1D8JA

Solution structure of the central core domain of tfiie beta
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
81
structure length
81
Chain Sequence
ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
total genus 23
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02186 TFIIE_beta TFIIE beta subunit core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1d8jA00
4N9HA 1HSTA 3NRVA 1JHFA 1BOAA 4LK0F 4BHBA 2YX7A 5E8GA 1BI1A 1Y0UA 1SMTA 1IN5A 1KA8A 2BBYA 2MD5A 1K78B 1IZ1A 3K1NA 1J2XA 1G3SA 3M8EA 3IWFA 1XMKA 4HZFA 3LAPA 3JSPA 1XGMA 3QPTA 2ESHA 3WTTC 1XSDA 4I0BA 3LWFA 2W85A 1QZZA 4PZJA 1K78A 1DPUA 2ZO4A 3GXOA 1O3TA 4HF1A 4PCQA 4LK1F 3TDUC 2VC0A 1ZH5A 4GXOA 1REPC 2UXNA 3ULQB 5BPDA 1LVAA 1PP7U 2O61A 2D45A 3BP8A 4ZYHA 1J0RA 3CUQA 2HR3A 2HEOA 1D8KA 2NYXA 2UXXA 1XN7A 3ELKA 3K2ZA 2WC2A 4MTEA 2RQPA 3FXUA 3LA7A 4O5VA 3CUQB 4IPAA 4CYDA 5H6QA 2V1XA 2ISZA 2J5PA 4WK8F 4BH9A 1ZRDA 3WU0A 3WTYC 3HOSA 3FXQA 2R7FA 5ILVA 1UFMA 3H3ZA 1P92A 2FU4A 3MZHA 1ULYA 2JRTA 2X4HA 4UHTA 3L7WA 4UNOA 2EV6A 2P6TA 4EJTA 2EFWA 5DCMA 1TW3A 4Y15A 2HGCA 3U1DA 1KYZA 2FMYA 4G7HF 2Z5UA 1R5HA 2M87A 1KQ0A 1G6NA 4G7ZF 3J81K 2RV8A 3R0AA 3ISPA 5FGMA 5HLIA 5LBQA 2Z33A 3F8NA 4AVPA 4L9NA 3ERED 1FZPB 3BJOA 2DAOA 4I2OA 3MFKA 2DQRA 3HTUA 3I71A 3FMQA 5ILSA 2IPQX 2DPDA 4M74A 3IRRA 1OYIA 4IXAA 4JBAA 5K5OA 4HYEA 3EDPA 3F72A 3C18A 1ZGAA 5BQTA 4D0PA 1ZYRF 4ASNA 4WWCA 3CTAA 3VOEA 3ZMVA 3T0YA 1O3SA 2M8EA 3EQLF 1TQPA 2ESNA 4GGGA 1SD4A 2XRNA 2MLGA 4A0XA 1W7PA 2IA2A 2ZXJA 2QWWA 4RB0A 4EGYA 1WWXA 2A68F 5H6RA 4O3MA 4A0ZA 1R00A 2IT0A 5AIPA 2PN6A 2PEXA 1WRJA 3BDDA 2XAQA 4U88A 4HA8A 3N97A 3B02A 2P5LC 5FO5A 2JZYA 3F8CA 4FX4A 3KP3A 1O7FA 1ZRFA 2E1NA 3TO9A 4MGRA 4A6DA 2VBZA 3G73A 2HKOA 1FPQA 4KFCA 1OYYA 3CO6C 1IN7A 5LGNA 1AOYA 4U0WA 4IF4A 2IA1A 2VBYA 2ADUA 2MH9A 2LSOA 3LFKA 4RS8A 3O2PE 3FX3A 3GUDA 4EM1A 3H3UA 1UHWA 2BGCA 2BE5F 1TTYA 2G7HA 4PGGA 1OMIA 3TGNA 1GHCA 2VXZA 4HLXA 4Q48A 2H6BA 1E17A 2W25A 1B6AA 2ISYA 1GXQA 4XRFA 4EV0A 1LDDA 3TO6A 4QWQA 5ICCA 1WI9A 5HS8A 1YQAA 2EA2A 2G9WA 1R1VA 1ZLJA 5F6FA 3HIFA 5HS7A 4G7OF 3GFLA 3D5LA 4RAZA 3WTUC 1SD5A 3O3KA 5FLXZ 4H0EA 1LNWA 5JI6A 2W84A 2QENA 2XUBA 1IRGA 2CSOA 2XGXA 5JR3A 5D4RA 3L09A 1TQIA 3G3ZA 1IUYA 2PMUA 2VBXA 1JHHA 3QP5A 1T38A 4IVNA 5FD5A 5D8KB 4P96A 2K86A 4ZYGA 2A6EF 1ZGJA 2FMLA 4HDUA 5LHGA 4MTDA 2D2WA 2XROA 4YFKF 1J5YA 4AD9A 2EV5A 3NQOA 3R0JA 4RB3C 2Y48A 4F7ZA 5HLGA 3QAHA 2PI0A 3CLOA 2O03A 4HLYA 2DTRA 1NHAA 1XGSA 2H6CA 3WG9A 3VFZA 2A3SA 4M71A 3ROUA 2NNNA 3F6VA 4A6EA 3OV8A 1P4AA 5BOXA 5HVQC 1JE8A 2RVCA 4I7HA 1IXCA 4WXHA 3V7RA 3MCZA 2CW0F 2DLLA 3FXRA 3PQJA 4K2EA 3ABTA 4G6QA 1O57A 3GX4X 2ETHA 1B59A 1U5TA 5D8LB 4WXDA 3ECHA 2FOKA 4KIGA 3DQVC 3WE3A 2VT3A 4HBLA 3QP6A 2L54A 4N0BA 3CDHA 4ZYEA 3H92A 1R5GA 2ZFWA 2CWEA 3JTHA 5DV5A 2F5CA 3MQ0A 3GVAA 1XCBA 2FNPA 1QZYA 3BPXA 2DBBA 4L0YB 3DKWA 3GF2A 1FYMA 2XHKA 1S8NA 3QU6A 4CHUA 2HDCA 1W5TA 4G8XA 1I27A 4OIQF 3ZMUA 1RUOA 2VE8A 3F22A 4KDPA 4HF2A 4NHJA 3GFIA 3KE2A 1D3YA 1QQIA 1O3RA 3TQNA 2CFXA 2FQ3A 5K5QA 5IT9Z 1KYWA 4LD5A 3DPTA 3BZ6A 2PLYA 5DDGA 4R79A 2HWVA 2RDPA 3FHZA 5CVUA 3E5XA 4IHSA 4IRHA 2DQLA 3EYIA 3SZTA 1ZG3A 1ZREA 2XIGA 4KT5C 5E18F 3V8KA 3E5UA 1F1ZA 2A5YB 1OPCA 2L3DA 5D6EA 5DUIA 1MJAA 2EK5A 3C3WA 4UVCA 1BM9A 2GQQA 4YIFA 5LEKA 1B9MA 3U2RA 1BC8C 3KCCA 3KP5A 4LLLA 1ZHFA 1Z9CA 1BIBA 2GXBA 3MEXA 4UXNA 2O3FA 4ESBA 5LHIA 1AWCA 3MAJA 5EEHA 2STWA 1ODDA 5CJ9A 3VODA 5JFRA 4XSZF 3HRMA 2JTVA 1YLFA 1W7PB 4A5MA 2IP2A 5KK1A 4EJWA 5ED4A 1XD7A 2RKHA 5CLSA 2M1BA 4LFUA 1YG2A 2W24A 1W5SA 3IHUA 2ELHA 1GVJA 4S04A 4XSXF 2UWMA 4PDKA 1YS7A 3COAC 3RPUA 3KZZA 5E1ZB 2KRFA 5K5RA 2VOOA 3IKVA 1XB4A 2OU2A 3WU1B 1DDNA 3T8TA 3D0SA 1X3UA 5TJJA 1V4RA 4XBFA 2PQ8A 5K1YA 2WTEA 3GZ6A 2C6YA 1F5TA 5ICFA 1T6SA 1Z6RA 4XLPF 1SD7A 4I09A 1P4WA 2G7UA 2V6CA 4O6JA 2KJCA 1FP2A 2TDXA 4TV7A 4ENNA 2MH2A 4OIOF 1Z1DA 1IN8A 3R6SA 4DQ2A 1XCVA 3BY6A 3WODF 2R7DA 4M72A 1IRFA 1MKMA 1S3JA 3JTGA 2DPUA 1V3FA 4ZYDA 1SFEA 5D5UB 2QQBA 2VONA 4BQAA 1BBYA 1FLIA 3C1DA 4MEYF 1U78A 2AS5F 4BXUA 2CYYA 3JAMK 1RZ4A 1KGSA 3B73A 3E6MA 2BEOA 4ETSA 3TOAA 4Q4ZF 2CGPA 1YIOA 2MLKA 4MHGA 4L18B 1D8JA 3HYIA 3RKXA 2XVCA 4I01A 1F9NA 3KETA 3BJAA 3L00A 5A2QZ 3KLNA 2B0LA 2EFQA 2PG4A 3M7GA 5LHHA 3HSEA 2BV6A 3HSFA 1R36A 1R22A 4E70A 2XKPA 4RGRA 4AWXB 2OD5A 1USTA 1T98A 3BJ6A 3HHHA 1MDMA 4RGUA 5BPIA 3I53A 2UZKA 1IW7F 4MNUA 4KMFA 1B4AA 1BI3A 5DCMB 1B9NA 2VT2A 1F4KA 1OR7A 1HKQA 3I58A 1XSVA 2E7XA 2NNYA 3HSRA 3J80Z 1H9TA 1HKSA 2J5OA 3GWZA 1OKRA 2P5KA 4I0AA 3KEQA 3P7NA 4YG2F 1QGPA 2V1UA 4L5JA 1G3TA 3FF5A 2H27A 3TDZC 2K7LA 2COMA 2ZMEB 1GXPA 3T8RA 2LDUA 1PP8F 4WF2A 4A0YA 3KP2A 2P6SA 2LKPA 1RIOH 5L3CA 2FSWA 2VODA 3BOQA 2WV0A 1ZG1A 1BC7C 3W6JB 3HUGA 2ZMEA 3SFZA 5FD6A 3IL2A 1G3YA 4KUMA 1S7AA 3F3XA 1HXDA 4YFNF 1MJBA 4LLNA 2PMHA 4GO1A 4JK1X 5ERIA 2O0YA 3HOTA 4HX4A 5FLXK 4U7DA 4ZZDA 2Q2EA 2QUFA 5E1XA 4EJUA 2EV0A 5AIQA 4LG0A 4L9JA 2ZCWA 2IA0A 1G4DA 5KVRA 1YFHA 1T39A 5HDNA 1SFXA 5L3GA 4R8HA 2FBIA 2CO5A 2JSCA 2ZJ2A 3QU3A 3ZN1A 5DD8A 1S7OA 1ZLKA 1FP1D 3FMRA 1LQ1A 5FB2A 3OOPA 4OMZA 1FBUA 2Y75A 1P6RA 4FX0A 2OQGA 5A2QK 2H94A 2A07F 3M9AA 3QPHA 3C7JA 1K6OA 2LF8A 1YW7A 4M6XA 4AIHA 5ICEA 4HQMA 2MBFA 1J75A 2IW5A 5E8IA 4M9XA 3N4MA 3KP7A 3T1BA 5LLQA 3LA3A 3WE2A 1R1TA 3SHFA 4OINF 1BI0A 3WTWC 5HS9A 1U3EM 3V4GA 4OU0A 2HTSA 2K27A 2DK5A 2P7CB 5CYVA 4LB5A 3ZP5A 5BMZA 4KNYA 1EH7A 3ECOA 3ZPLA 4A2UA 2CQKA 1YW8A 2LF7A 4RB2C 2OZ6A 1DPRA 5HOOA 2Z99A 3F8FA 4XLNF 1FSEA 3BPVA 1K79A 3WTXC 2DO7A 4KMUX 1YW9A 1CGPA 2FA5A 3GEZA 5E1WA 2VN2A 4HW0A 1YYVA 2RC4A 1J9IA 3LAJA 2A61A 4HQEA 5DYMA 1KQ8A 3U9GA 1S29A 4EGZA 5HDGA 1LEAA 3GFJA 1H0MA 4UUVA 1H9GA 3J80K 2IJLA 3EYYA 5DD4A 3V7SA 2D1VA 4P5OA 4CGZA 3WTSC 2QZ8A 4ENJA 2L4MA 2ZNZA 2JT1A 1FY7A 4BHCA 4PGHA 1RNLA 3K1MA 3V8JA 1EH6A 3FM5A 2HFHA 4CICA 3L9FA 4M9SA 1XSXA 2KIMA 1E2XA 1HSJA 1PUEE 1ZARA 2YX4A 4IRGA 4IRIA 3QRFF 4RAYA 5ILUA 4ZH4F 4A5NA 3HTSB 4U0VA 2L02A 2XAFA 3BWGA 1U6GA 3KP6A 1HQCA 1ZG5A 3RKWA 3FZVA 1ON1A 1USSA 3F23A 2A6HF 2P8TA 4CXFA 4DNCA 2W57A 4NB5A 2EFOA 1D5VA 2MC3A 2QBYA 5JHUA 1J7KA 1Z05A 4EVIA 4UVAA 2YPRA 2VC1A 3KEOA 2HZTA 1WQ2A 1XMAA 3MWMA 2F5FA 2ACJA 4HOBA 3P9KA 1LDKB 4EM0B 3E6CC 2L01A 1LDJA 3P9IA 3TO7A 1RI7A 3WGGA 2E7WA 4KIFA 4U0YA 2FEZA 4EMSA 3GLXA 1HKTA 1Z7UA 4IHTA 4BYYA 3I4PA 4AIKA 3CJNA 4L9VA 3E97A 4ON0A 3VEPA 2XASA 4ZZLA 2F2EA 2QM3A 1R7JA 5J8FA 4KN4X 2FF4A 4G6DA 1O7LA 4BNCA 1TNSA 4L5IA 5D5XB 2EWNA 2QYOA 5J8CA 1T0FA 3K0LA 2DFIA 5D5VB 4WX9A 1I5ZA 1MDMB 1O3QA 3I59B 4LGWA 2LNBA 4IJAA 2MA3A 2NAZA 5D5WB 3HRSA 3ZN0A 2GWRA 2VE9A 2XAGA 2ZBKA 4YFXF 3O6BB 3VB2A 4RGSA 1LB2A 4Z2YA 1U5TC 3DV8A 4KA4A 2JPCA 1QNTA 3F21A 2DW4A 2P7VB 3KZYA 3M1EA 5HLHA 1YTYA 2R3SA 2KIFA 2OQRA 4EM2A 1FBQA 1DUXC 4I02A 2VBWA 4GYGA 2EA4A 3WTZA 3J7AO 2KIUA 3I64A 1YS6A 2WWYA 2XKOA 1U8RA 2XV4S 4S05A 4B8XA 2JPBA 3P9CA 1KU2A 2XAJA 3LA2A 2FBHA 4M73A 1U5TB 3PQKA 2M30A 1R23A 1SFUA 2X0LA 2DT5A 1P2FA 3E5QA 5E20A 1FBSA 4Y17A 1ON2A 3S2WA 1VTNC 2GA1A 1FYKA 1FNNA 3M8FA 2HYFA 1IF1A 5F1RA 4Q47A 1MJ9A 3HHGA 3IKTA 2XAHA 1J59A 1U2WA 1XDUA 1SAXA 2QBYB 1S6LA 1BIAA 4EJOA 1FC3A 3GO5A 6PAXA 5HDKA 2V79A 5LRRA 4MEXF 1FYLA 2FBKA 3TOBA 5LGUA 2IVMA 4BAYA 3RJPA 4FHTA 2QQAA 4WCGA 1TBXA 1TLHB 1HW2A 2EB7A 4RGXA 3ZMDA 4P55A 5L3BA 4B09A 3RDIA 2Y0MA 1HBXG 3ML6A 4HV5A 3F8BA 1EV7A 4LG0B 2EFNA 4KIBA 5D4SA 4HX8A 2H09A 1CF7B 1I6XA 2Z9OA 1OYWA 2HTJA 4OOIA 3ABUA 3DEUA 2D1HA 3GW2A 5ICGA 2HQRA 3K69A 4HF0A 4ESJA 2KJBA 5L3EA 2DI3A 4WXCA 4HV6A 4G9YA 4CZZA 4EQQA 1XGNA 1K7AA 5J6XA 4M6YA 1A04A 4UVBA 2HKXA 2OA4A 2HS5A 5F64A 4GYIA 2M45A 3RKYA 1FT9A 3KLOA 2F5EA 3QOPA 4LB6B 4YIIA 4GCVA 3EETA 2V9VA 2ZKZA 2HOEA 2HQNA 3DP7A 5D6FA 3T5XA 4I98B 1MD0A 4HDVA 2PFBA 1EH8A 5CVIA 3WGIA 1SD6A 1W4MA 2NS0A 3R4KA 1BI2A 4MQVA 4BHPA 2L4AA 3JAMZ 4N9IA 4MQ9F 1LEBA 1KU7A 3I5UA 1ZAOA 4OIPF 2RNJA 3IC7A 3J81Z 2A69F 4HX7A 3ZMTA 2YSRA 5JVTA 1R58A 4P9UA 2Q0OA 2GIVA 3L2CA 3REOA 3FMSA 1ZRCA 1QPMA 4L0ZB 5DUKA 1IAWA 2AXLA 3FWEA 1HW5A 2BYVE 4UV8A 1L0OC 1IXRC 1T2KA 3WGHA 3V7CA 1WSUA 4A12A 5EEGA 3NEUA 1Z91A 1R1UA 5IT9K 1FX7A 1UHMA 4OIRF 2YU3A 3RPQA 4Q5SF 4ENMA 3I54A 5CVJA 2YR2A 1JGSA 2OZUA 4AIJA 1TNTA 3CUOA 4KYWA 2FE3A 2OAZA 3CUQC 2RGVA 1QBJA 1PDNC 5L3DA 1P4XA 3E6BA 2DU9A 3R60A 5E17F 3ZQ7A 1FWZA 3RI4A 2PJPA 4L9TA 2NRAC 1I1SA 5CVRA 3GZ5A 4RB1A 5H20A 1BN5A 1Z6TA 2FXAA 3DPLC 3ZMZA 1TQMA 2EFPA 4FT8A 2RN7A 2P4WA 1FOKA 3V8LA 3LQQA 5TRDA 4NQWA 5FFXA 4R1HA 3SQNA 3DF8A 2O8XA 3I0TA 5LGTA 3Q5FA 4JQFA 4KICA 1C0WA 2FNAA 3RTRA 3HRTA 5L3FA 2V1DA 4ENKA 5DCFA 2QVOA 3Q9VA 1IN6A 4G94A 4EJVA 2EJRA 1JXSA 5LEJA 4Y13A 1I1GA 2GXGA 3LSTA 1ZN2A 3RYPA 1L3LA 5FFZA 3JSOA 2K4JA 4CO8A 2VOPA 1FSHA 4M9ZA 5AONA 3Q9SA 1DP7P 2QQ9A 3SZPA 3DXJF 2FRHA 1UB9A 3PFIA 1W7PD 2ZNYA 4KN7X 1KQ9A 1XDSA 2P5VA 2GZWA 1G3WA 5LRSA 3FM3A 2PBIA 4HAMA 4UV9A 2QLZA 4LLGF 1BJAA 1HW1A 3LQRA 3SXYA 1ONVA 2O6GE 1CF7A 4QLCU 1SMYF 3W6KB 3F6OA 2Q8KA 3EUHA 3WTVC 1MGTA 2HYGD 2M5WA 3IRQA 3HRUA 2KKOA 4LJZF 2DK8A 2Z3YA 4P9FA 1IXSB 3I59A 3IWZA 3ZMSA 3K1PA 2IRFG 2K02A 3KP4A 1IN4A 4ESFA 3TKYA 1LJ9A 2F5DA 1STZA 2OBPA 3DFGA 3RIRA 3KFWX 1TW2A 3AAFA 2K4BA 3F8MA 3JW4A 3GYHX 3BROA 5IT3A 4LMYA 1YO5C 3E3VA 1Q1HA 3RYRA 4U7BA 3E6DA 5DEQA 3K9TA 2E1CA 4CDGA 1MZBA 1B1BA 5BS6A 1KU9A 3R61A 1KU3A 3MZYA 3GFMA 1RUNA 2STTA 2GAUA 1QO0D 1WKMA 2GA2A 5CVVA 4OMYA 2CG4A 1UCRA 3CO7C 1XGOA
chains in the Genus database with same CATH superfamily
4N9HA 1HSTA 3NRVA 1JHFA 1BOAA 3DU5A 4LK0F 4BHBA 2DA4A 2YX7A 5E8GA 2JSPA 3A2KA 1BI1A 3G1LA 1Y0UA 1SMTA 5B5EC 3H1CA 1IN5A 1KA8A 2BBYA 1SANA 2I5UA 2MD5A 4DYRA 1K78B 3S93A 1IZ1A 2VB6A 1GUUA 1EF4A 1A5JA 3K1NA 4NC6A 1J2XA 1G3SA 2IGMA 3CJTB 2O5RA 3M8EA 2Y30A 2XF6A 3IWFA 1XMKA 4HZFA 3LAPA 4C2UA 3S1QJ 3JSPA 1XGMA 3QPTA 2ESHA 5B66C 3WTTC 1XSDA 2K9MA 1W5CC 4I0BA 5E3LA 2R5ZA 1B72B 3LWFA 5IP9J 2W85A 1UG0A 1QZZA 1MMAA 4PZJA 5J1RA 1K78A 1DPUA 2JRMA 2ZO4A 2ZXHA 3GXOA 1O3TA 4HF1A 2KQRA 4PSWA 4PCQA 4ANJA 4LK1F 3TDUC 2VC0A 1ZH5A 4GXOA 1REPC 3F9KA 2WY8Q 2UXNA 3ULQB 1T08B 5M3MJ 1A36A 5BPDA 1LVAA 3CP2A 1PP7U 2HVSA 2O61A 2D45A 1TL8A 3BP8A 4XLAA 4X1EA 4ZYHA 1JI8A 4XOPA 1J0RA 5GADJ 1ZKGA 3CUQA 2HR3A 2HEOA 3O8GA 1D8KA 2NYXA 2UXXA 4V19K 1XN7A 1VQ6I 3ELKA 3K2ZA 3KZIC 2WC2A 4MTEA 3H5RA 3FXLA 2RQPA 1N25A 3FXUA 2R7WA 3LA7A 1MBEA 4O5VA 4AYBA 4CYCB 3CUQB 3OWTA 4IPAA 1FMVA 4CYDA 3PL8A 3BG3A 2V1XA 5H6QA 1R49A 2CMPA 1Z77A 2J5PA 4WK8F 2ISZA 4A93J 4BH9A 2KRHA 2PMZA 1ZRDA 3WU0A 3WTYC 3HOSA 3KIOA 3FXQA 1XPXA 2R7FA 2IXSA 5ILVA 2L0KA 4PJLA 4C30A 4XKCA 1WJAA 1UFMA 3H3ZA 1U0JA 2R93J 5FLMJ 1P92A 1V5GA 2FU4A 1SVLA 2FQ4A 2VQLA 1ULYA 4C3HJ 3A01B 3ZQQA 2JRTA 3MZHA 1ITYA 3HB9A 1SAUA 3ZRGA 2X4HA 2PJRA 4UHTA 3L7WA 4UNOA 2EV6A 2P6TA 4EJTA 2EZHA 2EFWA 1Y1WJ 2ME0A 1MNMC 5DCMA 1TW3A 4Y15A 1TT5B 1RR8C 2HGCA 3U1DA 1KYZA 2FMYA 2YUSA 4DJAA 4G7HF 2VLAA 1PVEA 3LSJA 4A3BJ 2XB0X 2Z5UA 4ZYAA 1R5HA 2DJIA 3CJQB 4II2A 2M87A 4AVZA 1KQ0A 4A3CJ 2DTZA 2VI6A 4I6ZA 2F5VA 3GTJJ 1G6NA 4G7ZF 2DYRH 2RV8A 3J81K 3OYKA 4E6KG 5M5WJ 1UZCA 4B4CA 4NDLA 4E7JA 2DFFA 2VQHA 3ISPA 3R0AA 2CU7A 5FGMA 5HLIA 5LBQA 2Z33A 1ZQ3P 3F8NA 4AUXA 1NG7A 4AVPA 4L9NA 3ERED 1FZPB 4U87A 3S16J 3BJOA 2DAOA 4I2OA 3MFKA 1H88C 4XLFA 3H3VK 4RM2A 2VQCA 1U9OA 2DQRA 2HQ5A 2KP6A 3FMQA 3HTUA 3I71A 5ILSA 2IPQX 4LITA 2LVSA 2DPDA 4M74A 3IRRA 1OYIA 4IXAA 4JBAA 5K5OA 4HYEA 3EDPA 3F72A 2BZTA 3C18A 3CMAI 1ZGAA 3OYAA 2R5YB 5IYCJ 5BQTA 4D0PA 1AKHB 2ZSIB 2QGUA 3GTLJ 2DOAA 1ZYRF 4BEHB 4ASNA 4WWCA 3CCEI 1I3QJ 3CTAA 3VOEA 3ZMVA 3T0YA 1O3SA 2HDDA 3SEZA 2M8EA 3EQLF 1GDTA 1TQPA 2M0CA 2VKEA 2ESNA 3G1MA 1SD4A 2PMZN 4GGGA 2F6CA 4YIRX 2XRNA 2MLGA 2XGEA 3CCVI 4A0XA 1W7PA 2IA2A 3I4MJ 2ZXJA 2QWWA 2IEKA 4RB0A 3S1RJ 4EGYA 1WWXA 1AKHA 2H8WA 3ABMH 2A68F 3IAM2 2OJED 5H6RA 2Y9ZA 4O3MA 4A0ZA 3ZQGA 2E71A 4UUTA 1PJRA 3FKIJ 3LOCA 1R00A 1PUFA 2ZFUA 2IT0A 3IUOA 1DP3A 4KISA 5AIPA 2PN6A 4KT6A 2PEXA 3ZOBA 1ETYA 2E1OA 3K4BA 3HOUJ 1WRJA 2JK3A 3BDDA 3HKZA 4CH7A 2XAQA 4U88A 4HA8A 3N97A 3B02A 2BXZA 3DTEA 2K3PA 5FO5A 2P5LC 1DGWY 2L9NA 3FBNB 1D0YA 2JZYA 5EZHA 3F8CA 4FX4A 3KP3A 2ZC2A 3C2GA 1O7FA 1X3ZB 1ZRFA 4NUBA 4XR6A 2DA1A 2E1NA 4OWRB 1IRXA 3TO9A 3VSKA 4BJTA 4MGRA 1QA6A 4A6DA 2VBZA 1BJZA 3G73A 2HKOA 1FPQA 1OYYA 1OCZH 4KFCA 3E0JB 3CO6C 1IN7A 3DBLB 1ORKA 2E1MC 5LGNA 3ZCOA 1AOYA 4U0WA 3BQYA 2QSFX 4IF4A 2IA1A 5IYBJ 4MLOA 3BR2A 2VBYA 2ADUA 2MH9A 2LSOA 2IS4A 3LFKA 1ETWA 4OAYA 4RS8A 4Y4RA 5HODA 3BG6A 1QZEA 1TT0A 3FX3A 3GUDA 3O2PE 4EM1A 3H3UA 3S3NA 1AU7A 1FOXA 2VPRA 4M3GA 1UHWA 3OYJA 3FDYA 2BGCA 2BE5F 3M4OJ 1TTYA 2G7HA 1FIPA 1RKWA 1T95A 1VQ9I 4PGGA 1OMIA 2KL4A 5DTDA 2KDZA 3AL0C 3MKYB 3TGNA 4JP0A 1GHCA 2VXZA 4HLXA 4Q48A 2H6BA 1E17A 1QVUA 2X6YA 3H9JA 2W25A 4PJMA 1B6AA 2ISYA 1GXQA 2L5QA 3DEWA 4XRFA 4EV0A 1LDDA 3TO6A 4QWQA 5ICCA 1FEXA 1WI9A 3HKZN 2DA2A 3ZQCA 1XMXA 5HS8A 2CJJA 1YQAA 2EA2A 5C44J 1Y0NA 1YE9A 2G9WA 5CKTA 1YIJI 1R1VA 1ZLJA 5F6FA 1HDPA 3HIFA 5HS7A 4A3IJ 4G7OF 3GFLA 3E1SA 3D5LA 4RAZA 3WTUC 3BQZA 1SD5A 3GBGA 3O3KA 5FLXZ 4H0EA 4EATA 2LKSA 1LNWA 3DLAA 4F3QA 4PJNA 5JI6A 3PSIA 2W84A 1MNEA 3K6GA 2QENA 5TISC 1N78A 2XUBA 2X85A 1OCPA 1IRGA 2CSOA 3QYBA 2XGXA 4PFOA 5JR3A 3BC8A 5D4RA 5GTHC 3L09A 1TQIA 4BQOA 4D7MA 3G3ZA 3H0DA 1IUYA 2PMUA 3ZXSA 3KPHA 2MW8A 1X2NA 4MO7A 4BDZA 3DCFA 4E4HA 2VBXA 5KNLA 1JHHA 3QP5A 4IVNA 5FD5A 1T38A 5D8KB 1E3OC 4P96A 3I56I 2DCEA 2K86A 4ZYGA 2F4IA 4PJ0C 2BXYA 2A6EF 4BKXA 2DA5A 4CCKA 3TBIA 2H1LA 3S8PA 5HLTA 1ZGJA 2FMLA 4HDUA 1S7EA 5LHGA 4DOZA 2HOTA 4E7SA 3SZGA 4MTDA 2D2WA 5DM6F 2XROA 3GTQJ 4YFKF 1J5YA 2EZIA 4AD9A 2EV5A 3NQOA 2IBDA 3R0JA 3M1CA 4CSWA 4RB3C 2MABA 1Z21A 4XN0A 2Y48A 4F7ZA 5HLGA 3QAHA 2PI0A 3CLOA 2O03A 2WB1A 4HLYA 2DTRA 1VQKI 2LR8A 1NHAA 2JWTA 4FE4A 2E5NA 4B47A 4HNVA 1XGSA 2K85A 2H6CA 3WG9A 3CCQI 3VFZA 2A3SA 1VFCA 4M71A 3ROUA 3JRHA 1GT0C 2CW8A 1R5ID 3LSGA 2NNNA 3F6VA 4RMNA 3SEQA 2OC6A 1MMDA 4CCLA 1APLC 4A6EA 3OV8A 3H5NA 1P4AA 2VPLA 2JA5J 3U1KA 5BOXA 3IP4B 5HVQC 1LFPA 1E0EA 1JE8A 2WAFA 3A0HC 2XSJC 2RVCA 2QKLB 5E3MA 3PUBA 4I7HA 2CW7A 2BY3A 4I76A 1IXCA 4WXHA 3V7RA 1VF9A 2BOLA 2OCCH 2UV1A 3D5SC 3MCZA 1X4PA 2CW0F 2DLLA 3FXRA 2ID6A 1MSFC 2A05A 2HYJA 3PQJA 1YRNA 4K2EA 3ABTA 4G6QA 1O57A 2DOFA 3GX4X 2FD5A 2EBIA 3ZQHA 1ETQA 2ETHA 1MMNA 2DA7A 4B43A 1ZR4A 3CQZJ 3CCLI 2BHZA 1B59A 1U5TA 5D8LB 4Y3OA 2D5VA 1BW5A 4WXDA 3ECHA 3M07A 2FOKA 4KIGA 3DQVC 1RESA 3JRDA 3WE3A 3OYCA 2VT3A 4XONA 3CP8A 4HBLA 3QP6A 2QA4I 1VQLI 5KCMA 2L54A 2WAQA 4N0BA 3CDHA 4ZDPA 4RAGA 4ZYEA 3H92A 2AQEA 2X1EA 4V2GA 1R5GA 1PYVA 1TWFJ 2ZFWA 2CWEA 2ZMEC 3JTHA 4A3KJ 4BQQA 1RR7A 5DV5A 1KONA 1SFOJ 2F5CA 3S3OA 1FTTA 4BQNA 3MQ0A 2DFEA 3GVAA 1XCBA 2FNPA 1QZYA 3LL7A 2JA6J 3BPXA 2DBBA 4L0YB 2PX9A 3DKWA 2CV0A 2BY1A 3GF2A 5K7FA 4XMYA 2M7BA 1FYMA 2XHKA 1S8NA 2A5WA 3QU6A 5HNFA 4CHUA 2EIKH 3SYTA 2M4KA 2DXIA 1MIJA 2HDCA 1W5TA 4G8XA 1I27A 3K4NA 4OIQF 4FQGA 3ZMUA 1RUOA 3OR1C 2XPUA 5GPAA 3FXOA 1BR4A 5K7ZA 1Y1VJ 1EKEA 2VE8A 3MVPA 4XLHA 1LUJB 3EUHC 3QWLA 3O8HA 4JX6A 2Y0SN 2ECBA 3F22A 4F91B 4KDPA 4XOTA 4HF2A 4NHJA 3AL0B 1S9HA 3GFIA 1JKRC 3KE2A 3UNGC 1D3YA 1QQIA 2XPVA 1GV2A 1O3RA 2XF5A 4BXFA 3HPGA 2CQQA 5J40A 4DBRA 3CMEI 3TQNA 2CFXA 2FQ3A 3FBIB 4JYKA 3VPRA 2LFBA 5K5QA 5IT9Z 1LE8B 1HCRA 4CCOA 2BY0A 1KYWA 3VDXA 4LD5A 4A3EJ 3DPTA 2F48A 3FXJA 3BZ6A 3W6VA 4HSTA 2PLYA 5DDGA 4R79A 5M5YJ 1YITI 2HWVA 2RDPA 3JRCA 2VJJA 1YX3A 3CC2I 3P5JA 2LTPA 3FHZA 2XF7A 4D5CA 5CVUA 3E5XA 4XK4A 2KZGA 2IGKA 4IHSA 3K10A 2EINH 2FJ1A 1B8IB 4IRHA 2OV7A 2DQLA 1P7IA 3EYIA 3SZTA 1OJLA 1MBGA 1ZG3A 1ZREA 5EDNA 2XIGA 2LYCA 4KT5C 5E18F 3V8KA 2LREA 3BCAA 3Q0UA 3E5UA 1F1ZA 2A5YB 1OPCA 2L3DA 5D6EA 5DUIA 1MBFA 1MJAA 3CLQA 2EK5A 3C3WA 4UVCA 1YHQI 3UKGA 1BM9A 2GQQA 4YIFA 5LEKA 5EEAA 1B9MA 2QSGX 2LC2A 3U2RA 1BC8C 3KCCA 3KP5A 2HXOA 2LP0A 4QPQA 4LLLA 1ZHFA 4ZDLA 5BNGA 1Z9CA 1BIBA 3AG3H 3DTKA 3CJRB 2GXBA 4F52A 3A0BC 4RLQA 5B3SH 3JREA 3MEXA 4UXNA 2O3FA 2L7MP 1DU0A 2XC7A 3VYSB 4ESBA 5LHIA 1MBHA 1AWCA 1TWCJ 2P0WA 3MAJA 4IL6C 5EEHA 1ENHA 2M3AA 4C9YA 1I3AA 2STWA 4IHXA 1X1BA 1ODDA 2LRDA 2ZB9A 5CJ9A 4BE0A 3QPLA 3NWTA 4D1QA 3VODA 1IDZA 5JFRA 1D1AA 4XSZF 3HRMA 2E60A 2JTVA 1U9NA 2CS3A 3DTIA 4B3XA 1YLFA 2Q1ZB 1TWAJ 1W7PB 2MSYA 4A5MA 2IP2A 5KK1A 2GOXB 4EJWA 3CCRI 5ED4A 1XD7A 3TMOA 4ABZA 2ZXWH 1VI0A 2NS7A 2RKHA 3I55I 5CLSA 3DBRB 2R5YA 1IJWC 3J7AY 5M5XJ 4PSXA 2M1BA 2R7QA 3G2BA 3HBLA 4LFUA 1YG2A 3BG9A 3PFYA 1JTYA 2W24A 3JRFA 1WHUA 1W5SA 2KHMA 3IHUA 5CQEA 2ELHA 1MMSA 1GVJA 1Z67A 3CCMI 2LY1A 3PIPF 4S04A 4XSXF 2UWMA 4PDKA 2BVLA 1YS7A 3COAC 1OFCX 3RPUA 4E7HA 1U8BA 2XRLA 3KZZA 5E1ZB 2KRFA 5K5RA 2VOOA 4BY7J 3IKVA 5C3EJ 3CC4I 1XB4A 2OU2A 3TEDA 1SEUA 1W36C 3WU1B 1DDNA 3T8TA 3D0SA 3CC7I 1X3UA 1RC9A 2M4GA 5TJJA 4CCMA 1V4RA 4XBFA 4E7LA 2PQ8A 1A6IA 3CCUI 5K1YA 1MW7A 2WTEA 3GZ6A 3TW6A 2C6YA 1F5TA 5ICFA 1T6SA 1Z6RA 4XLPF 1X4OA 4IOCF 5GPCA 1SD7A 4I09A 4Y52J 4KITB 1JUPA 1P4WA 4ITVA 3CCJI 2ZJPF 1VQMI 3K4LA 2G7UA 2V6CA 4O6JA 2KJCA 4NC7A 2JJ7A 1FP2A 1Z7LA 2TDXA 4TV7A 2FUG2 4ENNA 3OSFA 2MH2A 4OIOF 1Z1DA 1IN8A 4IOAF 3R6SA 2AQFA 5GP9A 4DQ2A 1XCVA 3BY6A 2CQXA 3WODF 3IH3A 3AG2H 2R7DA 3CZ6A 4M72A 2I10A 1IRFA 1S3JA 1MKMA 2MC4A 1YRNB 4IQJA 3JTGA 3U21A 2IGNA 3C2BA 2DPUA 1V3FA 4ZYDA 1LFUP 2KISA 2K9NA 1SFEA 4JOMA 3RSNA 2QQBA 5D5UB 2R5ZB 2ELJA 1NG6A 2HI3A 2VONA 2DMTA 3LFUA 2WA0A 4CA0A 1FJLA 4BQAA 1X1DA 1BBYA 2ID3A 1NK2P 1FLIA 3C1DA 2W82A 1W0UA 2KMUA 4MEYF 2GOMA 5M3FJ 1U78A 1OCTC 1D0XA 2AS5F 3CESA 4BXUA 1LKXA 3OMYA 3W2VA 2CYYA 3DWLE 5EGOA 1D5YA 3JAMK 1RZ4A 1KGSA 3B73A 3VYUB 1XX5A 1AA7A 3E6MA 2BEOA 4ETSA 2XPWA 2R7XA 4FCYA 3TOAA 3PIOF 4Q4ZF 2Y31A 1YIOA 2CGPA 2MLKA 3BG5A 4A3LJ 2VKDA 2CV1A 2E5ZA 3BTCA 4MHGA 4L18B 3B6AA 1D0ZA 1D8JA 4J01A 3HYIA 3UR3C 2JUCA 3RKXA 1X1AA 4C2TA 2XVCA 5E79C 4I01A 1F9NA 2R7UA 3K4JA 3KETA 3BJAA 3S1NJ 2DMUA 1WGXA 1QHGA 3HJEA 3L00A 5A2QZ 3BLYA 3KLNA 2B0LA 2EFQA 2PG4A 3DEEA 3M7GA 3G6EI 1AHDP 2AHQA 4B3AA 5LHHA 3HSEA 2RREA 1OCOH 2BV6A 3H35A 4BJ6C 3HSFA 3G4SI 3BR6A 4CUGA 1R36A 1R22A 2V26A 1DGRM 4E70A 3MZ8A 2K5CA 4NC8A 2XKPA 4RGRA 4C3IJ 4AWXB 1JJ8C 2OD5A 1USTA 4AYBN 1S5LC 1T98A 3MKLA 1FTZA 2DYSH 3BJ6A 2M2EA 3HHHA 1MDMA 2KDOA 5FRMA 4RGUA 4A3FJ 3I53A 4XRSA 2UZKA 5BPIA 1IW7F 4MNUA 4KMFA 1B4AA 1BI3A 2R0QC 5DCMB 1B9NA 4H4KC 3JRGA 2FOWA 4QPOA 3NARA 2VT2A 3S32A 2DODA 1F4KA 2E34A 1OR7A 4NBQA 1SC7A 1DQUA 2BY2A 5EYRA 2V9KA 3BR5A 4XL9A 1E3PA 1HKQA 5FKKA 4J00A 3I58A 1XSVA 1WVRA 1HLVA 2E7XA 2NNYA 5FRNA 3HSRA 3J80Z 5GTIC 1H9TA 1HKSA 3RPUD 3L1PA 2J5OA 3GWZA 2R7SA 1T56A 1OKRA 2P5KA 2W7NA 3PO2J 3PNYA 4I0AA 4BACA 3KEQA 3P7NA 4YG2F 5K7HA 2Y9YA 1QGPA 2V1UA 4L5JA 1G3TA 3FF5A 1TC3C 2H27A 5J47A 1BA5A 3TDZC 2K7LA 2COMA 2EQRA 4E7IA 3ASOH 4M6VA 2COBA 4RLFA 2ZMEB 3IH2A 4KJZA 3GTKJ 1GXPA 3FXMA 1VQPI 3T8RA 2LDUA 1PP8F 4JX4A 4WF2A 2W48A 2CUEA 4A0YA 3KP2A 2P6SA 4DZJA 2LKPA 1RIOH 3BG7A 1R71A 5L3CA 2FSWA 3ESWB 2IAIA 2VODA 3BOQA 2WV0A 4JX5A 2HDWA 4A69C 3LNQA 1ZG1A 1BC7C 3W6JB 3HUGA 2DMNA 3OSGA 1VQOI 1NH3A 2ZMEA 4XM3A 2MGQA 3FISA 5C4XJ 3SFZA 5FD6A 3IL2A 1G3YA 3K70D 2OTJI 4KUMA 1S7AA 3F3XA 4UY8I 3S1MJ 2HU9A 1HXDA 4YFNF 3A1YA 1TWHJ 1MJBA 3WHCA 4LLNA 2PMHA 4GO1A 3AFHA 4JK1X 4DYQA 5ERIA 2O0YA 3HOTA 4HX4A 4M3FA 4DBQA 4U7DA 1XS9A 4ZZDA 1ETKA 5FLXK 2Q2EA 2QUFA 5E1XA 4EJUA 2EV0A 5AIQA 5IYDJ 4LG0A 2KFDA 4L9JA 4BJ5C 2XGCA 5EG0B 2ZCWA 2IA0A 3J7YJ 1G4DA 2JA7J 1WJBA 2JMWA 5KVRA 1YFHA 1T39A 3HOYJ 1WI3A 5HDNA 1SFXA 5L3GA 4R8HA 4ZTJA 2L2OA 2FBIA 2CO5A 2JSCA 2ZJ2A 3QU3A 2E35A 4OAZA 3ZN1A 2DJNA 3HZJA 1G59A 5DD8A 1Y6IA 2Q2EB 3BCBA 4M3BA 1BW6A 4BDYA 1S7OA 2HQAA 1ZLKA 1IO2A 1FP1D 1RPWA 3FMRA 3FKJA 1LQ1A 2CUJA 2DDAA 2WADA 5FB2A 3W2AA 3QODA 3OOPA 4OMZA 1SVMA 1FBUA 2Y75A 1P6RA 2LK2A 4FX0A 2OQGA 1K6YA 1K61A 4FISA 5A2QK 2M7AA 2H94A 2A07F 3M9AA 1Z3YA 3TL4X 3QPHA 3C7JA 1QU3A 1I6HJ 1K6OA 5IY5H 2LF8A 1WJEA 1YW7A 4X6AJ 4ZDOA 4M6XA 4AIHA 3RKQA 2KIQA 1EJ9A 4BBRJ 5ICEA 3DBHB 5GAGJ 4HQMA 2NOJB 5FKNA 2PJRB 2MBFA 1J75A 4UUSA 4HNUA 2K3FA 2IW5A 3BZKA 1ZR2A 5E8IA 4M9XA 1LE8A 3N4MA 1IUFA 3KP7A 1D1CA 3CF5F 3T1BA 2AXTC 2DDBA 2DN0A 3PNTA 5LLQA 3A02A 1RETA 1OQYA 3LA3A 3WE2A 1H89C 4RA2A 1W36D 1R1TA 4QIWN 2A6TA 3SHFA 2QEXI 2NXNB 3HOVJ 4OINF 3OS0A 4BE2A 1BI0A 3WTWC 5HS9A 1U3EM 3V4GA 4OU0A 2HTSA 4HG2A 3S2HJ 3KYLA 5JLXA 2K27A 2DK5A 2P7CB 5CYVA 4LB5A 3ZP5A 5BMZA 1N77A 2QKMB 2IGOA 4A3MJ 4KNYA 1EH7A 1R4MB 3ECOA 1OCRH 3ZPLA 4A2UA 1S72I 2AO9A 3A01A 2CQKA 1YW8A 4LG3A 2LF7A 4RB2C 2OZ6A 1DPRA 1P7JA 1YJWI 5HOOA 2Z99A 3F8FA 4XLNF 3X2QH 1FSEA 1JT0A 3BPVA 3OL3A 3OS1A 4C2MJ 4FASD 1TWGJ 3HGGA 4IHYA 3HDDA 5F27A 1K79A 3WTXC 5F1JA 4BY1J 2DO7A 4BGDA 4KMUX 3I9V2 2ME6A 1YW9A 4B1RA 4AIDA 5DM7F 5EGOB 1CGPA 4S0HB 2FA5A 3GEZA 2QQ8A 3KEYA 5E1WA 3HXLA 1Y39A 1X1PA 2VN2A 4XIDA 4HW0A 2Y2ZA 1YYVA 1FMWA 5J1UA 2RC4A 3MN2A 1J9IA 3LAJA 3ABLH 2A61A 4HQEA 5DYMA 1KQ8A 2MFZA 3U9GA 1VNDA 5FROA 1S29A 4EGZA 5HDGA 2HOSA 1OLTA 1LEAA 4XLCA 1ACIA 2E36A 3GFJA 1OCCH 2LH9A 2X51A 1H0MA 4UUVA 2K9SA 5E3NA 1H9GA 3J80K 2XB5A 3OYMA 3HOWJ 2IJLA 3EYYA 2VQGA 5DD4A 3V7SA 1PUFB 1XC5A 2DMQA 2D1VA 4P5OA 5EJCA 4CGZA 2LD5A 1X1CA 3WTSC 2QZ8A 4ENJA 2LY9A 1VZ0A 1YJNI 2CFOA 5F0HA 2R7OA 2L4MA 2ZNZA 3Q0WA 1WPKA 2JT1A 1FY7A 4BHCA 4F92B 3ZQIA 4PGHA 4YELA 5B1BH 3LSRA 1RNLA 3K1MA 3CDIA 4BEHA 3V8JA 1BOBA 1EH6A 1IC8A 3FM5A 2HFHA 4CICA 3L9FA 5TGTA 2CV2A 4XICA 3K7AJ 4CZCA 4M9SA 2F4OB 1XSXA 2KIMA 4XNFA 3LSIA 2Y0SA 5EG0A 1E2XA 3BTLA 4BXXJ 1HSJA 1PUEE 2YU9J 2L7ZA 4ZTFA 4IZZA 1ZARA 2YX4A 1B72A 4IRGA 4IRIA 3QRFF 3QPSA 4RAYA 5ILUA 4ZH4F 4A5NA 3FK7A 3HTSB 2M9HA 4U0VA 3PO3J 4F93B 1WFXA 2L02A 2XAFA 3BWGA 1U6GA 1V54H 3KP6A 1HQCA 3JR9A 3OY9A 1ZG5A 2OCEA 2VL8A 3NWSA 3RKWA 1N75A 3Q0VA 3SFIA 3FZVA 1ON1A 1USSA 3HPHA 2BW3A 3QOEA 3F23A 2A6HF 3H9GA 3PJRA 1HF0A 4IHWA 2P8TA 9ANTA 4CXFA 4DNCA 3OYEA 2W57A 3A03A 4NB5A 1ZGWA 1WJCA 2X1DA 2EFOA 2WY7Q 1D5VA 1G8XA 4J19A 1T8IA 2MC3A 2QBYA 1MNDA 5JHUA 1J7KA 2ZJQF 1UELB 1Z05A 3MMYB 4EVIA 4UVAA 2LMDA 2YPRA 2VC1A 4XKBA 3DKYA 3KEOA 4BL0B 2HZTA 1WQ2A 5IPAA 1LVKA 1XMAA 1GVDA 3WG7H 3J7ZI 3MWMA 4PK4A 2F5FA 3VYTB 2JA8J 1BL0A 3HG9A 2ACJA 5J1YA 4HOBA 2QCOA 3P9KA 1LDKB 1WCMJ 3QYEA 4EM0B 4Z6YA 3E6CC 2L01A 1LDJA 2OPTA 3P9IA 4NNJA 1Z3XA 3TO7A 2R7RA 3JCUC 2IS6A 2L9SA 3S2DJ 3OYFA 3SDGA 3QYFA 1RI7A 4EEFG 3V42A 3OYLA 1R6RA 3WGGA 2E7WA 1JTXA 2DMPA 4KIFA 2R7TA 1K4SA 1UHSA 4U0YA 1JGGA 2FEZA 2EILH 1IV8A 2VIXA 4EMSA 3GLXA 2NOGA 4D9JA 2QSHX 5F0CA 1HKTA 2V4JC 5DS9A 1Z7UA 4IHTA 4IKFA 4BYYA 3I4PA 4P1WA 3CJNA 4AIKA 2WAEA 4L9VA 1ZK8A 3E97A 4ON0A 1Z0XA 3VEPA 3EUAA 3I4NJ 1YOVB 2XASA 2F2EA 2QM3A 4ZZLA 5LFAA 2EH3A 3HOXJ 1R7JA 5J8FA 1UAAA 4KN4X 2DOEA 2FF4A 4BS9A 4D5FA 4N4NB 1W0TA 1T33A 2Z1DA 3CF2A 1O7LA 4G6DA 1F43A 1W1WE 4BNCA 1TNSA 3G1OA 4FETA 4L5IA 5H2FC 3ZGKA 5D5XB 2EWNA 2QYOA 2EPFA 2GIZA 2VJIA 5J8CA 1T0FA 2EIMH 1MBJA 1YI2I 3ZQFA 3K0LA 2DFIA 5D5VB 2W1OA 4WX9A 3GTOJ 1I5ZA 1MDMB 2B63J 1O3QA 1O4XA 1FIAA 2I8DA 4DZPA 4PUSA 4GFBA 1KZHA 3I59B 4LGWA 2F4MB 2LNBA 2P81A 4IJAA 2W4SA 4N4OB 4BBSJ 2R7VA 2MA3A 2M8GX 2NAZA 3IH4A 4XN3A 3OL4A 4LIUA 5D5WB 3HRSA 4GDFA 3OIPA 3ZN0A 2GWRA 2VE9A 2XAGA 2ZBKA 4YEJA 4YFXF 3HGYA 3O6BB 3KYCB 1I50J 1FOYA 2V7FA 4M3EA 5CPRB 3VB2A 4RGSA 4Z2YA 1U5TC 5GAEJ 1LB2A 2GXAA 3DV8A 2X6OA 4KA4A 1P9QC 2JPCA 1QNTA 2OTLI 1IDYA 4B44A 2BHYA 1GV5A 2DW4A 3F21A 2P7VB 3PNVA 1VQ8I 2K9LA 4PFPA 3KZYA 3M1EA 2L7KA 5HLHA 2VJ5A 2CQ7A 1YTYA 2RQQA 2R3SA 2KIFA 2OQRA 4EM2A 5FKOA 4UUSB 1FBQA 2R4GA 1DUXC 4I02A 1HOMA 4HEA2 2VBWA 3S3MA 2OUMA 2QF7A 2H8RA 4GYGA 2EA4A 2CRGA 3WTZA 5KAFC 1LFBA 3OIQA 3J7AO 4YRVA 2KIUA 1K4TA 3I64A 2RAEA 3EUKL 3RQIA 1ERDA 1YS6A 2WWYA 2XKOA 4XORA 1U8RA 2XV4S 4XQFA 4S05A 4B8XA 2JPBA 3P9CA 1KU2A 2XAJA 3LA2A 2H1KA 2FBHA 4M73A 3DU6A 4RM3A 1IG7A 1R9TJ 2NVQJ 1U5TB 3PQKA 3DPUA 3JRBA 2M30A 2EIJH 1R23A 1SFUA 3OIOA 2X0LA 3GTPJ 2DT5A 1P2FA 3E5QA 1A35A 4LIVA 5E20A 1FBSA 4Y17A 1ON2A 3S2WA 3VSLA 1VTNC 2GA1A 3LSMA 1FYKA 1HDDC 1FNNA 3M8FA 2HYFA 1IF1A 1ZELA 3TW7A 2VXDA 5F1RA 4Q47A 5F0FA 3F0CA 1MJ9A 3WHBA 2JN6A 3HHGA 3LSKA 3IKTA 4IHVA 2BW3B 4ZJZA 3H5AA 3HC7A 4V2FA 2XAHA 4QTRA 1J59A 3GCMA 1U2WA 1XDUA 2VKHA 3FXKA 1SAXA 2IS1A 4XKWA 3SDBA 4FE7A 2QBYB 3GMEA 1LPQA 1S6LA 1BIAA 2XGDA 4EJOA 1FC3A 4DGWB 2V6EA 3GO5A 6PAXA 5HDKA 2V79A 5LRRA 1FOWA 3HL2A 1UMQA 5J4VA 2HVQA 4MEXF 2ECCA 1FYLA 2FBKA 4IO9F 3FIWA 3TOBA 4LOCA 5LGUA 2X48A 1MH3A 2IVMA 4IQ4A 2B9SA 4BAYA 3RJPA 4FHTA 2QQAA 2DA6A 3TP3A 4WCGA 2M34A 1TBXA 2X6XA 1TLHB 1TZLA 1HW2A 2EB7A 4RDUA 4RGXA 3ZMDA 1JKOC 1JUSA 4P55A 5L3BA 2CUFA 4B09A 3RDIA 2Y0MA 5FKMA 1HBXG 3ML6A 4HV5A 3H9QA 3OYHA 3F8BA 3L2QA 1EV7A 3CCYA 4LG0B 2EFNA 4KIBA 5D4SA 4HX8A 2H09A 2CQNA 2KPMA 1I39A 1JKQC 1CF7B 1I6XA 2JVHA 2L7FP 1IV6A 2Z9OA 1OYWA 4GRIA 2HTJA 4OOIA 3ABUA 1WJFA 2HZDA 3DEUA 3AG1H 4I99C 2D1HA 3GW2A 5ICGA 3AG4H 2HQRA 3K69A 3LMMA 4HF0A 1J09A 4ESJA 2E2JJ 2KJBA 5L3EA 3W2WA 3K4MA 1R4NB 2WB1N 2DI3A 1BR1A 4WXCA 3CDLA 3MKZA 2TCTA 4G9YA 4HV6A 4CZZA 3L2UA 5CQGA 5J3LA 1B8IA 1YX5A 4EQQA 1HA8A 1ETOA 3MD2A 1K83J 2N8GA 1XGNA 1K7AA 1XG1A 2IS2A 2K9QA 5J6XA 4RBOA 4UB6C 4M6YA 1OISA 1A04A 4RAFA 4UVBA 3BR1A 2MG4A 3OYIA 2HKXA 2OA4A 2O9LA 2HS5A 4XLEA 2L9VA 3GLLA 4GYIA 5F64A 2M0MA 2M45A 3QQAA 3RKYA 1G2HA 1FT9A 3OS2A 3KLOA 2F5EA 4IEJA 3QOPA 4LB6B 4YIIA 4GCVA 3EETA 2V9VA 5KAIC 5FKLA 2ZKZA 2GBYA 2HOEA 2HQNA 3DP7A 5E3OA 5D6FA 2LOOA 3T5XA 5FLVA 4I98B 1WZ2A 1MD0A 3L2RA 4HDVA 2PFBA 2KRCA 1EH8A 5CVIA 3WGIA 1SD6A 2ZXIA 4C3JJ 1W4MA 2NS0A 3R4KA 1BI2A 4MQVA 4Y33A 4BHPA 5KHDA 1IRZA 2L4AA 3JAMZ 2O7OA 4MQ9F 4N9IA 3RZDJ 1LEBA 2L9RA 4W1UA 2GLOA 3OYNA 1KU7A 3VWBA 3I5UA 1UJ8A 3DLLF 1ZAOA 1QRYA 4OIPF 2RNJA 2MD0A 3IC7A 1CQTA 3J81Z 2A69F 3SJMA 4HX7A 3ZMTA 2YSRA 5JVTA 3GTMJ 1R58A 4MFEA 2Q0OA 4P9UA 3N05A 4XKVA 3S17J 2GIVA 3L2CA 3REOA 2V9PA 3FMSA 2JVGA 1ZRCA 2W00A 3HUGB 1QPMA 4L0ZB 1MH4A 4PJJA 5DUKA 2E2IJ 1IAWA 2AXLA 3FWEA 5C4JJ 1HW5A 5J4YA 2BYVE 4FTHA 4UV8A 2CH0A 3OYBA 1POGA 4AC0A 2NVTJ 2R7ZJ 1OR7C 1L0OC 2MYSA 2O8KA 2JUGA 2NVXJ 1IXRC 1T2KA 3H36A 3WGHA 3BT9A 3V7CA 1H8AC 1A6QA 1WSUA 4A12A 5EEGA 3NEUA 3GTGJ 1JT6A 2DT7B 1Z91A 4UB8C 1R1UA 1EA3A 2ICWG 4DYCA 5IT9K 1FX7A 1UHMA 3ERMA 3OR2C 4OIRF 2YU3A 3RPQA 1RRJA 2ELKA 2Z16A 3GZNB 4CCNA 5HNHA 4Q5SF 2FX0A 4ENMA 3I54A 5JVGF 5CVJA 2YR2A 4BUPA 3BTJA 4A3JJ 4A3GJ 1JGSA 2OZUA 4AIJA 3K4KA 1TNTA 3CUOA 4KYWA 3S15J 2FE3A 4AU7A 4MFDA 2OAZA 3CUQC 2RGVA 1QBJA 1X3WB 2GM4A 1PDNC 4W97A 5L3DA 2R92J 1P4XA 3BR3A 3CD6I 3E6BA 3D5RC 2DU9A 2ZSHB 2KLOA 3R60A 3G71I 2EZLA 2VASA 5E17F 3ABKH 3M8JA 1WH7A 1VQ4I 3ZQ7A 3KYDB 1FWZA 3M3YJ 3RI4A 2PJPA 4L9TA 1QPIA 2NRAC 2BVMA 1I1SA 4NQWB 2LBFA 5CVRA 3GZ5A 4RB1A 1IGNA 3AKZA 2HVRA 5H20A 2HPIA 2X9DA 3NAUA 1BN5A 3CMYA 2VUMJ 1RKTA 5F04A 1YJ9I 1V5FA 4HNTA 1Z6TA 2FXAA 4BE1A 3DPLC 4CYCA 2K40A 3ZMZA 1TQMA 2EFPA 4FT8A 1MMGA 2RN7A 5IP7J 5B1AH 2P4WA 1FOKA 3CCSI 1A31A 1UG2A 3V8LA 3LQQA 4E7ZA 3LSHA 5TRDA 2VKVA 3S14J 2XSDC 2CUZA 5IOYA 2HNHA 2RNGA 4NQWA 2LBFB 1V5EA 1NK3P 4HPQA 5FFXA 2LLKA 2Y69H 1WH5A 4R1HA 2OF7A 3C2HA 3SQNA 4CCJA 3DF8A 4IX7A 2O8XA 3I0TA 5LGTA 3Q5FA 4G6TB 4JQFA 4KICA 1C0WA 3BR0A 2FNAA 1QHHD 4Y7NJ 2EZKA 3RTRA 5IP6A 4HRIA 3HRTA 5L3FA 2V1DA 1BR2A 1X2MA 3K70C 4ENKA 5DCFA 2NVUB 2NS8A 1JUMA 2QVOA 2KT0A 5GAHJ 3Q9VA 1IN6A 2LG4A 4II3A 4G94A 5EF6A 4EJVA 2EJRA 1JXSA 4L5EA 4DW6A 5LEJA 1Y8QB 4BU2A 4Y13A 2G0EA 4A3DJ 3DKXA 1I1GA 1V55H 2GXGA 3KX2A 2JA2A 1D1BA 2HXIA 3LSTA 3PUFA 1ZN2A 2DFHA 1MBKA 3RYPA 1L3LA 5FFZA 5JHFA 3JSOA 2K4JA 4CO8A 2VOPA 4HSRA 1FSHA 3ONQA 4M9ZA 3PM1A 3ASNH 5AONA 1GLNA 1VQNI 1MSEC 1F36A 3Q9SA 1DP7P 1ETXA 5LD2C 2QQ9A 3W3CA 2V1NA 3SZPA 3DXJF 3FK6A 1T0FC 1UB9A 2FRHA 3PFIA 1HC8A 1W7PD 3RQ4A 2E19A 2ZNYA 2X6WA 3EPZA 4KN7X 2Z2SB 3I3LA 2DT6A 1KQ9A 3LSPA 1XDSA 2P5VA 2GZWA 4M3DA 2ZJRF 3K2AA 1XTAA 3JRAA 3WU2C 3RZOJ 1G3WA 3K4CA 5LRSA 1SFKA 3FM3A 2PBIA 4XRSG 4HAMA 4UV9A 3JRIA 1VQ5I 2QLZA 2WV1A 4LLGF 1BJAA 1HW1A 3LQRA 3SXYA 3ZQLA 1ONVA 2O6GE 1CF7A 3BZCA 4QLCU 1SMYF 3OYDA 3W6KB 3IV5A 3F6OA 3RCOA 2E2HJ 2Q8KA 3EUHA 3WTVC 1MGTA 2HYGD 4X0GA 2M5WA 1Y8RB 3IRQA 3HRUA 2KKOA 4AM3A 4LJZF 3HEFA 2DK8A 2Z3YA 4P9FA 4B48A 3HOZJ 1Y56A 1ZTRA 2X1CA 2E1MB 3OOUA 4F55A 1X58A 1IXSB 3CMMA 3I59A 2XAUA 4G12A 3IWZA 3ZMSA 1TP4A 2HPMA 3K1PA 2IRFG 4MIMA 2K02A 5IOZA 1SVOA 3KP4A 1IN4A 2DA3A 2XDVA 4ESFA 2KZVA 3TKYA 3MKWB 1LJ9A 2F5DA 2WAQN 1X19A 1NTCA 2NVYJ 1STZA 2OBPA 3HM5A 3IAS2 3DFGA 3RIRA 5FJ8J 3KFWX 1TW2A 3AAFA 1WJDA 3L2VA 2K4BA 2JQ7A 1Q1VA 4DIQA 3F8MA 2VJ4A 3JW4A 3H0GJ 3BROA 3GYHX 5IT3A 1WJ5A 4LMYA 5EZGA 1YO5C 3E3VA 3Q3SA 1Q1HA 4ZC3A 3B6CA 3RYRA 1VQ7I 5JLWA 4U7BA 3E6DA 5DEQA 3K9TA 2HOAA 2TRTA 2E1CA 4CDGA 4E7KA 2LY2A 1MZBA 5F08A 1B1BA 5BS6A 3VYRB 1KU9A 3R61A 1KU3A 3MZYA 3D1NI 2B7EA 1ETVA 2LKXA 1JJ6C 2UUZA 3A4CA 3GFMA 1RUNA 2STTA 1QVTA 3TP0A 3OYGA 2GAUA 1QO0D 1WKMA 3BTIA 2GA2A 5CVVA 4XRMA 1E3HA 4OMYA 2WBMA 3L2WA 4QSHA 2CG4A 1DU6A 3PSFA 1JKPC 1UCRA 3ZR8X 2YS9A 3CO7C 4D7NA 1XGOA 3FHNA 3E7LA 1M1EB
chains in the Genus database with same CATH topology
4N9HA 1HSTA 3NRVA 1JHFA 1BOAA 4LK0F 4BHBA 2YX7A 5E8GA 1BI1A 1Y0UA 1SMTA 1IN5A 1KA8A 2BBYA 2MD5A 1K78B 1IZ1A 3K1NA 1J2XA 1G3SA 3M8EA 3IWFA 1XMKA 4HZFA 3LAPA 3JSPA 1XGMA 3QPTA 2ESHA 3WTTC 1XSDA 4I0BA 3LWFA 2W85A 1QZZA 4PZJA 1K78A 1DPUA 2ZO4A 3GXOA 1O3TA 4HF1A 4PCQA 4LK1F 3TDUC 2VC0A 1ZH5A 4GXOA 1REPC 2UXNA 3ULQB 5BPDA 1LVAA 1PP7U 2O61A 2D45A 3BP8A 4ZYHA 1J0RA 3CUQA 2HR3A 2HEOA 1D8KA 2NYXA 2UXXA 1XN7A 3ELKA 3K2ZA 2WC2A 4MTEA 2RQPA 3FXUA 3LA7A 4O5VA 3CUQB 4IPAA 4CYDA 5H6QA 2V1XA 2ISZA 2J5PA 4WK8F 4BH9A 1ZRDA 3WU0A 3WTYC 3HOSA 3FXQA 2R7FA 5ILVA 1UFMA 3H3ZA 1P92A 2FU4A 3MZHA 1ULYA 2JRTA 2X4HA 4UHTA 3L7WA 4UNOA 2EV6A 2P6TA 4EJTA 2EFWA 5DCMA 1TW3A 4Y15A 2HGCA 3U1DA 1KYZA 2FMYA 4G7HF 2Z5UA 1R5HA 2M87A 1KQ0A 1G6NA 4G7ZF 3J81K 2RV8A 3R0AA 3ISPA 5FGMA 5HLIA 5LBQA 2Z33A 3F8NA 4AVPA 4L9NA 3ERED 1FZPB 3BJOA 2DAOA 4I2OA 3MFKA 2DQRA 3HTUA 3I71A 3FMQA 5ILSA 2IPQX 2DPDA 4M74A 3IRRA 1OYIA 4IXAA 4JBAA 5K5OA 4HYEA 3EDPA 3F72A 3C18A 1ZGAA 5BQTA 4D0PA 1ZYRF 4ASNA 4WWCA 3CTAA 3VOEA 3ZMVA 3T0YA 1O3SA 2M8EA 3EQLF 1TQPA 2ESNA 4GGGA 1SD4A 2XRNA 2MLGA 4A0XA 1W7PA 2IA2A 2ZXJA 2QWWA 4RB0A 4EGYA 1WWXA 2A68F 5H6RA 4O3MA 4A0ZA 1R00A 2IT0A 5AIPA 2PN6A 2PEXA 1WRJA 3BDDA 2XAQA 4U88A 4HA8A 3N97A 3B02A 2P5LC 5FO5A 2JZYA 3F8CA 4FX4A 3KP3A 1O7FA 1ZRFA 2E1NA 3TO9A 4MGRA 4A6DA 2VBZA 3G73A 2HKOA 1FPQA 4KFCA 1OYYA 3CO6C 1IN7A 5LGNA 1AOYA 4U0WA 4IF4A 2IA1A 2VBYA 2ADUA 2MH9A 2LSOA 3LFKA 4RS8A 3O2PE 3FX3A 3GUDA 4EM1A 3H3UA 1UHWA 2BGCA 2BE5F 1TTYA 2G7HA 4PGGA 1OMIA 3TGNA 1GHCA 2VXZA 4HLXA 4Q48A 2H6BA 1E17A 2W25A 1B6AA 2ISYA 1GXQA 4XRFA 4EV0A 1LDDA 3TO6A 4QWQA 5ICCA 1WI9A 5HS8A 1YQAA 2EA2A 2G9WA 1R1VA 1ZLJA 5F6FA 3HIFA 5HS7A 4G7OF 3GFLA 3D5LA 4RAZA 3WTUC 1SD5A 3O3KA 5FLXZ 4H0EA 1LNWA 5JI6A 2W84A 2QENA 2XUBA 1IRGA 2CSOA 2XGXA 5JR3A 5D4RA 3L09A 1TQIA 3G3ZA 1IUYA 2PMUA 2VBXA 1JHHA 3QP5A 1T38A 4IVNA 5FD5A 5D8KB 4P96A 2K86A 4ZYGA 2A6EF 1ZGJA 2FMLA 4HDUA 5LHGA 4MTDA 2D2WA 2XROA 4YFKF 1J5YA 4AD9A 2EV5A 3NQOA 3R0JA 4RB3C 2Y48A 4F7ZA 5HLGA 3QAHA 2PI0A 3CLOA 2O03A 4HLYA 2DTRA 1NHAA 1XGSA 2H6CA 3WG9A 3VFZA 2A3SA 4M71A 3ROUA 2NNNA 3F6VA 4A6EA 3OV8A 1P4AA 5BOXA 5HVQC 1JE8A 2RVCA 4I7HA 1IXCA 4WXHA 3V7RA 3MCZA 2CW0F 2DLLA 3FXRA 3PQJA 4K2EA 3ABTA 4G6QA 1O57A 3GX4X 2ETHA 1B59A 1U5TA 5D8LB 4WXDA 3ECHA 2FOKA 4KIGA 3DQVC 3WE3A 2VT3A 4HBLA 3QP6A 2L54A 4N0BA 3CDHA 4ZYEA 3H92A 1R5GA 2ZFWA 2CWEA 3JTHA 5DV5A 2F5CA 3MQ0A 3GVAA 1XCBA 2FNPA 1QZYA 3BPXA 2DBBA 4L0YB 3DKWA 3GF2A 1FYMA 2XHKA 1S8NA 3QU6A 4CHUA 2HDCA 1W5TA 4G8XA 1I27A 4OIQF 3ZMUA 1RUOA 2VE8A 3F22A 4KDPA 4HF2A 4NHJA 3GFIA 3KE2A 1D3YA 1QQIA 1O3RA 3TQNA 2CFXA 2FQ3A 5K5QA 5IT9Z 1KYWA 4LD5A 3DPTA 3BZ6A 2PLYA 5DDGA 4R79A 2HWVA 2RDPA 3FHZA 5CVUA 3E5XA 4IHSA 4IRHA 2DQLA 3EYIA 3SZTA 1ZG3A 1ZREA 2XIGA 4KT5C 5E18F 3V8KA 3E5UA 1F1ZA 2A5YB 1OPCA 2L3DA 5D6EA 5DUIA 1MJAA 2EK5A 3C3WA 4UVCA 1BM9A 2GQQA 4YIFA 5LEKA 1B9MA 3U2RA 1BC8C 3KCCA 3KP5A 4LLLA 1ZHFA 1Z9CA 1BIBA 2GXBA 3MEXA 4UXNA 2O3FA 4ESBA 5LHIA 1AWCA 3MAJA 5EEHA 2STWA 1ODDA 5CJ9A 3VODA 5JFRA 4XSZF 3HRMA 2JTVA 1YLFA 1W7PB 4A5MA 2IP2A 5KK1A 4EJWA 5ED4A 1XD7A 2RKHA 5CLSA 2M1BA 4LFUA 1YG2A 2W24A 1W5SA 3IHUA 2ELHA 1GVJA 4S04A 4XSXF 2UWMA 4PDKA 1YS7A 3COAC 3RPUA 3KZZA 5E1ZB 2KRFA 5K5RA 2VOOA 3IKVA 1XB4A 2OU2A 3WU1B 1DDNA 3T8TA 3D0SA 1X3UA 5TJJA 1V4RA 4XBFA 2PQ8A 5K1YA 2WTEA 3GZ6A 2C6YA 1F5TA 5ICFA 1T6SA 1Z6RA 4XLPF 1SD7A 4I09A 1P4WA 2G7UA 2V6CA 4O6JA 2KJCA 1FP2A 2TDXA 4TV7A 4ENNA 2MH2A 4OIOF 1Z1DA 1IN8A 3R6SA 4DQ2A 1XCVA 3BY6A 3WODF 2R7DA 4M72A 1IRFA 1MKMA 1S3JA 3JTGA 2DPUA 1V3FA 4ZYDA 1SFEA 5D5UB 2QQBA 2VONA 4BQAA 1BBYA 1FLIA 3C1DA 4MEYF 1U78A 2AS5F 4BXUA 2CYYA 3JAMK 1RZ4A 1KGSA 3B73A 3E6MA 2BEOA 4ETSA 3TOAA 4Q4ZF 2CGPA 1YIOA 2MLKA 4MHGA 4L18B 1D8JA 3HYIA 3RKXA 2XVCA 4I01A 1F9NA 3KETA 3BJAA 3L00A 5A2QZ 3KLNA 2B0LA 2EFQA 2PG4A 3M7GA 5LHHA 3HSEA 2BV6A 3HSFA 1R36A 1R22A 4E70A 2XKPA 4RGRA 4AWXB 2OD5A 1USTA 1T98A 3BJ6A 3HHHA 1MDMA 4RGUA 5BPIA 3I53A 2UZKA 1IW7F 4MNUA 4KMFA 1B4AA 1BI3A 5DCMB 1B9NA 2VT2A 1F4KA 1OR7A 1HKQA 3I58A 1XSVA 2E7XA 2NNYA 3HSRA 3J80Z 1H9TA 1HKSA 2J5OA 3GWZA 1OKRA 2P5KA 4I0AA 3KEQA 3P7NA 4YG2F 1QGPA 2V1UA 4L5JA 1G3TA 3FF5A 2H27A 3TDZC 2K7LA 2COMA 2ZMEB 1GXPA 3T8RA 2LDUA 1PP8F 4WF2A 4A0YA 3KP2A 2P6SA 2LKPA 1RIOH 5L3CA 2FSWA 2VODA 3BOQA 2WV0A 1ZG1A 1BC7C 3W6JB 3HUGA 2ZMEA 3SFZA 5FD6A 3IL2A 1G3YA 4KUMA 1S7AA 3F3XA 1HXDA 4YFNF 1MJBA 4LLNA 2PMHA 4GO1A 4JK1X 5ERIA 2O0YA 3HOTA 4HX4A 5FLXK 4U7DA 4ZZDA 2Q2EA 2QUFA 5E1XA 4EJUA 2EV0A 5AIQA 4LG0A 4L9JA 2ZCWA 2IA0A 1G4DA 5KVRA 1YFHA 1T39A 5HDNA 1SFXA 5L3GA 4R8HA 2FBIA 2CO5A 2JSCA 2ZJ2A 3QU3A 3ZN1A 5DD8A 1S7OA 1ZLKA 1FP1D 3FMRA 1LQ1A 5FB2A 3OOPA 4OMZA 1FBUA 2Y75A 1P6RA 4FX0A 2OQGA 5A2QK 2H94A 2A07F 3M9AA 3QPHA 3C7JA 1K6OA 2LF8A 1YW7A 4M6XA 4AIHA 5ICEA 4HQMA 2MBFA 1J75A 2IW5A 5E8IA 4M9XA 3N4MA 3KP7A 3T1BA 5LLQA 3LA3A 3WE2A 1R1TA 3SHFA 4OINF 1BI0A 3WTWC 5HS9A 1U3EM 3V4GA 4OU0A 2HTSA 2K27A 2DK5A 2P7CB 5CYVA 4LB5A 3ZP5A 5BMZA 4KNYA 1EH7A 3ECOA 3ZPLA 4A2UA 2CQKA 1YW8A 2LF7A 4RB2C 2OZ6A 1DPRA 5HOOA 2Z99A 3F8FA 4XLNF 1FSEA 3BPVA 1K79A 3WTXC 2DO7A 4KMUX 1YW9A 1CGPA 2FA5A 3GEZA 5E1WA 2VN2A 4HW0A 1YYVA 2RC4A 1J9IA 3LAJA 2A61A 4HQEA 5DYMA 1KQ8A 3U9GA 1S29A 4EGZA 5HDGA 1LEAA 3GFJA 1H0MA 4UUVA 1H9GA 3J80K 2IJLA 3EYYA 5DD4A 3V7SA 2D1VA 4P5OA 4CGZA 3WTSC 2QZ8A 4ENJA 2L4MA 2ZNZA 2JT1A 1FY7A 4BHCA 4PGHA 1RNLA 3K1MA 3V8JA 1EH6A 3FM5A 2HFHA 4CICA 3L9FA 4M9SA 1XSXA 2KIMA 1E2XA 1HSJA 1PUEE 1ZARA 2YX4A 4IRGA 4IRIA 3QRFF 4RAYA 5ILUA 4ZH4F 4A5NA 3HTSB 4U0VA 2L02A 2XAFA 3BWGA 1U6GA 3KP6A 1HQCA 1ZG5A 3RKWA 3FZVA 1ON1A 1USSA 3F23A 2A6HF 2P8TA 4CXFA 4DNCA 2W57A 4NB5A 2EFOA 1D5VA 2MC3A 2QBYA 5JHUA 1J7KA 1Z05A 4EVIA 4UVAA 2YPRA 2VC1A 3KEOA 2HZTA 1WQ2A 1XMAA 3MWMA 2F5FA 2ACJA 4HOBA 3P9KA 1LDKB 4EM0B 3E6CC 2L01A 1LDJA 3P9IA 3TO7A 1RI7A 3WGGA 2E7WA 4KIFA 4U0YA 2FEZA 4EMSA 3GLXA 1HKTA 1Z7UA 4IHTA 4BYYA 3I4PA 4AIKA 3CJNA 4L9VA 3E97A 4ON0A 3VEPA 2XASA 4ZZLA 2F2EA 2QM3A 1R7JA 5J8FA 4KN4X 2FF4A 4G6DA 1O7LA 4BNCA 1TNSA 4L5IA 5D5XB 2EWNA 2QYOA 5J8CA 1T0FA 3K0LA 2DFIA 5D5VB 4WX9A 1I5ZA 1MDMB 1O3QA 3I59B 4LGWA 2LNBA 4IJAA 2MA3A 2NAZA 5D5WB 3HRSA 3ZN0A 2GWRA 2VE9A 2XAGA 2ZBKA 4YFXF 3O6BB 3VB2A 4RGSA 1LB2A 4Z2YA 1U5TC 3DV8A 4KA4A 2JPCA 1QNTA 3F21A 2DW4A 2P7VB 3KZYA 3M1EA 5HLHA 1YTYA 2R3SA 2KIFA 2OQRA 4EM2A 1FBQA 1DUXC 4I02A 2VBWA 4GYGA 2EA4A 3WTZA 3J7AO 2KIUA 3I64A 1YS6A 2WWYA 2XKOA 1U8RA 2XV4S 4S05A 4B8XA 2JPBA 3P9CA 1KU2A 2XAJA 3LA2A 2FBHA 4M73A 1U5TB 3PQKA 2M30A 1R23A 1SFUA 2X0LA 2DT5A 1P2FA 3E5QA 5E20A 1FBSA 4Y17A 1ON2A 3S2WA 1VTNC 2GA1A 1FYKA 1FNNA 3M8FA 2HYFA 1IF1A 5F1RA 4Q47A 1MJ9A 3HHGA 3IKTA 2XAHA 1J59A 1U2WA 1XDUA 1SAXA 2QBYB 1S6LA 1BIAA 4EJOA 1FC3A 3GO5A 6PAXA 5HDKA 2V79A 5LRRA 4MEXF 1FYLA 2FBKA 3TOBA 5LGUA 2IVMA 4BAYA 3RJPA 4FHTA 2QQAA 4WCGA 1TBXA 1TLHB 1HW2A 2EB7A 4RGXA 3ZMDA 4P55A 5L3BA 4B09A 3RDIA 2Y0MA 1HBXG 3ML6A 4HV5A 3F8BA 1EV7A 4LG0B 2EFNA 4KIBA 5D4SA 4HX8A 2H09A 1CF7B 1I6XA 2Z9OA 1OYWA 2HTJA 4OOIA 3ABUA 3DEUA 2D1HA 3GW2A 5ICGA 2HQRA 3K69A 4HF0A 4ESJA 2KJBA 5L3EA 2DI3A 4WXCA 4HV6A 4G9YA 4CZZA 4EQQA 1XGNA 1K7AA 5J6XA 4M6YA 1A04A 4UVBA 2HKXA 2OA4A 2HS5A 5F64A 4GYIA 2M45A 3RKYA 1FT9A 3KLOA 2F5EA 3QOPA 4LB6B 4YIIA 4GCVA 3EETA 2V9VA 2ZKZA 2HOEA 2HQNA 3DP7A 5D6FA 3T5XA 4I98B 1MD0A 4HDVA 2PFBA 1EH8A 5CVIA 3WGIA 1SD6A 1W4MA 2NS0A 3R4KA 1BI2A 4MQVA 4BHPA 2L4AA 3JAMZ 4N9IA 4MQ9F 1LEBA 1KU7A 3I5UA 1ZAOA 4OIPF 2RNJA 3IC7A 3J81Z 2A69F 4HX7A 3ZMTA 2YSRA 5JVTA 1R58A 4P9UA 2Q0OA 2GIVA 3L2CA 3REOA 3FMSA 1ZRCA 1QPMA 4L0ZB 5DUKA 1IAWA 2AXLA 3FWEA 1HW5A 2BYVE 4UV8A 1L0OC 1IXRC 1T2KA 3WGHA 3V7CA 1WSUA 4A12A 5EEGA 3NEUA 1Z91A 1R1UA 5IT9K 1FX7A 1UHMA 4OIRF 2YU3A 3RPQA 4Q5SF 4ENMA 3I54A 5CVJA 2YR2A 1JGSA 2OZUA 4AIJA 1TNTA 3CUOA 4KYWA 2FE3A 2OAZA 3CUQC 2RGVA 1QBJA 1PDNC 5L3DA 1P4XA 3E6BA 2DU9A 3R60A 5E17F 3ZQ7A 1FWZA 3RI4A 2PJPA 4L9TA 2NRAC 1I1SA 5CVRA 3GZ5A 4RB1A 5H20A 1BN5A 1Z6TA 2FXAA 3DPLC 3ZMZA 1TQMA 2EFPA 4FT8A 2RN7A 2P4WA 1FOKA 3V8LA 3LQQA 5TRDA 4NQWA 5FFXA 4R1HA 3SQNA 3DF8A 2O8XA 3I0TA 5LGTA 3Q5FA 4JQFA 4KICA 1C0WA 2FNAA 3RTRA 3HRTA 5L3FA 2V1DA 4ENKA 5DCFA 2QVOA 3Q9VA 1IN6A 4G94A 4EJVA 2EJRA 1JXSA 5LEJA 4Y13A 1I1GA 2GXGA 3LSTA 1ZN2A 3RYPA 1L3LA 5FFZA 3JSOA 2K4JA 4CO8A 2VOPA 1FSHA 4M9ZA 5AONA 3Q9SA 1DP7P 2QQ9A 3SZPA 3DXJF 2FRHA 1UB9A 3PFIA 1W7PD 2ZNYA 4KN7X 1KQ9A 1XDSA 2P5VA 2GZWA 1G3WA 5LRSA 3FM3A 2PBIA 4HAMA 4UV9A 2QLZA 4LLGF 1BJAA 1HW1A 3LQRA 3SXYA 1ONVA 2O6GE 1CF7A 4QLCU 1SMYF 3W6KB 3F6OA 2Q8KA 3EUHA 3WTVC 1MGTA 2HYGD 2M5WA 3IRQA 3HRUA 2KKOA 4LJZF 2DK8A 2Z3YA 4P9FA 1IXSB 3I59A 3IWZA 3ZMSA 3K1PA 2IRFG 2K02A 3KP4A 1IN4A 4ESFA 3TKYA 1LJ9A 2F5DA 1STZA 2OBPA 3DFGA 3RIRA 3KFWX 1TW2A 3AAFA 2K4BA 3F8MA 3JW4A 3GYHX 3BROA 5IT3A 4LMYA 1YO5C 3E3VA 1Q1HA 3RYRA 4U7BA 3E6DA 5DEQA 3K9TA 2E1CA 4CDGA 1MZBA 1B1BA 5BS6A 1KU9A 3R61A 1KU3A 3MZYA 3GFMA 1RUNA 2STTA 2GAUA 1QO0D 1WKMA 2GA2A 5CVVA 4OMYA 2CG4A 1UCRA 3CO7C 1XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9H A;  1HST A;  3NRV A;  1JHF A;  1BOA A;  4LK0 F;  4BHB A;  2YX7 A;  5E8G A;  1BI1 A;  1Y0U A;  1SMT A;  1IN5 A;  1KA8 A;  2BBY A;  2MD5 A;  1K78 B;  1IZ1 A;  3K1N A;  1J2X A;  1G3S A;  3M8E A;  3IWF A;  1XMK A;  4HZF A;  3LAP A;  3JSP A;  1XGM A;  3QPT A;  2ESH A;  3WTT C;  1XSD A;  4I0B A;  3LWF A;  2W85 A;  1QZZ A;  4PZJ A;  1K78 A;  1DPU A;  2ZO4 A;  3GXO A;  1O3T A;  4HF1 A;  4PCQ A;  4LK1 F;  3TDU C;  2VC0 A;  1ZH5 A;  4GXO A;  1REP C;  2UXN A;  3ULQ B;  5BPD A;  1LVA A;  1PP7 U;  2O61 A;  2D45 A;  3BP8 A;  4ZYH A;  1J0R A;  3CUQ A;  2HR3 A;  2HEO A;  1D8K A;  2NYX A;  2UXX A;  1XN7 A;  3ELK A;  3K2Z A;  2WC2 A;  4MTE A;  2RQP A;  3FXU A;  3LA7 A;  4O5V A;  3CUQ B;  4IPA A;  4CYD A;  5H6Q A;  2V1X A;  2ISZ A;  2J5P A;  4WK8 F;  4BH9 A;  1ZRD A;  3WU0 A;  3WTY C;  3HOS A;  3FXQ A;  2R7F A;  5ILV A;  1UFM A;  3H3Z A;  1P92 A;  2FU4 A;  3MZH A;  1ULY A;  2JRT A;  2X4H A;  4UHT A;  3L7W A;  4UNO A;  2EV6 A;  2P6T A;  4EJT A;  2EFW A;  5DCM A;  1TW3 A;  4Y15 A;  2HGC A;  3U1D A;  1KYZ A;  2FMY A;  4G7H F;  2Z5U A;  1R5H A;  2M87 A;  1KQ0 A;  1G6N A;  4G7Z F;  3J81 K;  2RV8 A;  3R0A A;  3ISP A;  5FGM A;  5HLI A;  5LBQ A;  2Z33 A;  3F8N A;  4AVP A;  4L9N A;  3ERE D;  1FZP B;  3BJO A;  2DAO A;  4I2O A;  3MFK A;  2DQR A;  3HTU A;  3I71 A;  3FMQ A;  5ILS A;  2IPQ X;  2DPD A;  4M74 A;  3IRR A;  1OYI A;  4IXA A;  4JBA A;  5K5O A;  4HYE A;  3EDP A;  3F72 A;  3C18 A;  1ZGA A;  5BQT A;  4D0P A;  1ZYR F;  4ASN A;  4WWC A;  3CTA A;  3VOE A;  3ZMV A;  3T0Y A;  1O3S A;  2M8E A;  3EQL F;  1TQP A;  2ESN A;  4GGG A;  1SD4 A;  2XRN A;  2MLG A;  4A0X A;  1W7P A;  2IA2 A;  2ZXJ A;  2QWW A;  4RB0 A;  4EGY A;  1WWX A;  2A68 F;  5H6R A;  4O3M A;  4A0Z A;  1R00 A;  2IT0 A;  5AIP A;  2PN6 A;  2PEX A;  1WRJ A;  3BDD A;  2XAQ A;  4U88 A;  4HA8 A;  3N97 A;  3B02 A;  2P5L C;  5FO5 A;  2JZY A;  3F8C A;  4FX4 A;  3KP3 A;  1O7F A;  1ZRF A;  2E1N A;  3TO9 A;  4MGR A;  4A6D A;  2VBZ A;  3G73 A;  2HKO A;  1FPQ A;  4KFC A;  1OYY A;  3CO6 C;  1IN7 A;  5LGN A;  1AOY A;  4U0W A;  4IF4 A;  2IA1 A;  2VBY A;  2ADU A;  2MH9 A;  2LSO A;  3LFK A;  4RS8 A;  3O2P E;  3FX3 A;  3GUD A;  4EM1 A;  3H3U A;  1UHW A;  2BGC A;  2BE5 F;  1TTY A;  2G7H A;  4PGG A;  1OMI A;  3TGN A;  1GHC A;  2VXZ A;  4HLX A;  4Q48 A;  2H6B A;  1E17 A;  2W25 A;  1B6A A;  2ISY A;  1GXQ A;  4XRF A;  4EV0 A;  1LDD A;  3TO6 A;  4QWQ A;  5ICC A;  1WI9 A;  5HS8 A;  1YQA A;  2EA2 A;  2G9W A;  1R1V A;  1ZLJ A;  5F6F A;  3HIF A;  5HS7 A;  4G7O F;  3GFL A;  3D5L A;  4RAZ A;  3WTU C;  1SD5 A;  3O3K A;  5FLX Z;  4H0E A;  1LNW A;  5JI6 A;  2W84 A;  2QEN A;  2XUB A;  1IRG A;  2CSO A;  2XGX A;  5JR3 A;  5D4R A;  3L09 A;  1TQI A;  3G3Z A;  1IUY A;  2PMU A;  2VBX A;  1JHH A;  3QP5 A;  1T38 A;  4IVN A;  5FD5 A;  5D8K B;  4P96 A;  2K86 A;  4ZYG A;  2A6E F;  1ZGJ A;  2FML A;  4HDU A;  5LHG A;  4MTD A;  2D2W A;  2XRO A;  4YFK F;  1J5Y A;  4AD9 A;  2EV5 A;  3NQO A;  3R0J A;  4RB3 C;  2Y48 A;  4F7Z A;  5HLG A;  3QAH A;  2PI0 A;  3CLO A;  2O03 A;  4HLY A;  2DTR A;  1NHA A;  1XGS A;  2H6C A;  3WG9 A;  3VFZ A;  2A3S A;  4M71 A;  3ROU A;  2NNN A;  3F6V A;  4A6E A;  3OV8 A;  1P4A A;  5BOX A;  5HVQ C;  1JE8 A;  2RVC A;  4I7H A;  1IXC A;  4WXH A;  3V7R A;  3MCZ A;  2CW0 F;  2DLL A;  3FXR A;  3PQJ A;  4K2E A;  3ABT A;  4G6Q A;  1O57 A;  3GX4 X;  2ETH A;  1B59 A;  1U5T A;  5D8L B;  4WXD A;  3ECH A;  2FOK A;  4KIG A;  3DQV C;  3WE3 A;  2VT3 A;  4HBL A;  3QP6 A;  2L54 A;  4N0B A;  3CDH A;  4ZYE A;  3H92 A;  1R5G A;  2ZFW A;  2CWE A;  3JTH A;  5DV5 A;  2F5C A;  3MQ0 A;  3GVA A;  1XCB A;  2FNP A;  1QZY A;  3BPX A;  2DBB A;  4L0Y B;  3DKW A;  3GF2 A;  1FYM A;  2XHK A;  1S8N A;  3QU6 A;  4CHU A;  2HDC A;  1W5T A;  4G8X A;  1I27 A;  4OIQ F;  3ZMU A;  1RUO A;  2VE8 A;  3F22 A;  4KDP A;  4HF2 A;  4NHJ A;  3GFI A;  3KE2 A;  1D3Y A;  1QQI A;  1O3R A;  3TQN A;  2CFX A;  2FQ3 A;  5K5Q A;  5IT9 Z;  1KYW A;  4LD5 A;  3DPT A;  3BZ6 A;  2PLY A;  5DDG A;  4R79 A;  2HWV A;  2RDP A;  3FHZ A;  5CVU A;  3E5X A;  4IHS A;  4IRH A;  2DQL A;  3EYI A;  3SZT A;  1ZG3 A;  1ZRE A;  2XIG A;  4KT5 C;  5E18 F;  3V8K A;  3E5U A;  1F1Z A;  2A5Y B;  1OPC A;  2L3D A;  5D6E A;  5DUI A;  1MJA A;  2EK5 A;  3C3W A;  4UVC A;  1BM9 A;  2GQQ A;  4YIF A;  5LEK A;  1B9M A;  3U2R A;  1BC8 C;  3KCC A;  3KP5 A;  4LLL A;  1ZHF A;  1Z9C A;  1BIB A;  2GXB A;  3MEX A;  4UXN A;  2O3F A;  4ESB A;  5LHI A;  1AWC A;  3MAJ A;  5EEH A;  2STW A;  1ODD A;  5CJ9 A;  3VOD A;  5JFR A;  4XSZ F;  3HRM A;  2JTV A;  1YLF A;  1W7P B;  4A5M A;  2IP2 A;  5KK1 A;  4EJW A;  5ED4 A;  1XD7 A;  2RKH A;  5CLS A;  2M1B A;  4LFU A;  1YG2 A;  2W24 A;  1W5S A;  3IHU A;  2ELH A;  1GVJ A;  4S04 A;  4XSX F;  2UWM A;  4PDK A;  1YS7 A;  3COA C;  3RPU A;  3KZZ A;  5E1Z B;  2KRF A;  5K5R A;  2VOO A;  3IKV A;  1XB4 A;  2OU2 A;  3WU1 B;  1DDN A;  3T8T A;  3D0S A;  1X3U A;  5TJJ A;  1V4R A;  4XBF A;  2PQ8 A;  5K1Y A;  2WTE A;  3GZ6 A;  2C6Y A;  1F5T A;  5ICF A;  1T6S A;  1Z6R A;  4XLP F;  1SD7 A;  4I09 A;  1P4W A;  2G7U A;  2V6C A;  4O6J A;  2KJC A;  1FP2 A;  2TDX A;  4TV7 A;  4ENN A;  2MH2 A;  4OIO F;  1Z1D A;  1IN8 A;  3R6S A;  4DQ2 A;  1XCV A;  3BY6 A;  3WOD F;  2R7D A;  4M72 A;  1IRF A;  1MKM A;  1S3J A;  3JTG A;  2DPU A;  1V3F A;  4ZYD A;  1SFE A;  5D5U B;  2QQB A;  2VON A;  4BQA A;  1BBY A;  1FLI A;  3C1D A;  4MEY F;  1U78 A;  2AS5 F;  4BXU A;  2CYY A;  3JAM K;  1RZ4 A;  1KGS A;  3B73 A;  3E6M A;  2BEO A;  4ETS A;  3TOA A;  4Q4Z F;  2CGP A;  1YIO A;  2MLK A;  4MHG A;  4L18 B;  1D8J A;  3HYI A;  3RKX A;  2XVC A;  4I01 A;  1F9N A;  3KET A;  3BJA A;  3L00 A;  5A2Q Z;  3KLN A;  2B0L A;  2EFQ A;  2PG4 A;  3M7G A;  5LHH A;  3HSE A;  2BV6 A;  3HSF A;  1R36 A;  1R22 A;  4E70 A;  2XKP A;  4RGR A;  4AWX B;  2OD5 A;  1UST A;  1T98 A;  3BJ6 A;  3HHH A;  1MDM A;  4RGU A;  5BPI A;  3I53 A;  2UZK A;  1IW7 F;  4MNU A;  4KMF A;  1B4A A;  1BI3 A;  5DCM B;  1B9N A;  2VT2 A;  1F4K A;  1OR7 A;  1HKQ A;  3I58 A;  1XSV A;  2E7X A;  2NNY A;  3HSR A;  3J80 Z;  1H9T A;  1HKS A;  2J5O A;  3GWZ A;  1OKR A;  2P5K A;  4I0A A;  3KEQ A;  3P7N A;  4YG2 F;  1QGP A;  2V1U A;  4L5J A;  1G3T A;  3FF5 A;  2H27 A;  3TDZ C;  2K7L A;  2COM A;  2ZME B;  1GXP A;  3T8R A;  2LDU A;  1PP8 F;  4WF2 A;  4A0Y A;  3KP2 A;  2P6S A;  2LKP A;  1RIO H;  5L3C A;  2FSW A;  2VOD A;  3BOQ A;  2WV0 A;  1ZG1 A;  1BC7 C;  3W6J B;  3HUG A;  2ZME A;  3SFZ A;  5FD6 A;  3IL2 A;  1G3Y A;  4KUM A;  1S7A A;  3F3X A;  1HXD A;  4YFN F;  1MJB A;  4LLN A;  2PMH A;  4GO1 A;  4JK1 X;  5ERI A;  2O0Y A;  3HOT A;  4HX4 A;  5FLX K;  4U7D A;  4ZZD A;  2Q2E A;  2QUF A;  5E1X A;  4EJU A;  2EV0 A;  5AIQ A;  4LG0 A;  4L9J A;  2ZCW A;  2IA0 A;  1G4D A;  5KVR A;  1YFH A;  1T39 A;  5HDN A;  1SFX A;  5L3G A;  4R8H A;  2FBI A;  2CO5 A;  2JSC A;  2ZJ2 A;  3QU3 A;  3ZN1 A;  5DD8 A;  1S7O A;  1ZLK A;  1FP1 D;  3FMR A;  1LQ1 A;  5FB2 A;  3OOP A;  4OMZ A;  1FBU A;  2Y75 A;  1P6R A;  4FX0 A;  2OQG A;  5A2Q K;  2H94 A;  2A07 F;  3M9A A;  3QPH A;  3C7J A;  1K6O A;  2LF8 A;  1YW7 A;  4M6X A;  4AIH A;  5ICE A;  4HQM A;  2MBF A;  1J75 A;  2IW5 A;  5E8I A;  4M9X A;  3N4M A;  3KP7 A;  3T1B A;  5LLQ A;  3LA3 A;  3WE2 A;  1R1T A;  3SHF A;  4OIN F;  1BI0 A;  3WTW C;  5HS9 A;  1U3E M;  3V4G A;  4OU0 A;  2HTS A;  2K27 A;  2DK5 A;  2P7C B;  5CYV A;  4LB5 A;  3ZP5 A;  5BMZ A;  4KNY A;  1EH7 A;  3ECO A;  3ZPL A;  4A2U A;  2CQK A;  1YW8 A;  2LF7 A;  4RB2 C;  2OZ6 A;  1DPR A;  5HOO A;  2Z99 A;  3F8F A;  4XLN F;  1FSE A;  3BPV A;  1K79 A;  3WTX C;  2DO7 A;  4KMU X;  1YW9 A;  1CGP A;  2FA5 A;  3GEZ A;  5E1W A;  2VN2 A;  4HW0 A;  1YYV A;  2RC4 A;  1J9I A;  3LAJ A;  2A61 A;  4HQE A;  5DYM A;  1KQ8 A;  3U9G A;  1S29 A;  4EGZ A;  5HDG A;  1LEA A;  3GFJ A;  1H0M A;  4UUV A;  1H9G A;  3J80 K;  2IJL A;  3EYY A;  5DD4 A;  3V7S A;  2D1V A;  4P5O A;  4CGZ A;  3WTS C;  2QZ8 A;  4ENJ A;  2L4M A;  2ZNZ A;  2JT1 A;  1FY7 A;  4BHC A;  4PGH A;  1RNL A;  3K1M A;  3V8J A;  1EH6 A;  3FM5 A;  2HFH A;  4CIC A;  3L9F A;  4M9S A;  1XSX A;  2KIM A;  1E2X A;  1HSJ A;  1PUE E;  1ZAR A;  2YX4 A;  4IRG A;  4IRI A;  3QRF F;  4RAY A;  5ILU A;  4ZH4 F;  4A5N A;  3HTS B;  4U0V A;  2L02 A;  2XAF A;  3BWG A;  1U6G A;  3KP6 A;  1HQC A;  1ZG5 A;  3RKW A;  3FZV A;  1ON1 A;  1USS A;  3F23 A;  2A6H F;  2P8T A;  4CXF A;  4DNC A;  2W57 A;  4NB5 A;  2EFO A;  1D5V A;  2MC3 A;  2QBY A;  5JHU A;  1J7K A;  1Z05 A;  4EVI A;  4UVA A;  2YPR A;  2VC1 A;  3KEO A;  2HZT A;  1WQ2 A;  1XMA A;  3MWM A;  2F5F A;  2ACJ A;  4HOB A;  3P9K A;  1LDK B;  4EM0 B;  3E6C C;  2L01 A;  1LDJ A;  3P9I A;  3TO7 A;  1RI7 A;  3WGG A;  2E7W A;  4KIF A;  4U0Y A;  2FEZ A;  4EMS A;  3GLX A;  1HKT A;  1Z7U A;  4IHT A;  4BYY A;  3I4P A;  4AIK A;  3CJN A;  4L9V A;  3E97 A;  4ON0 A;  3VEP A;  2XAS A;  4ZZL A;  2F2E A;  2QM3 A;  1R7J A;  5J8F A;  4KN4 X;  2FF4 A;  4G6D A;  1O7L A;  4BNC A;  1TNS A;  4L5I A;  5D5X B;  2EWN A;  2QYO A;  5J8C A;  1T0F A;  3K0L A;  2DFI A;  5D5V B;  4WX9 A;  1I5Z A;  1MDM B;  1O3Q A;  3I59 B;  4LGW A;  2LNB A;  4IJA A;  2MA3 A;  2NAZ A;  5D5W B;  3HRS A;  3ZN0 A;  2GWR A;  2VE9 A;  2XAG A;  2ZBK A;  4YFX F;  3O6B B;  3VB2 A;  4RGS A;  1LB2 A;  4Z2Y A;  1U5T C;  3DV8 A;  4KA4 A;  2JPC A;  1QNT A;  3F21 A;  2DW4 A;  2P7V B;  3KZY A;  3M1E A;  5HLH A;  1YTY A;  2R3S A;  2KIF A;  2OQR A;  4EM2 A;  1FBQ A;  1DUX C;  4I02 A;  2VBW A;  4GYG A;  2EA4 A;  3WTZ A;  3J7A O;  2KIU A;  3I64 A;  1YS6 A;  2WWY A;  2XKO A;  1U8R A;  2XV4 S;  4S05 A;  4B8X A;  2JPB A;  3P9C A;  1KU2 A;  2XAJ A;  3LA2 A;  2FBH A;  4M73 A;  1U5T B;  3PQK A;  2M30 A;  1R23 A;  1SFU A;  2X0L A;  2DT5 A;  1P2F A;  3E5Q A;  5E20 A;  1FBS A;  4Y17 A;  1ON2 A;  3S2W A;  1VTN C;  2GA1 A;  1FYK A;  1FNN A;  3M8F A;  2HYF A;  1IF1 A;  5F1R A;  4Q47 A;  1MJ9 A;  3HHG A;  3IKT A;  2XAH A;  1J59 A;  1U2W A;  1XDU A;  1SAX A;  2QBY B;  1S6L A;  1BIA A;  4EJO A;  1FC3 A;  3GO5 A;  6PAX A;  5HDK A;  2V79 A;  5LRR A;  4MEX F;  1FYL A;  2FBK A;  3TOB A;  5LGU A;  2IVM A;  4BAY A;  3RJP A;  4FHT A;  2QQA A;  4WCG A;  1TBX A;  1TLH B;  1HW2 A;  2EB7 A;  4RGX A;  3ZMD A;  4P55 A;  5L3B A;  4B09 A;  3RDI A;  2Y0M A;  1HBX G;  3ML6 A;  4HV5 A;  3F8B A;  1EV7 A;  4LG0 B;  2EFN A;  4KIB A;  5D4S A;  4HX8 A;  2H09 A;  1CF7 B;  1I6X A;  2Z9O A;  1OYW A;  2HTJ A;  4OOI A;  3ABU A;  3DEU A;  2D1H A;  3GW2 A;  5ICG A;  2HQR A;  3K69 A;  4HF0 A;  4ESJ A;  2KJB A;  5L3E A;  2DI3 A;  4WXC A;  4HV6 A;  4G9Y A;  4CZZ A;  4EQQ A;  1XGN A;  1K7A A;  5J6X A;  4M6Y A;  1A04 A;  4UVB A;  2HKX A;  2OA4 A;  2HS5 A;  5F64 A;  4GYI A;  2M45 A;  3RKY A;  1FT9 A;  3KLO A;  2F5E A;  3QOP A;  4LB6 B;  4YII A;  4GCV A;  3EET A;  2V9V A;  2ZKZ A;  2HOE A;  2HQN A;  3DP7 A;  5D6F A;  3T5X A;  4I98 B;  1MD0 A;  4HDV A;  2PFB A;  1EH8 A;  5CVI A;  3WGI A;  1SD6 A;  1W4M A;  2NS0 A;  3R4K A;  1BI2 A;  4MQV A;  4BHP A;  2L4A A;  3JAM Z;  4N9I A;  4MQ9 F;  1LEB A;  1KU7 A;  3I5U A;  1ZAO A;  4OIP F;  2RNJ A;  3IC7 A;  3J81 Z;  2A69 F;  4HX7 A;  3ZMT A;  2YSR A;  5JVT A;  1R58 A;  4P9U A;  2Q0O A;  2GIV A;  3L2C A;  3REO A;  3FMS A;  1ZRC A;  1QPM A;  4L0Z B;  5DUK A;  1IAW A;  2AXL A;  3FWE A;  1HW5 A;  2BYV E;  4UV8 A;  1L0O C;  1IXR C;  1T2K A;  3WGH A;  3V7C A;  1WSU A;  4A12 A;  5EEG A;  3NEU A;  1Z91 A;  1R1U A;  5IT9 K;  1FX7 A;  1UHM A;  4OIR F;  2YU3 A;  3RPQ A;  4Q5S F;  4ENM A;  3I54 A;  5CVJ A;  2YR2 A;  1JGS A;  2OZU A;  4AIJ A;  1TNT A;  3CUO A;  4KYW A;  2FE3 A;  2OAZ A;  3CUQ C;  2RGV A;  1QBJ A;  1PDN C;  5L3D A;  1P4X A;  3E6B A;  2DU9 A;  3R60 A;  5E17 F;  3ZQ7 A;  1FWZ A;  3RI4 A;  2PJP A;  4L9T A;  2NRA C;  1I1S A;  5CVR A;  3GZ5 A;  4RB1 A;  5H20 A;  1BN5 A;  1Z6T A;  2FXA A;  3DPL C;  3ZMZ A;  1TQM A;  2EFP A;  4FT8 A;  2RN7 A;  2P4W A;  1FOK A;  3V8L A;  3LQQ A;  5TRD A;  4NQW A;  5FFX A;  4R1H A;  3SQN A;  3DF8 A;  2O8X A;  3I0T A;  5LGT A;  3Q5F A;  4JQF A;  4KIC A;  1C0W A;  2FNA A;  3RTR A;  3HRT A;  5L3F A;  2V1D A;  4ENK A;  5DCF A;  2QVO A;  3Q9V A;  1IN6 A;  4G94 A;  4EJV A;  2EJR A;  1JXS A;  5LEJ A;  4Y13 A;  1I1G A;  2GXG A;  3LST A;  1ZN2 A;  3RYP A;  1L3L A;  5FFZ A;  3JSO A;  2K4J A;  4CO8 A;  2VOP A;  1FSH A;  4M9Z A;  5AON A;  3Q9S A;  1DP7 P;  2QQ9 A;  3SZP A;  3DXJ F;  2FRH A;  1UB9 A;  3PFI A;  1W7P D;  2ZNY A;  4KN7 X;  1KQ9 A;  1XDS A;  2P5V A;  2GZW A;  1G3W A;  5LRS A;  3FM3 A;  2PBI A;  4HAM A;  4UV9 A;  2QLZ A;  4LLG F;  1BJA A;  1HW1 A;  3LQR A;  3SXY A;  1ONV A;  2O6G E;  1CF7 A;  4QLC U;  1SMY F;  3W6K B;  3F6O A;  2Q8K A;  3EUH A;  3WTV C;  1MGT A;  2HYG D;  2M5W A;  3IRQ A;  3HRU A;  2KKO A;  4LJZ F;  2DK8 A;  2Z3Y A;  4P9F A;  1IXS B;  3I59 A;  3IWZ A;  3ZMS A;  3K1P A;  2IRF G;  2K02 A;  3KP4 A;  1IN4 A;  4ESF A;  3TKY A;  1LJ9 A;  2F5D A;  1STZ A;  2OBP A;  3DFG A;  3RIR A;  3KFW X;  1TW2 A;  3AAF A;  2K4B A;  3F8M A;  3JW4 A;  3GYH X;  3BRO A;  5IT3 A;  4LMY A;  1YO5 C;  3E3V A;  1Q1H A;  3RYR A;  4U7B A;  3E6D A;  5DEQ A;  3K9T A;  2E1C A;  4CDG A;  1MZB A;  1B1B A;  5BS6 A;  1KU9 A;  3R61 A;  1KU3 A;  3MZY A;  3GFM A;  1RUN A;  2STT A;  2GAU A;  1QO0 D;  1WKM A;  2GA2 A;  5CVV A;  4OMY A;  2CG4 A;  1UCR A;  3CO7 C;  1XGO A; 
#chains in the Genus database with same CATH topology
 4N9H A;  1HST A;  3NRV A;  1JHF A;  1BOA A;  3DU5 A;  4LK0 F;  4BHB A;  2DA4 A;  2YX7 A;  5E8G A;  2JSP A;  3A2K A;  1BI1 A;  3G1L A;  1Y0U A;  1SMT A;  5B5E C;  3H1C A;  1IN5 A;  1KA8 A;  2BBY A;  1SAN A;  2I5U A;  2MD5 A;  4DYR A;  1K78 B;  3S93 A;  1IZ1 A;  2VB6 A;  1GUU A;  1EF4 A;  1A5J A;  3K1N A;  4NC6 A;  1J2X A;  1G3S A;  2IGM A;  3CJT B;  2O5R A;  3M8E A;  2Y30 A;  2XF6 A;  3IWF A;  1XMK A;  4HZF A;  3LAP A;  4C2U A;  3S1Q J;  3JSP A;  1XGM A;  3QPT A;  2ESH A;  5B66 C;  3WTT C;  1XSD A;  2K9M A;  1W5C C;  4I0B A;  5E3L A;  2R5Z A;  1B72 B;  3LWF A;  5IP9 J;  2W85 A;  1UG0 A;  1QZZ A;  1MMA A;  4PZJ A;  5J1R A;  1K78 A;  1DPU A;  2JRM A;  2ZO4 A;  2ZXH A;  3GXO A;  1O3T A;  4HF1 A;  2KQR A;  4PSW A;  4PCQ A;  4ANJ A;  4LK1 F;  3TDU C;  2VC0 A;  1ZH5 A;  4GXO A;  1REP C;  3F9K A;  2WY8 Q;  2UXN A;  3ULQ B;  1T08 B;  5M3M J;  1A36 A;  5BPD A;  1LVA A;  3CP2 A;  1PP7 U;  2HVS A;  2O61 A;  2D45 A;  1TL8 A;  3BP8 A;  4XLA A;  4X1E A;  4ZYH A;  1JI8 A;  4XOP A;  1J0R A;  5GAD J;  1ZKG A;  3CUQ A;  2HR3 A;  2HEO A;  3O8G A;  1D8K A;  2NYX A;  2UXX A;  4V19 K;  1XN7 A;  1VQ6 I;  3ELK A;  3K2Z A;  3KZI C;  2WC2 A;  4MTE A;  3H5R A;  3FXL A;  2RQP A;  1N25 A;  3FXU A;  2R7W A;  3LA7 A;  1MBE A;  4O5V A;  4AYB A;  4CYC B;  3CUQ B;  3OWT A;  4IPA A;  1FMV A;  4CYD A;  3PL8 A;  3BG3 A;  2V1X A;  5H6Q A;  1R49 A;  2CMP A;  1Z77 A;  2J5P A;  4WK8 F;  2ISZ A;  4A93 J;  4BH9 A;  2KRH A;  2PMZ A;  1ZRD A;  3WU0 A;  3WTY C;  3HOS A;  3KIO A;  3FXQ A;  1XPX A;  2R7F A;  2IXS A;  5ILV A;  2L0K A;  4PJL A;  4C30 A;  4XKC A;  1WJA A;  1UFM A;  3H3Z A;  1U0J A;  2R93 J;  5FLM J;  1P92 A;  1V5G A;  2FU4 A;  1SVL A;  2FQ4 A;  2VQL A;  1ULY A;  4C3H J;  3A01 B;  3ZQQ A;  2JRT A;  3MZH A;  1ITY A;  3HB9 A;  1SAU A;  3ZRG A;  2X4H A;  2PJR A;  4UHT A;  3L7W A;  4UNO A;  2EV6 A;  2P6T A;  4EJT A;  2EZH A;  2EFW A;  1Y1W J;  2ME0 A;  1MNM C;  5DCM A;  1TW3 A;  4Y15 A;  1TT5 B;  1RR8 C;  2HGC A;  3U1D A;  1KYZ A;  2FMY A;  2YUS A;  4DJA A;  4G7H F;  2VLA A;  1PVE A;  3LSJ A;  4A3B J;  2XB0 X;  2Z5U A;  4ZYA A;  1R5H A;  2DJI A;  3CJQ B;  4II2 A;  2M87 A;  4AVZ A;  1KQ0 A;  4A3C J;  2DTZ A;  2VI6 A;  4I6Z A;  2F5V A;  3GTJ J;  1G6N A;  4G7Z F;  2DYR H;  2RV8 A;  3J81 K;  3OYK A;  4E6K G;  5M5W J;  1UZC A;  4B4C A;  4NDL A;  4E7J A;  2DFF A;  2VQH A;  3ISP A;  3R0A A;  2CU7 A;  5FGM A;  5HLI A;  5LBQ A;  2Z33 A;  1ZQ3 P;  3F8N A;  4AUX A;  1NG7 A;  4AVP A;  4L9N A;  3ERE D;  1FZP B;  4U87 A;  3S16 J;  3BJO A;  2DAO A;  4I2O A;  3MFK A;  1H88 C;  4XLF A;  3H3V K;  4RM2 A;  2VQC A;  1U9O A;  2DQR A;  2HQ5 A;  2KP6 A;  3FMQ A;  3HTU A;  3I71 A;  5ILS A;  2IPQ X;  4LIT A;  2LVS A;  2DPD A;  4M74 A;  3IRR A;  1OYI A;  4IXA A;  4JBA A;  5K5O A;  4HYE A;  3EDP A;  3F72 A;  2BZT A;  3C18 A;  3CMA I;  1ZGA A;  3OYA A;  2R5Y B;  5IYC J;  5BQT A;  4D0P A;  1AKH B;  2ZSI B;  2QGU A;  3GTL J;  2DOA A;  1ZYR F;  4BEH B;  4ASN A;  4WWC A;  3CCE I;  1I3Q J;  3CTA A;  3VOE A;  3ZMV A;  3T0Y A;  1O3S A;  2HDD A;  3SEZ A;  2M8E A;  3EQL F;  1GDT A;  1TQP A;  2M0C A;  2VKE A;  2ESN A;  3G1M A;  1SD4 A;  2PMZ N;  4GGG A;  2F6C A;  4YIR X;  2XRN A;  2MLG A;  2XGE A;  3CCV I;  4A0X A;  1W7P A;  2IA2 A;  3I4M J;  2ZXJ A;  2QWW A;  2IEK A;  4RB0 A;  3S1R J;  4EGY A;  1WWX A;  1AKH A;  2H8W A;  3ABM H;  2A68 F;  3IAM 2;  2OJE D;  5H6R A;  2Y9Z A;  4O3M A;  4A0Z A;  3ZQG A;  2E71 A;  4UUT A;  1PJR A;  3FKI J;  3LOC A;  1R00 A;  1PUF A;  2ZFU A;  2IT0 A;  3IUO A;  1DP3 A;  4KIS A;  5AIP A;  2PN6 A;  4KT6 A;  2PEX A;  3ZOB A;  1ETY A;  2E1O A;  3K4B A;  3HOU J;  1WRJ A;  2JK3 A;  3BDD A;  3HKZ A;  4CH7 A;  2XAQ A;  4U88 A;  4HA8 A;  3N97 A;  3B02 A;  2BXZ A;  3DTE A;  2K3P A;  5FO5 A;  2P5L C;  1DGW Y;  2L9N A;  3FBN B;  1D0Y A;  2JZY A;  5EZH A;  3F8C A;  4FX4 A;  3KP3 A;  2ZC2 A;  3C2G A;  1O7F A;  1X3Z B;  1ZRF A;  4NUB A;  4XR6 A;  2DA1 A;  2E1N A;  4OWR B;  1IRX A;  3TO9 A;  3VSK A;  4BJT A;  4MGR A;  1QA6 A;  4A6D A;  2VBZ A;  1BJZ A;  3G73 A;  2HKO A;  1FPQ A;  1OYY A;  1OCZ H;  4KFC A;  3E0J B;  3CO6 C;  1IN7 A;  3DBL B;  1ORK A;  2E1M C;  5LGN A;  3ZCO A;  1AOY A;  4U0W A;  3BQY A;  2QSF X;  4IF4 A;  2IA1 A;  5IYB J;  4MLO A;  3BR2 A;  2VBY A;  2ADU A;  2MH9 A;  2LSO A;  2IS4 A;  3LFK A;  1ETW A;  4OAY A;  4RS8 A;  4Y4R A;  5HOD A;  3BG6 A;  1QZE A;  1TT0 A;  3FX3 A;  3GUD A;  3O2P E;  4EM1 A;  3H3U A;  3S3N A;  1AU7 A;  1FOX A;  2VPR A;  4M3G A;  1UHW A;  3OYJ A;  3FDY A;  2BGC A;  2BE5 F;  3M4O J;  1TTY A;  2G7H A;  1FIP A;  1RKW A;  1T95 A;  1VQ9 I;  4PGG A;  1OMI A;  2KL4 A;  5DTD A;  2KDZ A;  3AL0 C;  3MKY B;  3TGN A;  4JP0 A;  1GHC A;  2VXZ A;  4HLX A;  4Q48 A;  2H6B A;  1E17 A;  1QVU A;  2X6Y A;  3H9J A;  2W25 A;  4PJM A;  1B6A A;  2ISY A;  1GXQ A;  2L5Q A;  3DEW A;  4XRF A;  4EV0 A;  1LDD A;  3TO6 A;  4QWQ A;  5ICC A;  1FEX A;  1WI9 A;  3HKZ N;  2DA2 A;  3ZQC A;  1XMX A;  5HS8 A;  2CJJ A;  1YQA A;  2EA2 A;  5C44 J;  1Y0N A;  1YE9 A;  2G9W A;  5CKT A;  1YIJ I;  1R1V A;  1ZLJ A;  5F6F A;  1HDP A;  3HIF A;  5HS7 A;  4A3I J;  4G7O F;  3GFL A;  3E1S A;  3D5L A;  4RAZ A;  3WTU C;  3BQZ A;  1SD5 A;  3GBG A;  3O3K A;  5FLX Z;  4H0E A;  4EAT A;  2LKS A;  1LNW A;  3DLA A;  4F3Q A;  4PJN A;  5JI6 A;  3PSI A;  2W84 A;  1MNE A;  3K6G A;  2QEN A;  5TIS C;  1N78 A;  2XUB A;  2X85 A;  1OCP A;  1IRG A;  2CSO A;  3QYB A;  2XGX A;  4PFO A;  5JR3 A;  3BC8 A;  5D4R A;  5GTH C;  3L09 A;  1TQI A;  4BQO A;  4D7M A;  3G3Z A;  3H0D A;  1IUY A;  2PMU A;  3ZXS A;  3KPH A;  2MW8 A;  1X2N A;  4MO7 A;  4BDZ A;  3DCF A;  4E4H A;  2VBX A;  5KNL A;  1JHH A;  3QP5 A;  4IVN A;  5FD5 A;  1T38 A;  5D8K B;  1E3O C;  4P96 A;  3I56 I;  2DCE A;  2K86 A;  4ZYG A;  2F4I A;  4PJ0 C;  2BXY A;  2A6E F;  4BKX A;  2DA5 A;  4CCK A;  3TBI A;  2H1L A;  3S8P A;  5HLT A;  1ZGJ A;  2FML A;  4HDU A;  1S7E A;  5LHG A;  4DOZ A;  2HOT A;  4E7S A;  3SZG A;  4MTD A;  2D2W A;  5DM6 F;  2XRO A;  3GTQ J;  4YFK F;  1J5Y A;  2EZI A;  4AD9 A;  2EV5 A;  3NQO A;  2IBD A;  3R0J A;  3M1C A;  4CSW A;  4RB3 C;  2MAB A;  1Z21 A;  4XN0 A;  2Y48 A;  4F7Z A;  5HLG A;  3QAH A;  2PI0 A;  3CLO A;  2O03 A;  2WB1 A;  4HLY A;  2DTR A;  1VQK I;  2LR8 A;  1NHA A;  2JWT A;  4FE4 A;  2E5N A;  4B47 A;  4HNV A;  1XGS A;  2K85 A;  2H6C A;  3WG9 A;  3CCQ I;  3VFZ A;  2A3S A;  1VFC A;  4M71 A;  3ROU A;  3JRH A;  1GT0 C;  2CW8 A;  1R5I D;  3LSG A;  2NNN A;  3F6V A;  4RMN A;  3SEQ A;  2OC6 A;  1MMD A;  4CCL A;  1APL C;  4A6E A;  3OV8 A;  3H5N A;  1P4A A;  2VPL A;  2JA5 J;  3U1K A;  5BOX A;  3IP4 B;  5HVQ C;  1LFP A;  1E0E A;  1JE8 A;  2WAF A;  3A0H C;  2XSJ C;  2RVC A;  2QKL B;  5E3M A;  3PUB A;  4I7H A;  2CW7 A;  2BY3 A;  4I76 A;  1IXC A;  4WXH A;  3V7R A;  1VF9 A;  2BOL A;  2OCC H;  2UV1 A;  3D5S C;  3MCZ A;  1X4P A;  2CW0 F;  2DLL A;  3FXR A;  2ID6 A;  1MSF C;  2A05 A;  2HYJ A;  3PQJ A;  1YRN A;  4K2E A;  3ABT A;  4G6Q A;  1O57 A;  2DOF A;  3GX4 X;  2FD5 A;  2EBI A;  3ZQH A;  1ETQ A;  2ETH A;  1MMN A;  2DA7 A;  4B43 A;  1ZR4 A;  3CQZ J;  3CCL I;  2BHZ A;  1B59 A;  1U5T A;  5D8L B;  4Y3O A;  2D5V A;  1BW5 A;  4WXD A;  3ECH A;  3M07 A;  2FOK A;  4KIG A;  3DQV C;  1RES A;  3JRD A;  3WE3 A;  3OYC A;  2VT3 A;  4XON A;  3CP8 A;  4HBL A;  3QP6 A;  2QA4 I;  1VQL I;  5KCM A;  2L54 A;  2WAQ A;  4N0B A;  3CDH A;  4ZDP A;  4RAG A;  4ZYE A;  3H92 A;  2AQE A;  2X1E A;  4V2G A;  1R5G A;  1PYV A;  1TWF J;  2ZFW A;  2CWE A;  2ZME C;  3JTH A;  4A3K J;  4BQQ A;  1RR7 A;  5DV5 A;  1KON A;  1SFO J;  2F5C A;  3S3O A;  1FTT A;  4BQN A;  3MQ0 A;  2DFE A;  3GVA A;  1XCB A;  2FNP A;  1QZY A;  3LL7 A;  2JA6 J;  3BPX A;  2DBB A;  4L0Y B;  2PX9 A;  3DKW A;  2CV0 A;  2BY1 A;  3GF2 A;  5K7F A;  4XMY A;  2M7B A;  1FYM A;  2XHK A;  1S8N A;  2A5W A;  3QU6 A;  5HNF A;  4CHU A;  2EIK H;  3SYT A;  2M4K A;  2DXI A;  1MIJ A;  2HDC A;  1W5T A;  4G8X A;  1I27 A;  3K4N A;  4OIQ F;  4FQG A;  3ZMU A;  1RUO A;  3OR1 C;  2XPU A;  5GPA A;  3FXO A;  1BR4 A;  5K7Z A;  1Y1V J;  1EKE A;  2VE8 A;  3MVP A;  4XLH A;  1LUJ B;  3EUH C;  3QWL A;  3O8H A;  4JX6 A;  2Y0S N;  2ECB A;  3F22 A;  4F91 B;  4KDP A;  4XOT A;  4HF2 A;  4NHJ A;  3AL0 B;  1S9H A;  3GFI A;  1JKR C;  3KE2 A;  3UNG C;  1D3Y A;  1QQI A;  2XPV A;  1GV2 A;  1O3R A;  2XF5 A;  4BXF A;  3HPG A;  2CQQ A;  5J40 A;  4DBR A;  3CME I;  3TQN A;  2CFX A;  2FQ3 A;  3FBI B;  4JYK A;  3VPR A;  2LFB A;  5K5Q A;  5IT9 Z;  1LE8 B;  1HCR A;  4CCO A;  2BY0 A;  1KYW A;  3VDX A;  4LD5 A;  4A3E J;  3DPT A;  2F48 A;  3FXJ A;  3BZ6 A;  3W6V A;  4HST A;  2PLY A;  5DDG A;  4R79 A;  5M5Y J;  1YIT I;  2HWV A;  2RDP A;  3JRC A;  2VJJ A;  1YX3 A;  3CC2 I;  3P5J A;  2LTP A;  3FHZ A;  2XF7 A;  4D5C A;  5CVU A;  3E5X A;  4XK4 A;  2KZG A;  2IGK A;  4IHS A;  3K10 A;  2EIN H;  2FJ1 A;  1B8I B;  4IRH A;  2OV7 A;  2DQL A;  1P7I A;  3EYI A;  3SZT A;  1OJL A;  1MBG A;  1ZG3 A;  1ZRE A;  5EDN A;  2XIG A;  2LYC A;  4KT5 C;  5E18 F;  3V8K A;  2LRE A;  3BCA A;  3Q0U A;  3E5U A;  1F1Z A;  2A5Y B;  1OPC A;  2L3D A;  5D6E A;  5DUI A;  1MBF A;  1MJA A;  3CLQ A;  2EK5 A;  3C3W A;  4UVC A;  1YHQ I;  3UKG A;  1BM9 A;  2GQQ A;  4YIF A;  5LEK A;  5EEA A;  1B9M A;  2QSG X;  2LC2 A;  3U2R A;  1BC8 C;  3KCC A;  3KP5 A;  2HXO A;  2LP0 A;  4QPQ A;  4LLL A;  1ZHF A;  4ZDL A;  5BNG A;  1Z9C A;  1BIB A;  3AG3 H;  3DTK A;  3CJR B;  2GXB A;  4F52 A;  3A0B C;  4RLQ A;  5B3S H;  3JRE A;  3MEX A;  4UXN A;  2O3F A;  2L7M P;  1DU0 A;  2XC7 A;  3VYS B;  4ESB A;  5LHI A;  1MBH A;  1AWC A;  1TWC J;  2P0W A;  3MAJ A;  4IL6 C;  5EEH A;  1ENH A;  2M3A A;  4C9Y A;  1I3A A;  2STW A;  4IHX A;  1X1B A;  1ODD A;  2LRD A;  2ZB9 A;  5CJ9 A;  4BE0 A;  3QPL A;  3NWT A;  4D1Q A;  3VOD A;  1IDZ A;  5JFR A;  1D1A A;  4XSZ F;  3HRM A;  2E60 A;  2JTV A;  1U9N A;  2CS3 A;  3DTI A;  4B3X A;  1YLF A;  2Q1Z B;  1TWA J;  1W7P B;  2MSY A;  4A5M A;  2IP2 A;  5KK1 A;  2GOX B;  4EJW A;  3CCR I;  5ED4 A;  1XD7 A;  3TMO A;  4ABZ A;  2ZXW H;  1VI0 A;  2NS7 A;  2RKH A;  3I55 I;  5CLS A;  3DBR B;  2R5Y A;  1IJW C;  3J7A Y;  5M5X J;  4PSX A;  2M1B A;  2R7Q A;  3G2B A;  3HBL A;  4LFU A;  1YG2 A;  3BG9 A;  3PFY A;  1JTY A;  2W24 A;  3JRF A;  1WHU A;  1W5S A;  2KHM A;  3IHU A;  5CQE A;  2ELH A;  1MMS A;  1GVJ A;  1Z67 A;  3CCM I;  2LY1 A;  3PIP F;  4S04 A;  4XSX F;  2UWM A;  4PDK A;  2BVL A;  1YS7 A;  3COA C;  1OFC X;  3RPU A;  4E7H A;  1U8B A;  2XRL A;  3KZZ A;  5E1Z B;  2KRF A;  5K5R A;  2VOO A;  4BY7 J;  3IKV A;  5C3E J;  3CC4 I;  1XB4 A;  2OU2 A;  3TED A;  1SEU A;  1W36 C;  3WU1 B;  1DDN A;  3T8T A;  3D0S A;  3CC7 I;  1X3U A;  1RC9 A;  2M4G A;  5TJJ A;  4CCM A;  1V4R A;  4XBF A;  4E7L A;  2PQ8 A;  1A6I A;  3CCU I;  5K1Y A;  1MW7 A;  2WTE A;  3GZ6 A;  3TW6 A;  2C6Y A;  1F5T A;  5ICF A;  1T6S A;  1Z6R A;  4XLP F;  1X4O A;  4IOC F;  5GPC A;  1SD7 A;  4I09 A;  4Y52 J;  4KIT B;  1JUP A;  1P4W A;  4ITV A;  3CCJ I;  2ZJP F;  1VQM I;  3K4L A;  2G7U A;  2V6C A;  4O6J A;  2KJC A;  4NC7 A;  2JJ7 A;  1FP2 A;  1Z7L A;  2TDX A;  4TV7 A;  2FUG 2;  4ENN A;  3OSF A;  2MH2 A;  4OIO F;  1Z1D A;  1IN8 A;  4IOA F;  3R6S A;  2AQF A;  5GP9 A;  4DQ2 A;  1XCV A;  3BY6 A;  2CQX A;  3WOD F;  3IH3 A;  3AG2 H;  2R7D A;  3CZ6 A;  4M72 A;  2I10 A;  1IRF A;  1S3J A;  1MKM A;  2MC4 A;  1YRN B;  4IQJ A;  3JTG A;  3U21 A;  2IGN A;  3C2B A;  2DPU A;  1V3F A;  4ZYD A;  1LFU P;  2KIS A;  2K9N A;  1SFE A;  4JOM A;  3RSN A;  2QQB A;  5D5U B;  2R5Z B;  2ELJ A;  1NG6 A;  2HI3 A;  2VON A;  2DMT A;  3LFU A;  2WA0 A;  4CA0 A;  1FJL A;  4BQA A;  1X1D A;  1BBY A;  2ID3 A;  1NK2 P;  1FLI A;  3C1D A;  2W82 A;  1W0U A;  2KMU A;  4MEY F;  2GOM A;  5M3F J;  1U78 A;  1OCT C;  1D0X A;  2AS5 F;  3CES A;  4BXU A;  1LKX A;  3OMY A;  3W2V A;  2CYY A;  3DWL E;  5EGO A;  1D5Y A;  3JAM K;  1RZ4 A;  1KGS A;  3B73 A;  3VYU B;  1XX5 A;  1AA7 A;  3E6M A;  2BEO A;  4ETS A;  2XPW A;  2R7X A;  4FCY A;  3TOA A;  3PIO F;  4Q4Z F;  2Y31 A;  1YIO A;  2CGP A;  2MLK A;  3BG5 A;  4A3L J;  2VKD A;  2CV1 A;  2E5Z A;  3BTC A;  4MHG A;  4L18 B;  3B6A A;  1D0Z A;  1D8J A;  4J01 A;  3HYI A;  3UR3 C;  2JUC A;  3RKX A;  1X1A A;  4C2T A;  2XVC A;  5E79 C;  4I01 A;  1F9N A;  2R7U A;  3K4J A;  3KET A;  3BJA A;  3S1N J;  2DMU A;  1WGX A;  1QHG A;  3HJE A;  3L00 A;  5A2Q Z;  3BLY A;  3KLN A;  2B0L A;  2EFQ A;  2PG4 A;  3DEE A;  3M7G A;  3G6E I;  1AHD P;  2AHQ A;  4B3A A;  5LHH A;  3HSE A;  2RRE A;  1OCO H;  2BV6 A;  3H35 A;  4BJ6 C;  3HSF A;  3G4S I;  3BR6 A;  4CUG A;  1R36 A;  1R22 A;  2V26 A;  1DGR M;  4E70 A;  3MZ8 A;  2K5C A;  4NC8 A;  2XKP A;  4RGR A;  4C3I J;  4AWX B;  1JJ8 C;  2OD5 A;  1UST A;  4AYB N;  1S5L C;  1T98 A;  3MKL A;  1FTZ A;  2DYS H;  3BJ6 A;  2M2E A;  3HHH A;  1MDM A;  2KDO A;  5FRM A;  4RGU A;  4A3F J;  3I53 A;  4XRS A;  2UZK A;  5BPI A;  1IW7 F;  4MNU A;  4KMF A;  1B4A A;  1BI3 A;  2R0Q C;  5DCM B;  1B9N A;  4H4K C;  3JRG A;  2FOW A;  4QPO A;  3NAR A;  2VT2 A;  3S32 A;  2DOD A;  1F4K A;  2E34 A;  1OR7 A;  4NBQ A;  1SC7 A;  1DQU A;  2BY2 A;  5EYR A;  2V9K A;  3BR5 A;  4XL9 A;  1E3P A;  1HKQ A;  5FKK A;  4J00 A;  3I58 A;  1XSV A;  1WVR A;  1HLV A;  2E7X A;  2NNY A;  5FRN A;  3HSR A;  3J80 Z;  5GTI C;  1H9T A;  1HKS A;  3RPU D;  3L1P A;  2J5O A;  3GWZ A;  2R7S A;  1T56 A;  1OKR A;  2P5K A;  2W7N A;  3PO2 J;  3PNY A;  4I0A A;  4BAC A;  3KEQ A;  3P7N A;  4YG2 F;  5K7H A;  2Y9Y A;  1QGP A;  2V1U A;  4L5J A;  1G3T A;  3FF5 A;  1TC3 C;  2H27 A;  5J47 A;  1BA5 A;  3TDZ C;  2K7L A;  2COM A;  2EQR A;  4E7I A;  3ASO H;  4M6V A;  2COB A;  4RLF A;  2ZME B;  3IH2 A;  4KJZ A;  3GTK J;  1GXP A;  3FXM A;  1VQP I;  3T8R A;  2LDU A;  1PP8 F;  4JX4 A;  4WF2 A;  2W48 A;  2CUE A;  4A0Y A;  3KP2 A;  2P6S A;  4DZJ A;  2LKP A;  1RIO H;  3BG7 A;  1R71 A;  5L3C A;  2FSW A;  3ESW B;  2IAI A;  2VOD A;  3BOQ A;  2WV0 A;  4JX5 A;  2HDW A;  4A69 C;  3LNQ A;  1ZG1 A;  1BC7 C;  3W6J B;  3HUG A;  2DMN A;  3OSG A;  1VQO I;  1NH3 A;  2ZME A;  4XM3 A;  2MGQ A;  3FIS A;  5C4X J;  3SFZ A;  5FD6 A;  3IL2 A;  1G3Y A;  3K70 D;  2OTJ I;  4KUM A;  1S7A A;  3F3X A;  4UY8 I;  3S1M J;  2HU9 A;  1HXD A;  4YFN F;  3A1Y A;  1TWH J;  1MJB A;  3WHC A;  4LLN A;  2PMH A;  4GO1 A;  3AFH A;  4JK1 X;  4DYQ A;  5ERI A;  2O0Y A;  3HOT A;  4HX4 A;  4M3F A;  4DBQ A;  4U7D A;  1XS9 A;  4ZZD A;  1ETK A;  5FLX K;  2Q2E A;  2QUF A;  5E1X A;  4EJU A;  2EV0 A;  5AIQ A;  5IYD J;  4LG0 A;  2KFD A;  4L9J A;  4BJ5 C;  2XGC A;  5EG0 B;  2ZCW A;  2IA0 A;  3J7Y J;  1G4D A;  2JA7 J;  1WJB A;  2JMW A;  5KVR A;  1YFH A;  1T39 A;  3HOY J;  1WI3 A;  5HDN A;  1SFX A;  5L3G A;  4R8H A;  4ZTJ A;  2L2O A;  2FBI A;  2CO5 A;  2JSC A;  2ZJ2 A;  3QU3 A;  2E35 A;  4OAZ A;  3ZN1 A;  2DJN A;  3HZJ A;  1G59 A;  5DD8 A;  1Y6I A;  2Q2E B;  3BCB A;  4M3B A;  1BW6 A;  4BDY A;  1S7O A;  2HQA A;  1ZLK A;  1IO2 A;  1FP1 D;  1RPW A;  3FMR A;  3FKJ A;  1LQ1 A;  2CUJ A;  2DDA A;  2WAD A;  5FB2 A;  3W2A A;  3QOD A;  3OOP A;  4OMZ A;  1SVM A;  1FBU A;  2Y75 A;  1P6R A;  2LK2 A;  4FX0 A;  2OQG A;  1K6Y A;  1K61 A;  4FIS A;  5A2Q K;  2M7A A;  2H94 A;  2A07 F;  3M9A A;  1Z3Y A;  3TL4 X;  3QPH A;  3C7J A;  1QU3 A;  1I6H J;  1K6O A;  5IY5 H;  2LF8 A;  1WJE A;  1YW7 A;  4X6A J;  4ZDO A;  4M6X A;  4AIH A;  3RKQ A;  2KIQ A;  1EJ9 A;  4BBR J;  5ICE A;  3DBH B;  5GAG J;  4HQM A;  2NOJ B;  5FKN A;  2PJR B;  2MBF A;  1J75 A;  4UUS A;  4HNU A;  2K3F A;  2IW5 A;  3BZK A;  1ZR2 A;  5E8I A;  4M9X A;  1LE8 A;  3N4M A;  1IUF A;  3KP7 A;  1D1C A;  3CF5 F;  3T1B A;  2AXT C;  2DDB A;  2DN0 A;  3PNT A;  5LLQ A;  3A02 A;  1RET A;  1OQY A;  3LA3 A;  3WE2 A;  1H89 C;  4RA2 A;  1W36 D;  1R1T A;  4QIW N;  2A6T A;  3SHF A;  2QEX I;  2NXN B;  3HOV J;  4OIN F;  3OS0 A;  4BE2 A;  1BI0 A;  3WTW C;  5HS9 A;  1U3E M;  3V4G A;  4OU0 A;  2HTS A;  4HG2 A;  3S2H J;  3KYL A;  5JLX A;  2K27 A;  2DK5 A;  2P7C B;  5CYV A;  4LB5 A;  3ZP5 A;  5BMZ A;  1N77 A;  2QKM B;  2IGO A;  4A3M J;  4KNY A;  1EH7 A;  1R4M B;  3ECO A;  1OCR H;  3ZPL A;  4A2U A;  1S72 I;  2AO9 A;  3A01 A;  2CQK A;  1YW8 A;  4LG3 A;  2LF7 A;  4RB2 C;  2OZ6 A;  1DPR A;  1P7J A;  1YJW I;  5HOO A;  2Z99 A;  3F8F A;  4XLN F;  3X2Q H;  1FSE A;  1JT0 A;  3BPV A;  3OL3 A;  3OS1 A;  4C2M J;  4FAS D;  1TWG J;  3HGG A;  4IHY A;  3HDD A;  5F27 A;  1K79 A;  3WTX C;  5F1J A;  4BY1 J;  2DO7 A;  4BGD A;  4KMU X;  3I9V 2;  2ME6 A;  1YW9 A;  4B1R A;  4AID A;  5DM7 F;  5EGO B;  1CGP A;  4S0H B;  2FA5 A;  3GEZ A;  2QQ8 A;  3KEY A;  5E1W A;  3HXL A;  1Y39 A;  1X1P A;  2VN2 A;  4XID A;  4HW0 A;  2Y2Z A;  1YYV A;  1FMW A;  5J1U A;  2RC4 A;  3MN2 A;  1J9I A;  3LAJ A;  3ABL H;  2A61 A;  4HQE A;  5DYM A;  1KQ8 A;  2MFZ A;  3U9G A;  1VND A;  5FRO A;  1S29 A;  4EGZ A;  5HDG A;  2HOS A;  1OLT A;  1LEA A;  4XLC A;  1ACI A;  2E36 A;  3GFJ A;  1OCC H;  2LH9 A;  2X51 A;  1H0M A;  4UUV A;  2K9S A;  5E3N A;  1H9G A;  3J80 K;  2XB5 A;  3OYM A;  3HOW J;  2IJL A;  3EYY A;  2VQG A;  5DD4 A;  3V7S A;  1PUF B;  1XC5 A;  2DMQ A;  2D1V A;  4P5O A;  5EJC A;  4CGZ A;  2LD5 A;  1X1C A;  3WTS C;  2QZ8 A;  4ENJ A;  2LY9 A;  1VZ0 A;  1YJN I;  2CFO A;  5F0H A;  2R7O A;  2L4M A;  2ZNZ A;  3Q0W A;  1WPK A;  2JT1 A;  1FY7 A;  4BHC A;  4F92 B;  3ZQI A;  4PGH A;  4YEL A;  5B1B H;  3LSR A;  1RNL A;  3K1M A;  3CDI A;  4BEH A;  3V8J A;  1BOB A;  1EH6 A;  1IC8 A;  3FM5 A;  2HFH A;  4CIC A;  3L9F A;  5TGT A;  2CV2 A;  4XIC A;  3K7A J;  4CZC A;  4M9S A;  2F4O B;  1XSX A;  2KIM A;  4XNF A;  3LSI A;  2Y0S A;  5EG0 A;  1E2X A;  3BTL A;  4BXX J;  1HSJ A;  1PUE E;  2YU9 J;  2L7Z A;  4ZTF A;  4IZZ A;  1ZAR A;  2YX4 A;  1B72 A;  4IRG A;  4IRI A;  3QRF F;  3QPS A;  4RAY A;  5ILU A;  4ZH4 F;  4A5N A;  3FK7 A;  3HTS B;  2M9H A;  4U0V A;  3PO3 J;  4F93 B;  1WFX A;  2L02 A;  2XAF A;  3BWG A;  1U6G A;  1V54 H;  3KP6 A;  1HQC A;  3JR9 A;  3OY9 A;  1ZG5 A;  2OCE A;  2VL8 A;  3NWS A;  3RKW A;  1N75 A;  3Q0V A;  3SFI A;  3FZV A;  1ON1 A;  1USS A;  3HPH A;  2BW3 A;  3QOE A;  3F23 A;  2A6H F;  3H9G A;  3PJR A;  1HF0 A;  4IHW A;  2P8T A;  9ANT A;  4CXF A;  4DNC A;  3OYE A;  2W57 A;  3A03 A;  4NB5 A;  1ZGW A;  1WJC A;  2X1D A;  2EFO A;  2WY7 Q;  1D5V A;  1G8X A;  4J19 A;  1T8I A;  2MC3 A;  2QBY A;  1MND A;  5JHU A;  1J7K A;  2ZJQ F;  1UEL B;  1Z05 A;  3MMY B;  4EVI A;  4UVA A;  2LMD A;  2YPR A;  2VC1 A;  4XKB A;  3DKY A;  3KEO A;  4BL0 B;  2HZT A;  1WQ2 A;  5IPA A;  1LVK A;  1XMA A;  1GVD A;  3WG7 H;  3J7Z I;  3MWM A;  4PK4 A;  2F5F A;  3VYT B;  2JA8 J;  1BL0 A;  3HG9 A;  2ACJ A;  5J1Y A;  4HOB A;  2QCO A;  3P9K A;  1LDK B;  1WCM J;  3QYE A;  4EM0 B;  4Z6Y A;  3E6C C;  2L01 A;  1LDJ A;  2OPT A;  3P9I A;  4NNJ A;  1Z3X A;  3TO7 A;  2R7R A;  3JCU C;  2IS6 A;  2L9S A;  3S2D J;  3OYF A;  3SDG A;  3QYF A;  1RI7 A;  4EEF G;  3V42 A;  3OYL A;  1R6R A;  3WGG A;  2E7W A;  1JTX A;  2DMP A;  4KIF A;  2R7T A;  1K4S A;  1UHS A;  4U0Y A;  1JGG A;  2FEZ A;  2EIL H;  1IV8 A;  2VIX A;  4EMS A;  3GLX A;  2NOG A;  4D9J A;  2QSH X;  5F0C A;  1HKT A;  2V4J C;  5DS9 A;  1Z7U A;  4IHT A;  4IKF A;  4BYY A;  3I4P A;  4P1W A;  3CJN A;  4AIK A;  2WAE A;  4L9V A;  1ZK8 A;  3E97 A;  4ON0 A;  1Z0X A;  3VEP A;  3EUA A;  3I4N J;  1YOV B;  2XAS A;  2F2E A;  2QM3 A;  4ZZL A;  5LFA A;  2EH3 A;  3HOX J;  1R7J A;  5J8F A;  1UAA A;  4KN4 X;  2DOE A;  2FF4 A;  4BS9 A;  4D5F A;  4N4N B;  1W0T A;  1T33 A;  2Z1D A;  3CF2 A;  1O7L A;  4G6D A;  1F43 A;  1W1W E;  4BNC A;  1TNS A;  3G1O A;  4FET A;  4L5I A;  5H2F C;  3ZGK A;  5D5X B;  2EWN A;  2QYO A;  2EPF A;  2GIZ A;  2VJI A;  5J8C A;  1T0F A;  2EIM H;  1MBJ A;  1YI2 I;  3ZQF A;  3K0L A;  2DFI A;  5D5V B;  2W1O A;  4WX9 A;  3GTO J;  1I5Z A;  1MDM B;  2B63 J;  1O3Q A;  1O4X A;  1FIA A;  2I8D A;  4DZP A;  4PUS A;  4GFB A;  1KZH A;  3I59 B;  4LGW A;  2F4M B;  2LNB A;  2P81 A;  4IJA A;  2W4S A;  4N4O B;  4BBS J;  2R7V A;  2MA3 A;  2M8G X;  2NAZ A;  3IH4 A;  4XN3 A;  3OL4 A;  4LIU A;  5D5W B;  3HRS A;  4GDF A;  3OIP A;  3ZN0 A;  2GWR A;  2VE9 A;  2XAG A;  2ZBK A;  4YEJ A;  4YFX F;  3HGY A;  3O6B B;  3KYC B;  1I50 J;  1FOY A;  2V7F A;  4M3E A;  5CPR B;  3VB2 A;  4RGS A;  4Z2Y A;  1U5T C;  5GAE J;  1LB2 A;  2GXA A;  3DV8 A;  2X6O A;  4KA4 A;  1P9Q C;  2JPC A;  1QNT A;  2OTL I;  1IDY A;  4B44 A;  2BHY A;  1GV5 A;  2DW4 A;  3F21 A;  2P7V B;  3PNV A;  1VQ8 I;  2K9L A;  4PFP A;  3KZY A;  3M1E A;  2L7K A;  5HLH A;  2VJ5 A;  2CQ7 A;  1YTY A;  2RQQ A;  2R3S A;  2KIF A;  2OQR A;  4EM2 A;  5FKO A;  4UUS B;  1FBQ A;  2R4G A;  1DUX C;  4I02 A;  1HOM A;  4HEA 2;  2VBW A;  3S3M A;  2OUM A;  2QF7 A;  2H8R A;  4GYG A;  2EA4 A;  2CRG A;  3WTZ A;  5KAF C;  1LFB A;  3OIQ A;  3J7A O;  4YRV A;  2KIU A;  1K4T A;  3I64 A;  2RAE A;  3EUK L;  3RQI A;  1ERD A;  1YS6 A;  2WWY A;  2XKO A;  4XOR A;  1U8R A;  2XV4 S;  4XQF A;  4S05 A;  4B8X A;  2JPB A;  3P9C A;  1KU2 A;  2XAJ A;  3LA2 A;  2H1K A;  2FBH A;  4M73 A;  3DU6 A;  4RM3 A;  1IG7 A;  1R9T J;  2NVQ J;  1U5T B;  3PQK A;  3DPU A;  3JRB A;  2M30 A;  2EIJ H;  1R23 A;  1SFU A;  3OIO A;  2X0L A;  3GTP J;  2DT5 A;  1P2F A;  3E5Q A;  1A35 A;  4LIV A;  5E20 A;  1FBS A;  4Y17 A;  1ON2 A;  3S2W A;  3VSL A;  1VTN C;  2GA1 A;  3LSM A;  1FYK A;  1HDD C;  1FNN A;  3M8F A;  2HYF A;  1IF1 A;  1ZEL A;  3TW7 A;  2VXD A;  5F1R A;  4Q47 A;  5F0F A;  3F0C A;  1MJ9 A;  3WHB A;  2JN6 A;  3HHG A;  3LSK A;  3IKT A;  4IHV A;  2BW3 B;  4ZJZ A;  3H5A A;  3HC7 A;  4V2F A;  2XAH A;  4QTR A;  1J59 A;  3GCM A;  1U2W A;  1XDU A;  2VKH A;  3FXK A;  1SAX A;  2IS1 A;  4XKW A;  3SDB A;  4FE7 A;  2QBY B;  3GME A;  1LPQ A;  1S6L A;  1BIA A;  2XGD A;  4EJO A;  1FC3 A;  4DGW B;  2V6E A;  3GO5 A;  6PAX A;  5HDK A;  2V79 A;  5LRR A;  1FOW A;  3HL2 A;  1UMQ A;  5J4V A;  2HVQ A;  4MEX F;  2ECC A;  1FYL A;  2FBK A;  4IO9 F;  3FIW A;  3TOB A;  4LOC A;  5LGU A;  2X48 A;  1MH3 A;  2IVM A;  4IQ4 A;  2B9S A;  4BAY A;  3RJP A;  4FHT A;  2QQA A;  2DA6 A;  3TP3 A;  4WCG A;  2M34 A;  1TBX A;  2X6X A;  1TLH B;  1TZL A;  1HW2 A;  2EB7 A;  4RDU A;  4RGX A;  3ZMD A;  1JKO C;  1JUS A;  4P55 A;  5L3B A;  2CUF A;  4B09 A;  3RDI A;  2Y0M A;  5FKM A;  1HBX G;  3ML6 A;  4HV5 A;  3H9Q A;  3OYH A;  3F8B A;  3L2Q A;  1EV7 A;  3CCY A;  4LG0 B;  2EFN A;  4KIB A;  5D4S A;  4HX8 A;  2H09 A;  2CQN A;  2KPM A;  1I39 A;  1JKQ C;  1CF7 B;  1I6X A;  2JVH A;  2L7F P;  1IV6 A;  2Z9O A;  1OYW A;  4GRI A;  2HTJ A;  4OOI A;  3ABU A;  1WJF A;  2HZD A;  3DEU A;  3AG1 H;  4I99 C;  2D1H A;  3GW2 A;  5ICG A;  3AG4 H;  2HQR A;  3K69 A;  3LMM A;  4HF0 A;  1J09 A;  4ESJ A;  2E2J J;  2KJB A;  5L3E A;  3W2W A;  3K4M A;  1R4N B;  2WB1 N;  2DI3 A;  1BR1 A;  4WXC A;  3CDL A;  3MKZ A;  2TCT A;  4G9Y A;  4HV6 A;  4CZZ A;  3L2U A;  5CQG A;  5J3L A;  1B8I A;  1YX5 A;  4EQQ A;  1HA8 A;  1ETO A;  3MD2 A;  1K83 J;  2N8G A;  1XGN A;  1K7A A;  1XG1 A;  2IS2 A;  2K9Q A;  5J6X A;  4RBO A;  4UB6 C;  4M6Y A;  1OIS A;  1A04 A;  4RAF A;  4UVB A;  3BR1 A;  2MG4 A;  3OYI A;  2HKX A;  2OA4 A;  2O9L A;  2HS5 A;  4XLE A;  2L9V A;  3GLL A;  4GYI A;  5F64 A;  2M0M A;  2M45 A;  3QQA A;  3RKY A;  1G2H A;  1FT9 A;  3OS2 A;  3KLO A;  2F5E A;  4IEJ A;  3QOP A;  4LB6 B;  4YII A;  4GCV A;  3EET A;  2V9V A;  5KAI C;  5FKL A;  2ZKZ A;  2GBY A;  2HOE A;  2HQN A;  3DP7 A;  5E3O A;  5D6F A;  2LOO A;  3T5X A;  5FLV A;  4I98 B;  1WZ2 A;  1MD0 A;  3L2R A;  4HDV A;  2PFB A;  2KRC A;  1EH8 A;  5CVI A;  3WGI A;  1SD6 A;  2ZXI A;  4C3J J;  1W4M A;  2NS0 A;  3R4K A;  1BI2 A;  4MQV A;  4Y33 A;  4BHP A;  5KHD A;  1IRZ A;  2L4A A;  3JAM Z;  2O7O A;  4MQ9 F;  4N9I A;  3RZD J;  1LEB A;  2L9R A;  4W1U A;  2GLO A;  3OYN A;  1KU7 A;  3VWB A;  3I5U A;  1UJ8 A;  3DLL F;  1ZAO A;  1QRY A;  4OIP F;  2RNJ A;  2MD0 A;  3IC7 A;  1CQT A;  3J81 Z;  2A69 F;  3SJM A;  4HX7 A;  3ZMT A;  2YSR A;  5JVT A;  3GTM J;  1R58 A;  4MFE A;  2Q0O A;  4P9U A;  3N05 A;  4XKV A;  3S17 J;  2GIV A;  3L2C A;  3REO A;  2V9P A;  3FMS A;  2JVG A;  1ZRC A;  2W00 A;  3HUG B;  1QPM A;  4L0Z B;  1MH4 A;  4PJJ A;  5DUK A;  2E2I J;  1IAW A;  2AXL A;  3FWE A;  5C4J J;  1HW5 A;  5J4Y A;  2BYV E;  4FTH A;  4UV8 A;  2CH0 A;  3OYB A;  1POG A;  4AC0 A;  2NVT J;  2R7Z J;  1OR7 C;  1L0O C;  2MYS A;  2O8K A;  2JUG A;  2NVX J;  1IXR C;  1T2K A;  3H36 A;  3WGH A;  3BT9 A;  3V7C A;  1H8A C;  1A6Q A;  1WSU A;  4A12 A;  5EEG A;  3NEU A;  3GTG J;  1JT6 A;  2DT7 B;  1Z91 A;  4UB8 C;  1R1U A;  1EA3 A;  2ICW G;  4DYC A;  5IT9 K;  1FX7 A;  1UHM A;  3ERM A;  3OR2 C;  4OIR F;  2YU3 A;  3RPQ A;  1RRJ A;  2ELK A;  2Z16 A;  3GZN B;  4CCN A;  5HNH A;  4Q5S F;  2FX0 A;  4ENM A;  3I54 A;  5JVG F;  5CVJ A;  2YR2 A;  4BUP A;  3BTJ A;  4A3J J;  4A3G J;  1JGS A;  2OZU A;  4AIJ A;  3K4K A;  1TNT A;  3CUO A;  4KYW A;  3S15 J;  2FE3 A;  4AU7 A;  4MFD A;  2OAZ A;  3CUQ C;  2RGV A;  1QBJ A;  1X3W B;  2GM4 A;  1PDN C;  4W97 A;  5L3D A;  2R92 J;  1P4X A;  3BR3 A;  3CD6 I;  3E6B A;  3D5R C;  2DU9 A;  2ZSH B;  2KLO A;  3R60 A;  3G71 I;  2EZL A;  2VAS A;  5E17 F;  3ABK H;  3M8J A;  1WH7 A;  1VQ4 I;  3ZQ7 A;  3KYD B;  1FWZ A;  3M3Y J;  3RI4 A;  2PJP A;  4L9T A;  1QPI A;  2NRA C;  2BVM A;  1I1S A;  4NQW B;  2LBF A;  5CVR A;  3GZ5 A;  4RB1 A;  1IGN A;  3AKZ A;  2HVR A;  5H20 A;  2HPI A;  2X9D A;  3NAU A;  1BN5 A;  3CMY A;  2VUM J;  1RKT A;  5F04 A;  1YJ9 I;  1V5F A;  4HNT A;  1Z6T A;  2FXA A;  4BE1 A;  3DPL C;  4CYC A;  2K40 A;  3ZMZ A;  1TQM A;  2EFP A;  4FT8 A;  1MMG A;  2RN7 A;  5IP7 J;  5B1A H;  2P4W A;  1FOK A;  3CCS I;  1A31 A;  1UG2 A;  3V8L A;  3LQQ A;  4E7Z A;  3LSH A;  5TRD A;  2VKV A;  3S14 J;  2XSD C;  2CUZ A;  5IOY A;  2HNH A;  2RNG A;  4NQW A;  2LBF B;  1V5E A;  1NK3 P;  4HPQ A;  5FFX A;  2LLK A;  2Y69 H;  1WH5 A;  4R1H A;  2OF7 A;  3C2H A;  3SQN A;  4CCJ A;  3DF8 A;  4IX7 A;  2O8X A;  3I0T A;  5LGT A;  3Q5F A;  4G6T B;  4JQF A;  4KIC A;  1C0W A;  3BR0 A;  2FNA A;  1QHH D;  4Y7N J;  2EZK A;  3RTR A;  5IP6 A;  4HRI A;  3HRT A;  5L3F A;  2V1D A;  1BR2 A;  1X2M A;  3K70 C;  4ENK A;  5DCF A;  2NVU B;  2NS8 A;  1JUM A;  2QVO A;  2KT0 A;  5GAH J;  3Q9V A;  1IN6 A;  2LG4 A;  4II3 A;  4G94 A;  5EF6 A;  4EJV A;  2EJR A;  1JXS A;  4L5E A;  4DW6 A;  5LEJ A;  1Y8Q B;  4BU2 A;  4Y13 A;  2G0E A;  4A3D J;  3DKX A;  1I1G A;  1V55 H;  2GXG A;  3KX2 A;  2JA2 A;  1D1B A;  2HXI A;  3LST A;  3PUF A;  1ZN2 A;  2DFH A;  1MBK A;  3RYP A;  1L3L A;  5FFZ A;  5JHF A;  3JSO A;  2K4J A;  4CO8 A;  2VOP A;  4HSR A;  1FSH A;  3ONQ A;  4M9Z A;  3PM1 A;  3ASN H;  5AON A;  1GLN A;  1VQN I;  1MSE C;  1F36 A;  3Q9S A;  1DP7 P;  1ETX A;  5LD2 C;  2QQ9 A;  3W3C A;  2V1N A;  3SZP A;  3DXJ F;  3FK6 A;  1T0F C;  1UB9 A;  2FRH A;  3PFI A;  1HC8 A;  1W7P D;  3RQ4 A;  2E19 A;  2ZNY A;  2X6W A;  3EPZ A;  4KN7 X;  2Z2S B;  3I3L A;  2DT6 A;  1KQ9 A;  3LSP A;  1XDS A;  2P5V A;  2GZW A;  4M3D A;  2ZJR F;  3K2A A;  1XTA A;  3JRA A;  3WU2 C;  3RZO J;  1G3W A;  3K4C A;  5LRS A;  1SFK A;  3FM3 A;  2PBI A;  4XRS G;  4HAM A;  4UV9 A;  3JRI A;  1VQ5 I;  2QLZ A;  2WV1 A;  4LLG F;  1BJA A;  1HW1 A;  3LQR A;  3SXY A;  3ZQL A;  1ONV A;  2O6G E;  1CF7 A;  3BZC A;  4QLC U;  1SMY F;  3OYD A;  3W6K B;  3IV5 A;  3F6O A;  3RCO A;  2E2H J;  2Q8K A;  3EUH A;  3WTV C;  1MGT A;  2HYG D;  4X0G A;  2M5W A;  1Y8R B;  3IRQ A;  3HRU A;  2KKO A;  4AM3 A;  4LJZ F;  3HEF A;  2DK8 A;  2Z3Y A;  4P9F A;  4B48 A;  3HOZ J;  1Y56 A;  1ZTR A;  2X1C A;  2E1M B;  3OOU A;  4F55 A;  1X58 A;  1IXS B;  3CMM A;  3I59 A;  2XAU A;  4G12 A;  3IWZ A;  3ZMS A;  1TP4 A;  2HPM A;  3K1P A;  2IRF G;  4MIM A;  2K02 A;  5IOZ A;  1SVO A;  3KP4 A;  1IN4 A;  2DA3 A;  2XDV A;  4ESF A;  2KZV A;  3TKY A;  3MKW B;  1LJ9 A;  2F5D A;  2WAQ N;  1X19 A;  1NTC A;  2NVY J;  1STZ A;  2OBP A;  3HM5 A;  3IAS 2;  3DFG A;  3RIR A;  5FJ8 J;  3KFW X;  1TW2 A;  3AAF A;  1WJD A;  3L2V A;  2K4B A;  2JQ7 A;  1Q1V A;  4DIQ A;  3F8M A;  2VJ4 A;  3JW4 A;  3H0G J;  3BRO A;  3GYH X;  5IT3 A;  1WJ5 A;  4LMY A;  5EZG A;  1YO5 C;  3E3V A;  3Q3S A;  1Q1H A;  4ZC3 A;  3B6C A;  3RYR A;  1VQ7 I;  5JLW A;  4U7B A;  3E6D A;  5DEQ A;  3K9T A;  2HOA A;  2TRT A;  2E1C A;  4CDG A;  4E7K A;  2LY2 A;  1MZB A;  5F08 A;  1B1B A;  5BS6 A;  3VYR B;  1KU9 A;  3R61 A;  1KU3 A;  3MZY A;  3D1N I;  2B7E A;  1ETV A;  2LKX A;  1JJ6 C;  2UUZ A;  3A4C A;  3GFM A;  1RUN A;  2STT A;  1QVT A;  3TP0 A;  3OYG A;  2GAU A;  1QO0 D;  1WKM A;  3BTI A;  2GA2 A;  5CVV A;  4XRM A;  1E3H A;  4OMY A;  2WBM A;  3L2W A;  4QSH A;  2CG4 A;  1DU6 A;  3PSF A;  1JKP C;  1UCR A;  3ZR8 X;  2YS9 A;  3CO7 C;  4D7N A;  1XGO A;  3FHN A;  3E7L A;  1M1E B; 
#chains in the Genus database with same CATH homology
 4N9H A;  1HST A;  3NRV A;  1JHF A;  1BOA A;  4LK0 F;  4BHB A;  2YX7 A;  5E8G A;  1BI1 A;  1Y0U A;  1SMT A;  1IN5 A;  1KA8 A;  2BBY A;  2MD5 A;  1K78 B;  1IZ1 A;  3K1N A;  1J2X A;  1G3S A;  3M8E A;  3IWF A;  1XMK A;  4HZF A;  3LAP A;  3JSP A;  1XGM A;  3QPT A;  2ESH A;  3WTT C;  1XSD A;  4I0B A;  3LWF A;  2W85 A;  1QZZ A;  4PZJ A;  1K78 A;  1DPU A;  2ZO4 A;  3GXO A;  1O3T A;  4HF1 A;  4PCQ A;  4LK1 F;  3TDU C;  2VC0 A;  1ZH5 A;  4GXO A;  1REP C;  2UXN A;  3ULQ B;  5BPD A;  1LVA A;  1PP7 U;  2O61 A;  2D45 A;  3BP8 A;  4ZYH A;  1J0R A;  3CUQ A;  2HR3 A;  2HEO A;  1D8K A;  2NYX A;  2UXX A;  1XN7 A;  3ELK A;  3K2Z A;  2WC2 A;  4MTE A;  2RQP A;  3FXU A;  3LA7 A;  4O5V A;  3CUQ B;  4IPA A;  4CYD A;  5H6Q A;  2V1X A;  2ISZ A;  2J5P A;  4WK8 F;  4BH9 A;  1ZRD A;  3WU0 A;  3WTY C;  3HOS A;  3FXQ A;  2R7F A;  5ILV A;  1UFM A;  3H3Z A;  1P92 A;  2FU4 A;  3MZH A;  1ULY A;  2JRT A;  2X4H A;  4UHT A;  3L7W A;  4UNO A;  2EV6 A;  2P6T A;  4EJT A;  2EFW A;  5DCM A;  1TW3 A;  4Y15 A;  2HGC A;  3U1D A;  1KYZ A;  2FMY A;  4G7H F;  2Z5U A;  1R5H A;  2M87 A;  1KQ0 A;  1G6N A;  4G7Z F;  3J81 K;  2RV8 A;  3R0A A;  3ISP A;  5FGM A;  5HLI A;  5LBQ A;  2Z33 A;  3F8N A;  4AVP A;  4L9N A;  3ERE D;  1FZP B;  3BJO A;  2DAO A;  4I2O A;  3MFK A;  2DQR A;  3HTU A;  3I71 A;  3FMQ A;  5ILS A;  2IPQ X;  2DPD A;  4M74 A;  3IRR A;  1OYI A;  4IXA A;  4JBA A;  5K5O A;  4HYE A;  3EDP A;  3F72 A;  3C18 A;  1ZGA A;  5BQT A;  4D0P A;  1ZYR F;  4ASN A;  4WWC A;  3CTA A;  3VOE A;  3ZMV A;  3T0Y A;  1O3S A;  2M8E A;  3EQL F;  1TQP A;  2ESN A;  4GGG A;  1SD4 A;  2XRN A;  2MLG A;  4A0X A;  1W7P A;  2IA2 A;  2ZXJ A;  2QWW A;  4RB0 A;  4EGY A;  1WWX A;  2A68 F;  5H6R A;  4O3M A;  4A0Z A;  1R00 A;  2IT0 A;  5AIP A;  2PN6 A;  2PEX A;  1WRJ A;  3BDD A;  2XAQ A;  4U88 A;  4HA8 A;  3N97 A;  3B02 A;  2P5L C;  5FO5 A;  2JZY A;  3F8C A;  4FX4 A;  3KP3 A;  1O7F A;  1ZRF A;  2E1N A;  3TO9 A;  4MGR A;  4A6D A;  2VBZ A;  3G73 A;  2HKO A;  1FPQ A;  4KFC A;  1OYY A;  3CO6 C;  1IN7 A;  5LGN A;  1AOY A;  4U0W A;  4IF4 A;  2IA1 A;  2VBY A;  2ADU A;  2MH9 A;  2LSO A;  3LFK A;  4RS8 A;  3O2P E;  3FX3 A;  3GUD A;  4EM1 A;  3H3U A;  1UHW A;  2BGC A;  2BE5 F;  1TTY A;  2G7H A;  4PGG A;  1OMI A;  3TGN A;  1GHC A;  2VXZ A;  4HLX A;  4Q48 A;  2H6B A;  1E17 A;  2W25 A;  1B6A A;  2ISY A;  1GXQ A;  4XRF A;  4EV0 A;  1LDD A;  3TO6 A;  4QWQ A;  5ICC A;  1WI9 A;  5HS8 A;  1YQA A;  2EA2 A;  2G9W A;  1R1V A;  1ZLJ A;  5F6F A;  3HIF A;  5HS7 A;  4G7O F;  3GFL A;  3D5L A;  4RAZ A;  3WTU C;  1SD5 A;  3O3K A;  5FLX Z;  4H0E A;  1LNW A;  5JI6 A;  2W84 A;  2QEN A;  2XUB A;  1IRG A;  2CSO A;  2XGX A;  5JR3 A;  5D4R A;  3L09 A;  1TQI A;  3G3Z A;  1IUY A;  2PMU A;  2VBX A;  1JHH A;  3QP5 A;  1T38 A;  4IVN A;  5FD5 A;  5D8K B;  4P96 A;  2K86 A;  4ZYG A;  2A6E F;  1ZGJ A;  2FML A;  4HDU A;  5LHG A;  4MTD A;  2D2W A;  2XRO A;  4YFK F;  1J5Y A;  4AD9 A;  2EV5 A;  3NQO A;  3R0J A;  4RB3 C;  2Y48 A;  4F7Z A;  5HLG A;  3QAH A;  2PI0 A;  3CLO A;  2O03 A;  4HLY A;  2DTR A;  1NHA A;  1XGS A;  2H6C A;  3WG9 A;  3VFZ A;  2A3S A;  4M71 A;  3ROU A;  2NNN A;  3F6V A;  4A6E A;  3OV8 A;  1P4A A;  5BOX A;  5HVQ C;  1JE8 A;  2RVC A;  4I7H A;  1IXC A;  4WXH A;  3V7R A;  3MCZ A;  2CW0 F;  2DLL A;  3FXR A;  3PQJ A;  4K2E A;  3ABT A;  4G6Q A;  1O57 A;  3GX4 X;  2ETH A;  1B59 A;  1U5T A;  5D8L B;  4WXD A;  3ECH A;  2FOK A;  4KIG A;  3DQV C;  3WE3 A;  2VT3 A;  4HBL A;  3QP6 A;  2L54 A;  4N0B A;  3CDH A;  4ZYE A;  3H92 A;  1R5G A;  2ZFW A;  2CWE A;  3JTH A;  5DV5 A;  2F5C A;  3MQ0 A;  3GVA A;  1XCB A;  2FNP A;  1QZY A;  3BPX A;  2DBB A;  4L0Y B;  3DKW A;  3GF2 A;  1FYM A;  2XHK A;  1S8N A;  3QU6 A;  4CHU A;  2HDC A;  1W5T A;  4G8X A;  1I27 A;  4OIQ F;  3ZMU A;  1RUO A;  2VE8 A;  3F22 A;  4KDP A;  4HF2 A;  4NHJ A;  3GFI A;  3KE2 A;  1D3Y A;  1QQI A;  1O3R A;  3TQN A;  2CFX A;  2FQ3 A;  5K5Q A;  5IT9 Z;  1KYW A;  4LD5 A;  3DPT A;  3BZ6 A;  2PLY A;  5DDG A;  4R79 A;  2HWV A;  2RDP A;  3FHZ A;  5CVU A;  3E5X A;  4IHS A;  4IRH A;  2DQL A;  3EYI A;  3SZT A;  1ZG3 A;  1ZRE A;  2XIG A;  4KT5 C;  5E18 F;  3V8K A;  3E5U A;  1F1Z A;  2A5Y B;  1OPC A;  2L3D A;  5D6E A;  5DUI A;  1MJA A;  2EK5 A;  3C3W A;  4UVC A;  1BM9 A;  2GQQ A;  4YIF A;  5LEK A;  1B9M A;  3U2R A;  1BC8 C;  3KCC A;  3KP5 A;  4LLL A;  1ZHF A;  1Z9C A;  1BIB A;  2GXB A;  3MEX A;  4UXN A;  2O3F A;  4ESB A;  5LHI A;  1AWC A;  3MAJ A;  5EEH A;  2STW A;  1ODD A;  5CJ9 A;  3VOD A;  5JFR A;  4XSZ F;  3HRM A;  2JTV A;  1YLF A;  1W7P B;  4A5M A;  2IP2 A;  5KK1 A;  4EJW A;  5ED4 A;  1XD7 A;  2RKH A;  5CLS A;  2M1B A;  4LFU A;  1YG2 A;  2W24 A;  1W5S A;  3IHU A;  2ELH A;  1GVJ A;  4S04 A;  4XSX F;  2UWM A;  4PDK A;  1YS7 A;  3COA C;  3RPU A;  3KZZ A;  5E1Z B;  2KRF A;  5K5R A;  2VOO A;  3IKV A;  1XB4 A;  2OU2 A;  3WU1 B;  1DDN A;  3T8T A;  3D0S A;  1X3U A;  5TJJ A;  1V4R A;  4XBF A;  2PQ8 A;  5K1Y A;  2WTE A;  3GZ6 A;  2C6Y A;  1F5T A;  5ICF A;  1T6S A;  1Z6R A;  4XLP F;  1SD7 A;  4I09 A;  1P4W A;  2G7U A;  2V6C A;  4O6J A;  2KJC A;  1FP2 A;  2TDX A;  4TV7 A;  4ENN A;  2MH2 A;  4OIO F;  1Z1D A;  1IN8 A;  3R6S A;  4DQ2 A;  1XCV A;  3BY6 A;  3WOD F;  2R7D A;  4M72 A;  1IRF A;  1MKM A;  1S3J A;  3JTG A;  2DPU A;  1V3F A;  4ZYD A;  1SFE A;  5D5U B;  2QQB A;  2VON A;  4BQA A;  1BBY A;  1FLI A;  3C1D A;  4MEY F;  1U78 A;  2AS5 F;  4BXU A;  2CYY A;  3JAM K;  1RZ4 A;  1KGS A;  3B73 A;  3E6M A;  2BEO A;  4ETS A;  3TOA A;  4Q4Z F;  2CGP A;  1YIO A;  2MLK A;  4MHG A;  4L18 B;  1D8J A;  3HYI A;  3RKX A;  2XVC A;  4I01 A;  1F9N A;  3KET A;  3BJA A;  3L00 A;  5A2Q Z;  3KLN A;  2B0L A;  2EFQ A;  2PG4 A;  3M7G A;  5LHH A;  3HSE A;  2BV6 A;  3HSF A;  1R36 A;  1R22 A;  4E70 A;  2XKP A;  4RGR A;  4AWX B;  2OD5 A;  1UST A;  1T98 A;  3BJ6 A;  3HHH A;  1MDM A;  4RGU A;  5BPI A;  3I53 A;  2UZK A;  1IW7 F;  4MNU A;  4KMF A;  1B4A A;  1BI3 A;  5DCM B;  1B9N A;  2VT2 A;  1F4K A;  1OR7 A;  1HKQ A;  3I58 A;  1XSV A;  2E7X A;  2NNY A;  3HSR A;  3J80 Z;  1H9T A;  1HKS A;  2J5O A;  3GWZ A;  1OKR A;  2P5K A;  4I0A A;  3KEQ A;  3P7N A;  4YG2 F;  1QGP A;  2V1U A;  4L5J A;  1G3T A;  3FF5 A;  2H27 A;  3TDZ C;  2K7L A;  2COM A;  2ZME B;  1GXP A;  3T8R A;  2LDU A;  1PP8 F;  4WF2 A;  4A0Y A;  3KP2 A;  2P6S A;  2LKP A;  1RIO H;  5L3C A;  2FSW A;  2VOD A;  3BOQ A;  2WV0 A;  1ZG1 A;  1BC7 C;  3W6J B;  3HUG A;  2ZME A;  3SFZ A;  5FD6 A;  3IL2 A;  1G3Y A;  4KUM A;  1S7A A;  3F3X A;  1HXD A;  4YFN F;  1MJB A;  4LLN A;  2PMH A;  4GO1 A;  4JK1 X;  5ERI A;  2O0Y A;  3HOT A;  4HX4 A;  5FLX K;  4U7D A;  4ZZD A;  2Q2E A;  2QUF A;  5E1X A;  4EJU A;  2EV0 A;  5AIQ A;  4LG0 A;  4L9J A;  2ZCW A;  2IA0 A;  1G4D A;  5KVR A;  1YFH A;  1T39 A;  5HDN A;  1SFX A;  5L3G A;  4R8H A;  2FBI A;  2CO5 A;  2JSC A;  2ZJ2 A;  3QU3 A;  3ZN1 A;  5DD8 A;  1S7O A;  1ZLK A;  1FP1 D;  3FMR A;  1LQ1 A;  5FB2 A;  3OOP A;  4OMZ A;  1FBU A;  2Y75 A;  1P6R A;  4FX0 A;  2OQG A;  5A2Q K;  2H94 A;  2A07 F;  3M9A A;  3QPH A;  3C7J A;  1K6O A;  2LF8 A;  1YW7 A;  4M6X A;  4AIH A;  5ICE A;  4HQM A;  2MBF A;  1J75 A;  2IW5 A;  5E8I A;  4M9X A;  3N4M A;  3KP7 A;  3T1B A;  5LLQ A;  3LA3 A;  3WE2 A;  1R1T A;  3SHF A;  4OIN F;  1BI0 A;  3WTW C;  5HS9 A;  1U3E M;  3V4G A;  4OU0 A;  2HTS A;  2K27 A;  2DK5 A;  2P7C B;  5CYV A;  4LB5 A;  3ZP5 A;  5BMZ A;  4KNY A;  1EH7 A;  3ECO A;  3ZPL A;  4A2U A;  2CQK A;  1YW8 A;  2LF7 A;  4RB2 C;  2OZ6 A;  1DPR A;  5HOO A;  2Z99 A;  3F8F A;  4XLN F;  1FSE A;  3BPV A;  1K79 A;  3WTX C;  2DO7 A;  4KMU X;  1YW9 A;  1CGP A;  2FA5 A;  3GEZ A;  5E1W A;  2VN2 A;  4HW0 A;  1YYV A;  2RC4 A;  1J9I A;  3LAJ A;  2A61 A;  4HQE A;  5DYM A;  1KQ8 A;  3U9G A;  1S29 A;  4EGZ A;  5HDG A;  1LEA A;  3GFJ A;  1H0M A;  4UUV A;  1H9G A;  3J80 K;  2IJL A;  3EYY A;  5DD4 A;  3V7S A;  2D1V A;  4P5O A;  4CGZ A;  3WTS C;  2QZ8 A;  4ENJ A;  2L4M A;  2ZNZ A;  2JT1 A;  1FY7 A;  4BHC A;  4PGH A;  1RNL A;  3K1M A;  3V8J A;  1EH6 A;  3FM5 A;  2HFH A;  4CIC A;  3L9F A;  4M9S A;  1XSX A;  2KIM A;  1E2X A;  1HSJ A;  1PUE E;  1ZAR A;  2YX4 A;  4IRG A;  4IRI A;  3QRF F;  4RAY A;  5ILU A;  4ZH4 F;  4A5N A;  3HTS B;  4U0V A;  2L02 A;  2XAF A;  3BWG A;  1U6G A;  3KP6 A;  1HQC A;  1ZG5 A;  3RKW A;  3FZV A;  1ON1 A;  1USS A;  3F23 A;  2A6H F;  2P8T A;  4CXF A;  4DNC A;  2W57 A;  4NB5 A;  2EFO A;  1D5V A;  2MC3 A;  2QBY A;  5JHU A;  1J7K A;  1Z05 A;  4EVI A;  4UVA A;  2YPR A;  2VC1 A;  3KEO A;  2HZT A;  1WQ2 A;  1XMA A;  3MWM A;  2F5F A;  2ACJ A;  4HOB A;  3P9K A;  1LDK B;  4EM0 B;  3E6C C;  2L01 A;  1LDJ A;  3P9I A;  3TO7 A;  1RI7 A;  3WGG A;  2E7W A;  4KIF A;  4U0Y A;  2FEZ A;  4EMS A;  3GLX A;  1HKT A;  1Z7U A;  4IHT A;  4BYY A;  3I4P A;  4AIK A;  3CJN A;  4L9V A;  3E97 A;  4ON0 A;  3VEP A;  2XAS A;  4ZZL A;  2F2E A;  2QM3 A;  1R7J A;  5J8F A;  4KN4 X;  2FF4 A;  4G6D A;  1O7L A;  4BNC A;  1TNS A;  4L5I A;  5D5X B;  2EWN A;  2QYO A;  5J8C A;  1T0F A;  3K0L A;  2DFI A;  5D5V B;  4WX9 A;  1I5Z A;  1MDM B;  1O3Q A;  3I59 B;  4LGW A;  2LNB A;  4IJA A;  2MA3 A;  2NAZ A;  5D5W B;  3HRS A;  3ZN0 A;  2GWR A;  2VE9 A;  2XAG A;  2ZBK A;  4YFX F;  3O6B B;  3VB2 A;  4RGS A;  1LB2 A;  4Z2Y A;  1U5T C;  3DV8 A;  4KA4 A;  2JPC A;  1QNT A;  3F21 A;  2DW4 A;  2P7V B;  3KZY A;  3M1E A;  5HLH A;  1YTY A;  2R3S A;  2KIF A;  2OQR A;  4EM2 A;  1FBQ A;  1DUX C;  4I02 A;  2VBW A;  4GYG A;  2EA4 A;  3WTZ A;  3J7A O;  2KIU A;  3I64 A;  1YS6 A;  2WWY A;  2XKO A;  1U8R A;  2XV4 S;  4S05 A;  4B8X A;  2JPB A;  3P9C A;  1KU2 A;  2XAJ A;  3LA2 A;  2FBH A;  4M73 A;  1U5T B;  3PQK A;  2M30 A;  1R23 A;  1SFU A;  2X0L A;  2DT5 A;  1P2F A;  3E5Q A;  5E20 A;  1FBS A;  4Y17 A;  1ON2 A;  3S2W A;  1VTN C;  2GA1 A;  1FYK A;  1FNN A;  3M8F A;  2HYF A;  1IF1 A;  5F1R A;  4Q47 A;  1MJ9 A;  3HHG A;  3IKT A;  2XAH A;  1J59 A;  1U2W A;  1XDU A;  1SAX A;  2QBY B;  1S6L A;  1BIA A;  4EJO A;  1FC3 A;  3GO5 A;  6PAX A;  5HDK A;  2V79 A;  5LRR A;  4MEX F;  1FYL A;  2FBK A;  3TOB A;  5LGU A;  2IVM A;  4BAY A;  3RJP A;  4FHT A;  2QQA A;  4WCG A;  1TBX A;  1TLH B;  1HW2 A;  2EB7 A;  4RGX A;  3ZMD A;  4P55 A;  5L3B A;  4B09 A;  3RDI A;  2Y0M A;  1HBX G;  3ML6 A;  4HV5 A;  3F8B A;  1EV7 A;  4LG0 B;  2EFN A;  4KIB A;  5D4S A;  4HX8 A;  2H09 A;  1CF7 B;  1I6X A;  2Z9O A;  1OYW A;  2HTJ A;  4OOI A;  3ABU A;  3DEU A;  2D1H A;  3GW2 A;  5ICG A;  2HQR A;  3K69 A;  4HF0 A;  4ESJ A;  2KJB A;  5L3E A;  2DI3 A;  4WXC A;  4HV6 A;  4G9Y A;  4CZZ A;  4EQQ A;  1XGN A;  1K7A A;  5J6X A;  4M6Y A;  1A04 A;  4UVB A;  2HKX A;  2OA4 A;  2HS5 A;  5F64 A;  4GYI A;  2M45 A;  3RKY A;  1FT9 A;  3KLO A;  2F5E A;  3QOP A;  4LB6 B;  4YII A;  4GCV A;  3EET A;  2V9V A;  2ZKZ A;  2HOE A;  2HQN A;  3DP7 A;  5D6F A;  3T5X A;  4I98 B;  1MD0 A;  4HDV A;  2PFB A;  1EH8 A;  5CVI A;  3WGI A;  1SD6 A;  1W4M A;  2NS0 A;  3R4K A;  1BI2 A;  4MQV A;  4BHP A;  2L4A A;  3JAM Z;  4N9I A;  4MQ9 F;  1LEB A;  1KU7 A;  3I5U A;  1ZAO A;  4OIP F;  2RNJ A;  3IC7 A;  3J81 Z;  2A69 F;  4HX7 A;  3ZMT A;  2YSR A;  5JVT A;  1R58 A;  4P9U A;  2Q0O A;  2GIV A;  3L2C A;  3REO A;  3FMS A;  1ZRC A;  1QPM A;  4L0Z B;  5DUK A;  1IAW A;  2AXL A;  3FWE A;  1HW5 A;  2BYV E;  4UV8 A;  1L0O C;  1IXR C;  1T2K A;  3WGH A;  3V7C A;  1WSU A;  4A12 A;  5EEG A;  3NEU A;  1Z91 A;  1R1U A;  5IT9 K;  1FX7 A;  1UHM A;  4OIR F;  2YU3 A;  3RPQ A;  4Q5S F;  4ENM A;  3I54 A;  5CVJ A;  2YR2 A;  1JGS A;  2OZU A;  4AIJ A;  1TNT A;  3CUO A;  4KYW A;  2FE3 A;  2OAZ A;  3CUQ C;  2RGV A;  1QBJ A;  1PDN C;  5L3D A;  1P4X A;  3E6B A;  2DU9 A;  3R60 A;  5E17 F;  3ZQ7 A;  1FWZ A;  3RI4 A;  2PJP A;  4L9T A;  2NRA C;  1I1S A;  5CVR A;  3GZ5 A;  4RB1 A;  5H20 A;  1BN5 A;  1Z6T A;  2FXA A;  3DPL C;  3ZMZ A;  1TQM A;  2EFP A;  4FT8 A;  2RN7 A;  2P4W A;  1FOK A;  3V8L A;  3LQQ A;  5TRD A;  4NQW A;  5FFX A;  4R1H A;  3SQN A;  3DF8 A;  2O8X A;  3I0T A;  5LGT A;  3Q5F A;  4JQF A;  4KIC A;  1C0W A;  2FNA A;  3RTR A;  3HRT A;  5L3F A;  2V1D A;  4ENK A;  5DCF A;  2QVO A;  3Q9V A;  1IN6 A;  4G94 A;  4EJV A;  2EJR A;  1JXS A;  5LEJ A;  4Y13 A;  1I1G A;  2GXG A;  3LST A;  1ZN2 A;  3RYP A;  1L3L A;  5FFZ A;  3JSO A;  2K4J A;  4CO8 A;  2VOP A;  1FSH A;  4M9Z A;  5AON A;  3Q9S A;  1DP7 P;  2QQ9 A;  3SZP A;  3DXJ F;  2FRH A;  1UB9 A;  3PFI A;  1W7P D;  2ZNY A;  4KN7 X;  1KQ9 A;  1XDS A;  2P5V A;  2GZW A;  1G3W A;  5LRS A;  3FM3 A;  2PBI A;  4HAM A;  4UV9 A;  2QLZ A;  4LLG F;  1BJA A;  1HW1 A;  3LQR A;  3SXY A;  1ONV A;  2O6G E;  1CF7 A;  4QLC U;  1SMY F;  3W6K B;  3F6O A;  2Q8K A;  3EUH A;  3WTV C;  1MGT A;  2HYG D;  2M5W A;  3IRQ A;  3HRU A;  2KKO A;  4LJZ F;  2DK8 A;  2Z3Y A;  4P9F A;  1IXS B;  3I59 A;  3IWZ A;  3ZMS A;  3K1P A;  2IRF G;  2K02 A;  3KP4 A;  1IN4 A;  4ESF A;  3TKY A;  1LJ9 A;  2F5D A;  1STZ A;  2OBP A;  3DFG A;  3RIR A;  3KFW X;  1TW2 A;  3AAF A;  2K4B A;  3F8M A;  3JW4 A;  3GYH X;  3BRO A;  5IT3 A;  4LMY A;  1YO5 C;  3E3V A;  1Q1H A;  3RYR A;  4U7B A;  3E6D A;  5DEQ A;  3K9T A;  2E1C A;  4CDG A;  1MZB A;  1B1B A;  5BS6 A;  1KU9 A;  3R61 A;  1KU3 A;  3MZY A;  3GFM A;  1RUN A;  2STT A;  2GAU A;  1QO0 D;  1WKM A;  2GA2 A;  5CVV A;  4OMY A;  2CG4 A;  1UCR A;  3CO7 C;  1XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...