1LFUP

Nmr solution structure of the extended pbx homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*CP*AP*TP*GP*AP*TP*TP*GP*CP*CP*C)-3'
publication title Lock and Key Binding of the HOX YPWM Peptide to the PBX Homeodomain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 22
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2002-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1lfuP00
3RQIA 3JRIA 5F04A 4M6VA 2JK3A 4XICA 2CJJA 2QF7A 5C4XJ 4QTRA 1ZTRA 2DMQA 1ETQA 2ID6A 3H0GJ 1RKWA 5F0FA 2L9RA 5EGOA 3TP3A 3OOUA 2MG4A 4XIDA 3HOUJ 5EDNA 1A5JA 1ETKA 1MBFA 3I4MJ 4J19A 2R0QC 2E2IJ 2TCTA 2LR8A 4DW6A 3TW6A 2R92J 2EZKA 2FJ1A 5FKLA 2HOTA 2P81A 2ZB9A 4FCYA 1Q1VA 3GTLJ 2M0CA 2X6OA 1D5YA 1APLC 1GUUA 1ETXA 5IYBJ 1TWGJ 5GP9A 3JRDA 3S1RJ 2H1KA 1OJLA 4C3JJ 2LY9A 1EF4A 5F27A 1X2MA 4XRMA 3E7LA 2B63J 3QPLA 1ETWA 4DYRA 5M5WJ 1HOMA 3HGYA 1TWHJ 4JX5A 5FJ8J 3S1MJ 5EGOB 1MH4A 1XG1A 2M8GX 4ABZA 2XSDC 3O8HA 3G1OA 4M3DA 1NTCA 3NAUA 4JYKA 5J1RA 3ZQGA 2JA6J 1TC3C 4AYBN 1XC5A 2DN0A 2CUEA 2FQ4A 3A02A 3K2AA 1I6HJ 3GTMJ 1H89C 1K61A 4JX6A 3ZQHA 3HKZN 1GVDA 3QQAA 2HXOA 1UMQA 5FLVA 1QRYA 2R7ZJ 2R5ZB 1JJ8C 3GBGA 4G12A 5M3MJ 1JT6A 4Y52J 1B72B 1WGXA 4A3IJ 4MFEA 3GTGJ 3HOXJ 3S1NJ 1HF0A 2VI6A 1I3QJ 1AKHA 2DA1A 2OPTA 1DU6A 1IJWC 4MIMA 4D5CA 1VI0A 2O9LA 3B6CA 3Q0VA 2JJ7A 1P7JA 2LD5A 1P7IA 4UUSB 1JUMA 3Q3SA 1F43A 5GPCA 2L7MP 2CRGA 2Y0SN 2FX0A 1IDYA 5FKNA 2WAQN 2H8RA 3JRAA 3SJMA 2D5VA 1ITYA 3CCYA 2HDDA 3IH4A 1ENHA 2MW8A 4JX4A 2DA4A 3RZOJ 1K83J 1VFCA 1R9TJ 5IYDJ 1F36A 3JRFA 2ME6A 4MFDA 1AKHB 2COBA 2L7FP 4W97A 1H8AC 1FTTA 2WV1A 2GM4A 4B4CA 1GT0C 2GBYA 1JGGA 1GDTA 3F0CA 3HEFA 4XRSG 2DA3A 1B8IA 2ECBA 2M2EA 2X48A 1VF9A 5M5XJ 4M3BA 3BTIA 4I6ZA 2JN6A 4FTHA 3G1MA 2RAEA 2XRLA 4D7MA 1ZQ3P 1MBEA 1IV6A 1IUFA 3GTOJ 2YU9J 4NDLA 3QPSA 4D7NA 3LSGA 3S14J 1JTYA 4IHVA 2GLOA 2DMTA 5F1JA 1TWAJ 5EG0A 3JRBA 2DA2A 2E1OA 1AHDP 4L5EA 5GPAA 1ORKA 1ZR4A 2CQXA 5IP9J 5K7FA 2LK2A 1RETA 2JA8J 4FISA 1A6IA 5EZHA 2XPWA 1BW5A 4JP0A 2L7ZA 2Y31A 1FEXA 1JKRC 1G2HA 3A03A 3HOVJ 1B8IB 2Y9ZA 3RKQA 5IOYA 4A93J 2R5ZA 3L1PA 5JLXA 2LKXA 1RR7A 5IP6A 2N8GA 1B72A 3JRHA 1X2NA 1FIAA 4QIWN 3VPRA 4A3LJ 4M3FA 2NS8A 2LFBA 3PM1A 4XK4A 5EG0B 1RKTA 2XB5A 4AUXA 1QPIA 3BR5A 3CQZJ 3BR0A 4BBSJ 1BA5A 4D5FA 3A01A 1LFBA 3GTPJ 2JMWA 5E3MA 4V2GA 3FK6A 4UUSA 2LTPA 1IGNA 1MSEC 4A3BJ 1PUFA 3NARA 5HODA 3HB9A 3GTQJ 1Z0XA 1ETOA 3GTKJ 3IV5A 2WB1N 1W0UA 3HM5A 2DMPA 2O7OA 2YUSA 3BR1A 1FTZA 1ZR2A 2M9HA 4A3FJ 2DTZA 4I76A 3BTCA 3HOWJ 3ZQIA 5DTDA 4EEFG 1JUSA 4A3EJ 1ZGWA 3OSFA 3FKIJ 1OCTC 3PO2J 3LSPA 1JKPC 2LLKA 4MLOA 1TWFJ 4BY7J 1XS9A 5FKKA 3A01B 2HI3A 2HOAA 2IEKA 3Q0WA 4A3DJ 4X6AJ 2ID3A 2EZIA 5J1UA 3MVPA 3K7AJ 4FE4A 4MO7A 5F0CA 4LOCA 2DA7A 1LE8A 5K7ZA 2L0KA 2W48A 1PUFB 2NVXJ 4IHXA 1T56A 1ZK8A 3M3YJ 1JTXA 5FKMA 5M5YJ 2IAIA 4RBOA 4BKXA 1T33A 2R5YA 2ELKA 3HOZJ 1E3OC 2MSYA 2DMNA 2XB0X 2AHQA 1RPWA 4DZPA 2E19A 5F08A 2Y30A 4IHYA 1HLVA 2VKVA 1BJZA 3IH3A 3S2HJ 2XGCA 5IPAA 3GTJJ 1JJ6C 2DMUA 5E3LA 3S2DJ 2HOSA 1WI3A 2NVTJ 1DU0A 2CQQA 1ZKGA 4AC0A 4A3CJ 4GFBA 5E3NA 4CYCA 3TW7A 3BQZA 5C4JJ 4B3AA 5K7HA 4S0HB 2LVSA 3DCFA 1LE8B 1U9NA 2XGEA 4IHWA 1IRZA 2MGQA 2M34A 4DZJA 5EZGA 3CDLA 4M3GA 5IOZA 4BY1J 2NS7A 2DA6A 1ETVA 4IEJA 1IG7A 3FK7A 2R5YB 2ME0A 2G0EA 3FISA 4M3EA 2PMZN 2K9QA 1NK3P 5EYRA 1BL0A 1MBGA 2CUFA 2Y2ZA 2EZHA 2DJNA 1HCRA 2HQ5A 3LSJA 1WH5A 3ZQCA 1Y1VJ 1Y1WJ 5JLWA 4A3MJ 3PO3J 1CQTA 2K9SA 4HNVA 4CYCB 5M3FJ 1FJLA 2KDZA 3BR6A 9ANTA 3OSGA 2Y9YA 2LP0A 4B1RA 3HBLA 3IH2A 2OF7A 3W6VA 2EBIA 3HGGA 2XGDA 1MBKA 4C3HJ 2XPVA 3B6AA 1WCMJ 4X1EA 3BQYA 2EQRA 1SFOJ 1YRNA 4DYCA 2EH3A 3BR3A 3S1QJ 2DA5A 1QVTA 1MNMC 3SFIA 1HDDC 3BT9A 5EEAA 1MBHA 1LFUP 2JA5J 3MN2A 1HDPA 2AO9A 2VPRA 5FLMJ 3DEWA 1JKOC 5J1YA 1X58A 1Z77A 3WHCA 4BXXJ 1I50J 2O8KA 4UUTA 1S7EA 3ZOBA 5J3LA 1OFCX 1TWCJ 4Y7NJ 2X9DA 2I10A 1W0TA 2QCOA 3H3VK 1NK2P 3SDGA 2KT0A 1MBJA 1YRNB 1O4XA 2NVQJ 4W1UA 3OIOA 3M4OJ 2HXIA 2JA7J 4RDUA 3I4NJ 2VUMJ 4A3JJ 1BW6A 1JUPA 4A3KJ 4XRSA 3JRCA 1POGA 5EF6A 4DYQA 4BBRJ 3FIWA 1UG2A 2XPUA 3MKLA 3Q0UA 3LNQA 5FKOA 2K9NA 1WPKA 3HDDA 3ZQFA 1OCPA 5C44J 1QVUA 2EZLA 3G1LA 3WHBA 3ZQLA 1JKQC 1WH7A 2NVYJ 3D1NI 1U78A 3HOYJ 1H88C 3S15J 2R93J 4C2MJ 4V2FA 2ECCA 2HYJA 2IBDA 5F0HA 3BTLA 3BG3A 3S17J 3LSRA 5DS9A 1IC8A 5IP7J 5C3EJ 3JRGA 4A3GJ 5IYCJ 3TP0A 1FIPA 3RZDJ 1VNDA 1GV5A 5E3OA 2NOGA 3BR2A 3JREA 1UHSA 1JT0A 2YS9A 4C3IJ 1MSFC 4A69C 2TRTA 2JWTA 3S16J 1U8BA 1AU7A 2E2JJ 3BG5A 1MH3A 4QSHA 1GV2A 3JR9A 1ETYA 2K40A 3O8GA 1SANA 4FE7A 2FD5A 3CMYA 3BG9A 3BTJA 5BNGA 3C2BA 3UKGA 3TEDA 2VKEA 2E2HJ 1U9OA 1RESA 1IDZA 3LOCA 2CU7A
chains in the Genus database with same CATH superfamily
1EA3A 4F3QA 2HDCA 4HV6A 4NC6A 4G7OF 5F04A 2XROA 1MJAA 1X3ZB 1GLNA 3TO9A 4XICA 2EIMH 1LDKB 2VC0A 5KK1A 3WTXC 4ZDPA 1JGSA 4F7ZA 4M9SA 2FBHA 1YTYA 5GADJ 1XSDA 3PFYA 1WJBA 1ZTRA 1ETQA 1XB4A 2DMQA 5K5QA 2M1BA 1J59A 2DDAA 2VE8A 2WA0A 3GEZA 5EGOA 1I6XA 5CKTA 2F6CA 3QODA 1N78A 1XCVA 3L2CA 4U7BA 1T2KA 2LMDA 4J19A 2H6CA 3TW6A 4JOMA 2EZKA 3QWLA 2HOTA 4KUMA 1P4XA 3KZZA 4GCVA 4IHSA 4I7HA 2IS6A 4FCYA 2O6GE 1X1AA 3GTLJ 4DGWB 2FF4A 1APLC 2ZXJA 3GYHX 5GP9A 1FC3A 3JRDA 1K78B 4C2UA 5FGMA 2VXZA 4LK1F 4C3JJ 1EF4A 4XRMA 2B63J 1IXRC 2A5WA 3K70C 1TZLA 4DYRA 1F5TA 3HGYA 1TL8A 3F6VA 2Y69H 1UFMA 4II3A 2DOEA 4AIJA 2M8GX 4ABZA 2CW8A 3J7YJ 2XSDC 5B1BH 2HR3A 4M3DA 3ZMDA 3KYLA 2M7BA 3ZQGA 5B66C 3ZMTA 5HLIA 4ZYHA 1WSUA 1BR1A 2ZC2A 3K2AA 4ENNA 4UVCA 2E35A 1X3WB 2VJ4A 1I39A 1SMTA 2HXOA 1VQ9I 3ESWB 1R58A 2X4HA 1A6QA 3GBGA 3BZCA 4E70A 1D1CA 4A12A 1WGXA 3F3XA 4A3IJ 3GTGJ 3OYDA 1ZRCA 1FBQA 1HF0A 1QZZA 2VI6A 4E7LA 1AKHA 3EUHA 1JXSA 2BHYA 4ANJA 1IJWC 2ZKZA 2WY8Q 3KP4A 4G6DA 3T8TA 3KCCA 3F8BA 5DCMA 4HF0A 3N97A 2DQRA 1E0EA 3PJRA 1Y39A 1P7JA 1RUNA 1QZYA 2NXNB 4Z2YA 2LD5A 3FBNB 1D1AA 1P7IA 2IPQX 2D1VA 4XONA 1RR8C 2CRGA 2FX0A 1X3UA 3DP7A 2GQQA 1IN8A 2D5VA 1ITYA 3CCYA 2RV8A 2HDDA 1R1TA 2Z1DA 3E3VA 1F1ZA 1HKQA 4IZZA 1K6OA 3ML6A 1ENHA 3ECOA 3GCMA 4X0GA 3PIPF 3BP8A 1FLIA 2DA4A 1R9TJ 5JR3A 5IYDJ 4WK8F 5LRSA 4BJTA 4XKVA 3H5NA 1ZG1A 1XSXA 2COBA 3AKZA 2P5KA 4BGDA 1H8AC 3B73A 1UHWA 3CDIA 2GM4A 2D45A 2MH9A 3OYFA 1VQLI 3JAMZ 1H9TA 2GBYA 4OIPF 2E36A 1D1BA 5HDKA 1RRJA 1LJ9A 1VQPI 2QQ8A 2CO5A 2IP2A 2QBYB 2DA3A 1B1BA 3U1KA 2ECBA 4A2UA 2BE5F 5M5XJ 1DGWY 2XHKA 2X1DA 2A6TA 4I6ZA 1MIJA 1VQ6I 5KAFC 3G1MA 4BQOA 1IV6A 4XQFA 3K4JA 2VT3A 3CD6I 1SFEA 3HUGB 1VQKI 3DF8A 1IF1A 3W2WA 3HC7A 5F1JA 3JRBA 1S8NA 1QHHD 1AHDP 4L5EA 1ORKA 3OV8A 2CQXA 4BDYA 2JRMA 4A6EA 3W6JB 2LK2A 3T1BA 2Q2EA 4EMSA 1ON2A 3FHNA 2JA8J 4FISA 1EH8A 2RKHA 4XLFA 1FP1D 1G2HA 1FEXA 1E2XA 3F8CA 1IZ1A 5CQGA 5KNLA 1ZARA 4P9FA 4LLLA 2R5ZA 4AWXB 5L3EA 5JLXA 3I5UA 2N8GA 1B72A 4BDZA 1X2NA 1O3TA 1IRFA 3ZQ7A 4M3FA 4EM2A 3RKXA 2LFBA 4XK4A 2KIMA 5TRDA 2KQRA 4UV8A 4BBSJ 2JVHA 2JMWA 5E3MA 4V2GA 1MNDA 2R7QA 3CUQA 2IGNA 2VC1A 2BVMA 1MSEC 1LEBA 3NARA 1GXPA 2RDPA 4IRHA 3K70D 1Z0XA 2ZJPF 1Z7LA 2WB1N 1W0UA 2X85A 1O3QA 3HHHA 1BR4A 4M71A 2XAUA 5D4RA 3KLNA 3HOWJ 1R49A 1SD4A 2LF7A 3O6BB 3OYIA 3M8JA 4F91B 3J81K 3CZ6A 3WU0A 1ZLKA 4BXFA 4GO1A 1SD7A 1Y8RB 3ZXSA 2R7OA 2DT7B 3V42A 1XS9A 5FKKA 3HTSB 3Q0WA 1EH7A 4X6AJ 3MVPA 3K7AJ 4G6TB 4N4NB 3ZQQA 1LE8A 4AM3A 4RGUA 3CTAA 2P4WA 1BI0A 1ZK8A 2QKMB 2LRDA 5M5YJ 5FKMA 1Z05A 2V1XA 2P5LC 3KEOA 2ESNA 4PJJA 5E1WA 1B4AA 2ELKA 2MSYA 2AHQA 2QUFA 1A31A 3NEUA 1YW8A 2KZVA 3OYGA 2Y30A 2A5YB 3HKZA 3H36A 4CCNA 1BJZA 1B9MA 4DIQA 2R7SA 5E3LA 2R7WA 2LF8A 3VDXA 2HEOA 2HOSA 1WI9A 1WVRA 3FMRA 1SFUA 4GFBA 1MMGA 3BQZA 3IC7A 2E71A 4Y33A 5ICFA 3M1CA 5H6QA 5HOOA 2XGEA 4IHWA 2W7NA 1BI3A 2CGPA 1S7OA 3CDLA 3F22A 2YSRA 4KITB 3RIRA 1H9GA 3KEYA 4BY1J 2IJLA 3P7NA 4XLNF 3FK7A 3LSTA 1QPMA 4AIKA 5FLXK 2K9QA 5E8GA 3V8JA 4YRVA 2HVQA 3OWTA 4M74A 4CYDA 3J80K 3K1MA 2CUFA 2EZHA 2FNPA 4EVIA 2WAQA 4YFKF 1HSJA 1WH5A 3ZQCA 4Z6YA 4A3MJ 2VODA 2H09A 3RYPA 1YO5C 2K9SA 3TKYA 4CYCB 1G6NA 5M3FJ 4YEJA 1V5FA 1TT0A 4ENMA 4CZZA 1S3JA 2KDZA 3DBLB 3BR6A 1QQIA 1XMKA 3G4SI 3OSGA 2Y9YA 5F6FA 1TLHB 5J4VA 3E0JB 3BJ6A 3RI4A 3IH2A 2O8XA 3W6VA 4DBRA 4FX0A 4RGSA 4XNFA 2DYRH 1UAAA 1DPUA 1Z3XA 3OYJA 1AWCA 4XBFA 2OTLI 1Z9CA 4C2TA 5K5RA 2XSJC 3TBIA 1WCMJ 4QWQA 2XKOA 4X1EA 2EQRA 3ASOH 1SFOJ 2CV1A 1IN6A 2AQEA 3BR3A 3S1QJ 2Q1ZB 5F64A 3MAJA 4XKWA 3VSKA 4G7HF 1YS6A 1FYLA 3ZMUA 5GTIC 2M8EA 2LBFB 1V54H 3BT9A 3HYIA 1WJFA 2AS5F 4E7HA 2K9LA 3MN2A 2Z9OA 3GWZA 2AO9A 1U5TB 1YJNI 4UXNA 1IUYA 1WWXA 1GXQA 5J1YA 5BMZA 1X58A 4MGRA 3WHCA 1W7PD 2ISYA 4IJAA 3B02A 1KYWA 2XV4S 2HYGD 4R8HA 1OFCX 1SVMA 2OU2A 5J47A 1IW7F 4BS9A 3VOEA 3PNVA 5TISC 3H3VK 4B48A 3MQ0A 2L7KA 2HS5A 2M45A 1S72I 1O4XA 3C1DA 2NVQJ 4BACA 3I53A 4W1UA 3F6OA 3ERED 2Z16A 3MZ8A 2JA7J 1NG7A 2IW5A 4RDUA 2PEXA 2P7CB 3V7RA 4CO8A 1BW6A 4A3KJ 1Z7UA 1FSEA 1Z6RA 4PJLA 3AG4H 5EF6A 4DYQA 3J7AY 5BQTA 1ODDA 4YIFA 1XGNA 3HL2A 2LY1A 1J0RA 4E6KG 4U87A 1B9NA 5C44J 2BOLA 2UZKA 2XDVA 3MD2A 1YE9A 1FT9A 3A4CA 2FOKA 2XAQA 3BG6A 2K3PA 2R93J 4RLQA 2ECCA 3CLOA 2H1LA 1ZELA 4IOCF 2HYFA 3BG3A 4HX4A 2F4MB 4C9YA 4P9UA 1IC8A 2CMPA 5DM7F 1FIPA 5FO5A 2OA4A 3R60A 3KIOA 2VT2A 2G9WA 1GV5A 3QOPA 5FD6A 2WAFA 1UHSA 3IL2A 4ZDLA 2L4AA 2Y75A 2JSCA 2TDXA 3W2VA 1FYKA 1SEUA 2QQBA 3MKZA 2F4IA 2VPLA 2KDOA 1PUEE 4YFNF 3CUQC 4S04A 2FBIA 3BG5A 1KGSA 4KT6A 1QNTA 1OCOH 3HOTA 5FFXA 2HKXA 2R7TA 1WQ2A 2JVGA 4KN7X 1SC7A 2QA4I 3WGHA 5BNGA 3UKGA 1G3YA 5KHDA 1A35A 1WJDA 1RESA 4ZTFA 1NH3A 2RQQA 2JSPA 3RQIA 2IS1A 5ERIA 3VODA 2R4GA 4M6VA 2JK3A 3A1YA 3K1PA 3HOSA 1UZCA 2V6EA 2CJJA 2QF7A 3K4KA 3KX2A 5FRMA 1J7KA 3DPUA 3F8MA 1SAUA 5CVRA 2ZBKA 3C18A 4IHTA 3EUAA 3HSFA 4XL9A 1AA7A 1G3TA 2B7EA 4G94A 2OC6A 5F0FA 4LFUA 3K0LA 3CO7C 4L5JA 5CJ9A 4HF2A 4XIDA 2ZMEA 2XC7A 1BI2A 2VJJA 1R00A 2BZTA 2M4GA 2O03A 1WHUA 1U2WA 3RJPA 2OCEA 4YIRX 2M5WA 2R92J 2CQKA 2FJ1A 4WX9A 1HXDA 2P81A 1TP4A 4HQEA 2BY1A 1DQUA 1Q1VA 4OIRF 2K02A 2X6OA 4GYGA 1I1SA 2K7LA 3E1SA 2MLKA 3F72A 4ZYGA 1ETXA 2CFOA 2R7FA 3H5AA 2H1KA 1OJLA 5HS9A 3OS2A 2V1UA 2CV0A 5F27A 3E7LA 3QPLA 3VSLA 1OLTA 5F1RA 1FP2A 1LVKA 2DODA 4HW0A 4LIVA 1N77A 2O0YA 1ZYRF 1WJ5A 3CMMA 1MH4A 1A04A 2I5UA 4LG3A 3JSOA 3IAM2 1OCRH 2WV0A 3FXOA 5H20A 4PK4A 2VXDA 3K4BA 4CDGA 3P9KA 3OYMA 1TTYA 4AYBN 5D5XB 1TC3C 5D6FA 4XOPA 2JA6J 1DUXC 1T08B 2CUEA 5D8KB 3A02A 3I64A 4NHJA 1I6HJ 2VBYA 2MC4A 2KJCA 1MMAA 3WE2A 1V4RA 1GVDA 3DKYA 2IT0A 4PJ0C 1UMQA 2OJED 1QRYA 1T98A 1OYWA 2R5ZB 2FQ3A 2Q0OA 3ELKA 1G59A 2R3SA 2NVUB 1B72B 3OL4A 1K7AA 4IKFA 2QSFX 2IRFG 3S1NJ 5EEGA 1R22A 3KP2A 4WXHA 2XUBA 3DV8A 2H94A 1OMIA 3GUDA 2XASA 4I02A 2DTRA 4D5CA 2O9LA 3GLLA 1MJ9A 4CCKA 3LFUA 4KICA 2F48A 4AIHA 4CCLA 2IVMA 3E6MA 1P2FA 1KA8A 2L7MP 2LH9A 4E7IA 2WTEA 5ILVA 3S3MA 3RPQA 2Y0SN 1IDYA 5FKNA 3SJMA 2DAOA 2ESHA 2M7AA 5DEQA 2RVCA 3TL4X 2R7VA 3FM5A 3JSPA 2J5OA 1W7PA 2CQNA 1FOXA 3CJRB 3K69A 3RZOJ 1K83J 1VFCA 1D8JA 2X51A 2V26A 1VZ0A 1F36A 2PMUA 3C7JA 3IP4B 4R1HA 3OYKA 1G3WA 2L7FP 4W97A 4B8XA 2EILH 3CF2A 2BYVE 3M07A 4H0EA 2A6HF 2ZXIA 3RKYA 4PGHA 4EGYA 1XMAA 5D8LB 2Z33A 1WJAA 4PUSA 1FOWA 4L0YB 2COMA 1OISA 5E17F 2L02A 2LG4A 3AG3H 1O3RA 1EJ9A 4P5OA 3EUKL 3S93A 2EIJH 3F0CA 4PDKA 1YI2I 1GDTA 4XRSG 1XSVA 1B8IA 2VN2A 5EJCA 3CLQA 2X48A 2RNGA 3BTIA 2YPRA 4XSXF 2JN6A 4D7MA 2RAEA 2XRLA 1MBEA 1EKEA 3GTOJ 2YU9J 3KP6A 3LSGA 2F5FA 4KISA 2DMTA 4LB6B 3BOQA 1N75A 3BROA 3K4MA 4WF2A 1YITI 3LA3A 2F5EA 2Y0MA 5GAHJ 4HNUA 2K85A 3LMMA 5IP9J 5K7FA 1LFPA 2OBPA 2Z2SB 3CP8A 1RETA 1ULYA 5DD8A 1BOBA 3DEUA 3QPHA 2ISZA 5EZHA 5FROA 4JP0A 1G4DA 4E7KA 2KMUA 4RB2C 2EJRA 5TJJA 3HOVJ 1K4TA 3RKQA 3R61A 5IOYA 1YW9A 4A93J 4XOTA 2O61A 3DBHB 1KZHA 2LKXA 2FNAA 4TV7A 4QPOA 2NRAC 3NRVA 3VWBA 3GZNB 3CMAI 3SZGA 3JRHA 1U6GA 3F21A 4JBAA 3UR3C 4Y3OA 4QIWN 2STWA 3DLAA 5EG0B 2XB5A 1TNTA 4B43A 3N4MA 3CCRI 2BY2A 2PBIA 3GLXA 1XGMA 1BA5A 2VIXA 3TOAA 4XKBA 4D5FA 3A01A 1SD6A 1ONVA 3ZMVA 5A2QK 3G6EI 2JT1A 3RTRA 1OQYA 1XPXA 2E1NA 2L2OA 3TOBA 1HA8A 2V1NA 2DI3A 1IN7A 4EQQA 4NUBA 5HODA 4BNCA 2PJRB 2GAUA 4LMYA 3HM5A 1S6LA 1ZN2A 2M9HA 4BEHA 4A3FJ 2DTZA 4I76A 3KETA 4OIOF 3ZQIA 5DTDA 4EEFG 1MMDA 2QGUA 3ISPA 1JUSA 3OSFA 3AL0B 3PO2J 3BC8A 3LSPA 4EJUA 1JKPC 4UV9A 4MLOA 1TWFJ 3OOPA 3SFZA 1IO2A 3RYRA 3ZP5A 2HVSA 4L0ZB 2HI3A 4A3DJ 2ZMEC 2KIQA 2M30A 5J8CA 2STTA 5DV5A 3W2AA 4LOCA 2DA7A 2MLGA 2V9VA 2L0KA 4ASNA 2DFFA 1PUFB 1RUOA 4KJZA 1T6SA 4I98B 3LFKA 2PJPA 5L3CA 4O5VA 3G71I 3FKJA 1KU7A 2DMNA 4BAYA 3LAJA 1RPWA 4CXFA 2JPCA 2VJIA 1LNWA 3SEZA 4CCMA 3RQ4A 5H2FC 2XGCA 5IPAA 4BHPA 3N05A 2DLLA 3MKWB 1WI3A 2F2EA 4HYEA 2CQQA 1ZKGA 2L01A 4A3CJ 2GOXB 2W24A 3AG1H 5E3NA 3TW7A 4LLGF 1YQAA 3WU1B 1X1CA 2LVSA 4G7ZF 2CSOA 3WTWC 4I99C 4DZJA 5EZGA 1VQOI 4RB0A 2HZDA 1EH6A 5IY5H 3A2KA 2R5YB 2X6WA 2PMZN 4RLFA 4LG0B 5LRRA 3E97A 3BG7A 3KZYA 2Y2ZA 2Z99A 3CUOA 1C0WA 3L2WA 2HZTA 2M4KA 5GAEJ 1KQ0A 1D0YA 3IWFA 3DWLE 3DFGA 2B0LA 4LLNA 3I59B 1Y0UA 3CDHA 4HNVA 3CCSI 1ZGAA 2W85A 4RAGA 4HBLA 4D9JA 2P8TA 1LPQA 1V55H 5CYVA 2BW3B 2ELHA 4UHTA 4NBQA 2D1HA 2DDBA 1OYYA 1X4OA 2A68F 4EV0A 2D2WA 4JQFA 4IQJA 3HGGA 3CJNA 4BHCA 2XGDA 1SMYF 4ETSA 5JI6A 3S2WA 2BY3A 3VYSB 1RNLA 4HZFA 5HDNA 3GX4X 3KP3A 1WFXA 2XGXA 3BQYA 3QU6A 2JUCA 1YRNA 1ON1A 2KRFA 4BXUA 2EH3A 2X6XA 1YX5A 3ABTA 5E18F 5BPDA 1MNMC 5LHIA 3ZCOA 2K3FA 4HX7A 1HDDC 1QHGA 2ZFUA 2XAJA 4XN3A 4IRIA 5L3FA 4RAZA 2UUZA 4B44A 2VPRA 4NQWB 1LKXA 3CC4I 1EV7A 2FXAA 4O6JA 1IV8A 3DPTA 4RMNA 4BXXJ 3HXLA 4ZZDA 2CUJA 2JUGA 2ZO4A 3ZOBA 4LIUA 3BPVA 2Z5UA 5J3LA 2IA1A 1TWCJ 2G7HA 4Y7NJ 2X9DA 3H3UA 4XLEA 1FNNA 1UCRA 5HDGA 1W36D 1BC7C 1MBJA 3U2RA 4CCJA 1FX7A 2NNNA 4RA2A 5KAIC 2W1OA 2WWYA 2EIKH 2HXIA 2Z3YA 1ZH5A 2JZYA 3I4NJ 1RC9A 3BDDA 3L2UA 2R7XA 3FF5A 1JUPA 2WADA 4I0AA 3WGGA 4XRSA 4RGXA 2A6EF 4BBRJ 3FIWA 3MKLA 5FKOA 2K9NA 1WPKA 3HDDA 4L9NA 3HSEA 5H6RA 1BC8C 2L54A 3G1LA 2NVYJ 1MDMA 4Y17A 1T39A 3PFIA 3GZ6A 2L5QA 1YW7A 4GGGA 1IN5A 4C2MJ 4MQVA 3L2VA 2IBDA 5E79C 3IRRA 1Y56A 3L09A 5IP7J 2V7FA 2KJBA 4A3GJ 5IYCJ 4HDVA 1VTNC 2GXAA 1ZHFA 2GXBA 2B9SA 4BYYA 1DDNA 2K9MA 1HKSA 3FBIB 2NOGA 3BR2A 5E3OA 1JT0A 2ZJ2A 2ICWG 1TNSA 6PAXA 1KU2A 4DBQA 3WTYC 4CGZA 4M9ZA 4WXCA 3BJOA 1U8BA 4OIQF 4XLCA 1MH3A 4HX8A 3CCLI 4QSHA 4BL0B 2UWMA 2DJIA 1GV2A 3JR9A 3DU5A 3F23A 4HLXA 2V4JC 5FB2A 4RS8A 1P6RA 2FD5A 3CMYA 3BG9A 5LEJA 4BQAA 4KA4A 2VKEA 2E5NA 4MTEA 1DGRM 3LOCA 3FDYA 3KLOA 3OYCA 2BXZA 3D5LA 2RC4A 2PMHA 3NQOA 1R4MB 3IKVA 3JRIA 4HOBA 1XDUA 1K78A 4HPQA 3EYIA 1MGTA 2ZNZA 2QEXI 1SFKA 3FXRA 1ZG3A 3EETA 1J9IA 3ABLH 4QTRA 3BZ6A 2ID6A 3G2BA 1U0JA 3SXYA 3TGNA 2QYOA 2HQAA 3TP3A 3OOUA 1R71A 4L18B 2VBWA 3T5XA 2MH2A 3OYBA 3HOUJ 2YX4A 1ETKA 3I4MJ 1CF7B 3D5SC 2R0QC 2E2IJ 2X1CA 2RREA 2X0LA 2E1MC 1QZEA 2EV6A 4XLHA 5LD2C 5FKLA 2OUMA 2ZB9A 3KYDB 2R7UA 3I4PA 2BV6A 2M0CA 4NB5A 2HKOA 2ZFWA 4RGRA 5IYBJ 2FEZA 4XLAA 1IAWA 2KZGA 3S1RJ 3ABUA 1DP3A 3OIPA 3HJEA 4Q5SF 2EPFA 2LY9A 2EV5A 2L9VA 1J75A 2XF5A 3I9V2 2CW0F 1ETWA 1YOVB 5M5WJ 4KDPA 3DTEA 3PIOF 3S1MJ 3WGIA 2G7UA 5EGOB 2CWEA 1E3HA 3I0TA 4MTDA 1F4KA 4AVZA 1VQ5I 1ACIA 2VL8A 4FASD 3FXMA 5L3DA 2CH0A 2F4OB 4M6XA 1NTCA 3A0BC 3NAUA 4JYKA 2ZNYA 2VOPA 4BUPA 1XC5A 2W84A 4YFXF 2IA0A 1M1EB 3BCAA 1FWZA 2PG4A 2XF7A 1K61A 3ZQHA 3S3OA 3LSHA 3QQAA 3V4GA 4HAMA 3ERMA 3I56I 4U0WA 4IRGA 2R7ZJ 1JJ8C 3M8EA 5IT9K 4G12A 5M3MJ 4Y52J 3QAHA 4BE0A 2KFDA 2QM3A 3ABMH 1X1BA 2ZXWH 4RAYA 4G8XA 1I3QJ 2VBZA 2W00A 2FSWA 3WTVC 4MIMA 4PZJA 2HTSA 3VEPA 3OYHA 1VI0A 2K5CA 3B6CA 3Q0VA 2JJ7A 2GOMA 1SD5A 1U3EM 4KFCA 3D5RC 1JUMA 5DCFA 2Q8KA 2VQGA 2BEOA 2H8RA 1BM9A 4KIBA 3J81Z 3TQNA 4CSWA 3WTUC 1FPQA 3JRAA 1HKTA 5GAGJ 1BBYA 4KT5C 4BEHB 3CJTB 2MW8A 4JX4A 1R1UA 2VOOA 1IRXA 3GFIA 1XDSA 3MMYB 2ME6A 3AAFA 3HUGA 1JI8A 1AKHB 2NOJB 4Q47A 3I71A 3ASNH 2YU3A 3J7AO 4AD9A 5DCMB 1FTTA 3LSKA 4B4CA 3CESA 3SQNA 2K4JA 3IUOA 3K6GA 3L9FA 3ABKH 3IAS2 3I54A 4U7DA 1JGGA 2J5PA 4LITA 3HEFA 4Y4RA 3OYLA 4P55A 1O7LA 3E6DA 3GFJA 4FTHA 1ZQ3P 3P9CA 2M87A 5ICCA 1IUFA 2VQLA 2WBMA 4NDLA 4A6DA 4D7NA 1JTYA 3UNGC 2GLOA 2P7VB 2QQAA 3PSIA 3M9AA 3OYNA 1JE8A 1WZ2A 3ECHA 1YJ9I 1D5VA 2DA2A 2E1OA 3GW2A 5BOXA 2VKDA 3Q9VA 5LEKA 1FOYA 2H8WA 2R7DA 2C6YA 3SEQA 5FLXZ 5TGTA 4IF4A 5J8FA 1YIJI 5DM6F 1BW5A 1MJBA 1XMXA 5DUIA 5J40A 5LGUA 1JKRC 2ELJA 2HNHA 2QKLB 1O3SA 1W5CC 2Y9ZA 1YYVA 4OWRB 4EJWA 5ICGA 3CCQI 2E5ZA 5L3BA 4FETA 4IX7A 1RR7A 2FMYA 2XVCA 1W1WE 1MMNA 1XGOA 3VPRA 4A3LJ 3HG9A 1OR7A 2NNYA 4OINF 2BVLA 3PM1A 3KP5A 1RKTA 4HV5A 4FX4A 3CQZJ 4B3XA 3LQQA 2V9KA 4II2A 5CVUA 2Q2EB 2V1DA 3K4LA 1R23A 3WODF 4UUSA 1S5LC 2LTPA 3FXJA 4E7JA 5K1YA 2QZ8A 4L5IA 3HB9A 3GTQJ 1AOYA 4XSZF 3IV5A 2ZJQF 2ETHA 3I55I 2O7OA 5J4YA 3QYFA 1FTZA 1ZR2A 3WTZA 5HNFA 4MEYF 3BTCA 4I01A 1DP7P 4ZZLA 4IL6C 4A3EJ 3BWGA 1OCTC 2K27A 2P0WA 4L9JA 3M7GA 2NS0A 3RPUD 5LHHA 3EPZA 2LLKA 2JQ7A 1LDJA 4BY7J 2F5CA 3L00A 1IXSB 2ID3A 2F5DA 4AU7A 2EZIA 4BQQA 3E6BA 1SAXA 3SZPA 3H9GA 1ZAOA 5F0CA 3CUQB 3K4NA 5K7ZA 2W48A 2NVXJ 5D5VB 3LA2A 2KRCA 5AIQA 1JTXA 1YFHA 1MNEA 1Y8QB 4BKXA 3V7CA 3JTGA 1WJEA 3JAMK 1E3OC 4HF1A 4M9XA 2QVOA 2DOFA 4DZPA 3KFWX 3K2ZA 3TO6A 3H5RA 4LB5A 2HVRA 4IHYA 3GVAA 4E7SA 2KRHA 3PQJA 4GRIA 3S2HJ 1J09A 3OS0A 1T0FC 3GTJJ 5D4SA 2DMUA 1IXCA 1UJ8A 3RCOA 4PGGA 2BXYA 3OL3A 2HFHA 3HRSA 3S2DJ 3QU3A 5CQEA 1DU0A 4AC0A 5E1XA 3V7SA 3CCJI 4CYCA 4Q48A 2DFHA 4B3AA 4S0HB 1FMWA 1LE8B 3DCFA 1U9NA 3LA7A 3REOA 1IRZA 5LHGA 3K4CA 2MGQA 3R4KA 4F52A 4M3GA 1R5HA 1G3SA 2HQNA 5HS7A 4ZJZA 2DA6A 4ENJA 4OMYA 1X19A 1Z91A 4HQMA 2ME0A 3FISA 3R0JA 4G6QA 4M3EA 4E4HA 1PP7U 2R7RA 1NK3P 4KNYA 3VYTB 3LAPA 2MD0A 5EYRA 4HG2A 1BL0A 4CICA 3KZIC 2Y0SA 3HIFA 2DJNA 5E8IA 3FXUA 3FXQA 3LSJA 4MHGA 5CVIA 2EA4A 4QPQA 1R5ID 3ZR8X 1E17A 1Y1VJ 2LYCA 3FHZA 5JLWA 4GDFA 1CQTA 2LBFA 1D0XA 4IVNA 1FBUA 1KQ8A 4LGWA 1A36A 4WCGA 4I0BA 5HNHA 3LSMA 1U5TA 4IOAF 4CHUA 2CYYA 5JVTA 9ANTA 2H6BA 1Z21A 2LP0A 1YHQI 4B1RA 5LBQA 1RZ4A 2EBIA 2DW4A 3KEQA 3SDBA 2AQFA 1B6AA 1DPRA 5B5EC 3F9KA 1Z1DA 5FD5A 1V5EA 4EM0B 3MZHA 3G3ZA 1PJRA 1FZPB 3LQRA 3V8KA 5KCMA 4WWCA 3WTTC 1HBXG 4A0YA 2DA5A 3CCUI 3ZN0A 1NHAA 3OY9A 1HC8A 4NNJA 4F92B 3SFIA 2KP6A 1FY7A 2OD5A 3I3LA 4MEXF 2JPBA 4ENKA 1W36C 5EEAA 1MD0A 4K2EA 1HDPA 3ZRGA 1JKOC 1SVLA 4XRFA 4ZYEA 1V5GA 2XAGA 3EQLF 3FWEA 3HRTA 4PSXA 2ZJRF 1Z77A 4DNCA 3ZGKA 1I50J 3IWZA 2IA2A 1VQ4I 3P9IA 4HNTA 2P6TA 4EATA 1BOAA 2DT5A 2VE9A 3VYUB 1BI1A 2KT0A 3E5XA 3H9QA 3RDIA 1TBXA 2DYSH 1OCCH 3R6SA 3LWFA 1TW3A 3PNTA 2QSHX 5D5WB 1X1PA 1YLFA 5E20A 2VUMJ 4A3JJ 5LFAA 3JRCA 1SFXA 2MA3A 1POGA 4R79A 5DUKA 2NYXA 4ESFA 1UG2A 2XPUA 3CP2A 4HLYA 3NWTA 3H1CA 3LNQA 3WTSC 1OCPA 3KP7A 3LSIA 3E6CC 2UXNA 2EZLA 3GXOA 3ZQLA 1WH7A 3E5QA 3U9GA 2QSGX 1VQMI 3HOYJ 1K4SA 3D0SA 5CVJA 3S15J 3JW4A 1O57A 4MQ9F 4V2FA 5F0HA 4HRIA 3BTLA 3S17J 1V3FA 2W25A 3C3WA 1K6YA 3JRGA 3OS1A 4JK1X 4M6YA 1OR7C 2IXSA 4ZC3A 3RZDJ 1VNDA 3FX3A 2IGKA 1STZA 2FA5A 2V6CA 1IN4A 2ZCWA 2MFZA 2YS9A 2EFNA 2AXTC 4A5MA 4C3IJ 4ZYAA 1ZRDA 2TRTA 4ZYDA 2JWTA 4A0XA 2EA2A 5B3SH 4DOZA 2W4SA 4LJZF 4EJTA 1ETYA 1KONA 3O8GA 3RPUA 2L3DA 1P4AA 1USTA 2A61A 3TEDA 2BY0A 1U9OA 4KN4X 2CW7A 2NAZA 1QGPA 5JHFA 1O7FA 4D0PA 3VB2A 1KU9A 1H0MA 3IKTA 4OAZA 3MKYB 2E34A 5ED4A 1RI7A 3IHUA 4ESBA 3OMYA 2KISA 2MYSA 3GZ5A 5BS6A 5ILSA 4CZCA 4RB3C 5C4XJ 4BE2A 4B09A 1ZLJA 1LQ1A 3H0GJ 3TDZC 1RKWA 2L9RA 1BR2A 3GMEA 2MG4A 3M8FA 4QLCU 5EDNA 3DPLC 3HHGA 1A5JA 5HS8A 1MBFA 1I3AA 2TCTA 2DPDA 2YX7A 2LR8A 4DW6A 3FMQA 4LK0F 1OPCA 1TT5B 1I1GA 4M73A 1REPC 1UB9A 4B47A 1N25A 2PMZA 2MABA 1W5TA 1YS7A 1D5YA 1GUUA 1TWGJ 4N9IA 3SZTA 3OIQA 2HPIA 4HEA2 1U8RA 2OCCH 4UY8I 4UVAA 4ITVA 3J7ZI 1X2MA 4PJMA 1ZG5A 1HOMA 1XD7A 1TWHJ 2KIFA 2ACJA 1F9NA 1LVAA 4JX5A 5FJ8J 5BPIA 3GO5A 1HW1A 2FMLA 1XG1A 1T8IA 4N9HA 2ZMEB 5D6EA 1W5SA 3A0HC 4EGZA 1HSTA 3O8HA 5L3GA 3G1OA 4WXDA 3QYEA 2X6YA 5CLSA 5LLQA 1GHCA 5LGTA 5J1RA 2WY7Q 4I09A 2VLAA 1WRJA 1QA6A 4V19K 2DN0A 4OAYA 3BLYA 3DTKA 1FSHA 2FQ4A 3F8FA 3GTMJ 4BHBA 2QQ9A 4RB1A 1H89C 4Q4ZF 2HGCA 4JX6A 3CCMI 3HKZN 5FLVA 4ON0A 2FBKA 4GXOA 2A05A 1FMVA 1JT6A 1Z3YA 5A2QZ 4PCQA 4MFEA 3BY6A 3HOXJ 2L9SA 1T38A 2PN6A 1PVEA 1U5TC 2EINH 1PDNC 2DA1A 1CGPA 2OPTA 1MKMA 1DU6A 4ZH4F 3CO6C 4HA8A 4ZTJA 2A07F 3I58A 5HVQC 4KMUX 2H27A 3U1DA 1KU3A 2WB1A 4I2OA 2KIUA 3PSFA 4UUSB 1PYVA 1G8XA 3Q3SA 1PP8F 1F43A 5GPCA 3DTIA 1FOKA 4XR6A 2FOWA 3C2HA 2VBXA 2YR2A 2WAQN 1P92A 1YG2A 2QENA 4BH9A 1HQCA 2QWWA 3GFMA 2QLZA 4IO9F 2VKHA 3IH4A 4A5NA 1W4MA 4A0ZA 5DD4A 3JRFA 4YELA 3DKWA 3W3CA 1VQ8I 2OZUA 4MFDA 2WAEA 2OZ6A 5D5UB 4KYWA 2O3FA 5HLGA 2LOOA 5JFRA 3T0YA 2HU9A 2WV1A 4HDUA 1QO0D 4RM2A 1Y0NA 1GT0C 4YIIA 3G73A 1I27A 2JRTA 1UHMA 3W6KB 4U0VA 1ZREA 1OYIA 4HSTA 1R5GA 2M2EA 1VF9A 4M3BA 2VQHA 3U21A 3O2PE 1W7PB 4PSWA 2JA2A 3TO7A 2XRNA 2A69F 3BJAA 3S14J 2M3AA 3QPSA 2BHZA 1JHHA 4GYIA 3MFKA 4IHVA 3BZKA 1TWAJ 2AXLA 5EG0A 3X2QH 2HWVA 2DXIA 5GPAA 1ZR4A 3EUHC 4KIFA 3DU6A 3VFZA 3Q5FA 4J00A 3H0DA 1XCBA 3ONQA 2EFWA 3QYBA 1J2XA 4EJVA 2KLOA 2FU4A 1A6IA 4IQ4A 2XPWA 3AFHA 2L7ZA 2Y31A 1D8KA 4U0YA 1LUJB 3A03A 2PJRA 1B8IB 4KIGA 4P1WA 5K5OA 2A3SA 2DO7A 3S32A 3PUBA 4UVBA 3L1PA 3DXJF 1YJWI 3KYCB 5IP6A 3OYEA 3CC7I 2KPMA 1T0FA 5EEHA 1FIAA 4C30A 3MCZA 2CV2A 1VQNI 5FFZA 1OKRA 2NS8A 5HLHA 1KQ9A 3GFLA 4AUXA 3WU2C 1QPIA 2EWNA 3BR5A 1WJCA 3BR0A 3EYYA 1LFBA 3RSNA 3GTPJ 2CFXA 4XN0A 1TW2A 1MW7A 3FK6A 2RQPA 3PUFA 1IGNA 4XMYA 3HSRA 2P6SA 3DBRB 4A3BJ 1Z6TA 1PUFA 2I8DA 4UB8C 2GWRA 2MC3A 1ETOA 3GTKJ 2GA1A 4AIDA 1R1VA 2GIZA 1R36A 3QP5A 2DMPA 2YUSA 3BR1A 5ICEA 4CA0A 2VQCA 3R0AA 2HTJA 1Y6IA 2WC2A 4AVPA 3TMOA 2CQ7A 2RNJA 2DK8A 3OR2C 1ZGWA 3FKIJ 2LKSA 3TDUC 2XIGA 1BIAA 2PFBA 4UNOA 3S8PA 3KPHA 2GA2A 2F5VA 4J01A 5KVRA 3P5JA 3A01B 1P9QC 2HOAA 2IEKA 5DDGA 3L2QA 3GF2A 3AG2H 3FM3A 4G9YA 4MNUA 4FE4A 5J1UA 4F55A 4MO7A 3PQKA 3QOEA 2CS3A 4IHXA 2IGOA 3L7WA 1T56A 3M3YJ 1BIBA 2QBYA 2IS4A 2RGVA 2E7XA 2OAZA 1R4NB 1FYMA 4U88A 2IAIA 4Y13A 3O3KA 4RBOA 1SVOA 1T33A 1MMSA 2R5YA 3JCUC 2XKPA 5DYMA 3HOZJ 2XB0X 1UG0A 3H35A 5B1AH 1XX5A 2GIVA 4O3MA 2K86A 2E19A 4LG0A 3C2GA 2V79A 2MBFA 5F08A 2UV1A 1XTAA 2V9PA 3ZPLA 1VQ7I 2LDUA 1HLVA 3H3ZA 2VKVA 3IH3A 4UUVA 1P4WA 1E3PA 1JJ6C 2OQGA 2E60A 3FZVA 2DCEA 5E1ZB 3ZMZA 2GZWA 2W57A 3ZMSA 3I59A 2BBYA 2LSOA 2NVTJ 1X1DA 2OTJI 2VJ5A 2VB6A 3K9TA 5K7HA 5C4JJ 2DQLA 1HW5A 2KHMA 3JTHA 3T8RA 1HW2A 3SHFA 1T95A 1LB2A 2BW3A 2M34A 5IOZA 2PI0A 3F8NA 2ZSHB 2NS7A 2XAHA 2DPUA 4P96A 4EJOA 1ETVA 4IEJA 1IG7A 1XN7A 2G0EA 2HQRA 2E1MB 1LEAA 5ILUA 4LD5A 4ZDOA 2X1EA 4CCOA 4OMZA 5IT3A 2KL4A 2VASA 3QPTA 1MBGA 2DT6A 4PJNA 4BE1A 4ESJA 1HCRA 3Q9SA 1OCZH 2E7WA 2HQ5A 3L2RA 3IRQA 3CC2I 2LC2A 5CVVA 2E1CA 1Y1WJ 3H9JA 3PO3J 4XM3A 4S05A 3CJQB 1TQIA 4RM3A 1TQPA 3RKWA 3V8LA 5FRNA 4UB6C 2HOEA 3WE3A 3EDPA 2K4BA 1FJLA 2BGCA 4NQWA 3J80Z 4OU0A 2HDWA 2IS2A 3H92A 2W82A 4XKCA 1IRGA 3HBLA 1ZGJA 2OF7A 2ADUA 2XF6A 1GVJA 1ZRFA 2PX9A 4BJ5C 1MBKA 3FXLA 4C3HJ 1K79A 2KKOA 1FBSA 2XPVA 3B6AA 2VONA 1LDDA 2DFIA 5CPRB 2JTVA 2LNBA 4L9TA 4PFPA 4DYCA 1QVTA 4PFOA 1D0ZA 1UELB 3MEXA 4H4KC 3CF5F 1MBHA 1LFUP 2JA5J 4BU2A 1BN5A 2FRHA 2MD5A 3CCEI 3DKXA 5FLMJ 2M0MA 3DEEA 3NWSA 3DEWA 5GTHC 1USSA 3WG9A 3HZJA 4YG2F 1S9HA 3QRFF 3M1EA 3BCBA 3MWMA 5J6XA 2O8KA 4UUTA 1S7EA 1TQMA 3HPHA 5AONA 4CUGA 3HRUA 2I10A 3KE2A 4NC7A 5JHUA 1W0TA 2QCOA 4F93B 2LKPA 3CMEI 1BJAA 4Y15A 2LREA 1NK2P 3SDGA 2L9NA 4M72A 4BJ6C 2DBBA 4FHTA 3ULQB 1NG6A 1YRNB 2L4MA 1QBJA 3K1NA 3COAC 3OIOA 3M4OJ 1XGSA 3PNYA 2DK5A 3MZYA 2UXXA 4XORA 3SYTA 3OYAA 1YIOA 5AIPA 1RIOH 4DJAA 4L9VA 1YX3A 3QP6A 4BQNA 1X4PA 2OV7A 4N0BA 2EV0A 3Q0UA 5HLTA 1B59A 3ZQFA 5JVGF 3ZN1A 1R6RA 2XAFA 1QVUA 2EK5A 2P5VA 1WKMA 4EM1A 3WHBA 1JKQC 1QU3A 1L3LA 4AYBA 3D1NI 1U78A 1L0OC 2EFOA 1Q1HA 3HRMA 3DLLF 1H88C 2EFPA 2GXGA 3HPGA 2HYJA 5IT9Z 2ZXHA 1D3YA 4IXAA 4IPAA 4NC8A 3ROUA 3LSRA 5DS9A 1I5ZA 2DOAA 2DFEA 2Y48A 2HPMA 4XLPF 4FT8A 5C3EJ 1JHFA 3TP0A 3AL0C 2CUZA 1ERDA 3WG7H 2OQRA 2O5RA 2DU9A 4RAFA 1Z67A 3PL8A 5LGNA 1S7AA 3K10A 3JREA 2FUG2 3DQVC 1J5YA 2LY2A 1MSFC 4N4OB 4A69C 4D1QA 3FXKA 2EFQA 3LL7A 2CG4A 3FMSA 3OR1C 4CH7A 2FE3A 3S16J 4DQ2A 3S3NA 1AU7A 1S29A 2E2JJ 1MDMB 3BPXA 2IGMA 1MZBA 2K40A 1SANA 2EB7A 2RN7A 3E5UA 4FQGA 3CCVI 1CF7A 2PQ8A 4FE7A 2PLYA 3BTJA 3C2BA 4HSRA 1KYZA 3VYRB 2E2HJ 4E7ZA 4KMFA 4OOIA 1R7JA 1IDZA 2ZSIB 3HTUA 2CU7A
chains in the Genus database with same CATH topology
3RQIA 3JRIA 5F04A 4M6VA 2JK3A 4XICA 2CJJA 2QF7A 5C4XJ 4QTRA 1ZTRA 2DMQA 1ETQA 2ID6A 3H0GJ 1RKWA 5F0FA 2L9RA 5EGOA 3TP3A 3OOUA 2MG4A 4XIDA 3HOUJ 5EDNA 1A5JA 1ETKA 1MBFA 3I4MJ 4J19A 2R0QC 2E2IJ 2TCTA 2LR8A 4DW6A 3TW6A 2R92J 2EZKA 2FJ1A 5FKLA 2HOTA 2P81A 2ZB9A 4FCYA 1Q1VA 3GTLJ 2M0CA 2X6OA 1D5YA 1APLC 1GUUA 1ETXA 5IYBJ 1TWGJ 5GP9A 3JRDA 3S1RJ 2H1KA 1OJLA 4C3JJ 2LY9A 1EF4A 5F27A 1X2MA 4XRMA 3E7LA 2B63J 3QPLA 1ETWA 4DYRA 5M5WJ 1HOMA 3HGYA 1TWHJ 4JX5A 5FJ8J 3S1MJ 5EGOB 1MH4A 1XG1A 2M8GX 4ABZA 2XSDC 3O8HA 3G1OA 4M3DA 1NTCA 3NAUA 4JYKA 5J1RA 3ZQGA 2JA6J 1TC3C 4AYBN 1XC5A 2DN0A 2CUEA 2FQ4A 3A02A 3K2AA 1I6HJ 3GTMJ 1H89C 1K61A 4JX6A 3ZQHA 3HKZN 1GVDA 3QQAA 2HXOA 1UMQA 5FLVA 1QRYA 2R7ZJ 2R5ZB 1JJ8C 3GBGA 4G12A 5M3MJ 1JT6A 4Y52J 1B72B 1WGXA 4A3IJ 4MFEA 3GTGJ 3HOXJ 3S1NJ 1HF0A 2VI6A 1I3QJ 1AKHA 2DA1A 2OPTA 1DU6A 1IJWC 4MIMA 4D5CA 1VI0A 2O9LA 3B6CA 3Q0VA 2JJ7A 1P7JA 2LD5A 1P7IA 4UUSB 1JUMA 3Q3SA 1F43A 5GPCA 2L7MP 2CRGA 2Y0SN 2FX0A 1IDYA 5FKNA 2WAQN 2H8RA 3JRAA 3SJMA 2D5VA 1ITYA 3CCYA 2HDDA 3IH4A 1ENHA 2MW8A 4JX4A 2DA4A 3RZOJ 1K83J 1VFCA 1R9TJ 5IYDJ 1F36A 3JRFA 2ME6A 4MFDA 1AKHB 2COBA 2L7FP 4W97A 1H8AC 1FTTA 2WV1A 2GM4A 4B4CA 1GT0C 2GBYA 1JGGA 1GDTA 3F0CA 3HEFA 4XRSG 2DA3A 1B8IA 2ECBA 2M2EA 2X48A 1VF9A 5M5XJ 4M3BA 3BTIA 4I6ZA 2JN6A 4FTHA 3G1MA 2RAEA 2XRLA 4D7MA 1ZQ3P 1MBEA 1IV6A 1IUFA 3GTOJ 2YU9J 4NDLA 3QPSA 4D7NA 3LSGA 3S14J 1JTYA 4IHVA 2GLOA 2DMTA 5F1JA 1TWAJ 5EG0A 3JRBA 2DA2A 2E1OA 1AHDP 4L5EA 5GPAA 1ORKA 1ZR4A 2CQXA 5IP9J 5K7FA 2LK2A 1RETA 2JA8J 4FISA 1A6IA 5EZHA 2XPWA 1BW5A 4JP0A 2L7ZA 2Y31A 1FEXA 1JKRC 1G2HA 3A03A 3HOVJ 1B8IB 2Y9ZA 3RKQA 5IOYA 4A93J 2R5ZA 3L1PA 5JLXA 2LKXA 1RR7A 5IP6A 2N8GA 1B72A 3JRHA 1X2NA 1FIAA 4QIWN 3VPRA 4A3LJ 4M3FA 2NS8A 2LFBA 3PM1A 4XK4A 5EG0B 1RKTA 2XB5A 4AUXA 1QPIA 3BR5A 3CQZJ 3BR0A 4BBSJ 1BA5A 4D5FA 3A01A 1LFBA 3GTPJ 2JMWA 5E3MA 4V2GA 3FK6A 4UUSA 2LTPA 1IGNA 1MSEC 4A3BJ 1PUFA 3NARA 5HODA 3HB9A 3GTQJ 1Z0XA 1ETOA 3GTKJ 3IV5A 2WB1N 1W0UA 3HM5A 2DMPA 2O7OA 2YUSA 3BR1A 1FTZA 1ZR2A 2M9HA 4A3FJ 2DTZA 4I76A 3BTCA 3HOWJ 3ZQIA 5DTDA 4EEFG 1JUSA 4A3EJ 1ZGWA 3OSFA 3FKIJ 1OCTC 3PO2J 3LSPA 1JKPC 2LLKA 4MLOA 1TWFJ 4BY7J 1XS9A 5FKKA 3A01B 2HI3A 2HOAA 2IEKA 3Q0WA 4A3DJ 4X6AJ 2ID3A 2EZIA 5J1UA 3MVPA 3K7AJ 4FE4A 4MO7A 5F0CA 4LOCA 2DA7A 1LE8A 5K7ZA 2L0KA 2W48A 1PUFB 2NVXJ 4IHXA 1T56A 1ZK8A 3M3YJ 1JTXA 5FKMA 5M5YJ 2IAIA 4RBOA 4BKXA 1T33A 2R5YA 2ELKA 3HOZJ 1E3OC 2MSYA 2DMNA 2XB0X 2AHQA 1RPWA 4DZPA 2E19A 5F08A 2Y30A 4IHYA 1HLVA 2VKVA 1BJZA 3IH3A 3S2HJ 2XGCA 5IPAA 3GTJJ 1JJ6C 2DMUA 5E3LA 3S2DJ 2HOSA 1WI3A 2NVTJ 1DU0A 2CQQA 1ZKGA 4AC0A 4A3CJ 4GFBA 5E3NA 4CYCA 3TW7A 3BQZA 5C4JJ 4B3AA 5K7HA 4S0HB 2LVSA 3DCFA 1LE8B 1U9NA 2XGEA 4IHWA 1IRZA 2MGQA 2M34A 4DZJA 5EZGA 3CDLA 4M3GA 5IOZA 4BY1J 2NS7A 2DA6A 1ETVA 4IEJA 1IG7A 3FK7A 2R5YB 2ME0A 2G0EA 3FISA 4M3EA 2PMZN 2K9QA 1NK3P 5EYRA 1BL0A 1MBGA 2CUFA 2Y2ZA 2EZHA 2DJNA 1HCRA 2HQ5A 3LSJA 1WH5A 3ZQCA 1Y1VJ 1Y1WJ 5JLWA 4A3MJ 3PO3J 1CQTA 2K9SA 4HNVA 4CYCB 5M3FJ 1FJLA 2KDZA 3BR6A 9ANTA 3OSGA 2Y9YA 2LP0A 4B1RA 3HBLA 3IH2A 2OF7A 3W6VA 2EBIA 3HGGA 2XGDA 1MBKA 4C3HJ 2XPVA 3B6AA 1WCMJ 4X1EA 3BQYA 2EQRA 1SFOJ 1YRNA 4DYCA 2EH3A 3BR3A 3S1QJ 2DA5A 1QVTA 1MNMC 3SFIA 1HDDC 3BT9A 5EEAA 1MBHA 1LFUP 2JA5J 3MN2A 1HDPA 2AO9A 2VPRA 5FLMJ 3DEWA 1JKOC 5J1YA 1X58A 1Z77A 3WHCA 4BXXJ 1I50J 2O8KA 4UUTA 1S7EA 3ZOBA 5J3LA 1OFCX 1TWCJ 4Y7NJ 2X9DA 2I10A 1W0TA 2QCOA 3H3VK 1NK2P 3SDGA 2KT0A 1MBJA 1YRNB 1O4XA 2NVQJ 4W1UA 3OIOA 3M4OJ 2HXIA 2JA7J 4RDUA 3I4NJ 2VUMJ 4A3JJ 1BW6A 1JUPA 4A3KJ 4XRSA 3JRCA 1POGA 5EF6A 4DYQA 4BBRJ 3FIWA 1UG2A 2XPUA 3MKLA 3Q0UA 3LNQA 5FKOA 2K9NA 1WPKA 3HDDA 3ZQFA 1OCPA 5C44J 1QVUA 2EZLA 3G1LA 3WHBA 3ZQLA 1JKQC 1WH7A 2NVYJ 3D1NI 1U78A 3HOYJ 1H88C 3S15J 2R93J 4C2MJ 4V2FA 2ECCA 2HYJA 2IBDA 5F0HA 3BTLA 3BG3A 3S17J 3LSRA 5DS9A 1IC8A 5IP7J 5C3EJ 3JRGA 4A3GJ 5IYCJ 3TP0A 1FIPA 3RZDJ 1VNDA 1GV5A 5E3OA 2NOGA 3BR2A 3JREA 1UHSA 1JT0A 2YS9A 4C3IJ 1MSFC 4A69C 2TRTA 2JWTA 3S16J 1U8BA 1AU7A 2E2JJ 3BG5A 1MH3A 4QSHA 1GV2A 3JR9A 1ETYA 2K40A 3O8GA 1SANA 4FE7A 2FD5A 3CMYA 3BG9A 3BTJA 5BNGA 3C2BA 3UKGA 3TEDA 2VKEA 2E2HJ 1U9OA 1RESA 1IDZA 3LOCA 2CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQI A;  3JRI A;  5F04 A;  4M6V A;  2JK3 A;  4XIC A;  2CJJ A;  2QF7 A;  5C4X J;  4QTR A;  1ZTR A;  2DMQ A;  1ETQ A;  2ID6 A;  3H0G J;  1RKW A;  5F0F A;  2L9R A;  5EGO A;  3TP3 A;  3OOU A;  2MG4 A;  4XID A;  3HOU J;  5EDN A;  1A5J A;  1ETK A;  1MBF A;  3I4M J;  4J19 A;  2R0Q C;  2E2I J;  2TCT A;  2LR8 A;  4DW6 A;  3TW6 A;  2R92 J;  2EZK A;  2FJ1 A;  5FKL A;  2HOT A;  2P81 A;  2ZB9 A;  4FCY A;  1Q1V A;  3GTL J;  2M0C A;  2X6O A;  1D5Y A;  1APL C;  1GUU A;  1ETX A;  5IYB J;  1TWG J;  5GP9 A;  3JRD A;  3S1R J;  2H1K A;  1OJL A;  4C3J J;  2LY9 A;  1EF4 A;  5F27 A;  1X2M A;  4XRM A;  3E7L A;  2B63 J;  3QPL A;  1ETW A;  4DYR A;  5M5W J;  1HOM A;  3HGY A;  1TWH J;  4JX5 A;  5FJ8 J;  3S1M J;  5EGO B;  1MH4 A;  1XG1 A;  2M8G X;  4ABZ A;  2XSD C;  3O8H A;  3G1O A;  4M3D A;  1NTC A;  3NAU A;  4JYK A;  5J1R A;  3ZQG A;  2JA6 J;  1TC3 C;  4AYB N;  1XC5 A;  2DN0 A;  2CUE A;  2FQ4 A;  3A02 A;  3K2A A;  1I6H J;  3GTM J;  1H89 C;  1K61 A;  4JX6 A;  3ZQH A;  3HKZ N;  1GVD A;  3QQA A;  2HXO A;  1UMQ A;  5FLV A;  1QRY A;  2R7Z J;  2R5Z B;  1JJ8 C;  3GBG A;  4G12 A;  5M3M J;  1JT6 A;  4Y52 J;  1B72 B;  1WGX A;  4A3I J;  4MFE A;  3GTG J;  3HOX J;  3S1N J;  1HF0 A;  2VI6 A;  1I3Q J;  1AKH A;  2DA1 A;  2OPT A;  1DU6 A;  1IJW C;  4MIM A;  4D5C A;  1VI0 A;  2O9L A;  3B6C A;  3Q0V A;  2JJ7 A;  1P7J A;  2LD5 A;  1P7I A;  4UUS B;  1JUM A;  3Q3S A;  1F43 A;  5GPC A;  2L7M P;  2CRG A;  2Y0S N;  2FX0 A;  1IDY A;  5FKN A;  2WAQ N;  2H8R A;  3JRA A;  3SJM A;  2D5V A;  1ITY A;  3CCY A;  2HDD A;  3IH4 A;  1ENH A;  2MW8 A;  4JX4 A;  2DA4 A;  3RZO J;  1K83 J;  1VFC A;  1R9T J;  5IYD J;  1F36 A;  3JRF A;  2ME6 A;  4MFD A;  1AKH B;  2COB A;  2L7F P;  4W97 A;  1H8A C;  1FTT A;  2WV1 A;  2GM4 A;  4B4C A;  1GT0 C;  2GBY A;  1JGG A;  1GDT A;  3F0C A;  3HEF A;  4XRS G;  2DA3 A;  1B8I A;  2ECB A;  2M2E A;  2X48 A;  1VF9 A;  5M5X J;  4M3B A;  3BTI A;  4I6Z A;  2JN6 A;  4FTH A;  3G1M A;  2RAE A;  2XRL A;  4D7M A;  1ZQ3 P;  1MBE A;  1IV6 A;  1IUF A;  3GTO J;  2YU9 J;  4NDL A;  3QPS A;  4D7N A;  3LSG A;  3S14 J;  1JTY A;  4IHV A;  2GLO A;  2DMT A;  5F1J A;  1TWA J;  5EG0 A;  3JRB A;  2DA2 A;  2E1O A;  1AHD P;  4L5E A;  5GPA A;  1ORK A;  1ZR4 A;  2CQX A;  5IP9 J;  5K7F A;  2LK2 A;  1RET A;  2JA8 J;  4FIS A;  1A6I A;  5EZH A;  2XPW A;  1BW5 A;  4JP0 A;  2L7Z A;  2Y31 A;  1FEX A;  1JKR C;  1G2H A;  3A03 A;  3HOV J;  1B8I B;  2Y9Z A;  3RKQ A;  5IOY A;  4A93 J;  2R5Z A;  3L1P A;  5JLX A;  2LKX A;  1RR7 A;  5IP6 A;  2N8G A;  1B72 A;  3JRH A;  1X2N A;  1FIA A;  4QIW N;  3VPR A;  4A3L J;  4M3F A;  2NS8 A;  2LFB A;  3PM1 A;  4XK4 A;  5EG0 B;  1RKT A;  2XB5 A;  4AUX A;  1QPI A;  3BR5 A;  3CQZ J;  3BR0 A;  4BBS J;  1BA5 A;  4D5F A;  3A01 A;  1LFB A;  3GTP J;  2JMW A;  5E3M A;  4V2G A;  3FK6 A;  4UUS A;  2LTP A;  1IGN A;  1MSE C;  4A3B J;  1PUF A;  3NAR A;  5HOD A;  3HB9 A;  3GTQ J;  1Z0X A;  1ETO A;  3GTK J;  3IV5 A;  2WB1 N;  1W0U A;  3HM5 A;  2DMP A;  2O7O A;  2YUS A;  3BR1 A;  1FTZ A;  1ZR2 A;  2M9H A;  4A3F J;  2DTZ A;  4I76 A;  3BTC A;  3HOW J;  3ZQI A;  5DTD A;  4EEF G;  1JUS A;  4A3E J;  1ZGW A;  3OSF A;  3FKI J;  1OCT C;  3PO2 J;  3LSP A;  1JKP C;  2LLK A;  4MLO A;  1TWF J;  4BY7 J;  1XS9 A;  5FKK A;  3A01 B;  2HI3 A;  2HOA A;  2IEK A;  3Q0W A;  4A3D J;  4X6A J;  2ID3 A;  2EZI A;  5J1U A;  3MVP A;  3K7A J;  4FE4 A;  4MO7 A;  5F0C A;  4LOC A;  2DA7 A;  1LE8 A;  5K7Z A;  2L0K A;  2W48 A;  1PUF B;  2NVX J;  4IHX A;  1T56 A;  1ZK8 A;  3M3Y J;  1JTX A;  5FKM A;  5M5Y J;  2IAI A;  4RBO A;  4BKX A;  1T33 A;  2R5Y A;  2ELK A;  3HOZ J;  1E3O C;  2MSY A;  2DMN A;  2XB0 X;  2AHQ A;  1RPW A;  4DZP A;  2E19 A;  5F08 A;  2Y30 A;  4IHY A;  1HLV A;  2VKV A;  1BJZ A;  3IH3 A;  3S2H J;  2XGC A;  5IPA A;  3GTJ J;  1JJ6 C;  2DMU A;  5E3L A;  3S2D J;  2HOS A;  1WI3 A;  2NVT J;  1DU0 A;  2CQQ A;  1ZKG A;  4AC0 A;  4A3C J;  4GFB A;  5E3N A;  4CYC A;  3TW7 A;  3BQZ A;  5C4J J;  4B3A A;  5K7H A;  4S0H B;  2LVS A;  3DCF A;  1LE8 B;  1U9N A;  2XGE A;  4IHW A;  1IRZ A;  2MGQ A;  2M34 A;  4DZJ A;  5EZG A;  3CDL A;  4M3G A;  5IOZ A;  4BY1 J;  2NS7 A;  2DA6 A;  1ETV A;  4IEJ A;  1IG7 A;  3FK7 A;  2R5Y B;  2ME0 A;  2G0E A;  3FIS A;  4M3E A;  2PMZ N;  2K9Q A;  1NK3 P;  5EYR A;  1BL0 A;  1MBG A;  2CUF A;  2Y2Z A;  2EZH A;  2DJN A;  1HCR A;  2HQ5 A;  3LSJ A;  1WH5 A;  3ZQC A;  1Y1V J;  1Y1W J;  5JLW A;  4A3M J;  3PO3 J;  1CQT A;  2K9S A;  4HNV A;  4CYC B;  5M3F J;  1FJL A;  2KDZ A;  3BR6 A;  9ANT A;  3OSG A;  2Y9Y A;  2LP0 A;  4B1R A;  3HBL A;  3IH2 A;  2OF7 A;  3W6V A;  2EBI A;  3HGG A;  2XGD A;  1MBK A;  4C3H J;  2XPV A;  3B6A A;  1WCM J;  4X1E A;  3BQY A;  2EQR A;  1SFO J;  1YRN A;  4DYC A;  2EH3 A;  3BR3 A;  3S1Q J;  2DA5 A;  1QVT A;  1MNM C;  3SFI A;  1HDD C;  3BT9 A;  5EEA A;  1MBH A;  1LFU P;  2JA5 J;  3MN2 A;  1HDP A;  2AO9 A;  2VPR A;  5FLM J;  3DEW A;  1JKO C;  5J1Y A;  1X58 A;  1Z77 A;  3WHC A;  4BXX J;  1I50 J;  2O8K A;  4UUT A;  1S7E A;  3ZOB A;  5J3L A;  1OFC X;  1TWC J;  4Y7N J;  2X9D A;  2I10 A;  1W0T A;  2QCO A;  3H3V K;  1NK2 P;  3SDG A;  2KT0 A;  1MBJ A;  1YRN B;  1O4X A;  2NVQ J;  4W1U A;  3OIO A;  3M4O J;  2HXI A;  2JA7 J;  4RDU A;  3I4N J;  2VUM J;  4A3J J;  1BW6 A;  1JUP A;  4A3K J;  4XRS A;  3JRC A;  1POG A;  5EF6 A;  4DYQ A;  4BBR J;  3FIW A;  1UG2 A;  2XPU A;  3MKL A;  3Q0U A;  3LNQ A;  5FKO A;  2K9N A;  1WPK A;  3HDD A;  3ZQF A;  1OCP A;  5C44 J;  1QVU A;  2EZL A;  3G1L A;  3WHB A;  3ZQL A;  1JKQ C;  1WH7 A;  2NVY J;  3D1N I;  1U78 A;  3HOY J;  1H88 C;  3S15 J;  2R93 J;  4C2M J;  4V2F A;  2ECC A;  2HYJ A;  2IBD A;  5F0H A;  3BTL A;  3BG3 A;  3S17 J;  3LSR A;  5DS9 A;  1IC8 A;  5IP7 J;  5C3E J;  3JRG A;  4A3G J;  5IYC J;  3TP0 A;  1FIP A;  3RZD J;  1VND A;  1GV5 A;  5E3O A;  2NOG A;  3BR2 A;  3JRE A;  1UHS A;  1JT0 A;  2YS9 A;  4C3I J;  1MSF C;  4A69 C;  2TRT A;  2JWT A;  3S16 J;  1U8B A;  1AU7 A;  2E2J J;  3BG5 A;  1MH3 A;  4QSH A;  1GV2 A;  3JR9 A;  1ETY A;  2K40 A;  3O8G A;  1SAN A;  4FE7 A;  2FD5 A;  3CMY A;  3BG9 A;  3BTJ A;  5BNG A;  3C2B A;  3UKG A;  3TED A;  2VKE A;  2E2H J;  1U9O A;  1RES A;  1IDZ A;  3LOC A;  2CU7 A; 
#chains in the Genus database with same CATH topology
 1EA3 A;  4F3Q A;  2HDC A;  4HV6 A;  4NC6 A;  4G7O F;  5F04 A;  2XRO A;  1MJA A;  1X3Z B;  1GLN A;  3TO9 A;  4XIC A;  2EIM H;  1LDK B;  2VC0 A;  5KK1 A;  3WTX C;  4ZDP A;  1JGS A;  4F7Z A;  4M9S A;  2FBH A;  1YTY A;  5GAD J;  1XSD A;  3PFY A;  1WJB A;  1ZTR A;  1ETQ A;  1XB4 A;  2DMQ A;  5K5Q A;  2M1B A;  1J59 A;  2DDA A;  2VE8 A;  2WA0 A;  3GEZ A;  5EGO A;  1I6X A;  5CKT A;  2F6C A;  3QOD A;  1N78 A;  1XCV A;  3L2C A;  4U7B A;  1T2K A;  2LMD A;  4J19 A;  2H6C A;  3TW6 A;  4JOM A;  2EZK A;  3QWL A;  2HOT A;  4KUM A;  1P4X A;  3KZZ A;  4GCV A;  4IHS A;  4I7H A;  2IS6 A;  4FCY A;  2O6G E;  1X1A A;  3GTL J;  4DGW B;  2FF4 A;  1APL C;  2ZXJ A;  3GYH X;  5GP9 A;  1FC3 A;  3JRD A;  1K78 B;  4C2U A;  5FGM A;  2VXZ A;  4LK1 F;  4C3J J;  1EF4 A;  4XRM A;  2B63 J;  1IXR C;  2A5W A;  3K70 C;  1TZL A;  4DYR A;  1F5T A;  3HGY A;  1TL8 A;  3F6V A;  2Y69 H;  1UFM A;  4II3 A;  2DOE A;  4AIJ A;  2M8G X;  4ABZ A;  2CW8 A;  3J7Y J;  2XSD C;  5B1B H;  2HR3 A;  4M3D A;  3ZMD A;  3KYL A;  2M7B A;  3ZQG A;  5B66 C;  3ZMT A;  5HLI A;  4ZYH A;  1WSU A;  1BR1 A;  2ZC2 A;  3K2A A;  4ENN A;  4UVC A;  2E35 A;  1X3W B;  2VJ4 A;  1I39 A;  1SMT A;  2HXO A;  1VQ9 I;  3ESW B;  1R58 A;  2X4H A;  1A6Q A;  3GBG A;  3BZC A;  4E70 A;  1D1C A;  4A12 A;  1WGX A;  3F3X A;  4A3I J;  3GTG J;  3OYD A;  1ZRC A;  1FBQ A;  1HF0 A;  1QZZ A;  2VI6 A;  4E7L A;  1AKH A;  3EUH A;  1JXS A;  2BHY A;  4ANJ A;  1IJW C;  2ZKZ A;  2WY8 Q;  3KP4 A;  4G6D A;  3T8T A;  3KCC A;  3F8B A;  5DCM A;  4HF0 A;  3N97 A;  2DQR A;  1E0E A;  3PJR A;  1Y39 A;  1P7J A;  1RUN A;  1QZY A;  2NXN B;  4Z2Y A;  2LD5 A;  3FBN B;  1D1A A;  1P7I A;  2IPQ X;  2D1V A;  4XON A;  1RR8 C;  2CRG A;  2FX0 A;  1X3U A;  3DP7 A;  2GQQ A;  1IN8 A;  2D5V A;  1ITY A;  3CCY A;  2RV8 A;  2HDD A;  1R1T A;  2Z1D A;  3E3V A;  1F1Z A;  1HKQ A;  4IZZ A;  1K6O A;  3ML6 A;  1ENH A;  3ECO A;  3GCM A;  4X0G A;  3PIP F;  3BP8 A;  1FLI A;  2DA4 A;  1R9T J;  5JR3 A;  5IYD J;  4WK8 F;  5LRS A;  4BJT A;  4XKV A;  3H5N A;  1ZG1 A;  1XSX A;  2COB A;  3AKZ A;  2P5K A;  4BGD A;  1H8A C;  3B73 A;  1UHW A;  3CDI A;  2GM4 A;  2D45 A;  2MH9 A;  3OYF A;  1VQL I;  3JAM Z;  1H9T A;  2GBY A;  4OIP F;  2E36 A;  1D1B A;  5HDK A;  1RRJ A;  1LJ9 A;  1VQP I;  2QQ8 A;  2CO5 A;  2IP2 A;  2QBY B;  2DA3 A;  1B1B A;  3U1K A;  2ECB A;  4A2U A;  2BE5 F;  5M5X J;  1DGW Y;  2XHK A;  2X1D A;  2A6T A;  4I6Z A;  1MIJ A;  1VQ6 I;  5KAF C;  3G1M A;  4BQO A;  1IV6 A;  4XQF A;  3K4J A;  2VT3 A;  3CD6 I;  1SFE A;  3HUG B;  1VQK I;  3DF8 A;  1IF1 A;  3W2W A;  3HC7 A;  5F1J A;  3JRB A;  1S8N A;  1QHH D;  1AHD P;  4L5E A;  1ORK A;  3OV8 A;  2CQX A;  4BDY A;  2JRM A;  4A6E A;  3W6J B;  2LK2 A;  3T1B A;  2Q2E A;  4EMS A;  1ON2 A;  3FHN A;  2JA8 J;  4FIS A;  1EH8 A;  2RKH A;  4XLF A;  1FP1 D;  1G2H A;  1FEX A;  1E2X A;  3F8C A;  1IZ1 A;  5CQG A;  5KNL A;  1ZAR A;  4P9F A;  4LLL A;  2R5Z A;  4AWX B;  5L3E A;  5JLX A;  3I5U A;  2N8G A;  1B72 A;  4BDZ A;  1X2N A;  1O3T A;  1IRF A;  3ZQ7 A;  4M3F A;  4EM2 A;  3RKX A;  2LFB A;  4XK4 A;  2KIM A;  5TRD A;  2KQR A;  4UV8 A;  4BBS J;  2JVH A;  2JMW A;  5E3M A;  4V2G A;  1MND A;  2R7Q A;  3CUQ A;  2IGN A;  2VC1 A;  2BVM A;  1MSE C;  1LEB A;  3NAR A;  1GXP A;  2RDP A;  4IRH A;  3K70 D;  1Z0X A;  2ZJP F;  1Z7L A;  2WB1 N;  1W0U A;  2X85 A;  1O3Q A;  3HHH A;  1BR4 A;  4M71 A;  2XAU A;  5D4R A;  3KLN A;  3HOW J;  1R49 A;  1SD4 A;  2LF7 A;  3O6B B;  3OYI A;  3M8J A;  4F91 B;  3J81 K;  3CZ6 A;  3WU0 A;  1ZLK A;  4BXF A;  4GO1 A;  1SD7 A;  1Y8R B;  3ZXS A;  2R7O A;  2DT7 B;  3V42 A;  1XS9 A;  5FKK A;  3HTS B;  3Q0W A;  1EH7 A;  4X6A J;  3MVP A;  3K7A J;  4G6T B;  4N4N B;  3ZQQ A;  1LE8 A;  4AM3 A;  4RGU A;  3CTA A;  2P4W A;  1BI0 A;  1ZK8 A;  2QKM B;  2LRD A;  5M5Y J;  5FKM A;  1Z05 A;  2V1X A;  2P5L C;  3KEO A;  2ESN A;  4PJJ A;  5E1W A;  1B4A A;  2ELK A;  2MSY A;  2AHQ A;  2QUF A;  1A31 A;  3NEU A;  1YW8 A;  2KZV A;  3OYG A;  2Y30 A;  2A5Y B;  3HKZ A;  3H36 A;  4CCN A;  1BJZ A;  1B9M A;  4DIQ A;  2R7S A;  5E3L A;  2R7W A;  2LF8 A;  3VDX A;  2HEO A;  2HOS A;  1WI9 A;  1WVR A;  3FMR A;  1SFU A;  4GFB A;  1MMG A;  3BQZ A;  3IC7 A;  2E71 A;  4Y33 A;  5ICF A;  3M1C A;  5H6Q A;  5HOO A;  2XGE A;  4IHW A;  2W7N A;  1BI3 A;  2CGP A;  1S7O A;  3CDL A;  3F22 A;  2YSR A;  4KIT B;  3RIR A;  1H9G A;  3KEY A;  4BY1 J;  2IJL A;  3P7N A;  4XLN F;  3FK7 A;  3LST A;  1QPM A;  4AIK A;  5FLX K;  2K9Q A;  5E8G A;  3V8J A;  4YRV A;  2HVQ A;  3OWT A;  4M74 A;  4CYD A;  3J80 K;  3K1M A;  2CUF A;  2EZH A;  2FNP A;  4EVI A;  2WAQ A;  4YFK F;  1HSJ A;  1WH5 A;  3ZQC A;  4Z6Y A;  4A3M J;  2VOD A;  2H09 A;  3RYP A;  1YO5 C;  2K9S A;  3TKY A;  4CYC B;  1G6N A;  5M3F J;  4YEJ A;  1V5F A;  1TT0 A;  4ENM A;  4CZZ A;  1S3J A;  2KDZ A;  3DBL B;  3BR6 A;  1QQI A;  1XMK A;  3G4S I;  3OSG A;  2Y9Y A;  5F6F A;  1TLH B;  5J4V A;  3E0J B;  3BJ6 A;  3RI4 A;  3IH2 A;  2O8X A;  3W6V A;  4DBR A;  4FX0 A;  4RGS A;  4XNF A;  2DYR H;  1UAA A;  1DPU A;  1Z3X A;  3OYJ A;  1AWC A;  4XBF A;  2OTL I;  1Z9C A;  4C2T A;  5K5R A;  2XSJ C;  3TBI A;  1WCM J;  4QWQ A;  2XKO A;  4X1E A;  2EQR A;  3ASO H;  1SFO J;  2CV1 A;  1IN6 A;  2AQE A;  3BR3 A;  3S1Q J;  2Q1Z B;  5F64 A;  3MAJ A;  4XKW A;  3VSK A;  4G7H F;  1YS6 A;  1FYL A;  3ZMU A;  5GTI C;  2M8E A;  2LBF B;  1V54 H;  3BT9 A;  3HYI A;  1WJF A;  2AS5 F;  4E7H A;  2K9L A;  3MN2 A;  2Z9O A;  3GWZ A;  2AO9 A;  1U5T B;  1YJN I;  4UXN A;  1IUY A;  1WWX A;  1GXQ A;  5J1Y A;  5BMZ A;  1X58 A;  4MGR A;  3WHC A;  1W7P D;  2ISY A;  4IJA A;  3B02 A;  1KYW A;  2XV4 S;  2HYG D;  4R8H A;  1OFC X;  1SVM A;  2OU2 A;  5J47 A;  1IW7 F;  4BS9 A;  3VOE A;  3PNV A;  5TIS C;  3H3V K;  4B48 A;  3MQ0 A;  2L7K A;  2HS5 A;  2M45 A;  1S72 I;  1O4X A;  3C1D A;  2NVQ J;  4BAC A;  3I53 A;  4W1U A;  3F6O A;  3ERE D;  2Z16 A;  3MZ8 A;  2JA7 J;  1NG7 A;  2IW5 A;  4RDU A;  2PEX A;  2P7C B;  3V7R A;  4CO8 A;  1BW6 A;  4A3K J;  1Z7U A;  1FSE A;  1Z6R A;  4PJL A;  3AG4 H;  5EF6 A;  4DYQ A;  3J7A Y;  5BQT A;  1ODD A;  4YIF A;  1XGN A;  3HL2 A;  2LY1 A;  1J0R A;  4E6K G;  4U87 A;  1B9N A;  5C44 J;  2BOL A;  2UZK A;  2XDV A;  3MD2 A;  1YE9 A;  1FT9 A;  3A4C A;  2FOK A;  2XAQ A;  3BG6 A;  2K3P A;  2R93 J;  4RLQ A;  2ECC A;  3CLO A;  2H1L A;  1ZEL A;  4IOC F;  2HYF A;  3BG3 A;  4HX4 A;  2F4M B;  4C9Y A;  4P9U A;  1IC8 A;  2CMP A;  5DM7 F;  1FIP A;  5FO5 A;  2OA4 A;  3R60 A;  3KIO A;  2VT2 A;  2G9W A;  1GV5 A;  3QOP A;  5FD6 A;  2WAF A;  1UHS A;  3IL2 A;  4ZDL A;  2L4A A;  2Y75 A;  2JSC A;  2TDX A;  3W2V A;  1FYK A;  1SEU A;  2QQB A;  3MKZ A;  2F4I A;  2VPL A;  2KDO A;  1PUE E;  4YFN F;  3CUQ C;  4S04 A;  2FBI A;  3BG5 A;  1KGS A;  4KT6 A;  1QNT A;  1OCO H;  3HOT A;  5FFX A;  2HKX A;  2R7T A;  1WQ2 A;  2JVG A;  4KN7 X;  1SC7 A;  2QA4 I;  3WGH A;  5BNG A;  3UKG A;  1G3Y A;  5KHD A;  1A35 A;  1WJD A;  1RES A;  4ZTF A;  1NH3 A;  2RQQ A;  2JSP A;  3RQI A;  2IS1 A;  5ERI A;  3VOD A;  2R4G A;  4M6V A;  2JK3 A;  3A1Y A;  3K1P A;  3HOS A;  1UZC A;  2V6E A;  2CJJ A;  2QF7 A;  3K4K A;  3KX2 A;  5FRM A;  1J7K A;  3DPU A;  3F8M A;  1SAU A;  5CVR A;  2ZBK A;  3C18 A;  4IHT A;  3EUA A;  3HSF A;  4XL9 A;  1AA7 A;  1G3T A;  2B7E A;  4G94 A;  2OC6 A;  5F0F A;  4LFU A;  3K0L A;  3CO7 C;  4L5J A;  5CJ9 A;  4HF2 A;  4XID A;  2ZME A;  2XC7 A;  1BI2 A;  2VJJ A;  1R00 A;  2BZT A;  2M4G A;  2O03 A;  1WHU A;  1U2W A;  3RJP A;  2OCE A;  4YIR X;  2M5W A;  2R92 J;  2CQK A;  2FJ1 A;  4WX9 A;  1HXD A;  2P81 A;  1TP4 A;  4HQE A;  2BY1 A;  1DQU A;  1Q1V A;  4OIR F;  2K02 A;  2X6O A;  4GYG A;  1I1S A;  2K7L A;  3E1S A;  2MLK A;  3F72 A;  4ZYG A;  1ETX A;  2CFO A;  2R7F A;  3H5A A;  2H1K A;  1OJL A;  5HS9 A;  3OS2 A;  2V1U A;  2CV0 A;  5F27 A;  3E7L A;  3QPL A;  3VSL A;  1OLT A;  5F1R A;  1FP2 A;  1LVK A;  2DOD A;  4HW0 A;  4LIV A;  1N77 A;  2O0Y A;  1ZYR F;  1WJ5 A;  3CMM A;  1MH4 A;  1A04 A;  2I5U A;  4LG3 A;  3JSO A;  3IAM 2;  1OCR H;  2WV0 A;  3FXO A;  5H20 A;  4PK4 A;  2VXD A;  3K4B A;  4CDG A;  3P9K A;  3OYM A;  1TTY A;  4AYB N;  5D5X B;  1TC3 C;  5D6F A;  4XOP A;  2JA6 J;  1DUX C;  1T08 B;  2CUE A;  5D8K B;  3A02 A;  3I64 A;  4NHJ A;  1I6H J;  2VBY A;  2MC4 A;  2KJC A;  1MMA A;  3WE2 A;  1V4R A;  1GVD A;  3DKY A;  2IT0 A;  4PJ0 C;  1UMQ A;  2OJE D;  1QRY A;  1T98 A;  1OYW A;  2R5Z B;  2FQ3 A;  2Q0O A;  3ELK A;  1G59 A;  2R3S A;  2NVU B;  1B72 B;  3OL4 A;  1K7A A;  4IKF A;  2QSF X;  2IRF G;  3S1N J;  5EEG A;  1R22 A;  3KP2 A;  4WXH A;  2XUB A;  3DV8 A;  2H94 A;  1OMI A;  3GUD A;  2XAS A;  4I02 A;  2DTR A;  4D5C A;  2O9L A;  3GLL A;  1MJ9 A;  4CCK A;  3LFU A;  4KIC A;  2F48 A;  4AIH A;  4CCL A;  2IVM A;  3E6M A;  1P2F A;  1KA8 A;  2L7M P;  2LH9 A;  4E7I A;  2WTE A;  5ILV A;  3S3M A;  3RPQ A;  2Y0S N;  1IDY A;  5FKN A;  3SJM A;  2DAO A;  2ESH A;  2M7A A;  5DEQ A;  2RVC A;  3TL4 X;  2R7V A;  3FM5 A;  3JSP A;  2J5O A;  1W7P A;  2CQN A;  1FOX A;  3CJR B;  3K69 A;  3RZO J;  1K83 J;  1VFC A;  1D8J A;  2X51 A;  2V26 A;  1VZ0 A;  1F36 A;  2PMU A;  3C7J A;  3IP4 B;  4R1H A;  3OYK A;  1G3W A;  2L7F P;  4W97 A;  4B8X A;  2EIL H;  3CF2 A;  2BYV E;  3M07 A;  4H0E A;  2A6H F;  2ZXI A;  3RKY A;  4PGH A;  4EGY A;  1XMA A;  5D8L B;  2Z33 A;  1WJA A;  4PUS A;  1FOW A;  4L0Y B;  2COM A;  1OIS A;  5E17 F;  2L02 A;  2LG4 A;  3AG3 H;  1O3R A;  1EJ9 A;  4P5O A;  3EUK L;  3S93 A;  2EIJ H;  3F0C A;  4PDK A;  1YI2 I;  1GDT A;  4XRS G;  1XSV A;  1B8I A;  2VN2 A;  5EJC A;  3CLQ A;  2X48 A;  2RNG A;  3BTI A;  2YPR A;  4XSX F;  2JN6 A;  4D7M A;  2RAE A;  2XRL A;  1MBE A;  1EKE A;  3GTO J;  2YU9 J;  3KP6 A;  3LSG A;  2F5F A;  4KIS A;  2DMT A;  4LB6 B;  3BOQ A;  1N75 A;  3BRO A;  3K4M A;  4WF2 A;  1YIT I;  3LA3 A;  2F5E A;  2Y0M A;  5GAH J;  4HNU A;  2K85 A;  3LMM A;  5IP9 J;  5K7F A;  1LFP A;  2OBP A;  2Z2S B;  3CP8 A;  1RET A;  1ULY A;  5DD8 A;  1BOB A;  3DEU A;  3QPH A;  2ISZ A;  5EZH A;  5FRO A;  4JP0 A;  1G4D A;  4E7K A;  2KMU A;  4RB2 C;  2EJR A;  5TJJ A;  3HOV J;  1K4T A;  3RKQ A;  3R61 A;  5IOY A;  1YW9 A;  4A93 J;  4XOT A;  2O61 A;  3DBH B;  1KZH A;  2LKX A;  2FNA A;  4TV7 A;  4QPO A;  2NRA C;  3NRV A;  3VWB A;  3GZN B;  3CMA I;  3SZG A;  3JRH A;  1U6G A;  3F21 A;  4JBA A;  3UR3 C;  4Y3O A;  4QIW N;  2STW A;  3DLA A;  5EG0 B;  2XB5 A;  1TNT A;  4B43 A;  3N4M A;  3CCR I;  2BY2 A;  2PBI A;  3GLX A;  1XGM A;  1BA5 A;  2VIX A;  3TOA A;  4XKB A;  4D5F A;  3A01 A;  1SD6 A;  1ONV A;  3ZMV A;  5A2Q K;  3G6E I;  2JT1 A;  3RTR A;  1OQY A;  1XPX A;  2E1N A;  2L2O A;  3TOB A;  1HA8 A;  2V1N A;  2DI3 A;  1IN7 A;  4EQQ A;  4NUB A;  5HOD A;  4BNC A;  2PJR B;  2GAU A;  4LMY A;  3HM5 A;  1S6L A;  1ZN2 A;  2M9H A;  4BEH A;  4A3F J;  2DTZ A;  4I76 A;  3KET A;  4OIO F;  3ZQI A;  5DTD A;  4EEF G;  1MMD A;  2QGU A;  3ISP A;  1JUS A;  3OSF A;  3AL0 B;  3PO2 J;  3BC8 A;  3LSP A;  4EJU A;  1JKP C;  4UV9 A;  4MLO A;  1TWF J;  3OOP A;  3SFZ A;  1IO2 A;  3RYR A;  3ZP5 A;  2HVS A;  4L0Z B;  2HI3 A;  4A3D J;  2ZME C;  2KIQ A;  2M30 A;  5J8C A;  2STT A;  5DV5 A;  3W2A A;  4LOC A;  2DA7 A;  2MLG A;  2V9V A;  2L0K A;  4ASN A;  2DFF A;  1PUF B;  1RUO A;  4KJZ A;  1T6S A;  4I98 B;  3LFK A;  2PJP A;  5L3C A;  4O5V A;  3G71 I;  3FKJ A;  1KU7 A;  2DMN A;  4BAY A;  3LAJ A;  1RPW A;  4CXF A;  2JPC A;  2VJI A;  1LNW A;  3SEZ A;  4CCM A;  3RQ4 A;  5H2F C;  2XGC A;  5IPA A;  4BHP A;  3N05 A;  2DLL A;  3MKW B;  1WI3 A;  2F2E A;  4HYE A;  2CQQ A;  1ZKG A;  2L01 A;  4A3C J;  2GOX B;  2W24 A;  3AG1 H;  5E3N A;  3TW7 A;  4LLG F;  1YQA A;  3WU1 B;  1X1C A;  2LVS A;  4G7Z F;  2CSO A;  3WTW C;  4I99 C;  4DZJ A;  5EZG A;  1VQO I;  4RB0 A;  2HZD A;  1EH6 A;  5IY5 H;  3A2K A;  2R5Y B;  2X6W A;  2PMZ N;  4RLF A;  4LG0 B;  5LRR A;  3E97 A;  3BG7 A;  3KZY A;  2Y2Z A;  2Z99 A;  3CUO A;  1C0W A;  3L2W A;  2HZT A;  2M4K A;  5GAE J;  1KQ0 A;  1D0Y A;  3IWF A;  3DWL E;  3DFG A;  2B0L A;  4LLN A;  3I59 B;  1Y0U A;  3CDH A;  4HNV A;  3CCS I;  1ZGA A;  2W85 A;  4RAG A;  4HBL A;  4D9J A;  2P8T A;  1LPQ A;  1V55 H;  5CYV A;  2BW3 B;  2ELH A;  4UHT A;  4NBQ A;  2D1H A;  2DDB A;  1OYY A;  1X4O A;  2A68 F;  4EV0 A;  2D2W A;  4JQF A;  4IQJ A;  3HGG A;  3CJN A;  4BHC A;  2XGD A;  1SMY F;  4ETS A;  5JI6 A;  3S2W A;  2BY3 A;  3VYS B;  1RNL A;  4HZF A;  5HDN A;  3GX4 X;  3KP3 A;  1WFX A;  2XGX A;  3BQY A;  3QU6 A;  2JUC A;  1YRN A;  1ON1 A;  2KRF A;  4BXU A;  2EH3 A;  2X6X A;  1YX5 A;  3ABT A;  5E18 F;  5BPD A;  1MNM C;  5LHI A;  3ZCO A;  2K3F A;  4HX7 A;  1HDD C;  1QHG A;  2ZFU A;  2XAJ A;  4XN3 A;  4IRI A;  5L3F A;  4RAZ A;  2UUZ A;  4B44 A;  2VPR A;  4NQW B;  1LKX A;  3CC4 I;  1EV7 A;  2FXA A;  4O6J A;  1IV8 A;  3DPT A;  4RMN A;  4BXX J;  3HXL A;  4ZZD A;  2CUJ A;  2JUG A;  2ZO4 A;  3ZOB A;  4LIU A;  3BPV A;  2Z5U A;  5J3L A;  2IA1 A;  1TWC J;  2G7H A;  4Y7N J;  2X9D A;  3H3U A;  4XLE A;  1FNN A;  1UCR A;  5HDG A;  1W36 D;  1BC7 C;  1MBJ A;  3U2R A;  4CCJ A;  1FX7 A;  2NNN A;  4RA2 A;  5KAI C;  2W1O A;  2WWY A;  2EIK H;  2HXI A;  2Z3Y A;  1ZH5 A;  2JZY A;  3I4N J;  1RC9 A;  3BDD A;  3L2U A;  2R7X A;  3FF5 A;  1JUP A;  2WAD A;  4I0A A;  3WGG A;  4XRS A;  4RGX A;  2A6E F;  4BBR J;  3FIW A;  3MKL A;  5FKO A;  2K9N A;  1WPK A;  3HDD A;  4L9N A;  3HSE A;  5H6R A;  1BC8 C;  2L54 A;  3G1L A;  2NVY J;  1MDM A;  4Y17 A;  1T39 A;  3PFI A;  3GZ6 A;  2L5Q A;  1YW7 A;  4GGG A;  1IN5 A;  4C2M J;  4MQV A;  3L2V A;  2IBD A;  5E79 C;  3IRR A;  1Y56 A;  3L09 A;  5IP7 J;  2V7F A;  2KJB A;  4A3G J;  5IYC J;  4HDV A;  1VTN C;  2GXA A;  1ZHF A;  2GXB A;  2B9S A;  4BYY A;  1DDN A;  2K9M A;  1HKS A;  3FBI B;  2NOG A;  3BR2 A;  5E3O A;  1JT0 A;  2ZJ2 A;  2ICW G;  1TNS A;  6PAX A;  1KU2 A;  4DBQ A;  3WTY C;  4CGZ A;  4M9Z A;  4WXC A;  3BJO A;  1U8B A;  4OIQ F;  4XLC A;  1MH3 A;  4HX8 A;  3CCL I;  4QSH A;  4BL0 B;  2UWM A;  2DJI A;  1GV2 A;  3JR9 A;  3DU5 A;  3F23 A;  4HLX A;  2V4J C;  5FB2 A;  4RS8 A;  1P6R A;  2FD5 A;  3CMY A;  3BG9 A;  5LEJ A;  4BQA A;  4KA4 A;  2VKE A;  2E5N A;  4MTE A;  1DGR M;  3LOC A;  3FDY A;  3KLO A;  3OYC A;  2BXZ A;  3D5L A;  2RC4 A;  2PMH A;  3NQO A;  1R4M B;  3IKV A;  3JRI A;  4HOB A;  1XDU A;  1K78 A;  4HPQ A;  3EYI A;  1MGT A;  2ZNZ A;  2QEX I;  1SFK A;  3FXR A;  1ZG3 A;  3EET A;  1J9I A;  3ABL H;  4QTR A;  3BZ6 A;  2ID6 A;  3G2B A;  1U0J A;  3SXY A;  3TGN A;  2QYO A;  2HQA A;  3TP3 A;  3OOU A;  1R71 A;  4L18 B;  2VBW A;  3T5X A;  2MH2 A;  3OYB A;  3HOU J;  2YX4 A;  1ETK A;  3I4M J;  1CF7 B;  3D5S C;  2R0Q C;  2E2I J;  2X1C A;  2RRE A;  2X0L A;  2E1M C;  1QZE A;  2EV6 A;  4XLH A;  5LD2 C;  5FKL A;  2OUM A;  2ZB9 A;  3KYD B;  2R7U A;  3I4P A;  2BV6 A;  2M0C A;  4NB5 A;  2HKO A;  2ZFW A;  4RGR A;  5IYB J;  2FEZ A;  4XLA A;  1IAW A;  2KZG A;  3S1R J;  3ABU A;  1DP3 A;  3OIP A;  3HJE A;  4Q5S F;  2EPF A;  2LY9 A;  2EV5 A;  2L9V A;  1J75 A;  2XF5 A;  3I9V 2;  2CW0 F;  1ETW A;  1YOV B;  5M5W J;  4KDP A;  3DTE A;  3PIO F;  3S1M J;  3WGI A;  2G7U A;  5EGO B;  2CWE A;  1E3H A;  3I0T A;  4MTD A;  1F4K A;  4AVZ A;  1VQ5 I;  1ACI A;  2VL8 A;  4FAS D;  3FXM A;  5L3D A;  2CH0 A;  2F4O B;  4M6X A;  1NTC A;  3A0B C;  3NAU A;  4JYK A;  2ZNY A;  2VOP A;  4BUP A;  1XC5 A;  2W84 A;  4YFX F;  2IA0 A;  1M1E B;  3BCA A;  1FWZ A;  2PG4 A;  2XF7 A;  1K61 A;  3ZQH A;  3S3O A;  3LSH A;  3QQA A;  3V4G A;  4HAM A;  3ERM A;  3I56 I;  4U0W A;  4IRG A;  2R7Z J;  1JJ8 C;  3M8E A;  5IT9 K;  4G12 A;  5M3M J;  4Y52 J;  3QAH A;  4BE0 A;  2KFD A;  2QM3 A;  3ABM H;  1X1B A;  2ZXW H;  4RAY A;  4G8X A;  1I3Q J;  2VBZ A;  2W00 A;  2FSW A;  3WTV C;  4MIM A;  4PZJ A;  2HTS A;  3VEP A;  3OYH A;  1VI0 A;  2K5C A;  3B6C A;  3Q0V A;  2JJ7 A;  2GOM A;  1SD5 A;  1U3E M;  4KFC A;  3D5R C;  1JUM A;  5DCF A;  2Q8K A;  2VQG A;  2BEO A;  2H8R A;  1BM9 A;  4KIB A;  3J81 Z;  3TQN A;  4CSW A;  3WTU C;  1FPQ A;  3JRA A;  1HKT A;  5GAG J;  1BBY A;  4KT5 C;  4BEH B;  3CJT B;  2MW8 A;  4JX4 A;  1R1U A;  2VOO A;  1IRX A;  3GFI A;  1XDS A;  3MMY B;  2ME6 A;  3AAF A;  3HUG A;  1JI8 A;  1AKH B;  2NOJ B;  4Q47 A;  3I71 A;  3ASN H;  2YU3 A;  3J7A O;  4AD9 A;  5DCM B;  1FTT A;  3LSK A;  4B4C A;  3CES A;  3SQN A;  2K4J A;  3IUO A;  3K6G A;  3L9F A;  3ABK H;  3IAS 2;  3I54 A;  4U7D A;  1JGG A;  2J5P A;  4LIT A;  3HEF A;  4Y4R A;  3OYL A;  4P55 A;  1O7L A;  3E6D A;  3GFJ A;  4FTH A;  1ZQ3 P;  3P9C A;  2M87 A;  5ICC A;  1IUF A;  2VQL A;  2WBM A;  4NDL A;  4A6D A;  4D7N A;  1JTY A;  3UNG C;  2GLO A;  2P7V B;  2QQA A;  3PSI A;  3M9A A;  3OYN A;  1JE8 A;  1WZ2 A;  3ECH A;  1YJ9 I;  1D5V A;  2DA2 A;  2E1O A;  3GW2 A;  5BOX A;  2VKD A;  3Q9V A;  5LEK A;  1FOY A;  2H8W A;  2R7D A;  2C6Y A;  3SEQ A;  5FLX Z;  5TGT A;  4IF4 A;  5J8F A;  1YIJ I;  5DM6 F;  1BW5 A;  1MJB A;  1XMX A;  5DUI A;  5J40 A;  5LGU A;  1JKR C;  2ELJ A;  2HNH A;  2QKL B;  1O3S A;  1W5C C;  2Y9Z A;  1YYV A;  4OWR B;  4EJW A;  5ICG A;  3CCQ I;  2E5Z A;  5L3B A;  4FET A;  4IX7 A;  1RR7 A;  2FMY A;  2XVC A;  1W1W E;  1MMN A;  1XGO A;  3VPR A;  4A3L J;  3HG9 A;  1OR7 A;  2NNY A;  4OIN F;  2BVL A;  3PM1 A;  3KP5 A;  1RKT A;  4HV5 A;  4FX4 A;  3CQZ J;  4B3X A;  3LQQ A;  2V9K A;  4II2 A;  5CVU A;  2Q2E B;  2V1D A;  3K4L A;  1R23 A;  3WOD F;  4UUS A;  1S5L C;  2LTP A;  3FXJ A;  4E7J A;  5K1Y A;  2QZ8 A;  4L5I A;  3HB9 A;  3GTQ J;  1AOY A;  4XSZ F;  3IV5 A;  2ZJQ F;  2ETH A;  3I55 I;  2O7O A;  5J4Y A;  3QYF A;  1FTZ A;  1ZR2 A;  3WTZ A;  5HNF A;  4MEY F;  3BTC A;  4I01 A;  1DP7 P;  4ZZL A;  4IL6 C;  4A3E J;  3BWG A;  1OCT C;  2K27 A;  2P0W A;  4L9J A;  3M7G A;  2NS0 A;  3RPU D;  5LHH A;  3EPZ A;  2LLK A;  2JQ7 A;  1LDJ A;  4BY7 J;  2F5C A;  3L00 A;  1IXS B;  2ID3 A;  2F5D A;  4AU7 A;  2EZI A;  4BQQ A;  3E6B A;  1SAX A;  3SZP A;  3H9G A;  1ZAO A;  5F0C A;  3CUQ B;  3K4N A;  5K7Z A;  2W48 A;  2NVX J;  5D5V B;  3LA2 A;  2KRC A;  5AIQ A;  1JTX A;  1YFH A;  1MNE A;  1Y8Q B;  4BKX A;  3V7C A;  3JTG A;  1WJE A;  3JAM K;  1E3O C;  4HF1 A;  4M9X A;  2QVO A;  2DOF A;  4DZP A;  3KFW X;  3K2Z A;  3TO6 A;  3H5R A;  4LB5 A;  2HVR A;  4IHY A;  3GVA A;  4E7S A;  2KRH A;  3PQJ A;  4GRI A;  3S2H J;  1J09 A;  3OS0 A;  1T0F C;  3GTJ J;  5D4S A;  2DMU A;  1IXC A;  1UJ8 A;  3RCO A;  4PGG A;  2BXY A;  3OL3 A;  2HFH A;  3HRS A;  3S2D J;  3QU3 A;  5CQE A;  1DU0 A;  4AC0 A;  5E1X A;  3V7S A;  3CCJ I;  4CYC A;  4Q48 A;  2DFH A;  4B3A A;  4S0H B;  1FMW A;  1LE8 B;  3DCF A;  1U9N A;  3LA7 A;  3REO A;  1IRZ A;  5LHG A;  3K4C A;  2MGQ A;  3R4K A;  4F52 A;  4M3G A;  1R5H A;  1G3S A;  2HQN A;  5HS7 A;  4ZJZ A;  2DA6 A;  4ENJ A;  4OMY A;  1X19 A;  1Z91 A;  4HQM A;  2ME0 A;  3FIS A;  3R0J A;  4G6Q A;  4M3E A;  4E4H A;  1PP7 U;  2R7R A;  1NK3 P;  4KNY A;  3VYT B;  3LAP A;  2MD0 A;  5EYR A;  4HG2 A;  1BL0 A;  4CIC A;  3KZI C;  2Y0S A;  3HIF A;  2DJN A;  5E8I A;  3FXU A;  3FXQ A;  3LSJ A;  4MHG A;  5CVI A;  2EA4 A;  4QPQ A;  1R5I D;  3ZR8 X;  1E17 A;  1Y1V J;  2LYC A;  3FHZ A;  5JLW A;  4GDF A;  1CQT A;  2LBF A;  1D0X A;  4IVN A;  1FBU A;  1KQ8 A;  4LGW A;  1A36 A;  4WCG A;  4I0B A;  5HNH A;  3LSM A;  1U5T A;  4IOA F;  4CHU A;  2CYY A;  5JVT A;  9ANT A;  2H6B A;  1Z21 A;  2LP0 A;  1YHQ I;  4B1R A;  5LBQ A;  1RZ4 A;  2EBI A;  2DW4 A;  3KEQ A;  3SDB A;  2AQF A;  1B6A A;  1DPR A;  5B5E C;  3F9K A;  1Z1D A;  5FD5 A;  1V5E A;  4EM0 B;  3MZH A;  3G3Z A;  1PJR A;  1FZP B;  3LQR A;  3V8K A;  5KCM A;  4WWC A;  3WTT C;  1HBX G;  4A0Y A;  2DA5 A;  3CCU I;  3ZN0 A;  1NHA A;  3OY9 A;  1HC8 A;  4NNJ A;  4F92 B;  3SFI A;  2KP6 A;  1FY7 A;  2OD5 A;  3I3L A;  4MEX F;  2JPB A;  4ENK A;  1W36 C;  5EEA A;  1MD0 A;  4K2E A;  1HDP A;  3ZRG A;  1JKO C;  1SVL A;  4XRF A;  4ZYE A;  1V5G A;  2XAG A;  3EQL F;  3FWE A;  3HRT A;  4PSX A;  2ZJR F;  1Z77 A;  4DNC A;  3ZGK A;  1I50 J;  3IWZ A;  2IA2 A;  1VQ4 I;  3P9I A;  4HNT A;  2P6T A;  4EAT A;  1BOA A;  2DT5 A;  2VE9 A;  3VYU B;  1BI1 A;  2KT0 A;  3E5X A;  3H9Q A;  3RDI A;  1TBX A;  2DYS H;  1OCC H;  3R6S A;  3LWF A;  1TW3 A;  3PNT A;  2QSH X;  5D5W B;  1X1P A;  1YLF A;  5E20 A;  2VUM J;  4A3J J;  5LFA A;  3JRC A;  1SFX A;  2MA3 A;  1POG A;  4R79 A;  5DUK A;  2NYX A;  4ESF A;  1UG2 A;  2XPU A;  3CP2 A;  4HLY A;  3NWT A;  3H1C A;  3LNQ A;  3WTS C;  1OCP A;  3KP7 A;  3LSI A;  3E6C C;  2UXN A;  2EZL A;  3GXO A;  3ZQL A;  1WH7 A;  3E5Q A;  3U9G A;  2QSG X;  1VQM I;  3HOY J;  1K4S A;  3D0S A;  5CVJ A;  3S15 J;  3JW4 A;  1O57 A;  4MQ9 F;  4V2F A;  5F0H A;  4HRI A;  3BTL A;  3S17 J;  1V3F A;  2W25 A;  3C3W A;  1K6Y A;  3JRG A;  3OS1 A;  4JK1 X;  4M6Y A;  1OR7 C;  2IXS A;  4ZC3 A;  3RZD J;  1VND A;  3FX3 A;  2IGK A;  1STZ A;  2FA5 A;  2V6C A;  1IN4 A;  2ZCW A;  2MFZ A;  2YS9 A;  2EFN A;  2AXT C;  4A5M A;  4C3I J;  4ZYA A;  1ZRD A;  2TRT A;  4ZYD A;  2JWT A;  4A0X A;  2EA2 A;  5B3S H;  4DOZ A;  2W4S A;  4LJZ F;  4EJT A;  1ETY A;  1KON A;  3O8G A;  3RPU A;  2L3D A;  1P4A A;  1UST A;  2A61 A;  3TED A;  2BY0 A;  1U9O A;  4KN4 X;  2CW7 A;  2NAZ A;  1QGP A;  5JHF A;  1O7F A;  4D0P A;  3VB2 A;  1KU9 A;  1H0M A;  3IKT A;  4OAZ A;  3MKY B;  2E34 A;  5ED4 A;  1RI7 A;  3IHU A;  4ESB A;  3OMY A;  2KIS A;  2MYS A;  3GZ5 A;  5BS6 A;  5ILS A;  4CZC A;  4RB3 C;  5C4X J;  4BE2 A;  4B09 A;  1ZLJ A;  1LQ1 A;  3H0G J;  3TDZ C;  1RKW A;  2L9R A;  1BR2 A;  3GME A;  2MG4 A;  3M8F A;  4QLC U;  5EDN A;  3DPL C;  3HHG A;  1A5J A;  5HS8 A;  1MBF A;  1I3A A;  2TCT A;  2DPD A;  2YX7 A;  2LR8 A;  4DW6 A;  3FMQ A;  4LK0 F;  1OPC A;  1TT5 B;  1I1G A;  4M73 A;  1REP C;  1UB9 A;  4B47 A;  1N25 A;  2PMZ A;  2MAB A;  1W5T A;  1YS7 A;  1D5Y A;  1GUU A;  1TWG J;  4N9I A;  3SZT A;  3OIQ A;  2HPI A;  4HEA 2;  1U8R A;  2OCC H;  4UY8 I;  4UVA A;  4ITV A;  3J7Z I;  1X2M A;  4PJM A;  1ZG5 A;  1HOM A;  1XD7 A;  1TWH J;  2KIF A;  2ACJ A;  1F9N A;  1LVA A;  4JX5 A;  5FJ8 J;  5BPI A;  3GO5 A;  1HW1 A;  2FML A;  1XG1 A;  1T8I A;  4N9H A;  2ZME B;  5D6E A;  1W5S A;  3A0H C;  4EGZ A;  1HST A;  3O8H A;  5L3G A;  3G1O A;  4WXD A;  3QYE A;  2X6Y A;  5CLS A;  5LLQ A;  1GHC A;  5LGT A;  5J1R A;  2WY7 Q;  4I09 A;  2VLA A;  1WRJ A;  1QA6 A;  4V19 K;  2DN0 A;  4OAY A;  3BLY A;  3DTK A;  1FSH A;  2FQ4 A;  3F8F A;  3GTM J;  4BHB A;  2QQ9 A;  4RB1 A;  1H89 C;  4Q4Z F;  2HGC A;  4JX6 A;  3CCM I;  3HKZ N;  5FLV A;  4ON0 A;  2FBK A;  4GXO A;  2A05 A;  1FMV A;  1JT6 A;  1Z3Y A;  5A2Q Z;  4PCQ A;  4MFE A;  3BY6 A;  3HOX J;  2L9S A;  1T38 A;  2PN6 A;  1PVE A;  1U5T C;  2EIN H;  1PDN C;  2DA1 A;  1CGP A;  2OPT A;  1MKM A;  1DU6 A;  4ZH4 F;  3CO6 C;  4HA8 A;  4ZTJ A;  2A07 F;  3I58 A;  5HVQ C;  4KMU X;  2H27 A;  3U1D A;  1KU3 A;  2WB1 A;  4I2O A;  2KIU A;  3PSF A;  4UUS B;  1PYV A;  1G8X A;  3Q3S A;  1PP8 F;  1F43 A;  5GPC A;  3DTI A;  1FOK A;  4XR6 A;  2FOW A;  3C2H A;  2VBX A;  2YR2 A;  2WAQ N;  1P92 A;  1YG2 A;  2QEN A;  4BH9 A;  1HQC A;  2QWW A;  3GFM A;  2QLZ A;  4IO9 F;  2VKH A;  3IH4 A;  4A5N A;  1W4M A;  4A0Z A;  5DD4 A;  3JRF A;  4YEL A;  3DKW A;  3W3C A;  1VQ8 I;  2OZU A;  4MFD A;  2WAE A;  2OZ6 A;  5D5U B;  4KYW A;  2O3F A;  5HLG A;  2LOO A;  5JFR A;  3T0Y A;  2HU9 A;  2WV1 A;  4HDU A;  1QO0 D;  4RM2 A;  1Y0N A;  1GT0 C;  4YII A;  3G73 A;  1I27 A;  2JRT A;  1UHM A;  3W6K B;  4U0V A;  1ZRE A;  1OYI A;  4HST A;  1R5G A;  2M2E A;  1VF9 A;  4M3B A;  2VQH A;  3U21 A;  3O2P E;  1W7P B;  4PSW A;  2JA2 A;  3TO7 A;  2XRN A;  2A69 F;  3BJA A;  3S14 J;  2M3A A;  3QPS A;  2BHZ A;  1JHH A;  4GYI A;  3MFK A;  4IHV A;  3BZK A;  1TWA J;  2AXL A;  5EG0 A;  3X2Q H;  2HWV A;  2DXI A;  5GPA A;  1ZR4 A;  3EUH C;  4KIF A;  3DU6 A;  3VFZ A;  3Q5F A;  4J00 A;  3H0D A;  1XCB A;  3ONQ A;  2EFW A;  3QYB A;  1J2X A;  4EJV A;  2KLO A;  2FU4 A;  1A6I A;  4IQ4 A;  2XPW A;  3AFH A;  2L7Z A;  2Y31 A;  1D8K A;  4U0Y A;  1LUJ B;  3A03 A;  2PJR A;  1B8I B;  4KIG A;  4P1W A;  5K5O A;  2A3S A;  2DO7 A;  3S32 A;  3PUB A;  4UVB A;  3L1P A;  3DXJ F;  1YJW I;  3KYC B;  5IP6 A;  3OYE A;  3CC7 I;  2KPM A;  1T0F A;  5EEH A;  1FIA A;  4C30 A;  3MCZ A;  2CV2 A;  1VQN I;  5FFZ A;  1OKR A;  2NS8 A;  5HLH A;  1KQ9 A;  3GFL A;  4AUX A;  3WU2 C;  1QPI A;  2EWN A;  3BR5 A;  1WJC A;  3BR0 A;  3EYY A;  1LFB A;  3RSN A;  3GTP J;  2CFX A;  4XN0 A;  1TW2 A;  1MW7 A;  3FK6 A;  2RQP A;  3PUF A;  1IGN A;  4XMY A;  3HSR A;  2P6S A;  3DBR B;  4A3B J;  1Z6T A;  1PUF A;  2I8D A;  4UB8 C;  2GWR A;  2MC3 A;  1ETO A;  3GTK J;  2GA1 A;  4AID A;  1R1V A;  2GIZ A;  1R36 A;  3QP5 A;  2DMP A;  2YUS A;  3BR1 A;  5ICE A;  4CA0 A;  2VQC A;  3R0A A;  2HTJ A;  1Y6I A;  2WC2 A;  4AVP A;  3TMO A;  2CQ7 A;  2RNJ A;  2DK8 A;  3OR2 C;  1ZGW A;  3FKI J;  2LKS A;  3TDU C;  2XIG A;  1BIA A;  2PFB A;  4UNO A;  3S8P A;  3KPH A;  2GA2 A;  2F5V A;  4J01 A;  5KVR A;  3P5J A;  3A01 B;  1P9Q C;  2HOA A;  2IEK A;  5DDG A;  3L2Q A;  3GF2 A;  3AG2 H;  3FM3 A;  4G9Y A;  4MNU A;  4FE4 A;  5J1U A;  4F55 A;  4MO7 A;  3PQK A;  3QOE A;  2CS3 A;  4IHX A;  2IGO A;  3L7W A;  1T56 A;  3M3Y J;  1BIB A;  2QBY A;  2IS4 A;  2RGV A;  2E7X A;  2OAZ A;  1R4N B;  1FYM A;  4U88 A;  2IAI A;  4Y13 A;  3O3K A;  4RBO A;  1SVO A;  1T33 A;  1MMS A;  2R5Y A;  3JCU C;  2XKP A;  5DYM A;  3HOZ J;  2XB0 X;  1UG0 A;  3H35 A;  5B1A H;  1XX5 A;  2GIV A;  4O3M A;  2K86 A;  2E19 A;  4LG0 A;  3C2G A;  2V79 A;  2MBF A;  5F08 A;  2UV1 A;  1XTA A;  2V9P A;  3ZPL A;  1VQ7 I;  2LDU A;  1HLV A;  3H3Z A;  2VKV A;  3IH3 A;  4UUV A;  1P4W A;  1E3P A;  1JJ6 C;  2OQG A;  2E60 A;  3FZV A;  2DCE A;  5E1Z B;  3ZMZ A;  2GZW A;  2W57 A;  3ZMS A;  3I59 A;  2BBY A;  2LSO A;  2NVT J;  1X1D A;  2OTJ I;  2VJ5 A;  2VB6 A;  3K9T A;  5K7H A;  5C4J J;  2DQL A;  1HW5 A;  2KHM A;  3JTH A;  3T8R A;  1HW2 A;  3SHF A;  1T95 A;  1LB2 A;  2BW3 A;  2M34 A;  5IOZ A;  2PI0 A;  3F8N A;  2ZSH B;  2NS7 A;  2XAH A;  2DPU A;  4P96 A;  4EJO A;  1ETV A;  4IEJ A;  1IG7 A;  1XN7 A;  2G0E A;  2HQR A;  2E1M B;  1LEA A;  5ILU A;  4LD5 A;  4ZDO A;  2X1E A;  4CCO A;  4OMZ A;  5IT3 A;  2KL4 A;  2VAS A;  3QPT A;  1MBG A;  2DT6 A;  4PJN A;  4BE1 A;  4ESJ A;  1HCR A;  3Q9S A;  1OCZ H;  2E7W A;  2HQ5 A;  3L2R A;  3IRQ A;  3CC2 I;  2LC2 A;  5CVV A;  2E1C A;  1Y1W J;  3H9J A;  3PO3 J;  4XM3 A;  4S05 A;  3CJQ B;  1TQI A;  4RM3 A;  1TQP A;  3RKW A;  3V8L A;  5FRN A;  4UB6 C;  2HOE A;  3WE3 A;  3EDP A;  2K4B A;  1FJL A;  2BGC A;  4NQW A;  3J80 Z;  4OU0 A;  2HDW A;  2IS2 A;  3H92 A;  2W82 A;  4XKC A;  1IRG A;  3HBL A;  1ZGJ A;  2OF7 A;  2ADU A;  2XF6 A;  1GVJ A;  1ZRF A;  2PX9 A;  4BJ5 C;  1MBK A;  3FXL A;  4C3H J;  1K79 A;  2KKO A;  1FBS A;  2XPV A;  3B6A A;  2VON A;  1LDD A;  2DFI A;  5CPR B;  2JTV A;  2LNB A;  4L9T A;  4PFP A;  4DYC A;  1QVT A;  4PFO A;  1D0Z A;  1UEL B;  3MEX A;  4H4K C;  3CF5 F;  1MBH A;  1LFU P;  2JA5 J;  4BU2 A;  1BN5 A;  2FRH A;  2MD5 A;  3CCE I;  3DKX A;  5FLM J;  2M0M A;  3DEE A;  3NWS A;  3DEW A;  5GTH C;  1USS A;  3WG9 A;  3HZJ A;  4YG2 F;  1S9H A;  3QRF F;  3M1E A;  3BCB A;  3MWM A;  5J6X A;  2O8K A;  4UUT A;  1S7E A;  1TQM A;  3HPH A;  5AON A;  4CUG A;  3HRU A;  2I10 A;  3KE2 A;  4NC7 A;  5JHU A;  1W0T A;  2QCO A;  4F93 B;  2LKP A;  3CME I;  1BJA A;  4Y15 A;  2LRE A;  1NK2 P;  3SDG A;  2L9N A;  4M72 A;  4BJ6 C;  2DBB A;  4FHT A;  3ULQ B;  1NG6 A;  1YRN B;  2L4M A;  1QBJ A;  3K1N A;  3COA C;  3OIO A;  3M4O J;  1XGS A;  3PNY A;  2DK5 A;  3MZY A;  2UXX A;  4XOR A;  3SYT A;  3OYA A;  1YIO A;  5AIP A;  1RIO H;  4DJA A;  4L9V A;  1YX3 A;  3QP6 A;  4BQN A;  1X4P A;  2OV7 A;  4N0B A;  2EV0 A;  3Q0U A;  5HLT A;  1B59 A;  3ZQF A;  5JVG F;  3ZN1 A;  1R6R A;  2XAF A;  1QVU A;  2EK5 A;  2P5V A;  1WKM A;  4EM1 A;  3WHB A;  1JKQ C;  1QU3 A;  1L3L A;  4AYB A;  3D1N I;  1U78 A;  1L0O C;  2EFO A;  1Q1H A;  3HRM A;  3DLL F;  1H88 C;  2EFP A;  2GXG A;  3HPG A;  2HYJ A;  5IT9 Z;  2ZXH A;  1D3Y A;  4IXA A;  4IPA A;  4NC8 A;  3ROU A;  3LSR A;  5DS9 A;  1I5Z A;  2DOA A;  2DFE A;  2Y48 A;  2HPM A;  4XLP F;  4FT8 A;  5C3E J;  1JHF A;  3TP0 A;  3AL0 C;  2CUZ A;  1ERD A;  3WG7 H;  2OQR A;  2O5R A;  2DU9 A;  4RAF A;  1Z67 A;  3PL8 A;  5LGN A;  1S7A A;  3K10 A;  3JRE A;  2FUG 2;  3DQV C;  1J5Y A;  2LY2 A;  1MSF C;  4N4O B;  4A69 C;  4D1Q A;  3FXK A;  2EFQ A;  3LL7 A;  2CG4 A;  3FMS A;  3OR1 C;  4CH7 A;  2FE3 A;  3S16 J;  4DQ2 A;  3S3N A;  1AU7 A;  1S29 A;  2E2J J;  1MDM B;  3BPX A;  2IGM A;  1MZB A;  2K40 A;  1SAN A;  2EB7 A;  2RN7 A;  3E5U A;  4FQG A;  3CCV I;  1CF7 A;  2PQ8 A;  4FE7 A;  2PLY A;  3BTJ A;  3C2B A;  4HSR A;  1KYZ A;  3VYR B;  2E2H J;  4E7Z A;  4KMF A;  4OOI A;  1R7J A;  1IDZ A;  2ZSI B;  3HTU A;  2CU7 A; 
#chains in the Genus database with same CATH homology
 3RQI A;  3JRI A;  5F04 A;  4M6V A;  2JK3 A;  4XIC A;  2CJJ A;  2QF7 A;  5C4X J;  4QTR A;  1ZTR A;  2DMQ A;  1ETQ A;  2ID6 A;  3H0G J;  1RKW A;  5F0F A;  2L9R A;  5EGO A;  3TP3 A;  3OOU A;  2MG4 A;  4XID A;  3HOU J;  5EDN A;  1A5J A;  1ETK A;  1MBF A;  3I4M J;  4J19 A;  2R0Q C;  2E2I J;  2TCT A;  2LR8 A;  4DW6 A;  3TW6 A;  2R92 J;  2EZK A;  2FJ1 A;  5FKL A;  2HOT A;  2P81 A;  2ZB9 A;  4FCY A;  1Q1V A;  3GTL J;  2M0C A;  2X6O A;  1D5Y A;  1APL C;  1GUU A;  1ETX A;  5IYB J;  1TWG J;  5GP9 A;  3JRD A;  3S1R J;  2H1K A;  1OJL A;  4C3J J;  2LY9 A;  1EF4 A;  5F27 A;  1X2M A;  4XRM A;  3E7L A;  2B63 J;  3QPL A;  1ETW A;  4DYR A;  5M5W J;  1HOM A;  3HGY A;  1TWH J;  4JX5 A;  5FJ8 J;  3S1M J;  5EGO B;  1MH4 A;  1XG1 A;  2M8G X;  4ABZ A;  2XSD C;  3O8H A;  3G1O A;  4M3D A;  1NTC A;  3NAU A;  4JYK A;  5J1R A;  3ZQG A;  2JA6 J;  1TC3 C;  4AYB N;  1XC5 A;  2DN0 A;  2CUE A;  2FQ4 A;  3A02 A;  3K2A A;  1I6H J;  3GTM J;  1H89 C;  1K61 A;  4JX6 A;  3ZQH A;  3HKZ N;  1GVD A;  3QQA A;  2HXO A;  1UMQ A;  5FLV A;  1QRY A;  2R7Z J;  2R5Z B;  1JJ8 C;  3GBG A;  4G12 A;  5M3M J;  1JT6 A;  4Y52 J;  1B72 B;  1WGX A;  4A3I J;  4MFE A;  3GTG J;  3HOX J;  3S1N J;  1HF0 A;  2VI6 A;  1I3Q J;  1AKH A;  2DA1 A;  2OPT A;  1DU6 A;  1IJW C;  4MIM A;  4D5C A;  1VI0 A;  2O9L A;  3B6C A;  3Q0V A;  2JJ7 A;  1P7J A;  2LD5 A;  1P7I A;  4UUS B;  1JUM A;  3Q3S A;  1F43 A;  5GPC A;  2L7M P;  2CRG A;  2Y0S N;  2FX0 A;  1IDY A;  5FKN A;  2WAQ N;  2H8R A;  3JRA A;  3SJM A;  2D5V A;  1ITY A;  3CCY A;  2HDD A;  3IH4 A;  1ENH A;  2MW8 A;  4JX4 A;  2DA4 A;  3RZO J;  1K83 J;  1VFC A;  1R9T J;  5IYD J;  1F36 A;  3JRF A;  2ME6 A;  4MFD A;  1AKH B;  2COB A;  2L7F P;  4W97 A;  1H8A C;  1FTT A;  2WV1 A;  2GM4 A;  4B4C A;  1GT0 C;  2GBY A;  1JGG A;  1GDT A;  3F0C A;  3HEF A;  4XRS G;  2DA3 A;  1B8I A;  2ECB A;  2M2E A;  2X48 A;  1VF9 A;  5M5X J;  4M3B A;  3BTI A;  4I6Z A;  2JN6 A;  4FTH A;  3G1M A;  2RAE A;  2XRL A;  4D7M A;  1ZQ3 P;  1MBE A;  1IV6 A;  1IUF A;  3GTO J;  2YU9 J;  4NDL A;  3QPS A;  4D7N A;  3LSG A;  3S14 J;  1JTY A;  4IHV A;  2GLO A;  2DMT A;  5F1J A;  1TWA J;  5EG0 A;  3JRB A;  2DA2 A;  2E1O A;  1AHD P;  4L5E A;  5GPA A;  1ORK A;  1ZR4 A;  2CQX A;  5IP9 J;  5K7F A;  2LK2 A;  1RET A;  2JA8 J;  4FIS A;  1A6I A;  5EZH A;  2XPW A;  1BW5 A;  4JP0 A;  2L7Z A;  2Y31 A;  1FEX A;  1JKR C;  1G2H A;  3A03 A;  3HOV J;  1B8I B;  2Y9Z A;  3RKQ A;  5IOY A;  4A93 J;  2R5Z A;  3L1P A;  5JLX A;  2LKX A;  1RR7 A;  5IP6 A;  2N8G A;  1B72 A;  3JRH A;  1X2N A;  1FIA A;  4QIW N;  3VPR A;  4A3L J;  4M3F A;  2NS8 A;  2LFB A;  3PM1 A;  4XK4 A;  5EG0 B;  1RKT A;  2XB5 A;  4AUX A;  1QPI A;  3BR5 A;  3CQZ J;  3BR0 A;  4BBS J;  1BA5 A;  4D5F A;  3A01 A;  1LFB A;  3GTP J;  2JMW A;  5E3M A;  4V2G A;  3FK6 A;  4UUS A;  2LTP A;  1IGN A;  1MSE C;  4A3B J;  1PUF A;  3NAR A;  5HOD A;  3HB9 A;  3GTQ J;  1Z0X A;  1ETO A;  3GTK J;  3IV5 A;  2WB1 N;  1W0U A;  3HM5 A;  2DMP A;  2O7O A;  2YUS A;  3BR1 A;  1FTZ A;  1ZR2 A;  2M9H A;  4A3F J;  2DTZ A;  4I76 A;  3BTC A;  3HOW J;  3ZQI A;  5DTD A;  4EEF G;  1JUS A;  4A3E J;  1ZGW A;  3OSF A;  3FKI J;  1OCT C;  3PO2 J;  3LSP A;  1JKP C;  2LLK A;  4MLO A;  1TWF J;  4BY7 J;  1XS9 A;  5FKK A;  3A01 B;  2HI3 A;  2HOA A;  2IEK A;  3Q0W A;  4A3D J;  4X6A J;  2ID3 A;  2EZI A;  5J1U A;  3MVP A;  3K7A J;  4FE4 A;  4MO7 A;  5F0C A;  4LOC A;  2DA7 A;  1LE8 A;  5K7Z A;  2L0K A;  2W48 A;  1PUF B;  2NVX J;  4IHX A;  1T56 A;  1ZK8 A;  3M3Y J;  1JTX A;  5FKM A;  5M5Y J;  2IAI A;  4RBO A;  4BKX A;  1T33 A;  2R5Y A;  2ELK A;  3HOZ J;  1E3O C;  2MSY A;  2DMN A;  2XB0 X;  2AHQ A;  1RPW A;  4DZP A;  2E19 A;  5F08 A;  2Y30 A;  4IHY A;  1HLV A;  2VKV A;  1BJZ A;  3IH3 A;  3S2H J;  2XGC A;  5IPA A;  3GTJ J;  1JJ6 C;  2DMU A;  5E3L A;  3S2D J;  2HOS A;  1WI3 A;  2NVT J;  1DU0 A;  2CQQ A;  1ZKG A;  4AC0 A;  4A3C J;  4GFB A;  5E3N A;  4CYC A;  3TW7 A;  3BQZ A;  5C4J J;  4B3A A;  5K7H A;  4S0H B;  2LVS A;  3DCF A;  1LE8 B;  1U9N A;  2XGE A;  4IHW A;  1IRZ A;  2MGQ A;  2M34 A;  4DZJ A;  5EZG A;  3CDL A;  4M3G A;  5IOZ A;  4BY1 J;  2NS7 A;  2DA6 A;  1ETV A;  4IEJ A;  1IG7 A;  3FK7 A;  2R5Y B;  2ME0 A;  2G0E A;  3FIS A;  4M3E A;  2PMZ N;  2K9Q A;  1NK3 P;  5EYR A;  1BL0 A;  1MBG A;  2CUF A;  2Y2Z A;  2EZH A;  2DJN A;  1HCR A;  2HQ5 A;  3LSJ A;  1WH5 A;  3ZQC A;  1Y1V J;  1Y1W J;  5JLW A;  4A3M J;  3PO3 J;  1CQT A;  2K9S A;  4HNV A;  4CYC B;  5M3F J;  1FJL A;  2KDZ A;  3BR6 A;  9ANT A;  3OSG A;  2Y9Y A;  2LP0 A;  4B1R A;  3HBL A;  3IH2 A;  2OF7 A;  3W6V A;  2EBI A;  3HGG A;  2XGD A;  1MBK A;  4C3H J;  2XPV A;  3B6A A;  1WCM J;  4X1E A;  3BQY A;  2EQR A;  1SFO J;  1YRN A;  4DYC A;  2EH3 A;  3BR3 A;  3S1Q J;  2DA5 A;  1QVT A;  1MNM C;  3SFI A;  1HDD C;  3BT9 A;  5EEA A;  1MBH A;  1LFU P;  2JA5 J;  3MN2 A;  1HDP A;  2AO9 A;  2VPR A;  5FLM J;  3DEW A;  1JKO C;  5J1Y A;  1X58 A;  1Z77 A;  3WHC A;  4BXX J;  1I50 J;  2O8K A;  4UUT A;  1S7E A;  3ZOB A;  5J3L A;  1OFC X;  1TWC J;  4Y7N J;  2X9D A;  2I10 A;  1W0T A;  2QCO A;  3H3V K;  1NK2 P;  3SDG A;  2KT0 A;  1MBJ A;  1YRN B;  1O4X A;  2NVQ J;  4W1U A;  3OIO A;  3M4O J;  2HXI A;  2JA7 J;  4RDU A;  3I4N J;  2VUM J;  4A3J J;  1BW6 A;  1JUP A;  4A3K J;  4XRS A;  3JRC A;  1POG A;  5EF6 A;  4DYQ A;  4BBR J;  3FIW A;  1UG2 A;  2XPU A;  3MKL A;  3Q0U A;  3LNQ A;  5FKO A;  2K9N A;  1WPK A;  3HDD A;  3ZQF A;  1OCP A;  5C44 J;  1QVU A;  2EZL A;  3G1L A;  3WHB A;  3ZQL A;  1JKQ C;  1WH7 A;  2NVY J;  3D1N I;  1U78 A;  3HOY J;  1H88 C;  3S15 J;  2R93 J;  4C2M J;  4V2F A;  2ECC A;  2HYJ A;  2IBD A;  5F0H A;  3BTL A;  3BG3 A;  3S17 J;  3LSR A;  5DS9 A;  1IC8 A;  5IP7 J;  5C3E J;  3JRG A;  4A3G J;  5IYC J;  3TP0 A;  1FIP A;  3RZD J;  1VND A;  1GV5 A;  5E3O A;  2NOG A;  3BR2 A;  3JRE A;  1UHS A;  1JT0 A;  2YS9 A;  4C3I J;  1MSF C;  4A69 C;  2TRT A;  2JWT A;  3S16 J;  1U8B A;  1AU7 A;  2E2J J;  3BG5 A;  1MH3 A;  4QSH A;  1GV2 A;  3JR9 A;  1ETY A;  2K40 A;  3O8G A;  1SAN A;  4FE7 A;  2FD5 A;  3CMY A;  3BG9 A;  3BTJ A;  5BNG A;  3C2B A;  3UKG A;  3TED A;  2VKE A;  2E2H J;  1U9O A;  1RES A;  1IDZ A;  3LOC A;  2CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...