1D8JA

Solution structure of the central core domain of tfiie beta
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
publication title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02186 TFIIE_beta TFIIE beta subunit core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d8jA00
2XGXA 1B1BA 4YFXF 1UHMA 3GO5A 1RNLA 2IRFG 3ECOA 3OV8A 3WTVC 1BN5A 1DUXC 4HZFA 3ISPA 5K5OA 3W6JB 4M73A 3R60A 5K1YA 2P5KA 2XAFA 3ZMVA 2G7UA 2Z99A 5ILSA 1K7AA 5LGTA 3S2WA 1BI0A 2WV0A 4P9FA 5DUIA 3I58A 2V9VA 3G73A 3BJOA 4IHTA 4FHTA 1O7LA 2YX4A 2CO5A 3HHGA 3J7AO 3T0YA 4MHGA 2L4AA 3TKYA 3TGNA 3TO6A 2O3FA 5JVTA 5LRRA 3L9FA 3V7SA 2FBHA 4HX7A 4I2OA 2V79A 4YFNF 3JTHA 1T38A 2DFIA 4JK1X 1KYZA 2PMUA 1O3RA 1QZYA 3LQQA 5AIPA 3ZMSA 1CGPA 3E6MA 2YX7A 1R1VA 2Y0MA 2PBIA 3FX3A 3N4MA 3ZMTA 3M1EA 5CVRA 1YW9A 4PGHA 1K79A 4IJAA 3M9AA 2A3SA 1T6SA 3RTRA 1XGOA 1TQIA 3MAJA 5K5RA 5HOOA 3HOSA 3GYHX 4BXUA 3F8FA 4ENJA 1KU3A 5LEKA 2PFBA 4IRIA 1QNTA 3EYIA 1RI7A 2IJLA 4KN4X 1W7PA 4S05A 1OPCA 3K1MA 3KP3A 5AONA 5L3EA 3JW4A 2QYOA 5D8KB 1FT9A 1O3SA 4LLLA 1R1TA 2RKHA 3RPUA 1JGSA 2KJBA 3Q5FA 2JTVA 3KFWX 1S29A 1OYWA 2EWNA 3R0JA 3HTSB 3F8BA 4BQAA 4MQVA 4L9TA 4KMFA 1T98A 1SMTA 1YYVA 5CLSA 2IA0A 3PQKA 3WTUC 3KP7A 3GZ6A 5E1ZB 3HSRA 3I71A 1ZARA 2WC2A 3ABTA 1J5YA 3FZVA 5BQTA 1IXSB 1O3QA 2CQKA 1GVJA 1HQCA 2LF8A 4GYIA 4NB5A 4L5JA 4HQEA 4AD9A 2QVOA 2A61A 1TQMA 5ERIA 4HYEA 1H9TA 2IW5A 1A04A 2IT0A 5LHIA 2DLLA 4DNCA 3IC7A 2ZFWA 1WKMA 5E17F 5D4RA 3C3WA 2HEOA 4I98B 2BE5F 5LBQA 4R1HA 1O57A 2HQRA 2XKOA 2DT5A 3BJAA 2FF4A 3LSTA 2QBYA 2QBYB 3OOPA 3WGHA 3K0LA 2M45A 6PAXA 1BIBA 1LDDA 2HDCA 3L09A 4B09A 5FD5A 3FHZA 1P6RA 1EH6A 2RC4A 1FBSA 3DEUA 4MEXF 5DV5A 2PMHA 4Y15A 2GWRA 1XGMA 2GA1A 3QPTA 1W5SA 5A2QZ 2HTJA 3H3ZA 5FD6A 1GXPA 1KU9A 3TDZC 3EYYA 2YR2A 1S6LA 2F2EA 3HRMA 3FXRA 1YO5C 2VE8A 1MJAA 4CHUA 4UUVA 4KFCA 3G3ZA 5CVJA 5A2QK 1V4RA 3WE3A 2VOOA 1KYWA 3KZYA 2XHKA 3FXQA 4KICA 3GFIA 2XV4S 2GXBA 4KMUX 1BOAA 4KDPA 1BC8C 3J81Z 4HV5A 2L01A 4ESBA 4XSZF 1BI3A 5E8GA 2HGCA 1STZA 3BJ6A 5F6FA 4G6DA 4A0ZA 1KGSA 4Y17A 2AXLA 4Q4ZF 1HSTA 3FMSA 1HBXG 3WU1B 4L18B 3J81K 5F64A 5FLXZ 4L9NA 1P4WA 4U88A 1FYMA 1FOKA 2EV6A 2LDUA 5JFRA 4HF0A 1TW2A 2STWA 3I53A 2HYGD 1ZHFA 1U5TC 1R23A 1SD6A 5FLXK 3AAFA 3P9CA 2XUBA 1U8RA 2M30A 2OZ6A 1DP7P 2UZKA 5BS6A 2OZUA 1Z6RA 2XRNA 2M8EA 3VFZA 3ZMDA 4HF1A 5DCMA 2ZXJA 1SD4A 5DCMB 4RAZA 4WX9A 4KA4A 3HUGA 2FEZA 2H6CA 4AWXB 1U5TB 4RB1A 1FC3A 2ZKZA 2A69F 2A6HF 3R4KA 2V1UA 4OMYA 4ZYGA 2GZWA 2V6CA 2MH2A 3E5QA 1BIAA 3IKVA 2NYXA 4G7HF 4KYWA 3ULQB 4N9HA 2DTRA 4ETSA 3GWZA 3E5XA 3F8MA 4MNUA 5L3CA 3C1DA 4P96A 1IN7A 3WGIA 2AS5F 2PJPA 2KRFA 3DKWA 2C6YA 1B9NA 4I0AA 4ZYEA 2IA1A 3O2PE 1D8KA 2MH9A 3V8JA 1EH8A 2CSOA 1Q1HA 5D5XB 4HBLA 4YIFA 1Z6TA 2LF7A 1B9MA 3LFKA 1Z05A 2GQQA 2JPCA 3N97A 1W4MA 2V1DA 2XROA 4A6DA 2HTSA 2QENA 4OIPF 2FRHA 2DBBA 4G7OF 3H92A 4N0BA 3HIFA 1IN5A 4ZH4F 1ZRDA 3L00A 4BHBA 4IRGA 4AIJA 3HRSA 4A2UA 3F6VA 2A68F 1ZG5A 1XSXA 5J8CA 4EJUA 1WI9A 5ICEA 5DDGA 3V7RA 1QQIA 5E20A 1GXQA 5CJ9A 2HR3A 5L3GA 2L02A 2CWEA 3IL2A 4HX4A 2ZO4A 3ZMZA 4AVPA 4CICA 3K9TA 2W85A 2DPDA 3KEOA 3V7CA 2CGPA 1MJ9A 2VN2A 2O61A 3LA3A 4RGXA 4HX8A 3ZQ7A 2VE9A 1ONVA 2IPQX 2O8XA 3T8TA 3RDIA 4PCQA 3U9GA 1ZGAA 5L3BA 3F8CA 3GLXA 1S7AA 1OMIA 1LDJA 2F5DA 3VB2A 2W25A 1BI1A 3BWGA 5H6QA 2EJRA 1RZ4A 3D0SA 2YSRA 1O3TA 3BPVA 2XAQA 4MQ9F 1ON1A 5HS7A 2MC3A 1W7PD 3B73A 4A12A 1Y0UA 2R7DA 1DDNA 4EJWA 2K4BA 5KK1A 4L9JA 4OMZA 1I27A 4M9XA 4WXHA 1ZG3A 1FBQA 2FU4A 3K2ZA 4EM2A 1QO0D 2UWMA 5H6RA 4PDKA 4XLNF 1F9NA 5LHGA 2VC1A 2ACJA 4U0YA 2LSOA 2Q2EA 1ZG1A 2ZNYA 1G3TA 4E70A 2A6EF 1KA8A 1R00A 1H9GA 3EDPA 2D2WA 3CO6C 1IZ1A 3PQJA 1ZH5A 1R1UA 4M71A 4BH9A 4HDUA 1J2XA 1IRGA 5ICGA 2ZJ2A 3C7JA 4RGSA 4LLGF 3KP4A 1VTNC 3FXUA 1MJBA 4R8HA 2MLKA 4ZYHA 1MKMA 4LK0F 1MD0A 2FBKA 3RI4A 1J75A 2EA4A 2DI3A 2YU3A 2YPRA 1RIOH 2A07F 1T0FA 4Q47A 1HW5A 4ESFA 3WTSC 4A5NA 5HLHA 1HSJA 3TO9A 1LNWA 3O6BB 4Q5SF 2P7VB 4JQFA 2PI0A 4U7DA 2EV0A 3K1NA 2NNNA 2X4HA 2ESNA 3KZZA 2DAOA 5JHUA 1TTYA 2IP2A 3ZMUA 4AIKA 1KQ8A 3SXYA 2OQGA 1PP7U 1U6GA 1MGTA 2NNYA 4A6EA 3COAC 2GXGA 2W24A 1P92A 3JSOA 1U78A 4KIFA 4GCVA 1TNTA 1E17A 1PP8F 2K7LA 5EEGA 1G6NA 3WG9A 5HVQC 2ZBKA 4IF4A 1BI2A 2FOKA 1XB4A 4HDVA 1LJ9A 3MZYA 4O3MA 3E6CC 3V8KA 2MBFA 2HQNA 4U0WA 2FA5A 1IF1A 1WQ2A 3J80Z 5D8LB 3WTYC 3K69A 1WSUA 2JPBA 2L54A 2VBXA 1ON2A 1YG2A 3BDDA 4M9SA 1TQPA 2DW4A 3M7GA 3WTTC 3U1DA 1XMAA 4ESJA 3KCCA 3J80K 1YFHA 5DD4A 3M8EA 4EM1A 3ECHA 2RDPA 4OINF 1JHHA 4Y13A 1FWZA 4GGGA 1AWCA 1R5GA 1SMYF 4IRHA 4FT8A 2KIFA 1B4AA 2EFNA 4H0EA 3HYIA 2TDXA 3ELKA 3GUDA 3REOA 2RN7A 1R58A 5FFXA 3LA2A 1S8NA 2EFPA 1LVAA 3F23A 4GO1A 4OIRF 4BHPA 5CYVA 3SZPA 4RS8A 4BYYA 1BM9A 4XLPF 3MFKA 2CG4A 3KEQA 1XCBA 1L3LA 4YG2F 3Q9SA 4LB5A 2R3SA 3TO7A 2GAUA 3TDUC 3GZ5A 1R22A 4EGZA 2H94A 1UCRA 4BHCA 3VEPA 3ZPLA 1T39A 1IXCA 1I1SA 4S04A 4PGGA 4FX0A 1TLHB 2BV6A 3DFGA 5HLIA 2STTA 4LGWA 3F6OA 3KLNA 4UNOA 1G3SA 3BROA 2FNPA 4EQQA 1P4AA 1XSDA 3DF8A 2VOPA 4YIIA 4CYDA 4CO8A 1QGPA 5E1WA 2UXXA 4LLNA 1HKSA 1ULYA 4LMYA 2P4WA 4A0YA 3KP5A 5L3FA 1GHCA 1KU2A 2KIMA 1LQ1A 2V1XA 3VODA 4ZZLA 2RGVA 1ZN2A 3CUOA 2R7FA 1MZBA 5JR3A 1RUNA 5DCFA 1FZPB 4I02A 2H6BA 2HKOA 5EEHA 1IXRC 4EGYA 3BP8A 1LEBA 1U5TA 2VONA 4O6JA 4HLYA 5FFZA 4I09A 2P7CB 1HXDA 5LGNA 1S7OA 5BMZA 1FSEA 4RB3C 4Q48A 3F72A 4EMSA 2FSWA 3E5UA 1ZAOA 4RB2C 3F3XA 5BOXA 3RYRA 3KP2A 2OU2A 1IN4A 3GVAA 2DK5A 3B02A 3WODF 2LNBA 4L9VA 4P5OA 5DEQA 1E2XA 3EQLF 2XAJA 3LQRA 2QQAA 1TBXA 3I4PA 1J0RA 5D5UB 2D45A 1KQ0A 2QZ8A 4B8XA 3JAMK 3ERED 2E1CA 4I0BA 4DQ2A 4ZYDA 2FNAA 1USTA 5J6XA 1Z1DA 3HTUA 4FX4A 4KIGA 4UVBA 1F5TA 4IXAA 3GX4X 4EJTA 1ZYRF 2FMYA 4P55A 2ADUA 2P5LC 3MZHA 3WE2A 1IAWA 1FLIA 1HW2A 3IKTA 4GYGA 4F7ZA 4UXNA 1NHAA 2Z3YA 2JRTA 3CTAA 2B0LA 3RIRA 3FM5A 1OKRA 1U3EM 1WRJA 2H09A 4IVNA 4M72A 5BPDA 5HLGA 5CVVA 4BNCA 5FB2A 2M5WA 5D6FA 1BBYA 3QU6A 1LB2A 1FYLA 3GFLA 3D5LA 2EFOA 1Z91A 4G9YA 3E6BA 5D6EA 5E8IA 5LEJA 2P8TA 1FY7A 2XAHA 1YS7A 2KKOA 2JT1A 3RKWA 2ISYA 2XASA 4G6QA 2RVCA 1IW7F 1XDSA 4NQWA 2QQBA 3MEXA 4WXCA 1K78A 2Y48A 3KETA 1K78B 3DP7A 3R6SA 2FMLA 4KN7X 4Z2YA 4BAYA 5AIQA 2ETHA 3FMQA 4OU0A 2GA2A 4G94A 2HS5A 5J8FA 3BOQA 3RJPA 3QAHA 1QZZA 4IPAA 2ELHA 4LK1F 2HZTA 5LGUA 2PEXA 1FYKA 5ILUA 1G3WA 2FBIA 4EV0A 2G9WA 2JZYA 4U0VA 1R7JA 2PN6A 1SD5A 3EETA 4O5VA 4WXDA 1T2KA 1XN7A 3HSFA 1FSHA 1IRFA 1FBUA 5H20A 4LG0A 3GW2A 5KVRA 2O0YA 4LG0B 5DUKA 2NRAC 3HSEA 4KIBA 2COMA 1X3UA 2JSCA 3GEZA 1PDNC 5LRSA 4WF2A 1CF7A 1QPMA 2F5EA 2E1NA 1CF7B 1JXSA 2ZNZA 3GFMA 3QRFF 3L2CA 2F5FA 2L4MA 4HAMA 5LLQA 5HDKA 2Z9OA 2EFQA 4OIOF 4PZJA 5HS9A 3BZ6A 5CVUA 4TV7A 4CZZA 4UVCA 3WTWC 3F21A 2QWWA 3I64A 3WGGA 3F8NA 3DXJF 1ZGJA 4UVAA 1SFUA 4AIHA 1I6XA 3IWFA 5DYMA 2CYYA 2K4JA 3GXOA 1YW7A 3L7WA 4EJOA 5ICFA 2NAZA 4L0ZB 1L0OC 1S3JA 1YS6A 1R36A 2E7XA 3LA7A 3W6KB 4M74A 3KP6A 4GXOA 2OAZA 2KJCA 5ILVA 2BYVE 1D5VA 2DU9A 3K1PA 1XCVA 2QM3A 5CVIA 4U7BA 2LKPA 4UV8A 1XDUA 4ON0A 4LB6B 4A0XA 3DQVC 1W7PB 3ROUA 3EUHA 1D3YA 5TRDA 2A5YB 2Z33A 4MGRA 3O3KA 3WU0A 4G7ZF 4EJVA 1DPUA 1OYIA 3CO7C 2WTEA 4I7HA 5HS8A 3QOPA 1AOYA 3I0TA 5L3DA 3FWEA 3DPLC 2M87A 4D0PA 2EA2A 3SZTA 2P6TA 1Z9CA 1TNSA 2HYFA 1H0MA 4ZZDA 2BGCA 3HRTA 2VXZA 2QQ9A 1FX7A 1DPRA 1MDMA 1C0WA 3I59A 2OD5A 1TW3A 1MDMB 3T8RA 2BEOA 3I59B 1P4XA 3WTXC 4ENNA 4CXFA 2UXNA 1J9IA 1K6OA 4L0YB 3CDHA 3TOAA 2ZMEA 5IT3A 2ZMEB 1JE8A 3CUQC 2CW0F 3IHUA 2Z5UA 1OYYA 1EV7A 2J5PA 3SFZA 1YIOA 3E97A 5D4SA 4RB0A 4YFKF 1IN6A 1ZLJA 2IA2A 3NQOA 4WCGA 4RAYA 4HA8A 1B6AA 4WWCA 1U2WA 3F22A 2ESHA 4CDGA 2FXAA 3CUQA 3CLOA 3CUQB 5E18F 5ED4A 2D1HA 3JTGA 2G7HA 2K02A 2OBPA 1KQ9A 3BY6A 2P6SA 1YQAA 2W84A 3PFIA 1B59A 3ML6A 1XD7A 3RYPA 5D5WB 2L3DA 1G3YA 2XAGA 1BC7C 2DO7A 1YTYA 3TQNA 2PG4A 1Z7UA 3VOEA 5LHHA 2K27A 3GFJA 1FPQA 2HKXA 2NS0A 3E6DA 4JBAA 4R79A 2DQRA 1YW8A 2W57A 2VT3A 1D8JA 3P7NA 3NRVA 5K5QA 4L5IA 1JHFA 1YLFA 1UHWA 1ZRCA 3QP5A 5HDNA 2IVMA 4ASNA 3I5UA 4OOIA 2EK5A 4G8XA 4RGRA 1WWXA 3LAPA 5ICCA 2DK8A 2HFHA 2OA4A 1LEAA 3MQ0A 3RKYA 3ZP5A 4EM0B 4XBFA 2O6GE 2RQPA 1P2FA 3FM3A 3RPQA 3MCZA 2M1BA 1O7FA 2VBWA 2J5OA 3DV8A 4HF2A 4KUMA 3CJNA 3I54A 3GF2A 4N9IA 3KE2A 2D1VA 1I1GA 1USSA 1XMKA 4ENMA 2ISZA 2RV8A 2EV5A 3TOBA 2DPUA 2WWYA 2VBYA 1FNNA 4MTEA 3LAJA 1XGSA 3IRRA 5FO5A 2EFWA 5DD8A 1I5ZA 5TJJA 2HWVA 4I01A 2RNJA 4ENKA 2Q8KA 1UB9A 3RKXA 3JAMZ 5BPIA 4HV6A 1IUYA 1XSVA 3JSPA 1F4KA 5F1RA 2QUFA 4CGZA 2VODA 4QWQA 4MEYF 2K86A 3V4GA 2KIUA 2E7WA 3MWMA 3P9IA 2O03A 2BBYA 3LWFA 4M6YA 3R0AA 3ZN1A 3FF5A 3HHHA 3U2RA 5D5VB 4OIQF 1HKTA 2PQ8A 1FP2A 1SD7A 4A5MA 4HW0A 1ZLKA 2EB7A 4HLXA 3QP6A 1EH7A 2DQLA 2MD5A 2X0LA 4UV9A 1SFEA 1BJAA 3KLOA 4KNYA 4HQMA 3BPXA 4XRFA 2VT2A 3HOTA 1SFXA 1W5TA 3P9KA 3QPHA 4XSXF 2FQ3A 1F1ZA 1ODDA 1HW1A 1LDKB 3DPTA 3H3UA 1SAXA 2MA3A 3SHFA 3Q9VA 4WK8F 2XKPA 4M9ZA 1ZREA 4LJZF 2XVCA 1V3FA 3IRQA 2XIGA 2P5VA 5E1XA 3ABUA 3HRUA 1RUOA 4K2EA 1HKQA 5IT9Z 2OQRA 3WTZA 3QU3A 3NEUA 4KT5C 3ZN0A 3SQNA 1OR7A 2MLGA 1QBJA 2H27A 1UFMA 2CFXA 2VC0A 2VBZA 1J7KA 4MTDA 3FMRA 4UHTA 2GIVA 4NHJA 4IHSA 5IT9K 4RGUA 1KU7A 2HOEA 5FGMA 2ZCWA 4HOBA 4LFUA 3T1BA 4LD5A 2PLYA 4QLCU 1XGNA 3R61A 4M6XA 1R5HA 1G4DA 4EVIA 2Q0OA 2F5CA 2FE3A 5JI6A 1J59A 1PUEE 1FP1D 2QLZA 1REPC 3IWZA 3E3VA 3C18A 2Y75A 1IN8A 3V8LA 4P9UA 3T5XA 5HDGA 3M8FA 1ZRFA
chains in the Genus database with same CATH superfamily
2XGXA 1B1BA 4IHWA 1I6HJ 4FE4A 4KJZA 1YIJI 4YFXF 1UHMA 3GO5A 3OMYA 1RNLA 1UAAA 5F0CA 2IRFG 1LUJB 3ECOA 4CA0A 3OV8A 3WTVC 1PYVA 4V2FA 3AKZA 1BN5A 1DUXC 4HZFA 2R7QA 2DFFA 3ISPA 4CCOA 5K5OA 1TWHJ 5DM6F 4NC7A 4M73A 4XKWA 3W6JB 5IYDJ 3R60A 1V5EA 2LBFA 5K1YA 2P5KA 2XAFA 3ZMVA 2DMUA 2G7UA 2Z99A 5ILSA 1VI0A 3DCFA 1K7AA 2XB0X 3RZDJ 4RMNA 2V6EA 5LGTA 3S2WA 1BI0A 3RPUD 2CV0A 2WV0A 3BT9A 4P9FA 3I58A 5DUIA 2V9VA 2KMUA 4X1EA 3G73A 4F93B 1HDDC 3BJOA 1X1CA 4IHTA 2E2JJ 3F0CA 4FHTA 2IS6A 2COBA 1O7LA 2IS1A 2YX4A 1XG1A 4J00A 2CO5A 3HHGA 3J7AO 3S1QJ 2F4IA 3FIWA 4I76A 3T0YA 4MHGA 1F43A 3EUKL 3VSKA 2O8KA 2L4AA 3TKYA 3TGNA 3TO6A 3S3OA 2R7UA 3CCYA 2Q2EB 2O3FA 3OIPA 5JVTA 2H8RA 2B63J 5LRRA 2LRDA 1RC9A 3L9FA 3V7SA 2FBHA 4HX7A 4I2OA 2V79A 5CQEA 5K7FA 5CPRB 5H2FC 2CQNA 4YFNF 3JTHA 1T38A 2MABA 3K4NA 2ELKA 4D9JA 2DFIA 2R7OA 3IH2A 2BVMA 2VKHA 4JX6A 4LIVA 3H9JA 4JK1X 4IHYA 1KYZA 2PMUA 1O3RA 4KISA 3FXOA 1QZYA 2DMNA 2XAUA 3LQQA 2EZIA 5AIPA 3ZMSA 4XLEA 2IGMA 3CCJI 1MBHA 4N4OB 1CGPA 3E6MA 1TC3C 2YX7A 2OTJI 5J3LA 1R1VA 2Y0MA 2PBIA 2LLKA 2VL8A 1M1EB 3FX3A 3N4MA 1HDPA 3TW6A 3ZMTA 3M1EA 5CVRA 1YW9A 2VKDA 4CSWA 4PGHA 3I4MJ 1K79A 4IJAA 4BY1J 5C4JJ 3M9AA 2A3SA 1T33A 5LD2C 4E7KA 2R7XA 1T6SA 3I55I 3RTRA 1Y1WJ 1KONA 1Y0NA 1XGOA 1TQIA 3MAJA 3VSLA 5K5RA 5HOOA 2VQLA 2JK3A 3I56I 3W2WA 5M5XJ 3HOSA 1JTYA 3K6GA 1GV5A 4HSTA 3H0GJ 3PFYA 1YX5A 3GYHX 4BXUA 3FISA 3F8FA 3HGYA 5FRMA 4ENJA 1KU3A 2OTLI 3G1OA 2LY9A 5LEKA 2ME0A 2PFBA 4IRIA 1QNTA 2XDVA 3ZQFA 3Q0UA 3EYIA 1RI7A 2IJLA 2R92J 1Y1VJ 2ZB9A 4PSWA 2RQQA 4KN4X 4CH7A 1W7PA 4S05A 1OPCA 3K1MA 1Y56A 3KP3A 5AONA 5L3EA 3ASNH 3JW4A 2QYOA 5KNLA 5D8KB 1IG7A 1Z3XA 1FT9A 1O3SA 4LLLA 3ABKH 1R1TA 2CQQA 2RKHA 3QQAA 3RPUA 3OYEA 1JGSA 1Y6IA 1ETOA 1V5FA 2KJBA 3K4KA 2Z16A 3BR1A 3OYBA 3Q5FA 3S1MJ 1JUSA 3JRBA 3JRFA 2JTVA 3KFWX 1S29A 1OYWA 2K85A 2W1OA 2EWNA 4ZDLA 3R0JA 3HTSB 3PSIA 3F8BA 2DA1A 5KCMA 4BQAA 4XOPA 4MQVA 4L9TA 4W97A 4KMFA 1T98A 1IGNA 1P7JA 1SMTA 1YYVA 5CLSA 2IA0A 3PQKA 3WTUC 2XSJC 3KP7A 3GZ6A 1V5GA 5E1ZB 2KZGA 2YS9A 3HSRA 1UG0A 3I71A 1ZARA 3ABTA 2WC2A 1ETQA 1J5YA 2ELJA 3DTIA 3FZVA 2F48A 5BQTA 1IXSB 5C4XJ 1O3QA 2JWTA 2CQKA 1GVJA 1H8AC 3NWSA 1HQCA 2LF8A 4Y3OA 2Y0SA 3PNTA 1JT6A 4XLCA 3SYTA 3BTLA 4GYIA 1JKPC 4NB5A 4L5JA 4HQEA 3LSHA 4AD9A 5K7ZA 2QVOA 2VASA 2A61A 2XF7A 1TQMA 2OV7A 2ME6A 5ERIA 4HYEA 1H9TA 3HOYJ 2IW5A 2VUMJ 1A04A 2IT0A 5LHIA 1K83J 5FKOA 3DPUA 2DLLA 4DNCA 3IC7A 2ID6A 5F04A 2ZFWA 2CV2A 1WKMA 4BBRJ 5E17F 5D4RA 3C3WA 3JRIA 5M3FJ 4BDZA 2HEOA 4I98B 2BE5F 5LBQA 4R1HA 2VJIA 1O57A 3OYHA 2HQRA 4JP0A 3PJRA 3KYLA 2XKOA 2DT5A 3BJAA 3WG7H 2FF4A 3LSTA 1NTCA 4DJAA 1ORKA 3SEZA 2QBYA 3BCAA 2QBYB 1MMAA 3OOPA 3WGHA 1TP4A 1DP3A 3CDLA 3K0LA 3OIQA 2M45A 3BR3A 2RAEA 1GVDA 3QPLA 6PAXA 2JA5J 1MIJA 4PSXA 3Q0WA 1BIBA 2LD5A 1LDDA 5J4YA 2HDCA 3OSFA 3L09A 4B09A 1RRJA 2Y0SN 2LR8A 1LFPA 4NNJA 5FD5A 3FHZA 3LSRA 4XIDA 4DBRA 1P6RA 2WY8Q 1BL0A 2BW3A 5IYCJ 3CF5F 3QPSA 2VLAA 1EH6A 2RC4A 5IOYA 2BW3B 1SVOA 2LVSA 1WH7A 1FBSA 1X4OA 3DEUA 2X6YA 4MEXF 5DV5A 2DN0A 3LSPA 1A35A 4B47A 2PMHA 4Y15A 2GWRA 1XGMA 1W0TA 2GA1A 2ZJRF 3QPTA 1W5SA 3OYIA 5EZHA 3PIOF 3OR2C 5A2QZ 1B8IA 2HTJA 3H3ZA 5FD6A 1GXPA 2QCOA 1KU9A 3TDZC 5K7HA 4A3KJ 3EYYA 4YRVA 1LE8A 2YR2A 4RDUA 3K10A 1LE8B 3L2VA 1S6LA 1QRYA 4YEJA 3PNYA 2F2EA 3HRMA 3FXRA 1YO5C 2EZHA 1LVKA 4CCJA 2VE8A 4CZCA 1MJAA 4CHUA 4UUVA 2FJ1A 3S1RJ 1MMNA 4KFCA 3G3ZA 1ITYA 5CVJA 5A2QK 4DYRA 2HQAA 2LP0A 1V4RA 3WE3A 1WJ5A 1KZHA 2NVTJ 1FOYA 2VOOA 1KYWA 3KZYA 3FKIJ 2XHKA 3FXQA 4KICA 3GFIA 2L9VA 2DYRH 2XV4S 4IOAF 2GXBA 4KMUX 4C2TA 1BOAA 4KDPA 3H36A 1BC8C 3J81Z 4HV5A 2L01A 4ESBA 2ZSIB 4XSZF 4M3GA 4CUGA 1Y8QB 1TWAJ 1WGXA 2XF5A 1NH3A 1JJ8C 2E2IJ 3OS0A 1W5CC 1BI3A 2DYSH 3SEQA 3K70C 5E8GA 1EF4A 3HOUJ 2HGCA 1STZA 2CJJA 2OUMA 3BJ6A 5IYBJ 5F6FA 3M4OJ 4G6DA 4A0ZA 1KGSA 4Y17A 2AXLA 1OCTC 2MGQA 4Q4ZF 1HSTA 4NUBA 4YIRX 4RLFA 2W00A 3FMSA 3O8HA 1HBXG 3WU1B 4L18B 3J81K 1I39A 5F64A 5FLXZ 4L9NA 5EYRA 1P4WA 4U88A 1FYMA 1FOKA 2A6TA 2EV6A 1FMWA 5FKKA 2LDUA 4RM3A 5M3MJ 2H1KA 5JFRA 4HF0A 1TW2A 2WADA 5HNFA 2STWA 1B72A 4B44A 1BA5A 3I53A 3ZXSA 2HYGD 1B72B 3OYJA 3M3YJ 1ZHFA 1U5TC 1R23A 3HZJA 1MBGA 2M7BA 3HM5A 1SD6A 2E35A 5FLXK 3JREA 3OOUA 3AAFA 4Y4RA 3P9CA 2XUBA 2KT0A 1U8RA 3HJEA 2ECBA 2M30A 2OZ6A 1DP7P 5FKMA 3HC7A 4M3FA 2UZKA 4BS9A 5BS6A 2BXZA 2OZUA 2LOOA 1Z6RA 2M34A 2XRNA 3H5RA 2M8EA 4M3BA 1JT0A 3RQIA 4ZTJA 3HXLA 3DBHB 3VFZA 3ZMDA 4HF1A 2IEKA 2ZXJA 5DCMA 2R7RA 1SD4A 1K4SA 1CQTA 2ZXIA 3MKZA 5DCMB 4RAZA 4BACA 4WX9A 4IHVA 4XORA 1DGWY 1ZTRA 4KA4A 1TL8A 2X6XA 2FEZA 3HUGA 1N77A 3HUGB 2H6CA 4AWXB 1U5TB 4RB1A 1FC3A 2KQRA 2ZKZA 5KHDA 4FASD 2A69F 3BG7A 2A6HF 3R4KA 2V1UA 4E7JA 4OMYA 4XKBA 2B9SA 3RKQA 4ZYGA 5IY5H 2GZWA 2V6CA 1XC5A 3GBGA 1GT0C 2MH2A 4AIDA 2H1LA 3E5QA 1MNDA 4AYBA 1BIAA 3H1CA 2ZSHB 3IKVA 1WPKA 2NYXA 4G7HF 3OYKA 4KYWA 3ULQB 4II3A 3TP3A 3ASOH 2DTRA 4N9HA 4ETSA 3GWZA 2MW8A 3E5XA 3F8MA 3LSJA 4MNUA 5L3CA 1QA6A 2BY1A 3C1DA 3PL8A 4P96A 1ERDA 5HLTA 1W0UA 2IAIA 1IN7A 3KX2A 3WGIA 3PO3J 1A6QA 2AS5F 2PJPA 2KRFA 3DKWA 4E6KG 2A05A 2NOJB 2C6YA 1B9NA 4I0AA 4DZPA 2VQHA 4XM3A 4ZYEA 2IA1A 3O2PE 1IRZA 2PMZA 1D8KA 2R5ZA 2MH9A 3V8JA 1EH8A 2DDAA 2R5ZB 3K4CA 2CSOA 3M1CA 1Q1HA 2XGCA 4HBLA 5D5XB 4YIFA 4YELA 4A69C 1ZR4A 1Z6TA 3QWLA 2X6WA 3K7AJ 1APLC 2LF7A 1B9MA 3LFKA 2BOLA 1ENHA 4A3FJ 1Z05A 2GQQA 2JPCA 4HSRA 1F36A 3N97A 1W4MA 2V1DA 2XROA 3J7AY 2VIXA 4E7SA 4J19A 4A6DA 2HTSA 5M5YJ 3HKZA 3H3VK 4AYBN 2QENA 5M5WJ 4OIPF 2FRHA 2DBBA 2HYJA 5IPAA 1ETKA 4BE1A 1Z67A 2FOWA 4G7OF 4Y7NJ 3H92A 4N0BA 3HIFA 1IN5A 1JUMA 4ZH4F 1ZRDA 1X3WB 1N25A 2K3FA 2X51A 3L00A 4BHBA 2B7EA 4IRGA 3KEYA 4AIJA 3HRSA 4A2UA 2PX9A 3F6VA 2A68F 3OYMA 1ZG5A 4A3CJ 1V54H 2CRGA 1XSXA 3OS2A 1UELB 5J8CA 4EJUA 2X1EA 1YJWI 1WI9A 1W36C 5ICEA 5DDGA 3ABMH 1T56A 3V7RA 1QQIA 5E20A 2ZJPF 2EIKH 1GXQA 2E1MB 5CJ9A 1MBEA 2HR3A 5L3GA 2L02A 1H88C 2CWEA 3IL2A 4HX4A 2ZO4A 2R5YA 3JCUC 3ZMZA 4AVPA 4CICA 2R5YB 3K9TA 4OAZA 2W85A 2DA3A 1VQ4I 2MC4A 1D5YA 2IGKA 2DPDA 2M8GX 1JKQC 3KEOA 3V7CA 2CGPA 1MJ9A 1XTAA 2VN2A 2NS8A 2O61A 1P9QC 3FXKA 3K4LA 3LA3A 2E60A 4RGXA 4HX8A 3ZQ7A 2VE9A 1ONVA 2IPQX 1Z77A 4F55A 2O8XA 1MMSA 3T8TA 3CC7I 3RDIA 4PCQA 2FD5A 3WHCA 1FOXA 3KZIC 5EZGA 1I50J 2DOFA 2HOSA 2CW8A 4G6TB 3AG1H 4KITB 3D1NI 3U9GA 1ZGAA 3VYUB 5L3BA 3F8CA 3GLXA 3BG5A 1S7AA 5F08A 1E3HA 1OMIA 1D0ZA 1LDJA 4XRSA 3ZQHA 2F5DA 3VB2A 1HOMA 2W25A 1BI1A 3BWGA 5H6QA 4XOTA 2BHYA 2EJRA 1RZ4A 3D0SA 2WAEA 4BJTA 2YSRA 3LSMA 1O3TA 2NVYJ 3BPVA 1TT5B 2XAQA 3OYGA 4MQ9F 3VYRB 1ON1A 4FTHA 2E36A 4IQJA 5HS7A 2MC3A 1W7PD 3B73A 4A12A 1Y0UA 2R7DA 4JX4A 1DDNA 3BQYA 4EJWA 1HLVA 2K4BA 4XLAA 4DOZA 5KK1A 1VQ5I 4IX7A 4L9JA 1U0JA 1I27A 4OMZA 4M9XA 2CV1A 4ITVA 2R93J 4IQ4A 4WXHA 3G6EI 1ZG3A 4W1UA 2DOEA 5J4VA 2VI6A 1BR1A 1FBQA 2IGNA 2LY1A 2KL4A 1VFCA 2FU4A 2F4OB 1IRXA 1QVUA 2E2HJ 3K2ZA 4EM2A 1BW5A 1QO0D 2UWMA 5H6RA 4PDKA 3OL4A 1X1PA 4XLNF 1IUFA 1F9NA 2KDOA 1WHUA 5LHGA 2VC1A 4XKCA 4U0YA 2ACJA 2LSOA 2Q2EA 4MO7A 4IOCF 1ZG1A 2R7WA 2ZNYA 2BVLA 5GAHJ 5FLMJ 3S2DJ 1JI8A 1ETXA 1G3TA 4E70A 2QSHX 2A6EF 1KA8A 1E3PA 1R00A 1WI3A 1H9GA 4ABZA 4XICA 3EDPA 2D2WA 5B1AH 3CO6C 2HQ5A 1IZ1A 2W82A 3UNGC 1Y8RB 3PQJA 4PFPA 1R1UA 1ZH5A 4M71A 3CLQA 4AC0A 1WJBA 4BH9A 2DFHA 3WHBA 4HDUA 1J2XA 5GADJ 1IRGA 5ICGA 5F1JA 2ZJ2A 3C7JA 4RGSA 2EIMH 2HU9A 4LLGF 2R7TA 3CJRB 5FLVA 3MN2A 3KP4A 4D7NA 1T0FC 1VTNC 4QSHA 3L2UA 3FXUA 2KIQA 1VQ7I 2BXYA 1MJBA 4R8HA 5E3MA 2JVHA 2XGEA 1JTXA 2MLKA 3OYDA 4ZYHA 5JHFA 1S5LC 1MKMA 4LK0F 2M9HA 1MD0A 2EINH 2FBKA 2KZVA 3HPHA 1JKOC 1VQ6I 3RI4A 3HBLA 2DOAA 1J75A 2HDDA 4KT6A 2EA4A 2DI3A 2HXOA 2YU3A 2YPRA 2KFDA 5E3NA 1RIOH 1U9OA 2DFEA 2A07F 4LG3A 2EIJH 5TISC 2L7ZA 1T0FA 2X6OA 2TCTA 4Q47A 1HW5A 4ESFA 3WTSC 4HRIA 2QEXI 4BJ5C 4A5NA 4EEFG 5HLHA 4FCYA 1HSJA 3TO9A 2E1OA 2DJNA 1AA7A 1LNWA 5GAEJ 3O6BB 4Q5SF 4PJLA 2XPVA 2P7VB 3MD2A 4JQFA 4XKVA 2PI0A 4U7DA 2EV0A 3K1NA 3CCSI 4F91B 4PJ0C 2NNNA 2X4HA 3CJQB 1J09A 2ESNA 3EUHC 3KZZA 3ZQLA 2DAOA 2ID3A 5JHUA 1TTYA 2IP2A 3ESWB 3QYBA 3ZMUA 2VJ4A 1Q1VA 1PJRA 3DTKA 4E7ZA 4AIKA 4P1WA 5F0FA 4FE7A 1KQ8A 3S1NJ 3SXYA 4F3QA 2OQGA 1ZR2A 1PP7U 1W1WE 1U6GA 4Z6YA 1MGTA 3AG2H 4D7MA 2NNYA 3BG3A 4A6EA 3COAC 1TWFJ 2GXGA 2W24A 3FXJA 1P92A 3JSOA 3S15J 3PUFA 2K9NA 3BR0A 5CQGA 3FDYA 1U78A 4KIFA 4RM2A 4B4CA 4GCVA 4F92B 1TNTA 3AFHA 1E17A 3PUBA 2CQ7A 1PP8F 2K7LA 5FKLA 2NOGA 2Z2SB 5EEGA 1G6NA 3Q0VA 1WJAA 2R7SA 3CF2A 2OPTA 3WG9A 1YITI 5HVQC 4C9YA 2DTZA 2ZBKA 4IF4A 2Y30A 2OCEA 1BI2A 2FOKA 1XB4A 3UKGA 4HDVA 1LJ9A 3MZYA 4HPQA 4BU2A 4O3MA 3E6CC 3V8KA 2MBFA 1IJWC 3CC2I 1SFKA 2HQNA 4U0WA 2FA5A 1IF1A 2RREA 1WQ2A 1LFUP 3J80Z 3HOWJ 5D8LB 2HPMA 2BY0A 2KP6A 3WTYC 3K69A 1WSUA 1LPQA 2JPBA 2L54A 3SDBA 1R6RA 2VBXA 5GTHC 1ON2A 4BQNA 3CCMI 3BDDA 1YG2A 1ETWA 4M9SA 1TQPA 1A5JA 2DW4A 4H4KC 4CCNA 1WJEA 3M7GA 3WTTC 1UZCA 2V9PA 2L9RA 3U1DA 3GMEA 1XMAA 2XGDA 2F5VA 4ESJA 3KCCA 4BL0B 3J80K 1JKRC 1YJNI 3K70D 3Q3SA 1YFHA 2LFBA 5DD4A 4MLOA 3JRDA 1S9HA 3I9V2 2M4KA 3M8EA 4EM1A 3ECHA 4QIWN 2RDPA 1MBFA 4OINF 2HNHA 1ZGWA 4A3GJ 1JHHA 1RETA 1FWZA 4Y13A 4GGGA 1AWCA 4E4HA 1R5GA 1SMYF 4IRHA 5KAIC 3H5NA 4FT8A 4XK4A 4AUXA 2KIFA 1B4AA 2EFNA 4H0EA 3HYIA 4XRSG 2TDXA 3ELKA 2DA2A 3GUDA 3REOA 2EZLA 2DA7A 2RN7A 2BY2A 3O8GA 3V42A 1R58A 2Y69H 1SVMA 3GTGJ 1RPWA 5FKNA 2R7VA 2LG4A 5FFXA 3CCQI 2MFZA 3LA2A 1AU7A 4BXFA 4RAFA 5IP6A 1WJFA 3E0JB 3IAS2 1S8NA 1YRNB 2EQRA 5IP9J 3W6VA 2EFPA 1LVAA 3F23A 1VNDA 4GO1A 3SJMA 4OIRF 1YHQI 1S72I 4BHPA 4M6VA 5CYVA 3SZPA 4ZTFA 4RS8A 1OCZH 5B3SH 4BYYA 2L7FP 1BM9A 3TW7A 4XLPF 3MFKA 3L2QA 2CG4A 3KEQA 1XCBA 2JUGA 1L3LA 4YG2F 3AG3H 2HDWA 1G2HA 2JA2A 3Q9SA 1DU0A 4LB5A 3BQZA 2R3SA 1PVEA 3FKJA 2VPLA 3TO7A 2GAUA 3A1YA 1BR4A 3TDUC 3S17J 3GZ5A 2GM4A 1R22A 4EGZA 2H94A 5FRNA 2W48A 1UCRA 4BHCA 1QHGA 1MNEA 3H9QA 3VEPA 3ZPLA 1T39A 1IXCA 4PJNA 2AHQA 4S04A 1I1SA 4NBQA 4PGGA 2XPUA 4FX0A 1TLHB 2BV6A 3DFGA 1R9TJ 5HLIA 2STTA 2M7AA 3GZNB 3ERMA 4LGWA 3F6OA 4DW6A 4BQQA 4ZDPA 3KLNA 2O9LA 4XL9A 4UNOA 1G3SA 3CMYA 4FISA 3BROA 2FNPA 4EQQA 1P4AA 3J7ZI 1XSDA 3DF8A 1P7IA 2HVQA 4V2GA 4UY8I 2VOPA 4YIIA 2XPWA 4CYDA 4CO8A 4QTRA 1R4MB 1QGPA 5E1WA 2XRLA 2F6CA 2UXXA 4LLNA 1HKSA 1ULYA 2M3AA 4LMYA 2M4GA 2P4WA 4A0YA 2QKMB 3MZ8A 2M0MA 2QSGX 3WU2C 4RAGA 3KP5A 5L3FA 1GHCA 1A6IA 1KU2A 3A02A 2IS4A 1QU3A 2KIMA 3MKWB 1LQ1A 3LL7A 2V1XA 3FHNA 5KAFC 2V4JC 3VODA 4ZZLA 5HODA 2RGVA 1AHDP 3JRHA 1ZN2A 1MMGA 3CUOA 1VQ8I 4XLFA 3GTPJ 2R7FA 3G1LA 1MZBA 3JRGA 5JR3A 2I5UA 1RUNA 5DCFA 1TWGJ 1FZPB 1NG6A 4HNUA 4I02A 3CMEI 4Y52J 2H6BA 2HKOA 3DU6A 2MD0A 2OJED 3GTOJ 3BZCA 4ZJZA 4BE2A 4B3AA 4BUPA 5EEHA 1IXRC 3MVPA 2VQGA 2HVSA 3ZQCA 2NVQJ 4EGYA 3BP8A 3QOEA 4HEA2 4BJ6C 1LEBA 1U5TA 3G71I 2HZDA 2VONA 4O6JA 4HLYA 1W36D 5FFZA 4I09A 2P7CB 2XSDC 1Z7LA 1HXDA 5LGNA 3A01B 1S7OA 5BMZA 3CMMA 1FSEA 4X0GA 4RB3C 4NC8A 4HG2A 3B6AA 4Q48A 3CZ6A 3F72A 2XB5A 4EMSA 3GCMA 3ZQGA 2FSWA 3E5UA 1ZAOA 4XQFA 4RB2C 2DA4A 3F3XA 2WBMA 1A36A 2VXDA 5BOXA 1OCCH 2VB6A 2L5QA 3PM1A 1IV6A 3RYRA 3KP2A 2OU2A 1IN4A 2ICWG 2DK5A 3B02A 3GVAA 4BXXJ 3AG4H 3WODF 2LNBA 4L9VA 4P5OA 5DEQA 3PO2J 1E2XA 3EQLF 3OYCA 2XAJA 4XMYA 3LQRA 2QQAA 1TBXA 3I4PA 1J0RA 4CCMA 5D5UB 2D45A 1KQ0A 2QZ8A 2EH3A 4B8XA 3JAMK 1FOWA 2LK2A 2L7KA 3H0DA 2OC6A 3ERED 1MMDA 2KRHA 3BTIA 3OYNA 1TT0A 2E1CA 1ZKGA 5DS9A 4CYCA 1HC8A 1SEUA 4I0BA 4DQ2A 4ZYDA 4CYCB 3BR6A 2FNAA 1USTA 2X1CA 1YOVB 5J6XA 4B43A 1IDYA 2JA7J 1Z1DA 3H35A 3HTUA 1XX5A 4KIGA 4FX4A 4UVBA 4Y33A 2WAQA 1F5TA 2V9KA 2NVUB 4IXAA 4I99C 3E7LA 3GX4X 4EJTA 1ZYRF 1IO2A 2FMYA 1U9NA 4P55A 1XPXA 4C3HJ 2ADUA 2P5LC 3MZHA 3WE2A 1IAWA 1FLIA 2E5NA 1HW2A 3IKTA 2PJRA 3OYFA 2DMPA 4GYGA 4F7ZA 2PJRB 1UJ8A 4UXNA 2L0KA 3I4NJ 3SFIA 1NHAA 1WJDA 2Z3YA 2ZFUA 3D5RC 2JRTA 2KISA 3CTAA 1RR7A 2B0LA 2GOXB 3RIRA 3OSGA 3FM5A 2DA5A 4UUTA 1OKRA 4MIMA 1U3EM 3TP0A 1WRJA 3HGGA 2QGUA 4XRMA 3VYSB 1NG7A 3AL0C 4OWRB 3FBIB 3CESA 3NWTA 2H09A 2NS7A 2F4MB 1POGA 2LTPA 4IVNA 4M72A 5BPDA 3F9KA 5HLGA 2FQ4A 1OISA 2O7OA 3SDGA 5CVVA 4BNCA 4CCKA 5FB2A 1BR2A 2M5WA 5D6FA 1BBYA 3QU6A 5CKTA 4B48A 3GTQJ 1LB2A 4AU7A 2AXTC 4NDLA 1FYLA 2WAQN 3GFLA 3D5LA 3HB9A 5DTDA 2EFOA 3A03A 2EBIA 3BC8A 4RLQA 2ZXWH 1BOBA 1Z91A 2FX0A 4G9YA 3E6BA 4PJJA 5D6EA 2X85A 3CCLI 2DT7B 5E8IA 5IOZA 3S16J 3A0HC 2CU7A 5LEJA 2P8TA 2Y9ZA 4E7IA 3AL0B 1FY7A 2XAHA 2JVGA 1YS7A 2KKOA 2JT1A 3RKWA 1G59A 2ISYA 5EF6A 1HF0A 2W4SA 3FXMA 3OS1A 3JRAA 3HPGA 2XASA 4G6QA 2RVCA 3S93A 1IW7F 1XDSA 2WY7Q 2VQCA 4NQWA 2QQBA 3IH3A 3MEXA 4WXCA 5J47A 4NQWB 1K78A 1SVLA 2Y48A 3KETA 4ZDOA 2LYCA 1K78B 1VQNI 1X3ZB 3DP7A 3R6SA 1WH5A 2FMLA 1RKTA 1WVRA 4KN7X 1VZ0A 5J40A 1R5ID 2JUCA 1X1DA 1ETVA 4Z2YA 4BAYA 1BW6A 3NARA 2Y31A 5AIQA 2VKVA 2CQXA 1O4XA 2ETHA 3CP2A 3VDXA 3FMQA 4FQGA 4OU0A 1UMQA 1E0EA 2GA2A 4G94A 4V19K 2HS5A 3S8PA 4A3DJ 5J8FA 1GLNA 3BOQA 3RJPA 2WB1A 3N05A 3HOXJ 1LKXA 3ZQIA 4IHXA 3HEFA 4OAYA 1DU6A 3QAHA 3ZCOA 3BCBA 2L7MP 1QZZA 3A0BC 1VQMI 3HL2A 5C44J 4IPAA 2BZTA 3LSGA 2ELHA 4LK1F 2HOTA 2HZTA 5LGUA 2PEXA 1S7EA 1FYKA 5ILUA 3EPZA 1G3WA 5E3LA 2FBIA 4EATA 4EV0A 2G9WA 2JA6J 2JZYA 4RA2A 3NAUA 2LBFB 4U0VA 1R7JA 4UB8C 1EJ9A 2K40A 2PN6A 1SD5A 2LKXA 4UB6C 3EETA 3ZOBA 4O5VA 2E19A 2YU9J 4WXDA 4A3IJ 1T2KA 1XN7A 2IXSA 3TEDA 5GTIC 3HSFA 1FSHA 2DJIA 2V1NA 5TGTA 1IRFA 1FBUA 4IEJA 5H20A 4LG0A 4BDYA 4L5EA 3GW2A 5KVRA 1WZ2A 4E7LA 2O0YA 4LG0B 5DUKA 2CUJA 2NRAC 3HSEA 4KIBA 3A2KA 2COMA 1X3UA 2WB1N 2JSCA 3GEZA 1PDNC 1V55H 3IV5A 5LRSA 4WF2A 1CF7A 1QPMA 2F5EA 2E1NA 3FK6A 4IZZA 1CF7B 1JXSA 1OQYA 2JRMA 1D0YA 2GBYA 2EPFA 3LNQA 2ZNZA 2X1DA 3CP8A 3TBIA 4B3XA 3GFMA 3QRFF 3L2CA 2F5FA 2LC2A 2L4MA 1EKEA 4HAMA 5LLQA 3KPHA 5HDKA 2Z9OA 2JSPA 2EFQA 3DKYA 3MMYB 4OIOF 4PZJA 5DM7F 5HS9A 3VWBA 3BZ6A 5CVUA 3X2QH 4TV7A 4XR6A 4CZZA 1QPIA 2K9LA 2DCEA 4UVCA 3WTWC 4AM3A 3F21A 3MKLA 2JMWA 3B6CA 2Y2ZA 1TZLA 1X58A 1D0XA 3CDIA 2QWWA 2TRTA 3I64A 4PK4A 3WGGA 3F8NA 3DXJF 1ZGJA 1ZK8A 4UVAA 2QF7A 9ANTA 1SFUA 3LOCA 1T8IA 4AIHA 1I6XA 5JLXA 3G4SI 5E79C 3BLYA 3IWFA 1FTTA 5DYMA 2JA8J 2JQ7A 2L2OA 3OL3A 2LKSA 3K4BA 2CYYA 2K4JA 3GXOA 2M2EA 1DQUA 4DYCA 4XONA 1YW7A 3OY9A 3LFUA 3L7WA 3ZGKA 4EJOA 5ICFA 2NAZA 4L0ZB 3TMOA 1RESA 4DGWB 1JGGA 1L0OC 3KYDB 3RZOJ 3D5SC 1S3JA 1YS6A 3L1PA 1R36A 2E7XA 3LA7A 3W6KB 2K9SA 4M74A 3KP6A 4GXOA 4AVZA 4ZYAA 2OAZA 3IUOA 2KJCA 5ILVA 2BYVE 3U21A 1D5VA 1OJLA 2DU9A 3SZGA 3K1PA 1XCVA 5GP9A 2EZKA 5HNHA 3W3CA 2QM3A 5CVIA 1MSFC 1ZQ3P 3IP4B 3I3LA 4U7BA 2LKPA 2LREA 2UUZA 4UV8A 1XDUA 3BG6A 4ON0A 2UV1A 1QZEA 4LB6B 4A0XA 1RR8C 1X4PA 2HVRA 3DQVC 1W7PB 3ROUA 1BJZA 3EUHA 4DBQA 1D3YA 3CCVI 1VQLI 5TRDA 2A5YB 1XS9A 2Z33A 4MGRA 3O3KA 3WU0A 4G7ZF 4DZJA 3CCUI 1H89C 1JJ6C 4XN0A 4EJVA 1DPUA 1YE9A 1OYIA 3CO7C 2RNGA 1UG2A 1TWCJ 2WTEA 4I7HA 2IGOA 3VYTB 5HS8A 3QOPA 1AOYA 3I0TA 2QSFX 2VKEA 5J1UA 5L3DA 5GPCA 3FWEA 3H9GA 3DPLC 2M87A 5BNGA 2YUSA 2ZMEC 2K9QA 2KRCA 5F27A 4D0PA 3S3MA 1YJ9I 2EA2A 3SZTA 2GLOA 4A3LJ 2P6TA 3K4MA 4BEHA 3CMAI 1Z9CA 4A3EJ 2R0QC 1TNSA 4BEHB 2HYFA 1H0MA 2KHMA 4ZZDA 3GTJJ 2BGCA 3HRTA 2K5CA 2KPMA 2QQ9A 2VXZA 4J01A 1NK2P 4ANJA 1FMVA 1FX7A 5E3OA 1DPRA 1MDMA 1C0WA 1T08B 3I59A 1K61A 1I3AA 2OD5A 1TW3A 1MDMB 3T8RA 2BEOA 3I59B 1P4XA 3WTXC 4ENNA 1R71A 3DU5A 4CXFA 2UXNA 1J9IA 1K6OA 4L0YB 3CDHA 3TOAA 2DXIA 2ZMEA 2BY3A 1MBKA 1FJLA 5IT3A 1MBJA 2HPIA 2ZMEB 2OF7A 1JE8A 5GAGJ 3CUQC 3OIOA 4LIUA 2CW0F 3IHUA 3HDDA 2Z5UA 5EJCA 1OYYA 1EV7A 2J5PA 1FIPA 3SFZA 4A3JJ 4LITA 1YIOA 3E97A 3H5AA 4RB0A 5D4SA 1VQOI 4YFKF 1IN6A 1ZLJA 2IA2A 2WAFA 1Y39A 3NQOA 5B1BH 2AQFA 4JYKA 3ZRGA 4WCGA 3CD6I 4RAYA 2A5WA 1HCRA 4HA8A 2WV1A 1B6AA 4WWCA 2MSYA 3QODA 3S3NA 1RKWA 4DIQA 1U2WA 3F22A 3G2BA 3BZKA 2ESHA 3CJTB 2XF6A 4CDGA 1D1AA 2K9MA 2M0CA 4BY7J 2FXAA 3BR5A 3CUQA 2ZXHA 3CLOA 3CUQB 2CUEA 5E18F 3G1MA 5ED4A 2D1HA 4C2MJ 3JTGA 2QQ8A 2G7HA 2K02A 2OBPA 1YRNA 4NC6A 1KQ9A 3J7YJ 4CCLA 3BY6A 2P6SA 1YQAA 1SANA 2NXNB 2W84A 3L2WA 3PFIA 1VQ9I 1B59A 5IP7J 4GDFA 4D1QA 3ML6A 1XD7A 3RYPA 5D5WB 2L3DA 1G3YA 2XAGA 1BC7C 1MSEC 4JOMA 1SAUA 2DO7A 1YTYA 3LSKA 5J1RA 3TQNA 2PG4A 4FETA 3S32A 3DTEA 1Z7UA 2Z1DA 1DGRM 2MG4A 4U87A 3VOEA 1IDZA 1N75A 3UR3C 4QPOA 5LHHA 2K27A 3GFJA 1FPQA 4M3DA 2CS3A 2DT6A 2HKXA 2LMDA 2NS0A 3RQ4A 3E6DA 3CC4I 3HOZJ 1K4TA 1B8IB 4A3MJ 2Y9YA 4JBAA 2GOMA 2ZC2A 4R79A 5F0HA 2DQRA 1YW8A 3OR1C 2W57A 2VT3A 1D1BA 1D8JA 3JR9A 1MNMC 3P7NA 3NRVA 1OCRH 2CUFA 2P0WA 5K5QA 3W2AA 4L5IA 1JHFA 3K2AA 1YLFA 3ABLH 1UHWA 1ZRCA 2W7NA 3QP5A 4MFEA 1MW7A 4XN3A 5HDNA 2IVMA 4ASNA 3I5UA 4XNFA 3OYLA 4OOIA 2EK5A 4G8XA 4RGRA 3BR2A 1A31A 1WWXA 3LAPA 1WJCA 5ICCA 2DODA 2JN6A 2H8WA 2L9NA 3BG9A 2DK8A 3TL4X 2HFHA 2OA4A 2WA0A 3QYEA 2KDZA 1LEAA 4BQOA 3MQ0A 3IAM2 2XC7A 1PUFA 3RKYA 2GIZA 3ZP5A 3BTCA 4C3IJ 4EM0B 4XBFA 2HXIA 2ECCA 1PUFB 3OWTA 3LSIA 4G12A 2O6GE 2RQPA 3C2BA 3FK7A 1P2FA 2E34A 1MH3A 3M8JA 3FM3A 1MH4A 3DLAA 3RPQA 5JVGF 3MCZA 2V26A 4XLHA 3KIOA 2M1BA 1O7FA 3OYAA 2N8GA 2VBWA 2J5OA 3DBLB 2I10A 3A4CA 1HA8A 3DV8A 2O5RA 4HF2A 1LFBA 1E3OC 4KUMA 3CJNA 3I54A 2JJ7A 3GF2A 4C30A 3U1KA 2E5ZA 1U8BA 5EEAA 4BKXA 1Z0XA 4N9IA 1EA3A 3KE2A 4DYQA 3FBNB 1WFXA 1D1CA 2D1VA 1I1GA 5FROA 3W2VA 1USSA 1G8XA 1XMKA 4ENMA 2ISZA 3MKYB 2RV8A 2EV5A 3IH4A 4I6ZA 3TOBA 1QHHD 2DPUA 2WWYA 2VBYA 1FEXA 1FNNA 3S14J 1X1BA 2V7FA 4MTEA 4S0HB 3CCRI 3LAJA 1XGSA 4A93J 3IRRA 5FO5A 3A01A 1VQKI 2CH0A 2EFWA 5DD8A 1I5ZA 3HG9A 4II2A 3PIPF 4IO9F 5TJJA 4IKFA 1X1AA 2HWVA 4I01A 4E7HA 1VQPI 2RNJA 4IL6C 2CMPA 4ENKA 3QYFA 2AO9A 4QPQA 2Q8KA 2X9DA 1UB9A 3RKXA 3JAMZ 2IBDA 1N78A 5BPIA 1X2NA 4BGDA 2LY2A 4HV6A 2CW7A 1IUYA 1XSVA 3P5JA 3JSPA 4BE0A 4PFOA 1SC7A 1F4KA 5F1RA 1X19A 4F52A 4BBSJ 3DEWA 1NK3P 5LFAA 1AKHA 3RCOA 2QUFA 2AQEA 4C2UA 5JLWA 4CGZA 2VODA 2VPRA 1AKHB 4QWQA 2R4GA 5B66C 4MEYF 3BTJA 5EDNA 2NVXJ 4HNVA 2CUZA 3DBRB 5FJ8J 2K86A 2LH9A 1SFOJ 3CCEI 3GLLA 3V4GA 2KIUA 2E7WA 3MWMA 3P9IA 1YI2I 2O03A 3RSNA 1OCPA 2BBYA 3LWFA 2I8DA 1Z3YA 3VPRA 4M6YA 3R0AA 2HOAA 3ZN1A 3FF5A 2Q1ZB 4GRIA 2ZJQF 2KLOA 3HHHA 3JRCA 3U2RA 3FXLA 3GTLJ 1JUPA 5D5VB 4OIQF 1HKTA 2PQ8A 1FP2A 1SD7A 4A5MA 1UHSA 4HW0A 4A3BJ 2VJ5A 1ZLKA 1ETYA 2QA4I 3EUAA 3L2RA 2EB7A 4HLXA 3QP6A 1EH7A 2DQLA 2MD5A 2X0LA 1Z21A 4UV9A 1SFEA 2DA6A 1ACIA 1BJAA 5EG0A 3KLOA 1GUUA 4KNYA 5EG0B 4B1RA 4HQMA 3BPXA 4XRFA 2VT2A 3HOTA 1SFXA 1W5TA 2E1MC 2K3PA 3P9KA 2OCCH 3QPHA 4XSXF 2FQ3A 1F1ZA 1ODDA 3C2GA 1HW1A 1LDKB 1OR7C 3DPTA 3H3UA 1SAXA 3ONQA 3KYCB 4M3EA 2MA3A 3SHFA 3Q9VA 4PUSA 3HOVJ 3DWLE 4WK8F 1IC8A 1XMXA 2XKPA 2DMTA 4RBOA 4M9ZA 2L9SA 1T95A 4PJMA 1X2MA 2DDBA 2DMQA 1ZREA 3PSFA 4LJZF 3GTKJ 1K6YA 5B5EC 1I3QJ 2E71A 2XVCA 1OCOH 1V3FA 3IRQA 3DLLF 2XIGA 2P5VA 1GV2A 5E1XA 3ABUA 2CFOA 4HNTA 4JX5A 2PMZN 3HRUA 1RUOA 4K2EA 1HKQA 5IT9Z 1OFCX 2OQRA 4MFDA 3WTZA 3QU3A 3NEUA 5EGOA 3K4JA 4KT5C 3ZN0A 5EGOB 4LOCA 3SQNA 1FIAA 1QVTA 1OR7A 1WCMJ 2HI3A 2P81A 2MLGA 2QKLB 5J1YA 1QBJA 2H27A 4X6AJ 1VF9A 1UFMA 2CFXA 2VC0A 2VBZA 3LMMA 1J7KA 1R4NB 4MTDA 3FMRA 4UHTA 2GIVA 3GTMJ 4NHJA 4IHSA 4D5CA 5IT9K 4RGUA 1KU7A 2HOEA 5FGMA 2ZCWA 2IS2A 4HOBA 3HKZN 4LFUA 4C3JJ 3T1BA 4LD5A 2PLYA 4QLCU 1XGNA 3C2HA 3R61A 4M6XA 1R5HA 1G4DA 4EVIA 2Q0OA 3E1SA 2GXAA 1R49A 3CQZJ 4UUSA 2F5CA 2FE3A 5JI6A 1J59A 1PUEE 5GPAA 1FP1D 4UUSB 2QLZA 1IV8A 1REPC 3IWZA 1GDTA 3E3VA 4N4NB 1FTZA 3C18A 2X48A 2Y75A 1IN8A 2EILH 2D5VA 4ZC3A 1OLTA 2FUG2 4GFBA 3PNVA 3V8LA 3M07A 4D5FA 4P9UA 5C3EJ 3T5XA 3S2HJ 2BHZA 2VJJA 3DEEA 5HDGA 3M8FA 2MYSA 1ZELA 1ZRFA 3ZR8X 2R7ZJ 1YX3A 2G0EA 3DKXA 3ZQQA
chains in the Genus database with same CATH topology
2XGXA 1B1BA 4YFXF 1UHMA 3GO5A 1RNLA 2IRFG 3ECOA 3OV8A 3WTVC 1BN5A 1DUXC 4HZFA 3ISPA 5K5OA 3W6JB 4M73A 3R60A 5K1YA 2P5KA 2XAFA 3ZMVA 2G7UA 2Z99A 5ILSA 1K7AA 5LGTA 3S2WA 1BI0A 2WV0A 4P9FA 5DUIA 3I58A 2V9VA 3G73A 3BJOA 4IHTA 4FHTA 1O7LA 2YX4A 2CO5A 3HHGA 3J7AO 3T0YA 4MHGA 2L4AA 3TKYA 3TGNA 3TO6A 2O3FA 5JVTA 5LRRA 3L9FA 3V7SA 2FBHA 4HX7A 4I2OA 2V79A 4YFNF 3JTHA 1T38A 2DFIA 4JK1X 1KYZA 2PMUA 1O3RA 1QZYA 3LQQA 5AIPA 3ZMSA 1CGPA 3E6MA 2YX7A 1R1VA 2Y0MA 2PBIA 3FX3A 3N4MA 3ZMTA 3M1EA 5CVRA 1YW9A 4PGHA 1K79A 4IJAA 3M9AA 2A3SA 1T6SA 3RTRA 1XGOA 1TQIA 3MAJA 5K5RA 5HOOA 3HOSA 3GYHX 4BXUA 3F8FA 4ENJA 1KU3A 5LEKA 2PFBA 4IRIA 1QNTA 3EYIA 1RI7A 2IJLA 4KN4X 1W7PA 4S05A 1OPCA 3K1MA 3KP3A 5AONA 5L3EA 3JW4A 2QYOA 5D8KB 1FT9A 1O3SA 4LLLA 1R1TA 2RKHA 3RPUA 1JGSA 2KJBA 3Q5FA 2JTVA 3KFWX 1S29A 1OYWA 2EWNA 3R0JA 3HTSB 3F8BA 4BQAA 4MQVA 4L9TA 4KMFA 1T98A 1SMTA 1YYVA 5CLSA 2IA0A 3PQKA 3WTUC 3KP7A 3GZ6A 5E1ZB 3HSRA 3I71A 1ZARA 2WC2A 3ABTA 1J5YA 3FZVA 5BQTA 1IXSB 1O3QA 2CQKA 1GVJA 1HQCA 2LF8A 4GYIA 4NB5A 4L5JA 4HQEA 4AD9A 2QVOA 2A61A 1TQMA 5ERIA 4HYEA 1H9TA 2IW5A 1A04A 2IT0A 5LHIA 2DLLA 4DNCA 3IC7A 2ZFWA 1WKMA 5E17F 5D4RA 3C3WA 2HEOA 4I98B 2BE5F 5LBQA 4R1HA 1O57A 2HQRA 2XKOA 2DT5A 3BJAA 2FF4A 3LSTA 2QBYA 2QBYB 3OOPA 3WGHA 3K0LA 2M45A 6PAXA 1BIBA 1LDDA 2HDCA 3L09A 4B09A 5FD5A 3FHZA 1P6RA 1EH6A 2RC4A 1FBSA 3DEUA 4MEXF 5DV5A 2PMHA 4Y15A 2GWRA 1XGMA 2GA1A 3QPTA 1W5SA 5A2QZ 2HTJA 3H3ZA 5FD6A 1GXPA 1KU9A 3TDZC 3EYYA 2YR2A 1S6LA 2F2EA 3HRMA 3FXRA 1YO5C 2VE8A 1MJAA 4CHUA 4UUVA 4KFCA 3G3ZA 5CVJA 5A2QK 1V4RA 3WE3A 2VOOA 1KYWA 3KZYA 2XHKA 3FXQA 4KICA 3GFIA 2XV4S 2GXBA 4KMUX 1BOAA 4KDPA 1BC8C 3J81Z 4HV5A 2L01A 4ESBA 4XSZF 1BI3A 5E8GA 2HGCA 1STZA 3BJ6A 5F6FA 4G6DA 4A0ZA 1KGSA 4Y17A 2AXLA 4Q4ZF 1HSTA 3FMSA 1HBXG 3WU1B 4L18B 3J81K 5F64A 5FLXZ 4L9NA 1P4WA 4U88A 1FYMA 1FOKA 2EV6A 2LDUA 5JFRA 4HF0A 1TW2A 2STWA 3I53A 2HYGD 1ZHFA 1U5TC 1R23A 1SD6A 5FLXK 3AAFA 3P9CA 2XUBA 1U8RA 2M30A 2OZ6A 1DP7P 2UZKA 5BS6A 2OZUA 1Z6RA 2XRNA 2M8EA 3VFZA 3ZMDA 4HF1A 5DCMA 2ZXJA 1SD4A 5DCMB 4RAZA 4WX9A 4KA4A 3HUGA 2FEZA 2H6CA 4AWXB 1U5TB 4RB1A 1FC3A 2ZKZA 2A69F 2A6HF 3R4KA 2V1UA 4OMYA 4ZYGA 2GZWA 2V6CA 2MH2A 3E5QA 1BIAA 3IKVA 2NYXA 4G7HF 4KYWA 3ULQB 4N9HA 2DTRA 4ETSA 3GWZA 3E5XA 3F8MA 4MNUA 5L3CA 3C1DA 4P96A 1IN7A 3WGIA 2AS5F 2PJPA 2KRFA 3DKWA 2C6YA 1B9NA 4I0AA 4ZYEA 2IA1A 3O2PE 1D8KA 2MH9A 3V8JA 1EH8A 2CSOA 1Q1HA 5D5XB 4HBLA 4YIFA 1Z6TA 2LF7A 1B9MA 3LFKA 1Z05A 2GQQA 2JPCA 3N97A 1W4MA 2V1DA 2XROA 4A6DA 2HTSA 2QENA 4OIPF 2FRHA 2DBBA 4G7OF 3H92A 4N0BA 3HIFA 1IN5A 4ZH4F 1ZRDA 3L00A 4BHBA 4IRGA 4AIJA 3HRSA 4A2UA 3F6VA 2A68F 1ZG5A 1XSXA 5J8CA 4EJUA 1WI9A 5ICEA 5DDGA 3V7RA 1QQIA 5E20A 1GXQA 5CJ9A 2HR3A 5L3GA 2L02A 2CWEA 3IL2A 4HX4A 2ZO4A 3ZMZA 4AVPA 4CICA 3K9TA 2W85A 2DPDA 3KEOA 3V7CA 2CGPA 1MJ9A 2VN2A 2O61A 3LA3A 4RGXA 4HX8A 3ZQ7A 2VE9A 1ONVA 2IPQX 2O8XA 3T8TA 3RDIA 4PCQA 3U9GA 1ZGAA 5L3BA 3F8CA 3GLXA 1S7AA 1OMIA 1LDJA 2F5DA 3VB2A 2W25A 1BI1A 3BWGA 5H6QA 2EJRA 1RZ4A 3D0SA 2YSRA 1O3TA 3BPVA 2XAQA 4MQ9F 1ON1A 5HS7A 2MC3A 1W7PD 3B73A 4A12A 1Y0UA 2R7DA 1DDNA 4EJWA 2K4BA 5KK1A 4L9JA 4OMZA 1I27A 4M9XA 4WXHA 1ZG3A 1FBQA 2FU4A 3K2ZA 4EM2A 1QO0D 2UWMA 5H6RA 4PDKA 4XLNF 1F9NA 5LHGA 2VC1A 2ACJA 4U0YA 2LSOA 2Q2EA 1ZG1A 2ZNYA 1G3TA 4E70A 2A6EF 1KA8A 1R00A 1H9GA 3EDPA 2D2WA 3CO6C 1IZ1A 3PQJA 1ZH5A 1R1UA 4M71A 4BH9A 4HDUA 1J2XA 1IRGA 5ICGA 2ZJ2A 3C7JA 4RGSA 4LLGF 3KP4A 1VTNC 3FXUA 1MJBA 4R8HA 2MLKA 4ZYHA 1MKMA 4LK0F 1MD0A 2FBKA 3RI4A 1J75A 2EA4A 2DI3A 2YU3A 2YPRA 1RIOH 2A07F 1T0FA 4Q47A 1HW5A 4ESFA 3WTSC 4A5NA 5HLHA 1HSJA 3TO9A 1LNWA 3O6BB 4Q5SF 2P7VB 4JQFA 2PI0A 4U7DA 2EV0A 3K1NA 2NNNA 2X4HA 2ESNA 3KZZA 2DAOA 5JHUA 1TTYA 2IP2A 3ZMUA 4AIKA 1KQ8A 3SXYA 2OQGA 1PP7U 1U6GA 1MGTA 2NNYA 4A6EA 3COAC 2GXGA 2W24A 1P92A 3JSOA 1U78A 4KIFA 4GCVA 1TNTA 1E17A 1PP8F 2K7LA 5EEGA 1G6NA 3WG9A 5HVQC 2ZBKA 4IF4A 1BI2A 2FOKA 1XB4A 4HDVA 1LJ9A 3MZYA 4O3MA 3E6CC 3V8KA 2MBFA 2HQNA 4U0WA 2FA5A 1IF1A 1WQ2A 3J80Z 5D8LB 3WTYC 3K69A 1WSUA 2JPBA 2L54A 2VBXA 1ON2A 1YG2A 3BDDA 4M9SA 1TQPA 2DW4A 3M7GA 3WTTC 3U1DA 1XMAA 4ESJA 3KCCA 3J80K 1YFHA 5DD4A 3M8EA 4EM1A 3ECHA 2RDPA 4OINF 1JHHA 4Y13A 1FWZA 4GGGA 1AWCA 1R5GA 1SMYF 4IRHA 4FT8A 2KIFA 1B4AA 2EFNA 4H0EA 3HYIA 2TDXA 3ELKA 3GUDA 3REOA 2RN7A 1R58A 5FFXA 3LA2A 1S8NA 2EFPA 1LVAA 3F23A 4GO1A 4OIRF 4BHPA 5CYVA 3SZPA 4RS8A 4BYYA 1BM9A 4XLPF 3MFKA 2CG4A 3KEQA 1XCBA 1L3LA 4YG2F 3Q9SA 4LB5A 2R3SA 3TO7A 2GAUA 3TDUC 3GZ5A 1R22A 4EGZA 2H94A 1UCRA 4BHCA 3VEPA 3ZPLA 1T39A 1IXCA 1I1SA 4S04A 4PGGA 4FX0A 1TLHB 2BV6A 3DFGA 5HLIA 2STTA 4LGWA 3F6OA 3KLNA 4UNOA 1G3SA 3BROA 2FNPA 4EQQA 1P4AA 1XSDA 3DF8A 2VOPA 4YIIA 4CYDA 4CO8A 1QGPA 5E1WA 2UXXA 4LLNA 1HKSA 1ULYA 4LMYA 2P4WA 4A0YA 3KP5A 5L3FA 1GHCA 1KU2A 2KIMA 1LQ1A 2V1XA 3VODA 4ZZLA 2RGVA 1ZN2A 3CUOA 2R7FA 1MZBA 5JR3A 1RUNA 5DCFA 1FZPB 4I02A 2H6BA 2HKOA 5EEHA 1IXRC 4EGYA 3BP8A 1LEBA 1U5TA 2VONA 4O6JA 4HLYA 5FFZA 4I09A 2P7CB 1HXDA 5LGNA 1S7OA 5BMZA 1FSEA 4RB3C 4Q48A 3F72A 4EMSA 2FSWA 3E5UA 1ZAOA 4RB2C 3F3XA 5BOXA 3RYRA 3KP2A 2OU2A 1IN4A 3GVAA 2DK5A 3B02A 3WODF 2LNBA 4L9VA 4P5OA 5DEQA 1E2XA 3EQLF 2XAJA 3LQRA 2QQAA 1TBXA 3I4PA 1J0RA 5D5UB 2D45A 1KQ0A 2QZ8A 4B8XA 3JAMK 3ERED 2E1CA 4I0BA 4DQ2A 4ZYDA 2FNAA 1USTA 5J6XA 1Z1DA 3HTUA 4FX4A 4KIGA 4UVBA 1F5TA 4IXAA 3GX4X 4EJTA 1ZYRF 2FMYA 4P55A 2ADUA 2P5LC 3MZHA 3WE2A 1IAWA 1FLIA 1HW2A 3IKTA 4GYGA 4F7ZA 4UXNA 1NHAA 2Z3YA 2JRTA 3CTAA 2B0LA 3RIRA 3FM5A 1OKRA 1U3EM 1WRJA 2H09A 4IVNA 4M72A 5BPDA 5HLGA 5CVVA 4BNCA 5FB2A 2M5WA 5D6FA 1BBYA 3QU6A 1LB2A 1FYLA 3GFLA 3D5LA 2EFOA 1Z91A 4G9YA 3E6BA 5D6EA 5E8IA 5LEJA 2P8TA 1FY7A 2XAHA 1YS7A 2KKOA 2JT1A 3RKWA 2ISYA 2XASA 4G6QA 2RVCA 1IW7F 1XDSA 4NQWA 2QQBA 3MEXA 4WXCA 1K78A 2Y48A 3KETA 1K78B 3DP7A 3R6SA 2FMLA 4KN7X 4Z2YA 4BAYA 5AIQA 2ETHA 3FMQA 4OU0A 2GA2A 4G94A 2HS5A 5J8FA 3BOQA 3RJPA 3QAHA 1QZZA 4IPAA 2ELHA 4LK1F 2HZTA 5LGUA 2PEXA 1FYKA 5ILUA 1G3WA 2FBIA 4EV0A 2G9WA 2JZYA 4U0VA 1R7JA 2PN6A 1SD5A 3EETA 4O5VA 4WXDA 1T2KA 1XN7A 3HSFA 1FSHA 1IRFA 1FBUA 5H20A 4LG0A 3GW2A 5KVRA 2O0YA 4LG0B 5DUKA 2NRAC 3HSEA 4KIBA 2COMA 1X3UA 2JSCA 3GEZA 1PDNC 5LRSA 4WF2A 1CF7A 1QPMA 2F5EA 2E1NA 1CF7B 1JXSA 2ZNZA 3GFMA 3QRFF 3L2CA 2F5FA 2L4MA 4HAMA 5LLQA 5HDKA 2Z9OA 2EFQA 4OIOF 4PZJA 5HS9A 3BZ6A 5CVUA 4TV7A 4CZZA 4UVCA 3WTWC 3F21A 2QWWA 3I64A 3WGGA 3F8NA 3DXJF 1ZGJA 4UVAA 1SFUA 4AIHA 1I6XA 3IWFA 5DYMA 2CYYA 2K4JA 3GXOA 1YW7A 3L7WA 4EJOA 5ICFA 2NAZA 4L0ZB 1L0OC 1S3JA 1YS6A 1R36A 2E7XA 3LA7A 3W6KB 4M74A 3KP6A 4GXOA 2OAZA 2KJCA 5ILVA 2BYVE 1D5VA 2DU9A 3K1PA 1XCVA 2QM3A 5CVIA 4U7BA 2LKPA 4UV8A 1XDUA 4ON0A 4LB6B 4A0XA 3DQVC 1W7PB 3ROUA 3EUHA 1D3YA 5TRDA 2A5YB 2Z33A 4MGRA 3O3KA 3WU0A 4G7ZF 4EJVA 1DPUA 1OYIA 3CO7C 2WTEA 4I7HA 5HS8A 3QOPA 1AOYA 3I0TA 5L3DA 3FWEA 3DPLC 2M87A 4D0PA 2EA2A 3SZTA 2P6TA 1Z9CA 1TNSA 2HYFA 1H0MA 4ZZDA 2BGCA 3HRTA 2VXZA 2QQ9A 1FX7A 1DPRA 1MDMA 1C0WA 3I59A 2OD5A 1TW3A 1MDMB 3T8RA 2BEOA 3I59B 1P4XA 3WTXC 4ENNA 4CXFA 2UXNA 1J9IA 1K6OA 4L0YB 3CDHA 3TOAA 2ZMEA 5IT3A 2ZMEB 1JE8A 3CUQC 2CW0F 3IHUA 2Z5UA 1OYYA 1EV7A 2J5PA 3SFZA 1YIOA 3E97A 5D4SA 4RB0A 4YFKF 1IN6A 1ZLJA 2IA2A 3NQOA 4WCGA 4RAYA 4HA8A 1B6AA 4WWCA 1U2WA 3F22A 2ESHA 4CDGA 2FXAA 3CUQA 3CLOA 3CUQB 5E18F 5ED4A 2D1HA 3JTGA 2G7HA 2K02A 2OBPA 1KQ9A 3BY6A 2P6SA 1YQAA 2W84A 3PFIA 1B59A 3ML6A 1XD7A 3RYPA 5D5WB 2L3DA 1G3YA 2XAGA 1BC7C 2DO7A 1YTYA 3TQNA 2PG4A 1Z7UA 3VOEA 5LHHA 2K27A 3GFJA 1FPQA 2HKXA 2NS0A 3E6DA 4JBAA 4R79A 2DQRA 1YW8A 2W57A 2VT3A 1D8JA 3P7NA 3NRVA 5K5QA 4L5IA 1JHFA 1YLFA 1UHWA 1ZRCA 3QP5A 5HDNA 2IVMA 4ASNA 3I5UA 4OOIA 2EK5A 4G8XA 4RGRA 1WWXA 3LAPA 5ICCA 2DK8A 2HFHA 2OA4A 1LEAA 3MQ0A 3RKYA 3ZP5A 4EM0B 4XBFA 2O6GE 2RQPA 1P2FA 3FM3A 3RPQA 3MCZA 2M1BA 1O7FA 2VBWA 2J5OA 3DV8A 4HF2A 4KUMA 3CJNA 3I54A 3GF2A 4N9IA 3KE2A 2D1VA 1I1GA 1USSA 1XMKA 4ENMA 2ISZA 2RV8A 2EV5A 3TOBA 2DPUA 2WWYA 2VBYA 1FNNA 4MTEA 3LAJA 1XGSA 3IRRA 5FO5A 2EFWA 5DD8A 1I5ZA 5TJJA 2HWVA 4I01A 2RNJA 4ENKA 2Q8KA 1UB9A 3RKXA 3JAMZ 5BPIA 4HV6A 1IUYA 1XSVA 3JSPA 1F4KA 5F1RA 2QUFA 4CGZA 2VODA 4QWQA 4MEYF 2K86A 3V4GA 2KIUA 2E7WA 3MWMA 3P9IA 2O03A 2BBYA 3LWFA 4M6YA 3R0AA 3ZN1A 3FF5A 3HHHA 3U2RA 5D5VB 4OIQF 1HKTA 2PQ8A 1FP2A 1SD7A 4A5MA 4HW0A 1ZLKA 2EB7A 4HLXA 3QP6A 1EH7A 2DQLA 2MD5A 2X0LA 4UV9A 1SFEA 1BJAA 3KLOA 4KNYA 4HQMA 3BPXA 4XRFA 2VT2A 3HOTA 1SFXA 1W5TA 3P9KA 3QPHA 4XSXF 2FQ3A 1F1ZA 1ODDA 1HW1A 1LDKB 3DPTA 3H3UA 1SAXA 2MA3A 3SHFA 3Q9VA 4WK8F 2XKPA 4M9ZA 1ZREA 4LJZF 2XVCA 1V3FA 3IRQA 2XIGA 2P5VA 5E1XA 3ABUA 3HRUA 1RUOA 4K2EA 1HKQA 5IT9Z 2OQRA 3WTZA 3QU3A 3NEUA 4KT5C 3ZN0A 3SQNA 1OR7A 2MLGA 1QBJA 2H27A 1UFMA 2CFXA 2VC0A 2VBZA 1J7KA 4MTDA 3FMRA 4UHTA 2GIVA 4NHJA 4IHSA 5IT9K 4RGUA 1KU7A 2HOEA 5FGMA 2ZCWA 4HOBA 4LFUA 3T1BA 4LD5A 2PLYA 4QLCU 1XGNA 3R61A 4M6XA 1R5HA 1G4DA 4EVIA 2Q0OA 2F5CA 2FE3A 5JI6A 1J59A 1PUEE 1FP1D 2QLZA 1REPC 3IWZA 3E3VA 3C18A 2Y75A 1IN8A 3V8LA 4P9UA 3T5XA 5HDGA 3M8FA 1ZRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGX A;  1B1B A;  4YFX F;  1UHM A;  3GO5 A;  1RNL A;  2IRF G;  3ECO A;  3OV8 A;  3WTV C;  1BN5 A;  1DUX C;  4HZF A;  3ISP A;  5K5O A;  3W6J B;  4M73 A;  3R60 A;  5K1Y A;  2P5K A;  2XAF A;  3ZMV A;  2G7U A;  2Z99 A;  5ILS A;  1K7A A;  5LGT A;  3S2W A;  1BI0 A;  2WV0 A;  4P9F A;  5DUI A;  3I58 A;  2V9V A;  3G73 A;  3BJO A;  4IHT A;  4FHT A;  1O7L A;  2YX4 A;  2CO5 A;  3HHG A;  3J7A O;  3T0Y A;  4MHG A;  2L4A A;  3TKY A;  3TGN A;  3TO6 A;  2O3F A;  5JVT A;  5LRR A;  3L9F A;  3V7S A;  2FBH A;  4HX7 A;  4I2O A;  2V79 A;  4YFN F;  3JTH A;  1T38 A;  2DFI A;  4JK1 X;  1KYZ A;  2PMU A;  1O3R A;  1QZY A;  3LQQ A;  5AIP A;  3ZMS A;  1CGP A;  3E6M A;  2YX7 A;  1R1V A;  2Y0M A;  2PBI A;  3FX3 A;  3N4M A;  3ZMT A;  3M1E A;  5CVR A;  1YW9 A;  4PGH A;  1K79 A;  4IJA A;  3M9A A;  2A3S A;  1T6S A;  3RTR A;  1XGO A;  1TQI A;  3MAJ A;  5K5R A;  5HOO A;  3HOS A;  3GYH X;  4BXU A;  3F8F A;  4ENJ A;  1KU3 A;  5LEK A;  2PFB A;  4IRI A;  1QNT A;  3EYI A;  1RI7 A;  2IJL A;  4KN4 X;  1W7P A;  4S05 A;  1OPC A;  3K1M A;  3KP3 A;  5AON A;  5L3E A;  3JW4 A;  2QYO A;  5D8K B;  1FT9 A;  1O3S A;  4LLL A;  1R1T A;  2RKH A;  3RPU A;  1JGS A;  2KJB A;  3Q5F A;  2JTV A;  3KFW X;  1S29 A;  1OYW A;  2EWN A;  3R0J A;  3HTS B;  3F8B A;  4BQA A;  4MQV A;  4L9T A;  4KMF A;  1T98 A;  1SMT A;  1YYV A;  5CLS A;  2IA0 A;  3PQK A;  3WTU C;  3KP7 A;  3GZ6 A;  5E1Z B;  3HSR A;  3I71 A;  1ZAR A;  2WC2 A;  3ABT A;  1J5Y A;  3FZV A;  5BQT A;  1IXS B;  1O3Q A;  2CQK A;  1GVJ A;  1HQC A;  2LF8 A;  4GYI A;  4NB5 A;  4L5J A;  4HQE A;  4AD9 A;  2QVO A;  2A61 A;  1TQM A;  5ERI A;  4HYE A;  1H9T A;  2IW5 A;  1A04 A;  2IT0 A;  5LHI A;  2DLL A;  4DNC A;  3IC7 A;  2ZFW A;  1WKM A;  5E17 F;  5D4R A;  3C3W A;  2HEO A;  4I98 B;  2BE5 F;  5LBQ A;  4R1H A;  1O57 A;  2HQR A;  2XKO A;  2DT5 A;  3BJA A;  2FF4 A;  3LST A;  2QBY A;  2QBY B;  3OOP A;  3WGH A;  3K0L A;  2M45 A;  6PAX A;  1BIB A;  1LDD A;  2HDC A;  3L09 A;  4B09 A;  5FD5 A;  3FHZ A;  1P6R A;  1EH6 A;  2RC4 A;  1FBS A;  3DEU A;  4MEX F;  5DV5 A;  2PMH A;  4Y15 A;  2GWR A;  1XGM A;  2GA1 A;  3QPT A;  1W5S A;  5A2Q Z;  2HTJ A;  3H3Z A;  5FD6 A;  1GXP A;  1KU9 A;  3TDZ C;  3EYY A;  2YR2 A;  1S6L A;  2F2E A;  3HRM A;  3FXR A;  1YO5 C;  2VE8 A;  1MJA A;  4CHU A;  4UUV A;  4KFC A;  3G3Z A;  5CVJ A;  5A2Q K;  1V4R A;  3WE3 A;  2VOO A;  1KYW A;  3KZY A;  2XHK A;  3FXQ A;  4KIC A;  3GFI A;  2XV4 S;  2GXB A;  4KMU X;  1BOA A;  4KDP A;  1BC8 C;  3J81 Z;  4HV5 A;  2L01 A;  4ESB A;  4XSZ F;  1BI3 A;  5E8G A;  2HGC A;  1STZ A;  3BJ6 A;  5F6F A;  4G6D A;  4A0Z A;  1KGS A;  4Y17 A;  2AXL A;  4Q4Z F;  1HST A;  3FMS A;  1HBX G;  3WU1 B;  4L18 B;  3J81 K;  5F64 A;  5FLX Z;  4L9N A;  1P4W A;  4U88 A;  1FYM A;  1FOK A;  2EV6 A;  2LDU A;  5JFR A;  4HF0 A;  1TW2 A;  2STW A;  3I53 A;  2HYG D;  1ZHF A;  1U5T C;  1R23 A;  1SD6 A;  5FLX K;  3AAF A;  3P9C A;  2XUB A;  1U8R A;  2M30 A;  2OZ6 A;  1DP7 P;  2UZK A;  5BS6 A;  2OZU A;  1Z6R A;  2XRN A;  2M8E A;  3VFZ A;  3ZMD A;  4HF1 A;  5DCM A;  2ZXJ A;  1SD4 A;  5DCM B;  4RAZ A;  4WX9 A;  4KA4 A;  3HUG A;  2FEZ A;  2H6C A;  4AWX B;  1U5T B;  4RB1 A;  1FC3 A;  2ZKZ A;  2A69 F;  2A6H F;  3R4K A;  2V1U A;  4OMY A;  4ZYG A;  2GZW A;  2V6C A;  2MH2 A;  3E5Q A;  1BIA A;  3IKV A;  2NYX A;  4G7H F;  4KYW A;  3ULQ B;  4N9H A;  2DTR A;  4ETS A;  3GWZ A;  3E5X A;  3F8M A;  4MNU A;  5L3C A;  3C1D A;  4P96 A;  1IN7 A;  3WGI A;  2AS5 F;  2PJP A;  2KRF A;  3DKW A;  2C6Y A;  1B9N A;  4I0A A;  4ZYE A;  2IA1 A;  3O2P E;  1D8K A;  2MH9 A;  3V8J A;  1EH8 A;  2CSO A;  1Q1H A;  5D5X B;  4HBL A;  4YIF A;  1Z6T A;  2LF7 A;  1B9M A;  3LFK A;  1Z05 A;  2GQQ A;  2JPC A;  3N97 A;  1W4M A;  2V1D A;  2XRO A;  4A6D A;  2HTS A;  2QEN A;  4OIP F;  2FRH A;  2DBB A;  4G7O F;  3H92 A;  4N0B A;  3HIF A;  1IN5 A;  4ZH4 F;  1ZRD A;  3L00 A;  4BHB A;  4IRG A;  4AIJ A;  3HRS A;  4A2U A;  3F6V A;  2A68 F;  1ZG5 A;  1XSX A;  5J8C A;  4EJU A;  1WI9 A;  5ICE A;  5DDG A;  3V7R A;  1QQI A;  5E20 A;  1GXQ A;  5CJ9 A;  2HR3 A;  5L3G A;  2L02 A;  2CWE A;  3IL2 A;  4HX4 A;  2ZO4 A;  3ZMZ A;  4AVP A;  4CIC A;  3K9T A;  2W85 A;  2DPD A;  3KEO A;  3V7C A;  2CGP A;  1MJ9 A;  2VN2 A;  2O61 A;  3LA3 A;  4RGX A;  4HX8 A;  3ZQ7 A;  2VE9 A;  1ONV A;  2IPQ X;  2O8X A;  3T8T A;  3RDI A;  4PCQ A;  3U9G A;  1ZGA A;  5L3B A;  3F8C A;  3GLX A;  1S7A A;  1OMI A;  1LDJ A;  2F5D A;  3VB2 A;  2W25 A;  1BI1 A;  3BWG A;  5H6Q A;  2EJR A;  1RZ4 A;  3D0S A;  2YSR A;  1O3T A;  3BPV A;  2XAQ A;  4MQ9 F;  1ON1 A;  5HS7 A;  2MC3 A;  1W7P D;  3B73 A;  4A12 A;  1Y0U A;  2R7D A;  1DDN A;  4EJW A;  2K4B A;  5KK1 A;  4L9J A;  4OMZ A;  1I27 A;  4M9X A;  4WXH A;  1ZG3 A;  1FBQ A;  2FU4 A;  3K2Z A;  4EM2 A;  1QO0 D;  2UWM A;  5H6R A;  4PDK A;  4XLN F;  1F9N A;  5LHG A;  2VC1 A;  2ACJ A;  4U0Y A;  2LSO A;  2Q2E A;  1ZG1 A;  2ZNY A;  1G3T A;  4E70 A;  2A6E F;  1KA8 A;  1R00 A;  1H9G A;  3EDP A;  2D2W A;  3CO6 C;  1IZ1 A;  3PQJ A;  1ZH5 A;  1R1U A;  4M71 A;  4BH9 A;  4HDU A;  1J2X A;  1IRG A;  5ICG A;  2ZJ2 A;  3C7J A;  4RGS A;  4LLG F;  3KP4 A;  1VTN C;  3FXU A;  1MJB A;  4R8H A;  2MLK A;  4ZYH A;  1MKM A;  4LK0 F;  1MD0 A;  2FBK A;  3RI4 A;  1J75 A;  2EA4 A;  2DI3 A;  2YU3 A;  2YPR A;  1RIO H;  2A07 F;  1T0F A;  4Q47 A;  1HW5 A;  4ESF A;  3WTS C;  4A5N A;  5HLH A;  1HSJ A;  3TO9 A;  1LNW A;  3O6B B;  4Q5S F;  2P7V B;  4JQF A;  2PI0 A;  4U7D A;  2EV0 A;  3K1N A;  2NNN A;  2X4H A;  2ESN A;  3KZZ A;  2DAO A;  5JHU A;  1TTY A;  2IP2 A;  3ZMU A;  4AIK A;  1KQ8 A;  3SXY A;  2OQG A;  1PP7 U;  1U6G A;  1MGT A;  2NNY A;  4A6E A;  3COA C;  2GXG A;  2W24 A;  1P92 A;  3JSO A;  1U78 A;  4KIF A;  4GCV A;  1TNT A;  1E17 A;  1PP8 F;  2K7L A;  5EEG A;  1G6N A;  3WG9 A;  5HVQ C;  2ZBK A;  4IF4 A;  1BI2 A;  2FOK A;  1XB4 A;  4HDV A;  1LJ9 A;  3MZY A;  4O3M A;  3E6C C;  3V8K A;  2MBF A;  2HQN A;  4U0W A;  2FA5 A;  1IF1 A;  1WQ2 A;  3J80 Z;  5D8L B;  3WTY C;  3K69 A;  1WSU A;  2JPB A;  2L54 A;  2VBX A;  1ON2 A;  1YG2 A;  3BDD A;  4M9S A;  1TQP A;  2DW4 A;  3M7G A;  3WTT C;  3U1D A;  1XMA A;  4ESJ A;  3KCC A;  3J80 K;  1YFH A;  5DD4 A;  3M8E A;  4EM1 A;  3ECH A;  2RDP A;  4OIN F;  1JHH A;  4Y13 A;  1FWZ A;  4GGG A;  1AWC A;  1R5G A;  1SMY F;  4IRH A;  4FT8 A;  2KIF A;  1B4A A;  2EFN A;  4H0E A;  3HYI A;  2TDX A;  3ELK A;  3GUD A;  3REO A;  2RN7 A;  1R58 A;  5FFX A;  3LA2 A;  1S8N A;  2EFP A;  1LVA A;  3F23 A;  4GO1 A;  4OIR F;  4BHP A;  5CYV A;  3SZP A;  4RS8 A;  4BYY A;  1BM9 A;  4XLP F;  3MFK A;  2CG4 A;  3KEQ A;  1XCB A;  1L3L A;  4YG2 F;  3Q9S A;  4LB5 A;  2R3S A;  3TO7 A;  2GAU A;  3TDU C;  3GZ5 A;  1R22 A;  4EGZ A;  2H94 A;  1UCR A;  4BHC A;  3VEP A;  3ZPL A;  1T39 A;  1IXC A;  1I1S A;  4S04 A;  4PGG A;  4FX0 A;  1TLH B;  2BV6 A;  3DFG A;  5HLI A;  2STT A;  4LGW A;  3F6O A;  3KLN A;  4UNO A;  1G3S A;  3BRO A;  2FNP A;  4EQQ A;  1P4A A;  1XSD A;  3DF8 A;  2VOP A;  4YII A;  4CYD A;  4CO8 A;  1QGP A;  5E1W A;  2UXX A;  4LLN A;  1HKS A;  1ULY A;  4LMY A;  2P4W A;  4A0Y A;  3KP5 A;  5L3F A;  1GHC A;  1KU2 A;  2KIM A;  1LQ1 A;  2V1X A;  3VOD A;  4ZZL A;  2RGV A;  1ZN2 A;  3CUO A;  2R7F A;  1MZB A;  5JR3 A;  1RUN A;  5DCF A;  1FZP B;  4I02 A;  2H6B A;  2HKO A;  5EEH A;  1IXR C;  4EGY A;  3BP8 A;  1LEB A;  1U5T A;  2VON A;  4O6J A;  4HLY A;  5FFZ A;  4I09 A;  2P7C B;  1HXD A;  5LGN A;  1S7O A;  5BMZ A;  1FSE A;  4RB3 C;  4Q48 A;  3F72 A;  4EMS A;  2FSW A;  3E5U A;  1ZAO A;  4RB2 C;  3F3X A;  5BOX A;  3RYR A;  3KP2 A;  2OU2 A;  1IN4 A;  3GVA A;  2DK5 A;  3B02 A;  3WOD F;  2LNB A;  4L9V A;  4P5O A;  5DEQ A;  1E2X A;  3EQL F;  2XAJ A;  3LQR A;  2QQA A;  1TBX A;  3I4P A;  1J0R A;  5D5U B;  2D45 A;  1KQ0 A;  2QZ8 A;  4B8X A;  3JAM K;  3ERE D;  2E1C A;  4I0B A;  4DQ2 A;  4ZYD A;  2FNA A;  1UST A;  5J6X A;  1Z1D A;  3HTU A;  4FX4 A;  4KIG A;  4UVB A;  1F5T A;  4IXA A;  3GX4 X;  4EJT A;  1ZYR F;  2FMY A;  4P55 A;  2ADU A;  2P5L C;  3MZH A;  3WE2 A;  1IAW A;  1FLI A;  1HW2 A;  3IKT A;  4GYG A;  4F7Z A;  4UXN A;  1NHA A;  2Z3Y A;  2JRT A;  3CTA A;  2B0L A;  3RIR A;  3FM5 A;  1OKR A;  1U3E M;  1WRJ A;  2H09 A;  4IVN A;  4M72 A;  5BPD A;  5HLG A;  5CVV A;  4BNC A;  5FB2 A;  2M5W A;  5D6F A;  1BBY A;  3QU6 A;  1LB2 A;  1FYL A;  3GFL A;  3D5L A;  2EFO A;  1Z91 A;  4G9Y A;  3E6B A;  5D6E A;  5E8I A;  5LEJ A;  2P8T A;  1FY7 A;  2XAH A;  1YS7 A;  2KKO A;  2JT1 A;  3RKW A;  2ISY A;  2XAS A;  4G6Q A;  2RVC A;  1IW7 F;  1XDS A;  4NQW A;  2QQB A;  3MEX A;  4WXC A;  1K78 A;  2Y48 A;  3KET A;  1K78 B;  3DP7 A;  3R6S A;  2FML A;  4KN7 X;  4Z2Y A;  4BAY A;  5AIQ A;  2ETH A;  3FMQ A;  4OU0 A;  2GA2 A;  4G94 A;  2HS5 A;  5J8F A;  3BOQ A;  3RJP A;  3QAH A;  1QZZ A;  4IPA A;  2ELH A;  4LK1 F;  2HZT A;  5LGU A;  2PEX A;  1FYK A;  5ILU A;  1G3W A;  2FBI A;  4EV0 A;  2G9W A;  2JZY A;  4U0V A;  1R7J A;  2PN6 A;  1SD5 A;  3EET A;  4O5V A;  4WXD A;  1T2K A;  1XN7 A;  3HSF A;  1FSH A;  1IRF A;  1FBU A;  5H20 A;  4LG0 A;  3GW2 A;  5KVR A;  2O0Y A;  4LG0 B;  5DUK A;  2NRA C;  3HSE A;  4KIB A;  2COM A;  1X3U A;  2JSC A;  3GEZ A;  1PDN C;  5LRS A;  4WF2 A;  1CF7 A;  1QPM A;  2F5E A;  2E1N A;  1CF7 B;  1JXS A;  2ZNZ A;  3GFM A;  3QRF F;  3L2C A;  2F5F A;  2L4M A;  4HAM A;  5LLQ A;  5HDK A;  2Z9O A;  2EFQ A;  4OIO F;  4PZJ A;  5HS9 A;  3BZ6 A;  5CVU A;  4TV7 A;  4CZZ A;  4UVC A;  3WTW C;  3F21 A;  2QWW A;  3I64 A;  3WGG A;  3F8N A;  3DXJ F;  1ZGJ A;  4UVA A;  1SFU A;  4AIH A;  1I6X A;  3IWF A;  5DYM A;  2CYY A;  2K4J A;  3GXO A;  1YW7 A;  3L7W A;  4EJO A;  5ICF A;  2NAZ A;  4L0Z B;  1L0O C;  1S3J A;  1YS6 A;  1R36 A;  2E7X A;  3LA7 A;  3W6K B;  4M74 A;  3KP6 A;  4GXO A;  2OAZ A;  2KJC A;  5ILV A;  2BYV E;  1D5V A;  2DU9 A;  3K1P A;  1XCV A;  2QM3 A;  5CVI A;  4U7B A;  2LKP A;  4UV8 A;  1XDU A;  4ON0 A;  4LB6 B;  4A0X A;  3DQV C;  1W7P B;  3ROU A;  3EUH A;  1D3Y A;  5TRD A;  2A5Y B;  2Z33 A;  4MGR A;  3O3K A;  3WU0 A;  4G7Z F;  4EJV A;  1DPU A;  1OYI A;  3CO7 C;  2WTE A;  4I7H A;  5HS8 A;  3QOP A;  1AOY A;  3I0T A;  5L3D A;  3FWE A;  3DPL C;  2M87 A;  4D0P A;  2EA2 A;  3SZT A;  2P6T A;  1Z9C A;  1TNS A;  2HYF A;  1H0M A;  4ZZD A;  2BGC A;  3HRT A;  2VXZ A;  2QQ9 A;  1FX7 A;  1DPR A;  1MDM A;  1C0W A;  3I59 A;  2OD5 A;  1TW3 A;  1MDM B;  3T8R A;  2BEO A;  3I59 B;  1P4X A;  3WTX C;  4ENN A;  4CXF A;  2UXN A;  1J9I A;  1K6O A;  4L0Y B;  3CDH A;  3TOA A;  2ZME A;  5IT3 A;  2ZME B;  1JE8 A;  3CUQ C;  2CW0 F;  3IHU A;  2Z5U A;  1OYY A;  1EV7 A;  2J5P A;  3SFZ A;  1YIO A;  3E97 A;  5D4S A;  4RB0 A;  4YFK F;  1IN6 A;  1ZLJ A;  2IA2 A;  3NQO A;  4WCG A;  4RAY A;  4HA8 A;  1B6A A;  4WWC A;  1U2W A;  3F22 A;  2ESH A;  4CDG A;  2FXA A;  3CUQ A;  3CLO A;  3CUQ B;  5E18 F;  5ED4 A;  2D1H A;  3JTG A;  2G7H A;  2K02 A;  2OBP A;  1KQ9 A;  3BY6 A;  2P6S A;  1YQA A;  2W84 A;  3PFI A;  1B59 A;  3ML6 A;  1XD7 A;  3RYP A;  5D5W B;  2L3D A;  1G3Y A;  2XAG A;  1BC7 C;  2DO7 A;  1YTY A;  3TQN A;  2PG4 A;  1Z7U A;  3VOE A;  5LHH A;  2K27 A;  3GFJ A;  1FPQ A;  2HKX A;  2NS0 A;  3E6D A;  4JBA A;  4R79 A;  2DQR A;  1YW8 A;  2W57 A;  2VT3 A;  1D8J A;  3P7N A;  3NRV A;  5K5Q A;  4L5I A;  1JHF A;  1YLF A;  1UHW A;  1ZRC A;  3QP5 A;  5HDN A;  2IVM A;  4ASN A;  3I5U A;  4OOI A;  2EK5 A;  4G8X A;  4RGR A;  1WWX A;  3LAP A;  5ICC A;  2DK8 A;  2HFH A;  2OA4 A;  1LEA A;  3MQ0 A;  3RKY A;  3ZP5 A;  4EM0 B;  4XBF A;  2O6G E;  2RQP A;  1P2F A;  3FM3 A;  3RPQ A;  3MCZ A;  2M1B A;  1O7F A;  2VBW A;  2J5O A;  3DV8 A;  4HF2 A;  4KUM A;  3CJN A;  3I54 A;  3GF2 A;  4N9I A;  3KE2 A;  2D1V A;  1I1G A;  1USS A;  1XMK A;  4ENM A;  2ISZ A;  2RV8 A;  2EV5 A;  3TOB A;  2DPU A;  2WWY A;  2VBY A;  1FNN A;  4MTE A;  3LAJ A;  1XGS A;  3IRR A;  5FO5 A;  2EFW A;  5DD8 A;  1I5Z A;  5TJJ A;  2HWV A;  4I01 A;  2RNJ A;  4ENK A;  2Q8K A;  1UB9 A;  3RKX A;  3JAM Z;  5BPI A;  4HV6 A;  1IUY A;  1XSV A;  3JSP A;  1F4K A;  5F1R A;  2QUF A;  4CGZ A;  2VOD A;  4QWQ A;  4MEY F;  2K86 A;  3V4G A;  2KIU A;  2E7W A;  3MWM A;  3P9I A;  2O03 A;  2BBY A;  3LWF A;  4M6Y A;  3R0A A;  3ZN1 A;  3FF5 A;  3HHH A;  3U2R A;  5D5V B;  4OIQ F;  1HKT A;  2PQ8 A;  1FP2 A;  1SD7 A;  4A5M A;  4HW0 A;  1ZLK A;  2EB7 A;  4HLX A;  3QP6 A;  1EH7 A;  2DQL A;  2MD5 A;  2X0L A;  4UV9 A;  1SFE A;  1BJA A;  3KLO A;  4KNY A;  4HQM A;  3BPX A;  4XRF A;  2VT2 A;  3HOT A;  1SFX A;  1W5T A;  3P9K A;  3QPH A;  4XSX F;  2FQ3 A;  1F1Z A;  1ODD A;  1HW1 A;  1LDK B;  3DPT A;  3H3U A;  1SAX A;  2MA3 A;  3SHF A;  3Q9V A;  4WK8 F;  2XKP A;  4M9Z A;  1ZRE A;  4LJZ F;  2XVC A;  1V3F A;  3IRQ A;  2XIG A;  2P5V A;  5E1X A;  3ABU A;  3HRU A;  1RUO A;  4K2E A;  1HKQ A;  5IT9 Z;  2OQR A;  3WTZ A;  3QU3 A;  3NEU A;  4KT5 C;  3ZN0 A;  3SQN A;  1OR7 A;  2MLG A;  1QBJ A;  2H27 A;  1UFM A;  2CFX A;  2VC0 A;  2VBZ A;  1J7K A;  4MTD A;  3FMR A;  4UHT A;  2GIV A;  4NHJ A;  4IHS A;  5IT9 K;  4RGU A;  1KU7 A;  2HOE A;  5FGM A;  2ZCW A;  4HOB A;  4LFU A;  3T1B A;  4LD5 A;  2PLY A;  4QLC U;  1XGN A;  3R61 A;  4M6X A;  1R5H A;  1G4D A;  4EVI A;  2Q0O A;  2F5C A;  2FE3 A;  5JI6 A;  1J59 A;  1PUE E;  1FP1 D;  2QLZ A;  1REP C;  3IWZ A;  3E3V A;  3C18 A;  2Y75 A;  1IN8 A;  3V8L A;  4P9U A;  3T5X A;  5HDG A;  3M8F A;  1ZRF A; 
#chains in the Genus database with same CATH topology
 2XGX A;  1B1B A;  4IHW A;  1I6H J;  4FE4 A;  4KJZ A;  1YIJ I;  4YFX F;  1UHM A;  3GO5 A;  3OMY A;  1RNL A;  1UAA A;  5F0C A;  2IRF G;  1LUJ B;  3ECO A;  4CA0 A;  3OV8 A;  3WTV C;  1PYV A;  4V2F A;  3AKZ A;  1BN5 A;  1DUX C;  4HZF A;  2R7Q A;  2DFF A;  3ISP A;  4CCO A;  5K5O A;  1TWH J;  5DM6 F;  4NC7 A;  4M73 A;  4XKW A;  3W6J B;  5IYD J;  3R60 A;  1V5E A;  2LBF A;  5K1Y A;  2P5K A;  2XAF A;  3ZMV A;  2DMU A;  2G7U A;  2Z99 A;  5ILS A;  1VI0 A;  3DCF A;  1K7A A;  2XB0 X;  3RZD J;  4RMN A;  2V6E A;  5LGT A;  3S2W A;  1BI0 A;  3RPU D;  2CV0 A;  2WV0 A;  3BT9 A;  4P9F A;  3I58 A;  5DUI A;  2V9V A;  2KMU A;  4X1E A;  3G73 A;  4F93 B;  1HDD C;  3BJO A;  1X1C A;  4IHT A;  2E2J J;  3F0C A;  4FHT A;  2IS6 A;  2COB A;  1O7L A;  2IS1 A;  2YX4 A;  1XG1 A;  4J00 A;  2CO5 A;  3HHG A;  3J7A O;  3S1Q J;  2F4I A;  3FIW A;  4I76 A;  3T0Y A;  4MHG A;  1F43 A;  3EUK L;  3VSK A;  2O8K A;  2L4A A;  3TKY A;  3TGN A;  3TO6 A;  3S3O A;  2R7U A;  3CCY A;  2Q2E B;  2O3F A;  3OIP A;  5JVT A;  2H8R A;  2B63 J;  5LRR A;  2LRD A;  1RC9 A;  3L9F A;  3V7S A;  2FBH A;  4HX7 A;  4I2O A;  2V79 A;  5CQE A;  5K7F A;  5CPR B;  5H2F C;  2CQN A;  4YFN F;  3JTH A;  1T38 A;  2MAB A;  3K4N A;  2ELK A;  4D9J A;  2DFI A;  2R7O A;  3IH2 A;  2BVM A;  2VKH A;  4JX6 A;  4LIV A;  3H9J A;  4JK1 X;  4IHY A;  1KYZ A;  2PMU A;  1O3R A;  4KIS A;  3FXO A;  1QZY A;  2DMN A;  2XAU A;  3LQQ A;  2EZI A;  5AIP A;  3ZMS A;  4XLE A;  2IGM A;  3CCJ I;  1MBH A;  4N4O B;  1CGP A;  3E6M A;  1TC3 C;  2YX7 A;  2OTJ I;  5J3L A;  1R1V A;  2Y0M A;  2PBI A;  2LLK A;  2VL8 A;  1M1E B;  3FX3 A;  3N4M A;  1HDP A;  3TW6 A;  3ZMT A;  3M1E A;  5CVR A;  1YW9 A;  2VKD A;  4CSW A;  4PGH A;  3I4M J;  1K79 A;  4IJA A;  4BY1 J;  5C4J J;  3M9A A;  2A3S A;  1T33 A;  5LD2 C;  4E7K A;  2R7X A;  1T6S A;  3I55 I;  3RTR A;  1Y1W J;  1KON A;  1Y0N A;  1XGO A;  1TQI A;  3MAJ A;  3VSL A;  5K5R A;  5HOO A;  2VQL A;  2JK3 A;  3I56 I;  3W2W A;  5M5X J;  3HOS A;  1JTY A;  3K6G A;  1GV5 A;  4HST A;  3H0G J;  3PFY A;  1YX5 A;  3GYH X;  4BXU A;  3FIS A;  3F8F A;  3HGY A;  5FRM A;  4ENJ A;  1KU3 A;  2OTL I;  3G1O A;  2LY9 A;  5LEK A;  2ME0 A;  2PFB A;  4IRI A;  1QNT A;  2XDV A;  3ZQF A;  3Q0U A;  3EYI A;  1RI7 A;  2IJL A;  2R92 J;  1Y1V J;  2ZB9 A;  4PSW A;  2RQQ A;  4KN4 X;  4CH7 A;  1W7P A;  4S05 A;  1OPC A;  3K1M A;  1Y56 A;  3KP3 A;  5AON A;  5L3E A;  3ASN H;  3JW4 A;  2QYO A;  5KNL A;  5D8K B;  1IG7 A;  1Z3X A;  1FT9 A;  1O3S A;  4LLL A;  3ABK H;  1R1T A;  2CQQ A;  2RKH A;  3QQA A;  3RPU A;  3OYE A;  1JGS A;  1Y6I A;  1ETO A;  1V5F A;  2KJB A;  3K4K A;  2Z16 A;  3BR1 A;  3OYB A;  3Q5F A;  3S1M J;  1JUS A;  3JRB A;  3JRF A;  2JTV A;  3KFW X;  1S29 A;  1OYW A;  2K85 A;  2W1O A;  2EWN A;  4ZDL A;  3R0J A;  3HTS B;  3PSI A;  3F8B A;  2DA1 A;  5KCM A;  4BQA A;  4XOP A;  4MQV A;  4L9T A;  4W97 A;  4KMF A;  1T98 A;  1IGN A;  1P7J A;  1SMT A;  1YYV A;  5CLS A;  2IA0 A;  3PQK A;  3WTU C;  2XSJ C;  3KP7 A;  3GZ6 A;  1V5G A;  5E1Z B;  2KZG A;  2YS9 A;  3HSR A;  1UG0 A;  3I71 A;  1ZAR A;  3ABT A;  2WC2 A;  1ETQ A;  1J5Y A;  2ELJ A;  3DTI A;  3FZV A;  2F48 A;  5BQT A;  1IXS B;  5C4X J;  1O3Q A;  2JWT A;  2CQK A;  1GVJ A;  1H8A C;  3NWS A;  1HQC A;  2LF8 A;  4Y3O A;  2Y0S A;  3PNT A;  1JT6 A;  4XLC A;  3SYT A;  3BTL A;  4GYI A;  1JKP C;  4NB5 A;  4L5J A;  4HQE A;  3LSH A;  4AD9 A;  5K7Z A;  2QVO A;  2VAS A;  2A61 A;  2XF7 A;  1TQM A;  2OV7 A;  2ME6 A;  5ERI A;  4HYE A;  1H9T A;  3HOY J;  2IW5 A;  2VUM J;  1A04 A;  2IT0 A;  5LHI A;  1K83 J;  5FKO A;  3DPU A;  2DLL A;  4DNC A;  3IC7 A;  2ID6 A;  5F04 A;  2ZFW A;  2CV2 A;  1WKM A;  4BBR J;  5E17 F;  5D4R A;  3C3W A;  3JRI A;  5M3F J;  4BDZ A;  2HEO A;  4I98 B;  2BE5 F;  5LBQ A;  4R1H A;  2VJI A;  1O57 A;  3OYH A;  2HQR A;  4JP0 A;  3PJR A;  3KYL A;  2XKO A;  2DT5 A;  3BJA A;  3WG7 H;  2FF4 A;  3LST A;  1NTC A;  4DJA A;  1ORK A;  3SEZ A;  2QBY A;  3BCA A;  2QBY B;  1MMA A;  3OOP A;  3WGH A;  1TP4 A;  1DP3 A;  3CDL A;  3K0L A;  3OIQ A;  2M45 A;  3BR3 A;  2RAE A;  1GVD A;  3QPL A;  6PAX A;  2JA5 J;  1MIJ A;  4PSX A;  3Q0W A;  1BIB A;  2LD5 A;  1LDD A;  5J4Y A;  2HDC A;  3OSF A;  3L09 A;  4B09 A;  1RRJ A;  2Y0S N;  2LR8 A;  1LFP A;  4NNJ A;  5FD5 A;  3FHZ A;  3LSR A;  4XID A;  4DBR A;  1P6R A;  2WY8 Q;  1BL0 A;  2BW3 A;  5IYC J;  3CF5 F;  3QPS A;  2VLA A;  1EH6 A;  2RC4 A;  5IOY A;  2BW3 B;  1SVO A;  2LVS A;  1WH7 A;  1FBS A;  1X4O A;  3DEU A;  2X6Y A;  4MEX F;  5DV5 A;  2DN0 A;  3LSP A;  1A35 A;  4B47 A;  2PMH A;  4Y15 A;  2GWR A;  1XGM A;  1W0T A;  2GA1 A;  2ZJR F;  3QPT A;  1W5S A;  3OYI A;  5EZH A;  3PIO F;  3OR2 C;  5A2Q Z;  1B8I A;  2HTJ A;  3H3Z A;  5FD6 A;  1GXP A;  2QCO A;  1KU9 A;  3TDZ C;  5K7H A;  4A3K J;  3EYY A;  4YRV A;  1LE8 A;  2YR2 A;  4RDU A;  3K10 A;  1LE8 B;  3L2V A;  1S6L A;  1QRY A;  4YEJ A;  3PNY A;  2F2E A;  3HRM A;  3FXR A;  1YO5 C;  2EZH A;  1LVK A;  4CCJ A;  2VE8 A;  4CZC A;  1MJA A;  4CHU A;  4UUV A;  2FJ1 A;  3S1R J;  1MMN A;  4KFC A;  3G3Z A;  1ITY A;  5CVJ A;  5A2Q K;  4DYR A;  2HQA A;  2LP0 A;  1V4R A;  3WE3 A;  1WJ5 A;  1KZH A;  2NVT J;  1FOY A;  2VOO A;  1KYW A;  3KZY A;  3FKI J;  2XHK A;  3FXQ A;  4KIC A;  3GFI A;  2L9V A;  2DYR H;  2XV4 S;  4IOA F;  2GXB A;  4KMU X;  4C2T A;  1BOA A;  4KDP A;  3H36 A;  1BC8 C;  3J81 Z;  4HV5 A;  2L01 A;  4ESB A;  2ZSI B;  4XSZ F;  4M3G A;  4CUG A;  1Y8Q B;  1TWA J;  1WGX A;  2XF5 A;  1NH3 A;  1JJ8 C;  2E2I J;  3OS0 A;  1W5C C;  1BI3 A;  2DYS H;  3SEQ A;  3K70 C;  5E8G A;  1EF4 A;  3HOU J;  2HGC A;  1STZ A;  2CJJ A;  2OUM A;  3BJ6 A;  5IYB J;  5F6F A;  3M4O J;  4G6D A;  4A0Z A;  1KGS A;  4Y17 A;  2AXL A;  1OCT C;  2MGQ A;  4Q4Z F;  1HST A;  4NUB A;  4YIR X;  4RLF A;  2W00 A;  3FMS A;  3O8H A;  1HBX G;  3WU1 B;  4L18 B;  3J81 K;  1I39 A;  5F64 A;  5FLX Z;  4L9N A;  5EYR A;  1P4W A;  4U88 A;  1FYM A;  1FOK A;  2A6T A;  2EV6 A;  1FMW A;  5FKK A;  2LDU A;  4RM3 A;  5M3M J;  2H1K A;  5JFR A;  4HF0 A;  1TW2 A;  2WAD A;  5HNF A;  2STW A;  1B72 A;  4B44 A;  1BA5 A;  3I53 A;  3ZXS A;  2HYG D;  1B72 B;  3OYJ A;  3M3Y J;  1ZHF A;  1U5T C;  1R23 A;  3HZJ A;  1MBG A;  2M7B A;  3HM5 A;  1SD6 A;  2E35 A;  5FLX K;  3JRE A;  3OOU A;  3AAF A;  4Y4R A;  3P9C A;  2XUB A;  2KT0 A;  1U8R A;  3HJE A;  2ECB A;  2M30 A;  2OZ6 A;  1DP7 P;  5FKM A;  3HC7 A;  4M3F A;  2UZK A;  4BS9 A;  5BS6 A;  2BXZ A;  2OZU A;  2LOO A;  1Z6R A;  2M34 A;  2XRN A;  3H5R A;  2M8E A;  4M3B A;  1JT0 A;  3RQI A;  4ZTJ A;  3HXL A;  3DBH B;  3VFZ A;  3ZMD A;  4HF1 A;  2IEK A;  2ZXJ A;  5DCM A;  2R7R A;  1SD4 A;  1K4S A;  1CQT A;  2ZXI A;  3MKZ A;  5DCM B;  4RAZ A;  4BAC A;  4WX9 A;  4IHV A;  4XOR A;  1DGW Y;  1ZTR A;  4KA4 A;  1TL8 A;  2X6X A;  2FEZ A;  3HUG A;  1N77 A;  3HUG B;  2H6C A;  4AWX B;  1U5T B;  4RB1 A;  1FC3 A;  2KQR A;  2ZKZ A;  5KHD A;  4FAS D;  2A69 F;  3BG7 A;  2A6H F;  3R4K A;  2V1U A;  4E7J A;  4OMY A;  4XKB A;  2B9S A;  3RKQ A;  4ZYG A;  5IY5 H;  2GZW A;  2V6C A;  1XC5 A;  3GBG A;  1GT0 C;  2MH2 A;  4AID A;  2H1L A;  3E5Q A;  1MND A;  4AYB A;  1BIA A;  3H1C A;  2ZSH B;  3IKV A;  1WPK A;  2NYX A;  4G7H F;  3OYK A;  4KYW A;  3ULQ B;  4II3 A;  3TP3 A;  3ASO H;  2DTR A;  4N9H A;  4ETS A;  3GWZ A;  2MW8 A;  3E5X A;  3F8M A;  3LSJ A;  4MNU A;  5L3C A;  1QA6 A;  2BY1 A;  3C1D A;  3PL8 A;  4P96 A;  1ERD A;  5HLT A;  1W0U A;  2IAI A;  1IN7 A;  3KX2 A;  3WGI A;  3PO3 J;  1A6Q A;  2AS5 F;  2PJP A;  2KRF A;  3DKW A;  4E6K G;  2A05 A;  2NOJ B;  2C6Y A;  1B9N A;  4I0A A;  4DZP A;  2VQH A;  4XM3 A;  4ZYE A;  2IA1 A;  3O2P E;  1IRZ A;  2PMZ A;  1D8K A;  2R5Z A;  2MH9 A;  3V8J A;  1EH8 A;  2DDA A;  2R5Z B;  3K4C A;  2CSO A;  3M1C A;  1Q1H A;  2XGC A;  4HBL A;  5D5X B;  4YIF A;  4YEL A;  4A69 C;  1ZR4 A;  1Z6T A;  3QWL A;  2X6W A;  3K7A J;  1APL C;  2LF7 A;  1B9M A;  3LFK A;  2BOL A;  1ENH A;  4A3F J;  1Z05 A;  2GQQ A;  2JPC A;  4HSR A;  1F36 A;  3N97 A;  1W4M A;  2V1D A;  2XRO A;  3J7A Y;  2VIX A;  4E7S A;  4J19 A;  4A6D A;  2HTS A;  5M5Y J;  3HKZ A;  3H3V K;  4AYB N;  2QEN A;  5M5W J;  4OIP F;  2FRH A;  2DBB A;  2HYJ A;  5IPA A;  1ETK A;  4BE1 A;  1Z67 A;  2FOW A;  4G7O F;  4Y7N J;  3H92 A;  4N0B A;  3HIF A;  1IN5 A;  1JUM A;  4ZH4 F;  1ZRD A;  1X3W B;  1N25 A;  2K3F A;  2X51 A;  3L00 A;  4BHB A;  2B7E A;  4IRG A;  3KEY A;  4AIJ A;  3HRS A;  4A2U A;  2PX9 A;  3F6V A;  2A68 F;  3OYM A;  1ZG5 A;  4A3C J;  1V54 H;  2CRG A;  1XSX A;  3OS2 A;  1UEL B;  5J8C A;  4EJU A;  2X1E A;  1YJW I;  1WI9 A;  1W36 C;  5ICE A;  5DDG A;  3ABM H;  1T56 A;  3V7R A;  1QQI A;  5E20 A;  2ZJP F;  2EIK H;  1GXQ A;  2E1M B;  5CJ9 A;  1MBE A;  2HR3 A;  5L3G A;  2L02 A;  1H88 C;  2CWE A;  3IL2 A;  4HX4 A;  2ZO4 A;  2R5Y A;  3JCU C;  3ZMZ A;  4AVP A;  4CIC A;  2R5Y B;  3K9T A;  4OAZ A;  2W85 A;  2DA3 A;  1VQ4 I;  2MC4 A;  1D5Y A;  2IGK A;  2DPD A;  2M8G X;  1JKQ C;  3KEO A;  3V7C A;  2CGP A;  1MJ9 A;  1XTA A;  2VN2 A;  2NS8 A;  2O61 A;  1P9Q C;  3FXK A;  3K4L A;  3LA3 A;  2E60 A;  4RGX A;  4HX8 A;  3ZQ7 A;  2VE9 A;  1ONV A;  2IPQ X;  1Z77 A;  4F55 A;  2O8X A;  1MMS A;  3T8T A;  3CC7 I;  3RDI A;  4PCQ A;  2FD5 A;  3WHC A;  1FOX A;  3KZI C;  5EZG A;  1I50 J;  2DOF A;  2HOS A;  2CW8 A;  4G6T B;  3AG1 H;  4KIT B;  3D1N I;  3U9G A;  1ZGA A;  3VYU B;  5L3B A;  3F8C A;  3GLX A;  3BG5 A;  1S7A A;  5F08 A;  1E3H A;  1OMI A;  1D0Z A;  1LDJ A;  4XRS A;  3ZQH A;  2F5D A;  3VB2 A;  1HOM A;  2W25 A;  1BI1 A;  3BWG A;  5H6Q A;  4XOT A;  2BHY A;  2EJR A;  1RZ4 A;  3D0S A;  2WAE A;  4BJT A;  2YSR A;  3LSM A;  1O3T A;  2NVY J;  3BPV A;  1TT5 B;  2XAQ A;  3OYG A;  4MQ9 F;  3VYR B;  1ON1 A;  4FTH A;  2E36 A;  4IQJ A;  5HS7 A;  2MC3 A;  1W7P D;  3B73 A;  4A12 A;  1Y0U A;  2R7D A;  4JX4 A;  1DDN A;  3BQY A;  4EJW A;  1HLV A;  2K4B A;  4XLA A;  4DOZ A;  5KK1 A;  1VQ5 I;  4IX7 A;  4L9J A;  1U0J A;  1I27 A;  4OMZ A;  4M9X A;  2CV1 A;  4ITV A;  2R93 J;  4IQ4 A;  4WXH A;  3G6E I;  1ZG3 A;  4W1U A;  2DOE A;  5J4V A;  2VI6 A;  1BR1 A;  1FBQ A;  2IGN A;  2LY1 A;  2KL4 A;  1VFC A;  2FU4 A;  2F4O B;  1IRX A;  1QVU A;  2E2H J;  3K2Z A;  4EM2 A;  1BW5 A;  1QO0 D;  2UWM A;  5H6R A;  4PDK A;  3OL4 A;  1X1P A;  4XLN F;  1IUF A;  1F9N A;  2KDO A;  1WHU A;  5LHG A;  2VC1 A;  4XKC A;  4U0Y A;  2ACJ A;  2LSO A;  2Q2E A;  4MO7 A;  4IOC F;  1ZG1 A;  2R7W A;  2ZNY A;  2BVL A;  5GAH J;  5FLM J;  3S2D J;  1JI8 A;  1ETX A;  1G3T A;  4E70 A;  2QSH X;  2A6E F;  1KA8 A;  1E3P A;  1R00 A;  1WI3 A;  1H9G A;  4ABZ A;  4XIC A;  3EDP A;  2D2W A;  5B1A H;  3CO6 C;  2HQ5 A;  1IZ1 A;  2W82 A;  3UNG C;  1Y8R B;  3PQJ A;  4PFP A;  1R1U A;  1ZH5 A;  4M71 A;  3CLQ A;  4AC0 A;  1WJB A;  4BH9 A;  2DFH A;  3WHB A;  4HDU A;  1J2X A;  5GAD J;  1IRG A;  5ICG A;  5F1J A;  2ZJ2 A;  3C7J A;  4RGS A;  2EIM H;  2HU9 A;  4LLG F;  2R7T A;  3CJR B;  5FLV A;  3MN2 A;  3KP4 A;  4D7N A;  1T0F C;  1VTN C;  4QSH A;  3L2U A;  3FXU A;  2KIQ A;  1VQ7 I;  2BXY A;  1MJB A;  4R8H A;  5E3M A;  2JVH A;  2XGE A;  1JTX A;  2MLK A;  3OYD A;  4ZYH A;  5JHF A;  1S5L C;  1MKM A;  4LK0 F;  2M9H A;  1MD0 A;  2EIN H;  2FBK A;  2KZV A;  3HPH A;  1JKO C;  1VQ6 I;  3RI4 A;  3HBL A;  2DOA A;  1J75 A;  2HDD A;  4KT6 A;  2EA4 A;  2DI3 A;  2HXO A;  2YU3 A;  2YPR A;  2KFD A;  5E3N A;  1RIO H;  1U9O A;  2DFE A;  2A07 F;  4LG3 A;  2EIJ H;  5TIS C;  2L7Z A;  1T0F A;  2X6O A;  2TCT A;  4Q47 A;  1HW5 A;  4ESF A;  3WTS C;  4HRI A;  2QEX I;  4BJ5 C;  4A5N A;  4EEF G;  5HLH A;  4FCY A;  1HSJ A;  3TO9 A;  2E1O A;  2DJN A;  1AA7 A;  1LNW A;  5GAE J;  3O6B B;  4Q5S F;  4PJL A;  2XPV A;  2P7V B;  3MD2 A;  4JQF A;  4XKV A;  2PI0 A;  4U7D A;  2EV0 A;  3K1N A;  3CCS I;  4F91 B;  4PJ0 C;  2NNN A;  2X4H A;  3CJQ B;  1J09 A;  2ESN A;  3EUH C;  3KZZ A;  3ZQL A;  2DAO A;  2ID3 A;  5JHU A;  1TTY A;  2IP2 A;  3ESW B;  3QYB A;  3ZMU A;  2VJ4 A;  1Q1V A;  1PJR A;  3DTK A;  4E7Z A;  4AIK A;  4P1W A;  5F0F A;  4FE7 A;  1KQ8 A;  3S1N J;  3SXY A;  4F3Q A;  2OQG A;  1ZR2 A;  1PP7 U;  1W1W E;  1U6G A;  4Z6Y A;  1MGT A;  3AG2 H;  4D7M A;  2NNY A;  3BG3 A;  4A6E A;  3COA C;  1TWF J;  2GXG A;  2W24 A;  3FXJ A;  1P92 A;  3JSO A;  3S15 J;  3PUF A;  2K9N A;  3BR0 A;  5CQG A;  3FDY A;  1U78 A;  4KIF A;  4RM2 A;  4B4C A;  4GCV A;  4F92 B;  1TNT A;  3AFH A;  1E17 A;  3PUB A;  2CQ7 A;  1PP8 F;  2K7L A;  5FKL A;  2NOG A;  2Z2S B;  5EEG A;  1G6N A;  3Q0V A;  1WJA A;  2R7S A;  3CF2 A;  2OPT A;  3WG9 A;  1YIT I;  5HVQ C;  4C9Y A;  2DTZ A;  2ZBK A;  4IF4 A;  2Y30 A;  2OCE A;  1BI2 A;  2FOK A;  1XB4 A;  3UKG A;  4HDV A;  1LJ9 A;  3MZY A;  4HPQ A;  4BU2 A;  4O3M A;  3E6C C;  3V8K A;  2MBF A;  1IJW C;  3CC2 I;  1SFK A;  2HQN A;  4U0W A;  2FA5 A;  1IF1 A;  2RRE A;  1WQ2 A;  1LFU P;  3J80 Z;  3HOW J;  5D8L B;  2HPM A;  2BY0 A;  2KP6 A;  3WTY C;  3K69 A;  1WSU A;  1LPQ A;  2JPB A;  2L54 A;  3SDB A;  1R6R A;  2VBX A;  5GTH C;  1ON2 A;  4BQN A;  3CCM I;  3BDD A;  1YG2 A;  1ETW A;  4M9S A;  1TQP A;  1A5J A;  2DW4 A;  4H4K C;  4CCN A;  1WJE A;  3M7G A;  3WTT C;  1UZC A;  2V9P A;  2L9R A;  3U1D A;  3GME A;  1XMA A;  2XGD A;  2F5V A;  4ESJ A;  3KCC A;  4BL0 B;  3J80 K;  1JKR C;  1YJN I;  3K70 D;  3Q3S A;  1YFH A;  2LFB A;  5DD4 A;  4MLO A;  3JRD A;  1S9H A;  3I9V 2;  2M4K A;  3M8E A;  4EM1 A;  3ECH A;  4QIW N;  2RDP A;  1MBF A;  4OIN F;  2HNH A;  1ZGW A;  4A3G J;  1JHH A;  1RET A;  1FWZ A;  4Y13 A;  4GGG A;  1AWC A;  4E4H A;  1R5G A;  1SMY F;  4IRH A;  5KAI C;  3H5N A;  4FT8 A;  4XK4 A;  4AUX A;  2KIF A;  1B4A A;  2EFN A;  4H0E A;  3HYI A;  4XRS G;  2TDX A;  3ELK A;  2DA2 A;  3GUD A;  3REO A;  2EZL A;  2DA7 A;  2RN7 A;  2BY2 A;  3O8G A;  3V42 A;  1R58 A;  2Y69 H;  1SVM A;  3GTG J;  1RPW A;  5FKN A;  2R7V A;  2LG4 A;  5FFX A;  3CCQ I;  2MFZ A;  3LA2 A;  1AU7 A;  4BXF A;  4RAF A;  5IP6 A;  1WJF A;  3E0J B;  3IAS 2;  1S8N A;  1YRN B;  2EQR A;  5IP9 J;  3W6V A;  2EFP A;  1LVA A;  3F23 A;  1VND A;  4GO1 A;  3SJM A;  4OIR F;  1YHQ I;  1S72 I;  4BHP A;  4M6V A;  5CYV A;  3SZP A;  4ZTF A;  4RS8 A;  1OCZ H;  5B3S H;  4BYY A;  2L7F P;  1BM9 A;  3TW7 A;  4XLP F;  3MFK A;  3L2Q A;  2CG4 A;  3KEQ A;  1XCB A;  2JUG A;  1L3L A;  4YG2 F;  3AG3 H;  2HDW A;  1G2H A;  2JA2 A;  3Q9S A;  1DU0 A;  4LB5 A;  3BQZ A;  2R3S A;  1PVE A;  3FKJ A;  2VPL A;  3TO7 A;  2GAU A;  3A1Y A;  1BR4 A;  3TDU C;  3S17 J;  3GZ5 A;  2GM4 A;  1R22 A;  4EGZ A;  2H94 A;  5FRN A;  2W48 A;  1UCR A;  4BHC A;  1QHG A;  1MNE A;  3H9Q A;  3VEP A;  3ZPL A;  1T39 A;  1IXC A;  4PJN A;  2AHQ A;  4S04 A;  1I1S A;  4NBQ A;  4PGG A;  2XPU A;  4FX0 A;  1TLH B;  2BV6 A;  3DFG A;  1R9T J;  5HLI A;  2STT A;  2M7A A;  3GZN B;  3ERM A;  4LGW A;  3F6O A;  4DW6 A;  4BQQ A;  4ZDP A;  3KLN A;  2O9L A;  4XL9 A;  4UNO A;  1G3S A;  3CMY A;  4FIS A;  3BRO A;  2FNP A;  4EQQ A;  1P4A A;  3J7Z I;  1XSD A;  3DF8 A;  1P7I A;  2HVQ A;  4V2G A;  4UY8 I;  2VOP A;  4YII A;  2XPW A;  4CYD A;  4CO8 A;  4QTR A;  1R4M B;  1QGP A;  5E1W A;  2XRL A;  2F6C A;  2UXX A;  4LLN A;  1HKS A;  1ULY A;  2M3A A;  4LMY A;  2M4G A;  2P4W A;  4A0Y A;  2QKM B;  3MZ8 A;  2M0M A;  2QSG X;  3WU2 C;  4RAG A;  3KP5 A;  5L3F A;  1GHC A;  1A6I A;  1KU2 A;  3A02 A;  2IS4 A;  1QU3 A;  2KIM A;  3MKW B;  1LQ1 A;  3LL7 A;  2V1X A;  3FHN A;  5KAF C;  2V4J C;  3VOD A;  4ZZL A;  5HOD A;  2RGV A;  1AHD P;  3JRH A;  1ZN2 A;  1MMG A;  3CUO A;  1VQ8 I;  4XLF A;  3GTP J;  2R7F A;  3G1L A;  1MZB A;  3JRG A;  5JR3 A;  2I5U A;  1RUN A;  5DCF A;  1TWG J;  1FZP B;  1NG6 A;  4HNU A;  4I02 A;  3CME I;  4Y52 J;  2H6B A;  2HKO A;  3DU6 A;  2MD0 A;  2OJE D;  3GTO J;  3BZC A;  4ZJZ A;  4BE2 A;  4B3A A;  4BUP A;  5EEH A;  1IXR C;  3MVP A;  2VQG A;  2HVS A;  3ZQC A;  2NVQ J;  4EGY A;  3BP8 A;  3QOE A;  4HEA 2;  4BJ6 C;  1LEB A;  1U5T A;  3G71 I;  2HZD A;  2VON A;  4O6J A;  4HLY A;  1W36 D;  5FFZ A;  4I09 A;  2P7C B;  2XSD C;  1Z7L A;  1HXD A;  5LGN A;  3A01 B;  1S7O A;  5BMZ A;  3CMM A;  1FSE A;  4X0G A;  4RB3 C;  4NC8 A;  4HG2 A;  3B6A A;  4Q48 A;  3CZ6 A;  3F72 A;  2XB5 A;  4EMS A;  3GCM A;  3ZQG A;  2FSW A;  3E5U A;  1ZAO A;  4XQF A;  4RB2 C;  2DA4 A;  3F3X A;  2WBM A;  1A36 A;  2VXD A;  5BOX A;  1OCC H;  2VB6 A;  2L5Q A;  3PM1 A;  1IV6 A;  3RYR A;  3KP2 A;  2OU2 A;  1IN4 A;  2ICW G;  2DK5 A;  3B02 A;  3GVA A;  4BXX J;  3AG4 H;  3WOD F;  2LNB A;  4L9V A;  4P5O A;  5DEQ A;  3PO2 J;  1E2X A;  3EQL F;  3OYC A;  2XAJ A;  4XMY A;  3LQR A;  2QQA A;  1TBX A;  3I4P A;  1J0R A;  4CCM A;  5D5U B;  2D45 A;  1KQ0 A;  2QZ8 A;  2EH3 A;  4B8X A;  3JAM K;  1FOW A;  2LK2 A;  2L7K A;  3H0D A;  2OC6 A;  3ERE D;  1MMD A;  2KRH A;  3BTI A;  3OYN A;  1TT0 A;  2E1C A;  1ZKG A;  5DS9 A;  4CYC A;  1HC8 A;  1SEU A;  4I0B A;  4DQ2 A;  4ZYD A;  4CYC B;  3BR6 A;  2FNA A;  1UST A;  2X1C A;  1YOV B;  5J6X A;  4B43 A;  1IDY A;  2JA7 J;  1Z1D A;  3H35 A;  3HTU A;  1XX5 A;  4KIG A;  4FX4 A;  4UVB A;  4Y33 A;  2WAQ A;  1F5T A;  2V9K A;  2NVU B;  4IXA A;  4I99 C;  3E7L A;  3GX4 X;  4EJT A;  1ZYR F;  1IO2 A;  2FMY A;  1U9N A;  4P55 A;  1XPX A;  4C3H J;  2ADU A;  2P5L C;  3MZH A;  3WE2 A;  1IAW A;  1FLI A;  2E5N A;  1HW2 A;  3IKT A;  2PJR A;  3OYF A;  2DMP A;  4GYG A;  4F7Z A;  2PJR B;  1UJ8 A;  4UXN A;  2L0K A;  3I4N J;  3SFI A;  1NHA A;  1WJD A;  2Z3Y A;  2ZFU A;  3D5R C;  2JRT A;  2KIS A;  3CTA A;  1RR7 A;  2B0L A;  2GOX B;  3RIR A;  3OSG A;  3FM5 A;  2DA5 A;  4UUT A;  1OKR A;  4MIM A;  1U3E M;  3TP0 A;  1WRJ A;  3HGG A;  2QGU A;  4XRM A;  3VYS B;  1NG7 A;  3AL0 C;  4OWR B;  3FBI B;  3CES A;  3NWT A;  2H09 A;  2NS7 A;  2F4M B;  1POG A;  2LTP A;  4IVN A;  4M72 A;  5BPD A;  3F9K A;  5HLG A;  2FQ4 A;  1OIS A;  2O7O A;  3SDG A;  5CVV A;  4BNC A;  4CCK A;  5FB2 A;  1BR2 A;  2M5W A;  5D6F A;  1BBY A;  3QU6 A;  5CKT A;  4B48 A;  3GTQ J;  1LB2 A;  4AU7 A;  2AXT C;  4NDL A;  1FYL A;  2WAQ N;  3GFL A;  3D5L A;  3HB9 A;  5DTD A;  2EFO A;  3A03 A;  2EBI A;  3BC8 A;  4RLQ A;  2ZXW H;  1BOB A;  1Z91 A;  2FX0 A;  4G9Y A;  3E6B A;  4PJJ A;  5D6E A;  2X85 A;  3CCL I;  2DT7 B;  5E8I A;  5IOZ A;  3S16 J;  3A0H C;  2CU7 A;  5LEJ A;  2P8T A;  2Y9Z A;  4E7I A;  3AL0 B;  1FY7 A;  2XAH A;  2JVG A;  1YS7 A;  2KKO A;  2JT1 A;  3RKW A;  1G59 A;  2ISY A;  5EF6 A;  1HF0 A;  2W4S A;  3FXM A;  3OS1 A;  3JRA A;  3HPG A;  2XAS A;  4G6Q A;  2RVC A;  3S93 A;  1IW7 F;  1XDS A;  2WY7 Q;  2VQC A;  4NQW A;  2QQB A;  3IH3 A;  3MEX A;  4WXC A;  5J47 A;  4NQW B;  1K78 A;  1SVL A;  2Y48 A;  3KET A;  4ZDO A;  2LYC A;  1K78 B;  1VQN I;  1X3Z B;  3DP7 A;  3R6S A;  1WH5 A;  2FML A;  1RKT A;  1WVR A;  4KN7 X;  1VZ0 A;  5J40 A;  1R5I D;  2JUC A;  1X1D A;  1ETV A;  4Z2Y A;  4BAY A;  1BW6 A;  3NAR A;  2Y31 A;  5AIQ A;  2VKV A;  2CQX A;  1O4X A;  2ETH A;  3CP2 A;  3VDX A;  3FMQ A;  4FQG A;  4OU0 A;  1UMQ A;  1E0E A;  2GA2 A;  4G94 A;  4V19 K;  2HS5 A;  3S8P A;  4A3D J;  5J8F A;  1GLN A;  3BOQ A;  3RJP A;  2WB1 A;  3N05 A;  3HOX J;  1LKX A;  3ZQI A;  4IHX A;  3HEF A;  4OAY A;  1DU6 A;  3QAH A;  3ZCO A;  3BCB A;  2L7M P;  1QZZ A;  3A0B C;  1VQM I;  3HL2 A;  5C44 J;  4IPA A;  2BZT A;  3LSG A;  2ELH A;  4LK1 F;  2HOT A;  2HZT A;  5LGU A;  2PEX A;  1S7E A;  1FYK A;  5ILU A;  3EPZ A;  1G3W A;  5E3L A;  2FBI A;  4EAT A;  4EV0 A;  2G9W A;  2JA6 J;  2JZY A;  4RA2 A;  3NAU A;  2LBF B;  4U0V A;  1R7J A;  4UB8 C;  1EJ9 A;  2K40 A;  2PN6 A;  1SD5 A;  2LKX A;  4UB6 C;  3EET A;  3ZOB A;  4O5V A;  2E19 A;  2YU9 J;  4WXD A;  4A3I J;  1T2K A;  1XN7 A;  2IXS A;  3TED A;  5GTI C;  3HSF A;  1FSH A;  2DJI A;  2V1N A;  5TGT A;  1IRF A;  1FBU A;  4IEJ A;  5H20 A;  4LG0 A;  4BDY A;  4L5E A;  3GW2 A;  5KVR A;  1WZ2 A;  4E7L A;  2O0Y A;  4LG0 B;  5DUK A;  2CUJ A;  2NRA C;  3HSE A;  4KIB A;  3A2K A;  2COM A;  1X3U A;  2WB1 N;  2JSC A;  3GEZ A;  1PDN C;  1V55 H;  3IV5 A;  5LRS A;  4WF2 A;  1CF7 A;  1QPM A;  2F5E A;  2E1N A;  3FK6 A;  4IZZ A;  1CF7 B;  1JXS A;  1OQY A;  2JRM A;  1D0Y A;  2GBY A;  2EPF A;  3LNQ A;  2ZNZ A;  2X1D A;  3CP8 A;  3TBI A;  4B3X A;  3GFM A;  3QRF F;  3L2C A;  2F5F A;  2LC2 A;  2L4M A;  1EKE A;  4HAM A;  5LLQ A;  3KPH A;  5HDK A;  2Z9O A;  2JSP A;  2EFQ A;  3DKY A;  3MMY B;  4OIO F;  4PZJ A;  5DM7 F;  5HS9 A;  3VWB A;  3BZ6 A;  5CVU A;  3X2Q H;  4TV7 A;  4XR6 A;  4CZZ A;  1QPI A;  2K9L A;  2DCE A;  4UVC A;  3WTW C;  4AM3 A;  3F21 A;  3MKL A;  2JMW A;  3B6C A;  2Y2Z A;  1TZL A;  1X58 A;  1D0X A;  3CDI A;  2QWW A;  2TRT A;  3I64 A;  4PK4 A;  3WGG A;  3F8N A;  3DXJ F;  1ZGJ A;  1ZK8 A;  4UVA A;  2QF7 A;  9ANT A;  1SFU A;  3LOC A;  1T8I A;  4AIH A;  1I6X A;  5JLX A;  3G4S I;  5E79 C;  3BLY A;  3IWF A;  1FTT A;  5DYM A;  2JA8 J;  2JQ7 A;  2L2O A;  3OL3 A;  2LKS A;  3K4B A;  2CYY A;  2K4J A;  3GXO A;  2M2E A;  1DQU A;  4DYC A;  4XON A;  1YW7 A;  3OY9 A;  3LFU A;  3L7W A;  3ZGK A;  4EJO A;  5ICF A;  2NAZ A;  4L0Z B;  3TMO A;  1RES A;  4DGW B;  1JGG A;  1L0O C;  3KYD B;  3RZO J;  3D5S C;  1S3J A;  1YS6 A;  3L1P A;  1R36 A;  2E7X A;  3LA7 A;  3W6K B;  2K9S A;  4M74 A;  3KP6 A;  4GXO A;  4AVZ A;  4ZYA A;  2OAZ A;  3IUO A;  2KJC A;  5ILV A;  2BYV E;  3U21 A;  1D5V A;  1OJL A;  2DU9 A;  3SZG A;  3K1P A;  1XCV A;  5GP9 A;  2EZK A;  5HNH A;  3W3C A;  2QM3 A;  5CVI A;  1MSF C;  1ZQ3 P;  3IP4 B;  3I3L A;  4U7B A;  2LKP A;  2LRE A;  2UUZ A;  4UV8 A;  1XDU A;  3BG6 A;  4ON0 A;  2UV1 A;  1QZE A;  4LB6 B;  4A0X A;  1RR8 C;  1X4P A;  2HVR A;  3DQV C;  1W7P B;  3ROU A;  1BJZ A;  3EUH A;  4DBQ A;  1D3Y A;  3CCV I;  1VQL I;  5TRD A;  2A5Y B;  1XS9 A;  2Z33 A;  4MGR A;  3O3K A;  3WU0 A;  4G7Z F;  4DZJ A;  3CCU I;  1H89 C;  1JJ6 C;  4XN0 A;  4EJV A;  1DPU A;  1YE9 A;  1OYI A;  3CO7 C;  2RNG A;  1UG2 A;  1TWC J;  2WTE A;  4I7H A;  2IGO A;  3VYT B;  5HS8 A;  3QOP A;  1AOY A;  3I0T A;  2QSF X;  2VKE A;  5J1U A;  5L3D A;  5GPC A;  3FWE A;  3H9G A;  3DPL C;  2M87 A;  5BNG A;  2YUS A;  2ZME C;  2K9Q A;  2KRC A;  5F27 A;  4D0P A;  3S3M A;  1YJ9 I;  2EA2 A;  3SZT A;  2GLO A;  4A3L J;  2P6T A;  3K4M A;  4BEH A;  3CMA I;  1Z9C A;  4A3E J;  2R0Q C;  1TNS A;  4BEH B;  2HYF A;  1H0M A;  2KHM A;  4ZZD A;  3GTJ J;  2BGC A;  3HRT A;  2K5C A;  2KPM A;  2QQ9 A;  2VXZ A;  4J01 A;  1NK2 P;  4ANJ A;  1FMV A;  1FX7 A;  5E3O A;  1DPR A;  1MDM A;  1C0W A;  1T08 B;  3I59 A;  1K61 A;  1I3A A;  2OD5 A;  1TW3 A;  1MDM B;  3T8R A;  2BEO A;  3I59 B;  1P4X A;  3WTX C;  4ENN A;  1R71 A;  3DU5 A;  4CXF A;  2UXN A;  1J9I A;  1K6O A;  4L0Y B;  3CDH A;  3TOA A;  2DXI A;  2ZME A;  2BY3 A;  1MBK A;  1FJL A;  5IT3 A;  1MBJ A;  2HPI A;  2ZME B;  2OF7 A;  1JE8 A;  5GAG J;  3CUQ C;  3OIO A;  4LIU A;  2CW0 F;  3IHU A;  3HDD A;  2Z5U A;  5EJC A;  1OYY A;  1EV7 A;  2J5P A;  1FIP A;  3SFZ A;  4A3J J;  4LIT A;  1YIO A;  3E97 A;  3H5A A;  4RB0 A;  5D4S A;  1VQO I;  4YFK F;  1IN6 A;  1ZLJ A;  2IA2 A;  2WAF A;  1Y39 A;  3NQO A;  5B1B H;  2AQF A;  4JYK A;  3ZRG A;  4WCG A;  3CD6 I;  4RAY A;  2A5W A;  1HCR A;  4HA8 A;  2WV1 A;  1B6A A;  4WWC A;  2MSY A;  3QOD A;  3S3N A;  1RKW A;  4DIQ A;  1U2W A;  3F22 A;  3G2B A;  3BZK A;  2ESH A;  3CJT B;  2XF6 A;  4CDG A;  1D1A A;  2K9M A;  2M0C A;  4BY7 J;  2FXA A;  3BR5 A;  3CUQ A;  2ZXH A;  3CLO A;  3CUQ B;  2CUE A;  5E18 F;  3G1M A;  5ED4 A;  2D1H A;  4C2M J;  3JTG A;  2QQ8 A;  2G7H A;  2K02 A;  2OBP A;  1YRN A;  4NC6 A;  1KQ9 A;  3J7Y J;  4CCL A;  3BY6 A;  2P6S A;  1YQA A;  1SAN A;  2NXN B;  2W84 A;  3L2W A;  3PFI A;  1VQ9 I;  1B59 A;  5IP7 J;  4GDF A;  4D1Q A;  3ML6 A;  1XD7 A;  3RYP A;  5D5W B;  2L3D A;  1G3Y A;  2XAG A;  1BC7 C;  1MSE C;  4JOM A;  1SAU A;  2DO7 A;  1YTY A;  3LSK A;  5J1R A;  3TQN A;  2PG4 A;  4FET A;  3S32 A;  3DTE A;  1Z7U A;  2Z1D A;  1DGR M;  2MG4 A;  4U87 A;  3VOE A;  1IDZ A;  1N75 A;  3UR3 C;  4QPO A;  5LHH A;  2K27 A;  3GFJ A;  1FPQ A;  4M3D A;  2CS3 A;  2DT6 A;  2HKX A;  2LMD A;  2NS0 A;  3RQ4 A;  3E6D A;  3CC4 I;  3HOZ J;  1K4T A;  1B8I B;  4A3M J;  2Y9Y A;  4JBA A;  2GOM A;  2ZC2 A;  4R79 A;  5F0H A;  2DQR A;  1YW8 A;  3OR1 C;  2W57 A;  2VT3 A;  1D1B A;  1D8J A;  3JR9 A;  1MNM C;  3P7N A;  3NRV A;  1OCR H;  2CUF A;  2P0W A;  5K5Q A;  3W2A A;  4L5I A;  1JHF A;  3K2A A;  1YLF A;  3ABL H;  1UHW A;  1ZRC A;  2W7N A;  3QP5 A;  4MFE A;  1MW7 A;  4XN3 A;  5HDN A;  2IVM A;  4ASN A;  3I5U A;  4XNF A;  3OYL A;  4OOI A;  2EK5 A;  4G8X A;  4RGR A;  3BR2 A;  1A31 A;  1WWX A;  3LAP A;  1WJC A;  5ICC A;  2DOD A;  2JN6 A;  2H8W A;  2L9N A;  3BG9 A;  2DK8 A;  3TL4 X;  2HFH A;  2OA4 A;  2WA0 A;  3QYE A;  2KDZ A;  1LEA A;  4BQO A;  3MQ0 A;  3IAM 2;  2XC7 A;  1PUF A;  3RKY A;  2GIZ A;  3ZP5 A;  3BTC A;  4C3I J;  4EM0 B;  4XBF A;  2HXI A;  2ECC A;  1PUF B;  3OWT A;  3LSI A;  4G12 A;  2O6G E;  2RQP A;  3C2B A;  3FK7 A;  1P2F A;  2E34 A;  1MH3 A;  3M8J A;  3FM3 A;  1MH4 A;  3DLA A;  3RPQ A;  5JVG F;  3MCZ A;  2V26 A;  4XLH A;  3KIO A;  2M1B A;  1O7F A;  3OYA A;  2N8G A;  2VBW A;  2J5O A;  3DBL B;  2I10 A;  3A4C A;  1HA8 A;  3DV8 A;  2O5R A;  4HF2 A;  1LFB A;  1E3O C;  4KUM A;  3CJN A;  3I54 A;  2JJ7 A;  3GF2 A;  4C30 A;  3U1K A;  2E5Z A;  1U8B A;  5EEA A;  4BKX A;  1Z0X A;  4N9I A;  1EA3 A;  3KE2 A;  4DYQ A;  3FBN B;  1WFX A;  1D1C A;  2D1V A;  1I1G A;  5FRO A;  3W2V A;  1USS A;  1G8X A;  1XMK A;  4ENM A;  2ISZ A;  3MKY B;  2RV8 A;  2EV5 A;  3IH4 A;  4I6Z A;  3TOB A;  1QHH D;  2DPU A;  2WWY A;  2VBY A;  1FEX A;  1FNN A;  3S14 J;  1X1B A;  2V7F A;  4MTE A;  4S0H B;  3CCR I;  3LAJ A;  1XGS A;  4A93 J;  3IRR A;  5FO5 A;  3A01 A;  1VQK I;  2CH0 A;  2EFW A;  5DD8 A;  1I5Z A;  3HG9 A;  4II2 A;  3PIP F;  4IO9 F;  5TJJ A;  4IKF A;  1X1A A;  2HWV A;  4I01 A;  4E7H A;  1VQP I;  2RNJ A;  4IL6 C;  2CMP A;  4ENK A;  3QYF A;  2AO9 A;  4QPQ A;  2Q8K A;  2X9D A;  1UB9 A;  3RKX A;  3JAM Z;  2IBD A;  1N78 A;  5BPI A;  1X2N A;  4BGD A;  2LY2 A;  4HV6 A;  2CW7 A;  1IUY A;  1XSV A;  3P5J A;  3JSP A;  4BE0 A;  4PFO A;  1SC7 A;  1F4K A;  5F1R A;  1X19 A;  4F52 A;  4BBS J;  3DEW A;  1NK3 P;  5LFA A;  1AKH A;  3RCO A;  2QUF A;  2AQE A;  4C2U A;  5JLW A;  4CGZ A;  2VOD A;  2VPR A;  1AKH B;  4QWQ A;  2R4G A;  5B66 C;  4MEY F;  3BTJ A;  5EDN A;  2NVX J;  4HNV A;  2CUZ A;  3DBR B;  5FJ8 J;  2K86 A;  2LH9 A;  1SFO J;  3CCE I;  3GLL A;  3V4G A;  2KIU A;  2E7W A;  3MWM A;  3P9I A;  1YI2 I;  2O03 A;  3RSN A;  1OCP A;  2BBY A;  3LWF A;  2I8D A;  1Z3Y A;  3VPR A;  4M6Y A;  3R0A A;  2HOA A;  3ZN1 A;  3FF5 A;  2Q1Z B;  4GRI A;  2ZJQ F;  2KLO A;  3HHH A;  3JRC A;  3U2R A;  3FXL A;  3GTL J;  1JUP A;  5D5V B;  4OIQ F;  1HKT A;  2PQ8 A;  1FP2 A;  1SD7 A;  4A5M A;  1UHS A;  4HW0 A;  4A3B J;  2VJ5 A;  1ZLK A;  1ETY A;  2QA4 I;  3EUA A;  3L2R A;  2EB7 A;  4HLX A;  3QP6 A;  1EH7 A;  2DQL A;  2MD5 A;  2X0L A;  1Z21 A;  4UV9 A;  1SFE A;  2DA6 A;  1ACI A;  1BJA A;  5EG0 A;  3KLO A;  1GUU A;  4KNY A;  5EG0 B;  4B1R A;  4HQM A;  3BPX A;  4XRF A;  2VT2 A;  3HOT A;  1SFX A;  1W5T A;  2E1M C;  2K3P A;  3P9K A;  2OCC H;  3QPH A;  4XSX F;  2FQ3 A;  1F1Z A;  1ODD A;  3C2G A;  1HW1 A;  1LDK B;  1OR7 C;  3DPT A;  3H3U A;  1SAX A;  3ONQ A;  3KYC B;  4M3E A;  2MA3 A;  3SHF A;  3Q9V A;  4PUS A;  3HOV J;  3DWL E;  4WK8 F;  1IC8 A;  1XMX A;  2XKP A;  2DMT A;  4RBO A;  4M9Z A;  2L9S A;  1T95 A;  4PJM A;  1X2M A;  2DDB A;  2DMQ A;  1ZRE A;  3PSF A;  4LJZ F;  3GTK J;  1K6Y A;  5B5E C;  1I3Q J;  2E71 A;  2XVC A;  1OCO H;  1V3F A;  3IRQ A;  3DLL F;  2XIG A;  2P5V A;  1GV2 A;  5E1X A;  3ABU A;  2CFO A;  4HNT A;  4JX5 A;  2PMZ N;  3HRU A;  1RUO A;  4K2E A;  1HKQ A;  5IT9 Z;  1OFC X;  2OQR A;  4MFD A;  3WTZ A;  3QU3 A;  3NEU A;  5EGO A;  3K4J A;  4KT5 C;  3ZN0 A;  5EGO B;  4LOC A;  3SQN A;  1FIA A;  1QVT A;  1OR7 A;  1WCM J;  2HI3 A;  2P81 A;  2MLG A;  2QKL B;  5J1Y A;  1QBJ A;  2H27 A;  4X6A J;  1VF9 A;  1UFM A;  2CFX A;  2VC0 A;  2VBZ A;  3LMM A;  1J7K A;  1R4N B;  4MTD A;  3FMR A;  4UHT A;  2GIV A;  3GTM J;  4NHJ A;  4IHS A;  4D5C A;  5IT9 K;  4RGU A;  1KU7 A;  2HOE A;  5FGM A;  2ZCW A;  2IS2 A;  4HOB A;  3HKZ N;  4LFU A;  4C3J J;  3T1B A;  4LD5 A;  2PLY A;  4QLC U;  1XGN A;  3C2H A;  3R61 A;  4M6X A;  1R5H A;  1G4D A;  4EVI A;  2Q0O A;  3E1S A;  2GXA A;  1R49 A;  3CQZ J;  4UUS A;  2F5C A;  2FE3 A;  5JI6 A;  1J59 A;  1PUE E;  5GPA A;  1FP1 D;  4UUS B;  2QLZ A;  1IV8 A;  1REP C;  3IWZ A;  1GDT A;  3E3V A;  4N4N B;  1FTZ A;  3C18 A;  2X48 A;  2Y75 A;  1IN8 A;  2EIL H;  2D5V A;  4ZC3 A;  1OLT A;  2FUG 2;  4GFB A;  3PNV A;  3V8L A;  3M07 A;  4D5F A;  4P9U A;  5C3E J;  3T5X A;  3S2H J;  2BHZ A;  2VJJ A;  3DEE A;  5HDG A;  3M8F A;  2MYS A;  1ZEL A;  1ZRF A;  3ZR8 X;  2R7Z J;  1YX3 A;  2G0E A;  3DKX A;  3ZQQ A; 
#chains in the Genus database with same CATH homology
 2XGX A;  1B1B A;  4YFX F;  1UHM A;  3GO5 A;  1RNL A;  2IRF G;  3ECO A;  3OV8 A;  3WTV C;  1BN5 A;  1DUX C;  4HZF A;  3ISP A;  5K5O A;  3W6J B;  4M73 A;  3R60 A;  5K1Y A;  2P5K A;  2XAF A;  3ZMV A;  2G7U A;  2Z99 A;  5ILS A;  1K7A A;  5LGT A;  3S2W A;  1BI0 A;  2WV0 A;  4P9F A;  5DUI A;  3I58 A;  2V9V A;  3G73 A;  3BJO A;  4IHT A;  4FHT A;  1O7L A;  2YX4 A;  2CO5 A;  3HHG A;  3J7A O;  3T0Y A;  4MHG A;  2L4A A;  3TKY A;  3TGN A;  3TO6 A;  2O3F A;  5JVT A;  5LRR A;  3L9F A;  3V7S A;  2FBH A;  4HX7 A;  4I2O A;  2V79 A;  4YFN F;  3JTH A;  1T38 A;  2DFI A;  4JK1 X;  1KYZ A;  2PMU A;  1O3R A;  1QZY A;  3LQQ A;  5AIP A;  3ZMS A;  1CGP A;  3E6M A;  2YX7 A;  1R1V A;  2Y0M A;  2PBI A;  3FX3 A;  3N4M A;  3ZMT A;  3M1E A;  5CVR A;  1YW9 A;  4PGH A;  1K79 A;  4IJA A;  3M9A A;  2A3S A;  1T6S A;  3RTR A;  1XGO A;  1TQI A;  3MAJ A;  5K5R A;  5HOO A;  3HOS A;  3GYH X;  4BXU A;  3F8F A;  4ENJ A;  1KU3 A;  5LEK A;  2PFB A;  4IRI A;  1QNT A;  3EYI A;  1RI7 A;  2IJL A;  4KN4 X;  1W7P A;  4S05 A;  1OPC A;  3K1M A;  3KP3 A;  5AON A;  5L3E A;  3JW4 A;  2QYO A;  5D8K B;  1FT9 A;  1O3S A;  4LLL A;  1R1T A;  2RKH A;  3RPU A;  1JGS A;  2KJB A;  3Q5F A;  2JTV A;  3KFW X;  1S29 A;  1OYW A;  2EWN A;  3R0J A;  3HTS B;  3F8B A;  4BQA A;  4MQV A;  4L9T A;  4KMF A;  1T98 A;  1SMT A;  1YYV A;  5CLS A;  2IA0 A;  3PQK A;  3WTU C;  3KP7 A;  3GZ6 A;  5E1Z B;  3HSR A;  3I71 A;  1ZAR A;  2WC2 A;  3ABT A;  1J5Y A;  3FZV A;  5BQT A;  1IXS B;  1O3Q A;  2CQK A;  1GVJ A;  1HQC A;  2LF8 A;  4GYI A;  4NB5 A;  4L5J A;  4HQE A;  4AD9 A;  2QVO A;  2A61 A;  1TQM A;  5ERI A;  4HYE A;  1H9T A;  2IW5 A;  1A04 A;  2IT0 A;  5LHI A;  2DLL A;  4DNC A;  3IC7 A;  2ZFW A;  1WKM A;  5E17 F;  5D4R A;  3C3W A;  2HEO A;  4I98 B;  2BE5 F;  5LBQ A;  4R1H A;  1O57 A;  2HQR A;  2XKO A;  2DT5 A;  3BJA A;  2FF4 A;  3LST A;  2QBY A;  2QBY B;  3OOP A;  3WGH A;  3K0L A;  2M45 A;  6PAX A;  1BIB A;  1LDD A;  2HDC A;  3L09 A;  4B09 A;  5FD5 A;  3FHZ A;  1P6R A;  1EH6 A;  2RC4 A;  1FBS A;  3DEU A;  4MEX F;  5DV5 A;  2PMH A;  4Y15 A;  2GWR A;  1XGM A;  2GA1 A;  3QPT A;  1W5S A;  5A2Q Z;  2HTJ A;  3H3Z A;  5FD6 A;  1GXP A;  1KU9 A;  3TDZ C;  3EYY A;  2YR2 A;  1S6L A;  2F2E A;  3HRM A;  3FXR A;  1YO5 C;  2VE8 A;  1MJA A;  4CHU A;  4UUV A;  4KFC A;  3G3Z A;  5CVJ A;  5A2Q K;  1V4R A;  3WE3 A;  2VOO A;  1KYW A;  3KZY A;  2XHK A;  3FXQ A;  4KIC A;  3GFI A;  2XV4 S;  2GXB A;  4KMU X;  1BOA A;  4KDP A;  1BC8 C;  3J81 Z;  4HV5 A;  2L01 A;  4ESB A;  4XSZ F;  1BI3 A;  5E8G A;  2HGC A;  1STZ A;  3BJ6 A;  5F6F A;  4G6D A;  4A0Z A;  1KGS A;  4Y17 A;  2AXL A;  4Q4Z F;  1HST A;  3FMS A;  1HBX G;  3WU1 B;  4L18 B;  3J81 K;  5F64 A;  5FLX Z;  4L9N A;  1P4W A;  4U88 A;  1FYM A;  1FOK A;  2EV6 A;  2LDU A;  5JFR A;  4HF0 A;  1TW2 A;  2STW A;  3I53 A;  2HYG D;  1ZHF A;  1U5T C;  1R23 A;  1SD6 A;  5FLX K;  3AAF A;  3P9C A;  2XUB A;  1U8R A;  2M30 A;  2OZ6 A;  1DP7 P;  2UZK A;  5BS6 A;  2OZU A;  1Z6R A;  2XRN A;  2M8E A;  3VFZ A;  3ZMD A;  4HF1 A;  5DCM A;  2ZXJ A;  1SD4 A;  5DCM B;  4RAZ A;  4WX9 A;  4KA4 A;  3HUG A;  2FEZ A;  2H6C A;  4AWX B;  1U5T B;  4RB1 A;  1FC3 A;  2ZKZ A;  2A69 F;  2A6H F;  3R4K A;  2V1U A;  4OMY A;  4ZYG A;  2GZW A;  2V6C A;  2MH2 A;  3E5Q A;  1BIA A;  3IKV A;  2NYX A;  4G7H F;  4KYW A;  3ULQ B;  4N9H A;  2DTR A;  4ETS A;  3GWZ A;  3E5X A;  3F8M A;  4MNU A;  5L3C A;  3C1D A;  4P96 A;  1IN7 A;  3WGI A;  2AS5 F;  2PJP A;  2KRF A;  3DKW A;  2C6Y A;  1B9N A;  4I0A A;  4ZYE A;  2IA1 A;  3O2P E;  1D8K A;  2MH9 A;  3V8J A;  1EH8 A;  2CSO A;  1Q1H A;  5D5X B;  4HBL A;  4YIF A;  1Z6T A;  2LF7 A;  1B9M A;  3LFK A;  1Z05 A;  2GQQ A;  2JPC A;  3N97 A;  1W4M A;  2V1D A;  2XRO A;  4A6D A;  2HTS A;  2QEN A;  4OIP F;  2FRH A;  2DBB A;  4G7O F;  3H92 A;  4N0B A;  3HIF A;  1IN5 A;  4ZH4 F;  1ZRD A;  3L00 A;  4BHB A;  4IRG A;  4AIJ A;  3HRS A;  4A2U A;  3F6V A;  2A68 F;  1ZG5 A;  1XSX A;  5J8C A;  4EJU A;  1WI9 A;  5ICE A;  5DDG A;  3V7R A;  1QQI A;  5E20 A;  1GXQ A;  5CJ9 A;  2HR3 A;  5L3G A;  2L02 A;  2CWE A;  3IL2 A;  4HX4 A;  2ZO4 A;  3ZMZ A;  4AVP A;  4CIC A;  3K9T A;  2W85 A;  2DPD A;  3KEO A;  3V7C A;  2CGP A;  1MJ9 A;  2VN2 A;  2O61 A;  3LA3 A;  4RGX A;  4HX8 A;  3ZQ7 A;  2VE9 A;  1ONV A;  2IPQ X;  2O8X A;  3T8T A;  3RDI A;  4PCQ A;  3U9G A;  1ZGA A;  5L3B A;  3F8C A;  3GLX A;  1S7A A;  1OMI A;  1LDJ A;  2F5D A;  3VB2 A;  2W25 A;  1BI1 A;  3BWG A;  5H6Q A;  2EJR A;  1RZ4 A;  3D0S A;  2YSR A;  1O3T A;  3BPV A;  2XAQ A;  4MQ9 F;  1ON1 A;  5HS7 A;  2MC3 A;  1W7P D;  3B73 A;  4A12 A;  1Y0U A;  2R7D A;  1DDN A;  4EJW A;  2K4B A;  5KK1 A;  4L9J A;  4OMZ A;  1I27 A;  4M9X A;  4WXH A;  1ZG3 A;  1FBQ A;  2FU4 A;  3K2Z A;  4EM2 A;  1QO0 D;  2UWM A;  5H6R A;  4PDK A;  4XLN F;  1F9N A;  5LHG A;  2VC1 A;  2ACJ A;  4U0Y A;  2LSO A;  2Q2E A;  1ZG1 A;  2ZNY A;  1G3T A;  4E70 A;  2A6E F;  1KA8 A;  1R00 A;  1H9G A;  3EDP A;  2D2W A;  3CO6 C;  1IZ1 A;  3PQJ A;  1ZH5 A;  1R1U A;  4M71 A;  4BH9 A;  4HDU A;  1J2X A;  1IRG A;  5ICG A;  2ZJ2 A;  3C7J A;  4RGS A;  4LLG F;  3KP4 A;  1VTN C;  3FXU A;  1MJB A;  4R8H A;  2MLK A;  4ZYH A;  1MKM A;  4LK0 F;  1MD0 A;  2FBK A;  3RI4 A;  1J75 A;  2EA4 A;  2DI3 A;  2YU3 A;  2YPR A;  1RIO H;  2A07 F;  1T0F A;  4Q47 A;  1HW5 A;  4ESF A;  3WTS C;  4A5N A;  5HLH A;  1HSJ A;  3TO9 A;  1LNW A;  3O6B B;  4Q5S F;  2P7V B;  4JQF A;  2PI0 A;  4U7D A;  2EV0 A;  3K1N A;  2NNN A;  2X4H A;  2ESN A;  3KZZ A;  2DAO A;  5JHU A;  1TTY A;  2IP2 A;  3ZMU A;  4AIK A;  1KQ8 A;  3SXY A;  2OQG A;  1PP7 U;  1U6G A;  1MGT A;  2NNY A;  4A6E A;  3COA C;  2GXG A;  2W24 A;  1P92 A;  3JSO A;  1U78 A;  4KIF A;  4GCV A;  1TNT A;  1E17 A;  1PP8 F;  2K7L A;  5EEG A;  1G6N A;  3WG9 A;  5HVQ C;  2ZBK A;  4IF4 A;  1BI2 A;  2FOK A;  1XB4 A;  4HDV A;  1LJ9 A;  3MZY A;  4O3M A;  3E6C C;  3V8K A;  2MBF A;  2HQN A;  4U0W A;  2FA5 A;  1IF1 A;  1WQ2 A;  3J80 Z;  5D8L B;  3WTY C;  3K69 A;  1WSU A;  2JPB A;  2L54 A;  2VBX A;  1ON2 A;  1YG2 A;  3BDD A;  4M9S A;  1TQP A;  2DW4 A;  3M7G A;  3WTT C;  3U1D A;  1XMA A;  4ESJ A;  3KCC A;  3J80 K;  1YFH A;  5DD4 A;  3M8E A;  4EM1 A;  3ECH A;  2RDP A;  4OIN F;  1JHH A;  4Y13 A;  1FWZ A;  4GGG A;  1AWC A;  1R5G A;  1SMY F;  4IRH A;  4FT8 A;  2KIF A;  1B4A A;  2EFN A;  4H0E A;  3HYI A;  2TDX A;  3ELK A;  3GUD A;  3REO A;  2RN7 A;  1R58 A;  5FFX A;  3LA2 A;  1S8N A;  2EFP A;  1LVA A;  3F23 A;  4GO1 A;  4OIR F;  4BHP A;  5CYV A;  3SZP A;  4RS8 A;  4BYY A;  1BM9 A;  4XLP F;  3MFK A;  2CG4 A;  3KEQ A;  1XCB A;  1L3L A;  4YG2 F;  3Q9S A;  4LB5 A;  2R3S A;  3TO7 A;  2GAU A;  3TDU C;  3GZ5 A;  1R22 A;  4EGZ A;  2H94 A;  1UCR A;  4BHC A;  3VEP A;  3ZPL A;  1T39 A;  1IXC A;  1I1S A;  4S04 A;  4PGG A;  4FX0 A;  1TLH B;  2BV6 A;  3DFG A;  5HLI A;  2STT A;  4LGW A;  3F6O A;  3KLN A;  4UNO A;  1G3S A;  3BRO A;  2FNP A;  4EQQ A;  1P4A A;  1XSD A;  3DF8 A;  2VOP A;  4YII A;  4CYD A;  4CO8 A;  1QGP A;  5E1W A;  2UXX A;  4LLN A;  1HKS A;  1ULY A;  4LMY A;  2P4W A;  4A0Y A;  3KP5 A;  5L3F A;  1GHC A;  1KU2 A;  2KIM A;  1LQ1 A;  2V1X A;  3VOD A;  4ZZL A;  2RGV A;  1ZN2 A;  3CUO A;  2R7F A;  1MZB A;  5JR3 A;  1RUN A;  5DCF A;  1FZP B;  4I02 A;  2H6B A;  2HKO A;  5EEH A;  1IXR C;  4EGY A;  3BP8 A;  1LEB A;  1U5T A;  2VON A;  4O6J A;  4HLY A;  5FFZ A;  4I09 A;  2P7C B;  1HXD A;  5LGN A;  1S7O A;  5BMZ A;  1FSE A;  4RB3 C;  4Q48 A;  3F72 A;  4EMS A;  2FSW A;  3E5U A;  1ZAO A;  4RB2 C;  3F3X A;  5BOX A;  3RYR A;  3KP2 A;  2OU2 A;  1IN4 A;  3GVA A;  2DK5 A;  3B02 A;  3WOD F;  2LNB A;  4L9V A;  4P5O A;  5DEQ A;  1E2X A;  3EQL F;  2XAJ A;  3LQR A;  2QQA A;  1TBX A;  3I4P A;  1J0R A;  5D5U B;  2D45 A;  1KQ0 A;  2QZ8 A;  4B8X A;  3JAM K;  3ERE D;  2E1C A;  4I0B A;  4DQ2 A;  4ZYD A;  2FNA A;  1UST A;  5J6X A;  1Z1D A;  3HTU A;  4FX4 A;  4KIG A;  4UVB A;  1F5T A;  4IXA A;  3GX4 X;  4EJT A;  1ZYR F;  2FMY A;  4P55 A;  2ADU A;  2P5L C;  3MZH A;  3WE2 A;  1IAW A;  1FLI A;  1HW2 A;  3IKT A;  4GYG A;  4F7Z A;  4UXN A;  1NHA A;  2Z3Y A;  2JRT A;  3CTA A;  2B0L A;  3RIR A;  3FM5 A;  1OKR A;  1U3E M;  1WRJ A;  2H09 A;  4IVN A;  4M72 A;  5BPD A;  5HLG A;  5CVV A;  4BNC A;  5FB2 A;  2M5W A;  5D6F A;  1BBY A;  3QU6 A;  1LB2 A;  1FYL A;  3GFL A;  3D5L A;  2EFO A;  1Z91 A;  4G9Y A;  3E6B A;  5D6E A;  5E8I A;  5LEJ A;  2P8T A;  1FY7 A;  2XAH A;  1YS7 A;  2KKO A;  2JT1 A;  3RKW A;  2ISY A;  2XAS A;  4G6Q A;  2RVC A;  1IW7 F;  1XDS A;  4NQW A;  2QQB A;  3MEX A;  4WXC A;  1K78 A;  2Y48 A;  3KET A;  1K78 B;  3DP7 A;  3R6S A;  2FML A;  4KN7 X;  4Z2Y A;  4BAY A;  5AIQ A;  2ETH A;  3FMQ A;  4OU0 A;  2GA2 A;  4G94 A;  2HS5 A;  5J8F A;  3BOQ A;  3RJP A;  3QAH A;  1QZZ A;  4IPA A;  2ELH A;  4LK1 F;  2HZT A;  5LGU A;  2PEX A;  1FYK A;  5ILU A;  1G3W A;  2FBI A;  4EV0 A;  2G9W A;  2JZY A;  4U0V A;  1R7J A;  2PN6 A;  1SD5 A;  3EET A;  4O5V A;  4WXD A;  1T2K A;  1XN7 A;  3HSF A;  1FSH A;  1IRF A;  1FBU A;  5H20 A;  4LG0 A;  3GW2 A;  5KVR A;  2O0Y A;  4LG0 B;  5DUK A;  2NRA C;  3HSE A;  4KIB A;  2COM A;  1X3U A;  2JSC A;  3GEZ A;  1PDN C;  5LRS A;  4WF2 A;  1CF7 A;  1QPM A;  2F5E A;  2E1N A;  1CF7 B;  1JXS A;  2ZNZ A;  3GFM A;  3QRF F;  3L2C A;  2F5F A;  2L4M A;  4HAM A;  5LLQ A;  5HDK A;  2Z9O A;  2EFQ A;  4OIO F;  4PZJ A;  5HS9 A;  3BZ6 A;  5CVU A;  4TV7 A;  4CZZ A;  4UVC A;  3WTW C;  3F21 A;  2QWW A;  3I64 A;  3WGG A;  3F8N A;  3DXJ F;  1ZGJ A;  4UVA A;  1SFU A;  4AIH A;  1I6X A;  3IWF A;  5DYM A;  2CYY A;  2K4J A;  3GXO A;  1YW7 A;  3L7W A;  4EJO A;  5ICF A;  2NAZ A;  4L0Z B;  1L0O C;  1S3J A;  1YS6 A;  1R36 A;  2E7X A;  3LA7 A;  3W6K B;  4M74 A;  3KP6 A;  4GXO A;  2OAZ A;  2KJC A;  5ILV A;  2BYV E;  1D5V A;  2DU9 A;  3K1P A;  1XCV A;  2QM3 A;  5CVI A;  4U7B A;  2LKP A;  4UV8 A;  1XDU A;  4ON0 A;  4LB6 B;  4A0X A;  3DQV C;  1W7P B;  3ROU A;  3EUH A;  1D3Y A;  5TRD A;  2A5Y B;  2Z33 A;  4MGR A;  3O3K A;  3WU0 A;  4G7Z F;  4EJV A;  1DPU A;  1OYI A;  3CO7 C;  2WTE A;  4I7H A;  5HS8 A;  3QOP A;  1AOY A;  3I0T A;  5L3D A;  3FWE A;  3DPL C;  2M87 A;  4D0P A;  2EA2 A;  3SZT A;  2P6T A;  1Z9C A;  1TNS A;  2HYF A;  1H0M A;  4ZZD A;  2BGC A;  3HRT A;  2VXZ A;  2QQ9 A;  1FX7 A;  1DPR A;  1MDM A;  1C0W A;  3I59 A;  2OD5 A;  1TW3 A;  1MDM B;  3T8R A;  2BEO A;  3I59 B;  1P4X A;  3WTX C;  4ENN A;  4CXF A;  2UXN A;  1J9I A;  1K6O A;  4L0Y B;  3CDH A;  3TOA A;  2ZME A;  5IT3 A;  2ZME B;  1JE8 A;  3CUQ C;  2CW0 F;  3IHU A;  2Z5U A;  1OYY A;  1EV7 A;  2J5P A;  3SFZ A;  1YIO A;  3E97 A;  5D4S A;  4RB0 A;  4YFK F;  1IN6 A;  1ZLJ A;  2IA2 A;  3NQO A;  4WCG A;  4RAY A;  4HA8 A;  1B6A A;  4WWC A;  1U2W A;  3F22 A;  2ESH A;  4CDG A;  2FXA A;  3CUQ A;  3CLO A;  3CUQ B;  5E18 F;  5ED4 A;  2D1H A;  3JTG A;  2G7H A;  2K02 A;  2OBP A;  1KQ9 A;  3BY6 A;  2P6S A;  1YQA A;  2W84 A;  3PFI A;  1B59 A;  3ML6 A;  1XD7 A;  3RYP A;  5D5W B;  2L3D A;  1G3Y A;  2XAG A;  1BC7 C;  2DO7 A;  1YTY A;  3TQN A;  2PG4 A;  1Z7U A;  3VOE A;  5LHH A;  2K27 A;  3GFJ A;  1FPQ A;  2HKX A;  2NS0 A;  3E6D A;  4JBA A;  4R79 A;  2DQR A;  1YW8 A;  2W57 A;  2VT3 A;  1D8J A;  3P7N A;  3NRV A;  5K5Q A;  4L5I A;  1JHF A;  1YLF A;  1UHW A;  1ZRC A;  3QP5 A;  5HDN A;  2IVM A;  4ASN A;  3I5U A;  4OOI A;  2EK5 A;  4G8X A;  4RGR A;  1WWX A;  3LAP A;  5ICC A;  2DK8 A;  2HFH A;  2OA4 A;  1LEA A;  3MQ0 A;  3RKY A;  3ZP5 A;  4EM0 B;  4XBF A;  2O6G E;  2RQP A;  1P2F A;  3FM3 A;  3RPQ A;  3MCZ A;  2M1B A;  1O7F A;  2VBW A;  2J5O A;  3DV8 A;  4HF2 A;  4KUM A;  3CJN A;  3I54 A;  3GF2 A;  4N9I A;  3KE2 A;  2D1V A;  1I1G A;  1USS A;  1XMK A;  4ENM A;  2ISZ A;  2RV8 A;  2EV5 A;  3TOB A;  2DPU A;  2WWY A;  2VBY A;  1FNN A;  4MTE A;  3LAJ A;  1XGS A;  3IRR A;  5FO5 A;  2EFW A;  5DD8 A;  1I5Z A;  5TJJ A;  2HWV A;  4I01 A;  2RNJ A;  4ENK A;  2Q8K A;  1UB9 A;  3RKX A;  3JAM Z;  5BPI A;  4HV6 A;  1IUY A;  1XSV A;  3JSP A;  1F4K A;  5F1R A;  2QUF A;  4CGZ A;  2VOD A;  4QWQ A;  4MEY F;  2K86 A;  3V4G A;  2KIU A;  2E7W A;  3MWM A;  3P9I A;  2O03 A;  2BBY A;  3LWF A;  4M6Y A;  3R0A A;  3ZN1 A;  3FF5 A;  3HHH A;  3U2R A;  5D5V B;  4OIQ F;  1HKT A;  2PQ8 A;  1FP2 A;  1SD7 A;  4A5M A;  4HW0 A;  1ZLK A;  2EB7 A;  4HLX A;  3QP6 A;  1EH7 A;  2DQL A;  2MD5 A;  2X0L A;  4UV9 A;  1SFE A;  1BJA A;  3KLO A;  4KNY A;  4HQM A;  3BPX A;  4XRF A;  2VT2 A;  3HOT A;  1SFX A;  1W5T A;  3P9K A;  3QPH A;  4XSX F;  2FQ3 A;  1F1Z A;  1ODD A;  1HW1 A;  1LDK B;  3DPT A;  3H3U A;  1SAX A;  2MA3 A;  3SHF A;  3Q9V A;  4WK8 F;  2XKP A;  4M9Z A;  1ZRE A;  4LJZ F;  2XVC A;  1V3F A;  3IRQ A;  2XIG A;  2P5V A;  5E1X A;  3ABU A;  3HRU A;  1RUO A;  4K2E A;  1HKQ A;  5IT9 Z;  2OQR A;  3WTZ A;  3QU3 A;  3NEU A;  4KT5 C;  3ZN0 A;  3SQN A;  1OR7 A;  2MLG A;  1QBJ A;  2H27 A;  1UFM A;  2CFX A;  2VC0 A;  2VBZ A;  1J7K A;  4MTD A;  3FMR A;  4UHT A;  2GIV A;  4NHJ A;  4IHS A;  5IT9 K;  4RGU A;  1KU7 A;  2HOE A;  5FGM A;  2ZCW A;  4HOB A;  4LFU A;  3T1B A;  4LD5 A;  2PLY A;  4QLC U;  1XGN A;  3R61 A;  4M6X A;  1R5H A;  1G4D A;  4EVI A;  2Q0O A;  2F5C A;  2FE3 A;  5JI6 A;  1J59 A;  1PUE E;  1FP1 D;  2QLZ A;  1REP C;  3IWZ A;  3E3V A;  3C18 A;  2Y75 A;  1IN8 A;  3V8L A;  4P9U A;  3T5X A;  5HDG A;  3M8F A;  1ZRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...