1LFUP

Nmr solution structure of the extended pbx homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*CP*AP*TP*GP*AP*TP*TP*GP*CP*CP*C)-3'
publication title Lock and Key Binding of the HOX YPWM Peptide to the PBX Homeodomain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 22
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2002-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1lfuP00
3A01B 5IOYA 2E19A 3NARA 3OIOA 2LP0A 2NVQJ 1X2MA 2Y31A 3BG9A 5FKNA 3HEFA 3SDGA 4DYRA 5E3MA 5M5YJ 4C3JJ 3MKLA 3HOUJ 3MN2A 3F0CA 4DZPA 4LOCA 1LE8B 4A93J 5EG0A 2HI3A 2VI6A 4A69C 4B4CA 5F1JA 1GVDA 2CUEA 1DU0A 3OOUA 4DYCA 2WB1N 3RZOJ 5FJ8J 4QIWN 3CMYA 4CYCB 1OCPA 2GM4A 4AYBN 5EZGA 5K7HA 5JLXA 1OJLA 4L5EA 1BL0A 3HM5A 2AHQA 4MFEA 2KDZA 4ABZA 1FEXA 2R0QC 3BT9A 2X48A 1TWGJ 2DA5A 2M2EA 3BR2A 1W0TA 2IBDA 1POGA 5EZHA 4A3GJ 3BR3A 4Y7NJ 1GT0C 3BR5A 3JRBA 4M3EA 1IDZA 5FLMJ 5F08A 3ZOBA 2YUSA 5GPAA 1K83J 4W1UA 1UG2A 4X6AJ 1I50J 4UUSB 2QCOA 5C3EJ 1SFOJ 3MVPA 3HB9A 3QPLA 2TRTA 2DMPA 5C44J 1IC8A 3FISA 3LSRA 4IHWA 1P7IA 4MIMA 4J19A 3GTOJ 2EZHA 1JKPC 3CDLA 2EH3A 2M0CA 1WH5A 1ZTRA 3O8HA 2ZB9A 5M3MJ 3IH3A 4AC0A 2E1OA 5J1YA 5M5XJ 1WI3A 1JTXA 1VNDA 1T33A 4A3FJ 2L9RA 3SJMA 5C4XJ 1ETOA 2IEKA 2MG4A 3JRIA 5IOZA 4V2GA 2DN0A 2K9QA 5FKLA 5M5WJ 4HNVA 3JRDA 1PUFB 1HDPA 4FISA 5IYBJ 1HLVA 1WH7A 1MH4A 3PO3J 3OSGA 2L7ZA 4Y52J 2JN6A 3HOXJ 1IJWC 2JK3A 2NVTJ 2MW8A 3WHCA 4FCYA 2DA3A 3S2HJ 2CQQA 5EEAA 5E3OA 4I76A 5F0HA 3GTGJ 1BJZA 3HGYA 1P7JA 1Y1VJ 3LSGA 5J1RA 2XRLA 5K7ZA 1JKOC 1JUPA 3S1NJ 2E2HJ 4D5FA 5J1UA 3FK6A 1G2HA 2H8RA 4C3IJ 3VPRA 3JREA 5IPAA 4RDUA 1Y1WJ 1B8IA 3I4MJ 1TC3C 2RAEA 1W0UA 3GTLJ 3S1QJ 2Y9ZA 2B63J 2EQRA 4I6ZA 2JA5J 3PM1A 1JKRC 1VFCA 2X9DA 4UUTA 1JJ6C 1HOMA 1AKHA 5F27A 3ZQCA 1JT6A 2K9SA 1F36A 4A3IJ 3B6CA 2NOGA 1H88C 3A01A 1XC5A 5F0CA 1RKWA 1B72A 4DYQA 2CRGA 1LFBA 2R5ZB 3BTJA 1X58A 3LSJA 1K61A 2EBIA 4M3GA 5EGOB 2HXIA 1RKTA 4W97A 3FIWA 3FKIJ 3G1MA 2DMQA 1LE8A 1TWCJ 1GV5A 4XRSG 2NVXJ 3GTKJ 4RBOA 3K2AA 2DA6A 2JA6J 2PMZN 1U9NA 2DMTA 3BQZA 1QRYA 3BR1A 4CYCA 2MSYA 4M3BA 2DMNA 1IV6A 2IAIA 2EZLA 1OFCX 2D5VA 4A3BJ 1TWAJ 2XGDA 4MLOA 3S16J 3QPSA 4B1RA 5FKOA 3ZQGA 1FIPA 2NS8A 5F04A 5IP7J 4M6VA 1OCTC 1Z77A 2LR8A 1MNMC 3G1LA 3L1PA 1IRZA 1MBKA 5FLVA 5DTDA 4XK4A 4XRSA 3A02A 2ME6A 2FQ4A 3PO2J 3RQIA 4JX4A 2XB0X 2N8GA 2X6OA 5EF6A 1IG7A 1RPWA 2LFBA 1WCMJ 5IYDJ 4A3JJ 1H8AC 3K7AJ 3JR9A 4UUSA 3IH4A 4FTHA 1GDTA 3JRAA 1I3QJ 2VUMJ 2R5YA 1ZGWA 2LTPA 5FKMA 1HDDC 3ZQFA 1JUSA 3GTJJ 1U8BA 2NS7A 2WV1A 2LY9A 2YU9J 2XGCA 2JMWA 2YS9A 3ZQIA 1IUFA 3RKQA 4BBSJ 3QQAA 1HCRA 1U78A 5EYRA 2Y9YA 5E3LA 2O8KA 2Y30A 4DZJA 1T56A 1AU7A 2E2IJ 1A5JA 1GV2A 2Y2ZA 4D7MA 5EDNA 3Q0UA 4MFDA 2LKXA 1LFUP 3HKZN 1ETVA 5K7FA 3Q0VA 4A3LJ 4BKXA 3DEWA 2TCTA 2G0EA 1YRNA 5IYCJ 1RETA 4JX6A 4G12A 3BQYA 1BW6A 1ETKA 3IV5A 2COBA 3ZQHA 1MBGA 3A03A 1Q1VA 2L0KA 2EZKA 3BG5A 1JGGA 9ANTA 3Q0WA 5E3NA 4A3EJ 2MGQA 4IHVA 2AO9A 2K40A 3Q3SA 1MBFA 1MBHA 2M8GX 4MO7A 3JRHA 1ETWA 1NTCA 4M3DA 5JLWA 1MH3A 2R7ZJ 3LNQA 3B6AA 1VF9A 2HOTA 3HOZJ 3JRFA 4XIDA 3G1OA 5IP9J 4V2FA 4GFBA 2XPUA 3BR0A 2VPRA 1QVUA 3JRGA 1ZR2A 1B8IB 4A3MJ 3ZQLA 1ETXA 4A3KJ 2E2JJ 1FJLA 3S1RJ 5FKKA 3TP3A 1FTTA 3O8GA 2ECCA 1HF0A 2DMUA 2ID6A 2JJ7A 4B3AA 2DA2A 5GPCA 2M34A 4BXXJ 2XPVA 4FE7A 1NK3P 3LOCA 1MBJA 2CUFA 2LD5A 2OF7A 2DA7A 2KT0A 2LK2A 3JRCA 1B72B 1RR7A 2CJJA 2I10A 1JKQC 1JT0A 4IEJA 2XGEA 5DS9A 1BA5A 3CCYA 1XG1A 2GLOA 2LLKA 3C2BA 5IP6A 2ID3A 4NDLA 2EZIA 4BY1J 2GBYA 2HXOA 5EG0B 3OSFA 4A3CJ 3HOVJ 2HOSA 2DJNA 4EEFG 4XICA 3LSPA 3BG3A 2M9HA 3IH2A 4D7NA 4D5CA 1NK2P 2HDDA 1AHDP 2H1KA 3W6VA 4AUXA 3S15J 2L7FP 2OPTA 3BTCA 4A3DJ 1JTYA 1IDYA 2JWTA 3GBGA 3E7LA 5F0FA 3TEDA 2LVSA 1D5YA 4IHYA 1A6IA 2JA7J 1JUMA 1X2NA 1S7EA 1ZR4A 3S1MJ 2ME0A 3BR6A 1ORKA 5M3FJ 2O7OA 2P81A 4BBRJ 1I6HJ 2HOAA 1CQTA 1FIAA 1E3OC 1R9TJ 3SFIA 3HDDA 2DA1A 1UMQA 3M3YJ 1WPKA 1Z0XA 2VKVA 4JYKA 5BNGA 2O9LA 1GUUA 2HQ5A 1MBEA 1DU6A 2FX0A 1ZKGA 1F43A 4BY7J 2R5YB 1O4XA 4JP0A 5J3LA 1FTZA 3HBLA 1SANA 3HOYJ 2XSDC 5C4JJ 3TW7A 4M3FA 3H3VK 1H89C 2DTZA 2CU7A 1IGNA 5HODA 1ITYA 1PUFA 1ENHA 4FE4A 3HGGA 3RZDJ 1MSFC 2Y0SN 2W48A 1TWFJ 2FD5A 4C3HJ 3D1NI 1APLC 3BTIA 3NAUA 4QTRA 1EF4A 4X1EA 2ELKA 2L7MP 2HYJA 3WHBA 1ZQ3P 2R92J 3UKGA 2NVYJ 3S14J 5GP9A 2FJ1A 3TP0A 2JA8J 2XB5A 3S2DJ 3TW6A 1BW5A 1ETYA 3GTMJ 1YRNB 2WAQN 4C2MJ 1VI0A 3FK7A 1ZK8A 1MSEC 2QF7A 3HOWJ 2DA4A 3BTLA 1WGXA 3I4NJ 2R93J 3CQZJ 1JJ8C 3H0GJ 1QVTA 1U9OA 4S0HB 4DW6A 1XS9A 1UHSA 4QSHA 2ECBA 2CQXA 3DCFA 3M4OJ 2VKEA 3GTQJ 4IHXA 3GTPJ 2XPWA 1RESA 1QPIA 3S17J 2R5ZA 1ETQA 2K9NA 4JX5A 1TWHJ 5EGOA 1AKHB 4XRMA
chains in the Genus database with same CATH superfamily
1R1TA 2V1NA 4LD5A 3A0BC 5IOYA 2E19A 2NVQJ 2LP0A 2WAFA 1X2MA 2Y31A 2KQRA 3TMOA 3HOUJ 3MKLA 4X0GA 5FRMA 3F0CA 4DZPA 4M9SA 5D4SA 1O3SA 3CESA 4N4NB 1R6RA 2IW5A 2KHMA 4A93J 3M07A 2HI3A 1OYYA 1YW9A 2OQRA 2DT5A 4B4CA 5D5XB 1DU0A 1FP1D 4E7KA 3RZOJ 5FJ8J 2IVMA 4MTEA 4CYCB 3CCMI 4AYBN 4B44A 5EZGA 1OJLA 2DDAA 3HXLA 3SQNA 1BL0A 3LA7A 2XHKA 3WGHA 4PFPA 3GFMA 2R0QC 3BT9A 4P96A 2V26A 3QPHA 3CCSI 2DA5A 2XKPA 5EZHA 3L09A 2OC6A 3BR5A 4PJNA 1A36A 1IN8A 1K7AA 3JRBA 4ZYHA 5ICEA 2BY3A 4E7HA 1ZG3A 5F08A 3D5LA 2EIJH 3K6GA 4PFOA 2HVRA 2HR3A 3F72A 3CMEI 1NG6A 2STTA 2ZO4A 2MH9A 3HTSB 1R4MB 2LRDA 2VT3A 1TBXA 2QCOA 1MNDA 4M74A 4ZYDA 1SFOJ 3D5SC 2IT0A 3HHGA 3ZCOA 2DMPA 3FF5A 1WQ2A 2Z33A 1KU7A 4BE0A 4L5JA 3E0JB 1NHAA 4UVCA 4BHBA 1ACIA 1TT5B 4J19A 2EZHA 3IHUA 1UCRA 1K79A 4QPOA 2P6SA 3IWFA 3O8HA 3U2RA 3IH3A 3GZNB 3WTXC 1W36D 1VNDA 1WVRA 3NRVA 3T0YA 4FX0A 4MEXF 1F9NA 5IOZA 4CDGA 4ESBA 3OWTA 2DN0A 4IO9F 2K9QA 2JSPA 5BPDA 3JRDA 3MZ8A 1KU3A 1HDPA 2BXZA 3TO9A 5CVIA 1WH7A 1MH4A 2XC7A 3S8PA 4AIKA 1FYMA 4CHUA 4A0ZA 3PO3J 4Y4RA 2LH9A 3KP5A 2W00A 2JN6A 3HOXJ 2OJED 2JK3A 2MW8A 2B7EA 3K69A 2GA1A 3K4MA 1YS6A 5J4YA 2IS1A 2K3FA 5E3OA 2IGNA 4AIDA 1IRGA 1FNNA 5F0HA 1OPCA 2ELJA 1BJZA 3EUHC 3HGYA 1J59A 3ELKA 5K7ZA 2XRLA 4BQQA 4U87A 5E8IA 4CZZA 1IN5A 3JREA 2Q1ZB 2M5WA 3FZVA 3OV8A 3PM1A 2Y75A 3S3OA 1VFCA 2VQHA 2A61A 2J5OA 2X9DA 4PJ0C 5LBQA 4GYIA 4XR6A 2FBIA 4A3IJ 2A6TA 1XC5A 2QWWA 4ZDOA 4NHJA 5KVRA 4DYQA 5J40A 1IZ1A 1X1CA 2HFHA 1X58A 3OS1A 4M3GA 1XMKA 5EGOB 4ZTFA 1RKTA 2VL8A 3FIWA 1D1BA 2DMQA 2EFOA 4XRSG 2NVXJ 5L3BA 3QAHA 3V8LA 2DA6A 2JA6J 5LHHA 2PMZN 3RKYA 1D0ZA 3TO6A 1VQOI 3LQQA 1WI9A 1HW1A 3BR1A 2X1DA 1YTYA 3QYBA 5LD2C 2DJIA 3EUKL 1ON1A 2DU9A 2EZLA 2OTLI 4U0VA 4O5VA 1LDDA 2XGDA 4BACA 2BVMA 3QPSA 3E1SA 1XSVA 1OMIA 4BGDA 2B9SA 2NS8A 5F04A 2WB1A 4ITVA 4M6VA 4JBAA 3T1BA 4L18B 2LR8A 2L54A 2PMZA 5DV5A 2LC2A 3K2ZA 3L1PA 3C2HA 1IRZA 3RPQA 1SVOA 1Z7UA 5D8KB 3PO2J 4RMNA 5E18F 2XB0X 2N8GA 2K9LA 4MGRA 2GIZA 1WJBA 1UFMA 4A3JJ 4LIVA 2IS6A 2IGMA 3K7AJ 3JR9A 3U9GA 3VODA 3IH4A 5E79C 1MJBA 4NC7A 4OIRF 2CW0F 2AQFA 1X3UA 3CCQI 5FKMA 3ZQFA 2E1MC 3G2BA 1JUSA 3GTJJ 3KZIC 4GXOA 3SZPA 4BDYA 1FZPB 5E1XA 3OYAA 1BR1A 2F5VA 3EYYA 5FFXA 4ENMA 4RLQA 3PUFA 5GADJ 2IGKA 2CQKA 2F5DA 2XKOA 4UB6C 1DP3A 2O8KA 2JZYA 4AVPA 1FBSA 2VC1A 2E2IJ 3P9IA 1A5JA 1GV2A 5ERIA 4BH9A 5CQEA 4KUMA 5JFRA 3F6VA 5K7FA 3DBLB 4ZTJA 5F6FA 2VBWA 4BKXA 3K70C 3E6BA 3ABLH 1REPC 2KIFA 1HSTA 1WSUA 1LDKB 3V8KA 5IYCJ 1LVKA 1RETA 3WTTC 4BNCA 4WWCA 1MJAA 1ETKA 2COBA 3MQ0A 3BZ6A 3BG5A 1TZLA 5FFZA 3A4CA 3Q0WA 2ZMEA 3ABTA 5E3NA 5LLQA 1G59A 2CV2A 5FO5A 4IHVA 3K9TA 4OAZA 3N4MA 1MBFA 5LEKA 4LIUA 3MKWB 4RM2A 3I55I 2NNNA 4JQFA 3JRHA 5TGTA 4UUVA 4AVZA 1NTCA 1O7LA 2E71A 2H6CA 4CGZA 3LAJA 3HOZJ 5D5WB 3JRFA 5IP9J 2CYYA 3E6CC 1P92A 2MC3A 4OU0A 1Z21A 3HSFA 2E1MB 1T38A 3DBRB 1G8XA 2KRFA 3JRGA 1ZR2A 2HYGD 1B8IB 1BC8C 4PGHA 5J47A 2E2JJ 3KP6A 2MABA 4ZDPA 2BE5F 3TP3A 1HF0A 2JQ7A 5LHGA 2DMUA 2JJ7A 2DA2A 3DP7A 2FE3A 2EWNA 3OS2A 2W24A 3OYMA 3CF2A 2KT0A 4ENKA 4LLNA 3JRCA 1DGWY 2XGXA 2E1NA 1LKXA 2CJJA 2DFFA 4HYEA 3DLAA 2KISA 1K6YA 2X6XA 1JT0A 2XGEA 5DS9A 3BC8A 4LK0F 1BA5A 4IRHA 2GLOA 1XG1A 2Q8KA 3GFIA 2VBZA 5E1ZB 3J80K 3ZXSA 1T39A 4NDLA 2PJRB 2EZIA 4Q4ZF 2Y69H 1N75A 2UZKA 1X1BA 2O0YA 4A3CJ 2P7VB 3I56I 1QU3A 2R3SA 2DJNA 2NS0A 2DI3A 3F8FA 1YJNI 2EILH 1W7PB 1FC3A 1ZHFA 4RGUA 1FSHA 2DBBA 2K5CA 2H1KA 3KYCB 4BDZA 1FYLA 3S15J 3CUQA 4F55A 2V79A 1IDYA 3MCZA 2XROA 1MKMA 1X19A 1TW2A 3E7LA 3HL2A 2LVSA 5BMZA 2STWA 3LA2A 1SVLA 4EQQA 2ZXHA 4MHGA 1S7EA 4XKWA 2R7VA 3K4JA 1VQ9I 3BR6A 1ORKA 1X3WB 2GXGA 1TTYA 2O7OA 1YHQI 3FXQA 1UHMA 3K4KA 3X2QH 1VQ7I 5HNFA 1Z1DA 2M1BA 3F8CA 2XASA 2OUMA 2MLGA 2ACJA 3H5AA 2VQLA 3SFIA 1S5LC 3MKYB 3TL4X 2RVCA 2FEZA 1WPKA 2XUBA 1USTA 4EM2A 2QSGX 5BNGA 3BG7A 1CF7A 4QLCU 3DWLE 3HRMA 3HYIA 4DQ2A 2F4IA 3OYFA 1O4XA 3OIQA 2W85A 2YPRA 1J7KA 5LFAA 3I3LA 1SANA 2XRNA 3OS0A 1R58A 1WJ5A 3FMQA 2QBYB 1JGSA 3ASNH 4M73A 1K4TA 1SD6A 2P6TA 2ZCWA 2EK5A 2CU7A 2HYFA 2JRTA 3HG9A 4L9VA 3ERED 2OA4A 1Z91A 4YEJA 2JA2A 4G8XA 3K10A 1XSXA 2F48A 4XQFA 2FD5A 3D1NI 1GHCA 1FX7A 3DKWA 4M9ZA 3NAUA 3RKXA 4QTRA 3QODA 4L5IA 1T2KA 4X1EA 3S32A 1KQ9A 3ZMUA 3H9GA 4NQWB 1XB4A 1SD4A 2ZXIA 1BI3A 2HDCA 4YFNF 1ZQ3P 4D1QA 1X4OA 4DBRA 2X85A 5TRDA 2FJ1A 2JA8J 3JTHA 1A35A 3QU3A 3L2RA 1VQLI 1E17A 1HKTA 2WADA 2Z3YA 2H6BA 3CCLI 1TQIA 2WAQN 3WGIA 1YRNB 1FBQA 4ZJZA 1T8IA 3HOWJ 1YIJI 2DA4A 3BTLA 4ENJA 2R93J 3CQZJ 4G94A 1W7PD 4CYDA 1QVTA 2VE8A 3WU0A 4S0HB 2LY1A 4WCGA 3HPHA 1MNEA 3Q9SA 2ECBA 5JI6A 2IA1A 4IHXA 3GTPJ 2QQAA 2ZSHB 1QPIA 2WAQA 2ZJPF 3HC7A 1ETQA 2X6WA 1XGMA 4CA0A 1KYWA 1WJFA 4XKBA 4BJ5C 4XRMA 3GUDA 3A01B 2ELHA 2LKSA 4L0ZB 3DLLF 3TBIA 5AIQA 2BHYA 3CP8A 3BG9A 5FKNA 4EGYA 3HEFA 4DYRA 5E3MA 2KRHA 1S72I 4N0BA 2BOLA 2DFIA 3MN2A 4LOCA 4RAYA 5IT9K 1LE8B 3OY9A 1QZEA 5TISC 3H1CA 2BGCA 5LGNA 2GXAA 4A69C 5HLTA 5F1JA 4DGWB 2CUEA 4HF1A 3QYEA 2XV4S 3OOUA 4DYCA 1A04A 1F5TA 3CMYA 1KQ0A 5D4RA 4RGXA 1OCPA 1U2WA 1BI1A 4M71A 2HZDA 5GTIC 3EETA 5JLXA 4L5EA 4BXUA 3M8FA 3DKYA 4AU7A 3HM5A 5K7HA 3IKTA 2M4KA 1S7AA 3FM3A 4DIQA 1B1BA 4J00A 4ABZA 1R71A 1FEXA 4ON0A 1TWGJ 1TQMA 1EA3A 2EJRA 1W0TA 4I02A 4AM3A 2QKMB 1D3YA 1DPRA 3ONQA 3I59B 4Y7NJ 4R8HA 2WC2A 1D1CA 1GT0C 1KQ8A 1X1DA 3VYUB 3CO6C 3P9CA 5FGMA 3L9FA 2F2EA 2L2OA 1VQNI 3V42A 3ZOBA 4UNOA 3DBHB 3JW4A 4XOTA 2DODA 2WA0A 4HF2A 3R60A 4C9YA 5C3EJ 1ULYA 1LEAA 4OMZA 1X1PA 3QPLA 4XSXF 4XORA 5HS8A 4RGSA 5GTHC 5C44J 1IC8A 3F8MA 2ISYA 3FISA 3LSHA 3F22A 1P7IA 4MIMA 4I0AA 2K4JA 3W3CA 2M4GA 2B0LA 1I6XA 4HX7A 4F93B 1WJAA 1XDUA 2EH3A 2M0CA 3ML6A 4Y17A 2HOEA 1ZTRA 2ZB9A 1S29A 4NBQA 2LBFB 4DOZA 1F4KA 2AS5F 1J9IA 1JTXA 1SFUA 1T33A 3E6MA 5KCMA 4A3FJ 4LB5A 3G6EI 2RQPA 1ETOA 2MG4A 3JRIA 2KIUA 2HWVA 1UHWA 4V2GA 2FNAA 4KT5C 2E5ZA 5M5WJ 5H20A 3SZTA 4BHPA 2OD5A 4RLFA 1PUFB 1AWCA 1D0YA 2EV6A 2GQQA 3IRQA 4H4KC 4S04A 4Y52J 3AG3H 1L3LA 2WWYA 1MDMB 3LA3A 5H2FC 2IRFG 2JPBA 3OYKA 2NVTJ 3F8BA 3QYFA 4FCYA 2DA3A 5IT9Z 3S2HJ 2CQQA 4CUGA 5EEAA 4LG0B 1AOYA 3VOEA 1T95A 4MQ9F 2LREA 4HX8A 4B3XA 4A5NA 2KJCA 2LDUA 5J1UA 1FOYA 2H8RA 2CQ7A 1WJDA 3CLQA 2VIXA 3PIOF 2EQRA 2A05A 2JA5J 4KA4A 1JXSA 5KNLA 3E3VA 4A5MA 1TL8A 2JSCA 1QA6A 4UUTA 4HOBA 1JJ6C 3E5UA 1Y8QB 3CP2A 3GW2A 3IUOA 5F27A 5DM7F 1JE8A 1AA7A 3JSPA 1AKHA 1JT6A 2IP2A 4OMYA 1F36A 3RKWA 1SVMA 3J81Z 3R4KA 3OOPA 2DW4A 2CRGA 2IS4A 4PCQA 3UNGC 4YIIA 1XN7A 2IGOA 3BPXA 3CMMA 3LSJA 3PSIA 1VQ4I 4UHTA 5A2QK 2OQGA 1RZ4A 2HXIA 3M7GA 4FASD 2WBMA 4W97A 3G1MA 1GV5A 4E70A 4RBOA 3K2AA 4HG2A 3OYIA 5E17F 4F92B 1ZREA 1KU9A 1TT0A 4EVIA 2GWRA 2I8DA 3WTSC 4PJLA 1QRYA 2QM3A 5K5RA 4CYCA 3EDPA 1O3TA 4HF0A 2DTRA 4A0XA 2YU3A 1U5TA 2KDOA 5L3CA 1SMTA 4A3BJ 1TWAJ 3V8JA 3S16J 3QWLA 4B1RA 3FM5A 1XCBA 2KZVA 4XKVA 2HNHA 2CUZA 4CCMA 2M30A 1Z77A 2K3PA 3TDZC 4ZDLA 1IN4A 1MNMC 1XDSA 4AYBA 2P5LC 1ZLKA 4Q5SF 2VQCA 3A02A 1M1EB 2JT1A 3BLYA 3FXUA 3LL7A 4YFXF 2E34A 3RQIA 5DYMA 4A12A 2ETHA 1RUOA 4JX4A 2QSFX 1Y8RB 2X6OA 5EF6A 3K4LA 1IG7A 2LFBA 3W2WA 4PJJA 4D0PA 1S7OA 1B9NA 3RIRA 1K78A 3TKYA 4G7ZF 4IVNA 4G7HF 1ZGJA 5CPRB 2NS7A 3E5XA 4I09A 2HU9A 2YU9J 4WK8F 2MD5A 1JHFA 3GO5A 5FROA 4RB3C 1OCCH 3HUGB 4BBSJ 3QQAA 1HCRA 1T0FA 3L2UA 2BEOA 2RDPA 4A0YA 2HVQA 2EINH 3DTKA 4UXNA 5E3LA 1FYKA 1G3SA 4BEHB 1B59A 2A5WA 2CV0A 2XF6A 2IA0A 1AU7A 4G6DA 3WE3A 3FXLA 3HOSA 1ZG5A 4D7MA 3TQNA 2HPIA 3Q0UA 4CCOA 3HTUA 3FMRA 1EH8A 3HKZN 4HSRA 4KITB 5DUKA 1OR7A 1W5TA 1YX5A 1ZELA 4LITA 4B47A 3ZQ7A 2VOPA 3H9QA 3ZMZA 1ZH5A 3K1NA 3CJTB 3CCEI 4JX6A 5ILVA 2PFBA 3BQYA 3EUAA 1BW6A 3RI4A 1ZARA 2VQGA 1DP7P 2EZKA 2RC4A 1XGOA 4A3EJ 2ZJ2A 2WV0A 3I71A 2K40A 3OYEA 3LSIA 4WXCA 1GLNA 1WKMA 5IT3A 2M8EA 3VYTB 1J5YA 4GYGA 4MO7A 4KIFA 5LHIA 2A07F 1VQ6I 2LY2A 3KIOA 3DKXA 5JLWA 4IX7A 5TJJA 3LNQA 4BL0B 2R7DA 1QHGA 2HDWA 2EB7A 1OISA 2V1DA 3G1OA 2Z1DA 4KFCA 3ZP5A 3O3KA 5CVUA 2ZNZA 4E7LA 2ESHA 2IJLA 2QSHX 1QVUA 2Q2EB 4A3MJ 2V6CA 2D1HA 4OOIA 5D5UB 2P5KA 3DPLC 2R7XA 1H9TA 4P1WA 1HC8A 1STZA 1FTTA 2VT2A 2ECCA 4BS9A 2ID6A 3IL2A 2CSOA 5GAHJ 1RIOH 3RPUA 3CO7C 2GA2A 2XPVA 3KYLA 1YG2A 4FE7A 2L5QA 2M7AA 3LOCA 3FX3A 2W7NA 3KPHA 4RAGA 4RM3A 2M7BA 2LD5A 1D8JA 1WHUA 2WTEA 2RQQA 1U6GA 2F4OB 2YSRA 4WXDA 2V1UA 4D9JA 4G6QA 3QRFF 1J0RA 4KT6A 5ICCA 3RYPA 1HBXG 2GIVA 3CCYA 4IXAA 2LLKA 3C2BA 1N25A 4KDPA 3CC7I 2GBYA 5EG0B 4P9FA 1EH6A 4AIJA 4XLPF 2JRMA 4LJZF 4XICA 3LSPA 3CCRI 3A2KA 3M9AA 4GCVA 2V7FA 3IH2A 2QQ9A 4LFUA 2FF4A 2ESNA 4H0EA 2VXZA 2DFHA 2DLLA 2OCCH 4PJMA 4D5CA 1NK2P 2UUZA 3KP3A 4L9TA 3OYDA 4AUXA 5J8FA 1YE9A 2L7FP 2OPTA 2W57A 1JTYA 1S6LA 2O8XA 3GBGA 3O2PE 4IF4A 1QZYA 4DJAA 2HEOA 3VYSB 3DEUA 3TEDA 3I54A 3PSFA 2O61A 1JUMA 1X2NA 5AONA 1G4DA 2KLOA 1T6SA 2PG4A 3I64A 5DUIA 2P81A 2QLZA 1ONVA 1MMNA 2RGVA 2DPDA 4CO8A 3K4CA 4CCKA 2ZXJA 2EIKH 2DA1A 2MA3A 3IC7A 3ISPA 1UMQA 1Z0XA 1FPQA 4JYKA 3CJRB 5CJ9A 1NH3A 1BN5A 2HQ5A 1MBEA 1KZHA 1UZCA 1ZKGA 5GAEJ 4LMYA 3VEPA 2EV0A 3BZKA 4PGGA 4E7SA 4JP0A 3I58A 3HBLA 4BUPA 3HOYJ 4K2EA 4BQOA 4U7DA 2H27A 5C4JJ 2W25A 4E6KG 5CVRA 1Y6IA 4ZYAA 1H89C 5HDNA 1HKSA 2DTZA 4IHTA 2A5YB 3AG4H 3VFZA 4KYWA 4C30A 2ICWG 2JPCA 1MJ9A 4ZYEA 1TWFJ 4QPQA 4G7OF 3HHHA 5BPIA 2ELKA 2L7MP 2DOAA 4ZYGA 3KP2A 3KLNA 3MKZA 2R92J 3ABUA 2DDBA 1QPMA 3W2AA 2LSOA 1MIJA 5EEGA 2NYXA 2F6CA 2R7OA 5GP9A 3TP0A 4EM0B 2XB5A 3OYHA 3SDBA 1YO5C 3TW6A 1BW5A 4O6JA 1QGPA 3FK7A 2LOOA 1ZK8A 2L3DA 2VJJA 4LGWA 3V4GA 4XNFA 1O7FA 3I4NJ 1IV8A 5EJCA 3FXOA 1JJ8C 3H0GJ 4DW6A 1IRXA 5FLXK 4YFKF 3VSKA 2CQXA 2DYSH 2MFZA 1Y0UA 3M4OJ 2O3FA 2KPMA 1LFPA 1RESA 2JVHA 2V4JC 3U1DA 4BHCA 2VC0A 4I01A 1R5ID 4IRGA 2R5ZA 4KIBA 3S17J 4NNJA 3B73A 1TWHJ 4L9NA 4YIFA 3OYNA 4II3A 1LVAA 1R5HA 4XONA 3CDHA 5D6FA 2AXTC 5BOXA 1WJCA 1PJRA 3QPTA 4LG3A 3NARA 2MH2A 4GGGA 2DK5A 5GAGJ 1MMSA 2BBYA 3M8JA 3PIPF 4XKCA 1KA8A 3WTYC 3SDGA 4C3JJ 1BM9A 5FD5A 3C2GA 2OAZA 4HPQA 4B09A 1R1UA 1VQPI 5DCMB 2XIGA 2DK8A 2PJRA 3N97A 4UY8I 1KONA 2O6GE 2VI6A 2Z16A 2QVOA 2CQNA 4LK1F 3SFZA 2XAHA 4EJOA 1W7PA 4QIWN 3BDDA 3V7CA 1TW3A 4IRIA 4ESFA 3JSOA 2L9SA 3AKZA 1XSDA 2HGCA 2AHQA 3QP6A 2KDZA 2VXDA 4RAZA 2X48A 3ULQB 2DYRH 2M2EA 1T98A 3HOTA 2QA4I 2W1OA 4JOMA 3WGGA 1K6OA 1B9MA 3MD2A 4L9JA 4YIRX 3H3UA 2EPFA 2GAUA 4F91B 3FBNB 4MTDA 1OKRA 3LAPA 5FLMJ 4Z6YA 1TQPA 2VJ4A 2YUSA 3QU6A 4B48A 2XAUA 4W1UA 3CJNA 1VQKI 2DOFA 1UG2A 1R22A 1IF1A 4UUSB 2BHZA 2BVLA 2LNBA 3HB9A 2K4BA 4BQAA 4XL9A 3G4SI 4XLAA 5B5EC 4KMFA 3LSRA 5L3GA 4IHWA 1I27A 3GTOJ 5L3EA 2BW3B 5KK1A 3KEOA 2QBYA 1WH5A 1UJ8A 4XSZF 5M3MJ 5FLXZ 2OBPA 5KAFC 1BC7C 4XBFA 4AC0A 2E1OA 1Z7LA 2EFPA 5J1YA 5M5XJ 4FT8A 3BJAA 1O3RA 1QNTA 1FOKA 4RB0A 5C4XJ 2IEKA 5HS9A 2H8WA 3BWGA 1YJ9I 2UWMA 4MNUA 2XAFA 5FKLA 4E7IA 3EQLF 4HNVA 3CZ6A 3ESWB 2OU2A 2XAJA 4FISA 4EMSA 2JTVA 2Y48A 3KE2A 1P6RA 3OSGA 2L7ZA 5EEHA 3WTVC 3J80Z 2EIMH 2H09A 1IJWC 2R4GA 2FMYA 5DM6F 2FSWA 1VTNC 4ETSA 4BAYA 2A68F 5DDGA 1FMVA 4I76A 3A0HC 3C1DA 3LFKA 5CYVA 1P7JA 1RI7A 2G7HA 2VBXA 1JUPA 1JKOC 1D8KA 2E2HJ 2PMUA 2DT6A 1G2HA 5HOOA 2QQ8A 2EFNA 3AAFA 5IPAA 4RDUA 1IW7F 3K1MA 2OZ6A 1TC3C 3MWMA 3KCCA 3GTLJ 1E3PA 3S1QJ 2B63J 4XLNF 1GVJA 2PMHA 3FHNA 4HV6A 4I6ZA 1JKRC 2UXXA 5KHDA 2MC4A 2MLKA 1HOMA 2R7FA 1MMDA 3AG1H 2A6EF 3ZQCA 2A6HF 3B6CA 3A01A 2V9VA 5F0CA 1B72A 3VSLA 3AFHA 1XPXA 3VWBA 1LFBA 6PAXA 1FSEA 2BY0A 2UV1A 3BTJA 2K27A 4HA8A 3OL4A 1ODDA 4KNYA 2CFXA 1PDNC 3FKIJ 1U3EM 1LE8A 1TWCJ 2EV5A 4RB1A 1CGPA 4Y13A 1QO0D 1D5VA 1TNSA 1RUNA 4B43A 3VDXA 2CW7A 3DEEA 1FT9A 3T8RA 4M3BA 2DMNA 1IV6A 1S8NA 5H6RA 2WY8Q 5JVTA 3JAMK 4FX4A 4EJTA 2FNPA 1IRFA 4MLOA 4AIHA 4UV8A 1O57A 4OINF 5JVGF 3IAM2 3Q5FA 1RRJA 1OCTC 5FD6A 2ZKZA 3LFUA 1OCOH 4EJVA 3I59A 3L2CA 2G9WA 1MBKA 5FLVA 1SD5A 3DQVC 4NB5A 5DTDA 1QQIA 3KP7A 4XRSA 1XD7A 2FOWA 2FQ4A 2ME6A 2ZJQF 1J09A 1FOXA 2V9KA 5JR3A 1HQCA 1RPWA 1T08B 1V55H 5IYDJ 3FMSA 4RAFA 1H8AC 2KZGA 3H0DA 2OCEA 1I1SA 4FTHA 4EGZA 2UXNA 3KP4A 2R5YA 2BXYA 4ZC3A 2LTPA 3FBIB 3HZJA 2GOXB 3QOPA 3ERMA 1HA8A 3T8TA 3CD6I 3WE2A 3KEQA 2XGCA 2YS9A 1FOWA 3ZMDA 1IUFA 3RKQA 5HLHA 4HNUA 5D8LB 1WWXA 5EYRA 1MZBA 4I0BA 1TP4A 4XN0A 2Z99A 2LBFA 2MBFA 2LMDA 3CC4I 1SFKA 1D1AA 4A2UA 3OYBA 2KL4A 3SXYA 4DZJA 1T56A 3ZPLA 2BY2A 4HW0A 2VONA 2EA2A 3BJOA 5EDNA 1ZLJA 1R49A 1ZAOA 1ZGAA 2LF7A 2LKXA 1FLIA 1KYZA 3CLOA 5LRRA 3OR1C 3JTGA 4A3LJ 1EV7A 2CWEA 3PQJA 1RNLA 3TO7A 3DEWA 1DQUA 1MW7A 1VQ5I 2MD0A 3RQ4A 1MDMA 4FETA 3ZR8X 1L0OC 1OQYA 3ZQHA 4Q47A 1MBGA 3A03A 1Q1VA 2H94A 3KFWX 4LG0A 1W4MA 1V5GA 9ANTA 1U5TC 3V7RA 3G73A 1XGNA 3I53A 3GZ5A 2VKHA 4FQGA 2M8GX 3ZMTA 3HSEA 4M6YA 1ZN2A 1YIOA 2R7ZJ 1FP2A 3H5NA 3B6AA 1VF9A 1UAAA 2HOTA 3JAMZ 3O6BB 3MFKA 1GXQA 1K4SA 2X1EA 4ZZDA 2LYCA 3BJ6A 2HS5A 2X4HA 4V2FA 2CFOA 3ECHA 2VLAA 3CTAA 1ZYRF 2LG4A 2XPUA 4ANJA 4CXFA 3BR0A 3DXJF 2VPRA 3W6KB 1YW8A 2L9NA 3BOQA 4A3KJ 2FMLA 4XN3A 3E5QA 3O8GA 3IAS2 3T5XA 4BXXJ 4NC8A 1YJWI 3MZYA 1LB2A 2L7KA 1DDNA 1NK3P 2PJPA 1BBYA 1MBJA 2OF7A 4LLLA 1PP8F 1R00A 3WG7H 5HNHA 2D1VA 2I10A 1JKQC 2HKXA 5E1WA 1Z3YA 1T0FC 4XOPA 2J5PA 3RYRA 4P55A 3ZMVA 5IP6A 1I39A 3GX4X 2M87A 4BY1J 2HXOA 4UVAA 1KU2A 4C2TA 2E5NA 2NAZA 2L4AA 3PJRA 3EPZA 4M72A 3BG3A 1IXCA 2KKOA 2O03A 3GLXA 5B3SH 2RREA 3L2WA 2E35A 4UV9A 1OR7C 2X6YA 4D7NA 5LEJA 3ASOH 1AHDP 3OYJA 1YX3A 4HDUA 5J6XA 2RNJA 5JHFA 2JWTA 1U5TB 3FXKA 3NWTA 5F0FA 2R7RA 3S3NA 1D5YA 3FXMA 2E1CA 2XF7A 2JA7J 2OTJI 1Z9CA 3TOAA 3S1MJ 1F1ZA 2E7WA 1A31A 4KICA 1N78A 2HOAA 3WODF 1BJAA 1HXDA 4KN7X 3KLOA 3ZN0A 1XMAA 2HTJA 2QQBA 2F5CA 3CUOA 5D6EA 3U1KA 2CW8A 1S9HA 3LQRA 3MMYB 4GDFA 3P7NA 3M3YJ 1BI2A 2VKVA 3CCJI 1LJ9A 2L01A 2V9PA 1LEBA 1VQ8I 2XSJC 2FX0A 3HUGA 3RDIA 2VOOA 4LLGF 4NC6A 1K78B 2DXIA 2X1CA 2G7UA 1YW7A 4C2UA 5FRNA 5J3LA 1FTZA 2F5EA 4BEHA 4EJWA 1GXPA 4A6DA 4B8XA 1LDJA 3GEZA 2NNYA 4M3FA 3B02A 4CCLA 3R0JA 5ILUA 4U0WA 3M1EA 2JVGA 3OYCA 5HODA 4FE4A 3IWZA 4RB2C 1MSFC 5HDGA 1USSA 2HQNA 2W48A 2P0WA 1O3QA 4C3HJ 2Z2SB 3J7ZI 4ENNA 2QYOA 2VASA 4M6XA 4G9YA 5A2QZ 2ZJRF 2GXBA 2Z9OA 2HTSA 5H6QA 2DFEA 3WHBA 2FBHA 4GRIA 3HKZA 3UKGA 1SFEA 1DUXC 2CGPA 3S14J 4UVBA 3VB2A 4G6TB 1H0MA 3ZMSA 1SEUA 2A3SA 3DPUA 4C2MJ 1OLTA 3G3ZA 1MSEC 2QF7A 4IZZA 3L00A 2V6EA 4KIGA 4QWQA 4DNCA 4EM1A 1OCZH 4BJ6C 3MZHA 3QOEA 3D0SA 2XVCA 5CQGA 3DCFA 4ESJA 4BYYA 3PUBA 5CVJA 2DO7A 2Q2EA 1V4RA 3GLLA 4BJTA 4JX5A 4U88A 3GYHX 2X0LA 4HBLA 4HQEA 4PDKA 1VZ0A 3OYLA 3RTRA 1X1AA 5EGOA 2PN6A 3PFIA 2HVSA 4KMUX 1G6NA 1P4WA 2R7QA 2FRHA 3KEYA 3OIOA 3AG2H 2EA4A 1V54H 4XLCA 5ICFA 1W5SA 2A69F 2DPUA 2L9VA 5M5YJ 2P7CB 1Q1HA 2FUG2 2EFQA 5CVVA 3PNTA 5D5VB 2BV6A 4HDVA 2VODA 4EV0A 2KJBA 5EG0A 4Y3OA 5AIPA 4WF2A 4IJAA 5CLSA 3F6OA 1GVDA 4IL6C 2BZTA 1EH7A 2HZTA 2WB1N 4HAMA 2ISZA 2GOMA 2VJ5A 2GM4A 1W5CC 2ZC2A 3GF2A 4L0YB 1WZ2A 3WTWC 2V1XA 3I9V2 3SEZA 4MFEA 4II2A 3EUHA 2LKPA 3OL3A 1D0XA 1G3TA 2YX4A 3KZYA 2CUJA 1IXSB 3BR2A 3LMMA 2PLYA 1X4PA 2BYVE 2PX9A 3BROA 2IBDA 1POGA 2RN7A 2ZMEC 1OYIA 2ZSIB 2FA5A 3BR3A 3HJEA 3F21A 4A3GJ 3C3WA 5CKTA 2IXSA 1XTAA 1YS7A 1V5FA 1PYVA 3PNVA 4M3EA 1IDZA 2CH0A 2COMA 3M1CA 3BPVA 5GPAA 2TDXA 1S3JA 3PL8A 5HVQC 1K83J 1ON2A 4EATA 4X6AJ 2IS2A 3BP8A 5BQTA 1I50J 2NRAC 5L3FA 4PK4A 2F5FA 3MVPA 1YLFA 2QKLB 2TRTA 1LUJB 2XAQA 1BOBA 3CMAI 1FWZA 2E7XA 4M9XA 4IKFA 1SAUA 1U0JA 3SZGA 3EYIA 1JKPC 4NUBA 4CCJA 3RJPA 1R5GA 3CDLA 3ZN1A 1BOAA 4U0YA 2H1LA 4O3MA 3IRRA 1LNWA 2W82A 2XF5A 1PP7U 3TGNA 5IY5H 1MMGA 1WI3A 2FU4A 4HLXA 4HNTA 5DD8A 4OWRB 3DV8A 1V5EA 3RCOA 2L9RA 3SYTA 3SJMA 4Q48A 3WU1B 3F3XA 1Z67A 1ZRDA 2RV8A 4OIPF 4IOAF 2L4MA 1J75A 1UB9A 2GZWA 3KZZA 2HQRA 2L02A 1J2XA 1P4AA 1B4AA 1R36A 5IYBJ 2LF8A 4E7ZA 5K5QA 3N05A 1HLVA 2M45A 4S05A 1ERDA 1XCVA 3S2WA 4E7JA 3RPUD 1YYVA 3G71I 3OIPA 3WHCA 4KISA 2XAGA 2DOEA 3CUQC 3AL0C 2XDVA 2KFDA 4PSWA 5E8GA 2ZMEB 3SEQA 3GTGJ 2CG4A 3COAC 3LSGA 1Y1VJ 1IN6A 5J1RA 1SMYF 3S1NJ 3WU2C 1HW2A 1QBJA 4IHSA 4D5FA 5DCFA 3ROUA 3FK6A 3J7AY 1OYWA 3RSNA 4C3IJ 3VPRA 1P4XA 4RGRA 1Y1WJ 1B8IA 3I4MJ 3OYGA 1E3HA 2RAEA 1W0UA 2KIMA 2Y9ZA 2O5RA 1DPUA 2I5UA 4F52A 1W1WE 1Y0NA 1MMAA 1WFXA 2CMPA 4CSWA 2QUFA 2K9SA 2NOGA 4OAYA 1R7JA 1H88C 1RKWA 2VE9A 5ILSA 3FWEA 4MEYF 2R5ZB 1TNTA 1K61A 2EBIA 3S3MA 2HQAA 3MEXA 3KYDB 5DCMA 1ZRCA 2VN2A 3GTKJ 3BY6A 5ED4A 3JCUC 3PQKA 3LSTA 2FOKA 3CJQB 1XX5A 4IOCF 1SAXA 3J7AO 1U9NA 2DMTA 3FXJA 3BQZA 4IPAA 1PUEE 1DGRM 2MSYA 3GWZA 3W6JB 4WXHA 2IAIA 2VBYA 5J4VA 1OCRH 3BCAA 1OFCX 2W4SA 2F4MB 5DEQA 4WX9A 1I5ZA 2D5VA 4CCNA 1C0WA 3NEUA 3I4PA 3FXRA 5FKOA 3ZQGA 1FIPA 5IP7J 4CICA 3GMEA 3BG6A 2RKHA 3GXOA 1U8RA 3CUQB 3AL0B 3G1LA 1YFHA 2D2WA 1Y56A 2C6YA 1RC9A 4XK4A 4Y15A 3UR3C 1IXRC 2VPLA 3SHFA 3ZQQA 1JHHA 2HKOA 2ZFUA 3PFYA 1WCMJ 2ZFWA 3ABKH 3GFJA 2R7TA 4UUSA 3K1PA 3JRAA 1BIBA 1GDTA 1FY7A 3OR2C 1I3QJ 2IA2A 4I98B 5BS6A 2VUMJ 1ZGWA 1P2FA 4R79A 5HLIA 1IN7A 2Y0MA 1HDDC 5ICGA 1U8BA 4F7ZA 4DBQA 4YG2F 2K02A 5L3DA 4BQNA 2WV1A 4RS8A 4XMYA 2LY9A 1H9GA 2JMWA 3ZQIA 4BU2A 1CF7B 1G3WA 4JK1X 2BW3A 2MYSA 1Z05A 3BZCA 4A6EA 1U78A 1XGSA 3REOA 2Y9YA 2DQRA 4P9UA 2WY7Q 4BXFA 1LQ1A 2Y30A 5J8CA 2K86A 2Y2ZA 3DTIA 4PSXA 2M3AA 4NQWA 3FHZA 4MFDA 4HZFA 3HSRA 1LFUP 1NG7A 3CF5F 1ETVA 3TOBA 3Q0VA 1BR4A 3DPTA 3F8NA 1N77A 1YQAA 4KJZA 1SD7A 1HW5A 2R7SA 4XLEA 4ASNA 1UELB 5K1YA 2TCTA 3DFGA 2G0EA 1YRNA 4G12A 1R4NB 4HV5A 3I0TA 3IV5A 3E6DA 1YI2I 5B1AH 1FMWA 3L2VA 2L0KA 2CO5A 2KMUA 1JGGA 2OV7A 2NXNB 3DU6A 2MGQA 1BIAA 2AO9A 1WJEA 3Q3SA 4XM3A 2JUGA 4J01A 2CS3A 3LWFA 1MBHA 1ETWA 3ECOA 4M3DA 3NWSA 1MH3A 2QEXI 3K0LA 4BE2A 1MD0A 3DTEA 4HSTA 4ZH4F 1X3ZB 3K70D 1PVEA 4XIDA 5KAIC 1SC7A 2ZNYA 3R6SA 4YELA 3IKVA 2P8TA 4XLHA 4GFBA 2OZUA 4Y33A 1EKEA 4PUSA 3U21A 3TDUC 2VJIA 2PEXA 2M0MA 2NVUB 3L2QA 3ZQLA 3WTZA 1ETXA 4AD9A 4U7BA 1FJLA 3S1RJ 3CDIA 4UB8C 5FKKA 4XLFA 2Z5UA 4B3AA 1Z6RA 5GPCA 2M34A 5DD4A 2FXAA 1B6AA 3GFLA 5F1RA 2CUFA 4HX4A 3H9JA 2DA7A 2LK2A 3ABMH 2KIQA 1B72B 1QZZA 1RR7A 1TLHB 2YX7A 4I99C 1WRJA 3CCVI 5HLGA 3H5RA 4IEJA 2DCEA 1JI8A 1R1VA 2R7WA 2AQEA 2ID3A 3LSMA 5FB2A 3NQOA 3C18A 3PNYA 3QP5A 3R61A 3OSFA 3HRSA 3GZ6A 5LGTA 3HOVJ 3D5RC 5B66C 2HOSA 2R7UA 3HIFA 4EEFG 1BI0A 1VQMI 1I1GA 3P9KA 2M9HA 4ZZLA 1A6QA 1P9QC 3DF8A 2HDDA 4AWXB 1Z3XA 3W6VA 2K7LA 2VKDA 4F3QA 3BTCA 1G3YA 4A3DJ 3K4NA 3HRUA 4R1HA 2DAOA 2KP6A 4IHYA 1LPQA 1A6IA 3S93A 4V19K 1Z6TA 1KGSA 4E4HA 1IO2A 1ZRFA 1ZR4A 2QENA 2ME0A 1HKQA 4N9IA 2VB6A 4N4OB 4PZJA 1E0EA 3P5JA 3J81K 3FKJA 4BBRJ 5M3FJ 1IAWA 1I6HJ 4Z2YA 2YR2A 1CQTA 1FIAA 2P4WA 1E3OC 2DT7B 1R9TJ 2HPMA 3HDDA 3KX2A 4IQJA 5F64A 2Q0OA 3ZRGA 1W36C 1R23A 5K5OA 4IQ4A 4P5OA 4FHTA 2O9LA 2K85A 1GUUA 2JUCA 4TV7A 1DU6A 1F43A 4BY7J 3CC2I 3J7YJ 3F23A 4CH7A 2R5YB 2AXLA 2QGUA 4XRFA 1I3AA 1MGTA 5E20A 4N9HA 2ZXWH 2D45A 1EJ9A 2K9MA 3CCUI 2XSDC 2E36A 3TW7A 5B1BH 3H3VK 4CZCA 1IGNA 2P5VA 1ITYA 1PUFA 1ENHA 4OIQF 5LRSA 3HGGA 2FBKA 3RZDJ 5HS7A 2Y0SN 2ZBKA 3R0AA 1YITI 1APLC 3BTIA 3KETA 3M8EA 4HQMA 2PI0A 4HRIA 1BR2A 1IUYA 4RA2A 3L7WA 1EF4A 2PBIA 3LSKA 3H92A 2HYJA 3Q9VA 2KRCA 1ZG1A 1RR8C 2RNGA 1UG0A 3FDYA 4HLYA 5JHUA 3H3ZA 2ADUA 4HEA2 2NVYJ 2EFWA 3VYRB 3H36A 1E2XA 2E60A 4GO1A 3H35A 3S2DJ 1HSJA 3I5UA 2Y0SA 1ETYA 3GTMJ 1VI0A 2FQ3A 4OIOF 4MQVA 3GVAA 3DU5A 2DQLA 5HDKA 4KN4X 3HRTA 4LB6B 1WGXA 5LGUA 3C7JA 1Y39A 2X51A 1XMXA 1QHHD 3WTUC 1U9OA 3K4BA 2CV1A 2WAEA 1XS9A 1UHSA 4QSHA 2NOJB 4YRVA 2IPQX 3BCBA 3IP4B 2VKEA 3W2VA 3A1YA 2W84A 3GTQJ 3V7SA 4I2OA 2XPWA 3HPGA 3MAJA 3E97A 3F9KA 2PQ8A 2BY1A 2K9NA 3ZGKA 1V3FA 3WG9A 4EJUA 1FBUA 1YOVB 3GCMA 1SFXA 3OMYA 1AKHB 4I7HA 2QZ8A 4BE1A
chains in the Genus database with same CATH topology
3A01B 5IOYA 2E19A 3NARA 3OIOA 2LP0A 2NVQJ 1X2MA 2Y31A 3BG9A 5FKNA 3HEFA 3SDGA 4DYRA 5E3MA 5M5YJ 4C3JJ 3MKLA 3HOUJ 3MN2A 3F0CA 4DZPA 4LOCA 1LE8B 4A93J 5EG0A 2HI3A 2VI6A 4A69C 4B4CA 5F1JA 1GVDA 2CUEA 1DU0A 3OOUA 4DYCA 2WB1N 3RZOJ 5FJ8J 4QIWN 3CMYA 4CYCB 1OCPA 2GM4A 4AYBN 5EZGA 5K7HA 5JLXA 1OJLA 4L5EA 1BL0A 3HM5A 2AHQA 4MFEA 2KDZA 4ABZA 1FEXA 2R0QC 3BT9A 2X48A 1TWGJ 2DA5A 2M2EA 3BR2A 1W0TA 2IBDA 1POGA 5EZHA 4A3GJ 3BR3A 4Y7NJ 1GT0C 3BR5A 3JRBA 4M3EA 1IDZA 5FLMJ 5F08A 3ZOBA 2YUSA 5GPAA 1K83J 4W1UA 1UG2A 4X6AJ 1I50J 4UUSB 2QCOA 5C3EJ 1SFOJ 3MVPA 3HB9A 3QPLA 2TRTA 2DMPA 5C44J 1IC8A 3FISA 3LSRA 4IHWA 1P7IA 4MIMA 4J19A 3GTOJ 2EZHA 1JKPC 3CDLA 2EH3A 2M0CA 1WH5A 1ZTRA 3O8HA 2ZB9A 5M3MJ 3IH3A 4AC0A 2E1OA 5J1YA 5M5XJ 1WI3A 1JTXA 1VNDA 1T33A 4A3FJ 2L9RA 3SJMA 5C4XJ 1ETOA 2IEKA 2MG4A 3JRIA 5IOZA 4V2GA 2DN0A 2K9QA 5FKLA 5M5WJ 4HNVA 3JRDA 1PUFB 1HDPA 4FISA 5IYBJ 1HLVA 1WH7A 1MH4A 3PO3J 3OSGA 2L7ZA 4Y52J 2JN6A 3HOXJ 1IJWC 2JK3A 2NVTJ 2MW8A 3WHCA 4FCYA 2DA3A 3S2HJ 2CQQA 5EEAA 5E3OA 4I76A 5F0HA 3GTGJ 1BJZA 3HGYA 1P7JA 1Y1VJ 3LSGA 5J1RA 2XRLA 5K7ZA 1JKOC 1JUPA 3S1NJ 2E2HJ 4D5FA 5J1UA 3FK6A 1G2HA 2H8RA 4C3IJ 3VPRA 3JREA 5IPAA 4RDUA 1Y1WJ 1B8IA 3I4MJ 1TC3C 2RAEA 1W0UA 3GTLJ 3S1QJ 2Y9ZA 2B63J 2EQRA 4I6ZA 2JA5J 3PM1A 1JKRC 1VFCA 2X9DA 4UUTA 1JJ6C 1HOMA 1AKHA 5F27A 3ZQCA 1JT6A 2K9SA 1F36A 4A3IJ 3B6CA 2NOGA 1H88C 3A01A 1XC5A 5F0CA 1RKWA 1B72A 4DYQA 2CRGA 1LFBA 2R5ZB 3BTJA 1X58A 3LSJA 1K61A 2EBIA 4M3GA 5EGOB 2HXIA 1RKTA 4W97A 3FIWA 3FKIJ 3G1MA 2DMQA 1LE8A 1TWCJ 1GV5A 4XRSG 2NVXJ 3GTKJ 4RBOA 3K2AA 2DA6A 2JA6J 2PMZN 1U9NA 2DMTA 3BQZA 1QRYA 3BR1A 4CYCA 2MSYA 4M3BA 2DMNA 1IV6A 2IAIA 2EZLA 1OFCX 2D5VA 4A3BJ 1TWAJ 2XGDA 4MLOA 3S16J 3QPSA 4B1RA 5FKOA 3ZQGA 1FIPA 2NS8A 5F04A 5IP7J 4M6VA 1OCTC 1Z77A 2LR8A 1MNMC 3G1LA 3L1PA 1IRZA 1MBKA 5FLVA 5DTDA 4XK4A 4XRSA 3A02A 2ME6A 2FQ4A 3PO2J 3RQIA 4JX4A 2XB0X 2N8GA 2X6OA 5EF6A 1IG7A 1RPWA 2LFBA 1WCMJ 5IYDJ 4A3JJ 1H8AC 3K7AJ 3JR9A 4UUSA 3IH4A 4FTHA 1GDTA 3JRAA 1I3QJ 2VUMJ 2R5YA 1ZGWA 2LTPA 5FKMA 1HDDC 3ZQFA 1JUSA 3GTJJ 1U8BA 2NS7A 2WV1A 2LY9A 2YU9J 2XGCA 2JMWA 2YS9A 3ZQIA 1IUFA 3RKQA 4BBSJ 3QQAA 1HCRA 1U78A 5EYRA 2Y9YA 5E3LA 2O8KA 2Y30A 4DZJA 1T56A 1AU7A 2E2IJ 1A5JA 1GV2A 2Y2ZA 4D7MA 5EDNA 3Q0UA 4MFDA 2LKXA 1LFUP 3HKZN 1ETVA 5K7FA 3Q0VA 4A3LJ 4BKXA 3DEWA 2TCTA 2G0EA 1YRNA 5IYCJ 1RETA 4JX6A 4G12A 3BQYA 1BW6A 1ETKA 3IV5A 2COBA 3ZQHA 1MBGA 3A03A 1Q1VA 2L0KA 2EZKA 3BG5A 1JGGA 9ANTA 3Q0WA 5E3NA 4A3EJ 2MGQA 4IHVA 2AO9A 2K40A 3Q3SA 1MBFA 1MBHA 2M8GX 4MO7A 3JRHA 1ETWA 1NTCA 4M3DA 5JLWA 1MH3A 2R7ZJ 3LNQA 3B6AA 1VF9A 2HOTA 3HOZJ 3JRFA 4XIDA 3G1OA 5IP9J 4V2FA 4GFBA 2XPUA 3BR0A 2VPRA 1QVUA 3JRGA 1ZR2A 1B8IB 4A3MJ 3ZQLA 1ETXA 4A3KJ 2E2JJ 1FJLA 3S1RJ 5FKKA 3TP3A 1FTTA 3O8GA 2ECCA 1HF0A 2DMUA 2ID6A 2JJ7A 4B3AA 2DA2A 5GPCA 2M34A 4BXXJ 2XPVA 4FE7A 1NK3P 3LOCA 1MBJA 2CUFA 2LD5A 2OF7A 2DA7A 2KT0A 2LK2A 3JRCA 1B72B 1RR7A 2CJJA 2I10A 1JKQC 1JT0A 4IEJA 2XGEA 5DS9A 1BA5A 3CCYA 1XG1A 2GLOA 2LLKA 3C2BA 5IP6A 2ID3A 4NDLA 2EZIA 4BY1J 2GBYA 2HXOA 5EG0B 3OSFA 4A3CJ 3HOVJ 2HOSA 2DJNA 4EEFG 4XICA 3LSPA 3BG3A 2M9HA 3IH2A 4D7NA 4D5CA 1NK2P 2HDDA 1AHDP 2H1KA 3W6VA 4AUXA 3S15J 2L7FP 2OPTA 3BTCA 4A3DJ 1JTYA 1IDYA 2JWTA 3GBGA 3E7LA 5F0FA 3TEDA 2LVSA 1D5YA 4IHYA 1A6IA 2JA7J 1JUMA 1X2NA 1S7EA 1ZR4A 3S1MJ 2ME0A 3BR6A 1ORKA 5M3FJ 2O7OA 2P81A 4BBRJ 1I6HJ 2HOAA 1CQTA 1FIAA 1E3OC 1R9TJ 3SFIA 3HDDA 2DA1A 1UMQA 3M3YJ 1WPKA 1Z0XA 2VKVA 4JYKA 5BNGA 2O9LA 1GUUA 2HQ5A 1MBEA 1DU6A 2FX0A 1ZKGA 1F43A 4BY7J 2R5YB 1O4XA 4JP0A 5J3LA 1FTZA 3HBLA 1SANA 3HOYJ 2XSDC 5C4JJ 3TW7A 4M3FA 3H3VK 1H89C 2DTZA 2CU7A 1IGNA 5HODA 1ITYA 1PUFA 1ENHA 4FE4A 3HGGA 3RZDJ 1MSFC 2Y0SN 2W48A 1TWFJ 2FD5A 4C3HJ 3D1NI 1APLC 3BTIA 3NAUA 4QTRA 1EF4A 4X1EA 2ELKA 2L7MP 2HYJA 3WHBA 1ZQ3P 2R92J 3UKGA 2NVYJ 3S14J 5GP9A 2FJ1A 3TP0A 2JA8J 2XB5A 3S2DJ 3TW6A 1BW5A 1ETYA 3GTMJ 1YRNB 2WAQN 4C2MJ 1VI0A 3FK7A 1ZK8A 1MSEC 2QF7A 3HOWJ 2DA4A 3BTLA 1WGXA 3I4NJ 2R93J 3CQZJ 1JJ8C 3H0GJ 1QVTA 1U9OA 4S0HB 4DW6A 1XS9A 1UHSA 4QSHA 2ECBA 2CQXA 3DCFA 3M4OJ 2VKEA 3GTQJ 4IHXA 3GTPJ 2XPWA 1RESA 1QPIA 3S17J 2R5ZA 1ETQA 2K9NA 4JX5A 1TWHJ 5EGOA 1AKHB 4XRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A01 B;  5IOY A;  2E19 A;  3NAR A;  3OIO A;  2LP0 A;  2NVQ J;  1X2M A;  2Y31 A;  3BG9 A;  5FKN A;  3HEF A;  3SDG A;  4DYR A;  5E3M A;  5M5Y J;  4C3J J;  3MKL A;  3HOU J;  3MN2 A;  3F0C A;  4DZP A;  4LOC A;  1LE8 B;  4A93 J;  5EG0 A;  2HI3 A;  2VI6 A;  4A69 C;  4B4C A;  5F1J A;  1GVD A;  2CUE A;  1DU0 A;  3OOU A;  4DYC A;  2WB1 N;  3RZO J;  5FJ8 J;  4QIW N;  3CMY A;  4CYC B;  1OCP A;  2GM4 A;  4AYB N;  5EZG A;  5K7H A;  5JLX A;  1OJL A;  4L5E A;  1BL0 A;  3HM5 A;  2AHQ A;  4MFE A;  2KDZ A;  4ABZ A;  1FEX A;  2R0Q C;  3BT9 A;  2X48 A;  1TWG J;  2DA5 A;  2M2E A;  3BR2 A;  1W0T A;  2IBD A;  1POG A;  5EZH A;  4A3G J;  3BR3 A;  4Y7N J;  1GT0 C;  3BR5 A;  3JRB A;  4M3E A;  1IDZ A;  5FLM J;  5F08 A;  3ZOB A;  2YUS A;  5GPA A;  1K83 J;  4W1U A;  1UG2 A;  4X6A J;  1I50 J;  4UUS B;  2QCO A;  5C3E J;  1SFO J;  3MVP A;  3HB9 A;  3QPL A;  2TRT A;  2DMP A;  5C44 J;  1IC8 A;  3FIS A;  3LSR A;  4IHW A;  1P7I A;  4MIM A;  4J19 A;  3GTO J;  2EZH A;  1JKP C;  3CDL A;  2EH3 A;  2M0C A;  1WH5 A;  1ZTR A;  3O8H A;  2ZB9 A;  5M3M J;  3IH3 A;  4AC0 A;  2E1O A;  5J1Y A;  5M5X J;  1WI3 A;  1JTX A;  1VND A;  1T33 A;  4A3F J;  2L9R A;  3SJM A;  5C4X J;  1ETO A;  2IEK A;  2MG4 A;  3JRI A;  5IOZ A;  4V2G A;  2DN0 A;  2K9Q A;  5FKL A;  5M5W J;  4HNV A;  3JRD A;  1PUF B;  1HDP A;  4FIS A;  5IYB J;  1HLV A;  1WH7 A;  1MH4 A;  3PO3 J;  3OSG A;  2L7Z A;  4Y52 J;  2JN6 A;  3HOX J;  1IJW C;  2JK3 A;  2NVT J;  2MW8 A;  3WHC A;  4FCY A;  2DA3 A;  3S2H J;  2CQQ A;  5EEA A;  5E3O A;  4I76 A;  5F0H A;  3GTG J;  1BJZ A;  3HGY A;  1P7J A;  1Y1V J;  3LSG A;  5J1R A;  2XRL A;  5K7Z A;  1JKO C;  1JUP A;  3S1N J;  2E2H J;  4D5F A;  5J1U A;  3FK6 A;  1G2H A;  2H8R A;  4C3I J;  3VPR A;  3JRE A;  5IPA A;  4RDU A;  1Y1W J;  1B8I A;  3I4M J;  1TC3 C;  2RAE A;  1W0U A;  3GTL J;  3S1Q J;  2Y9Z A;  2B63 J;  2EQR A;  4I6Z A;  2JA5 J;  3PM1 A;  1JKR C;  1VFC A;  2X9D A;  4UUT A;  1JJ6 C;  1HOM A;  1AKH A;  5F27 A;  3ZQC A;  1JT6 A;  2K9S A;  1F36 A;  4A3I J;  3B6C A;  2NOG A;  1H88 C;  3A01 A;  1XC5 A;  5F0C A;  1RKW A;  1B72 A;  4DYQ A;  2CRG A;  1LFB A;  2R5Z B;  3BTJ A;  1X58 A;  3LSJ A;  1K61 A;  2EBI A;  4M3G A;  5EGO B;  2HXI A;  1RKT A;  4W97 A;  3FIW A;  3FKI J;  3G1M A;  2DMQ A;  1LE8 A;  1TWC J;  1GV5 A;  4XRS G;  2NVX J;  3GTK J;  4RBO A;  3K2A A;  2DA6 A;  2JA6 J;  2PMZ N;  1U9N A;  2DMT A;  3BQZ A;  1QRY A;  3BR1 A;  4CYC A;  2MSY A;  4M3B A;  2DMN A;  1IV6 A;  2IAI A;  2EZL A;  1OFC X;  2D5V A;  4A3B J;  1TWA J;  2XGD A;  4MLO A;  3S16 J;  3QPS A;  4B1R A;  5FKO A;  3ZQG A;  1FIP A;  2NS8 A;  5F04 A;  5IP7 J;  4M6V A;  1OCT C;  1Z77 A;  2LR8 A;  1MNM C;  3G1L A;  3L1P A;  1IRZ A;  1MBK A;  5FLV A;  5DTD A;  4XK4 A;  4XRS A;  3A02 A;  2ME6 A;  2FQ4 A;  3PO2 J;  3RQI A;  4JX4 A;  2XB0 X;  2N8G A;  2X6O A;  5EF6 A;  1IG7 A;  1RPW A;  2LFB A;  1WCM J;  5IYD J;  4A3J J;  1H8A C;  3K7A J;  3JR9 A;  4UUS A;  3IH4 A;  4FTH A;  1GDT A;  3JRA A;  1I3Q J;  2VUM J;  2R5Y A;  1ZGW A;  2LTP A;  5FKM A;  1HDD C;  3ZQF A;  1JUS A;  3GTJ J;  1U8B A;  2NS7 A;  2WV1 A;  2LY9 A;  2YU9 J;  2XGC A;  2JMW A;  2YS9 A;  3ZQI A;  1IUF A;  3RKQ A;  4BBS J;  3QQA A;  1HCR A;  1U78 A;  5EYR A;  2Y9Y A;  5E3L A;  2O8K A;  2Y30 A;  4DZJ A;  1T56 A;  1AU7 A;  2E2I J;  1A5J A;  1GV2 A;  2Y2Z A;  4D7M A;  5EDN A;  3Q0U A;  4MFD A;  2LKX A;  1LFU P;  3HKZ N;  1ETV A;  5K7F A;  3Q0V A;  4A3L J;  4BKX A;  3DEW A;  2TCT A;  2G0E A;  1YRN A;  5IYC J;  1RET A;  4JX6 A;  4G12 A;  3BQY A;  1BW6 A;  1ETK A;  3IV5 A;  2COB A;  3ZQH A;  1MBG A;  3A03 A;  1Q1V A;  2L0K A;  2EZK A;  3BG5 A;  1JGG A;  9ANT A;  3Q0W A;  5E3N A;  4A3E J;  2MGQ A;  4IHV A;  2AO9 A;  2K40 A;  3Q3S A;  1MBF A;  1MBH A;  2M8G X;  4MO7 A;  3JRH A;  1ETW A;  1NTC A;  4M3D A;  5JLW A;  1MH3 A;  2R7Z J;  3LNQ A;  3B6A A;  1VF9 A;  2HOT A;  3HOZ J;  3JRF A;  4XID A;  3G1O A;  5IP9 J;  4V2F A;  4GFB A;  2XPU A;  3BR0 A;  2VPR A;  1QVU A;  3JRG A;  1ZR2 A;  1B8I B;  4A3M J;  3ZQL A;  1ETX A;  4A3K J;  2E2J J;  1FJL A;  3S1R J;  5FKK A;  3TP3 A;  1FTT A;  3O8G A;  2ECC A;  1HF0 A;  2DMU A;  2ID6 A;  2JJ7 A;  4B3A A;  2DA2 A;  5GPC A;  2M34 A;  4BXX J;  2XPV A;  4FE7 A;  1NK3 P;  3LOC A;  1MBJ A;  2CUF A;  2LD5 A;  2OF7 A;  2DA7 A;  2KT0 A;  2LK2 A;  3JRC A;  1B72 B;  1RR7 A;  2CJJ A;  2I10 A;  1JKQ C;  1JT0 A;  4IEJ A;  2XGE A;  5DS9 A;  1BA5 A;  3CCY A;  1XG1 A;  2GLO A;  2LLK A;  3C2B A;  5IP6 A;  2ID3 A;  4NDL A;  2EZI A;  4BY1 J;  2GBY A;  2HXO A;  5EG0 B;  3OSF A;  4A3C J;  3HOV J;  2HOS A;  2DJN A;  4EEF G;  4XIC A;  3LSP A;  3BG3 A;  2M9H A;  3IH2 A;  4D7N A;  4D5C A;  1NK2 P;  2HDD A;  1AHD P;  2H1K A;  3W6V A;  4AUX A;  3S15 J;  2L7F P;  2OPT A;  3BTC A;  4A3D J;  1JTY A;  1IDY A;  2JWT A;  3GBG A;  3E7L A;  5F0F A;  3TED A;  2LVS A;  1D5Y A;  4IHY A;  1A6I A;  2JA7 J;  1JUM A;  1X2N A;  1S7E A;  1ZR4 A;  3S1M J;  2ME0 A;  3BR6 A;  1ORK A;  5M3F J;  2O7O A;  2P81 A;  4BBR J;  1I6H J;  2HOA A;  1CQT A;  1FIA A;  1E3O C;  1R9T J;  3SFI A;  3HDD A;  2DA1 A;  1UMQ A;  3M3Y J;  1WPK A;  1Z0X A;  2VKV A;  4JYK A;  5BNG A;  2O9L A;  1GUU A;  2HQ5 A;  1MBE A;  1DU6 A;  2FX0 A;  1ZKG A;  1F43 A;  4BY7 J;  2R5Y B;  1O4X A;  4JP0 A;  5J3L A;  1FTZ A;  3HBL A;  1SAN A;  3HOY J;  2XSD C;  5C4J J;  3TW7 A;  4M3F A;  3H3V K;  1H89 C;  2DTZ A;  2CU7 A;  1IGN A;  5HOD A;  1ITY A;  1PUF A;  1ENH A;  4FE4 A;  3HGG A;  3RZD J;  1MSF C;  2Y0S N;  2W48 A;  1TWF J;  2FD5 A;  4C3H J;  3D1N I;  1APL C;  3BTI A;  3NAU A;  4QTR A;  1EF4 A;  4X1E A;  2ELK A;  2L7M P;  2HYJ A;  3WHB A;  1ZQ3 P;  2R92 J;  3UKG A;  2NVY J;  3S14 J;  5GP9 A;  2FJ1 A;  3TP0 A;  2JA8 J;  2XB5 A;  3S2D J;  3TW6 A;  1BW5 A;  1ETY A;  3GTM J;  1YRN B;  2WAQ N;  4C2M J;  1VI0 A;  3FK7 A;  1ZK8 A;  1MSE C;  2QF7 A;  3HOW J;  2DA4 A;  3BTL A;  1WGX A;  3I4N J;  2R93 J;  3CQZ J;  1JJ8 C;  3H0G J;  1QVT A;  1U9O A;  4S0H B;  4DW6 A;  1XS9 A;  1UHS A;  4QSH A;  2ECB A;  2CQX A;  3DCF A;  3M4O J;  2VKE A;  3GTQ J;  4IHX A;  3GTP J;  2XPW A;  1RES A;  1QPI A;  3S17 J;  2R5Z A;  1ETQ A;  2K9N A;  4JX5 A;  1TWH J;  5EGO A;  1AKH B;  4XRM A; 
#chains in the Genus database with same CATH topology
 1R1T A;  2V1N A;  4LD5 A;  3A0B C;  5IOY A;  2E19 A;  2NVQ J;  2LP0 A;  2WAF A;  1X2M A;  2Y31 A;  2KQR A;  3TMO A;  3HOU J;  3MKL A;  4X0G A;  5FRM A;  3F0C A;  4DZP A;  4M9S A;  5D4S A;  1O3S A;  3CES A;  4N4N B;  1R6R A;  2IW5 A;  2KHM A;  4A93 J;  3M07 A;  2HI3 A;  1OYY A;  1YW9 A;  2OQR A;  2DT5 A;  4B4C A;  5D5X B;  1DU0 A;  1FP1 D;  4E7K A;  3RZO J;  5FJ8 J;  2IVM A;  4MTE A;  4CYC B;  3CCM I;  4AYB N;  4B44 A;  5EZG A;  1OJL A;  2DDA A;  3HXL A;  3SQN A;  1BL0 A;  3LA7 A;  2XHK A;  3WGH A;  4PFP A;  3GFM A;  2R0Q C;  3BT9 A;  4P96 A;  2V26 A;  3QPH A;  3CCS I;  2DA5 A;  2XKP A;  5EZH A;  3L09 A;  2OC6 A;  3BR5 A;  4PJN A;  1A36 A;  1IN8 A;  1K7A A;  3JRB A;  4ZYH A;  5ICE A;  2BY3 A;  4E7H A;  1ZG3 A;  5F08 A;  3D5L A;  2EIJ H;  3K6G A;  4PFO A;  2HVR A;  2HR3 A;  3F72 A;  3CME I;  1NG6 A;  2STT A;  2ZO4 A;  2MH9 A;  3HTS B;  1R4M B;  2LRD A;  2VT3 A;  1TBX A;  2QCO A;  1MND A;  4M74 A;  4ZYD A;  1SFO J;  3D5S C;  2IT0 A;  3HHG A;  3ZCO A;  2DMP A;  3FF5 A;  1WQ2 A;  2Z33 A;  1KU7 A;  4BE0 A;  4L5J A;  3E0J B;  1NHA A;  4UVC A;  4BHB A;  1ACI A;  1TT5 B;  4J19 A;  2EZH A;  3IHU A;  1UCR A;  1K79 A;  4QPO A;  2P6S A;  3IWF A;  3O8H A;  3U2R A;  3IH3 A;  3GZN B;  3WTX C;  1W36 D;  1VND A;  1WVR A;  3NRV A;  3T0Y A;  4FX0 A;  4MEX F;  1F9N A;  5IOZ A;  4CDG A;  4ESB A;  3OWT A;  2DN0 A;  4IO9 F;  2K9Q A;  2JSP A;  5BPD A;  3JRD A;  3MZ8 A;  1KU3 A;  1HDP A;  2BXZ A;  3TO9 A;  5CVI A;  1WH7 A;  1MH4 A;  2XC7 A;  3S8P A;  4AIK A;  1FYM A;  4CHU A;  4A0Z A;  3PO3 J;  4Y4R A;  2LH9 A;  3KP5 A;  2W00 A;  2JN6 A;  3HOX J;  2OJE D;  2JK3 A;  2MW8 A;  2B7E A;  3K69 A;  2GA1 A;  3K4M A;  1YS6 A;  5J4Y A;  2IS1 A;  2K3F A;  5E3O A;  2IGN A;  4AID A;  1IRG A;  1FNN A;  5F0H A;  1OPC A;  2ELJ A;  1BJZ A;  3EUH C;  3HGY A;  1J59 A;  3ELK A;  5K7Z A;  2XRL A;  4BQQ A;  4U87 A;  5E8I A;  4CZZ A;  1IN5 A;  3JRE A;  2Q1Z B;  2M5W A;  3FZV A;  3OV8 A;  3PM1 A;  2Y75 A;  3S3O A;  1VFC A;  2VQH A;  2A61 A;  2J5O A;  2X9D A;  4PJ0 C;  5LBQ A;  4GYI A;  4XR6 A;  2FBI A;  4A3I J;  2A6T A;  1XC5 A;  2QWW A;  4ZDO A;  4NHJ A;  5KVR A;  4DYQ A;  5J40 A;  1IZ1 A;  1X1C A;  2HFH A;  1X58 A;  3OS1 A;  4M3G A;  1XMK A;  5EGO B;  4ZTF A;  1RKT A;  2VL8 A;  3FIW A;  1D1B A;  2DMQ A;  2EFO A;  4XRS G;  2NVX J;  5L3B A;  3QAH A;  3V8L A;  2DA6 A;  2JA6 J;  5LHH A;  2PMZ N;  3RKY A;  1D0Z A;  3TO6 A;  1VQO I;  3LQQ A;  1WI9 A;  1HW1 A;  3BR1 A;  2X1D A;  1YTY A;  3QYB A;  5LD2 C;  2DJI A;  3EUK L;  1ON1 A;  2DU9 A;  2EZL A;  2OTL I;  4U0V A;  4O5V A;  1LDD A;  2XGD A;  4BAC A;  2BVM A;  3QPS A;  3E1S A;  1XSV A;  1OMI A;  4BGD A;  2B9S A;  2NS8 A;  5F04 A;  2WB1 A;  4ITV A;  4M6V A;  4JBA A;  3T1B A;  4L18 B;  2LR8 A;  2L54 A;  2PMZ A;  5DV5 A;  2LC2 A;  3K2Z A;  3L1P A;  3C2H A;  1IRZ A;  3RPQ A;  1SVO A;  1Z7U A;  5D8K B;  3PO2 J;  4RMN A;  5E18 F;  2XB0 X;  2N8G A;  2K9L A;  4MGR A;  2GIZ A;  1WJB A;  1UFM A;  4A3J J;  4LIV A;  2IS6 A;  2IGM A;  3K7A J;  3JR9 A;  3U9G A;  3VOD A;  3IH4 A;  5E79 C;  1MJB A;  4NC7 A;  4OIR F;  2CW0 F;  2AQF A;  1X3U A;  3CCQ I;  5FKM A;  3ZQF A;  2E1M C;  3G2B A;  1JUS A;  3GTJ J;  3KZI C;  4GXO A;  3SZP A;  4BDY A;  1FZP B;  5E1X A;  3OYA A;  1BR1 A;  2F5V A;  3EYY A;  5FFX A;  4ENM A;  4RLQ A;  3PUF A;  5GAD J;  2IGK A;  2CQK A;  2F5D A;  2XKO A;  4UB6 C;  1DP3 A;  2O8K A;  2JZY A;  4AVP A;  1FBS A;  2VC1 A;  2E2I J;  3P9I A;  1A5J A;  1GV2 A;  5ERI A;  4BH9 A;  5CQE A;  4KUM A;  5JFR A;  3F6V A;  5K7F A;  3DBL B;  4ZTJ A;  5F6F A;  2VBW A;  4BKX A;  3K70 C;  3E6B A;  3ABL H;  1REP C;  2KIF A;  1HST A;  1WSU A;  1LDK B;  3V8K A;  5IYC J;  1LVK A;  1RET A;  3WTT C;  4BNC A;  4WWC A;  1MJA A;  1ETK A;  2COB A;  3MQ0 A;  3BZ6 A;  3BG5 A;  1TZL A;  5FFZ A;  3A4C A;  3Q0W A;  2ZME A;  3ABT A;  5E3N A;  5LLQ A;  1G59 A;  2CV2 A;  5FO5 A;  4IHV A;  3K9T A;  4OAZ A;  3N4M A;  1MBF A;  5LEK A;  4LIU A;  3MKW B;  4RM2 A;  3I55 I;  2NNN A;  4JQF A;  3JRH A;  5TGT A;  4UUV A;  4AVZ A;  1NTC A;  1O7L A;  2E71 A;  2H6C A;  4CGZ A;  3LAJ A;  3HOZ J;  5D5W B;  3JRF A;  5IP9 J;  2CYY A;  3E6C C;  1P92 A;  2MC3 A;  4OU0 A;  1Z21 A;  3HSF A;  2E1M B;  1T38 A;  3DBR B;  1G8X A;  2KRF A;  3JRG A;  1ZR2 A;  2HYG D;  1B8I B;  1BC8 C;  4PGH A;  5J47 A;  2E2J J;  3KP6 A;  2MAB A;  4ZDP A;  2BE5 F;  3TP3 A;  1HF0 A;  2JQ7 A;  5LHG A;  2DMU A;  2JJ7 A;  2DA2 A;  3DP7 A;  2FE3 A;  2EWN A;  3OS2 A;  2W24 A;  3OYM A;  3CF2 A;  2KT0 A;  4ENK A;  4LLN A;  3JRC A;  1DGW Y;  2XGX A;  2E1N A;  1LKX A;  2CJJ A;  2DFF A;  4HYE A;  3DLA A;  2KIS A;  1K6Y A;  2X6X A;  1JT0 A;  2XGE A;  5DS9 A;  3BC8 A;  4LK0 F;  1BA5 A;  4IRH A;  2GLO A;  1XG1 A;  2Q8K A;  3GFI A;  2VBZ A;  5E1Z B;  3J80 K;  3ZXS A;  1T39 A;  4NDL A;  2PJR B;  2EZI A;  4Q4Z F;  2Y69 H;  1N75 A;  2UZK A;  1X1B A;  2O0Y A;  4A3C J;  2P7V B;  3I56 I;  1QU3 A;  2R3S A;  2DJN A;  2NS0 A;  2DI3 A;  3F8F A;  1YJN I;  2EIL H;  1W7P B;  1FC3 A;  1ZHF A;  4RGU A;  1FSH A;  2DBB A;  2K5C A;  2H1K A;  3KYC B;  4BDZ A;  1FYL A;  3S15 J;  3CUQ A;  4F55 A;  2V79 A;  1IDY A;  3MCZ A;  2XRO A;  1MKM A;  1X19 A;  1TW2 A;  3E7L A;  3HL2 A;  2LVS A;  5BMZ A;  2STW A;  3LA2 A;  1SVL A;  4EQQ A;  2ZXH A;  4MHG A;  1S7E A;  4XKW A;  2R7V A;  3K4J A;  1VQ9 I;  3BR6 A;  1ORK A;  1X3W B;  2GXG A;  1TTY A;  2O7O A;  1YHQ I;  3FXQ A;  1UHM A;  3K4K A;  3X2Q H;  1VQ7 I;  5HNF A;  1Z1D A;  2M1B A;  3F8C A;  2XAS A;  2OUM A;  2MLG A;  2ACJ A;  3H5A A;  2VQL A;  3SFI A;  1S5L C;  3MKY B;  3TL4 X;  2RVC A;  2FEZ A;  1WPK A;  2XUB A;  1UST A;  4EM2 A;  2QSG X;  5BNG A;  3BG7 A;  1CF7 A;  4QLC U;  3DWL E;  3HRM A;  3HYI A;  4DQ2 A;  2F4I A;  3OYF A;  1O4X A;  3OIQ A;  2W85 A;  2YPR A;  1J7K A;  5LFA A;  3I3L A;  1SAN A;  2XRN A;  3OS0 A;  1R58 A;  1WJ5 A;  3FMQ A;  2QBY B;  1JGS A;  3ASN H;  4M73 A;  1K4T A;  1SD6 A;  2P6T A;  2ZCW A;  2EK5 A;  2CU7 A;  2HYF A;  2JRT A;  3HG9 A;  4L9V A;  3ERE D;  2OA4 A;  1Z91 A;  4YEJ A;  2JA2 A;  4G8X A;  3K10 A;  1XSX A;  2F48 A;  4XQF A;  2FD5 A;  3D1N I;  1GHC A;  1FX7 A;  3DKW A;  4M9Z A;  3NAU A;  3RKX A;  4QTR A;  3QOD A;  4L5I A;  1T2K A;  4X1E A;  3S32 A;  1KQ9 A;  3ZMU A;  3H9G A;  4NQW B;  1XB4 A;  1SD4 A;  2ZXI A;  1BI3 A;  2HDC A;  4YFN F;  1ZQ3 P;  4D1Q A;  1X4O A;  4DBR A;  2X85 A;  5TRD A;  2FJ1 A;  2JA8 J;  3JTH A;  1A35 A;  3QU3 A;  3L2R A;  1VQL I;  1E17 A;  1HKT A;  2WAD A;  2Z3Y A;  2H6B A;  3CCL I;  1TQI A;  2WAQ N;  3WGI A;  1YRN B;  1FBQ A;  4ZJZ A;  1T8I A;  3HOW J;  1YIJ I;  2DA4 A;  3BTL A;  4ENJ A;  2R93 J;  3CQZ J;  4G94 A;  1W7P D;  4CYD A;  1QVT A;  2VE8 A;  3WU0 A;  4S0H B;  2LY1 A;  4WCG A;  3HPH A;  1MNE A;  3Q9S A;  2ECB A;  5JI6 A;  2IA1 A;  4IHX A;  3GTP J;  2QQA A;  2ZSH B;  1QPI A;  2WAQ A;  2ZJP F;  3HC7 A;  1ETQ A;  2X6W A;  1XGM A;  4CA0 A;  1KYW A;  1WJF A;  4XKB A;  4BJ5 C;  4XRM A;  3GUD A;  3A01 B;  2ELH A;  2LKS A;  4L0Z B;  3DLL F;  3TBI A;  5AIQ A;  2BHY A;  3CP8 A;  3BG9 A;  5FKN A;  4EGY A;  3HEF A;  4DYR A;  5E3M A;  2KRH A;  1S72 I;  4N0B A;  2BOL A;  2DFI A;  3MN2 A;  4LOC A;  4RAY A;  5IT9 K;  1LE8 B;  3OY9 A;  1QZE A;  5TIS C;  3H1C A;  2BGC A;  5LGN A;  2GXA A;  4A69 C;  5HLT A;  5F1J A;  4DGW B;  2CUE A;  4HF1 A;  3QYE A;  2XV4 S;  3OOU A;  4DYC A;  1A04 A;  1F5T A;  3CMY A;  1KQ0 A;  5D4R A;  4RGX A;  1OCP A;  1U2W A;  1BI1 A;  4M71 A;  2HZD A;  5GTI C;  3EET A;  5JLX A;  4L5E A;  4BXU A;  3M8F A;  3DKY A;  4AU7 A;  3HM5 A;  5K7H A;  3IKT A;  2M4K A;  1S7A A;  3FM3 A;  4DIQ A;  1B1B A;  4J00 A;  4ABZ A;  1R71 A;  1FEX A;  4ON0 A;  1TWG J;  1TQM A;  1EA3 A;  2EJR A;  1W0T A;  4I02 A;  4AM3 A;  2QKM B;  1D3Y A;  1DPR A;  3ONQ A;  3I59 B;  4Y7N J;  4R8H A;  2WC2 A;  1D1C A;  1GT0 C;  1KQ8 A;  1X1D A;  3VYU B;  3CO6 C;  3P9C A;  5FGM A;  3L9F A;  2F2E A;  2L2O A;  1VQN I;  3V42 A;  3ZOB A;  4UNO A;  3DBH B;  3JW4 A;  4XOT A;  2DOD A;  2WA0 A;  4HF2 A;  3R60 A;  4C9Y A;  5C3E J;  1ULY A;  1LEA A;  4OMZ A;  1X1P A;  3QPL A;  4XSX F;  4XOR A;  5HS8 A;  4RGS A;  5GTH C;  5C44 J;  1IC8 A;  3F8M A;  2ISY A;  3FIS A;  3LSH A;  3F22 A;  1P7I A;  4MIM A;  4I0A A;  2K4J A;  3W3C A;  2M4G A;  2B0L A;  1I6X A;  4HX7 A;  4F93 B;  1WJA A;  1XDU A;  2EH3 A;  2M0C A;  3ML6 A;  4Y17 A;  2HOE A;  1ZTR A;  2ZB9 A;  1S29 A;  4NBQ A;  2LBF B;  4DOZ A;  1F4K A;  2AS5 F;  1J9I A;  1JTX A;  1SFU A;  1T33 A;  3E6M A;  5KCM A;  4A3F J;  4LB5 A;  3G6E I;  2RQP A;  1ETO A;  2MG4 A;  3JRI A;  2KIU A;  2HWV A;  1UHW A;  4V2G A;  2FNA A;  4KT5 C;  2E5Z A;  5M5W J;  5H20 A;  3SZT A;  4BHP A;  2OD5 A;  4RLF A;  1PUF B;  1AWC A;  1D0Y A;  2EV6 A;  2GQQ A;  3IRQ A;  4H4K C;  4S04 A;  4Y52 J;  3AG3 H;  1L3L A;  2WWY A;  1MDM B;  3LA3 A;  5H2F C;  2IRF G;  2JPB A;  3OYK A;  2NVT J;  3F8B A;  3QYF A;  4FCY A;  2DA3 A;  5IT9 Z;  3S2H J;  2CQQ A;  4CUG A;  5EEA A;  4LG0 B;  1AOY A;  3VOE A;  1T95 A;  4MQ9 F;  2LRE A;  4HX8 A;  4B3X A;  4A5N A;  2KJC A;  2LDU A;  5J1U A;  1FOY A;  2H8R A;  2CQ7 A;  1WJD A;  3CLQ A;  2VIX A;  3PIO F;  2EQR A;  2A05 A;  2JA5 J;  4KA4 A;  1JXS A;  5KNL A;  3E3V A;  4A5M A;  1TL8 A;  2JSC A;  1QA6 A;  4UUT A;  4HOB A;  1JJ6 C;  3E5U A;  1Y8Q B;  3CP2 A;  3GW2 A;  3IUO A;  5F27 A;  5DM7 F;  1JE8 A;  1AA7 A;  3JSP A;  1AKH A;  1JT6 A;  2IP2 A;  4OMY A;  1F36 A;  3RKW A;  1SVM A;  3J81 Z;  3R4K A;  3OOP A;  2DW4 A;  2CRG A;  2IS4 A;  4PCQ A;  3UNG C;  4YII A;  1XN7 A;  2IGO A;  3BPX A;  3CMM A;  3LSJ A;  3PSI A;  1VQ4 I;  4UHT A;  5A2Q K;  2OQG A;  1RZ4 A;  2HXI A;  3M7G A;  4FAS D;  2WBM A;  4W97 A;  3G1M A;  1GV5 A;  4E70 A;  4RBO A;  3K2A A;  4HG2 A;  3OYI A;  5E17 F;  4F92 B;  1ZRE A;  1KU9 A;  1TT0 A;  4EVI A;  2GWR A;  2I8D A;  3WTS C;  4PJL A;  1QRY A;  2QM3 A;  5K5R A;  4CYC A;  3EDP A;  1O3T A;  4HF0 A;  2DTR A;  4A0X A;  2YU3 A;  1U5T A;  2KDO A;  5L3C A;  1SMT A;  4A3B J;  1TWA J;  3V8J A;  3S16 J;  3QWL A;  4B1R A;  3FM5 A;  1XCB A;  2KZV A;  4XKV A;  2HNH A;  2CUZ A;  4CCM A;  2M30 A;  1Z77 A;  2K3P A;  3TDZ C;  4ZDL A;  1IN4 A;  1MNM C;  1XDS A;  4AYB A;  2P5L C;  1ZLK A;  4Q5S F;  2VQC A;  3A02 A;  1M1E B;  2JT1 A;  3BLY A;  3FXU A;  3LL7 A;  4YFX F;  2E34 A;  3RQI A;  5DYM A;  4A12 A;  2ETH A;  1RUO A;  4JX4 A;  2QSF X;  1Y8R B;  2X6O A;  5EF6 A;  3K4L A;  1IG7 A;  2LFB A;  3W2W A;  4PJJ A;  4D0P A;  1S7O A;  1B9N A;  3RIR A;  1K78 A;  3TKY A;  4G7Z F;  4IVN A;  4G7H F;  1ZGJ A;  5CPR B;  2NS7 A;  3E5X A;  4I09 A;  2HU9 A;  2YU9 J;  4WK8 F;  2MD5 A;  1JHF A;  3GO5 A;  5FRO A;  4RB3 C;  1OCC H;  3HUG B;  4BBS J;  3QQA A;  1HCR A;  1T0F A;  3L2U A;  2BEO A;  2RDP A;  4A0Y A;  2HVQ A;  2EIN H;  3DTK A;  4UXN A;  5E3L A;  1FYK A;  1G3S A;  4BEH B;  1B59 A;  2A5W A;  2CV0 A;  2XF6 A;  2IA0 A;  1AU7 A;  4G6D A;  3WE3 A;  3FXL A;  3HOS A;  1ZG5 A;  4D7M A;  3TQN A;  2HPI A;  3Q0U A;  4CCO A;  3HTU A;  3FMR A;  1EH8 A;  3HKZ N;  4HSR A;  4KIT B;  5DUK A;  1OR7 A;  1W5T A;  1YX5 A;  1ZEL A;  4LIT A;  4B47 A;  3ZQ7 A;  2VOP A;  3H9Q A;  3ZMZ A;  1ZH5 A;  3K1N A;  3CJT B;  3CCE I;  4JX6 A;  5ILV A;  2PFB A;  3BQY A;  3EUA A;  1BW6 A;  3RI4 A;  1ZAR A;  2VQG A;  1DP7 P;  2EZK A;  2RC4 A;  1XGO A;  4A3E J;  2ZJ2 A;  2WV0 A;  3I71 A;  2K40 A;  3OYE A;  3LSI A;  4WXC A;  1GLN A;  1WKM A;  5IT3 A;  2M8E A;  3VYT B;  1J5Y A;  4GYG A;  4MO7 A;  4KIF A;  5LHI A;  2A07 F;  1VQ6 I;  2LY2 A;  3KIO A;  3DKX A;  5JLW A;  4IX7 A;  5TJJ A;  3LNQ A;  4BL0 B;  2R7D A;  1QHG A;  2HDW A;  2EB7 A;  1OIS A;  2V1D A;  3G1O A;  2Z1D A;  4KFC A;  3ZP5 A;  3O3K A;  5CVU A;  2ZNZ A;  4E7L A;  2ESH A;  2IJL A;  2QSH X;  1QVU A;  2Q2E B;  4A3M J;  2V6C A;  2D1H A;  4OOI A;  5D5U B;  2P5K A;  3DPL C;  2R7X A;  1H9T A;  4P1W A;  1HC8 A;  1STZ A;  1FTT A;  2VT2 A;  2ECC A;  4BS9 A;  2ID6 A;  3IL2 A;  2CSO A;  5GAH J;  1RIO H;  3RPU A;  3CO7 C;  2GA2 A;  2XPV A;  3KYL A;  1YG2 A;  4FE7 A;  2L5Q A;  2M7A A;  3LOC A;  3FX3 A;  2W7N A;  3KPH A;  4RAG A;  4RM3 A;  2M7B A;  2LD5 A;  1D8J A;  1WHU A;  2WTE A;  2RQQ A;  1U6G A;  2F4O B;  2YSR A;  4WXD A;  2V1U A;  4D9J A;  4G6Q A;  3QRF F;  1J0R A;  4KT6 A;  5ICC A;  3RYP A;  1HBX G;  2GIV A;  3CCY A;  4IXA A;  2LLK A;  3C2B A;  1N25 A;  4KDP A;  3CC7 I;  2GBY A;  5EG0 B;  4P9F A;  1EH6 A;  4AIJ A;  4XLP F;  2JRM A;  4LJZ F;  4XIC A;  3LSP A;  3CCR I;  3A2K A;  3M9A A;  4GCV A;  2V7F A;  3IH2 A;  2QQ9 A;  4LFU A;  2FF4 A;  2ESN A;  4H0E A;  2VXZ A;  2DFH A;  2DLL A;  2OCC H;  4PJM A;  4D5C A;  1NK2 P;  2UUZ A;  3KP3 A;  4L9T A;  3OYD A;  4AUX A;  5J8F A;  1YE9 A;  2L7F P;  2OPT A;  2W57 A;  1JTY A;  1S6L A;  2O8X A;  3GBG A;  3O2P E;  4IF4 A;  1QZY A;  4DJA A;  2HEO A;  3VYS B;  3DEU A;  3TED A;  3I54 A;  3PSF A;  2O61 A;  1JUM A;  1X2N A;  5AON A;  1G4D A;  2KLO A;  1T6S A;  2PG4 A;  3I64 A;  5DUI A;  2P81 A;  2QLZ A;  1ONV A;  1MMN A;  2RGV A;  2DPD A;  4CO8 A;  3K4C A;  4CCK A;  2ZXJ A;  2EIK H;  2DA1 A;  2MA3 A;  3IC7 A;  3ISP A;  1UMQ A;  1Z0X A;  1FPQ A;  4JYK A;  3CJR B;  5CJ9 A;  1NH3 A;  1BN5 A;  2HQ5 A;  1MBE A;  1KZH A;  1UZC A;  1ZKG A;  5GAE J;  4LMY A;  3VEP A;  2EV0 A;  3BZK A;  4PGG A;  4E7S A;  4JP0 A;  3I58 A;  3HBL A;  4BUP A;  3HOY J;  4K2E A;  4BQO A;  4U7D A;  2H27 A;  5C4J J;  2W25 A;  4E6K G;  5CVR A;  1Y6I A;  4ZYA A;  1H89 C;  5HDN A;  1HKS A;  2DTZ A;  4IHT A;  2A5Y B;  3AG4 H;  3VFZ A;  4KYW A;  4C30 A;  2ICW G;  2JPC A;  1MJ9 A;  4ZYE A;  1TWF J;  4QPQ A;  4G7O F;  3HHH A;  5BPI A;  2ELK A;  2L7M P;  2DOA A;  4ZYG A;  3KP2 A;  3KLN A;  3MKZ A;  2R92 J;  3ABU A;  2DDB A;  1QPM A;  3W2A A;  2LSO A;  1MIJ A;  5EEG A;  2NYX A;  2F6C A;  2R7O A;  5GP9 A;  3TP0 A;  4EM0 B;  2XB5 A;  3OYH A;  3SDB A;  1YO5 C;  3TW6 A;  1BW5 A;  4O6J A;  1QGP A;  3FK7 A;  2LOO A;  1ZK8 A;  2L3D A;  2VJJ A;  4LGW A;  3V4G A;  4XNF A;  1O7F A;  3I4N J;  1IV8 A;  5EJC A;  3FXO A;  1JJ8 C;  3H0G J;  4DW6 A;  1IRX A;  5FLX K;  4YFK F;  3VSK A;  2CQX A;  2DYS H;  2MFZ A;  1Y0U A;  3M4O J;  2O3F A;  2KPM A;  1LFP A;  1RES A;  2JVH A;  2V4J C;  3U1D A;  4BHC A;  2VC0 A;  4I01 A;  1R5I D;  4IRG A;  2R5Z A;  4KIB A;  3S17 J;  4NNJ A;  3B73 A;  1TWH J;  4L9N A;  4YIF A;  3OYN A;  4II3 A;  1LVA A;  1R5H A;  4XON A;  3CDH A;  5D6F A;  2AXT C;  5BOX A;  1WJC A;  1PJR A;  3QPT A;  4LG3 A;  3NAR A;  2MH2 A;  4GGG A;  2DK5 A;  5GAG J;  1MMS A;  2BBY A;  3M8J A;  3PIP F;  4XKC A;  1KA8 A;  3WTY C;  3SDG A;  4C3J J;  1BM9 A;  5FD5 A;  3C2G A;  2OAZ A;  4HPQ A;  4B09 A;  1R1U A;  1VQP I;  5DCM B;  2XIG A;  2DK8 A;  2PJR A;  3N97 A;  4UY8 I;  1KON A;  2O6G E;  2VI6 A;  2Z16 A;  2QVO A;  2CQN A;  4LK1 F;  3SFZ A;  2XAH A;  4EJO A;  1W7P A;  4QIW N;  3BDD A;  3V7C A;  1TW3 A;  4IRI A;  4ESF A;  3JSO A;  2L9S A;  3AKZ A;  1XSD A;  2HGC A;  2AHQ A;  3QP6 A;  2KDZ A;  2VXD A;  4RAZ A;  2X48 A;  3ULQ B;  2DYR H;  2M2E A;  1T98 A;  3HOT A;  2QA4 I;  2W1O A;  4JOM A;  3WGG A;  1K6O A;  1B9M A;  3MD2 A;  4L9J A;  4YIR X;  3H3U A;  2EPF A;  2GAU A;  4F91 B;  3FBN B;  4MTD A;  1OKR A;  3LAP A;  5FLM J;  4Z6Y A;  1TQP A;  2VJ4 A;  2YUS A;  3QU6 A;  4B48 A;  2XAU A;  4W1U A;  3CJN A;  1VQK I;  2DOF A;  1UG2 A;  1R22 A;  1IF1 A;  4UUS B;  2BHZ A;  2BVL A;  2LNB A;  3HB9 A;  2K4B A;  4BQA A;  4XL9 A;  3G4S I;  4XLA A;  5B5E C;  4KMF A;  3LSR A;  5L3G A;  4IHW A;  1I27 A;  3GTO J;  5L3E A;  2BW3 B;  5KK1 A;  3KEO A;  2QBY A;  1WH5 A;  1UJ8 A;  4XSZ F;  5M3M J;  5FLX Z;  2OBP A;  5KAF C;  1BC7 C;  4XBF A;  4AC0 A;  2E1O A;  1Z7L A;  2EFP A;  5J1Y A;  5M5X J;  4FT8 A;  3BJA A;  1O3R A;  1QNT A;  1FOK A;  4RB0 A;  5C4X J;  2IEK A;  5HS9 A;  2H8W A;  3BWG A;  1YJ9 I;  2UWM A;  4MNU A;  2XAF A;  5FKL A;  4E7I A;  3EQL F;  4HNV A;  3CZ6 A;  3ESW B;  2OU2 A;  2XAJ A;  4FIS A;  4EMS A;  2JTV A;  2Y48 A;  3KE2 A;  1P6R A;  3OSG A;  2L7Z A;  5EEH A;  3WTV C;  3J80 Z;  2EIM H;  2H09 A;  1IJW C;  2R4G A;  2FMY A;  5DM6 F;  2FSW A;  1VTN C;  4ETS A;  4BAY A;  2A68 F;  5DDG A;  1FMV A;  4I76 A;  3A0H C;  3C1D A;  3LFK A;  5CYV A;  1P7J A;  1RI7 A;  2G7H A;  2VBX A;  1JUP A;  1JKO C;  1D8K A;  2E2H J;  2PMU A;  2DT6 A;  1G2H A;  5HOO A;  2QQ8 A;  2EFN A;  3AAF A;  5IPA A;  4RDU A;  1IW7 F;  3K1M A;  2OZ6 A;  1TC3 C;  3MWM A;  3KCC A;  3GTL J;  1E3P A;  3S1Q J;  2B63 J;  4XLN F;  1GVJ A;  2PMH A;  3FHN A;  4HV6 A;  4I6Z A;  1JKR C;  2UXX A;  5KHD A;  2MC4 A;  2MLK A;  1HOM A;  2R7F A;  1MMD A;  3AG1 H;  2A6E F;  3ZQC A;  2A6H F;  3B6C A;  3A01 A;  2V9V A;  5F0C A;  1B72 A;  3VSL A;  3AFH A;  1XPX A;  3VWB A;  1LFB A;  6PAX A;  1FSE A;  2BY0 A;  2UV1 A;  3BTJ A;  2K27 A;  4HA8 A;  3OL4 A;  1ODD A;  4KNY A;  2CFX A;  1PDN C;  3FKI J;  1U3E M;  1LE8 A;  1TWC J;  2EV5 A;  4RB1 A;  1CGP A;  4Y13 A;  1QO0 D;  1D5V A;  1TNS A;  1RUN A;  4B43 A;  3VDX A;  2CW7 A;  3DEE A;  1FT9 A;  3T8R A;  4M3B A;  2DMN A;  1IV6 A;  1S8N A;  5H6R A;  2WY8 Q;  5JVT A;  3JAM K;  4FX4 A;  4EJT A;  2FNP A;  1IRF A;  4MLO A;  4AIH A;  4UV8 A;  1O57 A;  4OIN F;  5JVG F;  3IAM 2;  3Q5F A;  1RRJ A;  1OCT C;  5FD6 A;  2ZKZ A;  3LFU A;  1OCO H;  4EJV A;  3I59 A;  3L2C A;  2G9W A;  1MBK A;  5FLV A;  1SD5 A;  3DQV C;  4NB5 A;  5DTD A;  1QQI A;  3KP7 A;  4XRS A;  1XD7 A;  2FOW A;  2FQ4 A;  2ME6 A;  2ZJQ F;  1J09 A;  1FOX A;  2V9K A;  5JR3 A;  1HQC A;  1RPW A;  1T08 B;  1V55 H;  5IYD J;  3FMS A;  4RAF A;  1H8A C;  2KZG A;  3H0D A;  2OCE A;  1I1S A;  4FTH A;  4EGZ A;  2UXN A;  3KP4 A;  2R5Y A;  2BXY A;  4ZC3 A;  2LTP A;  3FBI B;  3HZJ A;  2GOX B;  3QOP A;  3ERM A;  1HA8 A;  3T8T A;  3CD6 I;  3WE2 A;  3KEQ A;  2XGC A;  2YS9 A;  1FOW A;  3ZMD A;  1IUF A;  3RKQ A;  5HLH A;  4HNU A;  5D8L B;  1WWX A;  5EYR A;  1MZB A;  4I0B A;  1TP4 A;  4XN0 A;  2Z99 A;  2LBF A;  2MBF A;  2LMD A;  3CC4 I;  1SFK A;  1D1A A;  4A2U A;  3OYB A;  2KL4 A;  3SXY A;  4DZJ A;  1T56 A;  3ZPL A;  2BY2 A;  4HW0 A;  2VON A;  2EA2 A;  3BJO A;  5EDN A;  1ZLJ A;  1R49 A;  1ZAO A;  1ZGA A;  2LF7 A;  2LKX A;  1FLI A;  1KYZ A;  3CLO A;  5LRR A;  3OR1 C;  3JTG A;  4A3L J;  1EV7 A;  2CWE A;  3PQJ A;  1RNL A;  3TO7 A;  3DEW A;  1DQU A;  1MW7 A;  1VQ5 I;  2MD0 A;  3RQ4 A;  1MDM A;  4FET A;  3ZR8 X;  1L0O C;  1OQY A;  3ZQH A;  4Q47 A;  1MBG A;  3A03 A;  1Q1V A;  2H94 A;  3KFW X;  4LG0 A;  1W4M A;  1V5G A;  9ANT A;  1U5T C;  3V7R A;  3G73 A;  1XGN A;  3I53 A;  3GZ5 A;  2VKH A;  4FQG A;  2M8G X;  3ZMT A;  3HSE A;  4M6Y A;  1ZN2 A;  1YIO A;  2R7Z J;  1FP2 A;  3H5N A;  3B6A A;  1VF9 A;  1UAA A;  2HOT A;  3JAM Z;  3O6B B;  3MFK A;  1GXQ A;  1K4S A;  2X1E A;  4ZZD A;  2LYC A;  3BJ6 A;  2HS5 A;  2X4H A;  4V2F A;  2CFO A;  3ECH A;  2VLA A;  3CTA A;  1ZYR F;  2LG4 A;  2XPU A;  4ANJ A;  4CXF A;  3BR0 A;  3DXJ F;  2VPR A;  3W6K B;  1YW8 A;  2L9N A;  3BOQ A;  4A3K J;  2FML A;  4XN3 A;  3E5Q A;  3O8G A;  3IAS 2;  3T5X A;  4BXX J;  4NC8 A;  1YJW I;  3MZY A;  1LB2 A;  2L7K A;  1DDN A;  1NK3 P;  2PJP A;  1BBY A;  1MBJ A;  2OF7 A;  4LLL A;  1PP8 F;  1R00 A;  3WG7 H;  5HNH A;  2D1V A;  2I10 A;  1JKQ C;  2HKX A;  5E1W A;  1Z3Y A;  1T0F C;  4XOP A;  2J5P A;  3RYR A;  4P55 A;  3ZMV A;  5IP6 A;  1I39 A;  3GX4 X;  2M87 A;  4BY1 J;  2HXO A;  4UVA A;  1KU2 A;  4C2T A;  2E5N A;  2NAZ A;  2L4A A;  3PJR A;  3EPZ A;  4M72 A;  3BG3 A;  1IXC A;  2KKO A;  2O03 A;  3GLX A;  5B3S H;  2RRE A;  3L2W A;  2E35 A;  4UV9 A;  1OR7 C;  2X6Y A;  4D7N A;  5LEJ A;  3ASO H;  1AHD P;  3OYJ A;  1YX3 A;  4HDU A;  5J6X A;  2RNJ A;  5JHF A;  2JWT A;  1U5T B;  3FXK A;  3NWT A;  5F0F A;  2R7R A;  3S3N A;  1D5Y A;  3FXM A;  2E1C A;  2XF7 A;  2JA7 J;  2OTJ I;  1Z9C A;  3TOA A;  3S1M J;  1F1Z A;  2E7W A;  1A31 A;  4KIC A;  1N78 A;  2HOA A;  3WOD F;  1BJA A;  1HXD A;  4KN7 X;  3KLO A;  3ZN0 A;  1XMA A;  2HTJ A;  2QQB A;  2F5C A;  3CUO A;  5D6E A;  3U1K A;  2CW8 A;  1S9H A;  3LQR A;  3MMY B;  4GDF A;  3P7N A;  3M3Y J;  1BI2 A;  2VKV A;  3CCJ I;  1LJ9 A;  2L01 A;  2V9P A;  1LEB A;  1VQ8 I;  2XSJ C;  2FX0 A;  3HUG A;  3RDI A;  2VOO A;  4LLG F;  4NC6 A;  1K78 B;  2DXI A;  2X1C A;  2G7U A;  1YW7 A;  4C2U A;  5FRN A;  5J3L A;  1FTZ A;  2F5E A;  4BEH A;  4EJW A;  1GXP A;  4A6D A;  4B8X A;  1LDJ A;  3GEZ A;  2NNY A;  4M3F A;  3B02 A;  4CCL A;  3R0J A;  5ILU A;  4U0W A;  3M1E A;  2JVG A;  3OYC A;  5HOD A;  4FE4 A;  3IWZ A;  4RB2 C;  1MSF C;  5HDG A;  1USS A;  2HQN A;  2W48 A;  2P0W A;  1O3Q A;  4C3H J;  2Z2S B;  3J7Z I;  4ENN A;  2QYO A;  2VAS A;  4M6X A;  4G9Y A;  5A2Q Z;  2ZJR F;  2GXB A;  2Z9O A;  2HTS A;  5H6Q A;  2DFE A;  3WHB A;  2FBH A;  4GRI A;  3HKZ A;  3UKG A;  1SFE A;  1DUX C;  2CGP A;  3S14 J;  4UVB A;  3VB2 A;  4G6T B;  1H0M A;  3ZMS A;  1SEU A;  2A3S A;  3DPU A;  4C2M J;  1OLT A;  3G3Z A;  1MSE C;  2QF7 A;  4IZZ A;  3L00 A;  2V6E A;  4KIG A;  4QWQ A;  4DNC A;  4EM1 A;  1OCZ H;  4BJ6 C;  3MZH A;  3QOE A;  3D0S A;  2XVC A;  5CQG A;  3DCF A;  4ESJ A;  4BYY A;  3PUB A;  5CVJ A;  2DO7 A;  2Q2E A;  1V4R A;  3GLL A;  4BJT A;  4JX5 A;  4U88 A;  3GYH X;  2X0L A;  4HBL A;  4HQE A;  4PDK A;  1VZ0 A;  3OYL A;  3RTR A;  1X1A A;  5EGO A;  2PN6 A;  3PFI A;  2HVS A;  4KMU X;  1G6N A;  1P4W A;  2R7Q A;  2FRH A;  3KEY A;  3OIO A;  3AG2 H;  2EA4 A;  1V54 H;  4XLC A;  5ICF A;  1W5S A;  2A69 F;  2DPU A;  2L9V A;  5M5Y J;  2P7C B;  1Q1H A;  2FUG 2;  2EFQ A;  5CVV A;  3PNT A;  5D5V B;  2BV6 A;  4HDV A;  2VOD A;  4EV0 A;  2KJB A;  5EG0 A;  4Y3O A;  5AIP A;  4WF2 A;  4IJA A;  5CLS A;  3F6O A;  1GVD A;  4IL6 C;  2BZT A;  1EH7 A;  2HZT A;  2WB1 N;  4HAM A;  2ISZ A;  2GOM A;  2VJ5 A;  2GM4 A;  1W5C C;  2ZC2 A;  3GF2 A;  4L0Y B;  1WZ2 A;  3WTW C;  2V1X A;  3I9V 2;  3SEZ A;  4MFE A;  4II2 A;  3EUH A;  2LKP A;  3OL3 A;  1D0X A;  1G3T A;  2YX4 A;  3KZY A;  2CUJ A;  1IXS B;  3BR2 A;  3LMM A;  2PLY A;  1X4P A;  2BYV E;  2PX9 A;  3BRO A;  2IBD A;  1POG A;  2RN7 A;  2ZME C;  1OYI A;  2ZSI B;  2FA5 A;  3BR3 A;  3HJE A;  3F21 A;  4A3G J;  3C3W A;  5CKT A;  2IXS A;  1XTA A;  1YS7 A;  1V5F A;  1PYV A;  3PNV A;  4M3E A;  1IDZ A;  2CH0 A;  2COM A;  3M1C A;  3BPV A;  5GPA A;  2TDX A;  1S3J A;  3PL8 A;  5HVQ C;  1K83 J;  1ON2 A;  4EAT A;  4X6A J;  2IS2 A;  3BP8 A;  5BQT A;  1I50 J;  2NRA C;  5L3F A;  4PK4 A;  2F5F A;  3MVP A;  1YLF A;  2QKL B;  2TRT A;  1LUJ B;  2XAQ A;  1BOB A;  3CMA I;  1FWZ A;  2E7X A;  4M9X A;  4IKF A;  1SAU A;  1U0J A;  3SZG A;  3EYI A;  1JKP C;  4NUB A;  4CCJ A;  3RJP A;  1R5G A;  3CDL A;  3ZN1 A;  1BOA A;  4U0Y A;  2H1L A;  4O3M A;  3IRR A;  1LNW A;  2W82 A;  2XF5 A;  1PP7 U;  3TGN A;  5IY5 H;  1MMG A;  1WI3 A;  2FU4 A;  4HLX A;  4HNT A;  5DD8 A;  4OWR B;  3DV8 A;  1V5E A;  3RCO A;  2L9R A;  3SYT A;  3SJM A;  4Q48 A;  3WU1 B;  3F3X A;  1Z67 A;  1ZRD A;  2RV8 A;  4OIP F;  4IOA F;  2L4M A;  1J75 A;  1UB9 A;  2GZW A;  3KZZ A;  2HQR A;  2L02 A;  1J2X A;  1P4A A;  1B4A A;  1R36 A;  5IYB J;  2LF8 A;  4E7Z A;  5K5Q A;  3N05 A;  1HLV A;  2M45 A;  4S05 A;  1ERD A;  1XCV A;  3S2W A;  4E7J A;  3RPU D;  1YYV A;  3G71 I;  3OIP A;  3WHC A;  4KIS A;  2XAG A;  2DOE A;  3CUQ C;  3AL0 C;  2XDV A;  2KFD A;  4PSW A;  5E8G A;  2ZME B;  3SEQ A;  3GTG J;  2CG4 A;  3COA C;  3LSG A;  1Y1V J;  1IN6 A;  5J1R A;  1SMY F;  3S1N J;  3WU2 C;  1HW2 A;  1QBJ A;  4IHS A;  4D5F A;  5DCF A;  3ROU A;  3FK6 A;  3J7A Y;  1OYW A;  3RSN A;  4C3I J;  3VPR A;  1P4X A;  4RGR A;  1Y1W J;  1B8I A;  3I4M J;  3OYG A;  1E3H A;  2RAE A;  1W0U A;  2KIM A;  2Y9Z A;  2O5R A;  1DPU A;  2I5U A;  4F52 A;  1W1W E;  1Y0N A;  1MMA A;  1WFX A;  2CMP A;  4CSW A;  2QUF A;  2K9S A;  2NOG A;  4OAY A;  1R7J A;  1H88 C;  1RKW A;  2VE9 A;  5ILS A;  3FWE A;  4MEY F;  2R5Z B;  1TNT A;  1K61 A;  2EBI A;  3S3M A;  2HQA A;  3MEX A;  3KYD B;  5DCM A;  1ZRC A;  2VN2 A;  3GTK J;  3BY6 A;  5ED4 A;  3JCU C;  3PQK A;  3LST A;  2FOK A;  3CJQ B;  1XX5 A;  4IOC F;  1SAX A;  3J7A O;  1U9N A;  2DMT A;  3FXJ A;  3BQZ A;  4IPA A;  1PUE E;  1DGR M;  2MSY A;  3GWZ A;  3W6J B;  4WXH A;  2IAI A;  2VBY A;  5J4V A;  1OCR H;  3BCA A;  1OFC X;  2W4S A;  2F4M B;  5DEQ A;  4WX9 A;  1I5Z A;  2D5V A;  4CCN A;  1C0W A;  3NEU A;  3I4P A;  3FXR A;  5FKO A;  3ZQG A;  1FIP A;  5IP7 J;  4CIC A;  3GME A;  3BG6 A;  2RKH A;  3GXO A;  1U8R A;  3CUQ B;  3AL0 B;  3G1L A;  1YFH A;  2D2W A;  1Y56 A;  2C6Y A;  1RC9 A;  4XK4 A;  4Y15 A;  3UR3 C;  1IXR C;  2VPL A;  3SHF A;  3ZQQ A;  1JHH A;  2HKO A;  2ZFU A;  3PFY A;  1WCM J;  2ZFW A;  3ABK H;  3GFJ A;  2R7T A;  4UUS A;  3K1P A;  3JRA A;  1BIB A;  1GDT A;  1FY7 A;  3OR2 C;  1I3Q J;  2IA2 A;  4I98 B;  5BS6 A;  2VUM J;  1ZGW A;  1P2F A;  4R79 A;  5HLI A;  1IN7 A;  2Y0M A;  1HDD C;  5ICG A;  1U8B A;  4F7Z A;  4DBQ A;  4YG2 F;  2K02 A;  5L3D A;  4BQN A;  2WV1 A;  4RS8 A;  4XMY A;  2LY9 A;  1H9G A;  2JMW A;  3ZQI A;  4BU2 A;  1CF7 B;  1G3W A;  4JK1 X;  2BW3 A;  2MYS A;  1Z05 A;  3BZC A;  4A6E A;  1U78 A;  1XGS A;  3REO A;  2Y9Y A;  2DQR A;  4P9U A;  2WY7 Q;  4BXF A;  1LQ1 A;  2Y30 A;  5J8C A;  2K86 A;  2Y2Z A;  3DTI A;  4PSX A;  2M3A A;  4NQW A;  3FHZ A;  4MFD A;  4HZF A;  3HSR A;  1LFU P;  1NG7 A;  3CF5 F;  1ETV A;  3TOB A;  3Q0V A;  1BR4 A;  3DPT A;  3F8N A;  1N77 A;  1YQA A;  4KJZ A;  1SD7 A;  1HW5 A;  2R7S A;  4XLE A;  4ASN A;  1UEL B;  5K1Y A;  2TCT A;  3DFG A;  2G0E A;  1YRN A;  4G12 A;  1R4N B;  4HV5 A;  3I0T A;  3IV5 A;  3E6D A;  1YI2 I;  5B1A H;  1FMW A;  3L2V A;  2L0K A;  2CO5 A;  2KMU A;  1JGG A;  2OV7 A;  2NXN B;  3DU6 A;  2MGQ A;  1BIA A;  2AO9 A;  1WJE A;  3Q3S A;  4XM3 A;  2JUG A;  4J01 A;  2CS3 A;  3LWF A;  1MBH A;  1ETW A;  3ECO A;  4M3D A;  3NWS A;  1MH3 A;  2QEX I;  3K0L A;  4BE2 A;  1MD0 A;  3DTE A;  4HST A;  4ZH4 F;  1X3Z B;  3K70 D;  1PVE A;  4XID A;  5KAI C;  1SC7 A;  2ZNY A;  3R6S A;  4YEL A;  3IKV A;  2P8T A;  4XLH A;  4GFB A;  2OZU A;  4Y33 A;  1EKE A;  4PUS A;  3U21 A;  3TDU C;  2VJI A;  2PEX A;  2M0M A;  2NVU B;  3L2Q A;  3ZQL A;  3WTZ A;  1ETX A;  4AD9 A;  4U7B A;  1FJL A;  3S1R J;  3CDI A;  4UB8 C;  5FKK A;  4XLF A;  2Z5U A;  4B3A A;  1Z6R A;  5GPC A;  2M34 A;  5DD4 A;  2FXA A;  1B6A A;  3GFL A;  5F1R A;  2CUF A;  4HX4 A;  3H9J A;  2DA7 A;  2LK2 A;  3ABM H;  2KIQ A;  1B72 B;  1QZZ A;  1RR7 A;  1TLH B;  2YX7 A;  4I99 C;  1WRJ A;  3CCV I;  5HLG A;  3H5R A;  4IEJ A;  2DCE A;  1JI8 A;  1R1V A;  2R7W A;  2AQE A;  2ID3 A;  3LSM A;  5FB2 A;  3NQO A;  3C18 A;  3PNY A;  3QP5 A;  3R61 A;  3OSF A;  3HRS A;  3GZ6 A;  5LGT A;  3HOV J;  3D5R C;  5B66 C;  2HOS A;  2R7U A;  3HIF A;  4EEF G;  1BI0 A;  1VQM I;  1I1G A;  3P9K A;  2M9H A;  4ZZL A;  1A6Q A;  1P9Q C;  3DF8 A;  2HDD A;  4AWX B;  1Z3X A;  3W6V A;  2K7L A;  2VKD A;  4F3Q A;  3BTC A;  1G3Y A;  4A3D J;  3K4N A;  3HRU A;  4R1H A;  2DAO A;  2KP6 A;  4IHY A;  1LPQ A;  1A6I A;  3S93 A;  4V19 K;  1Z6T A;  1KGS A;  4E4H A;  1IO2 A;  1ZRF A;  1ZR4 A;  2QEN A;  2ME0 A;  1HKQ A;  4N9I A;  2VB6 A;  4N4O B;  4PZJ A;  1E0E A;  3P5J A;  3J81 K;  3FKJ A;  4BBR J;  5M3F J;  1IAW A;  1I6H J;  4Z2Y A;  2YR2 A;  1CQT A;  1FIA A;  2P4W A;  1E3O C;  2DT7 B;  1R9T J;  2HPM A;  3HDD A;  3KX2 A;  4IQJ A;  5F64 A;  2Q0O A;  3ZRG A;  1W36 C;  1R23 A;  5K5O A;  4IQ4 A;  4P5O A;  4FHT A;  2O9L A;  2K85 A;  1GUU A;  2JUC A;  4TV7 A;  1DU6 A;  1F43 A;  4BY7 J;  3CC2 I;  3J7Y J;  3F23 A;  4CH7 A;  2R5Y B;  2AXL A;  2QGU A;  4XRF A;  1I3A A;  1MGT A;  5E20 A;  4N9H A;  2ZXW H;  2D45 A;  1EJ9 A;  2K9M A;  3CCU I;  2XSD C;  2E36 A;  3TW7 A;  5B1B H;  3H3V K;  4CZC A;  1IGN A;  2P5V A;  1ITY A;  1PUF A;  1ENH A;  4OIQ F;  5LRS A;  3HGG A;  2FBK A;  3RZD J;  5HS7 A;  2Y0S N;  2ZBK A;  3R0A A;  1YIT I;  1APL C;  3BTI A;  3KET A;  3M8E A;  4HQM A;  2PI0 A;  4HRI A;  1BR2 A;  1IUY A;  4RA2 A;  3L7W A;  1EF4 A;  2PBI A;  3LSK A;  3H92 A;  2HYJ A;  3Q9V A;  2KRC A;  1ZG1 A;  1RR8 C;  2RNG A;  1UG0 A;  3FDY A;  4HLY A;  5JHU A;  3H3Z A;  2ADU A;  4HEA 2;  2NVY J;  2EFW A;  3VYR B;  3H36 A;  1E2X A;  2E60 A;  4GO1 A;  3H35 A;  3S2D J;  1HSJ A;  3I5U A;  2Y0S A;  1ETY A;  3GTM J;  1VI0 A;  2FQ3 A;  4OIO F;  4MQV A;  3GVA A;  3DU5 A;  2DQL A;  5HDK A;  4KN4 X;  3HRT A;  4LB6 B;  1WGX A;  5LGU A;  3C7J A;  1Y39 A;  2X51 A;  1XMX A;  1QHH D;  3WTU C;  1U9O A;  3K4B A;  2CV1 A;  2WAE A;  1XS9 A;  1UHS A;  4QSH A;  2NOJ B;  4YRV A;  2IPQ X;  3BCB A;  3IP4 B;  2VKE A;  3W2V A;  3A1Y A;  2W84 A;  3GTQ J;  3V7S A;  4I2O A;  2XPW A;  3HPG A;  3MAJ A;  3E97 A;  3F9K A;  2PQ8 A;  2BY1 A;  2K9N A;  3ZGK A;  1V3F A;  3WG9 A;  4EJU A;  1FBU A;  1YOV B;  3GCM A;  1SFX A;  3OMY A;  1AKH B;  4I7H A;  2QZ8 A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 3A01 B;  5IOY A;  2E19 A;  3NAR A;  3OIO A;  2LP0 A;  2NVQ J;  1X2M A;  2Y31 A;  3BG9 A;  5FKN A;  3HEF A;  3SDG A;  4DYR A;  5E3M A;  5M5Y J;  4C3J J;  3MKL A;  3HOU J;  3MN2 A;  3F0C A;  4DZP A;  4LOC A;  1LE8 B;  4A93 J;  5EG0 A;  2HI3 A;  2VI6 A;  4A69 C;  4B4C A;  5F1J A;  1GVD A;  2CUE A;  1DU0 A;  3OOU A;  4DYC A;  2WB1 N;  3RZO J;  5FJ8 J;  4QIW N;  3CMY A;  4CYC B;  1OCP A;  2GM4 A;  4AYB N;  5EZG A;  5K7H A;  5JLX A;  1OJL A;  4L5E A;  1BL0 A;  3HM5 A;  2AHQ A;  4MFE A;  2KDZ A;  4ABZ A;  1FEX A;  2R0Q C;  3BT9 A;  2X48 A;  1TWG J;  2DA5 A;  2M2E A;  3BR2 A;  1W0T A;  2IBD A;  1POG A;  5EZH A;  4A3G J;  3BR3 A;  4Y7N J;  1GT0 C;  3BR5 A;  3JRB A;  4M3E A;  1IDZ A;  5FLM J;  5F08 A;  3ZOB A;  2YUS A;  5GPA A;  1K83 J;  4W1U A;  1UG2 A;  4X6A J;  1I50 J;  4UUS B;  2QCO A;  5C3E J;  1SFO J;  3MVP A;  3HB9 A;  3QPL A;  2TRT A;  2DMP A;  5C44 J;  1IC8 A;  3FIS A;  3LSR A;  4IHW A;  1P7I A;  4MIM A;  4J19 A;  3GTO J;  2EZH A;  1JKP C;  3CDL A;  2EH3 A;  2M0C A;  1WH5 A;  1ZTR A;  3O8H A;  2ZB9 A;  5M3M J;  3IH3 A;  4AC0 A;  2E1O A;  5J1Y A;  5M5X J;  1WI3 A;  1JTX A;  1VND A;  1T33 A;  4A3F J;  2L9R A;  3SJM A;  5C4X J;  1ETO A;  2IEK A;  2MG4 A;  3JRI A;  5IOZ A;  4V2G A;  2DN0 A;  2K9Q A;  5FKL A;  5M5W J;  4HNV A;  3JRD A;  1PUF B;  1HDP A;  4FIS A;  5IYB J;  1HLV A;  1WH7 A;  1MH4 A;  3PO3 J;  3OSG A;  2L7Z A;  4Y52 J;  2JN6 A;  3HOX J;  1IJW C;  2JK3 A;  2NVT J;  2MW8 A;  3WHC A;  4FCY A;  2DA3 A;  3S2H J;  2CQQ A;  5EEA A;  5E3O A;  4I76 A;  5F0H A;  3GTG J;  1BJZ A;  3HGY A;  1P7J A;  1Y1V J;  3LSG A;  5J1R A;  2XRL A;  5K7Z A;  1JKO C;  1JUP A;  3S1N J;  2E2H J;  4D5F A;  5J1U A;  3FK6 A;  1G2H A;  2H8R A;  4C3I J;  3VPR A;  3JRE A;  5IPA A;  4RDU A;  1Y1W J;  1B8I A;  3I4M J;  1TC3 C;  2RAE A;  1W0U A;  3GTL J;  3S1Q J;  2Y9Z A;  2B63 J;  2EQR A;  4I6Z A;  2JA5 J;  3PM1 A;  1JKR C;  1VFC A;  2X9D A;  4UUT A;  1JJ6 C;  1HOM A;  1AKH A;  5F27 A;  3ZQC A;  1JT6 A;  2K9S A;  1F36 A;  4A3I J;  3B6C A;  2NOG A;  1H88 C;  3A01 A;  1XC5 A;  5F0C A;  1RKW A;  1B72 A;  4DYQ A;  2CRG A;  1LFB A;  2R5Z B;  3BTJ A;  1X58 A;  3LSJ A;  1K61 A;  2EBI A;  4M3G A;  5EGO B;  2HXI A;  1RKT A;  4W97 A;  3FIW A;  3FKI J;  3G1M A;  2DMQ A;  1LE8 A;  1TWC J;  1GV5 A;  4XRS G;  2NVX J;  3GTK J;  4RBO A;  3K2A A;  2DA6 A;  2JA6 J;  2PMZ N;  1U9N A;  2DMT A;  3BQZ A;  1QRY A;  3BR1 A;  4CYC A;  2MSY A;  4M3B A;  2DMN A;  1IV6 A;  2IAI A;  2EZL A;  1OFC X;  2D5V A;  4A3B J;  1TWA J;  2XGD A;  4MLO A;  3S16 J;  3QPS A;  4B1R A;  5FKO A;  3ZQG A;  1FIP A;  2NS8 A;  5F04 A;  5IP7 J;  4M6V A;  1OCT C;  1Z77 A;  2LR8 A;  1MNM C;  3G1L A;  3L1P A;  1IRZ A;  1MBK A;  5FLV A;  5DTD A;  4XK4 A;  4XRS A;  3A02 A;  2ME6 A;  2FQ4 A;  3PO2 J;  3RQI A;  4JX4 A;  2XB0 X;  2N8G A;  2X6O A;  5EF6 A;  1IG7 A;  1RPW A;  2LFB A;  1WCM J;  5IYD J;  4A3J J;  1H8A C;  3K7A J;  3JR9 A;  4UUS A;  3IH4 A;  4FTH A;  1GDT A;  3JRA A;  1I3Q J;  2VUM J;  2R5Y A;  1ZGW A;  2LTP A;  5FKM A;  1HDD C;  3ZQF A;  1JUS A;  3GTJ J;  1U8B A;  2NS7 A;  2WV1 A;  2LY9 A;  2YU9 J;  2XGC A;  2JMW A;  2YS9 A;  3ZQI A;  1IUF A;  3RKQ A;  4BBS J;  3QQA A;  1HCR A;  1U78 A;  5EYR A;  2Y9Y A;  5E3L A;  2O8K A;  2Y30 A;  4DZJ A;  1T56 A;  1AU7 A;  2E2I J;  1A5J A;  1GV2 A;  2Y2Z A;  4D7M A;  5EDN A;  3Q0U A;  4MFD A;  2LKX A;  1LFU P;  3HKZ N;  1ETV A;  5K7F A;  3Q0V A;  4A3L J;  4BKX A;  3DEW A;  2TCT A;  2G0E A;  1YRN A;  5IYC J;  1RET A;  4JX6 A;  4G12 A;  3BQY A;  1BW6 A;  1ETK A;  3IV5 A;  2COB A;  3ZQH A;  1MBG A;  3A03 A;  1Q1V A;  2L0K A;  2EZK A;  3BG5 A;  1JGG A;  9ANT A;  3Q0W A;  5E3N A;  4A3E J;  2MGQ A;  4IHV A;  2AO9 A;  2K40 A;  3Q3S A;  1MBF A;  1MBH A;  2M8G X;  4MO7 A;  3JRH A;  1ETW A;  1NTC A;  4M3D A;  5JLW A;  1MH3 A;  2R7Z J;  3LNQ A;  3B6A A;  1VF9 A;  2HOT A;  3HOZ J;  3JRF A;  4XID A;  3G1O A;  5IP9 J;  4V2F A;  4GFB A;  2XPU A;  3BR0 A;  2VPR A;  1QVU A;  3JRG A;  1ZR2 A;  1B8I B;  4A3M J;  3ZQL A;  1ETX A;  4A3K J;  2E2J J;  1FJL A;  3S1R J;  5FKK A;  3TP3 A;  1FTT A;  3O8G A;  2ECC A;  1HF0 A;  2DMU A;  2ID6 A;  2JJ7 A;  4B3A A;  2DA2 A;  5GPC A;  2M34 A;  4BXX J;  2XPV A;  4FE7 A;  1NK3 P;  3LOC A;  1MBJ A;  2CUF A;  2LD5 A;  2OF7 A;  2DA7 A;  2KT0 A;  2LK2 A;  3JRC A;  1B72 B;  1RR7 A;  2CJJ A;  2I10 A;  1JKQ C;  1JT0 A;  4IEJ A;  2XGE A;  5DS9 A;  1BA5 A;  3CCY A;  1XG1 A;  2GLO A;  2LLK A;  3C2B A;  5IP6 A;  2ID3 A;  4NDL A;  2EZI A;  4BY1 J;  2GBY A;  2HXO A;  5EG0 B;  3OSF A;  4A3C J;  3HOV J;  2HOS A;  2DJN A;  4EEF G;  4XIC A;  3LSP A;  3BG3 A;  2M9H A;  3IH2 A;  4D7N A;  4D5C A;  1NK2 P;  2HDD A;  1AHD P;  2H1K A;  3W6V A;  4AUX A;  3S15 J;  2L7F P;  2OPT A;  3BTC A;  4A3D J;  1JTY A;  1IDY A;  2JWT A;  3GBG A;  3E7L A;  5F0F A;  3TED A;  2LVS A;  1D5Y A;  4IHY A;  1A6I A;  2JA7 J;  1JUM A;  1X2N A;  1S7E A;  1ZR4 A;  3S1M J;  2ME0 A;  3BR6 A;  1ORK A;  5M3F J;  2O7O A;  2P81 A;  4BBR J;  1I6H J;  2HOA A;  1CQT A;  1FIA A;  1E3O C;  1R9T J;  3SFI A;  3HDD A;  2DA1 A;  1UMQ A;  3M3Y J;  1WPK A;  1Z0X A;  2VKV A;  4JYK A;  5BNG A;  2O9L A;  1GUU A;  2HQ5 A;  1MBE A;  1DU6 A;  2FX0 A;  1ZKG A;  1F43 A;  4BY7 J;  2R5Y B;  1O4X A;  4JP0 A;  5J3L A;  1FTZ A;  3HBL A;  1SAN A;  3HOY J;  2XSD C;  5C4J J;  3TW7 A;  4M3F A;  3H3V K;  1H89 C;  2DTZ A;  2CU7 A;  1IGN A;  5HOD A;  1ITY A;  1PUF A;  1ENH A;  4FE4 A;  3HGG A;  3RZD J;  1MSF C;  2Y0S N;  2W48 A;  1TWF J;  2FD5 A;  4C3H J;  3D1N I;  1APL C;  3BTI A;  3NAU A;  4QTR A;  1EF4 A;  4X1E A;  2ELK A;  2L7M P;  2HYJ A;  3WHB A;  1ZQ3 P;  2R92 J;  3UKG A;  2NVY J;  3S14 J;  5GP9 A;  2FJ1 A;  3TP0 A;  2JA8 J;  2XB5 A;  3S2D J;  3TW6 A;  1BW5 A;  1ETY A;  3GTM J;  1YRN B;  2WAQ N;  4C2M J;  1VI0 A;  3FK7 A;  1ZK8 A;  1MSE C;  2QF7 A;  3HOW J;  2DA4 A;  3BTL A;  1WGX A;  3I4N J;  2R93 J;  3CQZ J;  1JJ8 C;  3H0G J;  1QVT A;  1U9O A;  4S0H B;  4DW6 A;  1XS9 A;  1UHS A;  4QSH A;  2ECB A;  2CQX A;  3DCF A;  3M4O J;  2VKE A;  3GTQ J;  4IHX A;  3GTP J;  2XPW A;  1RES A;  1QPI A;  3S17 J;  2R5Z A;  1ETQ A;  2K9N A;  4JX5 A;  1TWH J;  5EGO A;  1AKH B;  4XRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...