1JGSA

Multiple antibiotic resistance repressor, marr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
b'LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
publication title The crystal structure of MarR, a regulator of multiple antibiotic resistance, at 2.3 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jgsA00
2ETHA 3GFLA 2CQKA 4OU0A 2MH2A 2JPBA 3NEUA 2A6EF 4MTDA 2F5EA 1KA8A 1XGOA 4CO8A 2EFOA 5AONA 1BI3A 3LA7A 1KQ9A 2IA0A 1EH6A 2K02A 3BPVA 2HTSA 3J80Z 3CDHA 4UVBA 4MNUA 4CICA 3TQNA 3KLOA 4Q5SF 4HDVA 2RC4A 4RAZA 1K6OA 5KVRA 2O3FA 3HYIA 1S29A 4R79A 1R58A 2EV0A 1FOKA 2DLLA 2X4HA 2L01A 3F6OA 1U3EM 1MJAA 2Z9OA 1XGSA 1JE8A 5D4RA 1ZARA 3VOEA 5IT3A 1UFMA 1JHHA 1KGSA 3B73A 2VXZA 2V1DA 3RDIA 2XVCA 2A61A 1F5TA 1X3UA 2PQ8A 1QZZA 2HTJA 1R5HA 1YO5C 3FM5A 4HOBA 3GX4X 3L9FA 2LDUA 2Y75A 4EM2A 2O0YA 2EA2A 3WGIA 3J80K 1UCRA 4RGSA 2ZCWA 3I5UA 4L5IA 5HS8A 5E20A 3ZMDA 4IVNA 2VT2A 2J5OA 4HZFA 1H9GA 2CFXA 2EV5A 2VC1A 3FWEA 1R22A 2VBZA 3F6VA 4BNCA 2ZO4A 5LHIA 2MC3A 2EFPA 3F8CA 3HRMA 4RB3C 3ZMVA 5FGMA 1LVAA 5FLXK 3LAJA 1XB4A 1KU9A 1ZG5A 3FXQA 1J7KA 2XGXA 4LMYA 1D8KA 5DEQA 2FBIA 4HX8A 2PFBA 4HBLA 1QZYA 3HOTA 1J75A 5FFZA 3ML6A 4L0YB 3WTWC 3BJAA 3GWZA 2GXGA 4YFNF 2R7DA 2M87A 3U1DA 4D0PA 4KIFA 3GLXA 2QENA 3P9CA 1KQ8A 3I0TA 1QNTA 3F21A 2DK5A 2HWVA 1SD7A 4R1HA 2XAJA 1ZRCA 3W6KB 4KYWA 3V8JA 1P92A 3C3WA 2H94A 3I64A 4ZYDA 1FNNA 1WWXA 1SD5A 1HW5A 4U0WA 3C1DA 2VOOA 4M9SA 1TW3A 3K2ZA 4I01A 3RKYA 5TJJA 5IT9Z 5FD5A 1BC8C 1IXRC 1O3QA 1IN4A 3O3KA 3JAMK 2OQGA 3QU3A 2IJLA 1GHCA 4GO1A 3WTTC 1BI1A 1LDJA 5JFRA 3ZPLA 4GCVA 3QP6A 3ULQB 4KMFA 5JVTA 4CXFA 2VT3A 2K86A 2CGPA 3I59A 1FWZA 2V1UA 3QOPA 3WTZA 2TDXA 1TNSA 2L4AA 3K1PA 2D45A 4KMUX 3V7RA 5K5RA 2F2EA 4ESJA 1WKMA 1V4RA 4MHGA 2HDCA 5D8KB 1O3TA 2NRAC 1SMYF 2UZKA 4KIBA 1T38A 1XDSA 3LA2A 3RPQA 3WTYC 5BPDA 5IT9K 3GVAA 1SFXA 1LEBA 3ZP5A 4U7DA 1ZREA 1HQCA 3B02A 3IL2A 3QRFF 1YQAA 3SFZA 2FOKA 3PQJA 1Z7UA 2CWEA 2FE3A 3O6BB 3R6SA 4N9HA 1QO0D 3GF2A 3CUQC 1U5TB 3SQNA 4XBFA 2QBYB 2BE5F 3LWFA 2PLYA 3CUQA 1ON1A 1LQ1A 2EK5A 2DQLA 2FMLA 3O2PE 5ICCA 2L54A 3N4MA 5K1YA 2JRTA 1QPMA 2DW4A 2AXLA 1BI0A 3HUGA 2DFIA 4LFUA 3HRSA 2W57A 5L3BA 4UHTA 2RDPA 5ILVA 1U5TA 2QBYA 5FB2A 3L00A 2K27A 2M5WA 3RIRA 1HXDA 2XHKA 1I27A 2OA4A 4MQ9F 3QPTA 1RZ4A 4I0BA 1ZG1A 2GZWA 1XGMA 5JR3A 3S2WA 3N97A 3HHGA 1FYKA 4I2OA 5F6FA 4I02A 4G7OF 1Z1DA 2YU3A 3GZ6A 3WGGA 2NS0A 4LLNA 2EFNA 3BJ6A 5HS7A 4KIGA 4BYYA 5A2QZ 4KA4A 1YYVA 1IRGA 2MA3A 4ENJA 1DUXC 1B9NA 3TO7A 5D5XB 5HS9A 4UV9A 1TQMA 4HQEA 4M71A 3E5QA 2E7XA 2YX7A 4IHTA 1T6SA 4ETSA 3K1MA 1W5TA 4NB5A 3RKWA 4UVCA 1W7PB 5E18F 1B4AA 1FC3A 3CLOA 4IRGA 1FZPB 1BN5A 3V8KA 5D6EA 2W25A 1Q1HA 3FX3A 4TV7A 2ZBKA 1OMIA 1BIBA 4Y17A 5BQTA 1YS6A 3BWGA 3V8LA 1E2XA 2HYFA 2V6CA 1W5SA 4EJOA 4FX4A 4PGGA 1I6XA 4PDKA 3LQQA 5BOXA 3LQRA 1SMTA 4ESBA 1ONVA 1F9NA 5A2QK 2IVMA 5K5QA 1XD7A 1OYWA 2ESNA 5HDGA 4B09A 4LG0B 4WX9A 1ZHFA 3FMQA 3V4GA 2W24A 1G4DA 2K4BA 3DFGA 3GEZA 3DEUA 1ODDA 1B6AA 1BC7C 5CVIA 2EV6A 1G6NA 4WXHA 2FEZA 4UUVA 3GUDA 3C7JA 1TNTA 2FNPA 4BHCA 6PAXA 1ZYRF 4KNYA 3M8FA 1AOYA 2HZTA 4UV8A 4MEXF 3W6JB 3WG9A 4M6YA 1O3SA 5ILUA 4JQFA 2A5YB 3F72A 2RNJA 3JSPA 2QQ9A 2VBXA 4ZYEA 3VEPA 2PG4A 3H3UA 5LHHA 5AIQA 4FHTA 2VODA 4M73A 3IRRA 3ABTA 4GXOA 1PDNC 4M72A 2CW0F 1U6GA 1OYIA 4CGZA 3C18A 3GFJA 2KJCA 5L3GA 4XSZF 4HX4A 1YLFA 1FP2A 5LGTA 3L7WA 4AWXB 1IF1A 1KQ0A 1U2WA 3DXJF 5J6XA 3KP4A 4EJVA 4EMSA 4IJAA 2BV6A 4AIJA 1KU2A 3GFIA 5BMZA 4A0XA 2F5CA 4MGRA 3CJNA 2P5LC 4HA8A 2FMYA 1F1ZA 4KUMA 3QPHA 4HLYA 1K78A 4ZZLA 1SAXA 1ZAOA 3F22A 3CUOA 4KN7X 2XUBA 4QWQA 1K79A 1IXCA 3OV8A 3FZVA 1G3TA 3KE2A 4M74A 2L4MA 1RUNA 3HOSA 4BAYA 4L5JA 3K1NA 4Y15A 5FLXZ 1MJ9A 3M8EA 4E70A 4BXUA 3F23A 4G9YA 2P5KA 4YIFA 1ZG3A 3L09A 4XLNF 2Y0MA 4LK1F 3T8RA 1Y0UA 2VONA 1DP7P 1T39A 1TQPA 1BM9A 3I71A 2JSCA 1PUEE 5HLHA 3HHHA 3EYIA 2YPRA 4HV5A 4KFCA 4A5NA 2QQAA 1FYMA 4PCQA 1XCVA 1RI7A 3I53A 4HF2A 3M9AA 4I09A 1JHFA 5HDNA 1MGTA 3NQOA 2IRFG 4I0AA 1T98A 2J5PA 2H6CA 3J81K 5DYMA 4LLLA 3QU6A 2WC2A 1W4MA 2G7HA 3H92A 5K5OA 4OIRF 4EJTA 3JAMZ 5LRRA 5CVUA 2DTRA 1SD4A 2OAZA 1U78A 1I5ZA 4UXNA 5ICEA 4P96A 3RTRA 2OBPA 3K9TA 3R0JA 2Z3YA 2ZNZA 1Z9CA 4RB0A 4RGUA 3MZHA 2YR2A 1USSA 4UNOA 3ROUA 2F5DA 4A2UA 1KYWA 4RGRA 5DDGA 4UVAA 4ENKA 5TRDA 4U88A 1HSJA 4BHPA 1A04A 1HW2A 5BPIA 4Q48A 2FA5A 2GA2A 2RKHA 1S7AA 1VTNC 2EA4A 2MD5A 5AIPA 5E8IA 1HKSA 3I59B 4YFXF 1CF7B 5BS6A 3DKWA 5DUKA 4N9IA 1FBUA 2NAZA 4U0VA 1PP8F 3HIFA 4L9VA 4A6EA 3TO9A 2X0LA 1HSTA 4XRFA 3RYPA 3DPTA 2HKOA 4S05A 3NRVA 1R1VA 2LF8A 4N0BA 4I7HA 3BPXA 2QM3A 4YFKF 3MAJA 2DT5A 2R3SA 2DPDA 3T8TA 3DV8A 4XLPF 4G94A 2OQRA 2DAOA 2EB7A 4F7ZA 1CF7A 1MD0A 2QUFA 2EJRA 5CYVA 3DP7A 3E6MA 2MH9A 5CJ9A 1ZGAA 2WV0A 3H3ZA 2HQNA 3FMRA 4LLGF 2FBKA 1B1BA 1IN8A 4KDPA 2VOPA 2XROA 1R5GA 3HSFA 5FFXA 5D5WB 2G9WA 2PBIA 2DI3A 4WCGA 2QWWA 3CUQB 1TTYA 4CHUA 2XKOA 1Z6TA 5L3DA 5ICFA 2IT0A 4OIPF 2XIGA 2NYXA 3D0SA 4HF0A 4I98B 2XKPA 5HVQC 2A3SA 1YW9A 4L0ZB 4MTEA 4O5VA 4G6QA 1E17A 3D5LA 3Q9VA 1BI2A 4L9JA 1D5VA 3IWFA 2ADUA 2KKOA 5HOOA 2NNYA 5EEHA 2CG4A 2XAHA 5ED4A 5DCMB 2IA2A 1WSUA 4K2EA 1CGPA 1RIOH 4WWCA 3SZPA 3EUHA 2JPCA 4GYGA 1SFUA 4OOIA 4HYEA 3R61A 2OZUA 3IKTA 4FX0A 2JT1A 4IF4A 1IAWA 2IP2A 2PJPA 2EWNA 3VB2A 4P55A 3GFMA 4G6DA 4Q4ZF 1Z6RA 5H6QA 4WXCA 5DCMA 4EVIA 2H6BA 1IW7F 2KIUA 1NHAA 3MEXA 4ESFA 5D6FA 3P9IA 2PN6A 3ELKA 1B59A 1OPCA 3DF8A 3V7CA 2UWMA 2F5FA 1IN6A 2UXXA 3FXUA 3T0YA 3R0AA 3LSTA 1IXSB 1SD6A 1LDKB 1D8JA 3ZN1A 2LSOA 2ISYA 5LLQA 3E6DA 1Z05A 4EJUA 2Q2EA 1PP7U 5ILSA 1XGNA 1YW8A 1P4AA 4YIIA 1I1SA 1HBXG 3WE2A 1IN5A 3ZQ7A 3ECHA 1XCBA 2P7CB 3KZYA 4O3MA 2L3DA 3RKXA 3G3ZA 3I58A 4M9ZA 3ZMUA 1AWCA 1O7FA 2P6SA 4LD5A 5ICGA 3FF5A 5D4SA 2IW5A 2MLGA 1WI9A 3JW4A 5E1ZB 2UXNA 2RVCA 3P9KA 3RJPA 1R1UA 1DPUA 4AD9A 4RS8A 4G7HF 1J0RA 5DD8A 2P5VA 1YIOA 1R1TA 1LEAA 3HTUA 4G7ZF 1QQIA 3RYRA 3K69A 2E7WA 2HFHA 2M45A 1OKRA 3G73A 3MFKA 3WTXC 4IPAA 3BJOA 2FNAA 1KYZA 1GVJA 5LGNA 1LB2A 2O6GE 2PMUA 3LA3A 3PQKA 5DV5A 1SFEA 2A07F 2BBYA 1YTYA 1UHWA 5HLIA 2HQRA 2HR3A 1FSHA 1ZLKA 4ON0A 4KICA 2A68F 5CLSA 4HW0A 3QAHA 3KP7A 4KT5C 1MKMA 1LDDA 2VBYA 3JSOA 1EH8A 2HOEA 2Z5UA 4R8HA 2FRHA 5LRSA 3MQ0A 5E17F 4IHSA 3TKYA 1K78B 2XAQA 3KLNA 4WK8F 2L02A 2WTEA 2WWYA 3WTUC 4DNCA 5LHGA 3GW2A 1C0WA 3E97A 3ECOA 3KEOA 2FQ3A 1FX7A 1XSXA 4A6DA 3KETA 2HS5A 5D8LB 4OIOF 1MDMB 2RN7A 5LEKA 2KIFA 2C6YA 4LB5A 1OR7A 4XSXF 2KIMA 3J7AO 1S6LA 3GO5A 1T2KA 2O61A 2IA1A 2GWRA 5E8GA 3WE3A 2G7UA 2ZXJA 2PEXA 2CYYA 1ZRFA 3F8NA 3TOAA 2D1VA 3GYHX 3VFZA 2XAFA 2P8TA 3KP2A 1BIAA 4RB1A 5DD4A 2FSWA 3T1BA 1MDMA 3TDUC 2STWA 2A69F 2DBBA 2HEOA 4CYDA 5L3EA 3MZYA 1ZN2A 4L18B 3J81Z 2NNNA 1JXSA 3OOPA 1TLHB 1FBSA 2ELHA 2XAGA 4KN4X 5DUIA 2DO7A 2GXBA 1XSDA 3AAFA 2P6TA 4PZJA 1J5YA 4P5OA 4GGGA 1HKTA 2JZYA 3FMSA 1H0MA 2EFWA 1HKQA 2K4JA 4EV0A 1L0OC 3KP5A 1H9TA 3KFWX 3M7GA 4FT8A 3R4KA 2YX4A 1W7PD 4OMZA 3GZ5A 3FXRA 2VC0A 1XMAA 4P9UA 1G3WA 1G3YA 4ZH4F 3E6CC 4EM1A 2D1HA 2K7LA 1YFHA 1ZH5A 2EFQA 1ZRDA 2FXAA 1MJBA 1J9IA 1J2XA 4OMYA 1DPRA 3BROA 3HRTA 2BYVE 3U2RA 3U9GA 2LF7A 3WU0A 5D5UB 4NQWA 2RQPA 1FSEA 3IC7A 2Z33A 2DQRA 1USTA 1BBYA 1EH7A 4RAYA 4RB2C 4OINF 2QQBA 3EYYA 1O7LA 2W84A 5EEGA 1V3FA 1ON2A 3IWZA 3F3XA 3Q5FA 3E6BA 4IXAA 5E1XA 5E1WA 1XDUA 1IZ1A 3ABUA 5DCFA 3FM3A 1WRJA 4ENNA 3L2CA 3ISPA 2ZFWA 4OIQF 1B9MA 5L3FA 2V79A 3HTSB 1LNWA 1Z91A 2CO5A 4AIHA 1QGPA 3K0LA 1TBXA 3KP6A 3EDPA 1P2FA 3DQVC 4M6XA 2OZ6A 3KCCA 1WQ2A 3V7SA 1S8NA 1QBJA 5HLGA 1G3SA 1I1GA 3RI4A 4ZYGA 4L9TA 4G8XA 2A6HF 4HQMA 3HSRA 4A0ZA 3LAPA 2P7VB 1YS7A 5KK1A 4HLXA 1UB9A 3RPUA 2E1NA 4ZYHA 3WGHA 2IPQX 5LBQA 3LFKA 3SHFA 3KZZA 4M9XA 4A0YA 2AS5F 3BDDA 4EM0B 2PMHA 2VE9A 2STTA 2PI0A 3F8MA 3HRUA 2DU9A 4LB6B 3MWMA 5H6RA 3JTGA 1T0FA 3KP3A 2XASA 2CSOA 2DPUA 1UHMA 1S3JA 5HDKA 2ZMEB 4RGXA 2JTVA 4JK1X 4Z2YA 2R7FA 3TDZC 2BEOA 2FF4A 3SZTA 1TQIA 3WTVC 3JTHA 5ERIA 3ZMZA 2KJBA 3ZMSA 1IN7A 4DQ2A 4YG2F 1P4WA 1FY7A 3COAC 3CTAA 3SXYA 1TW2A 4JBAA 1DDNA 2VE8A 1FLIA 4EJWA 3I4PA 1XSVA 1JGSA 2ZMEA 4CZZA 1FBQA 2QYOA 2LNBA 4L9NA 5J8CA 3E5UA 1LJ9A 3BY6A 3FHZA 1ULYA 1P4XA 2ESHA 3ERED 3WU1B 3E3VA 3VODA 1FT9A 4S04A 4PGHA 2Q0OA 4WXDA 5L3CA 4HDUA 4MQVA 3DPLC 4EQQA 1D3YA 2RV8A 1U5TC 4IRHA 1BJAA 4MEYF 2H09A 2ZNYA 4NHJA 2Q8KA 3GXOA 4EGYA 3TO6A 1XN7A 2VBWA 3PFIA 2ACJA 5F64A 2XRNA 1J59A 5JI6A 4EGZA 2MBFA 4A5MA 3R60A 1O3RA 4QLCU 4AIKA 5H20A 1EV7A 1RNLA 5LEJA 4HF1A 1P6RA 2KRFA 2H27A 1IRFA 1YG2A 1R7JA 4HV6A 4U0YA 3REOA 2XV4S 2ZKZA 3HSEA 4B8XA 2LKPA 1FYLA 4ASNA 4LJZF 1REPC 4HX7A 2OU2A 5CVRA 3I54A 3ZMTA 1L3LA 3EETA 1OYYA 4BQAA 1R00A 2P4WA 5D5VB 2OD5A 2GA1A 4LK0F 1MZBA 2O03A 3MCZA 3BP8A 2Z99A 4U7BA 2M1BA 2FBHA 1S7OA 2GQQA 1YW7A 4LGWA 3IKVA 2COMA 2ZJ2A 3P7NA 5CVJA 2YSRA 4Q47A 4P9FA 4H0EA 1U8RA 1IUYA 3WODF 3EQLF 4WF2A 5FO5A 1R36A 4O6JA 3F8BA 1GXQA 1XMKA 2MLKA 3BOQA 3M1EA 4HAMA 5FD6A 4ENMA 3WTSC 1R23A 2GIVA 4BHBA 3ZN0A 2QLZA 2FU4A 1HW1A 1RUOA 4CDGA 2GAUA 2QZ8A 2V9VA 2W85A 1O57A 2QVOA 2HYGD 3IRQA 2M30A 1ZLJA 1W7PA 2Y48A 3BZ6A 5J8FA 4GYIA 3IHUA 5JHUA 2M8EA 2VN2A 1KU7A 1KU3A 2E1CA 3KEQA 3TOBA 3F8FA 2B0LA 1BOAA 4AVPA 4A12A 2V1XA 4BH9A 2DK8A 3E5XA 3QP5A 5LGUA 2HKXA 1FP1D 1K7AA 4IRIA 3CO6C 1GXPA 2BGCA 3Q9SA 1STZA 1FPQA 3TGNA 1ZGJA 2HGCA 2O8XA 2RGVA 4LG0A 4ZZDA 1F4KA 5F1RA 4Y13A 2ISZA 2D2WA 3CO7C 5CVVA 3T5XA
chains in the Genus database with same CATH superfamily
2ETHA 3GFLA 2CQKA 2KZGA 2ME6A 4OU0A 5M5YJ 1S5LC 2MH2A 3MKZA 2JPBA 3NEUA 2A6EF 4MTDA 2F5EA 1K4SA 1KA8A 1IJWC 3BR1A 1YHQI 2JVHA 3GTPJ 1XGOA 4BL0B 2ZXIA 4CO8A 2EFOA 1OCZH 5AONA 1BI3A 3LA7A 1KQ9A 3HL2A 2IA0A 1EH6A 2K02A 3JRAA 4NC8A 2G0EA 4RA2A 3L2RA 3CD6I 3BPVA 3S3MA 2HTSA 1QHHD 3J80Z 3CDHA 4UVBA 4UB8C 4MNUA 4CICA 2E1MC 5EG0B 5EJCA 3TQNA 3G1LA 3KLOA 3C2BA 5GPCA 3CF5F 4Q5SF 2YUSA 4HDVA 2RC4A 2XF6A 2VASA 4RAZA 1K6OA 2HDDA 2WY8Q 5KVRA 4A3IJ 2O3FA 4IEJA 3HYIA 2DJNA 1S29A 4R79A 2LYCA 3QYEA 1R58A 2EV0A 1ZK8A 1FOKA 1MMGA 2DLLA 2X4HA 3RCOA 2DDAA 1VQNI 2L01A 3F6OA 1U3EM 1MJAA 4AYBA 2ZJPF 2Z9OA 1XGSA 1QVUA 1Z0XA 5EGOB 5HNFA 1JE8A 3ZGKA 5HODA 5D4RA 1ZARA 2KHMA 4XRSG 3K2AA 3VOEA 3ONQA 1NTCA 1UFMA 5IT3A 4NC7A 3OL4A 1JHHA 1KGSA 3B73A 3MVPA 2VXZA 2V1DA 3RDIA 2XVCA 2A61A 1F5TA 3KYLA 1X3UA 3PNTA 2PQ8A 1D0XA 1QZZA 2KRHA 2HTJA 1R5HA 1V5FA 2BY3A 3DKXA 3A01B 1YO5C 1FTTA 3FM5A 4HOBA 4M3EA 1P9QC 4NQWB 3GX4X 2XPUA 3E7LA 3L9FA 1SEUA 2BZTA 2F4MB 2LDUA 1Z3XA 2Y75A 4EM2A 2O0YA 2EA2A 4DBRA 3WGIA 2VQLA 3J80K 3FK6A 4V2FA 1Z3YA 2DT6A 2DFHA 2QA4I 1UCRA 3S93A 4RGSA 3K4CA 3BQZA 2ZCWA 2R5ZA 2DA5A 4M3DA 3FXLA 3WG7H 3I5UA 4L5IA 5HS8A 4JYKA 5E20A 3RQ4A 3ZMDA 3MZ8A 4IVNA 2M3AA 1CQTA 4BY1J 2VT2A 1RKWA 3WHCA 1ETWA 2BHZA 2J5OA 3OR1C 4HZFA 2KL4A 3TP3A 3OMYA 1H9GA 3CJTB 2CFXA 2EV5A 2VC1A 3FWEA 1R22A 4DZJA 3A01A 2VBZA 3F6VA 4BDYA 1BA5A 4BNCA 2VI6A 4ZTJA 4CA0A 2ZO4A 1ETQA 5LHIA 2MC3A 2NS8A 3HG9A 3UR3C 3BZCA 2EFPA 3F8CA 2R7VA 3HRMA 4XRMA 2KDZA 4RB3C 3ZMVA 1MBHA 4D5CA 3A0BC 3HEFA 5FGMA 4DOZA 1BOBA 1LVAA 2E5NA 1HF0A 5FLXK 4A93J 1A6IA 1HCRA 2R7QA 1XB4A 3LAJA 1KU9A 2DCEA 3OYKA 1ZG5A 3FXQA 2V26A 1J7KA 2CQNA 2XGXA 4LMYA 1D8KA 2AO9A 5DEQA 2FBIA 3BR6A 2DDBA 4HX8A 4E7ZA 3GTLJ 2PFBA 1A5JA 4HBLA 1QZYA 4PUSA 3HOTA 2ICWG 5FKKA 1LUJB 2VPRA 2Z2SB 1J75A 5FFZA 3ML6A 4L0YB 4IHXA 3WTWC 3BG9A 3L2UA 3BJAA 3GWZA 2GXGA 4YFNF 2R7DA 2DMPA 2M87A 3U1DA 4D0PA 4A3MJ 3GCMA 2FOWA 3BTLA 4KIFA 1WPKA 1I3AA 1LE8B 3GLXA 1RETA 2QENA 3P9CA 2QQ8A 4KJZA 1KQ8A 2HPMA 3I0TA 1QNTA 3P5JA 4MO7A 5TGTA 2CUFA 3VYRB 3F21A 3OR2C 2DK5A 1HA8A 2HWVA 1SD7A 4R1HA 2JMWA 2XAJA 3H0DA 2MD0A 1ZRCA 3HBLA 3W6KB 4KYWA 5FLMJ 3FISA 3V8JA 2L2OA 1P92A 3C3WA 2GM4A 2H94A 3I64A 3CCUI 1JKPC 4ZYDA 1FNNA 1WWXA 4BJ6C 2B9SA 1SD5A 1HW5A 1E3HA 4U0WA 3D5RC 3TMOA 2GLOA 1BR1A 3C1DA 2VOOA 4M9SA 1IC8A 1ZQ3P 1TW3A 2DA3A 2DOAA 3S15J 4NNJA 3BTIA 3K2ZA 2BXZA 1IDZA 4I01A 1JT6A 5TJJA 2BY1A 5FD5A 3RKYA 5J47A 1BC8C 1IXRC 5IT9Z 1O3QA 1IN4A 3O3KA 3JAMK 2OCCH 2OQGA 3QU3A 2IJLA 1GHCA 4GO1A 5B1AH 2IXSA 3WTTC 2E2JJ 1BI1A 1LDJA 1EKEA 5JFRA 2AQEA 3G71I 3ZPLA 3HPHA 4GCVA 3QP6A 3ULQB 3JRCA 3KPHA 4KMFA 2XGEA 5JVTA 3CC7I 1H8AC 3ZXSA 4CSWA 4CXFA 2VT3A 2K86A 1QA6A 3IH4A 2N8GA 2K40A 3K4MA 4LG3A 3KIOA 1GT0C 2CU7A 3I59A 2CGPA 2CUJA 1FWZA 4L5EA 4HNUA 2V1UA 3QOPA 2M9HA 4EATA 4E4HA 3AL0B 3WTZA 2TDXA 1U9NA 3CLQA 3M07A 1TNSA 2L4AA 3K1PA 2D45A 2CQQA 4A3CJ 4AVZA 4KMUX 2W7NA 2I8DA 3U21A 3TEDA 3S3NA 2LVSA 3OY9A 3V7RA 5K5RA 1SFOJ 2F2EA 2QSHX 4HEA2 4ESJA 1WKMA 4GRIA 3HJEA 3LSJA 1V4RA 2M8GX 2M34A 4MHGA 2IS2A 3DEEA 2HDCA 3W3CA 1JKQC 3OL3A 2ECCA 2WAFA 5D8KB 1NK2P 3I56I 3LNQA 1O3TA 2NRAC 1SMYF 5IP7J 2UZKA 1FIAA 4KIBA 1T38A 1XDSA 1O4XA 2QGUA 1ENHA 3LA2A 2XB0X 4JOMA 3RPQA 3WTYC 5BPDA 5IT9K 1VQOI 3GVAA 4RM2A 4FISA 1SFXA 1LEBA 1OJLA 3ZP5A 1MIJA 3S17J 1WJEA 4U7DA 1TWHJ 2JJ7A 2ECBA 4ITVA 1WGXA 1ZREA 2DMNA 3PO2J 1HQCA 4F3QA 3JR9A 5BNGA 2E1OA 3B02A 3IL2A 1GVDA 3HUGB 1YQAA 3QRFF 3SFZA 2FOKA 3PQJA 4JX4A 1Z7UA 2CWEA 2FE3A 3O6BB 3R6SA 3CZ6A 2NVXJ 4N9HA 4CYCB 1WJFA 2BVMA 1QO0D 2MW8A 5IPAA 1WJDA 3GF2A 2DOEA 2E60A 3A2KA 3CUQC 1U5TB 3SQNA 4XBFA 2QBYB 2BE5F 4A3JJ 3LWFA 4IHVA 1UZCA 2PLYA 2R7WA 3LOCA 3N05A 1JI8A 4A3BJ 3CUQA 1MBFA 1ON1A 1LQ1A 3EUHC 2EK5A 1SC7A 1N25A 3K6GA 2GOXB 2DQLA 1MMNA 2FMLA 2IGKA 3O2PE 2L54A 5ICCA 3N4MA 5K1YA 1XMXA 2CV1A 3MN2A 2JRTA 1U9OA 1QPMA 2DW4A 3OOUA 3W2VA 1MBGA 2M4KA 2AXLA 2I10A 3DWLE 3OIQA 5FLVA 1BI0A 2E34A 3HUGA 2LG4A 2DFIA 3TW7A 2OJED 4LFUA 3HRSA 2R7TA 2X48A 4FQGA 2W57A 5L3BA 5DM6F 3CCJI 3TW6A 3PSFA 4C9YA 5M3MJ 4UHTA 2RDPA 5E3MA 1HDPA 3K10A 5ILVA 4JX6A 1U5TA 2VPLA 3AG3H 2R7RA 2QBYA 3FDYA 5J40A 2DFFA 5FB2A 3D1NI 1VQ5I 2EBIA 2FQ4A 3SEQA 3L00A 5KCMA 2OTJI 1XC5A 2K27A 2M5WA 4Y4RA 2DOFA 4M3GA 3RIRA 1HXDA 2XHKA 1G2HA 1I27A 2OA4A 4PJJA 3L2QA 2UV1A 4MQ9F 2FJ1A 2H1LA 3QPTA 1RZ4A 1ACIA 1Y56A 4LOCA 4I0BA 3BG5A 2KLOA 3OYHA 1ZG1A 3HPGA 1R71A 2GZWA 2R4GA 3LSGA 3RSNA 1XGMA 2VKEA 2CW7A 5JR3A 3DTKA 1YOVB 3S2WA 3U1KA 3N97A 3ASNH 2LBFA 1VQPI 2EQRA 5KAIC 3HHGA 2W00A 1FYKA 4I2OA 5F6FA 4I02A 2IS1A 3IAS2 4G7OF 1Z1DA 2YU3A 3IUOA 3GZ6A 4C30A 3WGGA 3H9QA 2LY2A 1Q1VA 2K3FA 2NS0A 3O8HA 4LLNA 1Y1WJ 3G6EI 4XOPA 2X6XA 2EFNA 4IHYA 2MG4A 1RKTA 3BJ6A 3G2BA 5HS7A 4KIGA 4BYYA 3BTCA 5A2QZ 4KA4A 3MD2A 1G59A 1YYVA 2F6CA 2MA3A 3FXJA 1IRGA 4LIUA 4ENJA 1E3PA 4V2GA 1DUXC 5E79C 1P7IA 2DA1A 2ZJRF 1B9NA 3TO7A 2PX9A 5D5XB 2VB6A 5HS9A 3Q0WA 4UV9A 1TQMA 4HQEA 2DMQA 4M71A 3E5QA 4DYRA 4J19A 5IOZA 2WAQN 2E7XA 5GPAA 2DYSH 3PNVA 4PJ0C 2YX7A 3A1YA 4IHTA 1T6SA 4ETSA 2DJIA 4G12A 3K1MA 1W5TA 3PO3J 2CUZA 4NB5A 1T33A 4UVCA 3RKWA 4IZZA 3M1CA 1W7PB 4N4OB 5IY5H 5E18F 2KT0A 1P7JA 1B4AA 1FC3A 3CLOA 3O8GA 4IRGA 1FZPB 3PJRA 3B6AA 1BN5A 3PIPF 3V8KA 1HDDC 5D6EA 1Y39A 2W25A 1Q1HA 3FX3A 4TV7A 2ZBKA 1OMIA 4UB6C 1BIBA 4Y17A 5HNHA 2A5WA 1YX5A 1YS6A 3BWGA 5BQTA 3V8LA 3K4NA 2R92J 3ZQFA 1E2XA 2LD5A 2HYFA 1T08B 4B48A 2V6CA 1W5SA 4HNTA 1MSFC 4EJOA 2AQFA 2L7FP 4FX4A 2P0WA 5E3NA 4PGGA 1I6XA 3PM1A 1R9TJ 4PDKA 3OS1A 3LQQA 2Y69H 2GOMA 5BOXA 3OYGA 4J01A 3LQRA 1SMTA 1JUPA 4ESBA 1I50J 1MH3A 1ONVA 4D1QA 1F9NA 5A2QK 1X4OA 2ELKA 2IVMA 4RAGA 5K5QA 1XD7A 4YEJA 2JN6A 1OYWA 1X2NA 2ESNA 5HDGA 4B09A 5GAEJ 2DT7B 1APLC 4LG0B 5IYCJ 1RR7A 1NH3A 4WX9A 3CP8A 1ZHFA 5F04A 2JA2A 3FMQA 3V4GA 2W24A 1PVEA 2H8WA 3KEYA 1G4DA 5HLTA 4BEHB 2K4BA 3DFGA 3ABKH 4OAZA 3DU5A 3GEZA 4XNFA 3PL8A 1UELB 3DEUA 3IH3A 1ODDA 1B6AA 1BC7C 2M7BA 5EDNA 5CVIA 1Y8QB 2VJJA 2HI3A 3SDGA 2EV6A 1G6NA 2BW3A 2FEZA 4WXHA 4UUVA 3VSLA 3GUDA 3C7JA 2EILH 1TNTA 1FMVA 1X3ZB 3QWLA 3QPSA 4AC0A 2KIQA 2FNPA 4B3AA 5B66C 4BHCA 3MKYB 2CMPA 3DCFA 6PAXA 3DTEA 1ZYRF 3BZKA 4KNYA 3BR2A 2CRGA 3M8FA 3IAM2 1AOYA 4E6KG 1VF9A 2HZTA 4UV8A 3DLLF 4MEXF 4Y7NJ 1SFKA 3W6JB 3WG9A 1VQ4I 4M6YA 4UY8I 2L9RA 1O3SA 5ILUA 2AXTC 4JQFA 2LKXA 2A5YB 5LD2C 3F72A 2RNJA 3JSPA 4OWRB 1WZ2A 5F1JA 2QQ9A 2VBXA 3JRIA 2QF7A 2Y0SA 4ZYEA 2E1MB 2WAQA 3VEPA 3ZQQA 2PG4A 3H3UA 5LHHA 4BEHA 1VNDA 1WVRA 4HSRA 4LITA 4BQQA 4A3FJ 1R4NB 5AIQA 1YITI 2LK2A 1BJZA 4FHTA 2VODA 3HGGA 4BKXA 4M73A 3S1MJ 3IRRA 3ABTA 3FBNB 4GXOA 1PDNC 4XL9A 1FEXA 1BR4A 2CW0F 4M72A 5CPRB 1A31A 1U6GA 2KP6A 3SFIA 3CJQB 1OYIA 4CGZA 3C18A 3GFJA 2KJCA 1V55H 4XSZF 5L3GA 1X19A 4HX4A 1YLFA 1FP2A 5LGTA 2I5UA 3L7WA 4AWXB 1IF1A 1OR7C 1KQ0A 1K4TA 1U2WA 3DXJF 5J6XA 2MFZA 1T56A 3KP4A 4XORA 4EJVA 4EMSA 1RPWA 1GDTA 4IJAA 2BV6A 4AIJA 1LPQA 1KU2A 3GFIA 5BMZA 4A0XA 3OSGA 3GTQJ 2F5CA 4MGRA 1W36C 3CJNA 2P5LC 3VWBA 4HA8A 2FMYA 1F1ZA 4KUMA 3DPUA 3QPHA 4HLYA 1PJRA 1K78A 4ZZLA 1SAXA 1ZAOA 3F22A 3JRGA 3ASOH 3CUOA 1X2MA 3BQYA 4KN7X 1QHGA 2XUBA 4QWQA 4BE0A 1K79A 1IXCA 3K70D 2R5ZB 3OV8A 3E1SA 1VQ6I 2HVRA 3FZVA 1VQMI 1G3TA 2K3PA 3KE2A 4M74A 3CCRI 2L4MA 2LR8A 1W0TA 1RUNA 3HOSA 4BAYA 4L5JA 3K1NA 4Y15A 5FLXZ 3ZQHA 4EEFG 2Y30A 3NWTA 1MJ9A 4D7NA 1ETOA 3M8EA 4D7MA 4E70A 4BXUA 3F23A 4G9YA 1A6QA 2P5KA 4YIFA 1Z77A 2DMUA 4ABZA 2NVQJ 1ZG3A 3L09A 2LLKA 2X85A 4XLNF 2Y0MA 4LK1F 4B43A 3T8RA 2Y9ZA 1Y0UA 2DTZA 1D5YA 3TL4X 3E0JB 2NOGA 1YJWI 1DP7P 2VONA 4ZYAA 3OYBA 5GAHJ 1T39A 2BOLA 1TQPA 2R7ZJ 1R49A 1ETXA 1BM9A 2XF5A 3I71A 2JSCA 2BY0A 1PUEE 5HLHA 3HHHA 3EYIA 4YELA 1W0UA 3CMYA 5K7ZA 2YPRA 4HV5A 4BXFA 2M7AA 1W5CC 4KFCA 3FHNA 4A5NA 4E7HA 4BGDA 1MMDA 3GMEA 1ETKA 2DA4A 2QQAA 2Y2ZA 1RR8C 1FYMA 1SVMA 2BVLA 4PCQA 3LSPA 1XCVA 1RI7A 5E3LA 2PJRA 3I53A 2Q1ZB 3OYEA 5DS9A 4BE2A 4HF2A 3M9AA 4I09A 4BU2A 1JHFA 5HDNA 1MGTA 4UUSB 3NQOA 4NBQA 2IRFG 4I0AA 1T98A 3JRBA 4FETA 4XLCA 2XPVA 2J5PA 3K4BA 4PJLA 2FUG2 4DYQA 2H6CA 2V4JC 4BBRJ 3H1CA 3J81K 5DYMA 4LLLA 2W48A 3QU6A 2WC2A 1RRJA 1W4MA 3HKZN 1IV6A 2G7HA 3H92A 5K5OA 1QU3A 4OIRF 3GTKJ 3F9KA 3GZNB 4EJTA 3RQIA 3JAMZ 5LRRA 1U8BA 5CVUA 2ZXWH 2VKDA 2DTRA 2NVTJ 2K9NA 1SD4A 2OAZA 1X1BA 1U78A 4DBQA 1I5ZA 4UXNA 5ICEA 4P96A 3RTRA 5IP6A 2OBPA 3K9TA 2HVSA 3R0JA 2Z3YA 4UUSA 1PUFA 2HOTA 2ZNZA 4PJMA 1Z9CA 5B5EC 4RB0A 4RGUA 3PIOF 3MZHA 3HOZJ 2YR2A 1USSA 2IGMA 4UNOA 3ROUA 2QCOA 1H89C 2F5DA 4CCKA 4A2UA 1KYWA 4RGRA 5DDGA 4UVAA 4ENKA 5TRDA 4U88A 2DMTA 1HSJA 1N75A 1A04A 4BHPA 1W36D 1X1DA 1HW2A 5BPIA 4Q48A 3CCVI 2FA5A 2GA2A 2RKHA 4XKWA 1D0ZA 2IAIA 1ORKA 2D5VA 3ZQIA 4E7SA 4G6TB 4CCMA 4F91B 1S7AA 1VTNC 3K7AJ 2EA4A 2MD5A 5AIPA 4PFPA 5E8IA 1HKSA 3I59B 2QKLB 3KZIC 4YFXF 5LFAA 5IOYA 1CF7B 5C4XJ 4PJNA 5BS6A 3ZOBA 3DKWA 5DUKA 3G4SI 2XF7A 4N9IA 1FBUA 2NAZA 4U0VA 1PP8F 3HIFA 3JRFA 4L9VA 2GBYA 4A6EA 2L7ZA 2V9PA 3ZQGA 3TO9A 4C3HJ 2X0LA 1HSTA 4AUXA 1MNDA 2JQ7A 4BXXJ 2XGCA 3WU2C 4XRFA 3RYPA 1OLTA 3DPTA 2HKOA 1FOWA 2RQQA 4S05A 3NRVA 1R1VA 1MBEA 2LF8A 3QYBA 4ZC3A 1DU6A 4N0BA 1FOXA 4I7HA 3BPXA 2WBMA 1V5EA 4IHWA 1UG0A 2QM3A 4YFKF 3MAJA 2DT5A 2R3SA 3OYJA 2DPDA 1OCRH 3T8TA 3DV8A 2XGDA 1DP3A 1LKXA 2H8RA 1K6YA 2KPMA 3HM5A 1FTZA 1ETVA 4XLPF 2V6EA 4G94A 2OQRA 2DAOA 2EB7A 1D0YA 3I3LA 4F7ZA 1TWGJ 1CF7A 2ZC2A 1MD0A 3HKZA 1WH5A 2MGQA 2QUFA 2EJRA 5CYVA 3DP7A 3E6MA 3CCSI 2MH9A 5CJ9A 3JREA 3TBIA 1ZGAA 1W1WE 4NUBA 2XPWA 2W1OA 2WV0A 2L9VA 3KYCB 3OYDA 3W6VA 3H3ZA 1ZKGA 2HQNA 3DLAA 3FMRA 2FBKA 4LLGF 5JVGF 3HDDA 1B1BA 1T0FC 1IN8A 4KDPA 2E5ZA 2E35A 9ANTA 2VOPA 2XROA 2JK3A 3HZJA 1R5GA 3HSFA 3BG6A 2XDVA 1M1EB 5IP9J 2O8KA 1VI0A 5FFXA 5D5WB 2G9WA 3S16J 2PBIA 2DI3A 2VKHA 3BTJA 4WCGA 1F36A 2QWWA 2H1KA 3CUQB 1TTYA 4CHUA 2JWTA 2XKOA 1Z6TA 2VUMJ 4RM3A 5L3DA 5ICFA 3MKWB 2BHYA 2IT0A 1HOMA 4OIPF 2XIGA 1QZEA 5JLXA 2NYXA 3D0SA 4HF0A 3DBRB 2K9MA 2XKPA 4I98B 1BR2A 4GDFA 2JRMA 2ZJQF 4ANJA 2M2EA 5HVQC 1B72B 2A3SA 5J1RA 1YW9A 2YS9A 4L0ZB 4XIDA 4MTEA 1VFCA 4O5VA 2KRCA 3BR0A 3FBIB 4G6QA 1E17A 3D5LA 3Q9VA 1BI2A 2V7FA 2V1NA 4L9JA 1D5VA 2ZFUA 3IWFA 5FRNA 3ABMH 2IEKA 3HOVJ 2ADUA 2KKOA 2XSJC 5HOOA 2NNYA 4IO9F 5EEHA 2CG4A 2XAHA 5ED4A 4II3A 5DCMB 1JT0A 2IA2A 1E3OC 1BW5A 2MSYA 5J1UA 3VPRA 4CCJA 1WSUA 4K2EA 2M0CA 1CGPA 1OCTC 1RIOH 2ZMEC 1GV2A 5GADJ 2B63J 2W4SA 4WWCA 4W1UA 3SZPA 3EUHA 2JUCA 2Y31A 2JPCA 3HXLA 4GYGA 1SFUA 4XLHA 1YIJI 4CUGA 1SVLA 2KDOA 2EIMH 2NS7A 4OOIA 4HYEA 3R61A 1G8XA 2LTPA 4RLQA 3JRHA 2OZUA 1B72A 3IKTA 2R7UA 4XRSA 3HOXJ 4FX0A 2JT1A 2WY7Q 2LBFB 3L2VA 4IF4A 1IAWA 4XMYA 4Y3OA 3G1MA 1B8IA 3CP2A 2IP2A 2PJPA 4DYCA 2DA6A 4QTRA 2EWNA 3VB2A 4P55A 3QPLA 3GFMA 4G6DA 1HLVA 4Q4ZF 4A3DJ 2R7SA 1Z6RA 2CW8A 2KQRA 5H6QA 4WXCA 5DCMA 4CCNA 2H6BA 4D5FA 4EVIA 1IW7F 2X1DA 2KIUA 1NHAA 2V9KA 1YX3A 2VQCA 3H5AA 1S9HA 3MEXA 4ESFA 5D6FA 3P9IA 4C2TA 2PN6A 3RPUD 3ELKA 2HNHA 1B59A 5DTDA 3H5RA 1OPCA 3DF8A 3MKLA 2JA5J 2L7KA 3BT9A 3V7CA 2UWMA 1D1CA 4B44A 2F5FA 1IN6A 1A35A 2XB5A 1NK3P 2UXXA 3FXUA 3T0YA 3R0AA 2BY2A 3LSTA 4YIRX 2Z1DA 1IXSB 1GLNA 1LDKB 1SD6A 2CUEA 2DA2A 4A3KJ 1D8JA 1ERDA 4BQOA 2CH0A 4IL6C 3RKQA 4C2UA 3ZN1A 4XONA 4H4KC 5FKOA 1MBJA 2LSOA 5KAFC 1JKRC 2ISYA 5LLQA 2FD5A 2GXAA 3E6DA 3CCMI 1XTAA 4NC6A 5F0HA 2QSGX 3SYTA 1AKHA 1Z05A 4EJUA 2OTLI 2Q2EA 3OYMA 3OYFA 1HC8A 3ERMA 1PP7U 2UUZA 1XGNA 1YW8A 4RMNA 4UUTA 1P4AA 5ILSA 4YIIA 1I1SA 4MIMA 1HBXG 3WE2A 3L1PA 1IN5A 2XAUA 3ZQ7A 2VIXA 5GTHC 5TISC 3ECHA 1XCBA 2P7CB 2COBA 3HOWJ 4E7JA 3KZYA 1TL8A 3ESWB 1Y1VJ 4O3MA 2L3DA 3FXOA 3RKXA 3G3ZA 3I58A 4M9ZA 3BCBA 1MW7A 3ZMUA 1OFCX 5EF6A 1AWCA 1O7FA 1YE9A 2P6SA 4LD5A 5ICGA 3FF5A 5D4SA 2IW5A 2MLGA 4CCOA 3QQAA 1WI9A 3JW4A 5E1ZB 1RC9A 3RZOJ 2ME0A 2EIJH 2UXNA 2QEXI 2RVCA 1IUFA 4W97A 3P9KA 3H36A 3RJPA 4XN0A 1R1UA 1DPUA 4AD9A 3K70C 4F93B 4RS8A 3S2HJ 3CCEI 4G7HF 1J0RA 4E7IA 1ITYA 1TT0A 3QOEA 4P1WA 2XSDC 5DD8A 2P5VA 1YIOA 3OS0A 1R1TA 1LEAA 1VQLI 3HTUA 2BW3B 4XKBA 5K7HA 2R5YA 4G7ZF 1QQIA 3RYRA 4M3FA 3K69A 5FKMA 1N77A 2E7WA 2HFHA 4XKVA 2M45A 1OKRA 3OSFA 2EZLA 3MFKA 3G73A 5JHFA 3WTXC 4IPAA 3BJOA 4IQ4A 2LP0A 5M3FJ 1ZR2A 2FNAA 1KYZA 1GVJA 5LGNA 2MYSA 3OIPA 3X2QH 1LB2A 2O6GE 2IGOA 3S1NJ 1MMSA 1XPXA 3WHBA 2PMUA 2PMZN 3LA3A 2HYJA 3PQKA 4B47A 4JX5A 4PSWA 5DV5A 1IDYA 4QPOA 1MH4A 3K4KA 1WFXA 3VDXA 1VQ7I 4X1EA 4CZCA 1SFEA 2A07F 3H35A 4HG2A 2BBYA 3H3VK 1JGGA 1YTYA 1UHWA 2LFBA 3AG4H 5HLIA 2KFDA 2HQRA 2HR3A 1FSHA 4AYBN 1ZLKA 1I6HJ 3ZQCA 4ON0A 4KICA 2A68F 2HU9A 5CLSA 4HW0A 1WI3A 1IRXA 2DODA 3QAHA 1Z21A 4B1RA 3QODA 1ETYA 3KP7A 3FKJA 5M5WJ 3OYCA 1S72I 3S1QJ 4KT5C 1MKMA 4DIQA 1LDDA 3EPZA 2VBYA 3JSOA 1EH8A 5B1BH 2HOEA 4A3LJ 5IYDJ 2Z5UA 3CF2A 3I4NJ 4R8HA 2YU9J 2FRHA 5LRSA 3MQ0A 3W2AA 5E17F 4IHSA 3TKYA 1K78B 2XAQA 3UNGC 1NG7A 3KLNA 2EZHA 3BG3A 4WK8F 2L02A 3LSKA 3Q3SA 2WTEA 2WWYA 3WTUC 3BR3A 4DNCA 3TP0A 5LHGA 3GW2A 1C0WA 3V42A 3GTGJ 2X6WA 3E97A 3ECOA 3KEOA 2FQ3A 1FX7A 1XSXA 2QKMB 4A6DA 5E3OA 2HS5A 3KETA 4IX7A 5D8LB 2CQXA 4OIOF 2O7OA 1MDMB 5B3SH 4U87A 1AU7A 2RN7A 3VYSB 2HOSA 2VKVA 5FKLA 2X1EA 3AG2H 2R7XA 3H9JA 5LEKA 2KIFA 4C2MJ 2C6YA 1EA3A 4LB5A 4M3BA 1OR7A 4XSXF 2LRDA 3DEWA 2KIMA 3J7AO 3LSMA 1S6LA 3GO5A 1T2KA 2O61A 3OYAA 2IA1A 2GWRA 5E8GA 1X1CA 3WE3A 3NAUA 4A3GJ 3VSKA 2G7UA 4II2A 5FRMA 2EINH 1IO2A 3DU6A 2ZXJA 4QPQA 1UJ8A 3OIOA 1DGWY 2CYYA 2PEXA 2IS6A 4YRVA 1ZRFA 2PMZA 3F8NA 3TOAA 3OWTA 3CC4I 2D1VA 3GYHX 3M3YJ 3A02A 3VFZA 2XAFA 2P8TA 3KP2A 2X6OA 1BIAA 4RB1A 1MNMC 3FK7A 1LVKA 5DD4A 2FSWA 3T1BA 2KZVA 4FCYA 1MDMA 3TDUC 2LKSA 2STWA 2A69F 2DBBA 3Q0VA 2HEOA 4CYDA 5L3EA 3MZYA 1ZN2A 4L18B 1V5GA 2PJRB 3J81Z 2E36A 2NNNA 3BLYA 2VJ4A 1JXSA 4BJ5C 3OOPA 3H0GJ 1D1AA 1FBSA 1TLHB 2ELHA 2F4OB 2VJ5A 2XAGA 4KN4X 5EZGA 4ZTFA 1E0EA 3S8PA 2K85A 5DUIA 3GBGA 2DO7A 4DJAA 1A36A 2GXBA 3PSIA 1XSDA 3AAFA 1JUMA 3SZGA 2OCEA 2P6TA 1ZGWA 1SANA 4PZJA 1J5YA 1SAUA 4GGGA 4P5OA 1HKTA 3FIWA 2R0QC 2JZYA 3FMSA 2ZSHB 2OC6A 1H0MA 3OYLA 2EFWA 1HKQA 2K4JA 3PUBA 4EV0A 1L0OC 3CMEI 3KP5A 1H9TA 3H9GA 3KFWX 3M7GA 5EG0A 4FT8A 3R4KA 3SDBA 1WH7A 2YX4A 3C2GA 2KISA 1W7PD 3AFHA 3ZRGA 4OMZA 4IOAF 3GZ5A 3FXRA 2VC0A 2A6TA 4C3JJ 1ZR4A 1I39A 1XMAA 2IBDA 4CH7A 4F55A 5KHDA 1H88C 2L5QA 4P9UA 1G3WA 1G3YA 1JUSA 3IP4B 4ZH4F 3E6CC 1TC3C 2QSFX 3FKIJ 4EM1A 2D1HA 2K7LA 1YFHA 1ZH5A 2EFQA 1IRZA 2EIKH 3S1RJ 1ZRDA 1UMQA 2TCTA 2OF7A 2FXAA 1MJBA 4D9JA 3KX2A 5EGOA 2A05A 1PUFB 1J9IA 4MFDA 4BQNA 1J2XA 5EZHA 3NWSA 4IKFA 1ZTRA 4LIVA 1NG6A 2R7OA 2DXIA 3BG7A 3Q0UA 3LSRA 4OMYA 5C4JJ 4J00A 2M4GA 1DPRA 4B4CA 3BROA 2CV0A 3HRTA 2F5VA 4AU7A 1AHDP 2BYVE 3U2RA 1BW6A 1X3WB 3U9GA 1EJ9A 2LF7A 2L7MP 3WU0A 5D5UB 4NQWA 2RQPA 2CS3A 1RESA 3KYDB 1FSEA 1WHUA 3IC7A 3HGYA 3LMMA 2Z33A 4X6AJ 2DQRA 1USTA 3CCQI 1BBYA 4I6ZA 1EH7A 4RAYA 2NVUB 4RB2C 1KONA 2L9NA 1LFBA 3LL7A 4OINF 2QQBA 2CFOA 2LC2A 4KISA 3RZDJ 3EYYA 4S0HB 4E7LA 4HSTA 3W2WA 5F27A 1O7LA 2CJJA 3CDLA 2W84A 1V3FA 5EEGA 1N78A 1ON2A 1PYVA 3IWZA 3L2WA 3F3XA 3EUKL 5J4VA 5J3LA 3Q5FA 2O9LA 3E6BA 4IXAA 5E1XA 5E1WA 3GTJJ 1XDUA 2HZDA 2X51A 2K9QA 1IZ1A 3ABUA 4HNVA 2E2IJ 5DCFA 3FM3A 3OYNA 2LY9A 4IQJA 1WRJA 4N4NB 2RREA 4ENNA 3L2CA 3ISPA 4ZDLA 2ZFWA 3M4OJ 1IG7A 2HDWA 5DM7F 4BDZA 2Y9YA 1B9MA 4OIQF 3LFUA 5L3FA 2P81A 2V79A 3HTSB 1LNWA 2ID6A 2HXOA 1Z91A 2O5RA 2CO5A 4AIHA 2E71A 1QGPA 3HC7A 3K0LA 1TBXA 1VZ0A 3KP6A 3EDPA 1P2FA 1MBKA 3DQVC 4M6XA 2OZ6A 2HXIA 1WQ2A 3KCCA 3V7SA 4FTHA 1S8NA 3K4JA 5GTIC 1QBJA 5H2FC 4PSXA 3EUAA 1T95A 3A03A 4XKCA 5HLGA 2WB1N 3J7YJ 1G3SA 1I1GA 3PFYA 4XR6A 4RBOA 3RI4A 4ZYGA 1KZHA 4L9TA 4BBSJ 3PNYA 4MFEA 4G8XA 2DFEA 1T8IA 2A6HF 3M8JA 3NARA 2ZXHA 4HQMA 3HSRA 4MLOA 2VJIA 1BL0A 2VXDA 4A0ZA 3LAPA 2P7VB 1JTYA 1YS7A 4I99C 5KK1A 2K9LA 1LE8A 4HLXA 4C3IJ 1UB9A 3RPUA 4GFBA 2E1NA 1OCOH 4ZYHA 1Y8RB 1DU0A 3CESA 3WGHA 2IPQX 5LBQA 3LFKA 3SHFA 1Z7LA 3S3OA 1R6RA 2L0KA 1FJLA 3A4CA 2TRTA 3KZZA 4M9XA 4A0YA 2AS5F 3BDDA 2IGNA 4EM0B 2PMHA 4X0GA 2VE9A 3JRDA 5CQGA 3DBLB 2STTA 4PK4A 4BS9A 1OCCH 1IGNA 3F8MA 2PI0A 4XLFA 3HRUA 2DU9A 2RNGA 4BACA 2VL8A 4LB6B 3MWMA 4RAFA 2NXNB 5JLWA 4B3XA 1Z67A 1DQUA 5H6RA 4BJTA 5J1YA 4RDUA 3JTGA 1T0FA 3KP3A 4XQFA 2XASA 4M6VA 2CQ7A 1UAAA 3A0HC 3K4LA 1ZELA 1TZLA 1UHSA 2CSOA 1JJ8C 4A69C 2X9DA 2LH9A 2DPUA 3LSIA 1Y6IA 1UHMA 2AHQA 1S3JA 5HDKA 2ZMEB 4RGXA 5KNLA 3I4MJ 2JTVA 4JK1X 4OAYA 3C2HA 3J7ZI 4Z2YA 2R7FA 2X6YA 3TDZC 2MABA 2BEOA 2FF4A 3SZTA 1TQIA 1DGRM 4KITB 3WTVC 3JTHA 2IS4A 5ERIA 2ID3A 4FE7A 2DA7A 2XRLA 3AL0C 1V54H 2JA6J 2R93J 1WCMJ 4FASD 3BC8A 2EPFA 3ZMZA 2KJBA 3ZMSA 4F92B 1B8IB 2JA7J 1IN7A 3OYIA 2ELJA 2CV2A 1XS9A 4DQ2A 2LREA 1MMAA 1OISA 2VQGA 4YG2F 4IOCF 1P4WA 3ZCOA 1JTXA 2JUGA 2E2HJ 1FY7A 3GTMJ 1YI2I 3COAC 3CTAA 3SXYA 2X1CA 1TW2A 1XG1A 1D1BA 4JBAA 1DDNA 5EEAA 2WB1A 2VE8A 1FLIA 4EJWA 1VQ9I 3I4PA 1XSVA 1JGSA 2ZMEA 1Y0NA 4CZZA 1FOYA 2F4IA 3IV5A 3OS2A 1FBQA 5EYRA 3I55I 2QYOA 2EZKA 2LNBA 4L9NA 4AIDA 5J8CA 5GP9A 3E5UA 1LJ9A 2NVYJ 4NDLA 1I3QJ 3BY6A 4DGWB 4ZDOA 4PFOA 5K7FA 3FHZA 3GTOJ 1X4PA 4AM3A 1ULYA 1P4XA 2ESHA 3ERED 1YJNI 2WV1A 2WAEA 3WU1B 3CC2I 3E3VA 4DZPA 3VODA 1FT9A 4S04A 3JCUC 4V19K 4Y52J 4PGHA 1AA7A 2Q0OA 4I76A 3ZR8X 3D5SC 1MNEA 4WXDA 5L3CA 5C3EJ 4HDUA 4MQVA 5GAGJ 1MSEC 3DPLC 4EQQA 1D3YA 1AKHB 2RV8A 2Q2EB 4CYCA 1OQYA 1U5TC 4HPQA 4RLFA 5IYBJ 4IRHA 3H5NA 1BJAA 1GV5A 4ZDPA 4MEYF 2XC7A 1GUUA 2H09A 3J7AY 1WJAA 2E19A 2W82A 2ZNYA 4NHJA 2Q8KA 2KMUA 3GXOA 3I9V2 4EGYA 3TO6A 2JVGA 1XN7A 1TWAJ 3ABLH 2VBWA 3PFIA 2VQHA 2ACJA 5F64A 2L9SA 2XRNA 1LFPA 3BR5A 5JI6A 1J59A 4EGZA 5F0CA 2MBFA 4A5MA 3R60A 1O3RA 2FX0A 4QLCU 1LFUP 1TP4A 4AIKA 3CDIA 5H20A 1EV7A 1RNLA 2WA0A 5LEJA 4HF1A 1P6RA 2KRFA 2H27A 1IV8A 1XX5A 4XM3A 1IRFA 1YG2A 3LSHA 1WJCA 1R7JA 4HV6A 4U0YA 3REOA 2XV4S 4A3EJ 1YRNB 5CQEA 3S2DJ 2ZKZA 3HSEA 3HB9A 4B8XA 2LKPA 3IH2A 1FYLA 4ASNA 4LJZF 5C44J 1REPC 1K83J 4HX7A 1OCPA 3F0CA 2OU2A 4XLAA 2R5YB 1YJ9I 2DYRH 5CVRA 3I54A 3ZMTA 1L3LA 3FXKA 2WADA 3EETA 1OYYA 3B6CA 1JKOC 2OPTA 5CKTA 4BQAA 1R00A 3QYFA 5F0FA 2P4WA 1VQ8I 5D5VB 1TT5B 2OD5A 1QPIA 2GA1A 1R5ID 4LK0F 1X1PA 1MZBA 2O03A 1QVTA 1U0JA 3MCZA 1QRYA 4FE4A 3CJRB 5FROA 3BP8A 3AKZA 2Z99A 3HOUJ 4XK4A 2HVQA 4U7BA 3SJMA 3CCYA 2NOJB 1TWCJ 2M1BA 2Y0SN 2FBHA 1S7OA 2GQQA 2HOAA 1YRNA 4JP0A 4Y33A 1YW7A 1F43A 2DN0A 4LGWA 3IKVA 2COMA 2F48A 2ZJ2A 2RAEA 3P7NA 5CVJA 1X1AA 4BUPA 3AG1H 2YSRA 4Q47A 2LOOA 4BE1A 1JJ6C 2HPIA 4P9FA 4CCLA 4H0EA 1U8RA 3CCLI 1IUYA 4E7KA 3WODF 2LY1A 3EQLF 4WF2A 5FO5A 1R36A 5FKNA 4O6JA 1WJBA 1POGA 3F8BA 1GXQA 1UG2A 4KT6A 4Z6YA 2HQAA 4HRIA 1EF4A 1XMKA 4ZJZA 2MLKA 3BOQA 3M1EA 3DKYA 2HQ5A 3G1OA 4HAMA 5FD6A 2B7EA 4ENMA 3WTSC 3CMAI 1R23A 1R4MB 2GIVA 2ZB9A 4BHBA 3ZN0A 2QLZA 2OUMA 4XOTA 4XLEA 2FU4A 4F52A 4QIWN 1HW1A 3VYUB 1RUOA 4CDGA 5M5XJ 3SEZA 2W85A 2GAUA 2V9VA 2QZ8A 3PUFA 1O57A 2QVOA 2HYGD 3IRQA 2M30A 2EZIA 1ZLJA 1W7PA 4QSHA 2Y48A 5J4YA 3FXMA 3VYTB 4XICA 3BZ6A 3CQZJ 3ZQLA 5J8FA 4GYIA 3BCAA 2K5CA 5F08A 3IHUA 2VLAA 2EH3A 5JHUA 3DBHB 3S32A 2M8EA 2MC4A 1FIPA 2VN2A 1KU7A 1KU3A 2JA8J 2E1CA 1J09A 3KEQA 3TOBA 3F8FA 2B0LA 1BOAA 4AVPA 1S7EA 4XN3A 5FJ8J 1TWFJ 4A12A 2V1XA 1K61A 4BY7J 2M0MA 4BH9A 2DK8A 3E5XA 3QP5A 2GIZA 1VQKI 5LGUA 2HKXA 1SVOA 2Z16A 1FP1D 4DW6A 1K7AA 4IRIA 3CO6C 1GXPA 2BGCA 3MMYB 3Q9SA 2LMDA 1STZA 1FPQA 3GLLA 3TGNA 1X58A 3S14J 1ZGJA 2HGCA 2O8XA 3UKGA 2RGVA 1WJ5A 2ZSIB 4LG0A 4ZZDA 2JSPA 1F4KA 2K9SA 5F1RA 4Y13A 2BXYA 2ISZA 1FMWA 2D2WA 3CMMA 3CO7C 2OV7A 3HOYJ 3DTIA 5CVVA 3T5XA
chains in the Genus database with same CATH topology
2ETHA 3GFLA 2CQKA 4OU0A 2MH2A 2JPBA 3NEUA 2A6EF 4MTDA 2F5EA 1KA8A 1XGOA 4CO8A 2EFOA 5AONA 1BI3A 3LA7A 1KQ9A 2IA0A 1EH6A 2K02A 3BPVA 2HTSA 3J80Z 3CDHA 4UVBA 4MNUA 4CICA 3TQNA 3KLOA 4Q5SF 4HDVA 2RC4A 4RAZA 1K6OA 5KVRA 2O3FA 3HYIA 1S29A 4R79A 1R58A 2EV0A 1FOKA 2DLLA 2X4HA 2L01A 3F6OA 1U3EM 1MJAA 2Z9OA 1XGSA 1JE8A 5D4RA 1ZARA 3VOEA 5IT3A 1UFMA 1JHHA 1KGSA 3B73A 2VXZA 2V1DA 3RDIA 2XVCA 2A61A 1F5TA 1X3UA 2PQ8A 1QZZA 2HTJA 1R5HA 1YO5C 3FM5A 4HOBA 3GX4X 3L9FA 2LDUA 2Y75A 4EM2A 2O0YA 2EA2A 3WGIA 3J80K 1UCRA 4RGSA 2ZCWA 3I5UA 4L5IA 5HS8A 5E20A 3ZMDA 4IVNA 2VT2A 2J5OA 4HZFA 1H9GA 2CFXA 2EV5A 2VC1A 3FWEA 1R22A 2VBZA 3F6VA 4BNCA 2ZO4A 5LHIA 2MC3A 2EFPA 3F8CA 3HRMA 4RB3C 3ZMVA 5FGMA 1LVAA 5FLXK 3LAJA 1XB4A 1KU9A 1ZG5A 3FXQA 1J7KA 2XGXA 4LMYA 1D8KA 5DEQA 2FBIA 4HX8A 2PFBA 4HBLA 1QZYA 3HOTA 1J75A 5FFZA 3ML6A 4L0YB 3WTWC 3BJAA 3GWZA 2GXGA 4YFNF 2R7DA 2M87A 3U1DA 4D0PA 4KIFA 3GLXA 2QENA 3P9CA 1KQ8A 3I0TA 1QNTA 3F21A 2DK5A 2HWVA 1SD7A 4R1HA 2XAJA 1ZRCA 3W6KB 4KYWA 3V8JA 1P92A 3C3WA 2H94A 3I64A 4ZYDA 1FNNA 1WWXA 1SD5A 1HW5A 4U0WA 3C1DA 2VOOA 4M9SA 1TW3A 3K2ZA 4I01A 3RKYA 5TJJA 5IT9Z 5FD5A 1BC8C 1IXRC 1O3QA 1IN4A 3O3KA 3JAMK 2OQGA 3QU3A 2IJLA 1GHCA 4GO1A 3WTTC 1BI1A 1LDJA 5JFRA 3ZPLA 4GCVA 3QP6A 3ULQB 4KMFA 5JVTA 4CXFA 2VT3A 2K86A 2CGPA 3I59A 1FWZA 2V1UA 3QOPA 3WTZA 2TDXA 1TNSA 2L4AA 3K1PA 2D45A 4KMUX 3V7RA 5K5RA 2F2EA 4ESJA 1WKMA 1V4RA 4MHGA 2HDCA 5D8KB 1O3TA 2NRAC 1SMYF 2UZKA 4KIBA 1T38A 1XDSA 3LA2A 3RPQA 3WTYC 5BPDA 5IT9K 3GVAA 1SFXA 1LEBA 3ZP5A 4U7DA 1ZREA 1HQCA 3B02A 3IL2A 3QRFF 1YQAA 3SFZA 2FOKA 3PQJA 1Z7UA 2CWEA 2FE3A 3O6BB 3R6SA 4N9HA 1QO0D 3GF2A 3CUQC 1U5TB 3SQNA 4XBFA 2QBYB 2BE5F 3LWFA 2PLYA 3CUQA 1ON1A 1LQ1A 2EK5A 2DQLA 2FMLA 3O2PE 5ICCA 2L54A 3N4MA 5K1YA 2JRTA 1QPMA 2DW4A 2AXLA 1BI0A 3HUGA 2DFIA 4LFUA 3HRSA 2W57A 5L3BA 4UHTA 2RDPA 5ILVA 1U5TA 2QBYA 5FB2A 3L00A 2K27A 2M5WA 3RIRA 1HXDA 2XHKA 1I27A 2OA4A 4MQ9F 3QPTA 1RZ4A 4I0BA 1ZG1A 2GZWA 1XGMA 5JR3A 3S2WA 3N97A 3HHGA 1FYKA 4I2OA 5F6FA 4I02A 4G7OF 1Z1DA 2YU3A 3GZ6A 3WGGA 2NS0A 4LLNA 2EFNA 3BJ6A 5HS7A 4KIGA 4BYYA 5A2QZ 4KA4A 1YYVA 1IRGA 2MA3A 4ENJA 1DUXC 1B9NA 3TO7A 5D5XB 5HS9A 4UV9A 1TQMA 4HQEA 4M71A 3E5QA 2E7XA 2YX7A 4IHTA 1T6SA 4ETSA 3K1MA 1W5TA 4NB5A 3RKWA 4UVCA 1W7PB 5E18F 1B4AA 1FC3A 3CLOA 4IRGA 1FZPB 1BN5A 3V8KA 5D6EA 2W25A 1Q1HA 3FX3A 4TV7A 2ZBKA 1OMIA 1BIBA 4Y17A 5BQTA 1YS6A 3BWGA 3V8LA 1E2XA 2HYFA 2V6CA 1W5SA 4EJOA 4FX4A 4PGGA 1I6XA 4PDKA 3LQQA 5BOXA 3LQRA 1SMTA 4ESBA 1ONVA 1F9NA 5A2QK 2IVMA 5K5QA 1XD7A 1OYWA 2ESNA 5HDGA 4B09A 4LG0B 4WX9A 1ZHFA 3FMQA 3V4GA 2W24A 1G4DA 2K4BA 3DFGA 3GEZA 3DEUA 1ODDA 1B6AA 1BC7C 5CVIA 2EV6A 1G6NA 4WXHA 2FEZA 4UUVA 3GUDA 3C7JA 1TNTA 2FNPA 4BHCA 6PAXA 1ZYRF 4KNYA 3M8FA 1AOYA 2HZTA 4UV8A 4MEXF 3W6JB 3WG9A 4M6YA 1O3SA 5ILUA 4JQFA 2A5YB 3F72A 2RNJA 3JSPA 2QQ9A 2VBXA 4ZYEA 3VEPA 2PG4A 3H3UA 5LHHA 5AIQA 4FHTA 2VODA 4M73A 3IRRA 3ABTA 4GXOA 1PDNC 4M72A 2CW0F 1U6GA 1OYIA 4CGZA 3C18A 3GFJA 2KJCA 5L3GA 4XSZF 4HX4A 1YLFA 1FP2A 5LGTA 3L7WA 4AWXB 1IF1A 1KQ0A 1U2WA 3DXJF 5J6XA 3KP4A 4EJVA 4EMSA 4IJAA 2BV6A 4AIJA 1KU2A 3GFIA 5BMZA 4A0XA 2F5CA 4MGRA 3CJNA 2P5LC 4HA8A 2FMYA 1F1ZA 4KUMA 3QPHA 4HLYA 1K78A 4ZZLA 1SAXA 1ZAOA 3F22A 3CUOA 4KN7X 2XUBA 4QWQA 1K79A 1IXCA 3OV8A 3FZVA 1G3TA 3KE2A 4M74A 2L4MA 1RUNA 3HOSA 4BAYA 4L5JA 3K1NA 4Y15A 5FLXZ 1MJ9A 3M8EA 4E70A 4BXUA 3F23A 4G9YA 2P5KA 4YIFA 1ZG3A 3L09A 4XLNF 2Y0MA 4LK1F 3T8RA 1Y0UA 2VONA 1DP7P 1T39A 1TQPA 1BM9A 3I71A 2JSCA 1PUEE 5HLHA 3HHHA 3EYIA 2YPRA 4HV5A 4KFCA 4A5NA 2QQAA 1FYMA 4PCQA 1XCVA 1RI7A 3I53A 4HF2A 3M9AA 4I09A 1JHFA 5HDNA 1MGTA 3NQOA 2IRFG 4I0AA 1T98A 2J5PA 2H6CA 3J81K 5DYMA 4LLLA 3QU6A 2WC2A 1W4MA 2G7HA 3H92A 5K5OA 4OIRF 4EJTA 3JAMZ 5LRRA 5CVUA 2DTRA 1SD4A 2OAZA 1U78A 1I5ZA 4UXNA 5ICEA 4P96A 3RTRA 2OBPA 3K9TA 3R0JA 2Z3YA 2ZNZA 1Z9CA 4RB0A 4RGUA 3MZHA 2YR2A 1USSA 4UNOA 3ROUA 2F5DA 4A2UA 1KYWA 4RGRA 5DDGA 4UVAA 4ENKA 5TRDA 4U88A 1HSJA 4BHPA 1A04A 1HW2A 5BPIA 4Q48A 2FA5A 2GA2A 2RKHA 1S7AA 1VTNC 2EA4A 2MD5A 5AIPA 5E8IA 1HKSA 3I59B 4YFXF 1CF7B 5BS6A 3DKWA 5DUKA 4N9IA 1FBUA 2NAZA 4U0VA 1PP8F 3HIFA 4L9VA 4A6EA 3TO9A 2X0LA 1HSTA 4XRFA 3RYPA 3DPTA 2HKOA 4S05A 3NRVA 1R1VA 2LF8A 4N0BA 4I7HA 3BPXA 2QM3A 4YFKF 3MAJA 2DT5A 2R3SA 2DPDA 3T8TA 3DV8A 4XLPF 4G94A 2OQRA 2DAOA 2EB7A 4F7ZA 1CF7A 1MD0A 2QUFA 2EJRA 5CYVA 3DP7A 3E6MA 2MH9A 5CJ9A 1ZGAA 2WV0A 3H3ZA 2HQNA 3FMRA 4LLGF 2FBKA 1B1BA 1IN8A 4KDPA 2VOPA 2XROA 1R5GA 3HSFA 5FFXA 5D5WB 2G9WA 2PBIA 2DI3A 4WCGA 2QWWA 3CUQB 1TTYA 4CHUA 2XKOA 1Z6TA 5L3DA 5ICFA 2IT0A 4OIPF 2XIGA 2NYXA 3D0SA 4HF0A 4I98B 2XKPA 5HVQC 2A3SA 1YW9A 4L0ZB 4MTEA 4O5VA 4G6QA 1E17A 3D5LA 3Q9VA 1BI2A 4L9JA 1D5VA 3IWFA 2ADUA 2KKOA 5HOOA 2NNYA 5EEHA 2CG4A 2XAHA 5ED4A 5DCMB 2IA2A 1WSUA 4K2EA 1CGPA 1RIOH 4WWCA 3SZPA 3EUHA 2JPCA 4GYGA 1SFUA 4OOIA 4HYEA 3R61A 2OZUA 3IKTA 4FX0A 2JT1A 4IF4A 1IAWA 2IP2A 2PJPA 2EWNA 3VB2A 4P55A 3GFMA 4G6DA 4Q4ZF 1Z6RA 5H6QA 4WXCA 5DCMA 4EVIA 2H6BA 1IW7F 2KIUA 1NHAA 3MEXA 4ESFA 5D6FA 3P9IA 2PN6A 3ELKA 1B59A 1OPCA 3DF8A 3V7CA 2UWMA 2F5FA 1IN6A 2UXXA 3FXUA 3T0YA 3R0AA 3LSTA 1IXSB 1SD6A 1LDKB 1D8JA 3ZN1A 2LSOA 2ISYA 5LLQA 3E6DA 1Z05A 4EJUA 2Q2EA 1PP7U 5ILSA 1XGNA 1YW8A 1P4AA 4YIIA 1I1SA 1HBXG 3WE2A 1IN5A 3ZQ7A 3ECHA 1XCBA 2P7CB 3KZYA 4O3MA 2L3DA 3RKXA 3G3ZA 3I58A 4M9ZA 3ZMUA 1AWCA 1O7FA 2P6SA 4LD5A 5ICGA 3FF5A 5D4SA 2IW5A 2MLGA 1WI9A 3JW4A 5E1ZB 2UXNA 2RVCA 3P9KA 3RJPA 1R1UA 1DPUA 4AD9A 4RS8A 4G7HF 1J0RA 5DD8A 2P5VA 1YIOA 1R1TA 1LEAA 3HTUA 4G7ZF 1QQIA 3RYRA 3K69A 2E7WA 2HFHA 2M45A 1OKRA 3G73A 3MFKA 3WTXC 4IPAA 3BJOA 2FNAA 1KYZA 1GVJA 5LGNA 1LB2A 2O6GE 2PMUA 3LA3A 3PQKA 5DV5A 1SFEA 2A07F 2BBYA 1YTYA 1UHWA 5HLIA 2HQRA 2HR3A 1FSHA 1ZLKA 4ON0A 4KICA 2A68F 5CLSA 4HW0A 3QAHA 3KP7A 4KT5C 1MKMA 1LDDA 2VBYA 3JSOA 1EH8A 2HOEA 2Z5UA 4R8HA 2FRHA 5LRSA 3MQ0A 5E17F 4IHSA 3TKYA 1K78B 2XAQA 3KLNA 4WK8F 2L02A 2WTEA 2WWYA 3WTUC 4DNCA 5LHGA 3GW2A 1C0WA 3E97A 3ECOA 3KEOA 2FQ3A 1FX7A 1XSXA 4A6DA 3KETA 2HS5A 5D8LB 4OIOF 1MDMB 2RN7A 5LEKA 2KIFA 2C6YA 4LB5A 1OR7A 4XSXF 2KIMA 3J7AO 1S6LA 3GO5A 1T2KA 2O61A 2IA1A 2GWRA 5E8GA 3WE3A 2G7UA 2ZXJA 2PEXA 2CYYA 1ZRFA 3F8NA 3TOAA 2D1VA 3GYHX 3VFZA 2XAFA 2P8TA 3KP2A 1BIAA 4RB1A 5DD4A 2FSWA 3T1BA 1MDMA 3TDUC 2STWA 2A69F 2DBBA 2HEOA 4CYDA 5L3EA 3MZYA 1ZN2A 4L18B 3J81Z 2NNNA 1JXSA 3OOPA 1TLHB 1FBSA 2ELHA 2XAGA 4KN4X 5DUIA 2DO7A 2GXBA 1XSDA 3AAFA 2P6TA 4PZJA 1J5YA 4P5OA 4GGGA 1HKTA 2JZYA 3FMSA 1H0MA 2EFWA 1HKQA 2K4JA 4EV0A 1L0OC 3KP5A 1H9TA 3KFWX 3M7GA 4FT8A 3R4KA 2YX4A 1W7PD 4OMZA 3GZ5A 3FXRA 2VC0A 1XMAA 4P9UA 1G3WA 1G3YA 4ZH4F 3E6CC 4EM1A 2D1HA 2K7LA 1YFHA 1ZH5A 2EFQA 1ZRDA 2FXAA 1MJBA 1J9IA 1J2XA 4OMYA 1DPRA 3BROA 3HRTA 2BYVE 3U2RA 3U9GA 2LF7A 3WU0A 5D5UB 4NQWA 2RQPA 1FSEA 3IC7A 2Z33A 2DQRA 1USTA 1BBYA 1EH7A 4RAYA 4RB2C 4OINF 2QQBA 3EYYA 1O7LA 2W84A 5EEGA 1V3FA 1ON2A 3IWZA 3F3XA 3Q5FA 3E6BA 4IXAA 5E1XA 5E1WA 1XDUA 1IZ1A 3ABUA 5DCFA 3FM3A 1WRJA 4ENNA 3L2CA 3ISPA 2ZFWA 4OIQF 1B9MA 5L3FA 2V79A 3HTSB 1LNWA 1Z91A 2CO5A 4AIHA 1QGPA 3K0LA 1TBXA 3KP6A 3EDPA 1P2FA 3DQVC 4M6XA 2OZ6A 3KCCA 1WQ2A 3V7SA 1S8NA 1QBJA 5HLGA 1G3SA 1I1GA 3RI4A 4ZYGA 4L9TA 4G8XA 2A6HF 4HQMA 3HSRA 4A0ZA 3LAPA 2P7VB 1YS7A 5KK1A 4HLXA 1UB9A 3RPUA 2E1NA 4ZYHA 3WGHA 2IPQX 5LBQA 3LFKA 3SHFA 3KZZA 4M9XA 4A0YA 2AS5F 3BDDA 4EM0B 2PMHA 2VE9A 2STTA 2PI0A 3F8MA 3HRUA 2DU9A 4LB6B 3MWMA 5H6RA 3JTGA 1T0FA 3KP3A 2XASA 2CSOA 2DPUA 1UHMA 1S3JA 5HDKA 2ZMEB 4RGXA 2JTVA 4JK1X 4Z2YA 2R7FA 3TDZC 2BEOA 2FF4A 3SZTA 1TQIA 3WTVC 3JTHA 5ERIA 3ZMZA 2KJBA 3ZMSA 1IN7A 4DQ2A 4YG2F 1P4WA 1FY7A 3COAC 3CTAA 3SXYA 1TW2A 4JBAA 1DDNA 2VE8A 1FLIA 4EJWA 3I4PA 1XSVA 1JGSA 2ZMEA 4CZZA 1FBQA 2QYOA 2LNBA 4L9NA 5J8CA 3E5UA 1LJ9A 3BY6A 3FHZA 1ULYA 1P4XA 2ESHA 3ERED 3WU1B 3E3VA 3VODA 1FT9A 4S04A 4PGHA 2Q0OA 4WXDA 5L3CA 4HDUA 4MQVA 3DPLC 4EQQA 1D3YA 2RV8A 1U5TC 4IRHA 1BJAA 4MEYF 2H09A 2ZNYA 4NHJA 2Q8KA 3GXOA 4EGYA 3TO6A 1XN7A 2VBWA 3PFIA 2ACJA 5F64A 2XRNA 1J59A 5JI6A 4EGZA 2MBFA 4A5MA 3R60A 1O3RA 4QLCU 4AIKA 5H20A 1EV7A 1RNLA 5LEJA 4HF1A 1P6RA 2KRFA 2H27A 1IRFA 1YG2A 1R7JA 4HV6A 4U0YA 3REOA 2XV4S 2ZKZA 3HSEA 4B8XA 2LKPA 1FYLA 4ASNA 4LJZF 1REPC 4HX7A 2OU2A 5CVRA 3I54A 3ZMTA 1L3LA 3EETA 1OYYA 4BQAA 1R00A 2P4WA 5D5VB 2OD5A 2GA1A 4LK0F 1MZBA 2O03A 3MCZA 3BP8A 2Z99A 4U7BA 2M1BA 2FBHA 1S7OA 2GQQA 1YW7A 4LGWA 3IKVA 2COMA 2ZJ2A 3P7NA 5CVJA 2YSRA 4Q47A 4P9FA 4H0EA 1U8RA 1IUYA 3WODF 3EQLF 4WF2A 5FO5A 1R36A 4O6JA 3F8BA 1GXQA 1XMKA 2MLKA 3BOQA 3M1EA 4HAMA 5FD6A 4ENMA 3WTSC 1R23A 2GIVA 4BHBA 3ZN0A 2QLZA 2FU4A 1HW1A 1RUOA 4CDGA 2GAUA 2QZ8A 2V9VA 2W85A 1O57A 2QVOA 2HYGD 3IRQA 2M30A 1ZLJA 1W7PA 2Y48A 3BZ6A 5J8FA 4GYIA 3IHUA 5JHUA 2M8EA 2VN2A 1KU7A 1KU3A 2E1CA 3KEQA 3TOBA 3F8FA 2B0LA 1BOAA 4AVPA 4A12A 2V1XA 4BH9A 2DK8A 3E5XA 3QP5A 5LGUA 2HKXA 1FP1D 1K7AA 4IRIA 3CO6C 1GXPA 2BGCA 3Q9SA 1STZA 1FPQA 3TGNA 1ZGJA 2HGCA 2O8XA 2RGVA 4LG0A 4ZZDA 1F4KA 5F1RA 4Y13A 2ISZA 2D2WA 3CO7C 5CVVA 3T5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETH A;  3GFL A;  2CQK A;  4OU0 A;  2MH2 A;  2JPB A;  3NEU A;  2A6E F;  4MTD A;  2F5E A;  1KA8 A;  1XGO A;  4CO8 A;  2EFO A;  5AON A;  1BI3 A;  3LA7 A;  1KQ9 A;  2IA0 A;  1EH6 A;  2K02 A;  3BPV A;  2HTS A;  3J80 Z;  3CDH A;  4UVB A;  4MNU A;  4CIC A;  3TQN A;  3KLO A;  4Q5S F;  4HDV A;  2RC4 A;  4RAZ A;  1K6O A;  5KVR A;  2O3F A;  3HYI A;  1S29 A;  4R79 A;  1R58 A;  2EV0 A;  1FOK A;  2DLL A;  2X4H A;  2L01 A;  3F6O A;  1U3E M;  1MJA A;  2Z9O A;  1XGS A;  1JE8 A;  5D4R A;  1ZAR A;  3VOE A;  5IT3 A;  1UFM A;  1JHH A;  1KGS A;  3B73 A;  2VXZ A;  2V1D A;  3RDI A;  2XVC A;  2A61 A;  1F5T A;  1X3U A;  2PQ8 A;  1QZZ A;  2HTJ A;  1R5H A;  1YO5 C;  3FM5 A;  4HOB A;  3GX4 X;  3L9F A;  2LDU A;  2Y75 A;  4EM2 A;  2O0Y A;  2EA2 A;  3WGI A;  3J80 K;  1UCR A;  4RGS A;  2ZCW A;  3I5U A;  4L5I A;  5HS8 A;  5E20 A;  3ZMD A;  4IVN A;  2VT2 A;  2J5O A;  4HZF A;  1H9G A;  2CFX A;  2EV5 A;  2VC1 A;  3FWE A;  1R22 A;  2VBZ A;  3F6V A;  4BNC A;  2ZO4 A;  5LHI A;  2MC3 A;  2EFP A;  3F8C A;  3HRM A;  4RB3 C;  3ZMV A;  5FGM A;  1LVA A;  5FLX K;  3LAJ A;  1XB4 A;  1KU9 A;  1ZG5 A;  3FXQ A;  1J7K A;  2XGX A;  4LMY A;  1D8K A;  5DEQ A;  2FBI A;  4HX8 A;  2PFB A;  4HBL A;  1QZY A;  3HOT A;  1J75 A;  5FFZ A;  3ML6 A;  4L0Y B;  3WTW C;  3BJA A;  3GWZ A;  2GXG A;  4YFN F;  2R7D A;  2M87 A;  3U1D A;  4D0P A;  4KIF A;  3GLX A;  2QEN A;  3P9C A;  1KQ8 A;  3I0T A;  1QNT A;  3F21 A;  2DK5 A;  2HWV A;  1SD7 A;  4R1H A;  2XAJ A;  1ZRC A;  3W6K B;  4KYW A;  3V8J A;  1P92 A;  3C3W A;  2H94 A;  3I64 A;  4ZYD A;  1FNN A;  1WWX A;  1SD5 A;  1HW5 A;  4U0W A;  3C1D A;  2VOO A;  4M9S A;  1TW3 A;  3K2Z A;  4I01 A;  3RKY A;  5TJJ A;  5IT9 Z;  5FD5 A;  1BC8 C;  1IXR C;  1O3Q A;  1IN4 A;  3O3K A;  3JAM K;  2OQG A;  3QU3 A;  2IJL A;  1GHC A;  4GO1 A;  3WTT C;  1BI1 A;  1LDJ A;  5JFR A;  3ZPL A;  4GCV A;  3QP6 A;  3ULQ B;  4KMF A;  5JVT A;  4CXF A;  2VT3 A;  2K86 A;  2CGP A;  3I59 A;  1FWZ A;  2V1U A;  3QOP A;  3WTZ A;  2TDX A;  1TNS A;  2L4A A;  3K1P A;  2D45 A;  4KMU X;  3V7R A;  5K5R A;  2F2E A;  4ESJ A;  1WKM A;  1V4R A;  4MHG A;  2HDC A;  5D8K B;  1O3T A;  2NRA C;  1SMY F;  2UZK A;  4KIB A;  1T38 A;  1XDS A;  3LA2 A;  3RPQ A;  3WTY C;  5BPD A;  5IT9 K;  3GVA A;  1SFX A;  1LEB A;  3ZP5 A;  4U7D A;  1ZRE A;  1HQC A;  3B02 A;  3IL2 A;  3QRF F;  1YQA A;  3SFZ A;  2FOK A;  3PQJ A;  1Z7U A;  2CWE A;  2FE3 A;  3O6B B;  3R6S A;  4N9H A;  1QO0 D;  3GF2 A;  3CUQ C;  1U5T B;  3SQN A;  4XBF A;  2QBY B;  2BE5 F;  3LWF A;  2PLY A;  3CUQ A;  1ON1 A;  1LQ1 A;  2EK5 A;  2DQL A;  2FML A;  3O2P E;  5ICC A;  2L54 A;  3N4M A;  5K1Y A;  2JRT A;  1QPM A;  2DW4 A;  2AXL A;  1BI0 A;  3HUG A;  2DFI A;  4LFU A;  3HRS A;  2W57 A;  5L3B A;  4UHT A;  2RDP A;  5ILV A;  1U5T A;  2QBY A;  5FB2 A;  3L00 A;  2K27 A;  2M5W A;  3RIR A;  1HXD A;  2XHK A;  1I27 A;  2OA4 A;  4MQ9 F;  3QPT A;  1RZ4 A;  4I0B A;  1ZG1 A;  2GZW A;  1XGM A;  5JR3 A;  3S2W A;  3N97 A;  3HHG A;  1FYK A;  4I2O A;  5F6F A;  4I02 A;  4G7O F;  1Z1D A;  2YU3 A;  3GZ6 A;  3WGG A;  2NS0 A;  4LLN A;  2EFN A;  3BJ6 A;  5HS7 A;  4KIG A;  4BYY A;  5A2Q Z;  4KA4 A;  1YYV A;  1IRG A;  2MA3 A;  4ENJ A;  1DUX C;  1B9N A;  3TO7 A;  5D5X B;  5HS9 A;  4UV9 A;  1TQM A;  4HQE A;  4M71 A;  3E5Q A;  2E7X A;  2YX7 A;  4IHT A;  1T6S A;  4ETS A;  3K1M A;  1W5T A;  4NB5 A;  3RKW A;  4UVC A;  1W7P B;  5E18 F;  1B4A A;  1FC3 A;  3CLO A;  4IRG A;  1FZP B;  1BN5 A;  3V8K A;  5D6E A;  2W25 A;  1Q1H A;  3FX3 A;  4TV7 A;  2ZBK A;  1OMI A;  1BIB A;  4Y17 A;  5BQT A;  1YS6 A;  3BWG A;  3V8L A;  1E2X A;  2HYF A;  2V6C A;  1W5S A;  4EJO A;  4FX4 A;  4PGG A;  1I6X A;  4PDK A;  3LQQ A;  5BOX A;  3LQR A;  1SMT A;  4ESB A;  1ONV A;  1F9N A;  5A2Q K;  2IVM A;  5K5Q A;  1XD7 A;  1OYW A;  2ESN A;  5HDG A;  4B09 A;  4LG0 B;  4WX9 A;  1ZHF A;  3FMQ A;  3V4G A;  2W24 A;  1G4D A;  2K4B A;  3DFG A;  3GEZ A;  3DEU A;  1ODD A;  1B6A A;  1BC7 C;  5CVI A;  2EV6 A;  1G6N A;  4WXH A;  2FEZ A;  4UUV A;  3GUD A;  3C7J A;  1TNT A;  2FNP A;  4BHC A;  6PAX A;  1ZYR F;  4KNY A;  3M8F A;  1AOY A;  2HZT A;  4UV8 A;  4MEX F;  3W6J B;  3WG9 A;  4M6Y A;  1O3S A;  5ILU A;  4JQF A;  2A5Y B;  3F72 A;  2RNJ A;  3JSP A;  2QQ9 A;  2VBX A;  4ZYE A;  3VEP A;  2PG4 A;  3H3U A;  5LHH A;  5AIQ A;  4FHT A;  2VOD A;  4M73 A;  3IRR A;  3ABT A;  4GXO A;  1PDN C;  4M72 A;  2CW0 F;  1U6G A;  1OYI A;  4CGZ A;  3C18 A;  3GFJ A;  2KJC A;  5L3G A;  4XSZ F;  4HX4 A;  1YLF A;  1FP2 A;  5LGT A;  3L7W A;  4AWX B;  1IF1 A;  1KQ0 A;  1U2W A;  3DXJ F;  5J6X A;  3KP4 A;  4EJV A;  4EMS A;  4IJA A;  2BV6 A;  4AIJ A;  1KU2 A;  3GFI A;  5BMZ A;  4A0X A;  2F5C A;  4MGR A;  3CJN A;  2P5L C;  4HA8 A;  2FMY A;  1F1Z A;  4KUM A;  3QPH A;  4HLY A;  1K78 A;  4ZZL A;  1SAX A;  1ZAO A;  3F22 A;  3CUO A;  4KN7 X;  2XUB A;  4QWQ A;  1K79 A;  1IXC A;  3OV8 A;  3FZV A;  1G3T A;  3KE2 A;  4M74 A;  2L4M A;  1RUN A;  3HOS A;  4BAY A;  4L5J A;  3K1N A;  4Y15 A;  5FLX Z;  1MJ9 A;  3M8E A;  4E70 A;  4BXU A;  3F23 A;  4G9Y A;  2P5K A;  4YIF A;  1ZG3 A;  3L09 A;  4XLN F;  2Y0M A;  4LK1 F;  3T8R A;  1Y0U A;  2VON A;  1DP7 P;  1T39 A;  1TQP A;  1BM9 A;  3I71 A;  2JSC A;  1PUE E;  5HLH A;  3HHH A;  3EYI A;  2YPR A;  4HV5 A;  4KFC A;  4A5N A;  2QQA A;  1FYM A;  4PCQ A;  1XCV A;  1RI7 A;  3I53 A;  4HF2 A;  3M9A A;  4I09 A;  1JHF A;  5HDN A;  1MGT A;  3NQO A;  2IRF G;  4I0A A;  1T98 A;  2J5P A;  2H6C A;  3J81 K;  5DYM A;  4LLL A;  3QU6 A;  2WC2 A;  1W4M A;  2G7H A;  3H92 A;  5K5O A;  4OIR F;  4EJT A;  3JAM Z;  5LRR A;  5CVU A;  2DTR A;  1SD4 A;  2OAZ A;  1U78 A;  1I5Z A;  4UXN A;  5ICE A;  4P96 A;  3RTR A;  2OBP A;  3K9T A;  3R0J A;  2Z3Y A;  2ZNZ A;  1Z9C A;  4RB0 A;  4RGU A;  3MZH A;  2YR2 A;  1USS A;  4UNO A;  3ROU A;  2F5D A;  4A2U A;  1KYW A;  4RGR A;  5DDG A;  4UVA A;  4ENK A;  5TRD A;  4U88 A;  1HSJ A;  4BHP A;  1A04 A;  1HW2 A;  5BPI A;  4Q48 A;  2FA5 A;  2GA2 A;  2RKH A;  1S7A A;  1VTN C;  2EA4 A;  2MD5 A;  5AIP A;  5E8I A;  1HKS A;  3I59 B;  4YFX F;  1CF7 B;  5BS6 A;  3DKW A;  5DUK A;  4N9I A;  1FBU A;  2NAZ A;  4U0V A;  1PP8 F;  3HIF A;  4L9V A;  4A6E A;  3TO9 A;  2X0L A;  1HST A;  4XRF A;  3RYP A;  3DPT A;  2HKO A;  4S05 A;  3NRV A;  1R1V A;  2LF8 A;  4N0B A;  4I7H A;  3BPX A;  2QM3 A;  4YFK F;  3MAJ A;  2DT5 A;  2R3S A;  2DPD A;  3T8T A;  3DV8 A;  4XLP F;  4G94 A;  2OQR A;  2DAO A;  2EB7 A;  4F7Z A;  1CF7 A;  1MD0 A;  2QUF A;  2EJR A;  5CYV A;  3DP7 A;  3E6M A;  2MH9 A;  5CJ9 A;  1ZGA A;  2WV0 A;  3H3Z A;  2HQN A;  3FMR A;  4LLG F;  2FBK A;  1B1B A;  1IN8 A;  4KDP A;  2VOP A;  2XRO A;  1R5G A;  3HSF A;  5FFX A;  5D5W B;  2G9W A;  2PBI A;  2DI3 A;  4WCG A;  2QWW A;  3CUQ B;  1TTY A;  4CHU A;  2XKO A;  1Z6T A;  5L3D A;  5ICF A;  2IT0 A;  4OIP F;  2XIG A;  2NYX A;  3D0S A;  4HF0 A;  4I98 B;  2XKP A;  5HVQ C;  2A3S A;  1YW9 A;  4L0Z B;  4MTE A;  4O5V A;  4G6Q A;  1E17 A;  3D5L A;  3Q9V A;  1BI2 A;  4L9J A;  1D5V A;  3IWF A;  2ADU A;  2KKO A;  5HOO A;  2NNY A;  5EEH A;  2CG4 A;  2XAH A;  5ED4 A;  5DCM B;  2IA2 A;  1WSU A;  4K2E A;  1CGP A;  1RIO H;  4WWC A;  3SZP A;  3EUH A;  2JPC A;  4GYG A;  1SFU A;  4OOI A;  4HYE A;  3R61 A;  2OZU A;  3IKT A;  4FX0 A;  2JT1 A;  4IF4 A;  1IAW A;  2IP2 A;  2PJP A;  2EWN A;  3VB2 A;  4P55 A;  3GFM A;  4G6D A;  4Q4Z F;  1Z6R A;  5H6Q A;  4WXC A;  5DCM A;  4EVI A;  2H6B A;  1IW7 F;  2KIU A;  1NHA A;  3MEX A;  4ESF A;  5D6F A;  3P9I A;  2PN6 A;  3ELK A;  1B59 A;  1OPC A;  3DF8 A;  3V7C A;  2UWM A;  2F5F A;  1IN6 A;  2UXX A;  3FXU A;  3T0Y A;  3R0A A;  3LST A;  1IXS B;  1SD6 A;  1LDK B;  1D8J A;  3ZN1 A;  2LSO A;  2ISY A;  5LLQ A;  3E6D A;  1Z05 A;  4EJU A;  2Q2E A;  1PP7 U;  5ILS A;  1XGN A;  1YW8 A;  1P4A A;  4YII A;  1I1S A;  1HBX G;  3WE2 A;  1IN5 A;  3ZQ7 A;  3ECH A;  1XCB A;  2P7C B;  3KZY A;  4O3M A;  2L3D A;  3RKX A;  3G3Z A;  3I58 A;  4M9Z A;  3ZMU A;  1AWC A;  1O7F A;  2P6S A;  4LD5 A;  5ICG A;  3FF5 A;  5D4S A;  2IW5 A;  2MLG A;  1WI9 A;  3JW4 A;  5E1Z B;  2UXN A;  2RVC A;  3P9K A;  3RJP A;  1R1U A;  1DPU A;  4AD9 A;  4RS8 A;  4G7H F;  1J0R A;  5DD8 A;  2P5V A;  1YIO A;  1R1T A;  1LEA A;  3HTU A;  4G7Z F;  1QQI A;  3RYR A;  3K69 A;  2E7W A;  2HFH A;  2M45 A;  1OKR A;  3G73 A;  3MFK A;  3WTX C;  4IPA A;  3BJO A;  2FNA A;  1KYZ A;  1GVJ A;  5LGN A;  1LB2 A;  2O6G E;  2PMU A;  3LA3 A;  3PQK A;  5DV5 A;  1SFE A;  2A07 F;  2BBY A;  1YTY A;  1UHW A;  5HLI A;  2HQR A;  2HR3 A;  1FSH A;  1ZLK A;  4ON0 A;  4KIC A;  2A68 F;  5CLS A;  4HW0 A;  3QAH A;  3KP7 A;  4KT5 C;  1MKM A;  1LDD A;  2VBY A;  3JSO A;  1EH8 A;  2HOE A;  2Z5U A;  4R8H A;  2FRH A;  5LRS A;  3MQ0 A;  5E17 F;  4IHS A;  3TKY A;  1K78 B;  2XAQ A;  3KLN A;  4WK8 F;  2L02 A;  2WTE A;  2WWY A;  3WTU C;  4DNC A;  5LHG A;  3GW2 A;  1C0W A;  3E97 A;  3ECO A;  3KEO A;  2FQ3 A;  1FX7 A;  1XSX A;  4A6D A;  3KET A;  2HS5 A;  5D8L B;  4OIO F;  1MDM B;  2RN7 A;  5LEK A;  2KIF A;  2C6Y A;  4LB5 A;  1OR7 A;  4XSX F;  2KIM A;  3J7A O;  1S6L A;  3GO5 A;  1T2K A;  2O61 A;  2IA1 A;  2GWR A;  5E8G A;  3WE3 A;  2G7U A;  2ZXJ A;  2PEX A;  2CYY A;  1ZRF A;  3F8N A;  3TOA A;  2D1V A;  3GYH X;  3VFZ A;  2XAF A;  2P8T A;  3KP2 A;  1BIA A;  4RB1 A;  5DD4 A;  2FSW A;  3T1B A;  1MDM A;  3TDU C;  2STW A;  2A69 F;  2DBB A;  2HEO A;  4CYD A;  5L3E A;  3MZY A;  1ZN2 A;  4L18 B;  3J81 Z;  2NNN A;  1JXS A;  3OOP A;  1TLH B;  1FBS A;  2ELH A;  2XAG A;  4KN4 X;  5DUI A;  2DO7 A;  2GXB A;  1XSD A;  3AAF A;  2P6T A;  4PZJ A;  1J5Y A;  4P5O A;  4GGG A;  1HKT A;  2JZY A;  3FMS A;  1H0M A;  2EFW A;  1HKQ A;  2K4J A;  4EV0 A;  1L0O C;  3KP5 A;  1H9T A;  3KFW X;  3M7G A;  4FT8 A;  3R4K A;  2YX4 A;  1W7P D;  4OMZ A;  3GZ5 A;  3FXR A;  2VC0 A;  1XMA A;  4P9U A;  1G3W A;  1G3Y A;  4ZH4 F;  3E6C C;  4EM1 A;  2D1H A;  2K7L A;  1YFH A;  1ZH5 A;  2EFQ A;  1ZRD A;  2FXA A;  1MJB A;  1J9I A;  1J2X A;  4OMY A;  1DPR A;  3BRO A;  3HRT A;  2BYV E;  3U2R A;  3U9G A;  2LF7 A;  3WU0 A;  5D5U B;  4NQW A;  2RQP A;  1FSE A;  3IC7 A;  2Z33 A;  2DQR A;  1UST A;  1BBY A;  1EH7 A;  4RAY A;  4RB2 C;  4OIN F;  2QQB A;  3EYY A;  1O7L A;  2W84 A;  5EEG A;  1V3F A;  1ON2 A;  3IWZ A;  3F3X A;  3Q5F A;  3E6B A;  4IXA A;  5E1X A;  5E1W A;  1XDU A;  1IZ1 A;  3ABU A;  5DCF A;  3FM3 A;  1WRJ A;  4ENN A;  3L2C A;  3ISP A;  2ZFW A;  4OIQ F;  1B9M A;  5L3F A;  2V79 A;  3HTS B;  1LNW A;  1Z91 A;  2CO5 A;  4AIH A;  1QGP A;  3K0L A;  1TBX A;  3KP6 A;  3EDP A;  1P2F A;  3DQV C;  4M6X A;  2OZ6 A;  3KCC A;  1WQ2 A;  3V7S A;  1S8N A;  1QBJ A;  5HLG A;  1G3S A;  1I1G A;  3RI4 A;  4ZYG A;  4L9T A;  4G8X A;  2A6H F;  4HQM A;  3HSR A;  4A0Z A;  3LAP A;  2P7V B;  1YS7 A;  5KK1 A;  4HLX A;  1UB9 A;  3RPU A;  2E1N A;  4ZYH A;  3WGH A;  2IPQ X;  5LBQ A;  3LFK A;  3SHF A;  3KZZ A;  4M9X A;  4A0Y A;  2AS5 F;  3BDD A;  4EM0 B;  2PMH A;  2VE9 A;  2STT A;  2PI0 A;  3F8M A;  3HRU A;  2DU9 A;  4LB6 B;  3MWM A;  5H6R A;  3JTG A;  1T0F A;  3KP3 A;  2XAS A;  2CSO A;  2DPU A;  1UHM A;  1S3J A;  5HDK A;  2ZME B;  4RGX A;  2JTV A;  4JK1 X;  4Z2Y A;  2R7F A;  3TDZ C;  2BEO A;  2FF4 A;  3SZT A;  1TQI A;  3WTV C;  3JTH A;  5ERI A;  3ZMZ A;  2KJB A;  3ZMS A;  1IN7 A;  4DQ2 A;  4YG2 F;  1P4W A;  1FY7 A;  3COA C;  3CTA A;  3SXY A;  1TW2 A;  4JBA A;  1DDN A;  2VE8 A;  1FLI A;  4EJW A;  3I4P A;  1XSV A;  1JGS A;  2ZME A;  4CZZ A;  1FBQ A;  2QYO A;  2LNB A;  4L9N A;  5J8C A;  3E5U A;  1LJ9 A;  3BY6 A;  3FHZ A;  1ULY A;  1P4X A;  2ESH A;  3ERE D;  3WU1 B;  3E3V A;  3VOD A;  1FT9 A;  4S04 A;  4PGH A;  2Q0O A;  4WXD A;  5L3C A;  4HDU A;  4MQV A;  3DPL C;  4EQQ A;  1D3Y A;  2RV8 A;  1U5T C;  4IRH A;  1BJA A;  4MEY F;  2H09 A;  2ZNY A;  4NHJ A;  2Q8K A;  3GXO A;  4EGY A;  3TO6 A;  1XN7 A;  2VBW A;  3PFI A;  2ACJ A;  5F64 A;  2XRN A;  1J59 A;  5JI6 A;  4EGZ A;  2MBF A;  4A5M A;  3R60 A;  1O3R A;  4QLC U;  4AIK A;  5H20 A;  1EV7 A;  1RNL A;  5LEJ A;  4HF1 A;  1P6R A;  2KRF A;  2H27 A;  1IRF A;  1YG2 A;  1R7J A;  4HV6 A;  4U0Y A;  3REO A;  2XV4 S;  2ZKZ A;  3HSE A;  4B8X A;  2LKP A;  1FYL A;  4ASN A;  4LJZ F;  1REP C;  4HX7 A;  2OU2 A;  5CVR A;  3I54 A;  3ZMT A;  1L3L A;  3EET A;  1OYY A;  4BQA A;  1R00 A;  2P4W A;  5D5V B;  2OD5 A;  2GA1 A;  4LK0 F;  1MZB A;  2O03 A;  3MCZ A;  3BP8 A;  2Z99 A;  4U7B A;  2M1B A;  2FBH A;  1S7O A;  2GQQ A;  1YW7 A;  4LGW A;  3IKV A;  2COM A;  2ZJ2 A;  3P7N A;  5CVJ A;  2YSR A;  4Q47 A;  4P9F A;  4H0E A;  1U8R A;  1IUY A;  3WOD F;  3EQL F;  4WF2 A;  5FO5 A;  1R36 A;  4O6J A;  3F8B A;  1GXQ A;  1XMK A;  2MLK A;  3BOQ A;  3M1E A;  4HAM A;  5FD6 A;  4ENM A;  3WTS C;  1R23 A;  2GIV A;  4BHB A;  3ZN0 A;  2QLZ A;  2FU4 A;  1HW1 A;  1RUO A;  4CDG A;  2GAU A;  2QZ8 A;  2V9V A;  2W85 A;  1O57 A;  2QVO A;  2HYG D;  3IRQ A;  2M30 A;  1ZLJ A;  1W7P A;  2Y48 A;  3BZ6 A;  5J8F A;  4GYI A;  3IHU A;  5JHU A;  2M8E A;  2VN2 A;  1KU7 A;  1KU3 A;  2E1C A;  3KEQ A;  3TOB A;  3F8F A;  2B0L A;  1BOA A;  4AVP A;  4A12 A;  2V1X A;  4BH9 A;  2DK8 A;  3E5X A;  3QP5 A;  5LGU A;  2HKX A;  1FP1 D;  1K7A A;  4IRI A;  3CO6 C;  1GXP A;  2BGC A;  3Q9S A;  1STZ A;  1FPQ A;  3TGN A;  1ZGJ A;  2HGC A;  2O8X A;  2RGV A;  4LG0 A;  4ZZD A;  1F4K A;  5F1R A;  4Y13 A;  2ISZ A;  2D2W A;  3CO7 C;  5CVV A;  3T5X A; 
#chains in the Genus database with same CATH topology
 2ETH A;  3GFL A;  2CQK A;  2KZG A;  2ME6 A;  4OU0 A;  5M5Y J;  1S5L C;  2MH2 A;  3MKZ A;  2JPB A;  3NEU A;  2A6E F;  4MTD A;  2F5E A;  1K4S A;  1KA8 A;  1IJW C;  3BR1 A;  1YHQ I;  2JVH A;  3GTP J;  1XGO A;  4BL0 B;  2ZXI A;  4CO8 A;  2EFO A;  1OCZ H;  5AON A;  1BI3 A;  3LA7 A;  1KQ9 A;  3HL2 A;  2IA0 A;  1EH6 A;  2K02 A;  3JRA A;  4NC8 A;  2G0E A;  4RA2 A;  3L2R A;  3CD6 I;  3BPV A;  3S3M A;  2HTS A;  1QHH D;  3J80 Z;  3CDH A;  4UVB A;  4UB8 C;  4MNU A;  4CIC A;  2E1M C;  5EG0 B;  5EJC A;  3TQN A;  3G1L A;  3KLO A;  3C2B A;  5GPC A;  3CF5 F;  4Q5S F;  2YUS A;  4HDV A;  2RC4 A;  2XF6 A;  2VAS A;  4RAZ A;  1K6O A;  2HDD A;  2WY8 Q;  5KVR A;  4A3I J;  2O3F A;  4IEJ A;  3HYI A;  2DJN A;  1S29 A;  4R79 A;  2LYC A;  3QYE A;  1R58 A;  2EV0 A;  1ZK8 A;  1FOK A;  1MMG A;  2DLL A;  2X4H A;  3RCO A;  2DDA A;  1VQN I;  2L01 A;  3F6O A;  1U3E M;  1MJA A;  4AYB A;  2ZJP F;  2Z9O A;  1XGS A;  1QVU A;  1Z0X A;  5EGO B;  5HNF A;  1JE8 A;  3ZGK A;  5HOD A;  5D4R A;  1ZAR A;  2KHM A;  4XRS G;  3K2A A;  3VOE A;  3ONQ A;  1NTC A;  1UFM A;  5IT3 A;  4NC7 A;  3OL4 A;  1JHH A;  1KGS A;  3B73 A;  3MVP A;  2VXZ A;  2V1D A;  3RDI A;  2XVC A;  2A61 A;  1F5T A;  3KYL A;  1X3U A;  3PNT A;  2PQ8 A;  1D0X A;  1QZZ A;  2KRH A;  2HTJ A;  1R5H A;  1V5F A;  2BY3 A;  3DKX A;  3A01 B;  1YO5 C;  1FTT A;  3FM5 A;  4HOB A;  4M3E A;  1P9Q C;  4NQW B;  3GX4 X;  2XPU A;  3E7L A;  3L9F A;  1SEU A;  2BZT A;  2F4M B;  2LDU A;  1Z3X A;  2Y75 A;  4EM2 A;  2O0Y A;  2EA2 A;  4DBR A;  3WGI A;  2VQL A;  3J80 K;  3FK6 A;  4V2F A;  1Z3Y A;  2DT6 A;  2DFH A;  2QA4 I;  1UCR A;  3S93 A;  4RGS A;  3K4C A;  3BQZ A;  2ZCW A;  2R5Z A;  2DA5 A;  4M3D A;  3FXL A;  3WG7 H;  3I5U A;  4L5I A;  5HS8 A;  4JYK A;  5E20 A;  3RQ4 A;  3ZMD A;  3MZ8 A;  4IVN A;  2M3A A;  1CQT A;  4BY1 J;  2VT2 A;  1RKW A;  3WHC A;  1ETW A;  2BHZ A;  2J5O A;  3OR1 C;  4HZF A;  2KL4 A;  3TP3 A;  3OMY A;  1H9G A;  3CJT B;  2CFX A;  2EV5 A;  2VC1 A;  3FWE A;  1R22 A;  4DZJ A;  3A01 A;  2VBZ A;  3F6V A;  4BDY A;  1BA5 A;  4BNC A;  2VI6 A;  4ZTJ A;  4CA0 A;  2ZO4 A;  1ETQ A;  5LHI A;  2MC3 A;  2NS8 A;  3HG9 A;  3UR3 C;  3BZC A;  2EFP A;  3F8C A;  2R7V A;  3HRM A;  4XRM A;  2KDZ A;  4RB3 C;  3ZMV A;  1MBH A;  4D5C A;  3A0B C;  3HEF A;  5FGM A;  4DOZ A;  1BOB A;  1LVA A;  2E5N A;  1HF0 A;  5FLX K;  4A93 J;  1A6I A;  1HCR A;  2R7Q A;  1XB4 A;  3LAJ A;  1KU9 A;  2DCE A;  3OYK A;  1ZG5 A;  3FXQ A;  2V26 A;  1J7K A;  2CQN A;  2XGX A;  4LMY A;  1D8K A;  2AO9 A;  5DEQ A;  2FBI A;  3BR6 A;  2DDB A;  4HX8 A;  4E7Z A;  3GTL J;  2PFB A;  1A5J A;  4HBL A;  1QZY A;  4PUS A;  3HOT A;  2ICW G;  5FKK A;  1LUJ B;  2VPR A;  2Z2S B;  1J75 A;  5FFZ A;  3ML6 A;  4L0Y B;  4IHX A;  3WTW C;  3BG9 A;  3L2U A;  3BJA A;  3GWZ A;  2GXG A;  4YFN F;  2R7D A;  2DMP A;  2M87 A;  3U1D A;  4D0P A;  4A3M J;  3GCM A;  2FOW A;  3BTL A;  4KIF A;  1WPK A;  1I3A A;  1LE8 B;  3GLX A;  1RET A;  2QEN A;  3P9C A;  2QQ8 A;  4KJZ A;  1KQ8 A;  2HPM A;  3I0T A;  1QNT A;  3P5J A;  4MO7 A;  5TGT A;  2CUF A;  3VYR B;  3F21 A;  3OR2 C;  2DK5 A;  1HA8 A;  2HWV A;  1SD7 A;  4R1H A;  2JMW A;  2XAJ A;  3H0D A;  2MD0 A;  1ZRC A;  3HBL A;  3W6K B;  4KYW A;  5FLM J;  3FIS A;  3V8J A;  2L2O A;  1P92 A;  3C3W A;  2GM4 A;  2H94 A;  3I64 A;  3CCU I;  1JKP C;  4ZYD A;  1FNN A;  1WWX A;  4BJ6 C;  2B9S A;  1SD5 A;  1HW5 A;  1E3H A;  4U0W A;  3D5R C;  3TMO A;  2GLO A;  1BR1 A;  3C1D A;  2VOO A;  4M9S A;  1IC8 A;  1ZQ3 P;  1TW3 A;  2DA3 A;  2DOA A;  3S15 J;  4NNJ A;  3BTI A;  3K2Z A;  2BXZ A;  1IDZ A;  4I01 A;  1JT6 A;  5TJJ A;  2BY1 A;  5FD5 A;  3RKY A;  5J47 A;  1BC8 C;  1IXR C;  5IT9 Z;  1O3Q A;  1IN4 A;  3O3K A;  3JAM K;  2OCC H;  2OQG A;  3QU3 A;  2IJL A;  1GHC A;  4GO1 A;  5B1A H;  2IXS A;  3WTT C;  2E2J J;  1BI1 A;  1LDJ A;  1EKE A;  5JFR A;  2AQE A;  3G71 I;  3ZPL A;  3HPH A;  4GCV A;  3QP6 A;  3ULQ B;  3JRC A;  3KPH A;  4KMF A;  2XGE A;  5JVT A;  3CC7 I;  1H8A C;  3ZXS A;  4CSW A;  4CXF A;  2VT3 A;  2K86 A;  1QA6 A;  3IH4 A;  2N8G A;  2K40 A;  3K4M A;  4LG3 A;  3KIO A;  1GT0 C;  2CU7 A;  3I59 A;  2CGP A;  2CUJ A;  1FWZ A;  4L5E A;  4HNU A;  2V1U A;  3QOP A;  2M9H A;  4EAT A;  4E4H A;  3AL0 B;  3WTZ A;  2TDX A;  1U9N A;  3CLQ A;  3M07 A;  1TNS A;  2L4A A;  3K1P A;  2D45 A;  2CQQ A;  4A3C J;  4AVZ A;  4KMU X;  2W7N A;  2I8D A;  3U21 A;  3TED A;  3S3N A;  2LVS A;  3OY9 A;  3V7R A;  5K5R A;  1SFO J;  2F2E A;  2QSH X;  4HEA 2;  4ESJ A;  1WKM A;  4GRI A;  3HJE A;  3LSJ A;  1V4R A;  2M8G X;  2M34 A;  4MHG A;  2IS2 A;  3DEE A;  2HDC A;  3W3C A;  1JKQ C;  3OL3 A;  2ECC A;  2WAF A;  5D8K B;  1NK2 P;  3I56 I;  3LNQ A;  1O3T A;  2NRA C;  1SMY F;  5IP7 J;  2UZK A;  1FIA A;  4KIB A;  1T38 A;  1XDS A;  1O4X A;  2QGU A;  1ENH A;  3LA2 A;  2XB0 X;  4JOM A;  3RPQ A;  3WTY C;  5BPD A;  5IT9 K;  1VQO I;  3GVA A;  4RM2 A;  4FIS A;  1SFX A;  1LEB A;  1OJL A;  3ZP5 A;  1MIJ A;  3S17 J;  1WJE A;  4U7D A;  1TWH J;  2JJ7 A;  2ECB A;  4ITV A;  1WGX A;  1ZRE A;  2DMN A;  3PO2 J;  1HQC A;  4F3Q A;  3JR9 A;  5BNG A;  2E1O A;  3B02 A;  3IL2 A;  1GVD A;  3HUG B;  1YQA A;  3QRF F;  3SFZ A;  2FOK A;  3PQJ A;  4JX4 A;  1Z7U A;  2CWE A;  2FE3 A;  3O6B B;  3R6S A;  3CZ6 A;  2NVX J;  4N9H A;  4CYC B;  1WJF A;  2BVM A;  1QO0 D;  2MW8 A;  5IPA A;  1WJD A;  3GF2 A;  2DOE A;  2E60 A;  3A2K A;  3CUQ C;  1U5T B;  3SQN A;  4XBF A;  2QBY B;  2BE5 F;  4A3J J;  3LWF A;  4IHV A;  1UZC A;  2PLY A;  2R7W A;  3LOC A;  3N05 A;  1JI8 A;  4A3B J;  3CUQ A;  1MBF A;  1ON1 A;  1LQ1 A;  3EUH C;  2EK5 A;  1SC7 A;  1N25 A;  3K6G A;  2GOX B;  2DQL A;  1MMN A;  2FML A;  2IGK A;  3O2P E;  2L54 A;  5ICC A;  3N4M A;  5K1Y A;  1XMX A;  2CV1 A;  3MN2 A;  2JRT A;  1U9O A;  1QPM A;  2DW4 A;  3OOU A;  3W2V A;  1MBG A;  2M4K A;  2AXL A;  2I10 A;  3DWL E;  3OIQ A;  5FLV A;  1BI0 A;  2E34 A;  3HUG A;  2LG4 A;  2DFI A;  3TW7 A;  2OJE D;  4LFU A;  3HRS A;  2R7T A;  2X48 A;  4FQG A;  2W57 A;  5L3B A;  5DM6 F;  3CCJ I;  3TW6 A;  3PSF A;  4C9Y A;  5M3M J;  4UHT A;  2RDP A;  5E3M A;  1HDP A;  3K10 A;  5ILV A;  4JX6 A;  1U5T A;  2VPL A;  3AG3 H;  2R7R A;  2QBY A;  3FDY A;  5J40 A;  2DFF A;  5FB2 A;  3D1N I;  1VQ5 I;  2EBI A;  2FQ4 A;  3SEQ A;  3L00 A;  5KCM A;  2OTJ I;  1XC5 A;  2K27 A;  2M5W A;  4Y4R A;  2DOF A;  4M3G A;  3RIR A;  1HXD A;  2XHK A;  1G2H A;  1I27 A;  2OA4 A;  4PJJ A;  3L2Q A;  2UV1 A;  4MQ9 F;  2FJ1 A;  2H1L A;  3QPT A;  1RZ4 A;  1ACI A;  1Y56 A;  4LOC A;  4I0B A;  3BG5 A;  2KLO A;  3OYH A;  1ZG1 A;  3HPG A;  1R71 A;  2GZW A;  2R4G A;  3LSG A;  3RSN A;  1XGM A;  2VKE A;  2CW7 A;  5JR3 A;  3DTK A;  1YOV B;  3S2W A;  3U1K A;  3N97 A;  3ASN H;  2LBF A;  1VQP I;  2EQR A;  5KAI C;  3HHG A;  2W00 A;  1FYK A;  4I2O A;  5F6F A;  4I02 A;  2IS1 A;  3IAS 2;  4G7O F;  1Z1D A;  2YU3 A;  3IUO A;  3GZ6 A;  4C30 A;  3WGG A;  3H9Q A;  2LY2 A;  1Q1V A;  2K3F A;  2NS0 A;  3O8H A;  4LLN A;  1Y1W J;  3G6E I;  4XOP A;  2X6X A;  2EFN A;  4IHY A;  2MG4 A;  1RKT A;  3BJ6 A;  3G2B A;  5HS7 A;  4KIG A;  4BYY A;  3BTC A;  5A2Q Z;  4KA4 A;  3MD2 A;  1G59 A;  1YYV A;  2F6C A;  2MA3 A;  3FXJ A;  1IRG A;  4LIU A;  4ENJ A;  1E3P A;  4V2G A;  1DUX C;  5E79 C;  1P7I A;  2DA1 A;  2ZJR F;  1B9N A;  3TO7 A;  2PX9 A;  5D5X B;  2VB6 A;  5HS9 A;  3Q0W A;  4UV9 A;  1TQM A;  4HQE A;  2DMQ A;  4M71 A;  3E5Q A;  4DYR A;  4J19 A;  5IOZ A;  2WAQ N;  2E7X A;  5GPA A;  2DYS H;  3PNV A;  4PJ0 C;  2YX7 A;  3A1Y A;  4IHT A;  1T6S A;  4ETS A;  2DJI A;  4G12 A;  3K1M A;  1W5T A;  3PO3 J;  2CUZ A;  4NB5 A;  1T33 A;  4UVC A;  3RKW A;  4IZZ A;  3M1C A;  1W7P B;  4N4O B;  5IY5 H;  5E18 F;  2KT0 A;  1P7J A;  1B4A A;  1FC3 A;  3CLO A;  3O8G A;  4IRG A;  1FZP B;  3PJR A;  3B6A A;  1BN5 A;  3PIP F;  3V8K A;  1HDD C;  5D6E A;  1Y39 A;  2W25 A;  1Q1H A;  3FX3 A;  4TV7 A;  2ZBK A;  1OMI A;  4UB6 C;  1BIB A;  4Y17 A;  5HNH A;  2A5W A;  1YX5 A;  1YS6 A;  3BWG A;  5BQT A;  3V8L A;  3K4N A;  2R92 J;  3ZQF A;  1E2X A;  2LD5 A;  2HYF A;  1T08 B;  4B48 A;  2V6C A;  1W5S A;  4HNT A;  1MSF C;  4EJO A;  2AQF A;  2L7F P;  4FX4 A;  2P0W A;  5E3N A;  4PGG A;  1I6X A;  3PM1 A;  1R9T J;  4PDK A;  3OS1 A;  3LQQ A;  2Y69 H;  2GOM A;  5BOX A;  3OYG A;  4J01 A;  3LQR A;  1SMT A;  1JUP A;  4ESB A;  1I50 J;  1MH3 A;  1ONV A;  4D1Q A;  1F9N A;  5A2Q K;  1X4O A;  2ELK A;  2IVM A;  4RAG A;  5K5Q A;  1XD7 A;  4YEJ A;  2JN6 A;  1OYW A;  1X2N A;  2ESN A;  5HDG A;  4B09 A;  5GAE J;  2DT7 B;  1APL C;  4LG0 B;  5IYC J;  1RR7 A;  1NH3 A;  4WX9 A;  3CP8 A;  1ZHF A;  5F04 A;  2JA2 A;  3FMQ A;  3V4G A;  2W24 A;  1PVE A;  2H8W A;  3KEY A;  1G4D A;  5HLT A;  4BEH B;  2K4B A;  3DFG A;  3ABK H;  4OAZ A;  3DU5 A;  3GEZ A;  4XNF A;  3PL8 A;  1UEL B;  3DEU A;  3IH3 A;  1ODD A;  1B6A A;  1BC7 C;  2M7B A;  5EDN A;  5CVI A;  1Y8Q B;  2VJJ A;  2HI3 A;  3SDG A;  2EV6 A;  1G6N A;  2BW3 A;  2FEZ A;  4WXH A;  4UUV A;  3VSL A;  3GUD A;  3C7J A;  2EIL H;  1TNT A;  1FMV A;  1X3Z B;  3QWL A;  3QPS A;  4AC0 A;  2KIQ A;  2FNP A;  4B3A A;  5B66 C;  4BHC A;  3MKY B;  2CMP A;  3DCF A;  6PAX A;  3DTE A;  1ZYR F;  3BZK A;  4KNY A;  3BR2 A;  2CRG A;  3M8F A;  3IAM 2;  1AOY A;  4E6K G;  1VF9 A;  2HZT A;  4UV8 A;  3DLL F;  4MEX F;  4Y7N J;  1SFK A;  3W6J B;  3WG9 A;  1VQ4 I;  4M6Y A;  4UY8 I;  2L9R A;  1O3S A;  5ILU A;  2AXT C;  4JQF A;  2LKX A;  2A5Y B;  5LD2 C;  3F72 A;  2RNJ A;  3JSP A;  4OWR B;  1WZ2 A;  5F1J A;  2QQ9 A;  2VBX A;  3JRI A;  2QF7 A;  2Y0S A;  4ZYE A;  2E1M B;  2WAQ A;  3VEP A;  3ZQQ A;  2PG4 A;  3H3U A;  5LHH A;  4BEH A;  1VND A;  1WVR A;  4HSR A;  4LIT A;  4BQQ A;  4A3F J;  1R4N B;  5AIQ A;  1YIT I;  2LK2 A;  1BJZ A;  4FHT A;  2VOD A;  3HGG A;  4BKX A;  4M73 A;  3S1M J;  3IRR A;  3ABT A;  3FBN B;  4GXO A;  1PDN C;  4XL9 A;  1FEX A;  1BR4 A;  2CW0 F;  4M72 A;  5CPR B;  1A31 A;  1U6G A;  2KP6 A;  3SFI A;  3CJQ B;  1OYI A;  4CGZ A;  3C18 A;  3GFJ A;  2KJC A;  1V55 H;  4XSZ F;  5L3G A;  1X19 A;  4HX4 A;  1YLF A;  1FP2 A;  5LGT A;  2I5U A;  3L7W A;  4AWX B;  1IF1 A;  1OR7 C;  1KQ0 A;  1K4T A;  1U2W A;  3DXJ F;  5J6X A;  2MFZ A;  1T56 A;  3KP4 A;  4XOR A;  4EJV A;  4EMS A;  1RPW A;  1GDT A;  4IJA A;  2BV6 A;  4AIJ A;  1LPQ A;  1KU2 A;  3GFI A;  5BMZ A;  4A0X A;  3OSG A;  3GTQ J;  2F5C A;  4MGR A;  1W36 C;  3CJN A;  2P5L C;  3VWB A;  4HA8 A;  2FMY A;  1F1Z A;  4KUM A;  3DPU A;  3QPH A;  4HLY A;  1PJR A;  1K78 A;  4ZZL A;  1SAX A;  1ZAO A;  3F22 A;  3JRG A;  3ASO H;  3CUO A;  1X2M A;  3BQY A;  4KN7 X;  1QHG A;  2XUB A;  4QWQ A;  4BE0 A;  1K79 A;  1IXC A;  3K70 D;  2R5Z B;  3OV8 A;  3E1S A;  1VQ6 I;  2HVR A;  3FZV A;  1VQM I;  1G3T A;  2K3P A;  3KE2 A;  4M74 A;  3CCR I;  2L4M A;  2LR8 A;  1W0T A;  1RUN A;  3HOS A;  4BAY A;  4L5J A;  3K1N A;  4Y15 A;  5FLX Z;  3ZQH A;  4EEF G;  2Y30 A;  3NWT A;  1MJ9 A;  4D7N A;  1ETO A;  3M8E A;  4D7M A;  4E70 A;  4BXU A;  3F23 A;  4G9Y A;  1A6Q A;  2P5K A;  4YIF A;  1Z77 A;  2DMU A;  4ABZ A;  2NVQ J;  1ZG3 A;  3L09 A;  2LLK A;  2X85 A;  4XLN F;  2Y0M A;  4LK1 F;  4B43 A;  3T8R A;  2Y9Z A;  1Y0U A;  2DTZ A;  1D5Y A;  3TL4 X;  3E0J B;  2NOG A;  1YJW I;  1DP7 P;  2VON A;  4ZYA A;  3OYB A;  5GAH J;  1T39 A;  2BOL A;  1TQP A;  2R7Z J;  1R49 A;  1ETX A;  1BM9 A;  2XF5 A;  3I71 A;  2JSC A;  2BY0 A;  1PUE E;  5HLH A;  3HHH A;  3EYI A;  4YEL A;  1W0U A;  3CMY A;  5K7Z A;  2YPR A;  4HV5 A;  4BXF A;  2M7A A;  1W5C C;  4KFC A;  3FHN A;  4A5N A;  4E7H A;  4BGD A;  1MMD A;  3GME A;  1ETK A;  2DA4 A;  2QQA A;  2Y2Z A;  1RR8 C;  1FYM A;  1SVM A;  2BVL A;  4PCQ A;  3LSP A;  1XCV A;  1RI7 A;  5E3L A;  2PJR A;  3I53 A;  2Q1Z B;  3OYE A;  5DS9 A;  4BE2 A;  4HF2 A;  3M9A A;  4I09 A;  4BU2 A;  1JHF A;  5HDN A;  1MGT A;  4UUS B;  3NQO A;  4NBQ A;  2IRF G;  4I0A A;  1T98 A;  3JRB A;  4FET A;  4XLC A;  2XPV A;  2J5P A;  3K4B A;  4PJL A;  2FUG 2;  4DYQ A;  2H6C A;  2V4J C;  4BBR J;  3H1C A;  3J81 K;  5DYM A;  4LLL A;  2W48 A;  3QU6 A;  2WC2 A;  1RRJ A;  1W4M A;  3HKZ N;  1IV6 A;  2G7H A;  3H92 A;  5K5O A;  1QU3 A;  4OIR F;  3GTK J;  3F9K A;  3GZN B;  4EJT A;  3RQI A;  3JAM Z;  5LRR A;  1U8B A;  5CVU A;  2ZXW H;  2VKD A;  2DTR A;  2NVT J;  2K9N A;  1SD4 A;  2OAZ A;  1X1B A;  1U78 A;  4DBQ A;  1I5Z A;  4UXN A;  5ICE A;  4P96 A;  3RTR A;  5IP6 A;  2OBP A;  3K9T A;  2HVS A;  3R0J A;  2Z3Y A;  4UUS A;  1PUF A;  2HOT A;  2ZNZ A;  4PJM A;  1Z9C A;  5B5E C;  4RB0 A;  4RGU A;  3PIO F;  3MZH A;  3HOZ J;  2YR2 A;  1USS A;  2IGM A;  4UNO A;  3ROU A;  2QCO A;  1H89 C;  2F5D A;  4CCK A;  4A2U A;  1KYW A;  4RGR A;  5DDG A;  4UVA A;  4ENK A;  5TRD A;  4U88 A;  2DMT A;  1HSJ A;  1N75 A;  1A04 A;  4BHP A;  1W36 D;  1X1D A;  1HW2 A;  5BPI A;  4Q48 A;  3CCV I;  2FA5 A;  2GA2 A;  2RKH A;  4XKW A;  1D0Z A;  2IAI A;  1ORK A;  2D5V A;  3ZQI A;  4E7S A;  4G6T B;  4CCM A;  4F91 B;  1S7A A;  1VTN C;  3K7A J;  2EA4 A;  2MD5 A;  5AIP A;  4PFP A;  5E8I A;  1HKS A;  3I59 B;  2QKL B;  3KZI C;  4YFX F;  5LFA A;  5IOY A;  1CF7 B;  5C4X J;  4PJN A;  5BS6 A;  3ZOB A;  3DKW A;  5DUK A;  3G4S I;  2XF7 A;  4N9I A;  1FBU A;  2NAZ A;  4U0V A;  1PP8 F;  3HIF A;  3JRF A;  4L9V A;  2GBY A;  4A6E A;  2L7Z A;  2V9P A;  3ZQG A;  3TO9 A;  4C3H J;  2X0L A;  1HST A;  4AUX A;  1MND A;  2JQ7 A;  4BXX J;  2XGC A;  3WU2 C;  4XRF A;  3RYP A;  1OLT A;  3DPT A;  2HKO A;  1FOW A;  2RQQ A;  4S05 A;  3NRV A;  1R1V A;  1MBE A;  2LF8 A;  3QYB A;  4ZC3 A;  1DU6 A;  4N0B A;  1FOX A;  4I7H A;  3BPX A;  2WBM A;  1V5E A;  4IHW A;  1UG0 A;  2QM3 A;  4YFK F;  3MAJ A;  2DT5 A;  2R3S A;  3OYJ A;  2DPD A;  1OCR H;  3T8T A;  3DV8 A;  2XGD A;  1DP3 A;  1LKX A;  2H8R A;  1K6Y A;  2KPM A;  3HM5 A;  1FTZ A;  1ETV A;  4XLP F;  2V6E A;  4G94 A;  2OQR A;  2DAO A;  2EB7 A;  1D0Y A;  3I3L A;  4F7Z A;  1TWG J;  1CF7 A;  2ZC2 A;  1MD0 A;  3HKZ A;  1WH5 A;  2MGQ A;  2QUF A;  2EJR A;  5CYV A;  3DP7 A;  3E6M A;  3CCS I;  2MH9 A;  5CJ9 A;  3JRE A;  3TBI A;  1ZGA A;  1W1W E;  4NUB A;  2XPW A;  2W1O A;  2WV0 A;  2L9V A;  3KYC B;  3OYD A;  3W6V A;  3H3Z A;  1ZKG A;  2HQN A;  3DLA A;  3FMR A;  2FBK A;  4LLG F;  5JVG F;  3HDD A;  1B1B A;  1T0F C;  1IN8 A;  4KDP A;  2E5Z A;  2E35 A;  9ANT A;  2VOP A;  2XRO A;  2JK3 A;  3HZJ A;  1R5G A;  3HSF A;  3BG6 A;  2XDV A;  1M1E B;  5IP9 J;  2O8K A;  1VI0 A;  5FFX A;  5D5W B;  2G9W A;  3S16 J;  2PBI A;  2DI3 A;  2VKH A;  3BTJ A;  4WCG A;  1F36 A;  2QWW A;  2H1K A;  3CUQ B;  1TTY A;  4CHU A;  2JWT A;  2XKO A;  1Z6T A;  2VUM J;  4RM3 A;  5L3D A;  5ICF A;  3MKW B;  2BHY A;  2IT0 A;  1HOM A;  4OIP F;  2XIG A;  1QZE A;  5JLX A;  2NYX A;  3D0S A;  4HF0 A;  3DBR B;  2K9M A;  2XKP A;  4I98 B;  1BR2 A;  4GDF A;  2JRM A;  2ZJQ F;  4ANJ A;  2M2E A;  5HVQ C;  1B72 B;  2A3S A;  5J1R A;  1YW9 A;  2YS9 A;  4L0Z B;  4XID A;  4MTE A;  1VFC A;  4O5V A;  2KRC A;  3BR0 A;  3FBI B;  4G6Q A;  1E17 A;  3D5L A;  3Q9V A;  1BI2 A;  2V7F A;  2V1N A;  4L9J A;  1D5V A;  2ZFU A;  3IWF A;  5FRN A;  3ABM H;  2IEK A;  3HOV J;  2ADU A;  2KKO A;  2XSJ C;  5HOO A;  2NNY A;  4IO9 F;  5EEH A;  2CG4 A;  2XAH A;  5ED4 A;  4II3 A;  5DCM B;  1JT0 A;  2IA2 A;  1E3O C;  1BW5 A;  2MSY A;  5J1U A;  3VPR A;  4CCJ A;  1WSU A;  4K2E A;  2M0C A;  1CGP A;  1OCT C;  1RIO H;  2ZME C;  1GV2 A;  5GAD J;  2B63 J;  2W4S A;  4WWC A;  4W1U A;  3SZP A;  3EUH A;  2JUC A;  2Y31 A;  2JPC A;  3HXL A;  4GYG A;  1SFU A;  4XLH A;  1YIJ I;  4CUG A;  1SVL A;  2KDO A;  2EIM H;  2NS7 A;  4OOI A;  4HYE A;  3R61 A;  1G8X A;  2LTP A;  4RLQ A;  3JRH A;  2OZU A;  1B72 A;  3IKT A;  2R7U A;  4XRS A;  3HOX J;  4FX0 A;  2JT1 A;  2WY7 Q;  2LBF B;  3L2V A;  4IF4 A;  1IAW A;  4XMY A;  4Y3O A;  3G1M A;  1B8I A;  3CP2 A;  2IP2 A;  2PJP A;  4DYC A;  2DA6 A;  4QTR A;  2EWN A;  3VB2 A;  4P55 A;  3QPL A;  3GFM A;  4G6D A;  1HLV A;  4Q4Z F;  4A3D J;  2R7S A;  1Z6R A;  2CW8 A;  2KQR A;  5H6Q A;  4WXC A;  5DCM A;  4CCN A;  2H6B A;  4D5F A;  4EVI A;  1IW7 F;  2X1D A;  2KIU A;  1NHA A;  2V9K A;  1YX3 A;  2VQC A;  3H5A A;  1S9H A;  3MEX A;  4ESF A;  5D6F A;  3P9I A;  4C2T A;  2PN6 A;  3RPU D;  3ELK A;  2HNH A;  1B59 A;  5DTD A;  3H5R A;  1OPC A;  3DF8 A;  3MKL A;  2JA5 J;  2L7K A;  3BT9 A;  3V7C A;  2UWM A;  1D1C A;  4B44 A;  2F5F A;  1IN6 A;  1A35 A;  2XB5 A;  1NK3 P;  2UXX A;  3FXU A;  3T0Y A;  3R0A A;  2BY2 A;  3LST A;  4YIR X;  2Z1D A;  1IXS B;  1GLN A;  1LDK B;  1SD6 A;  2CUE A;  2DA2 A;  4A3K J;  1D8J A;  1ERD A;  4BQO A;  2CH0 A;  4IL6 C;  3RKQ A;  4C2U A;  3ZN1 A;  4XON A;  4H4K C;  5FKO A;  1MBJ A;  2LSO A;  5KAF C;  1JKR C;  2ISY A;  5LLQ A;  2FD5 A;  2GXA A;  3E6D A;  3CCM I;  1XTA A;  4NC6 A;  5F0H A;  2QSG X;  3SYT A;  1AKH A;  1Z05 A;  4EJU A;  2OTL I;  2Q2E A;  3OYM A;  3OYF A;  1HC8 A;  3ERM A;  1PP7 U;  2UUZ A;  1XGN A;  1YW8 A;  4RMN A;  4UUT A;  1P4A A;  5ILS A;  4YII A;  1I1S A;  4MIM A;  1HBX G;  3WE2 A;  3L1P A;  1IN5 A;  2XAU A;  3ZQ7 A;  2VIX A;  5GTH C;  5TIS C;  3ECH A;  1XCB A;  2P7C B;  2COB A;  3HOW J;  4E7J A;  3KZY A;  1TL8 A;  3ESW B;  1Y1V J;  4O3M A;  2L3D A;  3FXO A;  3RKX A;  3G3Z A;  3I58 A;  4M9Z A;  3BCB A;  1MW7 A;  3ZMU A;  1OFC X;  5EF6 A;  1AWC A;  1O7F A;  1YE9 A;  2P6S A;  4LD5 A;  5ICG A;  3FF5 A;  5D4S A;  2IW5 A;  2MLG A;  4CCO A;  3QQA A;  1WI9 A;  3JW4 A;  5E1Z B;  1RC9 A;  3RZO J;  2ME0 A;  2EIJ H;  2UXN A;  2QEX I;  2RVC A;  1IUF A;  4W97 A;  3P9K A;  3H36 A;  3RJP A;  4XN0 A;  1R1U A;  1DPU A;  4AD9 A;  3K70 C;  4F93 B;  4RS8 A;  3S2H J;  3CCE I;  4G7H F;  1J0R A;  4E7I A;  1ITY A;  1TT0 A;  3QOE A;  4P1W A;  2XSD C;  5DD8 A;  2P5V A;  1YIO A;  3OS0 A;  1R1T A;  1LEA A;  1VQL I;  3HTU A;  2BW3 B;  4XKB A;  5K7H A;  2R5Y A;  4G7Z F;  1QQI A;  3RYR A;  4M3F A;  3K69 A;  5FKM A;  1N77 A;  2E7W A;  2HFH A;  4XKV A;  2M45 A;  1OKR A;  3OSF A;  2EZL A;  3MFK A;  3G73 A;  5JHF A;  3WTX C;  4IPA A;  3BJO A;  4IQ4 A;  2LP0 A;  5M3F J;  1ZR2 A;  2FNA A;  1KYZ A;  1GVJ A;  5LGN A;  2MYS A;  3OIP A;  3X2Q H;  1LB2 A;  2O6G E;  2IGO A;  3S1N J;  1MMS A;  1XPX A;  3WHB A;  2PMU A;  2PMZ N;  3LA3 A;  2HYJ A;  3PQK A;  4B47 A;  4JX5 A;  4PSW A;  5DV5 A;  1IDY A;  4QPO A;  1MH4 A;  3K4K A;  1WFX A;  3VDX A;  1VQ7 I;  4X1E A;  4CZC A;  1SFE A;  2A07 F;  3H35 A;  4HG2 A;  2BBY A;  3H3V K;  1JGG A;  1YTY A;  1UHW A;  2LFB A;  3AG4 H;  5HLI A;  2KFD A;  2HQR A;  2HR3 A;  1FSH A;  4AYB N;  1ZLK A;  1I6H J;  3ZQC A;  4ON0 A;  4KIC A;  2A68 F;  2HU9 A;  5CLS A;  4HW0 A;  1WI3 A;  1IRX A;  2DOD A;  3QAH A;  1Z21 A;  4B1R A;  3QOD A;  1ETY A;  3KP7 A;  3FKJ A;  5M5W J;  3OYC A;  1S72 I;  3S1Q J;  4KT5 C;  1MKM A;  4DIQ A;  1LDD A;  3EPZ A;  2VBY A;  3JSO A;  1EH8 A;  5B1B H;  2HOE A;  4A3L J;  5IYD J;  2Z5U A;  3CF2 A;  3I4N J;  4R8H A;  2YU9 J;  2FRH A;  5LRS A;  3MQ0 A;  3W2A A;  5E17 F;  4IHS A;  3TKY A;  1K78 B;  2XAQ A;  3UNG C;  1NG7 A;  3KLN A;  2EZH A;  3BG3 A;  4WK8 F;  2L02 A;  3LSK A;  3Q3S A;  2WTE A;  2WWY A;  3WTU C;  3BR3 A;  4DNC A;  3TP0 A;  5LHG A;  3GW2 A;  1C0W A;  3V42 A;  3GTG J;  2X6W A;  3E97 A;  3ECO A;  3KEO A;  2FQ3 A;  1FX7 A;  1XSX A;  2QKM B;  4A6D A;  5E3O A;  2HS5 A;  3KET A;  4IX7 A;  5D8L B;  2CQX A;  4OIO F;  2O7O A;  1MDM B;  5B3S H;  4U87 A;  1AU7 A;  2RN7 A;  3VYS B;  2HOS A;  2VKV A;  5FKL A;  2X1E A;  3AG2 H;  2R7X A;  3H9J A;  5LEK A;  2KIF A;  4C2M J;  2C6Y A;  1EA3 A;  4LB5 A;  4M3B A;  1OR7 A;  4XSX F;  2LRD A;  3DEW A;  2KIM A;  3J7A O;  3LSM A;  1S6L A;  3GO5 A;  1T2K A;  2O61 A;  3OYA A;  2IA1 A;  2GWR A;  5E8G A;  1X1C A;  3WE3 A;  3NAU A;  4A3G J;  3VSK A;  2G7U A;  4II2 A;  5FRM A;  2EIN H;  1IO2 A;  3DU6 A;  2ZXJ A;  4QPQ A;  1UJ8 A;  3OIO A;  1DGW Y;  2CYY A;  2PEX A;  2IS6 A;  4YRV A;  1ZRF A;  2PMZ A;  3F8N A;  3TOA A;  3OWT A;  3CC4 I;  2D1V A;  3GYH X;  3M3Y J;  3A02 A;  3VFZ A;  2XAF A;  2P8T A;  3KP2 A;  2X6O A;  1BIA A;  4RB1 A;  1MNM C;  3FK7 A;  1LVK A;  5DD4 A;  2FSW A;  3T1B A;  2KZV A;  4FCY A;  1MDM A;  3TDU C;  2LKS A;  2STW A;  2A69 F;  2DBB A;  3Q0V A;  2HEO A;  4CYD A;  5L3E A;  3MZY A;  1ZN2 A;  4L18 B;  1V5G A;  2PJR B;  3J81 Z;  2E36 A;  2NNN A;  3BLY A;  2VJ4 A;  1JXS A;  4BJ5 C;  3OOP A;  3H0G J;  1D1A A;  1FBS A;  1TLH B;  2ELH A;  2F4O B;  2VJ5 A;  2XAG A;  4KN4 X;  5EZG A;  4ZTF A;  1E0E A;  3S8P A;  2K85 A;  5DUI A;  3GBG A;  2DO7 A;  4DJA A;  1A36 A;  2GXB A;  3PSI A;  1XSD A;  3AAF A;  1JUM A;  3SZG A;  2OCE A;  2P6T A;  1ZGW A;  1SAN A;  4PZJ A;  1J5Y A;  1SAU A;  4GGG A;  4P5O A;  1HKT A;  3FIW A;  2R0Q C;  2JZY A;  3FMS A;  2ZSH B;  2OC6 A;  1H0M A;  3OYL A;  2EFW A;  1HKQ A;  2K4J A;  3PUB A;  4EV0 A;  1L0O C;  3CME I;  3KP5 A;  1H9T A;  3H9G A;  3KFW X;  3M7G A;  5EG0 A;  4FT8 A;  3R4K A;  3SDB A;  1WH7 A;  2YX4 A;  3C2G A;  2KIS A;  1W7P D;  3AFH A;  3ZRG A;  4OMZ A;  4IOA F;  3GZ5 A;  3FXR A;  2VC0 A;  2A6T A;  4C3J J;  1ZR4 A;  1I39 A;  1XMA A;  2IBD A;  4CH7 A;  4F55 A;  5KHD A;  1H88 C;  2L5Q A;  4P9U A;  1G3W A;  1G3Y A;  1JUS A;  3IP4 B;  4ZH4 F;  3E6C C;  1TC3 C;  2QSF X;  3FKI J;  4EM1 A;  2D1H A;  2K7L A;  1YFH A;  1ZH5 A;  2EFQ A;  1IRZ A;  2EIK H;  3S1R J;  1ZRD A;  1UMQ A;  2TCT A;  2OF7 A;  2FXA A;  1MJB A;  4D9J A;  3KX2 A;  5EGO A;  2A05 A;  1PUF B;  1J9I A;  4MFD A;  4BQN A;  1J2X A;  5EZH A;  3NWS A;  4IKF A;  1ZTR A;  4LIV A;  1NG6 A;  2R7O A;  2DXI A;  3BG7 A;  3Q0U A;  3LSR A;  4OMY A;  5C4J J;  4J00 A;  2M4G A;  1DPR A;  4B4C A;  3BRO A;  2CV0 A;  3HRT A;  2F5V A;  4AU7 A;  1AHD P;  2BYV E;  3U2R A;  1BW6 A;  1X3W B;  3U9G A;  1EJ9 A;  2LF7 A;  2L7M P;  3WU0 A;  5D5U B;  4NQW A;  2RQP A;  2CS3 A;  1RES A;  3KYD B;  1FSE A;  1WHU A;  3IC7 A;  3HGY A;  3LMM A;  2Z33 A;  4X6A J;  2DQR A;  1UST A;  3CCQ I;  1BBY A;  4I6Z A;  1EH7 A;  4RAY A;  2NVU B;  4RB2 C;  1KON A;  2L9N A;  1LFB A;  3LL7 A;  4OIN F;  2QQB A;  2CFO A;  2LC2 A;  4KIS A;  3RZD J;  3EYY A;  4S0H B;  4E7L A;  4HST A;  3W2W A;  5F27 A;  1O7L A;  2CJJ A;  3CDL A;  2W84 A;  1V3F A;  5EEG A;  1N78 A;  1ON2 A;  1PYV A;  3IWZ A;  3L2W A;  3F3X A;  3EUK L;  5J4V A;  5J3L A;  3Q5F A;  2O9L A;  3E6B A;  4IXA A;  5E1X A;  5E1W A;  3GTJ J;  1XDU A;  2HZD A;  2X51 A;  2K9Q A;  1IZ1 A;  3ABU A;  4HNV A;  2E2I J;  5DCF A;  3FM3 A;  3OYN A;  2LY9 A;  4IQJ A;  1WRJ A;  4N4N B;  2RRE A;  4ENN A;  3L2C A;  3ISP A;  4ZDL A;  2ZFW A;  3M4O J;  1IG7 A;  2HDW A;  5DM7 F;  4BDZ A;  2Y9Y A;  1B9M A;  4OIQ F;  3LFU A;  5L3F A;  2P81 A;  2V79 A;  3HTS B;  1LNW A;  2ID6 A;  2HXO A;  1Z91 A;  2O5R A;  2CO5 A;  4AIH A;  2E71 A;  1QGP A;  3HC7 A;  3K0L A;  1TBX A;  1VZ0 A;  3KP6 A;  3EDP A;  1P2F A;  1MBK A;  3DQV C;  4M6X A;  2OZ6 A;  2HXI A;  1WQ2 A;  3KCC A;  3V7S A;  4FTH A;  1S8N A;  3K4J A;  5GTI C;  1QBJ A;  5H2F C;  4PSX A;  3EUA A;  1T95 A;  3A03 A;  4XKC A;  5HLG A;  2WB1 N;  3J7Y J;  1G3S A;  1I1G A;  3PFY A;  4XR6 A;  4RBO A;  3RI4 A;  4ZYG A;  1KZH A;  4L9T A;  4BBS J;  3PNY A;  4MFE A;  4G8X A;  2DFE A;  1T8I A;  2A6H F;  3M8J A;  3NAR A;  2ZXH A;  4HQM A;  3HSR A;  4MLO A;  2VJI A;  1BL0 A;  2VXD A;  4A0Z A;  3LAP A;  2P7V B;  1JTY A;  1YS7 A;  4I99 C;  5KK1 A;  2K9L A;  1LE8 A;  4HLX A;  4C3I J;  1UB9 A;  3RPU A;  4GFB A;  2E1N A;  1OCO H;  4ZYH A;  1Y8R B;  1DU0 A;  3CES A;  3WGH A;  2IPQ X;  5LBQ A;  3LFK A;  3SHF A;  1Z7L A;  3S3O A;  1R6R A;  2L0K A;  1FJL A;  3A4C A;  2TRT A;  3KZZ A;  4M9X A;  4A0Y A;  2AS5 F;  3BDD A;  2IGN A;  4EM0 B;  2PMH A;  4X0G A;  2VE9 A;  3JRD A;  5CQG A;  3DBL B;  2STT A;  4PK4 A;  4BS9 A;  1OCC H;  1IGN A;  3F8M A;  2PI0 A;  4XLF A;  3HRU A;  2DU9 A;  2RNG A;  4BAC A;  2VL8 A;  4LB6 B;  3MWM A;  4RAF A;  2NXN B;  5JLW A;  4B3X A;  1Z67 A;  1DQU A;  5H6R A;  4BJT A;  5J1Y A;  4RDU A;  3JTG A;  1T0F A;  3KP3 A;  4XQF A;  2XAS A;  4M6V A;  2CQ7 A;  1UAA A;  3A0H C;  3K4L A;  1ZEL A;  1TZL A;  1UHS A;  2CSO A;  1JJ8 C;  4A69 C;  2X9D A;  2LH9 A;  2DPU A;  3LSI A;  1Y6I A;  1UHM A;  2AHQ A;  1S3J A;  5HDK A;  2ZME B;  4RGX A;  5KNL A;  3I4M J;  2JTV A;  4JK1 X;  4OAY A;  3C2H A;  3J7Z I;  4Z2Y A;  2R7F A;  2X6Y A;  3TDZ C;  2MAB A;  2BEO A;  2FF4 A;  3SZT A;  1TQI A;  1DGR M;  4KIT B;  3WTV C;  3JTH A;  2IS4 A;  5ERI A;  2ID3 A;  4FE7 A;  2DA7 A;  2XRL A;  3AL0 C;  1V54 H;  2JA6 J;  2R93 J;  1WCM J;  4FAS D;  3BC8 A;  2EPF A;  3ZMZ A;  2KJB A;  3ZMS A;  4F92 B;  1B8I B;  2JA7 J;  1IN7 A;  3OYI A;  2ELJ A;  2CV2 A;  1XS9 A;  4DQ2 A;  2LRE A;  1MMA A;  1OIS A;  2VQG A;  4YG2 F;  4IOC F;  1P4W A;  3ZCO A;  1JTX A;  2JUG A;  2E2H J;  1FY7 A;  3GTM J;  1YI2 I;  3COA C;  3CTA A;  3SXY A;  2X1C A;  1TW2 A;  1XG1 A;  1D1B A;  4JBA A;  1DDN A;  5EEA A;  2WB1 A;  2VE8 A;  1FLI A;  4EJW A;  1VQ9 I;  3I4P A;  1XSV A;  1JGS A;  2ZME A;  1Y0N A;  4CZZ A;  1FOY A;  2F4I A;  3IV5 A;  3OS2 A;  1FBQ A;  5EYR A;  3I55 I;  2QYO A;  2EZK A;  2LNB A;  4L9N A;  4AID A;  5J8C A;  5GP9 A;  3E5U A;  1LJ9 A;  2NVY J;  4NDL A;  1I3Q J;  3BY6 A;  4DGW B;  4ZDO A;  4PFO A;  5K7F A;  3FHZ A;  3GTO J;  1X4P A;  4AM3 A;  1ULY A;  1P4X A;  2ESH A;  3ERE D;  1YJN I;  2WV1 A;  2WAE A;  3WU1 B;  3CC2 I;  3E3V A;  4DZP A;  3VOD A;  1FT9 A;  4S04 A;  3JCU C;  4V19 K;  4Y52 J;  4PGH A;  1AA7 A;  2Q0O A;  4I76 A;  3ZR8 X;  3D5S C;  1MNE A;  4WXD A;  5L3C A;  5C3E J;  4HDU A;  4MQV A;  5GAG J;  1MSE C;  3DPL C;  4EQQ A;  1D3Y A;  1AKH B;  2RV8 A;  2Q2E B;  4CYC A;  1OQY A;  1U5T C;  4HPQ A;  4RLF A;  5IYB J;  4IRH A;  3H5N A;  1BJA A;  1GV5 A;  4ZDP A;  4MEY F;  2XC7 A;  1GUU A;  2H09 A;  3J7A Y;  1WJA A;  2E19 A;  2W82 A;  2ZNY A;  4NHJ A;  2Q8K A;  2KMU A;  3GXO A;  3I9V 2;  4EGY A;  3TO6 A;  2JVG A;  1XN7 A;  1TWA J;  3ABL H;  2VBW A;  3PFI A;  2VQH A;  2ACJ A;  5F64 A;  2L9S A;  2XRN A;  1LFP A;  3BR5 A;  5JI6 A;  1J59 A;  4EGZ A;  5F0C A;  2MBF A;  4A5M A;  3R60 A;  1O3R A;  2FX0 A;  4QLC U;  1LFU P;  1TP4 A;  4AIK A;  3CDI A;  5H20 A;  1EV7 A;  1RNL A;  2WA0 A;  5LEJ A;  4HF1 A;  1P6R A;  2KRF A;  2H27 A;  1IV8 A;  1XX5 A;  4XM3 A;  1IRF A;  1YG2 A;  3LSH A;  1WJC A;  1R7J A;  4HV6 A;  4U0Y A;  3REO A;  2XV4 S;  4A3E J;  1YRN B;  5CQE A;  3S2D J;  2ZKZ A;  3HSE A;  3HB9 A;  4B8X A;  2LKP A;  3IH2 A;  1FYL A;  4ASN A;  4LJZ F;  5C44 J;  1REP C;  1K83 J;  4HX7 A;  1OCP A;  3F0C A;  2OU2 A;  4XLA A;  2R5Y B;  1YJ9 I;  2DYR H;  5CVR A;  3I54 A;  3ZMT A;  1L3L A;  3FXK A;  2WAD A;  3EET A;  1OYY A;  3B6C A;  1JKO C;  2OPT A;  5CKT A;  4BQA A;  1R00 A;  3QYF A;  5F0F A;  2P4W A;  1VQ8 I;  5D5V B;  1TT5 B;  2OD5 A;  1QPI A;  2GA1 A;  1R5I D;  4LK0 F;  1X1P A;  1MZB A;  2O03 A;  1QVT A;  1U0J A;  3MCZ A;  1QRY A;  4FE4 A;  3CJR B;  5FRO A;  3BP8 A;  3AKZ A;  2Z99 A;  3HOU J;  4XK4 A;  2HVQ A;  4U7B A;  3SJM A;  3CCY A;  2NOJ B;  1TWC J;  2M1B A;  2Y0S N;  2FBH A;  1S7O A;  2GQQ A;  2HOA A;  1YRN A;  4JP0 A;  4Y33 A;  1YW7 A;  1F43 A;  2DN0 A;  4LGW A;  3IKV A;  2COM A;  2F48 A;  2ZJ2 A;  2RAE A;  3P7N A;  5CVJ A;  1X1A A;  4BUP A;  3AG1 H;  2YSR A;  4Q47 A;  2LOO A;  4BE1 A;  1JJ6 C;  2HPI A;  4P9F A;  4CCL A;  4H0E A;  1U8R A;  3CCL I;  1IUY A;  4E7K A;  3WOD F;  2LY1 A;  3EQL F;  4WF2 A;  5FO5 A;  1R36 A;  5FKN A;  4O6J A;  1WJB A;  1POG A;  3F8B A;  1GXQ A;  1UG2 A;  4KT6 A;  4Z6Y A;  2HQA A;  4HRI A;  1EF4 A;  1XMK A;  4ZJZ A;  2MLK A;  3BOQ A;  3M1E A;  3DKY A;  2HQ5 A;  3G1O A;  4HAM A;  5FD6 A;  2B7E A;  4ENM A;  3WTS C;  3CMA I;  1R23 A;  1R4M B;  2GIV A;  2ZB9 A;  4BHB A;  3ZN0 A;  2QLZ A;  2OUM A;  4XOT A;  4XLE A;  2FU4 A;  4F52 A;  4QIW N;  1HW1 A;  3VYU B;  1RUO A;  4CDG A;  5M5X J;  3SEZ A;  2W85 A;  2GAU A;  2V9V A;  2QZ8 A;  3PUF A;  1O57 A;  2QVO A;  2HYG D;  3IRQ A;  2M30 A;  2EZI A;  1ZLJ A;  1W7P A;  4QSH A;  2Y48 A;  5J4Y A;  3FXM A;  3VYT B;  4XIC A;  3BZ6 A;  3CQZ J;  3ZQL A;  5J8F A;  4GYI A;  3BCA A;  2K5C A;  5F08 A;  3IHU A;  2VLA A;  2EH3 A;  5JHU A;  3DBH B;  3S32 A;  2M8E A;  2MC4 A;  1FIP A;  2VN2 A;  1KU7 A;  1KU3 A;  2JA8 J;  2E1C A;  1J09 A;  3KEQ A;  3TOB A;  3F8F A;  2B0L A;  1BOA A;  4AVP A;  1S7E A;  4XN3 A;  5FJ8 J;  1TWF J;  4A12 A;  2V1X A;  1K61 A;  4BY7 J;  2M0M A;  4BH9 A;  2DK8 A;  3E5X A;  3QP5 A;  2GIZ A;  1VQK I;  5LGU A;  2HKX A;  1SVO A;  2Z16 A;  1FP1 D;  4DW6 A;  1K7A A;  4IRI A;  3CO6 C;  1GXP A;  2BGC A;  3MMY B;  3Q9S A;  2LMD A;  1STZ A;  1FPQ A;  3GLL A;  3TGN A;  1X58 A;  3S14 J;  1ZGJ A;  2HGC A;  2O8X A;  3UKG A;  2RGV A;  1WJ5 A;  2ZSI B;  4LG0 A;  4ZZD A;  2JSP A;  1F4K A;  2K9S A;  5F1R A;  4Y13 A;  2BXY A;  2ISZ A;  1FMW A;  2D2W A;  3CMM A;  3CO7 C;  2OV7 A;  3HOY J;  3DTI A;  5CVV A;  3T5X A; 
#chains in the Genus database with same CATH homology
 2ETH A;  3GFL A;  2CQK A;  4OU0 A;  2MH2 A;  2JPB A;  3NEU A;  2A6E F;  4MTD A;  2F5E A;  1KA8 A;  1XGO A;  4CO8 A;  2EFO A;  5AON A;  1BI3 A;  3LA7 A;  1KQ9 A;  2IA0 A;  1EH6 A;  2K02 A;  3BPV A;  2HTS A;  3J80 Z;  3CDH A;  4UVB A;  4MNU A;  4CIC A;  3TQN A;  3KLO A;  4Q5S F;  4HDV A;  2RC4 A;  4RAZ A;  1K6O A;  5KVR A;  2O3F A;  3HYI A;  1S29 A;  4R79 A;  1R58 A;  2EV0 A;  1FOK A;  2DLL A;  2X4H A;  2L01 A;  3F6O A;  1U3E M;  1MJA A;  2Z9O A;  1XGS A;  1JE8 A;  5D4R A;  1ZAR A;  3VOE A;  5IT3 A;  1UFM A;  1JHH A;  1KGS A;  3B73 A;  2VXZ A;  2V1D A;  3RDI A;  2XVC A;  2A61 A;  1F5T A;  1X3U A;  2PQ8 A;  1QZZ A;  2HTJ A;  1R5H A;  1YO5 C;  3FM5 A;  4HOB A;  3GX4 X;  3L9F A;  2LDU A;  2Y75 A;  4EM2 A;  2O0Y A;  2EA2 A;  3WGI A;  3J80 K;  1UCR A;  4RGS A;  2ZCW A;  3I5U A;  4L5I A;  5HS8 A;  5E20 A;  3ZMD A;  4IVN A;  2VT2 A;  2J5O A;  4HZF A;  1H9G A;  2CFX A;  2EV5 A;  2VC1 A;  3FWE A;  1R22 A;  2VBZ A;  3F6V A;  4BNC A;  2ZO4 A;  5LHI A;  2MC3 A;  2EFP A;  3F8C A;  3HRM A;  4RB3 C;  3ZMV A;  5FGM A;  1LVA A;  5FLX K;  3LAJ A;  1XB4 A;  1KU9 A;  1ZG5 A;  3FXQ A;  1J7K A;  2XGX A;  4LMY A;  1D8K A;  5DEQ A;  2FBI A;  4HX8 A;  2PFB A;  4HBL A;  1QZY A;  3HOT A;  1J75 A;  5FFZ A;  3ML6 A;  4L0Y B;  3WTW C;  3BJA A;  3GWZ A;  2GXG A;  4YFN F;  2R7D A;  2M87 A;  3U1D A;  4D0P A;  4KIF A;  3GLX A;  2QEN A;  3P9C A;  1KQ8 A;  3I0T A;  1QNT A;  3F21 A;  2DK5 A;  2HWV A;  1SD7 A;  4R1H A;  2XAJ A;  1ZRC A;  3W6K B;  4KYW A;  3V8J A;  1P92 A;  3C3W A;  2H94 A;  3I64 A;  4ZYD A;  1FNN A;  1WWX A;  1SD5 A;  1HW5 A;  4U0W A;  3C1D A;  2VOO A;  4M9S A;  1TW3 A;  3K2Z A;  4I01 A;  3RKY A;  5TJJ A;  5IT9 Z;  5FD5 A;  1BC8 C;  1IXR C;  1O3Q A;  1IN4 A;  3O3K A;  3JAM K;  2OQG A;  3QU3 A;  2IJL A;  1GHC A;  4GO1 A;  3WTT C;  1BI1 A;  1LDJ A;  5JFR A;  3ZPL A;  4GCV A;  3QP6 A;  3ULQ B;  4KMF A;  5JVT A;  4CXF A;  2VT3 A;  2K86 A;  2CGP A;  3I59 A;  1FWZ A;  2V1U A;  3QOP A;  3WTZ A;  2TDX A;  1TNS A;  2L4A A;  3K1P A;  2D45 A;  4KMU X;  3V7R A;  5K5R A;  2F2E A;  4ESJ A;  1WKM A;  1V4R A;  4MHG A;  2HDC A;  5D8K B;  1O3T A;  2NRA C;  1SMY F;  2UZK A;  4KIB A;  1T38 A;  1XDS A;  3LA2 A;  3RPQ A;  3WTY C;  5BPD A;  5IT9 K;  3GVA A;  1SFX A;  1LEB A;  3ZP5 A;  4U7D A;  1ZRE A;  1HQC A;  3B02 A;  3IL2 A;  3QRF F;  1YQA A;  3SFZ A;  2FOK A;  3PQJ A;  1Z7U A;  2CWE A;  2FE3 A;  3O6B B;  3R6S A;  4N9H A;  1QO0 D;  3GF2 A;  3CUQ C;  1U5T B;  3SQN A;  4XBF A;  2QBY B;  2BE5 F;  3LWF A;  2PLY A;  3CUQ A;  1ON1 A;  1LQ1 A;  2EK5 A;  2DQL A;  2FML A;  3O2P E;  5ICC A;  2L54 A;  3N4M A;  5K1Y A;  2JRT A;  1QPM A;  2DW4 A;  2AXL A;  1BI0 A;  3HUG A;  2DFI A;  4LFU A;  3HRS A;  2W57 A;  5L3B A;  4UHT A;  2RDP A;  5ILV A;  1U5T A;  2QBY A;  5FB2 A;  3L00 A;  2K27 A;  2M5W A;  3RIR A;  1HXD A;  2XHK A;  1I27 A;  2OA4 A;  4MQ9 F;  3QPT A;  1RZ4 A;  4I0B A;  1ZG1 A;  2GZW A;  1XGM A;  5JR3 A;  3S2W A;  3N97 A;  3HHG A;  1FYK A;  4I2O A;  5F6F A;  4I02 A;  4G7O F;  1Z1D A;  2YU3 A;  3GZ6 A;  3WGG A;  2NS0 A;  4LLN A;  2EFN A;  3BJ6 A;  5HS7 A;  4KIG A;  4BYY A;  5A2Q Z;  4KA4 A;  1YYV A;  1IRG A;  2MA3 A;  4ENJ A;  1DUX C;  1B9N A;  3TO7 A;  5D5X B;  5HS9 A;  4UV9 A;  1TQM A;  4HQE A;  4M71 A;  3E5Q A;  2E7X A;  2YX7 A;  4IHT A;  1T6S A;  4ETS A;  3K1M A;  1W5T A;  4NB5 A;  3RKW A;  4UVC A;  1W7P B;  5E18 F;  1B4A A;  1FC3 A;  3CLO A;  4IRG A;  1FZP B;  1BN5 A;  3V8K A;  5D6E A;  2W25 A;  1Q1H A;  3FX3 A;  4TV7 A;  2ZBK A;  1OMI A;  1BIB A;  4Y17 A;  5BQT A;  1YS6 A;  3BWG A;  3V8L A;  1E2X A;  2HYF A;  2V6C A;  1W5S A;  4EJO A;  4FX4 A;  4PGG A;  1I6X A;  4PDK A;  3LQQ A;  5BOX A;  3LQR A;  1SMT A;  4ESB A;  1ONV A;  1F9N A;  5A2Q K;  2IVM A;  5K5Q A;  1XD7 A;  1OYW A;  2ESN A;  5HDG A;  4B09 A;  4LG0 B;  4WX9 A;  1ZHF A;  3FMQ A;  3V4G A;  2W24 A;  1G4D A;  2K4B A;  3DFG A;  3GEZ A;  3DEU A;  1ODD A;  1B6A A;  1BC7 C;  5CVI A;  2EV6 A;  1G6N A;  4WXH A;  2FEZ A;  4UUV A;  3GUD A;  3C7J A;  1TNT A;  2FNP A;  4BHC A;  6PAX A;  1ZYR F;  4KNY A;  3M8F A;  1AOY A;  2HZT A;  4UV8 A;  4MEX F;  3W6J B;  3WG9 A;  4M6Y A;  1O3S A;  5ILU A;  4JQF A;  2A5Y B;  3F72 A;  2RNJ A;  3JSP A;  2QQ9 A;  2VBX A;  4ZYE A;  3VEP A;  2PG4 A;  3H3U A;  5LHH A;  5AIQ A;  4FHT A;  2VOD A;  4M73 A;  3IRR A;  3ABT A;  4GXO A;  1PDN C;  4M72 A;  2CW0 F;  1U6G A;  1OYI A;  4CGZ A;  3C18 A;  3GFJ A;  2KJC A;  5L3G A;  4XSZ F;  4HX4 A;  1YLF A;  1FP2 A;  5LGT A;  3L7W A;  4AWX B;  1IF1 A;  1KQ0 A;  1U2W A;  3DXJ F;  5J6X A;  3KP4 A;  4EJV A;  4EMS A;  4IJA A;  2BV6 A;  4AIJ A;  1KU2 A;  3GFI A;  5BMZ A;  4A0X A;  2F5C A;  4MGR A;  3CJN A;  2P5L C;  4HA8 A;  2FMY A;  1F1Z A;  4KUM A;  3QPH A;  4HLY A;  1K78 A;  4ZZL A;  1SAX A;  1ZAO A;  3F22 A;  3CUO A;  4KN7 X;  2XUB A;  4QWQ A;  1K79 A;  1IXC A;  3OV8 A;  3FZV A;  1G3T A;  3KE2 A;  4M74 A;  2L4M A;  1RUN A;  3HOS A;  4BAY A;  4L5J A;  3K1N A;  4Y15 A;  5FLX Z;  1MJ9 A;  3M8E A;  4E70 A;  4BXU A;  3F23 A;  4G9Y A;  2P5K A;  4YIF A;  1ZG3 A;  3L09 A;  4XLN F;  2Y0M A;  4LK1 F;  3T8R A;  1Y0U A;  2VON A;  1DP7 P;  1T39 A;  1TQP A;  1BM9 A;  3I71 A;  2JSC A;  1PUE E;  5HLH A;  3HHH A;  3EYI A;  2YPR A;  4HV5 A;  4KFC A;  4A5N A;  2QQA A;  1FYM A;  4PCQ A;  1XCV A;  1RI7 A;  3I53 A;  4HF2 A;  3M9A A;  4I09 A;  1JHF A;  5HDN A;  1MGT A;  3NQO A;  2IRF G;  4I0A A;  1T98 A;  2J5P A;  2H6C A;  3J81 K;  5DYM A;  4LLL A;  3QU6 A;  2WC2 A;  1W4M A;  2G7H A;  3H92 A;  5K5O A;  4OIR F;  4EJT A;  3JAM Z;  5LRR A;  5CVU A;  2DTR A;  1SD4 A;  2OAZ A;  1U78 A;  1I5Z A;  4UXN A;  5ICE A;  4P96 A;  3RTR A;  2OBP A;  3K9T A;  3R0J A;  2Z3Y A;  2ZNZ A;  1Z9C A;  4RB0 A;  4RGU A;  3MZH A;  2YR2 A;  1USS A;  4UNO A;  3ROU A;  2F5D A;  4A2U A;  1KYW A;  4RGR A;  5DDG A;  4UVA A;  4ENK A;  5TRD A;  4U88 A;  1HSJ A;  4BHP A;  1A04 A;  1HW2 A;  5BPI A;  4Q48 A;  2FA5 A;  2GA2 A;  2RKH A;  1S7A A;  1VTN C;  2EA4 A;  2MD5 A;  5AIP A;  5E8I A;  1HKS A;  3I59 B;  4YFX F;  1CF7 B;  5BS6 A;  3DKW A;  5DUK A;  4N9I A;  1FBU A;  2NAZ A;  4U0V A;  1PP8 F;  3HIF A;  4L9V A;  4A6E A;  3TO9 A;  2X0L A;  1HST A;  4XRF A;  3RYP A;  3DPT A;  2HKO A;  4S05 A;  3NRV A;  1R1V A;  2LF8 A;  4N0B A;  4I7H A;  3BPX A;  2QM3 A;  4YFK F;  3MAJ A;  2DT5 A;  2R3S A;  2DPD A;  3T8T A;  3DV8 A;  4XLP F;  4G94 A;  2OQR A;  2DAO A;  2EB7 A;  4F7Z A;  1CF7 A;  1MD0 A;  2QUF A;  2EJR A;  5CYV A;  3DP7 A;  3E6M A;  2MH9 A;  5CJ9 A;  1ZGA A;  2WV0 A;  3H3Z A;  2HQN A;  3FMR A;  4LLG F;  2FBK A;  1B1B A;  1IN8 A;  4KDP A;  2VOP A;  2XRO A;  1R5G A;  3HSF A;  5FFX A;  5D5W B;  2G9W A;  2PBI A;  2DI3 A;  4WCG A;  2QWW A;  3CUQ B;  1TTY A;  4CHU A;  2XKO A;  1Z6T A;  5L3D A;  5ICF A;  2IT0 A;  4OIP F;  2XIG A;  2NYX A;  3D0S A;  4HF0 A;  4I98 B;  2XKP A;  5HVQ C;  2A3S A;  1YW9 A;  4L0Z B;  4MTE A;  4O5V A;  4G6Q A;  1E17 A;  3D5L A;  3Q9V A;  1BI2 A;  4L9J A;  1D5V A;  3IWF A;  2ADU A;  2KKO A;  5HOO A;  2NNY A;  5EEH A;  2CG4 A;  2XAH A;  5ED4 A;  5DCM B;  2IA2 A;  1WSU A;  4K2E A;  1CGP A;  1RIO H;  4WWC A;  3SZP A;  3EUH A;  2JPC A;  4GYG A;  1SFU A;  4OOI A;  4HYE A;  3R61 A;  2OZU A;  3IKT A;  4FX0 A;  2JT1 A;  4IF4 A;  1IAW A;  2IP2 A;  2PJP A;  2EWN A;  3VB2 A;  4P55 A;  3GFM A;  4G6D A;  4Q4Z F;  1Z6R A;  5H6Q A;  4WXC A;  5DCM A;  4EVI A;  2H6B A;  1IW7 F;  2KIU A;  1NHA A;  3MEX A;  4ESF A;  5D6F A;  3P9I A;  2PN6 A;  3ELK A;  1B59 A;  1OPC A;  3DF8 A;  3V7C A;  2UWM A;  2F5F A;  1IN6 A;  2UXX A;  3FXU A;  3T0Y A;  3R0A A;  3LST A;  1IXS B;  1SD6 A;  1LDK B;  1D8J A;  3ZN1 A;  2LSO A;  2ISY A;  5LLQ A;  3E6D A;  1Z05 A;  4EJU A;  2Q2E A;  1PP7 U;  5ILS A;  1XGN A;  1YW8 A;  1P4A A;  4YII A;  1I1S A;  1HBX G;  3WE2 A;  1IN5 A;  3ZQ7 A;  3ECH A;  1XCB A;  2P7C B;  3KZY A;  4O3M A;  2L3D A;  3RKX A;  3G3Z A;  3I58 A;  4M9Z A;  3ZMU A;  1AWC A;  1O7F A;  2P6S A;  4LD5 A;  5ICG A;  3FF5 A;  5D4S A;  2IW5 A;  2MLG A;  1WI9 A;  3JW4 A;  5E1Z B;  2UXN A;  2RVC A;  3P9K A;  3RJP A;  1R1U A;  1DPU A;  4AD9 A;  4RS8 A;  4G7H F;  1J0R A;  5DD8 A;  2P5V A;  1YIO A;  1R1T A;  1LEA A;  3HTU A;  4G7Z F;  1QQI A;  3RYR A;  3K69 A;  2E7W A;  2HFH A;  2M45 A;  1OKR A;  3G73 A;  3MFK A;  3WTX C;  4IPA A;  3BJO A;  2FNA A;  1KYZ A;  1GVJ A;  5LGN A;  1LB2 A;  2O6G E;  2PMU A;  3LA3 A;  3PQK A;  5DV5 A;  1SFE A;  2A07 F;  2BBY A;  1YTY A;  1UHW A;  5HLI A;  2HQR A;  2HR3 A;  1FSH A;  1ZLK A;  4ON0 A;  4KIC A;  2A68 F;  5CLS A;  4HW0 A;  3QAH A;  3KP7 A;  4KT5 C;  1MKM A;  1LDD A;  2VBY A;  3JSO A;  1EH8 A;  2HOE A;  2Z5U A;  4R8H A;  2FRH A;  5LRS A;  3MQ0 A;  5E17 F;  4IHS A;  3TKY A;  1K78 B;  2XAQ A;  3KLN A;  4WK8 F;  2L02 A;  2WTE A;  2WWY A;  3WTU C;  4DNC A;  5LHG A;  3GW2 A;  1C0W A;  3E97 A;  3ECO A;  3KEO A;  2FQ3 A;  1FX7 A;  1XSX A;  4A6D A;  3KET A;  2HS5 A;  5D8L B;  4OIO F;  1MDM B;  2RN7 A;  5LEK A;  2KIF A;  2C6Y A;  4LB5 A;  1OR7 A;  4XSX F;  2KIM A;  3J7A O;  1S6L A;  3GO5 A;  1T2K A;  2O61 A;  2IA1 A;  2GWR A;  5E8G A;  3WE3 A;  2G7U A;  2ZXJ A;  2PEX A;  2CYY A;  1ZRF A;  3F8N A;  3TOA A;  2D1V A;  3GYH X;  3VFZ A;  2XAF A;  2P8T A;  3KP2 A;  1BIA A;  4RB1 A;  5DD4 A;  2FSW A;  3T1B A;  1MDM A;  3TDU C;  2STW A;  2A69 F;  2DBB A;  2HEO A;  4CYD A;  5L3E A;  3MZY A;  1ZN2 A;  4L18 B;  3J81 Z;  2NNN A;  1JXS A;  3OOP A;  1TLH B;  1FBS A;  2ELH A;  2XAG A;  4KN4 X;  5DUI A;  2DO7 A;  2GXB A;  1XSD A;  3AAF A;  2P6T A;  4PZJ A;  1J5Y A;  4P5O A;  4GGG A;  1HKT A;  2JZY A;  3FMS A;  1H0M A;  2EFW A;  1HKQ A;  2K4J A;  4EV0 A;  1L0O C;  3KP5 A;  1H9T A;  3KFW X;  3M7G A;  4FT8 A;  3R4K A;  2YX4 A;  1W7P D;  4OMZ A;  3GZ5 A;  3FXR A;  2VC0 A;  1XMA A;  4P9U A;  1G3W A;  1G3Y A;  4ZH4 F;  3E6C C;  4EM1 A;  2D1H A;  2K7L A;  1YFH A;  1ZH5 A;  2EFQ A;  1ZRD A;  2FXA A;  1MJB A;  1J9I A;  1J2X A;  4OMY A;  1DPR A;  3BRO A;  3HRT A;  2BYV E;  3U2R A;  3U9G A;  2LF7 A;  3WU0 A;  5D5U B;  4NQW A;  2RQP A;  1FSE A;  3IC7 A;  2Z33 A;  2DQR A;  1UST A;  1BBY A;  1EH7 A;  4RAY A;  4RB2 C;  4OIN F;  2QQB A;  3EYY A;  1O7L A;  2W84 A;  5EEG A;  1V3F A;  1ON2 A;  3IWZ A;  3F3X A;  3Q5F A;  3E6B A;  4IXA A;  5E1X A;  5E1W A;  1XDU A;  1IZ1 A;  3ABU A;  5DCF A;  3FM3 A;  1WRJ A;  4ENN A;  3L2C A;  3ISP A;  2ZFW A;  4OIQ F;  1B9M A;  5L3F A;  2V79 A;  3HTS B;  1LNW A;  1Z91 A;  2CO5 A;  4AIH A;  1QGP A;  3K0L A;  1TBX A;  3KP6 A;  3EDP A;  1P2F A;  3DQV C;  4M6X A;  2OZ6 A;  3KCC A;  1WQ2 A;  3V7S A;  1S8N A;  1QBJ A;  5HLG A;  1G3S A;  1I1G A;  3RI4 A;  4ZYG A;  4L9T A;  4G8X A;  2A6H F;  4HQM A;  3HSR A;  4A0Z A;  3LAP A;  2P7V B;  1YS7 A;  5KK1 A;  4HLX A;  1UB9 A;  3RPU A;  2E1N A;  4ZYH A;  3WGH A;  2IPQ X;  5LBQ A;  3LFK A;  3SHF A;  3KZZ A;  4M9X A;  4A0Y A;  2AS5 F;  3BDD A;  4EM0 B;  2PMH A;  2VE9 A;  2STT A;  2PI0 A;  3F8M A;  3HRU A;  2DU9 A;  4LB6 B;  3MWM A;  5H6R A;  3JTG A;  1T0F A;  3KP3 A;  2XAS A;  2CSO A;  2DPU A;  1UHM A;  1S3J A;  5HDK A;  2ZME B;  4RGX A;  2JTV A;  4JK1 X;  4Z2Y A;  2R7F A;  3TDZ C;  2BEO A;  2FF4 A;  3SZT A;  1TQI A;  3WTV C;  3JTH A;  5ERI A;  3ZMZ A;  2KJB A;  3ZMS A;  1IN7 A;  4DQ2 A;  4YG2 F;  1P4W A;  1FY7 A;  3COA C;  3CTA A;  3SXY A;  1TW2 A;  4JBA A;  1DDN A;  2VE8 A;  1FLI A;  4EJW A;  3I4P A;  1XSV A;  1JGS A;  2ZME A;  4CZZ A;  1FBQ A;  2QYO A;  2LNB A;  4L9N A;  5J8C A;  3E5U A;  1LJ9 A;  3BY6 A;  3FHZ A;  1ULY A;  1P4X A;  2ESH A;  3ERE D;  3WU1 B;  3E3V A;  3VOD A;  1FT9 A;  4S04 A;  4PGH A;  2Q0O A;  4WXD A;  5L3C A;  4HDU A;  4MQV A;  3DPL C;  4EQQ A;  1D3Y A;  2RV8 A;  1U5T C;  4IRH A;  1BJA A;  4MEY F;  2H09 A;  2ZNY A;  4NHJ A;  2Q8K A;  3GXO A;  4EGY A;  3TO6 A;  1XN7 A;  2VBW A;  3PFI A;  2ACJ A;  5F64 A;  2XRN A;  1J59 A;  5JI6 A;  4EGZ A;  2MBF A;  4A5M A;  3R60 A;  1O3R A;  4QLC U;  4AIK A;  5H20 A;  1EV7 A;  1RNL A;  5LEJ A;  4HF1 A;  1P6R A;  2KRF A;  2H27 A;  1IRF A;  1YG2 A;  1R7J A;  4HV6 A;  4U0Y A;  3REO A;  2XV4 S;  2ZKZ A;  3HSE A;  4B8X A;  2LKP A;  1FYL A;  4ASN A;  4LJZ F;  1REP C;  4HX7 A;  2OU2 A;  5CVR A;  3I54 A;  3ZMT A;  1L3L A;  3EET A;  1OYY A;  4BQA A;  1R00 A;  2P4W A;  5D5V B;  2OD5 A;  2GA1 A;  4LK0 F;  1MZB A;  2O03 A;  3MCZ A;  3BP8 A;  2Z99 A;  4U7B A;  2M1B A;  2FBH A;  1S7O A;  2GQQ A;  1YW7 A;  4LGW A;  3IKV A;  2COM A;  2ZJ2 A;  3P7N A;  5CVJ A;  2YSR A;  4Q47 A;  4P9F A;  4H0E A;  1U8R A;  1IUY A;  3WOD F;  3EQL F;  4WF2 A;  5FO5 A;  1R36 A;  4O6J A;  3F8B A;  1GXQ A;  1XMK A;  2MLK A;  3BOQ A;  3M1E A;  4HAM A;  5FD6 A;  4ENM A;  3WTS C;  1R23 A;  2GIV A;  4BHB A;  3ZN0 A;  2QLZ A;  2FU4 A;  1HW1 A;  1RUO A;  4CDG A;  2GAU A;  2QZ8 A;  2V9V A;  2W85 A;  1O57 A;  2QVO A;  2HYG D;  3IRQ A;  2M30 A;  1ZLJ A;  1W7P A;  2Y48 A;  3BZ6 A;  5J8F A;  4GYI A;  3IHU A;  5JHU A;  2M8E A;  2VN2 A;  1KU7 A;  1KU3 A;  2E1C A;  3KEQ A;  3TOB A;  3F8F A;  2B0L A;  1BOA A;  4AVP A;  4A12 A;  2V1X A;  4BH9 A;  2DK8 A;  3E5X A;  3QP5 A;  5LGU A;  2HKX A;  1FP1 D;  1K7A A;  4IRI A;  3CO6 C;  1GXP A;  2BGC A;  3Q9S A;  1STZ A;  1FPQ A;  3TGN A;  1ZGJ A;  2HGC A;  2O8X A;  2RGV A;  4LG0 A;  4ZZD A;  1F4K A;  5F1R A;  4Y13 A;  2ISZ A;  2D2W A;  3CO7 C;  5CVV A;  3T5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...