1D8JA

Solution structure of the central core domain of tfiie beta
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
b'ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
molecule tags Gene regulation
source organism Homo sapiens
publication title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.
pubmed doi rcsb
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02186 TFIIE_beta TFIIE beta subunit core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d8jA00
5DEQA 3ISPA 3ECHA 4HV5A 4A12A 2Y0MA 4UNOA 4EMSA 4RAYA 4LB5A 3KP2A 1FYKA 1V3FA 2G7UA 4M72A 3ZN1A 1FWZA 4MQVA 1U3EM 1WQ2A 3QRFF 2WC2A 4HYEA 4BAYA 1JHHA 3S2WA 3I58A 1FOKA 2DK5A 1CGPA 3DF8A 4N9HA 1ZARA 2EV5A 2EFWA 4ENKA 4BYYA 2STTA 5ED4A 3COAC 4ESBA 4UV8A 2UWMA 1J9IA 2HTSA 1QQIA 3I59A 1MD0A 1BI0A 5E1ZB 2QBYA 2QZ8A 3GFLA 4LLLA 1T98A 1Z91A 1B1BA 2G9WA 4UV9A 2Q2EA 2QQAA 3WU1B 2GWRA 1LEBA 2XAQA 4KN4X 3B02A 3IL2A 3N97A 1PP7U 2ESNA 3IRQA 1KYWA 3MQ0A 1B9NA 3K1NA 1G3TA 3F6OA 2FBIA 3BY6A 1ZRCA 4KICA 1XSXA 3TOAA 3U2RA 4EGZA 3ERED 2ZMEB 1HW5A 4HBLA 1WWXA 4ZYGA 5L3FA 4M6XA 3FWEA 4YFNF 3FHZA 1YW7A 5AONA 1S29A 1D5VA 1IZ1A 4WF2A 4MEYF 2HOEA 3HSFA 4Q47A 4EJVA 2BGCA 3SZTA 2ISZA 3E97A 2Z33A 2Z5UA 3GZ5A 5EEHA 1G3WA 5ICFA 4EJOA 3F8NA 4I98B 3M8EA 5E20A 5CLSA 2C6YA 1PDNC 3FXUA 1ZGJA 3MAJA 4IRIA 1GHCA 1L0OC 3K1MA 5AIPA 1SAXA 5HDKA 3J80K 2HEOA 1USTA 5L3DA 4KIBA 2CFXA 2HYFA 2L3DA 5E17F 2M5WA 3CDHA 3IHUA 1G3SA 3IWZA 2FMYA 5D6FA 3MZYA 3WTSC 3R0JA 3RKXA 2LDUA 2HQNA 2OAZA 3QPHA 3M7GA 3CO7C 1GVJA 2Z99A 3DPLC 3R61A 2IA0A 1MDMA 4BHBA 3REOA 4LK0F 3EQLF 4G9YA 4OIPF 2VT3A 4HA8A 3GYHX 3SHFA 3TO9A 2OQGA 1OMIA 1SD5A 3HOTA 1AOYA 1O57A 4BHPA 2XIGA 5D8KB 2STWA 4A0ZA 3WODF 1AWCA 4H0EA 1J2XA 3WTVC 1R1UA 2DTRA 2ZFWA 5JHUA 5FLXZ 1V4RA 1Z05A 2IA2A 1ZYRF 1QGPA 4P9FA 2DLLA 5LGUA 3FM5A 4BXUA 5FO5A 1LNWA 2A61A 2ZNYA 2YX7A 5K5QA 1LDJA 1RZ4A 4JK1X 3EDPA 3QP6A 5TRDA 1KA8A 1FC3A 3V7RA 2HTJA 2DT5A 2LF7A 5ILUA 1BM9A 3ULQB 3Q9VA 4RB3C 4HX8A 3H92A 1F5TA 4HZFA 2XKOA 4ZZDA 1O3RA 4Q4ZF 4YFKF 1YW8A 3T5XA 3F22A 2ACJA 4IRGA 4L9VA 4CICA 3WG9A 2AXLA 2JZYA 1WRJA 2QYOA 1QPMA 5LHIA 1R00A 2OD5A 2MBFA 1P6RA 1F9NA 4EV0A 2FMLA 3ZMVA 3RKWA 2E7WA 4KN7X 1S8NA 2W85A 2OU2A 4OIRF 5J6XA 1KGSA 1OYWA 3KP4A 1K7AA 1ZG5A 5HLIA 3P7NA 4WCGA 1BJAA 4U88A 1B59A 1LVAA 1SD7A 4P55A 4ENJA 5E18F 5L3BA 1HSJA 4ZYDA 2MLKA 2NRAC 3HIFA 3GUDA 1D3YA 1U78A 2KIMA 3P9IA 3T8TA 4FX4A 2MC3A 3KZYA 2Z3YA 2MD5A 1T2KA 1IW7F 2XROA 1B9MA 3E6DA 4Q5SF 5DUKA 4IRHA 2EB7A 1XMKA 3LA3A 1FP1D 2ELHA 1MKMA 2NNNA 4U0WA 1IXCA 2X4HA 3LQRA 2FU4A 4QLCU 1BOAA 3HRTA 3TO7A 4TV7A 4FHTA 4GXOA 3RJPA 2H09A 1QZZA 3HUGA 4GO1A 2QBYB 1S3JA 1REPC 3LSTA 4B8XA 2IPQX 2RV8A 2IRFG 2A07F 5LBQA 4R1HA 1U5TA 3C3WA 3R6SA 2B0LA 1QNTA 2H27A 2DPDA 4ZYHA 2ZO4A 3ZMDA 2XRNA 1JGSA 5DCMA 2O6GE 3ABTA 1U5TC 2OQRA 2K27A 3TDZC 2KIUA 2XASA 4U7BA 1O3QA 3G3ZA 3J80Z 2VBXA 3CLOA 1NHAA 3EETA 2XGXA 1QZYA 2GA1A 3HYIA 4HOBA 4RB1A 1DPRA 3RYRA 2X0LA 1IRGA 3F3XA 3P9KA 1KU9A 3GLXA 3CUOA 3QP5A 4A0XA 1C0WA 2PG4A 4O6JA 3EUHA 3FMRA 2J5OA 3V7SA 1XSDA 5H6QA 2DPUA 3GO5A 4PDKA 4I0AA 2P6SA 1W7PD 2KKOA 2WWYA 4IJAA 2QWWA 3CUQB 4A5MA 3ZPLA 1SD4A 2P5VA 2F5FA 1S6LA 1BC7C 4GYGA 3B73A 1IN4A 3MWMA 5DCMB 4LMYA 3FXRA 4RGUA 3NQOA 1R1TA 4GGGA 4WWCA 1MZBA 1PUEE 1J5YA 1P2FA 3KEQA 2YX4A 4M6YA 2G7HA 4IXAA 1BN5A 4ZH4F 4M71A 2VXZA 1YW9A 3SQNA 2L01A 4LJZF 2VN2A 2VBYA 2O03A 3GZ6A 1IN5A 3JW4A 2K4JA 5BOXA 1R7JA 1O3TA 2E7XA 3IRRA 1W5TA 2O3FA 1YQAA 3JAMK 5K1YA 3HHHA 2CG4A 2EV6A 1UHWA 3L7WA 2NAZA 3O3KA 4N9IA 4U7DA 5LRSA 4LG0A 1GXPA 3WE2A 2AS5F 1EH6A 4WX9A 2GIVA 5ICEA 3DEUA 3KZZA 4LK1F 3VODA 4M74A 1W7PA 1XD7A 3W6JB 4DNCA 2QVOA 1HW1A 4EJUA 2A6EF 2DBBA 2PFBA 3GXOA 3FMSA 3C18A 4EVIA 1HXDA 1FNNA 4HLYA 3ZQ7A 3KP3A 2YU3A 4NB5A 4F7ZA 1W7PB 4L0ZB 2GZWA 2BV6A 1P4WA 1I5ZA 4L9TA 3N4MA 3ZMZA 1XDSA 4K2EA 3K69A 3CTAA 2FE3A 2QENA 4FT8A 2IT0A 1RUOA 2JRTA 1RI7A 1R5HA 1Y0UA 3BP8A 2EA4A 3HHGA 1XCBA 4U0YA 4EM1A 3U1DA 2HR3A 3OOPA 1FSEA 2O8XA 4PGGA 1DPUA 4IHTA 1YFHA 1LB2A 4M73A 2JTVA 4ON0A 3I54A 3KP5A 2W57A 1BBYA 2M45A 2A3SA 5JFRA 2XAFA 3C7JA 1RNLA 5FGMA 1IN6A 1BI3A 2W25A 3FMQA 3GW2A 2FOKA 2KJCA 2PMHA 3WTUC 5F64A 1CF7B 2YR2A 1K6OA 4S05A 4LFUA 3ELKA 4Y13A 3QOPA 2K4BA 5AIQA 3Q5FA 4HV6A 1XGSA 1YTYA 4LLNA 1BI1A 2UXXA 3E6BA 3E6CC 3KFWX 1ON1A 2P7VB 3D0SA 4OINF 3TGNA 1KU2A 2ADUA 1FBUA 4O5VA 1ZG1A 1O7FA 3KEOA 1O7LA 4D0PA 5JR3A 2GXBA 1I27A 5CVUA 3RTRA 2OBPA 1J75A 3DFGA 4Z2YA 1P4AA 1KQ8A 1Z6TA 1S7OA 4XLNF 3WGHA 3WTXC 2V1UA 1YIOA 3GEZA 1SFEA 3VB2A 4ENMA 4OIQF 2PEXA 1IN8A 4RAZA 3JSPA 5CJ9A 1LDDA 5LLQA 5D5UB 4IHSA 1FT9A 1K78B 2BE5F 1I1SA 4A6EA 3TDUC 3V8KA 3GWZA 4A2UA 3RPUA 3PFIA 2CQKA 2FSWA 2EFNA 3TO6A 4UVCA 3BJAA 2XHKA 2MLGA 5TJJA 1OYIA 2GA2A 1ZG3A 3V8JA 5F1RA 2FBHA 4KYWA 1J7KA 4LGWA 3M9AA 3E5XA 5CVJA 1A04A 2F5EA 4L18B 1TQMA 4KUMA 4MEXF 1E2XA 4CDGA 2E1CA 2FF4A 5H20A 4ESFA 3V4GA 1SFXA 3DPTA 1YYVA 1Z9CA 1XGNA 4I7HA 3VOEA 3I0TA 1SFUA 1Z6RA 3KCCA 3K1PA 2D45A 1LJ9A 3F8MA 3L09A 5HS8A 4BQAA 5D5XB 5FD6A 4EM0B 4DQ2A 2A68F 5CVRA 5LEKA 2YPRA 4EQQA 4Y15A 3M1EA 2VBWA 2ZJ2A 1BC8C 1KYZA 1OYYA 4G7OF 4RGRA 4ETSA 1SD6A 5D4RA 1P92A 1FYLA 2O0YA 2RC4A 3DQVC 1ZGAA 1HKTA 2QQBA 5IT9Z 1TQIA 1U5TB 3DXJF 4IF4A 1ZRFA 2L4MA 4LG0B 1LDKB 1HQCA 2RVCA 1RUNA 2CW0F 2ZXJA 5J8FA 3LA2A 1X3UA 5J8CA 2VE9A 4I0BA 2P8TA 2A6HF 5BQTA 4HDUA 2H6BA 2XAHA 2W24A 2EJRA 1BI2A 1XN7A 1DUXC 4EM2A 2M87A 2JSCA 2EV0A 2PI0A 1OPCA 1ZREA 5FB2A 5DDGA 4U0VA 3CUQC 3WGGA 3F72A 1B6AA 5BPDA 4ZYEA 4KNYA 2ZBKA 2K86A 1TTYA 3GF2A 2YSRA 1IF1A 2OZUA 2MH9A 4AD9A 4L9JA 5ILSA 1G3YA 1U6GA 1IN7A 3GX4X 4Y17A 2L4AA 4KMFA 4RB0A 5ICGA 4AIJA 2ZKZA 4RGXA 5DCFA 2TDXA 1YS6A 3LQQA 5HLGA 2XVCA 2O61A 3NEUA 5LGNA 3VEPA 4HQMA 3HTSB 3T1BA 3R4KA 5HS7A 4PGHA 3QU3A 2HGCA 2W84A 5LRRA 3SFZA 3BJ6A 3SXYA 3KE2A 4KIFA 3CO6C 5JI6A 3LA7A 1TBXA 2V9VA 1H9GA 1IXSB 1MJBA 4XBFA 1MDMB 3PQKA 1IUYA 2CWEA 2PQ8A 2R7FA 3K0LA 5FD5A 2V6CA 4M9ZA 1EH7A 3TOBA 2P7CB 2PJPA 4HAMA 2KIFA 2NYXA 4WK8F 2FA5A 2LSOA 4XSZF 4OU0A 2HS5A 4LB6B 1SMTA 5FFZA 3WGIA 4PCQA 3HTUA 5DV5A 3ROUA 2L02A 2LF8A 3F8BA 1FYMA 2ISYA 3L00A 5HVQC 3T8RA 1ON2A 5HOOA 3BROA 1XMAA 4WXHA 4S04A 4GYIA 2MH2A 4A5NA 3C1DA 4E70A 3R60A 3RYPA 3ZN0A 1T38A 3U9GA 2EFQA 4NQWA 2WTEA 3LAJA 4MGRA 1YLFA 2F5DA 4YIFA 1U8RA 4FX0A 1W4MA 5KVRA 5DUIA 4G6QA 2KJBA 4EGYA 3TKYA 5LHGA 2ETHA 2V79A 2DFIA 3FZVA 4G7ZF 4KMUX 2A69F 2P5LC 2WV0A 1ZLJA 1ZHFA 3I53A 1WI9A 2Q0OA 2XAJA 1Z7UA 3J81K 2QUFA 4WXDA 2FQ3A 1P4XA 1ODDA 1STZA 1T0FA 4HQEA 2EFOA 2E1NA 1IRFA 2Y75A 2R7DA 2DU9A 3R0AA 3I59B 1TQPA 3ZMTA 1T6SA 1G4DA 5IT9K 2D1VA 2DO7A 3V8LA 4AWXB 2JPCA 2RKHA 3BWGA 2HZTA 2FEZA 2DI3A 2PN6A 2ZNZA 4EJWA 4KT5C 4HF0A 3IC7A 2NNYA 3WTYC 4UUVA 3VFZA 1YG2A 3FX3A 4OMZA 2VOOA 4YG2F 3TQNA 4CZZA 2HFHA 5K5OA 1EH8A 3BDDA 2EFPA 3D5LA 2VONA 4A0YA 1R5GA 1DP7P 4M9XA 2FXAA 3RKYA 1TNSA 2FBKA 5L3GA 3DP7A 1VTNC 3WTWC 2QQ9A 2RDPA 3QAHA 1LQ1A 3H3ZA 3WTZA 2EWNA 1BIAA 1R58A 1JHFA 3EYIA 3JAMZ 1XSVA 2JPBA 4NHJA 1TLHB 3WTTC 1FY7A 1ONVA 3ABUA 4OOIA 4G6DA 1TNTA 2QLZA 4M9SA 1T39A 1K79A 5E1XA 3BZ6A 3LAPA 1F4KA 5DD4A 3JSOA 1HKQA 4G94A 4HF1A 3QPTA 4YFXF 3EYYA 4P96A 5ERIA 2UZKA 4CYDA 3HRMA 4RGSA 5HS9A 3KP6A 1OR7A 1UFMA 4HW0A 1KQ9A 5F6FA 2Y48A 2HDCA 2XUBA 2NS0A 4AIHA 2XAGA 4KA4A 4GCVA 1SMYF 2P4WA 1XCVA 3BJOA 4O3MA 1FX7A 4LD5A 5LEJA 3J81Z 4HX4A 4UHTA 3MZHA 1YS7A 5A2QZ 5E1WA 2ESHA 1WSUA 1BIBA 1OKRA 5CVVA 2ZCWA 2A5YB 4BH9A 2M8EA 5DYMA 4CXFA 2K7LA 3GFIA 1RIOH 1D8JA 4XLPF 1I6XA 3IWFA 1UCRA 2PMUA 3SZPA 3DV8A 2PBIA 4KIGA 2VODA 2P6TA 5CVIA 5KK1A 2QM3A 2VT2A 1O3SA 3F6VA 3CUQA 2CSOA 3V7CA 1IXRC 3W6KB 2FRHA 1XDUA 2GQQA 1KQ0A 1ZRDA 1FP2A 4RS8A 4L0YB 1HKSA 3KLNA 2IVMA 2D2WA 1USSA 2Z9OA 1FZPB 1YO5C 1IAWA 4ENNA 2H94A 2CO5A 1J0RA 3HOSA 4MQ9F 5CYVA 2KRFA 5HDGA 4UXNA 1JE8A 3J7AO 1D8KA 5LHHA 1I1GA 1XB4A 4HF2A 4QWQA 3FM3A 2HKOA 4G7HF 1JXSA 4OMYA 4JQFA 4EJTA 3ZMUA 3RDIA 3JTGA 3L9FA 4I02A 2CYYA 3NRVA 5A2QK 1HW2A 5D6EA 2MA3A 2GAUA 5L3EA 5D4SA 2M30A 1QBJA 3I64A 2D1HA 3MCZA 2L54A 1HBXG 2ZMEA 5DD8A 2RNJA 4MTEA 3M8FA 1J59A 5ILVA 5E8GA 2HKXA 2R3SA 1ZN2A 3ZMSA 1LEAA 2BYVE 1ZH5A 2DW4A 2XV4S 1UHMA 2IW5A 2HWVA 3MEXA 2IP2A 1ULYA 3T0YA 2OA4A 3F8FA 1UB9A 3K9TA 3FXQA 4KFCA 1MGTA 2DK8A 4LLGF 2OZ6A 5HLHA 3ML6A 5LGTA 3QU6A 5EEGA 1XGOA 4IPAA 4G8XA 2M1BA 2JT1A 5BPIA 4I09A 2COMA 2H6CA 1Z1DA 2EA2A 3RIRA 1HSTA 2VOPA 4BHCA 3OV8A 2Q8KA 2K02A 2VC1A 3F21A 3Q9SA 2RQPA 5IT3A 3MFKA 3HSEA 3RPQA 3I4PA 3AAFA 1L3LA 5BMZA 1R22A 2DAOA 3KP7A 4KDPA 1ZAOA 4WXCA 1R36A 3H3UA 4R79A 2V1XA 1U2WA 4PZJA 4P9UA 1FBSA 3BPXA 1EV7A 1WKMA 3HSRA 4CGZA 2VC0A 3HRSA 5D5VB 3HRUA 4R8HA 4XRFA 1PP8F 2UXNA 5JVTA 1KU3A 3KLOA 3IKTA 1H9TA 3E5QA 2RN7A 5K5RA 2EK5A 4OIOF 4N0BA 4HDVA 4I2OA 1ZLKA 4L5JA 2J5PA 2F2EA 3WE3A 3BOQA 4XSXF 1B4AA 4ASNA 2HYGD 2IJLA 3RI4A 1R23A 4L9NA 2BEOA 4AVPA 2BBYA 1TW3A 3GFMA 4RB2C 3ECOA 1TW2A 1GXQA 2LNBA 3E3VA 3I5UA 5D5WB 1Q1HA 4MNUA 2VBZA 3F23A 3I71A 5H6RA 1DDNA 1E17A 2CGPA 3PQJA 3LFKA 5E8IA 1CF7A 4I01A 3O2PE 4A6DA 2GXGA 3DKWA 5ICCA 1K78A 4AIKA 4CO8A 6PAXA 4UVAA 4HLXA 1FLIA 3CJNA 4ZZLA 3FF5A 3WU0A 1R1VA 2V1DA 1KU7A 2RGVA 1FBQA 4IVNA 3IKVA 5L3CA 5D8LB 4Q48A 3LWFA 3GVAA 2HQRA 1W5SA 2FNAA 4MHGA 2XKPA 2LKPA 3O6BB 5BS6A 3F8CA 4P5OA 3E5UA 4JBAA 3GFJA 1FPQA 3L2CA 4BNCA 5HDNA 5FFXA 1F1ZA 1FSHA 3JTHA 4HX7A 3BPVA 3ZP5A 4UVBA 2PLYA 1MJ9A 2DQLA 1XGMA 2IA1A 3G73A 4ESJA 1G6NA 4CHUA 1S7AA 2F5CA 2DQRA 4YIIA 4B09A 3P9CA 3E6MA 4L5IA 1H0MA 1MJAA 3KETA 5FLXK 2VE8A 1QO0D 4MTDA 3K2ZA 2P5KA 2FNPA
chains in the Genus database with same CATH superfamily
1MBHA 5DEQA 3JRGA 3ISPA 2LBFA 2CRGA 3ECHA 4HV5A 4A12A 3PO3J 2Y0MA 4B43A 2BHZA 4UNOA 2DDBA 4XKBA 4EMSA 4PFOA 3PNTA 4RAYA 1HOMA 4LB5A 4A3KJ 4F91B 3KP2A 1FYKA 1V3FA 3OYLA 2G7UA 4M72A 3ZN1A 1FWZA 4MQVA 1W36D 1I3AA 3A01A 1BW6A 5FRMA 3DU5A 4BJ5C 4A3DJ 1U3EM 1WQ2A 2VJIA 3BG5A 4AYBN 3HXLA 5J4YA 2A6TA 2WC2A 4HYEA 4BAYA 3QRFF 1VQ4I 1JHHA 3MVPA 3QYEA 3S2WA 3I58A 1FOKA 2IXSA 2DK5A 3UKGA 1CGPA 5DS9A 3DF8A 4N9HA 2QQ8A 1ZARA 3BG3A 3HUGB 2Y0SN 1RETA 2EV5A 2EFWA 2F5VA 2EZLA 4MIMA 2E34A 4ENKA 1E3OC 2EILH 4BYYA 4QIWN 2K9QA 2STTA 1PVEA 2LP0A 5ED4A 2OTLI 3COAC 4ESBA 4UV8A 2UWMA 1J9IA 2HTSA 1QQIA 1WGXA 3I59A 1MD0A 1BI0A 2TRTA 5GTHC 5E1ZB 2V26A 2QZ8A 2QBYA 3WHCA 1OFCX 3GFLA 3BR3A 1NTCA 1T98A 4LLLA 2NVUB 1Z91A 5GPAA 1B1BA 1POGA 2G9WA 3HKZA 4IZZA 4UV9A 3CCSI 3TBIA 2Q2EA 2K9MA 4RLQA 2QQAA 3WU1B 2GWRA 2F4OB 5IP6A 5FKKA 1BL0A 2ZJRF 2XF6A 2ZB9A 2E2JJ 1LEBA 2L7FP 1D0ZA 1RESA 2XAQA 4KN4X 2Z16A 3B02A 3IL2A 4ZJZA 1OCPA 4IHXA 1IV6A 3N97A 1PP7U 3ZQQA 2ESNA 2CQXA 3IRQA 1KYWA 1ENHA 3OYJA 3MQ0A 5IYBJ 1B9NA 2KIQA 5GTIC 4PFPA 1ZR4A 1NH3A 3K1NA 1G3TA 5GPCA 2K85A 3F6OA 3CLQA 1UG2A 2FBIA 3DEEA 3BY6A 1ZRCA 3CCJI 4KICA 5F0FA 3CMEI 1XSXA 3TOAA 3U2RA 4EGZA 3ERED 2ICWG 2ZMEB 1HW5A 4HBLA 2E5ZA 1WWXA 2XF7A 4ZYGA 5L3FA 1WJBA 5EZGA 2R5ZA 4M6XA 4BL0B 2CMPA 3OYAA 3FWEA 4YFNF 2W4SA 4MFDA 3FHZA 4FTHA 1YW7A 2VLAA 5AONA 2LOOA 1S29A 1D5VA 1IZ1A 4WF2A 4B1RA 4MEYF 2HOEA 3HSFA 4Q47A 4EJVA 1ZK8A 2BGCA 2EBIA 3SZTA 3K6GA 2QA4I 5EZHA 2ISZA 3E97A 2Z33A 3HDDA 2Z5UA 2R5YA 2GIZA 3GZ5A 5EEHA 1G3WA 4PSXA 5ICFA 4EJOA 3F8NA 4I98B 1IUFA 3M8EA 5E20A 1FJLA 4Y33A 5FRNA 3X2QH 4UY8I 5CLSA 2LY2A 2C6YA 1K83J 1PDNC 3FXUA 1ZGJA 3ESWB 3MAJA 2KPMA 1ZR2A 4IRIA 1GHCA 1L0OC 3K1MA 3LMMA 1VQPI 2X6YA 5AIPA 1SAXA 5HDKA 3J80K 2HEOA 1USTA 2GOXB 5L3DA 3OYEA 4AC0A 4B3XA 4KIBA 1Y6IA 2CFXA 2DJIA 3RCOA 2HYFA 2Z2SB 4D1QA 2L3DA 3GTLJ 4AYBA 2ID6A 1TT0A 3W2VA 5E17F 2M5WA 3CDHA 1WJ5A 3IHUA 1G3SA 3IWZA 3Q0WA 2FMYA 3S1NJ 3OMYA 1YITI 2GM4A 5EJCA 5D6FA 3MZYA 3WTSC 3R0JA 4KITB 3RKXA 3QQAA 2QEXI 2LDUA 4A3EJ 1E3HA 1X4OA 4C9YA 1GV2A 2CU7A 2HQNA 2OAZA 3VYSB 1MSEC 4BDYA 3EUHC 3H9JA 3QPHA 3M7GA 3CO7C 1GVJA 2Z99A 3IUOA 4L5EA 3DPLC 2WB1A 3R61A 2IA0A 1Y1WJ 1MDMA 4BHBA 4A3JJ 3REOA 4LK0F 3EQLF 4XN0A 2ME6A 4S0HB 1TL8A 4G9YA 1JUPA 5FLMJ 1Z3XA 3JRCA 4OIPF 2VT3A 1SVLA 4HA8A 5J3LA 3GYHX 3FXOA 4DYCA 3FXMA 3SHFA 3TO9A 3CCMI 2JVHA 1PJRA 2OQGA 1YX3A 1RC9A 1OMIA 1SD5A 3HOTA 4AUXA 3JRIA 2WA0A 1AOYA 1O57A 4BHPA 1D1BA 2XIGA 5D8KB 4M3FA 2STWA 2RQQA 4A0ZA 3WODF 1AWCA 4H0EA 1J2XA 3WTVC 1R1UA 2DTRA 5IY5H 3ZQLA 2ZFWA 5JHUA 2R0QC 5FLXZ 1V4RA 3RZOJ 1Z05A 2HDWA 4XL9A 2IA2A 3MKYB 1ZYRF 1YOVB 1ZQ3P 1FIPA 1A5JA 2F4MB 1ETYA 2HYJA 1QGPA 4P9FA 1TWGJ 2DLLA 3CCRI 5LGUA 2Y9YA 4I99C 3FM5A 4BXUA 1GLNA 5FO5A 1LNWA 1MNEA 2A61A 2ZNYA 2E71A 2ZXIA 2YX7A 2V1NA 2X6XA 1F36A 5K5QA 1E3PA 4XQFA 2OJED 3A02A 1JI8A 1LDJA 1U9OA 1RZ4A 4JK1X 3EDPA 3QP6A 5TRDA 1KA8A 1FC3A 3V7RA 2HTJA 2DT5A 2LF7A 1JGGA 5ILUA 1BM9A 3ULQB 2Y2ZA 3Q9VA 4RB3C 2OCEA 3G1LA 3M8JA 3D5RC 4HX8A 2IS2A 3H92A 1F5TA 1Y8RB 3BG7A 4HZFA 2XKOA 4ZZDA 1O3RA 3H3VK 4Q4ZF 3W6VA 4YFKF 3GTOJ 1YW8A 2M9HA 2WAEA 3T5XA 3IH3A 3SEQA 3F22A 2ACJA 3GCMA 4IRGA 4L9VA 4M3BA 4CICA 4V2FA 3WG9A 2DFFA 2AXLA 4ZTJA 1DGRM 2DYSH 4XMYA 2JZYA 4RMNA 1WRJA 2HPIA 2QYOA 2IS4A 1QPMA 5LHIA 1HDDC 1R00A 4IL6C 2OD5A 2MBFA 2VB6A 1P6RA 1F9NA 1WJEA 1TWCJ 2FMLA 3ZMVA 4EV0A 1R71A 1HLVA 3RKWA 4DOZA 1LUJB 3MD2A 2E7WA 2LH9A 3CDIA 4JYKA 4KN7X 1S8NA 2W85A 1HDPA 3ABMH 4B48A 2OU2A 1R4MB 4JP0A 4OIRF 3E1SA 2BY1A 2P0WA 5J6XA 1KGSA 3OR2C 5F1JA 4II2A 5IOYA 3SJMA 2UV1A 3DPUA 1OYWA 2NVXJ 3KP4A 1RRJA 1K7AA 5M5YJ 5HLIA 1ZG5A 1K4SA 3ZQIA 3P7NA 2L9NA 2BY3A 4WCGA 3OOUA 1BJAA 4BU2A 4U88A 1B59A 1LVAA 1SD7A 2VUMJ 4P55A 3GBGA 2O5RA 1ETQA 4ENJA 2YU9J 2DJNA 5E18F 2WAQN 5L3BA 1LFUP 2OV7A 1HSJA 2X51A 2MFZA 3DTKA 4ZYDA 4QTRA 4BGDA 2MLKA 2ZC2A 3HIFA 2NRAC 3GUDA 3FK7A 4MLOA 1D3YA 3TP0A 1U78A 2KIMA 2XPVA 4KISA 3P9IA 3T8TA 2GLOA 2X9DA 4FX4A 2MC3A 3KZYA 2Z3YA 2MD5A 4W1UA 3PFYA 4AIDA 3JRDA 2M4KA 4BJ6C 4A3BJ 1F43A 4FE7A 4E4HA 4D5FA 1T2KA 1IW7F 1B9MA 3SEZA 3E6DA 2XROA 4Q5SF 5DUKA 4IRHA 4BBRJ 2PJRA 2EB7A 2DA3A 1XMKA 3LA3A 4NQWB 4HNUA 1FP1D 2ELHA 3I4NJ 1LE8B 1MKMA 2NNNA 4U0WA 1IXCA 4DYQA 2X4HA 4DW6A 2QKMB 3LQRA 2FU4A 3Q0VA 4QLCU 1BOAA 2LR8A 3HRTA 2IGOA 4IEJA 3TO7A 4TV7A 4A3LJ 4FHTA 4GXOA 2BXYA 3RJPA 1TP4A 2H09A 1QZZA 3HUGA 4GO1A 4IQJA 3BR0A 2QBYB 3DBLB 3WU2C 1OISA 1S3JA 2OTJI 1K6YA 1REPC 3LSTA 4B8XA 2IPQX 2RV8A 2IRFG 2A07F 5LBQA 1IRZA 4R1HA 1IDZA 1D0YA 1U5TA 3C3WA 3R6SA 3K10A 2B0LA 5TGTA 5HLTA 1AHDP 2ZJPF 1QNTA 2H27A 4A3GJ 2DPDA 3CCYA 4ZYHA 2ZO4A 3ZMDA 2XRNA 3CMMA 3K4JA 4XORA 1JGSA 3LFUA 5DCMA 2O6GE 3PO2J 4BXXJ 3ABTA 1U5TC 3BTIA 2OQRA 2K27A 4HSRA 3TDZC 5JVGF 2TCTA 2KIUA 2XSDC 2XASA 3SYTA 4U7BA 1O3QA 3PUFA 5B3SH 2KT0A 3G3ZA 3DWLE 2LC2A 5J40A 3PNYA 3J80Z 2H1LA 2VBXA 2BZTA 3CLOA 1ZGWA 2NVTJ 2DFEA 2V7FA 3CC2I 1NHAA 3TL4X 1IRXA 5HNFA 1LVKA 2DMUA 3EETA 2XGXA 1JKQC 1QZYA 3K70D 2GA1A 3HYIA 4HOBA 4RB1A 1DPRA 3RYRA 1ETVA 2X0LA 1IRGA 4D9JA 3CCQI 3F3XA 3P9KA 1KU9A 2IGKA 4BY1J 2MABA 3GLXA 5IP7J 3CUOA 1XS9A 2CUZA 3QP5A 4A0XA 2O8KA 3HOYJ 3CJQB 1C0WA 3S1MJ 2PG4A 4O6JA 3EUHA 3FMRA 4FISA 2K3PA 2J5OA 3V7SA 1XSDA 5H6QA 2DPUA 3GO5A 2K40A 4I0AA 4PDKA 2Y9ZA 2P6SA 4IX7A 1W7PD 2KKOA 2K5CA 1QVTA 3OYGA 3FK6A 4IJAA 2WWYA 2QWWA 3CUQB 4A5MA 3ZPLA 3SDGA 1SD4A 4IHYA 2P5VA 2F5FA 1S6LA 3PSIA 1BC7C 3OYCA 3VWBA 5J1RA 2IGNA 1T56A 1A6IA 1D1CA 3GTMJ 4GYGA 1MBGA 4UUTA 5KHDA 2FJ1A 3AFHA 3CZ6A 3B73A 1IN4A 3MWMA 2MGQA 5DCMB 4LMYA 2L7MP 3FXRA 2R93J 3A0BC 4RGUA 3KIOA 2V9KA 3VYUB 2HOSA 3NQOA 1R1TA 4GGGA 4XKWA 4WWCA 1MZBA 2Y30A 4B47A 3VYRB 1PUEE 1J5YA 2IGMA 4IOCF 4C2UA 4XKCA 1P2FA 4C3JJ 4BXFA 3G1MA 1AU7A 2E2HJ 3KEQA 2YX4A 4M6YA 2G7HA 4IXAA 4CZCA 3BZCA 1BN5A 2MW8A 3E7LA 4AVZA 4ZH4F 3QODA 1JKRC 4M71A 2VXZA 4V19K 1YW9A 5TISC 1MSFC 3M3YJ 3ONQA 2I10A 2L01A 3SQNA 3W2WA 4LJZF 1Y0NA 2VN2A 2WBMA 1JKPC 2VBYA 2O03A 2BHYA 3PNVA 1MMNA 4UB8C 2DA5A 1IN5A 2K9LA 3JW4A 5FROA 2K4JA 3GZ6A 5BOXA 1R7JA 4Y3OA 3OS2A 1O3TA 5CKTA 2E7XA 1X1BA 3OSFA 1P7IA 5LD2C 4CUGA 1KZHA 3IRRA 5E3MA 1W5TA 2O3FA 1FTTA 1YQAA 3ZQCA 2DTZA 3JAMK 5K1YA 3HHHA 2CG4A 3LOCA 5F27A 2EV6A 1UHWA 3L7WA 2M8GX 2NAZA 4BKXA 3O3KA 4N4NB 3LSIA 1YJ9I 5M3FJ 9ANTA 1GUUA 4N9IA 5M5XJ 1VQOI 2NVQJ 4U7DA 4OAYA 5LRSA 4LG0A 1JJ6C 1GXPA 1ETKA 3L2QA 2H1KA 3WE2A 3F0CA 2K3FA 2AS5F 1EH6A 4WX9A 2GIVA 2MYSA 5ICEA 3DEUA 2L7ZA 3OL3A 2ZXHA 3EPZA 3KZZA 4LK1F 3VODA 2QKLB 4M74A 1E0EA 2EZHA 1W7PA 3FKJA 1D5YA 4M6VA 4JX5A 1XD7A 3W6JB 2VIXA 3NAUA 4DNCA 2QVOA 1HW1A 4EJUA 2A6EF 2DBBA 2PFBA 3PIPF 1W36C 1X2NA 2DA6A 3GXOA 3FMSA 1T33A 1GVDA 1N77A 1RKWA 2LKXA 2DMNA 1UJ8A 3C18A 4EVIA 2ZJQF 2VJ4A 1R49A 1HXDA 3ZQFA 4RLFA 4GDFA 3HGYA 1FNNA 4HLYA 3KX2A 2JA5J 3ZQ7A 3KP3A 4GRIA 3L2UA 2YU3A 1AA7A 5CQEA 1BA5A 1MBEA 4NB5A 4F7ZA 4BE1A 1W7PB 5B66C 4L0ZB 2GZWA 4ZDPA 2BV6A 4PJNA 1P4WA 1I5ZA 3KYLA 4L9TA 3N4MA 2O7OA 1T08B 3ZMZA 3LNQA 1YE9A 2VL8A 3GTKJ 2R7UA 1XDSA 4K2EA 4HSTA 3K69A 2WY8Q 2NOJB 3CTAA 2MG4A 2FE3A 2QENA 2DA4A 5KNLA 4XLEA 3OSGA 2HNHA 4FT8A 2IT0A 1RUOA 2JRTA 2F48A 1RI7A 1IO2A 1R5HA 1SAUA 1Y0UA 3BP8A 2IAIA 2EA4A 3HHGA 3OY9A 1XCBA 2AHQA 4PUSA 4U0YA 1XG1A 4XOPA 4EM1A 3U1DA 2HR3A 3OOPA 3FISA 1FSEA 2O8XA 4PGGA 1DPUA 4IHTA 2KFDA 1YFHA 1LB2A 4M73A 3K4MA 3RQ4A 1X2MA 2JTVA 4AU7A 4ON0A 5M3MJ 3I54A 3IH2A 2LREA 2W57A 1BBYA 3KP5A 3L2WA 1HF0A 2M45A 2A3SA 4XR6A 2XAFA 5JFRA 3C7JA 1RNLA 5FGMA 1IN6A 1BI3A 2W25A 3FMQA 3GW2A 3LSGA 1WJFA 2FOKA 3DLAA 2KJCA 2PMHA 3WTUC 5F64A 2GXAA 1QHHD 3H5AA 1CF7B 2YR2A 3ZXSA 1K6OA 2R92J 3FBIB 4S05A 4LFUA 3ELKA 2JJ7A 4RM2A 4Y13A 4A3FJ 1U8BA 3QOPA 1I3QJ 2K4BA 4PJJA 1S72I 1QA6A 1SFOJ 5AIQA 1N78A 1DU0A 4OWRB 3Q5FA 2XRLA 4HV6A 1XGSA 1NG6A 2W82A 5IYCJ 1YTYA 5GADJ 2CQQA 3ERMA 4E7LA 5KAIC 2R5ZB 1MIJA 2FUG2 4NC8A 4LLNA 3M4OJ 1BI1A 2UXXA 3CP2A 3E6BA 4V2GA 3E6CC 1V55H 3KFWX 2LD5A 3H5RA 3FXLA 3D0SA 1ON1A 2P7VB 4OINF 3GMEA 3TGNA 1KU2A 4XN3A 3J7ZI 1ZKGA 2ADUA 1FBUA 3L2RA 2JVGA 4O5VA 1ZG1A 1O7FA 3KEOA 1O7LA 4D0PA 4FCYA 1QZEA 5JR3A 2GXBA 1EF4A 3S14J 1I27A 1OJLA 2VKDA 5CVUA 2MSYA 3PM1A 1OLTA 3RTRA 2OBPA 1VZ0A 2VPRA 3JRFA 1J75A 3DFGA 2KRHA 2AQEA 4Z2YA 1P4AA 2RAEA 3LSJA 3ABKH 1KQ8A 1OQYA 3HPHA 1Z6TA 1H8AC 4XOTA 1S7OA 2E5NA 4XLNF 2D5VA 3WGHA 2LY1A 3WTXC 4C2MJ 1YIOA 2V1UA 4CCKA 2E35A 1SFEA 3GEZA 3KEYA 3VB2A 4ENMA 1MH3A 1T95A 2IS1A 1FTZA 4OIQF 1ITYA 2PEXA 4CA0A 3QOEA 2LRDA 3SDBA 1IN8A 4RAZA 4HNTA 3JSPA 1JUMA 5CJ9A 1LDDA 4NDLA 2ZSHB 5LLQA 2LMDA 5D5UB 1W0UA 3S17J 4P1WA 3S2DJ 2M4GA 1KONA 5EGOA 1X1CA 4IHSA 1FT9A 1CQTA 1TWAJ 3TEDA 2R7RA 1K78B 2BE5F 1XPXA 1I1SA 4A6EA 1X3WB 2DDAA 2ELJA 3VSKA 4E6KG 3TDUC 3V8KA 1DP3A 1VF9A 2I8DA 3GWZA 2Z1DA 2R7QA 1X1AA 4A2UA 3RPUA 4IKFA 3PFIA 3GZNB 2CQKA 2FSWA 2QGUA 2EFNA 1B72B 3TO6A 1MMGA 4UVCA 3BJAA 2XHKA 2MLGA 2AQFA 2DMQA 5TJJA 1OYIA 2GA2A 1ZG3A 4C2TA 2DOAA 3V8JA 2X6OA 5F1RA 2FBHA 4KYWA 2VKEA 1J7KA 1XC5A 2KZGA 3CJTB 4LGWA 3M9AA 2E1MB 1R9TJ 3E5XA 2KMUA 5CVJA 1T0FC 2X48A 1Q1VA 1A04A 1MMSA 5E3LA 4D7MA 2F5EA 2VKVA 2WV1A 5B1BH 4L18B 4UB6C 1RR7A 3HOWJ 1TQMA 3C2GA 4IO9F 1HCRA 4KUMA 4MEXF 3BR5A 3G2BA 4RDUA 1E2XA 3O8GA 3H36A 4CDGA 4B4CA 3QYBA 2XGEA 2E1CA 3S16J 1BJZA 1P7JA 2FF4A 5H20A 5JLXA 4YRVA 1VQ8I 4ESFA 1UELB 3V4GA 1SFXA 3HL2A 4BE2A 1NK3P 3DPTA 1YYVA 3MZ8A 2M3AA 1Z9CA 1A36A 1XGNA 2DFHA 4I7HA 3CD6I 1MH4A 3VOEA 2X1DA 5JHFA 3I0TA 1SFUA 3HOZJ 4E7ZA 2HXOA 1Z6RA 4N4OB 3S3OA 2EH3A 3KCCA 3K1PA 4LG3A 1LJ9A 3F8MA 2QF7A 3L09A 5HS8A 2D45A 3BC8A 4BQAA 3TMOA 2NVYJ 3S1QJ 5D5XB 5FD6A 4EM0B 4DQ2A 3TW6A 3IAM2 2A68F 5CVRA 2R7WA 5LEKA 4HG2A 2YPRA 2OF7A 4CYCA 1MMDA 4EQQA 4HPQA 5IYDJ 4Y15A 2GOMA 4II3A 2YS9A 3M1EA 5C3EJ 1EJ9A 2VBWA 2ZJ2A 3A4CA 1BC8C 1KYZA 1OYYA 4G7OF 4RGRA 4ETSA 1SD6A 5D4RA 1P92A 1FYLA 1S9HA 2NXNB 4XK4A 2O0YA 2XB5A 2RC4A 3DQVC 1ZGAA 2CS3A 1HKTA 3DLLF 2QQBA 3A0HC 3PUBA 5IT9Z 4IQ4A 1TQIA 2HVSA 2VQCA 1Z0XA 3GTQJ 1T8IA 3CJRB 1U5TB 3CDLA 3DXJF 4A3CJ 2VQGA 3CMYA 3MN2A 4IF4A 5J47A 1WI3A 4BEHA 1ZRFA 2L4MA 4LG0B 2W1OA 1LDKB 2L7KA 3B6AA 3ZQHA 1HQCA 2A05A 2L5QA 2RVCA 2F6CA 2N8GA 2CW0F 2ZXJA 5J8FA 3LA2A 1RUNA 2R7TA 1X3UA 5DM6F 4M3GA 1LFBA 5J8CA 2VE9A 4I0BA 3JRAA 2P8TA 2HPMA 2A6HF 1XX5A 3AG2H 2XAUA 4HEA2 1ERDA 5BQTA 3KZIC 4HDUA 3DTIA 3ZGKA 2H6BA 2XAHA 3U21A 2W24A 2EJRA 1BI2A 1XN7A 1JTYA 2XDVA 1I50J 5JLWA 2DYRH 2NS7A 1DUXC 2QSFX 4EM2A 2M87A 4MO7A 1WJDA 2DMPA 2JSCA 2EV0A 3ZRGA 2PI0A 3OYDA 1OPCA 3J7YJ 1ZREA 1B8IA 5FB2A 4XRSA 5DDGA 4U0VA 5GAGJ 3PJRA 3CUQC 3WGGA 2BY0A 2KQRA 3F72A 1B6AA 5BPDA 4ZYEA 4A3MJ 2VQLA 1WH5A 4KNYA 3B6CA 2JUCA 1WH7A 1QRYA 1EKEA 2K86A 2ZBKA 2O9LA 1TTYA 3GF2A 2YSRA 1IF1A 2OZUA 2MH9A 2XSJC 4AD9A 3H35A 1ZELA 2BW3A 4L9JA 5ILSA 3BT9A 2LLKA 3S32A 3PL8A 1JT6A 4UUSA 1G3YA 1U6GA 1EA3A 1IN7A 3ABLH 3GX4X 4Y17A 2L4AA 3S3NA 5FJ8J 3I56I 4KMFA 4RB0A 3G6EI 3ASOH 3G71I 5ICGA 4AIJA 2ZKZA 4XRSG 4RGXA 5DCFA 5B1AH 1YJNI 4Y7NJ 3OWTA 2TDXA 2DMTA 1YS6A 3LQQA 2LBFB 4J00A 1UG0A 3A1YA 5HLGA 2W48A 4BJTA 2CFOA 2XVCA 2O61A 3NEUA 5LGNA 2VJJA 1S7EA 4NC7A 3VEPA 4HQMA 3HC7A 1JTXA 2FQ4A 3HTSB 2IBDA 3KPHA 2EIJH 3CCVI 2VPLA 3T1BA 3R4KA 2R5YB 1JJ8C 1UZCA 5HS7A 4PGHA 3QU3A 3H0GJ 4CCNA 2HGCA 2W84A 5LRRA 4RA2A 1TC3C 3SFZA 5E79C 1V5FA 1X19A 2IEKA 3BJ6A 1WCMJ 1WVRA 3SXYA 2DT7B 3KE2A 1N25A 4KIFA 2JUGA 3CO6C 5JI6A 3DBRB 3OIPA 2MD0A 3IH4A 3LA7A 1TBXA 4XIDA 2V9VA 2PMZN 3HKZN 1Z67A 1H9GA 1IXSB 3TP3A 2JSPA 1NK2P 1MJBA 4XBFA 3WG7H 1MDMB 3PQKA 1IUYA 3L1PA 4F92B 2CWEA 2PQ8A 2WAFA 3A2KA 5FLVA 2R7FA 4XM3A 1TWFJ 3K0LA 1VQ9I 5FD5A 2XC7A 2V6CA 2LTPA 3HPGA 4M9ZA 4B3AA 1EH7A 3TOBA 2PX9A 2P7CB 1Z7LA 2PJPA 4HAMA 1W5CC 2KIFA 2NYXA 1FOYA 4DJAA 2R7OA 2BVLA 4WK8F 2FA5A 3TW7A 2LSOA 2R4GA 4XSZF 4OU0A 2HS5A 3HG9A 4ZYAA 4LB6B 1YRNB 1ACIA 1SMTA 3S15J 5FFZA 3WGIA 1FMWA 4PCQA 2JQ7A 3HTUA 2KP6A 1A31A 2F4IA 5DV5A 3ROUA 5C44J 2HU9A 2L02A 3BR1A 3C2HA 3OYMA 2LF8A 2HQ5A 3F8BA 2B7EA 1FYMA 5C4JJ 4FE4A 3H9QA 2ISYA 1V5EA 2ZSIB 3L00A 3S93A 1IDYA 5HVQC 3UR3C 1V5GA 3T8RA 2DODA 2WADA 1ON2A 3DKXA 3QYFA 5HOOA 1O4XA 3BROA 2K9NA 2E60A 1XMAA 4WXHA 2BVMA 2OUMA 4ZC3A 2FD5A 4B44A 1UAAA 1JKOC 4S04A 4GYIA 2DOFA 1QVUA 2MH2A 3GLLA 1PUFA 4A5NA 3BZKA 3C1DA 4E70A 2EQRA 2M0CA 3R60A 3RYPA 5BNGA 3ZN0A 1T38A 3U9GA 2EFQA 3ZQGA 4NQWA 5E3NA 4BS9A 4IHWA 4Z6YA 2WTEA 4DBRA 3LAJA 4HRIA 4MGRA 2HDDA 1ETXA 2KL4A 5DTDA 3AKZA 2BOLA 2EPFA 1YLFA 1XTAA 2F5DA 2CUEA 1SVMA 3G1OA 2KDZA 1K61A 4DZPA 4YIFA 4EEFG 4FX0A 2M34A 1U8RA 1JT0A 1W4MA 1VI0A 2DT6A 5KVRA 3HJEA 2KJBA 2BW3B 4G6QA 5DUIA 4EGYA 5EG0A 5E3OA 3TKYA 1GV5A 5EEAA 1MNMC 5J4VA 5LHGA 2WAQA 2ETHA 2V79A 1ORKA 2DFIA 3FZVA 4G7ZF 2QSHX 4BY7J 4KMUX 2ZFUA 3LL7A 1Y1VJ 2CQNA 1MBJA 2A69F 1BR1A 2WV0A 3DU6A 2P5LC 5F0HA 1ZLJA 2UUZA 1G2HA 3Q3SA 1ZHFA 3I53A 1WI9A 2Q0OA 3HM5A 3FXKA 1YJWI 2R7VA 1N75A 3MMYB 2XAJA 1Z7UA 2P81A 2QUFA 3J81K 4WXDA 2FQ3A 1P4XA 1ODDA 1STZA 1T0FA 3Q0UA 4E7SA 4HQEA 4A93J 2EFOA 1I6HJ 2XGDA 3UNGC 3OYIA 2E1NA 3VDXA 3GTGJ 3BR2A 1IRFA 2Y75A 2R7DA 3IP4B 2AXTC 2DU9A 3F9KA 3R0AA 3I59B 1TQPA 1JUSA 3ZMTA 1T6SA 1RKTA 1G4DA 5IT9K 1VQKI 2D1VA 2V9PA 1IV8A 2DO7A 4F52A 4BQNA 3V8LA 2FX0A 3K4CA 4I76A 4AWXB 2X6WA 2JPCA 2RKHA 3FHNA 1X1PA 3BWGA 4XKVA 3VPRA 4DGWB 2KLOA 2HZTA 1AKHA 3FDYA 2FEZA 5K7FA 1GT0C 2DI3A 1YIJI 2PN6A 5EG0B 4X0GA 2ZNZA 4EJWA 4KT5C 4HF0A 3IC7A 5KAFC 4LOCA 3QPSA 4H4KC 3PIOF 2NNYA 2KZVA 5CPRB 4J19A 3WTYC 4YELA 2DA7A 4UUVA 3W3CA 3VFZA 1APLC 1D0XA 1YG2A 3FX3A 4DYRA 3CC4I 4OMZA 2VOOA 4NUBA 2X1CA 4YG2F 4CCOA 3TQNA 2R7SA 4CZZA 4ZDLA 2KDOA 2HFHA 4W97A 5K5OA 4CYCB 3I4MJ 3HEFA 1EH8A 4RAGA 3BDDA 2DA2A 2Y69H 4BACA 2EFPA 3D5LA 1FOXA 2VONA 4A0YA 1R5GA 2DA1A 3FXJA 1DP7P 4M9XA 2FXAA 3RKYA 4BUPA 1LFPA 3RQIA 1TT5B 2VASA 1TNSA 1BR4A 1OCOH 2FBKA 5L3GA 3DP7A 4XLAA 1VTNC 3WTWC 2QQ9A 5M5WJ 1TZLA 2RDPA 3QAHA 4LIUA 5GAHJ 3H3ZA 1LQ1A 3WTZA 3OYBA 2E19A 2EWNA 1BIAA 1R58A 2WY7Q 1JHFA 3EYIA 2HXIA 1SC7A 3JAMZ 1XSVA 2JPBA 3OR1C 4NHJA 1TLHB 2X85A 3WTTC 1FY7A 1ONVA 3ABUA 4NNJA 4OOIA 3BTLA 4G6DA 3ZOBA 1TNTA 2QLZA 1HA8A 2IS6A 4M9SA 1T39A 1K79A 5E1XA 3BZ6A 3HB9A 5GP9A 3OYFA 3LAPA 2XPUA 1F4KA 5DD4A 3JSOA 1HKQA 3I55I 4G94A 3JRBA 4HF1A 3QPTA 4YFXF 2XF5A 3EYYA 4P96A 5ERIA 2LG4A 2UZKA 3BQZA 4RBOA 3DCFA 4CYDA 3HRMA 3PSFA 4RGSA 5HS9A 4E7JA 3GTPJ 1QU3A 3KP6A 1ETOA 4A69C 1YI2I 1OCRH 4XICA 4ZTFA 5B5EC 1OCZH 1OR7A 3JCUC 5K7HA 2I5UA 3W2AA 2EIMH 5H2FC 3HGGA 1UFMA 2JA6J 4HW0A 3CF5F 4E7HA 1KQ9A 5F6FA 2B63J 2DCEA 1BR2A 1Z21A 2Y48A 2HDCA 4BBSJ 1WPKA 2L9VA 4QPOA 2XUBA 2NS0A 4AIHA 3BCAA 1RR8C 2Q1ZB 1YHQI 2XAGA 4KA4A 4GCVA 2LY9A 1SMYF 1A35A 2JA7J 2P4WA 1XCVA 3BJOA 4O3MA 3SZGA 1FX7A 4PJLA 1WHUA 3DTEA 4LD5A 5LEJA 3J81Z 2NS8A 4C30A 1OCCH 1IGNA 4HX4A 3MKLA 4UHTA 2EIKH 4ANJA 3MZHA 1YS7A 5A2QZ 4MFEA 5E1WA 2ESHA 1WSUA 3S2HJ 3OL4A 4DZJA 1BIBA 1OKRA 5CVVA 2ZCWA 3S1RJ 4CCJA 3OIOA 2A5YB 4BH9A 2M8EA 5DYMA 3LSHA 4CXFA 3V42A 2K7LA 2JA2A 3GFIA 3S8PA 1M1EB 2Y31A 4XLFA 1RIOH 3H0DA 1D8JA 1RPWA 4XLPF 1I6XA 5IP9J 3IWFA 4LITA 1B8IB 1UCRA 2PMUA 3SZPA 2KHMA 3DV8A 2PBIA 4KIGA 4HNVA 2E1OA 2VODA 2P6TA 3KYDB 5CVIA 2VI6A 5KK1A 3OS0A 2PMZA 2QM3A 3EUAA 1P9QC 2VT2A 5FKLA 1O3SA 3O8HA 2ZXWH 3F6VA 5EF6A 3CUQA 2CSOA 3V7CA 1IXRC 3W6KB 3IV5A 2FRHA 1XDUA 2GQQA 1MBFA 1Y56A 1OR7C 4UUSB 1KQ0A 2M7BA 1ZRDA 1FP2A 4RS8A 5FKMA 4L0YB 3MKZA 1HKSA 1WFXA 2CUJA 3SFIA 3KLNA 4FETA 2IVMA 2D2WA 1USSA 2HZDA 3OYNA 2Z9OA 1FZPB 1YO5C 3VYTB 3BCBA 1IAWA 4ABZA 4ENNA 1U9NA 2ID3A 2H94A 2CO5A 1J0RA 3HOSA 4C3HJ 1Y8QB 1IJWC 3A03A 4F3QA 3VSLA 2E36A 4MQ9F 5CYVA 1V54H 1YX5A 1HC8A 2KRFA 5HDGA 4UXNA 1JE8A 3J7AO 1D8KA 3H1CA 1DU6A 1SEUA 2R7ZJ 5LHHA 1I1GA 1MBKA 3OYKA 1XB4A 1BW5A 2L0KA 3CC7I 4CCMA 4HF2A 4QWQA 1SFKA 2HI3A 3FM3A 2HKOA 4G7HF 1JXSA 3FKIJ 1IC8A 5EYRA 1VQMI 2LYCA 4OMYA 1SANA 2ECCA 2H8RA 4JQFA 4EJTA 3LSMA 1YRNA 3ZMUA 3RDIA 3JTGA 3L9FA 4I02A 3HOVJ 2CYYA 3NRVA 2Q2EB 5A2QK 3ASNH 2E2IJ 5F08A 1HW2A 5D6EA 2FOWA 2BY2A 2MA3A 3NWTA 2GAUA 1FMVA 5L3EA 1VQ6I 4CSWA 5LFAA 5D4SA 4ZDOA 2M30A 1QBJA 2LK2A 3I64A 2D1HA 4PSWA 5C4XJ 3MCZA 2L54A 1HBXG 2ZMEA 2LKSA 5DD8A 3BTJA 2RNJA 5F04A 4MTEA 3FIWA 3M8FA 3QPLA 5ILVA 1J59A 1W0TA 1G59A 5E8GA 2HKXA 2JK3A 2R3SA 1QPIA 2HOAA 1ZN2A 3ZMSA 1LEAA 4YIRX 2BYVE 1ZH5A 2DW4A 2VJ5A 2M7AA 2XV4S 1FOWA 1VQLI 1UHMA 2IW5A 2YUSA 4M3DA 1H89C 4GFBA 1A6QA 1G8XA 2HWVA 3MEXA 4LIVA 2CJJA 2IP2A 1ULYA 3CP8A 3T0YA 3HOUJ 2OA4A 3F8FA 1LPQA 1X3ZB 1UB9A 3K9TA 1UMQA 3FXQA 4KFCA 1MGTA 4PJMA 5GAEJ 2DK8A 4LLGF 2OZ6A 5HLHA 3ML6A 5LGTA 2CH0A 3QU6A 2ME0A 3HZJA 5EEGA 3CESA 1XGOA 4IPAA 1BOBA 4YEJA 2LVSA 3CCUI 4G8XA 2M1BA 4D7NA 4RAFA 2JT1A 5BPIA 5K7ZA 2X1EA 4I09A 2COMA 2H6CA 1Z1DA 3D1NI 2EA2A 3K70C 3RIRA 1HSTA 3AG1H 3BTCA 4BHCA 3OIQA 3OV8A 2DXIA 2VOPA 1R5ID 2Q8KA 2M0MA 2WB1N 1R4NB 2K02A 2VC1A 2PJRB 3F21A 3Q9SA 2CQ7A 2RQPA 3ZCOA 5IT3A 3MFKA 3E0JB 1Y39A 3HSEA 3RPQA 3I4PA 2HVRA 1LE8A 2M2EA 3AAFA 1L3LA 2VKHA 1FEXA 4QSHA 5IPAA 2AO9A 5BMZA 2G0EA 1R22A 2COBA 2DAOA 3KP7A 4XRMA 4KDPA 4U87A 2CW8A 4FQGA 3RKQA 1ZAOA 5J1YA 2HVQA 4WXCA 1R36A 3RZDJ 1GDTA 3H3UA 4R79A 2V1XA 1U2WA 4PZJA 4P9UA 1FBSA 2K9SA 3BPXA 2NOGA 3MKWB 2EZKA 3J7AY 1EV7A 3IAS2 1WKMA 4PK4A 3HSRA 2RREA 4CGZA 2VC0A 4KJZA 3HRSA 5D5VB 5IOZA 3HRUA 4EATA 3JR9A 3HBLA 4R8HA 4XRFA 1PP8F 2UXNA 3JREA 5JVTA 3H5NA 4G12A 1KU3A 3NARA 4I6ZA 3K2AA 3KLOA 3IKTA 1H9TA 3P5JA 3E5QA 3FBNB 4XLCA 2XB0X 2RN7A 4FASD 5HODA 1Z3YA 1VNDA 4F93B 5K5RA 2EK5A 4OAZA 1TWHJ 2VXDA 4NC6A 2Y0SA 3ZR8X 4G6TB 4OIOF 2OCCH 5KCMA 2H8WA 4N0BA 2JWTA 1IG7A 3I3LA 4HDVA 4I2OA 3LSKA 5FKNA 5F0CA 4F55A 1ZLKA 1QHGA 4L5JA 2L9RA 3WHBA 2CV1A 2KRCA 2W00A 2J5PA 2ELKA 4DIQA 2F2EA 4E7IA 1ETWA 3DKYA 2A5WA 3WE3A 3OYHA 3BOQA 4XSXF 1B4AA 2JMWA 2OPTA 1LKXA 4XLHA 4ASNA 2HYGD 3A01B 2IJLA 3RI4A 3C2BA 4JX6A 1R23A 4CCLA 4PJ0C 3D5SC 4BE0A 4L9NA 3G4SI 4BQQA 2BEOA 3K4KA 4AVPA 4D5CA 3NWSA 1MNDA 4X1EA 1AKHB 2BBYA 4A3IJ 5FKOA 1TW3A 2KISA 2EINH 3GFMA 4RM3A 2DOEA 4RB2C 3M07A 1H88C 3ECOA 1TW2A 1OCTC 3BQYA 1GXQA 2LNBA 4AM3A 3CQZJ 3E3VA 3I5UA 5D5WB 3RSNA 1Q1HA 1S5LC 3BLYA 1X58A 4MNUA 4Y52J 1D1AA 1B72A 2VBZA 1ZTRA 3F23A 3CCEI 3I71A 1VFCA 1UHSA 3BG9A 5H6RA 1DDNA 1E17A 3OS1A 1NG7A 2CGPA 2VQHA 4IHVA 2BXZA 3PQJA 3LFKA 2R7XA 5E8IA 3AL0C 3N05A 1VQ5I 1CF7A 4I01A 3O2PE 1WJCA 4E7KA 4A6DA 2GXGA 5EGOB 1K4TA 2MC4A 3DKWA 5J1UA 1U0JA 1SVOA 3KYCB 5ICCA 2XPWA 1K78A 1VQ7I 3EUKL 4AIKA 4DBQA 4BQOA 4CO8A 6PAXA 5EDNA 3U1KA 4UVAA 4HLXA 1FLIA 3CJNA 1DQUA 4ZZLA 3LSPA 3DBHB 2LFBA 3FF5A 3S3MA 2XGCA 1X1DA 1I39A 3BR6A 3WU0A 1R1VA 2V1DA 4QPQA 3DEWA 1KU7A 2CUFA 1DGWY 2RGVA 1FBQA 4IVNA 3IKVA 2V6EA 5L3CA 3CF2A 5D8LB 4Q48A 3LWFA 2L9SA 1W1WE 2B9SA 2V4JC 2E1MC 2QCOA 4X6AJ 5CQGA 1FIAA 2OC6A 2HQRA 1Z77A 3GVAA 2CV0A 1W5SA 3L2VA 2FNAA 3K7AJ 4JOMA 3RPUD 4MHGA 2XKPA 1J09A 2LKPA 3O6BB 4XNFA 5BS6A 3F8CA 4J01A 2QSGX 2HOTA 4P5OA 3E5UA 4JBAA 5HNHA 2HQAA 3AG4H 4CH7A 3GFJA 2CW7A 3AG3H 1FPQA 3K4NA 4BDZA 3AL0B 3L2CA 4BNCA 2DN0A 3QWLA 5HDNA 5FFXA 1F1ZA 1FSHA 3JTHA 1VQNI 4HX7A 2EZIA 3BPVA 3LSRA 3CCLI 3K4BA 2CV2A 3ZP5A 4UVBA 3M1CA 2W7NA 2PLYA 1MJ9A 4ITVA 2DQLA 1XGMA 3CMAI 2L2OA 2IA1A 4Y4RA 1MW7A 3G73A 3H9GA 2JN6A 1WZ2A 4ESJA 3BG6A 1XMXA 1G6NA 1PUFB 4NBQA 3K4LA 4CHUA 4IOAF 1S7AA 2JRMA 2ECBA 3HOXJ 2F5CA 2JA8J 2DQRA 4M3EA 4YIIA 4B09A 3P9CA 1WJAA 2RNGA 1X4PA 3E6MA 4L5IA 1H0MA 1MJAA 3KETA 4BEHB 1PYVA 1R6RA 5FLXK 2VE8A 4XONA 1MMAA 4JX4A 4C3IJ 1QO0D 2ZMEC 3JRHA 4MTDA 3K2ZA 2P5KA 2FNPA 3I9V2 3GTJJ 2GBYA 4KT6A 5DM7F
chains in the Genus database with same CATH topology
5DEQA 3ISPA 3ECHA 4HV5A 4A12A 2Y0MA 4UNOA 4EMSA 4RAYA 4LB5A 3KP2A 1FYKA 1V3FA 2G7UA 4M72A 3ZN1A 1FWZA 4MQVA 1U3EM 1WQ2A 3QRFF 2WC2A 4HYEA 4BAYA 1JHHA 3S2WA 3I58A 1FOKA 2DK5A 1CGPA 3DF8A 4N9HA 1ZARA 2EV5A 2EFWA 4ENKA 4BYYA 2STTA 5ED4A 3COAC 4ESBA 4UV8A 2UWMA 1J9IA 2HTSA 1QQIA 3I59A 1MD0A 1BI0A 5E1ZB 2QBYA 2QZ8A 3GFLA 4LLLA 1T98A 1Z91A 1B1BA 2G9WA 4UV9A 2Q2EA 2QQAA 3WU1B 2GWRA 1LEBA 2XAQA 4KN4X 3B02A 3IL2A 3N97A 1PP7U 2ESNA 3IRQA 1KYWA 3MQ0A 1B9NA 3K1NA 1G3TA 3F6OA 2FBIA 3BY6A 1ZRCA 4KICA 1XSXA 3TOAA 3U2RA 4EGZA 3ERED 2ZMEB 1HW5A 4HBLA 1WWXA 4ZYGA 5L3FA 4M6XA 3FWEA 4YFNF 3FHZA 1YW7A 5AONA 1S29A 1D5VA 1IZ1A 4WF2A 4MEYF 2HOEA 3HSFA 4Q47A 4EJVA 2BGCA 3SZTA 2ISZA 3E97A 2Z33A 2Z5UA 3GZ5A 5EEHA 1G3WA 5ICFA 4EJOA 3F8NA 4I98B 3M8EA 5E20A 5CLSA 2C6YA 1PDNC 3FXUA 1ZGJA 3MAJA 4IRIA 1GHCA 1L0OC 3K1MA 5AIPA 1SAXA 5HDKA 3J80K 2HEOA 1USTA 5L3DA 4KIBA 2CFXA 2HYFA 2L3DA 5E17F 2M5WA 3CDHA 3IHUA 1G3SA 3IWZA 2FMYA 5D6FA 3MZYA 3WTSC 3R0JA 3RKXA 2LDUA 2HQNA 2OAZA 3QPHA 3M7GA 3CO7C 1GVJA 2Z99A 3DPLC 3R61A 2IA0A 1MDMA 4BHBA 3REOA 4LK0F 3EQLF 4G9YA 4OIPF 2VT3A 4HA8A 3GYHX 3SHFA 3TO9A 2OQGA 1OMIA 1SD5A 3HOTA 1AOYA 1O57A 4BHPA 2XIGA 5D8KB 2STWA 4A0ZA 3WODF 1AWCA 4H0EA 1J2XA 3WTVC 1R1UA 2DTRA 2ZFWA 5JHUA 5FLXZ 1V4RA 1Z05A 2IA2A 1ZYRF 1QGPA 4P9FA 2DLLA 5LGUA 3FM5A 4BXUA 5FO5A 1LNWA 2A61A 2ZNYA 2YX7A 5K5QA 1LDJA 1RZ4A 4JK1X 3EDPA 3QP6A 5TRDA 1KA8A 1FC3A 3V7RA 2HTJA 2DT5A 2LF7A 5ILUA 1BM9A 3ULQB 3Q9VA 4RB3C 4HX8A 3H92A 1F5TA 4HZFA 2XKOA 4ZZDA 1O3RA 4Q4ZF 4YFKF 1YW8A 3T5XA 3F22A 2ACJA 4IRGA 4L9VA 4CICA 3WG9A 2AXLA 2JZYA 1WRJA 2QYOA 1QPMA 5LHIA 1R00A 2OD5A 2MBFA 1P6RA 1F9NA 4EV0A 2FMLA 3ZMVA 3RKWA 2E7WA 4KN7X 1S8NA 2W85A 2OU2A 4OIRF 5J6XA 1KGSA 1OYWA 3KP4A 1K7AA 1ZG5A 5HLIA 3P7NA 4WCGA 1BJAA 4U88A 1B59A 1LVAA 1SD7A 4P55A 4ENJA 5E18F 5L3BA 1HSJA 4ZYDA 2MLKA 2NRAC 3HIFA 3GUDA 1D3YA 1U78A 2KIMA 3P9IA 3T8TA 4FX4A 2MC3A 3KZYA 2Z3YA 2MD5A 1T2KA 1IW7F 2XROA 1B9MA 3E6DA 4Q5SF 5DUKA 4IRHA 2EB7A 1XMKA 3LA3A 1FP1D 2ELHA 1MKMA 2NNNA 4U0WA 1IXCA 2X4HA 3LQRA 2FU4A 4QLCU 1BOAA 3HRTA 3TO7A 4TV7A 4FHTA 4GXOA 3RJPA 2H09A 1QZZA 3HUGA 4GO1A 2QBYB 1S3JA 1REPC 3LSTA 4B8XA 2IPQX 2RV8A 2IRFG 2A07F 5LBQA 4R1HA 1U5TA 3C3WA 3R6SA 2B0LA 1QNTA 2H27A 2DPDA 4ZYHA 2ZO4A 3ZMDA 2XRNA 1JGSA 5DCMA 2O6GE 3ABTA 1U5TC 2OQRA 2K27A 3TDZC 2KIUA 2XASA 4U7BA 1O3QA 3G3ZA 3J80Z 2VBXA 3CLOA 1NHAA 3EETA 2XGXA 1QZYA 2GA1A 3HYIA 4HOBA 4RB1A 1DPRA 3RYRA 2X0LA 1IRGA 3F3XA 3P9KA 1KU9A 3GLXA 3CUOA 3QP5A 4A0XA 1C0WA 2PG4A 4O6JA 3EUHA 3FMRA 2J5OA 3V7SA 1XSDA 5H6QA 2DPUA 3GO5A 4PDKA 4I0AA 2P6SA 1W7PD 2KKOA 2WWYA 4IJAA 2QWWA 3CUQB 4A5MA 3ZPLA 1SD4A 2P5VA 2F5FA 1S6LA 1BC7C 4GYGA 3B73A 1IN4A 3MWMA 5DCMB 4LMYA 3FXRA 4RGUA 3NQOA 1R1TA 4GGGA 4WWCA 1MZBA 1PUEE 1J5YA 1P2FA 3KEQA 2YX4A 4M6YA 2G7HA 4IXAA 1BN5A 4ZH4F 4M71A 2VXZA 1YW9A 3SQNA 2L01A 4LJZF 2VN2A 2VBYA 2O03A 3GZ6A 1IN5A 3JW4A 2K4JA 5BOXA 1R7JA 1O3TA 2E7XA 3IRRA 1W5TA 2O3FA 1YQAA 3JAMK 5K1YA 3HHHA 2CG4A 2EV6A 1UHWA 3L7WA 2NAZA 3O3KA 4N9IA 4U7DA 5LRSA 4LG0A 1GXPA 3WE2A 2AS5F 1EH6A 4WX9A 2GIVA 5ICEA 3DEUA 3KZZA 4LK1F 3VODA 4M74A 1W7PA 1XD7A 3W6JB 4DNCA 2QVOA 1HW1A 4EJUA 2A6EF 2DBBA 2PFBA 3GXOA 3FMSA 3C18A 4EVIA 1HXDA 1FNNA 4HLYA 3ZQ7A 3KP3A 2YU3A 4NB5A 4F7ZA 1W7PB 4L0ZB 2GZWA 2BV6A 1P4WA 1I5ZA 4L9TA 3N4MA 3ZMZA 1XDSA 4K2EA 3K69A 3CTAA 2FE3A 2QENA 4FT8A 2IT0A 1RUOA 2JRTA 1RI7A 1R5HA 1Y0UA 3BP8A 2EA4A 3HHGA 1XCBA 4U0YA 4EM1A 3U1DA 2HR3A 3OOPA 1FSEA 2O8XA 4PGGA 1DPUA 4IHTA 1YFHA 1LB2A 4M73A 2JTVA 4ON0A 3I54A 3KP5A 2W57A 1BBYA 2M45A 2A3SA 5JFRA 2XAFA 3C7JA 1RNLA 5FGMA 1IN6A 1BI3A 2W25A 3FMQA 3GW2A 2FOKA 2KJCA 2PMHA 3WTUC 5F64A 1CF7B 2YR2A 1K6OA 4S05A 4LFUA 3ELKA 4Y13A 3QOPA 2K4BA 5AIQA 3Q5FA 4HV6A 1XGSA 1YTYA 4LLNA 1BI1A 2UXXA 3E6BA 3E6CC 3KFWX 1ON1A 2P7VB 3D0SA 4OINF 3TGNA 1KU2A 2ADUA 1FBUA 4O5VA 1ZG1A 1O7FA 3KEOA 1O7LA 4D0PA 5JR3A 2GXBA 1I27A 5CVUA 3RTRA 2OBPA 1J75A 3DFGA 4Z2YA 1P4AA 1KQ8A 1Z6TA 1S7OA 4XLNF 3WGHA 3WTXC 2V1UA 1YIOA 3GEZA 1SFEA 3VB2A 4ENMA 4OIQF 2PEXA 1IN8A 4RAZA 3JSPA 5CJ9A 1LDDA 5LLQA 5D5UB 4IHSA 1FT9A 1K78B 2BE5F 1I1SA 4A6EA 3TDUC 3V8KA 3GWZA 4A2UA 3RPUA 3PFIA 2CQKA 2FSWA 2EFNA 3TO6A 4UVCA 3BJAA 2XHKA 2MLGA 5TJJA 1OYIA 2GA2A 1ZG3A 3V8JA 5F1RA 2FBHA 4KYWA 1J7KA 4LGWA 3M9AA 3E5XA 5CVJA 1A04A 2F5EA 4L18B 1TQMA 4KUMA 4MEXF 1E2XA 4CDGA 2E1CA 2FF4A 5H20A 4ESFA 3V4GA 1SFXA 3DPTA 1YYVA 1Z9CA 1XGNA 4I7HA 3VOEA 3I0TA 1SFUA 1Z6RA 3KCCA 3K1PA 2D45A 1LJ9A 3F8MA 3L09A 5HS8A 4BQAA 5D5XB 5FD6A 4EM0B 4DQ2A 2A68F 5CVRA 5LEKA 2YPRA 4EQQA 4Y15A 3M1EA 2VBWA 2ZJ2A 1BC8C 1KYZA 1OYYA 4G7OF 4RGRA 4ETSA 1SD6A 5D4RA 1P92A 1FYLA 2O0YA 2RC4A 3DQVC 1ZGAA 1HKTA 2QQBA 5IT9Z 1TQIA 1U5TB 3DXJF 4IF4A 1ZRFA 2L4MA 4LG0B 1LDKB 1HQCA 2RVCA 1RUNA 2CW0F 2ZXJA 5J8FA 3LA2A 1X3UA 5J8CA 2VE9A 4I0BA 2P8TA 2A6HF 5BQTA 4HDUA 2H6BA 2XAHA 2W24A 2EJRA 1BI2A 1XN7A 1DUXC 4EM2A 2M87A 2JSCA 2EV0A 2PI0A 1OPCA 1ZREA 5FB2A 5DDGA 4U0VA 3CUQC 3WGGA 3F72A 1B6AA 5BPDA 4ZYEA 4KNYA 2ZBKA 2K86A 1TTYA 3GF2A 2YSRA 1IF1A 2OZUA 2MH9A 4AD9A 4L9JA 5ILSA 1G3YA 1U6GA 1IN7A 3GX4X 4Y17A 2L4AA 4KMFA 4RB0A 5ICGA 4AIJA 2ZKZA 4RGXA 5DCFA 2TDXA 1YS6A 3LQQA 5HLGA 2XVCA 2O61A 3NEUA 5LGNA 3VEPA 4HQMA 3HTSB 3T1BA 3R4KA 5HS7A 4PGHA 3QU3A 2HGCA 2W84A 5LRRA 3SFZA 3BJ6A 3SXYA 3KE2A 4KIFA 3CO6C 5JI6A 3LA7A 1TBXA 2V9VA 1H9GA 1IXSB 1MJBA 4XBFA 1MDMB 3PQKA 1IUYA 2CWEA 2PQ8A 2R7FA 3K0LA 5FD5A 2V6CA 4M9ZA 1EH7A 3TOBA 2P7CB 2PJPA 4HAMA 2KIFA 2NYXA 4WK8F 2FA5A 2LSOA 4XSZF 4OU0A 2HS5A 4LB6B 1SMTA 5FFZA 3WGIA 4PCQA 3HTUA 5DV5A 3ROUA 2L02A 2LF8A 3F8BA 1FYMA 2ISYA 3L00A 5HVQC 3T8RA 1ON2A 5HOOA 3BROA 1XMAA 4WXHA 4S04A 4GYIA 2MH2A 4A5NA 3C1DA 4E70A 3R60A 3RYPA 3ZN0A 1T38A 3U9GA 2EFQA 4NQWA 2WTEA 3LAJA 4MGRA 1YLFA 2F5DA 4YIFA 1U8RA 4FX0A 1W4MA 5KVRA 5DUIA 4G6QA 2KJBA 4EGYA 3TKYA 5LHGA 2ETHA 2V79A 2DFIA 3FZVA 4G7ZF 4KMUX 2A69F 2P5LC 2WV0A 1ZLJA 1ZHFA 3I53A 1WI9A 2Q0OA 2XAJA 1Z7UA 3J81K 2QUFA 4WXDA 2FQ3A 1P4XA 1ODDA 1STZA 1T0FA 4HQEA 2EFOA 2E1NA 1IRFA 2Y75A 2R7DA 2DU9A 3R0AA 3I59B 1TQPA 3ZMTA 1T6SA 1G4DA 5IT9K 2D1VA 2DO7A 3V8LA 4AWXB 2JPCA 2RKHA 3BWGA 2HZTA 2FEZA 2DI3A 2PN6A 2ZNZA 4EJWA 4KT5C 4HF0A 3IC7A 2NNYA 3WTYC 4UUVA 3VFZA 1YG2A 3FX3A 4OMZA 2VOOA 4YG2F 3TQNA 4CZZA 2HFHA 5K5OA 1EH8A 3BDDA 2EFPA 3D5LA 2VONA 4A0YA 1R5GA 1DP7P 4M9XA 2FXAA 3RKYA 1TNSA 2FBKA 5L3GA 3DP7A 1VTNC 3WTWC 2QQ9A 2RDPA 3QAHA 1LQ1A 3H3ZA 3WTZA 2EWNA 1BIAA 1R58A 1JHFA 3EYIA 3JAMZ 1XSVA 2JPBA 4NHJA 1TLHB 3WTTC 1FY7A 1ONVA 3ABUA 4OOIA 4G6DA 1TNTA 2QLZA 4M9SA 1T39A 1K79A 5E1XA 3BZ6A 3LAPA 1F4KA 5DD4A 3JSOA 1HKQA 4G94A 4HF1A 3QPTA 4YFXF 3EYYA 4P96A 5ERIA 2UZKA 4CYDA 3HRMA 4RGSA 5HS9A 3KP6A 1OR7A 1UFMA 4HW0A 1KQ9A 5F6FA 2Y48A 2HDCA 2XUBA 2NS0A 4AIHA 2XAGA 4KA4A 4GCVA 1SMYF 2P4WA 1XCVA 3BJOA 4O3MA 1FX7A 4LD5A 5LEJA 3J81Z 4HX4A 4UHTA 3MZHA 1YS7A 5A2QZ 5E1WA 2ESHA 1WSUA 1BIBA 1OKRA 5CVVA 2ZCWA 2A5YB 4BH9A 2M8EA 5DYMA 4CXFA 2K7LA 3GFIA 1RIOH 1D8JA 4XLPF 1I6XA 3IWFA 1UCRA 2PMUA 3SZPA 3DV8A 2PBIA 4KIGA 2VODA 2P6TA 5CVIA 5KK1A 2QM3A 2VT2A 1O3SA 3F6VA 3CUQA 2CSOA 3V7CA 1IXRC 3W6KB 2FRHA 1XDUA 2GQQA 1KQ0A 1ZRDA 1FP2A 4RS8A 4L0YB 1HKSA 3KLNA 2IVMA 2D2WA 1USSA 2Z9OA 1FZPB 1YO5C 1IAWA 4ENNA 2H94A 2CO5A 1J0RA 3HOSA 4MQ9F 5CYVA 2KRFA 5HDGA 4UXNA 1JE8A 3J7AO 1D8KA 5LHHA 1I1GA 1XB4A 4HF2A 4QWQA 3FM3A 2HKOA 4G7HF 1JXSA 4OMYA 4JQFA 4EJTA 3ZMUA 3RDIA 3JTGA 3L9FA 4I02A 2CYYA 3NRVA 5A2QK 1HW2A 5D6EA 2MA3A 2GAUA 5L3EA 5D4SA 2M30A 1QBJA 3I64A 2D1HA 3MCZA 2L54A 1HBXG 2ZMEA 5DD8A 2RNJA 4MTEA 3M8FA 1J59A 5ILVA 5E8GA 2HKXA 2R3SA 1ZN2A 3ZMSA 1LEAA 2BYVE 1ZH5A 2DW4A 2XV4S 1UHMA 2IW5A 2HWVA 3MEXA 2IP2A 1ULYA 3T0YA 2OA4A 3F8FA 1UB9A 3K9TA 3FXQA 4KFCA 1MGTA 2DK8A 4LLGF 2OZ6A 5HLHA 3ML6A 5LGTA 3QU6A 5EEGA 1XGOA 4IPAA 4G8XA 2M1BA 2JT1A 5BPIA 4I09A 2COMA 2H6CA 1Z1DA 2EA2A 3RIRA 1HSTA 2VOPA 4BHCA 3OV8A 2Q8KA 2K02A 2VC1A 3F21A 3Q9SA 2RQPA 5IT3A 3MFKA 3HSEA 3RPQA 3I4PA 3AAFA 1L3LA 5BMZA 1R22A 2DAOA 3KP7A 4KDPA 1ZAOA 4WXCA 1R36A 3H3UA 4R79A 2V1XA 1U2WA 4PZJA 4P9UA 1FBSA 3BPXA 1EV7A 1WKMA 3HSRA 4CGZA 2VC0A 3HRSA 5D5VB 3HRUA 4R8HA 4XRFA 1PP8F 2UXNA 5JVTA 1KU3A 3KLOA 3IKTA 1H9TA 3E5QA 2RN7A 5K5RA 2EK5A 4OIOF 4N0BA 4HDVA 4I2OA 1ZLKA 4L5JA 2J5PA 2F2EA 3WE3A 3BOQA 4XSXF 1B4AA 4ASNA 2HYGD 2IJLA 3RI4A 1R23A 4L9NA 2BEOA 4AVPA 2BBYA 1TW3A 3GFMA 4RB2C 3ECOA 1TW2A 1GXQA 2LNBA 3E3VA 3I5UA 5D5WB 1Q1HA 4MNUA 2VBZA 3F23A 3I71A 5H6RA 1DDNA 1E17A 2CGPA 3PQJA 3LFKA 5E8IA 1CF7A 4I01A 3O2PE 4A6DA 2GXGA 3DKWA 5ICCA 1K78A 4AIKA 4CO8A 6PAXA 4UVAA 4HLXA 1FLIA 3CJNA 4ZZLA 3FF5A 3WU0A 1R1VA 2V1DA 1KU7A 2RGVA 1FBQA 4IVNA 3IKVA 5L3CA 5D8LB 4Q48A 3LWFA 3GVAA 2HQRA 1W5SA 2FNAA 4MHGA 2XKPA 2LKPA 3O6BB 5BS6A 3F8CA 4P5OA 3E5UA 4JBAA 3GFJA 1FPQA 3L2CA 4BNCA 5HDNA 5FFXA 1F1ZA 1FSHA 3JTHA 4HX7A 3BPVA 3ZP5A 4UVBA 2PLYA 1MJ9A 2DQLA 1XGMA 2IA1A 3G73A 4ESJA 1G6NA 4CHUA 1S7AA 2F5CA 2DQRA 4YIIA 4B09A 3P9CA 3E6MA 4L5IA 1H0MA 1MJAA 3KETA 5FLXK 2VE8A 1QO0D 4MTDA 3K2ZA 2P5KA 2FNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEQ A;  3ISP A;  3ECH A;  4HV5 A;  4A12 A;  2Y0M A;  4UNO A;  4EMS A;  4RAY A;  4LB5 A;  3KP2 A;  1FYK A;  1V3F A;  2G7U A;  4M72 A;  3ZN1 A;  1FWZ A;  4MQV A;  1U3E M;  1WQ2 A;  3QRF F;  2WC2 A;  4HYE A;  4BAY A;  1JHH A;  3S2W A;  3I58 A;  1FOK A;  2DK5 A;  1CGP A;  3DF8 A;  4N9H A;  1ZAR A;  2EV5 A;  2EFW A;  4ENK A;  4BYY A;  2STT A;  5ED4 A;  3COA C;  4ESB A;  4UV8 A;  2UWM A;  1J9I A;  2HTS A;  1QQI A;  3I59 A;  1MD0 A;  1BI0 A;  5E1Z B;  2QBY A;  2QZ8 A;  3GFL A;  4LLL A;  1T98 A;  1Z91 A;  1B1B A;  2G9W A;  4UV9 A;  2Q2E A;  2QQA A;  3WU1 B;  2GWR A;  1LEB A;  2XAQ A;  4KN4 X;  3B02 A;  3IL2 A;  3N97 A;  1PP7 U;  2ESN A;  3IRQ A;  1KYW A;  3MQ0 A;  1B9N A;  3K1N A;  1G3T A;  3F6O A;  2FBI A;  3BY6 A;  1ZRC A;  4KIC A;  1XSX A;  3TOA A;  3U2R A;  4EGZ A;  3ERE D;  2ZME B;  1HW5 A;  4HBL A;  1WWX A;  4ZYG A;  5L3F A;  4M6X A;  3FWE A;  4YFN F;  3FHZ A;  1YW7 A;  5AON A;  1S29 A;  1D5V A;  1IZ1 A;  4WF2 A;  4MEY F;  2HOE A;  3HSF A;  4Q47 A;  4EJV A;  2BGC A;  3SZT A;  2ISZ A;  3E97 A;  2Z33 A;  2Z5U A;  3GZ5 A;  5EEH A;  1G3W A;  5ICF A;  4EJO A;  3F8N A;  4I98 B;  3M8E A;  5E20 A;  5CLS A;  2C6Y A;  1PDN C;  3FXU A;  1ZGJ A;  3MAJ A;  4IRI A;  1GHC A;  1L0O C;  3K1M A;  5AIP A;  1SAX A;  5HDK A;  3J80 K;  2HEO A;  1UST A;  5L3D A;  4KIB A;  2CFX A;  2HYF A;  2L3D A;  5E17 F;  2M5W A;  3CDH A;  3IHU A;  1G3S A;  3IWZ A;  2FMY A;  5D6F A;  3MZY A;  3WTS C;  3R0J A;  3RKX A;  2LDU A;  2HQN A;  2OAZ A;  3QPH A;  3M7G A;  3CO7 C;  1GVJ A;  2Z99 A;  3DPL C;  3R61 A;  2IA0 A;  1MDM A;  4BHB A;  3REO A;  4LK0 F;  3EQL F;  4G9Y A;  4OIP F;  2VT3 A;  4HA8 A;  3GYH X;  3SHF A;  3TO9 A;  2OQG A;  1OMI A;  1SD5 A;  3HOT A;  1AOY A;  1O57 A;  4BHP A;  2XIG A;  5D8K B;  2STW A;  4A0Z A;  3WOD F;  1AWC A;  4H0E A;  1J2X A;  3WTV C;  1R1U A;  2DTR A;  2ZFW A;  5JHU A;  5FLX Z;  1V4R A;  1Z05 A;  2IA2 A;  1ZYR F;  1QGP A;  4P9F A;  2DLL A;  5LGU A;  3FM5 A;  4BXU A;  5FO5 A;  1LNW A;  2A61 A;  2ZNY A;  2YX7 A;  5K5Q A;  1LDJ A;  1RZ4 A;  4JK1 X;  3EDP A;  3QP6 A;  5TRD A;  1KA8 A;  1FC3 A;  3V7R A;  2HTJ A;  2DT5 A;  2LF7 A;  5ILU A;  1BM9 A;  3ULQ B;  3Q9V A;  4RB3 C;  4HX8 A;  3H92 A;  1F5T A;  4HZF A;  2XKO A;  4ZZD A;  1O3R A;  4Q4Z F;  4YFK F;  1YW8 A;  3T5X A;  3F22 A;  2ACJ A;  4IRG A;  4L9V A;  4CIC A;  3WG9 A;  2AXL A;  2JZY A;  1WRJ A;  2QYO A;  1QPM A;  5LHI A;  1R00 A;  2OD5 A;  2MBF A;  1P6R A;  1F9N A;  4EV0 A;  2FML A;  3ZMV A;  3RKW A;  2E7W A;  4KN7 X;  1S8N A;  2W85 A;  2OU2 A;  4OIR F;  5J6X A;  1KGS A;  1OYW A;  3KP4 A;  1K7A A;  1ZG5 A;  5HLI A;  3P7N A;  4WCG A;  1BJA A;  4U88 A;  1B59 A;  1LVA A;  1SD7 A;  4P55 A;  4ENJ A;  5E18 F;  5L3B A;  1HSJ A;  4ZYD A;  2MLK A;  2NRA C;  3HIF A;  3GUD A;  1D3Y A;  1U78 A;  2KIM A;  3P9I A;  3T8T A;  4FX4 A;  2MC3 A;  3KZY A;  2Z3Y A;  2MD5 A;  1T2K A;  1IW7 F;  2XRO A;  1B9M A;  3E6D A;  4Q5S F;  5DUK A;  4IRH A;  2EB7 A;  1XMK A;  3LA3 A;  1FP1 D;  2ELH A;  1MKM A;  2NNN A;  4U0W A;  1IXC A;  2X4H A;  3LQR A;  2FU4 A;  4QLC U;  1BOA A;  3HRT A;  3TO7 A;  4TV7 A;  4FHT A;  4GXO A;  3RJP A;  2H09 A;  1QZZ A;  3HUG A;  4GO1 A;  2QBY B;  1S3J A;  1REP C;  3LST A;  4B8X A;  2IPQ X;  2RV8 A;  2IRF G;  2A07 F;  5LBQ A;  4R1H A;  1U5T A;  3C3W A;  3R6S A;  2B0L A;  1QNT A;  2H27 A;  2DPD A;  4ZYH A;  2ZO4 A;  3ZMD A;  2XRN A;  1JGS A;  5DCM A;  2O6G E;  3ABT A;  1U5T C;  2OQR A;  2K27 A;  3TDZ C;  2KIU A;  2XAS A;  4U7B A;  1O3Q A;  3G3Z A;  3J80 Z;  2VBX A;  3CLO A;  1NHA A;  3EET A;  2XGX A;  1QZY A;  2GA1 A;  3HYI A;  4HOB A;  4RB1 A;  1DPR A;  3RYR A;  2X0L A;  1IRG A;  3F3X A;  3P9K A;  1KU9 A;  3GLX A;  3CUO A;  3QP5 A;  4A0X A;  1C0W A;  2PG4 A;  4O6J A;  3EUH A;  3FMR A;  2J5O A;  3V7S A;  1XSD A;  5H6Q A;  2DPU A;  3GO5 A;  4PDK A;  4I0A A;  2P6S A;  1W7P D;  2KKO A;  2WWY A;  4IJA A;  2QWW A;  3CUQ B;  4A5M A;  3ZPL A;  1SD4 A;  2P5V A;  2F5F A;  1S6L A;  1BC7 C;  4GYG A;  3B73 A;  1IN4 A;  3MWM A;  5DCM B;  4LMY A;  3FXR A;  4RGU A;  3NQO A;  1R1T A;  4GGG A;  4WWC A;  1MZB A;  1PUE E;  1J5Y A;  1P2F A;  3KEQ A;  2YX4 A;  4M6Y A;  2G7H A;  4IXA A;  1BN5 A;  4ZH4 F;  4M71 A;  2VXZ A;  1YW9 A;  3SQN A;  2L01 A;  4LJZ F;  2VN2 A;  2VBY A;  2O03 A;  3GZ6 A;  1IN5 A;  3JW4 A;  2K4J A;  5BOX A;  1R7J A;  1O3T A;  2E7X A;  3IRR A;  1W5T A;  2O3F A;  1YQA A;  3JAM K;  5K1Y A;  3HHH A;  2CG4 A;  2EV6 A;  1UHW A;  3L7W A;  2NAZ A;  3O3K A;  4N9I A;  4U7D A;  5LRS A;  4LG0 A;  1GXP A;  3WE2 A;  2AS5 F;  1EH6 A;  4WX9 A;  2GIV A;  5ICE A;  3DEU A;  3KZZ A;  4LK1 F;  3VOD A;  4M74 A;  1W7P A;  1XD7 A;  3W6J B;  4DNC A;  2QVO A;  1HW1 A;  4EJU A;  2A6E F;  2DBB A;  2PFB A;  3GXO A;  3FMS A;  3C18 A;  4EVI A;  1HXD A;  1FNN A;  4HLY A;  3ZQ7 A;  3KP3 A;  2YU3 A;  4NB5 A;  4F7Z A;  1W7P B;  4L0Z B;  2GZW A;  2BV6 A;  1P4W A;  1I5Z A;  4L9T A;  3N4M A;  3ZMZ A;  1XDS A;  4K2E A;  3K69 A;  3CTA A;  2FE3 A;  2QEN A;  4FT8 A;  2IT0 A;  1RUO A;  2JRT A;  1RI7 A;  1R5H A;  1Y0U A;  3BP8 A;  2EA4 A;  3HHG A;  1XCB A;  4U0Y A;  4EM1 A;  3U1D A;  2HR3 A;  3OOP A;  1FSE A;  2O8X A;  4PGG A;  1DPU A;  4IHT A;  1YFH A;  1LB2 A;  4M73 A;  2JTV A;  4ON0 A;  3I54 A;  3KP5 A;  2W57 A;  1BBY A;  2M45 A;  2A3S A;  5JFR A;  2XAF A;  3C7J A;  1RNL A;  5FGM A;  1IN6 A;  1BI3 A;  2W25 A;  3FMQ A;  3GW2 A;  2FOK A;  2KJC A;  2PMH A;  3WTU C;  5F64 A;  1CF7 B;  2YR2 A;  1K6O A;  4S05 A;  4LFU A;  3ELK A;  4Y13 A;  3QOP A;  2K4B A;  5AIQ A;  3Q5F A;  4HV6 A;  1XGS A;  1YTY A;  4LLN A;  1BI1 A;  2UXX A;  3E6B A;  3E6C C;  3KFW X;  1ON1 A;  2P7V B;  3D0S A;  4OIN F;  3TGN A;  1KU2 A;  2ADU A;  1FBU A;  4O5V A;  1ZG1 A;  1O7F A;  3KEO A;  1O7L A;  4D0P A;  5JR3 A;  2GXB A;  1I27 A;  5CVU A;  3RTR A;  2OBP A;  1J75 A;  3DFG A;  4Z2Y A;  1P4A A;  1KQ8 A;  1Z6T A;  1S7O A;  4XLN F;  3WGH A;  3WTX C;  2V1U A;  1YIO A;  3GEZ A;  1SFE A;  3VB2 A;  4ENM A;  4OIQ F;  2PEX A;  1IN8 A;  4RAZ A;  3JSP A;  5CJ9 A;  1LDD A;  5LLQ A;  5D5U B;  4IHS A;  1FT9 A;  1K78 B;  2BE5 F;  1I1S A;  4A6E A;  3TDU C;  3V8K A;  3GWZ A;  4A2U A;  3RPU A;  3PFI A;  2CQK A;  2FSW A;  2EFN A;  3TO6 A;  4UVC A;  3BJA A;  2XHK A;  2MLG A;  5TJJ A;  1OYI A;  2GA2 A;  1ZG3 A;  3V8J A;  5F1R A;  2FBH A;  4KYW A;  1J7K A;  4LGW A;  3M9A A;  3E5X A;  5CVJ A;  1A04 A;  2F5E A;  4L18 B;  1TQM A;  4KUM A;  4MEX F;  1E2X A;  4CDG A;  2E1C A;  2FF4 A;  5H20 A;  4ESF A;  3V4G A;  1SFX A;  3DPT A;  1YYV A;  1Z9C A;  1XGN A;  4I7H A;  3VOE A;  3I0T A;  1SFU A;  1Z6R A;  3KCC A;  3K1P A;  2D45 A;  1LJ9 A;  3F8M A;  3L09 A;  5HS8 A;  4BQA A;  5D5X B;  5FD6 A;  4EM0 B;  4DQ2 A;  2A68 F;  5CVR A;  5LEK A;  2YPR A;  4EQQ A;  4Y15 A;  3M1E A;  2VBW A;  2ZJ2 A;  1BC8 C;  1KYZ A;  1OYY A;  4G7O F;  4RGR A;  4ETS A;  1SD6 A;  5D4R A;  1P92 A;  1FYL A;  2O0Y A;  2RC4 A;  3DQV C;  1ZGA A;  1HKT A;  2QQB A;  5IT9 Z;  1TQI A;  1U5T B;  3DXJ F;  4IF4 A;  1ZRF A;  2L4M A;  4LG0 B;  1LDK B;  1HQC A;  2RVC A;  1RUN A;  2CW0 F;  2ZXJ A;  5J8F A;  3LA2 A;  1X3U A;  5J8C A;  2VE9 A;  4I0B A;  2P8T A;  2A6H F;  5BQT A;  4HDU A;  2H6B A;  2XAH A;  2W24 A;  2EJR A;  1BI2 A;  1XN7 A;  1DUX C;  4EM2 A;  2M87 A;  2JSC A;  2EV0 A;  2PI0 A;  1OPC A;  1ZRE A;  5FB2 A;  5DDG A;  4U0V A;  3CUQ C;  3WGG A;  3F72 A;  1B6A A;  5BPD A;  4ZYE A;  4KNY A;  2ZBK A;  2K86 A;  1TTY A;  3GF2 A;  2YSR A;  1IF1 A;  2OZU A;  2MH9 A;  4AD9 A;  4L9J A;  5ILS A;  1G3Y A;  1U6G A;  1IN7 A;  3GX4 X;  4Y17 A;  2L4A A;  4KMF A;  4RB0 A;  5ICG A;  4AIJ A;  2ZKZ A;  4RGX A;  5DCF A;  2TDX A;  1YS6 A;  3LQQ A;  5HLG A;  2XVC A;  2O61 A;  3NEU A;  5LGN A;  3VEP A;  4HQM A;  3HTS B;  3T1B A;  3R4K A;  5HS7 A;  4PGH A;  3QU3 A;  2HGC A;  2W84 A;  5LRR A;  3SFZ A;  3BJ6 A;  3SXY A;  3KE2 A;  4KIF A;  3CO6 C;  5JI6 A;  3LA7 A;  1TBX A;  2V9V A;  1H9G A;  1IXS B;  1MJB A;  4XBF A;  1MDM B;  3PQK A;  1IUY A;  2CWE A;  2PQ8 A;  2R7F A;  3K0L A;  5FD5 A;  2V6C A;  4M9Z A;  1EH7 A;  3TOB A;  2P7C B;  2PJP A;  4HAM A;  2KIF A;  2NYX A;  4WK8 F;  2FA5 A;  2LSO A;  4XSZ F;  4OU0 A;  2HS5 A;  4LB6 B;  1SMT A;  5FFZ A;  3WGI A;  4PCQ A;  3HTU A;  5DV5 A;  3ROU A;  2L02 A;  2LF8 A;  3F8B A;  1FYM A;  2ISY A;  3L00 A;  5HVQ C;  3T8R A;  1ON2 A;  5HOO A;  3BRO A;  1XMA A;  4WXH A;  4S04 A;  4GYI A;  2MH2 A;  4A5N A;  3C1D A;  4E70 A;  3R60 A;  3RYP A;  3ZN0 A;  1T38 A;  3U9G A;  2EFQ A;  4NQW A;  2WTE A;  3LAJ A;  4MGR A;  1YLF A;  2F5D A;  4YIF A;  1U8R A;  4FX0 A;  1W4M A;  5KVR A;  5DUI A;  4G6Q A;  2KJB A;  4EGY A;  3TKY A;  5LHG A;  2ETH A;  2V79 A;  2DFI A;  3FZV A;  4G7Z F;  4KMU X;  2A69 F;  2P5L C;  2WV0 A;  1ZLJ A;  1ZHF A;  3I53 A;  1WI9 A;  2Q0O A;  2XAJ A;  1Z7U A;  3J81 K;  2QUF A;  4WXD A;  2FQ3 A;  1P4X A;  1ODD A;  1STZ A;  1T0F A;  4HQE A;  2EFO A;  2E1N A;  1IRF A;  2Y75 A;  2R7D A;  2DU9 A;  3R0A A;  3I59 B;  1TQP A;  3ZMT A;  1T6S A;  1G4D A;  5IT9 K;  2D1V A;  2DO7 A;  3V8L A;  4AWX B;  2JPC A;  2RKH A;  3BWG A;  2HZT A;  2FEZ A;  2DI3 A;  2PN6 A;  2ZNZ A;  4EJW A;  4KT5 C;  4HF0 A;  3IC7 A;  2NNY A;  3WTY C;  4UUV A;  3VFZ A;  1YG2 A;  3FX3 A;  4OMZ A;  2VOO A;  4YG2 F;  3TQN A;  4CZZ A;  2HFH A;  5K5O A;  1EH8 A;  3BDD A;  2EFP A;  3D5L A;  2VON A;  4A0Y A;  1R5G A;  1DP7 P;  4M9X A;  2FXA A;  3RKY A;  1TNS A;  2FBK A;  5L3G A;  3DP7 A;  1VTN C;  3WTW C;  2QQ9 A;  2RDP A;  3QAH A;  1LQ1 A;  3H3Z A;  3WTZ A;  2EWN A;  1BIA A;  1R58 A;  1JHF A;  3EYI A;  3JAM Z;  1XSV A;  2JPB A;  4NHJ A;  1TLH B;  3WTT C;  1FY7 A;  1ONV A;  3ABU A;  4OOI A;  4G6D A;  1TNT A;  2QLZ A;  4M9S A;  1T39 A;  1K79 A;  5E1X A;  3BZ6 A;  3LAP A;  1F4K A;  5DD4 A;  3JSO A;  1HKQ A;  4G94 A;  4HF1 A;  3QPT A;  4YFX F;  3EYY A;  4P96 A;  5ERI A;  2UZK A;  4CYD A;  3HRM A;  4RGS A;  5HS9 A;  3KP6 A;  1OR7 A;  1UFM A;  4HW0 A;  1KQ9 A;  5F6F A;  2Y48 A;  2HDC A;  2XUB A;  2NS0 A;  4AIH A;  2XAG A;  4KA4 A;  4GCV A;  1SMY F;  2P4W A;  1XCV A;  3BJO A;  4O3M A;  1FX7 A;  4LD5 A;  5LEJ A;  3J81 Z;  4HX4 A;  4UHT A;  3MZH A;  1YS7 A;  5A2Q Z;  5E1W A;  2ESH A;  1WSU A;  1BIB A;  1OKR A;  5CVV A;  2ZCW A;  2A5Y B;  4BH9 A;  2M8E A;  5DYM A;  4CXF A;  2K7L A;  3GFI A;  1RIO H;  1D8J A;  4XLP F;  1I6X A;  3IWF A;  1UCR A;  2PMU A;  3SZP A;  3DV8 A;  2PBI A;  4KIG A;  2VOD A;  2P6T A;  5CVI A;  5KK1 A;  2QM3 A;  2VT2 A;  1O3S A;  3F6V A;  3CUQ A;  2CSO A;  3V7C A;  1IXR C;  3W6K B;  2FRH A;  1XDU A;  2GQQ A;  1KQ0 A;  1ZRD A;  1FP2 A;  4RS8 A;  4L0Y B;  1HKS A;  3KLN A;  2IVM A;  2D2W A;  1USS A;  2Z9O A;  1FZP B;  1YO5 C;  1IAW A;  4ENN A;  2H94 A;  2CO5 A;  1J0R A;  3HOS A;  4MQ9 F;  5CYV A;  2KRF A;  5HDG A;  4UXN A;  1JE8 A;  3J7A O;  1D8K A;  5LHH A;  1I1G A;  1XB4 A;  4HF2 A;  4QWQ A;  3FM3 A;  2HKO A;  4G7H F;  1JXS A;  4OMY A;  4JQF A;  4EJT A;  3ZMU A;  3RDI A;  3JTG A;  3L9F A;  4I02 A;  2CYY A;  3NRV A;  5A2Q K;  1HW2 A;  5D6E A;  2MA3 A;  2GAU A;  5L3E A;  5D4S A;  2M30 A;  1QBJ A;  3I64 A;  2D1H A;  3MCZ A;  2L54 A;  1HBX G;  2ZME A;  5DD8 A;  2RNJ A;  4MTE A;  3M8F A;  1J59 A;  5ILV A;  5E8G A;  2HKX A;  2R3S A;  1ZN2 A;  3ZMS A;  1LEA A;  2BYV E;  1ZH5 A;  2DW4 A;  2XV4 S;  1UHM A;  2IW5 A;  2HWV A;  3MEX A;  2IP2 A;  1ULY A;  3T0Y A;  2OA4 A;  3F8F A;  1UB9 A;  3K9T A;  3FXQ A;  4KFC A;  1MGT A;  2DK8 A;  4LLG F;  2OZ6 A;  5HLH A;  3ML6 A;  5LGT A;  3QU6 A;  5EEG A;  1XGO A;  4IPA A;  4G8X A;  2M1B A;  2JT1 A;  5BPI A;  4I09 A;  2COM A;  2H6C A;  1Z1D A;  2EA2 A;  3RIR A;  1HST A;  2VOP A;  4BHC A;  3OV8 A;  2Q8K A;  2K02 A;  2VC1 A;  3F21 A;  3Q9S A;  2RQP A;  5IT3 A;  3MFK A;  3HSE A;  3RPQ A;  3I4P A;  3AAF A;  1L3L A;  5BMZ A;  1R22 A;  2DAO A;  3KP7 A;  4KDP A;  1ZAO A;  4WXC A;  1R36 A;  3H3U A;  4R79 A;  2V1X A;  1U2W A;  4PZJ A;  4P9U A;  1FBS A;  3BPX A;  1EV7 A;  1WKM A;  3HSR A;  4CGZ A;  2VC0 A;  3HRS A;  5D5V B;  3HRU A;  4R8H A;  4XRF A;  1PP8 F;  2UXN A;  5JVT A;  1KU3 A;  3KLO A;  3IKT A;  1H9T A;  3E5Q A;  2RN7 A;  5K5R A;  2EK5 A;  4OIO F;  4N0B A;  4HDV A;  4I2O A;  1ZLK A;  4L5J A;  2J5P A;  2F2E A;  3WE3 A;  3BOQ A;  4XSX F;  1B4A A;  4ASN A;  2HYG D;  2IJL A;  3RI4 A;  1R23 A;  4L9N A;  2BEO A;  4AVP A;  2BBY A;  1TW3 A;  3GFM A;  4RB2 C;  3ECO A;  1TW2 A;  1GXQ A;  2LNB A;  3E3V A;  3I5U A;  5D5W B;  1Q1H A;  4MNU A;  2VBZ A;  3F23 A;  3I71 A;  5H6R A;  1DDN A;  1E17 A;  2CGP A;  3PQJ A;  3LFK A;  5E8I A;  1CF7 A;  4I01 A;  3O2P E;  4A6D A;  2GXG A;  3DKW A;  5ICC A;  1K78 A;  4AIK A;  4CO8 A;  6PAX A;  4UVA A;  4HLX A;  1FLI A;  3CJN A;  4ZZL A;  3FF5 A;  3WU0 A;  1R1V A;  2V1D A;  1KU7 A;  2RGV A;  1FBQ A;  4IVN A;  3IKV A;  5L3C A;  5D8L B;  4Q48 A;  3LWF A;  3GVA A;  2HQR A;  1W5S A;  2FNA A;  4MHG A;  2XKP A;  2LKP A;  3O6B B;  5BS6 A;  3F8C A;  4P5O A;  3E5U A;  4JBA A;  3GFJ A;  1FPQ A;  3L2C A;  4BNC A;  5HDN A;  5FFX A;  1F1Z A;  1FSH A;  3JTH A;  4HX7 A;  3BPV A;  3ZP5 A;  4UVB A;  2PLY A;  1MJ9 A;  2DQL A;  1XGM A;  2IA1 A;  3G73 A;  4ESJ A;  1G6N A;  4CHU A;  1S7A A;  2F5C A;  2DQR A;  4YII A;  4B09 A;  3P9C A;  3E6M A;  4L5I A;  1H0M A;  1MJA A;  3KET A;  5FLX K;  2VE8 A;  1QO0 D;  4MTD A;  3K2Z A;  2P5K A;  2FNP A; 
#chains in the Genus database with same CATH topology
 1MBH A;  5DEQ A;  3JRG A;  3ISP A;  2LBF A;  2CRG A;  3ECH A;  4HV5 A;  4A12 A;  3PO3 J;  2Y0M A;  4B43 A;  2BHZ A;  4UNO A;  2DDB A;  4XKB A;  4EMS A;  4PFO A;  3PNT A;  4RAY A;  1HOM A;  4LB5 A;  4A3K J;  4F91 B;  3KP2 A;  1FYK A;  1V3F A;  3OYL A;  2G7U A;  4M72 A;  3ZN1 A;  1FWZ A;  4MQV A;  1W36 D;  1I3A A;  3A01 A;  1BW6 A;  5FRM A;  3DU5 A;  4BJ5 C;  4A3D J;  1U3E M;  1WQ2 A;  2VJI A;  3BG5 A;  4AYB N;  3HXL A;  5J4Y A;  2A6T A;  2WC2 A;  4HYE A;  4BAY A;  3QRF F;  1VQ4 I;  1JHH A;  3MVP A;  3QYE A;  3S2W A;  3I58 A;  1FOK A;  2IXS A;  2DK5 A;  3UKG A;  1CGP A;  5DS9 A;  3DF8 A;  4N9H A;  2QQ8 A;  1ZAR A;  3BG3 A;  3HUG B;  2Y0S N;  1RET A;  2EV5 A;  2EFW A;  2F5V A;  2EZL A;  4MIM A;  2E34 A;  4ENK A;  1E3O C;  2EIL H;  4BYY A;  4QIW N;  2K9Q A;  2STT A;  1PVE A;  2LP0 A;  5ED4 A;  2OTL I;  3COA C;  4ESB A;  4UV8 A;  2UWM A;  1J9I A;  2HTS A;  1QQI A;  1WGX A;  3I59 A;  1MD0 A;  1BI0 A;  2TRT A;  5GTH C;  5E1Z B;  2V26 A;  2QZ8 A;  2QBY A;  3WHC A;  1OFC X;  3GFL A;  3BR3 A;  1NTC A;  1T98 A;  4LLL A;  2NVU B;  1Z91 A;  5GPA A;  1B1B A;  1POG A;  2G9W A;  3HKZ A;  4IZZ A;  4UV9 A;  3CCS I;  3TBI A;  2Q2E A;  2K9M A;  4RLQ A;  2QQA A;  3WU1 B;  2GWR A;  2F4O B;  5IP6 A;  5FKK A;  1BL0 A;  2ZJR F;  2XF6 A;  2ZB9 A;  2E2J J;  1LEB A;  2L7F P;  1D0Z A;  1RES A;  2XAQ A;  4KN4 X;  2Z16 A;  3B02 A;  3IL2 A;  4ZJZ A;  1OCP A;  4IHX A;  1IV6 A;  3N97 A;  1PP7 U;  3ZQQ A;  2ESN A;  2CQX A;  3IRQ A;  1KYW A;  1ENH A;  3OYJ A;  3MQ0 A;  5IYB J;  1B9N A;  2KIQ A;  5GTI C;  4PFP A;  1ZR4 A;  1NH3 A;  3K1N A;  1G3T A;  5GPC A;  2K85 A;  3F6O A;  3CLQ A;  1UG2 A;  2FBI A;  3DEE A;  3BY6 A;  1ZRC A;  3CCJ I;  4KIC A;  5F0F A;  3CME I;  1XSX A;  3TOA A;  3U2R A;  4EGZ A;  3ERE D;  2ICW G;  2ZME B;  1HW5 A;  4HBL A;  2E5Z A;  1WWX A;  2XF7 A;  4ZYG A;  5L3F A;  1WJB A;  5EZG A;  2R5Z A;  4M6X A;  4BL0 B;  2CMP A;  3OYA A;  3FWE A;  4YFN F;  2W4S A;  4MFD A;  3FHZ A;  4FTH A;  1YW7 A;  2VLA A;  5AON A;  2LOO A;  1S29 A;  1D5V A;  1IZ1 A;  4WF2 A;  4B1R A;  4MEY F;  2HOE A;  3HSF A;  4Q47 A;  4EJV A;  1ZK8 A;  2BGC A;  2EBI A;  3SZT A;  3K6G A;  2QA4 I;  5EZH A;  2ISZ A;  3E97 A;  2Z33 A;  3HDD A;  2Z5U A;  2R5Y A;  2GIZ A;  3GZ5 A;  5EEH A;  1G3W A;  4PSX A;  5ICF A;  4EJO A;  3F8N A;  4I98 B;  1IUF A;  3M8E A;  5E20 A;  1FJL A;  4Y33 A;  5FRN A;  3X2Q H;  4UY8 I;  5CLS A;  2LY2 A;  2C6Y A;  1K83 J;  1PDN C;  3FXU A;  1ZGJ A;  3ESW B;  3MAJ A;  2KPM A;  1ZR2 A;  4IRI A;  1GHC A;  1L0O C;  3K1M A;  3LMM A;  1VQP I;  2X6Y A;  5AIP A;  1SAX A;  5HDK A;  3J80 K;  2HEO A;  1UST A;  2GOX B;  5L3D A;  3OYE A;  4AC0 A;  4B3X A;  4KIB A;  1Y6I A;  2CFX A;  2DJI A;  3RCO A;  2HYF A;  2Z2S B;  4D1Q A;  2L3D A;  3GTL J;  4AYB A;  2ID6 A;  1TT0 A;  3W2V A;  5E17 F;  2M5W A;  3CDH A;  1WJ5 A;  3IHU A;  1G3S A;  3IWZ A;  3Q0W A;  2FMY A;  3S1N J;  3OMY A;  1YIT I;  2GM4 A;  5EJC A;  5D6F A;  3MZY A;  3WTS C;  3R0J A;  4KIT B;  3RKX A;  3QQA A;  2QEX I;  2LDU A;  4A3E J;  1E3H A;  1X4O A;  4C9Y A;  1GV2 A;  2CU7 A;  2HQN A;  2OAZ A;  3VYS B;  1MSE C;  4BDY A;  3EUH C;  3H9J A;  3QPH A;  3M7G A;  3CO7 C;  1GVJ A;  2Z99 A;  3IUO A;  4L5E A;  3DPL C;  2WB1 A;  3R61 A;  2IA0 A;  1Y1W J;  1MDM A;  4BHB A;  4A3J J;  3REO A;  4LK0 F;  3EQL F;  4XN0 A;  2ME6 A;  4S0H B;  1TL8 A;  4G9Y A;  1JUP A;  5FLM J;  1Z3X A;  3JRC A;  4OIP F;  2VT3 A;  1SVL A;  4HA8 A;  5J3L A;  3GYH X;  3FXO A;  4DYC A;  3FXM A;  3SHF A;  3TO9 A;  3CCM I;  2JVH A;  1PJR A;  2OQG A;  1YX3 A;  1RC9 A;  1OMI A;  1SD5 A;  3HOT A;  4AUX A;  3JRI A;  2WA0 A;  1AOY A;  1O57 A;  4BHP A;  1D1B A;  2XIG A;  5D8K B;  4M3F A;  2STW A;  2RQQ A;  4A0Z A;  3WOD F;  1AWC A;  4H0E A;  1J2X A;  3WTV C;  1R1U A;  2DTR A;  5IY5 H;  3ZQL A;  2ZFW A;  5JHU A;  2R0Q C;  5FLX Z;  1V4R A;  3RZO J;  1Z05 A;  2HDW A;  4XL9 A;  2IA2 A;  3MKY B;  1ZYR F;  1YOV B;  1ZQ3 P;  1FIP A;  1A5J A;  2F4M B;  1ETY A;  2HYJ A;  1QGP A;  4P9F A;  1TWG J;  2DLL A;  3CCR I;  5LGU A;  2Y9Y A;  4I99 C;  3FM5 A;  4BXU A;  1GLN A;  5FO5 A;  1LNW A;  1MNE A;  2A61 A;  2ZNY A;  2E71 A;  2ZXI A;  2YX7 A;  2V1N A;  2X6X A;  1F36 A;  5K5Q A;  1E3P A;  4XQF A;  2OJE D;  3A02 A;  1JI8 A;  1LDJ A;  1U9O A;  1RZ4 A;  4JK1 X;  3EDP A;  3QP6 A;  5TRD A;  1KA8 A;  1FC3 A;  3V7R A;  2HTJ A;  2DT5 A;  2LF7 A;  1JGG A;  5ILU A;  1BM9 A;  3ULQ B;  2Y2Z A;  3Q9V A;  4RB3 C;  2OCE A;  3G1L A;  3M8J A;  3D5R C;  4HX8 A;  2IS2 A;  3H92 A;  1F5T A;  1Y8R B;  3BG7 A;  4HZF A;  2XKO A;  4ZZD A;  1O3R A;  3H3V K;  4Q4Z F;  3W6V A;  4YFK F;  3GTO J;  1YW8 A;  2M9H A;  2WAE A;  3T5X A;  3IH3 A;  3SEQ A;  3F22 A;  2ACJ A;  3GCM A;  4IRG A;  4L9V A;  4M3B A;  4CIC A;  4V2F A;  3WG9 A;  2DFF A;  2AXL A;  4ZTJ A;  1DGR M;  2DYS H;  4XMY A;  2JZY A;  4RMN A;  1WRJ A;  2HPI A;  2QYO A;  2IS4 A;  1QPM A;  5LHI A;  1HDD C;  1R00 A;  4IL6 C;  2OD5 A;  2MBF A;  2VB6 A;  1P6R A;  1F9N A;  1WJE A;  1TWC J;  2FML A;  3ZMV A;  4EV0 A;  1R71 A;  1HLV A;  3RKW A;  4DOZ A;  1LUJ B;  3MD2 A;  2E7W A;  2LH9 A;  3CDI A;  4JYK A;  4KN7 X;  1S8N A;  2W85 A;  1HDP A;  3ABM H;  4B48 A;  2OU2 A;  1R4M B;  4JP0 A;  4OIR F;  3E1S A;  2BY1 A;  2P0W A;  5J6X A;  1KGS A;  3OR2 C;  5F1J A;  4II2 A;  5IOY A;  3SJM A;  2UV1 A;  3DPU A;  1OYW A;  2NVX J;  3KP4 A;  1RRJ A;  1K7A A;  5M5Y J;  5HLI A;  1ZG5 A;  1K4S A;  3ZQI A;  3P7N A;  2L9N A;  2BY3 A;  4WCG A;  3OOU A;  1BJA A;  4BU2 A;  4U88 A;  1B59 A;  1LVA A;  1SD7 A;  2VUM J;  4P55 A;  3GBG A;  2O5R A;  1ETQ A;  4ENJ A;  2YU9 J;  2DJN A;  5E18 F;  2WAQ N;  5L3B A;  1LFU P;  2OV7 A;  1HSJ A;  2X51 A;  2MFZ A;  3DTK A;  4ZYD A;  4QTR A;  4BGD A;  2MLK A;  2ZC2 A;  3HIF A;  2NRA C;  3GUD A;  3FK7 A;  4MLO A;  1D3Y A;  3TP0 A;  1U78 A;  2KIM A;  2XPV A;  4KIS A;  3P9I A;  3T8T A;  2GLO A;  2X9D A;  4FX4 A;  2MC3 A;  3KZY A;  2Z3Y A;  2MD5 A;  4W1U A;  3PFY A;  4AID A;  3JRD A;  2M4K A;  4BJ6 C;  4A3B J;  1F43 A;  4FE7 A;  4E4H A;  4D5F A;  1T2K A;  1IW7 F;  1B9M A;  3SEZ A;  3E6D A;  2XRO A;  4Q5S F;  5DUK A;  4IRH A;  4BBR J;  2PJR A;  2EB7 A;  2DA3 A;  1XMK A;  3LA3 A;  4NQW B;  4HNU A;  1FP1 D;  2ELH A;  3I4N J;  1LE8 B;  1MKM A;  2NNN A;  4U0W A;  1IXC A;  4DYQ A;  2X4H A;  4DW6 A;  2QKM B;  3LQR A;  2FU4 A;  3Q0V A;  4QLC U;  1BOA A;  2LR8 A;  3HRT A;  2IGO A;  4IEJ A;  3TO7 A;  4TV7 A;  4A3L J;  4FHT A;  4GXO A;  2BXY A;  3RJP A;  1TP4 A;  2H09 A;  1QZZ A;  3HUG A;  4GO1 A;  4IQJ A;  3BR0 A;  2QBY B;  3DBL B;  3WU2 C;  1OIS A;  1S3J A;  2OTJ I;  1K6Y A;  1REP C;  3LST A;  4B8X A;  2IPQ X;  2RV8 A;  2IRF G;  2A07 F;  5LBQ A;  1IRZ A;  4R1H A;  1IDZ A;  1D0Y A;  1U5T A;  3C3W A;  3R6S A;  3K10 A;  2B0L A;  5TGT A;  5HLT A;  1AHD P;  2ZJP F;  1QNT A;  2H27 A;  4A3G J;  2DPD A;  3CCY A;  4ZYH A;  2ZO4 A;  3ZMD A;  2XRN A;  3CMM A;  3K4J A;  4XOR A;  1JGS A;  3LFU A;  5DCM A;  2O6G E;  3PO2 J;  4BXX J;  3ABT A;  1U5T C;  3BTI A;  2OQR A;  2K27 A;  4HSR A;  3TDZ C;  5JVG F;  2TCT A;  2KIU A;  2XSD C;  2XAS A;  3SYT A;  4U7B A;  1O3Q A;  3PUF A;  5B3S H;  2KT0 A;  3G3Z A;  3DWL E;  2LC2 A;  5J40 A;  3PNY A;  3J80 Z;  2H1L A;  2VBX A;  2BZT A;  3CLO A;  1ZGW A;  2NVT J;  2DFE A;  2V7F A;  3CC2 I;  1NHA A;  3TL4 X;  1IRX A;  5HNF A;  1LVK A;  2DMU A;  3EET A;  2XGX A;  1JKQ C;  1QZY A;  3K70 D;  2GA1 A;  3HYI A;  4HOB A;  4RB1 A;  1DPR A;  3RYR A;  1ETV A;  2X0L A;  1IRG A;  4D9J A;  3CCQ I;  3F3X A;  3P9K A;  1KU9 A;  2IGK A;  4BY1 J;  2MAB A;  3GLX A;  5IP7 J;  3CUO A;  1XS9 A;  2CUZ A;  3QP5 A;  4A0X A;  2O8K A;  3HOY J;  3CJQ B;  1C0W A;  3S1M J;  2PG4 A;  4O6J A;  3EUH A;  3FMR A;  4FIS A;  2K3P A;  2J5O A;  3V7S A;  1XSD A;  5H6Q A;  2DPU A;  3GO5 A;  2K40 A;  4I0A A;  4PDK A;  2Y9Z A;  2P6S A;  4IX7 A;  1W7P D;  2KKO A;  2K5C A;  1QVT A;  3OYG A;  3FK6 A;  4IJA A;  2WWY A;  2QWW A;  3CUQ B;  4A5M A;  3ZPL A;  3SDG A;  1SD4 A;  4IHY A;  2P5V A;  2F5F A;  1S6L A;  3PSI A;  1BC7 C;  3OYC A;  3VWB A;  5J1R A;  2IGN A;  1T56 A;  1A6I A;  1D1C A;  3GTM J;  4GYG A;  1MBG A;  4UUT A;  5KHD A;  2FJ1 A;  3AFH A;  3CZ6 A;  3B73 A;  1IN4 A;  3MWM A;  2MGQ A;  5DCM B;  4LMY A;  2L7M P;  3FXR A;  2R93 J;  3A0B C;  4RGU A;  3KIO A;  2V9K A;  3VYU B;  2HOS A;  3NQO A;  1R1T A;  4GGG A;  4XKW A;  4WWC A;  1MZB A;  2Y30 A;  4B47 A;  3VYR B;  1PUE E;  1J5Y A;  2IGM A;  4IOC F;  4C2U A;  4XKC A;  1P2F A;  4C3J J;  4BXF A;  3G1M A;  1AU7 A;  2E2H J;  3KEQ A;  2YX4 A;  4M6Y A;  2G7H A;  4IXA A;  4CZC A;  3BZC A;  1BN5 A;  2MW8 A;  3E7L A;  4AVZ A;  4ZH4 F;  3QOD A;  1JKR C;  4M71 A;  2VXZ A;  4V19 K;  1YW9 A;  5TIS C;  1MSF C;  3M3Y J;  3ONQ A;  2I10 A;  2L01 A;  3SQN A;  3W2W A;  4LJZ F;  1Y0N A;  2VN2 A;  2WBM A;  1JKP C;  2VBY A;  2O03 A;  2BHY A;  3PNV A;  1MMN A;  4UB8 C;  2DA5 A;  1IN5 A;  2K9L A;  3JW4 A;  5FRO A;  2K4J A;  3GZ6 A;  5BOX A;  1R7J A;  4Y3O A;  3OS2 A;  1O3T A;  5CKT A;  2E7X A;  1X1B A;  3OSF A;  1P7I A;  5LD2 C;  4CUG A;  1KZH A;  3IRR A;  5E3M A;  1W5T A;  2O3F A;  1FTT A;  1YQA A;  3ZQC A;  2DTZ A;  3JAM K;  5K1Y A;  3HHH A;  2CG4 A;  3LOC A;  5F27 A;  2EV6 A;  1UHW A;  3L7W A;  2M8G X;  2NAZ A;  4BKX A;  3O3K A;  4N4N B;  3LSI A;  1YJ9 I;  5M3F J;  9ANT A;  1GUU A;  4N9I A;  5M5X J;  1VQO I;  2NVQ J;  4U7D A;  4OAY A;  5LRS A;  4LG0 A;  1JJ6 C;  1GXP A;  1ETK A;  3L2Q A;  2H1K A;  3WE2 A;  3F0C A;  2K3F A;  2AS5 F;  1EH6 A;  4WX9 A;  2GIV A;  2MYS A;  5ICE A;  3DEU A;  2L7Z A;  3OL3 A;  2ZXH A;  3EPZ A;  3KZZ A;  4LK1 F;  3VOD A;  2QKL B;  4M74 A;  1E0E A;  2EZH A;  1W7P A;  3FKJ A;  1D5Y A;  4M6V A;  4JX5 A;  1XD7 A;  3W6J B;  2VIX A;  3NAU A;  4DNC A;  2QVO A;  1HW1 A;  4EJU A;  2A6E F;  2DBB A;  2PFB A;  3PIP F;  1W36 C;  1X2N A;  2DA6 A;  3GXO A;  3FMS A;  1T33 A;  1GVD A;  1N77 A;  1RKW A;  2LKX A;  2DMN A;  1UJ8 A;  3C18 A;  4EVI A;  2ZJQ F;  2VJ4 A;  1R49 A;  1HXD A;  3ZQF A;  4RLF A;  4GDF A;  3HGY A;  1FNN A;  4HLY A;  3KX2 A;  2JA5 J;  3ZQ7 A;  3KP3 A;  4GRI A;  3L2U A;  2YU3 A;  1AA7 A;  5CQE A;  1BA5 A;  1MBE A;  4NB5 A;  4F7Z A;  4BE1 A;  1W7P B;  5B66 C;  4L0Z B;  2GZW A;  4ZDP A;  2BV6 A;  4PJN A;  1P4W A;  1I5Z A;  3KYL A;  4L9T A;  3N4M A;  2O7O A;  1T08 B;  3ZMZ A;  3LNQ A;  1YE9 A;  2VL8 A;  3GTK J;  2R7U A;  1XDS A;  4K2E A;  4HST A;  3K69 A;  2WY8 Q;  2NOJ B;  3CTA A;  2MG4 A;  2FE3 A;  2QEN A;  2DA4 A;  5KNL A;  4XLE A;  3OSG A;  2HNH A;  4FT8 A;  2IT0 A;  1RUO A;  2JRT A;  2F48 A;  1RI7 A;  1IO2 A;  1R5H A;  1SAU A;  1Y0U A;  3BP8 A;  2IAI A;  2EA4 A;  3HHG A;  3OY9 A;  1XCB A;  2AHQ A;  4PUS A;  4U0Y A;  1XG1 A;  4XOP A;  4EM1 A;  3U1D A;  2HR3 A;  3OOP A;  3FIS A;  1FSE A;  2O8X A;  4PGG A;  1DPU A;  4IHT A;  2KFD A;  1YFH A;  1LB2 A;  4M73 A;  3K4M A;  3RQ4 A;  1X2M A;  2JTV A;  4AU7 A;  4ON0 A;  5M3M J;  3I54 A;  3IH2 A;  2LRE A;  2W57 A;  1BBY A;  3KP5 A;  3L2W A;  1HF0 A;  2M45 A;  2A3S A;  4XR6 A;  2XAF A;  5JFR A;  3C7J A;  1RNL A;  5FGM A;  1IN6 A;  1BI3 A;  2W25 A;  3FMQ A;  3GW2 A;  3LSG A;  1WJF A;  2FOK A;  3DLA A;  2KJC A;  2PMH A;  3WTU C;  5F64 A;  2GXA A;  1QHH D;  3H5A A;  1CF7 B;  2YR2 A;  3ZXS A;  1K6O A;  2R92 J;  3FBI B;  4S05 A;  4LFU A;  3ELK A;  2JJ7 A;  4RM2 A;  4Y13 A;  4A3F J;  1U8B A;  3QOP A;  1I3Q J;  2K4B A;  4PJJ A;  1S72 I;  1QA6 A;  1SFO J;  5AIQ A;  1N78 A;  1DU0 A;  4OWR B;  3Q5F A;  2XRL A;  4HV6 A;  1XGS A;  1NG6 A;  2W82 A;  5IYC J;  1YTY A;  5GAD J;  2CQQ A;  3ERM A;  4E7L A;  5KAI C;  2R5Z B;  1MIJ A;  2FUG 2;  4NC8 A;  4LLN A;  3M4O J;  1BI1 A;  2UXX A;  3CP2 A;  3E6B A;  4V2G A;  3E6C C;  1V55 H;  3KFW X;  2LD5 A;  3H5R A;  3FXL A;  3D0S A;  1ON1 A;  2P7V B;  4OIN F;  3GME A;  3TGN A;  1KU2 A;  4XN3 A;  3J7Z I;  1ZKG A;  2ADU A;  1FBU A;  3L2R A;  2JVG A;  4O5V A;  1ZG1 A;  1O7F A;  3KEO A;  1O7L A;  4D0P A;  4FCY A;  1QZE A;  5JR3 A;  2GXB A;  1EF4 A;  3S14 J;  1I27 A;  1OJL A;  2VKD A;  5CVU A;  2MSY A;  3PM1 A;  1OLT A;  3RTR A;  2OBP A;  1VZ0 A;  2VPR A;  3JRF A;  1J75 A;  3DFG A;  2KRH A;  2AQE A;  4Z2Y A;  1P4A A;  2RAE A;  3LSJ A;  3ABK H;  1KQ8 A;  1OQY A;  3HPH A;  1Z6T A;  1H8A C;  4XOT A;  1S7O A;  2E5N A;  4XLN F;  2D5V A;  3WGH A;  2LY1 A;  3WTX C;  4C2M J;  1YIO A;  2V1U A;  4CCK A;  2E35 A;  1SFE A;  3GEZ A;  3KEY A;  3VB2 A;  4ENM A;  1MH3 A;  1T95 A;  2IS1 A;  1FTZ A;  4OIQ F;  1ITY A;  2PEX A;  4CA0 A;  3QOE A;  2LRD A;  3SDB A;  1IN8 A;  4RAZ A;  4HNT A;  3JSP A;  1JUM A;  5CJ9 A;  1LDD A;  4NDL A;  2ZSH B;  5LLQ A;  2LMD A;  5D5U B;  1W0U A;  3S17 J;  4P1W A;  3S2D J;  2M4G A;  1KON A;  5EGO A;  1X1C A;  4IHS A;  1FT9 A;  1CQT A;  1TWA J;  3TED A;  2R7R A;  1K78 B;  2BE5 F;  1XPX A;  1I1S A;  4A6E A;  1X3W B;  2DDA A;  2ELJ A;  3VSK A;  4E6K G;  3TDU C;  3V8K A;  1DP3 A;  1VF9 A;  2I8D A;  3GWZ A;  2Z1D A;  2R7Q A;  1X1A A;  4A2U A;  3RPU A;  4IKF A;  3PFI A;  3GZN B;  2CQK A;  2FSW A;  2QGU A;  2EFN A;  1B72 B;  3TO6 A;  1MMG A;  4UVC A;  3BJA A;  2XHK A;  2MLG A;  2AQF A;  2DMQ A;  5TJJ A;  1OYI A;  2GA2 A;  1ZG3 A;  4C2T A;  2DOA A;  3V8J A;  2X6O A;  5F1R A;  2FBH A;  4KYW A;  2VKE A;  1J7K A;  1XC5 A;  2KZG A;  3CJT B;  4LGW A;  3M9A A;  2E1M B;  1R9T J;  3E5X A;  2KMU A;  5CVJ A;  1T0F C;  2X48 A;  1Q1V A;  1A04 A;  1MMS A;  5E3L A;  4D7M A;  2F5E A;  2VKV A;  2WV1 A;  5B1B H;  4L18 B;  4UB6 C;  1RR7 A;  3HOW J;  1TQM A;  3C2G A;  4IO9 F;  1HCR A;  4KUM A;  4MEX F;  3BR5 A;  3G2B A;  4RDU A;  1E2X A;  3O8G A;  3H36 A;  4CDG A;  4B4C A;  3QYB A;  2XGE A;  2E1C A;  3S16 J;  1BJZ A;  1P7J A;  2FF4 A;  5H20 A;  5JLX A;  4YRV A;  1VQ8 I;  4ESF A;  1UEL B;  3V4G A;  1SFX A;  3HL2 A;  4BE2 A;  1NK3 P;  3DPT A;  1YYV A;  3MZ8 A;  2M3A A;  1Z9C A;  1A36 A;  1XGN A;  2DFH A;  4I7H A;  3CD6 I;  1MH4 A;  3VOE A;  2X1D A;  5JHF A;  3I0T A;  1SFU A;  3HOZ J;  4E7Z A;  2HXO A;  1Z6R A;  4N4O B;  3S3O A;  2EH3 A;  3KCC A;  3K1P A;  4LG3 A;  1LJ9 A;  3F8M A;  2QF7 A;  3L09 A;  5HS8 A;  2D45 A;  3BC8 A;  4BQA A;  3TMO A;  2NVY J;  3S1Q J;  5D5X B;  5FD6 A;  4EM0 B;  4DQ2 A;  3TW6 A;  3IAM 2;  2A68 F;  5CVR A;  2R7W A;  5LEK A;  4HG2 A;  2YPR A;  2OF7 A;  4CYC A;  1MMD A;  4EQQ A;  4HPQ A;  5IYD J;  4Y15 A;  2GOM A;  4II3 A;  2YS9 A;  3M1E A;  5C3E J;  1EJ9 A;  2VBW A;  2ZJ2 A;  3A4C A;  1BC8 C;  1KYZ A;  1OYY A;  4G7O F;  4RGR A;  4ETS A;  1SD6 A;  5D4R A;  1P92 A;  1FYL A;  1S9H A;  2NXN B;  4XK4 A;  2O0Y A;  2XB5 A;  2RC4 A;  3DQV C;  1ZGA A;  2CS3 A;  1HKT A;  3DLL F;  2QQB A;  3A0H C;  3PUB A;  5IT9 Z;  4IQ4 A;  1TQI A;  2HVS A;  2VQC A;  1Z0X A;  3GTQ J;  1T8I A;  3CJR B;  1U5T B;  3CDL A;  3DXJ F;  4A3C J;  2VQG A;  3CMY A;  3MN2 A;  4IF4 A;  5J47 A;  1WI3 A;  4BEH A;  1ZRF A;  2L4M A;  4LG0 B;  2W1O A;  1LDK B;  2L7K A;  3B6A A;  3ZQH A;  1HQC A;  2A05 A;  2L5Q A;  2RVC A;  2F6C A;  2N8G A;  2CW0 F;  2ZXJ A;  5J8F A;  3LA2 A;  1RUN A;  2R7T A;  1X3U A;  5DM6 F;  4M3G A;  1LFB A;  5J8C A;  2VE9 A;  4I0B A;  3JRA A;  2P8T A;  2HPM A;  2A6H F;  1XX5 A;  3AG2 H;  2XAU A;  4HEA 2;  1ERD A;  5BQT A;  3KZI C;  4HDU A;  3DTI A;  3ZGK A;  2H6B A;  2XAH A;  3U21 A;  2W24 A;  2EJR A;  1BI2 A;  1XN7 A;  1JTY A;  2XDV A;  1I50 J;  5JLW A;  2DYR H;  2NS7 A;  1DUX C;  2QSF X;  4EM2 A;  2M87 A;  4MO7 A;  1WJD A;  2DMP A;  2JSC A;  2EV0 A;  3ZRG A;  2PI0 A;  3OYD A;  1OPC A;  3J7Y J;  1ZRE A;  1B8I A;  5FB2 A;  4XRS A;  5DDG A;  4U0V A;  5GAG J;  3PJR A;  3CUQ C;  3WGG A;  2BY0 A;  2KQR A;  3F72 A;  1B6A A;  5BPD A;  4ZYE A;  4A3M J;  2VQL A;  1WH5 A;  4KNY A;  3B6C A;  2JUC A;  1WH7 A;  1QRY A;  1EKE A;  2K86 A;  2ZBK A;  2O9L A;  1TTY A;  3GF2 A;  2YSR A;  1IF1 A;  2OZU A;  2MH9 A;  2XSJ C;  4AD9 A;  3H35 A;  1ZEL A;  2BW3 A;  4L9J A;  5ILS A;  3BT9 A;  2LLK A;  3S32 A;  3PL8 A;  1JT6 A;  4UUS A;  1G3Y A;  1U6G A;  1EA3 A;  1IN7 A;  3ABL H;  3GX4 X;  4Y17 A;  2L4A A;  3S3N A;  5FJ8 J;  3I56 I;  4KMF A;  4RB0 A;  3G6E I;  3ASO H;  3G71 I;  5ICG A;  4AIJ A;  2ZKZ A;  4XRS G;  4RGX A;  5DCF A;  5B1A H;  1YJN I;  4Y7N J;  3OWT A;  2TDX A;  2DMT A;  1YS6 A;  3LQQ A;  2LBF B;  4J00 A;  1UG0 A;  3A1Y A;  5HLG A;  2W48 A;  4BJT A;  2CFO A;  2XVC A;  2O61 A;  3NEU A;  5LGN A;  2VJJ A;  1S7E A;  4NC7 A;  3VEP A;  4HQM A;  3HC7 A;  1JTX A;  2FQ4 A;  3HTS B;  2IBD A;  3KPH A;  2EIJ H;  3CCV I;  2VPL A;  3T1B A;  3R4K A;  2R5Y B;  1JJ8 C;  1UZC A;  5HS7 A;  4PGH A;  3QU3 A;  3H0G J;  4CCN A;  2HGC A;  2W84 A;  5LRR A;  4RA2 A;  1TC3 C;  3SFZ A;  5E79 C;  1V5F A;  1X19 A;  2IEK A;  3BJ6 A;  1WCM J;  1WVR A;  3SXY A;  2DT7 B;  3KE2 A;  1N25 A;  4KIF A;  2JUG A;  3CO6 C;  5JI6 A;  3DBR B;  3OIP A;  2MD0 A;  3IH4 A;  3LA7 A;  1TBX A;  4XID A;  2V9V A;  2PMZ N;  3HKZ N;  1Z67 A;  1H9G A;  1IXS B;  3TP3 A;  2JSP A;  1NK2 P;  1MJB A;  4XBF A;  3WG7 H;  1MDM B;  3PQK A;  1IUY A;  3L1P A;  4F92 B;  2CWE A;  2PQ8 A;  2WAF A;  3A2K A;  5FLV A;  2R7F A;  4XM3 A;  1TWF J;  3K0L A;  1VQ9 I;  5FD5 A;  2XC7 A;  2V6C A;  2LTP A;  3HPG A;  4M9Z A;  4B3A A;  1EH7 A;  3TOB A;  2PX9 A;  2P7C B;  1Z7L A;  2PJP A;  4HAM A;  1W5C C;  2KIF A;  2NYX A;  1FOY A;  4DJA A;  2R7O A;  2BVL A;  4WK8 F;  2FA5 A;  3TW7 A;  2LSO A;  2R4G A;  4XSZ F;  4OU0 A;  2HS5 A;  3HG9 A;  4ZYA A;  4LB6 B;  1YRN B;  1ACI A;  1SMT A;  3S15 J;  5FFZ A;  3WGI A;  1FMW A;  4PCQ A;  2JQ7 A;  3HTU A;  2KP6 A;  1A31 A;  2F4I A;  5DV5 A;  3ROU A;  5C44 J;  2HU9 A;  2L02 A;  3BR1 A;  3C2H A;  3OYM A;  2LF8 A;  2HQ5 A;  3F8B A;  2B7E A;  1FYM A;  5C4J J;  4FE4 A;  3H9Q A;  2ISY A;  1V5E A;  2ZSI B;  3L00 A;  3S93 A;  1IDY A;  5HVQ C;  3UR3 C;  1V5G A;  3T8R A;  2DOD A;  2WAD A;  1ON2 A;  3DKX A;  3QYF A;  5HOO A;  1O4X A;  3BRO A;  2K9N A;  2E60 A;  1XMA A;  4WXH A;  2BVM A;  2OUM A;  4ZC3 A;  2FD5 A;  4B44 A;  1UAA A;  1JKO C;  4S04 A;  4GYI A;  2DOF A;  1QVU A;  2MH2 A;  3GLL A;  1PUF A;  4A5N A;  3BZK A;  3C1D A;  4E70 A;  2EQR A;  2M0C A;  3R60 A;  3RYP A;  5BNG A;  3ZN0 A;  1T38 A;  3U9G A;  2EFQ A;  3ZQG A;  4NQW A;  5E3N A;  4BS9 A;  4IHW A;  4Z6Y A;  2WTE A;  4DBR A;  3LAJ A;  4HRI A;  4MGR A;  2HDD A;  1ETX A;  2KL4 A;  5DTD A;  3AKZ A;  2BOL A;  2EPF A;  1YLF A;  1XTA A;  2F5D A;  2CUE A;  1SVM A;  3G1O A;  2KDZ A;  1K61 A;  4DZP A;  4YIF A;  4EEF G;  4FX0 A;  2M34 A;  1U8R A;  1JT0 A;  1W4M A;  1VI0 A;  2DT6 A;  5KVR A;  3HJE A;  2KJB A;  2BW3 B;  4G6Q A;  5DUI A;  4EGY A;  5EG0 A;  5E3O A;  3TKY A;  1GV5 A;  5EEA A;  1MNM C;  5J4V A;  5LHG A;  2WAQ A;  2ETH A;  2V79 A;  1ORK A;  2DFI A;  3FZV A;  4G7Z F;  2QSH X;  4BY7 J;  4KMU X;  2ZFU A;  3LL7 A;  1Y1V J;  2CQN A;  1MBJ A;  2A69 F;  1BR1 A;  2WV0 A;  3DU6 A;  2P5L C;  5F0H A;  1ZLJ A;  2UUZ A;  1G2H A;  3Q3S A;  1ZHF A;  3I53 A;  1WI9 A;  2Q0O A;  3HM5 A;  3FXK A;  1YJW I;  2R7V A;  1N75 A;  3MMY B;  2XAJ A;  1Z7U A;  2P81 A;  2QUF A;  3J81 K;  4WXD A;  2FQ3 A;  1P4X A;  1ODD A;  1STZ A;  1T0F A;  3Q0U A;  4E7S A;  4HQE A;  4A93 J;  2EFO A;  1I6H J;  2XGD A;  3UNG C;  3OYI A;  2E1N A;  3VDX A;  3GTG J;  3BR2 A;  1IRF A;  2Y75 A;  2R7D A;  3IP4 B;  2AXT C;  2DU9 A;  3F9K A;  3R0A A;  3I59 B;  1TQP A;  1JUS A;  3ZMT A;  1T6S A;  1RKT A;  1G4D A;  5IT9 K;  1VQK I;  2D1V A;  2V9P A;  1IV8 A;  2DO7 A;  4F52 A;  4BQN A;  3V8L A;  2FX0 A;  3K4C A;  4I76 A;  4AWX B;  2X6W A;  2JPC A;  2RKH A;  3FHN A;  1X1P A;  3BWG A;  4XKV A;  3VPR A;  4DGW B;  2KLO A;  2HZT A;  1AKH A;  3FDY A;  2FEZ A;  5K7F A;  1GT0 C;  2DI3 A;  1YIJ I;  2PN6 A;  5EG0 B;  4X0G A;  2ZNZ A;  4EJW A;  4KT5 C;  4HF0 A;  3IC7 A;  5KAF C;  4LOC A;  3QPS A;  4H4K C;  3PIO F;  2NNY A;  2KZV A;  5CPR B;  4J19 A;  3WTY C;  4YEL A;  2DA7 A;  4UUV A;  3W3C A;  3VFZ A;  1APL C;  1D0X A;  1YG2 A;  3FX3 A;  4DYR A;  3CC4 I;  4OMZ A;  2VOO A;  4NUB A;  2X1C A;  4YG2 F;  4CCO A;  3TQN A;  2R7S A;  4CZZ A;  4ZDL A;  2KDO A;  2HFH A;  4W97 A;  5K5O A;  4CYC B;  3I4M J;  3HEF A;  1EH8 A;  4RAG A;  3BDD A;  2DA2 A;  2Y69 H;  4BAC A;  2EFP A;  3D5L A;  1FOX A;  2VON A;  4A0Y A;  1R5G A;  2DA1 A;  3FXJ A;  1DP7 P;  4M9X A;  2FXA A;  3RKY A;  4BUP A;  1LFP A;  3RQI A;  1TT5 B;  2VAS A;  1TNS A;  1BR4 A;  1OCO H;  2FBK A;  5L3G A;  3DP7 A;  4XLA A;  1VTN C;  3WTW C;  2QQ9 A;  5M5W J;  1TZL A;  2RDP A;  3QAH A;  4LIU A;  5GAH J;  3H3Z A;  1LQ1 A;  3WTZ A;  3OYB A;  2E19 A;  2EWN A;  1BIA A;  1R58 A;  2WY7 Q;  1JHF A;  3EYI A;  2HXI A;  1SC7 A;  3JAM Z;  1XSV A;  2JPB A;  3OR1 C;  4NHJ A;  1TLH B;  2X85 A;  3WTT C;  1FY7 A;  1ONV A;  3ABU A;  4NNJ A;  4OOI A;  3BTL A;  4G6D A;  3ZOB A;  1TNT A;  2QLZ A;  1HA8 A;  2IS6 A;  4M9S A;  1T39 A;  1K79 A;  5E1X A;  3BZ6 A;  3HB9 A;  5GP9 A;  3OYF A;  3LAP A;  2XPU A;  1F4K A;  5DD4 A;  3JSO A;  1HKQ A;  3I55 I;  4G94 A;  3JRB A;  4HF1 A;  3QPT A;  4YFX F;  2XF5 A;  3EYY A;  4P96 A;  5ERI A;  2LG4 A;  2UZK A;  3BQZ A;  4RBO A;  3DCF A;  4CYD A;  3HRM A;  3PSF A;  4RGS A;  5HS9 A;  4E7J A;  3GTP J;  1QU3 A;  3KP6 A;  1ETO A;  4A69 C;  1YI2 I;  1OCR H;  4XIC A;  4ZTF A;  5B5E C;  1OCZ H;  1OR7 A;  3JCU C;  5K7H A;  2I5U A;  3W2A A;  2EIM H;  5H2F C;  3HGG A;  1UFM A;  2JA6 J;  4HW0 A;  3CF5 F;  4E7H A;  1KQ9 A;  5F6F A;  2B63 J;  2DCE A;  1BR2 A;  1Z21 A;  2Y48 A;  2HDC A;  4BBS J;  1WPK A;  2L9V A;  4QPO A;  2XUB A;  2NS0 A;  4AIH A;  3BCA A;  1RR8 C;  2Q1Z B;  1YHQ I;  2XAG A;  4KA4 A;  4GCV A;  2LY9 A;  1SMY F;  1A35 A;  2JA7 J;  2P4W A;  1XCV A;  3BJO A;  4O3M A;  3SZG A;  1FX7 A;  4PJL A;  1WHU A;  3DTE A;  4LD5 A;  5LEJ A;  3J81 Z;  2NS8 A;  4C30 A;  1OCC H;  1IGN A;  4HX4 A;  3MKL A;  4UHT A;  2EIK H;  4ANJ A;  3MZH A;  1YS7 A;  5A2Q Z;  4MFE A;  5E1W A;  2ESH A;  1WSU A;  3S2H J;  3OL4 A;  4DZJ A;  1BIB A;  1OKR A;  5CVV A;  2ZCW A;  3S1R J;  4CCJ A;  3OIO A;  2A5Y B;  4BH9 A;  2M8E A;  5DYM A;  3LSH A;  4CXF A;  3V42 A;  2K7L A;  2JA2 A;  3GFI A;  3S8P A;  1M1E B;  2Y31 A;  4XLF A;  1RIO H;  3H0D A;  1D8J A;  1RPW A;  4XLP F;  1I6X A;  5IP9 J;  3IWF A;  4LIT A;  1B8I B;  1UCR A;  2PMU A;  3SZP A;  2KHM A;  3DV8 A;  2PBI A;  4KIG A;  4HNV A;  2E1O A;  2VOD A;  2P6T A;  3KYD B;  5CVI A;  2VI6 A;  5KK1 A;  3OS0 A;  2PMZ A;  2QM3 A;  3EUA A;  1P9Q C;  2VT2 A;  5FKL A;  1O3S A;  3O8H A;  2ZXW H;  3F6V A;  5EF6 A;  3CUQ A;  2CSO A;  3V7C A;  1IXR C;  3W6K B;  3IV5 A;  2FRH A;  1XDU A;  2GQQ A;  1MBF A;  1Y56 A;  1OR7 C;  4UUS B;  1KQ0 A;  2M7B A;  1ZRD A;  1FP2 A;  4RS8 A;  5FKM A;  4L0Y B;  3MKZ A;  1HKS A;  1WFX A;  2CUJ A;  3SFI A;  3KLN A;  4FET A;  2IVM A;  2D2W A;  1USS A;  2HZD A;  3OYN A;  2Z9O A;  1FZP B;  1YO5 C;  3VYT B;  3BCB A;  1IAW A;  4ABZ A;  4ENN A;  1U9N A;  2ID3 A;  2H94 A;  2CO5 A;  1J0R A;  3HOS A;  4C3H J;  1Y8Q B;  1IJW C;  3A03 A;  4F3Q A;  3VSL A;  2E36 A;  4MQ9 F;  5CYV A;  1V54 H;  1YX5 A;  1HC8 A;  2KRF A;  5HDG A;  4UXN A;  1JE8 A;  3J7A O;  1D8K A;  3H1C A;  1DU6 A;  1SEU A;  2R7Z J;  5LHH A;  1I1G A;  1MBK A;  3OYK A;  1XB4 A;  1BW5 A;  2L0K A;  3CC7 I;  4CCM A;  4HF2 A;  4QWQ A;  1SFK A;  2HI3 A;  3FM3 A;  2HKO A;  4G7H F;  1JXS A;  3FKI J;  1IC8 A;  5EYR A;  1VQM I;  2LYC A;  4OMY A;  1SAN A;  2ECC A;  2H8R A;  4JQF A;  4EJT A;  3LSM A;  1YRN A;  3ZMU A;  3RDI A;  3JTG A;  3L9F A;  4I02 A;  3HOV J;  2CYY A;  3NRV A;  2Q2E B;  5A2Q K;  3ASN H;  2E2I J;  5F08 A;  1HW2 A;  5D6E A;  2FOW A;  2BY2 A;  2MA3 A;  3NWT A;  2GAU A;  1FMV A;  5L3E A;  1VQ6 I;  4CSW A;  5LFA A;  5D4S A;  4ZDO A;  2M30 A;  1QBJ A;  2LK2 A;  3I64 A;  2D1H A;  4PSW A;  5C4X J;  3MCZ A;  2L54 A;  1HBX G;  2ZME A;  2LKS A;  5DD8 A;  3BTJ A;  2RNJ A;  5F04 A;  4MTE A;  3FIW A;  3M8F A;  3QPL A;  5ILV A;  1J59 A;  1W0T A;  1G59 A;  5E8G A;  2HKX A;  2JK3 A;  2R3S A;  1QPI A;  2HOA A;  1ZN2 A;  3ZMS A;  1LEA A;  4YIR X;  2BYV E;  1ZH5 A;  2DW4 A;  2VJ5 A;  2M7A A;  2XV4 S;  1FOW A;  1VQL I;  1UHM A;  2IW5 A;  2YUS A;  4M3D A;  1H89 C;  4GFB A;  1A6Q A;  1G8X A;  2HWV A;  3MEX A;  4LIV A;  2CJJ A;  2IP2 A;  1ULY A;  3CP8 A;  3T0Y A;  3HOU J;  2OA4 A;  3F8F A;  1LPQ A;  1X3Z B;  1UB9 A;  3K9T A;  1UMQ A;  3FXQ A;  4KFC A;  1MGT A;  4PJM A;  5GAE J;  2DK8 A;  4LLG F;  2OZ6 A;  5HLH A;  3ML6 A;  5LGT A;  2CH0 A;  3QU6 A;  2ME0 A;  3HZJ A;  5EEG A;  3CES A;  1XGO A;  4IPA A;  1BOB A;  4YEJ A;  2LVS A;  3CCU I;  4G8X A;  2M1B A;  4D7N A;  4RAF A;  2JT1 A;  5BPI A;  5K7Z A;  2X1E A;  4I09 A;  2COM A;  2H6C A;  1Z1D A;  3D1N I;  2EA2 A;  3K70 C;  3RIR A;  1HST A;  3AG1 H;  3BTC A;  4BHC A;  3OIQ A;  3OV8 A;  2DXI A;  2VOP A;  1R5I D;  2Q8K A;  2M0M A;  2WB1 N;  1R4N B;  2K02 A;  2VC1 A;  2PJR B;  3F21 A;  3Q9S A;  2CQ7 A;  2RQP A;  3ZCO A;  5IT3 A;  3MFK A;  3E0J B;  1Y39 A;  3HSE A;  3RPQ A;  3I4P A;  2HVR A;  1LE8 A;  2M2E A;  3AAF A;  1L3L A;  2VKH A;  1FEX A;  4QSH A;  5IPA A;  2AO9 A;  5BMZ A;  2G0E A;  1R22 A;  2COB A;  2DAO A;  3KP7 A;  4XRM A;  4KDP A;  4U87 A;  2CW8 A;  4FQG A;  3RKQ A;  1ZAO A;  5J1Y A;  2HVQ A;  4WXC A;  1R36 A;  3RZD J;  1GDT A;  3H3U A;  4R79 A;  2V1X A;  1U2W A;  4PZJ A;  4P9U A;  1FBS A;  2K9S A;  3BPX A;  2NOG A;  3MKW B;  2EZK A;  3J7A Y;  1EV7 A;  3IAS 2;  1WKM A;  4PK4 A;  3HSR A;  2RRE A;  4CGZ A;  2VC0 A;  4KJZ A;  3HRS A;  5D5V B;  5IOZ A;  3HRU A;  4EAT A;  3JR9 A;  3HBL A;  4R8H A;  4XRF A;  1PP8 F;  2UXN A;  3JRE A;  5JVT A;  3H5N A;  4G12 A;  1KU3 A;  3NAR A;  4I6Z A;  3K2A A;  3KLO A;  3IKT A;  1H9T A;  3P5J A;  3E5Q A;  3FBN B;  4XLC A;  2XB0 X;  2RN7 A;  4FAS D;  5HOD A;  1Z3Y A;  1VND A;  4F93 B;  5K5R A;  2EK5 A;  4OAZ A;  1TWH J;  2VXD A;  4NC6 A;  2Y0S A;  3ZR8 X;  4G6T B;  4OIO F;  2OCC H;  5KCM A;  2H8W A;  4N0B A;  2JWT A;  1IG7 A;  3I3L A;  4HDV A;  4I2O A;  3LSK A;  5FKN A;  5F0C A;  4F55 A;  1ZLK A;  1QHG A;  4L5J A;  2L9R A;  3WHB A;  2CV1 A;  2KRC A;  2W00 A;  2J5P A;  2ELK A;  4DIQ A;  2F2E A;  4E7I A;  1ETW A;  3DKY A;  2A5W A;  3WE3 A;  3OYH A;  3BOQ A;  4XSX F;  1B4A A;  2JMW A;  2OPT A;  1LKX A;  4XLH A;  4ASN A;  2HYG D;  3A01 B;  2IJL A;  3RI4 A;  3C2B A;  4JX6 A;  1R23 A;  4CCL A;  4PJ0 C;  3D5S C;  4BE0 A;  4L9N A;  3G4S I;  4BQQ A;  2BEO A;  3K4K A;  4AVP A;  4D5C A;  3NWS A;  1MND A;  4X1E A;  1AKH B;  2BBY A;  4A3I J;  5FKO A;  1TW3 A;  2KIS A;  2EIN H;  3GFM A;  4RM3 A;  2DOE A;  4RB2 C;  3M07 A;  1H88 C;  3ECO A;  1TW2 A;  1OCT C;  3BQY A;  1GXQ A;  2LNB A;  4AM3 A;  3CQZ J;  3E3V A;  3I5U A;  5D5W B;  3RSN A;  1Q1H A;  1S5L C;  3BLY A;  1X58 A;  4MNU A;  4Y52 J;  1D1A A;  1B72 A;  2VBZ A;  1ZTR A;  3F23 A;  3CCE I;  3I71 A;  1VFC A;  1UHS A;  3BG9 A;  5H6R A;  1DDN A;  1E17 A;  3OS1 A;  1NG7 A;  2CGP A;  2VQH A;  4IHV A;  2BXZ A;  3PQJ A;  3LFK A;  2R7X A;  5E8I A;  3AL0 C;  3N05 A;  1VQ5 I;  1CF7 A;  4I01 A;  3O2P E;  1WJC A;  4E7K A;  4A6D A;  2GXG A;  5EGO B;  1K4T A;  2MC4 A;  3DKW A;  5J1U A;  1U0J A;  1SVO A;  3KYC B;  5ICC A;  2XPW A;  1K78 A;  1VQ7 I;  3EUK L;  4AIK A;  4DBQ A;  4BQO A;  4CO8 A;  6PAX A;  5EDN A;  3U1K A;  4UVA A;  4HLX A;  1FLI A;  3CJN A;  1DQU A;  4ZZL A;  3LSP A;  3DBH B;  2LFB A;  3FF5 A;  3S3M A;  2XGC A;  1X1D A;  1I39 A;  3BR6 A;  3WU0 A;  1R1V A;  2V1D A;  4QPQ A;  3DEW A;  1KU7 A;  2CUF A;  1DGW Y;  2RGV A;  1FBQ A;  4IVN A;  3IKV A;  2V6E A;  5L3C A;  3CF2 A;  5D8L B;  4Q48 A;  3LWF A;  2L9S A;  1W1W E;  2B9S A;  2V4J C;  2E1M C;  2QCO A;  4X6A J;  5CQG A;  1FIA A;  2OC6 A;  2HQR A;  1Z77 A;  3GVA A;  2CV0 A;  1W5S A;  3L2V A;  2FNA A;  3K7A J;  4JOM A;  3RPU D;  4MHG A;  2XKP A;  1J09 A;  2LKP A;  3O6B B;  4XNF A;  5BS6 A;  3F8C A;  4J01 A;  2QSG X;  2HOT A;  4P5O A;  3E5U A;  4JBA A;  5HNH A;  2HQA A;  3AG4 H;  4CH7 A;  3GFJ A;  2CW7 A;  3AG3 H;  1FPQ A;  3K4N A;  4BDZ A;  3AL0 B;  3L2C A;  4BNC A;  2DN0 A;  3QWL A;  5HDN A;  5FFX A;  1F1Z A;  1FSH A;  3JTH A;  1VQN I;  4HX7 A;  2EZI A;  3BPV A;  3LSR A;  3CCL I;  3K4B A;  2CV2 A;  3ZP5 A;  4UVB A;  3M1C A;  2W7N A;  2PLY A;  1MJ9 A;  4ITV A;  2DQL A;  1XGM A;  3CMA I;  2L2O A;  2IA1 A;  4Y4R A;  1MW7 A;  3G73 A;  3H9G A;  2JN6 A;  1WZ2 A;  4ESJ A;  3BG6 A;  1XMX A;  1G6N A;  1PUF B;  4NBQ A;  3K4L A;  4CHU A;  4IOA F;  1S7A A;  2JRM A;  2ECB A;  3HOX J;  2F5C A;  2JA8 J;  2DQR A;  4M3E A;  4YII A;  4B09 A;  3P9C A;  1WJA A;  2RNG A;  1X4P A;  3E6M A;  4L5I A;  1H0M A;  1MJA A;  3KET A;  4BEH B;  1PYV A;  1R6R A;  5FLX K;  2VE8 A;  4XON A;  1MMA A;  4JX4 A;  4C3I J;  1QO0 D;  2ZME C;  3JRH A;  4MTD A;  3K2Z A;  2P5K A;  2FNP A;  3I9V 2;  3GTJ J;  2GBY A;  4KT6 A;  5DM7 F; 
#chains in the Genus database with same CATH homology
 5DEQ A;  3ISP A;  3ECH A;  4HV5 A;  4A12 A;  2Y0M A;  4UNO A;  4EMS A;  4RAY A;  4LB5 A;  3KP2 A;  1FYK A;  1V3F A;  2G7U A;  4M72 A;  3ZN1 A;  1FWZ A;  4MQV A;  1U3E M;  1WQ2 A;  3QRF F;  2WC2 A;  4HYE A;  4BAY A;  1JHH A;  3S2W A;  3I58 A;  1FOK A;  2DK5 A;  1CGP A;  3DF8 A;  4N9H A;  1ZAR A;  2EV5 A;  2EFW A;  4ENK A;  4BYY A;  2STT A;  5ED4 A;  3COA C;  4ESB A;  4UV8 A;  2UWM A;  1J9I A;  2HTS A;  1QQI A;  3I59 A;  1MD0 A;  1BI0 A;  5E1Z B;  2QBY A;  2QZ8 A;  3GFL A;  4LLL A;  1T98 A;  1Z91 A;  1B1B A;  2G9W A;  4UV9 A;  2Q2E A;  2QQA A;  3WU1 B;  2GWR A;  1LEB A;  2XAQ A;  4KN4 X;  3B02 A;  3IL2 A;  3N97 A;  1PP7 U;  2ESN A;  3IRQ A;  1KYW A;  3MQ0 A;  1B9N A;  3K1N A;  1G3T A;  3F6O A;  2FBI A;  3BY6 A;  1ZRC A;  4KIC A;  1XSX A;  3TOA A;  3U2R A;  4EGZ A;  3ERE D;  2ZME B;  1HW5 A;  4HBL A;  1WWX A;  4ZYG A;  5L3F A;  4M6X A;  3FWE A;  4YFN F;  3FHZ A;  1YW7 A;  5AON A;  1S29 A;  1D5V A;  1IZ1 A;  4WF2 A;  4MEY F;  2HOE A;  3HSF A;  4Q47 A;  4EJV A;  2BGC A;  3SZT A;  2ISZ A;  3E97 A;  2Z33 A;  2Z5U A;  3GZ5 A;  5EEH A;  1G3W A;  5ICF A;  4EJO A;  3F8N A;  4I98 B;  3M8E A;  5E20 A;  5CLS A;  2C6Y A;  1PDN C;  3FXU A;  1ZGJ A;  3MAJ A;  4IRI A;  1GHC A;  1L0O C;  3K1M A;  5AIP A;  1SAX A;  5HDK A;  3J80 K;  2HEO A;  1UST A;  5L3D A;  4KIB A;  2CFX A;  2HYF A;  2L3D A;  5E17 F;  2M5W A;  3CDH A;  3IHU A;  1G3S A;  3IWZ A;  2FMY A;  5D6F A;  3MZY A;  3WTS C;  3R0J A;  3RKX A;  2LDU A;  2HQN A;  2OAZ A;  3QPH A;  3M7G A;  3CO7 C;  1GVJ A;  2Z99 A;  3DPL C;  3R61 A;  2IA0 A;  1MDM A;  4BHB A;  3REO A;  4LK0 F;  3EQL F;  4G9Y A;  4OIP F;  2VT3 A;  4HA8 A;  3GYH X;  3SHF A;  3TO9 A;  2OQG A;  1OMI A;  1SD5 A;  3HOT A;  1AOY A;  1O57 A;  4BHP A;  2XIG A;  5D8K B;  2STW A;  4A0Z A;  3WOD F;  1AWC A;  4H0E A;  1J2X A;  3WTV C;  1R1U A;  2DTR A;  2ZFW A;  5JHU A;  5FLX Z;  1V4R A;  1Z05 A;  2IA2 A;  1ZYR F;  1QGP A;  4P9F A;  2DLL A;  5LGU A;  3FM5 A;  4BXU A;  5FO5 A;  1LNW A;  2A61 A;  2ZNY A;  2YX7 A;  5K5Q A;  1LDJ A;  1RZ4 A;  4JK1 X;  3EDP A;  3QP6 A;  5TRD A;  1KA8 A;  1FC3 A;  3V7R A;  2HTJ A;  2DT5 A;  2LF7 A;  5ILU A;  1BM9 A;  3ULQ B;  3Q9V A;  4RB3 C;  4HX8 A;  3H92 A;  1F5T A;  4HZF A;  2XKO A;  4ZZD A;  1O3R A;  4Q4Z F;  4YFK F;  1YW8 A;  3T5X A;  3F22 A;  2ACJ A;  4IRG A;  4L9V A;  4CIC A;  3WG9 A;  2AXL A;  2JZY A;  1WRJ A;  2QYO A;  1QPM A;  5LHI A;  1R00 A;  2OD5 A;  2MBF A;  1P6R A;  1F9N A;  4EV0 A;  2FML A;  3ZMV A;  3RKW A;  2E7W A;  4KN7 X;  1S8N A;  2W85 A;  2OU2 A;  4OIR F;  5J6X A;  1KGS A;  1OYW A;  3KP4 A;  1K7A A;  1ZG5 A;  5HLI A;  3P7N A;  4WCG A;  1BJA A;  4U88 A;  1B59 A;  1LVA A;  1SD7 A;  4P55 A;  4ENJ A;  5E18 F;  5L3B A;  1HSJ A;  4ZYD A;  2MLK A;  2NRA C;  3HIF A;  3GUD A;  1D3Y A;  1U78 A;  2KIM A;  3P9I A;  3T8T A;  4FX4 A;  2MC3 A;  3KZY A;  2Z3Y A;  2MD5 A;  1T2K A;  1IW7 F;  2XRO A;  1B9M A;  3E6D A;  4Q5S F;  5DUK A;  4IRH A;  2EB7 A;  1XMK A;  3LA3 A;  1FP1 D;  2ELH A;  1MKM A;  2NNN A;  4U0W A;  1IXC A;  2X4H A;  3LQR A;  2FU4 A;  4QLC U;  1BOA A;  3HRT A;  3TO7 A;  4TV7 A;  4FHT A;  4GXO A;  3RJP A;  2H09 A;  1QZZ A;  3HUG A;  4GO1 A;  2QBY B;  1S3J A;  1REP C;  3LST A;  4B8X A;  2IPQ X;  2RV8 A;  2IRF G;  2A07 F;  5LBQ A;  4R1H A;  1U5T A;  3C3W A;  3R6S A;  2B0L A;  1QNT A;  2H27 A;  2DPD A;  4ZYH A;  2ZO4 A;  3ZMD A;  2XRN A;  1JGS A;  5DCM A;  2O6G E;  3ABT A;  1U5T C;  2OQR A;  2K27 A;  3TDZ C;  2KIU A;  2XAS A;  4U7B A;  1O3Q A;  3G3Z A;  3J80 Z;  2VBX A;  3CLO A;  1NHA A;  3EET A;  2XGX A;  1QZY A;  2GA1 A;  3HYI A;  4HOB A;  4RB1 A;  1DPR A;  3RYR A;  2X0L A;  1IRG A;  3F3X A;  3P9K A;  1KU9 A;  3GLX A;  3CUO A;  3QP5 A;  4A0X A;  1C0W A;  2PG4 A;  4O6J A;  3EUH A;  3FMR A;  2J5O A;  3V7S A;  1XSD A;  5H6Q A;  2DPU A;  3GO5 A;  4PDK A;  4I0A A;  2P6S A;  1W7P D;  2KKO A;  2WWY A;  4IJA A;  2QWW A;  3CUQ B;  4A5M A;  3ZPL A;  1SD4 A;  2P5V A;  2F5F A;  1S6L A;  1BC7 C;  4GYG A;  3B73 A;  1IN4 A;  3MWM A;  5DCM B;  4LMY A;  3FXR A;  4RGU A;  3NQO A;  1R1T A;  4GGG A;  4WWC A;  1MZB A;  1PUE E;  1J5Y A;  1P2F A;  3KEQ A;  2YX4 A;  4M6Y A;  2G7H A;  4IXA A;  1BN5 A;  4ZH4 F;  4M71 A;  2VXZ A;  1YW9 A;  3SQN A;  2L01 A;  4LJZ F;  2VN2 A;  2VBY A;  2O03 A;  3GZ6 A;  1IN5 A;  3JW4 A;  2K4J A;  5BOX A;  1R7J A;  1O3T A;  2E7X A;  3IRR A;  1W5T A;  2O3F A;  1YQA A;  3JAM K;  5K1Y A;  3HHH A;  2CG4 A;  2EV6 A;  1UHW A;  3L7W A;  2NAZ A;  3O3K A;  4N9I A;  4U7D A;  5LRS A;  4LG0 A;  1GXP A;  3WE2 A;  2AS5 F;  1EH6 A;  4WX9 A;  2GIV A;  5ICE A;  3DEU A;  3KZZ A;  4LK1 F;  3VOD A;  4M74 A;  1W7P A;  1XD7 A;  3W6J B;  4DNC A;  2QVO A;  1HW1 A;  4EJU A;  2A6E F;  2DBB A;  2PFB A;  3GXO A;  3FMS A;  3C18 A;  4EVI A;  1HXD A;  1FNN A;  4HLY A;  3ZQ7 A;  3KP3 A;  2YU3 A;  4NB5 A;  4F7Z A;  1W7P B;  4L0Z B;  2GZW A;  2BV6 A;  1P4W A;  1I5Z A;  4L9T A;  3N4M A;  3ZMZ A;  1XDS A;  4K2E A;  3K69 A;  3CTA A;  2FE3 A;  2QEN A;  4FT8 A;  2IT0 A;  1RUO A;  2JRT A;  1RI7 A;  1R5H A;  1Y0U A;  3BP8 A;  2EA4 A;  3HHG A;  1XCB A;  4U0Y A;  4EM1 A;  3U1D A;  2HR3 A;  3OOP A;  1FSE A;  2O8X A;  4PGG A;  1DPU A;  4IHT A;  1YFH A;  1LB2 A;  4M73 A;  2JTV A;  4ON0 A;  3I54 A;  3KP5 A;  2W57 A;  1BBY A;  2M45 A;  2A3S A;  5JFR A;  2XAF A;  3C7J A;  1RNL A;  5FGM A;  1IN6 A;  1BI3 A;  2W25 A;  3FMQ A;  3GW2 A;  2FOK A;  2KJC A;  2PMH A;  3WTU C;  5F64 A;  1CF7 B;  2YR2 A;  1K6O A;  4S05 A;  4LFU A;  3ELK A;  4Y13 A;  3QOP A;  2K4B A;  5AIQ A;  3Q5F A;  4HV6 A;  1XGS A;  1YTY A;  4LLN A;  1BI1 A;  2UXX A;  3E6B A;  3E6C C;  3KFW X;  1ON1 A;  2P7V B;  3D0S A;  4OIN F;  3TGN A;  1KU2 A;  2ADU A;  1FBU A;  4O5V A;  1ZG1 A;  1O7F A;  3KEO A;  1O7L A;  4D0P A;  5JR3 A;  2GXB A;  1I27 A;  5CVU A;  3RTR A;  2OBP A;  1J75 A;  3DFG A;  4Z2Y A;  1P4A A;  1KQ8 A;  1Z6T A;  1S7O A;  4XLN F;  3WGH A;  3WTX C;  2V1U A;  1YIO A;  3GEZ A;  1SFE A;  3VB2 A;  4ENM A;  4OIQ F;  2PEX A;  1IN8 A;  4RAZ A;  3JSP A;  5CJ9 A;  1LDD A;  5LLQ A;  5D5U B;  4IHS A;  1FT9 A;  1K78 B;  2BE5 F;  1I1S A;  4A6E A;  3TDU C;  3V8K A;  3GWZ A;  4A2U A;  3RPU A;  3PFI A;  2CQK A;  2FSW A;  2EFN A;  3TO6 A;  4UVC A;  3BJA A;  2XHK A;  2MLG A;  5TJJ A;  1OYI A;  2GA2 A;  1ZG3 A;  3V8J A;  5F1R A;  2FBH A;  4KYW A;  1J7K A;  4LGW A;  3M9A A;  3E5X A;  5CVJ A;  1A04 A;  2F5E A;  4L18 B;  1TQM A;  4KUM A;  4MEX F;  1E2X A;  4CDG A;  2E1C A;  2FF4 A;  5H20 A;  4ESF A;  3V4G A;  1SFX A;  3DPT A;  1YYV A;  1Z9C A;  1XGN A;  4I7H A;  3VOE A;  3I0T A;  1SFU A;  1Z6R A;  3KCC A;  3K1P A;  2D45 A;  1LJ9 A;  3F8M A;  3L09 A;  5HS8 A;  4BQA A;  5D5X B;  5FD6 A;  4EM0 B;  4DQ2 A;  2A68 F;  5CVR A;  5LEK A;  2YPR A;  4EQQ A;  4Y15 A;  3M1E A;  2VBW A;  2ZJ2 A;  1BC8 C;  1KYZ A;  1OYY A;  4G7O F;  4RGR A;  4ETS A;  1SD6 A;  5D4R A;  1P92 A;  1FYL A;  2O0Y A;  2RC4 A;  3DQV C;  1ZGA A;  1HKT A;  2QQB A;  5IT9 Z;  1TQI A;  1U5T B;  3DXJ F;  4IF4 A;  1ZRF A;  2L4M A;  4LG0 B;  1LDK B;  1HQC A;  2RVC A;  1RUN A;  2CW0 F;  2ZXJ A;  5J8F A;  3LA2 A;  1X3U A;  5J8C A;  2VE9 A;  4I0B A;  2P8T A;  2A6H F;  5BQT A;  4HDU A;  2H6B A;  2XAH A;  2W24 A;  2EJR A;  1BI2 A;  1XN7 A;  1DUX C;  4EM2 A;  2M87 A;  2JSC A;  2EV0 A;  2PI0 A;  1OPC A;  1ZRE A;  5FB2 A;  5DDG A;  4U0V A;  3CUQ C;  3WGG A;  3F72 A;  1B6A A;  5BPD A;  4ZYE A;  4KNY A;  2ZBK A;  2K86 A;  1TTY A;  3GF2 A;  2YSR A;  1IF1 A;  2OZU A;  2MH9 A;  4AD9 A;  4L9J A;  5ILS A;  1G3Y A;  1U6G A;  1IN7 A;  3GX4 X;  4Y17 A;  2L4A A;  4KMF A;  4RB0 A;  5ICG A;  4AIJ A;  2ZKZ A;  4RGX A;  5DCF A;  2TDX A;  1YS6 A;  3LQQ A;  5HLG A;  2XVC A;  2O61 A;  3NEU A;  5LGN A;  3VEP A;  4HQM A;  3HTS B;  3T1B A;  3R4K A;  5HS7 A;  4PGH A;  3QU3 A;  2HGC A;  2W84 A;  5LRR A;  3SFZ A;  3BJ6 A;  3SXY A;  3KE2 A;  4KIF A;  3CO6 C;  5JI6 A;  3LA7 A;  1TBX A;  2V9V A;  1H9G A;  1IXS B;  1MJB A;  4XBF A;  1MDM B;  3PQK A;  1IUY A;  2CWE A;  2PQ8 A;  2R7F A;  3K0L A;  5FD5 A;  2V6C A;  4M9Z A;  1EH7 A;  3TOB A;  2P7C B;  2PJP A;  4HAM A;  2KIF A;  2NYX A;  4WK8 F;  2FA5 A;  2LSO A;  4XSZ F;  4OU0 A;  2HS5 A;  4LB6 B;  1SMT A;  5FFZ A;  3WGI A;  4PCQ A;  3HTU A;  5DV5 A;  3ROU A;  2L02 A;  2LF8 A;  3F8B A;  1FYM A;  2ISY A;  3L00 A;  5HVQ C;  3T8R A;  1ON2 A;  5HOO A;  3BRO A;  1XMA A;  4WXH A;  4S04 A;  4GYI A;  2MH2 A;  4A5N A;  3C1D A;  4E70 A;  3R60 A;  3RYP A;  3ZN0 A;  1T38 A;  3U9G A;  2EFQ A;  4NQW A;  2WTE A;  3LAJ A;  4MGR A;  1YLF A;  2F5D A;  4YIF A;  1U8R A;  4FX0 A;  1W4M A;  5KVR A;  5DUI A;  4G6Q A;  2KJB A;  4EGY A;  3TKY A;  5LHG A;  2ETH A;  2V79 A;  2DFI A;  3FZV A;  4G7Z F;  4KMU X;  2A69 F;  2P5L C;  2WV0 A;  1ZLJ A;  1ZHF A;  3I53 A;  1WI9 A;  2Q0O A;  2XAJ A;  1Z7U A;  3J81 K;  2QUF A;  4WXD A;  2FQ3 A;  1P4X A;  1ODD A;  1STZ A;  1T0F A;  4HQE A;  2EFO A;  2E1N A;  1IRF A;  2Y75 A;  2R7D A;  2DU9 A;  3R0A A;  3I59 B;  1TQP A;  3ZMT A;  1T6S A;  1G4D A;  5IT9 K;  2D1V A;  2DO7 A;  3V8L A;  4AWX B;  2JPC A;  2RKH A;  3BWG A;  2HZT A;  2FEZ A;  2DI3 A;  2PN6 A;  2ZNZ A;  4EJW A;  4KT5 C;  4HF0 A;  3IC7 A;  2NNY A;  3WTY C;  4UUV A;  3VFZ A;  1YG2 A;  3FX3 A;  4OMZ A;  2VOO A;  4YG2 F;  3TQN A;  4CZZ A;  2HFH A;  5K5O A;  1EH8 A;  3BDD A;  2EFP A;  3D5L A;  2VON A;  4A0Y A;  1R5G A;  1DP7 P;  4M9X A;  2FXA A;  3RKY A;  1TNS A;  2FBK A;  5L3G A;  3DP7 A;  1VTN C;  3WTW C;  2QQ9 A;  2RDP A;  3QAH A;  1LQ1 A;  3H3Z A;  3WTZ A;  2EWN A;  1BIA A;  1R58 A;  1JHF A;  3EYI A;  3JAM Z;  1XSV A;  2JPB A;  4NHJ A;  1TLH B;  3WTT C;  1FY7 A;  1ONV A;  3ABU A;  4OOI A;  4G6D A;  1TNT A;  2QLZ A;  4M9S A;  1T39 A;  1K79 A;  5E1X A;  3BZ6 A;  3LAP A;  1F4K A;  5DD4 A;  3JSO A;  1HKQ A;  4G94 A;  4HF1 A;  3QPT A;  4YFX F;  3EYY A;  4P96 A;  5ERI A;  2UZK A;  4CYD A;  3HRM A;  4RGS A;  5HS9 A;  3KP6 A;  1OR7 A;  1UFM A;  4HW0 A;  1KQ9 A;  5F6F A;  2Y48 A;  2HDC A;  2XUB A;  2NS0 A;  4AIH A;  2XAG A;  4KA4 A;  4GCV A;  1SMY F;  2P4W A;  1XCV A;  3BJO A;  4O3M A;  1FX7 A;  4LD5 A;  5LEJ A;  3J81 Z;  4HX4 A;  4UHT A;  3MZH A;  1YS7 A;  5A2Q Z;  5E1W A;  2ESH A;  1WSU A;  1BIB A;  1OKR A;  5CVV A;  2ZCW A;  2A5Y B;  4BH9 A;  2M8E A;  5DYM A;  4CXF A;  2K7L A;  3GFI A;  1RIO H;  1D8J A;  4XLP F;  1I6X A;  3IWF A;  1UCR A;  2PMU A;  3SZP A;  3DV8 A;  2PBI A;  4KIG A;  2VOD A;  2P6T A;  5CVI A;  5KK1 A;  2QM3 A;  2VT2 A;  1O3S A;  3F6V A;  3CUQ A;  2CSO A;  3V7C A;  1IXR C;  3W6K B;  2FRH A;  1XDU A;  2GQQ A;  1KQ0 A;  1ZRD A;  1FP2 A;  4RS8 A;  4L0Y B;  1HKS A;  3KLN A;  2IVM A;  2D2W A;  1USS A;  2Z9O A;  1FZP B;  1YO5 C;  1IAW A;  4ENN A;  2H94 A;  2CO5 A;  1J0R A;  3HOS A;  4MQ9 F;  5CYV A;  2KRF A;  5HDG A;  4UXN A;  1JE8 A;  3J7A O;  1D8K A;  5LHH A;  1I1G A;  1XB4 A;  4HF2 A;  4QWQ A;  3FM3 A;  2HKO A;  4G7H F;  1JXS A;  4OMY A;  4JQF A;  4EJT A;  3ZMU A;  3RDI A;  3JTG A;  3L9F A;  4I02 A;  2CYY A;  3NRV A;  5A2Q K;  1HW2 A;  5D6E A;  2MA3 A;  2GAU A;  5L3E A;  5D4S A;  2M30 A;  1QBJ A;  3I64 A;  2D1H A;  3MCZ A;  2L54 A;  1HBX G;  2ZME A;  5DD8 A;  2RNJ A;  4MTE A;  3M8F A;  1J59 A;  5ILV A;  5E8G A;  2HKX A;  2R3S A;  1ZN2 A;  3ZMS A;  1LEA A;  2BYV E;  1ZH5 A;  2DW4 A;  2XV4 S;  1UHM A;  2IW5 A;  2HWV A;  3MEX A;  2IP2 A;  1ULY A;  3T0Y A;  2OA4 A;  3F8F A;  1UB9 A;  3K9T A;  3FXQ A;  4KFC A;  1MGT A;  2DK8 A;  4LLG F;  2OZ6 A;  5HLH A;  3ML6 A;  5LGT A;  3QU6 A;  5EEG A;  1XGO A;  4IPA A;  4G8X A;  2M1B A;  2JT1 A;  5BPI A;  4I09 A;  2COM A;  2H6C A;  1Z1D A;  2EA2 A;  3RIR A;  1HST A;  2VOP A;  4BHC A;  3OV8 A;  2Q8K A;  2K02 A;  2VC1 A;  3F21 A;  3Q9S A;  2RQP A;  5IT3 A;  3MFK A;  3HSE A;  3RPQ A;  3I4P A;  3AAF A;  1L3L A;  5BMZ A;  1R22 A;  2DAO A;  3KP7 A;  4KDP A;  1ZAO A;  4WXC A;  1R36 A;  3H3U A;  4R79 A;  2V1X A;  1U2W A;  4PZJ A;  4P9U A;  1FBS A;  3BPX A;  1EV7 A;  1WKM A;  3HSR A;  4CGZ A;  2VC0 A;  3HRS A;  5D5V B;  3HRU A;  4R8H A;  4XRF A;  1PP8 F;  2UXN A;  5JVT A;  1KU3 A;  3KLO A;  3IKT A;  1H9T A;  3E5Q A;  2RN7 A;  5K5R A;  2EK5 A;  4OIO F;  4N0B A;  4HDV A;  4I2O A;  1ZLK A;  4L5J A;  2J5P A;  2F2E A;  3WE3 A;  3BOQ A;  4XSX F;  1B4A A;  4ASN A;  2HYG D;  2IJL A;  3RI4 A;  1R23 A;  4L9N A;  2BEO A;  4AVP A;  2BBY A;  1TW3 A;  3GFM A;  4RB2 C;  3ECO A;  1TW2 A;  1GXQ A;  2LNB A;  3E3V A;  3I5U A;  5D5W B;  1Q1H A;  4MNU A;  2VBZ A;  3F23 A;  3I71 A;  5H6R A;  1DDN A;  1E17 A;  2CGP A;  3PQJ A;  3LFK A;  5E8I A;  1CF7 A;  4I01 A;  3O2P E;  4A6D A;  2GXG A;  3DKW A;  5ICC A;  1K78 A;  4AIK A;  4CO8 A;  6PAX A;  4UVA A;  4HLX A;  1FLI A;  3CJN A;  4ZZL A;  3FF5 A;  3WU0 A;  1R1V A;  2V1D A;  1KU7 A;  2RGV A;  1FBQ A;  4IVN A;  3IKV A;  5L3C A;  5D8L B;  4Q48 A;  3LWF A;  3GVA A;  2HQR A;  1W5S A;  2FNA A;  4MHG A;  2XKP A;  2LKP A;  3O6B B;  5BS6 A;  3F8C A;  4P5O A;  3E5U A;  4JBA A;  3GFJ A;  1FPQ A;  3L2C A;  4BNC A;  5HDN A;  5FFX A;  1F1Z A;  1FSH A;  3JTH A;  4HX7 A;  3BPV A;  3ZP5 A;  4UVB A;  2PLY A;  1MJ9 A;  2DQL A;  1XGM A;  2IA1 A;  3G73 A;  4ESJ A;  1G6N A;  4CHU A;  1S7A A;  2F5C A;  2DQR A;  4YII A;  4B09 A;  3P9C A;  3E6M A;  4L5I A;  1H0M A;  1MJA A;  3KET A;  5FLX K;  2VE8 A;  1QO0 D;  4MTD A;  3K2Z A;  2P5K A;  2FNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...