXQA 2KIUA 1LEBA 3V8JA 1KU2A 2OZUA 3H3UA 3KEOA 1D5VA 3KP5A 3FWEA 1O3TA 4P55A 1W5SA 4LG0B 1B59A 4H0EA 1IZ1A 2F5FA 3W6KB 4G6DA 1IN8A 5JR3A 3R0AA 2HTSA 3FXQA 3QPTA 3F6VA 1IRGA 2XUBA 4Y13A 2DQLA 5K1YA 3NRVA 1HKQA 3E5UA 1TW3A 1ZAOA 1U6GA 2M30A 1DUXC 2FOKA 1XN7A 4LB5A 1FOKA 3TGNA 1KQ0A 1KU3A 3LA2A 3N4MA 2EA4A 4UUVA 3F23A 4IHTA 3L09A 2ZNYA 2OZ6A 1MJAA 3TKYA 1P2FA 2K27A 3I0TA 1LDKB 2YSRA 3V4GA 1P6RA 1YW9A 2DK8A 1MJ9A 3HTUA 4R79A 2P6TA 3MAJA 3GZ5A 3C18A 3DKWA 2L54A 4L0ZB 2P5KA 4O6JA 1BC8C 2DPUA 5LHIA 2LSOA 2M8EA 2FRHA 2EFNA 1IN4A 1FYLA 1D8JA 3Q5FA 3DQVC 4HW0A 5CVRA 4L9JA 4B09A 4O3MA 1O3QA 1ZREA 4LLGF 1TNTA 1RIOH 2FNPA 2HEOA 2VBYA 2PEXA 2KRFA 3E6BA 3C7JA 1K7AA 1UB9A 1KU9A 3BP8A 1XGMA 1KYZA 3K1PA 2GA2A 5D5WB 4M72A 2RGVA 2V1XA 1IRFA 3I59B 3DXJF 2EV6A 4ENJA 3R4KA 4WWCA 1PP7U 4IRHA 1TQIA 1ODDA 3RKXA 4EGYA 2EV5A 1BN5A 4EV0A 3DP7A 4ZYHA 5A2QZ 1SFUA 3T8TA 5E8GA 4IF4A 4ZYGA 5ICGA 5DCMA 2RN7A 4HOBA 2IVMA 2JRTA 2EFQA 4L0YB 1HKTA 1REPC 2M45A 1U2WA 4A0XA 2RNJA 2HKXA 1FWZA 5D4RA 3RTRA 1T2KA 2Z99A 1GXPA 3M1EA 3U2RA 4LLLA 1YQAA 4EGZA 1B6AA 4HX8A 2IJLA 2K86A 4WCGA 5E1XA 1MJBA 5FFXA 2OA4A 3IKVA 4D0PA 2NNYA 2HYFA 1YYVA 4FHTA 4I09A 2Z3YA 4ENMA 3IWZA 1KGSA 2GIVA 2ISYA 1IXSB 2K7LA 2EFWA 3HSEA 2V9VA 3HRSA 1WRJA 4KA4A 4EJTA 5FD5A 4CYDA 2YX4A 1WWXA 2TDXA 4I0BA 1S29A 2LNBA 1EH8A 2AXLA 3F8CA 3KLNA 2Z33A 3RPUA 2D1VA 4QLCU 4EM0B 2ISZA 2L4MA 4BXUA 4BHBA 4RB0A 2FE3A 1U5TA 1T0FA 4AWXB 3JTHA 3BOQA 1K6OA 5CVJA 2FBKA 1LQ1A 2HZTA 1I27A 4CZZA 3T1BA 1VTNC 1F4KA 4MQ9F 4R8HA 1I1GA 2FA5A 3ECHA 2H27A 2W25A 1T6SA 4FX4A 3FXUA 3J81Z 1FLIA 4F7ZA 1QZYA 3ZPLA 2QLZA 4XLNF 1X3UA 2XASA 1FP2A 3ERED 5JVTA 4U7BA 3FMRA 2ZJ2A 4G7OF 2WV0A 3Q9SA 5HOOA 1ZG3A 4MTDA 3DF8A 3M7GA 4YIFA 2DAOA 1BOAA 2HYGD 5IT3A 2MA3A 3G3ZA 4ESFA 3N97A 4RAZA 5D4SA 2QVOA 3BPXA 3IRRA 3FHZA 4I7HA 1GVJA 2J5PA 2WWYA 1TQMA 2QQBA 4G9YA 5L3FA 2IRFG 5FLXZ 1MGTA 3P7NA 4XSZF 5DCFA 2P5LC 3WODF 4PCQA 3OOPA 1IAWA 3FM5A 2XRNA 2CYYA 5A2QK 3NEUA 4U7DA 1PP8F 5DUIA 2NS0A 2FSWA 1RI7A 3FMQA 4M74A 1XSDA 4CO8A 2DI3A 4HV5A 3F72A 4YIIA 3GW2A 2A6HF 5D5UB 2ZFWA 2FNAA 4N9HA 3E3VA 2O0YA 2A6EF 2VT3A 1AWCA 1ZG1A 3HTSB 3I5UA 2DQRA 2VOPA 2G7HA 3O6BB 2P8TA 5BPIA 2EB7A 3F8NA 1FX7A 2EWNA 5DD8A 4R1HA 4WK8F 1P4WA 5DYMA 3TOAA 2JTVA 2QUFA 3TDZC 3RKYA 2A07F 4BNCA 2ZKZA 1S7OA 2GXBA 3CUQC 5LBQA 3M8EA 5TJJA 3S2WA 2UXXA 1TBXA 3ULQB 1IW7F 1ZG5A 3PQKA 2PLYA 2ETHA 2OQRA 4XRFA 2QBYB 3ZMDA 4U0VA 4KUMA 2NYXA 5L3CA 4EQQA 2L02A 3D0SA 4OINF 5E18F 3BY6A 4JQFA 5ILSA 3WTXC 1SMYF 2HGCA 2Z9OA 4I2OA 2KIFA 2Q0OA 2XAHA 5BOXA 3HRTA 1XSVA 3JAMZ 2R7DA 2IA0A 1V4RA 1HXDA 3V7RA 1IUYA 3JSOA 4I0AA 2PMUA 2Q8KA 1CF7A 3QOPA 3PQJA 2QM3A 4LMYA 3MQ0A 5LHHA 1G3SA 4MEXF 5FD6A 1G6NA 3GFLA 3IHUA 2W24A 3VFZA 5J8FA 3LAJA 1R1VA 1R1TA 1O3RA 4YFKF 1J59A 2O61A 3CUOA 4GGGA 3L2CA 2VT2A 4ZZLA 1YS6A 3ECOA 3ZP5A 2K4BA 1ONVA 3RYRA 2M5WA 2HQNA 5HS8A 1WI9A 4LD5A 2IP2A 3M8FA 4EJVA 2QQ9A 2OQGA 1R58A 5HLGA 3EDPA 1UCRA 1R1UA 3L9FA 1P4AA 3GYHX 2L01A 2XGXA 5HLHA 2ZO4A 2HR3A 1LJ9A 1LEAA 2DW4A 5EEHA 1YLFA 1ZHFA 4HYEA 2HFHA 1W7PA 2RKHA 3WTZA 1ZH5A 1ZLKA 3K2ZA 2BBYA 2ZMEB 1S3JA 2O8XA 2MLGA 2DTRA 1FY7A 3WTTC 2R7FA 1XCBA 4CHUA 4M6YA 3LSTA 1U8RA 1QO0D 2HS5A 3VEPA 1A04A 4XLPF 5L3BA 2MBFA 4ENNA 2XV4S 5TRDA 3O3KA 2H94A 5LHGA 5FB2A 3G73A 1SFEA 2UZKA 1BI1A 2H09A 5FFZA 1MZBA 1FYKA 4G7ZF 5D6FA 3B02A 5IT9Z 1HSJA 2XAFA 3T5XA 5JI6A 2OAZA 1LVAA 3HYIA 4UVBA 1FBQA 1S7AA 1Z7UA 4O5VA 3RI4A 1K78A 3QU6A 4YFNF 1ZLJA 3JSPA 1IN7A 2ESHA 3LQRA 1ZARA 3ZMSA 3EQLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W85 A;  1MKM A;  2RVC A;  5HVQ C;  2PG4 A;  1V3F A;  3I58 A;  2PMH A;  2OD5 A;  3BJ6 A;  4UV9 A;  4RB3 C;  3ABU A;  2A3S A;  4ZZD A;  3FZV A;  4MEY F;  3I71 A;  3HSF A;  4L9N A;  2F5E A;  2V1D A;  1U5T C;  1XMA A;  2Y0M A;  2A61 A;  2FU4 A;  4WX9 A;  1FBU A;  1DPU A;  5DV5 A;  2VBZ A;  1UFM A;  2LKP A;  4G6Q A;  2W57 A;  5LGT A;  1R5G A;  3Q9V A;  1ULY A;  3E6M A;  4WXH A;  1FYM A;  1B9N A;  5L3E A;  4GYI A;  1D8K A;  2HWV A;  4S04 A;  1FZP B;  4I01 A;  3WGH A;  4RGS A;  2IA1 A;  1FT9 A;  1F9N A;  3BRO A;  5BMZ A;  3ZN1 A;  3DFG A;  1MD0 A;  1OR7 A;  3ML6 A;  4DQ2 A;  4A0Z A;  1TTY A;  3IL2 A;  4Q47 A;  1O57 A;  1NHA A;  1WKM A;  3WU1 B;  1G4D A;  4HLY A;  5L3D A;  5DD4 A;  4HLX A;  1TNS A;  5H6R A;  3F8B A;  1XSX A;  4OIQ F;  2H6B A;  3HHG A;  3KP6 A;  3ELK A;  3I4P A;  4GYG A;  5JFR A;  4EJO A;  1OYI A;  5L3G A;  2ZNZ A;  3L7W A;  2O3F A;  3HRM A;  2EJR A;  2E1C A;  1LDJ A;  1JE8 A;  2LF8 A;  4CDG A;  3KP4 A;  4BHP A;  1IXR C;  5D5X B;  4ZYE A;  4CGZ A;  1J7K A;  1UST A;  2RQP A;  3ISP A;  5ICE A;  4KMF A;  4IXA A;  1XGN A;  3L00 A;  3ZQ7 A;  5DUK A;  3RKW A;  1C0W A;  4OMZ A;  4XBF A;  3W6J B;  2FXA A;  1R5H A;  3KE2 A;  2VE8 A;  2CWE A;  4P9U A;  2DT5 A;  1YW8 A;  3MEX A;  1I5Z A;  3FXR A;  3SHF A;  4XSX F;  3F22 A;  4CXF A;  2D45 A;  2NRA C;  3E5X A;  5CLS A;  1ON2 A;  1HBX G;  2KJC A;  2IA2 A;  2XAQ A;  3IRQ A;  2GZW A;  2GWR A;  3ZMT A;  3CUQ B;  2A69 F;  2CSO A;  1RNL A;  4HX7 A;  1L0O C;  2VXZ A;  2X4H A;  3BDD A;  4I02 A;  3EYY A;  1AOY A;  2E1N A;  3WGG A;  1HW5 A;  1E2X A;  4LG0 A;  4WXD A;  3GZ6 A;  3P9I A;  1HW1 A;  3V7C A;  3R0J A;  4OOI A;  3FMS A;  1KA8 A;  2R3S A;  1Z05 A;  4WXC A;  5DDG A;  3FF5 A;  4A2U A;  2BE5 F;  3EET A;  5AIP A;  2QYO A;  2P6S A;  2FEZ A;  3MZY A;  1YO5 C;  1S8N A;  2RV8 A;  1K79 A;  1BC7 C;  4LGW A;  1DDN A;  3R60 A;  1R36 A;  3GUD A;  2JSC A;  3QU3 A;  2K4J A;  1XMK A;  4JBA A;  3GX4 X;  1O7F A;  5LLQ A;  1XGS A;  3WTW C;  3SQN A;  1U3E M;  3BPV A;  3DPL C;  2FBI A;  1BIB A;  1S6L A;  4RS8 A;  3PFI A;  3DPT A;  2W84 A;  4IVN A;  1SD5 A;  4UV8 A;  2CQK A;  5D8L B;  3RYP A;  3QRF F;  5LEK A;  3HRU A;  1XB4 A;  1EV7 A;  2K02 A;  3ZMU A;  3GVA A;  4AIJ A;  1STZ A;  4G7H F;  1PUE E;  2CO5 A;  5KVR A;  4Q48 A;  2VOD A;  1G3W A;  2QWW A;  3R61 A;  4OU0 A;  1YTY A;  5FO5 A;  3K1M A;  4AVP A;  5ILV A;  4A5M A;  2G9W A;  1R00 A;  2JT1 A;  1YIO A;  2EFP A;  3WGI A;  1IXC A;  2VOO A;  2HOE A;  4UVC A;  3T0Y A;  5ED4 A;  2KIM A;  2Q2E A;  3ZN0 A;  6PAX A;  4ASN A;  1Z6R A;  5HDN A;  1J0R A;  2COM A;  5HDG A;  2IT0 A;  1SD7 A;  3TO7 A;  3ROU A;  1J9I A;  1FSE A;  1SD4 A;  2BEO A;  5D6E A;  4HQE A;  3I59 A;  4HF0 A;  4M71 A;  3JW4 A;  1LB2 A;  2XAJ A;  4BQA A;  1HST A;  1O3S A;  2VBX A;  1UHW A;  3K9T A;  2P5V A;  1E17 A;  3U9G A;  2F5C A;  1HKS A;  4A5N A;  4IRI A;  3F3X A;  2V1U A;  2GA1 A;  4A6D A;  4FT8 A;  1DPR A;  5ICC A;  4KT5 C;  5DCM B;  4BH9 A;  4PGG A;  2X0L A;  1H0M A;  3M9A A;  3J81 K;  4LLN A;  1RUN A;  2QEN A;  3TO9 A;  3WU0 A;  2XVC A;  1Y0U A;  1BBY A;  3CLO A;  1BJA A;  4B8X A;  1OYW A;  1F1Z A;  1B9M A;  3P9C A;  1I1S A;  3WTU C;  4IRG A;  4GO1 A;  3VB2 A;  4P96 A;  3RDI A;  4HA8 A;  3H3Z A;  2PN6 A;  2XHK A;  4U0W A;  1FPQ A;  3GXO A;  1T98 A;  4Q4Z F;  5FLX K;  4KN7 X;  4HBL A;  4M6X A;  4EJW A;  2XKP A;  2JZY A;  2FMY A;  2FQ3 A;  4HX4 A;  2QZ8 A;  2C6Y A;  1JHF A;  3GF2 A;  3E97 A;  3HSR A;  2BGC A;  2DO7 A;  4Y17 A;  5CVV A;  5LRS A;  2Y48 A;  2MH9 A;  2L3D A;  3MFK A;  1H9G A;  2FF4 A;  4MNU A;  1ZGJ A;  2LF7 A;  1U5T B;  2BV6 A;  1H9T A;  2RDP A;  5AIQ A;  3KET A;  1FP1 D;  5HS9 A;  1TLH B;  5K5O A;  3TO6 A;  3ZMV A;  4MQV A;  3TQN A;  2D2W A;  2HKO A;  4ETS A;  1SMT A;  3CDH A;  3BJA A;  3BJO A;  3C1D A;  5K5R A;  2VC0 A;  5AON A;  3LFK A;  2XAG A;  4KIG A;  3KZY A;  4G8X A;  4KIB A;  3D5L A;  3NQO A;  3VOD A;  4RGU A;  2NAZ A;  3V8L A;  1YFH A;  3KEQ A;  1RUO A;  3GLX A;  4NQW A;  5D5V B;  1B4A A;  3EYI A;  3IC7 A;  1KYW A;  2PI0 A;  1ZRC A;  2ADU A;  4HF1 A;  2CGP A;  1ZYR F;  3HUG A;  3CO6 C;  4ESJ A;  2HDC A;  1KQ8 A;  4Q5S F;  4AIH A;  3LQQ A;  5CYV A;  2F2E A;  3IWF A;  2EV0 A;  2A68 F;  2JPC A;  4KDP A;  1YS7 A;  3HIF A;  1ON1 A;  1IN5 A;  3KZZ A;  3RJP A;  3J7A O;  3JAM K;  1Q1H A;  4UHT A;  2A5Y B;  2M87 A;  5LGN A;  1TW2 A;  1JHH A;  1SD6 A;  4MTE A;  2F5D A;  1J5Y A;  1ZRF A;  4PDK A;  4IHS A;  1RZ4 A;  3GO5 A;  1BM9 A;  1W7P D;  3E6D A;  3WG9 A;  3WTY C;  1HQC A;  4M73 A;  1FSH A;  1P4X A;  2OBP A;  5H20 A;  1ZN2 A;  5BQT A;  4U0Y A;  5EEG A;  5H6Q A;  2P7C B;  3U1D A;  3MZH A;  1IF1 A;  5JHU A;  1B1B A;  3VOE A;  1OYY A;  3SXY A;  1KQ9 A;  2IW5 A;  3H92 A;  5LRR A;  4MGR A;  4OIP F;  3REO A;  5D8K B;  4A12 A;  2QBY A;  1U78 A;  1GHC A;  4L5J A;  1YW7 A;  3KP2 A;  4KYW A;  2YR2 A;  1D3Y A;  3F8M A;  3OV8 A;  3RPQ A;  1BIA A;  3ABT A;  1FNN A;  3T8R A;  4U88 A;  2WTE A;  1I6X A;  4BAY A;  3CO7 C;  1USS A;  1HW2 A;  3WTS C;  3KFW X;  3WE2 A;  5LEJ A;  1SFX A;  2E7W A;  2V6C A;  3K1N A;  1XGO A;  4BYY A;  1G3Y A;  2XIG A;  1XDU A;  3GEZ A;  3KCC A;  1YG2 A;  4QWQ A;  1CF7 B;  2VN2 A;  4NHJ A;  2VBW A;  4UXN A;  1OKR A;  4ZH4 F;  1O7L A;  4DNC A;  5ILU A;  1R23 A;  3J80 Z;  2H6C A;  3V7S A;  1MDM A;  3DEU A;  4ESB A;  2IPQ X;  4TV7 A;  5IT9 K;  3R6S A;  1LNW A;  4LK0 F;  5HS7 A;  3COA C;  2DK5 A;  3HOT A;  1UHM A;  1R22 A;  4RGX A;  2P4W A;  3LAP A;  1XCV A;  1QGP A;  3SZP A;  2ZXJ A;  1FBS A;  1L3L A;  1W5T A;  2LDU A;  5HLI A;  1BI0 A;  5ERI A;  1T39 A;  1DP7 P;  2Z5U A;  1QBJ A;  4AD9 A;  3E6C C;  4EJU A;  5FGM A;  3ZMZ A;  3BWG A;  3LWF A;  4A6E A;  3O2P E;  3I54 A;  5E1W A;  4N9I A;  3MCZ A;  5J8C A;  2JPB A;  2ZME A;  1W7P B;  2J5O A;  1QPM A;  4OMY A;  1T38 A;  5J6X A;  1JGS A;  2GAU A;  2MD5 A;  2STW A;  4NB5 A;  4RB2 C;  2PQ8 A;  2ZCW A;  1ZRD A;  3GFI A;  2RC4 A;  1QNT A;  3TDU C;  1Z1D A;  2O03 A;  4IJA A;  4KIC A;  3RIR A;  4L18 B;  2VE9 A;  2O6G E;  4WF2 A;  1J75 A;  2B0L A;  2P7V B;  2KJB A;  4HAM A;  4KN4 X;  4GXO A;  4M9S A;  3WTV C;  4N0B A;  3I64 A;  3TOB A;  5E17 F;  1K78 B;  3AAF A;  4Y15 A;  3K0L A;  4M9X A;  3FX3 A;  4RGR A;  5KK1 A;  3V8K A;  4LB6 B;  1G3T A;  4UVA A;  3JTG A;  4KNY A;  4G94 A;  5F6F A;  5K5Q A;  1F5T A;  4HF2 A;  2EK5 A;  4HV6 A;  1KU7 A;  3BZ6 A;  2FML A;  2E7X A;  4L9T A;  1EH6 A;  4HDV A;  4S05 A;  3KP7 A;  5CJ9 A;  3CJN A;  5F1R A;  3DV8 A;  2AS5 F;  1OMI A;  1XD7 A;  1OPC A;  2XKO A;  4EM1 A;  5HDK A;  2KKO A;  2EA2 A;  3GFJ A;  2YPR A;  2DPD A;  4UNO A;  3GFM A;  3QP5 A;  3I53 A;  3B73 A;  3KP3 A;  3J80 K;  5ICF A;  4HDU A;  4KFC A;  1FC3 A;  4KIF A;  1WQ2 A;  2Y75 A;  1J2X A;  4EMS A;  1LDD A;  4ON0 A;  2PFB A;  3WE3 A;  4I98 B;  2CW0 F;  4P5O A;  3KLO A;  2CG4 A;  1QQI A;  2WC2 A;  3P9K A;  2HQR A;  4EVI A;  1TQP A;  3QP6 A;  3QPH A;  5BS6 A;  2XRO A;  1BI2 A;  4RAY A;  2D1H A;  2DU9 A;  3F6O A;  4AIK A;  5CVU A;  2EFO A;  4PGH A;  5F64 A;  3MWM A;  2ESN A;  4GCV A;  4ENK A;  1JXS A;  2YU3 A;  1EH7 A;  4LK1 F;  2UXN A;  3E5Q A;  2CFX A;  3C3W A;  2DLL A;  5CVI A;  4Z2Y A;  1Z91 A;  1W4M A;  2MC3 A;  4LJZ F;  2V79 A;  1R7J A;  5BPD A;  2GXG A;  5DEQ A;  4L9V A;  2GQQ A;  1BI3 A;  1P92 A;  4L5I A;  4KMU X;  4HQM A;  2VC1 A;  3K69 A;  4OIO F;  1Z6T A;  2YX7 A;  4ZYD A;  1PDN C;  4HZF A;  2L4A A;  2MLK A;  4K2E A;  2VON A;  4CIC A;  4IPA A;  2PJP A;  4FX0 A;  4M9Z A;  3SFZ A;  4A0Y A;  4E70 A;  3SZT A;  2ZBK A;  2PBI A;  3FM3 A;  2OU2 A;  1QZZ A;  1MDM B;  1SAX A;  3EUH A;  3F21 A;  2DFI A;  5E8I A;  1ZGA A;  4LFU A;  3GWZ A;  2G7U A;  3CTA A;  5E20 A;  4BHC A;  1XDS A;  4YFX F;  3HHH A;  2M1B A;  4MHG A;  4PZJ A;  2QQA A;  3LA3 A;  4EM2 A;  3HOS A;  2NNN A;  4OIR F;  3LA7 A;  2ACJ A;  2FBH A;  2MH2 A;  3QAH A;  2STT A;  2UWM A;  3F8F A;  1Z9C A;  2BYV E;  3IKT A;  1CGP A;  5E1Z B;  4RB1 A;  1WSU A;  4JK1 X;  3CUQ A;  2HTJ A;  4YG2 F;  5LGU A;  2DBB A;  2ELH A;  4P9F A;  1IN6 A;  1GXQ A;  2KIU A;  1LEB A;  3V8J A;  1KU2 A;  2OZU A;  3H3U A;  3KEO A;  1D5V A;  3KP5 A;  3FWE A;  1O3T A;  4P55 A;  1W5S A;  4LG0 B;  1B59 A;  4H0E A;  1IZ1 A;  2F5F A;  3W6K B;  4G6D A;  1IN8 A;  5JR3 A;  3R0A A;  2HTS A;  3FXQ A;  3QPT A;  3F6V A;  1IRG A;  2XUB A;  4Y13 A;  2DQL A;  5K1Y A;  3NRV A;  1HKQ A;  3E5U A;  1TW3 A;  1ZAO A;  1U6G A;  2M30 A;  1DUX C;  2FOK A;  1XN7 A;  4LB5 A;  1FOK A;  3TGN A;  1KQ0 A;  1KU3 A;  3LA2 A;  3N4M A;  2EA4 A;  4UUV A;  3F23 A;  4IHT A;  3L09 A;  2ZNY A;  2OZ6 A;  1MJA A;  3TKY A;  1P2F A;  2K27 A;  3I0T A;  1LDK B;  2YSR A;  3V4G A;  1P6R A;  1YW9 A;  2DK8 A;  1MJ9 A;  3HTU A;  4R79 A;  2P6T A;  3MAJ A;  3GZ5 A;  3C18 A;  3DKW A;  2L54 A;  4L0Z B;  2P5K A;  4O6J A;  1BC8 C;  2DPU A;  5LHI A;  2LSO A;  2M8E A;  2FRH A;  2EFN A;  1IN4 A;  1FYL A;  1D8J A;  3Q5F A;  3DQV C;  4HW0 A;  5CVR A;  4L9J A;  4B09 A;  4O3M A;  1O3Q A;  1ZRE A;  4LLG F;  1TNT A;  1RIO H;  2FNP A;  2HEO A;  2VBY A;  2PEX A;  2KRF A;  3E6B A;  3C7J A;  1K7A A;  1UB9 A;  1KU9 A;  3BP8 A;  1XGM A;  1KYZ A;  3K1P A;  2GA2 A;  5D5W B;  4M72 A;  2RGV A;  2V1X A;  1IRF A;  3I59 B;  3DXJ F;  2EV6 A;  4ENJ A;  3R4K A;  4WWC A;  1PP7 U;  4IRH A;  1TQI A;  1ODD A;  3RKX A;  4EGY A;  2EV5 A;  1BN5 A;  4EV0 A;  3DP7 A;  4ZYH A;  5A2Q Z;  1SFU A;  3T8T A;  5E8G A;  4IF4 A;  4ZYG A;  5ICG A;  5DCM A;  2RN7 A;  4HOB A;  2IVM A;  2JRT A;  2EFQ A;  4L0Y B;  1HKT A;  1REP C;  2M45 A;  1U2W A;  4A0X A;  2RNJ A;  2HKX A;  1FWZ A;  5D4R A;  3RTR A;  1T2K A;  2Z99 A;  1GXP A;  3M1E A;  3U2R A;  4LLL A;  1YQA A;  4EGZ A;  1B6A A;  4HX8 A;  2IJL A;  2K86 A;  4WCG A;  5E1X A;  1MJB A;  5FFX A;  2OA4 A;  3IKV A;  4D0P A;  2NNY A;  2HYF A;  1YYV A;  4FHT A;  4I09 A;  2Z3Y A;  4ENM A;  3IWZ A;  1KGS A;  2GIV A;  2ISY A;  1IXS B;  2K7L A;  2EFW A;  3HSE A;  2V9V A;  3HRS A;  1WRJ A;  4KA4 A;  4EJT A;  5FD5 A;  4CYD A;  2YX4 A;  1WWX A;  2TDX A;  4I0B A;  1S29 A;  2LNB A;  1EH8 A;  2AXL A;  3F8C A;  3KLN A;  2Z33 A;  3RPU A;  2D1V A;  4QLC U;  4EM0 B;  2ISZ A;  2L4M A;  4BXU A;  4BHB A;  4RB0 A;  2FE3 A;  1U5T A;  1T0F A;  4AWX B;  3JTH A;  3BOQ A;  1K6O A;  5CVJ A;  2FBK A;  1LQ1 A;  2HZT A;  1I27 A;  4CZZ A;  3T1B A;  1VTN C;  1F4K A;  4MQ9 F;  4R8H A;  1I1G A;  2FA5 A;  3ECH A;  2H27 A;  2W25 A;  1T6S A;  4FX4 A;  3FXU A;  3J81 Z;  1FLI A;  4F7Z A;  1QZY A;  3ZPL A;  2QLZ A;  4XLN F;  1X3U A;  2XAS A;  1FP2 A;  3ERE D;  5JVT A;  4U7B A;  3FMR A;  2ZJ2 A;  4G7O F;  2WV0 A;  3Q9S A;  5HOO A;  1ZG3 A;  4MTD A;  3DF8 A;  3M7G A;  4YIF A;  2DAO A;  1BOA A;  2HYG D;  5IT3 A;  2MA3 A;  3G3Z A;  4ESF A;  3N97 A;  4RAZ A;  5D4S A;  2QVO A;  3BPX A;  3IRR A;  3FHZ A;  4I7H A;  1GVJ A;  2J5P A;  2WWY A;  1TQM A;  2QQB A;  4G9Y A;  5L3F A;  2IRF G;  5FLX Z;  1MGT A;  3P7N A;  4XSZ F;  5DCF A;  2P5L C;  3WOD F;  4PCQ A;  3OOP A;  1IAW A;  3FM5 A;  2XRN A;  2CYY A;  5A2Q K;  3NEU A;  4U7D A;  1PP8 F;  5DUI A;  2NS0 A;  2FSW A;  1RI7 A;  3FMQ A;  4M74 A;  1XSD A;  4CO8 A;  2DI3 A;  4HV5 A;  3F72 A;  4YII A;  3GW2 A;  2A6H F;  5D5U B;  2ZFW A;  2FNA A;  4N9H A;  3E3V A;  2O0Y A;  2A6E F;  2VT3 A;  1AWC A;  1ZG1 A;  3HTS B;  3I5U A;  2DQR A;  2VOP A;  2G7H A;  3O6B B;  2P8T A;  5BPI A;  2EB7 A;  3F8N A;  1FX7 A;  2EWN A;  5DD8 A;  4R1H A;  4WK8 F;  1P4W A;  5DYM A;  3TOA A;  2JTV A;  2QUF A;  3TDZ C;  3RKY A;  2A07 F;  4BNC A;  2ZKZ A;  1S7O A;  2GXB A;  3CUQ C;  5LBQ A;  3M8E A;  5TJJ A;  3S2W A;  2UXX A;  1TBX A;  3ULQ B;  1IW7 F;  1ZG5 A;  3PQK A;  2PLY A;  2ETH A;  2OQR A;  4XRF A;  2QBY B;  3ZMD A;  4U0V A;  4KUM A;  2NYX A;  5L3C A;  4EQQ A;  2L02 A;  3D0S A;  4OIN F;  5E18 F;  3BY6 A;  4JQF A;  5ILS A;  3WTX C;  1SMY F;  2HGC A;  2Z9O A;  4I2O A;  2KIF A;  2Q0O A;  2XAH A;  5BOX A;  3HRT A;  1XSV A;  3JAM Z;  2R7D A;  2IA0 A;  1V4R A;  1HXD A;  3V7R A;  1IUY A;  3JSO A;  4I0A A;  2PMU A;  2Q8K A;  1CF7 A;  3QOP A;  3PQJ A;  2QM3 A;  4LMY A;  3MQ0 A;  5LHH A;  1G3S A;  4MEX F;  5FD6 A;  1G6N A;  3GFL A;  3IHU A;  2W24 A;  3VFZ A;  5J8F A;  3LAJ A;  1R1V A;  1R1T A;  1O3R A;  4YFK F;  1J59 A;  2O61 A;  3CUO A;  4GGG A;  3L2C A;  2VT2 A;  4ZZL A;  1YS6 A;  3ECO A;  3ZP5 A;  2K4B A;  1ONV A;  3RYR A;  2M5W A;  2HQN A;  5HS8 A;  1WI9 A;  4LD5 A;  2IP2 A;  3M8F A;  4EJV A;  2QQ9 A;  2OQG A;  1R58 A;  5HLG A;  3EDP A;  1UCR A;  1R1U A;  3L9F A;  1P4A A;  3GYH X;  2L01 A;  2XGX A;  5HLH A;  2ZO4 A;  2HR3 A;  1LJ9 A;  1LEA A;  2DW4 A;  5EEH A;  1YLF A;  1ZHF A;  4HYE A;  2HFH A;  1W7P A;  2RKH A;  3WTZ A;  1ZH5 A;  1ZLK A;  3K2Z A;  2BBY A;  2ZME B;  1S3J A;  2O8X A;  2MLG A;  2DTR A;  1FY7 A;  3WTT C;  2R7F A;  1XCB A;  4CHU A;  4M6Y A;  3LST A;  1U8R A;  1QO0 D;  2HS5 A;  3VEP A;  1A04 A;  4XLP F;  5L3B A;  2MBF A;  4ENN A;  2XV4 S;  5TRD A;  3O3K A;  2H94 A;  5LHG A;  5FB2 A;  3G73 A;  1SFE A;  2UZK A;  1BI1 A;  2H09 A;  5FFZ A;  1MZB A;  1FYK A;  4G7Z F;  5D6F A;  3B02 A;  5IT9 Z;  1HSJ A;  2XAF A;  3T5X A;  5JI6 A;  2OAZ A;  1LVA A;  3HYI A;  4UVB A;  1FBQ A;  1S7A A;  1Z7U A;  4O5V A;  3RI4 A;  1K78 A;  3QU6 A;  4YFN F;  1ZLJ A;  3JSP A;  1IN7 A;  2ESH A;  3LQR A;  1ZAR A;  3ZMS A;  3EQL F; 
#chains in the Genus database with same CATH topology
 2QA4 I;  4OAZ A;  2W85 A;  3CME I;  1MKM A;  2KDZ A;  2ECC A;  3L2R A;  2RVC A;  1U9N A;  5J4V A;  3PO2 J;  5HVQ C;  2PG4 A;  1OQY A;  1WPK A;  1BL0 A;  2IAI A;  2K3F A;  1V3F A;  3I58 A;  2PMH A;  3DBL B;  2OD5 A;  3BJ6 A;  4UV9 A;  4RB3 C;  2EIN H;  4ZTF A;  3QOE A;  2KL4 A;  1N25 A;  3ABU A;  2A3S A;  5IYB J;  4CH7 A;  4ZZD A;  3FZV A;  5BNG A;  3CC2 I;  1YHQ I;  4MEY F;  1T33 A;  3OS1 A;  3I71 A;  3HSF A;  4L9N A;  1N77 A;  2F5E A;  1U0J A;  2H8R A;  2L7K A;  2V1D A;  4XRS A;  1U5T C;  2CRG A;  2KZG A;  4D1Q A;  1XMA A;  2Y0M A;  2ZXW H;  1FOX A;  2A61 A;  3K4N A;  1PVE A;  2FU4 A;  2V9P A;  5HOD A;  4JYK A;  5B66 C;  4ANJ A;  3GTO J;  4XK4 A;  4WX9 A;  3OYA A;  1FBU A;  2DXI A;  1DPU A;  5DV5 A;  2VBZ A;  1UFM A;  3OL3 A;  1GDT A;  1QPI A;  3JRB A;  2LKP A;  1OCP A;  4G6Q A;  2W57 A;  4V2F A;  4LOC A;  5GTH C;  1RES A;  3CZ6 A;  3S15 J;  3PFY A;  5LGT A;  4C2U A;  1R5G A;  3Q9V A;  3ONQ A;  4XID A;  1ULY A;  3E6M A;  2GM4 A;  4WXH A;  1FYM A;  1B9N A;  5L3E A;  4PJ0 C;  4F93 B;  4GYI A;  1D8K A;  4D5C A;  2NS7 A;  2HWV A;  3S93 A;  4S04 A;  2KMU A;  1FZP B;  1DQU A;  4I01 A;  4ZDL A;  2R7U A;  3DPU A;  3WGH A;  1BR4 A;  4RGS A;  2IA1 A;  1RKW A;  1FT9 A;  1X4P A;  5F0H A;  3OIP A;  3BRO A;  1F9N A;  1VQ7 I;  5BMZ A;  1ACI A;  2AHQ A;  3ZN1 A;  2QGU A;  5EJC A;  3K70 C;  3DFG A;  1MD0 A;  1OR7 A;  1SFO J;  2BOL A;  4E7I A;  3ML6 A;  3GZN B;  4DQ2 A;  4A0Z A;  5H2F C;  2JA2 A;  1R71 A;  1Z0X A;  1TTY A;  3IL2 A;  4Q47 A;  1O57 A;  1NHA A;  1WKM A;  3CJT B;  3WU1 B;  2XGC A;  2AQF A;  1G4D A;  4HLY A;  4ZC3 A;  2ID6 A;  1Z77 A;  3PSI A;  5L3D A;  2LRE A;  2Y2Z A;  3W2V A;  3WU2 C;  5DD4 A;  4HLX A;  1K4T A;  1TNS A;  4XRS G;  4QSH A;  5K7F A;  5H6R A;  3MKL A;  3F8B A;  3X2Q H;  2XC7 A;  1XSX A;  2A6T A;  4OIQ F;  3HOW J;  2H6B A;  5M5X J;  3HHG A;  2B9S A;  1R4M B;  3KP6 A;  3ELK A;  3I4P A;  4GYG A;  5JFR A;  4EJO A;  3F9K A;  4J19 A;  1OYI A;  5L3G A;  2ZNZ A;  3L7W A;  2KLO A;  2O3F A;  4QIW N;  1XMX A;  1YI2 I;  3HRM A;  2EJR A;  1V5G A;  4PJJ A;  1LDJ A;  2E1C A;  1JE8 A;  2LF8 A;  4CDG A;  3JRC A;  3KP4 A;  4BAC A;  5KAI C;  4BHP A;  1IXR C;  3G6E I;  3OMY A;  2CV2 A;  4DGW B;  5D5X B;  4ZYE A;  4CGZ A;  1J7K A;  4C30 A;  1UST A;  2RQP A;  3ISP A;  5ICE A;  2LR8 A;  1HLV A;  3HGY A;  4KMF A;  4IXA A;  2HXI A;  1XGN A;  3GCM A;  3CCM I;  2F48 A;  2R7W A;  3L00 A;  4E7H A;  3ZQ7 A;  2OC6 A;  2RNG A;  5DUK A;  3RKW A;  1C0W A;  4Y52 J;  4OMZ A;  2DJI A;  4X0G A;  2O5R A;  4N4O B;  4XBF A;  3KEY A;  4YIR X;  3W6J B;  3I9V 2;  2FXA A;  4E7Z A;  1R5H A;  3KE2 A;  2R7X A;  3FXJ A;  4GRI A;  3Q3S A;  2UV1 A;  2VE8 A;  2CWE A;  3C2B A;  2Y0S N;  2CUZ A;  4P9U A;  1A6I A;  2DT5 A;  2OCC H;  3FBI B;  5J47 A;  1YW8 A;  2Y9Y A;  3MEX A;  1I5Z A;  1K61 A;  2DA5 A;  3FXR A;  5EGO A;  1ETK A;  3SHF A;  1WJF A;  4XSX F;  3F22 A;  1SVL A;  4CXF A;  2D45 A;  2NRA C;  3LSK A;  3DKY A;  3E5X A;  5CLS A;  3ZXS A;  1ON2 A;  5F27 A;  1JJ6 C;  2M7A A;  1HBX G;  5FLM J;  2KJC A;  2LD5 A;  3D1N I;  1ZQ3 P;  2IA2 A;  2HPI A;  2LLK A;  2DA4 A;  2XAQ A;  2XRL A;  3IRQ A;  2GZW A;  2GWR A;  3ZMT A;  3CUQ B;  1A35 A;  1EF4 A;  5DM7 F;  2A69 F;  4XOR A;  2CSO A;  1YRN B;  1RNL A;  4HX7 A;  2ICW G;  3KYC B;  3QOD A;  2ME6 A;  1L0O C;  3DTK A;  2VXZ A;  2X4H A;  3BDD A;  4I02 A;  2WAQ A;  3LFU A;  3EYY A;  2FQ4 A;  2L7M P;  3K4J A;  3ZCO A;  1AOY A;  1S9H A;  2E1N A;  3PSF A;  3WGG A;  1HW5 A;  4BQQ A;  1E2X A;  4LG0 A;  4WXD A;  1W36 C;  1U8B A;  2VJJ A;  3GZ6 A;  3P9I A;  4Y3O A;  1HW1 A;  3V7C A;  3R0J A;  4OOI A;  3BT9 A;  3FMS A;  3PIO F;  1D1C A;  1KA8 A;  4AYB A;  2R3S A;  3KPH A;  1Z05 A;  4WXC A;  5DDG A;  2I5U A;  3FF5 A;  4A2U A;  2BE5 F;  2Y9Z A;  3EET A;  3SEZ A;  1VI0 A;  5AIP A;  2QYO A;  2P6S A;  2FEZ A;  3OSG A;  4D7N A;  3S1R J;  3MZY A;  1ENH A;  1UG2 A;  1YO5 C;  1S8N A;  2RV8 A;  3BR1 A;  1K79 A;  4ZJZ A;  3HXL A;  4P1W A;  2H1L A;  4FQG A;  5M3F J;  1BC7 C;  4LGW A;  1DDN A;  3R60 A;  2PX9 A;  4NDL A;  4CCJ A;  1R36 A;  3GUD A;  2JSC A;  3SYT A;  3OYF A;  2QSG X;  3E7L A;  1IV8 A;  3QU3 A;  4Y7N J;  4EEF G;  2K4J A;  2LYC A;  1XMK A;  1Y1V J;  4JBA A;  3GX4 X;  1O7F A;  3G4S I;  3HC7 A;  5LLQ A;  1XGS A;  3I3L A;  3WTW C;  3SQN A;  5LD2 C;  2NVX J;  4OWR B;  1U3E M;  2WY8 Q;  2L9R A;  3NAR A;  4FE4 A;  4BL0 B;  3RPU D;  3BPV A;  2W82 A;  3DPL C;  2FBI A;  1BIB A;  3DTE A;  3A01 B;  1S6L A;  4RS8 A;  3PFI A;  2UUZ A;  4UY8 I;  3DPT A;  2W84 A;  4C3I J;  2M34 A;  4IVN A;  5IOZ A;  2R7R A;  1SD5 A;  3HJE A;  4UV8 A;  3HM5 A;  3DU6 A;  3PNY A;  1J09 A;  4E7L A;  4XKB A;  1FMV A;  1YJW I;  2CQK A;  4XOT A;  2R7Z J;  5D8L B;  5CQE A;  4IHV A;  2QF7 A;  3RYP A;  2HVQ A;  3QRF F;  3PJR A;  5LEK A;  3H5R A;  3HRU A;  3AFH A;  3J7A Y;  1XB4 A;  1LFB A;  1EV7 A;  2K02 A;  3ZMU A;  3GVA A;  4PUS A;  4AIJ A;  2HU9 A;  2DFH A;  3HPG A;  5IP9 J;  1STZ A;  1PYV A;  2KHM A;  2MSY A;  4G7H F;  1PUE E;  2BY1 A;  2CO5 A;  5KVR A;  2VAS A;  5EF6 A;  4Q48 A;  2VOD A;  1G3W A;  4AM3 A;  4EAT A;  4FCY A;  2QWW A;  3R61 A;  4OU0 A;  2P0W A;  1BW5 A;  1YTY A;  2CQ7 A;  5IY5 H;  5FO5 A;  1XPX A;  2RQQ A;  3K1M A;  3OIQ A;  4AVP A;  3HOY J;  5ILV A;  4Y4R A;  4A5M A;  3AG3 H;  1AKH A;  2G9W A;  1R00 A;  2JT1 A;  4F3Q A;  1YIO A;  2MFZ A;  3ZQL A;  2EFP A;  3WGI A;  2JWT A;  2X6Y A;  1IXC A;  2VOO A;  2VJI A;  1GV5 A;  2HOE A;  4UVC A;  3OYD A;  3T0Y A;  4KIS A;  5ED4 A;  2KIM A;  2R5Z A;  3QPS A;  1TL8 A;  4B4C A;  2Q2E A;  3ZN0 A;  2K9L A;  6PAX A;  4A69 C;  4ASN A;  1Z6R A;  5HDN A;  1J0R A;  2COM A;  4W97 A;  5HDG A;  4QTR A;  1YJ9 I;  2IT0 A;  3S1N J;  1SD7 A;  3TO7 A;  3ROU A;  3K70 D;  1J9I A;  2QSF X;  2EIK H;  1FSE A;  1SD4 A;  2BEO A;  5D6E A;  4HQE A;  3I59 A;  1LFU P;  5FRN A;  4XMY A;  2EBI A;  4HF0 A;  4M71 A;  3JW4 A;  4S0H B;  1LB2 A;  2XAJ A;  2CUJ A;  4PJM A;  4XQF A;  2DA1 A;  4BQA A;  1HST A;  3OYE A;  3CP2 A;  2VBX A;  5KNL A;  1O3S A;  1UHW A;  3K9T A;  2P5V A;  3JRD A;  1E17 A;  4HNV A;  3U9G A;  2F5C A;  2CV0 A;  2HDW A;  1HKS A;  4A5N A;  2CW8 A;  4IRI A;  1TWG J;  3F3X A;  3BG7 A;  2V1U A;  1IC8 A;  2GA1 A;  2HVS A;  2IS1 A;  4A6D A;  2HOA A;  1OIS A;  4FT8 A;  3TMO A;  2EH3 A;  1DPR A;  5M5W J;  3ZQH A;  3HDD A;  5ICC A;  4MO7 A;  4KT5 C;  2R0Q C;  5DCM B;  4BH9 A;  3CMM A;  4PGG A;  2CS3 A;  2X0L A;  4LIU A;  2QKM B;  1S7E A;  1E3P A;  3EUA A;  3M9A A;  1H0M A;  3J81 K;  2E34 A;  4IHW A;  3GTL J;  2DYR H;  4C3H J;  4LLN A;  1LE8 B;  1IDZ A;  5K7Z A;  2QEN A;  1RUN A;  3TO9 A;  4E7K A;  2RRE A;  3CCJ I;  3WU0 A;  4RBO A;  2XVC A;  1Y0U A;  4CYC A;  1BBY A;  1I39 A;  3CLO A;  1BJA A;  3FKJ A;  4B8X A;  1OYW A;  1QU3 A;  1F1Z A;  1B9M A;  3P9C A;  1MBJ A;  2F4I A;  2X85 A;  1QZE A;  2EQR A;  2BY3 A;  2K3P A;  1I1S A;  1GUU A;  2X51 A;  4XKW A;  2JA7 J;  3WTU C;  1S5L C;  4IRG A;  3HG9 A;  2VPL A;  4GO1 A;  3E1S A;  2HNH A;  3VB2 A;  4P96 A;  3LMM A;  3D5S C;  3UNG C;  3RDI A;  4HA8 A;  3H3Z A;  2PN6 A;  2XHK A;  4NC6 A;  4MFD A;  1Y39 A;  5TIS C;  3G2B A;  4U0W A;  3TP3 A;  1FPQ A;  3B6C A;  2LK2 A;  1T98 A;  3GXO A;  1NG6 A;  3TP0 A;  4Q4Z F;  3CMA I;  5M3M J;  3CCL I;  3K4B A;  5FLX K;  4KN7 X;  4HBL A;  4M6X A;  2NXN B;  3K4L A;  4EJW A;  2XKP A;  2JZY A;  1OCZ H;  1QRY A;  2FMY A;  2FQ3 A;  3BTI A;  2FX0 A;  4HX4 A;  4II2 A;  1VQM I;  2L5Q A;  2XAU A;  4G6T B;  3SZG A;  2TRT A;  2QZ8 A;  2C6Y A;  1JHF A;  3HB9 A;  4XNF A;  3GF2 A;  3E97 A;  4UB6 C;  5F0F A;  3CCR I;  3HSR A;  2BGC A;  1O4X A;  2BW3 B;  3GBG A;  3L2V A;  2DO7 A;  2LP0 A;  4Y17 A;  1T08 B;  4HEA 2;  2L2O A;  5CVV A;  5LRS A;  3ERM A;  4ZDO A;  2LBF A;  3L2Q A;  2Y48 A;  2MH9 A;  1YIT I;  2L3D A;  1Y6I A;  3MFK A;  1H9G A;  5M5Y J;  4XN3 A;  3A03 A;  2FF4 A;  4C2M J;  4MNU A;  4F91 B;  4NC7 A;  3WHC A;  1X58 A;  5CKT A;  4HNU A;  1ZGJ A;  2LF7 A;  3GTM J;  1U5T B;  2BV6 A;  5JLX A;  5DTD A;  4FTH A;  2DCE A;  3LSJ A;  4UUS A;  1H9T A;  3QYF A;  2RDP A;  2IGN A;  4IHY A;  5AIQ A;  3KET A;  1T8I A;  3CCS I;  3N05 A;  3MMY B;  1FP1 D;  5HS9 A;  3ABK H;  1TLH B;  5K5O A;  1WJA A;  4M6V A;  3TO6 A;  2KQR A;  1MBH A;  1SEU A;  2VQL A;  3ZMV A;  4MQV A;  3TQN A;  2D2W A;  2HKO A;  4ETS A;  3H0G J;  1SMT A;  4BU2 A;  3CDH A;  5C4X J;  3IH2 A;  3O8H A;  3BJA A;  1JTY A;  3BJO A;  3H35 A;  3C1D A;  1WJB A;  2OUM A;  5K5R A;  1LFP A;  2JSP A;  2OF7 A;  2VC0 A;  2E1M C;  5AON A;  2K40 A;  3LFK A;  2XAG A;  1SC7 A;  4KIG A;  1RC9 A;  3U21 A;  3VSK A;  1TT0 A;  3KZY A;  2LY9 A;  2K9S A;  2LY2 A;  4G8X A;  1PUF A;  2CUE A;  4G12 A;  1RKT A;  3DEE A;  4KIB A;  3D5L A;  3NQO A;  3VOD A;  4RGU A;  2NAZ A;  3V8L A;  1JKO C;  2F4O B;  4KT6 A;  4A3K J;  3KEQ A;  1YFH A;  3K4M A;  1RR7 A;  1RUO A;  3GLX A;  2WAQ N;  4NQW A;  5D5V B;  1B4A A;  4V19 K;  3EYI A;  3BR6 A;  2KP6 A;  3IC7 A;  2EPF A;  4IQJ A;  1KYW A;  3K6G A;  1B72 A;  2PI0 A;  1ZRC A;  2EIM H;  2ADU A;  4HF1 A;  2CGP A;  1ZYR F;  3H9Q A;  3PM1 A;  4B48 A;  4PFP A;  3HUG A;  4L5E A;  4BEH B;  3CO6 C;  2BVL A;  2DFE A;  4ESJ A;  2HDC A;  1KQ8 A;  4Q5S F;  4AYB N;  4AIH A;  1IRZ A;  3LQQ A;  2E60 A;  3IP4 B;  5CYV A;  3S1M J;  2F2E A;  3IWF A;  2EV0 A;  2A68 F;  4H4K C;  2VUM J;  2JPC A;  4KDP A;  1YS7 A;  1WHU A;  5J40 A;  3A2K A;  3HIF A;  1ON1 A;  3DEW A;  1WFX A;  1IN5 A;  1BR1 A;  3S3N A;  1ZR4 A;  3KZZ A;  3RJP A;  3J7A O;  3JAM K;  1Q1H A;  2BXY A;  3LOC A;  1M1E B;  4UHT A;  2VQH A;  2A5Y B;  3RQ4 A;  1P7J A;  5GAE J;  3H36 A;  2M87 A;  1HDP A;  1YX3 A;  2B63 J;  2AO9 A;  2E5Z A;  5LGN A;  1TW2 A;  1ZEL A;  2FD5 A;  3BR3 A;  4XLA A;  4M3D A;  2BY0 A;  1JHH A;  1SD6 A;  1LPQ A;  4MTE A;  2F5D A;  1JUS A;  4JX5 A;  1J5Y A;  4XKV A;  3OOU A;  4PDK A;  1ZRF A;  3LSH A;  4IHS A;  3CMY A;  1LKX A;  1RZ4 A;  3GO5 A;  1BM9 A;  1W7P D;  3E6D A;  3WG9 A;  2MYS A;  3WTY C;  1VQ6 I;  3CDI A;  1K4S A;  1HQC A;  2WB1 A;  4IEJ A;  4M73 A;  2JN6 A;  2WV1 A;  1MBE A;  3HGG A;  3S17 J;  1FSH A;  1P4X A;  2OBP A;  5E3O A;  3GTQ J;  5H20 A;  2E19 A;  1G2H A;  1ZN2 A;  4LIV A;  4CUG A;  2YU9 J;  5BQT A;  2QCO A;  3FK7 A;  1W0U A;  1Y0N A;  3C2G A;  2TCT A;  4U0Y A;  5E79 C;  2E2I J;  1FTT A;  5EEG A;  1D0X A;  3ABL H;  5H6Q A;  2KIQ A;  2P7C B;  1D1B A;  3TED A;  2ELJ A;  1TWC J;  3U1D A;  3MZH A;  1AKH B;  5JHU A;  4BDY A;  1IF1 A;  3M3Y J;  3H1C A;  3TL4 X;  1B1B A;  2M3A A;  4FE7 A;  3VOE A;  1OYY A;  2DN0 A;  1UEL B;  3SXY A;  1KQ9 A;  4DJA A;  5KAF C;  2IW5 A;  3H92 A;  1OCC H;  5LRR A;  4B44 A;  3M07 A;  2VPR A;  4MGR A;  4OIP F;  3REO A;  5D8K B;  4A12 A;  2QBY A;  2IEK A;  1DP3 A;  1UMQ A;  1U78 A;  2X9D A;  2M7B A;  1GHC A;  4L5J A;  3BTL A;  2EIJ H;  2VL8 A;  1YW7 A;  3B6A A;  3KP2 A;  1N78 A;  1JI8 A;  3FK6 A;  4KYW A;  4A3F J;  3I4N J;  3CD6 I;  2YR2 A;  1D3Y A;  1ZK8 A;  3BCA A;  3F8M A;  3OV8 A;  3RPQ A;  1BIA A;  3ABT A;  1FNN A;  1SAN A;  3T8R A;  4U88 A;  2OCE A;  5FJ8 J;  2WTE A;  2QSH X;  1I6X A;  3QWL A;  4BAY A;  5B3S H;  3CO7 C;  1USS A;  1HW2 A;  3S2D J;  1AA7 A;  4NUB A;  3WTS C;  4JX6 A;  1P7I A;  3KFW X;  3WE2 A;  2NOG A;  1TWA J;  2R93 J;  5LEJ A;  1SFX A;  2E7W A;  2V6C A;  3K1N A;  1XGO A;  3LL7 A;  4BYY A;  1G3Y A;  3CLQ A;  2XIG A;  3NAU A;  1XDU A;  2DA7 A;  3GEZ A;  3HL2 A;  3KCC A;  1YG2 A;  2DYS H;  4QWQ A;  3FXK A;  1CF7 B;  1R4N B;  3OS0 A;  1BW6 A;  3BG3 A;  2VN2 A;  2HOS A;  3DTI A;  4NHJ A;  2VBW A;  3K4K A;  1B8I A;  4UXN A;  1OKR A;  3FIW A;  4XLC A;  4ZH4 F;  5DS9 A;  2W00 A;  2GIZ A;  1FOW A;  1O7L A;  4DNC A;  1R23 A;  5ILU A;  3J80 Z;  2H6C A;  3V7S A;  1MDM A;  2V9K A;  3ZQF A;  2F4M B;  3DEU A;  2GOX B;  1H8A C;  5GPC A;  4ESB A;  2IPQ X;  4Z6Y A;  4TV7 A;  5IT9 K;  3KX2 A;  3R6S A;  3LNQ A;  5EG0 B;  1LNW A;  4A3G J;  4LK0 F;  5HS7 A;  2M4K A;  3COA C;  1MMD A;  2DK5 A;  3HOT A;  1GV2 A;  2FJ1 A;  4BGD A;  3IH4 A;  1UHM A;  1R22 A;  4RGX A;  2P4W A;  3BG5 A;  3J7Y J;  1MW7 A;  2M9H A;  3I56 I;  5FKN A;  1XCV A;  3LAP A;  4LIT A;  1WI3 A;  2M2E A;  4HST A;  3BG6 A;  3FBN B;  1JUM A;  3TW7 A;  1QGP A;  2E5N A;  5IPA A;  3OYC A;  1R5I D;  3SZP A;  2ZXJ A;  1FBS A;  1L3L A;  1W5T A;  2LDU A;  3L1P A;  5HLI A;  1BI0 A;  4QPO A;  5ERI A;  1T39 A;  1DP7 P;  2Z5U A;  1QBJ A;  2MG4 A;  4AD9 A;  1OCO H;  3PNV A;  1VQN I;  3E6C C;  4EJU A;  3CCV I;  3AKZ A;  2ZB9 A;  5FGM A;  3ZMZ A;  2KRC A;  3BWG A;  3MKZ A;  3LWF A;  3O2P E;  5E1W A;  3I54 A;  1D0Y A;  4A6E A;  4N9I A;  3MCZ A;  4XIC A;  2ZXI A;  2JVG A;  3UKG A;  1ETX A;  1G59 A;  5J8C A;  3OYM A;  2DMU A;  1VQK I;  2JPB A;  2ZME A;  1BA5 A;  1I3Q J;  1W7P B;  5J1Y A;  1WZ2 A;  2J5O A;  1QPM A;  1WGX A;  4I99 C;  4OMY A;  1T38 A;  5J6X A;  3JRE A;  4IQ4 A;  1JGS A;  1ORK A;  1KON A;  4PK4 A;  4IX7 A;  4X6A J;  3HEF A;  2GAU A;  2HDD A;  4AUX A;  5IP6 A;  2R5Y B;  1MMN A;  2MD5 A;  2JUG A;  2XDV A;  3HZJ A;  2STW A;  2Z1D A;  3SJM A;  3HBL A;  2NVT J;  1JKR C;  4NB5 A;  2CUF A;  4RB2 C;  2PQ8 A;  2ZCW A;  1ZRD A;  3GFI A;  2RC4 A;  2HOT A;  1QNT A;  1XG1 A;  1Z1D A;  2O03 A;  4IJA A;  4KIC A;  3MD2 A;  3TDU C;  3PUB A;  3VDX A;  1ETO A;  3MVP A;  3RIR A;  3VPR A;  4L18 B;  2VE9 A;  3DBR B;  2O6G E;  1Z3X A;  1YX5 A;  1MNE A;  2Y31 A;  4WF2 A;  1J75 A;  4X1E A;  2B0L A;  2P7V B;  1X2M A;  1V5E A;  3CCE I;  2KJB A;  4HAM A;  4KN4 X;  3BTJ A;  4A3C J;  4MFE A;  3GTP J;  4GXO A;  4HG2 A;  2IGK A;  5F1J A;  1QHG A;  4M9S A;  4A3M J;  2ZJQ F;  5KCM A;  1MMG A;  3WTV C;  3ABM H;  4C9Y A;  2HQ5 A;  1T56 A;  3FXL A;  2JK3 A;  4RA2 A;  3GTJ J;  3D5R C;  2VKH A;  4N0B A;  4LG3 A;  4XOP A;  3CCQ I;  2VXD A;  3I64 A;  3TOB A;  1BJZ A;  1Y1W J;  3CC4 I;  5E17 F;  1K78 B;  2AQE A;  3AAF A;  3LSP A;  5C44 J;  1UJ8 A;  4Y15 A;  3K0L A;  4M9X A;  3FX3 A;  4RGR A;  5KK1 A;  2V1N A;  3S14 J;  3V8K A;  1E0E A;  2XF6 A;  4LB6 B;  4BE0 A;  1NTC A;  2Z16 A;  1G3T A;  2K5C A;  2DMN A;  3CJR B;  4UVA A;  3JTG A;  4KNY A;  1V5F A;  2IS4 A;  4G94 A;  2EIL H;  5F6F A;  4XRM A;  5K5Q A;  1F5T A;  5LFA A;  3CQZ J;  4HF2 A;  2EK5 A;  2GLO A;  5E3N A;  4HV6 A;  1KU7 A;  3BZ6 A;  1RET A;  3DU5 A;  2FML A;  2E7X A;  2BHZ A;  1EH6 A;  4L9T A;  4HDV A;  4E7S A;  3HOX J;  5C3E J;  5FKO A;  4S05 A;  4ZDP A;  3M8J A;  3KP7 A;  1Y8Q B;  5F04 A;  5CJ9 A;  4B43 A;  2I10 A;  3CJN A;  5F1R A;  2BXZ A;  2ZXH A;  3OS2 A;  3DV8 A;  3CES A;  2AS5 F;  1OMI A;  1XD7 A;  1OPC A;  2VKE A;  4XON A;  2XKO A;  4EM1 A;  1FEX A;  5HDK A;  5B5E C;  1Z21 A;  2KKO A;  1QVT A;  2EA2 A;  3GFJ A;  2YPR A;  2DPD A;  4UNO A;  2K9M A;  3DLL F;  3GFM A;  2G0E A;  3QP5 A;  3VYR B;  3I53 A;  3B73 A;  3KP3 A;  4BXX J;  3J80 K;  1LUJ B;  5ICF A;  3JRI A;  4J01 A;  4HDU A;  4KFC A;  1FC3 A;  5JHF A;  3W6V A;  4KIF A;  2LKX A;  1WQ2 A;  2Y75 A;  1J2X A;  1FIA A;  3L2U A;  4EMS A;  3OYJ A;  5GAH J;  1LDD A;  2ZSI B;  2PFB A;  2XGD A;  4ON0 A;  3SDB A;  3WE3 A;  4XL9 A;  3ZR8 X;  2PMZ A;  4IOA F;  1F43 A;  4I98 B;  2LOO A;  2CW0 F;  4P5O A;  2WB1 N;  4II3 A;  2BY2 A;  4OAY A;  2X1E A;  3KLO A;  4DYQ A;  3F0C A;  2CG4 A;  1QQI A;  2OV7 A;  2XPU A;  2WC2 A;  5GAD J;  3P9K A;  2HQR A;  4EVI A;  1X19 A;  1TQP A;  3QP6 A;  4PSX A;  1K83 J;  3BG9 A;  4DZP A;  3QPH A;  5BS6 A;  1JGG A;  2W4S A;  2KT0 A;  2XRO A;  1BI2 A;  3DCF A;  2D1H A;  4RAY A;  3OR2 C;  2DU9 A;  2XSD C;  4RLQ A;  3PO3 J;  3F6O A;  4FET A;  4BY1 J;  4AIK A;  5CVU A;  1OCR H;  2EFO A;  4PGH A;  5F64 A;  3MWM A;  4F55 A;  1EJ9 A;  2ESN A;  4GCV A;  4ENK A;  1JXS A;  2YU3 A;  1EH7 A;  4LK1 F;  4DW6 A;  2UXN A;  1TZL A;  3RQI A;  1F36 A;  3E5Q A;  2Y30 A;  4FAS D;  2CFX A;  1OFC X;  3C3W A;  3H9J A;  1X3Z B;  2CJJ A;  3MKW B;  2DLL A;  5CVI A;  5J1U A;  2WAE A;  4BJ6 C;  2CU7 A;  1WJD A;  2ID3 A;  4Z2Y A;  1GVD A;  4QPQ A;  1Z91 A;  1W4M A;  4IKF A;  5FKM A;  2MC3 A;  2CV1 A;  4LJZ F;  2V79 A;  1A31 A;  1CQT A;  1YOV B;  1R7J A;  5BPD A;  1WCM J;  2GXG A;  5DEQ A;  4L9V A;  3ZQC A;  2GQQ A;  1BI3 A;  2VI6 A;  3BR0 A;  1P92 A;  2B7E A;  1AU7 A;  1SVM A;  4E6K G;  2DA2 A;  4IZZ A;  4NNJ A;  1FMW A;  4L5I A;  2HXO A;  5J4Y A;  4KMU X;  1UHS A;  3JRF A;  1SAU A;  4HQM A;  2VC1 A;  1ZTR A;  1P9Q C;  3K69 A;  4A3E J;  4OIO F;  1Z6T A;  2YX7 A;  4ZYD A;  1PDN C;  3KYL A;  4HZF A;  2VKV A;  2L4A A;  2MLK A;  2NS8 A;  2ME0 A;  4K2E A;  2VON A;  3HOZ J;  3BZC A;  1XTA A;  2E2H J;  2YUS A;  4CIC A;  4IPA A;  2JJ7 A;  2PJP A;  1TWH J;  3ESW B;  4FX0 A;  2L9V A;  4M9Z A;  3SFZ A;  4A0Y A;  4E70 A;  2KIS A;  3SZT A;  1MSF C;  1E3O C;  2LVS A;  3CF2 A;  1DGW Y;  2ZBK A;  2PBI A;  3HKZ N;  3FM3 A;  5FKL A;  1Q1V A;  2OU2 A;  1QZZ A;  1MDM B;  3ZRG A;  4IHX A;  1SAX A;  1ETV A;  3EUH A;  3F21 A;  2DFI A;  5E8I A;  3IV5 A;  1WH7 A;  2EZL A;  3JRH A;  4RAF A;  1ZGA A;  1ETQ A;  4LFU A;  1WJ5 A;  2GOM A;  3GWZ A;  3CJQ B;  1DU6 A;  2G7U A;  3CTA A;  1HA8 A;  2CFO A;  5FLV A;  5E20 A;  3EPZ A;  2FOW A;  2WBM A;  1XDS A;  4BHC A;  5GAG J;  3H5A A;  2DMP A;  4YFX F;  3A0B C;  3HHH A;  2M1B A;  4MHG A;  2L7Z A;  1TWF J;  4PZJ A;  2QQA A;  3LA3 A;  4EM2 A;  3HOS A;  4UUT A;  2NNN A;  5JVG F;  2ZJP F;  2DA6 A;  4OIR F;  4KIT B;  3ZQG A;  3RZO J;  1W36 D;  3LA7 A;  2ACJ A;  3J7Z I;  2IGO A;  2FBH A;  2MH2 A;  4AVZ A;  1MMS A;  1I6H J;  5K7H A;  3QAH A;  2STT A;  4D9J A;  2UWM A;  3F8F A;  1Z9C A;  2BYV E;  3IKT A;  2VJ4 A;  4BJ5 C;  5EGO B;  4GFB A;  1CGP A;  2MAB A;  5E1Z B;  4RB1 A;  1MIJ A;  2LH9 A;  4JK1 X;  1WSU A;  1JKQ C;  3CUQ A;  1IJW C;  1IO2 A;  2HTJ A;  4YG2 F;  2VB6 A;  1OJL A;  3S8P A;  5LGU A;  1YRN A;  2DBB A;  2ELH A;  4P9F A;  2Z2S B;  3S32 A;  1IN6 A;  4XLH A;  4NC8 A;  3HOV J;  1GXQ A;  2KIU A;  1IGN A;  2IBD A;  1BR2 A;  4M3F A;  1BOB A;  1LEB A;  3V8J A;  1KU2 A;  2OZU A;  4XLE A;  3H3U A;  3KEO A;  1D5V A;  3KP5 A;  3FWE A;  4E4H A;  1O3T A;  3GME A;  4P55 A;  5DM6 F;  1W5S A;  4LG0 B;  1B59 A;  4H0E A;  1IZ1 A;  2F5F A;  3W6K B;  2X1D A;  4RAG A;  4G6D A;  1IN8 A;  5EZH A;  3LSR A;  1T95 A;  5JR3 A;  3A02 A;  3R0A A;  2HTS A;  3FXQ A;  3QPT A;  2Y69 H;  3F6V A;  2NVQ J;  1VQO I;  2E71 A;  3TW6 A;  1IRG A;  2XUB A;  2M0C A;  3AG1 H;  4Y13 A;  2DQL A;  2O7O A;  1X3W B;  5K1Y A;  3NRV A;  1YIJ I;  1HKQ A;  3OYB A;  3E5U A;  1TW3 A;  1ZAO A;  3FHN A;  3PIP F;  3JRA A;  1U6G A;  2M30 A;  1DUX C;  3HOU J;  2FOK A;  1XN7 A;  4LB5 A;  1FOK A;  4J00 A;  3TGN A;  1JUP A;  2M8G X;  2JA8 J;  5TGT A;  3I4M J;  1KQ0 A;  1KU3 A;  2XSJ C;  3LA2 A;  3N4M A;  2EA4 A;  4UUV A;  3F23 A;  4IHT A;  3L09 A;  2ZNY A;  1DGR M;  1VQ4 I;  1G8X A;  2CQX A;  2OZ6 A;  5EYR A;  1MJA A;  4NBQ A;  3TKY A;  1P2F A;  1MBF A;  3SEQ A;  1MH3 A;  2K27 A;  3I0T A;  4PJN A;  3SFI A;  1OLT A;  4JX4 A;  1LDK B;  1W0T A;  2YSR A;  1YJN I;  1VZ0 A;  3V4G A;  1VQL I;  3A01 A;  1P6R A;  1YW9 A;  1I50 J;  2DK8 A;  1JTX A;  1MJ9 A;  2JRM A;  3HTU A;  4R79 A;  1X1C A;  4D7M A;  1VQ5 I;  4DIQ A;  2ECB A;  3AG2 H;  4CZC A;  2P6T A;  3A1Y A;  3MAJ A;  5E3L A;  3GZ5 A;  5IYD J;  2LTP A;  4XN0 A;  3C18 A;  2P81 A;  3DKW A;  2L54 A;  2LMD A;  1MND A;  1ETW A;  2X6W A;  4L0Z B;  3OYG A;  2BZT A;  3C2H A;  4PJL A;  2P5K A;  1IUF A;  1I3A A;  2CQQ A;  4O6J A;  2K9N A;  1BC8 C;  4BBS J;  3Q0U A;  2WAF A;  2XPV A;  2WAD A;  5FRO A;  4U87 A;  2O9L A;  1S72 I;  2XF5 A;  2DPU A;  5LHI A;  2LSO A;  2DDA A;  4BY7 J;  1HF0 A;  1IV6 A;  4YEJ A;  2M8E A;  1UAA A;  2FRH A;  4A93 J;  3BR2 A;  2EFN A;  3CCU I;  4A3I J;  2YS9 A;  3S16 J;  1IN4 A;  3KZI C;  5EEA A;  1FYL A;  2O8K A;  1D8J A;  1QHH D;  2R7O A;  3Q5F A;  3AL0 C;  2LRD A;  3DQV C;  2A5W A;  3O8G A;  4HW0 A;  5CVR A;  4I76 A;  4L9J A;  4B09 A;  4O3M A;  1O3Q A;  1ZRE A;  4LLG F;  1TNT A;  3M1C A;  2CQN A;  1RIO H;  2FNP A;  2HEO A;  1MBG A;  2VBY A;  2PEX A;  1T0F C;  4F52 A;  2V6E A;  2KRF A;  3E6B A;  3QQA A;  2W7N A;  3C7J A;  4AC0 A;  4IOC F;  1K7A A;  2AXT C;  1UB9 A;  1KU9 A;  2Q1Z B;  3BP8 A;  1XGM A;  2R5Z B;  2DA3 A;  2ZME C;  2Q2E B;  1KYZ A;  4XKC A;  3K1P A;  5FRM A;  3SDG A;  2GA2 A;  5D5W B;  4M72 A;  2RGV A;  1HCR A;  3OL4 A;  2V1X A;  1RPW A;  1W5C C;  1IRF A;  2DFF A;  3I59 B;  3DXJ F;  2EV6 A;  4ENJ A;  3R4K A;  4IO9 F;  4WWC A;  1PP7 U;  4DYC A;  3RKQ A;  2KFD A;  4IRH A;  5GTI C;  1TQI A;  1ODD A;  3RKX A;  4V2G A;  2WY7 Q;  4EGY A;  2PMZ N;  2EV5 A;  5B1B H;  1BN5 A;  4EV0 A;  1Z67 A;  1Y8R B;  2R7Q A;  3DP7 A;  4ZYH A;  5A2Q Z;  1SFU A;  2I8D A;  3T8T A;  5E8G A;  4IF4 A;  4ZYG A;  5ICG A;  2HYJ A;  5DCM A;  3OYK A;  1WVR A;  2RN7 A;  3NWS A;  3MZ8 A;  4HOB A;  2LC2 A;  3DWL E;  2IVM A;  4BUP A;  5HNH A;  2JRT A;  3JR9 A;  5EZG A;  1LE8 A;  2HZD A;  3HKZ A;  2EFQ A;  1X4O A;  4L0Y B;  4BXF A;  1HKT A;  1REP C;  2M45 A;  1U2W A;  5CQG A;  2CH0 A;  3ZGK A;  2HVR A;  1JKP C;  4JOM A;  1QVU A;  3QPL A;  2GXA A;  4A0X A;  2RNJ A;  3ZQQ A;  2HKX A;  1FWZ A;  5D4R A;  3RTR A;  1SFK A;  1T2K A;  2Z99 A;  1GXP A;  1R6R A;  4CYC B;  4DYR A;  1GLN A;  1D5Y A;  3M1E A;  3U2R A;  4LLL A;  1YQA A;  3JCU C;  4EGZ A;  1B6A A;  4HX8 A;  4RDU A;  3S1Q J;  2IJL A;  4B3X A;  2K86 A;  3PUF A;  4CA0 A;  1NH3 A;  3IAS 2;  4WCG A;  5CPR B;  5E1X A;  4B47 A;  1MJB A;  5FFX A;  3DLA A;  1HC8 A;  2OA4 A;  2DT6 A;  2PJR A;  3GTG J;  3IKV A;  1UZC A;  4D0P A;  2NNY A;  2HYF A;  5F08 A;  1XX5 A;  1YYV A;  2HI3 A;  4FHT A;  3BR5 A;  3VYU B;  4I09 A;  2Z3Y A;  1WJE A;  1Z3Y A;  4ENM A;  2E35 A;  5F0C A;  3IWZ A;  1KGS A;  2GIV A;  4PSW A;  4HRI A;  1FIP A;  2ISY A;  3L2W A;  1IXS B;  2K7L A;  2EFW A;  1AHD P;  3EUK L;  3K4C A;  4PFO A;  3HSE A;  2V9V A;  3HRS A;  4FIS A;  3G1M A;  1MBK A;  1TT5 B;  1WRJ A;  4KA4 A;  4EJT A;  5FD5 A;  4JP0 A;  4CYD A;  2YX4 A;  4B1R A;  2BW3 A;  1FJL A;  1WWX A;  2L9N A;  2TDX A;  4I0B A;  3RSN A;  1S29 A;  4ABZ A;  2LNB A;  1EH8 A;  2AXL A;  2DOA A;  2KZV A;  3F8C A;  2LG4 A;  3IUO A;  2F5V A;  4CCN A;  3KLN A;  4F92 B;  2Z33 A;  2N8G A;  2D1V A;  3RPU A;  4QLC U;  4EM0 B;  2ISZ A;  3VYT B;  2L4M A;  2LBF B;  3S3M A;  4BXU A;  3CCY A;  5GPA A;  4BHB A;  4RB0 A;  2FE3 A;  1U5T A;  4RM3 A;  3RCO A;  4RLF A;  1T0F A;  2NVU B;  4AWX B;  3JTH A;  3BOQ A;  1K6O A;  2VJ5 A;  5CVJ A;  3RZD J;  2FBK A;  5KHD A;  2DJN A;  1LQ1 A;  2HZT A;  4HNT A;  4UUS B;  5J3L A;  1I27 A;  4CZZ A;  1H88 C;  2MGQ A;  2DOD A;  1A6Q A;  3BZK A;  2DDB A;  3ASO H;  4BQO A;  2XB5 A;  3T1B A;  1VTN C;  2JVH A;  1F4K A;  3K10 A;  4MQ9 F;  4R8H A;  1I1G A;  3A0H C;  2V26 A;  2FA5 A;  3ECH A;  2EZK A;  2H1K A;  2H27 A;  2W25 A;  1A5J A;  3W3C A;  1T6S A;  3BQZ A;  3Q0V A;  4FX4 A;  3BLY A;  3FXU A;  3J81 Z;  2K85 A;  1FLI A;  3GTK J;  2COB A;  4A3J J;  1JJ8 C;  2IS6 A;  4F7Z A;  2LKS A;  4Y33 A;  1QZY A;  2M4G A;  4M3G A;  3ZPL A;  1IG7 A;  2QLZ A;  3CDL A;  1X2N A;  4XLN F;  1ITY A;  1QA6 A;  1X3U A;  2XAS A;  1FP2 A;  2QEX I;  5JVT A;  3BC8 A;  2WA0 A;  3ERE D;  4U7B A;  3K7A J;  3FMR A;  1FOY A;  2A05 A;  1N75 A;  2ZJ2 A;  4G7O F;  3OIO A;  2WV0 A;  3Q9S A;  5HOO A;  1ZG3 A;  4MTD A;  1WJC A;  3DF8 A;  3M7G A;  4YIF A;  1VND A;  2K9Q A;  1JT6 A;  1SVO A;  1PUF B;  3OSF A;  2DAO A;  1BOA A;  1A36 A;  2HYG D;  1EA3 A;  2F6C A;  2H8W A;  3LSG A;  5IT3 A;  4YRV A;  2MA3 A;  1E3H A;  3G3Z A;  4ESF A;  3N97 A;  4CCM A;  4RAZ A;  1X1A A;  2VQG A;  5D4S A;  2QVO A;  4NQW B;  3BPX A;  2KDO A;  2JUC A;  3IRR A;  3FHZ A;  4I7H A;  1GVJ A;  2J5P A;  2WWY A;  1TQM A;  2QQB A;  3IAM 2;  2XGE A;  4G9Y A;  5L3F A;  3OYH A;  1B72 B;  4ITV A;  2IRF G;  4BEH A;  2IS2 A;  3W2W A;  4BJT A;  5FLX Z;  1MGT A;  3IH3 A;  5FKK A;  4XLF A;  3HUG B;  3P7N A;  4C3J J;  1TC3 C;  4XSZ F;  5DCF A;  2P5L C;  3WOD F;  1XS9 A;  4M3E A;  3OOP A;  4PCQ A;  3S3O A;  4A3B J;  1IAW A;  3FM5 A;  2XRN A;  3FDY A;  2D5V A;  2CYY A;  4C2T A;  4GDF A;  2DMT A;  4DZJ A;  3ZOB A;  5A2Q K;  3NEU A;  1Y56 A;  4U7D A;  1PP8 F;  4ZYA A;  2BVM A;  2MC4 A;  5J1R A;  5DUI A;  2NS0 A;  2FSW A;  5IOY A;  1RI7 A;  4M3B A;  3DKX A;  3FMQ A;  3QYB A;  4M74 A;  3FKI J;  3M4O J;  2L9S A;  1XSD A;  4CO8 A;  2DI3 A;  4HV5 A;  3EUH C;  3G71 I;  3F72 A;  4YII A;  4DBQ A;  3JRG A;  3GW2 A;  2E1O A;  1NK2 P;  2A6H F;  2DT7 B;  1WH5 A;  5D5U B;  2ZFW A;  2FNA A;  4N9H A;  3E3V A;  3QYE A;  3V42 A;  3WG7 H;  2ELK A;  2O0Y A;  2A6E F;  2VT3 A;  1AWC A;  1ZGW A;  2JA5 J;  1ZG1 A;  4IL6 C;  3KIO A;  5GP9 A;  3HTS B;  3E0J B;  4ZTJ A;  3FXM A;  3H3V K;  1LVK A;  3I5U A;  1D0Z A;  3PL8 A;  2DQR A;  2VOP A;  2G7H A;  2R7T A;  4AU7 A;  3O6B B;  2P8T A;  3U1K A;  4CCO A;  5BPI A;  2EB7 A;  5HNF A;  3F8N A;  1MSE C;  4E7J A;  1FX7 A;  2EWN A;  5DD8 A;  1ETY A;  1VQ8 I;  4R1H A;  1TP4 A;  4WK8 F;  1X1P A;  1R49 A;  3S2H J;  1P4W A;  1W1W E;  2LY1 A;  5DYM A;  1MMA A;  3TOA A;  4I6Z A;  3G1L A;  1GT0 C;  2JTV A;  3K2A A;  4CCL A;  2RAE A;  2QUF A;  3TDZ C;  3I55 I;  4DOZ A;  3RKY A;  3P5J A;  2A07 F;  4BNC A;  2ZKZ A;  1MH4 A;  1S7O A;  2GXB A;  2JA6 J;  2X1C A;  3LSI A;  3MKY B;  3CUQ C;  4A3D J;  9ANT A;  5LBQ A;  3M8E A;  5TJJ A;  2OTJ I;  3S2W A;  2IGM A;  2UXX A;  2R92 J;  3FXO A;  5C4J J;  1TBX A;  3ULQ B;  3AG4 H;  2OTL I;  1IW7 F;  1ZG5 A;  3PQK A;  2PLY A;  2ETH A;  2OQR A;  2DTZ A;  2DOE A;  4AID A;  1X1B A;  4XRF A;  2QBY B;  1ZR2 A;  3ZMD A;  4U0V A;  4KUM A;  2NYX A;  5L3C A;  4EQQ A;  2L02 A;  3D0S A;  2E1M B;  4BQN A;  3H9G A;  3CC7 I;  4OIN F;  2VIX A;  4RMN A;  1NK3 P;  2V7F A;  5E18 F;  2HPM A;  2XF7 A;  4CSW A;  3H5N A;  3BY6 A;  4JQF A;  5ILS A;  1RR8 C;  4XM3 A;  1IDY A;  4KJZ A;  2ZSH B;  3WTX C;  1SMY F;  2HGC A;  2Z9O A;  4W1U A;  2DMQ A;  4I2O A;  2KIF A;  2QQ8 A;  2Q0O A;  2XB0 X;  2ZJR F;  2XAH A;  5BOX A;  3HRT A;  4BDZ A;  1XSV A;  3JAM Z;  3HPH A;  4YEL A;  2R7D A;  2IA0 A;  1V4R A;  1HXD A;  3V7R A;  1IUY A;  3MN2 A;  2M0M A;  2ZFU A;  2JMW A;  3JSO A;  2R7V A;  2NOJ B;  2L7F P;  4I0A A;  2E36 A;  2PMU A;  2Q8K A;  4XR6 A;  1CF7 A;  3QOP A;  3PQJ A;  2QM3 A;  1EKE A;  3OYI A;  4LMY A;  3MQ0 A;  5LHH A;  1G3S A;  4MEX F;  2VLA A;  2R4G A;  5FD6 A;  1VF9 A;  1G6N A;  3GFL A;  3IHU A;  2W24 A;  3VFZ A;  4A3L J;  4HPQ A;  2R7S A;  5J8F A;  5IP7 J;  5JLW A;  1R1V A;  3LAJ A;  1FTZ A;  1VQ9 I;  1JT0 A;  1R1T A;  1O3R A;  4YFK F;  1J59 A;  2O61 A;  3CUO A;  4GGG A;  3L2C A;  1B8I B;  2JQ7 A;  2BHY A;  2VT2 A;  4ZZL A;  1YS6 A;  2CMP A;  3PNT A;  4BE2 A;  3G1O A;  3ECO A;  3ZP5 A;  2K4B A;  3DBH B;  1ONV A;  3RYR A;  2M5W A;  5EG0 A;  4UB8 C;  2HQN A;  2PJR B;  2Y0S A;  1V54 H;  5HS8 A;  1IRX A;  3OWT A;  3A4C A;  3VSL A;  3FIS A;  1WI9 A;  4LD5 A;  1K6Y A;  4MLO A;  2VKD A;  2IP2 A;  3OYL A;  1VQP I;  1ZKG A;  2V4J C;  3M8F A;  4EJV A;  2E2J J;  3BTC A;  1Z7L A;  2QQ9 A;  2XPW A;  2X6X A;  1ERD A;  2OQG A;  1R58 A;  1KZH A;  1R9T J;  4DBR A;  5HLG A;  2DOF A;  3EDP A;  1UCR A;  1R1U A;  5E3M A;  3OY9 A;  2KPM A;  4RM2 A;  3L9F A;  1P4A A;  2MD0 A;  3LSM A;  3TBI A;  3GYH X;  1VFC A;  1H89 C;  3W2A A;  2L01 A;  2XGX A;  4D5F A;  1POG A;  5HLH A;  3AL0 B;  5IYC J;  2ZO4 A;  3BCB A;  1HOM A;  2HR3 A;  1LJ9 A;  4N4N B;  1LEA A;  2DW4 A;  1RRJ A;  1HDD C;  5EEH A;  1YLF A;  3UR3 C;  1ZHF A;  3BQY A;  5B1A H;  2LFB A;  4HYE A;  2HFH A;  4BE1 A;  1W7P A;  2RKH A;  3WTZ A;  1ZH5 A;  3VWB A;  1ZLK A;  3K2Z A;  3VYS B;  2BBY A;  2ZME B;  1S3J A;  4MIM A;  2O8X A;  1NG7 A;  2MLG A;  2X48 A;  3H0D A;  2EZI A;  2DTR A;  1FY7 A;  2R7F A;  3WTT C;  1XCB A;  4CHU A;  4M6Y A;  2R5Y A;  3NWT A;  2ZC2 A;  3LST A;  1U8R A;  4BKX A;  2CW7 A;  1UG0 A;  3CF5 F;  1QO0 D;  1YE9 A;  2HS5 A;  2VQC A;  2FUG 2;  2MW8 A;  3VEP A;  1A04 A;  1V55 H;  2KRH A;  4XLP F;  5L3B A;  2MBF A;  4ENN A;  2OJE D;  2XV4 S;  5TRD A;  2NVY J;  4BS9 A;  2X6O A;  3O3K A;  1MNM C;  2H94 A;  5LHG A;  5FB2 A;  3G73 A;  1SFE A;  2QKL B;  1OCT C;  2HQA A;  3ZQI A;  2UZK A;  3OYN A;  1BI1 A;  2H09 A;  3OR1 C;  5FFZ A;  1MZB A;  1FYK A;  4G7Z F;  2OPT A;  1OR7 C;  5D6F A;  3ASN H;  3B02 A;  5IT9 Z;  1HSJ A;  2XAF A;  3T5X A;  2L0K A;  5JI6 A;  2OAZ A;  1LVA A;  2W1O A;  3HYI A;  3Q0W A;  4UVB A;  2IXS A;  1FBQ A;  2GBY A;  1S7A A;  4HSR A;  1Z7U A;  3KYD B;  1PJR A;  4CCK A;  4O5V A;  3CP8 A;  3RI4 A;  1XC5 A;  1K78 A;  3WHB A;  4B3A A;  3QU6 A;  4YFN F;  1APL C;  1ZLJ A;  2W48 A;  1D1A A;  3JSP A;  1IN7 A;  1U9O A;  2ESH A;  3LQR A;  2EZH A;  1DU0 A;  4BBR J;  1ZAR A;  5HLT A;  1X1D A;  3ZMS A;  5EDN A;  3EQL F;  3GLL A; 
#chains in the Genus database with same CATH homology
 2W85 A;  1MKM A;  2RVC A;  5HVQ C;  2PG4 A;  1V3F A;  3I58 A;  2PMH A;  2OD5 A;  3BJ6 A;  4UV9 A;  4RB3 C;  3ABU A;  2A3S A;  4ZZD A;  3FZV A;  4MEY F;  3I71 A;  3HSF A;  4L9N A;  2F5E A;  2V1D A;  1U5T C;  1XMA A;  2Y0M A;  2A61 A;  2FU4 A;  4WX9 A;  1FBU A;  1DPU A;  5DV5 A;  2VBZ A;  1UFM A;  2LKP A;  4G6Q A;  2W57 A;  5LGT A;  1R5G A;  3Q9V A;  1ULY A;  3E6M A;  4WXH A;  1FYM A;  1B9N A;  5L3E A;  4GYI A;  1D8K A;  2HWV A;  4S04 A;  1FZP B;  4I01 A;  3WGH A;  4RGS A;  2IA1 A;  1FT9 A;  1F9N A;  3BRO A;  5BMZ A;  3ZN1 A;  3DFG A;  1MD0 A;  1OR7 A;  3ML6 A;  4DQ2 A;  4A0Z A;  1TTY A;  3IL2 A;  4Q47 A;  1O57 A;  1NHA A;  1WKM A;  3WU1 B;  1G4D A;  4HLY A;  5L3D A;  5DD4 A;  4HLX A;  1TNS A;  5H6R A;  3F8B A;  1XSX A;  4OIQ F;  2H6B A;  3HHG A;  3KP6 A;  3ELK A;  3I4P A;  4GYG A;  5JFR A;  4EJO A;  1OYI A;  5L3G A;  2ZNZ A;  3L7W A;  2O3F A;  3HRM A;  2EJR A;  2E1C A;  1LDJ A;  1JE8 A;  2LF8 A;  4CDG A;  3KP4 A;  4BHP A;  1IXR C;  5D5X B;  4ZYE A;  4CGZ A;  1J7K A;  1UST A;  2RQP A;  3ISP A;  5ICE A;  4KMF A;  4IXA A;  1XGN A;  3L00 A;  3ZQ7 A;  5DUK A;  3RKW A;  1C0W A;  4OMZ A;  4XBF A;  3W6J B;  2FXA A;  1R5H A;  3KE2 A;  2VE8 A;  2CWE A;  4P9U A;  2DT5 A;  1YW8 A;  3MEX A;  1I5Z A;  3FXR A;  3SHF A;  4XSX F;  3F22 A;  4CXF A;  2D45 A;  2NRA C;  3E5X A;  5CLS A;  1ON2 A;  1HBX G;  2KJC A;  2IA2 A;  2XAQ A;  3IRQ A;  2GZW A;  2GWR A;  3ZMT A;  3CUQ B;  2A69 F;  2CSO A;  1RNL A;  4HX7 A;  1L0O C;  2VXZ A;  2X4H A;  3BDD A;  4I02 A;  3EYY A;  1AOY A;  2E1N A;  3WGG A;  1HW5 A;  1E2X A;  4LG0 A;  4WXD A;  3GZ6 A;  3P9I A;  1HW1 A;  3V7C A;  3R0J A;  4OOI A;  3FMS A;  1KA8 A;  2R3S A;  1Z05 A;  4WXC A;  5DDG A;  3FF5 A;  4A2U A;  2BE5 F;  3EET A;  5AIP A;  2QYO A;  2P6S A;  2FEZ A;  3MZY A;  1YO5 C;  1S8N A;  2RV8 A;  1K79 A;  1BC7 C;  4LGW A;  1DDN A;  3R60 A;  1R36 A;  3GUD A;  2JSC A;  3QU3 A;  2K4J A;  1XMK A;  4JBA A;  3GX4 X;  1O7F A;  5LLQ A;  1XGS A;  3WTW C;  3SQN A;  1U3E M;  3BPV A;  3DPL C;  2FBI A;  1BIB A;  1S6L A;  4RS8 A;  3PFI A;  3DPT A;  2W84 A;  4IVN A;  1SD5 A;  4UV8 A;  2CQK A;  5D8L B;  3RYP A;  3QRF F;  5LEK A;  3HRU A;  1XB4 A;  1EV7 A;  2K02 A;  3ZMU A;  3GVA A;  4AIJ A;  1STZ A;  4G7H F;  1PUE E;  2CO5 A;  5KVR A;  4Q48 A;  2VOD A;  1G3W A;  2QWW A;  3R61 A;  4OU0 A;  1YTY A;  5FO5 A;  3K1M A;  4AVP A;  5ILV A;  4A5M A;  2G9W A;  1R00 A;  2JT1 A;  1YIO A;  2EFP A;  3WGI A;  1IXC A;  2VOO A;  2HOE A;  4UVC A;  3T0Y A;  5ED4 A;  2KIM A;  2Q2E A;  3ZN0 A;  6PAX A;  4ASN A;  1Z6R A;  5HDN A;  1J0R A;  2COM A;  5HDG A;  2IT0 A;  1SD7 A;  3TO7 A;  3ROU A;  1J9I A;  1FSE A;  1SD4 A;  2BEO A;  5D6E A;  4HQE A;  3I59 A;  4HF0 A;  4M71 A;  3JW4 A;  1LB2 A;  2XAJ A;  4BQA A;  1HST A;  1O3S A;  2VBX A;  1UHW A;  3K9T A;  2P5V A;  1E17 A;  3U9G A;  2F5C A;  1HKS A;  4A5N A;  4IRI A;  3F3X A;  2V1U A;  2GA1 A;  4A6D A;  4FT8 A;  1DPR A;  5ICC A;  4KT5 C;  5DCM B;  4BH9 A;  4PGG A;  2X0L A;  1H0M A;  3M9A A;  3J81 K;  4LLN A;  1RUN A;  2QEN A;  3TO9 A;  3WU0 A;  2XVC A;  1Y0U A;  1BBY A;  3CLO A;  1BJA A;  4B8X A;  1OYW A;  1F1Z A;  1B9M A;  3P9C A;  1I1S A;  3WTU C;  4IRG A;  4GO1 A;  3VB2 A;  4P96 A;  3RDI A;  4HA8 A;  3H3Z A;  2PN6 A;  2XHK A;  4U0W A;  1FPQ A;  3GXO A;  1T98 A;  4Q4Z F;  5FLX K;  4KN7 X;  4HBL A;  4M6X A;  4EJW A;  2XKP A;  2JZY A;  2FMY A;  2FQ3 A;  4HX4 A;  2QZ8 A;  2C6Y A;  1JHF A;  3GF2 A;  3E97 A;  3HSR A;  2BGC A;  2DO7 A;  4Y17 A;  5CVV A;  5LRS A;  2Y48 A;  2MH9 A;  2L3D A;  3MFK A;  1H9G A;  2FF4 A;  4MNU A;  1ZGJ A;  2LF7 A;  1U5T B;  2BV6 A;  1H9T A;  2RDP A;  5AIQ A;  3KET A;  1FP1 D;  5HS9 A;  1TLH B;  5K5O A;  3TO6 A;  3ZMV A;  4MQV A;  3TQN A;  2D2W A;  2HKO A;  4ETS A;  1SMT A;  3CDH A;  3BJA A;  3BJO A;  3C1D A;  5K5R A;  2VC0 A;  5AON A;  3LFK A;  2XAG A;  4KIG A;  3KZY A;  4G8X A;  4KIB A;  3D5L A;  3NQO A;  3VOD A;  4RGU A;  2NAZ A;  3V8L A;  1YFH A;  3KEQ A;  1RUO A;  3GLX A;  4NQW A;  5D5V B;  1B4A A;  3EYI A;  3IC7 A;  1KYW A;  2PI0 A;  1ZRC A;  2ADU A;  4HF1 A;  2CGP A;  1ZYR F;  3HUG A;  3CO6 C;  4ESJ A;  2HDC A;  1KQ8 A;  4Q5S F;  4AIH A;  3LQQ A;  5CYV A;  2F2E A;  3IWF A;  2EV0 A;  2A68 F;  2JPC A;  4KDP A;  1YS7 A;  3HIF A;  1ON1 A;  1IN5 A;  3KZZ A;  3RJP A;  3J7A O;  3JAM K;  1Q1H A;  4UHT A;  2A5Y B;  2M87 A;  5LGN A;  1TW2 A;  1JHH A;  1SD6 A;  4MTE A;  2F5D A;  1J5Y A;  1ZRF A;  4PDK A;  4IHS A;  1RZ4 A;  3GO5 A;  1BM9 A;  1W7P D;  3E6D A;  3WG9 A;  3WTY C;  1HQC A;  4M73 A;  1FSH A;  1P4X A;  2OBP A;  5H20 A;  1ZN2 A;  5BQT A;  4U0Y A;  5EEG A;  5H6Q A;  2P7C B;  3U1D A;  3MZH A;  1IF1 A;  5JHU A;  1B1B A;  3VOE A;  1OYY A;  3SXY A;  1KQ9 A;  2IW5 A;  3H92 A;  5LRR A;  4MGR A;  4OIP F;  3REO A;  5D8K B;  4A12 A;  2QBY A;  1U78 A;  1GHC A;  4L5J A;  1YW7 A;  3KP2 A;  4KYW A;  2YR2 A;  1D3Y A;  3F8M A;  3OV8 A;  3RPQ A;  1BIA A;  3ABT A;  1FNN A;  3T8R A;  4U88 A;  2WTE A;  1I6X A;  4BAY A;  3CO7 C;  1USS A;  1HW2 A;  3WTS C;  3KFW X;  3WE2 A;  5LEJ A;  1SFX A;  2E7W A;  2V6C A;  3K1N A;  1XGO A;  4BYY A;  1G3Y A;  2XIG A;  1XDU A;  3GEZ A;  3KCC A;  1YG2 A;  4QWQ A;  1CF7 B;  2VN2 A;  4NHJ A;  2VBW A;  4UXN A;  1OKR A;  4ZH4 F;  1O7L A;  4DNC A;  5ILU A;  1R23 A;  3J80 Z;  2H6C A;  3V7S A;  1MDM A;  3DEU A;  4ESB A;  2IPQ X;  4TV7 A;  5IT9 K;  3R6S A;  1LNW A;  4LK0 F;  5HS7 A;  3COA C;  2DK5 A;  3HOT A;  1UHM A;  1R22 A;  4RGX A;  2P4W A;  3LAP A;  1XCV A;  1QGP A;  3SZP A;  2ZXJ A;  1FBS A;  1L3L A;  1W5T A;  2LDU A;  5HLI A;  1BI0 A;  5ERI A;  1T39 A;  1DP7 P;  2Z5U A;  1QBJ A;  4AD9 A;  3E6C C;  4EJU A;  5FGM A;  3ZMZ A;  3BWG A;  3LWF A;  4A6E A;  3O2P E;  3I54 A;  5E1W A;  4N9I A;  3MCZ A;  5J8C A;  2JPB A;  2ZME A;  1W7P B;  2J5O A;  1QPM A;  4OMY A;  1T38 A;  5J6X A;  1JGS A;  2GAU A;  2MD5 A;  2STW A;  4NB5 A;  4RB2 C;  2PQ8 A;  2ZCW A;  1ZRD A;  3GFI A;  2RC4 A;  1QNT A;  3TDU C;  1Z1D A;  2O03 A;  4IJA A;  4KIC A;  3RIR A;  4L18 B;  2VE9 A;  2O6G E;  4WF2 A;  1J75 A;  2B0L A;  2P7V B;  2KJB A;  4HAM A;  4KN4 X;  4GXO A;  4M9S A;  3WTV C;  4N0B A;  3I64 A;  3TOB A;  5E17 F;  1K78 B;  3AAF A;  4Y15 A;  3K0L A;  4M9X A;  3FX3 A;  4RGR A;  5KK1 A;  3V8K A;  4LB6 B;  1G3T A;  4UVA A;  3JTG A;  4KNY A;  4G94 A;  5F6F A;  5K5Q A;  1F5T A;  4HF2 A;  2EK5 A;  4HV6 A;  1KU7 A;  3BZ6 A;  2FML A;  2E7X A;  4L9T A;  1EH6 A;  4HDV A;  4S05 A;  3KP7 A;  5CJ9 A;  3CJN A;  5F1R A;  3DV8 A;  2AS5 F;  1OMI A;  1XD7 A;  1OPC A;  2XKO A;  4EM1 A;  5HDK A;  2KKO A;  2EA2 A;  3GFJ A;  2YPR A;  2DPD A;  4UNO A;  3GFM A;  3QP5 A;  3I53 A;  3B73 A;  3KP3 A;  3J80 K;  5ICF A;  4HDU A;  4KFC A;  1FC3 A;  4KIF A;  1WQ2 A;  2Y75 A;  1J2X A;  4EMS A;  1LDD A;  4ON0 A;  2PFB A;  3WE3 A;  4I98 B;  2CW0 F;  4P5O A;  3KLO A;  2CG4 A;  1QQI A;  2WC2 A;  3P9K A;  2HQR A;  4EVI A;  1TQP A;  3QP6 A;  3QPH A;  5BS6 A;  2XRO A;  1BI2 A;  4RAY A;  2D1H A;  2DU9 A;  3F6O A;  4AIK A;  5CVU A;  2EFO A;  4PGH A;  5F64 A;  3MWM A;  2ESN A;  4GCV A;  4ENK A;  1JXS A;  2YU3 A;  1EH7 A;  4LK1 F;  2UXN A;  3E5Q A;  2CFX A;  3C3W A;  2DLL A;  5CVI A;  4Z2Y A;  1Z91 A;  1W4M A;  2MC3 A;  4LJZ F;  2V79 A;  1R7J A;  5BPD A;  2GXG A;  5DEQ A;  4L9V A;  2GQQ A;  1BI3 A;  1P92 A;  4L5I A;  4KMU X;  4HQM A;  2VC1 A;  3K69 A;  4OIO F;  1Z6T A;  2YX7 A;  4ZYD A;  1PDN C;  4HZF A;  2L4A A;  2MLK A;  4K2E A;  2VON A;  4CIC A;  4IPA A;  2PJP A;  4FX0 A;  4M9Z A;  3SFZ A;  4A0Y A;  4E70 A;  3SZT A;  2ZBK A;  2PBI A;  3FM3 A;  2OU2 A;  1QZZ A;  1MDM B;  1SAX A;  3EUH A;  3F21 A;  2DFI A;  5E8I A;  1ZGA A;  4LFU A;  3GWZ A;  2G7U A;  3CTA A;  5E20 A;  4BHC A;  1XDS A;  4YFX F;  3HHH A;  2M1B A;  4MHG A;  4PZJ A;  2QQA A;  3LA3 A;  4EM2 A;  3HOS A;  2NNN A;  4OIR F;  3LA7 A;  2ACJ A;  2FBH A;  2MH2 A;  3QAH A;  2STT A;  2UWM A;  3F8F A;  1Z9C A;  2BYV E;  3IKT A;  1CGP A;  5E1Z B;  4RB1 A;  1WSU A;  4JK1 X;  3CUQ A;  2HTJ A;  4YG2 F;  5LGU A;  2DBB A;  2ELH A;  4P9F A;  1IN6 A;  1GXQ A;  2KIU A;  1LEB A;  3V8J A;  1KU2 A;  2OZU A;  3H3U A;  3KEO A;  1D5V A;  3KP5 A;  3FWE A;  1O3T A;  4P55 A;  1W5S A;  4LG0 B;  1B59 A;  4H0E A;  1IZ1 A;  2F5F A;  3W6K B;  4G6D A;  1IN8 A;  5JR3 A;  3R0A A;  2HTS A;  3FXQ A;  3QPT A;  3F6V A;  1IRG A;  2XUB A;  4Y13 A;  2DQL A;  5K1Y A;  3NRV A;  1HKQ A;  3E5U A;  1TW3 A;  1ZAO A;  1U6G A;  2M30 A;  1DUX C;  2FOK A;  1XN7 A;  4LB5 A;  1FOK A;  3TGN A;  1KQ0 A;  1KU3 A;  3LA2 A;  3N4M A;  2EA4 A;  4UUV A;  3F23 A;  4IHT A;  3L09 A;  2ZNY A;  2OZ6 A;  1MJA A;  3TKY A;  1P2F A;  2K27 A;  3I0T A;  1LDK B;  2YSR A;  3V4G A;  1P6R A;  1YW9 A;  2DK8 A;  1MJ9 A;  3HTU A;  4R79 A;  2P6T A;  3MAJ A;  3GZ5 A;  3C18 A;  3DKW A;  2L54 A;  4L0Z B;  2P5K A;  4O6J A;  1BC8 C;  2DPU A;  5LHI A;  2LSO A;  2M8E A;  2FRH A;  2EFN A;  1IN4 A;  1FYL A;  1D8J A;  3Q5F A;  3DQV C;  4HW0 A;  5CVR A;  4L9J A;  4B09 A;  4O3M A;  1O3Q A;  1ZRE A;  4LLG F;  1TNT A;  1RIO H;  2FNP A;  2HEO A;  2VBY A;  2PEX A;  2KRF A;  3E6B A;  3C7J A;  1K7A A;  1UB9 A;  1KU9 A;  3BP8 A;  1XGM A;  1KYZ A;  3K1P A;  2GA2 A;  5D5W B;  4M72 A;  2RGV A;  2V1X A;  1IRF A;  3I59 B;  3DXJ F;  2EV6 A;  4ENJ A;  3R4K A;  4WWC A;  1PP7 U;  4IRH A;  1TQI A;  1ODD A;  3RKX A;  4EGY A;  2EV5 A;  1BN5 A;  4EV0 A;  3DP7 A;  4ZYH A;  5A2Q Z;  1SFU A;  3T8T A;  5E8G A;  4IF4 A;  4ZYG A;  5ICG A;  5DCM A;  2RN7 A;  4HOB A;  2IVM A;  2JRT A;  2EFQ A;  4L0Y B;  1HKT A;  1REP C;  2M45 A;  1U2W A;  4A0X A;  2RNJ A;  2HKX A;  1FWZ A;  5D4R A;  3RTR A;  1T2K A;  2Z99 A;  1GXP A;  3M1E A;  3U2R A;  4LLL A;  1YQA A;  4EGZ A;  1B6A A;  4HX8 A;  2IJL A;  2K86 A;  4WCG A;  5E1X A;  1MJB A;  5FFX A;  2OA4 A;  3IKV A;  4D0P A;  2NNY A;  2HYF A;  1YYV A;  4FHT A;  4I09 A;  2Z3Y A;  4ENM A;  3IWZ A;  1KGS A;  2GIV A;  2ISY A;  1IXS B;  2K7L A;  2EFW A;  3HSE A;  2V9V A;  3HRS A;  1WRJ A;  4KA4 A;  4EJT A;  5FD5 A;  4CYD A;  2YX4 A;  1WWX A;  2TDX A;  4I0B A;  1S29 A;  2LNB A;  1EH8 A;  2AXL A;  3F8C A;  3KLN A;  2Z33 A;  3RPU A;  2D1V A;  4QLC U;  4EM0 B;  2ISZ A;  2L4M A;  4BXU A;  4BHB A;  4RB0 A;  2FE3 A;  1U5T A;  1T0F A;  4AWX B;  3JTH A;  3BOQ A;  1K6O A;  5CVJ A;  2FBK A;  1LQ1 A;  2HZT A;  1I27 A;  4CZZ A;  3T1B A;  1VTN C;  1F4K A;  4MQ9 F;  4R8H A;  1I1G A;  2FA5 A;  3ECH A;  2H27 A;  2W25 A;  1T6S A;  4FX4 A;  3FXU A;  3J81 Z;  1FLI A;  4F7Z A;  1QZY A;  3ZPL A;  2QLZ A;  4XLN F;  1X3U A;  2XAS A;  1FP2 A;  3ERE D;  5JVT A;  4U7B A;  3FMR A;  2ZJ2 A;  4G7O F;  2WV0 A;  3Q9S A;  5HOO A;  1ZG3 A;  4MTD A;  3DF8 A;  3M7G A;  4YIF A;  2DAO A;  1BOA A;  2HYG D;  5IT3 A;  2MA3 A;  3G3Z A;  4ESF A;  3N97 A;  4RAZ A;  5D4S A;  2QVO A;  3BPX A;  3IRR A;  3FHZ A;  4I7H A;  1GVJ A;  2J5P A;  2WWY A;  1TQM A;  2QQB A;  4G9Y A;  5L3F A;  2IRF G;  5FLX Z;  1MGT A;  3P7N A;  4XSZ F;  5DCF A;  2P5L C;  3WOD F;  4PCQ A;  3OOP A;  1IAW A;  3FM5 A;  2XRN A;  2CYY A;  5A2Q K;  3NEU A;  4U7D A;  1PP8 F;  5DUI A;  2NS0 A;  2FSW A;  1RI7 A;  3FMQ A;  4M74 A;  1XSD A;  4CO8 A;  2DI3 A;  4HV5 A;  3F72 A;  4YII A;  3GW2 A;  2A6H F;  5D5U B;  2ZFW A;  2FNA A;  4N9H A;  3E3V A;  2O0Y A;  2A6E F;  2VT3 A;  1AWC A;  1ZG1 A;  3HTS B;  3I5U A;  2DQR A;  2VOP A;  2G7H A;  3O6B B;  2P8T A;  5BPI A;  2EB7 A;  3F8N A;  1FX7 A;  2EWN A;  5DD8 A;  4R1H A;  4WK8 F;  1P4W A;  5DYM A;  3TOA A;  2JTV A;  2QUF A;  3TDZ C;  3RKY A;  2A07 F;  4BNC A;  2ZKZ A;  1S7O A;  2GXB A;  3CUQ C;  5LBQ A;  3M8E A;  5TJJ A;  3S2W A;  2UXX A;  1TBX A;  3ULQ B;  1IW7 F;  1ZG5 A;  3PQK A;  2PLY A;  2ETH A;  2OQR A;  4XRF A;  2QBY B;  3ZMD A;  4U0V A;  4KUM A;  2NYX A;  5L3C A;  4EQQ A;  2L02 A;  3D0S A;  4OIN F;  5E18 F;  3BY6 A;  4JQF A;  5ILS A;  3WTX C;  1SMY F;  2HGC A;  2Z9O A;  4I2O A;  2KIF A;  2Q0O A;  2XAH A;  5BOX A;  3HRT A;  1XSV A;  3JAM Z;  2R7D A;  2IA0 A;  1V4R A;  1HXD A;  3V7R A;  1IUY A;  3JSO A;  4I0A A;  2PMU A;  2Q8K A;  1CF7 A;  3QOP A;  3PQJ A;  2QM3 A;  4LMY A;  3MQ0 A;  5LHH A;  1G3S A;  4MEX F;  5FD6 A;  1G6N A;  3GFL A;  3IHU A;  2W24 A;  3VFZ A;  5J8F A;  3LAJ A;  1R1V A;  1R1T A;  1O3R A;  4YFK F;  1J59 A;  2O61 A;  3CUO A;  4GGG A;  3L2C A;  2VT2 A;  4ZZL A;  1YS6 A;  3ECO A;  3ZP5 A;  2K4B A;  1ONV A;  3RYR A;  2M5W A;  2HQN A;  5HS8 A;  1WI9 A;  4LD5 A;  2IP2 A;  3M8F A;  4EJV A;  2QQ9 A;  2OQG A;  1R58 A;  5HLG A;  3EDP A;  1UCR A;  1R1U A;  3L9F A;  1P4A A;  3GYH X;  2L01 A;  2XGX A;  5HLH A;  2ZO4 A;  2HR3 A;  1LJ9 A;  1LEA A;  2DW4 A;  5EEH A;  1YLF A;  1ZHF A;  4HYE A;  2HFH A;  1W7P A;  2RKH A;  3WTZ A;  1ZH5 A;  1ZLK A;  3K2Z A;  2BBY A;  2ZME B;  1S3J A;  2O8X A;  2MLG A;  2DTR A;  1FY7 A;  3WTT C;  2R7F A;  1XCB A;  4CHU A;  4M6Y A;  3LST A;  1U8R A;  1QO0 D;  2HS5 A;  3VEP A;  1A04 A;  4XLP F;  5L3B A;  2MBF A;  4ENN A;  2XV4 S;  5TRD A;  3O3K A;  2H94 A;  5LHG A;  5FB2 A;  3G73 A;  1SFE A;  2UZK A;  1BI1 A;  2H09 A;  5FFZ A;  1MZB A;  1FYK A;  4G7Z F;  5D6F A;  3B02 A;  5IT9 Z;  1HSJ A;  2XAF A;  3T5X A;  5JI6 A;  2OAZ A;  1LVA A;  3HYI A;  4UVB A;  1FBQ A;  1S7A A;  1Z7U A;  4O5V A;  3RI4 A;  1K78 A;  3QU6 A;  4YFN F;  1ZLJ A;  3JSP A;  1IN7 A;  2ESH A;  3LQR A;  1ZAR A;  3ZMS A;  3EQL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...