5E1WA

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the ligand free form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLKKHMVRIKLSEKAIDTFYQALEISNRVYKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides sp. cbdb1
molecule tags Transcription
total genus 60
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e1wA00
1P2FA 2HKXA 4WXDA 1E17A 4LG0A 2F5FA 1O3SA 3ZMTA 5CYVA 3BPXA 3U2RA 1Z6TA 4KN7X 4M9XA 1SMYF 4XSXF 2Z99A 1ZAOA 4HF1A 4HYEA 4KT5C 3HYIA 3ABTA 4NB5A 1RUNA 1FBSA 4P55A 3COAC 1FYLA 1SD5A 4G7ZF 4RS8A 1SFEA 4B8XA 4M6XA 4KICA 4WCGA 1F4KA 2JRTA 3W6JB 5DUIA 2PQ8A 5L3FA 2A6HF 3I71A 5FD5A 4ENKA 2JPBA 3WTVC 3LQQA 4R8HA 3RPQA 1IRGA 3M9AA 3F3XA 1G6NA 4KYWA 2ZO4A 2BEOA 1BOAA 3R6SA 1O3TA 1YTYA 1YIOA 1U5TC 1SAXA 3DFGA 2Y48A 3QP5A 1QNTA 3MAJA 2M45A 2VXZA 2J5OA 3KP6A 3EUHA 3V8LA 3GEZA 2PI0A 3J81K 1OYWA 1WRJA 1Y0UA 1FWZA 2DW4A 2GWRA 3RTRA 5HDNA 2FNPA 4HDUA 4LFUA 4DNCA 3IRRA 4ESBA 1I6XA 1O7FA 4HBLA 3WTUC 5LBQA 3RKWA 4CZZA 1S3JA 2KIMA 3I59A 5ILSA 2MA3A 3WE2A 1DPRA 5E1ZB 1U8RA 2XASA 5ERIA 2O61A 1R23A 3HIFA 5E1WA 2FMYA 4EM1A 4MEXF 4UVBA 3HOSA 2IVMA 2VE9A 3QU3A 1ZRCA 3IC7A 2FA5A 3HUGA 3I54A 2QM3A 2QQ9A 2WV0A 2HKOA 1W7PA 5F1RA 1CGPA 2O3FA 1MDMB 3F6VA 3I0TA 1ZYRF 2P4WA 1KU9A 3BWGA 2NNYA 3BJ6A 1W4MA 2XKPA 1B9MA 1IN7A 2WWYA 3CUQC 2L4AA 1H0MA 4S04A 2MLKA 1FOKA 1QPMA 1ON2A 4KIFA 4O5VA 2IW5A 3SXYA 3ML6A 3RPUA 2YR2A 1PUEE 1J5YA 2EA2A 1OKRA 4RB2C 4OIRF 4N9IA 2O6GE 2HTJA 1UHWA 3HRTA 4ENNA 1UCRA 3WGGA 1TBXA 3CTAA 3ZMVA 4XSZF 3GYHX 3F23A 1XDUA 3HOTA 1S6LA 2O03A 1FC3A 4NHJA 1PP8F 3BY6A 1OR7A 3V7RA 1FYMA 4A6EA 2UWMA 2HWVA 2MH9A 1ZG1A 4KUMA 1IN8A 2FXAA 5DDGA 4U7DA 2H09A 1KYWA 4CDGA 1C0WA 2Y75A 4EJWA 3HTUA 1R58A 5BQTA 2V79A 1TNSA 1P92A 1BI2A 3V8KA 4U88A 4G7OF 1DDNA 4LD5A 3GUDA 3J80K 4L0ZB 3T5XA 4BHBA 3WTWC 3WU0A 1LDJA 3LA7A 3L00A 1JXSA 3L09A 4HOBA 2A61A 3P9IA 4U0WA 4MEYF 1BC8C 5D5WB 2FBHA 4MQVA 3GF2A 5IT9Z 1Z7UA 5JI6A 3C1DA 3I5UA 3KETA 1W7PD 5E1XA 1XSXA 3K0LA 1U78A 4H0EA 1D3YA 1W5SA 2BV6A 3TGNA 3ZP5A 2A07F 2IRFG 4RAYA 2VOPA 4UV8A 1B1BA 4EM2A 1OYIA 5DUKA 2K4BA 2PN6A 4AIHA 3DEUA 3J80Z 3K69A 4GXOA 2NAZA 3MZYA 5HLIA 3QU6A 2VN2A 1L3LA 3JAMZ 4Z2YA 5K1YA 2EFPA 4GCVA 4ON0A 5F64A 2DK5A 3ZMDA 3R4KA 4L18B 2XKOA 2XGXA 2X0LA 4U0YA 4JQFA 4DQ2A 4M9SA 4A5MA 5ED4A 2NYXA 2FRHA 4UXNA 4XLPF 4CGZA 4JK1X 1QZZA 2FNAA 3F72A 2D1VA 4LG0B 2L01A 3FXRA 1BN5A 2W25A 4EMSA 4M6YA 3B02A 2XROA 4QLCU 1CF7A 1ZGJA 1UHMA 4HF2A 4KMFA 4YIFA 1SMTA 3GFIA 2F5DA 4A5NA 2RC4A 5K5QA 4WWCA 1A04A 4RGUA 1FT9A 1F1ZA 5CVRA 1ZARA 4BHCA 3EQLF 2CGPA 1ZRDA 4HF0A 5H6RA 4CXFA 4I01A 1GVJA 2ELHA 2IPQX 5AONA 4XBFA 5FB2A 5J8CA 1XGOA 2W24A 2XHKA 4OMZA 3BZ6A 2H27A 2K86A 2M87A 1HW5A 2ZCWA 1MGTA 2Q8KA 1USTA 4R1HA 2QQBA 1G3SA 2BYVE 4RAZA 5CVVA 5LHGA 3FHZA 2XAQA 4OU0A 4EM0B 2ZBKA 4R79A 3GZ6A 1R7JA 3ZPLA 3TO7A 2V9VA 4OIOF 4RB0A 4GO1A 2DTRA 2HFHA 5TRDA 4NQWA 5HVQC 1OMIA 3KCCA 1STZA 5D5XB 2M1BA 1ODDA 4L5JA 4N9HA 4HQMA 2V1XA 5D8KB 3WTYC 5H6QA 2YX4A 4KMUX 4LB5A 3GO5A 3LAJA 3KLOA 1S8NA 2ISYA 2LKPA 2W85A 3C7JA 5BPDA 3DP7A 2HZTA 3MEXA 2E1NA 4WF2A 3KEOA 4UV9A 3VODA 1SFUA 1T0FA 1B59A 2NNNA 4ASNA 1J9IA 2QBYA 1TNTA 2MBFA 4Y17A 5JVTA 1ULYA 1W7PB 2QENA 3CUOA 3Q5FA 2UZKA 5LGTA 3O6BB 3ZMUA 2XAGA 1U6GA 1R5GA 3AAFA 1YW7A 3KP7A 2PMUA 1BI1A 4A0YA 2ESHA 2UXNA 2ESNA 2DU9A 1XGMA 5HLGA 5D4RA 3TOAA 1ON1A 1DUXC 2A3SA 4KDPA 4AVPA 2IP2A 1WSUA 5D5UB 1RI7A 4ZH4F 4A2UA 4IPAA 1S7AA 5ICCA 1DPUA 1KQ8A 3H92A 1FZPB 1TW3A 3P9KA 3D5LA 2CW0F 1HKSA 2M30A 5LHHA 2O0YA 2PBIA 3K1PA 4O6JA 1I1GA 5DYMA 2VT2A 2W84A 3N4MA 1YW9A 4M73A 1BIAA 1FSEA 1Z05A 3FM3A 1JGSA 2B0LA 3ERED 1K78A 1FNNA 2D1HA 4AIJA 2CYYA 5DCMA 2MD5A 1RZ4A 2IA1A 3ROUA 5FD6A 1UB9A 5KK1A 5LGNA 2GIVA 4L5IA 1T38A 3O3KA 3KP4A 5LEKA 3E6BA 3KZZA 2DPUA 4KA4A 5E8IA 2PFBA 3QP6A 1LNWA 1H9TA 2V1DA 1IXCA 2AXLA 3G3ZA 2XVCA 3E5XA 2CWEA 2VONA 2YU3A 5K5OA 2W57A 5L3CA 5K5RA 5ICFA 1LDKB 2HOEA 1U5TA 1J2XA 3I58A 1H9GA 3CO6C 5E8GA 5HOOA 3HSFA 2A68F 4IRIA 1QZYA 1JHFA 4MHGA 5L3DA 1IN6A 2AS5F 1LEBA 3DKWA 4A12A 3WG9A 4A0ZA 2D45A 1AOYA 3V8JA 3FMRA 5D5VB 2WTEA 4HAMA 4PGGA 3J81Z 4GYGA 4EJOA 3O2PE 2UXXA 2HS5A 1X3UA 3F8FA 2M8EA 2L54A 5CJ9A 2XIGA 3PQJA 3IKVA 4UHTA 1REPC 1FBQA 3GFMA 3GW2A 2RVCA 5TJJA 5BS6A 2MLGA 4Q4ZF 1BBYA 2J5PA 1HKQA 1IUYA 2DT5A 5LLQA 2KRFA 4BHPA 2Z3YA 4FX0A 1CF7B 5L3EA 2E7XA 1YW8A 1LVAA 4D0PA 1O7LA 1XB4A 1FPQA 3P9CA 1ZH5A 2Q2EA 4I02A 2DI3A 3DQVC 2VBWA 4IRGA 3GFLA 3TO9A 2GXBA 5FLXK 2EV5A 4HX8A 5F6FA 2EV0A 4CO8A 4HV6A 2VE8A 5AIQA 3WTSC 4Q47A 3CUQA 3KP2A 1JHHA 1R1UA 2OQGA 2YSRA 1IN5A 1LEAA 2C6YA 1MKMA 4CYDA 2ZMEA 2STWA 3RDIA 3SHFA 3RKXA 4LLLA 3E3VA 4YFKF 4I09A 4ENJA 2CFXA 2BE5F 2BGCA 1LQ1A 2F5EA 2P5KA 2G7UA 1GHCA 2FSWA 4CICA 2FBIA 5JFRA 1USSA 4LK1F 3ZN1A 2ACJA 2XAHA 2Z33A 5D8LB 3F6OA 4HV5A 4P96A 2LNBA 1R5HA 4MQ9F 3WTZA 4MTDA 4QWQA 1XCBA 3FM5A 5DD8A 3MFKA 1BM9A 4PGHA 1K7AA 3G73A 3T8TA 2ISZA 1KQ9A 1QGPA 4HLXA 3JW4A 4WX9A 4AWXB 3F21A 3DPLC 4Y15A 3L7WA 2JZYA 3JTGA 2CO5A 1TQIA 1ZREA 3IHUA 3V7CA 2QBYB 3BROA 3K9TA 4RGXA 2JPCA 4G7HF 3J7AO 2JTVA 5AIPA 4PZJA 5L3BA 4O3MA 2IA0A 2Y0MA 3KLNA 3HHGA 4GGGA 4Y13A 4UNOA 2KJBA 5J8FA 1V4RA 4M72A 4A6DA 1HBXG 5D6EA 2L4MA 3F8MA 5L3GA 3ECOA 2HGCA 1YS7A 2QZ8A 2DBBA 1EH7A 2F5CA 4FT8A 2KKOA 3MZHA 4IRHA 5BOXA 2EFWA 4F7ZA 2HEOA 2FF4A 3E6DA 4LMYA 4YG2F 3WU1B 3DXJF 2OQRA 3LAPA 3HSEA 3T8RA 3H3UA 1XGSA 1S7OA 1WKMA 3IL2A 1MDMA 4OIQF 2V1UA 1FSHA 3E6CC 2CSOA 2PLYA 2HTSA 2IT0A 2CQKA 1RNLA 4EJTA 2ZNYA 4B09A 2QVOA 4CHUA 2GA1A 2XAFA 2FMLA 4I0BA 3LWFA 4I7HA 3T0YA 3E97A 4L0YB 1HKTA 3C3WA 1NHAA 3CO7C 4JBAA 4PDKA 4LLNA 2RV8A 3DPTA 3IWFA 3U9GA 3ULQB 5DCMB 4I2OA 1O57A 1HW1A 2VBYA 4ESFA 6PAXA 2PG4A 2EA4A 1IZ1A 4ETSA 3EETA 2GAUA 1ZN2A 3N97A 3LA2A 5HDKA 2EFNA 3Q9VA 4L9TA 3M1EA 3WGHA 2EWNA 4OINF 1IXSB 5CLSA 4WK8F 1J75A 5LRSA 4LK0F 1YFHA 2HQRA 1SFXA 1R00A 2R3SA 5JHUA 3BDDA 2FOKA 2HR3A 1RIOH 4AIKA 4YFNF 2K4JA 3DF8A 3W6KB 5DCFA 2QWWA 2HYFA 5E20A 3SFZA 5ILVA 3TDZC 3GVAA 4FHTA 2ZJ2A 3HSRA 2GQQA 4GYIA 2DQRA 2DO7A 1IW7F 1U5TB 3I59B 1ONVA 4PCQA 1MJAA 2STTA 5HS9A 2F2EA 2V6CA 5HS7A 2LDUA 4BNCA 3I64A 2YX7A 2K02A 3FX3A 3ZMZA 4EV0A 1SD4A 2R7DA 3TO6A 3KE2A 3CJNA 3FF5A 4RB1A 1J59A 1MJ9A 2PJPA 2G7HA 1TTYA 3GX4X 3EDPA 1P4XA 3RIRA 3FMQA 5LGUA 1YYVA 1UFMA 5D4SA 5FO5A 5EEHA 4S05A 1U2WA 3HHHA 3JSPA 4P9FA 2OBPA 3WODF 2EJRA 1KGSA 4HA8A 2VBXA 2GXGA 1BI0A 3Q9SA 4UVCA 1KU3A 4ZZLA 5J6XA 2GA2A 1EH6A 1ZGAA 4XRFA 1SD7A 4IXAA 4OOIA 4LGWA 3R61A 3ELKA 2KIFA 4KIBA 1KU2A 2EFOA 2JT1A 5D6FA 1G4DA 1WWXA 1XSDA 1O3QA 3CDHA 3REOA 3HTSB 2FQ3A 2L3DA 3TKYA 1BI3A 5H20A 2LF8A 2ADUA 4G8XA 2HYGD 2OAZA 1IAWA 4RGSA 3CUQB 1E2XA 2XRNA 4HX7A 4WXCA 3WTXC 1IRFA 4IHSA 3BPVA 1ZG5A 1XMAA 1FX7A 1HSTA 1G3YA 2ZMEB 1MJBA 3IKTA 5DEQA 1F9NA 2ZKZA 2GZWA 2RN7A 3FXUA 2COMA 4Q5SF 1G3TA 3M7GA 3SZTA 1KA8A 1TW2A 2DK8A 2QQAA 3RJPA 4LJZF 4HQEA 3GZ5A 4BXUA 4G94A 2Z5UA 2OA4A 3KZYA 3VOEA 3E5UA 2A6EF 4UVAA 3KEQA 3OV8A 1BC7C 2Z9OA 1ZRFA 4LB6B 2EFQA 2PEXA 2VT3A 3ZMSA 3MWMA 2FBKA 1P4AA 2OD5A 5HLHA 3GLXA 5E18F 3OOPA 1KQ0A 2FE3A 3QPHA 4G9YA 1FYKA 2DPDA 3K1NA 3R0AA 3QAHA 2LSOA 4A0XA 5DD4A 3P7NA 1G3WA 3TOBA 2HDCA 2R7FA 3FXQA 4I0AA 1EV7A 2RNJA 3GXOA 4HDVA 3TDUC 3LA3A 1QQIA 3L2CA 2P8TA 1HSJA 1Q1HA 4E70A 2A5YB 3R0JA 4ESJA 4ZYGA 1Z91A 2ETHA 2P7VB 1HXDA 3ZN0A 1BJAA 2OZ6A 2NRAC 2H94A 1Z9CA 4BAYA 1PDNC 4HLYA 4ZYHA 1WI9A 1LJ9A 3BOQA 4BYYA 2ZNZA 1YS6A 1P4WA 5A2QK 4EGZA 3PFIA 1XMKA 1ZLKA 2P5VA 3F8BA 1GXPA 3LQRA 4ZZDA 5JR3A 1J0RA 1KU7A 4OIPF 1I27A 5ICEA 3KFWX 3LFKA 1WQ2A 3KP5A 1QBJA 4U0VA 5ILUA 4IF4A 1MD0A 3IWZA 2IA2A 2O8XA 5CVIA 1YG2A 2EB7A 1K6OA 3MQ0A 4G6QA 5IT9K 2EV6A 4KNYA 1T39A 4ZYEA 1P6RA 2RDPA 2VOOA 2PMHA 4IVNA 2FEZA 5LHIA 5A2QZ 3JSOA 1IXRC 2E1CA 3RKYA 4EQQA 3M8FA 2IJLA 5KVRA 3I53A 5FLXZ 3M8EA 2VBZA 2ZXJA 2A69F 3GFJA 3E5QA 4EJUA 3V7SA 3SZPA 3D0SA 5IT3A 3U1DA 3K1MA 2DAOA 1AWCA 1OPCA 1ZG3A 2QYOA 3RYRA 4YFXF 2P6SA 2M5WA 2L02A 4HW0A 3JAMK 2RQPA 1ZHFA 4K2EA 1B6AA 1R1TA 1TQMA 1YQAA 1Z1DA 4EVIA 1B4AA 5FFZA 3IRQA 2K7LA 2H6BA 3F22A 4ZYDA 3NQOA 1PP7U 2KIUA 3V4GA 2RGVA 1T2KA 1HQCA 3ABUA 2OZUA 3F8CA 1O3RA 1QO0D 2LF7A 5CVUA 2KJCA 2P5LC 3FZVA 3HRSA 2H6CA 4Q48A 4G6DA 3PQKA 4UUVA 3ZQ7A 3VEPA 1Z6RA 1L0OC 1D8JA 1V3FA 1J7KA 1FY7A 4HZFA 3T1BA 2YPRA 1RUOA 2XAJA 3NRVA 2DLLA 3VB2A 4RB3C 2ZFWA 3WE3A 3LSTA 4FX4A 4HX4A 3ECHA 3L9FA 4P5OA 1XD7A 2RKHA 4EJVA 3SQNA 1R22A 3QOPA 1T6SA 2DFIA 1JE8A 3K2ZA 3CLOA 4KFCA 1R1VA 3WTTC 2FU4A 1LB2A 4U7BA 4KN4X 1BIBA 1D5VA 4MTEA 3DV8A 1OYYA 2E7WA 5FFXA 4MNUA 3RYPA 4YIIA 4P9UA 2JSCA 1XDSA 1HW2A 1D8KA 1FLIA 3I4PA 1K78B 4IHTA 5E17F 4EGYA 3FMSA 2D2WA 1IF1A 3BJOA 4WXHA 1EH8A 3FWEA 2XV4S 1IN4A 4AD9A 1XCVA 3ISPA 4M71A 2G9WA 3MCZA 2OU2A 3EYYA 3KP3A 4TV7A 1I1SA 2EK5A 5ICGA 3B73A 1XGNA 4KIGA 3JTHA 1F5TA 1VTNC 3BJAA 5HDGA 4RGRA 3QRFF 1I5ZA 4OMYA 1GXQA 3F8NA 3QPTA 4L9NA 4ENMA 5LRRA 5CVJA 2MH2A 2WC2A 1T98A 1ZLJA 1FBUA 1TQPA 3R60A 3H3ZA 2CG4A 3EYIA 1U3EM 5BMZA 1FP1D 3NEUA 1YO5C 3S2WA 2P7CB 2K27A 2VODA 4MGRA 3HRMA 1LDDA 2P6TA 5FGMA 1W5TA 1SD6A 2MC3A 2VC0A 4BH9A 4I98B 5EEGA 5LEJA 4L9VA 5DV5A 1FP2A 5HS8A 1TLHB 4M74A 1MZBA 4IJAA 3VFZA 1K79A 4M9ZA 4L9JA 2XUBA 1S29A 2DQLA 2X4HA 1XN7A 2TDXA 3TQNA 4N0BA 3WGIA 2BBYA 1R36A 3RI4A 3C18A 4XLNF 2NS0A 1DP7P 3GWZA 1YLFA 3BP8A 3HRUA 2Q0OA 4LLGF 1XSVA 4BQAA 1B9NA 1KYZA 2QUFA 2VC1A 2QLZA 3E6MA 2HQNA 5BPIA
chains in the Genus database with same CATH superfamily
3WHCA 4PJ0C 1P2FA 2HKXA 1KONA 4WXDA 1D1AA 5FKLA 2AO9A 3GTLJ 1E17A 4LG0A 2HI3A 4PJNA 2F5FA 1XG1A 1A36A 2HOTA 1O3SA 1DQUA 3ZMTA 2R7TA 2JMWA 3B6CA 3J7ZI 5CYVA 3BPXA 3U2RA 2ELKA 1Z6TA 4KN7X 3F0CA 1WVRA 1X1BA 4M9XA 1SMYF 1NG7A 4XSXF 3ZRGA 4C9YA 3J7YJ 2WB1N 3A1YA 2Z99A 3IAM2 1ZAOA 4HF1A 4HYEA 4KT5C 3HYIA 4H4KC 3ABTA 4NB5A 3PSIA 3CCEI 3S14J 1RUNA 1FBSA 2DA3A 4PK4A 4P55A 1T8IA 2LYCA 3W2AA 3COAC 4NC7A 1FYLA 4IOAF 1SD5A 1T95A 4G7ZF 1MMAA 1ORKA 1OCRH 1ETYA 4D7NA 4RS8A 1SFEA 4B8XA 4M6XA 1YRNA 4KICA 4WCGA 1F4KA 2VJ4A 2JRTA 3W6JB 1QU3A 1VQLI 3EUHC 5DUIA 1MBJA 2PQ8A 4E7IA 5L3FA 4M6VA 2A6HF 3I71A 5FD5A 4ENKA 2JPBA 3WTVC 2IGKA 1ZR2A 4IHVA 3LQQA 2DMUA 4R8HA 4XLAA 3RPQA 1IRGA 2ZXWH 1NK2P 3M9AA 3WU2C 3F3XA 1G6NA 1ETWA 3BG6A 2ZO4A 4KYWA 1YOVB 4A69C 1ZKGA 4RAGA 2JVHA 4Z6YA 1WPKA 2BEOA 1BOAA 3R6SA 1O3TA 3MKWB 1W0UA 4YIRX 2HZDA 1YIOA 5TGTA 1N25A 1U5TC 1VZ0A 2CQQA 1YTYA 1SAXA 2LP0A 2XF6A 3DFGA 2Y48A 2E5NA 3QP5A 1QNTA 3MAJA 2M45A 3UR3C 2VXZA 2J5OA 1WJ5A 3KP6A 3EUHA 3V8LA 3GEZA 3QOEA 1XC5A 5FRMA 4IHXA 2PI0A 1A6IA 3NAUA 1OYWA 1WRJA 1Y0UA 1FWZA 2DW4A 2GWRA 2VQHA 3RTRA 5HDNA 1UHSA 2FX0A 1WH7A 2FNPA 5J40A 4ZTJA 4HDUA 4II3A 4LFUA 4ANJA 4DNCA 3A2KA 1P7JA 3IRRA 1SVMA 4BQNA 5F04A 5GAHJ 2PJRA 4ESBA 1LKXA 1S5LC 1I6XA 1O7FA 2X9DA 4HBLA 4PSWA 3WTUC 1WJFA 3OSGA 3QPLA 5LBQA 3QPSA 3RKWA 2E60A 5DM7F 4CZZA 1ERDA 1S3JA 2KIMA 3SZGA 3JRBA 1IJWC 3I59A 5ILSA 2MA3A 3WE2A 1HC8A 1DPRA 2M0MA 5E1ZB 1UG2A 4DGWB 1U8RA 3ABMH 2XASA 2ZSHB 2YU9J 3M4OJ 5ERIA 1MIJA 3S93A 2O61A 3J81K 1R23A 3HIFA 1Q1VA 5E1WA 2BHZA 2FMYA 5TISC 2LBFA 2CH0A 3W2VA 3ESWB 1S72I 4EM1A 5GPAA 4MEXF 1U9NA 4UVBA 2R7WA 3HOSA 3DU6A 2DMTA 3K4LA 2IVMA 2JK3A 1WJEA 2CUJA 2VE9A 2F4IA 2XRLA 3G1LA 4A3CJ 3QU3A 3N05A 1ZRCA 3IC7A 2FA5A 3HUGA 4B3XA 1FJLA 3I54A 2QM3A 4DZJA 3QYEA 2QQ9A 2LH9A 2WV0A 4CSWA 5E3MA 2HKOA 2KLOA 1W7PA 4M3BA 2BW3B 5M5XJ 4XRSG 5F1RA 1CGPA 3CZ6A 2O3FA 2FD5A 1D1BA 1MDMB 2D5VA 1XPXA 3F6VA 3LSPA 3I0TA 4RLQA 1ZYRF 2P4WA 1KU9A 3BWGA 2Y31A 2NNYA 2DCEA 4MO7A 3BJ6A 3CCRI 1W36C 4C2UA 1WJDA 1SEUA 3LSGA 3OYJA 3JREA 5M3FJ 1W4MA 2XKPA 1ETKA 2M0CA 1B9MA 1IN7A 2WWYA 3CUQC 3OSFA 2L4AA 1FMWA 1H0MA 4S04A 1MW7A 2MLKA 5DTDA 1YIJI 1FOKA 4X1EA 1QPMA 1SANA 2BZTA 1VQPI 1ON2A 1WHUA 4KIFA 4O5VA 2IW5A 3SXYA 3CMYA 3ML6A 3RPUA 2YR2A 1PUEE 1J5YA 4AYBN 2JA2A 2EA2A 5EF6A 1OKRA 4RB2C 4JYKA 1E0EA 2K3FA 4Y4RA 2E2HJ 3G2BA 4N9IA 4OIRF 1RR8C 2O6GE 2O5RA 4XKWA 2IGMA 1IUFA 2HTJA 1UHWA 3HRTA 3L2RA 4ENNA 4Y52J 1UCRA 3FIWA 3WGGA 1D0YA 1TBXA 3CTAA 3ZMVA 1JKPC 4XSZF 3GYHX 3F23A 3GTPJ 3LOCA 1PYVA 1XDUA 2F4OB 4DOZA 1WI3A 3DLLF 4B44A 3HOTA 2XAUA 4OAYA 1S6LA 2O03A 5JHFA 1JJ6C 1MNEA 1FC3A 4NHJA 2CV1A 2UUZA 4P1WA 1PP8F 1W1WE 1X4OA 3BY6A 3FKIJ 4F93B 4E7JA 3U21A 1OCPA 1OR7A 4BE1A 2EQRA 3V7RA 5LFAA 4A6EA 1FYMA 2UWMA 3QQAA 4XN0A 4HNTA 2HWVA 2MH9A 2DT7B 3EUAA 3PM1A 1ZG1A 4KUMA 1IN8A 2DOFA 2FXAA 1DU6A 5DDGA 4U7DA 2H09A 5K7FA 1KYWA 2XB0X 2DTZA 4CDGA 4JOMA 1C0WA 1Z7LA 2Y75A 4EJWA 2H1LA 3HTUA 3ASNH 1QZEA 1R58A 3S2HJ 2KRCA 5BQTA 2V79A 5LD2C 2RAEA 3FBNB 1TNSA 3J7AY 1P92A 1BI2A 1HF0A 4BUPA 3V8KA 2DDAA 1PUFA 4U88A 5IP9J 1T08B 2KP6A 4BJTA 4G7OF 1DDNA 2MG4A 4LD5A 3GUDA 1MMGA 3J80K 4L0ZB 3T5XA 4BHBA 3WTWC 3WU0A 3K6GA 2DMPA 3CP2A 1LDJA 3LA7A 3L00A 1JXSA 2DN0A 3L09A 3OY9A 4HOBA 2A61A 3P9IA 4U0WA 4HPQA 3JRDA 1EA3A 4MEYF 1BC8C 3L2VA 5D5WB 2FBHA 2E1MC 4MQVA 3OYDA 3GF2A 3CDIA 5IT9Z 1LE8A 2LY9A 1Z7UA 5IY5H 5JI6A 2TCTA 3C1DA 3DPUA 3BLYA 3I5UA 3KETA 1W7PD 1YI2I 5E1XA 1XSXA 2W4SA 2WAQN 3ABLH 3K0LA 5DM6F 1U78A 2EBIA 5GP9A 4H0EA 1D3YA 1W5SA 2BV6A 3TGNA 3ZP5A 4JX6A 2A07F 2IRFG 4RAYA 5EJCA 2K3PA 2VOPA 4UV8A 1Z0XA 1B1BA 1TWGJ 2F4MB 4EM2A 1OYIA 5DUKA 2K4BA 5K7HA 2PN6A 4AIHA 2LVSA 2VQLA 5FLMJ 3HOVJ 3DEUA 3C2BA 4HG2A 3J80Z 3K69A 4GXOA 1OLTA 4BE2A 5C44J 2VASA 2NAZA 3MZYA 5HLIA 3QU6A 2VN2A 2K5CA 1L3LA 3JAMZ 4Z2YA 5K1YA 2EFPA 4GCVA 4ON0A 5F64A 3RPUD 2BY1A 2DK5A 3ZMDA 3R4KA 1T33A 4L18B 2XKOA 2XGXA 2X0LA 4U0YA 5J47A 4JQFA 5J4VA 2FJ1A 4DQ2A 3H5RA 4M9SA 2ME6A 1TWHJ 3DCFA 2LLKA 5EGOB 2R5ZB 3BR6A 4A5MA 3OYMA 5FLVA 5ED4A 2NYXA 3S2DJ 4BDYA 3HPHA 2FRHA 3A03A 3ZQLA 3HKZA 3TP3A 4UXNA 4XLPF 3RQIA 1TWFJ 3A0BC 1WCMJ 3OOUA 4CGZA 3VYRB 3E1SA 2HXOA 4JK1X 1I50J 1QZZA 2CUEA 2FNAA 3F72A 2D1VA 1W5CC 4LIUA 4XLFA 4LG0B 2L01A 1F36A 1BN5A 2MABA 3FXRA 2AQFA 2W25A 4EMSA 1YITI 3OYGA 4M6YA 3HOWJ 3B02A 2XROA 4QLCU 1CF7A 1ZGJA 1A5JA 1UHMA 4HF2A 4KMFA 4YIFA 1SMTA 1MBKA 3GFIA 1PVEA 4KT6A 2F5DA 4A5NA 2HXIA 2RC4A 5K5QA 1A31A 4WWCA 3H5AA 2ME0A 1A04A 1X4PA 3NWSA 1WFXA 5EZGA 2W00A 3LSIA 2KDZA 4RGUA 4CYCA 2QF7A 3H0GJ 1YRNB 1FT9A 1F1ZA 1RC9A 1EKEA 5CVRA 1ZARA 2HDWA 4BKXA 4BHCA 3EQLF 2CGPA 2ZXIA 1ZRDA 5CPRB 3CCQI 2OC6A 1G59A 2ZFUA 4NDLA 4HF0A 5H6RA 3OYNA 4E7SA 4CXFA 4I01A 1GVJA 1A35A 1TC3C 2ELHA 2IPQX 2LY2A 1FIPA 5AONA 2CFOA 4XBFA 1FEXA 5FB2A 5J8CA 3BG9A 1XGOA 2W24A 2XHKA 4OMZA 2Y9ZA 3BZ6A 1MMSA 2MYSA 3HEFA 1X19A 2H27A 2K86A 2CS3A 3VSKA 4B3AA 5EG0A 3GTGJ 2M87A 3VPRA 1HW5A 1WJBA 2ZCWA 1MGTA 2Q8KA 3CJRB 1USTA 4R1HA 2QQBA 1G3SA 2BYVE 5IPAA 3K70C 4RAZA 5CVVA 3CCMI 4BE0A 5LHGA 1FOWA 4XKCA 3CCUI 3NARA 3FHZA 2XAQA 1XX5A 4OU0A 3CJTB 4EM0B 2ZBKA 4R79A 3GZ6A 1R7JA 5C3EJ 3TO7A 3ZPLA 2V9VA 1N75A 4OIOF 2M9HA 4RB0A 1MNMC 4GO1A 2XGEA 2DTRA 5IOZA 2VKEA 2HFHA 2V7FA 2ICWG 4CCMA 3OYEA 4NQWA 1SAUA 4N4OB 5TRDA 5HVQC 2CV0A 2CMPA 1ETVA 4M3FA 1OMIA 1Y6IA 2AQEA 3HL2A 3KCCA 1ETXA 2PJRB 1STZA 4YELA 3TMOA 5D5XB 2M1BA 1Y39A 1ETQA 2R92J 2BY0A 1ODDA 2CQXA 4L5JA 4N9HA 4HQMA 4F55A 2V1XA 5D8KB 3WTYC 5H6QA 2YX4A 2WAEA 4KMUX 4LB5A 3V42A 2DJNA 3AL0C 4UUSA 4IEJA 1QVTA 3E7LA 4F92B 1RR7A 2LY1A 2MSYA 1JKQC 3PO2J 2R5YA 2HDDA 3GO5A 3LAJA 1IRXA 3S1MJ 3KLOA 1S8NA 2ISYA 2LKPA 2CRGA 1UMQA 2W85A 2EH3A 3WHBA 3C7JA 5BPDA 3DP7A 2CUZA 3PFYA 2HZTA 3W3CA 3MEXA 2K9MA 2E1NA 2LBFB 1R4MB 2PMZN 4WF2A 3HOXJ 3Q0UA 3KEOA 1G8XA 4YEJA 4UV9A 3VODA 4D5FA 1SFUA 5KAIC 2CV2A 1T0FA 1B59A 2NNNA 4ASNA 2ZJQF 2HPMA 1J9IA 2QBYA 1UELB 1TNTA 2X85A 2YUSA 2MBFA 1A6QA 1ENHA 4Y17A 5JVTA 1ULYA 1W7PB 3QWLA 4J00A 2O7OA 2QENA 2QGUA 1GUUA 2LTPA 3CUOA 3HOYJ 4V2GA 3Q5FA 3K4CA 2B9SA 1YJ9I 2UZKA 5LGTA 3O8HA 5HNFA 4CZCA 3O6BB 3ZMUA 1VQKI 2XAGA 2Y0SA 1U6GA 3OIOA 5GTHC 1R5GA 3K10A 1YW7A 3AAFA 1TL8A 3BZCA 2I5UA 3KP7A 2PMUA 1BI1A 1OCOH 2XGCA 3H9JA 4IZZA 4A0YA 2ESHA 2UXNA 1VQ5I 2ESNA 3ZCOA 2DU9A 1XGMA 5HLGA 5D4RA 4ZTFA 3TOAA 4AM3A 1ON1A 2OTLI 4ZYAA 2M7BA 1DUXC 2A3SA 4KDPA 4AVPA 2WA0A 1Y1VJ 2IP2A 2DODA 1WSUA 5D5UB 1RI7A 4ZH4F 3GTQJ 4A2UA 4IPAA 1YX5A 1S7AA 5ICCA 1DPUA 1Y56A 1KQ8A 2CQ7A 1SC7A 1LFBA 3H92A 1TW3A 3VSLA 3ABKH 1FZPB 3P9KA 3D5LA 3BC8A 2R7UA 5CKTA 2CW0F 3S1RJ 1HKSA 3K4NA 2XPWA 4I6ZA 2IXSA 2VKDA 2M30A 5LHHA 3I4NJ 2BY2A 2KZVA 1H88C 2WAFA 4CCKA 5HODA 5FKMA 1BW5A 2O0YA 2JUGA 2PBIA 3K1PA 2H8WA 4O6JA 2LD5A 5IP6A 2Y69H 1I1GA 4HSRA 5DYMA 1TT5B 2VT2A 2W84A 1YW9A 4M73A 3N4MA 1GT0C 1BIAA 3FHNA 1FSEA 1Z05A 2M7AA 3FM3A 2GXAA 1Y8RB 1JGSA 2B0LA 3ERED 4A3DJ 1K78A 2LK2A 1JJ8C 3A0HC 1FNNA 2NS7A 1HDPA 2F6CA 1BJZA 2X51A 5FRNA 2D1HA 1Z21A 2ZJPF 3KZIC 3M1CA 4AIJA 3GZNB 2CYYA 2QA4I 5DCMA 2MD5A 3WG7H 4X0GA 2EZIA 1RZ4A 2IA1A 3BTIA 3K70D 3BZKA 3ROUA 1MMNA 1PUFB 4AU7A 5FD6A 1Y8QB 1BW6A 4NNJA 4UY8I 3C2HA 3G4SI 4E6KG 1VI0A 1UB9A 3LSHA 5KK1A 5GAEJ 2QKMB 2GIVA 2OPTA 4L5IA 5LGNA 1T38A 2HPIA 3O3KA 1FMVA 2L7FP 4KITB 3KP4A 5LEKA 3E6BA 3KZZA 3CMAI 2DPUA 4KA4A 4FCYA 5E8IA 2Q1ZB 2PFBA 3QP6A 1LNWA 4PJJA 2NVTJ 1H9TA 1OCTC 2DT6A 3ZGKA 2V1DA 2ZSIB 2FUG2 1LE8B 5KNLA 1IXCA 2AXLA 2KL4A 3CDLA 1I6HJ 3GTOJ 4D9JA 2N8GA 3LSRA 3G3ZA 2LRDA 3A01A 2XVCA 3E5XA 2CWEA 3HM5A 4U87A 2MGQA 2VONA 2X1CA 2I10A 1E3OC 4JP0A 1OQYA 1RKWA 2YU3A 5K5OA 4KJZA 2XPUA 1O4XA 2W57A 2JA8J 4CH7A 5L3CA 5K5RA 5IOYA 4PSXA 5ICFA 3PIOF 2MD0A 1LDKB 2HOEA 1U5TA 3GTJJ 1J2XA 3I58A 1H9GA 5F08A 4AUXA 1B72A 3KX2A 1JKOC 3CO6C 5E8GA 3IUOA 5HOOA 3IAS2 1I3AA 1MBHA 3HSFA 5KAFC 2A68F 4HEA2 2NVQJ 1GV5A 4RBOA 3TP0A 4IRIA 1QZYA 4CCLA 3DKXA 1JHFA 3OIQA 4MHGA 5L3DA 1IN6A 2AS5F 1LEBA 3DKWA 4A12A 3WG9A 4A0ZA 2D45A 1MH3A 3ASOH 1AOYA 2OV7A 4FISA 3V8JA 2W1OA 3BR2A 3FMRA 1VQOI 3RSNA 2DJIA 5D5VB 2WTEA 4HAMA 4PGGA 2F48A 4JX5A 5BNGA 3J81Z 2JA5J 1FTZA 4GYGA 1NG6A 2VJJA 4GRIA 4EJOA 1HOMA 3O2PE 1MSFC 2UXXA 2HS5A 3S1QJ 1X3UA 4E4HA 4Y3OA 4BXXJ 3F8FA 1IO2A 2M8EA 2L54A 4QPOA 3CCJI 5CJ9A 2R7XA 2ZC2A 2XIGA 3PQJA 3IKVA 4UHTA 1REPC 5F0CA 3FISA 1FBQA 4QIWN 3GFMA 2GOMA 3PNTA 3GW2A 2RVCA 5TJJA 5E3OA 2VLAA 3HB9A 3HBLA 5J1YA 5B1AH 5BS6A 2MLGA 3BQZA 4AIDA 4F91B 4Q4ZF 1BBYA 2J5PA 1HKQA 1IUYA 5CQGA 2M4KA 2DT5A 2F5VA 5LLQA 1AKHA 2KRFA 4BHPA 2Z3YA 4FX0A 4B4CA 4BJ5C 1CF7B 1WJCA 5L3EA 3I55I 2Z1DA 2E7XA 1YW8A 1LVAA 3U1KA 1APLC 4KISA 4D0PA 4HSTA 1O7LA 1XB4A 1FPQA 3P9CA 1ZH5A 2Q2EA 4I02A 4M3GA 2BXZA 5J1RA 2OJED 3ZQHA 2NVUB 3S17J 1GLNA 4PFOA 1I3QJ 4UB6C 5H2FC 2DI3A 3DQVC 3FBIB 2ZMEC 3KIOA 2VBWA 4DBRA 1H89C 3OR2C 4BQOA 1ITYA 4CYCB 4IRGA 3GFLA 3TO9A 2GXBA 5FLXK 3SEZA 5GPCA 4XKBA 1MMDA 4FETA 2EV5A 4HX8A 3A4CA 5F6FA 2EV0A 2LKXA 4CO8A 4HV6A 4IKFA 1ZTRA 2VE8A 1G2HA 5AIQA 4HRIA 3WTSC 4Q47A 1VQ9I 2QKLB 2DXIA 4DYQA 4DJAA 3CUQA 3KP2A 1MBFA 1JHHA 1R1UA 1I39A 2OQGA 4NBQA 2YSRA 1IN5A 1LEAA 2H8RA 2NXNB 2C6YA 3PIPF 3VWBA 1MKMA 2QSHX 4CYDA 4PFPA 4HNVA 1P7IA 5GTIC 4LIVA 3D5RC 2ZMEA 2STWA 3RDIA 3SHFA 3RKXA 1FIAA 2VPLA 4LLLA 4A3IJ 3E3VA 4YFKF 4I09A 4ENJA 2RREA 2CFXA 2VPRA 2BE5F 1S7EA 1R6RA 2BGCA 1IRZA 4FTHA 1LQ1A 2V9PA 4A3BJ 2F5EA 1JUMA 2MW8A 2P5KA 2G7UA 2X6WA 1GHCA 2FSWA 5FKKA 3W2WA 2E1OA 4CICA 2FBIA 5JFRA 3DEEA 1USSA 4LK1F 2R7QA 4NQWB 3G71I 3ZN1A 2ACJA 4Y33A 5F1JA 2W7NA 2XAHA 2LREA 2Z33A 1Z77A 1V5EA 5D8LB 4CCJA 3F6OA 1YJNI 4HV5A 2KISA 3I9V2 2LNBA 4P96A 2VQGA 1R5HA 3CCYA 4ZC3A 4MQ9F 3VYUB 3WTZA 4MTDA 1Z3XA 2W82A 4QWQA 4XR6A 1XCBA 2P0WA 3FM5A 4UUSB 2DFFA 3E0JB 4B47A 3S32A 5DD8A 3MFKA 4BL0B 2R5YB 2Z16A 2DA2A 1BM9A 4PGHA 3ZQCA 1NK3P 3I56I 1K7AA 4MFDA 4BXFA 1ETOA 1KZHA 4GFBA 2LC2A 3G73A 3T8TA 2ISZA 2OTJI 1KQ9A 2VKHA 4FE7A 1QGPA 4Y7NJ 3TL4X 1SVLA 4HLXA 3JW4A 4WX9A 4AWXB 3HKZN 1XMXA 1IV6A 3F21A 3DPLC 2WY7Q 4Y15A 1VF9A 3L7WA 2DA7A 2JZYA 3JTGA 4N4NB 2CO5A 3OYIA 1TQIA 1ZREA 4L5EA 3H0DA 3IHUA 3V7CA 2QBYB 4D7MA 1EF4A 3DEWA 1LFUP 4I76A 3BROA 3K9TA 4DIQA 3SEQA 4RGXA 1CQTA 2JPCA 4QPQA 4G7HF 1D1CA 3J7AO 3BCAA 1XTAA 2JTVA 4BS9A 5AIPA 2QEXI 1GDTA 4PZJA 5L3BA 1QRYA 4O3MA 5B3SH 1VQ4I 4ZJZA 3JRGA 3MKLA 1BR4A 2IA0A 2I8DA 2Y0MA 3KLNA 4IX7A 3K4JA 3HHGA 4CA0A 2VIXA 4GGGA 4Y13A 4UNOA 2IEKA 2KJBA 1V4RA 5J8FA 2WBMA 3OYKA 4M72A 4A6DA 4IQ4A 1FTTA 1HBXG 3AG1H 3I3LA 1P9QC 5D6EA 4CCOA 2L4MA 3F8MA 4RA2A 5L3GA 3ECOA 2HGCA 1YS7A 3MD2A 2QZ8A 2X48A 2DBBA 1EH7A 3AG3H 2F5CA 4FT8A 4A3MJ 3FXLA 3OYFA 2KKOA 3MZHA 2IGOA 1W36D 4IRHA 1SVOA 5BOXA 2EFWA 3HDDA 4F7ZA 3PSFA 2HEOA 3QYFA 2FF4A 3E6DA 4LMYA 2ECCA 3FK6A 1ZELA 3Q0VA 4YG2F 3DXJF 1POGA 5F27A 3WU1B 3D1NI 2OQRA 3LAPA 3CQZJ 4B43A 3HSEA 1UJ8A 3H3UA 1XGSA 3T8RA 2E36A 3OYBA 1S7OA 1WKMA 3IL2A 1MDMA 3JCUC 5GADJ 4OIQF 2KDOA 2V1UA 1JTXA 1FSHA 4F52A 3E6CC 5J3LA 2CSOA 2PLYA 3FXMA 2HTSA 1DU0A 3ZQGA 2IT0A 2CQKA 4XN3A 1RNLA 3GMEA 4EJTA 2ZNYA 2QQ8A 4B09A 5DS9A 3BR0A 2QVOA 2HOAA 3RKQA 2FOWA 2FQ4A 4CHUA 2GA1A 3KPHA 2XAFA 2FMLA 3M8JA 4I0BA 3PUFA 3SYTA 3LWFA 1ZGWA 4FASD 2E2IJ 4A93J 4V19K 4I7HA 2ZB9A 3HGGA 1Y0NA 3T0YA 1LPQA 5GAGJ 3E97A 4L0YB 1HKTA 1VQ7I 3C3WA 3S16J 3ONQA 1NHAA 3CO7C 4JBAA 4PDKA 3OYCA 4LLNA 2RV8A 1RPWA 4XRMA 2MC4A 3DPTA 2M34A 4BDZA 3IWFA 3BR3A 3U9GA 3ULQB 1DP3A 5DCMB 2IS4A 4I2OA 1O57A 3S8PA 1YJWI 1HW1A 2VBYA 4ESFA 6PAXA 1VQ6I 2PG4A 2EA4A 1IZ1A 2IGNA 2X6XA 4XM3A 4ETSA 3EETA 2GAUA 4PJMA 5EZHA 1ZN2A 3N97A 3LA2A 5HDKA 4BJ6C 2EFNA 4A3JJ 2E19A 4OWRB 1RETA 2V26A 3Q9VA 4L9TA 4QTRA 2XF5A 2Y9YA 3CC7I 1RESA 1V55H 3M1EA 3WGHA 2EWNA 4OINF 1IXSB 5CLSA 1F43A 3CCVI 4WK8F 1J75A 3M3YJ 5LRSA 2QSGX 4LK0F 1YFHA 2HQRA 1SFXA 2KIQA 1R00A 2R3SA 2DA6A 3BDDA 2FOKA 2HR3A 5JHUA 1RIOH 2A05A 4XORA 3X2QH 4YFNF 4AIKA 2VQCA 2K4JA 3DF8A 5J1UA 3W6KB 5IP7J 5DCFA 2QWWA 2HYFA 5E20A 2TRTA 3A01B 3SFZA 5ILVA 1LVKA 3L2QA 2BOLA 2R7RA 3OYLA 2BVMA 3TDZC 2JUCA 3GVAA 4FHTA 2ZJ2A 5HLTA 3H35A 4BY7J 3HSRA 1U0JA 2GQQA 3CMEI 4GYIA 2NOGA 2WV1A 2DQRA 4XMYA 1IW7F 1U5TB 2DO7A 2Y0SN 5K7ZA 3I59B 3GCMA 1U8BA 1MNDA 1OJLA 1ONVA 4PCQA 1MJAA 2STTA 5HS9A 2MFZA 2F2EA 2V6CA 5HS7A 2JVGA 2LDUA 5J4YA 4BNCA 3CF2A 3I64A 1K4SA 2YX7A 2R7SA 2K9SA 3JRAA 2K02A 3FX3A 4D5CA 3RQ4A 3ZMZA 3OS0A 1X1AA 2ID6A 4EV0A 2P81A 1SD4A 5E3NA 2R7DA 3TO6A 5E3LA 3KE2A 3BTCA 3OL3A 1FOXA 3CJNA 3FF5A 4RB1A 2R0QC 1J59A 1MJ9A 2PJPA 1RKTA 2ELJA 3HUGB 2G7HA 3HXLA 4IO9F 1TTYA 5IYDJ 4IOCF 3QODA 3GX4X 2L9VA 3DTIA 4MIMA 3EDPA 1P4XA 4M3EA 3RIRA 3FMQA 5F0HA 5LGUA 3K4KA 1YYVA 1UFMA 2DA1A 5FO5A 5KCMA 5D4SA 4RDUA 4CCNA 4E7HA 3FXKA 5EEHA 3LSMA 4S05A 1U2WA 2Y2ZA 3HHHA 2K40A 5B66C 2AXTC 2CW8A 3JSPA 3DLAA 2XDVA 4P9FA 2OBPA 1DGWY 3WODF 2EPFA 2EJRA 1HCRA 1OCZH 1KGSA 4HA8A 2VBXA 2L9SA 3EPZA 2GXGA 3OS1A 1BI0A 2M3AA 3Q9SA 2ECBA 2E2JJ 4UVCA 4A3GJ 1KU3A 4ZZLA 5J6XA 2GA2A 1EH6A 1ZGAA 3Q3SA 4XRFA 3RCOA 3S3OA 1SD7A 1X1CA 4IXAA 3BR5A 4IHYA 4OOIA 4LGWA 3R61A 2Q2EB 3ELKA 2OCEA 3TBIA 3OMYA 2XB5A 1YE9A 2KIFA 2NOJB 1KU2A 2L0KA 4KIBA 4AC0A 4HNUA 2B7EA 2DMNA 2EFOA 4BGDA 2HOSA 2JT1A 2OCCH 5D6FA 3BQYA 1G4DA 1WWXA 1XSDA 3MKZA 2XPVA 3CDHA 4ITVA 5EYRA 3REOA 2FQ3A 2HVQA 1O3QA 3HTSB 1JI8A 4A3EJ 1E3HA 2L3DA 3TKYA 1BI3A 2E71A 3PO3J 5H20A 4J19A 1NH3A 3W6VA 2LF8A 2ADUA 4G8XA 2HYGD 2OAZA 2X1EA 1IAWA 4RGSA 3CUQB 5JLXA 1E2XA 2XRNA 3H9GA 4HX7A 4WXCA 3WTXC 1IRFA 1HLVA 4IHSA 3VYSB 1X1DA 3BPVA 2EIKH 2ZJRF 1ZG5A 1XMAA 1X2NA 1FX7A 5KHDA 1HSTA 1M1EB 2HVRA 3K2AA 4X6AJ 2O9LA 1G3YA 4FE4A 2E35A 2ZMEB 3M07A 1MJBA 3IKTA 2EINH 1HDDC 3DBLB 2EZLA 5DEQA 1F9NA 2ZKZA 3KYCB 5FROA 1OCCH 2GZWA 5EEAA 2M4GA 2RN7A 5E79C 2BHYA 3FXUA 2COMA 4Q5SF 2K9NA 1B8IA 1G3TA 3M7GA 3JRIA 3SZTA 3HC7A 1KA8A 1TW2A 2DK8A 3OS2A 3IH3A 1K6YA 2QQAA 3RJPA 3MN2A 4LJZF 2DOEA 4HQEA 3DKYA 3FXOA 5F0FA 3KYLA 3GZ5A 3HZJA 1Y1WJ 4BXUA 4G94A 3IV5A 2Z5UA 2OA4A 1YX3A 1WH5A 4DYCA 3KZYA 4W1UA 3VOEA 3E5UA 2A6EF 2G0EA 2AHQA 3OYAA 3L1PA 3JR9A 4UVAA 1VQNI 4LG3A 5M5YJ 3DBRB 4ZDOA 3KEQA 3OV8A 3GLLA 1BC7C 2WB1A 4II2A 1EJ9A 2Z9OA 1ZRFA 3SDBA 4LB6B 3FK7A 4MFEA 1R9TJ 2EFQA 2PEXA 2VT3A 2VUMJ 3TEDA 3UNGC 2DFHA 1D5YA 3ZMSA 1WZ2A 2EILH 2GBYA 3MWMA 2R7ZJ 2FBKA 1P4AA 2OD5A 3DTKA 1TP4A 4W97A 4BACA 2V1NA 4NUBA 2R4GA 4J01A 5HLHA 3GLXA 5E18F 3JRFA 2A6TA 2DYSH 2L9NA 4XK4A 1R71A 3OOPA 2UV1A 1JT0A 1KQ0A 2FE3A 5HNHA 2OF7A 3QPHA 3AFHA 4G9YA 3UKGA 2E1MB 1S9HA 1FYKA 3K1NA 3R0AA 2DPDA 3QAHA 4JX4A 2ID3A 2LSOA 2HNHA 2JA7J 2VJ5A 4A0XA 1ZK8A 3PUBA 5DD4A 3C2GA 3P7NA 1G3WA 3TOBA 2HDCA 1ACIA 1D0ZA 2R7FA 3FXQA 4I0AA 1EV7A 2K9LA 2RNJA 2X1DA 5IYBJ 3GXOA 5FJ8J 4HDVA 2PX9A 4B48A 4BQQA 3TDUC 3LL7A 2L7MP 2XF7A 2VKVA 3LA3A 3OL4A 1QQIA 3L2CA 2P8TA 4CUGA 2XSJC 1HSJA 1Q1HA 4E70A 2A5YB 1VQ8I 2WADA 3R0JA 2DOAA 4ESJA 3VDXA 4I99C 4ZYGA 3CCSI 1Z91A 2ETHA 1QHGA 2P7VB 4XIDA 2YS9A 3S3MA 1TWAJ 1HXDA 3ZN0A 1BJAA 2OZ6A 2NRAC 1IGNA 2H94A 1Z9CA 3G1OA 4BAYA 4HLYA 3DU5A 3H36A 1PDNC 4ZYHA 1WI9A 2V6EA 1LJ9A 3QYBA 3BOQA 2EIMH 1JT6A 4BYYA 2ZXHA 1WGXA 2EZHA 3ZR8X 2ZNZA 4GDFA 1V5FA 1AA7A 1YS6A 1JKRC 4C3JJ 1P4WA 2DFEA 5A2QK 2KFDA 1UG0A 5B1BH 4EGZA 4V2FA 5M5WJ 3PFIA 1XMKA 1ZLKA 2CU7A 2Z2SB 2P5VA 4B1RA 4BEHA 1OR7C 1X3WB 3F8BA 2Y30A 1GXPA 3LQRA 2V4JC 4ZZDA 5JR3A 1J0RA 1KU7A 3IP4B 3S15J 3G6EI 4OIPF 3A02A 3CC4I 2M2EA 1LFPA 4YRVA 3BG5A 1I27A 5ICEA 2XC7A 3KFWX 3LFKA 1WQ2A 3KP5A 3ZXSA 3GTKJ 1QBJA 4XKVA 3DTEA 5EG0B 4U0VA 5B5EC 5ILUA 4IF4A 1MD0A 3IWZA 2IA2A 2O8XA 2NVXJ 5CVIA 3ZQIA 1YG2A 3AG4H 2VI6A 1PJRA 2VJIA 4RAFA 4D1QA 4EEFG 2EB7A 2EZKA 3MQ0A 1K6OA 3AG2H 4G6QA 4XONA 3EUKL 5IT9K 2EV6A 4KNYA 4F3QA 1T39A 4ZYEA 2R7OA 1XS9A 1P6RA 1TZLA 2JQ7A 3BG7A 3HOUJ 3BT9A 2RDPA 1MBGA 4DZPA 3LMMA 2L7ZA 2VOOA 4A3LJ 2PMHA 4IVNA 3KYDB 4C30A 4LITA 2FEZA 3GTMJ 3FKJA 2HU9A 5LHIA 1MH4A 5A2QZ 3JSOA 2KMUA 1IXRC 2E1CA 2JRMA 3MZ8A 3RKYA 4EQQA 3M8FA 2IJLA 5KVRA 3I53A 5FLXZ 3M8EA 4IL6C 3CMMA 1E3PA 2VBZA 1VQMI 4ABZA 2ZXJA 2A69F 3GFJA 4AYBA 3E5QA 3NWTA 3SJMA 1AU7A 3H3VK 1HA8A 2DMQA 2QSFX 3IH4A 3SZPA 3D0SA 3V7SA 4EJUA 5IT3A 3U1DA 3K1MA 1UZCA 2JWTA 3K4MA 1IV8A 1VNDA 2DAOA 2LG4A 1AWCA 1OPCA 2L5QA 1ZG3A 4ZDLA 2O8KA 1R5ID 2KT0A 1AHDP 2QYOA 3RYRA 5C4XJ 4YFXF 2KHMA 2P6SA 2M5WA 2L02A 4HW0A 2V9KA 1JGGA 3JAMK 2RQPA 1ZHFA 3CLQA 4K2EA 1B6AA 2IS6A 4G6TB 1J09A 1JUPA 1R1TA 1TQMA 1YQAA 1Z1DA 3BG3A 1B4AA 4EVIA 5FFZA 4A3KJ 3AKZA 1Z3YA 3IRQA 2K7LA 2LKSA 2H6BA 3BCBA 3F22A 1N77A 4IHWA 1JUSA 4ZYDA 3NQOA 1DGRM 1PP7U 2KIUA 3V4GA 2LR8A 4XQFA 1YHQI 3HG9A 2RGVA 4E7ZA 3CC2I 1T2KA 4FQGA 1HQCA 3ABUA 2OZUA 2LMDA 1BOBA 3F8CA 1O3RA 2X6OA 1QO0D 2LF7A 5CVUA 2KJCA 2GLOA 2P5LC 3FZVA 3HRSA 4AVZA 2H6CA 1U9OA 2RQQA 4Q48A 2M8GX 2NVYJ 3AL0B 4G6DA 3PQKA 2X6YA 4UUVA 3CCLI 2JA6J 3O8GA 2IS1A 2QCOA 4E7KA 4UUTA 3ZQ7A 1X1PA 4M3DA 1R4NB 2BY3A 3VEPA 1T56A 1Z6RA 1L0OC 3SFIA 1VFCA 3ZQQA 4RMNA 1D8JA 2COBA 1N78A 1V3FA 1TT0A 5CQEA 3CF5F 4RM2A 1J7KA 1FY7A 3FDYA 4HZFA 3T1BA 4LOCA 3PJRA 1FOYA 2YPRA 3HGYA 3LSJA 1RUOA 2XAJA 2L7KA 2CW7A 3NRVA 2DLLA 4XL9A 5IYCJ 3VB2A 4XRSA 4RB3C 3OYHA 3JRCA 2ZFWA 2W48A 3WE3A 3L2UA 1JTYA 4XLEA 3JRHA 3LSTA 1V54H 4FX4A 4HX4A 3ECHA 3L9FA 4P5OA 1XD7A 2RKHA 2VXDA 4XICA 4EJVA 2HQAA 3SQNA 2BW3A 1R22A 1UAAA 3GBGA 3QOPA 1T6SA 2WAQA 4XLHA 3VYTB 1LUJB 2DFIA 1JE8A 2B63J 3P5JA 3K2ZA 3CLOA 2H1KA 1H8AC 1R1VA 4DW6A 2FU4A 3WTTC 1LB2A 4KFCA 4BBSJ 5JLWA 4U7BA 4C2TA 3I4MJ 4KN4X 1BIBA 4BBRJ 1D5VA 4MTEA 3DV8A 1QHHD 1OYYA 2E7WA 5FFXA 1IG7A 4MNUA 3RYPA 4YIIA 4P9UA 2JSCA 3IH2A 1V5GA 3LNQA 3ZQFA 1XDSA 4XLCA 1WJAA 1HW2A 1K61A 1D8KA 3TW6A 4C3HJ 1FLIA 3I4PA 3G1MA 1K78B 4C3IJ 1GVDA 4IHTA 5E17F 3D5SC 5FKOA 4EGYA 3FMSA 1ZQ3P 2D2WA 1GV2A 4ZDPA 3Q0WA 1IF1A 3MMYB 3H1CA 4DYRA 2DDBA 4DBQA 2KPMA 3BJOA 4QSHA 2K85A 4WXHA 1EH8A 3HPGA 3DWLE 3FWEA 3TW7A 2XV4S 3MKYB 1B8IB 3H9QA 1IN4A 4AD9A 1XCVA 1D0XA 3ISPA 1NTCA 4M71A 3CD6I 2G9WA 1BA5A 3MCZA 3PL8A 2OU2A 3EYYA 3KP3A 4TV7A 1I1SA 1BL0A 1R49A 2EK5A 4EATA 5ICGA 3B73A 1XGNA 4E7LA 1K4TA 3OR1C 4KIGA 3MVPA 3PNYA 3JTHA 2XGDA 3S1NJ 3CP8A 1F5TA 1QVUA 2DA4A 1VTNC 2HQ5A 3BJAA 2LOOA 2BXYA 5HDGA 4XNFA 3OIPA 3DBHB 4RGRA 2CQNA 3QRFF 1I5ZA 4OMYA 1GXQA 3F8NA 2GOXB 3QPTA 2A5WA 3SDGA 3BR1A 2L9RA 4L9NA 4BY1J 2R93J 4ENMA 5LRRA 4A3FJ 4NC8A 5CVJA 2L2OA 2MH2A 2WC2A 2LFBA 1T98A 1BR2A 1ZLJA 1FBUA 1BR1A 1X2MA 1TQPA 3R60A 3CESA 5C4JJ 2IS2A 3H3ZA 2CG4A 3LSKA 4MLOA 3EYIA 1IDZA 1U3EM 2VL8A 2JSPA 5BMZA 1FP1D 2XSDC 1B72B 3FXJA 2KZGA 3NEUA 1YO5C 3S2WA 1T0FC 2P7CB 2HVSA 2K27A 1SFKA 2VODA 3B6AA 4MGRA 9ANTA 2JJ7A 4UB8C 3KEYA 3HRMA 1W0TA 1LDDA 2OUMA 2P6TA 5M3MJ 3S3NA 1RRJA 1MSEC 1IDYA 5FGMA 1QA6A 4IQJA 2WY8Q 1W5TA 2VB6A 3BTLA 1SD6A 4RM3A 3L2WA 2RNGA 2MC3A 1ZR4A 2VC0A 4BH9A 4I98B 3BTJA 2IBDA 5EEGA 3CJQB 2GIZA 2E34A 3PNVA 5LEJA 4L9VA 3HJEA 5DV5A 3F9KA 1X3ZB 2DYRH 1FP2A 5HS8A 1TLHB 2CJJA 1QPIA 2GM4A 4M74A 4XOPA 2KRHA 1MZBA 1X58A 4IJAA 3K7AJ 4RLFA 4BU2A 2HYJA 2BVLA 1IC8A 2IAIA 3RZDJ 2CUFA 1K83J 2EIJH 1OISA 3VFZA 1K79A 4M9ZA 2NS8A 1OFCX 4XOTA 5JVGF 4L9JA 1AKHB 2XUBA 3RZOJ 1S29A 2DQLA 2E5ZA 1XN7A 2X4HA 4PUSA 2TDXA 3TQNA 4N0BA 3WGIA 2BBYA 1R36A 4G12A 3RI4A 1Z67A 5FKNA 3K4BA 3ZOBA 3C18A 4XLNF 4OAZA 2K9QA 2NS0A 1DP7P 3GWZA 1YLFA 2R7VA 1TWCJ 4NC6A 3LFUA 2JN6A 1SFOJ 3HOZJ 3H5NA 3BP8A 3HRUA 5EDNA 3OWTA 5EGOA 4PJLA 2R5ZA 2KQRA 2Q0OA 3ERMA 4LLGF 4S0HB 1XSVA 4BQAA 1B9NA 1KYZA 4C2MJ 2QUFA 2DA5A 2PMZA 4BEHB 1MBEA 2VC1A 2QLZA 3E6MA 2HQNA 5BPIA
chains in the Genus database with same CATH topology
1P2FA 2HKXA 4WXDA 1E17A 4LG0A 2F5FA 1O3SA 3ZMTA 5CYVA 3BPXA 3U2RA 1Z6TA 4KN7X 4M9XA 1SMYF 4XSXF 2Z99A 1ZAOA 4HF1A 4HYEA 4KT5C 3HYIA 3ABTA 4NB5A 1RUNA 1FBSA 4P55A 3COAC 1FYLA 1SD5A 4G7ZF 4RS8A 1SFEA 4B8XA 4M6XA 4KICA 4WCGA 1F4KA 2JRTA 3W6JB 5DUIA 2PQ8A 5L3FA 2A6HF 3I71A 5FD5A 4ENKA 2JPBA 3WTVC 3LQQA 4R8HA 3RPQA 1IRGA 3M9AA 3F3XA 1G6NA 4KYWA 2ZO4A 2BEOA 1BOAA 3R6SA 1O3TA 1YTYA 1YIOA 1U5TC 1SAXA 3DFGA 2Y48A 3QP5A 1QNTA 3MAJA 2M45A 2VXZA 2J5OA 3KP6A 3EUHA 3V8LA 3GEZA 2PI0A 3J81K 1OYWA 1WRJA 1Y0UA 1FWZA 2DW4A 2GWRA 3RTRA 5HDNA 2FNPA 4HDUA 4LFUA 4DNCA 3IRRA 4ESBA 1I6XA 1O7FA 4HBLA 3WTUC 5LBQA 3RKWA 4CZZA 1S3JA 2KIMA 3I59A 5ILSA 2MA3A 3WE2A 1DPRA 5E1ZB 1U8RA 2XASA 5ERIA 2O61A 1R23A 3HIFA 5E1WA 2FMYA 4EM1A 4MEXF 4UVBA 3HOSA 2IVMA 2VE9A 3QU3A 1ZRCA 3IC7A 2FA5A 3HUGA 3I54A 2QM3A 2QQ9A 2WV0A 2HKOA 1W7PA 5F1RA 1CGPA 2O3FA 1MDMB 3F6VA 3I0TA 1ZYRF 2P4WA 1KU9A 3BWGA 2NNYA 3BJ6A 1W4MA 2XKPA 1B9MA 1IN7A 2WWYA 3CUQC 2L4AA 1H0MA 4S04A 2MLKA 1FOKA 1QPMA 1ON2A 4KIFA 4O5VA 2IW5A 3SXYA 3ML6A 3RPUA 2YR2A 1PUEE 1J5YA 2EA2A 1OKRA 4RB2C 4OIRF 4N9IA 2O6GE 2HTJA 1UHWA 3HRTA 4ENNA 1UCRA 3WGGA 1TBXA 3CTAA 3ZMVA 4XSZF 3GYHX 3F23A 1XDUA 3HOTA 1S6LA 2O03A 1FC3A 4NHJA 1PP8F 3BY6A 1OR7A 3V7RA 1FYMA 4A6EA 2UWMA 2HWVA 2MH9A 1ZG1A 4KUMA 1IN8A 2FXAA 5DDGA 4U7DA 2H09A 1KYWA 4CDGA 1C0WA 2Y75A 4EJWA 3HTUA 1R58A 5BQTA 2V79A 1TNSA 1P92A 1BI2A 3V8KA 4U88A 4G7OF 1DDNA 4LD5A 3GUDA 3J80K 4L0ZB 3T5XA 4BHBA 3WTWC 3WU0A 1LDJA 3LA7A 3L00A 1JXSA 3L09A 4HOBA 2A61A 3P9IA 4U0WA 4MEYF 1BC8C 5D5WB 2FBHA 4MQVA 3GF2A 5IT9Z 1Z7UA 5JI6A 3C1DA 3I5UA 3KETA 1W7PD 5E1XA 1XSXA 3K0LA 1U78A 4H0EA 1D3YA 1W5SA 2BV6A 3TGNA 3ZP5A 2A07F 2IRFG 4RAYA 2VOPA 4UV8A 1B1BA 4EM2A 1OYIA 5DUKA 2K4BA 2PN6A 4AIHA 3DEUA 3J80Z 3K69A 4GXOA 2NAZA 3MZYA 5HLIA 3QU6A 2VN2A 1L3LA 3JAMZ 4Z2YA 5K1YA 2EFPA 4GCVA 4ON0A 5F64A 2DK5A 3ZMDA 3R4KA 4L18B 2XKOA 2XGXA 2X0LA 4U0YA 4JQFA 4DQ2A 4M9SA 4A5MA 5ED4A 2NYXA 2FRHA 4UXNA 4XLPF 4CGZA 4JK1X 1QZZA 2FNAA 3F72A 2D1VA 4LG0B 2L01A 3FXRA 1BN5A 2W25A 4EMSA 4M6YA 3B02A 2XROA 4QLCU 1CF7A 1ZGJA 1UHMA 4HF2A 4KMFA 4YIFA 1SMTA 3GFIA 2F5DA 4A5NA 2RC4A 5K5QA 4WWCA 1A04A 4RGUA 1FT9A 1F1ZA 5CVRA 1ZARA 4BHCA 3EQLF 2CGPA 1ZRDA 4HF0A 5H6RA 4CXFA 4I01A 1GVJA 2ELHA 2IPQX 5AONA 4XBFA 5FB2A 5J8CA 1XGOA 2W24A 2XHKA 4OMZA 3BZ6A 2H27A 2K86A 2M87A 1HW5A 2ZCWA 1MGTA 2Q8KA 1USTA 4R1HA 2QQBA 1G3SA 2BYVE 4RAZA 5CVVA 5LHGA 3FHZA 2XAQA 4OU0A 4EM0B 2ZBKA 4R79A 3GZ6A 1R7JA 3ZPLA 3TO7A 2V9VA 4OIOF 4RB0A 4GO1A 2DTRA 2HFHA 5TRDA 4NQWA 5HVQC 1OMIA 3KCCA 1STZA 5D5XB 2M1BA 1ODDA 4L5JA 4N9HA 4HQMA 2V1XA 5D8KB 3WTYC 5H6QA 2YX4A 4KMUX 4LB5A 3GO5A 3LAJA 3KLOA 1S8NA 2ISYA 2LKPA 2W85A 3C7JA 5BPDA 3DP7A 2HZTA 3MEXA 2E1NA 4WF2A 3KEOA 4UV9A 3VODA 1SFUA 1T0FA 1B59A 2NNNA 4ASNA 1J9IA 2QBYA 1TNTA 2MBFA 4Y17A 5JVTA 1ULYA 1W7PB 2QENA 3CUOA 3Q5FA 2UZKA 5LGTA 3O6BB 3ZMUA 2XAGA 1U6GA 1R5GA 3AAFA 1YW7A 3KP7A 2PMUA 1BI1A 4A0YA 2ESHA 2UXNA 2ESNA 2DU9A 1XGMA 5HLGA 5D4RA 3TOAA 1ON1A 1DUXC 2A3SA 4KDPA 4AVPA 2IP2A 1WSUA 5D5UB 1RI7A 4ZH4F 4A2UA 4IPAA 1S7AA 5ICCA 1DPUA 1KQ8A 3H92A 1FZPB 1TW3A 3P9KA 3D5LA 2CW0F 1HKSA 2M30A 5LHHA 2O0YA 2PBIA 3K1PA 4O6JA 1I1GA 5DYMA 2VT2A 2W84A 3N4MA 1YW9A 4M73A 1BIAA 1FSEA 1Z05A 3FM3A 1JGSA 2B0LA 3ERED 1K78A 1FNNA 2D1HA 4AIJA 2CYYA 5DCMA 2MD5A 1RZ4A 2IA1A 3ROUA 5FD6A 1UB9A 5KK1A 5LGNA 2GIVA 4L5IA 1T38A 3O3KA 3KP4A 5LEKA 3E6BA 3KZZA 2DPUA 4KA4A 5E8IA 2PFBA 3QP6A 1LNWA 1H9TA 2V1DA 1IXCA 2AXLA 3G3ZA 2XVCA 3E5XA 2CWEA 2VONA 2YU3A 5K5OA 2W57A 5L3CA 5K5RA 5ICFA 1LDKB 2HOEA 1U5TA 1J2XA 3I58A 1H9GA 3CO6C 5E8GA 5HOOA 3HSFA 2A68F 4IRIA 1QZYA 1JHFA 4MHGA 5L3DA 1IN6A 2AS5F 1LEBA 3DKWA 4A12A 3WG9A 4A0ZA 2D45A 1AOYA 3V8JA 3FMRA 5D5VB 2WTEA 4HAMA 4PGGA 3J81Z 4GYGA 4EJOA 3O2PE 2UXXA 2HS5A 1X3UA 3F8FA 2M8EA 2L54A 5CJ9A 2XIGA 3PQJA 3IKVA 4UHTA 1REPC 1FBQA 3GFMA 3GW2A 2RVCA 5TJJA 5BS6A 2MLGA 4Q4ZF 1BBYA 2J5PA 1HKQA 1IUYA 2DT5A 5LLQA 2KRFA 4BHPA 2Z3YA 4FX0A 1CF7B 5L3EA 2E7XA 1YW8A 1LVAA 4D0PA 1O7LA 1XB4A 1FPQA 3P9CA 1ZH5A 2Q2EA 4I02A 2DI3A 3DQVC 2VBWA 4IRGA 3GFLA 3TO9A 2GXBA 5FLXK 2EV5A 4HX8A 5F6FA 2EV0A 4CO8A 4HV6A 2VE8A 5AIQA 3WTSC 4Q47A 3CUQA 3KP2A 1JHHA 1R1UA 2OQGA 2YSRA 1IN5A 1LEAA 2C6YA 1MKMA 4CYDA 2ZMEA 2STWA 3RDIA 3SHFA 3RKXA 4LLLA 3E3VA 4YFKF 4I09A 4ENJA 2CFXA 2BE5F 2BGCA 1LQ1A 2F5EA 2P5KA 2G7UA 1GHCA 2FSWA 4CICA 2FBIA 5JFRA 1USSA 4LK1F 3ZN1A 2ACJA 2XAHA 2Z33A 5D8LB 3F6OA 4HV5A 4P96A 2LNBA 1R5HA 4MQ9F 3WTZA 4MTDA 4QWQA 1XCBA 3FM5A 5DD8A 3MFKA 1BM9A 4PGHA 1K7AA 3G73A 3T8TA 2ISZA 1KQ9A 1QGPA 4HLXA 3JW4A 4WX9A 4AWXB 3F21A 3DPLC 4Y15A 3L7WA 2JZYA 3JTGA 2CO5A 1TQIA 1ZREA 3IHUA 3V7CA 2QBYB 3BROA 3K9TA 4RGXA 2JPCA 4G7HF 3J7AO 2JTVA 5AIPA 4PZJA 5L3BA 4O3MA 2IA0A 2Y0MA 3KLNA 3HHGA 4GGGA 4Y13A 4UNOA 2KJBA 5J8FA 1V4RA 4M72A 4A6DA 1HBXG 5D6EA 2L4MA 3F8MA 5L3GA 3ECOA 2HGCA 1YS7A 2QZ8A 2DBBA 1EH7A 2F5CA 4FT8A 2KKOA 3MZHA 4IRHA 5BOXA 2EFWA 4F7ZA 2HEOA 2FF4A 3E6DA 4LMYA 4YG2F 3WU1B 3DXJF 2OQRA 3LAPA 3HSEA 3T8RA 3H3UA 1XGSA 1S7OA 1WKMA 3IL2A 1MDMA 4OIQF 2V1UA 1FSHA 3E6CC 2CSOA 2PLYA 2HTSA 2IT0A 2CQKA 1RNLA 4EJTA 2ZNYA 4B09A 2QVOA 4CHUA 2GA1A 2XAFA 2FMLA 4I0BA 3LWFA 4I7HA 3T0YA 3E97A 4L0YB 1HKTA 3C3WA 1NHAA 3CO7C 4JBAA 4PDKA 4LLNA 2RV8A 3DPTA 3IWFA 3U9GA 3ULQB 5DCMB 4I2OA 1O57A 1HW1A 2VBYA 4ESFA 6PAXA 2PG4A 2EA4A 1IZ1A 4ETSA 3EETA 2GAUA 1ZN2A 3N97A 3LA2A 5HDKA 2EFNA 3Q9VA 4L9TA 3M1EA 3WGHA 2EWNA 4OINF 1IXSB 5CLSA 4WK8F 1J75A 5LRSA 4LK0F 1YFHA 2HQRA 1SFXA 1R00A 2R3SA 5JHUA 3BDDA 2FOKA 2HR3A 1RIOH 4AIKA 4YFNF 2K4JA 3DF8A 3W6KB 5DCFA 2QWWA 2HYFA 5E20A 3SFZA 5ILVA 3TDZC 3GVAA 4FHTA 2ZJ2A 3HSRA 2GQQA 4GYIA 2DQRA 2DO7A 1IW7F 1U5TB 3I59B 1ONVA 4PCQA 1MJAA 2STTA 5HS9A 2F2EA 2V6CA 5HS7A 2LDUA 4BNCA 3I64A 2YX7A 2K02A 3FX3A 3ZMZA 4EV0A 1SD4A 2R7DA 3TO6A 3KE2A 3CJNA 3FF5A 4RB1A 1J59A 1MJ9A 2PJPA 2G7HA 1TTYA 3GX4X 3EDPA 1P4XA 3RIRA 3FMQA 5LGUA 1YYVA 1UFMA 5D4SA 5FO5A 5EEHA 4S05A 1U2WA 3HHHA 3JSPA 4P9FA 2OBPA 3WODF 2EJRA 1KGSA 4HA8A 2VBXA 2GXGA 1BI0A 3Q9SA 4UVCA 1KU3A 4ZZLA 5J6XA 2GA2A 1EH6A 1ZGAA 4XRFA 1SD7A 4IXAA 4OOIA 4LGWA 3R61A 3ELKA 2KIFA 4KIBA 1KU2A 2EFOA 2JT1A 5D6FA 1G4DA 1WWXA 1XSDA 1O3QA 3CDHA 3REOA 3HTSB 2FQ3A 2L3DA 3TKYA 1BI3A 5H20A 2LF8A 2ADUA 4G8XA 2HYGD 2OAZA 1IAWA 4RGSA 3CUQB 1E2XA 2XRNA 4HX7A 4WXCA 3WTXC 1IRFA 4IHSA 3BPVA 1ZG5A 1XMAA 1FX7A 1HSTA 1G3YA 2ZMEB 1MJBA 3IKTA 5DEQA 1F9NA 2ZKZA 2GZWA 2RN7A 3FXUA 2COMA 4Q5SF 1G3TA 3M7GA 3SZTA 1KA8A 1TW2A 2DK8A 2QQAA 3RJPA 4LJZF 4HQEA 3GZ5A 4BXUA 4G94A 2Z5UA 2OA4A 3KZYA 3VOEA 3E5UA 2A6EF 4UVAA 3KEQA 3OV8A 1BC7C 2Z9OA 1ZRFA 4LB6B 2EFQA 2PEXA 2VT3A 3ZMSA 3MWMA 2FBKA 1P4AA 2OD5A 5HLHA 3GLXA 5E18F 3OOPA 1KQ0A 2FE3A 3QPHA 4G9YA 1FYKA 2DPDA 3K1NA 3R0AA 3QAHA 2LSOA 4A0XA 5DD4A 3P7NA 1G3WA 3TOBA 2HDCA 2R7FA 3FXQA 4I0AA 1EV7A 2RNJA 3GXOA 4HDVA 3TDUC 3LA3A 1QQIA 3L2CA 2P8TA 1HSJA 1Q1HA 4E70A 2A5YB 3R0JA 4ESJA 4ZYGA 1Z91A 2ETHA 2P7VB 1HXDA 3ZN0A 1BJAA 2OZ6A 2NRAC 2H94A 1Z9CA 4BAYA 1PDNC 4HLYA 4ZYHA 1WI9A 1LJ9A 3BOQA 4BYYA 2ZNZA 1YS6A 1P4WA 5A2QK 4EGZA 3PFIA 1XMKA 1ZLKA 2P5VA 3F8BA 1GXPA 3LQRA 4ZZDA 5JR3A 1J0RA 1KU7A 4OIPF 1I27A 5ICEA 3KFWX 3LFKA 1WQ2A 3KP5A 1QBJA 4U0VA 5ILUA 4IF4A 1MD0A 3IWZA 2IA2A 2O8XA 5CVIA 1YG2A 2EB7A 1K6OA 3MQ0A 4G6QA 5IT9K 2EV6A 4KNYA 1T39A 4ZYEA 1P6RA 2RDPA 2VOOA 2PMHA 4IVNA 2FEZA 5LHIA 5A2QZ 3JSOA 1IXRC 2E1CA 3RKYA 4EQQA 3M8FA 2IJLA 5KVRA 3I53A 5FLXZ 3M8EA 2VBZA 2ZXJA 2A69F 3GFJA 3E5QA 4EJUA 3V7SA 3SZPA 3D0SA 5IT3A 3U1DA 3K1MA 2DAOA 1AWCA 1OPCA 1ZG3A 2QYOA 3RYRA 4YFXF 2P6SA 2M5WA 2L02A 4HW0A 3JAMK 2RQPA 1ZHFA 4K2EA 1B6AA 1R1TA 1TQMA 1YQAA 1Z1DA 4EVIA 1B4AA 5FFZA 3IRQA 2K7LA 2H6BA 3F22A 4ZYDA 3NQOA 1PP7U 2KIUA 3V4GA 2RGVA 1T2KA 1HQCA 3ABUA 2OZUA 3F8CA 1O3RA 1QO0D 2LF7A 5CVUA 2KJCA 2P5LC 3FZVA 3HRSA 2H6CA 4Q48A 4G6DA 3PQKA 4UUVA 3ZQ7A 3VEPA 1Z6RA 1L0OC 1D8JA 1V3FA 1J7KA 1FY7A 4HZFA 3T1BA 2YPRA 1RUOA 2XAJA 3NRVA 2DLLA 3VB2A 4RB3C 2ZFWA 3WE3A 3LSTA 4FX4A 4HX4A 3ECHA 3L9FA 4P5OA 1XD7A 2RKHA 4EJVA 3SQNA 1R22A 3QOPA 1T6SA 2DFIA 1JE8A 3K2ZA 3CLOA 4KFCA 1R1VA 3WTTC 2FU4A 1LB2A 4U7BA 4KN4X 1BIBA 1D5VA 4MTEA 3DV8A 1OYYA 2E7WA 5FFXA 4MNUA 3RYPA 4YIIA 4P9UA 2JSCA 1XDSA 1HW2A 1D8KA 1FLIA 3I4PA 1K78B 4IHTA 5E17F 4EGYA 3FMSA 2D2WA 1IF1A 3BJOA 4WXHA 1EH8A 3FWEA 2XV4S 1IN4A 4AD9A 1XCVA 3ISPA 4M71A 2G9WA 3MCZA 2OU2A 3EYYA 3KP3A 4TV7A 1I1SA 2EK5A 5ICGA 3B73A 1XGNA 4KIGA 3JTHA 1F5TA 1VTNC 3BJAA 5HDGA 4RGRA 3QRFF 1I5ZA 4OMYA 1GXQA 3F8NA 3QPTA 4L9NA 4ENMA 5LRRA 5CVJA 2MH2A 2WC2A 1T98A 1ZLJA 1FBUA 1TQPA 3R60A 3H3ZA 2CG4A 3EYIA 1U3EM 5BMZA 1FP1D 3NEUA 1YO5C 3S2WA 2P7CB 2K27A 2VODA 4MGRA 3HRMA 1LDDA 2P6TA 5FGMA 1W5TA 1SD6A 2MC3A 2VC0A 4BH9A 4I98B 5EEGA 5LEJA 4L9VA 5DV5A 1FP2A 5HS8A 1TLHB 4M74A 1MZBA 4IJAA 3VFZA 1K79A 4M9ZA 4L9JA 2XUBA 1S29A 2DQLA 2X4HA 1XN7A 2TDXA 3TQNA 4N0BA 3WGIA 2BBYA 1R36A 3RI4A 3C18A 4XLNF 2NS0A 1DP7P 3GWZA 1YLFA 3BP8A 3HRUA 2Q0OA 4LLGF 1XSVA 4BQAA 1B9NA 1KYZA 2QUFA 2VC1A 2QLZA 3E6MA 2HQNA 5BPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2F A;  2HKX A;  4WXD A;  1E17 A;  4LG0 A;  2F5F A;  1O3S A;  3ZMT A;  5CYV A;  3BPX A;  3U2R A;  1Z6T A;  4KN7 X;  4M9X A;  1SMY F;  4XSX F;  2Z99 A;  1ZAO A;  4HF1 A;  4HYE A;  4KT5 C;  3HYI A;  3ABT A;  4NB5 A;  1RUN A;  1FBS A;  4P55 A;  3COA C;  1FYL A;  1SD5 A;  4G7Z F;  4RS8 A;  1SFE A;  4B8X A;  4M6X A;  4KIC A;  4WCG A;  1F4K A;  2JRT A;  3W6J B;  5DUI A;  2PQ8 A;  5L3F A;  2A6H F;  3I71 A;  5FD5 A;  4ENK A;  2JPB A;  3WTV C;  3LQQ A;  4R8H A;  3RPQ A;  1IRG A;  3M9A A;  3F3X A;  1G6N A;  4KYW A;  2ZO4 A;  2BEO A;  1BOA A;  3R6S A;  1O3T A;  1YTY A;  1YIO A;  1U5T C;  1SAX A;  3DFG A;  2Y48 A;  3QP5 A;  1QNT A;  3MAJ A;  2M45 A;  2VXZ A;  2J5O A;  3KP6 A;  3EUH A;  3V8L A;  3GEZ A;  2PI0 A;  3J81 K;  1OYW A;  1WRJ A;  1Y0U A;  1FWZ A;  2DW4 A;  2GWR A;  3RTR A;  5HDN A;  2FNP A;  4HDU A;  4LFU A;  4DNC A;  3IRR A;  4ESB A;  1I6X A;  1O7F A;  4HBL A;  3WTU C;  5LBQ A;  3RKW A;  4CZZ A;  1S3J A;  2KIM A;  3I59 A;  5ILS A;  2MA3 A;  3WE2 A;  1DPR A;  5E1Z B;  1U8R A;  2XAS A;  5ERI A;  2O61 A;  1R23 A;  3HIF A;  5E1W A;  2FMY A;  4EM1 A;  4MEX F;  4UVB A;  3HOS A;  2IVM A;  2VE9 A;  3QU3 A;  1ZRC A;  3IC7 A;  2FA5 A;  3HUG A;  3I54 A;  2QM3 A;  2QQ9 A;  2WV0 A;  2HKO A;  1W7P A;  5F1R A;  1CGP A;  2O3F A;  1MDM B;  3F6V A;  3I0T A;  1ZYR F;  2P4W A;  1KU9 A;  3BWG A;  2NNY A;  3BJ6 A;  1W4M A;  2XKP A;  1B9M A;  1IN7 A;  2WWY A;  3CUQ C;  2L4A A;  1H0M A;  4S04 A;  2MLK A;  1FOK A;  1QPM A;  1ON2 A;  4KIF A;  4O5V A;  2IW5 A;  3SXY A;  3ML6 A;  3RPU A;  2YR2 A;  1PUE E;  1J5Y A;  2EA2 A;  1OKR A;  4RB2 C;  4OIR F;  4N9I A;  2O6G E;  2HTJ A;  1UHW A;  3HRT A;  4ENN A;  1UCR A;  3WGG A;  1TBX A;  3CTA A;  3ZMV A;  4XSZ F;  3GYH X;  3F23 A;  1XDU A;  3HOT A;  1S6L A;  2O03 A;  1FC3 A;  4NHJ A;  1PP8 F;  3BY6 A;  1OR7 A;  3V7R A;  1FYM A;  4A6E A;  2UWM A;  2HWV A;  2MH9 A;  1ZG1 A;  4KUM A;  1IN8 A;  2FXA A;  5DDG A;  4U7D A;  2H09 A;  1KYW A;  4CDG A;  1C0W A;  2Y75 A;  4EJW A;  3HTU A;  1R58 A;  5BQT A;  2V79 A;  1TNS A;  1P92 A;  1BI2 A;  3V8K A;  4U88 A;  4G7O F;  1DDN A;  4LD5 A;  3GUD A;  3J80 K;  4L0Z B;  3T5X A;  4BHB A;  3WTW C;  3WU0 A;  1LDJ A;  3LA7 A;  3L00 A;  1JXS A;  3L09 A;  4HOB A;  2A61 A;  3P9I A;  4U0W A;  4MEY F;  1BC8 C;  5D5W B;  2FBH A;  4MQV A;  3GF2 A;  5IT9 Z;  1Z7U A;  5JI6 A;  3C1D A;  3I5U A;  3KET A;  1W7P D;  5E1X A;  1XSX A;  3K0L A;  1U78 A;  4H0E A;  1D3Y A;  1W5S A;  2BV6 A;  3TGN A;  3ZP5 A;  2A07 F;  2IRF G;  4RAY A;  2VOP A;  4UV8 A;  1B1B A;  4EM2 A;  1OYI A;  5DUK A;  2K4B A;  2PN6 A;  4AIH A;  3DEU A;  3J80 Z;  3K69 A;  4GXO A;  2NAZ A;  3MZY A;  5HLI A;  3QU6 A;  2VN2 A;  1L3L A;  3JAM Z;  4Z2Y A;  5K1Y A;  2EFP A;  4GCV A;  4ON0 A;  5F64 A;  2DK5 A;  3ZMD A;  3R4K A;  4L18 B;  2XKO A;  2XGX A;  2X0L A;  4U0Y A;  4JQF A;  4DQ2 A;  4M9S A;  4A5M A;  5ED4 A;  2NYX A;  2FRH A;  4UXN A;  4XLP F;  4CGZ A;  4JK1 X;  1QZZ A;  2FNA A;  3F72 A;  2D1V A;  4LG0 B;  2L01 A;  3FXR A;  1BN5 A;  2W25 A;  4EMS A;  4M6Y A;  3B02 A;  2XRO A;  4QLC U;  1CF7 A;  1ZGJ A;  1UHM A;  4HF2 A;  4KMF A;  4YIF A;  1SMT A;  3GFI A;  2F5D A;  4A5N A;  2RC4 A;  5K5Q A;  4WWC A;  1A04 A;  4RGU A;  1FT9 A;  1F1Z A;  5CVR A;  1ZAR A;  4BHC A;  3EQL F;  2CGP A;  1ZRD A;  4HF0 A;  5H6R A;  4CXF A;  4I01 A;  1GVJ A;  2ELH A;  2IPQ X;  5AON A;  4XBF A;  5FB2 A;  5J8C A;  1XGO A;  2W24 A;  2XHK A;  4OMZ A;  3BZ6 A;  2H27 A;  2K86 A;  2M87 A;  1HW5 A;  2ZCW A;  1MGT A;  2Q8K A;  1UST A;  4R1H A;  2QQB A;  1G3S A;  2BYV E;  4RAZ A;  5CVV A;  5LHG A;  3FHZ A;  2XAQ A;  4OU0 A;  4EM0 B;  2ZBK A;  4R79 A;  3GZ6 A;  1R7J A;  3ZPL A;  3TO7 A;  2V9V A;  4OIO F;  4RB0 A;  4GO1 A;  2DTR A;  2HFH A;  5TRD A;  4NQW A;  5HVQ C;  1OMI A;  3KCC A;  1STZ A;  5D5X B;  2M1B A;  1ODD A;  4L5J A;  4N9H A;  4HQM A;  2V1X A;  5D8K B;  3WTY C;  5H6Q A;  2YX4 A;  4KMU X;  4LB5 A;  3GO5 A;  3LAJ A;  3KLO A;  1S8N A;  2ISY A;  2LKP A;  2W85 A;  3C7J A;  5BPD A;  3DP7 A;  2HZT A;  3MEX A;  2E1N A;  4WF2 A;  3KEO A;  4UV9 A;  3VOD A;  1SFU A;  1T0F A;  1B59 A;  2NNN A;  4ASN A;  1J9I A;  2QBY A;  1TNT A;  2MBF A;  4Y17 A;  5JVT A;  1ULY A;  1W7P B;  2QEN A;  3CUO A;  3Q5F A;  2UZK A;  5LGT A;  3O6B B;  3ZMU A;  2XAG A;  1U6G A;  1R5G A;  3AAF A;  1YW7 A;  3KP7 A;  2PMU A;  1BI1 A;  4A0Y A;  2ESH A;  2UXN A;  2ESN A;  2DU9 A;  1XGM A;  5HLG A;  5D4R A;  3TOA A;  1ON1 A;  1DUX C;  2A3S A;  4KDP A;  4AVP A;  2IP2 A;  1WSU A;  5D5U B;  1RI7 A;  4ZH4 F;  4A2U A;  4IPA A;  1S7A A;  5ICC A;  1DPU A;  1KQ8 A;  3H92 A;  1FZP B;  1TW3 A;  3P9K A;  3D5L A;  2CW0 F;  1HKS A;  2M30 A;  5LHH A;  2O0Y A;  2PBI A;  3K1P A;  4O6J A;  1I1G A;  5DYM A;  2VT2 A;  2W84 A;  3N4M A;  1YW9 A;  4M73 A;  1BIA A;  1FSE A;  1Z05 A;  3FM3 A;  1JGS A;  2B0L A;  3ERE D;  1K78 A;  1FNN A;  2D1H A;  4AIJ A;  2CYY A;  5DCM A;  2MD5 A;  1RZ4 A;  2IA1 A;  3ROU A;  5FD6 A;  1UB9 A;  5KK1 A;  5LGN A;  2GIV A;  4L5I A;  1T38 A;  3O3K A;  3KP4 A;  5LEK A;  3E6B A;  3KZZ A;  2DPU A;  4KA4 A;  5E8I A;  2PFB A;  3QP6 A;  1LNW A;  1H9T A;  2V1D A;  1IXC A;  2AXL A;  3G3Z A;  2XVC A;  3E5X A;  2CWE A;  2VON A;  2YU3 A;  5K5O A;  2W57 A;  5L3C A;  5K5R A;  5ICF A;  1LDK B;  2HOE A;  1U5T A;  1J2X A;  3I58 A;  1H9G A;  3CO6 C;  5E8G A;  5HOO A;  3HSF A;  2A68 F;  4IRI A;  1QZY A;  1JHF A;  4MHG A;  5L3D A;  1IN6 A;  2AS5 F;  1LEB A;  3DKW A;  4A12 A;  3WG9 A;  4A0Z A;  2D45 A;  1AOY A;  3V8J A;  3FMR A;  5D5V B;  2WTE A;  4HAM A;  4PGG A;  3J81 Z;  4GYG A;  4EJO A;  3O2P E;  2UXX A;  2HS5 A;  1X3U A;  3F8F A;  2M8E A;  2L54 A;  5CJ9 A;  2XIG A;  3PQJ A;  3IKV A;  4UHT A;  1REP C;  1FBQ A;  3GFM A;  3GW2 A;  2RVC A;  5TJJ A;  5BS6 A;  2MLG A;  4Q4Z F;  1BBY A;  2J5P A;  1HKQ A;  1IUY A;  2DT5 A;  5LLQ A;  2KRF A;  4BHP A;  2Z3Y A;  4FX0 A;  1CF7 B;  5L3E A;  2E7X A;  1YW8 A;  1LVA A;  4D0P A;  1O7L A;  1XB4 A;  1FPQ A;  3P9C A;  1ZH5 A;  2Q2E A;  4I02 A;  2DI3 A;  3DQV C;  2VBW A;  4IRG A;  3GFL A;  3TO9 A;  2GXB A;  5FLX K;  2EV5 A;  4HX8 A;  5F6F A;  2EV0 A;  4CO8 A;  4HV6 A;  2VE8 A;  5AIQ A;  3WTS C;  4Q47 A;  3CUQ A;  3KP2 A;  1JHH A;  1R1U A;  2OQG A;  2YSR A;  1IN5 A;  1LEA A;  2C6Y A;  1MKM A;  4CYD A;  2ZME A;  2STW A;  3RDI A;  3SHF A;  3RKX A;  4LLL A;  3E3V A;  4YFK F;  4I09 A;  4ENJ A;  2CFX A;  2BE5 F;  2BGC A;  1LQ1 A;  2F5E A;  2P5K A;  2G7U A;  1GHC A;  2FSW A;  4CIC A;  2FBI A;  5JFR A;  1USS A;  4LK1 F;  3ZN1 A;  2ACJ A;  2XAH A;  2Z33 A;  5D8L B;  3F6O A;  4HV5 A;  4P96 A;  2LNB A;  1R5H A;  4MQ9 F;  3WTZ A;  4MTD A;  4QWQ A;  1XCB A;  3FM5 A;  5DD8 A;  3MFK A;  1BM9 A;  4PGH A;  1K7A A;  3G73 A;  3T8T A;  2ISZ A;  1KQ9 A;  1QGP A;  4HLX A;  3JW4 A;  4WX9 A;  4AWX B;  3F21 A;  3DPL C;  4Y15 A;  3L7W A;  2JZY A;  3JTG A;  2CO5 A;  1TQI A;  1ZRE A;  3IHU A;  3V7C A;  2QBY B;  3BRO A;  3K9T A;  4RGX A;  2JPC A;  4G7H F;  3J7A O;  2JTV A;  5AIP A;  4PZJ A;  5L3B A;  4O3M A;  2IA0 A;  2Y0M A;  3KLN A;  3HHG A;  4GGG A;  4Y13 A;  4UNO A;  2KJB A;  5J8F A;  1V4R A;  4M72 A;  4A6D A;  1HBX G;  5D6E A;  2L4M A;  3F8M A;  5L3G A;  3ECO A;  2HGC A;  1YS7 A;  2QZ8 A;  2DBB A;  1EH7 A;  2F5C A;  4FT8 A;  2KKO A;  3MZH A;  4IRH A;  5BOX A;  2EFW A;  4F7Z A;  2HEO A;  2FF4 A;  3E6D A;  4LMY A;  4YG2 F;  3WU1 B;  3DXJ F;  2OQR A;  3LAP A;  3HSE A;  3T8R A;  3H3U A;  1XGS A;  1S7O A;  1WKM A;  3IL2 A;  1MDM A;  4OIQ F;  2V1U A;  1FSH A;  3E6C C;  2CSO A;  2PLY A;  2HTS A;  2IT0 A;  2CQK A;  1RNL A;  4EJT A;  2ZNY A;  4B09 A;  2QVO A;  4CHU A;  2GA1 A;  2XAF A;  2FML A;  4I0B A;  3LWF A;  4I7H A;  3T0Y A;  3E97 A;  4L0Y B;  1HKT A;  3C3W A;  1NHA A;  3CO7 C;  4JBA A;  4PDK A;  4LLN A;  2RV8 A;  3DPT A;  3IWF A;  3U9G A;  3ULQ B;  5DCM B;  4I2O A;  1O57 A;  1HW1 A;  2VBY A;  4ESF A;  6PAX A;  2PG4 A;  2EA4 A;  1IZ1 A;  4ETS A;  3EET A;  2GAU A;  1ZN2 A;  3N97 A;  3LA2 A;  5HDK A;  2EFN A;  3Q9V A;  4L9T A;  3M1E A;  3WGH A;  2EWN A;  4OIN F;  1IXS B;  5CLS A;  4WK8 F;  1J75 A;  5LRS A;  4LK0 F;  1YFH A;  2HQR A;  1SFX A;  1R00 A;  2R3S A;  5JHU A;  3BDD A;  2FOK A;  2HR3 A;  1RIO H;  4AIK A;  4YFN F;  2K4J A;  3DF8 A;  3W6K B;  5DCF A;  2QWW A;  2HYF A;  5E20 A;  3SFZ A;  5ILV A;  3TDZ C;  3GVA A;  4FHT A;  2ZJ2 A;  3HSR A;  2GQQ A;  4GYI A;  2DQR A;  2DO7 A;  1IW7 F;  1U5T B;  3I59 B;  1ONV A;  4PCQ A;  1MJA A;  2STT A;  5HS9 A;  2F2E A;  2V6C A;  5HS7 A;  2LDU A;  4BNC A;  3I64 A;  2YX7 A;  2K02 A;  3FX3 A;  3ZMZ A;  4EV0 A;  1SD4 A;  2R7D A;  3TO6 A;  3KE2 A;  3CJN A;  3FF5 A;  4RB1 A;  1J59 A;  1MJ9 A;  2PJP A;  2G7H A;  1TTY A;  3GX4 X;  3EDP A;  1P4X A;  3RIR A;  3FMQ A;  5LGU A;  1YYV A;  1UFM A;  5D4S A;  5FO5 A;  5EEH A;  4S05 A;  1U2W A;  3HHH A;  3JSP A;  4P9F A;  2OBP A;  3WOD F;  2EJR A;  1KGS A;  4HA8 A;  2VBX A;  2GXG A;  1BI0 A;  3Q9S A;  4UVC A;  1KU3 A;  4ZZL A;  5J6X A;  2GA2 A;  1EH6 A;  1ZGA A;  4XRF A;  1SD7 A;  4IXA A;  4OOI A;  4LGW A;  3R61 A;  3ELK A;  2KIF A;  4KIB A;  1KU2 A;  2EFO A;  2JT1 A;  5D6F A;  1G4D A;  1WWX A;  1XSD A;  1O3Q A;  3CDH A;  3REO A;  3HTS B;  2FQ3 A;  2L3D A;  3TKY A;  1BI3 A;  5H20 A;  2LF8 A;  2ADU A;  4G8X A;  2HYG D;  2OAZ A;  1IAW A;  4RGS A;  3CUQ B;  1E2X A;  2XRN A;  4HX7 A;  4WXC A;  3WTX C;  1IRF A;  4IHS A;  3BPV A;  1ZG5 A;  1XMA A;  1FX7 A;  1HST A;  1G3Y A;  2ZME B;  1MJB A;  3IKT A;  5DEQ A;  1F9N A;  2ZKZ A;  2GZW A;  2RN7 A;  3FXU A;  2COM A;  4Q5S F;  1G3T A;  3M7G A;  3SZT A;  1KA8 A;  1TW2 A;  2DK8 A;  2QQA A;  3RJP A;  4LJZ F;  4HQE A;  3GZ5 A;  4BXU A;  4G94 A;  2Z5U A;  2OA4 A;  3KZY A;  3VOE A;  3E5U A;  2A6E F;  4UVA A;  3KEQ A;  3OV8 A;  1BC7 C;  2Z9O A;  1ZRF A;  4LB6 B;  2EFQ A;  2PEX A;  2VT3 A;  3ZMS A;  3MWM A;  2FBK A;  1P4A A;  2OD5 A;  5HLH A;  3GLX A;  5E18 F;  3OOP A;  1KQ0 A;  2FE3 A;  3QPH A;  4G9Y A;  1FYK A;  2DPD A;  3K1N A;  3R0A A;  3QAH A;  2LSO A;  4A0X A;  5DD4 A;  3P7N A;  1G3W A;  3TOB A;  2HDC A;  2R7F A;  3FXQ A;  4I0A A;  1EV7 A;  2RNJ A;  3GXO A;  4HDV A;  3TDU C;  3LA3 A;  1QQI A;  3L2C A;  2P8T A;  1HSJ A;  1Q1H A;  4E70 A;  2A5Y B;  3R0J A;  4ESJ A;  4ZYG A;  1Z91 A;  2ETH A;  2P7V B;  1HXD A;  3ZN0 A;  1BJA A;  2OZ6 A;  2NRA C;  2H94 A;  1Z9C A;  4BAY A;  1PDN C;  4HLY A;  4ZYH A;  1WI9 A;  1LJ9 A;  3BOQ A;  4BYY A;  2ZNZ A;  1YS6 A;  1P4W A;  5A2Q K;  4EGZ A;  3PFI A;  1XMK A;  1ZLK A;  2P5V A;  3F8B A;  1GXP A;  3LQR A;  4ZZD A;  5JR3 A;  1J0R A;  1KU7 A;  4OIP F;  1I27 A;  5ICE A;  3KFW X;  3LFK A;  1WQ2 A;  3KP5 A;  1QBJ A;  4U0V A;  5ILU A;  4IF4 A;  1MD0 A;  3IWZ A;  2IA2 A;  2O8X A;  5CVI A;  1YG2 A;  2EB7 A;  1K6O A;  3MQ0 A;  4G6Q A;  5IT9 K;  2EV6 A;  4KNY A;  1T39 A;  4ZYE A;  1P6R A;  2RDP A;  2VOO A;  2PMH A;  4IVN A;  2FEZ A;  5LHI A;  5A2Q Z;  3JSO A;  1IXR C;  2E1C A;  3RKY A;  4EQQ A;  3M8F A;  2IJL A;  5KVR A;  3I53 A;  5FLX Z;  3M8E A;  2VBZ A;  2ZXJ A;  2A69 F;  3GFJ A;  3E5Q A;  4EJU A;  3V7S A;  3SZP A;  3D0S A;  5IT3 A;  3U1D A;  3K1M A;  2DAO A;  1AWC A;  1OPC A;  1ZG3 A;  2QYO A;  3RYR A;  4YFX F;  2P6S A;  2M5W A;  2L02 A;  4HW0 A;  3JAM K;  2RQP A;  1ZHF A;  4K2E A;  1B6A A;  1R1T A;  1TQM A;  1YQA A;  1Z1D A;  4EVI A;  1B4A A;  5FFZ A;  3IRQ A;  2K7L A;  2H6B A;  3F22 A;  4ZYD A;  3NQO A;  1PP7 U;  2KIU A;  3V4G A;  2RGV A;  1T2K A;  1HQC A;  3ABU A;  2OZU A;  3F8C A;  1O3R A;  1QO0 D;  2LF7 A;  5CVU A;  2KJC A;  2P5L C;  3FZV A;  3HRS A;  2H6C A;  4Q48 A;  4G6D A;  3PQK A;  4UUV A;  3ZQ7 A;  3VEP A;  1Z6R A;  1L0O C;  1D8J A;  1V3F A;  1J7K A;  1FY7 A;  4HZF A;  3T1B A;  2YPR A;  1RUO A;  2XAJ A;  3NRV A;  2DLL A;  3VB2 A;  4RB3 C;  2ZFW A;  3WE3 A;  3LST A;  4FX4 A;  4HX4 A;  3ECH A;  3L9F A;  4P5O A;  1XD7 A;  2RKH A;  4EJV A;  3SQN A;  1R22 A;  3QOP A;  1T6S A;  2DFI A;  1JE8 A;  3K2Z A;  3CLO A;  4KFC A;  1R1V A;  3WTT C;  2FU4 A;  1LB2 A;  4U7B A;  4KN4 X;  1BIB A;  1D5V A;  4MTE A;  3DV8 A;  1OYY A;  2E7W A;  5FFX A;  4MNU A;  3RYP A;  4YII A;  4P9U A;  2JSC A;  1XDS A;  1HW2 A;  1D8K A;  1FLI A;  3I4P A;  1K78 B;  4IHT A;  5E17 F;  4EGY A;  3FMS A;  2D2W A;  1IF1 A;  3BJO A;  4WXH A;  1EH8 A;  3FWE A;  2XV4 S;  1IN4 A;  4AD9 A;  1XCV A;  3ISP A;  4M71 A;  2G9W A;  3MCZ A;  2OU2 A;  3EYY A;  3KP3 A;  4TV7 A;  1I1S A;  2EK5 A;  5ICG A;  3B73 A;  1XGN A;  4KIG A;  3JTH A;  1F5T A;  1VTN C;  3BJA A;  5HDG A;  4RGR A;  3QRF F;  1I5Z A;  4OMY A;  1GXQ A;  3F8N A;  3QPT A;  4L9N A;  4ENM A;  5LRR A;  5CVJ A;  2MH2 A;  2WC2 A;  1T98 A;  1ZLJ A;  1FBU A;  1TQP A;  3R60 A;  3H3Z A;  2CG4 A;  3EYI A;  1U3E M;  5BMZ A;  1FP1 D;  3NEU A;  1YO5 C;  3S2W A;  2P7C B;  2K27 A;  2VOD A;  4MGR A;  3HRM A;  1LDD A;  2P6T A;  5FGM A;  1W5T A;  1SD6 A;  2MC3 A;  2VC0 A;  4BH9 A;  4I98 B;  5EEG A;  5LEJ A;  4L9V A;  5DV5 A;  1FP2 A;  5HS8 A;  1TLH B;  4M74 A;  1MZB A;  4IJA A;  3VFZ A;  1K79 A;  4M9Z A;  4L9J A;  2XUB A;  1S29 A;  2DQL A;  2X4H A;  1XN7 A;  2TDX A;  3TQN A;  4N0B A;  3WGI A;  2BBY A;  1R36 A;  3RI4 A;  3C18 A;  4XLN F;  2NS0 A;  1DP7 P;  3GWZ A;  1YLF A;  3BP8 A;  3HRU A;  2Q0O A;  4LLG F;  1XSV A;  4BQA A;  1B9N A;  1KYZ A;  2QUF A;  2VC1 A;  2QLZ A;  3E6M A;  2HQN A;  5BPI A; 
#chains in the Genus database with same CATH topology
 3WHC A;  4PJ0 C;  1P2F A;  2HKX A;  1KON A;  4WXD A;  1D1A A;  5FKL A;  2AO9 A;  3GTL J;  1E17 A;  4LG0 A;  2HI3 A;  4PJN A;  2F5F A;  1XG1 A;  1A36 A;  2HOT A;  1O3S A;  1DQU A;  3ZMT A;  2R7T A;  2JMW A;  3B6C A;  3J7Z I;  5CYV A;  3BPX A;  3U2R A;  2ELK A;  1Z6T A;  4KN7 X;  3F0C A;  1WVR A;  1X1B A;  4M9X A;  1SMY F;  1NG7 A;  4XSX F;  3ZRG A;  4C9Y A;  3J7Y J;  2WB1 N;  3A1Y A;  2Z99 A;  3IAM 2;  1ZAO A;  4HF1 A;  4HYE A;  4KT5 C;  3HYI A;  4H4K C;  3ABT A;  4NB5 A;  3PSI A;  3CCE I;  3S14 J;  1RUN A;  1FBS A;  2DA3 A;  4PK4 A;  4P55 A;  1T8I A;  2LYC A;  3W2A A;  3COA C;  4NC7 A;  1FYL A;  4IOA F;  1SD5 A;  1T95 A;  4G7Z F;  1MMA A;  1ORK A;  1OCR H;  1ETY A;  4D7N A;  4RS8 A;  1SFE A;  4B8X A;  4M6X A;  1YRN A;  4KIC A;  4WCG A;  1F4K A;  2VJ4 A;  2JRT A;  3W6J B;  1QU3 A;  1VQL I;  3EUH C;  5DUI A;  1MBJ A;  2PQ8 A;  4E7I A;  5L3F A;  4M6V A;  2A6H F;  3I71 A;  5FD5 A;  4ENK A;  2JPB A;  3WTV C;  2IGK A;  1ZR2 A;  4IHV A;  3LQQ A;  2DMU A;  4R8H A;  4XLA A;  3RPQ A;  1IRG A;  2ZXW H;  1NK2 P;  3M9A A;  3WU2 C;  3F3X A;  1G6N A;  1ETW A;  3BG6 A;  2ZO4 A;  4KYW A;  1YOV B;  4A69 C;  1ZKG A;  4RAG A;  2JVH A;  4Z6Y A;  1WPK A;  2BEO A;  1BOA A;  3R6S A;  1O3T A;  3MKW B;  1W0U A;  4YIR X;  2HZD A;  1YIO A;  5TGT A;  1N25 A;  1U5T C;  1VZ0 A;  2CQQ A;  1YTY A;  1SAX A;  2LP0 A;  2XF6 A;  3DFG A;  2Y48 A;  2E5N A;  3QP5 A;  1QNT A;  3MAJ A;  2M45 A;  3UR3 C;  2VXZ A;  2J5O A;  1WJ5 A;  3KP6 A;  3EUH A;  3V8L A;  3GEZ A;  3QOE A;  1XC5 A;  5FRM A;  4IHX A;  2PI0 A;  1A6I A;  3NAU A;  1OYW A;  1WRJ A;  1Y0U A;  1FWZ A;  2DW4 A;  2GWR A;  2VQH A;  3RTR A;  5HDN A;  1UHS A;  2FX0 A;  1WH7 A;  2FNP A;  5J40 A;  4ZTJ A;  4HDU A;  4II3 A;  4LFU A;  4ANJ A;  4DNC A;  3A2K A;  1P7J A;  3IRR A;  1SVM A;  4BQN A;  5F04 A;  5GAH J;  2PJR A;  4ESB A;  1LKX A;  1S5L C;  1I6X A;  1O7F A;  2X9D A;  4HBL A;  4PSW A;  3WTU C;  1WJF A;  3OSG A;  3QPL A;  5LBQ A;  3QPS A;  3RKW A;  2E60 A;  5DM7 F;  4CZZ A;  1ERD A;  1S3J A;  2KIM A;  3SZG A;  3JRB A;  1IJW C;  3I59 A;  5ILS A;  2MA3 A;  3WE2 A;  1HC8 A;  1DPR A;  2M0M A;  5E1Z B;  1UG2 A;  4DGW B;  1U8R A;  3ABM H;  2XAS A;  2ZSH B;  2YU9 J;  3M4O J;  5ERI A;  1MIJ A;  3S93 A;  2O61 A;  3J81 K;  1R23 A;  3HIF A;  1Q1V A;  5E1W A;  2BHZ A;  2FMY A;  5TIS C;  2LBF A;  2CH0 A;  3W2V A;  3ESW B;  1S72 I;  4EM1 A;  5GPA A;  4MEX F;  1U9N A;  4UVB A;  2R7W A;  3HOS A;  3DU6 A;  2DMT A;  3K4L A;  2IVM A;  2JK3 A;  1WJE A;  2CUJ A;  2VE9 A;  2F4I A;  2XRL A;  3G1L A;  4A3C J;  3QU3 A;  3N05 A;  1ZRC A;  3IC7 A;  2FA5 A;  3HUG A;  4B3X A;  1FJL A;  3I54 A;  2QM3 A;  4DZJ A;  3QYE A;  2QQ9 A;  2LH9 A;  2WV0 A;  4CSW A;  5E3M A;  2HKO A;  2KLO A;  1W7P A;  4M3B A;  2BW3 B;  5M5X J;  4XRS G;  5F1R A;  1CGP A;  3CZ6 A;  2O3F A;  2FD5 A;  1D1B A;  1MDM B;  2D5V A;  1XPX A;  3F6V A;  3LSP A;  3I0T A;  4RLQ A;  1ZYR F;  2P4W A;  1KU9 A;  3BWG A;  2Y31 A;  2NNY A;  2DCE A;  4MO7 A;  3BJ6 A;  3CCR I;  1W36 C;  4C2U A;  1WJD A;  1SEU A;  3LSG A;  3OYJ A;  3JRE A;  5M3F J;  1W4M A;  2XKP A;  1ETK A;  2M0C A;  1B9M A;  1IN7 A;  2WWY A;  3CUQ C;  3OSF A;  2L4A A;  1FMW A;  1H0M A;  4S04 A;  1MW7 A;  2MLK A;  5DTD A;  1YIJ I;  1FOK A;  4X1E A;  1QPM A;  1SAN A;  2BZT A;  1VQP I;  1ON2 A;  1WHU A;  4KIF A;  4O5V A;  2IW5 A;  3SXY A;  3CMY A;  3ML6 A;  3RPU A;  2YR2 A;  1PUE E;  1J5Y A;  4AYB N;  2JA2 A;  2EA2 A;  5EF6 A;  1OKR A;  4RB2 C;  4JYK A;  1E0E A;  2K3F A;  4Y4R A;  2E2H J;  3G2B A;  4N9I A;  4OIR F;  1RR8 C;  2O6G E;  2O5R A;  4XKW A;  2IGM A;  1IUF A;  2HTJ A;  1UHW A;  3HRT A;  3L2R A;  4ENN A;  4Y52 J;  1UCR A;  3FIW A;  3WGG A;  1D0Y A;  1TBX A;  3CTA A;  3ZMV A;  1JKP C;  4XSZ F;  3GYH X;  3F23 A;  3GTP J;  3LOC A;  1PYV A;  1XDU A;  2F4O B;  4DOZ A;  1WI3 A;  3DLL F;  4B44 A;  3HOT A;  2XAU A;  4OAY A;  1S6L A;  2O03 A;  5JHF A;  1JJ6 C;  1MNE A;  1FC3 A;  4NHJ A;  2CV1 A;  2UUZ A;  4P1W A;  1PP8 F;  1W1W E;  1X4O A;  3BY6 A;  3FKI J;  4F93 B;  4E7J A;  3U21 A;  1OCP A;  1OR7 A;  4BE1 A;  2EQR A;  3V7R A;  5LFA A;  4A6E A;  1FYM A;  2UWM A;  3QQA A;  4XN0 A;  4HNT A;  2HWV A;  2MH9 A;  2DT7 B;  3EUA A;  3PM1 A;  1ZG1 A;  4KUM A;  1IN8 A;  2DOF A;  2FXA A;  1DU6 A;  5DDG A;  4U7D A;  2H09 A;  5K7F A;  1KYW A;  2XB0 X;  2DTZ A;  4CDG A;  4JOM A;  1C0W A;  1Z7L A;  2Y75 A;  4EJW A;  2H1L A;  3HTU A;  3ASN H;  1QZE A;  1R58 A;  3S2H J;  2KRC A;  5BQT A;  2V79 A;  5LD2 C;  2RAE A;  3FBN B;  1TNS A;  3J7A Y;  1P92 A;  1BI2 A;  1HF0 A;  4BUP A;  3V8K A;  2DDA A;  1PUF A;  4U88 A;  5IP9 J;  1T08 B;  2KP6 A;  4BJT A;  4G7O F;  1DDN A;  2MG4 A;  4LD5 A;  3GUD A;  1MMG A;  3J80 K;  4L0Z B;  3T5X A;  4BHB A;  3WTW C;  3WU0 A;  3K6G A;  2DMP A;  3CP2 A;  1LDJ A;  3LA7 A;  3L00 A;  1JXS A;  2DN0 A;  3L09 A;  3OY9 A;  4HOB A;  2A61 A;  3P9I A;  4U0W A;  4HPQ A;  3JRD A;  1EA3 A;  4MEY F;  1BC8 C;  3L2V A;  5D5W B;  2FBH A;  2E1M C;  4MQV A;  3OYD A;  3GF2 A;  3CDI A;  5IT9 Z;  1LE8 A;  2LY9 A;  1Z7U A;  5IY5 H;  5JI6 A;  2TCT A;  3C1D A;  3DPU A;  3BLY A;  3I5U A;  3KET A;  1W7P D;  1YI2 I;  5E1X A;  1XSX A;  2W4S A;  2WAQ N;  3ABL H;  3K0L A;  5DM6 F;  1U78 A;  2EBI A;  5GP9 A;  4H0E A;  1D3Y A;  1W5S A;  2BV6 A;  3TGN A;  3ZP5 A;  4JX6 A;  2A07 F;  2IRF G;  4RAY A;  5EJC A;  2K3P A;  2VOP A;  4UV8 A;  1Z0X A;  1B1B A;  1TWG J;  2F4M B;  4EM2 A;  1OYI A;  5DUK A;  2K4B A;  5K7H A;  2PN6 A;  4AIH A;  2LVS A;  2VQL A;  5FLM J;  3HOV J;  3DEU A;  3C2B A;  4HG2 A;  3J80 Z;  3K69 A;  4GXO A;  1OLT A;  4BE2 A;  5C44 J;  2VAS A;  2NAZ A;  3MZY A;  5HLI A;  3QU6 A;  2VN2 A;  2K5C A;  1L3L A;  3JAM Z;  4Z2Y A;  5K1Y A;  2EFP A;  4GCV A;  4ON0 A;  5F64 A;  3RPU D;  2BY1 A;  2DK5 A;  3ZMD A;  3R4K A;  1T33 A;  4L18 B;  2XKO A;  2XGX A;  2X0L A;  4U0Y A;  5J47 A;  4JQF A;  5J4V A;  2FJ1 A;  4DQ2 A;  3H5R A;  4M9S A;  2ME6 A;  1TWH J;  3DCF A;  2LLK A;  5EGO B;  2R5Z B;  3BR6 A;  4A5M A;  3OYM A;  5FLV A;  5ED4 A;  2NYX A;  3S2D J;  4BDY A;  3HPH A;  2FRH A;  3A03 A;  3ZQL A;  3HKZ A;  3TP3 A;  4UXN A;  4XLP F;  3RQI A;  1TWF J;  3A0B C;  1WCM J;  3OOU A;  4CGZ A;  3VYR B;  3E1S A;  2HXO A;  4JK1 X;  1I50 J;  1QZZ A;  2CUE A;  2FNA A;  3F72 A;  2D1V A;  1W5C C;  4LIU A;  4XLF A;  4LG0 B;  2L01 A;  1F36 A;  1BN5 A;  2MAB A;  3FXR A;  2AQF A;  2W25 A;  4EMS A;  1YIT I;  3OYG A;  4M6Y A;  3HOW J;  3B02 A;  2XRO A;  4QLC U;  1CF7 A;  1ZGJ A;  1A5J A;  1UHM A;  4HF2 A;  4KMF A;  4YIF A;  1SMT A;  1MBK A;  3GFI A;  1PVE A;  4KT6 A;  2F5D A;  4A5N A;  2HXI A;  2RC4 A;  5K5Q A;  1A31 A;  4WWC A;  3H5A A;  2ME0 A;  1A04 A;  1X4P A;  3NWS A;  1WFX A;  5EZG A;  2W00 A;  3LSI A;  2KDZ A;  4RGU A;  4CYC A;  2QF7 A;  3H0G J;  1YRN B;  1FT9 A;  1F1Z A;  1RC9 A;  1EKE A;  5CVR A;  1ZAR A;  2HDW A;  4BKX A;  4BHC A;  3EQL F;  2CGP A;  2ZXI A;  1ZRD A;  5CPR B;  3CCQ I;  2OC6 A;  1G59 A;  2ZFU A;  4NDL A;  4HF0 A;  5H6R A;  3OYN A;  4E7S A;  4CXF A;  4I01 A;  1GVJ A;  1A35 A;  1TC3 C;  2ELH A;  2IPQ X;  2LY2 A;  1FIP A;  5AON A;  2CFO A;  4XBF A;  1FEX A;  5FB2 A;  5J8C A;  3BG9 A;  1XGO A;  2W24 A;  2XHK A;  4OMZ A;  2Y9Z A;  3BZ6 A;  1MMS A;  2MYS A;  3HEF A;  1X19 A;  2H27 A;  2K86 A;  2CS3 A;  3VSK A;  4B3A A;  5EG0 A;  3GTG J;  2M87 A;  3VPR A;  1HW5 A;  1WJB A;  2ZCW A;  1MGT A;  2Q8K A;  3CJR B;  1UST A;  4R1H A;  2QQB A;  1G3S A;  2BYV E;  5IPA A;  3K70 C;  4RAZ A;  5CVV A;  3CCM I;  4BE0 A;  5LHG A;  1FOW A;  4XKC A;  3CCU I;  3NAR A;  3FHZ A;  2XAQ A;  1XX5 A;  4OU0 A;  3CJT B;  4EM0 B;  2ZBK A;  4R79 A;  3GZ6 A;  1R7J A;  5C3E J;  3TO7 A;  3ZPL A;  2V9V A;  1N75 A;  4OIO F;  2M9H A;  4RB0 A;  1MNM C;  4GO1 A;  2XGE A;  2DTR A;  5IOZ A;  2VKE A;  2HFH A;  2V7F A;  2ICW G;  4CCM A;  3OYE A;  4NQW A;  1SAU A;  4N4O B;  5TRD A;  5HVQ C;  2CV0 A;  2CMP A;  1ETV A;  4M3F A;  1OMI A;  1Y6I A;  2AQE A;  3HL2 A;  3KCC A;  1ETX A;  2PJR B;  1STZ A;  4YEL A;  3TMO A;  5D5X B;  2M1B A;  1Y39 A;  1ETQ A;  2R92 J;  2BY0 A;  1ODD A;  2CQX A;  4L5J A;  4N9H A;  4HQM A;  4F55 A;  2V1X A;  5D8K B;  3WTY C;  5H6Q A;  2YX4 A;  2WAE A;  4KMU X;  4LB5 A;  3V42 A;  2DJN A;  3AL0 C;  4UUS A;  4IEJ A;  1QVT A;  3E7L A;  4F92 B;  1RR7 A;  2LY1 A;  2MSY A;  1JKQ C;  3PO2 J;  2R5Y A;  2HDD A;  3GO5 A;  3LAJ A;  1IRX A;  3S1M J;  3KLO A;  1S8N A;  2ISY A;  2LKP A;  2CRG A;  1UMQ A;  2W85 A;  2EH3 A;  3WHB A;  3C7J A;  5BPD A;  3DP7 A;  2CUZ A;  3PFY A;  2HZT A;  3W3C A;  3MEX A;  2K9M A;  2E1N A;  2LBF B;  1R4M B;  2PMZ N;  4WF2 A;  3HOX J;  3Q0U A;  3KEO A;  1G8X A;  4YEJ A;  4UV9 A;  3VOD A;  4D5F A;  1SFU A;  5KAI C;  2CV2 A;  1T0F A;  1B59 A;  2NNN A;  4ASN A;  2ZJQ F;  2HPM A;  1J9I A;  2QBY A;  1UEL B;  1TNT A;  2X85 A;  2YUS A;  2MBF A;  1A6Q A;  1ENH A;  4Y17 A;  5JVT A;  1ULY A;  1W7P B;  3QWL A;  4J00 A;  2O7O A;  2QEN A;  2QGU A;  1GUU A;  2LTP A;  3CUO A;  3HOY J;  4V2G A;  3Q5F A;  3K4C A;  2B9S A;  1YJ9 I;  2UZK A;  5LGT A;  3O8H A;  5HNF A;  4CZC A;  3O6B B;  3ZMU A;  1VQK I;  2XAG A;  2Y0S A;  1U6G A;  3OIO A;  5GTH C;  1R5G A;  3K10 A;  1YW7 A;  3AAF A;  1TL8 A;  3BZC A;  2I5U A;  3KP7 A;  2PMU A;  1BI1 A;  1OCO H;  2XGC A;  3H9J A;  4IZZ A;  4A0Y A;  2ESH A;  2UXN A;  1VQ5 I;  2ESN A;  3ZCO A;  2DU9 A;  1XGM A;  5HLG A;  5D4R A;  4ZTF A;  3TOA A;  4AM3 A;  1ON1 A;  2OTL I;  4ZYA A;  2M7B A;  1DUX C;  2A3S A;  4KDP A;  4AVP A;  2WA0 A;  1Y1V J;  2IP2 A;  2DOD A;  1WSU A;  5D5U B;  1RI7 A;  4ZH4 F;  3GTQ J;  4A2U A;  4IPA A;  1YX5 A;  1S7A A;  5ICC A;  1DPU A;  1Y56 A;  1KQ8 A;  2CQ7 A;  1SC7 A;  1LFB A;  3H92 A;  1TW3 A;  3VSL A;  3ABK H;  1FZP B;  3P9K A;  3D5L A;  3BC8 A;  2R7U A;  5CKT A;  2CW0 F;  3S1R J;  1HKS A;  3K4N A;  2XPW A;  4I6Z A;  2IXS A;  2VKD A;  2M30 A;  5LHH A;  3I4N J;  2BY2 A;  2KZV A;  1H88 C;  2WAF A;  4CCK A;  5HOD A;  5FKM A;  1BW5 A;  2O0Y A;  2JUG A;  2PBI A;  3K1P A;  2H8W A;  4O6J A;  2LD5 A;  5IP6 A;  2Y69 H;  1I1G A;  4HSR A;  5DYM A;  1TT5 B;  2VT2 A;  2W84 A;  1YW9 A;  4M73 A;  3N4M A;  1GT0 C;  1BIA A;  3FHN A;  1FSE A;  1Z05 A;  2M7A A;  3FM3 A;  2GXA A;  1Y8R B;  1JGS A;  2B0L A;  3ERE D;  4A3D J;  1K78 A;  2LK2 A;  1JJ8 C;  3A0H C;  1FNN A;  2NS7 A;  1HDP A;  2F6C A;  1BJZ A;  2X51 A;  5FRN A;  2D1H A;  1Z21 A;  2ZJP F;  3KZI C;  3M1C A;  4AIJ A;  3GZN B;  2CYY A;  2QA4 I;  5DCM A;  2MD5 A;  3WG7 H;  4X0G A;  2EZI A;  1RZ4 A;  2IA1 A;  3BTI A;  3K70 D;  3BZK A;  3ROU A;  1MMN A;  1PUF B;  4AU7 A;  5FD6 A;  1Y8Q B;  1BW6 A;  4NNJ A;  4UY8 I;  3C2H A;  3G4S I;  4E6K G;  1VI0 A;  1UB9 A;  3LSH A;  5KK1 A;  5GAE J;  2QKM B;  2GIV A;  2OPT A;  4L5I A;  5LGN A;  1T38 A;  2HPI A;  3O3K A;  1FMV A;  2L7F P;  4KIT B;  3KP4 A;  5LEK A;  3E6B A;  3KZZ A;  3CMA I;  2DPU A;  4KA4 A;  4FCY A;  5E8I A;  2Q1Z B;  2PFB A;  3QP6 A;  1LNW A;  4PJJ A;  2NVT J;  1H9T A;  1OCT C;  2DT6 A;  3ZGK A;  2V1D A;  2ZSI B;  2FUG 2;  1LE8 B;  5KNL A;  1IXC A;  2AXL A;  2KL4 A;  3CDL A;  1I6H J;  3GTO J;  4D9J A;  2N8G A;  3LSR A;  3G3Z A;  2LRD A;  3A01 A;  2XVC A;  3E5X A;  2CWE A;  3HM5 A;  4U87 A;  2MGQ A;  2VON A;  2X1C A;  2I10 A;  1E3O C;  4JP0 A;  1OQY A;  1RKW A;  2YU3 A;  5K5O A;  4KJZ A;  2XPU A;  1O4X A;  2W57 A;  2JA8 J;  4CH7 A;  5L3C A;  5K5R A;  5IOY A;  4PSX A;  5ICF A;  3PIO F;  2MD0 A;  1LDK B;  2HOE A;  1U5T A;  3GTJ J;  1J2X A;  3I58 A;  1H9G A;  5F08 A;  4AUX A;  1B72 A;  3KX2 A;  1JKO C;  3CO6 C;  5E8G A;  3IUO A;  5HOO A;  3IAS 2;  1I3A A;  1MBH A;  3HSF A;  5KAF C;  2A68 F;  4HEA 2;  2NVQ J;  1GV5 A;  4RBO A;  3TP0 A;  4IRI A;  1QZY A;  4CCL A;  3DKX A;  1JHF A;  3OIQ A;  4MHG A;  5L3D A;  1IN6 A;  2AS5 F;  1LEB A;  3DKW A;  4A12 A;  3WG9 A;  4A0Z A;  2D45 A;  1MH3 A;  3ASO H;  1AOY A;  2OV7 A;  4FIS A;  3V8J A;  2W1O A;  3BR2 A;  3FMR A;  1VQO I;  3RSN A;  2DJI A;  5D5V B;  2WTE A;  4HAM A;  4PGG A;  2F48 A;  4JX5 A;  5BNG A;  3J81 Z;  2JA5 J;  1FTZ A;  4GYG A;  1NG6 A;  2VJJ A;  4GRI A;  4EJO A;  1HOM A;  3O2P E;  1MSF C;  2UXX A;  2HS5 A;  3S1Q J;  1X3U A;  4E4H A;  4Y3O A;  4BXX J;  3F8F A;  1IO2 A;  2M8E A;  2L54 A;  4QPO A;  3CCJ I;  5CJ9 A;  2R7X A;  2ZC2 A;  2XIG A;  3PQJ A;  3IKV A;  4UHT A;  1REP C;  5F0C A;  3FIS A;  1FBQ A;  4QIW N;  3GFM A;  2GOM A;  3PNT A;  3GW2 A;  2RVC A;  5TJJ A;  5E3O A;  2VLA A;  3HB9 A;  3HBL A;  5J1Y A;  5B1A H;  5BS6 A;  2MLG A;  3BQZ A;  4AID A;  4F91 B;  4Q4Z F;  1BBY A;  2J5P A;  1HKQ A;  1IUY A;  5CQG A;  2M4K A;  2DT5 A;  2F5V A;  5LLQ A;  1AKH A;  2KRF A;  4BHP A;  2Z3Y A;  4FX0 A;  4B4C A;  4BJ5 C;  1CF7 B;  1WJC A;  5L3E A;  3I55 I;  2Z1D A;  2E7X A;  1YW8 A;  1LVA A;  3U1K A;  1APL C;  4KIS A;  4D0P A;  4HST A;  1O7L A;  1XB4 A;  1FPQ A;  3P9C A;  1ZH5 A;  2Q2E A;  4I02 A;  4M3G A;  2BXZ A;  5J1R A;  2OJE D;  3ZQH A;  2NVU B;  3S17 J;  1GLN A;  4PFO A;  1I3Q J;  4UB6 C;  5H2F C;  2DI3 A;  3DQV C;  3FBI B;  2ZME C;  3KIO A;  2VBW A;  4DBR A;  1H89 C;  3OR2 C;  4BQO A;  1ITY A;  4CYC B;  4IRG A;  3GFL A;  3TO9 A;  2GXB A;  5FLX K;  3SEZ A;  5GPC A;  4XKB A;  1MMD A;  4FET A;  2EV5 A;  4HX8 A;  3A4C A;  5F6F A;  2EV0 A;  2LKX A;  4CO8 A;  4HV6 A;  4IKF A;  1ZTR A;  2VE8 A;  1G2H A;  5AIQ A;  4HRI A;  3WTS C;  4Q47 A;  1VQ9 I;  2QKL B;  2DXI A;  4DYQ A;  4DJA A;  3CUQ A;  3KP2 A;  1MBF A;  1JHH A;  1R1U A;  1I39 A;  2OQG A;  4NBQ A;  2YSR A;  1IN5 A;  1LEA A;  2H8R A;  2NXN B;  2C6Y A;  3PIP F;  3VWB A;  1MKM A;  2QSH X;  4CYD A;  4PFP A;  4HNV A;  1P7I A;  5GTI C;  4LIV A;  3D5R C;  2ZME A;  2STW A;  3RDI A;  3SHF A;  3RKX A;  1FIA A;  2VPL A;  4LLL A;  4A3I J;  3E3V A;  4YFK F;  4I09 A;  4ENJ A;  2RRE A;  2CFX A;  2VPR A;  2BE5 F;  1S7E A;  1R6R A;  2BGC A;  1IRZ A;  4FTH A;  1LQ1 A;  2V9P A;  4A3B J;  2F5E A;  1JUM A;  2MW8 A;  2P5K A;  2G7U A;  2X6W A;  1GHC A;  2FSW A;  5FKK A;  3W2W A;  2E1O A;  4CIC A;  2FBI A;  5JFR A;  3DEE A;  1USS A;  4LK1 F;  2R7Q A;  4NQW B;  3G71 I;  3ZN1 A;  2ACJ A;  4Y33 A;  5F1J A;  2W7N A;  2XAH A;  2LRE A;  2Z33 A;  1Z77 A;  1V5E A;  5D8L B;  4CCJ A;  3F6O A;  1YJN I;  4HV5 A;  2KIS A;  3I9V 2;  2LNB A;  4P96 A;  2VQG A;  1R5H A;  3CCY A;  4ZC3 A;  4MQ9 F;  3VYU B;  3WTZ A;  4MTD A;  1Z3X A;  2W82 A;  4QWQ A;  4XR6 A;  1XCB A;  2P0W A;  3FM5 A;  4UUS B;  2DFF A;  3E0J B;  4B47 A;  3S32 A;  5DD8 A;  3MFK A;  4BL0 B;  2R5Y B;  2Z16 A;  2DA2 A;  1BM9 A;  4PGH A;  3ZQC A;  1NK3 P;  3I56 I;  1K7A A;  4MFD A;  4BXF A;  1ETO A;  1KZH A;  4GFB A;  2LC2 A;  3G73 A;  3T8T A;  2ISZ A;  2OTJ I;  1KQ9 A;  2VKH A;  4FE7 A;  1QGP A;  4Y7N J;  3TL4 X;  1SVL A;  4HLX A;  3JW4 A;  4WX9 A;  4AWX B;  3HKZ N;  1XMX A;  1IV6 A;  3F21 A;  3DPL C;  2WY7 Q;  4Y15 A;  1VF9 A;  3L7W A;  2DA7 A;  2JZY A;  3JTG A;  4N4N B;  2CO5 A;  3OYI A;  1TQI A;  1ZRE A;  4L5E A;  3H0D A;  3IHU A;  3V7C A;  2QBY B;  4D7M A;  1EF4 A;  3DEW A;  1LFU P;  4I76 A;  3BRO A;  3K9T A;  4DIQ A;  3SEQ A;  4RGX A;  1CQT A;  2JPC A;  4QPQ A;  4G7H F;  1D1C A;  3J7A O;  3BCA A;  1XTA A;  2JTV A;  4BS9 A;  5AIP A;  2QEX I;  1GDT A;  4PZJ A;  5L3B A;  1QRY A;  4O3M A;  5B3S H;  1VQ4 I;  4ZJZ A;  3JRG A;  3MKL A;  1BR4 A;  2IA0 A;  2I8D A;  2Y0M A;  3KLN A;  4IX7 A;  3K4J A;  3HHG A;  4CA0 A;  2VIX A;  4GGG A;  4Y13 A;  4UNO A;  2IEK A;  2KJB A;  1V4R A;  5J8F A;  2WBM A;  3OYK A;  4M72 A;  4A6D A;  4IQ4 A;  1FTT A;  1HBX G;  3AG1 H;  3I3L A;  1P9Q C;  5D6E A;  4CCO A;  2L4M A;  3F8M A;  4RA2 A;  5L3G A;  3ECO A;  2HGC A;  1YS7 A;  3MD2 A;  2QZ8 A;  2X48 A;  2DBB A;  1EH7 A;  3AG3 H;  2F5C A;  4FT8 A;  4A3M J;  3FXL A;  3OYF A;  2KKO A;  3MZH A;  2IGO A;  1W36 D;  4IRH A;  1SVO A;  5BOX A;  2EFW A;  3HDD A;  4F7Z A;  3PSF A;  2HEO A;  3QYF A;  2FF4 A;  3E6D A;  4LMY A;  2ECC A;  3FK6 A;  1ZEL A;  3Q0V A;  4YG2 F;  3DXJ F;  1POG A;  5F27 A;  3WU1 B;  3D1N I;  2OQR A;  3LAP A;  3CQZ J;  4B43 A;  3HSE A;  1UJ8 A;  3H3U A;  1XGS A;  3T8R A;  2E36 A;  3OYB A;  1S7O A;  1WKM A;  3IL2 A;  1MDM A;  3JCU C;  5GAD J;  4OIQ F;  2KDO A;  2V1U A;  1JTX A;  1FSH A;  4F52 A;  3E6C C;  5J3L A;  2CSO A;  2PLY A;  3FXM A;  2HTS A;  1DU0 A;  3ZQG A;  2IT0 A;  2CQK A;  4XN3 A;  1RNL A;  3GME A;  4EJT A;  2ZNY A;  2QQ8 A;  4B09 A;  5DS9 A;  3BR0 A;  2QVO A;  2HOA A;  3RKQ A;  2FOW A;  2FQ4 A;  4CHU A;  2GA1 A;  3KPH A;  2XAF A;  2FML A;  3M8J A;  4I0B A;  3PUF A;  3SYT A;  3LWF A;  1ZGW A;  4FAS D;  2E2I J;  4A93 J;  4V19 K;  4I7H A;  2ZB9 A;  3HGG A;  1Y0N A;  3T0Y A;  1LPQ A;  5GAG J;  3E97 A;  4L0Y B;  1HKT A;  1VQ7 I;  3C3W A;  3S16 J;  3ONQ A;  1NHA A;  3CO7 C;  4JBA A;  4PDK A;  3OYC A;  4LLN A;  2RV8 A;  1RPW A;  4XRM A;  2MC4 A;  3DPT A;  2M34 A;  4BDZ A;  3IWF A;  3BR3 A;  3U9G A;  3ULQ B;  1DP3 A;  5DCM B;  2IS4 A;  4I2O A;  1O57 A;  3S8P A;  1YJW I;  1HW1 A;  2VBY A;  4ESF A;  6PAX A;  1VQ6 I;  2PG4 A;  2EA4 A;  1IZ1 A;  2IGN A;  2X6X A;  4XM3 A;  4ETS A;  3EET A;  2GAU A;  4PJM A;  5EZH A;  1ZN2 A;  3N97 A;  3LA2 A;  5HDK A;  4BJ6 C;  2EFN A;  4A3J J;  2E19 A;  4OWR B;  1RET A;  2V26 A;  3Q9V A;  4L9T A;  4QTR A;  2XF5 A;  2Y9Y A;  3CC7 I;  1RES A;  1V55 H;  3M1E A;  3WGH A;  2EWN A;  4OIN F;  1IXS B;  5CLS A;  1F43 A;  3CCV I;  4WK8 F;  1J75 A;  3M3Y J;  5LRS A;  2QSG X;  4LK0 F;  1YFH A;  2HQR A;  1SFX A;  2KIQ A;  1R00 A;  2R3S A;  2DA6 A;  3BDD A;  2FOK A;  2HR3 A;  5JHU A;  1RIO H;  2A05 A;  4XOR A;  3X2Q H;  4YFN F;  4AIK A;  2VQC A;  2K4J A;  3DF8 A;  5J1U A;  3W6K B;  5IP7 J;  5DCF A;  2QWW A;  2HYF A;  5E20 A;  2TRT A;  3A01 B;  3SFZ A;  5ILV A;  1LVK A;  3L2Q A;  2BOL A;  2R7R A;  3OYL A;  2BVM A;  3TDZ C;  2JUC A;  3GVA A;  4FHT A;  2ZJ2 A;  5HLT A;  3H35 A;  4BY7 J;  3HSR A;  1U0J A;  2GQQ A;  3CME I;  4GYI A;  2NOG A;  2WV1 A;  2DQR A;  4XMY A;  1IW7 F;  1U5T B;  2DO7 A;  2Y0S N;  5K7Z A;  3I59 B;  3GCM A;  1U8B A;  1MND A;  1OJL A;  1ONV A;  4PCQ A;  1MJA A;  2STT A;  5HS9 A;  2MFZ A;  2F2E A;  2V6C A;  5HS7 A;  2JVG A;  2LDU A;  5J4Y A;  4BNC A;  3CF2 A;  3I64 A;  1K4S A;  2YX7 A;  2R7S A;  2K9S A;  3JRA A;  2K02 A;  3FX3 A;  4D5C A;  3RQ4 A;  3ZMZ A;  3OS0 A;  1X1A A;  2ID6 A;  4EV0 A;  2P81 A;  1SD4 A;  5E3N A;  2R7D A;  3TO6 A;  5E3L A;  3KE2 A;  3BTC A;  3OL3 A;  1FOX A;  3CJN A;  3FF5 A;  4RB1 A;  2R0Q C;  1J59 A;  1MJ9 A;  2PJP A;  1RKT A;  2ELJ A;  3HUG B;  2G7H A;  3HXL A;  4IO9 F;  1TTY A;  5IYD J;  4IOC F;  3QOD A;  3GX4 X;  2L9V A;  3DTI A;  4MIM A;  3EDP A;  1P4X A;  4M3E A;  3RIR A;  3FMQ A;  5F0H A;  5LGU A;  3K4K A;  1YYV A;  1UFM A;  2DA1 A;  5FO5 A;  5KCM A;  5D4S A;  4RDU A;  4CCN A;  4E7H A;  3FXK A;  5EEH A;  3LSM A;  4S05 A;  1U2W A;  2Y2Z A;  3HHH A;  2K40 A;  5B66 C;  2AXT C;  2CW8 A;  3JSP A;  3DLA A;  2XDV A;  4P9F A;  2OBP A;  1DGW Y;  3WOD F;  2EPF A;  2EJR A;  1HCR A;  1OCZ H;  1KGS A;  4HA8 A;  2VBX A;  2L9S A;  3EPZ A;  2GXG A;  3OS1 A;  1BI0 A;  2M3A A;  3Q9S A;  2ECB A;  2E2J J;  4UVC A;  4A3G J;  1KU3 A;  4ZZL A;  5J6X A;  2GA2 A;  1EH6 A;  1ZGA A;  3Q3S A;  4XRF A;  3RCO A;  3S3O A;  1SD7 A;  1X1C A;  4IXA A;  3BR5 A;  4IHY A;  4OOI A;  4LGW A;  3R61 A;  2Q2E B;  3ELK A;  2OCE A;  3TBI A;  3OMY A;  2XB5 A;  1YE9 A;  2KIF A;  2NOJ B;  1KU2 A;  2L0K A;  4KIB A;  4AC0 A;  4HNU A;  2B7E A;  2DMN A;  2EFO A;  4BGD A;  2HOS A;  2JT1 A;  2OCC H;  5D6F A;  3BQY A;  1G4D A;  1WWX A;  1XSD A;  3MKZ A;  2XPV A;  3CDH A;  4ITV A;  5EYR A;  3REO A;  2FQ3 A;  2HVQ A;  1O3Q A;  3HTS B;  1JI8 A;  4A3E J;  1E3H A;  2L3D A;  3TKY A;  1BI3 A;  2E71 A;  3PO3 J;  5H20 A;  4J19 A;  1NH3 A;  3W6V A;  2LF8 A;  2ADU A;  4G8X A;  2HYG D;  2OAZ A;  2X1E A;  1IAW A;  4RGS A;  3CUQ B;  5JLX A;  1E2X A;  2XRN A;  3H9G A;  4HX7 A;  4WXC A;  3WTX C;  1IRF A;  1HLV A;  4IHS A;  3VYS B;  1X1D A;  3BPV A;  2EIK H;  2ZJR F;  1ZG5 A;  1XMA A;  1X2N A;  1FX7 A;  5KHD A;  1HST A;  1M1E B;  2HVR A;  3K2A A;  4X6A J;  2O9L A;  1G3Y A;  4FE4 A;  2E35 A;  2ZME B;  3M07 A;  1MJB A;  3IKT A;  2EIN H;  1HDD C;  3DBL B;  2EZL A;  5DEQ A;  1F9N A;  2ZKZ A;  3KYC B;  5FRO A;  1OCC H;  2GZW A;  5EEA A;  2M4G A;  2RN7 A;  5E79 C;  2BHY A;  3FXU A;  2COM A;  4Q5S F;  2K9N A;  1B8I A;  1G3T A;  3M7G A;  3JRI A;  3SZT A;  3HC7 A;  1KA8 A;  1TW2 A;  2DK8 A;  3OS2 A;  3IH3 A;  1K6Y A;  2QQA A;  3RJP A;  3MN2 A;  4LJZ F;  2DOE A;  4HQE A;  3DKY A;  3FXO A;  5F0F A;  3KYL A;  3GZ5 A;  3HZJ A;  1Y1W J;  4BXU A;  4G94 A;  3IV5 A;  2Z5U A;  2OA4 A;  1YX3 A;  1WH5 A;  4DYC A;  3KZY A;  4W1U A;  3VOE A;  3E5U A;  2A6E F;  2G0E A;  2AHQ A;  3OYA A;  3L1P A;  3JR9 A;  4UVA A;  1VQN I;  4LG3 A;  5M5Y J;  3DBR B;  4ZDO A;  3KEQ A;  3OV8 A;  3GLL A;  1BC7 C;  2WB1 A;  4II2 A;  1EJ9 A;  2Z9O A;  1ZRF A;  3SDB A;  4LB6 B;  3FK7 A;  4MFE A;  1R9T J;  2EFQ A;  2PEX A;  2VT3 A;  2VUM J;  3TED A;  3UNG C;  2DFH A;  1D5Y A;  3ZMS A;  1WZ2 A;  2EIL H;  2GBY A;  3MWM A;  2R7Z J;  2FBK A;  1P4A A;  2OD5 A;  3DTK A;  1TP4 A;  4W97 A;  4BAC A;  2V1N A;  4NUB A;  2R4G A;  4J01 A;  5HLH A;  3GLX A;  5E18 F;  3JRF A;  2A6T A;  2DYS H;  2L9N A;  4XK4 A;  1R71 A;  3OOP A;  2UV1 A;  1JT0 A;  1KQ0 A;  2FE3 A;  5HNH A;  2OF7 A;  3QPH A;  3AFH A;  4G9Y A;  3UKG A;  2E1M B;  1S9H A;  1FYK A;  3K1N A;  3R0A A;  2DPD A;  3QAH A;  4JX4 A;  2ID3 A;  2LSO A;  2HNH A;  2JA7 J;  2VJ5 A;  4A0X A;  1ZK8 A;  3PUB A;  5DD4 A;  3C2G A;  3P7N A;  1G3W A;  3TOB A;  2HDC A;  1ACI A;  1D0Z A;  2R7F A;  3FXQ A;  4I0A A;  1EV7 A;  2K9L A;  2RNJ A;  2X1D A;  5IYB J;  3GXO A;  5FJ8 J;  4HDV A;  2PX9 A;  4B48 A;  4BQQ A;  3TDU C;  3LL7 A;  2L7M P;  2XF7 A;  2VKV A;  3LA3 A;  3OL4 A;  1QQI A;  3L2C A;  2P8T A;  4CUG A;  2XSJ C;  1HSJ A;  1Q1H A;  4E70 A;  2A5Y B;  1VQ8 I;  2WAD A;  3R0J A;  2DOA A;  4ESJ A;  3VDX A;  4I99 C;  4ZYG A;  3CCS I;  1Z91 A;  2ETH A;  1QHG A;  2P7V B;  4XID A;  2YS9 A;  3S3M A;  1TWA J;  1HXD A;  3ZN0 A;  1BJA A;  2OZ6 A;  2NRA C;  1IGN A;  2H94 A;  1Z9C A;  3G1O A;  4BAY A;  4HLY A;  3DU5 A;  3H36 A;  1PDN C;  4ZYH A;  1WI9 A;  2V6E A;  1LJ9 A;  3QYB A;  3BOQ A;  2EIM H;  1JT6 A;  4BYY A;  2ZXH A;  1WGX A;  2EZH A;  3ZR8 X;  2ZNZ A;  4GDF A;  1V5F A;  1AA7 A;  1YS6 A;  1JKR C;  4C3J J;  1P4W A;  2DFE A;  5A2Q K;  2KFD A;  1UG0 A;  5B1B H;  4EGZ A;  4V2F A;  5M5W J;  3PFI A;  1XMK A;  1ZLK A;  2CU7 A;  2Z2S B;  2P5V A;  4B1R A;  4BEH A;  1OR7 C;  1X3W B;  3F8B A;  2Y30 A;  1GXP A;  3LQR A;  2V4J C;  4ZZD A;  5JR3 A;  1J0R A;  1KU7 A;  3IP4 B;  3S15 J;  3G6E I;  4OIP F;  3A02 A;  3CC4 I;  2M2E A;  1LFP A;  4YRV A;  3BG5 A;  1I27 A;  5ICE A;  2XC7 A;  3KFW X;  3LFK A;  1WQ2 A;  3KP5 A;  3ZXS A;  3GTK J;  1QBJ A;  4XKV A;  3DTE A;  5EG0 B;  4U0V A;  5B5E C;  5ILU A;  4IF4 A;  1MD0 A;  3IWZ A;  2IA2 A;  2O8X A;  2NVX J;  5CVI A;  3ZQI A;  1YG2 A;  3AG4 H;  2VI6 A;  1PJR A;  2VJI A;  4RAF A;  4D1Q A;  4EEF G;  2EB7 A;  2EZK A;  3MQ0 A;  1K6O A;  3AG2 H;  4G6Q A;  4XON A;  3EUK L;  5IT9 K;  2EV6 A;  4KNY A;  4F3Q A;  1T39 A;  4ZYE A;  2R7O A;  1XS9 A;  1P6R A;  1TZL A;  2JQ7 A;  3BG7 A;  3HOU J;  3BT9 A;  2RDP A;  1MBG A;  4DZP A;  3LMM A;  2L7Z A;  2VOO A;  4A3L J;  2PMH A;  4IVN A;  3KYD B;  4C30 A;  4LIT A;  2FEZ A;  3GTM J;  3FKJ A;  2HU9 A;  5LHI A;  1MH4 A;  5A2Q Z;  3JSO A;  2KMU A;  1IXR C;  2E1C A;  2JRM A;  3MZ8 A;  3RKY A;  4EQQ A;  3M8F A;  2IJL A;  5KVR A;  3I53 A;  5FLX Z;  3M8E A;  4IL6 C;  3CMM A;  1E3P A;  2VBZ A;  1VQM I;  4ABZ A;  2ZXJ A;  2A69 F;  3GFJ A;  4AYB A;  3E5Q A;  3NWT A;  3SJM A;  1AU7 A;  3H3V K;  1HA8 A;  2DMQ A;  2QSF X;  3IH4 A;  3SZP A;  3D0S A;  3V7S A;  4EJU A;  5IT3 A;  3U1D A;  3K1M A;  1UZC A;  2JWT A;  3K4M A;  1IV8 A;  1VND A;  2DAO A;  2LG4 A;  1AWC A;  1OPC A;  2L5Q A;  1ZG3 A;  4ZDL A;  2O8K A;  1R5I D;  2KT0 A;  1AHD P;  2QYO A;  3RYR A;  5C4X J;  4YFX F;  2KHM A;  2P6S A;  2M5W A;  2L02 A;  4HW0 A;  2V9K A;  1JGG A;  3JAM K;  2RQP A;  1ZHF A;  3CLQ A;  4K2E A;  1B6A A;  2IS6 A;  4G6T B;  1J09 A;  1JUP A;  1R1T A;  1TQM A;  1YQA A;  1Z1D A;  3BG3 A;  1B4A A;  4EVI A;  5FFZ A;  4A3K J;  3AKZ A;  1Z3Y A;  3IRQ A;  2K7L A;  2LKS A;  2H6B A;  3BCB A;  3F22 A;  1N77 A;  4IHW A;  1JUS A;  4ZYD A;  3NQO A;  1DGR M;  1PP7 U;  2KIU A;  3V4G A;  2LR8 A;  4XQF A;  1YHQ I;  3HG9 A;  2RGV A;  4E7Z A;  3CC2 I;  1T2K A;  4FQG A;  1HQC A;  3ABU A;  2OZU A;  2LMD A;  1BOB A;  3F8C A;  1O3R A;  2X6O A;  1QO0 D;  2LF7 A;  5CVU A;  2KJC A;  2GLO A;  2P5L C;  3FZV A;  3HRS A;  4AVZ A;  2H6C A;  1U9O A;  2RQQ A;  4Q48 A;  2M8G X;  2NVY J;  3AL0 B;  4G6D A;  3PQK A;  2X6Y A;  4UUV A;  3CCL I;  2JA6 J;  3O8G A;  2IS1 A;  2QCO A;  4E7K A;  4UUT A;  3ZQ7 A;  1X1P A;  4M3D A;  1R4N B;  2BY3 A;  3VEP A;  1T56 A;  1Z6R A;  1L0O C;  3SFI A;  1VFC A;  3ZQQ A;  4RMN A;  1D8J A;  2COB A;  1N78 A;  1V3F A;  1TT0 A;  5CQE A;  3CF5 F;  4RM2 A;  1J7K A;  1FY7 A;  3FDY A;  4HZF A;  3T1B A;  4LOC A;  3PJR A;  1FOY A;  2YPR A;  3HGY A;  3LSJ A;  1RUO A;  2XAJ A;  2L7K A;  2CW7 A;  3NRV A;  2DLL A;  4XL9 A;  5IYC J;  3VB2 A;  4XRS A;  4RB3 C;  3OYH A;  3JRC A;  2ZFW A;  2W48 A;  3WE3 A;  3L2U A;  1JTY A;  4XLE A;  3JRH A;  3LST A;  1V54 H;  4FX4 A;  4HX4 A;  3ECH A;  3L9F A;  4P5O A;  1XD7 A;  2RKH A;  2VXD A;  4XIC A;  4EJV A;  2HQA A;  3SQN A;  2BW3 A;  1R22 A;  1UAA A;  3GBG A;  3QOP A;  1T6S A;  2WAQ A;  4XLH A;  3VYT B;  1LUJ B;  2DFI A;  1JE8 A;  2B63 J;  3P5J A;  3K2Z A;  3CLO A;  2H1K A;  1H8A C;  1R1V A;  4DW6 A;  2FU4 A;  3WTT C;  1LB2 A;  4KFC A;  4BBS J;  5JLW A;  4U7B A;  4C2T A;  3I4M J;  4KN4 X;  1BIB A;  4BBR J;  1D5V A;  4MTE A;  3DV8 A;  1QHH D;  1OYY A;  2E7W A;  5FFX A;  1IG7 A;  4MNU A;  3RYP A;  4YII A;  4P9U A;  2JSC A;  3IH2 A;  1V5G A;  3LNQ A;  3ZQF A;  1XDS A;  4XLC A;  1WJA A;  1HW2 A;  1K61 A;  1D8K A;  3TW6 A;  4C3H J;  1FLI A;  3I4P A;  3G1M A;  1K78 B;  4C3I J;  1GVD A;  4IHT A;  5E17 F;  3D5S C;  5FKO A;  4EGY A;  3FMS A;  1ZQ3 P;  2D2W A;  1GV2 A;  4ZDP A;  3Q0W A;  1IF1 A;  3MMY B;  3H1C A;  4DYR A;  2DDB A;  4DBQ A;  2KPM A;  3BJO A;  4QSH A;  2K85 A;  4WXH A;  1EH8 A;  3HPG A;  3DWL E;  3FWE A;  3TW7 A;  2XV4 S;  3MKY B;  1B8I B;  3H9Q A;  1IN4 A;  4AD9 A;  1XCV A;  1D0X A;  3ISP A;  1NTC A;  4M71 A;  3CD6 I;  2G9W A;  1BA5 A;  3MCZ A;  3PL8 A;  2OU2 A;  3EYY A;  3KP3 A;  4TV7 A;  1I1S A;  1BL0 A;  1R49 A;  2EK5 A;  4EAT A;  5ICG A;  3B73 A;  1XGN A;  4E7L A;  1K4T A;  3OR1 C;  4KIG A;  3MVP A;  3PNY A;  3JTH A;  2XGD A;  3S1N J;  3CP8 A;  1F5T A;  1QVU A;  2DA4 A;  1VTN C;  2HQ5 A;  3BJA A;  2LOO A;  2BXY A;  5HDG A;  4XNF A;  3OIP A;  3DBH B;  4RGR A;  2CQN A;  3QRF F;  1I5Z A;  4OMY A;  1GXQ A;  3F8N A;  2GOX B;  3QPT A;  2A5W A;  3SDG A;  3BR1 A;  2L9R A;  4L9N A;  4BY1 J;  2R93 J;  4ENM A;  5LRR A;  4A3F J;  4NC8 A;  5CVJ A;  2L2O A;  2MH2 A;  2WC2 A;  2LFB A;  1T98 A;  1BR2 A;  1ZLJ A;  1FBU A;  1BR1 A;  1X2M A;  1TQP A;  3R60 A;  3CES A;  5C4J J;  2IS2 A;  3H3Z A;  2CG4 A;  3LSK A;  4MLO A;  3EYI A;  1IDZ A;  1U3E M;  2VL8 A;  2JSP A;  5BMZ A;  1FP1 D;  2XSD C;  1B72 B;  3FXJ A;  2KZG A;  3NEU A;  1YO5 C;  3S2W A;  1T0F C;  2P7C B;  2HVS A;  2K27 A;  1SFK A;  2VOD A;  3B6A A;  4MGR A;  9ANT A;  2JJ7 A;  4UB8 C;  3KEY A;  3HRM A;  1W0T A;  1LDD A;  2OUM A;  2P6T A;  5M3M J;  3S3N A;  1RRJ A;  1MSE C;  1IDY A;  5FGM A;  1QA6 A;  4IQJ A;  2WY8 Q;  1W5T A;  2VB6 A;  3BTL A;  1SD6 A;  4RM3 A;  3L2W A;  2RNG A;  2MC3 A;  1ZR4 A;  2VC0 A;  4BH9 A;  4I98 B;  3BTJ A;  2IBD A;  5EEG A;  3CJQ B;  2GIZ A;  2E34 A;  3PNV A;  5LEJ A;  4L9V A;  3HJE A;  5DV5 A;  3F9K A;  1X3Z B;  2DYR H;  1FP2 A;  5HS8 A;  1TLH B;  2CJJ A;  1QPI A;  2GM4 A;  4M74 A;  4XOP A;  2KRH A;  1MZB A;  1X58 A;  4IJA A;  3K7A J;  4RLF A;  4BU2 A;  2HYJ A;  2BVL A;  1IC8 A;  2IAI A;  3RZD J;  2CUF A;  1K83 J;  2EIJ H;  1OIS A;  3VFZ A;  1K79 A;  4M9Z A;  2NS8 A;  1OFC X;  4XOT A;  5JVG F;  4L9J A;  1AKH B;  2XUB A;  3RZO J;  1S29 A;  2DQL A;  2E5Z A;  1XN7 A;  2X4H A;  4PUS A;  2TDX A;  3TQN A;  4N0B A;  3WGI A;  2BBY A;  1R36 A;  4G12 A;  3RI4 A;  1Z67 A;  5FKN A;  3K4B A;  3ZOB A;  3C18 A;  4XLN F;  4OAZ A;  2K9Q A;  2NS0 A;  1DP7 P;  3GWZ A;  1YLF A;  2R7V A;  1TWC J;  4NC6 A;  3LFU A;  2JN6 A;  1SFO J;  3HOZ J;  3H5N A;  3BP8 A;  3HRU A;  5EDN A;  3OWT A;  5EGO A;  4PJL A;  2R5Z A;  2KQR A;  2Q0O A;  3ERM A;  4LLG F;  4S0H B;  1XSV A;  4BQA A;  1B9N A;  1KYZ A;  4C2M J;  2QUF A;  2DA5 A;  2PMZ A;  4BEH B;  1MBE A;  2VC1 A;  2QLZ A;  3E6M A;  2HQN A;  5BPI A; 
#chains in the Genus database with same CATH homology
 1P2F A;  2HKX A;  4WXD A;  1E17 A;  4LG0 A;  2F5F A;  1O3S A;  3ZMT A;  5CYV A;  3BPX A;  3U2R A;  1Z6T A;  4KN7 X;  4M9X A;  1SMY F;  4XSX F;  2Z99 A;  1ZAO A;  4HF1 A;  4HYE A;  4KT5 C;  3HYI A;  3ABT A;  4NB5 A;  1RUN A;  1FBS A;  4P55 A;  3COA C;  1FYL A;  1SD5 A;  4G7Z F;  4RS8 A;  1SFE A;  4B8X A;  4M6X A;  4KIC A;  4WCG A;  1F4K A;  2JRT A;  3W6J B;  5DUI A;  2PQ8 A;  5L3F A;  2A6H F;  3I71 A;  5FD5 A;  4ENK A;  2JPB A;  3WTV C;  3LQQ A;  4R8H A;  3RPQ A;  1IRG A;  3M9A A;  3F3X A;  1G6N A;  4KYW A;  2ZO4 A;  2BEO A;  1BOA A;  3R6S A;  1O3T A;  1YTY A;  1YIO A;  1U5T C;  1SAX A;  3DFG A;  2Y48 A;  3QP5 A;  1QNT A;  3MAJ A;  2M45 A;  2VXZ A;  2J5O A;  3KP6 A;  3EUH A;  3V8L A;  3GEZ A;  2PI0 A;  3J81 K;  1OYW A;  1WRJ A;  1Y0U A;  1FWZ A;  2DW4 A;  2GWR A;  3RTR A;  5HDN A;  2FNP A;  4HDU A;  4LFU A;  4DNC A;  3IRR A;  4ESB A;  1I6X A;  1O7F A;  4HBL A;  3WTU C;  5LBQ A;  3RKW A;  4CZZ A;  1S3J A;  2KIM A;  3I59 A;  5ILS A;  2MA3 A;  3WE2 A;  1DPR A;  5E1Z B;  1U8R A;  2XAS A;  5ERI A;  2O61 A;  1R23 A;  3HIF A;  5E1W A;  2FMY A;  4EM1 A;  4MEX F;  4UVB A;  3HOS A;  2IVM A;  2VE9 A;  3QU3 A;  1ZRC A;  3IC7 A;  2FA5 A;  3HUG A;  3I54 A;  2QM3 A;  2QQ9 A;  2WV0 A;  2HKO A;  1W7P A;  5F1R A;  1CGP A;  2O3F A;  1MDM B;  3F6V A;  3I0T A;  1ZYR F;  2P4W A;  1KU9 A;  3BWG A;  2NNY A;  3BJ6 A;  1W4M A;  2XKP A;  1B9M A;  1IN7 A;  2WWY A;  3CUQ C;  2L4A A;  1H0M A;  4S04 A;  2MLK A;  1FOK A;  1QPM A;  1ON2 A;  4KIF A;  4O5V A;  2IW5 A;  3SXY A;  3ML6 A;  3RPU A;  2YR2 A;  1PUE E;  1J5Y A;  2EA2 A;  1OKR A;  4RB2 C;  4OIR F;  4N9I A;  2O6G E;  2HTJ A;  1UHW A;  3HRT A;  4ENN A;  1UCR A;  3WGG A;  1TBX A;  3CTA A;  3ZMV A;  4XSZ F;  3GYH X;  3F23 A;  1XDU A;  3HOT A;  1S6L A;  2O03 A;  1FC3 A;  4NHJ A;  1PP8 F;  3BY6 A;  1OR7 A;  3V7R A;  1FYM A;  4A6E A;  2UWM A;  2HWV A;  2MH9 A;  1ZG1 A;  4KUM A;  1IN8 A;  2FXA A;  5DDG A;  4U7D A;  2H09 A;  1KYW A;  4CDG A;  1C0W A;  2Y75 A;  4EJW A;  3HTU A;  1R58 A;  5BQT A;  2V79 A;  1TNS A;  1P92 A;  1BI2 A;  3V8K A;  4U88 A;  4G7O F;  1DDN A;  4LD5 A;  3GUD A;  3J80 K;  4L0Z B;  3T5X A;  4BHB A;  3WTW C;  3WU0 A;  1LDJ A;  3LA7 A;  3L00 A;  1JXS A;  3L09 A;  4HOB A;  2A61 A;  3P9I A;  4U0W A;  4MEY F;  1BC8 C;  5D5W B;  2FBH A;  4MQV A;  3GF2 A;  5IT9 Z;  1Z7U A;  5JI6 A;  3C1D A;  3I5U A;  3KET A;  1W7P D;  5E1X A;  1XSX A;  3K0L A;  1U78 A;  4H0E A;  1D3Y A;  1W5S A;  2BV6 A;  3TGN A;  3ZP5 A;  2A07 F;  2IRF G;  4RAY A;  2VOP A;  4UV8 A;  1B1B A;  4EM2 A;  1OYI A;  5DUK A;  2K4B A;  2PN6 A;  4AIH A;  3DEU A;  3J80 Z;  3K69 A;  4GXO A;  2NAZ A;  3MZY A;  5HLI A;  3QU6 A;  2VN2 A;  1L3L A;  3JAM Z;  4Z2Y A;  5K1Y A;  2EFP A;  4GCV A;  4ON0 A;  5F64 A;  2DK5 A;  3ZMD A;  3R4K A;  4L18 B;  2XKO A;  2XGX A;  2X0L A;  4U0Y A;  4JQF A;  4DQ2 A;  4M9S A;  4A5M A;  5ED4 A;  2NYX A;  2FRH A;  4UXN A;  4XLP F;  4CGZ A;  4JK1 X;  1QZZ A;  2FNA A;  3F72 A;  2D1V A;  4LG0 B;  2L01 A;  3FXR A;  1BN5 A;  2W25 A;  4EMS A;  4M6Y A;  3B02 A;  2XRO A;  4QLC U;  1CF7 A;  1ZGJ A;  1UHM A;  4HF2 A;  4KMF A;  4YIF A;  1SMT A;  3GFI A;  2F5D A;  4A5N A;  2RC4 A;  5K5Q A;  4WWC A;  1A04 A;  4RGU A;  1FT9 A;  1F1Z A;  5CVR A;  1ZAR A;  4BHC A;  3EQL F;  2CGP A;  1ZRD A;  4HF0 A;  5H6R A;  4CXF A;  4I01 A;  1GVJ A;  2ELH A;  2IPQ X;  5AON A;  4XBF A;  5FB2 A;  5J8C A;  1XGO A;  2W24 A;  2XHK A;  4OMZ A;  3BZ6 A;  2H27 A;  2K86 A;  2M87 A;  1HW5 A;  2ZCW A;  1MGT A;  2Q8K A;  1UST A;  4R1H A;  2QQB A;  1G3S A;  2BYV E;  4RAZ A;  5CVV A;  5LHG A;  3FHZ A;  2XAQ A;  4OU0 A;  4EM0 B;  2ZBK A;  4R79 A;  3GZ6 A;  1R7J A;  3ZPL A;  3TO7 A;  2V9V A;  4OIO F;  4RB0 A;  4GO1 A;  2DTR A;  2HFH A;  5TRD A;  4NQW A;  5HVQ C;  1OMI A;  3KCC A;  1STZ A;  5D5X B;  2M1B A;  1ODD A;  4L5J A;  4N9H A;  4HQM A;  2V1X A;  5D8K B;  3WTY C;  5H6Q A;  2YX4 A;  4KMU X;  4LB5 A;  3GO5 A;  3LAJ A;  3KLO A;  1S8N A;  2ISY A;  2LKP A;  2W85 A;  3C7J A;  5BPD A;  3DP7 A;  2HZT A;  3MEX A;  2E1N A;  4WF2 A;  3KEO A;  4UV9 A;  3VOD A;  1SFU A;  1T0F A;  1B59 A;  2NNN A;  4ASN A;  1J9I A;  2QBY A;  1TNT A;  2MBF A;  4Y17 A;  5JVT A;  1ULY A;  1W7P B;  2QEN A;  3CUO A;  3Q5F A;  2UZK A;  5LGT A;  3O6B B;  3ZMU A;  2XAG A;  1U6G A;  1R5G A;  3AAF A;  1YW7 A;  3KP7 A;  2PMU A;  1BI1 A;  4A0Y A;  2ESH A;  2UXN A;  2ESN A;  2DU9 A;  1XGM A;  5HLG A;  5D4R A;  3TOA A;  1ON1 A;  1DUX C;  2A3S A;  4KDP A;  4AVP A;  2IP2 A;  1WSU A;  5D5U B;  1RI7 A;  4ZH4 F;  4A2U A;  4IPA A;  1S7A A;  5ICC A;  1DPU A;  1KQ8 A;  3H92 A;  1FZP B;  1TW3 A;  3P9K A;  3D5L A;  2CW0 F;  1HKS A;  2M30 A;  5LHH A;  2O0Y A;  2PBI A;  3K1P A;  4O6J A;  1I1G A;  5DYM A;  2VT2 A;  2W84 A;  3N4M A;  1YW9 A;  4M73 A;  1BIA A;  1FSE A;  1Z05 A;  3FM3 A;  1JGS A;  2B0L A;  3ERE D;  1K78 A;  1FNN A;  2D1H A;  4AIJ A;  2CYY A;  5DCM A;  2MD5 A;  1RZ4 A;  2IA1 A;  3ROU A;  5FD6 A;  1UB9 A;  5KK1 A;  5LGN A;  2GIV A;  4L5I A;  1T38 A;  3O3K A;  3KP4 A;  5LEK A;  3E6B A;  3KZZ A;  2DPU A;  4KA4 A;  5E8I A;  2PFB A;  3QP6 A;  1LNW A;  1H9T A;  2V1D A;  1IXC A;  2AXL A;  3G3Z A;  2XVC A;  3E5X A;  2CWE A;  2VON A;  2YU3 A;  5K5O A;  2W57 A;  5L3C A;  5K5R A;  5ICF A;  1LDK B;  2HOE A;  1U5T A;  1J2X A;  3I58 A;  1H9G A;  3CO6 C;  5E8G A;  5HOO A;  3HSF A;  2A68 F;  4IRI A;  1QZY A;  1JHF A;  4MHG A;  5L3D A;  1IN6 A;  2AS5 F;  1LEB A;  3DKW A;  4A12 A;  3WG9 A;  4A0Z A;  2D45 A;  1AOY A;  3V8J A;  3FMR A;  5D5V B;  2WTE A;  4HAM A;  4PGG A;  3J81 Z;  4GYG A;  4EJO A;  3O2P E;  2UXX A;  2HS5 A;  1X3U A;  3F8F A;  2M8E A;  2L54 A;  5CJ9 A;  2XIG A;  3PQJ A;  3IKV A;  4UHT A;  1REP C;  1FBQ A;  3GFM A;  3GW2 A;  2RVC A;  5TJJ A;  5BS6 A;  2MLG A;  4Q4Z F;  1BBY A;  2J5P A;  1HKQ A;  1IUY A;  2DT5 A;  5LLQ A;  2KRF A;  4BHP A;  2Z3Y A;  4FX0 A;  1CF7 B;  5L3E A;  2E7X A;  1YW8 A;  1LVA A;  4D0P A;  1O7L A;  1XB4 A;  1FPQ A;  3P9C A;  1ZH5 A;  2Q2E A;  4I02 A;  2DI3 A;  3DQV C;  2VBW A;  4IRG A;  3GFL A;  3TO9 A;  2GXB A;  5FLX K;  2EV5 A;  4HX8 A;  5F6F A;  2EV0 A;  4CO8 A;  4HV6 A;  2VE8 A;  5AIQ A;  3WTS C;  4Q47 A;  3CUQ A;  3KP2 A;  1JHH A;  1R1U A;  2OQG A;  2YSR A;  1IN5 A;  1LEA A;  2C6Y A;  1MKM A;  4CYD A;  2ZME A;  2STW A;  3RDI A;  3SHF A;  3RKX A;  4LLL A;  3E3V A;  4YFK F;  4I09 A;  4ENJ A;  2CFX A;  2BE5 F;  2BGC A;  1LQ1 A;  2F5E A;  2P5K A;  2G7U A;  1GHC A;  2FSW A;  4CIC A;  2FBI A;  5JFR A;  1USS A;  4LK1 F;  3ZN1 A;  2ACJ A;  2XAH A;  2Z33 A;  5D8L B;  3F6O A;  4HV5 A;  4P96 A;  2LNB A;  1R5H A;  4MQ9 F;  3WTZ A;  4MTD A;  4QWQ A;  1XCB A;  3FM5 A;  5DD8 A;  3MFK A;  1BM9 A;  4PGH A;  1K7A A;  3G73 A;  3T8T A;  2ISZ A;  1KQ9 A;  1QGP A;  4HLX A;  3JW4 A;  4WX9 A;  4AWX B;  3F21 A;  3DPL C;  4Y15 A;  3L7W A;  2JZY A;  3JTG A;  2CO5 A;  1TQI A;  1ZRE A;  3IHU A;  3V7C A;  2QBY B;  3BRO A;  3K9T A;  4RGX A;  2JPC A;  4G7H F;  3J7A O;  2JTV A;  5AIP A;  4PZJ A;  5L3B A;  4O3M A;  2IA0 A;  2Y0M A;  3KLN A;  3HHG A;  4GGG A;  4Y13 A;  4UNO A;  2KJB A;  5J8F A;  1V4R A;  4M72 A;  4A6D A;  1HBX G;  5D6E A;  2L4M A;  3F8M A;  5L3G A;  3ECO A;  2HGC A;  1YS7 A;  2QZ8 A;  2DBB A;  1EH7 A;  2F5C A;  4FT8 A;  2KKO A;  3MZH A;  4IRH A;  5BOX A;  2EFW A;  4F7Z A;  2HEO A;  2FF4 A;  3E6D A;  4LMY A;  4YG2 F;  3WU1 B;  3DXJ F;  2OQR A;  3LAP A;  3HSE A;  3T8R A;  3H3U A;  1XGS A;  1S7O A;  1WKM A;  3IL2 A;  1MDM A;  4OIQ F;  2V1U A;  1FSH A;  3E6C C;  2CSO A;  2PLY A;  2HTS A;  2IT0 A;  2CQK A;  1RNL A;  4EJT A;  2ZNY A;  4B09 A;  2QVO A;  4CHU A;  2GA1 A;  2XAF A;  2FML A;  4I0B A;  3LWF A;  4I7H A;  3T0Y A;  3E97 A;  4L0Y B;  1HKT A;  3C3W A;  1NHA A;  3CO7 C;  4JBA A;  4PDK A;  4LLN A;  2RV8 A;  3DPT A;  3IWF A;  3U9G A;  3ULQ B;  5DCM B;  4I2O A;  1O57 A;  1HW1 A;  2VBY A;  4ESF A;  6PAX A;  2PG4 A;  2EA4 A;  1IZ1 A;  4ETS A;  3EET A;  2GAU A;  1ZN2 A;  3N97 A;  3LA2 A;  5HDK A;  2EFN A;  3Q9V A;  4L9T A;  3M1E A;  3WGH A;  2EWN A;  4OIN F;  1IXS B;  5CLS A;  4WK8 F;  1J75 A;  5LRS A;  4LK0 F;  1YFH A;  2HQR A;  1SFX A;  1R00 A;  2R3S A;  5JHU A;  3BDD A;  2FOK A;  2HR3 A;  1RIO H;  4AIK A;  4YFN F;  2K4J A;  3DF8 A;  3W6K B;  5DCF A;  2QWW A;  2HYF A;  5E20 A;  3SFZ A;  5ILV A;  3TDZ C;  3GVA A;  4FHT A;  2ZJ2 A;  3HSR A;  2GQQ A;  4GYI A;  2DQR A;  2DO7 A;  1IW7 F;  1U5T B;  3I59 B;  1ONV A;  4PCQ A;  1MJA A;  2STT A;  5HS9 A;  2F2E A;  2V6C A;  5HS7 A;  2LDU A;  4BNC A;  3I64 A;  2YX7 A;  2K02 A;  3FX3 A;  3ZMZ A;  4EV0 A;  1SD4 A;  2R7D A;  3TO6 A;  3KE2 A;  3CJN A;  3FF5 A;  4RB1 A;  1J59 A;  1MJ9 A;  2PJP A;  2G7H A;  1TTY A;  3GX4 X;  3EDP A;  1P4X A;  3RIR A;  3FMQ A;  5LGU A;  1YYV A;  1UFM A;  5D4S A;  5FO5 A;  5EEH A;  4S05 A;  1U2W A;  3HHH A;  3JSP A;  4P9F A;  2OBP A;  3WOD F;  2EJR A;  1KGS A;  4HA8 A;  2VBX A;  2GXG A;  1BI0 A;  3Q9S A;  4UVC A;  1KU3 A;  4ZZL A;  5J6X A;  2GA2 A;  1EH6 A;  1ZGA A;  4XRF A;  1SD7 A;  4IXA A;  4OOI A;  4LGW A;  3R61 A;  3ELK A;  2KIF A;  4KIB A;  1KU2 A;  2EFO A;  2JT1 A;  5D6F A;  1G4D A;  1WWX A;  1XSD A;  1O3Q A;  3CDH A;  3REO A;  3HTS B;  2FQ3 A;  2L3D A;  3TKY A;  1BI3 A;  5H20 A;  2LF8 A;  2ADU A;  4G8X A;  2HYG D;  2OAZ A;  1IAW A;  4RGS A;  3CUQ B;  1E2X A;  2XRN A;  4HX7 A;  4WXC A;  3WTX C;  1IRF A;  4IHS A;  3BPV A;  1ZG5 A;  1XMA A;  1FX7 A;  1HST A;  1G3Y A;  2ZME B;  1MJB A;  3IKT A;  5DEQ A;  1F9N A;  2ZKZ A;  2GZW A;  2RN7 A;  3FXU A;  2COM A;  4Q5S F;  1G3T A;  3M7G A;  3SZT A;  1KA8 A;  1TW2 A;  2DK8 A;  2QQA A;  3RJP A;  4LJZ F;  4HQE A;  3GZ5 A;  4BXU A;  4G94 A;  2Z5U A;  2OA4 A;  3KZY A;  3VOE A;  3E5U A;  2A6E F;  4UVA A;  3KEQ A;  3OV8 A;  1BC7 C;  2Z9O A;  1ZRF A;  4LB6 B;  2EFQ A;  2PEX A;  2VT3 A;  3ZMS A;  3MWM A;  2FBK A;  1P4A A;  2OD5 A;  5HLH A;  3GLX A;  5E18 F;  3OOP A;  1KQ0 A;  2FE3 A;  3QPH A;  4G9Y A;  1FYK A;  2DPD A;  3K1N A;  3R0A A;  3QAH A;  2LSO A;  4A0X A;  5DD4 A;  3P7N A;  1G3W A;  3TOB A;  2HDC A;  2R7F A;  3FXQ A;  4I0A A;  1EV7 A;  2RNJ A;  3GXO A;  4HDV A;  3TDU C;  3LA3 A;  1QQI A;  3L2C A;  2P8T A;  1HSJ A;  1Q1H A;  4E70 A;  2A5Y B;  3R0J A;  4ESJ A;  4ZYG A;  1Z91 A;  2ETH A;  2P7V B;  1HXD A;  3ZN0 A;  1BJA A;  2OZ6 A;  2NRA C;  2H94 A;  1Z9C A;  4BAY A;  1PDN C;  4HLY A;  4ZYH A;  1WI9 A;  1LJ9 A;  3BOQ A;  4BYY A;  2ZNZ A;  1YS6 A;  1P4W A;  5A2Q K;  4EGZ A;  3PFI A;  1XMK A;  1ZLK A;  2P5V A;  3F8B A;  1GXP A;  3LQR A;  4ZZD A;  5JR3 A;  1J0R A;  1KU7 A;  4OIP F;  1I27 A;  5ICE A;  3KFW X;  3LFK A;  1WQ2 A;  3KP5 A;  1QBJ A;  4U0V A;  5ILU A;  4IF4 A;  1MD0 A;  3IWZ A;  2IA2 A;  2O8X A;  5CVI A;  1YG2 A;  2EB7 A;  1K6O A;  3MQ0 A;  4G6Q A;  5IT9 K;  2EV6 A;  4KNY A;  1T39 A;  4ZYE A;  1P6R A;  2RDP A;  2VOO A;  2PMH A;  4IVN A;  2FEZ A;  5LHI A;  5A2Q Z;  3JSO A;  1IXR C;  2E1C A;  3RKY A;  4EQQ A;  3M8F A;  2IJL A;  5KVR A;  3I53 A;  5FLX Z;  3M8E A;  2VBZ A;  2ZXJ A;  2A69 F;  3GFJ A;  3E5Q A;  4EJU A;  3V7S A;  3SZP A;  3D0S A;  5IT3 A;  3U1D A;  3K1M A;  2DAO A;  1AWC A;  1OPC A;  1ZG3 A;  2QYO A;  3RYR A;  4YFX F;  2P6S A;  2M5W A;  2L02 A;  4HW0 A;  3JAM K;  2RQP A;  1ZHF A;  4K2E A;  1B6A A;  1R1T A;  1TQM A;  1YQA A;  1Z1D A;  4EVI A;  1B4A A;  5FFZ A;  3IRQ A;  2K7L A;  2H6B A;  3F22 A;  4ZYD A;  3NQO A;  1PP7 U;  2KIU A;  3V4G A;  2RGV A;  1T2K A;  1HQC A;  3ABU A;  2OZU A;  3F8C A;  1O3R A;  1QO0 D;  2LF7 A;  5CVU A;  2KJC A;  2P5L C;  3FZV A;  3HRS A;  2H6C A;  4Q48 A;  4G6D A;  3PQK A;  4UUV A;  3ZQ7 A;  3VEP A;  1Z6R A;  1L0O C;  1D8J A;  1V3F A;  1J7K A;  1FY7 A;  4HZF A;  3T1B A;  2YPR A;  1RUO A;  2XAJ A;  3NRV A;  2DLL A;  3VB2 A;  4RB3 C;  2ZFW A;  3WE3 A;  3LST A;  4FX4 A;  4HX4 A;  3ECH A;  3L9F A;  4P5O A;  1XD7 A;  2RKH A;  4EJV A;  3SQN A;  1R22 A;  3QOP A;  1T6S A;  2DFI A;  1JE8 A;  3K2Z A;  3CLO A;  4KFC A;  1R1V A;  3WTT C;  2FU4 A;  1LB2 A;  4U7B A;  4KN4 X;  1BIB A;  1D5V A;  4MTE A;  3DV8 A;  1OYY A;  2E7W A;  5FFX A;  4MNU A;  3RYP A;  4YII A;  4P9U A;  2JSC A;  1XDS A;  1HW2 A;  1D8K A;  1FLI A;  3I4P A;  1K78 B;  4IHT A;  5E17 F;  4EGY A;  3FMS A;  2D2W A;  1IF1 A;  3BJO A;  4WXH A;  1EH8 A;  3FWE A;  2XV4 S;  1IN4 A;  4AD9 A;  1XCV A;  3ISP A;  4M71 A;  2G9W A;  3MCZ A;  2OU2 A;  3EYY A;  3KP3 A;  4TV7 A;  1I1S A;  2EK5 A;  5ICG A;  3B73 A;  1XGN A;  4KIG A;  3JTH A;  1F5T A;  1VTN C;  3BJA A;  5HDG A;  4RGR A;  3QRF F;  1I5Z A;  4OMY A;  1GXQ A;  3F8N A;  3QPT A;  4L9N A;  4ENM A;  5LRR A;  5CVJ A;  2MH2 A;  2WC2 A;  1T98 A;  1ZLJ A;  1FBU A;  1TQP A;  3R60 A;  3H3Z A;  2CG4 A;  3EYI A;  1U3E M;  5BMZ A;  1FP1 D;  3NEU A;  1YO5 C;  3S2W A;  2P7C B;  2K27 A;  2VOD A;  4MGR A;  3HRM A;  1LDD A;  2P6T A;  5FGM A;  1W5T A;  1SD6 A;  2MC3 A;  2VC0 A;  4BH9 A;  4I98 B;  5EEG A;  5LEJ A;  4L9V A;  5DV5 A;  1FP2 A;  5HS8 A;  1TLH B;  4M74 A;  1MZB A;  4IJA A;  3VFZ A;  1K79 A;  4M9Z A;  4L9J A;  2XUB A;  1S29 A;  2DQL A;  2X4H A;  1XN7 A;  2TDX A;  3TQN A;  4N0B A;  3WGI A;  2BBY A;  1R36 A;  3RI4 A;  3C18 A;  4XLN F;  2NS0 A;  1DP7 P;  3GWZ A;  1YLF A;  3BP8 A;  3HRU A;  2Q0O A;  4LLG F;  1XSV A;  4BQA A;  1B9N A;  1KYZ A;  2QUF A;  2VC1 A;  2QLZ A;  3E6M A;  2HQN A;  5BPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...