5E1WA

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the ligand free form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLKKHMVRIKLSEKAIDTFYQALEISNRVYKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides sp. cbdb1
total genus 60
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e1wA00
2A3SA 2FBHA 5L3BA 5JFRA 2H6CA 4I0BA 2DK5A 2MH2A 3F23A 3ML6A 5D5VB 4KUMA 2GA2A 2VOPA 1BI1A 4ZYDA 3CO7C 4JBAA 3TQNA 3CJNA 5ILVA 1CF7B 2M1BA 1IN8A 2EFPA 3V7RA 1RI7A 5D4SA 3WGIA 3FWEA 3KZYA 2VONA 3FM3A 3CTAA 2KIFA 5E20A 2F5FA 1H0MA 1BC7C 1I6XA 1LDDA 2RQPA 1FSHA 3P7NA 3U1DA 2HDCA 2L4AA 4WF2A 1XCVA 4EV0A 1FP1D 1FP2A 5BOXA 1EV7A 1LDKB 1WI9A 4A6EA 4MQ9F 4BHPA 2VBWA 1B9MA 1LNWA 4HAMA 3FXRA 4KIBA 4GYIA 4IPAA 2F5DA 4P55A 3F3XA 1TW2A 5H20A 4MTDA 5D5WB 1R00A 3GZ6A 3F72A 3ZP5A 1IN5A 1YFHA 5BPIA 3L00A 3TDZC 3ZQ7A 3S2WA 1WWXA 1D3YA 4I01A 3IKVA 5IT9K 4IF4A 2VC0A 5HS8A 2E1CA 1FT9A 3E6MA 1MZBA 2PMHA 2Q8KA 2OZ6A 2M5WA 3ZN1A 5J6XA 3K1PA 2QZ8A 1IUYA 3KP7A 3HRSA 1OYIA 4ESJA 2KRFA 5LRSA 2FMYA 2F2EA 5K1YA 3DPTA 1ODDA 1HKSA 2QQBA 3GFMA 4KICA 3LAJA 1X3UA 1AOYA 2L4MA 2ZJ2A 5JR3A 1YTYA 1T98A 3JAMZ 5DEQA 4EVIA 4YFKF 1S29A 1PUEE 3ECHA 3GEZA 2E7WA 3IRRA 2VE8A 4G7HF 1WSUA 4LB5A 3CUOA 2WWYA 3KP6A 4RGUA 5LEJA 4A0XA 5D6FA 2J5OA 4M9XA 4LK0F 2C6YA 1MKMA 3DV8A 4P9FA 3KEOA 1V3FA 2ZXJA 2HQNA 1U5TC 2E1NA 3F8FA 1EH6A 4U88A 1XSXA 1K78A 1BM9A 3MCZA 4GYGA 3FXQA 3L9FA 3ZMDA 2RDPA 3SQNA 4YIIA 1REPC 2IA0A 1ZLJA 2FU4A 3BZ6A 3KP4A 3R0JA 2W85A 3WU0A 2D45A 4FX0A 4D0PA 1R1TA 3LQRA 3H92A 1O7LA 3HRUA 1S7AA 3ELKA 5L3EA 3JTHA 4A5MA 2L01A 1KGSA 1RNLA 3FM5A 2PFBA 2GXGA 2JPCA 4ZH4F 2IW5A 5LEKA 2HKXA 3T5XA 1TNTA 3BP8A 2FOKA 2ZKZA 2LKPA 3GO5A 2HTSA 2RVCA 2GIVA 2CSOA 4UNOA 3AAFA 2QBYB 4R1HA 4HV5A 5LGNA 2FXAA 1GHCA 4HZFA 4LGWA 3I59A 3IC7A 4LG0A 3LAPA 1KU9A 1U2WA 3F8BA 3PQJA 3P9CA 4L5IA 4N0BA 5J8FA 3I4PA 2STWA 1IZ1A 3NQOA 1QNTA 1I5ZA 4KDPA 5DD4A 4OIOF 3C18A 5FD6A 3TOBA 3WTVC 2NAZA 1IRGA 2IVMA 1JE8A 4PCQA 1IF1A 1B9NA 5BS6A 2DW4A 1Z05A 3VFZA 5TRDA 4DQ2A 5E8IA 3FMRA 4OOIA 5K5OA 4BNCA 1H9TA 5FO5A 1ZH5A 1YW9A 5HDGA 1OYWA 1T6SA 3V7SA 4LLGF 1TQPA 2OQRA 5CVJA 5LGUA 1JGSA 3CDHA 4G6QA 1T2KA 2FMLA 5E1ZB 2X0LA 2HKOA 3RDIA 3ZMUA 2F5CA 3BROA 2GA1A 2XKOA 2Q2EA 2XV4S 4AIKA 4EMSA 2QQAA 2P7CB 1HXDA 3M8EA 5D8LB 2EK5A 1J0RA 3KZZA 1HSJA 4IHTA 3E97A 3TDUC 1G6NA 2EWNA 5H6QA 1DP7P 3WODF 3WGHA 2M30A 4HX4A 1U5TA 4KMUX 1JHFA 4CHUA 1UB9A 4GCVA 2ZCWA 4CYDA 4HA8A 2TDXA 4BQAA 3LA7A 4NB5A 3KLNA 1ZRDA 1T39A 3IWZA 3DPLC 1BBYA 2XRNA 4P5OA 5D8KB 1GVJA 2EV5A 4A2UA 3ISPA 4QLCU 4OINF 2QM3A 3BJAA 1NHAA 4L5JA 3OOPA 4EJVA 1KQ0A 3DKWA 2HEOA 5HS7A 1S6LA 5IT9Z 1BI2A 3WTYC 2VE9A 5BPDA 2LF7A 3WTZA 2VN2A 5CVVA 3H3UA 5DUIA 5DCMA 2XAQA 3KP3A 1OR7A 4Q47A 4EJOA 5IT3A 1W5TA 2EFOA 3G3ZA 4NHJA 1USTA 3W6JB 2ZMEA 4RGXA 4OU0A 3J81K 2EJRA 5CVUA 5FD5A 2P5KA 4UVCA 1ON1A 1B6AA 4LFUA 4ON0A 1B4AA 3ZMZA 1SD7A 4A0ZA 4AIHA 3M9AA 3RYPA 2D1VA 3H3ZA 1ZLKA 3GFJA 4HQMA 3R4KA 1USSA 2W24A 1MJBA 1R22A 3ABUA 1W7PB 5LRRA 1FYKA 3E3VA 4A12A 1SD4A 3F8NA 3ZMSA 1FLIA 3QOPA 4M72A 2CFXA 1LB2A 3NEUA 2L3DA 1R58A 1U3EM 1PDNC 3N4MA 2VXZA 5L3FA 3SHFA 3B73A 1XSDA 2K86A 5KK1A 3DQVC 2JPBA 4YIFA 5HDKA 2LDUA 2AS5F 3DP7A 2QENA 1XGOA 4OMZA 3U9GA 3R0AA 4S05A 5D4RA 2Z5UA 4ZYEA 5DUKA 2V1DA 3W6KB 4R79A 3RYRA 4GGGA 2GZWA 1EH7A 1J9IA 2YX7A 4LJZF 3HOTA 2H09A 2Z33A 4EJUA 2ETHA 3VOEA 2J5PA 4ENKA 3MAJA 2RKHA 1YW7A 2ISZA 5E17F 2PQ8A 3WTSC 5ICEA 1B59A 1WKMA 2RC4A 1FWZA 2P6TA 1S8NA 1RUNA 3OV8A 1Z91A 2HYFA 1W5SA 1FYLA 4LK1F 4AIJA 1G3TA 1U6GA 4AWXB 4Z2YA 1ZG3A 1IRFA 1KA8A 1QZZA 4KN7X 3BPVA 4GXOA 5FLXK 2IA2A 2K7LA 4UHTA 4EJTA 4LLNA 2BGCA 4RB0A 2JSCA 2L54A 1D8JA 1IN6A 5J8CA 2A6HF 2O0YA 4UV8A 3HTSB 1P4AA 3GLXA 1QO0D 1BN5A 3CUQC 1U78A 3FF5A 3I53A 3QAHA 3I0TA 1D8KA 1E2XA 4PDKA 4DNCA 3E5QA 3QP5A 2Z99A 1K78B 2HOEA 1HW2A 2Z3YA 2JTVA 2RGVA 2O03A 1KU7A 2IA1A 2ESNA 4EM0B 3COAC 2WV0A 2RV8A 4BYYA 3FZVA 2XVCA 4KYWA 2FF4A 3IL2A 5D5XB 2Y48A 1SFEA 3K1MA 3MWMA 3ECOA 5E1WA 3KP5A 2ESHA 1J59A 3WTWC 4BH9A 4HLYA 2XHKA 3GWZA 4KIFA 5HS9A 3VODA 5F6FA 3HRMA 2VOOA 1RZ4A 5DYMA 2FNPA 4MNUA 2OD5A 4HQEA 1OMIA 3F8CA 2PI0A 3HYIA 2KIMA 1XDUA 2V79A 3VEPA 3Q5FA 3KEQA 3O6BB 4IVNA 1RIOH 3F6OA 5A2QK 3I58A 3I59B 4QWQA 4LG0B 2EA4A 4U0VA 4A6DA 5ERIA 4WXHA 2KKOA 1EH8A 2A69F 2CQKA 4A0YA 4JK1X 3ZMTA 2ELHA 2P6SA 2DAOA 4ENNA 1SD6A 3N97A 4HW0A 4I7HA 1O57A 2HZTA 5LLQA 4Y13A 2ZFWA 5DD8A 1BC8C 2YR2A 1ZHFA 5HVQC 1XGNA 4RB1A 2QVOA 1MDMA 3SZTA 2QQ9A 4E70A 3QPHA 1IN4A 4EM2A 5LHGA 2F5EA 1KU3A 4M73A 4CDGA 3DFGA 4A5NA 4ZYGA 1XD7A 1XSVA 3TO7A 3IKTA 4N9HA 3J81Z 3E5XA 4IRIA 5ICFA 5H6RA 1ZRFA 4ENMA 3M1EA 5AONA 4Q4ZF 2HWVA 4FT8A 3IRQA 4BAYA 2XAFA 3CUQA 4RB3C 3NRVA 1U5TB 1MJ9A 3GUDA 1VTNC 2CO5A 3WTXC 3M7GA 3PQKA 1I1GA 5CVRA 2XUBA 4O5VA 2CYYA 5HLIA 4EGYA 4PZJA 2FBIA 1S7OA 2EV0A 1SMYF 1T0FA 2DT5A 1TW3A 3QU6A 4I09A 4O6JA 1FY7A 3QP6A 5D6EA 1ZREA 1U8RA 1ZARA 5ICGA 2W57A 5DCMB 2BV6A 1J7KA 2YSRA 3HUGA 2XASA 2M45A 1BI3A 5CLSA 3WE2A 2HS5A 4ESFA 3JTGA 3I64A 2ZMEB 3CO6C 1P4WA 1Y0UA 3MZHA 3K1NA 3P9IA 1DPRA 1GXQA 1HW1A 3HIFA 4KA4A 2OAZA 2VBXA 4L0YB 2NS0A 5CYVA 4MHGA 2A61A 1A04A 2M87A 3WGGA 3ZN0A 4RGRA 3ERED 2DTRA 4ZYHA 2EFQA 4I02A 2NNYA 2Y0MA 4WX9A 2DQLA 5FFZA 5FLXZ 2R7FA 3I71A 2CW0F 2OQGA 2CGPA 1R23A 2IT0A 2OBPA 3F8MA 1E17A 2O8XA 4OMYA 1OPCA 5L3CA 2XKPA 2MLKA 1Z7UA 2FEZA 4HV6A 3RTRA 3REOA 1P4XA 3K0LA 2IJLA 4O3MA 1R5GA 3VB2A 3M8FA 1YQAA 4CO8A 1F1ZA 2CG4A 1LJ9A 5BMZA 3J80K 3FMQA 5TJJA 4BHBA 3GYHX 2XAGA 3EETA 2JRTA 1QQIA 4P9UA 4S04A 2A68F 4FHTA 1IAWA 4IXAA 1G3WA 3TO6A 4MQVA 4M9SA 3LA3A 1XMKA 4KN4X 1BOAA 3RKWA 4UV9A 3JSOA 1LDJA 4U0WA 2VBZA 2FNAA 1Q1HA 2XGXA 2NRAC 1KYWA 1OYYA 2ISYA 5E8GA 3EQLF 4HF2A 2R7DA 3RKYA 4EJWA 1FBSA 2DPDA 4CGZA 1IW7F 2STTA 1J75A 3BJOA 5HDNA 1IXSB 3RIRA 5CVIA 5F64A 1YG2A 4KIGA 5ILSA 2JZYA 2R3SA 3MQ0A 5A2QZ 2OU2A 5AIQA 3HSEA 2VT2A 1K7AA 3PFIA 3V8KA 5BQTA 1YIOA 2IRFG 1YS7A 1XMAA 2HGCA 2A07F 4HX8A 4OIQF 3GX4X 1FBQA 6PAXA 2PMUA 3K9TA 4RB2C 2YX4A 2QUFA 1KYZA 4MEYF 1T38A 2IP2A 2PG4A 5CJ9A 1L0OC 5JVTA 4ASNA 2PEXA 4R8HA 2P7VB 5DV5A 4Y15A 1HKQA 1ONVA 2LSOA 3HSFA 2COMA 3BOQA 2VT3A 1MD0A 3KE2A 4P96A 4BHCA 3KCCA 2KIUA 4RAYA 4CICA 3ZMVA 3FXUA 3DXJF 2FA5A 3C1DA 2IPQX 2GXBA 2P5LC 1P2FA 4LD5A 1STZA 2XIGA 4Q5SF 2MLGA 1R1VA 3L2CA 1KQ8A 3D0SA 2G7UA 1ZAOA 5D5UB 2QLZA 3E6BA 3L7WA 2O3FA 4L0ZB 5LHHA 3WG9A 1QBJA 3V8LA 2L02A 2MH9A 5ED4A 2G9WA 2RN7A 3LQQA 4YFXF 2H94A 3QU3A 1R1UA 2VODA 5HOOA 1XGMA 1SD5A 2ACJA 3IHUA 1O3TA 2Z9OA 1PP8F 1TLHB 2KJBA 3DEUA 1MDMB 3V7CA 3RJPA 1UFMA 4KT5C 5K5RA 4KNYA 3MFKA 2MD5A 3JW4A 4RAZA 3U2RA 3IWFA 2EB7A 2LNBA 1G4DA 3TKYA 2V1XA 4LLLA 5FGMA 2UXNA 3T8TA 3FX3A 2Y75A 2HTJA 2DFIA 2E7XA 3EUHA 2O6GE 1BIAA 1MGTA 4XRFA 2HYGD 1SAXA 4B09A 4G7OF 1ULYA 4HX7A 1XB4A 1TTYA 3V4GA 3CUQB 3BJ6A 2D2WA 3WU1B 3Q9SA 1O7FA 2FQ3A 4L9VA 1YYVA 3TGNA 4G94A 3RPQA 2QWWA 1DUXC 1DPUA 2JT1A 3HHHA 5FB2A 1W7PA 2ZNYA 4ZZDA 1CGPA 4EM1A 1LEBA 1ZN2A 1KU2A 4I98B 2ZO4A 3FHZA 1TNSA 2KJCA 4I0AA 4B8XA 4MGRA 3QPTA 1F4KA 1W4MA 1I1SA 3LSTA 4MEXF 2UXXA 4WWCA 3J80Z 3DF8A 2M8EA 4RGSA 2BBYA 3WE3A 5EEGA 1GXPA 3TO9A 1ZGAA 4EQQA 1HBXG 4UVBA 4UXNA 5AIPA 1FX7A 4ESBA 2BYVE 3E5UA 3BWGA 3L09A 3E6CC 1OKRA 1PP7U 4NQWA 4Q48A 5DDGA 4HF0A 4GO1A 3TOAA 1FOKA 1FBUA 1FPQA 1O3QA 1FC3A 1J5YA 3KFWX 1S3JA 2UWMA 2W84A 2DO7A 5JI6A 5LGTA 1CF7A 3MEXA 2YPRA 4IHSA 4G9YA 3T1BA 1L3LA 3HOSA 1UHWA 3KETA 1ZG1A 1WRJA 4JQFA 3P9KA 4N9IA 1XCBA 3RI4A 2NYXA 1IXCA 1XGSA 1HKTA 3WTTC 4OIRF 1LQ1A 4L18B 4M6YA 4ETSA 2V1UA 1D5VA 1G3YA 3GFLA 1Z9CA 4XBFA 1FSEA 2DLLA 1ZYRF 2K27A 1JHHA 4G8XA 2EA2A 1P92A 3LFKA 1R36A 4HOBA 1SFXA 2VC1A 3RKXA 2FSWA 4KMFA 1ON2A 2MA3A 3JSPA 3J7AO 1F5TA 3BDDA 2X4HA 1HW5A 4XLPF 1J2XA 1ZRCA 2GQQA 2ZNZA 2G7HA 2VBYA 3CLOA 1P6RA 1YW8A 4U7BA 2XAHA 3R6SA 3T8RA 5E1XA 5F1RA 1R7JA 1B1BA 5LBQA 2RNJA 1IN7A 1XN7A 1LEAA 5EEHA 5K5QA 1HSTA 2WC2A 3R61A 1Z6RA 2NNNA 3ULQB 4FX4A 1F9NA 3I5UA 4Y17A 2ZBKA 4AD9A 4WXDA 4MTEA 1H9GA 3EYIA 3F21A 1BI0A 4PGHA 3Q9VA 2DQRA 3C7JA 2OA4A 3V8JA 4U0YA 2BE5F 2CWEA 2DK8A 1K6OA 1G3SA 2DBBA 4M74A 2P5VA 1DDNA 1AWCA 2OZUA 3K69A 1TQIA 3F22A 2A6EF 2FBKA 2D1HA 3GF2A 3KP2A 4G6DA 2PJPA 4G7ZF 4L9JA 2ADUA 5HLHA 2O61A 1FZPB 3E6DA 4XLNF 4IJAA 4K2EA 2A5YB 2K4JA 2LF8A 1IXRC 4IRHA 2WTEA 4CZZA 2EFWA 3SFZA 3GVAA 1FYMA 2P4WA 5L3GA 2B0LA 2EFNA 4OIPF 1W7PD 4AVPA 4LMYA 4PGGA 5ILUA 3O2PE 2PBIA 3SZPA 1QPMA 3HHGA 3O3KA 2DPUA 3GW2A 4IRGA 4LB6B 1TQMA 4TV7A 5DCFA 3SXYA 2DU9A 3F6VA 1I27A 3G73A 3KLOA 4RS8A 1YS6A 3BY6A 1QZYA 3ZPLA 1LVAA 1KQ9A 1BJAA 2PLYA 3B02A 2V9VA 1YLFA 1SMTA 1R5HA 5L3DA 3K2ZA 4HDUA 3GZ5A 2AXLA 2HFHA 2P8TA 4ZZLA 3FMSA 4YG2F 2MBFA 2GWRA 1ZG5A 1JXSA 2K02A 3HSRA 3D5LA 4HDVA 1O3SA 4F7ZA 5E18F 2MC3A 2HQRA 3JAMK 3QRFF 2XAJA 5KVRA 3HRTA 2PN6A 4HLXA 1Z1DA 3HTUA 3R60A 1SFUA 4YFNF 3LWFA 4M9ZA 3GXOA 1C0WA 1WQ2A 2K4BA 2QBYA 1V4RA 4EGZA 4CXFA 4I2OA 1ZGJA 1BIBA 4L9TA 4XSXF 1UCRA 2UZKA 4M6XA 4ENJA 2Q0OA 4HYEA 4WCGA 3WTUC 4UVAA 3BPXA 3T0YA 4L9NA 3ROUA 1YO5C 1QGPA 4HF1A 1FNNA 3LA2A 3MZYA 5JHUA 5HLGA 2V6CA 4BXUA 1RUOA 5FFXA 5LHIA 3EYYA 2EV6A 1MJAA 2DI3A 1K79A 4U7DA 4WXCA 2GAUA 3ABTA 2HR3A 1XDSA 3C3WA 4H0EA 4M71A 4UUVA 2FE3A 4HBLA 4WK8F 4XSZF 1Z6TA 2QYOA 2YU3A 4KFCA 2H27A 2FRHA 3EDPA 3GFIA 3RPUA 2H6BA 1O3RA 2W25A 2XROA 1TBXA 1UHMA 2BEOA 3I54A 5ICCA 1HQCA
chains in the Genus database with same CATH superfamily
3WG7H 2A3SA 2FBHA 2P81A 1YJ9I 2LY9A 4XKCA 5L3BA 5JFRA 2E36A 2H6CA 4NQWB 1UHSA 2FJ1A 4V19K 3HM5A 4I0BA 2DK5A 2MH2A 3F23A 5C4XJ 2L5QA 3M07A 4XKVA 3ML6A 5D5VB 1X1DA 4KUMA 1X1CA 2GA2A 4HNVA 3LSMA 4XRSA 2Y30A 2VOPA 2KT0A 1BI1A 1JT6A 4ZYDA 3CO7C 3JRIA 4JBAA 2DMPA 3CJNA 3TQNA 3BTIA 5ILVA 3FKIJ 1CF7B 3I9V2 2E19A 2LMDA 1G8XA 1SVLA 3JRBA 3RZOJ 4E4HA 2M1BA 1OQYA 1IN8A 2EFPA 2GM4A 3Q3SA 3V7RA 1RI7A 2X6YA 5D4SA 5B1AH 3WGIA 1RETA 3FWEA 4CCMA 3KZYA 2VONA 2LYCA 2M2EA 1T8IA 3FM3A 1Y56A 3A02A 1TT0A 2K9NA 3CTAA 3EUKL 4UB6C 2KIFA 5E20A 3L2WA 2F5FA 3ZQCA 1H0MA 3PNVA 2R0QC 4FETA 4YRVA 1W36D 2HOAA 4UUSA 4PUSA 4HPQA 1BC7C 2JWTA 1I6XA 1YRNB 2VKVA 3QODA 5TGTA 1LDDA 2DN0A 2RQPA 2Y31A 1FSHA 3P7NA 3U1DA 2LC2A 2Y0SN 2HDCA 4N4OB 2HVQA 2L4AA 4WF2A 2ICWG 1XCVA 2AHQA 4EV0A 4Y4RA 2OCCH 4ZDLA 2VUMJ 1FP1D 3IH3A 4RM3A 1FP2A 5BOXA 1EV7A 2DODA 5IP9J 2QSHX 3CMMA 1TZLA 1UAAA 1LDKB 3PIOF 2OV7A 4HRIA 1WI9A 4A6EA 4MQ9F 4BHPA 4BBSJ 2E71A 2VBWA 1B9MA 1YOVB 2VKHA 2VQCA 3ZCOA 1LNWA 1TWGJ 4HAMA 3DEWA 3FXRA 1X2MA 2XRLA 4KIBA 3MVPA 4GYIA 4IPAA 2EIJH 1TL8A 2F5DA 3NWSA 4P55A 3F3XA 1D5YA 1TW2A 5H20A 3H9GA 3NAUA 4MTDA 1JGGA 3MD2A 1PJRA 5D5WB 1R00A 2LLKA 1JUMA 2ZJPF 3H5AA 2KZVA 4XLHA 2L9RA 1A36A 1ZKGA 3GZ6A 3F72A 4A3IJ 4FISA 3ZP5A 1IN5A 1YFHA 5BPIA 3FK6A 3L00A 4YELA 3TDZC 4HSRA 3ZQ7A 3S2WA 1WWXA 3LSPA 1D3YA 2HU9A 4I01A 4A3JJ 3HUGB 3IKVA 1SC7A 5IT9K 4IF4A 2KLOA 2VC0A 5HS8A 2E1CA 1FT9A 3E6MA 1CQTA 1MZBA 1TWFJ 2PMHA 1ETWA 2VPRA 2Q8KA 1GVDA 1JKPC 1A6IA 1VFCA 2NVQJ 2OZ6A 1UG2A 2XGDA 2DDBA 2X1EA 2M5WA 3FK7A 3JCUC 3ZN1A 5J6XA 3TMOA 3K1PA 2R7UA 1I50J 2QZ8A 1Q1VA 4XIDA 1IUYA 1WFXA 3KP7A 3L2QA 4I6ZA 4NNJA 3VWBA 3HRSA 1OYIA 4ESJA 3OS0A 2BZTA 5IP7J 2KRFA 4AC0A 3TP3A 2OPTA 4FCYA 2QGUA 5LRSA 1BR2A 2WY8Q 2FMYA 2F2EA 4E7ZA 2FOWA 3DCFA 1MNMC 5DM7F 1MSFC 2LOOA 2ZB9A 1ODDA 1HKSA 2QQBA 3DPTA 3GFMA 4KICA 1X3UA 5K1YA 3LAJA 2L4MA 1W36C 1AOYA 2ZJ2A 5JR3A 3O8HA 4PSXA 1YTYA 3K4JA 1T98A 3SYTA 3JAMZ 1LPQA 2XC7A 2Z1DA 5DEQA 2ELJA 4EVIA 2NOGA 4YFKF 4XLEA 1S29A 1PUEE 3ECHA 3AG2H 5F27A 3GEZA 2E7WA 2V4JC 3IRRA 4V2FA 3GTJJ 2VE8A 4G7HF 1WSUA 1HC8A 4LB5A 2PJRB 4AYBN 3CUOA 2WWYA 1ETOA 3KP6A 4RGUA 4H4KC 3E1SA 5LEJA 4A0XA 5D6FA 2J5OA 4M9XA 4LK0F 1QPIA 2C6YA 1MKMA 2V1NA 1N75A 1G59A 2RAEA 3DV8A 4P9FA 2YU9J 1VF9A 3KEOA 1V3FA 2ZXJA 2HQNA 1U5TC 2R92J 1EJ9A 2E1NA 3F8FA 2R93J 1EH6A 3RPUD 3HOVJ 4U88A 1XSXA 1A6QA 4FE4A 1K78A 4PSWA 1BM9A 3OYKA 3MCZA 4GYGA 5EDNA 5FKLA 3FXQA 3HXLA 3L9FA 2RDPA 3ZMDA 3FXKA 3VSLA 3CF5F 3SQNA 4YIIA 1REPC 1DGWY 2IA0A 1ZLJA 2R5ZA 2FU4A 3FHNA 3BZ6A 3KP4A 3R0JA 2OCEA 1JT0A 2W85A 4ABZA 3PUFA 4IZZA 2DCEA 3WU0A 2D45A 4RA2A 2R5YA 4FX0A 1HCRA 1AKHA 2VJ4A 4D0PA 1R1TA 3LQRA 3H92A 3WHCA 1O7LA 5FJ8J 2VI6A 2XAUA 5KNLA 3HRUA 1S7AA 5HLTA 3ELKA 5L3EA 5B1BH 4IO9F 3ZQGA 2VPLA 3CC4I 1ITYA 3JTHA 3PFYA 4A5MA 2YUSA 2VLAA 1DU6A 2L01A 2HOTA 2I10A 3UKGA 2LTPA 1KGSA 1SANA 4HEA2 3A2KA 1RNLA 3FM5A 2PFBA 4W97A 2GXGA 2JPCA 3IAM2 1U8BA 1VQPI 3H5NA 4ZH4F 3GTLJ 2L7ZA 2IW5A 3BT9A 1RRJA 5IYDJ 1JI8A 2ZMEC 3G1OA 5LEKA 1FIAA 2HKXA 5FKKA 3T5XA 1TNTA 1HOMA 5K7ZA 3BP8A 2BXYA 2FOKA 5FROA 5HODA 2ZKZA 1D0YA 2LKPA 3GO5A 2OTLI 2HTSA 2JA6J 2RVCA 1I3AA 2CSOA 2GIVA 4AU7A 4UNOA 3AAFA 2QBYB 4R1HA 4HV5A 5LGNA 2FXAA 1GHCA 4HZFA 4LGWA 3I59A 3IC7A 1RKWA 3CCSI 4LG0A 5EZGA 1FOWA 3LAPA 2CUJA 1KU9A 1P7IA 4J00A 1U2WA 3F8BA 3PQJA 1Y39A 1GDTA 5CQEA 4LOCA 3P9CA 4L5IA 2M3AA 4N0BA 5EGOA 3JRHA 1XS9A 2BVLA 5J8FA 3I4PA 2STWA 1IZ1A 3NQOA 1YIJI 4MFEA 1QNTA 5FLVA 2R7RA 1I5ZA 2E60A 1XG1A 5CPRB 2VASA 4KDPA 5DD4A 4CUGA 4OIOF 3C18A 5FD6A 3TOBA 4A3LJ 3WTVC 2ZFUA 4Y33A 2NAZA 1IRGA 2QEXI 2IVMA 4LG3A 2M4KA 2Y69H 4B3XA 1LE8B 1B72A 2MFZA 1JKRC 1JE8A 4PCQA 3IUOA 3VDXA 1F36A 5B66C 1IF1A 1B9NA 2I5UA 4NC8A 5BS6A 4GFBA 2DW4A 5F0CA 4AUXA 1Z05A 5DTDA 3VFZA 4XLFA 2LVSA 2W1OA 5TRDA 4ANJA 4DQ2A 5E8IA 3FMRA 3OYBA 4OOIA 5K5OA 4ZYAA 4IHYA 5C4JJ 4BNCA 1X3WB 1OLTA 4E7KA 1AU7A 1H9TA 2L9SA 5FO5A 4D7NA 1ZH5A 4Y52J 1YW9A 5HDGA 1OYWA 1WHUA 3H9JA 1T6SA 3V7SA 3CD6I 3MZ8A 1IV6A 4LLGF 1TQPA 1Z7LA 2OQRA 5CVJA 5LGUA 1JGSA 1MH4A 1X4PA 3CDHA 4G6QA 4AM3A 1FTTA 1MMAA 1T2KA 4E7IA 2WAEA 2FMLA 2Z16A 1FTZA 2KRCA 5E1ZB 3LSGA 3I56I 4C2UA 3CQZJ 3DLLF 5C3EJ 1U0JA 1H89C 3BTLA 3QPLA 2X0LA 2HKOA 3RDIA 2EBIA 3ZMUA 2F5CA 3BROA 2GA1A 2XKOA 3O8GA 3CC2I 2E1MC 2Q2EA 2XV4S 4AIKA 4EMSA 3M3YJ 2QQAA 3DEEA 2P7CB 3S1QJ 1HXDA 3M8EA 4FE7A 1K4SA 5D8LB 2EK5A 1D0XA 2CUZA 1Y1WJ 4HSTA 3JREA 1J0RA 2ME6A 1AKHB 4A93J 2M0CA 3KZZA 5F1JA 1HSJA 4IHTA 3E97A 2MYSA 3HB9A 3JRFA 3TDUC 3GTKJ 1G6NA 2EWNA 4BDYA 2QF7A 5H6QA 1DP7P 3WODF 3WGHA 2M30A 4HX4A 1S5LC 1U5TA 4KMUX 1JHFA 3SDBA 4CHUA 3UR3C 1QHHD 1UB9A 4BGDA 1VQ4I 3LMMA 5FRMA 2KHMA 2ZCWA 4GCVA 3SEZA 3HJEA 4CYDA 3QOEA 4HA8A 2TDXA 2W48A 1XX5A 2CRGA 4HNTA 4BQAA 1ETYA 3LA7A 4NB5A 3MMYB 3KLNA 3UNGC 1ZRDA 2NVXJ 1T39A 1VQ7I 4A3BJ 2RQQA 3IWZA 5E3LA 5EYRA 3DPLC 2QSGX 1BBYA 2XRNA 4P5OA 5D8KB 4DYCA 4IQ4A 1GVJA 2EV5A 2IAIA 1MMGA 4A2UA 4IEJA 3ISPA 4PJ0C 3MN2A 3CCQI 4QLCU 2UUZA 4CCNA 1VQ8I 1UG0A 4OINF 1BOBA 2QM3A 4BQOA 3BJAA 1NHAA 4L5JA 3OOPA 1KQ0A 2R7QA 4EJVA 1JUPA 3DKWA 3D5SC 3LNQA 2HEOA 5HS7A 1S6LA 5IT9Z 5J1YA 2EILH 1BI2A 3WTYC 2VE9A 2VJIA 4ZDPA 2LF7A 5BPDA 3WTZA 3BG9A 4IKFA 2VN2A 5CVVA 3TW6A 4UUSB 3IV5A 3S3MA 4ZC3A 3H3UA 5DUIA 3ZQLA 5DCMA 2XAQA 4YIRX 3KP3A 2HDDA 1LFPA 1OR7A 4Q47A 2D5VA 4DZJA 2BY1A 4EJOA 1Y0NA 5IT3A 1W5TA 2EFOA 3CMAI 3G3ZA 2DYRH 2VIXA 2IXSA 3OYHA 4NHJA 1USTA 3RQ4A 3W6JB 1ZELA 2BXZA 3S1RJ 2ZMEA 1SEUA 2WB1A 4RGXA 4OU0A 3NWTA 3J81K 2EJRA 4BE1A 5CVUA 4C3IJ 5FD5A 2P5KA 4UVCA 1ON1A 3BG5A 4MFDA 1B6AA 4Y7NJ 4LFUA 3GTMJ 4ON0A 2LH9A 3PJRA 1B4AA 1U9OA 3ZMZA 1SD7A 4A0ZA 4AIHA 1JUSA 4DYRA 2NS7A 3FBIB 3M9AA 3RYPA 2D1VA 3H3ZA 1I6HJ 1MBFA 1ZLKA 3GFJA 5IP6A 4HQMA 1HLVA 3R4KA 1LKXA 1USSA 5GADJ 1AHDP 2W24A 1MJBA 1R22A 3ABUA 1BW5A 1W7PB 2HDWA 3OS1A 5LRRA 4A3GJ 3S32A 1FYKA 1X1PA 3F9KA 3E3VA 2WY7Q 4A12A 1SD4A 2XGEA 3F8NA 3ZMSA 1I39A 1FLIA 3QOPA 2NOJB 4M72A 2CFXA 1LB2A 2E34A 4GDFA 3M8JA 3NEUA 2L3DA 1R58A 3K10A 1U3EM 1PDNC 1VQKI 3N4MA 2VXZA 5L3FA 3SHFA 3PL8A 1HDDC 3FXOA 3B73A 1XSDA 2K86A 4B44A 1TWHJ 3PM1A 3DQVC 5KK1A 5J3LA 4II3A 3GZNB 2JPBA 4XOPA 4YIFA 1KZHA 2LDUA 5HDKA 2AS5F 3DP7A 2QENA 1XGOA 4OMZA 3U9GA 3R0AA 4S05A 5D4RA 2CS3A 4BY1J 2Z5UA 4ZYEA 5DUKA 4X0GA 3AG4H 2V1DA 1OCPA 3W6KB 3OYFA 4R79A 1I3QJ 2KDOA 5E79C 3KX2A 3RYRA 2H1KA 4GGGA 5EG0A 2GZWA 1MMDA 4CCKA 2QCOA 3W2VA 1EH7A 1T56A 2LKXA 1J9IA 5GPAA 1GV2A 2YX7A 4LJZF 2JA5J 1IDYA 4JP0A 3F0CA 3HOTA 2H09A 2W82A 2Z33A 4EJUA 2ETHA 2EZKA 3PO3J 3W6VA 3VOEA 3PUBA 1WGXA 2J5PA 4F91B 3BC8A 4KITB 5LFAA 4ENKA 3MAJA 4DGWB 3S3NA 5FKMA 2RKHA 2TCTA 3DBLB 1YW7A 2CV1A 2ISZA 3BR1A 5E17F 1VI0A 3MKWB 2PQ8A 3WTSC 5ICEA 1Y6IA 1B59A 2ZJRF 3K6GA 1WKMA 2RC4A 4JX6A 2R7OA 1YI2I 1FWZA 1E3OC 2P6TA 1S8NA 1N78A 2X48A 4XQFA 1RUNA 3AKZA 3OV8A 1Z91A 2B7EA 2HYFA 1W5SA 3L2VA 1FYLA 4LK1F 4AIJA 1APLC 1G3TA 1BW6A 1U6GA 4AWXB 4Z2YA 1J09A 1ZG3A 1IRFA 1KA8A 1QZZA 3EPZA 4KN7X 3J7YJ 3BPVA 4GXOA 3OYDA 5FLXK 4IOCF 2IA2A 2K7LA 4UHTA 1ZK8A 4EJTA 4XL9A 4A3KJ 2BGCA 4LLNA 4RB0A 2R7VA 2O8KA 2JSCA 3DTKA 1RESA 2L54A 1YHQI 3BTCA 1D8JA 3H5RA 1IN6A 5J8CA 2DA3A 1WI3A 2A6HF 2O0YA 4UV8A 2LRDA 3HTSB 1P4AA 2M4GA 2GOXB 3GLXA 1QO0D 1BN5A 1IG7A 3CUQC 1U78A 3LSIA 1YJWI 2L7MP 2XPWA 3FF5A 3I3LA 3I53A 3QAHA 3I0TA 1D8KA 5K7HA 2WAQA 3P5JA 1E2XA 3ONQA 2ZXWH 4PDKA 4DNCA 3E5QA 3QP5A 2R7WA 2Z99A 1K78B 2HZDA 2HOEA 3LFUA 4YEJA 2BW3B 1HW2A 3BTJA 2Z3YA 4QSHA 2JTVA 3EUAA 5B5EC 1ETVA 2RGVA 2O03A 3VSKA 1KU7A 2R5ZB 2JSPA 4UB8C 2IA1A 2ESNA 4EM0B 1IO2A 3COAC 3M4OJ 2WV0A 2K9QA 2RV8A 3C2GA 4BYYA 1IUFA 3FZVA 2XVCA 1DU0A 4KYWA 2FF4A 2GOMA 2R5YB 1M1EB 3IL2A 2VKEA 5D5XB 2Y48A 3CP8A 5J1RA 1SFEA 3K1MA 1Z3XA 3MWMA 4A3EJ 3ECOA 3QQAA 3A01A 1E3HA 2JA7J 1Y8QB 2HPIA 4CA0A 1WJAA 2N8GA 5E1WA 3KP5A 2ESHA 1J59A 3CCRI 3CP2A 3WTWC 3S14J 3SFIA 4BH9A 4HLYA 3GCMA 1D1AA 2XHKA 3GWZA 5CKTA 4KIFA 5HS9A 3DU6A 1KONA 3VODA 1MBKA 5F6FA 1V54H 3HRMA 5EF6A 4C30A 2VOOA 1RZ4A 2X6WA 5DYMA 3MKLA 2FNPA 4MNUA 1Z21A 2OD5A 3GTQJ 2DMTA 3G6EI 4HQEA 1OMIA 3F8CA 2PI0A 3HYIA 2KIMA 1SVMA 4ZJZA 2B9SA 3CCYA 4ZDOA 1W1WE 3OY9A 1XDUA 2V79A 3VEPA 1TP4A 2ID3A 3Q5FA 3KEQA 3O6BB 3OMYA 4BUPA 4IVNA 3MKZA 2XDVA 1Z3YA 1YX3A 2CV2A 1MNEA 3F6OA 1RIOH 5A2QK 3I58A 3I59B 2L9NA 4QWQA 4CYCA 4LG0B 2EA4A 4U0VA 4A6DA 3OIPA 3BR3A 1QZEA 5ERIA 4WXHA 2KKOA 4AVZA 4DW6A 5EGOB 4C3HJ 4ZTFA 3H36A 1R49A 4DZPA 2EZIA 1EH8A 3H35A 2A69F 4DBQA 3HOYJ 2CQKA 4A0YA 5E3MA 4JK1X 3AFHA 1QVUA 3ZMTA 2DFFA 4NDLA 2ELHA 1ZGWA 2P6SA 2JA2A 1XTAA 1TT5B 2DAOA 5IOYA 3ESWB 4ENNA 3N05A 1SD6A 3L2UA 3N97A 2PMZA 3OS2A 2LD5A 3V42A 1B72B 4OAZA 4HW0A 1Y8RB 4I7HA 4NUBA 1O57A 2BY2A 2HZTA 3CMEI 5LLQA 2Z2SB 4Y13A 2ZFWA 5DD8A 1R71A 3ZQQA 1DP3A 2LR8A 1BC8C 2MC4A 2YR2A 3G71I 1ZHFA 2CUEA 5HVQC 1XGNA 2HXOA 4RB1A 4FQGA 3CC7I 2QKLB 3AL0C 2QVOA 1NG6A 1MDMA 3SZTA 3OYAA 3BR2A 2L9VA 2QQ9A 4CSWA 4E70A 3MKYB 2L7KA 3QPHA 2KZGA 4QIWN 1IN4A 4XR6A 2K40A 4EM2A 2IS1A 5LHGA 2BHYA 2F5EA 4W1UA 1KU3A 2OC6A 4M73A 4CDGA 3DFGA 4A5NA 4ZYGA 3S16J 5IYBJ 1XD7A 2TRTA 1S7EA 1NK3P 2KL4A 1XSVA 3TO7A 3I4MJ 3BR0A 3IKTA 5HNFA 1ETQA 1EKEA 2M7AA 3AL0B 4N9HA 4FASD 3HBLA 3CCUI 3J81Z 3E5XA 3SZGA 4IRIA 5ICFA 5H6RA 1ZRFA 4ENMA 2PX9A 4OWRB 3M1EA 1YRNA 1U9NA 5AONA 1ZR4A 2X9DA 4Q4ZF 2HWVA 3LOCA 4FT8A 2IGNA 2XF6A 1EA3A 3IRQA 2EINH 4BAYA 3I4NJ 2M9HA 2DT7B 2XAFA 3CUQA 4RB3C 3NRVA 4DOZA 2BY3A 1U5TB 3HEFA 3VPRA 1MJ9A 3GUDA 4PFPA 2B63J 1VTNC 2CH0A 2VL8A 2CO5A 3H0DA 3B6AA 3WTXC 3M7GA 2DA1A 3PQKA 2DYSH 1I1GA 4MO7A 1IJWC 5CVRA 2XUBA 5IY5H 4KT6A 1YE9A 3SEQA 4O5VA 2CYYA 1LVKA 2XB0X 3HGYA 5HLIA 1OR7C 3JR9A 3PIPF 2F5VA 4J01A 4EGYA 2GXAA 4D5FA 1Z77A 1V5GA 1K4TA 4PZJA 2FBIA 1S7OA 3DKYA 5H2FC 2EV0A 1SMYF 4DIQA 1T0FA 2DT5A 1TW3A 3QU6A 4I09A 4O6JA 1FY7A 2OTJI 1GV5A 2RREA 3QP6A 1VNDA 5D6EA 3BCAA 1ZREA 2K5CA 1U8RA 1ZARA 2AXTC 2K9LA 2KMUA 1FJLA 5ICGA 1OJLA 1WCMJ 2W57A 5DCMB 2BV6A 1RR7A 2DA7A 2O7OA 1NTCA 1J7KA 2YSRA 3HUGA 2XASA 2M45A 1YITI 1BI3A 5CLSA 3WE2A 2HS5A 3BZCA 4ESFA 3JTGA 3I64A 1IRXA 2ZMEB 3FDYA 3H9QA 3QYFA 1RR8C 1ENHA 2CQ7A 3CO6C 1P4WA 1Y0UA 1FMVA 2ZC2A 3MZHA 2MG4A 2DMQA 3K1NA 2WB1N 3P9IA 3OSGA 2XF5A 2IS6A 2X1DA 4I76A 1DPRA 1GXQA 1HW1A 2QSFX 3HIFA 4KA4A 2VQGA 2X6XA 2OAZA 2VBXA 1V55H 4L0YB 2COBA 2NS0A 5CYVA 2R7XA 1ZQ3P 1JKOC 1G2HA 2A6TA 2O5RA 1X2NA 4LITA 4MHGA 2A61A 1NK2P 5J4YA 1A04A 5GAGJ 2M87A 1VQMI 3WGGA 3ZN0A 4JYKA 4RGRA 1SFOJ 3ERED 2DTRA 4ZYHA 1MBEA 2EFQA 4I02A 5FLMJ 2NNYA 1W0UA 2Y0MA 4WX9A 2L2OA 5F0FA 2A05A 1WPKA 2DQLA 2WADA 5FFZA 2EIKH 5FLXZ 5FKNA 2R7FA 4B4CA 3I71A 2OUMA 1PYVA 3CCJI 2CW0F 2OQGA 4A3FJ 2CGPA 1R23A 2IT0A 5GAHJ 2OBPA 3OYIA 3A4CA 3HC7A 3F8MA 3H3VK 1TWAJ 3S1MJ 1E17A 2O8XA 2XGCA 5F04A 4OMYA 2NS8A 4CCLA 1OPCA 3G1MA 3I55I 5L3CA 4XNFA 2XKPA 2MLKA 3TEDA 1Z7UA 2FEZA 5EJCA 4HV6A 3RTRA 3REOA 2PJRA 1P4XA 3K0LA 2IJLA 4O3MA 3HKZA 4BJ6C 3S1NJ 1R5GA 2ID6A 3VB2A 3OYNA 3M8FA 1YQAA 3RQIA 4CO8A 4IHVA 1F1ZA 2CG4A 1LJ9A 3DTEA 5BMZA 3J80K 5KHDA 3FMQA 5TJJA 4BHBA 3CCMI 3GYHX 2XAGA 3EETA 2JRTA 1QQIA 3D5RC 4P9UA 2UV1A 2E5NA 4S04A 2A68F 4FHTA 1IAWA 4IXAA 2ZSIB 1IRZA 1G3WA 3OL4A 3TO6A 4MQVA 4M9SA 5FRNA 2E1MB 3LA3A 1FOXA 1XMKA 4KN4X 2NVTJ 1QU3A 1BOAA 3X2QH 3RKWA 3OYCA 4UV9A 3JSOA 1LDJA 3TBIA 4U0WA 3HG9A 4UY8I 2VBZA 3ASNH 3ERMA 2FNAA 3H1CA 1RKTA 3BQZA 3GLLA 4B47A 2E2HJ 3CJTB 3ZOBA 1Q1HA 2XGXA 3DBRB 3RKQA 4M3DA 2NRAC 1KYWA 1OYYA 2ISYA 5J4VA 5E8GA 3EQLF 4RAGA 4HF2A 2R7DA 1W0TA 2LP0A 3RKYA 4EJWA 2MD0A 1FBSA 4XICA 1BA5A 3OL3A 4BDZA 1LFUP 3K70D 1MMNA 3QYEA 4X1EA 5JVGF 2DPDA 4BEHA 4CGZA 1IW7F 3BQYA 1HA8A 2STTA 2WV1A 1WJDA 4C2MJ 1J75A 3BJOA 5HDNA 1IXSB 3RIRA 5CVIA 5F64A 1YG2A 4KIGA 5KAIC 2HVRA 5ILSA 3ZQFA 2JZYA 2R3SA 4RBOA 4G6TB 2DA6A 1OFCX 3MQ0A 5A2QZ 2OU2A 5AIQA 4BXFA 1UMQA 3HSEA 2VT2A 1K7AA 1MNDA 3PFIA 3IH2A 3V8KA 5BQTA 1WJEA 1YIOA 2IRFG 1YS7A 1XMAA 2HGCA 1WJ5A 1BJZA 2A07F 3CLQA 2WAQN 3ZR8X 4HX8A 2NXNB 4OIQF 2JK3A 2XB5A 4PJNA 4F3QA 3GX4X 1FBQA 6PAXA 2PMUA 3K9TA 2H8WA 2GIZA 1MW7A 4RB2C 2YX4A 3SJMA 2QUFA 2OJED 3K4NA 1KYZA 4MEYF 1ZTRA 1T38A 1GT0C 2IP2A 2PG4A 1OCRH 3FXJA 5CJ9A 1L0OC 5JVTA 1POGA 2O9LA 1WJFA 4B48A 2Q1ZB 2VJ5A 4XLCA 3S8PA 3ZXSA 4ASNA 2PEXA 4Z6YA 2CV0A 3A01B 4R8HA 2P7VB 2W7NA 3G4SI 3DBHB 5DV5A 4Y15A 1HKQA 1ONVA 2LSOA 3HOUJ 2WBMA 2HQ5A 2COMA 3BOQA 3HSFA 2AQFA 3FIWA 3K4CA 1FMWA 1OCZH 2VT3A 1MD0A 3KE2A 3U21A 4B43A 3WU2C 4P96A 2QKMB 4EEFG 2BHZA 2XSJC 2KIUA 3KCCA 2GBYA 4RAYA 4BHCA 4CICA 2HOSA 3ZMVA 1BR1A 1JKQC 3FXUA 1GLNA 3DXJF 2FA5A 2X1CA 3C1DA 1TC3C 2IPQX 4PJMA 1XC5A 3OIQA 3HGGA 3FXLA 3KZIC 2GXBA 1VQ6I 3GTOJ 2P5LC 2LBFA 1UZCA 1P2FA 4LD5A 2ECBA 1STZA 4QPQA 2XIGA 4Q5SF 2Y9ZA 2MLGA 1GUUA 1R1VA 4RLQA 4A3CJ 3J7ZI 4CYCB 3H0GJ 3L2CA 1KQ8A 3S2DJ 4M6VA 3D0SA 2VXDA 3SDGA 1VQNI 2G7UA 1P7JA 1R5ID 2IGKA 2DTZA 1ZAOA 3RSNA 5D5UB 4BL0B 2HNHA 2QLZA 4XN3A 3KIOA 3E6BA 3L7WA 2W4SA 2O3FA 2P0WA 4L0ZB 3HOXJ 3AG1H 1K83J 5LHHA 3WG9A 4BBRJ 3K70C 1QBJA 2XSDC 3FXMA 4XKBA 3V8LA 1E3PA 2L02A 2MH9A 2XPVA 5ED4A 3A03A 4XLAA 2G9WA 2RN7A 3OSFA 3LQQA 2OF7A 1PUFA 4YFXF 3ASOH 2CW7A 2HYJA 2DXIA 2H94A 3QU3A 4DJAA 1R1UA 3GTGJ 2VODA 4JOMA 1JJ8C 2DFHA 4HG2A 2PMZN 5HOOA 1MBHA 4E7JA 3ZRGA 1XGMA 1WJBA 1SD5A 1WVRA 2ACJA 2F4OB 2R7ZJ 3IHUA 1O3TA 2NVUB 1H88C 2DDAA 4E7HA 2Z9OA 4BJ5C 1PP8F 3DEUA 1TLHB 2KJBA 3M1CA 2KP6A 5JHFA 5J47A 2CU7A 3PNTA 2F48A 1R4MB 2NVYJ 1MDMB 3E7LA 3RJPA 3V7CA 2GLOA 4IHXA 1UFMA 1VZ0A 3A1YA 4KT5C 5K5RA 4KNYA 2LREA 3MFKA 2XPUA 1P9QC 2JVHA 1WH7A 2JN6A 2MD5A 3JW4A 3OIOA 4RAZA 4XM3A 3IWFA 3U2RA 3PO2J 2EB7A 2LNBA 1G4DA 3TKYA 1YJNI 3VYRB 2V1XA 2IS2A 3A0BC 3OYJA 2I8DA 2VQHA 4XORA 4LLLA 5FGMA 2UXNA 1FIPA 3T8TA 5EEAA 3FX3A 2Y75A 2HTJA 4XONA 4RM2A 3BG3A 1V5FA 2DFIA 2IGMA 2E7XA 1PVEA 4GRIA 3EUHA 3DLAA 2W00A 5JLXA 2O6GE 1BIAA 1MGTA 2F4IA 4XRFA 4IHWA 4BU2A 2HI3A 3W2AA 4F93B 2DA5A 3LSJA 2ELKA 2HYGD 1SAXA 1VQ5I 5IPAA 3HL2A 3B6CA 4B09A 4DYQA 4G7OF 2KDZA 2M34A 1TWCJ 1ULYA 4HX7A 1XB4A 1TTYA 2V9KA 3V4GA 3CUQB 3BJ6A 2D2WA 3WU1B 4D7MA 3Q9SA 1VQLI 4DBRA 1T0FC 2QQ8A 1O7FA 2VJJA 3ABMH 2FQ3A 4L9VA 2LK2A 1YYVA 5M5WJ 3TGNA 4G94A 3RPQA 2JVGA 1N25A 2EZHA 2QWWA 1DUXC 3TP0A 1X58A 2ZSHB 2MSYA 1DPUA 2JT1A 2R4GA 1D1CA 3HHHA 2LFBA 5FB2A 1W7PA 2DMUA 2M0MA 2FUG2 4B3AA 2ZNYA 3FKJA 4ZZDA 1B8IA 2LG4A 3FISA 3JRAA 1CGPA 4EM1A 3W2WA 1LEBA 1ZN2A 2EIMH 1KU2A 4I98B 2ZO4A 1WH5A 3FHZA 2V7FA 2DOEA 1TNSA 2KFDA 2KJCA 4I0AA 3S93A 4X6AJ 4B8XA 3CJQB 4MGRA 4XKWA 3QPTA 2DMNA 2JUCA 1F4KA 2EPFA 5KCMA 1W4MA 2JUGA 2R7SA 1I1SA 2BOLA 3LSTA 3HPHA 4MEXF 1AA7A 2UXXA 3QWLA 4WWCA 2E35A 2X85A 3J80Z 1A35A 3C2BA 2M8EA 3DF8A 4RGSA 2BBYA 3WE3A 5EEGA 1GXPA 3E0JB 4NBQA 5E3NA 3OYGA 2K3FA 3C2HA 3TO9A 1ZGAA 3OYLA 4EQQA 1HBXG 4UVBA 4UXNA 4LIVA 5AIPA 1NH3A 2X51A 4XRSG 1FX7A 3Q0VA 4ESBA 1OISA 2BYVE 5HNHA 2KIQA 3E5UA 3BWGA 3L09A 4IL6C 1SFKA 2CQXA 2K9SA 1K6YA 4C3JJ 3E6CC 1OKRA 1PP7U 4NQWA 4Q48A 5DDGA 4J19A 4HF0A 4GO1A 3TOAA 1FOKA 3WHBA 3HOZJ 1QRYA 3S3OA 1FBUA 1FPQA 1XMXA 3OYMA 1LUJB 3ZQIA 1O3QA 1FC3A 1A31A 1J5YA 3W3CA 3KFWX 1S3JA 2UWMA 2W84A 4KISA 2DO7A 2DT6A 5JI6A 3IH4A 3K2AA 5LGTA 4BE2A 2E2JJ 9ANTA 1UELB 3MEXA 1CF7A 4IOAF 2VKDA 2YPRA 4IHSA 1T95A 4G9YA 3T1BA 1L3LA 3HOSA 1UHWA 3KETA 1ZG1A 1FOYA 1WRJA 4Y3OA 2DOAA 3CJRB 5K7FA 4U87A 2MGQA 3G2BA 2L0KA 3PNYA 4JQFA 3P9KA 4N9IA 4P1WA 4A3MJ 3VYTB 1XCBA 1X4OA 3PSFA 3RI4A 2NYXA 1IXCA 1XGSA 4OAYA 1HKTA 3WTTC 4F55A 2EQRA 5M5XJ 2WA0A 4BQNA 4OIRF 1LQ1A 1ACIA 4L18B 4M6YA 4ETSA 2V1UA 5KAFC 1D5VA 1G3YA 2AO9A 2VQLA 3GFLA 4NC6A 2Q2EB 4XBFA 1FSEA 2DLLA 1Z9CA 1ZYRF 2K27A 2KPMA 1T08B 2ZXHA 3GTPJ 1A5JA 4BACA 1JHHA 2Y0SA 4G8XA 3HKZN 1ZR2A 1F43A 2EA2A 1P92A 4E7SA 4F92B 2R7TA 5GP9A 3LFKA 1R36A 1MMSA 4HOBA 3LSHA 4I99C 4LIUA 1OCOH 1SFXA 1IGNA 2VC1A 4MIMA 5GTHC 3DWLE 3RKXA 3L2RA 2FSWA 2FX0A 4KMFA 1ON2A 2MA3A 3JSPA 3TW7A 2BW3A 2V6EA 3J7AO 1F5TA 3BDDA 4BQQA 2X4HA 1HW5A 4XLPF 1J2XA 2DJNA 4M3FA 2HQAA 1ZRCA 5TISC 2GQQA 2KQRA 3BZKA 3RZDJ 1SVOA 4PJJA 5B3SH 2DA2A 2ZNZA 4F52A 2G7HA 2VBYA 3BG6A 2QA4I 2IGOA 2CMPA 2MW8A 1JTYA 1P6RA 3CLOA 4V2GA 1YW8A 4U7BA 2XAHA 3CCLI 2CQQA 3R6SA 4AIDA 3T8RA 5IYCJ 5E1XA 5F1RA 1R7JA 1B1BA 4FTHA 4D9JA 5LBQA 2RNJA 1IN7A 1XN7A 1LEAA 2KISA 1UJ8A 5EEHA 4PJLA 3TL4X 3ZGKA 5GAEJ 4BEHB 5K5QA 3L1PA 1HSTA 2CUFA 2WC2A 4CH7A 3R61A 2LY2A 1Z6RA 2M8GX 2VB6A 2NNNA 2EH3A 1VQOI 3ULQB 2L7FP 3J7AY 4FX4A 1F9NA 3I5UA 4Y17A 2ZBKA 4AD9A 1FEXA 2ZJQF 1X19A 3D1NI 3CDIA 3CESA 4WXDA 4MTEA 1D1BA 4A69C 1T33A 1H9GA 2H1LA 5DM6F 2FQ4A 3EYIA 4E7LA 1QHGA 1Z0XA 3F21A 1BI0A 3G1LA 3ABLH 4PGHA 4E6KG 3Q9VA 2DQRA 4N4NB 3IP4B 3C7JA 2OA4A 2JA8J 4ZTJA 2G0EA 3V8JA 4U0YA 2AQEA 2BE5F 3RCOA 3DTIA 4C9YA 4S0HB 4CCOA 2CQNA 2CWEA 2DK8A 1XPXA 1K6OA 3LSRA 1G3SA 4XN0A 2DBBA 4M74A 4D1QA 2P5VA 3OR2C 3JRDA 4A3DJ 3DKXA 4EATA 1DDNA 1AWCA 2OZUA 3K69A 4BE0A 1TQIA 4UUTA 3F22A 2A6EF 1MIJA 1MH3A 2FBKA 1E0EA 2D1HA 3U1KA 1S72I 3GF2A 3KP2A 4G6DA 5M3FJ 2PJPA 4G7ZF 3K4KA 2IS4A 4L9JA 5IOZA 2ADUA 2K3PA 2Y2ZA 5HLHA 2ECCA 2O61A 1FZPB 3E6DA 4XLNF 4IJAA 1D0ZA 1X3ZB 4CZCA 3K4LA 4K2EA 2BVMA 5J1UA 2A5YB 2K4JA 2LF8A 3KYLA 1IXRC 4IRHA 2WTEA 4CZZA 5DS9A 3BG7A 3K4BA 3LL7A 3SFZA 2EFWA 3GVAA 4KJZA 2V9PA 1FYMA 2P4WA 4M3GA 4XOTA 5L3GA 2B0LA 2EFNA 5BNGA 3PSIA 4OIPF 1W7PD 1DGRM 4AVPA 4LMYA 4PGGA 2K85A 3K7AJ 4AYBA 5ILUA 1RPWA 3HZJA 4IX7A 3O2PE 2PBIA 4M3BA 2MABA 3SZPA 5M3MJ 1QPMA 3KEYA 3QYBA 3HHGA 2LBFB 3O3KA 3DPUA 2DPUA 4NC7A 3GW2A 4IRGA 4LB6B 1TQMA 1IDZA 1K61A 2K9MA 2WAFA 4TV7A 5EG0B 2LKSA 5DCFA 3GBGA 3K4MA 1ETXA 1VQ9I 3SXYA 2JJ7A 1OCCH 2DU9A 1JTXA 2YS9A 3ABKH 1WJCA 3S15J 1Z67A 1HF0A 3F6VA 1HDPA 1I27A 4XRMA 4ITVA 3G73A 3BLYA 1JJ6C 2HXIA 3KLOA 4G12A 4RS8A 2RNGA 1YS6A 3BY6A 1QZYA 3ZPLA 1IC8A 2JRMA 1LVAA 2FD5A 1KQ9A 1BJAA 1PUFB 2PLYA 3B02A 2DA4A 2V9VA 1YLFA 1SMTA 1X1BA 4RAFA 2JQ7A 1DQUA 1R5HA 3CCEI 5L3DA 3S17J 2HPMA 3K2ZA 4HDUA 3GZ5A 2AXLA 2LY1A 2HFHA 1Y1VJ 2DFEA 2P8TA 4ZZLA 3FMSA 4YG2F 1OCTC 4BXXJ 2MBFA 1R9TJ 2GWRA 2X6OA 3GMEA 3KYDB 3LSKA 4RLFA 1ZG5A 2EZLA 1JXSA 2K02A 4RDUA 3HSRA 3D5LA 1MBGA 4CCJA 4HDVA 1MSEC 1O3SA 4F7ZA 3EUHC 2MC3A 5E18F 2Y9YA 2HQRA 1ORKA 3JAMK 2ME0A 4XK4A 1IV8A 3OR1C 2ZXIA 1EF4A 4B1RA 3JRGA 3Q0UA 2E2IJ 4RMNA 3QRFF 2M7BA 4BS9A 2XAJA 5FKOA 1BL0A 1V5EA 5KVRA 3HRTA 2PN6A 2KRHA 4HLXA 1RC9A 3KYCB 1Z1DA 3HTUA 3BR6A 3CCVI 3R60A 3A0HC 1SFUA 1WZ2A 4YFNF 4L5EA 3OWTA 3S2HJ 3LWFA 4M9ZA 3GXOA 3HDDA 5F0HA 1C0WA 1WQ2A 2DOFA 2K4BA 2H8RA 2QBYA 1V4RA 4EGZA 3CDLA 4II2A 4CXFA 4I2OA 1MBJA 1ZGJA 4PFOA 2F4MB 1BIBA 5JLWA 4L9TA 1ERDA 4XSXF 2HVSA 1UCRA 4MLOA 2IBDA 2V26A 2UZKA 4M6XA 3VYSB 3BCBA 4BKXA 2Q0OA 4ENJA 3CF2A 4D5CA 4HYEA 4WCGA 4BY7J 5J40A 5GPCA 5M5YJ 5E3OA 3WTUC 4UVAA 3BPXA 1X1AA 3CMYA 3T0YA 4QTRA 4L9NA 3IAS2 1LFBA 2A5WA 2E1OA 4C2TA 1BR4A 3ROUA 1YO5C 1QGPA 3Q0WA 1FNNA 4HF1A 3QPSA 1ETKA 3AG3H 1YX5A 2F6CA 1LE8A 3LA2A 3MZYA 5JHUA 4HNUA 5HLGA 3ZQHA 4IQJA 3KPHA 2V6CA 1R4NB 4JX5A 4BXUA 4XMYA 3OYEA 1RUOA 5FFXA 5LHIA 1H8AC 3EYYA 4BJTA 2EV6A 1MJAA 4PK4A 2DI3A 2JMWA 1B8IB 1K79A 4U7DA 1N77A 1QVTA 4WXCA 4QPOA 2GAUA 3HOWJ 3ABTA 2HR3A 2E5ZA 1XDSA 5LD2C 3C3WA 5EZHA 4H0EA 1W5CC 2CW8A 4M71A 1NG7A 4UUVA 2FE3A 3DU5A 4HBLA 4WK8F 1S9HA 4M3EA 1R6RA 4XSZF 5F08A 5GTIC 1Z6TA 2XF7A 2QYOA 2YU3A 3CZ6A 4KFCA 2DJIA 2BY0A 2CFOA 2H27A 2FRHA 3EDPA 3JRCA 3GFIA 3BR5A 5C44J 2CJJA 3RPUA 2H6BA 3FBNB 1O3RA 3NARA 3VYUB 2W25A 2IEKA 3HPGA 2XROA 1TBXA 1UHMA 5CQGA 3OOUA 1QA6A 2BEOA 4JX4A 3I54A 5ICCA 1HQCA 1SAUA 1O4XA
chains in the Genus database with same CATH topology
2A3SA 2FBHA 5L3BA 5JFRA 2H6CA 4I0BA 2DK5A 2MH2A 3F23A 3ML6A 5D5VB 4KUMA 2GA2A 2VOPA 1BI1A 4ZYDA 3CO7C 4JBAA 3TQNA 3CJNA 5ILVA 1CF7B 2M1BA 1IN8A 2EFPA 3V7RA 1RI7A 5D4SA 3WGIA 3FWEA 3KZYA 2VONA 3FM3A 3CTAA 2KIFA 5E20A 2F5FA 1H0MA 1BC7C 1I6XA 1LDDA 2RQPA 1FSHA 3P7NA 3U1DA 2HDCA 2L4AA 4WF2A 1XCVA 4EV0A 1FP1D 1FP2A 5BOXA 1EV7A 1LDKB 1WI9A 4A6EA 4MQ9F 4BHPA 2VBWA 1B9MA 1LNWA 4HAMA 3FXRA 4KIBA 4GYIA 4IPAA 2F5DA 4P55A 3F3XA 1TW2A 5H20A 4MTDA 5D5WB 1R00A 3GZ6A 3F72A 3ZP5A 1IN5A 1YFHA 5BPIA 3L00A 3TDZC 3ZQ7A 3S2WA 1WWXA 1D3YA 4I01A 3IKVA 5IT9K 4IF4A 2VC0A 5HS8A 2E1CA 1FT9A 3E6MA 1MZBA 2PMHA 2Q8KA 2OZ6A 2M5WA 3ZN1A 5J6XA 3K1PA 2QZ8A 1IUYA 3KP7A 3HRSA 1OYIA 4ESJA 2KRFA 5LRSA 2FMYA 2F2EA 5K1YA 3DPTA 1ODDA 1HKSA 2QQBA 3GFMA 4KICA 3LAJA 1X3UA 1AOYA 2L4MA 2ZJ2A 5JR3A 1YTYA 1T98A 3JAMZ 5DEQA 4EVIA 4YFKF 1S29A 1PUEE 3ECHA 3GEZA 2E7WA 3IRRA 2VE8A 4G7HF 1WSUA 4LB5A 3CUOA 2WWYA 3KP6A 4RGUA 5LEJA 4A0XA 5D6FA 2J5OA 4M9XA 4LK0F 2C6YA 1MKMA 3DV8A 4P9FA 3KEOA 1V3FA 2ZXJA 2HQNA 1U5TC 2E1NA 3F8FA 1EH6A 4U88A 1XSXA 1K78A 1BM9A 3MCZA 4GYGA 3FXQA 3L9FA 3ZMDA 2RDPA 3SQNA 4YIIA 1REPC 2IA0A 1ZLJA 2FU4A 3BZ6A 3KP4A 3R0JA 2W85A 3WU0A 2D45A 4FX0A 4D0PA 1R1TA 3LQRA 3H92A 1O7LA 3HRUA 1S7AA 3ELKA 5L3EA 3JTHA 4A5MA 2L01A 1KGSA 1RNLA 3FM5A 2PFBA 2GXGA 2JPCA 4ZH4F 2IW5A 5LEKA 2HKXA 3T5XA 1TNTA 3BP8A 2FOKA 2ZKZA 2LKPA 3GO5A 2HTSA 2RVCA 2GIVA 2CSOA 4UNOA 3AAFA 2QBYB 4R1HA 4HV5A 5LGNA 2FXAA 1GHCA 4HZFA 4LGWA 3I59A 3IC7A 4LG0A 3LAPA 1KU9A 1U2WA 3F8BA 3PQJA 3P9CA 4L5IA 4N0BA 5J8FA 3I4PA 2STWA 1IZ1A 3NQOA 1QNTA 1I5ZA 4KDPA 5DD4A 4OIOF 3C18A 5FD6A 3TOBA 3WTVC 2NAZA 1IRGA 2IVMA 1JE8A 4PCQA 1IF1A 1B9NA 5BS6A 2DW4A 1Z05A 3VFZA 5TRDA 4DQ2A 5E8IA 3FMRA 4OOIA 5K5OA 4BNCA 1H9TA 5FO5A 1ZH5A 1YW9A 5HDGA 1OYWA 1T6SA 3V7SA 4LLGF 1TQPA 2OQRA 5CVJA 5LGUA 1JGSA 3CDHA 4G6QA 1T2KA 2FMLA 5E1ZB 2X0LA 2HKOA 3RDIA 3ZMUA 2F5CA 3BROA 2GA1A 2XKOA 2Q2EA 2XV4S 4AIKA 4EMSA 2QQAA 2P7CB 1HXDA 3M8EA 5D8LB 2EK5A 1J0RA 3KZZA 1HSJA 4IHTA 3E97A 3TDUC 1G6NA 2EWNA 5H6QA 1DP7P 3WODF 3WGHA 2M30A 4HX4A 1U5TA 4KMUX 1JHFA 4CHUA 1UB9A 4GCVA 2ZCWA 4CYDA 4HA8A 2TDXA 4BQAA 3LA7A 4NB5A 3KLNA 1ZRDA 1T39A 3IWZA 3DPLC 1BBYA 2XRNA 4P5OA 5D8KB 1GVJA 2EV5A 4A2UA 3ISPA 4QLCU 4OINF 2QM3A 3BJAA 1NHAA 4L5JA 3OOPA 4EJVA 1KQ0A 3DKWA 2HEOA 5HS7A 1S6LA 5IT9Z 1BI2A 3WTYC 2VE9A 5BPDA 2LF7A 3WTZA 2VN2A 5CVVA 3H3UA 5DUIA 5DCMA 2XAQA 3KP3A 1OR7A 4Q47A 4EJOA 5IT3A 1W5TA 2EFOA 3G3ZA 4NHJA 1USTA 3W6JB 2ZMEA 4RGXA 4OU0A 3J81K 2EJRA 5CVUA 5FD5A 2P5KA 4UVCA 1ON1A 1B6AA 4LFUA 4ON0A 1B4AA 3ZMZA 1SD7A 4A0ZA 4AIHA 3M9AA 3RYPA 2D1VA 3H3ZA 1ZLKA 3GFJA 4HQMA 3R4KA 1USSA 2W24A 1MJBA 1R22A 3ABUA 1W7PB 5LRRA 1FYKA 3E3VA 4A12A 1SD4A 3F8NA 3ZMSA 1FLIA 3QOPA 4M72A 2CFXA 1LB2A 3NEUA 2L3DA 1R58A 1U3EM 1PDNC 3N4MA 2VXZA 5L3FA 3SHFA 3B73A 1XSDA 2K86A 5KK1A 3DQVC 2JPBA 4YIFA 5HDKA 2LDUA 2AS5F 3DP7A 2QENA 1XGOA 4OMZA 3U9GA 3R0AA 4S05A 5D4RA 2Z5UA 4ZYEA 5DUKA 2V1DA 3W6KB 4R79A 3RYRA 4GGGA 2GZWA 1EH7A 1J9IA 2YX7A 4LJZF 3HOTA 2H09A 2Z33A 4EJUA 2ETHA 3VOEA 2J5PA 4ENKA 3MAJA 2RKHA 1YW7A 2ISZA 5E17F 2PQ8A 3WTSC 5ICEA 1B59A 1WKMA 2RC4A 1FWZA 2P6TA 1S8NA 1RUNA 3OV8A 1Z91A 2HYFA 1W5SA 1FYLA 4LK1F 4AIJA 1G3TA 1U6GA 4AWXB 4Z2YA 1ZG3A 1IRFA 1KA8A 1QZZA 4KN7X 3BPVA 4GXOA 5FLXK 2IA2A 2K7LA 4UHTA 4EJTA 4LLNA 2BGCA 4RB0A 2JSCA 2L54A 1D8JA 1IN6A 5J8CA 2A6HF 2O0YA 4UV8A 3HTSB 1P4AA 3GLXA 1QO0D 1BN5A 3CUQC 1U78A 3FF5A 3I53A 3QAHA 3I0TA 1D8KA 1E2XA 4PDKA 4DNCA 3E5QA 3QP5A 2Z99A 1K78B 2HOEA 1HW2A 2Z3YA 2JTVA 2RGVA 2O03A 1KU7A 2IA1A 2ESNA 4EM0B 3COAC 2WV0A 2RV8A 4BYYA 3FZVA 2XVCA 4KYWA 2FF4A 3IL2A 5D5XB 2Y48A 1SFEA 3K1MA 3MWMA 3ECOA 5E1WA 3KP5A 2ESHA 1J59A 3WTWC 4BH9A 4HLYA 2XHKA 3GWZA 4KIFA 5HS9A 3VODA 5F6FA 3HRMA 2VOOA 1RZ4A 5DYMA 2FNPA 4MNUA 2OD5A 4HQEA 1OMIA 3F8CA 2PI0A 3HYIA 2KIMA 1XDUA 2V79A 3VEPA 3Q5FA 3KEQA 3O6BB 4IVNA 1RIOH 3F6OA 5A2QK 3I58A 3I59B 4QWQA 4LG0B 2EA4A 4U0VA 4A6DA 5ERIA 4WXHA 2KKOA 1EH8A 2A69F 2CQKA 4A0YA 4JK1X 3ZMTA 2ELHA 2P6SA 2DAOA 4ENNA 1SD6A 3N97A 4HW0A 4I7HA 1O57A 2HZTA 5LLQA 4Y13A 2ZFWA 5DD8A 1BC8C 2YR2A 1ZHFA 5HVQC 1XGNA 4RB1A 2QVOA 1MDMA 3SZTA 2QQ9A 4E70A 3QPHA 1IN4A 4EM2A 5LHGA 2F5EA 1KU3A 4M73A 4CDGA 3DFGA 4A5NA 4ZYGA 1XD7A 1XSVA 3TO7A 3IKTA 4N9HA 3J81Z 3E5XA 4IRIA 5ICFA 5H6RA 1ZRFA 4ENMA 3M1EA 5AONA 4Q4ZF 2HWVA 4FT8A 3IRQA 4BAYA 2XAFA 3CUQA 4RB3C 3NRVA 1U5TB 1MJ9A 3GUDA 1VTNC 2CO5A 3WTXC 3M7GA 3PQKA 1I1GA 5CVRA 2XUBA 4O5VA 2CYYA 5HLIA 4EGYA 4PZJA 2FBIA 1S7OA 2EV0A 1SMYF 1T0FA 2DT5A 1TW3A 3QU6A 4I09A 4O6JA 1FY7A 3QP6A 5D6EA 1ZREA 1U8RA 1ZARA 5ICGA 2W57A 5DCMB 2BV6A 1J7KA 2YSRA 3HUGA 2XASA 2M45A 1BI3A 5CLSA 3WE2A 2HS5A 4ESFA 3JTGA 3I64A 2ZMEB 3CO6C 1P4WA 1Y0UA 3MZHA 3K1NA 3P9IA 1DPRA 1GXQA 1HW1A 3HIFA 4KA4A 2OAZA 2VBXA 4L0YB 2NS0A 5CYVA 4MHGA 2A61A 1A04A 2M87A 3WGGA 3ZN0A 4RGRA 3ERED 2DTRA 4ZYHA 2EFQA 4I02A 2NNYA 2Y0MA 4WX9A 2DQLA 5FFZA 5FLXZ 2R7FA 3I71A 2CW0F 2OQGA 2CGPA 1R23A 2IT0A 2OBPA 3F8MA 1E17A 2O8XA 4OMYA 1OPCA 5L3CA 2XKPA 2MLKA 1Z7UA 2FEZA 4HV6A 3RTRA 3REOA 1P4XA 3K0LA 2IJLA 4O3MA 1R5GA 3VB2A 3M8FA 1YQAA 4CO8A 1F1ZA 2CG4A 1LJ9A 5BMZA 3J80K 3FMQA 5TJJA 4BHBA 3GYHX 2XAGA 3EETA 2JRTA 1QQIA 4P9UA 4S04A 2A68F 4FHTA 1IAWA 4IXAA 1G3WA 3TO6A 4MQVA 4M9SA 3LA3A 1XMKA 4KN4X 1BOAA 3RKWA 4UV9A 3JSOA 1LDJA 4U0WA 2VBZA 2FNAA 1Q1HA 2XGXA 2NRAC 1KYWA 1OYYA 2ISYA 5E8GA 3EQLF 4HF2A 2R7DA 3RKYA 4EJWA 1FBSA 2DPDA 4CGZA 1IW7F 2STTA 1J75A 3BJOA 5HDNA 1IXSB 3RIRA 5CVIA 5F64A 1YG2A 4KIGA 5ILSA 2JZYA 2R3SA 3MQ0A 5A2QZ 2OU2A 5AIQA 3HSEA 2VT2A 1K7AA 3PFIA 3V8KA 5BQTA 1YIOA 2IRFG 1YS7A 1XMAA 2HGCA 2A07F 4HX8A 4OIQF 3GX4X 1FBQA 6PAXA 2PMUA 3K9TA 4RB2C 2YX4A 2QUFA 1KYZA 4MEYF 1T38A 2IP2A 2PG4A 5CJ9A 1L0OC 5JVTA 4ASNA 2PEXA 4R8HA 2P7VB 5DV5A 4Y15A 1HKQA 1ONVA 2LSOA 3HSFA 2COMA 3BOQA 2VT3A 1MD0A 3KE2A 4P96A 4BHCA 3KCCA 2KIUA 4RAYA 4CICA 3ZMVA 3FXUA 3DXJF 2FA5A 3C1DA 2IPQX 2GXBA 2P5LC 1P2FA 4LD5A 1STZA 2XIGA 4Q5SF 2MLGA 1R1VA 3L2CA 1KQ8A 3D0SA 2G7UA 1ZAOA 5D5UB 2QLZA 3E6BA 3L7WA 2O3FA 4L0ZB 5LHHA 3WG9A 1QBJA 3V8LA 2L02A 2MH9A 5ED4A 2G9WA 2RN7A 3LQQA 4YFXF 2H94A 3QU3A 1R1UA 2VODA 5HOOA 1XGMA 1SD5A 2ACJA 3IHUA 1O3TA 2Z9OA 1PP8F 1TLHB 2KJBA 3DEUA 1MDMB 3V7CA 3RJPA 1UFMA 4KT5C 5K5RA 4KNYA 3MFKA 2MD5A 3JW4A 4RAZA 3U2RA 3IWFA 2EB7A 2LNBA 1G4DA 3TKYA 2V1XA 4LLLA 5FGMA 2UXNA 3T8TA 3FX3A 2Y75A 2HTJA 2DFIA 2E7XA 3EUHA 2O6GE 1BIAA 1MGTA 4XRFA 2HYGD 1SAXA 4B09A 4G7OF 1ULYA 4HX7A 1XB4A 1TTYA 3V4GA 3CUQB 3BJ6A 2D2WA 3WU1B 3Q9SA 1O7FA 2FQ3A 4L9VA 1YYVA 3TGNA 4G94A 3RPQA 2QWWA 1DUXC 1DPUA 2JT1A 3HHHA 5FB2A 1W7PA 2ZNYA 4ZZDA 1CGPA 4EM1A 1LEBA 1ZN2A 1KU2A 4I98B 2ZO4A 3FHZA 1TNSA 2KJCA 4I0AA 4B8XA 4MGRA 3QPTA 1F4KA 1W4MA 1I1SA 3LSTA 4MEXF 2UXXA 4WWCA 3J80Z 3DF8A 2M8EA 4RGSA 2BBYA 3WE3A 5EEGA 1GXPA 3TO9A 1ZGAA 4EQQA 1HBXG 4UVBA 4UXNA 5AIPA 1FX7A 4ESBA 2BYVE 3E5UA 3BWGA 3L09A 3E6CC 1OKRA 1PP7U 4NQWA 4Q48A 5DDGA 4HF0A 4GO1A 3TOAA 1FOKA 1FBUA 1FPQA 1O3QA 1FC3A 1J5YA 3KFWX 1S3JA 2UWMA 2W84A 2DO7A 5JI6A 5LGTA 1CF7A 3MEXA 2YPRA 4IHSA 4G9YA 3T1BA 1L3LA 3HOSA 1UHWA 3KETA 1ZG1A 1WRJA 4JQFA 3P9KA 4N9IA 1XCBA 3RI4A 2NYXA 1IXCA 1XGSA 1HKTA 3WTTC 4OIRF 1LQ1A 4L18B 4M6YA 4ETSA 2V1UA 1D5VA 1G3YA 3GFLA 1Z9CA 4XBFA 1FSEA 2DLLA 1ZYRF 2K27A 1JHHA 4G8XA 2EA2A 1P92A 3LFKA 1R36A 4HOBA 1SFXA 2VC1A 3RKXA 2FSWA 4KMFA 1ON2A 2MA3A 3JSPA 3J7AO 1F5TA 3BDDA 2X4HA 1HW5A 4XLPF 1J2XA 1ZRCA 2GQQA 2ZNZA 2G7HA 2VBYA 3CLOA 1P6RA 1YW8A 4U7BA 2XAHA 3R6SA 3T8RA 5E1XA 5F1RA 1R7JA 1B1BA 5LBQA 2RNJA 1IN7A 1XN7A 1LEAA 5EEHA 5K5QA 1HSTA 2WC2A 3R61A 1Z6RA 2NNNA 3ULQB 4FX4A 1F9NA 3I5UA 4Y17A 2ZBKA 4AD9A 4WXDA 4MTEA 1H9GA 3EYIA 3F21A 1BI0A 4PGHA 3Q9VA 2DQRA 3C7JA 2OA4A 3V8JA 4U0YA 2BE5F 2CWEA 2DK8A 1K6OA 1G3SA 2DBBA 4M74A 2P5VA 1DDNA 1AWCA 2OZUA 3K69A 1TQIA 3F22A 2A6EF 2FBKA 2D1HA 3GF2A 3KP2A 4G6DA 2PJPA 4G7ZF 4L9JA 2ADUA 5HLHA 2O61A 1FZPB 3E6DA 4XLNF 4IJAA 4K2EA 2A5YB 2K4JA 2LF8A 1IXRC 4IRHA 2WTEA 4CZZA 2EFWA 3SFZA 3GVAA 1FYMA 2P4WA 5L3GA 2B0LA 2EFNA 4OIPF 1W7PD 4AVPA 4LMYA 4PGGA 5ILUA 3O2PE 2PBIA 3SZPA 1QPMA 3HHGA 3O3KA 2DPUA 3GW2A 4IRGA 4LB6B 1TQMA 4TV7A 5DCFA 3SXYA 2DU9A 3F6VA 1I27A 3G73A 3KLOA 4RS8A 1YS6A 3BY6A 1QZYA 3ZPLA 1LVAA 1KQ9A 1BJAA 2PLYA 3B02A 2V9VA 1YLFA 1SMTA 1R5HA 5L3DA 3K2ZA 4HDUA 3GZ5A 2AXLA 2HFHA 2P8TA 4ZZLA 3FMSA 4YG2F 2MBFA 2GWRA 1ZG5A 1JXSA 2K02A 3HSRA 3D5LA 4HDVA 1O3SA 4F7ZA 5E18F 2MC3A 2HQRA 3JAMK 3QRFF 2XAJA 5KVRA 3HRTA 2PN6A 4HLXA 1Z1DA 3HTUA 3R60A 1SFUA 4YFNF 3LWFA 4M9ZA 3GXOA 1C0WA 1WQ2A 2K4BA 2QBYA 1V4RA 4EGZA 4CXFA 4I2OA 1ZGJA 1BIBA 4L9TA 4XSXF 1UCRA 2UZKA 4M6XA 4ENJA 2Q0OA 4HYEA 4WCGA 3WTUC 4UVAA 3BPXA 3T0YA 4L9NA 3ROUA 1YO5C 1QGPA 4HF1A 1FNNA 3LA2A 3MZYA 5JHUA 5HLGA 2V6CA 4BXUA 1RUOA 5FFXA 5LHIA 3EYYA 2EV6A 1MJAA 2DI3A 1K79A 4U7DA 4WXCA 2GAUA 3ABTA 2HR3A 1XDSA 3C3WA 4H0EA 4M71A 4UUVA 2FE3A 4HBLA 4WK8F 4XSZF 1Z6TA 2QYOA 2YU3A 4KFCA 2H27A 2FRHA 3EDPA 3GFIA 3RPUA 2H6BA 1O3RA 2W25A 2XROA 1TBXA 1UHMA 2BEOA 3I54A 5ICCA 1HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3S A;  2FBH A;  5L3B A;  5JFR A;  2H6C A;  4I0B A;  2DK5 A;  2MH2 A;  3F23 A;  3ML6 A;  5D5V B;  4KUM A;  2GA2 A;  2VOP A;  1BI1 A;  4ZYD A;  3CO7 C;  4JBA A;  3TQN A;  3CJN A;  5ILV A;  1CF7 B;  2M1B A;  1IN8 A;  2EFP A;  3V7R A;  1RI7 A;  5D4S A;  3WGI A;  3FWE A;  3KZY A;  2VON A;  3FM3 A;  3CTA A;  2KIF A;  5E20 A;  2F5F A;  1H0M A;  1BC7 C;  1I6X A;  1LDD A;  2RQP A;  1FSH A;  3P7N A;  3U1D A;  2HDC A;  2L4A A;  4WF2 A;  1XCV A;  4EV0 A;  1FP1 D;  1FP2 A;  5BOX A;  1EV7 A;  1LDK B;  1WI9 A;  4A6E A;  4MQ9 F;  4BHP A;  2VBW A;  1B9M A;  1LNW A;  4HAM A;  3FXR A;  4KIB A;  4GYI A;  4IPA A;  2F5D A;  4P55 A;  3F3X A;  1TW2 A;  5H20 A;  4MTD A;  5D5W B;  1R00 A;  3GZ6 A;  3F72 A;  3ZP5 A;  1IN5 A;  1YFH A;  5BPI A;  3L00 A;  3TDZ C;  3ZQ7 A;  3S2W A;  1WWX A;  1D3Y A;  4I01 A;  3IKV A;  5IT9 K;  4IF4 A;  2VC0 A;  5HS8 A;  2E1C A;  1FT9 A;  3E6M A;  1MZB A;  2PMH A;  2Q8K A;  2OZ6 A;  2M5W A;  3ZN1 A;  5J6X A;  3K1P A;  2QZ8 A;  1IUY A;  3KP7 A;  3HRS A;  1OYI A;  4ESJ A;  2KRF A;  5LRS A;  2FMY A;  2F2E A;  5K1Y A;  3DPT A;  1ODD A;  1HKS A;  2QQB A;  3GFM A;  4KIC A;  3LAJ A;  1X3U A;  1AOY A;  2L4M A;  2ZJ2 A;  5JR3 A;  1YTY A;  1T98 A;  3JAM Z;  5DEQ A;  4EVI A;  4YFK F;  1S29 A;  1PUE E;  3ECH A;  3GEZ A;  2E7W A;  3IRR A;  2VE8 A;  4G7H F;  1WSU A;  4LB5 A;  3CUO A;  2WWY A;  3KP6 A;  4RGU A;  5LEJ A;  4A0X A;  5D6F A;  2J5O A;  4M9X A;  4LK0 F;  2C6Y A;  1MKM A;  3DV8 A;  4P9F A;  3KEO A;  1V3F A;  2ZXJ A;  2HQN A;  1U5T C;  2E1N A;  3F8F A;  1EH6 A;  4U88 A;  1XSX A;  1K78 A;  1BM9 A;  3MCZ A;  4GYG A;  3FXQ A;  3L9F A;  3ZMD A;  2RDP A;  3SQN A;  4YII A;  1REP C;  2IA0 A;  1ZLJ A;  2FU4 A;  3BZ6 A;  3KP4 A;  3R0J A;  2W85 A;  3WU0 A;  2D45 A;  4FX0 A;  4D0P A;  1R1T A;  3LQR A;  3H92 A;  1O7L A;  3HRU A;  1S7A A;  3ELK A;  5L3E A;  3JTH A;  4A5M A;  2L01 A;  1KGS A;  1RNL A;  3FM5 A;  2PFB A;  2GXG A;  2JPC A;  4ZH4 F;  2IW5 A;  5LEK A;  2HKX A;  3T5X A;  1TNT A;  3BP8 A;  2FOK A;  2ZKZ A;  2LKP A;  3GO5 A;  2HTS A;  2RVC A;  2GIV A;  2CSO A;  4UNO A;  3AAF A;  2QBY B;  4R1H A;  4HV5 A;  5LGN A;  2FXA A;  1GHC A;  4HZF A;  4LGW A;  3I59 A;  3IC7 A;  4LG0 A;  3LAP A;  1KU9 A;  1U2W A;  3F8B A;  3PQJ A;  3P9C A;  4L5I A;  4N0B A;  5J8F A;  3I4P A;  2STW A;  1IZ1 A;  3NQO A;  1QNT A;  1I5Z A;  4KDP A;  5DD4 A;  4OIO F;  3C18 A;  5FD6 A;  3TOB A;  3WTV C;  2NAZ A;  1IRG A;  2IVM A;  1JE8 A;  4PCQ A;  1IF1 A;  1B9N A;  5BS6 A;  2DW4 A;  1Z05 A;  3VFZ A;  5TRD A;  4DQ2 A;  5E8I A;  3FMR A;  4OOI A;  5K5O A;  4BNC A;  1H9T A;  5FO5 A;  1ZH5 A;  1YW9 A;  5HDG A;  1OYW A;  1T6S A;  3V7S A;  4LLG F;  1TQP A;  2OQR A;  5CVJ A;  5LGU A;  1JGS A;  3CDH A;  4G6Q A;  1T2K A;  2FML A;  5E1Z B;  2X0L A;  2HKO A;  3RDI A;  3ZMU A;  2F5C A;  3BRO A;  2GA1 A;  2XKO A;  2Q2E A;  2XV4 S;  4AIK A;  4EMS A;  2QQA A;  2P7C B;  1HXD A;  3M8E A;  5D8L B;  2EK5 A;  1J0R A;  3KZZ A;  1HSJ A;  4IHT A;  3E97 A;  3TDU C;  1G6N A;  2EWN A;  5H6Q A;  1DP7 P;  3WOD F;  3WGH A;  2M30 A;  4HX4 A;  1U5T A;  4KMU X;  1JHF A;  4CHU A;  1UB9 A;  4GCV A;  2ZCW A;  4CYD A;  4HA8 A;  2TDX A;  4BQA A;  3LA7 A;  4NB5 A;  3KLN A;  1ZRD A;  1T39 A;  3IWZ A;  3DPL C;  1BBY A;  2XRN A;  4P5O A;  5D8K B;  1GVJ A;  2EV5 A;  4A2U A;  3ISP A;  4QLC U;  4OIN F;  2QM3 A;  3BJA A;  1NHA A;  4L5J A;  3OOP A;  4EJV A;  1KQ0 A;  3DKW A;  2HEO A;  5HS7 A;  1S6L A;  5IT9 Z;  1BI2 A;  3WTY C;  2VE9 A;  5BPD A;  2LF7 A;  3WTZ A;  2VN2 A;  5CVV A;  3H3U A;  5DUI A;  5DCM A;  2XAQ A;  3KP3 A;  1OR7 A;  4Q47 A;  4EJO A;  5IT3 A;  1W5T A;  2EFO A;  3G3Z A;  4NHJ A;  1UST A;  3W6J B;  2ZME A;  4RGX A;  4OU0 A;  3J81 K;  2EJR A;  5CVU A;  5FD5 A;  2P5K A;  4UVC A;  1ON1 A;  1B6A A;  4LFU A;  4ON0 A;  1B4A A;  3ZMZ A;  1SD7 A;  4A0Z A;  4AIH A;  3M9A A;  3RYP A;  2D1V A;  3H3Z A;  1ZLK A;  3GFJ A;  4HQM A;  3R4K A;  1USS A;  2W24 A;  1MJB A;  1R22 A;  3ABU A;  1W7P B;  5LRR A;  1FYK A;  3E3V A;  4A12 A;  1SD4 A;  3F8N A;  3ZMS A;  1FLI A;  3QOP A;  4M72 A;  2CFX A;  1LB2 A;  3NEU A;  2L3D A;  1R58 A;  1U3E M;  1PDN C;  3N4M A;  2VXZ A;  5L3F A;  3SHF A;  3B73 A;  1XSD A;  2K86 A;  5KK1 A;  3DQV C;  2JPB A;  4YIF A;  5HDK A;  2LDU A;  2AS5 F;  3DP7 A;  2QEN A;  1XGO A;  4OMZ A;  3U9G A;  3R0A A;  4S05 A;  5D4R A;  2Z5U A;  4ZYE A;  5DUK A;  2V1D A;  3W6K B;  4R79 A;  3RYR A;  4GGG A;  2GZW A;  1EH7 A;  1J9I A;  2YX7 A;  4LJZ F;  3HOT A;  2H09 A;  2Z33 A;  4EJU A;  2ETH A;  3VOE A;  2J5P A;  4ENK A;  3MAJ A;  2RKH A;  1YW7 A;  2ISZ A;  5E17 F;  2PQ8 A;  3WTS C;  5ICE A;  1B59 A;  1WKM A;  2RC4 A;  1FWZ A;  2P6T A;  1S8N A;  1RUN A;  3OV8 A;  1Z91 A;  2HYF A;  1W5S A;  1FYL A;  4LK1 F;  4AIJ A;  1G3T A;  1U6G A;  4AWX B;  4Z2Y A;  1ZG3 A;  1IRF A;  1KA8 A;  1QZZ A;  4KN7 X;  3BPV A;  4GXO A;  5FLX K;  2IA2 A;  2K7L A;  4UHT A;  4EJT A;  4LLN A;  2BGC A;  4RB0 A;  2JSC A;  2L54 A;  1D8J A;  1IN6 A;  5J8C A;  2A6H F;  2O0Y A;  4UV8 A;  3HTS B;  1P4A A;  3GLX A;  1QO0 D;  1BN5 A;  3CUQ C;  1U78 A;  3FF5 A;  3I53 A;  3QAH A;  3I0T A;  1D8K A;  1E2X A;  4PDK A;  4DNC A;  3E5Q A;  3QP5 A;  2Z99 A;  1K78 B;  2HOE A;  1HW2 A;  2Z3Y A;  2JTV A;  2RGV A;  2O03 A;  1KU7 A;  2IA1 A;  2ESN A;  4EM0 B;  3COA C;  2WV0 A;  2RV8 A;  4BYY A;  3FZV A;  2XVC A;  4KYW A;  2FF4 A;  3IL2 A;  5D5X B;  2Y48 A;  1SFE A;  3K1M A;  3MWM A;  3ECO A;  5E1W A;  3KP5 A;  2ESH A;  1J59 A;  3WTW C;  4BH9 A;  4HLY A;  2XHK A;  3GWZ A;  4KIF A;  5HS9 A;  3VOD A;  5F6F A;  3HRM A;  2VOO A;  1RZ4 A;  5DYM A;  2FNP A;  4MNU A;  2OD5 A;  4HQE A;  1OMI A;  3F8C A;  2PI0 A;  3HYI A;  2KIM A;  1XDU A;  2V79 A;  3VEP A;  3Q5F A;  3KEQ A;  3O6B B;  4IVN A;  1RIO H;  3F6O A;  5A2Q K;  3I58 A;  3I59 B;  4QWQ A;  4LG0 B;  2EA4 A;  4U0V A;  4A6D A;  5ERI A;  4WXH A;  2KKO A;  1EH8 A;  2A69 F;  2CQK A;  4A0Y A;  4JK1 X;  3ZMT A;  2ELH A;  2P6S A;  2DAO A;  4ENN A;  1SD6 A;  3N97 A;  4HW0 A;  4I7H A;  1O57 A;  2HZT A;  5LLQ A;  4Y13 A;  2ZFW A;  5DD8 A;  1BC8 C;  2YR2 A;  1ZHF A;  5HVQ C;  1XGN A;  4RB1 A;  2QVO A;  1MDM A;  3SZT A;  2QQ9 A;  4E70 A;  3QPH A;  1IN4 A;  4EM2 A;  5LHG A;  2F5E A;  1KU3 A;  4M73 A;  4CDG A;  3DFG A;  4A5N A;  4ZYG A;  1XD7 A;  1XSV A;  3TO7 A;  3IKT A;  4N9H A;  3J81 Z;  3E5X A;  4IRI A;  5ICF A;  5H6R A;  1ZRF A;  4ENM A;  3M1E A;  5AON A;  4Q4Z F;  2HWV A;  4FT8 A;  3IRQ A;  4BAY A;  2XAF A;  3CUQ A;  4RB3 C;  3NRV A;  1U5T B;  1MJ9 A;  3GUD A;  1VTN C;  2CO5 A;  3WTX C;  3M7G A;  3PQK A;  1I1G A;  5CVR A;  2XUB A;  4O5V A;  2CYY A;  5HLI A;  4EGY A;  4PZJ A;  2FBI A;  1S7O A;  2EV0 A;  1SMY F;  1T0F A;  2DT5 A;  1TW3 A;  3QU6 A;  4I09 A;  4O6J A;  1FY7 A;  3QP6 A;  5D6E A;  1ZRE A;  1U8R A;  1ZAR A;  5ICG A;  2W57 A;  5DCM B;  2BV6 A;  1J7K A;  2YSR A;  3HUG A;  2XAS A;  2M45 A;  1BI3 A;  5CLS A;  3WE2 A;  2HS5 A;  4ESF A;  3JTG A;  3I64 A;  2ZME B;  3CO6 C;  1P4W A;  1Y0U A;  3MZH A;  3K1N A;  3P9I A;  1DPR A;  1GXQ A;  1HW1 A;  3HIF A;  4KA4 A;  2OAZ A;  2VBX A;  4L0Y B;  2NS0 A;  5CYV A;  4MHG A;  2A61 A;  1A04 A;  2M87 A;  3WGG A;  3ZN0 A;  4RGR A;  3ERE D;  2DTR A;  4ZYH A;  2EFQ A;  4I02 A;  2NNY A;  2Y0M A;  4WX9 A;  2DQL A;  5FFZ A;  5FLX Z;  2R7F A;  3I71 A;  2CW0 F;  2OQG A;  2CGP A;  1R23 A;  2IT0 A;  2OBP A;  3F8M A;  1E17 A;  2O8X A;  4OMY A;  1OPC A;  5L3C A;  2XKP A;  2MLK A;  1Z7U A;  2FEZ A;  4HV6 A;  3RTR A;  3REO A;  1P4X A;  3K0L A;  2IJL A;  4O3M A;  1R5G A;  3VB2 A;  3M8F A;  1YQA A;  4CO8 A;  1F1Z A;  2CG4 A;  1LJ9 A;  5BMZ A;  3J80 K;  3FMQ A;  5TJJ A;  4BHB A;  3GYH X;  2XAG A;  3EET A;  2JRT A;  1QQI A;  4P9U A;  4S04 A;  2A68 F;  4FHT A;  1IAW A;  4IXA A;  1G3W A;  3TO6 A;  4MQV A;  4M9S A;  3LA3 A;  1XMK A;  4KN4 X;  1BOA A;  3RKW A;  4UV9 A;  3JSO A;  1LDJ A;  4U0W A;  2VBZ A;  2FNA A;  1Q1H A;  2XGX A;  2NRA C;  1KYW A;  1OYY A;  2ISY A;  5E8G A;  3EQL F;  4HF2 A;  2R7D A;  3RKY A;  4EJW A;  1FBS A;  2DPD A;  4CGZ A;  1IW7 F;  2STT A;  1J75 A;  3BJO A;  5HDN A;  1IXS B;  3RIR A;  5CVI A;  5F64 A;  1YG2 A;  4KIG A;  5ILS A;  2JZY A;  2R3S A;  3MQ0 A;  5A2Q Z;  2OU2 A;  5AIQ A;  3HSE A;  2VT2 A;  1K7A A;  3PFI A;  3V8K A;  5BQT A;  1YIO A;  2IRF G;  1YS7 A;  1XMA A;  2HGC A;  2A07 F;  4HX8 A;  4OIQ F;  3GX4 X;  1FBQ A;  6PAX A;  2PMU A;  3K9T A;  4RB2 C;  2YX4 A;  2QUF A;  1KYZ A;  4MEY F;  1T38 A;  2IP2 A;  2PG4 A;  5CJ9 A;  1L0O C;  5JVT A;  4ASN A;  2PEX A;  4R8H A;  2P7V B;  5DV5 A;  4Y15 A;  1HKQ A;  1ONV A;  2LSO A;  3HSF A;  2COM A;  3BOQ A;  2VT3 A;  1MD0 A;  3KE2 A;  4P96 A;  4BHC A;  3KCC A;  2KIU A;  4RAY A;  4CIC A;  3ZMV A;  3FXU A;  3DXJ F;  2FA5 A;  3C1D A;  2IPQ X;  2GXB A;  2P5L C;  1P2F A;  4LD5 A;  1STZ A;  2XIG A;  4Q5S F;  2MLG A;  1R1V A;  3L2C A;  1KQ8 A;  3D0S A;  2G7U A;  1ZAO A;  5D5U B;  2QLZ A;  3E6B A;  3L7W A;  2O3F A;  4L0Z B;  5LHH A;  3WG9 A;  1QBJ A;  3V8L A;  2L02 A;  2MH9 A;  5ED4 A;  2G9W A;  2RN7 A;  3LQQ A;  4YFX F;  2H94 A;  3QU3 A;  1R1U A;  2VOD A;  5HOO A;  1XGM A;  1SD5 A;  2ACJ A;  3IHU A;  1O3T A;  2Z9O A;  1PP8 F;  1TLH B;  2KJB A;  3DEU A;  1MDM B;  3V7C A;  3RJP A;  1UFM A;  4KT5 C;  5K5R A;  4KNY A;  3MFK A;  2MD5 A;  3JW4 A;  4RAZ A;  3U2R A;  3IWF A;  2EB7 A;  2LNB A;  1G4D A;  3TKY A;  2V1X A;  4LLL A;  5FGM A;  2UXN A;  3T8T A;  3FX3 A;  2Y75 A;  2HTJ A;  2DFI A;  2E7X A;  3EUH A;  2O6G E;  1BIA A;  1MGT A;  4XRF A;  2HYG D;  1SAX A;  4B09 A;  4G7O F;  1ULY A;  4HX7 A;  1XB4 A;  1TTY A;  3V4G A;  3CUQ B;  3BJ6 A;  2D2W A;  3WU1 B;  3Q9S A;  1O7F A;  2FQ3 A;  4L9V A;  1YYV A;  3TGN A;  4G94 A;  3RPQ A;  2QWW A;  1DUX C;  1DPU A;  2JT1 A;  3HHH A;  5FB2 A;  1W7P A;  2ZNY A;  4ZZD A;  1CGP A;  4EM1 A;  1LEB A;  1ZN2 A;  1KU2 A;  4I98 B;  2ZO4 A;  3FHZ A;  1TNS A;  2KJC A;  4I0A A;  4B8X A;  4MGR A;  3QPT A;  1F4K A;  1W4M A;  1I1S A;  3LST A;  4MEX F;  2UXX A;  4WWC A;  3J80 Z;  3DF8 A;  2M8E A;  4RGS A;  2BBY A;  3WE3 A;  5EEG A;  1GXP A;  3TO9 A;  1ZGA A;  4EQQ A;  1HBX G;  4UVB A;  4UXN A;  5AIP A;  1FX7 A;  4ESB A;  2BYV E;  3E5U A;  3BWG A;  3L09 A;  3E6C C;  1OKR A;  1PP7 U;  4NQW A;  4Q48 A;  5DDG A;  4HF0 A;  4GO1 A;  3TOA A;  1FOK A;  1FBU A;  1FPQ A;  1O3Q A;  1FC3 A;  1J5Y A;  3KFW X;  1S3J A;  2UWM A;  2W84 A;  2DO7 A;  5JI6 A;  5LGT A;  1CF7 A;  3MEX A;  2YPR A;  4IHS A;  4G9Y A;  3T1B A;  1L3L A;  3HOS A;  1UHW A;  3KET A;  1ZG1 A;  1WRJ A;  4JQF A;  3P9K A;  4N9I A;  1XCB A;  3RI4 A;  2NYX A;  1IXC A;  1XGS A;  1HKT A;  3WTT C;  4OIR F;  1LQ1 A;  4L18 B;  4M6Y A;  4ETS A;  2V1U A;  1D5V A;  1G3Y A;  3GFL A;  1Z9C A;  4XBF A;  1FSE A;  2DLL A;  1ZYR F;  2K27 A;  1JHH A;  4G8X A;  2EA2 A;  1P92 A;  3LFK A;  1R36 A;  4HOB A;  1SFX A;  2VC1 A;  3RKX A;  2FSW A;  4KMF A;  1ON2 A;  2MA3 A;  3JSP A;  3J7A O;  1F5T A;  3BDD A;  2X4H A;  1HW5 A;  4XLP F;  1J2X A;  1ZRC A;  2GQQ A;  2ZNZ A;  2G7H A;  2VBY A;  3CLO A;  1P6R A;  1YW8 A;  4U7B A;  2XAH A;  3R6S A;  3T8R A;  5E1X A;  5F1R A;  1R7J A;  1B1B A;  5LBQ A;  2RNJ A;  1IN7 A;  1XN7 A;  1LEA A;  5EEH A;  5K5Q A;  1HST A;  2WC2 A;  3R61 A;  1Z6R A;  2NNN A;  3ULQ B;  4FX4 A;  1F9N A;  3I5U A;  4Y17 A;  2ZBK A;  4AD9 A;  4WXD A;  4MTE A;  1H9G A;  3EYI A;  3F21 A;  1BI0 A;  4PGH A;  3Q9V A;  2DQR A;  3C7J A;  2OA4 A;  3V8J A;  4U0Y A;  2BE5 F;  2CWE A;  2DK8 A;  1K6O A;  1G3S A;  2DBB A;  4M74 A;  2P5V A;  1DDN A;  1AWC A;  2OZU A;  3K69 A;  1TQI A;  3F22 A;  2A6E F;  2FBK A;  2D1H A;  3GF2 A;  3KP2 A;  4G6D A;  2PJP A;  4G7Z F;  4L9J A;  2ADU A;  5HLH A;  2O61 A;  1FZP B;  3E6D A;  4XLN F;  4IJA A;  4K2E A;  2A5Y B;  2K4J A;  2LF8 A;  1IXR C;  4IRH A;  2WTE A;  4CZZ A;  2EFW A;  3SFZ A;  3GVA A;  1FYM A;  2P4W A;  5L3G A;  2B0L A;  2EFN A;  4OIP F;  1W7P D;  4AVP A;  4LMY A;  4PGG A;  5ILU A;  3O2P E;  2PBI A;  3SZP A;  1QPM A;  3HHG A;  3O3K A;  2DPU A;  3GW2 A;  4IRG A;  4LB6 B;  1TQM A;  4TV7 A;  5DCF A;  3SXY A;  2DU9 A;  3F6V A;  1I27 A;  3G73 A;  3KLO A;  4RS8 A;  1YS6 A;  3BY6 A;  1QZY A;  3ZPL A;  1LVA A;  1KQ9 A;  1BJA A;  2PLY A;  3B02 A;  2V9V A;  1YLF A;  1SMT A;  1R5H A;  5L3D A;  3K2Z A;  4HDU A;  3GZ5 A;  2AXL A;  2HFH A;  2P8T A;  4ZZL A;  3FMS A;  4YG2 F;  2MBF A;  2GWR A;  1ZG5 A;  1JXS A;  2K02 A;  3HSR A;  3D5L A;  4HDV A;  1O3S A;  4F7Z A;  5E18 F;  2MC3 A;  2HQR A;  3JAM K;  3QRF F;  2XAJ A;  5KVR A;  3HRT A;  2PN6 A;  4HLX A;  1Z1D A;  3HTU A;  3R60 A;  1SFU A;  4YFN F;  3LWF A;  4M9Z A;  3GXO A;  1C0W A;  1WQ2 A;  2K4B A;  2QBY A;  1V4R A;  4EGZ A;  4CXF A;  4I2O A;  1ZGJ A;  1BIB A;  4L9T A;  4XSX F;  1UCR A;  2UZK A;  4M6X A;  4ENJ A;  2Q0O A;  4HYE A;  4WCG A;  3WTU C;  4UVA A;  3BPX A;  3T0Y A;  4L9N A;  3ROU A;  1YO5 C;  1QGP A;  4HF1 A;  1FNN A;  3LA2 A;  3MZY A;  5JHU A;  5HLG A;  2V6C A;  4BXU A;  1RUO A;  5FFX A;  5LHI A;  3EYY A;  2EV6 A;  1MJA A;  2DI3 A;  1K79 A;  4U7D A;  4WXC A;  2GAU A;  3ABT A;  2HR3 A;  1XDS A;  3C3W A;  4H0E A;  4M71 A;  4UUV A;  2FE3 A;  4HBL A;  4WK8 F;  4XSZ F;  1Z6T A;  2QYO A;  2YU3 A;  4KFC A;  2H27 A;  2FRH A;  3EDP A;  3GFI A;  3RPU A;  2H6B A;  1O3R A;  2W25 A;  2XRO A;  1TBX A;  1UHM A;  2BEO A;  3I54 A;  5ICC A;  1HQC A; 
#chains in the Genus database with same CATH topology
 3WG7 H;  2A3S A;  2FBH A;  2P81 A;  1YJ9 I;  2LY9 A;  4XKC A;  5L3B A;  5JFR A;  2E36 A;  2H6C A;  4NQW B;  1UHS A;  2FJ1 A;  4V19 K;  3HM5 A;  4I0B A;  2DK5 A;  2MH2 A;  3F23 A;  5C4X J;  2L5Q A;  3M07 A;  4XKV A;  3ML6 A;  5D5V B;  1X1D A;  4KUM A;  1X1C A;  2GA2 A;  4HNV A;  3LSM A;  4XRS A;  2Y30 A;  2VOP A;  2KT0 A;  1BI1 A;  1JT6 A;  4ZYD A;  3CO7 C;  3JRI A;  4JBA A;  2DMP A;  3CJN A;  3TQN A;  3BTI A;  5ILV A;  3FKI J;  1CF7 B;  3I9V 2;  2E19 A;  2LMD A;  1G8X A;  1SVL A;  3JRB A;  3RZO J;  4E4H A;  2M1B A;  1OQY A;  1IN8 A;  2EFP A;  2GM4 A;  3Q3S A;  3V7R A;  1RI7 A;  2X6Y A;  5D4S A;  5B1A H;  3WGI A;  1RET A;  3FWE A;  4CCM A;  3KZY A;  2VON A;  2LYC A;  2M2E A;  1T8I A;  3FM3 A;  1Y56 A;  3A02 A;  1TT0 A;  2K9N A;  3CTA A;  3EUK L;  4UB6 C;  2KIF A;  5E20 A;  3L2W A;  2F5F A;  3ZQC A;  1H0M A;  3PNV A;  2R0Q C;  4FET A;  4YRV A;  1W36 D;  2HOA A;  4UUS A;  4PUS A;  4HPQ A;  1BC7 C;  2JWT A;  1I6X A;  1YRN B;  2VKV A;  3QOD A;  5TGT A;  1LDD A;  2DN0 A;  2RQP A;  2Y31 A;  1FSH A;  3P7N A;  3U1D A;  2LC2 A;  2Y0S N;  2HDC A;  4N4O B;  2HVQ A;  2L4A A;  4WF2 A;  2ICW G;  1XCV A;  2AHQ A;  4EV0 A;  4Y4R A;  2OCC H;  4ZDL A;  2VUM J;  1FP1 D;  3IH3 A;  4RM3 A;  1FP2 A;  5BOX A;  1EV7 A;  2DOD A;  5IP9 J;  2QSH X;  3CMM A;  1TZL A;  1UAA A;  1LDK B;  3PIO F;  2OV7 A;  4HRI A;  1WI9 A;  4A6E A;  4MQ9 F;  4BHP A;  4BBS J;  2E71 A;  2VBW A;  1B9M A;  1YOV B;  2VKH A;  2VQC A;  3ZCO A;  1LNW A;  1TWG J;  4HAM A;  3DEW A;  3FXR A;  1X2M A;  2XRL A;  4KIB A;  3MVP A;  4GYI A;  4IPA A;  2EIJ H;  1TL8 A;  2F5D A;  3NWS A;  4P55 A;  3F3X A;  1D5Y A;  1TW2 A;  5H20 A;  3H9G A;  3NAU A;  4MTD A;  1JGG A;  3MD2 A;  1PJR A;  5D5W B;  1R00 A;  2LLK A;  1JUM A;  2ZJP F;  3H5A A;  2KZV A;  4XLH A;  2L9R A;  1A36 A;  1ZKG A;  3GZ6 A;  3F72 A;  4A3I J;  4FIS A;  3ZP5 A;  1IN5 A;  1YFH A;  5BPI A;  3FK6 A;  3L00 A;  4YEL A;  3TDZ C;  4HSR A;  3ZQ7 A;  3S2W A;  1WWX A;  3LSP A;  1D3Y A;  2HU9 A;  4I01 A;  4A3J J;  3HUG B;  3IKV A;  1SC7 A;  5IT9 K;  4IF4 A;  2KLO A;  2VC0 A;  5HS8 A;  2E1C A;  1FT9 A;  3E6M A;  1CQT A;  1MZB A;  1TWF J;  2PMH A;  1ETW A;  2VPR A;  2Q8K A;  1GVD A;  1JKP C;  1A6I A;  1VFC A;  2NVQ J;  2OZ6 A;  1UG2 A;  2XGD A;  2DDB A;  2X1E A;  2M5W A;  3FK7 A;  3JCU C;  3ZN1 A;  5J6X A;  3TMO A;  3K1P A;  2R7U A;  1I50 J;  2QZ8 A;  1Q1V A;  4XID A;  1IUY A;  1WFX A;  3KP7 A;  3L2Q A;  4I6Z A;  4NNJ A;  3VWB A;  3HRS A;  1OYI A;  4ESJ A;  3OS0 A;  2BZT A;  5IP7 J;  2KRF A;  4AC0 A;  3TP3 A;  2OPT A;  4FCY A;  2QGU A;  5LRS A;  1BR2 A;  2WY8 Q;  2FMY A;  2F2E A;  4E7Z A;  2FOW A;  3DCF A;  1MNM C;  5DM7 F;  1MSF C;  2LOO A;  2ZB9 A;  1ODD A;  1HKS A;  2QQB A;  3DPT A;  3GFM A;  4KIC A;  1X3U A;  5K1Y A;  3LAJ A;  2L4M A;  1W36 C;  1AOY A;  2ZJ2 A;  5JR3 A;  3O8H A;  4PSX A;  1YTY A;  3K4J A;  1T98 A;  3SYT A;  3JAM Z;  1LPQ A;  2XC7 A;  2Z1D A;  5DEQ A;  2ELJ A;  4EVI A;  2NOG A;  4YFK F;  4XLE A;  1S29 A;  1PUE E;  3ECH A;  3AG2 H;  5F27 A;  3GEZ A;  2E7W A;  2V4J C;  3IRR A;  4V2F A;  3GTJ J;  2VE8 A;  4G7H F;  1WSU A;  1HC8 A;  4LB5 A;  2PJR B;  4AYB N;  3CUO A;  2WWY A;  1ETO A;  3KP6 A;  4RGU A;  4H4K C;  3E1S A;  5LEJ A;  4A0X A;  5D6F A;  2J5O A;  4M9X A;  4LK0 F;  1QPI A;  2C6Y A;  1MKM A;  2V1N A;  1N75 A;  1G59 A;  2RAE A;  3DV8 A;  4P9F A;  2YU9 J;  1VF9 A;  3KEO A;  1V3F A;  2ZXJ A;  2HQN A;  1U5T C;  2R92 J;  1EJ9 A;  2E1N A;  3F8F A;  2R93 J;  1EH6 A;  3RPU D;  3HOV J;  4U88 A;  1XSX A;  1A6Q A;  4FE4 A;  1K78 A;  4PSW A;  1BM9 A;  3OYK A;  3MCZ A;  4GYG A;  5EDN A;  5FKL A;  3FXQ A;  3HXL A;  3L9F A;  2RDP A;  3ZMD A;  3FXK A;  3VSL A;  3CF5 F;  3SQN A;  4YII A;  1REP C;  1DGW Y;  2IA0 A;  1ZLJ A;  2R5Z A;  2FU4 A;  3FHN A;  3BZ6 A;  3KP4 A;  3R0J A;  2OCE A;  1JT0 A;  2W85 A;  4ABZ A;  3PUF A;  4IZZ A;  2DCE A;  3WU0 A;  2D45 A;  4RA2 A;  2R5Y A;  4FX0 A;  1HCR A;  1AKH A;  2VJ4 A;  4D0P A;  1R1T A;  3LQR A;  3H92 A;  3WHC A;  1O7L A;  5FJ8 J;  2VI6 A;  2XAU A;  5KNL A;  3HRU A;  1S7A A;  5HLT A;  3ELK A;  5L3E A;  5B1B H;  4IO9 F;  3ZQG A;  2VPL A;  3CC4 I;  1ITY A;  3JTH A;  3PFY A;  4A5M A;  2YUS A;  2VLA A;  1DU6 A;  2L01 A;  2HOT A;  2I10 A;  3UKG A;  2LTP A;  1KGS A;  1SAN A;  4HEA 2;  3A2K A;  1RNL A;  3FM5 A;  2PFB A;  4W97 A;  2GXG A;  2JPC A;  3IAM 2;  1U8B A;  1VQP I;  3H5N A;  4ZH4 F;  3GTL J;  2L7Z A;  2IW5 A;  3BT9 A;  1RRJ A;  5IYD J;  1JI8 A;  2ZME C;  3G1O A;  5LEK A;  1FIA A;  2HKX A;  5FKK A;  3T5X A;  1TNT A;  1HOM A;  5K7Z A;  3BP8 A;  2BXY A;  2FOK A;  5FRO A;  5HOD A;  2ZKZ A;  1D0Y A;  2LKP A;  3GO5 A;  2OTL I;  2HTS A;  2JA6 J;  2RVC A;  1I3A A;  2CSO A;  2GIV A;  4AU7 A;  4UNO A;  3AAF A;  2QBY B;  4R1H A;  4HV5 A;  5LGN A;  2FXA A;  1GHC A;  4HZF A;  4LGW A;  3I59 A;  3IC7 A;  1RKW A;  3CCS I;  4LG0 A;  5EZG A;  1FOW A;  3LAP A;  2CUJ A;  1KU9 A;  1P7I A;  4J00 A;  1U2W A;  3F8B A;  3PQJ A;  1Y39 A;  1GDT A;  5CQE A;  4LOC A;  3P9C A;  4L5I A;  2M3A A;  4N0B A;  5EGO A;  3JRH A;  1XS9 A;  2BVL A;  5J8F A;  3I4P A;  2STW A;  1IZ1 A;  3NQO A;  1YIJ I;  4MFE A;  1QNT A;  5FLV A;  2R7R A;  1I5Z A;  2E60 A;  1XG1 A;  5CPR B;  2VAS A;  4KDP A;  5DD4 A;  4CUG A;  4OIO F;  3C18 A;  5FD6 A;  3TOB A;  4A3L J;  3WTV C;  2ZFU A;  4Y33 A;  2NAZ A;  1IRG A;  2QEX I;  2IVM A;  4LG3 A;  2M4K A;  2Y69 H;  4B3X A;  1LE8 B;  1B72 A;  2MFZ A;  1JKR C;  1JE8 A;  4PCQ A;  3IUO A;  3VDX A;  1F36 A;  5B66 C;  1IF1 A;  1B9N A;  2I5U A;  4NC8 A;  5BS6 A;  4GFB A;  2DW4 A;  5F0C A;  4AUX A;  1Z05 A;  5DTD A;  3VFZ A;  4XLF A;  2LVS A;  2W1O A;  5TRD A;  4ANJ A;  4DQ2 A;  5E8I A;  3FMR A;  3OYB A;  4OOI A;  5K5O A;  4ZYA A;  4IHY A;  5C4J J;  4BNC A;  1X3W B;  1OLT A;  4E7K A;  1AU7 A;  1H9T A;  2L9S A;  5FO5 A;  4D7N A;  1ZH5 A;  4Y52 J;  1YW9 A;  5HDG A;  1OYW A;  1WHU A;  3H9J A;  1T6S A;  3V7S A;  3CD6 I;  3MZ8 A;  1IV6 A;  4LLG F;  1TQP A;  1Z7L A;  2OQR A;  5CVJ A;  5LGU A;  1JGS A;  1MH4 A;  1X4P A;  3CDH A;  4G6Q A;  4AM3 A;  1FTT A;  1MMA A;  1T2K A;  4E7I A;  2WAE A;  2FML A;  2Z16 A;  1FTZ A;  2KRC A;  5E1Z B;  3LSG A;  3I56 I;  4C2U A;  3CQZ J;  3DLL F;  5C3E J;  1U0J A;  1H89 C;  3BTL A;  3QPL A;  2X0L A;  2HKO A;  3RDI A;  2EBI A;  3ZMU A;  2F5C A;  3BRO A;  2GA1 A;  2XKO A;  3O8G A;  3CC2 I;  2E1M C;  2Q2E A;  2XV4 S;  4AIK A;  4EMS A;  3M3Y J;  2QQA A;  3DEE A;  2P7C B;  3S1Q J;  1HXD A;  3M8E A;  4FE7 A;  1K4S A;  5D8L B;  2EK5 A;  1D0X A;  2CUZ A;  1Y1W J;  4HST A;  3JRE A;  1J0R A;  2ME6 A;  1AKH B;  4A93 J;  2M0C A;  3KZZ A;  5F1J A;  1HSJ A;  4IHT A;  3E97 A;  2MYS A;  3HB9 A;  3JRF A;  3TDU C;  3GTK J;  1G6N A;  2EWN A;  4BDY A;  2QF7 A;  5H6Q A;  1DP7 P;  3WOD F;  3WGH A;  2M30 A;  4HX4 A;  1S5L C;  1U5T A;  4KMU X;  1JHF A;  3SDB A;  4CHU A;  3UR3 C;  1QHH D;  1UB9 A;  4BGD A;  1VQ4 I;  3LMM A;  5FRM A;  2KHM A;  2ZCW A;  4GCV A;  3SEZ A;  3HJE A;  4CYD A;  3QOE A;  4HA8 A;  2TDX A;  2W48 A;  1XX5 A;  2CRG A;  4HNT A;  4BQA A;  1ETY A;  3LA7 A;  4NB5 A;  3MMY B;  3KLN A;  3UNG C;  1ZRD A;  2NVX J;  1T39 A;  1VQ7 I;  4A3B J;  2RQQ A;  3IWZ A;  5E3L A;  5EYR A;  3DPL C;  2QSG X;  1BBY A;  2XRN A;  4P5O A;  5D8K B;  4DYC A;  4IQ4 A;  1GVJ A;  2EV5 A;  2IAI A;  1MMG A;  4A2U A;  4IEJ A;  3ISP A;  4PJ0 C;  3MN2 A;  3CCQ I;  4QLC U;  2UUZ A;  4CCN A;  1VQ8 I;  1UG0 A;  4OIN F;  1BOB A;  2QM3 A;  4BQO A;  3BJA A;  1NHA A;  4L5J A;  3OOP A;  1KQ0 A;  2R7Q A;  4EJV A;  1JUP A;  3DKW A;  3D5S C;  3LNQ A;  2HEO A;  5HS7 A;  1S6L A;  5IT9 Z;  5J1Y A;  2EIL H;  1BI2 A;  3WTY C;  2VE9 A;  2VJI A;  4ZDP A;  2LF7 A;  5BPD A;  3WTZ A;  3BG9 A;  4IKF A;  2VN2 A;  5CVV A;  3TW6 A;  4UUS B;  3IV5 A;  3S3M A;  4ZC3 A;  3H3U A;  5DUI A;  3ZQL A;  5DCM A;  2XAQ A;  4YIR X;  3KP3 A;  2HDD A;  1LFP A;  1OR7 A;  4Q47 A;  2D5V A;  4DZJ A;  2BY1 A;  4EJO A;  1Y0N A;  5IT3 A;  1W5T A;  2EFO A;  3CMA I;  3G3Z A;  2DYR H;  2VIX A;  2IXS A;  3OYH A;  4NHJ A;  1UST A;  3RQ4 A;  3W6J B;  1ZEL A;  2BXZ A;  3S1R J;  2ZME A;  1SEU A;  2WB1 A;  4RGX A;  4OU0 A;  3NWT A;  3J81 K;  2EJR A;  4BE1 A;  5CVU A;  4C3I J;  5FD5 A;  2P5K A;  4UVC A;  1ON1 A;  3BG5 A;  4MFD A;  1B6A A;  4Y7N J;  4LFU A;  3GTM J;  4ON0 A;  2LH9 A;  3PJR A;  1B4A A;  1U9O A;  3ZMZ A;  1SD7 A;  4A0Z A;  4AIH A;  1JUS A;  4DYR A;  2NS7 A;  3FBI B;  3M9A A;  3RYP A;  2D1V A;  3H3Z A;  1I6H J;  1MBF A;  1ZLK A;  3GFJ A;  5IP6 A;  4HQM A;  1HLV A;  3R4K A;  1LKX A;  1USS A;  5GAD J;  1AHD P;  2W24 A;  1MJB A;  1R22 A;  3ABU A;  1BW5 A;  1W7P B;  2HDW A;  3OS1 A;  5LRR A;  4A3G J;  3S32 A;  1FYK A;  1X1P A;  3F9K A;  3E3V A;  2WY7 Q;  4A12 A;  1SD4 A;  2XGE A;  3F8N A;  3ZMS A;  1I39 A;  1FLI A;  3QOP A;  2NOJ B;  4M72 A;  2CFX A;  1LB2 A;  2E34 A;  4GDF A;  3M8J A;  3NEU A;  2L3D A;  1R58 A;  3K10 A;  1U3E M;  1PDN C;  1VQK I;  3N4M A;  2VXZ A;  5L3F A;  3SHF A;  3PL8 A;  1HDD C;  3FXO A;  3B73 A;  1XSD A;  2K86 A;  4B44 A;  1TWH J;  3PM1 A;  3DQV C;  5KK1 A;  5J3L A;  4II3 A;  3GZN B;  2JPB A;  4XOP A;  4YIF A;  1KZH A;  2LDU A;  5HDK A;  2AS5 F;  3DP7 A;  2QEN A;  1XGO A;  4OMZ A;  3U9G A;  3R0A A;  4S05 A;  5D4R A;  2CS3 A;  4BY1 J;  2Z5U A;  4ZYE A;  5DUK A;  4X0G A;  3AG4 H;  2V1D A;  1OCP A;  3W6K B;  3OYF A;  4R79 A;  1I3Q J;  2KDO A;  5E79 C;  3KX2 A;  3RYR A;  2H1K A;  4GGG A;  5EG0 A;  2GZW A;  1MMD A;  4CCK A;  2QCO A;  3W2V A;  1EH7 A;  1T56 A;  2LKX A;  1J9I A;  5GPA A;  1GV2 A;  2YX7 A;  4LJZ F;  2JA5 J;  1IDY A;  4JP0 A;  3F0C A;  3HOT A;  2H09 A;  2W82 A;  2Z33 A;  4EJU A;  2ETH A;  2EZK A;  3PO3 J;  3W6V A;  3VOE A;  3PUB A;  1WGX A;  2J5P A;  4F91 B;  3BC8 A;  4KIT B;  5LFA A;  4ENK A;  3MAJ A;  4DGW B;  3S3N A;  5FKM A;  2RKH A;  2TCT A;  3DBL B;  1YW7 A;  2CV1 A;  2ISZ A;  3BR1 A;  5E17 F;  1VI0 A;  3MKW B;  2PQ8 A;  3WTS C;  5ICE A;  1Y6I A;  1B59 A;  2ZJR F;  3K6G A;  1WKM A;  2RC4 A;  4JX6 A;  2R7O A;  1YI2 I;  1FWZ A;  1E3O C;  2P6T A;  1S8N A;  1N78 A;  2X48 A;  4XQF A;  1RUN A;  3AKZ A;  3OV8 A;  1Z91 A;  2B7E A;  2HYF A;  1W5S A;  3L2V A;  1FYL A;  4LK1 F;  4AIJ A;  1APL C;  1G3T A;  1BW6 A;  1U6G A;  4AWX B;  4Z2Y A;  1J09 A;  1ZG3 A;  1IRF A;  1KA8 A;  1QZZ A;  3EPZ A;  4KN7 X;  3J7Y J;  3BPV A;  4GXO A;  3OYD A;  5FLX K;  4IOC F;  2IA2 A;  2K7L A;  4UHT A;  1ZK8 A;  4EJT A;  4XL9 A;  4A3K J;  2BGC A;  4LLN A;  4RB0 A;  2R7V A;  2O8K A;  2JSC A;  3DTK A;  1RES A;  2L54 A;  1YHQ I;  3BTC A;  1D8J A;  3H5R A;  1IN6 A;  5J8C A;  2DA3 A;  1WI3 A;  2A6H F;  2O0Y A;  4UV8 A;  2LRD A;  3HTS B;  1P4A A;  2M4G A;  2GOX B;  3GLX A;  1QO0 D;  1BN5 A;  1IG7 A;  3CUQ C;  1U78 A;  3LSI A;  1YJW I;  2L7M P;  2XPW A;  3FF5 A;  3I3L A;  3I53 A;  3QAH A;  3I0T A;  1D8K A;  5K7H A;  2WAQ A;  3P5J A;  1E2X A;  3ONQ A;  2ZXW H;  4PDK A;  4DNC A;  3E5Q A;  3QP5 A;  2R7W A;  2Z99 A;  1K78 B;  2HZD A;  2HOE A;  3LFU A;  4YEJ A;  2BW3 B;  1HW2 A;  3BTJ A;  2Z3Y A;  4QSH A;  2JTV A;  3EUA A;  5B5E C;  1ETV A;  2RGV A;  2O03 A;  3VSK A;  1KU7 A;  2R5Z B;  2JSP A;  4UB8 C;  2IA1 A;  2ESN A;  4EM0 B;  1IO2 A;  3COA C;  3M4O J;  2WV0 A;  2K9Q A;  2RV8 A;  3C2G A;  4BYY A;  1IUF A;  3FZV A;  2XVC A;  1DU0 A;  4KYW A;  2FF4 A;  2GOM A;  2R5Y B;  1M1E B;  3IL2 A;  2VKE A;  5D5X B;  2Y48 A;  3CP8 A;  5J1R A;  1SFE A;  3K1M A;  1Z3X A;  3MWM A;  4A3E J;  3ECO A;  3QQA A;  3A01 A;  1E3H A;  2JA7 J;  1Y8Q B;  2HPI A;  4CA0 A;  1WJA A;  2N8G A;  5E1W A;  3KP5 A;  2ESH A;  1J59 A;  3CCR I;  3CP2 A;  3WTW C;  3S14 J;  3SFI A;  4BH9 A;  4HLY A;  3GCM A;  1D1A A;  2XHK A;  3GWZ A;  5CKT A;  4KIF A;  5HS9 A;  3DU6 A;  1KON A;  3VOD A;  1MBK A;  5F6F A;  1V54 H;  3HRM A;  5EF6 A;  4C30 A;  2VOO A;  1RZ4 A;  2X6W A;  5DYM A;  3MKL A;  2FNP A;  4MNU A;  1Z21 A;  2OD5 A;  3GTQ J;  2DMT A;  3G6E I;  4HQE A;  1OMI A;  3F8C A;  2PI0 A;  3HYI A;  2KIM A;  1SVM A;  4ZJZ A;  2B9S A;  3CCY A;  4ZDO A;  1W1W E;  3OY9 A;  1XDU A;  2V79 A;  3VEP A;  1TP4 A;  2ID3 A;  3Q5F A;  3KEQ A;  3O6B B;  3OMY A;  4BUP A;  4IVN A;  3MKZ A;  2XDV A;  1Z3Y A;  1YX3 A;  2CV2 A;  1MNE A;  3F6O A;  1RIO H;  5A2Q K;  3I58 A;  3I59 B;  2L9N A;  4QWQ A;  4CYC A;  4LG0 B;  2EA4 A;  4U0V A;  4A6D A;  3OIP A;  3BR3 A;  1QZE A;  5ERI A;  4WXH A;  2KKO A;  4AVZ A;  4DW6 A;  5EGO B;  4C3H J;  4ZTF A;  3H36 A;  1R49 A;  4DZP A;  2EZI A;  1EH8 A;  3H35 A;  2A69 F;  4DBQ A;  3HOY J;  2CQK A;  4A0Y A;  5E3M A;  4JK1 X;  3AFH A;  1QVU A;  3ZMT A;  2DFF A;  4NDL A;  2ELH A;  1ZGW A;  2P6S A;  2JA2 A;  1XTA A;  1TT5 B;  2DAO A;  5IOY A;  3ESW B;  4ENN A;  3N05 A;  1SD6 A;  3L2U A;  3N97 A;  2PMZ A;  3OS2 A;  2LD5 A;  3V42 A;  1B72 B;  4OAZ A;  4HW0 A;  1Y8R B;  4I7H A;  4NUB A;  1O57 A;  2BY2 A;  2HZT A;  3CME I;  5LLQ A;  2Z2S B;  4Y13 A;  2ZFW A;  5DD8 A;  1R71 A;  3ZQQ A;  1DP3 A;  2LR8 A;  1BC8 C;  2MC4 A;  2YR2 A;  3G71 I;  1ZHF A;  2CUE A;  5HVQ C;  1XGN A;  2HXO A;  4RB1 A;  4FQG A;  3CC7 I;  2QKL B;  3AL0 C;  2QVO A;  1NG6 A;  1MDM A;  3SZT A;  3OYA A;  3BR2 A;  2L9V A;  2QQ9 A;  4CSW A;  4E70 A;  3MKY B;  2L7K A;  3QPH A;  2KZG A;  4QIW N;  1IN4 A;  4XR6 A;  2K40 A;  4EM2 A;  2IS1 A;  5LHG A;  2BHY A;  2F5E A;  4W1U A;  1KU3 A;  2OC6 A;  4M73 A;  4CDG A;  3DFG A;  4A5N A;  4ZYG A;  3S16 J;  5IYB J;  1XD7 A;  2TRT A;  1S7E A;  1NK3 P;  2KL4 A;  1XSV A;  3TO7 A;  3I4M J;  3BR0 A;  3IKT A;  5HNF A;  1ETQ A;  1EKE A;  2M7A A;  3AL0 B;  4N9H A;  4FAS D;  3HBL A;  3CCU I;  3J81 Z;  3E5X A;  3SZG A;  4IRI A;  5ICF A;  5H6R A;  1ZRF A;  4ENM A;  2PX9 A;  4OWR B;  3M1E A;  1YRN A;  1U9N A;  5AON A;  1ZR4 A;  2X9D A;  4Q4Z F;  2HWV A;  3LOC A;  4FT8 A;  2IGN A;  2XF6 A;  1EA3 A;  3IRQ A;  2EIN H;  4BAY A;  3I4N J;  2M9H A;  2DT7 B;  2XAF A;  3CUQ A;  4RB3 C;  3NRV A;  4DOZ A;  2BY3 A;  1U5T B;  3HEF A;  3VPR A;  1MJ9 A;  3GUD A;  4PFP A;  2B63 J;  1VTN C;  2CH0 A;  2VL8 A;  2CO5 A;  3H0D A;  3B6A A;  3WTX C;  3M7G A;  2DA1 A;  3PQK A;  2DYS H;  1I1G A;  4MO7 A;  1IJW C;  5CVR A;  2XUB A;  5IY5 H;  4KT6 A;  1YE9 A;  3SEQ A;  4O5V A;  2CYY A;  1LVK A;  2XB0 X;  3HGY A;  5HLI A;  1OR7 C;  3JR9 A;  3PIP F;  2F5V A;  4J01 A;  4EGY A;  2GXA A;  4D5F A;  1Z77 A;  1V5G A;  1K4T A;  4PZJ A;  2FBI A;  1S7O A;  3DKY A;  5H2F C;  2EV0 A;  1SMY F;  4DIQ A;  1T0F A;  2DT5 A;  1TW3 A;  3QU6 A;  4I09 A;  4O6J A;  1FY7 A;  2OTJ I;  1GV5 A;  2RRE A;  3QP6 A;  1VND A;  5D6E A;  3BCA A;  1ZRE A;  2K5C A;  1U8R A;  1ZAR A;  2AXT C;  2K9L A;  2KMU A;  1FJL A;  5ICG A;  1OJL A;  1WCM J;  2W57 A;  5DCM B;  2BV6 A;  1RR7 A;  2DA7 A;  2O7O A;  1NTC A;  1J7K A;  2YSR A;  3HUG A;  2XAS A;  2M45 A;  1YIT I;  1BI3 A;  5CLS A;  3WE2 A;  2HS5 A;  3BZC A;  4ESF A;  3JTG A;  3I64 A;  1IRX A;  2ZME B;  3FDY A;  3H9Q A;  3QYF A;  1RR8 C;  1ENH A;  2CQ7 A;  3CO6 C;  1P4W A;  1Y0U A;  1FMV A;  2ZC2 A;  3MZH A;  2MG4 A;  2DMQ A;  3K1N A;  2WB1 N;  3P9I A;  3OSG A;  2XF5 A;  2IS6 A;  2X1D A;  4I76 A;  1DPR A;  1GXQ A;  1HW1 A;  2QSF X;  3HIF A;  4KA4 A;  2VQG A;  2X6X A;  2OAZ A;  2VBX A;  1V55 H;  4L0Y B;  2COB A;  2NS0 A;  5CYV A;  2R7X A;  1ZQ3 P;  1JKO C;  1G2H A;  2A6T A;  2O5R A;  1X2N A;  4LIT A;  4MHG A;  2A61 A;  1NK2 P;  5J4Y A;  1A04 A;  5GAG J;  2M87 A;  1VQM I;  3WGG A;  3ZN0 A;  4JYK A;  4RGR A;  1SFO J;  3ERE D;  2DTR A;  4ZYH A;  1MBE A;  2EFQ A;  4I02 A;  5FLM J;  2NNY A;  1W0U A;  2Y0M A;  4WX9 A;  2L2O A;  5F0F A;  2A05 A;  1WPK A;  2DQL A;  2WAD A;  5FFZ A;  2EIK H;  5FLX Z;  5FKN A;  2R7F A;  4B4C A;  3I71 A;  2OUM A;  1PYV A;  3CCJ I;  2CW0 F;  2OQG A;  4A3F J;  2CGP A;  1R23 A;  2IT0 A;  5GAH J;  2OBP A;  3OYI A;  3A4C A;  3HC7 A;  3F8M A;  3H3V K;  1TWA J;  3S1M J;  1E17 A;  2O8X A;  2XGC A;  5F04 A;  4OMY A;  2NS8 A;  4CCL A;  1OPC A;  3G1M A;  3I55 I;  5L3C A;  4XNF A;  2XKP A;  2MLK A;  3TED A;  1Z7U A;  2FEZ A;  5EJC A;  4HV6 A;  3RTR A;  3REO A;  2PJR A;  1P4X A;  3K0L A;  2IJL A;  4O3M A;  3HKZ A;  4BJ6 C;  3S1N J;  1R5G A;  2ID6 A;  3VB2 A;  3OYN A;  3M8F A;  1YQA A;  3RQI A;  4CO8 A;  4IHV A;  1F1Z A;  2CG4 A;  1LJ9 A;  3DTE A;  5BMZ A;  3J80 K;  5KHD A;  3FMQ A;  5TJJ A;  4BHB A;  3CCM I;  3GYH X;  2XAG A;  3EET A;  2JRT A;  1QQI A;  3D5R C;  4P9U A;  2UV1 A;  2E5N A;  4S04 A;  2A68 F;  4FHT A;  1IAW A;  4IXA A;  2ZSI B;  1IRZ A;  1G3W A;  3OL4 A;  3TO6 A;  4MQV A;  4M9S A;  5FRN A;  2E1M B;  3LA3 A;  1FOX A;  1XMK A;  4KN4 X;  2NVT J;  1QU3 A;  1BOA A;  3X2Q H;  3RKW A;  3OYC A;  4UV9 A;  3JSO A;  1LDJ A;  3TBI A;  4U0W A;  3HG9 A;  4UY8 I;  2VBZ A;  3ASN H;  3ERM A;  2FNA A;  3H1C A;  1RKT A;  3BQZ A;  3GLL A;  4B47 A;  2E2H J;  3CJT B;  3ZOB A;  1Q1H A;  2XGX A;  3DBR B;  3RKQ A;  4M3D A;  2NRA C;  1KYW A;  1OYY A;  2ISY A;  5J4V A;  5E8G A;  3EQL F;  4RAG A;  4HF2 A;  2R7D A;  1W0T A;  2LP0 A;  3RKY A;  4EJW A;  2MD0 A;  1FBS A;  4XIC A;  1BA5 A;  3OL3 A;  4BDZ A;  1LFU P;  3K70 D;  1MMN A;  3QYE A;  4X1E A;  5JVG F;  2DPD A;  4BEH A;  4CGZ A;  1IW7 F;  3BQY A;  1HA8 A;  2STT A;  2WV1 A;  1WJD A;  4C2M J;  1J75 A;  3BJO A;  5HDN A;  1IXS B;  3RIR A;  5CVI A;  5F64 A;  1YG2 A;  4KIG A;  5KAI C;  2HVR A;  5ILS A;  3ZQF A;  2JZY A;  2R3S A;  4RBO A;  4G6T B;  2DA6 A;  1OFC X;  3MQ0 A;  5A2Q Z;  2OU2 A;  5AIQ A;  4BXF A;  1UMQ A;  3HSE A;  2VT2 A;  1K7A A;  1MND A;  3PFI A;  3IH2 A;  3V8K A;  5BQT A;  1WJE A;  1YIO A;  2IRF G;  1YS7 A;  1XMA A;  2HGC A;  1WJ5 A;  1BJZ A;  2A07 F;  3CLQ A;  2WAQ N;  3ZR8 X;  4HX8 A;  2NXN B;  4OIQ F;  2JK3 A;  2XB5 A;  4PJN A;  4F3Q A;  3GX4 X;  1FBQ A;  6PAX A;  2PMU A;  3K9T A;  2H8W A;  2GIZ A;  1MW7 A;  4RB2 C;  2YX4 A;  3SJM A;  2QUF A;  2OJE D;  3K4N A;  1KYZ A;  4MEY F;  1ZTR A;  1T38 A;  1GT0 C;  2IP2 A;  2PG4 A;  1OCR H;  3FXJ A;  5CJ9 A;  1L0O C;  5JVT A;  1POG A;  2O9L A;  1WJF A;  4B48 A;  2Q1Z B;  2VJ5 A;  4XLC A;  3S8P A;  3ZXS A;  4ASN A;  2PEX A;  4Z6Y A;  2CV0 A;  3A01 B;  4R8H A;  2P7V B;  2W7N A;  3G4S I;  3DBH B;  5DV5 A;  4Y15 A;  1HKQ A;  1ONV A;  2LSO A;  3HOU J;  2WBM A;  2HQ5 A;  2COM A;  3BOQ A;  3HSF A;  2AQF A;  3FIW A;  3K4C A;  1FMW A;  1OCZ H;  2VT3 A;  1MD0 A;  3KE2 A;  3U21 A;  4B43 A;  3WU2 C;  4P96 A;  2QKM B;  4EEF G;  2BHZ A;  2XSJ C;  2KIU A;  3KCC A;  2GBY A;  4RAY A;  4BHC A;  4CIC A;  2HOS A;  3ZMV A;  1BR1 A;  1JKQ C;  3FXU A;  1GLN A;  3DXJ F;  2FA5 A;  2X1C A;  3C1D A;  1TC3 C;  2IPQ X;  4PJM A;  1XC5 A;  3OIQ A;  3HGG A;  3FXL A;  3KZI C;  2GXB A;  1VQ6 I;  3GTO J;  2P5L C;  2LBF A;  1UZC A;  1P2F A;  4LD5 A;  2ECB A;  1STZ A;  4QPQ A;  2XIG A;  4Q5S F;  2Y9Z A;  2MLG A;  1GUU A;  1R1V A;  4RLQ A;  4A3C J;  3J7Z I;  4CYC B;  3H0G J;  3L2C A;  1KQ8 A;  3S2D J;  4M6V A;  3D0S A;  2VXD A;  3SDG A;  1VQN I;  2G7U A;  1P7J A;  1R5I D;  2IGK A;  2DTZ A;  1ZAO A;  3RSN A;  5D5U B;  4BL0 B;  2HNH A;  2QLZ A;  4XN3 A;  3KIO A;  3E6B A;  3L7W A;  2W4S A;  2O3F A;  2P0W A;  4L0Z B;  3HOX J;  3AG1 H;  1K83 J;  5LHH A;  3WG9 A;  4BBR J;  3K70 C;  1QBJ A;  2XSD C;  3FXM A;  4XKB A;  3V8L A;  1E3P A;  2L02 A;  2MH9 A;  2XPV A;  5ED4 A;  3A03 A;  4XLA A;  2G9W A;  2RN7 A;  3OSF A;  3LQQ A;  2OF7 A;  1PUF A;  4YFX F;  3ASO H;  2CW7 A;  2HYJ A;  2DXI A;  2H94 A;  3QU3 A;  4DJA A;  1R1U A;  3GTG J;  2VOD A;  4JOM A;  1JJ8 C;  2DFH A;  4HG2 A;  2PMZ N;  5HOO A;  1MBH A;  4E7J A;  3ZRG A;  1XGM A;  1WJB A;  1SD5 A;  1WVR A;  2ACJ A;  2F4O B;  2R7Z J;  3IHU A;  1O3T A;  2NVU B;  1H88 C;  2DDA A;  4E7H A;  2Z9O A;  4BJ5 C;  1PP8 F;  3DEU A;  1TLH B;  2KJB A;  3M1C A;  2KP6 A;  5JHF A;  5J47 A;  2CU7 A;  3PNT A;  2F48 A;  1R4M B;  2NVY J;  1MDM B;  3E7L A;  3RJP A;  3V7C A;  2GLO A;  4IHX A;  1UFM A;  1VZ0 A;  3A1Y A;  4KT5 C;  5K5R A;  4KNY A;  2LRE A;  3MFK A;  2XPU A;  1P9Q C;  2JVH A;  1WH7 A;  2JN6 A;  2MD5 A;  3JW4 A;  3OIO A;  4RAZ A;  4XM3 A;  3IWF A;  3U2R A;  3PO2 J;  2EB7 A;  2LNB A;  1G4D A;  3TKY A;  1YJN I;  3VYR B;  2V1X A;  2IS2 A;  3A0B C;  3OYJ A;  2I8D A;  2VQH A;  4XOR A;  4LLL A;  5FGM A;  2UXN A;  1FIP A;  3T8T A;  5EEA A;  3FX3 A;  2Y75 A;  2HTJ A;  4XON A;  4RM2 A;  3BG3 A;  1V5F A;  2DFI A;  2IGM A;  2E7X A;  1PVE A;  4GRI A;  3EUH A;  3DLA A;  2W00 A;  5JLX A;  2O6G E;  1BIA A;  1MGT A;  2F4I A;  4XRF A;  4IHW A;  4BU2 A;  2HI3 A;  3W2A A;  4F93 B;  2DA5 A;  3LSJ A;  2ELK A;  2HYG D;  1SAX A;  1VQ5 I;  5IPA A;  3HL2 A;  3B6C A;  4B09 A;  4DYQ A;  4G7O F;  2KDZ A;  2M34 A;  1TWC J;  1ULY A;  4HX7 A;  1XB4 A;  1TTY A;  2V9K A;  3V4G A;  3CUQ B;  3BJ6 A;  2D2W A;  3WU1 B;  4D7M A;  3Q9S A;  1VQL I;  4DBR A;  1T0F C;  2QQ8 A;  1O7F A;  2VJJ A;  3ABM H;  2FQ3 A;  4L9V A;  2LK2 A;  1YYV A;  5M5W J;  3TGN A;  4G94 A;  3RPQ A;  2JVG A;  1N25 A;  2EZH A;  2QWW A;  1DUX C;  3TP0 A;  1X58 A;  2ZSH B;  2MSY A;  1DPU A;  2JT1 A;  2R4G A;  1D1C A;  3HHH A;  2LFB A;  5FB2 A;  1W7P A;  2DMU A;  2M0M A;  2FUG 2;  4B3A A;  2ZNY A;  3FKJ A;  4ZZD A;  1B8I A;  2LG4 A;  3FIS A;  3JRA A;  1CGP A;  4EM1 A;  3W2W A;  1LEB A;  1ZN2 A;  2EIM H;  1KU2 A;  4I98 B;  2ZO4 A;  1WH5 A;  3FHZ A;  2V7F A;  2DOE A;  1TNS A;  2KFD A;  2KJC A;  4I0A A;  3S93 A;  4X6A J;  4B8X A;  3CJQ B;  4MGR A;  4XKW A;  3QPT A;  2DMN A;  2JUC A;  1F4K A;  2EPF A;  5KCM A;  1W4M A;  2JUG A;  2R7S A;  1I1S A;  2BOL A;  3LST A;  3HPH A;  4MEX F;  1AA7 A;  2UXX A;  3QWL A;  4WWC A;  2E35 A;  2X85 A;  3J80 Z;  1A35 A;  3C2B A;  2M8E A;  3DF8 A;  4RGS A;  2BBY A;  3WE3 A;  5EEG A;  1GXP A;  3E0J B;  4NBQ A;  5E3N A;  3OYG A;  2K3F A;  3C2H A;  3TO9 A;  1ZGA A;  3OYL A;  4EQQ A;  1HBX G;  4UVB A;  4UXN A;  4LIV A;  5AIP A;  1NH3 A;  2X51 A;  4XRS G;  1FX7 A;  3Q0V A;  4ESB A;  1OIS A;  2BYV E;  5HNH A;  2KIQ A;  3E5U A;  3BWG A;  3L09 A;  4IL6 C;  1SFK A;  2CQX A;  2K9S A;  1K6Y A;  4C3J J;  3E6C C;  1OKR A;  1PP7 U;  4NQW A;  4Q48 A;  5DDG A;  4J19 A;  4HF0 A;  4GO1 A;  3TOA A;  1FOK A;  3WHB A;  3HOZ J;  1QRY A;  3S3O A;  1FBU A;  1FPQ A;  1XMX A;  3OYM A;  1LUJ B;  3ZQI A;  1O3Q A;  1FC3 A;  1A31 A;  1J5Y A;  3W3C A;  3KFW X;  1S3J A;  2UWM A;  2W84 A;  4KIS A;  2DO7 A;  2DT6 A;  5JI6 A;  3IH4 A;  3K2A A;  5LGT A;  4BE2 A;  2E2J J;  9ANT A;  1UEL B;  3MEX A;  1CF7 A;  4IOA F;  2VKD A;  2YPR A;  4IHS A;  1T95 A;  4G9Y A;  3T1B A;  1L3L A;  3HOS A;  1UHW A;  3KET A;  1ZG1 A;  1FOY A;  1WRJ A;  4Y3O A;  2DOA A;  3CJR B;  5K7F A;  4U87 A;  2MGQ A;  3G2B A;  2L0K A;  3PNY A;  4JQF A;  3P9K A;  4N9I A;  4P1W A;  4A3M J;  3VYT B;  1XCB A;  1X4O A;  3PSF A;  3RI4 A;  2NYX A;  1IXC A;  1XGS A;  4OAY A;  1HKT A;  3WTT C;  4F55 A;  2EQR A;  5M5X J;  2WA0 A;  4BQN A;  4OIR F;  1LQ1 A;  1ACI A;  4L18 B;  4M6Y A;  4ETS A;  2V1U A;  5KAF C;  1D5V A;  1G3Y A;  2AO9 A;  2VQL A;  3GFL A;  4NC6 A;  2Q2E B;  4XBF A;  1FSE A;  2DLL A;  1Z9C A;  1ZYR F;  2K27 A;  2KPM A;  1T08 B;  2ZXH A;  3GTP J;  1A5J A;  4BAC A;  1JHH A;  2Y0S A;  4G8X A;  3HKZ N;  1ZR2 A;  1F43 A;  2EA2 A;  1P92 A;  4E7S A;  4F92 B;  2R7T A;  5GP9 A;  3LFK A;  1R36 A;  1MMS A;  4HOB A;  3LSH A;  4I99 C;  4LIU A;  1OCO H;  1SFX A;  1IGN A;  2VC1 A;  4MIM A;  5GTH C;  3DWL E;  3RKX A;  3L2R A;  2FSW A;  2FX0 A;  4KMF A;  1ON2 A;  2MA3 A;  3JSP A;  3TW7 A;  2BW3 A;  2V6E A;  3J7A O;  1F5T A;  3BDD A;  4BQQ A;  2X4H A;  1HW5 A;  4XLP F;  1J2X A;  2DJN A;  4M3F A;  2HQA A;  1ZRC A;  5TIS C;  2GQQ A;  2KQR A;  3BZK A;  3RZD J;  1SVO A;  4PJJ A;  5B3S H;  2DA2 A;  2ZNZ A;  4F52 A;  2G7H A;  2VBY A;  3BG6 A;  2QA4 I;  2IGO A;  2CMP A;  2MW8 A;  1JTY A;  1P6R A;  3CLO A;  4V2G A;  1YW8 A;  4U7B A;  2XAH A;  3CCL I;  2CQQ A;  3R6S A;  4AID A;  3T8R A;  5IYC J;  5E1X A;  5F1R A;  1R7J A;  1B1B A;  4FTH A;  4D9J A;  5LBQ A;  2RNJ A;  1IN7 A;  1XN7 A;  1LEA A;  2KIS A;  1UJ8 A;  5EEH A;  4PJL A;  3TL4 X;  3ZGK A;  5GAE J;  4BEH B;  5K5Q A;  3L1P A;  1HST A;  2CUF A;  2WC2 A;  4CH7 A;  3R61 A;  2LY2 A;  1Z6R A;  2M8G X;  2VB6 A;  2NNN A;  2EH3 A;  1VQO I;  3ULQ B;  2L7F P;  3J7A Y;  4FX4 A;  1F9N A;  3I5U A;  4Y17 A;  2ZBK A;  4AD9 A;  1FEX A;  2ZJQ F;  1X19 A;  3D1N I;  3CDI A;  3CES A;  4WXD A;  4MTE A;  1D1B A;  4A69 C;  1T33 A;  1H9G A;  2H1L A;  5DM6 F;  2FQ4 A;  3EYI A;  4E7L A;  1QHG A;  1Z0X A;  3F21 A;  1BI0 A;  3G1L A;  3ABL H;  4PGH A;  4E6K G;  3Q9V A;  2DQR A;  4N4N B;  3IP4 B;  3C7J A;  2OA4 A;  2JA8 J;  4ZTJ A;  2G0E A;  3V8J A;  4U0Y A;  2AQE A;  2BE5 F;  3RCO A;  3DTI A;  4C9Y A;  4S0H B;  4CCO A;  2CQN A;  2CWE A;  2DK8 A;  1XPX A;  1K6O A;  3LSR A;  1G3S A;  4XN0 A;  2DBB A;  4M74 A;  4D1Q A;  2P5V A;  3OR2 C;  3JRD A;  4A3D J;  3DKX A;  4EAT A;  1DDN A;  1AWC A;  2OZU A;  3K69 A;  4BE0 A;  1TQI A;  4UUT A;  3F22 A;  2A6E F;  1MIJ A;  1MH3 A;  2FBK A;  1E0E A;  2D1H A;  3U1K A;  1S72 I;  3GF2 A;  3KP2 A;  4G6D A;  5M3F J;  2PJP A;  4G7Z F;  3K4K A;  2IS4 A;  4L9J A;  5IOZ A;  2ADU A;  2K3P A;  2Y2Z A;  5HLH A;  2ECC A;  2O61 A;  1FZP B;  3E6D A;  4XLN F;  4IJA A;  1D0Z A;  1X3Z B;  4CZC A;  3K4L A;  4K2E A;  2BVM A;  5J1U A;  2A5Y B;  2K4J A;  2LF8 A;  3KYL A;  1IXR C;  4IRH A;  2WTE A;  4CZZ A;  5DS9 A;  3BG7 A;  3K4B A;  3LL7 A;  3SFZ A;  2EFW A;  3GVA A;  4KJZ A;  2V9P A;  1FYM A;  2P4W A;  4M3G A;  4XOT A;  5L3G A;  2B0L A;  2EFN A;  5BNG A;  3PSI A;  4OIP F;  1W7P D;  1DGR M;  4AVP A;  4LMY A;  4PGG A;  2K85 A;  3K7A J;  4AYB A;  5ILU A;  1RPW A;  3HZJ A;  4IX7 A;  3O2P E;  2PBI A;  4M3B A;  2MAB A;  3SZP A;  5M3M J;  1QPM A;  3KEY A;  3QYB A;  3HHG A;  2LBF B;  3O3K A;  3DPU A;  2DPU A;  4NC7 A;  3GW2 A;  4IRG A;  4LB6 B;  1TQM A;  1IDZ A;  1K61 A;  2K9M A;  2WAF A;  4TV7 A;  5EG0 B;  2LKS A;  5DCF A;  3GBG A;  3K4M A;  1ETX A;  1VQ9 I;  3SXY A;  2JJ7 A;  1OCC H;  2DU9 A;  1JTX A;  2YS9 A;  3ABK H;  1WJC A;  3S15 J;  1Z67 A;  1HF0 A;  3F6V A;  1HDP A;  1I27 A;  4XRM A;  4ITV A;  3G73 A;  3BLY A;  1JJ6 C;  2HXI A;  3KLO A;  4G12 A;  4RS8 A;  2RNG A;  1YS6 A;  3BY6 A;  1QZY A;  3ZPL A;  1IC8 A;  2JRM A;  1LVA A;  2FD5 A;  1KQ9 A;  1BJA A;  1PUF B;  2PLY A;  3B02 A;  2DA4 A;  2V9V A;  1YLF A;  1SMT A;  1X1B A;  4RAF A;  2JQ7 A;  1DQU A;  1R5H A;  3CCE I;  5L3D A;  3S17 J;  2HPM A;  3K2Z A;  4HDU A;  3GZ5 A;  2AXL A;  2LY1 A;  2HFH A;  1Y1V J;  2DFE A;  2P8T A;  4ZZL A;  3FMS A;  4YG2 F;  1OCT C;  4BXX J;  2MBF A;  1R9T J;  2GWR A;  2X6O A;  3GME A;  3KYD B;  3LSK A;  4RLF A;  1ZG5 A;  2EZL A;  1JXS A;  2K02 A;  4RDU A;  3HSR A;  3D5L A;  1MBG A;  4CCJ A;  4HDV A;  1MSE C;  1O3S A;  4F7Z A;  3EUH C;  2MC3 A;  5E18 F;  2Y9Y A;  2HQR A;  1ORK A;  3JAM K;  2ME0 A;  4XK4 A;  1IV8 A;  3OR1 C;  2ZXI A;  1EF4 A;  4B1R A;  3JRG A;  3Q0U A;  2E2I J;  4RMN A;  3QRF F;  2M7B A;  4BS9 A;  2XAJ A;  5FKO A;  1BL0 A;  1V5E A;  5KVR A;  3HRT A;  2PN6 A;  2KRH A;  4HLX A;  1RC9 A;  3KYC B;  1Z1D A;  3HTU A;  3BR6 A;  3CCV I;  3R60 A;  3A0H C;  1SFU A;  1WZ2 A;  4YFN F;  4L5E A;  3OWT A;  3S2H J;  3LWF A;  4M9Z A;  3GXO A;  3HDD A;  5F0H A;  1C0W A;  1WQ2 A;  2DOF A;  2K4B A;  2H8R A;  2QBY A;  1V4R A;  4EGZ A;  3CDL A;  4II2 A;  4CXF A;  4I2O A;  1MBJ A;  1ZGJ A;  4PFO A;  2F4M B;  1BIB A;  5JLW A;  4L9T A;  1ERD A;  4XSX F;  2HVS A;  1UCR A;  4MLO A;  2IBD A;  2V26 A;  2UZK A;  4M6X A;  3VYS B;  3BCB A;  4BKX A;  2Q0O A;  4ENJ A;  3CF2 A;  4D5C A;  4HYE A;  4WCG A;  4BY7 J;  5J40 A;  5GPC A;  5M5Y J;  5E3O A;  3WTU C;  4UVA A;  3BPX A;  1X1A A;  3CMY A;  3T0Y A;  4QTR A;  4L9N A;  3IAS 2;  1LFB A;  2A5W A;  2E1O A;  4C2T A;  1BR4 A;  3ROU A;  1YO5 C;  1QGP A;  3Q0W A;  1FNN A;  4HF1 A;  3QPS A;  1ETK A;  3AG3 H;  1YX5 A;  2F6C A;  1LE8 A;  3LA2 A;  3MZY A;  5JHU A;  4HNU A;  5HLG A;  3ZQH A;  4IQJ A;  3KPH A;  2V6C A;  1R4N B;  4JX5 A;  4BXU A;  4XMY A;  3OYE A;  1RUO A;  5FFX A;  5LHI A;  1H8A C;  3EYY A;  4BJT A;  2EV6 A;  1MJA A;  4PK4 A;  2DI3 A;  2JMW A;  1B8I B;  1K79 A;  4U7D A;  1N77 A;  1QVT A;  4WXC A;  4QPO A;  2GAU A;  3HOW J;  3ABT A;  2HR3 A;  2E5Z A;  1XDS A;  5LD2 C;  3C3W A;  5EZH A;  4H0E A;  1W5C C;  2CW8 A;  4M71 A;  1NG7 A;  4UUV A;  2FE3 A;  3DU5 A;  4HBL A;  4WK8 F;  1S9H A;  4M3E A;  1R6R A;  4XSZ F;  5F08 A;  5GTI C;  1Z6T A;  2XF7 A;  2QYO A;  2YU3 A;  3CZ6 A;  4KFC A;  2DJI A;  2BY0 A;  2CFO A;  2H27 A;  2FRH A;  3EDP A;  3JRC A;  3GFI A;  3BR5 A;  5C44 J;  2CJJ A;  3RPU A;  2H6B A;  3FBN B;  1O3R A;  3NAR A;  3VYU B;  2W25 A;  2IEK A;  3HPG A;  2XRO A;  1TBX A;  1UHM A;  5CQG A;  3OOU A;  1QA6 A;  2BEO A;  4JX4 A;  3I54 A;  5ICC A;  1HQC A;  1SAU A;  1O4X A; 
#chains in the Genus database with same CATH homology
 2A3S A;  2FBH A;  5L3B A;  5JFR A;  2H6C A;  4I0B A;  2DK5 A;  2MH2 A;  3F23 A;  3ML6 A;  5D5V B;  4KUM A;  2GA2 A;  2VOP A;  1BI1 A;  4ZYD A;  3CO7 C;  4JBA A;  3TQN A;  3CJN A;  5ILV A;  1CF7 B;  2M1B A;  1IN8 A;  2EFP A;  3V7R A;  1RI7 A;  5D4S A;  3WGI A;  3FWE A;  3KZY A;  2VON A;  3FM3 A;  3CTA A;  2KIF A;  5E20 A;  2F5F A;  1H0M A;  1BC7 C;  1I6X A;  1LDD A;  2RQP A;  1FSH A;  3P7N A;  3U1D A;  2HDC A;  2L4A A;  4WF2 A;  1XCV A;  4EV0 A;  1FP1 D;  1FP2 A;  5BOX A;  1EV7 A;  1LDK B;  1WI9 A;  4A6E A;  4MQ9 F;  4BHP A;  2VBW A;  1B9M A;  1LNW A;  4HAM A;  3FXR A;  4KIB A;  4GYI A;  4IPA A;  2F5D A;  4P55 A;  3F3X A;  1TW2 A;  5H20 A;  4MTD A;  5D5W B;  1R00 A;  3GZ6 A;  3F72 A;  3ZP5 A;  1IN5 A;  1YFH A;  5BPI A;  3L00 A;  3TDZ C;  3ZQ7 A;  3S2W A;  1WWX A;  1D3Y A;  4I01 A;  3IKV A;  5IT9 K;  4IF4 A;  2VC0 A;  5HS8 A;  2E1C A;  1FT9 A;  3E6M A;  1MZB A;  2PMH A;  2Q8K A;  2OZ6 A;  2M5W A;  3ZN1 A;  5J6X A;  3K1P A;  2QZ8 A;  1IUY A;  3KP7 A;  3HRS A;  1OYI A;  4ESJ A;  2KRF A;  5LRS A;  2FMY A;  2F2E A;  5K1Y A;  3DPT A;  1ODD A;  1HKS A;  2QQB A;  3GFM A;  4KIC A;  3LAJ A;  1X3U A;  1AOY A;  2L4M A;  2ZJ2 A;  5JR3 A;  1YTY A;  1T98 A;  3JAM Z;  5DEQ A;  4EVI A;  4YFK F;  1S29 A;  1PUE E;  3ECH A;  3GEZ A;  2E7W A;  3IRR A;  2VE8 A;  4G7H F;  1WSU A;  4LB5 A;  3CUO A;  2WWY A;  3KP6 A;  4RGU A;  5LEJ A;  4A0X A;  5D6F A;  2J5O A;  4M9X A;  4LK0 F;  2C6Y A;  1MKM A;  3DV8 A;  4P9F A;  3KEO A;  1V3F A;  2ZXJ A;  2HQN A;  1U5T C;  2E1N A;  3F8F A;  1EH6 A;  4U88 A;  1XSX A;  1K78 A;  1BM9 A;  3MCZ A;  4GYG A;  3FXQ A;  3L9F A;  3ZMD A;  2RDP A;  3SQN A;  4YII A;  1REP C;  2IA0 A;  1ZLJ A;  2FU4 A;  3BZ6 A;  3KP4 A;  3R0J A;  2W85 A;  3WU0 A;  2D45 A;  4FX0 A;  4D0P A;  1R1T A;  3LQR A;  3H92 A;  1O7L A;  3HRU A;  1S7A A;  3ELK A;  5L3E A;  3JTH A;  4A5M A;  2L01 A;  1KGS A;  1RNL A;  3FM5 A;  2PFB A;  2GXG A;  2JPC A;  4ZH4 F;  2IW5 A;  5LEK A;  2HKX A;  3T5X A;  1TNT A;  3BP8 A;  2FOK A;  2ZKZ A;  2LKP A;  3GO5 A;  2HTS A;  2RVC A;  2GIV A;  2CSO A;  4UNO A;  3AAF A;  2QBY B;  4R1H A;  4HV5 A;  5LGN A;  2FXA A;  1GHC A;  4HZF A;  4LGW A;  3I59 A;  3IC7 A;  4LG0 A;  3LAP A;  1KU9 A;  1U2W A;  3F8B A;  3PQJ A;  3P9C A;  4L5I A;  4N0B A;  5J8F A;  3I4P A;  2STW A;  1IZ1 A;  3NQO A;  1QNT A;  1I5Z A;  4KDP A;  5DD4 A;  4OIO F;  3C18 A;  5FD6 A;  3TOB A;  3WTV C;  2NAZ A;  1IRG A;  2IVM A;  1JE8 A;  4PCQ A;  1IF1 A;  1B9N A;  5BS6 A;  2DW4 A;  1Z05 A;  3VFZ A;  5TRD A;  4DQ2 A;  5E8I A;  3FMR A;  4OOI A;  5K5O A;  4BNC A;  1H9T A;  5FO5 A;  1ZH5 A;  1YW9 A;  5HDG A;  1OYW A;  1T6S A;  3V7S A;  4LLG F;  1TQP A;  2OQR A;  5CVJ A;  5LGU A;  1JGS A;  3CDH A;  4G6Q A;  1T2K A;  2FML A;  5E1Z B;  2X0L A;  2HKO A;  3RDI A;  3ZMU A;  2F5C A;  3BRO A;  2GA1 A;  2XKO A;  2Q2E A;  2XV4 S;  4AIK A;  4EMS A;  2QQA A;  2P7C B;  1HXD A;  3M8E A;  5D8L B;  2EK5 A;  1J0R A;  3KZZ A;  1HSJ A;  4IHT A;  3E97 A;  3TDU C;  1G6N A;  2EWN A;  5H6Q A;  1DP7 P;  3WOD F;  3WGH A;  2M30 A;  4HX4 A;  1U5T A;  4KMU X;  1JHF A;  4CHU A;  1UB9 A;  4GCV A;  2ZCW A;  4CYD A;  4HA8 A;  2TDX A;  4BQA A;  3LA7 A;  4NB5 A;  3KLN A;  1ZRD A;  1T39 A;  3IWZ A;  3DPL C;  1BBY A;  2XRN A;  4P5O A;  5D8K B;  1GVJ A;  2EV5 A;  4A2U A;  3ISP A;  4QLC U;  4OIN F;  2QM3 A;  3BJA A;  1NHA A;  4L5J A;  3OOP A;  4EJV A;  1KQ0 A;  3DKW A;  2HEO A;  5HS7 A;  1S6L A;  5IT9 Z;  1BI2 A;  3WTY C;  2VE9 A;  5BPD A;  2LF7 A;  3WTZ A;  2VN2 A;  5CVV A;  3H3U A;  5DUI A;  5DCM A;  2XAQ A;  3KP3 A;  1OR7 A;  4Q47 A;  4EJO A;  5IT3 A;  1W5T A;  2EFO A;  3G3Z A;  4NHJ A;  1UST A;  3W6J B;  2ZME A;  4RGX A;  4OU0 A;  3J81 K;  2EJR A;  5CVU A;  5FD5 A;  2P5K A;  4UVC A;  1ON1 A;  1B6A A;  4LFU A;  4ON0 A;  1B4A A;  3ZMZ A;  1SD7 A;  4A0Z A;  4AIH A;  3M9A A;  3RYP A;  2D1V A;  3H3Z A;  1ZLK A;  3GFJ A;  4HQM A;  3R4K A;  1USS A;  2W24 A;  1MJB A;  1R22 A;  3ABU A;  1W7P B;  5LRR A;  1FYK A;  3E3V A;  4A12 A;  1SD4 A;  3F8N A;  3ZMS A;  1FLI A;  3QOP A;  4M72 A;  2CFX A;  1LB2 A;  3NEU A;  2L3D A;  1R58 A;  1U3E M;  1PDN C;  3N4M A;  2VXZ A;  5L3F A;  3SHF A;  3B73 A;  1XSD A;  2K86 A;  5KK1 A;  3DQV C;  2JPB A;  4YIF A;  5HDK A;  2LDU A;  2AS5 F;  3DP7 A;  2QEN A;  1XGO A;  4OMZ A;  3U9G A;  3R0A A;  4S05 A;  5D4R A;  2Z5U A;  4ZYE A;  5DUK A;  2V1D A;  3W6K B;  4R79 A;  3RYR A;  4GGG A;  2GZW A;  1EH7 A;  1J9I A;  2YX7 A;  4LJZ F;  3HOT A;  2H09 A;  2Z33 A;  4EJU A;  2ETH A;  3VOE A;  2J5P A;  4ENK A;  3MAJ A;  2RKH A;  1YW7 A;  2ISZ A;  5E17 F;  2PQ8 A;  3WTS C;  5ICE A;  1B59 A;  1WKM A;  2RC4 A;  1FWZ A;  2P6T A;  1S8N A;  1RUN A;  3OV8 A;  1Z91 A;  2HYF A;  1W5S A;  1FYL A;  4LK1 F;  4AIJ A;  1G3T A;  1U6G A;  4AWX B;  4Z2Y A;  1ZG3 A;  1IRF A;  1KA8 A;  1QZZ A;  4KN7 X;  3BPV A;  4GXO A;  5FLX K;  2IA2 A;  2K7L A;  4UHT A;  4EJT A;  4LLN A;  2BGC A;  4RB0 A;  2JSC A;  2L54 A;  1D8J A;  1IN6 A;  5J8C A;  2A6H F;  2O0Y A;  4UV8 A;  3HTS B;  1P4A A;  3GLX A;  1QO0 D;  1BN5 A;  3CUQ C;  1U78 A;  3FF5 A;  3I53 A;  3QAH A;  3I0T A;  1D8K A;  1E2X A;  4PDK A;  4DNC A;  3E5Q A;  3QP5 A;  2Z99 A;  1K78 B;  2HOE A;  1HW2 A;  2Z3Y A;  2JTV A;  2RGV A;  2O03 A;  1KU7 A;  2IA1 A;  2ESN A;  4EM0 B;  3COA C;  2WV0 A;  2RV8 A;  4BYY A;  3FZV A;  2XVC A;  4KYW A;  2FF4 A;  3IL2 A;  5D5X B;  2Y48 A;  1SFE A;  3K1M A;  3MWM A;  3ECO A;  5E1W A;  3KP5 A;  2ESH A;  1J59 A;  3WTW C;  4BH9 A;  4HLY A;  2XHK A;  3GWZ A;  4KIF A;  5HS9 A;  3VOD A;  5F6F A;  3HRM A;  2VOO A;  1RZ4 A;  5DYM A;  2FNP A;  4MNU A;  2OD5 A;  4HQE A;  1OMI A;  3F8C A;  2PI0 A;  3HYI A;  2KIM A;  1XDU A;  2V79 A;  3VEP A;  3Q5F A;  3KEQ A;  3O6B B;  4IVN A;  1RIO H;  3F6O A;  5A2Q K;  3I58 A;  3I59 B;  4QWQ A;  4LG0 B;  2EA4 A;  4U0V A;  4A6D A;  5ERI A;  4WXH A;  2KKO A;  1EH8 A;  2A69 F;  2CQK A;  4A0Y A;  4JK1 X;  3ZMT A;  2ELH A;  2P6S A;  2DAO A;  4ENN A;  1SD6 A;  3N97 A;  4HW0 A;  4I7H A;  1O57 A;  2HZT A;  5LLQ A;  4Y13 A;  2ZFW A;  5DD8 A;  1BC8 C;  2YR2 A;  1ZHF A;  5HVQ C;  1XGN A;  4RB1 A;  2QVO A;  1MDM A;  3SZT A;  2QQ9 A;  4E70 A;  3QPH A;  1IN4 A;  4EM2 A;  5LHG A;  2F5E A;  1KU3 A;  4M73 A;  4CDG A;  3DFG A;  4A5N A;  4ZYG A;  1XD7 A;  1XSV A;  3TO7 A;  3IKT A;  4N9H A;  3J81 Z;  3E5X A;  4IRI A;  5ICF A;  5H6R A;  1ZRF A;  4ENM A;  3M1E A;  5AON A;  4Q4Z F;  2HWV A;  4FT8 A;  3IRQ A;  4BAY A;  2XAF A;  3CUQ A;  4RB3 C;  3NRV A;  1U5T B;  1MJ9 A;  3GUD A;  1VTN C;  2CO5 A;  3WTX C;  3M7G A;  3PQK A;  1I1G A;  5CVR A;  2XUB A;  4O5V A;  2CYY A;  5HLI A;  4EGY A;  4PZJ A;  2FBI A;  1S7O A;  2EV0 A;  1SMY F;  1T0F A;  2DT5 A;  1TW3 A;  3QU6 A;  4I09 A;  4O6J A;  1FY7 A;  3QP6 A;  5D6E A;  1ZRE A;  1U8R A;  1ZAR A;  5ICG A;  2W57 A;  5DCM B;  2BV6 A;  1J7K A;  2YSR A;  3HUG A;  2XAS A;  2M45 A;  1BI3 A;  5CLS A;  3WE2 A;  2HS5 A;  4ESF A;  3JTG A;  3I64 A;  2ZME B;  3CO6 C;  1P4W A;  1Y0U A;  3MZH A;  3K1N A;  3P9I A;  1DPR A;  1GXQ A;  1HW1 A;  3HIF A;  4KA4 A;  2OAZ A;  2VBX A;  4L0Y B;  2NS0 A;  5CYV A;  4MHG A;  2A61 A;  1A04 A;  2M87 A;  3WGG A;  3ZN0 A;  4RGR A;  3ERE D;  2DTR A;  4ZYH A;  2EFQ A;  4I02 A;  2NNY A;  2Y0M A;  4WX9 A;  2DQL A;  5FFZ A;  5FLX Z;  2R7F A;  3I71 A;  2CW0 F;  2OQG A;  2CGP A;  1R23 A;  2IT0 A;  2OBP A;  3F8M A;  1E17 A;  2O8X A;  4OMY A;  1OPC A;  5L3C A;  2XKP A;  2MLK A;  1Z7U A;  2FEZ A;  4HV6 A;  3RTR A;  3REO A;  1P4X A;  3K0L A;  2IJL A;  4O3M A;  1R5G A;  3VB2 A;  3M8F A;  1YQA A;  4CO8 A;  1F1Z A;  2CG4 A;  1LJ9 A;  5BMZ A;  3J80 K;  3FMQ A;  5TJJ A;  4BHB A;  3GYH X;  2XAG A;  3EET A;  2JRT A;  1QQI A;  4P9U A;  4S04 A;  2A68 F;  4FHT A;  1IAW A;  4IXA A;  1G3W A;  3TO6 A;  4MQV A;  4M9S A;  3LA3 A;  1XMK A;  4KN4 X;  1BOA A;  3RKW A;  4UV9 A;  3JSO A;  1LDJ A;  4U0W A;  2VBZ A;  2FNA A;  1Q1H A;  2XGX A;  2NRA C;  1KYW A;  1OYY A;  2ISY A;  5E8G A;  3EQL F;  4HF2 A;  2R7D A;  3RKY A;  4EJW A;  1FBS A;  2DPD A;  4CGZ A;  1IW7 F;  2STT A;  1J75 A;  3BJO A;  5HDN A;  1IXS B;  3RIR A;  5CVI A;  5F64 A;  1YG2 A;  4KIG A;  5ILS A;  2JZY A;  2R3S A;  3MQ0 A;  5A2Q Z;  2OU2 A;  5AIQ A;  3HSE A;  2VT2 A;  1K7A A;  3PFI A;  3V8K A;  5BQT A;  1YIO A;  2IRF G;  1YS7 A;  1XMA A;  2HGC A;  2A07 F;  4HX8 A;  4OIQ F;  3GX4 X;  1FBQ A;  6PAX A;  2PMU A;  3K9T A;  4RB2 C;  2YX4 A;  2QUF A;  1KYZ A;  4MEY F;  1T38 A;  2IP2 A;  2PG4 A;  5CJ9 A;  1L0O C;  5JVT A;  4ASN A;  2PEX A;  4R8H A;  2P7V B;  5DV5 A;  4Y15 A;  1HKQ A;  1ONV A;  2LSO A;  3HSF A;  2COM A;  3BOQ A;  2VT3 A;  1MD0 A;  3KE2 A;  4P96 A;  4BHC A;  3KCC A;  2KIU A;  4RAY A;  4CIC A;  3ZMV A;  3FXU A;  3DXJ F;  2FA5 A;  3C1D A;  2IPQ X;  2GXB A;  2P5L C;  1P2F A;  4LD5 A;  1STZ A;  2XIG A;  4Q5S F;  2MLG A;  1R1V A;  3L2C A;  1KQ8 A;  3D0S A;  2G7U A;  1ZAO A;  5D5U B;  2QLZ A;  3E6B A;  3L7W A;  2O3F A;  4L0Z B;  5LHH A;  3WG9 A;  1QBJ A;  3V8L A;  2L02 A;  2MH9 A;  5ED4 A;  2G9W A;  2RN7 A;  3LQQ A;  4YFX F;  2H94 A;  3QU3 A;  1R1U A;  2VOD A;  5HOO A;  1XGM A;  1SD5 A;  2ACJ A;  3IHU A;  1O3T A;  2Z9O A;  1PP8 F;  1TLH B;  2KJB A;  3DEU A;  1MDM B;  3V7C A;  3RJP A;  1UFM A;  4KT5 C;  5K5R A;  4KNY A;  3MFK A;  2MD5 A;  3JW4 A;  4RAZ A;  3U2R A;  3IWF A;  2EB7 A;  2LNB A;  1G4D A;  3TKY A;  2V1X A;  4LLL A;  5FGM A;  2UXN A;  3T8T A;  3FX3 A;  2Y75 A;  2HTJ A;  2DFI A;  2E7X A;  3EUH A;  2O6G E;  1BIA A;  1MGT A;  4XRF A;  2HYG D;  1SAX A;  4B09 A;  4G7O F;  1ULY A;  4HX7 A;  1XB4 A;  1TTY A;  3V4G A;  3CUQ B;  3BJ6 A;  2D2W A;  3WU1 B;  3Q9S A;  1O7F A;  2FQ3 A;  4L9V A;  1YYV A;  3TGN A;  4G94 A;  3RPQ A;  2QWW A;  1DUX C;  1DPU A;  2JT1 A;  3HHH A;  5FB2 A;  1W7P A;  2ZNY A;  4ZZD A;  1CGP A;  4EM1 A;  1LEB A;  1ZN2 A;  1KU2 A;  4I98 B;  2ZO4 A;  3FHZ A;  1TNS A;  2KJC A;  4I0A A;  4B8X A;  4MGR A;  3QPT A;  1F4K A;  1W4M A;  1I1S A;  3LST A;  4MEX F;  2UXX A;  4WWC A;  3J80 Z;  3DF8 A;  2M8E A;  4RGS A;  2BBY A;  3WE3 A;  5EEG A;  1GXP A;  3TO9 A;  1ZGA A;  4EQQ A;  1HBX G;  4UVB A;  4UXN A;  5AIP A;  1FX7 A;  4ESB A;  2BYV E;  3E5U A;  3BWG A;  3L09 A;  3E6C C;  1OKR A;  1PP7 U;  4NQW A;  4Q48 A;  5DDG A;  4HF0 A;  4GO1 A;  3TOA A;  1FOK A;  1FBU A;  1FPQ A;  1O3Q A;  1FC3 A;  1J5Y A;  3KFW X;  1S3J A;  2UWM A;  2W84 A;  2DO7 A;  5JI6 A;  5LGT A;  1CF7 A;  3MEX A;  2YPR A;  4IHS A;  4G9Y A;  3T1B A;  1L3L A;  3HOS A;  1UHW A;  3KET A;  1ZG1 A;  1WRJ A;  4JQF A;  3P9K A;  4N9I A;  1XCB A;  3RI4 A;  2NYX A;  1IXC A;  1XGS A;  1HKT A;  3WTT C;  4OIR F;  1LQ1 A;  4L18 B;  4M6Y A;  4ETS A;  2V1U A;  1D5V A;  1G3Y A;  3GFL A;  1Z9C A;  4XBF A;  1FSE A;  2DLL A;  1ZYR F;  2K27 A;  1JHH A;  4G8X A;  2EA2 A;  1P92 A;  3LFK A;  1R36 A;  4HOB A;  1SFX A;  2VC1 A;  3RKX A;  2FSW A;  4KMF A;  1ON2 A;  2MA3 A;  3JSP A;  3J7A O;  1F5T A;  3BDD A;  2X4H A;  1HW5 A;  4XLP F;  1J2X A;  1ZRC A;  2GQQ A;  2ZNZ A;  2G7H A;  2VBY A;  3CLO A;  1P6R A;  1YW8 A;  4U7B A;  2XAH A;  3R6S A;  3T8R A;  5E1X A;  5F1R A;  1R7J A;  1B1B A;  5LBQ A;  2RNJ A;  1IN7 A;  1XN7 A;  1LEA A;  5EEH A;  5K5Q A;  1HST A;  2WC2 A;  3R61 A;  1Z6R A;  2NNN A;  3ULQ B;  4FX4 A;  1F9N A;  3I5U A;  4Y17 A;  2ZBK A;  4AD9 A;  4WXD A;  4MTE A;  1H9G A;  3EYI A;  3F21 A;  1BI0 A;  4PGH A;  3Q9V A;  2DQR A;  3C7J A;  2OA4 A;  3V8J A;  4U0Y A;  2BE5 F;  2CWE A;  2DK8 A;  1K6O A;  1G3S A;  2DBB A;  4M74 A;  2P5V A;  1DDN A;  1AWC A;  2OZU A;  3K69 A;  1TQI A;  3F22 A;  2A6E F;  2FBK A;  2D1H A;  3GF2 A;  3KP2 A;  4G6D A;  2PJP A;  4G7Z F;  4L9J A;  2ADU A;  5HLH A;  2O61 A;  1FZP B;  3E6D A;  4XLN F;  4IJA A;  4K2E A;  2A5Y B;  2K4J A;  2LF8 A;  1IXR C;  4IRH A;  2WTE A;  4CZZ A;  2EFW A;  3SFZ A;  3GVA A;  1FYM A;  2P4W A;  5L3G A;  2B0L A;  2EFN A;  4OIP F;  1W7P D;  4AVP A;  4LMY A;  4PGG A;  5ILU A;  3O2P E;  2PBI A;  3SZP A;  1QPM A;  3HHG A;  3O3K A;  2DPU A;  3GW2 A;  4IRG A;  4LB6 B;  1TQM A;  4TV7 A;  5DCF A;  3SXY A;  2DU9 A;  3F6V A;  1I27 A;  3G73 A;  3KLO A;  4RS8 A;  1YS6 A;  3BY6 A;  1QZY A;  3ZPL A;  1LVA A;  1KQ9 A;  1BJA A;  2PLY A;  3B02 A;  2V9V A;  1YLF A;  1SMT A;  1R5H A;  5L3D A;  3K2Z A;  4HDU A;  3GZ5 A;  2AXL A;  2HFH A;  2P8T A;  4ZZL A;  3FMS A;  4YG2 F;  2MBF A;  2GWR A;  1ZG5 A;  1JXS A;  2K02 A;  3HSR A;  3D5L A;  4HDV A;  1O3S A;  4F7Z A;  5E18 F;  2MC3 A;  2HQR A;  3JAM K;  3QRF F;  2XAJ A;  5KVR A;  3HRT A;  2PN6 A;  4HLX A;  1Z1D A;  3HTU A;  3R60 A;  1SFU A;  4YFN F;  3LWF A;  4M9Z A;  3GXO A;  1C0W A;  1WQ2 A;  2K4B A;  2QBY A;  1V4R A;  4EGZ A;  4CXF A;  4I2O A;  1ZGJ A;  1BIB A;  4L9T A;  4XSX F;  1UCR A;  2UZK A;  4M6X A;  4ENJ A;  2Q0O A;  4HYE A;  4WCG A;  3WTU C;  4UVA A;  3BPX A;  3T0Y A;  4L9N A;  3ROU A;  1YO5 C;  1QGP A;  4HF1 A;  1FNN A;  3LA2 A;  3MZY A;  5JHU A;  5HLG A;  2V6C A;  4BXU A;  1RUO A;  5FFX A;  5LHI A;  3EYY A;  2EV6 A;  1MJA A;  2DI3 A;  1K79 A;  4U7D A;  4WXC A;  2GAU A;  3ABT A;  2HR3 A;  1XDS A;  3C3W A;  4H0E A;  4M71 A;  4UUV A;  2FE3 A;  4HBL A;  4WK8 F;  4XSZ F;  1Z6T A;  2QYO A;  2YU3 A;  4KFC A;  2H27 A;  2FRH A;  3EDP A;  3GFI A;  3RPU A;  2H6B A;  1O3R A;  2W25 A;  2XRO A;  1TBX A;  1UHM A;  2BEO A;  3I54 A;  5ICC A;  1HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...