2E60A

Solution structure of the surp1 domain in splicing factor, arginine/serine-rich 8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
GSSGSSGVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Splicing factor, arginine/serine-rich 8
publication title Solution structure of the surp1 domain in splicing factor, arginine/serine-rich 8
rcsb
source organism Homo sapiens
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e60A01
1UG0A 2DT6A 1X4PA 2E5ZA 4DGWB 2DT7B 2E60A 1X4OA
chains in the Genus database with same CATH superfamily
4XLHA 2VKHA 5K1YA 4KICA 4A0YA 2HVSA 2K3FA 3DTEA 3MZ8A 2M0MA 3M9AA 3RZDJ 2KIUA 2XF7A 3VOEA 2ECBA 5HLTA 1IO2A 1X1DA 2H1KA 2XAGA 1YHQI 2DYSH 1IDZA 4BJ6C 3WGGA 3KYCB 2HYGD 3B6AA 2HI3A 3BJOA 3Q0VA 2ZMEA 2M0CA 2NVQJ 5M5WJ 4Y4RA 1ZRCA 3HB9A 3BZ6A 2KDZA 3ROUA 5DD8A 3HUGB 4UVCA 3E3VA 4MTEA 4EGZA 2R7XA 1N77A 1VQOI 4JK1X 1RR8C 1BJAA 1U9OA 5FKMA 4G12A 4HX8A 3CDIA 3FHNA 4L5EA 2BW3A 3ZN0A 2HFHA 4HEA2 4GO1A 3RPQA 2ETHA 1YS7A 5CQGA 5D8LB 1FJLA 1E2XA 4F3QA 2BY0A 4PJJA 4IRGA 4E7ZA 3H5NA 5D6FA 5KVRA 1GVJA 1LE8B 2XC7A 4XLFA 4B48A 2R7OA 3QPLA 5FKKA 4A3IJ 3I53A 2DMPA 1HSJA 4MLOA 3GTOJ 1A35A 2EFWA 1P4WA 1MBEA 1R7JA 3JRFA 4I0AA 3BQYA 2JJ7A 2DDBA 3A2KA 1YOVB 2DN0A 3QWLA 4BAYA 3CCQI 4M9SA 5F64A 1XMKA 2DJIA 1D1BA 2LRDA 2GAUA 5EG0B 4HG2A 4DQ2A 2JA7J 2M5WA 3W2WA 3H35A 3G3ZA 1LEAA 1MH4A 1S8NA 3PNYA 3BCBA 3AAFA 2EV0A 4FCYA 2QZ8A 2AXLA 2O6GE 3TP3A 3VSLA 1A5JA 1BR4A 3P9IA 5EF6A 1L3LA 4A3FJ 1OCCH 5C4XJ 3ZMVA 3H36A 4Z6YA 2DU9A 2OF7A 3P7NA 4M3FA 1WSUA 1QZEA 3WE3A 1VQLI 3EYYA 1DGWY 2NS8A 5J1UA 2Z1DA 2XAFA 3KFWX 5ICFA 3G1MA 3FK6A 3D5LA 2M8EA 2LBFB 3FM3A 2EIMH 1FP2A 3WODF 2CGPA 3ERED 4EGYA 3OYAA 3R61A 3A1YA 4I76A 1D0XA 1U9NA 1SMTA 2W82A 1STZA 1IRXA 1TZLA 2ME0A 4UB6C 1JUSA 3OWTA 3ZQFA 1JKQC 5L3GA 1XCBA 3V7RA 4G9YA 1ZGJA 2XGCA 1TWCJ 3BZCA 5CPRB 1FIAA 2XSDC 5GPAA 4D7NA 4D1QA 2BYVE 2ISZA 3KZYA 5FJ8J 3CCMI 4LB5A 1SC7A 3QPTA 4I09A 3JTHA 3LOCA 2EFNA 4II2A 5E18F 1OPCA 1LVAA 2QEXI 4UB8C 3AG2H 2RN7A 3S1MJ 2GWRA 3I4MJ 3ZMTA 1WJBA 2HZDA 1YE9A 2DT6A 2DMQA 5JR3A 2CQ7A 3PUFA 2DQRA 4ZZLA 1G4DA 1E0EA 3S14J 1UZCA 1HKSA 2K85A 5EEHA 1SEUA 4NC6A 1IXCA 1F1ZA 1MBKA 1Z7LA 2ZFWA 3M1CA 3WU1B 2L0KA 3S1RJ 1FTTA 4BDYA 1KU2A 3HPGA 3GMEA 1K79A 2GIZA 2WB1A 4CCJA 3ECHA 2Y9YA 3B73A 2IRFG 3CLQA 4LLNA 5C3EJ 2IAIA 1G2HA 4HSRA 3PUBA 5M3MJ 3OMYA 4NDLA 1UHSA 4DBRA 1CF7A 2ZJQF 4M9XA 3GO5A 1G3TA 3QPHA 4M3BA 4Q48A 1SVLA 1GLNA 2OTLI 5DYMA 3BR0A 3K1PA 4M9ZA 4YG2F 1ZYRF 4DW6A 4A12A 2BXYA 4AD9A 4JX6A 4F91B 5ICGA 1OMIA 2L01A 4ABZA 1HKTA 1YFHA 1AOYA 1R1TA 1ULYA 1USTA 2R7WA 2P6TA 2NRAC 4HDVA 3QQAA 4NQWB 1PJRA 1RUNA 2VI6A 4HNTA 2FEZA 2YX4A 4KUMA 4NUBA 5FD5A 1WI9A 3L2WA 5JHUA 2ZSIB 4CCNA 3RQ4A 2EILH 3KE2A 5IT9Z 3T5XA 3OOUA 3DBHB 1A6IA 4R8HA 3GFMA 4QSHA 3C7JA 1OCTC 2M30A 2K3PA 3RCOA 3CMEI 2P5LC 1YYVA 2PX9A 3F9KA 2P4WA 4L0YB 5GAEJ 2OAZA 2JRMA 4HDUA 5K5RA 3EYIA 3GTMJ 2R5YB 2L4MA 1FBQA 2M7BA 1Y39A 4P1WA 2XB0X 1B8IB 3VYUB 5E3NA 3IUOA 1S6LA 3M8EA 1MMGA 3BPXA 2LKPA 2X85A 4HZFA 1GT0C 3RQIA 1CQTA 1X58A 5JFRA 3LSJA 4KDPA 3GWZA 2LC2A 1I3QJ 2NNNA 4ZJZA 1TQMA 4UV8A 2Z33A 5D5WB 2ZCWA 3FXOA 4BKXA 3RKQA 1WRJA 2O9LA 3OYGA 3TQNA 2O7OA 4ITVA 4CZCA 2DK8A 5K5QA 3H3ZA 2FJ1A 1EV7A 4UXNA 1WJ5A 4UV9A 1RZ4A 4O5VA 2KMUA 3RKWA 4BBSJ 3FMRA 4NB5A 2H27A 4LG0A 3IV5A 1IRFA 5IT3A 1ZREA 4CCOA 4J19A 3SYTA 4CICA 4Y7NJ 2V1NA 3PJRA 1RKTA 4F55A 2JZYA 3ZR8X 4E7IA 3HZJA 1U78A 2BXZA 4BNCA 4CA0A 4GRIA 1O3TA 2FD5A 2IS1A 3F21A 2ZFUA 1WVRA 2FX0A 3E1SA 3GVAA 4DIQA 5GAGJ 2DQLA 4ZZDA 2P0WA 3LMMA 1D3YA 2QVOA 4XLAA 4IXAA 3OYMA 5E1WA 2NVXJ 1S7EA 2HKOA 4LLLA 3AG1H 4XORA 4XBFA 3OYKA 3S3OA 1QU3A 3CESA 2EZIA 2DLLA 1HW5A 1UHWA 5F0HA 4DNCA 2P7VB 2R7TA 4M3DA 2JVGA 4RS8A 2KPMA 5HS7A 3REOA 3B6CA 2R5ZA 2LF8A 5BPIA 3SFIA 5K7ZA 1R49A 2KHMA 1I1GA 2A5WA 5TGTA 1IXRC 5HLIA 4CYDA 4AC0A 3ML6A 4IHXA 3I59A 3KP7A 1U8RA 1K7AA 4RAZA 2HYFA 2VASA 1ZR4A 4ESBA 3ZQ7A 1FSHA 2WY8Q 4AWXB 4C3IJ 1REPC 5IY5H 2HQRA 5M5XJ 4DGWB 3RYRA 2LY9A 3RKYA 5DV5A 1HQCA 5ILVA 1Z91A 3JRBA 4KJZA 5BQTA 1LFBA 5A2QZ 4RA2A 2OU2A 4OIPF 5L3CA 1FOYA 2OCCH 3HL2A 1PDNC 2K40A 1OYIA 4HSTA 4OMYA 1OCRH 1KA8A 2X6WA 3B02A 3FXQA 4XIDA 4JX5A 3Q9SA 2GXGA 3RSNA 2JUCA 2V6CA 3MAJA 1BOAA 2R4GA 3G73A 1R4NB 3W2AA 4C9YA 5J40A 1BI3A 3IKTA 4X6AJ 3ABTA 4D0PA 3UR3C 4PJLA 3BR3A 2IA0A 5DM7F 4BDZA 5KNLA 3R0JA 4Y17A 2P5KA 3V8KA 1IV6A 4P55A 1BW6A 3JRCA 2L9NA 3PNTA 1D1AA 2MC3A 3S3MA 4OIOF 2JSCA 2O5RA 4B09A 2F48A 1RIOH 2TDXA 3JSOA 1ORKA 1U3EM 3OYHA 2ZJPF 4HV6A 1MMDA 1JTYA 4AU7A 2IA1A 3EUAA 5H6RA 1YJNI 3O8GA 2HQNA 3AG3H 4BE1A 5J47A 2V6EA 4KISA 2H09A 2DA4A 2ZXWH 3TBIA 1TWFJ 2KKOA 1W0UA 4EM0B 2E35A 3LNQA 2DFIA 1WJDA 2VLAA 2OPTA 2F5DA 3X2QH 3PM1A 3ABMH 2O03A 4Y13A 1T98A 4AIDA 4JP0A 3F8MA 3V7SA 3RI4A 1WQ2A 1MMAA 2DA5A 5HS8A 2CH0A 4HPQA 4MHGA 4U87A 4G6DA 4KN7X 3DKXA 2HQ5A 4L9NA 4BGDA 1ETWA 5CVUA 3VYTB 2BOLA 3QODA 3L2QA 1LDJA 1U2WA 1FPQA 2MW8A 2QKLB 2VIXA 3IRRA 4A3LJ 2XVCA 3HBLA 5K5OA 4UUVA 3ZQGA 5DS9A 3OYDA 2DOAA 5HOOA 1Q1HA 1R4MB 3SQNA 4ZDOA 5HODA 5HLHA 2EBIA 2E2IJ 1MDMB 2EV5A 1OCZH 2JK3A 1SD5A 2HWVA 1VQ6I 2D45A 3F3XA 1FX7A 1E17A 1JT6A 1R36A 3LFUA 2VOPA 3I56I 2K27A 1FOWA 3S16J 3W2VA 5EZHA 3R6SA 1U5TA 3GCMA 1ZLJA 3K1MA 1H89C 3Q0UA 4DBQA 4XSXF 4CCMA 1OISA 1T0FA 4G6TB 3DLLF 2BEOA 3G4SI 4BY1J 1SD7A 2WV1A 2RDPA 2CO5A 1AWCA 2JA2A 2OQGA 3TMOA 3S15J 1T33A 2FBIA 5TJJA 3ASNH 2KP6A 2DMTA 3LSPA 1F36A 1RRJA 5K7FA 2QBYA 1Z9CA 5FKNA 3I54A 3SEZA 5L3BA 3DP7A 4LMYA 3C2GA 4OIQF 3W6VA 1V5FA 4K2EA 5CJ9A 2RQPA 5CQEA 1LDKB 3OIQA 4IHSA 4H0EA 5H6QA 1HXDA 4KITB 1ZARA 2VT2A 1EJ9A 1USSA 1WGXA 1HBXG 2UWMA 3BR6A 4UUSB 2A05A 5ICCA 2DMNA 5J1RA 3J7YJ 2CRGA 2M3AA 2L9SA 2C6YA 2A5YB 3DEEA 4CDGA 3A02A 3EETA 4PJNA 1NG7A 4TV7A 2XSJC 4R1HA 3E5QA 1XDSA 1Y1WJ 1FLIA 1ERDA 3CF5F 3ZQLA 2W25A 2OTJI 1BC7C 1ZG3A 2M7AA 3BG6A 4ZH4F 3BTLA 4G7OF 4IEJA 1Z67A 2UXXA 1JHHA 2AQFA 4B3XA 3KP5A 1LFUP 4JQFA 2VBXA 1R00A 2AQEA 4LG3A 3CTAA 2K86A 4XSZF 5LGTA 2R7RA 1KYWA 2CQNA 4NC7A 1I1SA 5JLXA 1W36C 2E1MB 4FT8A 3G2BA 3SJMA 3LSGA 3LSIA 1T8IA 2CUJA 4YIRX 3FXLA 1R1UA 2FOKA 3KEYA 3KZIC 3GZNB 1L0OC 1XGSA 1W36D 2WAQA 4V19K 4BUPA 3GLLA 3DLAA 5L3DA 1G3YA 1UAAA 3WTZA 3S32A 1PUFA 4EJTA 3OYNA 4U7BA 1R9TJ 1E3HA 2LKSA 5GADJ 2STWA 2PEXA 2HZTA 3TO7A 2A61A 3ABKH 2VQHA 1Y8RB 2Z9OA 5E1XA 1B72A 1OCOH 3C3WA 3NEUA 1LJ9A 4MFEA 1LPQA 1K78A 2G7UA 3KEOA 3IH4A 3GTGJ 3H5AA 3PNVA 4J01A 1VQNI 1WHUA 4BHCA 2HVRA 4CGZA 1UELB 3KP2A 1T6SA 2X51A 2XGEA 4CXFA 2DT5A 3BY6A 3NRVA 4CSWA 1R5HA 2EV6A 5DCMB 3KPHA 4RLQA 3G71I 1J2XA 4C2UA 1MJBA 1RPWA 3V7CA 4XICA 3U1KA 1XGMA 4XOPA 3HGYA 3CMAI 5E3MA 5FRNA 2MG4A 4ZYDA 2DT7B 3NQOA 2M4GA 1UJ8A 3CDHA 3H0GJ 2DTRA 2OCEA 3F22A 3TDZC 3CCLI 4M73A 4BY7J 4MEYF 2Z3YA 1UMQA 2V1DA 5BNGA 5BPDA 3CDLA 3MCZA 2Q2EA 3TOAA 2E7XA 2FRHA 1RUOA 1WKMA 1IW7F 2HTJA 2XIGA 1OKRA 5TRDA 1IAWA 2OQRA 2QM3A 3RJPA 4I6ZA 3HC7A 4V2FA 3CQZJ 3A03A 3JAMZ 5B5EC 1K6YA 2FMYA 2PJRA 2Y2ZA 1J0RA 3KIOA 3P9CA 3ASOH 4GCVA 3ZGKA 3DXJF 4EMSA 1MBFA 4ESFA 1Z21A 3CJNA 3M1EA 2VONA 2GZWA 4HF0A 5CVJA 1KU7A 1QQIA 2NVUB 3SZTA 1ZAOA 2ZMEC 3DV8A 1KGSA 2QQAA 3HOYJ 3HJEA 3ONQA 4E7SA 2B63J 2CS3A 1WPKA 1Z77A 4NHJA 2KRCA 2DFEA 4BEHB 2CQKA 1GXQA 4P9UA 1ZK8A 2VQGA 3O6BB 4N4NB 1VQKI 3JREA 2L4AA 5D8KB 1R5ID 3DU5A 3OV8A 2LDUA 1W5TA 3CUQA 5HDNA 3DBLB 3DEUA 2MSYA 1TLHB 3BTJA 3DBRB 5IYCJ 5FRMA 1JTXA 3MEXA 5F08A 2IGKA 3K4JA 5J4YA 3LFKA 2AS5F 3V8LA 3OYJA 4ON0A 4U88A 5C4JJ 2PMZN 1A04A 2HTSA 3A0HC 3HXLA 4C3HJ 2NS0A 1KU9A 1Y8QB 1IN7A 5B1AH 2XGXA 2QWWA 3WGHA 1O4XA 2CQQA 5BS6A 3LSTA 1D5VA 4HQMA 2K4JA 2R3SA 1WFXA 1OJLA 1WWXA 1JGGA 4BQNA 5EZGA 2LVSA 1ZR2A 2KFDA 3QAHA 1UB9A 1X1BA 3NWTA 1P7IA 5GP9A 2ID6A 1FWZA 3VDXA 1B9NA 3DPUA 4IL6C 3S2HJ 1D1CA 3IRQA 1H88C 3DCFA 4UUTA 3LWFA 2L02A 3ESWB 1MMNA 2FNAA 4BJTA 5F6FA 4A5MA 2HXOA 5JHFA 1ON2A 1FY7A 4HX7A 4AM3A 4WXCA 4KA4A 2ZNYA 1JT0A 3QP5A 2QCOA 3LSRA 5EJCA 3SZPA 1GXPA 3U1DA 2LY1A 1DP7P 2EZHA 1RI7A 2COMA 4OINF 3SZGA 5J1YA 3PSIA 2EK5A 5D5XB 3OY9A 2IP2A 1D0YA 1FP1D 2XPVA 3C18A 3J80Z 4YFNF 3K4MA 3L2RA 4G94A 2BBYA 2X48A 5F1JA 4A3DJ 2J5OA 2JMWA 2OUMA 1FOXA 1XSVA 3E6BA 1KU3A 2R92J 3F0CA 1SD4A 3CCEI 2KZGA 5H20A 1SMYF 1Y0UA 3J7ZI 3LSMA 4XN0A 4EM2A 1YQAA 3GXOA 2ZC2A 2GIVA 4F93B 1SFKA 3RIRA 3ZP5A 2UXNA 2CV1A 1TWAJ 2XUBA 2DA1A 1R71A 3DQVC 1WJAA 2W00A 1TBXA 4PFOA 1VQPI 3I5UA 1R22A 1T08B 3NWSA 1VNDA 2DJNA 2K9QA 4LK0F 2ZJRF 4ENMA 3I4PA 2KIMA 2JSPA 1O3RA 4S05A 2DFHA 2W57A 4CCLA 1VI0A 1LEBA 1IDYA 1HOMA 1CGPA 1IN8A 4FTHA 2IXSA 3JW4A 4EJWA 2CFXA 2DDAA 1UG2A 2DCEA 1I50J 3G1OA 4XKVA 3C2HA 2V26A 3H3UA 2EFPA 3FXMA 1K61A 3D5SC 4O3MA 4QPOA 3F6VA 2YX7A 4EM1A 1XDUA 6PAXA 3TO9A 4B8XA 2PMUA 1VF9A 4MIMA 4AYBA 4U7DA 4A3JJ 1DDNA 2CV0A 3WTSC 3LA3A 1MSFC 3KETA 2EFOA 4W97A 2VPRA 2XAHA 1Z0XA 1U6GA 2KT0A 4RGUA 3SFZA 2M1BA 3FZVA 4IHVA 2DA6A 2FOWA 3ULQB 1YTYA 1F4KA 1DPUA 1ODDA 5DDGA 1S7AA 2XRNA 3BP8A 2ZSHB 2ZMEB 1Z05A 2BE5F 5IOZA 1J7KA 1ZGWA 3ZQQA 2KLOA 2G9WA 2QF7A 3K6GA 3JRDA 1VQMI 3ZPLA 1EH6A 1NH3A 1KQ0A 1KYZA 3HRTA 4XK4A 2Y0SA 4BXXJ 5M3FJ 3OR2C 1FOKA 1OYYA 1XGOA 4XONA 1AA7A 1Q1VA 3DKYA 4BH9A 4IO9F 1DUXC 1XB4A 3PO2J 3CCJI 2R7QA 3HOVJ 1BA5A 1R58A 1V55H 4II3A 1ETOA 3DTKA 2E1OA 2YU3A 2HYJA 1LQ1A 5FLXK 2H8RA 1G3SA 2HQAA 2KJBA 1MBGA 2VB6A 2WV0A 1Y0NA 2XKOA 3A4CA 1ZG1A 2CW0F 2BW3B 3KLNA 5E1ZB 2VKEA 3HRUA 3HRMA 5IPAA 3CCSI 5KK1A 1AKHA 1ZG5A 1SAXA 1JKOC 4A6DA 1TQIA 1I39A 2IPQX 3EUHA 4KT5C 4LOCA 1JXSA 4WX9A 2D1VA 1G6NA 2IS6A 2RC4A 4B47A 5LD2C 1X4PA 2FNPA 3OSGA 1Z6RA 3CJRB 3HOXJ 5IP9J 1TQPA 3TO6A 4C3JJ 2EIKH 1PP8F 2BVMA 2EA2A 1WCMJ 2R7VA 4HF2A 1B9MA 1QGPA 3PL8A 5CVRA 1TNTA 3DEWA 5GTHC 2WAFA 4Y15A 1FMVA 1QZZA 4RAFA 1XTAA 3GTQJ 5F27A 2JVHA 2Y9ZA 5HDKA 2E1CA 4M74A 4OMZA 1ZH5A 2V9VA 3K9TA 3M8FA 4FETA 1X3WB 1BBYA 4KMUX 3U21A 2LH9A 5J8CA 1PP7U 3M8JA 1G8XA 1RC9A 3F23A 3S1QJ 5AIQA 4QLCU 5IP6A 1BIAA 2DK5A 2DO7A 4AUXA 2NNYA 5IYDJ 1MNEA 4OAZA 3TDUC 3J81Z 4E7HA 4BXFA 2VJIA 1JJ8C 1IXSB 2K9NA 3V8JA 2WB1N 2MC4A 3FIWA 3WTVC 5DCFA 2MH2A 4RBOA 1GUUA 3FBIB 3OYIA 1VQ8I 2E5ZA 2ELJA 2V7FA 3VYRB 1YJ9I 3ECOA 3TKYA 4IOCF 1WH7A 2WA0A 5IP7J 5BMZA 1W5CC 2FMLA 1ETYA 4DZPA 3W6JB 1BW5A 5KAIC 1YO5C 1FTZA 5HVQC 4ANJA 2WTEA 3P9KA 4XRMA 3BJAA 3FWEA 4M71A 4PK4A 5LFAA 4KNYA 2LFBA 1HDDC 2HOEA 1SVMA 2HDWA 3HEFA 1A6QA 3AG4H 4A5NA 4A6EA 3HDDA 3TOBA 3RPUA 4CCKA 1OR7A 4ESJA 2OZUA 1MNMC 2GOMA 2UUZA 3K4BA 4WCGA 1EF4A 3R0AA 2R7SA 1MH3A 3DPTA 2ZNZA 2HOAA 5KCMA 4I7HA 3UNGC 4XNFA 5D5VB 2EQRA 2G0EA 4B3AA 2OJED 4E70A 3CZ6A 4XQFA 2F5VA 3WE2A 1MMSA 3BPVA 3AKZA 2L5QA 5FLMJ 3LQQA 4MEXF 5F1RA 2M4KA 3FXJA 4HOBA 3GZ5A 1EH7A 5L3FA 3ZQHA 4IHWA 4U0WA 4IF4A 3BLYA 3ZMUA 3PO3J 1HF0A 4L9TA 1KONA 3H0DA 3I64A 3WU0A 3FKJA 3U9GA 1BOBA 2ACJA 2BY2A 3BR2A 1W7PA 4A2UA 4XLPF 2NS7A 1CF7B 2W85A 2VL8A 4A3BJ 1ENHA 2PG4A 4D5FA 2RKHA 4HNVA 1N75A 5H2FC 3LAPA 5EGOA 5F0FA 2XHKA 2Z5UA 1F43A 4XM3A 2O61A 1FIPA 4HLXA 2ELHA 3VB2A 5EDNA 3NARA 4RMNA 3OYEA 1XS9A 5FROA 4Y33A 2LYCA 1Z3XA 2A6HF 5FB2A 1NK2P 2YPRA 3K4LA 4B44A 2M87A 2X1EA 1FNNA 3DF8A 1V5EA 4P5OA 1PYVA 1IGNA 2HNHA 2WC2A 4M6YA 2BY1A 3M3YJ 5E20A 1W1WE 4CH7A 3K7AJ 3QOEA 3ABLH 2VUMJ 3PQKA 5CVVA 3GTLJ 1IG7A 3MD2A 4IOAF 1ZELA 4FQGA 3H3VK 1H9GA 5J8FA 1P92A 1IUFA 3IH3A 1XN7A 2XAQA 1MIJA 4BHBA 3BCAA 4DYRA 2VJJA 1O57A 1P7JA 2XF5A 3ZXSA 2JQ7A 2MGQA 2DTZA 4XLEA 4HNUA 2WBMA 4PUSA 1XPXA 2ECCA 3EDPA 4RB2C 1ZTRA 1YX3A 1QVUA 1TT0A 3L09A 3BWGA 3DTIA 3D5RC 3FISA 5DUIA 3H9GA 1SFXA 2UZKA 1SFOJ 4P9FA 4PZJA 4ETSA 1YRNA 4IQJA 1U8BA 2XPWA 2VBZA 3KP6A 1EKEA 4GYGA 5E8GA 3OS0A 3F8NA 5HDGA 3C1DA 1QPIA 2KJCA 2MD5A 1W5SA 3H9JA 2VJ5A 5DM6F 3CO6C 1RNLA 1NK3P 1IRGA 2VOOA 1YG2A 4GYIA 4WK8F 1VQ9I 2NVYJ 2R7DA 4L0ZB 4EV0A 4JYKA 4CO8A 2Y30A 3HHGA 1ZHFA 3R4KA 1QVTA 3LA2A 3F8FA 3PQJA 3WG9A 2HOTA 4LG0B 2HS5A 2X4HA 3H1CA 1U5TC 3KX2A 4ZC3A 3RYPA 5IT9K 5LRRA 3U2RA 3HUGA 4XKCA 5LGNA 1J09A 1X3UA 1TL8A 2VXZA 1T0FC 4KT6A 4U0VA 4ZYAA 3CC4I 2HR3A 3A0BC 2QSFX 1OCPA 1OFCX 3E6CC 4WF2A 1TTYA 2BHYA 5CKTA 1S3JA 4E6KG 2MH9A 4BQQA 3W3CA 3BJ6A 2ZKZA 1QHHD 2D2WA 2KL4A 2W84A 4EATA 4OU0A 2V9KA 3LSKA 5M5YJ 2YR2A 3IL2A 1LE8A 3HOSA 1NTCA 2CQXA 4E4HA 4A3KJ 5LGUA 1JE8A 1QNTA 3IC7A 4KIBA 2ME6A 3H92A 4M3GA 3EQLF 5IOYA 3MKWB 2FQ3A 4EJVA 3FMQA 4LIVA 3F8CA 3HTUA 5FFXA 1SD6A 1A31A 1GV5A 4L18B 5E8IA 4I98B 2OZ6A 4YRVA 2QENA 3PSFA 4BL0B 2R5ZB 2HU9A 5EG0A 4GDFA 3OYLA 1DQUA 2EB7A 4P96A 2QGUA 4EQQA 1BI2A 2XB5A 3DFGA 2VQLA 2ID3A 2LTPA 3I59B 1V3FA 2PMHA 1HW2A 2DI3A 5DD4A 5ILSA 4BYYA 4RB1A 2JA5J 3T1BA 2X0LA 3PFIA 2QSHX 1B4AA 1D8KA 3N05A 2Y31A 2IEKA 5BOXA 2F2EA 4E7KA 2FBKA 4HRIA 2VBYA 3BDDA 3HPHA 3WTXC 1ETKA 4YEJA 5J4VA 4BQAA 2Q0OA 3CD6I 3MVPA 3JCUC 2DYRH 4F92B 3LAJA 1X1CA 1YIJI 5B66C 1Z1DA 2F5EA 2VJ4A 5EYRA 2H94A 1X4OA 2K7LA 3V4GA 3FKIJ 2DFFA 1NG6A 1O7LA 3QU3A 1IC8A 1ZGAA 2JPBA 3HSFA 3LQRA 4FHTA 2LBFA 3CJQB 2CW8A 1QHGA 4M3EA 3GBGA 4XR6A 3JRAA 2HXIA 2XASA 1YIOA 4IZZA 1HLVA 3A01A 1BI0A 3O2PE 1P6RA 3BG3A 1Y1VJ 4HA8A 3WTUC 3L1PA 4BBRJ 4NNJA 4PFPA 1JJ6C 3FXRA 5HNFA 3CMMA 4LFUA 2QYOA 3IH2A 4L5JA 2BV6A 2IGMA 2RGVA 4N9HA 1JKRC 3L7WA 3KEQA 1JUPA 4PGHA 4HAMA 1KQ9A 5JLWA 2WAEA 3NAUA 2P7CB 2CMPA 1IZ1A 1B6AA 3CJTB 3K70C 2I8DA 2LD5A 2ESNA 3JRHA 1Y56A 2CSOA 2ZBKA 2BHZA 1H9TA 2BY3A 4IHTA 4IHYA 3QYBA 2A6TA 3QU6A 3BTIA 3PIPF 1K83J 2K9LA 4LIUA 3F72A 2E7WA 1FBSA 2D1HA 2DAOA 5A2QK 1QZYA 1P4XA 3K1NA 2X1CA 3CCVI 1VTNC 3SXYA 1S72I 2GXAA 2EPFA 3OS2A 2ICWG 3ERMA 3K70D 4A69C 1SFUA 2JUGA 3HIFA 2R7UA 3S1NJ 4PSWA 2BGCA 3IAS2 3GYHX 1B1BA 3KP4A 3BR5A 3BTCA 4B1RA 2JTVA 3CCRI 1FYLA 1I3AA 2ZXHA 2YS9A 4PJMA 5DUKA 1H0MA 2LK2A 2O0YA 4RM3A 2X6XA 5IYBJ 2RNGA 1J5YA 2CWEA 1ETQA 4DJAA 3R60A 1P9QC 2IGNA 3VODA 3GZ6A 2GM4A 4XLCA 1Z7UA 2X6YA 3JTGA 3F8BA 5HLGA 3LA7A 2RV8A 1W0TA 2M8GX 4D7MA 4M6XA 2V1UA 1IV8A 3WTTC 5C44J 3E5UA 2Z2SB 3QPSA 4IQ4A 3L2CA 3I0TA 4LITA 5ERIA 2LOOA 1MBJA 1YW7A 1U5TB 2FF4A 4KIGA 4YIIA 4F7ZA 3MWMA 1O7FA 1BJZA 1MGTA 1VZ0A 4HLYA 2B7EA 2L7MP 4NQWA 2NOGA 4CYCA 1VQ5I 3L2VA 1E3PA 1XMXA 4QIWN 1U0JA 2RVCA 3OR1C 2MD0A 1R23A 1TNSA 3Q3SA 1HDPA 2IW5A 3AL0C 1TT5B 2QBYB 3IWZA 2YUSA 4DZJA 3TGNA 4I01A 2QKMB 2QQBA 2QSGX 2RNJA 4HF1A 4UY8I 2DMUA 3CUQC 2E2HJ 1ACIA 1I6XA 2M9HA 5HNHA 3GF2A 2R5YA 4C2MJ 3CUOA 2MYSA 1YJWI 2WAQN 5E17F 2AHQA 1T38A 3ZN1A 1B8IA 4OAYA 3GTKJ 2EA4A 4I0BA 1ETXA 1FMWA 3I9V2 3DWLE 2DBBA 1IN4A 4QPQA 3SEQA 1JHFA 3WG7H 3CCUI 3J7AY 2CG4A 4AVPA 5B3SH 1MNDA 1YI2I 4WXHA 4RB3C 2XAJA 1JGSA 4U0YA 4BE0A 1V5GA 1HSTA 2RQQA 1YS6A 3EPZA 1LKXA 4I02A 3FHZA 2IBDA 3OL4A 5B1BH 2TRTA 5HS9A 3RKXA 2LP0A 1LUJB 2UV1A 1MJ9A 9ANTA 3FMSA 2XF6A 2EFQA 5AIPA 1T2KA 1FBUA 3MKZA 4MTDA 3FK7A 1J9IA 2G7HA 2OA4A 3DPLC 3Q9VA 4C2TA 2EZLA 1K6OA 3SDGA 1R5GA 1SAUA 2EINH 2MA3A 1UFMA 2ZXIA 2MABA 3O8HA 5ICEA 2VT3A 3TW6A 4UVBA 2H6BA 3K2ZA 3ZRGA 2R93J 1S5LC 2XPUA 1PUFB 1ZRFA 1TP4A 2HDCA 1XC5A 2HOSA 2CFOA 2NXNB 3HSEA 3HGGA 1OQYA 2DXIA 3SHFA 3A01B 3MQ0A 1B72B 3TW7A 2FA5A 2B9SA 4BE2A 1K78B 3P5JA 2WWYA 3CP8A 1LDDA 1ETVA 1FSEA 2FU4A 1HC8A 2A3SA 1TWGJ 1ZRDA 2E19A 4BQOA 1G3WA 5K7HA 4LD5A 3ZMDA 2K9SA 4GXOA 1RESA 1BR1A 2R0QC 2E2JJ 4I99C 3HYIA 3M7GA 3MZYA 4IJAA 3CC7I 1LFPA 4R79A 3GTPJ 1JUMA 4PSXA 2VPLA 1IN6A 1X2MA 3MKLA 3QOPA 4KFCA 3HHHA 3MN2A 4X1EA 2DODA 3ZMZA 1BC8C 2PQ8A 4XKBA 4IKFA 1RR7A 3DU6A 2EH3A 4Q4ZF 2J5PA 2E71A 1YX5A 1I6HJ 4JBAA 2Y75A 1V54H 2L7ZA 2R7FA 2F6CA 1RKWA 2E36A 4S04A 4L9JA 5FFZA 2D5VA 4ZYHA 2H1LA 3K2AA 2Q2EB 1EH8A 2FE3A 3F6OA 4XRFA 3ZCOA 5D4SA 2VC1A 1O3SA 1UCRA 2COBA 3FXKA 4WXDA 3T8RA 3E6DA 3LSHA 4ZYEA 4EJUA 1IUYA 4M6VA 2GA1A 1XSXA 3E7LA 1K4SA 4IRIA 4ENJA 1ONVA 4NC8A 3CCYA 1XG1A 1D5YA 5ILUA 4FX0A 4HW0A 4HV5A 2PJRB 5CYVA 3GTJJ 2KZVA 1IN5A 4AIJA 4B43A 4BHPA 2F5FA 2L7KA 3M4OJ 2Q8KA 2K9MA 4PCQA 4XMYA 3VWBA 5FO5A 4RAYA 2PN6A 2W7NA 2KQRA 5E3LA 4IX7A 3BOQA 1UHMA 4JOMA 1ZKGA 4LLGF 4IRHA 2OC6A 1IF1A 3AL0B 3S8PA 1MZBA 3H9QA 1T56A 4CYCB 1N25A 1VQ7I 3K69A 2NYXA 3ABUA 2KRFA 2MLGA 5FKLA 3CUQB 4F52A 3HRSA 4YFXF 2GBYA 4N4OB 4FE7A 2KDOA 4RGRA 4XL9A 3HTSB 2PJPA 2VE8A 4EEFG 4RAGA 2HPIA 2R7ZJ 3D1NI 4Z2YA 1BM9A 2VXDA 3VPRA 2CJJA 2CUEA 3EUHC 3MZHA 3JAMK 3C2BA 2VKDA 2ZJ2A 1FYKA 2DW4A 4PJ0C 2B0LA 1S9HA 2DA7A 2Z16A 5CLSA 1FT9A 1DU0A 4RGSA 4A3MJ 3N97A 3RZOJ 1HA8A 4I2OA 4AVZA 4DOZA 1MDMA 2LY2A 4ZTFA 2L54A 3Q5FA 5F04A 1OYWA 2KRHA 3UKGA 4D9JA 4WWCA 4UHTA 5D6EA 2XRLA 3LL7A 2CW7A 2CUZA 1ON1A 3VSKA 4BS9A 2Y48A 5F0CA 1IJWC 4LB6B 5DEQA 4S0HB 2P6SA 2P5VA 2DOFA 3MFKA 2FXAA 1N78A 1XMAA 2A6EF 2F4IA 3O3KA 2XROA 1W4MA 4MGRA 1GVDA 2CV2A 1VFCA 4W1UA 3WGIA 3WU2C 2EIJH 2Q1ZB 4XKWA 5LHIA 4QTRA 3SDBA 5LLQA 2Z99A 2H6CA 3IWFA 3WHBA 3HOTA 2F5CA 3OYFA 2RAEA 2STTA 4B4CA 4AYBN 4KMFA 4LJZF 5LBQA 1ZLKA 2VBWA 1Y6IA 5GAHJ 1FYMA 1BR2A 4YELA 3S3NA 2K02A 2X9DA 1MBHA 2XDVA 2OD5A 1POGA 1TW3A 4UUSA 1GHCA 1I5ZA 1SFEA 4JX4A 4ENKA 2EWNA 4KIFA 5DTDA 2HGCA 2EZKA 1KZHA 3OL3A 4EJOA 4E7JA 1TWHJ 1OR7C 2Y0SN 1TC3C 1FZPB 2X6OA 2LREA 4OOIA 1X19A 4XN3A 3CO7C 1JKPC 3BG7A 1X2NA 2VN2A 3EUKL 4ZDPA 3S2WA 3HOWJ 1MKMA 5JVGF 4HQEA 1J75A 3RPUD 3FDYA 4RLFA 3ISPA 2A07F 4XLNF 2YU9J 1HCRA 2CYYA 3ZQCA 2FSWA 3G1LA 2L3DA 2MLKA 1WI3A 2JN6A 2N8GA 2LLKA 4YFKF 3GW2A 2NOJB 2LSOA 1C0WA 4HYEA 4DYQA 3J80K 2IGOA 3K4CA 4A93J 3QYEA 1DGRM 1RETA 2I5UA 4O6JA 3HM5A 4C30A 4IVNA 3ELKA 3WHCA 2IS2A 4A0XA 3M07A 4ZYGA 2E1MC 2I10A 4G7HF 2LR8A 4YIFA 5LHHA 2FUG2 4Y52J 1LB2A 1Z3YA 2VODA 1D0ZA 1YITI 1ZN2A 3E0JB 5KHDA 2JWTA 5LRSA 4A3GJ 3ZOBA 3BR1A 2YSRA 1W7PD 2CUFA 1DP3A 1QPMA 2LNBA 2PFBA 2QQ9A 4RGXA 5E79C 1E3OC 3TEDA 1T95A 3L00A 4GFBA 2JA8J 2A69F 2IT0A 1QRYA 2ESHA 2ISYA 1TW2A 4AIKA 1DPRA 2NVTJ 2K5CA 5DCMA 2L7FP 3FM5A 2KIQA 4XOTA 4RDUA 3RTRA 1ITYA 3KLOA 2W1OA 1AKHB 3E6MA 2EJRA 5FGMA 2O8KA 3PFYA 1GDTA 4D5CA 2W4SA 3E5XA 2QQ8A 1AHDP 4A3CJ 4J00A 2JRTA 2WY7Q 1BN5A 1T39A 1S7OA 4FISA 1BI1A 4HBLA 2E34A 1X1PA 1QBJA 3W6KB 3OYBA 2V4JC 1PUEE 3GX4X 4Y3OA 3I71A 3OS1A 1DU6A 2HEOA 1KQ8A 4ENNA 4MNUA 3HOUJ 4X0GA 3JR9A 3MMYB 1EA3A 1SVOA 2FBHA 1WJEA 1XCVA 2ZO4A 1HKQA 4GGGA 4KYWA 3FF5A 3J7AO 2M45A 1B59A 1BIBA 2WADA 3GFLA 5L3EA 3KCCA 2LMDA 3G6EI 3HOZJ 4BJ5C 4BXUA 4G6QA 3N4MA 5GTIC 1NHAA 4CZZA 3OIOA 2GXBA 4PGGA 5EEAA 2V1XA 2A68F 3AFHA 3FXUA 2MFZA 3K10A 1LNWA 4MO7A 5LEKA 2VE9A 2KIFA 4N0BA 2F4MB 1MJAA 3E97A 4G8XA 2E60A 2QLZA 2ELKA 3GEZA 3HKZA 4A0ZA 3WTYC 2GQQA 3V42A 2MBFA 5CVIA 4FX4A 3OYCA 5LHGA 1XGNA 2F4OB 4BEHA 3COAC 2LF7A 3QRFF 3BROA 4N9IA 1D8JA 2H8WA 1P4AA 4L9VA 3TP0A 2CU7A 2BVLA 3DKWA 1I27A 1YW8A 3BQZA 1FEXA 1MW7A 1YLFA 1OLTA 3IAM2 2L2OA 2PLYA 2P81A 2GOXB 2JA6J 4E7LA 3BZKA 3CMYA 3I3LA 5FD6A 4LK1F 3BG5A 4Q47A 3IKVA 3HG9A 4H4KC 3L9FA 4M72A 2M2EA 2PI0A 4DYCA 1BL0A 3QP6A 1J59A 2IJLA 2DPDA 3S2DJ 2DA3A 4XRSA 2QUFA 1XSDA 3JSPA 2BZTA 2O8XA 1MD0A 3GFIA 1V4RA 2HPMA 1APLC 2GA2A 3KYLA 1MSEC 4CHUA 1Z6TA 1GV2A 1P2FA 3KP3A 3RDIA 3GUDA 5LEJA 3S93A 3TL4X 3IHUA 4FE4A 4QWQA 2GLOA 4RM2A 3I55I 4Q5SF 1QA6A 2Y0MA 2PBIA 4OWRB 1FC3A 3BC8A 3VEPA 5KAFC 4CUGA 3KZZA 1AU7A 2IS4A 2E5NA 1XD7A 3FX3A 3OIPA 1JI8A 4ZDLA 1UG0A 1H8AC 3WTWC 4L5IA 1K4TA 2DA2A 4UNOA 2M34A 2VKVA 3J81K 2AO9A 2X1DA 2AXTC 2RREA 2ZXJA 1X1AA 2L9RA 1G59A 2E1NA 3BT9A 4XRSG 1XX5A 2ZB9A 4PDKA 2XGDA 3QYFA 5ED4A 4BACA 5EEGA 1HW1A 3S17J 1PVEA 2P8TA 1W7PB 3I4NJ 3IP4B 2V9PA 2XV4S 4OIRF 2W24A 1O3QA 2PMZA 2W48A 1LVKA 2K4BA 3ZMSA 4NBQA 2IA2A 2OBPA 4AIHA 5EGOB 2DPUA 4MQ9F 3JRGA 4G7ZF 3OSFA 2L9VA 3OOPA 2NAZA 3T8TA 1WJFA 2V79A 4HX4A 3JRIA 3T0YA 2HDDA 4A3EJ 5JVTA 3MKYB 5TISC 4ASNA 3Q0WA 1F5TA 3GLXA 1S29A 1WJCA 5J6XA 3K4KA 5D4RA 2IVMA 2OV7A 2VC0A 4ZTJA 2VQCA 2JPCA 4EVIA 1A36A 1R6RA 2HKXA 4KN4X 4MQVA 3PIOF 5FKOA 1F9NA 3HSRA 4RB0A 3FBNB 4FASD 3CC2I 1QO0D 5AONA 5JI6A 1VQ4I 3GFJA 3CLOA 2O3FA 5E3OA 5GPCA 1WH5A 2Y69H 4MFDA 3H5RA 3CF2A 3D0SA 2XAUA 1X3ZB 4IPAA 1WZ2A 1SANA 3ZQIA 4V2GA 2LKXA 1ZQ3P 4UVAA 5J3LA 2JT1A 2TCTA 3HKZN 3K4NA 4BU2A 5FLXZ 3BG9A 2HVQA 3KYDB 1IRZA 1M1EB 1YW9A 2XKPA 5D5UB 3K0LA 3L2UA 2FQ4A 2QA4I 2ADUA 3VYSB 2DOEA 3CP2A 1R1VA 4LGWA 3VFZA 2KISA 2LG4A 5FLVA 3I58A 1YRNB
chains in the Genus database with same CATH topology
4XLHA 2VKHA 2HVSA 4DBQA 4CCMA 4PSXA 2VPLA 3DTEA 2M0MA 4G6TB 5HVQC 4ANJA 2XF7A 5HLTA 4XKBA 4IKFA 3DU6A 1X1DA 2JA2A 3TMOA 4PK4A 5LFAA 1YX5A 4BJ6C 2HDWA 2KP6A 2F6CA 4CCKA 3SEZA 2GOMA 2Q2EB 2UUZA 3K4BA 3ZCOA 3C2GA 4Y4RA 1V5FA 2R7SA 3DPTA 3LSHA 5KCMA 5CQEA 3UNGC 1LDKB 3HUGB 4XNFA 3OIQA 4NC8A 3CZ6A 2R7XA 4XQFA 1N77A 2F5VA 3AKZA 2L5QA 4KITB 2PJRB 2KZVA 2UWMA 2M4KA 2M3AA 3FHNA 2BW3A 2L9SA 4HEA2 4B43A 3DEEA 2L7KA 5CQGA 3BLYA 4PJNA 4F3QA 2K9MA 4PJJA 1NG7A 4XMYA 4E7ZA 3VWBA 3H5NA 1KONA 2W7NA 2XSJC 3H0DA 2KQRA 2XC7A 4XLFA 4B48A 2R7OA 4IX7A 1ERDA 3FKJA 1BOBA 4JOMA 2M7AA 4MLOA 3BG6A 2VL8A 4B3XA 2AQFA 2OC6A 3AL0B 3S8PA 4JQFA 1N75A 2AQEA 3H9QA 4LG3A 3A2KA 2R7RA 4XM3A 4NC7A 2DJIA 1D1BA 2LRDA 4RMNA 1W36C 4F52A 4HG2A 2E1MB 4N4OB 3OYEA 3G2BA 5FROA 4Y33A 3LSGA 2LYCA 3LSIA 3W2WA 2CUJA 3H35A 1Z3XA 2KDOA 3PNYA 4XL9A 3BCBA 3KEYA 3K4LA 4B44A 2HPIA 2X1EA 1V5EA 4P5OA 1PYVA 3VSLA 1BR4A 2VXDA 1W36D 2HNHA 2WAQA 3EUHC 4BUPA 3DLAA 2VKDA 4CH7A 1UAAA 1S9HA 3QOEA 3S32A 3OYNA 4U7BA 2Z16A 3MD2A 2VQHA 1ZELA 1HA8A 4AVZA 2LG4A 4DOZA 2LY2A 4ZTFA 1DGWY 3BCAA 3H5AA 2Z1DA 3PNVA 2LBFB 2VJJA 3D5LA 4J01A 2KRHA 2XF5A 3ZXSA 2HVRA 1UELB 4XLEA 4HNUA 2WBMA 2X51A 4PUSA 3A1YA 4D9JA 1D0XA 3OYAA 3LL7A 2CW7A 2CUZA 2W82A 1YX3A 1TT0A 1IRXA 1TZLA 3D5RC 3DTIA 3VSKA 3H9GA 3OWTA 4CSWA 4C2UA 4RLQA 4BS9A 4XOPA 4IQJA 5CPRB 5FRNA 2DT7B 3OS0A 2M4GA 4D1QA 1N78A 2F4IA 3H9JA 2VJ5A 2CV2A 4II2A 2Q1ZB 4XKWA 3SDBA 3HOTA 3OYFA 1WJBA 2HZDA 1YE9A 2DT6A 4ZC3A 3KX2A 1E0EA 1Y6IA 3HC7A 4XKCA 1J09A 1BR2A 2VXZA 1T0FC 4KT6A 4ZYAA 4YELA 3S3NA 1K6YA 2XDVA 3M1CA 1Z7LA 2PJRA 5CKTA 3ZGKA 4BDYA 3HPGA 4E6KG 1Z21A 4BQQA 2WB1A 3W3CA 4CCJA 1QHHD 3OL3A 2KL4A 4E7JA 4EATA 1OR7C 4HSRA 2V9KA 3PUBA 3LSKA 3ONQA 2LREA 3OMYA 4E7SA 3HOSA 1X19A 2CS3A 4XN3A 4E4HA 4DBRA 3BG7A 3EUKL 2KRCA 4ZDPA 3MKWB 4BEHB 1GLNA 4LIVA 3RPUD 3FDYA 2VQGA 4RLFA 4N4NB 4YRVA 3DU5A 4F91B 3PSFA 4BL0B 2HU9A 3OYLA 1DQUA 2NOJB 5FRMA 2VQLA 2IGKA 3K4JA 2R7WA 3OYJA 2IGOA 3K4CA 3QYEA 4NQWB 1DGRM 1PJRA 4C30A 4HNTA 2IS2A 4NUBA 3HXLA 3L2WA 2ZSIB 2E1MC 3N05A 4CCNA 3RQ4A 4E7KA 4HRIA 3HPHA 3OOUA 2FUG2 4YEJA 1Z3YA 1D0ZA 2K3PA 3E0JB 3RCOA 4F92B 5KHDA 1X1CA 1WFXA 3F9KA 1DP3A 2VJ4A 1X4OA 4BQNA 1NG6A 2LBFA 3CJQB 2CW8A 1T95A 1QHGA 1X1BA 3NWTA 2M7BA 3GBGA 4P1WA 4XR6A 3VYUB 3VDXA 4IZZA 3DPUA 3IUOA 1D1CA 2K5CA 1MMGA 2X85A 4XOTA 3RTRA 1MMNA 2LC2A 4NNJA 4PFPA 4BJTA 4ZJZA 5JHFA 2W1OA 5HNFA 3CMMA 2IGMA 3PFYA 2W4SA 4J00A 2WY7Q 3OYGA 4ITVA 4CZCA 2WAEA 2LY1A 3SZGA 3OY9A 3OYBA 2CMPA 2V4JC 3PSIA 3K70C 1WJ5A 2I8DA 4Y3OA 3OS1A 1Y56A 2KMUA 1D0YA 3QYBA 2A6TA 3K4MA 3L2RA 4X0GA 3MMYB 2K9LA 4LIUA 1EA3A 1WJEA 4CCOA 2OUMA 3SYTA 2X1CA 3OS2A 2V1NA 2WADA 3K70D 3PJRA 2JUGA 4BJ5C 2R7UA 4F55A 4PSWA 3ZR8X 3IAS2 4E7IA 3LSMA 4XN0A 4F93B 1SFKA 3AFHA 2CV1A 3K10A 2MFZA 2ZXHA 4CA0A 4GRIA 2IS1A 2ZFUA 3E1SA 4DIQA 4PJMA 3DQVC 4RM3A 1WJAA 2W00A 2X6XA 2RNGA 4PFOA 4DJAA 2P0WA 2E60A 3LMMA 3NWSA 1P9QC 2IGNA 3HKZA 4XLAA 3V42A 3OYMA 2JSPA 4XLCA 2X6YA 3OYCA 4CCLA 3OYKA 4XORA 3S3OA 1QU3A 3CESA 4BEHA 2IXSA 2R7TA 2Z2SB 2BVLA 2JVGA 2DCEA 2KPMA 4IQ4A 4XKVA 3C2HA 1MW7A 2V26A 1OLTA 4LITA 2LOOA 3IAM2 2L2OA 3D5SC 2KHMA 2GOXB 4QPOA 2A5WA 4E7LA 5TGTA 3I3LA 1VZ0A 3HG9A 4H4KC 4AYBA 2VASA 2CV0A 3L2VA 2WY8Q 1U0JA 3OR1C 2MD0A 4DGWB 2HPMA 3KYLA 3AL0C 4KJZA 2ZSHB 2QKMB 3HL2A 3S93A 3TL4X 3ZQQA 4HSTA 2KLOA 3K6GA 4RM2A 2X6WA 2Y0SA 3OR2C 4XONA 1AA7A 3DKYA 3RSNA 4OWRB 5HNHA 3BC8A 2MYSA 2R7QA 2IS4A 2R4GA 4CUGA 4II3A 3W2AA 4C9YA 2E5NA 3DTKA 3OIPA 1JI8A 4ZDLA 1UG0A 4OAYA 2HQAA 2VB6A 4PJLA 3UR3C 3A4CA 2BW3B 1FMWA 2RREA 2X1DA 4BDZA 1X1AA 3I9V2 5KNLA 1G59A 3DWLE 4QPQA 3SEQA 2L9NA 3PNTA 3QYFA 3J7AY 4BACA 1D1AA 3S3MA 2O5RA 1MNDA 3OYHA 3IP4B 1MMDA 4AU7A 1V5GA 2PMZA 4BE0A 1LVKA 2RQQA 3EUAA 2IS6A 4BE1A 2V6EA 4KISA 3EPZA 1LKXA 3OL4A 4B47A 5LD2C 1X4PA 3TBIA 2UV1A 3CJRB 1WJFA 1WJDA 2XF6A 2VLAA 2BVMA 3MKYB 3MKZA 2R7VA 1WJCA 3DPLC 4C2TA 3K4KA 3PL8A 2OV7A 4ZTJA 2VQCA 1SAUA 1MMAA 1R6RA 2CH0A 2WAFA 1FMVA 2ZXIA 4HPQA 4U87A 2MABA 3DKXA 4BGDA 3FBNB 3VYTB 2BOLA 3QODA 4FASD 2JVHA 3ZRGA 3L2QA 2VIXA 2QKLB 3H5RA 3CF2A 2XAUA 2CFOA 4FETA 3OYDA 2DXIA 3U21A 2DOAA 5HOOA 2LH9A 4ZDOA 3M8JA 1G8XA 3K4NA 4BE2A 4BU2A 3CP8A 2HVQA 1MNEA 4OAZA 4E7HA 4BXFA 2VJIA 4BQOA 3L2UA 2MC4A 3LFUA 3VYSB 1BR1A 3FBIB 3OYIA 3CP2A 2E5ZA 2ELJA 2V7FA 3VYRB 3W2VA 2WA0A 1LFPA 4R79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG0 A;  2DT6 A;  1X4P A;  2E5Z A;  4DGW B;  2DT7 B;  2E60 A;  1X4O A; 
#chains in the Genus database with same CATH topology
 4XLH A;  2VKH A;  5K1Y A;  4KIC A;  4A0Y A;  2HVS A;  2K3F A;  3DTE A;  3MZ8 A;  2M0M A;  3M9A A;  3RZD J;  2KIU A;  2XF7 A;  3VOE A;  2ECB A;  5HLT A;  1IO2 A;  1X1D A;  2H1K A;  2XAG A;  1YHQ I;  2DYS H;  1IDZ A;  4BJ6 C;  3WGG A;  3KYC B;  2HYG D;  3B6A A;  2HI3 A;  3BJO A;  3Q0V A;  2ZME A;  2M0C A;  2NVQ J;  5M5W J;  4Y4R A;  1ZRC A;  3HB9 A;  3BZ6 A;  2KDZ A;  3ROU A;  5DD8 A;  3HUG B;  4UVC A;  3E3V A;  4MTE A;  4EGZ A;  2R7X A;  1N77 A;  1VQO I;  4JK1 X;  1RR8 C;  1BJA A;  1U9O A;  5FKM A;  4G12 A;  4HX8 A;  3CDI A;  3FHN A;  4L5E A;  2BW3 A;  3ZN0 A;  2HFH A;  4HEA 2;  4GO1 A;  3RPQ A;  2ETH A;  1YS7 A;  5CQG A;  5D8L B;  1FJL A;  1E2X A;  4F3Q A;  2BY0 A;  4PJJ A;  4IRG A;  4E7Z A;  3H5N A;  5D6F A;  5KVR A;  1GVJ A;  1LE8 B;  2XC7 A;  4XLF A;  4B48 A;  2R7O A;  3QPL A;  5FKK A;  4A3I J;  3I53 A;  2DMP A;  1HSJ A;  4MLO A;  3GTO J;  1A35 A;  2EFW A;  1P4W A;  1MBE A;  1R7J A;  3JRF A;  4I0A A;  3BQY A;  2JJ7 A;  2DDB A;  3A2K A;  1YOV B;  2DN0 A;  3QWL A;  4BAY A;  3CCQ I;  4M9S A;  5F64 A;  1XMK A;  2DJI A;  1D1B A;  2LRD A;  2GAU A;  5EG0 B;  4HG2 A;  4DQ2 A;  2JA7 J;  2M5W A;  3W2W A;  3H35 A;  3G3Z A;  1LEA A;  1MH4 A;  1S8N A;  3PNY A;  3BCB A;  3AAF A;  2EV0 A;  4FCY A;  2QZ8 A;  2AXL A;  2O6G E;  3TP3 A;  3VSL A;  1A5J A;  1BR4 A;  3P9I A;  5EF6 A;  1L3L A;  4A3F J;  1OCC H;  5C4X J;  3ZMV A;  3H36 A;  4Z6Y A;  2DU9 A;  2OF7 A;  3P7N A;  4M3F A;  1WSU A;  1QZE A;  3WE3 A;  1VQL I;  3EYY A;  1DGW Y;  2NS8 A;  5J1U A;  2Z1D A;  2XAF A;  3KFW X;  5ICF A;  3G1M A;  3FK6 A;  3D5L A;  2M8E A;  2LBF B;  3FM3 A;  2EIM H;  1FP2 A;  3WOD F;  2CGP A;  3ERE D;  4EGY A;  3OYA A;  3R61 A;  3A1Y A;  4I76 A;  1D0X A;  1U9N A;  1SMT A;  2W82 A;  1STZ A;  1IRX A;  1TZL A;  2ME0 A;  4UB6 C;  1JUS A;  3OWT A;  3ZQF A;  1JKQ C;  5L3G A;  1XCB A;  3V7R A;  4G9Y A;  1ZGJ A;  2XGC A;  1TWC J;  3BZC A;  5CPR B;  1FIA A;  2XSD C;  5GPA A;  4D7N A;  4D1Q A;  2BYV E;  2ISZ A;  3KZY A;  5FJ8 J;  3CCM I;  4LB5 A;  1SC7 A;  3QPT A;  4I09 A;  3JTH A;  3LOC A;  2EFN A;  4II2 A;  5E18 F;  1OPC A;  1LVA A;  2QEX I;  4UB8 C;  3AG2 H;  2RN7 A;  3S1M J;  2GWR A;  3I4M J;  3ZMT A;  1WJB A;  2HZD A;  1YE9 A;  2DT6 A;  2DMQ A;  5JR3 A;  2CQ7 A;  3PUF A;  2DQR A;  4ZZL A;  1G4D A;  1E0E A;  3S14 J;  1UZC A;  1HKS A;  2K85 A;  5EEH A;  1SEU A;  4NC6 A;  1IXC A;  1F1Z A;  1MBK A;  1Z7L A;  2ZFW A;  3M1C A;  3WU1 B;  2L0K A;  3S1R J;  1FTT A;  4BDY A;  1KU2 A;  3HPG A;  3GME A;  1K79 A;  2GIZ A;  2WB1 A;  4CCJ A;  3ECH A;  2Y9Y A;  3B73 A;  2IRF G;  3CLQ A;  4LLN A;  5C3E J;  2IAI A;  1G2H A;  4HSR A;  3PUB A;  5M3M J;  3OMY A;  4NDL A;  1UHS A;  4DBR A;  1CF7 A;  2ZJQ F;  4M9X A;  3GO5 A;  1G3T A;  3QPH A;  4M3B A;  4Q48 A;  1SVL A;  1GLN A;  2OTL I;  5DYM A;  3BR0 A;  3K1P A;  4M9Z A;  4YG2 F;  1ZYR F;  4DW6 A;  4A12 A;  2BXY A;  4AD9 A;  4JX6 A;  4F91 B;  5ICG A;  1OMI A;  2L01 A;  4ABZ A;  1HKT A;  1YFH A;  1AOY A;  1R1T A;  1ULY A;  1UST A;  2R7W A;  2P6T A;  2NRA C;  4HDV A;  3QQA A;  4NQW B;  1PJR A;  1RUN A;  2VI6 A;  4HNT A;  2FEZ A;  2YX4 A;  4KUM A;  4NUB A;  5FD5 A;  1WI9 A;  3L2W A;  5JHU A;  2ZSI B;  4CCN A;  3RQ4 A;  2EIL H;  3KE2 A;  5IT9 Z;  3T5X A;  3OOU A;  3DBH B;  1A6I A;  4R8H A;  3GFM A;  4QSH A;  3C7J A;  1OCT C;  2M30 A;  2K3P A;  3RCO A;  3CME I;  2P5L C;  1YYV A;  2PX9 A;  3F9K A;  2P4W A;  4L0Y B;  5GAE J;  2OAZ A;  2JRM A;  4HDU A;  5K5R A;  3EYI A;  3GTM J;  2R5Y B;  2L4M A;  1FBQ A;  2M7B A;  1Y39 A;  4P1W A;  2XB0 X;  1B8I B;  3VYU B;  5E3N A;  3IUO A;  1S6L A;  3M8E A;  1MMG A;  3BPX A;  2LKP A;  2X85 A;  4HZF A;  1GT0 C;  3RQI A;  1CQT A;  1X58 A;  5JFR A;  3LSJ A;  4KDP A;  3GWZ A;  2LC2 A;  1I3Q J;  2NNN A;  4ZJZ A;  1TQM A;  4UV8 A;  2Z33 A;  5D5W B;  2ZCW A;  3FXO A;  4BKX A;  3RKQ A;  1WRJ A;  2O9L A;  3OYG A;  3TQN A;  2O7O A;  4ITV A;  4CZC A;  2DK8 A;  5K5Q A;  3H3Z A;  2FJ1 A;  1EV7 A;  4UXN A;  1WJ5 A;  4UV9 A;  1RZ4 A;  4O5V A;  2KMU A;  3RKW A;  4BBS J;  3FMR A;  4NB5 A;  2H27 A;  4LG0 A;  3IV5 A;  1IRF A;  5IT3 A;  1ZRE A;  4CCO A;  4J19 A;  3SYT A;  4CIC A;  4Y7N J;  2V1N A;  3PJR A;  1RKT A;  4F55 A;  2JZY A;  3ZR8 X;  4E7I A;  3HZJ A;  1U78 A;  2BXZ A;  4BNC A;  4CA0 A;  4GRI A;  1O3T A;  2FD5 A;  2IS1 A;  3F21 A;  2ZFU A;  1WVR A;  2FX0 A;  3E1S A;  3GVA A;  4DIQ A;  5GAG J;  2DQL A;  4ZZD A;  2P0W A;  3LMM A;  1D3Y A;  2QVO A;  4XLA A;  4IXA A;  3OYM A;  5E1W A;  2NVX J;  1S7E A;  2HKO A;  4LLL A;  3AG1 H;  4XOR A;  4XBF A;  3OYK A;  3S3O A;  1QU3 A;  3CES A;  2EZI A;  2DLL A;  1HW5 A;  1UHW A;  5F0H A;  4DNC A;  2P7V B;  2R7T A;  4M3D A;  2JVG A;  4RS8 A;  2KPM A;  5HS7 A;  3REO A;  3B6C A;  2R5Z A;  2LF8 A;  5BPI A;  3SFI A;  5K7Z A;  1R49 A;  2KHM A;  1I1G A;  2A5W A;  5TGT A;  1IXR C;  5HLI A;  4CYD A;  4AC0 A;  3ML6 A;  4IHX A;  3I59 A;  3KP7 A;  1U8R A;  1K7A A;  4RAZ A;  2HYF A;  2VAS A;  1ZR4 A;  4ESB A;  3ZQ7 A;  1FSH A;  2WY8 Q;  4AWX B;  4C3I J;  1REP C;  5IY5 H;  2HQR A;  5M5X J;  4DGW B;  3RYR A;  2LY9 A;  3RKY A;  5DV5 A;  1HQC A;  5ILV A;  1Z91 A;  3JRB A;  4KJZ A;  5BQT A;  1LFB A;  5A2Q Z;  4RA2 A;  2OU2 A;  4OIP F;  5L3C A;  1FOY A;  2OCC H;  3HL2 A;  1PDN C;  2K40 A;  1OYI A;  4HST A;  4OMY A;  1OCR H;  1KA8 A;  2X6W A;  3B02 A;  3FXQ A;  4XID A;  4JX5 A;  3Q9S A;  2GXG A;  3RSN A;  2JUC A;  2V6C A;  3MAJ A;  1BOA A;  2R4G A;  3G73 A;  1R4N B;  3W2A A;  4C9Y A;  5J40 A;  1BI3 A;  3IKT A;  4X6A J;  3ABT A;  4D0P A;  3UR3 C;  4PJL A;  3BR3 A;  2IA0 A;  5DM7 F;  4BDZ A;  5KNL A;  3R0J A;  4Y17 A;  2P5K A;  3V8K A;  1IV6 A;  4P55 A;  1BW6 A;  3JRC A;  2L9N A;  3PNT A;  1D1A A;  2MC3 A;  3S3M A;  4OIO F;  2JSC A;  2O5R A;  4B09 A;  2F48 A;  1RIO H;  2TDX A;  3JSO A;  1ORK A;  1U3E M;  3OYH A;  2ZJP F;  4HV6 A;  1MMD A;  1JTY A;  4AU7 A;  2IA1 A;  3EUA A;  5H6R A;  1YJN I;  3O8G A;  2HQN A;  3AG3 H;  4BE1 A;  5J47 A;  2V6E A;  4KIS A;  2H09 A;  2DA4 A;  2ZXW H;  3TBI A;  1TWF J;  2KKO A;  1W0U A;  4EM0 B;  2E35 A;  3LNQ A;  2DFI A;  1WJD A;  2VLA A;  2OPT A;  2F5D A;  3X2Q H;  3PM1 A;  3ABM H;  2O03 A;  4Y13 A;  1T98 A;  4AID A;  4JP0 A;  3F8M A;  3V7S A;  3RI4 A;  1WQ2 A;  1MMA A;  2DA5 A;  5HS8 A;  2CH0 A;  4HPQ A;  4MHG A;  4U87 A;  4G6D A;  4KN7 X;  3DKX A;  2HQ5 A;  4L9N A;  4BGD A;  1ETW A;  5CVU A;  3VYT B;  2BOL A;  3QOD A;  3L2Q A;  1LDJ A;  1U2W A;  1FPQ A;  2MW8 A;  2QKL B;  2VIX A;  3IRR A;  4A3L J;  2XVC A;  3HBL A;  5K5O A;  4UUV A;  3ZQG A;  5DS9 A;  3OYD A;  2DOA A;  5HOO A;  1Q1H A;  1R4M B;  3SQN A;  4ZDO A;  5HOD A;  5HLH A;  2EBI A;  2E2I J;  1MDM B;  2EV5 A;  1OCZ H;  2JK3 A;  1SD5 A;  2HWV A;  1VQ6 I;  2D45 A;  3F3X A;  1FX7 A;  1E17 A;  1JT6 A;  1R36 A;  3LFU A;  2VOP A;  3I56 I;  2K27 A;  1FOW A;  3S16 J;  3W2V A;  5EZH A;  3R6S A;  1U5T A;  3GCM A;  1ZLJ A;  3K1M A;  1H89 C;  3Q0U A;  4DBQ A;  4XSX F;  4CCM A;  1OIS A;  1T0F A;  4G6T B;  3DLL F;  2BEO A;  3G4S I;  4BY1 J;  1SD7 A;  2WV1 A;  2RDP A;  2CO5 A;  1AWC A;  2JA2 A;  2OQG A;  3TMO A;  3S15 J;  1T33 A;  2FBI A;  5TJJ A;  3ASN H;  2KP6 A;  2DMT A;  3LSP A;  1F36 A;  1RRJ A;  5K7F A;  2QBY A;  1Z9C A;  5FKN A;  3I54 A;  3SEZ A;  5L3B A;  3DP7 A;  4LMY A;  3C2G A;  4OIQ F;  3W6V A;  1V5F A;  4K2E A;  5CJ9 A;  2RQP A;  5CQE A;  1LDK B;  3OIQ A;  4IHS A;  4H0E A;  5H6Q A;  1HXD A;  4KIT B;  1ZAR A;  2VT2 A;  1EJ9 A;  1USS A;  1WGX A;  1HBX G;  2UWM A;  3BR6 A;  4UUS B;  2A05 A;  5ICC A;  2DMN A;  5J1R A;  3J7Y J;  2CRG A;  2M3A A;  2L9S A;  2C6Y A;  2A5Y B;  3DEE A;  4CDG A;  3A02 A;  3EET A;  4PJN A;  1NG7 A;  4TV7 A;  2XSJ C;  4R1H A;  3E5Q A;  1XDS A;  1Y1W J;  1FLI A;  1ERD A;  3CF5 F;  3ZQL A;  2W25 A;  2OTJ I;  1BC7 C;  1ZG3 A;  2M7A A;  3BG6 A;  4ZH4 F;  3BTL A;  4G7O F;  4IEJ A;  1Z67 A;  2UXX A;  1JHH A;  2AQF A;  4B3X A;  3KP5 A;  1LFU P;  4JQF A;  2VBX A;  1R00 A;  2AQE A;  4LG3 A;  3CTA A;  2K86 A;  4XSZ F;  5LGT A;  2R7R A;  1KYW A;  2CQN A;  4NC7 A;  1I1S A;  5JLX A;  1W36 C;  2E1M B;  4FT8 A;  3G2B A;  3SJM A;  3LSG A;  3LSI A;  1T8I A;  2CUJ A;  4YIR X;  3FXL A;  1R1U A;  2FOK A;  3KEY A;  3KZI C;  3GZN B;  1L0O C;  1XGS A;  1W36 D;  2WAQ A;  4V19 K;  4BUP A;  3GLL A;  3DLA A;  5L3D A;  1G3Y A;  1UAA A;  3WTZ A;  3S32 A;  1PUF A;  4EJT A;  3OYN A;  4U7B A;  1R9T J;  1E3H A;  2LKS A;  5GAD J;  2STW A;  2PEX A;  2HZT A;  3TO7 A;  2A61 A;  3ABK H;  2VQH A;  1Y8R B;  2Z9O A;  5E1X A;  1B72 A;  1OCO H;  3C3W A;  3NEU A;  1LJ9 A;  4MFE A;  1LPQ A;  1K78 A;  2G7U A;  3KEO A;  3IH4 A;  3GTG J;  3H5A A;  3PNV A;  4J01 A;  1VQN I;  1WHU A;  4BHC A;  2HVR A;  4CGZ A;  1UEL B;  3KP2 A;  1T6S A;  2X51 A;  2XGE A;  4CXF A;  2DT5 A;  3BY6 A;  3NRV A;  4CSW A;  1R5H A;  2EV6 A;  5DCM B;  3KPH A;  4RLQ A;  3G71 I;  1J2X A;  4C2U A;  1MJB A;  1RPW A;  3V7C A;  4XIC A;  3U1K A;  1XGM A;  4XOP A;  3HGY A;  3CMA I;  5E3M A;  5FRN A;  2MG4 A;  4ZYD A;  2DT7 B;  3NQO A;  2M4G A;  1UJ8 A;  3CDH A;  3H0G J;  2DTR A;  2OCE A;  3F22 A;  3TDZ C;  3CCL I;  4M73 A;  4BY7 J;  4MEY F;  2Z3Y A;  1UMQ A;  2V1D A;  5BNG A;  5BPD A;  3CDL A;  3MCZ A;  2Q2E A;  3TOA A;  2E7X A;  2FRH A;  1RUO A;  1WKM A;  1IW7 F;  2HTJ A;  2XIG A;  1OKR A;  5TRD A;  1IAW A;  2OQR A;  2QM3 A;  3RJP A;  4I6Z A;  3HC7 A;  4V2F A;  3CQZ J;  3A03 A;  3JAM Z;  5B5E C;  1K6Y A;  2FMY A;  2PJR A;  2Y2Z A;  1J0R A;  3KIO A;  3P9C A;  3ASO H;  4GCV A;  3ZGK A;  3DXJ F;  4EMS A;  1MBF A;  4ESF A;  1Z21 A;  3CJN A;  3M1E A;  2VON A;  2GZW A;  4HF0 A;  5CVJ A;  1KU7 A;  1QQI A;  2NVU B;  3SZT A;  1ZAO A;  2ZME C;  3DV8 A;  1KGS A;  2QQA A;  3HOY J;  3HJE A;  3ONQ A;  4E7S A;  2B63 J;  2CS3 A;  1WPK A;  1Z77 A;  4NHJ A;  2KRC A;  2DFE A;  4BEH B;  2CQK A;  1GXQ A;  4P9U A;  1ZK8 A;  2VQG A;  3O6B B;  4N4N B;  1VQK I;  3JRE A;  2L4A A;  5D8K B;  1R5I D;  3DU5 A;  3OV8 A;  2LDU A;  1W5T A;  3CUQ A;  5HDN A;  3DBL B;  3DEU A;  2MSY A;  1TLH B;  3BTJ A;  3DBR B;  5IYC J;  5FRM A;  1JTX A;  3MEX A;  5F08 A;  2IGK A;  3K4J A;  5J4Y A;  3LFK A;  2AS5 F;  3V8L A;  3OYJ A;  4ON0 A;  4U88 A;  5C4J J;  2PMZ N;  1A04 A;  2HTS A;  3A0H C;  3HXL A;  4C3H J;  2NS0 A;  1KU9 A;  1Y8Q B;  1IN7 A;  5B1A H;  2XGX A;  2QWW A;  3WGH A;  1O4X A;  2CQQ A;  5BS6 A;  3LST A;  1D5V A;  4HQM A;  2K4J A;  2R3S A;  1WFX A;  1OJL A;  1WWX A;  1JGG A;  4BQN A;  5EZG A;  2LVS A;  1ZR2 A;  2KFD A;  3QAH A;  1UB9 A;  1X1B A;  3NWT A;  1P7I A;  5GP9 A;  2ID6 A;  1FWZ A;  3VDX A;  1B9N A;  3DPU A;  4IL6 C;  3S2H J;  1D1C A;  3IRQ A;  1H88 C;  3DCF A;  4UUT A;  3LWF A;  2L02 A;  3ESW B;  1MMN A;  2FNA A;  4BJT A;  5F6F A;  4A5M A;  2HXO A;  5JHF A;  1ON2 A;  1FY7 A;  4HX7 A;  4AM3 A;  4WXC A;  4KA4 A;  2ZNY A;  1JT0 A;  3QP5 A;  2QCO A;  3LSR A;  5EJC A;  3SZP A;  1GXP A;  3U1D A;  2LY1 A;  1DP7 P;  2EZH A;  1RI7 A;  2COM A;  4OIN F;  3SZG A;  5J1Y A;  3PSI A;  2EK5 A;  5D5X B;  3OY9 A;  2IP2 A;  1D0Y A;  1FP1 D;  2XPV A;  3C18 A;  3J80 Z;  4YFN F;  3K4M A;  3L2R A;  4G94 A;  2BBY A;  2X48 A;  5F1J A;  4A3D J;  2J5O A;  2JMW A;  2OUM A;  1FOX A;  1XSV A;  3E6B A;  1KU3 A;  2R92 J;  3F0C A;  1SD4 A;  3CCE I;  2KZG A;  5H20 A;  1SMY F;  1Y0U A;  3J7Z I;  3LSM A;  4XN0 A;  4EM2 A;  1YQA A;  3GXO A;  2ZC2 A;  2GIV A;  4F93 B;  1SFK A;  3RIR A;  3ZP5 A;  2UXN A;  2CV1 A;  1TWA J;  2XUB A;  2DA1 A;  1R71 A;  3DQV C;  1WJA A;  2W00 A;  1TBX A;  4PFO A;  1VQP I;  3I5U A;  1R22 A;  1T08 B;  3NWS A;  1VND A;  2DJN A;  2K9Q A;  4LK0 F;  2ZJR F;  4ENM A;  3I4P A;  2KIM A;  2JSP A;  1O3R A;  4S05 A;  2DFH A;  2W57 A;  4CCL A;  1VI0 A;  1LEB A;  1IDY A;  1HOM A;  1CGP A;  1IN8 A;  4FTH A;  2IXS A;  3JW4 A;  4EJW A;  2CFX A;  2DDA A;  1UG2 A;  2DCE A;  1I50 J;  3G1O A;  4XKV A;  3C2H A;  2V26 A;  3H3U A;  2EFP A;  3FXM A;  1K61 A;  3D5S C;  4O3M A;  4QPO A;  3F6V A;  2YX7 A;  4EM1 A;  1XDU A;  6PAX A;  3TO9 A;  4B8X A;  2PMU A;  1VF9 A;  4MIM A;  4AYB A;  4U7D A;  4A3J J;  1DDN A;  2CV0 A;  3WTS C;  3LA3 A;  1MSF C;  3KET A;  2EFO A;  4W97 A;  2VPR A;  2XAH A;  1Z0X A;  1U6G A;  2KT0 A;  4RGU A;  3SFZ A;  2M1B A;  3FZV A;  4IHV A;  2DA6 A;  2FOW A;  3ULQ B;  1YTY A;  1F4K A;  1DPU A;  1ODD A;  5DDG A;  1S7A A;  2XRN A;  3BP8 A;  2ZSH B;  2ZME B;  1Z05 A;  2BE5 F;  5IOZ A;  1J7K A;  1ZGW A;  3ZQQ A;  2KLO A;  2G9W A;  2QF7 A;  3K6G A;  3JRD A;  1VQM I;  3ZPL A;  1EH6 A;  1NH3 A;  1KQ0 A;  1KYZ A;  3HRT A;  4XK4 A;  2Y0S A;  4BXX J;  5M3F J;  3OR2 C;  1FOK A;  1OYY A;  1XGO A;  4XON A;  1AA7 A;  1Q1V A;  3DKY A;  4BH9 A;  4IO9 F;  1DUX C;  1XB4 A;  3PO2 J;  3CCJ I;  2R7Q A;  3HOV J;  1BA5 A;  1R58 A;  1V55 H;  4II3 A;  1ETO A;  3DTK A;  2E1O A;  2YU3 A;  2HYJ A;  1LQ1 A;  5FLX K;  2H8R A;  1G3S A;  2HQA A;  2KJB A;  1MBG A;  2VB6 A;  2WV0 A;  1Y0N A;  2XKO A;  3A4C A;  1ZG1 A;  2CW0 F;  2BW3 B;  3KLN A;  5E1Z B;  2VKE A;  3HRU A;  3HRM A;  5IPA A;  3CCS I;  5KK1 A;  1AKH A;  1ZG5 A;  1SAX A;  1JKO C;  4A6D A;  1TQI A;  1I39 A;  2IPQ X;  3EUH A;  4KT5 C;  4LOC A;  1JXS A;  4WX9 A;  2D1V A;  1G6N A;  2IS6 A;  2RC4 A;  4B47 A;  5LD2 C;  1X4P A;  2FNP A;  3OSG A;  1Z6R A;  3CJR B;  3HOX J;  5IP9 J;  1TQP A;  3TO6 A;  4C3J J;  2EIK H;  1PP8 F;  2BVM A;  2EA2 A;  1WCM J;  2R7V A;  4HF2 A;  1B9M A;  1QGP A;  3PL8 A;  5CVR A;  1TNT A;  3DEW A;  5GTH C;  2WAF A;  4Y15 A;  1FMV A;  1QZZ A;  4RAF A;  1XTA A;  3GTQ J;  5F27 A;  2JVH A;  2Y9Z A;  5HDK A;  2E1C A;  4M74 A;  4OMZ A;  1ZH5 A;  2V9V A;  3K9T A;  3M8F A;  4FET A;  1X3W B;  1BBY A;  4KMU X;  3U21 A;  2LH9 A;  5J8C A;  1PP7 U;  3M8J A;  1G8X A;  1RC9 A;  3F23 A;  3S1Q J;  5AIQ A;  4QLC U;  5IP6 A;  1BIA A;  2DK5 A;  2DO7 A;  4AUX A;  2NNY A;  5IYD J;  1MNE A;  4OAZ A;  3TDU C;  3J81 Z;  4E7H A;  4BXF A;  2VJI A;  1JJ8 C;  1IXS B;  2K9N A;  3V8J A;  2WB1 N;  2MC4 A;  3FIW A;  3WTV C;  5DCF A;  2MH2 A;  4RBO A;  1GUU A;  3FBI B;  3OYI A;  1VQ8 I;  2E5Z A;  2ELJ A;  2V7F A;  3VYR B;  1YJ9 I;  3ECO A;  3TKY A;  4IOC F;  1WH7 A;  2WA0 A;  5IP7 J;  5BMZ A;  1W5C C;  2FML A;  1ETY A;  4DZP A;  3W6J B;  1BW5 A;  5KAI C;  1YO5 C;  1FTZ A;  5HVQ C;  4ANJ A;  2WTE A;  3P9K A;  4XRM A;  3BJA A;  3FWE A;  4M71 A;  4PK4 A;  5LFA A;  4KNY A;  2LFB A;  1HDD C;  2HOE A;  1SVM A;  2HDW A;  3HEF A;  1A6Q A;  3AG4 H;  4A5N A;  4A6E A;  3HDD A;  3TOB A;  3RPU A;  4CCK A;  1OR7 A;  4ESJ A;  2OZU A;  1MNM C;  2GOM A;  2UUZ A;  3K4B A;  4WCG A;  1EF4 A;  3R0A A;  2R7S A;  1MH3 A;  3DPT A;  2ZNZ A;  2HOA A;  5KCM A;  4I7H A;  3UNG C;  4XNF A;  5D5V B;  2EQR A;  2G0E A;  4B3A A;  2OJE D;  4E70 A;  3CZ6 A;  4XQF A;  2F5V A;  3WE2 A;  1MMS A;  3BPV A;  3AKZ A;  2L5Q A;  5FLM J;  3LQQ A;  4MEX F;  5F1R A;  2M4K A;  3FXJ A;  4HOB A;  3GZ5 A;  1EH7 A;  5L3F A;  3ZQH A;  4IHW A;  4U0W A;  4IF4 A;  3BLY A;  3ZMU A;  3PO3 J;  1HF0 A;  4L9T A;  1KON A;  3H0D A;  3I64 A;  3WU0 A;  3FKJ A;  3U9G A;  1BOB A;  2ACJ A;  2BY2 A;  3BR2 A;  1W7P A;  4A2U A;  4XLP F;  2NS7 A;  1CF7 B;  2W85 A;  2VL8 A;  4A3B J;  1ENH A;  2PG4 A;  4D5F A;  2RKH A;  4HNV A;  1N75 A;  5H2F C;  3LAP A;  5EGO A;  5F0F A;  2XHK A;  2Z5U A;  1F43 A;  4XM3 A;  2O61 A;  1FIP A;  4HLX A;  2ELH A;  3VB2 A;  5EDN A;  3NAR A;  4RMN A;  3OYE A;  1XS9 A;  5FRO A;  4Y33 A;  2LYC A;  1Z3X A;  2A6H F;  5FB2 A;  1NK2 P;  2YPR A;  3K4L A;  4B44 A;  2M87 A;  2X1E A;  1FNN A;  3DF8 A;  1V5E A;  4P5O A;  1PYV A;  1IGN A;  2HNH A;  2WC2 A;  4M6Y A;  2BY1 A;  3M3Y J;  5E20 A;  1W1W E;  4CH7 A;  3K7A J;  3QOE A;  3ABL H;  2VUM J;  3PQK A;  5CVV A;  3GTL J;  1IG7 A;  3MD2 A;  4IOA F;  1ZEL A;  4FQG A;  3H3V K;  1H9G A;  5J8F A;  1P92 A;  1IUF A;  3IH3 A;  1XN7 A;  2XAQ A;  1MIJ A;  4BHB A;  3BCA A;  4DYR A;  2VJJ A;  1O57 A;  1P7J A;  2XF5 A;  3ZXS A;  2JQ7 A;  2MGQ A;  2DTZ A;  4XLE A;  4HNU A;  2WBM A;  4PUS A;  1XPX A;  2ECC A;  3EDP A;  4RB2 C;  1ZTR A;  1YX3 A;  1QVU A;  1TT0 A;  3L09 A;  3BWG A;  3DTI A;  3D5R C;  3FIS A;  5DUI A;  3H9G A;  1SFX A;  2UZK A;  1SFO J;  4P9F A;  4PZJ A;  4ETS A;  1YRN A;  4IQJ A;  1U8B A;  2XPW A;  2VBZ A;  3KP6 A;  1EKE A;  4GYG A;  5E8G A;  3OS0 A;  3F8N A;  5HDG A;  3C1D A;  1QPI A;  2KJC A;  2MD5 A;  1W5S A;  3H9J A;  2VJ5 A;  5DM6 F;  3CO6 C;  1RNL A;  1NK3 P;  1IRG A;  2VOO A;  1YG2 A;  4GYI A;  4WK8 F;  1VQ9 I;  2NVY J;  2R7D A;  4L0Z B;  4EV0 A;  4JYK A;  4CO8 A;  2Y30 A;  3HHG A;  1ZHF A;  3R4K A;  1QVT A;  3LA2 A;  3F8F A;  3PQJ A;  3WG9 A;  2HOT A;  4LG0 B;  2HS5 A;  2X4H A;  3H1C A;  1U5T C;  3KX2 A;  4ZC3 A;  3RYP A;  5IT9 K;  5LRR A;  3U2R A;  3HUG A;  4XKC A;  5LGN A;  1J09 A;  1X3U A;  1TL8 A;  2VXZ A;  1T0F C;  4KT6 A;  4U0V A;  4ZYA A;  3CC4 I;  2HR3 A;  3A0B C;  2QSF X;  1OCP A;  1OFC X;  3E6C C;  4WF2 A;  1TTY A;  2BHY A;  5CKT A;  1S3J A;  4E6K G;  2MH9 A;  4BQQ A;  3W3C A;  3BJ6 A;  2ZKZ A;  1QHH D;  2D2W A;  2KL4 A;  2W84 A;  4EAT A;  4OU0 A;  2V9K A;  3LSK A;  5M5Y J;  2YR2 A;  3IL2 A;  1LE8 A;  3HOS A;  1NTC A;  2CQX A;  4E4H A;  4A3K J;  5LGU A;  1JE8 A;  1QNT A;  3IC7 A;  4KIB A;  2ME6 A;  3H92 A;  4M3G A;  3EQL F;  5IOY A;  3MKW B;  2FQ3 A;  4EJV A;  3FMQ A;  4LIV A;  3F8C A;  3HTU A;  5FFX A;  1SD6 A;  1A31 A;  1GV5 A;  4L18 B;  5E8I A;  4I98 B;  2OZ6 A;  4YRV A;  2QEN A;  3PSF A;  4BL0 B;  2R5Z B;  2HU9 A;  5EG0 A;  4GDF A;  3OYL A;  1DQU A;  2EB7 A;  4P96 A;  2QGU A;  4EQQ A;  1BI2 A;  2XB5 A;  3DFG A;  2VQL A;  2ID3 A;  2LTP A;  3I59 B;  1V3F A;  2PMH A;  1HW2 A;  2DI3 A;  5DD4 A;  5ILS A;  4BYY A;  4RB1 A;  2JA5 J;  3T1B A;  2X0L A;  3PFI A;  2QSH X;  1B4A A;  1D8K A;  3N05 A;  2Y31 A;  2IEK A;  5BOX A;  2F2E A;  4E7K A;  2FBK A;  4HRI A;  2VBY A;  3BDD A;  3HPH A;  3WTX C;  1ETK A;  4YEJ A;  5J4V A;  4BQA A;  2Q0O A;  3CD6 I;  3MVP A;  3JCU C;  2DYR H;  4F92 B;  3LAJ A;  1X1C A;  1YIJ I;  5B66 C;  1Z1D A;  2F5E A;  2VJ4 A;  5EYR A;  2H94 A;  1X4O A;  2K7L A;  3V4G A;  3FKI J;  2DFF A;  1NG6 A;  1O7L A;  3QU3 A;  1IC8 A;  1ZGA A;  2JPB A;  3HSF A;  3LQR A;  4FHT A;  2LBF A;  3CJQ B;  2CW8 A;  1QHG A;  4M3E A;  3GBG A;  4XR6 A;  3JRA A;  2HXI A;  2XAS A;  1YIO A;  4IZZ A;  1HLV A;  3A01 A;  1BI0 A;  3O2P E;  1P6R A;  3BG3 A;  1Y1V J;  4HA8 A;  3WTU C;  3L1P A;  4BBR J;  4NNJ A;  4PFP A;  1JJ6 C;  3FXR A;  5HNF A;  3CMM A;  4LFU A;  2QYO A;  3IH2 A;  4L5J A;  2BV6 A;  2IGM A;  2RGV A;  4N9H A;  1JKR C;  3L7W A;  3KEQ A;  1JUP A;  4PGH A;  4HAM A;  1KQ9 A;  5JLW A;  2WAE A;  3NAU A;  2P7C B;  2CMP A;  1IZ1 A;  1B6A A;  3CJT B;  3K70 C;  2I8D A;  2LD5 A;  2ESN A;  3JRH A;  1Y56 A;  2CSO A;  2ZBK A;  2BHZ A;  1H9T A;  2BY3 A;  4IHT A;  4IHY A;  3QYB A;  2A6T A;  3QU6 A;  3BTI A;  3PIP F;  1K83 J;  2K9L A;  4LIU A;  3F72 A;  2E7W A;  1FBS A;  2D1H A;  2DAO A;  5A2Q K;  1QZY A;  1P4X A;  3K1N A;  2X1C A;  3CCV I;  1VTN C;  3SXY A;  1S72 I;  2GXA A;  2EPF A;  3OS2 A;  2ICW G;  3ERM A;  3K70 D;  4A69 C;  1SFU A;  2JUG A;  3HIF A;  2R7U A;  3S1N J;  4PSW A;  2BGC A;  3IAS 2;  3GYH X;  1B1B A;  3KP4 A;  3BR5 A;  3BTC A;  4B1R A;  2JTV A;  3CCR I;  1FYL A;  1I3A A;  2ZXH A;  2YS9 A;  4PJM A;  5DUK A;  1H0M A;  2LK2 A;  2O0Y A;  4RM3 A;  2X6X A;  5IYB J;  2RNG A;  1J5Y A;  2CWE A;  1ETQ A;  4DJA A;  3R60 A;  1P9Q C;  2IGN A;  3VOD A;  3GZ6 A;  2GM4 A;  4XLC A;  1Z7U A;  2X6Y A;  3JTG A;  3F8B A;  5HLG A;  3LA7 A;  2RV8 A;  1W0T A;  2M8G X;  4D7M A;  4M6X A;  2V1U A;  1IV8 A;  3WTT C;  5C44 J;  3E5U A;  2Z2S B;  3QPS A;  4IQ4 A;  3L2C A;  3I0T A;  4LIT A;  5ERI A;  2LOO A;  1MBJ A;  1YW7 A;  1U5T B;  2FF4 A;  4KIG A;  4YII A;  4F7Z A;  3MWM A;  1O7F A;  1BJZ A;  1MGT A;  1VZ0 A;  4HLY A;  2B7E A;  2L7M P;  4NQW A;  2NOG A;  4CYC A;  1VQ5 I;  3L2V A;  1E3P A;  1XMX A;  4QIW N;  1U0J A;  2RVC A;  3OR1 C;  2MD0 A;  1R23 A;  1TNS A;  3Q3S A;  1HDP A;  2IW5 A;  3AL0 C;  1TT5 B;  2QBY B;  3IWZ A;  2YUS A;  4DZJ A;  3TGN A;  4I01 A;  2QKM B;  2QQB A;  2QSG X;  2RNJ A;  4HF1 A;  4UY8 I;  2DMU A;  3CUQ C;  2E2H J;  1ACI A;  1I6X A;  2M9H A;  5HNH A;  3GF2 A;  2R5Y A;  4C2M J;  3CUO A;  2MYS A;  1YJW I;  2WAQ N;  5E17 F;  2AHQ A;  1T38 A;  3ZN1 A;  1B8I A;  4OAY A;  3GTK J;  2EA4 A;  4I0B A;  1ETX A;  1FMW A;  3I9V 2;  3DWL E;  2DBB A;  1IN4 A;  4QPQ A;  3SEQ A;  1JHF A;  3WG7 H;  3CCU I;  3J7A Y;  2CG4 A;  4AVP A;  5B3S H;  1MND A;  1YI2 I;  4WXH A;  4RB3 C;  2XAJ A;  1JGS A;  4U0Y A;  4BE0 A;  1V5G A;  1HST A;  2RQQ A;  1YS6 A;  3EPZ A;  1LKX A;  4I02 A;  3FHZ A;  2IBD A;  3OL4 A;  5B1B H;  2TRT A;  5HS9 A;  3RKX A;  2LP0 A;  1LUJ B;  2UV1 A;  1MJ9 A;  9ANT A;  3FMS A;  2XF6 A;  2EFQ A;  5AIP A;  1T2K A;  1FBU A;  3MKZ A;  4MTD A;  3FK7 A;  1J9I A;  2G7H A;  2OA4 A;  3DPL C;  3Q9V A;  4C2T A;  2EZL A;  1K6O A;  3SDG A;  1R5G A;  1SAU A;  2EIN H;  2MA3 A;  1UFM A;  2ZXI A;  2MAB A;  3O8H A;  5ICE A;  2VT3 A;  3TW6 A;  4UVB A;  2H6B A;  3K2Z A;  3ZRG A;  2R93 J;  1S5L C;  2XPU A;  1PUF B;  1ZRF A;  1TP4 A;  2HDC A;  1XC5 A;  2HOS A;  2CFO A;  2NXN B;  3HSE A;  3HGG A;  1OQY A;  2DXI A;  3SHF A;  3A01 B;  3MQ0 A;  1B72 B;  3TW7 A;  2FA5 A;  2B9S A;  4BE2 A;  1K78 B;  3P5J A;  2WWY A;  3CP8 A;  1LDD A;  1ETV A;  1FSE A;  2FU4 A;  1HC8 A;  2A3S A;  1TWG J;  1ZRD A;  2E19 A;  4BQO A;  1G3W A;  5K7H A;  4LD5 A;  3ZMD A;  2K9S A;  4GXO A;  1RES A;  1BR1 A;  2R0Q C;  2E2J J;  4I99 C;  3HYI A;  3M7G A;  3MZY A;  4IJA A;  3CC7 I;  1LFP A;  4R79 A;  3GTP J;  1JUM A;  4PSX A;  2VPL A;  1IN6 A;  1X2M A;  3MKL A;  3QOP A;  4KFC A;  3HHH A;  3MN2 A;  4X1E A;  2DOD A;  3ZMZ A;  1BC8 C;  2PQ8 A;  4XKB A;  4IKF A;  1RR7 A;  3DU6 A;  2EH3 A;  4Q4Z F;  2J5P A;  2E71 A;  1YX5 A;  1I6H J;  4JBA A;  2Y75 A;  1V54 H;  2L7Z A;  2R7F A;  2F6C A;  1RKW A;  2E36 A;  4S04 A;  4L9J A;  5FFZ A;  2D5V A;  4ZYH A;  2H1L A;  3K2A A;  2Q2E B;  1EH8 A;  2FE3 A;  3F6O A;  4XRF A;  3ZCO A;  5D4S A;  2VC1 A;  1O3S A;  1UCR A;  2COB A;  3FXK A;  4WXD A;  3T8R A;  3E6D A;  3LSH A;  4ZYE A;  4EJU A;  1IUY A;  4M6V A;  2GA1 A;  1XSX A;  3E7L A;  1K4S A;  4IRI A;  4ENJ A;  1ONV A;  4NC8 A;  3CCY A;  1XG1 A;  1D5Y A;  5ILU A;  4FX0 A;  4HW0 A;  4HV5 A;  2PJR B;  5CYV A;  3GTJ J;  2KZV A;  1IN5 A;  4AIJ A;  4B43 A;  4BHP A;  2F5F A;  2L7K A;  3M4O J;  2Q8K A;  2K9M A;  4PCQ A;  4XMY A;  3VWB A;  5FO5 A;  4RAY A;  2PN6 A;  2W7N A;  2KQR A;  5E3L A;  4IX7 A;  3BOQ A;  1UHM A;  4JOM A;  1ZKG A;  4LLG F;  4IRH A;  2OC6 A;  1IF1 A;  3AL0 B;  3S8P A;  1MZB A;  3H9Q A;  1T56 A;  4CYC B;  1N25 A;  1VQ7 I;  3K69 A;  2NYX A;  3ABU A;  2KRF A;  2MLG A;  5FKL A;  3CUQ B;  4F52 A;  3HRS A;  4YFX F;  2GBY A;  4N4O B;  4FE7 A;  2KDO A;  4RGR A;  4XL9 A;  3HTS B;  2PJP A;  2VE8 A;  4EEF G;  4RAG A;  2HPI A;  2R7Z J;  3D1N I;  4Z2Y A;  1BM9 A;  2VXD A;  3VPR A;  2CJJ A;  2CUE A;  3EUH C;  3MZH A;  3JAM K;  3C2B A;  2VKD A;  2ZJ2 A;  1FYK A;  2DW4 A;  4PJ0 C;  2B0L A;  1S9H A;  2DA7 A;  2Z16 A;  5CLS A;  1FT9 A;  1DU0 A;  4RGS A;  4A3M J;  3N97 A;  3RZO J;  1HA8 A;  4I2O A;  4AVZ A;  4DOZ A;  1MDM A;  2LY2 A;  4ZTF A;  2L54 A;  3Q5F A;  5F04 A;  1OYW A;  2KRH A;  3UKG A;  4D9J A;  4WWC A;  4UHT A;  5D6E A;  2XRL A;  3LL7 A;  2CW7 A;  2CUZ A;  1ON1 A;  3VSK A;  4BS9 A;  2Y48 A;  5F0C A;  1IJW C;  4LB6 B;  5DEQ A;  4S0H B;  2P6S A;  2P5V A;  2DOF A;  3MFK A;  2FXA A;  1N78 A;  1XMA A;  2A6E F;  2F4I A;  3O3K A;  2XRO A;  1W4M A;  4MGR A;  1GVD A;  2CV2 A;  1VFC A;  4W1U A;  3WGI A;  3WU2 C;  2EIJ H;  2Q1Z B;  4XKW A;  5LHI A;  4QTR A;  3SDB A;  5LLQ A;  2Z99 A;  2H6C A;  3IWF A;  3WHB A;  3HOT A;  2F5C A;  3OYF A;  2RAE A;  2STT A;  4B4C A;  4AYB N;  4KMF A;  4LJZ F;  5LBQ A;  1ZLK A;  2VBW A;  1Y6I A;  5GAH J;  1FYM A;  1BR2 A;  4YEL A;  3S3N A;  2K02 A;  2X9D A;  1MBH A;  2XDV A;  2OD5 A;  1POG A;  1TW3 A;  4UUS A;  1GHC A;  1I5Z A;  1SFE A;  4JX4 A;  4ENK A;  2EWN A;  4KIF A;  5DTD A;  2HGC A;  2EZK A;  1KZH A;  3OL3 A;  4EJO A;  4E7J A;  1TWH J;  1OR7 C;  2Y0S N;  1TC3 C;  1FZP B;  2X6O A;  2LRE A;  4OOI A;  1X19 A;  4XN3 A;  3CO7 C;  1JKP C;  3BG7 A;  1X2N A;  2VN2 A;  3EUK L;  4ZDP A;  3S2W A;  3HOW J;  1MKM A;  5JVG F;  4HQE A;  1J75 A;  3RPU D;  3FDY A;  4RLF A;  3ISP A;  2A07 F;  4XLN F;  2YU9 J;  1HCR A;  2CYY A;  3ZQC A;  2FSW A;  3G1L A;  2L3D A;  2MLK A;  1WI3 A;  2JN6 A;  2N8G A;  2LLK A;  4YFK F;  3GW2 A;  2NOJ B;  2LSO A;  1C0W A;  4HYE A;  4DYQ A;  3J80 K;  2IGO A;  3K4C A;  4A93 J;  3QYE A;  1DGR M;  1RET A;  2I5U A;  4O6J A;  3HM5 A;  4C30 A;  4IVN A;  3ELK A;  3WHC A;  2IS2 A;  4A0X A;  3M07 A;  4ZYG A;  2E1M C;  2I10 A;  4G7H F;  2LR8 A;  4YIF A;  5LHH A;  2FUG 2;  4Y52 J;  1LB2 A;  1Z3Y A;  2VOD A;  1D0Z A;  1YIT I;  1ZN2 A;  3E0J B;  5KHD A;  2JWT A;  5LRS A;  4A3G J;  3ZOB A;  3BR1 A;  2YSR A;  1W7P D;  2CUF A;  1DP3 A;  1QPM A;  2LNB A;  2PFB A;  2QQ9 A;  4RGX A;  5E79 C;  1E3O C;  3TED A;  1T95 A;  3L00 A;  4GFB A;  2JA8 J;  2A69 F;  2IT0 A;  1QRY A;  2ESH A;  2ISY A;  1TW2 A;  4AIK A;  1DPR A;  2NVT J;  2K5C A;  5DCM A;  2L7F P;  3FM5 A;  2KIQ A;  4XOT A;  4RDU A;  3RTR A;  1ITY A;  3KLO A;  2W1O A;  1AKH B;  3E6M A;  2EJR A;  5FGM A;  2O8K A;  3PFY A;  1GDT A;  4D5C A;  2W4S A;  3E5X A;  2QQ8 A;  1AHD P;  4A3C J;  4J00 A;  2JRT A;  2WY7 Q;  1BN5 A;  1T39 A;  1S7O A;  4FIS A;  1BI1 A;  4HBL A;  2E34 A;  1X1P A;  1QBJ A;  3W6K B;  3OYB A;  2V4J C;  1PUE E;  3GX4 X;  4Y3O A;  3I71 A;  3OS1 A;  1DU6 A;  2HEO A;  1KQ8 A;  4ENN A;  4MNU A;  3HOU J;  4X0G A;  3JR9 A;  3MMY B;  1EA3 A;  1SVO A;  2FBH A;  1WJE A;  1XCV A;  2ZO4 A;  1HKQ A;  4GGG A;  4KYW A;  3FF5 A;  3J7A O;  2M45 A;  1B59 A;  1BIB A;  2WAD A;  3GFL A;  5L3E A;  3KCC A;  2LMD A;  3G6E I;  3HOZ J;  4BJ5 C;  4BXU A;  4G6Q A;  3N4M A;  5GTI C;  1NHA A;  4CZZ A;  3OIO A;  2GXB A;  4PGG A;  5EEA A;  2V1X A;  2A68 F;  3AFH A;  3FXU A;  2MFZ A;  3K10 A;  1LNW A;  4MO7 A;  5LEK A;  2VE9 A;  2KIF A;  4N0B A;  2F4M B;  1MJA A;  3E97 A;  4G8X A;  2E60 A;  2QLZ A;  2ELK A;  3GEZ A;  3HKZ A;  4A0Z A;  3WTY C;  2GQQ A;  3V42 A;  2MBF A;  5CVI A;  4FX4 A;  3OYC A;  5LHG A;  1XGN A;  2F4O B;  4BEH A;  3COA C;  2LF7 A;  3QRF F;  3BRO A;  4N9I A;  1D8J A;  2H8W A;  1P4A A;  4L9V A;  3TP0 A;  2CU7 A;  2BVL A;  3DKW A;  1I27 A;  1YW8 A;  3BQZ A;  1FEX A;  1MW7 A;  1YLF A;  1OLT A;  3IAM 2;  2L2O A;  2PLY A;  2P81 A;  2GOX B;  2JA6 J;  4E7L A;  3BZK A;  3CMY A;  3I3L A;  5FD6 A;  4LK1 F;  3BG5 A;  4Q47 A;  3IKV A;  3HG9 A;  4H4K C;  3L9F A;  4M72 A;  2M2E A;  2PI0 A;  4DYC A;  1BL0 A;  3QP6 A;  1J59 A;  2IJL A;  2DPD A;  3S2D J;  2DA3 A;  4XRS A;  2QUF A;  1XSD A;  3JSP A;  2BZT A;  2O8X A;  1MD0 A;  3GFI A;  1V4R A;  2HPM A;  1APL C;  2GA2 A;  3KYL A;  1MSE C;  4CHU A;  1Z6T A;  1GV2 A;  1P2F A;  3KP3 A;  3RDI A;  3GUD A;  5LEJ A;  3S93 A;  3TL4 X;  3IHU A;  4FE4 A;  4QWQ A;  2GLO A;  4RM2 A;  3I55 I;  4Q5S F;  1QA6 A;  2Y0M A;  2PBI A;  4OWR B;  1FC3 A;  3BC8 A;  3VEP A;  5KAF C;  4CUG A;  3KZZ A;  1AU7 A;  2IS4 A;  2E5N A;  1XD7 A;  3FX3 A;  3OIP A;  1JI8 A;  4ZDL A;  1UG0 A;  1H8A C;  3WTW C;  4L5I A;  1K4T A;  2DA2 A;  4UNO A;  2M34 A;  2VKV A;  3J81 K;  2AO9 A;  2X1D A;  2AXT C;  2RRE A;  2ZXJ A;  1X1A A;  2L9R A;  1G59 A;  2E1N A;  3BT9 A;  4XRS G;  1XX5 A;  2ZB9 A;  4PDK A;  2XGD A;  3QYF A;  5ED4 A;  4BAC A;  5EEG A;  1HW1 A;  3S17 J;  1PVE A;  2P8T A;  1W7P B;  3I4N J;  3IP4 B;  2V9P A;  2XV4 S;  4OIR F;  2W24 A;  1O3Q A;  2PMZ A;  2W48 A;  1LVK A;  2K4B A;  3ZMS A;  4NBQ A;  2IA2 A;  2OBP A;  4AIH A;  5EGO B;  2DPU A;  4MQ9 F;  3JRG A;  4G7Z F;  3OSF A;  2L9V A;  3OOP A;  2NAZ A;  3T8T A;  1WJF A;  2V79 A;  4HX4 A;  3JRI A;  3T0Y A;  2HDD A;  4A3E J;  5JVT A;  3MKY B;  5TIS C;  4ASN A;  3Q0W A;  1F5T A;  3GLX A;  1S29 A;  1WJC A;  5J6X A;  3K4K A;  5D4R A;  2IVM A;  2OV7 A;  2VC0 A;  4ZTJ A;  2VQC A;  2JPC A;  4EVI A;  1A36 A;  1R6R A;  2HKX A;  4KN4 X;  4MQV A;  3PIO F;  5FKO A;  1F9N A;  3HSR A;  4RB0 A;  3FBN B;  4FAS D;  3CC2 I;  1QO0 D;  5AON A;  5JI6 A;  1VQ4 I;  3GFJ A;  3CLO A;  2O3F A;  5E3O A;  5GPC A;  1WH5 A;  2Y69 H;  4MFD A;  3H5R A;  3CF2 A;  3D0S A;  2XAU A;  1X3Z B;  4IPA A;  1WZ2 A;  1SAN A;  3ZQI A;  4V2G A;  2LKX A;  1ZQ3 P;  4UVA A;  5J3L A;  2JT1 A;  2TCT A;  3HKZ N;  3K4N A;  4BU2 A;  5FLX Z;  3BG9 A;  2HVQ A;  3KYD B;  1IRZ A;  1M1E B;  1YW9 A;  2XKP A;  5D5U B;  3K0L A;  3L2U A;  2FQ4 A;  2QA4 I;  2ADU A;  3VYS B;  2DOE A;  3CP2 A;  1R1V A;  4LGW A;  3VFZ A;  2KIS A;  2LG4 A;  5FLV A;  3I58 A;  1YRN B; 
#chains in the Genus database with same CATH homology
 4XLH A;  2VKH A;  2HVS A;  4DBQ A;  4CCM A;  4PSX A;  2VPL A;  3DTE A;  2M0M A;  4G6T B;  5HVQ C;  4ANJ A;  2XF7 A;  5HLT A;  4XKB A;  4IKF A;  3DU6 A;  1X1D A;  2JA2 A;  3TMO A;  4PK4 A;  5LFA A;  1YX5 A;  4BJ6 C;  2HDW A;  2KP6 A;  2F6C A;  4CCK A;  3SEZ A;  2GOM A;  2Q2E B;  2UUZ A;  3K4B A;  3ZCO A;  3C2G A;  4Y4R A;  1V5F A;  2R7S A;  3DPT A;  3LSH A;  5KCM A;  5CQE A;  3UNG C;  1LDK B;  3HUG B;  4XNF A;  3OIQ A;  4NC8 A;  3CZ6 A;  2R7X A;  4XQF A;  1N77 A;  2F5V A;  3AKZ A;  2L5Q A;  4KIT B;  2PJR B;  2KZV A;  2UWM A;  2M4K A;  2M3A A;  3FHN A;  2BW3 A;  2L9S A;  4HEA 2;  4B43 A;  3DEE A;  2L7K A;  5CQG A;  3BLY A;  4PJN A;  4F3Q A;  2K9M A;  4PJJ A;  1NG7 A;  4XMY A;  4E7Z A;  3VWB A;  3H5N A;  1KON A;  2W7N A;  2XSJ C;  3H0D A;  2KQR A;  2XC7 A;  4XLF A;  4B48 A;  2R7O A;  4IX7 A;  1ERD A;  3FKJ A;  1BOB A;  4JOM A;  2M7A A;  4MLO A;  3BG6 A;  2VL8 A;  4B3X A;  2AQF A;  2OC6 A;  3AL0 B;  3S8P A;  4JQF A;  1N75 A;  2AQE A;  3H9Q A;  4LG3 A;  3A2K A;  2R7R A;  4XM3 A;  4NC7 A;  2DJI A;  1D1B A;  2LRD A;  4RMN A;  1W36 C;  4F52 A;  4HG2 A;  2E1M B;  4N4O B;  3OYE A;  3G2B A;  5FRO A;  4Y33 A;  3LSG A;  2LYC A;  3LSI A;  3W2W A;  2CUJ A;  3H35 A;  1Z3X A;  2KDO A;  3PNY A;  4XL9 A;  3BCB A;  3KEY A;  3K4L A;  4B44 A;  2HPI A;  2X1E A;  1V5E A;  4P5O A;  1PYV A;  3VSL A;  1BR4 A;  2VXD A;  1W36 D;  2HNH A;  2WAQ A;  3EUH C;  4BUP A;  3DLA A;  2VKD A;  4CH7 A;  1UAA A;  1S9H A;  3QOE A;  3S32 A;  3OYN A;  4U7B A;  2Z16 A;  3MD2 A;  2VQH A;  1ZEL A;  1HA8 A;  4AVZ A;  2LG4 A;  4DOZ A;  2LY2 A;  4ZTF A;  1DGW Y;  3BCA A;  3H5A A;  2Z1D A;  3PNV A;  2LBF B;  2VJJ A;  3D5L A;  4J01 A;  2KRH A;  2XF5 A;  3ZXS A;  2HVR A;  1UEL B;  4XLE A;  4HNU A;  2WBM A;  2X51 A;  4PUS A;  3A1Y A;  4D9J A;  1D0X A;  3OYA A;  3LL7 A;  2CW7 A;  2CUZ A;  2W82 A;  1YX3 A;  1TT0 A;  1IRX A;  1TZL A;  3D5R C;  3DTI A;  3VSK A;  3H9G A;  3OWT A;  4CSW A;  4C2U A;  4RLQ A;  4BS9 A;  4XOP A;  4IQJ A;  5CPR B;  5FRN A;  2DT7 B;  3OS0 A;  2M4G A;  4D1Q A;  1N78 A;  2F4I A;  3H9J A;  2VJ5 A;  2CV2 A;  4II2 A;  2Q1Z B;  4XKW A;  3SDB A;  3HOT A;  3OYF A;  1WJB A;  2HZD A;  1YE9 A;  2DT6 A;  4ZC3 A;  3KX2 A;  1E0E A;  1Y6I A;  3HC7 A;  4XKC A;  1J09 A;  1BR2 A;  2VXZ A;  1T0F C;  4KT6 A;  4ZYA A;  4YEL A;  3S3N A;  1K6Y A;  2XDV A;  3M1C A;  1Z7L A;  2PJR A;  5CKT A;  3ZGK A;  4BDY A;  3HPG A;  4E6K G;  1Z21 A;  4BQQ A;  2WB1 A;  3W3C A;  4CCJ A;  1QHH D;  3OL3 A;  2KL4 A;  4E7J A;  4EAT A;  1OR7 C;  4HSR A;  2V9K A;  3PUB A;  3LSK A;  3ONQ A;  2LRE A;  3OMY A;  4E7S A;  3HOS A;  1X19 A;  2CS3 A;  4XN3 A;  4E4H A;  4DBR A;  3BG7 A;  3EUK L;  2KRC A;  4ZDP A;  3MKW B;  4BEH B;  1GLN A;  4LIV A;  3RPU D;  3FDY A;  2VQG A;  4RLF A;  4N4N B;  4YRV A;  3DU5 A;  4F91 B;  3PSF A;  4BL0 B;  2HU9 A;  3OYL A;  1DQU A;  2NOJ B;  5FRM A;  2VQL A;  2IGK A;  3K4J A;  2R7W A;  3OYJ A;  2IGO A;  3K4C A;  3QYE A;  4NQW B;  1DGR M;  1PJR A;  4C30 A;  4HNT A;  2IS2 A;  4NUB A;  3HXL A;  3L2W A;  2ZSI B;  2E1M C;  3N05 A;  4CCN A;  3RQ4 A;  4E7K A;  4HRI A;  3HPH A;  3OOU A;  2FUG 2;  4YEJ A;  1Z3Y A;  1D0Z A;  2K3P A;  3E0J B;  3RCO A;  4F92 B;  5KHD A;  1X1C A;  1WFX A;  3F9K A;  1DP3 A;  2VJ4 A;  1X4O A;  4BQN A;  1NG6 A;  2LBF A;  3CJQ B;  2CW8 A;  1T95 A;  1QHG A;  1X1B A;  3NWT A;  2M7B A;  3GBG A;  4P1W A;  4XR6 A;  3VYU B;  3VDX A;  4IZZ A;  3DPU A;  3IUO A;  1D1C A;  2K5C A;  1MMG A;  2X85 A;  4XOT A;  3RTR A;  1MMN A;  2LC2 A;  4NNJ A;  4PFP A;  4BJT A;  4ZJZ A;  5JHF A;  2W1O A;  5HNF A;  3CMM A;  2IGM A;  3PFY A;  2W4S A;  4J00 A;  2WY7 Q;  3OYG A;  4ITV A;  4CZC A;  2WAE A;  2LY1 A;  3SZG A;  3OY9 A;  3OYB A;  2CMP A;  2V4J C;  3PSI A;  3K70 C;  1WJ5 A;  2I8D A;  4Y3O A;  3OS1 A;  1Y56 A;  2KMU A;  1D0Y A;  3QYB A;  2A6T A;  3K4M A;  3L2R A;  4X0G A;  3MMY B;  2K9L A;  4LIU A;  1EA3 A;  1WJE A;  4CCO A;  2OUM A;  3SYT A;  2X1C A;  3OS2 A;  2V1N A;  2WAD A;  3K70 D;  3PJR A;  2JUG A;  4BJ5 C;  2R7U A;  4F55 A;  4PSW A;  3ZR8 X;  3IAS 2;  4E7I A;  3LSM A;  4XN0 A;  4F93 B;  1SFK A;  3AFH A;  2CV1 A;  3K10 A;  2MFZ A;  2ZXH A;  4CA0 A;  4GRI A;  2IS1 A;  2ZFU A;  3E1S A;  4DIQ A;  4PJM A;  3DQV C;  4RM3 A;  1WJA A;  2W00 A;  2X6X A;  2RNG A;  4PFO A;  4DJA A;  2P0W A;  2E60 A;  3LMM A;  3NWS A;  1P9Q C;  2IGN A;  3HKZ A;  4XLA A;  3V42 A;  3OYM A;  2JSP A;  4XLC A;  2X6Y A;  3OYC A;  4CCL A;  3OYK A;  4XOR A;  3S3O A;  1QU3 A;  3CES A;  4BEH A;  2IXS A;  2R7T A;  2Z2S B;  2BVL A;  2JVG A;  2DCE A;  2KPM A;  4IQ4 A;  4XKV A;  3C2H A;  1MW7 A;  2V26 A;  1OLT A;  4LIT A;  2LOO A;  3IAM 2;  2L2O A;  3D5S C;  2KHM A;  2GOX B;  4QPO A;  2A5W A;  4E7L A;  5TGT A;  3I3L A;  1VZ0 A;  3HG9 A;  4H4K C;  4AYB A;  2VAS A;  2CV0 A;  3L2V A;  2WY8 Q;  1U0J A;  3OR1 C;  2MD0 A;  4DGW B;  2HPM A;  3KYL A;  3AL0 C;  4KJZ A;  2ZSH B;  2QKM B;  3HL2 A;  3S93 A;  3TL4 X;  3ZQQ A;  4HST A;  2KLO A;  3K6G A;  4RM2 A;  2X6W A;  2Y0S A;  3OR2 C;  4XON A;  1AA7 A;  3DKY A;  3RSN A;  4OWR B;  5HNH A;  3BC8 A;  2MYS A;  2R7Q A;  2IS4 A;  2R4G A;  4CUG A;  4II3 A;  3W2A A;  4C9Y A;  2E5N A;  3DTK A;  3OIP A;  1JI8 A;  4ZDL A;  1UG0 A;  4OAY A;  2HQA A;  2VB6 A;  4PJL A;  3UR3 C;  3A4C A;  2BW3 B;  1FMW A;  2RRE A;  2X1D A;  4BDZ A;  1X1A A;  3I9V 2;  5KNL A;  1G59 A;  3DWL E;  4QPQ A;  3SEQ A;  2L9N A;  3PNT A;  3QYF A;  3J7A Y;  4BAC A;  1D1A A;  3S3M A;  2O5R A;  1MND A;  3OYH A;  3IP4 B;  1MMD A;  4AU7 A;  1V5G A;  2PMZ A;  4BE0 A;  1LVK A;  2RQQ A;  3EUA A;  2IS6 A;  4BE1 A;  2V6E A;  4KIS A;  3EPZ A;  1LKX A;  3OL4 A;  4B47 A;  5LD2 C;  1X4P A;  3TBI A;  2UV1 A;  3CJR B;  1WJF A;  1WJD A;  2XF6 A;  2VLA A;  2BVM A;  3MKY B;  3MKZ A;  2R7V A;  1WJC A;  3DPL C;  4C2T A;  3K4K A;  3PL8 A;  2OV7 A;  4ZTJ A;  2VQC A;  1SAU A;  1MMA A;  1R6R A;  2CH0 A;  2WAF A;  1FMV A;  2ZXI A;  4HPQ A;  4U87 A;  2MAB A;  3DKX A;  4BGD A;  3FBN B;  3VYT B;  2BOL A;  3QOD A;  4FAS D;  2JVH A;  3ZRG A;  3L2Q A;  2VIX A;  2QKL B;  3H5R A;  3CF2 A;  2XAU A;  2CFO A;  4FET A;  3OYD A;  2DXI A;  3U21 A;  2DOA A;  5HOO A;  2LH9 A;  4ZDO A;  3M8J A;  1G8X A;  3K4N A;  4BE2 A;  4BU2 A;  3CP8 A;  2HVQ A;  1MNE A;  4OAZ A;  4E7H A;  4BXF A;  2VJI A;  4BQO A;  3L2U A;  2MC4 A;  3LFU A;  3VYS B;  1BR1 A;  3FBI B;  3OYI A;  3CP2 A;  2E5Z A;  2ELJ A;  2V7F A;  3VYR B;  3W2V A;  2WA0 A;  1LFP A;  4R79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...