1LFUP

Nmr solution structure of the extended pbx homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 5'-D(*GP*CP*GP*CP*AP*TP*GP*AP*TP*TP*GP*CP*CP*C)-3'
publication title Lock and Key Binding of the HOX YPWM Peptide to the PBX Homeodomain
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2002-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1lfuP00
3SDGA 1JTYA 1PUFB 3LSPA 2CQQA 1G2HA 2NVXJ 3JRDA 3LSJA 1X2NA 3CMYA 3NAUA 2M2EA 3OIOA 2LD5A 4QSHA 2ECCA 3BR6A 3HOUJ 2O8KA 1JUPA 2K9SA 1IDZA 1GV5A 2GBYA 1OCPA 2QF7A 3A01A 1QVUA 3JRAA 2M8GX 1ETKA 1AKHB 1H88C 4A3FJ 4FE4A 1AU7A 1FJLA 2M9HA 2XB5A 1TWHJ 3F0CA 2G0EA 4CYCA 1DU6A 3FK6A 2E19A 3BR2A 5C3EJ 1TWAJ 1VI0A 2DMTA 1FTTA 2HI3A 1HLVA 2XGEA 5DTDA 4AUXA 2R5YB 2HQ5A 3RKQA 4ABZA 1JTXA 1ETOA 3B6AA 4S0HB 1ZR2A 4G12A 2DA3A 3GTJJ 2FJ1A 1NK2P 1MH4A 5E3MA 4X1EA 3S2HJ 2VUMJ 2JA7J 5K7FA 1MBEA 1CQTA 3S1RJ 3BR3A 2B63J 1ITYA 2XSDC 2CUEA 1PUFA 5K7HA 2E2HJ 1MBKA 1IJWC 4V2GA 3DEWA 3LSRA 5EZGA 2DA4A 5F27A 2IEKA 5IP7J 3TW6A 3BTJA 1FEXA 2VI6A 1JKPC 2CU7A 5HODA 5E3OA 1AKHA 2NVTJ 4HNVA 2ID6A 4AYBN 3HBLA 5IP6A 4IHVA 4A3LJ 3S15J 1RKTA 3LOCA 1WH5A 1S7EA 3PM1A 4QIWN 1ZR4A 1ZGWA 2TRTA 1TWGJ 3L1PA 3LNQA 1A5JA 4W97A 1GUUA 1WI3A 2FD5A 2EZKA 2R0QC 1WH7A 3VPRA 5GPAA 3HM5A 1RESA 4M3BA 2R5YA 1B72B 1P7JA 5IOYA 3BT9A 3FK7A 1T33A 1YRNA 1ETXA 1Z77A 3JRBA 2GLOA 4RDUA 3PO2J 2WAQN 1UG2A 2L9RA 4CYCB 5E3LA 2EZHA 1OCTC 3GTGJ 2DMNA 1HDDC 3I4NJ 5EG0A 5M5XJ 2XGCA 3JRGA 1T56A 2LY9A 2ME6A 3HOVJ 1X2MA 1QRYA 2DMPA 2HDDA 2DA5A 2ZB9A 1LFUP 2K9NA 4B4CA 4JX6A 2E1OA 4XICA 3W6VA 3M3YJ 5F0HA 1W0UA 1QVTA 1NTCA 2HXIA 4X6AJ 4BBRJ 2M34A 5GPCA 1JT0A 3BTIA 2NOGA 2O7OA 3FKIJ 4MFEA 1R9TJ 1XS9A 3Q0UA 1JJ8C 4GFBA 2R92J 3NARA 4MFDA 2XPWA 3QQAA 5EEAA 2XPVA 4A3CJ 1ORKA 4M3FA 5M5WJ 2EZIA 1IUFA 3ZQIA 1BW5A 5IPAA 2R93J 1B72A 3S17J 5C4XJ 4A93J 1IDYA 2LK2A 2GM4A 1MSEC 2YUSA 2CUFA 3SFIA 1GVDA 3OOUA 3PO3J 1ENHA 1HOMA 4XRSA 5F0CA 1QPIA 2R7ZJ 4I76A 1VF9A 2CRGA 1DU0A 1HF0A 1MBJA 2FX0A 4A3KJ 1H8AC 3QPSA 1D5YA 3ZOBA 2YU9J 3H0GJ 1JUMA 1WPKA 2YS9A 3JREA 5F08A 3BTCA 4BBSJ 3M4OJ 2TCTA 2EQRA 2OF7A 1YRNB 2Y2ZA 4A3IJ 1ETVA 2EZLA 1LE8A 4FTHA 4A3JJ 4D5CA 4EEFG 1I3QJ 3MN2A 4A3DJ 1RR7A 1UHSA 1MBGA 1JT6A 2VKVA 4DYQA 2MG4A 3S2DJ 1B8IA 5EG0B 2L7MP 4A3BJ 2JN6A 5EGOB 4XRMA 4FCYA 1IRZA 2X48A 1GV2A 2JA8J 3BR1A 2NVYJ 5FKLA 2DMUA 2M0CA 1U78A 3FISA 1UMQA 3K7AJ 3RZDJ 1ZTRA 1MSFC 2K9QA 3HOZJ 2L7FP 2JA5J 1BA5A 4A3EJ 4LOCA 2JWTA 3IH4A 4IEJA 3ZQCA 3G1LA 2JJ7A 2R5ZB 2K40A 3C2BA 5IP9J 3GTLJ 3Q0VA 2W48A 3I4MJ 5IYDJ 3B6CA 2KDZA 1W0TA 1O4XA 1GDTA 3BG3A 4RBOA 1JJ6C 3BG9A 2LP0A 3ZQLA 3BG5A 3WHCA 1MBHA 3IH2A 3CCYA 2L7ZA 4QTRA 2XB0X 2MGQA 3JRIA 5FKKA 3RQIA 4A3GJ 5JLWA 1H89C 3HOYJ 1JGGA 4FE7A 5K7ZA 3TP0A 3BTLA 5EF6A 1ZKGA 1Q1VA 3S16J 3MKLA 4W1UA 2IAIA 1JKQC 2WV1A 1BL0A 1NK3P 1MH3A 5EGOA 2VPRA 5FLVA 1ZK8A 2FQ4A 1RKWA 1Z0XA 2HYJA 1ETQA 4BY7J 2Y9YA 1LE8B 5FLMJ 1HDPA 1RPWA 3LSGA 4M3EA 1F36A 5M3FJ 1U9OA 2HXOA 5J3LA 4JP0A 1B8IB 2P81A 2ELKA 3ZQFA 2R5ZA 3JRHA 1AHDP 2X6OA 2AO9A 3CDLA 3OSFA 1JUSA 5FKOA 2LTPA 4DW6A 4IHYA 3HDDA 4BY1J 3TP3A 3Q3SA 4L5EA 5IYBJ 3JR9A 2X9DA 2JMWA 2DA2A 1I6HJ 1FTZA 2ECBA 4DYRA 1X58A 3HGYA 2DJNA 3HOWJ 4IHXA 5EZHA 1GT0C 4JYKA 2E2JJ 1I50J 2NVQJ 3H3VK 5GP9A 3SJMA 5J1YA 1IV6A 3FIWA 5J1RA 4A3MJ 2IBDA 1BW6A 1XC5A 3S14J 4UUTA 5FKMA 3HKZN 3WHBA 2N8GA 1IGNA 3GTQJ 2DTZA 2LFBA 5IYCJ 3S1NJ 1ETYA 3TEDA 4FISA 4D5FA 2LLKA 2DMQA 4C3JJ 1LFBA 5F1JA 4UUSB 3RZOJ 1K83J 1E3OC 3S1MJ 4M6VA 4MIMA 4AC0A 3K2AA 2WB1N 5DS9A 2LVSA 3D1NI 4XIDA 2D5VA 4MLOA 2Y9ZA 1Y1WJ 1K61A 4B1RA 1ETWA 1OFCX 4DYCA 2H1KA 2EBIA 3BQZA 2Y0SN 2DA7A 3GTOJ 3Q0WA 2I10A 4JX5A 3HGGA 4C2MJ 4V2FA 3JRFA 1EF4A 3A03A 2XRLA 2L0KA 1WCMJ 5J1UA 2Y31A 1MBFA 2HOSA 2EH3A 1U9NA 1MNMC 1POGA 3GTPJ 5BNGA 5EDNA 3E7LA 1FIAA 1VFCA 2E2IJ 3JRCA 4NDLA 1BJZA 2NS8A 3G1OA 5FKNA 2XGDA 4M3DA 2HOAA 4J19A 2HOTA 4JX4A 1SFOJ 3BR5A 2JA6J 5M3MJ 1P7IA 2H8RA 5F04A 2CJJA 2ME0A 5M5YJ 1U8BA 4A69C 1HCRA 2KT0A 3HEFA 5IOZA 4UUSA 4XK4A 1XG1A 5EYRA 4I6ZA 1IC8A 3BR0A 4D7NA 1OJLA 2RAEA 4C3HJ 1JKOC 2O9LA 2DN0A 3QPLA 2MSYA 1IG7A 2LR8A 5C44J 2ID3A 2OPTA 3IH3A 2VKEA 3O8HA 3OSGA 4XRSG 1TC3C 3GTKJ 1F43A 3GBGA 1FIPA 3A01B 2COBA 5E3NA 4DZPA 1ZQ3P 2JK3A 2PMZN 3MVPA 3A02A 1VNDA 2XPUA 3BQYA 4B3AA 3IV5A 2DA6A 3O8GA 2NS7A 3HB9A 1SANA 2Y30A 3UKGA 2CQXA 5JLXA 5C4JJ 3G1MA 1Y1VJ 4MO7A 4DZJA 1APLC 1TWCJ 3DCFA 2QCOA 1JKRC 1RETA 4BXXJ 3ZQHA 3ZQGA 3TW7A 3CQZJ 2AHQA 3S1QJ 4C3IJ 1WGXA 9ANTA 2DA1A 2MW8A 3HOXJ 2LKXA 4IHWA 1TWFJ 1A6IA 4M3GA 4BKXA 5FJ8J 3GTMJ 5F0FA 4Y52J 4D7MA 4Y7NJ
chains in the Genus database with same CATH superfamily
5TRDA 1Y8QB 2P4WA 1I1GA 5IT9K 1HKSA 1YW9A 1JTYA 3KEYA 2AXLA 2CO5A 1WWXA 2FXAA 3BLYA 4II2A 5GTIC 6PAXA 3BOQA 4CH7A 4IF4A 2GWRA 2NVXJ 3LSJA 1X2NA 2EV0A 1JHHA 3E5QA 5HDNA 4OU0A 1T08B 5KK1A 3KP7A 3HC7A 1R71A 4E7SA 4FETA 3VYSB 1JUPA 1OCPA 2XC7A 1U2WA 1ZRFA 3OYAA 4X0GA 3SDBA 2VLAA 3OR2C 3J7YJ 2M9HA 2XB5A 5FLXK 4IL6C 2V1XA 3AL0B 1YS6A 4CYCA 3VB2A 1JHFA 1DPRA 3FK6A 4QWQA 2FUG2 1TWAJ 3KEQA 3CCUI 2V79A 2WB1A 2HVRA 4BQAA 4ABZA 4CCNA 4DNCA 1JTXA 3CD6I 1BOAA 3FMRA 2XV4S 4BE1A 4XN3A 3GTJJ 4LIUA 3GW2A 4X1EA 2ELJA 1OYIA 3NWTA 1MBEA 1CQTA 2MC4A 2L02A 4K2EA 2LY2A 2HDCA 3CP2A 3W6JB 2BVMA 2IVMA 2DQLA 3BY6A 4I09A 4BJTA 1D1BA 4G7ZF 2GIZA 2E2HJ 2L3DA 1MBKA 2ZSIB 3R0JA 2O0YA 1HXDA 3DP7A 2V9VA 2V6CA 3AL0C 2UXXA 2VOPA 1ACIA 2EIJH 3TW6A 4HSRA 4RMNA 3BPVA 4F93B 3A0BC 3K1NA 4EGYA 2PJRA 5HODA 1X19A 1AKHA 3WTZA 2PG4A 2MFZA 2NVUB 5IP6A 3PUBA 3S15J 2RQQA 5FRNA 4EMSA 3IP4B 3OYLA 4PJJA 2DK8A 1ZR4A 1YIJI 4KT6A 2TRTA 3MKWB 2NNNA 3G71I 2EZKA 2D2WA 5GAHJ 4BEHB 1ZN2A 2NXNB 1EA3A 4YIFA 2AQFA 2ZJPF 5K5OA 2FBIA 5E18F 2VODA 4AIHA 5E1XA 1W1WE 4RDUA 4Y4RA 2YX7A 2L9VA 4ANJA 2LY1A 4CYCB 1HKTA 2FA5A 1VQNI 2Y48A 1HDDC 1UHWA 4LFUA 4BACA 2LY9A 3P9IA 4UV8A 1X2MA 2M1BA 2CWEA 2R7TA 1Z05A 4B4CA 2ACJA 2E1OA 1D5VA 1I39A 1MNDA 2LSOA 4BBRJ 2M34A 4LK0F 2NAZA 4AVZA 3LA3A 3VFZA 3GYHX 3BTIA 2HOEA 2NOGA 3FKIJ 3ZRGA 3F8NA 3ZPLA 3A0HC 5L3DA 3Q0UA 5D8LB 1MGTA 4M3FA 2RN7A 3ROUA 1UZCA 3RSNA 4XN0A 2QEXI 1Z1DA 1B72A 2OC6A 3S17J 3CCLI 2KJCA 3K4KA 2HNHA 4GRIA 3FHNA 2F4IA 5B66C 2XF7A 2OZUA 2XKOA 2YUSA 3HPHA 5KHDA 3W2AA 3DEEA 3G6EI 3OOUA 4RAYA 2ISZA 4HX7A 4G6TB 4AD9A 2CRGA 2IA0A 5DCFA 4ENJA 2M3AA 2FE3A 1MBJA 4WXHA 2FX0A 3V8KA 2X0LA 4HBLA 1EJ9A 2L9SA 5DD8A 2DDAA 5CVRA 1RUOA 3UNGC 2HTSA 2K4BA 1VQ6I 3M8EA 3S3MA 2JUCA 2QBYA 3PIOF 3OR1C 2H8WA 3M4OJ 1MMDA 2TCTA 3I58A 2OF7A 1RI7A 4Z6YA 1IRGA 1ETVA 2EZLA 1LE8A 4FTHA 4S05A 4A3DJ 4NBQA 2LREA 4HEA2 4DJAA 4C2UA 1GHCA 1GLNA 2VKVA 4ITVA 4DYQA 2IJLA 1D8KA 1I6XA 3K4JA 1VZ0A 1B8IA 3NEUA 2VJ5A 4LLNA 2XAQA 4XRMA 4IHSA 3W6KB 1JE8A 3SZGA 1ON2A 1WVRA 2NVYJ 2GA2A 2M0CA 1U78A 1GVJA 3D5SC 1YX3A 2CYYA 2K9QA 3H9JA 3L2UA 1VQ5I 4XLPF 3VSLA 2JA5J 5HS8A 3HYIA 4U7BA 1FYMA 4A3EJ 4LOCA 3IH4A 1XGOA 3ZQCA 2DOAA 2IS1A 3O3KA 1LJ9A 1KA8A 2K40A 4I01A 1BM9A 4XBFA 3WTVC 1U5TA 2HTJA 5IP9J 3GTLJ 2W48A 3B6CA 4KIGA 1G3YA 4HLXA 2CQKA 2DT5A 1UCRA 1Z6TA 5A2QK 2R7DA 5HS7A 4Q5SF 5KCMA 4XONA 4OOIA 4FHTA 3E5XA 4S04A 4GXOA 5H2FC 3ONQA 4A3GJ 2EB7A 4OMYA 1RC9A 1SC7A 3BP8A 4FE7A 5K7ZA 4YEJA 3AFHA 3TDUC 3BTLA 3OYHA 1JKQC 1WJEA 1P9QC 2EPFA 1HQCA 1IN8A 3C1DA 3I71A 1NK3P 1MH3A 2MC3A 3BCAA 2L9NA 4HG2A 4CHUA 3K4BA 2DBBA 1XCVA 4KYWA 2FQ4A 4LD5A 1Z0XA 1UB9A 2Y9YA 3EUHA 1LE8B 4LITA 5FLMJ 3I54A 2GOMA 1RPWA 2XASA 3BG7A 3KP3A 3SQNA 3LSGA 3VODA 2IGMA 3DLLF 1F36A 5AIPA 4MTDA 1R22A 1KGSA 1OCRH 1P6RA 2HXOA 3E6DA 2LC2A 1YG2A 2WTEA 4A0YA 1B8IB 3VEPA 1MMGA 2XSJC 3QU6A 5CVIA 4KA4A 2JT1A 2JVHA 3BJAA 3QWLA 4M6YA 4JBAA 3KZYA 4XLAA 3DWLE 3HDDA 3Q3SA 4L5JA 1TZLA 4ZZDA 2V26A 3PUFA 5D6FA 3I9V2 4BDZA 1I6HJ 3HL2A 1XX5A 1S5LC 3L9FA 3P5JA 1N75A 4CCKA 1S7OA 3L00A 4ENMA 2O8XA 2MABA 4IZZA 1Z91A 5EZHA 4B43A 2ESNA 4JYKA 1GT0C 3RPUD 2E2JJ 1U5TB 1SMYF 4Q47A 5CVJA 5K1YA 4G7OF 2E36A 4RGXA 2EIMH 1TW3A 5DM7F 2CH0A 3KYLA 4L18B 4ZDLA 3WHBA 1IGNA 3TMOA 5LHHA 4ENNA 4XKCA 3DKXA 1KYWA 5KVRA 1Z67A 4RB3C 2LH9A 1KU3A 4EJWA 2LLKA 2BYVE 3RZOJ 1FMVA 1E3OC 5FO5A 3S1MJ 4M6VA 2CUJA 2BEOA 3K2AA 2L7KA 3BZKA 3FM5A 1R1UA 3BWGA 2LVSA 3R4KA 3CO7C 2W4SA 3HIFA 4ZYEA 2QSGX 4XIDA 3K70D 4G94A 2HFHA 5ILSA 1ZREA 2P5KA 3FX3A 4YELA 1KQ0A 3R61A 1IF1A 1OFCX 4N9HA 4ETSA 2H1KA 3H3UA 5FROA 2DA7A 1WJCA 2MLKA 3CMMA 1U5TC 3WE2A 1SVLA 1R5GA 4C2MJ 3MFKA 4V2FA 3JRFA 3PJRA 2R7UA 1EF4A 1R6RA 4E7ZA 2H6BA 4KJZA 4G7HF 5CVUA 2X6WA 1MKMA 3FHZA 1MBFA 3ISPA 3TKYA 2HOSA 2BY3A 1MNMC 1HW2A 2IGKA 1KU2A 5E79C 4BU2A 1U3EM 2JSCA 2G7HA 2JRTA 4HF2A 3ZN0A 3BZCA 5BNGA 3I59A 3JRCA 1G3WA 4NDLA 1OMIA 3X2QH 5FKNA 1LQ1A 2WY8Q 4J19A 4P9FA 4II3A 2M8EA 1P7IA 3Q9VA 2UZKA 5ICGA 4RA2A 2ME0A 1K6YA 4KN4X 1F1ZA 3WU0A 4BJ5C 1HCRA 5IOZA 1KONA 4M73A 1HSJA 3QYBA 4PZJA 1V54H 4UUSA 3LSIA 3EUHC 4L9JA 4I6ZA 2X1EA 1D3YA 2RAEA 1YJWI 4RB2C 3RTRA 4U7DA 3U21A 3I5UA 4ZH4F 1IG7A 2LR8A 3GFJA 1XD7A 4BUPA 2OPTA 2MH2A 3H36A 2VBYA 1Q1HA 2BW3A 2MA3A 4XRSG 4ASNA 4HX4A 3GFLA 3GVAA 4KT5C 4Z2YA 2QKLB 3A01B 2COBA 3OYKA 2CQ7A 4DZPA 1ZQ3P 2JK3A 2Y69H 2ZCWA 1Y0NA 3OIPA 4BQNA 5DV5A 1IN7A 2IS4A 3B02A 3O8GA 4E7HA 4IX7A 4IRIA 1SANA 2KRCA 4U88A 4HW0A 3TO7A 2RREA 1YFHA 5C4JJ 1LDDA 2GXGA 1YX5A 2XAGA 1P4AA 1QO0D 3FXLA 3LQQA 3COAC 3CF5F 3N05A 4G9YA 5LHGA 1JKRC 4EV0A 5D5WB 4IPAA 1BBYA 4E7KA 3ZQQA 2YU3A 9ANTA 4OIRF 2DA1A 4IHWA 1TWFJ 1A6IA 2L4AA 4BKXA 2P6TA 4Y52J 1JXSA 4D7MA 4Y7NJ 4EVIA 1IRXA 3QODA 4HV5A 4I02A 3RKYA 1PUFB 3I59B 2IT0A 2CQQA 2GIVA 1R1VA 1G2HA 1XGMA 3BROA 3VSKA 2UUZA 3MWMA 2LG4A 4NB5A 3BR6A 3U2RA 1IDZA 2VBWA 2M8GX 3ZP5A 1ETKA 2KQRA 2WADA 5DCMB 4H4KC 4A3FJ 2LOOA 5JR3A 3MEXA 1FJLA 1TWHJ 5LEJA 3HKZA 2WBMA 1IN6A 3F0CA 5E17F 1TLHB 3WGIA 1H0MA 3FXUA 5BMZA 4CCMA 5C3EJ 2DMTA 4HDUA 2HI3A 4HF1A 1HLVA 5DTDA 2G7UA 5F1RA 3OL4A 2R5YB 1R23A 3SZTA 4ZYGA 1S3JA 2ZJ2A 4HQMA 3RPUA 5LRSA 4S0HB 1ZR2A 1BI2A 2AQEA 5J4YA 4BXUA 3OYBA 2DA3A 3D0SA 1O57A 3BCBA 1G6NA 1MH4A 2VUMJ 4EM0B 5GAGJ 3CCQI 3BR3A 2E5ZA 1YO5C 2QENA 4P5OA 2DLLA 4BL0B 1R1TA 1XTAA 2CUEA 2EA4A 1B1BA 1DQUA 2KHMA 1T2KA 1EKEA 2RNJA 2H27A 1VQKI 5EJCA 4G6QA 1OCCH 3FM3A 4KITB 1IJWC 3LSRA 2DA4A 2K85A 4NC8A 4BH9A 2IEKA 5BPDA 3QP5A 5IP7J 1WSUA 4MEYF 1OISA 2ADUA 1XMAA 2R7QA 5E3OA 4HNVA 2QM3A 3VDXA 4AYBN 2PFBA 5BS6A 2VIXA 3AG4H 4A3LJ 3LQRA 3OYCA 1B6AA 4I2OA 1WH5A 4QIWN 2VN2A 1IN4A 3ABMH 3FKJA 4HQEA 1A5JA 4W97A 1WI3A 2FD5A 4HDVA 2VQCA 3HTSB 2CV1A 1RESA 3OYJA 1DP3A 1P7JA 2WA0A 3BT9A 3FK7A 3S93A 2ZJRF 4E7LA 1ODDA 3OS0A 2H09A 4IVNA 1XMXA 1FMWA 1U6GA 1XDSA 3ZQ7A 3O6BB 2HZDA 3ZXSA 5E3LA 2I5UA 1DDNA 2EZHA 2E1CA 1EH6A 1OCTC 4N4NB 2DMNA 4BE2A 5EG0A 3J81K 5IT9Z 3HUGA 1FP1D 5AIQA 1T56A 3UR3C 2ME6A 3AKZA 5CPRB 3F23A 3HOVJ 4OIOF 4MQVA 3MKYB 5LGNA 1MMNA 1V55H 5CQGA 2YR2A 4UNOA 2IS2A 4JX6A 4BAYA 1ZGAA 4XICA 1KU9A 3KZZA 5F0HA 2H94A 2IS6A 3J7ZI 2QSHX 2HXIA 4JK1X 3WTUC 4MQ9F 1JT0A 1RUNA 1ZG3A 2DFHA 4E7JA 1PYVA 4MFEA 3KETA 1PP8F 3IKTA 2V1UA 3E6BA 1TNTA 2V6EA 4MFDA 2JVGA 5FLXZ 1U0JA 2A6EF 5EEAA 3K4CA 5M5WJ 4IHTA 2COMA 2XRNA 1IUFA 3IWZA 4PJLA 4B44A 3ZQIA 1YS7A 3GLXA 4GYGA 4BEHA 1BW5A 4HLYA 2DPDA 2R7SA 4LG0B 3IL2A 2LMDA 3HHHA 2LKSA 2F5CA 2YSRA 1Y0UA 1GVDA 3G2BA 2DFIA 2ZXHA 2W24A 3EPZA 4I76A 1X3UA 2GXBA 4I99C 3H9GA 1VQ9I 2QGUA 3CJTB 2O6GE 3MD2A 5B5EC 4A3KJ 2Q8KA 2FSWA 3LL7A 2TDXA 1K4TA 1D5YA 2YU9J 4GDFA 4XNFA 1XSXA 4CICA 2HKXA 3JREA 5F08A 2RDPA 4BBSJ 4RGRA 2EQRA 4BHPA 1W5CC 1CF7A 2F4MB 2ZFWA 3IKVA 5IT3A 3K70C 4EEFG 1G8XA 1I3QJ 2STWA 3E1SA 1FWZA 3RJPA 3FWEA 3U1KA 3PFIA 3HPGA 1MBGA 1UHMA 1USSA 2EFPA 4XOPA 5FB2A 4N9IA 4RAFA 5BPIA 5EG0B 2L7MP 3HUGB 2JN6A 3F8BA 4FCYA 2DO7A 2VOOA 2HQNA 4I7HA 3HOTA 2I8DA 3ASNH 1GV2A 4RAZA 5ED4A 1K6OA 1TQPA 4ENKA 1FBUA 2W00A 5LEKA 3F8FA 3GWZA 1UMQA 3K7AJ 3RZDJ 5K5RA 1MSFC 1SFEA 2P7CB 2BGCA 4UVAA 1HW5A 2VC1A 2CW8A 2L7FP 1S7AA 2R3SA 3KP4A 1OYWA 1YE9A 2H6CA 2JWTA 2KJBA 2QSFX 4IEJA 2KIMA 1A6QA 1R7JA 1BC8C 2M30A 5DDGA 1D0ZA 3HSRA 5IYDJ 2LRDA 2BHZA 4ZJZA 1YITI 1FOYA 1V5FA 4ESJA 2W1OA 3KE2A 4CDGA 2JPCA 3BG9A 1BOBA 3ZQLA 3WHCA 3EETA 1N25A 2KFDA 3CCYA 2L7ZA 3O2PE 1ZG1A 4PFPA 3JRIA 5FKKA 2OTJI 4HV6A 1Z3YA 4KIFA 3HOYJ 3F72A 1T39A 3GF2A 2O5RA 1ZKGA 4XL9A 1M1EB 3S16J 3HTUA 3SXYA 2PMZA 3D5LA 2PEXA 3LA2A 1X4PA 2EILH 2ZJQF 2XIGA 3A4CA 2HQAA 2X1DA 3S3OA 1HA8A 2R7XA 3CF2A 3ZCOA 2RGVA 2IA2A 1YJNI 2DU9A 1ETQA 3ZMUA 4KMUX 4N4OB 5KAIC 1CF7B 1HDPA 2JPBA 4M3EA 5D4SA 3M8FA 3LSMA 3LSKA 4PGHA 5FRMA 2XF5A 1LVAA 4JP0A 5HNFA 4PJMA 1JGSA 3CCRI 1J2XA 3E0JB 2RVCA 3ZQFA 3TOAA 4QPQA 3JRHA 4LLGF 3L2CA 1W7PD 2AO9A 1TQMA 3OSFA 1JUSA 1T95A 1C0WA 4IHYA 4BY1J 1ON1A 3ZN1A 4NNJA 5IYBJ 1OR7C 4WK8F 3OMYA 1FTZA 3DTEA 4WX9A 5HDGA 4YFKF 2R7VA 2ZXWH 3HGYA 5E8GA 1BI3A 2DJNA 3HOWJ 1E3PA 5JHUA 3M9AA 3P9KA 4XLNF 4R79A 3L09A 3QYFA 4UHTA 3ESWB 2W85A 2W82A 2HGCA 5J1YA 2CW7A 1XMKA 3QPTA 1WJ5A 1K7AA 3DPLC 2M87A 1XC5A 5J8FA 3CC7I 4UUTA 3S14J 3TL4X 5FKMA 2DYRH 3V4GA 3K4NA 3FMSA 2DTZA 2LFBA 4Y13A 1MDMA 2DOEA 2RKHA 1XB4A 1V5GA 4C3JJ 3FXMA 4E4HA 2HVQA 3CJQB 2M45A 4U0VA 5KAFC 3BG6A 2W25A 4WF2A 2MBFA 5DS9A 2PJPA 3F6OA 3ZMTA 3OY9A 4OIQF 1OCOH 4B3XA 4PJNA 1BJAA 4XSZF 3RCOA 2CFOA 2OV7A 4B1RA 1D0XA 3KFWX 2KZGA 4RB1A 4LG3A 4DYCA 1H9TA 2EBIA 2Z1DA 2H1LA 2Y0SN 4RM2A 1LPQA 1WI9A 3GTOJ 1HKQA 2BY0A 4OAYA 1FX7A 3Q0WA 4XKBA 2I10A 4DIQA 3DBLB 1BI0A 3L2QA 4J01A 2L0KA 2A3SA 5J1UA 1MIJA 5A2QZ 2F5VA 2L54A 3HRTA 1B4AA 1W4MA 1CGPA 2DTRA 1REPC 1IW7F 3TGNA 5HOOA 1FIAA 3CZ6A 2OQRA 2E2IJ 3PSFA 3JTGA 5D6EA 3G1OA 5F6FA 3J7AO 4RM3A 3JCUC 1SFOJ 2QQ9A 5M3MJ 1F4KA 1Y56A 4CCOA 1WFXA 1WJDA 2M0MA 2PN6A 4L5IA 4L9VA 1SFUA 5F04A 1IZ1A 1U8BA 4A69C 3FXOA 2K3PA 1SAUA 2KT0A 2XAUA 3HEFA 4EQQA 1F9NA 3OYMA 2EFNA 2VPLA 3QYEA 1FBQA 5EYRA 3B73A 1IXCA 1OJLA 2DN0A 3I4PA 4XR6A 5LD2C 2FQ3A 2UXNA 5C44J 2ID3A 2VKEA 1DPUA 2DAOA 3WODF 1F43A 2M4GA 2V1DA 2XAHA 1TT0A 2RNGA 2DOFA 3S32A 1MDMB 5E3NA 4AU7A 2OTLI 5LBQA 1W36D 3A02A 3IV5A 1VQLI 2DA6A 4CZZA 2ZNZA 3E6CC 3K1PA 2Y30A 1G3TA 3J80Z 5EEGA 3WTWC 1IXSB 4BS9A 1MD0A 2ICWG 1V3FA 5CYVA 3RPQA 4OIPF 4BGDA 4NHJA 2VC0A 4IRGA 3W3CA 1TWCJ 3M07A 3C18A 2XGXA 4U87A 2Z33A 1VQPI 4H0EA 1JI8A 3RQ4A 3VOEA 5LGTA 2GQQA 3TW7A 5CLSA 2AHQA 2EFWA 3S1QJ 3BZ6A 3J80K 1A04A 4C9YA 2MW8A 3HOXJ 3CMAI 1RR8C 3WTYC 3MKZA 2LKXA 3KP2A 5FJ8J 1FP2A 1IN5A 5D8KB 1PUEE 4YG2F 2XDVA 4UUVA 2L01A 2DI3A 1XSDA 2Y75A 2E1MB 4GYIA 3V8LA 3LSPA 2PBIA 3CC4I 4CCJA 4L0ZB 2Z3YA 4Q48A 2CUZA 4XLEA 1IAWA 1LEBA 3GFMA 5TGTA 2ZO4A 3SYTA 4JQFA 2BZTA 4XSXF 3V8JA 2DT7B 3NAUA 3OIOA 1VQOI 2LD5A 1QU3A 2F2EA 2ECCA 4QSHA 1KZHA 4B8XA 2GOXB 2HKOA 3HOUJ 3LAPA 2K9SA 4EJUA 2QF7A 2GBYA 4RLQA 3A01A 2P6SA 1QVUA 3JRAA 4Y33A 1Z3XA 1TNSA 4L0YB 1W7PA 2HYFA 3AG2H 3E3VA 1H88C 4FE4A 1T6SA 3KLNA 1DP7P 1AU7A 3P7NA 2GAUA 2KRFA 4C30A 3OYIA 3IAS2 1YTYA 2G0EA 2P5LC 4HPQA 2E19A 5IY5H 3MQ0A 2KP6A 2XGEA 4A2UA 1J7KA 3CLQA 3IAM2 5ERIA 4O5VA 2E1MC 4ZTFA 2OUMA 3RKQA 4ZDPA 1XGSA 1KQ8A 3EDPA 1ETOA 1FOXA 3RIRA 1NG7A 4BXFA 3R6SA 4ESBA 2FJ1A 2OQGA 3ZMSA 4KDPA 1VQMI 3U9GA 4OAZA 3S2HJ 2JA7J 1TBXA 5K7FA 4KUMA 1I5ZA 2DPUA 3LWFA 1ITYA 2XVCA 4RGUA 2XF6A 3JTHA 4FT8A 1PUFA 3KP6A 4J00A 2J5OA 2VT2A 3WTTC 2DXIA 2NOJB 2FF4A 3DEWA 5EEHA 3P9CA 2A69F 3H3ZA 3F8CA 3K0LA 2M7AA 3N97A 3BTJA 1V4RA 2VI6A 4M6XA 1WKMA 1JKPC 3WTXC 2CU7A 5ICEA 2X6XA 1AOYA 2NVTJ 3RDIA 2ID6A 1GXQA 1TW2A 2RC4A 5DCMA 2ISYA 4MTEA 3HBLA 3J7AY 3ZMVA 1HBXG 3V7SA 3DPUA 1ZH5A 1S7EA 3PM1A 1ZYRF 2V7FA 1ZGWA 1X4OA 3C3WA 4F55A 1TWGJ 3LNQA 2X85A 1ONVA 2R0QC 1GUUA 5GPAA 1FOWA 3NQOA 4M3BA 2R5YA 1UAAA 1S29A 3MMYB 1EH7A 5HLGA 2CV2A 1T33A 3CDHA 1S6LA 1W7PB 2A61A 1ETXA 3M8JA 3NWSA 1Z77A 2GLOA 5JVGF 1P2FA 3MZYA 3PO2J 2QVOA 1TT5B 2WAQN 1UG2A 4ZYAA 3VYUB 3RKXA 4XLFA 1HSTA 1W5TA 4ON0A 1IXRC 3ASOH 3ULQB 5FD6A 4OMZA 5ILVA 3WG7H 5D5XB 4O3MA 4E7IA 5M5XJ 2BHYA 3BC8A 2VQLA 3CC2I 1E3HA 3Q9SA 4PUSA 2FOWA 2DMPA 2HDDA 2DA5A 1FT9A 2K9NA 5KNLA 3FXRA 3W6VA 1FPQA 3GUDA 1QVTA 1NTCA 4CO8A 2P5VA 2G9WA 4HYEA 4F3QA 1LDKB 2VONA 4LK1F 5GPCA 3FBNB 1WJAA 4A6DA 1TL8A 2O61A 2K4JA 5L3GA 2O7OA 1XS9A 1R9TJ 3BDDA 1YW8A 4LIVA 4EJVA 5LLQA 5LGUA 2F5FA 3GX4X 4R1HA 1JJ8C 4GFBA 2VASA 3NARA 5FGMA 2XPWA 3QQAA 1ZGJA 2XPVA 4A3CJ 1ORKA 3R60A 3KEOA 4P55A 3WU1B 1Z7LA 2EJRA 3CMEI 5IPAA 4XM3A 3LMMA 2QQBA 4RB0A 4A93J 5FFZA 5TJJA 4LB6B 1IDYA 1NH3A 2GM4A 3CDIA 2CUFA 1VTNC 2ESHA 2A07F 1BC7C 4CZCA 4C2TA 3PO3J 2FEZA 1HOMA 5F0CA 3I53A 1QPIA 5DD4A 1VF9A 4UY8I 1Z9CA 1E2XA 1A36A 4RS8A 3C7JA 3PL8A 2JQ7A 2YPRA 2V9PA 4XOTA 1QHGA 3L2RA 1RIOH 1ZRCA 1ZHFA 4CSWA 1JUMA 1WPKA 2F6CA 2YS9A 3K9TA 3T5XA 5GTHC 3ERMA 3BTCA 5LFAA 4ZYDA 3K4MA 1BIBA 1ZAOA 2KPMA 4YRVA 1VQ8I 4D5CA 3MN2A 3R0AA 5F64A 3DF8A 1UHSA 4MGRA 3WU2C 1SD4A 3PSIA 4A3BJ 2IA1A 4HAMA 3CCVI 2CGPA 5EGOB 2KMUA 2O03A 4F52A 3V7CA 4ZYHA 4M9XA 3BR1A 1YOVB 5ILUA 2GA1A 5CQEA 2M5WA 3F3XA 3GZ5A 3FISA 2QZ8A 1ZTRA 2WAEA 3JAMZ 1D1CA 2FNPA 3DXJF 2LF7A 3HOZJ 4LG0A 3OL3A 4NC7A 4PDKA 3K2ZA 1FYLA 1G59A 4GCVA 3G1LA 2MLGA 3ABKH 2R5ZB 2Q0OA 1UG0A 1B59A 3C2BA 1Y8RB 2JZYA 3EUKL 2E34A 1B9MA 3Q0VA 1BR1A 1WRJA 1O4XA 3C2GA 4F7ZA 3BG3A 1GDTA 4B47A 1XDUA 3IC7A 4AYBA 3JAMK 1T8IA 2DDBA 1FBSA 2LP0A 1QZYA 2L4MA 3CJRB 1J09A 2K7LA 3BG5A 1J59A 4RAGA 3J81Z 1IRFA 2BOLA 2NYXA 4QTRA 2XB0X 4QLCU 4I98B 5JLWA 1H89C 4A6EA 1JGGA 1OYYA 5E8IA 4KN7X 3OS1A 3MKLA 2ETHA 5AONA 4UB6C 5H6QA 5J40A 3HZJA 1FNNA 1W36C 5HDKA 4BHCA 1J5YA 2A5WA 1K4SA 4HSTA 1YQAA 2VPRA 3WGGA 3AG1H 4L9TA 2L2OA 2XHKA 3IHUA 4BY7J 1OPCA 4O6JA 1UJ8A 1X3ZB 2LBFB 2A05A 4B09A 4AIKA 3G4SI 4NC6A 2GZWA 2HVSA 2EA2A 1A35A 1U9OA 2JSPA 3M1EA 2A68F 5J3LA 1B9NA 4LMYA 2L5QA 2QLZA 2VBXA 2ELKA 4IQJA 2FMYA 4ZDOA 2E7WA 3KIOA 3HSFA 1AHDP 5H6RA 2QQ8A 4EJOA 3CDLA 3SFZA 3FXQA 5FKOA 2JRMA 2OJED 4NQWB 4DW6A 3TP3A 4L5EA 3RKWA 3RYRA 3GMEA 2O3FA 2DA2A 4DBRA 3OV8A 3ERED 2RQPA 1X58A 3MZ8A 3VWBA 4KICA 4KNYA 1X3WB 2BXZA 2MH9A 1R49A 2EFOA 2FRHA 2LKPA 1ZG5A 3I56I 2PI0A 4EM2A 3FXJA 5GP9A 1D1AA 2B0LA 3FIWA 3JSOA 3F22A 3D5RC 2MD0A 1R4NB 1S8NA 3W2VA 2ZKZA 5J47A 1OR7A 3L2VA 3ECHA 2DFEA 1FOKA 3GTQJ 4ZTJA 2K5CA 2E35A 5L3FA 2HEOA 5IYCJ 3K4LA 3K6GA 3G73A 1ETYA 3CUOA 3DBHB 1T98A 2JTVA 4PK4A 3TEDA 2JA2A 2DMQA 1PJRA 4KFCA 4WWCA 4IKFA 2R7OA 2Q1ZB 2W57A 3NRVA 3PQJA 4OINF 4AC0A 2WB1N 4IQ4A 2CG4A 1L0OC 4ZC3A 3T8RA 1QZEA 2F4OB 1N77A 4LLLA 2K9MA 3HHGA 4MLOA 4HNTA 4KIBA 3KX2A 4CXFA 3GXOA 1K61A 2BY1A 2E60A 1YJ9I 4PFOA 3H92A 4OWRB 4B48A 2F5EA 2OZ6A 1YIOA 4JX5A 2X1CA 3EYIA 2KDOA 2KL4A 2VQHA 1Z6RA 4FX0A 3SEZA 1QBJA 1WJFA 3GEZA 1MJBA 3TOBA 2DFFA 2OBPA 4D0PA 4FQGA 4HNUA 2VBZA 2KRHA 2E5NA 3OYNA 2ELHA 1G4DA 4IOCF 3OYGA 1I27A 1E0EA 3EYYA 3OYFA 4XLHA 4MNUA 2KKOA 4A0ZA 1BJZA 2NS8A 2XGDA 3QU3A 5BOXA 2HOTA 1LNWA 2CMPA 3BR5A 2JA6J 5E20A 2H8RA 4LGWA 4XKVA 2CV0A 2CJJA 5M5YJ 2PMUA 4WXDA 3IRQA 2WC2A 1R36A 3ZMDA 3BR0A 3T1BA 4D7NA 2FU4A 2O9LA 4HRIA 3RI4A 2VB6A 3IH3A 2KIFA 1TC3C 3DU6A 4KISA 3GBGA 1QQIA 1FIPA 1LEAA 5DM6F 3CUQA 4XORA 4EATA 2UWMA 2DK5A 2WY7Q 2BBYA 3OOPA 2XAJA 2B9SA 2PMZN 3MVPA 2W84A 2ZMEA 1VNDA 2XPUA 5ICFA 4HX8A 3DEUA 2NS7A 1N78A 1LVKA 3FDYA 3HB9A 2STTA 3UKGA 2DJIA 2EFQA 2P7VB 3GZNB 3L7WA 2LF8A 3PNTA 4DZJA 3DCFA 1O3RA 5D5VB 3ZQHA 1H9GA 3ZQGA 3CQZJ 5GADJ 2HS5A 4HF0A 1F5TA 3DU5A 1D8JA 4BQQA 2OCCH 3N4MA 1WGXA 5D4RA 2D1HA 1T0FA 2ZSHB 1RZ4A 1I3AA 4QPOA 1QPMA 5LHIA 1I1SA 1SFKA 1BR2A 2AXTC 2WAFA 4UB8C 2QWWA 2IGOA 3SDGA 1Y39A 2Z2SB 1DGWY 3HRMA 3H5NA 3CP8A 2VE9A 1QGPA 4UV9A 3JRDA 1MNEA 1P4WA 2F48A 3CMYA 2M2EA 1ZARA 4AWXB 2VL8A 3F8MA 2O8KA 1XCBA 2Z9OA 1EH8A 1O7FA 3S8PA 1MMAA 1GV5A 1ZLKA 4I0BA 4Y17A 2PJRB 3WG9A 1AKHB 3WTSC 3QAHA 4TV7A 4YFNF 3JW4A 2XAFA 3FZVA 3KYDB 3HJEA 4V19K 3HRUA 3SHFA 1KU7A 3TO9A 5HLHA 4RLFA 1SAXA 2IGNA 2VJJA 1DU6A 3BR2A 3K1MA 1VI0A 1AA7A 1FTTA 3CUQB 2EV6A 4AUXA 3GZ6A 2QUFA 1SD6A 1RNLA 3LSHA 1PP7U 2HQ5A 4BYYA 2BY2A 2ZMEB 4LB5A 3T0YA 2WWYA 5E1ZB 3B6AA 4G12A 1VQ7I 1NK2P 5E3MA 2MD5A 2DODA 1P92A 2QKMB 3S1RJ 2Y0SA 5H20A 4P1WA 1SMTA 2B63J 4CUGA 2XSDC 1BN5A 4PCQA 2PQ8A 3FXKA 5K7HA 1WHUA 5JVTA 4M9ZA 2IPQX 1UELB 3HG9A 2KIQA 2ZNYA 3DKYA 4V2GA 5EZGA 5F27A 3BPXA 3VYRB 3ELKA 3G3ZA 1ULYA 4M9SA 1RRJA 2X51A 1FEXA 5CKTA 3CUQC 5CVVA 1O3SA 4EJTA 1QA6A 2CQNA 3F6VA 3DPTA 2J5PA 3PNYA 1U8RA 1O3TA 2ZMEC 1P4XA 3ECOA 4A5NA 2R7WA 4IHVA 1VQ4I 3QOEA 1RKTA 2QA4I 3LOCA 2CS3A 2K9LA 2FOKA 3QP6A 1LUJB 2IW5A 3ZR8X 2VE8A 3EQLF 3L1PA 4XKWA 2BE5F 2ZFUA 3AG3H 3EUAA 1WH7A 3VPRA 4XRFA 4ZZLA 3HM5A 1S72I 1B72B 4YFXF 5IOYA 1SD7A 1USTA 1ZELA 3CCEI 3LAJA 1YRNA 1T0FC 5B1AH 2FMLA 5HNHA 3JRBA 2VXZA 1AWCA 3U1DA 1IUYA 4U0WA 1EV7A 2QQAA 2L9RA 3K10A 5B1BH 1QHHD 1YYVA 2FBHA 4A5MA 3OS2A 3REOA 3GTGJ 2M4KA 3I4NJ 2CFXA 3KYCB 2XGCA 3CESA 2DCEA 2UV1A 3JRGA 1FLIA 1O3QA 2HQRA 3V7RA 2A6HF 2QBYB 1QRYA 2ZB9A 4UVBA 1LFUP 1PDNC 5FD5A 2HR3A 5DYMA 1R00A 4RGSA 5J6XA 1S9HA 3M3YJ 1W0UA 4CYDA 4I0AA 2A5YB 1MZBA 4X6AJ 1FC3A 2E71A 3GCMA 4XLCA 4CGZA 5L3EA 1J0RA 4BQOA 2XUBA 1GXPA 4BJ6C 2LDUA 2D1VA 2V1NA 4MEXF 1BI1A 2VQGA 2R92J 5JHFA 1IO2A 3ABLH 2IRFG 5E1WA 2EZIA 3F9KA 3KCCA 3GLLA 2R7RA 1L3LA 4E70A 3E6MA 2X6YA 2X4HA 4IXAA 2R93J 1BR4A 5C4XJ 1YW7A 3LSTA 1D0YA 3QRFF 2LK2A 3HRSA 1MSEC 4N0BA 1SEUA 2K3FA 2Z99A 4HOBA 3SFIA 3BJOA 2XROA 3L2WA 3JSPA 1ENHA 3QOPA 4XRSA 2R7ZJ 1YLFA 2VKHA 1DU0A 2OU2A 1HF0A 4A0XA 1R5HA 3LA7A 3RYPA 3H5AA 1H8AC 3QPSA 2Q2EA 3ZOBA 3H0GJ 4UXNA 3CJNA 1X1CA 5JFRA 3T8TA 5TISC 2PMHA 5BQTA 5GAEJ 1YRNB 3ZMZA 2Y2ZA 4A3IJ 4Q4ZF 4PSXA 3MCZA 4A3JJ 3CTAA 3OWTA 1RR7A 4CCLA 2A6TA 1ZRDA 2B7EA 1JT6A 2W7NA 4HZFA 2ZC2A 4ESFA 2MG4A 3I0TA 4UVCA 3S2DJ 3C2HA 5J4VA 2R4GA 5B3SH 2OAZA 4YIRX 1IV8A 1X1DA 2HWVA 1IRZA 2ZXIA 2X48A 2JA8J 1XN7A 5FFXA 1T38A 5FKLA 2DMUA 1OCZH 5DUIA 1W5SA 3DV8A 2KLOA 1OLTA 4D1QA 2BV6A 3F21A 2HZTA 4DQ2A 1BA5A 1TP4A 1FSEA 3SEQA 5D5UB 4LJZF 1K78A 3SZPA 3MZHA 2JJ7A 3H1CA 3PFYA 3WE3A 3I4MJ 3E5UA 4G6DA 4AVPA 4U0YA 2KDZA 1W0TA 2QYOA 2ZXJA 1O7LA 3TDZC 2FBKA 4RBOA 4P96A 4CA0A 2HDWA 4PJ0C 1JJ6C 1NHAA 3DTIA 3I3LA 2HPMA 1MBHA 2EV5A 2HU9A 3IH2A 4IO9F 4BDYA 2EINH 4XMYA 1MW7A 2MGQA 3A1YA 1WQ2A 3RQIA 3I64A 1K79A 3BJ6A 4NUBA 2HPIA 4MHGA 5JI6A 3FBIB 5HLIA 4KMFA 3M7GA 3W2WA 3CCSI 5HLTA 3TP0A 5EF6A 5L3BA 3PNVA 4WXCA 1NG6A 1Q1VA 4W1UA 2IAIA 2LNBA 2KZVA 2WV1A 3HSEA 1BL0A 1V5EA 4DOZA 1SVMA 1STZA 2Q2EB 2ZBKA 1A31A 3TO6A 5EGOA 3CCJI 2D45A 4EM1A 2WAQA 2CW0F 1ZK8A 4R8HA 4E6KG 1MJ9A 5FLVA 3A2KA 4M74A 1RKWA 1MJAA 2F5DA 2HYJA 1OKRA 4DBQA 2JUGA 2DW4A 3ZGKA 2VJ4A 1UFMA 1YI2I 4AIDA 5DUKA 1HW1A 5M3FJ 4DGWB 1WZ2A 2XKPA 5DEQA 1FY7A 3AAFA 1LKXA 3OIQA 4M72A 1XGNA 2P81A 4JOMA 2R5ZA 4WCGA 3WGHA 2P0WA 2X6OA 1J9IA 3IRRA 2V9KA 4F91B 1Z7UA 2LTPA 4AM3A 1LB2A 5HS9A 3V42A 3FF5A 3PIPF 3JR9A 2X9DA 1SD5A 2JMWA 4IJAA 1YHQI 3QPHA 3HXLA 5K5QA 2DT6A 3HOSA 2ECBA 2KISA 4DYRA 2C6YA 3DBRB 4Y15A 2DYSH 1K78B 4IHXA 3CLOA 2EWNA 1I50J 1SFXA 2NVQJ 3H3VK 5CJ9A 3K69A 3SJMA 4L9NA 3IWFA 4EGZA 1IV6A 1TQIA 1X1PA 5J1RA 4A3MJ 2IBDA 3IUOA 1BW6A 1PVEA 2Y0MA 1X1BA 2CSOA 3HKZN 2RV8A 2N8GA 1WJBA 4PSWA 1MMSA 1X1AA 3DQVC 4BNCA 3S1NJ 1Y6IA 2MYSA 3ML6A 3DFGA 4FISA 4D5FA 1LFBA 5F1JA 4UUSB 1HC8A 1QZZA 3ABUA 4AIJA 4BE0A 1K83J 2OA4A 3H9QA 2LBFA 4MIMA 2VJIA 2PX9A 3KP5A 2E7XA 3D1NI 3I55I 2D5VA 2Y9ZA 1XPXA 1Y1WJ 5LRRA 2BW3B 2OCEA 3TQNA 1FZPB 1ETWA 2GXAA 2R7FA 1R58A 3BQZA 4M71A 3H35A 2PLYA 1J75A 2IXSA 2Z16A 3HGGA 4NQWA 1LDJA 3LFKA 1Z21A 3A03A 2VT3A 1G3SA 4P9UA 2XRLA 1FYKA 2WV0A 1WCMJ 4HA8A 2Y31A 2NRAC 4FASD 2EH3A 3TBIA 1U9NA 3VYTB 1POGA 2BVLA 3GTPJ 3DLAA 1FSHA 2DQRA 2KIUA 5EDNA 3E7LA 4PGGA 3M1CA 3H0DA 2P8TA 1VFCA 2M7BA 3Q5FA 4GGGA 1R5ID 2NS0A 2V4JC 4M3DA 2HOAA 4BHBA 5L3CA 3DKWA 4IOAF 2K86A 4JX4A 3OYDA 4F92B 1QNTA 1SVOA 1ZLJA 2K02A 3FMQA 4FX4A 3CCMI 3ABTA 4XK4A 4Y3OA 3KZIC 1XG1A 1DGRM 2K27A 3PQKA 3MAJA 1IC8A 3S3NA 4C3HJ 1JKOC 2EK5A 3QPLA 2MSYA 2Z5UA 3KPHA 1XSVA 4G8XA 3LFUA 1E17A 3O8HA 5ICCA 3OSGA 3GTKJ 1TTYA 2VKDA 4GO1A 2EIKH 1KYZA 2LYCA 4YIIA 3BQYA 4B3AA 2E1NA 2VXDA 3OYEA 1KQ9A 2CQXA 5JLXA 5J8CA 3GO5A 1OQYA 3S2WA 1BIAA 3G1MA 1Y1VJ 1R4MB 3KLOA 4MO7A 1APLC 3GFIA 2HYGD 2QCOA 1DUXC 4XQFA 1RETA 4IRHA 5HVQC 1LFPA 2FNAA 4BXXJ 3E97A 4C3IJ 3H5RA 3CO6C 2BXYA 4A12A 1ERDA 2YX4A 3DTKA 2OD5A 2NNYA 2AS5F 4D9JA 4M3GA 3GTMJ 2IP2A 5F0FA
chains in the Genus database with same CATH topology
3SDGA 1JTYA 1PUFB 3LSPA 2CQQA 1G2HA 2NVXJ 3JRDA 3LSJA 1X2NA 3CMYA 3NAUA 2M2EA 3OIOA 2LD5A 4QSHA 2ECCA 3BR6A 3HOUJ 2O8KA 1JUPA 2K9SA 1IDZA 1GV5A 2GBYA 1OCPA 2QF7A 3A01A 1QVUA 3JRAA 2M8GX 1ETKA 1AKHB 1H88C 4A3FJ 4FE4A 1AU7A 1FJLA 2M9HA 2XB5A 1TWHJ 3F0CA 2G0EA 4CYCA 1DU6A 3FK6A 2E19A 3BR2A 5C3EJ 1TWAJ 1VI0A 2DMTA 1FTTA 2HI3A 1HLVA 2XGEA 5DTDA 4AUXA 2R5YB 2HQ5A 3RKQA 4ABZA 1JTXA 1ETOA 3B6AA 4S0HB 1ZR2A 4G12A 2DA3A 3GTJJ 2FJ1A 1NK2P 1MH4A 5E3MA 4X1EA 3S2HJ 2VUMJ 2JA7J 5K7FA 1MBEA 1CQTA 3S1RJ 3BR3A 2B63J 1ITYA 2XSDC 2CUEA 1PUFA 5K7HA 2E2HJ 1MBKA 1IJWC 4V2GA 3DEWA 3LSRA 5EZGA 2DA4A 5F27A 2IEKA 5IP7J 3TW6A 3BTJA 1FEXA 2VI6A 1JKPC 2CU7A 5HODA 5E3OA 1AKHA 2NVTJ 4HNVA 2ID6A 4AYBN 3HBLA 5IP6A 4IHVA 4A3LJ 3S15J 1RKTA 3LOCA 1WH5A 1S7EA 3PM1A 4QIWN 1ZR4A 1ZGWA 2TRTA 1TWGJ 3L1PA 3LNQA 1A5JA 4W97A 1GUUA 1WI3A 2FD5A 2EZKA 2R0QC 1WH7A 3VPRA 5GPAA 3HM5A 1RESA 4M3BA 2R5YA 1B72B 1P7JA 5IOYA 3BT9A 3FK7A 1T33A 1YRNA 1ETXA 1Z77A 3JRBA 2GLOA 4RDUA 3PO2J 2WAQN 1UG2A 2L9RA 4CYCB 5E3LA 2EZHA 1OCTC 3GTGJ 2DMNA 1HDDC 3I4NJ 5EG0A 5M5XJ 2XGCA 3JRGA 1T56A 2LY9A 2ME6A 3HOVJ 1X2MA 1QRYA 2DMPA 2HDDA 2DA5A 2ZB9A 1LFUP 2K9NA 4B4CA 4JX6A 2E1OA 4XICA 3W6VA 3M3YJ 5F0HA 1W0UA 1QVTA 1NTCA 2HXIA 4X6AJ 4BBRJ 2M34A 5GPCA 1JT0A 3BTIA 2NOGA 2O7OA 3FKIJ 4MFEA 1R9TJ 1XS9A 3Q0UA 1JJ8C 4GFBA 2R92J 3NARA 4MFDA 2XPWA 3QQAA 5EEAA 2XPVA 4A3CJ 1ORKA 4M3FA 5M5WJ 2EZIA 1IUFA 3ZQIA 1BW5A 5IPAA 2R93J 1B72A 3S17J 5C4XJ 4A93J 1IDYA 2LK2A 2GM4A 1MSEC 2YUSA 2CUFA 3SFIA 1GVDA 3OOUA 3PO3J 1ENHA 1HOMA 4XRSA 5F0CA 1QPIA 2R7ZJ 4I76A 1VF9A 2CRGA 1DU0A 1HF0A 1MBJA 2FX0A 4A3KJ 1H8AC 3QPSA 1D5YA 3ZOBA 2YU9J 3H0GJ 1JUMA 1WPKA 2YS9A 3JREA 5F08A 3BTCA 4BBSJ 3M4OJ 2TCTA 2EQRA 2OF7A 1YRNB 2Y2ZA 4A3IJ 1ETVA 2EZLA 1LE8A 4FTHA 4A3JJ 4D5CA 4EEFG 1I3QJ 3MN2A 4A3DJ 1RR7A 1UHSA 1MBGA 1JT6A 2VKVA 4DYQA 2MG4A 3S2DJ 1B8IA 5EG0B 2L7MP 4A3BJ 2JN6A 5EGOB 4XRMA 4FCYA 1IRZA 2X48A 1GV2A 2JA8J 3BR1A 2NVYJ 5FKLA 2DMUA 2M0CA 1U78A 3FISA 1UMQA 3K7AJ 3RZDJ 1ZTRA 1MSFC 2K9QA 3HOZJ 2L7FP 2JA5J 1BA5A 4A3EJ 4LOCA 2JWTA 3IH4A 4IEJA 3ZQCA 3G1LA 2JJ7A 2R5ZB 2K40A 3C2BA 5IP9J 3GTLJ 3Q0VA 2W48A 3I4MJ 5IYDJ 3B6CA 2KDZA 1W0TA 1O4XA 1GDTA 3BG3A 4RBOA 1JJ6C 3BG9A 2LP0A 3ZQLA 3BG5A 3WHCA 1MBHA 3IH2A 3CCYA 2L7ZA 4QTRA 2XB0X 2MGQA 3JRIA 5FKKA 3RQIA 4A3GJ 5JLWA 1H89C 3HOYJ 1JGGA 4FE7A 5K7ZA 3TP0A 3BTLA 5EF6A 1ZKGA 1Q1VA 3S16J 3MKLA 4W1UA 2IAIA 1JKQC 2WV1A 1BL0A 1NK3P 1MH3A 5EGOA 2VPRA 5FLVA 1ZK8A 2FQ4A 1RKWA 1Z0XA 2HYJA 1ETQA 4BY7J 2Y9YA 1LE8B 5FLMJ 1HDPA 1RPWA 3LSGA 4M3EA 1F36A 5M3FJ 1U9OA 2HXOA 5J3LA 4JP0A 1B8IB 2P81A 2ELKA 3ZQFA 2R5ZA 3JRHA 1AHDP 2X6OA 2AO9A 3CDLA 3OSFA 1JUSA 5FKOA 2LTPA 4DW6A 4IHYA 3HDDA 4BY1J 3TP3A 3Q3SA 4L5EA 5IYBJ 3JR9A 2X9DA 2JMWA 2DA2A 1I6HJ 1FTZA 2ECBA 4DYRA 1X58A 3HGYA 2DJNA 3HOWJ 4IHXA 5EZHA 1GT0C 4JYKA 2E2JJ 1I50J 2NVQJ 3H3VK 5GP9A 3SJMA 5J1YA 1IV6A 3FIWA 5J1RA 4A3MJ 2IBDA 1BW6A 1XC5A 3S14J 4UUTA 5FKMA 3HKZN 3WHBA 2N8GA 1IGNA 3GTQJ 2DTZA 2LFBA 5IYCJ 3S1NJ 1ETYA 3TEDA 4FISA 4D5FA 2LLKA 2DMQA 4C3JJ 1LFBA 5F1JA 4UUSB 3RZOJ 1K83J 1E3OC 3S1MJ 4M6VA 4MIMA 4AC0A 3K2AA 2WB1N 5DS9A 2LVSA 3D1NI 4XIDA 2D5VA 4MLOA 2Y9ZA 1Y1WJ 1K61A 4B1RA 1ETWA 1OFCX 4DYCA 2H1KA 2EBIA 3BQZA 2Y0SN 2DA7A 3GTOJ 3Q0WA 2I10A 4JX5A 3HGGA 4C2MJ 4V2FA 3JRFA 1EF4A 3A03A 2XRLA 2L0KA 1WCMJ 5J1UA 2Y31A 1MBFA 2HOSA 2EH3A 1U9NA 1MNMC 1POGA 3GTPJ 5BNGA 5EDNA 3E7LA 1FIAA 1VFCA 2E2IJ 3JRCA 4NDLA 1BJZA 2NS8A 3G1OA 5FKNA 2XGDA 4M3DA 2HOAA 4J19A 2HOTA 4JX4A 1SFOJ 3BR5A 2JA6J 5M3MJ 1P7IA 2H8RA 5F04A 2CJJA 2ME0A 5M5YJ 1U8BA 4A69C 1HCRA 2KT0A 3HEFA 5IOZA 4UUSA 4XK4A 1XG1A 5EYRA 4I6ZA 1IC8A 3BR0A 4D7NA 1OJLA 2RAEA 4C3HJ 1JKOC 2O9LA 2DN0A 3QPLA 2MSYA 1IG7A 2LR8A 5C44J 2ID3A 2OPTA 3IH3A 2VKEA 3O8HA 3OSGA 4XRSG 1TC3C 3GTKJ 1F43A 3GBGA 1FIPA 3A01B 2COBA 5E3NA 4DZPA 1ZQ3P 2JK3A 2PMZN 3MVPA 3A02A 1VNDA 2XPUA 3BQYA 4B3AA 3IV5A 2DA6A 3O8GA 2NS7A 3HB9A 1SANA 2Y30A 3UKGA 2CQXA 5JLXA 5C4JJ 3G1MA 1Y1VJ 4MO7A 4DZJA 1APLC 1TWCJ 3DCFA 2QCOA 1JKRC 1RETA 4BXXJ 3ZQHA 3ZQGA 3TW7A 3CQZJ 2AHQA 3S1QJ 4C3IJ 1WGXA 9ANTA 2DA1A 2MW8A 3HOXJ 2LKXA 4IHWA 1TWFJ 1A6IA 4M3GA 4BKXA 5FJ8J 3GTMJ 5F0FA 4Y52J 4D7MA 4Y7NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDG A;  1JTY A;  1PUF B;  3LSP A;  2CQQ A;  1G2H A;  2NVX J;  3JRD A;  3LSJ A;  1X2N A;  3CMY A;  3NAU A;  2M2E A;  3OIO A;  2LD5 A;  4QSH A;  2ECC A;  3BR6 A;  3HOU J;  2O8K A;  1JUP A;  2K9S A;  1IDZ A;  1GV5 A;  2GBY A;  1OCP A;  2QF7 A;  3A01 A;  1QVU A;  3JRA A;  2M8G X;  1ETK A;  1AKH B;  1H88 C;  4A3F J;  4FE4 A;  1AU7 A;  1FJL A;  2M9H A;  2XB5 A;  1TWH J;  3F0C A;  2G0E A;  4CYC A;  1DU6 A;  3FK6 A;  2E19 A;  3BR2 A;  5C3E J;  1TWA J;  1VI0 A;  2DMT A;  1FTT A;  2HI3 A;  1HLV A;  2XGE A;  5DTD A;  4AUX A;  2R5Y B;  2HQ5 A;  3RKQ A;  4ABZ A;  1JTX A;  1ETO A;  3B6A A;  4S0H B;  1ZR2 A;  4G12 A;  2DA3 A;  3GTJ J;  2FJ1 A;  1NK2 P;  1MH4 A;  5E3M A;  4X1E A;  3S2H J;  2VUM J;  2JA7 J;  5K7F A;  1MBE A;  1CQT A;  3S1R J;  3BR3 A;  2B63 J;  1ITY A;  2XSD C;  2CUE A;  1PUF A;  5K7H A;  2E2H J;  1MBK A;  1IJW C;  4V2G A;  3DEW A;  3LSR A;  5EZG A;  2DA4 A;  5F27 A;  2IEK A;  5IP7 J;  3TW6 A;  3BTJ A;  1FEX A;  2VI6 A;  1JKP C;  2CU7 A;  5HOD A;  5E3O A;  1AKH A;  2NVT J;  4HNV A;  2ID6 A;  4AYB N;  3HBL A;  5IP6 A;  4IHV A;  4A3L J;  3S15 J;  1RKT A;  3LOC A;  1WH5 A;  1S7E A;  3PM1 A;  4QIW N;  1ZR4 A;  1ZGW A;  2TRT A;  1TWG J;  3L1P A;  3LNQ A;  1A5J A;  4W97 A;  1GUU A;  1WI3 A;  2FD5 A;  2EZK A;  2R0Q C;  1WH7 A;  3VPR A;  5GPA A;  3HM5 A;  1RES A;  4M3B A;  2R5Y A;  1B72 B;  1P7J A;  5IOY A;  3BT9 A;  3FK7 A;  1T33 A;  1YRN A;  1ETX A;  1Z77 A;  3JRB A;  2GLO A;  4RDU A;  3PO2 J;  2WAQ N;  1UG2 A;  2L9R A;  4CYC B;  5E3L A;  2EZH A;  1OCT C;  3GTG J;  2DMN A;  1HDD C;  3I4N J;  5EG0 A;  5M5X J;  2XGC A;  3JRG A;  1T56 A;  2LY9 A;  2ME6 A;  3HOV J;  1X2M A;  1QRY A;  2DMP A;  2HDD A;  2DA5 A;  2ZB9 A;  1LFU P;  2K9N A;  4B4C A;  4JX6 A;  2E1O A;  4XIC A;  3W6V A;  3M3Y J;  5F0H A;  1W0U A;  1QVT A;  1NTC A;  2HXI A;  4X6A J;  4BBR J;  2M34 A;  5GPC A;  1JT0 A;  3BTI A;  2NOG A;  2O7O A;  3FKI J;  4MFE A;  1R9T J;  1XS9 A;  3Q0U A;  1JJ8 C;  4GFB A;  2R92 J;  3NAR A;  4MFD A;  2XPW A;  3QQA A;  5EEA A;  2XPV A;  4A3C J;  1ORK A;  4M3F A;  5M5W J;  2EZI A;  1IUF A;  3ZQI A;  1BW5 A;  5IPA A;  2R93 J;  1B72 A;  3S17 J;  5C4X J;  4A93 J;  1IDY A;  2LK2 A;  2GM4 A;  1MSE C;  2YUS A;  2CUF A;  3SFI A;  1GVD A;  3OOU A;  3PO3 J;  1ENH A;  1HOM A;  4XRS A;  5F0C A;  1QPI A;  2R7Z J;  4I76 A;  1VF9 A;  2CRG A;  1DU0 A;  1HF0 A;  1MBJ A;  2FX0 A;  4A3K J;  1H8A C;  3QPS A;  1D5Y A;  3ZOB A;  2YU9 J;  3H0G J;  1JUM A;  1WPK A;  2YS9 A;  3JRE A;  5F08 A;  3BTC A;  4BBS J;  3M4O J;  2TCT A;  2EQR A;  2OF7 A;  1YRN B;  2Y2Z A;  4A3I J;  1ETV A;  2EZL A;  1LE8 A;  4FTH A;  4A3J J;  4D5C A;  4EEF G;  1I3Q J;  3MN2 A;  4A3D J;  1RR7 A;  1UHS A;  1MBG A;  1JT6 A;  2VKV A;  4DYQ A;  2MG4 A;  3S2D J;  1B8I A;  5EG0 B;  2L7M P;  4A3B J;  2JN6 A;  5EGO B;  4XRM A;  4FCY A;  1IRZ A;  2X48 A;  1GV2 A;  2JA8 J;  3BR1 A;  2NVY J;  5FKL A;  2DMU A;  2M0C A;  1U78 A;  3FIS A;  1UMQ A;  3K7A J;  3RZD J;  1ZTR A;  1MSF C;  2K9Q A;  3HOZ J;  2L7F P;  2JA5 J;  1BA5 A;  4A3E J;  4LOC A;  2JWT A;  3IH4 A;  4IEJ A;  3ZQC A;  3G1L A;  2JJ7 A;  2R5Z B;  2K40 A;  3C2B A;  5IP9 J;  3GTL J;  3Q0V A;  2W48 A;  3I4M J;  5IYD J;  3B6C A;  2KDZ A;  1W0T A;  1O4X A;  1GDT A;  3BG3 A;  4RBO A;  1JJ6 C;  3BG9 A;  2LP0 A;  3ZQL A;  3BG5 A;  3WHC A;  1MBH A;  3IH2 A;  3CCY A;  2L7Z A;  4QTR A;  2XB0 X;  2MGQ A;  3JRI A;  5FKK A;  3RQI A;  4A3G J;  5JLW A;  1H89 C;  3HOY J;  1JGG A;  4FE7 A;  5K7Z A;  3TP0 A;  3BTL A;  5EF6 A;  1ZKG A;  1Q1V A;  3S16 J;  3MKL A;  4W1U A;  2IAI A;  1JKQ C;  2WV1 A;  1BL0 A;  1NK3 P;  1MH3 A;  5EGO A;  2VPR A;  5FLV A;  1ZK8 A;  2FQ4 A;  1RKW A;  1Z0X A;  2HYJ A;  1ETQ A;  4BY7 J;  2Y9Y A;  1LE8 B;  5FLM J;  1HDP A;  1RPW A;  3LSG A;  4M3E A;  1F36 A;  5M3F J;  1U9O A;  2HXO A;  5J3L A;  4JP0 A;  1B8I B;  2P81 A;  2ELK A;  3ZQF A;  2R5Z A;  3JRH A;  1AHD P;  2X6O A;  2AO9 A;  3CDL A;  3OSF A;  1JUS A;  5FKO A;  2LTP A;  4DW6 A;  4IHY A;  3HDD A;  4BY1 J;  3TP3 A;  3Q3S A;  4L5E A;  5IYB J;  3JR9 A;  2X9D A;  2JMW A;  2DA2 A;  1I6H J;  1FTZ A;  2ECB A;  4DYR A;  1X58 A;  3HGY A;  2DJN A;  3HOW J;  4IHX A;  5EZH A;  1GT0 C;  4JYK A;  2E2J J;  1I50 J;  2NVQ J;  3H3V K;  5GP9 A;  3SJM A;  5J1Y A;  1IV6 A;  3FIW A;  5J1R A;  4A3M J;  2IBD A;  1BW6 A;  1XC5 A;  3S14 J;  4UUT A;  5FKM A;  3HKZ N;  3WHB A;  2N8G A;  1IGN A;  3GTQ J;  2DTZ A;  2LFB A;  5IYC J;  3S1N J;  1ETY A;  3TED A;  4FIS A;  4D5F A;  2LLK A;  2DMQ A;  4C3J J;  1LFB A;  5F1J A;  4UUS B;  3RZO J;  1K83 J;  1E3O C;  3S1M J;  4M6V A;  4MIM A;  4AC0 A;  3K2A A;  2WB1 N;  5DS9 A;  2LVS A;  3D1N I;  4XID A;  2D5V A;  4MLO A;  2Y9Z A;  1Y1W J;  1K61 A;  4B1R A;  1ETW A;  1OFC X;  4DYC A;  2H1K A;  2EBI A;  3BQZ A;  2Y0S N;  2DA7 A;  3GTO J;  3Q0W A;  2I10 A;  4JX5 A;  3HGG A;  4C2M J;  4V2F A;  3JRF A;  1EF4 A;  3A03 A;  2XRL A;  2L0K A;  1WCM J;  5J1U A;  2Y31 A;  1MBF A;  2HOS A;  2EH3 A;  1U9N A;  1MNM C;  1POG A;  3GTP J;  5BNG A;  5EDN A;  3E7L A;  1FIA A;  1VFC A;  2E2I J;  3JRC A;  4NDL A;  1BJZ A;  2NS8 A;  3G1O A;  5FKN A;  2XGD A;  4M3D A;  2HOA A;  4J19 A;  2HOT A;  4JX4 A;  1SFO J;  3BR5 A;  2JA6 J;  5M3M J;  1P7I A;  2H8R A;  5F04 A;  2CJJ A;  2ME0 A;  5M5Y J;  1U8B A;  4A69 C;  1HCR A;  2KT0 A;  3HEF A;  5IOZ A;  4UUS A;  4XK4 A;  1XG1 A;  5EYR A;  4I6Z A;  1IC8 A;  3BR0 A;  4D7N A;  1OJL A;  2RAE A;  4C3H J;  1JKO C;  2O9L A;  2DN0 A;  3QPL A;  2MSY A;  1IG7 A;  2LR8 A;  5C44 J;  2ID3 A;  2OPT A;  3IH3 A;  2VKE A;  3O8H A;  3OSG A;  4XRS G;  1TC3 C;  3GTK J;  1F43 A;  3GBG A;  1FIP A;  3A01 B;  2COB A;  5E3N A;  4DZP A;  1ZQ3 P;  2JK3 A;  2PMZ N;  3MVP A;  3A02 A;  1VND A;  2XPU A;  3BQY A;  4B3A A;  3IV5 A;  2DA6 A;  3O8G A;  2NS7 A;  3HB9 A;  1SAN A;  2Y30 A;  3UKG A;  2CQX A;  5JLX A;  5C4J J;  3G1M A;  1Y1V J;  4MO7 A;  4DZJ A;  1APL C;  1TWC J;  3DCF A;  2QCO A;  1JKR C;  1RET A;  4BXX J;  3ZQH A;  3ZQG A;  3TW7 A;  3CQZ J;  2AHQ A;  3S1Q J;  4C3I J;  1WGX A;  9ANT A;  2DA1 A;  2MW8 A;  3HOX J;  2LKX A;  4IHW A;  1TWF J;  1A6I A;  4M3G A;  4BKX A;  5FJ8 J;  3GTM J;  5F0F A;  4Y52 J;  4D7M A;  4Y7N J; 
#chains in the Genus database with same CATH topology
 5TRD A;  1Y8Q B;  2P4W A;  1I1G A;  5IT9 K;  1HKS A;  1YW9 A;  1JTY A;  3KEY A;  2AXL A;  2CO5 A;  1WWX A;  2FXA A;  3BLY A;  4II2 A;  5GTI C;  6PAX A;  3BOQ A;  4CH7 A;  4IF4 A;  2GWR A;  2NVX J;  3LSJ A;  1X2N A;  2EV0 A;  1JHH A;  3E5Q A;  5HDN A;  4OU0 A;  1T08 B;  5KK1 A;  3KP7 A;  3HC7 A;  1R71 A;  4E7S A;  4FET A;  3VYS B;  1JUP A;  1OCP A;  2XC7 A;  1U2W A;  1ZRF A;  3OYA A;  4X0G A;  3SDB A;  2VLA A;  3OR2 C;  3J7Y J;  2M9H A;  2XB5 A;  5FLX K;  4IL6 C;  2V1X A;  3AL0 B;  1YS6 A;  4CYC A;  3VB2 A;  1JHF A;  1DPR A;  3FK6 A;  4QWQ A;  2FUG 2;  1TWA J;  3KEQ A;  3CCU I;  2V79 A;  2WB1 A;  2HVR A;  4BQA A;  4ABZ A;  4CCN A;  4DNC A;  1JTX A;  3CD6 I;  1BOA A;  3FMR A;  2XV4 S;  4BE1 A;  4XN3 A;  3GTJ J;  4LIU A;  3GW2 A;  4X1E A;  2ELJ A;  1OYI A;  3NWT A;  1MBE A;  1CQT A;  2MC4 A;  2L02 A;  4K2E A;  2LY2 A;  2HDC A;  3CP2 A;  3W6J B;  2BVM A;  2IVM A;  2DQL A;  3BY6 A;  4I09 A;  4BJT A;  1D1B A;  4G7Z F;  2GIZ A;  2E2H J;  2L3D A;  1MBK A;  2ZSI B;  3R0J A;  2O0Y A;  1HXD A;  3DP7 A;  2V9V A;  2V6C A;  3AL0 C;  2UXX A;  2VOP A;  1ACI A;  2EIJ H;  3TW6 A;  4HSR A;  4RMN A;  3BPV A;  4F93 B;  3A0B C;  3K1N A;  4EGY A;  2PJR A;  5HOD A;  1X19 A;  1AKH A;  3WTZ A;  2PG4 A;  2MFZ A;  2NVU B;  5IP6 A;  3PUB A;  3S15 J;  2RQQ A;  5FRN A;  4EMS A;  3IP4 B;  3OYL A;  4PJJ A;  2DK8 A;  1ZR4 A;  1YIJ I;  4KT6 A;  2TRT A;  3MKW B;  2NNN A;  3G71 I;  2EZK A;  2D2W A;  5GAH J;  4BEH B;  1ZN2 A;  2NXN B;  1EA3 A;  4YIF A;  2AQF A;  2ZJP F;  5K5O A;  2FBI A;  5E18 F;  2VOD A;  4AIH A;  5E1X A;  1W1W E;  4RDU A;  4Y4R A;  2YX7 A;  2L9V A;  4ANJ A;  2LY1 A;  4CYC B;  1HKT A;  2FA5 A;  1VQN I;  2Y48 A;  1HDD C;  1UHW A;  4LFU A;  4BAC A;  2LY9 A;  3P9I A;  4UV8 A;  1X2M A;  2M1B A;  2CWE A;  2R7T A;  1Z05 A;  4B4C A;  2ACJ A;  2E1O A;  1D5V A;  1I39 A;  1MND A;  2LSO A;  4BBR J;  2M34 A;  4LK0 F;  2NAZ A;  4AVZ A;  3LA3 A;  3VFZ A;  3GYH X;  3BTI A;  2HOE A;  2NOG A;  3FKI J;  3ZRG A;  3F8N A;  3ZPL A;  3A0H C;  5L3D A;  3Q0U A;  5D8L B;  1MGT A;  4M3F A;  2RN7 A;  3ROU A;  1UZC A;  3RSN A;  4XN0 A;  2QEX I;  1Z1D A;  1B72 A;  2OC6 A;  3S17 J;  3CCL I;  2KJC A;  3K4K A;  2HNH A;  4GRI A;  3FHN A;  2F4I A;  5B66 C;  2XF7 A;  2OZU A;  2XKO A;  2YUS A;  3HPH A;  5KHD A;  3W2A A;  3DEE A;  3G6E I;  3OOU A;  4RAY A;  2ISZ A;  4HX7 A;  4G6T B;  4AD9 A;  2CRG A;  2IA0 A;  5DCF A;  4ENJ A;  2M3A A;  2FE3 A;  1MBJ A;  4WXH A;  2FX0 A;  3V8K A;  2X0L A;  4HBL A;  1EJ9 A;  2L9S A;  5DD8 A;  2DDA A;  5CVR A;  1RUO A;  3UNG C;  2HTS A;  2K4B A;  1VQ6 I;  3M8E A;  3S3M A;  2JUC A;  2QBY A;  3PIO F;  3OR1 C;  2H8W A;  3M4O J;  1MMD A;  2TCT A;  3I58 A;  2OF7 A;  1RI7 A;  4Z6Y A;  1IRG A;  1ETV A;  2EZL A;  1LE8 A;  4FTH A;  4S05 A;  4A3D J;  4NBQ A;  2LRE A;  4HEA 2;  4DJA A;  4C2U A;  1GHC A;  1GLN A;  2VKV A;  4ITV A;  4DYQ A;  2IJL A;  1D8K A;  1I6X A;  3K4J A;  1VZ0 A;  1B8I A;  3NEU A;  2VJ5 A;  4LLN A;  2XAQ A;  4XRM A;  4IHS A;  3W6K B;  1JE8 A;  3SZG A;  1ON2 A;  1WVR A;  2NVY J;  2GA2 A;  2M0C A;  1U78 A;  1GVJ A;  3D5S C;  1YX3 A;  2CYY A;  2K9Q A;  3H9J A;  3L2U A;  1VQ5 I;  4XLP F;  3VSL A;  2JA5 J;  5HS8 A;  3HYI A;  4U7B A;  1FYM A;  4A3E J;  4LOC A;  3IH4 A;  1XGO A;  3ZQC A;  2DOA A;  2IS1 A;  3O3K A;  1LJ9 A;  1KA8 A;  2K40 A;  4I01 A;  1BM9 A;  4XBF A;  3WTV C;  1U5T A;  2HTJ A;  5IP9 J;  3GTL J;  2W48 A;  3B6C A;  4KIG A;  1G3Y A;  4HLX A;  2CQK A;  2DT5 A;  1UCR A;  1Z6T A;  5A2Q K;  2R7D A;  5HS7 A;  4Q5S F;  5KCM A;  4XON A;  4OOI A;  4FHT A;  3E5X A;  4S04 A;  4GXO A;  5H2F C;  3ONQ A;  4A3G J;  2EB7 A;  4OMY A;  1RC9 A;  1SC7 A;  3BP8 A;  4FE7 A;  5K7Z A;  4YEJ A;  3AFH A;  3TDU C;  3BTL A;  3OYH A;  1JKQ C;  1WJE A;  1P9Q C;  2EPF A;  1HQC A;  1IN8 A;  3C1D A;  3I71 A;  1NK3 P;  1MH3 A;  2MC3 A;  3BCA A;  2L9N A;  4HG2 A;  4CHU A;  3K4B A;  2DBB A;  1XCV A;  4KYW A;  2FQ4 A;  4LD5 A;  1Z0X A;  1UB9 A;  2Y9Y A;  3EUH A;  1LE8 B;  4LIT A;  5FLM J;  3I54 A;  2GOM A;  1RPW A;  2XAS A;  3BG7 A;  3KP3 A;  3SQN A;  3LSG A;  3VOD A;  2IGM A;  3DLL F;  1F36 A;  5AIP A;  4MTD A;  1R22 A;  1KGS A;  1OCR H;  1P6R A;  2HXO A;  3E6D A;  2LC2 A;  1YG2 A;  2WTE A;  4A0Y A;  1B8I B;  3VEP A;  1MMG A;  2XSJ C;  3QU6 A;  5CVI A;  4KA4 A;  2JT1 A;  2JVH A;  3BJA A;  3QWL A;  4M6Y A;  4JBA A;  3KZY A;  4XLA A;  3DWL E;  3HDD A;  3Q3S A;  4L5J A;  1TZL A;  4ZZD A;  2V26 A;  3PUF A;  5D6F A;  3I9V 2;  4BDZ A;  1I6H J;  3HL2 A;  1XX5 A;  1S5L C;  3L9F A;  3P5J A;  1N75 A;  4CCK A;  1S7O A;  3L00 A;  4ENM A;  2O8X A;  2MAB A;  4IZZ A;  1Z91 A;  5EZH A;  4B43 A;  2ESN A;  4JYK A;  1GT0 C;  3RPU D;  2E2J J;  1U5T B;  1SMY F;  4Q47 A;  5CVJ A;  5K1Y A;  4G7O F;  2E36 A;  4RGX A;  2EIM H;  1TW3 A;  5DM7 F;  2CH0 A;  3KYL A;  4L18 B;  4ZDL A;  3WHB A;  1IGN A;  3TMO A;  5LHH A;  4ENN A;  4XKC A;  3DKX A;  1KYW A;  5KVR A;  1Z67 A;  4RB3 C;  2LH9 A;  1KU3 A;  4EJW A;  2LLK A;  2BYV E;  3RZO J;  1FMV A;  1E3O C;  5FO5 A;  3S1M J;  4M6V A;  2CUJ A;  2BEO A;  3K2A A;  2L7K A;  3BZK A;  3FM5 A;  1R1U A;  3BWG A;  2LVS A;  3R4K A;  3CO7 C;  2W4S A;  3HIF A;  4ZYE A;  2QSG X;  4XID A;  3K70 D;  4G94 A;  2HFH A;  5ILS A;  1ZRE A;  2P5K A;  3FX3 A;  4YEL A;  1KQ0 A;  3R61 A;  1IF1 A;  1OFC X;  4N9H A;  4ETS A;  2H1K A;  3H3U A;  5FRO A;  2DA7 A;  1WJC A;  2MLK A;  3CMM A;  1U5T C;  3WE2 A;  1SVL A;  1R5G A;  4C2M J;  3MFK A;  4V2F A;  3JRF A;  3PJR A;  2R7U A;  1EF4 A;  1R6R A;  4E7Z A;  2H6B A;  4KJZ A;  4G7H F;  5CVU A;  2X6W A;  1MKM A;  3FHZ A;  1MBF A;  3ISP A;  3TKY A;  2HOS A;  2BY3 A;  1MNM C;  1HW2 A;  2IGK A;  1KU2 A;  5E79 C;  4BU2 A;  1U3E M;  2JSC A;  2G7H A;  2JRT A;  4HF2 A;  3ZN0 A;  3BZC A;  5BNG A;  3I59 A;  3JRC A;  1G3W A;  4NDL A;  1OMI A;  3X2Q H;  5FKN A;  1LQ1 A;  2WY8 Q;  4J19 A;  4P9F A;  4II3 A;  2M8E A;  1P7I A;  3Q9V A;  2UZK A;  5ICG A;  4RA2 A;  2ME0 A;  1K6Y A;  4KN4 X;  1F1Z A;  3WU0 A;  4BJ5 C;  1HCR A;  5IOZ A;  1KON A;  4M73 A;  1HSJ A;  3QYB A;  4PZJ A;  1V54 H;  4UUS A;  3LSI A;  3EUH C;  4L9J A;  4I6Z A;  2X1E A;  1D3Y A;  2RAE A;  1YJW I;  4RB2 C;  3RTR A;  4U7D A;  3U21 A;  3I5U A;  4ZH4 F;  1IG7 A;  2LR8 A;  3GFJ A;  1XD7 A;  4BUP A;  2OPT A;  2MH2 A;  3H36 A;  2VBY A;  1Q1H A;  2BW3 A;  2MA3 A;  4XRS G;  4ASN A;  4HX4 A;  3GFL A;  3GVA A;  4KT5 C;  4Z2Y A;  2QKL B;  3A01 B;  2COB A;  3OYK A;  2CQ7 A;  4DZP A;  1ZQ3 P;  2JK3 A;  2Y69 H;  2ZCW A;  1Y0N A;  3OIP A;  4BQN A;  5DV5 A;  1IN7 A;  2IS4 A;  3B02 A;  3O8G A;  4E7H A;  4IX7 A;  4IRI A;  1SAN A;  2KRC A;  4U88 A;  4HW0 A;  3TO7 A;  2RRE A;  1YFH A;  5C4J J;  1LDD A;  2GXG A;  1YX5 A;  2XAG A;  1P4A A;  1QO0 D;  3FXL A;  3LQQ A;  3COA C;  3CF5 F;  3N05 A;  4G9Y A;  5LHG A;  1JKR C;  4EV0 A;  5D5W B;  4IPA A;  1BBY A;  4E7K A;  3ZQQ A;  2YU3 A;  9ANT A;  4OIR F;  2DA1 A;  4IHW A;  1TWF J;  1A6I A;  2L4A A;  4BKX A;  2P6T A;  4Y52 J;  1JXS A;  4D7M A;  4Y7N J;  4EVI A;  1IRX A;  3QOD A;  4HV5 A;  4I02 A;  3RKY A;  1PUF B;  3I59 B;  2IT0 A;  2CQQ A;  2GIV A;  1R1V A;  1G2H A;  1XGM A;  3BRO A;  3VSK A;  2UUZ A;  3MWM A;  2LG4 A;  4NB5 A;  3BR6 A;  3U2R A;  1IDZ A;  2VBW A;  2M8G X;  3ZP5 A;  1ETK A;  2KQR A;  2WAD A;  5DCM B;  4H4K C;  4A3F J;  2LOO A;  5JR3 A;  3MEX A;  1FJL A;  1TWH J;  5LEJ A;  3HKZ A;  2WBM A;  1IN6 A;  3F0C A;  5E17 F;  1TLH B;  3WGI A;  1H0M A;  3FXU A;  5BMZ A;  4CCM A;  5C3E J;  2DMT A;  4HDU A;  2HI3 A;  4HF1 A;  1HLV A;  5DTD A;  2G7U A;  5F1R A;  3OL4 A;  2R5Y B;  1R23 A;  3SZT A;  4ZYG A;  1S3J A;  2ZJ2 A;  4HQM A;  3RPU A;  5LRS A;  4S0H B;  1ZR2 A;  1BI2 A;  2AQE A;  5J4Y A;  4BXU A;  3OYB A;  2DA3 A;  3D0S A;  1O57 A;  3BCB A;  1G6N A;  1MH4 A;  2VUM J;  4EM0 B;  5GAG J;  3CCQ I;  3BR3 A;  2E5Z A;  1YO5 C;  2QEN A;  4P5O A;  2DLL A;  4BL0 B;  1R1T A;  1XTA A;  2CUE A;  2EA4 A;  1B1B A;  1DQU A;  2KHM A;  1T2K A;  1EKE A;  2RNJ A;  2H27 A;  1VQK I;  5EJC A;  4G6Q A;  1OCC H;  3FM3 A;  4KIT B;  1IJW C;  3LSR A;  2DA4 A;  2K85 A;  4NC8 A;  4BH9 A;  2IEK A;  5BPD A;  3QP5 A;  5IP7 J;  1WSU A;  4MEY F;  1OIS A;  2ADU A;  1XMA A;  2R7Q A;  5E3O A;  4HNV A;  2QM3 A;  3VDX A;  4AYB N;  2PFB A;  5BS6 A;  2VIX A;  3AG4 H;  4A3L J;  3LQR A;  3OYC A;  1B6A A;  4I2O A;  1WH5 A;  4QIW N;  2VN2 A;  1IN4 A;  3ABM H;  3FKJ A;  4HQE A;  1A5J A;  4W97 A;  1WI3 A;  2FD5 A;  4HDV A;  2VQC A;  3HTS B;  2CV1 A;  1RES A;  3OYJ A;  1DP3 A;  1P7J A;  2WA0 A;  3BT9 A;  3FK7 A;  3S93 A;  2ZJR F;  4E7L A;  1ODD A;  3OS0 A;  2H09 A;  4IVN A;  1XMX A;  1FMW A;  1U6G A;  1XDS A;  3ZQ7 A;  3O6B B;  2HZD A;  3ZXS A;  5E3L A;  2I5U A;  1DDN A;  2EZH A;  2E1C A;  1EH6 A;  1OCT C;  4N4N B;  2DMN A;  4BE2 A;  5EG0 A;  3J81 K;  5IT9 Z;  3HUG A;  1FP1 D;  5AIQ A;  1T56 A;  3UR3 C;  2ME6 A;  3AKZ A;  5CPR B;  3F23 A;  3HOV J;  4OIO F;  4MQV A;  3MKY B;  5LGN A;  1MMN A;  1V55 H;  5CQG A;  2YR2 A;  4UNO A;  2IS2 A;  4JX6 A;  4BAY A;  1ZGA A;  4XIC A;  1KU9 A;  3KZZ A;  5F0H A;  2H94 A;  2IS6 A;  3J7Z I;  2QSH X;  2HXI A;  4JK1 X;  3WTU C;  4MQ9 F;  1JT0 A;  1RUN A;  1ZG3 A;  2DFH A;  4E7J A;  1PYV A;  4MFE A;  3KET A;  1PP8 F;  3IKT A;  2V1U A;  3E6B A;  1TNT A;  2V6E A;  4MFD A;  2JVG A;  5FLX Z;  1U0J A;  2A6E F;  5EEA A;  3K4C A;  5M5W J;  4IHT A;  2COM A;  2XRN A;  1IUF A;  3IWZ A;  4PJL A;  4B44 A;  3ZQI A;  1YS7 A;  3GLX A;  4GYG A;  4BEH A;  1BW5 A;  4HLY A;  2DPD A;  2R7S A;  4LG0 B;  3IL2 A;  2LMD A;  3HHH A;  2LKS A;  2F5C A;  2YSR A;  1Y0U A;  1GVD A;  3G2B A;  2DFI A;  2ZXH A;  2W24 A;  3EPZ A;  4I76 A;  1X3U A;  2GXB A;  4I99 C;  3H9G A;  1VQ9 I;  2QGU A;  3CJT B;  2O6G E;  3MD2 A;  5B5E C;  4A3K J;  2Q8K A;  2FSW A;  3LL7 A;  2TDX A;  1K4T A;  1D5Y A;  2YU9 J;  4GDF A;  4XNF A;  1XSX A;  4CIC A;  2HKX A;  3JRE A;  5F08 A;  2RDP A;  4BBS J;  4RGR A;  2EQR A;  4BHP A;  1W5C C;  1CF7 A;  2F4M B;  2ZFW A;  3IKV A;  5IT3 A;  3K70 C;  4EEF G;  1G8X A;  1I3Q J;  2STW A;  3E1S A;  1FWZ A;  3RJP A;  3FWE A;  3U1K A;  3PFI A;  3HPG A;  1MBG A;  1UHM A;  1USS A;  2EFP A;  4XOP A;  5FB2 A;  4N9I A;  4RAF A;  5BPI A;  5EG0 B;  2L7M P;  3HUG B;  2JN6 A;  3F8B A;  4FCY A;  2DO7 A;  2VOO A;  2HQN A;  4I7H A;  3HOT A;  2I8D A;  3ASN H;  1GV2 A;  4RAZ A;  5ED4 A;  1K6O A;  1TQP A;  4ENK A;  1FBU A;  2W00 A;  5LEK A;  3F8F A;  3GWZ A;  1UMQ A;  3K7A J;  3RZD J;  5K5R A;  1MSF C;  1SFE A;  2P7C B;  2BGC A;  4UVA A;  1HW5 A;  2VC1 A;  2CW8 A;  2L7F P;  1S7A A;  2R3S A;  3KP4 A;  1OYW A;  1YE9 A;  2H6C A;  2JWT A;  2KJB A;  2QSF X;  4IEJ A;  2KIM A;  1A6Q A;  1R7J A;  1BC8 C;  2M30 A;  5DDG A;  1D0Z A;  3HSR A;  5IYD J;  2LRD A;  2BHZ A;  4ZJZ A;  1YIT I;  1FOY A;  1V5F A;  4ESJ A;  2W1O A;  3KE2 A;  4CDG A;  2JPC A;  3BG9 A;  1BOB A;  3ZQL A;  3WHC A;  3EET A;  1N25 A;  2KFD A;  3CCY A;  2L7Z A;  3O2P E;  1ZG1 A;  4PFP A;  3JRI A;  5FKK A;  2OTJ I;  4HV6 A;  1Z3Y A;  4KIF A;  3HOY J;  3F72 A;  1T39 A;  3GF2 A;  2O5R A;  1ZKG A;  4XL9 A;  1M1E B;  3S16 J;  3HTU A;  3SXY A;  2PMZ A;  3D5L A;  2PEX A;  3LA2 A;  1X4P A;  2EIL H;  2ZJQ F;  2XIG A;  3A4C A;  2HQA A;  2X1D A;  3S3O A;  1HA8 A;  2R7X A;  3CF2 A;  3ZCO A;  2RGV A;  2IA2 A;  1YJN I;  2DU9 A;  1ETQ A;  3ZMU A;  4KMU X;  4N4O B;  5KAI C;  1CF7 B;  1HDP A;  2JPB A;  4M3E A;  5D4S A;  3M8F A;  3LSM A;  3LSK A;  4PGH A;  5FRM A;  2XF5 A;  1LVA A;  4JP0 A;  5HNF A;  4PJM A;  1JGS A;  3CCR I;  1J2X A;  3E0J B;  2RVC A;  3ZQF A;  3TOA A;  4QPQ A;  3JRH A;  4LLG F;  3L2C A;  1W7P D;  2AO9 A;  1TQM A;  3OSF A;  1JUS A;  1T95 A;  1C0W A;  4IHY A;  4BY1 J;  1ON1 A;  3ZN1 A;  4NNJ A;  5IYB J;  1OR7 C;  4WK8 F;  3OMY A;  1FTZ A;  3DTE A;  4WX9 A;  5HDG A;  4YFK F;  2R7V A;  2ZXW H;  3HGY A;  5E8G A;  1BI3 A;  2DJN A;  3HOW J;  1E3P A;  5JHU A;  3M9A A;  3P9K A;  4XLN F;  4R79 A;  3L09 A;  3QYF A;  4UHT A;  3ESW B;  2W85 A;  2W82 A;  2HGC A;  5J1Y A;  2CW7 A;  1XMK A;  3QPT A;  1WJ5 A;  1K7A A;  3DPL C;  2M87 A;  1XC5 A;  5J8F A;  3CC7 I;  4UUT A;  3S14 J;  3TL4 X;  5FKM A;  2DYR H;  3V4G A;  3K4N A;  3FMS A;  2DTZ A;  2LFB A;  4Y13 A;  1MDM A;  2DOE A;  2RKH A;  1XB4 A;  1V5G A;  4C3J J;  3FXM A;  4E4H A;  2HVQ A;  3CJQ B;  2M45 A;  4U0V A;  5KAF C;  3BG6 A;  2W25 A;  4WF2 A;  2MBF A;  5DS9 A;  2PJP A;  3F6O A;  3ZMT A;  3OY9 A;  4OIQ F;  1OCO H;  4B3X A;  4PJN A;  1BJA A;  4XSZ F;  3RCO A;  2CFO A;  2OV7 A;  4B1R A;  1D0X A;  3KFW X;  2KZG A;  4RB1 A;  4LG3 A;  4DYC A;  1H9T A;  2EBI A;  2Z1D A;  2H1L A;  2Y0S N;  4RM2 A;  1LPQ A;  1WI9 A;  3GTO J;  1HKQ A;  2BY0 A;  4OAY A;  1FX7 A;  3Q0W A;  4XKB A;  2I10 A;  4DIQ A;  3DBL B;  1BI0 A;  3L2Q A;  4J01 A;  2L0K A;  2A3S A;  5J1U A;  1MIJ A;  5A2Q Z;  2F5V A;  2L54 A;  3HRT A;  1B4A A;  1W4M A;  1CGP A;  2DTR A;  1REP C;  1IW7 F;  3TGN A;  5HOO A;  1FIA A;  3CZ6 A;  2OQR A;  2E2I J;  3PSF A;  3JTG A;  5D6E A;  3G1O A;  5F6F A;  3J7A O;  4RM3 A;  3JCU C;  1SFO J;  2QQ9 A;  5M3M J;  1F4K A;  1Y56 A;  4CCO A;  1WFX A;  1WJD A;  2M0M A;  2PN6 A;  4L5I A;  4L9V A;  1SFU A;  5F04 A;  1IZ1 A;  1U8B A;  4A69 C;  3FXO A;  2K3P A;  1SAU A;  2KT0 A;  2XAU A;  3HEF A;  4EQQ A;  1F9N A;  3OYM A;  2EFN A;  2VPL A;  3QYE A;  1FBQ A;  5EYR A;  3B73 A;  1IXC A;  1OJL A;  2DN0 A;  3I4P A;  4XR6 A;  5LD2 C;  2FQ3 A;  2UXN A;  5C44 J;  2ID3 A;  2VKE A;  1DPU A;  2DAO A;  3WOD F;  1F43 A;  2M4G A;  2V1D A;  2XAH A;  1TT0 A;  2RNG A;  2DOF A;  3S32 A;  1MDM B;  5E3N A;  4AU7 A;  2OTL I;  5LBQ A;  1W36 D;  3A02 A;  3IV5 A;  1VQL I;  2DA6 A;  4CZZ A;  2ZNZ A;  3E6C C;  3K1P A;  2Y30 A;  1G3T A;  3J80 Z;  5EEG A;  3WTW C;  1IXS B;  4BS9 A;  1MD0 A;  2ICW G;  1V3F A;  5CYV A;  3RPQ A;  4OIP F;  4BGD A;  4NHJ A;  2VC0 A;  4IRG A;  3W3C A;  1TWC J;  3M07 A;  3C18 A;  2XGX A;  4U87 A;  2Z33 A;  1VQP I;  4H0E A;  1JI8 A;  3RQ4 A;  3VOE A;  5LGT A;  2GQQ A;  3TW7 A;  5CLS A;  2AHQ A;  2EFW A;  3S1Q J;  3BZ6 A;  3J80 K;  1A04 A;  4C9Y A;  2MW8 A;  3HOX J;  3CMA I;  1RR8 C;  3WTY C;  3MKZ A;  2LKX A;  3KP2 A;  5FJ8 J;  1FP2 A;  1IN5 A;  5D8K B;  1PUE E;  4YG2 F;  2XDV A;  4UUV A;  2L01 A;  2DI3 A;  1XSD A;  2Y75 A;  2E1M B;  4GYI A;  3V8L A;  3LSP A;  2PBI A;  3CC4 I;  4CCJ A;  4L0Z B;  2Z3Y A;  4Q48 A;  2CUZ A;  4XLE A;  1IAW A;  1LEB A;  3GFM A;  5TGT A;  2ZO4 A;  3SYT A;  4JQF A;  2BZT A;  4XSX F;  3V8J A;  2DT7 B;  3NAU A;  3OIO A;  1VQO I;  2LD5 A;  1QU3 A;  2F2E A;  2ECC A;  4QSH A;  1KZH A;  4B8X A;  2GOX B;  2HKO A;  3HOU J;  3LAP A;  2K9S A;  4EJU A;  2QF7 A;  2GBY A;  4RLQ A;  3A01 A;  2P6S A;  1QVU A;  3JRA A;  4Y33 A;  1Z3X A;  1TNS A;  4L0Y B;  1W7P A;  2HYF A;  3AG2 H;  3E3V A;  1H88 C;  4FE4 A;  1T6S A;  3KLN A;  1DP7 P;  1AU7 A;  3P7N A;  2GAU A;  2KRF A;  4C30 A;  3OYI A;  3IAS 2;  1YTY A;  2G0E A;  2P5L C;  4HPQ A;  2E19 A;  5IY5 H;  3MQ0 A;  2KP6 A;  2XGE A;  4A2U A;  1J7K A;  3CLQ A;  3IAM 2;  5ERI A;  4O5V A;  2E1M C;  4ZTF A;  2OUM A;  3RKQ A;  4ZDP A;  1XGS A;  1KQ8 A;  3EDP A;  1ETO A;  1FOX A;  3RIR A;  1NG7 A;  4BXF A;  3R6S A;  4ESB A;  2FJ1 A;  2OQG A;  3ZMS A;  4KDP A;  1VQM I;  3U9G A;  4OAZ A;  3S2H J;  2JA7 J;  1TBX A;  5K7F A;  4KUM A;  1I5Z A;  2DPU A;  3LWF A;  1ITY A;  2XVC A;  4RGU A;  2XF6 A;  3JTH A;  4FT8 A;  1PUF A;  3KP6 A;  4J00 A;  2J5O A;  2VT2 A;  3WTT C;  2DXI A;  2NOJ B;  2FF4 A;  3DEW A;  5EEH A;  3P9C A;  2A69 F;  3H3Z A;  3F8C A;  3K0L A;  2M7A A;  3N97 A;  3BTJ A;  1V4R A;  2VI6 A;  4M6X A;  1WKM A;  1JKP C;  3WTX C;  2CU7 A;  5ICE A;  2X6X A;  1AOY A;  2NVT J;  3RDI A;  2ID6 A;  1GXQ A;  1TW2 A;  2RC4 A;  5DCM A;  2ISY A;  4MTE A;  3HBL A;  3J7A Y;  3ZMV A;  1HBX G;  3V7S A;  3DPU A;  1ZH5 A;  1S7E A;  3PM1 A;  1ZYR F;  2V7F A;  1ZGW A;  1X4O A;  3C3W A;  4F55 A;  1TWG J;  3LNQ A;  2X85 A;  1ONV A;  2R0Q C;  1GUU A;  5GPA A;  1FOW A;  3NQO A;  4M3B A;  2R5Y A;  1UAA A;  1S29 A;  3MMY B;  1EH7 A;  5HLG A;  2CV2 A;  1T33 A;  3CDH A;  1S6L A;  1W7P B;  2A61 A;  1ETX A;  3M8J A;  3NWS A;  1Z77 A;  2GLO A;  5JVG F;  1P2F A;  3MZY A;  3PO2 J;  2QVO A;  1TT5 B;  2WAQ N;  1UG2 A;  4ZYA A;  3VYU B;  3RKX A;  4XLF A;  1HST A;  1W5T A;  4ON0 A;  1IXR C;  3ASO H;  3ULQ B;  5FD6 A;  4OMZ A;  5ILV A;  3WG7 H;  5D5X B;  4O3M A;  4E7I A;  5M5X J;  2BHY A;  3BC8 A;  2VQL A;  3CC2 I;  1E3H A;  3Q9S A;  4PUS A;  2FOW A;  2DMP A;  2HDD A;  2DA5 A;  1FT9 A;  2K9N A;  5KNL A;  3FXR A;  3W6V A;  1FPQ A;  3GUD A;  1QVT A;  1NTC A;  4CO8 A;  2P5V A;  2G9W A;  4HYE A;  4F3Q A;  1LDK B;  2VON A;  4LK1 F;  5GPC A;  3FBN B;  1WJA A;  4A6D A;  1TL8 A;  2O61 A;  2K4J A;  5L3G A;  2O7O A;  1XS9 A;  1R9T J;  3BDD A;  1YW8 A;  4LIV A;  4EJV A;  5LLQ A;  5LGU A;  2F5F A;  3GX4 X;  4R1H A;  1JJ8 C;  4GFB A;  2VAS A;  3NAR A;  5FGM A;  2XPW A;  3QQA A;  1ZGJ A;  2XPV A;  4A3C J;  1ORK A;  3R60 A;  3KEO A;  4P55 A;  3WU1 B;  1Z7L A;  2EJR A;  3CME I;  5IPA A;  4XM3 A;  3LMM A;  2QQB A;  4RB0 A;  4A93 J;  5FFZ A;  5TJJ A;  4LB6 B;  1IDY A;  1NH3 A;  2GM4 A;  3CDI A;  2CUF A;  1VTN C;  2ESH A;  2A07 F;  1BC7 C;  4CZC A;  4C2T A;  3PO3 J;  2FEZ A;  1HOM A;  5F0C A;  3I53 A;  1QPI A;  5DD4 A;  1VF9 A;  4UY8 I;  1Z9C A;  1E2X A;  1A36 A;  4RS8 A;  3C7J A;  3PL8 A;  2JQ7 A;  2YPR A;  2V9P A;  4XOT A;  1QHG A;  3L2R A;  1RIO H;  1ZRC A;  1ZHF A;  4CSW A;  1JUM A;  1WPK A;  2F6C A;  2YS9 A;  3K9T A;  3T5X A;  5GTH C;  3ERM A;  3BTC A;  5LFA A;  4ZYD A;  3K4M A;  1BIB A;  1ZAO A;  2KPM A;  4YRV A;  1VQ8 I;  4D5C A;  3MN2 A;  3R0A A;  5F64 A;  3DF8 A;  1UHS A;  4MGR A;  3WU2 C;  1SD4 A;  3PSI A;  4A3B J;  2IA1 A;  4HAM A;  3CCV I;  2CGP A;  5EGO B;  2KMU A;  2O03 A;  4F52 A;  3V7C A;  4ZYH A;  4M9X A;  3BR1 A;  1YOV B;  5ILU A;  2GA1 A;  5CQE A;  2M5W A;  3F3X A;  3GZ5 A;  3FIS A;  2QZ8 A;  1ZTR A;  2WAE A;  3JAM Z;  1D1C A;  2FNP A;  3DXJ F;  2LF7 A;  3HOZ J;  4LG0 A;  3OL3 A;  4NC7 A;  4PDK A;  3K2Z A;  1FYL A;  1G59 A;  4GCV A;  3G1L A;  2MLG A;  3ABK H;  2R5Z B;  2Q0O A;  1UG0 A;  1B59 A;  3C2B A;  1Y8R B;  2JZY A;  3EUK L;  2E34 A;  1B9M A;  3Q0V A;  1BR1 A;  1WRJ A;  1O4X A;  3C2G A;  4F7Z A;  3BG3 A;  1GDT A;  4B47 A;  1XDU A;  3IC7 A;  4AYB A;  3JAM K;  1T8I A;  2DDB A;  1FBS A;  2LP0 A;  1QZY A;  2L4M A;  3CJR B;  1J09 A;  2K7L A;  3BG5 A;  1J59 A;  4RAG A;  3J81 Z;  1IRF A;  2BOL A;  2NYX A;  4QTR A;  2XB0 X;  4QLC U;  4I98 B;  5JLW A;  1H89 C;  4A6E A;  1JGG A;  1OYY A;  5E8I A;  4KN7 X;  3OS1 A;  3MKL A;  2ETH A;  5AON A;  4UB6 C;  5H6Q A;  5J40 A;  3HZJ A;  1FNN A;  1W36 C;  5HDK A;  4BHC A;  1J5Y A;  2A5W A;  1K4S A;  4HST A;  1YQA A;  2VPR A;  3WGG A;  3AG1 H;  4L9T A;  2L2O A;  2XHK A;  3IHU A;  4BY7 J;  1OPC A;  4O6J A;  1UJ8 A;  1X3Z B;  2LBF B;  2A05 A;  4B09 A;  4AIK A;  3G4S I;  4NC6 A;  2GZW A;  2HVS A;  2EA2 A;  1A35 A;  1U9O A;  2JSP A;  3M1E A;  2A68 F;  5J3L A;  1B9N A;  4LMY A;  2L5Q A;  2QLZ A;  2VBX A;  2ELK A;  4IQJ A;  2FMY A;  4ZDO A;  2E7W A;  3KIO A;  3HSF A;  1AHD P;  5H6R A;  2QQ8 A;  4EJO A;  3CDL A;  3SFZ A;  3FXQ A;  5FKO A;  2JRM A;  2OJE D;  4NQW B;  4DW6 A;  3TP3 A;  4L5E A;  3RKW A;  3RYR A;  3GME A;  2O3F A;  2DA2 A;  4DBR A;  3OV8 A;  3ERE D;  2RQP A;  1X58 A;  3MZ8 A;  3VWB A;  4KIC A;  4KNY A;  1X3W B;  2BXZ A;  2MH9 A;  1R49 A;  2EFO A;  2FRH A;  2LKP A;  1ZG5 A;  3I56 I;  2PI0 A;  4EM2 A;  3FXJ A;  5GP9 A;  1D1A A;  2B0L A;  3FIW A;  3JSO A;  3F22 A;  3D5R C;  2MD0 A;  1R4N B;  1S8N A;  3W2V A;  2ZKZ A;  5J47 A;  1OR7 A;  3L2V A;  3ECH A;  2DFE A;  1FOK A;  3GTQ J;  4ZTJ A;  2K5C A;  2E35 A;  5L3F A;  2HEO A;  5IYC J;  3K4L A;  3K6G A;  3G73 A;  1ETY A;  3CUO A;  3DBH B;  1T98 A;  2JTV A;  4PK4 A;  3TED A;  2JA2 A;  2DMQ A;  1PJR A;  4KFC A;  4WWC A;  4IKF A;  2R7O A;  2Q1Z B;  2W57 A;  3NRV A;  3PQJ A;  4OIN F;  4AC0 A;  2WB1 N;  4IQ4 A;  2CG4 A;  1L0O C;  4ZC3 A;  3T8R A;  1QZE A;  2F4O B;  1N77 A;  4LLL A;  2K9M A;  3HHG A;  4MLO A;  4HNT A;  4KIB A;  3KX2 A;  4CXF A;  3GXO A;  1K61 A;  2BY1 A;  2E60 A;  1YJ9 I;  4PFO A;  3H92 A;  4OWR B;  4B48 A;  2F5E A;  2OZ6 A;  1YIO A;  4JX5 A;  2X1C A;  3EYI A;  2KDO A;  2KL4 A;  2VQH A;  1Z6R A;  4FX0 A;  3SEZ A;  1QBJ A;  1WJF A;  3GEZ A;  1MJB A;  3TOB A;  2DFF A;  2OBP A;  4D0P A;  4FQG A;  4HNU A;  2VBZ A;  2KRH A;  2E5N A;  3OYN A;  2ELH A;  1G4D A;  4IOC F;  3OYG A;  1I27 A;  1E0E A;  3EYY A;  3OYF A;  4XLH A;  4MNU A;  2KKO A;  4A0Z A;  1BJZ A;  2NS8 A;  2XGD A;  3QU3 A;  5BOX A;  2HOT A;  1LNW A;  2CMP A;  3BR5 A;  2JA6 J;  5E20 A;  2H8R A;  4LGW A;  4XKV A;  2CV0 A;  2CJJ A;  5M5Y J;  2PMU A;  4WXD A;  3IRQ A;  2WC2 A;  1R36 A;  3ZMD A;  3BR0 A;  3T1B A;  4D7N A;  2FU4 A;  2O9L A;  4HRI A;  3RI4 A;  2VB6 A;  3IH3 A;  2KIF A;  1TC3 C;  3DU6 A;  4KIS A;  3GBG A;  1QQI A;  1FIP A;  1LEA A;  5DM6 F;  3CUQ A;  4XOR A;  4EAT A;  2UWM A;  2DK5 A;  2WY7 Q;  2BBY A;  3OOP A;  2XAJ A;  2B9S A;  2PMZ N;  3MVP A;  2W84 A;  2ZME A;  1VND A;  2XPU A;  5ICF A;  4HX8 A;  3DEU A;  2NS7 A;  1N78 A;  1LVK A;  3FDY A;  3HB9 A;  2STT A;  3UKG A;  2DJI A;  2EFQ A;  2P7V B;  3GZN B;  3L7W A;  2LF8 A;  3PNT A;  4DZJ A;  3DCF A;  1O3R A;  5D5V B;  3ZQH A;  1H9G A;  3ZQG A;  3CQZ J;  5GAD J;  2HS5 A;  4HF0 A;  1F5T A;  3DU5 A;  1D8J A;  4BQQ A;  2OCC H;  3N4M A;  1WGX A;  5D4R A;  2D1H A;  1T0F A;  2ZSH B;  1RZ4 A;  1I3A A;  4QPO A;  1QPM A;  5LHI A;  1I1S A;  1SFK A;  1BR2 A;  2AXT C;  2WAF A;  4UB8 C;  2QWW A;  2IGO A;  3SDG A;  1Y39 A;  2Z2S B;  1DGW Y;  3HRM A;  3H5N A;  3CP8 A;  2VE9 A;  1QGP A;  4UV9 A;  3JRD A;  1MNE A;  1P4W A;  2F48 A;  3CMY A;  2M2E A;  1ZAR A;  4AWX B;  2VL8 A;  3F8M A;  2O8K A;  1XCB A;  2Z9O A;  1EH8 A;  1O7F A;  3S8P A;  1MMA A;  1GV5 A;  1ZLK A;  4I0B A;  4Y17 A;  2PJR B;  3WG9 A;  1AKH B;  3WTS C;  3QAH A;  4TV7 A;  4YFN F;  3JW4 A;  2XAF A;  3FZV A;  3KYD B;  3HJE A;  4V19 K;  3HRU A;  3SHF A;  1KU7 A;  3TO9 A;  5HLH A;  4RLF A;  1SAX A;  2IGN A;  2VJJ A;  1DU6 A;  3BR2 A;  3K1M A;  1VI0 A;  1AA7 A;  1FTT A;  3CUQ B;  2EV6 A;  4AUX A;  3GZ6 A;  2QUF A;  1SD6 A;  1RNL A;  3LSH A;  1PP7 U;  2HQ5 A;  4BYY A;  2BY2 A;  2ZME B;  4LB5 A;  3T0Y A;  2WWY A;  5E1Z B;  3B6A A;  4G12 A;  1VQ7 I;  1NK2 P;  5E3M A;  2MD5 A;  2DOD A;  1P92 A;  2QKM B;  3S1R J;  2Y0S A;  5H20 A;  4P1W A;  1SMT A;  2B63 J;  4CUG A;  2XSD C;  1BN5 A;  4PCQ A;  2PQ8 A;  3FXK A;  5K7H A;  1WHU A;  5JVT A;  4M9Z A;  2IPQ X;  1UEL B;  3HG9 A;  2KIQ A;  2ZNY A;  3DKY A;  4V2G A;  5EZG A;  5F27 A;  3BPX A;  3VYR B;  3ELK A;  3G3Z A;  1ULY A;  4M9S A;  1RRJ A;  2X51 A;  1FEX A;  5CKT A;  3CUQ C;  5CVV A;  1O3S A;  4EJT A;  1QA6 A;  2CQN A;  3F6V A;  3DPT A;  2J5P A;  3PNY A;  1U8R A;  1O3T A;  2ZME C;  1P4X A;  3ECO A;  4A5N A;  2R7W A;  4IHV A;  1VQ4 I;  3QOE A;  1RKT A;  2QA4 I;  3LOC A;  2CS3 A;  2K9L A;  2FOK A;  3QP6 A;  1LUJ B;  2IW5 A;  3ZR8 X;  2VE8 A;  3EQL F;  3L1P A;  4XKW A;  2BE5 F;  2ZFU A;  3AG3 H;  3EUA A;  1WH7 A;  3VPR A;  4XRF A;  4ZZL A;  3HM5 A;  1S72 I;  1B72 B;  4YFX F;  5IOY A;  1SD7 A;  1UST A;  1ZEL A;  3CCE I;  3LAJ A;  1YRN A;  1T0F C;  5B1A H;  2FML A;  5HNH A;  3JRB A;  2VXZ A;  1AWC A;  3U1D A;  1IUY A;  4U0W A;  1EV7 A;  2QQA A;  2L9R A;  3K10 A;  5B1B H;  1QHH D;  1YYV A;  2FBH A;  4A5M A;  3OS2 A;  3REO A;  3GTG J;  2M4K A;  3I4N J;  2CFX A;  3KYC B;  2XGC A;  3CES A;  2DCE A;  2UV1 A;  3JRG A;  1FLI A;  1O3Q A;  2HQR A;  3V7R A;  2A6H F;  2QBY B;  1QRY A;  2ZB9 A;  4UVB A;  1LFU P;  1PDN C;  5FD5 A;  2HR3 A;  5DYM A;  1R00 A;  4RGS A;  5J6X A;  1S9H A;  3M3Y J;  1W0U A;  4CYD A;  4I0A A;  2A5Y B;  1MZB A;  4X6A J;  1FC3 A;  2E71 A;  3GCM A;  4XLC A;  4CGZ A;  5L3E A;  1J0R A;  4BQO A;  2XUB A;  1GXP A;  4BJ6 C;  2LDU A;  2D1V A;  2V1N A;  4MEX F;  1BI1 A;  2VQG A;  2R92 J;  5JHF A;  1IO2 A;  3ABL H;  2IRF G;  5E1W A;  2EZI A;  3F9K A;  3KCC A;  3GLL A;  2R7R A;  1L3L A;  4E70 A;  3E6M A;  2X6Y A;  2X4H A;  4IXA A;  2R93 J;  1BR4 A;  5C4X J;  1YW7 A;  3LST A;  1D0Y A;  3QRF F;  2LK2 A;  3HRS A;  1MSE C;  4N0B A;  1SEU A;  2K3F A;  2Z99 A;  4HOB A;  3SFI A;  3BJO A;  2XRO A;  3L2W A;  3JSP A;  1ENH A;  3QOP A;  4XRS A;  2R7Z J;  1YLF A;  2VKH A;  1DU0 A;  2OU2 A;  1HF0 A;  4A0X A;  1R5H A;  3LA7 A;  3RYP A;  3H5A A;  1H8A C;  3QPS A;  2Q2E A;  3ZOB A;  3H0G J;  4UXN A;  3CJN A;  1X1C A;  5JFR A;  3T8T A;  5TIS C;  2PMH A;  5BQT A;  5GAE J;  1YRN B;  3ZMZ A;  2Y2Z A;  4A3I J;  4Q4Z F;  4PSX A;  3MCZ A;  4A3J J;  3CTA A;  3OWT A;  1RR7 A;  4CCL A;  2A6T A;  1ZRD A;  2B7E A;  1JT6 A;  2W7N A;  4HZF A;  2ZC2 A;  4ESF A;  2MG4 A;  3I0T A;  4UVC A;  3S2D J;  3C2H A;  5J4V A;  2R4G A;  5B3S H;  2OAZ A;  4YIR X;  1IV8 A;  1X1D A;  2HWV A;  1IRZ A;  2ZXI A;  2X48 A;  2JA8 J;  1XN7 A;  5FFX A;  1T38 A;  5FKL A;  2DMU A;  1OCZ H;  5DUI A;  1W5S A;  3DV8 A;  2KLO A;  1OLT A;  4D1Q A;  2BV6 A;  3F21 A;  2HZT A;  4DQ2 A;  1BA5 A;  1TP4 A;  1FSE A;  3SEQ A;  5D5U B;  4LJZ F;  1K78 A;  3SZP A;  3MZH A;  2JJ7 A;  3H1C A;  3PFY A;  3WE3 A;  3I4M J;  3E5U A;  4G6D A;  4AVP A;  4U0Y A;  2KDZ A;  1W0T A;  2QYO A;  2ZXJ A;  1O7L A;  3TDZ C;  2FBK A;  4RBO A;  4P96 A;  4CA0 A;  2HDW A;  4PJ0 C;  1JJ6 C;  1NHA A;  3DTI A;  3I3L A;  2HPM A;  1MBH A;  2EV5 A;  2HU9 A;  3IH2 A;  4IO9 F;  4BDY A;  2EIN H;  4XMY A;  1MW7 A;  2MGQ A;  3A1Y A;  1WQ2 A;  3RQI A;  3I64 A;  1K79 A;  3BJ6 A;  4NUB A;  2HPI A;  4MHG A;  5JI6 A;  3FBI B;  5HLI A;  4KMF A;  3M7G A;  3W2W A;  3CCS I;  5HLT A;  3TP0 A;  5EF6 A;  5L3B A;  3PNV A;  4WXC A;  1NG6 A;  1Q1V A;  4W1U A;  2IAI A;  2LNB A;  2KZV A;  2WV1 A;  3HSE A;  1BL0 A;  1V5E A;  4DOZ A;  1SVM A;  1STZ A;  2Q2E B;  2ZBK A;  1A31 A;  3TO6 A;  5EGO A;  3CCJ I;  2D45 A;  4EM1 A;  2WAQ A;  2CW0 F;  1ZK8 A;  4R8H A;  4E6K G;  1MJ9 A;  5FLV A;  3A2K A;  4M74 A;  1RKW A;  1MJA A;  2F5D A;  2HYJ A;  1OKR A;  4DBQ A;  2JUG A;  2DW4 A;  3ZGK A;  2VJ4 A;  1UFM A;  1YI2 I;  4AID A;  5DUK A;  1HW1 A;  5M3F J;  4DGW B;  1WZ2 A;  2XKP A;  5DEQ A;  1FY7 A;  3AAF A;  1LKX A;  3OIQ A;  4M72 A;  1XGN A;  2P81 A;  4JOM A;  2R5Z A;  4WCG A;  3WGH A;  2P0W A;  2X6O A;  1J9I A;  3IRR A;  2V9K A;  4F91 B;  1Z7U A;  2LTP A;  4AM3 A;  1LB2 A;  5HS9 A;  3V42 A;  3FF5 A;  3PIP F;  3JR9 A;  2X9D A;  1SD5 A;  2JMW A;  4IJA A;  1YHQ I;  3QPH A;  3HXL A;  5K5Q A;  2DT6 A;  3HOS A;  2ECB A;  2KIS A;  4DYR A;  2C6Y A;  3DBR B;  4Y15 A;  2DYS H;  1K78 B;  4IHX A;  3CLO A;  2EWN A;  1I50 J;  1SFX A;  2NVQ J;  3H3V K;  5CJ9 A;  3K69 A;  3SJM A;  4L9N A;  3IWF A;  4EGZ A;  1IV6 A;  1TQI A;  1X1P A;  5J1R A;  4A3M J;  2IBD A;  3IUO A;  1BW6 A;  1PVE A;  2Y0M A;  1X1B A;  2CSO A;  3HKZ N;  2RV8 A;  2N8G A;  1WJB A;  4PSW A;  1MMS A;  1X1A A;  3DQV C;  4BNC A;  3S1N J;  1Y6I A;  2MYS A;  3ML6 A;  3DFG A;  4FIS A;  4D5F A;  1LFB A;  5F1J A;  4UUS B;  1HC8 A;  1QZZ A;  3ABU A;  4AIJ A;  4BE0 A;  1K83 J;  2OA4 A;  3H9Q A;  2LBF A;  4MIM A;  2VJI A;  2PX9 A;  3KP5 A;  2E7X A;  3D1N I;  3I55 I;  2D5V A;  2Y9Z A;  1XPX A;  1Y1W J;  5LRR A;  2BW3 B;  2OCE A;  3TQN A;  1FZP B;  1ETW A;  2GXA A;  2R7F A;  1R58 A;  3BQZ A;  4M71 A;  3H35 A;  2PLY A;  1J75 A;  2IXS A;  2Z16 A;  3HGG A;  4NQW A;  1LDJ A;  3LFK A;  1Z21 A;  3A03 A;  2VT3 A;  1G3S A;  4P9U A;  2XRL A;  1FYK A;  2WV0 A;  1WCM J;  4HA8 A;  2Y31 A;  2NRA C;  4FAS D;  2EH3 A;  3TBI A;  1U9N A;  3VYT B;  1POG A;  2BVL A;  3GTP J;  3DLA A;  1FSH A;  2DQR A;  2KIU A;  5EDN A;  3E7L A;  4PGG A;  3M1C A;  3H0D A;  2P8T A;  1VFC A;  2M7B A;  3Q5F A;  4GGG A;  1R5I D;  2NS0 A;  2V4J C;  4M3D A;  2HOA A;  4BHB A;  5L3C A;  3DKW A;  4IOA F;  2K86 A;  4JX4 A;  3OYD A;  4F92 B;  1QNT A;  1SVO A;  1ZLJ A;  2K02 A;  3FMQ A;  4FX4 A;  3CCM I;  3ABT A;  4XK4 A;  4Y3O A;  3KZI C;  1XG1 A;  1DGR M;  2K27 A;  3PQK A;  3MAJ A;  1IC8 A;  3S3N A;  4C3H J;  1JKO C;  2EK5 A;  3QPL A;  2MSY A;  2Z5U A;  3KPH A;  1XSV A;  4G8X A;  3LFU A;  1E17 A;  3O8H A;  5ICC A;  3OSG A;  3GTK J;  1TTY A;  2VKD A;  4GO1 A;  2EIK H;  1KYZ A;  2LYC A;  4YII A;  3BQY A;  4B3A A;  2E1N A;  2VXD A;  3OYE A;  1KQ9 A;  2CQX A;  5JLX A;  5J8C A;  3GO5 A;  1OQY A;  3S2W A;  1BIA A;  3G1M A;  1Y1V J;  1R4M B;  3KLO A;  4MO7 A;  1APL C;  3GFI A;  2HYG D;  2QCO A;  1DUX C;  4XQF A;  1RET A;  4IRH A;  5HVQ C;  1LFP A;  2FNA A;  4BXX J;  3E97 A;  4C3I J;  3H5R A;  3CO6 C;  2BXY A;  4A12 A;  1ERD A;  2YX4 A;  3DTK A;  2OD5 A;  2NNY A;  2AS5 F;  4D9J A;  4M3G A;  3GTM J;  2IP2 A;  5F0F A; 
#chains in the Genus database with same CATH homology
 3SDG A;  1JTY A;  1PUF B;  3LSP A;  2CQQ A;  1G2H A;  2NVX J;  3JRD A;  3LSJ A;  1X2N A;  3CMY A;  3NAU A;  2M2E A;  3OIO A;  2LD5 A;  4QSH A;  2ECC A;  3BR6 A;  3HOU J;  2O8K A;  1JUP A;  2K9S A;  1IDZ A;  1GV5 A;  2GBY A;  1OCP A;  2QF7 A;  3A01 A;  1QVU A;  3JRA A;  2M8G X;  1ETK A;  1AKH B;  1H88 C;  4A3F J;  4FE4 A;  1AU7 A;  1FJL A;  2M9H A;  2XB5 A;  1TWH J;  3F0C A;  2G0E A;  4CYC A;  1DU6 A;  3FK6 A;  2E19 A;  3BR2 A;  5C3E J;  1TWA J;  1VI0 A;  2DMT A;  1FTT A;  2HI3 A;  1HLV A;  2XGE A;  5DTD A;  4AUX A;  2R5Y B;  2HQ5 A;  3RKQ A;  4ABZ A;  1JTX A;  1ETO A;  3B6A A;  4S0H B;  1ZR2 A;  4G12 A;  2DA3 A;  3GTJ J;  2FJ1 A;  1NK2 P;  1MH4 A;  5E3M A;  4X1E A;  3S2H J;  2VUM J;  2JA7 J;  5K7F A;  1MBE A;  1CQT A;  3S1R J;  3BR3 A;  2B63 J;  1ITY A;  2XSD C;  2CUE A;  1PUF A;  5K7H A;  2E2H J;  1MBK A;  1IJW C;  4V2G A;  3DEW A;  3LSR A;  5EZG A;  2DA4 A;  5F27 A;  2IEK A;  5IP7 J;  3TW6 A;  3BTJ A;  1FEX A;  2VI6 A;  1JKP C;  2CU7 A;  5HOD A;  5E3O A;  1AKH A;  2NVT J;  4HNV A;  2ID6 A;  4AYB N;  3HBL A;  5IP6 A;  4IHV A;  4A3L J;  3S15 J;  1RKT A;  3LOC A;  1WH5 A;  1S7E A;  3PM1 A;  4QIW N;  1ZR4 A;  1ZGW A;  2TRT A;  1TWG J;  3L1P A;  3LNQ A;  1A5J A;  4W97 A;  1GUU A;  1WI3 A;  2FD5 A;  2EZK A;  2R0Q C;  1WH7 A;  3VPR A;  5GPA A;  3HM5 A;  1RES A;  4M3B A;  2R5Y A;  1B72 B;  1P7J A;  5IOY A;  3BT9 A;  3FK7 A;  1T33 A;  1YRN A;  1ETX A;  1Z77 A;  3JRB A;  2GLO A;  4RDU A;  3PO2 J;  2WAQ N;  1UG2 A;  2L9R A;  4CYC B;  5E3L A;  2EZH A;  1OCT C;  3GTG J;  2DMN A;  1HDD C;  3I4N J;  5EG0 A;  5M5X J;  2XGC A;  3JRG A;  1T56 A;  2LY9 A;  2ME6 A;  3HOV J;  1X2M A;  1QRY A;  2DMP A;  2HDD A;  2DA5 A;  2ZB9 A;  1LFU P;  2K9N A;  4B4C A;  4JX6 A;  2E1O A;  4XIC A;  3W6V A;  3M3Y J;  5F0H A;  1W0U A;  1QVT A;  1NTC A;  2HXI A;  4X6A J;  4BBR J;  2M34 A;  5GPC A;  1JT0 A;  3BTI A;  2NOG A;  2O7O A;  3FKI J;  4MFE A;  1R9T J;  1XS9 A;  3Q0U A;  1JJ8 C;  4GFB A;  2R92 J;  3NAR A;  4MFD A;  2XPW A;  3QQA A;  5EEA A;  2XPV A;  4A3C J;  1ORK A;  4M3F A;  5M5W J;  2EZI A;  1IUF A;  3ZQI A;  1BW5 A;  5IPA A;  2R93 J;  1B72 A;  3S17 J;  5C4X J;  4A93 J;  1IDY A;  2LK2 A;  2GM4 A;  1MSE C;  2YUS A;  2CUF A;  3SFI A;  1GVD A;  3OOU A;  3PO3 J;  1ENH A;  1HOM A;  4XRS A;  5F0C A;  1QPI A;  2R7Z J;  4I76 A;  1VF9 A;  2CRG A;  1DU0 A;  1HF0 A;  1MBJ A;  2FX0 A;  4A3K J;  1H8A C;  3QPS A;  1D5Y A;  3ZOB A;  2YU9 J;  3H0G J;  1JUM A;  1WPK A;  2YS9 A;  3JRE A;  5F08 A;  3BTC A;  4BBS J;  3M4O J;  2TCT A;  2EQR A;  2OF7 A;  1YRN B;  2Y2Z A;  4A3I J;  1ETV A;  2EZL A;  1LE8 A;  4FTH A;  4A3J J;  4D5C A;  4EEF G;  1I3Q J;  3MN2 A;  4A3D J;  1RR7 A;  1UHS A;  1MBG A;  1JT6 A;  2VKV A;  4DYQ A;  2MG4 A;  3S2D J;  1B8I A;  5EG0 B;  2L7M P;  4A3B J;  2JN6 A;  5EGO B;  4XRM A;  4FCY A;  1IRZ A;  2X48 A;  1GV2 A;  2JA8 J;  3BR1 A;  2NVY J;  5FKL A;  2DMU A;  2M0C A;  1U78 A;  3FIS A;  1UMQ A;  3K7A J;  3RZD J;  1ZTR A;  1MSF C;  2K9Q A;  3HOZ J;  2L7F P;  2JA5 J;  1BA5 A;  4A3E J;  4LOC A;  2JWT A;  3IH4 A;  4IEJ A;  3ZQC A;  3G1L A;  2JJ7 A;  2R5Z B;  2K40 A;  3C2B A;  5IP9 J;  3GTL J;  3Q0V A;  2W48 A;  3I4M J;  5IYD J;  3B6C A;  2KDZ A;  1W0T A;  1O4X A;  1GDT A;  3BG3 A;  4RBO A;  1JJ6 C;  3BG9 A;  2LP0 A;  3ZQL A;  3BG5 A;  3WHC A;  1MBH A;  3IH2 A;  3CCY A;  2L7Z A;  4QTR A;  2XB0 X;  2MGQ A;  3JRI A;  5FKK A;  3RQI A;  4A3G J;  5JLW A;  1H89 C;  3HOY J;  1JGG A;  4FE7 A;  5K7Z A;  3TP0 A;  3BTL A;  5EF6 A;  1ZKG A;  1Q1V A;  3S16 J;  3MKL A;  4W1U A;  2IAI A;  1JKQ C;  2WV1 A;  1BL0 A;  1NK3 P;  1MH3 A;  5EGO A;  2VPR A;  5FLV A;  1ZK8 A;  2FQ4 A;  1RKW A;  1Z0X A;  2HYJ A;  1ETQ A;  4BY7 J;  2Y9Y A;  1LE8 B;  5FLM J;  1HDP A;  1RPW A;  3LSG A;  4M3E A;  1F36 A;  5M3F J;  1U9O A;  2HXO A;  5J3L A;  4JP0 A;  1B8I B;  2P81 A;  2ELK A;  3ZQF A;  2R5Z A;  3JRH A;  1AHD P;  2X6O A;  2AO9 A;  3CDL A;  3OSF A;  1JUS A;  5FKO A;  2LTP A;  4DW6 A;  4IHY A;  3HDD A;  4BY1 J;  3TP3 A;  3Q3S A;  4L5E A;  5IYB J;  3JR9 A;  2X9D A;  2JMW A;  2DA2 A;  1I6H J;  1FTZ A;  2ECB A;  4DYR A;  1X58 A;  3HGY A;  2DJN A;  3HOW J;  4IHX A;  5EZH A;  1GT0 C;  4JYK A;  2E2J J;  1I50 J;  2NVQ J;  3H3V K;  5GP9 A;  3SJM A;  5J1Y A;  1IV6 A;  3FIW A;  5J1R A;  4A3M J;  2IBD A;  1BW6 A;  1XC5 A;  3S14 J;  4UUT A;  5FKM A;  3HKZ N;  3WHB A;  2N8G A;  1IGN A;  3GTQ J;  2DTZ A;  2LFB A;  5IYC J;  3S1N J;  1ETY A;  3TED A;  4FIS A;  4D5F A;  2LLK A;  2DMQ A;  4C3J J;  1LFB A;  5F1J A;  4UUS B;  3RZO J;  1K83 J;  1E3O C;  3S1M J;  4M6V A;  4MIM A;  4AC0 A;  3K2A A;  2WB1 N;  5DS9 A;  2LVS A;  3D1N I;  4XID A;  2D5V A;  4MLO A;  2Y9Z A;  1Y1W J;  1K61 A;  4B1R A;  1ETW A;  1OFC X;  4DYC A;  2H1K A;  2EBI A;  3BQZ A;  2Y0S N;  2DA7 A;  3GTO J;  3Q0W A;  2I10 A;  4JX5 A;  3HGG A;  4C2M J;  4V2F A;  3JRF A;  1EF4 A;  3A03 A;  2XRL A;  2L0K A;  1WCM J;  5J1U A;  2Y31 A;  1MBF A;  2HOS A;  2EH3 A;  1U9N A;  1MNM C;  1POG A;  3GTP J;  5BNG A;  5EDN A;  3E7L A;  1FIA A;  1VFC A;  2E2I J;  3JRC A;  4NDL A;  1BJZ A;  2NS8 A;  3G1O A;  5FKN A;  2XGD A;  4M3D A;  2HOA A;  4J19 A;  2HOT A;  4JX4 A;  1SFO J;  3BR5 A;  2JA6 J;  5M3M J;  1P7I A;  2H8R A;  5F04 A;  2CJJ A;  2ME0 A;  5M5Y J;  1U8B A;  4A69 C;  1HCR A;  2KT0 A;  3HEF A;  5IOZ A;  4UUS A;  4XK4 A;  1XG1 A;  5EYR A;  4I6Z A;  1IC8 A;  3BR0 A;  4D7N A;  1OJL A;  2RAE A;  4C3H J;  1JKO C;  2O9L A;  2DN0 A;  3QPL A;  2MSY A;  1IG7 A;  2LR8 A;  5C44 J;  2ID3 A;  2OPT A;  3IH3 A;  2VKE A;  3O8H A;  3OSG A;  4XRS G;  1TC3 C;  3GTK J;  1F43 A;  3GBG A;  1FIP A;  3A01 B;  2COB A;  5E3N A;  4DZP A;  1ZQ3 P;  2JK3 A;  2PMZ N;  3MVP A;  3A02 A;  1VND A;  2XPU A;  3BQY A;  4B3A A;  3IV5 A;  2DA6 A;  3O8G A;  2NS7 A;  3HB9 A;  1SAN A;  2Y30 A;  3UKG A;  2CQX A;  5JLX A;  5C4J J;  3G1M A;  1Y1V J;  4MO7 A;  4DZJ A;  1APL C;  1TWC J;  3DCF A;  2QCO A;  1JKR C;  1RET A;  4BXX J;  3ZQH A;  3ZQG A;  3TW7 A;  3CQZ J;  2AHQ A;  3S1Q J;  4C3I J;  1WGX A;  9ANT A;  2DA1 A;  2MW8 A;  3HOX J;  2LKX A;  4IHW A;  1TWF J;  1A6I A;  4M3G A;  4BKX A;  5FJ8 J;  3GTM J;  5F0F A;  4Y52 J;  4D7M A;  4Y7N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...