1D8JA

Solution structure of the central core domain of tfiie beta
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
publication title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02186 TFIIE_beta TFIIE beta subunit core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d8jA00
2P4WA 4YFNF 4LLLA 1Z1DA 4JQFA 4IRGA 1XGMA 2CG4A 1WSUA 1Z9CA 2M8EA 2PBIA 4RB2C 1J9IA 3DXJF 5ICCA 5JVTA 2RNJA 3M7GA 3U2RA 3W6KB 3SFZA 2KJBA 2OBPA 3FXQA 2Q2EA 1R00A 3M8FA 2P7CB 2GA1A 3RPUA 1Z05A 1HSTA 3RKXA 4HDUA 5LLQA 5EEHA 1FYMA 4U7DA 2HR3A 1IRFA 3RYPA 1ZLJA 2Z9OA 2A07F 3U1DA 5K1YA 1B1BA 1IUYA 5FB2A 2RGVA 5AIPA 1USTA 2ZO4A 1XMAA 1CGPA 4L5IA 3L09A 2BV6A 3F8CA 2EV5A 2GA2A 4KFCA 1O7FA 3DKWA 2HYFA 2HQNA 1MZBA 3ERED 2OZUA 3KETA 3FMSA 3T1BA 2D45A 1S7AA 3GZ5A 2D1HA 2P7VB 5JR3A 4XSXF 3CO7C 2P8TA 2WTEA 3I58A 4L9NA 2YSRA 1K78A 2ZJ2A 3ABUA 2E1NA 3TO6A 3IWZA 3WGGA 5DCFA 2VN2A 4EQQA 4DNCA 3ZP5A 4OMYA 2EK5A 3FXRA 1H9TA 3MAJA 3BROA 1HQCA 5D8KB 2ISYA 2IT0A 4HV6A 4PDKA 2WWYA 5HDGA 3K0LA 3WTUC 2QENA 2V1DA 1QO0D 2UWMA 4GYGA 5ILSA 1HW2A 1WQ2A 1FC3A 3E97A 1FSEA 2QLZA 1W5SA 5ICEA 4IHTA 1LQ1A 2HOEA 2A3SA 1R58A 4G9YA 1P4AA 2DPUA 2FMYA 2MA3A 5D6EA 3E6CC 3COAC 2PMUA 1S6LA 2MLKA 1TLHB 2W57A 2XAGA 2ZMEB 2G7UA 1IN4A 3ULQB 3JAMZ 1U5TB 4I02A 3HSEA 5DV5A 3HRTA 1Z6RA 4NB5A 1DP7P 4HX7A 1O57A 2H6CA 4F7ZA 4A5MA 5BOXA 1OKRA 3F8NA 4CYDA 4U0VA 3L00A 1LVAA 2VBXA 4KIGA 4HV5A 3CJNA 3PQJA 3LAPA 3QRFF 2E7WA 5K5OA 5A2QZ 3F8FA 3ZPLA 2DK5A 1VTNC 2QZ8A 2NS0A 1OYYA 3ZMDA 2L4AA 3VEPA 2STTA 3JW4A 4M71A 3VFZA 2VC0A 5TJJA 2DTRA 2QQAA 4B09A 4BYYA 3KP4A 1F5TA 3IRRA 3LA2A 3SZTA 1I27A 4ZYEA 1LB2A 1WWXA 2IA1A 1W7PA 3FM3A 3HRSA 3R6SA 2Q8KA 3T5XA 1FOKA 2VBZA 4M74A 1F9NA 4QLCU 1X3UA 1BM9A 2HS5A 2HKXA 1IN6A 4KMUX 2VBWA 2R3SA 4UV9A 5HS7A 4HW0A 1FNNA 3HHHA 1IRGA 4HF0A 3IC7A 4LMYA 4NHJA 1SD7A 1KGSA 2UXXA 5DCMA 1FWZA 3HTUA 2M30A 3PFIA 4G6DA 1R22A 1BIBA 5KK1A 4OOIA 3WE3A 3KP7A 2JPCA 4UVCA 4ZYHA 2IA0A 2LNBA 2XGXA 1OYWA 2J5OA 1ZH5A 4MTDA 4G7ZF 2XVCA 4EM1A 1R1TA 1ZRFA 1OR7A 4MTEA 2HQRA 3C18A 2ZNYA 1PDNC 1L0OC 1RI7A 3GUDA 3J81K 1IN5A 3J80K 1BJAA 3I54A 1SD4A 1BOAA 5DD8A 3LFKA 2HFHA 4UVBA 5KVRA 4HF1A 2Y75A 5LHHA 4MNUA 3L7WA 5CJ9A 1QQIA 1IN7A 3ZMTA 3QP6A 3LA7A 5L3CA 4L9VA 1FP1D 2AXLA 2D2WA 3RTRA 2HZTA 2L54A 3KZZA 1U78A 4A2UA 3WODF 2FBKA 2XV4S 1O3SA 2O03A 3L2CA 2JPBA 2QBYB 1JHFA 4CHUA 3HUGA 2VXZA 1ZYRF 4ESJA 3K1MA 2ZCWA 4EM2A 5F6FA 1UFMA 2D1VA 3M9AA 1JE8A 3HIFA 4KT5C 5LGNA 1FZPB 3EUHA 3H3ZA 4A0ZA 4HOBA 3KP6A 4ZYDA 4BXUA 2DK8A 3TDUC 4LK1F 2VODA 3HRUA 4PGGA 2DLLA 2L3DA 3KP2A 4A6EA 4HX4A 1LNWA 3V8LA 2VOPA 3MWMA 5D4SA 3M8EA 3V7RA 2GXBA 2EV6A 2R7DA 5HDNA 1I1SA 1T6SA 5HLGA 4G6QA 4UNOA 3O3KA 1HW5A 5E17F 2JZYA 2CQKA 1R7JA 1HW1A 4Q48A 3QAHA 3TGNA 5DEQA 5D5UB 4R8HA 1BN5A 2BGCA 3DFGA 1LDKB 3MEXA 1PP7U 1FY7A 1BC7C 1YLFA 2XHKA 5F64A 4H0EA 4RAYA 3I5UA 3DP7A 3RIRA 3FWEA 1HKQA 2RQPA 1D5VA 3TO7A 3F3XA 3MZYA 5J6XA 3OV8A 2FOKA 1B59A 5HS8A 3R61A 1XCVA 2Z3YA 1TQPA 3EYIA 3KP5A 1FYLA 3HSRA 2KJCA 1B6AA 3F6OA 4M6XA 5ILUA 1F4KA 1ZREA 2W85A 2EFOA 3K1NA 3P9IA 5IT9K 2O6GE 2KKOA 5LBQA 2Z99A 1WI9A 1TQIA 1FYKA 2EFQA 1G3SA 1KQ8A 1QGPA 4HQEA 5FD6A 1LJ9A 4L0YB 1TW3A 1T98A 1V4RA 3C7JA 4EJVA 1SFXA 2FNAA 2XIGA 1FLIA 3WU1B 2EFPA 5LHIA 1BIAA 2CGPA 4G7HF 2YPRA 2O8XA 3QU3A 2L01A 5CVRA 1MJ9A 1WRJA 4PGHA 1GHCA 3EYYA 3CTAA 1I6XA 2NAZA 1S29A 4IRIA 3GW2A 3ECOA 2ISZA 3WTZA 1R36A 4MGRA 2Y0MA 2EB7A 5F1RA 4KYWA 1V3FA 2FEZA 4M9SA 3LWFA 4XRFA 1BBYA 1KQ9A 2M1BA 3V8KA 2OU2A 2WC2A 4A12A 5FGMA 2FSWA 4UV8A 3RI4A 2DFIA 1J0RA 4O6JA 4IHSA 3P9CA 1WKMA 2V79A 3E6MA 3V7SA 1Z91A 3ZMSA 4N9IA 3TOAA 5CVUA 3O2PE 5JI6A 3BWGA 4RAZA 2G9WA 5D5VB 4I7HA 2JT1A 4UVAA 3R0AA 3BZ6A 4KA4A 2A6EF 4BNCA 4HBLA 1S7OA 1KQ0A 1H0MA 4KICA 3HRMA 4KN4X 4GCVA 3I4PA 1S8NA 1G3WA 2K27A 3DEUA 4IF4A 2RC4A 3G3ZA 2XKPA 4R79A 4WX9A 3HOSA 5DUKA 4DQ2A 3BPVA 5D6FA 5L3BA 2P5LC 1SFEA 2EA4A 1SAXA 1H9GA 3RKWA 3IRQA 2GIVA 1ZG5A 3DF8A 3WG9A 3AAFA 1I5ZA 2EV0A 1W7PB 1FBUA 3NQOA 2QUFA 1LEAA 5FLXK 2VE9A 2EWNA 1ZARA 1DPRA 4Y15A 3TKYA 3V8JA 3GX4X 1XSVA 1FSHA 4BQAA 5LEJA 4B8XA 4EGZA 4ENMA 2OAZA 5K5QA 1KYWA 1R23A 3I64A 4CICA 2CYYA 4QWQA 3FZVA 5HVQC 1ZGAA 1OPCA 2CFXA 2VT2A 4GXOA 5DCMB 1DUXC 5ICGA 2XKOA 5L3DA 4RB3C 3LQQA 1KU3A 5FD5A 4YIIA 4LLNA 4OU0A 1EV7A 4M6YA 4M9XA 3HTSB 2FBHA 5IT3A 2FBIA 1IXRC 1SMTA 1QZYA 4LFUA 3K69A 4FT8A 3CO6C 2IP2A 2DW4A 1Z7UA 3IL2A 1XMKA 3WGIA 5HDKA 2VE8A 3RDIA 5IT9Z 3O6BB 2Y48A 2DQLA 2PFBA 3MCZA 1G4DA 2KIMA 1ZHFA 3KFWX 4M73A 2IPQX 3REOA 4M72A 2K4JA 1ON2A 3T0YA 4OINF 1XSXA 2LKPA 2OD5A 4Q4ZF 1D8KA 1SD6A 4AIKA 5H20A 2PN6A 1G3TA 2ZFWA 4G94A 1T39A 1F1ZA 1CF7B 3GLXA 2ZKZA 1O3QA 4WCGA 4JK1X 5DUIA 3WTVC 5D5WB 3WTWC 3S2WA 5H6RA 1SFUA 1XDUA 1IF1A 5L3FA 1YO5C 2OZ6A 4L5JA 1KA8A 1ZGJA 4EV0A 2W24A 1K6OA 4K2EA 2HDCA 2NNYA 3CUOA 2V9VA 2GWRA 4P9UA 1PP8F 3GF2A 5ILVA 3GFLA 5AONA 3GXOA 2V1XA 2LDUA 4ENJA 1IXCA 2OA4A 2ZNZA 3MQ0A 1UHMA 3QPHA 2ELHA 5LGUA 5BMZA 4D0PA 4YFKF 3E5QA 3K9TA 4IPAA 4XLNF 5E8IA 4HX8A 1IAWA 4WF2A 4OIOF 1HXDA 5J8CA 2PEXA 2E1CA 3N4MA 3FMRA 1OYIA 2J5PA 2IRFG 2MH9A 3BJAA 3WTYC 1YQAA 3BP8A 5E20A 3IHUA 1D8JA 1QPMA 2F5EA 5ICFA 1MGTA 1MD0A 1T38A 4HAMA 3EDPA 1NHAA 5HS9A 5FFZA 1R5GA 4G7OF 3P9KA 1CF7A 3E6BA 4MEYF 3ELKA 2JRTA 4AIJA 1SMYF 5CLSA 3I59A 1K79A 2DO7A 5CYVA 2LF8A 2DT5A 1AWCA 1GXPA 4MQVA 2H6BA 3F72A 2X0LA 4KN7X 4UXNA 1IW7F 5D8LB 4OIRF 1TQMA 4O5VA 2VONA 4XLPF 2PJPA 1FPQA 2A69F 3ZMVA 5JFRA 3VODA 4ETSA 2XUBA 2ESHA 2HKOA 3JSPA 1U8RA 3SXYA 1LDDA 1JHHA 2FE3A 2BYVE 3KZYA 3DV8A 2BEOA 1U6GA 1TNSA 2FRHA 2ETHA 4RB0A 4Z2YA 4UUVA 5E1WA 3FXUA 2VT3A 4S05A 4ASNA 4OMZA 2YX7A 2DU9A 1YW8A 3F6VA 2PLYA 3ZMUA 3HSFA 1YW7A 4L9JA 1FT9A 1W7PD 3E5XA 4A0YA 5LGTA 4EJOA 4RS8A 2IA2A 5L3GA 3TQNA 5LHGA 2M87A 2F2EA 1U2WA 4GYIA 2Q0OA 1R5HA 3F8MA 1P2FA 1ULYA 2EJRA 1ZLKA 3VB2A 4NQWA 2FXAA 2VC1A 3ML6A 5FFXA 3EETA 4XSZF 1O3RA 1QZZA 2KRFA 2RN7A 1Y0UA 3PQKA 4PZJA 5JHUA 2H94A 3QOPA 1UB9A 4U88A 3BJOA 4I98B 1KU9A 3ISPA 4I2OA 3BPXA 3RKYA 4Q47A 2GQQA 5CVJA 2A5YB 4HYEA 1OMIA 3DPLC 2XAJA 3GZ6A 2STWA 3B02A 2FQ3A 2MH2A 5E1XA 5A2QK 1BI1A 2K7LA 2E7XA 1W5TA 2HGCA 2LSOA 1ON1A 2UZKA 3R60A 2XASA 3E6DA 1R1UA 1I1GA 1BI3A 1ZAOA 3HHGA 3Q9SA 3SHFA 4N0BA 4KMFA 4LJZF 3GFMA 1W4MA 3P7NA 2YX4A 4IVNA 2ADUA 4ESBA 2M5WA 5BS6A 3N97A 2Z5UA 2FA5A 3ZMZA 3WTTC 1HBXG 3J81Z 3J80Z 2V6CA 1S3JA 2LF7A 3NRVA 3TO9A 4KIBA 2EFWA 4E70A 4RGUA 3KLOA 3TOBA 3J7AO 2IW5A 5DDGA 4HA8A 3V4GA 2CSOA 5BPIA 1J59A 4HQMA 3DPTA 2FNPA 5H6QA 6PAXA 2RDPA 2UXNA 4EMSA 1XN7A 3QU6A 1KU2A 1Q1HA 1A04A 3RPQA 3F8BA 4IXAA 1XCBA 4Q5SF 4XBFA 4ENKA 1BI2A 4ZYGA 3GYHX 1ZN2A 4FX4A 4WXHA 3F21A 4LGWA 1FBSA 4I01A 5BPDA 3L9FA 2FF4A 1YTYA 1U5TC 4AD9A 2CWEA 2NYXA 2HTSA 2K86A 4R1HA 2C6YA 2AS5F 5LRRA 4L0ZB 2ACJA 3ABTA 2VBYA 4EM0B 1USSA 4KUMA 1MDMB 4G8XA 4OIPF 1UCRA 1PUEE 4HZFA 1EH7A 4I0AA 4KDPA 3M1EA 4IJAA 4YG2F 2CO5A 4MHGA 4BAYA 1YIOA 2X4HA 1D3YA 4P5OA 2P5VA 4IRHA 2QVOA 3H92A 2YR2A 2OQGA 3LQRA 4LB6B 3TDZC 1LEBA 1MJAA 2PMHA 2BBYA 2JTVA 2PQ8A 4LK0F 4N9HA 4LB5A 4AWXB 1G3YA 1JXSA 1GXQA 2GAUA 3MFKA 2COMA 3JTHA 4ZZLA 4YFXF 3ECHA 2HYGD 4HF2A 3GVAA 2WV0A 3WTSC 1RIOH 4I09A 1AOYA 1YFHA 1G6NA 3KCCA 2V1UA 3C3WA 5TRDA 1RUOA 1DPUA 2QWWA 3WU0A 3U9GA 5LRSA 1XDSA 5E18F 4CZZA 4U0YA 1JGSA 1YYVA 4BHBA 2ZXJA 2RVCA 3D0SA 3FHZA 2H27A 2EA2A 3KLNA 1QBJA 1XGNA 3R0JA 3CLOA 5HOOA 2G7HA 2DAOA 1ODDA 3BJ6A 2W25A 4TV7A 1P4XA 2PG4A 2FMLA 2MD5A 3FM5A 3ROUA 1XB4A 5DYMA 3Q9VA 1MDMA 3FMQA 3T8TA 1FP2A 1YG2A 2O3FA 3WGHA 2K4BA 1J75A 3Q5FA 4LLGF 3I59B 4L18B 1XSDA 1KU7A 3HOTA 1O7LA 4FHTA 4RGSA 4EGYA 1TTYA 2L02A 3LSTA 5D4RA 3E5UA 3ZQ7A 2HWVA 2OQRA 3F23A 1P92A 4A6DA 1T2KA 4L9TA 1ZG3A 1IN8A 3WE2A 5CVIA 3FF5A 2P6SA 3K1PA 4ESFA 1O3TA 1TBXA 4P55A 2NNNA 4KNYA 4RB1A 1J7KA 1TNTA 3RJPA 2XAHA 4EJUA 2TDXA 4U7BA 2ESNA 3QP5A 5ED4A 2DPDA 4JBAA 5HLIA 2GXGA 4BH9A 3F22A 2L4MA 1FBQA 2XROA 4EVIA 2PI0A 2B0LA 3CUQC 1J5YA 2EFNA 3NEUA 2ZMEA 4BHCA 1B4AA 3KEQA 4CXFA 4LG0B 3MZHA 2VOOA 1U5TA 1ZRCA 5L3EA 1BI0A 4UHTA 4A0XA 4AIHA 3GO5A 4WXCA 4EJWA 4ZZDA 1RNLA 1E17A 3JTGA 1TW2A 3FX3A 2CW0F 2QQ9A 5ERIA 1IXSB 1YW9A 3K2ZA 3ZN1A 3B73A 2JSCA 2O61A 4RGRA 1HKTA 1KYZA 3LA3A 5FO5A 4WXDA 3D5LA 2YU3A 3W6JB 1XGOA 3GFIA 5FLXZ 5EEGA 3E3VA 4EJTA 2P6TA 5E1ZB 2K02A 2MLGA 2MC3A 3BY6A 2P5KA 5DD4A 5BQTA 2O0YA 1DDNA 4ENNA 2A68F 1ZG1A 2BE5F 2ZBKA 4KIFA 1HKSA 3IKVA 1Z6TA 2M45A 3KEOA 4U0WA 3T8RA 3I53A 1E2XA 4OIQF 1XD7A 3C1DA 1IZ1A 3BOQA 4HLYA 3LAJA 1QNTA 1STZA 3H3UA 5CVVA 3CUQB 4YIFA 3G73A 1B9NA 3OOPA 2DQRA 2IVMA 1BC8C 3IKTA 1B9MA 4LG0A 2DI3A 4CDGA 4HDVA 5D5XB 4S04A 3GEZA 2KIFA 4MEXF 1EH6A 2RKHA 3HYIA 4FX0A 2QQBA 2MBFA 1U3EM 5LEKA 1RZ4A 2F5FA 2XRNA 4GGGA 4CGZA 2R7FA 1YS7A 4CO8A 1P4WA 3GFJA 2HTJA 1L3LA 1ZRDA 3IWFA 1P6RA 1C0WA 3WTXC 3SZPA 4AVPA 1FX7A 2RV8A 3ZN0A 2FU4A 4BHPA 3VOEA 1K7AA 2W84A 1LDJA 4Y17A 1T0FA 2QM3A 1YS6A 3SQNA 2H09A 3JAMK 1EH8A 4HLXA 4RGXA 3JSOA 2Z33A 2QBYA 1REPC 2XAFA 1XGSA 5AIQA 4WWCA 3RYRA 3R4KA 3EQLF 4WK8F 1ONVA 5J8FA 1MJBA 4P9FA 2F5DA 2KIUA 2XAQA 2F5CA 3KP3A 3I71A 1SD5A 3CDHA 4P96A 4A5NA 4LD5A 2A61A 3CUQA 1GVJA 1MKMA 3BDDA 5K5RA 3V7CA 4Y13A 2NRAC 3KE2A 4ZH4F 2GZWA 3GWZA 4PCQA 3QPTA 4MQ9F 5E8GA 2IJLA 3I0TA 4M9ZA 2HEOA 1UHWA 2QYOA 3DQVC 4GO1A 1J2XA 4O3MA 1HSJA 2DBBA 4ON0A 2A6HF 1K78B 1R1VA 4I0BA 5HLHA 1RUNA
chains in the Genus database with same CATH superfamily
3C2GA 2P4WA 5IOZA 2KDOA 4XRSA 4YFNF 2DFHA 4B4CA 4LLLA 3MZ8A 1Z1DA 4M3DA 2QQ8A 1O4XA 2R7WA 2VIXA 1I50J 4JQFA 4Y33A 4IRGA 4OAZA 1XGMA 2OCEA 2EIMH 4N4OB 3SEZA 2CG4A 2E71A 2WAEA 5EGOB 5C44J 4QSHA 1WSUA 4QTRA 3CCJI 2FX0A 1Z9CA 4UB6C 1AKHA 2HI3A 1U0JA 1FOXA 2M8EA 2CQNA 2PBIA 3FISA 3KZIC 4RB2C 1J9IA 3DXJF 5ICCA 3H0GJ 2RNJA 3M7GA 3U2RA 5JVTA 3W6KB 1UHSA 2ZFUA 3SFZA 2KJBA 2OBPA 2VJJA 1ETYA 2ICWG 5IP7J 3FXQA 4E7IA 3CCSI 2Q2EA 2HOSA 1R00A 4XLHA 2CUEA 3M8FA 2EINH 1H88C 2P7CB 4FQGA 2GA1A 3RPUA 2F48A 3WU2C 1Z05A 1HDDC 1I6HJ 1HSTA 4NC6A 3RKXA 2CRGA 1OCOH 4HSRA 3ZGKA 4HDUA 2O9LA 1ENHA 3KYCB 5LLQA 5EEHA 1FYMA 4U7DA 1VQKI 2HR3A 3FHNA 1IRFA 3RYPA 4CA0A 1ZLJA 5LFAA 1VQ7I 2Z9OA 3LMMA 1Y1WJ 2A07F 1I3QJ 3U1DA 3HJEA 1XG1A 3HOVJ 1FIAA 5K1YA 1B1BA 1IUYA 3DWLE 5FB2A 2RGVA 4ITVA 5AIPA 1USTA 2VQGA 4FTHA 3DCFA 4A3EJ 1IRZA 2LBFA 1N75A 2ZO4A 1XMAA 1CGPA 4L5IA 1OR7C 3L09A 1SFOJ 2BV6A 3F8CA 3CCLI 2EV5A 2GA2A 3F9KA 1YJNI 3DTIA 4F92B 4KFCA 4LITA 1O7FA 3DKWA 1BW6A 3OYIA 2HYFA 2HQNA 1MZBA 4B43A 2NVTJ 3ERED 2DFFA 4ZYAA 5FKNA 2OZUA 4XN3A 3VPRA 3KETA 3FMSA 1D0YA 2IGKA 3T1BA 1WJ5A 5FRMA 5DM6F 2D45A 1S7AA 2MC4A 3GZ5A 2D1HA 2P7VB 1OCCH 5JR3A 4XSXF 3CO7C 2P8TA 2WTEA 3I58A 4L9NA 2YSRA 1K78A 2ZJ2A 3QPSA 5CQEA 1F36A 3ABUA 5IYDJ 3MN2A 2E1NA 2X48A 4BE0A 3TO6A 2Y0SA 3SEQA 2HXIA 3IWZA 3S1QJ 3WGGA 1UG2A 4PSWA 5DCFA 1RR8C 2VN2A 4EQQA 4DNCA 3G6EI 3ZP5A 4OMYA 3CCYA 3IAS2 2EK5A 1HOMA 1FIPA 3FXRA 1H9TA 3MAJA 4V2GA 3BROA 3QPLA 5EGOA 4DZPA 3SDGA 4FE4A 1HQCA 1VFCA 5D8KB 2ISYA 2K9NA 2IT0A 4HV6A 4PDKA 3S15J 2WWYA 5HDGA 1MBFA 3K0LA 3WTUC 2QENA 2V1DA 1QO0D 4XRMA 2UWMA 4GYGA 5ILSA 1HW2A 1WQ2A 4B44A 1FC3A 2O7OA 1OCPA 3E97A 1FSEA 2QLZA 4ZTJA 1W5SA 2Q1ZB 2ZB9A 5ICEA 4IHTA 1YIJI 1LQ1A 2HOEA 2HXOA 3EUHC 2E60A 2A3SA 5FKKA 1NK2P 2Z16A 1R58A 3PL8A 3HPHA 4G9YA 2IGNA 1P4AA 2DPUA 4A3DJ 2FMYA 2MA3A 2W00A 5D6EA 3S2DJ 2R7SA 3E6CC 3COAC 1R4MB 5J3LA 2PMUA 3CP2A 2DJIA 3RSNA 1S6LA 2MLKA 1TLHB 2W57A 2XAGA 3GMEA 2ZMEB 2XDVA 2G7UA 2QSGX 1IN4A 1JTXA 3ULQB 3JAMZ 1ETQA 1U5TB 4A3KJ 4I02A 3HSEA 2LC2A 5DV5A 4BEHA 3HRTA 1Z6RA 1X1CA 2FUG2 1D1AA 3E0JB 4NB5A 1DP7P 3JREA 3CQZJ 5FLMJ 4S0HB 4HX7A 2E2IJ 2QGUA 1O57A 5F0HA 1QHHD 2H6CA 4N4NB 4F7ZA 5LD2C 4A5MA 3FKJA 5BOXA 5EZHA 2DMPA 4JX4A 4FCYA 4AIDA 2VQHA 1OKRA 3F8NA 5CKTA 4CYDA 4FETA 4U0VA 4D7MA 2UV1A 3L00A 1LVAA 2VBXA 4KIGA 2DT7B 3CJNA 3PQJA 4HV5A 4W97A 3LAPA 3QRFF 2KZVA 2CH0A 2E7WA 3N05A 5K5OA 5A2QZ 3G4SI 2VJ4A 2DA1A 3F8FA 1GV2A 3K4KA 3ZPLA 3OIPA 2H1LA 2DK5A 2VJ5A 1VTNC 3BG7A 1K4SA 2QZ8A 5EDNA 3HGGA 2NS0A 1OYYA 4L0YB 2WAFA 4ZC3A 3ZMDA 2L4AA 3VEPA 3H5AA 1OCRH 2K9SA 2STTA 3JW4A 4M71A 2VC0A 5TJJA 3VFZA 2DTRA 2QQAA 4B09A 5F08A 2CU7A 3KP4A 4BYYA 5EG0B 1F5TA 4W1UA 3IRRA 3LA2A 3SZTA 1I27A 3H36A 1WJAA 4ZYEA 3BTJA 1LB2A 4E7JA 1WWXA 3WHBA 2IA1A 1W7PA 2LR8A 3FM3A 3HRSA 5JHFA 3R6SA 4XL9A 4RLQA 2Q8KA 3T5XA 1FOKA 2VBZA 4M74A 1F9NA 1QPIA 3S8PA 2GXAA 1MBHA 2LRDA 4HSTA 1X3UA 4QLCU 2MW8A 4BKXA 1BM9A 3LSJA 2HS5A 2HKXA 3J7YJ 1OLTA 5F0CA 1IN6A 4KMUX 2A6TA 2VBWA 3HB9A 3HOWJ 3IAM2 2Y9YA 5IPAA 2VKHA 1FJLA 1D0ZA 2R3SA 2VB6A 2R7OA 3HUGB 4UV9A 4HW0A 3P5JA 5HS7A 2EZIA 1E3OC 1FNNA 3HHHA 2VLAA 3KPHA 1D0XA 3DKYA 2QSHX 2Y69H 4HF0A 3IC7A 1BR4A 4LMYA 3ERMA 1S9HA 3C2BA 1S72I 4NHJA 4RM3A 1SD7A 1P7JA 3L2QA 2EIKH 1KGSA 1A31A 2UXXA 5DCMA 2L9RA 1FWZA 4EEFG 3HTUA 2M30A 1DU6A 1Y56A 2ME0A 3PFIA 2O5RA 1MNMC 4G6DA 2M8GX 2VPRA 1R22A 1BIBA 2GLOA 5KK1A 4OOIA 3BG5A 3WE3A 3IUOA 3KP7A 4DJAA 2JPCA 4ZTFA 4PJ0C 2AHQA 4UVCA 4ZYHA 1VQ8I 5FLVA 2JQ7A 2BHYA 2IA0A 4KJZA 2LNBA 1A5JA 4AUXA 2XGXA 3BR3A 1HA8A 4IZZA 1OYWA 1BA5A 2J5OA 1ZH5A 5E3NA 4HEA2 3D5SC 4MTDA 2JRMA 3OYLA 2JSPA 3HOXJ 4G7ZF 1W0UA 2XVCA 4EM1A 2KLOA 3O8GA 1R1TA 3SFIA 4A3MJ 2LTPA 2VKDA 3DLAA 1ZRFA 4Y7NJ 4X0GA 1OR7A 4IO9F 4MTEA 3WHCA 2HQRA 3C18A 1ZTRA 2ZNYA 1PDNC 1L0OC 3MVPA 1RI7A 1WJCA 2K5CA 3GUDA 3J81K 1IN5A 4V2FA 1WJFA 2F5VA 1N77A 3J80K 3H5RA 1BJAA 3I54A 1SD4A 2G0EA 1BOAA 5DD8A 3LFKA 2HFHA 4XQFA 4UVBA 3GZNB 5KVRA 4HF1A 3LOCA 2Y75A 5LHHA 3BZCA 1Z77A 3KEYA 4MNUA 1X1DA 3BTIA 4DYQA 3L7WA 5CJ9A 1WCMJ 1QQIA 1IN7A 3BR0A 1G59A 3ZMTA 3QP6A 4LOCA 2IEKA 3LA7A 5L3CA 3NWTA 2TRTA 3FXKA 4L9VA 2E2JJ 1FP1D 2AXLA 2Y0SN 2D2WA 3RTRA 4IQJA 1ETXA 2ME6A 2HZTA 2L54A 3KZZA 1U78A 4A2UA 2B63J 3WODF 4MIMA 2FBKA 2HOAA 2XV4S 1FTZA 1O3SA 2O03A 4YIRX 4C30A 3L2CA 4DBQA 2JPBA 2XB5A 4B3AA 3OOUA 2IGOA 1LFPA 2QBYB 1IV8A 1JHFA 3HUGA 4CHUA 2VXZA 1ZYRF 4ESJA 3AG3H 3K1MA 2HYJA 2ZCWA 4EM2A 1UG0A 5F6FA 3HC7A 1UFMA 2NS8A 2D1VA 3M9AA 5FKOA 1JE8A 3HIFA 4KT5C 5LGNA 1FZPB 3GTQJ 3EUHA 3H3ZA 3ABLH 4A0ZA 3OYKA 3S93A 4HOBA 3KP6A 4IX7A 1QHGA 4ZYDA 4BXUA 2E1OA 1TP4A 2DK8A 2ZSHB 4LK1F 3HRUA 3TDUC 2VODA 4PGGA 2DLLA 2L3DA 3KP2A 4H4KC 4A6EA 3IH2A 1SFKA 4HX4A 2CV2A 1LNWA 2B9SA 3CC4I 2ZJQF 3I9V2 4XORA 3S1NJ 2DOEA 3A0BC 3V8LA 2VOPA 3MWMA 1A36A 5D4SA 1XC5A 2V7FA 1EA3A 3M8EA 3V7RA 2GXBA 2CUZA 2EV6A 2R7DA 1MW7A 1YITI 5HDNA 3M1CA 4UY8I 1I1SA 3W2AA 3M07A 1T6SA 1VNDA 1TT0A 3DTKA 5HLGA 4G6QA 2WY8Q 2BY2A 4UNOA 3O3KA 2HOTA 1HW5A 4C9YA 3H9GA 5E17F 2JZYA 2L7FP 2M4GA 3IP4B 1T33A 2CQKA 1R7JA 1HW1A 2FOWA 3SJMA 2OUMA 4Q48A 3LSRA 3QAHA 4M3FA 3TGNA 5DEQA 5D5UB 2CW8A 3ONQA 3PO3J 4R8HA 4F93B 1BN5A 2BGCA 3PUBA 4D1QA 3DFGA 1LDKB 4J19A 3MEXA 1PP7U 1FY7A 4AC0A 1BC7C 2I8DA 3CC2I 1YLFA 2DDAA 2XHKA 2H8WA 5EEAA 1HLVA 5F64A 4AU7A 4BU2A 4H0EA 1IJWC 4RAYA 3I5UA 3DP7A 3RIRA 3FWEA 1GVDA 1HKQA 2RQPA 1D5VA 4NC8A 3TO7A 3F3XA 4BXFA 1MBEA 2OTLI 3MZYA 5J6XA 3MKLA 1T08B 2RQQA 3OV8A 2FOKA 1B59A 2KIQA 5C4JJ 3H5NA 2CFOA 3V42A 5HS8A 2ZJPF 1NH3A 1ZR4A 2RNGA 3R61A 2NOJB 1E3HA 3HOZJ 1POGA 4CCJA 1W36C 1XCVA 2Z3YA 1TQPA 5GADJ 3EYIA 3KP5A 1FYLA 2L7ZA 3HSRA 2KJCA 1B6AA 3F6OA 4M6XA 2IS1A 3VYUB 5ILUA 3K70D 2IBDA 1F4KA 1ZREA 2W85A 2EFOA 3K1NA 3I4NJ 4PJJA 4NBQA 1SC7A 3TP3A 3H1CA 3P9IA 2JA5J 4IKFA 5IT9K 3B6AA 1JTYA 1VQNI 3NAUA 2O6GE 3RZOJ 2KKOA 5LBQA 2Z99A 1WI9A 2JWTA 1TQIA 2EIJH 4CCLA 3OY9A 2EFQA 3TMOA 3FXJA 5FROA 1FYKA 1G3SA 1KQ8A 1QGPA 2BY1A 2DDBA 1LJ9A 3KIOA 5FD6A 4HQEA 1TW3A 5GAGJ 1T98A 1V4RA 2E5NA 3C7JA 4MLOA 2LVSA 1SVLA 4EJVA 1SFXA 2FNAA 2XIGA 4JP0A 4XICA 2BW3B 1FLIA 3WU1B 2EFPA 5LHIA 1BIAA 2ELKA 2CGPA 4PFPA 4G7HF 2YPRA 3IH4A 2O8XA 3QU3A 4Z6YA 2L01A 3QWLA 3UNGC 4IOCF 4XOTA 4G6TB 2KT0A 1MJ9A 5CVRA 1K61A 1WRJA 1R9TJ 4PGHA 4AYBA 1GHCA 3EYYA 1Z3YA 3CTAA 4BY1J 1D1CA 1I6XA 1W1WE 2NAZA 2LFBA 1S29A 5HODA 4IRIA 4BDZA 3JRCA 2VL8A 4IHXA 4MO7A 3B6CA 3FIWA 2V9PA 3CLQA 3GW2A 3ECOA 2ISZA 3WTZA 1R36A 4MGRA 2W48A 2Y0MA 2EB7A 2DJNA 3S2HJ 1Z21A 5F1RA 3ZQCA 4KYWA 3CD6I 1Z67A 1OQYA 4XONA 1V3FA 2FEZA 4M9SA 1EKEA 4XLAA 3A02A 3LWFA 4XRFA 1FOYA 1BBYA 1KQ9A 2M1BA 1ETWA 3V8KA 2OU2A 3KYLA 2WC2A 3S17J 4A12A 5FGMA 3DU5A 2FSWA 4UV8A 1D1BA 3RI4A 3HBLA 4RLFA 2DFIA 3M4OJ 3BTLA 1J0RA 4O6JA 4IHSA 3P9CA 1WKMA 3LL7A 2V79A 5DTDA 3E6MA 1S5LC 1IG7A 3V7SA 2HQAA 1Z91A 4FE7A 1MBGA 4JX5A 3ZMSA 3ZQIA 5EF6A 4N9IA 3Q0VA 3TOAA 1QA6A 5CVUA 1NK3P 4E4HA 3O2PE 1MMSA 2X1CA 5JI6A 2F4MB 1ZKGA 3BWGA 2M34A 3KYDB 4RAZA 2LY1A 3CESA 1BR2A 2G9WA 2AXTC 5D5VB 4I7HA 2JT1A 3NWSA 4UVAA 4BEHB 3R0AA 2IGMA 3BZ6A 2KISA 2A6EF 3A4CA 4KA4A 3I55I 4BNCA 1OFCX 1YHQI 1FOWA 4HBLA 5J4YA 1S7OA 3CDLA 2VKEA 1KQ0A 1H0MA 4KICA 3HRMA 4KN4X 2LY2A 3HGYA 4GCVA 2COBA 3I4PA 1JUPA 1S8NA 1G3WA 2K27A 3DEUA 1Z3XA 4D7NA 2LYCA 4IF4A 3VYSB 2BOLA 2RC4A 1IUFA 3G3ZA 2XKPA 4R79A 1A6QA 3VWBA 5BNGA 4WX9A 4RBOA 3HOSA 5DUKA 2BW3A 4DQ2A 2ZXWH 5KHDA 5E3LA 3AL0C 3BPVA 2H1KA 5D6FA 5L3BA 2P5LC 1ETOA 2DYSH 1YI2I 2ID6A 4BXXJ 1SFEA 2CMPA 5B1BH 2EA4A 4CCOA 1Q1VA 1SAXA 1H9GA 3RKWA 5EJCA 3I56I 4C2TA 2M9HA 1WI3A 3BZKA 3IRQA 2GIVA 3OIQA 1ZG5A 1HF0A 3DF8A 1NG6A 4GRIA 2EPFA 3WG9A 3AAFA 2LREA 4DOZA 1I5ZA 5KCMA 2EV0A 1W7PB 1FBUA 4XM3A 1Y0NA 3NQOA 1GLNA 1LEAA 2QUFA 3JCUC 5FLXK 3OL4A 2VE9A 2ZJRF 2EWNA 1ZARA 3RZDJ 5J47A 2FQ4A 1DPRA 4IL6C 1YX5A 4KT6A 4GDFA 1N25A 1SAUA 2KP6A 4Y15A 3TKYA 3V8JA 1MMAA 2HPIA 3GX4X 1XSVA 4A3GJ 1FSHA 4RDUA 3GTLJ 3RQ4A 4BQAA 2Y2ZA 2XF7A 5LEJA 2W7NA 4B8XA 4EGZA 4ENMA 3SDBA 2OAZA 4M3EA 4IHYA 5K5QA 1KYWA 1R23A 2XSDC 3I64A 4CICA 2VQCA 2CYYA 1SVOA 5B66C 4QWQA 3FZVA 5HVQC 3U21A 1ZGAA 1OPCA 3AKZA 2CFXA 2VT2A 4GXOA 1X1BA 2DA5A 4YEJA 1HC8A 4AM3A 5DCMB 3MKYB 1DUXC 4CCKA 5ICGA 2WY7Q 5GAEJ 3GTJJ 2XKOA 5L3DA 2ZXHA 5JLWA 4RB3C 2E35A 2KRCA 1J09A 3LQQA 1KU3A 5FD5A 4LIUA 2DCEA 4YIIA 4F52A 2IAIA 2JK3A 2R7RA 2XAUA 4LLNA 2R7XA 5M3FJ 4OU0A 3L2UA 3VSLA 3OMYA 2HVRA 1EV7A 2V6EA 4M6YA 4M9XA 3HTSB 2FBHA 5IT3A 1LFUP 2FBIA 2R7UA 1IXRC 1SMTA 4E7SA 3F0CA 3W2WA 4HNTA 3A03A 3I4MJ 4KISA 1EF4A 1QZYA 4LFUA 3K69A 4FT8A 1WJEA 1WGXA 3PNTA 3CO6C 1ZQ3P 2IP2A 2R7ZJ 2DW4A 4JOMA 3QYFA 1Z7UA 3IL2A 2R4GA 3OIOA 2EZHA 2CQQA 1VQ4I 1XMKA 1X1AA 2DA3A 3WGIA 2AO9A 2LOOA 4NUBA 2AQFA 5HDKA 2VE8A 3RDIA 4U87A 1IRXA 4MFEA 4I76A 3AL0B 2HZDA 5IT9Z 3CJRB 1OJLA 3S16J 3G1OA 3O6BB 2Y48A 2DQLA 2PFBA 2L9SA 3K4MA 3MCZA 5C3EJ 2RREA 4AVZA 2W1OA 1OCZH 1G4DA 1X3WB 2VASA 4D9JA 2KIMA 4XLFA 4C2MJ 1ZHFA 4BDYA 3PNVA 3KFWX 4M73A 2IPQX 2Z2SB 4XR6A 1B72B 3REOA 2K3FA 4M72A 5CPRB 2K4JA 1ON2A 3T0YA 4OINF 1XSXA 2LKPA 2OD5A 4BUPA 4Q4ZF 2LLKA 1D8KA 1SD6A 1WFXA 2DMQA 4AYBN 5H20A 4AIKA 2PN6A 1G3TA 2ZFWA 4G94A 3HG9A 1T39A 2QA4I 4MFDA 2MFZA 4RM2A 1F1ZA 1CF7B 5HLTA 3GLXA 4B48A 2ZKZA 1O3QA 3OYGA 4WCGA 4JK1X 5DUIA 3WTVC 5H2FC 5D5WB 3WTWC 3S2WA 2XF5A 5H6RA 1SFUA 1XDUA 3CCEI 3ESWB 3RPUD 4BE1A 1IF1A 5IYBJ 5L3FA 1YO5C 3PNYA 3AG1H 2OZ6A 2ECCA 2E1MC 4L5JA 1KA8A 1IO2A 2XC7A 2NXNB 3RCOA 2M7AA 1ZGJA 4EV0A 3A01B 3CC7I 2M2EA 2W24A 3L2RA 1K6OA 2CQ7A 1M1EB 1UJ8A 4K2EA 2KHMA 2HDCA 1IRGA 2VPLA 2QKMB 2R7QA 5B5EC 2NNYA 3CUOA 4BY7J 2V9VA 2GWRA 2GBYA 4P9UA 2HVSA 2M0CA 1PP8F 4XRSG 3GF2A 2EQRA 5ILVA 2R7VA 3GFLA 5AONA 2LDUA 2V1XA 3GXOA 4ENJA 1Y1VJ 1IXCA 1W5CC 2OA4A 3OSGA 2ZNZA 3M8JA 3FXOA 1FTTA 3MQ0A 1UHMA 3QPHA 4BACA 1GT0C 2ELHA 5LGUA 4A3CJ 5BMZA 4D0PA 1ZELA 4YFKF 3D5RC 3EPZA 3FBNB 4YRVA 1ZGWA 3E5QA 1V5EA 1U9OA 3K9TA 3PIPF 3H35A 4G12A 4IPAA 9ANTA 4XLNF 1HDPA 5E8IA 1MH3A 4HX8A 1IAWA 2W82A 2ELJA 4WF2A 4OIOF 1HXDA 1Y8RB 4X1EA 5J8CA 2PEXA 1E0EA 1N78A 2E1CA 3N4MA 3FMRA 1OYIA 2J5PA 2IRFG 2MH9A 1TWFJ 3BJAA 3WTYC 1YQAA 3BP8A 4XKVA 5E20A 1PUFB 4A93J 4NDLA 3IHUA 1D8JA 1QPMA 3K7AJ 3DU6A 4IHVA 2F5EA 1UMQA 1QU3A 2Y30A 5ICFA 1MGTA 1Y6IA 3ABKH 1MD0A 1ETKA 4DYCA 2MSYA 1T38A 4HAMA 3EDPA 1B72A 2NOGA 3TEDA 2YUSA 1LVKA 3ZRGA 3GTGJ 4HRIA 1NHAA 4CCNA 2UUZA 3DEEA 5HS9A 4BQQA 3OYMA 5FFZA 1VQPI 3ABMH 3CJTB 4F3QA 1ZK8A 2F4OB 1R5GA 4G7OF 3P9KA 3LSPA 3CCRI 3E6BA 4MEYF 3ELKA 3TW6A 5GPCA 1CF7A 3S14J 3BG6A 3LFUA 4CSWA 2JRTA 4AIJA 3VDXA 2DXIA 2NS7A 1SMYF 3HKZN 5CLSA 3I59A 3OYHA 1K79A 2DO7A 1AHDP 4DW6A 5CYVA 1MBKA 1VI0A 2LF8A 2DT5A 2ZSIB 1CQTA 1AWCA 5J1UA 1GXPA 4MQVA 2H6BA 2V1NA 2V4JC 3F72A 4DIQA 1P9QC 2EBIA 2X0LA 4KN7X 1MMGA 4UXNA 2CS3A 1X2NA 4PJNA 1GDTA 5IP9J 1IW7F 3A01A 3E7LA 1U9NA 5D8LB 2PX9A 3K10A 3K4LA 4OIRF 1MSFC 3C2HA 1TQMA 1FMVA 4O5VA 1V55H 2VONA 4XLPF 3OYBA 2PJPA 1FPQA 3HEFA 2A69F 1YOVB 3ZMVA 5JFRA 5IYCJ 3VODA 2E36A 3TL4X 2PMZN 2ZC2A 1V5FA 3HOUJ 2X85A 4A3JJ 3HXLA 4ETSA 2NVUB 2XUBA 2ESHA 2HKOA 3JSPA 2BY3A 1ITYA 1U8RA 2LP0A 3SXYA 2H8RA 1LDDA 4C3IJ 2BVLA 1JHHA 2Y9ZA 4XLEA 2FE3A 3CCVI 4XMYA 2BYVE 3Q0WA 1OCTC 3ZQGA 3KZYA 3Q0UA 3HL2A 3DV8A 2Z1DA 4ZJZA 1JJ6C 2BEOA 1U6GA 2VI6A 1TNSA 1WHUA 2FRHA 2ETHA 2M7BA 2CUFA 4RB0A 4Z2YA 3CMAI 5KAIC 3OR1C 3BTCA 3FXUA 3K4JA 5E1WA 4UUVA 2VT3A 3BCBA 4S05A 4ASNA 4CUGA 4OMZA 2YX7A 2YU9J 2DU9A 1YW8A 3F6VA 2PLYA 3CJQB 3ZMUA 3MMYB 1T95A 3BR5A 3HSFA 1YW7A 4L9JA 1FT9A 5F1JA 5IY5H 3A1YA 5JVGF 1W7PD 4BS9A 3E5XA 1PUFA 2BXZA 1G8XA 4A0YA 5LGTA 4EJOA 4RS8A 2IA2A 1HCRA 5L3GA 3TQNA 3BR1A 5LHGA 4J01A 2M87A 3BQYA 5GTIC 3LSHA 2F2EA 1U2WA 4GYIA 2Q0OA 1R5HA 3F8MA 4PFOA 1P2FA 1ULYA 2EJRA 1ZLKA 3VB2A 1WH5A 4PSXA 2EILH 4NQWA 4F91B 1MMNA 2FXAA 1JJ8C 2FJ1A 2VC1A 1I39A 3QYEA 3ML6A 4QPOA 5FFXA 1AA7A 3EETA 3UR3C 4XSZF 3BT9A 3VSKA 1O3RA 4CH7A 1QZZA 2OPTA 2F4IA 2KRFA 2RN7A 1Y0UA 3PQKA 1IC8A 2VJIA 4PZJA 5JHUA 2H94A 3OYJA 2K9LA 3PSIA 3DLLF 2GOXB 3JRIA 3QOPA 1UB9A 2VXDA 1RPWA 4U88A 3H9JA 3BJOA 4E7HA 4LG3A 3U1KA 4I98B 2XF6A 1KU9A 3ISPA 4I2OA 4DBRA 3BPXA 4Q47A 3RKYA 4RA2A 2GQQA 5CVJA 3S1MJ 2LKXA 2A5YB 3OYEA 4HYEA 3G71I 2JA8J 1OMIA 3DPLC 2XAJA 3GZ6A 3GTKJ 2STWA 3B02A 5K7FA 2FQ3A 2MH2A 3CMEI 3OYAA 5E1XA 3K4NA 1X1PA 5A2QK 1BI1A 2DMUA 5E3OA 2K7LA 2VUMJ 1G2HA 2E7XA 2WAQN 1W5TA 1IDYA 2JUGA 3CCQI 2BXYA 2HGCA 4IQ4A 1YJ9I 1B8IB 3DBRB 2LSOA 1ON1A 2UZKA 5IP6A 1WH7A 1ETVA 3R60A 2XASA 1VQOI 4XIDA 1UELB 3E6DA 1I3AA 1T8IA 1JI8A 1VF9A 5GAHJ 2MYSA 4J00A 2JA7J 1SANA 2KMUA 1XS9A 3HM5A 2L5QA 1R1UA 1I1GA 4A69C 1BI3A 1ZAOA 3HHGA 1VQMI 2XSJC 4YELA 3Q9SA 3SHFA 4N0BA 4KMFA 3HDDA 4LJZF 3GFMA 1MMDA 2L2OA 2NVQJ 1W4MA 3P7NA 2VKVA 2YX4A 3DTEA 4IVNA 2CV0A 2JUCA 1V54H 2ADUA 4ESBA 3VYTB 2M5WA 1K6YA 5BS6A 3N97A 2Z5UA 2FA5A 3ZMZA 3WTTC 1HBXG 3SYTA 2DODA 2ID3A 2LKSA 4F55A 3J81Z 3HPGA 4EATA 3PIOF 4LIVA 3J80Z 4XOPA 2V6CA 1QVUA 1S3JA 4OWRB 5EZGA 2LF7A 1Z7LA 2A05A 1GUUA 5FRNA 1DQUA 2R5ZB 3NRVA 3TO9A 4KIBA 2EFWA 1YJWI 2DOFA 4E70A 4RGUA 3BG9A 1WZ2A 3KLOA 2KRHA 1F43A 1YRNA 4HNUA 3TOBA 3J7AO 2KQRA 2HNHA 1LUJB 4ZDPA 2X1DA 4BQNA 2IW5A 5DDGA 2HVQA 5FKMA 4HA8A 3V4GA 5E3MA 2CSOA 3MD2A 1DU0A 5BPIA 2LH9A 1J59A 4HQMA 5E79C 2JN6A 4XLCA 2DA2A 2FNPA 3DPTA 5H6QA 6PAXA 2RDPA 2UXNA 4EMSA 2HU9A 1XN7A 1UZCA 2Y31A 1KU2A 3QU6A 4Y3OA 1Q1HA 4E7LA 1A04A 2FD5A 4QPQA 1JKQC 3RPQA 4E6KG 3F8BA 1IDZA 2TCTA 4IXAA 3OS0A 4II2A 4C2UA 2K9MA 3H3VK 5M5YJ 1XCBA 5TISC 3J7AY 4Q5SF 4BGDA 1ERDA 4C3JJ 1TWCJ 3OS2A 3W2VA 4BL0B 4XBFA 4ENKA 1BI2A 4ZYGA 1VZ0A 5EYRA 3W6VA 4JYKA 3GYHX 1ZN2A 3FXMA 4FX4A 2IS4A 4WXHA 3F21A 3JRGA 2QSFX 2EZLA 1TL8A 2OJED 5GPAA 1SVMA 4LGWA 4CCMA 1FBSA 3DBHB 4KITB 2QKLB 2R92J 2EZKA 4I01A 2BY0A 2LMDA 3L9FA 2ZMEC 5BPDA 2FF4A 1YTYA 3K70C 2GM4A 2XGCA 3ZQQA 2XB0X 1U5TC 1XMXA 4AD9A 2CWEA 2NYXA 3EUKL 2HTSA 2K86A 1LE8A 2KPMA 4R1HA 4UUTA 1R5ID 3K4BA 2C6YA 2AS5F 3CF5F 2I5UA 1B8IA 1RETA 1WJDA 3QOEA 3BQZA 5LRRA 4RMNA 4L0ZB 4XKBA 5M5XJ 1WJBA 3QODA 3FDYA 3ABTA 2RAEA 2VBYA 4NNJA 1USSA 3FKIJ 4KUMA 4EM0B 2ACJA 1MDMB 2IS6A 2HDDA 4ZDOA 4G8XA 4OIPF 3OWTA 3OR2C 2W4SA 1UCRA 1R49A 1PUEE 2XRLA 1TZLA 4HZFA 1EH7A 4I0AA 4KDPA 3M1EA 4IJAA 4YG2F 3X2QH 2WV1A 2CO5A 3HKZA 4MHGA 4BAYA 1FEXA 1YIOA 2X4HA 1D3YA 4P5OA 2P5VA 2XPWA 5J1RA 1EJ9A 3D1NI 3SZGA 4IRHA 2R5YA 2QVOA 3H92A 1SEUA 2K9QA 2YR2A 5TGTA 2OQGA 3LQRA 4LB6B 1RKTA 4PUSA 3TDZC 2DTZA 1MJAA 1LEBA 4B1RA 2PMHA 2R5ZA 1LKXA 2KDZA 2BBYA 2JTVA 2PQ8A 4LK0F 4N9HA 3GTMJ 4LB5A 4BBSJ 3RQIA 4AWXB 3FK6A 1G3YA 1K4TA 1JXSA 1GXQA 2GAUA 3S3OA 3A2KA 3MFKA 2COMA 3JTHA 4ZZLA 4YFXF 2X9DA 3ECHA 2HYGD 3KX2A 3MKWB 2PMZA 3I3LA 4HF2A 2OC6A 3GVAA 2WV0A 3WTSC 4D5FA 1RIOH 4I09A 5FKLA 4BQOA 2MABA 4UUSB 3PJRA 2XGEA 1QRYA 4HPQA 1AOYA 1YFHA 1G6NA 2CUJA 3KCCA 2V1UA 3C3WA 1IV6A 5TRDA 3LSGA 1RUOA 1DPUA 2YS9A 2QWWA 2B7EA 4II3A 3BR6A 1BL0A 1YE9A 3WU0A 5K7ZA 3G2BA 3U9GA 5LRSA 2N8GA 3WG7H 1JUMA 1BJZA 1H89C 4HG2A 2QEXI 5HNHA 1X3ZB 1XDSA 5E18F 3OYFA 4CZZA 4U0YA 1JGSA 1XTAA 1YYVA 2QCOA 1LFBA 3BLYA 4BHBA 4NC7A 4Y4RA 2ZXJA 2DA4A 2RVCA 4CYCB 3D0SA 3FHZA 1YX3A 3OS1A 2H27A 2EA2A 4ANJA 3KLNA 1QBJA 1XGNA 3R0JA 3CLOA 3JRAA 3S3MA 5HOOA 2G7HA 2DAOA 1ODDA 3ZQFA 2L9NA 3BJ6A 2W25A 4TV7A 2GOMA 3OYNA 3JR9A 1P4XA 3VYRB 2PG4A 2M0MA 2FMLA 2MD5A 4XK4A 3H0DA 1X4OA 2JA6J 3J7ZI 3FM5A 4PK4A 3ROUA 3JRHA 2MGQA 1XB4A 1PVEA 1RRJA 3PSFA 5DYMA 2E2HJ 3Q9VA 1MDMA 3FMQA 3K6GA 3T8TA 1FP2A 2L9VA 1YG2A 2E19A 2O3FA 3O8HA 1X4PA 3WGHA 4CZCA 4L5EA 4GFBA 3ZQLA 1MSEC 2K4BA 1DGRM 2DMNA 2L7KA 1J75A 5KNLA 3K2AA 1P7IA 2DN0A 3Q5FA 4LLGF 3I59B 4L18B 1XSDA 1KU7A 1ORKA 3IV5A 3BR2A 2DOAA 2QF7A 2WB1A 5F27A 3HOTA 3AFHA 3W3CA 1O7LA 1Z0XA 4FHTA 4RGSA 4EGYA 4BJ6C 4A3BJ 2ZXIA 1TTYA 2L02A 3LSTA 3BCAA 5D4RA 3E5UA 1R71A 1T0FC 3S32A 3ZQ7A 5F04A 2HWVA 2OQRA 3NARA 5JLXA 1XX5A 3F23A 2OTJI 1P92A 4A6DA 3FBIB 5F0FA 1T2KA 4L9TA 2OCCH 1ZG3A 1IN8A 3WE2A 4BE2A 5CVIA 3FF5A 2P6SA 3K1PA 4ESFA 1O3TA 1TBXA 3ZQHA 4P55A 5B3SH 1VQ9I 2NNNA 4KNYA 4M6VA 4IHWA 4RB1A 1J7KA 1NG7A 1TNTA 2CW7A 3RJPA 4E7KA 1PJRA 4UB8C 2XAHA 4EJUA 2BHZA 2TDXA 4Y52J 1DP3A 2WAQA 4UUSA 1W0TA 4U7BA 2ESNA 2V9KA 3QP5A 5GTHC 3Q3SA 5ED4A 1U8BA 1VQ5I 2DPDA 3GTOJ 4JBAA 3ASNH 1LPQA 1QVTA 3FXLA 3GCMA 5HLIA 2GXGA 4XNFA 1PYVA 4BH9A 3S3NA 3F22A 2L4MA 1FBQA 2XROA 4XKCA 4EVIA 1WVRA 2XPVA 2B0LA 2BZTA 2PI0A 2GIZA 1WPKA 3CUQC 1J5YA 3G1LA 2EFNA 1BOBA 4B3XA 3NEUA 3TBIA 2JMWA 2LY9A 2ZMEA 4BHCA 1B4AA 3KEQA 4DGWB 4CXFA 4LG0B 4XKWA 4DYRA 1R4NB 4RAFA 4E7ZA 3MZHA 2VOOA 1A35A 2O8KA 4CYCA 3QYBA 1U5TA 4M3GA 2IS2A 4RAGA 1ZRCA 4PJLA 5L3EA 1BI0A 4UHTA 2DFEA 1K83J 1MNDA 4A0XA 4AIHA 3TW7A 2HPMA 3GO5A 4WXCA 1MBJA 3DBLB 4EJWA 1TWAJ 3H9QA 4ZZDA 1TWGJ 3PM1A 4BJ5C 5HNFA 1RNLA 3K4CA 1E17A 1RC9A 3QQAA 3JTGA 1TW2A 3FX3A 2CW0F 2QQ9A 5KAFC 5ERIA 1IXSB 1YW9A 3K2ZA 5B1AH 3JRFA 1Y39A 3OYDA 3LSKA 4NQWB 3ZN1A 3B73A 2JSCA 4DZJA 2XGDA 3E1SA 1JGGA 2O61A 4RGRA 3GLLA 1HKTA 2DYRH 1KYZA 2X6OA 1V5GA 3LA3A 1X2MA 2E34A 5FO5A 1DGWY 4WXDA 3D5LA 2YU3A 3W6JB 1XGOA 3GFIA 3L2VA 2OF7A 2R93J 3AG4H 5EEGA 2BVMA 5FLXZ 3E3VA 1UAAA 5EG0A 2E1MB 4EJTA 1A6IA 2EH3A 2P6TA 1H8AC 1KZHA 5E1ZB 2L0KA 2K02A 2MLGA 2MC3A 3HZJA 5J1YA 3BY6A 2P5KA 3CCUI 5DD4A 5BQTA 5M3MJ 2O0YA 2X1EA 2CQXA 3CDIA 1DDNA 4ENNA 2A68F 1ZG1A 2D5VA 1RKWA 2BE5F 2ZBKA 4KIFA 1W36D 1HKSA 1T56A 3IKVA 2V26A 1ACIA 2WA0A 4FISA 2PJRB 2KZGA 3DKXA 3RKQA 2CJJA 3CZ6A 4BBRJ 3CP8A 3PUFA 1E3PA 3UKGA 1Y8QB 3G1MA 3CF2A 1MIJA 1MNEA 2AQEA 1Z6TA 2M45A 3OL3A 3KEOA 3TP0A 3CMMA 4U0WA 3T8RA 1VQ6I 1ZR2A 5DS9A 3I53A 3S1RJ 1E2XA 1JUSA 2NVYJ 4BJTA 4OIQF 3L2WA 1XD7A 3C1DA 1IZ1A 3ZR8X 5C4XJ 3GBGA 3BOQA 4HLYA 3LAJA 5DM7F 5FJ8J 1QNTA 1STZA 3DEWA 5IOYA 3H3UA 5CVVA 3CUQB 5CQGA 4YIFA 2E5ZA 2DA6A 3G73A 1B9NA 3OOPA 2DQRA 2IVMA 2WBMA 1BC8C 3IKTA 1B9MA 2L7MP 1KONA 4LG0A 2P81A 2DI3A 4CDGA 4HDVA 5D5XB 3ZOBA 4S04A 4V19K 1X58A 1S7EA 3GEZA 4I6ZA 1RR7A 2KIFA 4MEXF 1EH6A 2CV1A 1BW5A 2RKHA 3HYIA 4FX0A 2QQBA 2MBFA 3CCMI 1U3EM 1TWHJ 3OSFA 4ZDLA 1BR1A 3AG2H 5LEKA 5K7HA 1JT0A 1RZ4A 2X6XA 2F5FA 2R0QC 2XRNA 2I10A 4GGGA 4CGZA 2R7FA 1YS7A 4C3HJ 2K40A 4A3IJ 2X6WA 1YRNB 2M4KA 2HDWA 4CO8A 3HOYJ 1P4WA 5J4VA 1IGNA 3GFJA 4PJMA 2DA7A 1OISA 2HTJA 1L3LA 1JT6A 2DMTA 1ZRDA 1AKHB 3IWFA 1JKOC 1P6RA 1C0WA 3WTXC 3SZPA 1FMWA 3MKZA 1APLC 3ZXSA 5GP9A 2R7TA 2MD0A 4AVPA 1FX7A 1R6RA 4I99C 2LK2A 2RV8A 3ZN0A 4HNVA 4OAYA 2FU4A 2ECBA 2JJ7A 3ZCOA 3LNQA 2Q2EB 4BHPA 3VOEA 2NVXJ 1K7AA 2WB1N 2W84A 1LDJA 4Y17A 1T0FA 2QM3A 2DT6A 4QIWN 2MG4A 2VQLA 1AU7A 3M3YJ 1YS6A 3SQNA 2KFDA 2H09A 3JAMK 1GV5A 4M3BA 1EH8A 4HLXA 2PJRA 4RGXA 4IEJA 4B47A 3GTPJ 3JSOA 1TT5B 4P1WA 3OYCA 2Z33A 2QBYA 3FK7A 1REPC 2XAFA 1XGSA 3LSMA 2F6CA 2M3AA 2X51A 5AIQA 4WWCA 1JKRC 3DPUA 3RYRA 3PO2J 3BC8A 2A5WA 2OV7A 3R4KA 3EQLF 4WK8F 1ONVA 5J8FA 4XN0A 1MJBA 4P9FA 2F5DA 4FASD 4JX6A 1MH4A 2KIUA 2XAQA 2LD5A 2F5CA 1LE8B 3KP3A 1JKPC 2LBFB 3I71A 3ASOH 4X6AJ 2XPUA 3A0HC 1SD5A 1RESA 2K3PA 3CDHA 4P96A 2JA2A 1XPXA 4A3FJ 4A5NA 4LD5A 2A61A 4IOAF 4A3LJ 3CUQA 1GVJA 1MKMA 2HQ5A 5J40A 3CMYA 3BDDA 4ABZA 5M5WJ 3L1PA 5K5RA 2K85A 3V7CA 4Y13A 2JVHA 3BG3A 2KL4A 2NRAC 3IH3A 3KE2A 4ZH4F 1QZEA 2GZWA 3GWZA 4PCQA 3EUAA 1X19A 3QPTA 4MQ9F 2IJLA 5E8GA 3I0TA 1NTCA 4M9ZA 2X6YA 2HEOA 1UHWA 2LG4A 2QYOA 1TC3C 3DQVC 4GO1A 3PFYA 1J2XA 4O3MA 1HSJA 2DBBA 4ON0A 1D5YA 2JVGA 2A6HF 4D5CA 1R1VA 2P0WA 3LSIA 2IXSA 1K78B 2R5YB 4I0BA 3JRDA 1VQLI 2WADA 5HLHA 1RUNA 3JRBA
chains in the Genus database with same CATH topology
2P4WA 4YFNF 4LLLA 1Z1DA 4JQFA 4IRGA 1XGMA 2CG4A 1WSUA 1Z9CA 2M8EA 2PBIA 4RB2C 1J9IA 3DXJF 5ICCA 5JVTA 2RNJA 3M7GA 3U2RA 3W6KB 3SFZA 2KJBA 2OBPA 3FXQA 2Q2EA 1R00A 3M8FA 2P7CB 2GA1A 3RPUA 1Z05A 1HSTA 3RKXA 4HDUA 5LLQA 5EEHA 1FYMA 4U7DA 2HR3A 1IRFA 3RYPA 1ZLJA 2Z9OA 2A07F 3U1DA 5K1YA 1B1BA 1IUYA 5FB2A 2RGVA 5AIPA 1USTA 2ZO4A 1XMAA 1CGPA 4L5IA 3L09A 2BV6A 3F8CA 2EV5A 2GA2A 4KFCA 1O7FA 3DKWA 2HYFA 2HQNA 1MZBA 3ERED 2OZUA 3KETA 3FMSA 3T1BA 2D45A 1S7AA 3GZ5A 2D1HA 2P7VB 5JR3A 4XSXF 3CO7C 2P8TA 2WTEA 3I58A 4L9NA 2YSRA 1K78A 2ZJ2A 3ABUA 2E1NA 3TO6A 3IWZA 3WGGA 5DCFA 2VN2A 4EQQA 4DNCA 3ZP5A 4OMYA 2EK5A 3FXRA 1H9TA 3MAJA 3BROA 1HQCA 5D8KB 2ISYA 2IT0A 4HV6A 4PDKA 2WWYA 5HDGA 3K0LA 3WTUC 2QENA 2V1DA 1QO0D 2UWMA 4GYGA 5ILSA 1HW2A 1WQ2A 1FC3A 3E97A 1FSEA 2QLZA 1W5SA 5ICEA 4IHTA 1LQ1A 2HOEA 2A3SA 1R58A 4G9YA 1P4AA 2DPUA 2FMYA 2MA3A 5D6EA 3E6CC 3COAC 2PMUA 1S6LA 2MLKA 1TLHB 2W57A 2XAGA 2ZMEB 2G7UA 1IN4A 3ULQB 3JAMZ 1U5TB 4I02A 3HSEA 5DV5A 3HRTA 1Z6RA 4NB5A 1DP7P 4HX7A 1O57A 2H6CA 4F7ZA 4A5MA 5BOXA 1OKRA 3F8NA 4CYDA 4U0VA 3L00A 1LVAA 2VBXA 4KIGA 4HV5A 3CJNA 3PQJA 3LAPA 3QRFF 2E7WA 5K5OA 5A2QZ 3F8FA 3ZPLA 2DK5A 1VTNC 2QZ8A 2NS0A 1OYYA 3ZMDA 2L4AA 3VEPA 2STTA 3JW4A 4M71A 3VFZA 2VC0A 5TJJA 2DTRA 2QQAA 4B09A 4BYYA 3KP4A 1F5TA 3IRRA 3LA2A 3SZTA 1I27A 4ZYEA 1LB2A 1WWXA 2IA1A 1W7PA 3FM3A 3HRSA 3R6SA 2Q8KA 3T5XA 1FOKA 2VBZA 4M74A 1F9NA 4QLCU 1X3UA 1BM9A 2HS5A 2HKXA 1IN6A 4KMUX 2VBWA 2R3SA 4UV9A 5HS7A 4HW0A 1FNNA 3HHHA 1IRGA 4HF0A 3IC7A 4LMYA 4NHJA 1SD7A 1KGSA 2UXXA 5DCMA 1FWZA 3HTUA 2M30A 3PFIA 4G6DA 1R22A 1BIBA 5KK1A 4OOIA 3WE3A 3KP7A 2JPCA 4UVCA 4ZYHA 2IA0A 2LNBA 2XGXA 1OYWA 2J5OA 1ZH5A 4MTDA 4G7ZF 2XVCA 4EM1A 1R1TA 1ZRFA 1OR7A 4MTEA 2HQRA 3C18A 2ZNYA 1PDNC 1L0OC 1RI7A 3GUDA 3J81K 1IN5A 3J80K 1BJAA 3I54A 1SD4A 1BOAA 5DD8A 3LFKA 2HFHA 4UVBA 5KVRA 4HF1A 2Y75A 5LHHA 4MNUA 3L7WA 5CJ9A 1QQIA 1IN7A 3ZMTA 3QP6A 3LA7A 5L3CA 4L9VA 1FP1D 2AXLA 2D2WA 3RTRA 2HZTA 2L54A 3KZZA 1U78A 4A2UA 3WODF 2FBKA 2XV4S 1O3SA 2O03A 3L2CA 2JPBA 2QBYB 1JHFA 4CHUA 3HUGA 2VXZA 1ZYRF 4ESJA 3K1MA 2ZCWA 4EM2A 5F6FA 1UFMA 2D1VA 3M9AA 1JE8A 3HIFA 4KT5C 5LGNA 1FZPB 3EUHA 3H3ZA 4A0ZA 4HOBA 3KP6A 4ZYDA 4BXUA 2DK8A 3TDUC 4LK1F 2VODA 3HRUA 4PGGA 2DLLA 2L3DA 3KP2A 4A6EA 4HX4A 1LNWA 3V8LA 2VOPA 3MWMA 5D4SA 3M8EA 3V7RA 2GXBA 2EV6A 2R7DA 5HDNA 1I1SA 1T6SA 5HLGA 4G6QA 4UNOA 3O3KA 1HW5A 5E17F 2JZYA 2CQKA 1R7JA 1HW1A 4Q48A 3QAHA 3TGNA 5DEQA 5D5UB 4R8HA 1BN5A 2BGCA 3DFGA 1LDKB 3MEXA 1PP7U 1FY7A 1BC7C 1YLFA 2XHKA 5F64A 4H0EA 4RAYA 3I5UA 3DP7A 3RIRA 3FWEA 1HKQA 2RQPA 1D5VA 3TO7A 3F3XA 3MZYA 5J6XA 3OV8A 2FOKA 1B59A 5HS8A 3R61A 1XCVA 2Z3YA 1TQPA 3EYIA 3KP5A 1FYLA 3HSRA 2KJCA 1B6AA 3F6OA 4M6XA 5ILUA 1F4KA 1ZREA 2W85A 2EFOA 3K1NA 3P9IA 5IT9K 2O6GE 2KKOA 5LBQA 2Z99A 1WI9A 1TQIA 1FYKA 2EFQA 1G3SA 1KQ8A 1QGPA 4HQEA 5FD6A 1LJ9A 4L0YB 1TW3A 1T98A 1V4RA 3C7JA 4EJVA 1SFXA 2FNAA 2XIGA 1FLIA 3WU1B 2EFPA 5LHIA 1BIAA 2CGPA 4G7HF 2YPRA 2O8XA 3QU3A 2L01A 5CVRA 1MJ9A 1WRJA 4PGHA 1GHCA 3EYYA 3CTAA 1I6XA 2NAZA 1S29A 4IRIA 3GW2A 3ECOA 2ISZA 3WTZA 1R36A 4MGRA 2Y0MA 2EB7A 5F1RA 4KYWA 1V3FA 2FEZA 4M9SA 3LWFA 4XRFA 1BBYA 1KQ9A 2M1BA 3V8KA 2OU2A 2WC2A 4A12A 5FGMA 2FSWA 4UV8A 3RI4A 2DFIA 1J0RA 4O6JA 4IHSA 3P9CA 1WKMA 2V79A 3E6MA 3V7SA 1Z91A 3ZMSA 4N9IA 3TOAA 5CVUA 3O2PE 5JI6A 3BWGA 4RAZA 2G9WA 5D5VB 4I7HA 2JT1A 4UVAA 3R0AA 3BZ6A 4KA4A 2A6EF 4BNCA 4HBLA 1S7OA 1KQ0A 1H0MA 4KICA 3HRMA 4KN4X 4GCVA 3I4PA 1S8NA 1G3WA 2K27A 3DEUA 4IF4A 2RC4A 3G3ZA 2XKPA 4R79A 4WX9A 3HOSA 5DUKA 4DQ2A 3BPVA 5D6FA 5L3BA 2P5LC 1SFEA 2EA4A 1SAXA 1H9GA 3RKWA 3IRQA 2GIVA 1ZG5A 3DF8A 3WG9A 3AAFA 1I5ZA 2EV0A 1W7PB 1FBUA 3NQOA 2QUFA 1LEAA 5FLXK 2VE9A 2EWNA 1ZARA 1DPRA 4Y15A 3TKYA 3V8JA 3GX4X 1XSVA 1FSHA 4BQAA 5LEJA 4B8XA 4EGZA 4ENMA 2OAZA 5K5QA 1KYWA 1R23A 3I64A 4CICA 2CYYA 4QWQA 3FZVA 5HVQC 1ZGAA 1OPCA 2CFXA 2VT2A 4GXOA 5DCMB 1DUXC 5ICGA 2XKOA 5L3DA 4RB3C 3LQQA 1KU3A 5FD5A 4YIIA 4LLNA 4OU0A 1EV7A 4M6YA 4M9XA 3HTSB 2FBHA 5IT3A 2FBIA 1IXRC 1SMTA 1QZYA 4LFUA 3K69A 4FT8A 3CO6C 2IP2A 2DW4A 1Z7UA 3IL2A 1XMKA 3WGIA 5HDKA 2VE8A 3RDIA 5IT9Z 3O6BB 2Y48A 2DQLA 2PFBA 3MCZA 1G4DA 2KIMA 1ZHFA 3KFWX 4M73A 2IPQX 3REOA 4M72A 2K4JA 1ON2A 3T0YA 4OINF 1XSXA 2LKPA 2OD5A 4Q4ZF 1D8KA 1SD6A 4AIKA 5H20A 2PN6A 1G3TA 2ZFWA 4G94A 1T39A 1F1ZA 1CF7B 3GLXA 2ZKZA 1O3QA 4WCGA 4JK1X 5DUIA 3WTVC 5D5WB 3WTWC 3S2WA 5H6RA 1SFUA 1XDUA 1IF1A 5L3FA 1YO5C 2OZ6A 4L5JA 1KA8A 1ZGJA 4EV0A 2W24A 1K6OA 4K2EA 2HDCA 2NNYA 3CUOA 2V9VA 2GWRA 4P9UA 1PP8F 3GF2A 5ILVA 3GFLA 5AONA 3GXOA 2V1XA 2LDUA 4ENJA 1IXCA 2OA4A 2ZNZA 3MQ0A 1UHMA 3QPHA 2ELHA 5LGUA 5BMZA 4D0PA 4YFKF 3E5QA 3K9TA 4IPAA 4XLNF 5E8IA 4HX8A 1IAWA 4WF2A 4OIOF 1HXDA 5J8CA 2PEXA 2E1CA 3N4MA 3FMRA 1OYIA 2J5PA 2IRFG 2MH9A 3BJAA 3WTYC 1YQAA 3BP8A 5E20A 3IHUA 1D8JA 1QPMA 2F5EA 5ICFA 1MGTA 1MD0A 1T38A 4HAMA 3EDPA 1NHAA 5HS9A 5FFZA 1R5GA 4G7OF 3P9KA 1CF7A 3E6BA 4MEYF 3ELKA 2JRTA 4AIJA 1SMYF 5CLSA 3I59A 1K79A 2DO7A 5CYVA 2LF8A 2DT5A 1AWCA 1GXPA 4MQVA 2H6BA 3F72A 2X0LA 4KN7X 4UXNA 1IW7F 5D8LB 4OIRF 1TQMA 4O5VA 2VONA 4XLPF 2PJPA 1FPQA 2A69F 3ZMVA 5JFRA 3VODA 4ETSA 2XUBA 2ESHA 2HKOA 3JSPA 1U8RA 3SXYA 1LDDA 1JHHA 2FE3A 2BYVE 3KZYA 3DV8A 2BEOA 1U6GA 1TNSA 2FRHA 2ETHA 4RB0A 4Z2YA 4UUVA 5E1WA 3FXUA 2VT3A 4S05A 4ASNA 4OMZA 2YX7A 2DU9A 1YW8A 3F6VA 2PLYA 3ZMUA 3HSFA 1YW7A 4L9JA 1FT9A 1W7PD 3E5XA 4A0YA 5LGTA 4EJOA 4RS8A 2IA2A 5L3GA 3TQNA 5LHGA 2M87A 2F2EA 1U2WA 4GYIA 2Q0OA 1R5HA 3F8MA 1P2FA 1ULYA 2EJRA 1ZLKA 3VB2A 4NQWA 2FXAA 2VC1A 3ML6A 5FFXA 3EETA 4XSZF 1O3RA 1QZZA 2KRFA 2RN7A 1Y0UA 3PQKA 4PZJA 5JHUA 2H94A 3QOPA 1UB9A 4U88A 3BJOA 4I98B 1KU9A 3ISPA 4I2OA 3BPXA 3RKYA 4Q47A 2GQQA 5CVJA 2A5YB 4HYEA 1OMIA 3DPLC 2XAJA 3GZ6A 2STWA 3B02A 2FQ3A 2MH2A 5E1XA 5A2QK 1BI1A 2K7LA 2E7XA 1W5TA 2HGCA 2LSOA 1ON1A 2UZKA 3R60A 2XASA 3E6DA 1R1UA 1I1GA 1BI3A 1ZAOA 3HHGA 3Q9SA 3SHFA 4N0BA 4KMFA 4LJZF 3GFMA 1W4MA 3P7NA 2YX4A 4IVNA 2ADUA 4ESBA 2M5WA 5BS6A 3N97A 2Z5UA 2FA5A 3ZMZA 3WTTC 1HBXG 3J81Z 3J80Z 2V6CA 1S3JA 2LF7A 3NRVA 3TO9A 4KIBA 2EFWA 4E70A 4RGUA 3KLOA 3TOBA 3J7AO 2IW5A 5DDGA 4HA8A 3V4GA 2CSOA 5BPIA 1J59A 4HQMA 3DPTA 2FNPA 5H6QA 6PAXA 2RDPA 2UXNA 4EMSA 1XN7A 3QU6A 1KU2A 1Q1HA 1A04A 3RPQA 3F8BA 4IXAA 1XCBA 4Q5SF 4XBFA 4ENKA 1BI2A 4ZYGA 3GYHX 1ZN2A 4FX4A 4WXHA 3F21A 4LGWA 1FBSA 4I01A 5BPDA 3L9FA 2FF4A 1YTYA 1U5TC 4AD9A 2CWEA 2NYXA 2HTSA 2K86A 4R1HA 2C6YA 2AS5F 5LRRA 4L0ZB 2ACJA 3ABTA 2VBYA 4EM0B 1USSA 4KUMA 1MDMB 4G8XA 4OIPF 1UCRA 1PUEE 4HZFA 1EH7A 4I0AA 4KDPA 3M1EA 4IJAA 4YG2F 2CO5A 4MHGA 4BAYA 1YIOA 2X4HA 1D3YA 4P5OA 2P5VA 4IRHA 2QVOA 3H92A 2YR2A 2OQGA 3LQRA 4LB6B 3TDZC 1LEBA 1MJAA 2PMHA 2BBYA 2JTVA 2PQ8A 4LK0F 4N9HA 4LB5A 4AWXB 1G3YA 1JXSA 1GXQA 2GAUA 3MFKA 2COMA 3JTHA 4ZZLA 4YFXF 3ECHA 2HYGD 4HF2A 3GVAA 2WV0A 3WTSC 1RIOH 4I09A 1AOYA 1YFHA 1G6NA 3KCCA 2V1UA 3C3WA 5TRDA 1RUOA 1DPUA 2QWWA 3WU0A 3U9GA 5LRSA 1XDSA 5E18F 4CZZA 4U0YA 1JGSA 1YYVA 4BHBA 2ZXJA 2RVCA 3D0SA 3FHZA 2H27A 2EA2A 3KLNA 1QBJA 1XGNA 3R0JA 3CLOA 5HOOA 2G7HA 2DAOA 1ODDA 3BJ6A 2W25A 4TV7A 1P4XA 2PG4A 2FMLA 2MD5A 3FM5A 3ROUA 1XB4A 5DYMA 3Q9VA 1MDMA 3FMQA 3T8TA 1FP2A 1YG2A 2O3FA 3WGHA 2K4BA 1J75A 3Q5FA 4LLGF 3I59B 4L18B 1XSDA 1KU7A 3HOTA 1O7LA 4FHTA 4RGSA 4EGYA 1TTYA 2L02A 3LSTA 5D4RA 3E5UA 3ZQ7A 2HWVA 2OQRA 3F23A 1P92A 4A6DA 1T2KA 4L9TA 1ZG3A 1IN8A 3WE2A 5CVIA 3FF5A 2P6SA 3K1PA 4ESFA 1O3TA 1TBXA 4P55A 2NNNA 4KNYA 4RB1A 1J7KA 1TNTA 3RJPA 2XAHA 4EJUA 2TDXA 4U7BA 2ESNA 3QP5A 5ED4A 2DPDA 4JBAA 5HLIA 2GXGA 4BH9A 3F22A 2L4MA 1FBQA 2XROA 4EVIA 2PI0A 2B0LA 3CUQC 1J5YA 2EFNA 3NEUA 2ZMEA 4BHCA 1B4AA 3KEQA 4CXFA 4LG0B 3MZHA 2VOOA 1U5TA 1ZRCA 5L3EA 1BI0A 4UHTA 4A0XA 4AIHA 3GO5A 4WXCA 4EJWA 4ZZDA 1RNLA 1E17A 3JTGA 1TW2A 3FX3A 2CW0F 2QQ9A 5ERIA 1IXSB 1YW9A 3K2ZA 3ZN1A 3B73A 2JSCA 2O61A 4RGRA 1HKTA 1KYZA 3LA3A 5FO5A 4WXDA 3D5LA 2YU3A 3W6JB 1XGOA 3GFIA 5FLXZ 5EEGA 3E3VA 4EJTA 2P6TA 5E1ZB 2K02A 2MLGA 2MC3A 3BY6A 2P5KA 5DD4A 5BQTA 2O0YA 1DDNA 4ENNA 2A68F 1ZG1A 2BE5F 2ZBKA 4KIFA 1HKSA 3IKVA 1Z6TA 2M45A 3KEOA 4U0WA 3T8RA 3I53A 1E2XA 4OIQF 1XD7A 3C1DA 1IZ1A 3BOQA 4HLYA 3LAJA 1QNTA 1STZA 3H3UA 5CVVA 3CUQB 4YIFA 3G73A 1B9NA 3OOPA 2DQRA 2IVMA 1BC8C 3IKTA 1B9MA 4LG0A 2DI3A 4CDGA 4HDVA 5D5XB 4S04A 3GEZA 2KIFA 4MEXF 1EH6A 2RKHA 3HYIA 4FX0A 2QQBA 2MBFA 1U3EM 5LEKA 1RZ4A 2F5FA 2XRNA 4GGGA 4CGZA 2R7FA 1YS7A 4CO8A 1P4WA 3GFJA 2HTJA 1L3LA 1ZRDA 3IWFA 1P6RA 1C0WA 3WTXC 3SZPA 4AVPA 1FX7A 2RV8A 3ZN0A 2FU4A 4BHPA 3VOEA 1K7AA 2W84A 1LDJA 4Y17A 1T0FA 2QM3A 1YS6A 3SQNA 2H09A 3JAMK 1EH8A 4HLXA 4RGXA 3JSOA 2Z33A 2QBYA 1REPC 2XAFA 1XGSA 5AIQA 4WWCA 3RYRA 3R4KA 3EQLF 4WK8F 1ONVA 5J8FA 1MJBA 4P9FA 2F5DA 2KIUA 2XAQA 2F5CA 3KP3A 3I71A 1SD5A 3CDHA 4P96A 4A5NA 4LD5A 2A61A 3CUQA 1GVJA 1MKMA 3BDDA 5K5RA 3V7CA 4Y13A 2NRAC 3KE2A 4ZH4F 2GZWA 3GWZA 4PCQA 3QPTA 4MQ9F 5E8GA 2IJLA 3I0TA 4M9ZA 2HEOA 1UHWA 2QYOA 3DQVC 4GO1A 1J2XA 4O3MA 1HSJA 2DBBA 4ON0A 2A6HF 1K78B 1R1VA 4I0BA 5HLHA 1RUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4W A;  4YFN F;  4LLL A;  1Z1D A;  4JQF A;  4IRG A;  1XGM A;  2CG4 A;  1WSU A;  1Z9C A;  2M8E A;  2PBI A;  4RB2 C;  1J9I A;  3DXJ F;  5ICC A;  5JVT A;  2RNJ A;  3M7G A;  3U2R A;  3W6K B;  3SFZ A;  2KJB A;  2OBP A;  3FXQ A;  2Q2E A;  1R00 A;  3M8F A;  2P7C B;  2GA1 A;  3RPU A;  1Z05 A;  1HST A;  3RKX A;  4HDU A;  5LLQ A;  5EEH A;  1FYM A;  4U7D A;  2HR3 A;  1IRF A;  3RYP A;  1ZLJ A;  2Z9O A;  2A07 F;  3U1D A;  5K1Y A;  1B1B A;  1IUY A;  5FB2 A;  2RGV A;  5AIP A;  1UST A;  2ZO4 A;  1XMA A;  1CGP A;  4L5I A;  3L09 A;  2BV6 A;  3F8C A;  2EV5 A;  2GA2 A;  4KFC A;  1O7F A;  3DKW A;  2HYF A;  2HQN A;  1MZB A;  3ERE D;  2OZU A;  3KET A;  3FMS A;  3T1B A;  2D45 A;  1S7A A;  3GZ5 A;  2D1H A;  2P7V B;  5JR3 A;  4XSX F;  3CO7 C;  2P8T A;  2WTE A;  3I58 A;  4L9N A;  2YSR A;  1K78 A;  2ZJ2 A;  3ABU A;  2E1N A;  3TO6 A;  3IWZ A;  3WGG A;  5DCF A;  2VN2 A;  4EQQ A;  4DNC A;  3ZP5 A;  4OMY A;  2EK5 A;  3FXR A;  1H9T A;  3MAJ A;  3BRO A;  1HQC A;  5D8K B;  2ISY A;  2IT0 A;  4HV6 A;  4PDK A;  2WWY A;  5HDG A;  3K0L A;  3WTU C;  2QEN A;  2V1D A;  1QO0 D;  2UWM A;  4GYG A;  5ILS A;  1HW2 A;  1WQ2 A;  1FC3 A;  3E97 A;  1FSE A;  2QLZ A;  1W5S A;  5ICE A;  4IHT A;  1LQ1 A;  2HOE A;  2A3S A;  1R58 A;  4G9Y A;  1P4A A;  2DPU A;  2FMY A;  2MA3 A;  5D6E A;  3E6C C;  3COA C;  2PMU A;  1S6L A;  2MLK A;  1TLH B;  2W57 A;  2XAG A;  2ZME B;  2G7U A;  1IN4 A;  3ULQ B;  3JAM Z;  1U5T B;  4I02 A;  3HSE A;  5DV5 A;  3HRT A;  1Z6R A;  4NB5 A;  1DP7 P;  4HX7 A;  1O57 A;  2H6C A;  4F7Z A;  4A5M A;  5BOX A;  1OKR A;  3F8N A;  4CYD A;  4U0V A;  3L00 A;  1LVA A;  2VBX A;  4KIG A;  4HV5 A;  3CJN A;  3PQJ A;  3LAP A;  3QRF F;  2E7W A;  5K5O A;  5A2Q Z;  3F8F A;  3ZPL A;  2DK5 A;  1VTN C;  2QZ8 A;  2NS0 A;  1OYY A;  3ZMD A;  2L4A A;  3VEP A;  2STT A;  3JW4 A;  4M71 A;  3VFZ A;  2VC0 A;  5TJJ A;  2DTR A;  2QQA A;  4B09 A;  4BYY A;  3KP4 A;  1F5T A;  3IRR A;  3LA2 A;  3SZT A;  1I27 A;  4ZYE A;  1LB2 A;  1WWX A;  2IA1 A;  1W7P A;  3FM3 A;  3HRS A;  3R6S A;  2Q8K A;  3T5X A;  1FOK A;  2VBZ A;  4M74 A;  1F9N A;  4QLC U;  1X3U A;  1BM9 A;  2HS5 A;  2HKX A;  1IN6 A;  4KMU X;  2VBW A;  2R3S A;  4UV9 A;  5HS7 A;  4HW0 A;  1FNN A;  3HHH A;  1IRG A;  4HF0 A;  3IC7 A;  4LMY A;  4NHJ A;  1SD7 A;  1KGS A;  2UXX A;  5DCM A;  1FWZ A;  3HTU A;  2M30 A;  3PFI A;  4G6D A;  1R22 A;  1BIB A;  5KK1 A;  4OOI A;  3WE3 A;  3KP7 A;  2JPC A;  4UVC A;  4ZYH A;  2IA0 A;  2LNB A;  2XGX A;  1OYW A;  2J5O A;  1ZH5 A;  4MTD A;  4G7Z F;  2XVC A;  4EM1 A;  1R1T A;  1ZRF A;  1OR7 A;  4MTE A;  2HQR A;  3C18 A;  2ZNY A;  1PDN C;  1L0O C;  1RI7 A;  3GUD A;  3J81 K;  1IN5 A;  3J80 K;  1BJA A;  3I54 A;  1SD4 A;  1BOA A;  5DD8 A;  3LFK A;  2HFH A;  4UVB A;  5KVR A;  4HF1 A;  2Y75 A;  5LHH A;  4MNU A;  3L7W A;  5CJ9 A;  1QQI A;  1IN7 A;  3ZMT A;  3QP6 A;  3LA7 A;  5L3C A;  4L9V A;  1FP1 D;  2AXL A;  2D2W A;  3RTR A;  2HZT A;  2L54 A;  3KZZ A;  1U78 A;  4A2U A;  3WOD F;  2FBK A;  2XV4 S;  1O3S A;  2O03 A;  3L2C A;  2JPB A;  2QBY B;  1JHF A;  4CHU A;  3HUG A;  2VXZ A;  1ZYR F;  4ESJ A;  3K1M A;  2ZCW A;  4EM2 A;  5F6F A;  1UFM A;  2D1V A;  3M9A A;  1JE8 A;  3HIF A;  4KT5 C;  5LGN A;  1FZP B;  3EUH A;  3H3Z A;  4A0Z A;  4HOB A;  3KP6 A;  4ZYD A;  4BXU A;  2DK8 A;  3TDU C;  4LK1 F;  2VOD A;  3HRU A;  4PGG A;  2DLL A;  2L3D A;  3KP2 A;  4A6E A;  4HX4 A;  1LNW A;  3V8L A;  2VOP A;  3MWM A;  5D4S A;  3M8E A;  3V7R A;  2GXB A;  2EV6 A;  2R7D A;  5HDN A;  1I1S A;  1T6S A;  5HLG A;  4G6Q A;  4UNO A;  3O3K A;  1HW5 A;  5E17 F;  2JZY A;  2CQK A;  1R7J A;  1HW1 A;  4Q48 A;  3QAH A;  3TGN A;  5DEQ A;  5D5U B;  4R8H A;  1BN5 A;  2BGC A;  3DFG A;  1LDK B;  3MEX A;  1PP7 U;  1FY7 A;  1BC7 C;  1YLF A;  2XHK A;  5F64 A;  4H0E A;  4RAY A;  3I5U A;  3DP7 A;  3RIR A;  3FWE A;  1HKQ A;  2RQP A;  1D5V A;  3TO7 A;  3F3X A;  3MZY A;  5J6X A;  3OV8 A;  2FOK A;  1B59 A;  5HS8 A;  3R61 A;  1XCV A;  2Z3Y A;  1TQP A;  3EYI A;  3KP5 A;  1FYL A;  3HSR A;  2KJC A;  1B6A A;  3F6O A;  4M6X A;  5ILU A;  1F4K A;  1ZRE A;  2W85 A;  2EFO A;  3K1N A;  3P9I A;  5IT9 K;  2O6G E;  2KKO A;  5LBQ A;  2Z99 A;  1WI9 A;  1TQI A;  1FYK A;  2EFQ A;  1G3S A;  1KQ8 A;  1QGP A;  4HQE A;  5FD6 A;  1LJ9 A;  4L0Y B;  1TW3 A;  1T98 A;  1V4R A;  3C7J A;  4EJV A;  1SFX A;  2FNA A;  2XIG A;  1FLI A;  3WU1 B;  2EFP A;  5LHI A;  1BIA A;  2CGP A;  4G7H F;  2YPR A;  2O8X A;  3QU3 A;  2L01 A;  5CVR A;  1MJ9 A;  1WRJ A;  4PGH A;  1GHC A;  3EYY A;  3CTA A;  1I6X A;  2NAZ A;  1S29 A;  4IRI A;  3GW2 A;  3ECO A;  2ISZ A;  3WTZ A;  1R36 A;  4MGR A;  2Y0M A;  2EB7 A;  5F1R A;  4KYW A;  1V3F A;  2FEZ A;  4M9S A;  3LWF A;  4XRF A;  1BBY A;  1KQ9 A;  2M1B A;  3V8K A;  2OU2 A;  2WC2 A;  4A12 A;  5FGM A;  2FSW A;  4UV8 A;  3RI4 A;  2DFI A;  1J0R A;  4O6J A;  4IHS A;  3P9C A;  1WKM A;  2V79 A;  3E6M A;  3V7S A;  1Z91 A;  3ZMS A;  4N9I A;  3TOA A;  5CVU A;  3O2P E;  5JI6 A;  3BWG A;  4RAZ A;  2G9W A;  5D5V B;  4I7H A;  2JT1 A;  4UVA A;  3R0A A;  3BZ6 A;  4KA4 A;  2A6E F;  4BNC A;  4HBL A;  1S7O A;  1KQ0 A;  1H0M A;  4KIC A;  3HRM A;  4KN4 X;  4GCV A;  3I4P A;  1S8N A;  1G3W A;  2K27 A;  3DEU A;  4IF4 A;  2RC4 A;  3G3Z A;  2XKP A;  4R79 A;  4WX9 A;  3HOS A;  5DUK A;  4DQ2 A;  3BPV A;  5D6F A;  5L3B A;  2P5L C;  1SFE A;  2EA4 A;  1SAX A;  1H9G A;  3RKW A;  3IRQ A;  2GIV A;  1ZG5 A;  3DF8 A;  3WG9 A;  3AAF A;  1I5Z A;  2EV0 A;  1W7P B;  1FBU A;  3NQO A;  2QUF A;  1LEA A;  5FLX K;  2VE9 A;  2EWN A;  1ZAR A;  1DPR A;  4Y15 A;  3TKY A;  3V8J A;  3GX4 X;  1XSV A;  1FSH A;  4BQA A;  5LEJ A;  4B8X A;  4EGZ A;  4ENM A;  2OAZ A;  5K5Q A;  1KYW A;  1R23 A;  3I64 A;  4CIC A;  2CYY A;  4QWQ A;  3FZV A;  5HVQ C;  1ZGA A;  1OPC A;  2CFX A;  2VT2 A;  4GXO A;  5DCM B;  1DUX C;  5ICG A;  2XKO A;  5L3D A;  4RB3 C;  3LQQ A;  1KU3 A;  5FD5 A;  4YII A;  4LLN A;  4OU0 A;  1EV7 A;  4M6Y A;  4M9X A;  3HTS B;  2FBH A;  5IT3 A;  2FBI A;  1IXR C;  1SMT A;  1QZY A;  4LFU A;  3K69 A;  4FT8 A;  3CO6 C;  2IP2 A;  2DW4 A;  1Z7U A;  3IL2 A;  1XMK A;  3WGI A;  5HDK A;  2VE8 A;  3RDI A;  5IT9 Z;  3O6B B;  2Y48 A;  2DQL A;  2PFB A;  3MCZ A;  1G4D A;  2KIM A;  1ZHF A;  3KFW X;  4M73 A;  2IPQ X;  3REO A;  4M72 A;  2K4J A;  1ON2 A;  3T0Y A;  4OIN F;  1XSX A;  2LKP A;  2OD5 A;  4Q4Z F;  1D8K A;  1SD6 A;  4AIK A;  5H20 A;  2PN6 A;  1G3T A;  2ZFW A;  4G94 A;  1T39 A;  1F1Z A;  1CF7 B;  3GLX A;  2ZKZ A;  1O3Q A;  4WCG A;  4JK1 X;  5DUI A;  3WTV C;  5D5W B;  3WTW C;  3S2W A;  5H6R A;  1SFU A;  1XDU A;  1IF1 A;  5L3F A;  1YO5 C;  2OZ6 A;  4L5J A;  1KA8 A;  1ZGJ A;  4EV0 A;  2W24 A;  1K6O A;  4K2E A;  2HDC A;  2NNY A;  3CUO A;  2V9V A;  2GWR A;  4P9U A;  1PP8 F;  3GF2 A;  5ILV A;  3GFL A;  5AON A;  3GXO A;  2V1X A;  2LDU A;  4ENJ A;  1IXC A;  2OA4 A;  2ZNZ A;  3MQ0 A;  1UHM A;  3QPH A;  2ELH A;  5LGU A;  5BMZ A;  4D0P A;  4YFK F;  3E5Q A;  3K9T A;  4IPA A;  4XLN F;  5E8I A;  4HX8 A;  1IAW A;  4WF2 A;  4OIO F;  1HXD A;  5J8C A;  2PEX A;  2E1C A;  3N4M A;  3FMR A;  1OYI A;  2J5P A;  2IRF G;  2MH9 A;  3BJA A;  3WTY C;  1YQA A;  3BP8 A;  5E20 A;  3IHU A;  1D8J A;  1QPM A;  2F5E A;  5ICF A;  1MGT A;  1MD0 A;  1T38 A;  4HAM A;  3EDP A;  1NHA A;  5HS9 A;  5FFZ A;  1R5G A;  4G7O F;  3P9K A;  1CF7 A;  3E6B A;  4MEY F;  3ELK A;  2JRT A;  4AIJ A;  1SMY F;  5CLS A;  3I59 A;  1K79 A;  2DO7 A;  5CYV A;  2LF8 A;  2DT5 A;  1AWC A;  1GXP A;  4MQV A;  2H6B A;  3F72 A;  2X0L A;  4KN7 X;  4UXN A;  1IW7 F;  5D8L B;  4OIR F;  1TQM A;  4O5V A;  2VON A;  4XLP F;  2PJP A;  1FPQ A;  2A69 F;  3ZMV A;  5JFR A;  3VOD A;  4ETS A;  2XUB A;  2ESH A;  2HKO A;  3JSP A;  1U8R A;  3SXY A;  1LDD A;  1JHH A;  2FE3 A;  2BYV E;  3KZY A;  3DV8 A;  2BEO A;  1U6G A;  1TNS A;  2FRH A;  2ETH A;  4RB0 A;  4Z2Y A;  4UUV A;  5E1W A;  3FXU A;  2VT3 A;  4S05 A;  4ASN A;  4OMZ A;  2YX7 A;  2DU9 A;  1YW8 A;  3F6V A;  2PLY A;  3ZMU A;  3HSF A;  1YW7 A;  4L9J A;  1FT9 A;  1W7P D;  3E5X A;  4A0Y A;  5LGT A;  4EJO A;  4RS8 A;  2IA2 A;  5L3G A;  3TQN A;  5LHG A;  2M87 A;  2F2E A;  1U2W A;  4GYI A;  2Q0O A;  1R5H A;  3F8M A;  1P2F A;  1ULY A;  2EJR A;  1ZLK A;  3VB2 A;  4NQW A;  2FXA A;  2VC1 A;  3ML6 A;  5FFX A;  3EET A;  4XSZ F;  1O3R A;  1QZZ A;  2KRF A;  2RN7 A;  1Y0U A;  3PQK A;  4PZJ A;  5JHU A;  2H94 A;  3QOP A;  1UB9 A;  4U88 A;  3BJO A;  4I98 B;  1KU9 A;  3ISP A;  4I2O A;  3BPX A;  3RKY A;  4Q47 A;  2GQQ A;  5CVJ A;  2A5Y B;  4HYE A;  1OMI A;  3DPL C;  2XAJ A;  3GZ6 A;  2STW A;  3B02 A;  2FQ3 A;  2MH2 A;  5E1X A;  5A2Q K;  1BI1 A;  2K7L A;  2E7X A;  1W5T A;  2HGC A;  2LSO A;  1ON1 A;  2UZK A;  3R60 A;  2XAS A;  3E6D A;  1R1U A;  1I1G A;  1BI3 A;  1ZAO A;  3HHG A;  3Q9S A;  3SHF A;  4N0B A;  4KMF A;  4LJZ F;  3GFM A;  1W4M A;  3P7N A;  2YX4 A;  4IVN A;  2ADU A;  4ESB A;  2M5W A;  5BS6 A;  3N97 A;  2Z5U A;  2FA5 A;  3ZMZ A;  3WTT C;  1HBX G;  3J81 Z;  3J80 Z;  2V6C A;  1S3J A;  2LF7 A;  3NRV A;  3TO9 A;  4KIB A;  2EFW A;  4E70 A;  4RGU A;  3KLO A;  3TOB A;  3J7A O;  2IW5 A;  5DDG A;  4HA8 A;  3V4G A;  2CSO A;  5BPI A;  1J59 A;  4HQM A;  3DPT A;  2FNP A;  5H6Q A;  6PAX A;  2RDP A;  2UXN A;  4EMS A;  1XN7 A;  3QU6 A;  1KU2 A;  1Q1H A;  1A04 A;  3RPQ A;  3F8B A;  4IXA A;  1XCB A;  4Q5S F;  4XBF A;  4ENK A;  1BI2 A;  4ZYG A;  3GYH X;  1ZN2 A;  4FX4 A;  4WXH A;  3F21 A;  4LGW A;  1FBS A;  4I01 A;  5BPD A;  3L9F A;  2FF4 A;  1YTY A;  1U5T C;  4AD9 A;  2CWE A;  2NYX A;  2HTS A;  2K86 A;  4R1H A;  2C6Y A;  2AS5 F;  5LRR A;  4L0Z B;  2ACJ A;  3ABT A;  2VBY A;  4EM0 B;  1USS A;  4KUM A;  1MDM B;  4G8X A;  4OIP F;  1UCR A;  1PUE E;  4HZF A;  1EH7 A;  4I0A A;  4KDP A;  3M1E A;  4IJA A;  4YG2 F;  2CO5 A;  4MHG A;  4BAY A;  1YIO A;  2X4H A;  1D3Y A;  4P5O A;  2P5V A;  4IRH A;  2QVO A;  3H92 A;  2YR2 A;  2OQG A;  3LQR A;  4LB6 B;  3TDZ C;  1LEB A;  1MJA A;  2PMH A;  2BBY A;  2JTV A;  2PQ8 A;  4LK0 F;  4N9H A;  4LB5 A;  4AWX B;  1G3Y A;  1JXS A;  1GXQ A;  2GAU A;  3MFK A;  2COM A;  3JTH A;  4ZZL A;  4YFX F;  3ECH A;  2HYG D;  4HF2 A;  3GVA A;  2WV0 A;  3WTS C;  1RIO H;  4I09 A;  1AOY A;  1YFH A;  1G6N A;  3KCC A;  2V1U A;  3C3W A;  5TRD A;  1RUO A;  1DPU A;  2QWW A;  3WU0 A;  3U9G A;  5LRS A;  1XDS A;  5E18 F;  4CZZ A;  4U0Y A;  1JGS A;  1YYV A;  4BHB A;  2ZXJ A;  2RVC A;  3D0S A;  3FHZ A;  2H27 A;  2EA2 A;  3KLN A;  1QBJ A;  1XGN A;  3R0J A;  3CLO A;  5HOO A;  2G7H A;  2DAO A;  1ODD A;  3BJ6 A;  2W25 A;  4TV7 A;  1P4X A;  2PG4 A;  2FML A;  2MD5 A;  3FM5 A;  3ROU A;  1XB4 A;  5DYM A;  3Q9V A;  1MDM A;  3FMQ A;  3T8T A;  1FP2 A;  1YG2 A;  2O3F A;  3WGH A;  2K4B A;  1J75 A;  3Q5F A;  4LLG F;  3I59 B;  4L18 B;  1XSD A;  1KU7 A;  3HOT A;  1O7L A;  4FHT A;  4RGS A;  4EGY A;  1TTY A;  2L02 A;  3LST A;  5D4R A;  3E5U A;  3ZQ7 A;  2HWV A;  2OQR A;  3F23 A;  1P92 A;  4A6D A;  1T2K A;  4L9T A;  1ZG3 A;  1IN8 A;  3WE2 A;  5CVI A;  3FF5 A;  2P6S A;  3K1P A;  4ESF A;  1O3T A;  1TBX A;  4P55 A;  2NNN A;  4KNY A;  4RB1 A;  1J7K A;  1TNT A;  3RJP A;  2XAH A;  4EJU A;  2TDX A;  4U7B A;  2ESN A;  3QP5 A;  5ED4 A;  2DPD A;  4JBA A;  5HLI A;  2GXG A;  4BH9 A;  3F22 A;  2L4M A;  1FBQ A;  2XRO A;  4EVI A;  2PI0 A;  2B0L A;  3CUQ C;  1J5Y A;  2EFN A;  3NEU A;  2ZME A;  4BHC A;  1B4A A;  3KEQ A;  4CXF A;  4LG0 B;  3MZH A;  2VOO A;  1U5T A;  1ZRC A;  5L3E A;  1BI0 A;  4UHT A;  4A0X A;  4AIH A;  3GO5 A;  4WXC A;  4EJW A;  4ZZD A;  1RNL A;  1E17 A;  3JTG A;  1TW2 A;  3FX3 A;  2CW0 F;  2QQ9 A;  5ERI A;  1IXS B;  1YW9 A;  3K2Z A;  3ZN1 A;  3B73 A;  2JSC A;  2O61 A;  4RGR A;  1HKT A;  1KYZ A;  3LA3 A;  5FO5 A;  4WXD A;  3D5L A;  2YU3 A;  3W6J B;  1XGO A;  3GFI A;  5FLX Z;  5EEG A;  3E3V A;  4EJT A;  2P6T A;  5E1Z B;  2K02 A;  2MLG A;  2MC3 A;  3BY6 A;  2P5K A;  5DD4 A;  5BQT A;  2O0Y A;  1DDN A;  4ENN A;  2A68 F;  1ZG1 A;  2BE5 F;  2ZBK A;  4KIF A;  1HKS A;  3IKV A;  1Z6T A;  2M45 A;  3KEO A;  4U0W A;  3T8R A;  3I53 A;  1E2X A;  4OIQ F;  1XD7 A;  3C1D A;  1IZ1 A;  3BOQ A;  4HLY A;  3LAJ A;  1QNT A;  1STZ A;  3H3U A;  5CVV A;  3CUQ B;  4YIF A;  3G73 A;  1B9N A;  3OOP A;  2DQR A;  2IVM A;  1BC8 C;  3IKT A;  1B9M A;  4LG0 A;  2DI3 A;  4CDG A;  4HDV A;  5D5X B;  4S04 A;  3GEZ A;  2KIF A;  4MEX F;  1EH6 A;  2RKH A;  3HYI A;  4FX0 A;  2QQB A;  2MBF A;  1U3E M;  5LEK A;  1RZ4 A;  2F5F A;  2XRN A;  4GGG A;  4CGZ A;  2R7F A;  1YS7 A;  4CO8 A;  1P4W A;  3GFJ A;  2HTJ A;  1L3L A;  1ZRD A;  3IWF A;  1P6R A;  1C0W A;  3WTX C;  3SZP A;  4AVP A;  1FX7 A;  2RV8 A;  3ZN0 A;  2FU4 A;  4BHP A;  3VOE A;  1K7A A;  2W84 A;  1LDJ A;  4Y17 A;  1T0F A;  2QM3 A;  1YS6 A;  3SQN A;  2H09 A;  3JAM K;  1EH8 A;  4HLX A;  4RGX A;  3JSO A;  2Z33 A;  2QBY A;  1REP C;  2XAF A;  1XGS A;  5AIQ A;  4WWC A;  3RYR A;  3R4K A;  3EQL F;  4WK8 F;  1ONV A;  5J8F A;  1MJB A;  4P9F A;  2F5D A;  2KIU A;  2XAQ A;  2F5C A;  3KP3 A;  3I71 A;  1SD5 A;  3CDH A;  4P96 A;  4A5N A;  4LD5 A;  2A61 A;  3CUQ A;  1GVJ A;  1MKM A;  3BDD A;  5K5R A;  3V7C A;  4Y13 A;  2NRA C;  3KE2 A;  4ZH4 F;  2GZW A;  3GWZ A;  4PCQ A;  3QPT A;  4MQ9 F;  5E8G A;  2IJL A;  3I0T A;  4M9Z A;  2HEO A;  1UHW A;  2QYO A;  3DQV C;  4GO1 A;  1J2X A;  4O3M A;  1HSJ A;  2DBB A;  4ON0 A;  2A6H F;  1K78 B;  1R1V A;  4I0B A;  5HLH A;  1RUN A; 
#chains in the Genus database with same CATH topology
 3C2G A;  2P4W A;  5IOZ A;  2KDO A;  4XRS A;  4YFN F;  2DFH A;  4B4C A;  4LLL A;  3MZ8 A;  1Z1D A;  4M3D A;  2QQ8 A;  1O4X A;  2R7W A;  2VIX A;  1I50 J;  4JQF A;  4Y33 A;  4IRG A;  4OAZ A;  1XGM A;  2OCE A;  2EIM H;  4N4O B;  3SEZ A;  2CG4 A;  2E71 A;  2WAE A;  5EGO B;  5C44 J;  4QSH A;  1WSU A;  4QTR A;  3CCJ I;  2FX0 A;  1Z9C A;  4UB6 C;  1AKH A;  2HI3 A;  1U0J A;  1FOX A;  2M8E A;  2CQN A;  2PBI A;  3FIS A;  3KZI C;  4RB2 C;  1J9I A;  3DXJ F;  5ICC A;  3H0G J;  2RNJ A;  3M7G A;  3U2R A;  5JVT A;  3W6K B;  1UHS A;  2ZFU A;  3SFZ A;  2KJB A;  2OBP A;  2VJJ A;  1ETY A;  2ICW G;  5IP7 J;  3FXQ A;  4E7I A;  3CCS I;  2Q2E A;  2HOS A;  1R00 A;  4XLH A;  2CUE A;  3M8F A;  2EIN H;  1H88 C;  2P7C B;  4FQG A;  2GA1 A;  3RPU A;  2F48 A;  3WU2 C;  1Z05 A;  1HDD C;  1I6H J;  1HST A;  4NC6 A;  3RKX A;  2CRG A;  1OCO H;  4HSR A;  3ZGK A;  4HDU A;  2O9L A;  1ENH A;  3KYC B;  5LLQ A;  5EEH A;  1FYM A;  4U7D A;  1VQK I;  2HR3 A;  3FHN A;  1IRF A;  3RYP A;  4CA0 A;  1ZLJ A;  5LFA A;  1VQ7 I;  2Z9O A;  3LMM A;  1Y1W J;  2A07 F;  1I3Q J;  3U1D A;  3HJE A;  1XG1 A;  3HOV J;  1FIA A;  5K1Y A;  1B1B A;  1IUY A;  3DWL E;  5FB2 A;  2RGV A;  4ITV A;  5AIP A;  1UST A;  2VQG A;  4FTH A;  3DCF A;  4A3E J;  1IRZ A;  2LBF A;  1N75 A;  2ZO4 A;  1XMA A;  1CGP A;  4L5I A;  1OR7 C;  3L09 A;  1SFO J;  2BV6 A;  3F8C A;  3CCL I;  2EV5 A;  2GA2 A;  3F9K A;  1YJN I;  3DTI A;  4F92 B;  4KFC A;  4LIT A;  1O7F A;  3DKW A;  1BW6 A;  3OYI A;  2HYF A;  2HQN A;  1MZB A;  4B43 A;  2NVT J;  3ERE D;  2DFF A;  4ZYA A;  5FKN A;  2OZU A;  4XN3 A;  3VPR A;  3KET A;  3FMS A;  1D0Y A;  2IGK A;  3T1B A;  1WJ5 A;  5FRM A;  5DM6 F;  2D45 A;  1S7A A;  2MC4 A;  3GZ5 A;  2D1H A;  2P7V B;  1OCC H;  5JR3 A;  4XSX F;  3CO7 C;  2P8T A;  2WTE A;  3I58 A;  4L9N A;  2YSR A;  1K78 A;  2ZJ2 A;  3QPS A;  5CQE A;  1F36 A;  3ABU A;  5IYD J;  3MN2 A;  2E1N A;  2X48 A;  4BE0 A;  3TO6 A;  2Y0S A;  3SEQ A;  2HXI A;  3IWZ A;  3S1Q J;  3WGG A;  1UG2 A;  4PSW A;  5DCF A;  1RR8 C;  2VN2 A;  4EQQ A;  4DNC A;  3G6E I;  3ZP5 A;  4OMY A;  3CCY A;  3IAS 2;  2EK5 A;  1HOM A;  1FIP A;  3FXR A;  1H9T A;  3MAJ A;  4V2G A;  3BRO A;  3QPL A;  5EGO A;  4DZP A;  3SDG A;  4FE4 A;  1HQC A;  1VFC A;  5D8K B;  2ISY A;  2K9N A;  2IT0 A;  4HV6 A;  4PDK A;  3S15 J;  2WWY A;  5HDG A;  1MBF A;  3K0L A;  3WTU C;  2QEN A;  2V1D A;  1QO0 D;  4XRM A;  2UWM A;  4GYG A;  5ILS A;  1HW2 A;  1WQ2 A;  4B44 A;  1FC3 A;  2O7O A;  1OCP A;  3E97 A;  1FSE A;  2QLZ A;  4ZTJ A;  1W5S A;  2Q1Z B;  2ZB9 A;  5ICE A;  4IHT A;  1YIJ I;  1LQ1 A;  2HOE A;  2HXO A;  3EUH C;  2E60 A;  2A3S A;  5FKK A;  1NK2 P;  2Z16 A;  1R58 A;  3PL8 A;  3HPH A;  4G9Y A;  2IGN A;  1P4A A;  2DPU A;  4A3D J;  2FMY A;  2MA3 A;  2W00 A;  5D6E A;  3S2D J;  2R7S A;  3E6C C;  3COA C;  1R4M B;  5J3L A;  2PMU A;  3CP2 A;  2DJI A;  3RSN A;  1S6L A;  2MLK A;  1TLH B;  2W57 A;  2XAG A;  3GME A;  2ZME B;  2XDV A;  2G7U A;  2QSG X;  1IN4 A;  1JTX A;  3ULQ B;  3JAM Z;  1ETQ A;  1U5T B;  4A3K J;  4I02 A;  3HSE A;  2LC2 A;  5DV5 A;  4BEH A;  3HRT A;  1Z6R A;  1X1C A;  2FUG 2;  1D1A A;  3E0J B;  4NB5 A;  1DP7 P;  3JRE A;  3CQZ J;  5FLM J;  4S0H B;  4HX7 A;  2E2I J;  2QGU A;  1O57 A;  5F0H A;  1QHH D;  2H6C A;  4N4N B;  4F7Z A;  5LD2 C;  4A5M A;  3FKJ A;  5BOX A;  5EZH A;  2DMP A;  4JX4 A;  4FCY A;  4AID A;  2VQH A;  1OKR A;  3F8N A;  5CKT A;  4CYD A;  4FET A;  4U0V A;  4D7M A;  2UV1 A;  3L00 A;  1LVA A;  2VBX A;  4KIG A;  2DT7 B;  3CJN A;  3PQJ A;  4HV5 A;  4W97 A;  3LAP A;  3QRF F;  2KZV A;  2CH0 A;  2E7W A;  3N05 A;  5K5O A;  5A2Q Z;  3G4S I;  2VJ4 A;  2DA1 A;  3F8F A;  1GV2 A;  3K4K A;  3ZPL A;  3OIP A;  2H1L A;  2DK5 A;  2VJ5 A;  1VTN C;  3BG7 A;  1K4S A;  2QZ8 A;  5EDN A;  3HGG A;  2NS0 A;  1OYY A;  4L0Y B;  2WAF A;  4ZC3 A;  3ZMD A;  2L4A A;  3VEP A;  3H5A A;  1OCR H;  2K9S A;  2STT A;  3JW4 A;  4M71 A;  2VC0 A;  5TJJ A;  3VFZ A;  2DTR A;  2QQA A;  4B09 A;  5F08 A;  2CU7 A;  3KP4 A;  4BYY A;  5EG0 B;  1F5T A;  4W1U A;  3IRR A;  3LA2 A;  3SZT A;  1I27 A;  3H36 A;  1WJA A;  4ZYE A;  3BTJ A;  1LB2 A;  4E7J A;  1WWX A;  3WHB A;  2IA1 A;  1W7P A;  2LR8 A;  3FM3 A;  3HRS A;  5JHF A;  3R6S A;  4XL9 A;  4RLQ A;  2Q8K A;  3T5X A;  1FOK A;  2VBZ A;  4M74 A;  1F9N A;  1QPI A;  3S8P A;  2GXA A;  1MBH A;  2LRD A;  4HST A;  1X3U A;  4QLC U;  2MW8 A;  4BKX A;  1BM9 A;  3LSJ A;  2HS5 A;  2HKX A;  3J7Y J;  1OLT A;  5F0C A;  1IN6 A;  4KMU X;  2A6T A;  2VBW A;  3HB9 A;  3HOW J;  3IAM 2;  2Y9Y A;  5IPA A;  2VKH A;  1FJL A;  1D0Z A;  2R3S A;  2VB6 A;  2R7O A;  3HUG B;  4UV9 A;  4HW0 A;  3P5J A;  5HS7 A;  2EZI A;  1E3O C;  1FNN A;  3HHH A;  2VLA A;  3KPH A;  1D0X A;  3DKY A;  2QSH X;  2Y69 H;  4HF0 A;  3IC7 A;  1BR4 A;  4LMY A;  3ERM A;  1S9H A;  3C2B A;  1S72 I;  4NHJ A;  4RM3 A;  1SD7 A;  1P7J A;  3L2Q A;  2EIK H;  1KGS A;  1A31 A;  2UXX A;  5DCM A;  2L9R A;  1FWZ A;  4EEF G;  3HTU A;  2M30 A;  1DU6 A;  1Y56 A;  2ME0 A;  3PFI A;  2O5R A;  1MNM C;  4G6D A;  2M8G X;  2VPR A;  1R22 A;  1BIB A;  2GLO A;  5KK1 A;  4OOI A;  3BG5 A;  3WE3 A;  3IUO A;  3KP7 A;  4DJA A;  2JPC A;  4ZTF A;  4PJ0 C;  2AHQ A;  4UVC A;  4ZYH A;  1VQ8 I;  5FLV A;  2JQ7 A;  2BHY A;  2IA0 A;  4KJZ A;  2LNB A;  1A5J A;  4AUX A;  2XGX A;  3BR3 A;  1HA8 A;  4IZZ A;  1OYW A;  1BA5 A;  2J5O A;  1ZH5 A;  5E3N A;  4HEA 2;  3D5S C;  4MTD A;  2JRM A;  3OYL A;  2JSP A;  3HOX J;  4G7Z F;  1W0U A;  2XVC A;  4EM1 A;  2KLO A;  3O8G A;  1R1T A;  3SFI A;  4A3M J;  2LTP A;  2VKD A;  3DLA A;  1ZRF A;  4Y7N J;  4X0G A;  1OR7 A;  4IO9 F;  4MTE A;  3WHC A;  2HQR A;  3C18 A;  1ZTR A;  2ZNY A;  1PDN C;  1L0O C;  3MVP A;  1RI7 A;  1WJC A;  2K5C A;  3GUD A;  3J81 K;  1IN5 A;  4V2F A;  1WJF A;  2F5V A;  1N77 A;  3J80 K;  3H5R A;  1BJA A;  3I54 A;  1SD4 A;  2G0E A;  1BOA A;  5DD8 A;  3LFK A;  2HFH A;  4XQF A;  4UVB A;  3GZN B;  5KVR A;  4HF1 A;  3LOC A;  2Y75 A;  5LHH A;  3BZC A;  1Z77 A;  3KEY A;  4MNU A;  1X1D A;  3BTI A;  4DYQ A;  3L7W A;  5CJ9 A;  1WCM J;  1QQI A;  1IN7 A;  3BR0 A;  1G59 A;  3ZMT A;  3QP6 A;  4LOC A;  2IEK A;  3LA7 A;  5L3C A;  3NWT A;  2TRT A;  3FXK A;  4L9V A;  2E2J J;  1FP1 D;  2AXL A;  2Y0S N;  2D2W A;  3RTR A;  4IQJ A;  1ETX A;  2ME6 A;  2HZT A;  2L54 A;  3KZZ A;  1U78 A;  4A2U A;  2B63 J;  3WOD F;  4MIM A;  2FBK A;  2HOA A;  2XV4 S;  1FTZ A;  1O3S A;  2O03 A;  4YIR X;  4C30 A;  3L2C A;  4DBQ A;  2JPB A;  2XB5 A;  4B3A A;  3OOU A;  2IGO A;  1LFP A;  2QBY B;  1IV8 A;  1JHF A;  3HUG A;  4CHU A;  2VXZ A;  1ZYR F;  4ESJ A;  3AG3 H;  3K1M A;  2HYJ A;  2ZCW A;  4EM2 A;  1UG0 A;  5F6F A;  3HC7 A;  1UFM A;  2NS8 A;  2D1V A;  3M9A A;  5FKO A;  1JE8 A;  3HIF A;  4KT5 C;  5LGN A;  1FZP B;  3GTQ J;  3EUH A;  3H3Z A;  3ABL H;  4A0Z A;  3OYK A;  3S93 A;  4HOB A;  3KP6 A;  4IX7 A;  1QHG A;  4ZYD A;  4BXU A;  2E1O A;  1TP4 A;  2DK8 A;  2ZSH B;  4LK1 F;  3HRU A;  3TDU C;  2VOD A;  4PGG A;  2DLL A;  2L3D A;  3KP2 A;  4H4K C;  4A6E A;  3IH2 A;  1SFK A;  4HX4 A;  2CV2 A;  1LNW A;  2B9S A;  3CC4 I;  2ZJQ F;  3I9V 2;  4XOR A;  3S1N J;  2DOE A;  3A0B C;  3V8L A;  2VOP A;  3MWM A;  1A36 A;  5D4S A;  1XC5 A;  2V7F A;  1EA3 A;  3M8E A;  3V7R A;  2GXB A;  2CUZ A;  2EV6 A;  2R7D A;  1MW7 A;  1YIT I;  5HDN A;  3M1C A;  4UY8 I;  1I1S A;  3W2A A;  3M07 A;  1T6S A;  1VND A;  1TT0 A;  3DTK A;  5HLG A;  4G6Q A;  2WY8 Q;  2BY2 A;  4UNO A;  3O3K A;  2HOT A;  1HW5 A;  4C9Y A;  3H9G A;  5E17 F;  2JZY A;  2L7F P;  2M4G A;  3IP4 B;  1T33 A;  2CQK A;  1R7J A;  1HW1 A;  2FOW A;  3SJM A;  2OUM A;  4Q48 A;  3LSR A;  3QAH A;  4M3F A;  3TGN A;  5DEQ A;  5D5U B;  2CW8 A;  3ONQ A;  3PO3 J;  4R8H A;  4F93 B;  1BN5 A;  2BGC A;  3PUB A;  4D1Q A;  3DFG A;  1LDK B;  4J19 A;  3MEX A;  1PP7 U;  1FY7 A;  4AC0 A;  1BC7 C;  2I8D A;  3CC2 I;  1YLF A;  2DDA A;  2XHK A;  2H8W A;  5EEA A;  1HLV A;  5F64 A;  4AU7 A;  4BU2 A;  4H0E A;  1IJW C;  4RAY A;  3I5U A;  3DP7 A;  3RIR A;  3FWE A;  1GVD A;  1HKQ A;  2RQP A;  1D5V A;  4NC8 A;  3TO7 A;  3F3X A;  4BXF A;  1MBE A;  2OTL I;  3MZY A;  5J6X A;  3MKL A;  1T08 B;  2RQQ A;  3OV8 A;  2FOK A;  1B59 A;  2KIQ A;  5C4J J;  3H5N A;  2CFO A;  3V42 A;  5HS8 A;  2ZJP F;  1NH3 A;  1ZR4 A;  2RNG A;  3R61 A;  2NOJ B;  1E3H A;  3HOZ J;  1POG A;  4CCJ A;  1W36 C;  1XCV A;  2Z3Y A;  1TQP A;  5GAD J;  3EYI A;  3KP5 A;  1FYL A;  2L7Z A;  3HSR A;  2KJC A;  1B6A A;  3F6O A;  4M6X A;  2IS1 A;  3VYU B;  5ILU A;  3K70 D;  2IBD A;  1F4K A;  1ZRE A;  2W85 A;  2EFO A;  3K1N A;  3I4N J;  4PJJ A;  4NBQ A;  1SC7 A;  3TP3 A;  3H1C A;  3P9I A;  2JA5 J;  4IKF A;  5IT9 K;  3B6A A;  1JTY A;  1VQN I;  3NAU A;  2O6G E;  3RZO J;  2KKO A;  5LBQ A;  2Z99 A;  1WI9 A;  2JWT A;  1TQI A;  2EIJ H;  4CCL A;  3OY9 A;  2EFQ A;  3TMO A;  3FXJ A;  5FRO A;  1FYK A;  1G3S A;  1KQ8 A;  1QGP A;  2BY1 A;  2DDB A;  1LJ9 A;  3KIO A;  5FD6 A;  4HQE A;  1TW3 A;  5GAG J;  1T98 A;  1V4R A;  2E5N A;  3C7J A;  4MLO A;  2LVS A;  1SVL A;  4EJV A;  1SFX A;  2FNA A;  2XIG A;  4JP0 A;  4XIC A;  2BW3 B;  1FLI A;  3WU1 B;  2EFP A;  5LHI A;  1BIA A;  2ELK A;  2CGP A;  4PFP A;  4G7H F;  2YPR A;  3IH4 A;  2O8X A;  3QU3 A;  4Z6Y A;  2L01 A;  3QWL A;  3UNG C;  4IOC F;  4XOT A;  4G6T B;  2KT0 A;  1MJ9 A;  5CVR A;  1K61 A;  1WRJ A;  1R9T J;  4PGH A;  4AYB A;  1GHC A;  3EYY A;  1Z3Y A;  3CTA A;  4BY1 J;  1D1C A;  1I6X A;  1W1W E;  2NAZ A;  2LFB A;  1S29 A;  5HOD A;  4IRI A;  4BDZ A;  3JRC A;  2VL8 A;  4IHX A;  4MO7 A;  3B6C A;  3FIW A;  2V9P A;  3CLQ A;  3GW2 A;  3ECO A;  2ISZ A;  3WTZ A;  1R36 A;  4MGR A;  2W48 A;  2Y0M A;  2EB7 A;  2DJN A;  3S2H J;  1Z21 A;  5F1R A;  3ZQC A;  4KYW A;  3CD6 I;  1Z67 A;  1OQY A;  4XON A;  1V3F A;  2FEZ A;  4M9S A;  1EKE A;  4XLA A;  3A02 A;  3LWF A;  4XRF A;  1FOY A;  1BBY A;  1KQ9 A;  2M1B A;  1ETW A;  3V8K A;  2OU2 A;  3KYL A;  2WC2 A;  3S17 J;  4A12 A;  5FGM A;  3DU5 A;  2FSW A;  4UV8 A;  1D1B A;  3RI4 A;  3HBL A;  4RLF A;  2DFI A;  3M4O J;  3BTL A;  1J0R A;  4O6J A;  4IHS A;  3P9C A;  1WKM A;  3LL7 A;  2V79 A;  5DTD A;  3E6M A;  1S5L C;  1IG7 A;  3V7S A;  2HQA A;  1Z91 A;  4FE7 A;  1MBG A;  4JX5 A;  3ZMS A;  3ZQI A;  5EF6 A;  4N9I A;  3Q0V A;  3TOA A;  1QA6 A;  5CVU A;  1NK3 P;  4E4H A;  3O2P E;  1MMS A;  2X1C A;  5JI6 A;  2F4M B;  1ZKG A;  3BWG A;  2M34 A;  3KYD B;  4RAZ A;  2LY1 A;  3CES A;  1BR2 A;  2G9W A;  2AXT C;  5D5V B;  4I7H A;  2JT1 A;  3NWS A;  4UVA A;  4BEH B;  3R0A A;  2IGM A;  3BZ6 A;  2KIS A;  2A6E F;  3A4C A;  4KA4 A;  3I55 I;  4BNC A;  1OFC X;  1YHQ I;  1FOW A;  4HBL A;  5J4Y A;  1S7O A;  3CDL A;  2VKE A;  1KQ0 A;  1H0M A;  4KIC A;  3HRM A;  4KN4 X;  2LY2 A;  3HGY A;  4GCV A;  2COB A;  3I4P A;  1JUP A;  1S8N A;  1G3W A;  2K27 A;  3DEU A;  1Z3X A;  4D7N A;  2LYC A;  4IF4 A;  3VYS B;  2BOL A;  2RC4 A;  1IUF A;  3G3Z A;  2XKP A;  4R79 A;  1A6Q A;  3VWB A;  5BNG A;  4WX9 A;  4RBO A;  3HOS A;  5DUK A;  2BW3 A;  4DQ2 A;  2ZXW H;  5KHD A;  5E3L A;  3AL0 C;  3BPV A;  2H1K A;  5D6F A;  5L3B A;  2P5L C;  1ETO A;  2DYS H;  1YI2 I;  2ID6 A;  4BXX J;  1SFE A;  2CMP A;  5B1B H;  2EA4 A;  4CCO A;  1Q1V A;  1SAX A;  1H9G A;  3RKW A;  5EJC A;  3I56 I;  4C2T A;  2M9H A;  1WI3 A;  3BZK A;  3IRQ A;  2GIV A;  3OIQ A;  1ZG5 A;  1HF0 A;  3DF8 A;  1NG6 A;  4GRI A;  2EPF A;  3WG9 A;  3AAF A;  2LRE A;  4DOZ A;  1I5Z A;  5KCM A;  2EV0 A;  1W7P B;  1FBU A;  4XM3 A;  1Y0N A;  3NQO A;  1GLN A;  1LEA A;  2QUF A;  3JCU C;  5FLX K;  3OL4 A;  2VE9 A;  2ZJR F;  2EWN A;  1ZAR A;  3RZD J;  5J47 A;  2FQ4 A;  1DPR A;  4IL6 C;  1YX5 A;  4KT6 A;  4GDF A;  1N25 A;  1SAU A;  2KP6 A;  4Y15 A;  3TKY A;  3V8J A;  1MMA A;  2HPI A;  3GX4 X;  1XSV A;  4A3G J;  1FSH A;  4RDU A;  3GTL J;  3RQ4 A;  4BQA A;  2Y2Z A;  2XF7 A;  5LEJ A;  2W7N A;  4B8X A;  4EGZ A;  4ENM A;  3SDB A;  2OAZ A;  4M3E A;  4IHY A;  5K5Q A;  1KYW A;  1R23 A;  2XSD C;  3I64 A;  4CIC A;  2VQC A;  2CYY A;  1SVO A;  5B66 C;  4QWQ A;  3FZV A;  5HVQ C;  3U21 A;  1ZGA A;  1OPC A;  3AKZ A;  2CFX A;  2VT2 A;  4GXO A;  1X1B A;  2DA5 A;  4YEJ A;  1HC8 A;  4AM3 A;  5DCM B;  3MKY B;  1DUX C;  4CCK A;  5ICG A;  2WY7 Q;  5GAE J;  3GTJ J;  2XKO A;  5L3D A;  2ZXH A;  5JLW A;  4RB3 C;  2E35 A;  2KRC A;  1J09 A;  3LQQ A;  1KU3 A;  5FD5 A;  4LIU A;  2DCE A;  4YII A;  4F52 A;  2IAI A;  2JK3 A;  2R7R A;  2XAU A;  4LLN A;  2R7X A;  5M3F J;  4OU0 A;  3L2U A;  3VSL A;  3OMY A;  2HVR A;  1EV7 A;  2V6E A;  4M6Y A;  4M9X A;  3HTS B;  2FBH A;  5IT3 A;  1LFU P;  2FBI A;  2R7U A;  1IXR C;  1SMT A;  4E7S A;  3F0C A;  3W2W A;  4HNT A;  3A03 A;  3I4M J;  4KIS A;  1EF4 A;  1QZY A;  4LFU A;  3K69 A;  4FT8 A;  1WJE A;  1WGX A;  3PNT A;  3CO6 C;  1ZQ3 P;  2IP2 A;  2R7Z J;  2DW4 A;  4JOM A;  3QYF A;  1Z7U A;  3IL2 A;  2R4G A;  3OIO A;  2EZH A;  2CQQ A;  1VQ4 I;  1XMK A;  1X1A A;  2DA3 A;  3WGI A;  2AO9 A;  2LOO A;  4NUB A;  2AQF A;  5HDK A;  2VE8 A;  3RDI A;  4U87 A;  1IRX A;  4MFE A;  4I76 A;  3AL0 B;  2HZD A;  5IT9 Z;  3CJR B;  1OJL A;  3S16 J;  3G1O A;  3O6B B;  2Y48 A;  2DQL A;  2PFB A;  2L9S A;  3K4M A;  3MCZ A;  5C3E J;  2RRE A;  4AVZ A;  2W1O A;  1OCZ H;  1G4D A;  1X3W B;  2VAS A;  4D9J A;  2KIM A;  4XLF A;  4C2M J;  1ZHF A;  4BDY A;  3PNV A;  3KFW X;  4M73 A;  2IPQ X;  2Z2S B;  4XR6 A;  1B72 B;  3REO A;  2K3F A;  4M72 A;  5CPR B;  2K4J A;  1ON2 A;  3T0Y A;  4OIN F;  1XSX A;  2LKP A;  2OD5 A;  4BUP A;  4Q4Z F;  2LLK A;  1D8K A;  1SD6 A;  1WFX A;  2DMQ A;  4AYB N;  5H20 A;  4AIK A;  2PN6 A;  1G3T A;  2ZFW A;  4G94 A;  3HG9 A;  1T39 A;  2QA4 I;  4MFD A;  2MFZ A;  4RM2 A;  1F1Z A;  1CF7 B;  5HLT A;  3GLX A;  4B48 A;  2ZKZ A;  1O3Q A;  3OYG A;  4WCG A;  4JK1 X;  5DUI A;  3WTV C;  5H2F C;  5D5W B;  3WTW C;  3S2W A;  2XF5 A;  5H6R A;  1SFU A;  1XDU A;  3CCE I;  3ESW B;  3RPU D;  4BE1 A;  1IF1 A;  5IYB J;  5L3F A;  1YO5 C;  3PNY A;  3AG1 H;  2OZ6 A;  2ECC A;  2E1M C;  4L5J A;  1KA8 A;  1IO2 A;  2XC7 A;  2NXN B;  3RCO A;  2M7A A;  1ZGJ A;  4EV0 A;  3A01 B;  3CC7 I;  2M2E A;  2W24 A;  3L2R A;  1K6O A;  2CQ7 A;  1M1E B;  1UJ8 A;  4K2E A;  2KHM A;  2HDC A;  1IRG A;  2VPL A;  2QKM B;  2R7Q A;  5B5E C;  2NNY A;  3CUO A;  4BY7 J;  2V9V A;  2GWR A;  2GBY A;  4P9U A;  2HVS A;  2M0C A;  1PP8 F;  4XRS G;  3GF2 A;  2EQR A;  5ILV A;  2R7V A;  3GFL A;  5AON A;  2LDU A;  2V1X A;  3GXO A;  4ENJ A;  1Y1V J;  1IXC A;  1W5C C;  2OA4 A;  3OSG A;  2ZNZ A;  3M8J A;  3FXO A;  1FTT A;  3MQ0 A;  1UHM A;  3QPH A;  4BAC A;  1GT0 C;  2ELH A;  5LGU A;  4A3C J;  5BMZ A;  4D0P A;  1ZEL A;  4YFK F;  3D5R C;  3EPZ A;  3FBN B;  4YRV A;  1ZGW A;  3E5Q A;  1V5E A;  1U9O A;  3K9T A;  3PIP F;  3H35 A;  4G12 A;  4IPA A;  9ANT A;  4XLN F;  1HDP A;  5E8I A;  1MH3 A;  4HX8 A;  1IAW A;  2W82 A;  2ELJ A;  4WF2 A;  4OIO F;  1HXD A;  1Y8R B;  4X1E A;  5J8C A;  2PEX A;  1E0E A;  1N78 A;  2E1C A;  3N4M A;  3FMR A;  1OYI A;  2J5P A;  2IRF G;  2MH9 A;  1TWF J;  3BJA A;  3WTY C;  1YQA A;  3BP8 A;  4XKV A;  5E20 A;  1PUF B;  4A93 J;  4NDL A;  3IHU A;  1D8J A;  1QPM A;  3K7A J;  3DU6 A;  4IHV A;  2F5E A;  1UMQ A;  1QU3 A;  2Y30 A;  5ICF A;  1MGT A;  1Y6I A;  3ABK H;  1MD0 A;  1ETK A;  4DYC A;  2MSY A;  1T38 A;  4HAM A;  3EDP A;  1B72 A;  2NOG A;  3TED A;  2YUS A;  1LVK A;  3ZRG A;  3GTG J;  4HRI A;  1NHA A;  4CCN A;  2UUZ A;  3DEE A;  5HS9 A;  4BQQ A;  3OYM A;  5FFZ A;  1VQP I;  3ABM H;  3CJT B;  4F3Q A;  1ZK8 A;  2F4O B;  1R5G A;  4G7O F;  3P9K A;  3LSP A;  3CCR I;  3E6B A;  4MEY F;  3ELK A;  3TW6 A;  5GPC A;  1CF7 A;  3S14 J;  3BG6 A;  3LFU A;  4CSW A;  2JRT A;  4AIJ A;  3VDX A;  2DXI A;  2NS7 A;  1SMY F;  3HKZ N;  5CLS A;  3I59 A;  3OYH A;  1K79 A;  2DO7 A;  1AHD P;  4DW6 A;  5CYV A;  1MBK A;  1VI0 A;  2LF8 A;  2DT5 A;  2ZSI B;  1CQT A;  1AWC A;  5J1U A;  1GXP A;  4MQV A;  2H6B A;  2V1N A;  2V4J C;  3F72 A;  4DIQ A;  1P9Q C;  2EBI A;  2X0L A;  4KN7 X;  1MMG A;  4UXN A;  2CS3 A;  1X2N A;  4PJN A;  1GDT A;  5IP9 J;  1IW7 F;  3A01 A;  3E7L A;  1U9N A;  5D8L B;  2PX9 A;  3K10 A;  3K4L A;  4OIR F;  1MSF C;  3C2H A;  1TQM A;  1FMV A;  4O5V A;  1V55 H;  2VON A;  4XLP F;  3OYB A;  2PJP A;  1FPQ A;  3HEF A;  2A69 F;  1YOV B;  3ZMV A;  5JFR A;  5IYC J;  3VOD A;  2E36 A;  3TL4 X;  2PMZ N;  2ZC2 A;  1V5F A;  3HOU J;  2X85 A;  4A3J J;  3HXL A;  4ETS A;  2NVU B;  2XUB A;  2ESH A;  2HKO A;  3JSP A;  2BY3 A;  1ITY A;  1U8R A;  2LP0 A;  3SXY A;  2H8R A;  1LDD A;  4C3I J;  2BVL A;  1JHH A;  2Y9Z A;  4XLE A;  2FE3 A;  3CCV I;  4XMY A;  2BYV E;  3Q0W A;  1OCT C;  3ZQG A;  3KZY A;  3Q0U A;  3HL2 A;  3DV8 A;  2Z1D A;  4ZJZ A;  1JJ6 C;  2BEO A;  1U6G A;  2VI6 A;  1TNS A;  1WHU A;  2FRH A;  2ETH A;  2M7B A;  2CUF A;  4RB0 A;  4Z2Y A;  3CMA I;  5KAI C;  3OR1 C;  3BTC A;  3FXU A;  3K4J A;  5E1W A;  4UUV A;  2VT3 A;  3BCB A;  4S05 A;  4ASN A;  4CUG A;  4OMZ A;  2YX7 A;  2YU9 J;  2DU9 A;  1YW8 A;  3F6V A;  2PLY A;  3CJQ B;  3ZMU A;  3MMY B;  1T95 A;  3BR5 A;  3HSF A;  1YW7 A;  4L9J A;  1FT9 A;  5F1J A;  5IY5 H;  3A1Y A;  5JVG F;  1W7P D;  4BS9 A;  3E5X A;  1PUF A;  2BXZ A;  1G8X A;  4A0Y A;  5LGT A;  4EJO A;  4RS8 A;  2IA2 A;  1HCR A;  5L3G A;  3TQN A;  3BR1 A;  5LHG A;  4J01 A;  2M87 A;  3BQY A;  5GTI C;  3LSH A;  2F2E A;  1U2W A;  4GYI A;  2Q0O A;  1R5H A;  3F8M A;  4PFO A;  1P2F A;  1ULY A;  2EJR A;  1ZLK A;  3VB2 A;  1WH5 A;  4PSX A;  2EIL H;  4NQW A;  4F91 B;  1MMN A;  2FXA A;  1JJ8 C;  2FJ1 A;  2VC1 A;  1I39 A;  3QYE A;  3ML6 A;  4QPO A;  5FFX A;  1AA7 A;  3EET A;  3UR3 C;  4XSZ F;  3BT9 A;  3VSK A;  1O3R A;  4CH7 A;  1QZZ A;  2OPT A;  2F4I A;  2KRF A;  2RN7 A;  1Y0U A;  3PQK A;  1IC8 A;  2VJI A;  4PZJ A;  5JHU A;  2H94 A;  3OYJ A;  2K9L A;  3PSI A;  3DLL F;  2GOX B;  3JRI A;  3QOP A;  1UB9 A;  2VXD A;  1RPW A;  4U88 A;  3H9J A;  3BJO A;  4E7H A;  4LG3 A;  3U1K A;  4I98 B;  2XF6 A;  1KU9 A;  3ISP A;  4I2O A;  4DBR A;  3BPX A;  4Q47 A;  3RKY A;  4RA2 A;  2GQQ A;  5CVJ A;  3S1M J;  2LKX A;  2A5Y B;  3OYE A;  4HYE A;  3G71 I;  2JA8 J;  1OMI A;  3DPL C;  2XAJ A;  3GZ6 A;  3GTK J;  2STW A;  3B02 A;  5K7F A;  2FQ3 A;  2MH2 A;  3CME I;  3OYA A;  5E1X A;  3K4N A;  1X1P A;  5A2Q K;  1BI1 A;  2DMU A;  5E3O A;  2K7L A;  2VUM J;  1G2H A;  2E7X A;  2WAQ N;  1W5T A;  1IDY A;  2JUG A;  3CCQ I;  2BXY A;  2HGC A;  4IQ4 A;  1YJ9 I;  1B8I B;  3DBR B;  2LSO A;  1ON1 A;  2UZK A;  5IP6 A;  1WH7 A;  1ETV A;  3R60 A;  2XAS A;  1VQO I;  4XID A;  1UEL B;  3E6D A;  1I3A A;  1T8I A;  1JI8 A;  1VF9 A;  5GAH J;  2MYS A;  4J00 A;  2JA7 J;  1SAN A;  2KMU A;  1XS9 A;  3HM5 A;  2L5Q A;  1R1U A;  1I1G A;  4A69 C;  1BI3 A;  1ZAO A;  3HHG A;  1VQM I;  2XSJ C;  4YEL A;  3Q9S A;  3SHF A;  4N0B A;  4KMF A;  3HDD A;  4LJZ F;  3GFM A;  1MMD A;  2L2O A;  2NVQ J;  1W4M A;  3P7N A;  2VKV A;  2YX4 A;  3DTE A;  4IVN A;  2CV0 A;  2JUC A;  1V54 H;  2ADU A;  4ESB A;  3VYT B;  2M5W A;  1K6Y A;  5BS6 A;  3N97 A;  2Z5U A;  2FA5 A;  3ZMZ A;  3WTT C;  1HBX G;  3SYT A;  2DOD A;  2ID3 A;  2LKS A;  4F55 A;  3J81 Z;  3HPG A;  4EAT A;  3PIO F;  4LIV A;  3J80 Z;  4XOP A;  2V6C A;  1QVU A;  1S3J A;  4OWR B;  5EZG A;  2LF7 A;  1Z7L A;  2A05 A;  1GUU A;  5FRN A;  1DQU A;  2R5Z B;  3NRV A;  3TO9 A;  4KIB A;  2EFW A;  1YJW I;  2DOF A;  4E70 A;  4RGU A;  3BG9 A;  1WZ2 A;  3KLO A;  2KRH A;  1F43 A;  1YRN A;  4HNU A;  3TOB A;  3J7A O;  2KQR A;  2HNH A;  1LUJ B;  4ZDP A;  2X1D A;  4BQN A;  2IW5 A;  5DDG A;  2HVQ A;  5FKM A;  4HA8 A;  3V4G A;  5E3M A;  2CSO A;  3MD2 A;  1DU0 A;  5BPI A;  2LH9 A;  1J59 A;  4HQM A;  5E79 C;  2JN6 A;  4XLC A;  2DA2 A;  2FNP A;  3DPT A;  5H6Q A;  6PAX A;  2RDP A;  2UXN A;  4EMS A;  2HU9 A;  1XN7 A;  1UZC A;  2Y31 A;  1KU2 A;  3QU6 A;  4Y3O A;  1Q1H A;  4E7L A;  1A04 A;  2FD5 A;  4QPQ A;  1JKQ C;  3RPQ A;  4E6K G;  3F8B A;  1IDZ A;  2TCT A;  4IXA A;  3OS0 A;  4II2 A;  4C2U A;  2K9M A;  3H3V K;  5M5Y J;  1XCB A;  5TIS C;  3J7A Y;  4Q5S F;  4BGD A;  1ERD A;  4C3J J;  1TWC J;  3OS2 A;  3W2V A;  4BL0 B;  4XBF A;  4ENK A;  1BI2 A;  4ZYG A;  1VZ0 A;  5EYR A;  3W6V A;  4JYK A;  3GYH X;  1ZN2 A;  3FXM A;  4FX4 A;  2IS4 A;  4WXH A;  3F21 A;  3JRG A;  2QSF X;  2EZL A;  1TL8 A;  2OJE D;  5GPA A;  1SVM A;  4LGW A;  4CCM A;  1FBS A;  3DBH B;  4KIT B;  2QKL B;  2R92 J;  2EZK A;  4I01 A;  2BY0 A;  2LMD A;  3L9F A;  2ZME C;  5BPD A;  2FF4 A;  1YTY A;  3K70 C;  2GM4 A;  2XGC A;  3ZQQ A;  2XB0 X;  1U5T C;  1XMX A;  4AD9 A;  2CWE A;  2NYX A;  3EUK L;  2HTS A;  2K86 A;  1LE8 A;  2KPM A;  4R1H A;  4UUT A;  1R5I D;  3K4B A;  2C6Y A;  2AS5 F;  3CF5 F;  2I5U A;  1B8I A;  1RET A;  1WJD A;  3QOE A;  3BQZ A;  5LRR A;  4RMN A;  4L0Z B;  4XKB A;  5M5X J;  1WJB A;  3QOD A;  3FDY A;  3ABT A;  2RAE A;  2VBY A;  4NNJ A;  1USS A;  3FKI J;  4KUM A;  4EM0 B;  2ACJ A;  1MDM B;  2IS6 A;  2HDD A;  4ZDO A;  4G8X A;  4OIP F;  3OWT A;  3OR2 C;  2W4S A;  1UCR A;  1R49 A;  1PUE E;  2XRL A;  1TZL A;  4HZF A;  1EH7 A;  4I0A A;  4KDP A;  3M1E A;  4IJA A;  4YG2 F;  3X2Q H;  2WV1 A;  2CO5 A;  3HKZ A;  4MHG A;  4BAY A;  1FEX A;  1YIO A;  2X4H A;  1D3Y A;  4P5O A;  2P5V A;  2XPW A;  5J1R A;  1EJ9 A;  3D1N I;  3SZG A;  4IRH A;  2R5Y A;  2QVO A;  3H92 A;  1SEU A;  2K9Q A;  2YR2 A;  5TGT A;  2OQG A;  3LQR A;  4LB6 B;  1RKT A;  4PUS A;  3TDZ C;  2DTZ A;  1MJA A;  1LEB A;  4B1R A;  2PMH A;  2R5Z A;  1LKX A;  2KDZ A;  2BBY A;  2JTV A;  2PQ8 A;  4LK0 F;  4N9H A;  3GTM J;  4LB5 A;  4BBS J;  3RQI A;  4AWX B;  3FK6 A;  1G3Y A;  1K4T A;  1JXS A;  1GXQ A;  2GAU A;  3S3O A;  3A2K A;  3MFK A;  2COM A;  3JTH A;  4ZZL A;  4YFX F;  2X9D A;  3ECH A;  2HYG D;  3KX2 A;  3MKW B;  2PMZ A;  3I3L A;  4HF2 A;  2OC6 A;  3GVA A;  2WV0 A;  3WTS C;  4D5F A;  1RIO H;  4I09 A;  5FKL A;  4BQO A;  2MAB A;  4UUS B;  3PJR A;  2XGE A;  1QRY A;  4HPQ A;  1AOY A;  1YFH A;  1G6N A;  2CUJ A;  3KCC A;  2V1U A;  3C3W A;  1IV6 A;  5TRD A;  3LSG A;  1RUO A;  1DPU A;  2YS9 A;  2QWW A;  2B7E A;  4II3 A;  3BR6 A;  1BL0 A;  1YE9 A;  3WU0 A;  5K7Z A;  3G2B A;  3U9G A;  5LRS A;  2N8G A;  3WG7 H;  1JUM A;  1BJZ A;  1H89 C;  4HG2 A;  2QEX I;  5HNH A;  1X3Z B;  1XDS A;  5E18 F;  3OYF A;  4CZZ A;  4U0Y A;  1JGS A;  1XTA A;  1YYV A;  2QCO A;  1LFB A;  3BLY A;  4BHB A;  4NC7 A;  4Y4R A;  2ZXJ A;  2DA4 A;  2RVC A;  4CYC B;  3D0S A;  3FHZ A;  1YX3 A;  3OS1 A;  2H27 A;  2EA2 A;  4ANJ A;  3KLN A;  1QBJ A;  1XGN A;  3R0J A;  3CLO A;  3JRA A;  3S3M A;  5HOO A;  2G7H A;  2DAO A;  1ODD A;  3ZQF A;  2L9N A;  3BJ6 A;  2W25 A;  4TV7 A;  2GOM A;  3OYN A;  3JR9 A;  1P4X A;  3VYR B;  2PG4 A;  2M0M A;  2FML A;  2MD5 A;  4XK4 A;  3H0D A;  1X4O A;  2JA6 J;  3J7Z I;  3FM5 A;  4PK4 A;  3ROU A;  3JRH A;  2MGQ A;  1XB4 A;  1PVE A;  1RRJ A;  3PSF A;  5DYM A;  2E2H J;  3Q9V A;  1MDM A;  3FMQ A;  3K6G A;  3T8T A;  1FP2 A;  2L9V A;  1YG2 A;  2E19 A;  2O3F A;  3O8H A;  1X4P A;  3WGH A;  4CZC A;  4L5E A;  4GFB A;  3ZQL A;  1MSE C;  2K4B A;  1DGR M;  2DMN A;  2L7K A;  1J75 A;  5KNL A;  3K2A A;  1P7I A;  2DN0 A;  3Q5F A;  4LLG F;  3I59 B;  4L18 B;  1XSD A;  1KU7 A;  1ORK A;  3IV5 A;  3BR2 A;  2DOA A;  2QF7 A;  2WB1 A;  5F27 A;  3HOT A;  3AFH A;  3W3C A;  1O7L A;  1Z0X A;  4FHT A;  4RGS A;  4EGY A;  4BJ6 C;  4A3B J;  2ZXI A;  1TTY A;  2L02 A;  3LST A;  3BCA A;  5D4R A;  3E5U A;  1R71 A;  1T0F C;  3S32 A;  3ZQ7 A;  5F04 A;  2HWV A;  2OQR A;  3NAR A;  5JLX A;  1XX5 A;  3F23 A;  2OTJ I;  1P92 A;  4A6D A;  3FBI B;  5F0F A;  1T2K A;  4L9T A;  2OCC H;  1ZG3 A;  1IN8 A;  3WE2 A;  4BE2 A;  5CVI A;  3FF5 A;  2P6S A;  3K1P A;  4ESF A;  1O3T A;  1TBX A;  3ZQH A;  4P55 A;  5B3S H;  1VQ9 I;  2NNN A;  4KNY A;  4M6V A;  4IHW A;  4RB1 A;  1J7K A;  1NG7 A;  1TNT A;  2CW7 A;  3RJP A;  4E7K A;  1PJR A;  4UB8 C;  2XAH A;  4EJU A;  2BHZ A;  2TDX A;  4Y52 J;  1DP3 A;  2WAQ A;  4UUS A;  1W0T A;  4U7B A;  2ESN A;  2V9K A;  3QP5 A;  5GTH C;  3Q3S A;  5ED4 A;  1U8B A;  1VQ5 I;  2DPD A;  3GTO J;  4JBA A;  3ASN H;  1LPQ A;  1QVT A;  3FXL A;  3GCM A;  5HLI A;  2GXG A;  4XNF A;  1PYV A;  4BH9 A;  3S3N A;  3F22 A;  2L4M A;  1FBQ A;  2XRO A;  4XKC A;  4EVI A;  1WVR A;  2XPV A;  2B0L A;  2BZT A;  2PI0 A;  2GIZ A;  1WPK A;  3CUQ C;  1J5Y A;  3G1L A;  2EFN A;  1BOB A;  4B3X A;  3NEU A;  3TBI A;  2JMW A;  2LY9 A;  2ZME A;  4BHC A;  1B4A A;  3KEQ A;  4DGW B;  4CXF A;  4LG0 B;  4XKW A;  4DYR A;  1R4N B;  4RAF A;  4E7Z A;  3MZH A;  2VOO A;  1A35 A;  2O8K A;  4CYC A;  3QYB A;  1U5T A;  4M3G A;  2IS2 A;  4RAG A;  1ZRC A;  4PJL A;  5L3E A;  1BI0 A;  4UHT A;  2DFE A;  1K83 J;  1MND A;  4A0X A;  4AIH A;  3TW7 A;  2HPM A;  3GO5 A;  4WXC A;  1MBJ A;  3DBL B;  4EJW A;  1TWA J;  3H9Q A;  4ZZD A;  1TWG J;  3PM1 A;  4BJ5 C;  5HNF A;  1RNL A;  3K4C A;  1E17 A;  1RC9 A;  3QQA A;  3JTG A;  1TW2 A;  3FX3 A;  2CW0 F;  2QQ9 A;  5KAF C;  5ERI A;  1IXS B;  1YW9 A;  3K2Z A;  5B1A H;  3JRF A;  1Y39 A;  3OYD A;  3LSK A;  4NQW B;  3ZN1 A;  3B73 A;  2JSC A;  4DZJ A;  2XGD A;  3E1S A;  1JGG A;  2O61 A;  4RGR A;  3GLL A;  1HKT A;  2DYR H;  1KYZ A;  2X6O A;  1V5G A;  3LA3 A;  1X2M A;  2E34 A;  5FO5 A;  1DGW Y;  4WXD A;  3D5L A;  2YU3 A;  3W6J B;  1XGO A;  3GFI A;  3L2V A;  2OF7 A;  2R93 J;  3AG4 H;  5EEG A;  2BVM A;  5FLX Z;  3E3V A;  1UAA A;  5EG0 A;  2E1M B;  4EJT A;  1A6I A;  2EH3 A;  2P6T A;  1H8A C;  1KZH A;  5E1Z B;  2L0K A;  2K02 A;  2MLG A;  2MC3 A;  3HZJ A;  5J1Y A;  3BY6 A;  2P5K A;  3CCU I;  5DD4 A;  5BQT A;  5M3M J;  2O0Y A;  2X1E A;  2CQX A;  3CDI A;  1DDN A;  4ENN A;  2A68 F;  1ZG1 A;  2D5V A;  1RKW A;  2BE5 F;  2ZBK A;  4KIF A;  1W36 D;  1HKS A;  1T56 A;  3IKV A;  2V26 A;  1ACI A;  2WA0 A;  4FIS A;  2PJR B;  2KZG A;  3DKX A;  3RKQ A;  2CJJ A;  3CZ6 A;  4BBR J;  3CP8 A;  3PUF A;  1E3P A;  3UKG A;  1Y8Q B;  3G1M A;  3CF2 A;  1MIJ A;  1MNE A;  2AQE A;  1Z6T A;  2M45 A;  3OL3 A;  3KEO A;  3TP0 A;  3CMM A;  4U0W A;  3T8R A;  1VQ6 I;  1ZR2 A;  5DS9 A;  3I53 A;  3S1R J;  1E2X A;  1JUS A;  2NVY J;  4BJT A;  4OIQ F;  3L2W A;  1XD7 A;  3C1D A;  1IZ1 A;  3ZR8 X;  5C4X J;  3GBG A;  3BOQ A;  4HLY A;  3LAJ A;  5DM7 F;  5FJ8 J;  1QNT A;  1STZ A;  3DEW A;  5IOY A;  3H3U A;  5CVV A;  3CUQ B;  5CQG A;  4YIF A;  2E5Z A;  2DA6 A;  3G73 A;  1B9N A;  3OOP A;  2DQR A;  2IVM A;  2WBM A;  1BC8 C;  3IKT A;  1B9M A;  2L7M P;  1KON A;  4LG0 A;  2P81 A;  2DI3 A;  4CDG A;  4HDV A;  5D5X B;  3ZOB A;  4S04 A;  4V19 K;  1X58 A;  1S7E A;  3GEZ A;  4I6Z A;  1RR7 A;  2KIF A;  4MEX F;  1EH6 A;  2CV1 A;  1BW5 A;  2RKH A;  3HYI A;  4FX0 A;  2QQB A;  2MBF A;  3CCM I;  1U3E M;  1TWH J;  3OSF A;  4ZDL A;  1BR1 A;  3AG2 H;  5LEK A;  5K7H A;  1JT0 A;  1RZ4 A;  2X6X A;  2F5F A;  2R0Q C;  2XRN A;  2I10 A;  4GGG A;  4CGZ A;  2R7F A;  1YS7 A;  4C3H J;  2K40 A;  4A3I J;  2X6W A;  1YRN B;  2M4K A;  2HDW A;  4CO8 A;  3HOY J;  1P4W A;  5J4V A;  1IGN A;  3GFJ A;  4PJM A;  2DA7 A;  1OIS A;  2HTJ A;  1L3L A;  1JT6 A;  2DMT A;  1ZRD A;  1AKH B;  3IWF A;  1JKO C;  1P6R A;  1C0W A;  3WTX C;  3SZP A;  1FMW A;  3MKZ A;  1APL C;  3ZXS A;  5GP9 A;  2R7T A;  2MD0 A;  4AVP A;  1FX7 A;  1R6R A;  4I99 C;  2LK2 A;  2RV8 A;  3ZN0 A;  4HNV A;  4OAY A;  2FU4 A;  2ECB A;  2JJ7 A;  3ZCO A;  3LNQ A;  2Q2E B;  4BHP A;  3VOE A;  2NVX J;  1K7A A;  2WB1 N;  2W84 A;  1LDJ A;  4Y17 A;  1T0F A;  2QM3 A;  2DT6 A;  4QIW N;  2MG4 A;  2VQL A;  1AU7 A;  3M3Y J;  1YS6 A;  3SQN A;  2KFD A;  2H09 A;  3JAM K;  1GV5 A;  4M3B A;  1EH8 A;  4HLX A;  2PJR A;  4RGX A;  4IEJ A;  4B47 A;  3GTP J;  3JSO A;  1TT5 B;  4P1W A;  3OYC A;  2Z33 A;  2QBY A;  3FK7 A;  1REP C;  2XAF A;  1XGS A;  3LSM A;  2F6C A;  2M3A A;  2X51 A;  5AIQ A;  4WWC A;  1JKR C;  3DPU A;  3RYR A;  3PO2 J;  3BC8 A;  2A5W A;  2OV7 A;  3R4K A;  3EQL F;  4WK8 F;  1ONV A;  5J8F A;  4XN0 A;  1MJB A;  4P9F A;  2F5D A;  4FAS D;  4JX6 A;  1MH4 A;  2KIU A;  2XAQ A;  2LD5 A;  2F5C A;  1LE8 B;  3KP3 A;  1JKP C;  2LBF B;  3I71 A;  3ASO H;  4X6A J;  2XPU A;  3A0H C;  1SD5 A;  1RES A;  2K3P A;  3CDH A;  4P96 A;  2JA2 A;  1XPX A;  4A3F J;  4A5N A;  4LD5 A;  2A61 A;  4IOA F;  4A3L J;  3CUQ A;  1GVJ A;  1MKM A;  2HQ5 A;  5J40 A;  3CMY A;  3BDD A;  4ABZ A;  5M5W J;  3L1P A;  5K5R A;  2K85 A;  3V7C A;  4Y13 A;  2JVH A;  3BG3 A;  2KL4 A;  2NRA C;  3IH3 A;  3KE2 A;  4ZH4 F;  1QZE A;  2GZW A;  3GWZ A;  4PCQ A;  3EUA A;  1X19 A;  3QPT A;  4MQ9 F;  2IJL A;  5E8G A;  3I0T A;  1NTC A;  4M9Z A;  2X6Y A;  2HEO A;  1UHW A;  2LG4 A;  2QYO A;  1TC3 C;  3DQV C;  4GO1 A;  3PFY A;  1J2X A;  4O3M A;  1HSJ A;  2DBB A;  4ON0 A;  1D5Y A;  2JVG A;  2A6H F;  4D5C A;  1R1V A;  2P0W A;  3LSI A;  2IXS A;  1K78 B;  2R5Y B;  4I0B A;  3JRD A;  1VQL I;  2WAD A;  5HLH A;  1RUN A;  3JRB A; 
#chains in the Genus database with same CATH homology
 2P4W A;  4YFN F;  4LLL A;  1Z1D A;  4JQF A;  4IRG A;  1XGM A;  2CG4 A;  1WSU A;  1Z9C A;  2M8E A;  2PBI A;  4RB2 C;  1J9I A;  3DXJ F;  5ICC A;  5JVT A;  2RNJ A;  3M7G A;  3U2R A;  3W6K B;  3SFZ A;  2KJB A;  2OBP A;  3FXQ A;  2Q2E A;  1R00 A;  3M8F A;  2P7C B;  2GA1 A;  3RPU A;  1Z05 A;  1HST A;  3RKX A;  4HDU A;  5LLQ A;  5EEH A;  1FYM A;  4U7D A;  2HR3 A;  1IRF A;  3RYP A;  1ZLJ A;  2Z9O A;  2A07 F;  3U1D A;  5K1Y A;  1B1B A;  1IUY A;  5FB2 A;  2RGV A;  5AIP A;  1UST A;  2ZO4 A;  1XMA A;  1CGP A;  4L5I A;  3L09 A;  2BV6 A;  3F8C A;  2EV5 A;  2GA2 A;  4KFC A;  1O7F A;  3DKW A;  2HYF A;  2HQN A;  1MZB A;  3ERE D;  2OZU A;  3KET A;  3FMS A;  3T1B A;  2D45 A;  1S7A A;  3GZ5 A;  2D1H A;  2P7V B;  5JR3 A;  4XSX F;  3CO7 C;  2P8T A;  2WTE A;  3I58 A;  4L9N A;  2YSR A;  1K78 A;  2ZJ2 A;  3ABU A;  2E1N A;  3TO6 A;  3IWZ A;  3WGG A;  5DCF A;  2VN2 A;  4EQQ A;  4DNC A;  3ZP5 A;  4OMY A;  2EK5 A;  3FXR A;  1H9T A;  3MAJ A;  3BRO A;  1HQC A;  5D8K B;  2ISY A;  2IT0 A;  4HV6 A;  4PDK A;  2WWY A;  5HDG A;  3K0L A;  3WTU C;  2QEN A;  2V1D A;  1QO0 D;  2UWM A;  4GYG A;  5ILS A;  1HW2 A;  1WQ2 A;  1FC3 A;  3E97 A;  1FSE A;  2QLZ A;  1W5S A;  5ICE A;  4IHT A;  1LQ1 A;  2HOE A;  2A3S A;  1R58 A;  4G9Y A;  1P4A A;  2DPU A;  2FMY A;  2MA3 A;  5D6E A;  3E6C C;  3COA C;  2PMU A;  1S6L A;  2MLK A;  1TLH B;  2W57 A;  2XAG A;  2ZME B;  2G7U A;  1IN4 A;  3ULQ B;  3JAM Z;  1U5T B;  4I02 A;  3HSE A;  5DV5 A;  3HRT A;  1Z6R A;  4NB5 A;  1DP7 P;  4HX7 A;  1O57 A;  2H6C A;  4F7Z A;  4A5M A;  5BOX A;  1OKR A;  3F8N A;  4CYD A;  4U0V A;  3L00 A;  1LVA A;  2VBX A;  4KIG A;  4HV5 A;  3CJN A;  3PQJ A;  3LAP A;  3QRF F;  2E7W A;  5K5O A;  5A2Q Z;  3F8F A;  3ZPL A;  2DK5 A;  1VTN C;  2QZ8 A;  2NS0 A;  1OYY A;  3ZMD A;  2L4A A;  3VEP A;  2STT A;  3JW4 A;  4M71 A;  3VFZ A;  2VC0 A;  5TJJ A;  2DTR A;  2QQA A;  4B09 A;  4BYY A;  3KP4 A;  1F5T A;  3IRR A;  3LA2 A;  3SZT A;  1I27 A;  4ZYE A;  1LB2 A;  1WWX A;  2IA1 A;  1W7P A;  3FM3 A;  3HRS A;  3R6S A;  2Q8K A;  3T5X A;  1FOK A;  2VBZ A;  4M74 A;  1F9N A;  4QLC U;  1X3U A;  1BM9 A;  2HS5 A;  2HKX A;  1IN6 A;  4KMU X;  2VBW A;  2R3S A;  4UV9 A;  5HS7 A;  4HW0 A;  1FNN A;  3HHH A;  1IRG A;  4HF0 A;  3IC7 A;  4LMY A;  4NHJ A;  1SD7 A;  1KGS A;  2UXX A;  5DCM A;  1FWZ A;  3HTU A;  2M30 A;  3PFI A;  4G6D A;  1R22 A;  1BIB A;  5KK1 A;  4OOI A;  3WE3 A;  3KP7 A;  2JPC A;  4UVC A;  4ZYH A;  2IA0 A;  2LNB A;  2XGX A;  1OYW A;  2J5O A;  1ZH5 A;  4MTD A;  4G7Z F;  2XVC A;  4EM1 A;  1R1T A;  1ZRF A;  1OR7 A;  4MTE A;  2HQR A;  3C18 A;  2ZNY A;  1PDN C;  1L0O C;  1RI7 A;  3GUD A;  3J81 K;  1IN5 A;  3J80 K;  1BJA A;  3I54 A;  1SD4 A;  1BOA A;  5DD8 A;  3LFK A;  2HFH A;  4UVB A;  5KVR A;  4HF1 A;  2Y75 A;  5LHH A;  4MNU A;  3L7W A;  5CJ9 A;  1QQI A;  1IN7 A;  3ZMT A;  3QP6 A;  3LA7 A;  5L3C A;  4L9V A;  1FP1 D;  2AXL A;  2D2W A;  3RTR A;  2HZT A;  2L54 A;  3KZZ A;  1U78 A;  4A2U A;  3WOD F;  2FBK A;  2XV4 S;  1O3S A;  2O03 A;  3L2C A;  2JPB A;  2QBY B;  1JHF A;  4CHU A;  3HUG A;  2VXZ A;  1ZYR F;  4ESJ A;  3K1M A;  2ZCW A;  4EM2 A;  5F6F A;  1UFM A;  2D1V A;  3M9A A;  1JE8 A;  3HIF A;  4KT5 C;  5LGN A;  1FZP B;  3EUH A;  3H3Z A;  4A0Z A;  4HOB A;  3KP6 A;  4ZYD A;  4BXU A;  2DK8 A;  3TDU C;  4LK1 F;  2VOD A;  3HRU A;  4PGG A;  2DLL A;  2L3D A;  3KP2 A;  4A6E A;  4HX4 A;  1LNW A;  3V8L A;  2VOP A;  3MWM A;  5D4S A;  3M8E A;  3V7R A;  2GXB A;  2EV6 A;  2R7D A;  5HDN A;  1I1S A;  1T6S A;  5HLG A;  4G6Q A;  4UNO A;  3O3K A;  1HW5 A;  5E17 F;  2JZY A;  2CQK A;  1R7J A;  1HW1 A;  4Q48 A;  3QAH A;  3TGN A;  5DEQ A;  5D5U B;  4R8H A;  1BN5 A;  2BGC A;  3DFG A;  1LDK B;  3MEX A;  1PP7 U;  1FY7 A;  1BC7 C;  1YLF A;  2XHK A;  5F64 A;  4H0E A;  4RAY A;  3I5U A;  3DP7 A;  3RIR A;  3FWE A;  1HKQ A;  2RQP A;  1D5V A;  3TO7 A;  3F3X A;  3MZY A;  5J6X A;  3OV8 A;  2FOK A;  1B59 A;  5HS8 A;  3R61 A;  1XCV A;  2Z3Y A;  1TQP A;  3EYI A;  3KP5 A;  1FYL A;  3HSR A;  2KJC A;  1B6A A;  3F6O A;  4M6X A;  5ILU A;  1F4K A;  1ZRE A;  2W85 A;  2EFO A;  3K1N A;  3P9I A;  5IT9 K;  2O6G E;  2KKO A;  5LBQ A;  2Z99 A;  1WI9 A;  1TQI A;  1FYK A;  2EFQ A;  1G3S A;  1KQ8 A;  1QGP A;  4HQE A;  5FD6 A;  1LJ9 A;  4L0Y B;  1TW3 A;  1T98 A;  1V4R A;  3C7J A;  4EJV A;  1SFX A;  2FNA A;  2XIG A;  1FLI A;  3WU1 B;  2EFP A;  5LHI A;  1BIA A;  2CGP A;  4G7H F;  2YPR A;  2O8X A;  3QU3 A;  2L01 A;  5CVR A;  1MJ9 A;  1WRJ A;  4PGH A;  1GHC A;  3EYY A;  3CTA A;  1I6X A;  2NAZ A;  1S29 A;  4IRI A;  3GW2 A;  3ECO A;  2ISZ A;  3WTZ A;  1R36 A;  4MGR A;  2Y0M A;  2EB7 A;  5F1R A;  4KYW A;  1V3F A;  2FEZ A;  4M9S A;  3LWF A;  4XRF A;  1BBY A;  1KQ9 A;  2M1B A;  3V8K A;  2OU2 A;  2WC2 A;  4A12 A;  5FGM A;  2FSW A;  4UV8 A;  3RI4 A;  2DFI A;  1J0R A;  4O6J A;  4IHS A;  3P9C A;  1WKM A;  2V79 A;  3E6M A;  3V7S A;  1Z91 A;  3ZMS A;  4N9I A;  3TOA A;  5CVU A;  3O2P E;  5JI6 A;  3BWG A;  4RAZ A;  2G9W A;  5D5V B;  4I7H A;  2JT1 A;  4UVA A;  3R0A A;  3BZ6 A;  4KA4 A;  2A6E F;  4BNC A;  4HBL A;  1S7O A;  1KQ0 A;  1H0M A;  4KIC A;  3HRM A;  4KN4 X;  4GCV A;  3I4P A;  1S8N A;  1G3W A;  2K27 A;  3DEU A;  4IF4 A;  2RC4 A;  3G3Z A;  2XKP A;  4R79 A;  4WX9 A;  3HOS A;  5DUK A;  4DQ2 A;  3BPV A;  5D6F A;  5L3B A;  2P5L C;  1SFE A;  2EA4 A;  1SAX A;  1H9G A;  3RKW A;  3IRQ A;  2GIV A;  1ZG5 A;  3DF8 A;  3WG9 A;  3AAF A;  1I5Z A;  2EV0 A;  1W7P B;  1FBU A;  3NQO A;  2QUF A;  1LEA A;  5FLX K;  2VE9 A;  2EWN A;  1ZAR A;  1DPR A;  4Y15 A;  3TKY A;  3V8J A;  3GX4 X;  1XSV A;  1FSH A;  4BQA A;  5LEJ A;  4B8X A;  4EGZ A;  4ENM A;  2OAZ A;  5K5Q A;  1KYW A;  1R23 A;  3I64 A;  4CIC A;  2CYY A;  4QWQ A;  3FZV A;  5HVQ C;  1ZGA A;  1OPC A;  2CFX A;  2VT2 A;  4GXO A;  5DCM B;  1DUX C;  5ICG A;  2XKO A;  5L3D A;  4RB3 C;  3LQQ A;  1KU3 A;  5FD5 A;  4YII A;  4LLN A;  4OU0 A;  1EV7 A;  4M6Y A;  4M9X A;  3HTS B;  2FBH A;  5IT3 A;  2FBI A;  1IXR C;  1SMT A;  1QZY A;  4LFU A;  3K69 A;  4FT8 A;  3CO6 C;  2IP2 A;  2DW4 A;  1Z7U A;  3IL2 A;  1XMK A;  3WGI A;  5HDK A;  2VE8 A;  3RDI A;  5IT9 Z;  3O6B B;  2Y48 A;  2DQL A;  2PFB A;  3MCZ A;  1G4D A;  2KIM A;  1ZHF A;  3KFW X;  4M73 A;  2IPQ X;  3REO A;  4M72 A;  2K4J A;  1ON2 A;  3T0Y A;  4OIN F;  1XSX A;  2LKP A;  2OD5 A;  4Q4Z F;  1D8K A;  1SD6 A;  4AIK A;  5H20 A;  2PN6 A;  1G3T A;  2ZFW A;  4G94 A;  1T39 A;  1F1Z A;  1CF7 B;  3GLX A;  2ZKZ A;  1O3Q A;  4WCG A;  4JK1 X;  5DUI A;  3WTV C;  5D5W B;  3WTW C;  3S2W A;  5H6R A;  1SFU A;  1XDU A;  1IF1 A;  5L3F A;  1YO5 C;  2OZ6 A;  4L5J A;  1KA8 A;  1ZGJ A;  4EV0 A;  2W24 A;  1K6O A;  4K2E A;  2HDC A;  2NNY A;  3CUO A;  2V9V A;  2GWR A;  4P9U A;  1PP8 F;  3GF2 A;  5ILV A;  3GFL A;  5AON A;  3GXO A;  2V1X A;  2LDU A;  4ENJ A;  1IXC A;  2OA4 A;  2ZNZ A;  3MQ0 A;  1UHM A;  3QPH A;  2ELH A;  5LGU A;  5BMZ A;  4D0P A;  4YFK F;  3E5Q A;  3K9T A;  4IPA A;  4XLN F;  5E8I A;  4HX8 A;  1IAW A;  4WF2 A;  4OIO F;  1HXD A;  5J8C A;  2PEX A;  2E1C A;  3N4M A;  3FMR A;  1OYI A;  2J5P A;  2IRF G;  2MH9 A;  3BJA A;  3WTY C;  1YQA A;  3BP8 A;  5E20 A;  3IHU A;  1D8J A;  1QPM A;  2F5E A;  5ICF A;  1MGT A;  1MD0 A;  1T38 A;  4HAM A;  3EDP A;  1NHA A;  5HS9 A;  5FFZ A;  1R5G A;  4G7O F;  3P9K A;  1CF7 A;  3E6B A;  4MEY F;  3ELK A;  2JRT A;  4AIJ A;  1SMY F;  5CLS A;  3I59 A;  1K79 A;  2DO7 A;  5CYV A;  2LF8 A;  2DT5 A;  1AWC A;  1GXP A;  4MQV A;  2H6B A;  3F72 A;  2X0L A;  4KN7 X;  4UXN A;  1IW7 F;  5D8L B;  4OIR F;  1TQM A;  4O5V A;  2VON A;  4XLP F;  2PJP A;  1FPQ A;  2A69 F;  3ZMV A;  5JFR A;  3VOD A;  4ETS A;  2XUB A;  2ESH A;  2HKO A;  3JSP A;  1U8R A;  3SXY A;  1LDD A;  1JHH A;  2FE3 A;  2BYV E;  3KZY A;  3DV8 A;  2BEO A;  1U6G A;  1TNS A;  2FRH A;  2ETH A;  4RB0 A;  4Z2Y A;  4UUV A;  5E1W A;  3FXU A;  2VT3 A;  4S05 A;  4ASN A;  4OMZ A;  2YX7 A;  2DU9 A;  1YW8 A;  3F6V A;  2PLY A;  3ZMU A;  3HSF A;  1YW7 A;  4L9J A;  1FT9 A;  1W7P D;  3E5X A;  4A0Y A;  5LGT A;  4EJO A;  4RS8 A;  2IA2 A;  5L3G A;  3TQN A;  5LHG A;  2M87 A;  2F2E A;  1U2W A;  4GYI A;  2Q0O A;  1R5H A;  3F8M A;  1P2F A;  1ULY A;  2EJR A;  1ZLK A;  3VB2 A;  4NQW A;  2FXA A;  2VC1 A;  3ML6 A;  5FFX A;  3EET A;  4XSZ F;  1O3R A;  1QZZ A;  2KRF A;  2RN7 A;  1Y0U A;  3PQK A;  4PZJ A;  5JHU A;  2H94 A;  3QOP A;  1UB9 A;  4U88 A;  3BJO A;  4I98 B;  1KU9 A;  3ISP A;  4I2O A;  3BPX A;  3RKY A;  4Q47 A;  2GQQ A;  5CVJ A;  2A5Y B;  4HYE A;  1OMI A;  3DPL C;  2XAJ A;  3GZ6 A;  2STW A;  3B02 A;  2FQ3 A;  2MH2 A;  5E1X A;  5A2Q K;  1BI1 A;  2K7L A;  2E7X A;  1W5T A;  2HGC A;  2LSO A;  1ON1 A;  2UZK A;  3R60 A;  2XAS A;  3E6D A;  1R1U A;  1I1G A;  1BI3 A;  1ZAO A;  3HHG A;  3Q9S A;  3SHF A;  4N0B A;  4KMF A;  4LJZ F;  3GFM A;  1W4M A;  3P7N A;  2YX4 A;  4IVN A;  2ADU A;  4ESB A;  2M5W A;  5BS6 A;  3N97 A;  2Z5U A;  2FA5 A;  3ZMZ A;  3WTT C;  1HBX G;  3J81 Z;  3J80 Z;  2V6C A;  1S3J A;  2LF7 A;  3NRV A;  3TO9 A;  4KIB A;  2EFW A;  4E70 A;  4RGU A;  3KLO A;  3TOB A;  3J7A O;  2IW5 A;  5DDG A;  4HA8 A;  3V4G A;  2CSO A;  5BPI A;  1J59 A;  4HQM A;  3DPT A;  2FNP A;  5H6Q A;  6PAX A;  2RDP A;  2UXN A;  4EMS A;  1XN7 A;  3QU6 A;  1KU2 A;  1Q1H A;  1A04 A;  3RPQ A;  3F8B A;  4IXA A;  1XCB A;  4Q5S F;  4XBF A;  4ENK A;  1BI2 A;  4ZYG A;  3GYH X;  1ZN2 A;  4FX4 A;  4WXH A;  3F21 A;  4LGW A;  1FBS A;  4I01 A;  5BPD A;  3L9F A;  2FF4 A;  1YTY A;  1U5T C;  4AD9 A;  2CWE A;  2NYX A;  2HTS A;  2K86 A;  4R1H A;  2C6Y A;  2AS5 F;  5LRR A;  4L0Z B;  2ACJ A;  3ABT A;  2VBY A;  4EM0 B;  1USS A;  4KUM A;  1MDM B;  4G8X A;  4OIP F;  1UCR A;  1PUE E;  4HZF A;  1EH7 A;  4I0A A;  4KDP A;  3M1E A;  4IJA A;  4YG2 F;  2CO5 A;  4MHG A;  4BAY A;  1YIO A;  2X4H A;  1D3Y A;  4P5O A;  2P5V A;  4IRH A;  2QVO A;  3H92 A;  2YR2 A;  2OQG A;  3LQR A;  4LB6 B;  3TDZ C;  1LEB A;  1MJA A;  2PMH A;  2BBY A;  2JTV A;  2PQ8 A;  4LK0 F;  4N9H A;  4LB5 A;  4AWX B;  1G3Y A;  1JXS A;  1GXQ A;  2GAU A;  3MFK A;  2COM A;  3JTH A;  4ZZL A;  4YFX F;  3ECH A;  2HYG D;  4HF2 A;  3GVA A;  2WV0 A;  3WTS C;  1RIO H;  4I09 A;  1AOY A;  1YFH A;  1G6N A;  3KCC A;  2V1U A;  3C3W A;  5TRD A;  1RUO A;  1DPU A;  2QWW A;  3WU0 A;  3U9G A;  5LRS A;  1XDS A;  5E18 F;  4CZZ A;  4U0Y A;  1JGS A;  1YYV A;  4BHB A;  2ZXJ A;  2RVC A;  3D0S A;  3FHZ A;  2H27 A;  2EA2 A;  3KLN A;  1QBJ A;  1XGN A;  3R0J A;  3CLO A;  5HOO A;  2G7H A;  2DAO A;  1ODD A;  3BJ6 A;  2W25 A;  4TV7 A;  1P4X A;  2PG4 A;  2FML A;  2MD5 A;  3FM5 A;  3ROU A;  1XB4 A;  5DYM A;  3Q9V A;  1MDM A;  3FMQ A;  3T8T A;  1FP2 A;  1YG2 A;  2O3F A;  3WGH A;  2K4B A;  1J75 A;  3Q5F A;  4LLG F;  3I59 B;  4L18 B;  1XSD A;  1KU7 A;  3HOT A;  1O7L A;  4FHT A;  4RGS A;  4EGY A;  1TTY A;  2L02 A;  3LST A;  5D4R A;  3E5U A;  3ZQ7 A;  2HWV A;  2OQR A;  3F23 A;  1P92 A;  4A6D A;  1T2K A;  4L9T A;  1ZG3 A;  1IN8 A;  3WE2 A;  5CVI A;  3FF5 A;  2P6S A;  3K1P A;  4ESF A;  1O3T A;  1TBX A;  4P55 A;  2NNN A;  4KNY A;  4RB1 A;  1J7K A;  1TNT A;  3RJP A;  2XAH A;  4EJU A;  2TDX A;  4U7B A;  2ESN A;  3QP5 A;  5ED4 A;  2DPD A;  4JBA A;  5HLI A;  2GXG A;  4BH9 A;  3F22 A;  2L4M A;  1FBQ A;  2XRO A;  4EVI A;  2PI0 A;  2B0L A;  3CUQ C;  1J5Y A;  2EFN A;  3NEU A;  2ZME A;  4BHC A;  1B4A A;  3KEQ A;  4CXF A;  4LG0 B;  3MZH A;  2VOO A;  1U5T A;  1ZRC A;  5L3E A;  1BI0 A;  4UHT A;  4A0X A;  4AIH A;  3GO5 A;  4WXC A;  4EJW A;  4ZZD A;  1RNL A;  1E17 A;  3JTG A;  1TW2 A;  3FX3 A;  2CW0 F;  2QQ9 A;  5ERI A;  1IXS B;  1YW9 A;  3K2Z A;  3ZN1 A;  3B73 A;  2JSC A;  2O61 A;  4RGR A;  1HKT A;  1KYZ A;  3LA3 A;  5FO5 A;  4WXD A;  3D5L A;  2YU3 A;  3W6J B;  1XGO A;  3GFI A;  5FLX Z;  5EEG A;  3E3V A;  4EJT A;  2P6T A;  5E1Z B;  2K02 A;  2MLG A;  2MC3 A;  3BY6 A;  2P5K A;  5DD4 A;  5BQT A;  2O0Y A;  1DDN A;  4ENN A;  2A68 F;  1ZG1 A;  2BE5 F;  2ZBK A;  4KIF A;  1HKS A;  3IKV A;  1Z6T A;  2M45 A;  3KEO A;  4U0W A;  3T8R A;  3I53 A;  1E2X A;  4OIQ F;  1XD7 A;  3C1D A;  1IZ1 A;  3BOQ A;  4HLY A;  3LAJ A;  1QNT A;  1STZ A;  3H3U A;  5CVV A;  3CUQ B;  4YIF A;  3G73 A;  1B9N A;  3OOP A;  2DQR A;  2IVM A;  1BC8 C;  3IKT A;  1B9M A;  4LG0 A;  2DI3 A;  4CDG A;  4HDV A;  5D5X B;  4S04 A;  3GEZ A;  2KIF A;  4MEX F;  1EH6 A;  2RKH A;  3HYI A;  4FX0 A;  2QQB A;  2MBF A;  1U3E M;  5LEK A;  1RZ4 A;  2F5F A;  2XRN A;  4GGG A;  4CGZ A;  2R7F A;  1YS7 A;  4CO8 A;  1P4W A;  3GFJ A;  2HTJ A;  1L3L A;  1ZRD A;  3IWF A;  1P6R A;  1C0W A;  3WTX C;  3SZP A;  4AVP A;  1FX7 A;  2RV8 A;  3ZN0 A;  2FU4 A;  4BHP A;  3VOE A;  1K7A A;  2W84 A;  1LDJ A;  4Y17 A;  1T0F A;  2QM3 A;  1YS6 A;  3SQN A;  2H09 A;  3JAM K;  1EH8 A;  4HLX A;  4RGX A;  3JSO A;  2Z33 A;  2QBY A;  1REP C;  2XAF A;  1XGS A;  5AIQ A;  4WWC A;  3RYR A;  3R4K A;  3EQL F;  4WK8 F;  1ONV A;  5J8F A;  1MJB A;  4P9F A;  2F5D A;  2KIU A;  2XAQ A;  2F5C A;  3KP3 A;  3I71 A;  1SD5 A;  3CDH A;  4P96 A;  4A5N A;  4LD5 A;  2A61 A;  3CUQ A;  1GVJ A;  1MKM A;  3BDD A;  5K5R A;  3V7C A;  4Y13 A;  2NRA C;  3KE2 A;  4ZH4 F;  2GZW A;  3GWZ A;  4PCQ A;  3QPT A;  4MQ9 F;  5E8G A;  2IJL A;  3I0T A;  4M9Z A;  2HEO A;  1UHW A;  2QYO A;  3DQV C;  4GO1 A;  1J2X A;  4O3M A;  1HSJ A;  2DBB A;  4ON0 A;  2A6H F;  1K78 B;  1R1V A;  4I0B A;  5HLH A;  1RUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...